2VUMJ

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2vumJ00
5GP9A 4BY7J 1RETA 5HODA 4IHYA 3B6CA 2JA8J 3HOWJ 1IDZA 2LD5A 1EF4A 5BNGA 2G0EA 1TWCJ 3IH2A 2LTPA 3PM1A 4X1EA 1YRNB 1TWGJ 5EF6A 1GV5A 3K2AA 3ZQGA 2HI3A 3NARA 4V2GA 4DZPA 1AKHB 3S14J 3HOYJ 1XS9A 2MG4A 3S2HJ 1CQTA 3F0CA 3TW6A 2JWTA 3WHCA 2K40A 4QSHA 1WGXA 3WHBA 4JP0A 5M5YJ 1UG2A 2NS8A 1P7IA 1IJWC 1XC5A 5JLWA 5IOZA 2H8RA 2VUMJ 2DMTA 1VI0A 2HXIA 3FK6A 1BJZA 2N8GA 3ZQCA 5IYCJ 4IHXA 5K7HA 1ETXA 4A3CJ 1HDDC 3BG3A 1ETWA 3D1NI 2R93J 4M3GA 1O4XA 4MIMA 4UUTA 5K7FA 1JUMA 1U78A 5FKKA 1ETKA 1GT0C 1Y1WJ 1GUUA 3DCFA 2ME6A 2VKVA 2HXOA 5M3MJ 1X2NA 1Q1VA 5F0CA 3BQZA 3BQYA 5M5WJ 2M8GX 2Y30A 1X58A 3JRFA 5F08A 2JA7J 3HGYA 4DW6A 2Y9ZA 2XRLA 1HCRA 2JK3A 3A02A 4IHVA 2ID3A 5FLMJ 2LFBA 4M3FA 2Y9YA 2LLKA 1TWFJ 2EH3A 1BW5A 3GBGA 3HOUJ 2EZKA 2K9NA 2R0QC 2E2JJ 1LFBA 1WPKA 5C4JJ 3MN2A 3S1QJ 4G12A 3IH3A 4DYQA 3H3VK 5F04A 1TC3C 2DA1A 1SFOJ 5E3LA 2R7ZJ 3JRHA 4A3GJ 1B8IB 1UHSA 3VPRA 1MBKA 1T33A 2LY9A 5F0HA 1IG7A 5FKOA 1HF0A 1B72B 4BBSJ 3L1PA 4A3JJ 4V2FA 1H8AC 4HNVA 2P81A 5EZGA 3JRGA 3GTGJ 5J1YA 3BR2A 4D7MA 3BR6A 3HOVJ 3S17J 3GTMJ 2O7OA 2QF7A 3G1MA 1U9OA 1QPIA 3LSPA 4XK4A 3G1LA 4MLOA 5EYRA 2ID6A 2RAEA 2H1KA 3BTIA 1JTXA 3Q0UA 2EZLA 1RKTA 2M9HA 1ZTRA 4XRSA 5FJ8J 1WH7A 1F36A 1ZKGA 2JJ7A 3HEFA 5EZHA 5EGOB 1SANA 2COBA 4A3IJ 1JKPC 3GTKJ 3HKZN 3O8GA 1MBEA 4M3BA 3JRIA 4A3LJ 2XPWA 1WH5A 3UKGA 4IEJA 3JRCA 1IRZA 3BR3A 2LK2A 4XRMA 1A5JA 3RQIA 1JT6A 4XIDA 3HGGA 4GFBA 1IGNA 1MH4A 1XG1A 3BR5A 3GTJJ 3RZOJ 1MBGA 1BL0A 1VF9A 2R92J 2PMZN 2NVXJ 4JX5A 5C44J 3ZQHA 3SFIA 3TP3A 4UUSB 1QVUA 1BW6A 1I3QJ 2WB1N 2FD5A 2ELKA 2NVYJ 2CQQA 2M0CA 4Y52J 2E2IJ 2DMUA 3M4OJ 2ME0A 2IEKA 3HM5A 2QCOA 3GTLJ 2FX0A 1E3OC 1FTZA 3A01A 1WCMJ 2HYJA 2NS7A 3MKLA 4MFDA 2CUFA 5J1UA 1ETVA 1MSFC 1DU6A 3GTOJ 1JUSA 3OIOA 1ZGWA 1NK2P 4EEFG 2CU7A 4M3EA 4ABZA 5F0FA 3GTQJ 2HOAA 2DA5A 5JLXA 4Y7NJ 3IV5A 1S7EA 1W0UA 1Z77A 1LE8A 2FJ1A 3B6AA 2YU9J 3DEWA 2X48A 2XB0X 4JYKA 2I10A 2XGEA 3A01B 4S0HB 1K83J 1OCPA 2KDZA 1JKQC 2GLOA 2LR8A 3BTCA 3O8HA 1AU7A 1FIAA 4DYRA 1IC8A 3A03A 1IV6A 3S2DJ 1IDYA 2FQ4A 2L0KA 4BKXA 2DMPA 2E1OA 2LP0A 4B4CA 2DMNA 1AHDP 2R5ZB 4A3MJ 2CUEA 2XPVA 1IUFA 3HOXJ 1MNMC 2L7MP 3E7LA 3ZQFA 4XRSG 1QRYA 2EZHA 3OOUA 4JX4A 4W97A 2CJJA 5IP7J 5F27A 1MBJA 3HDDA 1A6IA 3W6VA 1PUFA 2CQXA 4FE7A 5FKLA 2YUSA 1YRNA 3CQZJ 5K7ZA 4A3FJ 4JX6A 1MBFA 3FISA 1FEXA 4I76A 3I4NJ 3FK7A 3SJMA 4C2MJ 1G2HA 1FIPA 1U9NA 1MBHA 1ORKA 4I6ZA 1ZR2A 2R5YA 1ZR4A 1VFCA 3QPSA 4A93J 1JJ6C 2VPRA 1VNDA 3Q0WA 1ETQA 1HLVA 1GVDA 4UUSA 1ITYA 2YS9A 3BT9A 2AHQA 1RPWA 2X6OA 2DA7A 1ZK8A 1JKOC 2TCTA 2XSDC 1MSEC 2K9SA 2E2HJ 3HOZJ 3S16J 3S1NJ 5FKNA 2Y31A 4NDLA 2LKXA 3JRAA 5E3MA 1NK3P 5IP9J 3BG9A 1MH3A 2ECCA 2R5YB 2JMWA 5C4XJ 1Z0XA 2OPTA 3ZQIA 5J1RA 3OSFA 2O9LA 4M6VA 2NVTJ 2GM4A 1POGA 9ANTA 1GV2A 5GPAA 5EDNA 2WV1A 1H88C 3JRDA 1FTTA 1WI3A 3QQAA 3K7AJ 3HB9A 1R9TJ 1JUPA 3CDLA 3HBLA 3MVPA 1RKWA 2NVQJ 2X9DA 1TWHJ 2JA5J 3LSJA 2AO9A 5IOYA 2XB5A 3JRBA 1F43A 2DA2A 1JT0A 1QVTA 2JN6A 5IPAA 3BR0A 1D5YA 2HOTA 3LSGA 2DMQA 2B63J 4IHWA 4FE4A 3BTJA 4W1UA 4AYBN 4FTHA 5DS9A 2M34A 2L7FP 4MFEA 3S1RJ 1OFCX 2Y2ZA 3TP0A 3JR9A 1RR7A 2K9QA 1BA5A 3LOCA 5GPCA 5C3EJ 1JGGA 2DA6A 5DTDA 2HQ5A 3FKIJ 4A3KJ 4M3DA 2M2EA 1OJLA 2CRGA 2ZB9A 4A69C 5EGOA 3BR1A 3TW7A 2TRTA 2XPUA 5J3LA 3S15J 4XICA 1PUFB 2DN0A 1OCTC 3BTLA 2NOGA 1NTCA 1K61A 4RBOA 2WAQN 3M3YJ 1AKHA 2E19A 1HDPA 1H89C 5FLVA 3S1MJ 5F1JA 4B1RA 1JJ8C 2XGDA 3PO3J 4B3AA 1T56A 3ZOBA 4D5FA 1I6HJ 1U8BA 1JTYA 2VI6A 4BBRJ 2DTZA 5M3FJ 5M5XJ 3CCYA 2DJNA 5E3NA 1UMQA 2O8KA 3ZQLA 1ETYA 5E3OA 5FKMA 5EG0A 2L7ZA 2L9RA 2EBIA 5IYBJ 3JREA 3C2BA 4D7NA 4QIWN 3LSRA 3I4MJ 1W0TA 3CMYA 1TWAJ 4AUXA 2MSYA 1ZQ3P 1RESA 1X2MA 4DYCA 3QPLA 2VKEA 1DU0A 4LOCA 4RDUA 2GBYA 5EG0B 1Y1VJ 2DA4A 2OF7A 2IBDA 2HDDA 4A3DJ 4BY1J 5IP6A 3LNQA 3FIWA 5EEAA 4D5CA 3GTPJ 1B72A 3RKQA 3BG5A 1JKRC 2HOSA 3NAUA 4MO7A 2JA6J 2EZIA 4QTRA 4AC0A 4CYCA 3RZDJ 1P7JA 4BXXJ 2MW8A 2D5VA 2KT0A 3IH4A 1LE8B 4FISA 2IAIA 5IYDJ 3Q3SA 3TEDA 1FJLA 2LVSA 3H0GJ 3OSGA 1HOMA 4J19A 2MGQA 2XGCA 3G1OA 2W48A 1ETOA 4DZJA 3SDGA 4C3JJ 1B8IA 4X6AJ 2ECBA 4C3HJ 1LFUP 4A3BJ 4FCYA 3Q0VA 2R5ZA 1APLC 4A3EJ 1ENHA 4CYCB 2Y0SN 4C3IJ 1I50J 1GDTA 4L5EA 3PO2J 2DA3A 2EQRA
chains in the Genus database with same CATH superfamily
2DYRH 3HJEA 4CCOA 1LUJB 3HSRA 2Y75A 3B6CA 1XMKA 5LHHA 3CMEI 5FRMA 3JTGA 2JA8J 4GXOA 4NHJA 1O3RA 5GTHC 2VC0A 3FWEA 5BNGA 2R7TA 2LTPA 3I59B 3QPTA 3EDPA 5HNFA 3OYIA 1XD7A 1T38A 2R7QA 3C2GA 1KYWA 3ZQGA 4V2GA 2MG4A 2UXNA 1VQ4I 1W5TA 3WHCA 1VTNC 2M4KA 2CV0A 3WHBA 4IOAF 3AKZA 1XDSA 3ZMVA 1UG2A 3BP8A 2OCCH 1FYMA 4B47A 1P7IA 5D4RA 3ZP5A 1X4PA 4IRHA 2E34A 3T0YA 3VODA 5JLWA 2H8RA 2DMTA 4F3QA 1G6NA 3KZYA 2B0LA 4B44A 4U7BA 1MJAA 4I98B 4PJJA 2N8GA 1WRJA 5K7HA 1VQ6I 1ETXA 4A3CJ 2V79A 2PQ8A 2CQKA 3COAC 3BG3A 1J2XA 4PFOA 5CVUA 1JUMA 3FX3A 1ETKA 1WJEA 1S8NA 1GT0C 1QBJA 3CCSI 3DCFA 3E1SA 2ME6A 3A4CA 3SZTA 3O6BB 1QZYA 5F0CA 2GZWA 4ENKA 1J59A 4CUGA 3OYLA 1KONA 4BE2A 1XN7A 3WODF 3LQRA 1HCRA 2HKOA 2NNNA 4RB0A 1WWXA 4IRIA 1YYVA 5H20A 5FLMJ 4RM2A 1TWFJ 1SFUA 1BW5A 1BM9A 2AQEA 3PSFA 1JHFA 1T95A 4MEYF 2K9NA 2VBYA 1LVAA 2ICWG 5FD5A 1K4TA 2OTJI 5HS9A 1RR8C 1HKTA 4KT6A 3AG3H 5F0HA 4RLQA 4Z6YA 2NVUB 2QEXI 4BBSJ 2STTA 2XSJC 4H4KC 4V2FA 2KIUA 2P4WA 2W1OA 4HZFA 5EZGA 3BR2A 1T98A 1FOKA 3RIRA 3DLLF 3OYAA 3J81K 1TQIA 3G1MA 3OMYA 4D0PA 1YITI 2HOEA 1QPIA 3LSPA 2LH9A 3CLOA 3U1KA 3G1LA 3RYRA 4IO9F 2RAEA 2W7NA 3OYMA 3Q0UA 2EZLA 1ZTRA 2JJ7A 5EGOB 4A3IJ 1JKPC 1SANA 2COBA 4BDYA 4GCVA 1EV7A 3I55I 3E6MA 5J4VA 1XGOA 3SYTA 4KN7X 3JRCA 3FBNB 3I5UA 1OR7A 4BGDA 2AXLA 2JRMA 2ZSIB 1SVMA 4XL9A 4HLXA 2LYCA 4HSTA 4EJOA 3MD2A 3CCQI 4G7OF 3BR5A 2NAZA 3GTJJ 2E5ZA 5HLTA 1K78A 1BL0A 2KZGA 4BHCA 4JOMA 4JX5A 5C44J 5CLSA 1I1GA 2QWWA 4C2UA 2F2EA 1CF7B 4ZC3A 1QVUA 3S93A 2YR2A 4M9ZA 5LGTA 3GZNB 3TOAA 4WK8F 2PI0A 3HG9A 2NVYJ 3DFGA 5CYVA 1TW3A 1TW2A 2CQQA 2MC3A 3KP4A 4HF0A 4Y52J 4AIDA 3K4JA 1R4NB 2IEKA 5B3SH 2QCOA 4G9YA 2FX0A 3LFKA 4KDPA 4M6YA 3U2RA 3UR3C 4HV6A 4PCQA 1ODDA 4UV8A 3WU2C 1YW7A 2HYJA 3MMYB 1LNWA 4OU0A 4YG2F 3OS2A 3P9CA 3GTOJ 3J80Z 3NWSA 1JUSA 4ZDLA 4BE1A 1WI9A 3OIOA 1ZGWA 4RLFA 2R7XA 4KIGA 1NK2P 1MMNA 1TNTA 2KQRA 3HRUA 4M3EA 3NEUA 2EIMH 2IGNA 3KP3A 5KVRA 3IKTA 4YIRX 5F0FA 1WSUA 2K5CA 5JLXA 2H94A 4IQ4A 1HQCA 2XC7A 3IV5A 5K5QA 1FYLA 1L0OC 1BI2A 3F8FA 2XB0X 3BCBA 2XGEA 2DPUA 4F52A 1ZRCA 2PG4A 1QO0D 4Q4ZF 2PN6A 1SAXA 5AIQA 2KDZA 3LAPA 2KIMA 3O8HA 4DBQA 3AG1H 1O3TA 1DP3A 1HC8A 2IVMA 2DOEA 3TDZC 3TL4X 4BKXA 3ZR8X 1HXDA 2DO7A 1DUXC 4B4CA 3RTRA 5E17F 1MGTA 2R5ZB 2K9LA 3EUAA 1HA8A 2CYYA 2CUEA 4KISA 1OR7C 2WAFA 3HOXJ 1MNMC 2NXNB 3MKYB 4HDUA 4O5VA 3E7LA 1IN8A 3EUHC 1QRYA 4WXHA 3OYKA 2IS1A 3OOUA 4HA8A 4ANJA 1WHUA 5IP7J 2CJJA 3FHZA 1I3AA 5F27A 3QRFF 2JVGA 4YFKF 3HDDA 2HWVA 1A6IA 1TQMA 3VSKA 2V1DA 2BHYA 3I59A 1UG0A 2ZSHB 5A2QK 4AM3A 1H9TA 2DQRA 3HIFA 3PSIA 3CQZJ 5K7ZA 4CA0A 4A3FJ 4PJNA 5JVGF 4G7HF 3R60A 5D5XB 3WGGA 2QGUA 5JHFA 2F5CA 4I01A 4MTDA 1U9NA 2A61A 3OR2C 4E70A 4IVNA 2WC2A 5K5RA 4HW0A 2ISZA 3OR1C 1PVEA 5IT3A 1VFCA 1G4DA 1DQUA 1R5HA 1D1BA 5E1WA 1WVRA 4IXAA 3KP7A 1ETQA 1ZGJA 3HRTA 2XAQA 1HLVA 1CF7A 4CGZA 1ITYA 4A5MA 5KNLA 2AHQA 1RPWA 2X6OA 1SD5A 2DI3A 2DA7A 2Q2EB 2WY8Q 1ZK8A 3ZMZA 3N4MA 2TCTA 1J0RA 2K9SA 5CVIA 3WE3A 4UV9A 2V9KA 1Y0NA 2M1BA 4NDLA 2YX7A 3VFZA 5E3MA 4EJWA 1X19A 4HBLA 4E7JA 5FROA 2R5YB 4OIPF 3TBIA 2QZ8A 5J8CA 5CQEA 1IZ1A 1W7PD 3WTSC 2OPTA 2XV4S 5KK1A 2O9LA 2A69F 2OD5A 3K4MA 9ANTA 5GPAA 4I02A 3JRDA 2DT6A 1IO2A 1HW1A 1EH8A 3K7AJ 2WAEA 3HB9A 2RQQA 3HXLA 2KPMA 1ZLJA 3GW2A 4U88A 3PNVA 2IS2A 3HBLA 3MAJA 1RKWA 2BZTA 2BV6A 2X9DA 3LSJA 2DK5A 4E7SA 2HYGD 2JZYA 2K9MA 1K4SA 3SDBA 1K6OA 3LA3A 3IHUA 2XB5A 2ACJA 3LSHA 4XN3A 4IF4A 1R23A 2DA2A 2Z5UA 4CH7A 3AAFA 3V42A 3G3ZA 2JN6A 2M0MA 2GOMA 2ZFWA 4F7ZA 2DMQA 2E1MB 4FE4A 1ZRDA 2HKXA 1E2XA 1R7JA 2L7FP 3S1RJ 4R1HA 3HYIA 1VQMI 1KQ8A 3TP0A 3QP6A 1ZG1A 1RR7A 3UNGC 2FOWA 4P96A 5B66C 3DF8A 1STZA 2XIGA 4QPOA 2VODA 5J40A 2LBFA 3KX2A 2HQ5A 4A3KJ 4IL6C 2XROA 2LNBA 1LEAA 2CFXA 3L2UA 3J7AO 1ZH5A 2FMYA 2KRCA 3FKJA 3H3ZA 4XICA 4YIIA 3HC7A 3AL0C 1Y56A 3D5LA 1LPQA 2JUGA 4RBOA 4ZJZA 4HX8A 4NQWB 4IZZA 1FC3A 4ZYDA 4YIFA 4DOZA 4UB6C 4ZZLA 3RKWA 2HS5A 3C1DA 1SFXA 2Y48A 1T56A 1I6HJ 4G6DA 1U8BA 1JTYA 1KZHA 5M3FJ 4ESFA 3CCYA 2XAGA 2EB7A 1LJ9A 2RREA 3WTTC 5K5OA 5EG0A 3FM3A 3OY9A 1BC7C 2L7ZA 3GEZA 4CXFA 2QBYB 3JREA 2XKOA 3CCEI 4QIWN 1XSVA 4S04A 2O03A 3E6CC 4DBRA 2JTVA 3CMYA 2G7HA 1QHHD 3OIQA 1RZ4A 2LF8A 5FD6A 1U6GA 2ZXHA 2HU9A 1V5GA 1DU0A 4LOCA 2EILH 2HQNA 3RKYA 4CDGA 1E3PA 4PJMA 4Z2YA 5DM6F 5IT9Z 1Y1VJ 1S29A 4HYEA 5ILVA 3PNYA 2HDDA 3EETA 4TV7A 2KZVA 2PMHA 4A3DJ 5IP6A 4M6XA 3T8RA 3BDDA 1YIJI 2LKSA 1KGSA 1S6LA 3SZGA 3V8LA 2XUBA 2DJIA 3X2QH 5D5VB 3WTYC 3GX4X 1B72A 3RKQA 2WB1A 2K85A 2E60A 1T8IA 2WV0A 2JRTA 3DU6A 1Z7UA 2HVSA 1YI2I 2CWEA 3DEEA 2KT0A 1DP7P 2D1HA 2IAIA 2ZKZA 1FJLA 3K0LA 1HKSA 2VBXA 3DKXA 3GFJA 5DUKA 1E3HA 5BQTA 2E1NA 1HKQA 3I0TA 4J19A 2PMZA 1EKEA 5LRRA 4BAYA 1ETOA 5H2FC 4DZJA 2A68F 2VASA 5HDKA 4X6AJ 3WTVC 4C3HJ 4XM3A 4KA4A 2AXTC 4BH9A 4C3IJ 1I50J 3OYGA 3WTUC 2ZXIA 2EQRA 1X58A 3J7AY 3M7GA 5GP9A 5HODA 3BZCA 3S3MA 4IHYA 5KHDA 2OA4A 3WE2A 4QWQA 4DNCA 1ZGAA 4X0GA 3KP6A 1IDZA 3FXKA 3RPQA 1V55H 4I0AA 2A07F 4A2UA 3OOPA 2VKHA 2VOOA 3W3CA 2L4MA 1TWCJ 2MA3A 3IH2A 3JTHA 3PM1A 4OMZA 4E6KG 1TWGJ 2K86A 4NQWA 3V8JA 3S2WA 1FY7A 1GV5A 1KYZA 3QPHA 1ACIA 2F5EA 4DZPA 4JBAA 1J7KA 3HOYJ 3WG7H 2O61A 3TW6A 2JWTA 2Y0SA 3ELKA 3SQNA 1USTA 2KHMA 3F72A 2P7CB 3S3OA 4A0YA 1PYVA 2NS8A 1IN6A 3DPLC 1IJWC 1XC5A 1FPQA 1VI0A 4NC8A 5CJ9A 1B1BA 4G7ZF 1TQPA 3FDYA 2VQCA 1F1ZA 2KRHA 2F48A 2CW8A 4I09A 2DDAA 2QBYA 3FK6A 3BJOA 1ZELA 2DDBA 1SFEA 3QYBA 4HSRA 2STWA 1YW8A 2OZ6A 4RAZA 1OYIA 3HSFA 1ETWA 2R93J 3E5XA 3KEQA 4UUTA 4FX4A 3QP5A 3RPUA 2RNGA 5K7FA 1R1TA 1IRFA 2VC1A 2L54A 2OZUA 4BJ5C 2IPQX 3U1DA 1GUUA 5FB2A 2KRFA 3W6JB 2MD5A 4M73A 2LRDA 3I4PA 1FOYA 5M3MJ 2L4AA 1X2NA 2JVHA 1Z3XA 4Y3OA 3BQZA 2R7OA 2F4IA 4CO8A 1U5TA 2Y30A 3JRFA 1QQIA 1I39A 5J4YA 3HGYA 4M74A 1ON2A 5FFXA 3A02A 2O0YA 4XORA 3AFHA 4CHUA 4AIJA 3OV8A 5HS8A 1TT5B 3U21A 3MZYA 2GIVA 1D0ZA 2DOAA 3R61A 2RGVA 3H9JA 1XPXA 3HOUJ 2WA0A 2EZKA 2KIQA 1Z91A 1WJFA 1WPKA 5E8GA 5C4JJ 1VQ9I 2V1XA 1YQAA 3MN2A 3S1QJ 4P5OA 4G12A 2X85A 2PMUA 4ZYHA 2DA1A 1SFOJ 1P92A 3GYHX 2KLOA 1MBKA 2MYSA 3EUKL 1VQ8I 1T33A 4KNYA 5EEHA 3OL4A 4F91B 2CMPA 2XRNA 3GUDA 1IG7A 3ABLH 4ASNA 1W36D 5F1RA 2G7UA 3FXOA 1WJDA 4NC6A 2BW3B 4XLCA 2X51A 4D7MA 2VXZA 3ZMTA 1QHGA 2PFBA 2O7OA 3NWTA 4CCLA 3LAJA 2LG4A 4XK4A 3MQ0A 3BTIA 3HPGA 1JTXA 4OIQF 5FJ8J 2LDUA 1F36A 4JQFA 4R79A 3CUQB 3KYLA 1MMAA 4M3BA 3R0JA 1PJRA 4RA2A 1SMTA 2VE9A 2LK2A 1D0YA 2KKOA 1MDMA 3ABUA 2BY2A 4IJAA 1JT6A 3V8KA 3ROUA 4RB1A 3FXLA 3ZCOA 5DD4A 3QU6A 2DODA 1MH4A 1W5SA 3GO5A 2ZJQF 2V9PA 2PLYA 2ZC2A 3K6GA 3VYUB 3RZOJ 1XTAA 5E79C 1A04A 2FA5A 4LG0A 3KP2A 2PMZN 1W4MA 5LGUA 2X1EA 3H35A 2NVXJ 2NS0A 3ZQHA 3JAMZ 4KN4X 1B59A 3VOEA 1AOYA 1SAUA 1I1SA 2FNAA 4PSWA 2FXAA 3F8NA 3WGIA 3QYEA 2TDXA 2MBFA 4EGYA 1I3QJ 2JQ7A 4M72A 2W00A 1WJCA 1DDNA 2FD5A 4WXDA 3CCJI 1KU2A 2DMUA 3BWGA 2ME0A 3M4OJ 4U0WA 3CJRB 1EH7A 4DJAA 3IRQA 3I3LA 3SXYA 5D8KB 1FTZA 1WCMJ 2HVQA 3OS1A 4MFDA 5HOOA 5FLXK 2ETHA 4FHTA 4EEFG 3O3KA 2Z99A 4XONA 5DDGA 4PUSA 1A6QA 3BG6A 4ABZA 2HOAA 4L18B 3TGNA 1Y39A 2XHKA 4BYYA 3B6AA 2GXAA 3DEWA 2X48A 2I10A 3DPUA 3E5UA 3IC7A 1WFXA 3D0SA 3A01B 1HSJA 4XSZF 4CZCA 4BS9A 1OCPA 3RCOA 1JKQC 2XASA 1VQ5I 2RN7A 2IT0A 1BJAA 4DYRA 4P1WA 3A03A 4BQAA 4L9TA 4PZJA 3S2DJ 2FQ4A 1WJBA 2CUZA 4RS8A 2LP0A 1YFHA 1X1AA 1Y0UA 2DMNA 1B9NA 4A3MJ 4B48A 3DKWA 4ENNA 1IUFA 4P55A 1JXSA 2L7MP 3LWFA 1P4WA 2GIZA 1BI1A 2ZMEA 2RNJA 4LFUA 4XRSG 3AL0B 2COMA 3VB2A 2EZHA 1GXPA 2R7WA 4XNFA 4JX4A 2D1VA 1MBJA 1O7LA 5HLHA 1YTYA 4BACA 1Z6TA 2MLGA 2Y0MA 2YUSA 4L5IA 1N77A 3GZ5A 1AA7A 2O6GE 2VQGA 3TDUC 5DCMB 4KJZA 3FISA 1KU3A 3JAMK 3V7RA 3GWZA 2DXIA 3FK7A 4ESBA 3SJMA 4IKFA 1G2HA 2GOXB 3EPZA 4N0BA 2X0LA 3OIPA 3CCUI 4BE0A 1K79A 2R7FA 1QZEA 5F64A 4OIRF 3QPSA 5BMZA 2VPRA 1IXSB 1X1PA 2GWRA 3Q0WA 4HLYA 1MJBA 2EFQA 5FRNA 3HTUA 2YS9A 3QAHA 1XCBA 1HW5A 3RKXA 2HZDA 1LDDA 2E2HJ 2L3DA 1LFPA 5FKNA 2VB6A 2A6EF 1YHQI 3Q9SA 4IX7A 1VQPI 3FHNA 2QQ9A 1Z6RA 1KU7A 1RUOA 2DTRA 1ON1A 4HOBA 1A31A 4Q5SF 3J80K 4U87A 5E1ZB 2GM4A 3OYHA 5EDNA 2FF4A 2IGKA 1H88C 1Z9CA 4IQJA 1YJNI 3VDXA 1WI3A 4YFXF 1R58A 3R0AA 2X6WA 3KZZA 2V7FA 1IXRC 3CDLA 1KQ9A 1P2FA 2D2WA 2P6TA 3OYJA 2AO9A 1KU9A 3JRBA 3ZRGA 1TT0A 4EATA 2BY3A 3QU3A 5J8FA 1B9MA 1SVLA 1OCZH 4GYGA 4Q47A 3TO9A 2ZO4A 2B9SA 1FBUA 1QVTA 1P6RA 5IPAA 2FMLA 3BR0A 2HOTA 1FSEA 1YO5C 3A0BC 2B63J 3BTJA 4YELA 4FTHA 5DS9A 3CJNA 4MFEA 2OQRA 2FOKA 1TP4A 4WX9A 4LJZF 2Y2ZA 1OMIA 2K9QA 2XAJA 2JPCA 3LOCA 3OS0A 5GPCA 1IN4A 5ICCA 4LK0F 1QZZA 2F5DA 2ESHA 5EEGA 4M3DA 5K1YA 3DBLB 3BPVA 4A69C 4AIKA 2IA2A 3ONQA 2TRTA 2XPUA 4ENMA 2ELJA 3CUQC 1OCRH 1O3SA 3LSMA 1AWCA 2P5LC 3CJTB 1ZRFA 1OCTC 3NRVA 2P0WA 1NTCA 2M87A 5AONA 2OU2A 3I58A 3G71I 3CTAA 4XLNF 5DCMA 2HPMA 3M3YJ 4L9JA 2EFWA 4E7HA 4LB6B 3K4KA 1MDMB 2XAHA 1H89C 5FLVA 3FXRA 4F55A 3S1MJ 2JT1A 4CZZA 3MKZA 1JJ8C 3GFIA 2QLZA 5CVRA 3ZOBA 3FXMA 2DTZA 3DXJF 5DYMA 2DFEA 1UMQA 2MH2A 3ZQLA 2O8KA 2PX9A 3E3VA 3IAS2 3KE2A 1X4OA 1YS6A 1OISA 1D1CA 2L9RA 2H6CA 1G59A 4LK1F 5IYBJ 2FU4A 4D7NA 1TZLA 1YOVB 4CCNA 4AVZA 3E6BA 4BEHB 4BNCA 3I4MJ 2R4GA 2M7BA 2UXXA 2FBHA 4AUXA 2MSYA 4L0ZB 3V7SA 2V1NA 4DYCA 1S3JA 2HZTA 3HUGA 2D45A 4OMYA 2VKEA 2OTLI 5FLXZ 4PDKA 4ZYAA 2ZFUA 1PP7U 1QGPA 3DTIA 2OF7A 3HRMA 4BXUA 1X1DA 4BY1J 3WTXC 1R1UA 4PJLA 4LITA 1LDJA 1UFMA 2BEOA 2WY7Q 5J6XA 5FO5A 3FM5A 3LA7A 3GTPJ 1JKRC 2HOSA 2EZIA 1HBXG 4AC0A 5IT9K 1BOAA 4CYCA 3B02A 3GLLA 4D9JA 3RZDJ 5ICGA 1P7JA 3IH4A 2XF6A 1S72I 4FISA 3DKYA 4JK1X 2P5VA 2Q0OA 3H0GJ 1HOMA 3CDHA 3L2VA 2V4JC 4A5NA 3G1OA 2W48A 2XDVA 3FMRA 2IGMA 3QWLA 3SDGA 1UHMA 4C3JJ 2QYOA 1B8IA 2ECBA 3SZPA 2H8WA 5DUIA 4FCYA 1O57A 2EA4A 3Q0VA 4UNOA 1D8JA 4AD9A 1ZLKA 1DGWY 5E8IA 3LMMA 4QLCU 4L5EA 2NOJB 1Y8RB 5FFZA 3L09A 2EPFA 4L0YB 3GCMA 1RETA 2ELHA 3BJAA 3J7ZI 4IOCF 1W5CC 4B3XA 1JGSA 4HNUA 3TMOA 2ZMEB 4WXCA 3HOWJ 2DT7B 2E36A 2LD5A 4HF1A 4XOPA 2VOPA 1S7OA 1BR2A 1WQ2A 4G94A 5CQGA 3K70C 4ITVA 2QKMB 1G3WA 4X1EA 1YRNB 1VQNI 4H0EA 4LB5A 2BHZA 3PJRA 1GVJA 1T0FC 3DPTA 4DQ2A 2HI3A 2VT3A 2YSRA 3IWZA 3S14J 2FBKA 2VN2A 1OCCH 5GTIC 2VONA 1FT9A 3F0CA 2LBFB 2BOLA 4HV5A 2K40A 5M5YJ 1WGXA 4F93B 2IJLA 2R7DA 4UVBA 4UHTA 2X1CA 3WG9A 3I53A 2EV5A 2VUMJ 5ILSA 1FSHA 1IV8A 2KJBA 1FX7A 3ZQCA 2Z1DA 4MNUA 3PQKA 1OYWA 2KISA 4Y4RA 1FLIA 2DFHA 2HTSA 3T1BA 1HDDC 1IRXA 4N9IA 1YW9A 4BQQA 3D1NI 4M3GA 1O4XA 2HEOA 2JSPA 1U78A 3F8MA 4MQ9F 3B73A 3DTEA 1WJAA 1N25A 3OYDA 3W2VA 4DIQA 2ZMEC 3KYDB 2VKVA 1XDUA 5M5WJ 2M8GX 1V4RA 1L3LA 2JA7J 4Y17A 3BOQA 5D4SA 4KYWA 2VKDA 4DW6A 2XRLA 2JK3A 4R8HA 1LDKB 3F6OA 2NNYA 1TTYA 2F5FA 2EH3A 2MFZA 4UXNA 4E4HA 1V5FA 5KAIC 1U3EM 2LY1A 2R0QC 2E2JJ 2CH0A 3CESA 1D3YA 3LL7A 3S8PA 3PNTA 4XKWA 4HAMA 2I8DA 5L3GA 2PJPA 2CFOA 2VQHA 3IH3A 3H3VK 5F04A 2OQGA 2LOOA 2R7ZJ 3JRHA 2BY0A 2VJIA 3C18A 1B8IB 5HDNA 4N4OB 1ONVA 4UVAA 2QA4I 1XSDA 2LY9A 5FKOA 2LMDA 3A1YA 1B72B 1X3UA 3L1PA 4A3JJ 3L2QA 1H8AC 4HNVA 2P81A 1R5GA 2YX4A 4RGUA 3JRGA 5J1YA 3ABKH 3S17J 2LREA 2WTEA 2K3PA 4L9VA 1U9OA 2WAQA 2DW4A 4MLOA 5EYRA 1MMDA 3RSNA 4XRSA 2JPBA 2MD0A 1RKTA 4EJTA 3GTKJ 4M9SA 3I56I 1B4AA 3H5NA 1MBEA 3JRIA 4MQVA 5B1BH 1WH5A 3UKGA 4EM0B 4AIHA 4IEJA 4EMSA 3BR3A 1NG7A 4J00A 4XRMA 3GLXA 4FASD 3CCVI 3RQIA 3PFIA 3TQNA 4XIDA 4ON0A 4XN0A 1QPMA 3VWBA 4GFBA 1ULYA 3RQ4A 1IGNA 2HGCA 5IY5H 2JUCA 1VF9A 2HQAA 1SC7A 1D5VA 3ECOA 1XCVA 4KUMA 4P9FA 3LSIA 4MGRA 4A12A 2E71A 3F22A 2V26A 1GLNA 2K3FA 3GMEA 4HX4A 3FXJA 4UUSB 2F4MB 3ISPA 1BW6A 3SEQA 1LB2A 4UVCA 4KITB 3VYRB 2IW5A 2ELKA 1P4XA 1UB9A 2ZJ2A 3SFZA 2HVRA 1E0EA 3HM5A 1K78B 3CF5F 4UUVA 4XSXF 3BZKA 2F6CA 3GTLJ 1P9QC 1NG6A 5L3DA 2NS7A 2CUFA 1Q1HA 1ETVA 2XAFA 2BY1A 2HNHA 3HHGA 3HPHA 1V3FA 1YS7A 5DM7F 1SMYF 1DPUA 5LEKA 2OUMA 3AG2H 3GTQJ 2BYVE 3J7YJ 3PIOF 2XF7A 2XGXA 1MMGA 4Y7NJ 3ZPLA 4HNTA 5TJJA 3M1CA 1Z77A 4FETA 1LE8A 4FT8A 2FEZA 2BBYA 2Y69H 1SD7A 2DBBA 2RDPA 3CZ6A 1JI8A 2EV6A 2DQLA 3IP4B 5LHGA 1AU7A 1F5TA 4RM3A 1Z7LA 1IC8A 3I9V2 2ZXJA 3E0JB 1IN5A 2L0KA 2DMPA 2QSHX 2KL4A 2F4OB 5ICFA 3DTKA 4II2A 3F8BA 2X1DA 3WTZA 1U8RA 4YFNF 4CYDA 4K2EA 1P4AA 3K70D 1YJWI 5DD8A 2VT2A 1VQKI 4EM1A 4U0YA 3G6EI 4HRIA 3KEOA 3WU1B 1W7PB 1YX5A 3I54A 4E7LA 2WWYA 2IP2A 4KIFA 3L2WA 3F3XA 3H9QA 4W97A 5JVTA 5LD2C 4G6QA 3MZ8A 4EM2A 2JSCA 2R7SA 3M8FA 5FKLA 5LBQA 2MH9A 3IL2A 1VQOI 1YRNA 2BW3A 1QA6A 4BU2A 1MW7A 2EV0A 2QM3A 2Q2EA 4IHSA 4XQFA 1MBFA 1ZG3A 1FEXA 4I76A 4DGWB 4BJ6C 3GVAA 5TGTA 2PEXA 4PK4A 1Z3YA 2IGOA 1FIPA 2XAUA 3C3WA 1XB4A 1UHWA 1ORKA 1R00A 4I6ZA 1ZR2A 2R5YA 3W2AA 3K1MA 4FQGA 2V6EA 4XRFA 1JJ6C 2CG4A 4PFPA 1VNDA 2AS5F 5E18F 1A35A 2ZCWA 3JCUC 4Y13A 4UUSA 3K69A 3H1CA 4OAYA 2DYSH 1FMWA 3HOZJ 1LVKA 3P9IA 4YEJA 3K9TA 3K2ZA 3CCRI 4OIOF 2H27A 3S1NJ 2HPIA 2O8XA 3JRAA 2FSWA 1NK3P 1WZ2A 4L9NA 1YG2A 3TO6A 5IP9J 3HL2A 3H3UA 5GADJ 2JMWA 4RGRA 2MLKA 3M1EA 4LG0B 1Z0XA 2B7EA 3EYYA 3C2HA 3ZQIA 1GXQA 3JW4A 1POGA 1GV2A 3FBIB 2RC4A 2WV1A 2M45A 2A3SA 2R3SA 4CCKA 1EH6A 1IRGA 4KMFA 4LD5A 1BIBA 1JUPA 3OL3A 2OCEA 2LF7A 2X6XA 2M30A 3MVPA 1IF1A 2DCEA 5D6FA 2GA1A 3K4BA 1J5YA 2JA5J 3F8CA 2JA2A 3DEUA 2A05A 3O2PE 3EUHA 5GAHJ 4ENJA 3HHHA 4CSWA 1ZARA 1F43A 2EFNA 2ZJPF 2Z9OA 3V4GA 3KP5A 1D5YA 5ERIA 5AIPA 3LSGA 1R36A 4W1UA 1F9NA 2M34A 1Z67A 5DCFA 2E7WA 1OFCX 3H92A 3KETA 3CO6C 1W36C 1X1CA 1MNEA 3JR9A 1DPRA 4HG2A 1U5TC 4WCGA 3KPHA 4XKBA 1D8KA 1JGGA 3E6DA 3P7NA 4NB5A 3MFKA 4HPQA 3KZIC 1OJLA 2CRGA 2CUJA 2FRHA 1R22A 3BPXA 2F5VA 4MTEA 1UELB 2OBPA 1R49A 2IXSA 4E7ZA 3OYBA 2XVCA 1MMSA 4I2OA 3ASOH 3F6VA 3WTWC 2KIFA 4KMUX 2ZBKA 2WAQN 5GAEJ 3DU5A 3GFMA 4XLEA 5ED4A 2CQ7A 2KDOA 3JSPA 1AKHA 2EFOA 4EQQA 2E19A 1HDPA 1LEBA 1G3YA 3W6KB 4BXFA 4AU7A 5F1JA 4CICA 4B1RA 4B3AA 4D5FA 4BBRJ 2VI6A 4U7DA 5M5XJ 2FBIA 1RI7A 2G9WA 2GXGA 3BROA 3K1NA 5LHIA 3PQJA 4LMYA 5FKMA 3RPUD 4XLAA 4XLFA 4HQMA 1F4KA 3VEPA 4A0XA 2EBIA 1T0FA 1M1EB 3C2BA 4HF2A 1W0TA 5CPRB 1TWAJ 3ECHA 2NRAC 2VIXA 3ZMSA 1ZQ3P 1RESA 3HSEA 3M9AA 2KFDA 4GYIA 2K02A 3ERED 1R4MB 4EJVA 1RRJA 1D0XA 3D5SC 3ERMA 1ZYRF 4XR6A 3MZHA 5J47A 5EG0B 4ZZDA 5F6FA 2DPDA 2IBDA 2ZNZA 3G73A 1FZPB 2RV8A 4LIVA 2R7RA 3PUFA 1PUEE 3DWLE 3LNQA 4Q48A 3FIWA 1S7AA 1N78A 4ETSA 3ZGKA 2MC4A 2H6BA 4D5CA 2IS4A 3H9GA 3NAUA 2CV2A 4QTRA 1E17A 2HDWA 3MEXA 2VJ5A 1I6XA 4BXXJ 4OOIA 2VLAA 2D5VA 3L00A 1K6YA 1LE8B 1BOBA 5IYDJ 3Q3SA 3LSTA 4NC7A 3H5AA 2M3AA 3M07A 2GXBA 3OSGA 3GXOA 1X3WB 1FOXA 3FXUA 3DP7A 4BDZA 5H6RA 4M9XA 4A6DA 1U2WA 2ZNYA 2C6YA 3OYCA 3GFLA 4RAGA 1LFUP 4A3BJ 4ZYGA 5KCMA 1Z21A 2IS6A 3CC7I 1APLC 4NUBA 2OV7A 1RIOH 1ENHA 2Y0SN 2E1CA 3A2KA 2L2OA 3REOA 2DA3A 2K27A 4KICA 4BY7J 1YLFA 3SHFA 3WGHA 2KP6A 3T8TA 3WU0A 2L5QA 2OJED 1EF4A 3V7CA 1FMVA 5LFAA 3PL8A 2G0EA 2BGCA 4XLPF 3FMQA 2IA0A 3ZXSA 4ZDPA 5EF6A 3K2AA 1YE9A 2V1UA 1AKHB 3NARA 1SEUA 1BI0A 1OPCA 1XS9A 2L02A 3S2HJ 2AQFA 3H36A 3PIPF 4RAYA 1CQTA 2QKLB 1JHHA 3T5XA 4XBFA 3KYCB 4LLLA 2IRFG 4QSHA 3IAM2 4JP0A 1Y6IA 1IXCA 2QUFA 3LSKA 1T08B 3QYFA 3M8EA 5IOZA 3R4KA 4E7IA 3CD6I 2HXIA 3CJQB 3QOEA 3L2RA 3BZ6A 4RGSA 2VXDA 5LGNA 4ESJA 3A0HC 2HDCA 1FBSA 2X4HA 5LLQA 1BJZA 2Q1ZB 3FXQA 3P5JA 5IYCJ 4IHXA 1NHAA 4ZDOA 1ZG5A 4LGWA 1FP1D 3I64A 4Y33A 1C0WA 2A5YB 2V9VA 1USSA 3HZJA 3RYPA 4MIMA 3J81Z 5CVJA 1YJ9I 1Z05A 2H09A 1Y1WJ 4BQOA 1XGMA 2EJRA 1BR4A 2IA1A 2PJRA 2KMUA 2HXOA 1XSXA 2L9NA 1Q1VA 1XGNA 3ABMH 3K4LA 4CCJA 1SD4A 1G8XA 4V19K 3BQYA 2W4SA 2CW7A 3M8JA 5L3BA 2P6SA 2EIJH 5F08A 1D1AA 3ZMUA 2Y9ZA 2L7KA 1RC9A 4C9YA 3R6SA 2ID3A 4IHVA 4BEHA 2LFBA 2R7VA 4J01A 3ASNH 4M3FA 2Y9YA 2LLKA 3IWFA 3N05A 4RB2C 3NQOA 2YU3A 2RKHA 4BHPA 3GBGA 4ZTJA 2H1LA 2VQLA 4XKCA 1LFBA 2RQPA 1A36A 4G8XA 1XGSA 2P8TA 4G6TB 1FNNA 2VJJA 4DYQA 5B5EC 1TC3C 3KIOA 2GAUA 5E3LA 4A3GJ 3PFYA 5BPDA 1UHSA 3VPRA 1IW7F 2CV1A 1ZREA 2XF5A 1OKRA 3CF2A 2EIKH 1HF0A 3OYEA 3ML6A 1RNLA 4IRGA 4XLHA 1REPC 3CC2I 1QU3A 2FE3A 2MABA 4GDFA 3GTGJ 3E97A 1H0MA 3K1PA 3BR6A 4CCMA 3HOVJ 3GTMJ 2QF7A 2A6HF 4B09A 5D6EA 3TO7A 5BS6A 2ISYA 2ID6A 2J5PA 2H1KA 2M9HA 3GF2A 1WH7A 3TKYA 5JR3A 1ZKGA 1VZ0A 3ULQB 3HEFA 5EZHA 3IUOA 3HKZN 1U0JA 2BVMA 1OCOH 3O8GA 4AWXB 3Q5FA 2BE5F 4O6JA 4WWCA 2HQRA 5CKTA 4A3LJ 2XPWA 2RVCA 4I99C 1IRZA 2QQBA 3BLYA 2ZJRF 1A5JA 3L2CA 1NH3A 4XOTA 2CW0F 3HGGA 1V54H 3QOPA 2M5WA 4PSXA 5JHUA 1R5ID 1ERDA 5HS7A 5HVQC 1XG1A 2FNPA 3KLOA 2J5OA 3KCCA 1MBGA 5HLIA 2HYFA 3E5QA 3IKVA 5CVVA 2W24A 3CUQA 1Z1DA 2K7LA 2Q8KA 2R92J 3W2WA 1SD6A 5BPIA 3K4CA 3DLAA 5D5WB 1I5ZA 3ZN0A 1BR1A 3SFIA 3TP3A 3LA2A 4II3A 4OINF 4GGGA 1R1VA 3CMMA 1QNTA 3H5RA 1UAAA 3AG4H 5TISC 4A0ZA 4OWRB 4UY8I 3OYFA 5BOXA 1FBQA 2WB1N 2BXZA 2M0CA 5ICEA 2E2IJ 5D5UB 5E1XA 3RJPA 3S3NA 3FF5A 3IRRA 1EJ9A 3QODA 1V5EA 1W1WE 2DAOA 1O7FA 1E3OC 2OAZA 3A01A 1FOWA 1TNSA 3KEYA 4BQNA 3HTSB 5LRSA 2ZXWH 3MKLA 2K4JA 2BVLA 5J1UA 1MSFC 5HLGA 3GZ6A 2VBZA 1DU6A 2QQAA 3CDIA 2GQQA 3CLQA 4B43A 2CU7A 2LSOA 1UCRA 4FX0A 1UZCA 2DA5A 4I7HA 1S7EA 2HFHA 1W0UA 4NNJA 1FWZA 2FJ1A 3BC8A 2YU9J 4JYKA 2YPRA 1BI3A 2R7UA 5HDGA 4S0HB 1K83J 5LEJA 3DQVC 2GLOA 5L3CA 2ADUA 2LR8A 3BTCA 1CGPA 1FIAA 2A6TA 2M7AA 1J9IA 4EVIA 1IAWA 1IV6A 1IDYA 1T39A 4XKVA 3CP8A 2E1OA 5KAFC 1MZBA 1AHDP 1MNDA 2L9VA 2Z3YA 2HTJA 3LFUA 2WBMA 2XPVA 2KJCA 3DBHB 1XMXA 3Q9VA 3KFWX 3VYSB 3ZQFA 4EV0A 1J75A 4C30A 1R6RA 4Y15A 1BIAA 2O5RA 4OAZA 2QQ8A 1X3ZB 3ESWB 4RAFA 5FGMA 2O3FA 4XMYA 1VQ7I 1ZHFA 2E5NA 3BJ6A 3G4SI 1JE8A 3W6VA 2WADA 4KT5C 1PUFA 4RB3C 1XX5A 2DLLA 2CQXA 2A5WA 4FE7A 5HNHA 1T6SA 1BC8C 1G3TA 3VYTB 3HOSA 1IN7A 2UWMA 2LKPA 4JX6A 1SVOA 3I4NJ 3K10A 4C2MJ 5EJCA 2DFIA 1TL8A 2I5UA 1LKXA 4AYBA 2LY2A 1MBHA 4EGZA 1UJ8A 1ZR4A 3CC4I 4A93J 3MKWB 2CQNA 5H6QA 2L01A 1J09A 4A6EA 1GVDA 4ZTFA 1KA8A 3BT9A 4NBQA 3MWMA 1JKOC 1WKMA 2XSDC 5GAGJ 3H0DA 5TRDA 1MSEC 3S16J 1IUYA 4GRIA 1BBYA 2E1MC 2Y31A 4U0VA 2LKXA 3BG9A 1MH3A 2ECCA 1DGRM 1HSTA 2QVOA 5C4XJ 3BY6A 3G2BA 5J1RA 3OSFA 4WF2A 3CCMI 3D5RC 2BXYA 4E7KA 2P5KA 4M6VA 2NVTJ 2OC6A 4PGHA 2PJRB 2X6YA 6PAXA 1FTTA 4EJUA 2EA2A 3QQAA 2VBWA 3BCAA 3HKZA 4BJTA 1WJ5A 1R9TJ 2EFPA 4QPQA 2VPLA 4PJ0C 2CS3A 4KFCA 2NVQJ 1TWHJ 1YIOA 1Y8QB 2Z16A 4F92B 4LG3A 1RUNA 4BUPA 3CMAI 2NYXA 5IOYA 3VSLA 4RGXA 4LLNA 3PUBA 2E35A 1TBXA 1S9HA 3L9FA 1JT0A 1BN5A 1EA3A 2E7XA 4IHTA 2Z2SB 5DV5A 3CUOA 3RDIA 4IHWA 2LC2A 4AYBN 4ZYEA 1MD0A 2DU9A 2W25A 1XMAA 2VJ4A 5JI6A 1H9GA 3OYNA 1FP2A 3N97A 3ZQQA 1BA5A 2HR3A 2QSGX 2W57A 5C3EJ 3FZVA 2DA6A 5E20A 1PP8F 3MCZA 5DTDA 3FKIJ 2FUG2 2UV1A 2M2EA 4HDVA 1K7AA 4O3MA 1OLTA 3LQQA 3EQLF 2ZB9A 5EGOA 3BR1A 3TW7A 3ZN1A 1TLHB 5J3LA 3S15J 2UUZA 1G3SA 1PUFB 3U9GA 2DN0A 4RMNA 1I27A 3BTLA 2DOFA 3CCLI 3C7JA 2NOGA 3CO7C 2M8EA 1K61A 3EYIA 1R71A 3F9KA 1GHCA 1MIJA 4AVPA 2XGDA 3PO3J 1W7PA 5DEQA 3RI4A 2FQ3A 4LLGF 3L7WA 5B1AH 2UZKA 1LQ1A 4MEXF 2V6CA 1PDNC 1B6AA 2DJNA 5E3NA 2CGPA 1KQ0A 2VL8A 1ETYA 5E3OA 4UB8C 3ZQ7A 5JFRA 1FYKA 2EINH 1O3QA 3OWTA 5D8LB 1U5TB 4MHGA 3F23A 2QENA 1ZN2A 2L9SA 3F21A 2W82A 5ILUA 3LSRA 4S05A 4N4NB 3KLNA 3ABTA 2CO5A 4BL0B 4HQEA 3DBRB 1X1BA 1X2MA 2VE8A 2EWNA 3QPLA 3FMSA 4YRVA 3P9KA 1HW2A 2DT5A 2W85A 4ZH4F 2W84A 5L3FA 3DV8A 2ESNA 2GBYA 4RDUA 1T2KA 4B8XA 2Z33A 3CP2A 2CSOA 2DA4A 2M4GA 1VQLI 5A2QZ 4PGGA 4N9HA 3TOBA 5EEAA 2DFFA 1SFKA 4M71A 3SEZA 2GA2A 1OQYA 4KIBA 3BG5A 4MO7A 2JA6J 2EK5A 2XKPA 3HUGB 3HRSA 1MJ9A 1MKMA 1N75A 2MW8A 4L5JA 3BG7A 3S32A 3TEDA 2K4BA 4HEA2 3ZMDA 1OYYA 2LVSA 4HX7A 2MGQA 2XGCA 3I71A 3HOTA 2P7VB 5L3EA 3JSOA 3K4NA 4BHBA 4D1QA 2DK8A 4C2TA 4GO1A 1S5LC 1ZAOA 4IPAA 2PBIA 2R5ZA 4LIUA 4A3EJ 4P9UA 4CYCB 4I0BA 2QSFX 1GDTA 3PO2J 1YX3A 5FKKA
chains in the Genus database with same CATH topology
5GP9A 4BY7J 1RETA 5HODA 4IHYA 3B6CA 2JA8J 3HOWJ 1IDZA 2LD5A 1EF4A 5BNGA 2G0EA 1TWCJ 3IH2A 2LTPA 3PM1A 4X1EA 1YRNB 1TWGJ 5EF6A 1GV5A 3K2AA 3ZQGA 2HI3A 3NARA 4V2GA 4DZPA 1AKHB 3S14J 3HOYJ 1XS9A 2MG4A 3S2HJ 1CQTA 3F0CA 3TW6A 2JWTA 3WHCA 2K40A 4QSHA 1WGXA 3WHBA 4JP0A 5M5YJ 1UG2A 2NS8A 1P7IA 1IJWC 1XC5A 5JLWA 5IOZA 2H8RA 2VUMJ 2DMTA 1VI0A 2HXIA 3FK6A 1BJZA 2N8GA 3ZQCA 5IYCJ 4IHXA 5K7HA 1ETXA 4A3CJ 1HDDC 3BG3A 1ETWA 3D1NI 2R93J 4M3GA 1O4XA 4MIMA 4UUTA 5K7FA 1JUMA 1U78A 5FKKA 1ETKA 1GT0C 1Y1WJ 1GUUA 3DCFA 2ME6A 2VKVA 2HXOA 5M3MJ 1X2NA 1Q1VA 5F0CA 3BQZA 3BQYA 5M5WJ 2M8GX 2Y30A 1X58A 3JRFA 5F08A 2JA7J 3HGYA 4DW6A 2Y9ZA 2XRLA 1HCRA 2JK3A 3A02A 4IHVA 2ID3A 5FLMJ 2LFBA 4M3FA 2Y9YA 2LLKA 1TWFJ 2EH3A 1BW5A 3GBGA 3HOUJ 2EZKA 2K9NA 2R0QC 2E2JJ 1LFBA 1WPKA 5C4JJ 3MN2A 3S1QJ 4G12A 3IH3A 4DYQA 3H3VK 5F04A 1TC3C 2DA1A 1SFOJ 5E3LA 2R7ZJ 3JRHA 4A3GJ 1B8IB 1UHSA 3VPRA 1MBKA 1T33A 2LY9A 5F0HA 1IG7A 5FKOA 1HF0A 1B72B 4BBSJ 3L1PA 4A3JJ 4V2FA 1H8AC 4HNVA 2P81A 5EZGA 3JRGA 3GTGJ 5J1YA 3BR2A 4D7MA 3BR6A 3HOVJ 3S17J 3GTMJ 2O7OA 2QF7A 3G1MA 1U9OA 1QPIA 3LSPA 4XK4A 3G1LA 4MLOA 5EYRA 2ID6A 2RAEA 2H1KA 3BTIA 1JTXA 3Q0UA 2EZLA 1RKTA 2M9HA 1ZTRA 4XRSA 5FJ8J 1WH7A 1F36A 1ZKGA 2JJ7A 3HEFA 5EZHA 5EGOB 1SANA 2COBA 4A3IJ 1JKPC 3GTKJ 3HKZN 3O8GA 1MBEA 4M3BA 3JRIA 4A3LJ 2XPWA 1WH5A 3UKGA 4IEJA 3JRCA 1IRZA 3BR3A 2LK2A 4XRMA 1A5JA 3RQIA 1JT6A 4XIDA 3HGGA 4GFBA 1IGNA 1MH4A 1XG1A 3BR5A 3GTJJ 3RZOJ 1MBGA 1BL0A 1VF9A 2R92J 2PMZN 2NVXJ 4JX5A 5C44J 3ZQHA 3SFIA 3TP3A 4UUSB 1QVUA 1BW6A 1I3QJ 2WB1N 2FD5A 2ELKA 2NVYJ 2CQQA 2M0CA 4Y52J 2E2IJ 2DMUA 3M4OJ 2ME0A 2IEKA 3HM5A 2QCOA 3GTLJ 2FX0A 1E3OC 1FTZA 3A01A 1WCMJ 2HYJA 2NS7A 3MKLA 4MFDA 2CUFA 5J1UA 1ETVA 1MSFC 1DU6A 3GTOJ 1JUSA 3OIOA 1ZGWA 1NK2P 4EEFG 2CU7A 4M3EA 4ABZA 5F0FA 3GTQJ 2HOAA 2DA5A 5JLXA 4Y7NJ 3IV5A 1S7EA 1W0UA 1Z77A 1LE8A 2FJ1A 3B6AA 2YU9J 3DEWA 2X48A 2XB0X 4JYKA 2I10A 2XGEA 3A01B 4S0HB 1K83J 1OCPA 2KDZA 1JKQC 2GLOA 2LR8A 3BTCA 3O8HA 1AU7A 1FIAA 4DYRA 1IC8A 3A03A 1IV6A 3S2DJ 1IDYA 2FQ4A 2L0KA 4BKXA 2DMPA 2E1OA 2LP0A 4B4CA 2DMNA 1AHDP 2R5ZB 4A3MJ 2CUEA 2XPVA 1IUFA 3HOXJ 1MNMC 2L7MP 3E7LA 3ZQFA 4XRSG 1QRYA 2EZHA 3OOUA 4JX4A 4W97A 2CJJA 5IP7J 5F27A 1MBJA 3HDDA 1A6IA 3W6VA 1PUFA 2CQXA 4FE7A 5FKLA 2YUSA 1YRNA 3CQZJ 5K7ZA 4A3FJ 4JX6A 1MBFA 3FISA 1FEXA 4I76A 3I4NJ 3FK7A 3SJMA 4C2MJ 1G2HA 1FIPA 1U9NA 1MBHA 1ORKA 4I6ZA 1ZR2A 2R5YA 1ZR4A 1VFCA 3QPSA 4A93J 1JJ6C 2VPRA 1VNDA 3Q0WA 1ETQA 1HLVA 1GVDA 4UUSA 1ITYA 2YS9A 3BT9A 2AHQA 1RPWA 2X6OA 2DA7A 1ZK8A 1JKOC 2TCTA 2XSDC 1MSEC 2K9SA 2E2HJ 3HOZJ 3S16J 3S1NJ 5FKNA 2Y31A 4NDLA 2LKXA 3JRAA 5E3MA 1NK3P 5IP9J 3BG9A 1MH3A 2ECCA 2R5YB 2JMWA 5C4XJ 1Z0XA 2OPTA 3ZQIA 5J1RA 3OSFA 2O9LA 4M6VA 2NVTJ 2GM4A 1POGA 9ANTA 1GV2A 5GPAA 5EDNA 2WV1A 1H88C 3JRDA 1FTTA 1WI3A 3QQAA 3K7AJ 3HB9A 1R9TJ 1JUPA 3CDLA 3HBLA 3MVPA 1RKWA 2NVQJ 2X9DA 1TWHJ 2JA5J 3LSJA 2AO9A 5IOYA 2XB5A 3JRBA 1F43A 2DA2A 1JT0A 1QVTA 2JN6A 5IPAA 3BR0A 1D5YA 2HOTA 3LSGA 2DMQA 2B63J 4IHWA 4FE4A 3BTJA 4W1UA 4AYBN 4FTHA 5DS9A 2M34A 2L7FP 4MFEA 3S1RJ 1OFCX 2Y2ZA 3TP0A 3JR9A 1RR7A 2K9QA 1BA5A 3LOCA 5GPCA 5C3EJ 1JGGA 2DA6A 5DTDA 2HQ5A 3FKIJ 4A3KJ 4M3DA 2M2EA 1OJLA 2CRGA 2ZB9A 4A69C 5EGOA 3BR1A 3TW7A 2TRTA 2XPUA 5J3LA 3S15J 4XICA 1PUFB 2DN0A 1OCTC 3BTLA 2NOGA 1NTCA 1K61A 4RBOA 2WAQN 3M3YJ 1AKHA 2E19A 1HDPA 1H89C 5FLVA 3S1MJ 5F1JA 4B1RA 1JJ8C 2XGDA 3PO3J 4B3AA 1T56A 3ZOBA 4D5FA 1I6HJ 1U8BA 1JTYA 2VI6A 4BBRJ 2DTZA 5M3FJ 5M5XJ 3CCYA 2DJNA 5E3NA 1UMQA 2O8KA 3ZQLA 1ETYA 5E3OA 5FKMA 5EG0A 2L7ZA 2L9RA 2EBIA 5IYBJ 3JREA 3C2BA 4D7NA 4QIWN 3LSRA 3I4MJ 1W0TA 3CMYA 1TWAJ 4AUXA 2MSYA 1ZQ3P 1RESA 1X2MA 4DYCA 3QPLA 2VKEA 1DU0A 4LOCA 4RDUA 2GBYA 5EG0B 1Y1VJ 2DA4A 2OF7A 2IBDA 2HDDA 4A3DJ 4BY1J 5IP6A 3LNQA 3FIWA 5EEAA 4D5CA 3GTPJ 1B72A 3RKQA 3BG5A 1JKRC 2HOSA 3NAUA 4MO7A 2JA6J 2EZIA 4QTRA 4AC0A 4CYCA 3RZDJ 1P7JA 4BXXJ 2MW8A 2D5VA 2KT0A 3IH4A 1LE8B 4FISA 2IAIA 5IYDJ 3Q3SA 3TEDA 1FJLA 2LVSA 3H0GJ 3OSGA 1HOMA 4J19A 2MGQA 2XGCA 3G1OA 2W48A 1ETOA 4DZJA 3SDGA 4C3JJ 1B8IA 4X6AJ 2ECBA 4C3HJ 1LFUP 4A3BJ 4FCYA 3Q0VA 2R5ZA 1APLC 4A3EJ 1ENHA 4CYCB 2Y0SN 4C3IJ 1I50J 1GDTA 4L5EA 3PO2J 2DA3A 2EQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GP9 A;  4BY7 J;  1RET A;  5HOD A;  4IHY A;  3B6C A;  2JA8 J;  3HOW J;  1IDZ A;  2LD5 A;  1EF4 A;  5BNG A;  2G0E A;  1TWC J;  3IH2 A;  2LTP A;  3PM1 A;  4X1E A;  1YRN B;  1TWG J;  5EF6 A;  1GV5 A;  3K2A A;  3ZQG A;  2HI3 A;  3NAR A;  4V2G A;  4DZP A;  1AKH B;  3S14 J;  3HOY J;  1XS9 A;  2MG4 A;  3S2H J;  1CQT A;  3F0C A;  3TW6 A;  2JWT A;  3WHC A;  2K40 A;  4QSH A;  1WGX A;  3WHB A;  4JP0 A;  5M5Y J;  1UG2 A;  2NS8 A;  1P7I A;  1IJW C;  1XC5 A;  5JLW A;  5IOZ A;  2H8R A;  2VUM J;  2DMT A;  1VI0 A;  2HXI A;  3FK6 A;  1BJZ A;  2N8G A;  3ZQC A;  5IYC J;  4IHX A;  5K7H A;  1ETX A;  4A3C J;  1HDD C;  3BG3 A;  1ETW A;  3D1N I;  2R93 J;  4M3G A;  1O4X A;  4MIM A;  4UUT A;  5K7F A;  1JUM A;  1U78 A;  5FKK A;  1ETK A;  1GT0 C;  1Y1W J;  1GUU A;  3DCF A;  2ME6 A;  2VKV A;  2HXO A;  5M3M J;  1X2N A;  1Q1V A;  5F0C A;  3BQZ A;  3BQY A;  5M5W J;  2M8G X;  2Y30 A;  1X58 A;  3JRF A;  5F08 A;  2JA7 J;  3HGY A;  4DW6 A;  2Y9Z A;  2XRL A;  1HCR A;  2JK3 A;  3A02 A;  4IHV A;  2ID3 A;  5FLM J;  2LFB A;  4M3F A;  2Y9Y A;  2LLK A;  1TWF J;  2EH3 A;  1BW5 A;  3GBG A;  3HOU J;  2EZK A;  2K9N A;  2R0Q C;  2E2J J;  1LFB A;  1WPK A;  5C4J J;  3MN2 A;  3S1Q J;  4G12 A;  3IH3 A;  4DYQ A;  3H3V K;  5F04 A;  1TC3 C;  2DA1 A;  1SFO J;  5E3L A;  2R7Z J;  3JRH A;  4A3G J;  1B8I B;  1UHS A;  3VPR A;  1MBK A;  1T33 A;  2LY9 A;  5F0H A;  1IG7 A;  5FKO A;  1HF0 A;  1B72 B;  4BBS J;  3L1P A;  4A3J J;  4V2F A;  1H8A C;  4HNV A;  2P81 A;  5EZG A;  3JRG A;  3GTG J;  5J1Y A;  3BR2 A;  4D7M A;  3BR6 A;  3HOV J;  3S17 J;  3GTM J;  2O7O A;  2QF7 A;  3G1M A;  1U9O A;  1QPI A;  3LSP A;  4XK4 A;  3G1L A;  4MLO A;  5EYR A;  2ID6 A;  2RAE A;  2H1K A;  3BTI A;  1JTX A;  3Q0U A;  2EZL A;  1RKT A;  2M9H A;  1ZTR A;  4XRS A;  5FJ8 J;  1WH7 A;  1F36 A;  1ZKG A;  2JJ7 A;  3HEF A;  5EZH A;  5EGO B;  1SAN A;  2COB A;  4A3I J;  1JKP C;  3GTK J;  3HKZ N;  3O8G A;  1MBE A;  4M3B A;  3JRI A;  4A3L J;  2XPW A;  1WH5 A;  3UKG A;  4IEJ A;  3JRC A;  1IRZ A;  3BR3 A;  2LK2 A;  4XRM A;  1A5J A;  3RQI A;  1JT6 A;  4XID A;  3HGG A;  4GFB A;  1IGN A;  1MH4 A;  1XG1 A;  3BR5 A;  3GTJ J;  3RZO J;  1MBG A;  1BL0 A;  1VF9 A;  2R92 J;  2PMZ N;  2NVX J;  4JX5 A;  5C44 J;  3ZQH A;  3SFI A;  3TP3 A;  4UUS B;  1QVU A;  1BW6 A;  1I3Q J;  2WB1 N;  2FD5 A;  2ELK A;  2NVY J;  2CQQ A;  2M0C A;  4Y52 J;  2E2I J;  2DMU A;  3M4O J;  2ME0 A;  2IEK A;  3HM5 A;  2QCO A;  3GTL J;  2FX0 A;  1E3O C;  1FTZ A;  3A01 A;  1WCM J;  2HYJ A;  2NS7 A;  3MKL A;  4MFD A;  2CUF A;  5J1U A;  1ETV A;  1MSF C;  1DU6 A;  3GTO J;  1JUS A;  3OIO A;  1ZGW A;  1NK2 P;  4EEF G;  2CU7 A;  4M3E A;  4ABZ A;  5F0F A;  3GTQ J;  2HOA A;  2DA5 A;  5JLX A;  4Y7N J;  3IV5 A;  1S7E A;  1W0U A;  1Z77 A;  1LE8 A;  2FJ1 A;  3B6A A;  2YU9 J;  3DEW A;  2X48 A;  2XB0 X;  4JYK A;  2I10 A;  2XGE A;  3A01 B;  4S0H B;  1K83 J;  1OCP A;  2KDZ A;  1JKQ C;  2GLO A;  2LR8 A;  3BTC A;  3O8H A;  1AU7 A;  1FIA A;  4DYR A;  1IC8 A;  3A03 A;  1IV6 A;  3S2D J;  1IDY A;  2FQ4 A;  2L0K A;  4BKX A;  2DMP A;  2E1O A;  2LP0 A;  4B4C A;  2DMN A;  1AHD P;  2R5Z B;  4A3M J;  2CUE A;  2XPV A;  1IUF A;  3HOX J;  1MNM C;  2L7M P;  3E7L A;  3ZQF A;  4XRS G;  1QRY A;  2EZH A;  3OOU A;  4JX4 A;  4W97 A;  2CJJ A;  5IP7 J;  5F27 A;  1MBJ A;  3HDD A;  1A6I A;  3W6V A;  1PUF A;  2CQX A;  4FE7 A;  5FKL A;  2YUS A;  1YRN A;  3CQZ J;  5K7Z A;  4A3F J;  4JX6 A;  1MBF A;  3FIS A;  1FEX A;  4I76 A;  3I4N J;  3FK7 A;  3SJM A;  4C2M J;  1G2H A;  1FIP A;  1U9N A;  1MBH A;  1ORK A;  4I6Z A;  1ZR2 A;  2R5Y A;  1ZR4 A;  1VFC A;  3QPS A;  4A93 J;  1JJ6 C;  2VPR A;  1VND A;  3Q0W A;  1ETQ A;  1HLV A;  1GVD A;  4UUS A;  1ITY A;  2YS9 A;  3BT9 A;  2AHQ A;  1RPW A;  2X6O A;  2DA7 A;  1ZK8 A;  1JKO C;  2TCT A;  2XSD C;  1MSE C;  2K9S A;  2E2H J;  3HOZ J;  3S16 J;  3S1N J;  5FKN A;  2Y31 A;  4NDL A;  2LKX A;  3JRA A;  5E3M A;  1NK3 P;  5IP9 J;  3BG9 A;  1MH3 A;  2ECC A;  2R5Y B;  2JMW A;  5C4X J;  1Z0X A;  2OPT A;  3ZQI A;  5J1R A;  3OSF A;  2O9L A;  4M6V A;  2NVT J;  2GM4 A;  1POG A;  9ANT A;  1GV2 A;  5GPA A;  5EDN A;  2WV1 A;  1H88 C;  3JRD A;  1FTT A;  1WI3 A;  3QQA A;  3K7A J;  3HB9 A;  1R9T J;  1JUP A;  3CDL A;  3HBL A;  3MVP A;  1RKW A;  2NVQ J;  2X9D A;  1TWH J;  2JA5 J;  3LSJ A;  2AO9 A;  5IOY A;  2XB5 A;  3JRB A;  1F43 A;  2DA2 A;  1JT0 A;  1QVT A;  2JN6 A;  5IPA A;  3BR0 A;  1D5Y A;  2HOT A;  3LSG A;  2DMQ A;  2B63 J;  4IHW A;  4FE4 A;  3BTJ A;  4W1U A;  4AYB N;  4FTH A;  5DS9 A;  2M34 A;  2L7F P;  4MFE A;  3S1R J;  1OFC X;  2Y2Z A;  3TP0 A;  3JR9 A;  1RR7 A;  2K9Q A;  1BA5 A;  3LOC A;  5GPC A;  5C3E J;  1JGG A;  2DA6 A;  5DTD A;  2HQ5 A;  3FKI J;  4A3K J;  4M3D A;  2M2E A;  1OJL A;  2CRG A;  2ZB9 A;  4A69 C;  5EGO A;  3BR1 A;  3TW7 A;  2TRT A;  2XPU A;  5J3L A;  3S15 J;  4XIC A;  1PUF B;  2DN0 A;  1OCT C;  3BTL A;  2NOG A;  1NTC A;  1K61 A;  4RBO A;  2WAQ N;  3M3Y J;  1AKH A;  2E19 A;  1HDP A;  1H89 C;  5FLV A;  3S1M J;  5F1J A;  4B1R A;  1JJ8 C;  2XGD A;  3PO3 J;  4B3A A;  1T56 A;  3ZOB A;  4D5F A;  1I6H J;  1U8B A;  1JTY A;  2VI6 A;  4BBR J;  2DTZ A;  5M3F J;  5M5X J;  3CCY A;  2DJN A;  5E3N A;  1UMQ A;  2O8K A;  3ZQL A;  1ETY A;  5E3O A;  5FKM A;  5EG0 A;  2L7Z A;  2L9R A;  2EBI A;  5IYB J;  3JRE A;  3C2B A;  4D7N A;  4QIW N;  3LSR A;  3I4M J;  1W0T A;  3CMY A;  1TWA J;  4AUX A;  2MSY A;  1ZQ3 P;  1RES A;  1X2M A;  4DYC A;  3QPL A;  2VKE A;  1DU0 A;  4LOC A;  4RDU A;  2GBY A;  5EG0 B;  1Y1V J;  2DA4 A;  2OF7 A;  2IBD A;  2HDD A;  4A3D J;  4BY1 J;  5IP6 A;  3LNQ A;  3FIW A;  5EEA A;  4D5C A;  3GTP J;  1B72 A;  3RKQ A;  3BG5 A;  1JKR C;  2HOS A;  3NAU A;  4MO7 A;  2JA6 J;  2EZI A;  4QTR A;  4AC0 A;  4CYC A;  3RZD J;  1P7J A;  4BXX J;  2MW8 A;  2D5V A;  2KT0 A;  3IH4 A;  1LE8 B;  4FIS A;  2IAI A;  5IYD J;  3Q3S A;  3TED A;  1FJL A;  2LVS A;  3H0G J;  3OSG A;  1HOM A;  4J19 A;  2MGQ A;  2XGC A;  3G1O A;  2W48 A;  1ETO A;  4DZJ A;  3SDG A;  4C3J J;  1B8I A;  4X6A J;  2ECB A;  4C3H J;  1LFU P;  4A3B J;  4FCY A;  3Q0V A;  2R5Z A;  1APL C;  4A3E J;  1ENH A;  4CYC B;  2Y0S N;  4C3I J;  1I50 J;  1GDT A;  4L5E A;  3PO2 J;  2DA3 A;  2EQR A; 
#chains in the Genus database with same CATH topology
 2DYR H;  3HJE A;  4CCO A;  1LUJ B;  3HSR A;  2Y75 A;  3B6C A;  1XMK A;  5LHH A;  3CME I;  5FRM A;  3JTG A;  2JA8 J;  4GXO A;  4NHJ A;  1O3R A;  5GTH C;  2VC0 A;  3FWE A;  5BNG A;  2R7T A;  2LTP A;  3I59 B;  3QPT A;  3EDP A;  5HNF A;  3OYI A;  1XD7 A;  1T38 A;  2R7Q A;  3C2G A;  1KYW A;  3ZQG A;  4V2G A;  2MG4 A;  2UXN A;  1VQ4 I;  1W5T A;  3WHC A;  1VTN C;  2M4K A;  2CV0 A;  3WHB A;  4IOA F;  3AKZ A;  1XDS A;  3ZMV A;  1UG2 A;  3BP8 A;  2OCC H;  1FYM A;  4B47 A;  1P7I A;  5D4R A;  3ZP5 A;  1X4P A;  4IRH A;  2E34 A;  3T0Y A;  3VOD A;  5JLW A;  2H8R A;  2DMT A;  4F3Q A;  1G6N A;  3KZY A;  2B0L A;  4B44 A;  4U7B A;  1MJA A;  4I98 B;  4PJJ A;  2N8G A;  1WRJ A;  5K7H A;  1VQ6 I;  1ETX A;  4A3C J;  2V79 A;  2PQ8 A;  2CQK A;  3COA C;  3BG3 A;  1J2X A;  4PFO A;  5CVU A;  1JUM A;  3FX3 A;  1ETK A;  1WJE A;  1S8N A;  1GT0 C;  1QBJ A;  3CCS I;  3DCF A;  3E1S A;  2ME6 A;  3A4C A;  3SZT A;  3O6B B;  1QZY A;  5F0C A;  2GZW A;  4ENK A;  1J59 A;  4CUG A;  3OYL A;  1KON A;  4BE2 A;  1XN7 A;  3WOD F;  3LQR A;  1HCR A;  2HKO A;  2NNN A;  4RB0 A;  1WWX A;  4IRI A;  1YYV A;  5H20 A;  5FLM J;  4RM2 A;  1TWF J;  1SFU A;  1BW5 A;  1BM9 A;  2AQE A;  3PSF A;  1JHF A;  1T95 A;  4MEY F;  2K9N A;  2VBY A;  1LVA A;  2ICW G;  5FD5 A;  1K4T A;  2OTJ I;  5HS9 A;  1RR8 C;  1HKT A;  4KT6 A;  3AG3 H;  5F0H A;  4RLQ A;  4Z6Y A;  2NVU B;  2QEX I;  4BBS J;  2STT A;  2XSJ C;  4H4K C;  4V2F A;  2KIU A;  2P4W A;  2W1O A;  4HZF A;  5EZG A;  3BR2 A;  1T98 A;  1FOK A;  3RIR A;  3DLL F;  3OYA A;  3J81 K;  1TQI A;  3G1M A;  3OMY A;  4D0P A;  1YIT I;  2HOE A;  1QPI A;  3LSP A;  2LH9 A;  3CLO A;  3U1K A;  3G1L A;  3RYR A;  4IO9 F;  2RAE A;  2W7N A;  3OYM A;  3Q0U A;  2EZL A;  1ZTR A;  2JJ7 A;  5EGO B;  4A3I J;  1JKP C;  1SAN A;  2COB A;  4BDY A;  4GCV A;  1EV7 A;  3I55 I;  3E6M A;  5J4V A;  1XGO A;  3SYT A;  4KN7 X;  3JRC A;  3FBN B;  3I5U A;  1OR7 A;  4BGD A;  2AXL A;  2JRM A;  2ZSI B;  1SVM A;  4XL9 A;  4HLX A;  2LYC A;  4HST A;  4EJO A;  3MD2 A;  3CCQ I;  4G7O F;  3BR5 A;  2NAZ A;  3GTJ J;  2E5Z A;  5HLT A;  1K78 A;  1BL0 A;  2KZG A;  4BHC A;  4JOM A;  4JX5 A;  5C44 J;  5CLS A;  1I1G A;  2QWW A;  4C2U A;  2F2E A;  1CF7 B;  4ZC3 A;  1QVU A;  3S93 A;  2YR2 A;  4M9Z A;  5LGT A;  3GZN B;  3TOA A;  4WK8 F;  2PI0 A;  3HG9 A;  2NVY J;  3DFG A;  5CYV A;  1TW3 A;  1TW2 A;  2CQQ A;  2MC3 A;  3KP4 A;  4HF0 A;  4Y52 J;  4AID A;  3K4J A;  1R4N B;  2IEK A;  5B3S H;  2QCO A;  4G9Y A;  2FX0 A;  3LFK A;  4KDP A;  4M6Y A;  3U2R A;  3UR3 C;  4HV6 A;  4PCQ A;  1ODD A;  4UV8 A;  3WU2 C;  1YW7 A;  2HYJ A;  3MMY B;  1LNW A;  4OU0 A;  4YG2 F;  3OS2 A;  3P9C A;  3GTO J;  3J80 Z;  3NWS A;  1JUS A;  4ZDL A;  4BE1 A;  1WI9 A;  3OIO A;  1ZGW A;  4RLF A;  2R7X A;  4KIG A;  1NK2 P;  1MMN A;  1TNT A;  2KQR A;  3HRU A;  4M3E A;  3NEU A;  2EIM H;  2IGN A;  3KP3 A;  5KVR A;  3IKT A;  4YIR X;  5F0F A;  1WSU A;  2K5C A;  5JLX A;  2H94 A;  4IQ4 A;  1HQC A;  2XC7 A;  3IV5 A;  5K5Q A;  1FYL A;  1L0O C;  1BI2 A;  3F8F A;  2XB0 X;  3BCB A;  2XGE A;  2DPU A;  4F52 A;  1ZRC A;  2PG4 A;  1QO0 D;  4Q4Z F;  2PN6 A;  1SAX A;  5AIQ A;  2KDZ A;  3LAP A;  2KIM A;  3O8H A;  4DBQ A;  3AG1 H;  1O3T A;  1DP3 A;  1HC8 A;  2IVM A;  2DOE A;  3TDZ C;  3TL4 X;  4BKX A;  3ZR8 X;  1HXD A;  2DO7 A;  1DUX C;  4B4C A;  3RTR A;  5E17 F;  1MGT A;  2R5Z B;  2K9L A;  3EUA A;  1HA8 A;  2CYY A;  2CUE A;  4KIS A;  1OR7 C;  2WAF A;  3HOX J;  1MNM C;  2NXN B;  3MKY B;  4HDU A;  4O5V A;  3E7L A;  1IN8 A;  3EUH C;  1QRY A;  4WXH A;  3OYK A;  2IS1 A;  3OOU A;  4HA8 A;  4ANJ A;  1WHU A;  5IP7 J;  2CJJ A;  3FHZ A;  1I3A A;  5F27 A;  3QRF F;  2JVG A;  4YFK F;  3HDD A;  2HWV A;  1A6I A;  1TQM A;  3VSK A;  2V1D A;  2BHY A;  3I59 A;  1UG0 A;  2ZSH B;  5A2Q K;  4AM3 A;  1H9T A;  2DQR A;  3HIF A;  3PSI A;  3CQZ J;  5K7Z A;  4CA0 A;  4A3F J;  4PJN A;  5JVG F;  4G7H F;  3R60 A;  5D5X B;  3WGG A;  2QGU A;  5JHF A;  2F5C A;  4I01 A;  4MTD A;  1U9N A;  2A61 A;  3OR2 C;  4E70 A;  4IVN A;  2WC2 A;  5K5R A;  4HW0 A;  2ISZ A;  3OR1 C;  1PVE A;  5IT3 A;  1VFC A;  1G4D A;  1DQU A;  1R5H A;  1D1B A;  5E1W A;  1WVR A;  4IXA A;  3KP7 A;  1ETQ A;  1ZGJ A;  3HRT A;  2XAQ A;  1HLV A;  1CF7 A;  4CGZ A;  1ITY A;  4A5M A;  5KNL A;  2AHQ A;  1RPW A;  2X6O A;  1SD5 A;  2DI3 A;  2DA7 A;  2Q2E B;  2WY8 Q;  1ZK8 A;  3ZMZ A;  3N4M A;  2TCT A;  1J0R A;  2K9S A;  5CVI A;  3WE3 A;  4UV9 A;  2V9K A;  1Y0N A;  2M1B A;  4NDL A;  2YX7 A;  3VFZ A;  5E3M A;  4EJW A;  1X19 A;  4HBL A;  4E7J A;  5FRO A;  2R5Y B;  4OIP F;  3TBI A;  2QZ8 A;  5J8C A;  5CQE A;  1IZ1 A;  1W7P D;  3WTS C;  2OPT A;  2XV4 S;  5KK1 A;  2O9L A;  2A69 F;  2OD5 A;  3K4M A;  9ANT A;  5GPA A;  4I02 A;  3JRD A;  2DT6 A;  1IO2 A;  1HW1 A;  1EH8 A;  3K7A J;  2WAE A;  3HB9 A;  2RQQ A;  3HXL A;  2KPM A;  1ZLJ A;  3GW2 A;  4U88 A;  3PNV A;  2IS2 A;  3HBL A;  3MAJ A;  1RKW A;  2BZT A;  2BV6 A;  2X9D A;  3LSJ A;  2DK5 A;  4E7S A;  2HYG D;  2JZY A;  2K9M A;  1K4S A;  3SDB A;  1K6O A;  3LA3 A;  3IHU A;  2XB5 A;  2ACJ A;  3LSH A;  4XN3 A;  4IF4 A;  1R23 A;  2DA2 A;  2Z5U A;  4CH7 A;  3AAF A;  3V42 A;  3G3Z A;  2JN6 A;  2M0M A;  2GOM A;  2ZFW A;  4F7Z A;  2DMQ A;  2E1M B;  4FE4 A;  1ZRD A;  2HKX A;  1E2X A;  1R7J A;  2L7F P;  3S1R J;  4R1H A;  3HYI A;  1VQM I;  1KQ8 A;  3TP0 A;  3QP6 A;  1ZG1 A;  1RR7 A;  3UNG C;  2FOW A;  4P96 A;  5B66 C;  3DF8 A;  1STZ A;  2XIG A;  4QPO A;  2VOD A;  5J40 A;  2LBF A;  3KX2 A;  2HQ5 A;  4A3K J;  4IL6 C;  2XRO A;  2LNB A;  1LEA A;  2CFX A;  3L2U A;  3J7A O;  1ZH5 A;  2FMY A;  2KRC A;  3FKJ A;  3H3Z A;  4XIC A;  4YII A;  3HC7 A;  3AL0 C;  1Y56 A;  3D5L A;  1LPQ A;  2JUG A;  4RBO A;  4ZJZ A;  4HX8 A;  4NQW B;  4IZZ A;  1FC3 A;  4ZYD A;  4YIF A;  4DOZ A;  4UB6 C;  4ZZL A;  3RKW A;  2HS5 A;  3C1D A;  1SFX A;  2Y48 A;  1T56 A;  1I6H J;  4G6D A;  1U8B A;  1JTY A;  1KZH A;  5M3F J;  4ESF A;  3CCY A;  2XAG A;  2EB7 A;  1LJ9 A;  2RRE A;  3WTT C;  5K5O A;  5EG0 A;  3FM3 A;  3OY9 A;  1BC7 C;  2L7Z A;  3GEZ A;  4CXF A;  2QBY B;  3JRE A;  2XKO A;  3CCE I;  4QIW N;  1XSV A;  4S04 A;  2O03 A;  3E6C C;  4DBR A;  2JTV A;  3CMY A;  2G7H A;  1QHH D;  3OIQ A;  1RZ4 A;  2LF8 A;  5FD6 A;  1U6G A;  2ZXH A;  2HU9 A;  1V5G A;  1DU0 A;  4LOC A;  2EIL H;  2HQN A;  3RKY A;  4CDG A;  1E3P A;  4PJM A;  4Z2Y A;  5DM6 F;  5IT9 Z;  1Y1V J;  1S29 A;  4HYE A;  5ILV A;  3PNY A;  2HDD A;  3EET A;  4TV7 A;  2KZV A;  2PMH A;  4A3D J;  5IP6 A;  4M6X A;  3T8R A;  3BDD A;  1YIJ I;  2LKS A;  1KGS A;  1S6L A;  3SZG A;  3V8L A;  2XUB A;  2DJI A;  3X2Q H;  5D5V B;  3WTY C;  3GX4 X;  1B72 A;  3RKQ A;  2WB1 A;  2K85 A;  2E60 A;  1T8I A;  2WV0 A;  2JRT A;  3DU6 A;  1Z7U A;  2HVS A;  1YI2 I;  2CWE A;  3DEE A;  2KT0 A;  1DP7 P;  2D1H A;  2IAI A;  2ZKZ A;  1FJL A;  3K0L A;  1HKS A;  2VBX A;  3DKX A;  3GFJ A;  5DUK A;  1E3H A;  5BQT A;  2E1N A;  1HKQ A;  3I0T A;  4J19 A;  2PMZ A;  1EKE A;  5LRR A;  4BAY A;  1ETO A;  5H2F C;  4DZJ A;  2A68 F;  2VAS A;  5HDK A;  4X6A J;  3WTV C;  4C3H J;  4XM3 A;  4KA4 A;  2AXT C;  4BH9 A;  4C3I J;  1I50 J;  3OYG A;  3WTU C;  2ZXI A;  2EQR A;  1X58 A;  3J7A Y;  3M7G A;  5GP9 A;  5HOD A;  3BZC A;  3S3M A;  4IHY A;  5KHD A;  2OA4 A;  3WE2 A;  4QWQ A;  4DNC A;  1ZGA A;  4X0G A;  3KP6 A;  1IDZ A;  3FXK A;  3RPQ A;  1V55 H;  4I0A A;  2A07 F;  4A2U A;  3OOP A;  2VKH A;  2VOO A;  3W3C A;  2L4M A;  1TWC J;  2MA3 A;  3IH2 A;  3JTH A;  3PM1 A;  4OMZ A;  4E6K G;  1TWG J;  2K86 A;  4NQW A;  3V8J A;  3S2W A;  1FY7 A;  1GV5 A;  1KYZ A;  3QPH A;  1ACI A;  2F5E A;  4DZP A;  4JBA A;  1J7K A;  3HOY J;  3WG7 H;  2O61 A;  3TW6 A;  2JWT A;  2Y0S A;  3ELK A;  3SQN A;  1UST A;  2KHM A;  3F72 A;  2P7C B;  3S3O A;  4A0Y A;  1PYV A;  2NS8 A;  1IN6 A;  3DPL C;  1IJW C;  1XC5 A;  1FPQ A;  1VI0 A;  4NC8 A;  5CJ9 A;  1B1B A;  4G7Z F;  1TQP A;  3FDY A;  2VQC A;  1F1Z A;  2KRH A;  2F48 A;  2CW8 A;  4I09 A;  2DDA A;  2QBY A;  3FK6 A;  3BJO A;  1ZEL A;  2DDB A;  1SFE A;  3QYB A;  4HSR A;  2STW A;  1YW8 A;  2OZ6 A;  4RAZ A;  1OYI A;  3HSF A;  1ETW A;  2R93 J;  3E5X A;  3KEQ A;  4UUT A;  4FX4 A;  3QP5 A;  3RPU A;  2RNG A;  5K7F A;  1R1T A;  1IRF A;  2VC1 A;  2L54 A;  2OZU A;  4BJ5 C;  2IPQ X;  3U1D A;  1GUU A;  5FB2 A;  2KRF A;  3W6J B;  2MD5 A;  4M73 A;  2LRD A;  3I4P A;  1FOY A;  5M3M J;  2L4A A;  1X2N A;  2JVH A;  1Z3X A;  4Y3O A;  3BQZ A;  2R7O A;  2F4I A;  4CO8 A;  1U5T A;  2Y30 A;  3JRF A;  1QQI A;  1I39 A;  5J4Y A;  3HGY A;  4M74 A;  1ON2 A;  5FFX A;  3A02 A;  2O0Y A;  4XOR A;  3AFH A;  4CHU A;  4AIJ A;  3OV8 A;  5HS8 A;  1TT5 B;  3U21 A;  3MZY A;  2GIV A;  1D0Z A;  2DOA A;  3R61 A;  2RGV A;  3H9J A;  1XPX A;  3HOU J;  2WA0 A;  2EZK A;  2KIQ A;  1Z91 A;  1WJF A;  1WPK A;  5E8G A;  5C4J J;  1VQ9 I;  2V1X A;  1YQA A;  3MN2 A;  3S1Q J;  4P5O A;  4G12 A;  2X85 A;  2PMU A;  4ZYH A;  2DA1 A;  1SFO J;  1P92 A;  3GYH X;  2KLO A;  1MBK A;  2MYS A;  3EUK L;  1VQ8 I;  1T33 A;  4KNY A;  5EEH A;  3OL4 A;  4F91 B;  2CMP A;  2XRN A;  3GUD A;  1IG7 A;  3ABL H;  4ASN A;  1W36 D;  5F1R A;  2G7U A;  3FXO A;  1WJD A;  4NC6 A;  2BW3 B;  4XLC A;  2X51 A;  4D7M A;  2VXZ A;  3ZMT A;  1QHG A;  2PFB A;  2O7O A;  3NWT A;  4CCL A;  3LAJ A;  2LG4 A;  4XK4 A;  3MQ0 A;  3BTI A;  3HPG A;  1JTX A;  4OIQ F;  5FJ8 J;  2LDU A;  1F36 A;  4JQF A;  4R79 A;  3CUQ B;  3KYL A;  1MMA A;  4M3B A;  3R0J A;  1PJR A;  4RA2 A;  1SMT A;  2VE9 A;  2LK2 A;  1D0Y A;  2KKO A;  1MDM A;  3ABU A;  2BY2 A;  4IJA A;  1JT6 A;  3V8K A;  3ROU A;  4RB1 A;  3FXL A;  3ZCO A;  5DD4 A;  3QU6 A;  2DOD A;  1MH4 A;  1W5S A;  3GO5 A;  2ZJQ F;  2V9P A;  2PLY A;  2ZC2 A;  3K6G A;  3VYU B;  3RZO J;  1XTA A;  5E79 C;  1A04 A;  2FA5 A;  4LG0 A;  3KP2 A;  2PMZ N;  1W4M A;  5LGU A;  2X1E A;  3H35 A;  2NVX J;  2NS0 A;  3ZQH A;  3JAM Z;  4KN4 X;  1B59 A;  3VOE A;  1AOY A;  1SAU A;  1I1S A;  2FNA A;  4PSW A;  2FXA A;  3F8N A;  3WGI A;  3QYE A;  2TDX A;  2MBF A;  4EGY A;  1I3Q J;  2JQ7 A;  4M72 A;  2W00 A;  1WJC A;  1DDN A;  2FD5 A;  4WXD A;  3CCJ I;  1KU2 A;  2DMU A;  3BWG A;  2ME0 A;  3M4O J;  4U0W A;  3CJR B;  1EH7 A;  4DJA A;  3IRQ A;  3I3L A;  3SXY A;  5D8K B;  1FTZ A;  1WCM J;  2HVQ A;  3OS1 A;  4MFD A;  5HOO A;  5FLX K;  2ETH A;  4FHT A;  4EEF G;  3O3K A;  2Z99 A;  4XON A;  5DDG A;  4PUS A;  1A6Q A;  3BG6 A;  4ABZ A;  2HOA A;  4L18 B;  3TGN A;  1Y39 A;  2XHK A;  4BYY A;  3B6A A;  2GXA A;  3DEW A;  2X48 A;  2I10 A;  3DPU A;  3E5U A;  3IC7 A;  1WFX A;  3D0S A;  3A01 B;  1HSJ A;  4XSZ F;  4CZC A;  4BS9 A;  1OCP A;  3RCO A;  1JKQ C;  2XAS A;  1VQ5 I;  2RN7 A;  2IT0 A;  1BJA A;  4DYR A;  4P1W A;  3A03 A;  4BQA A;  4L9T A;  4PZJ A;  3S2D J;  2FQ4 A;  1WJB A;  2CUZ A;  4RS8 A;  2LP0 A;  1YFH A;  1X1A A;  1Y0U A;  2DMN A;  1B9N A;  4A3M J;  4B48 A;  3DKW A;  4ENN A;  1IUF A;  4P55 A;  1JXS A;  2L7M P;  3LWF A;  1P4W A;  2GIZ A;  1BI1 A;  2ZME A;  2RNJ A;  4LFU A;  4XRS G;  3AL0 B;  2COM A;  3VB2 A;  2EZH A;  1GXP A;  2R7W A;  4XNF A;  4JX4 A;  2D1V A;  1MBJ A;  1O7L A;  5HLH A;  1YTY A;  4BAC A;  1Z6T A;  2MLG A;  2Y0M A;  2YUS A;  4L5I A;  1N77 A;  3GZ5 A;  1AA7 A;  2O6G E;  2VQG A;  3TDU C;  5DCM B;  4KJZ A;  3FIS A;  1KU3 A;  3JAM K;  3V7R A;  3GWZ A;  2DXI A;  3FK7 A;  4ESB A;  3SJM A;  4IKF A;  1G2H A;  2GOX B;  3EPZ A;  4N0B A;  2X0L A;  3OIP A;  3CCU I;  4BE0 A;  1K79 A;  2R7F A;  1QZE A;  5F64 A;  4OIR F;  3QPS A;  5BMZ A;  2VPR A;  1IXS B;  1X1P A;  2GWR A;  3Q0W A;  4HLY A;  1MJB A;  2EFQ A;  5FRN A;  3HTU A;  2YS9 A;  3QAH A;  1XCB A;  1HW5 A;  3RKX A;  2HZD A;  1LDD A;  2E2H J;  2L3D A;  1LFP A;  5FKN A;  2VB6 A;  2A6E F;  1YHQ I;  3Q9S A;  4IX7 A;  1VQP I;  3FHN A;  2QQ9 A;  1Z6R A;  1KU7 A;  1RUO A;  2DTR A;  1ON1 A;  4HOB A;  1A31 A;  4Q5S F;  3J80 K;  4U87 A;  5E1Z B;  2GM4 A;  3OYH A;  5EDN A;  2FF4 A;  2IGK A;  1H88 C;  1Z9C A;  4IQJ A;  1YJN I;  3VDX A;  1WI3 A;  4YFX F;  1R58 A;  3R0A A;  2X6W A;  3KZZ A;  2V7F A;  1IXR C;  3CDL A;  1KQ9 A;  1P2F A;  2D2W A;  2P6T A;  3OYJ A;  2AO9 A;  1KU9 A;  3JRB A;  3ZRG A;  1TT0 A;  4EAT A;  2BY3 A;  3QU3 A;  5J8F A;  1B9M A;  1SVL A;  1OCZ H;  4GYG A;  4Q47 A;  3TO9 A;  2ZO4 A;  2B9S A;  1FBU A;  1QVT A;  1P6R A;  5IPA A;  2FML A;  3BR0 A;  2HOT A;  1FSE A;  1YO5 C;  3A0B C;  2B63 J;  3BTJ A;  4YEL A;  4FTH A;  5DS9 A;  3CJN A;  4MFE A;  2OQR A;  2FOK A;  1TP4 A;  4WX9 A;  4LJZ F;  2Y2Z A;  1OMI A;  2K9Q A;  2XAJ A;  2JPC A;  3LOC A;  3OS0 A;  5GPC A;  1IN4 A;  5ICC A;  4LK0 F;  1QZZ A;  2F5D A;  2ESH A;  5EEG A;  4M3D A;  5K1Y A;  3DBL B;  3BPV A;  4A69 C;  4AIK A;  2IA2 A;  3ONQ A;  2TRT A;  2XPU A;  4ENM A;  2ELJ A;  3CUQ C;  1OCR H;  1O3S A;  3LSM A;  1AWC A;  2P5L C;  3CJT B;  1ZRF A;  1OCT C;  3NRV A;  2P0W A;  1NTC A;  2M87 A;  5AON A;  2OU2 A;  3I58 A;  3G71 I;  3CTA A;  4XLN F;  5DCM A;  2HPM A;  3M3Y J;  4L9J A;  2EFW A;  4E7H A;  4LB6 B;  3K4K A;  1MDM B;  2XAH A;  1H89 C;  5FLV A;  3FXR A;  4F55 A;  3S1M J;  2JT1 A;  4CZZ A;  3MKZ A;  1JJ8 C;  3GFI A;  2QLZ A;  5CVR A;  3ZOB A;  3FXM A;  2DTZ A;  3DXJ F;  5DYM A;  2DFE A;  1UMQ A;  2MH2 A;  3ZQL A;  2O8K A;  2PX9 A;  3E3V A;  3IAS 2;  3KE2 A;  1X4O A;  1YS6 A;  1OIS A;  1D1C A;  2L9R A;  2H6C A;  1G59 A;  4LK1 F;  5IYB J;  2FU4 A;  4D7N A;  1TZL A;  1YOV B;  4CCN A;  4AVZ A;  3E6B A;  4BEH B;  4BNC A;  3I4M J;  2R4G A;  2M7B A;  2UXX A;  2FBH A;  4AUX A;  2MSY A;  4L0Z B;  3V7S A;  2V1N A;  4DYC A;  1S3J A;  2HZT A;  3HUG A;  2D45 A;  4OMY A;  2VKE A;  2OTL I;  5FLX Z;  4PDK A;  4ZYA A;  2ZFU A;  1PP7 U;  1QGP A;  3DTI A;  2OF7 A;  3HRM A;  4BXU A;  1X1D A;  4BY1 J;  3WTX C;  1R1U A;  4PJL A;  4LIT A;  1LDJ A;  1UFM A;  2BEO A;  2WY7 Q;  5J6X A;  5FO5 A;  3FM5 A;  3LA7 A;  3GTP J;  1JKR C;  2HOS A;  2EZI A;  1HBX G;  4AC0 A;  5IT9 K;  1BOA A;  4CYC A;  3B02 A;  3GLL A;  4D9J A;  3RZD J;  5ICG A;  1P7J A;  3IH4 A;  2XF6 A;  1S72 I;  4FIS A;  3DKY A;  4JK1 X;  2P5V A;  2Q0O A;  3H0G J;  1HOM A;  3CDH A;  3L2V A;  2V4J C;  4A5N A;  3G1O A;  2W48 A;  2XDV A;  3FMR A;  2IGM A;  3QWL A;  3SDG A;  1UHM A;  4C3J J;  2QYO A;  1B8I A;  2ECB A;  3SZP A;  2H8W A;  5DUI A;  4FCY A;  1O57 A;  2EA4 A;  3Q0V A;  4UNO A;  1D8J A;  4AD9 A;  1ZLK A;  1DGW Y;  5E8I A;  3LMM A;  4QLC U;  4L5E A;  2NOJ B;  1Y8R B;  5FFZ A;  3L09 A;  2EPF A;  4L0Y B;  3GCM A;  1RET A;  2ELH A;  3BJA A;  3J7Z I;  4IOC F;  1W5C C;  4B3X A;  1JGS A;  4HNU A;  3TMO A;  2ZME B;  4WXC A;  3HOW J;  2DT7 B;  2E36 A;  2LD5 A;  4HF1 A;  4XOP A;  2VOP A;  1S7O A;  1BR2 A;  1WQ2 A;  4G94 A;  5CQG A;  3K70 C;  4ITV A;  2QKM B;  1G3W A;  4X1E A;  1YRN B;  1VQN I;  4H0E A;  4LB5 A;  2BHZ A;  3PJR A;  1GVJ A;  1T0F C;  3DPT A;  4DQ2 A;  2HI3 A;  2VT3 A;  2YSR A;  3IWZ A;  3S14 J;  2FBK A;  2VN2 A;  1OCC H;  5GTI C;  2VON A;  1FT9 A;  3F0C A;  2LBF B;  2BOL A;  4HV5 A;  2K40 A;  5M5Y J;  1WGX A;  4F93 B;  2IJL A;  2R7D A;  4UVB A;  4UHT A;  2X1C A;  3WG9 A;  3I53 A;  2EV5 A;  2VUM J;  5ILS A;  1FSH A;  1IV8 A;  2KJB A;  1FX7 A;  3ZQC A;  2Z1D A;  4MNU A;  3PQK A;  1OYW A;  2KIS A;  4Y4R A;  1FLI A;  2DFH A;  2HTS A;  3T1B A;  1HDD C;  1IRX A;  4N9I A;  1YW9 A;  4BQQ A;  3D1N I;  4M3G A;  1O4X A;  2HEO A;  2JSP A;  1U78 A;  3F8M A;  4MQ9 F;  3B73 A;  3DTE A;  1WJA A;  1N25 A;  3OYD A;  3W2V A;  4DIQ A;  2ZME C;  3KYD B;  2VKV A;  1XDU A;  5M5W J;  2M8G X;  1V4R A;  1L3L A;  2JA7 J;  4Y17 A;  3BOQ A;  5D4S A;  4KYW A;  2VKD A;  4DW6 A;  2XRL A;  2JK3 A;  4R8H A;  1LDK B;  3F6O A;  2NNY A;  1TTY A;  2F5F A;  2EH3 A;  2MFZ A;  4UXN A;  4E4H A;  1V5F A;  5KAI C;  1U3E M;  2LY1 A;  2R0Q C;  2E2J J;  2CH0 A;  3CES A;  1D3Y A;  3LL7 A;  3S8P A;  3PNT A;  4XKW A;  4HAM A;  2I8D A;  5L3G A;  2PJP A;  2CFO A;  2VQH A;  3IH3 A;  3H3V K;  5F04 A;  2OQG A;  2LOO A;  2R7Z J;  3JRH A;  2BY0 A;  2VJI A;  3C18 A;  1B8I B;  5HDN A;  4N4O B;  1ONV A;  4UVA A;  2QA4 I;  1XSD A;  2LY9 A;  5FKO A;  2LMD A;  3A1Y A;  1B72 B;  1X3U A;  3L1P A;  4A3J J;  3L2Q A;  1H8A C;  4HNV A;  2P81 A;  1R5G A;  2YX4 A;  4RGU A;  3JRG A;  5J1Y A;  3ABK H;  3S17 J;  2LRE A;  2WTE A;  2K3P A;  4L9V A;  1U9O A;  2WAQ A;  2DW4 A;  4MLO A;  5EYR A;  1MMD A;  3RSN A;  4XRS A;  2JPB A;  2MD0 A;  1RKT A;  4EJT A;  3GTK J;  4M9S A;  3I56 I;  1B4A A;  3H5N A;  1MBE A;  3JRI A;  4MQV A;  5B1B H;  1WH5 A;  3UKG A;  4EM0 B;  4AIH A;  4IEJ A;  4EMS A;  3BR3 A;  1NG7 A;  4J00 A;  4XRM A;  3GLX A;  4FAS D;  3CCV I;  3RQI A;  3PFI A;  3TQN A;  4XID A;  4ON0 A;  4XN0 A;  1QPM A;  3VWB A;  4GFB A;  1ULY A;  3RQ4 A;  1IGN A;  2HGC A;  5IY5 H;  2JUC A;  1VF9 A;  2HQA A;  1SC7 A;  1D5V A;  3ECO A;  1XCV A;  4KUM A;  4P9F A;  3LSI A;  4MGR A;  4A12 A;  2E71 A;  3F22 A;  2V26 A;  1GLN A;  2K3F A;  3GME A;  4HX4 A;  3FXJ A;  4UUS B;  2F4M B;  3ISP A;  1BW6 A;  3SEQ A;  1LB2 A;  4UVC A;  4KIT B;  3VYR B;  2IW5 A;  2ELK A;  1P4X A;  1UB9 A;  2ZJ2 A;  3SFZ A;  2HVR A;  1E0E A;  3HM5 A;  1K78 B;  3CF5 F;  4UUV A;  4XSX F;  3BZK A;  2F6C A;  3GTL J;  1P9Q C;  1NG6 A;  5L3D A;  2NS7 A;  2CUF A;  1Q1H A;  1ETV A;  2XAF A;  2BY1 A;  2HNH A;  3HHG A;  3HPH A;  1V3F A;  1YS7 A;  5DM7 F;  1SMY F;  1DPU A;  5LEK A;  2OUM A;  3AG2 H;  3GTQ J;  2BYV E;  3J7Y J;  3PIO F;  2XF7 A;  2XGX A;  1MMG A;  4Y7N J;  3ZPL A;  4HNT A;  5TJJ A;  3M1C A;  1Z77 A;  4FET A;  1LE8 A;  4FT8 A;  2FEZ A;  2BBY A;  2Y69 H;  1SD7 A;  2DBB A;  2RDP A;  3CZ6 A;  1JI8 A;  2EV6 A;  2DQL A;  3IP4 B;  5LHG A;  1AU7 A;  1F5T A;  4RM3 A;  1Z7L A;  1IC8 A;  3I9V 2;  2ZXJ A;  3E0J B;  1IN5 A;  2L0K A;  2DMP A;  2QSH X;  2KL4 A;  2F4O B;  5ICF A;  3DTK A;  4II2 A;  3F8B A;  2X1D A;  3WTZ A;  1U8R A;  4YFN F;  4CYD A;  4K2E A;  1P4A A;  3K70 D;  1YJW I;  5DD8 A;  2VT2 A;  1VQK I;  4EM1 A;  4U0Y A;  3G6E I;  4HRI A;  3KEO A;  3WU1 B;  1W7P B;  1YX5 A;  3I54 A;  4E7L A;  2WWY A;  2IP2 A;  4KIF A;  3L2W A;  3F3X A;  3H9Q A;  4W97 A;  5JVT A;  5LD2 C;  4G6Q A;  3MZ8 A;  4EM2 A;  2JSC A;  2R7S A;  3M8F A;  5FKL A;  5LBQ A;  2MH9 A;  3IL2 A;  1VQO I;  1YRN A;  2BW3 A;  1QA6 A;  4BU2 A;  1MW7 A;  2EV0 A;  2QM3 A;  2Q2E A;  4IHS A;  4XQF A;  1MBF A;  1ZG3 A;  1FEX A;  4I76 A;  4DGW B;  4BJ6 C;  3GVA A;  5TGT A;  2PEX A;  4PK4 A;  1Z3Y A;  2IGO A;  1FIP A;  2XAU A;  3C3W A;  1XB4 A;  1UHW A;  1ORK A;  1R00 A;  4I6Z A;  1ZR2 A;  2R5Y A;  3W2A A;  3K1M A;  4FQG A;  2V6E A;  4XRF A;  1JJ6 C;  2CG4 A;  4PFP A;  1VND A;  2AS5 F;  5E18 F;  1A35 A;  2ZCW A;  3JCU C;  4Y13 A;  4UUS A;  3K69 A;  3H1C A;  4OAY A;  2DYS H;  1FMW A;  3HOZ J;  1LVK A;  3P9I A;  4YEJ A;  3K9T A;  3K2Z A;  3CCR I;  4OIO F;  2H27 A;  3S1N J;  2HPI A;  2O8X A;  3JRA A;  2FSW A;  1NK3 P;  1WZ2 A;  4L9N A;  1YG2 A;  3TO6 A;  5IP9 J;  3HL2 A;  3H3U A;  5GAD J;  2JMW A;  4RGR A;  2MLK A;  3M1E A;  4LG0 B;  1Z0X A;  2B7E A;  3EYY A;  3C2H A;  3ZQI A;  1GXQ A;  3JW4 A;  1POG A;  1GV2 A;  3FBI B;  2RC4 A;  2WV1 A;  2M45 A;  2A3S A;  2R3S A;  4CCK A;  1EH6 A;  1IRG A;  4KMF A;  4LD5 A;  1BIB A;  1JUP A;  3OL3 A;  2OCE A;  2LF7 A;  2X6X A;  2M30 A;  3MVP A;  1IF1 A;  2DCE A;  5D6F A;  2GA1 A;  3K4B A;  1J5Y A;  2JA5 J;  3F8C A;  2JA2 A;  3DEU A;  2A05 A;  3O2P E;  3EUH A;  5GAH J;  4ENJ A;  3HHH A;  4CSW A;  1ZAR A;  1F43 A;  2EFN A;  2ZJP F;  2Z9O A;  3V4G A;  3KP5 A;  1D5Y A;  5ERI A;  5AIP A;  3LSG A;  1R36 A;  4W1U A;  1F9N A;  2M34 A;  1Z67 A;  5DCF A;  2E7W A;  1OFC X;  3H92 A;  3KET A;  3CO6 C;  1W36 C;  1X1C A;  1MNE A;  3JR9 A;  1DPR A;  4HG2 A;  1U5T C;  4WCG A;  3KPH A;  4XKB A;  1D8K A;  1JGG A;  3E6D A;  3P7N A;  4NB5 A;  3MFK A;  4HPQ A;  3KZI C;  1OJL A;  2CRG A;  2CUJ A;  2FRH A;  1R22 A;  3BPX A;  2F5V A;  4MTE A;  1UEL B;  2OBP A;  1R49 A;  2IXS A;  4E7Z A;  3OYB A;  2XVC A;  1MMS A;  4I2O A;  3ASO H;  3F6V A;  3WTW C;  2KIF A;  4KMU X;  2ZBK A;  2WAQ N;  5GAE J;  3DU5 A;  3GFM A;  4XLE A;  5ED4 A;  2CQ7 A;  2KDO A;  3JSP A;  1AKH A;  2EFO A;  4EQQ A;  2E19 A;  1HDP A;  1LEB A;  1G3Y A;  3W6K B;  4BXF A;  4AU7 A;  5F1J A;  4CIC A;  4B1R A;  4B3A A;  4D5F A;  4BBR J;  2VI6 A;  4U7D A;  5M5X J;  2FBI A;  1RI7 A;  2G9W A;  2GXG A;  3BRO A;  3K1N A;  5LHI A;  3PQJ A;  4LMY A;  5FKM A;  3RPU D;  4XLA A;  4XLF A;  4HQM A;  1F4K A;  3VEP A;  4A0X A;  2EBI A;  1T0F A;  1M1E B;  3C2B A;  4HF2 A;  1W0T A;  5CPR B;  1TWA J;  3ECH A;  2NRA C;  2VIX A;  3ZMS A;  1ZQ3 P;  1RES A;  3HSE A;  3M9A A;  2KFD A;  4GYI A;  2K02 A;  3ERE D;  1R4M B;  4EJV A;  1RRJ A;  1D0X A;  3D5S C;  3ERM A;  1ZYR F;  4XR6 A;  3MZH A;  5J47 A;  5EG0 B;  4ZZD A;  5F6F A;  2DPD A;  2IBD A;  2ZNZ A;  3G73 A;  1FZP B;  2RV8 A;  4LIV A;  2R7R A;  3PUF A;  1PUE E;  3DWL E;  3LNQ A;  4Q48 A;  3FIW A;  1S7A A;  1N78 A;  4ETS A;  3ZGK A;  2MC4 A;  2H6B A;  4D5C A;  2IS4 A;  3H9G A;  3NAU A;  2CV2 A;  4QTR A;  1E17 A;  2HDW A;  3MEX A;  2VJ5 A;  1I6X A;  4BXX J;  4OOI A;  2VLA A;  2D5V A;  3L00 A;  1K6Y A;  1LE8 B;  1BOB A;  5IYD J;  3Q3S A;  3LST A;  4NC7 A;  3H5A A;  2M3A A;  3M07 A;  2GXB A;  3OSG A;  3GXO A;  1X3W B;  1FOX A;  3FXU A;  3DP7 A;  4BDZ A;  5H6R A;  4M9X A;  4A6D A;  1U2W A;  2ZNY A;  2C6Y A;  3OYC A;  3GFL A;  4RAG A;  1LFU P;  4A3B J;  4ZYG A;  5KCM A;  1Z21 A;  2IS6 A;  3CC7 I;  1APL C;  4NUB A;  2OV7 A;  1RIO H;  1ENH A;  2Y0S N;  2E1C A;  3A2K A;  2L2O A;  3REO A;  2DA3 A;  2K27 A;  4KIC A;  4BY7 J;  1YLF A;  3SHF A;  3WGH A;  2KP6 A;  3T8T A;  3WU0 A;  2L5Q A;  2OJE D;  1EF4 A;  3V7C A;  1FMV A;  5LFA A;  3PL8 A;  2G0E A;  2BGC A;  4XLP F;  3FMQ A;  2IA0 A;  3ZXS A;  4ZDP A;  5EF6 A;  3K2A A;  1YE9 A;  2V1U A;  1AKH B;  3NAR A;  1SEU A;  1BI0 A;  1OPC A;  1XS9 A;  2L02 A;  3S2H J;  2AQF A;  3H36 A;  3PIP F;  4RAY A;  1CQT A;  2QKL B;  1JHH A;  3T5X A;  4XBF A;  3KYC B;  4LLL A;  2IRF G;  4QSH A;  3IAM 2;  4JP0 A;  1Y6I A;  1IXC A;  2QUF A;  3LSK A;  1T08 B;  3QYF A;  3M8E A;  5IOZ A;  3R4K A;  4E7I A;  3CD6 I;  2HXI A;  3CJQ B;  3QOE A;  3L2R A;  3BZ6 A;  4RGS A;  2VXD A;  5LGN A;  4ESJ A;  3A0H C;  2HDC A;  1FBS A;  2X4H A;  5LLQ A;  1BJZ A;  2Q1Z B;  3FXQ A;  3P5J A;  5IYC J;  4IHX A;  1NHA A;  4ZDO A;  1ZG5 A;  4LGW A;  1FP1 D;  3I64 A;  4Y33 A;  1C0W A;  2A5Y B;  2V9V A;  1USS A;  3HZJ A;  3RYP A;  4MIM A;  3J81 Z;  5CVJ A;  1YJ9 I;  1Z05 A;  2H09 A;  1Y1W J;  4BQO A;  1XGM A;  2EJR A;  1BR4 A;  2IA1 A;  2PJR A;  2KMU A;  2HXO A;  1XSX A;  2L9N A;  1Q1V A;  1XGN A;  3ABM H;  3K4L A;  4CCJ A;  1SD4 A;  1G8X A;  4V19 K;  3BQY A;  2W4S A;  2CW7 A;  3M8J A;  5L3B A;  2P6S A;  2EIJ H;  5F08 A;  1D1A A;  3ZMU A;  2Y9Z A;  2L7K A;  1RC9 A;  4C9Y A;  3R6S A;  2ID3 A;  4IHV A;  4BEH A;  2LFB A;  2R7V A;  4J01 A;  3ASN H;  4M3F A;  2Y9Y A;  2LLK A;  3IWF A;  3N05 A;  4RB2 C;  3NQO A;  2YU3 A;  2RKH A;  4BHP A;  3GBG A;  4ZTJ A;  2H1L A;  2VQL A;  4XKC A;  1LFB A;  2RQP A;  1A36 A;  4G8X A;  1XGS A;  2P8T A;  4G6T B;  1FNN A;  2VJJ A;  4DYQ A;  5B5E C;  1TC3 C;  3KIO A;  2GAU A;  5E3L A;  4A3G J;  3PFY A;  5BPD A;  1UHS A;  3VPR A;  1IW7 F;  2CV1 A;  1ZRE A;  2XF5 A;  1OKR A;  3CF2 A;  2EIK H;  1HF0 A;  3OYE A;  3ML6 A;  1RNL A;  4IRG A;  4XLH A;  1REP C;  3CC2 I;  1QU3 A;  2FE3 A;  2MAB A;  4GDF A;  3GTG J;  3E97 A;  1H0M A;  3K1P A;  3BR6 A;  4CCM A;  3HOV J;  3GTM J;  2QF7 A;  2A6H F;  4B09 A;  5D6E A;  3TO7 A;  5BS6 A;  2ISY A;  2ID6 A;  2J5P A;  2H1K A;  2M9H A;  3GF2 A;  1WH7 A;  3TKY A;  5JR3 A;  1ZKG A;  1VZ0 A;  3ULQ B;  3HEF A;  5EZH A;  3IUO A;  3HKZ N;  1U0J A;  2BVM A;  1OCO H;  3O8G A;  4AWX B;  3Q5F A;  2BE5 F;  4O6J A;  4WWC A;  2HQR A;  5CKT A;  4A3L J;  2XPW A;  2RVC A;  4I99 C;  1IRZ A;  2QQB A;  3BLY A;  2ZJR F;  1A5J A;  3L2C A;  1NH3 A;  4XOT A;  2CW0 F;  3HGG A;  1V54 H;  3QOP A;  2M5W A;  4PSX A;  5JHU A;  1R5I D;  1ERD A;  5HS7 A;  5HVQ C;  1XG1 A;  2FNP A;  3KLO A;  2J5O A;  3KCC A;  1MBG A;  5HLI A;  2HYF A;  3E5Q A;  3IKV A;  5CVV A;  2W24 A;  3CUQ A;  1Z1D A;  2K7L A;  2Q8K A;  2R92 J;  3W2W A;  1SD6 A;  5BPI A;  3K4C A;  3DLA A;  5D5W B;  1I5Z A;  3ZN0 A;  1BR1 A;  3SFI A;  3TP3 A;  3LA2 A;  4II3 A;  4OIN F;  4GGG A;  1R1V A;  3CMM A;  1QNT A;  3H5R A;  1UAA A;  3AG4 H;  5TIS C;  4A0Z A;  4OWR B;  4UY8 I;  3OYF A;  5BOX A;  1FBQ A;  2WB1 N;  2BXZ A;  2M0C A;  5ICE A;  2E2I J;  5D5U B;  5E1X A;  3RJP A;  3S3N A;  3FF5 A;  3IRR A;  1EJ9 A;  3QOD A;  1V5E A;  1W1W E;  2DAO A;  1O7F A;  1E3O C;  2OAZ A;  3A01 A;  1FOW A;  1TNS A;  3KEY A;  4BQN A;  3HTS B;  5LRS A;  2ZXW H;  3MKL A;  2K4J A;  2BVL A;  5J1U A;  1MSF C;  5HLG A;  3GZ6 A;  2VBZ A;  1DU6 A;  2QQA A;  3CDI A;  2GQQ A;  3CLQ A;  4B43 A;  2CU7 A;  2LSO A;  1UCR A;  4FX0 A;  1UZC A;  2DA5 A;  4I7H A;  1S7E A;  2HFH A;  1W0U A;  4NNJ A;  1FWZ A;  2FJ1 A;  3BC8 A;  2YU9 J;  4JYK A;  2YPR A;  1BI3 A;  2R7U A;  5HDG A;  4S0H B;  1K83 J;  5LEJ A;  3DQV C;  2GLO A;  5L3C A;  2ADU A;  2LR8 A;  3BTC A;  1CGP A;  1FIA A;  2A6T A;  2M7A A;  1J9I A;  4EVI A;  1IAW A;  1IV6 A;  1IDY A;  1T39 A;  4XKV A;  3CP8 A;  2E1O A;  5KAF C;  1MZB A;  1AHD P;  1MND A;  2L9V A;  2Z3Y A;  2HTJ A;  3LFU A;  2WBM A;  2XPV A;  2KJC A;  3DBH B;  1XMX A;  3Q9V A;  3KFW X;  3VYS B;  3ZQF A;  4EV0 A;  1J75 A;  4C30 A;  1R6R A;  4Y15 A;  1BIA A;  2O5R A;  4OAZ A;  2QQ8 A;  1X3Z B;  3ESW B;  4RAF A;  5FGM A;  2O3F A;  4XMY A;  1VQ7 I;  1ZHF A;  2E5N A;  3BJ6 A;  3G4S I;  1JE8 A;  3W6V A;  2WAD A;  4KT5 C;  1PUF A;  4RB3 C;  1XX5 A;  2DLL A;  2CQX A;  2A5W A;  4FE7 A;  5HNH A;  1T6S A;  1BC8 C;  1G3T A;  3VYT B;  3HOS A;  1IN7 A;  2UWM A;  2LKP A;  4JX6 A;  1SVO A;  3I4N J;  3K10 A;  4C2M J;  5EJC A;  2DFI A;  1TL8 A;  2I5U A;  1LKX A;  4AYB A;  2LY2 A;  1MBH A;  4EGZ A;  1UJ8 A;  1ZR4 A;  3CC4 I;  4A93 J;  3MKW B;  2CQN A;  5H6Q A;  2L01 A;  1J09 A;  4A6E A;  1GVD A;  4ZTF A;  1KA8 A;  3BT9 A;  4NBQ A;  3MWM A;  1JKO C;  1WKM A;  2XSD C;  5GAG J;  3H0D A;  5TRD A;  1MSE C;  3S16 J;  1IUY A;  4GRI A;  1BBY A;  2E1M C;  2Y31 A;  4U0V A;  2LKX A;  3BG9 A;  1MH3 A;  2ECC A;  1DGR M;  1HST A;  2QVO A;  5C4X J;  3BY6 A;  3G2B A;  5J1R A;  3OSF A;  4WF2 A;  3CCM I;  3D5R C;  2BXY A;  4E7K A;  2P5K A;  4M6V A;  2NVT J;  2OC6 A;  4PGH A;  2PJR B;  2X6Y A;  6PAX A;  1FTT A;  4EJU A;  2EA2 A;  3QQA A;  2VBW A;  3BCA A;  3HKZ A;  4BJT A;  1WJ5 A;  1R9T J;  2EFP A;  4QPQ A;  2VPL A;  4PJ0 C;  2CS3 A;  4KFC A;  2NVQ J;  1TWH J;  1YIO A;  1Y8Q B;  2Z16 A;  4F92 B;  4LG3 A;  1RUN A;  4BUP A;  3CMA I;  2NYX A;  5IOY A;  3VSL A;  4RGX A;  4LLN A;  3PUB A;  2E35 A;  1TBX A;  1S9H A;  3L9F A;  1JT0 A;  1BN5 A;  1EA3 A;  2E7X A;  4IHT A;  2Z2S B;  5DV5 A;  3CUO A;  3RDI A;  4IHW A;  2LC2 A;  4AYB N;  4ZYE A;  1MD0 A;  2DU9 A;  2W25 A;  1XMA A;  2VJ4 A;  5JI6 A;  1H9G A;  3OYN A;  1FP2 A;  3N97 A;  3ZQQ A;  1BA5 A;  2HR3 A;  2QSG X;  2W57 A;  5C3E J;  3FZV A;  2DA6 A;  5E20 A;  1PP8 F;  3MCZ A;  5DTD A;  3FKI J;  2FUG 2;  2UV1 A;  2M2E A;  4HDV A;  1K7A A;  4O3M A;  1OLT A;  3LQQ A;  3EQL F;  2ZB9 A;  5EGO A;  3BR1 A;  3TW7 A;  3ZN1 A;  1TLH B;  5J3L A;  3S15 J;  2UUZ A;  1G3S A;  1PUF B;  3U9G A;  2DN0 A;  4RMN A;  1I27 A;  3BTL A;  2DOF A;  3CCL I;  3C7J A;  2NOG A;  3CO7 C;  2M8E A;  1K61 A;  3EYI A;  1R71 A;  3F9K A;  1GHC A;  1MIJ A;  4AVP A;  2XGD A;  3PO3 J;  1W7P A;  5DEQ A;  3RI4 A;  2FQ3 A;  4LLG F;  3L7W A;  5B1A H;  2UZK A;  1LQ1 A;  4MEX F;  2V6C A;  1PDN C;  1B6A A;  2DJN A;  5E3N A;  2CGP A;  1KQ0 A;  2VL8 A;  1ETY A;  5E3O A;  4UB8 C;  3ZQ7 A;  5JFR A;  1FYK A;  2EIN H;  1O3Q A;  3OWT A;  5D8L B;  1U5T B;  4MHG A;  3F23 A;  2QEN A;  1ZN2 A;  2L9S A;  3F21 A;  2W82 A;  5ILU A;  3LSR A;  4S05 A;  4N4N B;  3KLN A;  3ABT A;  2CO5 A;  4BL0 B;  4HQE A;  3DBR B;  1X1B A;  1X2M A;  2VE8 A;  2EWN A;  3QPL A;  3FMS A;  4YRV A;  3P9K A;  1HW2 A;  2DT5 A;  2W85 A;  4ZH4 F;  2W84 A;  5L3F A;  3DV8 A;  2ESN A;  2GBY A;  4RDU A;  1T2K A;  4B8X A;  2Z33 A;  3CP2 A;  2CSO A;  2DA4 A;  2M4G A;  1VQL I;  5A2Q Z;  4PGG A;  4N9H A;  3TOB A;  5EEA A;  2DFF A;  1SFK A;  4M71 A;  3SEZ A;  2GA2 A;  1OQY A;  4KIB A;  3BG5 A;  4MO7 A;  2JA6 J;  2EK5 A;  2XKP A;  3HUG B;  3HRS A;  1MJ9 A;  1MKM A;  1N75 A;  2MW8 A;  4L5J A;  3BG7 A;  3S32 A;  3TED A;  2K4B A;  4HEA 2;  3ZMD A;  1OYY A;  2LVS A;  4HX7 A;  2MGQ A;  2XGC A;  3I71 A;  3HOT A;  2P7V B;  5L3E A;  3JSO A;  3K4N A;  4BHB A;  4D1Q A;  2DK8 A;  4C2T A;  4GO1 A;  1S5L C;  1ZAO A;  4IPA A;  2PBI A;  2R5Z A;  4LIU A;  4A3E J;  4P9U A;  4CYC B;  4I0B A;  2QSF X;  1GDT A;  3PO2 J;  1YX3 A;  5FKK A; 
#chains in the Genus database with same CATH homology
 5GP9 A;  4BY7 J;  1RET A;  5HOD A;  4IHY A;  3B6C A;  2JA8 J;  3HOW J;  1IDZ A;  2LD5 A;  1EF4 A;  5BNG A;  2G0E A;  1TWC J;  3IH2 A;  2LTP A;  3PM1 A;  4X1E A;  1YRN B;  1TWG J;  5EF6 A;  1GV5 A;  3K2A A;  3ZQG A;  2HI3 A;  3NAR A;  4V2G A;  4DZP A;  1AKH B;  3S14 J;  3HOY J;  1XS9 A;  2MG4 A;  3S2H J;  1CQT A;  3F0C A;  3TW6 A;  2JWT A;  3WHC A;  2K40 A;  4QSH A;  1WGX A;  3WHB A;  4JP0 A;  5M5Y J;  1UG2 A;  2NS8 A;  1P7I A;  1IJW C;  1XC5 A;  5JLW A;  5IOZ A;  2H8R A;  2VUM J;  2DMT A;  1VI0 A;  2HXI A;  3FK6 A;  1BJZ A;  2N8G A;  3ZQC A;  5IYC J;  4IHX A;  5K7H A;  1ETX A;  4A3C J;  1HDD C;  3BG3 A;  1ETW A;  3D1N I;  2R93 J;  4M3G A;  1O4X A;  4MIM A;  4UUT A;  5K7F A;  1JUM A;  1U78 A;  5FKK A;  1ETK A;  1GT0 C;  1Y1W J;  1GUU A;  3DCF A;  2ME6 A;  2VKV A;  2HXO A;  5M3M J;  1X2N A;  1Q1V A;  5F0C A;  3BQZ A;  3BQY A;  5M5W J;  2M8G X;  2Y30 A;  1X58 A;  3JRF A;  5F08 A;  2JA7 J;  3HGY A;  4DW6 A;  2Y9Z A;  2XRL A;  1HCR A;  2JK3 A;  3A02 A;  4IHV A;  2ID3 A;  5FLM J;  2LFB A;  4M3F A;  2Y9Y A;  2LLK A;  1TWF J;  2EH3 A;  1BW5 A;  3GBG A;  3HOU J;  2EZK A;  2K9N A;  2R0Q C;  2E2J J;  1LFB A;  1WPK A;  5C4J J;  3MN2 A;  3S1Q J;  4G12 A;  3IH3 A;  4DYQ A;  3H3V K;  5F04 A;  1TC3 C;  2DA1 A;  1SFO J;  5E3L A;  2R7Z J;  3JRH A;  4A3G J;  1B8I B;  1UHS A;  3VPR A;  1MBK A;  1T33 A;  2LY9 A;  5F0H A;  1IG7 A;  5FKO A;  1HF0 A;  1B72 B;  4BBS J;  3L1P A;  4A3J J;  4V2F A;  1H8A C;  4HNV A;  2P81 A;  5EZG A;  3JRG A;  3GTG J;  5J1Y A;  3BR2 A;  4D7M A;  3BR6 A;  3HOV J;  3S17 J;  3GTM J;  2O7O A;  2QF7 A;  3G1M A;  1U9O A;  1QPI A;  3LSP A;  4XK4 A;  3G1L A;  4MLO A;  5EYR A;  2ID6 A;  2RAE A;  2H1K A;  3BTI A;  1JTX A;  3Q0U A;  2EZL A;  1RKT A;  2M9H A;  1ZTR A;  4XRS A;  5FJ8 J;  1WH7 A;  1F36 A;  1ZKG A;  2JJ7 A;  3HEF A;  5EZH A;  5EGO B;  1SAN A;  2COB A;  4A3I J;  1JKP C;  3GTK J;  3HKZ N;  3O8G A;  1MBE A;  4M3B A;  3JRI A;  4A3L J;  2XPW A;  1WH5 A;  3UKG A;  4IEJ A;  3JRC A;  1IRZ A;  3BR3 A;  2LK2 A;  4XRM A;  1A5J A;  3RQI A;  1JT6 A;  4XID A;  3HGG A;  4GFB A;  1IGN A;  1MH4 A;  1XG1 A;  3BR5 A;  3GTJ J;  3RZO J;  1MBG A;  1BL0 A;  1VF9 A;  2R92 J;  2PMZ N;  2NVX J;  4JX5 A;  5C44 J;  3ZQH A;  3SFI A;  3TP3 A;  4UUS B;  1QVU A;  1BW6 A;  1I3Q J;  2WB1 N;  2FD5 A;  2ELK A;  2NVY J;  2CQQ A;  2M0C A;  4Y52 J;  2E2I J;  2DMU A;  3M4O J;  2ME0 A;  2IEK A;  3HM5 A;  2QCO A;  3GTL J;  2FX0 A;  1E3O C;  1FTZ A;  3A01 A;  1WCM J;  2HYJ A;  2NS7 A;  3MKL A;  4MFD A;  2CUF A;  5J1U A;  1ETV A;  1MSF C;  1DU6 A;  3GTO J;  1JUS A;  3OIO A;  1ZGW A;  1NK2 P;  4EEF G;  2CU7 A;  4M3E A;  4ABZ A;  5F0F A;  3GTQ J;  2HOA A;  2DA5 A;  5JLX A;  4Y7N J;  3IV5 A;  1S7E A;  1W0U A;  1Z77 A;  1LE8 A;  2FJ1 A;  3B6A A;  2YU9 J;  3DEW A;  2X48 A;  2XB0 X;  4JYK A;  2I10 A;  2XGE A;  3A01 B;  4S0H B;  1K83 J;  1OCP A;  2KDZ A;  1JKQ C;  2GLO A;  2LR8 A;  3BTC A;  3O8H A;  1AU7 A;  1FIA A;  4DYR A;  1IC8 A;  3A03 A;  1IV6 A;  3S2D J;  1IDY A;  2FQ4 A;  2L0K A;  4BKX A;  2DMP A;  2E1O A;  2LP0 A;  4B4C A;  2DMN A;  1AHD P;  2R5Z B;  4A3M J;  2CUE A;  2XPV A;  1IUF A;  3HOX J;  1MNM C;  2L7M P;  3E7L A;  3ZQF A;  4XRS G;  1QRY A;  2EZH A;  3OOU A;  4JX4 A;  4W97 A;  2CJJ A;  5IP7 J;  5F27 A;  1MBJ A;  3HDD A;  1A6I A;  3W6V A;  1PUF A;  2CQX A;  4FE7 A;  5FKL A;  2YUS A;  1YRN A;  3CQZ J;  5K7Z A;  4A3F J;  4JX6 A;  1MBF A;  3FIS A;  1FEX A;  4I76 A;  3I4N J;  3FK7 A;  3SJM A;  4C2M J;  1G2H A;  1FIP A;  1U9N A;  1MBH A;  1ORK A;  4I6Z A;  1ZR2 A;  2R5Y A;  1ZR4 A;  1VFC A;  3QPS A;  4A93 J;  1JJ6 C;  2VPR A;  1VND A;  3Q0W A;  1ETQ A;  1HLV A;  1GVD A;  4UUS A;  1ITY A;  2YS9 A;  3BT9 A;  2AHQ A;  1RPW A;  2X6O A;  2DA7 A;  1ZK8 A;  1JKO C;  2TCT A;  2XSD C;  1MSE C;  2K9S A;  2E2H J;  3HOZ J;  3S16 J;  3S1N J;  5FKN A;  2Y31 A;  4NDL A;  2LKX A;  3JRA A;  5E3M A;  1NK3 P;  5IP9 J;  3BG9 A;  1MH3 A;  2ECC A;  2R5Y B;  2JMW A;  5C4X J;  1Z0X A;  2OPT A;  3ZQI A;  5J1R A;  3OSF A;  2O9L A;  4M6V A;  2NVT J;  2GM4 A;  1POG A;  9ANT A;  1GV2 A;  5GPA A;  5EDN A;  2WV1 A;  1H88 C;  3JRD A;  1FTT A;  1WI3 A;  3QQA A;  3K7A J;  3HB9 A;  1R9T J;  1JUP A;  3CDL A;  3HBL A;  3MVP A;  1RKW A;  2NVQ J;  2X9D A;  1TWH J;  2JA5 J;  3LSJ A;  2AO9 A;  5IOY A;  2XB5 A;  3JRB A;  1F43 A;  2DA2 A;  1JT0 A;  1QVT A;  2JN6 A;  5IPA A;  3BR0 A;  1D5Y A;  2HOT A;  3LSG A;  2DMQ A;  2B63 J;  4IHW A;  4FE4 A;  3BTJ A;  4W1U A;  4AYB N;  4FTH A;  5DS9 A;  2M34 A;  2L7F P;  4MFE A;  3S1R J;  1OFC X;  2Y2Z A;  3TP0 A;  3JR9 A;  1RR7 A;  2K9Q A;  1BA5 A;  3LOC A;  5GPC A;  5C3E J;  1JGG A;  2DA6 A;  5DTD A;  2HQ5 A;  3FKI J;  4A3K J;  4M3D A;  2M2E A;  1OJL A;  2CRG A;  2ZB9 A;  4A69 C;  5EGO A;  3BR1 A;  3TW7 A;  2TRT A;  2XPU A;  5J3L A;  3S15 J;  4XIC A;  1PUF B;  2DN0 A;  1OCT C;  3BTL A;  2NOG A;  1NTC A;  1K61 A;  4RBO A;  2WAQ N;  3M3Y J;  1AKH A;  2E19 A;  1HDP A;  1H89 C;  5FLV A;  3S1M J;  5F1J A;  4B1R A;  1JJ8 C;  2XGD A;  3PO3 J;  4B3A A;  1T56 A;  3ZOB A;  4D5F A;  1I6H J;  1U8B A;  1JTY A;  2VI6 A;  4BBR J;  2DTZ A;  5M3F J;  5M5X J;  3CCY A;  2DJN A;  5E3N A;  1UMQ A;  2O8K A;  3ZQL A;  1ETY A;  5E3O A;  5FKM A;  5EG0 A;  2L7Z A;  2L9R A;  2EBI A;  5IYB J;  3JRE A;  3C2B A;  4D7N A;  4QIW N;  3LSR A;  3I4M J;  1W0T A;  3CMY A;  1TWA J;  4AUX A;  2MSY A;  1ZQ3 P;  1RES A;  1X2M A;  4DYC A;  3QPL A;  2VKE A;  1DU0 A;  4LOC A;  4RDU A;  2GBY A;  5EG0 B;  1Y1V J;  2DA4 A;  2OF7 A;  2IBD A;  2HDD A;  4A3D J;  4BY1 J;  5IP6 A;  3LNQ A;  3FIW A;  5EEA A;  4D5C A;  3GTP J;  1B72 A;  3RKQ A;  3BG5 A;  1JKR C;  2HOS A;  3NAU A;  4MO7 A;  2JA6 J;  2EZI A;  4QTR A;  4AC0 A;  4CYC A;  3RZD J;  1P7J A;  4BXX J;  2MW8 A;  2D5V A;  2KT0 A;  3IH4 A;  1LE8 B;  4FIS A;  2IAI A;  5IYD J;  3Q3S A;  3TED A;  1FJL A;  2LVS A;  3H0G J;  3OSG A;  1HOM A;  4J19 A;  2MGQ A;  2XGC A;  3G1O A;  2W48 A;  1ETO A;  4DZJ A;  3SDG A;  4C3J J;  1B8I A;  4X6A J;  2ECB A;  4C3H J;  1LFU P;  4A3B J;  4FCY A;  3Q0V A;  2R5Z A;  1APL C;  4A3E J;  1ENH A;  4CYC B;  2Y0S N;  4C3I J;  1I50 J;  1GDT A;  4L5E A;  3PO2 J;  2DA3 A;  2EQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...