3LNQA

Structure of aristaless homeodomain in complex with dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords Homeobox protein aristaless
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3lnqA00
5IYBJ 2ECBA 3TW7A 3Q0WA 2Y30A 2H8RA 3FIWA 3HOUJ 1VI0A 4A3FJ 1NK2P 1A6IA 1GUUA 2EZKA 3BR5A 5EEAA 3IH3A 2ZB9A 1X2MA 4FCYA 4BBRJ 5GPAA 1SANA 3PM1A 4A3DJ 3JRGA 2FD5A 1H88C 1PUFA 1Z0XA 3TEDA 5C4XJ 1IC8A 4I76A 5M5XJ 1MBKA 2YUSA 3BR3A 1RPWA 3M4OJ 4DW6A 2R5ZA 5E3OA 2XPUA 4X1EA 1E3OC 1IGNA 4V2GA 4M3DA 4A3EJ 4B4CA 3RQIA 1BL0A 4BXXJ 4A3GJ 1CQTA 4A93J 1JKOC 3BR1A 4XRSG 2HOAA 3HBLA 1Y1VJ 1XG1A 1POGA 1JT0A 4DYRA 1VNDA 3OSGA 4XK4A 5EGOA 4A3IJ 2EQRA 1QVUA 2K40A 1JKQC 1RKTA 3JREA 3LOCA 1ZR2A 1PUFB 9ANTA 4M3FA 1I3QJ 2IAIA 3CDLA 5K7FA 3K7AJ 1Y1WJ 1IJWC 2R5ZB 2IEKA 4QSHA 1RR7A 4NDLA 4D7NA 4DYCA 2LVSA 1JUMA 1FJLA 3HOVJ 2CU7A 3RZOJ 3BTCA 1P7IA 4A3CJ 2LK2A 5EZGA 4BKXA 4UUSB 1TWFJ 2JA6J 3JRIA 1GDTA 3FK6A 1TWCJ 3HM5A 4XRSA 3JR9A 1Z77A 1ORKA 2OPTA 4DZJA 5K7ZA 1U78A 4MO7A 3S2DJ 2NOGA 5F1JA 1BA5A 5EGOB 2JWTA 4QTRA 3C2BA 4A69C 5M5WJ 5J1UA 3I4MJ 2DTZA 1LE8B 1VF9A 1ETVA 1DU6A 2G0EA 3LSJA 1WPKA 3G1LA 1WI3A 1IDYA 5FKKA 4M3BA 1ZKGA 2N8GA 3HDDA 5DS9A 2VI6A 1Q1VA 5IYCJ 2COBA 1F36A 1FEXA 3ZQFA 3H3VK 2I10A 2LP0A 2M2EA 5IP7J 1GV5A 5JLXA 1HDDC 2JA5J 1X58A 4GFBA 2Y9YA 1K61A 1MBJA 2XGDA 3VPRA 1ETXA 4CYCA 3MKLA 3GTOJ 3QPSA 1FIAA 2HYJA 1ITYA 1LFUP 3WHCA 1FIPA 3LSRA 1ENHA 5GP9A 2VPRA 1QPIA 2D5VA 4C2MJ 3K2AA 5BNGA 1RETA 2RAEA 4AUXA 2KDZA 1TC3C 5F27A 5FKOA 2YS9A 2DMQA 4A3MJ 1F43A 1JGGA 5IPAA 1EF4A 2DMTA 2NS8A 2X6OA 1IV6A 1WH5A 3G1MA 5FKLA 2W48A 5M3MJ 1DU0A 1YRNA 1FTTA 3O8HA 2AHQA 2FQ4A 5C3EJ 2R7ZJ 1U9NA 5F04A 4IHYA 3GTPJ 3TW6A 4CYCB 3HOWJ 2L0KA 2CQXA 3HGYA 4J19A 1HDPA 1OFCX 2WAQN 2XPVA 4RDUA 3JRBA 3OOUA 2ME6A 4AYBN 3HGGA 3LSGA 1AHDP 1P7JA 3ZQLA 4W97A 1TWHJ 2HI3A 3BTJA 3GTMJ 4FE7A 1SFOJ 2IBDA 4D5FA 2ID6A 5EF6A 5M5YJ 4IHXA 1MSEC 3S1MJ 3BG9A 3MVPA 5E3MA 3S16J 1FTZA 2XB5A 4FISA 2VUMJ 4UUSA 1H8AC 4S0HB 5HODA 1AU7A 5IYDJ 4JX6A 1OCTC 1ETWA 4MIMA 5IP6A 1HCRA 4MFDA 1YRNB 1B8IA 3G1OA 2JMWA 5E3LA 1NK3P 4X6AJ 3HKZN 1T33A 1HLVA 1ETQA 4UUTA 1A5JA 5F0CA 5F0HA 1LE8A 2LTPA 2O9LA 3Q0VA 4FE4A 2E2IJ 4FTHA 5J1RA 4B3AA 2X48A 2L7MP 2DMPA 3DCFA 4DYQA 1GVDA 3ZQCA 2HXIA 2XSDC 3RKQA 4JP0A 2CUFA 2NS7A 1X2NA 3S15J 1QRYA 4M3EA 2ECCA 2DA5A 2FJ1A 1HF0A 2NVYJ 1ZTRA 3SFIA 2E1OA 2DJNA 2GBYA 3HB9A 4QIWN 3JRHA 1AKHA 3JRAA 3BQZA 1ZR4A 2EH3A 2NVTJ 1B8IB 4BBSJ 4C3IJ 2B63J 2E19A 1H89C 1MNMC 5JLWA 5FKNA 1WCMJ 2AO9A 2LFBA 3D1NI 3MN2A 2O8KA 2CUEA 2R93J 2FX0A 4EEFG 3A02A 1JUSA 3O8GA 2L9RA 2WB1N 2M34A 2M0CA 1QVTA 2VKVA 2MG4A 5FLVA 1TWAJ 2NVXJ 3HOYJ 4JX5A 2DA6A 1GV2A 2DA2A 4G12A 2H1KA 5M3FJ 3CCYA 1JTXA 3ZOBA 4MFEA 3H0GJ 3SDGA 1AKHB 4D7MA 1MH3A 2HXOA 4Y7NJ 3JRDA 4AC0A 4HNVA 1S7EA 3Q3SA 5DTDA 5IOYA 2HDDA 1I6HJ 1MBEA 2KT0A 3BT9A 2JJ7A 4W1UA 2DA3A 3I4NJ 3S14J 1XS9A 3QQAA 1XC5A 4Y52J 2VKEA 1BJZA 2LD5A 3SJMA 1MBFA 2EZLA 3JRCA 4XIDA 2JN6A 3FISA 1D5YA 2HOSA 1APLC 1UMQA 1WGXA 2XPWA 3IH2A 2K9SA 3IH4A 2DMNA 1MBHA 3FKIJ 1BW6A 1JUPA 3W6VA 2QCOA 1MSFC 1K83J 1LFBA 3GTGJ 2JA7J 1G2HA 2JK3A 4M6VA 2L7ZA 2TCTA 4IHVA 3BG5A 4B1RA 4D5CA 3S17J 2CJJA 2M9HA 3BR6A 2XGEA 2R0QC 2EBIA 3LNQA 1JKPC 1IG7A 2HOTA 3DEWA 1U8BA 2WV1A 1OJLA 1UG2A 5C44J 2HQ5A 3PO2J 2MGQA 4ABZA 5J1YA 2JA8J 4L5EA 5EZHA 2DMUA 1JKRC 1ETYA 4LOCA 2YU9J 2LKXA 3S1RJ 1IRZA 1I50J 5E3NA 1ZGWA 3HOZJ 3NAUA 2MW8A 5IOZA 5EG0A 1TWGJ 2X9DA 2LR8A 5FKMA 4RBOA 4A3KJ 3GTJJ 2CQQA 3GTQJ 2K9NA 2GM4A 2DA1A 2DA4A 5C4JJ 3S2HJ 4C3HJ 4BY1J 4DZPA 4I6ZA 3CQZJ 2ELKA 3B6AA 3ZQGA 4C3JJ 1B72B 5EYRA 5GPCA 2LLKA 3OSFA 3F0CA 1ETKA 1GT0C 3Q0UA 3JRFA 2Y31A 4IEJA 5K7HA 3L1PA 2TRTA 4A3JJ 2Y9ZA 4A3BJ 4M3GA 2XB0X 3S1QJ 3WHBA 1BW5A 3BQYA 5J3LA 3RZDJ 3ZQHA 5EG0B 5FLMJ 2XGCA 5EDNA 3QPLA 3S1NJ 3BTLA 5IP9J 3IV5A 1U9OA 2EZHA 3BG3A 1JT6A 3GBGA 2M8GX 4MLOA 5F0FA 3FK7A 2L7FP 2R5YA 3TP0A 3HOXJ 3CMYA 1RKWA 5FJ8J 2E2HJ 3A01A 3TP3A 2NVQJ 1RESA 2Y0SN 1NTCA 2ME0A 1OCPA 2OF7A 1HOMA 1JJ8C 1IDZA 2XRLA 3E7LA 1B72A 1ZQ3P 2GLOA 3GTLJ 3M3YJ 2CRGA 4IHWA 2P81A 3NARA 2O7OA 2DN0A 2PMZN 2MSYA 1WH7A 3HEFA 2LY9A 2ID3A 1MBGA 1UHSA 4XRMA 2QF7A 1W0UA 3BR2A 3ZQIA 4JYKA 2E2JJ 1W0TA 2R5YB 4JX4A 4BY7J 2EZIA 3OIOA 3UKGA 3GTKJ 1MH4A 2Y2ZA 4XICA 2R92J 3A01B 1IUFA 1ETOA 3B6CA 5F08A 3A03A 3BTIA 2DA7A 4V2FA 1T56A 1VFCA 2K9QA 4A3LJ 3PO3J 1O4XA 1R9TJ 3LSPA 1ZK8A 3BR0A 1JJ6C 1JTYA
chains in the Genus database with same CATH superfamily
4L9NA 4P9UA 4ZTJA 1K4TA 1FX7A 2DK5A 4WWCA 2O3FA 4A3FJ 1NK2P 3LSMA 4HOBA 4XNFA 5LRSA 1X1CA 2CWEA 1OR7C 1UB9A 2ETHA 2EZKA 3DPUA 2UXXA 3BC8A 3OWTA 1RUNA 3IH3A 3QP6A 2XASA 3K4MA 2Z16A 4RLQA 5DUIA 1KQ9A 2KJBA 1SANA 2LMDA 3PM1A 4IF4A 5H20A 3RCOA 1H88C 1TQPA 3B02A 1Z0XA 3TEDA 4BE1A 3OS2A 1IC8A 2EV0A 2DFFA 4I76A 5M5XJ 3M4OJ 3GWZA 1W5SA 4GXOA 2KLOA 2VJ4A 1B6AA 4EJVA 1K79A 2QQ8A 2W4SA 3CCJI 3TQNA 1ZRFA 2FQ3A 4V2GA 4UY8I 1D0YA 1T0FA 4GYIA 4BXXJ 2L4MA 4RB0A 1U8RA 3KCCA 4XRSG 2GXBA 4E4HA 3CMAI 1YFHA 4HA8A 2PMZA 4EMSA 3DWLE 1Y1VJ 2M1BA 2FA5A 1POGA 3JW4A 3FWEA 4FETA 3QAHA 3LA7A 2KP6A 5DD8A 3L2UA 3IHUA 2F5DA 1LPQA 1V5GA 3RPUD 1Y0UA 2L9SA 4E7IA 1D1CA 4HF2A 4G7OF 2HKOA 1IJWC 1FWZA 2D1HA 2HDWA 2IAIA 1Y1WJ 1XMXA 2LSOA 2XROA 1WJFA 2X4HA 4NDLA 3F21A 4I02A 1FJLA 5CQGA 4U0VA 3RZOJ 1BJAA 5DCMA 3BTCA 5KVRA 1TTYA 3D5LA 5EZGA 3CCLI 1X4OA 5L3CA 2ZC2A 1R71A 1TWFJ 3HPGA 3I58A 5L3FA 5HS7A 2L5QA 2A05A 4DZJA 1WSUA 4YG2F 2OZUA 4BXFA 3IWZA 4XR6A 1BA5A 4P5OA 4Z6YA 3HSFA 4HG2A 1S3JA 2GIVA 4QTRA 3DTKA 3E97A 3AL0C 2QQAA 5J1UA 1MMDA 3E3VA 4KITB 2K85A 1O3RA 1EH7A 1F4KA 1ZN2A 5HS9A 2RN7A 4CYDA 1VF9A 2CGPA 1ETVA 1DU6A 3CCRI 2DQLA 3LFUA 4XLFA 1GHCA 2LG4A 1HW5A 3LSJA 1WPKA 1Z7LA 3BPXA 3BZCA 2XAQA 4XOTA 2KIUA 1Q1VA 3H35A 3ZQFA 1BBYA 4MEYF 2LP0A 5DCMB 3BLYA 4OIPF 5JLXA 4E7LA 1FOYA 1I1GA 1SC7A 2LH9A 2V9KA 4B8XA 3L2CA 2XGDA 2F2EA 1ETXA 2VQLA 3M8FA 1ZG1A 2ZJRF 4I99C 1FBUA 3ABKH 2EWNA 4LGWA 1BC7C 3QPSA 1FIAA 3SDBA 4B47A 4ESBA 4L0ZB 1LFUP 1TT5B 3GLXA 3DKYA 1ENHA 2H8WA 5GP9A 2EFOA 2K9MA 4CCLA 4EJWA 3CF5F 3JAMK 1KQ0A 3K2AA 1RETA 3JTGA 3VWBA 1BI3A 1FYKA 3MKZA 2EJRA 2DO7A 2KDZA 4ESJA 2L02A 3JCUC 2YS9A 1X3WB 4ITVA 2Q0OA 1F43A 4R79A 1A36A 2DMTA 2DLLA 1IV6A 3G1MA 5E79C 4ZYAA 2DJIA 4V19K 1P2FA 3H9GA 1Y39A 1YRNA 2YSRA 1ZELA 3EDPA 1AWCA 4M73A 3RDIA 3W2AA 3HGYA 4J19A 3KP6A 3LAPA 2UZKA 2XAUA 3ML6A 1FBQA 4DNCA 4PJNA 4ZZDA 1BI0A 1XMAA 1C0WA 4NBQA 3ZQLA 4W97A 1WVRA 2EFPA 3I5UA 1T0FC 2IBDA 2PX9A 5ICFA 5M5YJ 1MSEC 3SZGA 3BG9A 3VYUB 3S1MJ 3A4CA 4ZJZA 5LGTA 5E3MA 3FBNB 3S16J 2VUMJ 4UUSA 1H8AC 1CGPA 3F8BA 4BL0B 1OCTC 2VASA 4HF1A 1HCRA 4UNOA 4MFDA 1YRNB 2CV1A 5D4RA 2FNAA 5CVJA 1D8JA 5E3LA 1E2XA 3K4CA 1ZRCA 3CF2A 1NK3P 4GYGA 1ZH5A 1T33A 1KA8A 1HLVA 3OL4A 2IA2A 3K4JA 3P5JA 1S29A 3ECOA 3HSRA 5H2FC 5F0CA 2FF4A 4BU2A 2UUZA 4KNYA 4WCGA 3QU3A 3ZQCA 3DTIA 2XSDC 2QYOA 2NS7A 1ZYRF 2WWYA 3K9TA 4MTEA 2HNHA 1WI9A 1OCOH 2Z2SB 5D5WB 4QIWN 3JRHA 3BG6A 1JGSA 2KISA 3GZ6A 2EH3A 1S72I 3WE3A 4C3IJ 3PIPF 2DTRA 1SD7A 2LYCA 1OLTA 3IC7A 1MNMC 3TO9A 5FKNA 4BJTA 2L7KA 1YJ9I 4L9TA 1HA8A 3MD2A 1VQ8I 3MN2A 2O8KA 2FX0A 4N9HA 2DCEA 4LITA 4ASNA 3CZ6A 3WE2A 1SFXA 2L9RA 2WB1N 2M34A 2W1OA 4AM3A 1QVTA 3ABTA 2QWWA 2VKVA 2XSJC 1HW2A 2W57A 1GVJA 2OU2A 3GW2A 4UVBA 5B1BH 2H1KA 5M3FJ 2R7XA 3K0LA 2OV7A 3QYEA 4LIVA 1MMSA 1JTXA 2STWA 5KK1A 3S8PA 5HS8A 3RPQA 1HSTA 1QA6A 4MFEA 3H0GJ 3SDGA 4D7MA 2ZJPF 5ED4A 1V5FA 2XVCA 4BE2A 2KJCA 4KUMA 2QBYA 2J5OA 5DTDA 4BAYA 1QQIA 4IZZA 2E7XA 4XN3A 3CLOA 2X1DA 4G6QA 3OY9A 2NVUB 3ECHA 2G7UA 4HEA2 4CSWA 1IN5A 2DFHA 3S14J 3CC2I 2P7VB 1FC3A 4Q5SF 2AXLA 1Z67A 2HTSA 3QQAA 2VC1A 1XS9A 3CCVI 1E17A 5DDGA 1E0EA 5ERIA 2EZLA 3ZMTA 3GVAA 1SAXA 3IH2A 1NH3A 2XAFA 3IH4A 4EM0B 1R5HA 2P6TA 3W6VA 1ZAOA 2KZGA 3KETA 1LFBA 1R6RA 2WADA 1YLFA 1YOVB 2QBYB 3TGNA 5FB2A 4CCJA 2TCTA 5D6EA 5AONA 2LRDA 1SVOA 4HAMA 1WWXA 3BG5A 3DQVC 4B1RA 2CJJA 4PZJA 2M9HA 1TQMA 2ZFWA 3TOBA 4IOCF 2R7DA 3NQOA 3QP5A 5GADJ 3J7YJ 2DPDA 5L3BA 1KYZA 3LNQA 1IG7A 3W6JB 3SEZA 4NC7A 4WXHA 2WV1A 4N0BA 3S2WA 1VQ9I 5JR3A 3CC4I 4ABZA 4FQGA 3BJ6A 4NB5A 5EZHA 1O7LA 2DFEA 1I39A 3T8TA 5TJJA 4XOPA 3IAM2 2XDVA 1UHMA 5ICGA 2LKXA 3S1RJ 1PP7U 1IRZA 4O6JA 5FLXK 3F8MA 4ZH4F 4KN4X 2EFWA 4B43A 1X19A 2QQ9A 4XKVA 3C7JA 2VJIA 1QZYA 1R4NB 3ISPA 4A3KJ 3GTJJ 1KU7A 1B9NA 1ULYA 1RIOH 2MLKA 2EPFA 4PGGA 4FX0A 4BY1J 4I6ZA 1YE9A 2W00A 4C3JJ 4IO9F 1BI1A 2ESHA 4L9VA 2VOPA 5D6FA 1W5CC 3UR3C 3I0TA 3TKYA 1SFKA 1X1DA 1H9TA 2HQAA 2RNGA 3OR2C 5TISC 1K7AA 3L1PA 1MW7A 2TRTA 4A3JJ 3K4LA 4XONA 2XB0X 1LNWA 2L54A 2X6WA 3NWTA 4UV8A 1J0RA 2YU3A 4G6DA 3DP7A 2XGCA 4HYEA 2GA2A 1N25A 3S1NJ 3L2WA 3ZQ7A 3HC7A 2LF7A 3WTSC 1XGOA 2GZWA 1X1AA 1JT6A 4MLOA 3FK7A 2L7FP 4WX9A 3IL2A 1LJ9A 3BZKA 1RKWA 5FJ8J 3J80Z 3H36A 4M9SA 1T39A 2LNBA 5HDNA 2QGUA 2NVQJ 3E6CC 3KEQA 1NTCA 4BQOA 2ME0A 3N97A 1OCPA 4WK8F 2OF7A 1IRXA 1JJ8C 4RAGA 2JZYA 2XRLA 2DYRH 2QQBA 2WA0A 1ZQ3P 2GLOA 1Y8QB 3VSLA 1Z21A 4LK0F 2O7OA 1UELB 3BZ6A 1E3PA 1YQAA 5A2QZ 2P0WA 4ZYHA 2QF7A 2V26A 3BR2A 3L7WA 4XRMA 3DLAA 4JYKA 2E2JJ 1W0TA 1M1EB 4JX4A 3G4SI 1P4WA 2VBZA 2VKDA 4GRIA 3S32A 4XICA 1Z7UA 3B6CA 3BTIA 3FZVA 3CO6C 1OCZH 2DA7A 2BHYA 1KQ8A 1TL8A 3DPTA 3CDHA 5K1YA 1XTAA 3LSPA 1WJ5A 2F6CA 2PI0A 3BR0A 3GYHX 1JJ6C 1VQ6I 2PN6A 3CC7I 3TW7A 3Q0WA 3SXYA 3F8NA 2H8RA 2K4JA 2V9PA 1VI0A 2QSHX 4M74A 1G8XA 4Y3OA 5FRNA 3PUBA 1J9IA 4IQJA 5HLTA 1MGTA 3BR5A 4C9YA 5DV5A 3K70D 3V4GA 4BBRJ 2FBKA 5F6FA 3K4KA 2V6CA 2M30A 4LD5A 3JRGA 3AKZA 4A3DJ 1FY7A 3FX3A 3MKYB 2IA0A 2XC7A 3EUHC 3KPHA 3OL3A 4G94A 3U9GA 2ZJ2A 5EEHA 1MBKA 2QSFX 5J8CA 1FNNA 2R5ZA 5FO5A 1FP2A 3HOSA 1X4PA 4M3DA 4A3EJ 4B4CA 2BE5F 3WODF 1Y0NA 3MZ8A 1RZ4A 3I56I 1P4XA 2IVMA 4A93J 3BR1A 2GA1A 2HWVA 3R61A 3MQ0A 2X85A 4RGRA 3HBLA 3R4KA 4EQQA 2OUMA 4BJ6C 1P6RA 3ROUA 3IRRA 1GXPA 1XG1A 3CCEI 5LHIA 1JT0A 4DYRA 4YIFA 2DFIA 1VNDA 3OSGA 2L9NA 4XK4A 5EGOA 3A2KA 5H6QA 2K40A 1RKTA 3FM5A 3V7RA 3H5AA 1IN7A 3ABMH 3BCAA 1I5ZA 4A5MA 1EH8A 3EQLF 3RQ4A 3WU0A 2QEXI 4F7ZA 2PQ8A 3K1MA 2EV6A 2R5ZB 1UAAA 4E7JA 3SEQA 3HOVJ 2ZSIB 5D5UB 2GOMA 3P9IA 3OYHA 4A3CJ 1P7IA 2LK2A 2LREA 2VT3A 3F6VA 4BKXA 4MGRA 3MZHA 2JA6J 1H9GA 1K6YA 3FK6A 3HM5A 4UVCA 1R5GA 1Z77A 1MDMB 3W3CA 1U78A 4YIIA 3GFMA 2M7BA 2NOGA 5F1JA 4WXCA 3ZMVA 2PBIA 5EGOB 1DP7P 1JE8A 2JWTA 3GEZA 3KE2A 3FXOA 5JVGF 3SYTA 2O6GE 5IT9K 3AG4H 1OKRA 5M5WJ 3ZCOA 2JRTA 2KIMA 4I09A 5JHUA 3CUQA 1T98A 4PJJA 3RYPA 1FYMA 3G1LA 1LB2A 2QKMB 1WI3A 1WJAA 1U0JA 5FKKA 2A5WA 4M3BA 2N8GA 2FRHA 3BCBA 3HDDA 1YG2A 3MMYB 1F36A 2M45A 3G71I 1FEXA 5CLSA 5J40A 3OYCA 3H3VK 2FXAA 2I10A 5IP7J 3UNGC 1VTNC 2HKXA 1OISA 3LWFA 4C2TA 3E6MA 3GTOJ 1U3EM 3FDYA 1XSDA 4HNTA 1F5TA 3OYIA 1RUOA 1ITYA 2UV1A 1D5VA 3LSRA 4BDZA 1PJRA 2AS5F 4C2MJ 2QLZA 3SQNA 5BNGA 3CUQB 2X6XA 2X51A 2L4AA 4KMFA 2KKOA 5F27A 2YPRA 2CYYA 2DMQA 4A3MJ 3OYDA 3J81Z 2JT1A 3WTYC 3E5QA 4CCKA 3OMYA 1EF4A 2ELJA 4KA4A 1WH5A 4Q48A 2HVQA 1WJBA 1P9QC 3O8HA 3VYTB 2NYXA 4Y17A 5F04A 4I0AA 3HOWJ 2L0KA 2CQXA 1BOAA 1YIOA 1S5LC 1HDPA 2E36A 2L9VA 1ONVA 2XPVA 2JTVA 3E6BA 2QUFA 4BUPA 3DKWA 3BJAA 3WU2C 3GZNB 5J8FA 4XQFA 4AIJA 1Y8RB 1TWHJ 5ILSA 2HI3A 3BTJA 2EFQA 4FE7A 1MMGA 1SFOJ 3ZXSA 4IHXA 5EF6A 4HLYA 1D0XA 1I3AA 4FISA 2HZTA 4E7HA 3OYNA 1AU7A 1J7KA 4I01A 1ETWA 2Y48A 2BVLA 3OYGA 2UXNA 2JMWA 1IZ1A 3V8LA 5JHFA 3DBRB 1WFXA 4A0XA 4BQNA 3HKZN 4QLCU 3HHGA 4KT5C 4D0PA 2BVMA 5GAGJ 3GXOA 3DXJF 1A5JA 3RTRA 1B9MA 2IGMA 4BDYA 1Z9CA 2O9LA 4NC6A 5E8GA 5J1RA 2MC4A 5E8IA 4B3AA 3OR1C 4IX7A 3I9V2 1XGMA 2DMPA 2IGKA 3DCFA 1XDUA 4J00A 2HXIA 1R00A 2CUFA 1X2NA 4S04A 1DGWY 3RKXA 2ECCA 1AOYA 1ZTRA 1VQNI 2DJNA 3HB9A 3ZGKA 3BQZA 2JVGA 4UHTA 2F4IA 1ZR4A 1FT9A 2NVTJ 1QZZA 2VE9A 4BBSJ 4I2OA 1H89C 3JAMZ 3JSPA 1VQ5I 3OYKA 2CUZA 3CUQC 3U1KA 1MJ9A 2A3SA 3Q9VA 2BYVE 5LGNA 1DQUA 1Y56A 2MYSA 3V42A 4CCNA 1W1WE 2JSPA 3L2VA 1O3SA 5IY5H 4NUBA 1A6QA 3OYJA 2MG4A 2YX4A 4D1QA 2DA6A 2F5FA 4IJAA 4G12A 2IW5A 3ERMA 4PJMA 4CUGA 1EJ9A 1YTYA 3CCYA 3G3ZA 3S93A 2DODA 1FZPB 3ZOBA 4ZDPA 2PJPA 1J2XA 2D45A 3BPVA 3ASNH 5DCFA 4AD9A 3I3LA 2Z1DA 2KIFA 5B66C 4RGUA 1R5ID 4HNVA 5CKTA 5LGUA 1IRGA 1OCCH 2E1NA 5IOYA 1I6HJ 2JUCA 1HXDA 2KT0A 2P8TA 1A04A 1GLNA 2DDBA 2Z33A 1D1AA 3L2RA 3BT9A 2V1XA 3CJTB 2DAOA 4ENMA 2CSOA 2JJ7A 5D8KB 3M8JA 2JQ7A 2E35A 1QHHD 1QPMA 2VE8A 4FX4A 3I4NJ 1IXSB 1S7OA 4PUSA 4F92B 5LHGA 2IXSA 1XC5A 5BMZA 4GO1A 2VKEA 4ENKA 2LKSA 3SJMA 2PMHA 1REPC 3FISA 3GFLA 1WGXA 4CGZA 2IS4A 2K9SA 2B0LA 2DMNA 2QVOA 3EETA 1VQMI 3ERED 1UCRA 4OU0A 1MSFC 1QBJA 4IRGA 4QWQA 2JA7J 2JK3A 4NC8A 3HTUA 2L7ZA 5DEQA 3FXMA 3QPHA 1F1ZA 5EEGA 5CJ9A 2O8XA 1Q1HA 2R0QC 4XL9A 4U87A 1JKPC 1D3YA 2HOTA 4F93B 2WB1A 1OYYA 3PNYA 1U8BA 1OJLA 4DJAA 4IPAA 2R4GA 4U0YA 3CUOA 3K70C 3F6OA 3D5SC 2BBYA 3H0DA 3L9FA 1MMAA 3A1YA 4IKFA 2HYGD 2VL8A 2KHMA 5E3NA 3HOZJ 4EATA 5IOZA 2FU4A 1TWGJ 2CW0F 5HDKA 2OC6A 2MH2A 2KL4A 2LR8A 3FHNA 4CCOA 4BNCA 2VN2A 1WJCA 3OS1A 3J7ZI 1IXRC 4A6EA 2P4WA 3H92A 1SD4A 1G4DA 3VSKA 4F91B 3WU1B 3SHFA 1TZLA 4YELA 1OYWA 1O7FA 3LSTA 3TO6A 2M4KA 4PK4A 5L3GA 3ZPLA 1W5TA 3HHHA 2O5RA 2ZKZA 4KIGA 2BY0A 3Q0UA 2D1VA 5K7HA 1X3UA 2R7RA 1YYVA 5KNLA 2Y9ZA 1CF7B 4HLXA 1G6NA 2MA3A 4A3BJ 4DBRA 3C3WA 2VBYA 5J3LA 3RZDJ 1MKMA 5FLMJ 5J4YA 2V7FA 5D5VB 5IP9J 1BR4A 2DOEA 3HUGA 4RB2C 2M8GX 4WXDA 3ZMDA 4KYWA 4MNUA 1QHGA 2V79A 3BG7A 2H27A 3TP3A 4YRVA 2D2WA 3AG1H 2Y0SN 4KMUX 4LB6B 1XMKA 3R0JA 4YFKF 4KFCA 5HDGA 2UWMA 5HNHA 1IDZA 1TBXA 1VQ4I 2CO5A 1D8KA 2STTA 2DW4A 3E7LA 1B72A 1TP4A 1WJEA 2CRGA 1KYWA 1ZARA 4CZZA 1H0MA 3CJRB 2P81A 3NARA 2I8DA 2DN0A 1JHHA 4G9YA 1WH7A 3HEFA 2LY9A 4GGGA 1FOKA 3LSHA 1XGSA 1UHSA 4YEJA 4OIRF 4LLNA 5JVTA 3HUGB 3ZMUA 1QGPA 2EZIA 5B3SH 4M9XA 2HDCA 1MH4A 3DPLC 3RYRA 3BOQA 4PDKA 1YW9A 3MAJA 1T56A 2K9QA 4E7SA 3F3XA 1O4XA 2P7CB 2R7TA 4BEHA 2DBBA 1JTYA 1B72B 5FFZA 2ECBA 1USSA 2Y30A 2GXAA 2HQNA 2BV6A 3FIWA 3HOUJ 4X0GA 2IPQX 2ZO4A 4UV9A 2FE3A 1A6IA 1GUUA 3EYYA 4AIHA 3K1PA 4RMNA 4HBLA 3LMMA 3FMSA 5CVIA 4FCYA 3CCMI 2ZMEA 3K10A 4XLHA 2FD5A 1LEBA 2Y75A 4AIKA 2VONA 2LKPA 2VJ5A 1PUFA 4N4OB 4HQEA 4HDVA 3CMMA 3EUHA 3KEOA 2LC2A 4Y33A 3KX2A 4DW6A 2KRCA 2LY1A 5E3OA 2OQGA 3HG9A 4BEHB 5JI6A 1IGNA 4P9FA 4RLFA 3RQIA 1BL0A 2J5PA 3O3KA 2HQRA 4ETSA 5CVVA 1JKOC 1P4AA 2CMPA 1ZGAA 2WY8Q 3E6DA 5LBQA 3CP8A 4HRIA 4OIQF 2ZXHA 1HKSA 3F9KA 2F4MB 4IRIA 4A3IJ 2EQRA 2ZMEB 3E5UA 3GF2A 1JKQC 1ZLJA 1FMVA 2BEOA 3QU6A 3RI4A 2NXNB 3WTTC 1ZR2A 3TBIA 2FOKA 2OJED 1PUFB 4LLGF 2PJRA 2MD0A 3NEUA 2KRHA 4M3FA 3S3NA 3CDLA 4EJOA 3K7AJ 4Y4RA 2O03A 4QSHA 4IQ4A 2GIZA 3KYDB 2GXGA 1YITI 2ZFUA 4D7NA 4DYCA 4NHJA 1JUMA 2DXIA 1J59A 2CU7A 1EV7A 2LDUA 4P55A 1ZHFA 4BHPA 3V8JA 5HVQC 3R0AA 3BY6A 2ESNA 3I54A 2A6EF 3TDUC 4CICA 1TWCJ 5E17F 4XRSA 1BR1A 2CW8A 1W4MA 4DQ2A 1ZLKA 4GDFA 2RC4A 4MO7A 2BY2A 4XSXF 3HXLA 2O0YA 2VT2A 4CCMA 3C2BA 4A69C 3K1NA 2XRNA 1RC9A 3I4MJ 1MNDA 2Y69H 4U7DA 2PJRB 1LE8B 5LHHA 2ZXJA 2G0EA 2E71A 2HTJA 4AYBA 1IDYA 3WGHA 1FSEA 3BDDA 2CQNA 4KIBA 2VI6A 5IYCJ 2COBA 2M5WA 4OAZA 2XF6A 2GAUA 2E7WA 2M2EA 1GV5A 2R7OA 5F64A 5BPIA 1X58A 2JA5J 5L3DA 1YJNI 4GFBA 2VC0A 1MBJA 1QU3A 2IS6A 2V4JC 3MKLA 4UXNA 3KZZA 2F5EA 2XGXA 3HIFA 5CQEA 3QWLA 2HYJA 2HGCA 3HRSA 3WHCA 4AWXB 2CS3A 3GO5A 2BOLA 4PGHA 4RGSA 2RAEA 3MFKA 1T8IA 3EYIA 2Q8KA 1YHQI 2IA1A 4E7KA 1TC3C 1LKXA 3FMRA 2DYSH 3WG9A 4JQFA 4B44A 1MZBA 3PSFA 4ENJA 2BW3B 1JGGA 5IPAA 3FM3A 3KLOA 2NS8A 2X6OA 2XKOA 5FKLA 4OWRB 3KIOA 3G73A 2W48A 1IN6A 2ZMEC 5M3MJ 2AHQA 2FQ4A 2HPIA 2RNJA 4IHYA 3GTPJ 1FYLA 2XV4S 1SD5A 1VZ0A 3M9AA 2DOFA 1ON1A 1OFCX 2QM3A 2X1CA 2XAJA 1K78A 2KZVA 3L09A 1IW7F 4FT8A 4CDGA 2VQGA 1XDSA 2ME6A 2CFOA 4AYBN 3LSGA 1AHDP 2DQRA 3IWFA 3VEPA 3F22A 2ID6A 2QSGX 1WQ2A 2O61A 2ZBKA 1B1BA 1OCRH 3MVPA 3AFHA 5DM6F 2XB5A 3KYCB 1ZG5A 5KCMA 4IRHA 1T2KA 4S0HB 1S9HA 4JX6A 5IYDJ 1W7PA 5GAHJ 4MIMA 4FHTA 5D5XB 5IP6A 1MDMA 1B8IA 4OAYA 4HPQA 1DP3A 4X6AJ 3K2ZA 2IT0A 5DYMA 4KIFA 2H6BA 1K78B 3OS0A 2ADUA 4N9IA 2F5VA 2I5UA 2XF5A 2VXZA 3E0JB 3NRVA 4FE4A 4UB8C 3CDIA 1YW8A 4FTHA 4HF0A 2L7MP 3QOEA 1USTA 4HX4A 4HSTA 4DYQA 1GVDA 5K5OA 2X0LA 2VJJA 2EK5A 4LLLA 1LFPA 2DOAA 2HZDA 1HQCA 2RQQA 3RKQA 4JP0A 3W2VA 3COAC 2FMYA 1V55H 1G3WA 3S15J 1QRYA 4M3EA 2A61A 2CG4A 1EA3A 2K86A 2NVYJ 4QPOA 2A6HF 3FHZA 3SFIA 3OYFA 3TMOA 2X1EA 3T5XA 4CH7A 1W7PB 1LDJA 3JRAA 1UZCA 1B8IB 2B63J 1FBSA 2E19A 1ZG3A 2ICWG 2G7HA 1WCMJ 2K4BA 1KU9A 1YS6A 3DU6A 2PEXA 4M72A 2VIXA 2OTLI 2CUJA 2E5ZA 5GAEJ 2DI3A 2PG4A 2EA2A 2CQKA 1IN8A 3PQKA 5D4SA 4FASD 4WF2A 3ABUA 3DV8A 1IO2A 3ZN1A 2X6YA 5FLVA 2NNYA 1DPUA 4PSWA 2NVXJ 3HOYJ 4HDUA 4IHTA 4AVPA 1MJAA 2DA2A 4R1HA 1SEUA 2B9SA 1A31A 1BIAA 3KP2A 1YX3A 1O3QA 3WGIA 3DEUA 3FXUA 1LUJB 1Z6RA 3SZTA 2HXOA 1IRFA 4Y7NJ 1P92A 1HC8A 3JRDA 5J47A 1S7EA 4RAZA 3DTEA 2HDDA 3Q5FA 2CFXA 2KPMA 4XKWA 5LLQA 3HKZA 1XX5A 1MJBA 4HNUA 1JHFA 4EJTA 4LB5A 1E3HA 4BHCA 3F23A 1ZGJA 4W1UA 4P96A 2DA3A 3PNTA 3BROA 4ZDLA 2HVRA 1R4MB 4IXAA 3P9KA 3CCUI 2OBPA 3K6GA 2HS5A 3CO7C 4Y52J 1HKQA 3AG3H 4EVIA 1MBFA 2HOSA 3KZIC 4UB6C 4KN7X 1D5YA 1KU2A 3MCZA 4UUVA 1UMQA 2BGCA 2XPWA 5E20A 1ODDA 2PLYA 5FROA 3FKIJ 4OMZA 1JUPA 1XCVA 2QCOA 1K83J 1DGRM 1G2HA 4U0WA 4M6VA 1DUXC 3Q9SA 4IHVA 4D9JA 4PFPA 2NNNA 2FBIA 3FXLA 1VQKI 3D5RC 4XORA 3S17J 3BR6A 3A0BC 1TLHB 5TGTA 1RR8C 2XGEA 3RSNA 2EBIA 4ZDOA 1S8NA 5K5RA 3GZ5A 2JPBA 3SFZA 1J09A 3H9JA 4EJUA 1LVKA 4KISA 3HRUA 2CQ7A 1UG2A 4F3QA 2HQ5A 2M8EA 4MHGA 5GTHC 5C44J 1VQPI 3PO2J 1V3FA 3BWGA 3F8FA 2JA8J 1JKRC 1MNEA 5LEKA 5CVRA 1RNLA 3OYMA 1ETYA 1TW2A 4XKCA 2R7VA 4LOCA 3VODA 3VFZA 2YU9J 5CYVA 3VOEA 1OPCA 2R7WA 4LFUA 3LA2A 1KONA 1D1BA 3FXKA 1ZGWA 1PDNC 2MW8A 3O2PE 5EG0A 5E1XA 3RKYA 4ESFA 4A2UA 2X9DA 3JSOA 1LEAA 3KLNA 3J81K 2K9NA 2W85A 4C30A 2DA1A 2DA4A 2F48A 5C4JJ 5FGMA 4C3HJ 1YO5C 4DZPA 3JTHA 3H5RA 3V8KA 5HLHA 2Z99A 4ZTFA 1TQIA 1SFEA 2R7FA 5GPCA 5ICCA 2A69F 1U6GA 4Z2YA 2W84A 3V7CA 3ZRGA 2Y31A 4IEJA 1R1TA 2W24A 2NAZA 2RV8A 3MEXA 4M3GA 3WHBA 1R1UA 2NS0A 5LRRA 4BQAA 1BW5A 2L3DA 3BQYA 1L3LA 1BI2A 3ZQHA 5EG0B 4DGWB 2XHKA 2JPCA 1N75A 2M3AA 2PFBA 5EDNA 3QPLA 2WAEA 1BOBA 3IV5A 1U9OA 4B3XA 5B1AH 3GBGA 1WZ2A 3CMYA 3ASOH 3L2QA 1FLIA 3U2RA 4NQWA 3A01A 1DDNA 3NWSA 3O6BB 2E60A 1ZRDA 4RA2A 4U88A 1WKMA 3CLQA 3DBLB 2V1DA 3FXQA 4IVNA 1HOMA 2Z9OA 2K3PA 4EM1A 4DIQA 3LAJA 3M3YJ 2A6TA 1I27A 2IRFG 1EH6A 4E7ZA 2P5VA 3HL2A 5DUKA 4BJ5C 1IXCA 1XB4A 4IHWA 2PMZN 2MSYA 1Z05A 1XSVA 1ZREA 3FKJA 4F55A 2BXYA 2Q2EA 1W0UA 3PJRA 3ZQIA 3G2BA 3CMEI 3OIOA 3UKGA 1FSHA 4PJ0C 4LMYA 4NQWB 4QPQA 3A01B 2R92J 1IUFA 3A03A 2TDXA 4DBQA 5D8LB 3OYBA 4CXFA 3CTAA 2H09A 1VFCA 4A3LJ 3PO3J 3WG7H 5GTIC 1HBXG 2H6CA 5E1ZB 2IJLA 2FNPA 2EFNA 1ZK8A 1BN5A 4MQVA 5IYBJ 2OAZA 1TNTA 1QNTA 1S7AA 3KP3A 1R22A 3VDXA 1PVEA 2A5YB 4KDPA 2M4GA 1R36A 4C2UA 1TW3A 3RJPA 2VPLA 1Y6IA 2MBFA 2H1LA 4EM2A 1BR2A 3HJEA 5EEAA 2XUBA 2ZB9A 1X2MA 3OYLA 3V7SA 2Q2EB 3W6KB 1SAUA 2QZ8A 5GPAA 2L2OA 4G7HF 2OTJI 2CW7A 2ZXIA 2BY1A 1KZHA 4L5JA 1S6LA 4I98B 3X2QH 1F9NA 4XKBA 1NHAA 1LDKB 2LBFA 3BP8A 4XN0A 2DPUA 5C4XJ 3G6EI 4M6XA 2YUSA 5HLGA 3BR3A 1RPWA 1IV8A 2HYFA 2Y0SA 1CF7A 2AXTC 1OMIA 3QOPA 2IGNA 2XPUA 4X1EA 2K7LA 1E3OC 1BC8C 2RVCA 3H3ZA 2COMA 2EB7A 4A3GJ 1CQTA 1XSXA 5BQTA 2HOAA 2EILH 3ZMZA 1TT0A 1EKEA 4I0BA 4II2A 2ZNYA 1D0ZA 4ZC3A 2MD5A 2RDPA 4YFXF 1R1VA 4M9ZA 2FSWA 2YX7A 3EUKL 1QVUA 2HOEA 5JFRA 1Z91A 2H94A 1GXQA 3HRTA 3U1DA 2V9VA 1HSJA 2XKPA 3LOCA 4HV5A 3JREA 2HVSA 3K4NA 2LY2A 2LBFB 1HW1A 9ANTA 1YS7A 5DM7F 2ZCWA 5H6RA 4PCQA 1DPRA 2AQEA 1FPQA 1I3QJ 5K7FA 1V54H 2F4OB 5ILVA 2IEKA 1W36C 1VQLI 4L18B 3CESA 1I1SA 1RR7A 4LIUA 2R7UA 2LVSA 4Q47A 2WTEA 4OMYA 4XLNF 4UUSB 1L0OC 4RB1A 3WTWC 2F5CA 2RKHA 3JRIA 1GDTA 3JR9A 3GLLA 1UFMA 1ORKA 2OPTA 3HSEA 5K7ZA 2FEZA 2FOWA 1BM9A 3DU5A 2GWRA 3S2DJ 2BZTA 4CA0A 4A0YA 3N4MA 4IL6C 3FBIB 4JOMA 2OA4A 3REOA 1SVLA 3C1DA 4XLCA 1N78A 1K4SA 1YX5A 3W2WA 2DTZA 2WAQA 3F72A 3IAS2 2XAGA 1V5EA 3K69A 4G8XA 4I7HA 4MQ9F 3RPUA 5TRDA 1V4RA 4LG3A 3M1EA 4PJLA 2FBHA 1XPXA 4KICA 2HPMA 1TNSA 1NG6A 1ZKGA 5DS9A 4XM3A 4ZYDA 3AG2H 2Z3YA 4U7BA 1R7JA 1B59A 1HDDC 3QODA 2Y9YA 3K4BA 1K61A 2P5KA 4XMYA 3LL7A 3TOAA 3PUFA 5K5QA 3VPRA 2GOXB 2VODA 4CYCA 1U2WA 2BY3A 1QO0D 2RQPA 4B48A 2EIJH 2JSCA 3GFIA 5LFAA 4PFOA 4HX8A 2Y0MA 2E1MB 4L5IA 4XSZF 5FLXZ 3ONQA 4AIDA 1FIPA 4IOAF 2VPRA 4HV6A 3H1CA 1QPIA 4YFNF 2D5VA 1FOXA 1J5YA 4TV7A 2IS2A 3HOTA 4AUXA 2FMLA 3WTVC 1JI8A 1BIBA 5FKOA 3RKWA 1IN4A 3ESWB 5HNFA 3L00A 1K6OA 1T38A 1W7PD 1FOWA 3GCMA 1G3YA 2OD5A 2QA4I 2EV5A 3LSIA 3M8EA 3IUOA 5AIPA 4GCVA 3GFJA 1DU0A 1FTTA 5C3EJ 2R7ZJ 1U9NA 2ZJQF 2RGVA 1LQ1A 4CZCA 3TW6A 4ZZLA 2HR3A 2MFZA 4CYCB 1AA7A 2JA2A 3ZP5A 2WAQN 3KEYA 4RDUA 2CV2A 3T1BA 4HQMA 4Y15A 1FMWA 3JRBA 2VXDA 3OOUA 5E18F 4IHSA 5CPRB 2HEOA 3FXJA 3HGGA 3C18A 3J7AY 4S05A 1P7JA 3QYBA 2MABA 1B4AA 2MLGA 3GTMJ 4D5FA 2VQCA 3OOPA 3ABLH 5HOOA 3F8CA 1Z3XA 1FTZA 5J6XA 2ZXWH 3LQQA 3FXRA 3P9CA 3U21A 3ZMSA 1KGSA 5HODA 2XIGA 3BJOA 3KP5A 4HZFA 4F52A 3HZJA 3LQRA 2M87A 1G3SA 4BHBA 3CD6I 5FD6A 3G1OA 3HYIA 5ICEA 5HLIA 3KYLA 3SZPA 5BPDA 2IP2A 2LOOA 2DT5A 4XBFA 1ETQA 2K27A 4UUTA 4ZYGA 5F0HA 3KP4A 2LTPA 1LE8A 3Q0VA 2E2IJ 3S3MA 4Y13A 2X48A 3MZYA 3R6SA 1ERDA 3EPZA 3GUDA 4L9JA 2Q1ZB 2OCCH 3PSIA 3T0YA 1N77A 5EJCA 3VB2A 2WAFA 2R7SA 2VBXA 2VKHA 2R3SA 3QPTA 3LSKA 1SD6A 2DA5A 3KZYA 4LK1F 2FJ1A 1RRJA 1HF0A 2V6EA 5B5EC 2E1OA 4BGDA 2W82A 4BACA 2GBYA 2RREA 1AKHA 2KIQA 2V1NA 3OYEA 2E1MC 4RM2A 2HFHA 1R58A 2DT6A 5JLWA 3KP7A 3A0HC 2AO9A 2LFBA 3CJNA 2A07F 4O3MA 3D1NI 2CUEA 2ZSHB 2R93J 1XGNA 2PMUA 3IP4B 3PNVA 4M71A 3OYAA 3J7AO 4OINF 1XN7A 5FD5A 4EEFG 2P5LC 3A02A 3H5NA 1JUSA 2VBWA 2NRAC 1T08B 2M0MA 3O8GA 4AU7A 2M0CA 2OQRA 2XAHA 3M7GA 1TWAJ 3E1SA 4HSRA 1YIJI 2EA4A 5KAFC 4JX5A 1GV2A 2BW3A 2K3FA 1X1PA 1G59A 2GQQA 3QRFF 2K02A 3D0SA 3DEEA 4LJZF 1RI7A 1O57A 4RM3A 1ACIA 4XLPF 1IAWA 1AKHB 3OIPA 3IKTA 1MH3A 2QENA 1X1BA 2K5CA 4AC0A 1VQOI 3Q3SA 1LVAA 1IF1A 1WJDA 3HRMA 4H4KC 2OCEA 1MBEA 4OIOF 4BXUA 4H0EA 3T8RA 2KQRA 1WHUA 4G6TB 2KDOA 1MMNA 2E5NA 5KHDA 1SFUA 4R8HA 3I71A 2K9LA 1VQ7I 1U5TA 2ISYA 3CJQB 2JRMA 4HW0A 2LF8A 2JVHA 2ELHA 2XF7A 3QYFA 2V1UA 3ZR8X 3CCQI 4BYYA 2QKLB 1BJZA 2LD5A 2DK8A 3C2HA 3JRCA 4XIDA 2JN6A 4J01A 4A12A 1YJWI 1APLC 1LDDA 3J80K 5DD4A 4YIRX 3MKWB 1MBHA 2FUG2 1BW6A 1WRJA 1Z6TA 3ELKA 3I55I 3ULQB 2R7QA 3TL4X 3GTGJ 3I4PA 2ZNZA 1UG0A 4A6DA 4EV0A 1XCBA 4XLAA 4BE0A 1Z3YA 5BS6A 4D5CA 1FP1D 3M07A 3FF5A 3HPHA 3ZN0A 2WBMA 3P7NA 1OR7A 1U5TB 4MTDA 5AIQA 3DEWA 2Z5UA 2HU9A 2OZ6A 5A2QK 3ZQQA 2MGQA 1PP8F 5J1YA 4N4NB 4L5EA 1G3TA 2DMUA 4BQQA 4M6YA 2CH0A 1SMYF 2ISZA 3GX4X 4Q4ZF 5IT9Z 1X3ZB 4NNJA 1NG7A 2B7EA 2MC3A 3LFKA 4CO8A 1W36D 2W7NA 1J75A 3IRQA 4RS8A 1I50J 5L3EA 2G9WA 3NAUA 3I64A 3R60A 3IKVA 4RB3C 1R23A 4LG0A 4KJZA 5CVUA 5FKMA 4RBOA 2AQFA 1XD7A 3B73A 2MH9A 2CV0A 6PAXA 2CQQA 3GTQJ 2GM4A 3H3UA 4CHUA 3I59A 3H9QA 4PSXA 3VYRB 2YR2A 3S2HJ 1PYVA 3PIOF 5E1WA 3CQZJ 2ELKA 2A68F 1OQYA 3B6AA 3TO7A 4ON0A 3ZQGA 4HX7A 5BOXA 4ENNA 5EYRA 1T95A 2LLKA 1I6XA 3DBHB 3EUAA 3F0CA 3OSFA 3S3OA 1ETKA 2BHZA 3C2GA 3OV8A 3DLLF 2JUGA 3WTZA 2WY7Q 1GT0C 3JRFA 2E1CA 2IGOA 2KFDA 4II3A 2M7AA 4A0ZA 4MEXF 1SVMA 3S1QJ 4RAFA 3VYSB 3WGGA 1ON2A 3TDZC 4O5VA 4E6KG 3CCSI 3HTSB 2EIMH 4LG0B 3PQJA 3KFWX 4AVZA 5LD2C 2WC2A 1UHWA 3BTLA 3WTUC 1A35A 3FMQA 2EZHA 1STZA 3BG3A 4A5NA 3DKXA 4BS9A 2W25A 4K2EA 5F0FA 4E70A 2R5YA 3PFIA 3CP2A 3PFYA 4RAYA 1T6SA 3I59B 3TP0A 5F1RA 3HOXJ 4RGXA 3LA3A 2C6YA 1UJ8A 3I53A 3RIRA 1SMTA 2E2HJ 5FFXA 4XLEA 4JBAA 3DFGA 3AAFA 2VOOA 1RESA 2KMUA 2EIKH 1OYIA 1PUEE 2L01A 4ZYEA 5FRMA 2EINH 1YW7A 4DOZA 2ACJA 4UVAA 3GTLJ 1HKTA 2DU9A 4P1WA 2P6SA 3MWMA 1JXSA 3GMEA 4EGZA 3M1CA 1IUYA 4B09A 5LEJA 2IS1A 1U5TC 5J4VA 1KU3A 1QZEA 2ID3A 1MBGA 5KAIC 2DT7B 1MD0A 4EGYA 2BXZA 4KT6A 3DF8A 5ILUA 1Z1DA 3OIQA 4BY7J 4ANJA 4OOIA 2R5YB 1YI2I 3GTKJ 4L0YB 2NOJB 2Y2ZA 3PL8A 4G7ZF 4JK1X 1MIJA 1ETOA 2VB6A 2WV0A 1R49A 5F08A 3N05A 5IT3A 2VLAA 4V2FA 4BH9A 3WTXC 2DDAA 2KRFA 1O3TA 2VQHA 1R9TJ 3AL0B 2E34A 3E5XA 4XRFA
chains in the Genus database with same CATH topology
5IYBJ 2ECBA 3TW7A 3Q0WA 2Y30A 2H8RA 3FIWA 3HOUJ 1VI0A 4A3FJ 1NK2P 1A6IA 1GUUA 2EZKA 3BR5A 5EEAA 3IH3A 2ZB9A 1X2MA 4FCYA 4BBRJ 5GPAA 1SANA 3PM1A 4A3DJ 3JRGA 2FD5A 1H88C 1PUFA 1Z0XA 3TEDA 5C4XJ 1IC8A 4I76A 5M5XJ 1MBKA 2YUSA 3BR3A 1RPWA 3M4OJ 4DW6A 2R5ZA 5E3OA 2XPUA 4X1EA 1E3OC 1IGNA 4V2GA 4M3DA 4A3EJ 4B4CA 3RQIA 1BL0A 4BXXJ 4A3GJ 1CQTA 4A93J 1JKOC 3BR1A 4XRSG 2HOAA 3HBLA 1Y1VJ 1XG1A 1POGA 1JT0A 4DYRA 1VNDA 3OSGA 4XK4A 5EGOA 4A3IJ 2EQRA 1QVUA 2K40A 1JKQC 1RKTA 3JREA 3LOCA 1ZR2A 1PUFB 9ANTA 4M3FA 1I3QJ 2IAIA 3CDLA 5K7FA 3K7AJ 1Y1WJ 1IJWC 2R5ZB 2IEKA 4QSHA 1RR7A 4NDLA 4D7NA 4DYCA 2LVSA 1JUMA 1FJLA 3HOVJ 2CU7A 3RZOJ 3BTCA 1P7IA 4A3CJ 2LK2A 5EZGA 4BKXA 4UUSB 1TWFJ 2JA6J 3JRIA 1GDTA 3FK6A 1TWCJ 3HM5A 4XRSA 3JR9A 1Z77A 1ORKA 2OPTA 4DZJA 5K7ZA 1U78A 4MO7A 3S2DJ 2NOGA 5F1JA 1BA5A 5EGOB 2JWTA 4QTRA 3C2BA 4A69C 5M5WJ 5J1UA 3I4MJ 2DTZA 1LE8B 1VF9A 1ETVA 1DU6A 2G0EA 3LSJA 1WPKA 3G1LA 1WI3A 1IDYA 5FKKA 4M3BA 1ZKGA 2N8GA 3HDDA 5DS9A 2VI6A 1Q1VA 5IYCJ 2COBA 1F36A 1FEXA 3ZQFA 3H3VK 2I10A 2LP0A 2M2EA 5IP7J 1GV5A 5JLXA 1HDDC 2JA5J 1X58A 4GFBA 2Y9YA 1K61A 1MBJA 2XGDA 3VPRA 1ETXA 4CYCA 3MKLA 3GTOJ 3QPSA 1FIAA 2HYJA 1ITYA 1LFUP 3WHCA 1FIPA 3LSRA 1ENHA 5GP9A 2VPRA 1QPIA 2D5VA 4C2MJ 3K2AA 5BNGA 1RETA 2RAEA 4AUXA 2KDZA 1TC3C 5F27A 5FKOA 2YS9A 2DMQA 4A3MJ 1F43A 1JGGA 5IPAA 1EF4A 2DMTA 2NS8A 2X6OA 1IV6A 1WH5A 3G1MA 5FKLA 2W48A 5M3MJ 1DU0A 1YRNA 1FTTA 3O8HA 2AHQA 2FQ4A 5C3EJ 2R7ZJ 1U9NA 5F04A 4IHYA 3GTPJ 3TW6A 4CYCB 3HOWJ 2L0KA 2CQXA 3HGYA 4J19A 1HDPA 1OFCX 2WAQN 2XPVA 4RDUA 3JRBA 3OOUA 2ME6A 4AYBN 3HGGA 3LSGA 1AHDP 1P7JA 3ZQLA 4W97A 1TWHJ 2HI3A 3BTJA 3GTMJ 4FE7A 1SFOJ 2IBDA 4D5FA 2ID6A 5EF6A 5M5YJ 4IHXA 1MSEC 3S1MJ 3BG9A 3MVPA 5E3MA 3S16J 1FTZA 2XB5A 4FISA 2VUMJ 4UUSA 1H8AC 4S0HB 5HODA 1AU7A 5IYDJ 4JX6A 1OCTC 1ETWA 4MIMA 5IP6A 1HCRA 4MFDA 1YRNB 1B8IA 3G1OA 2JMWA 5E3LA 1NK3P 4X6AJ 3HKZN 1T33A 1HLVA 1ETQA 4UUTA 1A5JA 5F0CA 5F0HA 1LE8A 2LTPA 2O9LA 3Q0VA 4FE4A 2E2IJ 4FTHA 5J1RA 4B3AA 2X48A 2L7MP 2DMPA 3DCFA 4DYQA 1GVDA 3ZQCA 2HXIA 2XSDC 3RKQA 4JP0A 2CUFA 2NS7A 1X2NA 3S15J 1QRYA 4M3EA 2ECCA 2DA5A 2FJ1A 1HF0A 2NVYJ 1ZTRA 3SFIA 2E1OA 2DJNA 2GBYA 3HB9A 4QIWN 3JRHA 1AKHA 3JRAA 3BQZA 1ZR4A 2EH3A 2NVTJ 1B8IB 4BBSJ 4C3IJ 2B63J 2E19A 1H89C 1MNMC 5JLWA 5FKNA 1WCMJ 2AO9A 2LFBA 3D1NI 3MN2A 2O8KA 2CUEA 2R93J 2FX0A 4EEFG 3A02A 1JUSA 3O8GA 2L9RA 2WB1N 2M34A 2M0CA 1QVTA 2VKVA 2MG4A 5FLVA 1TWAJ 2NVXJ 3HOYJ 4JX5A 2DA6A 1GV2A 2DA2A 4G12A 2H1KA 5M3FJ 3CCYA 1JTXA 3ZOBA 4MFEA 3H0GJ 3SDGA 1AKHB 4D7MA 1MH3A 2HXOA 4Y7NJ 3JRDA 4AC0A 4HNVA 1S7EA 3Q3SA 5DTDA 5IOYA 2HDDA 1I6HJ 1MBEA 2KT0A 3BT9A 2JJ7A 4W1UA 2DA3A 3I4NJ 3S14J 1XS9A 3QQAA 1XC5A 4Y52J 2VKEA 1BJZA 2LD5A 3SJMA 1MBFA 2EZLA 3JRCA 4XIDA 2JN6A 3FISA 1D5YA 2HOSA 1APLC 1UMQA 1WGXA 2XPWA 3IH2A 2K9SA 3IH4A 2DMNA 1MBHA 3FKIJ 1BW6A 1JUPA 3W6VA 2QCOA 1MSFC 1K83J 1LFBA 3GTGJ 2JA7J 1G2HA 2JK3A 4M6VA 2L7ZA 2TCTA 4IHVA 3BG5A 4B1RA 4D5CA 3S17J 2CJJA 2M9HA 3BR6A 2XGEA 2R0QC 2EBIA 3LNQA 1JKPC 1IG7A 2HOTA 3DEWA 1U8BA 2WV1A 1OJLA 1UG2A 5C44J 2HQ5A 3PO2J 2MGQA 4ABZA 5J1YA 2JA8J 4L5EA 5EZHA 2DMUA 1JKRC 1ETYA 4LOCA 2YU9J 2LKXA 3S1RJ 1IRZA 1I50J 5E3NA 1ZGWA 3HOZJ 3NAUA 2MW8A 5IOZA 5EG0A 1TWGJ 2X9DA 2LR8A 5FKMA 4RBOA 4A3KJ 3GTJJ 2CQQA 3GTQJ 2K9NA 2GM4A 2DA1A 2DA4A 5C4JJ 3S2HJ 4C3HJ 4BY1J 4DZPA 4I6ZA 3CQZJ 2ELKA 3B6AA 3ZQGA 4C3JJ 1B72B 5EYRA 5GPCA 2LLKA 3OSFA 3F0CA 1ETKA 1GT0C 3Q0UA 3JRFA 2Y31A 4IEJA 5K7HA 3L1PA 2TRTA 4A3JJ 2Y9ZA 4A3BJ 4M3GA 2XB0X 3S1QJ 3WHBA 1BW5A 3BQYA 5J3LA 3RZDJ 3ZQHA 5EG0B 5FLMJ 2XGCA 5EDNA 3QPLA 3S1NJ 3BTLA 5IP9J 3IV5A 1U9OA 2EZHA 3BG3A 1JT6A 3GBGA 2M8GX 4MLOA 5F0FA 3FK7A 2L7FP 2R5YA 3TP0A 3HOXJ 3CMYA 1RKWA 5FJ8J 2E2HJ 3A01A 3TP3A 2NVQJ 1RESA 2Y0SN 1NTCA 2ME0A 1OCPA 2OF7A 1HOMA 1JJ8C 1IDZA 2XRLA 3E7LA 1B72A 1ZQ3P 2GLOA 3GTLJ 3M3YJ 2CRGA 4IHWA 2P81A 3NARA 2O7OA 2DN0A 2PMZN 2MSYA 1WH7A 3HEFA 2LY9A 2ID3A 1MBGA 1UHSA 4XRMA 2QF7A 1W0UA 3BR2A 3ZQIA 4JYKA 2E2JJ 1W0TA 2R5YB 4JX4A 4BY7J 2EZIA 3OIOA 3UKGA 3GTKJ 1MH4A 2Y2ZA 4XICA 2R92J 3A01B 1IUFA 1ETOA 3B6CA 5F08A 3A03A 3BTIA 2DA7A 4V2FA 1T56A 1VFCA 2K9QA 4A3LJ 3PO3J 1O4XA 1R9TJ 3LSPA 1ZK8A 3BR0A 1JJ6C 1JTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB J;  2ECB A;  3TW7 A;  3Q0W A;  2Y30 A;  2H8R A;  3FIW A;  3HOU J;  1VI0 A;  4A3F J;  1NK2 P;  1A6I A;  1GUU A;  2EZK A;  3BR5 A;  5EEA A;  3IH3 A;  2ZB9 A;  1X2M A;  4FCY A;  4BBR J;  5GPA A;  1SAN A;  3PM1 A;  4A3D J;  3JRG A;  2FD5 A;  1H88 C;  1PUF A;  1Z0X A;  3TED A;  5C4X J;  1IC8 A;  4I76 A;  5M5X J;  1MBK A;  2YUS A;  3BR3 A;  1RPW A;  3M4O J;  4DW6 A;  2R5Z A;  5E3O A;  2XPU A;  4X1E A;  1E3O C;  1IGN A;  4V2G A;  4M3D A;  4A3E J;  4B4C A;  3RQI A;  1BL0 A;  4BXX J;  4A3G J;  1CQT A;  4A93 J;  1JKO C;  3BR1 A;  4XRS G;  2HOA A;  3HBL A;  1Y1V J;  1XG1 A;  1POG A;  1JT0 A;  4DYR A;  1VND A;  3OSG A;  4XK4 A;  5EGO A;  4A3I J;  2EQR A;  1QVU A;  2K40 A;  1JKQ C;  1RKT A;  3JRE A;  3LOC A;  1ZR2 A;  1PUF B;  9ANT A;  4M3F A;  1I3Q J;  2IAI A;  3CDL A;  5K7F A;  3K7A J;  1Y1W J;  1IJW C;  2R5Z B;  2IEK A;  4QSH A;  1RR7 A;  4NDL A;  4D7N A;  4DYC A;  2LVS A;  1JUM A;  1FJL A;  3HOV J;  2CU7 A;  3RZO J;  3BTC A;  1P7I A;  4A3C J;  2LK2 A;  5EZG A;  4BKX A;  4UUS B;  1TWF J;  2JA6 J;  3JRI A;  1GDT A;  3FK6 A;  1TWC J;  3HM5 A;  4XRS A;  3JR9 A;  1Z77 A;  1ORK A;  2OPT A;  4DZJ A;  5K7Z A;  1U78 A;  4MO7 A;  3S2D J;  2NOG A;  5F1J A;  1BA5 A;  5EGO B;  2JWT A;  4QTR A;  3C2B A;  4A69 C;  5M5W J;  5J1U A;  3I4M J;  2DTZ A;  1LE8 B;  1VF9 A;  1ETV A;  1DU6 A;  2G0E A;  3LSJ A;  1WPK A;  3G1L A;  1WI3 A;  1IDY A;  5FKK A;  4M3B A;  1ZKG A;  2N8G A;  3HDD A;  5DS9 A;  2VI6 A;  1Q1V A;  5IYC J;  2COB A;  1F36 A;  1FEX A;  3ZQF A;  3H3V K;  2I10 A;  2LP0 A;  2M2E A;  5IP7 J;  1GV5 A;  5JLX A;  1HDD C;  2JA5 J;  1X58 A;  4GFB A;  2Y9Y A;  1K61 A;  1MBJ A;  2XGD A;  3VPR A;  1ETX A;  4CYC A;  3MKL A;  3GTO J;  3QPS A;  1FIA A;  2HYJ A;  1ITY A;  1LFU P;  3WHC A;  1FIP A;  3LSR A;  1ENH A;  5GP9 A;  2VPR A;  1QPI A;  2D5V A;  4C2M J;  3K2A A;  5BNG A;  1RET A;  2RAE A;  4AUX A;  2KDZ A;  1TC3 C;  5F27 A;  5FKO A;  2YS9 A;  2DMQ A;  4A3M J;  1F43 A;  1JGG A;  5IPA A;  1EF4 A;  2DMT A;  2NS8 A;  2X6O A;  1IV6 A;  1WH5 A;  3G1M A;  5FKL A;  2W48 A;  5M3M J;  1DU0 A;  1YRN A;  1FTT A;  3O8H A;  2AHQ A;  2FQ4 A;  5C3E J;  2R7Z J;  1U9N A;  5F04 A;  4IHY A;  3GTP J;  3TW6 A;  4CYC B;  3HOW J;  2L0K A;  2CQX A;  3HGY A;  4J19 A;  1HDP A;  1OFC X;  2WAQ N;  2XPV A;  4RDU A;  3JRB A;  3OOU A;  2ME6 A;  4AYB N;  3HGG A;  3LSG A;  1AHD P;  1P7J A;  3ZQL A;  4W97 A;  1TWH J;  2HI3 A;  3BTJ A;  3GTM J;  4FE7 A;  1SFO J;  2IBD A;  4D5F A;  2ID6 A;  5EF6 A;  5M5Y J;  4IHX A;  1MSE C;  3S1M J;  3BG9 A;  3MVP A;  5E3M A;  3S16 J;  1FTZ A;  2XB5 A;  4FIS A;  2VUM J;  4UUS A;  1H8A C;  4S0H B;  5HOD A;  1AU7 A;  5IYD J;  4JX6 A;  1OCT C;  1ETW A;  4MIM A;  5IP6 A;  1HCR A;  4MFD A;  1YRN B;  1B8I A;  3G1O A;  2JMW A;  5E3L A;  1NK3 P;  4X6A J;  3HKZ N;  1T33 A;  1HLV A;  1ETQ A;  4UUT A;  1A5J A;  5F0C A;  5F0H A;  1LE8 A;  2LTP A;  2O9L A;  3Q0V A;  4FE4 A;  2E2I J;  4FTH A;  5J1R A;  4B3A A;  2X48 A;  2L7M P;  2DMP A;  3DCF A;  4DYQ A;  1GVD A;  3ZQC A;  2HXI A;  2XSD C;  3RKQ A;  4JP0 A;  2CUF A;  2NS7 A;  1X2N A;  3S15 J;  1QRY A;  4M3E A;  2ECC A;  2DA5 A;  2FJ1 A;  1HF0 A;  2NVY J;  1ZTR A;  3SFI A;  2E1O A;  2DJN A;  2GBY A;  3HB9 A;  4QIW N;  3JRH A;  1AKH A;  3JRA A;  3BQZ A;  1ZR4 A;  2EH3 A;  2NVT J;  1B8I B;  4BBS J;  4C3I J;  2B63 J;  2E19 A;  1H89 C;  1MNM C;  5JLW A;  5FKN A;  1WCM J;  2AO9 A;  2LFB A;  3D1N I;  3MN2 A;  2O8K A;  2CUE A;  2R93 J;  2FX0 A;  4EEF G;  3A02 A;  1JUS A;  3O8G A;  2L9R A;  2WB1 N;  2M34 A;  2M0C A;  1QVT A;  2VKV A;  2MG4 A;  5FLV A;  1TWA J;  2NVX J;  3HOY J;  4JX5 A;  2DA6 A;  1GV2 A;  2DA2 A;  4G12 A;  2H1K A;  5M3F J;  3CCY A;  1JTX A;  3ZOB A;  4MFE A;  3H0G J;  3SDG A;  1AKH B;  4D7M A;  1MH3 A;  2HXO A;  4Y7N J;  3JRD A;  4AC0 A;  4HNV A;  1S7E A;  3Q3S A;  5DTD A;  5IOY A;  2HDD A;  1I6H J;  1MBE A;  2KT0 A;  3BT9 A;  2JJ7 A;  4W1U A;  2DA3 A;  3I4N J;  3S14 J;  1XS9 A;  3QQA A;  1XC5 A;  4Y52 J;  2VKE A;  1BJZ A;  2LD5 A;  3SJM A;  1MBF A;  2EZL A;  3JRC A;  4XID A;  2JN6 A;  3FIS A;  1D5Y A;  2HOS A;  1APL C;  1UMQ A;  1WGX A;  2XPW A;  3IH2 A;  2K9S A;  3IH4 A;  2DMN A;  1MBH A;  3FKI J;  1BW6 A;  1JUP A;  3W6V A;  2QCO A;  1MSF C;  1K83 J;  1LFB A;  3GTG J;  2JA7 J;  1G2H A;  2JK3 A;  4M6V A;  2L7Z A;  2TCT A;  4IHV A;  3BG5 A;  4B1R A;  4D5C A;  3S17 J;  2CJJ A;  2M9H A;  3BR6 A;  2XGE A;  2R0Q C;  2EBI A;  3LNQ A;  1JKP C;  1IG7 A;  2HOT A;  3DEW A;  1U8B A;  2WV1 A;  1OJL A;  1UG2 A;  5C44 J;  2HQ5 A;  3PO2 J;  2MGQ A;  4ABZ A;  5J1Y A;  2JA8 J;  4L5E A;  5EZH A;  2DMU A;  1JKR C;  1ETY A;  4LOC A;  2YU9 J;  2LKX A;  3S1R J;  1IRZ A;  1I50 J;  5E3N A;  1ZGW A;  3HOZ J;  3NAU A;  2MW8 A;  5IOZ A;  5EG0 A;  1TWG J;  2X9D A;  2LR8 A;  5FKM A;  4RBO A;  4A3K J;  3GTJ J;  2CQQ A;  3GTQ J;  2K9N A;  2GM4 A;  2DA1 A;  2DA4 A;  5C4J J;  3S2H J;  4C3H J;  4BY1 J;  4DZP A;  4I6Z A;  3CQZ J;  2ELK A;  3B6A A;  3ZQG A;  4C3J J;  1B72 B;  5EYR A;  5GPC A;  2LLK A;  3OSF A;  3F0C A;  1ETK A;  1GT0 C;  3Q0U A;  3JRF A;  2Y31 A;  4IEJ A;  5K7H A;  3L1P A;  2TRT A;  4A3J J;  2Y9Z A;  4A3B J;  4M3G A;  2XB0 X;  3S1Q J;  3WHB A;  1BW5 A;  3BQY A;  5J3L A;  3RZD J;  3ZQH A;  5EG0 B;  5FLM J;  2XGC A;  5EDN A;  3QPL A;  3S1N J;  3BTL A;  5IP9 J;  3IV5 A;  1U9O A;  2EZH A;  3BG3 A;  1JT6 A;  3GBG A;  2M8G X;  4MLO A;  5F0F A;  3FK7 A;  2L7F P;  2R5Y A;  3TP0 A;  3HOX J;  3CMY A;  1RKW A;  5FJ8 J;  2E2H J;  3A01 A;  3TP3 A;  2NVQ J;  1RES A;  2Y0S N;  1NTC A;  2ME0 A;  1OCP A;  2OF7 A;  1HOM A;  1JJ8 C;  1IDZ A;  2XRL A;  3E7L A;  1B72 A;  1ZQ3 P;  2GLO A;  3GTL J;  3M3Y J;  2CRG A;  4IHW A;  2P81 A;  3NAR A;  2O7O A;  2DN0 A;  2PMZ N;  2MSY A;  1WH7 A;  3HEF A;  2LY9 A;  2ID3 A;  1MBG A;  1UHS A;  4XRM A;  2QF7 A;  1W0U A;  3BR2 A;  3ZQI A;  4JYK A;  2E2J J;  1W0T A;  2R5Y B;  4JX4 A;  4BY7 J;  2EZI A;  3OIO A;  3UKG A;  3GTK J;  1MH4 A;  2Y2Z A;  4XIC A;  2R92 J;  3A01 B;  1IUF A;  1ETO A;  3B6C A;  5F08 A;  3A03 A;  3BTI A;  2DA7 A;  4V2F A;  1T56 A;  1VFC A;  2K9Q A;  4A3L J;  3PO3 J;  1O4X A;  1R9T J;  3LSP A;  1ZK8 A;  3BR0 A;  1JJ6 C;  1JTY A; 
#chains in the Genus database with same CATH topology
 4L9N A;  4P9U A;  4ZTJ A;  1K4T A;  1FX7 A;  2DK5 A;  4WWC A;  2O3F A;  4A3F J;  1NK2 P;  3LSM A;  4HOB A;  4XNF A;  5LRS A;  1X1C A;  2CWE A;  1OR7 C;  1UB9 A;  2ETH A;  2EZK A;  3DPU A;  2UXX A;  3BC8 A;  3OWT A;  1RUN A;  3IH3 A;  3QP6 A;  2XAS A;  3K4M A;  2Z16 A;  4RLQ A;  5DUI A;  1KQ9 A;  2KJB A;  1SAN A;  2LMD A;  3PM1 A;  4IF4 A;  5H20 A;  3RCO A;  1H88 C;  1TQP A;  3B02 A;  1Z0X A;  3TED A;  4BE1 A;  3OS2 A;  1IC8 A;  2EV0 A;  2DFF A;  4I76 A;  5M5X J;  3M4O J;  3GWZ A;  1W5S A;  4GXO A;  2KLO A;  2VJ4 A;  1B6A A;  4EJV A;  1K79 A;  2QQ8 A;  2W4S A;  3CCJ I;  3TQN A;  1ZRF A;  2FQ3 A;  4V2G A;  4UY8 I;  1D0Y A;  1T0F A;  4GYI A;  4BXX J;  2L4M A;  4RB0 A;  1U8R A;  3KCC A;  4XRS G;  2GXB A;  4E4H A;  3CMA I;  1YFH A;  4HA8 A;  2PMZ A;  4EMS A;  3DWL E;  1Y1V J;  2M1B A;  2FA5 A;  1POG A;  3JW4 A;  3FWE A;  4FET A;  3QAH A;  3LA7 A;  2KP6 A;  5DD8 A;  3L2U A;  3IHU A;  2F5D A;  1LPQ A;  1V5G A;  3RPU D;  1Y0U A;  2L9S A;  4E7I A;  1D1C A;  4HF2 A;  4G7O F;  2HKO A;  1IJW C;  1FWZ A;  2D1H A;  2HDW A;  2IAI A;  1Y1W J;  1XMX A;  2LSO A;  2XRO A;  1WJF A;  2X4H A;  4NDL A;  3F21 A;  4I02 A;  1FJL A;  5CQG A;  4U0V A;  3RZO J;  1BJA A;  5DCM A;  3BTC A;  5KVR A;  1TTY A;  3D5L A;  5EZG A;  3CCL I;  1X4O A;  5L3C A;  2ZC2 A;  1R71 A;  1TWF J;  3HPG A;  3I58 A;  5L3F A;  5HS7 A;  2L5Q A;  2A05 A;  4DZJ A;  1WSU A;  4YG2 F;  2OZU A;  4BXF A;  3IWZ A;  4XR6 A;  1BA5 A;  4P5O A;  4Z6Y A;  3HSF A;  4HG2 A;  1S3J A;  2GIV A;  4QTR A;  3DTK A;  3E97 A;  3AL0 C;  2QQA A;  5J1U A;  1MMD A;  3E3V A;  4KIT B;  2K85 A;  1O3R A;  1EH7 A;  1F4K A;  1ZN2 A;  5HS9 A;  2RN7 A;  4CYD A;  1VF9 A;  2CGP A;  1ETV A;  1DU6 A;  3CCR I;  2DQL A;  3LFU A;  4XLF A;  1GHC A;  2LG4 A;  1HW5 A;  3LSJ A;  1WPK A;  1Z7L A;  3BPX A;  3BZC A;  2XAQ A;  4XOT A;  2KIU A;  1Q1V A;  3H35 A;  3ZQF A;  1BBY A;  4MEY F;  2LP0 A;  5DCM B;  3BLY A;  4OIP F;  5JLX A;  4E7L A;  1FOY A;  1I1G A;  1SC7 A;  2LH9 A;  2V9K A;  4B8X A;  3L2C A;  2XGD A;  2F2E A;  1ETX A;  2VQL A;  3M8F A;  1ZG1 A;  2ZJR F;  4I99 C;  1FBU A;  3ABK H;  2EWN A;  4LGW A;  1BC7 C;  3QPS A;  1FIA A;  3SDB A;  4B47 A;  4ESB A;  4L0Z B;  1LFU P;  1TT5 B;  3GLX A;  3DKY A;  1ENH A;  2H8W A;  5GP9 A;  2EFO A;  2K9M A;  4CCL A;  4EJW A;  3CF5 F;  3JAM K;  1KQ0 A;  3K2A A;  1RET A;  3JTG A;  3VWB A;  1BI3 A;  1FYK A;  3MKZ A;  2EJR A;  2DO7 A;  2KDZ A;  4ESJ A;  2L02 A;  3JCU C;  2YS9 A;  1X3W B;  4ITV A;  2Q0O A;  1F43 A;  4R79 A;  1A36 A;  2DMT A;  2DLL A;  1IV6 A;  3G1M A;  5E79 C;  4ZYA A;  2DJI A;  4V19 K;  1P2F A;  3H9G A;  1Y39 A;  1YRN A;  2YSR A;  1ZEL A;  3EDP A;  1AWC A;  4M73 A;  3RDI A;  3W2A A;  3HGY A;  4J19 A;  3KP6 A;  3LAP A;  2UZK A;  2XAU A;  3ML6 A;  1FBQ A;  4DNC A;  4PJN A;  4ZZD A;  1BI0 A;  1XMA A;  1C0W A;  4NBQ A;  3ZQL A;  4W97 A;  1WVR A;  2EFP A;  3I5U A;  1T0F C;  2IBD A;  2PX9 A;  5ICF A;  5M5Y J;  1MSE C;  3SZG A;  3BG9 A;  3VYU B;  3S1M J;  3A4C A;  4ZJZ A;  5LGT A;  5E3M A;  3FBN B;  3S16 J;  2VUM J;  4UUS A;  1H8A C;  1CGP A;  3F8B A;  4BL0 B;  1OCT C;  2VAS A;  4HF1 A;  1HCR A;  4UNO A;  4MFD A;  1YRN B;  2CV1 A;  5D4R A;  2FNA A;  5CVJ A;  1D8J A;  5E3L A;  1E2X A;  3K4C A;  1ZRC A;  3CF2 A;  1NK3 P;  4GYG A;  1ZH5 A;  1T33 A;  1KA8 A;  1HLV A;  3OL4 A;  2IA2 A;  3K4J A;  3P5J A;  1S29 A;  3ECO A;  3HSR A;  5H2F C;  5F0C A;  2FF4 A;  4BU2 A;  2UUZ A;  4KNY A;  4WCG A;  3QU3 A;  3ZQC A;  3DTI A;  2XSD C;  2QYO A;  2NS7 A;  1ZYR F;  2WWY A;  3K9T A;  4MTE A;  2HNH A;  1WI9 A;  1OCO H;  2Z2S B;  5D5W B;  4QIW N;  3JRH A;  3BG6 A;  1JGS A;  2KIS A;  3GZ6 A;  2EH3 A;  1S72 I;  3WE3 A;  4C3I J;  3PIP F;  2DTR A;  1SD7 A;  2LYC A;  1OLT A;  3IC7 A;  1MNM C;  3TO9 A;  5FKN A;  4BJT A;  2L7K A;  1YJ9 I;  4L9T A;  1HA8 A;  3MD2 A;  1VQ8 I;  3MN2 A;  2O8K A;  2FX0 A;  4N9H A;  2DCE A;  4LIT A;  4ASN A;  3CZ6 A;  3WE2 A;  1SFX A;  2L9R A;  2WB1 N;  2M34 A;  2W1O A;  4AM3 A;  1QVT A;  3ABT A;  2QWW A;  2VKV A;  2XSJ C;  1HW2 A;  2W57 A;  1GVJ A;  2OU2 A;  3GW2 A;  4UVB A;  5B1B H;  2H1K A;  5M3F J;  2R7X A;  3K0L A;  2OV7 A;  3QYE A;  4LIV A;  1MMS A;  1JTX A;  2STW A;  5KK1 A;  3S8P A;  5HS8 A;  3RPQ A;  1HST A;  1QA6 A;  4MFE A;  3H0G J;  3SDG A;  4D7M A;  2ZJP F;  5ED4 A;  1V5F A;  2XVC A;  4BE2 A;  2KJC A;  4KUM A;  2QBY A;  2J5O A;  5DTD A;  4BAY A;  1QQI A;  4IZZ A;  2E7X A;  4XN3 A;  3CLO A;  2X1D A;  4G6Q A;  3OY9 A;  2NVU B;  3ECH A;  2G7U A;  4HEA 2;  4CSW A;  1IN5 A;  2DFH A;  3S14 J;  3CC2 I;  2P7V B;  1FC3 A;  4Q5S F;  2AXL A;  1Z67 A;  2HTS A;  3QQA A;  2VC1 A;  1XS9 A;  3CCV I;  1E17 A;  5DDG A;  1E0E A;  5ERI A;  2EZL A;  3ZMT A;  3GVA A;  1SAX A;  3IH2 A;  1NH3 A;  2XAF A;  3IH4 A;  4EM0 B;  1R5H A;  2P6T A;  3W6V A;  1ZAO A;  2KZG A;  3KET A;  1LFB A;  1R6R A;  2WAD A;  1YLF A;  1YOV B;  2QBY B;  3TGN A;  5FB2 A;  4CCJ A;  2TCT A;  5D6E A;  5AON A;  2LRD A;  1SVO A;  4HAM A;  1WWX A;  3BG5 A;  3DQV C;  4B1R A;  2CJJ A;  4PZJ A;  2M9H A;  1TQM A;  2ZFW A;  3TOB A;  4IOC F;  2R7D A;  3NQO A;  3QP5 A;  5GAD J;  3J7Y J;  2DPD A;  5L3B A;  1KYZ A;  3LNQ A;  1IG7 A;  3W6J B;  3SEZ A;  4NC7 A;  4WXH A;  2WV1 A;  4N0B A;  3S2W A;  1VQ9 I;  5JR3 A;  3CC4 I;  4ABZ A;  4FQG A;  3BJ6 A;  4NB5 A;  5EZH A;  1O7L A;  2DFE A;  1I39 A;  3T8T A;  5TJJ A;  4XOP A;  3IAM 2;  2XDV A;  1UHM A;  5ICG A;  2LKX A;  3S1R J;  1PP7 U;  1IRZ A;  4O6J A;  5FLX K;  3F8M A;  4ZH4 F;  4KN4 X;  2EFW A;  4B43 A;  1X19 A;  2QQ9 A;  4XKV A;  3C7J A;  2VJI A;  1QZY A;  1R4N B;  3ISP A;  4A3K J;  3GTJ J;  1KU7 A;  1B9N A;  1ULY A;  1RIO H;  2MLK A;  2EPF A;  4PGG A;  4FX0 A;  4BY1 J;  4I6Z A;  1YE9 A;  2W00 A;  4C3J J;  4IO9 F;  1BI1 A;  2ESH A;  4L9V A;  2VOP A;  5D6F A;  1W5C C;  3UR3 C;  3I0T A;  3TKY A;  1SFK A;  1X1D A;  1H9T A;  2HQA A;  2RNG A;  3OR2 C;  5TIS C;  1K7A A;  3L1P A;  1MW7 A;  2TRT A;  4A3J J;  3K4L A;  4XON A;  2XB0 X;  1LNW A;  2L54 A;  2X6W A;  3NWT A;  4UV8 A;  1J0R A;  2YU3 A;  4G6D A;  3DP7 A;  2XGC A;  4HYE A;  2GA2 A;  1N25 A;  3S1N J;  3L2W A;  3ZQ7 A;  3HC7 A;  2LF7 A;  3WTS C;  1XGO A;  2GZW A;  1X1A A;  1JT6 A;  4MLO A;  3FK7 A;  2L7F P;  4WX9 A;  3IL2 A;  1LJ9 A;  3BZK A;  1RKW A;  5FJ8 J;  3J80 Z;  3H36 A;  4M9S A;  1T39 A;  2LNB A;  5HDN A;  2QGU A;  2NVQ J;  3E6C C;  3KEQ A;  1NTC A;  4BQO A;  2ME0 A;  3N97 A;  1OCP A;  4WK8 F;  2OF7 A;  1IRX A;  1JJ8 C;  4RAG A;  2JZY A;  2XRL A;  2DYR H;  2QQB A;  2WA0 A;  1ZQ3 P;  2GLO A;  1Y8Q B;  3VSL A;  1Z21 A;  4LK0 F;  2O7O A;  1UEL B;  3BZ6 A;  1E3P A;  1YQA A;  5A2Q Z;  2P0W A;  4ZYH A;  2QF7 A;  2V26 A;  3BR2 A;  3L7W A;  4XRM A;  3DLA A;  4JYK A;  2E2J J;  1W0T A;  1M1E B;  4JX4 A;  3G4S I;  1P4W A;  2VBZ A;  2VKD A;  4GRI A;  3S32 A;  4XIC A;  1Z7U A;  3B6C A;  3BTI A;  3FZV A;  3CO6 C;  1OCZ H;  2DA7 A;  2BHY A;  1KQ8 A;  1TL8 A;  3DPT A;  3CDH A;  5K1Y A;  1XTA A;  3LSP A;  1WJ5 A;  2F6C A;  2PI0 A;  3BR0 A;  3GYH X;  1JJ6 C;  1VQ6 I;  2PN6 A;  3CC7 I;  3TW7 A;  3Q0W A;  3SXY A;  3F8N A;  2H8R A;  2K4J A;  2V9P A;  1VI0 A;  2QSH X;  4M74 A;  1G8X A;  4Y3O A;  5FRN A;  3PUB A;  1J9I A;  4IQJ A;  5HLT A;  1MGT A;  3BR5 A;  4C9Y A;  5DV5 A;  3K70 D;  3V4G A;  4BBR J;  2FBK A;  5F6F A;  3K4K A;  2V6C A;  2M30 A;  4LD5 A;  3JRG A;  3AKZ A;  4A3D J;  1FY7 A;  3FX3 A;  3MKY B;  2IA0 A;  2XC7 A;  3EUH C;  3KPH A;  3OL3 A;  4G94 A;  3U9G A;  2ZJ2 A;  5EEH A;  1MBK A;  2QSF X;  5J8C A;  1FNN A;  2R5Z A;  5FO5 A;  1FP2 A;  3HOS A;  1X4P A;  4M3D A;  4A3E J;  4B4C A;  2BE5 F;  3WOD F;  1Y0N A;  3MZ8 A;  1RZ4 A;  3I56 I;  1P4X A;  2IVM A;  4A93 J;  3BR1 A;  2GA1 A;  2HWV A;  3R61 A;  3MQ0 A;  2X85 A;  4RGR A;  3HBL A;  3R4K A;  4EQQ A;  2OUM A;  4BJ6 C;  1P6R A;  3ROU A;  3IRR A;  1GXP A;  1XG1 A;  3CCE I;  5LHI A;  1JT0 A;  4DYR A;  4YIF A;  2DFI A;  1VND A;  3OSG A;  2L9N A;  4XK4 A;  5EGO A;  3A2K A;  5H6Q A;  2K40 A;  1RKT A;  3FM5 A;  3V7R A;  3H5A A;  1IN7 A;  3ABM H;  3BCA A;  1I5Z A;  4A5M A;  1EH8 A;  3EQL F;  3RQ4 A;  3WU0 A;  2QEX I;  4F7Z A;  2PQ8 A;  3K1M A;  2EV6 A;  2R5Z B;  1UAA A;  4E7J A;  3SEQ A;  3HOV J;  2ZSI B;  5D5U B;  2GOM A;  3P9I A;  3OYH A;  4A3C J;  1P7I A;  2LK2 A;  2LRE A;  2VT3 A;  3F6V A;  4BKX A;  4MGR A;  3MZH A;  2JA6 J;  1H9G A;  1K6Y A;  3FK6 A;  3HM5 A;  4UVC A;  1R5G A;  1Z77 A;  1MDM B;  3W3C A;  1U78 A;  4YII A;  3GFM A;  2M7B A;  2NOG A;  5F1J A;  4WXC A;  3ZMV A;  2PBI A;  5EGO B;  1DP7 P;  1JE8 A;  2JWT A;  3GEZ A;  3KE2 A;  3FXO A;  5JVG F;  3SYT A;  2O6G E;  5IT9 K;  3AG4 H;  1OKR A;  5M5W J;  3ZCO A;  2JRT A;  2KIM A;  4I09 A;  5JHU A;  3CUQ A;  1T98 A;  4PJJ A;  3RYP A;  1FYM A;  3G1L A;  1LB2 A;  2QKM B;  1WI3 A;  1WJA A;  1U0J A;  5FKK A;  2A5W A;  4M3B A;  2N8G A;  2FRH A;  3BCB A;  3HDD A;  1YG2 A;  3MMY B;  1F36 A;  2M45 A;  3G71 I;  1FEX A;  5CLS A;  5J40 A;  3OYC A;  3H3V K;  2FXA A;  2I10 A;  5IP7 J;  3UNG C;  1VTN C;  2HKX A;  1OIS A;  3LWF A;  4C2T A;  3E6M A;  3GTO J;  1U3E M;  3FDY A;  1XSD A;  4HNT A;  1F5T A;  3OYI A;  1RUO A;  1ITY A;  2UV1 A;  1D5V A;  3LSR A;  4BDZ A;  1PJR A;  2AS5 F;  4C2M J;  2QLZ A;  3SQN A;  5BNG A;  3CUQ B;  2X6X A;  2X51 A;  2L4A A;  4KMF A;  2KKO A;  5F27 A;  2YPR A;  2CYY A;  2DMQ A;  4A3M J;  3OYD A;  3J81 Z;  2JT1 A;  3WTY C;  3E5Q A;  4CCK A;  3OMY A;  1EF4 A;  2ELJ A;  4KA4 A;  1WH5 A;  4Q48 A;  2HVQ A;  1WJB A;  1P9Q C;  3O8H A;  3VYT B;  2NYX A;  4Y17 A;  5F04 A;  4I0A A;  3HOW J;  2L0K A;  2CQX A;  1BOA A;  1YIO A;  1S5L C;  1HDP A;  2E36 A;  2L9V A;  1ONV A;  2XPV A;  2JTV A;  3E6B A;  2QUF A;  4BUP A;  3DKW A;  3BJA A;  3WU2 C;  3GZN B;  5J8F A;  4XQF A;  4AIJ A;  1Y8R B;  1TWH J;  5ILS A;  2HI3 A;  3BTJ A;  2EFQ A;  4FE7 A;  1MMG A;  1SFO J;  3ZXS A;  4IHX A;  5EF6 A;  4HLY A;  1D0X A;  1I3A A;  4FIS A;  2HZT A;  4E7H A;  3OYN A;  1AU7 A;  1J7K A;  4I01 A;  1ETW A;  2Y48 A;  2BVL A;  3OYG A;  2UXN A;  2JMW A;  1IZ1 A;  3V8L A;  5JHF A;  3DBR B;  1WFX A;  4A0X A;  4BQN A;  3HKZ N;  4QLC U;  3HHG A;  4KT5 C;  4D0P A;  2BVM A;  5GAG J;  3GXO A;  3DXJ F;  1A5J A;  3RTR A;  1B9M A;  2IGM A;  4BDY A;  1Z9C A;  2O9L A;  4NC6 A;  5E8G A;  5J1R A;  2MC4 A;  5E8I A;  4B3A A;  3OR1 C;  4IX7 A;  3I9V 2;  1XGM A;  2DMP A;  2IGK A;  3DCF A;  1XDU A;  4J00 A;  2HXI A;  1R00 A;  2CUF A;  1X2N A;  4S04 A;  1DGW Y;  3RKX A;  2ECC A;  1AOY A;  1ZTR A;  1VQN I;  2DJN A;  3HB9 A;  3ZGK A;  3BQZ A;  2JVG A;  4UHT A;  2F4I A;  1ZR4 A;  1FT9 A;  2NVT J;  1QZZ A;  2VE9 A;  4BBS J;  4I2O A;  1H89 C;  3JAM Z;  3JSP A;  1VQ5 I;  3OYK A;  2CUZ A;  3CUQ C;  3U1K A;  1MJ9 A;  2A3S A;  3Q9V A;  2BYV E;  5LGN A;  1DQU A;  1Y56 A;  2MYS A;  3V42 A;  4CCN A;  1W1W E;  2JSP A;  3L2V A;  1O3S A;  5IY5 H;  4NUB A;  1A6Q A;  3OYJ A;  2MG4 A;  2YX4 A;  4D1Q A;  2DA6 A;  2F5F A;  4IJA A;  4G12 A;  2IW5 A;  3ERM A;  4PJM A;  4CUG A;  1EJ9 A;  1YTY A;  3CCY A;  3G3Z A;  3S93 A;  2DOD A;  1FZP B;  3ZOB A;  4ZDP A;  2PJP A;  1J2X A;  2D45 A;  3BPV A;  3ASN H;  5DCF A;  4AD9 A;  3I3L A;  2Z1D A;  2KIF A;  5B66 C;  4RGU A;  1R5I D;  4HNV A;  5CKT A;  5LGU A;  1IRG A;  1OCC H;  2E1N A;  5IOY A;  1I6H J;  2JUC A;  1HXD A;  2KT0 A;  2P8T A;  1A04 A;  1GLN A;  2DDB A;  2Z33 A;  1D1A A;  3L2R A;  3BT9 A;  2V1X A;  3CJT B;  2DAO A;  4ENM A;  2CSO A;  2JJ7 A;  5D8K B;  3M8J A;  2JQ7 A;  2E35 A;  1QHH D;  1QPM A;  2VE8 A;  4FX4 A;  3I4N J;  1IXS B;  1S7O A;  4PUS A;  4F92 B;  5LHG A;  2IXS A;  1XC5 A;  5BMZ A;  4GO1 A;  2VKE A;  4ENK A;  2LKS A;  3SJM A;  2PMH A;  1REP C;  3FIS A;  3GFL A;  1WGX A;  4CGZ A;  2IS4 A;  2K9S A;  2B0L A;  2DMN A;  2QVO A;  3EET A;  1VQM I;  3ERE D;  1UCR A;  4OU0 A;  1MSF C;  1QBJ A;  4IRG A;  4QWQ A;  2JA7 J;  2JK3 A;  4NC8 A;  3HTU A;  2L7Z A;  5DEQ A;  3FXM A;  3QPH A;  1F1Z A;  5EEG A;  5CJ9 A;  2O8X A;  1Q1H A;  2R0Q C;  4XL9 A;  4U87 A;  1JKP C;  1D3Y A;  2HOT A;  4F93 B;  2WB1 A;  1OYY A;  3PNY A;  1U8B A;  1OJL A;  4DJA A;  4IPA A;  2R4G A;  4U0Y A;  3CUO A;  3K70 C;  3F6O A;  3D5S C;  2BBY A;  3H0D A;  3L9F A;  1MMA A;  3A1Y A;  4IKF A;  2HYG D;  2VL8 A;  2KHM A;  5E3N A;  3HOZ J;  4EAT A;  5IOZ A;  2FU4 A;  1TWG J;  2CW0 F;  5HDK A;  2OC6 A;  2MH2 A;  2KL4 A;  2LR8 A;  3FHN A;  4CCO A;  4BNC A;  2VN2 A;  1WJC A;  3OS1 A;  3J7Z I;  1IXR C;  4A6E A;  2P4W A;  3H92 A;  1SD4 A;  1G4D A;  3VSK A;  4F91 B;  3WU1 B;  3SHF A;  1TZL A;  4YEL A;  1OYW A;  1O7F A;  3LST A;  3TO6 A;  2M4K A;  4PK4 A;  5L3G A;  3ZPL A;  1W5T A;  3HHH A;  2O5R A;  2ZKZ A;  4KIG A;  2BY0 A;  3Q0U A;  2D1V A;  5K7H A;  1X3U A;  2R7R A;  1YYV A;  5KNL A;  2Y9Z A;  1CF7 B;  4HLX A;  1G6N A;  2MA3 A;  4A3B J;  4DBR A;  3C3W A;  2VBY A;  5J3L A;  3RZD J;  1MKM A;  5FLM J;  5J4Y A;  2V7F A;  5D5V B;  5IP9 J;  1BR4 A;  2DOE A;  3HUG A;  4RB2 C;  2M8G X;  4WXD A;  3ZMD A;  4KYW A;  4MNU A;  1QHG A;  2V79 A;  3BG7 A;  2H27 A;  3TP3 A;  4YRV A;  2D2W A;  3AG1 H;  2Y0S N;  4KMU X;  4LB6 B;  1XMK A;  3R0J A;  4YFK F;  4KFC A;  5HDG A;  2UWM A;  5HNH A;  1IDZ A;  1TBX A;  1VQ4 I;  2CO5 A;  1D8K A;  2STT A;  2DW4 A;  3E7L A;  1B72 A;  1TP4 A;  1WJE A;  2CRG A;  1KYW A;  1ZAR A;  4CZZ A;  1H0M A;  3CJR B;  2P81 A;  3NAR A;  2I8D A;  2DN0 A;  1JHH A;  4G9Y A;  1WH7 A;  3HEF A;  2LY9 A;  4GGG A;  1FOK A;  3LSH A;  1XGS A;  1UHS A;  4YEJ A;  4OIR F;  4LLN A;  5JVT A;  3HUG B;  3ZMU A;  1QGP A;  2EZI A;  5B3S H;  4M9X A;  2HDC A;  1MH4 A;  3DPL C;  3RYR A;  3BOQ A;  4PDK A;  1YW9 A;  3MAJ A;  1T56 A;  2K9Q A;  4E7S A;  3F3X A;  1O4X A;  2P7C B;  2R7T A;  4BEH A;  2DBB A;  1JTY A;  1B72 B;  5FFZ A;  2ECB A;  1USS A;  2Y30 A;  2GXA A;  2HQN A;  2BV6 A;  3FIW A;  3HOU J;  4X0G A;  2IPQ X;  2ZO4 A;  4UV9 A;  2FE3 A;  1A6I A;  1GUU A;  3EYY A;  4AIH A;  3K1P A;  4RMN A;  4HBL A;  3LMM A;  3FMS A;  5CVI A;  4FCY A;  3CCM I;  2ZME A;  3K10 A;  4XLH A;  2FD5 A;  1LEB A;  2Y75 A;  4AIK A;  2VON A;  2LKP A;  2VJ5 A;  1PUF A;  4N4O B;  4HQE A;  4HDV A;  3CMM A;  3EUH A;  3KEO A;  2LC2 A;  4Y33 A;  3KX2 A;  4DW6 A;  2KRC A;  2LY1 A;  5E3O A;  2OQG A;  3HG9 A;  4BEH B;  5JI6 A;  1IGN A;  4P9F A;  4RLF A;  3RQI A;  1BL0 A;  2J5P A;  3O3K A;  2HQR A;  4ETS A;  5CVV A;  1JKO C;  1P4A A;  2CMP A;  1ZGA A;  2WY8 Q;  3E6D A;  5LBQ A;  3CP8 A;  4HRI A;  4OIQ F;  2ZXH A;  1HKS A;  3F9K A;  2F4M B;  4IRI A;  4A3I J;  2EQR A;  2ZME B;  3E5U A;  3GF2 A;  1JKQ C;  1ZLJ A;  1FMV A;  2BEO A;  3QU6 A;  3RI4 A;  2NXN B;  3WTT C;  1ZR2 A;  3TBI A;  2FOK A;  2OJE D;  1PUF B;  4LLG F;  2PJR A;  2MD0 A;  3NEU A;  2KRH A;  4M3F A;  3S3N A;  3CDL A;  4EJO A;  3K7A J;  4Y4R A;  2O03 A;  4QSH A;  4IQ4 A;  2GIZ A;  3KYD B;  2GXG A;  1YIT I;  2ZFU A;  4D7N A;  4DYC A;  4NHJ A;  1JUM A;  2DXI A;  1J59 A;  2CU7 A;  1EV7 A;  2LDU A;  4P55 A;  1ZHF A;  4BHP A;  3V8J A;  5HVQ C;  3R0A A;  3BY6 A;  2ESN A;  3I54 A;  2A6E F;  3TDU C;  4CIC A;  1TWC J;  5E17 F;  4XRS A;  1BR1 A;  2CW8 A;  1W4M A;  4DQ2 A;  1ZLK A;  4GDF A;  2RC4 A;  4MO7 A;  2BY2 A;  4XSX F;  3HXL A;  2O0Y A;  2VT2 A;  4CCM A;  3C2B A;  4A69 C;  3K1N A;  2XRN A;  1RC9 A;  3I4M J;  1MND A;  2Y69 H;  4U7D A;  2PJR B;  1LE8 B;  5LHH A;  2ZXJ A;  2G0E A;  2E71 A;  2HTJ A;  4AYB A;  1IDY A;  3WGH A;  1FSE A;  3BDD A;  2CQN A;  4KIB A;  2VI6 A;  5IYC J;  2COB A;  2M5W A;  4OAZ A;  2XF6 A;  2GAU A;  2E7W A;  2M2E A;  1GV5 A;  2R7O A;  5F64 A;  5BPI A;  1X58 A;  2JA5 J;  5L3D A;  1YJN I;  4GFB A;  2VC0 A;  1MBJ A;  1QU3 A;  2IS6 A;  2V4J C;  3MKL A;  4UXN A;  3KZZ A;  2F5E A;  2XGX A;  3HIF A;  5CQE A;  3QWL A;  2HYJ A;  2HGC A;  3HRS A;  3WHC A;  4AWX B;  2CS3 A;  3GO5 A;  2BOL A;  4PGH A;  4RGS A;  2RAE A;  3MFK A;  1T8I A;  3EYI A;  2Q8K A;  1YHQ I;  2IA1 A;  4E7K A;  1TC3 C;  1LKX A;  3FMR A;  2DYS H;  3WG9 A;  4JQF A;  4B44 A;  1MZB A;  3PSF A;  4ENJ A;  2BW3 B;  1JGG A;  5IPA A;  3FM3 A;  3KLO A;  2NS8 A;  2X6O A;  2XKO A;  5FKL A;  4OWR B;  3KIO A;  3G73 A;  2W48 A;  1IN6 A;  2ZME C;  5M3M J;  2AHQ A;  2FQ4 A;  2HPI A;  2RNJ A;  4IHY A;  3GTP J;  1FYL A;  2XV4 S;  1SD5 A;  1VZ0 A;  3M9A A;  2DOF A;  1ON1 A;  1OFC X;  2QM3 A;  2X1C A;  2XAJ A;  1K78 A;  2KZV A;  3L09 A;  1IW7 F;  4FT8 A;  4CDG A;  2VQG A;  1XDS A;  2ME6 A;  2CFO A;  4AYB N;  3LSG A;  1AHD P;  2DQR A;  3IWF A;  3VEP A;  3F22 A;  2ID6 A;  2QSG X;  1WQ2 A;  2O61 A;  2ZBK A;  1B1B A;  1OCR H;  3MVP A;  3AFH A;  5DM6 F;  2XB5 A;  3KYC B;  1ZG5 A;  5KCM A;  4IRH A;  1T2K A;  4S0H B;  1S9H A;  4JX6 A;  5IYD J;  1W7P A;  5GAH J;  4MIM A;  4FHT A;  5D5X B;  5IP6 A;  1MDM A;  1B8I A;  4OAY A;  4HPQ A;  1DP3 A;  4X6A J;  3K2Z A;  2IT0 A;  5DYM A;  4KIF A;  2H6B A;  1K78 B;  3OS0 A;  2ADU A;  4N9I A;  2F5V A;  2I5U A;  2XF5 A;  2VXZ A;  3E0J B;  3NRV A;  4FE4 A;  4UB8 C;  3CDI A;  1YW8 A;  4FTH A;  4HF0 A;  2L7M P;  3QOE A;  1UST A;  4HX4 A;  4HST A;  4DYQ A;  1GVD A;  5K5O A;  2X0L A;  2VJJ A;  2EK5 A;  4LLL A;  1LFP A;  2DOA A;  2HZD A;  1HQC A;  2RQQ A;  3RKQ A;  4JP0 A;  3W2V A;  3COA C;  2FMY A;  1V55 H;  1G3W A;  3S15 J;  1QRY A;  4M3E A;  2A61 A;  2CG4 A;  1EA3 A;  2K86 A;  2NVY J;  4QPO A;  2A6H F;  3FHZ A;  3SFI A;  3OYF A;  3TMO A;  2X1E A;  3T5X A;  4CH7 A;  1W7P B;  1LDJ A;  3JRA A;  1UZC A;  1B8I B;  2B63 J;  1FBS A;  2E19 A;  1ZG3 A;  2ICW G;  2G7H A;  1WCM J;  2K4B A;  1KU9 A;  1YS6 A;  3DU6 A;  2PEX A;  4M72 A;  2VIX A;  2OTL I;  2CUJ A;  2E5Z A;  5GAE J;  2DI3 A;  2PG4 A;  2EA2 A;  2CQK A;  1IN8 A;  3PQK A;  5D4S A;  4FAS D;  4WF2 A;  3ABU A;  3DV8 A;  1IO2 A;  3ZN1 A;  2X6Y A;  5FLV A;  2NNY A;  1DPU A;  4PSW A;  2NVX J;  3HOY J;  4HDU A;  4IHT A;  4AVP A;  1MJA A;  2DA2 A;  4R1H A;  1SEU A;  2B9S A;  1A31 A;  1BIA A;  3KP2 A;  1YX3 A;  1O3Q A;  3WGI A;  3DEU A;  3FXU A;  1LUJ B;  1Z6R A;  3SZT A;  2HXO A;  1IRF A;  4Y7N J;  1P92 A;  1HC8 A;  3JRD A;  5J47 A;  1S7E A;  4RAZ A;  3DTE A;  2HDD A;  3Q5F A;  2CFX A;  2KPM A;  4XKW A;  5LLQ A;  3HKZ A;  1XX5 A;  1MJB A;  4HNU A;  1JHF A;  4EJT A;  4LB5 A;  1E3H A;  4BHC A;  3F23 A;  1ZGJ A;  4W1U A;  4P96 A;  2DA3 A;  3PNT A;  3BRO A;  4ZDL A;  2HVR A;  1R4M B;  4IXA A;  3P9K A;  3CCU I;  2OBP A;  3K6G A;  2HS5 A;  3CO7 C;  4Y52 J;  1HKQ A;  3AG3 H;  4EVI A;  1MBF A;  2HOS A;  3KZI C;  4UB6 C;  4KN7 X;  1D5Y A;  1KU2 A;  3MCZ A;  4UUV A;  1UMQ A;  2BGC A;  2XPW A;  5E20 A;  1ODD A;  2PLY A;  5FRO A;  3FKI J;  4OMZ A;  1JUP A;  1XCV A;  2QCO A;  1K83 J;  1DGR M;  1G2H A;  4U0W A;  4M6V A;  1DUX C;  3Q9S A;  4IHV A;  4D9J A;  4PFP A;  2NNN A;  2FBI A;  3FXL A;  1VQK I;  3D5R C;  4XOR A;  3S17 J;  3BR6 A;  3A0B C;  1TLH B;  5TGT A;  1RR8 C;  2XGE A;  3RSN A;  2EBI A;  4ZDO A;  1S8N A;  5K5R A;  3GZ5 A;  2JPB A;  3SFZ A;  1J09 A;  3H9J A;  4EJU A;  1LVK A;  4KIS A;  3HRU A;  2CQ7 A;  1UG2 A;  4F3Q A;  2HQ5 A;  2M8E A;  4MHG A;  5GTH C;  5C44 J;  1VQP I;  3PO2 J;  1V3F A;  3BWG A;  3F8F A;  2JA8 J;  1JKR C;  1MNE A;  5LEK A;  5CVR A;  1RNL A;  3OYM A;  1ETY A;  1TW2 A;  4XKC A;  2R7V A;  4LOC A;  3VOD A;  3VFZ A;  2YU9 J;  5CYV A;  3VOE A;  1OPC A;  2R7W A;  4LFU A;  3LA2 A;  1KON A;  1D1B A;  3FXK A;  1ZGW A;  1PDN C;  2MW8 A;  3O2P E;  5EG0 A;  5E1X A;  3RKY A;  4ESF A;  4A2U A;  2X9D A;  3JSO A;  1LEA A;  3KLN A;  3J81 K;  2K9N A;  2W85 A;  4C30 A;  2DA1 A;  2DA4 A;  2F48 A;  5C4J J;  5FGM A;  4C3H J;  1YO5 C;  4DZP A;  3JTH A;  3H5R A;  3V8K A;  5HLH A;  2Z99 A;  4ZTF A;  1TQI A;  1SFE A;  2R7F A;  5GPC A;  5ICC A;  2A69 F;  1U6G A;  4Z2Y A;  2W84 A;  3V7C A;  3ZRG A;  2Y31 A;  4IEJ A;  1R1T A;  2W24 A;  2NAZ A;  2RV8 A;  3MEX A;  4M3G A;  3WHB A;  1R1U A;  2NS0 A;  5LRR A;  4BQA A;  1BW5 A;  2L3D A;  3BQY A;  1L3L A;  1BI2 A;  3ZQH A;  5EG0 B;  4DGW B;  2XHK A;  2JPC A;  1N75 A;  2M3A A;  2PFB A;  5EDN A;  3QPL A;  2WAE A;  1BOB A;  3IV5 A;  1U9O A;  4B3X A;  5B1A H;  3GBG A;  1WZ2 A;  3CMY A;  3ASO H;  3L2Q A;  1FLI A;  3U2R A;  4NQW A;  3A01 A;  1DDN A;  3NWS A;  3O6B B;  2E60 A;  1ZRD A;  4RA2 A;  4U88 A;  1WKM A;  3CLQ A;  3DBL B;  2V1D A;  3FXQ A;  4IVN A;  1HOM A;  2Z9O A;  2K3P A;  4EM1 A;  4DIQ A;  3LAJ A;  3M3Y J;  2A6T A;  1I27 A;  2IRF G;  1EH6 A;  4E7Z A;  2P5V A;  3HL2 A;  5DUK A;  4BJ5 C;  1IXC A;  1XB4 A;  4IHW A;  2PMZ N;  2MSY A;  1Z05 A;  1XSV A;  1ZRE A;  3FKJ A;  4F55 A;  2BXY A;  2Q2E A;  1W0U A;  3PJR A;  3ZQI A;  3G2B A;  3CME I;  3OIO A;  3UKG A;  1FSH A;  4PJ0 C;  4LMY A;  4NQW B;  4QPQ A;  3A01 B;  2R92 J;  1IUF A;  3A03 A;  2TDX A;  4DBQ A;  5D8L B;  3OYB A;  4CXF A;  3CTA A;  2H09 A;  1VFC A;  4A3L J;  3PO3 J;  3WG7 H;  5GTI C;  1HBX G;  2H6C A;  5E1Z B;  2IJL A;  2FNP A;  2EFN A;  1ZK8 A;  1BN5 A;  4MQV A;  5IYB J;  2OAZ A;  1TNT A;  1QNT A;  1S7A A;  3KP3 A;  1R22 A;  3VDX A;  1PVE A;  2A5Y B;  4KDP A;  2M4G A;  1R36 A;  4C2U A;  1TW3 A;  3RJP A;  2VPL A;  1Y6I A;  2MBF A;  2H1L A;  4EM2 A;  1BR2 A;  3HJE A;  5EEA A;  2XUB A;  2ZB9 A;  1X2M A;  3OYL A;  3V7S A;  2Q2E B;  3W6K B;  1SAU A;  2QZ8 A;  5GPA A;  2L2O A;  4G7H F;  2OTJ I;  2CW7 A;  2ZXI A;  2BY1 A;  1KZH A;  4L5J A;  1S6L A;  4I98 B;  3X2Q H;  1F9N A;  4XKB A;  1NHA A;  1LDK B;  2LBF A;  3BP8 A;  4XN0 A;  2DPU A;  5C4X J;  3G6E I;  4M6X A;  2YUS A;  5HLG A;  3BR3 A;  1RPW A;  1IV8 A;  2HYF A;  2Y0S A;  1CF7 A;  2AXT C;  1OMI A;  3QOP A;  2IGN A;  2XPU A;  4X1E A;  2K7L A;  1E3O C;  1BC8 C;  2RVC A;  3H3Z A;  2COM A;  2EB7 A;  4A3G J;  1CQT A;  1XSX A;  5BQT A;  2HOA A;  2EIL H;  3ZMZ A;  1TT0 A;  1EKE A;  4I0B A;  4II2 A;  2ZNY A;  1D0Z A;  4ZC3 A;  2MD5 A;  2RDP A;  4YFX F;  1R1V A;  4M9Z A;  2FSW A;  2YX7 A;  3EUK L;  1QVU A;  2HOE A;  5JFR A;  1Z91 A;  2H94 A;  1GXQ A;  3HRT A;  3U1D A;  2V9V A;  1HSJ A;  2XKP A;  3LOC A;  4HV5 A;  3JRE A;  2HVS A;  3K4N A;  2LY2 A;  2LBF B;  1HW1 A;  9ANT A;  1YS7 A;  5DM7 F;  2ZCW A;  5H6R A;  4PCQ A;  1DPR A;  2AQE A;  1FPQ A;  1I3Q J;  5K7F A;  1V54 H;  2F4O B;  5ILV A;  2IEK A;  1W36 C;  1VQL I;  4L18 B;  3CES A;  1I1S A;  1RR7 A;  4LIU A;  2R7U A;  2LVS A;  4Q47 A;  2WTE A;  4OMY A;  4XLN F;  4UUS B;  1L0O C;  4RB1 A;  3WTW C;  2F5C A;  2RKH A;  3JRI A;  1GDT A;  3JR9 A;  3GLL A;  1UFM A;  1ORK A;  2OPT A;  3HSE A;  5K7Z A;  2FEZ A;  2FOW A;  1BM9 A;  3DU5 A;  2GWR A;  3S2D J;  2BZT A;  4CA0 A;  4A0Y A;  3N4M A;  4IL6 C;  3FBI B;  4JOM A;  2OA4 A;  3REO A;  1SVL A;  3C1D A;  4XLC A;  1N78 A;  1K4S A;  1YX5 A;  3W2W A;  2DTZ A;  2WAQ A;  3F72 A;  3IAS 2;  2XAG A;  1V5E A;  3K69 A;  4G8X A;  4I7H A;  4MQ9 F;  3RPU A;  5TRD A;  1V4R A;  4LG3 A;  3M1E A;  4PJL A;  2FBH A;  1XPX A;  4KIC A;  2HPM A;  1TNS A;  1NG6 A;  1ZKG A;  5DS9 A;  4XM3 A;  4ZYD A;  3AG2 H;  2Z3Y A;  4U7B A;  1R7J A;  1B59 A;  1HDD C;  3QOD A;  2Y9Y A;  3K4B A;  1K61 A;  2P5K A;  4XMY A;  3LL7 A;  3TOA A;  3PUF A;  5K5Q A;  3VPR A;  2GOX B;  2VOD A;  4CYC A;  1U2W A;  2BY3 A;  1QO0 D;  2RQP A;  4B48 A;  2EIJ H;  2JSC A;  3GFI A;  5LFA A;  4PFO A;  4HX8 A;  2Y0M A;  2E1M B;  4L5I A;  4XSZ F;  5FLX Z;  3ONQ A;  4AID A;  1FIP A;  4IOA F;  2VPR A;  4HV6 A;  3H1C A;  1QPI A;  4YFN F;  2D5V A;  1FOX A;  1J5Y A;  4TV7 A;  2IS2 A;  3HOT A;  4AUX A;  2FML A;  3WTV C;  1JI8 A;  1BIB A;  5FKO A;  3RKW A;  1IN4 A;  3ESW B;  5HNF A;  3L00 A;  1K6O A;  1T38 A;  1W7P D;  1FOW A;  3GCM A;  1G3Y A;  2OD5 A;  2QA4 I;  2EV5 A;  3LSI A;  3M8E A;  3IUO A;  5AIP A;  4GCV A;  3GFJ A;  1DU0 A;  1FTT A;  5C3E J;  2R7Z J;  1U9N A;  2ZJQ F;  2RGV A;  1LQ1 A;  4CZC A;  3TW6 A;  4ZZL A;  2HR3 A;  2MFZ A;  4CYC B;  1AA7 A;  2JA2 A;  3ZP5 A;  2WAQ N;  3KEY A;  4RDU A;  2CV2 A;  3T1B A;  4HQM A;  4Y15 A;  1FMW A;  3JRB A;  2VXD A;  3OOU A;  5E18 F;  4IHS A;  5CPR B;  2HEO A;  3FXJ A;  3HGG A;  3C18 A;  3J7A Y;  4S05 A;  1P7J A;  3QYB A;  2MAB A;  1B4A A;  2MLG A;  3GTM J;  4D5F A;  2VQC A;  3OOP A;  3ABL H;  5HOO A;  3F8C A;  1Z3X A;  1FTZ A;  5J6X A;  2ZXW H;  3LQQ A;  3FXR A;  3P9C A;  3U21 A;  3ZMS A;  1KGS A;  5HOD A;  2XIG A;  3BJO A;  3KP5 A;  4HZF A;  4F52 A;  3HZJ A;  3LQR A;  2M87 A;  1G3S A;  4BHB A;  3CD6 I;  5FD6 A;  3G1O A;  3HYI A;  5ICE A;  5HLI A;  3KYL A;  3SZP A;  5BPD A;  2IP2 A;  2LOO A;  2DT5 A;  4XBF A;  1ETQ A;  2K27 A;  4UUT A;  4ZYG A;  5F0H A;  3KP4 A;  2LTP A;  1LE8 A;  3Q0V A;  2E2I J;  3S3M A;  4Y13 A;  2X48 A;  3MZY A;  3R6S A;  1ERD A;  3EPZ A;  3GUD A;  4L9J A;  2Q1Z B;  2OCC H;  3PSI A;  3T0Y A;  1N77 A;  5EJC A;  3VB2 A;  2WAF A;  2R7S A;  2VBX A;  2VKH A;  2R3S A;  3QPT A;  3LSK A;  1SD6 A;  2DA5 A;  3KZY A;  4LK1 F;  2FJ1 A;  1RRJ A;  1HF0 A;  2V6E A;  5B5E C;  2E1O A;  4BGD A;  2W82 A;  4BAC A;  2GBY A;  2RRE A;  1AKH A;  2KIQ A;  2V1N A;  3OYE A;  2E1M C;  4RM2 A;  2HFH A;  1R58 A;  2DT6 A;  5JLW A;  3KP7 A;  3A0H C;  2AO9 A;  2LFB A;  3CJN A;  2A07 F;  4O3M A;  3D1N I;  2CUE A;  2ZSH B;  2R93 J;  1XGN A;  2PMU A;  3IP4 B;  3PNV A;  4M71 A;  3OYA A;  3J7A O;  4OIN F;  1XN7 A;  5FD5 A;  4EEF G;  2P5L C;  3A02 A;  3H5N A;  1JUS A;  2VBW A;  2NRA C;  1T08 B;  2M0M A;  3O8G A;  4AU7 A;  2M0C A;  2OQR A;  2XAH A;  3M7G A;  1TWA J;  3E1S A;  4HSR A;  1YIJ I;  2EA4 A;  5KAF C;  4JX5 A;  1GV2 A;  2BW3 A;  2K3F A;  1X1P A;  1G59 A;  2GQQ A;  3QRF F;  2K02 A;  3D0S A;  3DEE A;  4LJZ F;  1RI7 A;  1O57 A;  4RM3 A;  1ACI A;  4XLP F;  1IAW A;  1AKH B;  3OIP A;  3IKT A;  1MH3 A;  2QEN A;  1X1B A;  2K5C A;  4AC0 A;  1VQO I;  3Q3S A;  1LVA A;  1IF1 A;  1WJD A;  3HRM A;  4H4K C;  2OCE A;  1MBE A;  4OIO F;  4BXU A;  4H0E A;  3T8R A;  2KQR A;  1WHU A;  4G6T B;  2KDO A;  1MMN A;  2E5N A;  5KHD A;  1SFU A;  4R8H A;  3I71 A;  2K9L A;  1VQ7 I;  1U5T A;  2ISY A;  3CJQ B;  2JRM A;  4HW0 A;  2LF8 A;  2JVH A;  2ELH A;  2XF7 A;  3QYF A;  2V1U A;  3ZR8 X;  3CCQ I;  4BYY A;  2QKL B;  1BJZ A;  2LD5 A;  2DK8 A;  3C2H A;  3JRC A;  4XID A;  2JN6 A;  4J01 A;  4A12 A;  1YJW I;  1APL C;  1LDD A;  3J80 K;  5DD4 A;  4YIR X;  3MKW B;  1MBH A;  2FUG 2;  1BW6 A;  1WRJ A;  1Z6T A;  3ELK A;  3I55 I;  3ULQ B;  2R7Q A;  3TL4 X;  3GTG J;  3I4P A;  2ZNZ A;  1UG0 A;  4A6D A;  4EV0 A;  1XCB A;  4XLA A;  4BE0 A;  1Z3Y A;  5BS6 A;  4D5C A;  1FP1 D;  3M07 A;  3FF5 A;  3HPH A;  3ZN0 A;  2WBM A;  3P7N A;  1OR7 A;  1U5T B;  4MTD A;  5AIQ A;  3DEW A;  2Z5U A;  2HU9 A;  2OZ6 A;  5A2Q K;  3ZQQ A;  2MGQ A;  1PP8 F;  5J1Y A;  4N4N B;  4L5E A;  1G3T A;  2DMU A;  4BQQ A;  4M6Y A;  2CH0 A;  1SMY F;  2ISZ A;  3GX4 X;  4Q4Z F;  5IT9 Z;  1X3Z B;  4NNJ A;  1NG7 A;  2B7E A;  2MC3 A;  3LFK A;  4CO8 A;  1W36 D;  2W7N A;  1J75 A;  3IRQ A;  4RS8 A;  1I50 J;  5L3E A;  2G9W A;  3NAU A;  3I64 A;  3R60 A;  3IKV A;  4RB3 C;  1R23 A;  4LG0 A;  4KJZ A;  5CVU A;  5FKM A;  4RBO A;  2AQF A;  1XD7 A;  3B73 A;  2MH9 A;  2CV0 A;  6PAX A;  2CQQ A;  3GTQ J;  2GM4 A;  3H3U A;  4CHU A;  3I59 A;  3H9Q A;  4PSX A;  3VYR B;  2YR2 A;  3S2H J;  1PYV A;  3PIO F;  5E1W A;  3CQZ J;  2ELK A;  2A68 F;  1OQY A;  3B6A A;  3TO7 A;  4ON0 A;  3ZQG A;  4HX7 A;  5BOX A;  4ENN A;  5EYR A;  1T95 A;  2LLK A;  1I6X A;  3DBH B;  3EUA A;  3F0C A;  3OSF A;  3S3O A;  1ETK A;  2BHZ A;  3C2G A;  3OV8 A;  3DLL F;  2JUG A;  3WTZ A;  2WY7 Q;  1GT0 C;  3JRF A;  2E1C A;  2IGO A;  2KFD A;  4II3 A;  2M7A A;  4A0Z A;  4MEX F;  1SVM A;  3S1Q J;  4RAF A;  3VYS B;  3WGG A;  1ON2 A;  3TDZ C;  4O5V A;  4E6K G;  3CCS I;  3HTS B;  2EIM H;  4LG0 B;  3PQJ A;  3KFW X;  4AVZ A;  5LD2 C;  2WC2 A;  1UHW A;  3BTL A;  3WTU C;  1A35 A;  3FMQ A;  2EZH A;  1STZ A;  3BG3 A;  4A5N A;  3DKX A;  4BS9 A;  2W25 A;  4K2E A;  5F0F A;  4E70 A;  2R5Y A;  3PFI A;  3CP2 A;  3PFY A;  4RAY A;  1T6S A;  3I59 B;  3TP0 A;  5F1R A;  3HOX J;  4RGX A;  3LA3 A;  2C6Y A;  1UJ8 A;  3I53 A;  3RIR A;  1SMT A;  2E2H J;  5FFX A;  4XLE A;  4JBA A;  3DFG A;  3AAF A;  2VOO A;  1RES A;  2KMU A;  2EIK H;  1OYI A;  1PUE E;  2L01 A;  4ZYE A;  5FRM A;  2EIN H;  1YW7 A;  4DOZ A;  2ACJ A;  4UVA A;  3GTL J;  1HKT A;  2DU9 A;  4P1W A;  2P6S A;  3MWM A;  1JXS A;  3GME A;  4EGZ A;  3M1C A;  1IUY A;  4B09 A;  5LEJ A;  2IS1 A;  1U5T C;  5J4V A;  1KU3 A;  1QZE A;  2ID3 A;  1MBG A;  5KAI C;  2DT7 B;  1MD0 A;  4EGY A;  2BXZ A;  4KT6 A;  3DF8 A;  5ILU A;  1Z1D A;  3OIQ A;  4BY7 J;  4ANJ A;  4OOI A;  2R5Y B;  1YI2 I;  3GTK J;  4L0Y B;  2NOJ B;  2Y2Z A;  3PL8 A;  4G7Z F;  4JK1 X;  1MIJ A;  1ETO A;  2VB6 A;  2WV0 A;  1R49 A;  5F08 A;  3N05 A;  5IT3 A;  2VLA A;  4V2F A;  4BH9 A;  3WTX C;  2DDA A;  2KRF A;  1O3T A;  2VQH A;  1R9T J;  3AL0 B;  2E34 A;  3E5X A;  4XRF A; 
#chains in the Genus database with same CATH homology
 5IYB J;  2ECB A;  3TW7 A;  3Q0W A;  2Y30 A;  2H8R A;  3FIW A;  3HOU J;  1VI0 A;  4A3F J;  1NK2 P;  1A6I A;  1GUU A;  2EZK A;  3BR5 A;  5EEA A;  3IH3 A;  2ZB9 A;  1X2M A;  4FCY A;  4BBR J;  5GPA A;  1SAN A;  3PM1 A;  4A3D J;  3JRG A;  2FD5 A;  1H88 C;  1PUF A;  1Z0X A;  3TED A;  5C4X J;  1IC8 A;  4I76 A;  5M5X J;  1MBK A;  2YUS A;  3BR3 A;  1RPW A;  3M4O J;  4DW6 A;  2R5Z A;  5E3O A;  2XPU A;  4X1E A;  1E3O C;  1IGN A;  4V2G A;  4M3D A;  4A3E J;  4B4C A;  3RQI A;  1BL0 A;  4BXX J;  4A3G J;  1CQT A;  4A93 J;  1JKO C;  3BR1 A;  4XRS G;  2HOA A;  3HBL A;  1Y1V J;  1XG1 A;  1POG A;  1JT0 A;  4DYR A;  1VND A;  3OSG A;  4XK4 A;  5EGO A;  4A3I J;  2EQR A;  1QVU A;  2K40 A;  1JKQ C;  1RKT A;  3JRE A;  3LOC A;  1ZR2 A;  1PUF B;  9ANT A;  4M3F A;  1I3Q J;  2IAI A;  3CDL A;  5K7F A;  3K7A J;  1Y1W J;  1IJW C;  2R5Z B;  2IEK A;  4QSH A;  1RR7 A;  4NDL A;  4D7N A;  4DYC A;  2LVS A;  1JUM A;  1FJL A;  3HOV J;  2CU7 A;  3RZO J;  3BTC A;  1P7I A;  4A3C J;  2LK2 A;  5EZG A;  4BKX A;  4UUS B;  1TWF J;  2JA6 J;  3JRI A;  1GDT A;  3FK6 A;  1TWC J;  3HM5 A;  4XRS A;  3JR9 A;  1Z77 A;  1ORK A;  2OPT A;  4DZJ A;  5K7Z A;  1U78 A;  4MO7 A;  3S2D J;  2NOG A;  5F1J A;  1BA5 A;  5EGO B;  2JWT A;  4QTR A;  3C2B A;  4A69 C;  5M5W J;  5J1U A;  3I4M J;  2DTZ A;  1LE8 B;  1VF9 A;  1ETV A;  1DU6 A;  2G0E A;  3LSJ A;  1WPK A;  3G1L A;  1WI3 A;  1IDY A;  5FKK A;  4M3B A;  1ZKG A;  2N8G A;  3HDD A;  5DS9 A;  2VI6 A;  1Q1V A;  5IYC J;  2COB A;  1F36 A;  1FEX A;  3ZQF A;  3H3V K;  2I10 A;  2LP0 A;  2M2E A;  5IP7 J;  1GV5 A;  5JLX A;  1HDD C;  2JA5 J;  1X58 A;  4GFB A;  2Y9Y A;  1K61 A;  1MBJ A;  2XGD A;  3VPR A;  1ETX A;  4CYC A;  3MKL A;  3GTO J;  3QPS A;  1FIA A;  2HYJ A;  1ITY A;  1LFU P;  3WHC A;  1FIP A;  3LSR A;  1ENH A;  5GP9 A;  2VPR A;  1QPI A;  2D5V A;  4C2M J;  3K2A A;  5BNG A;  1RET A;  2RAE A;  4AUX A;  2KDZ A;  1TC3 C;  5F27 A;  5FKO A;  2YS9 A;  2DMQ A;  4A3M J;  1F43 A;  1JGG A;  5IPA A;  1EF4 A;  2DMT A;  2NS8 A;  2X6O A;  1IV6 A;  1WH5 A;  3G1M A;  5FKL A;  2W48 A;  5M3M J;  1DU0 A;  1YRN A;  1FTT A;  3O8H A;  2AHQ A;  2FQ4 A;  5C3E J;  2R7Z J;  1U9N A;  5F04 A;  4IHY A;  3GTP J;  3TW6 A;  4CYC B;  3HOW J;  2L0K A;  2CQX A;  3HGY A;  4J19 A;  1HDP A;  1OFC X;  2WAQ N;  2XPV A;  4RDU A;  3JRB A;  3OOU A;  2ME6 A;  4AYB N;  3HGG A;  3LSG A;  1AHD P;  1P7J A;  3ZQL A;  4W97 A;  1TWH J;  2HI3 A;  3BTJ A;  3GTM J;  4FE7 A;  1SFO J;  2IBD A;  4D5F A;  2ID6 A;  5EF6 A;  5M5Y J;  4IHX A;  1MSE C;  3S1M J;  3BG9 A;  3MVP A;  5E3M A;  3S16 J;  1FTZ A;  2XB5 A;  4FIS A;  2VUM J;  4UUS A;  1H8A C;  4S0H B;  5HOD A;  1AU7 A;  5IYD J;  4JX6 A;  1OCT C;  1ETW A;  4MIM A;  5IP6 A;  1HCR A;  4MFD A;  1YRN B;  1B8I A;  3G1O A;  2JMW A;  5E3L A;  1NK3 P;  4X6A J;  3HKZ N;  1T33 A;  1HLV A;  1ETQ A;  4UUT A;  1A5J A;  5F0C A;  5F0H A;  1LE8 A;  2LTP A;  2O9L A;  3Q0V A;  4FE4 A;  2E2I J;  4FTH A;  5J1R A;  4B3A A;  2X48 A;  2L7M P;  2DMP A;  3DCF A;  4DYQ A;  1GVD A;  3ZQC A;  2HXI A;  2XSD C;  3RKQ A;  4JP0 A;  2CUF A;  2NS7 A;  1X2N A;  3S15 J;  1QRY A;  4M3E A;  2ECC A;  2DA5 A;  2FJ1 A;  1HF0 A;  2NVY J;  1ZTR A;  3SFI A;  2E1O A;  2DJN A;  2GBY A;  3HB9 A;  4QIW N;  3JRH A;  1AKH A;  3JRA A;  3BQZ A;  1ZR4 A;  2EH3 A;  2NVT J;  1B8I B;  4BBS J;  4C3I J;  2B63 J;  2E19 A;  1H89 C;  1MNM C;  5JLW A;  5FKN A;  1WCM J;  2AO9 A;  2LFB A;  3D1N I;  3MN2 A;  2O8K A;  2CUE A;  2R93 J;  2FX0 A;  4EEF G;  3A02 A;  1JUS A;  3O8G A;  2L9R A;  2WB1 N;  2M34 A;  2M0C A;  1QVT A;  2VKV A;  2MG4 A;  5FLV A;  1TWA J;  2NVX J;  3HOY J;  4JX5 A;  2DA6 A;  1GV2 A;  2DA2 A;  4G12 A;  2H1K A;  5M3F J;  3CCY A;  1JTX A;  3ZOB A;  4MFE A;  3H0G J;  3SDG A;  1AKH B;  4D7M A;  1MH3 A;  2HXO A;  4Y7N J;  3JRD A;  4AC0 A;  4HNV A;  1S7E A;  3Q3S A;  5DTD A;  5IOY A;  2HDD A;  1I6H J;  1MBE A;  2KT0 A;  3BT9 A;  2JJ7 A;  4W1U A;  2DA3 A;  3I4N J;  3S14 J;  1XS9 A;  3QQA A;  1XC5 A;  4Y52 J;  2VKE A;  1BJZ A;  2LD5 A;  3SJM A;  1MBF A;  2EZL A;  3JRC A;  4XID A;  2JN6 A;  3FIS A;  1D5Y A;  2HOS A;  1APL C;  1UMQ A;  1WGX A;  2XPW A;  3IH2 A;  2K9S A;  3IH4 A;  2DMN A;  1MBH A;  3FKI J;  1BW6 A;  1JUP A;  3W6V A;  2QCO A;  1MSF C;  1K83 J;  1LFB A;  3GTG J;  2JA7 J;  1G2H A;  2JK3 A;  4M6V A;  2L7Z A;  2TCT A;  4IHV A;  3BG5 A;  4B1R A;  4D5C A;  3S17 J;  2CJJ A;  2M9H A;  3BR6 A;  2XGE A;  2R0Q C;  2EBI A;  3LNQ A;  1JKP C;  1IG7 A;  2HOT A;  3DEW A;  1U8B A;  2WV1 A;  1OJL A;  1UG2 A;  5C44 J;  2HQ5 A;  3PO2 J;  2MGQ A;  4ABZ A;  5J1Y A;  2JA8 J;  4L5E A;  5EZH A;  2DMU A;  1JKR C;  1ETY A;  4LOC A;  2YU9 J;  2LKX A;  3S1R J;  1IRZ A;  1I50 J;  5E3N A;  1ZGW A;  3HOZ J;  3NAU A;  2MW8 A;  5IOZ A;  5EG0 A;  1TWG J;  2X9D A;  2LR8 A;  5FKM A;  4RBO A;  4A3K J;  3GTJ J;  2CQQ A;  3GTQ J;  2K9N A;  2GM4 A;  2DA1 A;  2DA4 A;  5C4J J;  3S2H J;  4C3H J;  4BY1 J;  4DZP A;  4I6Z A;  3CQZ J;  2ELK A;  3B6A A;  3ZQG A;  4C3J J;  1B72 B;  5EYR A;  5GPC A;  2LLK A;  3OSF A;  3F0C A;  1ETK A;  1GT0 C;  3Q0U A;  3JRF A;  2Y31 A;  4IEJ A;  5K7H A;  3L1P A;  2TRT A;  4A3J J;  2Y9Z A;  4A3B J;  4M3G A;  2XB0 X;  3S1Q J;  3WHB A;  1BW5 A;  3BQY A;  5J3L A;  3RZD J;  3ZQH A;  5EG0 B;  5FLM J;  2XGC A;  5EDN A;  3QPL A;  3S1N J;  3BTL A;  5IP9 J;  3IV5 A;  1U9O A;  2EZH A;  3BG3 A;  1JT6 A;  3GBG A;  2M8G X;  4MLO A;  5F0F A;  3FK7 A;  2L7F P;  2R5Y A;  3TP0 A;  3HOX J;  3CMY A;  1RKW A;  5FJ8 J;  2E2H J;  3A01 A;  3TP3 A;  2NVQ J;  1RES A;  2Y0S N;  1NTC A;  2ME0 A;  1OCP A;  2OF7 A;  1HOM A;  1JJ8 C;  1IDZ A;  2XRL A;  3E7L A;  1B72 A;  1ZQ3 P;  2GLO A;  3GTL J;  3M3Y J;  2CRG A;  4IHW A;  2P81 A;  3NAR A;  2O7O A;  2DN0 A;  2PMZ N;  2MSY A;  1WH7 A;  3HEF A;  2LY9 A;  2ID3 A;  1MBG A;  1UHS A;  4XRM A;  2QF7 A;  1W0U A;  3BR2 A;  3ZQI A;  4JYK A;  2E2J J;  1W0T A;  2R5Y B;  4JX4 A;  4BY7 J;  2EZI A;  3OIO A;  3UKG A;  3GTK J;  1MH4 A;  2Y2Z A;  4XIC A;  2R92 J;  3A01 B;  1IUF A;  1ETO A;  3B6C A;  5F08 A;  3A03 A;  3BTI A;  2DA7 A;  4V2F A;  1T56 A;  1VFC A;  2K9Q A;  4A3L J;  3PO3 J;  1O4X A;  1R9T J;  3LSP A;  1ZK8 A;  3BR0 A;  1JJ6 C;  1JTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...