3NAUA

Crystal structure of zhx2 hd2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
b'KTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc fingers and homeoboxes protein 2
publication title Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3nauA00
5F0HA 3SJMA 5FKKA 1BW5A 2R0QC 1MNMC 3WHCA 5DS9A 4FCYA 4A3LJ 3SFIA 1GUUA 3ZQLA 1AU7A 3GTMJ 2R92J 1VF9A 5F0FA 1JKQC 3BT9A 4AC0A 4A69C 2M34A 2R5ZA 4DW6A 4M3DA 3ZQCA 1JJ6C 1GDTA 5EF6A 1YRNA 3BTCA 4I76A 1A5JA 1SANA 4ABZA 1IV6A 5IPAA 1DU0A 1LE8A 3DEWA 2JWTA 1APLC 2E2HJ 3SDGA 1YRNB 4XRSG 3JRAA 3RQIA 4J19A 1I3QJ 2HOSA 4A3CJ 3LSJA 1Q1VA 3VPRA 1JGGA 2O8KA 1LE8B 3ZQFA 3JRDA 3HDDA 1JKPC 4LOCA 2NOGA 3MN2A 2K9NA 1G2HA 1OJLA 3BQZA 1WH5A 4DYQA 2W48A 1X2MA 3HEFA 1Y1VJ 2AO9A 3IV5A 4MO7A 3G1MA 2MSYA 5F27A 1TWGJ 2ELKA 5M3FJ 2DTZA 3ZQGA 2B63J 3E7LA 4IHYA 1TWFJ 2JA5J 3S1QJ 3FK7A 3TW7A 2L7FP 2XB5A 4C3JJ 3C2BA 2I10A 1JUPA 3S16J 4C3HJ 2QCOA 3IH2A 2HQ5A 2NS7A 4BBRJ 2DMNA 4JX4A 1ZQ3P 3FIWA 2FX0A 3LNQA 3OSFA 2DMUA 3H0GJ 2CUFA 3S15J 2L7MP 3LSRA 3IH4A 1WI3A 2L7ZA 4MFEA 3CQZJ 2GBYA 3QPLA 1OCTC 3HM5A 2XB0X 2XGCA 3TW6A 1UHSA 1D5YA 5FJ8J 5EEAA 5C3EJ 1Y1WJ 1JTYA 5GPAA 2YUSA 2Y9ZA 1NTCA 2LK2A 4D7MA 3JR9A 3S17J 5IOYA 1JUSA 2COBA 5J1UA 3RZOJ 1VNDA 2HXOA 1FJLA 4A3DJ 5IYDJ 1XG1A 1HLVA 2DA1A 5F0CA 1IUFA 1QRYA 3FK6A 2HI3A 3F0CA 3S1NJ 2XPVA 4V2GA 2XPUA 4D5CA 3HGGA 3BG5A 4DZPA 3JRFA 2EZHA 1ENHA 5FKMA 4A3BJ 2KDZA 1JKRC 3FISA 4DYCA 1U9NA 2L9RA 3A01B 3BG9A 1OCPA 2LKXA 1GV5A 4M3EA 4A3GJ 2JA8J 1T56A 2LR8A 3B6CA 3GTJJ 4D5FA 5EG0B 3OIOA 2E19A 2EQRA 1IJWC 3I4NJ 2RAEA 1FIAA 4CYCB 2FQ4A 2NS8A 1MBGA 2DMTA 3MKLA 2ECBA 3HOZJ 2JA7J 1X58A 2QF7A 3L1PA 2VPRA 3NAUA 2Y31A 5J1RA 3S2DJ 3S14J 2CUEA 3G1LA 4MIMA 4A3EJ 1IGNA 1JUMA 5M5YJ 2ID6A 1LFUP 2DN0A 4NDLA 5F08A 3BQYA 1HDPA 1ETXA 3S2HJ 4X6AJ 3BR2A 1TWAJ 3HOWJ 2M9HA 3HOXJ 1A6IA 1I50J 1MBKA 2O9LA 1RR7A 3QQAA 5EZHA 3WHBA 2MG4A 4A3IJ 2X48A 3B6AA 1HOMA 2CJJA 4FE4A 1O4XA 1ZR4A 2EZKA 1ETWA 2H8RA 2IBDA 5EDNA 1U8BA 2NVQJ 4UUTA 5BNGA 4B4CA 2EBIA 3HOVJ 2WB1N 2Y9YA 4BKXA 1U78A 1NK2P 1XS9A 1GV2A 2K9QA 2VUMJ 2E1OA 2VKVA 1UMQA 3PO2J 1ZR2A 2NVTJ 4W97A 4D7NA 4IEJA 2Y30A 3Q0WA 4HNVA 2K40A 1H89C 1ETYA 3BTLA 4JX6A 1B8IB 5IP7J 3Q0VA 3D1NI 3NARA 2R93J 4BY7J 1W0TA 1MSEC 3GTOJ 3K7AJ 4JYKA 2LY9A 1X2NA 2XPWA 2JK3A 2DJNA 2XGDA 1Z77A 2JJ7A 2TCTA 2MW8A 3TP3A 2E2JJ 3S1RJ 1K61A 3O8GA 1RPWA 1FTZA 3UKGA 1T33A 1H8AC 4A3FJ 1JTXA 4RDUA 3M3YJ 1IDYA 5IOZA 1NK3P 1FIPA 4QSHA 1ETOA 2X9DA 2N8GA 2DA4A 5E3LA 4QIWN 4XRMA 1BJZA 1HF0A 3PM1A 3TP0A 4JX5A 4B3AA 2JN6A 2CRGA 4V2FA 3HOUJ 2IAIA 1W0UA 4A3KJ 1F36A 1UG2A 5M3MJ 1F43A 2EZLA 5C4XJ 4FE7A 4QTRA 3A01A 1H88C 5IP6A 1WPKA 1MH3A 4C2MJ 3BR0A 1WCMJ 3BTIA 3OOUA 2MGQA 2O7OA 5EG0A 1IRZA 1JT0A 3LSGA 1OFCX 2HDDA 1ZKGA 2K9SA 3I4MJ 4CYCA 1VFCA 4FTHA 2HOTA 1RETA 4JP0A 2ECCA 3ZQHA 3CDLA 4W1UA 3DCFA 2WV1A 3K2AA 1BW6A 4M3BA 3CCYA 2VI6A 3M4OJ 3HOYJ 5GP9A 5DTDA 1QVUA 2M2EA 5JLWA 2GM4A 2XGEA 2HOAA 1ORKA 5E3OA 3OSGA 5FLMJ 1MBJA 3JREA 1E3OC 1BL0A 4XK4A 5M5XJ 4XICA 2R7ZJ 1I6HJ 2CQQA 3LSPA 1DU6A 1RKTA 3RZDJ 4A3MJ 5J1YA 4XIDA 2LFBA 5IYBJ 1PUFB 2TRTA 1AKHB 2G0EA 1B72B 2E2IJ 3GTQJ 5M5WJ 2EZIA 1JT6A 2NVYJ 4BXXJ 2VKEA 1P7JA 4EEFG 2LP0A 2DMPA 2ID3A 2GLOA 3RKQA 2DA7A 3IH3A 5C4JJ 1IG7A 1MBFA 1ETQA 3H3VK 4A93J 2FJ1A 2OF7A 1TC3C 1MBEA 2LTPA 2AHQA 1JKOC 1TWCJ 5EYRA 2D5VA 4M3FA 3TEDA 2M8GX 5HODA 5E3MA 3CMYA 1POGA 2X6OA 2R5ZB 3MVPA 1IC8A 2IEKA 4BBSJ 2CU7A 1XC5A 3HB9A 1B8IA 2DA3A 1IDZA 2HXIA 3HGYA 2LLKA 2JA6J 5E3NA 2NVXJ 2R5YA 2XRLA 1JJ8C 5FKOA 3Q3SA 1Z0XA 4IHVA 1RESA 2YU9J 4L5EA 3ZQIA 2R5YB 2Y0SN 4XRSA 9ANTA 1CQTA 1HDDC 3JRBA 4I6ZA 4DZJA 2H1KA 2WAQN 4S0HB 3BTJA 4M6VA 2L0KA 1ZK8A 3JRGA 3G1OA 1BA5A 3GBGA 1HCRA 3O8HA 2LVSA 3JRCA 2DA5A 3A02A 1U9OA 5F04A 1MH4A 5EZGA 1AHDP 2LD5A 4DYRA 1QVTA 4X1EA 4UUSA 2DA6A 3LOCA 4A3JJ 1MSFC 2KT0A 1TWHJ 3BR3A 4UUSB 1ITYA 1ETKA 5J3LA 2P81A 3JRHA 3W6VA 3BR1A 4AUXA 2EH3A 5K7ZA 1EF4A 4BY1J 4C3IJ 3Q0UA 1WH7A 4RBOA 2HYJA 3S1MJ 5IP9J 2DMQA 3GTPJ 3GTGJ 3BR5A 4MFDA 2OPTA 5FKLA 1ETVA 1VI0A 2JMWA 3QPSA 4AYBN 1QPIA 4G12A 1SFOJ 5K7FA 3BR6A 3HBLA 3HKZN 4Y7NJ 3BG3A 5JLXA 4GFBA 2XSDC 3PO3J 5K7HA 4Y52J 4B1RA 2Y2ZA 1GVDA 5EGOA 2YS9A 2ZB9A 2DA2A 3A03A 1RKWA 4FISA 3FKIJ 2ME6A 1GT0C 5EGOB 5FLVA 3GTKJ 2CQXA 2M0CA 1MBHA 4IHWA 5F1JA 4MLOA 5IYCJ 2ME0A 4M3GA 5FKNA 1PUFA 1AKHA 1B72A 3GTLJ 1P7IA 4IHXA 1FEXA 1LFBA 1K83J 1FTTA 2FD5A 3ZOBA 1R9TJ 1ZGWA 5C44J 1ZTRA 3JRIA 5GPCA 1S7EA 1WGXA 2PMZN
chains in the Genus database with same CATH superfamily
4F91B 1PP8F 4PFPA 4IJAA 2LY2A 5FD6A 1P6RA 1V55H 3WTTC 3SJMA 1BW5A 2R0QC 2P5KA 4NHJA 4BUPA 4A0ZA 2KIUA 2L2OA 4UVAA 3DBHB 1X1BA 3GTMJ 1R23A 1P2FA 4AYBA 2VASA 2A68F 4CZCA 4AC0A 1BJAA 4DW6A 4M3DA 2JVGA 5J8FA 1BI3A 1GDTA 5IT9K 3F8FA 1YRNA 3AG3H 3T1BA 2CS3A 4I76A 2H27A 4GDFA 4Q47A 1Y8RB 4ABZA 4BE0A 5IPAA 1IV6A 2JWTA 2E2HJ 3HUGA 1LPQA 4XRSG 3Q9VA 1YRNB 3RTRA 2HOSA 4KISA 4A3CJ 2Y0MA 3VPRA 2BEOA 1JGGA 2HQAA 5AONA 2O8KA 2VONA 2W4SA 1SMYF 2L01A 2MBFA 4UV9A 3HUGB 1D1CA 2V6EA 3RIRA 3MN2A 2K9NA 2XHKA 1FP1D 3L7WA 3F6VA 3L2QA 1ACIA 2R7WA 1BR4A 1K7AA 4KIBA 5ICFA 1W5SA 1X2MA 1FP2A 3DXJF 1WHUA 2AO9A 2YSRA 2PG4A 1J9IA 5ICCA 1BN5A 3HJEA 4X0GA 5M3FJ 3AG4H 2V79A 5FFZA 2X6XA 2B63J 1IXRC 1ZGJA 5HDGA 1BI1A 1TWFJ 4WXCA 1T6SA 1FSHA 2E5NA 3CCEI 5D4SA 1J5YA 5DYMA 1IZ1A 2G7HA 3OY9A 1YFHA 1KQ8A 1AWCA 3DLAA 2XB5A 3RQ4A 3F3XA 1YW9A 4I7HA 2QCOA 3ELKA 2HQ5A 3KCCA 5B66C 2DW4A 3J7YJ 4MEYF 3I56I 1S6LA 3LNQA 1KYWA 3OSFA 2DMUA 3H0GJ 2CUFA 2GXBA 5JFRA 3CP2A 2V9VA 4I99C 1F4KA 1WI3A 1O3QA 2LNBA 2RN7A 3QP6A 1K6OA 2B0LA 3CQZJ 5LGTA 3BCAA 3H35A 3FZVA 4GGGA 5LD2C 1DPRA 3ECOA 3I59B 2OJED 4NQWA 1UHSA 4KT5C 1IRFA 1D5YA 1KA8A 1TP4A 5TISC 1JTYA 5GPAA 2YUSA 4MQVA 2BOLA 3EYIA 1JUSA 4NQWB 4YFXF 1VNDA 2ACJA 2ELHA 2OUMA 1SFUA 3FXOA 2DA1A 4HQEA 2HI3A 3F0CA 3V8JA 2XPVA 5KAFC 3MZ8A 2XPUA 1HA8A 3BCBA 4F92B 4L0YB 2A6HF 1X4OA 4DZPA 4IO9F 2EZHA 4F52A 3W3CA 1UZCA 4C2TA 3GEZA 4IHSA 3LA3A 3G73A 3QYEA 4LG0A 3SZTA 2LR8A 2DYSH 3CJRB 1UCRA 3OIOA 2CW8A 5HVQC 2KZGA 2RAEA 4LD5A 2FQ4A 1SAXA 4IXAA 1MBGA 4JBAA 1IXSB 2EFQA 5DUKA 1PUEE 1GHCA 4LMYA 1X1DA 2X1CA 3SFZA 3L1PA 4S05A 2Y31A 3JAMZ 5JR3A 5DCMB 2GOXB 3FM3A 5J1RA 1BI0A 4A3EJ 4K2EA 3ZN0A 2QGUA 1QNTA 3LFUA 4G7OF 2LYCA 2DN0A 3BQYA 4O3MA 1FWZA 2EK5A 3F8NA 1HDPA 4B44A 1SAUA 2MC3A 4X6AJ 3HG9A 3RYPA 4EV0A 1TWAJ 3T8RA 2DO7A 5LEKA 1RR7A 1T0FC 3QQAA 3FXLA 3PIPF 2ISZA 3SZPA 1YX3A 5EJCA 4A2UA 2VLAA 3LA7A 3R60A 1Z3YA 1IN7A 3CMMA 4XKWA 4WX9A 1ETWA 2BY1A 4IHTA 2Q0OA 4CCJA 2EFNA 1N77A 2ZJRF 1IF1A 2NS0A 1A36A 4OMYA 1BR2A 2DQLA 3OS0A 1OR7C 2P5LC 3SDBA 2XC7A 1U78A 2F48A 1P4WA 5J40A 3DF8A 5K5QA 5CVVA 1XS9A 4FASD 1R5HA 2VT2A 5D5WB 3PO2J 2VC1A 3P9IA 3PUBA 2K3FA 4W97A 2QKMB 2Y30A 4HV6A 5H2FC 2F5DA 3BPXA 2K40A 1H89C 1AOYA 2DFFA 1DPUA 2CQNA 4YRVA 1B9MA 2HNHA 2V9PA 1LDKB 3KLOA 3D1NI 3K1PA 2BXZA 2IA1A 5A2QZ 4KMFA 1Z1DA 3KP4A 3MKYB 3W2VA 2HZDA 3F8CA 3K4LA 1X2NA 3U21A 3OYJA 3A2KA 2MW8A 3TP3A 2VN2A 5CQEA 3O8GA 1HKQA 4Z6YA 2CV0A 3RJPA 2OTLI 4B09A 3ASOH 3CDHA 3KFWX 3EYYA 3UKGA 1E3HA 1XMKA 2F5FA 2K86A 2E7WA 3KYLA 4A3FJ 3P9KA 2WV0A 4JOMA 1ZGAA 3AAFA 3KEQA 2QSGX 1VQ4I 3F8MA 2IGMA 1ETOA 2GIVA 1Z67A 3K1MA 4CA0A 1D8JA 2E1MB 3RCOA 4N9IA 3GMEA 1I3AA 4ZTJA 1IAWA 2BGCA 2QQ9A 3PNVA 1NHAA 2KIQA 3COAC 1ON2A 3U1KA 4FT8A 1QZYA 1F9NA 2HVSA 5DV5A 1ZARA 1F36A 2QM3A 1UG2A 1OYYA 4XLCA 2EZLA 3TOBA 3CCRI 4QTRA 3DTEA 1R1TA 5IP6A 4XONA 1LKXA 1WPKA 4C2MJ 3B02A 1U5TA 1HBXG 2ZJPF 1U3EM 5EG0A 2MGQA 2GXAA 1ZKGA 2K9LA 4N4OB 1RETA 4JP0A 3ZQHA 1S8NA 1LQ1A 2G9WA 3CDLA 4W1UA 2CW0F 3H5NA 1OCOH 3M4OJ 4BE2A 1WQ2A 3N05A 4AWXB 5JLWA 2BYVE 2ZJ2A 4M6YA 1ORKA 5E3OA 3MZHA 3DBLB 5FLMJ 3JREA 2XVCA 2FF4A 3RKYA 2VBZA 4IL6C 3GZ5A 4JQFA 3AKZA 2P8TA 3V8LA 1UB9A 3T0YA 1XGMA 3CUQC 4P9UA 4YIRX 2VPLA 3S8PA 2DPDA 2E2IJ 1B72B 4U88A 1E2XA 5M5WJ 1YI2I 2EZIA 1YYVA 2ZXJA 3OYLA 4B48A 3B73A 2OTJI 2CQKA 3CC4I 2ID3A 2K5CA 1KU2A 2O3FA 3TDZC 5C4JJ 1MBFA 3HC7A 4DBRA 3WODF 1YW8A 2WADA 3HOSA 3ABTA 1FY7A 2LTPA 1TWCJ 2MH9A 1E3PA 4UB6C 2PJRA 3FBNB 5HODA 1POGA 2L3DA 3KIOA 3MVPA 1IC8A 2CU7A 4WXDA 4ZYGA 3OYEA 1UAAA 2DA3A 1Y6IA 1V5GA 3H5AA 2O03A 4A0YA 2XRLA 1G8XA 1HC8A 1IW7F 2LREA 2R4GA 3Q3SA 3I5UA 3HXLA 3QOEA 2O8XA 3KZIC 1YS7A 3I54A 3TO6A 1HDDC 2HQNA 3KZYA 3QU3A 2H1KA 3ZCOA 2Z99A 5IT9Z 1R58A 4GO1A 4M6VA 3JRGA 1QPMA 1Z9CA 1BA5A 4RGXA 3O8HA 2B9SA 3KLNA 4ZYHA 3P5JA 5EZGA 1N78A 3BPVA 4HX8A 3D5SC 4ZYAA 1OYWA 5HS8A 1O3SA 3LOCA 1ZH5A 2DOFA 1RC9A 1MJBA 4MQ9F 2BVLA 1TWHJ 3WE2A 1YITI 1G6NA 2WB1A 3I3LA 2NXNB 2VE9A 3T8TA 1ETKA 1MW7A 3S3MA 2IA2A 4LB5A 2XAJA 1ONVA 4AD9A 2W24A 4C3IJ 3ZPLA 3KPHA 3I4PA 4RBOA 1PYVA 3KEYA 1AA7A 1W4MA 5E1ZB 1HSJA 2DMQA 2E36A 1EA3A 3IAS2 2AQFA 2XKPA 2LDUA 2VOOA 1E0EA 1YE9A 4MFDA 1Y0UA 1Z6RA 4F55A 1ETVA 2PEXA 3CF2A 1VI0A 5GTIC 1R5ID 1XGSA 2EIJH 3OMYA 4FX4A 1QPIA 2KMUA 1MZBA 3MEXA 2MABA 4L9TA 2LSOA 1WZ2A 2M45A 5JLXA 4GFBA 1YTYA 3CD6I 5F1RA 3PO3J 1ZAOA 2Y2ZA 3IC7A 3S93A 2VT3A 2DA2A 3WG7H 3HRUA 2A61A 1RKWA 3KP3A 4FISA 3F9KA 1S5LC 2X6YA 2W25A 3ECHA 1A6QA 1LVKA 1GT0C 3LSHA 4N4NB 3ZGKA 1KU7A 2EA2A 5IYCJ 4IQ4A 3H1CA 1W36D 2K7LA 4HBLA 3FWEA 2JQ7A 3OYIA 1P7IA 4E6KG 4IHXA 1LFBA 1K83J 1FTTA 2LBFB 1RZ4A 1WFXA 2CG4A 3DBRB 1XCVA 2H1LA 3SEQA 5GPCA 1S7EA 2OQGA 1TW3A 2DYRH 4MNUA 1HW2A 2R3SA 1J2XA 1OYIA 4HV5A 5ILUA 3M8EA 3K6GA 1B59A 2P5VA 2V1XA 2D2WA 3TKYA 4E7IA 4HQMA 3E6MA 3BJAA 3EDPA 3OYKA 1F1ZA 3L00A 4FCYA 1VQ9I 3ERMA 1GUUA 3DTKA 3QOPA 3R4KA 1AU7A 3BP8A 2M4GA 2WA0A 4U87A 3EETA 3BT9A 1NG7A 2Y69H 4A6DA 2M34A 1WKMA 2R5ZA 3DEUA 3K4BA 2H8WA 2M5WA 2IS4A 4G6DA 1X3ZB 1S7OA 2VJ5A 4GCVA 3OL4A 3QP5A 4G7ZF 4BGDA 1XDSA 1DU0A 3DEWA 1B9NA 4RAZA 4OWRB 1VQKI 4XLHA 1YJWI 4ITVA 1R49A 2WY7Q 1I3QJ 1B6AA 4J19A 3LSJA 5EEGA 2VODA 2UWMA 3GYHX 2QA4I 3JRDA 5E79C 2GA1A 4LOCA 1YIJI 3FBIB 1OJLA 1SFKA 3GUDA 3GCMA 4H0EA 1GVJA 5EEHA 1K78A 2M30A 3IWFA 1A35A 3PFYA 2W48A 3HEFA 1TQPA 1FC3A 1FZPB 2OV7A 3G1MA 4HDVA 2RNJA 2ELKA 2FBIA 2V26A 2EFPA 4OU0A 3QRFF 2QBYA 3E7LA 3MMYB 4BHPA 3E6BA 2RC4A 2JA5J 1G3TA 1SD4A 3ZMTA 5FD5A 3BLYA 5BS6A 4AVZA 3TW7A 4HX7A 4D9JA 3CDIA 1VZ0A 4C3JJ 5HDKA 1W7PD 1JUPA 2GWRA 4BBRJ 3OS1A 2DMNA 1VQ5I 1JGSA 1GXPA 1ZYRF 1HW1A 3AFHA 2MD5A 1R1VA 3FIWA 4OIPF 2IPQX 4P5OA 1XMAA 2ZMEA 1TNSA 2CH0A 3LSRA 3IH4A 2PN6A 3P7NA 1FNNA 3MCZA 2HKOA 1YOVB 4MFEA 2L7KA 2J5OA 1FYKA 2M0MA 3TW6A 4BJTA 2GXGA 2HPIA 4BYYA 5C3EJ 4Y17A 2ZO4A 2Y9ZA 3C18A 3S17J 2MYSA 1RRJA 3SQNA 2HXOA 3ROUA 5IT3A 3CESA 4NC6A 4XLPF 3OYDA 3OS2A 3VSLA 1I27A 1X4PA 2CQ7A 2H6CA 1REPC 2X51A 5F0CA 2KZVA 3TBIA 2CUJA 3S1NJ 3Q9SA 2DT6A 1WJCA 4R79A 4LK0F 3FXQA 3HGGA 2VQHA 2ZFWA 3BG5A 2QVOA 1ZRCA 4A3BJ 3FISA 4DYCA 1Z7LA 3A01B 4RS8A 3PQJA 1OCPA 3ZMUA 1GV5A 2LKSA 1NG6A 4RMNA 3IKVA 1JHHA 2XKOA 1T56A 1HXDA 3B6CA 3ZRGA 3GTJJ 1P4XA 4A6EA 1XCBA 3Q5FA 2E7XA 4HNTA 2E19A 4QLCU 1RIOH 2EQRA 3KZZA 3I4NJ 4CYCB 3WE3A 2STWA 2DMTA 4UHTA 1WJDA 2E1NA 3DKXA 2JA7J 3LSKA 1X58A 2PMUA 4HNUA 5FB2A 2HYFA 3NAUA 4XN0A 2KQRA 2E1MC 1IGNA 2GA2A 2ID6A 3P9CA 3CMAI 4YELA 4AIKA 3ML6A 1FBUA 4NDLA 2EFWA 2XAFA 1J7KA 1ETXA 3S2HJ 4KDPA 5FLXZ 3HOWJ 2M9HA 1KQ0A 4HLXA 1BBYA 3HOXJ 1ERDA 3X2QH 5E18F 2HR3A 3WHBA 2M3AA 2MG4A 3HOTA 4A3IJ 2R7SA 2ZXHA 2L9SA 2X48A 3B6AA 1O4XA 3HIFA 4QWQA 2LF8A 1TZLA 4PJ0C 1YJ9I 1Y0NA 3CC7I 1U8RA 3H9JA 3KETA 2BV6A 4ZYEA 4HF0A 2PBIA 4UUTA 1U5TC 2K9MA 4B4CA 1HKTA 2JA2A 1PVEA 1I5ZA 4RM2A 2WB1N 1BIAA 3HOVJ 2IRFG 5CLSA 4KIGA 3CZ6A 1NK2P 3G6EI 1XN7A 4LB6B 1ZG5A 3ZXSA 2VUMJ 3H0DA 4UY8I 2KL4A 2XSJC 1UMQA 1ZR2A 3I0TA 2NVTJ 1BOAA 3Q0WA 2FXAA 4XM3A 2DU9A 1PJRA 3QPHA 2ZSIB 3M1CA 3DU6A 3Q0VA 3NARA 2R93J 1SFXA 2FNPA 2WBMA 4DQ2A 4HRIA 2KJCA 2X1EA 4G9YA 1V5FA 4QPQA 3GTOJ 5ED4A 2LY9A 1DUXC 4LGWA 2JK3A 2DJNA 4M6XA 2DXIA 3VYRB 2QQ8A 1F5TA 2E2JJ 1MMSA 2M1BA 3S1RJ 3N97A 1K61A 1ZELA 2HS5A 3KP5A 3MFKA 3HHGA 2X6WA 2OZUA 2A6EF 1TT0A 3OYAA 2F4OB 2MD0A 2C6YA 3U2RA 3I59A 4RLFA 4UV8A 1R5GA 4UVBA 5IOZA 4HPQA 3M8JA 1FIPA 1X3WB 2A05A 3OYHA 2DA4A 4AVPA 4QIWN 2FMYA 4O5VA 1D3YA 3ULQB 2RDPA 3C2GA 2FBHA 1HF0A 3TP0A 1G3SA 1J09A 4GYIA 2VB6A 2O61A 5GAEJ 2KRHA 5LGNA 3W6KB 2DDBA 4EGYA 1F43A 3K4NA 2VBXA 2DQRA 2JZYA 3EUHC 1J59A 5KCMA 3GVAA 2IGKA 4L5IA 2VBYA 2MC4A 1MGTA 3TMOA 4JK1X 2IT0A 3OOUA 1TW2A 4RAGA 2RGVA 1MIJA 2IGOA 1LNWA 2P7VB 3FXKA 4II2A 3GFIA 1VFCA 1O7LA 3JW4A 4HX4A 3SXYA 1OISA 2R7UA 2LKPA 2WV1A 2YX7A 3V42A 5E1XA 3ZR8X 5DCMA 3GXOA 3DKYA 5GP9A 3WGHA 2Z3YA 1KYZA 2M2EA 5ILSA 3FDYA 3GF2A 5L3EA 4ZDOA 1JXSA 4RAFA 2HVQA 5IY5H 2GM4A 1ZREA 2IS2A 1FLIA 5L3DA 1KU3A 3J80K 3OSGA 5GAHJ 4ESJA 3J7AY 1MBJA 5HLGA 5KNLA 4D1QA 4RA2A 1E3OC 4LIVA 1EH6A 4NUBA 2R7ZJ 2A3SA 1I6HJ 3FHNA 2BHYA 1LJ9A 1RKTA 3RZDJ 3GZNB 2W1OA 2KIFA 1PUFB 2A69F 2TRTA 2G0EA 1AKHB 5BMZA 3GTQJ 4I01A 3VYUB 2W57A 3L2WA 2DT5A 4BXXJ 1HQCA 1P7JA 4EEFG 4XQFA 2LP0A 1X1PA 1VQ8I 2DMPA 1YX5A 4I0AA 2GLOA 3GWZA 3J81K 3RKQA 2OC6A 4XOTA 4EGZA 2Q2EA 4AU7A 2LOOA 1UELB 2AQEA 3OYCA 2NVUB 1ETQA 2KJBA 3VFZA 3H3VK 3HRSA 4A5NA 2OF7A 5DUIA 1TC3C 4NB5A 1I1GA 1JKOC 2P4WA 1WWXA 3K70D 2Q2EB 4IPAA 5EYRA 4BJ6C 5GTHC 2D5VA 4R8HA 2RNGA 2KP6A 1Z7UA 2I5UA 4FX0A 3CMYA 1VTNC 5HLTA 1ODDA 2IA0A 1T2KA 3J7ZI 1HKSA 3HB9A 2HTSA 3T5XA 1TBXA 3NRVA 5KAIC 2HXIA 1OMIA 2MA3A 2ZCWA 3HGYA 2LG4A 3HYIA 5D5VB 2LMDA 3R0JA 5DM7F 4I0BA 5F6FA 5DDGA 3ZN1A 4N0BA 4BL0B 4DZJA 3H9QA 2TDXA 4BJ5C 5E8GA 4KFCA 1OLTA 3FXRA 1ZK8A 1ZN2A 4LK1F 1HCRA 4LJZF 1XGNA 1UG0A 3K4KA 1FBQA 2R7FA 1BOBA 2K4BA 1U0JA 3KP2A 2ZBKA 3F23A 1QVTA 4X1EA 4AIDA 4UUSA 4MEXF 1MMDA 4A3JJ 4CGZA 3BWGA 1E17A 3GFJA 3TDUC 3M9AA 4HLYA 2HTJA 3JTGA 3PJRA 4BH9A 4UUSB 4IOCF 1Q1HA 3DWLE 5J3LA 5H6QA 4C30A 3VYSB 3W6VA 2EV6A 3BR1A 2KLOA 4AUXA 1ON1A 3RPQA 2EH3A 3CJTB 1EF4A 5TRDA 2XF5A 4L18B 2L4AA 2Y48A 3O2PE 2HYJA 3VWBA 1DQUA 1VQMI 1WJ5A 3JSOA 2CMPA 2VXDA 3SHFA 4F93B 5CVJA 5L3FA 3S3NA 1YO5C 2VJIA 3GTGJ 4CSWA 3OR2C 2OPTA 3E5QA 3DEEA 1D0XA 2JSCA 3TO9A 2VL8A 4AYBN 4G12A 4RGSA 4Z2YA 4UNOA 4XKCA 3E0JB 2BZTA 4Y7NJ 5ERIA 1USSA 5E20A 2OA4A 3CUOA 1FBSA 4OINF 5LFAA 1FMVA 4YFNF 4PJJA 3C7JA 4ON0A 4E7HA 2K3PA 3KYCB 3RYRA 3DV8A 1FX7A 1JE8A 2CQXA 2M0CA 2JPBA 4IHWA 4CUGA 2NRAC 2F5EA 1MD0A 2BY2A 1B72A 2JUGA 4C9YA 4A0XA 4RGUA 3R0AA 3QODA 2OQRA 1ZGWA 3LL7A 3O3KA 3R6SA 3PSIA 4BQOA 3JRIA 2D1HA 5BPDA 3LMMA 4NC7A 2XGXA 4RLQA 2QSHX 3CLOA 2QWWA 5B5EC 2KKOA 2VQLA 4XNFA 2BE5F 2ZMEC 5CVIA 1FOWA 5FKKA 5D4RA 1G59A 5TGTA 3ONQA 4BDYA 5DS9A 3SFIA 1O3TA 2ESHA 4DNCA 3ZQLA 4IRGA 5KVRA 1JKQC 5FFXA 2PQ8A 1MJ9A 2F2EA 4A69C 1IO2A 2NNYA 1EJ9A 1DDNA 3ABMH 5J6XA 1JJ6C 1N25A 1HW5A 2XAUA 1X3UA 4PK4A 5HOOA 3QAHA 1S7AA 2FQ3A 3ZMVA 4KJZA 4OIOF 4I2OA 3CJNA 4B47A 3EUHA 3SDGA 3JRAA 3RQIA 1D0ZA 1Q1VA 2KFDA 3G71I 5AIPA 1XGOA 3ZQFA 3HDDA 1JKPC 3LAPA 1YLFA 5J47A 2EPFA 3C1DA 3VOEA 4L9VA 3BQZA 1WJEA 3OWTA 4U0WA 4DYQA 3HPHA 2OCCH 1Y1VJ 2NYXA 3IV5A 4MO7A 2YR2A 5F27A 2DBBA 1TWGJ 4RGRA 1QZEA 1OCZH 3SEZA 3G4SI 5B1BH 2L54A 3DPLC 3ZQGA 4HYEA 4IHYA 2OBPA 2HQRA 3V7CA 3V7SA 4EATA 1W5TA 3BZCA 2FEZA 4U0VA 1P4AA 2ISYA 4EQQA 3L2UA 2HKXA 4B3XA 3JTHA 4AIHA 4C3HJ 4TV7A 3F6OA 3IH2A 2NS7A 5CPRB 4JX4A 4Y4RA 3QPTA 4BS9A 1SVMA 3GO5A 2FX0A 4ZJZA 4RB2C 4YIFA 3S15J 3H5RA 2DK5A 1R00A 3MWMA 1XTAA 1FOKA 2VXZA 2M4KA 4E70A 5ICEA 2GBYA 3QPLA 4M71A 5HLIA 3ZMZA 3E97A 3EUAA 4ENJA 2XB0X 4Y33A 2DDAA 4N9HA 1TQMA 5EEAA 1Y1WJ 4ZTFA 4MTEA 1NTCA 2JRTA 2LF7A 2XAGA 3FMRA 1I6XA 3GFLA 4KITB 5IOYA 1SEUA 2COBA 5J1UA 4BNCA 2BVMA 4A3DJ 5IYDJ 3CCVI 1XG1A 2A6TA 1QHHD 1HLVA 4LFUA 4XBFA 3KE2A 1QRYA 4V2GA 3W2AA 1MMGA 3F8BA 3GLXA 3CMEI 3L2RA 2FOWA 2A5YB 1W1WE 1ENHA 5FKMA 3JAMK 3L9FA 2XASA 3MAJA 4BQNA 1GLNA 4AM3A 2LBFA 1B4AA 1U9NA 3BG9A 3ABLH 4YG2F 4RAYA 4M3EA 4A3GJ 3TL4X 2JA8J 1Z21A 1V3FA 3U9GA 2L5QA 1W7PB 2E60A 4XL9A 3WTUC 1IJWC 2OAZA 3IL2A 4OOIA 3E1SA 3E5UA 2ECBA 2D45A 3HOZJ 4IVNA 3JSPA 3DU5A 4CYDA 4KT6A 1KQ9A 2QF7A 2H94A 4G94A 4PZJA 3TO7A 4BACA 2EIMH 3S14J 3G1LA 4MIMA 1BC7C 4BHCA 1S29A 1JUMA 3PIOF 2E34A 1LFUP 5B1AH 5F08A 1JHFA 2DFIA 2ZXWH 3BR2A 3UR3C 4Y15A 1A6IA 1I50J 1MBKA 3ASNH 3NQOA 3PSFA 3BG7A 5EZHA 5D8KB 2FRHA 1VQPI 1JI8A 1W5CC 4YIIA 4L9JA 4M9XA 3CF5F 3G2BA 1Y56A 4FE4A 5K1YA 1ZR4A 1O7FA 4AIJA 2IXSA 2D1VA 2QKLB 3RSNA 2IBDA 4ZC3A 5E1WA 4EJWA 5EDNA 4BAYA 5DCFA 2A5WA 1U8BA 1R71A 2NVQJ 3GX4X 1G3WA 5A2QK 5BNGA 3CC2I 2EBIA 5HS7A 5CJ9A 2Y9YA 4Q5SF 4HDUA 2ZKZA 1GV2A 3LSTA 2VKVA 4V19K 2R7RA 1IN4A 2PX9A 4BQQA 3I55I 3WGIA 4IEJA 2PMZA 3IUOA 3J81Z 1V5EA 4IX7A 3BC8A 4HNVA 5JI6A 4E7ZA 2W85A 3I9V2 1QGPA 4DGWB 4KUMA 2GZWA 5IP7J 4HW0A 1B8IB 4ZDPA 5DD8A 1H9TA 1XD7A 2DLLA 2Z16A 4YEJA 3K7AJ 2DOEA 3FMSA 2ZJQF 2XF7A 2XPWA 2UXNA 2XGDA 3BOQA 1K6YA 3I58A 1DGRM 2Y75A 4KIFA 4CCNA 1FTZA 1FOYA 1MMNA 4G8XA 3SZGA 1SMTA 2UZKA 1H8AC 3HRMA 3M3YJ 2KIMA 1D1AA 1IDYA 2E35A 2X9DA 2BW3A 2N8GA 4HEA2 3OYGA 4XORA 4PDKA 4XRMA 2IGNA 2FSWA 3LSMA 5DD4A 1UHWA 1FOXA 2I8DA 2BW3B 4B3AA 2CRGA 5LGUA 2VJJA 3CUQB 3HOUJ 2IAIA 4XLFA 3F21A 3QU6A 2IVMA 2RVCA 1ZHFA 1S3JA 1Z05A 4EM2A 4HZFA 2ESNA 3I71A 5C4XJ 3A01A 1WSUA 1H88C 4FHTA 2DFHA 1MH3A 2HDWA 4P55A 5FO5A 3ZMDA 2FOKA 3BR0A 1WCMJ 2O0YA 3BTIA 2QZ8A 2OD5A 2VBWA 4WWCA 1IRZA 1OFCX 2HDDA 2L4MA 2J5PA 3OIPA 4CYCA 2WY8Q 5HNHA 2HOTA 1WRJA 1IV8A 2CW7A 3DCFA 2Q8KA 3I64A 1BW6A 1R6RA 3CCYA 4M3BA 2VI6A 3V4GA 5J4VA 5LHIA 1IXCA 5CVUA 1QVUA 5DTDA 3L2VA 1B1BA 2DFEA 2EA4A 2XGEA 2ZSHB 1SD6A 2IS1A 3OOPA 1P9QC 2OU2A 3FXUA 2V1DA 3A4CA 3WU0A 1SFOJ 1QA6A 1XMXA 4P9FA 1DP7P 4HSRA 5M5XJ 3CLQA 6PAXA 3GZ6A 2XV4S 3LSPA 1DU6A 2VJ4A 1USTA 1ZG3A 4ZZDA 4A3MJ 1YW7A 5J1YA 4DIQA 2LFBA 3RPUD 5L3GA 4BEHA 3WTZA 1JT6A 2NVYJ 1Z6TA 1XSDA 1R4NB 4KNYA 5LHHA 3PUFA 5D6FA 4BEHB 5JVTA 4XSZF 1D8KA 3IWZA 1YHQI 4M74A 4CXFA 3IHUA 1Y8QB 2DA7A 2VKHA 3IH3A 1IG7A 2JPCA 2CUZA 1LDDA 4A93J 1MBEA 4E7JA 4U0YA 2GQQA 2NOJB 1OCRH 2WAFA 4M3FA 5D6EA 1TL8A 3TEDA 2M8GX 5E3MA 2X6OA 2UV1A 4M72A 1XC5A 4ESBA 1FT9A 5AIQA 2VOPA 1ULYA 3LAJA 3RI4A 2FUG2 3IP4B 1OPCA 3CP8A 4E4HA 5E3NA 2R7XA 2R5YA 5FKOA 5LHGA 3CTAA 1Z0XA 1IN8A 3R61A 2GOMA 2YU9J 4LLGF 3FXMA 4OIRF 3ZQIA 9ANTA 2EILH 2R5YB 1K4SA 1CQTA 2W82A 1J0RA 2O5RA 3JRBA 1GXQA 2R7QA 4WF2A 3CCJI 2GIZA 2QQBA 2K27A 1EKEA 3BTJA 2EJRA 3CCUI 3G1OA 3WTVC 4CCMA 1FMWA 3FXJA 2W7NA 3ZMSA 3GFMA 2JRMA 4OAZA 2VQCA 2DA5A 5FGMA 3JRCA 4XLAA 1U9OA 5F04A 1MH4A 2F4MB 3TOAA 1Y39A 2A07F 1AHDP 3HSFA 4L5JA 4OAYA 2X0LA 1MSFC 3AL0B 1M1EB 1XDUA 3BR3A 1VQ6I 2HYGD 1ITYA 3IRQA 2QQAA 1I1SA 1Z3XA 5CYVA 5B3SH 3E5XA 1T8IA 5LRSA 3OL3A 2DI3A 2Z33A 2HOEA 1UHMA 5IP9J 4KMUX 4IRIA 1U2WA 3DPUA 3G3ZA 2AXLA 4PCQA 2COMA 3BR5A 3E6DA 5BQTA 4CICA 5FKLA 3PNTA 4G6QA 1TT5B 2E5ZA 3DFGA 2EINH 4PJLA 3AG2H 2EV5A 3CCMI 1W36C 1LVAA 4XLEA 2NNNA 5K7FA 3BR6A 4G7HF 3HBLA 2NAZA 4CDGA 4Y3OA 1HSTA 2AXTC 2STTA 2CSOA 3BJ6A 2XSDC 2F4IA 3JCUC 2EIKH 1T38A 1J75A 1XSXA 4EJUA 5L3CA 2DJIA 4B1RA 1MJAA 1GVDA 2HZTA 1KGSA 4IF4A 5EGOA 1L3LA 1RNLA 3A03A 2FU4A 3W2WA 3FKIJ 4HG2A 3GLLA 3ERED 2EFOA 4LIUA 3LA2A 5EGOB 2DODA 1RI7A 5D8LB 3GTKJ 2OCEA 5F1JA 5FKNA 2MFZA 3KP7A 1PUFA 2CO5A 1AKHA 3HHHA 2EWNA 2JSPA 1FEXA 4RB0A 5CKTA 2K02A 4BXFA 2MLKA 4G6TB 3F72A 4HA8A 3WG9A 3K4CA 4LG0B 1KONA 5C44J 1ZTRA 3KEOA 2BHZA 2M8EA 4E7SA 1R4MB 4OMZA 1FYMA 3E6CC 1WGXA 2PMZN 1X1CA 2E1CA 5F0HA 2CWEA 3KYDB 4XN3A 4M9ZA 4KN7X 4DBQA 1SC7A 2FBKA 1RR8C 1MNMC 2IP2A 2KDOA 3WHCA 4CHUA 4A3LJ 1PDNC 4UB8C 2KPMA 2R92J 4DJAA 1VF9A 5F0FA 2QUFA 3U1DA 4F7ZA 3F22A 4M73A 3OYNA 1O3RA 2WTEA 3ZQCA 5E8IA 3HTUA 3IAM2 4I09A 5FRNA 5EF6A 3BTCA 4I98B 5CVRA 3A0HC 3CCQI 1A5JA 1A04A 4LG3A 1SANA 1LE8A 3M8FA 1APLC 1BR1A 4D0PA 3N4MA 2RV8A 3WTYC 2QEXI 2V9KA 4HOBA 4UVCA 1CGPA 3DP7A 2Z5UA 1S9HA 1LE8B 4XR6A 4B8XA 3MKZA 2ZXIA 3M1EA 3OV8A 1K4TA 2NOGA 2KISA 3BY6A 1WJBA 4U7DA 1G2HA 3MQ0A 1V54H 4RM3A 3IKTA 1WH5A 2RQPA 5LLQA 5F64A 2XUBA 2LRDA 2KRCA 5DEQA 2MSYA 2CFOA 2PI0A 3PNYA 4ESFA 1O57A 2IJLA 1S72I 2DTZA 4L0ZB 4U7BA 1R1UA 2HVRA 1R7JA 3C2HA 2DT7B 1XPXA 3L2CA 3S1QJ 3FK7A 2R7DA 1OCCH 2HGCA 2V6CA 3PQKA 2VIXA 2L7FP 1ZRDA 3V7RA 3C2BA 4KICA 2PMHA 2I10A 3BZKA 3S16J 2HWVA 3WGGA 1YIOA 1X1AA 1NH3A 1ZQ3P 4NBQA 2XIGA 4XMYA 2ZFUA 4PJNA 3S2WA 5HLHA 2L7MP 2VC0A 1UFMA 2L7ZA 3M07A 4BQAA 1RUNA 2KHMA 4NC8A 3H9GA 2KRFA 1BI2A 2ETHA 1OCTC 3HM5A 4PUSA 2ZNYA 2XGCA 1WI9A 4XLNF 5FJ8J 2JVHA 2Y0SA 1BC8C 2LK2A 1I39A 1KZHA 4D7MA 3JR9A 4UUVA 5J4YA 3IRRA 3WTSC 5JVGF 1H0MA 2WAQA 3RZOJ 4R1HA 4LLLA 1IRGA 1FJLA 2V7FA 2BBYA 3D5LA 1KU9A 2LC2A 1IUFA 3SYTA 4XKBA 4CCOA 3V8KA 3FK6A 3H92A 1ZLJA 2MH2A 4Y13A 3D0SA 4D5CA 3OYFA 3EUKL 3JRFA 2KDZA 1JKRC 1ZG1A 1UJ8A 2L9RA 2H6BA 2E71A 4P1WA 2LKXA 2H09A 1U5TB 1MKMA 3K1NA 3ZP5A 2F6CA 4D5FA 5EG0B 4RB3C 1LFPA 3K4JA 5FLXK 1FIAA 2NS8A 3RKWA 1L0OC 3PFIA 3MKLA 3HSRA 3CCSI 1IRXA 1QQIA 2PFBA 2O6GE 5L3BA 1T39A 3BZ6A 2VPRA 3S2DJ 4A5MA 2CUEA 4J00A 1MDMA 2HU9A 2M7AA 5M5YJ 5KK1A 1MDMB 1VQOI 1G4DA 2HPMA 1CF7A 3PL8A 4DOZA 1STZA 3D5RC 3HKZA 5CQGA 1YQAA 2O9LA 3VB2A 4BXUA 5HDNA 2GAUA 5JHFA 2X85A 1CF7B 2FNAA 5ILVA 1IN5A 1XB4A 2UUZA 1HOMA 2CJJA 2FE3A 1VQLI 4ANJA 2ZC2A 2R7TA 2EZKA 2L9VA 2H8RA 3QWLA 5FRMA 1EH7A 4IKFA 3KX2A 3S3OA 4KYWA 3ESWB 2P6SA 3RDIA 4YFKF 4LITA 2XROA 2YX4A 4BKXA 2VKDA 3OYBA 2QYOA 4HF1A 2K9QA 2JTVA 2E1OA 3LWFA 3CO6C 2HDCA 3H36A 4WXHA 2QLZA 4D7NA 2PJRB 2BXYA 4PJMA 1ETYA 3H3UA 3BTLA 4JX6A 2B7EA 1QZZA 3CJQB 3HRTA 1QBJA 2ZNZA 1D0YA 4BY7J 2R7VA 3J7AO 1W0TA 1MSEC 1P92A 5HNFA 5D5XB 4M9SA 3CCLI 2CV1A 4JYKA 1WVRA 2FA5A 4XSXF 2Z2SB 4WCGA 3EQLF 2HFHA 2QSFX 1Z77A 2JJ7A 2Q1ZB 2TCTA 4EJOA 4RB1A 1TQIA 2OZ6A 4B43A 4MHGA 2VE8A 4H4KC 1RPWA 2WAEA 4KN4X 2F5VA 1A31A 2P6TA 3LQQA 1T33A 1JTXA 4RDUA 2P0WA 3BJOA 2CV2A 4LLNA 1QU3A 4ENNA 2M7BA 3QYBA 1NK3P 4CZZA 4QSHA 5E3LA 3WTWC 4GRIA 3O6BB 3FMQA 4EJTA 1BJZA 3DTIA 3KP6A 4KA4A 2BY0A 4QPOA 1U6GA 3PM1A 3M7GA 1T0FA 2X4HA 4JX5A 2JN6A 4PSXA 2DPUA 2JUCA 4XKVA 3VSKA 4V2FA 1TLHB 2LY1A 1W0UA 2XRNA 3FKJA 4A3KJ 4EMSA 2JT1A 3HSEA 3EPZA 3VDXA 4IOAF 5M3MJ 1T08B 3DPTA 4FE7A 2Z1DA 3K69A 2W84A 3GW2A 1ZRFA 1OR7A 1W7PA 2O7OA 5JHUA 1JT0A 3LSGA 2ADUA 2RQQA 2R7OA 2K9SA 5TJJA 3I4MJ 4C2UA 4OIQF 1VQNI 4FTHA 4E7KA 2RKHA 3WTXC 3HL2A 3DKWA 3W6JB 2ECCA 5J8CA 4PGHA 3OYMA 2AS5F 4FETA 3NEUA 3K2AA 1LEBA 2IS6A 1QHGA 3HOYJ 1LDJA 1G3YA 3MZYA 5BPIA 3DLLF 2V1NA 4GXOA 4BE1A 1IN6A 2FMLA 2HOAA 1BIBA 3AL0C 3DQVC 4E7LA 3K2ZA 2L02A 2CGPA 2WC2A 4PSWA 2PJPA 1YJNI 4ZYDA 1BL0A 4XK4A 4XICA 1EH8A 2CQQA 4ZDLA 4A12A 2DK8A 3K70C 4XIDA 5IYBJ 2DCEA 4EM0B 1SD7A 1K79A 4O6JA 4P96A 1YS6A 2VKEA 5KHDA 4ZH4F 4S04A 1D5VA 1XX5A 1MNEA 4MGRA 5BOXA 3HPGA 3J80Z 3FHZA 2M87A 2V4JC 1FYLA 1EV7A 3L09A 1BM9A 2G7UA 1R22A 2HEOA 3MD2A 5GAGJ 2FJ1A 3ZQQA 2ICWG 2AHQA 5FROA 4ENMA 3FX3A 5ICGA 4XOPA 3A1YA 3VODA 1WJFA 3FM5A 4EVIA 4CH7A 1FPQA 4MTDA 2R5ZB 2IEKA 4BBSJ 3BROA 1SD5A 1B8IA 2K4JA 2XF6A 4NNJA 1IDZA 3K9TA 2CYYA 1OKRA 2LLKA 3H3ZA 2JA6J 3VEPA 2NVXJ 3UNGC 2CFXA 2DAOA 1JJ8C 4FQGA 4J01A 2VQGA 4ASNA 4IHVA 1RESA 4I02A 4L5EA 2Y0SN 4HAMA 4XRSA 1SFEA 3BG6A 1N75A 5D5UB 1X19A 1MNDA 3BDDA 4I6ZA 4BU2A 4CCLA 4CO8A 1D1BA 3AG1H 1XSVA 2WAQN 3RPUA 4S0HB 1LUJB 2L0KA 3GBGA 3E3VA 4XRFA 1K78B 2LVSA 1C0WA 4ENKA 1WJAA 4F3QA 4L9NA 3A02A 4CCKA 2F5CA 2XAQA 2LD5A 1TNTA 4DYRA 1VQ7I 2QBYB 2UXXA 4EJVA 2DA6A 3OIQA 2KT0A 2W00A 2WWYA 4PGGA 1PP7U 2DOAA 2K85A 5K5OA 2PLYA 1T98A 3NWTA 3TGNA 3CUQA 3FF5A 3S32A 4HF2A 2MLGA 5LRRA 2P81A 3REOA 3JRHA 3K0LA 4UXNA 1DP3A 2Z9OA 4ZZLA 5K7ZA 1R36A 4BY1J 3Q0UA 1WH7A 3HZJA 5LBQA 1MMAA 3HTSB 3S1MJ 2LH9A 4ETSA 3A0BC 3TQNA 3ZQ7A 2BY3A 3RKXA 2L9NA 4Q48A 2ZMEB 3GTPJ 3I53A 4Q4ZF 4PFOA 4EM1A 3K4MA 5H6RA 4BHBA 4WK8F 1RUOA 2RREA 4II3A 3WU2C 1LB2A 2JMWA 4IRHA 3QPSA 3K10A 1TTYA 3LFKA 3ABUA 4IQJA 3LSIA 4IZZA 5DM6F 4HSTA 2X1DA 3HKZN 3ABKH 3OR1C 3BG3A 5LEJA 1OQYA 5K7HA 2EB7A 4Y52J 5H20A 1H9GA 3LQRA 1DGWY 2ZB9A 2IW5A 2YS9A 2QENA 2XAHA 1IUYA 4GYGA 1Z91A 3MKWB 1T95A 3NWSA 3ISPA 2ME6A 1SVLA 1YG2A 3VYTB 5FLVA 2XDVA 3QYFA 1MBHA 1QO0D 4MLOA 5HS9A 2P7CB 2ME0A 4M3GA 3C3WA 3GTLJ 1V4RA 5E17F 2FD5A 3ZOBA 1SVOA 2DTRA 5K5RA 1R9TJ 2YPRA 2ELJA 3CO7C 5GADJ 3WU1B 4BDZA 2V1UA 2EV0A 1LEAA 2YU3A 1FSEA 1ZLKA
chains in the Genus database with same CATH topology
5F0HA 3SJMA 5FKKA 1BW5A 2R0QC 1MNMC 3WHCA 5DS9A 4FCYA 4A3LJ 3SFIA 1GUUA 3ZQLA 1AU7A 3GTMJ 2R92J 1VF9A 5F0FA 1JKQC 3BT9A 4AC0A 4A69C 2M34A 2R5ZA 4DW6A 4M3DA 3ZQCA 1JJ6C 1GDTA 5EF6A 1YRNA 3BTCA 4I76A 1A5JA 1SANA 4ABZA 1IV6A 5IPAA 1DU0A 1LE8A 3DEWA 2JWTA 1APLC 2E2HJ 3SDGA 1YRNB 4XRSG 3JRAA 3RQIA 4J19A 1I3QJ 2HOSA 4A3CJ 3LSJA 1Q1VA 3VPRA 1JGGA 2O8KA 1LE8B 3ZQFA 3JRDA 3HDDA 1JKPC 4LOCA 2NOGA 3MN2A 2K9NA 1G2HA 1OJLA 3BQZA 1WH5A 4DYQA 2W48A 1X2MA 3HEFA 1Y1VJ 2AO9A 3IV5A 4MO7A 3G1MA 2MSYA 5F27A 1TWGJ 2ELKA 5M3FJ 2DTZA 3ZQGA 2B63J 3E7LA 4IHYA 1TWFJ 2JA5J 3S1QJ 3FK7A 3TW7A 2L7FP 2XB5A 4C3JJ 3C2BA 2I10A 1JUPA 3S16J 4C3HJ 2QCOA 3IH2A 2HQ5A 2NS7A 4BBRJ 2DMNA 4JX4A 1ZQ3P 3FIWA 2FX0A 3LNQA 3OSFA 2DMUA 3H0GJ 2CUFA 3S15J 2L7MP 3LSRA 3IH4A 1WI3A 2L7ZA 4MFEA 3CQZJ 2GBYA 3QPLA 1OCTC 3HM5A 2XB0X 2XGCA 3TW6A 1UHSA 1D5YA 5FJ8J 5EEAA 5C3EJ 1Y1WJ 1JTYA 5GPAA 2YUSA 2Y9ZA 1NTCA 2LK2A 4D7MA 3JR9A 3S17J 5IOYA 1JUSA 2COBA 5J1UA 3RZOJ 1VNDA 2HXOA 1FJLA 4A3DJ 5IYDJ 1XG1A 1HLVA 2DA1A 5F0CA 1IUFA 1QRYA 3FK6A 2HI3A 3F0CA 3S1NJ 2XPVA 4V2GA 2XPUA 4D5CA 3HGGA 3BG5A 4DZPA 3JRFA 2EZHA 1ENHA 5FKMA 4A3BJ 2KDZA 1JKRC 3FISA 4DYCA 1U9NA 2L9RA 3A01B 3BG9A 1OCPA 2LKXA 1GV5A 4M3EA 4A3GJ 2JA8J 1T56A 2LR8A 3B6CA 3GTJJ 4D5FA 5EG0B 3OIOA 2E19A 2EQRA 1IJWC 3I4NJ 2RAEA 1FIAA 4CYCB 2FQ4A 2NS8A 1MBGA 2DMTA 3MKLA 2ECBA 3HOZJ 2JA7J 1X58A 2QF7A 3L1PA 2VPRA 3NAUA 2Y31A 5J1RA 3S2DJ 3S14J 2CUEA 3G1LA 4MIMA 4A3EJ 1IGNA 1JUMA 5M5YJ 2ID6A 1LFUP 2DN0A 4NDLA 5F08A 3BQYA 1HDPA 1ETXA 3S2HJ 4X6AJ 3BR2A 1TWAJ 3HOWJ 2M9HA 3HOXJ 1A6IA 1I50J 1MBKA 2O9LA 1RR7A 3QQAA 5EZHA 3WHBA 2MG4A 4A3IJ 2X48A 3B6AA 1HOMA 2CJJA 4FE4A 1O4XA 1ZR4A 2EZKA 1ETWA 2H8RA 2IBDA 5EDNA 1U8BA 2NVQJ 4UUTA 5BNGA 4B4CA 2EBIA 3HOVJ 2WB1N 2Y9YA 4BKXA 1U78A 1NK2P 1XS9A 1GV2A 2K9QA 2VUMJ 2E1OA 2VKVA 1UMQA 3PO2J 1ZR2A 2NVTJ 4W97A 4D7NA 4IEJA 2Y30A 3Q0WA 4HNVA 2K40A 1H89C 1ETYA 3BTLA 4JX6A 1B8IB 5IP7J 3Q0VA 3D1NI 3NARA 2R93J 4BY7J 1W0TA 1MSEC 3GTOJ 3K7AJ 4JYKA 2LY9A 1X2NA 2XPWA 2JK3A 2DJNA 2XGDA 1Z77A 2JJ7A 2TCTA 2MW8A 3TP3A 2E2JJ 3S1RJ 1K61A 3O8GA 1RPWA 1FTZA 3UKGA 1T33A 1H8AC 4A3FJ 1JTXA 4RDUA 3M3YJ 1IDYA 5IOZA 1NK3P 1FIPA 4QSHA 1ETOA 2X9DA 2N8GA 2DA4A 5E3LA 4QIWN 4XRMA 1BJZA 1HF0A 3PM1A 3TP0A 4JX5A 4B3AA 2JN6A 2CRGA 4V2FA 3HOUJ 2IAIA 1W0UA 4A3KJ 1F36A 1UG2A 5M3MJ 1F43A 2EZLA 5C4XJ 4FE7A 4QTRA 3A01A 1H88C 5IP6A 1WPKA 1MH3A 4C2MJ 3BR0A 1WCMJ 3BTIA 3OOUA 2MGQA 2O7OA 5EG0A 1IRZA 1JT0A 3LSGA 1OFCX 2HDDA 1ZKGA 2K9SA 3I4MJ 4CYCA 1VFCA 4FTHA 2HOTA 1RETA 4JP0A 2ECCA 3ZQHA 3CDLA 4W1UA 3DCFA 2WV1A 3K2AA 1BW6A 4M3BA 3CCYA 2VI6A 3M4OJ 3HOYJ 5GP9A 5DTDA 1QVUA 2M2EA 5JLWA 2GM4A 2XGEA 2HOAA 1ORKA 5E3OA 3OSGA 5FLMJ 1MBJA 3JREA 1E3OC 1BL0A 4XK4A 5M5XJ 4XICA 2R7ZJ 1I6HJ 2CQQA 3LSPA 1DU6A 1RKTA 3RZDJ 4A3MJ 5J1YA 4XIDA 2LFBA 5IYBJ 1PUFB 2TRTA 1AKHB 2G0EA 1B72B 2E2IJ 3GTQJ 5M5WJ 2EZIA 1JT6A 2NVYJ 4BXXJ 2VKEA 1P7JA 4EEFG 2LP0A 2DMPA 2ID3A 2GLOA 3RKQA 2DA7A 3IH3A 5C4JJ 1IG7A 1MBFA 1ETQA 3H3VK 4A93J 2FJ1A 2OF7A 1TC3C 1MBEA 2LTPA 2AHQA 1JKOC 1TWCJ 5EYRA 2D5VA 4M3FA 3TEDA 2M8GX 5HODA 5E3MA 3CMYA 1POGA 2X6OA 2R5ZB 3MVPA 1IC8A 2IEKA 4BBSJ 2CU7A 1XC5A 3HB9A 1B8IA 2DA3A 1IDZA 2HXIA 3HGYA 2LLKA 2JA6J 5E3NA 2NVXJ 2R5YA 2XRLA 1JJ8C 5FKOA 3Q3SA 1Z0XA 4IHVA 1RESA 2YU9J 4L5EA 3ZQIA 2R5YB 2Y0SN 4XRSA 9ANTA 1CQTA 1HDDC 3JRBA 4I6ZA 4DZJA 2H1KA 2WAQN 4S0HB 3BTJA 4M6VA 2L0KA 1ZK8A 3JRGA 3G1OA 1BA5A 3GBGA 1HCRA 3O8HA 2LVSA 3JRCA 2DA5A 3A02A 1U9OA 5F04A 1MH4A 5EZGA 1AHDP 2LD5A 4DYRA 1QVTA 4X1EA 4UUSA 2DA6A 3LOCA 4A3JJ 1MSFC 2KT0A 1TWHJ 3BR3A 4UUSB 1ITYA 1ETKA 5J3LA 2P81A 3JRHA 3W6VA 3BR1A 4AUXA 2EH3A 5K7ZA 1EF4A 4BY1J 4C3IJ 3Q0UA 1WH7A 4RBOA 2HYJA 3S1MJ 5IP9J 2DMQA 3GTPJ 3GTGJ 3BR5A 4MFDA 2OPTA 5FKLA 1ETVA 1VI0A 2JMWA 3QPSA 4AYBN 1QPIA 4G12A 1SFOJ 5K7FA 3BR6A 3HBLA 3HKZN 4Y7NJ 3BG3A 5JLXA 4GFBA 2XSDC 3PO3J 5K7HA 4Y52J 4B1RA 2Y2ZA 1GVDA 5EGOA 2YS9A 2ZB9A 2DA2A 3A03A 1RKWA 4FISA 3FKIJ 2ME6A 1GT0C 5EGOB 5FLVA 3GTKJ 2CQXA 2M0CA 1MBHA 4IHWA 5F1JA 4MLOA 5IYCJ 2ME0A 4M3GA 5FKNA 1PUFA 1AKHA 1B72A 3GTLJ 1P7IA 4IHXA 1FEXA 1LFBA 1K83J 1FTTA 2FD5A 3ZOBA 1R9TJ 1ZGWA 5C44J 1ZTRA 3JRIA 5GPCA 1S7EA 1WGXA 2PMZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0H A;  3SJM A;  5FKK A;  1BW5 A;  2R0Q C;  1MNM C;  3WHC A;  5DS9 A;  4FCY A;  4A3L J;  3SFI A;  1GUU A;  3ZQL A;  1AU7 A;  3GTM J;  2R92 J;  1VF9 A;  5F0F A;  1JKQ C;  3BT9 A;  4AC0 A;  4A69 C;  2M34 A;  2R5Z A;  4DW6 A;  4M3D A;  3ZQC A;  1JJ6 C;  1GDT A;  5EF6 A;  1YRN A;  3BTC A;  4I76 A;  1A5J A;  1SAN A;  4ABZ A;  1IV6 A;  5IPA A;  1DU0 A;  1LE8 A;  3DEW A;  2JWT A;  1APL C;  2E2H J;  3SDG A;  1YRN B;  4XRS G;  3JRA A;  3RQI A;  4J19 A;  1I3Q J;  2HOS A;  4A3C J;  3LSJ A;  1Q1V A;  3VPR A;  1JGG A;  2O8K A;  1LE8 B;  3ZQF A;  3JRD A;  3HDD A;  1JKP C;  4LOC A;  2NOG A;  3MN2 A;  2K9N A;  1G2H A;  1OJL A;  3BQZ A;  1WH5 A;  4DYQ A;  2W48 A;  1X2M A;  3HEF A;  1Y1V J;  2AO9 A;  3IV5 A;  4MO7 A;  3G1M A;  2MSY A;  5F27 A;  1TWG J;  2ELK A;  5M3F J;  2DTZ A;  3ZQG A;  2B63 J;  3E7L A;  4IHY A;  1TWF J;  2JA5 J;  3S1Q J;  3FK7 A;  3TW7 A;  2L7F P;  2XB5 A;  4C3J J;  3C2B A;  2I10 A;  1JUP A;  3S16 J;  4C3H J;  2QCO A;  3IH2 A;  2HQ5 A;  2NS7 A;  4BBR J;  2DMN A;  4JX4 A;  1ZQ3 P;  3FIW A;  2FX0 A;  3LNQ A;  3OSF A;  2DMU A;  3H0G J;  2CUF A;  3S15 J;  2L7M P;  3LSR A;  3IH4 A;  1WI3 A;  2L7Z A;  4MFE A;  3CQZ J;  2GBY A;  3QPL A;  1OCT C;  3HM5 A;  2XB0 X;  2XGC A;  3TW6 A;  1UHS A;  1D5Y A;  5FJ8 J;  5EEA A;  5C3E J;  1Y1W J;  1JTY A;  5GPA A;  2YUS A;  2Y9Z A;  1NTC A;  2LK2 A;  4D7M A;  3JR9 A;  3S17 J;  5IOY A;  1JUS A;  2COB A;  5J1U A;  3RZO J;  1VND A;  2HXO A;  1FJL A;  4A3D J;  5IYD J;  1XG1 A;  1HLV A;  2DA1 A;  5F0C A;  1IUF A;  1QRY A;  3FK6 A;  2HI3 A;  3F0C A;  3S1N J;  2XPV A;  4V2G A;  2XPU A;  4D5C A;  3HGG A;  3BG5 A;  4DZP A;  3JRF A;  2EZH A;  1ENH A;  5FKM A;  4A3B J;  2KDZ A;  1JKR C;  3FIS A;  4DYC A;  1U9N A;  2L9R A;  3A01 B;  3BG9 A;  1OCP A;  2LKX A;  1GV5 A;  4M3E A;  4A3G J;  2JA8 J;  1T56 A;  2LR8 A;  3B6C A;  3GTJ J;  4D5F A;  5EG0 B;  3OIO A;  2E19 A;  2EQR A;  1IJW C;  3I4N J;  2RAE A;  1FIA A;  4CYC B;  2FQ4 A;  2NS8 A;  1MBG A;  2DMT A;  3MKL A;  2ECB A;  3HOZ J;  2JA7 J;  1X58 A;  2QF7 A;  3L1P A;  2VPR A;  3NAU A;  2Y31 A;  5J1R A;  3S2D J;  3S14 J;  2CUE A;  3G1L A;  4MIM A;  4A3E J;  1IGN A;  1JUM A;  5M5Y J;  2ID6 A;  1LFU P;  2DN0 A;  4NDL A;  5F08 A;  3BQY A;  1HDP A;  1ETX A;  3S2H J;  4X6A J;  3BR2 A;  1TWA J;  3HOW J;  2M9H A;  3HOX J;  1A6I A;  1I50 J;  1MBK A;  2O9L A;  1RR7 A;  3QQA A;  5EZH A;  3WHB A;  2MG4 A;  4A3I J;  2X48 A;  3B6A A;  1HOM A;  2CJJ A;  4FE4 A;  1O4X A;  1ZR4 A;  2EZK A;  1ETW A;  2H8R A;  2IBD A;  5EDN A;  1U8B A;  2NVQ J;  4UUT A;  5BNG A;  4B4C A;  2EBI A;  3HOV J;  2WB1 N;  2Y9Y A;  4BKX A;  1U78 A;  1NK2 P;  1XS9 A;  1GV2 A;  2K9Q A;  2VUM J;  2E1O A;  2VKV A;  1UMQ A;  3PO2 J;  1ZR2 A;  2NVT J;  4W97 A;  4D7N A;  4IEJ A;  2Y30 A;  3Q0W A;  4HNV A;  2K40 A;  1H89 C;  1ETY A;  3BTL A;  4JX6 A;  1B8I B;  5IP7 J;  3Q0V A;  3D1N I;  3NAR A;  2R93 J;  4BY7 J;  1W0T A;  1MSE C;  3GTO J;  3K7A J;  4JYK A;  2LY9 A;  1X2N A;  2XPW A;  2JK3 A;  2DJN A;  2XGD A;  1Z77 A;  2JJ7 A;  2TCT A;  2MW8 A;  3TP3 A;  2E2J J;  3S1R J;  1K61 A;  3O8G A;  1RPW A;  1FTZ A;  3UKG A;  1T33 A;  1H8A C;  4A3F J;  1JTX A;  4RDU A;  3M3Y J;  1IDY A;  5IOZ A;  1NK3 P;  1FIP A;  4QSH A;  1ETO A;  2X9D A;  2N8G A;  2DA4 A;  5E3L A;  4QIW N;  4XRM A;  1BJZ A;  1HF0 A;  3PM1 A;  3TP0 A;  4JX5 A;  4B3A A;  2JN6 A;  2CRG A;  4V2F A;  3HOU J;  2IAI A;  1W0U A;  4A3K J;  1F36 A;  1UG2 A;  5M3M J;  1F43 A;  2EZL A;  5C4X J;  4FE7 A;  4QTR A;  3A01 A;  1H88 C;  5IP6 A;  1WPK A;  1MH3 A;  4C2M J;  3BR0 A;  1WCM J;  3BTI A;  3OOU A;  2MGQ A;  2O7O A;  5EG0 A;  1IRZ A;  1JT0 A;  3LSG A;  1OFC X;  2HDD A;  1ZKG A;  2K9S A;  3I4M J;  4CYC A;  1VFC A;  4FTH A;  2HOT A;  1RET A;  4JP0 A;  2ECC A;  3ZQH A;  3CDL A;  4W1U A;  3DCF A;  2WV1 A;  3K2A A;  1BW6 A;  4M3B A;  3CCY A;  2VI6 A;  3M4O J;  3HOY J;  5GP9 A;  5DTD A;  1QVU A;  2M2E A;  5JLW A;  2GM4 A;  2XGE A;  2HOA A;  1ORK A;  5E3O A;  3OSG A;  5FLM J;  1MBJ A;  3JRE A;  1E3O C;  1BL0 A;  4XK4 A;  5M5X J;  4XIC A;  2R7Z J;  1I6H J;  2CQQ A;  3LSP A;  1DU6 A;  1RKT A;  3RZD J;  4A3M J;  5J1Y A;  4XID A;  2LFB A;  5IYB J;  1PUF B;  2TRT A;  1AKH B;  2G0E A;  1B72 B;  2E2I J;  3GTQ J;  5M5W J;  2EZI A;  1JT6 A;  2NVY J;  4BXX J;  2VKE A;  1P7J A;  4EEF G;  2LP0 A;  2DMP A;  2ID3 A;  2GLO A;  3RKQ A;  2DA7 A;  3IH3 A;  5C4J J;  1IG7 A;  1MBF A;  1ETQ A;  3H3V K;  4A93 J;  2FJ1 A;  2OF7 A;  1TC3 C;  1MBE A;  2LTP A;  2AHQ A;  1JKO C;  1TWC J;  5EYR A;  2D5V A;  4M3F A;  3TED A;  2M8G X;  5HOD A;  5E3M A;  3CMY A;  1POG A;  2X6O A;  2R5Z B;  3MVP A;  1IC8 A;  2IEK A;  4BBS J;  2CU7 A;  1XC5 A;  3HB9 A;  1B8I A;  2DA3 A;  1IDZ A;  2HXI A;  3HGY A;  2LLK A;  2JA6 J;  5E3N A;  2NVX J;  2R5Y A;  2XRL A;  1JJ8 C;  5FKO A;  3Q3S A;  1Z0X A;  4IHV A;  1RES A;  2YU9 J;  4L5E A;  3ZQI A;  2R5Y B;  2Y0S N;  4XRS A;  9ANT A;  1CQT A;  1HDD C;  3JRB A;  4I6Z A;  4DZJ A;  2H1K A;  2WAQ N;  4S0H B;  3BTJ A;  4M6V A;  2L0K A;  1ZK8 A;  3JRG A;  3G1O A;  1BA5 A;  3GBG A;  1HCR A;  3O8H A;  2LVS A;  3JRC A;  2DA5 A;  3A02 A;  1U9O A;  5F04 A;  1MH4 A;  5EZG A;  1AHD P;  2LD5 A;  4DYR A;  1QVT A;  4X1E A;  4UUS A;  2DA6 A;  3LOC A;  4A3J J;  1MSF C;  2KT0 A;  1TWH J;  3BR3 A;  4UUS B;  1ITY A;  1ETK A;  5J3L A;  2P81 A;  3JRH A;  3W6V A;  3BR1 A;  4AUX A;  2EH3 A;  5K7Z A;  1EF4 A;  4BY1 J;  4C3I J;  3Q0U A;  1WH7 A;  4RBO A;  2HYJ A;  3S1M J;  5IP9 J;  2DMQ A;  3GTP J;  3GTG J;  3BR5 A;  4MFD A;  2OPT A;  5FKL A;  1ETV A;  1VI0 A;  2JMW A;  3QPS A;  4AYB N;  1QPI A;  4G12 A;  1SFO J;  5K7F A;  3BR6 A;  3HBL A;  3HKZ N;  4Y7N J;  3BG3 A;  5JLX A;  4GFB A;  2XSD C;  3PO3 J;  5K7H A;  4Y52 J;  4B1R A;  2Y2Z A;  1GVD A;  5EGO A;  2YS9 A;  2ZB9 A;  2DA2 A;  3A03 A;  1RKW A;  4FIS A;  3FKI J;  2ME6 A;  1GT0 C;  5EGO B;  5FLV A;  3GTK J;  2CQX A;  2M0C A;  1MBH A;  4IHW A;  5F1J A;  4MLO A;  5IYC J;  2ME0 A;  4M3G A;  5FKN A;  1PUF A;  1AKH A;  1B72 A;  3GTL J;  1P7I A;  4IHX A;  1FEX A;  1LFB A;  1K83 J;  1FTT A;  2FD5 A;  3ZOB A;  1R9T J;  1ZGW A;  5C44 J;  1ZTR A;  3JRI A;  5GPC A;  1S7E A;  1WGX A;  2PMZ N; 
#chains in the Genus database with same CATH topology
 4F91 B;  1PP8 F;  4PFP A;  4IJA A;  2LY2 A;  5FD6 A;  1P6R A;  1V55 H;  3WTT C;  3SJM A;  1BW5 A;  2R0Q C;  2P5K A;  4NHJ A;  4BUP A;  4A0Z A;  2KIU A;  2L2O A;  4UVA A;  3DBH B;  1X1B A;  3GTM J;  1R23 A;  1P2F A;  4AYB A;  2VAS A;  2A68 F;  4CZC A;  4AC0 A;  1BJA A;  4DW6 A;  4M3D A;  2JVG A;  5J8F A;  1BI3 A;  1GDT A;  5IT9 K;  3F8F A;  1YRN A;  3AG3 H;  3T1B A;  2CS3 A;  4I76 A;  2H27 A;  4GDF A;  4Q47 A;  1Y8R B;  4ABZ A;  4BE0 A;  5IPA A;  1IV6 A;  2JWT A;  2E2H J;  3HUG A;  1LPQ A;  4XRS G;  3Q9V A;  1YRN B;  3RTR A;  2HOS A;  4KIS A;  4A3C J;  2Y0M A;  3VPR A;  2BEO A;  1JGG A;  2HQA A;  5AON A;  2O8K A;  2VON A;  2W4S A;  1SMY F;  2L01 A;  2MBF A;  4UV9 A;  3HUG B;  1D1C A;  2V6E A;  3RIR A;  3MN2 A;  2K9N A;  2XHK A;  1FP1 D;  3L7W A;  3F6V A;  3L2Q A;  1ACI A;  2R7W A;  1BR4 A;  1K7A A;  4KIB A;  5ICF A;  1W5S A;  1X2M A;  1FP2 A;  3DXJ F;  1WHU A;  2AO9 A;  2YSR A;  2PG4 A;  1J9I A;  5ICC A;  1BN5 A;  3HJE A;  4X0G A;  5M3F J;  3AG4 H;  2V79 A;  5FFZ A;  2X6X A;  2B63 J;  1IXR C;  1ZGJ A;  5HDG A;  1BI1 A;  1TWF J;  4WXC A;  1T6S A;  1FSH A;  2E5N A;  3CCE I;  5D4S A;  1J5Y A;  5DYM A;  1IZ1 A;  2G7H A;  3OY9 A;  1YFH A;  1KQ8 A;  1AWC A;  3DLA A;  2XB5 A;  3RQ4 A;  3F3X A;  1YW9 A;  4I7H A;  2QCO A;  3ELK A;  2HQ5 A;  3KCC A;  5B66 C;  2DW4 A;  3J7Y J;  4MEY F;  3I56 I;  1S6L A;  3LNQ A;  1KYW A;  3OSF A;  2DMU A;  3H0G J;  2CUF A;  2GXB A;  5JFR A;  3CP2 A;  2V9V A;  4I99 C;  1F4K A;  1WI3 A;  1O3Q A;  2LNB A;  2RN7 A;  3QP6 A;  1K6O A;  2B0L A;  3CQZ J;  5LGT A;  3BCA A;  3H35 A;  3FZV A;  4GGG A;  5LD2 C;  1DPR A;  3ECO A;  3I59 B;  2OJE D;  4NQW A;  1UHS A;  4KT5 C;  1IRF A;  1D5Y A;  1KA8 A;  1TP4 A;  5TIS C;  1JTY A;  5GPA A;  2YUS A;  4MQV A;  2BOL A;  3EYI A;  1JUS A;  4NQW B;  4YFX F;  1VND A;  2ACJ A;  2ELH A;  2OUM A;  1SFU A;  3FXO A;  2DA1 A;  4HQE A;  2HI3 A;  3F0C A;  3V8J A;  2XPV A;  5KAF C;  3MZ8 A;  2XPU A;  1HA8 A;  3BCB A;  4F92 B;  4L0Y B;  2A6H F;  1X4O A;  4DZP A;  4IO9 F;  2EZH A;  4F52 A;  3W3C A;  1UZC A;  4C2T A;  3GEZ A;  4IHS A;  3LA3 A;  3G73 A;  3QYE A;  4LG0 A;  3SZT A;  2LR8 A;  2DYS H;  3CJR B;  1UCR A;  3OIO A;  2CW8 A;  5HVQ C;  2KZG A;  2RAE A;  4LD5 A;  2FQ4 A;  1SAX A;  4IXA A;  1MBG A;  4JBA A;  1IXS B;  2EFQ A;  5DUK A;  1PUE E;  1GHC A;  4LMY A;  1X1D A;  2X1C A;  3SFZ A;  3L1P A;  4S05 A;  2Y31 A;  3JAM Z;  5JR3 A;  5DCM B;  2GOX B;  3FM3 A;  5J1R A;  1BI0 A;  4A3E J;  4K2E A;  3ZN0 A;  2QGU A;  1QNT A;  3LFU A;  4G7O F;  2LYC A;  2DN0 A;  3BQY A;  4O3M A;  1FWZ A;  2EK5 A;  3F8N A;  1HDP A;  4B44 A;  1SAU A;  2MC3 A;  4X6A J;  3HG9 A;  3RYP A;  4EV0 A;  1TWA J;  3T8R A;  2DO7 A;  5LEK A;  1RR7 A;  1T0F C;  3QQA A;  3FXL A;  3PIP F;  2ISZ A;  3SZP A;  1YX3 A;  5EJC A;  4A2U A;  2VLA A;  3LA7 A;  3R60 A;  1Z3Y A;  1IN7 A;  3CMM A;  4XKW A;  4WX9 A;  1ETW A;  2BY1 A;  4IHT A;  2Q0O A;  4CCJ A;  2EFN A;  1N77 A;  2ZJR F;  1IF1 A;  2NS0 A;  1A36 A;  4OMY A;  1BR2 A;  2DQL A;  3OS0 A;  1OR7 C;  2P5L C;  3SDB A;  2XC7 A;  1U78 A;  2F48 A;  1P4W A;  5J40 A;  3DF8 A;  5K5Q A;  5CVV A;  1XS9 A;  4FAS D;  1R5H A;  2VT2 A;  5D5W B;  3PO2 J;  2VC1 A;  3P9I A;  3PUB A;  2K3F A;  4W97 A;  2QKM B;  2Y30 A;  4HV6 A;  5H2F C;  2F5D A;  3BPX A;  2K40 A;  1H89 C;  1AOY A;  2DFF A;  1DPU A;  2CQN A;  4YRV A;  1B9M A;  2HNH A;  2V9P A;  1LDK B;  3KLO A;  3D1N I;  3K1P A;  2BXZ A;  2IA1 A;  5A2Q Z;  4KMF A;  1Z1D A;  3KP4 A;  3MKY B;  3W2V A;  2HZD A;  3F8C A;  3K4L A;  1X2N A;  3U21 A;  3OYJ A;  3A2K A;  2MW8 A;  3TP3 A;  2VN2 A;  5CQE A;  3O8G A;  1HKQ A;  4Z6Y A;  2CV0 A;  3RJP A;  2OTL I;  4B09 A;  3ASO H;  3CDH A;  3KFW X;  3EYY A;  3UKG A;  1E3H A;  1XMK A;  2F5F A;  2K86 A;  2E7W A;  3KYL A;  4A3F J;  3P9K A;  2WV0 A;  4JOM A;  1ZGA A;  3AAF A;  3KEQ A;  2QSG X;  1VQ4 I;  3F8M A;  2IGM A;  1ETO A;  2GIV A;  1Z67 A;  3K1M A;  4CA0 A;  1D8J A;  2E1M B;  3RCO A;  4N9I A;  3GME A;  1I3A A;  4ZTJ A;  1IAW A;  2BGC A;  2QQ9 A;  3PNV A;  1NHA A;  2KIQ A;  3COA C;  1ON2 A;  3U1K A;  4FT8 A;  1QZY A;  1F9N A;  2HVS A;  5DV5 A;  1ZAR A;  1F36 A;  2QM3 A;  1UG2 A;  1OYY A;  4XLC A;  2EZL A;  3TOB A;  3CCR I;  4QTR A;  3DTE A;  1R1T A;  5IP6 A;  4XON A;  1LKX A;  1WPK A;  4C2M J;  3B02 A;  1U5T A;  1HBX G;  2ZJP F;  1U3E M;  5EG0 A;  2MGQ A;  2GXA A;  1ZKG A;  2K9L A;  4N4O B;  1RET A;  4JP0 A;  3ZQH A;  1S8N A;  1LQ1 A;  2G9W A;  3CDL A;  4W1U A;  2CW0 F;  3H5N A;  1OCO H;  3M4O J;  4BE2 A;  1WQ2 A;  3N05 A;  4AWX B;  5JLW A;  2BYV E;  2ZJ2 A;  4M6Y A;  1ORK A;  5E3O A;  3MZH A;  3DBL B;  5FLM J;  3JRE A;  2XVC A;  2FF4 A;  3RKY A;  2VBZ A;  4IL6 C;  3GZ5 A;  4JQF A;  3AKZ A;  2P8T A;  3V8L A;  1UB9 A;  3T0Y A;  1XGM A;  3CUQ C;  4P9U A;  4YIR X;  2VPL A;  3S8P A;  2DPD A;  2E2I J;  1B72 B;  4U88 A;  1E2X A;  5M5W J;  1YI2 I;  2EZI A;  1YYV A;  2ZXJ A;  3OYL A;  4B48 A;  3B73 A;  2OTJ I;  2CQK A;  3CC4 I;  2ID3 A;  2K5C A;  1KU2 A;  2O3F A;  3TDZ C;  5C4J J;  1MBF A;  3HC7 A;  4DBR A;  3WOD F;  1YW8 A;  2WAD A;  3HOS A;  3ABT A;  1FY7 A;  2LTP A;  1TWC J;  2MH9 A;  1E3P A;  4UB6 C;  2PJR A;  3FBN B;  5HOD A;  1POG A;  2L3D A;  3KIO A;  3MVP A;  1IC8 A;  2CU7 A;  4WXD A;  4ZYG A;  3OYE A;  1UAA A;  2DA3 A;  1Y6I A;  1V5G A;  3H5A A;  2O03 A;  4A0Y A;  2XRL A;  1G8X A;  1HC8 A;  1IW7 F;  2LRE A;  2R4G A;  3Q3S A;  3I5U A;  3HXL A;  3QOE A;  2O8X A;  3KZI C;  1YS7 A;  3I54 A;  3TO6 A;  1HDD C;  2HQN A;  3KZY A;  3QU3 A;  2H1K A;  3ZCO A;  2Z99 A;  5IT9 Z;  1R58 A;  4GO1 A;  4M6V A;  3JRG A;  1QPM A;  1Z9C A;  1BA5 A;  4RGX A;  3O8H A;  2B9S A;  3KLN A;  4ZYH A;  3P5J A;  5EZG A;  1N78 A;  3BPV A;  4HX8 A;  3D5S C;  4ZYA A;  1OYW A;  5HS8 A;  1O3S A;  3LOC A;  1ZH5 A;  2DOF A;  1RC9 A;  1MJB A;  4MQ9 F;  2BVL A;  1TWH J;  3WE2 A;  1YIT I;  1G6N A;  2WB1 A;  3I3L A;  2NXN B;  2VE9 A;  3T8T A;  1ETK A;  1MW7 A;  3S3M A;  2IA2 A;  4LB5 A;  2XAJ A;  1ONV A;  4AD9 A;  2W24 A;  4C3I J;  3ZPL A;  3KPH A;  3I4P A;  4RBO A;  1PYV A;  3KEY A;  1AA7 A;  1W4M A;  5E1Z B;  1HSJ A;  2DMQ A;  2E36 A;  1EA3 A;  3IAS 2;  2AQF A;  2XKP A;  2LDU A;  2VOO A;  1E0E A;  1YE9 A;  4MFD A;  1Y0U A;  1Z6R A;  4F55 A;  1ETV A;  2PEX A;  3CF2 A;  1VI0 A;  5GTI C;  1R5I D;  1XGS A;  2EIJ H;  3OMY A;  4FX4 A;  1QPI A;  2KMU A;  1MZB A;  3MEX A;  2MAB A;  4L9T A;  2LSO A;  1WZ2 A;  2M45 A;  5JLX A;  4GFB A;  1YTY A;  3CD6 I;  5F1R A;  3PO3 J;  1ZAO A;  2Y2Z A;  3IC7 A;  3S93 A;  2VT3 A;  2DA2 A;  3WG7 H;  3HRU A;  2A61 A;  1RKW A;  3KP3 A;  4FIS A;  3F9K A;  1S5L C;  2X6Y A;  2W25 A;  3ECH A;  1A6Q A;  1LVK A;  1GT0 C;  3LSH A;  4N4N B;  3ZGK A;  1KU7 A;  2EA2 A;  5IYC J;  4IQ4 A;  3H1C A;  1W36 D;  2K7L A;  4HBL A;  3FWE A;  2JQ7 A;  3OYI A;  1P7I A;  4E6K G;  4IHX A;  1LFB A;  1K83 J;  1FTT A;  2LBF B;  1RZ4 A;  1WFX A;  2CG4 A;  3DBR B;  1XCV A;  2H1L A;  3SEQ A;  5GPC A;  1S7E A;  2OQG A;  1TW3 A;  2DYR H;  4MNU A;  1HW2 A;  2R3S A;  1J2X A;  1OYI A;  4HV5 A;  5ILU A;  3M8E A;  3K6G A;  1B59 A;  2P5V A;  2V1X A;  2D2W A;  3TKY A;  4E7I A;  4HQM A;  3E6M A;  3BJA A;  3EDP A;  3OYK A;  1F1Z A;  3L00 A;  4FCY A;  1VQ9 I;  3ERM A;  1GUU A;  3DTK A;  3QOP A;  3R4K A;  1AU7 A;  3BP8 A;  2M4G A;  2WA0 A;  4U87 A;  3EET A;  3BT9 A;  1NG7 A;  2Y69 H;  4A6D A;  2M34 A;  1WKM A;  2R5Z A;  3DEU A;  3K4B A;  2H8W A;  2M5W A;  2IS4 A;  4G6D A;  1X3Z B;  1S7O A;  2VJ5 A;  4GCV A;  3OL4 A;  3QP5 A;  4G7Z F;  4BGD A;  1XDS A;  1DU0 A;  3DEW A;  1B9N A;  4RAZ A;  4OWR B;  1VQK I;  4XLH A;  1YJW I;  4ITV A;  1R49 A;  2WY7 Q;  1I3Q J;  1B6A A;  4J19 A;  3LSJ A;  5EEG A;  2VOD A;  2UWM A;  3GYH X;  2QA4 I;  3JRD A;  5E79 C;  2GA1 A;  4LOC A;  1YIJ I;  3FBI B;  1OJL A;  1SFK A;  3GUD A;  3GCM A;  4H0E A;  1GVJ A;  5EEH A;  1K78 A;  2M30 A;  3IWF A;  1A35 A;  3PFY A;  2W48 A;  3HEF A;  1TQP A;  1FC3 A;  1FZP B;  2OV7 A;  3G1M A;  4HDV A;  2RNJ A;  2ELK A;  2FBI A;  2V26 A;  2EFP A;  4OU0 A;  3QRF F;  2QBY A;  3E7L A;  3MMY B;  4BHP A;  3E6B A;  2RC4 A;  2JA5 J;  1G3T A;  1SD4 A;  3ZMT A;  5FD5 A;  3BLY A;  5BS6 A;  4AVZ A;  3TW7 A;  4HX7 A;  4D9J A;  3CDI A;  1VZ0 A;  4C3J J;  5HDK A;  1W7P D;  1JUP A;  2GWR A;  4BBR J;  3OS1 A;  2DMN A;  1VQ5 I;  1JGS A;  1GXP A;  1ZYR F;  1HW1 A;  3AFH A;  2MD5 A;  1R1V A;  3FIW A;  4OIP F;  2IPQ X;  4P5O A;  1XMA A;  2ZME A;  1TNS A;  2CH0 A;  3LSR A;  3IH4 A;  2PN6 A;  3P7N A;  1FNN A;  3MCZ A;  2HKO A;  1YOV B;  4MFE A;  2L7K A;  2J5O A;  1FYK A;  2M0M A;  3TW6 A;  4BJT A;  2GXG A;  2HPI A;  4BYY A;  5C3E J;  4Y17 A;  2ZO4 A;  2Y9Z A;  3C18 A;  3S17 J;  2MYS A;  1RRJ A;  3SQN A;  2HXO A;  3ROU A;  5IT3 A;  3CES A;  4NC6 A;  4XLP F;  3OYD A;  3OS2 A;  3VSL A;  1I27 A;  1X4P A;  2CQ7 A;  2H6C A;  1REP C;  2X51 A;  5F0C A;  2KZV A;  3TBI A;  2CUJ A;  3S1N J;  3Q9S A;  2DT6 A;  1WJC A;  4R79 A;  4LK0 F;  3FXQ A;  3HGG A;  2VQH A;  2ZFW A;  3BG5 A;  2QVO A;  1ZRC A;  4A3B J;  3FIS A;  4DYC A;  1Z7L A;  3A01 B;  4RS8 A;  3PQJ A;  1OCP A;  3ZMU A;  1GV5 A;  2LKS A;  1NG6 A;  4RMN A;  3IKV A;  1JHH A;  2XKO A;  1T56 A;  1HXD A;  3B6C A;  3ZRG A;  3GTJ J;  1P4X A;  4A6E A;  1XCB A;  3Q5F A;  2E7X A;  4HNT A;  2E19 A;  4QLC U;  1RIO H;  2EQR A;  3KZZ A;  3I4N J;  4CYC B;  3WE3 A;  2STW A;  2DMT A;  4UHT A;  1WJD A;  2E1N A;  3DKX A;  2JA7 J;  3LSK A;  1X58 A;  2PMU A;  4HNU A;  5FB2 A;  2HYF A;  3NAU A;  4XN0 A;  2KQR A;  2E1M C;  1IGN A;  2GA2 A;  2ID6 A;  3P9C A;  3CMA I;  4YEL A;  4AIK A;  3ML6 A;  1FBU A;  4NDL A;  2EFW A;  2XAF A;  1J7K A;  1ETX A;  3S2H J;  4KDP A;  5FLX Z;  3HOW J;  2M9H A;  1KQ0 A;  4HLX A;  1BBY A;  3HOX J;  1ERD A;  3X2Q H;  5E18 F;  2HR3 A;  3WHB A;  2M3A A;  2MG4 A;  3HOT A;  4A3I J;  2R7S A;  2ZXH A;  2L9S A;  2X48 A;  3B6A A;  1O4X A;  3HIF A;  4QWQ A;  2LF8 A;  1TZL A;  4PJ0 C;  1YJ9 I;  1Y0N A;  3CC7 I;  1U8R A;  3H9J A;  3KET A;  2BV6 A;  4ZYE A;  4HF0 A;  2PBI A;  4UUT A;  1U5T C;  2K9M A;  4B4C A;  1HKT A;  2JA2 A;  1PVE A;  1I5Z A;  4RM2 A;  2WB1 N;  1BIA A;  3HOV J;  2IRF G;  5CLS A;  4KIG A;  3CZ6 A;  1NK2 P;  3G6E I;  1XN7 A;  4LB6 B;  1ZG5 A;  3ZXS A;  2VUM J;  3H0D A;  4UY8 I;  2KL4 A;  2XSJ C;  1UMQ A;  1ZR2 A;  3I0T A;  2NVT J;  1BOA A;  3Q0W A;  2FXA A;  4XM3 A;  2DU9 A;  1PJR A;  3QPH A;  2ZSI B;  3M1C A;  3DU6 A;  3Q0V A;  3NAR A;  2R93 J;  1SFX A;  2FNP A;  2WBM A;  4DQ2 A;  4HRI A;  2KJC A;  2X1E A;  4G9Y A;  1V5F A;  4QPQ A;  3GTO J;  5ED4 A;  2LY9 A;  1DUX C;  4LGW A;  2JK3 A;  2DJN A;  4M6X A;  2DXI A;  3VYR B;  2QQ8 A;  1F5T A;  2E2J J;  1MMS A;  2M1B A;  3S1R J;  3N97 A;  1K61 A;  1ZEL A;  2HS5 A;  3KP5 A;  3MFK A;  3HHG A;  2X6W A;  2OZU A;  2A6E F;  1TT0 A;  3OYA A;  2F4O B;  2MD0 A;  2C6Y A;  3U2R A;  3I59 A;  4RLF A;  4UV8 A;  1R5G A;  4UVB A;  5IOZ A;  4HPQ A;  3M8J A;  1FIP A;  1X3W B;  2A05 A;  3OYH A;  2DA4 A;  4AVP A;  4QIW N;  2FMY A;  4O5V A;  1D3Y A;  3ULQ B;  2RDP A;  3C2G A;  2FBH A;  1HF0 A;  3TP0 A;  1G3S A;  1J09 A;  4GYI A;  2VB6 A;  2O61 A;  5GAE J;  2KRH A;  5LGN A;  3W6K B;  2DDB A;  4EGY A;  1F43 A;  3K4N A;  2VBX A;  2DQR A;  2JZY A;  3EUH C;  1J59 A;  5KCM A;  3GVA A;  2IGK A;  4L5I A;  2VBY A;  2MC4 A;  1MGT A;  3TMO A;  4JK1 X;  2IT0 A;  3OOU A;  1TW2 A;  4RAG A;  2RGV A;  1MIJ A;  2IGO A;  1LNW A;  2P7V B;  3FXK A;  4II2 A;  3GFI A;  1VFC A;  1O7L A;  3JW4 A;  4HX4 A;  3SXY A;  1OIS A;  2R7U A;  2LKP A;  2WV1 A;  2YX7 A;  3V42 A;  5E1X A;  3ZR8 X;  5DCM A;  3GXO A;  3DKY A;  5GP9 A;  3WGH A;  2Z3Y A;  1KYZ A;  2M2E A;  5ILS A;  3FDY A;  3GF2 A;  5L3E A;  4ZDO A;  1JXS A;  4RAF A;  2HVQ A;  5IY5 H;  2GM4 A;  1ZRE A;  2IS2 A;  1FLI A;  5L3D A;  1KU3 A;  3J80 K;  3OSG A;  5GAH J;  4ESJ A;  3J7A Y;  1MBJ A;  5HLG A;  5KNL A;  4D1Q A;  4RA2 A;  1E3O C;  4LIV A;  1EH6 A;  4NUB A;  2R7Z J;  2A3S A;  1I6H J;  3FHN A;  2BHY A;  1LJ9 A;  1RKT A;  3RZD J;  3GZN B;  2W1O A;  2KIF A;  1PUF B;  2A69 F;  2TRT A;  2G0E A;  1AKH B;  5BMZ A;  3GTQ J;  4I01 A;  3VYU B;  2W57 A;  3L2W A;  2DT5 A;  4BXX J;  1HQC A;  1P7J A;  4EEF G;  4XQF A;  2LP0 A;  1X1P A;  1VQ8 I;  2DMP A;  1YX5 A;  4I0A A;  2GLO A;  3GWZ A;  3J81 K;  3RKQ A;  2OC6 A;  4XOT A;  4EGZ A;  2Q2E A;  4AU7 A;  2LOO A;  1UEL B;  2AQE A;  3OYC A;  2NVU B;  1ETQ A;  2KJB A;  3VFZ A;  3H3V K;  3HRS A;  4A5N A;  2OF7 A;  5DUI A;  1TC3 C;  4NB5 A;  1I1G A;  1JKO C;  2P4W A;  1WWX A;  3K70 D;  2Q2E B;  4IPA A;  5EYR A;  4BJ6 C;  5GTH C;  2D5V A;  4R8H A;  2RNG A;  2KP6 A;  1Z7U A;  2I5U A;  4FX0 A;  3CMY A;  1VTN C;  5HLT A;  1ODD A;  2IA0 A;  1T2K A;  3J7Z I;  1HKS A;  3HB9 A;  2HTS A;  3T5X A;  1TBX A;  3NRV A;  5KAI C;  2HXI A;  1OMI A;  2MA3 A;  2ZCW A;  3HGY A;  2LG4 A;  3HYI A;  5D5V B;  2LMD A;  3R0J A;  5DM7 F;  4I0B A;  5F6F A;  5DDG A;  3ZN1 A;  4N0B A;  4BL0 B;  4DZJ A;  3H9Q A;  2TDX A;  4BJ5 C;  5E8G A;  4KFC A;  1OLT A;  3FXR A;  1ZK8 A;  1ZN2 A;  4LK1 F;  1HCR A;  4LJZ F;  1XGN A;  1UG0 A;  3K4K A;  1FBQ A;  2R7F A;  1BOB A;  2K4B A;  1U0J A;  3KP2 A;  2ZBK A;  3F23 A;  1QVT A;  4X1E A;  4AID A;  4UUS A;  4MEX F;  1MMD A;  4A3J J;  4CGZ A;  3BWG A;  1E17 A;  3GFJ A;  3TDU C;  3M9A A;  4HLY A;  2HTJ A;  3JTG A;  3PJR A;  4BH9 A;  4UUS B;  4IOC F;  1Q1H A;  3DWL E;  5J3L A;  5H6Q A;  4C30 A;  3VYS B;  3W6V A;  2EV6 A;  3BR1 A;  2KLO A;  4AUX A;  1ON1 A;  3RPQ A;  2EH3 A;  3CJT B;  1EF4 A;  5TRD A;  2XF5 A;  4L18 B;  2L4A A;  2Y48 A;  3O2P E;  2HYJ A;  3VWB A;  1DQU A;  1VQM I;  1WJ5 A;  3JSO A;  2CMP A;  2VXD A;  3SHF A;  4F93 B;  5CVJ A;  5L3F A;  3S3N A;  1YO5 C;  2VJI A;  3GTG J;  4CSW A;  3OR2 C;  2OPT A;  3E5Q A;  3DEE A;  1D0X A;  2JSC A;  3TO9 A;  2VL8 A;  4AYB N;  4G12 A;  4RGS A;  4Z2Y A;  4UNO A;  4XKC A;  3E0J B;  2BZT A;  4Y7N J;  5ERI A;  1USS A;  5E20 A;  2OA4 A;  3CUO A;  1FBS A;  4OIN F;  5LFA A;  1FMV A;  4YFN F;  4PJJ A;  3C7J A;  4ON0 A;  4E7H A;  2K3P A;  3KYC B;  3RYR A;  3DV8 A;  1FX7 A;  1JE8 A;  2CQX A;  2M0C A;  2JPB A;  4IHW A;  4CUG A;  2NRA C;  2F5E A;  1MD0 A;  2BY2 A;  1B72 A;  2JUG A;  4C9Y A;  4A0X A;  4RGU A;  3R0A A;  3QOD A;  2OQR A;  1ZGW A;  3LL7 A;  3O3K A;  3R6S A;  3PSI A;  4BQO A;  3JRI A;  2D1H A;  5BPD A;  3LMM A;  4NC7 A;  2XGX A;  4RLQ A;  2QSH X;  3CLO A;  2QWW A;  5B5E C;  2KKO A;  2VQL A;  4XNF A;  2BE5 F;  2ZME C;  5CVI A;  1FOW A;  5FKK A;  5D4R A;  1G59 A;  5TGT A;  3ONQ A;  4BDY A;  5DS9 A;  3SFI A;  1O3T A;  2ESH A;  4DNC A;  3ZQL A;  4IRG A;  5KVR A;  1JKQ C;  5FFX A;  2PQ8 A;  1MJ9 A;  2F2E A;  4A69 C;  1IO2 A;  2NNY A;  1EJ9 A;  1DDN A;  3ABM H;  5J6X A;  1JJ6 C;  1N25 A;  1HW5 A;  2XAU A;  1X3U A;  4PK4 A;  5HOO A;  3QAH A;  1S7A A;  2FQ3 A;  3ZMV A;  4KJZ A;  4OIO F;  4I2O A;  3CJN A;  4B47 A;  3EUH A;  3SDG A;  3JRA A;  3RQI A;  1D0Z A;  1Q1V A;  2KFD A;  3G71 I;  5AIP A;  1XGO A;  3ZQF A;  3HDD A;  1JKP C;  3LAP A;  1YLF A;  5J47 A;  2EPF A;  3C1D A;  3VOE A;  4L9V A;  3BQZ A;  1WJE A;  3OWT A;  4U0W A;  4DYQ A;  3HPH A;  2OCC H;  1Y1V J;  2NYX A;  3IV5 A;  4MO7 A;  2YR2 A;  5F27 A;  2DBB A;  1TWG J;  4RGR A;  1QZE A;  1OCZ H;  3SEZ A;  3G4S I;  5B1B H;  2L54 A;  3DPL C;  3ZQG A;  4HYE A;  4IHY A;  2OBP A;  2HQR A;  3V7C A;  3V7S A;  4EAT A;  1W5T A;  3BZC A;  2FEZ A;  4U0V A;  1P4A A;  2ISY A;  4EQQ A;  3L2U A;  2HKX A;  4B3X A;  3JTH A;  4AIH A;  4C3H J;  4TV7 A;  3F6O A;  3IH2 A;  2NS7 A;  5CPR B;  4JX4 A;  4Y4R A;  3QPT A;  4BS9 A;  1SVM A;  3GO5 A;  2FX0 A;  4ZJZ A;  4RB2 C;  4YIF A;  3S15 J;  3H5R A;  2DK5 A;  1R00 A;  3MWM A;  1XTA A;  1FOK A;  2VXZ A;  2M4K A;  4E70 A;  5ICE A;  2GBY A;  3QPL A;  4M71 A;  5HLI A;  3ZMZ A;  3E97 A;  3EUA A;  4ENJ A;  2XB0 X;  4Y33 A;  2DDA A;  4N9H A;  1TQM A;  5EEA A;  1Y1W J;  4ZTF A;  4MTE A;  1NTC A;  2JRT A;  2LF7 A;  2XAG A;  3FMR A;  1I6X A;  3GFL A;  4KIT B;  5IOY A;  1SEU A;  2COB A;  5J1U A;  4BNC A;  2BVM A;  4A3D J;  5IYD J;  3CCV I;  1XG1 A;  2A6T A;  1QHH D;  1HLV A;  4LFU A;  4XBF A;  3KE2 A;  1QRY A;  4V2G A;  3W2A A;  1MMG A;  3F8B A;  3GLX A;  3CME I;  3L2R A;  2FOW A;  2A5Y B;  1W1W E;  1ENH A;  5FKM A;  3JAM K;  3L9F A;  2XAS A;  3MAJ A;  4BQN A;  1GLN A;  4AM3 A;  2LBF A;  1B4A A;  1U9N A;  3BG9 A;  3ABL H;  4YG2 F;  4RAY A;  4M3E A;  4A3G J;  3TL4 X;  2JA8 J;  1Z21 A;  1V3F A;  3U9G A;  2L5Q A;  1W7P B;  2E60 A;  4XL9 A;  3WTU C;  1IJW C;  2OAZ A;  3IL2 A;  4OOI A;  3E1S A;  3E5U A;  2ECB A;  2D45 A;  3HOZ J;  4IVN A;  3JSP A;  3DU5 A;  4CYD A;  4KT6 A;  1KQ9 A;  2QF7 A;  2H94 A;  4G94 A;  4PZJ A;  3TO7 A;  4BAC A;  2EIM H;  3S14 J;  3G1L A;  4MIM A;  1BC7 C;  4BHC A;  1S29 A;  1JUM A;  3PIO F;  2E34 A;  1LFU P;  5B1A H;  5F08 A;  1JHF A;  2DFI A;  2ZXW H;  3BR2 A;  3UR3 C;  4Y15 A;  1A6I A;  1I50 J;  1MBK A;  3ASN H;  3NQO A;  3PSF A;  3BG7 A;  5EZH A;  5D8K B;  2FRH A;  1VQP I;  1JI8 A;  1W5C C;  4YII A;  4L9J A;  4M9X A;  3CF5 F;  3G2B A;  1Y56 A;  4FE4 A;  5K1Y A;  1ZR4 A;  1O7F A;  4AIJ A;  2IXS A;  2D1V A;  2QKL B;  3RSN A;  2IBD A;  4ZC3 A;  5E1W A;  4EJW A;  5EDN A;  4BAY A;  5DCF A;  2A5W A;  1U8B A;  1R71 A;  2NVQ J;  3GX4 X;  1G3W A;  5A2Q K;  5BNG A;  3CC2 I;  2EBI A;  5HS7 A;  5CJ9 A;  2Y9Y A;  4Q5S F;  4HDU A;  2ZKZ A;  1GV2 A;  3LST A;  2VKV A;  4V19 K;  2R7R A;  1IN4 A;  2PX9 A;  4BQQ A;  3I55 I;  3WGI A;  4IEJ A;  2PMZ A;  3IUO A;  3J81 Z;  1V5E A;  4IX7 A;  3BC8 A;  4HNV A;  5JI6 A;  4E7Z A;  2W85 A;  3I9V 2;  1QGP A;  4DGW B;  4KUM A;  2GZW A;  5IP7 J;  4HW0 A;  1B8I B;  4ZDP A;  5DD8 A;  1H9T A;  1XD7 A;  2DLL A;  2Z16 A;  4YEJ A;  3K7A J;  2DOE A;  3FMS A;  2ZJQ F;  2XF7 A;  2XPW A;  2UXN A;  2XGD A;  3BOQ A;  1K6Y A;  3I58 A;  1DGR M;  2Y75 A;  4KIF A;  4CCN A;  1FTZ A;  1FOY A;  1MMN A;  4G8X A;  3SZG A;  1SMT A;  2UZK A;  1H8A C;  3HRM A;  3M3Y J;  2KIM A;  1D1A A;  1IDY A;  2E35 A;  2X9D A;  2BW3 A;  2N8G A;  4HEA 2;  3OYG A;  4XOR A;  4PDK A;  4XRM A;  2IGN A;  2FSW A;  3LSM A;  5DD4 A;  1UHW A;  1FOX A;  2I8D A;  2BW3 B;  4B3A A;  2CRG A;  5LGU A;  2VJJ A;  3CUQ B;  3HOU J;  2IAI A;  4XLF A;  3F21 A;  3QU6 A;  2IVM A;  2RVC A;  1ZHF A;  1S3J A;  1Z05 A;  4EM2 A;  4HZF A;  2ESN A;  3I71 A;  5C4X J;  3A01 A;  1WSU A;  1H88 C;  4FHT A;  2DFH A;  1MH3 A;  2HDW A;  4P55 A;  5FO5 A;  3ZMD A;  2FOK A;  3BR0 A;  1WCM J;  2O0Y A;  3BTI A;  2QZ8 A;  2OD5 A;  2VBW A;  4WWC A;  1IRZ A;  1OFC X;  2HDD A;  2L4M A;  2J5P A;  3OIP A;  4CYC A;  2WY8 Q;  5HNH A;  2HOT A;  1WRJ A;  1IV8 A;  2CW7 A;  3DCF A;  2Q8K A;  3I64 A;  1BW6 A;  1R6R A;  3CCY A;  4M3B A;  2VI6 A;  3V4G A;  5J4V A;  5LHI A;  1IXC A;  5CVU A;  1QVU A;  5DTD A;  3L2V A;  1B1B A;  2DFE A;  2EA4 A;  2XGE A;  2ZSH B;  1SD6 A;  2IS1 A;  3OOP A;  1P9Q C;  2OU2 A;  3FXU A;  2V1D A;  3A4C A;  3WU0 A;  1SFO J;  1QA6 A;  1XMX A;  4P9F A;  1DP7 P;  4HSR A;  5M5X J;  3CLQ A;  6PAX A;  3GZ6 A;  2XV4 S;  3LSP A;  1DU6 A;  2VJ4 A;  1UST A;  1ZG3 A;  4ZZD A;  4A3M J;  1YW7 A;  5J1Y A;  4DIQ A;  2LFB A;  3RPU D;  5L3G A;  4BEH A;  3WTZ A;  1JT6 A;  2NVY J;  1Z6T A;  1XSD A;  1R4N B;  4KNY A;  5LHH A;  3PUF A;  5D6F A;  4BEH B;  5JVT A;  4XSZ F;  1D8K A;  3IWZ A;  1YHQ I;  4M74 A;  4CXF A;  3IHU A;  1Y8Q B;  2DA7 A;  2VKH A;  3IH3 A;  1IG7 A;  2JPC A;  2CUZ A;  1LDD A;  4A93 J;  1MBE A;  4E7J A;  4U0Y A;  2GQQ A;  2NOJ B;  1OCR H;  2WAF A;  4M3F A;  5D6E A;  1TL8 A;  3TED A;  2M8G X;  5E3M A;  2X6O A;  2UV1 A;  4M72 A;  1XC5 A;  4ESB A;  1FT9 A;  5AIQ A;  2VOP A;  1ULY A;  3LAJ A;  3RI4 A;  2FUG 2;  3IP4 B;  1OPC A;  3CP8 A;  4E4H A;  5E3N A;  2R7X A;  2R5Y A;  5FKO A;  5LHG A;  3CTA A;  1Z0X A;  1IN8 A;  3R61 A;  2GOM A;  2YU9 J;  4LLG F;  3FXM A;  4OIR F;  3ZQI A;  9ANT A;  2EIL H;  2R5Y B;  1K4S A;  1CQT A;  2W82 A;  1J0R A;  2O5R A;  3JRB A;  1GXQ A;  2R7Q A;  4WF2 A;  3CCJ I;  2GIZ A;  2QQB A;  2K27 A;  1EKE A;  3BTJ A;  2EJR A;  3CCU I;  3G1O A;  3WTV C;  4CCM A;  1FMW A;  3FXJ A;  2W7N A;  3ZMS A;  3GFM A;  2JRM A;  4OAZ A;  2VQC A;  2DA5 A;  5FGM A;  3JRC A;  4XLA A;  1U9O A;  5F04 A;  1MH4 A;  2F4M B;  3TOA A;  1Y39 A;  2A07 F;  1AHD P;  3HSF A;  4L5J A;  4OAY A;  2X0L A;  1MSF C;  3AL0 B;  1M1E B;  1XDU A;  3BR3 A;  1VQ6 I;  2HYG D;  1ITY A;  3IRQ A;  2QQA A;  1I1S A;  1Z3X A;  5CYV A;  5B3S H;  3E5X A;  1T8I A;  5LRS A;  3OL3 A;  2DI3 A;  2Z33 A;  2HOE A;  1UHM A;  5IP9 J;  4KMU X;  4IRI A;  1U2W A;  3DPU A;  3G3Z A;  2AXL A;  4PCQ A;  2COM A;  3BR5 A;  3E6D A;  5BQT A;  4CIC A;  5FKL A;  3PNT A;  4G6Q A;  1TT5 B;  2E5Z A;  3DFG A;  2EIN H;  4PJL A;  3AG2 H;  2EV5 A;  3CCM I;  1W36 C;  1LVA A;  4XLE A;  2NNN A;  5K7F A;  3BR6 A;  4G7H F;  3HBL A;  2NAZ A;  4CDG A;  4Y3O A;  1HST A;  2AXT C;  2STT A;  2CSO A;  3BJ6 A;  2XSD C;  2F4I A;  3JCU C;  2EIK H;  1T38 A;  1J75 A;  1XSX A;  4EJU A;  5L3C A;  2DJI A;  4B1R A;  1MJA A;  1GVD A;  2HZT A;  1KGS A;  4IF4 A;  5EGO A;  1L3L A;  1RNL A;  3A03 A;  2FU4 A;  3W2W A;  3FKI J;  4HG2 A;  3GLL A;  3ERE D;  2EFO A;  4LIU A;  3LA2 A;  5EGO B;  2DOD A;  1RI7 A;  5D8L B;  3GTK J;  2OCE A;  5F1J A;  5FKN A;  2MFZ A;  3KP7 A;  1PUF A;  2CO5 A;  1AKH A;  3HHH A;  2EWN A;  2JSP A;  1FEX A;  4RB0 A;  5CKT A;  2K02 A;  4BXF A;  2MLK A;  4G6T B;  3F72 A;  4HA8 A;  3WG9 A;  3K4C A;  4LG0 B;  1KON A;  5C44 J;  1ZTR A;  3KEO A;  2BHZ A;  2M8E A;  4E7S A;  1R4M B;  4OMZ A;  1FYM A;  3E6C C;  1WGX A;  2PMZ N;  1X1C A;  2E1C A;  5F0H A;  2CWE A;  3KYD B;  4XN3 A;  4M9Z A;  4KN7 X;  4DBQ A;  1SC7 A;  2FBK A;  1RR8 C;  1MNM C;  2IP2 A;  2KDO A;  3WHC A;  4CHU A;  4A3L J;  1PDN C;  4UB8 C;  2KPM A;  2R92 J;  4DJA A;  1VF9 A;  5F0F A;  2QUF A;  3U1D A;  4F7Z A;  3F22 A;  4M73 A;  3OYN A;  1O3R A;  2WTE A;  3ZQC A;  5E8I A;  3HTU A;  3IAM 2;  4I09 A;  5FRN A;  5EF6 A;  3BTC A;  4I98 B;  5CVR A;  3A0H C;  3CCQ I;  1A5J A;  1A04 A;  4LG3 A;  1SAN A;  1LE8 A;  3M8F A;  1APL C;  1BR1 A;  4D0P A;  3N4M A;  2RV8 A;  3WTY C;  2QEX I;  2V9K A;  4HOB A;  4UVC A;  1CGP A;  3DP7 A;  2Z5U A;  1S9H A;  1LE8 B;  4XR6 A;  4B8X A;  3MKZ A;  2ZXI A;  3M1E A;  3OV8 A;  1K4T A;  2NOG A;  2KIS A;  3BY6 A;  1WJB A;  4U7D A;  1G2H A;  3MQ0 A;  1V54 H;  4RM3 A;  3IKT A;  1WH5 A;  2RQP A;  5LLQ A;  5F64 A;  2XUB A;  2LRD A;  2KRC A;  5DEQ A;  2MSY A;  2CFO A;  2PI0 A;  3PNY A;  4ESF A;  1O57 A;  2IJL A;  1S72 I;  2DTZ A;  4L0Z B;  4U7B A;  1R1U A;  2HVR A;  1R7J A;  3C2H A;  2DT7 B;  1XPX A;  3L2C A;  3S1Q J;  3FK7 A;  2R7D A;  1OCC H;  2HGC A;  2V6C A;  3PQK A;  2VIX A;  2L7F P;  1ZRD A;  3V7R A;  3C2B A;  4KIC A;  2PMH A;  2I10 A;  3BZK A;  3S16 J;  2HWV A;  3WGG A;  1YIO A;  1X1A A;  1NH3 A;  1ZQ3 P;  4NBQ A;  2XIG A;  4XMY A;  2ZFU A;  4PJN A;  3S2W A;  5HLH A;  2L7M P;  2VC0 A;  1UFM A;  2L7Z A;  3M07 A;  4BQA A;  1RUN A;  2KHM A;  4NC8 A;  3H9G A;  2KRF A;  1BI2 A;  2ETH A;  1OCT C;  3HM5 A;  4PUS A;  2ZNY A;  2XGC A;  1WI9 A;  4XLN F;  5FJ8 J;  2JVH A;  2Y0S A;  1BC8 C;  2LK2 A;  1I39 A;  1KZH A;  4D7M A;  3JR9 A;  4UUV A;  5J4Y A;  3IRR A;  3WTS C;  5JVG F;  1H0M A;  2WAQ A;  3RZO J;  4R1H A;  4LLL A;  1IRG A;  1FJL A;  2V7F A;  2BBY A;  3D5L A;  1KU9 A;  2LC2 A;  1IUF A;  3SYT A;  4XKB A;  4CCO A;  3V8K A;  3FK6 A;  3H92 A;  1ZLJ A;  2MH2 A;  4Y13 A;  3D0S A;  4D5C A;  3OYF A;  3EUK L;  3JRF A;  2KDZ A;  1JKR C;  1ZG1 A;  1UJ8 A;  2L9R A;  2H6B A;  2E71 A;  4P1W A;  2LKX A;  2H09 A;  1U5T B;  1MKM A;  3K1N A;  3ZP5 A;  2F6C A;  4D5F A;  5EG0 B;  4RB3 C;  1LFP A;  3K4J A;  5FLX K;  1FIA A;  2NS8 A;  3RKW A;  1L0O C;  3PFI A;  3MKL A;  3HSR A;  3CCS I;  1IRX A;  1QQI A;  2PFB A;  2O6G E;  5L3B A;  1T39 A;  3BZ6 A;  2VPR A;  3S2D J;  4A5M A;  2CUE A;  4J00 A;  1MDM A;  2HU9 A;  2M7A A;  5M5Y J;  5KK1 A;  1MDM B;  1VQO I;  1G4D A;  2HPM A;  1CF7 A;  3PL8 A;  4DOZ A;  1STZ A;  3D5R C;  3HKZ A;  5CQG A;  1YQA A;  2O9L A;  3VB2 A;  4BXU A;  5HDN A;  2GAU A;  5JHF A;  2X85 A;  1CF7 B;  2FNA A;  5ILV A;  1IN5 A;  1XB4 A;  2UUZ A;  1HOM A;  2CJJ A;  2FE3 A;  1VQL I;  4ANJ A;  2ZC2 A;  2R7T A;  2EZK A;  2L9V A;  2H8R A;  3QWL A;  5FRM A;  1EH7 A;  4IKF A;  3KX2 A;  3S3O A;  4KYW A;  3ESW B;  2P6S A;  3RDI A;  4YFK F;  4LIT A;  2XRO A;  2YX4 A;  4BKX A;  2VKD A;  3OYB A;  2QYO A;  4HF1 A;  2K9Q A;  2JTV A;  2E1O A;  3LWF A;  3CO6 C;  2HDC A;  3H36 A;  4WXH A;  2QLZ A;  4D7N A;  2PJR B;  2BXY A;  4PJM A;  1ETY A;  3H3U A;  3BTL A;  4JX6 A;  2B7E A;  1QZZ A;  3CJQ B;  3HRT A;  1QBJ A;  2ZNZ A;  1D0Y A;  4BY7 J;  2R7V A;  3J7A O;  1W0T A;  1MSE C;  1P92 A;  5HNF A;  5D5X B;  4M9S A;  3CCL I;  2CV1 A;  4JYK A;  1WVR A;  2FA5 A;  4XSX F;  2Z2S B;  4WCG A;  3EQL F;  2HFH A;  2QSF X;  1Z77 A;  2JJ7 A;  2Q1Z B;  2TCT A;  4EJO A;  4RB1 A;  1TQI A;  2OZ6 A;  4B43 A;  4MHG A;  2VE8 A;  4H4K C;  1RPW A;  2WAE A;  4KN4 X;  2F5V A;  1A31 A;  2P6T A;  3LQQ A;  1T33 A;  1JTX A;  4RDU A;  2P0W A;  3BJO A;  2CV2 A;  4LLN A;  1QU3 A;  4ENN A;  2M7B A;  3QYB A;  1NK3 P;  4CZZ A;  4QSH A;  5E3L A;  3WTW C;  4GRI A;  3O6B B;  3FMQ A;  4EJT A;  1BJZ A;  3DTI A;  3KP6 A;  4KA4 A;  2BY0 A;  4QPO A;  1U6G A;  3PM1 A;  3M7G A;  1T0F A;  2X4H A;  4JX5 A;  2JN6 A;  4PSX A;  2DPU A;  2JUC A;  4XKV A;  3VSK A;  4V2F A;  1TLH B;  2LY1 A;  1W0U A;  2XRN A;  3FKJ A;  4A3K J;  4EMS A;  2JT1 A;  3HSE A;  3EPZ A;  3VDX A;  4IOA F;  5M3M J;  1T08 B;  3DPT A;  4FE7 A;  2Z1D A;  3K69 A;  2W84 A;  3GW2 A;  1ZRF A;  1OR7 A;  1W7P A;  2O7O A;  5JHU A;  1JT0 A;  3LSG A;  2ADU A;  2RQQ A;  2R7O A;  2K9S A;  5TJJ A;  3I4M J;  4C2U A;  4OIQ F;  1VQN I;  4FTH A;  4E7K A;  2RKH A;  3WTX C;  3HL2 A;  3DKW A;  3W6J B;  2ECC A;  5J8C A;  4PGH A;  3OYM A;  2AS5 F;  4FET A;  3NEU A;  3K2A A;  1LEB A;  2IS6 A;  1QHG A;  3HOY J;  1LDJ A;  1G3Y A;  3MZY A;  5BPI A;  3DLL F;  2V1N A;  4GXO A;  4BE1 A;  1IN6 A;  2FML A;  2HOA A;  1BIB A;  3AL0 C;  3DQV C;  4E7L A;  3K2Z A;  2L02 A;  2CGP A;  2WC2 A;  4PSW A;  2PJP A;  1YJN I;  4ZYD A;  1BL0 A;  4XK4 A;  4XIC A;  1EH8 A;  2CQQ A;  4ZDL A;  4A12 A;  2DK8 A;  3K70 C;  4XID A;  5IYB J;  2DCE A;  4EM0 B;  1SD7 A;  1K79 A;  4O6J A;  4P96 A;  1YS6 A;  2VKE A;  5KHD A;  4ZH4 F;  4S04 A;  1D5V A;  1XX5 A;  1MNE A;  4MGR A;  5BOX A;  3HPG A;  3J80 Z;  3FHZ A;  2M87 A;  2V4J C;  1FYL A;  1EV7 A;  3L09 A;  1BM9 A;  2G7U A;  1R22 A;  2HEO A;  3MD2 A;  5GAG J;  2FJ1 A;  3ZQQ A;  2ICW G;  2AHQ A;  5FRO A;  4ENM A;  3FX3 A;  5ICG A;  4XOP A;  3A1Y A;  3VOD A;  1WJF A;  3FM5 A;  4EVI A;  4CH7 A;  1FPQ A;  4MTD A;  2R5Z B;  2IEK A;  4BBS J;  3BRO A;  1SD5 A;  1B8I A;  2K4J A;  2XF6 A;  4NNJ A;  1IDZ A;  3K9T A;  2CYY A;  1OKR A;  2LLK A;  3H3Z A;  2JA6 J;  3VEP A;  2NVX J;  3UNG C;  2CFX A;  2DAO A;  1JJ8 C;  4FQG A;  4J01 A;  2VQG A;  4ASN A;  4IHV A;  1RES A;  4I02 A;  4L5E A;  2Y0S N;  4HAM A;  4XRS A;  1SFE A;  3BG6 A;  1N75 A;  5D5U B;  1X19 A;  1MND A;  3BDD A;  4I6Z A;  4BU2 A;  4CCL A;  4CO8 A;  1D1B A;  3AG1 H;  1XSV A;  2WAQ N;  3RPU A;  4S0H B;  1LUJ B;  2L0K A;  3GBG A;  3E3V A;  4XRF A;  1K78 B;  2LVS A;  1C0W A;  4ENK A;  1WJA A;  4F3Q A;  4L9N A;  3A02 A;  4CCK A;  2F5C A;  2XAQ A;  2LD5 A;  1TNT A;  4DYR A;  1VQ7 I;  2QBY B;  2UXX A;  4EJV A;  2DA6 A;  3OIQ A;  2KT0 A;  2W00 A;  2WWY A;  4PGG A;  1PP7 U;  2DOA A;  2K85 A;  5K5O A;  2PLY A;  1T98 A;  3NWT A;  3TGN A;  3CUQ A;  3FF5 A;  3S32 A;  4HF2 A;  2MLG A;  5LRR A;  2P81 A;  3REO A;  3JRH A;  3K0L A;  4UXN A;  1DP3 A;  2Z9O A;  4ZZL A;  5K7Z A;  1R36 A;  4BY1 J;  3Q0U A;  1WH7 A;  3HZJ A;  5LBQ A;  1MMA A;  3HTS B;  3S1M J;  2LH9 A;  4ETS A;  3A0B C;  3TQN A;  3ZQ7 A;  2BY3 A;  3RKX A;  2L9N A;  4Q48 A;  2ZME B;  3GTP J;  3I53 A;  4Q4Z F;  4PFO A;  4EM1 A;  3K4M A;  5H6R A;  4BHB A;  4WK8 F;  1RUO A;  2RRE A;  4II3 A;  3WU2 C;  1LB2 A;  2JMW A;  4IRH A;  3QPS A;  3K10 A;  1TTY A;  3LFK A;  3ABU A;  4IQJ A;  3LSI A;  4IZZ A;  5DM6 F;  4HST A;  2X1D A;  3HKZ N;  3ABK H;  3OR1 C;  3BG3 A;  5LEJ A;  1OQY A;  5K7H A;  2EB7 A;  4Y52 J;  5H20 A;  1H9G A;  3LQR A;  1DGW Y;  2ZB9 A;  2IW5 A;  2YS9 A;  2QEN A;  2XAH A;  1IUY A;  4GYG A;  1Z91 A;  3MKW B;  1T95 A;  3NWS A;  3ISP A;  2ME6 A;  1SVL A;  1YG2 A;  3VYT B;  5FLV A;  2XDV A;  3QYF A;  1MBH A;  1QO0 D;  4MLO A;  5HS9 A;  2P7C B;  2ME0 A;  4M3G A;  3C3W A;  3GTL J;  1V4R A;  5E17 F;  2FD5 A;  3ZOB A;  1SVO A;  2DTR A;  5K5R A;  1R9T J;  2YPR A;  2ELJ A;  3CO7 C;  5GAD J;  3WU1 B;  4BDZ A;  2V1U A;  2EV0 A;  1LEA A;  2YU3 A;  1FSE A;  1ZLK A; 
#chains in the Genus database with same CATH homology
 5F0H A;  3SJM A;  5FKK A;  1BW5 A;  2R0Q C;  1MNM C;  3WHC A;  5DS9 A;  4FCY A;  4A3L J;  3SFI A;  1GUU A;  3ZQL A;  1AU7 A;  3GTM J;  2R92 J;  1VF9 A;  5F0F A;  1JKQ C;  3BT9 A;  4AC0 A;  4A69 C;  2M34 A;  2R5Z A;  4DW6 A;  4M3D A;  3ZQC A;  1JJ6 C;  1GDT A;  5EF6 A;  1YRN A;  3BTC A;  4I76 A;  1A5J A;  1SAN A;  4ABZ A;  1IV6 A;  5IPA A;  1DU0 A;  1LE8 A;  3DEW A;  2JWT A;  1APL C;  2E2H J;  3SDG A;  1YRN B;  4XRS G;  3JRA A;  3RQI A;  4J19 A;  1I3Q J;  2HOS A;  4A3C J;  3LSJ A;  1Q1V A;  3VPR A;  1JGG A;  2O8K A;  1LE8 B;  3ZQF A;  3JRD A;  3HDD A;  1JKP C;  4LOC A;  2NOG A;  3MN2 A;  2K9N A;  1G2H A;  1OJL A;  3BQZ A;  1WH5 A;  4DYQ A;  2W48 A;  1X2M A;  3HEF A;  1Y1V J;  2AO9 A;  3IV5 A;  4MO7 A;  3G1M A;  2MSY A;  5F27 A;  1TWG J;  2ELK A;  5M3F J;  2DTZ A;  3ZQG A;  2B63 J;  3E7L A;  4IHY A;  1TWF J;  2JA5 J;  3S1Q J;  3FK7 A;  3TW7 A;  2L7F P;  2XB5 A;  4C3J J;  3C2B A;  2I10 A;  1JUP A;  3S16 J;  4C3H J;  2QCO A;  3IH2 A;  2HQ5 A;  2NS7 A;  4BBR J;  2DMN A;  4JX4 A;  1ZQ3 P;  3FIW A;  2FX0 A;  3LNQ A;  3OSF A;  2DMU A;  3H0G J;  2CUF A;  3S15 J;  2L7M P;  3LSR A;  3IH4 A;  1WI3 A;  2L7Z A;  4MFE A;  3CQZ J;  2GBY A;  3QPL A;  1OCT C;  3HM5 A;  2XB0 X;  2XGC A;  3TW6 A;  1UHS A;  1D5Y A;  5FJ8 J;  5EEA A;  5C3E J;  1Y1W J;  1JTY A;  5GPA A;  2YUS A;  2Y9Z A;  1NTC A;  2LK2 A;  4D7M A;  3JR9 A;  3S17 J;  5IOY A;  1JUS A;  2COB A;  5J1U A;  3RZO J;  1VND A;  2HXO A;  1FJL A;  4A3D J;  5IYD J;  1XG1 A;  1HLV A;  2DA1 A;  5F0C A;  1IUF A;  1QRY A;  3FK6 A;  2HI3 A;  3F0C A;  3S1N J;  2XPV A;  4V2G A;  2XPU A;  4D5C A;  3HGG A;  3BG5 A;  4DZP A;  3JRF A;  2EZH A;  1ENH A;  5FKM A;  4A3B J;  2KDZ A;  1JKR C;  3FIS A;  4DYC A;  1U9N A;  2L9R A;  3A01 B;  3BG9 A;  1OCP A;  2LKX A;  1GV5 A;  4M3E A;  4A3G J;  2JA8 J;  1T56 A;  2LR8 A;  3B6C A;  3GTJ J;  4D5F A;  5EG0 B;  3OIO A;  2E19 A;  2EQR A;  1IJW C;  3I4N J;  2RAE A;  1FIA A;  4CYC B;  2FQ4 A;  2NS8 A;  1MBG A;  2DMT A;  3MKL A;  2ECB A;  3HOZ J;  2JA7 J;  1X58 A;  2QF7 A;  3L1P A;  2VPR A;  3NAU A;  2Y31 A;  5J1R A;  3S2D J;  3S14 J;  2CUE A;  3G1L A;  4MIM A;  4A3E J;  1IGN A;  1JUM A;  5M5Y J;  2ID6 A;  1LFU P;  2DN0 A;  4NDL A;  5F08 A;  3BQY A;  1HDP A;  1ETX A;  3S2H J;  4X6A J;  3BR2 A;  1TWA J;  3HOW J;  2M9H A;  3HOX J;  1A6I A;  1I50 J;  1MBK A;  2O9L A;  1RR7 A;  3QQA A;  5EZH A;  3WHB A;  2MG4 A;  4A3I J;  2X48 A;  3B6A A;  1HOM A;  2CJJ A;  4FE4 A;  1O4X A;  1ZR4 A;  2EZK A;  1ETW A;  2H8R A;  2IBD A;  5EDN A;  1U8B A;  2NVQ J;  4UUT A;  5BNG A;  4B4C A;  2EBI A;  3HOV J;  2WB1 N;  2Y9Y A;  4BKX A;  1U78 A;  1NK2 P;  1XS9 A;  1GV2 A;  2K9Q A;  2VUM J;  2E1O A;  2VKV A;  1UMQ A;  3PO2 J;  1ZR2 A;  2NVT J;  4W97 A;  4D7N A;  4IEJ A;  2Y30 A;  3Q0W A;  4HNV A;  2K40 A;  1H89 C;  1ETY A;  3BTL A;  4JX6 A;  1B8I B;  5IP7 J;  3Q0V A;  3D1N I;  3NAR A;  2R93 J;  4BY7 J;  1W0T A;  1MSE C;  3GTO J;  3K7A J;  4JYK A;  2LY9 A;  1X2N A;  2XPW A;  2JK3 A;  2DJN A;  2XGD A;  1Z77 A;  2JJ7 A;  2TCT A;  2MW8 A;  3TP3 A;  2E2J J;  3S1R J;  1K61 A;  3O8G A;  1RPW A;  1FTZ A;  3UKG A;  1T33 A;  1H8A C;  4A3F J;  1JTX A;  4RDU A;  3M3Y J;  1IDY A;  5IOZ A;  1NK3 P;  1FIP A;  4QSH A;  1ETO A;  2X9D A;  2N8G A;  2DA4 A;  5E3L A;  4QIW N;  4XRM A;  1BJZ A;  1HF0 A;  3PM1 A;  3TP0 A;  4JX5 A;  4B3A A;  2JN6 A;  2CRG A;  4V2F A;  3HOU J;  2IAI A;  1W0U A;  4A3K J;  1F36 A;  1UG2 A;  5M3M J;  1F43 A;  2EZL A;  5C4X J;  4FE7 A;  4QTR A;  3A01 A;  1H88 C;  5IP6 A;  1WPK A;  1MH3 A;  4C2M J;  3BR0 A;  1WCM J;  3BTI A;  3OOU A;  2MGQ A;  2O7O A;  5EG0 A;  1IRZ A;  1JT0 A;  3LSG A;  1OFC X;  2HDD A;  1ZKG A;  2K9S A;  3I4M J;  4CYC A;  1VFC A;  4FTH A;  2HOT A;  1RET A;  4JP0 A;  2ECC A;  3ZQH A;  3CDL A;  4W1U A;  3DCF A;  2WV1 A;  3K2A A;  1BW6 A;  4M3B A;  3CCY A;  2VI6 A;  3M4O J;  3HOY J;  5GP9 A;  5DTD A;  1QVU A;  2M2E A;  5JLW A;  2GM4 A;  2XGE A;  2HOA A;  1ORK A;  5E3O A;  3OSG A;  5FLM J;  1MBJ A;  3JRE A;  1E3O C;  1BL0 A;  4XK4 A;  5M5X J;  4XIC A;  2R7Z J;  1I6H J;  2CQQ A;  3LSP A;  1DU6 A;  1RKT A;  3RZD J;  4A3M J;  5J1Y A;  4XID A;  2LFB A;  5IYB J;  1PUF B;  2TRT A;  1AKH B;  2G0E A;  1B72 B;  2E2I J;  3GTQ J;  5M5W J;  2EZI A;  1JT6 A;  2NVY J;  4BXX J;  2VKE A;  1P7J A;  4EEF G;  2LP0 A;  2DMP A;  2ID3 A;  2GLO A;  3RKQ A;  2DA7 A;  3IH3 A;  5C4J J;  1IG7 A;  1MBF A;  1ETQ A;  3H3V K;  4A93 J;  2FJ1 A;  2OF7 A;  1TC3 C;  1MBE A;  2LTP A;  2AHQ A;  1JKO C;  1TWC J;  5EYR A;  2D5V A;  4M3F A;  3TED A;  2M8G X;  5HOD A;  5E3M A;  3CMY A;  1POG A;  2X6O A;  2R5Z B;  3MVP A;  1IC8 A;  2IEK A;  4BBS J;  2CU7 A;  1XC5 A;  3HB9 A;  1B8I A;  2DA3 A;  1IDZ A;  2HXI A;  3HGY A;  2LLK A;  2JA6 J;  5E3N A;  2NVX J;  2R5Y A;  2XRL A;  1JJ8 C;  5FKO A;  3Q3S A;  1Z0X A;  4IHV A;  1RES A;  2YU9 J;  4L5E A;  3ZQI A;  2R5Y B;  2Y0S N;  4XRS A;  9ANT A;  1CQT A;  1HDD C;  3JRB A;  4I6Z A;  4DZJ A;  2H1K A;  2WAQ N;  4S0H B;  3BTJ A;  4M6V A;  2L0K A;  1ZK8 A;  3JRG A;  3G1O A;  1BA5 A;  3GBG A;  1HCR A;  3O8H A;  2LVS A;  3JRC A;  2DA5 A;  3A02 A;  1U9O A;  5F04 A;  1MH4 A;  5EZG A;  1AHD P;  2LD5 A;  4DYR A;  1QVT A;  4X1E A;  4UUS A;  2DA6 A;  3LOC A;  4A3J J;  1MSF C;  2KT0 A;  1TWH J;  3BR3 A;  4UUS B;  1ITY A;  1ETK A;  5J3L A;  2P81 A;  3JRH A;  3W6V A;  3BR1 A;  4AUX A;  2EH3 A;  5K7Z A;  1EF4 A;  4BY1 J;  4C3I J;  3Q0U A;  1WH7 A;  4RBO A;  2HYJ A;  3S1M J;  5IP9 J;  2DMQ A;  3GTP J;  3GTG J;  3BR5 A;  4MFD A;  2OPT A;  5FKL A;  1ETV A;  1VI0 A;  2JMW A;  3QPS A;  4AYB N;  1QPI A;  4G12 A;  1SFO J;  5K7F A;  3BR6 A;  3HBL A;  3HKZ N;  4Y7N J;  3BG3 A;  5JLX A;  4GFB A;  2XSD C;  3PO3 J;  5K7H A;  4Y52 J;  4B1R A;  2Y2Z A;  1GVD A;  5EGO A;  2YS9 A;  2ZB9 A;  2DA2 A;  3A03 A;  1RKW A;  4FIS A;  3FKI J;  2ME6 A;  1GT0 C;  5EGO B;  5FLV A;  3GTK J;  2CQX A;  2M0C A;  1MBH A;  4IHW A;  5F1J A;  4MLO A;  5IYC J;  2ME0 A;  4M3G A;  5FKN A;  1PUF A;  1AKH A;  1B72 A;  3GTL J;  1P7I A;  4IHX A;  1FEX A;  1LFB A;  1K83 J;  1FTT A;  2FD5 A;  3ZOB A;  1R9T J;  1ZGW A;  5C44 J;  1ZTR A;  3JRI A;  5GPC A;  1S7E A;  1WGX A;  2PMZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...