3NAUA

Crystal structure of zhx2 hd2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
KTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Zinc fingers and homeoboxes protein 2
publication title Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3nauA00
4QSHA 2YUSA 2OPTA 2R5ZB 3HBLA 3FIWA 3JR9A 1ETXA 1VI0A 2DTZA 2EZHA 3JRDA 3E7LA 2EZIA 5E3MA 2TRTA 5GP9A 5EDNA 4B3AA 4RDUA 4XK4A 3W6VA 3GTQJ 1AKHB 4AUXA 1F36A 3NARA 1A6IA 3TP0A 2M2EA 1TWCJ 1JUPA 2CUEA 1ZQ3P 3OSFA 1UMQA 2QCOA 1XC5A 1PUFB 2GLOA 2DN0A 1BW5A 3BTCA 2COBA 3Q0WA 5EGOB 5JLXA 2I10A 2JN6A 4JX4A 3RQIA 5HODA 2VPRA 3S17J 2IEKA 1IG7A 3UKGA 4W97A 2QF7A 3HGGA 2X9DA 3A02A 2IBDA 2B63J 2CQQA 2M0CA 2HDDA 3WHBA 1HF0A 3CQZJ 4A3CJ 3IV5A 3BR5A 3QQAA 3TW7A 4XIDA 3BTJA 1U9OA 2VI6A 4C3IJ 5EG0A 2JA5J 1VFCA 2NS7A 4DW6A 3ZQIA 1MBJA 2XPWA 3CCYA 2XPVA 3S1RJ 1U78A 1GV5A 4IHWA 2NVTJ 2K9QA 4ABZA 1WH7A 1DU0A 4IHXA 5IYBJ 4A69C 3I4MJ 3JRFA 1MSFC 4DZPA 1QRYA 1TWGJ 2DA2A 4AC0A 1JKPC 4UUSA 3GTLJ 2ZB9A 3JRCA 2XGDA 1E3OC 1X58A 1YRNA 1POGA 3ZQGA 2ID6A 3BR1A 1HOMA 5E3OA 3QPSA 3SJMA 3MVPA 1FTTA 3K2AA 1HLVA 1HDPA 4AYBN 1P7JA 4XICA 1MH4A 3O8HA 2CRGA 2E1OA 1Y1WJ 1D5YA 2ID3A 2JMWA 3IH4A 1AKHA 3LSJA 2DA1A 4V2FA 1VNDA 3Q3SA 5C3EJ 1ITYA 4I76A 1QPIA 2DA7A 1OCTC 1JT6A 2LKXA 4FE7A 1IGNA 2HOSA 3RZOJ 1PUFA 3BQZA 1I50J 4FISA 4L5EA 5EGOA 1JUMA 1IDZA 1I3QJ 2JA7J 3M3YJ 2LD5A 5FKLA 2DMTA 3S15J 2Y30A 3FK6A 4A3BJ 3IH2A 3ZQCA 3JRIA 3BR0A 3BG3A 3LSRA 3GTJJ 5IOZA 2WAQN 1MSEC 3O8GA 1RR7A 4M3DA 1JGGA 1BW6A 4M3EA 2XSDC 3RZDJ 4A3FJ 4D5FA 3G1OA 5IP6A 1LE8B 2EZLA 3MKLA 1JKRC 1O4XA 4BBSJ 3GTGJ 1GUUA 2FD5A 4MIMA 3Q0UA 2EBIA 3LOCA 3GTMJ 3S14J 2HXIA 5F1JA 1MNMC 1NTCA 5EZHA 4CYCB 1Q1VA 4A3LJ 1WCMJ 2DMUA 5FLMJ 4C2MJ 2M8GX 2HOAA 1FTZA 1WGXA 1H89C 1W0UA 1UG2A 1APLC 2E2HJ 1T56A 4LOCA 1TWFJ 3JRHA 1RKWA 2L7FP 2O7OA 3PM1A 3TP3A 2HOTA 1K61A 4C3JJ 2MW8A 1ETOA 1LFUP 2CJJA 3TW6A 2Y0SN 5F27A 4GFBA 3HGYA 4MLOA 2ECBA 2EZKA 4MFEA 1U9NA 2M9HA 3S1QJ 2DMNA 1A5JA 3A03A 4XRSA 5FKKA 4Y7NJ 3BTIA 2EH3A 1W0TA 1K83J 2Y2ZA 2NVXJ 2Y9YA 2LK2A 4DYCA 2AHQA 2LVSA 4UUTA 1LFBA 2R7ZJ 4M3FA 1AU7A 2DA5A 1I6HJ 3F0CA 1GT0C 5IOYA 3ZQHA 3HB9A 1SANA 1ETVA 1B8IB 3HM5A 3HOWJ 1S7EA 1LE8A 2K40A 2HQ5A 1IC8A 1TC3C 5GPAA 3D1NI 4D7NA 3OIOA 4IEJA 1T33A 2ME0A 4D5CA 1CQTA 1NK3P 3M4OJ 4X6AJ 2R5ZA 3IH3A 1ZR2A 4M3GA 2ECCA 5FKMA 5K7ZA 1X2NA 2M34A 2WB1N 3G1MA 1GVDA 3CDLA 4CYCA 2XPUA 3DCFA 1ZGWA 2H1KA 4XRMA 1WH5A 1X2MA 2HXOA 2GM4A 1ETQA 4BBRJ 5J1RA 2JA6J 4A3KJ 4JYKA 2FX0A 1RKTA 4A3MJ 3BR2A 5J1YA 1MBFA 1F43A 4NDLA 2DA4A 5FLVA 5F08A 9ANTA 2L0KA 5IYCJ 3B6CA 3HEFA 1HDDC 2YS9A 2O8KA 5M5XJ 4BY1J 1JTXA 1ZKGA 4FTHA 5DS9A 1JUSA 1H8AC 4C3HJ 4W1UA 4JX5A 4J19A 1ZTRA 2XB5A 1IJWC 2JA8J 1HCRA 2OF7A 1IDYA 1TWAJ 2MGQA 3LSGA 3I4NJ 4BY7J 1MH3A 5M3FJ 4Y52J 3S2DJ 3OOUA 3FK7A 5EEAA 2KDZA 2R92J 1TWHJ 1B72B 3S2HJ 1B8IA 2H8RA 1BL0A 2R5YB 4D7MA 5EG0B 1BA5A 2HYJA 4FCYA 2LTPA 3G1LA 2LP0A 3K7AJ 2P81A 4DZJA 1NK2P 1IRZA 5IYDJ 2E19A 3HOVJ 5F0CA 5E3LA 4RBOA 1FEXA 3SFIA 3JREA 2G0EA 4MFDA 1MBEA 1QVTA 3PO3J 2D5VA 3A01B 5F0HA 1FIAA 1GV2A 2NOGA 3ZQFA 4I6ZA 2X48A 4X1EA 5JLWA 2Y9ZA 1MBGA 2CQXA 4BKXA 1QVUA 1G2HA 5J3LA 4FE4A 1ENHA 4DYQA 1JJ8C 2L7ZA 3CMYA 1RPWA 1GDTA 1ZK8A 5DTDA 3BR3A 4JP0A 4DYRA 1JKQC 1OFCX 1MBHA 1JT0A 4QTRA 4M6VA 2L7MP 2GBYA 1U8BA 2W48A 2TCTA 3FKIJ 2RAEA 4S0HB 2DA6A 2K9SA 2X6OA 5FJ8J 4A3DJ 5EF6A 2JJ7A 2NS8A 3BG9A 2CUFA 3JRBA 1AHDP 3LSPA 2LFBA 1XS9A 1ETKA 3S1NJ 1H88C 2K9NA 3L1PA 2XGCA 2DJNA 3BTLA 5FKNA 4HNVA 1B72A 5IPAA 3BR6A 1JJ6C 2R5YA 1VF9A 4MO7A 3HDDA 2WV1A 1ORKA 1RETA 5C4XJ 2MG4A 3C2BA 4G12A 5E3NA 3H0GJ 3GTPJ 4B1RA 1UHSA 5F0FA 3VPRA 2CU7A 1FIPA 2VKVA 1EF4A 1JTYA 2XRLA 3FISA 3SDGA 3GTKJ 1JKOC 3H3VK 1OCPA 3HOZJ 3OSGA 2LLKA 3A01A 1ETYA 2O9LA 3RKQA 1Z77A 5IP7J 2R93J 2NVYJ 4V2GA 3GTOJ 4QIWN 1BJZA 1Y1VJ 2EQRA 5M5YJ 3HOXJ 1YRNB 2DMPA 2LR8A 2E2JJ 3ZOBA 2VKEA 4B4CA 5C44J 2N8GA 2YU9J 4A93J 1OJLA 1RESA 3GBGA 1MBKA 3PO2J 4IHYA 4A3IJ 3JRGA 3Q0VA 4EEFG 2R0QC 5FKOA 5IP9J 5K7FA 5EYRA 2MSYA 3ZQLA 3HOYJ 3TEDA 1R9TJ 2XGEA 4BXXJ 4A3EJ 2JWTA 3BQYA 2PMZN 3JRAA 2KT0A 3HKZN 2NVQJ 3MN2A 1DU6A 4A3GJ 3LNQA 4A3JJ 2ELKA 2AO9A 2XB0X 2VUMJ 2L9RA 5F04A 1P7IA 2E2IJ 3DEWA 1ETWA 5GPCA 2HI3A 4XRSG 4JX6A 3S16J 1IUFA 1ZR4A 1XG1A 3B6AA 5EZGA 2FJ1A 5M3MJ 2JK3A 1SFOJ 2Y31A 3HOUJ 1FJLA 3WHCA 1IV6A 1WPKA 2IAIA 2DMQA 5BNGA 3S1MJ 3BT9A 5C4JJ 2LY9A 5K7HA 5M5WJ 2DA3A 2ME6A 1Z0XA 3NAUA 4UUSB 3QPLA 4IHVA 4M3BA 3BG5A 2FQ4A 5J1UA 1WI3A
chains in the Genus database with same CATH superfamily
2YUSA 3SZTA 2IS2A 3TO9A 3ZMUA 3DEUA 1L0OC 2F5EA 2QLZA 4M9XA 4EJOA 5DM7F 2EZIA 5GP9A 3NRVA 5E8IA 5EDNA 3MKYB 1DDNA 3GTQJ 2X6YA 2R7OA 4AUXA 2BY2A 2V26A 1QHHD 1Y39A 1TWCJ 1OCZH 2CUEA 1ZQ3P 2QCOA 1R49A 1XC5A 1PUFB 1BW5A 2X6WA 2E5ZA 3BTCA 3Q0WA 4A0YA 4J00A 2HOEA 2M45A 3DKXA 3I59B 2JN6A 2VPRA 5HDGA 2Z9OA 3AAFA 2ZFUA 2KFDA 2X9DA 3A02A 2B63J 5FFZA 2CQQA 3G6EI 4EMSA 4E7ZA 1ZGAA 4I2OA 1Z3YA 3WHBA 3ZGKA 4BQAA 3CQZJ 3LSMA 4N9HA 3OS2A 3BR5A 3QQAA 3GZ6A 1YG2A 2HKXA 3QU3A 3BG7A 1U9OA 4ZYAA 2XAFA 4FT8A 1SD7A 1G59A 2K7LA 3S3OA 4Y17A 4JK1X 4HX7A 2XPWA 4U88A 5L3FA 4CDGA 2RVCA 1MMDA 3AG4H 1MW7A 3GF2A 3D0SA 2DTRA 3LAPA 3JRFA 1MSFC 5HLTA 1CF7A 3K9TA 4PSWA 1QRYA 1TWGJ 4A0XA 4M71A 4PK4A 3RKYA 1SC7A 3GTLJ 2KL4A 4KIFA 1XSVA 1OPCA 3FXKA 2VQGA 1X58A 3ELKA 2EFOA 4LLLA 1YE9A 3A0HC 5B1AH 2KIUA 1IUYA 2DYSH 1IN5A 4I0BA 3ZQ7A 2CRGA 2IGMA 3LL7A 1HW2A 2DA1A 3HRTA 4IQ4A 1BC8C 1ITYA 3QRFF 3KYCB 3WE3A 2L4MA 2DA7A 2EV0A 3M8EA 1FOYA 2XUBA 2KQRA 1MJAA 4WF2A 3F8FA 1JUMA 1I3QJ 2JA7J 5LD2C 5D5WB 1R58A 3GW2A 1KZHA 3UNGC 1VQOI 3J80K 5DDGA 3OIPA 3ABTA 3BJAA 2GZWA 2V1UA 4BJ5C 3JRIA 1PDNC 4AIJA 1K6YA 4BJ6C 3BZ6A 2BY1A 2M7BA 1W7PD 1ZLJA 2H94A 2NS0A 4ENNA 1FOWA 2QWWA 4M3DA 4EM1A 4M3EA 2XSDC 4A3FJ 1H9TA 4D5FA 3G1OA 5LEKA 2EA4A 3NWTA 5IP6A 2EZLA 3VFZA 4WXDA 4L18B 4BBSJ 3CZ6A 1W5TA 5DCMA 1IF1A 5ICFA 2D1HA 1YLFA 4CA0A 4HBLA 4MNUA 2HXIA 5F1JA 1NTCA 4CYCB 2LG4A 3A2KA 2BGCA 4IRHA 1WCMJ 1TQIA 2R7VA 3IHUA 2OTLI 3ZQQA 2CW0F 4KISA 2L7KA 1K78B 2L5QA 1APLC 1HXDA 2BVLA 1NH3A 4PUSA 3JRHA 2VQLA 1RKWA 3H36A 3HOTA 2O7OA 1FZPB 3TP3A 2PX9A 1K61A 2XKPA 4C3JJ 2HOTA 1V5FA 4R8HA 1ETOA 3J81K 2EINH 4FX0A 4Y4RA 4MLOA 4HX4A 1TW2A 2HZDA 5L3CA 1R5ID 1Q1HA 1YO5C 2YX4A 2DMNA 1UHMA 1JHHA 5GADJ 1A5JA 1JXSA 2FEZA 4HEA2 5FKKA 2Q8KA 2XKOA 1Y0UA 3H1CA 1VQLI 5KK1A 2ZNYA 4XSXF 1K83J 2DXIA 2NVXJ 3WTTC 2LK2A 3ERMA 2GIZA 2P5LC 5D8LB 2KP6A 4RGSA 1SAXA 4CCLA 2VBXA 4P1WA 4M3FA 4ZJZA 3HYIA 4KITB 2HVSA 2R7ZJ 4JOMA 2XAGA 1XD7A 3BCAA 3F0CA 1GT0C 1QA6A 3EYYA 3HB9A 1B8IB 4CO8A 4WWCA 2OC6A 2OAZA 3HOWJ 1S7EA 4EJUA 1U5TC 1F1ZA 3SEQA 1LUJB 4KT5C 3JW4A 1Z7UA 4D7NA 2KJCA 5LBQA 3ERED 4BDYA 1I6XA 3J80Z 1YX5A 3IAM2 1W7PA 4BACA 2V6EA 3CO6C 2PN6A 4PZJA 5JI6A 3CC7I 3ASOH 3PIPF 1SD6A 1ZR2A 4BDZA 1YTYA 5K7ZA 4BYYA 1GVDA 2UZKA 1ZARA 2RNGA 4UUVA 2XPUA 1ZGWA 2IS4A 5JHFA 1FYLA 4XRMA 4G8XA 3OYLA 1X2MA 4LJZF 4NB5A 3PJRA 4BBRJ 5J1RA 4A3KJ 2FX0A 3NWSA 2PEXA 4IQJA 3MD2A 2ZMEA 1X3ZB 3U1KA 3BLYA 2PJRA 4M9SA 1OKRA 2OQGA 1N75A 1S29A 1F43A 5FLVA 2XF7A 3E6MA 3GUDA 3MFKA 2YS9A 5E8GA 2ETHA 4L0YB 5M5XJ 2KIMA 3K1MA 1G3WA 1JTXA 4UVCA 3U9GA 1JUSA 2QVOA 3WTZA 3FMQA 4HNTA 2W7NA 3F21A 2P5KA 2LMDA 4W1UA 1BM9A 4JX5A 4J19A 2FU4A 1HCRA 3IP4B 4E6KG 2ESNA 1IN6A 1X1BA 3G73A 4B3XA 5CVJA 3J81Z 1IZ1A 2WADA 3GMEA 1B72B 1FYMA 3W2AA 3S2HJ 3CMAI 3F6OA 3D5SC 2CH0A 3OYJA 2IXSA 1BA5A 1U2WA 4FCYA 1W5SA 2F5VA 1IW7F 2P81A 4DZJA 1NK2P 1V55H 3HTUA 2L2OA 2E19A 3OMYA 5E1XA 3J7YJ 1KGSA 5F0CA 1ZYRF 4ZDPA 3KP2A 4RBOA 1RIOH 1FEXA 2G0EA 3HG9A 1T0FC 1MBEA 3DBLB 1QVTA 4U0YA 2X1CA 2CW8A 1FSEA 1GV2A 2R7QA 3A1YA 3DKYA 4G9YA 1J7KA 4BHCA 3R6SA 2FOWA 4ENJA 1MBGA 4BKXA 1S7OA 1G2HA 4LG0A 2A3SA 1PYVA 4FE4A 1MKMA 2L7ZA 2XRNA 3CMYA 1MJBA 3P9KA 1GDTA 4HAMA 1ZK8A 2GOMA 5JVGF 5DTDA 3FZVA 4LFUA 3KX2A 3ZMVA 1JT0A 1WHUA 2CV0A 2R3SA 2GBYA 2LBFA 2M87A 3SDBA 1PJRA 3DWLE 1KU9A 2M3AA 3CCLI 3VSKA 1USSA 3DPUA 3WU0A 3S8PA 1TNSA 2ZXHA 4YFNF 1PP8F 2X6OA 1M1EB 3G3ZA 3FXRA 3OYCA 4ZC3A 2JJ7A 2X1DA 2Z1DA 1FX7A 2LFBA 4CCOA 1XS9A 1ETKA 2NOJB 1OCRH 4GO1A 4ESFA 1JI8A 3U2RA 4JBAA 2L02A 3JTGA 1O57A 1XGNA 2MD5A 3BR6A 4HA8A 4G6QA 4F3QA 4DOZA 1JJ6C 2R5YA 5K5QA 1VF9A 3K6GA 1ZLKA 3HDDA 2DPDA 2MBFA 2K4JA 5LHIA 3CDHA 3DF8A 3OIQA 2X51A 3EUHC 3MZYA 2DO7A 2F5FA 3H5RA 4HF0A 3FXOA 3KLOA 2UXNA 1JTYA 2HZTA 3SDGA 4HSRA 1BI0A 2DODA 1YYVA 1E3PA 4A6DA 1ZREA 3HUGA 3OSGA 3CDIA 3L2VA 2LLKA 4AIDA 1ETYA 3C18A 3CTAA 2XVCA 5AIPA 2QSHX 2A6HF 4IOCF 5FROA 4RMNA 4QIWN 2AXLA 1Z6TA 1Y1VJ 2VJ4A 1AA7A 3HOXJ 1ZG1A 1YRNB 2EFPA 3ABLH 2LR8A 3WTYC 1P4WA 3ABUA 5LHGA 3GBGA 3R4KA 3V8KA 3SQNA 4EEFG 2ZJQF 3H3ZA 2KDOA 2G7HA 3MMYB 2VJ5A 1B1BA 2CW7A 1TTYA 2XGEA 1P4XA 3FMSA 4BXXJ 3VB2A 4R1HA 4E4HA 1ERDA 3OYIA 2DAOA 3BQYA 4KUMA 5CQEA 2F5CA 4A3EJ 4FASD 3DEEA 2L9NA 3HKZN 3VSLA 5A2QK 2KLOA 1IAWA 3S3MA 3LNQA 3HTSB 1R5GA 3I53A 1NHAA 2VN2A 3V7RA 1FLIA 4L9NA 3ZRGA 2VUMJ 1DUXC 2ZJPF 2A6TA 1FBQA 1R6RA 3CCQI 2D2WA 3F6VA 1Z67A 3TQNA 1HW1A 1ETWA 4CGZA 3I4PA 1LVAA 5GPCA 1ZELA 1FY7A 4XRSG 2DQRA 2RC4A 5DD8A 3QOEA 1H0MA 1ZH5A 5M3MJ 2R7SA 2FSWA 2DMQA 1X3WB 2A68F 3BT9A 3E6CC 3EPZA 3OV8A 3K2ZA 3ABKH 2DA3A 4CYDA 2ME6A 1U3EM 4UUSB 3FM3A 5ILUA 3C3WA 3ZMTA 4R79A 2ZNZA 1YW8A 4XLEA 1YJ9I 4PSXA 5CVRA 2LY1A 3DPTA 2W82A 2V9VA 2OPTA 3I58A 3HBLA 1MDMA 1ETXA 2DTZA 2EB7A 1SD4A 2RN7A 2QQ8A 4RLFA 3W6VA 2M7AA 1B6AA 1G8XA 2F5DA 5LLQA 4I98B 1T38A 3TP0A 1Z3XA 1NG6A 2G7UA 2M2EA 1OQYA 4P9FA 1WVRA 3PFIA 1V3FA 4BJTA 1REPC 1GLNA 2I10A 3CCJI 2PLYA 1KYZA 4JX4A 3BDDA 4XSZF 3RTRA 5HODA 1KYWA 2ZXWH 2QF7A 2IBDA 2K9LA 3HOSA 3LAJA 2CO5A 5L3BA 1QBJA 1YJNI 1R22A 3KZZA 3TW7A 2P0WA 4B48A 1MZBA 1K79A 3V8JA 3SYTA 4IJAA 4C3IJ 5EG0A 5HOOA 1VFCA 2RGVA 2DPUA 2NS7A 2W85A 4DW6A 1R23A 3S93A 3ZQIA 3S1RJ 3CCYA 4IHWA 3CJNA 1SAUA 2K85A 1WH7A 2V79A 1J09A 2BZTA 2W57A 3N05A 3H9GA 5J4VA 4BL0B 1YJWI 1W36C 3I4MJ 3BROA 5DEQA 4ZTFA 1QO0D 5DD4A 3I55I 2DCEA 2DA2A 5A2QZ 2VB6A 5GAHJ 5J4YA 1JKPC 2FNPA 3JRCA 2XGDA 1STZA 1YRNA 5HNHA 1POGA 4I7HA 2M8EA 4MQVA 2VBYA 1I39A 3BR1A 3AFHA 2WA0A 3F8MA 1FTTA 3K2AA 1XGOA 2UUZA 1HDPA 1MH4A 2DOAA 4LITA 2P8TA 2E1OA 1Y1WJ 3R61A 4E7IA 2ID3A 2JMWA 2J5OA 3IH4A 3KP7A 4NQWA 4YRVA 3IAS2 5LEJA 4BNCA 1VNDA 3Q3SA 2K9MA 2WY8Q 4G94A 1T6SA 1JT6A 4FE7A 1IGNA 3IC7A 3GLXA 2DBBA 3RZOJ 5FFXA 3BQZA 1PUFA 1NG7A 1I50J 2IT0A 2ZXIA 1IDZA 1OYWA 2DYRH 3I59A 4N4OB 1EKEA 2BE5F 4L5JA 3S15J 4ZDOA 1HKTA 2LF8A 4EJWA 3VDXA 5DCFA 4B44A 1Z9CA 1WFXA 3LA7A 1WRJA 5J8CA 3ZQCA 1ON2A 3W2VA 4XM3A 3WGIA 4YFKF 1RNLA 1FBSA 3DTEA 3LSRA 3GTJJ 1Y0NA 2PMZA 1V54H 4HZFA 1YS6A 4GXOA 5CPRB 1JGGA 3O6BB 1MMSA 3RZDJ 3KE2A 5KVRA 2IS1A 2HKOA 2OZ6A 3DTKA 4UB6C 3FKJA 3GTGJ 2I5UA 2BW3B 1YIOA 1MMGA 1SVMA 1IV8A 4MIMA 3SZGA 3Q5FA 4XMYA 3H35A 1TZLA 3O3KA 3S14J 1KU2A 5EJCA 1BIBA 2E71A 1D8KA 5FD5A 5EZHA 3K10A 4HQEA 4A3LJ 1PVEA 2DW4A 2YPRA 4ASNA 1WJFA 3K1NA 3TDUC 1FP2A 1VQ5I 1Y8QB 1H89C 3T8TA 5LFAA 1AOYA 1N25A 2E1NA 2W25A 5D5UB 1MMNA 2KZGA 2L7FP 1U8RA 3QAHA 1D0YA 2LRDA 3HJEA 4CCNA 2MW8A 4BGDA 1HQCA 2A5WA 2Y0SN 5F27A 1BI1A 3MAJA 2IVMA 1R00A 2M9HA 3WU1B 5BPDA 4RB3C 3AL0B 3REOA 3BTIA 5B66C 3ONQA 5LRRA 1W0TA 2RQPA 3E3VA 4IHTA 1D5VA 4ZTJA 1B59A 4L9JA 2Q2EB 4BHBA 2K4BA 4DYCA 4UUTA 1ULYA 2DA5A 3CP2A 5BS6A 3RJPA 2JRMA 5FRNA 4L9VA 1ETVA 3WTXC 1OLTA 3W6KB 3G2BA 1O7FA 3IKTA 3ECHA 3PIOF 2K40A 2HQ5A 3WE2A 1FWZA 4IEJA 1W36D 4OIOF 3M4OJ 3E5UA 3PL8A 4D1QA 3PQKA 1U0JA 4PJJA 5K1YA 2R5ZA 1O3RA 3FBNB 2ECCA 2V1DA 3KPHA 1XSDA 1ZN2A 1X2NA 2M34A 2WBMA 2WB1N 3CESA 3OYFA 3M1CA 4MTDA 4CYCA 3T8RA 4G6DA 3RI4A 1BI2A 3LA2A 2OBPA 2GM4A 5AONA 4JYKA 4XONA 3ZPLA 2VC1A 1X4PA 3DPLC 3FDYA 1S5LC 3WG9A 1ZAOA 2WV0A 2LC2A 1BC7C 1J59A 3VYRB 4A12A 5J1YA 1MBFA 2OA4A 2C6YA 1J9IA 1UCRA 2DA4A 5F08A 9ANTA 4AU7A 2XASA 2GA2A 2KRHA 2MLGA 1HDDC 2DK8A 3KEQA 5DUIA 2Z99A 2EPFA 1VTNC 4HOBA 3W6JB 1HKQA 2ZSIB 1LEBA 2OCCH 4ZH4F 2MH2A 4G6TB 3GLLA 4F52A 4Y15A 1ZTRA 5HS8A 2VODA 2XB5A 2JA8J 2CQKA 4E7HA 2EILH 1IDYA 1FYKA 3DU5A 1ZGJA 4OAYA 3I4NJ 5M3FJ 1X1AA 5K5RA 1DQUA 4Z2YA 2Z2SB 3FK7A 3OOUA 2R92J 1TWHJ 4AWXB 1B8IA 3GO5A 5CYVA 1OYYA 3CC4I 1D1AA 4D7MA 5L3GA 2YX7A 2EA2A 2HYJA 2R7TA 2LTPA 1KONA 2LP0A 2HVQA 3FHNA 5CJ9A 3V4GA 2L3DA 3HOVJ 5IYDJ 3ZMDA 5B3SH 3LA3A 3CCMI 4BEHA 3N97A 4A0ZA 3SFIA 1XB4A 4D0PA 3KETA 3WGHA 4CSWA 2EIMH 2HQAA 1Z7LA 3RKXA 1A6QA 1BBYA 3PO3J 3A01B 4C30A 2EV6A 4G7ZF 2EFNA 4PFOA 4I6ZA 3AKZA 3QYEA 4X1EA 1SEUA 5IT9K 2LF7A 4MEYF 2L4AA 4OINF 3WU2C 1ENHA 1R1VA 3E5QA 2P5VA 1J75A 4BE0A 1Y56A 1RPWA 4PJLA 2KRCA 1R1UA 4JP0A 3H92A 4DYRA 4X0GA 3QPHA 4OIQF 1YW9A 2X4HA 4KIBA 5TGTA 1RZ4A 4E7LA 1Y8RB 2L7MP 3VYTB 5FD6A 4RGUA 1U8BA 4ESBA 2DQLA 3QYBA 1WQ2A 4XN3A 4OIRF 2KJBA 2A69F 2K3PA 3I0TA 2DA6A 4QPOA 2ZSHB 5LGUA 2QSGX 5HLGA 1XSXA 3L00A 3NQOA 1XCBA 2CUFA 4B09A 3LSPA 1R7JA 2IGNA 3S1NJ 2VC0A 3DFGA 3M07A 3L1PA 2KIQA 2VLAA 1OMIA 3C2HA 2OCEA 3HRUA 2E34A 5DV5A 2VXDA 4AD9A 3GFMA 4RS8A 2W4SA 1W1WE 1B72A 2QGUA 4RGXA 4HV5A 4M6XA 1OR7A 4M73A 1BOAA 3A4CA 3IUOA 4M9ZA 4NUBA 4HG2A 2WV1A 4BS9A 5C4XJ 1XTAA 3BCBA 3HSRA 2MG4A 1F4KA 4G12A 3GTPJ 5LGTA 4UXNA 1MMAA 1I27A 2L9SA 5F0FA 2CU7A 4G7HF 2EIJH 2GIVA 1PP7U 3FISA 4V19K 5HNFA 2ISYA 1VQNI 3GTKJ 3RPUD 4XQFA 4LLGF 3HRMA 2LKSA 5GAGJ 1QZZA 3W3CA 1Z77A 3I64A 2NVYJ 4S05A 1CGPA 1K4SA 2JT1A 1UZCA 5M5YJ 4XLFA 3SEZA 2EV5A 4UV9A 3ZOBA 2VKEA 1QQIA 4AVPA 4B43A 4KJZA 1LJ9A 4F91B 5H2FC 4A93J 4YIFA 4IXAA 1S72I 3KEOA 2O6GE 3PO2J 4IRGA 3ULQB 2FNAA 4DJAA 3JRGA 2R0QC 3QYFA 3ASNH 1UELB 4II3A 3HOYJ 5EYRA 2MSYA 4ZZLA 4EJVA 1ODDA 1XGSA 4IVNA 4ANJA 1YHQI 2ZKZA 4LB6B 5LRSA 3T0YA 1KQ8A 2KT0A 5IT9Z 4AIHA 3CLOA 4XBFA 3MN2A 1DU6A 4LMYA 4KN4X 3TKYA 3VEPA 2F6CA 2XB0X 3BOQA 5GTHC 2MFZA 1YI2I 1ZRFA 3HPHA 4EJTA 4ENKA 4MGRA 3DEWA 5JVTA 2ZCWA 2XDVA 1SVOA 1ZR4A 4FQGA 3KZIC 5AIQA 3DU6A 2JK3A 3E97A 2VJIA 1IV6A 1IRFA 3CO7C 3HPGA 3H5AA 1ZRDA 5J47A 5M5WJ 4XKWA 2L01A 1IO2A 3NAUA 5E17F 3SFZA 4XKBA 2JVHA 3K70C 2BY3A 1T08B 2Y75A 1ONVA 2EZHA 3JRDA 3E7LA 4LIVA 4N0BA 2QBYB 1XX5A 4NNJA 5E3MA 4ZZDA 4B3AA 2F2EA 2CWEA 3MZ8A 2ICWG 3RPUA 1AKHB 3GFLA 1F36A 3RPQA 3KP3A 1X1DA 3AL0C 5F6FA 1TBXA 1BOBA 4WK8F 1E3HA 3BC8A 2QQ9A 3J7AY 2OQRA 1EV7A 4TV7A 2K86A 2FBKA 1B4AA 2OV7A 3PFYA 4WXHA 4RB2C 2GLOA 3QWLA 2R7WA 2HDCA 2V4JC 5EGOB 3OYKA 1EH8A 1G3SA 2STTA 4IPAA 4HQMA 3RQIA 3EUKL 4BQOA 4OU0A 3S17J 2UWMA 3V7CA 3EQLF 4W97A 4JQFA 1SFUA 2QENA 5DUKA 4IZZA 2M0CA 2KISA 2HDDA 1SMYF 1HF0A 2DJIA 3LSKA 4IF4A 3IV5A 4HV6A 3HSEA 3CCSI 3FXMA 1V4RA 2WTEA 4BU2A 1ZHFA 3VYSB 2JA5J 2D45A 1GV5A 5F64A 3KLNA 5E1ZB 4ABZA 5D5XB 4MQ9F 3U21A 5L3DA 1S6LA 2XGXA 1LPQA 4IHXA 4A69C 4WX9A 1D8JA 3K1PA 1RRJA 3F8NA 2K5CA 4OIPF 3IKVA 1T2KA 4AC0A 4UUSA 1IXSB 5CKTA 1I1GA 2ZB9A 3H9QA 3DV8A 1FMVA 4NHJA 1E3OC 1QGPA 1LB2A 2CUJA 3FMRA 3ZQGA 1W4MA 2ID6A 1XMXA 1HOMA 3QPSA 2HGCA 1VQKI 3LMMA 3SJMA 3M1EA 3MVPA 2JVGA 4ON0A 2GOXB 2JPBA 3FXUA 4AYBN 1P7JA 3O8HA 4CZZA 1D5YA 2FMYA 4Z6YA 3MWMA 4LG0B 3SXYA 2GQQA 2RREA 4CZCA 1KU7A 3SHFA 3L2QA 5HDNA 3PSFA 1IRXA 1FOKA 1WJ5A 1TP4A 1RUOA 4PFPA 1WJAA 4FHTA 4FISA 4RA2A 3CCEI 2KIFA 2O3FA 5D4SA 5BQTA 3M3YJ 1QZEA 1Z05A 2Y30A 3FK6A 3JCUC 2HPMA 4H0EA 3HXLA 2JSCA 4B47A 4HPQA 1FC3A 4U0VA 3HHGA 1R36A 3IRQA 3BG3A 2VQCA 3BZKA 2ZC2A 1UB9A 4CICA 2W24A 1R5HA 1BR1A 5IOZA 1IN7A 2WAQN 3HKZA 2MH9A 3O8GA 1PUEE 4I02A 1BW6A 2KHMA 1OCOH 2M0MA 3M7GA 4RB0A 3ZN0A 1LE8B 1D3YA 3LSIA 2JA2A 3MKLA 1JKRC 4EVIA 2CYYA 1XDSA 2DFHA 3GWZA 4DBQA 1F9NA 4CHUA 4KIGA 1Z21A 1U5TA 1GUUA 3CJTB 3Q0UA 2CUZA 5BOXA 3PNYA 2EIKH 4HF2A 2JSPA 3LOCA 1E17A 2WAQA 2CFXA 3AG3H 3VOEA 4EM2A 2MC4A 4YG2F 1QHGA 4IOAF 4P5OA 1Q1VA 2MD0A 3CUQB 3RSNA 1TLHB 2QYOA 5HS7A 4A6EA 5E20A 1T95A 2DMUA 3F23A 4C2MJ 1WWXA 2EFQA 2HOAA 1FTZA 1WGXA 2E60A 1UG2A 3F22A 1W0UA 1WJDA 5HVQC 1S8NA 2E2HJ 1T56A 4LOCA 4EGZA 4BAYA 2ZXJA 2BHZA 2ADUA 3PM1A 4BH9A 4FETA 3ROUA 2CJJA 1FNNA 3R0AA 4GFBA 2FRHA 2HDWA 4ZYDA 4CXFA 1A35A 3MZHA 1X1PA 2XF6A 3EYIA 3S1QJ 4UHTA 3RDIA 4D9JA 1QZYA 2XAUA 3A03A 3KFWX 3VYUB 4BQNA 4XRSA 4Y7NJ 2EH3A 3O2PE 5B5EC 2A6EF 3FBIB 4U87A 3WG7H 2Z5UA 2LREA 3BWGA 3I9V2 3TO6A 5ICEA 4KA4A 4MEXF 2AHQA 4ITVA 4KMUX 3Q9SA 2AS5F 3ZCOA 1XN7A 5FGMA 1LEAA 4ZYEA 1AU7A 1HKSA 1ZG3A 3OR1C 4XORA 1I6HJ 2R4GA 2JPCA 1LFPA 3ZXSA 3JAMK 3ZQHA 3J7AO 4C2UA 3P7NA 4U0WA 2R7RA 3HIFA 2HNHA 2BXZA 4M74A 1GXPA 4XR6A 2V9PA 4NC6A 1LQ1A 1JHFA 2V9KA 1IC8A 2OU2A 3Q9VA 5GPAA 4C9YA 2V6CA 4ESJA 1T33A 2QUFA 4D5CA 5J6XA 1SFKA 1EJ9A 1CQTA 3JSOA 2OD5A 1NK3P 4GGGA 2E1CA 1S9HA 1LNWA 1TT5B 2AXTC 4M3GA 3TMOA 4KDPA 3BG6A 3PSIA 3G1MA 1D1BA 4EQQA 4S04A 3DCFA 3QPTA 4HW0A 1S3JA 1T0FA 2LKPA 1V5EA 4GCVA 2JA6J 1GHCA 1MDMB 3C2GA 3QP6A 1Z91A 3OR2C 3I5UA 4A3MJ 3AG1H 4KYWA 3BPXA 5FO5A 2IW5A 1R4MB 3RCOA 1HBXG 2MA3A 1A04A 2PI0A 2EJRA 4RLQA 3KYLA 2L0KA 5IYCJ 1O3TA 3DLAA 2QKLB 2EWNA 3HEFA 1EH6A 1IN4A 3E6BA 2KPMA 2VL8A 1IN8A 3BJ6A 2TDXA 2H27A 1TT0A 2IGOA 3L09A 1SFEA 4I99C 1KU3A 3JSPA 4FTHA 5DS9A 2ZBKA 2VKDA 3WODF 3L2CA 2XIGA 1H8AC 4C3HJ 5ILVA 5D8KB 2K02A 4RB1A 4XNFA 3OYDA 2QKMB 1FT9A 3U1DA 4HRIA 2MGQA 1MNEA 3MKWB 1MH3A 2WC2A 2FBHA 1FMWA 2A5YB 3DTIA 3E1SA 5J8FA 3S2DJ 3F9KA 2KDZA 2VE8A 1A36A 2PMUA 4PGHA 5LGNA 3RKWA 1G4DA 2F4IA 5EG0B 3ZMSA 4P9UA 4L0ZB 4MTEA 1P4AA 1YITI 4BXUA 1G6NA 5E3LA 3ZR8X 4KT6A 4Q5SF 3LFUA 1IXCA 3I71A 1O3SA 3LQQA 4MFDA 1R71A 3WGGA 3EUHA 2D5VA 4OOIA 5F0HA 4UNOA 2NOGA 3G71I 3JAMZ 2CMPA 3RIRA 2BVMA 2X48A 5JLWA 2V7FA 2STWA 2B9SA 3D5LA 4G7OF 1QVUA 2PMHA 3ECOA 3LSHA 5J3LA 1GVJA 4OMZA 1WJBA 1VQPI 4PDKA 4DYQA 2HFHA 2VONA 3C7JA 1D0XA 1SMTA 2GWRA 2G9WA 2HQRA 4NQWB 1WSUA 2AQFA 2XF5A 2BHYA 1Z6RA 2I8DA 1RI7A 2VIXA 2W48A 5JR3A 2K3FA 3FKIJ 2FMLA 2RAEA 1BJAA 3ML6A 4LK0F 1G3TA 3JTHA 1VQ4I 2K9SA 5JHUA 5FJ8J 2Y0SA 2IA2A 4A3DJ 5EF6A 1X4OA 4F7ZA 5ICCA 3FWEA 2OJED 3QOPA 4KMFA 2RNJA 4P96A 3OYAA 2K9NA 5GAEJ 1H88C 4BHPA 3FXJA 4RAYA 1AWCA 2XGCA 4QWQA 4WXCA 5FKNA 2DOFA 1B9NA 4HNVA 3KCCA 4HF1A 5IPAA 4XKCA 3GFJA 2VE9A 2GA1A 5BMZA 3RYPA 2M30A 3H0DA 2EFWA 4F55A 2VPLA 4MO7A 2W00A 1RETA 2IPQX 3ABMH 2ZJRF 3L9FA 3SZPA 1A31A 1UHSA 3GEZA 2W1OA 1I1SA 1EF4A 1FIPA 2VKVA 2XRLA 1FP1D 2EK5A 1E2XA 3H3VK 1OCPA 3HOZJ 1BIAA 2DFFA 3A01A 4LGWA 4AVZA 1K78A 2R7UA 5HDKA 2AQEA 3C1DA 2X85A 3PUFA 3GTOJ 3MKZA 4XL9A 3FXQA 2FA5A 3QODA 2JQ7A 2QEXI 2DDBA 1EA3A 1WKMA 2DMPA 1DP7P 3OYNA 4LLNA 2WB1A 2E2JJ 4B4CA 4BUPA 2YU9J 3TL4X 1N77A 3OY9A 5DYMA 2CQ7A 1UJ8A 2HS5A 5D6FA 2RQQA 3GCMA 4OAZA 4A3IJ 4IHYA 5FKOA 4XLPF 1DPUA 5IP9J 1J0RA 2E35A 5EEHA 3OS1A 4N9IA 5FB2A 1VZ0A 1R9TJ 4HDUA 2DOEA 3DP7A 3DBHB 3GZNB 3RYRA 2IA0A 3JRAA 1YX3A 3OS0A 1MJ9A 1P9QC 2H6CA 4E7KA 1FBUA 1SD5A 3BY6A 3OYHA 1QU3A 3CJQB 1O7LA 2WAEA 4L9TA 3TO7A 1XGMA 2X0LA 2XAQA 5F04A 5ED4A 2E2IJ 3M8FA 1I3AA 2NXNB 3K4NA 5E79C 2HI3A 3PNTA 1XMAA 4JX6A 1IUFA 2HR3A 3DBRB 3B6AA 3GX4X 5EZGA 3ZP5A 1K4TA 2FJ1A 1BR2A 1VQ9I 3OYEA 1SFOJ 2Y31A 3HOUJ 4HLXA 3WHCA 2O61A 1WPKA 3MCZA 4KN7X 2O8XA 2XSJC 5BNGA 5C4JJ 1CF7B 3CUQC 4I09A 4A5MA 3UR3C 3TGNA 3KZYA 5KAFC 2NYXA 1SVLA 4ZYGA 3E5XA 3K4MA 3KIOA 4M3BA 2JZYA 3ESWB 1DGRM 3BG5A 3I56I 1WI3A 2ZO4A 4KICA 4QSHA 3GYHX 3CMEI 1WI9A 2R5ZB 3FIWA 3JR9A 3T1BA 1VI0A 1WJEA 2E1MB 3K4BA 2TRTA 5IT3A 3QU6A 4RDUA 2COMA 4XK4A 1YS7A 3D5RC 2DK5A 4LD5A 2BOLA 4O6JA 2BY0A 3NARA 3N4MA 2CG4A 1A6IA 2WY7Q 3K69A 4YIIA 1RC9A 3E6DA 1VQMI 1JUPA 5DM6F 3OOPA 3OSFA 2P7CB 1UMQA 2VKHA 2QQBA 2DN0A 2YSRA 2COBA 4DBRA 3HC7A 1E0EA 5E1WA 2VOOA 2MLKA 5JLXA 3L2WA 4CH7A 1G3YA 1MGTA 3TOAA 2IEKA 1X19A 3MEXA 3UKGA 1QNTA 1IG7A 3FXLA 1GXQA 3CCUI 3HGGA 3IL2A 2F4MB 2QM3A 3FX3A 5TISC 4O5VA 3K4JA 3EUAA 4A3CJ 4E7SA 4XIDA 3BTJA 2VI6A 1OCCH 3OL4A 4YEJA 3E0JB 2QQAA 2CFOA 2DT7B 1U78A 1MBJA 3BZCA 2P7VB 2XPVA 2NAZA 2NVTJ 4PGGA 2K9QA 1F5TA 2Y0MA 4UVBA 1DU0A 4RGRA 1UG0A 5IYBJ 5ICGA 1J5YA 3WTSC 2VBZA 5DCMB 4DZPA 4BXFA 4EV0A 3CCVI 3DLLF 3K0LA 2IA1A 3MQ0A 3CLQA 4BEHB 4PJMA 4GDFA 1Z1DA 2ELJA 3COAC 1KQ0A 4O3MA 3AG2H 2NNNA 5E3OA 2FBIA 2NRAC 1KQ9A 2K27A 2KZVA 4Q4ZF 3S3NA 2QBYA 2GXAA 4YFXF 2HEOA 1HLVA 3CMMA 4Y13A 4XICA 1LKXA 4XLNF 5IY5H 2IJLA 1BI3A 1LDJA 3LSJA 4V2FA 1AKHA 2W84A 5C3EJ 4I76A 3ZN1A 2HVRA 2JUCA 3NEUA 3PNVA 2JTVA 1OCTC 2DFIA 1QPIA 1OYIA 2P6SA 2LKXA 2H6BA 3OWTA 1H9GA 2HOSA 2VT3A 5TRDA 4K2EA 4L5EA 5EGOA 2P6TA 2LD5A 5CVVA 3OYMA 5FKLA 2VOPA 2DMTA 2Y48A 4CCMA 5HLIA 3IWZA 1P92A 2KKOA 3TOBA 4MHGA 4A3BJ 5CVUA 2E7WA 3IH2A 3FHZA 1ZRCA 4YELA 4PJNA 3BR0A 2LNBA 2CV2A 4HX8A 4C2TA 3LQRA 1LDKB 4AIKA 2BBYA 2UV1A 1T39A 2ZJ2A 2VJJA 4XRFA 2B7EA 1MSEC 1FSHA 1D1CA 1RR7A 2LDUA 2UXXA 5KAIC 5K5OA 1TL8A 4E70A 2O5RA 3I54A 2VQHA 3EETA 3OYBA 1O4XA 3OL3A 4UB8C 4ENMA 1W7PB 1YW7A 2FD5A 4RAGA 4DGWB 3R0JA 1L3LA 2EBIA 3V8LA 2BV6A 3P9CA 4XKVA 5J40A 2A61A 1XPXA 3GTMJ 3V42A 5ILSA 4RAZA 2VASA 2FOKA 1MNMC 4RM3A 4WCGA 5CLSA 4CCJA 4EGYA 1SFXA 2X1EA 2IRFG 5D4RA 4HYEA 5FLMJ 2M8GX 2LSOA 2NNYA 4NC7A 5BPIA 3P5JA 2RKHA 2CV1A 4IRIA 4ETSA 1MD0A 2ZMEB 2ISZA 1TWFJ 3T5XA 3CD6I 2PJRB 4IHSA 1IXRC 2OZUA 2IP2A 5JFRA 1LFUP 3TW6A 5L3EA 2JRTA 3F3XA 3HGYA 3VODA 2ECBA 2DU9A 2CSOA 2EZKA 3X2QH 3VWBA 2LYCA 4MFEA 4EM0B 1U9NA 3WTWC 1XMKA 3I3LA 2DFEA 1N78A 1LDDA 3DQVC 3GVAA 2FE3A 2L9VA 4L5IA 4RM2A 3M9AA 1YQAA 1UFMA 3P9IA 3KP5A 2Y2ZA 3B02A 2Y9YA 4Y3OA 1W5CC 5GTIC 2LVSA 2CS3A 1LFBA 3IWFA 2Z16A 4XOTA 1DP3A 5IOYA 4IO9F 2Q1ZB 3LWFA 1SANA 2VBWA 5B1BH 4HNUA 1WZ2A 4IL6C 2GXGA 1U6GA 2Y69H 3CF5F 3BP8A 4PCQA 2ELHA 3HM5A 1YFHA 1D0ZA 1TW3A 1LE8A 1UHWA 5FLXK 2ACJA 2FQ3A 2Z33A 1TC3C 3ISPA 3D1NI 4LG3A 3OIOA 1K7AA 3TBIA 1VQ6I 1BN5A 2PJPA 4XLHA 2ME0A 4LK1F 4KFCA 4X6AJ 2R7DA 4CUGA 3HL2A 2H8WA 2HU9A 3IH3A 4ZYHA 2ZFWA 3HRSA 5FKMA 1O3QA 3M8JA 2M5WA 2M4GA 4AM3A 3CDLA 4U7DA 2H1KA 3IRRA 1DGWY 3CUQA 3HHHA 3R60A 1WH5A 4DQ2A 2HXOA 1ETQA 3RQ4A 2LH9A 2H1LA 3L2UA 1RKTA 1QPMA 4QPQA 3CCRI 3F8CA 3BR2A 3H3UA 3BPVA 2GXBA 3V7SA 4NDLA 4F93B 2E36A 1MNDA 4LIUA 2OUMA 3B6CA 2XROA 3GZ5A 3GXOA 4AYBA 1B9MA 2LBFB 2R7XA 3CP8A 2O8KA 3A0BC 2DT6A 4BY1J 4DNCA 1R4NB 2J5PA 1ZKGA 2HPIA 2XAJA 4DIQA 1DPRA 5KNLA 2DDAA 1IJWC 2BXYA 2OF7A 3W2WA 1LVKA 1TQMA 1TWAJ 1P6RA 3LSGA 2XC7A 4BY7J 4OWRB 1FOXA 3CC2I 2DI3A 2RDPA 4Y52J 1I5ZA 5EEAA 1XDUA 3PUBA 4A2UA 4BQQA 3K4CA 2H8RA 4HDVA 2HYGD 1BL0A 1MIJA 2R5YB 1V5GA 1RUNA 2F4OB 3OYGA 4P55A 5LHHA 1K6OA 2DT5A 2HTSA 3G1LA 3K7AJ 2DLLA 2XHKA 3K4KA 1IRZA 4UV8A 3F72A 2HWVA 1VQ8I 5CQGA 2E1MC 3F8BA 5KCMA 2WWYA 6PAXA 2YR2A 1OISA 3JREA 3K70D 2ESHA 3S32A 2B0LA 3FM5A 4J01A 2XV4S 1WJCA 2QA4I 3S2WA 3HUGB 1EH7A 5H20A 3BJOA 1FIAA 3ZQFA 2KRFA 2KMUA 2MABA 2Y9ZA 2CQXA 1HC8A 4XOPA 4A5NA 2FXAA 5FLXZ 2D1VA 5HS9A 2P4WA 1JJ8C 1USTA 2HTJA 4BE1A 2JUGA 3BR3A 2RV8A 4CCKA 1JE8A 1JKQC 1OFCX 1MBHA 1KA8A 4HSTA 2FF4A 4QTRA 4M6VA 4U7BA 4I01A 2TCTA 2VXZA 4F92B 3WTVC 1VQ7I 3GFIA 4OMYA 2GAUA 1YOVB 4S0HB 2F48A 2OTJI 3L7WA 4KNYA 5HLHA 1C0WA 3BG9A 2HYFA 2YU3A 2NS8A 4M6YA 2BEOA 2IGKA 3WTUC 3JRBA 1AHDP 3H5NA 2NVUB 2DJNA 1TNTA 3BTLA 4IKFA 3G4SI 3CJRB 4UY8I 3LFKA 2BW3A 4H4KC 4II2A 1ORKA 1Y6IA 3C2BA 5E3NA 3H0GJ 3H9JA 4B1RA 1ACIA 2CGPA 3VPRA 2MC3A 4M72A 2M1BA 4GRIA 1P2FA 1S7AA 3PQJA 1U5TB 1X3UA 1J2XA 1YIJI 1JKOC 2CQNA 1R1TA 4PJ0C 4I0AA 1UAAA 4LB5A 3J7ZI 2O9LA 3KP4A 1HSTA 5IP7J 3RKQA 2PFBA 3CUOA 3DXJF 3ZMZA 2R93J 3CF2A 4V2GA 1IRGA 2E5NA 4ZDLA 1BJZA 2A05A 2IS6A 2Q0OA 2EQRA 1T98A 4HLYA 2V1NA 2BYVE 3KEYA 4YIRX 4XN0A 5H6RA 5C44J 2N8GA 4XLAA 3FF5A 3KYDB 2FUG2 1OJLA 1RESA 2V1XA 4BE2A 2LY2A 1MBKA 3LSTA 1HSJA 4GYIA 3EDPA 3Q0VA 5TJJA 4IX7A 3K4LA 2A07F 3HSFA 1ON1A 5K7FA 3ZQLA 1FPQA 4GYGA 3TEDA 4XLCA 3HZJA 1JGSA 2O03A 2Z3YA 1BR4A 2Q2EA 2JWTA 2QSFX 2PMZN 3TDZC 1TQPA 5EEGA 4UVAA 2NVQJ 2PBIA 2H09A 4A3GJ 5E18F 1RR8C 1ZG5A 5F1RA 4A3JJ 2X6XA 4Q48A 2ELKA 2AO9A 3QP5A 4Y33A 2PG4A 2E7XA 2L9RA 2MYSA 2PQ8A 4NC8A 1P7IA 1OR7C 4NBQA 5D6EA 4FX4A 3S16J 5D5VB 1XCVA 2XAHA 1XG1A 2L54A 2LOOA 1X1CA 2WAFA 2HQNA 4RAFA 1FJLA 3L2RA 4EATA 2IAIA 2VT2A 4QLCU 3S1MJ 2M4KA 4B8XA 5FRMA 3B73A 2LY9A 5K7HA 5CVIA 5KHDA 3KP6A 1T8IA 1HA8A 1Z0XA 3QPLA 5H6QA 4N4NB 1HW5A 4Q47A 4E7JA 4IHVA 2O0YA 2QZ8A 5ERIA 2ZMEC 3DKWA 2FQ4A 2R7FA 5J1UA
chains in the Genus database with same CATH topology
4QSHA 2YUSA 2OPTA 2R5ZB 3HBLA 3FIWA 3JR9A 1ETXA 1VI0A 2DTZA 2EZHA 3JRDA 3E7LA 2EZIA 5E3MA 2TRTA 5GP9A 5EDNA 4B3AA 4RDUA 4XK4A 3W6VA 3GTQJ 1AKHB 4AUXA 1F36A 3NARA 1A6IA 3TP0A 2M2EA 1TWCJ 1JUPA 2CUEA 1ZQ3P 3OSFA 1UMQA 2QCOA 1XC5A 1PUFB 2GLOA 2DN0A 1BW5A 3BTCA 2COBA 3Q0WA 5EGOB 5JLXA 2I10A 2JN6A 4JX4A 3RQIA 5HODA 2VPRA 3S17J 2IEKA 1IG7A 3UKGA 4W97A 2QF7A 3HGGA 2X9DA 3A02A 2IBDA 2B63J 2CQQA 2M0CA 2HDDA 3WHBA 1HF0A 3CQZJ 4A3CJ 3IV5A 3BR5A 3QQAA 3TW7A 4XIDA 3BTJA 1U9OA 2VI6A 4C3IJ 5EG0A 2JA5J 1VFCA 2NS7A 4DW6A 3ZQIA 1MBJA 2XPWA 3CCYA 2XPVA 3S1RJ 1U78A 1GV5A 4IHWA 2NVTJ 2K9QA 4ABZA 1WH7A 1DU0A 4IHXA 5IYBJ 4A69C 3I4MJ 3JRFA 1MSFC 4DZPA 1QRYA 1TWGJ 2DA2A 4AC0A 1JKPC 4UUSA 3GTLJ 2ZB9A 3JRCA 2XGDA 1E3OC 1X58A 1YRNA 1POGA 3ZQGA 2ID6A 3BR1A 1HOMA 5E3OA 3QPSA 3SJMA 3MVPA 1FTTA 3K2AA 1HLVA 1HDPA 4AYBN 1P7JA 4XICA 1MH4A 3O8HA 2CRGA 2E1OA 1Y1WJ 1D5YA 2ID3A 2JMWA 3IH4A 1AKHA 3LSJA 2DA1A 4V2FA 1VNDA 3Q3SA 5C3EJ 1ITYA 4I76A 1QPIA 2DA7A 1OCTC 1JT6A 2LKXA 4FE7A 1IGNA 2HOSA 3RZOJ 1PUFA 3BQZA 1I50J 4FISA 4L5EA 5EGOA 1JUMA 1IDZA 1I3QJ 2JA7J 3M3YJ 2LD5A 5FKLA 2DMTA 3S15J 2Y30A 3FK6A 4A3BJ 3IH2A 3ZQCA 3JRIA 3BR0A 3BG3A 3LSRA 3GTJJ 5IOZA 2WAQN 1MSEC 3O8GA 1RR7A 4M3DA 1JGGA 1BW6A 4M3EA 2XSDC 3RZDJ 4A3FJ 4D5FA 3G1OA 5IP6A 1LE8B 2EZLA 3MKLA 1JKRC 1O4XA 4BBSJ 3GTGJ 1GUUA 2FD5A 4MIMA 3Q0UA 2EBIA 3LOCA 3GTMJ 3S14J 2HXIA 5F1JA 1MNMC 1NTCA 5EZHA 4CYCB 1Q1VA 4A3LJ 1WCMJ 2DMUA 5FLMJ 4C2MJ 2M8GX 2HOAA 1FTZA 1WGXA 1H89C 1W0UA 1UG2A 1APLC 2E2HJ 1T56A 4LOCA 1TWFJ 3JRHA 1RKWA 2L7FP 2O7OA 3PM1A 3TP3A 2HOTA 1K61A 4C3JJ 2MW8A 1ETOA 1LFUP 2CJJA 3TW6A 2Y0SN 5F27A 4GFBA 3HGYA 4MLOA 2ECBA 2EZKA 4MFEA 1U9NA 2M9HA 3S1QJ 2DMNA 1A5JA 3A03A 4XRSA 5FKKA 4Y7NJ 3BTIA 2EH3A 1W0TA 1K83J 2Y2ZA 2NVXJ 2Y9YA 2LK2A 4DYCA 2AHQA 2LVSA 4UUTA 1LFBA 2R7ZJ 4M3FA 1AU7A 2DA5A 1I6HJ 3F0CA 1GT0C 5IOYA 3ZQHA 3HB9A 1SANA 1ETVA 1B8IB 3HM5A 3HOWJ 1S7EA 1LE8A 2K40A 2HQ5A 1IC8A 1TC3C 5GPAA 3D1NI 4D7NA 3OIOA 4IEJA 1T33A 2ME0A 4D5CA 1CQTA 1NK3P 3M4OJ 4X6AJ 2R5ZA 3IH3A 1ZR2A 4M3GA 2ECCA 5FKMA 5K7ZA 1X2NA 2M34A 2WB1N 3G1MA 1GVDA 3CDLA 4CYCA 2XPUA 3DCFA 1ZGWA 2H1KA 4XRMA 1WH5A 1X2MA 2HXOA 2GM4A 1ETQA 4BBRJ 5J1RA 2JA6J 4A3KJ 4JYKA 2FX0A 1RKTA 4A3MJ 3BR2A 5J1YA 1MBFA 1F43A 4NDLA 2DA4A 5FLVA 5F08A 9ANTA 2L0KA 5IYCJ 3B6CA 3HEFA 1HDDC 2YS9A 2O8KA 5M5XJ 4BY1J 1JTXA 1ZKGA 4FTHA 5DS9A 1JUSA 1H8AC 4C3HJ 4W1UA 4JX5A 4J19A 1ZTRA 2XB5A 1IJWC 2JA8J 1HCRA 2OF7A 1IDYA 1TWAJ 2MGQA 3LSGA 3I4NJ 4BY7J 1MH3A 5M3FJ 4Y52J 3S2DJ 3OOUA 3FK7A 5EEAA 2KDZA 2R92J 1TWHJ 1B72B 3S2HJ 1B8IA 2H8RA 1BL0A 2R5YB 4D7MA 5EG0B 1BA5A 2HYJA 4FCYA 2LTPA 3G1LA 2LP0A 3K7AJ 2P81A 4DZJA 1NK2P 1IRZA 5IYDJ 2E19A 3HOVJ 5F0CA 5E3LA 4RBOA 1FEXA 3SFIA 3JREA 2G0EA 4MFDA 1MBEA 1QVTA 3PO3J 2D5VA 3A01B 5F0HA 1FIAA 1GV2A 2NOGA 3ZQFA 4I6ZA 2X48A 4X1EA 5JLWA 2Y9ZA 1MBGA 2CQXA 4BKXA 1QVUA 1G2HA 5J3LA 4FE4A 1ENHA 4DYQA 1JJ8C 2L7ZA 3CMYA 1RPWA 1GDTA 1ZK8A 5DTDA 3BR3A 4JP0A 4DYRA 1JKQC 1OFCX 1MBHA 1JT0A 4QTRA 4M6VA 2L7MP 2GBYA 1U8BA 2W48A 2TCTA 3FKIJ 2RAEA 4S0HB 2DA6A 2K9SA 2X6OA 5FJ8J 4A3DJ 5EF6A 2JJ7A 2NS8A 3BG9A 2CUFA 3JRBA 1AHDP 3LSPA 2LFBA 1XS9A 1ETKA 3S1NJ 1H88C 2K9NA 3L1PA 2XGCA 2DJNA 3BTLA 5FKNA 4HNVA 1B72A 5IPAA 3BR6A 1JJ6C 2R5YA 1VF9A 4MO7A 3HDDA 2WV1A 1ORKA 1RETA 5C4XJ 2MG4A 3C2BA 4G12A 5E3NA 3H0GJ 3GTPJ 4B1RA 1UHSA 5F0FA 3VPRA 2CU7A 1FIPA 2VKVA 1EF4A 1JTYA 2XRLA 3FISA 3SDGA 3GTKJ 1JKOC 3H3VK 1OCPA 3HOZJ 3OSGA 2LLKA 3A01A 1ETYA 2O9LA 3RKQA 1Z77A 5IP7J 2R93J 2NVYJ 4V2GA 3GTOJ 4QIWN 1BJZA 1Y1VJ 2EQRA 5M5YJ 3HOXJ 1YRNB 2DMPA 2LR8A 2E2JJ 3ZOBA 2VKEA 4B4CA 5C44J 2N8GA 2YU9J 4A93J 1OJLA 1RESA 3GBGA 1MBKA 3PO2J 4IHYA 4A3IJ 3JRGA 3Q0VA 4EEFG 2R0QC 5FKOA 5IP9J 5K7FA 5EYRA 2MSYA 3ZQLA 3HOYJ 3TEDA 1R9TJ 2XGEA 4BXXJ 4A3EJ 2JWTA 3BQYA 2PMZN 3JRAA 2KT0A 3HKZN 2NVQJ 3MN2A 1DU6A 4A3GJ 3LNQA 4A3JJ 2ELKA 2AO9A 2XB0X 2VUMJ 2L9RA 5F04A 1P7IA 2E2IJ 3DEWA 1ETWA 5GPCA 2HI3A 4XRSG 4JX6A 3S16J 1IUFA 1ZR4A 1XG1A 3B6AA 5EZGA 2FJ1A 5M3MJ 2JK3A 1SFOJ 2Y31A 3HOUJ 1FJLA 3WHCA 1IV6A 1WPKA 2IAIA 2DMQA 5BNGA 3S1MJ 3BT9A 5C4JJ 2LY9A 5K7HA 5M5WJ 2DA3A 2ME6A 1Z0XA 3NAUA 4UUSB 3QPLA 4IHVA 4M3BA 3BG5A 2FQ4A 5J1UA 1WI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSH A;  2YUS A;  2OPT A;  2R5Z B;  3HBL A;  3FIW A;  3JR9 A;  1ETX A;  1VI0 A;  2DTZ A;  2EZH A;  3JRD A;  3E7L A;  2EZI A;  5E3M A;  2TRT A;  5GP9 A;  5EDN A;  4B3A A;  4RDU A;  4XK4 A;  3W6V A;  3GTQ J;  1AKH B;  4AUX A;  1F36 A;  3NAR A;  1A6I A;  3TP0 A;  2M2E A;  1TWC J;  1JUP A;  2CUE A;  1ZQ3 P;  3OSF A;  1UMQ A;  2QCO A;  1XC5 A;  1PUF B;  2GLO A;  2DN0 A;  1BW5 A;  3BTC A;  2COB A;  3Q0W A;  5EGO B;  5JLX A;  2I10 A;  2JN6 A;  4JX4 A;  3RQI A;  5HOD A;  2VPR A;  3S17 J;  2IEK A;  1IG7 A;  3UKG A;  4W97 A;  2QF7 A;  3HGG A;  2X9D A;  3A02 A;  2IBD A;  2B63 J;  2CQQ A;  2M0C A;  2HDD A;  3WHB A;  1HF0 A;  3CQZ J;  4A3C J;  3IV5 A;  3BR5 A;  3QQA A;  3TW7 A;  4XID A;  3BTJ A;  1U9O A;  2VI6 A;  4C3I J;  5EG0 A;  2JA5 J;  1VFC A;  2NS7 A;  4DW6 A;  3ZQI A;  1MBJ A;  2XPW A;  3CCY A;  2XPV A;  3S1R J;  1U78 A;  1GV5 A;  4IHW A;  2NVT J;  2K9Q A;  4ABZ A;  1WH7 A;  1DU0 A;  4IHX A;  5IYB J;  4A69 C;  3I4M J;  3JRF A;  1MSF C;  4DZP A;  1QRY A;  1TWG J;  2DA2 A;  4AC0 A;  1JKP C;  4UUS A;  3GTL J;  2ZB9 A;  3JRC A;  2XGD A;  1E3O C;  1X58 A;  1YRN A;  1POG A;  3ZQG A;  2ID6 A;  3BR1 A;  1HOM A;  5E3O A;  3QPS A;  3SJM A;  3MVP A;  1FTT A;  3K2A A;  1HLV A;  1HDP A;  4AYB N;  1P7J A;  4XIC A;  1MH4 A;  3O8H A;  2CRG A;  2E1O A;  1Y1W J;  1D5Y A;  2ID3 A;  2JMW A;  3IH4 A;  1AKH A;  3LSJ A;  2DA1 A;  4V2F A;  1VND A;  3Q3S A;  5C3E J;  1ITY A;  4I76 A;  1QPI A;  2DA7 A;  1OCT C;  1JT6 A;  2LKX A;  4FE7 A;  1IGN A;  2HOS A;  3RZO J;  1PUF A;  3BQZ A;  1I50 J;  4FIS A;  4L5E A;  5EGO A;  1JUM A;  1IDZ A;  1I3Q J;  2JA7 J;  3M3Y J;  2LD5 A;  5FKL A;  2DMT A;  3S15 J;  2Y30 A;  3FK6 A;  4A3B J;  3IH2 A;  3ZQC A;  3JRI A;  3BR0 A;  3BG3 A;  3LSR A;  3GTJ J;  5IOZ A;  2WAQ N;  1MSE C;  3O8G A;  1RR7 A;  4M3D A;  1JGG A;  1BW6 A;  4M3E A;  2XSD C;  3RZD J;  4A3F J;  4D5F A;  3G1O A;  5IP6 A;  1LE8 B;  2EZL A;  3MKL A;  1JKR C;  1O4X A;  4BBS J;  3GTG J;  1GUU A;  2FD5 A;  4MIM A;  3Q0U A;  2EBI A;  3LOC A;  3GTM J;  3S14 J;  2HXI A;  5F1J A;  1MNM C;  1NTC A;  5EZH A;  4CYC B;  1Q1V A;  4A3L J;  1WCM J;  2DMU A;  5FLM J;  4C2M J;  2M8G X;  2HOA A;  1FTZ A;  1WGX A;  1H89 C;  1W0U A;  1UG2 A;  1APL C;  2E2H J;  1T56 A;  4LOC A;  1TWF J;  3JRH A;  1RKW A;  2L7F P;  2O7O A;  3PM1 A;  3TP3 A;  2HOT A;  1K61 A;  4C3J J;  2MW8 A;  1ETO A;  1LFU P;  2CJJ A;  3TW6 A;  2Y0S N;  5F27 A;  4GFB A;  3HGY A;  4MLO A;  2ECB A;  2EZK A;  4MFE A;  1U9N A;  2M9H A;  3S1Q J;  2DMN A;  1A5J A;  3A03 A;  4XRS A;  5FKK A;  4Y7N J;  3BTI A;  2EH3 A;  1W0T A;  1K83 J;  2Y2Z A;  2NVX J;  2Y9Y A;  2LK2 A;  4DYC A;  2AHQ A;  2LVS A;  4UUT A;  1LFB A;  2R7Z J;  4M3F A;  1AU7 A;  2DA5 A;  1I6H J;  3F0C A;  1GT0 C;  5IOY A;  3ZQH A;  3HB9 A;  1SAN A;  1ETV A;  1B8I B;  3HM5 A;  3HOW J;  1S7E A;  1LE8 A;  2K40 A;  2HQ5 A;  1IC8 A;  1TC3 C;  5GPA A;  3D1N I;  4D7N A;  3OIO A;  4IEJ A;  1T33 A;  2ME0 A;  4D5C A;  1CQT A;  1NK3 P;  3M4O J;  4X6A J;  2R5Z A;  3IH3 A;  1ZR2 A;  4M3G A;  2ECC A;  5FKM A;  5K7Z A;  1X2N A;  2M34 A;  2WB1 N;  3G1M A;  1GVD A;  3CDL A;  4CYC A;  2XPU A;  3DCF A;  1ZGW A;  2H1K A;  4XRM A;  1WH5 A;  1X2M A;  2HXO A;  2GM4 A;  1ETQ A;  4BBR J;  5J1R A;  2JA6 J;  4A3K J;  4JYK A;  2FX0 A;  1RKT A;  4A3M J;  3BR2 A;  5J1Y A;  1MBF A;  1F43 A;  4NDL A;  2DA4 A;  5FLV A;  5F08 A;  9ANT A;  2L0K A;  5IYC J;  3B6C A;  3HEF A;  1HDD C;  2YS9 A;  2O8K A;  5M5X J;  4BY1 J;  1JTX A;  1ZKG A;  4FTH A;  5DS9 A;  1JUS A;  1H8A C;  4C3H J;  4W1U A;  4JX5 A;  4J19 A;  1ZTR A;  2XB5 A;  1IJW C;  2JA8 J;  1HCR A;  2OF7 A;  1IDY A;  1TWA J;  2MGQ A;  3LSG A;  3I4N J;  4BY7 J;  1MH3 A;  5M3F J;  4Y52 J;  3S2D J;  3OOU A;  3FK7 A;  5EEA A;  2KDZ A;  2R92 J;  1TWH J;  1B72 B;  3S2H J;  1B8I A;  2H8R A;  1BL0 A;  2R5Y B;  4D7M A;  5EG0 B;  1BA5 A;  2HYJ A;  4FCY A;  2LTP A;  3G1L A;  2LP0 A;  3K7A J;  2P81 A;  4DZJ A;  1NK2 P;  1IRZ A;  5IYD J;  2E19 A;  3HOV J;  5F0C A;  5E3L A;  4RBO A;  1FEX A;  3SFI A;  3JRE A;  2G0E A;  4MFD A;  1MBE A;  1QVT A;  3PO3 J;  2D5V A;  3A01 B;  5F0H A;  1FIA A;  1GV2 A;  2NOG A;  3ZQF A;  4I6Z A;  2X48 A;  4X1E A;  5JLW A;  2Y9Z A;  1MBG A;  2CQX A;  4BKX A;  1QVU A;  1G2H A;  5J3L A;  4FE4 A;  1ENH A;  4DYQ A;  1JJ8 C;  2L7Z A;  3CMY A;  1RPW A;  1GDT A;  1ZK8 A;  5DTD A;  3BR3 A;  4JP0 A;  4DYR A;  1JKQ C;  1OFC X;  1MBH A;  1JT0 A;  4QTR A;  4M6V A;  2L7M P;  2GBY A;  1U8B A;  2W48 A;  2TCT A;  3FKI J;  2RAE A;  4S0H B;  2DA6 A;  2K9S A;  2X6O A;  5FJ8 J;  4A3D J;  5EF6 A;  2JJ7 A;  2NS8 A;  3BG9 A;  2CUF A;  3JRB A;  1AHD P;  3LSP A;  2LFB A;  1XS9 A;  1ETK A;  3S1N J;  1H88 C;  2K9N A;  3L1P A;  2XGC A;  2DJN A;  3BTL A;  5FKN A;  4HNV A;  1B72 A;  5IPA A;  3BR6 A;  1JJ6 C;  2R5Y A;  1VF9 A;  4MO7 A;  3HDD A;  2WV1 A;  1ORK A;  1RET A;  5C4X J;  2MG4 A;  3C2B A;  4G12 A;  5E3N A;  3H0G J;  3GTP J;  4B1R A;  1UHS A;  5F0F A;  3VPR A;  2CU7 A;  1FIP A;  2VKV A;  1EF4 A;  1JTY A;  2XRL A;  3FIS A;  3SDG A;  3GTK J;  1JKO C;  3H3V K;  1OCP A;  3HOZ J;  3OSG A;  2LLK A;  3A01 A;  1ETY A;  2O9L A;  3RKQ A;  1Z77 A;  5IP7 J;  2R93 J;  2NVY J;  4V2G A;  3GTO J;  4QIW N;  1BJZ A;  1Y1V J;  2EQR A;  5M5Y J;  3HOX J;  1YRN B;  2DMP A;  2LR8 A;  2E2J J;  3ZOB A;  2VKE A;  4B4C A;  5C44 J;  2N8G A;  2YU9 J;  4A93 J;  1OJL A;  1RES A;  3GBG A;  1MBK A;  3PO2 J;  4IHY A;  4A3I J;  3JRG A;  3Q0V A;  4EEF G;  2R0Q C;  5FKO A;  5IP9 J;  5K7F A;  5EYR A;  2MSY A;  3ZQL A;  3HOY J;  3TED A;  1R9T J;  2XGE A;  4BXX J;  4A3E J;  2JWT A;  3BQY A;  2PMZ N;  3JRA A;  2KT0 A;  3HKZ N;  2NVQ J;  3MN2 A;  1DU6 A;  4A3G J;  3LNQ A;  4A3J J;  2ELK A;  2AO9 A;  2XB0 X;  2VUM J;  2L9R A;  5F04 A;  1P7I A;  2E2I J;  3DEW A;  1ETW A;  5GPC A;  2HI3 A;  4XRS G;  4JX6 A;  3S16 J;  1IUF A;  1ZR4 A;  1XG1 A;  3B6A A;  5EZG A;  2FJ1 A;  5M3M J;  2JK3 A;  1SFO J;  2Y31 A;  3HOU J;  1FJL A;  3WHC A;  1IV6 A;  1WPK A;  2IAI A;  2DMQ A;  5BNG A;  3S1M J;  3BT9 A;  5C4J J;  2LY9 A;  5K7H A;  5M5W J;  2DA3 A;  2ME6 A;  1Z0X A;  3NAU A;  4UUS B;  3QPL A;  4IHV A;  4M3B A;  3BG5 A;  2FQ4 A;  5J1U A;  1WI3 A; 
#chains in the Genus database with same CATH topology
 2YUS A;  3SZT A;  2IS2 A;  3TO9 A;  3ZMU A;  3DEU A;  1L0O C;  2F5E A;  2QLZ A;  4M9X A;  4EJO A;  5DM7 F;  2EZI A;  5GP9 A;  3NRV A;  5E8I A;  5EDN A;  3MKY B;  1DDN A;  3GTQ J;  2X6Y A;  2R7O A;  4AUX A;  2BY2 A;  2V26 A;  1QHH D;  1Y39 A;  1TWC J;  1OCZ H;  2CUE A;  1ZQ3 P;  2QCO A;  1R49 A;  1XC5 A;  1PUF B;  1BW5 A;  2X6W A;  2E5Z A;  3BTC A;  3Q0W A;  4A0Y A;  4J00 A;  2HOE A;  2M45 A;  3DKX A;  3I59 B;  2JN6 A;  2VPR A;  5HDG A;  2Z9O A;  3AAF A;  2ZFU A;  2KFD A;  2X9D A;  3A02 A;  2B63 J;  5FFZ A;  2CQQ A;  3G6E I;  4EMS A;  4E7Z A;  1ZGA A;  4I2O A;  1Z3Y A;  3WHB A;  3ZGK A;  4BQA A;  3CQZ J;  3LSM A;  4N9H A;  3OS2 A;  3BR5 A;  3QQA A;  3GZ6 A;  1YG2 A;  2HKX A;  3QU3 A;  3BG7 A;  1U9O A;  4ZYA A;  2XAF A;  4FT8 A;  1SD7 A;  1G59 A;  2K7L A;  3S3O A;  4Y17 A;  4JK1 X;  4HX7 A;  2XPW A;  4U88 A;  5L3F A;  4CDG A;  2RVC A;  1MMD A;  3AG4 H;  1MW7 A;  3GF2 A;  3D0S A;  2DTR A;  3LAP A;  3JRF A;  1MSF C;  5HLT A;  1CF7 A;  3K9T A;  4PSW A;  1QRY A;  1TWG J;  4A0X A;  4M71 A;  4PK4 A;  3RKY A;  1SC7 A;  3GTL J;  2KL4 A;  4KIF A;  1XSV A;  1OPC A;  3FXK A;  2VQG A;  1X58 A;  3ELK A;  2EFO A;  4LLL A;  1YE9 A;  3A0H C;  5B1A H;  2KIU A;  1IUY A;  2DYS H;  1IN5 A;  4I0B A;  3ZQ7 A;  2CRG A;  2IGM A;  3LL7 A;  1HW2 A;  2DA1 A;  3HRT A;  4IQ4 A;  1BC8 C;  1ITY A;  3QRF F;  3KYC B;  3WE3 A;  2L4M A;  2DA7 A;  2EV0 A;  3M8E A;  1FOY A;  2XUB A;  2KQR A;  1MJA A;  4WF2 A;  3F8F A;  1JUM A;  1I3Q J;  2JA7 J;  5LD2 C;  5D5W B;  1R58 A;  3GW2 A;  1KZH A;  3UNG C;  1VQO I;  3J80 K;  5DDG A;  3OIP A;  3ABT A;  3BJA A;  2GZW A;  2V1U A;  4BJ5 C;  3JRI A;  1PDN C;  4AIJ A;  1K6Y A;  4BJ6 C;  3BZ6 A;  2BY1 A;  2M7B A;  1W7P D;  1ZLJ A;  2H94 A;  2NS0 A;  4ENN A;  1FOW A;  2QWW A;  4M3D A;  4EM1 A;  4M3E A;  2XSD C;  4A3F J;  1H9T A;  4D5F A;  3G1O A;  5LEK A;  2EA4 A;  3NWT A;  5IP6 A;  2EZL A;  3VFZ A;  4WXD A;  4L18 B;  4BBS J;  3CZ6 A;  1W5T A;  5DCM A;  1IF1 A;  5ICF A;  2D1H A;  1YLF A;  4CA0 A;  4HBL A;  4MNU A;  2HXI A;  5F1J A;  1NTC A;  4CYC B;  2LG4 A;  3A2K A;  2BGC A;  4IRH A;  1WCM J;  1TQI A;  2R7V A;  3IHU A;  2OTL I;  3ZQQ A;  2CW0 F;  4KIS A;  2L7K A;  1K78 B;  2L5Q A;  1APL C;  1HXD A;  2BVL A;  1NH3 A;  4PUS A;  3JRH A;  2VQL A;  1RKW A;  3H36 A;  3HOT A;  2O7O A;  1FZP B;  3TP3 A;  2PX9 A;  1K61 A;  2XKP A;  4C3J J;  2HOT A;  1V5F A;  4R8H A;  1ETO A;  3J81 K;  2EIN H;  4FX0 A;  4Y4R A;  4MLO A;  4HX4 A;  1TW2 A;  2HZD A;  5L3C A;  1R5I D;  1Q1H A;  1YO5 C;  2YX4 A;  2DMN A;  1UHM A;  1JHH A;  5GAD J;  1A5J A;  1JXS A;  2FEZ A;  4HEA 2;  5FKK A;  2Q8K A;  2XKO A;  1Y0U A;  3H1C A;  1VQL I;  5KK1 A;  2ZNY A;  4XSX F;  1K83 J;  2DXI A;  2NVX J;  3WTT C;  2LK2 A;  3ERM A;  2GIZ A;  2P5L C;  5D8L B;  2KP6 A;  4RGS A;  1SAX A;  4CCL A;  2VBX A;  4P1W A;  4M3F A;  4ZJZ A;  3HYI A;  4KIT B;  2HVS A;  2R7Z J;  4JOM A;  2XAG A;  1XD7 A;  3BCA A;  3F0C A;  1GT0 C;  1QA6 A;  3EYY A;  3HB9 A;  1B8I B;  4CO8 A;  4WWC A;  2OC6 A;  2OAZ A;  3HOW J;  1S7E A;  4EJU A;  1U5T C;  1F1Z A;  3SEQ A;  1LUJ B;  4KT5 C;  3JW4 A;  1Z7U A;  4D7N A;  2KJC A;  5LBQ A;  3ERE D;  4BDY A;  1I6X A;  3J80 Z;  1YX5 A;  3IAM 2;  1W7P A;  4BAC A;  2V6E A;  3CO6 C;  2PN6 A;  4PZJ A;  5JI6 A;  3CC7 I;  3ASO H;  3PIP F;  1SD6 A;  1ZR2 A;  4BDZ A;  1YTY A;  5K7Z A;  4BYY A;  1GVD A;  2UZK A;  1ZAR A;  2RNG A;  4UUV A;  2XPU A;  1ZGW A;  2IS4 A;  5JHF A;  1FYL A;  4XRM A;  4G8X A;  3OYL A;  1X2M A;  4LJZ F;  4NB5 A;  3PJR A;  4BBR J;  5J1R A;  4A3K J;  2FX0 A;  3NWS A;  2PEX A;  4IQJ A;  3MD2 A;  2ZME A;  1X3Z B;  3U1K A;  3BLY A;  2PJR A;  4M9S A;  1OKR A;  2OQG A;  1N75 A;  1S29 A;  1F43 A;  5FLV A;  2XF7 A;  3E6M A;  3GUD A;  3MFK A;  2YS9 A;  5E8G A;  2ETH A;  4L0Y B;  5M5X J;  2KIM A;  3K1M A;  1G3W A;  1JTX A;  4UVC A;  3U9G A;  1JUS A;  2QVO A;  3WTZ A;  3FMQ A;  4HNT A;  2W7N A;  3F21 A;  2P5K A;  2LMD A;  4W1U A;  1BM9 A;  4JX5 A;  4J19 A;  2FU4 A;  1HCR A;  3IP4 B;  4E6K G;  2ESN A;  1IN6 A;  1X1B A;  3G73 A;  4B3X A;  5CVJ A;  3J81 Z;  1IZ1 A;  2WAD A;  3GME A;  1B72 B;  1FYM A;  3W2A A;  3S2H J;  3CMA I;  3F6O A;  3D5S C;  2CH0 A;  3OYJ A;  2IXS A;  1BA5 A;  1U2W A;  4FCY A;  1W5S A;  2F5V A;  1IW7 F;  2P81 A;  4DZJ A;  1NK2 P;  1V55 H;  3HTU A;  2L2O A;  2E19 A;  3OMY A;  5E1X A;  3J7Y J;  1KGS A;  5F0C A;  1ZYR F;  4ZDP A;  3KP2 A;  4RBO A;  1RIO H;  1FEX A;  2G0E A;  3HG9 A;  1T0F C;  1MBE A;  3DBL B;  1QVT A;  4U0Y A;  2X1C A;  2CW8 A;  1FSE A;  1GV2 A;  2R7Q A;  3A1Y A;  3DKY A;  4G9Y A;  1J7K A;  4BHC A;  3R6S A;  2FOW A;  4ENJ A;  1MBG A;  4BKX A;  1S7O A;  1G2H A;  4LG0 A;  2A3S A;  1PYV A;  4FE4 A;  1MKM A;  2L7Z A;  2XRN A;  3CMY A;  1MJB A;  3P9K A;  1GDT A;  4HAM A;  1ZK8 A;  2GOM A;  5JVG F;  5DTD A;  3FZV A;  4LFU A;  3KX2 A;  3ZMV A;  1JT0 A;  1WHU A;  2CV0 A;  2R3S A;  2GBY A;  2LBF A;  2M87 A;  3SDB A;  1PJR A;  3DWL E;  1KU9 A;  2M3A A;  3CCL I;  3VSK A;  1USS A;  3DPU A;  3WU0 A;  3S8P A;  1TNS A;  2ZXH A;  4YFN F;  1PP8 F;  2X6O A;  1M1E B;  3G3Z A;  3FXR A;  3OYC A;  4ZC3 A;  2JJ7 A;  2X1D A;  2Z1D A;  1FX7 A;  2LFB A;  4CCO A;  1XS9 A;  1ETK A;  2NOJ B;  1OCR H;  4GO1 A;  4ESF A;  1JI8 A;  3U2R A;  4JBA A;  2L02 A;  3JTG A;  1O57 A;  1XGN A;  2MD5 A;  3BR6 A;  4HA8 A;  4G6Q A;  4F3Q A;  4DOZ A;  1JJ6 C;  2R5Y A;  5K5Q A;  1VF9 A;  3K6G A;  1ZLK A;  3HDD A;  2DPD A;  2MBF A;  2K4J A;  5LHI A;  3CDH A;  3DF8 A;  3OIQ A;  2X51 A;  3EUH C;  3MZY A;  2DO7 A;  2F5F A;  3H5R A;  4HF0 A;  3FXO A;  3KLO A;  2UXN A;  1JTY A;  2HZT A;  3SDG A;  4HSR A;  1BI0 A;  2DOD A;  1YYV A;  1E3P A;  4A6D A;  1ZRE A;  3HUG A;  3OSG A;  3CDI A;  3L2V A;  2LLK A;  4AID A;  1ETY A;  3C18 A;  3CTA A;  2XVC A;  5AIP A;  2QSH X;  2A6H F;  4IOC F;  5FRO A;  4RMN A;  4QIW N;  2AXL A;  1Z6T A;  1Y1V J;  2VJ4 A;  1AA7 A;  3HOX J;  1ZG1 A;  1YRN B;  2EFP A;  3ABL H;  2LR8 A;  3WTY C;  1P4W A;  3ABU A;  5LHG A;  3GBG A;  3R4K A;  3V8K A;  3SQN A;  4EEF G;  2ZJQ F;  3H3Z A;  2KDO A;  2G7H A;  3MMY B;  2VJ5 A;  1B1B A;  2CW7 A;  1TTY A;  2XGE A;  1P4X A;  3FMS A;  4BXX J;  3VB2 A;  4R1H A;  4E4H A;  1ERD A;  3OYI A;  2DAO A;  3BQY A;  4KUM A;  5CQE A;  2F5C A;  4A3E J;  4FAS D;  3DEE A;  2L9N A;  3HKZ N;  3VSL A;  5A2Q K;  2KLO A;  1IAW A;  3S3M A;  3LNQ A;  3HTS B;  1R5G A;  3I53 A;  1NHA A;  2VN2 A;  3V7R A;  1FLI A;  4L9N A;  3ZRG A;  2VUM J;  1DUX C;  2ZJP F;  2A6T A;  1FBQ A;  1R6R A;  3CCQ I;  2D2W A;  3F6V A;  1Z67 A;  3TQN A;  1HW1 A;  1ETW A;  4CGZ A;  3I4P A;  1LVA A;  5GPC A;  1ZEL A;  1FY7 A;  4XRS G;  2DQR A;  2RC4 A;  5DD8 A;  3QOE A;  1H0M A;  1ZH5 A;  5M3M J;  2R7S A;  2FSW A;  2DMQ A;  1X3W B;  2A68 F;  3BT9 A;  3E6C C;  3EPZ A;  3OV8 A;  3K2Z A;  3ABK H;  2DA3 A;  4CYD A;  2ME6 A;  1U3E M;  4UUS B;  3FM3 A;  5ILU A;  3C3W A;  3ZMT A;  4R79 A;  2ZNZ A;  1YW8 A;  4XLE A;  1YJ9 I;  4PSX A;  5CVR A;  2LY1 A;  3DPT A;  2W82 A;  2V9V A;  2OPT A;  3I58 A;  3HBL A;  1MDM A;  1ETX A;  2DTZ A;  2EB7 A;  1SD4 A;  2RN7 A;  2QQ8 A;  4RLF A;  3W6V A;  2M7A A;  1B6A A;  1G8X A;  2F5D A;  5LLQ A;  4I98 B;  1T38 A;  3TP0 A;  1Z3X A;  1NG6 A;  2G7U A;  2M2E A;  1OQY A;  4P9F A;  1WVR A;  3PFI A;  1V3F A;  4BJT A;  1REP C;  1GLN A;  2I10 A;  3CCJ I;  2PLY A;  1KYZ A;  4JX4 A;  3BDD A;  4XSZ F;  3RTR A;  5HOD A;  1KYW A;  2ZXW H;  2QF7 A;  2IBD A;  2K9L A;  3HOS A;  3LAJ A;  2CO5 A;  5L3B A;  1QBJ A;  1YJN I;  1R22 A;  3KZZ A;  3TW7 A;  2P0W A;  4B48 A;  1MZB A;  1K79 A;  3V8J A;  3SYT A;  4IJA A;  4C3I J;  5EG0 A;  5HOO A;  1VFC A;  2RGV A;  2DPU A;  2NS7 A;  2W85 A;  4DW6 A;  1R23 A;  3S93 A;  3ZQI A;  3S1R J;  3CCY A;  4IHW A;  3CJN A;  1SAU A;  2K85 A;  1WH7 A;  2V79 A;  1J09 A;  2BZT A;  2W57 A;  3N05 A;  3H9G A;  5J4V A;  4BL0 B;  1YJW I;  1W36 C;  3I4M J;  3BRO A;  5DEQ A;  4ZTF A;  1QO0 D;  5DD4 A;  3I55 I;  2DCE A;  2DA2 A;  5A2Q Z;  2VB6 A;  5GAH J;  5J4Y A;  1JKP C;  2FNP A;  3JRC A;  2XGD A;  1STZ A;  1YRN A;  5HNH A;  1POG A;  4I7H A;  2M8E A;  4MQV A;  2VBY A;  1I39 A;  3BR1 A;  3AFH A;  2WA0 A;  3F8M A;  1FTT A;  3K2A A;  1XGO A;  2UUZ A;  1HDP A;  1MH4 A;  2DOA A;  4LIT A;  2P8T A;  2E1O A;  1Y1W J;  3R61 A;  4E7I A;  2ID3 A;  2JMW A;  2J5O A;  3IH4 A;  3KP7 A;  4NQW A;  4YRV A;  3IAS 2;  5LEJ A;  4BNC A;  1VND A;  3Q3S A;  2K9M A;  2WY8 Q;  4G94 A;  1T6S A;  1JT6 A;  4FE7 A;  1IGN A;  3IC7 A;  3GLX A;  2DBB A;  3RZO J;  5FFX A;  3BQZ A;  1PUF A;  1NG7 A;  1I50 J;  2IT0 A;  2ZXI A;  1IDZ A;  1OYW A;  2DYR H;  3I59 A;  4N4O B;  1EKE A;  2BE5 F;  4L5J A;  3S15 J;  4ZDO A;  1HKT A;  2LF8 A;  4EJW A;  3VDX A;  5DCF A;  4B44 A;  1Z9C A;  1WFX A;  3LA7 A;  1WRJ A;  5J8C A;  3ZQC A;  1ON2 A;  3W2V A;  4XM3 A;  3WGI A;  4YFK F;  1RNL A;  1FBS A;  3DTE A;  3LSR A;  3GTJ J;  1Y0N A;  2PMZ A;  1V54 H;  4HZF A;  1YS6 A;  4GXO A;  5CPR B;  1JGG A;  3O6B B;  1MMS A;  3RZD J;  3KE2 A;  5KVR A;  2IS1 A;  2HKO A;  2OZ6 A;  3DTK A;  4UB6 C;  3FKJ A;  3GTG J;  2I5U A;  2BW3 B;  1YIO A;  1MMG A;  1SVM A;  1IV8 A;  4MIM A;  3SZG A;  3Q5F A;  4XMY A;  3H35 A;  1TZL A;  3O3K A;  3S14 J;  1KU2 A;  5EJC A;  1BIB A;  2E71 A;  1D8K A;  5FD5 A;  5EZH A;  3K10 A;  4HQE A;  4A3L J;  1PVE A;  2DW4 A;  2YPR A;  4ASN A;  1WJF A;  3K1N A;  3TDU C;  1FP2 A;  1VQ5 I;  1Y8Q B;  1H89 C;  3T8T A;  5LFA A;  1AOY A;  1N25 A;  2E1N A;  2W25 A;  5D5U B;  1MMN A;  2KZG A;  2L7F P;  1U8R A;  3QAH A;  1D0Y A;  2LRD A;  3HJE A;  4CCN A;  2MW8 A;  4BGD A;  1HQC A;  2A5W A;  2Y0S N;  5F27 A;  1BI1 A;  3MAJ A;  2IVM A;  1R00 A;  2M9H A;  3WU1 B;  5BPD A;  4RB3 C;  3AL0 B;  3REO A;  3BTI A;  5B66 C;  3ONQ A;  5LRR A;  1W0T A;  2RQP A;  3E3V A;  4IHT A;  1D5V A;  4ZTJ A;  1B59 A;  4L9J A;  2Q2E B;  4BHB A;  2K4B A;  4DYC A;  4UUT A;  1ULY A;  2DA5 A;  3CP2 A;  5BS6 A;  3RJP A;  2JRM A;  5FRN A;  4L9V A;  1ETV A;  3WTX C;  1OLT A;  3W6K B;  3G2B A;  1O7F A;  3IKT A;  3ECH A;  3PIO F;  2K40 A;  2HQ5 A;  3WE2 A;  1FWZ A;  4IEJ A;  1W36 D;  4OIO F;  3M4O J;  3E5U A;  3PL8 A;  4D1Q A;  3PQK A;  1U0J A;  4PJJ A;  5K1Y A;  2R5Z A;  1O3R A;  3FBN B;  2ECC A;  2V1D A;  3KPH A;  1XSD A;  1ZN2 A;  1X2N A;  2M34 A;  2WBM A;  2WB1 N;  3CES A;  3OYF A;  3M1C A;  4MTD A;  4CYC A;  3T8R A;  4G6D A;  3RI4 A;  1BI2 A;  3LA2 A;  2OBP A;  2GM4 A;  5AON A;  4JYK A;  4XON A;  3ZPL A;  2VC1 A;  1X4P A;  3DPL C;  3FDY A;  1S5L C;  3WG9 A;  1ZAO A;  2WV0 A;  2LC2 A;  1BC7 C;  1J59 A;  3VYR B;  4A12 A;  5J1Y A;  1MBF A;  2OA4 A;  2C6Y A;  1J9I A;  1UCR A;  2DA4 A;  5F08 A;  9ANT A;  4AU7 A;  2XAS A;  2GA2 A;  2KRH A;  2MLG A;  1HDD C;  2DK8 A;  3KEQ A;  5DUI A;  2Z99 A;  2EPF A;  1VTN C;  4HOB A;  3W6J B;  1HKQ A;  2ZSI B;  1LEB A;  2OCC H;  4ZH4 F;  2MH2 A;  4G6T B;  3GLL A;  4F52 A;  4Y15 A;  1ZTR A;  5HS8 A;  2VOD A;  2XB5 A;  2JA8 J;  2CQK A;  4E7H A;  2EIL H;  1IDY A;  1FYK A;  3DU5 A;  1ZGJ A;  4OAY A;  3I4N J;  5M3F J;  1X1A A;  5K5R A;  1DQU A;  4Z2Y A;  2Z2S B;  3FK7 A;  3OOU A;  2R92 J;  1TWH J;  4AWX B;  1B8I A;  3GO5 A;  5CYV A;  1OYY A;  3CC4 I;  1D1A A;  4D7M A;  5L3G A;  2YX7 A;  2EA2 A;  2HYJ A;  2R7T A;  2LTP A;  1KON A;  2LP0 A;  2HVQ A;  3FHN A;  5CJ9 A;  3V4G A;  2L3D A;  3HOV J;  5IYD J;  3ZMD A;  5B3S H;  3LA3 A;  3CCM I;  4BEH A;  3N97 A;  4A0Z A;  3SFI A;  1XB4 A;  4D0P A;  3KET A;  3WGH A;  4CSW A;  2EIM H;  2HQA A;  1Z7L A;  3RKX A;  1A6Q A;  1BBY A;  3PO3 J;  3A01 B;  4C30 A;  2EV6 A;  4G7Z F;  2EFN A;  4PFO A;  4I6Z A;  3AKZ A;  3QYE A;  4X1E A;  1SEU A;  5IT9 K;  2LF7 A;  4MEY F;  2L4A A;  4OIN F;  3WU2 C;  1ENH A;  1R1V A;  3E5Q A;  2P5V A;  1J75 A;  4BE0 A;  1Y56 A;  1RPW A;  4PJL A;  2KRC A;  1R1U A;  4JP0 A;  3H92 A;  4DYR A;  4X0G A;  3QPH A;  4OIQ F;  1YW9 A;  2X4H A;  4KIB A;  5TGT A;  1RZ4 A;  4E7L A;  1Y8R B;  2L7M P;  3VYT B;  5FD6 A;  4RGU A;  1U8B A;  4ESB A;  2DQL A;  3QYB A;  1WQ2 A;  4XN3 A;  4OIR F;  2KJB A;  2A69 F;  2K3P A;  3I0T A;  2DA6 A;  4QPO A;  2ZSH B;  5LGU A;  2QSG X;  5HLG A;  1XSX A;  3L00 A;  3NQO A;  1XCB A;  2CUF A;  4B09 A;  3LSP A;  1R7J A;  2IGN A;  3S1N J;  2VC0 A;  3DFG A;  3M07 A;  3L1P A;  2KIQ A;  2VLA A;  1OMI A;  3C2H A;  2OCE A;  3HRU A;  2E34 A;  5DV5 A;  2VXD A;  4AD9 A;  3GFM A;  4RS8 A;  2W4S A;  1W1W E;  1B72 A;  2QGU A;  4RGX A;  4HV5 A;  4M6X A;  1OR7 A;  4M73 A;  1BOA A;  3A4C A;  3IUO A;  4M9Z A;  4NUB A;  4HG2 A;  2WV1 A;  4BS9 A;  5C4X J;  1XTA A;  3BCB A;  3HSR A;  2MG4 A;  1F4K A;  4G12 A;  3GTP J;  5LGT A;  4UXN A;  1MMA A;  1I27 A;  2L9S A;  5F0F A;  2CU7 A;  4G7H F;  2EIJ H;  2GIV A;  1PP7 U;  3FIS A;  4V19 K;  5HNF A;  2ISY A;  1VQN I;  3GTK J;  3RPU D;  4XQF A;  4LLG F;  3HRM A;  2LKS A;  5GAG J;  1QZZ A;  3W3C A;  1Z77 A;  3I64 A;  2NVY J;  4S05 A;  1CGP A;  1K4S A;  2JT1 A;  1UZC A;  5M5Y J;  4XLF A;  3SEZ A;  2EV5 A;  4UV9 A;  3ZOB A;  2VKE A;  1QQI A;  4AVP A;  4B43 A;  4KJZ A;  1LJ9 A;  4F91 B;  5H2F C;  4A93 J;  4YIF A;  4IXA A;  1S72 I;  3KEO A;  2O6G E;  3PO2 J;  4IRG A;  3ULQ B;  2FNA A;  4DJA A;  3JRG A;  2R0Q C;  3QYF A;  3ASN H;  1UEL B;  4II3 A;  3HOY J;  5EYR A;  2MSY A;  4ZZL A;  4EJV A;  1ODD A;  1XGS A;  4IVN A;  4ANJ A;  1YHQ I;  2ZKZ A;  4LB6 B;  5LRS A;  3T0Y A;  1KQ8 A;  2KT0 A;  5IT9 Z;  4AIH A;  3CLO A;  4XBF A;  3MN2 A;  1DU6 A;  4LMY A;  4KN4 X;  3TKY A;  3VEP A;  2F6C A;  2XB0 X;  3BOQ A;  5GTH C;  2MFZ A;  1YI2 I;  1ZRF A;  3HPH A;  4EJT A;  4ENK A;  4MGR A;  3DEW A;  5JVT A;  2ZCW A;  2XDV A;  1SVO A;  1ZR4 A;  4FQG A;  3KZI C;  5AIQ A;  3DU6 A;  2JK3 A;  3E97 A;  2VJI A;  1IV6 A;  1IRF A;  3CO7 C;  3HPG A;  3H5A A;  1ZRD A;  5J47 A;  5M5W J;  4XKW A;  2L01 A;  1IO2 A;  3NAU A;  5E17 F;  3SFZ A;  4XKB A;  2JVH A;  3K70 C;  2BY3 A;  1T08 B;  2Y75 A;  1ONV A;  2EZH A;  3JRD A;  3E7L A;  4LIV A;  4N0B A;  2QBY B;  1XX5 A;  4NNJ A;  5E3M A;  4ZZD A;  4B3A A;  2F2E A;  2CWE A;  3MZ8 A;  2ICW G;  3RPU A;  1AKH B;  3GFL A;  1F36 A;  3RPQ A;  3KP3 A;  1X1D A;  3AL0 C;  5F6F A;  1TBX A;  1BOB A;  4WK8 F;  1E3H A;  3BC8 A;  2QQ9 A;  3J7A Y;  2OQR A;  1EV7 A;  4TV7 A;  2K86 A;  2FBK A;  1B4A A;  2OV7 A;  3PFY A;  4WXH A;  4RB2 C;  2GLO A;  3QWL A;  2R7W A;  2HDC A;  2V4J C;  5EGO B;  3OYK A;  1EH8 A;  1G3S A;  2STT A;  4IPA A;  4HQM A;  3RQI A;  3EUK L;  4BQO A;  4OU0 A;  3S17 J;  2UWM A;  3V7C A;  3EQL F;  4W97 A;  4JQF A;  1SFU A;  2QEN A;  5DUK A;  4IZZ A;  2M0C A;  2KIS A;  2HDD A;  1SMY F;  1HF0 A;  2DJI A;  3LSK A;  4IF4 A;  3IV5 A;  4HV6 A;  3HSE A;  3CCS I;  3FXM A;  1V4R A;  2WTE A;  4BU2 A;  1ZHF A;  3VYS B;  2JA5 J;  2D45 A;  1GV5 A;  5F64 A;  3KLN A;  5E1Z B;  4ABZ A;  5D5X B;  4MQ9 F;  3U21 A;  5L3D A;  1S6L A;  2XGX A;  1LPQ A;  4IHX A;  4A69 C;  4WX9 A;  1D8J A;  3K1P A;  1RRJ A;  3F8N A;  2K5C A;  4OIP F;  3IKV A;  1T2K A;  4AC0 A;  4UUS A;  1IXS B;  5CKT A;  1I1G A;  2ZB9 A;  3H9Q A;  3DV8 A;  1FMV A;  4NHJ A;  1E3O C;  1QGP A;  1LB2 A;  2CUJ A;  3FMR A;  3ZQG A;  1W4M A;  2ID6 A;  1XMX A;  1HOM A;  3QPS A;  2HGC A;  1VQK I;  3LMM A;  3SJM A;  3M1E A;  3MVP A;  2JVG A;  4ON0 A;  2GOX B;  2JPB A;  3FXU A;  4AYB N;  1P7J A;  3O8H A;  4CZZ A;  1D5Y A;  2FMY A;  4Z6Y A;  3MWM A;  4LG0 B;  3SXY A;  2GQQ A;  2RRE A;  4CZC A;  1KU7 A;  3SHF A;  3L2Q A;  5HDN A;  3PSF A;  1IRX A;  1FOK A;  1WJ5 A;  1TP4 A;  1RUO A;  4PFP A;  1WJA A;  4FHT A;  4FIS A;  4RA2 A;  3CCE I;  2KIF A;  2O3F A;  5D4S A;  5BQT A;  3M3Y J;  1QZE A;  1Z05 A;  2Y30 A;  3FK6 A;  3JCU C;  2HPM A;  4H0E A;  3HXL A;  2JSC A;  4B47 A;  4HPQ A;  1FC3 A;  4U0V A;  3HHG A;  1R36 A;  3IRQ A;  3BG3 A;  2VQC A;  3BZK A;  2ZC2 A;  1UB9 A;  4CIC A;  2W24 A;  1R5H A;  1BR1 A;  5IOZ A;  1IN7 A;  2WAQ N;  3HKZ A;  2MH9 A;  3O8G A;  1PUE E;  4I02 A;  1BW6 A;  2KHM A;  1OCO H;  2M0M A;  3M7G A;  4RB0 A;  3ZN0 A;  1LE8 B;  1D3Y A;  3LSI A;  2JA2 A;  3MKL A;  1JKR C;  4EVI A;  2CYY A;  1XDS A;  2DFH A;  3GWZ A;  4DBQ A;  1F9N A;  4CHU A;  4KIG A;  1Z21 A;  1U5T A;  1GUU A;  3CJT B;  3Q0U A;  2CUZ A;  5BOX A;  3PNY A;  2EIK H;  4HF2 A;  2JSP A;  3LOC A;  1E17 A;  2WAQ A;  2CFX A;  3AG3 H;  3VOE A;  4EM2 A;  2MC4 A;  4YG2 F;  1QHG A;  4IOA F;  4P5O A;  1Q1V A;  2MD0 A;  3CUQ B;  3RSN A;  1TLH B;  2QYO A;  5HS7 A;  4A6E A;  5E20 A;  1T95 A;  2DMU A;  3F23 A;  4C2M J;  1WWX A;  2EFQ A;  2HOA A;  1FTZ A;  1WGX A;  2E60 A;  1UG2 A;  3F22 A;  1W0U A;  1WJD A;  5HVQ C;  1S8N A;  2E2H J;  1T56 A;  4LOC A;  4EGZ A;  4BAY A;  2ZXJ A;  2BHZ A;  2ADU A;  3PM1 A;  4BH9 A;  4FET A;  3ROU A;  2CJJ A;  1FNN A;  3R0A A;  4GFB A;  2FRH A;  2HDW A;  4ZYD A;  4CXF A;  1A35 A;  3MZH A;  1X1P A;  2XF6 A;  3EYI A;  3S1Q J;  4UHT A;  3RDI A;  4D9J A;  1QZY A;  2XAU A;  3A03 A;  3KFW X;  3VYU B;  4BQN A;  4XRS A;  4Y7N J;  2EH3 A;  3O2P E;  5B5E C;  2A6E F;  3FBI B;  4U87 A;  3WG7 H;  2Z5U A;  2LRE A;  3BWG A;  3I9V 2;  3TO6 A;  5ICE A;  4KA4 A;  4MEX F;  2AHQ A;  4ITV A;  4KMU X;  3Q9S A;  2AS5 F;  3ZCO A;  1XN7 A;  5FGM A;  1LEA A;  4ZYE A;  1AU7 A;  1HKS A;  1ZG3 A;  3OR1 C;  4XOR A;  1I6H J;  2R4G A;  2JPC A;  1LFP A;  3ZXS A;  3JAM K;  3ZQH A;  3J7A O;  4C2U A;  3P7N A;  4U0W A;  2R7R A;  3HIF A;  2HNH A;  2BXZ A;  4M74 A;  1GXP A;  4XR6 A;  2V9P A;  4NC6 A;  1LQ1 A;  1JHF A;  2V9K A;  1IC8 A;  2OU2 A;  3Q9V A;  5GPA A;  4C9Y A;  2V6C A;  4ESJ A;  1T33 A;  2QUF A;  4D5C A;  5J6X A;  1SFK A;  1EJ9 A;  1CQT A;  3JSO A;  2OD5 A;  1NK3 P;  4GGG A;  2E1C A;  1S9H A;  1LNW A;  1TT5 B;  2AXT C;  4M3G A;  3TMO A;  4KDP A;  3BG6 A;  3PSI A;  3G1M A;  1D1B A;  4EQQ A;  4S04 A;  3DCF A;  3QPT A;  4HW0 A;  1S3J A;  1T0F A;  2LKP A;  1V5E A;  4GCV A;  2JA6 J;  1GHC A;  1MDM B;  3C2G A;  3QP6 A;  1Z91 A;  3OR2 C;  3I5U A;  4A3M J;  3AG1 H;  4KYW A;  3BPX A;  5FO5 A;  2IW5 A;  1R4M B;  3RCO A;  1HBX G;  2MA3 A;  1A04 A;  2PI0 A;  2EJR A;  4RLQ A;  3KYL A;  2L0K A;  5IYC J;  1O3T A;  3DLA A;  2QKL B;  2EWN A;  3HEF A;  1EH6 A;  1IN4 A;  3E6B A;  2KPM A;  2VL8 A;  1IN8 A;  3BJ6 A;  2TDX A;  2H27 A;  1TT0 A;  2IGO A;  3L09 A;  1SFE A;  4I99 C;  1KU3 A;  3JSP A;  4FTH A;  5DS9 A;  2ZBK A;  2VKD A;  3WOD F;  3L2C A;  2XIG A;  1H8A C;  4C3H J;  5ILV A;  5D8K B;  2K02 A;  4RB1 A;  4XNF A;  3OYD A;  2QKM B;  1FT9 A;  3U1D A;  4HRI A;  2MGQ A;  1MNE A;  3MKW B;  1MH3 A;  2WC2 A;  2FBH A;  1FMW A;  2A5Y B;  3DTI A;  3E1S A;  5J8F A;  3S2D J;  3F9K A;  2KDZ A;  2VE8 A;  1A36 A;  2PMU A;  4PGH A;  5LGN A;  3RKW A;  1G4D A;  2F4I A;  5EG0 B;  3ZMS A;  4P9U A;  4L0Z B;  4MTE A;  1P4A A;  1YIT I;  4BXU A;  1G6N A;  5E3L A;  3ZR8 X;  4KT6 A;  4Q5S F;  3LFU A;  1IXC A;  3I71 A;  1O3S A;  3LQQ A;  4MFD A;  1R71 A;  3WGG A;  3EUH A;  2D5V A;  4OOI A;  5F0H A;  4UNO A;  2NOG A;  3G71 I;  3JAM Z;  2CMP A;  3RIR A;  2BVM A;  2X48 A;  5JLW A;  2V7F A;  2STW A;  2B9S A;  3D5L A;  4G7O F;  1QVU A;  2PMH A;  3ECO A;  3LSH A;  5J3L A;  1GVJ A;  4OMZ A;  1WJB A;  1VQP I;  4PDK A;  4DYQ A;  2HFH A;  2VON A;  3C7J A;  1D0X A;  1SMT A;  2GWR A;  2G9W A;  2HQR A;  4NQW B;  1WSU A;  2AQF A;  2XF5 A;  2BHY A;  1Z6R A;  2I8D A;  1RI7 A;  2VIX A;  2W48 A;  5JR3 A;  2K3F A;  3FKI J;  2FML A;  2RAE A;  1BJA A;  3ML6 A;  4LK0 F;  1G3T A;  3JTH A;  1VQ4 I;  2K9S A;  5JHU A;  5FJ8 J;  2Y0S A;  2IA2 A;  4A3D J;  5EF6 A;  1X4O A;  4F7Z A;  5ICC A;  3FWE A;  2OJE D;  3QOP A;  4KMF A;  2RNJ A;  4P96 A;  3OYA A;  2K9N A;  5GAE J;  1H88 C;  4BHP A;  3FXJ A;  4RAY A;  1AWC A;  2XGC A;  4QWQ A;  4WXC A;  5FKN A;  2DOF A;  1B9N A;  4HNV A;  3KCC A;  4HF1 A;  5IPA A;  4XKC A;  3GFJ A;  2VE9 A;  2GA1 A;  5BMZ A;  3RYP A;  2M30 A;  3H0D A;  2EFW A;  4F55 A;  2VPL A;  4MO7 A;  2W00 A;  1RET A;  2IPQ X;  3ABM H;  2ZJR F;  3L9F A;  3SZP A;  1A31 A;  1UHS A;  3GEZ A;  2W1O A;  1I1S A;  1EF4 A;  1FIP A;  2VKV A;  2XRL A;  1FP1 D;  2EK5 A;  1E2X A;  3H3V K;  1OCP A;  3HOZ J;  1BIA A;  2DFF A;  3A01 A;  4LGW A;  4AVZ A;  1K78 A;  2R7U A;  5HDK A;  2AQE A;  3C1D A;  2X85 A;  3PUF A;  3GTO J;  3MKZ A;  4XL9 A;  3FXQ A;  2FA5 A;  3QOD A;  2JQ7 A;  2QEX I;  2DDB A;  1EA3 A;  1WKM A;  2DMP A;  1DP7 P;  3OYN A;  4LLN A;  2WB1 A;  2E2J J;  4B4C A;  4BUP A;  2YU9 J;  3TL4 X;  1N77 A;  3OY9 A;  5DYM A;  2CQ7 A;  1UJ8 A;  2HS5 A;  5D6F A;  2RQQ A;  3GCM A;  4OAZ A;  4A3I J;  4IHY A;  5FKO A;  4XLP F;  1DPU A;  5IP9 J;  1J0R A;  2E35 A;  5EEH A;  3OS1 A;  4N9I A;  5FB2 A;  1VZ0 A;  1R9T J;  4HDU A;  2DOE A;  3DP7 A;  3DBH B;  3GZN B;  3RYR A;  2IA0 A;  3JRA A;  1YX3 A;  3OS0 A;  1MJ9 A;  1P9Q C;  2H6C A;  4E7K A;  1FBU A;  1SD5 A;  3BY6 A;  3OYH A;  1QU3 A;  3CJQ B;  1O7L A;  2WAE A;  4L9T A;  3TO7 A;  1XGM A;  2X0L A;  2XAQ A;  5F04 A;  5ED4 A;  2E2I J;  3M8F A;  1I3A A;  2NXN B;  3K4N A;  5E79 C;  2HI3 A;  3PNT A;  1XMA A;  4JX6 A;  1IUF A;  2HR3 A;  3DBR B;  3B6A A;  3GX4 X;  5EZG A;  3ZP5 A;  1K4T A;  2FJ1 A;  1BR2 A;  1VQ9 I;  3OYE A;  1SFO J;  2Y31 A;  3HOU J;  4HLX A;  3WHC A;  2O61 A;  1WPK A;  3MCZ A;  4KN7 X;  2O8X A;  2XSJ C;  5BNG A;  5C4J J;  1CF7 B;  3CUQ C;  4I09 A;  4A5M A;  3UR3 C;  3TGN A;  3KZY A;  5KAF C;  2NYX A;  1SVL A;  4ZYG A;  3E5X A;  3K4M A;  3KIO A;  4M3B A;  2JZY A;  3ESW B;  1DGR M;  3BG5 A;  3I56 I;  1WI3 A;  2ZO4 A;  4KIC A;  4QSH A;  3GYH X;  3CME I;  1WI9 A;  2R5Z B;  3FIW A;  3JR9 A;  3T1B A;  1VI0 A;  1WJE A;  2E1M B;  3K4B A;  2TRT A;  5IT3 A;  3QU6 A;  4RDU A;  2COM A;  4XK4 A;  1YS7 A;  3D5R C;  2DK5 A;  4LD5 A;  2BOL A;  4O6J A;  2BY0 A;  3NAR A;  3N4M A;  2CG4 A;  1A6I A;  2WY7 Q;  3K69 A;  4YII A;  1RC9 A;  3E6D A;  1VQM I;  1JUP A;  5DM6 F;  3OOP A;  3OSF A;  2P7C B;  1UMQ A;  2VKH A;  2QQB A;  2DN0 A;  2YSR A;  2COB A;  4DBR A;  3HC7 A;  1E0E A;  5E1W A;  2VOO A;  2MLK A;  5JLX A;  3L2W A;  4CH7 A;  1G3Y A;  1MGT A;  3TOA A;  2IEK A;  1X19 A;  3MEX A;  3UKG A;  1QNT A;  1IG7 A;  3FXL A;  1GXQ A;  3CCU I;  3HGG A;  3IL2 A;  2F4M B;  2QM3 A;  3FX3 A;  5TIS C;  4O5V A;  3K4J A;  3EUA A;  4A3C J;  4E7S A;  4XID A;  3BTJ A;  2VI6 A;  1OCC H;  3OL4 A;  4YEJ A;  3E0J B;  2QQA A;  2CFO A;  2DT7 B;  1U78 A;  1MBJ A;  3BZC A;  2P7V B;  2XPV A;  2NAZ A;  2NVT J;  4PGG A;  2K9Q A;  1F5T A;  2Y0M A;  4UVB A;  1DU0 A;  4RGR A;  1UG0 A;  5IYB J;  5ICG A;  1J5Y A;  3WTS C;  2VBZ A;  5DCM B;  4DZP A;  4BXF A;  4EV0 A;  3CCV I;  3DLL F;  3K0L A;  2IA1 A;  3MQ0 A;  3CLQ A;  4BEH B;  4PJM A;  4GDF A;  1Z1D A;  2ELJ A;  3COA C;  1KQ0 A;  4O3M A;  3AG2 H;  2NNN A;  5E3O A;  2FBI A;  2NRA C;  1KQ9 A;  2K27 A;  2KZV A;  4Q4Z F;  3S3N A;  2QBY A;  2GXA A;  4YFX F;  2HEO A;  1HLV A;  3CMM A;  4Y13 A;  4XIC A;  1LKX A;  4XLN F;  5IY5 H;  2IJL A;  1BI3 A;  1LDJ A;  3LSJ A;  4V2F A;  1AKH A;  2W84 A;  5C3E J;  4I76 A;  3ZN1 A;  2HVR A;  2JUC A;  3NEU A;  3PNV A;  2JTV A;  1OCT C;  2DFI A;  1QPI A;  1OYI A;  2P6S A;  2LKX A;  2H6B A;  3OWT A;  1H9G A;  2HOS A;  2VT3 A;  5TRD A;  4K2E A;  4L5E A;  5EGO A;  2P6T A;  2LD5 A;  5CVV A;  3OYM A;  5FKL A;  2VOP A;  2DMT A;  2Y48 A;  4CCM A;  5HLI A;  3IWZ A;  1P92 A;  2KKO A;  3TOB A;  4MHG A;  4A3B J;  5CVU A;  2E7W A;  3IH2 A;  3FHZ A;  1ZRC A;  4YEL A;  4PJN A;  3BR0 A;  2LNB A;  2CV2 A;  4HX8 A;  4C2T A;  3LQR A;  1LDK B;  4AIK A;  2BBY A;  2UV1 A;  1T39 A;  2ZJ2 A;  2VJJ A;  4XRF A;  2B7E A;  1MSE C;  1FSH A;  1D1C A;  1RR7 A;  2LDU A;  2UXX A;  5KAI C;  5K5O A;  1TL8 A;  4E70 A;  2O5R A;  3I54 A;  2VQH A;  3EET A;  3OYB A;  1O4X A;  3OL3 A;  4UB8 C;  4ENM A;  1W7P B;  1YW7 A;  2FD5 A;  4RAG A;  4DGW B;  3R0J A;  1L3L A;  2EBI A;  3V8L A;  2BV6 A;  3P9C A;  4XKV A;  5J40 A;  2A61 A;  1XPX A;  3GTM J;  3V42 A;  5ILS A;  4RAZ A;  2VAS A;  2FOK A;  1MNM C;  4RM3 A;  4WCG A;  5CLS A;  4CCJ A;  4EGY A;  1SFX A;  2X1E A;  2IRF G;  5D4R A;  4HYE A;  5FLM J;  2M8G X;  2LSO A;  2NNY A;  4NC7 A;  5BPI A;  3P5J A;  2RKH A;  2CV1 A;  4IRI A;  4ETS A;  1MD0 A;  2ZME B;  2ISZ A;  1TWF J;  3T5X A;  3CD6 I;  2PJR B;  4IHS A;  1IXR C;  2OZU A;  2IP2 A;  5JFR A;  1LFU P;  3TW6 A;  5L3E A;  2JRT A;  3F3X A;  3HGY A;  3VOD A;  2ECB A;  2DU9 A;  2CSO A;  2EZK A;  3X2Q H;  3VWB A;  2LYC A;  4MFE A;  4EM0 B;  1U9N A;  3WTW C;  1XMK A;  3I3L A;  2DFE A;  1N78 A;  1LDD A;  3DQV C;  3GVA A;  2FE3 A;  2L9V A;  4L5I A;  4RM2 A;  3M9A A;  1YQA A;  1UFM A;  3P9I A;  3KP5 A;  2Y2Z A;  3B02 A;  2Y9Y A;  4Y3O A;  1W5C C;  5GTI C;  2LVS A;  2CS3 A;  1LFB A;  3IWF A;  2Z16 A;  4XOT A;  1DP3 A;  5IOY A;  4IO9 F;  2Q1Z B;  3LWF A;  1SAN A;  2VBW A;  5B1B H;  4HNU A;  1WZ2 A;  4IL6 C;  2GXG A;  1U6G A;  2Y69 H;  3CF5 F;  3BP8 A;  4PCQ A;  2ELH A;  3HM5 A;  1YFH A;  1D0Z A;  1TW3 A;  1LE8 A;  1UHW A;  5FLX K;  2ACJ A;  2FQ3 A;  2Z33 A;  1TC3 C;  3ISP A;  3D1N I;  4LG3 A;  3OIO A;  1K7A A;  3TBI A;  1VQ6 I;  1BN5 A;  2PJP A;  4XLH A;  2ME0 A;  4LK1 F;  4KFC A;  4X6A J;  2R7D A;  4CUG A;  3HL2 A;  2H8W A;  2HU9 A;  3IH3 A;  4ZYH A;  2ZFW A;  3HRS A;  5FKM A;  1O3Q A;  3M8J A;  2M5W A;  2M4G A;  4AM3 A;  3CDL A;  4U7D A;  2H1K A;  3IRR A;  1DGW Y;  3CUQ A;  3HHH A;  3R60 A;  1WH5 A;  4DQ2 A;  2HXO A;  1ETQ A;  3RQ4 A;  2LH9 A;  2H1L A;  3L2U A;  1RKT A;  1QPM A;  4QPQ A;  3CCR I;  3F8C A;  3BR2 A;  3H3U A;  3BPV A;  2GXB A;  3V7S A;  4NDL A;  4F93 B;  2E36 A;  1MND A;  4LIU A;  2OUM A;  3B6C A;  2XRO A;  3GZ5 A;  3GXO A;  4AYB A;  1B9M A;  2LBF B;  2R7X A;  3CP8 A;  2O8K A;  3A0B C;  2DT6 A;  4BY1 J;  4DNC A;  1R4N B;  2J5P A;  1ZKG A;  2HPI A;  2XAJ A;  4DIQ A;  1DPR A;  5KNL A;  2DDA A;  1IJW C;  2BXY A;  2OF7 A;  3W2W A;  1LVK A;  1TQM A;  1TWA J;  1P6R A;  3LSG A;  2XC7 A;  4BY7 J;  4OWR B;  1FOX A;  3CC2 I;  2DI3 A;  2RDP A;  4Y52 J;  1I5Z A;  5EEA A;  1XDU A;  3PUB A;  4A2U A;  4BQQ A;  3K4C A;  2H8R A;  4HDV A;  2HYG D;  1BL0 A;  1MIJ A;  2R5Y B;  1V5G A;  1RUN A;  2F4O B;  3OYG A;  4P55 A;  5LHH A;  1K6O A;  2DT5 A;  2HTS A;  3G1L A;  3K7A J;  2DLL A;  2XHK A;  3K4K A;  1IRZ A;  4UV8 A;  3F72 A;  2HWV A;  1VQ8 I;  5CQG A;  2E1M C;  3F8B A;  5KCM A;  2WWY A;  6PAX A;  2YR2 A;  1OIS A;  3JRE A;  3K70 D;  2ESH A;  3S32 A;  2B0L A;  3FM5 A;  4J01 A;  2XV4 S;  1WJC A;  2QA4 I;  3S2W A;  3HUG B;  1EH7 A;  5H20 A;  3BJO A;  1FIA A;  3ZQF A;  2KRF A;  2KMU A;  2MAB A;  2Y9Z A;  2CQX A;  1HC8 A;  4XOP A;  4A5N A;  2FXA A;  5FLX Z;  2D1V A;  5HS9 A;  2P4W A;  1JJ8 C;  1UST A;  2HTJ A;  4BE1 A;  2JUG A;  3BR3 A;  2RV8 A;  4CCK A;  1JE8 A;  1JKQ C;  1OFC X;  1MBH A;  1KA8 A;  4HST A;  2FF4 A;  4QTR A;  4M6V A;  4U7B A;  4I01 A;  2TCT A;  2VXZ A;  4F92 B;  3WTV C;  1VQ7 I;  3GFI A;  4OMY A;  2GAU A;  1YOV B;  4S0H B;  2F48 A;  2OTJ I;  3L7W A;  4KNY A;  5HLH A;  1C0W A;  3BG9 A;  2HYF A;  2YU3 A;  2NS8 A;  4M6Y A;  2BEO A;  2IGK A;  3WTU C;  3JRB A;  1AHD P;  3H5N A;  2NVU B;  2DJN A;  1TNT A;  3BTL A;  4IKF A;  3G4S I;  3CJR B;  4UY8 I;  3LFK A;  2BW3 A;  4H4K C;  4II2 A;  1ORK A;  1Y6I A;  3C2B A;  5E3N A;  3H0G J;  3H9J A;  4B1R A;  1ACI A;  2CGP A;  3VPR A;  2MC3 A;  4M72 A;  2M1B A;  4GRI A;  1P2F A;  1S7A A;  3PQJ A;  1U5T B;  1X3U A;  1J2X A;  1YIJ I;  1JKO C;  2CQN A;  1R1T A;  4PJ0 C;  4I0A A;  1UAA A;  4LB5 A;  3J7Z I;  2O9L A;  3KP4 A;  1HST A;  5IP7 J;  3RKQ A;  2PFB A;  3CUO A;  3DXJ F;  3ZMZ A;  2R93 J;  3CF2 A;  4V2G A;  1IRG A;  2E5N A;  4ZDL A;  1BJZ A;  2A05 A;  2IS6 A;  2Q0O A;  2EQR A;  1T98 A;  4HLY A;  2V1N A;  2BYV E;  3KEY A;  4YIR X;  4XN0 A;  5H6R A;  5C44 J;  2N8G A;  4XLA A;  3FF5 A;  3KYD B;  2FUG 2;  1OJL A;  1RES A;  2V1X A;  4BE2 A;  2LY2 A;  1MBK A;  3LST A;  1HSJ A;  4GYI A;  3EDP A;  3Q0V A;  5TJJ A;  4IX7 A;  3K4L A;  2A07 F;  3HSF A;  1ON1 A;  5K7F A;  3ZQL A;  1FPQ A;  4GYG A;  3TED A;  4XLC A;  3HZJ A;  1JGS A;  2O03 A;  2Z3Y A;  1BR4 A;  2Q2E A;  2JWT A;  2QSF X;  2PMZ N;  3TDZ C;  1TQP A;  5EEG A;  4UVA A;  2NVQ J;  2PBI A;  2H09 A;  4A3G J;  5E18 F;  1RR8 C;  1ZG5 A;  5F1R A;  4A3J J;  2X6X A;  4Q48 A;  2ELK A;  2AO9 A;  3QP5 A;  4Y33 A;  2PG4 A;  2E7X A;  2L9R A;  2MYS A;  2PQ8 A;  4NC8 A;  1P7I A;  1OR7 C;  4NBQ A;  5D6E A;  4FX4 A;  3S16 J;  5D5V B;  1XCV A;  2XAH A;  1XG1 A;  2L54 A;  2LOO A;  1X1C A;  2WAF A;  2HQN A;  4RAF A;  1FJL A;  3L2R A;  4EAT A;  2IAI A;  2VT2 A;  4QLC U;  3S1M J;  2M4K A;  4B8X A;  5FRM A;  3B73 A;  2LY9 A;  5K7H A;  5CVI A;  5KHD A;  3KP6 A;  1T8I A;  1HA8 A;  1Z0X A;  3QPL A;  5H6Q A;  4N4N B;  1HW5 A;  4Q47 A;  4E7J A;  4IHV A;  2O0Y A;  2QZ8 A;  5ERI A;  2ZME C;  3DKW A;  2FQ4 A;  2R7F A;  5J1U A; 
#chains in the Genus database with same CATH homology
 4QSH A;  2YUS A;  2OPT A;  2R5Z B;  3HBL A;  3FIW A;  3JR9 A;  1ETX A;  1VI0 A;  2DTZ A;  2EZH A;  3JRD A;  3E7L A;  2EZI A;  5E3M A;  2TRT A;  5GP9 A;  5EDN A;  4B3A A;  4RDU A;  4XK4 A;  3W6V A;  3GTQ J;  1AKH B;  4AUX A;  1F36 A;  3NAR A;  1A6I A;  3TP0 A;  2M2E A;  1TWC J;  1JUP A;  2CUE A;  1ZQ3 P;  3OSF A;  1UMQ A;  2QCO A;  1XC5 A;  1PUF B;  2GLO A;  2DN0 A;  1BW5 A;  3BTC A;  2COB A;  3Q0W A;  5EGO B;  5JLX A;  2I10 A;  2JN6 A;  4JX4 A;  3RQI A;  5HOD A;  2VPR A;  3S17 J;  2IEK A;  1IG7 A;  3UKG A;  4W97 A;  2QF7 A;  3HGG A;  2X9D A;  3A02 A;  2IBD A;  2B63 J;  2CQQ A;  2M0C A;  2HDD A;  3WHB A;  1HF0 A;  3CQZ J;  4A3C J;  3IV5 A;  3BR5 A;  3QQA A;  3TW7 A;  4XID A;  3BTJ A;  1U9O A;  2VI6 A;  4C3I J;  5EG0 A;  2JA5 J;  1VFC A;  2NS7 A;  4DW6 A;  3ZQI A;  1MBJ A;  2XPW A;  3CCY A;  2XPV A;  3S1R J;  1U78 A;  1GV5 A;  4IHW A;  2NVT J;  2K9Q A;  4ABZ A;  1WH7 A;  1DU0 A;  4IHX A;  5IYB J;  4A69 C;  3I4M J;  3JRF A;  1MSF C;  4DZP A;  1QRY A;  1TWG J;  2DA2 A;  4AC0 A;  1JKP C;  4UUS A;  3GTL J;  2ZB9 A;  3JRC A;  2XGD A;  1E3O C;  1X58 A;  1YRN A;  1POG A;  3ZQG A;  2ID6 A;  3BR1 A;  1HOM A;  5E3O A;  3QPS A;  3SJM A;  3MVP A;  1FTT A;  3K2A A;  1HLV A;  1HDP A;  4AYB N;  1P7J A;  4XIC A;  1MH4 A;  3O8H A;  2CRG A;  2E1O A;  1Y1W J;  1D5Y A;  2ID3 A;  2JMW A;  3IH4 A;  1AKH A;  3LSJ A;  2DA1 A;  4V2F A;  1VND A;  3Q3S A;  5C3E J;  1ITY A;  4I76 A;  1QPI A;  2DA7 A;  1OCT C;  1JT6 A;  2LKX A;  4FE7 A;  1IGN A;  2HOS A;  3RZO J;  1PUF A;  3BQZ A;  1I50 J;  4FIS A;  4L5E A;  5EGO A;  1JUM A;  1IDZ A;  1I3Q J;  2JA7 J;  3M3Y J;  2LD5 A;  5FKL A;  2DMT A;  3S15 J;  2Y30 A;  3FK6 A;  4A3B J;  3IH2 A;  3ZQC A;  3JRI A;  3BR0 A;  3BG3 A;  3LSR A;  3GTJ J;  5IOZ A;  2WAQ N;  1MSE C;  3O8G A;  1RR7 A;  4M3D A;  1JGG A;  1BW6 A;  4M3E A;  2XSD C;  3RZD J;  4A3F J;  4D5F A;  3G1O A;  5IP6 A;  1LE8 B;  2EZL A;  3MKL A;  1JKR C;  1O4X A;  4BBS J;  3GTG J;  1GUU A;  2FD5 A;  4MIM A;  3Q0U A;  2EBI A;  3LOC A;  3GTM J;  3S14 J;  2HXI A;  5F1J A;  1MNM C;  1NTC A;  5EZH A;  4CYC B;  1Q1V A;  4A3L J;  1WCM J;  2DMU A;  5FLM J;  4C2M J;  2M8G X;  2HOA A;  1FTZ A;  1WGX A;  1H89 C;  1W0U A;  1UG2 A;  1APL C;  2E2H J;  1T56 A;  4LOC A;  1TWF J;  3JRH A;  1RKW A;  2L7F P;  2O7O A;  3PM1 A;  3TP3 A;  2HOT A;  1K61 A;  4C3J J;  2MW8 A;  1ETO A;  1LFU P;  2CJJ A;  3TW6 A;  2Y0S N;  5F27 A;  4GFB A;  3HGY A;  4MLO A;  2ECB A;  2EZK A;  4MFE A;  1U9N A;  2M9H A;  3S1Q J;  2DMN A;  1A5J A;  3A03 A;  4XRS A;  5FKK A;  4Y7N J;  3BTI A;  2EH3 A;  1W0T A;  1K83 J;  2Y2Z A;  2NVX J;  2Y9Y A;  2LK2 A;  4DYC A;  2AHQ A;  2LVS A;  4UUT A;  1LFB A;  2R7Z J;  4M3F A;  1AU7 A;  2DA5 A;  1I6H J;  3F0C A;  1GT0 C;  5IOY A;  3ZQH A;  3HB9 A;  1SAN A;  1ETV A;  1B8I B;  3HM5 A;  3HOW J;  1S7E A;  1LE8 A;  2K40 A;  2HQ5 A;  1IC8 A;  1TC3 C;  5GPA A;  3D1N I;  4D7N A;  3OIO A;  4IEJ A;  1T33 A;  2ME0 A;  4D5C A;  1CQT A;  1NK3 P;  3M4O J;  4X6A J;  2R5Z A;  3IH3 A;  1ZR2 A;  4M3G A;  2ECC A;  5FKM A;  5K7Z A;  1X2N A;  2M34 A;  2WB1 N;  3G1M A;  1GVD A;  3CDL A;  4CYC A;  2XPU A;  3DCF A;  1ZGW A;  2H1K A;  4XRM A;  1WH5 A;  1X2M A;  2HXO A;  2GM4 A;  1ETQ A;  4BBR J;  5J1R A;  2JA6 J;  4A3K J;  4JYK A;  2FX0 A;  1RKT A;  4A3M J;  3BR2 A;  5J1Y A;  1MBF A;  1F43 A;  4NDL A;  2DA4 A;  5FLV A;  5F08 A;  9ANT A;  2L0K A;  5IYC J;  3B6C A;  3HEF A;  1HDD C;  2YS9 A;  2O8K A;  5M5X J;  4BY1 J;  1JTX A;  1ZKG A;  4FTH A;  5DS9 A;  1JUS A;  1H8A C;  4C3H J;  4W1U A;  4JX5 A;  4J19 A;  1ZTR A;  2XB5 A;  1IJW C;  2JA8 J;  1HCR A;  2OF7 A;  1IDY A;  1TWA J;  2MGQ A;  3LSG A;  3I4N J;  4BY7 J;  1MH3 A;  5M3F J;  4Y52 J;  3S2D J;  3OOU A;  3FK7 A;  5EEA A;  2KDZ A;  2R92 J;  1TWH J;  1B72 B;  3S2H J;  1B8I A;  2H8R A;  1BL0 A;  2R5Y B;  4D7M A;  5EG0 B;  1BA5 A;  2HYJ A;  4FCY A;  2LTP A;  3G1L A;  2LP0 A;  3K7A J;  2P81 A;  4DZJ A;  1NK2 P;  1IRZ A;  5IYD J;  2E19 A;  3HOV J;  5F0C A;  5E3L A;  4RBO A;  1FEX A;  3SFI A;  3JRE A;  2G0E A;  4MFD A;  1MBE A;  1QVT A;  3PO3 J;  2D5V A;  3A01 B;  5F0H A;  1FIA A;  1GV2 A;  2NOG A;  3ZQF A;  4I6Z A;  2X48 A;  4X1E A;  5JLW A;  2Y9Z A;  1MBG A;  2CQX A;  4BKX A;  1QVU A;  1G2H A;  5J3L A;  4FE4 A;  1ENH A;  4DYQ A;  1JJ8 C;  2L7Z A;  3CMY A;  1RPW A;  1GDT A;  1ZK8 A;  5DTD A;  3BR3 A;  4JP0 A;  4DYR A;  1JKQ C;  1OFC X;  1MBH A;  1JT0 A;  4QTR A;  4M6V A;  2L7M P;  2GBY A;  1U8B A;  2W48 A;  2TCT A;  3FKI J;  2RAE A;  4S0H B;  2DA6 A;  2K9S A;  2X6O A;  5FJ8 J;  4A3D J;  5EF6 A;  2JJ7 A;  2NS8 A;  3BG9 A;  2CUF A;  3JRB A;  1AHD P;  3LSP A;  2LFB A;  1XS9 A;  1ETK A;  3S1N J;  1H88 C;  2K9N A;  3L1P A;  2XGC A;  2DJN A;  3BTL A;  5FKN A;  4HNV A;  1B72 A;  5IPA A;  3BR6 A;  1JJ6 C;  2R5Y A;  1VF9 A;  4MO7 A;  3HDD A;  2WV1 A;  1ORK A;  1RET A;  5C4X J;  2MG4 A;  3C2B A;  4G12 A;  5E3N A;  3H0G J;  3GTP J;  4B1R A;  1UHS A;  5F0F A;  3VPR A;  2CU7 A;  1FIP A;  2VKV A;  1EF4 A;  1JTY A;  2XRL A;  3FIS A;  3SDG A;  3GTK J;  1JKO C;  3H3V K;  1OCP A;  3HOZ J;  3OSG A;  2LLK A;  3A01 A;  1ETY A;  2O9L A;  3RKQ A;  1Z77 A;  5IP7 J;  2R93 J;  2NVY J;  4V2G A;  3GTO J;  4QIW N;  1BJZ A;  1Y1V J;  2EQR A;  5M5Y J;  3HOX J;  1YRN B;  2DMP A;  2LR8 A;  2E2J J;  3ZOB A;  2VKE A;  4B4C A;  5C44 J;  2N8G A;  2YU9 J;  4A93 J;  1OJL A;  1RES A;  3GBG A;  1MBK A;  3PO2 J;  4IHY A;  4A3I J;  3JRG A;  3Q0V A;  4EEF G;  2R0Q C;  5FKO A;  5IP9 J;  5K7F A;  5EYR A;  2MSY A;  3ZQL A;  3HOY J;  3TED A;  1R9T J;  2XGE A;  4BXX J;  4A3E J;  2JWT A;  3BQY A;  2PMZ N;  3JRA A;  2KT0 A;  3HKZ N;  2NVQ J;  3MN2 A;  1DU6 A;  4A3G J;  3LNQ A;  4A3J J;  2ELK A;  2AO9 A;  2XB0 X;  2VUM J;  2L9R A;  5F04 A;  1P7I A;  2E2I J;  3DEW A;  1ETW A;  5GPC A;  2HI3 A;  4XRS G;  4JX6 A;  3S16 J;  1IUF A;  1ZR4 A;  1XG1 A;  3B6A A;  5EZG A;  2FJ1 A;  5M3M J;  2JK3 A;  1SFO J;  2Y31 A;  3HOU J;  1FJL A;  3WHC A;  1IV6 A;  1WPK A;  2IAI A;  2DMQ A;  5BNG A;  3S1M J;  3BT9 A;  5C4J J;  2LY9 A;  5K7H A;  5M5W J;  2DA3 A;  2ME6 A;  1Z0X A;  3NAU A;  4UUS B;  3QPL A;  4IHV A;  4M3B A;  3BG5 A;  2FQ4 A;  5J1U A;  1WI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...