3LNQA

Structure of aristaless homeodomain in complex with dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein aristaless
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Gene regulation/dna
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3lnqA00
3S1MJ 2CUFA 5F0CA 5DTDA 4D5FA 2LP0A 2XB5A 4A3CJ 1A5JA 2NVYJ 3BTCA 2XSDC 3FISA 3K2AA 3LSRA 2EQRA 2ID3A 4M3FA 2XGEA 3HOVJ 1U9OA 1JT0A 3MN2A 3LSGA 2E2JJ 1QVUA 5FKNA 3JRAA 3JREA 1QPIA 2DA6A 2M0CA 2HDDA 1IDYA 1QRYA 5EZGA 3SDGA 4A3IJ 5K7FA 3IH2A 1WGXA 1MNMC 1JGGA 2MG4A 2LLKA 4JX6A 5J1UA 2K9NA 2NS7A 4C2MJ 1GV5A 4XRMA 1YRNA 2JK3A 1JJ6C 1K83J 1TWFJ 2CRGA 3JRCA 2JJ7A 2K40A 1W0UA 4G12A 2E19A 4RBOA 2YU9J 1ETVA 1ZKGA 3JRBA 2I10A 3GTQJ 2WAQN 3TEDA 2FX0A 5IP6A 2EH3A 4HNVA 3H0GJ 2EZKA 2QF7A 1B72A 3OIOA 3PM1A 4DZPA 4JX4A 1JTXA 2HOTA 2CJJA 2YUSA 4S0HB 3RZOJ 5F0FA 5FKKA 3I4MJ 1T33A 2LY9A 2VKEA 4AUXA 4C3HJ 4BBSJ 2R93J 5C4XJ 3BQYA 4DZJA 1TWCJ 3Q0WA 1ETQA 2DMNA 2LK2A 1WH7A 3CQZJ 1WH5A 1ZK8A 2ZB9A 3A01A 2PMZN 2QCOA 5EG0A 2CU7A 3NAUA 5FKLA 1XC5A 1P7JA 2L0KA 1ZGWA 1OCPA 3K7AJ 1MBGA 3BR0A 4XRSG 1SFOJ 1RESA 5IYCJ 3S16J 1FIAA 5HODA 3FK6A 4C3JJ 5F0HA 2VUMJ 3RKQA 3A03A 5K7ZA 3D1NI 1IV6A 4EEFG 4NDLA 2JWTA 4MFEA 2TRTA 2ECCA 1WCMJ 2XPVA 3S1RJ 1ENHA 1NK3P 2GM4A 2R5YB 5IYBJ 1A6IA 3SJMA 1MBHA 1PUFA 5IOZA 2NVXJ 1FEXA 1S7EA 5FJ8J 1DU6A 1T56A 2EZHA 5FLVA 2LKXA 1GDTA 1H89C 3E7LA 3FIWA 5IPAA 4FE7A 1F36A 4C3IJ 2IAIA 3Q3SA 3JRGA 2HI3A 2X9DA 1JKQC 3RQIA 4BKXA 2E2HJ 1U8BA 4M3DA 4IEJA 5GPAA 3BR3A 1NTCA 1U78A 3LSJA 2FD5A 2Y2ZA 3W6VA 4BY1J 1BA5A 3HOXJ 5EZHA 3BR5A 1FTTA 3G1LA 1H88C 2CQQA 4IHYA 3QPLA 5FKMA 1Y1WJ 1IC8A 4A3DJ 1RKWA 1UHSA 4UUSA 1AKHB 5F08A 4XICA 2DMQA 1ETOA 2L7ZA 2XB0X 3OOUA 2M8GX 1FJLA 4M3BA 4X6AJ 2M2EA 2R0QC 1SANA 3B6AA 3S17J 1IGNA 1MBEA 5EGOA 4CYCB 3JRIA 4A3JJ 4V2FA 5IP7J 9ANTA 1JKOC 1VFCA 2G0EA 4L5EA 2XPUA 3SFIA 2DA3A 4DYRA 1JT6A 3O8HA 1IRZA 4V2GA 3GTMJ 2R7ZJ 4W97A 5EDNA 1JUPA 5E3MA 5DS9A 1GT0C 2EZIA 4JX5A 5M5YJ 5J1RA 4J19A 5JLXA 1BW6A 2E2IJ 2IEKA 3BR2A 2D5VA 1O4XA 4BXXJ 2L7MP 1LE8A 1E3OC 2NVTJ 2NS8A 1Z0XA 2NVQJ 3TW6A 4BY7J 2WB1N 2DA7A 4I76A 3IH4A 1MBKA 3ZQGA 2R5ZA 4DYCA 2M34A 1VNDA 2IBDA 3HB9A 1B8IA 3HDDA 1YRNB 3BR6A 3JRFA 2DA1A 2HOSA 3BT9A 2O9LA 1I50J 1IUFA 2XGCA 1XS9A 4B1RA 3Q0UA 1HCRA 3HGYA 1BW5A 2FQ4A 1TWAJ 5IOYA 2DA4A 2EBIA 3HOWJ 5F1JA 2X48A 2DMUA 1TC3C 3L1PA 5J3LA 2H1KA 5EF6A 3HOUJ 3M3YJ 3C2BA 4FCYA 1JKRC 1OFCX 3OSFA 1IG7A 2X6OA 2JA7J 2MSYA 5C4JJ 3G1MA 2GLOA 3WHCA 4MIMA 4A93J 4X1EA 4A3LJ 2RAEA 4I6ZA 2E1OA 1FIPA 3CDLA 2ELKA 1B72B 2DN0A 2AO9A 4DW6A 3GTPJ 1P7IA 4LOCA 1IJWC 1LFBA 3GTOJ 1RKTA 3Q0VA 4FISA 1VF9A 3QPSA 4D7MA 4QIWN 4Y52J 3TP0A 1LFUP 2JMWA 3BG5A 3CMYA 1MSEC 2Y30A 2W48A 5JLWA 1JJ8C 3A01B 4D7NA 1D5YA 4FTHA 3IV5A 4A69C 5EG0B 3H3VK 1POGA 4QSHA 4W1UA 1JTYA 5E3LA 4B4CA 3JRDA 5M3FJ 1GVDA 3GTKJ 3F0CA 2JN6A 3A02A 4A3BJ 2JA6J 2Y31A 1RR7A 2DJNA 3HGGA 3BTIA 4M6VA 1OJLA 3DCFA 2GBYA 5C3EJ 3IH3A 3WHBA 5F27A 1AU7A 3JRHA 1BL0A 4RDUA 3ZQHA 2JA8J 4MLOA 5J1YA 3PO2J 1ZTRA 1K61A 2DMTA 1ETYA 2Y9ZA 4XIDA 1PUFB 2HQ5A 3CCYA 4XK4A 5C44J 1UG2A 4JP0A 4A3FJ 2WV1A 3GBGA 3ZOBA 3QQAA 3BQZA 3FK7A 4Y7NJ 3PO3J 4DYQA 3O8GA 1GUUA 2N8GA 5E3NA 5GP9A 4GFBA 2P81A 2ME0A 4A3EJ 1ETKA 2CUEA 3BTLA 1U9NA 1F43A 1X2NA 3S14J 3G1OA 1MBJA 3LNQA 2DMPA 1I3QJ 2VI6A 4QTRA 2DTZA 1NK2P 4D5CA 3FKIJ 2CQXA 1CQTA 2XPWA 4UUSB 1JUMA 1MH4A 5FKOA 1ZQ3P 4AYBN 3GTJJ 2HXOA 2O8KA 3M4OJ 1ITYA 1HDPA 3BTJA 1RPWA 1VI0A 2K9QA 4IHXA 1DU0A 2ID6A 3HBLA 5IP9J 5M5WJ 2ECBA 5EGOB 2EZLA 1RETA 2LTPA 1BJZA 1TWGJ 2O7OA 2H8RA 4IHVA 1GV2A 3GTGJ 3HOYJ 3TP3A 5FLMJ 3OSGA 1G2HA 2K9SA 1Q1VA 3BG9A 1EF4A 3GTLJ 4UUTA 4JYKA 1I6HJ 3RZDJ 3HEFA 3ZQIA 2VPRA 2KT0A 1X58A 2MGQA 1QVTA 5M5XJ 2COBA 1ZR2A 2R5YA 2MW8A 1X2MA 3HOZJ 3DEWA 1WI3A 1MBFA 2VKVA 5F04A 1HOMA 1MSFC 1ETXA 1JUSA 3B6CA 5EYRA 2Y9YA 3S2HJ 4A3KJ 3BR1A 4BBRJ 4B3AA 5EEAA 1OCTC 4M3EA 1JKPC 2AHQA 1LE8B 1MH3A 3VPRA 3JR9A 2XRLA 2LD5A 4MFDA 1APLC 2FJ1A 5IYDJ 1XG1A 2L7FP 2KDZA 1ETWA 2LFBA 3NARA 2Y0SN 3ZQCA 2TCTA 3BG3A 4AC0A 2HXIA 3LSPA 2R5ZB 1WPKA 3S1QJ 4M3GA 1B8IB 4IHWA 2DA5A 2DA2A 2LR8A 3S2DJ 5E3OA 3ZQFA 4ABZA 5K7HA 1AKHA 3I4NJ 4FE4A 1AHDP 5GPCA 4A3MJ 1TWHJ 1ORKA 3ZQLA 1HLVA 1H8AC 2JA5J 3S15J 2M9HA 4MO7A 1HF0A 3MKLA 4CYCA 5M3MJ 2ME6A 1R9TJ 2OF7A 3TW7A 2B63J 2R92J 4XRSA 4A3GJ 3UKGA 5BNGA 1ZR4A 3S1NJ 2YS9A 1FTZA 2XGDA 1Z77A 2HOAA 3MVPA 1W0TA 1HDDC 1Y1VJ 3LOCA 3HKZN 2NOGA 2OPTA 2L9RA 1IDZA 1UMQA 2HYJA 2LVSA 3HM5A
chains in the Genus database with same CATH superfamily
4RM2A 2LP0A 2XB5A 1DUXC 4ENKA 1TT0A 3BTCA 3KZIC 4M74A 1SVMA 2M7AA 3PNVA 4EATA 3RDIA 4XR6A 3OYMA 3LSRA 1A36A 2LSOA 2ID3A 2Q2EB 4RLFA 4NBQA 3FXMA 1WZ2A 2MC4A 3L7WA 3TO6A 2BHYA 2DA6A 2HDDA 3IKVA 1IXSB 3SDGA 1S5LC 5CYVA 3FXUA 4ZTJA 2V1NA 3MZHA 3C2HA 3CO6C 1J9IA 1F9NA 3ISPA 1SD6A 2BVLA 2MG4A 2VQGA 4JX6A 5J1UA 1RZ4A 2HEOA 4IO9F 1UG0A 1TQIA 2FBIA 2OD5A 2FE3A 1FMVA 5J6XA 1K78A 2HU9A 4KIFA 1F4KA 1QHHD 1JJ6C 1TWFJ 4TV7A 4L5IA 2JJ7A 1E3HA 1ZARA 1W7PA 1HKSA 3FX3A 4RBOA 3COAC 1FOKA 3D5RC 2YU9J 4GXOA 2HVRA 2WAQN 4KMFA 5KHDA 2CQ7A 3TEDA 2FX0A 3LSTA 3HC7A 4M72A 2A6EF 2EH3A 2P5VA 2RKHA 5FO5A 2AS5F 1B9MA 2GIVA 4BDZA 3PUFA 5JVGF 5CVIA 3VEPA 5HS7A 1H9GA 3EUKL 1Z1DA 3I54A 3PM1A 3VSLA 1ZREA 3I58A 1ZHFA 3GYHX 2JRMA 1XGOA 4I7HA 2LC2A 3PNTA 3F8FA 2QEXI 5LEJA 2YUSA 2STTA 5F0FA 4EJVA 4E7HA 2VKEA 4C3HJ 2R93J 5C4XJ 3BQYA 5KNLA 3Q0WA 4XOTA 4XQFA 1FOWA 2DMNA 2EILH 2LK2A 3DKWA 2CFOA 5HLTA 1VTNC 2IRFG 3M07A 2GXBA 3OYDA 2VC1A 1ZK8A 1G3TA 3RYPA 2PMZN 3HL2A 3QWLA 5ILUA 4DIQA 5EG0A 2RREA 1J0RA 3HTUA 3NAUA 5FKLA 5ERIA 1XC5A 1MGTA 2Z1DA 1ZG5A 3K4NA 3BR0A 2DFFA 1RESA 2WADA 2GA2A 4G7ZF 5IY5H 3WGIA 2A3SA 1OPCA 5BQTA 1VQPI 2J5OA 2VUMJ 1NHAA 3D1NI 3JSOA 1MD0A 2JWTA 3KZYA 1YG2A 5LLQA 1X4OA 2XPVA 5CQGA 4IHSA 1HW5A 1SFKA 4YIIA 2PEXA 1R1TA 3HRUA 2NNYA 2Q0OA 1ACIA 4NHJA 2UZKA 2R5YB 4BJ5C 1MBHA 2NVXJ 1FEXA 2OU2A 2AQEA 5FJ8J 1D5VA 3LSKA 3OL3A 3H35A 5DCFA 2M45A 3OR1C 1BR1A 1GDTA 5IPAA 1PDNC 5ICCA 4FE7A 1FLIA 3H5NA 2G9WA 3KFWX 4C3IJ 1LFPA 1I5ZA 1O7LA 4BKXA 1U0JA 3J7AY 1IN6A 4M3DA 3RJPA 1FY7A 2VT2A 3JSPA 2L9VA 3ZMDA 2MLGA 2E1NA 1LEAA 4HDVA 4RGSA 1L0OC 4CSWA 2GOMA 1FTTA 3OS2A 3PL8A 2KIQA 2CQQA 1H88C 1EJ9A 2LKSA 2RVCA 1RKWA 4LG0A 4UUSA 2HQRA 3WTWC 3V4GA 4L5JA 5DM6F 2FEZA 2L7ZA 4R79A 4KFCA 2XB0X 2HVSA 3LQRA 2M8GX 5LBQA 1R71A 3KP7A 1S7AA 4JOMA 3QOEA 3S17J 4HX7A 1IGNA 2VC0A 3V7SA 4EJUA 5EGOA 2DT6A 4V2FA 5IP7J 1AOYA 2WC2A 3TQNA 4GRIA 4L5EA 2IJLA 4RB0A 5LGTA 3SFIA 1EV7A 2A5WA 2CFXA 3SZGA 1V3FA 4OMYA 3OWTA 2HZTA 4W97A 3L09A 1G4DA 2OAZA 3K4KA 3L2VA 1OYIA 5ILVA 2R7DA 3GX4X 4JX5A 3U1KA 3FBIB 1YLFA 2HWVA 1BW6A 4KT6A 2V9KA 2GQQA 2D5VA 1G3YA 2KLOA 2CW7A 2L7MP 3OYEA 1E3OC 2NS8A 4J00A 3LL7A 3FKJA 5B1AH 2F5CA 5F1RA 2DA7A 4I76A 4B09A 1XX5A 1EA3A 3PQJA 3IH4A 5HLHA 1WSUA 2CW8A 3KP2A 3IKTA 3KYLA 2IS4A 4I01A 2O3FA 2VE9A 2XF6A 1B1BA 4NQWA 3V42A 4XN3A 3OYLA 1N77A 2HQNA 1FYKA 1YRNB 2DA1A 2HOSA 3BT9A 5CPRB 3SZPA 2VOOA 2X6YA 2IW5A 2EWNA 1BN5A 3HGYA 1BW5A 5IOYA 3GXOA 2X48A 1BI1A 1REPC 1BIAA 2W85A 3ONQA 3L1PA 4I0AA 5EF6A 1QO0D 2CMPA 4F92B 1MIJA 1OFCX 5DCMA 3OSFA 2JA7J 1ONVA 3RQ4A 2MSYA 5C4JJ 1R5GA 3ABKH 4A93J 3OV8A 1SMTA 5F64A 4JQFA 1Z6RA 1XSVA 5E1ZB 2K5CA 1MMSA 1OYYA 1ZELA 4XN0A 3GTPJ 1O3RA 4CUGA 1MJ9A 2K4BA 3WG9A 1JE8A 2JPBA 3HIFA 4GDFA 1R1VA 4HQEA 4ZJZA 3ZMUA 1IRFA 1QHGA 3EPZA 1UAAA 2BY0A 2VN2A 1RKTA 4ENMA 2DU9A 2RC4A 4KICA 4HNUA 3H1CA 3TP0A 1WHUA 4BEHA 1LFUP 2RQPA 1LDJA 2KP6A 2IS1A 1JJ8C 4NNJA 2O5RA 5DUIA 4FTHA 1D5YA 5E20A 3QYEA 4A2UA 2K7LA 3WU1B 1MJAA 2Z3YA 5E3LA 4E6KG 1NG7A 5M3FJ 4RAYA 1GXQA 2C6YA 2JN6A 4A3BJ 2BY1A 1PVEA 1GLNA 2V4JC 3RTRA 2HDCA 3HOTA 4HV5A 2ZXIA 3WHBA 5F27A 4RS8A 5D6FA 2XAFA 3C1DA 1LVAA 3DU6A 2RN7A 1OR7A 2EA4A 4YRVA 3K69A 1T0FC 4B48A 1D1CA 1PUFB 2HQ5A 3KYCB 2ACJA 2ISZA 4MEXF 4XK4A 2O6GE 4XKVA 1J75A 4JP0A 5J8FA 2WV1A 2FXAA 2A05A 1OCCH 3S93A 3E6CC 4HF2A 3R6SA 3FK7A 4O3MA 4PJMA 3F9KA 2R4GA 4ANJA 4OIQF 4CICA 4AIDA 2E60A 3DKYA 2F2EA 2XHKA 4RA2A 4FX4A 1R36A 2ADUA 2JTVA 4GGGA 4KMUX 2CUEA 3L2QA 3DQVC 1ZRCA 1X2NA 1F43A 2Z16A 4IRHA 1WFXA 2VJJA 3LNQA 1DDNA 2CV0A 4QTRA 2LNBA 3E97A 2W82A 4D5CA 3QRFF 3L2UA 2D1VA 2A6TA 2I5UA 4WX9A 3F8NA 4AYBN 3GTJJ 3F8CA 3EQLF 3BTJA 3FHNA 3CCUI 1CGPA 1DU0A 5IP9J 3LFKA 1IAWA 3CUQA 3QYFA 1TWGJ 2O7OA 1X3UA 2Z9OA 2F4OB 3DTKA 2YX4A 4Q48A 5AIQA 5FLMJ 3OSGA 2K9SA 3AL0C 2LRDA 1AWCA 4CCOA 1EF4A 1YX3A 2HQAA 4CZCA 3F22A 4UUTA 5E8GA 1I6HJ 2X1DA 3HEFA 1XPXA 4PCQA 2VPRA 3OIPA 5FGMA 2XROA 3IUOA 3KE2A 5L3EA 2UXNA 1QVTA 1J2XA 2COBA 2VJ4A 4A5MA 1ON1A 3I0TA 3W6KB 2ZJQF 2V9VA 1X2MA 4EJOA 2IA1A 2HPMA 4L9JA 1HOMA 1Z3YA 3ZP5A 1D3YA 5EYRA 4BE0A 4A3KJ 3HHHA 3M9AA 2FQ3A 3MWMA 4Y33A 2W25A 2AQFA 4M3EA 3ZGKA 2O03A 4GYGA 1B6AA 1MH3A 4K2EA 3VPRA 1JGSA 5GAGJ 5JI6A 1YJWI 5IYDJ 5HOOA 2L54A 2LFBA 2Y0SN 2TCTA 3G4SI 4LLGF 3E5UA 2FOWA 2HXIA 3IAS2 4AC0A 3LSPA 1O3QA 3EDPA 2G7UA 3LA3A 2QENA 1B8IB 1DP3A 3G6EI 2K3FA 1U5TA 2LR8A 2FF4A 3WG7H 1YFHA 1MNDA 3ABLH 3S2DJ 1R5ID 2OV7A 4IPAA 3I4NJ 2R7TA 5LRSA 4IVNA 3CTAA 4B3XA 1FP1D 1AHDP 3HKZA 4B47A 3VYTB 2GOXB 2F4IA 4MHGA 1H8AC 1ORKA 1ZAOA 3ZQLA 1QU3A 2M9HA 4FT8A 1O3TA 1HF0A 3DXJF 3K4LA 1R9TJ 5E8IA 1S8NA 1CF7B 2NXNB 4A0XA 1F5TA 3KP6A 1E2XA 3UKGA 5BNGA 1ZR4A 3S1NJ 2OCEA 1FTZA 1KONA 4Q47A 1HQCA 1K4TA 4HV6A 4KISA 3TOBA 2KRHA 3HKZN 3OYFA 5KK1A 2OPTA 1IRXA 2HYJA 3W6JB 2IGKA 5KVRA 1MNEA 2GAUA 1HSJA 3JW4A 4ESBA 3BPXA 3FISA 3K2AA 3WTVC 3BWGA 3MQ0A 4PUSA 2W4SA 2XGEA 4BQNA 3HOVJ 2PLYA 1BOAA 2E2JJ 3LSGA 4IJAA 4D9JA 2Y48A 3DBHB 3CCRI 3K1MA 4Z6YA 4PJNA 3IHUA 3H36A 1QRYA 4XLCA 3CMAI 1RIOH 5LGUA 1BOBA 2KPMA 1LPQA 1WGXA 4F3QA 3AKZA 1KU9A 2WAEA 2K9NA 3HJEA 1S72I 2NS7A 5B3SH 4I99C 2KISA 2ZNYA 2OUMA 3KLOA 4PZJA 2CRGA 3SYTA 4IHTA 2L5QA 2P8TA 5GADJ 2E19A 4LG3A 1W0UA 1VQKI 1BI0A 2W7NA 3OOPA 4OMZA 3JRBA 2EV5A 4PK4A 3Q9SA 3GTQJ 1QQIA 4KT5C 1NG6A 2DQLA 2BW3B 4XM3A 1T98A 4F91B 4YFNF 1EH6A 3FF5A 1A6QA 4KUMA 4N4OB 2VIXA 1FP2A 1UJ8A 3G71I 1B72A 1JXSA 1W1WE 3CESA 3VDXA 2EA2A 3H9JA 1Y39A 2PJRB 1QZYA 2WWYA 3LSHA 2CJJA 4OOIA 2JSCA 2Z33A 2HOTA 2Q1ZB 1WJCA 1J09A 3H0DA 2QBYA 2E7XA 1VQ4I 3GCMA 3P9IA 2K86A 4KN7X 3QPHA 1VQ8I 3GZ6A 4DZJA 1MDMA 1FOXA 4OAYA 3AG3H 1MKMA 2KRCA 2K9LA 4P55A 1WH7A 1FBSA 3CQZJ 3QODA 1XGMA 4DNCA 3IL2A 3PSFA 3IRQA 3HZJA 5GTHC 3A01A 3WTSC 2MD5A 3WTYC 5JFRA 4IOCF 3WTUC 3F3XA 1ZGJA 3P9CA 1P7JA 1YIOA 3L2CA 4IRIA 5CVVA 2KJBA 2PMHA 3GFLA 3S16J 1BR2A 3ZCOA 5D8LB 4C3JJ 2VBZA 4BQOA 4EEFG 4PFOA 2L4MA 3TBIA 2PG4A 1P6RA 2ECCA 2DDBA 4LIVA 2HR3A 2LF7A 3R4KA 4F55A 1LB2A 2GIZA 4HYEA 2CS3A 4HSRA 1ENHA 1NK3P 1EKEA 2OTLI 5IYBJ 2ETHA 1C0WA 2XUBA 3HXLA 1S7EA 3N4MA 3FHZA 3CJTB 1DU6A 2DTRA 2XIGA 2EZHA 3ML6A 2LKXA 5LGNA 1H89C 3E7LA 4ZYAA 2OA4A 4Q4ZF 1VQ9I 2DOAA 4ZZDA 3LMMA 5BS6A 4LD5A 5JVTA 3FM5A 2QZ8A 2JZYA 5HLIA 2KDOA 3HOSA 2CH0A 4LFUA 2WA0A 1OYWA 5GPAA 3BPVA 3BR3A 3TGNA 1NTCA 1PUEE 1R4MB 1XD7A 4XLHA 1U78A 4ASNA 3LSJA 2FD5A 2ICWG 3CF2A 5B1BH 4U0VA 2GXAA 4BY1J 1LDDA 1XMXA 2FU4A 3BCAA 3KP4A 3WU0A 3QPLA 1Y1WJ 4A3DJ 2QGUA 2EIMH 4Y17A 2F48A 3HSFA 3QAHA 2VOPA 2PBIA 1SFUA 1W5TA 2EFQA 3OOUA 1AA7A 1TL8A 1FJLA 4X6AJ 2L9SA 3B6AA 3EUHA 1T2KA 4BXFA 2LG4A 4CYCB 2TDXA 3RPUA 1T95A 4A3JJ 2V79A 2L3DA 2XAGA 9ANTA 1TW2A 2ELJA 3ERED 4A5NA 1VFCA 2G0EA 2L01A 2BGCA 2GWRA 1SAUA 1S3JA 2IGNA 2XPUA 4L9VA 4BQQA 1IXRC 4EM0B 2DA3A 4J01A 4DYRA 1I1SA 2GA1A 4HX8A 1JT6A 3H3UA 2LH9A 3FXRA 4BJTA 1K4SA 3X2QH 3S32A 3GTMJ 4D1QA 4V19K 4IQJA 3FWEA 5EDNA 4ON0A 1XDSA 1WRJA 5ICFA 5H2FC 4A12A 1H0MA 2ZMEB 1LVKA 3I59B 3CC2I 3VYSB 3GZNB 2EZIA 2BZTA 3ZMSA 4N9HA 2ELHA 5J1RA 1UELB 4LMYA 5JLXA 1D8JA 4I98B 1KQ0A 2M87A 1U2WA 1TTYA 1FYLA 2OJED 3K4BA 4WK8F 4BXXJ 3GZ5A 4E7SA 3CJRB 1X1DA 3O2PE 2OZ6A 3TW6A 4BY7J 4R8HA 4MTEA 4AVPA 4WWCA 1SEUA 1KYZA 3K1PA 1UHMA 1J59A 2R7WA 3ZQ7A 2VPLA 1WJFA 1MMGA 3DV8A 4PGHA 1P2FA 1WWXA 2R5ZA 3UR3C 1MZBA 1VNDA 2HOEA 2IBDA 2KQRA 3GFIA 3K4CA 5BMZA 3BR6A 3JRFA 4NC6A 4A6DA 3KEYA 1K6YA 2VQLA 3KEOA 4HPQA 2FRHA 2EBIA 5ICEA 3HOWJ 2A61A 4BS9A 4O6JA 4II2A 1RC9A 3HOUJ 3MMYB 1O57A 3C2BA 4FCYA 2IS2A 2O0YA 1SD5A 1T08B 2I8DA 1IF1A 2DPUA 3DF8A 3M1CA 4X1EA 2EV6A 5FLXZ 2E1OA 3CDLA 3SEQA 4I6ZA 4XNFA 1V55H 5DDGA 2F5EA 3F21A 4UV9A 3KYDB 2JQ7A 2AO9A 4B44A 4DW6A 3AL0B 2DXIA 4EGZA 2VE8A 3C18A 2FBHA 3I4PA 2V1DA 2BV6A 1IJWC 1LFBA 4OIRF 1EH7A 1XSXA 3BJAA 3GTOJ 2Z99A 1VF9A 4D7MA 4IL6C 1HKTA 2W48A 5JLWA 1LJ9A 4ZDLA 4XLPF 4UNOA 3BROA 3IV5A 3K70C 2F5FA 3MEXA 3ZPLA 3H3VK 2P7CB 1S7OA 2DFEA 1POGA 1S9HA 2KZVA 4XRFA 4QSHA 1P4XA 2K4JA 3JRDA 1GVDA 4MEYF 3S2WA 4ZYHA 1FX7A 3CLOA 4U7BA 2Q2EA 3A02A 4G94A 3ULQB 1RR7A 3P9KA 5GAEJ 5IT9K 2X1CA 4M6VA 3F6VA 1Z91A 4PJLA 5LHGA 4G8XA 5AONA 4ENJA 5C3EJ 2NOJB 3E1SA 3W2WA 3FXQA 3VWBA 3W2VA 3HRSA 4RDUA 1SVOA 3ZQHA 4P96A 3ZMVA 1I39A 3ZN1A 4MLOA 5J1YA 4CCJA 3AAFA 3PO2J 1ZTRA 4XBFA 3D5SC 4X0GA 3I55I 1ETYA 3SDBA 4GO1A 3T0YA 4XIDA 4DJAA 5TISC 4RB1A 4XL9A 5C44J 3M8EA 4XONA 1FZPB 2H27A 1Y8QB 1WJEA 4UV8A 3KIOA 2J5PA 3RIRA 4E7ZA 4HX4A 3GBGA 3DP7A 1P9QC 2XGXA 3QQAA 4Y7NJ 4KYWA 4MQVA 1PJRA 3O8GA 1GUUA 2FA5A 1LQ1A 1K7AA 3FXJA 2N8GA 1XDUA 5E3NA 3QPTA 4YIRX 3PIPF 2X0LA 2KJCA 1G6NA 2ME0A 3BJOA 4S05A 3BTLA 4Y15A 5EEHA 2HKXA 1LUJB 2FNPA 5J8CA 3J7AO 3O6BB 2CQXA 1CQTA 4EJTA 2CSOA 4FASD 4HOBA 3S3NA 1MH4A 1HC8A 2DODA 1JI8A 1HDPA 4ZYGA 3SHFA 1WJBA 4KA4A 3CZ6A 2K9QA 4IKFA 4XLNF 2DPDA 5D4SA 5M5WJ 2ECBA 3CDHA 3ZRGA 4BHCA 2LTPA 1BJZA 5HNFA 1OISA 4L0ZB 4E7JA 2B7EA 2W24A 3HOYJ 2X1EA 3E5XA 3BG9A 3I56I 4XSZF 1X1PA 2E5ZA 3C3WA 3GTLJ 4E7IA 5HDGA 5GTIC 1TW3A 1LDKB 2DO7A 2VODA 3K10A 6PAXA 1X58A 3TO9A 2ZNZA 5M5XJ 3TDUC 2QLZA 3OYAA 1ODDA 2R5YA 2MW8A 2XAJA 1I1GA 3CCVI 1IN8A 2M8EA 3EUAA 2Y0MA 3DBLB 5CJ9A 1UCRA 4L9NA 2JRTA 3A2KA 2KRFA 2QM3A 2ZXHA 1YE9A 4BBRJ 3CCSI 2ZKZA 4B3AA 5EEAA 1LEBA 3CCJI 1W5CC 1OKRA 5CVUA 3V7CA 2AHQA 1LE8B 2EFNA 3KP3A 3HRTA 1RRJA 3JR9A 4RM3A 2ZXWH 3ZQQA 3U9GA 1FPQA 3NARA 4BHBA 3E0JB 2MH9A 2O8XA 3FMSA 3U2RA 4S04A 1USTA 2M3AA 2A6HF 1WKMA 4HEA2 1R4NB 1Z7LA 4M3GA 4IHWA 2DA5A 5H20A 2M1BA 2FMYA 2XKPA 3BDDA 5H6RA 3IWFA 4C30A 3ZQFA 2UUZA 4BL0B 2HTJA 5DYMA 3GLXA 3AG4H 4AVZA 2L02A 1YX5A 1UHWA 1FBUA 5GPCA 3U1DA 1YS6A 3MKLA 3RYRA 1P92A 2UWMA 2CO5A 2ISYA 4UHTA 2V6CA 1RUNA 2R92J 2HPIA 3VFZA 4DBRA 3OYHA 2YS9A 3NWSA 2ZMEC 1Z77A 3ROUA 4XORA 2QSHX 1W0TA 1HDDC 1Y56A 5FRNA 2AXTC 1K6OA 1D1BA 2NOGA 4HAMA 2L9RA 4XMYA 4LLNA 4P9FA 2FOKA 3ZN0A 1OMIA 2ESHA 4DOZA 3PSIA 4CCNA 1I6XA 1OCOH 3GVAA 3FXLA 2DBBA 3J80Z 5E17F 2CUFA 5F0CA 1QBJA 3GWZA 2H6BA 4A3CJ 4E4HA 2L2OA 2BXZA 2NVYJ 4OINF 2H94A 1F1ZA 3HUGB 3SXYA 1RI7A 4U7DA 2EQRA 2XF5A 3VYRB 3F8BA 2OTJI 4KNYA 1QVUA 5FKNA 3JRAA 1QPIA 2VQCA 3F72A 1XMAA 1IDYA 2HGCA 5EZGA 5KAFC 4A3IJ 2RGVA 2VJIA 2CQKA 2KZGA 1FT9A 4YEJA 5JHUA 2F6CA 2JT1A 1O7FA 3JCUC 4RMNA 2ZXJA 4YELA 1IXCA 4C2MJ 1GV5A 3BJ6A 1YRNA 1IUYA 4Y3OA 3CLQA 2JK3A 3J81K 4AM3A 5DD4A 1SFXA 3ESWB 4II3A 4G6QA 2VONA 3IRRA 2W84A 3JRCA 2VBWA 2K40A 2VBXA 3NWTA 3R0JA 1QA6A 2I10A 3VOEA 3CJQB 1V5GA 2VASA 5DD8A 1T38A 5LHIA 3IAM2 4CA0A 4ZDOA 1YIJI 4LLLA 3OIOA 2IGMA 5LD2C 1JTXA 3J7ZI 2K9MA 2VLAA 2PMUA 3I4MJ 5B5EC 1T33A 5L3FA 1YW9A 3QP6A 5DUKA 1FBQA 1ETQA 3RKWA 4G9YA 4AWXB 3K9TA 2LBFB 5FFZA 1GXPA 2ZB9A 3LQQA 2H09A 2V9PA 2ESNA 2L0KA 1OCPA 1ZGWA 1MBGA 4XRSG 1SFOJ 3MKWB 4F93B 5CLSA 5D5WB 2PX9A 2IXSA 2DAOA 4CO8A 2DFIA 4BUPA 5F0HA 4EGYA 3QU3A 5K7ZA 1U8RA 2EINH 2TRTA 2R7QA 2V1XA 2M4KA 4UVBA 2JVGA 2XSJC 3OYBA 3S1RJ 4U0YA 1V5EA 3OS0A 2IT0A 1FWZA 2GM4A 3W2AA 3GMEA 3G73A 3IP4B 1PUFA 5IOZA 5F6FA 4DQ2A 3MD2A 2E1MC 3RKYA 3BOQA 1R23A 4M9SA 4HLYA 5FLVA 3BP8A 1D0ZA 3EYYA 4H4KC 1FSEA 5DEQA 5FD5A 3BLYA 2YSRA 3CUOA 3LAJA 1A31A 3JRGA 1BJAA 2HI3A 2X9DA 2MA3A 3RQIA 2E2HJ 1TQMA 1T6SA 4RGRA 1XSDA 3K70D 4N0BA 3RI4A 3K6GA 4LITA 1N78A 2Y2ZA 1KQ8A 1BA5A 3U21A 3HOXJ 5FB2A 3BR5A 2HNHA 4MNUA 3GF2A 2IGOA 3SZTA 2E7WA 3G1LA 5TJJA 5FKMA 1UHSA 4ETSA 2ZCWA 1BBYA 1KU7A 5F08A 1AKHB 1Y0UA 4XICA 2DMQA 2BBYA 4CDGA 2KL4A 4AIJA 2RQQA 4CCKA 3ZXSA 2M2EA 2MFZA 2R0QC 1SANA 5JHFA 1STZA 3HPHA 4ZYEA 4KITB 1HBXG 4HQMA 3MCZA 1JKOC 1W36C 1XB4A 3EYIA 4L18B 1YO5C 2HYFA 2W00A 4OU0A 3O8HA 2R7OA 2DFHA 4V2GA 2R7ZJ 2WB1A 1JUPA 2Y69H 3HYIA 1FC3A 5E3MA 1GT0C 2DK5A 4EM2A 4N9IA 3WTTC 1XMKA 4Q5SF 3Q9VA 2IEKA 2X6XA 3BR2A 3CUQC 5FROA 2MBFA 4AU7A 2R7XA 2VXZA 3WTXC 2XV4S 4UB8C 1ZYRF 2PQ8A 3F6OA 2NVTJ 1S29A 1TP4A 3F23A 2QYOA 2WB1N 3LSIA 4BACA 1KGSA 3DPTA 1YW8A 1KYWA 1ZH5A 3UNGC 4ZH4F 1MBKA 1ULYA 3TDZC 3WTZA 1DGWY 3ELKA 4DYCA 2M34A 1IV8A 3M7GA 1B8IA 3HDDA 4U0WA 2O9LA 1K78B 1I50J 1IUFA 1SFEA 4A0ZA 2XGCA 5HDNA 2R7VA 3Q0UA 2HYGD 2LOOA 3MZ8A 2DT5A 2FQ4A 1TWAJ 2DA4A 4BJ6C 3I9V2 1W7PB 5F1JA 2DMUA 1TC3C 3KETA 4M71A 4EMSA 5BPDA 4PDKA 3M3YJ 1QZEA 4IF4A 1JKRC 2LY2A 3P5JA 2JA2A 2QQ8A 2X6OA 3DBRB 3G1MA 1X1CA 2GLOA 1YQAA 2LMDA 4A3LJ 3C7JA 2BY3A 1CF7A 2ELKA 1MMAA 2DN0A 5EJCA 3H3ZA 2RV8A 3PIOF 4HZFA 5J47A 2P5KA 2R7UA 1P7IA 2P5LC 2LREA 3R60A 4QIWN 2VL8A 3QPSA 2L9NA 3H9QA 4Y52J 2CUZA 3BG5A 4UY8I 1MSEC 1BR4A 3CO7C 3KX2A 4ESJA 2XAQA 2Y30A 3BG6A 3K4MA 5LHHA 4D7NA 5A2QK 3HHGA 3SEZA 5EG0B 3ECOA 2D2WA 2M5WA 1X1BA 4O5VA 5D5VB 2YR2A 2EPFA 4W1UA 4AIHA 3TMOA 2EFOA 1LKXA 3M8JA 3F0CA 4XKBA 2JA6J 2ZJRF 1ON2A 2DJNA 1X4PA 1OJLA 2GBYA 3FMQA 4BHPA 3OYNA 1E3PA 2F5DA 4HDUA 3IH3A 1R7JA 1AU7A 4A0YA 4CGZA 3BG7A 4I02A 1BL0A 3F8MA 2LDUA 2JA8J 2BE5F 4XLEA 4IQ4A 3KLNA 1PYVA 4P1WA 3CC4I 2E34A 3L9FA 2STWA 3RKXA 3T8RA 5D5UB 4AD9A 3I64A 2ZJ2A 1HA8A 2K85A 1RUOA 1UG2A 2W1OA 2QWWA 4G6TB 1MMNA 1DPRA 1XGSA 4BQAA 2XDVA 3CD6I 4B43A 3BZ6A 3MKZA 2WBMA 3HSRA 2D1HA 1GVJA 4ZDPA 4ZYDA 2BW3A 3KCCA 2EIJH 2DQRA 5FFXA 3PO3J 2XVCA 2COMA 2L7KA 2VBYA 4HA8A 2A5YB 5LFAA 4H0EA 1NH3A 2DCEA 2OZUA 3ERMA 1DP7P 2P81A 3H5AA 5KAIC 1M1EB 3N97A 3M8FA 1ETKA 2PN6A 5TRDA 3HPGA 2HS5A 3CF5F 3VYUB 2PJRA 1U9NA 3JAMK 4M73A 3S14J 1I3QJ 2WAQA 3WGGA 4LB5A 4PSXA 2E36A 2XPWA 4RAZA 1JUMA 4DGWB 4M9ZA 4UUSB 5FKOA 4LG0B 3VODA 1VZ0A 2HXOA 4OIPF 3M4OJ 3MZYA 1RPWA 1VI0A 4BXUA 2PJPA 3FXOA 2ID6A 3WE2A 1YI2I 3HBLA 3M1EA 3REOA 5EGOB 2EZLA 1RETA 2H8RA 2CWEA 4IHVA 3GTGJ 5ILSA 3S3MA 4XOPA 3TP3A 3OL4A 3A0BC 3IWZA 3I3LA 1ERDA 2X4HA 2PMZA 3FBNB 3GEZA 1HW2A 4JYKA 1Z7UA 3ZQIA 1VQOI 1G3SA 2K3PA 2KT0A 1HSTA 2MGQA 1XN7A 2OBPA 3MAJA 2LYCA 3OYIA 1R5HA 1ZRDA 1KA8A 4CHUA 3HOZJ 3DEWA 1WI3A 1MBFA 2VKVA 3CP2A 1D0YA 1MSFC 4M9XA 1YJNI 3S2HJ 1SD7A 2Y9YA 3DPLC 1R22A 3N05A 2RDPA 4ZZLA 2E1CA 4XLAA 5IT3A 2A69F 3ABTA 1E0EA 1JKPC 4RAFA 5ED4A 4F7ZA 2DLLA 1P4AA 4HF1A 1ZLJA 1QNTA 2XKOA 2ZFUA 4MFDA 3OYGA 2FJ1A 3V8LA 1IN7A 1Y0NA 2L7FP 2KDZA 2EV0A 3R61A 3S3OA 4CYDA 3CP8A 5IT9Z 1PP8F 1BI3A 4R1HA 2CV1A 1V5FA 3S1QJ 4NQWB 4HBLA 3DLAA 3NRVA 2DT7B 2P4WA 3OYKA 1MJBA 1WVRA 1IRGA 4XKCA 2D45A 4I09A 2K27A 3H9GA 3DEEA 2L4AA 1J5YA 1EH8A 1TWHJ 4D0PA 1HLVA 2JA5J 5DCMB 2HZDA 3E5QA 2XASA 4CYCA 5M3MJ 2P6TA 2ME6A 2B63J 5FLXK 1BI2A 3LA2A 4XRSA 3DLLF 1XCBA 4A3GJ 1IO2A 2VKHA 1WJAA 5BPIA 1KU2A 2XGDA 2E35A 2HOAA 3E3VA 1XGNA 3LOCA 4P5OA 2RNJA 1R6RA 5E1WA 3HSEA 4RB3C 5TGTA 2LVSA 3MKYB 4BEHB 2M4GA 2ZMEA 3I59A 4NUBA 3HM5A 5HVQC 1U3EM 1T0FA 3PJRA 3T8TA 3S1MJ 5DTDA 4D5FA 4A6EA 3EUHC 5B66C 1A5JA 3LA7A 2XSDC 1P4WA 1VQ5I 4FETA 1X3WB 2E1MB 3AFHA 2YPRA 1RR8C 4M3FA 3FM3A 4U87A 1U9OA 2IVMA 2ZBKA 3EETA 1JT0A 3MN2A 2XAHA 4GCVA 3JREA 3OMYA 2M0CA 4NC7A 1TZLA 3A4CA 4BE2A 5K7FA 2M7BA 3IH2A 2OQGA 5J4VA 1MNMC 1SMYF 1U6GA 1JGGA 2CV2A 2LLKA 2KKOA 3GUDA 3GLLA 4BDYA 1SVLA 3BCBA 4XRMA 2DYRH 4HSTA 3K0LA 2LF8A 4E7LA 1W36D 2V6EA 2EFWA 1ZRFA 1K83J 1SD4A 2QKLB 1D8KA 1FMWA 2QKMB 4G12A 3DFGA 1ETVA 1ZKGA 1KU3A 1BC7C 3FZVA 3K1NA 5J40A 3B73A 3KPHA 2XC7A 5IP6A 1O3SA 1HW1A 3PFIA 4HNVA 1BC8C 3H0GJ 2A07F 4LIUA 1XTAA 2EZKA 2ZJPF 2DJIA 2QF7A 4NB5A 2IP2A 1H9TA 3ZR8X 4DZPA 2YU3A 4JX4A 4YG2F 4UVCA 3RZOJ 1J7KA 4S0HB 2QUFA 5D4RA 1MMDA 1WJDA 2QQ9A 5FKKA 2ZC2A 2LY9A 2CG4A 4AUXA 5L3GA 4BBSJ 1FOYA 5LRRA 1TWCJ 2WY8Q 1FSHA 5HS8A 2Z2SB 2R7RA 5L3CA 2W57A 4HLXA 3K2ZA 1B59A 1WH5A 1DPUA 1Q1HA 1ZN2A 2KIMA 2QCOA 2R7SA 4YFKF 1Y8RB 5E79C 3LAPA 2CU7A 5FRMA 4PSWA 2ZO4A 3CUQB 4WCGA 3K7AJ 2OQRA 5IYCJ 1FIAA 2NAZA 5HODA 3FK6A 1JHHA 4C2UA 4UXNA 3CDIA 2RNGA 2G7HA 2DW4A 3RKQA 3A03A 3V8KA 5CVJA 1IV6A 4NDLA 3H5RA 2EIKH 1VQNI 4MFEA 2BHZA 2BVMA 4WXDA 1WCMJ 2E5NA 3HG9A 2FUG2 1QPMA 3RSNA 1BM9A 2R3SA 4LGWA 3TO7A 4N4NB 3Q5FA 2X6WA 5L3DA 1A6IA 1QZZA 3SJMA 2JSPA 3CCMI 1Z05A 1S6LA 2Z5UA 2BXYA 2P6SA 4IOAF 1K79A 1T56A 4QLCU 1VQLI 4KJZA 2VKDA 2HVQA 2FBKA 3FIWA 1XCVA 3E6DA 1Z9CA 1F36A 2XF7A 3ZMZA 1TT5B 2IAIA 2HTSA 2VJ5A 3Q3SA 2V7FA 1JKQC 2BY2A 1U8BA 4L0YB 1PP7U 1R58A 3ABMH 4IEJA 2P0WA 1TNSA 4CXFA 3K4JA 4EV0A 1G8XA 1W5SA 3W6VA 1I3AA 1E17A 5EZHA 1HXDA 2NRAC 4XSXF 1U5TB 3DU5A 3CC7I 2B0LA 4IHYA 5L3BA 2EB7A 3ZMTA 1IC8A 1VQMI 1D0XA 1KQ9A 2HFHA 2KHMA 4EVIA 1ETOA 1YITI 5K5RA 2QQBA 3J81Z 5CKTA 4CCMA 4M3BA 2DOEA 3LSMA 3VB2A 1MBEA 3JRIA 3CCLI 3KEQA 1UFMA 4RGXA 3I5UA 3A0HC 2B9SA 4UB6C 4AYBA 1A04A 1FYMA 1G59A 4C9YA 4Y4RA 3OR2C 4L9TA 2V26A 1IRZA 3P7NA 3QU6A 2WAFA 4ESFA 1DQUA 1Z21A 2EK5A 3PNYA 3JTGA 5DS9A 3CMEI 3J80K 1HKQA 2WV0A 4BAYA 5M5YJ 2JPCA 4J19A 4BE1A 2E2IJ 4WXCA 4PFPA 5FD6A 4GYIA 2CGPA 2CYYA 2MH2A 1ZG1A 4BYYA 1X1AA 1O4XA 1YHQI 4U88A 2ZSHB 3BZCA 4E7KA 2LKPA 4RGUA 1LE8A 5GAHJ 1Z0XA 3CCEI 2NVQJ 4EM1A 1Z67A 3ASNH 2XRNA 2NVUB 3OYJA 4BU2A 3TL4X 2IA2A 2VB6A 3KP5A 4WXHA 3ZQGA 2YX7A 4ZC3A 2DYSH 2FSWA 2XAUA 3HB9A 2E71A 1T39A 2QQAA 2IPQX 1XS9A 4B1RA 1OCRH 5K1YA 1HCRA 1VQ7I 1UZCA 1YTYA 1Z3XA 2K02A 2NS0A 3O3KA 2UXXA 1G3WA 5J3LA 2H1KA 4BH9A 2Y0SA 5H6QA 4OIOF 5K5QA 3T5XA 1IG7A 2MLKA 5HS9A 4LK0F 3SQNA 3WHCA 4AIKA 4MIMA 2CUJA 3I71A 2RAEA 4ITVA 4KIGA 4BGDA 4RLQA 2DI3A 2X85A 1TBXA 1FIPA 1Y6IA 1LNWA 3BC8A 1B72B 4OAZA 3PQKA 3B02A 1IW7F 3DTEA 4KIBA 2F4MB 2QBYB 1VQ6I 2EFPA 3GFMA 2MC3A 2M0MA 3DWLE 4LOCA 3L2RA 1MDMB 3Q0VA 1Z6TA 3E6MA 4FISA 5D6EA 1DGRM 3A1YA 4MQ9F 2BOLA 2JMWA 2R7FA 5K5OA 3CMYA 2PFBA 3ASOH 4LB6B 1X3ZB 3A01B 1QGPA 1IZ1A 2GZWA 3MFKA 2H8WA 4A69C 2ZSIB 3HUGA 3AG1H 4M6YA 3JTHA 4UVAA 1JTYA 4B4CA 3GTKJ 4EQQA 3T1BA 2Y31A 1OCZH 2VXDA 3HGGA 3QP5A 1OR7C 1MW7A 3BTIA 1BIBA 3DCFA 3ECHA 1OLTA 2M30A 4LJZF 4NC8A 3WU2C 3JRHA 5J4YA 1GHCA 3KZZA 3PUBA 4ZTFA 4RB2C 1B4AA 1K61A 4FHTA 5ICGA 2DMTA 2GXGA 4IX7A 5DM7F 2Y9ZA 2H6CA 3CCYA 4HNTA 3G2BA 5AIPA 2MD0A 2VT3A 2ZFWA 3S8PA 1T8IA 1V54H 2HDWA 4A3FJ 3NQOA 3IC7A 3C2GA 1ZG3A 4P9UA 3CCQI 3L00A 2P7VB 2JUCA 3ZOBA 5HLGA 3BQZA 4IRGA 5E1XA 1D1AA 4G6DA 4DYQA 2OC6A 4Y13A 5KCMA 4IZZA 2QA4I 4BNCA 3WODF 1R49A 5GP9A 4IXAA 2PI0A 2DOFA 4GFBA 4A3EJ 3RPUD 4XLFA 5D8KB 3RPQA 1TNTA 3VSKA 3G1OA 1MBJA 1I27A 2DMPA 4I2OA 2OCCH 2VI6A 2BYVE 1YOVB 2DTZA 4OWRB 1NK2P 2MABA 2QSGX 3WE3A 1RNLA 2KIUA 3FKIJ 3HRMA 3NEUA 4HRIA 2A68F 4LK1F 1KZHA 4UUVA 1ZQ3P 2BEOA 4CZZA 2LBFA 2O8KA 1ITYA 2QSFX 4JK1X 3TKYA 1IN5A 2NNNA 4IHXA 3PFYA 1W7PD 2JVHA 1TLHB 2VQHA 4DBQA 1YS7A 4G7HF 3GW2A 4KDPA 3OYCA 4FQGA 1GV2A 3HTSB 2WY7Q 4HW0A 1G2HA 2CQNA 3V8JA 1WI9A 4HF0A 1Q1VA 3I53A 2NYXA 1V4RA 2KIFA 2HKOA 1YYVA 2FNAA 1R00A 3RZDJ 1SAXA 3LFUA 3BZKA 4QPQA 3TOAA 1JHFA 2IA0A 2LY1A 3CMMA 4MGRA 5CVRA 1OQYA 1ZR2A 4PJJA 5BOXA 3J7YJ 3QYBA 3QOPA 5F04A 3H92A 3E6BA 1ETXA 1JUSA 3B6CA 4XKWA 3BR1A 4YFXF 2KMUA 1A35A 1OCTC 4G7OF 3DTIA 2CW0F 3GO5A 5DV5A 1FNNA 2DK8A 2V1UA 5A2QZ 4Z2YA 3GFJA 5CQEA 3DEUA 1UB9A 4CCLA 3LWFA 4CH7A 2JUGA 3DPUA 2XRLA 2AXLA 2LD5A 1WQ2A 1APLC 4B8XA 4EJWA 1U5TC 1XG1A 1ETWA 3ABUA 4PJ0C 1YW7A 3ZQCA 5EEGA 2Q8KA 3SFZA 1W4MA 5LEKA 3BG3A 4QPOA 3FMRA 3R0AA 2F5VA 1X19A 2WTEA 1WPKA 1USSA 1ZGAA 4WF2A 2R5ZB 2DA2A 1ZLKA 2Y75A 1WJ5A 2MYSA 4E70A 5E3OA 4ABZA 2H1LA 4HG2A 3G3ZA 3OIQA 5K7HA 1AKHA 4FE4A 4RAGA 3AG2H 3WGHA 5HNHA 4FX0A 3D0SA 4I0BA 5D5XB 3OY9A 4C2TA 4A3MJ 3S15J 3FXKA 1TQPA 2KFDA 2X51A 3BY6A 4KN4X 4MO7A 1N75A 2QVOA 3V7RA 2OF7A 4QWQA 3TW7A 5JR3A 4ENNA 3RCOA 3CJNA 1SC7A 1YJ9I 2DDAA 4MTDA 2IS6A 1R1UA 3W3CA 3L2WA 1IN4A 3FDYA 3MVPA 3D5LA 2EJRA 4YIFA 1Y1VJ 1B9NA 4F52A 4PGGA 5HDKA 4M6XA 1N25A 1IDZA 1UMQA 2FMLA 1L3LA 2O61A 2UV1A 3DKXA 5E18F 3JAMZ 3OS1A 4JBAA
chains in the Genus database with same CATH topology
3S1MJ 2CUFA 5F0CA 5DTDA 4D5FA 2LP0A 2XB5A 4A3CJ 1A5JA 2NVYJ 3BTCA 2XSDC 3FISA 3K2AA 3LSRA 2EQRA 2ID3A 4M3FA 2XGEA 3HOVJ 1U9OA 1JT0A 3MN2A 3LSGA 2E2JJ 1QVUA 5FKNA 3JRAA 3JREA 1QPIA 2DA6A 2M0CA 2HDDA 1IDYA 1QRYA 5EZGA 3SDGA 4A3IJ 5K7FA 3IH2A 1WGXA 1MNMC 1JGGA 2MG4A 2LLKA 4JX6A 5J1UA 2K9NA 2NS7A 4C2MJ 1GV5A 4XRMA 1YRNA 2JK3A 1JJ6C 1K83J 1TWFJ 2CRGA 3JRCA 2JJ7A 2K40A 1W0UA 4G12A 2E19A 4RBOA 2YU9J 1ETVA 1ZKGA 3JRBA 2I10A 3GTQJ 2WAQN 3TEDA 2FX0A 5IP6A 2EH3A 4HNVA 3H0GJ 2EZKA 2QF7A 1B72A 3OIOA 3PM1A 4DZPA 4JX4A 1JTXA 2HOTA 2CJJA 2YUSA 4S0HB 3RZOJ 5F0FA 5FKKA 3I4MJ 1T33A 2LY9A 2VKEA 4AUXA 4C3HJ 4BBSJ 2R93J 5C4XJ 3BQYA 4DZJA 1TWCJ 3Q0WA 1ETQA 2DMNA 2LK2A 1WH7A 3CQZJ 1WH5A 1ZK8A 2ZB9A 3A01A 2PMZN 2QCOA 5EG0A 2CU7A 3NAUA 5FKLA 1XC5A 1P7JA 2L0KA 1ZGWA 1OCPA 3K7AJ 1MBGA 3BR0A 4XRSG 1SFOJ 1RESA 5IYCJ 3S16J 1FIAA 5HODA 3FK6A 4C3JJ 5F0HA 2VUMJ 3RKQA 3A03A 5K7ZA 3D1NI 1IV6A 4EEFG 4NDLA 2JWTA 4MFEA 2TRTA 2ECCA 1WCMJ 2XPVA 3S1RJ 1ENHA 1NK3P 2GM4A 2R5YB 5IYBJ 1A6IA 3SJMA 1MBHA 1PUFA 5IOZA 2NVXJ 1FEXA 1S7EA 5FJ8J 1DU6A 1T56A 2EZHA 5FLVA 2LKXA 1GDTA 1H89C 3E7LA 3FIWA 5IPAA 4FE7A 1F36A 4C3IJ 2IAIA 3Q3SA 3JRGA 2HI3A 2X9DA 1JKQC 3RQIA 4BKXA 2E2HJ 1U8BA 4M3DA 4IEJA 5GPAA 3BR3A 1NTCA 1U78A 3LSJA 2FD5A 2Y2ZA 3W6VA 4BY1J 1BA5A 3HOXJ 5EZHA 3BR5A 1FTTA 3G1LA 1H88C 2CQQA 4IHYA 3QPLA 5FKMA 1Y1WJ 1IC8A 4A3DJ 1RKWA 1UHSA 4UUSA 1AKHB 5F08A 4XICA 2DMQA 1ETOA 2L7ZA 2XB0X 3OOUA 2M8GX 1FJLA 4M3BA 4X6AJ 2M2EA 2R0QC 1SANA 3B6AA 3S17J 1IGNA 1MBEA 5EGOA 4CYCB 3JRIA 4A3JJ 4V2FA 5IP7J 9ANTA 1JKOC 1VFCA 2G0EA 4L5EA 2XPUA 3SFIA 2DA3A 4DYRA 1JT6A 3O8HA 1IRZA 4V2GA 3GTMJ 2R7ZJ 4W97A 5EDNA 1JUPA 5E3MA 5DS9A 1GT0C 2EZIA 4JX5A 5M5YJ 5J1RA 4J19A 5JLXA 1BW6A 2E2IJ 2IEKA 3BR2A 2D5VA 1O4XA 4BXXJ 2L7MP 1LE8A 1E3OC 2NVTJ 2NS8A 1Z0XA 2NVQJ 3TW6A 4BY7J 2WB1N 2DA7A 4I76A 3IH4A 1MBKA 3ZQGA 2R5ZA 4DYCA 2M34A 1VNDA 2IBDA 3HB9A 1B8IA 3HDDA 1YRNB 3BR6A 3JRFA 2DA1A 2HOSA 3BT9A 2O9LA 1I50J 1IUFA 2XGCA 1XS9A 4B1RA 3Q0UA 1HCRA 3HGYA 1BW5A 2FQ4A 1TWAJ 5IOYA 2DA4A 2EBIA 3HOWJ 5F1JA 2X48A 2DMUA 1TC3C 3L1PA 5J3LA 2H1KA 5EF6A 3HOUJ 3M3YJ 3C2BA 4FCYA 1JKRC 1OFCX 3OSFA 1IG7A 2X6OA 2JA7J 2MSYA 5C4JJ 3G1MA 2GLOA 3WHCA 4MIMA 4A93J 4X1EA 4A3LJ 2RAEA 4I6ZA 2E1OA 1FIPA 3CDLA 2ELKA 1B72B 2DN0A 2AO9A 4DW6A 3GTPJ 1P7IA 4LOCA 1IJWC 1LFBA 3GTOJ 1RKTA 3Q0VA 4FISA 1VF9A 3QPSA 4D7MA 4QIWN 4Y52J 3TP0A 1LFUP 2JMWA 3BG5A 3CMYA 1MSEC 2Y30A 2W48A 5JLWA 1JJ8C 3A01B 4D7NA 1D5YA 4FTHA 3IV5A 4A69C 5EG0B 3H3VK 1POGA 4QSHA 4W1UA 1JTYA 5E3LA 4B4CA 3JRDA 5M3FJ 1GVDA 3GTKJ 3F0CA 2JN6A 3A02A 4A3BJ 2JA6J 2Y31A 1RR7A 2DJNA 3HGGA 3BTIA 4M6VA 1OJLA 3DCFA 2GBYA 5C3EJ 3IH3A 3WHBA 5F27A 1AU7A 3JRHA 1BL0A 4RDUA 3ZQHA 2JA8J 4MLOA 5J1YA 3PO2J 1ZTRA 1K61A 2DMTA 1ETYA 2Y9ZA 4XIDA 1PUFB 2HQ5A 3CCYA 4XK4A 5C44J 1UG2A 4JP0A 4A3FJ 2WV1A 3GBGA 3ZOBA 3QQAA 3BQZA 3FK7A 4Y7NJ 3PO3J 4DYQA 3O8GA 1GUUA 2N8GA 5E3NA 5GP9A 4GFBA 2P81A 2ME0A 4A3EJ 1ETKA 2CUEA 3BTLA 1U9NA 1F43A 1X2NA 3S14J 3G1OA 1MBJA 3LNQA 2DMPA 1I3QJ 2VI6A 4QTRA 2DTZA 1NK2P 4D5CA 3FKIJ 2CQXA 1CQTA 2XPWA 4UUSB 1JUMA 1MH4A 5FKOA 1ZQ3P 4AYBN 3GTJJ 2HXOA 2O8KA 3M4OJ 1ITYA 1HDPA 3BTJA 1RPWA 1VI0A 2K9QA 4IHXA 1DU0A 2ID6A 3HBLA 5IP9J 5M5WJ 2ECBA 5EGOB 2EZLA 1RETA 2LTPA 1BJZA 1TWGJ 2O7OA 2H8RA 4IHVA 1GV2A 3GTGJ 3HOYJ 3TP3A 5FLMJ 3OSGA 1G2HA 2K9SA 1Q1VA 3BG9A 1EF4A 3GTLJ 4UUTA 4JYKA 1I6HJ 3RZDJ 3HEFA 3ZQIA 2VPRA 2KT0A 1X58A 2MGQA 1QVTA 5M5XJ 2COBA 1ZR2A 2R5YA 2MW8A 1X2MA 3HOZJ 3DEWA 1WI3A 1MBFA 2VKVA 5F04A 1HOMA 1MSFC 1ETXA 1JUSA 3B6CA 5EYRA 2Y9YA 3S2HJ 4A3KJ 3BR1A 4BBRJ 4B3AA 5EEAA 1OCTC 4M3EA 1JKPC 2AHQA 1LE8B 1MH3A 3VPRA 3JR9A 2XRLA 2LD5A 4MFDA 1APLC 2FJ1A 5IYDJ 1XG1A 2L7FP 2KDZA 1ETWA 2LFBA 3NARA 2Y0SN 3ZQCA 2TCTA 3BG3A 4AC0A 2HXIA 3LSPA 2R5ZB 1WPKA 3S1QJ 4M3GA 1B8IB 4IHWA 2DA5A 2DA2A 2LR8A 3S2DJ 5E3OA 3ZQFA 4ABZA 5K7HA 1AKHA 3I4NJ 4FE4A 1AHDP 5GPCA 4A3MJ 1TWHJ 1ORKA 3ZQLA 1HLVA 1H8AC 2JA5J 3S15J 2M9HA 4MO7A 1HF0A 3MKLA 4CYCA 5M3MJ 2ME6A 1R9TJ 2OF7A 3TW7A 2B63J 2R92J 4XRSA 4A3GJ 3UKGA 5BNGA 1ZR4A 3S1NJ 2YS9A 1FTZA 2XGDA 1Z77A 2HOAA 3MVPA 1W0TA 1HDDC 1Y1VJ 3LOCA 3HKZN 2NOGA 2OPTA 2L9RA 1IDZA 1UMQA 2HYJA 2LVSA 3HM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M J;  2CUF A;  5F0C A;  5DTD A;  4D5F A;  2LP0 A;  2XB5 A;  4A3C J;  1A5J A;  2NVY J;  3BTC A;  2XSD C;  3FIS A;  3K2A A;  3LSR A;  2EQR A;  2ID3 A;  4M3F A;  2XGE A;  3HOV J;  1U9O A;  1JT0 A;  3MN2 A;  3LSG A;  2E2J J;  1QVU A;  5FKN A;  3JRA A;  3JRE A;  1QPI A;  2DA6 A;  2M0C A;  2HDD A;  1IDY A;  1QRY A;  5EZG A;  3SDG A;  4A3I J;  5K7F A;  3IH2 A;  1WGX A;  1MNM C;  1JGG A;  2MG4 A;  2LLK A;  4JX6 A;  5J1U A;  2K9N A;  2NS7 A;  4C2M J;  1GV5 A;  4XRM A;  1YRN A;  2JK3 A;  1JJ6 C;  1K83 J;  1TWF J;  2CRG A;  3JRC A;  2JJ7 A;  2K40 A;  1W0U A;  4G12 A;  2E19 A;  4RBO A;  2YU9 J;  1ETV A;  1ZKG A;  3JRB A;  2I10 A;  3GTQ J;  2WAQ N;  3TED A;  2FX0 A;  5IP6 A;  2EH3 A;  4HNV A;  3H0G J;  2EZK A;  2QF7 A;  1B72 A;  3OIO A;  3PM1 A;  4DZP A;  4JX4 A;  1JTX A;  2HOT A;  2CJJ A;  2YUS A;  4S0H B;  3RZO J;  5F0F A;  5FKK A;  3I4M J;  1T33 A;  2LY9 A;  2VKE A;  4AUX A;  4C3H J;  4BBS J;  2R93 J;  5C4X J;  3BQY A;  4DZJ A;  1TWC J;  3Q0W A;  1ETQ A;  2DMN A;  2LK2 A;  1WH7 A;  3CQZ J;  1WH5 A;  1ZK8 A;  2ZB9 A;  3A01 A;  2PMZ N;  2QCO A;  5EG0 A;  2CU7 A;  3NAU A;  5FKL A;  1XC5 A;  1P7J A;  2L0K A;  1ZGW A;  1OCP A;  3K7A J;  1MBG A;  3BR0 A;  4XRS G;  1SFO J;  1RES A;  5IYC J;  3S16 J;  1FIA A;  5HOD A;  3FK6 A;  4C3J J;  5F0H A;  2VUM J;  3RKQ A;  3A03 A;  5K7Z A;  3D1N I;  1IV6 A;  4EEF G;  4NDL A;  2JWT A;  4MFE A;  2TRT A;  2ECC A;  1WCM J;  2XPV A;  3S1R J;  1ENH A;  1NK3 P;  2GM4 A;  2R5Y B;  5IYB J;  1A6I A;  3SJM A;  1MBH A;  1PUF A;  5IOZ A;  2NVX J;  1FEX A;  1S7E A;  5FJ8 J;  1DU6 A;  1T56 A;  2EZH A;  5FLV A;  2LKX A;  1GDT A;  1H89 C;  3E7L A;  3FIW A;  5IPA A;  4FE7 A;  1F36 A;  4C3I J;  2IAI A;  3Q3S A;  3JRG A;  2HI3 A;  2X9D A;  1JKQ C;  3RQI A;  4BKX A;  2E2H J;  1U8B A;  4M3D A;  4IEJ A;  5GPA A;  3BR3 A;  1NTC A;  1U78 A;  3LSJ A;  2FD5 A;  2Y2Z A;  3W6V A;  4BY1 J;  1BA5 A;  3HOX J;  5EZH A;  3BR5 A;  1FTT A;  3G1L A;  1H88 C;  2CQQ A;  4IHY A;  3QPL A;  5FKM A;  1Y1W J;  1IC8 A;  4A3D J;  1RKW A;  1UHS A;  4UUS A;  1AKH B;  5F08 A;  4XIC A;  2DMQ A;  1ETO A;  2L7Z A;  2XB0 X;  3OOU A;  2M8G X;  1FJL A;  4M3B A;  4X6A J;  2M2E A;  2R0Q C;  1SAN A;  3B6A A;  3S17 J;  1IGN A;  1MBE A;  5EGO A;  4CYC B;  3JRI A;  4A3J J;  4V2F A;  5IP7 J;  9ANT A;  1JKO C;  1VFC A;  2G0E A;  4L5E A;  2XPU A;  3SFI A;  2DA3 A;  4DYR A;  1JT6 A;  3O8H A;  1IRZ A;  4V2G A;  3GTM J;  2R7Z J;  4W97 A;  5EDN A;  1JUP A;  5E3M A;  5DS9 A;  1GT0 C;  2EZI A;  4JX5 A;  5M5Y J;  5J1R A;  4J19 A;  5JLX A;  1BW6 A;  2E2I J;  2IEK A;  3BR2 A;  2D5V A;  1O4X A;  4BXX J;  2L7M P;  1LE8 A;  1E3O C;  2NVT J;  2NS8 A;  1Z0X A;  2NVQ J;  3TW6 A;  4BY7 J;  2WB1 N;  2DA7 A;  4I76 A;  3IH4 A;  1MBK A;  3ZQG A;  2R5Z A;  4DYC A;  2M34 A;  1VND A;  2IBD A;  3HB9 A;  1B8I A;  3HDD A;  1YRN B;  3BR6 A;  3JRF A;  2DA1 A;  2HOS A;  3BT9 A;  2O9L A;  1I50 J;  1IUF A;  2XGC A;  1XS9 A;  4B1R A;  3Q0U A;  1HCR A;  3HGY A;  1BW5 A;  2FQ4 A;  1TWA J;  5IOY A;  2DA4 A;  2EBI A;  3HOW J;  5F1J A;  2X48 A;  2DMU A;  1TC3 C;  3L1P A;  5J3L A;  2H1K A;  5EF6 A;  3HOU J;  3M3Y J;  3C2B A;  4FCY A;  1JKR C;  1OFC X;  3OSF A;  1IG7 A;  2X6O A;  2JA7 J;  2MSY A;  5C4J J;  3G1M A;  2GLO A;  3WHC A;  4MIM A;  4A93 J;  4X1E A;  4A3L J;  2RAE A;  4I6Z A;  2E1O A;  1FIP A;  3CDL A;  2ELK A;  1B72 B;  2DN0 A;  2AO9 A;  4DW6 A;  3GTP J;  1P7I A;  4LOC A;  1IJW C;  1LFB A;  3GTO J;  1RKT A;  3Q0V A;  4FIS A;  1VF9 A;  3QPS A;  4D7M A;  4QIW N;  4Y52 J;  3TP0 A;  1LFU P;  2JMW A;  3BG5 A;  3CMY A;  1MSE C;  2Y30 A;  2W48 A;  5JLW A;  1JJ8 C;  3A01 B;  4D7N A;  1D5Y A;  4FTH A;  3IV5 A;  4A69 C;  5EG0 B;  3H3V K;  1POG A;  4QSH A;  4W1U A;  1JTY A;  5E3L A;  4B4C A;  3JRD A;  5M3F J;  1GVD A;  3GTK J;  3F0C A;  2JN6 A;  3A02 A;  4A3B J;  2JA6 J;  2Y31 A;  1RR7 A;  2DJN A;  3HGG A;  3BTI A;  4M6V A;  1OJL A;  3DCF A;  2GBY A;  5C3E J;  3IH3 A;  3WHB A;  5F27 A;  1AU7 A;  3JRH A;  1BL0 A;  4RDU A;  3ZQH A;  2JA8 J;  4MLO A;  5J1Y A;  3PO2 J;  1ZTR A;  1K61 A;  2DMT A;  1ETY A;  2Y9Z A;  4XID A;  1PUF B;  2HQ5 A;  3CCY A;  4XK4 A;  5C44 J;  1UG2 A;  4JP0 A;  4A3F J;  2WV1 A;  3GBG A;  3ZOB A;  3QQA A;  3BQZ A;  3FK7 A;  4Y7N J;  3PO3 J;  4DYQ A;  3O8G A;  1GUU A;  2N8G A;  5E3N A;  5GP9 A;  4GFB A;  2P81 A;  2ME0 A;  4A3E J;  1ETK A;  2CUE A;  3BTL A;  1U9N A;  1F43 A;  1X2N A;  3S14 J;  3G1O A;  1MBJ A;  3LNQ A;  2DMP A;  1I3Q J;  2VI6 A;  4QTR A;  2DTZ A;  1NK2 P;  4D5C A;  3FKI J;  2CQX A;  1CQT A;  2XPW A;  4UUS B;  1JUM A;  1MH4 A;  5FKO A;  1ZQ3 P;  4AYB N;  3GTJ J;  2HXO A;  2O8K A;  3M4O J;  1ITY A;  1HDP A;  3BTJ A;  1RPW A;  1VI0 A;  2K9Q A;  4IHX A;  1DU0 A;  2ID6 A;  3HBL A;  5IP9 J;  5M5W J;  2ECB A;  5EGO B;  2EZL A;  1RET A;  2LTP A;  1BJZ A;  1TWG J;  2O7O A;  2H8R A;  4IHV A;  1GV2 A;  3GTG J;  3HOY J;  3TP3 A;  5FLM J;  3OSG A;  1G2H A;  2K9S A;  1Q1V A;  3BG9 A;  1EF4 A;  3GTL J;  4UUT A;  4JYK A;  1I6H J;  3RZD J;  3HEF A;  3ZQI A;  2VPR A;  2KT0 A;  1X58 A;  2MGQ A;  1QVT A;  5M5X J;  2COB A;  1ZR2 A;  2R5Y A;  2MW8 A;  1X2M A;  3HOZ J;  3DEW A;  1WI3 A;  1MBF A;  2VKV A;  5F04 A;  1HOM A;  1MSF C;  1ETX A;  1JUS A;  3B6C A;  5EYR A;  2Y9Y A;  3S2H J;  4A3K J;  3BR1 A;  4BBR J;  4B3A A;  5EEA A;  1OCT C;  4M3E A;  1JKP C;  2AHQ A;  1LE8 B;  1MH3 A;  3VPR A;  3JR9 A;  2XRL A;  2LD5 A;  4MFD A;  1APL C;  2FJ1 A;  5IYD J;  1XG1 A;  2L7F P;  2KDZ A;  1ETW A;  2LFB A;  3NAR A;  2Y0S N;  3ZQC A;  2TCT A;  3BG3 A;  4AC0 A;  2HXI A;  3LSP A;  2R5Z B;  1WPK A;  3S1Q J;  4M3G A;  1B8I B;  4IHW A;  2DA5 A;  2DA2 A;  2LR8 A;  3S2D J;  5E3O A;  3ZQF A;  4ABZ A;  5K7H A;  1AKH A;  3I4N J;  4FE4 A;  1AHD P;  5GPC A;  4A3M J;  1TWH J;  1ORK A;  3ZQL A;  1HLV A;  1H8A C;  2JA5 J;  3S15 J;  2M9H A;  4MO7 A;  1HF0 A;  3MKL A;  4CYC A;  5M3M J;  2ME6 A;  1R9T J;  2OF7 A;  3TW7 A;  2B63 J;  2R92 J;  4XRS A;  4A3G J;  3UKG A;  5BNG A;  1ZR4 A;  3S1N J;  2YS9 A;  1FTZ A;  2XGD A;  1Z77 A;  2HOA A;  3MVP A;  1W0T A;  1HDD C;  1Y1V J;  3LOC A;  3HKZ N;  2NOG A;  2OPT A;  2L9R A;  1IDZ A;  1UMQ A;  2HYJ A;  2LVS A;  3HM5 A; 
#chains in the Genus database with same CATH topology
 4RM2 A;  2LP0 A;  2XB5 A;  1DUX C;  4ENK A;  1TT0 A;  3BTC A;  3KZI C;  4M74 A;  1SVM A;  2M7A A;  3PNV A;  4EAT A;  3RDI A;  4XR6 A;  3OYM A;  3LSR A;  1A36 A;  2LSO A;  2ID3 A;  2Q2E B;  4RLF A;  4NBQ A;  3FXM A;  1WZ2 A;  2MC4 A;  3L7W A;  3TO6 A;  2BHY A;  2DA6 A;  2HDD A;  3IKV A;  1IXS B;  3SDG A;  1S5L C;  5CYV A;  3FXU A;  4ZTJ A;  2V1N A;  3MZH A;  3C2H A;  3CO6 C;  1J9I A;  1F9N A;  3ISP A;  1SD6 A;  2BVL A;  2MG4 A;  2VQG A;  4JX6 A;  5J1U A;  1RZ4 A;  2HEO A;  4IO9 F;  1UG0 A;  1TQI A;  2FBI A;  2OD5 A;  2FE3 A;  1FMV A;  5J6X A;  1K78 A;  2HU9 A;  4KIF A;  1F4K A;  1QHH D;  1JJ6 C;  1TWF J;  4TV7 A;  4L5I A;  2JJ7 A;  1E3H A;  1ZAR A;  1W7P A;  1HKS A;  3FX3 A;  4RBO A;  3COA C;  1FOK A;  3D5R C;  2YU9 J;  4GXO A;  2HVR A;  2WAQ N;  4KMF A;  5KHD A;  2CQ7 A;  3TED A;  2FX0 A;  3LST A;  3HC7 A;  4M72 A;  2A6E F;  2EH3 A;  2P5V A;  2RKH A;  5FO5 A;  2AS5 F;  1B9M A;  2GIV A;  4BDZ A;  3PUF A;  5JVG F;  5CVI A;  3VEP A;  5HS7 A;  1H9G A;  3EUK L;  1Z1D A;  3I54 A;  3PM1 A;  3VSL A;  1ZRE A;  3I58 A;  1ZHF A;  3GYH X;  2JRM A;  1XGO A;  4I7H A;  2LC2 A;  3PNT A;  3F8F A;  2QEX I;  5LEJ A;  2YUS A;  2STT A;  5F0F A;  4EJV A;  4E7H A;  2VKE A;  4C3H J;  2R93 J;  5C4X J;  3BQY A;  5KNL A;  3Q0W A;  4XOT A;  4XQF A;  1FOW A;  2DMN A;  2EIL H;  2LK2 A;  3DKW A;  2CFO A;  5HLT A;  1VTN C;  2IRF G;  3M07 A;  2GXB A;  3OYD A;  2VC1 A;  1ZK8 A;  1G3T A;  3RYP A;  2PMZ N;  3HL2 A;  3QWL A;  5ILU A;  4DIQ A;  5EG0 A;  2RRE A;  1J0R A;  3HTU A;  3NAU A;  5FKL A;  5ERI A;  1XC5 A;  1MGT A;  2Z1D A;  1ZG5 A;  3K4N A;  3BR0 A;  2DFF A;  1RES A;  2WAD A;  2GA2 A;  4G7Z F;  5IY5 H;  3WGI A;  2A3S A;  1OPC A;  5BQT A;  1VQP I;  2J5O A;  2VUM J;  1NHA A;  3D1N I;  3JSO A;  1MD0 A;  2JWT A;  3KZY A;  1YG2 A;  5LLQ A;  1X4O A;  2XPV A;  5CQG A;  4IHS A;  1HW5 A;  1SFK A;  4YII A;  2PEX A;  1R1T A;  3HRU A;  2NNY A;  2Q0O A;  1ACI A;  4NHJ A;  2UZK A;  2R5Y B;  4BJ5 C;  1MBH A;  2NVX J;  1FEX A;  2OU2 A;  2AQE A;  5FJ8 J;  1D5V A;  3LSK A;  3OL3 A;  3H35 A;  5DCF A;  2M45 A;  3OR1 C;  1BR1 A;  1GDT A;  5IPA A;  1PDN C;  5ICC A;  4FE7 A;  1FLI A;  3H5N A;  2G9W A;  3KFW X;  4C3I J;  1LFP A;  1I5Z A;  1O7L A;  4BKX A;  1U0J A;  3J7A Y;  1IN6 A;  4M3D A;  3RJP A;  1FY7 A;  2VT2 A;  3JSP A;  2L9V A;  3ZMD A;  2MLG A;  2E1N A;  1LEA A;  4HDV A;  4RGS A;  1L0O C;  4CSW A;  2GOM A;  1FTT A;  3OS2 A;  3PL8 A;  2KIQ A;  2CQQ A;  1H88 C;  1EJ9 A;  2LKS A;  2RVC A;  1RKW A;  4LG0 A;  4UUS A;  2HQR A;  3WTW C;  3V4G A;  4L5J A;  5DM6 F;  2FEZ A;  2L7Z A;  4R79 A;  4KFC A;  2XB0 X;  2HVS A;  3LQR A;  2M8G X;  5LBQ A;  1R71 A;  3KP7 A;  1S7A A;  4JOM A;  3QOE A;  3S17 J;  4HX7 A;  1IGN A;  2VC0 A;  3V7S A;  4EJU A;  5EGO A;  2DT6 A;  4V2F A;  5IP7 J;  1AOY A;  2WC2 A;  3TQN A;  4GRI A;  4L5E A;  2IJL A;  4RB0 A;  5LGT A;  3SFI A;  1EV7 A;  2A5W A;  2CFX A;  3SZG A;  1V3F A;  4OMY A;  3OWT A;  2HZT A;  4W97 A;  3L09 A;  1G4D A;  2OAZ A;  3K4K A;  3L2V A;  1OYI A;  5ILV A;  2R7D A;  3GX4 X;  4JX5 A;  3U1K A;  3FBI B;  1YLF A;  2HWV A;  1BW6 A;  4KT6 A;  2V9K A;  2GQQ A;  2D5V A;  1G3Y A;  2KLO A;  2CW7 A;  2L7M P;  3OYE A;  1E3O C;  2NS8 A;  4J00 A;  3LL7 A;  3FKJ A;  5B1A H;  2F5C A;  5F1R A;  2DA7 A;  4I76 A;  4B09 A;  1XX5 A;  1EA3 A;  3PQJ A;  3IH4 A;  5HLH A;  1WSU A;  2CW8 A;  3KP2 A;  3IKT A;  3KYL A;  2IS4 A;  4I01 A;  2O3F A;  2VE9 A;  2XF6 A;  1B1B A;  4NQW A;  3V42 A;  4XN3 A;  3OYL A;  1N77 A;  2HQN A;  1FYK A;  1YRN B;  2DA1 A;  2HOS A;  3BT9 A;  5CPR B;  3SZP A;  2VOO A;  2X6Y A;  2IW5 A;  2EWN A;  1BN5 A;  3HGY A;  1BW5 A;  5IOY A;  3GXO A;  2X48 A;  1BI1 A;  1REP C;  1BIA A;  2W85 A;  3ONQ A;  3L1P A;  4I0A A;  5EF6 A;  1QO0 D;  2CMP A;  4F92 B;  1MIJ A;  1OFC X;  5DCM A;  3OSF A;  2JA7 J;  1ONV A;  3RQ4 A;  2MSY A;  5C4J J;  1R5G A;  3ABK H;  4A93 J;  3OV8 A;  1SMT A;  5F64 A;  4JQF A;  1Z6R A;  1XSV A;  5E1Z B;  2K5C A;  1MMS A;  1OYY A;  1ZEL A;  4XN0 A;  3GTP J;  1O3R A;  4CUG A;  1MJ9 A;  2K4B A;  3WG9 A;  1JE8 A;  2JPB A;  3HIF A;  4GDF A;  1R1V A;  4HQE A;  4ZJZ A;  3ZMU A;  1IRF A;  1QHG A;  3EPZ A;  1UAA A;  2BY0 A;  2VN2 A;  1RKT A;  4ENM A;  2DU9 A;  2RC4 A;  4KIC A;  4HNU A;  3H1C A;  3TP0 A;  1WHU A;  4BEH A;  1LFU P;  2RQP A;  1LDJ A;  2KP6 A;  2IS1 A;  1JJ8 C;  4NNJ A;  2O5R A;  5DUI A;  4FTH A;  1D5Y A;  5E20 A;  3QYE A;  4A2U A;  2K7L A;  3WU1 B;  1MJA A;  2Z3Y A;  5E3L A;  4E6K G;  1NG7 A;  5M3F J;  4RAY A;  1GXQ A;  2C6Y A;  2JN6 A;  4A3B J;  2BY1 A;  1PVE A;  1GLN A;  2V4J C;  3RTR A;  2HDC A;  3HOT A;  4HV5 A;  2ZXI A;  3WHB A;  5F27 A;  4RS8 A;  5D6F A;  2XAF A;  3C1D A;  1LVA A;  3DU6 A;  2RN7 A;  1OR7 A;  2EA4 A;  4YRV A;  3K69 A;  1T0F C;  4B48 A;  1D1C A;  1PUF B;  2HQ5 A;  3KYC B;  2ACJ A;  2ISZ A;  4MEX F;  4XK4 A;  2O6G E;  4XKV A;  1J75 A;  4JP0 A;  5J8F A;  2WV1 A;  2FXA A;  2A05 A;  1OCC H;  3S93 A;  3E6C C;  4HF2 A;  3R6S A;  3FK7 A;  4O3M A;  4PJM A;  3F9K A;  2R4G A;  4ANJ A;  4OIQ F;  4CIC A;  4AID A;  2E60 A;  3DKY A;  2F2E A;  2XHK A;  4RA2 A;  4FX4 A;  1R36 A;  2ADU A;  2JTV A;  4GGG A;  4KMU X;  2CUE A;  3L2Q A;  3DQV C;  1ZRC A;  1X2N A;  1F43 A;  2Z16 A;  4IRH A;  1WFX A;  2VJJ A;  3LNQ A;  1DDN A;  2CV0 A;  4QTR A;  2LNB A;  3E97 A;  2W82 A;  4D5C A;  3QRF F;  3L2U A;  2D1V A;  2A6T A;  2I5U A;  4WX9 A;  3F8N A;  4AYB N;  3GTJ J;  3F8C A;  3EQL F;  3BTJ A;  3FHN A;  3CCU I;  1CGP A;  1DU0 A;  5IP9 J;  3LFK A;  1IAW A;  3CUQ A;  3QYF A;  1TWG J;  2O7O A;  1X3U A;  2Z9O A;  2F4O B;  3DTK A;  2YX4 A;  4Q48 A;  5AIQ A;  5FLM J;  3OSG A;  2K9S A;  3AL0 C;  2LRD A;  1AWC A;  4CCO A;  1EF4 A;  1YX3 A;  2HQA A;  4CZC A;  3F22 A;  4UUT A;  5E8G A;  1I6H J;  2X1D A;  3HEF A;  1XPX A;  4PCQ A;  2VPR A;  3OIP A;  5FGM A;  2XRO A;  3IUO A;  3KE2 A;  5L3E A;  2UXN A;  1QVT A;  1J2X A;  2COB A;  2VJ4 A;  4A5M A;  1ON1 A;  3I0T A;  3W6K B;  2ZJQ F;  2V9V A;  1X2M A;  4EJO A;  2IA1 A;  2HPM A;  4L9J A;  1HOM A;  1Z3Y A;  3ZP5 A;  1D3Y A;  5EYR A;  4BE0 A;  4A3K J;  3HHH A;  3M9A A;  2FQ3 A;  3MWM A;  4Y33 A;  2W25 A;  2AQF A;  4M3E A;  3ZGK A;  2O03 A;  4GYG A;  1B6A A;  1MH3 A;  4K2E A;  3VPR A;  1JGS A;  5GAG J;  5JI6 A;  1YJW I;  5IYD J;  5HOO A;  2L54 A;  2LFB A;  2Y0S N;  2TCT A;  3G4S I;  4LLG F;  3E5U A;  2FOW A;  2HXI A;  3IAS 2;  4AC0 A;  3LSP A;  1O3Q A;  3EDP A;  2G7U A;  3LA3 A;  2QEN A;  1B8I B;  1DP3 A;  3G6E I;  2K3F A;  1U5T A;  2LR8 A;  2FF4 A;  3WG7 H;  1YFH A;  1MND A;  3ABL H;  3S2D J;  1R5I D;  2OV7 A;  4IPA A;  3I4N J;  2R7T A;  5LRS A;  4IVN A;  3CTA A;  4B3X A;  1FP1 D;  1AHD P;  3HKZ A;  4B47 A;  3VYT B;  2GOX B;  2F4I A;  4MHG A;  1H8A C;  1ORK A;  1ZAO A;  3ZQL A;  1QU3 A;  2M9H A;  4FT8 A;  1O3T A;  1HF0 A;  3DXJ F;  3K4L A;  1R9T J;  5E8I A;  1S8N A;  1CF7 B;  2NXN B;  4A0X A;  1F5T A;  3KP6 A;  1E2X A;  3UKG A;  5BNG A;  1ZR4 A;  3S1N J;  2OCE A;  1FTZ A;  1KON A;  4Q47 A;  1HQC A;  1K4T A;  4HV6 A;  4KIS A;  3TOB A;  2KRH A;  3HKZ N;  3OYF A;  5KK1 A;  2OPT A;  1IRX A;  2HYJ A;  3W6J B;  2IGK A;  5KVR A;  1MNE A;  2GAU A;  1HSJ A;  3JW4 A;  4ESB A;  3BPX A;  3FIS A;  3K2A A;  3WTV C;  3BWG A;  3MQ0 A;  4PUS A;  2W4S A;  2XGE A;  4BQN A;  3HOV J;  2PLY A;  1BOA A;  2E2J J;  3LSG A;  4IJA A;  4D9J A;  2Y48 A;  3DBH B;  3CCR I;  3K1M A;  4Z6Y A;  4PJN A;  3IHU A;  3H36 A;  1QRY A;  4XLC A;  3CMA I;  1RIO H;  5LGU A;  1BOB A;  2KPM A;  1LPQ A;  1WGX A;  4F3Q A;  3AKZ A;  1KU9 A;  2WAE A;  2K9N A;  3HJE A;  1S72 I;  2NS7 A;  5B3S H;  4I99 C;  2KIS A;  2ZNY A;  2OUM A;  3KLO A;  4PZJ A;  2CRG A;  3SYT A;  4IHT A;  2L5Q A;  2P8T A;  5GAD J;  2E19 A;  4LG3 A;  1W0U A;  1VQK I;  1BI0 A;  2W7N A;  3OOP A;  4OMZ A;  3JRB A;  2EV5 A;  4PK4 A;  3Q9S A;  3GTQ J;  1QQI A;  4KT5 C;  1NG6 A;  2DQL A;  2BW3 B;  4XM3 A;  1T98 A;  4F91 B;  4YFN F;  1EH6 A;  3FF5 A;  1A6Q A;  4KUM A;  4N4O B;  2VIX A;  1FP2 A;  1UJ8 A;  3G71 I;  1B72 A;  1JXS A;  1W1W E;  3CES A;  3VDX A;  2EA2 A;  3H9J A;  1Y39 A;  2PJR B;  1QZY A;  2WWY A;  3LSH A;  2CJJ A;  4OOI A;  2JSC A;  2Z33 A;  2HOT A;  2Q1Z B;  1WJC A;  1J09 A;  3H0D A;  2QBY A;  2E7X A;  1VQ4 I;  3GCM A;  3P9I A;  2K86 A;  4KN7 X;  3QPH A;  1VQ8 I;  3GZ6 A;  4DZJ A;  1MDM A;  1FOX A;  4OAY A;  3AG3 H;  1MKM A;  2KRC A;  2K9L A;  4P55 A;  1WH7 A;  1FBS A;  3CQZ J;  3QOD A;  1XGM A;  4DNC A;  3IL2 A;  3PSF A;  3IRQ A;  3HZJ A;  5GTH C;  3A01 A;  3WTS C;  2MD5 A;  3WTY C;  5JFR A;  4IOC F;  3WTU C;  3F3X A;  1ZGJ A;  3P9C A;  1P7J A;  1YIO A;  3L2C A;  4IRI A;  5CVV A;  2KJB A;  2PMH A;  3GFL A;  3S16 J;  1BR2 A;  3ZCO A;  5D8L B;  4C3J J;  2VBZ A;  4BQO A;  4EEF G;  4PFO A;  2L4M A;  3TBI A;  2PG4 A;  1P6R A;  2ECC A;  2DDB A;  4LIV A;  2HR3 A;  2LF7 A;  3R4K A;  4F55 A;  1LB2 A;  2GIZ A;  4HYE A;  2CS3 A;  4HSR A;  1ENH A;  1NK3 P;  1EKE A;  2OTL I;  5IYB J;  2ETH A;  1C0W A;  2XUB A;  3HXL A;  1S7E A;  3N4M A;  3FHZ A;  3CJT B;  1DU6 A;  2DTR A;  2XIG A;  2EZH A;  3ML6 A;  2LKX A;  5LGN A;  1H89 C;  3E7L A;  4ZYA A;  2OA4 A;  4Q4Z F;  1VQ9 I;  2DOA A;  4ZZD A;  3LMM A;  5BS6 A;  4LD5 A;  5JVT A;  3FM5 A;  2QZ8 A;  2JZY A;  5HLI A;  2KDO A;  3HOS A;  2CH0 A;  4LFU A;  2WA0 A;  1OYW A;  5GPA A;  3BPV A;  3BR3 A;  3TGN A;  1NTC A;  1PUE E;  1R4M B;  1XD7 A;  4XLH A;  1U78 A;  4ASN A;  3LSJ A;  2FD5 A;  2ICW G;  3CF2 A;  5B1B H;  4U0V A;  2GXA A;  4BY1 J;  1LDD A;  1XMX A;  2FU4 A;  3BCA A;  3KP4 A;  3WU0 A;  3QPL A;  1Y1W J;  4A3D J;  2QGU A;  2EIM H;  4Y17 A;  2F48 A;  3HSF A;  3QAH A;  2VOP A;  2PBI A;  1SFU A;  1W5T A;  2EFQ A;  3OOU A;  1AA7 A;  1TL8 A;  1FJL A;  4X6A J;  2L9S A;  3B6A A;  3EUH A;  1T2K A;  4BXF A;  2LG4 A;  4CYC B;  2TDX A;  3RPU A;  1T95 A;  4A3J J;  2V79 A;  2L3D A;  2XAG A;  9ANT A;  1TW2 A;  2ELJ A;  3ERE D;  4A5N A;  1VFC A;  2G0E A;  2L01 A;  2BGC A;  2GWR A;  1SAU A;  1S3J A;  2IGN A;  2XPU A;  4L9V A;  4BQQ A;  1IXR C;  4EM0 B;  2DA3 A;  4J01 A;  4DYR A;  1I1S A;  2GA1 A;  4HX8 A;  1JT6 A;  3H3U A;  2LH9 A;  3FXR A;  4BJT A;  1K4S A;  3X2Q H;  3S32 A;  3GTM J;  4D1Q A;  4V19 K;  4IQJ A;  3FWE A;  5EDN A;  4ON0 A;  1XDS A;  1WRJ A;  5ICF A;  5H2F C;  4A12 A;  1H0M A;  2ZME B;  1LVK A;  3I59 B;  3CC2 I;  3VYS B;  3GZN B;  2EZI A;  2BZT A;  3ZMS A;  4N9H A;  2ELH A;  5J1R A;  1UEL B;  4LMY A;  5JLX A;  1D8J A;  4I98 B;  1KQ0 A;  2M87 A;  1U2W A;  1TTY A;  1FYL A;  2OJE D;  3K4B A;  4WK8 F;  4BXX J;  3GZ5 A;  4E7S A;  3CJR B;  1X1D A;  3O2P E;  2OZ6 A;  3TW6 A;  4BY7 J;  4R8H A;  4MTE A;  4AVP A;  4WWC A;  1SEU A;  1KYZ A;  3K1P A;  1UHM A;  1J59 A;  2R7W A;  3ZQ7 A;  2VPL A;  1WJF A;  1MMG A;  3DV8 A;  4PGH A;  1P2F A;  1WWX A;  2R5Z A;  3UR3 C;  1MZB A;  1VND A;  2HOE A;  2IBD A;  2KQR A;  3GFI A;  3K4C A;  5BMZ A;  3BR6 A;  3JRF A;  4NC6 A;  4A6D A;  3KEY A;  1K6Y A;  2VQL A;  3KEO A;  4HPQ A;  2FRH A;  2EBI A;  5ICE A;  3HOW J;  2A61 A;  4BS9 A;  4O6J A;  4II2 A;  1RC9 A;  3HOU J;  3MMY B;  1O57 A;  3C2B A;  4FCY A;  2IS2 A;  2O0Y A;  1SD5 A;  1T08 B;  2I8D A;  1IF1 A;  2DPU A;  3DF8 A;  3M1C A;  4X1E A;  2EV6 A;  5FLX Z;  2E1O A;  3CDL A;  3SEQ A;  4I6Z A;  4XNF A;  1V55 H;  5DDG A;  2F5E A;  3F21 A;  4UV9 A;  3KYD B;  2JQ7 A;  2AO9 A;  4B44 A;  4DW6 A;  3AL0 B;  2DXI A;  4EGZ A;  2VE8 A;  3C18 A;  2FBH A;  3I4P A;  2V1D A;  2BV6 A;  1IJW C;  1LFB A;  4OIR F;  1EH7 A;  1XSX A;  3BJA A;  3GTO J;  2Z99 A;  1VF9 A;  4D7M A;  4IL6 C;  1HKT A;  2W48 A;  5JLW A;  1LJ9 A;  4ZDL A;  4XLP F;  4UNO A;  3BRO A;  3IV5 A;  3K70 C;  2F5F A;  3MEX A;  3ZPL A;  3H3V K;  2P7C B;  1S7O A;  2DFE A;  1POG A;  1S9H A;  2KZV A;  4XRF A;  4QSH A;  1P4X A;  2K4J A;  3JRD A;  1GVD A;  4MEY F;  3S2W A;  4ZYH A;  1FX7 A;  3CLO A;  4U7B A;  2Q2E A;  3A02 A;  4G94 A;  3ULQ B;  1RR7 A;  3P9K A;  5GAE J;  5IT9 K;  2X1C A;  4M6V A;  3F6V A;  1Z91 A;  4PJL A;  5LHG A;  4G8X A;  5AON A;  4ENJ A;  5C3E J;  2NOJ B;  3E1S A;  3W2W A;  3FXQ A;  3VWB A;  3W2V A;  3HRS A;  4RDU A;  1SVO A;  3ZQH A;  4P96 A;  3ZMV A;  1I39 A;  3ZN1 A;  4MLO A;  5J1Y A;  4CCJ A;  3AAF A;  3PO2 J;  1ZTR A;  4XBF A;  3D5S C;  4X0G A;  3I55 I;  1ETY A;  3SDB A;  4GO1 A;  3T0Y A;  4XID A;  4DJA A;  5TIS C;  4RB1 A;  4XL9 A;  5C44 J;  3M8E A;  4XON A;  1FZP B;  2H27 A;  1Y8Q B;  1WJE A;  4UV8 A;  3KIO A;  2J5P A;  3RIR A;  4E7Z A;  4HX4 A;  3GBG A;  3DP7 A;  1P9Q C;  2XGX A;  3QQA A;  4Y7N J;  4KYW A;  4MQV A;  1PJR A;  3O8G A;  1GUU A;  2FA5 A;  1LQ1 A;  1K7A A;  3FXJ A;  2N8G A;  1XDU A;  5E3N A;  3QPT A;  4YIR X;  3PIP F;  2X0L A;  2KJC A;  1G6N A;  2ME0 A;  3BJO A;  4S05 A;  3BTL A;  4Y15 A;  5EEH A;  2HKX A;  1LUJ B;  2FNP A;  5J8C A;  3J7A O;  3O6B B;  2CQX A;  1CQT A;  4EJT A;  2CSO A;  4FAS D;  4HOB A;  3S3N A;  1MH4 A;  1HC8 A;  2DOD A;  1JI8 A;  1HDP A;  4ZYG A;  3SHF A;  1WJB A;  4KA4 A;  3CZ6 A;  2K9Q A;  4IKF A;  4XLN F;  2DPD A;  5D4S A;  5M5W J;  2ECB A;  3CDH A;  3ZRG A;  4BHC A;  2LTP A;  1BJZ A;  5HNF A;  1OIS A;  4L0Z B;  4E7J A;  2B7E A;  2W24 A;  3HOY J;  2X1E A;  3E5X A;  3BG9 A;  3I56 I;  4XSZ F;  1X1P A;  2E5Z A;  3C3W A;  3GTL J;  4E7I A;  5HDG A;  5GTI C;  1TW3 A;  1LDK B;  2DO7 A;  2VOD A;  3K10 A;  6PAX A;  1X58 A;  3TO9 A;  2ZNZ A;  5M5X J;  3TDU C;  2QLZ A;  3OYA A;  1ODD A;  2R5Y A;  2MW8 A;  2XAJ A;  1I1G A;  3CCV I;  1IN8 A;  2M8E A;  3EUA A;  2Y0M A;  3DBL B;  5CJ9 A;  1UCR A;  4L9N A;  2JRT A;  3A2K A;  2KRF A;  2QM3 A;  2ZXH A;  1YE9 A;  4BBR J;  3CCS I;  2ZKZ A;  4B3A A;  5EEA A;  1LEB A;  3CCJ I;  1W5C C;  1OKR A;  5CVU A;  3V7C A;  2AHQ A;  1LE8 B;  2EFN A;  3KP3 A;  3HRT A;  1RRJ A;  3JR9 A;  4RM3 A;  2ZXW H;  3ZQQ A;  3U9G A;  1FPQ A;  3NAR A;  4BHB A;  3E0J B;  2MH9 A;  2O8X A;  3FMS A;  3U2R A;  4S04 A;  1UST A;  2M3A A;  2A6H F;  1WKM A;  4HEA 2;  1R4N B;  1Z7L A;  4M3G A;  4IHW A;  2DA5 A;  5H20 A;  2M1B A;  2FMY A;  2XKP A;  3BDD A;  5H6R A;  3IWF A;  4C30 A;  3ZQF A;  2UUZ A;  4BL0 B;  2HTJ A;  5DYM A;  3GLX A;  3AG4 H;  4AVZ A;  2L02 A;  1YX5 A;  1UHW A;  1FBU A;  5GPC A;  3U1D A;  1YS6 A;  3MKL A;  3RYR A;  1P92 A;  2UWM A;  2CO5 A;  2ISY A;  4UHT A;  2V6C A;  1RUN A;  2R92 J;  2HPI A;  3VFZ A;  4DBR A;  3OYH A;  2YS9 A;  3NWS A;  2ZME C;  1Z77 A;  3ROU A;  4XOR A;  2QSH X;  1W0T A;  1HDD C;  1Y56 A;  5FRN A;  2AXT C;  1K6O A;  1D1B A;  2NOG A;  4HAM A;  2L9R A;  4XMY A;  4LLN A;  4P9F A;  2FOK A;  3ZN0 A;  1OMI A;  2ESH A;  4DOZ A;  3PSI A;  4CCN A;  1I6X A;  1OCO H;  3GVA A;  3FXL A;  2DBB A;  3J80 Z;  5E17 F;  2CUF A;  5F0C A;  1QBJ A;  3GWZ A;  2H6B A;  4A3C J;  4E4H A;  2L2O A;  2BXZ A;  2NVY J;  4OIN F;  2H94 A;  1F1Z A;  3HUG B;  3SXY A;  1RI7 A;  4U7D A;  2EQR A;  2XF5 A;  3VYR B;  3F8B A;  2OTJ I;  4KNY A;  1QVU A;  5FKN A;  3JRA A;  1QPI A;  2VQC A;  3F72 A;  1XMA A;  1IDY A;  2HGC A;  5EZG A;  5KAF C;  4A3I J;  2RGV A;  2VJI A;  2CQK A;  2KZG A;  1FT9 A;  4YEJ A;  5JHU A;  2F6C A;  2JT1 A;  1O7F A;  3JCU C;  4RMN A;  2ZXJ A;  4YEL A;  1IXC A;  4C2M J;  1GV5 A;  3BJ6 A;  1YRN A;  1IUY A;  4Y3O A;  3CLQ A;  2JK3 A;  3J81 K;  4AM3 A;  5DD4 A;  1SFX A;  3ESW B;  4II3 A;  4G6Q A;  2VON A;  3IRR A;  2W84 A;  3JRC A;  2VBW A;  2K40 A;  2VBX A;  3NWT A;  3R0J A;  1QA6 A;  2I10 A;  3VOE A;  3CJQ B;  1V5G A;  2VAS A;  5DD8 A;  1T38 A;  5LHI A;  3IAM 2;  4CA0 A;  4ZDO A;  1YIJ I;  4LLL A;  3OIO A;  2IGM A;  5LD2 C;  1JTX A;  3J7Z I;  2K9M A;  2VLA A;  2PMU A;  3I4M J;  5B5E C;  1T33 A;  5L3F A;  1YW9 A;  3QP6 A;  5DUK A;  1FBQ A;  1ETQ A;  3RKW A;  4G9Y A;  4AWX B;  3K9T A;  2LBF B;  5FFZ A;  1GXP A;  2ZB9 A;  3LQQ A;  2H09 A;  2V9P A;  2ESN A;  2L0K A;  1OCP A;  1ZGW A;  1MBG A;  4XRS G;  1SFO J;  3MKW B;  4F93 B;  5CLS A;  5D5W B;  2PX9 A;  2IXS A;  2DAO A;  4CO8 A;  2DFI A;  4BUP A;  5F0H A;  4EGY A;  3QU3 A;  5K7Z A;  1U8R A;  2EIN H;  2TRT A;  2R7Q A;  2V1X A;  2M4K A;  4UVB A;  2JVG A;  2XSJ C;  3OYB A;  3S1R J;  4U0Y A;  1V5E A;  3OS0 A;  2IT0 A;  1FWZ A;  2GM4 A;  3W2A A;  3GME A;  3G73 A;  3IP4 B;  1PUF A;  5IOZ A;  5F6F A;  4DQ2 A;  3MD2 A;  2E1M C;  3RKY A;  3BOQ A;  1R23 A;  4M9S A;  4HLY A;  5FLV A;  3BP8 A;  1D0Z A;  3EYY A;  4H4K C;  1FSE A;  5DEQ A;  5FD5 A;  3BLY A;  2YSR A;  3CUO A;  3LAJ A;  1A31 A;  3JRG A;  1BJA A;  2HI3 A;  2X9D A;  2MA3 A;  3RQI A;  2E2H J;  1TQM A;  1T6S A;  4RGR A;  1XSD A;  3K70 D;  4N0B A;  3RI4 A;  3K6G A;  4LIT A;  1N78 A;  2Y2Z A;  1KQ8 A;  1BA5 A;  3U21 A;  3HOX J;  5FB2 A;  3BR5 A;  2HNH A;  4MNU A;  3GF2 A;  2IGO A;  3SZT A;  2E7W A;  3G1L A;  5TJJ A;  5FKM A;  1UHS A;  4ETS A;  2ZCW A;  1BBY A;  1KU7 A;  5F08 A;  1AKH B;  1Y0U A;  4XIC A;  2DMQ A;  2BBY A;  4CDG A;  2KL4 A;  4AIJ A;  2RQQ A;  4CCK A;  3ZXS A;  2M2E A;  2MFZ A;  2R0Q C;  1SAN A;  5JHF A;  1STZ A;  3HPH A;  4ZYE A;  4KIT B;  1HBX G;  4HQM A;  3MCZ A;  1JKO C;  1W36 C;  1XB4 A;  3EYI A;  4L18 B;  1YO5 C;  2HYF A;  2W00 A;  4OU0 A;  3O8H A;  2R7O A;  2DFH A;  4V2G A;  2R7Z J;  2WB1 A;  1JUP A;  2Y69 H;  3HYI A;  1FC3 A;  5E3M A;  1GT0 C;  2DK5 A;  4EM2 A;  4N9I A;  3WTT C;  1XMK A;  4Q5S F;  3Q9V A;  2IEK A;  2X6X A;  3BR2 A;  3CUQ C;  5FRO A;  2MBF A;  4AU7 A;  2R7X A;  2VXZ A;  3WTX C;  2XV4 S;  4UB8 C;  1ZYR F;  2PQ8 A;  3F6O A;  2NVT J;  1S29 A;  1TP4 A;  3F23 A;  2QYO A;  2WB1 N;  3LSI A;  4BAC A;  1KGS A;  3DPT A;  1YW8 A;  1KYW A;  1ZH5 A;  3UNG C;  4ZH4 F;  1MBK A;  1ULY A;  3TDZ C;  3WTZ A;  1DGW Y;  3ELK A;  4DYC A;  2M34 A;  1IV8 A;  3M7G A;  1B8I A;  3HDD A;  4U0W A;  2O9L A;  1K78 B;  1I50 J;  1IUF A;  1SFE A;  4A0Z A;  2XGC A;  5HDN A;  2R7V A;  3Q0U A;  2HYG D;  2LOO A;  3MZ8 A;  2DT5 A;  2FQ4 A;  1TWA J;  2DA4 A;  4BJ6 C;  3I9V 2;  1W7P B;  5F1J A;  2DMU A;  1TC3 C;  3KET A;  4M71 A;  4EMS A;  5BPD A;  4PDK A;  3M3Y J;  1QZE A;  4IF4 A;  1JKR C;  2LY2 A;  3P5J A;  2JA2 A;  2QQ8 A;  2X6O A;  3DBR B;  3G1M A;  1X1C A;  2GLO A;  1YQA A;  2LMD A;  4A3L J;  3C7J A;  2BY3 A;  1CF7 A;  2ELK A;  1MMA A;  2DN0 A;  5EJC A;  3H3Z A;  2RV8 A;  3PIO F;  4HZF A;  5J47 A;  2P5K A;  2R7U A;  1P7I A;  2P5L C;  2LRE A;  3R60 A;  4QIW N;  2VL8 A;  3QPS A;  2L9N A;  3H9Q A;  4Y52 J;  2CUZ A;  3BG5 A;  4UY8 I;  1MSE C;  1BR4 A;  3CO7 C;  3KX2 A;  4ESJ A;  2XAQ A;  2Y30 A;  3BG6 A;  3K4M A;  5LHH A;  4D7N A;  5A2Q K;  3HHG A;  3SEZ A;  5EG0 B;  3ECO A;  2D2W A;  2M5W A;  1X1B A;  4O5V A;  5D5V B;  2YR2 A;  2EPF A;  4W1U A;  4AIH A;  3TMO A;  2EFO A;  1LKX A;  3M8J A;  3F0C A;  4XKB A;  2JA6 J;  2ZJR F;  1ON2 A;  2DJN A;  1X4P A;  1OJL A;  2GBY A;  3FMQ A;  4BHP A;  3OYN A;  1E3P A;  2F5D A;  4HDU A;  3IH3 A;  1R7J A;  1AU7 A;  4A0Y A;  4CGZ A;  3BG7 A;  4I02 A;  1BL0 A;  3F8M A;  2LDU A;  2JA8 J;  2BE5 F;  4XLE A;  4IQ4 A;  3KLN A;  1PYV A;  4P1W A;  3CC4 I;  2E34 A;  3L9F A;  2STW A;  3RKX A;  3T8R A;  5D5U B;  4AD9 A;  3I64 A;  2ZJ2 A;  1HA8 A;  2K85 A;  1RUO A;  1UG2 A;  2W1O A;  2QWW A;  4G6T B;  1MMN A;  1DPR A;  1XGS A;  4BQA A;  2XDV A;  3CD6 I;  4B43 A;  3BZ6 A;  3MKZ A;  2WBM A;  3HSR A;  2D1H A;  1GVJ A;  4ZDP A;  4ZYD A;  2BW3 A;  3KCC A;  2EIJ H;  2DQR A;  5FFX A;  3PO3 J;  2XVC A;  2COM A;  2L7K A;  2VBY A;  4HA8 A;  2A5Y B;  5LFA A;  4H0E A;  1NH3 A;  2DCE A;  2OZU A;  3ERM A;  1DP7 P;  2P81 A;  3H5A A;  5KAI C;  1M1E B;  3N97 A;  3M8F A;  1ETK A;  2PN6 A;  5TRD A;  3HPG A;  2HS5 A;  3CF5 F;  3VYU B;  2PJR A;  1U9N A;  3JAM K;  4M73 A;  3S14 J;  1I3Q J;  2WAQ A;  3WGG A;  4LB5 A;  4PSX A;  2E36 A;  2XPW A;  4RAZ A;  1JUM A;  4DGW B;  4M9Z A;  4UUS B;  5FKO A;  4LG0 B;  3VOD A;  1VZ0 A;  2HXO A;  4OIP F;  3M4O J;  3MZY A;  1RPW A;  1VI0 A;  4BXU A;  2PJP A;  3FXO A;  2ID6 A;  3WE2 A;  1YI2 I;  3HBL A;  3M1E A;  3REO A;  5EGO B;  2EZL A;  1RET A;  2H8R A;  2CWE A;  4IHV A;  3GTG J;  5ILS A;  3S3M A;  4XOP A;  3TP3 A;  3OL4 A;  3A0B C;  3IWZ A;  3I3L A;  1ERD A;  2X4H A;  2PMZ A;  3FBN B;  3GEZ A;  1HW2 A;  4JYK A;  1Z7U A;  3ZQI A;  1VQO I;  1G3S A;  2K3P A;  2KT0 A;  1HST A;  2MGQ A;  1XN7 A;  2OBP A;  3MAJ A;  2LYC A;  3OYI A;  1R5H A;  1ZRD A;  1KA8 A;  4CHU A;  3HOZ J;  3DEW A;  1WI3 A;  1MBF A;  2VKV A;  3CP2 A;  1D0Y A;  1MSF C;  4M9X A;  1YJN I;  3S2H J;  1SD7 A;  2Y9Y A;  3DPL C;  1R22 A;  3N05 A;  2RDP A;  4ZZL A;  2E1C A;  4XLA A;  5IT3 A;  2A69 F;  3ABT A;  1E0E A;  1JKP C;  4RAF A;  5ED4 A;  4F7Z A;  2DLL A;  1P4A A;  4HF1 A;  1ZLJ A;  1QNT A;  2XKO A;  2ZFU A;  4MFD A;  3OYG A;  2FJ1 A;  3V8L A;  1IN7 A;  1Y0N A;  2L7F P;  2KDZ A;  2EV0 A;  3R61 A;  3S3O A;  4CYD A;  3CP8 A;  5IT9 Z;  1PP8 F;  1BI3 A;  4R1H A;  2CV1 A;  1V5F A;  3S1Q J;  4NQW B;  4HBL A;  3DLA A;  3NRV A;  2DT7 B;  2P4W A;  3OYK A;  1MJB A;  1WVR A;  1IRG A;  4XKC A;  2D45 A;  4I09 A;  2K27 A;  3H9G A;  3DEE A;  2L4A A;  1J5Y A;  1EH8 A;  1TWH J;  4D0P A;  1HLV A;  2JA5 J;  5DCM B;  2HZD A;  3E5Q A;  2XAS A;  4CYC A;  5M3M J;  2P6T A;  2ME6 A;  2B63 J;  5FLX K;  1BI2 A;  3LA2 A;  4XRS A;  3DLL F;  1XCB A;  4A3G J;  1IO2 A;  2VKH A;  1WJA A;  5BPI A;  1KU2 A;  2XGD A;  2E35 A;  2HOA A;  3E3V A;  1XGN A;  3LOC A;  4P5O A;  2RNJ A;  1R6R A;  5E1W A;  3HSE A;  4RB3 C;  5TGT A;  2LVS A;  3MKY B;  4BEH B;  2M4G A;  2ZME A;  3I59 A;  4NUB A;  3HM5 A;  5HVQ C;  1U3E M;  1T0F A;  3PJR A;  3T8T A;  3S1M J;  5DTD A;  4D5F A;  4A6E A;  3EUH C;  5B66 C;  1A5J A;  3LA7 A;  2XSD C;  1P4W A;  1VQ5 I;  4FET A;  1X3W B;  2E1M B;  3AFH A;  2YPR A;  1RR8 C;  4M3F A;  3FM3 A;  4U87 A;  1U9O A;  2IVM A;  2ZBK A;  3EET A;  1JT0 A;  3MN2 A;  2XAH A;  4GCV A;  3JRE A;  3OMY A;  2M0C A;  4NC7 A;  1TZL A;  3A4C A;  4BE2 A;  5K7F A;  2M7B A;  3IH2 A;  2OQG A;  5J4V A;  1MNM C;  1SMY F;  1U6G A;  1JGG A;  2CV2 A;  2LLK A;  2KKO A;  3GUD A;  3GLL A;  4BDY A;  1SVL A;  3BCB A;  4XRM A;  2DYR H;  4HST A;  3K0L A;  2LF8 A;  4E7L A;  1W36 D;  2V6E A;  2EFW A;  1ZRF A;  1K83 J;  1SD4 A;  2QKL B;  1D8K A;  1FMW A;  2QKM B;  4G12 A;  3DFG A;  1ETV A;  1ZKG A;  1KU3 A;  1BC7 C;  3FZV A;  3K1N A;  5J40 A;  3B73 A;  3KPH A;  2XC7 A;  5IP6 A;  1O3S A;  1HW1 A;  3PFI A;  4HNV A;  1BC8 C;  3H0G J;  2A07 F;  4LIU A;  1XTA A;  2EZK A;  2ZJP F;  2DJI A;  2QF7 A;  4NB5 A;  2IP2 A;  1H9T A;  3ZR8 X;  4DZP A;  2YU3 A;  4JX4 A;  4YG2 F;  4UVC A;  3RZO J;  1J7K A;  4S0H B;  2QUF A;  5D4R A;  1MMD A;  1WJD A;  2QQ9 A;  5FKK A;  2ZC2 A;  2LY9 A;  2CG4 A;  4AUX A;  5L3G A;  4BBS J;  1FOY A;  5LRR A;  1TWC J;  2WY8 Q;  1FSH A;  5HS8 A;  2Z2S B;  2R7R A;  5L3C A;  2W57 A;  4HLX A;  3K2Z A;  1B59 A;  1WH5 A;  1DPU A;  1Q1H A;  1ZN2 A;  2KIM A;  2QCO A;  2R7S A;  4YFK F;  1Y8R B;  5E79 C;  3LAP A;  2CU7 A;  5FRM A;  4PSW A;  2ZO4 A;  3CUQ B;  4WCG A;  3K7A J;  2OQR A;  5IYC J;  1FIA A;  2NAZ A;  5HOD A;  3FK6 A;  1JHH A;  4C2U A;  4UXN A;  3CDI A;  2RNG A;  2G7H A;  2DW4 A;  3RKQ A;  3A03 A;  3V8K A;  5CVJ A;  1IV6 A;  4NDL A;  3H5R A;  2EIK H;  1VQN I;  4MFE A;  2BHZ A;  2BVM A;  4WXD A;  1WCM J;  2E5N A;  3HG9 A;  2FUG 2;  1QPM A;  3RSN A;  1BM9 A;  2R3S A;  4LGW A;  3TO7 A;  4N4N B;  3Q5F A;  2X6W A;  5L3D A;  1A6I A;  1QZZ A;  3SJM A;  2JSP A;  3CCM I;  1Z05 A;  1S6L A;  2Z5U A;  2BXY A;  2P6S A;  4IOA F;  1K79 A;  1T56 A;  4QLC U;  1VQL I;  4KJZ A;  2VKD A;  2HVQ A;  2FBK A;  3FIW A;  1XCV A;  3E6D A;  1Z9C A;  1F36 A;  2XF7 A;  3ZMZ A;  1TT5 B;  2IAI A;  2HTS A;  2VJ5 A;  3Q3S A;  2V7F A;  1JKQ C;  2BY2 A;  1U8B A;  4L0Y B;  1PP7 U;  1R58 A;  3ABM H;  4IEJ A;  2P0W A;  1TNS A;  4CXF A;  3K4J A;  4EV0 A;  1G8X A;  1W5S A;  3W6V A;  1I3A A;  1E17 A;  5EZH A;  1HXD A;  2NRA C;  4XSX F;  1U5T B;  3DU5 A;  3CC7 I;  2B0L A;  4IHY A;  5L3B A;  2EB7 A;  3ZMT A;  1IC8 A;  1VQM I;  1D0X A;  1KQ9 A;  2HFH A;  2KHM A;  4EVI A;  1ETO A;  1YIT I;  5K5R A;  2QQB A;  3J81 Z;  5CKT A;  4CCM A;  4M3B A;  2DOE A;  3LSM A;  3VB2 A;  1MBE A;  3JRI A;  3CCL I;  3KEQ A;  1UFM A;  4RGX A;  3I5U A;  3A0H C;  2B9S A;  4UB6 C;  4AYB A;  1A04 A;  1FYM A;  1G59 A;  4C9Y A;  4Y4R A;  3OR2 C;  4L9T A;  2V26 A;  1IRZ A;  3P7N A;  3QU6 A;  2WAF A;  4ESF A;  1DQU A;  1Z21 A;  2EK5 A;  3PNY A;  3JTG A;  5DS9 A;  3CME I;  3J80 K;  1HKQ A;  2WV0 A;  4BAY A;  5M5Y J;  2JPC A;  4J19 A;  4BE1 A;  2E2I J;  4WXC A;  4PFP A;  5FD6 A;  4GYI A;  2CGP A;  2CYY A;  2MH2 A;  1ZG1 A;  4BYY A;  1X1A A;  1O4X A;  1YHQ I;  4U88 A;  2ZSH B;  3BZC A;  4E7K A;  2LKP A;  4RGU A;  1LE8 A;  5GAH J;  1Z0X A;  3CCE I;  2NVQ J;  4EM1 A;  1Z67 A;  3ASN H;  2XRN A;  2NVU B;  3OYJ A;  4BU2 A;  3TL4 X;  2IA2 A;  2VB6 A;  3KP5 A;  4WXH A;  3ZQG A;  2YX7 A;  4ZC3 A;  2DYS H;  2FSW A;  2XAU A;  3HB9 A;  2E71 A;  1T39 A;  2QQA A;  2IPQ X;  1XS9 A;  4B1R A;  1OCR H;  5K1Y A;  1HCR A;  1VQ7 I;  1UZC A;  1YTY A;  1Z3X A;  2K02 A;  2NS0 A;  3O3K A;  2UXX A;  1G3W A;  5J3L A;  2H1K A;  4BH9 A;  2Y0S A;  5H6Q A;  4OIO F;  5K5Q A;  3T5X A;  1IG7 A;  2MLK A;  5HS9 A;  4LK0 F;  3SQN A;  3WHC A;  4AIK A;  4MIM A;  2CUJ A;  3I71 A;  2RAE A;  4ITV A;  4KIG A;  4BGD A;  4RLQ A;  2DI3 A;  2X85 A;  1TBX A;  1FIP A;  1Y6I A;  1LNW A;  3BC8 A;  1B72 B;  4OAZ A;  3PQK A;  3B02 A;  1IW7 F;  3DTE A;  4KIB A;  2F4M B;  2QBY B;  1VQ6 I;  2EFP A;  3GFM A;  2MC3 A;  2M0M A;  3DWL E;  4LOC A;  3L2R A;  1MDM B;  3Q0V A;  1Z6T A;  3E6M A;  4FIS A;  5D6E A;  1DGR M;  3A1Y A;  4MQ9 F;  2BOL A;  2JMW A;  2R7F A;  5K5O A;  3CMY A;  2PFB A;  3ASO H;  4LB6 B;  1X3Z B;  3A01 B;  1QGP A;  1IZ1 A;  2GZW A;  3MFK A;  2H8W A;  4A69 C;  2ZSI B;  3HUG A;  3AG1 H;  4M6Y A;  3JTH A;  4UVA A;  1JTY A;  4B4C A;  3GTK J;  4EQQ A;  3T1B A;  2Y31 A;  1OCZ H;  2VXD A;  3HGG A;  3QP5 A;  1OR7 C;  1MW7 A;  3BTI A;  1BIB A;  3DCF A;  3ECH A;  1OLT A;  2M30 A;  4LJZ F;  4NC8 A;  3WU2 C;  3JRH A;  5J4Y A;  1GHC A;  3KZZ A;  3PUB A;  4ZTF A;  4RB2 C;  1B4A A;  1K61 A;  4FHT A;  5ICG A;  2DMT A;  2GXG A;  4IX7 A;  5DM7 F;  2Y9Z A;  2H6C A;  3CCY A;  4HNT A;  3G2B A;  5AIP A;  2MD0 A;  2VT3 A;  2ZFW A;  3S8P A;  1T8I A;  1V54 H;  2HDW A;  4A3F J;  3NQO A;  3IC7 A;  3C2G A;  1ZG3 A;  4P9U A;  3CCQ I;  3L00 A;  2P7V B;  2JUC A;  3ZOB A;  5HLG A;  3BQZ A;  4IRG A;  5E1X A;  1D1A A;  4G6D A;  4DYQ A;  2OC6 A;  4Y13 A;  5KCM A;  4IZZ A;  2QA4 I;  4BNC A;  3WOD F;  1R49 A;  5GP9 A;  4IXA A;  2PI0 A;  2DOF A;  4GFB A;  4A3E J;  3RPU D;  4XLF A;  5D8K B;  3RPQ A;  1TNT A;  3VSK A;  3G1O A;  1MBJ A;  1I27 A;  2DMP A;  4I2O A;  2OCC H;  2VI6 A;  2BYV E;  1YOV B;  2DTZ A;  4OWR B;  1NK2 P;  2MAB A;  2QSG X;  3WE3 A;  1RNL A;  2KIU A;  3FKI J;  3HRM A;  3NEU A;  4HRI A;  2A68 F;  4LK1 F;  1KZH A;  4UUV A;  1ZQ3 P;  2BEO A;  4CZZ A;  2LBF A;  2O8K A;  1ITY A;  2QSF X;  4JK1 X;  3TKY A;  1IN5 A;  2NNN A;  4IHX A;  3PFY A;  1W7P D;  2JVH A;  1TLH B;  2VQH A;  4DBQ A;  1YS7 A;  4G7H F;  3GW2 A;  4KDP A;  3OYC A;  4FQG A;  1GV2 A;  3HTS B;  2WY7 Q;  4HW0 A;  1G2H A;  2CQN A;  3V8J A;  1WI9 A;  4HF0 A;  1Q1V A;  3I53 A;  2NYX A;  1V4R A;  2KIF A;  2HKO A;  1YYV A;  2FNA A;  1R00 A;  3RZD J;  1SAX A;  3LFU A;  3BZK A;  4QPQ A;  3TOA A;  1JHF A;  2IA0 A;  2LY1 A;  3CMM A;  4MGR A;  5CVR A;  1OQY A;  1ZR2 A;  4PJJ A;  5BOX A;  3J7Y J;  3QYB A;  3QOP A;  5F04 A;  3H92 A;  3E6B A;  1ETX A;  1JUS A;  3B6C A;  4XKW A;  3BR1 A;  4YFX F;  2KMU A;  1A35 A;  1OCT C;  4G7O F;  3DTI A;  2CW0 F;  3GO5 A;  5DV5 A;  1FNN A;  2DK8 A;  2V1U A;  5A2Q Z;  4Z2Y A;  3GFJ A;  5CQE A;  3DEU A;  1UB9 A;  4CCL A;  3LWF A;  4CH7 A;  2JUG A;  3DPU A;  2XRL A;  2AXL A;  2LD5 A;  1WQ2 A;  1APL C;  4B8X A;  4EJW A;  1U5T C;  1XG1 A;  1ETW A;  3ABU A;  4PJ0 C;  1YW7 A;  3ZQC A;  5EEG A;  2Q8K A;  3SFZ A;  1W4M A;  5LEK A;  3BG3 A;  4QPO A;  3FMR A;  3R0A A;  2F5V A;  1X19 A;  2WTE A;  1WPK A;  1USS A;  1ZGA A;  4WF2 A;  2R5Z B;  2DA2 A;  1ZLK A;  2Y75 A;  1WJ5 A;  2MYS A;  4E70 A;  5E3O A;  4ABZ A;  2H1L A;  4HG2 A;  3G3Z A;  3OIQ A;  5K7H A;  1AKH A;  4FE4 A;  4RAG A;  3AG2 H;  3WGH A;  5HNH A;  4FX0 A;  3D0S A;  4I0B A;  5D5X B;  3OY9 A;  4C2T A;  4A3M J;  3S15 J;  3FXK A;  1TQP A;  2KFD A;  2X51 A;  3BY6 A;  4KN4 X;  4MO7 A;  1N75 A;  2QVO A;  3V7R A;  2OF7 A;  4QWQ A;  3TW7 A;  5JR3 A;  4ENN A;  3RCO A;  3CJN A;  1SC7 A;  1YJ9 I;  2DDA A;  4MTD A;  2IS6 A;  1R1U A;  3W3C A;  3L2W A;  1IN4 A;  3FDY A;  3MVP A;  3D5L A;  2EJR A;  4YIF A;  1Y1V J;  1B9N A;  4F52 A;  4PGG A;  5HDK A;  4M6X A;  1N25 A;  1IDZ A;  1UMQ A;  2FML A;  1L3L A;  2O61 A;  2UV1 A;  3DKX A;  5E18 F;  3JAM Z;  3OS1 A;  4JBA A; 
#chains in the Genus database with same CATH homology
 3S1M J;  2CUF A;  5F0C A;  5DTD A;  4D5F A;  2LP0 A;  2XB5 A;  4A3C J;  1A5J A;  2NVY J;  3BTC A;  2XSD C;  3FIS A;  3K2A A;  3LSR A;  2EQR A;  2ID3 A;  4M3F A;  2XGE A;  3HOV J;  1U9O A;  1JT0 A;  3MN2 A;  3LSG A;  2E2J J;  1QVU A;  5FKN A;  3JRA A;  3JRE A;  1QPI A;  2DA6 A;  2M0C A;  2HDD A;  1IDY A;  1QRY A;  5EZG A;  3SDG A;  4A3I J;  5K7F A;  3IH2 A;  1WGX A;  1MNM C;  1JGG A;  2MG4 A;  2LLK A;  4JX6 A;  5J1U A;  2K9N A;  2NS7 A;  4C2M J;  1GV5 A;  4XRM A;  1YRN A;  2JK3 A;  1JJ6 C;  1K83 J;  1TWF J;  2CRG A;  3JRC A;  2JJ7 A;  2K40 A;  1W0U A;  4G12 A;  2E19 A;  4RBO A;  2YU9 J;  1ETV A;  1ZKG A;  3JRB A;  2I10 A;  3GTQ J;  2WAQ N;  3TED A;  2FX0 A;  5IP6 A;  2EH3 A;  4HNV A;  3H0G J;  2EZK A;  2QF7 A;  1B72 A;  3OIO A;  3PM1 A;  4DZP A;  4JX4 A;  1JTX A;  2HOT A;  2CJJ A;  2YUS A;  4S0H B;  3RZO J;  5F0F A;  5FKK A;  3I4M J;  1T33 A;  2LY9 A;  2VKE A;  4AUX A;  4C3H J;  4BBS J;  2R93 J;  5C4X J;  3BQY A;  4DZJ A;  1TWC J;  3Q0W A;  1ETQ A;  2DMN A;  2LK2 A;  1WH7 A;  3CQZ J;  1WH5 A;  1ZK8 A;  2ZB9 A;  3A01 A;  2PMZ N;  2QCO A;  5EG0 A;  2CU7 A;  3NAU A;  5FKL A;  1XC5 A;  1P7J A;  2L0K A;  1ZGW A;  1OCP A;  3K7A J;  1MBG A;  3BR0 A;  4XRS G;  1SFO J;  1RES A;  5IYC J;  3S16 J;  1FIA A;  5HOD A;  3FK6 A;  4C3J J;  5F0H A;  2VUM J;  3RKQ A;  3A03 A;  5K7Z A;  3D1N I;  1IV6 A;  4EEF G;  4NDL A;  2JWT A;  4MFE A;  2TRT A;  2ECC A;  1WCM J;  2XPV A;  3S1R J;  1ENH A;  1NK3 P;  2GM4 A;  2R5Y B;  5IYB J;  1A6I A;  3SJM A;  1MBH A;  1PUF A;  5IOZ A;  2NVX J;  1FEX A;  1S7E A;  5FJ8 J;  1DU6 A;  1T56 A;  2EZH A;  5FLV A;  2LKX A;  1GDT A;  1H89 C;  3E7L A;  3FIW A;  5IPA A;  4FE7 A;  1F36 A;  4C3I J;  2IAI A;  3Q3S A;  3JRG A;  2HI3 A;  2X9D A;  1JKQ C;  3RQI A;  4BKX A;  2E2H J;  1U8B A;  4M3D A;  4IEJ A;  5GPA A;  3BR3 A;  1NTC A;  1U78 A;  3LSJ A;  2FD5 A;  2Y2Z A;  3W6V A;  4BY1 J;  1BA5 A;  3HOX J;  5EZH A;  3BR5 A;  1FTT A;  3G1L A;  1H88 C;  2CQQ A;  4IHY A;  3QPL A;  5FKM A;  1Y1W J;  1IC8 A;  4A3D J;  1RKW A;  1UHS A;  4UUS A;  1AKH B;  5F08 A;  4XIC A;  2DMQ A;  1ETO A;  2L7Z A;  2XB0 X;  3OOU A;  2M8G X;  1FJL A;  4M3B A;  4X6A J;  2M2E A;  2R0Q C;  1SAN A;  3B6A A;  3S17 J;  1IGN A;  1MBE A;  5EGO A;  4CYC B;  3JRI A;  4A3J J;  4V2F A;  5IP7 J;  9ANT A;  1JKO C;  1VFC A;  2G0E A;  4L5E A;  2XPU A;  3SFI A;  2DA3 A;  4DYR A;  1JT6 A;  3O8H A;  1IRZ A;  4V2G A;  3GTM J;  2R7Z J;  4W97 A;  5EDN A;  1JUP A;  5E3M A;  5DS9 A;  1GT0 C;  2EZI A;  4JX5 A;  5M5Y J;  5J1R A;  4J19 A;  5JLX A;  1BW6 A;  2E2I J;  2IEK A;  3BR2 A;  2D5V A;  1O4X A;  4BXX J;  2L7M P;  1LE8 A;  1E3O C;  2NVT J;  2NS8 A;  1Z0X A;  2NVQ J;  3TW6 A;  4BY7 J;  2WB1 N;  2DA7 A;  4I76 A;  3IH4 A;  1MBK A;  3ZQG A;  2R5Z A;  4DYC A;  2M34 A;  1VND A;  2IBD A;  3HB9 A;  1B8I A;  3HDD A;  1YRN B;  3BR6 A;  3JRF A;  2DA1 A;  2HOS A;  3BT9 A;  2O9L A;  1I50 J;  1IUF A;  2XGC A;  1XS9 A;  4B1R A;  3Q0U A;  1HCR A;  3HGY A;  1BW5 A;  2FQ4 A;  1TWA J;  5IOY A;  2DA4 A;  2EBI A;  3HOW J;  5F1J A;  2X48 A;  2DMU A;  1TC3 C;  3L1P A;  5J3L A;  2H1K A;  5EF6 A;  3HOU J;  3M3Y J;  3C2B A;  4FCY A;  1JKR C;  1OFC X;  3OSF A;  1IG7 A;  2X6O A;  2JA7 J;  2MSY A;  5C4J J;  3G1M A;  2GLO A;  3WHC A;  4MIM A;  4A93 J;  4X1E A;  4A3L J;  2RAE A;  4I6Z A;  2E1O A;  1FIP A;  3CDL A;  2ELK A;  1B72 B;  2DN0 A;  2AO9 A;  4DW6 A;  3GTP J;  1P7I A;  4LOC A;  1IJW C;  1LFB A;  3GTO J;  1RKT A;  3Q0V A;  4FIS A;  1VF9 A;  3QPS A;  4D7M A;  4QIW N;  4Y52 J;  3TP0 A;  1LFU P;  2JMW A;  3BG5 A;  3CMY A;  1MSE C;  2Y30 A;  2W48 A;  5JLW A;  1JJ8 C;  3A01 B;  4D7N A;  1D5Y A;  4FTH A;  3IV5 A;  4A69 C;  5EG0 B;  3H3V K;  1POG A;  4QSH A;  4W1U A;  1JTY A;  5E3L A;  4B4C A;  3JRD A;  5M3F J;  1GVD A;  3GTK J;  3F0C A;  2JN6 A;  3A02 A;  4A3B J;  2JA6 J;  2Y31 A;  1RR7 A;  2DJN A;  3HGG A;  3BTI A;  4M6V A;  1OJL A;  3DCF A;  2GBY A;  5C3E J;  3IH3 A;  3WHB A;  5F27 A;  1AU7 A;  3JRH A;  1BL0 A;  4RDU A;  3ZQH A;  2JA8 J;  4MLO A;  5J1Y A;  3PO2 J;  1ZTR A;  1K61 A;  2DMT A;  1ETY A;  2Y9Z A;  4XID A;  1PUF B;  2HQ5 A;  3CCY A;  4XK4 A;  5C44 J;  1UG2 A;  4JP0 A;  4A3F J;  2WV1 A;  3GBG A;  3ZOB A;  3QQA A;  3BQZ A;  3FK7 A;  4Y7N J;  3PO3 J;  4DYQ A;  3O8G A;  1GUU A;  2N8G A;  5E3N A;  5GP9 A;  4GFB A;  2P81 A;  2ME0 A;  4A3E J;  1ETK A;  2CUE A;  3BTL A;  1U9N A;  1F43 A;  1X2N A;  3S14 J;  3G1O A;  1MBJ A;  3LNQ A;  2DMP A;  1I3Q J;  2VI6 A;  4QTR A;  2DTZ A;  1NK2 P;  4D5C A;  3FKI J;  2CQX A;  1CQT A;  2XPW A;  4UUS B;  1JUM A;  1MH4 A;  5FKO A;  1ZQ3 P;  4AYB N;  3GTJ J;  2HXO A;  2O8K A;  3M4O J;  1ITY A;  1HDP A;  3BTJ A;  1RPW A;  1VI0 A;  2K9Q A;  4IHX A;  1DU0 A;  2ID6 A;  3HBL A;  5IP9 J;  5M5W J;  2ECB A;  5EGO B;  2EZL A;  1RET A;  2LTP A;  1BJZ A;  1TWG J;  2O7O A;  2H8R A;  4IHV A;  1GV2 A;  3GTG J;  3HOY J;  3TP3 A;  5FLM J;  3OSG A;  1G2H A;  2K9S A;  1Q1V A;  3BG9 A;  1EF4 A;  3GTL J;  4UUT A;  4JYK A;  1I6H J;  3RZD J;  3HEF A;  3ZQI A;  2VPR A;  2KT0 A;  1X58 A;  2MGQ A;  1QVT A;  5M5X J;  2COB A;  1ZR2 A;  2R5Y A;  2MW8 A;  1X2M A;  3HOZ J;  3DEW A;  1WI3 A;  1MBF A;  2VKV A;  5F04 A;  1HOM A;  1MSF C;  1ETX A;  1JUS A;  3B6C A;  5EYR A;  2Y9Y A;  3S2H J;  4A3K J;  3BR1 A;  4BBR J;  4B3A A;  5EEA A;  1OCT C;  4M3E A;  1JKP C;  2AHQ A;  1LE8 B;  1MH3 A;  3VPR A;  3JR9 A;  2XRL A;  2LD5 A;  4MFD A;  1APL C;  2FJ1 A;  5IYD J;  1XG1 A;  2L7F P;  2KDZ A;  1ETW A;  2LFB A;  3NAR A;  2Y0S N;  3ZQC A;  2TCT A;  3BG3 A;  4AC0 A;  2HXI A;  3LSP A;  2R5Z B;  1WPK A;  3S1Q J;  4M3G A;  1B8I B;  4IHW A;  2DA5 A;  2DA2 A;  2LR8 A;  3S2D J;  5E3O A;  3ZQF A;  4ABZ A;  5K7H A;  1AKH A;  3I4N J;  4FE4 A;  1AHD P;  5GPC A;  4A3M J;  1TWH J;  1ORK A;  3ZQL A;  1HLV A;  1H8A C;  2JA5 J;  3S15 J;  2M9H A;  4MO7 A;  1HF0 A;  3MKL A;  4CYC A;  5M3M J;  2ME6 A;  1R9T J;  2OF7 A;  3TW7 A;  2B63 J;  2R92 J;  4XRS A;  4A3G J;  3UKG A;  5BNG A;  1ZR4 A;  3S1N J;  2YS9 A;  1FTZ A;  2XGD A;  1Z77 A;  2HOA A;  3MVP A;  1W0T A;  1HDD C;  1Y1V J;  3LOC A;  3HKZ N;  2NOG A;  2OPT A;  2L9R A;  1IDZ A;  1UMQ A;  2HYJ A;  2LVS A;  3HM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...