2VUMJ

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2vumJ00
1NTCA 3BTCA 3BQZA 4AUXA 5FKNA 5M5YJ 1RKTA 4A3IJ 4ABZA 2D5VA 3ZQIA 1MBKA 1BW6A 1JTYA 5F27A 3GBGA 1FTTA 1HF0A 1FIPA 2K9NA 2NVQJ 2CU7A 1B8IA 1LE8A 1FEXA 2E19A 2TCTA 1VFCA 2HOAA 2X6OA 3MN2A 3D1NI 1JKPC 3BR2A 3LSGA 4DW6A 2EZHA 2CJJA 1ETXA 2HXIA 2OPTA 2P81A 5E3MA 2E2IJ 1U9NA 1WI3A 2N8GA 3MKLA 4A69C 1IGNA 5DTDA 1F36A 1ETVA 3BT9A 2XGEA 3HDDA 3BTJA 4A3FJ 5F0FA 3Q0VA 1K83J 2JA8J 1K61A 2AHQA 2XGDA 3MVPA 1FJLA 4XK4A 3HOXJ 9ANTA 4XICA 1RPWA 2E2JJ 1JUMA 1I50J 1WCMJ 2M0CA 1NK3P 4QSHA 3IH3A 5EGOB 3JRHA 1RKWA 3PM1A 3B6AA 2DA1A 1JUPA 4JX4A 3HKZN 1IRZA 2YU9J 4IHYA 3HOWJ 1WH7A 1TC3C 5IPAA 3CQZJ 1Y1WJ 4A3BJ 3JREA 5JLXA 2EZLA 1HDPA 3LSRA 3E7LA 1H88C 1BW5A 2LTPA 3CDLA 1JJ6C 2HYJA 5FLMJ 1W0UA 1I3QJ 3JRGA 2K9SA 3A01B 1HOMA 3W6VA 2B63J 5F08A 2M9HA 3GTJJ 2FX0A 4AYBN 5JLWA 2Y0SN 2VPRA 4XRSA 2E2HJ 3Q3SA 4A3EJ 1WH5A 2DMUA 3OOUA 3HGGA 2XPVA 1DU0A 3BR1A 3H3VK 3L1PA 2EH3A 1B72B 4W1UA 3GTGJ 5EG0B 1A6IA 4JX5A 2XRLA 5BNGA 1YRNA 4M3DA 1OCPA 1Z0XA 2DN0A 1BA5A 1ZR4A 3FK7A 3A01A 4A3JJ 5E3OA 2HXOA 2LD5A 4NDLA 3OIOA 2YUSA 2M2EA 5EEAA 2G0EA 3WHCA 1TWFJ 5F0CA 3K7AJ 1NK2P 4CYCB 3S14J 4JX6A 1MBHA 3BTIA 3LSJA 3TP0A 1GV2A 2DJNA 3TW7A 1IC8A 3K2AA 2JK3A 2CUEA 4D5FA 1B72A 3RQIA 4D7MA 2COBA 2DMQA 4S0HB 1ETYA 5EG0A 1B8IB 5K7FA 4LOCA 3FIWA 5EZHA 1JUSA 2HI3A 4MLOA 1LFBA 1P7IA 3ZQLA 2DMPA 1APLC 2R93J 2JMWA 4BBSJ 4HNVA 4CYCA 2DA7A 3RZDJ 2XB5A 3BG5A 3S1RJ 1RR7A 2FQ4A 2CUFA 5EYRA 1ZKGA 3BG9A 3S17J 3CCYA 3JR9A 3JRIA 4XRMA 1ENHA 1XG1A 1MSEC 2R5ZB 3B6CA 3JRBA 1OCTC 5FKOA 1S7EA 4RBOA 2HDDA 1P7JA 2VKVA 3O8GA 2O8KA 1ETKA 3JRCA 5F1JA 4A3LJ 3FISA 2O9LA 1D5YA 1U78A 5EF6A 3PO2J 2M34A 1DU6A 1ZR2A 2LY9A 2EZIA 4BY7J 2YS9A 5GPCA 3I4MJ 4I6ZA 1HLVA 1JT0A 1U8BA 2DA4A 3S1QJ 2WAQN 4MIMA 3TW6A 2R5ZA 4JP0A 5IYCJ 1OJLA 4UUTA 1OFCX 1QPIA 4M3EA 1TWAJ 1LFUP 3BG3A 4Y7NJ 4IHVA 2QF7A 3GTLJ 2GBYA 3S16J 5GPAA 1H8AC 2DMNA 2VKEA 1AKHB 2NVTJ 2CRGA 2RAEA 3HGYA 2XSDC 4V2FA 2MG4A 1BL0A 2ELKA 3Q0UA 1VNDA 3DEWA 3BR6A 4DZPA 1TWGJ 3BR5A 3LSPA 3IH2A 1RESA 5E3LA 3ZQFA 1ZK8A 5F04A 5GP9A 3HOUJ 4FISA 2H8RA 3BR3A 5J1RA 3S1MJ 4C3HJ 3S2HJ 1ETQA 4A3CJ 2PMZN 4BKXA 3OSFA 3M3YJ 5FLVA 2JA7J 1XC5A 4M3GA 1YRNB 2LFBA 1UHSA 1AKHA 1TWCJ 1QVUA 2EZKA 4M3FA 2EQRA 3H0GJ 4QIWN 5IP9J 3RKQA 2I10A 2FD5A 4IEJA 5M5WJ 2Y30A 2ME0A 2MGQA 3HM5A 4DYRA 4I76A 2LP0A 5C3EJ 4MFEA 1Y1VJ 1MBFA 2LLKA 1QRYA 3HEFA 3WHBA 2LVSA 3GTQJ 2DTZA 3SFIA 4B1RA 4GFBA 4A93J 1VF9A 2H1KA 3LOCA 4IHXA 3BTLA 5J3LA 2R5YA 2NS8A 1H89C 1IDZA 3UKGA 2TRTA 1GVDA 3HBLA 3O8HA 3ZQCA 3ZOBA 2Y2ZA 4EEFG 2L9RA 1GV5A 1X2NA 4B4CA 1Z77A 2LR8A 1UMQA 3A03A 2DA5A 2Y9YA 2K40A 1XS9A 5FJ8J 2JN6A 3I4NJ 4UUSB 3M4OJ 2Y31A 4BXXJ 2WV1A 5FKLA 4FE7A 2LKXA 2QCOA 4X6AJ 1ZGWA 2JJ7A 4C2MJ 4D5CA 2HQ5A 1ETWA 1JT6A 2K9QA 4QTRA 2FJ1A 2W48A 2LK2A 3FK6A 3TP3A 2L7ZA 2X9DA 2XGCA 1BJZA 4JYKA 2L7FP 2R0QC 2XPWA 5F0HA 2IEKA 4V2GA 1PUFB 4A3KJ 2GLOA 4Y52J 4UUSA 1F43A 1ETOA 4FE4A 1MBGA 1ZTRA 2L7MP 1CQTA 3QPLA 5FKKA 3VPRA 5DS9A 3LNQA 1FIAA 3IH4A 3JRFA 1MH4A 2NVYJ 3BR0A 4L5EA 1TWHJ 4MO7A 4XRSG 1JKQC 2ECCA 1ITYA 3S2DJ 3SDGA 3NARA 3F0CA 5M3FJ 4MFDA 5IYBJ 2HOTA 1JJ8C 2AO9A 1IJWC 1JKOC 4W97A 2ID6A 4C3JJ 2X48A 1AU7A 4AC0A 5IOYA 1ORKA 3FKIJ 4DYQA 1PUFA 5K7HA 3SJMA 1SFOJ 3DCFA 3NAUA 2OF7A 5EZGA 4FCYA 5IP6A 2ME6A 1IUFA 2VI6A 3HB9A 3QPSA 1WGXA 2M8GX 4B3AA 5HODA 4FTHA 3G1MA 3G1OA 4A3GJ 2WB1N 4BY1J 2ZB9A 4M6VA 1FTZA 1ZQ3P 4D7NA 5K7ZA 2Y9ZA 5IYDJ 3OSGA 2VUMJ 3QQAA 2DA6A 1HDDC 1HCRA 5J1UA 2XPUA 3TEDA 2MSYA 1EF4A 4J19A 2NVXJ 5C4XJ 3JRDA 3IV5A 3GTKJ 2CQQA 2IBDA 1VI0A 4C3IJ 1MBJA 2KT0A 1MH3A 4DYCA 2R5YB 4DZJA 3Q0WA 2IAIA 4IHWA 1X58A 5IOZA 3G1LA 1Q1VA 2XB0X 3A02A 3GTMJ 5FKMA 1IG7A 1POGA 1UG2A 3ZQGA 4XIDA 1R9TJ 2JA6J 5EGOA 2CQXA 4RDUA 2HOSA 1U9OA 4A3MJ 1MSFC 5M5XJ 3GTPJ 1E3OC 2ID3A 3S15J 2ECBA 4BBRJ 5C4JJ 2MW8A 4M3BA 2DA3A 1JGGA 3CMYA 3PO3J 5EDNA 3GTOJ 2EBIA 2L0KA 4G12A 2NOGA 1MBEA 1GT0C 1T33A 1I6HJ 3HOYJ 5IP7J 1A5JA 3HOVJ 2R7ZJ 2R92J 2NS7A 4X1EA 1GUUA 3JRAA 3S1NJ 2DA2A 5J1YA 3C2BA 1X2MA 1IV6A 2DMTA 2O7OA 2E1OA 1JTXA 3BQYA 5E3NA 1AHDP 2JWTA 1SANA 2KDZA 1W0TA 1GDTA 4A3DJ 5C44J 1T56A 2GM4A 1JKRC 2JA5J 1LE8B 3HOZJ 5M3MJ 1WPKA 1RETA 1O4XA 1MNMC 3RZOJ 1QVTA 1G2HA 1IDYA 3ZQHA
chains in the Genus database with same CATH superfamily
3K10A 1NTCA 3BQZA 4AUXA 2J5OA 5M5YJ 4CHUA 1KQ0A 2VN2A 2FXAA 2WC2A 4RGRA 1USSA 2RQPA 1YTYA 1O7FA 2RN7A 1JTYA 4HF2A 3GLXA 5LFAA 1RI7A 2BY3A 4EM0B 3FXMA 2J5PA 3P9IA 3OS0A 2K86A 3HRMA 1O3SA 3GCMA 1VFCA 3QOPA 3TQNA 2D2WA 3M8FA 1JKPC 2BY0A 3BR2A 4KIGA 4DW6A 2EV6A 3W6JB 1FZPB 3OYFA 1ETXA 2HXIA 2RGVA 2W1OA 2F6CA 3VEPA 1IGNA 2HQNA 4HLXA 1ETVA 3BT9A 1MNDA 2R7TA 1WJ5A 5L3FA 3R0AA 4GO1A 2YX4A 1K83J 2ZJQF 3CCSI 3HUGA 1D1AA 3MVPA 1Z1DA 2P6SA 1W7PD 2LY2A 2PG4A 9ANTA 1E0EA 3P5JA 2A61A 1RPWA 1I50J 2M0CA 2V79A 1NK3P 2ISZA 4QSHA 1N77A 2ESNA 4XLEA 5B1AH 2DA1A 2K3PA 2M7AA 2K4JA 4M9ZA 2Y48A 3OYLA 1WQ2A 2GXBA 3AFHA 2NYXA 2XF7A 3CQZJ 3K6GA 2BVLA 2ZBKA 2EZLA 4YEJA 3VWBA 2JTVA 3QOEA 4FHTA 1HQCA 1BW5A 4CH7A 2X51A 3DTIA 1T8IA 4LD5A 2L5QA 3JRGA 1HOMA 2D1HA 2ZNZA 1I6XA 3FBNB 3FMQA 1BI2A 1HKTA 1ZLKA 5F08A 3GTJJ 1FP1D 2Y0SN 3Q3SA 4HEA2 1RZ4A 2A69F 3T8TA 5KCMA 3PFIA 2DMUA 4DBQA 2XPVA 3ZPLA 1MIJA 3BR1A 3L1PA 4HSTA 3OS1A 3TL4X 4WXDA 5EG0B 3IL2A 2ZSHB 1FYKA 2XRLA 1V5GA 4EJUA 2VQLA 1BA5A 4G9YA 1I1SA 1BIBA 2FMYA 2O8XA 4U88A 4EM1A 5E3OA 1RC9A 5FRNA 2OQRA 2YUSA 5AIQA 3WHCA 1ZARA 1TWFJ 5F0CA 1NK2P 3AKZA 4KICA 4JX6A 4AVZA 3E6MA 2QVOA 1MBHA 3LSJA 3LQQA 1XPXA 3A0HC 4BE2A 3TW7A 3WU1B 2IW5A 1ZHFA 2PMZA 5TISC 5KAIC 4D5FA 1B72A 1P92A 1KONA 3RQIA 4D7MA 4YIFA 2COBA 1ETYA 4AIDA 2JVGA 2WTEA 3K4BA 3SEZA 5DCFA 3F8NA 3QPTA 5H20A 4CCMA 2KIUA 1MNEA 1APLC 2R93J 4GXOA 4PSXA 4L9JA 2WV0A 2EINH 3W2VA 1T2KA 4BBSJ 5E20A 4I99C 1HSJA 4I7HA 3E5QA 4N0BA 4HNVA 3ASOH 3OYIA 3BG5A 4ITVA 3K70D 1RR7A 2FQ4A 3FX3A 1F1ZA 4PFOA 3CLQA 1LQ1A 2EK5A 5KHDA 2WAEA 4CUGA 4UNOA 1XGMA 1YW7A 1OCTC 2E1MC 3MMYB 1R5HA 2JT1A 3KP2A 4CZCA 3F6OA 4L5IA 5D5VB 4M74A 4EMSA 1XD7A 3WGHA 2CFOA 2O9LA 2PQ8A 3E3VA 1T98A 3C2GA 1FBQA 2LBFB 4NQWB 2PN6A 2DOEA 1BJAA 3PO2J 3DPLC 2E36A 3EUAA 2OV7A 2VT3A 2YR2A 2Q2EA 4ENJA 1DGWY 4BY7J 2YS9A 5GPCA 1DP3A 1QO0D 1JT0A 3S1QJ 3GEZA 1XMKA 1CF7A 2R5ZA 1X1BA 1EH6A 4OAZA 4M3EA 1LFUP 2HU9A 3RSNA 1QBJA 4MEYF 3G71I 4XONA 2E7WA 4ZYHA 1Y39A 1A35A 4LG3A 3OYBA 2RAEA 3FWEA 3V7SA 2XSDC 4V2FA 2MG4A 2WBMA 1BL0A 2M5WA 3Q0UA 1X4OA 4A0YA 4NBQA 2A6HF 3DWLE 1SEUA 3ZQFA 1W7PA 3TDZC 4C2UA 5GP9A 4HQEA 4HX4A 1WJDA 3W6KB 2A5YB 4G7ZF 2EILH 3S1MJ 4C3HJ 3H3ZA 5TRDA 2C6YA 3S2HJ 5K5RA 1EA3A 2EFPA 5FLVA 2JA7J 1REPC 4CICA 3HOSA 1AKHA 2IGOA 3SEQA 2QKLB 2I10A 3K4CA 1S7OA 4JK1X 4E7IA 1LPQA 2K7LA 4IEJA 4P96A 1TNTA 1K7AA 4AIHA 2EFNA 4MFEA 1HW2A 3K1NA 1A6QA 5HVQC 4I2OA 1Y1VJ 2BHYA 1ZRDA 1UHMA 5LGUA 3O3KA 3CLOA 3OL3A 4L0YB 1TLHB 1WJEA 1ODDA 1UB9A 3HXLA 2KJCA 4Y15A 4E7HA 4A93J 1VF9A 1UG0A 1QHHD 3P7NA 2RNJA 1HXDA 5J3LA 2R5YA 1YO5C 3WTUC 3X2QH 4G8XA 4DGWB 5LHHA 3E0JB 3O8HA 3ERED 3ZQCA 1H9TA 3PJRA 5CPRB 2L9RA 2NVUB 1X2NA 6PAXA 1L0OC 1Z77A 2WAFA 3J7YJ 3HHGA 2DA5A 2Y9YA 2L01A 1PYVA 3ABKH 1XS9A 5H2FC 2TDXA 2JN6A 2RQQA 3WTZA 2Z1DA 4BU2A 4BXXJ 3DEUA 3PNVA 1TP4A 4P9UA 1MDMA 2R7SA 2H27A 4C2MJ 2E5ZA 2ZFUA 4D5CA 2UUZA 1Y6IA 4QTRA 1U0JA 2FJ1A 3KZIC 2W48A 2XDVA 3RQ4A 2F5DA 4KYWA 4CYDA 3KFWX 2KP6A 3PQKA 3KEQA 3DKWA 3JAMZ 5HLTA 4I02A 3JAMK 2RREA 5F0HA 4H0EA 4A3KJ 1ON2A 3I4PA 3SQNA 2GLOA 3V8KA 2A5WA 3MZYA 2QSGX 4XKCA 2X6WA 3A1YA 3EQLF 2VQGA 3QAHA 4GGGA 3LNQA 1FIAA 3JRFA 2DTRA 3BR0A 1JI8A 1TWHJ 3P9CA 3VYSB 2CQNA 1YW8A 4MO7A 1HBXG 4L0ZB 3CJRB 1A31A 2ECCA 2L7KA 4ZYGA 3SDGA 2F2EA 2HYGD 5M3FJ 5IYBJ 2HOTA 1JJ8C 4JQFA 4OU0A 1P4AA 1IJWC 3DBLB 2IT0A 2A68F 1AU7A 5J4YA 1K4SA 2VJJA 5IOYA 4KIFA 3H9JA 2OTLI 4B3XA 1KU2A 4O3MA 2WADA 1IRGA 1J7KA 3EUHA 5IP6A 2ME6A 3IRRA 3GXOA 1T38A 4PZJA 4IOAF 3BDDA 2VC1A 2YPRA 4EM2A 4ESJA 3I54A 4CGZA 3KX2A 4I0BA 1S3JA 4A6DA 4A3GJ 1FBUA 1IO2A 3E5UA 4M6VA 4E7ZA 1ZQ3P 3W3CA 4WX9A 5K7ZA 3RKYA 2FMLA 4BH9A 5DM6F 1KGSA 2LSOA 2IA1A 3MKWB 2DO7A 4D0PA 2V1NA 1BR1A 5J1UA 2MSYA 1G3TA 2X1CA 1EF4A 2M45A 2W57A 3CCVI 2NAZA 5C4XJ 1DDNA 3JRDA 3ECHA 3VYTB 4F93B 3GTKJ 2XASA 1WKMA 3K4LA 3OMYA 1MBJA 3FHZA 3G4SI 2VOOA 2KRHA 2EV5A 1Z6TA 4DYCA 3G2BA 4MHGA 2W25A 4M9SA 2IAIA 2V1XA 4IHWA 5D6FA 1X58A 3QWLA 3QU6A 2O03A 1Z7LA 2HVQA 2VT2A 3HC7A 1ZRCA 2DFFA 1G3WA 2NXNB 2JZYA 1QZZA 2XUBA 4LK1F 1Q1VA 4WCGA 3GTMJ 4S04A 4NC8A 1UG2A 4HRIA 4BUPA 3QPHA 1R9TJ 2JA6J 1R22A 4IZZA 2IPQX 4UXNA 2IVMA 5EEGA 2HOSA 2WB1A 4HLYA 1S5LC 2DI3A 2HTSA 2V9PA 3CCEI 3IP4B 2VBWA 2ZMEA 5M5XJ 1UELB 2V26A 4PJNA 2QENA 3M1EA 3J7ZI 1VQ7I 2DLLA 1RUOA 4M3BA 2MD5A 1HW1A 1IXSB 3QU3A 4ZC3A 2FF4A 5EDNA 2JUGA 2UXNA 3GTOJ 4OINF 3WG7H 2ZXWH 3G6EI 4MNUA 1GT0C 3T1BA 1VQPI 2KRFA 4FASD 1XCVA 3M7GA 3S3OA 2G7HA 4LK0F 3HKZA 3LA2A 3HOVJ 2CW0F 4UVAA 1MZBA 3JRAA 3KPHA 1BR2A 3M8EA 1IW7F 1TQMA 4HF0A 2CO5A 3PNTA 3DEEA 2IS6A 2JWTA 1SANA 4D1QA 2HFHA 4XOTA 4A3DJ 4C30A 1PP7U 4Q47A 1C0WA 1FT9A 2JPBA 4XLHA 3I56I 3MZHA 4B44A 2JA5J 1MMSA 2EFOA 5M3MJ 2X6YA 2O5RA 5CKTA 3ABUA 1WVRA 2LKSA 1QVTA 2M87A 4MEXF 1B1BA 2ZXJA 4U7DA 3BPVA 4QPOA 2HZDA 3FXRA 3EYYA 2XHKA 4BACA 1XSDA 3I59B 5FKNA 3IUOA 1X4PA 4ABZA 1U8RA 2D5VA 1OYWA 4CCOA 3G3ZA 3TDUC 2GIZA 3GBGA 1HF0A 3GFLA 3F72A 2MH2A 4M6XA 3HOTA 2K9NA 3HPHA 2W84A 3I55I 2CU7A 3CCJI 2AS5F 1FEXA 2R7VA 2NNYA 3BY6A 1Z3YA 4CSWA 3GO5A 2VKHA 1LUJB 4Y17A 4G7HF 4HG2A 2A6EF 2VJIA 1XDSA 2EZHA 2MLGA 2ZSIB 3L7WA 3KP5A 2BY1A 5E3MA 5L3BA 2N8GA 3MKLA 4KUMA 1SVMA 5DTDA 1ZG3A 3N4MA 2XGEA 2HQAA 4M9XA 3ZMTA 4A3FJ 5F0FA 2Z9OA 4ZJZA 2K85A 2H94A 3AG2H 1P6RA 2XGDA 2AXTC 1FJLA 2R7XA 4ZYDA 1Y0NA 2HEOA 2WY8Q 3KP4A 1OCCH 4CXFA 5LEKA 1U3EM 1JUMA 1WCMJ 1I1GA 3NQOA 2K02A 3OYDA 2CYYA 1RKWA 4HW0A 4NQWA 2QQ8A 5CYVA 4JX4A 2YU9J 3R60A 2FBHA 1OPCA 3GLLA 1LVKA 1YOVB 3CESA 3EDPA 3ONQA 4PSWA 3K4NA 3J81Z 4PFPA 3N97A 2VE8A 5JLXA 5LHGA 2PJRB 1SFUA 2UZKA 3FHNA 2QZ8A 1FP2A 2LTPA 2DT6A 4HF1A 4HPQA 3K69A 5CJ9A 3HL2A 1JJ6C 2IA2A 3OYEA 2CS3A 2A3SA 1IN5A 3CJTB 5FLXZ 4IKFA 3LAPA 4UVCA 2HDCA 3QP6A 2K9SA 3A01B 5FD5A 2Z3YA 1YLFA 2B63J 4ON0A 4PDKA 2EJRA 5KAFC 1E3PA 4A5MA 4AYBN 2VPRA 4M6YA 2PJPA 2L9VA 2VASA 4A3EJ 1Z7UA 1WH5A 3F8FA 4EGYA 2OZ6A 2DU9A 1ZGJA 3U2RA 1R6RA 1BI0A 3HGGA 1Z6RA 3HTUA 3QYBA 2GAUA 3WE3A 4RAFA 4PJMA 3L2WA 1V54H 3RIRA 4LIVA 4IHSA 2BV6A 1WWXA 4IOCF 4M3DA 1OCPA 1Z0XA 2GXGA 3EPZA 1J5YA 3HIFA 3WTVC 2XVCA 1BC8C 2LD5A 2DAOA 3KYLA 5EEAA 2H6CA 2QQBA 2G0EA 4BDZA 1YHQI 4OIOF 4CYCB 4ZH4F 2FEZA 2O3FA 1ZYRF 1GV2A 4Q4ZF 1IC8A 3K2AA 2DQRA 4A2UA 2CUEA 4A0ZA 1UAAA 1FOXA 2XV4S 2A05A 4RS8A 4S0HB 3MKYB 1B8IB 3EETA 4LOCA 5J6XA 2V1UA 1ZELA 2HI3A 1WI9A 4RLFA 1X3UA 1K78B 4IXAA 3CMEI 4UB8C 1YI2I 4A12A 3GMEA 3U1KA 2P0WA 4YELA 1V3FA 2GOMA 3OY9A 5D5UB 3S1RJ 3VYRB 4XORA 5EYRA 2LNBA 3BC8A 4EJWA 1JXSA 4ASNA 2X4HA 3CCYA 3S17J 1HSTA 2UWMA 1IAWA 3B6CA 1IN4A 1S7EA 4XLPF 1WJCA 5HLGA 2P7VB 2BXYA 1WFXA 2VKVA 4CCNA 1SFEA 5E1ZB 2O8KA 4A3LJ 2VJ5A 4LMYA 4HNUA 1ZN2A 1U78A 1WHUA 1RIOH 2FU4A 2STTA 4KDPA 1DU6A 4AVPA 3WTXC 1ZR2A 2LY9A 1J2XA 2JPCA 3OR2C 4LG0B 2OU2A 1T0FC 4RAGA 2BYVE 2ISYA 3TO9A 3WE2A 1XSXA 3PUBA 1HLVA 3LAJA 1U8BA 5DD8A 3RYPA 2KL4A 1XMXA 3KCCA 4N4NB 4JP0A 5E17F 2NRAC 2COMA 2JVHA 3BG3A 4HOBA 4FETA 4Y7NJ 4IHVA 3VODA 3E97A 3WU0A 2QF7A 3GTLJ 1AA7A 4G7OF 1FNNA 3KLOA 5GPAA 2M4KA 2VKEA 2F5EA 3HGYA 1XX5A 4KMFA 2ELKA 4XOPA 3BR6A 3F21A 4DZPA 5L3CA 2OTJI 3IH2A 3BZKA 2CSOA 5HDGA 2I8DA 5F04A 3D0SA 5K5OA 4GCVA 3EYIA 2KMUA 5CQEA 4FISA 2H8RA 4QWQA 3COAC 3KLNA 4HX7A 3LSKA 4A3CJ 2VXZA 4BKXA 3OSFA 2DQLA 3BPXA 5ICFA 4DJAA 3F8MA 3M3YJ 1YRNB 1TNSA 1OCOH 1S8NA 1TWCJ 2EZKA 2EQRA 3RKQA 3ESWB 3ZMZA 4F91B 2V9KA 5D4RA 3LSMA 4KJZA 1FX7A 5LHIA 2MGQA 3H0DA 3HM5A 4DYRA 5GTHC 1H9GA 4I76A 4BHBA 5JI6A 4BNCA 1WRJA 2R3SA 1U5TC 2CMPA 2LLKA 4ZZLA 2EIMH 3ERMA 4R79A 3HEFA 4EATA 3GTQJ 3I64A 4PJJA 4MQ9F 5BMZA 4OIRF 3R4KA 1W36C 2FUG2 2H1KA 1XCBA 3PIOF 3LOCA 2W00A 4BQOA 3L2UA 2QA4I 3K1PA 1H89C 2XROA 3UKGA 4BJTA 2V1DA 5A2QZ 2Y2ZA 3HRUA 2B0LA 3MAJA 2E71A 4BEHB 5A2QK 4R1HA 3JSPA 1EJ9A 3ABTA 2NS0A 2KPMA 1ZLJA 4YFXF 2K40A 3RKWA 2L4MA 1NH3A 2BZTA 3M4OJ 5FKLA 4EQQA 2QCOA 4RB1A 2GIVA 1P9QC 3C2HA 3K0LA 5EEHA 2HQ5A 2HPIA 3H5RA 2K9QA 2XAQA 2X1DA 2BW3B 3KEOA 1F5TA 5HS8A 4IX7A 3CP2A 2M3AA 5HNHA 3BJ6A 2WWYA 2E34A 2PX9A 3BP8A 3CP8A 2KRCA 3KP6A 5JFRA 4UUSA 1T95A 1IUYA 1F43A 1ETOA 4FE4A 3B73A 5AONA 4B48A 4A0XA 4LB6B 1MJBA 2O0YA 5FKKA 5DCMB 1MH4A 1J9IA 2NVYJ 4BJ6C 2ZJ2A 3NWSA 4XRSG 1JKQC 2P5KA 1YX3A 3S2DJ 5E1XA 1ACIA 4U87A 1U5TB 4IHTA 2FBIA 2ID6A 2PMUA 5ICCA 4IPAA 3MEXA 4E6KG 1Y0UA 1LJ9A 1PUFA 5B5EC 5K7HA 5CVUA 2X6XA 3JSOA 3SJMA 1SFOJ 4OAYA 3NAUA 4A6EA 5ED4A 1ULYA 5EZGA 3SZPA 1ZH5A 4NNJA 1IUFA 3QPSA 1WGXA 3A4CA 3H35A 3U9GA 2EA2A 3I59A 2WY7Q 1RUNA 5HODA 1XGOA 4RM3A 3G1MA 5J40A 4F55A 3L2CA 3BJOA 3CC7I 2WB1N 5KK1A 2ZB9A 1FTZA 4RM2A 4NC7A 3KEYA 4GYGA 1YG2A 2Y9ZA 5IYDJ 1UFMA 3OSGA 1Y8QB 2ZXIA 1U2WA 2CUJA 2BBYA 2JRTA 2CQKA 5LBQA 4BYYA 4L18B 4ZYEA 4RAYA 1HDDC 2XPUA 2V9VA 4J19A 5GAHJ 1Z9CA 3IV5A 1JE8A 3ZRGA 2I5UA 4LITA 3MWMA 1B59A 2VB6A 4ZYAA 2HKOA 2IGMA 2L3DA 3C7JA 2DYRH 2HYFA 1AOYA 3CUQC 1UCRA 5LEJA 1QU3A 2EA4A 4E7KA 1TL8A 5FFZA 3A0BC 1D0ZA 1SVLA 4N9HA 4YFKF 3EUKL 1OYYA 2L02A 3A02A 1HC8A 1GVJA 5FKMA 2MA3A 2HKXA 1G6NA 1XN7A 3HSFA 4XIDA 2JSPA 1G4DA 5ERIA 2CQXA 2MLKA 2QGUA 4FX0A 2KZVA 4EJTA 2VC0A 1K4TA 1DP7P 2VONA 3GTPJ 3FXLA 2XAHA 2ID3A 4IRHA 2CG4A 2DXIA 3S15J 2ECBA 5DDGA 5C4JJ 5DUIA 3CCRI 2DA3A 1LEBA 3GZNB 2P5LC 3K4JA 2Q8KA 2PJRA 4U7BA 5FD6A 4G12A 2NOGA 3H9QA 1MJ9A 1WSUA 2CV0A 4KITB 1T33A 1I6HJ 3HOYJ 3FXJA 3IRQA 4RGSA 5L3GA 3OYNA 2CQ7A 2R7ZJ 2R92J 3UNGC 2D45A 3DU5A 2Z5UA 4X1EA 4U0VA 4RB3C 1LDJA 2K3FA 3DLLF 2DA2A 3LQRA 3F8CA 1SAUA 3HSRA 2H09A 3I71A 4YRVA 1E2XA 1NG7A 4UHTA 3K9TA 2DDAA 1RRJA 2O7OA 2E1OA 2R7DA 4II3A 4J00A 1MD0A 2HDWA 4J01A 2KDZA 1BOAA 1GDTA 4HDUA 3MFKA 2HTJA 1T56A 4PCQA 4NC6A 2OQGA 1VQOI 2LY1A 3LSIA 4CO8A 1WPKA 3S93A 2ZXHA 3CZ6A 4KNYA 1RETA 3OYAA 1O4XA 1MNMC 2Y0SA 3VB2A 3ZQHA 4OIPF 3ZCOA 4C2TA 3PL8A 2KQRA 4OIQF 4GRIA 3CUQB 5E18F 4AD9A 1Y8RB 5CVIA 1R58A 2BXZA 4PJLA 2OA4A 1MBKA 3ZQIA 2LREA 4XSXF 1FTTA 2R7QA 3BZ6A 1FIPA 4RGUA 4F92B 1XGNA 3HUGB 2NVQJ 2VODA 1KU9A 4EGZA 1B8IA 3W2AA 2DFEA 1LE8A 1GLNA 1VQ9I 3F6VA 2E19A 4UV8A 2TCTA 3MQ0A 2ESHA 3MN2A 3D1NI 3ZQ7A 3CO7C 2Z33A 1K79A 3LSGA 4BXUA 3CCQI 3CF5F 3F23A 2OPTA 2ELJA 2P81A 2E2IJ 1U9NA 3SFZA 1F36A 4OMZA 3BCBA 2XAGA 3BTJA 4ANJA 5BQTA 3TO7A 3WTYC 1S6LA 2NOJB 1WJBA 1ON1A 3DKYA 2HVRA 5ILVA 2AHQA 3TOBA 1FLIA 1YW9A 2FOWA 2FOKA 2PMHA 1XB4A 3HOXJ 3AG4H 4L9TA 4IO9F 3PSFA 4I09A 2OAZA 4P5OA 1DUXC 3GYHX 3JRHA 3IH3A 4CCKA 2L9SA 3PM1A 2ZC2A 1IRZA 1FMVA 1FOKA 2M0MA 1P2FA 1LDKB 4IHYA 3CDIA 3HOWJ 4M73A 2R7RA 2R7WA 1TC3C 1BOBA 3H36A 1VQNI 2VOPA 2DOFA 1UZCA 4HAMA 1FWZA 1Y1WJ 1XSVA 1F4KA 3S2WA 3CD6I 3LSRA 3E7LA 1D3YA 1H88C 3GFMA 3N05A 4ZDOA 5FLMJ 2DT5A 1YS7A 3WTWC 1WJAA 4ZDLA 3T8RA 5FB2A 2RNGA 2X85A 1QZEA 2F4MB 4P9FA 4EVIA 4OMYA 2FX0A 5JLWA 3GF2A 4E7LA 1R49A 1VZ0A 3TO6A 4XRSA 2E2HJ 4BHPA 4MTEA 4Y3OA 4XRFA 4E7JA 1SMYF 1ZREA 5GTIC 1TT0A 3FMSA 5DYMA 4IL6C 5E79C 2LMDA 3CCMI 3CO6C 4KFCA 2LF8A 3H3VK 3LSTA 1B72B 5JHFA 3GTGJ 3FXKA 4CDGA 4JX5A 3L09A 5KVRA 1YRNA 1WJFA 4UY8I 4A3JJ 2PBIA 3QP5A 4HNTA 5HOOA 3GFIA 5CVJA 4NDLA 3OIOA 3NEUA 3CUOA 2IS4A 2VPLA 4JOMA 3K1MA 3K7AJ 1EH8A 2LRDA 4B8XA 2VE9A 2E1CA 3CC4I 1SC7A 3LWFA 2QEXI 3NRVA 3BTIA 3TP0A 3DU6A 2F4IA 2DFIA 4I01A 4O5VA 3PNYA 4RLQA 4XLCA 1V55H 1HKQA 2JK3A 1W5TA 3H9GA 3AL0C 5D8LB 4B09A 3J7AO 3L9FA 2EPFA 2AQFA 5EG0A 1B4AA 2XC7A 2KZGA 4CA0A 5K7FA 1K6OA 3FIWA 3GVAA 3L00A 3HZJA 3PFYA 1LFBA 1ZRFA 1KA8A 3OL4A 3ZQLA 2DMPA 2JRMA 2V7FA 1TTYA 4AU7A 2ZJPF 2DA7A 1YE9A 2STWA 2XB5A 3I53A 2Q2EB 4BEHA 3TMOA 3IKVA 2DPDA 3ELKA 1T39A 3DBRB 1VQ5I 4E4HA 3BG9A 4IRGA 3JR9A 1YQAA 1I3AA 4BJ5C 2KJBA 3R0JA 1XG1A 1CF7B 2R5ZB 1R23A 3ABMH 1FPQA 5FKOA 2L9NA 2HDDA 3JRCA 5J8CA 1D5YA 3C18A 2MC4A 1X1DA 5D4SA 2BW3A 4C9YA 5HDKA 1KU7A 3GWZA 2EWNA 2M34A 3HPGA 4XQFA 2DFHA 3SZTA 1PP8F 1MMGA 4YFNF 1TW2A 1D8KA 1T6SA 3H3UA 1E17A 3I4MJ 1S9HA 1W7PB 1YYVA 2P4WA 4I6ZA 2AXLA 4XSZF 4XKVA 4MIMA 2DK8A 4UUTA 4LGWA 3RI4A 2G9WA 2LOOA 5LGTA 2DCEA 1PDNC 2GBYA 1IZ1A 4XR6A 4LLLA 1H8AC 1AKHB 2NVTJ 1OLTA 2LBFA 2CRGA 4EV0A 1ZAOA 5D8KB 1VNDA 3DEWA 1TWGJ 1O57A 2ZNYA 3AL0B 3K70C 1S29A 2DBBA 5LRSA 5E3LA 4E7SA 2QYOA 2MABA 3K2ZA 4WXHA 2ELHA 2R4GA 3CMAI 3BR3A 1FOYA 3VFZA 1SD5A 2DOAA 3R6SA 2BE5F 2CV1A 1VQ4I 4IRIA 2PMZN 4LIUA 2VQHA 2XF6A 1D1CA 2ICWG 3DPUA 2IS1A 3ZMUA 1UHSA 1QZYA 4YIIA 3EUHC 2G7UA 4QIWN 5IP9J 3H0GJ 3L2QA 4EJVA 1J09A 3L2RA 3OIQA 3HG9A 4WXCA 2LKPA 2YU3A 2PI0A 2WAQA 5HS9A 1PJRA 1X3ZB 2XRNA 2CGPA 4L9NA 3ULQB 2RKHA 1QRYA 4XLAA 2B7EA 2DW4A 1W4MA 5KNLA 3WHBA 2LVSA 1VQ6I 1V4RA 5D6EA 4O6JA 1MDMB 2YX7A 5CQGA 1IF1A 4GFBA 4B1RA 2QQAA 2R7OA 2VBYA 5DUKA 4IHXA 2E60A 1R4MB 4DQ2A 1IDZA 3GW2A 1X3WB 1GVDA 3HBLA 5E1WA 3ZOBA 3CJNA 4EEFG 1GV5A 2W82A 4HBLA 1STZA 1QQIA 1UMQA 3A03A 2LH9A 1NG6A 2CW7A 2DJIA 2Y31A 1J0RA 4PGGA 4Y4RA 2WV1A 2EFQA 4FE7A 4HZFA 4X6AJ 1ZGWA 5B3SH 1R71A 3ZMVA 4DIQA 1ETWA 3BWGA 1JT6A 1OR7C 2BGCA 2HQRA 4F52A 2HPMA 2LK2A 1TT5B 3FK6A 4K2EA 4E70A 2XGCA 2R7UA 2ZMEC 4JYKA 4MGRA 3D5SC 5FRMA 5IT3A 4ZTFA 1LFPA 2IEKA 1BR4A 5L3EA 1MMNA 2P6TA 5ICGA 1ZTRA 3IAS2 1CQTA 1DQUA 4LB5A 3E6DA 3VPRA 4RGXA 3IH4A 5IT9K 4L5EA 2Y69H 4P55A 1IN7A 3WU2C 3G73A 2OD5A 2M7BA 4BL0B 1T08B 1ITYA 1SFKA 2K9MA 4AWXB 2EIJH 2K9LA 4II2A 4MFDA 2AO9A 2M1BA 3C3WA 3O6BB 2VLAA 1HW5A 4W97A 3S3NA 3IWFA 4XN0A 2X48A 1D0XA 1ORKA 2IXSA 2B9SA 2QSHX 4DYQA 5TGTA 4LLGF 3DCFA 4RAZA 2V6CA 2E5NA 2H1LA 1GXPA 4FCYA 1D1BA 3KP3A 1V5EA 2W4SA 2VI6A 2XAUA 3V8LA 3CUQA 5F1RA 1Z05A 1MMDA 4FTHA 1SAXA 3ML6A 4XNFA 1KQ9A 2KDOA 3S32A 4BY1J 3HSEA 4CZZA 4BE0A 1UHWA 3FKJA 3LFKA 3SXYA 1VQMI 1QA6A 2Y0MA 4D7NA 1R4NB 2VUMJ 2IGNA 2DA6A 1RR8C 4LJZF 1V5FA 1YJNI 1JGSA 5E8GA 1A36A 3SYTA 1HCRA 1RNLA 1KQ8A 2VBZA 2NVXJ 2KKOA 3I5UA 1XTAA 5DM7F 4RB2C 1QGPA 3ZP5A 2CQQA 4C3IJ 1VI0A 4AIJA 3D5LA 5B1BH 4ZDPA 2GWRA 1G3SA 2DK5A 2ZMEB 2HR3A 3DKXA 1EKEA 4DZJA 2V4JC 3Q0WA 5HS7A 3RKXA 3V4GA 2D1VA 5AIPA 4GDFA 2OZUA 1VQLI 4NHJA 2A6TA 3OYHA 5TJJA 5J4VA 5L3DA 4HX8A 1FC3A 5BOXA 3ZN1A 4GYIA 1N78A 2R7FA 3BOQA 5CVVA 2H8WA 2QSFX 3I58A 3O2PE 5LLQA 5BPIA 1O7LA 1U9OA 3VYUB 1MW7A 4HSRA 2YSRA 3F8BA 3DTKA 3KZYA 4IVNA 1YJ9I 2MW8A 4BS9A 1IXCA 3BROA 3CMMA 1JGGA 4ENMA 2F48A 5GADJ 3PO3J 2L0KA 5FO5A 1OKRA 4RA2A 3MKZA 2DYSH 2FA5A 3CCUI 5F64A 3R61A 4LFUA 1WZ2A 2NS7A 3RPQA 3ISPA 2CFXA 3GZ5A 3U21A 1GUUA 3S1NJ 3FDYA 4XN3A 3C2BA 4KISA 1IV6A 5CLSA 3IAM2 3FXQA 5DV5A 4KA4A 2F4OB 2FBKA 3H92A 3ABLH 4Q5SF 4L9VA 3BQYA 5ILUA 1OISA 2ZO4A 3T5XA 1D8JA 5E3NA 4FQGA 1AHDP 2P5VA 2OCCH 1W0TA 3K4MA 2LC2A 4QLCU 1MKMA 2FQ3A 3BJAA 5C44J 2M8EA 1FOWA 2Z2SB 3OR1C 3V7CA 2VQCA 2HS5A 2VBXA 3V7RA 3FZVA 3CJQB 4WK8F 1LNWA 3FM5A 1Z91A 4AYBA 2QKMB 3RZOJ 1G59A 3FXOA 3KETA 4XBFA 1GHCA 3BTCA 2Z16A 2CWEA 4ESBA 1RKTA 2KIMA 2H6BA 2X1EA 4A3IJ 2IA0A 3Q9VA 1IN8A 2A07F 1BBYA 2MH9A 2VJ4A 2HNHA 1BW6A 2E35A 2ZKZA 2MC3A 4PJ0C 4PK4A 5F27A 4IQJA 4FT8A 1G3YA 2L2OA 3PIPF 1BI3A 4ESFA 1W5CC 2RC4A 3OYGA 3M8JA 3GUDA 2HOAA 1IV8A 2OJED 2X6OA 3RCOA 1OYIA 1BIAA 5FFXA 1X1AA 1SD4A 3L2VA 4PGHA 3HJEA 4XM3A 3MCZA 5HLHA 2CJJA 1PVEA 2HZTA 3FM3A 1QNTA 1WI3A 2OCEA 4A69C 4IQ4A 2HVSA 4XL9A 1FBSA 5F6FA 3HRTA 3HDDA 2KFDA 3FBIB 2F5VA 3Q0VA 3OIPA 3RTRA 4UB6C 2JA8J 1K61A 3DXJF 5E8IA 3B02A 4KT6A 3VDXA 1X1PA 4XK4A 3CC2I 4L5JA 4PUSA 2K5CA 4XICA 2E2JJ 4BE1A 2GQQA 3HHHA 5EGOB 3JCUC 3B6AA 3E1SA 1JUPA 2ZFWA 3HKZN 3BG7A 1YS6A 2OBPA 4QPQA 4I98B 1WH7A 1Y56A 5IPAA 4XLFA 1ZG5A 4A3BJ 3SDBA 3JREA 3REOA 5ICEA 1HDPA 3PUFA 3BZCA 1OMIA 2IRFG 5LD2C 3CDLA 1X19A 2XGXA 3OOPA 3TOAA 5JVTA 2GXAA 2V6EA 2HYJA 3OYMA 1YX5A 5H6RA 1W0UA 1I3QJ 4BAYA 2JQ7A 4N4OB 1O3QA 3W6VA 3I0TA 1IRFA 3W2WA 4X0GA 3BLYA 4OWRB 2M9HA 1JHHA 2ACJA 1O3TA 3KYDB 2XAJA 1D0YA 3RYRA 3Q5FA 4G94A 1N75A 4XKBA 4NUBA 1S72I 1USTA 4R8HA 2E1MB 3OOUA 3WTTC 1B9MA 1DU0A 1TQPA 1PUEE 2EH3A 4IJAA 4W1UA 3QYEA 2K27A 1TW3A 1A6IA 4CCLA 5BNGA 2QBYB 1FSEA 3HYIA 2DN0A 3S8PA 1ZR4A 3FK7A 3A01A 5J47A 3IKTA 2HXOA 1LDDA 2VKDA 4CCJA 4DBRA 3RPUD 2M2EA 3S14J 3KP7A 2VL8A 1KZHA 4KN4X 1FYLA 5ILSA 2DJNA 2Q1ZB 1EH7A 1N25A 2FNAA 1IN6A 1A04A 4ENNA 2Z99A 5JR3A 3M9AA 4U0YA 2DMQA 1QPMA 3DQVC 3NWTA 2LDUA 1FMWA 4Q48A 1K6YA 5EZHA 1JUSA 4F7ZA 4A5NA 2P7CB 4MLOA 1P7IA 4TV7A 2AQEA 2JMWA 4HV5A 1W1WE 1P4XA 3OWTA 4BQAA 3V42A 3DBHB 4CYCA 3RZDJ 2F5FA 2L4AA 4M72A 1FSHA 2JSCA 2MYSA 3TKYA 3DTEA 1J75A 2CUFA 1ZKGA 2FNPA 2LYCA 3JRIA 4XRMA 1ENHA 2IGKA 4I0AA 3I3LA 1MJAA 4HV6A 1DPUA 1MSEC 1VQ8I 2KIQA 2KHMA 3JRBA 3F3XA 4RBOA 3MZ8A 1VQKI 1P7JA 3ROUA 3O8GA 1K78A 1ETKA 1OCRH 1XGSA 5F1JA 4G6TB 5K1YA 5GAEJ 3FISA 3OS2A 4WWCA 1R5GA 3VOEA 2HOEA 5EF6A 3KIOA 5B66C 3E5XA 3SZGA 3GZ6A 3J7AY 3ZR8X 1E3HA 1ERDA 3ASNH 2DPUA 3KZZA 1R1VA 3LFUA 3CF2A 1S7AA 2EZIA 3OYJA 2RDPA 2KIFA 4H4KC 2FSWA 3OV8A 2DA4A 2K4BA 1CGPA 2WAQN 3TW6A 4KN7X 4EJOA 2PEXA 1LEAA 1OJLA 2OUMA 3M1CA 5IYCJ 1OFCX 1QPIA 5EJCA 1TWAJ 1X1CA 1Q1HA 3HRSA 4YG2F 1SD7A 5JHUA 3S16J 1EV7A 1R1UA 2DMNA 1W36D 1H0MA 1O3RA 4BGDA 3DP7A 2XAFA 4JBAA 1B9NA 3OYKA 1OCZH 4KT5C 3BR5A 4LG0A 4B43A 3LSPA 2ZJRF 1AWCA 5BS6A 1RESA 1ZK8A 1G8XA 1OQYA 3SHFA 3HOUJ 2L54A 3PSIA 5J1RA 2XIGA 4YIRX 3FXUA 2VXDA 1ETQA 2MD0A 5DD4A 1YJWI 3WGGA 1LVAA 3Q9SA 4BHCA 1XC5A 4M3GA 1BC7C 2LFBA 2QWWA 1GXQA 1QVUA 4M3FA 2PLYA 4DOZA 1W5SA 2FD5A 3CDHA 3DV8A 3VSLA 5M5WJ 1MMAA 2E7XA 3U1DA 2IS2A 2Y30A 2ME0A 4D9JA 2F5CA 2DODA 4FX4A 2Q0OA 2LP0A 4KMUX 1I39A 5C3EJ 3QRFF 2CUZA 4HQMA 1DPRA 4HA8A 2EFWA 2FRHA 1MBFA 3D5RC 1TQIA 1JHFA 1U6GA 3ZN0A 1OR7A 4Y33A 4UUVA 2EV0A 2W85A 4M71A 2DTZA 2BEOA 3BCAA 2XKPA 3SFIA 4S05A 1FYMA 2W7NA 2QQ9A 4ENKA 3IWZA 3VSKA 1XDUA 3BTLA 2NS8A 1SFXA 2TRTA 5D5XB 2DDBA 2ZCWA 2GA1A 4B4CA 2CV2A 1ZG1A 3GFJA 2LR8A 5FJ8J 3QYFA 3I4NJ 4UUSB 3RPUA 1SVOA 1FY7A 3HTSB 3IHUA 2BOLA 4RB0A 3TGNA 2LKXA 3AG3H 3LSHA 4G6QA 3UR3C 3ZMDA 2JJ7A 5J8FA 4V19K 2BVMA 2W24A 4WF2A 1T0FA 1KU3A 3E6BA 4RMNA 3TBIA 3ZQQA 1R5ID 1KYWA 4HYEA 2BY2A 1KYZA 3TP3A 1ONVA 2L7ZA 2X9DA 3M07A 1Z21A 1BJZA 1NHAA 1Z67A 2L7FP 1M1EB 1LKXA 2KLOA 2XPWA 2R0QC 1XMAA 4V2GA 2CH0A 5FROA 1PUFB 4Y52J 3E6CC 1R1TA 2XSJC 3DLAA 2M4GA 5DEQA 1MBGA 2L7MP 2PFBA 4ETSA 3QPLA 3DFGA 5DS9A 3H1CA 3CTAA 2IP2A 4G6DA 3T0YA 3WTSC 2ETHA 4OOIA 2UV1A 1TZLA 3NARA 4F3QA 3F0CA 1D5VA 4BXFA 2P8TA 1YIOA 3KYCB 1JKOC 1R36A 4AIKA 4Z6YA 3K4KA 3LMMA 2O61A 3V8JA 1IXRC 4C3JJ 3CCLI 4AC0A 1ZGAA 3JTGA 3FKIJ 3F9KA 1I5ZA 2XF5A 2IJLA 2OF7A 1F9NA 3HB9A 5DCMA 4KIBA 3C1DA 3PQJA 2M8GX 5HNFA 5IY5H 4B3AA 2EB7A 2JUCA 2WA0A 5JVGF 2MBFA 3G1OA 5K5QA 3WGIA 5HDNA 1IRXA 1U5TA 1DGRM 3BG6A 5LRRA 4ZZDA 4U0WA 1P4WA 3QQAA 2NNNA 4Z2YA 3JW4A 1UJ8A 3IC7A 2RV8A 1BN5A 3TEDA 4B47A 4ZTJA 1I27A 5D5WB 2KISA 1QHGA 1BM9A 2UXXA 2XKOA 3QODA 3FF5A 2IBDA 4NB5A 4DNCA 3WODF 2KT0A 1MH3A 2X0LA 2R5YB 4Y13A 4XKWA 4BQQA 3OYCA 4XLNF 2DT7B 1VTNC 1MGTA 3I9V2 1LB2A 5IOZA 3G1LA 3DF8A 3J81K 2GA2A 2QM3A 2XB0X 4P1WA 1L3LA 4UVBA 4MQVA 3S3MA 1HA8A 3MD2A 1POGA 4IF4A 4HDVA 1IG7A 4BDYA 3LA3A 3ZQGA 2MFZA 3JTHA 3RDIA 1YIJI 1B6AA 5EGOA 4RDUA 5FLXK 3H5AA 2QUFA 3A2KA 1J59A 3ZMSA 2BHZA 4A3MJ 3LL7A 5LGNA 3J80Z 3F22A 1MSFC 3WG9A 1E3OC 3J80K 2HWVA 2E1NA 3FMRA 4BBRJ 1BI1A 1SMTA 5FGMA 1HKSA 3AAFA 4MTDA 3CMYA 3DPTA 1R00A 1Z3XA 3P9KA 2LG4A 4BQNA 2EBIA 3RJPA 3ZXSA 1MBEA 2QLZA 4LLNA 2RVCA 2CW8A 2EIKH 5IP7J 1A5JA 1YFHA 5CVRA 3AG1H 1YITI 4UV9A 4N9IA 3LA7A 2LF7A 1R7JA 5J1YA 1X2MA 4XMYA 5HLIA 2DMTA 2Y75A 3ECOA 1TBXA 2OC6A 5GAGJ 1JTXA 2ADUA 2FE3A 4AM3A 2GZWA 2O6GE 2GOXB 5BPDA 3H5NA 2JA2A 2GM4A 2M30A 1JKRC 1LE8B 2QBYA 2HGCA 2VIXA 3HOZJ 1G2HA 5H6QA 3ZGKA 5IT9Z 1IDYA 3KE2A 3GX4X 1SD6A
chains in the Genus database with same CATH topology
1NTCA 3BTCA 3BQZA 4AUXA 5FKNA 5M5YJ 1RKTA 4A3IJ 4ABZA 2D5VA 3ZQIA 1MBKA 1BW6A 1JTYA 5F27A 3GBGA 1FTTA 1HF0A 1FIPA 2K9NA 2NVQJ 2CU7A 1B8IA 1LE8A 1FEXA 2E19A 2TCTA 1VFCA 2HOAA 2X6OA 3MN2A 3D1NI 1JKPC 3BR2A 3LSGA 4DW6A 2EZHA 2CJJA 1ETXA 2HXIA 2OPTA 2P81A 5E3MA 2E2IJ 1U9NA 1WI3A 2N8GA 3MKLA 4A69C 1IGNA 5DTDA 1F36A 1ETVA 3BT9A 2XGEA 3HDDA 3BTJA 4A3FJ 5F0FA 3Q0VA 1K83J 2JA8J 1K61A 2AHQA 2XGDA 3MVPA 1FJLA 4XK4A 3HOXJ 9ANTA 4XICA 1RPWA 2E2JJ 1JUMA 1I50J 1WCMJ 2M0CA 1NK3P 4QSHA 3IH3A 5EGOB 3JRHA 1RKWA 3PM1A 3B6AA 2DA1A 1JUPA 4JX4A 3HKZN 1IRZA 2YU9J 4IHYA 3HOWJ 1WH7A 1TC3C 5IPAA 3CQZJ 1Y1WJ 4A3BJ 3JREA 5JLXA 2EZLA 1HDPA 3LSRA 3E7LA 1H88C 1BW5A 2LTPA 3CDLA 1JJ6C 2HYJA 5FLMJ 1W0UA 1I3QJ 3JRGA 2K9SA 3A01B 1HOMA 3W6VA 2B63J 5F08A 2M9HA 3GTJJ 2FX0A 4AYBN 5JLWA 2Y0SN 2VPRA 4XRSA 2E2HJ 3Q3SA 4A3EJ 1WH5A 2DMUA 3OOUA 3HGGA 2XPVA 1DU0A 3BR1A 3H3VK 3L1PA 2EH3A 1B72B 4W1UA 3GTGJ 5EG0B 1A6IA 4JX5A 2XRLA 5BNGA 1YRNA 4M3DA 1OCPA 1Z0XA 2DN0A 1BA5A 1ZR4A 3FK7A 3A01A 4A3JJ 5E3OA 2HXOA 2LD5A 4NDLA 3OIOA 2YUSA 2M2EA 5EEAA 2G0EA 3WHCA 1TWFJ 5F0CA 3K7AJ 1NK2P 4CYCB 3S14J 4JX6A 1MBHA 3BTIA 3LSJA 3TP0A 1GV2A 2DJNA 3TW7A 1IC8A 3K2AA 2JK3A 2CUEA 4D5FA 1B72A 3RQIA 4D7MA 2COBA 2DMQA 4S0HB 1ETYA 5EG0A 1B8IB 5K7FA 4LOCA 3FIWA 5EZHA 1JUSA 2HI3A 4MLOA 1LFBA 1P7IA 3ZQLA 2DMPA 1APLC 2R93J 2JMWA 4BBSJ 4HNVA 4CYCA 2DA7A 3RZDJ 2XB5A 3BG5A 3S1RJ 1RR7A 2FQ4A 2CUFA 5EYRA 1ZKGA 3BG9A 3S17J 3CCYA 3JR9A 3JRIA 4XRMA 1ENHA 1XG1A 1MSEC 2R5ZB 3B6CA 3JRBA 1OCTC 5FKOA 1S7EA 4RBOA 2HDDA 1P7JA 2VKVA 3O8GA 2O8KA 1ETKA 3JRCA 5F1JA 4A3LJ 3FISA 2O9LA 1D5YA 1U78A 5EF6A 3PO2J 2M34A 1DU6A 1ZR2A 2LY9A 2EZIA 4BY7J 2YS9A 5GPCA 3I4MJ 4I6ZA 1HLVA 1JT0A 1U8BA 2DA4A 3S1QJ 2WAQN 4MIMA 3TW6A 2R5ZA 4JP0A 5IYCJ 1OJLA 4UUTA 1OFCX 1QPIA 4M3EA 1TWAJ 1LFUP 3BG3A 4Y7NJ 4IHVA 2QF7A 3GTLJ 2GBYA 3S16J 5GPAA 1H8AC 2DMNA 2VKEA 1AKHB 2NVTJ 2CRGA 2RAEA 3HGYA 2XSDC 4V2FA 2MG4A 1BL0A 2ELKA 3Q0UA 1VNDA 3DEWA 3BR6A 4DZPA 1TWGJ 3BR5A 3LSPA 3IH2A 1RESA 5E3LA 3ZQFA 1ZK8A 5F04A 5GP9A 3HOUJ 4FISA 2H8RA 3BR3A 5J1RA 3S1MJ 4C3HJ 3S2HJ 1ETQA 4A3CJ 2PMZN 4BKXA 3OSFA 3M3YJ 5FLVA 2JA7J 1XC5A 4M3GA 1YRNB 2LFBA 1UHSA 1AKHA 1TWCJ 1QVUA 2EZKA 4M3FA 2EQRA 3H0GJ 4QIWN 5IP9J 3RKQA 2I10A 2FD5A 4IEJA 5M5WJ 2Y30A 2ME0A 2MGQA 3HM5A 4DYRA 4I76A 2LP0A 5C3EJ 4MFEA 1Y1VJ 1MBFA 2LLKA 1QRYA 3HEFA 3WHBA 2LVSA 3GTQJ 2DTZA 3SFIA 4B1RA 4GFBA 4A93J 1VF9A 2H1KA 3LOCA 4IHXA 3BTLA 5J3LA 2R5YA 2NS8A 1H89C 1IDZA 3UKGA 2TRTA 1GVDA 3HBLA 3O8HA 3ZQCA 3ZOBA 2Y2ZA 4EEFG 2L9RA 1GV5A 1X2NA 4B4CA 1Z77A 2LR8A 1UMQA 3A03A 2DA5A 2Y9YA 2K40A 1XS9A 5FJ8J 2JN6A 3I4NJ 4UUSB 3M4OJ 2Y31A 4BXXJ 2WV1A 5FKLA 4FE7A 2LKXA 2QCOA 4X6AJ 1ZGWA 2JJ7A 4C2MJ 4D5CA 2HQ5A 1ETWA 1JT6A 2K9QA 4QTRA 2FJ1A 2W48A 2LK2A 3FK6A 3TP3A 2L7ZA 2X9DA 2XGCA 1BJZA 4JYKA 2L7FP 2R0QC 2XPWA 5F0HA 2IEKA 4V2GA 1PUFB 4A3KJ 2GLOA 4Y52J 4UUSA 1F43A 1ETOA 4FE4A 1MBGA 1ZTRA 2L7MP 1CQTA 3QPLA 5FKKA 3VPRA 5DS9A 3LNQA 1FIAA 3IH4A 3JRFA 1MH4A 2NVYJ 3BR0A 4L5EA 1TWHJ 4MO7A 4XRSG 1JKQC 2ECCA 1ITYA 3S2DJ 3SDGA 3NARA 3F0CA 5M3FJ 4MFDA 5IYBJ 2HOTA 1JJ8C 2AO9A 1IJWC 1JKOC 4W97A 2ID6A 4C3JJ 2X48A 1AU7A 4AC0A 5IOYA 1ORKA 3FKIJ 4DYQA 1PUFA 5K7HA 3SJMA 1SFOJ 3DCFA 3NAUA 2OF7A 5EZGA 4FCYA 5IP6A 2ME6A 1IUFA 2VI6A 3HB9A 3QPSA 1WGXA 2M8GX 4B3AA 5HODA 4FTHA 3G1MA 3G1OA 4A3GJ 2WB1N 4BY1J 2ZB9A 4M6VA 1FTZA 1ZQ3P 4D7NA 5K7ZA 2Y9ZA 5IYDJ 3OSGA 2VUMJ 3QQAA 2DA6A 1HDDC 1HCRA 5J1UA 2XPUA 3TEDA 2MSYA 1EF4A 4J19A 2NVXJ 5C4XJ 3JRDA 3IV5A 3GTKJ 2CQQA 2IBDA 1VI0A 4C3IJ 1MBJA 2KT0A 1MH3A 4DYCA 2R5YB 4DZJA 3Q0WA 2IAIA 4IHWA 1X58A 5IOZA 3G1LA 1Q1VA 2XB0X 3A02A 3GTMJ 5FKMA 1IG7A 1POGA 1UG2A 3ZQGA 4XIDA 1R9TJ 2JA6J 5EGOA 2CQXA 4RDUA 2HOSA 1U9OA 4A3MJ 1MSFC 5M5XJ 3GTPJ 1E3OC 2ID3A 3S15J 2ECBA 4BBRJ 5C4JJ 2MW8A 4M3BA 2DA3A 1JGGA 3CMYA 3PO3J 5EDNA 3GTOJ 2EBIA 2L0KA 4G12A 2NOGA 1MBEA 1GT0C 1T33A 1I6HJ 3HOYJ 5IP7J 1A5JA 3HOVJ 2R7ZJ 2R92J 2NS7A 4X1EA 1GUUA 3JRAA 3S1NJ 2DA2A 5J1YA 3C2BA 1X2MA 1IV6A 2DMTA 2O7OA 2E1OA 1JTXA 3BQYA 5E3NA 1AHDP 2JWTA 1SANA 2KDZA 1W0TA 1GDTA 4A3DJ 5C44J 1T56A 2GM4A 1JKRC 2JA5J 1LE8B 3HOZJ 5M3MJ 1WPKA 1RETA 1O4XA 1MNMC 3RZOJ 1QVTA 1G2HA 1IDYA 3ZQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTC A;  3BTC A;  3BQZ A;  4AUX A;  5FKN A;  5M5Y J;  1RKT A;  4A3I J;  4ABZ A;  2D5V A;  3ZQI A;  1MBK A;  1BW6 A;  1JTY A;  5F27 A;  3GBG A;  1FTT A;  1HF0 A;  1FIP A;  2K9N A;  2NVQ J;  2CU7 A;  1B8I A;  1LE8 A;  1FEX A;  2E19 A;  2TCT A;  1VFC A;  2HOA A;  2X6O A;  3MN2 A;  3D1N I;  1JKP C;  3BR2 A;  3LSG A;  4DW6 A;  2EZH A;  2CJJ A;  1ETX A;  2HXI A;  2OPT A;  2P81 A;  5E3M A;  2E2I J;  1U9N A;  1WI3 A;  2N8G A;  3MKL A;  4A69 C;  1IGN A;  5DTD A;  1F36 A;  1ETV A;  3BT9 A;  2XGE A;  3HDD A;  3BTJ A;  4A3F J;  5F0F A;  3Q0V A;  1K83 J;  2JA8 J;  1K61 A;  2AHQ A;  2XGD A;  3MVP A;  1FJL A;  4XK4 A;  3HOX J;  9ANT A;  4XIC A;  1RPW A;  2E2J J;  1JUM A;  1I50 J;  1WCM J;  2M0C A;  1NK3 P;  4QSH A;  3IH3 A;  5EGO B;  3JRH A;  1RKW A;  3PM1 A;  3B6A A;  2DA1 A;  1JUP A;  4JX4 A;  3HKZ N;  1IRZ A;  2YU9 J;  4IHY A;  3HOW J;  1WH7 A;  1TC3 C;  5IPA A;  3CQZ J;  1Y1W J;  4A3B J;  3JRE A;  5JLX A;  2EZL A;  1HDP A;  3LSR A;  3E7L A;  1H88 C;  1BW5 A;  2LTP A;  3CDL A;  1JJ6 C;  2HYJ A;  5FLM J;  1W0U A;  1I3Q J;  3JRG A;  2K9S A;  3A01 B;  1HOM A;  3W6V A;  2B63 J;  5F08 A;  2M9H A;  3GTJ J;  2FX0 A;  4AYB N;  5JLW A;  2Y0S N;  2VPR A;  4XRS A;  2E2H J;  3Q3S A;  4A3E J;  1WH5 A;  2DMU A;  3OOU A;  3HGG A;  2XPV A;  1DU0 A;  3BR1 A;  3H3V K;  3L1P A;  2EH3 A;  1B72 B;  4W1U A;  3GTG J;  5EG0 B;  1A6I A;  4JX5 A;  2XRL A;  5BNG A;  1YRN A;  4M3D A;  1OCP A;  1Z0X A;  2DN0 A;  1BA5 A;  1ZR4 A;  3FK7 A;  3A01 A;  4A3J J;  5E3O A;  2HXO A;  2LD5 A;  4NDL A;  3OIO A;  2YUS A;  2M2E A;  5EEA A;  2G0E A;  3WHC A;  1TWF J;  5F0C A;  3K7A J;  1NK2 P;  4CYC B;  3S14 J;  4JX6 A;  1MBH A;  3BTI A;  3LSJ A;  3TP0 A;  1GV2 A;  2DJN A;  3TW7 A;  1IC8 A;  3K2A A;  2JK3 A;  2CUE A;  4D5F A;  1B72 A;  3RQI A;  4D7M A;  2COB A;  2DMQ A;  4S0H B;  1ETY A;  5EG0 A;  1B8I B;  5K7F A;  4LOC A;  3FIW A;  5EZH A;  1JUS A;  2HI3 A;  4MLO A;  1LFB A;  1P7I A;  3ZQL A;  2DMP A;  1APL C;  2R93 J;  2JMW A;  4BBS J;  4HNV A;  4CYC A;  2DA7 A;  3RZD J;  2XB5 A;  3BG5 A;  3S1R J;  1RR7 A;  2FQ4 A;  2CUF A;  5EYR A;  1ZKG A;  3BG9 A;  3S17 J;  3CCY A;  3JR9 A;  3JRI A;  4XRM A;  1ENH A;  1XG1 A;  1MSE C;  2R5Z B;  3B6C A;  3JRB A;  1OCT C;  5FKO A;  1S7E A;  4RBO A;  2HDD A;  1P7J A;  2VKV A;  3O8G A;  2O8K A;  1ETK A;  3JRC A;  5F1J A;  4A3L J;  3FIS A;  2O9L A;  1D5Y A;  1U78 A;  5EF6 A;  3PO2 J;  2M34 A;  1DU6 A;  1ZR2 A;  2LY9 A;  2EZI A;  4BY7 J;  2YS9 A;  5GPC A;  3I4M J;  4I6Z A;  1HLV A;  1JT0 A;  1U8B A;  2DA4 A;  3S1Q J;  2WAQ N;  4MIM A;  3TW6 A;  2R5Z A;  4JP0 A;  5IYC J;  1OJL A;  4UUT A;  1OFC X;  1QPI A;  4M3E A;  1TWA J;  1LFU P;  3BG3 A;  4Y7N J;  4IHV A;  2QF7 A;  3GTL J;  2GBY A;  3S16 J;  5GPA A;  1H8A C;  2DMN A;  2VKE A;  1AKH B;  2NVT J;  2CRG A;  2RAE A;  3HGY A;  2XSD C;  4V2F A;  2MG4 A;  1BL0 A;  2ELK A;  3Q0U A;  1VND A;  3DEW A;  3BR6 A;  4DZP A;  1TWG J;  3BR5 A;  3LSP A;  3IH2 A;  1RES A;  5E3L A;  3ZQF A;  1ZK8 A;  5F04 A;  5GP9 A;  3HOU J;  4FIS A;  2H8R A;  3BR3 A;  5J1R A;  3S1M J;  4C3H J;  3S2H J;  1ETQ A;  4A3C J;  2PMZ N;  4BKX A;  3OSF A;  3M3Y J;  5FLV A;  2JA7 J;  1XC5 A;  4M3G A;  1YRN B;  2LFB A;  1UHS A;  1AKH A;  1TWC J;  1QVU A;  2EZK A;  4M3F A;  2EQR A;  3H0G J;  4QIW N;  5IP9 J;  3RKQ A;  2I10 A;  2FD5 A;  4IEJ A;  5M5W J;  2Y30 A;  2ME0 A;  2MGQ A;  3HM5 A;  4DYR A;  4I76 A;  2LP0 A;  5C3E J;  4MFE A;  1Y1V J;  1MBF A;  2LLK A;  1QRY A;  3HEF A;  3WHB A;  2LVS A;  3GTQ J;  2DTZ A;  3SFI A;  4B1R A;  4GFB A;  4A93 J;  1VF9 A;  2H1K A;  3LOC A;  4IHX A;  3BTL A;  5J3L A;  2R5Y A;  2NS8 A;  1H89 C;  1IDZ A;  3UKG A;  2TRT A;  1GVD A;  3HBL A;  3O8H A;  3ZQC A;  3ZOB A;  2Y2Z A;  4EEF G;  2L9R A;  1GV5 A;  1X2N A;  4B4C A;  1Z77 A;  2LR8 A;  1UMQ A;  3A03 A;  2DA5 A;  2Y9Y A;  2K40 A;  1XS9 A;  5FJ8 J;  2JN6 A;  3I4N J;  4UUS B;  3M4O J;  2Y31 A;  4BXX J;  2WV1 A;  5FKL A;  4FE7 A;  2LKX A;  2QCO A;  4X6A J;  1ZGW A;  2JJ7 A;  4C2M J;  4D5C A;  2HQ5 A;  1ETW A;  1JT6 A;  2K9Q A;  4QTR A;  2FJ1 A;  2W48 A;  2LK2 A;  3FK6 A;  3TP3 A;  2L7Z A;  2X9D A;  2XGC A;  1BJZ A;  4JYK A;  2L7F P;  2R0Q C;  2XPW A;  5F0H A;  2IEK A;  4V2G A;  1PUF B;  4A3K J;  2GLO A;  4Y52 J;  4UUS A;  1F43 A;  1ETO A;  4FE4 A;  1MBG A;  1ZTR A;  2L7M P;  1CQT A;  3QPL A;  5FKK A;  3VPR A;  5DS9 A;  3LNQ A;  1FIA A;  3IH4 A;  3JRF A;  1MH4 A;  2NVY J;  3BR0 A;  4L5E A;  1TWH J;  4MO7 A;  4XRS G;  1JKQ C;  2ECC A;  1ITY A;  3S2D J;  3SDG A;  3NAR A;  3F0C A;  5M3F J;  4MFD A;  5IYB J;  2HOT A;  1JJ8 C;  2AO9 A;  1IJW C;  1JKO C;  4W97 A;  2ID6 A;  4C3J J;  2X48 A;  1AU7 A;  4AC0 A;  5IOY A;  1ORK A;  3FKI J;  4DYQ A;  1PUF A;  5K7H A;  3SJM A;  1SFO J;  3DCF A;  3NAU A;  2OF7 A;  5EZG A;  4FCY A;  5IP6 A;  2ME6 A;  1IUF A;  2VI6 A;  3HB9 A;  3QPS A;  1WGX A;  2M8G X;  4B3A A;  5HOD A;  4FTH A;  3G1M A;  3G1O A;  4A3G J;  2WB1 N;  4BY1 J;  2ZB9 A;  4M6V A;  1FTZ A;  1ZQ3 P;  4D7N A;  5K7Z A;  2Y9Z A;  5IYD J;  3OSG A;  2VUM J;  3QQA A;  2DA6 A;  1HDD C;  1HCR A;  5J1U A;  2XPU A;  3TED A;  2MSY A;  1EF4 A;  4J19 A;  2NVX J;  5C4X J;  3JRD A;  3IV5 A;  3GTK J;  2CQQ A;  2IBD A;  1VI0 A;  4C3I J;  1MBJ A;  2KT0 A;  1MH3 A;  4DYC A;  2R5Y B;  4DZJ A;  3Q0W A;  2IAI A;  4IHW A;  1X58 A;  5IOZ A;  3G1L A;  1Q1V A;  2XB0 X;  3A02 A;  3GTM J;  5FKM A;  1IG7 A;  1POG A;  1UG2 A;  3ZQG A;  4XID A;  1R9T J;  2JA6 J;  5EGO A;  2CQX A;  4RDU A;  2HOS A;  1U9O A;  4A3M J;  1MSF C;  5M5X J;  3GTP J;  1E3O C;  2ID3 A;  3S15 J;  2ECB A;  4BBR J;  5C4J J;  2MW8 A;  4M3B A;  2DA3 A;  1JGG A;  3CMY A;  3PO3 J;  5EDN A;  3GTO J;  2EBI A;  2L0K A;  4G12 A;  2NOG A;  1MBE A;  1GT0 C;  1T33 A;  1I6H J;  3HOY J;  5IP7 J;  1A5J A;  3HOV J;  2R7Z J;  2R92 J;  2NS7 A;  4X1E A;  1GUU A;  3JRA A;  3S1N J;  2DA2 A;  5J1Y A;  3C2B A;  1X2M A;  1IV6 A;  2DMT A;  2O7O A;  2E1O A;  1JTX A;  3BQY A;  5E3N A;  1AHD P;  2JWT A;  1SAN A;  2KDZ A;  1W0T A;  1GDT A;  4A3D J;  5C44 J;  1T56 A;  2GM4 A;  1JKR C;  2JA5 J;  1LE8 B;  3HOZ J;  5M3M J;  1WPK A;  1RET A;  1O4X A;  1MNM C;  3RZO J;  1QVT A;  1G2H A;  1IDY A;  3ZQH A; 
#chains in the Genus database with same CATH topology
 3K10 A;  1NTC A;  3BQZ A;  4AUX A;  2J5O A;  5M5Y J;  4CHU A;  1KQ0 A;  2VN2 A;  2FXA A;  2WC2 A;  4RGR A;  1USS A;  2RQP A;  1YTY A;  1O7F A;  2RN7 A;  1JTY A;  4HF2 A;  3GLX A;  5LFA A;  1RI7 A;  2BY3 A;  4EM0 B;  3FXM A;  2J5P A;  3P9I A;  3OS0 A;  2K86 A;  3HRM A;  1O3S A;  3GCM A;  1VFC A;  3QOP A;  3TQN A;  2D2W A;  3M8F A;  1JKP C;  2BY0 A;  3BR2 A;  4KIG A;  4DW6 A;  2EV6 A;  3W6J B;  1FZP B;  3OYF A;  1ETX A;  2HXI A;  2RGV A;  2W1O A;  2F6C A;  3VEP A;  1IGN A;  2HQN A;  4HLX A;  1ETV A;  3BT9 A;  1MND A;  2R7T A;  1WJ5 A;  5L3F A;  3R0A A;  4GO1 A;  2YX4 A;  1K83 J;  2ZJQ F;  3CCS I;  3HUG A;  1D1A A;  3MVP A;  1Z1D A;  2P6S A;  1W7P D;  2LY2 A;  2PG4 A;  9ANT A;  1E0E A;  3P5J A;  2A61 A;  1RPW A;  1I50 J;  2M0C A;  2V79 A;  1NK3 P;  2ISZ A;  4QSH A;  1N77 A;  2ESN A;  4XLE A;  5B1A H;  2DA1 A;  2K3P A;  2M7A A;  2K4J A;  4M9Z A;  2Y48 A;  3OYL A;  1WQ2 A;  2GXB A;  3AFH A;  2NYX A;  2XF7 A;  3CQZ J;  3K6G A;  2BVL A;  2ZBK A;  2EZL A;  4YEJ A;  3VWB A;  2JTV A;  3QOE A;  4FHT A;  1HQC A;  1BW5 A;  4CH7 A;  2X51 A;  3DTI A;  1T8I A;  4LD5 A;  2L5Q A;  3JRG A;  1HOM A;  2D1H A;  2ZNZ A;  1I6X A;  3FBN B;  3FMQ A;  1BI2 A;  1HKT A;  1ZLK A;  5F08 A;  3GTJ J;  1FP1 D;  2Y0S N;  3Q3S A;  4HEA 2;  1RZ4 A;  2A69 F;  3T8T A;  5KCM A;  3PFI A;  2DMU A;  4DBQ A;  2XPV A;  3ZPL A;  1MIJ A;  3BR1 A;  3L1P A;  4HST A;  3OS1 A;  3TL4 X;  4WXD A;  5EG0 B;  3IL2 A;  2ZSH B;  1FYK A;  2XRL A;  1V5G A;  4EJU A;  2VQL A;  1BA5 A;  4G9Y A;  1I1S A;  1BIB A;  2FMY A;  2O8X A;  4U88 A;  4EM1 A;  5E3O A;  1RC9 A;  5FRN A;  2OQR A;  2YUS A;  5AIQ A;  3WHC A;  1ZAR A;  1TWF J;  5F0C A;  1NK2 P;  3AKZ A;  4KIC A;  4JX6 A;  4AVZ A;  3E6M A;  2QVO A;  1MBH A;  3LSJ A;  3LQQ A;  1XPX A;  3A0H C;  4BE2 A;  3TW7 A;  3WU1 B;  2IW5 A;  1ZHF A;  2PMZ A;  5TIS C;  5KAI C;  4D5F A;  1B72 A;  1P92 A;  1KON A;  3RQI A;  4D7M A;  4YIF A;  2COB A;  1ETY A;  4AID A;  2JVG A;  2WTE A;  3K4B A;  3SEZ A;  5DCF A;  3F8N A;  3QPT A;  5H20 A;  4CCM A;  2KIU A;  1MNE A;  1APL C;  2R93 J;  4GXO A;  4PSX A;  4L9J A;  2WV0 A;  2EIN H;  3W2V A;  1T2K A;  4BBS J;  5E20 A;  4I99 C;  1HSJ A;  4I7H A;  3E5Q A;  4N0B A;  4HNV A;  3ASO H;  3OYI A;  3BG5 A;  4ITV A;  3K70 D;  1RR7 A;  2FQ4 A;  3FX3 A;  1F1Z A;  4PFO A;  3CLQ A;  1LQ1 A;  2EK5 A;  5KHD A;  2WAE A;  4CUG A;  4UNO A;  1XGM A;  1YW7 A;  1OCT C;  2E1M C;  3MMY B;  1R5H A;  2JT1 A;  3KP2 A;  4CZC A;  3F6O A;  4L5I A;  5D5V B;  4M74 A;  4EMS A;  1XD7 A;  3WGH A;  2CFO A;  2O9L A;  2PQ8 A;  3E3V A;  1T98 A;  3C2G A;  1FBQ A;  2LBF B;  4NQW B;  2PN6 A;  2DOE A;  1BJA A;  3PO2 J;  3DPL C;  2E36 A;  3EUA A;  2OV7 A;  2VT3 A;  2YR2 A;  2Q2E A;  4ENJ A;  1DGW Y;  4BY7 J;  2YS9 A;  5GPC A;  1DP3 A;  1QO0 D;  1JT0 A;  3S1Q J;  3GEZ A;  1XMK A;  1CF7 A;  2R5Z A;  1X1B A;  1EH6 A;  4OAZ A;  4M3E A;  1LFU P;  2HU9 A;  3RSN A;  1QBJ A;  4MEY F;  3G71 I;  4XON A;  2E7W A;  4ZYH A;  1Y39 A;  1A35 A;  4LG3 A;  3OYB A;  2RAE A;  3FWE A;  3V7S A;  2XSD C;  4V2F A;  2MG4 A;  2WBM A;  1BL0 A;  2M5W A;  3Q0U A;  1X4O A;  4A0Y A;  4NBQ A;  2A6H F;  3DWL E;  1SEU A;  3ZQF A;  1W7P A;  3TDZ C;  4C2U A;  5GP9 A;  4HQE A;  4HX4 A;  1WJD A;  3W6K B;  2A5Y B;  4G7Z F;  2EIL H;  3S1M J;  4C3H J;  3H3Z A;  5TRD A;  2C6Y A;  3S2H J;  5K5R A;  1EA3 A;  2EFP A;  5FLV A;  2JA7 J;  1REP C;  4CIC A;  3HOS A;  1AKH A;  2IGO A;  3SEQ A;  2QKL B;  2I10 A;  3K4C A;  1S7O A;  4JK1 X;  4E7I A;  1LPQ A;  2K7L A;  4IEJ A;  4P96 A;  1TNT A;  1K7A A;  4AIH A;  2EFN A;  4MFE A;  1HW2 A;  3K1N A;  1A6Q A;  5HVQ C;  4I2O A;  1Y1V J;  2BHY A;  1ZRD A;  1UHM A;  5LGU A;  3O3K A;  3CLO A;  3OL3 A;  4L0Y B;  1TLH B;  1WJE A;  1ODD A;  1UB9 A;  3HXL A;  2KJC A;  4Y15 A;  4E7H A;  4A93 J;  1VF9 A;  1UG0 A;  1QHH D;  3P7N A;  2RNJ A;  1HXD A;  5J3L A;  2R5Y A;  1YO5 C;  3WTU C;  3X2Q H;  4G8X A;  4DGW B;  5LHH A;  3E0J B;  3O8H A;  3ERE D;  3ZQC A;  1H9T A;  3PJR A;  5CPR B;  2L9R A;  2NVU B;  1X2N A;  6PAX A;  1L0O C;  1Z77 A;  2WAF A;  3J7Y J;  3HHG A;  2DA5 A;  2Y9Y A;  2L01 A;  1PYV A;  3ABK H;  1XS9 A;  5H2F C;  2TDX A;  2JN6 A;  2RQQ A;  3WTZ A;  2Z1D A;  4BU2 A;  4BXX J;  3DEU A;  3PNV A;  1TP4 A;  4P9U A;  1MDM A;  2R7S A;  2H27 A;  4C2M J;  2E5Z A;  2ZFU A;  4D5C A;  2UUZ A;  1Y6I A;  4QTR A;  1U0J A;  2FJ1 A;  3KZI C;  2W48 A;  2XDV A;  3RQ4 A;  2F5D A;  4KYW A;  4CYD A;  3KFW X;  2KP6 A;  3PQK A;  3KEQ A;  3DKW A;  3JAM Z;  5HLT A;  4I02 A;  3JAM K;  2RRE A;  5F0H A;  4H0E A;  4A3K J;  1ON2 A;  3I4P A;  3SQN A;  2GLO A;  3V8K A;  2A5W A;  3MZY A;  2QSG X;  4XKC A;  2X6W A;  3A1Y A;  3EQL F;  2VQG A;  3QAH A;  4GGG A;  3LNQ A;  1FIA A;  3JRF A;  2DTR A;  3BR0 A;  1JI8 A;  1TWH J;  3P9C A;  3VYS B;  2CQN A;  1YW8 A;  4MO7 A;  1HBX G;  4L0Z B;  3CJR B;  1A31 A;  2ECC A;  2L7K A;  4ZYG A;  3SDG A;  2F2E A;  2HYG D;  5M3F J;  5IYB J;  2HOT A;  1JJ8 C;  4JQF A;  4OU0 A;  1P4A A;  1IJW C;  3DBL B;  2IT0 A;  2A68 F;  1AU7 A;  5J4Y A;  1K4S A;  2VJJ A;  5IOY A;  4KIF A;  3H9J A;  2OTL I;  4B3X A;  1KU2 A;  4O3M A;  2WAD A;  1IRG A;  1J7K A;  3EUH A;  5IP6 A;  2ME6 A;  3IRR A;  3GXO A;  1T38 A;  4PZJ A;  4IOA F;  3BDD A;  2VC1 A;  2YPR A;  4EM2 A;  4ESJ A;  3I54 A;  4CGZ A;  3KX2 A;  4I0B A;  1S3J A;  4A6D A;  4A3G J;  1FBU A;  1IO2 A;  3E5U A;  4M6V A;  4E7Z A;  1ZQ3 P;  3W3C A;  4WX9 A;  5K7Z A;  3RKY A;  2FML A;  4BH9 A;  5DM6 F;  1KGS A;  2LSO A;  2IA1 A;  3MKW B;  2DO7 A;  4D0P A;  2V1N A;  1BR1 A;  5J1U A;  2MSY A;  1G3T A;  2X1C A;  1EF4 A;  2M45 A;  2W57 A;  3CCV I;  2NAZ A;  5C4X J;  1DDN A;  3JRD A;  3ECH A;  3VYT B;  4F93 B;  3GTK J;  2XAS A;  1WKM A;  3K4L A;  3OMY A;  1MBJ A;  3FHZ A;  3G4S I;  2VOO A;  2KRH A;  2EV5 A;  1Z6T A;  4DYC A;  3G2B A;  4MHG A;  2W25 A;  4M9S A;  2IAI A;  2V1X A;  4IHW A;  5D6F A;  1X58 A;  3QWL A;  3QU6 A;  2O03 A;  1Z7L A;  2HVQ A;  2VT2 A;  3HC7 A;  1ZRC A;  2DFF A;  1G3W A;  2NXN B;  2JZY A;  1QZZ A;  2XUB A;  4LK1 F;  1Q1V A;  4WCG A;  3GTM J;  4S04 A;  4NC8 A;  1UG2 A;  4HRI A;  4BUP A;  3QPH A;  1R9T J;  2JA6 J;  1R22 A;  4IZZ A;  2IPQ X;  4UXN A;  2IVM A;  5EEG A;  2HOS A;  2WB1 A;  4HLY A;  1S5L C;  2DI3 A;  2HTS A;  2V9P A;  3CCE I;  3IP4 B;  2VBW A;  2ZME A;  5M5X J;  1UEL B;  2V26 A;  4PJN A;  2QEN A;  3M1E A;  3J7Z I;  1VQ7 I;  2DLL A;  1RUO A;  4M3B A;  2MD5 A;  1HW1 A;  1IXS B;  3QU3 A;  4ZC3 A;  2FF4 A;  5EDN A;  2JUG A;  2UXN A;  3GTO J;  4OIN F;  3WG7 H;  2ZXW H;  3G6E I;  4MNU A;  1GT0 C;  3T1B A;  1VQP I;  2KRF A;  4FAS D;  1XCV A;  3M7G A;  3S3O A;  2G7H A;  4LK0 F;  3HKZ A;  3LA2 A;  3HOV J;  2CW0 F;  4UVA A;  1MZB A;  3JRA A;  3KPH A;  1BR2 A;  3M8E A;  1IW7 F;  1TQM A;  4HF0 A;  2CO5 A;  3PNT A;  3DEE A;  2IS6 A;  2JWT A;  1SAN A;  4D1Q A;  2HFH A;  4XOT A;  4A3D J;  4C30 A;  1PP7 U;  4Q47 A;  1C0W A;  1FT9 A;  2JPB A;  4XLH A;  3I56 I;  3MZH A;  4B44 A;  2JA5 J;  1MMS A;  2EFO A;  5M3M J;  2X6Y A;  2O5R A;  5CKT A;  3ABU A;  1WVR A;  2LKS A;  1QVT A;  2M87 A;  4MEX F;  1B1B A;  2ZXJ A;  4U7D A;  3BPV A;  4QPO A;  2HZD A;  3FXR A;  3EYY A;  2XHK A;  4BAC A;  1XSD A;  3I59 B;  5FKN A;  3IUO A;  1X4P A;  4ABZ A;  1U8R A;  2D5V A;  1OYW A;  4CCO A;  3G3Z A;  3TDU C;  2GIZ A;  3GBG A;  1HF0 A;  3GFL A;  3F72 A;  2MH2 A;  4M6X A;  3HOT A;  2K9N A;  3HPH A;  2W84 A;  3I55 I;  2CU7 A;  3CCJ I;  2AS5 F;  1FEX A;  2R7V A;  2NNY A;  3BY6 A;  1Z3Y A;  4CSW A;  3GO5 A;  2VKH A;  1LUJ B;  4Y17 A;  4G7H F;  4HG2 A;  2A6E F;  2VJI A;  1XDS A;  2EZH A;  2MLG A;  2ZSI B;  3L7W A;  3KP5 A;  2BY1 A;  5E3M A;  5L3B A;  2N8G A;  3MKL A;  4KUM A;  1SVM A;  5DTD A;  1ZG3 A;  3N4M A;  2XGE A;  2HQA A;  4M9X A;  3ZMT A;  4A3F J;  5F0F A;  2Z9O A;  4ZJZ A;  2K85 A;  2H94 A;  3AG2 H;  1P6R A;  2XGD A;  2AXT C;  1FJL A;  2R7X A;  4ZYD A;  1Y0N A;  2HEO A;  2WY8 Q;  3KP4 A;  1OCC H;  4CXF A;  5LEK A;  1U3E M;  1JUM A;  1WCM J;  1I1G A;  3NQO A;  2K02 A;  3OYD A;  2CYY A;  1RKW A;  4HW0 A;  4NQW A;  2QQ8 A;  5CYV A;  4JX4 A;  2YU9 J;  3R60 A;  2FBH A;  1OPC A;  3GLL A;  1LVK A;  1YOV B;  3CES A;  3EDP A;  3ONQ A;  4PSW A;  3K4N A;  3J81 Z;  4PFP A;  3N97 A;  2VE8 A;  5JLX A;  5LHG A;  2PJR B;  1SFU A;  2UZK A;  3FHN A;  2QZ8 A;  1FP2 A;  2LTP A;  2DT6 A;  4HF1 A;  4HPQ A;  3K69 A;  5CJ9 A;  3HL2 A;  1JJ6 C;  2IA2 A;  3OYE A;  2CS3 A;  2A3S A;  1IN5 A;  3CJT B;  5FLX Z;  4IKF A;  3LAP A;  4UVC A;  2HDC A;  3QP6 A;  2K9S A;  3A01 B;  5FD5 A;  2Z3Y A;  1YLF A;  2B63 J;  4ON0 A;  4PDK A;  2EJR A;  5KAF C;  1E3P A;  4A5M A;  4AYB N;  2VPR A;  4M6Y A;  2PJP A;  2L9V A;  2VAS A;  4A3E J;  1Z7U A;  1WH5 A;  3F8F A;  4EGY A;  2OZ6 A;  2DU9 A;  1ZGJ A;  3U2R A;  1R6R A;  1BI0 A;  3HGG A;  1Z6R A;  3HTU A;  3QYB A;  2GAU A;  3WE3 A;  4RAF A;  4PJM A;  3L2W A;  1V54 H;  3RIR A;  4LIV A;  4IHS A;  2BV6 A;  1WWX A;  4IOC F;  4M3D A;  1OCP A;  1Z0X A;  2GXG A;  3EPZ A;  1J5Y A;  3HIF A;  3WTV C;  2XVC A;  1BC8 C;  2LD5 A;  2DAO A;  3KYL A;  5EEA A;  2H6C A;  2QQB A;  2G0E A;  4BDZ A;  1YHQ I;  4OIO F;  4CYC B;  4ZH4 F;  2FEZ A;  2O3F A;  1ZYR F;  1GV2 A;  4Q4Z F;  1IC8 A;  3K2A A;  2DQR A;  4A2U A;  2CUE A;  4A0Z A;  1UAA A;  1FOX A;  2XV4 S;  2A05 A;  4RS8 A;  4S0H B;  3MKY B;  1B8I B;  3EET A;  4LOC A;  5J6X A;  2V1U A;  1ZEL A;  2HI3 A;  1WI9 A;  4RLF A;  1X3U A;  1K78 B;  4IXA A;  3CME I;  4UB8 C;  1YI2 I;  4A12 A;  3GME A;  3U1K A;  2P0W A;  4YEL A;  1V3F A;  2GOM A;  3OY9 A;  5D5U B;  3S1R J;  3VYR B;  4XOR A;  5EYR A;  2LNB A;  3BC8 A;  4EJW A;  1JXS A;  4ASN A;  2X4H A;  3CCY A;  3S17 J;  1HST A;  2UWM A;  1IAW A;  3B6C A;  1IN4 A;  1S7E A;  4XLP F;  1WJC A;  5HLG A;  2P7V B;  2BXY A;  1WFX A;  2VKV A;  4CCN A;  1SFE A;  5E1Z B;  2O8K A;  4A3L J;  2VJ5 A;  4LMY A;  4HNU A;  1ZN2 A;  1U78 A;  1WHU A;  1RIO H;  2FU4 A;  2STT A;  4KDP A;  1DU6 A;  4AVP A;  3WTX C;  1ZR2 A;  2LY9 A;  1J2X A;  2JPC A;  3OR2 C;  4LG0 B;  2OU2 A;  1T0F C;  4RAG A;  2BYV E;  2ISY A;  3TO9 A;  3WE2 A;  1XSX A;  3PUB A;  1HLV A;  3LAJ A;  1U8B A;  5DD8 A;  3RYP A;  2KL4 A;  1XMX A;  3KCC A;  4N4N B;  4JP0 A;  5E17 F;  2NRA C;  2COM A;  2JVH A;  3BG3 A;  4HOB A;  4FET A;  4Y7N J;  4IHV A;  3VOD A;  3E97 A;  3WU0 A;  2QF7 A;  3GTL J;  1AA7 A;  4G7O F;  1FNN A;  3KLO A;  5GPA A;  2M4K A;  2VKE A;  2F5E A;  3HGY A;  1XX5 A;  4KMF A;  2ELK A;  4XOP A;  3BR6 A;  3F21 A;  4DZP A;  5L3C A;  2OTJ I;  3IH2 A;  3BZK A;  2CSO A;  5HDG A;  2I8D A;  5F04 A;  3D0S A;  5K5O A;  4GCV A;  3EYI A;  2KMU A;  5CQE A;  4FIS A;  2H8R A;  4QWQ A;  3COA C;  3KLN A;  4HX7 A;  3LSK A;  4A3C J;  2VXZ A;  4BKX A;  3OSF A;  2DQL A;  3BPX A;  5ICF A;  4DJA A;  3F8M A;  3M3Y J;  1YRN B;  1TNS A;  1OCO H;  1S8N A;  1TWC J;  2EZK A;  2EQR A;  3RKQ A;  3ESW B;  3ZMZ A;  4F91 B;  2V9K A;  5D4R A;  3LSM A;  4KJZ A;  1FX7 A;  5LHI A;  2MGQ A;  3H0D A;  3HM5 A;  4DYR A;  5GTH C;  1H9G A;  4I76 A;  4BHB A;  5JI6 A;  4BNC A;  1WRJ A;  2R3S A;  1U5T C;  2CMP A;  2LLK A;  4ZZL A;  2EIM H;  3ERM A;  4R79 A;  3HEF A;  4EAT A;  3GTQ J;  3I64 A;  4PJJ A;  4MQ9 F;  5BMZ A;  4OIR F;  3R4K A;  1W36 C;  2FUG 2;  2H1K A;  1XCB A;  3PIO F;  3LOC A;  2W00 A;  4BQO A;  3L2U A;  2QA4 I;  3K1P A;  1H89 C;  2XRO A;  3UKG A;  4BJT A;  2V1D A;  5A2Q Z;  2Y2Z A;  3HRU A;  2B0L A;  3MAJ A;  2E71 A;  4BEH B;  5A2Q K;  4R1H A;  3JSP A;  1EJ9 A;  3ABT A;  2NS0 A;  2KPM A;  1ZLJ A;  4YFX F;  2K40 A;  3RKW A;  2L4M A;  1NH3 A;  2BZT A;  3M4O J;  5FKL A;  4EQQ A;  2QCO A;  4RB1 A;  2GIV A;  1P9Q C;  3C2H A;  3K0L A;  5EEH A;  2HQ5 A;  2HPI A;  3H5R A;  2K9Q A;  2XAQ A;  2X1D A;  2BW3 B;  3KEO A;  1F5T A;  5HS8 A;  4IX7 A;  3CP2 A;  2M3A A;  5HNH A;  3BJ6 A;  2WWY A;  2E34 A;  2PX9 A;  3BP8 A;  3CP8 A;  2KRC A;  3KP6 A;  5JFR A;  4UUS A;  1T95 A;  1IUY A;  1F43 A;  1ETO A;  4FE4 A;  3B73 A;  5AON A;  4B48 A;  4A0X A;  4LB6 B;  1MJB A;  2O0Y A;  5FKK A;  5DCM B;  1MH4 A;  1J9I A;  2NVY J;  4BJ6 C;  2ZJ2 A;  3NWS A;  4XRS G;  1JKQ C;  2P5K A;  1YX3 A;  3S2D J;  5E1X A;  1ACI A;  4U87 A;  1U5T B;  4IHT A;  2FBI A;  2ID6 A;  2PMU A;  5ICC A;  4IPA A;  3MEX A;  4E6K G;  1Y0U A;  1LJ9 A;  1PUF A;  5B5E C;  5K7H A;  5CVU A;  2X6X A;  3JSO A;  3SJM A;  1SFO J;  4OAY A;  3NAU A;  4A6E A;  5ED4 A;  1ULY A;  5EZG A;  3SZP A;  1ZH5 A;  4NNJ A;  1IUF A;  3QPS A;  1WGX A;  3A4C A;  3H35 A;  3U9G A;  2EA2 A;  3I59 A;  2WY7 Q;  1RUN A;  5HOD A;  1XGO A;  4RM3 A;  3G1M A;  5J40 A;  4F55 A;  3L2C A;  3BJO A;  3CC7 I;  2WB1 N;  5KK1 A;  2ZB9 A;  1FTZ A;  4RM2 A;  4NC7 A;  3KEY A;  4GYG A;  1YG2 A;  2Y9Z A;  5IYD J;  1UFM A;  3OSG A;  1Y8Q B;  2ZXI A;  1U2W A;  2CUJ A;  2BBY A;  2JRT A;  2CQK A;  5LBQ A;  4BYY A;  4L18 B;  4ZYE A;  4RAY A;  1HDD C;  2XPU A;  2V9V A;  4J19 A;  5GAH J;  1Z9C A;  3IV5 A;  1JE8 A;  3ZRG A;  2I5U A;  4LIT A;  3MWM A;  1B59 A;  2VB6 A;  4ZYA A;  2HKO A;  2IGM A;  2L3D A;  3C7J A;  2DYR H;  2HYF A;  1AOY A;  3CUQ C;  1UCR A;  5LEJ A;  1QU3 A;  2EA4 A;  4E7K A;  1TL8 A;  5FFZ A;  3A0B C;  1D0Z A;  1SVL A;  4N9H A;  4YFK F;  3EUK L;  1OYY A;  2L02 A;  3A02 A;  1HC8 A;  1GVJ A;  5FKM A;  2MA3 A;  2HKX A;  1G6N A;  1XN7 A;  3HSF A;  4XID A;  2JSP A;  1G4D A;  5ERI A;  2CQX A;  2MLK A;  2QGU A;  4FX0 A;  2KZV A;  4EJT A;  2VC0 A;  1K4T A;  1DP7 P;  2VON A;  3GTP J;  3FXL A;  2XAH A;  2ID3 A;  4IRH A;  2CG4 A;  2DXI A;  3S15 J;  2ECB A;  5DDG A;  5C4J J;  5DUI A;  3CCR I;  2DA3 A;  1LEB A;  3GZN B;  2P5L C;  3K4J A;  2Q8K A;  2PJR A;  4U7B A;  5FD6 A;  4G12 A;  2NOG A;  3H9Q A;  1MJ9 A;  1WSU A;  2CV0 A;  4KIT B;  1T33 A;  1I6H J;  3HOY J;  3FXJ A;  3IRQ A;  4RGS A;  5L3G A;  3OYN A;  2CQ7 A;  2R7Z J;  2R92 J;  3UNG C;  2D45 A;  3DU5 A;  2Z5U A;  4X1E A;  4U0V A;  4RB3 C;  1LDJ A;  2K3F A;  3DLL F;  2DA2 A;  3LQR A;  3F8C A;  1SAU A;  3HSR A;  2H09 A;  3I71 A;  4YRV A;  1E2X A;  1NG7 A;  4UHT A;  3K9T A;  2DDA A;  1RRJ A;  2O7O A;  2E1O A;  2R7D A;  4II3 A;  4J00 A;  1MD0 A;  2HDW A;  4J01 A;  2KDZ A;  1BOA A;  1GDT A;  4HDU A;  3MFK A;  2HTJ A;  1T56 A;  4PCQ A;  4NC6 A;  2OQG A;  1VQO I;  2LY1 A;  3LSI A;  4CO8 A;  1WPK A;  3S93 A;  2ZXH A;  3CZ6 A;  4KNY A;  1RET A;  3OYA A;  1O4X A;  1MNM C;  2Y0S A;  3VB2 A;  3ZQH A;  4OIP F;  3ZCO A;  4C2T A;  3PL8 A;  2KQR A;  4OIQ F;  4GRI A;  3CUQ B;  5E18 F;  4AD9 A;  1Y8R B;  5CVI A;  1R58 A;  2BXZ A;  4PJL A;  2OA4 A;  1MBK A;  3ZQI A;  2LRE A;  4XSX F;  1FTT A;  2R7Q A;  3BZ6 A;  1FIP A;  4RGU A;  4F92 B;  1XGN A;  3HUG B;  2NVQ J;  2VOD A;  1KU9 A;  4EGZ A;  1B8I A;  3W2A A;  2DFE A;  1LE8 A;  1GLN A;  1VQ9 I;  3F6V A;  2E19 A;  4UV8 A;  2TCT A;  3MQ0 A;  2ESH A;  3MN2 A;  3D1N I;  3ZQ7 A;  3CO7 C;  2Z33 A;  1K79 A;  3LSG A;  4BXU A;  3CCQ I;  3CF5 F;  3F23 A;  2OPT A;  2ELJ A;  2P81 A;  2E2I J;  1U9N A;  3SFZ A;  1F36 A;  4OMZ A;  3BCB A;  2XAG A;  3BTJ A;  4ANJ A;  5BQT A;  3TO7 A;  3WTY C;  1S6L A;  2NOJ B;  1WJB A;  1ON1 A;  3DKY A;  2HVR A;  5ILV A;  2AHQ A;  3TOB A;  1FLI A;  1YW9 A;  2FOW A;  2FOK A;  2PMH A;  1XB4 A;  3HOX J;  3AG4 H;  4L9T A;  4IO9 F;  3PSF A;  4I09 A;  2OAZ A;  4P5O A;  1DUX C;  3GYH X;  3JRH A;  3IH3 A;  4CCK A;  2L9S A;  3PM1 A;  2ZC2 A;  1IRZ A;  1FMV A;  1FOK A;  2M0M A;  1P2F A;  1LDK B;  4IHY A;  3CDI A;  3HOW J;  4M73 A;  2R7R A;  2R7W A;  1TC3 C;  1BOB A;  3H36 A;  1VQN I;  2VOP A;  2DOF A;  1UZC A;  4HAM A;  1FWZ A;  1Y1W J;  1XSV A;  1F4K A;  3S2W A;  3CD6 I;  3LSR A;  3E7L A;  1D3Y A;  1H88 C;  3GFM A;  3N05 A;  4ZDO A;  5FLM J;  2DT5 A;  1YS7 A;  3WTW C;  1WJA A;  4ZDL A;  3T8R A;  5FB2 A;  2RNG A;  2X85 A;  1QZE A;  2F4M B;  4P9F A;  4EVI A;  4OMY A;  2FX0 A;  5JLW A;  3GF2 A;  4E7L A;  1R49 A;  1VZ0 A;  3TO6 A;  4XRS A;  2E2H J;  4BHP A;  4MTE A;  4Y3O A;  4XRF A;  4E7J A;  1SMY F;  1ZRE A;  5GTI C;  1TT0 A;  3FMS A;  5DYM A;  4IL6 C;  5E79 C;  2LMD A;  3CCM I;  3CO6 C;  4KFC A;  2LF8 A;  3H3V K;  3LST A;  1B72 B;  5JHF A;  3GTG J;  3FXK A;  4CDG A;  4JX5 A;  3L09 A;  5KVR A;  1YRN A;  1WJF A;  4UY8 I;  4A3J J;  2PBI A;  3QP5 A;  4HNT A;  5HOO A;  3GFI A;  5CVJ A;  4NDL A;  3OIO A;  3NEU A;  3CUO A;  2IS4 A;  2VPL A;  4JOM A;  3K1M A;  3K7A J;  1EH8 A;  2LRD A;  4B8X A;  2VE9 A;  2E1C A;  3CC4 I;  1SC7 A;  3LWF A;  2QEX I;  3NRV A;  3BTI A;  3TP0 A;  3DU6 A;  2F4I A;  2DFI A;  4I01 A;  4O5V A;  3PNY A;  4RLQ A;  4XLC A;  1V55 H;  1HKQ A;  2JK3 A;  1W5T A;  3H9G A;  3AL0 C;  5D8L B;  4B09 A;  3J7A O;  3L9F A;  2EPF A;  2AQF A;  5EG0 A;  1B4A A;  2XC7 A;  2KZG A;  4CA0 A;  5K7F A;  1K6O A;  3FIW A;  3GVA A;  3L00 A;  3HZJ A;  3PFY A;  1LFB A;  1ZRF A;  1KA8 A;  3OL4 A;  3ZQL A;  2DMP A;  2JRM A;  2V7F A;  1TTY A;  4AU7 A;  2ZJP F;  2DA7 A;  1YE9 A;  2STW A;  2XB5 A;  3I53 A;  2Q2E B;  4BEH A;  3TMO A;  3IKV A;  2DPD A;  3ELK A;  1T39 A;  3DBR B;  1VQ5 I;  4E4H A;  3BG9 A;  4IRG A;  3JR9 A;  1YQA A;  1I3A A;  4BJ5 C;  2KJB A;  3R0J A;  1XG1 A;  1CF7 B;  2R5Z B;  1R23 A;  3ABM H;  1FPQ A;  5FKO A;  2L9N A;  2HDD A;  3JRC A;  5J8C A;  1D5Y A;  3C18 A;  2MC4 A;  1X1D A;  5D4S A;  2BW3 A;  4C9Y A;  5HDK A;  1KU7 A;  3GWZ A;  2EWN A;  2M34 A;  3HPG A;  4XQF A;  2DFH A;  3SZT A;  1PP8 F;  1MMG A;  4YFN F;  1TW2 A;  1D8K A;  1T6S A;  3H3U A;  1E17 A;  3I4M J;  1S9H A;  1W7P B;  1YYV A;  2P4W A;  4I6Z A;  2AXL A;  4XSZ F;  4XKV A;  4MIM A;  2DK8 A;  4UUT A;  4LGW A;  3RI4 A;  2G9W A;  2LOO A;  5LGT A;  2DCE A;  1PDN C;  2GBY A;  1IZ1 A;  4XR6 A;  4LLL A;  1H8A C;  1AKH B;  2NVT J;  1OLT A;  2LBF A;  2CRG A;  4EV0 A;  1ZAO A;  5D8K B;  1VND A;  3DEW A;  1TWG J;  1O57 A;  2ZNY A;  3AL0 B;  3K70 C;  1S29 A;  2DBB A;  5LRS A;  5E3L A;  4E7S A;  2QYO A;  2MAB A;  3K2Z A;  4WXH A;  2ELH A;  2R4G A;  3CMA I;  3BR3 A;  1FOY A;  3VFZ A;  1SD5 A;  2DOA A;  3R6S A;  2BE5 F;  2CV1 A;  1VQ4 I;  4IRI A;  2PMZ N;  4LIU A;  2VQH A;  2XF6 A;  1D1C A;  2ICW G;  3DPU A;  2IS1 A;  3ZMU A;  1UHS A;  1QZY A;  4YII A;  3EUH C;  2G7U A;  4QIW N;  5IP9 J;  3H0G J;  3L2Q A;  4EJV A;  1J09 A;  3L2R A;  3OIQ A;  3HG9 A;  4WXC A;  2LKP A;  2YU3 A;  2PI0 A;  2WAQ A;  5HS9 A;  1PJR A;  1X3Z B;  2XRN A;  2CGP A;  4L9N A;  3ULQ B;  2RKH A;  1QRY A;  4XLA A;  2B7E A;  2DW4 A;  1W4M A;  5KNL A;  3WHB A;  2LVS A;  1VQ6 I;  1V4R A;  5D6E A;  4O6J A;  1MDM B;  2YX7 A;  5CQG A;  1IF1 A;  4GFB A;  4B1R A;  2QQA A;  2R7O A;  2VBY A;  5DUK A;  4IHX A;  2E60 A;  1R4M B;  4DQ2 A;  1IDZ A;  3GW2 A;  1X3W B;  1GVD A;  3HBL A;  5E1W A;  3ZOB A;  3CJN A;  4EEF G;  1GV5 A;  2W82 A;  4HBL A;  1STZ A;  1QQI A;  1UMQ A;  3A03 A;  2LH9 A;  1NG6 A;  2CW7 A;  2DJI A;  2Y31 A;  1J0R A;  4PGG A;  4Y4R A;  2WV1 A;  2EFQ A;  4FE7 A;  4HZF A;  4X6A J;  1ZGW A;  5B3S H;  1R71 A;  3ZMV A;  4DIQ A;  1ETW A;  3BWG A;  1JT6 A;  1OR7 C;  2BGC A;  2HQR A;  4F52 A;  2HPM A;  2LK2 A;  1TT5 B;  3FK6 A;  4K2E A;  4E70 A;  2XGC A;  2R7U A;  2ZME C;  4JYK A;  4MGR A;  3D5S C;  5FRM A;  5IT3 A;  4ZTF A;  1LFP A;  2IEK A;  1BR4 A;  5L3E A;  1MMN A;  2P6T A;  5ICG A;  1ZTR A;  3IAS 2;  1CQT A;  1DQU A;  4LB5 A;  3E6D A;  3VPR A;  4RGX A;  3IH4 A;  5IT9 K;  4L5E A;  2Y69 H;  4P55 A;  1IN7 A;  3WU2 C;  3G73 A;  2OD5 A;  2M7B A;  4BL0 B;  1T08 B;  1ITY A;  1SFK A;  2K9M A;  4AWX B;  2EIJ H;  2K9L A;  4II2 A;  4MFD A;  2AO9 A;  2M1B A;  3C3W A;  3O6B B;  2VLA A;  1HW5 A;  4W97 A;  3S3N A;  3IWF A;  4XN0 A;  2X48 A;  1D0X A;  1ORK A;  2IXS A;  2B9S A;  2QSH X;  4DYQ A;  5TGT A;  4LLG F;  3DCF A;  4RAZ A;  2V6C A;  2E5N A;  2H1L A;  1GXP A;  4FCY A;  1D1B A;  3KP3 A;  1V5E A;  2W4S A;  2VI6 A;  2XAU A;  3V8L A;  3CUQ A;  5F1R A;  1Z05 A;  1MMD A;  4FTH A;  1SAX A;  3ML6 A;  4XNF A;  1KQ9 A;  2KDO A;  3S32 A;  4BY1 J;  3HSE A;  4CZZ A;  4BE0 A;  1UHW A;  3FKJ A;  3LFK A;  3SXY A;  1VQM I;  1QA6 A;  2Y0M A;  4D7N A;  1R4N B;  2VUM J;  2IGN A;  2DA6 A;  1RR8 C;  4LJZ F;  1V5F A;  1YJN I;  1JGS A;  5E8G A;  1A36 A;  3SYT A;  1HCR A;  1RNL A;  1KQ8 A;  2VBZ A;  2NVX J;  2KKO A;  3I5U A;  1XTA A;  5DM7 F;  4RB2 C;  1QGP A;  3ZP5 A;  2CQQ A;  4C3I J;  1VI0 A;  4AIJ A;  3D5L A;  5B1B H;  4ZDP A;  2GWR A;  1G3S A;  2DK5 A;  2ZME B;  2HR3 A;  3DKX A;  1EKE A;  4DZJ A;  2V4J C;  3Q0W A;  5HS7 A;  3RKX A;  3V4G A;  2D1V A;  5AIP A;  4GDF A;  2OZU A;  1VQL I;  4NHJ A;  2A6T A;  3OYH A;  5TJJ A;  5J4V A;  5L3D A;  4HX8 A;  1FC3 A;  5BOX A;  3ZN1 A;  4GYI A;  1N78 A;  2R7F A;  3BOQ A;  5CVV A;  2H8W A;  2QSF X;  3I58 A;  3O2P E;  5LLQ A;  5BPI A;  1O7L A;  1U9O A;  3VYU B;  1MW7 A;  4HSR A;  2YSR A;  3F8B A;  3DTK A;  3KZY A;  4IVN A;  1YJ9 I;  2MW8 A;  4BS9 A;  1IXC A;  3BRO A;  3CMM A;  1JGG A;  4ENM A;  2F48 A;  5GAD J;  3PO3 J;  2L0K A;  5FO5 A;  1OKR A;  4RA2 A;  3MKZ A;  2DYS H;  2FA5 A;  3CCU I;  5F64 A;  3R61 A;  4LFU A;  1WZ2 A;  2NS7 A;  3RPQ A;  3ISP A;  2CFX A;  3GZ5 A;  3U21 A;  1GUU A;  3S1N J;  3FDY A;  4XN3 A;  3C2B A;  4KIS A;  1IV6 A;  5CLS A;  3IAM 2;  3FXQ A;  5DV5 A;  4KA4 A;  2F4O B;  2FBK A;  3H92 A;  3ABL H;  4Q5S F;  4L9V A;  3BQY A;  5ILU A;  1OIS A;  2ZO4 A;  3T5X A;  1D8J A;  5E3N A;  4FQG A;  1AHD P;  2P5V A;  2OCC H;  1W0T A;  3K4M A;  2LC2 A;  4QLC U;  1MKM A;  2FQ3 A;  3BJA A;  5C44 J;  2M8E A;  1FOW A;  2Z2S B;  3OR1 C;  3V7C A;  2VQC A;  2HS5 A;  2VBX A;  3V7R A;  3FZV A;  3CJQ B;  4WK8 F;  1LNW A;  3FM5 A;  1Z91 A;  4AYB A;  2QKM B;  3RZO J;  1G59 A;  3FXO A;  3KET A;  4XBF A;  1GHC A;  3BTC A;  2Z16 A;  2CWE A;  4ESB A;  1RKT A;  2KIM A;  2H6B A;  2X1E A;  4A3I J;  2IA0 A;  3Q9V A;  1IN8 A;  2A07 F;  1BBY A;  2MH9 A;  2VJ4 A;  2HNH A;  1BW6 A;  2E35 A;  2ZKZ A;  2MC3 A;  4PJ0 C;  4PK4 A;  5F27 A;  4IQJ A;  4FT8 A;  1G3Y A;  2L2O A;  3PIP F;  1BI3 A;  4ESF A;  1W5C C;  2RC4 A;  3OYG A;  3M8J A;  3GUD A;  2HOA A;  1IV8 A;  2OJE D;  2X6O A;  3RCO A;  1OYI A;  1BIA A;  5FFX A;  1X1A A;  1SD4 A;  3L2V A;  4PGH A;  3HJE A;  4XM3 A;  3MCZ A;  5HLH A;  2CJJ A;  1PVE A;  2HZT A;  3FM3 A;  1QNT A;  1WI3 A;  2OCE A;  4A69 C;  4IQ4 A;  2HVS A;  4XL9 A;  1FBS A;  5F6F A;  3HRT A;  3HDD A;  2KFD A;  3FBI B;  2F5V A;  3Q0V A;  3OIP A;  3RTR A;  4UB6 C;  2JA8 J;  1K61 A;  3DXJ F;  5E8I A;  3B02 A;  4KT6 A;  3VDX A;  1X1P A;  4XK4 A;  3CC2 I;  4L5J A;  4PUS A;  2K5C A;  4XIC A;  2E2J J;  4BE1 A;  2GQQ A;  3HHH A;  5EGO B;  3JCU C;  3B6A A;  3E1S A;  1JUP A;  2ZFW A;  3HKZ N;  3BG7 A;  1YS6 A;  2OBP A;  4QPQ A;  4I98 B;  1WH7 A;  1Y56 A;  5IPA A;  4XLF A;  1ZG5 A;  4A3B J;  3SDB A;  3JRE A;  3REO A;  5ICE A;  1HDP A;  3PUF A;  3BZC A;  1OMI A;  2IRF G;  5LD2 C;  3CDL A;  1X19 A;  2XGX A;  3OOP A;  3TOA A;  5JVT A;  2GXA A;  2V6E A;  2HYJ A;  3OYM A;  1YX5 A;  5H6R A;  1W0U A;  1I3Q J;  4BAY A;  2JQ7 A;  4N4O B;  1O3Q A;  3W6V A;  3I0T A;  1IRF A;  3W2W A;  4X0G A;  3BLY A;  4OWR B;  2M9H A;  1JHH A;  2ACJ A;  1O3T A;  3KYD B;  2XAJ A;  1D0Y A;  3RYR A;  3Q5F A;  4G94 A;  1N75 A;  4XKB A;  4NUB A;  1S72 I;  1UST A;  4R8H A;  2E1M B;  3OOU A;  3WTT C;  1B9M A;  1DU0 A;  1TQP A;  1PUE E;  2EH3 A;  4IJA A;  4W1U A;  3QYE A;  2K27 A;  1TW3 A;  1A6I A;  4CCL A;  5BNG A;  2QBY B;  1FSE A;  3HYI A;  2DN0 A;  3S8P A;  1ZR4 A;  3FK7 A;  3A01 A;  5J47 A;  3IKT A;  2HXO A;  1LDD A;  2VKD A;  4CCJ A;  4DBR A;  3RPU D;  2M2E A;  3S14 J;  3KP7 A;  2VL8 A;  1KZH A;  4KN4 X;  1FYL A;  5ILS A;  2DJN A;  2Q1Z B;  1EH7 A;  1N25 A;  2FNA A;  1IN6 A;  1A04 A;  4ENN A;  2Z99 A;  5JR3 A;  3M9A A;  4U0Y A;  2DMQ A;  1QPM A;  3DQV C;  3NWT A;  2LDU A;  1FMW A;  4Q48 A;  1K6Y A;  5EZH A;  1JUS A;  4F7Z A;  4A5N A;  2P7C B;  4MLO A;  1P7I A;  4TV7 A;  2AQE A;  2JMW A;  4HV5 A;  1W1W E;  1P4X A;  3OWT A;  4BQA A;  3V42 A;  3DBH B;  4CYC A;  3RZD J;  2F5F A;  2L4A A;  4M72 A;  1FSH A;  2JSC A;  2MYS A;  3TKY A;  3DTE A;  1J75 A;  2CUF A;  1ZKG A;  2FNP A;  2LYC A;  3JRI A;  4XRM A;  1ENH A;  2IGK A;  4I0A A;  3I3L A;  1MJA A;  4HV6 A;  1DPU A;  1MSE C;  1VQ8 I;  2KIQ A;  2KHM A;  3JRB A;  3F3X A;  4RBO A;  3MZ8 A;  1VQK I;  1P7J A;  3ROU A;  3O8G A;  1K78 A;  1ETK A;  1OCR H;  1XGS A;  5F1J A;  4G6T B;  5K1Y A;  5GAE J;  3FIS A;  3OS2 A;  4WWC A;  1R5G A;  3VOE A;  2HOE A;  5EF6 A;  3KIO A;  5B66 C;  3E5X A;  3SZG A;  3GZ6 A;  3J7A Y;  3ZR8 X;  1E3H A;  1ERD A;  3ASN H;  2DPU A;  3KZZ A;  1R1V A;  3LFU A;  3CF2 A;  1S7A A;  2EZI A;  3OYJ A;  2RDP A;  2KIF A;  4H4K C;  2FSW A;  3OV8 A;  2DA4 A;  2K4B A;  1CGP A;  2WAQ N;  3TW6 A;  4KN7 X;  4EJO A;  2PEX A;  1LEA A;  1OJL A;  2OUM A;  3M1C A;  5IYC J;  1OFC X;  1QPI A;  5EJC A;  1TWA J;  1X1C A;  1Q1H A;  3HRS A;  4YG2 F;  1SD7 A;  5JHU A;  3S16 J;  1EV7 A;  1R1U A;  2DMN A;  1W36 D;  1H0M A;  1O3R A;  4BGD A;  3DP7 A;  2XAF A;  4JBA A;  1B9N A;  3OYK A;  1OCZ H;  4KT5 C;  3BR5 A;  4LG0 A;  4B43 A;  3LSP A;  2ZJR F;  1AWC A;  5BS6 A;  1RES A;  1ZK8 A;  1G8X A;  1OQY A;  3SHF A;  3HOU J;  2L54 A;  3PSI A;  5J1R A;  2XIG A;  4YIR X;  3FXU A;  2VXD A;  1ETQ A;  2MD0 A;  5DD4 A;  1YJW I;  3WGG A;  1LVA A;  3Q9S A;  4BHC A;  1XC5 A;  4M3G A;  1BC7 C;  2LFB A;  2QWW A;  1GXQ A;  1QVU A;  4M3F A;  2PLY A;  4DOZ A;  1W5S A;  2FD5 A;  3CDH A;  3DV8 A;  3VSL A;  5M5W J;  1MMA A;  2E7X A;  3U1D A;  2IS2 A;  2Y30 A;  2ME0 A;  4D9J A;  2F5C A;  2DOD A;  4FX4 A;  2Q0O A;  2LP0 A;  4KMU X;  1I39 A;  5C3E J;  3QRF F;  2CUZ A;  4HQM A;  1DPR A;  4HA8 A;  2EFW A;  2FRH A;  1MBF A;  3D5R C;  1TQI A;  1JHF A;  1U6G A;  3ZN0 A;  1OR7 A;  4Y33 A;  4UUV A;  2EV0 A;  2W85 A;  4M71 A;  2DTZ A;  2BEO A;  3BCA A;  2XKP A;  3SFI A;  4S05 A;  1FYM A;  2W7N A;  2QQ9 A;  4ENK A;  3IWZ A;  3VSK A;  1XDU A;  3BTL A;  2NS8 A;  1SFX A;  2TRT A;  5D5X B;  2DDB A;  2ZCW A;  2GA1 A;  4B4C A;  2CV2 A;  1ZG1 A;  3GFJ A;  2LR8 A;  5FJ8 J;  3QYF A;  3I4N J;  4UUS B;  3RPU A;  1SVO A;  1FY7 A;  3HTS B;  3IHU A;  2BOL A;  4RB0 A;  3TGN A;  2LKX A;  3AG3 H;  3LSH A;  4G6Q A;  3UR3 C;  3ZMD A;  2JJ7 A;  5J8F A;  4V19 K;  2BVM A;  2W24 A;  4WF2 A;  1T0F A;  1KU3 A;  3E6B A;  4RMN A;  3TBI A;  3ZQQ A;  1R5I D;  1KYW A;  4HYE A;  2BY2 A;  1KYZ A;  3TP3 A;  1ONV A;  2L7Z A;  2X9D A;  3M07 A;  1Z21 A;  1BJZ A;  1NHA A;  1Z67 A;  2L7F P;  1M1E B;  1LKX A;  2KLO A;  2XPW A;  2R0Q C;  1XMA A;  4V2G A;  2CH0 A;  5FRO A;  1PUF B;  4Y52 J;  3E6C C;  1R1T A;  2XSJ C;  3DLA A;  2M4G A;  5DEQ A;  1MBG A;  2L7M P;  2PFB A;  4ETS A;  3QPL A;  3DFG A;  5DS9 A;  3H1C A;  3CTA A;  2IP2 A;  4G6D A;  3T0Y A;  3WTS C;  2ETH A;  4OOI A;  2UV1 A;  1TZL A;  3NAR A;  4F3Q A;  3F0C A;  1D5V A;  4BXF A;  2P8T A;  1YIO A;  3KYC B;  1JKO C;  1R36 A;  4AIK A;  4Z6Y A;  3K4K A;  3LMM A;  2O61 A;  3V8J A;  1IXR C;  4C3J J;  3CCL I;  4AC0 A;  1ZGA A;  3JTG A;  3FKI J;  3F9K A;  1I5Z A;  2XF5 A;  2IJL A;  2OF7 A;  1F9N A;  3HB9 A;  5DCM A;  4KIB A;  3C1D A;  3PQJ A;  2M8G X;  5HNF A;  5IY5 H;  4B3A A;  2EB7 A;  2JUC A;  2WA0 A;  5JVG F;  2MBF A;  3G1O A;  5K5Q A;  3WGI A;  5HDN A;  1IRX A;  1U5T A;  1DGR M;  3BG6 A;  5LRR A;  4ZZD A;  4U0W A;  1P4W A;  3QQA A;  2NNN A;  4Z2Y A;  3JW4 A;  1UJ8 A;  3IC7 A;  2RV8 A;  1BN5 A;  3TED A;  4B47 A;  4ZTJ A;  1I27 A;  5D5W B;  2KIS A;  1QHG A;  1BM9 A;  2UXX A;  2XKO A;  3QOD A;  3FF5 A;  2IBD A;  4NB5 A;  4DNC A;  3WOD F;  2KT0 A;  1MH3 A;  2X0L A;  2R5Y B;  4Y13 A;  4XKW A;  4BQQ A;  3OYC A;  4XLN F;  2DT7 B;  1VTN C;  1MGT A;  3I9V 2;  1LB2 A;  5IOZ A;  3G1L A;  3DF8 A;  3J81 K;  2GA2 A;  2QM3 A;  2XB0 X;  4P1W A;  1L3L A;  4UVB A;  4MQV A;  3S3M A;  1HA8 A;  3MD2 A;  1POG A;  4IF4 A;  4HDV A;  1IG7 A;  4BDY A;  3LA3 A;  3ZQG A;  2MFZ A;  3JTH A;  3RDI A;  1YIJ I;  1B6A A;  5EGO A;  4RDU A;  5FLX K;  3H5A A;  2QUF A;  3A2K A;  1J59 A;  3ZMS A;  2BHZ A;  4A3M J;  3LL7 A;  5LGN A;  3J80 Z;  3F22 A;  1MSF C;  3WG9 A;  1E3O C;  3J80 K;  2HWV A;  2E1N A;  3FMR A;  4BBR J;  1BI1 A;  1SMT A;  5FGM A;  1HKS A;  3AAF A;  4MTD A;  3CMY A;  3DPT A;  1R00 A;  1Z3X A;  3P9K A;  2LG4 A;  4BQN A;  2EBI A;  3RJP A;  3ZXS A;  1MBE A;  2QLZ A;  4LLN A;  2RVC A;  2CW8 A;  2EIK H;  5IP7 J;  1A5J A;  1YFH A;  5CVR A;  3AG1 H;  1YIT I;  4UV9 A;  4N9I A;  3LA7 A;  2LF7 A;  1R7J A;  5J1Y A;  1X2M A;  4XMY A;  5HLI A;  2DMT A;  2Y75 A;  3ECO A;  1TBX A;  2OC6 A;  5GAG J;  1JTX A;  2ADU A;  2FE3 A;  4AM3 A;  2GZW A;  2O6G E;  2GOX B;  5BPD A;  3H5N A;  2JA2 A;  2GM4 A;  2M30 A;  1JKR C;  1LE8 B;  2QBY A;  2HGC A;  2VIX A;  3HOZ J;  1G2H A;  5H6Q A;  3ZGK A;  5IT9 Z;  1IDY A;  3KE2 A;  3GX4 X;  1SD6 A; 
#chains in the Genus database with same CATH homology
 1NTC A;  3BTC A;  3BQZ A;  4AUX A;  5FKN A;  5M5Y J;  1RKT A;  4A3I J;  4ABZ A;  2D5V A;  3ZQI A;  1MBK A;  1BW6 A;  1JTY A;  5F27 A;  3GBG A;  1FTT A;  1HF0 A;  1FIP A;  2K9N A;  2NVQ J;  2CU7 A;  1B8I A;  1LE8 A;  1FEX A;  2E19 A;  2TCT A;  1VFC A;  2HOA A;  2X6O A;  3MN2 A;  3D1N I;  1JKP C;  3BR2 A;  3LSG A;  4DW6 A;  2EZH A;  2CJJ A;  1ETX A;  2HXI A;  2OPT A;  2P81 A;  5E3M A;  2E2I J;  1U9N A;  1WI3 A;  2N8G A;  3MKL A;  4A69 C;  1IGN A;  5DTD A;  1F36 A;  1ETV A;  3BT9 A;  2XGE A;  3HDD A;  3BTJ A;  4A3F J;  5F0F A;  3Q0V A;  1K83 J;  2JA8 J;  1K61 A;  2AHQ A;  2XGD A;  3MVP A;  1FJL A;  4XK4 A;  3HOX J;  9ANT A;  4XIC A;  1RPW A;  2E2J J;  1JUM A;  1I50 J;  1WCM J;  2M0C A;  1NK3 P;  4QSH A;  3IH3 A;  5EGO B;  3JRH A;  1RKW A;  3PM1 A;  3B6A A;  2DA1 A;  1JUP A;  4JX4 A;  3HKZ N;  1IRZ A;  2YU9 J;  4IHY A;  3HOW J;  1WH7 A;  1TC3 C;  5IPA A;  3CQZ J;  1Y1W J;  4A3B J;  3JRE A;  5JLX A;  2EZL A;  1HDP A;  3LSR A;  3E7L A;  1H88 C;  1BW5 A;  2LTP A;  3CDL A;  1JJ6 C;  2HYJ A;  5FLM J;  1W0U A;  1I3Q J;  3JRG A;  2K9S A;  3A01 B;  1HOM A;  3W6V A;  2B63 J;  5F08 A;  2M9H A;  3GTJ J;  2FX0 A;  4AYB N;  5JLW A;  2Y0S N;  2VPR A;  4XRS A;  2E2H J;  3Q3S A;  4A3E J;  1WH5 A;  2DMU A;  3OOU A;  3HGG A;  2XPV A;  1DU0 A;  3BR1 A;  3H3V K;  3L1P A;  2EH3 A;  1B72 B;  4W1U A;  3GTG J;  5EG0 B;  1A6I A;  4JX5 A;  2XRL A;  5BNG A;  1YRN A;  4M3D A;  1OCP A;  1Z0X A;  2DN0 A;  1BA5 A;  1ZR4 A;  3FK7 A;  3A01 A;  4A3J J;  5E3O A;  2HXO A;  2LD5 A;  4NDL A;  3OIO A;  2YUS A;  2M2E A;  5EEA A;  2G0E A;  3WHC A;  1TWF J;  5F0C A;  3K7A J;  1NK2 P;  4CYC B;  3S14 J;  4JX6 A;  1MBH A;  3BTI A;  3LSJ A;  3TP0 A;  1GV2 A;  2DJN A;  3TW7 A;  1IC8 A;  3K2A A;  2JK3 A;  2CUE A;  4D5F A;  1B72 A;  3RQI A;  4D7M A;  2COB A;  2DMQ A;  4S0H B;  1ETY A;  5EG0 A;  1B8I B;  5K7F A;  4LOC A;  3FIW A;  5EZH A;  1JUS A;  2HI3 A;  4MLO A;  1LFB A;  1P7I A;  3ZQL A;  2DMP A;  1APL C;  2R93 J;  2JMW A;  4BBS J;  4HNV A;  4CYC A;  2DA7 A;  3RZD J;  2XB5 A;  3BG5 A;  3S1R J;  1RR7 A;  2FQ4 A;  2CUF A;  5EYR A;  1ZKG A;  3BG9 A;  3S17 J;  3CCY A;  3JR9 A;  3JRI A;  4XRM A;  1ENH A;  1XG1 A;  1MSE C;  2R5Z B;  3B6C A;  3JRB A;  1OCT C;  5FKO A;  1S7E A;  4RBO A;  2HDD A;  1P7J A;  2VKV A;  3O8G A;  2O8K A;  1ETK A;  3JRC A;  5F1J A;  4A3L J;  3FIS A;  2O9L A;  1D5Y A;  1U78 A;  5EF6 A;  3PO2 J;  2M34 A;  1DU6 A;  1ZR2 A;  2LY9 A;  2EZI A;  4BY7 J;  2YS9 A;  5GPC A;  3I4M J;  4I6Z A;  1HLV A;  1JT0 A;  1U8B A;  2DA4 A;  3S1Q J;  2WAQ N;  4MIM A;  3TW6 A;  2R5Z A;  4JP0 A;  5IYC J;  1OJL A;  4UUT A;  1OFC X;  1QPI A;  4M3E A;  1TWA J;  1LFU P;  3BG3 A;  4Y7N J;  4IHV A;  2QF7 A;  3GTL J;  2GBY A;  3S16 J;  5GPA A;  1H8A C;  2DMN A;  2VKE A;  1AKH B;  2NVT J;  2CRG A;  2RAE A;  3HGY A;  2XSD C;  4V2F A;  2MG4 A;  1BL0 A;  2ELK A;  3Q0U A;  1VND A;  3DEW A;  3BR6 A;  4DZP A;  1TWG J;  3BR5 A;  3LSP A;  3IH2 A;  1RES A;  5E3L A;  3ZQF A;  1ZK8 A;  5F04 A;  5GP9 A;  3HOU J;  4FIS A;  2H8R A;  3BR3 A;  5J1R A;  3S1M J;  4C3H J;  3S2H J;  1ETQ A;  4A3C J;  2PMZ N;  4BKX A;  3OSF A;  3M3Y J;  5FLV A;  2JA7 J;  1XC5 A;  4M3G A;  1YRN B;  2LFB A;  1UHS A;  1AKH A;  1TWC J;  1QVU A;  2EZK A;  4M3F A;  2EQR A;  3H0G J;  4QIW N;  5IP9 J;  3RKQ A;  2I10 A;  2FD5 A;  4IEJ A;  5M5W J;  2Y30 A;  2ME0 A;  2MGQ A;  3HM5 A;  4DYR A;  4I76 A;  2LP0 A;  5C3E J;  4MFE A;  1Y1V J;  1MBF A;  2LLK A;  1QRY A;  3HEF A;  3WHB A;  2LVS A;  3GTQ J;  2DTZ A;  3SFI A;  4B1R A;  4GFB A;  4A93 J;  1VF9 A;  2H1K A;  3LOC A;  4IHX A;  3BTL A;  5J3L A;  2R5Y A;  2NS8 A;  1H89 C;  1IDZ A;  3UKG A;  2TRT A;  1GVD A;  3HBL A;  3O8H A;  3ZQC A;  3ZOB A;  2Y2Z A;  4EEF G;  2L9R A;  1GV5 A;  1X2N A;  4B4C A;  1Z77 A;  2LR8 A;  1UMQ A;  3A03 A;  2DA5 A;  2Y9Y A;  2K40 A;  1XS9 A;  5FJ8 J;  2JN6 A;  3I4N J;  4UUS B;  3M4O J;  2Y31 A;  4BXX J;  2WV1 A;  5FKL A;  4FE7 A;  2LKX A;  2QCO A;  4X6A J;  1ZGW A;  2JJ7 A;  4C2M J;  4D5C A;  2HQ5 A;  1ETW A;  1JT6 A;  2K9Q A;  4QTR A;  2FJ1 A;  2W48 A;  2LK2 A;  3FK6 A;  3TP3 A;  2L7Z A;  2X9D A;  2XGC A;  1BJZ A;  4JYK A;  2L7F P;  2R0Q C;  2XPW A;  5F0H A;  2IEK A;  4V2G A;  1PUF B;  4A3K J;  2GLO A;  4Y52 J;  4UUS A;  1F43 A;  1ETO A;  4FE4 A;  1MBG A;  1ZTR A;  2L7M P;  1CQT A;  3QPL A;  5FKK A;  3VPR A;  5DS9 A;  3LNQ A;  1FIA A;  3IH4 A;  3JRF A;  1MH4 A;  2NVY J;  3BR0 A;  4L5E A;  1TWH J;  4MO7 A;  4XRS G;  1JKQ C;  2ECC A;  1ITY A;  3S2D J;  3SDG A;  3NAR A;  3F0C A;  5M3F J;  4MFD A;  5IYB J;  2HOT A;  1JJ8 C;  2AO9 A;  1IJW C;  1JKO C;  4W97 A;  2ID6 A;  4C3J J;  2X48 A;  1AU7 A;  4AC0 A;  5IOY A;  1ORK A;  3FKI J;  4DYQ A;  1PUF A;  5K7H A;  3SJM A;  1SFO J;  3DCF A;  3NAU A;  2OF7 A;  5EZG A;  4FCY A;  5IP6 A;  2ME6 A;  1IUF A;  2VI6 A;  3HB9 A;  3QPS A;  1WGX A;  2M8G X;  4B3A A;  5HOD A;  4FTH A;  3G1M A;  3G1O A;  4A3G J;  2WB1 N;  4BY1 J;  2ZB9 A;  4M6V A;  1FTZ A;  1ZQ3 P;  4D7N A;  5K7Z A;  2Y9Z A;  5IYD J;  3OSG A;  2VUM J;  3QQA A;  2DA6 A;  1HDD C;  1HCR A;  5J1U A;  2XPU A;  3TED A;  2MSY A;  1EF4 A;  4J19 A;  2NVX J;  5C4X J;  3JRD A;  3IV5 A;  3GTK J;  2CQQ A;  2IBD A;  1VI0 A;  4C3I J;  1MBJ A;  2KT0 A;  1MH3 A;  4DYC A;  2R5Y B;  4DZJ A;  3Q0W A;  2IAI A;  4IHW A;  1X58 A;  5IOZ A;  3G1L A;  1Q1V A;  2XB0 X;  3A02 A;  3GTM J;  5FKM A;  1IG7 A;  1POG A;  1UG2 A;  3ZQG A;  4XID A;  1R9T J;  2JA6 J;  5EGO A;  2CQX A;  4RDU A;  2HOS A;  1U9O A;  4A3M J;  1MSF C;  5M5X J;  3GTP J;  1E3O C;  2ID3 A;  3S15 J;  2ECB A;  4BBR J;  5C4J J;  2MW8 A;  4M3B A;  2DA3 A;  1JGG A;  3CMY A;  3PO3 J;  5EDN A;  3GTO J;  2EBI A;  2L0K A;  4G12 A;  2NOG A;  1MBE A;  1GT0 C;  1T33 A;  1I6H J;  3HOY J;  5IP7 J;  1A5J A;  3HOV J;  2R7Z J;  2R92 J;  2NS7 A;  4X1E A;  1GUU A;  3JRA A;  3S1N J;  2DA2 A;  5J1Y A;  3C2B A;  1X2M A;  1IV6 A;  2DMT A;  2O7O A;  2E1O A;  1JTX A;  3BQY A;  5E3N A;  1AHD P;  2JWT A;  1SAN A;  2KDZ A;  1W0T A;  1GDT A;  4A3D J;  5C44 J;  1T56 A;  2GM4 A;  1JKR C;  2JA5 J;  1LE8 B;  3HOZ J;  5M3M J;  1WPK A;  1RET A;  1O4X A;  1MNM C;  3RZO J;  1QVT A;  1G2H A;  1IDY A;  3ZQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...