2VUMJ

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2vumJ00
1APLC 3RZOJ 2E1OA 5IOZA 3IV5A 3E7LA 3TP3A 4A3LJ 1T33A 2JN6A 5C44J 4A3DJ 5FKLA 2O9LA 3PO2J 1ETWA 1MBGA 2ECBA 2DMNA 1X58A 3GTLJ 3TW6A 3HOUJ 2L0KA 2L7FP 1MSFC 1ZQ3P 1JJ6C 1HCRA 5F0HA 3S1MJ 2CRGA 2LFBA 1WCMJ 2DMPA 3HM5A 1X2MA 3RQIA 1JUPA 2YS9A 2XRLA 5EZGA 3HGGA 2XB0X 3BR0A 5IPAA 1PUFB 3Q0VA 1W0UA 4XRMA 4AUXA 4FCYA 4MFEA 2DA2A 3BG9A 3H0GJ 4JYKA 1MBHA 4XRSG 3GTJJ 1HF0A 2NS8A 4QIWN 2MGQA 4C2MJ 4D5CA 2CU7A 1O4XA 1PUFA 1HOMA 5EGOB 1ETYA 3TW7A 5E3MA 1BJZA 4FISA 1VI0A 3B6AA 1IGNA 5F0FA 2NOGA 2QCOA 2RAEA 3D1NI 3QPSA 2JA5J 2DJNA 3LSJA 1VNDA 3M4OJ 5FKOA 1RESA 5M5WJ 2LD5A 2ME6A 2H8RA 3M3YJ 3S15J 3HB9A 2OF7A 4IHYA 2EQRA 3S2DJ 4MIMA 2VUMJ 1R9TJ 2B63J 2HXIA 1ZK8A 3MKLA 3Q3SA 1OCPA 1WGXA 2R5ZB 2NVQJ 2LR8A 5J1RA 4GFBA 5FKMA 2EZHA 3DCFA 4DYCA 4A3JJ 3JR9A 3LSGA 5J3LA 3SFIA 1SFOJ 3HBLA 2K9NA 5DTDA 1LFBA 2AO9A 1WI3A 1ETOA 4M3GA 2JWTA 5EG0B 2DTZA 3RKQA 5FKNA 3A01B 1JKRC 3GTMJ 1X2NA 1ZR4A 1MBFA 2CUFA 3JRGA 1FIAA 2E19A 2R7ZJ 5IP7J 1I6HJ 1YRNA 1GVDA 4IHVA 1QVTA 4A3GJ 4AC0A 3GTKJ 1MNMC 4A93J 1U8BA 2D5VA 1IV6A 5M3MJ 4CYCB 3G1LA 2HOSA 3HKZN 3S1NJ 3W6VA 2COBA 1RKTA 3OSGA 1Q1VA 4BY7J 2XGDA 1ETXA 3FISA 4S0HB 2JJ7A 3NAUA 2ME0A 1POGA 1LE8A 1ITYA 1QPIA 1IJWC 4A3MJ 2GLOA 2AHQA 4A3FJ 3OOUA 3JRFA 1ZKGA 4B3AA 3JRCA 1JKQC 4XICA 3VPRA 1QRYA 1IDZA 4MLOA 1K83J 2NVYJ 5K7FA 2XSDC 2JMWA 5EZHA 3IH4A 2M0CA 3MN2A 3GTOJ 4QTRA 1JKOC 3F0CA 2R5YA 1Y1VJ 3SDGA 2HOTA 5BNGA 2DMTA 2K9SA 4XK4A 2DMUA 2IEKA 1TWGJ 4DYRA 1P7IA 3ZQCA 1RETA 5HODA 4DZPA 1G2HA 4JX6A 2GBYA 3HOWJ 4A3KJ 1UMQA 2Y30A 4JX4A 2ZB9A 2CQQA 3I4MJ 1BA5A 1BW6A 2P81A 4C3JJ 4V2GA 2M9HA 3IH2A 3HEFA 4D7NA 2EH3A 2XPUA 3GTQJ 5IP6A 2M8GX 1CQTA 5F04A 1MBKA 1WH5A 1DU0A 3HOZJ 2EZIA 1Z77A 4M3EA 3S17J 2WV1A 4B1RA 1TWHJ 2HI3A 1ZTRA 3Q0WA 3K2AA 4RDUA 1D5YA 3NARA 2NVTJ 4V2FA 2Y31A 2W48A 4JP0A 1LFUP 5GPAA 1AKHA 1GDTA 3OSFA 2DA5A 2E2HJ 4W97A 2L9RA 4EEFG 1JTXA 2EZLA 3BG3A 4FE4A 1FTZA 3Q0UA 1IUFA 2VPRA 3OIOA 1I50J 1BL0A 4MFDA 3BR1A 3JRHA 3JRBA 3S2HJ 2Y2ZA 1JKPC 3S16J 3LNQA 2K9QA 3FK6A 2EBIA 1E3OC 2WAQN 2JK3A 1IRZA 3CQZJ 3H3VK 1JJ8C 3JREA 1MBEA 1NK3P 3BT9A 5EDNA 1NK2P 1JTYA 1TWCJ 2O8KA 3QQAA 2DA4A 4ABZA 1YRNB 1F43A 2XGEA 2ELKA 2XB5A 4BY1J 4A3CJ 1ENHA 1HLVA 1FJLA 1ETQA 3CDLA 2R93J 1BW5A 3LSRA 4RBOA 1ORKA 5GPCA 2KDZA 3GTGJ 3CMYA 2NS7A 1B72B 2FX0A 1LE8B 2HQ5A 2N8GA 1GUUA 4C3HJ 1GV5A 2XPWA 5F1JA 4I76A 4IHWA 1XC5A 1DU6A 3RZDJ 1AHDP 2MG4A 1IG7A 3BR2A 1B72A 4G12A 1RR7A 2YU9J 1HDDC 2R92J 3HOYJ 3HGYA 2ECCA 4MO7A 5F08A 5IOYA 2X6OA 2QF7A 2R5YB 5E3NA 4DZJA 4BBSJ 2LK2A 1S7EA 3A02A 2VKEA 3BTIA 4A69C 3BQYA 3BG5A 2HXOA 5F0CA 2KT0A 3IH3A 1B8IA 1UHSA 3BTJA 1U78A 5C4XJ 2VI6A 4L5EA 3BR6A 3UKGA 2FD5A 5FJ8J 2XPVA 4XIDA 2Y9YA 3A03A 1XS9A 1K61A 2DA3A 2LVSA 5IP9J 3TEDA 5EEAA 5FLVA 1GV2A 4A3BJ 3S1QJ 2JA7J 5FLMJ 3GBGA 4IEJA 2O7OA 3BQZA 3FIWA 4FTHA 2CQXA 1OFCX 4DYQA 2DA7A 3S14J 1ETVA 5M5YJ 3LSPA 1JT0A 2XGCA 3JRAA 4NDLA 3JRDA 4Y7NJ 1I3QJ 4X6AJ 1MBJA 3BTCA 1OJLA 5K7ZA 4M3BA 4M3DA 3LOCA 1H88C 9ANTA 2HOAA 1ZGWA 1AKHB 4X1EA 2DMQA 2IAIA 2M34A 1T56A 2OPTA 5M5XJ 3HOXJ 1NTCA 4DW6A 3ZQFA 2HDDA 4FE7A 2JA8J 2YUSA 1VF9A 4C3IJ 2VKVA 1IC8A 3ZQLA 4IHXA 3JRIA 2LTPA 1P7JA 3FKIJ 5C3EJ 5E3LA 1IDYA 1F36A 2CUEA 4I6ZA 1UG2A 1AU7A 2LY9A 5EF6A 5J1UA 1JGGA 3HDDA 2M2EA 2GM4A 2K40A 1WPKA 4AYBN 5JLXA 3QPLA 2Y0SN 4XRSA 3PO3J 2FQ4A 1FEXA 2R0QC 2X48A 2L7ZA 3ZOBA 3L1PA 2X9DA 4A3IJ 4W1UA 3WHCA 1W0TA 1VFCA 1RPWA 3C2BA 1TC3C 2CJJA 3ZQIA 4Y52J 3O8GA 4D5FA 4BXXJ 1MH3A 3O8HA 4UUSB 3G1MA 5FKKA 5GP9A 3ZQGA 4HNVA 5EGOA 2HYJA 2G0EA 3B6CA 3MVPA 3SJMA 5IYCJ 2LLKA 5EYRA 5E3OA 4B4CA 2DA1A 3S1RJ 2E2IJ 1QVUA 3HOVJ 4LOCA 2Y9ZA 2PMZN 1A5JA 4UUSA 2WB1N 1Y1WJ 2MSYA 1FTTA 5DS9A 1H8AC 1H89C 1MSEC 2LKXA 1EF4A 4A3EJ 4M6VA 5C4JJ 1FIPA 3TP0A 3GTPJ 3G1OA 2TCTA 3ZQHA 2LP0A 3BR3A 2R5ZA 2H1KA 4M3FA 3WHBA 2I10A 1U9OA 1WH7A 2IBDA 2MW8A 5IYBJ 1GT0C 1XG1A 2NVXJ 2ID6A 4QSHA 1ETKA 1SANA 2DA6A 2EZKA 2FJ1A 1OCTC 1JT6A 1RKWA 5EG0A 1JUSA 2ID3A 3CCYA 5F27A 3BTLA 3I4NJ 1B8IB 3FK7A 3A01A 1MH4A 3K7AJ 4UUTA 2L7MP 4J19A 1JUMA 4BKXA 1TWFJ 4JX5A 3PM1A 4BBRJ 1ZR2A 1A6IA 1Z0XA 2TRTA 4CYCA 5K7HA 5JLWA 2JA6J 4D7MA 1TWAJ 5IYDJ 3BR5A 3DEWA 1U9NA 5J1YA 5M3FJ 2E2JJ 1HDPA 2DN0A
chains in the Genus database with same CATH superfamily
4NUBA 3RZOJ 2JPCA 3S3OA 2NNYA 5IOZA 1HKTA 4LG3A 1QHGA 3EUHC 4A3DJ 2O9LA 1RUOA 4KISA 2QKLB 1ETWA 3J7AO 3GTLJ 2E1CA 2EFOA 1Y8RB 3PNYA 2CSOA 1SD6A 3FXKA 4R79A 1IV8A 5ICFA 1HCRA 4LIUA 2GIZA 1E3PA 1XN7A 5JR3A 1D0XA 4BXFA 2FNPA 5LHGA 5LLQA 6PAXA 1MDMB 4LMYA 2CW0F 1WRJA 3GX4X 3H5AA 4WXDA 5IPAA 1PUFB 4EJTA 2VC1A 2H6BA 3QU6A 2M1BA 2ZCWA 4Y13A 4MFEA 2NXNB 4L18B 1CGPA 4JYKA 1MBHA 3HYIA 3GTJJ 3SZTA 1J9IA 1V5EA 3QPTA 4ON0A 2JVHA 2NAZA 2ZMEC 4EGZA 1SFKA 4XLHA 4B47A 1EH6A 3ZMDA 4HW0A 4HYEA 2HPMA 2QCOA 2RAEA 1XX5A 3D1NI 2K86A 2GIVA 2R7RA 2F4MB 1VNDA 2IA0A 5FKOA 2DT7B 3M3YJ 3ZMVA 2EINH 3HKZA 3QYBA 5FD5A 1R71A 5FRMA 4ZDLA 2VUMJ 2M45A 3I71A 5LHHA 1YLFA 4MQVA 3TL4X 4LB5A 3I53A 2B63J 1ZK8A 2J5PA 4KIGA 3OYIA 3MKLA 3Q3SA 1WGXA 4M9SA 1KU9A 3ESWB 2K4JA 3EETA 3EYIA 4DYCA 2VBXA 3OIPA 2QQBA 4KUMA 2MC4A 3JR9A 3ASNH 1LFBA 5DTDA 3CUQA 3RPQA 2KRHA 1TW3A 4DBQA 1WI3A 5K5RA 4XLNF 3HC7A 1ZRCA 1XPXA 1IAWA 3GTMJ 3KP7A 1X2NA 1ZR4A 2HQAA 1MBFA 2GA2A 5TGTA 4Z6YA 2GZWA 1I6HJ 3CCRI 4H4KC 1YRNA 1GVDA 3KP5A 1O3SA 2BOLA 4M6YA 5JI6A 2LH9A 3GTKJ 1MNMC 2D5VA 5M3MJ 2BE5F 2V79A 3MFKA 5L3DA 1IF1A 2HOSA 4HX4A 3S1NJ 2COBA 2EV6A 2BHYA 3OSGA 4K2EA 4HV6A 2G7UA 2XIGA 1ETXA 1T6SA 1VQNI 1POGA 4UXNA 1LE8A 3S3MA 2JRTA 4BJ6C 3MKYB 1IJWC 3S8PA 5HDKA 2GLOA 2BY2A 4FQGA 4EM0B 2HS5A 2DQLA 1TT0A 4FX0A 3JRFA 4P55A 1ZKGA 4B3AA 3JRCA 1JKQC 2P7VB 4QPQA 4XICA 1T38A 2P5VA 3E97A 4ZDOA 1K83J 1OR7A 2A6HF 2VJJA 1LDDA 5EZHA 4PJMA 1QZEA 1WQ2A 2XAQA 2DYSH 2A05A 3IH4A 3J7AY 1Z21A 3MN2A 3GTOJ 4QTRA 2Z99A 3AG4H 2XGXA 4NC6A 1Y1VJ 3HTUA 5BNGA 5HLHA 2DMTA 4HF2A 5EJCA 4LJZF 1YQAA 2DMUA 2H09A 3WU2C 4ZJZA 4MHGA 1K78B 1HXDA 1XTAA 4FT8A 2R7WA 1WJDA 1R49A 1TWGJ 2YU3A 1S8NA 1R5ID 4ENMA 4KDPA 1VQPI 4IVNA 2CFOA 5HODA 3OR1C 3CMAI 2QSFX 1MIJA 4KIFA 3HOWJ 2Y30A 4RGSA 1HW5A 4KT5C 5LRRA 3TDUC 4UHTA 1IN4A 1BW6A 3OYNA 1UELB 4C3JJ 2WAQA 2NS0A 3DPUA 1Z3XA 1Z7UA 4RB0A 3FXRA 3TO9A 4D7NA 2EH3A 4L5JA 1PP8F 5IP6A 2M8GX 3A0BC 3KX2A 1MBKA 1KYZA 1WH5A 2RNGA 5DD8A 3QODA 2EZIA 2MLKA 1DU0A 3HOZJ 4RGRA 2WV1A 2MBFA 5LGNA 1SC7A 4ZYAA 4Y15A 5D5VB 2DO7A 3K2AA 1D5YA 2DQRA 3PQJA 3WE2A 1REPC 2WY8Q 4V2FA 2DW4A 2YR2A 2CUJA 4L9TA 2MD5A 4U0YA 1R6RA 2K3FA 1R1UA 3DV8A 1GDTA 2VBZA 1OCZH 2E2HJ 3SDBA 2OUMA 4W97A 2L9RA 4EEFG 5CKTA 3BG3A 4Z2YA 1N78A 1Y39A 4JQFA 4G7HF 4RB2C 3REOA 1D1CA 4LK0F 5F6FA 3NWSA 2EA4A 3CJQB 3BR1A 1T2KA 1XGMA 1FLIA 3K4KA 2Y2ZA 1JKPC 3S16J 3LNQA 2K27A 2LBFA 4YEJA 3E0JB 4BEHA 2X51A 4BJ5C 2LNBA 3HPHA 1FWZA 2W1OA 1WJ5A 3BT9A 4HV5A 2KDOA 4P96A 1Z67A 3D5RC 3QQAA 1FT9A 4EM1A 3OR2C 4ZTJA 1F43A 5HDNA 4BY1J 3QU3A 3CZ6A 1ETQA 2KMUA 2E1NA 3TBIA 2LSOA 4RBOA 3QWLA 1ORKA 2JQ7A 3GTGJ 2VQLA 3H0DA 3ML6A 2XRNA 3DKXA 2FX0A 3HG9A 1R58A 2ZJ2A 4MTDA 1VQ5I 1X1BA 4HQEA 2EFNA 1YI2I 1FC3A 1JI8A 2TDXA 2XPWA 5F1JA 5LGUA 4I76A 1XC5A 3EYYA 4F91B 1YOVB 2CV2A 3KLOA 2I8DA 4ZC3A 3BR2A 3QAHA 4G12A 2BW3B 2BVMA 2FSWA 3I59B 5IOYA 2G9WA 4BQAA 4UV9A 2H6CA 2STTA 2EJRA 2HOEA 5AONA 5E3NA 4BBSJ 3ZMTA 3HHGA 1DP3A 2ZC2A 3P9CA 1KU7A 3GFLA 1J0RA 4LK1F 1XGSA 3F6OA 1H0MA 4BE2A 1VQ4I 2QM3A 2DT6A 3FXLA 2HXOA 2HNHA 4ZTFA 4YFKF 5F0CA 1S5LC 5E1WA 2V6CA 3IH3A 3GCMA 1UHSA 3KEYA 2O5RA 2VI6A 4L5EA 5FJ8J 2XPVA 1U5TB 2Y9YA 2WTEA 3A03A 2OAZA 4XLCA 1FOWA 2CYYA 1K61A 2DAOA 4Q47A 1STZA 3TEDA 3HSEA 4I02A 5FLVA 3GUDA 4NC8A 5FLMJ 4GYIA 1QQIA 1KQ9A 3BQZA 3E5QA 4CCNA 3PUBA 1OFCX 2O8XA 5DV5A 4DYQA 2ZXJA 1BI1A 3LSPA 4RAYA 2JSPA 4ZYGA 1HKQA 3GFJA 4JBAA 3FMSA 4M9XA 2M87A 4NDLA 3JRDA 1X3UA 3WG9A 2WY7Q 2VOOA 1ZLJA 2KZVA 2X6WA 3LQRA 2M4GA 1W5SA 3ONQA 1V55H 3F8CA 5TISC 1EH8A 1MBJA 3BTCA 3PSIA 1I3AA 4M3DA 2FU4A 3LOCA 1P4XA 1Z05A 1AKHB 2PQ8A 3PQKA 4X1EA 4E7IA 5FB2A 3B02A 3U9GA 5DCMA 2X1EA 2IAIA 2LG4A 2X4HA 3I4PA 1RI7A 5A2QZ 3HIFA 3ZQFA 3O3KA 5J8CA 2JA8J 3KP2A 4MNUA 2HTJA 3ZQLA 4KMFA 2W85A 2IXSA 4F55A 4D1QA 5LRSA 1IDYA 1FYMA 2LY9A 3E6MA 5EF6A 1SD4A 1AU7A 2OQGA 3HDDA 1LVAA 3C2GA 2K40A 4RAFA 4GO1A 3DPTA 4E7JA 4ESFA 3CC4I 4XRSA 3PO3J 4LB6B 2QGUA 4EV0A 3CJTB 1ERDA 4FHTA 2JTVA 2X48A 1A6QA 3AKZA 2XROA 4L9NA 2Y69H 2B7EA 2CJJA 3SYTA 2NNNA 2D1HA 4D5FA 3OYJA 4GYGA 4BXXJ 2EIJH 4UUSB 5FKKA 3ZQGA 2ZFUA 1T95A 3HHHA 3I9V2 2IS2A 2KIUA 1U5TC 2VKDA 1QBJA 1PDNC 4KJZA 3BG6A 3S1RJ 2E2IJ 3IP4B 3F72A 2VC0A 2E1MC 2EFWA 3WTUC 3E6DA 1UFMA 3QP6A 5LGTA 2VASA 1OYWA 2HDWA 4LG0A 2VXZA 4EATA 2BYVE 4A3EJ 2CV1A 3CC2I 2F5CA 3OYHA 3ZN0A 2R5ZA 1L3LA 4M71A 2Z9OA 4BNCA 2R7SA 1GT0C 2LOOA 4RA2A 1NHAA 3FBNB 4C2TA 3PIPF 2O3FA 2OU2A 3S32A 2VL8A 4BACA 1JT6A 1DPRA 4XORA 5IY5H 3DU5A 2ZBKA 3RIRA 4UNOA 1IN6A 3BPVA 3BTLA 1V5FA 3MWMA 2PX9A 2HGCA 1A35A 3K70D 1D3YA 3HSRA 3F8NA 2LKSA 2COMA 5F64A 1PVEA 1ZG3A 1XB4A 4Q4ZF 2A61A 2LKPA 1I39A 4CYCA 3MKZA 1YS6A 2ZKZA 3LWFA 4D7MA 3BZKA 2FRHA 1BOBA 5IYDJ 1DGWY 3BR5A 1S7AA 2Z3YA 4PSWA 2P5LC 5M3FJ 5E1ZB 2ZXIA 2QBYA 4FX4A 2H1KA 1I1SA 4QLCU 3F23A 4E7LA 4OIQF 1M1EB 4PSXA 3IV5A 3TP3A 2M0MA 3GEZA 1DPUA 1T33A 2K9LA 4E7HA 2JN6A 3AG1H 5FKLA 4DOZA 1U0JA 5TJJA 3J81Z 1VQMI 4S04A 1RIOH 2ESNA 3HOSA 3GYHX 2BXZA 1F1ZA 3TW6A 2ICWG 4NC7A 3GZ6A 4PJJA 3S1MJ 1S6LA 2DMPA 3HM5A 2P0WA 4I0BA 5FROA 4XMYA 5F1RA 4M9ZA 3OY9A 1W4MA 2WADA 2QKMB 3DKWA 2YS9A 2XRLA 5EZGA 3HGGA 4BGDA 1T0FA 3H36A 2A07F 3ZGKA 5DUIA 4M73A 3OS1A 1SFXA 4PK4A 4BH9A 2XC7A 2BXYA 3C2HA 4XRSG 5A2QK 1P6RA 3EQLF 2M30A 2NS8A 4QIWN 3L2UA 4C2MJ 4D5CA 2CU7A 3OWTA 1WJAA 1R1TA 4S05A 5K5OA 1ETYA 2VQCA 5EGOB 2FNAA 3LA3A 1RNLA 4BQNA 2F2EA 1KU3A 4FISA 3B6AA 3VDXA 3IL2A 1IGNA 2M8EA 3LSJA 4YELA 4OIPF 3M4OJ 1RESA 5M5WJ 4BQQA 4XOPA 4ESJA 3S15J 5IT9K 1PJRA 3HB9A 2OF7A 2VXDA 3M8JA 3NEUA 3HUGA 4IHYA 1FMWA 1QNTA 2EB7A 4KA4A 2QSHX 1O57A 4MIMA 1YIJI 4G7ZF 1YX3A 3IKVA 1YYVA 2VT2A 3DBLB 1IZ1A 2RGVA 4XKCA 4ZZDA 1TZLA 3JTGA 2GOXB 5J1RA 2NVQJ 5FKMA 1TBXA 3A0HC 2MA3A 3DTEA 2EZHA 4A3JJ 2OD5A 1BI0A 2Q1ZB 5HLGA 5J3LA 1SFOJ 2GXBA 3HBLA 2DU9A 2K9NA 5J40A 4Y3OA 5CQEA 3TOAA 2ISYA 2AO9A 3K4MA 5HNHA 4CH7A 3CCEI 1ETOA 5EG0B 3RKQA 2XAFA 5FKNA 1JKRC 3BJOA 3JRGA 3GZNB 2R7ZJ 2ZJQF 4JK1X 4HRIA 3AG3H 3COAC 1YFHA 3CP2A 4IRHA 2M5WA 4EM2A 3LSKA 1VQLI 3W3CA 2V1NA 3M07A 4BY7J 2IGOA 4G6QA 4S0HB 3KIOA 4JOMA 4I0AA 4BE0A 1ITYA 1QPIA 2IA1A 2GWRA 2V1DA 1FNNA 3OYEA 4G6TB 5E18F 2EFPA 1VQ9I 4HX7A 1OISA 4L9JA 3VPRA 4IRIA 5E1XA 3OS2A 1IDZA 4MLOA 5K7FA 2XSDC 2M7BA 2ZSIB 3E3VA 2JMWA 4P9FA 1QZYA 1RUNA 3BROA 5L3EA 1VQ6I 2VJ4A 3QPHA 2DXIA 4OOIA 2YX4A 4KT6A 3J80Z 1JKOC 3F0CA 4LD5A 5K1YA 3LQQA 2F5FA 2MH9A 3DKYA 2HOTA 1VQ8I 2JZYA 4EJUA 4XSXF 2QQAA 1VQOI 1KYWA 2IEKA 3TDZC 3TQNA 4CA0A 1RETA 3FHZA 5CLSA 5L3GA 1LDJA 4JX6A 1ZH5A 2GBYA 4DGWB 3T8RA 2MC3A 4YFXF 4RLFA 5J4VA 2L01A 3CDIA 4HG2A 2X0LA 1IRGA 4CHUA 1MMNA 3D0SA 2P81A 4XRFA 5H20A 2A69F 2M9HA 4V2GA 4F92B 1LDKB 3J81K 3IH2A 5KCMA 2D2WA 2X6YA 3F8FA 2L9NA 4HQMA 4HZFA 1XCVA 5F04A 1LVKA 1ULYA 3C3WA 5TRDA 4U0WA 3G2BA 4ENNA 2UUZA 4M3EA 3H9JA 4PFOA 3ZRGA 2JSCA 4B1RA 1TWHJ 3H3ZA 4RMNA 1NG7A 3H9QA 2HI3A 3Q0WA 3KPHA 3VYRB 4RDUA 2LMDA 1FBUA 3NARA 2OBPA 3S93A 1KQ0A 1Y0UA 2WAEA 1I1GA 4RB3C 2Y31A 2KISA 1LFUP 4A0XA 1K7AA 1G3WA 2HZDA 1FSEA 3OSFA 5HS8A 2DA5A 2Y75A 1BC8C 1SMYF 4RS8A 3NWTA 2NYXA 4BEHB 1IUFA 2VPRA 4KNYA 2WA0A 5LFAA 1YJNI 3C1DA 1E0EA 1I50J 1U3EM 4FETA 1AOYA 4F52A 3PJRA 4G8XA 3ZP5A 4OWRB 3FK6A 1W7PB 2EBIA 2F4OB 1E3OC 3PL8A 2P6TA 1MJ9A 2IJLA 3H35A 2FBKA 1G3SA 1MGTA 1Y6IA 1NK3P 5EDNA 3IRQA 5HLTA 1TWCJ 2A6EF 2DI3A 4ABZA 2XGEA 2E36A 3NRVA 3GF2A 4A3CJ 4Y4RA 1HLVA 1FJLA 3Q9SA 3M1CA 4I09A 1HC8A 2ELHA 2L4MA 2ELJA 2R93J 3L9FA 3ECOA 1F5TA 3KCCA 3CCSI 4PJLA 2NOJB 2MFZA 1V4RA 2L4AA 1UAAA 3LMMA 4CCLA 3X2QH 2N8GA 3V8KA 2RDPA 4WXHA 4C30A 3K69A 2F4IA 4YIIA 4KITB 2KIFA 3K1PA 4HBLA 5LD2C 5HS9A 3E5UA 1DU6A 3RZDJ 1Z6RA 1AHDP 2MG4A 3OYAA 1IG7A 1R7JA 4CICA 2LC2A 3RSNA 1B72A 2FMLA 3DBHB 4PDKA 1E2XA 3OYLA 1HBXG 2PJRB 4PCQA 3V7CA 3OOPA 2UV1A 3P5JA 3RQ4A 3RTRA 4A5MA 1NH3A 5K5QA 2PFBA 2R92J 3DQVC 3F8MA 2KJBA 4MO7A 4PGHA 1BBYA 2R5YB 1WWXA 2LK2A 1QU3A 3LSIA 4ETSA 1S7EA 3A02A 4HLYA 3FXJA 2B0LA 4A69C 3J7ZI 1WZ2A 5E8IA 3MZHA 2Q2EA 1FP2A 3RDIA 2VQHA 2IS6A 1W36D 3WTTC 3KETA 3BTJA 1GLNA 3UKGA 3BR6A 2XKPA 3F6VA 2ZMEA 3LAPA 4U88A 1XS9A 2DA3A 4MEYF 2LVSA 5H2FC 5IP9J 4BUPA 4M6XA 4AYBA 2Z1DA 5EEAA 3GLLA 1GV2A 2XKOA 3B73A 3BLYA 2JA7J 1QA6A 3V7RA 1FX7A 4FTHA 2CQXA 3J80K 1RRJA 2H94A 3S14J 1EKEA 1X1AA 4R1HA 5DYMA 1JT0A 2EWNA 2BY0A 1USTA 3SFZA 3JRAA 2LY2A 3ZXSA 4P1WA 3RYRA 1EH7A 1I3QJ 2HYFA 2R7QA 4ASNA 2OZUA 3VSKA 2QWWA 3I58A 2VLAA 1SD7A 3HTSB 3ABLH 2R7FA 2OA4A 5CYVA 3UNGC 4B44A 5K7ZA 1ZYRF 2MD0A 2XUBA 2F6CA 2QUFA 3TO6A 9ANTA 1YG2A 4NNJA 2PI0A 2H8WA 2M34A 2OPTA 3RPUA 3HOXJ 1USSA 1NTCA 2DJIA 2P8TA 4DW6A 1FOKA 2QZ8A 3QOEA 2YUSA 1IC8A 2VKVA 4Q5SF 1P7JA 4GCVA 4OIOF 4OMYA 2IGMA 2ZSHB 3CLQA 1XSVA 5CJ9A 5E3LA 1F36A 2HDCA 2KIMA 2I5UA 3TOBA 2OTLI 5J1UA 2M2EA 2GM4A 2DODA 1MDMA 3CJNA 3HZJA 5JLXA 1ON1A 5FLXZ 3QPLA 1YIOA 4WXCA 1W5TA 2P5KA 3K0LA 1ONVA 2FQ4A 1XSDA 3SEQA 2R0QC 5DUKA 2L7ZA 1R4NB 2YX7A 3I56I 1HKSA 4A3IJ 3VWBA 4W1UA 1W0TA 1TC3C 3OYGA 4XQFA 4YIFA 4Y52J 2VE8A 1TL8A 2KIQA 3BC8A 2KRFA 3KYCB 3OYCA 1MH3A 4B09A 3G1MA 4HNVA 4E7KA 4YRVA 2OZ6A 1HSTA 5IYCJ 2LREA 5EYRA 5E3OA 4B4CA 2DA1A 2GXAA 1IUYA 3DXJF 3KFWX 3HOVJ 4LOCA 2Y9ZA 2LY1A 2BY3A 2QQ9A 3CLOA 4LGWA 1JE8A 2V6EA 1G4DA 3K4CA 2RQPA 1U2WA 4RB1A 4B8XA 1ZAOA 2LKXA 3HXLA 1Z9CA 3TP0A 3GTPJ 1TQPA 3ZQHA 2LP0A 3BR3A 4M3FA 2IRFG 3WHBA 2R7UA 2GA1A 2OCCH 3G4SI 2MW8A 2R7VA 1XG1A 2PEXA 2PBIA 1JHHA 1ZGJA 1YJWI 2UXNA 2XF5A 1ETKA 2EZKA 1IRXA 5HNFA 1E17A 1CF7B 2M7AA 2L54A 1FYKA 1K6YA 1OCTC 2K4BA 3Q9VA 3BP8A 1JUSA 3WU1B 2FOKA 3I4NJ 4DNCA 1B8IB 1A36A 1MH4A 4J01A 3M8EA 1D0YA 1WI9A 3VSLA 1GHCA 1MNDA 1JUMA 1XMXA 1MW7A 4AVPA 1TWFJ 3F3XA 4JX5A 3UR3C 3ZCOA 3L2RA 1Z0XA 1GXPA 1WFXA 1SAUA 4I99C 3SQNA 5K7HA 5JLWA 1SFUA 1SMTA 2JUGA 3G6EI 4BHBA 4Q48A 3KEOA 3ZR8X 1U9NA 4WK8F 2XV4S 4YG2F 4CGZA 2UWMA 1K4TA 3KZIC 4RM3A 2DPUA 2E2JJ 3BJ6A 3FM3A 2WAFA 2E1MB 2A5YB 1ACIA 2E1OA 5BMZA 1DQUA 1GVJA 3E7LA 4IQJA 1F9NA 2L5QA 5HLIA 2YPRA 1B6AA 5CPRB 5D8KB 4KICA 1VQ7I 5C44J 3JSPA 4AVZA 4GRIA 4F7ZA 1MBGA 2ECBA 1X58A 4U7BA 1LNWA 1MSFC 4N0BA 4N9IA 3SZGA 2CRGA 2LFBA 1X3ZB 2R4GA 1BI3A 5CVJA 3ABUA 4LFUA 1TLHB 5D6EA 1Z1DA 4CCJA 5J4YA 1K78A 1X2MA 4XNFA 3RQIA 1BR2A 1MMGA 5J8FA 2HKOA 2XB0X 3BR0A 1LJ9A 1YX5A 3Q0VA 2P4WA 3K9TA 2A68F 2HEOA 4AUXA 2E71A 3L2WA 4FCYA 2DA2A 3AL0B 3H0GJ 5IT9Z 4IOAF 1X1CA 1HF0A 3PIOF 1S3JA 3KLNA 2CS3A 1O4XA 1HOMA 1Y56A 2PMHA 3GVAA 4ZYEA 2L02A 2XHKA 5E3MA 3CMEI 1VI0A 4PJNA 3BZ6A 1SVLA 3D5LA 1XMAA 5DM6F 2D1VA 2JA5J 2DJNA 2BHZA 4AU7A 2LD5A 2ME6A 2H8RA 5FLXK 3K70C 3R4KA 4HOBA 2EQRA 4NHJA 2CH0A 2CW8A 1LEAA 2FQ3A 5H6RA 5ILSA 3R0JA 1J2XA 2AQFA 2DDBA 3HSFA 2Q0OA 3LAJA 2FXAA 1MJBA 2HXIA 1D8JA 2VPLA 2W00A 4A6DA 3TGNA 2CUZA 4UB8C 2IP2A 3I5UA 3RKWA 1DGRM 1UB9A 1FBSA 1Z7LA 4OAZA 3MCZA 3ZMZA 3H92A 3GW2A 1D0ZA 4A5NA 2NRAC 5CVVA 5L3BA 3K4LA 3KZZA 5D4SA 2VE9A 4M3GA 4LLGF 1B4AA 4DJAA 3OYDA 3GFMA 2GOMA 4QPOA 3L2QA 1T0FC 3A01B 4CDGA 1UCRA 2CUFA 2DTRA 4HF1A 1FIAA 1TQIA 2E19A 3RKYA 4A12A 2VB6A 4KYWA 1D1AA 1QVTA 1OYIA 4HA8A 4N4OB 1G3YA 1WJFA 4A93J 4UVBA 1U8BA 1T98A 3FXMA 3OYMA 3IUOA 3G1LA 4CUGA 4AM3A 4XN3A 4PJ0C 3HKZN 2BY1A 4BXUA 2W4SA 3T8TA 2QYOA 3A4CA 1RKTA 2X6XA 3CCQI 2XGDA 3AL0C 3MQ0A 3FISA 2JJ7A 5E79C 2ME0A 3L00A 2DOAA 1TP4A 2PMUA 4PFPA 4CO8A 4ZYDA 1WJCA 1WHUA 1QPMA 2DT5A 4E7SA 1RR8C 1P4WA 1D8KA 2BW3A 3R61A 2M0CA 3IAS2 2KPMA 1X19A 1I5ZA 3N05A 1EJ9A 3ZQQA 3SDGA 3C7JA 4G94A 2D45A 2P6SA 2K9SA 4XK4A 3CCLI 2X1CA 3DTKA 3R6SA 1P7IA 3CTAA 4GGGA 5AIPA 5FO5A 3ZQCA 4ITVA 5JVTA 1U8RA 1G2HA 4IPAA 3JAMZ 3LA2A 4A3KJ 1UMQA 4JX4A 3F21A 2VODA 1FZPB 1U5TA 2ZB9A 1FMVA 2Z5UA 3CCVI 3GLXA 1MJAA 1W1WE 3BY6A 3FMRA 3H5NA 1RC9A 2K02A 2VKHA 3OYFA 3H1CA 1P4AA 4AIJA 1P92A 3T0YA 3CO6C 3GTQJ 4ZZLA 3GWZA 1KGSA 2OCEA 4IL6C 1BR4A 1A04A 1Z77A 2JT1A 4HLXA 1HW2A 5IT3A 4ESBA 2AXTC 2IT0A 1K4SA 3CMMA 4WWCA 1QGPA 3LL7A 4ZH4F 2MLGA 1T08B 4IKFA 1U6GA 5GTHC 3W2AA 3ABKH 1R4MB 4ZDPA 4A2UA 5LHIA 2EIMH 1O7FA 2XAJA 2OV7A 2W48A 4JP0A 5GPAA 1AKHA 1MMAA 4XOTA 1MNEA 4HDVA 1JTXA 4I7HA 1J5YA 3DLAA 3HRTA 3I55I 3WTWC 3GFIA 1FTZA 3Q0UA 3OIOA 2LF7A 4BQOA 2QSGX 1BL0A 4WX9A 4MFDA 4H0EA 3JRBA 3S2HJ 1MMDA 3CUQB 5ERIA 2K9QA 3AG2H 2WAQN 2JK3A 5KAIC 1IRZA 3CJRB 1ZREA 2VT3A 3CQZJ 1PUEE 2JRMA 4A0YA 1JJ8C 3JREA 3H3VK 1MBEA 3D5SC 3S2WA 3FBIB 3KE2A 5KHDA 2O8KA 3FWEA 4IQ4A 2JVGA 1YRNB 1YTYA 4BHCA 4A0ZA 2ETHA 3K4JA 4IF4A 2P7CB 1Y8QB 3E6BA 2FMYA 4QWQA 5LBQA 1E3HA 2KLOA 2ZXHA 5ICCA 1BW5A 1UZCA 3JW4A 2MYSA 4IHTA 5GPCA 5GTIC 2KDZA 3CMYA 2E60A 2RC4A 1B72B 2RNJA 1LE8B 1O7LA 1XGOA 4BL0B 1J59A 2BBYA 1IRFA 4C3HJ 1GV5A 3CO7C 1R5HA 5B3SH 4XKWA 2W57A 3HRUA 3IC7A 4PZJA 4P5OA 1RR7A 2JPBA 4AIHA 3SHFA 5D8LB 5GAGJ 2YU9J 3EPZA 2PN6A 2EK5A 1N77A 2ECCA 1R5GA 2JUCA 5F08A 3E1SA 2QF7A 3ABMH 2EILH 1OKRA 4CZCA 5BQTA 3BTIA 5JFRA 1BN5A 4O5VA 1X3WB 1XDSA 3BQYA 3W6JB 2DYRH 2L3DA 4XM3A 2KZGA 1WJEA 2KT0A 5ILVA 3K6GA 5KAFC 1FY7A 1JGSA 4LITA 2VIXA 4E70A 5D5UB 2VJ5A 2CQKA 3W2WA 3CUQC 1DUXC 2XVCA 1BIAA 1GXQA 3P7NA 5HS7A 4UV8A 3GBGA 4TV7A 2ACJA 2O7OA 3FIWA 1QO0D 1BR1A 4L0ZB 1DDNA 2CQ7A 2DA7A 3BOQA 1LUJB 3FXUA 1ETVA 1YW9A 2XGCA 3FX3A 4RAGA 3ERMA 4BU2A 3T1BA 4X6AJ 2GAUA 2DFHA 3IWZA 1J7KA 4EJVA 2RN7A 3O6BB 5JVGF 4BYYA 2A3SA 1YW7A 2GQQA 2YSRA 1OJLA 2WBMA 4M3BA 3R0AA 3JAMK 1A31A 2HVRA 1H88C 4HAMA 2HOAA 2V26A 3VB2A 2DMQA 1T56A 1ZELA 5JHFA 2PJPA 2KFDA 3PFYA 4FE7A 2R7OA 1VF9A 4C3IJ 4IZZA 3G73A 1UHMA 4IHXA 2RQQA 3JRIA 2LTPA 4E4HA 3FKIJ 5C3EJ 4CXFA 1W5CC 2V9VA 1OR7C 4J00A 1T39A 2CUEA 3ZMSA 2R3SA 4L0YB 1ZLKA 2DOEA 2DPDA 3G71I 4N9HA 1JGGA 2OTJI 2LBFB 1WPKA 1S7OA 2V1XA 2QLZA 3DEEA 1QHHD 4MGRA 1FEXA 5KNLA 3H3UA 2HFHA 4HDUA 5DEQA 5ICEA 1RPWA 3C2BA 1AWCA 3O8GA 2BGCA 4IRGA 5EGOA 3RKXA 1O3TA 4CSWA 2IA2A 3B6CA 1K6OA 4HNTA 3SJMA 4MQ9F 2KRCA 2Z2SB 2LLKA 1TNTA 1VZ0A 2HU9A 1TNSA 3ERED 1HA8A 2IGKA 3NQOA 1FSHA 3LSHA 1W36C 2A6TA 3WTYC 1FOYA 3K4NA 2CWEA 2R7TA 3OL3A 4XLEA 1I6XA 4XKVA 4D0PA 2DFEA 4EJWA 5FD6A 1FTTA 2XDVA 1WVRA 5DS9A 3MAJA 5B1AH 2EV0A 3EUHA 4XR6A 3OIQA 1MSEC 4R8HA 3CESA 2F5EA 2LYCA 1SFEA 1FIPA 3LSTA 3KYDB 1G6NA 2TCTA 1YHQI 3I64A 3FM5A 4UB6C 3VYTB 1J75A 5KK1A 4UVCA 4BJTA 1YS7A 1HSJA 2OC6A 2I10A 1U9OA 1WH7A 1X1PA 2IBDA 2KL4A 1XD7A 3WTSC 2VBYA 2QQ8A 1ON2A 5HOOA 2ID6A 2LRDA 2V9PA 3FHNA 1S72I 1MD0A 5BOXA 1PP7U 1RKWA 5EG0A 3Q5FA 3CCYA 2IGNA 5F27A 3FF5A 3AAFA 4PUSA 3FK7A 1H9TA 4I01A 2ISZA 2HQRA 3WGHA 3ASOH 2V9KA 1BC7C 1JXSA 4YIRX 2Y48A 1IXRC 2DCEA 2ZJPF 1BI2A 1TTYA 2FEZA 3GMEA 1LEBA 1IO2A 2NVUB 1D1BA 1A6IA 3VYUB 4HX8A 2O03A 4NQWA 3KYLA 4XL9A 1ODDA 3VOEA 2JA6J 1FOXA 1TWAJ 4AD9A 5JHUA 5J1YA 3I54A 4WCGA 2L2OA 2Y0SA 3U2RA 5BPIA 4IX7A 3H5RA 3RPUD 2DN0A 1APLC 5FFXA 4MTEA 3OYKA 2F48A 5CVIA 1ZG1A 1SEUA 1F4KA 4EJOA 4ENKA 4A3LJ 4XSZF 1Z6TA 5DCMB 3PO2J 3N97A 3W6KB 2V7FA 3PSFA 1O3QA 4F93B 1IW7F 2DMNA 3RYPA 4BHPA 3JSOA 3RCOA 5GAEJ 3HOUJ 2L0KA 2L7FP 4M72A 2QA4I 1ZQ3P 2F5VA 1JJ6C 3WGGA 1OQYA 5F0HA 5D6FA 2K85A 4LLLA 1WCMJ 4M74A 4XN0A 2PMZA 1OYYA 2HTSA 3BWGA 1J09A 4L5IA 1G59A 2WB1A 2H27A 1JUPA 2DBBA 2MABA 3VODA 2BV6A 1R1VA 3DEUA 3IWFA 4OINF 2V1UA 2CFXA 2WC2A 4XKBA 1W0UA 4XRMA 2A5WA 3ELKA 4PGGA 4L9VA 3BG9A 3K4BA 3ZN1A 4U7DA 2MGQA 2OQRA 3LA7A 2Z33A 1ZHFA 1PUFA 1HDPA 4B3XA 2WWYA 3ZPLA 3WU0A 3V4GA 3TW7A 4ANJA 2G7HA 1WKMA 1BJZA 3FZVA 3CF5F 5F0FA 2NOGA 3PUFA 3QPSA 4EMSA 5D5WB 4LLNA 4A6EA 5B1BH 3N4MA 3V42A 3QOPA 1BJAA 2X1DA 5ED4A 1W7PD 4MEXF 3SXYA 3BPXA 4LG0B 3M8FA 2DFFA 3SEZA 2UZKA 3S2DJ 1R9TJ 4BS9A 1SAXA 2VN2A 3F9KA 4C2UA 3JCUC 1OCPA 4RGUA 2QEXI 2F5DA 2R5ZB 2LR8A 4GFBA 2AQEA 3DCFA 5D5XB 1Z3YA 1ZRDA 4RGXA 3LSGA 2K3PA 3SFIA 3S3NA 2PG4A 2DDAA 2ZNYA 1W7PA 4EQQA 2M4KA 1TQMA 1Q1HA 2J5OA 2WV0A 2W25A 3L7WA 2JWTA 3WE3A 2DTZA 4O3MA 3DFGA 3MMYB 1YO5C 4GDFA 3BG7A 4DQ2A 4EGYA 2IVMA 3IHUA 1FBQA 2L7KA 5IP7J 4KN7X 4IHVA 4A3GJ 2CG4A 3DPLC 3MEXA 2STWA 4AC0A 2ESHA 3OV8A 1XMKA 4BDZA 1IV6A 4CYCB 2JA2A 1O3RA 3U1KA 2XAGA 1H9GA 2BZTA 3W6VA 4OAYA 2L9SA 1Q1VA 3DU6A 2CQNA 4XLPF 3ISPA 2DFIA 5FRNA 1T8IA 3MD2A 2QBYB 3NAUA 4CYDA 2W24A 4U0VA 4A3MJ 3E6CC 2AS5F 2AHQA 4A3FJ 3OOUA 1B1BA 2DLLA 4HF0A 3OS0A 1QRYA 1FYLA 2NVYJ 4Y17A 2PJRA 3HOTA 2QVOA 4UY8I 4IJAA 4KMUX 1YITI 4OMZA 2X85A 4XONA 4IO9F 1L0OC 4G7OF 2R5YA 1ZARA 2EV5A 3V8LA 4CCKA 5DCFA 2IS4A 2H1LA 3P9KA 3PFIA 5CVRA 2ZJRF 5B66C 5GAHJ 2VOPA 2R7DA 4E7ZA 3FDYA 3L2CA 1UG0A 2VJIA 4DYRA 2HZTA 4B48A 3PNTA 4DZPA 2VBWA 3ROUA 1K79A 1JHFA 2Y0MA 1N75A 3IKTA 2E35A 4E6KG 3ECHA 3OYBA 5E17F 3F22A 2CQQA 4WF2A 3BDDA 5BS6A 3I4MJ 1BA5A 2XSJC 2RREA 3KP3A 5DM7F 3HEFA 2QENA 1SD5A 4II2A 2XPUA 1SVOA 3HJEA 3WTZA 2XF7A 1CQTA 4XLAA 1OPCA 1X4PA 2HYGD 3S17J 4Y33A 3KP4A 3I0TA 1LFPA 4N4NB 4BE1A 4AIKA 1MKMA 1ZTRA 4G9YA 3WTVC 1NG6A 1BM9A 2NVTJ 3FMQA 1XDUA 2W7NA 3HUGB 4G6DA 3VEPA 3V8JA 4UUVA 4II3A 1Z91A 3C18A 2PLYA 4XLFA 1P2FA 2EZLA 1OLTA 5LEJA 2HVQA 4FE4A 4YFNF 3DP7A 3QYEA 5EEGA 5BPDA 1IN5A 3IAM2 3CCMI 5HDGA 3K2ZA 2DK5A 4KIBA 2HPIA 3CF2A 2VQGA 3JRHA 3U21A 1OCRH 2CV0A 5GADJ 2GXGA 5FFZA 3J7YJ 5HVQC 3U1DA 4C9YA 3WTXC 3M1EA 1NK2P 1JTYA 2DK8A 3VYSB 2CGPA 2DA4A 4BAYA 1EA3A 2RKHA 3QRFF 4AWXB 2ELKA 2XB5A 4LIVA 1AA7A 1HW1A 2ZO4A 3A2KA 1ENHA 2EPFA 3IRRA 3RI4A 4F3QA 3CDLA 1LPQA 3GO5A 3LSRA 3QYFA 2ZXWH 3ZQ7A 2OJED 2E7XA 3KZYA 5L3FA 3EDPA 2NS7A 1IN7A 3PNVA 1G8XA 2HQ5A 3EUAA 2KKOA 3ULQB 1GUUA 2K9MA 1ZN2A 4OU0A 4IHWA 2VONA 1HQCA 4GXOA 2XASA 1IXCA 5E8GA 4HSRA 1XCBA 4IOCF 1X4OA 5DDGA 1WJBA 3DBRB 3RJPA 2MH2A 2RV8A 1HDDC 5FGMA 3HOYJ 3HGYA 3TKYA 2KHMA 3OMYA 2X6OA 3QP5A 1DP7P 1X1DA 5E20A 4DZJA 1VQKI 1FP1D 5H6QA 2VKEA 2FOWA 3MZ8A 1PYVA 1B9MA 2B9SA 1CF7A 3CCUI 2O6GE 3I59A 4KFCA 3BG5A 2HQNA 2IPQX 3DF8A 3TMOA 3H9GA 3OL4A 5B5EC 3LSMA 1B8IA 1P9QC 1U78A 5C4XJ 2FD5A 4XIDA 5ICGA 1ZG5A 4O6JA 5D4RA 1YE9A 2O61A 1VTNC 1B59A 5AIQA 1KA8A 4IHSA 4A3BJ 3CD6I 3L09A 3S1QJ 4IEJA 2ZFWA 1R36A 4HPQA 1FPQA 2UXXA 3KP6A 2M3AA 5M5YJ 2Z16A 3I3LA 3HL2A 1BIBA 3LFUA 3ZMUA 4RM2A 4Y7NJ 2LF8A 2CMPA 2E34A 4HNUA 2XF6A 3DWLE 3M9AA 2HVSA 3MZYA 4OIRF 1EV7A 2ADUA 2XAUA 3G3ZA 1SVMA 4NBQA 3VFZA 3A1YA 5CQGA 2RVCA 4B43A 1ZGWA 1YW8A 5M5XJ 3KEQA 3MKWB 2EFQA 4X0GA 4BDYA 3CUOA 2HDDA 3K10A 3WGIA 1TW2A 2FF4A 3JTHA 1KU2A 3HPGA 2KP6A 2FA5A 3GXOA 4CCOA 4I6ZA 2AXLA 5LEKA 3AFHA 1UG2A 3BJAA 1KZHA 4RAZA 3CP8A 2BVLA 2IW5A 4AYBN 5DD4A 1C0WA 2ZNZA 2Y0SN 3HRMA 3W2VA 4ZYHA 1YJ9I 1N25A 3FKJA 1R00A 2XAHA 5EEHA 2EA2A 4HEA2 4EVIA 1ZRFA 3ZOBA 3L1PA 2X9DA 4D9JA 3WHCA 1VFCA 2FBHA 3BZCA 3HRSA 5KVRA 1UHWA 3ZQIA 4CCMA 1OCOH 2BEOA 1OMIA 3LFKA 5L3CA 3O8HA 3BCBA 5GP9A 3SZPA 3DLLF 4XBFA 1UJ8A 3K1NA 4ENJA 2HYJA 3EUKL 3R60A 2G0EA 3MVPA 3WG7H 4V19K 1MZBA 3CC7I 4FASD 3E5XA 1B9NA 3ABTA 2K5CA 3CDHA 1MMSA 2R7XA 1QVUA 5J47A 2HWVA 2PMZN 4KN4X 1LQ1A 1I27A 3WODF 1A5JA 1V54H 4UUSA 1XGNA 1WSUA 1S29A 3CCJI 2WB1N 2HKXA 1ZGAA 2DOFA 4HSTA 1Y1WJ 2MSYA 3FXQA 3P9IA 4IXAA 1D5VA 2O0YA 1H8AC 1H89C 1EF4A 3O2PE 2K7LA 4M6VA 5C4JJ 1XSXA 2W82A 2E5ZA 3G1OA 1OCCH 1Y0NA 2FE3A 2LDUA 1QZZA 2IS1A 4P9UA 1KONA 3DTIA 5IYBJ 3FXOA 1V3FA 1IXSB 2CW7A 2NVXJ 3M7GA 4QSHA 2FUG2 1SANA 2DA6A 2FJ1A 4U87A 3T5XA 2Q2EB 5CVUA 5ILUA 1BOAA 4I2OA 2ID3A 1LKXA 1G3TA 4DBRA 2Q8KA 3A01A 4NQWB 3BCAA 1TT5B 3K7AJ 4UUTA 4UVAA 2ZMEB 2L7MP 4J19A 1R22A 1R23A 4BKXA 4CZZA 4I98B 2E5NA 2FBIA 2V4JC 3GZ5A 3PM1A 4BBRJ 1KQ8A 1ZR2A 4NB5A 4AIDA 3F8BA 2TRTA 3K1MA 4RLQA 2C6YA 2EIKH 4DIQA 3TO7A 2CO5A 2KJCA 5J6XA 1IN8A 3DEWA 3V7SA 1LB2A 1V5GA 2E7WA 2HR3A 3L2VA 2W84A 2L9VA 2KQRA 1S9HA 1RZ4A
chains in the Genus database with same CATH topology
1APLC 3RZOJ 2E1OA 5IOZA 3IV5A 3E7LA 3TP3A 4A3LJ 1T33A 2JN6A 5C44J 4A3DJ 5FKLA 2O9LA 3PO2J 1ETWA 1MBGA 2ECBA 2DMNA 1X58A 3GTLJ 3TW6A 3HOUJ 2L0KA 2L7FP 1MSFC 1ZQ3P 1JJ6C 1HCRA 5F0HA 3S1MJ 2CRGA 2LFBA 1WCMJ 2DMPA 3HM5A 1X2MA 3RQIA 1JUPA 2YS9A 2XRLA 5EZGA 3HGGA 2XB0X 3BR0A 5IPAA 1PUFB 3Q0VA 1W0UA 4XRMA 4AUXA 4FCYA 4MFEA 2DA2A 3BG9A 3H0GJ 4JYKA 1MBHA 4XRSG 3GTJJ 1HF0A 2NS8A 4QIWN 2MGQA 4C2MJ 4D5CA 2CU7A 1O4XA 1PUFA 1HOMA 5EGOB 1ETYA 3TW7A 5E3MA 1BJZA 4FISA 1VI0A 3B6AA 1IGNA 5F0FA 2NOGA 2QCOA 2RAEA 3D1NI 3QPSA 2JA5J 2DJNA 3LSJA 1VNDA 3M4OJ 5FKOA 1RESA 5M5WJ 2LD5A 2ME6A 2H8RA 3M3YJ 3S15J 3HB9A 2OF7A 4IHYA 2EQRA 3S2DJ 4MIMA 2VUMJ 1R9TJ 2B63J 2HXIA 1ZK8A 3MKLA 3Q3SA 1OCPA 1WGXA 2R5ZB 2NVQJ 2LR8A 5J1RA 4GFBA 5FKMA 2EZHA 3DCFA 4DYCA 4A3JJ 3JR9A 3LSGA 5J3LA 3SFIA 1SFOJ 3HBLA 2K9NA 5DTDA 1LFBA 2AO9A 1WI3A 1ETOA 4M3GA 2JWTA 5EG0B 2DTZA 3RKQA 5FKNA 3A01B 1JKRC 3GTMJ 1X2NA 1ZR4A 1MBFA 2CUFA 3JRGA 1FIAA 2E19A 2R7ZJ 5IP7J 1I6HJ 1YRNA 1GVDA 4IHVA 1QVTA 4A3GJ 4AC0A 3GTKJ 1MNMC 4A93J 1U8BA 2D5VA 1IV6A 5M3MJ 4CYCB 3G1LA 2HOSA 3HKZN 3S1NJ 3W6VA 2COBA 1RKTA 3OSGA 1Q1VA 4BY7J 2XGDA 1ETXA 3FISA 4S0HB 2JJ7A 3NAUA 2ME0A 1POGA 1LE8A 1ITYA 1QPIA 1IJWC 4A3MJ 2GLOA 2AHQA 4A3FJ 3OOUA 3JRFA 1ZKGA 4B3AA 3JRCA 1JKQC 4XICA 3VPRA 1QRYA 1IDZA 4MLOA 1K83J 2NVYJ 5K7FA 2XSDC 2JMWA 5EZHA 3IH4A 2M0CA 3MN2A 3GTOJ 4QTRA 1JKOC 3F0CA 2R5YA 1Y1VJ 3SDGA 2HOTA 5BNGA 2DMTA 2K9SA 4XK4A 2DMUA 2IEKA 1TWGJ 4DYRA 1P7IA 3ZQCA 1RETA 5HODA 4DZPA 1G2HA 4JX6A 2GBYA 3HOWJ 4A3KJ 1UMQA 2Y30A 4JX4A 2ZB9A 2CQQA 3I4MJ 1BA5A 1BW6A 2P81A 4C3JJ 4V2GA 2M9HA 3IH2A 3HEFA 4D7NA 2EH3A 2XPUA 3GTQJ 5IP6A 2M8GX 1CQTA 5F04A 1MBKA 1WH5A 1DU0A 3HOZJ 2EZIA 1Z77A 4M3EA 3S17J 2WV1A 4B1RA 1TWHJ 2HI3A 1ZTRA 3Q0WA 3K2AA 4RDUA 1D5YA 3NARA 2NVTJ 4V2FA 2Y31A 2W48A 4JP0A 1LFUP 5GPAA 1AKHA 1GDTA 3OSFA 2DA5A 2E2HJ 4W97A 2L9RA 4EEFG 1JTXA 2EZLA 3BG3A 4FE4A 1FTZA 3Q0UA 1IUFA 2VPRA 3OIOA 1I50J 1BL0A 4MFDA 3BR1A 3JRHA 3JRBA 3S2HJ 2Y2ZA 1JKPC 3S16J 3LNQA 2K9QA 3FK6A 2EBIA 1E3OC 2WAQN 2JK3A 1IRZA 3CQZJ 3H3VK 1JJ8C 3JREA 1MBEA 1NK3P 3BT9A 5EDNA 1NK2P 1JTYA 1TWCJ 2O8KA 3QQAA 2DA4A 4ABZA 1YRNB 1F43A 2XGEA 2ELKA 2XB5A 4BY1J 4A3CJ 1ENHA 1HLVA 1FJLA 1ETQA 3CDLA 2R93J 1BW5A 3LSRA 4RBOA 1ORKA 5GPCA 2KDZA 3GTGJ 3CMYA 2NS7A 1B72B 2FX0A 1LE8B 2HQ5A 2N8GA 1GUUA 4C3HJ 1GV5A 2XPWA 5F1JA 4I76A 4IHWA 1XC5A 1DU6A 3RZDJ 1AHDP 2MG4A 1IG7A 3BR2A 1B72A 4G12A 1RR7A 2YU9J 1HDDC 2R92J 3HOYJ 3HGYA 2ECCA 4MO7A 5F08A 5IOYA 2X6OA 2QF7A 2R5YB 5E3NA 4DZJA 4BBSJ 2LK2A 1S7EA 3A02A 2VKEA 3BTIA 4A69C 3BQYA 3BG5A 2HXOA 5F0CA 2KT0A 3IH3A 1B8IA 1UHSA 3BTJA 1U78A 5C4XJ 2VI6A 4L5EA 3BR6A 3UKGA 2FD5A 5FJ8J 2XPVA 4XIDA 2Y9YA 3A03A 1XS9A 1K61A 2DA3A 2LVSA 5IP9J 3TEDA 5EEAA 5FLVA 1GV2A 4A3BJ 3S1QJ 2JA7J 5FLMJ 3GBGA 4IEJA 2O7OA 3BQZA 3FIWA 4FTHA 2CQXA 1OFCX 4DYQA 2DA7A 3S14J 1ETVA 5M5YJ 3LSPA 1JT0A 2XGCA 3JRAA 4NDLA 3JRDA 4Y7NJ 1I3QJ 4X6AJ 1MBJA 3BTCA 1OJLA 5K7ZA 4M3BA 4M3DA 3LOCA 1H88C 9ANTA 2HOAA 1ZGWA 1AKHB 4X1EA 2DMQA 2IAIA 2M34A 1T56A 2OPTA 5M5XJ 3HOXJ 1NTCA 4DW6A 3ZQFA 2HDDA 4FE7A 2JA8J 2YUSA 1VF9A 4C3IJ 2VKVA 1IC8A 3ZQLA 4IHXA 3JRIA 2LTPA 1P7JA 3FKIJ 5C3EJ 5E3LA 1IDYA 1F36A 2CUEA 4I6ZA 1UG2A 1AU7A 2LY9A 5EF6A 5J1UA 1JGGA 3HDDA 2M2EA 2GM4A 2K40A 1WPKA 4AYBN 5JLXA 3QPLA 2Y0SN 4XRSA 3PO3J 2FQ4A 1FEXA 2R0QC 2X48A 2L7ZA 3ZOBA 3L1PA 2X9DA 4A3IJ 4W1UA 3WHCA 1W0TA 1VFCA 1RPWA 3C2BA 1TC3C 2CJJA 3ZQIA 4Y52J 3O8GA 4D5FA 4BXXJ 1MH3A 3O8HA 4UUSB 3G1MA 5FKKA 5GP9A 3ZQGA 4HNVA 5EGOA 2HYJA 2G0EA 3B6CA 3MVPA 3SJMA 5IYCJ 2LLKA 5EYRA 5E3OA 4B4CA 2DA1A 3S1RJ 2E2IJ 1QVUA 3HOVJ 4LOCA 2Y9ZA 2PMZN 1A5JA 4UUSA 2WB1N 1Y1WJ 2MSYA 1FTTA 5DS9A 1H8AC 1H89C 1MSEC 2LKXA 1EF4A 4A3EJ 4M6VA 5C4JJ 1FIPA 3TP0A 3GTPJ 3G1OA 2TCTA 3ZQHA 2LP0A 3BR3A 2R5ZA 2H1KA 4M3FA 3WHBA 2I10A 1U9OA 1WH7A 2IBDA 2MW8A 5IYBJ 1GT0C 1XG1A 2NVXJ 2ID6A 4QSHA 1ETKA 1SANA 2DA6A 2EZKA 2FJ1A 1OCTC 1JT6A 1RKWA 5EG0A 1JUSA 2ID3A 3CCYA 5F27A 3BTLA 3I4NJ 1B8IB 3FK7A 3A01A 1MH4A 3K7AJ 4UUTA 2L7MP 4J19A 1JUMA 4BKXA 1TWFJ 4JX5A 3PM1A 4BBRJ 1ZR2A 1A6IA 1Z0XA 2TRTA 4CYCA 5K7HA 5JLWA 2JA6J 4D7MA 1TWAJ 5IYDJ 3BR5A 3DEWA 1U9NA 5J1YA 5M3FJ 2E2JJ 1HDPA 2DN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1APL C;  3RZO J;  2E1O A;  5IOZ A;  3IV5 A;  3E7L A;  3TP3 A;  4A3L J;  1T33 A;  2JN6 A;  5C44 J;  4A3D J;  5FKL A;  2O9L A;  3PO2 J;  1ETW A;  1MBG A;  2ECB A;  2DMN A;  1X58 A;  3GTL J;  3TW6 A;  3HOU J;  2L0K A;  2L7F P;  1MSF C;  1ZQ3 P;  1JJ6 C;  1HCR A;  5F0H A;  3S1M J;  2CRG A;  2LFB A;  1WCM J;  2DMP A;  3HM5 A;  1X2M A;  3RQI A;  1JUP A;  2YS9 A;  2XRL A;  5EZG A;  3HGG A;  2XB0 X;  3BR0 A;  5IPA A;  1PUF B;  3Q0V A;  1W0U A;  4XRM A;  4AUX A;  4FCY A;  4MFE A;  2DA2 A;  3BG9 A;  3H0G J;  4JYK A;  1MBH A;  4XRS G;  3GTJ J;  1HF0 A;  2NS8 A;  4QIW N;  2MGQ A;  4C2M J;  4D5C A;  2CU7 A;  1O4X A;  1PUF A;  1HOM A;  5EGO B;  1ETY A;  3TW7 A;  5E3M A;  1BJZ A;  4FIS A;  1VI0 A;  3B6A A;  1IGN A;  5F0F A;  2NOG A;  2QCO A;  2RAE A;  3D1N I;  3QPS A;  2JA5 J;  2DJN A;  3LSJ A;  1VND A;  3M4O J;  5FKO A;  1RES A;  5M5W J;  2LD5 A;  2ME6 A;  2H8R A;  3M3Y J;  3S15 J;  3HB9 A;  2OF7 A;  4IHY A;  2EQR A;  3S2D J;  4MIM A;  2VUM J;  1R9T J;  2B63 J;  2HXI A;  1ZK8 A;  3MKL A;  3Q3S A;  1OCP A;  1WGX A;  2R5Z B;  2NVQ J;  2LR8 A;  5J1R A;  4GFB A;  5FKM A;  2EZH A;  3DCF A;  4DYC A;  4A3J J;  3JR9 A;  3LSG A;  5J3L A;  3SFI A;  1SFO J;  3HBL A;  2K9N A;  5DTD A;  1LFB A;  2AO9 A;  1WI3 A;  1ETO A;  4M3G A;  2JWT A;  5EG0 B;  2DTZ A;  3RKQ A;  5FKN A;  3A01 B;  1JKR C;  3GTM J;  1X2N A;  1ZR4 A;  1MBF A;  2CUF A;  3JRG A;  1FIA A;  2E19 A;  2R7Z J;  5IP7 J;  1I6H J;  1YRN A;  1GVD A;  4IHV A;  1QVT A;  4A3G J;  4AC0 A;  3GTK J;  1MNM C;  4A93 J;  1U8B A;  2D5V A;  1IV6 A;  5M3M J;  4CYC B;  3G1L A;  2HOS A;  3HKZ N;  3S1N J;  3W6V A;  2COB A;  1RKT A;  3OSG A;  1Q1V A;  4BY7 J;  2XGD A;  1ETX A;  3FIS A;  4S0H B;  2JJ7 A;  3NAU A;  2ME0 A;  1POG A;  1LE8 A;  1ITY A;  1QPI A;  1IJW C;  4A3M J;  2GLO A;  2AHQ A;  4A3F J;  3OOU A;  3JRF A;  1ZKG A;  4B3A A;  3JRC A;  1JKQ C;  4XIC A;  3VPR A;  1QRY A;  1IDZ A;  4MLO A;  1K83 J;  2NVY J;  5K7F A;  2XSD C;  2JMW A;  5EZH A;  3IH4 A;  2M0C A;  3MN2 A;  3GTO J;  4QTR A;  1JKO C;  3F0C A;  2R5Y A;  1Y1V J;  3SDG A;  2HOT A;  5BNG A;  2DMT A;  2K9S A;  4XK4 A;  2DMU A;  2IEK A;  1TWG J;  4DYR A;  1P7I A;  3ZQC A;  1RET A;  5HOD A;  4DZP A;  1G2H A;  4JX6 A;  2GBY A;  3HOW J;  4A3K J;  1UMQ A;  2Y30 A;  4JX4 A;  2ZB9 A;  2CQQ A;  3I4M J;  1BA5 A;  1BW6 A;  2P81 A;  4C3J J;  4V2G A;  2M9H A;  3IH2 A;  3HEF A;  4D7N A;  2EH3 A;  2XPU A;  3GTQ J;  5IP6 A;  2M8G X;  1CQT A;  5F04 A;  1MBK A;  1WH5 A;  1DU0 A;  3HOZ J;  2EZI A;  1Z77 A;  4M3E A;  3S17 J;  2WV1 A;  4B1R A;  1TWH J;  2HI3 A;  1ZTR A;  3Q0W A;  3K2A A;  4RDU A;  1D5Y A;  3NAR A;  2NVT J;  4V2F A;  2Y31 A;  2W48 A;  4JP0 A;  1LFU P;  5GPA A;  1AKH A;  1GDT A;  3OSF A;  2DA5 A;  2E2H J;  4W97 A;  2L9R A;  4EEF G;  1JTX A;  2EZL A;  3BG3 A;  4FE4 A;  1FTZ A;  3Q0U A;  1IUF A;  2VPR A;  3OIO A;  1I50 J;  1BL0 A;  4MFD A;  3BR1 A;  3JRH A;  3JRB A;  3S2H J;  2Y2Z A;  1JKP C;  3S16 J;  3LNQ A;  2K9Q A;  3FK6 A;  2EBI A;  1E3O C;  2WAQ N;  2JK3 A;  1IRZ A;  3CQZ J;  3H3V K;  1JJ8 C;  3JRE A;  1MBE A;  1NK3 P;  3BT9 A;  5EDN A;  1NK2 P;  1JTY A;  1TWC J;  2O8K A;  3QQA A;  2DA4 A;  4ABZ A;  1YRN B;  1F43 A;  2XGE A;  2ELK A;  2XB5 A;  4BY1 J;  4A3C J;  1ENH A;  1HLV A;  1FJL A;  1ETQ A;  3CDL A;  2R93 J;  1BW5 A;  3LSR A;  4RBO A;  1ORK A;  5GPC A;  2KDZ A;  3GTG J;  3CMY A;  2NS7 A;  1B72 B;  2FX0 A;  1LE8 B;  2HQ5 A;  2N8G A;  1GUU A;  4C3H J;  1GV5 A;  2XPW A;  5F1J A;  4I76 A;  4IHW A;  1XC5 A;  1DU6 A;  3RZD J;  1AHD P;  2MG4 A;  1IG7 A;  3BR2 A;  1B72 A;  4G12 A;  1RR7 A;  2YU9 J;  1HDD C;  2R92 J;  3HOY J;  3HGY A;  2ECC A;  4MO7 A;  5F08 A;  5IOY A;  2X6O A;  2QF7 A;  2R5Y B;  5E3N A;  4DZJ A;  4BBS J;  2LK2 A;  1S7E A;  3A02 A;  2VKE A;  3BTI A;  4A69 C;  3BQY A;  3BG5 A;  2HXO A;  5F0C A;  2KT0 A;  3IH3 A;  1B8I A;  1UHS A;  3BTJ A;  1U78 A;  5C4X J;  2VI6 A;  4L5E A;  3BR6 A;  3UKG A;  2FD5 A;  5FJ8 J;  2XPV A;  4XID A;  2Y9Y A;  3A03 A;  1XS9 A;  1K61 A;  2DA3 A;  2LVS A;  5IP9 J;  3TED A;  5EEA A;  5FLV A;  1GV2 A;  4A3B J;  3S1Q J;  2JA7 J;  5FLM J;  3GBG A;  4IEJ A;  2O7O A;  3BQZ A;  3FIW A;  4FTH A;  2CQX A;  1OFC X;  4DYQ A;  2DA7 A;  3S14 J;  1ETV A;  5M5Y J;  3LSP A;  1JT0 A;  2XGC A;  3JRA A;  4NDL A;  3JRD A;  4Y7N J;  1I3Q J;  4X6A J;  1MBJ A;  3BTC A;  1OJL A;  5K7Z A;  4M3B A;  4M3D A;  3LOC A;  1H88 C;  9ANT A;  2HOA A;  1ZGW A;  1AKH B;  4X1E A;  2DMQ A;  2IAI A;  2M34 A;  1T56 A;  2OPT A;  5M5X J;  3HOX J;  1NTC A;  4DW6 A;  3ZQF A;  2HDD A;  4FE7 A;  2JA8 J;  2YUS A;  1VF9 A;  4C3I J;  2VKV A;  1IC8 A;  3ZQL A;  4IHX A;  3JRI A;  2LTP A;  1P7J A;  3FKI J;  5C3E J;  5E3L A;  1IDY A;  1F36 A;  2CUE A;  4I6Z A;  1UG2 A;  1AU7 A;  2LY9 A;  5EF6 A;  5J1U A;  1JGG A;  3HDD A;  2M2E A;  2GM4 A;  2K40 A;  1WPK A;  4AYB N;  5JLX A;  3QPL A;  2Y0S N;  4XRS A;  3PO3 J;  2FQ4 A;  1FEX A;  2R0Q C;  2X48 A;  2L7Z A;  3ZOB A;  3L1P A;  2X9D A;  4A3I J;  4W1U A;  3WHC A;  1W0T A;  1VFC A;  1RPW A;  3C2B A;  1TC3 C;  2CJJ A;  3ZQI A;  4Y52 J;  3O8G A;  4D5F A;  4BXX J;  1MH3 A;  3O8H A;  4UUS B;  3G1M A;  5FKK A;  5GP9 A;  3ZQG A;  4HNV A;  5EGO A;  2HYJ A;  2G0E A;  3B6C A;  3MVP A;  3SJM A;  5IYC J;  2LLK A;  5EYR A;  5E3O A;  4B4C A;  2DA1 A;  3S1R J;  2E2I J;  1QVU A;  3HOV J;  4LOC A;  2Y9Z A;  2PMZ N;  1A5J A;  4UUS A;  2WB1 N;  1Y1W J;  2MSY A;  1FTT A;  5DS9 A;  1H8A C;  1H89 C;  1MSE C;  2LKX A;  1EF4 A;  4A3E J;  4M6V A;  5C4J J;  1FIP A;  3TP0 A;  3GTP J;  3G1O A;  2TCT A;  3ZQH A;  2LP0 A;  3BR3 A;  2R5Z A;  2H1K A;  4M3F A;  3WHB A;  2I10 A;  1U9O A;  1WH7 A;  2IBD A;  2MW8 A;  5IYB J;  1GT0 C;  1XG1 A;  2NVX J;  2ID6 A;  4QSH A;  1ETK A;  1SAN A;  2DA6 A;  2EZK A;  2FJ1 A;  1OCT C;  1JT6 A;  1RKW A;  5EG0 A;  1JUS A;  2ID3 A;  3CCY A;  5F27 A;  3BTL A;  3I4N J;  1B8I B;  3FK7 A;  3A01 A;  1MH4 A;  3K7A J;  4UUT A;  2L7M P;  4J19 A;  1JUM A;  4BKX A;  1TWF J;  4JX5 A;  3PM1 A;  4BBR J;  1ZR2 A;  1A6I A;  1Z0X A;  2TRT A;  4CYC A;  5K7H A;  5JLW A;  2JA6 J;  4D7M A;  1TWA J;  5IYD J;  3BR5 A;  3DEW A;  1U9N A;  5J1Y A;  5M3F J;  2E2J J;  1HDP A;  2DN0 A; 
#chains in the Genus database with same CATH topology
 4NUB A;  3RZO J;  2JPC A;  3S3O A;  2NNY A;  5IOZ A;  1HKT A;  4LG3 A;  1QHG A;  3EUH C;  4A3D J;  2O9L A;  1RUO A;  4KIS A;  2QKL B;  1ETW A;  3J7A O;  3GTL J;  2E1C A;  2EFO A;  1Y8R B;  3PNY A;  2CSO A;  1SD6 A;  3FXK A;  4R79 A;  1IV8 A;  5ICF A;  1HCR A;  4LIU A;  2GIZ A;  1E3P A;  1XN7 A;  5JR3 A;  1D0X A;  4BXF A;  2FNP A;  5LHG A;  5LLQ A;  6PAX A;  1MDM B;  4LMY A;  2CW0 F;  1WRJ A;  3GX4 X;  3H5A A;  4WXD A;  5IPA A;  1PUF B;  4EJT A;  2VC1 A;  2H6B A;  3QU6 A;  2M1B A;  2ZCW A;  4Y13 A;  4MFE A;  2NXN B;  4L18 B;  1CGP A;  4JYK A;  1MBH A;  3HYI A;  3GTJ J;  3SZT A;  1J9I A;  1V5E A;  3QPT A;  4ON0 A;  2JVH A;  2NAZ A;  2ZME C;  4EGZ A;  1SFK A;  4XLH A;  4B47 A;  1EH6 A;  3ZMD A;  4HW0 A;  4HYE A;  2HPM A;  2QCO A;  2RAE A;  1XX5 A;  3D1N I;  2K86 A;  2GIV A;  2R7R A;  2F4M B;  1VND A;  2IA0 A;  5FKO A;  2DT7 B;  3M3Y J;  3ZMV A;  2EIN H;  3HKZ A;  3QYB A;  5FD5 A;  1R71 A;  5FRM A;  4ZDL A;  2VUM J;  2M45 A;  3I71 A;  5LHH A;  1YLF A;  4MQV A;  3TL4 X;  4LB5 A;  3I53 A;  2B63 J;  1ZK8 A;  2J5P A;  4KIG A;  3OYI A;  3MKL A;  3Q3S A;  1WGX A;  4M9S A;  1KU9 A;  3ESW B;  2K4J A;  3EET A;  3EYI A;  4DYC A;  2VBX A;  3OIP A;  2QQB A;  4KUM A;  2MC4 A;  3JR9 A;  3ASN H;  1LFB A;  5DTD A;  3CUQ A;  3RPQ A;  2KRH A;  1TW3 A;  4DBQ A;  1WI3 A;  5K5R A;  4XLN F;  3HC7 A;  1ZRC A;  1XPX A;  1IAW A;  3GTM J;  3KP7 A;  1X2N A;  1ZR4 A;  2HQA A;  1MBF A;  2GA2 A;  5TGT A;  4Z6Y A;  2GZW A;  1I6H J;  3CCR I;  4H4K C;  1YRN A;  1GVD A;  3KP5 A;  1O3S A;  2BOL A;  4M6Y A;  5JI6 A;  2LH9 A;  3GTK J;  1MNM C;  2D5V A;  5M3M J;  2BE5 F;  2V79 A;  3MFK A;  5L3D A;  1IF1 A;  2HOS A;  4HX4 A;  3S1N J;  2COB A;  2EV6 A;  2BHY A;  3OSG A;  4K2E A;  4HV6 A;  2G7U A;  2XIG A;  1ETX A;  1T6S A;  1VQN I;  1POG A;  4UXN A;  1LE8 A;  3S3M A;  2JRT A;  4BJ6 C;  3MKY B;  1IJW C;  3S8P A;  5HDK A;  2GLO A;  2BY2 A;  4FQG A;  4EM0 B;  2HS5 A;  2DQL A;  1TT0 A;  4FX0 A;  3JRF A;  4P55 A;  1ZKG A;  4B3A A;  3JRC A;  1JKQ C;  2P7V B;  4QPQ A;  4XIC A;  1T38 A;  2P5V A;  3E97 A;  4ZDO A;  1K83 J;  1OR7 A;  2A6H F;  2VJJ A;  1LDD A;  5EZH A;  4PJM A;  1QZE A;  1WQ2 A;  2XAQ A;  2DYS H;  2A05 A;  3IH4 A;  3J7A Y;  1Z21 A;  3MN2 A;  3GTO J;  4QTR A;  2Z99 A;  3AG4 H;  2XGX A;  4NC6 A;  1Y1V J;  3HTU A;  5BNG A;  5HLH A;  2DMT A;  4HF2 A;  5EJC A;  4LJZ F;  1YQA A;  2DMU A;  2H09 A;  3WU2 C;  4ZJZ A;  4MHG A;  1K78 B;  1HXD A;  1XTA A;  4FT8 A;  2R7W A;  1WJD A;  1R49 A;  1TWG J;  2YU3 A;  1S8N A;  1R5I D;  4ENM A;  4KDP A;  1VQP I;  4IVN A;  2CFO A;  5HOD A;  3OR1 C;  3CMA I;  2QSF X;  1MIJ A;  4KIF A;  3HOW J;  2Y30 A;  4RGS A;  1HW5 A;  4KT5 C;  5LRR A;  3TDU C;  4UHT A;  1IN4 A;  1BW6 A;  3OYN A;  1UEL B;  4C3J J;  2WAQ A;  2NS0 A;  3DPU A;  1Z3X A;  1Z7U A;  4RB0 A;  3FXR A;  3TO9 A;  4D7N A;  2EH3 A;  4L5J A;  1PP8 F;  5IP6 A;  2M8G X;  3A0B C;  3KX2 A;  1MBK A;  1KYZ A;  1WH5 A;  2RNG A;  5DD8 A;  3QOD A;  2EZI A;  2MLK A;  1DU0 A;  3HOZ J;  4RGR A;  2WV1 A;  2MBF A;  5LGN A;  1SC7 A;  4ZYA A;  4Y15 A;  5D5V B;  2DO7 A;  3K2A A;  1D5Y A;  2DQR A;  3PQJ A;  3WE2 A;  1REP C;  2WY8 Q;  4V2F A;  2DW4 A;  2YR2 A;  2CUJ A;  4L9T A;  2MD5 A;  4U0Y A;  1R6R A;  2K3F A;  1R1U A;  3DV8 A;  1GDT A;  2VBZ A;  1OCZ H;  2E2H J;  3SDB A;  2OUM A;  4W97 A;  2L9R A;  4EEF G;  5CKT A;  3BG3 A;  4Z2Y A;  1N78 A;  1Y39 A;  4JQF A;  4G7H F;  4RB2 C;  3REO A;  1D1C A;  4LK0 F;  5F6F A;  3NWS A;  2EA4 A;  3CJQ B;  3BR1 A;  1T2K A;  1XGM A;  1FLI A;  3K4K A;  2Y2Z A;  1JKP C;  3S16 J;  3LNQ A;  2K27 A;  2LBF A;  4YEJ A;  3E0J B;  4BEH A;  2X51 A;  4BJ5 C;  2LNB A;  3HPH A;  1FWZ A;  2W1O A;  1WJ5 A;  3BT9 A;  4HV5 A;  2KDO A;  4P96 A;  1Z67 A;  3D5R C;  3QQA A;  1FT9 A;  4EM1 A;  3OR2 C;  4ZTJ A;  1F43 A;  5HDN A;  4BY1 J;  3QU3 A;  3CZ6 A;  1ETQ A;  2KMU A;  2E1N A;  3TBI A;  2LSO A;  4RBO A;  3QWL A;  1ORK A;  2JQ7 A;  3GTG J;  2VQL A;  3H0D A;  3ML6 A;  2XRN A;  3DKX A;  2FX0 A;  3HG9 A;  1R58 A;  2ZJ2 A;  4MTD A;  1VQ5 I;  1X1B A;  4HQE A;  2EFN A;  1YI2 I;  1FC3 A;  1JI8 A;  2TDX A;  2XPW A;  5F1J A;  5LGU A;  4I76 A;  1XC5 A;  3EYY A;  4F91 B;  1YOV B;  2CV2 A;  3KLO A;  2I8D A;  4ZC3 A;  3BR2 A;  3QAH A;  4G12 A;  2BW3 B;  2BVM A;  2FSW A;  3I59 B;  5IOY A;  2G9W A;  4BQA A;  4UV9 A;  2H6C A;  2STT A;  2EJR A;  2HOE A;  5AON A;  5E3N A;  4BBS J;  3ZMT A;  3HHG A;  1DP3 A;  2ZC2 A;  3P9C A;  1KU7 A;  3GFL A;  1J0R A;  4LK1 F;  1XGS A;  3F6O A;  1H0M A;  4BE2 A;  1VQ4 I;  2QM3 A;  2DT6 A;  3FXL A;  2HXO A;  2HNH A;  4ZTF A;  4YFK F;  5F0C A;  1S5L C;  5E1W A;  2V6C A;  3IH3 A;  3GCM A;  1UHS A;  3KEY A;  2O5R A;  2VI6 A;  4L5E A;  5FJ8 J;  2XPV A;  1U5T B;  2Y9Y A;  2WTE A;  3A03 A;  2OAZ A;  4XLC A;  1FOW A;  2CYY A;  1K61 A;  2DAO A;  4Q47 A;  1STZ A;  3TED A;  3HSE A;  4I02 A;  5FLV A;  3GUD A;  4NC8 A;  5FLM J;  4GYI A;  1QQI A;  1KQ9 A;  3BQZ A;  3E5Q A;  4CCN A;  3PUB A;  1OFC X;  2O8X A;  5DV5 A;  4DYQ A;  2ZXJ A;  1BI1 A;  3LSP A;  4RAY A;  2JSP A;  4ZYG A;  1HKQ A;  3GFJ A;  4JBA A;  3FMS A;  4M9X A;  2M87 A;  4NDL A;  3JRD A;  1X3U A;  3WG9 A;  2WY7 Q;  2VOO A;  1ZLJ A;  2KZV A;  2X6W A;  3LQR A;  2M4G A;  1W5S A;  3ONQ A;  1V55 H;  3F8C A;  5TIS C;  1EH8 A;  1MBJ A;  3BTC A;  3PSI A;  1I3A A;  4M3D A;  2FU4 A;  3LOC A;  1P4X A;  1Z05 A;  1AKH B;  2PQ8 A;  3PQK A;  4X1E A;  4E7I A;  5FB2 A;  3B02 A;  3U9G A;  5DCM A;  2X1E A;  2IAI A;  2LG4 A;  2X4H A;  3I4P A;  1RI7 A;  5A2Q Z;  3HIF A;  3ZQF A;  3O3K A;  5J8C A;  2JA8 J;  3KP2 A;  4MNU A;  2HTJ A;  3ZQL A;  4KMF A;  2W85 A;  2IXS A;  4F55 A;  4D1Q A;  5LRS A;  1IDY A;  1FYM A;  2LY9 A;  3E6M A;  5EF6 A;  1SD4 A;  1AU7 A;  2OQG A;  3HDD A;  1LVA A;  3C2G A;  2K40 A;  4RAF A;  4GO1 A;  3DPT A;  4E7J A;  4ESF A;  3CC4 I;  4XRS A;  3PO3 J;  4LB6 B;  2QGU A;  4EV0 A;  3CJT B;  1ERD A;  4FHT A;  2JTV A;  2X48 A;  1A6Q A;  3AKZ A;  2XRO A;  4L9N A;  2Y69 H;  2B7E A;  2CJJ A;  3SYT A;  2NNN A;  2D1H A;  4D5F A;  3OYJ A;  4GYG A;  4BXX J;  2EIJ H;  4UUS B;  5FKK A;  3ZQG A;  2ZFU A;  1T95 A;  3HHH A;  3I9V 2;  2IS2 A;  2KIU A;  1U5T C;  2VKD A;  1QBJ A;  1PDN C;  4KJZ A;  3BG6 A;  3S1R J;  2E2I J;  3IP4 B;  3F72 A;  2VC0 A;  2E1M C;  2EFW A;  3WTU C;  3E6D A;  1UFM A;  3QP6 A;  5LGT A;  2VAS A;  1OYW A;  2HDW A;  4LG0 A;  2VXZ A;  4EAT A;  2BYV E;  4A3E J;  2CV1 A;  3CC2 I;  2F5C A;  3OYH A;  3ZN0 A;  2R5Z A;  1L3L A;  4M71 A;  2Z9O A;  4BNC A;  2R7S A;  1GT0 C;  2LOO A;  4RA2 A;  1NHA A;  3FBN B;  4C2T A;  3PIP F;  2O3F A;  2OU2 A;  3S32 A;  2VL8 A;  4BAC A;  1JT6 A;  1DPR A;  4XOR A;  5IY5 H;  3DU5 A;  2ZBK A;  3RIR A;  4UNO A;  1IN6 A;  3BPV A;  3BTL A;  1V5F A;  3MWM A;  2PX9 A;  2HGC A;  1A35 A;  3K70 D;  1D3Y A;  3HSR A;  3F8N A;  2LKS A;  2COM A;  5F64 A;  1PVE A;  1ZG3 A;  1XB4 A;  4Q4Z F;  2A61 A;  2LKP A;  1I39 A;  4CYC A;  3MKZ A;  1YS6 A;  2ZKZ A;  3LWF A;  4D7M A;  3BZK A;  2FRH A;  1BOB A;  5IYD J;  1DGW Y;  3BR5 A;  1S7A A;  2Z3Y A;  4PSW A;  2P5L C;  5M3F J;  5E1Z B;  2ZXI A;  2QBY A;  4FX4 A;  2H1K A;  1I1S A;  4QLC U;  3F23 A;  4E7L A;  4OIQ F;  1M1E B;  4PSX A;  3IV5 A;  3TP3 A;  2M0M A;  3GEZ A;  1DPU A;  1T33 A;  2K9L A;  4E7H A;  2JN6 A;  3AG1 H;  5FKL A;  4DOZ A;  1U0J A;  5TJJ A;  3J81 Z;  1VQM I;  4S04 A;  1RIO H;  2ESN A;  3HOS A;  3GYH X;  2BXZ A;  1F1Z A;  3TW6 A;  2ICW G;  4NC7 A;  3GZ6 A;  4PJJ A;  3S1M J;  1S6L A;  2DMP A;  3HM5 A;  2P0W A;  4I0B A;  5FRO A;  4XMY A;  5F1R A;  4M9Z A;  3OY9 A;  1W4M A;  2WAD A;  2QKM B;  3DKW A;  2YS9 A;  2XRL A;  5EZG A;  3HGG A;  4BGD A;  1T0F A;  3H36 A;  2A07 F;  3ZGK A;  5DUI A;  4M73 A;  3OS1 A;  1SFX A;  4PK4 A;  4BH9 A;  2XC7 A;  2BXY A;  3C2H A;  4XRS G;  5A2Q K;  1P6R A;  3EQL F;  2M30 A;  2NS8 A;  4QIW N;  3L2U A;  4C2M J;  4D5C A;  2CU7 A;  3OWT A;  1WJA A;  1R1T A;  4S05 A;  5K5O A;  1ETY A;  2VQC A;  5EGO B;  2FNA A;  3LA3 A;  1RNL A;  4BQN A;  2F2E A;  1KU3 A;  4FIS A;  3B6A A;  3VDX A;  3IL2 A;  1IGN A;  2M8E A;  3LSJ A;  4YEL A;  4OIP F;  3M4O J;  1RES A;  5M5W J;  4BQQ A;  4XOP A;  4ESJ A;  3S15 J;  5IT9 K;  1PJR A;  3HB9 A;  2OF7 A;  2VXD A;  3M8J A;  3NEU A;  3HUG A;  4IHY A;  1FMW A;  1QNT A;  2EB7 A;  4KA4 A;  2QSH X;  1O57 A;  4MIM A;  1YIJ I;  4G7Z F;  1YX3 A;  3IKV A;  1YYV A;  2VT2 A;  3DBL B;  1IZ1 A;  2RGV A;  4XKC A;  4ZZD A;  1TZL A;  3JTG A;  2GOX B;  5J1R A;  2NVQ J;  5FKM A;  1TBX A;  3A0H C;  2MA3 A;  3DTE A;  2EZH A;  4A3J J;  2OD5 A;  1BI0 A;  2Q1Z B;  5HLG A;  5J3L A;  1SFO J;  2GXB A;  3HBL A;  2DU9 A;  2K9N A;  5J40 A;  4Y3O A;  5CQE A;  3TOA A;  2ISY A;  2AO9 A;  3K4M A;  5HNH A;  4CH7 A;  3CCE I;  1ETO A;  5EG0 B;  3RKQ A;  2XAF A;  5FKN A;  1JKR C;  3BJO A;  3JRG A;  3GZN B;  2R7Z J;  2ZJQ F;  4JK1 X;  4HRI A;  3AG3 H;  3COA C;  1YFH A;  3CP2 A;  4IRH A;  2M5W A;  4EM2 A;  3LSK A;  1VQL I;  3W3C A;  2V1N A;  3M07 A;  4BY7 J;  2IGO A;  4G6Q A;  4S0H B;  3KIO A;  4JOM A;  4I0A A;  4BE0 A;  1ITY A;  1QPI A;  2IA1 A;  2GWR A;  2V1D A;  1FNN A;  3OYE A;  4G6T B;  5E18 F;  2EFP A;  1VQ9 I;  4HX7 A;  1OIS A;  4L9J A;  3VPR A;  4IRI A;  5E1X A;  3OS2 A;  1IDZ A;  4MLO A;  5K7F A;  2XSD C;  2M7B A;  2ZSI B;  3E3V A;  2JMW A;  4P9F A;  1QZY A;  1RUN A;  3BRO A;  5L3E A;  1VQ6 I;  2VJ4 A;  3QPH A;  2DXI A;  4OOI A;  2YX4 A;  4KT6 A;  3J80 Z;  1JKO C;  3F0C A;  4LD5 A;  5K1Y A;  3LQQ A;  2F5F A;  2MH9 A;  3DKY A;  2HOT A;  1VQ8 I;  2JZY A;  4EJU A;  4XSX F;  2QQA A;  1VQO I;  1KYW A;  2IEK A;  3TDZ C;  3TQN A;  4CA0 A;  1RET A;  3FHZ A;  5CLS A;  5L3G A;  1LDJ A;  4JX6 A;  1ZH5 A;  2GBY A;  4DGW B;  3T8R A;  2MC3 A;  4YFX F;  4RLF A;  5J4V A;  2L01 A;  3CDI A;  4HG2 A;  2X0L A;  1IRG A;  4CHU A;  1MMN A;  3D0S A;  2P81 A;  4XRF A;  5H20 A;  2A69 F;  2M9H A;  4V2G A;  4F92 B;  1LDK B;  3J81 K;  3IH2 A;  5KCM A;  2D2W A;  2X6Y A;  3F8F A;  2L9N A;  4HQM A;  4HZF A;  1XCV A;  5F04 A;  1LVK A;  1ULY A;  3C3W A;  5TRD A;  4U0W A;  3G2B A;  4ENN A;  2UUZ A;  4M3E A;  3H9J A;  4PFO A;  3ZRG A;  2JSC A;  4B1R A;  1TWH J;  3H3Z A;  4RMN A;  1NG7 A;  3H9Q A;  2HI3 A;  3Q0W A;  3KPH A;  3VYR B;  4RDU A;  2LMD A;  1FBU A;  3NAR A;  2OBP A;  3S93 A;  1KQ0 A;  1Y0U A;  2WAE A;  1I1G A;  4RB3 C;  2Y31 A;  2KIS A;  1LFU P;  4A0X A;  1K7A A;  1G3W A;  2HZD A;  1FSE A;  3OSF A;  5HS8 A;  2DA5 A;  2Y75 A;  1BC8 C;  1SMY F;  4RS8 A;  3NWT A;  2NYX A;  4BEH B;  1IUF A;  2VPR A;  4KNY A;  2WA0 A;  5LFA A;  1YJN I;  3C1D A;  1E0E A;  1I50 J;  1U3E M;  4FET A;  1AOY A;  4F52 A;  3PJR A;  4G8X A;  3ZP5 A;  4OWR B;  3FK6 A;  1W7P B;  2EBI A;  2F4O B;  1E3O C;  3PL8 A;  2P6T A;  1MJ9 A;  2IJL A;  3H35 A;  2FBK A;  1G3S A;  1MGT A;  1Y6I A;  1NK3 P;  5EDN A;  3IRQ A;  5HLT A;  1TWC J;  2A6E F;  2DI3 A;  4ABZ A;  2XGE A;  2E36 A;  3NRV A;  3GF2 A;  4A3C J;  4Y4R A;  1HLV A;  1FJL A;  3Q9S A;  3M1C A;  4I09 A;  1HC8 A;  2ELH A;  2L4M A;  2ELJ A;  2R93 J;  3L9F A;  3ECO A;  1F5T A;  3KCC A;  3CCS I;  4PJL A;  2NOJ B;  2MFZ A;  1V4R A;  2L4A A;  1UAA A;  3LMM A;  4CCL A;  3X2Q H;  2N8G A;  3V8K A;  2RDP A;  4WXH A;  4C30 A;  3K69 A;  2F4I A;  4YII A;  4KIT B;  2KIF A;  3K1P A;  4HBL A;  5LD2 C;  5HS9 A;  3E5U A;  1DU6 A;  3RZD J;  1Z6R A;  1AHD P;  2MG4 A;  3OYA A;  1IG7 A;  1R7J A;  4CIC A;  2LC2 A;  3RSN A;  1B72 A;  2FML A;  3DBH B;  4PDK A;  1E2X A;  3OYL A;  1HBX G;  2PJR B;  4PCQ A;  3V7C A;  3OOP A;  2UV1 A;  3P5J A;  3RQ4 A;  3RTR A;  4A5M A;  1NH3 A;  5K5Q A;  2PFB A;  2R92 J;  3DQV C;  3F8M A;  2KJB A;  4MO7 A;  4PGH A;  1BBY A;  2R5Y B;  1WWX A;  2LK2 A;  1QU3 A;  3LSI A;  4ETS A;  1S7E A;  3A02 A;  4HLY A;  3FXJ A;  2B0L A;  4A69 C;  3J7Z I;  1WZ2 A;  5E8I A;  3MZH A;  2Q2E A;  1FP2 A;  3RDI A;  2VQH A;  2IS6 A;  1W36 D;  3WTT C;  3KET A;  3BTJ A;  1GLN A;  3UKG A;  3BR6 A;  2XKP A;  3F6V A;  2ZME A;  3LAP A;  4U88 A;  1XS9 A;  2DA3 A;  4MEY F;  2LVS A;  5H2F C;  5IP9 J;  4BUP A;  4M6X A;  4AYB A;  2Z1D A;  5EEA A;  3GLL A;  1GV2 A;  2XKO A;  3B73 A;  3BLY A;  2JA7 J;  1QA6 A;  3V7R A;  1FX7 A;  4FTH A;  2CQX A;  3J80 K;  1RRJ A;  2H94 A;  3S14 J;  1EKE A;  1X1A A;  4R1H A;  5DYM A;  1JT0 A;  2EWN A;  2BY0 A;  1UST A;  3SFZ A;  3JRA A;  2LY2 A;  3ZXS A;  4P1W A;  3RYR A;  1EH7 A;  1I3Q J;  2HYF A;  2R7Q A;  4ASN A;  2OZU A;  3VSK A;  2QWW A;  3I58 A;  2VLA A;  1SD7 A;  3HTS B;  3ABL H;  2R7F A;  2OA4 A;  5CYV A;  3UNG C;  4B44 A;  5K7Z A;  1ZYR F;  2MD0 A;  2XUB A;  2F6C A;  2QUF A;  3TO6 A;  9ANT A;  1YG2 A;  4NNJ A;  2PI0 A;  2H8W A;  2M34 A;  2OPT A;  3RPU A;  3HOX J;  1USS A;  1NTC A;  2DJI A;  2P8T A;  4DW6 A;  1FOK A;  2QZ8 A;  3QOE A;  2YUS A;  1IC8 A;  2VKV A;  4Q5S F;  1P7J A;  4GCV A;  4OIO F;  4OMY A;  2IGM A;  2ZSH B;  3CLQ A;  1XSV A;  5CJ9 A;  5E3L A;  1F36 A;  2HDC A;  2KIM A;  2I5U A;  3TOB A;  2OTL I;  5J1U A;  2M2E A;  2GM4 A;  2DOD A;  1MDM A;  3CJN A;  3HZJ A;  5JLX A;  1ON1 A;  5FLX Z;  3QPL A;  1YIO A;  4WXC A;  1W5T A;  2P5K A;  3K0L A;  1ONV A;  2FQ4 A;  1XSD A;  3SEQ A;  2R0Q C;  5DUK A;  2L7Z A;  1R4N B;  2YX7 A;  3I56 I;  1HKS A;  4A3I J;  3VWB A;  4W1U A;  1W0T A;  1TC3 C;  3OYG A;  4XQF A;  4YIF A;  4Y52 J;  2VE8 A;  1TL8 A;  2KIQ A;  3BC8 A;  2KRF A;  3KYC B;  3OYC A;  1MH3 A;  4B09 A;  3G1M A;  4HNV A;  4E7K A;  4YRV A;  2OZ6 A;  1HST A;  5IYC J;  2LRE A;  5EYR A;  5E3O A;  4B4C A;  2DA1 A;  2GXA A;  1IUY A;  3DXJ F;  3KFW X;  3HOV J;  4LOC A;  2Y9Z A;  2LY1 A;  2BY3 A;  2QQ9 A;  3CLO A;  4LGW A;  1JE8 A;  2V6E A;  1G4D A;  3K4C A;  2RQP A;  1U2W A;  4RB1 A;  4B8X A;  1ZAO A;  2LKX A;  3HXL A;  1Z9C A;  3TP0 A;  3GTP J;  1TQP A;  3ZQH A;  2LP0 A;  3BR3 A;  4M3F A;  2IRF G;  3WHB A;  2R7U A;  2GA1 A;  2OCC H;  3G4S I;  2MW8 A;  2R7V A;  1XG1 A;  2PEX A;  2PBI A;  1JHH A;  1ZGJ A;  1YJW I;  2UXN A;  2XF5 A;  1ETK A;  2EZK A;  1IRX A;  5HNF A;  1E17 A;  1CF7 B;  2M7A A;  2L54 A;  1FYK A;  1K6Y A;  1OCT C;  2K4B A;  3Q9V A;  3BP8 A;  1JUS A;  3WU1 B;  2FOK A;  3I4N J;  4DNC A;  1B8I B;  1A36 A;  1MH4 A;  4J01 A;  3M8E A;  1D0Y A;  1WI9 A;  3VSL A;  1GHC A;  1MND A;  1JUM A;  1XMX A;  1MW7 A;  4AVP A;  1TWF J;  3F3X A;  4JX5 A;  3UR3 C;  3ZCO A;  3L2R A;  1Z0X A;  1GXP A;  1WFX A;  1SAU A;  4I99 C;  3SQN A;  5K7H A;  5JLW A;  1SFU A;  1SMT A;  2JUG A;  3G6E I;  4BHB A;  4Q48 A;  3KEO A;  3ZR8 X;  1U9N A;  4WK8 F;  2XV4 S;  4YG2 F;  4CGZ A;  2UWM A;  1K4T A;  3KZI C;  4RM3 A;  2DPU A;  2E2J J;  3BJ6 A;  3FM3 A;  2WAF A;  2E1M B;  2A5Y B;  1ACI A;  2E1O A;  5BMZ A;  1DQU A;  1GVJ A;  3E7L A;  4IQJ A;  1F9N A;  2L5Q A;  5HLI A;  2YPR A;  1B6A A;  5CPR B;  5D8K B;  4KIC A;  1VQ7 I;  5C44 J;  3JSP A;  4AVZ A;  4GRI A;  4F7Z A;  1MBG A;  2ECB A;  1X58 A;  4U7B A;  1LNW A;  1MSF C;  4N0B A;  4N9I A;  3SZG A;  2CRG A;  2LFB A;  1X3Z B;  2R4G A;  1BI3 A;  5CVJ A;  3ABU A;  4LFU A;  1TLH B;  5D6E A;  1Z1D A;  4CCJ A;  5J4Y A;  1K78 A;  1X2M A;  4XNF A;  3RQI A;  1BR2 A;  1MMG A;  5J8F A;  2HKO A;  2XB0 X;  3BR0 A;  1LJ9 A;  1YX5 A;  3Q0V A;  2P4W A;  3K9T A;  2A68 F;  2HEO A;  4AUX A;  2E71 A;  3L2W A;  4FCY A;  2DA2 A;  3AL0 B;  3H0G J;  5IT9 Z;  4IOA F;  1X1C A;  1HF0 A;  3PIO F;  1S3J A;  3KLN A;  2CS3 A;  1O4X A;  1HOM A;  1Y56 A;  2PMH A;  3GVA A;  4ZYE A;  2L02 A;  2XHK A;  5E3M A;  3CME I;  1VI0 A;  4PJN A;  3BZ6 A;  1SVL A;  3D5L A;  1XMA A;  5DM6 F;  2D1V A;  2JA5 J;  2DJN A;  2BHZ A;  4AU7 A;  2LD5 A;  2ME6 A;  2H8R A;  5FLX K;  3K70 C;  3R4K A;  4HOB A;  2EQR A;  4NHJ A;  2CH0 A;  2CW8 A;  1LEA A;  2FQ3 A;  5H6R A;  5ILS A;  3R0J A;  1J2X A;  2AQF A;  2DDB A;  3HSF A;  2Q0O A;  3LAJ A;  2FXA A;  1MJB A;  2HXI A;  1D8J A;  2VPL A;  2W00 A;  4A6D A;  3TGN A;  2CUZ A;  4UB8 C;  2IP2 A;  3I5U A;  3RKW A;  1DGR M;  1UB9 A;  1FBS A;  1Z7L A;  4OAZ A;  3MCZ A;  3ZMZ A;  3H92 A;  3GW2 A;  1D0Z A;  4A5N A;  2NRA C;  5CVV A;  5L3B A;  3K4L A;  3KZZ A;  5D4S A;  2VE9 A;  4M3G A;  4LLG F;  1B4A A;  4DJA A;  3OYD A;  3GFM A;  2GOM A;  4QPO A;  3L2Q A;  1T0F C;  3A01 B;  4CDG A;  1UCR A;  2CUF A;  2DTR A;  4HF1 A;  1FIA A;  1TQI A;  2E19 A;  3RKY A;  4A12 A;  2VB6 A;  4KYW A;  1D1A A;  1QVT A;  1OYI A;  4HA8 A;  4N4O B;  1G3Y A;  1WJF A;  4A93 J;  4UVB A;  1U8B A;  1T98 A;  3FXM A;  3OYM A;  3IUO A;  3G1L A;  4CUG A;  4AM3 A;  4XN3 A;  4PJ0 C;  3HKZ N;  2BY1 A;  4BXU A;  2W4S A;  3T8T A;  2QYO A;  3A4C A;  1RKT A;  2X6X A;  3CCQ I;  2XGD A;  3AL0 C;  3MQ0 A;  3FIS A;  2JJ7 A;  5E79 C;  2ME0 A;  3L00 A;  2DOA A;  1TP4 A;  2PMU A;  4PFP A;  4CO8 A;  4ZYD A;  1WJC A;  1WHU A;  1QPM A;  2DT5 A;  4E7S A;  1RR8 C;  1P4W A;  1D8K A;  2BW3 A;  3R61 A;  2M0C A;  3IAS 2;  2KPM A;  1X19 A;  1I5Z A;  3N05 A;  1EJ9 A;  3ZQQ A;  3SDG A;  3C7J A;  4G94 A;  2D45 A;  2P6S A;  2K9S A;  4XK4 A;  3CCL I;  2X1C A;  3DTK A;  3R6S A;  1P7I A;  3CTA A;  4GGG A;  5AIP A;  5FO5 A;  3ZQC A;  4ITV A;  5JVT A;  1U8R A;  1G2H A;  4IPA A;  3JAM Z;  3LA2 A;  4A3K J;  1UMQ A;  4JX4 A;  3F21 A;  2VOD A;  1FZP B;  1U5T A;  2ZB9 A;  1FMV A;  2Z5U A;  3CCV I;  3GLX A;  1MJA A;  1W1W E;  3BY6 A;  3FMR A;  3H5N A;  1RC9 A;  2K02 A;  2VKH A;  3OYF A;  3H1C A;  1P4A A;  4AIJ A;  1P92 A;  3T0Y A;  3CO6 C;  3GTQ J;  4ZZL A;  3GWZ A;  1KGS A;  2OCE A;  4IL6 C;  1BR4 A;  1A04 A;  1Z77 A;  2JT1 A;  4HLX A;  1HW2 A;  5IT3 A;  4ESB A;  2AXT C;  2IT0 A;  1K4S A;  3CMM A;  4WWC A;  1QGP A;  3LL7 A;  4ZH4 F;  2MLG A;  1T08 B;  4IKF A;  1U6G A;  5GTH C;  3W2A A;  3ABK H;  1R4M B;  4ZDP A;  4A2U A;  5LHI A;  2EIM H;  1O7F A;  2XAJ A;  2OV7 A;  2W48 A;  4JP0 A;  5GPA A;  1AKH A;  1MMA A;  4XOT A;  1MNE A;  4HDV A;  1JTX A;  4I7H A;  1J5Y A;  3DLA A;  3HRT A;  3I55 I;  3WTW C;  3GFI A;  1FTZ A;  3Q0U A;  3OIO A;  2LF7 A;  4BQO A;  2QSG X;  1BL0 A;  4WX9 A;  4MFD A;  4H0E A;  3JRB A;  3S2H J;  1MMD A;  3CUQ B;  5ERI A;  2K9Q A;  3AG2 H;  2WAQ N;  2JK3 A;  5KAI C;  1IRZ A;  3CJR B;  1ZRE A;  2VT3 A;  3CQZ J;  1PUE E;  2JRM A;  4A0Y A;  1JJ8 C;  3JRE A;  3H3V K;  1MBE A;  3D5S C;  3S2W A;  3FBI B;  3KE2 A;  5KHD A;  2O8K A;  3FWE A;  4IQ4 A;  2JVG A;  1YRN B;  1YTY A;  4BHC A;  4A0Z A;  2ETH A;  3K4J A;  4IF4 A;  2P7C B;  1Y8Q B;  3E6B A;  2FMY A;  4QWQ A;  5LBQ A;  1E3H A;  2KLO A;  2ZXH A;  5ICC A;  1BW5 A;  1UZC A;  3JW4 A;  2MYS A;  4IHT A;  5GPC A;  5GTI C;  2KDZ A;  3CMY A;  2E60 A;  2RC4 A;  1B72 B;  2RNJ A;  1LE8 B;  1O7L A;  1XGO A;  4BL0 B;  1J59 A;  2BBY A;  1IRF A;  4C3H J;  1GV5 A;  3CO7 C;  1R5H A;  5B3S H;  4XKW A;  2W57 A;  3HRU A;  3IC7 A;  4PZJ A;  4P5O A;  1RR7 A;  2JPB A;  4AIH A;  3SHF A;  5D8L B;  5GAG J;  2YU9 J;  3EPZ A;  2PN6 A;  2EK5 A;  1N77 A;  2ECC A;  1R5G A;  2JUC A;  5F08 A;  3E1S A;  2QF7 A;  3ABM H;  2EIL H;  1OKR A;  4CZC A;  5BQT A;  3BTI A;  5JFR A;  1BN5 A;  4O5V A;  1X3W B;  1XDS A;  3BQY A;  3W6J B;  2DYR H;  2L3D A;  4XM3 A;  2KZG A;  1WJE A;  2KT0 A;  5ILV A;  3K6G A;  5KAF C;  1FY7 A;  1JGS A;  4LIT A;  2VIX A;  4E70 A;  5D5U B;  2VJ5 A;  2CQK A;  3W2W A;  3CUQ C;  1DUX C;  2XVC A;  1BIA A;  1GXQ A;  3P7N A;  5HS7 A;  4UV8 A;  3GBG A;  4TV7 A;  2ACJ A;  2O7O A;  3FIW A;  1QO0 D;  1BR1 A;  4L0Z B;  1DDN A;  2CQ7 A;  2DA7 A;  3BOQ A;  1LUJ B;  3FXU A;  1ETV A;  1YW9 A;  2XGC A;  3FX3 A;  4RAG A;  3ERM A;  4BU2 A;  3T1B A;  4X6A J;  2GAU A;  2DFH A;  3IWZ A;  1J7K A;  4EJV A;  2RN7 A;  3O6B B;  5JVG F;  4BYY A;  2A3S A;  1YW7 A;  2GQQ A;  2YSR A;  1OJL A;  2WBM A;  4M3B A;  3R0A A;  3JAM K;  1A31 A;  2HVR A;  1H88 C;  4HAM A;  2HOA A;  2V26 A;  3VB2 A;  2DMQ A;  1T56 A;  1ZEL A;  5JHF A;  2PJP A;  2KFD A;  3PFY A;  4FE7 A;  2R7O A;  1VF9 A;  4C3I J;  4IZZ A;  3G73 A;  1UHM A;  4IHX A;  2RQQ A;  3JRI A;  2LTP A;  4E4H A;  3FKI J;  5C3E J;  4CXF A;  1W5C C;  2V9V A;  1OR7 C;  4J00 A;  1T39 A;  2CUE A;  3ZMS A;  2R3S A;  4L0Y B;  1ZLK A;  2DOE A;  2DPD A;  3G71 I;  4N9H A;  1JGG A;  2OTJ I;  2LBF B;  1WPK A;  1S7O A;  2V1X A;  2QLZ A;  3DEE A;  1QHH D;  4MGR A;  1FEX A;  5KNL A;  3H3U A;  2HFH A;  4HDU A;  5DEQ A;  5ICE A;  1RPW A;  3C2B A;  1AWC A;  3O8G A;  2BGC A;  4IRG A;  5EGO A;  3RKX A;  1O3T A;  4CSW A;  2IA2 A;  3B6C A;  1K6O A;  4HNT A;  3SJM A;  4MQ9 F;  2KRC A;  2Z2S B;  2LLK A;  1TNT A;  1VZ0 A;  2HU9 A;  1TNS A;  3ERE D;  1HA8 A;  2IGK A;  3NQO A;  1FSH A;  3LSH A;  1W36 C;  2A6T A;  3WTY C;  1FOY A;  3K4N A;  2CWE A;  2R7T A;  3OL3 A;  4XLE A;  1I6X A;  4XKV A;  4D0P A;  2DFE A;  4EJW A;  5FD6 A;  1FTT A;  2XDV A;  1WVR A;  5DS9 A;  3MAJ A;  5B1A H;  2EV0 A;  3EUH A;  4XR6 A;  3OIQ A;  1MSE C;  4R8H A;  3CES A;  2F5E A;  2LYC A;  1SFE A;  1FIP A;  3LST A;  3KYD B;  1G6N A;  2TCT A;  1YHQ I;  3I64 A;  3FM5 A;  4UB6 C;  3VYT B;  1J75 A;  5KK1 A;  4UVC A;  4BJT A;  1YS7 A;  1HSJ A;  2OC6 A;  2I10 A;  1U9O A;  1WH7 A;  1X1P A;  2IBD A;  2KL4 A;  1XD7 A;  3WTS C;  2VBY A;  2QQ8 A;  1ON2 A;  5HOO A;  2ID6 A;  2LRD A;  2V9P A;  3FHN A;  1S72 I;  1MD0 A;  5BOX A;  1PP7 U;  1RKW A;  5EG0 A;  3Q5F A;  3CCY A;  2IGN A;  5F27 A;  3FF5 A;  3AAF A;  4PUS A;  3FK7 A;  1H9T A;  4I01 A;  2ISZ A;  2HQR A;  3WGH A;  3ASO H;  2V9K A;  1BC7 C;  1JXS A;  4YIR X;  2Y48 A;  1IXR C;  2DCE A;  2ZJP F;  1BI2 A;  1TTY A;  2FEZ A;  3GME A;  1LEB A;  1IO2 A;  2NVU B;  1D1B A;  1A6I A;  3VYU B;  4HX8 A;  2O03 A;  4NQW A;  3KYL A;  4XL9 A;  1ODD A;  3VOE A;  2JA6 J;  1FOX A;  1TWA J;  4AD9 A;  5JHU A;  5J1Y A;  3I54 A;  4WCG A;  2L2O A;  2Y0S A;  3U2R A;  5BPI A;  4IX7 A;  3H5R A;  3RPU D;  2DN0 A;  1APL C;  5FFX A;  4MTE A;  3OYK A;  2F48 A;  5CVI A;  1ZG1 A;  1SEU A;  1F4K A;  4EJO A;  4ENK A;  4A3L J;  4XSZ F;  1Z6T A;  5DCM B;  3PO2 J;  3N97 A;  3W6K B;  2V7F A;  3PSF A;  1O3Q A;  4F93 B;  1IW7 F;  2DMN A;  3RYP A;  4BHP A;  3JSO A;  3RCO A;  5GAE J;  3HOU J;  2L0K A;  2L7F P;  4M72 A;  2QA4 I;  1ZQ3 P;  2F5V A;  1JJ6 C;  3WGG A;  1OQY A;  5F0H A;  5D6F A;  2K85 A;  4LLL A;  1WCM J;  4M74 A;  4XN0 A;  2PMZ A;  1OYY A;  2HTS A;  3BWG A;  1J09 A;  4L5I A;  1G59 A;  2WB1 A;  2H27 A;  1JUP A;  2DBB A;  2MAB A;  3VOD A;  2BV6 A;  1R1V A;  3DEU A;  3IWF A;  4OIN F;  2V1U A;  2CFX A;  2WC2 A;  4XKB A;  1W0U A;  4XRM A;  2A5W A;  3ELK A;  4PGG A;  4L9V A;  3BG9 A;  3K4B A;  3ZN1 A;  4U7D A;  2MGQ A;  2OQR A;  3LA7 A;  2Z33 A;  1ZHF A;  1PUF A;  1HDP A;  4B3X A;  2WWY A;  3ZPL A;  3WU0 A;  3V4G A;  3TW7 A;  4ANJ A;  2G7H A;  1WKM A;  1BJZ A;  3FZV A;  3CF5 F;  5F0F A;  2NOG A;  3PUF A;  3QPS A;  4EMS A;  5D5W B;  4LLN A;  4A6E A;  5B1B H;  3N4M A;  3V42 A;  3QOP A;  1BJA A;  2X1D A;  5ED4 A;  1W7P D;  4MEX F;  3SXY A;  3BPX A;  4LG0 B;  3M8F A;  2DFF A;  3SEZ A;  2UZK A;  3S2D J;  1R9T J;  4BS9 A;  1SAX A;  2VN2 A;  3F9K A;  4C2U A;  3JCU C;  1OCP A;  4RGU A;  2QEX I;  2F5D A;  2R5Z B;  2LR8 A;  4GFB A;  2AQE A;  3DCF A;  5D5X B;  1Z3Y A;  1ZRD A;  4RGX A;  3LSG A;  2K3P A;  3SFI A;  3S3N A;  2PG4 A;  2DDA A;  2ZNY A;  1W7P A;  4EQQ A;  2M4K A;  1TQM A;  1Q1H A;  2J5O A;  2WV0 A;  2W25 A;  3L7W A;  2JWT A;  3WE3 A;  2DTZ A;  4O3M A;  3DFG A;  3MMY B;  1YO5 C;  4GDF A;  3BG7 A;  4DQ2 A;  4EGY A;  2IVM A;  3IHU A;  1FBQ A;  2L7K A;  5IP7 J;  4KN7 X;  4IHV A;  4A3G J;  2CG4 A;  3DPL C;  3MEX A;  2STW A;  4AC0 A;  2ESH A;  3OV8 A;  1XMK A;  4BDZ A;  1IV6 A;  4CYC B;  2JA2 A;  1O3R A;  3U1K A;  2XAG A;  1H9G A;  2BZT A;  3W6V A;  4OAY A;  2L9S A;  1Q1V A;  3DU6 A;  2CQN A;  4XLP F;  3ISP A;  2DFI A;  5FRN A;  1T8I A;  3MD2 A;  2QBY B;  3NAU A;  4CYD A;  2W24 A;  4U0V A;  4A3M J;  3E6C C;  2AS5 F;  2AHQ A;  4A3F J;  3OOU A;  1B1B A;  2DLL A;  4HF0 A;  3OS0 A;  1QRY A;  1FYL A;  2NVY J;  4Y17 A;  2PJR A;  3HOT A;  2QVO A;  4UY8 I;  4IJA A;  4KMU X;  1YIT I;  4OMZ A;  2X85 A;  4XON A;  4IO9 F;  1L0O C;  4G7O F;  2R5Y A;  1ZAR A;  2EV5 A;  3V8L A;  4CCK A;  5DCF A;  2IS4 A;  2H1L A;  3P9K A;  3PFI A;  5CVR A;  2ZJR F;  5B66 C;  5GAH J;  2VOP A;  2R7D A;  4E7Z A;  3FDY A;  3L2C A;  1UG0 A;  2VJI A;  4DYR A;  2HZT A;  4B48 A;  3PNT A;  4DZP A;  2VBW A;  3ROU A;  1K79 A;  1JHF A;  2Y0M A;  1N75 A;  3IKT A;  2E35 A;  4E6K G;  3ECH A;  3OYB A;  5E17 F;  3F22 A;  2CQQ A;  4WF2 A;  3BDD A;  5BS6 A;  3I4M J;  1BA5 A;  2XSJ C;  2RRE A;  3KP3 A;  5DM7 F;  3HEF A;  2QEN A;  1SD5 A;  4II2 A;  2XPU A;  1SVO A;  3HJE A;  3WTZ A;  2XF7 A;  1CQT A;  4XLA A;  1OPC A;  1X4P A;  2HYG D;  3S17 J;  4Y33 A;  3KP4 A;  3I0T A;  1LFP A;  4N4N B;  4BE1 A;  4AIK A;  1MKM A;  1ZTR A;  4G9Y A;  3WTV C;  1NG6 A;  1BM9 A;  2NVT J;  3FMQ A;  1XDU A;  2W7N A;  3HUG B;  4G6D A;  3VEP A;  3V8J A;  4UUV A;  4II3 A;  1Z91 A;  3C18 A;  2PLY A;  4XLF A;  1P2F A;  2EZL A;  1OLT A;  5LEJ A;  2HVQ A;  4FE4 A;  4YFN F;  3DP7 A;  3QYE A;  5EEG A;  5BPD A;  1IN5 A;  3IAM 2;  3CCM I;  5HDG A;  3K2Z A;  2DK5 A;  4KIB A;  2HPI A;  3CF2 A;  2VQG A;  3JRH A;  3U21 A;  1OCR H;  2CV0 A;  5GAD J;  2GXG A;  5FFZ A;  3J7Y J;  5HVQ C;  3U1D A;  4C9Y A;  3WTX C;  3M1E A;  1NK2 P;  1JTY A;  2DK8 A;  3VYS B;  2CGP A;  2DA4 A;  4BAY A;  1EA3 A;  2RKH A;  3QRF F;  4AWX B;  2ELK A;  2XB5 A;  4LIV A;  1AA7 A;  1HW1 A;  2ZO4 A;  3A2K A;  1ENH A;  2EPF A;  3IRR A;  3RI4 A;  4F3Q A;  3CDL A;  1LPQ A;  3GO5 A;  3LSR A;  3QYF A;  2ZXW H;  3ZQ7 A;  2OJE D;  2E7X A;  3KZY A;  5L3F A;  3EDP A;  2NS7 A;  1IN7 A;  3PNV A;  1G8X A;  2HQ5 A;  3EUA A;  2KKO A;  3ULQ B;  1GUU A;  2K9M A;  1ZN2 A;  4OU0 A;  4IHW A;  2VON A;  1HQC A;  4GXO A;  2XAS A;  1IXC A;  5E8G A;  4HSR A;  1XCB A;  4IOC F;  1X4O A;  5DDG A;  1WJB A;  3DBR B;  3RJP A;  2MH2 A;  2RV8 A;  1HDD C;  5FGM A;  3HOY J;  3HGY A;  3TKY A;  2KHM A;  3OMY A;  2X6O A;  3QP5 A;  1DP7 P;  1X1D A;  5E20 A;  4DZJ A;  1VQK I;  1FP1 D;  5H6Q A;  2VKE A;  2FOW A;  3MZ8 A;  1PYV A;  1B9M A;  2B9S A;  1CF7 A;  3CCU I;  2O6G E;  3I59 A;  4KFC A;  3BG5 A;  2HQN A;  2IPQ X;  3DF8 A;  3TMO A;  3H9G A;  3OL4 A;  5B5E C;  3LSM A;  1B8I A;  1P9Q C;  1U78 A;  5C4X J;  2FD5 A;  4XID A;  5ICG A;  1ZG5 A;  4O6J A;  5D4R A;  1YE9 A;  2O61 A;  1VTN C;  1B59 A;  5AIQ A;  1KA8 A;  4IHS A;  4A3B J;  3CD6 I;  3L09 A;  3S1Q J;  4IEJ A;  2ZFW A;  1R36 A;  4HPQ A;  1FPQ A;  2UXX A;  3KP6 A;  2M3A A;  5M5Y J;  2Z16 A;  3I3L A;  3HL2 A;  1BIB A;  3LFU A;  3ZMU A;  4RM2 A;  4Y7N J;  2LF8 A;  2CMP A;  2E34 A;  4HNU A;  2XF6 A;  3DWL E;  3M9A A;  2HVS A;  3MZY A;  4OIR F;  1EV7 A;  2ADU A;  2XAU A;  3G3Z A;  1SVM A;  4NBQ A;  3VFZ A;  3A1Y A;  5CQG A;  2RVC A;  4B43 A;  1ZGW A;  1YW8 A;  5M5X J;  3KEQ A;  3MKW B;  2EFQ A;  4X0G A;  4BDY A;  3CUO A;  2HDD A;  3K10 A;  3WGI A;  1TW2 A;  2FF4 A;  3JTH A;  1KU2 A;  3HPG A;  2KP6 A;  2FA5 A;  3GXO A;  4CCO A;  4I6Z A;  2AXL A;  5LEK A;  3AFH A;  1UG2 A;  3BJA A;  1KZH A;  4RAZ A;  3CP8 A;  2BVL A;  2IW5 A;  4AYB N;  5DD4 A;  1C0W A;  2ZNZ A;  2Y0S N;  3HRM A;  3W2V A;  4ZYH A;  1YJ9 I;  1N25 A;  3FKJ A;  1R00 A;  2XAH A;  5EEH A;  2EA2 A;  4HEA 2;  4EVI A;  1ZRF A;  3ZOB A;  3L1P A;  2X9D A;  4D9J A;  3WHC A;  1VFC A;  2FBH A;  3BZC A;  3HRS A;  5KVR A;  1UHW A;  3ZQI A;  4CCM A;  1OCO H;  2BEO A;  1OMI A;  3LFK A;  5L3C A;  3O8H A;  3BCB A;  5GP9 A;  3SZP A;  3DLL F;  4XBF A;  1UJ8 A;  3K1N A;  4ENJ A;  2HYJ A;  3EUK L;  3R60 A;  2G0E A;  3MVP A;  3WG7 H;  4V19 K;  1MZB A;  3CC7 I;  4FAS D;  3E5X A;  1B9N A;  3ABT A;  2K5C A;  3CDH A;  1MMS A;  2R7X A;  1QVU A;  5J47 A;  2HWV A;  2PMZ N;  4KN4 X;  1LQ1 A;  1I27 A;  3WOD F;  1A5J A;  1V54 H;  4UUS A;  1XGN A;  1WSU A;  1S29 A;  3CCJ I;  2WB1 N;  2HKX A;  1ZGA A;  2DOF A;  4HST A;  1Y1W J;  2MSY A;  3FXQ A;  3P9I A;  4IXA A;  1D5V A;  2O0Y A;  1H8A C;  1H89 C;  1EF4 A;  3O2P E;  2K7L A;  4M6V A;  5C4J J;  1XSX A;  2W82 A;  2E5Z A;  3G1O A;  1OCC H;  1Y0N A;  2FE3 A;  2LDU A;  1QZZ A;  2IS1 A;  4P9U A;  1KON A;  3DTI A;  5IYB J;  3FXO A;  1V3F A;  1IXS B;  2CW7 A;  2NVX J;  3M7G A;  4QSH A;  2FUG 2;  1SAN A;  2DA6 A;  2FJ1 A;  4U87 A;  3T5X A;  2Q2E B;  5CVU A;  5ILU A;  1BOA A;  4I2O A;  2ID3 A;  1LKX A;  1G3T A;  4DBR A;  2Q8K A;  3A01 A;  4NQW B;  3BCA A;  1TT5 B;  3K7A J;  4UUT A;  4UVA A;  2ZME B;  2L7M P;  4J19 A;  1R22 A;  1R23 A;  4BKX A;  4CZZ A;  4I98 B;  2E5N A;  2FBI A;  2V4J C;  3GZ5 A;  3PM1 A;  4BBR J;  1KQ8 A;  1ZR2 A;  4NB5 A;  4AID A;  3F8B A;  2TRT A;  3K1M A;  4RLQ A;  2C6Y A;  2EIK H;  4DIQ A;  3TO7 A;  2CO5 A;  2KJC A;  5J6X A;  1IN8 A;  3DEW A;  3V7S A;  1LB2 A;  1V5G A;  2E7W A;  2HR3 A;  3L2V A;  2W84 A;  2L9V A;  2KQR A;  1S9H A;  1RZ4 A; 
#chains in the Genus database with same CATH homology
 1APL C;  3RZO J;  2E1O A;  5IOZ A;  3IV5 A;  3E7L A;  3TP3 A;  4A3L J;  1T33 A;  2JN6 A;  5C44 J;  4A3D J;  5FKL A;  2O9L A;  3PO2 J;  1ETW A;  1MBG A;  2ECB A;  2DMN A;  1X58 A;  3GTL J;  3TW6 A;  3HOU J;  2L0K A;  2L7F P;  1MSF C;  1ZQ3 P;  1JJ6 C;  1HCR A;  5F0H A;  3S1M J;  2CRG A;  2LFB A;  1WCM J;  2DMP A;  3HM5 A;  1X2M A;  3RQI A;  1JUP A;  2YS9 A;  2XRL A;  5EZG A;  3HGG A;  2XB0 X;  3BR0 A;  5IPA A;  1PUF B;  3Q0V A;  1W0U A;  4XRM A;  4AUX A;  4FCY A;  4MFE A;  2DA2 A;  3BG9 A;  3H0G J;  4JYK A;  1MBH A;  4XRS G;  3GTJ J;  1HF0 A;  2NS8 A;  4QIW N;  2MGQ A;  4C2M J;  4D5C A;  2CU7 A;  1O4X A;  1PUF A;  1HOM A;  5EGO B;  1ETY A;  3TW7 A;  5E3M A;  1BJZ A;  4FIS A;  1VI0 A;  3B6A A;  1IGN A;  5F0F A;  2NOG A;  2QCO A;  2RAE A;  3D1N I;  3QPS A;  2JA5 J;  2DJN A;  3LSJ A;  1VND A;  3M4O J;  5FKO A;  1RES A;  5M5W J;  2LD5 A;  2ME6 A;  2H8R A;  3M3Y J;  3S15 J;  3HB9 A;  2OF7 A;  4IHY A;  2EQR A;  3S2D J;  4MIM A;  2VUM J;  1R9T J;  2B63 J;  2HXI A;  1ZK8 A;  3MKL A;  3Q3S A;  1OCP A;  1WGX A;  2R5Z B;  2NVQ J;  2LR8 A;  5J1R A;  4GFB A;  5FKM A;  2EZH A;  3DCF A;  4DYC A;  4A3J J;  3JR9 A;  3LSG A;  5J3L A;  3SFI A;  1SFO J;  3HBL A;  2K9N A;  5DTD A;  1LFB A;  2AO9 A;  1WI3 A;  1ETO A;  4M3G A;  2JWT A;  5EG0 B;  2DTZ A;  3RKQ A;  5FKN A;  3A01 B;  1JKR C;  3GTM J;  1X2N A;  1ZR4 A;  1MBF A;  2CUF A;  3JRG A;  1FIA A;  2E19 A;  2R7Z J;  5IP7 J;  1I6H J;  1YRN A;  1GVD A;  4IHV A;  1QVT A;  4A3G J;  4AC0 A;  3GTK J;  1MNM C;  4A93 J;  1U8B A;  2D5V A;  1IV6 A;  5M3M J;  4CYC B;  3G1L A;  2HOS A;  3HKZ N;  3S1N J;  3W6V A;  2COB A;  1RKT A;  3OSG A;  1Q1V A;  4BY7 J;  2XGD A;  1ETX A;  3FIS A;  4S0H B;  2JJ7 A;  3NAU A;  2ME0 A;  1POG A;  1LE8 A;  1ITY A;  1QPI A;  1IJW C;  4A3M J;  2GLO A;  2AHQ A;  4A3F J;  3OOU A;  3JRF A;  1ZKG A;  4B3A A;  3JRC A;  1JKQ C;  4XIC A;  3VPR A;  1QRY A;  1IDZ A;  4MLO A;  1K83 J;  2NVY J;  5K7F A;  2XSD C;  2JMW A;  5EZH A;  3IH4 A;  2M0C A;  3MN2 A;  3GTO J;  4QTR A;  1JKO C;  3F0C A;  2R5Y A;  1Y1V J;  3SDG A;  2HOT A;  5BNG A;  2DMT A;  2K9S A;  4XK4 A;  2DMU A;  2IEK A;  1TWG J;  4DYR A;  1P7I A;  3ZQC A;  1RET A;  5HOD A;  4DZP A;  1G2H A;  4JX6 A;  2GBY A;  3HOW J;  4A3K J;  1UMQ A;  2Y30 A;  4JX4 A;  2ZB9 A;  2CQQ A;  3I4M J;  1BA5 A;  1BW6 A;  2P81 A;  4C3J J;  4V2G A;  2M9H A;  3IH2 A;  3HEF A;  4D7N A;  2EH3 A;  2XPU A;  3GTQ J;  5IP6 A;  2M8G X;  1CQT A;  5F04 A;  1MBK A;  1WH5 A;  1DU0 A;  3HOZ J;  2EZI A;  1Z77 A;  4M3E A;  3S17 J;  2WV1 A;  4B1R A;  1TWH J;  2HI3 A;  1ZTR A;  3Q0W A;  3K2A A;  4RDU A;  1D5Y A;  3NAR A;  2NVT J;  4V2F A;  2Y31 A;  2W48 A;  4JP0 A;  1LFU P;  5GPA A;  1AKH A;  1GDT A;  3OSF A;  2DA5 A;  2E2H J;  4W97 A;  2L9R A;  4EEF G;  1JTX A;  2EZL A;  3BG3 A;  4FE4 A;  1FTZ A;  3Q0U A;  1IUF A;  2VPR A;  3OIO A;  1I50 J;  1BL0 A;  4MFD A;  3BR1 A;  3JRH A;  3JRB A;  3S2H J;  2Y2Z A;  1JKP C;  3S16 J;  3LNQ A;  2K9Q A;  3FK6 A;  2EBI A;  1E3O C;  2WAQ N;  2JK3 A;  1IRZ A;  3CQZ J;  3H3V K;  1JJ8 C;  3JRE A;  1MBE A;  1NK3 P;  3BT9 A;  5EDN A;  1NK2 P;  1JTY A;  1TWC J;  2O8K A;  3QQA A;  2DA4 A;  4ABZ A;  1YRN B;  1F43 A;  2XGE A;  2ELK A;  2XB5 A;  4BY1 J;  4A3C J;  1ENH A;  1HLV A;  1FJL A;  1ETQ A;  3CDL A;  2R93 J;  1BW5 A;  3LSR A;  4RBO A;  1ORK A;  5GPC A;  2KDZ A;  3GTG J;  3CMY A;  2NS7 A;  1B72 B;  2FX0 A;  1LE8 B;  2HQ5 A;  2N8G A;  1GUU A;  4C3H J;  1GV5 A;  2XPW A;  5F1J A;  4I76 A;  4IHW A;  1XC5 A;  1DU6 A;  3RZD J;  1AHD P;  2MG4 A;  1IG7 A;  3BR2 A;  1B72 A;  4G12 A;  1RR7 A;  2YU9 J;  1HDD C;  2R92 J;  3HOY J;  3HGY A;  2ECC A;  4MO7 A;  5F08 A;  5IOY A;  2X6O A;  2QF7 A;  2R5Y B;  5E3N A;  4DZJ A;  4BBS J;  2LK2 A;  1S7E A;  3A02 A;  2VKE A;  3BTI A;  4A69 C;  3BQY A;  3BG5 A;  2HXO A;  5F0C A;  2KT0 A;  3IH3 A;  1B8I A;  1UHS A;  3BTJ A;  1U78 A;  5C4X J;  2VI6 A;  4L5E A;  3BR6 A;  3UKG A;  2FD5 A;  5FJ8 J;  2XPV A;  4XID A;  2Y9Y A;  3A03 A;  1XS9 A;  1K61 A;  2DA3 A;  2LVS A;  5IP9 J;  3TED A;  5EEA A;  5FLV A;  1GV2 A;  4A3B J;  3S1Q J;  2JA7 J;  5FLM J;  3GBG A;  4IEJ A;  2O7O A;  3BQZ A;  3FIW A;  4FTH A;  2CQX A;  1OFC X;  4DYQ A;  2DA7 A;  3S14 J;  1ETV A;  5M5Y J;  3LSP A;  1JT0 A;  2XGC A;  3JRA A;  4NDL A;  3JRD A;  4Y7N J;  1I3Q J;  4X6A J;  1MBJ A;  3BTC A;  1OJL A;  5K7Z A;  4M3B A;  4M3D A;  3LOC A;  1H88 C;  9ANT A;  2HOA A;  1ZGW A;  1AKH B;  4X1E A;  2DMQ A;  2IAI A;  2M34 A;  1T56 A;  2OPT A;  5M5X J;  3HOX J;  1NTC A;  4DW6 A;  3ZQF A;  2HDD A;  4FE7 A;  2JA8 J;  2YUS A;  1VF9 A;  4C3I J;  2VKV A;  1IC8 A;  3ZQL A;  4IHX A;  3JRI A;  2LTP A;  1P7J A;  3FKI J;  5C3E J;  5E3L A;  1IDY A;  1F36 A;  2CUE A;  4I6Z A;  1UG2 A;  1AU7 A;  2LY9 A;  5EF6 A;  5J1U A;  1JGG A;  3HDD A;  2M2E A;  2GM4 A;  2K40 A;  1WPK A;  4AYB N;  5JLX A;  3QPL A;  2Y0S N;  4XRS A;  3PO3 J;  2FQ4 A;  1FEX A;  2R0Q C;  2X48 A;  2L7Z A;  3ZOB A;  3L1P A;  2X9D A;  4A3I J;  4W1U A;  3WHC A;  1W0T A;  1VFC A;  1RPW A;  3C2B A;  1TC3 C;  2CJJ A;  3ZQI A;  4Y52 J;  3O8G A;  4D5F A;  4BXX J;  1MH3 A;  3O8H A;  4UUS B;  3G1M A;  5FKK A;  5GP9 A;  3ZQG A;  4HNV A;  5EGO A;  2HYJ A;  2G0E A;  3B6C A;  3MVP A;  3SJM A;  5IYC J;  2LLK A;  5EYR A;  5E3O A;  4B4C A;  2DA1 A;  3S1R J;  2E2I J;  1QVU A;  3HOV J;  4LOC A;  2Y9Z A;  2PMZ N;  1A5J A;  4UUS A;  2WB1 N;  1Y1W J;  2MSY A;  1FTT A;  5DS9 A;  1H8A C;  1H89 C;  1MSE C;  2LKX A;  1EF4 A;  4A3E J;  4M6V A;  5C4J J;  1FIP A;  3TP0 A;  3GTP J;  3G1O A;  2TCT A;  3ZQH A;  2LP0 A;  3BR3 A;  2R5Z A;  2H1K A;  4M3F A;  3WHB A;  2I10 A;  1U9O A;  1WH7 A;  2IBD A;  2MW8 A;  5IYB J;  1GT0 C;  1XG1 A;  2NVX J;  2ID6 A;  4QSH A;  1ETK A;  1SAN A;  2DA6 A;  2EZK A;  2FJ1 A;  1OCT C;  1JT6 A;  1RKW A;  5EG0 A;  1JUS A;  2ID3 A;  3CCY A;  5F27 A;  3BTL A;  3I4N J;  1B8I B;  3FK7 A;  3A01 A;  1MH4 A;  3K7A J;  4UUT A;  2L7M P;  4J19 A;  1JUM A;  4BKX A;  1TWF J;  4JX5 A;  3PM1 A;  4BBR J;  1ZR2 A;  1A6I A;  1Z0X A;  2TRT A;  4CYC A;  5K7H A;  5JLW A;  2JA6 J;  4D7M A;  1TWA J;  5IYD J;  3BR5 A;  3DEW A;  1U9N A;  5J1Y A;  5M3F J;  2E2J J;  1HDP A;  2DN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...