3NAUA

Crystal structure of zhx2 hd2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
KTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Zinc fingers and homeoboxes protein 2
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3nauA00
4XICA 1RKTA 4J19A 4I6ZA 5DTDA 2IAIA 3BR2A 1TWHJ 5J1YA 5F27A 4GFBA 2R5ZA 1Y1WJ 2XPVA 3JR9A 1RESA 2R5YA 1ETWA 2HXIA 5FKNA 4M3GA 3S1RJ 1P7JA 2LKXA 3HOWJ 2M9HA 2LTPA 2OF7A 3CDLA 1HDDC 2H1KA 2XB0X 1WGXA 3BR0A 1FTZA 1VFCA 2FQ4A 1F36A 2M34A 5K7ZA 4XK4A 2CQQA 2QF7A 3BG5A 4FISA 3JRIA 5C4JJ 4A3DJ 1QVUA 3CQZJ 1QVTA 2B63J 3IH3A 3HEFA 4CYCB 2ME0A 5M3FJ 1MSEC 1PUFA 3K2AA 1WH7A 1A6IA 1D5YA 4ABZA 4X6AJ 1JTXA 3FK6A 3HB9A 3OSGA 3OIOA 4DYQA 4IHWA 5IP6A 5HODA 3W6VA 3LSRA 4MIMA 2FJ1A 3WHCA 2M8GX 3OOUA 5K7HA 3JRCA 2JA8J 3PM1A 2VI6A 4B4CA 1I6HJ 3BQYA 2HYJA 3GBGA 5GP9A 3DCFA 1X58A 1ENHA 5IPAA 1QRYA 2JN6A 2YUSA 3S1NJ 2LD5A 1ZKGA 1JT6A 2NS8A 3BQZA 4A93J 3GTJJ 2FD5A 3O8HA 2X48A 4DYRA 2E2IJ 5F08A 3HM5A 4AUXA 1W0TA 2EZKA 3K7AJ 3SJMA 1H8AC 3M3YJ 2R0QC 1NK2P 4BKXA 1O4XA 4M3EA 4DZJA 1QPIA 2GBYA 2L7FP 3Q0UA 2NVXJ 4JX4A 3BG9A 4D7MA 3D1NI 5F04A 1MH4A 2R93J 2K40A 1JGGA 5JLWA 2R7ZJ 1W0UA 1DU0A 5F0HA 2LK2A 2XGCA 1UG2A 3BR1A 3S16J 4JYKA 2DMQA 1FTTA 2DN0A 4I76A 2LY9A 1BA5A 1OCTC 2DMPA 4D5FA 3BR3A 3F0CA 1ETKA 2Y2ZA 3TP3A 3I4NJ 4JX5A 5BNGA 2ZB9A 1R9TJ 2NVQJ 3PO3J 3G1LA 3S2DJ 1SANA 4MO7A 2Y31A 4CYCA 5IYDJ 1IGNA 2KT0A 1LE8A 1IUFA 1MNMC 1WPKA 4V2FA 2ECCA 4UUSB 1MBFA 2DA6A 5E3MA 1VF9A 3O8GA 2K9QA 1MBEA 5K7FA 2CQXA 1FIPA 1ETYA 5EEAA 2MSYA 2DA5A 2M2EA 3NARA 4XRMA 4DW6A 2DMTA 1GV2A 1U9OA 3QQAA 5M5XJ 3LOCA 1VI0A 5FJ8J 1OCPA 1RETA 3MVPA 1NTCA 1K61A 3HOZJ 2YS9A 4FE7A 4C3IJ 5FLMJ 5J1RA 2HI3A 3GTGJ 3Q3SA 2JK3A 1GT0C 4FE4A 1MBHA 3I4MJ 3ZQIA 1JKRC 4A3FJ 3A02A 5EGOA 1X2NA 5DS9A 2EH3A 1YRNA 2HXOA 3L1PA 3S15J 4IHXA 4JP0A 1ZK8A 1WI3A 3RZOJ 2NVTJ 4M3DA 4RDUA 4EEFG 2VKEA 1G2HA 1OFCX 3ZQFA 2ID3A 3ZOBA 1HDPA 3ZQCA 2P81A 4UUSA 5EZGA 5J1UA 3WHBA 1IC8A 3UKGA 5C4XJ 3JRFA 1POGA 4B3AA 5M5YJ 1ZR2A 1FIAA 2LLKA 1B72A 1JKQC 2O9LA 1XG1A 1ETVA 2Y30A 2EZIA 2MGQA 3SFIA 2K9NA 1A5JA 1Q1VA 3PO2J 2WB1N 4A3KJ 2L7MP 3HOXJ 1Y1VJ 3H0GJ 2K9SA 1DU6A 4W97A 2H8RA 2YU9J 4A3LJ 2E2JJ 2R5ZB 2HQ5A 1LE8B 2JMWA 2R5YB 2VUMJ 3C2BA 3JREA 2DTZA 2O7OA 5E3NA 3OSFA 4D5CA 4B1RA 2VKVA 5IOZA 2G0EA 4X1EA 4A3IJ 3JRBA 2ID6A 4AYBN 1X2MA 2LVSA 2RAEA 4NDLA 2AO9A 2DA7A 3DEWA 2AHQA 4AC0A 4D7NA 3RKQA 5E3OA 4QTRA 2WAQN 2E1OA 3G1MA 1FJLA 4IEJA 1JTYA 1BJZA 2QCOA 5EG0B 1UHSA 1TC3C 1I3QJ 2VPRA 3Q0VA 2Y9ZA 5EGOB 1JUMA 3RQIA 4C3JJ 5IP9J 1IV6A 3HOYJ 2R92J 1GVDA 1HLVA 1ZR4A 2CRGA 1ZQ3P 4M6VA 2NS7A 1APLC 3ZQGA 2I10A 1HCRA 2FX0A 4M3BA 4RBOA 3TEDA 1GDTA 4A3JJ 4Y52J 4BY1J 2DMNA 2JA7J 1CQTA 1VNDA 4XRSA 5C44J 3GTLJ 1MH3A 3BT9A 2KDZA 5E3LA 3JRDA 4JX6A 1LFUP 4C3HJ 1IDYA 4UUTA 3HOUJ 1IJWC 2JA6J 2D5VA 5EYRA 3FK7A 3CCYA 3IH4A 3MN2A 1B8IA 2Y9YA 3A01B 4Y7NJ 2X9DA 4G12A 1JJ6C 4FCYA 3ZQLA 5EG0A 5IYCJ 5M5WJ 1T56A 3G1OA 1MBJA 4XIDA 1MBKA 3GTQJ 2EZLA 4A3CJ 2E19A 1BL0A 1IG7A 2NVYJ 4BBRJ 1IDZA 3E7LA 3LSPA 4BBSJ 1ITYA 1BW5A 3BTJA 1ORKA 4LOCA 2M0CA 3CMYA 2XGEA 1JUSA 1IRZA 1PUFB 2WV1A 3FIWA 2EQRA 4XRSG 4V2GA 3S17J 4FTHA 2E2HJ 1BW6A 1FEXA 1ZTRA 4QSHA 2XGDA 3ZQHA 1E3OC 2GM4A 3GTKJ 5FKLA 2HOSA 4A69C 2L9RA 1OJLA 2CUFA 3BTCA 1LFBA 4DZPA 4IHVA 2IBDA 4A3GJ 2NOGA 5F0CA 1JT0A 2L7ZA 3BTIA 2DA1A 2PMZN 4MFEA 1XS9A 2JA5J 1H88C 2LR8A 1AHDP 1P7IA 3BG3A 1RR7A 5EDNA 4DYCA 2XPUA 2COBA 2GLOA 3HBLA 1HOMA 5C3EJ 3JRGA 4IHYA 3A01A 2ELKA 3GTOJ 3IH2A 2ECBA 2CUEA 3Q0WA 4QIWN 5F1JA 1H89C 1F43A 1TWFJ 1TWCJ 4HNVA 2X6OA 1RPWA 3A03A 3GTPJ 1UMQA 4A3EJ 3LSGA 1ETQA 3VPRA 2DJNA 3BTLA 3B6AA 3GTMJ 3S1MJ 2W48A 1U9NA 2EZHA 1HF0A 1AU7A 2XB5A 5GPAA 1JJ8C 4L5EA 3IV5A 5IYBJ 1GV5A 3S14J 5FLVA 3B6CA 5F0FA 4A3BJ 3TP0A 1GUUA 4W1UA 2XPWA 5EZHA 2MG4A 4C2MJ 2XSDC 5FKOA 1K83J 2CU7A 3RZDJ 2LP0A 3HDDA 2EBIA 2XRLA 2HOTA 1NK3P 3TW7A 3BR6A 1AKHB 2JWTA 3HGYA 1U8BA 3HKZN 2DA3A 3S2HJ 2HDDA 1Z77A 5M3MJ 4BXXJ 1MSFC 2MW8A 1MBGA 3LSJA 5IOYA 1Z0XA 2N8GA 4MLOA 1JKPC 1JKOC 4MFDA 3JRHA 5J3LA 2OPTA 2TCTA 2DA2A 4A3MJ 1TWAJ 5IP7J 5GPCA 3S1QJ 3HOVJ 2JJ7A 1TWGJ 1U78A 3BR5A 1I50J 1JUPA 4M3FA 9ANTA 2L0KA 5FKMA 3SDGA 4BY7J 3LNQA 1EF4A 3H3VK 2ME6A 2LFBA 3FKIJ 2O8KA 1XC5A 1ETXA 2Y0SN 3M4OJ 1T33A 1SFOJ 3MKLA 3QPSA 5JLXA 1S7EA 4S0HB 1ZGWA 2TRTA 3NAUA 1WCMJ 2DA4A 3HGGA 3FISA 1B8IB 1WH5A 5FKKA 3TW6A 2DMUA 1ETOA 1RKWA 3JRAA 2CJJA 2IEKA 1YRNB 3QPLA 5EF6A 1AKHA 2HOAA 1B72B
chains in the Genus database with same CATH superfamily
2JRMA 3VSKA 1XSVA 2IS1A 1RKTA 4ZJZA 3OYCA 2IAIA 2BW3A 3BR2A 5HS7A 2D45A 1KA8A 5J1YA 2R5ZA 4MNUA 1Z1DA 1I39A 2ZMEC 4CCJA 5IY5H 2DFIA 2GA2A 4UB8C 2WAFA 5CVUA 2HTSA 4L9NA 2LKXA 1SD7A 2OF7A 5ILUA 2HVSA 3BZCA 1LDJA 3BR0A 1WGXA 2GWRA 4LG3A 1VFCA 1IO2A 2WAEA 4Q48A 2E34A 1G8XA 3ABMH 3F6VA 4BH9A 4BQQA 2B63J 3SYTA 3ZRGA 2PLYA 2XAFA 3HEFA 5BPDA 1FWZA 3F72A 6PAXA 3HTUA 1WH7A 2ZJRF 1P4XA 2DXIA 1LEAA 2IS6A 3FK6A 4ESJA 2PN6A 3BZ6A 3I54A 1WJEA 2V9PA 4XNFA 5J4YA 2RNJA 2MA3A 4EV0A 2J5OA 5IP6A 4S05A 3JAMZ 3W6VA 1YO5C 5LEJA 4II2A 4MIMA 4S04A 4IHTA 3WHCA 5TGTA 2K7LA 1YLFA 1U5TC 4FHTA 1WZ2A 4EMSA 3JRCA 4XKCA 2JA8J 2VOPA 3KLOA 2HYJA 2UXXA 3BLYA 1MD0A 3GBGA 3QPHA 2DU9A 4IQJA 2XRNA 3KE2A 3HHGA 2L9SA 1VQNI 5DCMA 1R36A 2LD5A 4CA0A 3OYGA 2H27A 2DOAA 3GTJJ 2LKPA 4MQVA 3O8HA 2QBYA 1TW3A 4GCVA 3GO5A 4DYRA 3EUKL 3CCMI 2JZYA 4AUXA 5H20A 2FBHA 3KEQA 1FOKA 2PG4A 1BN5A 1H8AC 3AG2H 3H9GA 4XL9A 4BKXA 1O4XA 4OIOF 4M3EA 2EINH 4LD5A 1QPIA 3K1NA 1DPRA 1U5TB 4BGDA 3K9TA 3OYKA 2OCCH 1J5YA 5FFXA 2HZDA 3ABKH 3H35A 3KZZA 4HYEA 1WSUA 1MMSA 4BXFA 4Q4ZF 2XGCA 1UG2A 4JYKA 1R6RA 4KN4X 1R7JA 3FXJA 2GQQA 2BEOA 1XGMA 2ZB9A 3G6EI 2LYCA 2V1DA 3GLLA 5HLGA 2PX9A 2ZJ2A 2KDOA 4A6EA 1IGNA 2RQQA 2ZKZA 5HOOA 3CJRB 1IUFA 2R7XA 3GFMA 2ECCA 1UHMA 1TQPA 1VQPI 1F5TA 3KYLA 1ZH5A 1R5ID 3CUOA 2K9QA 3BDDA 3O8GA 2FUG2 2PMZA 3P9IA 3V7SA 2DOFA 3OOPA 5K7FA 1R23A 5F6FA 3DKXA 1O3QA 3ZMVA 1FBQA 4HDUA 5CVIA 5E79C 4KFCA 2KIFA 2DMTA 5ILVA 1S6LA 4F3QA 5M5XJ 1JGSA 2VKHA 3C2GA 3LOCA 1VQ5I 1D8KA 2KJCA 3MVPA 1NTCA 4WK8F 3HOZJ 4YIFA 2R7WA 4FE7A 4C3IJ 2HI3A 3ZQ7A 3PL8A 3V8LA 2C6YA 1R1TA 1Z21A 2J5PA 1R49A 2BW3B 2QZ8A 2KMUA 5DS9A 4BJ5C 2GA1A 1YRNA 2LF7A 3VYSB 3U1KA 3S15J 4K2EA 1EJ9A 1ZK8A 1FSEA 2VKDA 3IC7A 3RZOJ 2QBYB 1X3ZB 4M9ZA 3WU1B 1I5ZA 4YEJA 3IAS2 5TRDA 1ZRCA 2HDCA 2F5DA 3OY9A 3DPTA 3ABUA 4U0VA 1XSDA 4DGWB 1AWCA 1YFHA 5J1UA 3WHBA 3HKZA 2PJRB 2ZCWA 2MD5A 4CO8A 3W2VA 1ZGJA 1FIAA 4RB0A 4XLAA 3S8PA 1ERDA 2AXTC 2RVCA 3BJAA 4NC6A 2Y30A 2EZIA 4BQNA 2GIVA 1QQIA 3SFIA 1T38A 4HZFA 1LKXA 4HV6A 1Q1VA 1ZELA 2LKSA 2KHMA 2WB1N 4RGUA 3CCSI 3JSPA 2OZ6A 5E17F 1RI7A 3TDUC 4ZTFA 3GFLA 4W97A 5HLHA 4CDGA 2YU9J 4A3LJ 2DBBA 5AIQA 2HQ5A 1SAUA 5LLQA 1LB2A 2O7OA 4U7BA 3OSFA 4D5CA 2X6YA 2VKVA 2VLAA 3DBLB 4XLNF 1DQUA 3F21A 4ENKA 3K4BA 3JRBA 1X4PA 3BZKA 3OS0A 1E17A 4D7NA 1L0OC 3OS1A 3RKQA 2AHQA 2F5CA 2R7FA 3UR3C 2A6TA 4MGRA 5J47A 2VBZA 1G6NA 5E1ZB 3G1MA 3VFZA 2ZSIB 2M0MA 2K3FA 1ZREA 3HPGA 3QP6A 2L7KA 1TC3C 3Q0VA 4P1WA 1J9IA 4AM3A 5BS6A 1D0YA 1I27A 2RQPA 3HOYJ 1IV6A 1B9MA 2Q2EA 4ANJA 3HPHA 3LSMA 3SZGA 4M6VA 2A68F 4LGWA 1TBXA 1ZAOA 2M4GA 3RKWA 3ZQGA 4OMZA 4RBOA 2KIMA 3X2QH 2DMNA 2JA7J 1VNDA 2ELHA 1TQIA 3TGNA 5DD8A 3GTLJ 1YQAA 5IT3A 2KDZA 2FA5A 3MCZA 4IQ4A 4C3HJ 2E71A 3KPHA 1WKMA 3KETA 3HOUJ 1XGOA 2JA6J 2IA0A 1MJAA 2KRHA 4YIRX 3PNYA 2ZC2A 1KQ9A 4NQWB 1FP2A 5DCFA 4P55A 2Y9YA 3D5LA 4B44A 2I8DA 4O5VA 2M8EA 1G3TA 1WRJA 1RNLA 5IYCJ 2EA4A 3G1OA 2Z99A 4ASNA 4AYBA 1MBKA 4R1HA 1XCBA 2E5ZA 4Z6YA 1FC3A 3P9KA 1BL0A 2A5YB 2DT5A 3MMYB 3IWZA 3L2RA 1ITYA 4BU2A 4E7ZA 3CD6I 3BTJA 2R7VA 1BW5A 4RB2C 3E1SA 2OJED 3G4SI 4XLPF 2XGEA 3L7WA 3CC4I 1IRZA 1DGWY 2WV1A 1K6YA 1K78A 2FBKA 1HSTA 3LA3A 4V2GA 2OAZA 4A0XA 1KQ0A 4ITVA 2ZXHA 3CCVI 4G7ZF 3DBHB 2O0YA 3E5XA 2DT7B 2A3SA 3VSLA 4MEXF 2CS3A 2DDAA 1FMVA 2M7BA 1OJLA 4IHVA 2CO5A 2IBDA 5F0CA 3G73A 3M8EA 2FSWA 3IUOA 2VQHA 1LNWA 2LOOA 4MFEA 3U2RA 3N4MA 1AHDP 2PJRA 3BJOA 4UXNA 1P7IA 3JAMK 3IAM2 1RR7A 3BG3A 5EDNA 2QWWA 1UCRA 4DYCA 2XPUA 2Z16A 3D5RC 3HBLA 3WTTC 1VQ7I 3BCAA 1GHCA 3Q0WA 5J8FA 5F1JA 4HW0A 2ADUA 2MLKA 2GOXB 3TOBA 4CYDA 3LA2A 2E1MC 4XSZF 2M7AA 4V19K 2DT6A 4M6YA 1G3SA 3BTLA 3M07A 4B43A 4G94A 4E7SA 3PIPF 3GFIA 5ICCA 2EZHA 2V7FA 3H5NA 4LFUA 5GPAA 4H0EA 1JJ8C 1F1ZA 2Y75A 5D5XB 3FM3A 4I98B 4ESFA 1GV5A 2CSOA 3OMYA 5FLVA 3R6SA 3B6CA 1P6RA 4ESBA 1QGPA 1LDDA 1Y39A 4A3BJ 5EZHA 1BR2A 1V5GA 2MG4A 1M1EB 2F4IA 1YOVB 2LP0A 3DKWA 3DF8A 3HDDA 2CW8A 2HKXA 2JSCA 2RDPA 3SFZA 1PJRA 1AKHB 2JWTA 3ZN1A 3HGYA 2FQ3A 2W25A 2STWA 2VBXA 3GLXA 4BUPA 1U8BA 2RC4A 2VC0A 4L5IA 2LY1A 1WQ2A 5M3MJ 2M1BA 4ZYAA 2MW8A 4ZTJA 1WJFA 2VOOA 3LSJA 5J6XA 2STTA 1Z0XA 2FBIA 2N8GA 4ZDLA 4IO9F 4M6XA 4MLOA 3U9GA 1JKOC 4MFDA 1KU7A 3WU2C 4FQGA 4L0YB 2VT2A 4IKFA 3BG6A 1Z6TA 1U2WA 2EB7A 5CYVA 4KN7X 3PFYA 5GADJ 5IP7J 3HTSB 4EJTA 2R7OA 1FX7A 1MJ9A 2EWNA 5FO5A 3WTVC 1TLHB 3WE2A 1J2XA 2L0KA 3SDGA 1GXQA 1Z6RA 4BY7J 1IXCA 2QQ8A 1TNTA 4RLFA 4D9JA 2BVMA 3H3VK 2LFBA 3VYUB 1XC5A 3VEPA 1ETXA 2Y0SN 2DJIA 3MKLA 5K1YA 3AG3H 1N75A 2HPMA 2Q2EB 1E0EA 3C18A 2GXBA 1S7EA 2E60A 2ZNYA 1X1AA 1Q1HA 2YX7A 3GZ6A 3HGGA 3FISA 4E7KA 1B8IB 3OL3A 3ROUA 2DQLA 3HJEA 2IS2A 5LHHA 1HBXG 1EH6A 2IEKA 1FPQA 3QPLA 1B72B 3VDXA 1YIOA 2DO7A 3KEOA 3VOEA 4XICA 4CHUA 1BI1A 4G7OF 1OYYA 2L4AA 4LLLA 2ESNA 4LB6B 3KZYA 1Y0UA 1RESA 3KP2A 2R5YA 2HXIA 1U0JA 5FKNA 2P4WA 3R4KA 4ON0A 2NYXA 5CKTA 3S1RJ 2IRFG 1P7JA 1S7OA 3HOWJ 2OC6A 1HDDC 3AAFA 2XB0X 4KJZA 2FQ4A 2F4OB 3OS2A 3DFGA 4LG0B 1JXSA 2M34A 5K5RA 3PNVA 2DTRA 5D6FA 1OMIA 2Y69H 1FNNA 2QF7A 2RN7A 3JRIA 4IRIA 4A3DJ 1QZEA 3GW2A 3L2CA 2NS0A 1Y6IA 1D0XA 1PVEA 3KP4A 4LK1F 5J4VA 4IZZA 3IH3A 3CUQA 1A04A 1LJ9A 5FGMA 4PGHA 3K2AA 3JSOA 2QQ9A 1A6IA 3CO7C 2P5LC 1D5YA 1K78B 4M74A 1W4MA 1X1BA 4G9YA 2DW4A 2A6EF 2ZXIA 1JTXA 1TW2A 3FHNA 1K79A 3PSFA 1AA7A 2D2WA 1Z67A 2EFOA 3I0TA 3S32A 2OA4A 1BM9A 5CQGA 3FXLA 3LSRA 3QOPA 4R79A 1S3JA 4U87A 3ECOA 2Y48A 5BQTA 2CUJA 1J7KA 2QSGX 4KT5C 2DCEA 2VI6A 4B4CA 1NG6A 4KMFA 5FRNA 1MGTA 3BQYA 3O2PE 4CUGA 3J81Z 4XLFA 5GP9A 3DCFA 4E4HA 3S2WA 2LH9A 1UAAA 1VQOI 2JN6A 1QU3A 3S1NJ 5F1RA 3KYDB 1ZKGA 4P9FA 3OYFA 4RA2A 2LC2A 4Y17A 4OU0A 3IWFA 3HSRA 3A0BC 4A93J 2FD5A 4PJNA 1VQ9I 3CZ6A 1D1BA 2CW0F 3ASOH 2HWVA 1SAXA 3FBIB 2EZKA 2K27A 3K7AJ 3SJMA 3J7YJ 2LBFB 2E7XA 5L3FA 4RAYA 2GBYA 2KRFA 4JX4A 4QWQA 2COMA 5F04A 1MH4A 4EM1A 1ZHFA 5JLWA 5L3EA 1Y56A 5KNLA 5FLXK 1J59A 2XDVA 5D8LB 2LK2A 1MZBA 2OTJI 3BR1A 1FTTA 2R7QA 4I76A 5D5WB 4D5FA 1TZLA 1ETKA 3V8JA 3TP3A 3RJPA 3DEEA 2P5VA 1D0ZA 1MNDA 2VT3A 1JHFA 3C2HA 4MO7A 1HW2A 5IYDJ 2R7UA 1MNMC 1WPKA 4V2FA 2JSPA 1MBFA 2DA6A 2H8WA 5E3MA 4NHJA 1OISA 3VWBA 3DEUA 3K70D 1NG7A 2QVOA 1FIPA 1ETYA 3P7NA 1YJNI 1X19A 2DK5A 3GFJA 3HRTA 3KYCB 1EKEA 5HLTA 1IW7F 1GV2A 2GOMA 1SMTA 4WXHA 5J8CA 2BHZA 2QEXI 2PI0A 1ZYRF 2CFXA 2D1VA 5DM6F 4L0ZB 3GTGJ 2V26A 3Q3SA 5L3DA 2JK3A 3ERMA 1USSA 1SVLA 3K4LA 3DLLF 3ZQIA 1VTNC 5LHIA 3I4MJ 3WTYC 1PUEE 4KMUX 4L5JA 3SZTA 3CC2I 3AL0B 3NEUA 2EFPA 1X2NA 2CW7A 2EIJH 2HXOA 1DDNA 1AOYA 1KONA 4JP0A 3KEYA 1V55H 1RUOA 4KNYA 2NVTJ 3LWFA 3N05A 2KL4A 3GWZA 4M3DA 3DV8A 2IJLA 1IN7A 4EEFG 4Q47A 2VKEA 2HFHA 1G2HA 2ID3A 1D8JA 3EUHC 5LGTA 1S7AA 1D1AA 4UUSA 3JW4A 1SFKA 4A0YA 3PUBA 5C4XJ 1B6AA 3JRFA 1POGA 2VJJA 4ZYGA 2HQAA 5L3CA 1YI2I 5M5YJ 4Y4RA 4ZYEA 1XB4A 1EA3A 1V5EA 4BJ6C 1B72A 5ED4A 1JKQC 2O9LA 1K6OA 3E6CC 5L3BA 2K9NA 2EFWA 5FFZA 3AL0C 3ZCOA 1A5JA 3F8BA 3L2QA 2Q1ZB 1MNEA 2OZUA 2UZKA 4YELA 3QAHA 2LRDA 2YX4A 3HOXJ 3M1EA 4I7HA 1ONVA 5JVGF 2XASA 4ZYHA 2E2JJ 2V1XA 3W2AA 3LMMA 1GXPA 2Z5UA 2JMWA 4I0BA 1DUXC 1BBYA 1IV8A 5JR3A 3GYHX 1XPXA 3L2UA 2E1CA 4KUMA 4OIRF 2QA4I 5B5EC 3Q5FA 4AYBN 3L2WA 2LVSA 4X0GA 1W5CC 3GCMA 2AO9A 4H4KC 3JTHA 4LMYA 2DODA 3IRRA 5D4RA 1R5HA 5BOXA 2NNNA 3R0JA 1JHHA 4XKBA 3E6BA 4RAGA 2X1DA 3HOTA 4HSRA 1FOYA 5D6EA 4IEJA 1BJZA 3HRUA 3MKYB 3CP2A 1UHSA 3UNGC 1I3QJ 3T5XA 3K10A 4WX9A 3BJ6A 1JUMA 2ZMEA 3LSTA 3RQIA 4C2UA 3FBNB 2DPUA 5IP9J 3ZN0A 3FXMA 1GVDA 5DV5A 3OYJA 4A6DA 1ZQ3P 4AWXB 1APLC 2QKLB 2P8TA 3LQQA 2FX0A 4ZYDA 2H1LA 4M3BA 3CP8A 3TEDA 1W36C 1L3LA 1GDTA 3J7ZI 4HF2A 3KX2A 1YG2A 4XRSA 4EQQA 2QQBA 4B09A 3JRDA 1TQMA 2BXYA 3DU5A 2PFBA 2VQCA 4UUTA 3OYHA 2KISA 2P0WA 2HEOA 1A6QA 2W85A 5EYRA 1P9QC 3OV8A 3CCYA 3IH4A 1F9NA 5H6QA 4E7JA 2XUBA 2HYFA 2QQAA 1E3HA 3NQOA 4LJZF 3A01B 1N78A 1MMNA 2X9DA 4A2UA 3ZQLA 4WXDA 5HNHA 5EG0A 3GTQJ 4XIDA 1MBJA 1W5SA 5CVJA 2FEZA 2JUGA 4A3CJ 4IL6C 1B1BA 1DGRM 3E97A 1N77A 1FBUA 4RAFA 4KA4A 3LSPA 4GO1A 4XKVA 1ORKA 2DFHA 2M0CA 3I71A 1IF1A 2CUZA 3OYLA 1XMAA 4YFNF 3OWTA 1JI8A 2UUZA 1LVAA 3MZ8A 4Y3OA 4XOTA 2E2HJ 1BW6A 3A1YA 1T2KA 2HOEA 5LFAA 3WODF 3L2VA 3A2KA 4KIFA 1X1CA 4BDZA 1OCZH 1Z7UA 1UHWA 4ZZLA 4BHPA 1FSHA 1OCRH 4GXOA 2EJRA 4A69C 3E5UA 3EETA 3ZMUA 4PGGA 2L02A 4N4OB 1JT0A 2DYRH 1YYVA 4NUBA 2DA1A 1X3UA 1XS9A 2L9VA 4XORA 1H88C 1YS6A 4N0BA 2IGNA 3RKXA 5E20A 4NQWA 5HLIA 1K4SA 1SD6A 4HG2A 2QYOA 5EEHA 5C3EJ 3JRGA 5KCMA 3GTOJ 4AVZA 2VJ5A 2QM3A 1IN4A 4DOZA 1H89C 1F43A 4I99C 1R4MB 4PDKA 3SQNA 3I55I 1BJAA 1MJBA 5CVRA 2X6OA 4HX7A 1O7FA 3A03A 4OAZA 1UMQA 4A3EJ 2VC1A 5ICEA 3MFKA 1ZARA 3KCCA 3VPRA 1O3RA 2OUMA 3RYPA 1GLNA 2O8XA 1UB9A 4YG2F 2IGKA 3OR1C 5FROA 4HQEA 4XN3A 3CMAI 4L5EA 1MMGA 2B0LA 2MD0A 5BMZA 4BJTA 2DAOA 2DK8A 3FHZA 2HGCA 3ZMTA 3L9FA 4DQ2A 1YS7A 2O61A 1X1PA 4LLNA 3FM5A 2V1NA 2LF8A 4KIBA 5GAEJ 4BYYA 5KHDA 2WY8Q 2HS5A 2E36A 3LFKA 4L18B 1K83J 2JT1A 5FLXZ 3S3MA 2L2OA 2EBIA 2F5FA 5ILSA 4RB1A 1NK3P 2HOTA 4F92B 5A2QZ 2W00A 2CQKA 2FE3A 3S93A 1PDNC 2DA3A 5LEKA 2Z33A 4BXXJ 1MBGA 2V79A 5IOYA 4ETSA 2PQ8A 2CQ7A 3GZNB 4L9JA 3BY6A 2IT0A 3SZPA 2A5WA 3CJNA 2JTVA 5CQEA 3RIRA 3JRHA 2K5CA 3DKYA 2TCTA 2RKHA 2XAQA 2X6WA 2V1UA 2PMHA 3H3UA 4LIUA 5GPCA 2E7WA 4XLHA 2JJ7A 1TWGJ 1SVMA 3ZPLA 3BR5A 3M7GA 3HOVJ 1I50J 1JUPA 4M3FA 5FKMA 2MBFA 4KYWA 1SVOA 2WC2A 5LGNA 1A31A 3FKIJ 4NC8A 4P96A 3G71I 2PMUA 1QNTA 4PJLA 3QOEA 4AD9A 1YE9A 5JLXA 2PEXA 3IKVA 4CH7A 2TRTA 1BIBA 1WFXA 2I5UA 2DA4A 4MQ9F 4E70A 1DPUA 2LREA 3CUQC 1SFEA 4KIGA 5FKKA 2BY2A 2OBPA 2KQRA 1ON1A 1K7AA 5HS9A 3ELKA 4PFOA 3I56I 5EF6A 1AKHA 3SEQA 4J19A 3CDIA 3T1BA 4I6ZA 4PSWA 5DTDA 1OR7C 4G6TB 3TO7A 2ZBKA 4M71A 3OYBA 5F27A 4GFBA 2CFOA 1J75A 2IA2A 3RPUD 1IAWA 4EJVA 4M3GA 2JRTA 1Z91A 2BY1A 2KFDA 2OU2A 2M9HA 2LTPA 2RREA 3CMMA 3FMRA 2H1KA 2ISZA 2NVUB 1FTZA 1ZRFA 5HVQC 1WI9A 1F36A 2V6EA 5K7ZA 4XK4A 2IGMA 1QZZA 3B02A 3I9V2 2CQQA 2L4MA 2XGXA 4FISA 4BHBA 2QUFA 5D8KB 1QVUA 3J7AY 2W1OA 1QVTA 2QLZA 3HSFA 2CG4A 1MSEC 2ZFWA 1KU2A 2E35A 1R1UA 2RV8A 2XAJA 1REPC 2LBFA 3R0AA 4BEHB 3GXOA 3WTXC 3CMEI 4X6AJ 1O7LA 3JCUC 2FOWA 3OIOA 3F9KA 2EIKH 3W2WA 2JVGA 5HODA 4L9VA 4ZC3A 3ULQB 1FOWA 2RGVA 2FJ1A 2MC3A 5GTHC 2CGPA 2M8GX 3T8RA 4N9IA 2W57A 3OOUA 5K7HA 4U88A 3K6GA 1HSJA 4BE1A 2EV5A 2XF6A 3H36A 3OL4A 4E7LA 1V3FA 3ZMSA 1MIJA 2L5QA 2VXDA 2BXZA 2FOKA 2XF7A 2R7SA 4A5NA 2R7TA 2CYYA 2YUSA 1YW8A 2BV6A 2JPBA 1W5TA 1B4AA 2NS8A 1BR1A 2X48A 1H0MA 2GXAA 2E2IJ 4JK1X 2MYSA 3OYAA 3LL7A 1USTA 4N4NB 1A35A 2JUCA 3TL4X 4LB5A 2XKPA 1T98A 4DZJA 5DEQA 2DLLA 3Q0UA 2NVXJ 4D7MA 1QA6A 2R93J 1YW9A 5H2FC 3OYDA 3WGGA 3ZMDA 1XD7A 1JGGA 2OCEA 4KDPA 2R7ZJ 4YIIA 2JA2A 1DU0A 1X3WB 4MEYF 2V9KA 2DMQA 4LIVA 2DN0A 1IN5A 2LY9A 1BA5A 3MKZA 2QSFX 3WE3A 3I4NJ 4TV7A 5BNGA 1I1GA 3QWLA 1MKMA 2K86A 3BC8A 3MZHA 5FD5A 2CH0A 5DM7F 2NVQJ 1MDMA 1SANA 1QO0D 1XGNA 2RNGA 3ABTA 4CYCA 3WTUC 4ZDPA 4JBAA 1LE8A 3PFIA 4O3MA 4IX7A 3KP7A 1I1SA 3I59B 2MC4A 5KAIC 3F22A 2BOLA 2HPIA 4HAMA 1MBEA 4IXAA 3MAJA 4EJOA 2UWMA 2DA5A 3NARA 3MKWB 4P5OA 1W7PD 3PIOF 3CLQA 4BXUA 4UNOA 5TJJA 1U9OA 3QQAA 4EGYA 5FJ8J 1XDSA 3F3XA 1OCPA 1RETA 3SDBA 1I6XA 5LD2C 2NNYA 5E1WA 1K61A 4PJMA 1BIAA 4FETA 5FLMJ 2P7CB 1OQYA 5B1BH 4D1QA 4C9YA 3KIOA 5JFRA 1U5TA 2R4GA 4FE4A 4A3FJ 4BE0A 3A02A 2OTLI 2H6BA 2WADA 3CCLI 1ULYA 4BE2A 1LEBA 5HDGA 1STZA 2AQEA 2Y0SA 4HQMA 2AQFA 2XIGA 3LQRA 2DQRA 1LQ1A 1BC7C 4WWCA 3DLAA 4I09A 4RDUA 3H1CA 4NNJA 2ESHA 1VQLI 2GZWA 4N9HA 3ZQFA 2YPRA 4OIPF 1HDPA 2VE8A 3BP8A 4Z2YA 1IRGA 1MDMB 1IC8A 2NAZA 3RYRA 4BQOA 4IOAF 1OYIA 1KU3A 2LSOA 1G4DA 1ON2A 1E3PA 4CSWA 4XLEA 1CF7A 1HKTA 3RDIA 2FXAA 1IXRC 3TO6A 4HX4A 4HF0A 2LDUA 3V4GA 2VBWA 3QODA 3PO2J 3CUQB 3CCRI 5K5QA 1OCOH 3O6BB 3I58A 3R61A 4ZH4F 1F4KA 3BWGA 2L7MP 1RIOH 1BI0A 3LSIA 1S72I 3H0GJ 2M45A 1DU6A 3IL2A 1UJ8A 3FDYA 1HXDA 1R5GA 1LE8B 1ZG5A 4OIQF 3A4CA 5HDNA 5E3NA 3ABLH 5IOZA 2OD5A 4X1EA 2AXLA 3LAJA 3V42A 4IJAA 4PJJA 4AU7A 2KZGA 4ENNA 4CCNA 1FZPB 4NDLA 4AC0A 1XMXA 3V8KA 1MMDA 1KYZA 1IN8A 5KK1A 1V4RA 1UELB 3KLNA 2CV0A 2YSRA 3HRMA 1TT5B 5LBQA 2E1OA 4ZDOA 2KKOA 2VQGA 2CV2A 2WAQA 4EM2A 2XHKA 5DYMA 4IPAA 2X85A 2VONA 1JTYA 3F6OA 2QCOA 2FF4A 3M1CA 4LLGF 3IKTA 3WG7H 2Y9ZA 5EGOB 4F91B 4F7ZA 1FYMA 4F52A 1TP4A 3SHFA 2IGOA 2NS7A 2VB6A 4GYIA 2I10A 1R71A 3CJQB 2O5RA 2BY3A 1KYWA 4A3JJ 5HDKA 3L09A 4BY1J 3K4CA 1CQTA 3DTKA 4F55A 4Y33A 4OINF 3COAC 5IT9Z 3W6JB 1LVKA 1WVRA 1MH3A 3BT9A 3RPQA 5E3LA 5HS8A 1X1DA 4M72A 1LFUP 4IRGA 1IDYA 4A12A 3Q9SA 3PSIA 1YHQI 2A61A 2VJIA 3BG7A 1ZLKA 4HNUA 3CCQI 5BPIA 1IZ1A 4WXCA 5DUIA 1HKSA 4MTEA 2EILH 2W82A 5JHFA 3C3WA 4Y7NJ 2FMLA 2VASA 2HQRA 4G12A 4FCYA 3FZVA 3DP7A 3H3ZA 4PZJA 1T56A 2XAGA 4RAZA 4C30A 3LFUA 2Z2SB 1IG7A 2NVYJ 1ZRDA 1QHGA 4BBRJ 2KIQA 3ECHA 2K3PA 3E7LA 1IDZA 4BBSJ 2Q0OA 2A05A 2IP2A 1TNSA 2IPQX 1PP7U 1JUSA 5AIPA 1FBSA 3ML6A 1PUFB 1W7PA 2JPCA 3FIWA 3TDZC 1NH3A 1SFXA 3S17J 4HEA2 2HKOA 3CCEI 4M73A 1Y8QB 1B9NA 2OQGA 4NB5A 2XC7A 1RRJA 1ZTRA 3PQJA 4QSHA 3ZQHA 1P92A 2V9VA 2KIUA 4RGSA 3RKYA 2HOSA 1D1CA 2MFZA 3P9CA 3JTGA 4GDFA 3BTCA 4DZPA 2BZTA 3V7RA 4B48A 4A3GJ 2NOGA 3TO9A 3BTIA 4OOIA 2IS4A 2VL8A 2LR8A 1D3YA 2HZTA 1HW1A 1YX5A 4XR6A 5FB2A 2DFFA 5E8GA 2COBA 1HOMA 4IHYA 3A01A 2ELKA 3E6DA 3P5JA 3N97A 1Z3YA 4QIWN 5LRSA 1SEUA 3W6KB 4HNVA 5JI6A 4G6DA 2IA1A 3EYIA 1RUNA 4PK4A 2NOJB 1FT9A 2DPDA 2FRHA 1FYKA 2HQNA 3QYBA 2W4SA 3GTMJ 3S1MJ 1LFPA 3K4KA 2W48A 1U9NA 3I3LA 2Z1DA 4PSXA 4BAYA 1MW7A 3ESWB 3HG9A 4HF1A 2CMPA 2CWEA 2D1HA 3IV5A 5IYBJ 5D5UB 2VXZA 4XQFA 3S14J 2A6HF 3E3VA 2KZVA 1T0FA 3DPUA 3D0SA 5DD4A 3NRVA 4KITB 4G7HF 4C2MJ 3T0YA 3OYMA 2EFQA 2L54A 3K4MA 4UVCA 3U21A 2XSDC 2BVLA 2FNPA 2CQNA 3RZDJ 1NHAA 4UB6C 1QBJA 1DP7P 1ZGAA 4M9SA 3K70C 3OR2C 1OLTA 3CLOA 2OV7A 2HDWA 4YFKF 3S2HJ 1Z77A 3H92A 2ETHA 2JVHA 5CVVA 1Z3XA 3H0DA 4U0WA 4RMNA 3J80Z 3G2BA 3PNTA 3WTZA 3HUGB 3WGIA 1YIJI 1I3AA 1FLIA 1MMAA 3S3OA 1RC9A 1EH7A 3MWMA 1P4WA 5K5OA 3FMSA 1TWAJ 3CESA 4RM3A 3GX4X 1T95A 1BR4A 2K85A 4GGGA 2LG4A 2WWYA 1U78A 2F6CA 3HXLA 3LSKA 1GVJA 2K9MA 4WF2A 2WY7Q 3LNQA 2Z3YA 3D5SC 2ZXJA 3ZMZA 2F5EA 2JQ7A 2H94A 2ME6A 2W84A 4PCQA 1U3EM 2O8KA 2ZMEB 5L3GA 2L3DA 3RPUA 2X51A 3QRFF 3LSHA 2QGUA 3QPSA 2NXNB 2LNBA 3C1DA 1VZ0A 4BHCA 3FMQA 3M8JA 4S0HB 1WCMJ 4WCGA 2F4MB 1CF7B 3B73A 2DOEA 4HPQA 3TW6A 2DMUA 4OMYA 1ETOA 3EPZA 3K69A 2CJJA 1YRNB 1ACIA 3BROA 4DJAA 1LUJB 3SEZA 3PJRA 3IP4B 5CLSA 1VQ8I 3FF5A 4U0YA 1TWHJ 4HLYA 4RS8A 1XX5A 3J81K 1Y1WJ 2XPVA 2G7UA 3Q9VA 3JR9A 3DWLE 1ETWA 2ZJQF 1V54H 1WJBA 1HQCA 2X4HA 2R3SA 2HNHA 2VIXA 3H5AA 1R1VA 2KP6A 3CDLA 3KZIC 1T8IA 1WJAA 2OQRA 3EDPA 4XN0A 2V6CA 2GAUA 4EATA 1FYLA 1OR7A 2GIZA 2XV4S 3MZYA 3ZXSA 1W1WE 3KP3A 2M30A 1S8NA 4HRIA 2EFNA 3WG9A 2DDBA 3BG5A 3BPVA 1G3WA 5C4JJ 2XSJC 1SD5A 2Q8KA 3M8FA 4JQFA 3TKYA 3CQZJ 3DBRB 5CJ9A 3RCOA 4CYCB 2ME0A 2R7RA 5M3FJ 4BL0B 2F48A 1PUFA 4HA8A 3CCUI 3ASNH 5J40A 3TMOA 4DBQA 4ABZA 4DBRA 2H09A 4HLXA 3HB9A 1Y0NA 4ZZDA 2X0LA 3OSGA 1FY7A 1Z7LA 5JHUA 2CV1A 2VPLA 3DPLC 4DYQA 4PJ0C 4IHWA 3HL2A 1XDUA 5F64A 3DTEA 1O57A 2X1CA 4G8XA 3L00A 1ODDA 3PQKA 2KRCA 4IOCF 2UXNA 1J0RA 5AONA 4UUVA 3VYTB 4B8XA 1BOAA 3PM1A 2ZFUA 1DP3A 1I6HJ 2PBIA 3REOA 3EQLF 1BC8C 2HVRA 1E2XA 2ISYA 1IRFA 1X58A 1EV7A 1ENHA 1XN7A 4CZCA 3U1DA 2ACJA 5IPAA 4QLCU 1QRYA 2A07F 4CICA 5E1XA 4YRVA 3OYEA 1VQ4I 3F8CA 3O3KA 1JT6A 3EUAA 3BQZA 4DNCA 1OPCA 5EEGA 5F08A 5D5VB 2MLGA 3HM5A 4HBLA 1W0TA 3OYNA 3M3YJ 3WGHA 2R0QC 1NK2P 3HRSA 1R4NB 4AIHA 5IT9K 3BPXA 2L7FP 3AG4H 1QHHD 3VB2A 4AIKA 1ZG3A 1W36D 3BG9A 3D1NI 1UFMA 4UVAA 3CF5F 2K40A 1YX3A 2VN2A 1TTYA 5GTIC 1QZYA 1W0UA 3F8MA 1H9TA 5F0HA 3E5QA 3S16J 4D0PA 5A2QK 1J09A 2KJBA 1OCTC 2DMPA 4CCKA 1IRXA 3BR3A 2Y2ZA 3F0CA 1XTAA 1XMKA 4JX5A 4IHSA 3CO6C 4I01A 2AS5F 1R9TJ 4RLQA 1YJ9I 3PO3J 1IXSB 3G1LA 1KU9A 2Y0MA 2YU3A 3CDHA 2K02A 3S2DJ 1OKRA 2Y31A 4I02A 2DI3A 4XMYA 5ERIA 2KT0A 4ENJA 2EV0A 1HC8A 3FXKA 4UUSB 5FRMA 1VF9A 5EJCA 4DIQA 1V5FA 4OAYA 2CQXA 3TBIA 3FXRA 2MSYA 5EEAA 4MTDA 2IVMA 2M87A 2O3FA 2M2EA 2Z9OA 4XRMA 3K0LA 3W3CA 4DW6A 3MEXA 2BGCA 1XSXA 2W7NA 5E8IA 4IVNA 4UVBA 3NWTA 1VI0A 4E7HA 2BE5F 1VQ6I 2XKOA 3K1MA 2YS9A 4UY8I 4AIJA 2HVQA 3K4JA 5J1RA 4XM3A 4IRHA 2K4JA 1W7PB 1GT0C 4XSXF 1MBHA 2K4BA 1JKRC 3H5RA 2WV0A 3BCBA 5EGOA 1SC7A 2EH3A 4HV5A 4E7IA 3L1PA 4C2TA 4IHXA 3GUDA 5B3SH 4KICA 1WI3A 2H6CA 2VBYA 5E18F 3ZP5A 1Y8RB 4ENMA 2P7VB 4LITA 2L9NA 1VQMI 3H9QA 2V4JC 4Y15A 1OFCX 3HIFA 3F23A 3T8TA 3ZOBA 4AIDA 3ZQCA 3OIPA 2YR2A 1G3YA 1U6GA 2P81A 1SFUA 2FMYA 4CCLA 2XROA 3QYEA 5EZGA 1BI3A 3OYIA 1KQ8A 3UKGA 4B3AA 1WJCA 1ZR2A 2LLKA 3FXUA 1IUYA 1XG1A 1ETVA 3VYRB 2MGQA 3PUFA 4EJUA 1HA8A 1YW7A 4XBFA 2E1NA 1TL8A 2X1EA 3C7JA 1ZN2A 3WU0A 1A36A 3DXJF 1R58A 1YJWI 3TOAA 4FX0A 1YTYA 2M4KA 3SXYA 4A3KJ 4YFXF 2R7DA 3K1PA 2G7HA 1Y1VJ 1YITI 2KLOA 5ICFA 2K9SA 3IHUA 2H8RA 3GEZA 3G3ZA 4EVIA 4Q5SF 2R5ZB 1Z9CA 2B9SA 2XF5A 2R5YB 2VUMJ 3C2BA 3HZJA 2DTZA 3JREA 2XAUA 2QKMB 2DYSH 4LK0F 1HW5A 5TISC 1T6SA 4B1RA 2G0EA 4A3IJ 4QPQA 1OYWA 3EUHA 2ID6A 3GF2A 1X2MA 2UV1A 2RAEA 2DA7A 3DEWA 3HYIA 3ONQA 5E3OA 3IRQA 2MABA 4B3XA 4QTRA 4A5MA 2NRAC 1S29A 5LRRA 2WAQN 4II3A 1FJLA 2K9LA 4CCMA 3EYYA 2PJPA 3J80K 3NWSA 5EG0B 2XVCA 3RQ4A 2VPRA 1RR8C 1RZ4A 1G59A 3CF2A 2VQLA 4C3JJ 3H9JA 5FD6A 1B59A 2FU4A 4GRIA 2R92J 1QPMA 1HLVA 1P4AA 1ZR4A 1P2FA 2CRGA 5CPRB 1JE8A 3VODA 3CCJI 1FOXA 2VE9A 3I53A 1LPQA 1HCRA 4Y52J 4CZZA 4U7DA 2DFEA 2MH9A 5GAHJ 5M5WJ 1CGPA 1R00A 3HOSA 3QP5A 2A69F 3CJTB 5C44J 3KFWX 3V7CA 2LMDA 4JX6A 2E5NA 4B47A 4HDVA 3RTRA 3K4NA 5KAFC 2W24A 3DU6A 1R22A 5DCMB 1IJWC 1IN6A 2O03A 3DQVC 2ZSHB 3HSEA 2HTJA 4FT8A 2L01A 2D5VA 1D5VA 3FK7A 3ERED 1H9GA 4A0ZA 4FASD 5ICGA 4R8HA 3MN2A 1B8IA 4UHTA 4CXFA 1OCCH 3GVAA 1JJ6C 4IF4A 2XAHA 1T0FC 2EZLA 3I4PA 1FP1D 1SD4A 2E19A 4XKWA 1PYVA 5DUKA 3RI4A 2ICWG 4CGZA 2BBYA 4XLCA 3BOQA 3MD2A 1WWXA 3OIQA 2IW5A 2GXGA 2EV6A 1KGSA 4LOCA 3CMYA 4PUSA 4JOMA 3TQNA 4BQAA 3AG1H 2EQRA 1UZCA 4J00A 4HX8A 3RSNA 4XRSG 1XGSA 1ZG1A 2P5KA 4FTHA 2O6GE 1BOBA 2WB1A 2VJ4A 1X4OA 4HNTA 4RGRA 3AFHA 1KZHA 5DDGA 1UG0A 1FEXA 3J7AO 1ZLJA 2XGDA 4XRFA 2M5WA 4BDYA 1E3OC 4NC7A 1O3TA 2GM4A 1T08B 3QU6A 3AKZA 3GTKJ 3FXQA 5FKLA 1BI2A 2EPFA 2E1MB 2L9RA 2P6TA 2CUFA 1LFBA 1S9HA 3LAPA 2HU9A 3WTSC 2L7ZA 4E6KG 4PFPA 2PMZN 3I5UA 4BEHA 2JA5J 2BHYA 2F5VA 3HC7A 1WHUA 3QU3A 1LDKB 2ELJA 4NBQA 1T39A 1VQKI 3A0HC 4FX4A 3F8FA 4MHGA 2QSHX 2GLOA 5HNFA 3IH2A 3ZGKA 1C0WA 2ECBA 2CUEA 3FWEA 2BY0A 1PP8F 1TWFJ 3K2ZA 1TWCJ 4P9UA 1O3SA 1RPWA 3R60A 5D4SA 2EIMH 3GTPJ 3LSGA 1ETQA 4KISA 4CCOA 2DJNA 5B1AH 3B6AA 2ZXWH 2G9WA 2IXSA 3HUGA 3FX3A 3ISPA 3HHHA 1HF0A 3MQ0A 1AU7A 4I2OA 2XB5A 2WA0A 2BYVE 2KPMA 4EM0B 2WBMA 2TDXA 4BS9A 3E6MA 5LHGA 4RB3C 4BACA 5F0FA 2FNAA 4I0AA 4UV9A 1GUUA 4W1UA 2XPWA 1S5LC 3TP0A 4RGXA 3I59A 5FKOA 2CU7A 4G6QA 4HSTA 5JVTA 3CC7I 2XRLA 1FMWA 3FXOA 3TW7A 1K4TA 3BR6A 3ZQQA 1XCVA 1TT0A 2WTEA 3HKZN 2EA2A 5LGUA 2MH2A 3I64A 4L9TA 2HDDA 3QPTA 3DTIA 2P6SA 1MSFC 4F93B 3QYFA 1WJ5A 4UV8A 3LA7A 4XONA 1HKQA 1JKPC 3GMEA 5H6RA 4EGZA 2QENA 5J3LA 2OPTA 1WJDA 2HR3A 4J01A 5KVRA 4AVPA 4OWRB 3E0JB 2B7EA 2DA2A 4LG0A 4A3MJ 4HOBA 3S1QJ 9ANTA 4XOPA 3S3NA 1EF4A 3M9AA 2ZJPF 3GZ5A 4RM2A 4M9XA 1U8RA 2ZO4A 3M4OJ 1T33A 1N25A 1SFOJ 4GYGA 2F2EA 1Z05A 3KP6A 2M3AA 2ZNZA 1EH8A 4KT6A 4BNCA 2EK5A 2LY2A 1ZGWA 3FKJA 3NAUA 4QPOA 3F8NA 3CTAA 4Y13A 5GAGJ 1WH5A 3ZR8X 1SMYF 2X6XA 5B66C 1RKWA 4O6JA 4EJWA 3WTWC 3JRAA 2VODA 2HOAA 2HYGD 3KP5A
chains in the Genus database with same CATH topology
4XICA 1RKTA 4J19A 4I6ZA 5DTDA 2IAIA 3BR2A 1TWHJ 5J1YA 5F27A 4GFBA 2R5ZA 1Y1WJ 2XPVA 3JR9A 1RESA 2R5YA 1ETWA 2HXIA 5FKNA 4M3GA 3S1RJ 1P7JA 2LKXA 3HOWJ 2M9HA 2LTPA 2OF7A 3CDLA 1HDDC 2H1KA 2XB0X 1WGXA 3BR0A 1FTZA 1VFCA 2FQ4A 1F36A 2M34A 5K7ZA 4XK4A 2CQQA 2QF7A 3BG5A 4FISA 3JRIA 5C4JJ 4A3DJ 1QVUA 3CQZJ 1QVTA 2B63J 3IH3A 3HEFA 4CYCB 2ME0A 5M3FJ 1MSEC 1PUFA 3K2AA 1WH7A 1A6IA 1D5YA 4ABZA 4X6AJ 1JTXA 3FK6A 3HB9A 3OSGA 3OIOA 4DYQA 4IHWA 5IP6A 5HODA 3W6VA 3LSRA 4MIMA 2FJ1A 3WHCA 2M8GX 3OOUA 5K7HA 3JRCA 2JA8J 3PM1A 2VI6A 4B4CA 1I6HJ 3BQYA 2HYJA 3GBGA 5GP9A 3DCFA 1X58A 1ENHA 5IPAA 1QRYA 2JN6A 2YUSA 3S1NJ 2LD5A 1ZKGA 1JT6A 2NS8A 3BQZA 4A93J 3GTJJ 2FD5A 3O8HA 2X48A 4DYRA 2E2IJ 5F08A 3HM5A 4AUXA 1W0TA 2EZKA 3K7AJ 3SJMA 1H8AC 3M3YJ 2R0QC 1NK2P 4BKXA 1O4XA 4M3EA 4DZJA 1QPIA 2GBYA 2L7FP 3Q0UA 2NVXJ 4JX4A 3BG9A 4D7MA 3D1NI 5F04A 1MH4A 2R93J 2K40A 1JGGA 5JLWA 2R7ZJ 1W0UA 1DU0A 5F0HA 2LK2A 2XGCA 1UG2A 3BR1A 3S16J 4JYKA 2DMQA 1FTTA 2DN0A 4I76A 2LY9A 1BA5A 1OCTC 2DMPA 4D5FA 3BR3A 3F0CA 1ETKA 2Y2ZA 3TP3A 3I4NJ 4JX5A 5BNGA 2ZB9A 1R9TJ 2NVQJ 3PO3J 3G1LA 3S2DJ 1SANA 4MO7A 2Y31A 4CYCA 5IYDJ 1IGNA 2KT0A 1LE8A 1IUFA 1MNMC 1WPKA 4V2FA 2ECCA 4UUSB 1MBFA 2DA6A 5E3MA 1VF9A 3O8GA 2K9QA 1MBEA 5K7FA 2CQXA 1FIPA 1ETYA 5EEAA 2MSYA 2DA5A 2M2EA 3NARA 4XRMA 4DW6A 2DMTA 1GV2A 1U9OA 3QQAA 5M5XJ 3LOCA 1VI0A 5FJ8J 1OCPA 1RETA 3MVPA 1NTCA 1K61A 3HOZJ 2YS9A 4FE7A 4C3IJ 5FLMJ 5J1RA 2HI3A 3GTGJ 3Q3SA 2JK3A 1GT0C 4FE4A 1MBHA 3I4MJ 3ZQIA 1JKRC 4A3FJ 3A02A 5EGOA 1X2NA 5DS9A 2EH3A 1YRNA 2HXOA 3L1PA 3S15J 4IHXA 4JP0A 1ZK8A 1WI3A 3RZOJ 2NVTJ 4M3DA 4RDUA 4EEFG 2VKEA 1G2HA 1OFCX 3ZQFA 2ID3A 3ZOBA 1HDPA 3ZQCA 2P81A 4UUSA 5EZGA 5J1UA 3WHBA 1IC8A 3UKGA 5C4XJ 3JRFA 1POGA 4B3AA 5M5YJ 1ZR2A 1FIAA 2LLKA 1B72A 1JKQC 2O9LA 1XG1A 1ETVA 2Y30A 2EZIA 2MGQA 3SFIA 2K9NA 1A5JA 1Q1VA 3PO2J 2WB1N 4A3KJ 2L7MP 3HOXJ 1Y1VJ 3H0GJ 2K9SA 1DU6A 4W97A 2H8RA 2YU9J 4A3LJ 2E2JJ 2R5ZB 2HQ5A 1LE8B 2JMWA 2R5YB 2VUMJ 3C2BA 3JREA 2DTZA 2O7OA 5E3NA 3OSFA 4D5CA 4B1RA 2VKVA 5IOZA 2G0EA 4X1EA 4A3IJ 3JRBA 2ID6A 4AYBN 1X2MA 2LVSA 2RAEA 4NDLA 2AO9A 2DA7A 3DEWA 2AHQA 4AC0A 4D7NA 3RKQA 5E3OA 4QTRA 2WAQN 2E1OA 3G1MA 1FJLA 4IEJA 1JTYA 1BJZA 2QCOA 5EG0B 1UHSA 1TC3C 1I3QJ 2VPRA 3Q0VA 2Y9ZA 5EGOB 1JUMA 3RQIA 4C3JJ 5IP9J 1IV6A 3HOYJ 2R92J 1GVDA 1HLVA 1ZR4A 2CRGA 1ZQ3P 4M6VA 2NS7A 1APLC 3ZQGA 2I10A 1HCRA 2FX0A 4M3BA 4RBOA 3TEDA 1GDTA 4A3JJ 4Y52J 4BY1J 2DMNA 2JA7J 1CQTA 1VNDA 4XRSA 5C44J 3GTLJ 1MH3A 3BT9A 2KDZA 5E3LA 3JRDA 4JX6A 1LFUP 4C3HJ 1IDYA 4UUTA 3HOUJ 1IJWC 2JA6J 2D5VA 5EYRA 3FK7A 3CCYA 3IH4A 3MN2A 1B8IA 2Y9YA 3A01B 4Y7NJ 2X9DA 4G12A 1JJ6C 4FCYA 3ZQLA 5EG0A 5IYCJ 5M5WJ 1T56A 3G1OA 1MBJA 4XIDA 1MBKA 3GTQJ 2EZLA 4A3CJ 2E19A 1BL0A 1IG7A 2NVYJ 4BBRJ 1IDZA 3E7LA 3LSPA 4BBSJ 1ITYA 1BW5A 3BTJA 1ORKA 4LOCA 2M0CA 3CMYA 2XGEA 1JUSA 1IRZA 1PUFB 2WV1A 3FIWA 2EQRA 4XRSG 4V2GA 3S17J 4FTHA 2E2HJ 1BW6A 1FEXA 1ZTRA 4QSHA 2XGDA 3ZQHA 1E3OC 2GM4A 3GTKJ 5FKLA 2HOSA 4A69C 2L9RA 1OJLA 2CUFA 3BTCA 1LFBA 4DZPA 4IHVA 2IBDA 4A3GJ 2NOGA 5F0CA 1JT0A 2L7ZA 3BTIA 2DA1A 2PMZN 4MFEA 1XS9A 2JA5J 1H88C 2LR8A 1AHDP 1P7IA 3BG3A 1RR7A 5EDNA 4DYCA 2XPUA 2COBA 2GLOA 3HBLA 1HOMA 5C3EJ 3JRGA 4IHYA 3A01A 2ELKA 3GTOJ 3IH2A 2ECBA 2CUEA 3Q0WA 4QIWN 5F1JA 1H89C 1F43A 1TWFJ 1TWCJ 4HNVA 2X6OA 1RPWA 3A03A 3GTPJ 1UMQA 4A3EJ 3LSGA 1ETQA 3VPRA 2DJNA 3BTLA 3B6AA 3GTMJ 3S1MJ 2W48A 1U9NA 2EZHA 1HF0A 1AU7A 2XB5A 5GPAA 1JJ8C 4L5EA 3IV5A 5IYBJ 1GV5A 3S14J 5FLVA 3B6CA 5F0FA 4A3BJ 3TP0A 1GUUA 4W1UA 2XPWA 5EZHA 2MG4A 4C2MJ 2XSDC 5FKOA 1K83J 2CU7A 3RZDJ 2LP0A 3HDDA 2EBIA 2XRLA 2HOTA 1NK3P 3TW7A 3BR6A 1AKHB 2JWTA 3HGYA 1U8BA 3HKZN 2DA3A 3S2HJ 2HDDA 1Z77A 5M3MJ 4BXXJ 1MSFC 2MW8A 1MBGA 3LSJA 5IOYA 1Z0XA 2N8GA 4MLOA 1JKPC 1JKOC 4MFDA 3JRHA 5J3LA 2OPTA 2TCTA 2DA2A 4A3MJ 1TWAJ 5IP7J 5GPCA 3S1QJ 3HOVJ 2JJ7A 1TWGJ 1U78A 3BR5A 1I50J 1JUPA 4M3FA 9ANTA 2L0KA 5FKMA 3SDGA 4BY7J 3LNQA 1EF4A 3H3VK 2ME6A 2LFBA 3FKIJ 2O8KA 1XC5A 1ETXA 2Y0SN 3M4OJ 1T33A 1SFOJ 3MKLA 3QPSA 5JLXA 1S7EA 4S0HB 1ZGWA 2TRTA 3NAUA 1WCMJ 2DA4A 3HGGA 3FISA 1B8IB 1WH5A 5FKKA 3TW6A 2DMUA 1ETOA 1RKWA 3JRAA 2CJJA 2IEKA 1YRNB 3QPLA 5EF6A 1AKHA 2HOAA 1B72B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XIC A;  1RKT A;  4J19 A;  4I6Z A;  5DTD A;  2IAI A;  3BR2 A;  1TWH J;  5J1Y A;  5F27 A;  4GFB A;  2R5Z A;  1Y1W J;  2XPV A;  3JR9 A;  1RES A;  2R5Y A;  1ETW A;  2HXI A;  5FKN A;  4M3G A;  3S1R J;  1P7J A;  2LKX A;  3HOW J;  2M9H A;  2LTP A;  2OF7 A;  3CDL A;  1HDD C;  2H1K A;  2XB0 X;  1WGX A;  3BR0 A;  1FTZ A;  1VFC A;  2FQ4 A;  1F36 A;  2M34 A;  5K7Z A;  4XK4 A;  2CQQ A;  2QF7 A;  3BG5 A;  4FIS A;  3JRI A;  5C4J J;  4A3D J;  1QVU A;  3CQZ J;  1QVT A;  2B63 J;  3IH3 A;  3HEF A;  4CYC B;  2ME0 A;  5M3F J;  1MSE C;  1PUF A;  3K2A A;  1WH7 A;  1A6I A;  1D5Y A;  4ABZ A;  4X6A J;  1JTX A;  3FK6 A;  3HB9 A;  3OSG A;  3OIO A;  4DYQ A;  4IHW A;  5IP6 A;  5HOD A;  3W6V A;  3LSR A;  4MIM A;  2FJ1 A;  3WHC A;  2M8G X;  3OOU A;  5K7H A;  3JRC A;  2JA8 J;  3PM1 A;  2VI6 A;  4B4C A;  1I6H J;  3BQY A;  2HYJ A;  3GBG A;  5GP9 A;  3DCF A;  1X58 A;  1ENH A;  5IPA A;  1QRY A;  2JN6 A;  2YUS A;  3S1N J;  2LD5 A;  1ZKG A;  1JT6 A;  2NS8 A;  3BQZ A;  4A93 J;  3GTJ J;  2FD5 A;  3O8H A;  2X48 A;  4DYR A;  2E2I J;  5F08 A;  3HM5 A;  4AUX A;  1W0T A;  2EZK A;  3K7A J;  3SJM A;  1H8A C;  3M3Y J;  2R0Q C;  1NK2 P;  4BKX A;  1O4X A;  4M3E A;  4DZJ A;  1QPI A;  2GBY A;  2L7F P;  3Q0U A;  2NVX J;  4JX4 A;  3BG9 A;  4D7M A;  3D1N I;  5F04 A;  1MH4 A;  2R93 J;  2K40 A;  1JGG A;  5JLW A;  2R7Z J;  1W0U A;  1DU0 A;  5F0H A;  2LK2 A;  2XGC A;  1UG2 A;  3BR1 A;  3S16 J;  4JYK A;  2DMQ A;  1FTT A;  2DN0 A;  4I76 A;  2LY9 A;  1BA5 A;  1OCT C;  2DMP A;  4D5F A;  3BR3 A;  3F0C A;  1ETK A;  2Y2Z A;  3TP3 A;  3I4N J;  4JX5 A;  5BNG A;  2ZB9 A;  1R9T J;  2NVQ J;  3PO3 J;  3G1L A;  3S2D J;  1SAN A;  4MO7 A;  2Y31 A;  4CYC A;  5IYD J;  1IGN A;  2KT0 A;  1LE8 A;  1IUF A;  1MNM C;  1WPK A;  4V2F A;  2ECC A;  4UUS B;  1MBF A;  2DA6 A;  5E3M A;  1VF9 A;  3O8G A;  2K9Q A;  1MBE A;  5K7F A;  2CQX A;  1FIP A;  1ETY A;  5EEA A;  2MSY A;  2DA5 A;  2M2E A;  3NAR A;  4XRM A;  4DW6 A;  2DMT A;  1GV2 A;  1U9O A;  3QQA A;  5M5X J;  3LOC A;  1VI0 A;  5FJ8 J;  1OCP A;  1RET A;  3MVP A;  1NTC A;  1K61 A;  3HOZ J;  2YS9 A;  4FE7 A;  4C3I J;  5FLM J;  5J1R A;  2HI3 A;  3GTG J;  3Q3S A;  2JK3 A;  1GT0 C;  4FE4 A;  1MBH A;  3I4M J;  3ZQI A;  1JKR C;  4A3F J;  3A02 A;  5EGO A;  1X2N A;  5DS9 A;  2EH3 A;  1YRN A;  2HXO A;  3L1P A;  3S15 J;  4IHX A;  4JP0 A;  1ZK8 A;  1WI3 A;  3RZO J;  2NVT J;  4M3D A;  4RDU A;  4EEF G;  2VKE A;  1G2H A;  1OFC X;  3ZQF A;  2ID3 A;  3ZOB A;  1HDP A;  3ZQC A;  2P81 A;  4UUS A;  5EZG A;  5J1U A;  3WHB A;  1IC8 A;  3UKG A;  5C4X J;  3JRF A;  1POG A;  4B3A A;  5M5Y J;  1ZR2 A;  1FIA A;  2LLK A;  1B72 A;  1JKQ C;  2O9L A;  1XG1 A;  1ETV A;  2Y30 A;  2EZI A;  2MGQ A;  3SFI A;  2K9N A;  1A5J A;  1Q1V A;  3PO2 J;  2WB1 N;  4A3K J;  2L7M P;  3HOX J;  1Y1V J;  3H0G J;  2K9S A;  1DU6 A;  4W97 A;  2H8R A;  2YU9 J;  4A3L J;  2E2J J;  2R5Z B;  2HQ5 A;  1LE8 B;  2JMW A;  2R5Y B;  2VUM J;  3C2B A;  3JRE A;  2DTZ A;  2O7O A;  5E3N A;  3OSF A;  4D5C A;  4B1R A;  2VKV A;  5IOZ A;  2G0E A;  4X1E A;  4A3I J;  3JRB A;  2ID6 A;  4AYB N;  1X2M A;  2LVS A;  2RAE A;  4NDL A;  2AO9 A;  2DA7 A;  3DEW A;  2AHQ A;  4AC0 A;  4D7N A;  3RKQ A;  5E3O A;  4QTR A;  2WAQ N;  2E1O A;  3G1M A;  1FJL A;  4IEJ A;  1JTY A;  1BJZ A;  2QCO A;  5EG0 B;  1UHS A;  1TC3 C;  1I3Q J;  2VPR A;  3Q0V A;  2Y9Z A;  5EGO B;  1JUM A;  3RQI A;  4C3J J;  5IP9 J;  1IV6 A;  3HOY J;  2R92 J;  1GVD A;  1HLV A;  1ZR4 A;  2CRG A;  1ZQ3 P;  4M6V A;  2NS7 A;  1APL C;  3ZQG A;  2I10 A;  1HCR A;  2FX0 A;  4M3B A;  4RBO A;  3TED A;  1GDT A;  4A3J J;  4Y52 J;  4BY1 J;  2DMN A;  2JA7 J;  1CQT A;  1VND A;  4XRS A;  5C44 J;  3GTL J;  1MH3 A;  3BT9 A;  2KDZ A;  5E3L A;  3JRD A;  4JX6 A;  1LFU P;  4C3H J;  1IDY A;  4UUT A;  3HOU J;  1IJW C;  2JA6 J;  2D5V A;  5EYR A;  3FK7 A;  3CCY A;  3IH4 A;  3MN2 A;  1B8I A;  2Y9Y A;  3A01 B;  4Y7N J;  2X9D A;  4G12 A;  1JJ6 C;  4FCY A;  3ZQL A;  5EG0 A;  5IYC J;  5M5W J;  1T56 A;  3G1O A;  1MBJ A;  4XID A;  1MBK A;  3GTQ J;  2EZL A;  4A3C J;  2E19 A;  1BL0 A;  1IG7 A;  2NVY J;  4BBR J;  1IDZ A;  3E7L A;  3LSP A;  4BBS J;  1ITY A;  1BW5 A;  3BTJ A;  1ORK A;  4LOC A;  2M0C A;  3CMY A;  2XGE A;  1JUS A;  1IRZ A;  1PUF B;  2WV1 A;  3FIW A;  2EQR A;  4XRS G;  4V2G A;  3S17 J;  4FTH A;  2E2H J;  1BW6 A;  1FEX A;  1ZTR A;  4QSH A;  2XGD A;  3ZQH A;  1E3O C;  2GM4 A;  3GTK J;  5FKL A;  2HOS A;  4A69 C;  2L9R A;  1OJL A;  2CUF A;  3BTC A;  1LFB A;  4DZP A;  4IHV A;  2IBD A;  4A3G J;  2NOG A;  5F0C A;  1JT0 A;  2L7Z A;  3BTI A;  2DA1 A;  2PMZ N;  4MFE A;  1XS9 A;  2JA5 J;  1H88 C;  2LR8 A;  1AHD P;  1P7I A;  3BG3 A;  1RR7 A;  5EDN A;  4DYC A;  2XPU A;  2COB A;  2GLO A;  3HBL A;  1HOM A;  5C3E J;  3JRG A;  4IHY A;  3A01 A;  2ELK A;  3GTO J;  3IH2 A;  2ECB A;  2CUE A;  3Q0W A;  4QIW N;  5F1J A;  1H89 C;  1F43 A;  1TWF J;  1TWC J;  4HNV A;  2X6O A;  1RPW A;  3A03 A;  3GTP J;  1UMQ A;  4A3E J;  3LSG A;  1ETQ A;  3VPR A;  2DJN A;  3BTL A;  3B6A A;  3GTM J;  3S1M J;  2W48 A;  1U9N A;  2EZH A;  1HF0 A;  1AU7 A;  2XB5 A;  5GPA A;  1JJ8 C;  4L5E A;  3IV5 A;  5IYB J;  1GV5 A;  3S14 J;  5FLV A;  3B6C A;  5F0F A;  4A3B J;  3TP0 A;  1GUU A;  4W1U A;  2XPW A;  5EZH A;  2MG4 A;  4C2M J;  2XSD C;  5FKO A;  1K83 J;  2CU7 A;  3RZD J;  2LP0 A;  3HDD A;  2EBI A;  2XRL A;  2HOT A;  1NK3 P;  3TW7 A;  3BR6 A;  1AKH B;  2JWT A;  3HGY A;  1U8B A;  3HKZ N;  2DA3 A;  3S2H J;  2HDD A;  1Z77 A;  5M3M J;  4BXX J;  1MSF C;  2MW8 A;  1MBG A;  3LSJ A;  5IOY A;  1Z0X A;  2N8G A;  4MLO A;  1JKP C;  1JKO C;  4MFD A;  3JRH A;  5J3L A;  2OPT A;  2TCT A;  2DA2 A;  4A3M J;  1TWA J;  5IP7 J;  5GPC A;  3S1Q J;  3HOV J;  2JJ7 A;  1TWG J;  1U78 A;  3BR5 A;  1I50 J;  1JUP A;  4M3F A;  9ANT A;  2L0K A;  5FKM A;  3SDG A;  4BY7 J;  3LNQ A;  1EF4 A;  3H3V K;  2ME6 A;  2LFB A;  3FKI J;  2O8K A;  1XC5 A;  1ETX A;  2Y0S N;  3M4O J;  1T33 A;  1SFO J;  3MKL A;  3QPS A;  5JLX A;  1S7E A;  4S0H B;  1ZGW A;  2TRT A;  3NAU A;  1WCM J;  2DA4 A;  3HGG A;  3FIS A;  1B8I B;  1WH5 A;  5FKK A;  3TW6 A;  2DMU A;  1ETO A;  1RKW A;  3JRA A;  2CJJ A;  2IEK A;  1YRN B;  3QPL A;  5EF6 A;  1AKH A;  2HOA A;  1B72 B; 
#chains in the Genus database with same CATH topology
 2JRM A;  3VSK A;  1XSV A;  2IS1 A;  1RKT A;  4ZJZ A;  3OYC A;  2IAI A;  2BW3 A;  3BR2 A;  5HS7 A;  2D45 A;  1KA8 A;  5J1Y A;  2R5Z A;  4MNU A;  1Z1D A;  1I39 A;  2ZME C;  4CCJ A;  5IY5 H;  2DFI A;  2GA2 A;  4UB8 C;  2WAF A;  5CVU A;  2HTS A;  4L9N A;  2LKX A;  1SD7 A;  2OF7 A;  5ILU A;  2HVS A;  3BZC A;  1LDJ A;  3BR0 A;  1WGX A;  2GWR A;  4LG3 A;  1VFC A;  1IO2 A;  2WAE A;  4Q48 A;  2E34 A;  1G8X A;  3ABM H;  3F6V A;  4BH9 A;  4BQQ A;  2B63 J;  3SYT A;  3ZRG A;  2PLY A;  2XAF A;  3HEF A;  5BPD A;  1FWZ A;  3F72 A;  6PAX A;  3HTU A;  1WH7 A;  2ZJR F;  1P4X A;  2DXI A;  1LEA A;  2IS6 A;  3FK6 A;  4ESJ A;  2PN6 A;  3BZ6 A;  3I54 A;  1WJE A;  2V9P A;  4XNF A;  5J4Y A;  2RNJ A;  2MA3 A;  4EV0 A;  2J5O A;  5IP6 A;  4S05 A;  3JAM Z;  3W6V A;  1YO5 C;  5LEJ A;  4II2 A;  4MIM A;  4S04 A;  4IHT A;  3WHC A;  5TGT A;  2K7L A;  1YLF A;  1U5T C;  4FHT A;  1WZ2 A;  4EMS A;  3JRC A;  4XKC A;  2JA8 J;  2VOP A;  3KLO A;  2HYJ A;  2UXX A;  3BLY A;  1MD0 A;  3GBG A;  3QPH A;  2DU9 A;  4IQJ A;  2XRN A;  3KE2 A;  3HHG A;  2L9S A;  1VQN I;  5DCM A;  1R36 A;  2LD5 A;  4CA0 A;  3OYG A;  2H27 A;  2DOA A;  3GTJ J;  2LKP A;  4MQV A;  3O8H A;  2QBY A;  1TW3 A;  4GCV A;  3GO5 A;  4DYR A;  3EUK L;  3CCM I;  2JZY A;  4AUX A;  5H20 A;  2FBH A;  3KEQ A;  1FOK A;  2PG4 A;  1BN5 A;  1H8A C;  3AG2 H;  3H9G A;  4XL9 A;  4BKX A;  1O4X A;  4OIO F;  4M3E A;  2EIN H;  4LD5 A;  1QPI A;  3K1N A;  1DPR A;  1U5T B;  4BGD A;  3K9T A;  3OYK A;  2OCC H;  1J5Y A;  5FFX A;  2HZD A;  3ABK H;  3H35 A;  3KZZ A;  4HYE A;  1WSU A;  1MMS A;  4BXF A;  4Q4Z F;  2XGC A;  1UG2 A;  4JYK A;  1R6R A;  4KN4 X;  1R7J A;  3FXJ A;  2GQQ A;  2BEO A;  1XGM A;  2ZB9 A;  3G6E I;  2LYC A;  2V1D A;  3GLL A;  5HLG A;  2PX9 A;  2ZJ2 A;  2KDO A;  4A6E A;  1IGN A;  2RQQ A;  2ZKZ A;  5HOO A;  3CJR B;  1IUF A;  2R7X A;  3GFM A;  2ECC A;  1UHM A;  1TQP A;  1VQP I;  1F5T A;  3KYL A;  1ZH5 A;  1R5I D;  3CUO A;  2K9Q A;  3BDD A;  3O8G A;  2FUG 2;  2PMZ A;  3P9I A;  3V7S A;  2DOF A;  3OOP A;  5K7F A;  1R23 A;  5F6F A;  3DKX A;  1O3Q A;  3ZMV A;  1FBQ A;  4HDU A;  5CVI A;  5E79 C;  4KFC A;  2KIF A;  2DMT A;  5ILV A;  1S6L A;  4F3Q A;  5M5X J;  1JGS A;  2VKH A;  3C2G A;  3LOC A;  1VQ5 I;  1D8K A;  2KJC A;  3MVP A;  1NTC A;  4WK8 F;  3HOZ J;  4YIF A;  2R7W A;  4FE7 A;  4C3I J;  2HI3 A;  3ZQ7 A;  3PL8 A;  3V8L A;  2C6Y A;  1R1T A;  1Z21 A;  2J5P A;  1R49 A;  2BW3 B;  2QZ8 A;  2KMU A;  5DS9 A;  4BJ5 C;  2GA1 A;  1YRN A;  2LF7 A;  3VYS B;  3U1K A;  3S15 J;  4K2E A;  1EJ9 A;  1ZK8 A;  1FSE A;  2VKD A;  3IC7 A;  3RZO J;  2QBY B;  1X3Z B;  4M9Z A;  3WU1 B;  1I5Z A;  4YEJ A;  3IAS 2;  5TRD A;  1ZRC A;  2HDC A;  2F5D A;  3OY9 A;  3DPT A;  3ABU A;  4U0V A;  1XSD A;  4DGW B;  1AWC A;  1YFH A;  5J1U A;  3WHB A;  3HKZ A;  2PJR B;  2ZCW A;  2MD5 A;  4CO8 A;  3W2V A;  1ZGJ A;  1FIA A;  4RB0 A;  4XLA A;  3S8P A;  1ERD A;  2AXT C;  2RVC A;  3BJA A;  4NC6 A;  2Y30 A;  2EZI A;  4BQN A;  2GIV A;  1QQI A;  3SFI A;  1T38 A;  4HZF A;  1LKX A;  4HV6 A;  1Q1V A;  1ZEL A;  2LKS A;  2KHM A;  2WB1 N;  4RGU A;  3CCS I;  3JSP A;  2OZ6 A;  5E17 F;  1RI7 A;  3TDU C;  4ZTF A;  3GFL A;  4W97 A;  5HLH A;  4CDG A;  2YU9 J;  4A3L J;  2DBB A;  5AIQ A;  2HQ5 A;  1SAU A;  5LLQ A;  1LB2 A;  2O7O A;  4U7B A;  3OSF A;  4D5C A;  2X6Y A;  2VKV A;  2VLA A;  3DBL B;  4XLN F;  1DQU A;  3F21 A;  4ENK A;  3K4B A;  3JRB A;  1X4P A;  3BZK A;  3OS0 A;  1E17 A;  4D7N A;  1L0O C;  3OS1 A;  3RKQ A;  2AHQ A;  2F5C A;  2R7F A;  3UR3 C;  2A6T A;  4MGR A;  5J47 A;  2VBZ A;  1G6N A;  5E1Z B;  3G1M A;  3VFZ A;  2ZSI B;  2M0M A;  2K3F A;  1ZRE A;  3HPG A;  3QP6 A;  2L7K A;  1TC3 C;  3Q0V A;  4P1W A;  1J9I A;  4AM3 A;  5BS6 A;  1D0Y A;  1I27 A;  2RQP A;  3HOY J;  1IV6 A;  1B9M A;  2Q2E A;  4ANJ A;  3HPH A;  3LSM A;  3SZG A;  4M6V A;  2A68 F;  4LGW A;  1TBX A;  1ZAO A;  2M4G A;  3RKW A;  3ZQG A;  4OMZ A;  4RBO A;  2KIM A;  3X2Q H;  2DMN A;  2JA7 J;  1VND A;  2ELH A;  1TQI A;  3TGN A;  5DD8 A;  3GTL J;  1YQA A;  5IT3 A;  2KDZ A;  2FA5 A;  3MCZ A;  4IQ4 A;  4C3H J;  2E71 A;  3KPH A;  1WKM A;  3KET A;  3HOU J;  1XGO A;  2JA6 J;  2IA0 A;  1MJA A;  2KRH A;  4YIR X;  3PNY A;  2ZC2 A;  1KQ9 A;  4NQW B;  1FP2 A;  5DCF A;  4P55 A;  2Y9Y A;  3D5L A;  4B44 A;  2I8D A;  4O5V A;  2M8E A;  1G3T A;  1WRJ A;  1RNL A;  5IYC J;  2EA4 A;  3G1O A;  2Z99 A;  4ASN A;  4AYB A;  1MBK A;  4R1H A;  1XCB A;  2E5Z A;  4Z6Y A;  1FC3 A;  3P9K A;  1BL0 A;  2A5Y B;  2DT5 A;  3MMY B;  3IWZ A;  3L2R A;  1ITY A;  4BU2 A;  4E7Z A;  3CD6 I;  3BTJ A;  2R7V A;  1BW5 A;  4RB2 C;  3E1S A;  2OJE D;  3G4S I;  4XLP F;  2XGE A;  3L7W A;  3CC4 I;  1IRZ A;  1DGW Y;  2WV1 A;  1K6Y A;  1K78 A;  2FBK A;  1HST A;  3LA3 A;  4V2G A;  2OAZ A;  4A0X A;  1KQ0 A;  4ITV A;  2ZXH A;  3CCV I;  4G7Z F;  3DBH B;  2O0Y A;  3E5X A;  2DT7 B;  2A3S A;  3VSL A;  4MEX F;  2CS3 A;  2DDA A;  1FMV A;  2M7B A;  1OJL A;  4IHV A;  2CO5 A;  2IBD A;  5F0C A;  3G73 A;  3M8E A;  2FSW A;  3IUO A;  2VQH A;  1LNW A;  2LOO A;  4MFE A;  3U2R A;  3N4M A;  1AHD P;  2PJR A;  3BJO A;  4UXN A;  1P7I A;  3JAM K;  3IAM 2;  1RR7 A;  3BG3 A;  5EDN A;  2QWW A;  1UCR A;  4DYC A;  2XPU A;  2Z16 A;  3D5R C;  3HBL A;  3WTT C;  1VQ7 I;  3BCA A;  1GHC A;  3Q0W A;  5J8F A;  5F1J A;  4HW0 A;  2ADU A;  2MLK A;  2GOX B;  3TOB A;  4CYD A;  3LA2 A;  2E1M C;  4XSZ F;  2M7A A;  4V19 K;  2DT6 A;  4M6Y A;  1G3S A;  3BTL A;  3M07 A;  4B43 A;  4G94 A;  4E7S A;  3PIP F;  3GFI A;  5ICC A;  2EZH A;  2V7F A;  3H5N A;  4LFU A;  5GPA A;  4H0E A;  1JJ8 C;  1F1Z A;  2Y75 A;  5D5X B;  3FM3 A;  4I98 B;  4ESF A;  1GV5 A;  2CSO A;  3OMY A;  5FLV A;  3R6S A;  3B6C A;  1P6R A;  4ESB A;  1QGP A;  1LDD A;  1Y39 A;  4A3B J;  5EZH A;  1BR2 A;  1V5G A;  2MG4 A;  1M1E B;  2F4I A;  1YOV B;  2LP0 A;  3DKW A;  3DF8 A;  3HDD A;  2CW8 A;  2HKX A;  2JSC A;  2RDP A;  3SFZ A;  1PJR A;  1AKH B;  2JWT A;  3ZN1 A;  3HGY A;  2FQ3 A;  2W25 A;  2STW A;  2VBX A;  3GLX A;  4BUP A;  1U8B A;  2RC4 A;  2VC0 A;  4L5I A;  2LY1 A;  1WQ2 A;  5M3M J;  2M1B A;  4ZYA A;  2MW8 A;  4ZTJ A;  1WJF A;  2VOO A;  3LSJ A;  5J6X A;  2STT A;  1Z0X A;  2FBI A;  2N8G A;  4ZDL A;  4IO9 F;  4M6X A;  4MLO A;  3U9G A;  1JKO C;  4MFD A;  1KU7 A;  3WU2 C;  4FQG A;  4L0Y B;  2VT2 A;  4IKF A;  3BG6 A;  1Z6T A;  1U2W A;  2EB7 A;  5CYV A;  4KN7 X;  3PFY A;  5GAD J;  5IP7 J;  3HTS B;  4EJT A;  2R7O A;  1FX7 A;  1MJ9 A;  2EWN A;  5FO5 A;  3WTV C;  1TLH B;  3WE2 A;  1J2X A;  2L0K A;  3SDG A;  1GXQ A;  1Z6R A;  4BY7 J;  1IXC A;  2QQ8 A;  1TNT A;  4RLF A;  4D9J A;  2BVM A;  3H3V K;  2LFB A;  3VYU B;  1XC5 A;  3VEP A;  1ETX A;  2Y0S N;  2DJI A;  3MKL A;  5K1Y A;  3AG3 H;  1N75 A;  2HPM A;  2Q2E B;  1E0E A;  3C18 A;  2GXB A;  1S7E A;  2E60 A;  2ZNY A;  1X1A A;  1Q1H A;  2YX7 A;  3GZ6 A;  3HGG A;  3FIS A;  4E7K A;  1B8I B;  3OL3 A;  3ROU A;  2DQL A;  3HJE A;  2IS2 A;  5LHH A;  1HBX G;  1EH6 A;  2IEK A;  1FPQ A;  3QPL A;  1B72 B;  3VDX A;  1YIO A;  2DO7 A;  3KEO A;  3VOE A;  4XIC A;  4CHU A;  1BI1 A;  4G7O F;  1OYY A;  2L4A A;  4LLL A;  2ESN A;  4LB6 B;  3KZY A;  1Y0U A;  1RES A;  3KP2 A;  2R5Y A;  2HXI A;  1U0J A;  5FKN A;  2P4W A;  3R4K A;  4ON0 A;  2NYX A;  5CKT A;  3S1R J;  2IRF G;  1P7J A;  1S7O A;  3HOW J;  2OC6 A;  1HDD C;  3AAF A;  2XB0 X;  4KJZ A;  2FQ4 A;  2F4O B;  3OS2 A;  3DFG A;  4LG0 B;  1JXS A;  2M34 A;  5K5R A;  3PNV A;  2DTR A;  5D6F A;  1OMI A;  2Y69 H;  1FNN A;  2QF7 A;  2RN7 A;  3JRI A;  4IRI A;  4A3D J;  1QZE A;  3GW2 A;  3L2C A;  2NS0 A;  1Y6I A;  1D0X A;  1PVE A;  3KP4 A;  4LK1 F;  5J4V A;  4IZZ A;  3IH3 A;  3CUQ A;  1A04 A;  1LJ9 A;  5FGM A;  4PGH A;  3K2A A;  3JSO A;  2QQ9 A;  1A6I A;  3CO7 C;  2P5L C;  1D5Y A;  1K78 B;  4M74 A;  1W4M A;  1X1B A;  4G9Y A;  2DW4 A;  2A6E F;  2ZXI A;  1JTX A;  1TW2 A;  3FHN A;  1K79 A;  3PSF A;  1AA7 A;  2D2W A;  1Z67 A;  2EFO A;  3I0T A;  3S32 A;  2OA4 A;  1BM9 A;  5CQG A;  3FXL A;  3LSR A;  3QOP A;  4R79 A;  1S3J A;  4U87 A;  3ECO A;  2Y48 A;  5BQT A;  2CUJ A;  1J7K A;  2QSG X;  4KT5 C;  2DCE A;  2VI6 A;  4B4C A;  1NG6 A;  4KMF A;  5FRN A;  1MGT A;  3BQY A;  3O2P E;  4CUG A;  3J81 Z;  4XLF A;  5GP9 A;  3DCF A;  4E4H A;  3S2W A;  2LH9 A;  1UAA A;  1VQO I;  2JN6 A;  1QU3 A;  3S1N J;  5F1R A;  3KYD B;  1ZKG A;  4P9F A;  3OYF A;  4RA2 A;  2LC2 A;  4Y17 A;  4OU0 A;  3IWF A;  3HSR A;  3A0B C;  4A93 J;  2FD5 A;  4PJN A;  1VQ9 I;  3CZ6 A;  1D1B A;  2CW0 F;  3ASO H;  2HWV A;  1SAX A;  3FBI B;  2EZK A;  2K27 A;  3K7A J;  3SJM A;  3J7Y J;  2LBF B;  2E7X A;  5L3F A;  4RAY A;  2GBY A;  2KRF A;  4JX4 A;  4QWQ A;  2COM A;  5F04 A;  1MH4 A;  4EM1 A;  1ZHF A;  5JLW A;  5L3E A;  1Y56 A;  5KNL A;  5FLX K;  1J59 A;  2XDV A;  5D8L B;  2LK2 A;  1MZB A;  2OTJ I;  3BR1 A;  1FTT A;  2R7Q A;  4I76 A;  5D5W B;  4D5F A;  1TZL A;  1ETK A;  3V8J A;  3TP3 A;  3RJP A;  3DEE A;  2P5V A;  1D0Z A;  1MND A;  2VT3 A;  1JHF A;  3C2H A;  4MO7 A;  1HW2 A;  5IYD J;  2R7U A;  1MNM C;  1WPK A;  4V2F A;  2JSP A;  1MBF A;  2DA6 A;  2H8W A;  5E3M A;  4NHJ A;  1OIS A;  3VWB A;  3DEU A;  3K70 D;  1NG7 A;  2QVO A;  1FIP A;  1ETY A;  3P7N A;  1YJN I;  1X19 A;  2DK5 A;  3GFJ A;  3HRT A;  3KYC B;  1EKE A;  5HLT A;  1IW7 F;  1GV2 A;  2GOM A;  1SMT A;  4WXH A;  5J8C A;  2BHZ A;  2QEX I;  2PI0 A;  1ZYR F;  2CFX A;  2D1V A;  5DM6 F;  4L0Z B;  3GTG J;  2V26 A;  3Q3S A;  5L3D A;  2JK3 A;  3ERM A;  1USS A;  1SVL A;  3K4L A;  3DLL F;  3ZQI A;  1VTN C;  5LHI A;  3I4M J;  3WTY C;  1PUE E;  4KMU X;  4L5J A;  3SZT A;  3CC2 I;  3AL0 B;  3NEU A;  2EFP A;  1X2N A;  2CW7 A;  2EIJ H;  2HXO A;  1DDN A;  1AOY A;  1KON A;  4JP0 A;  3KEY A;  1V55 H;  1RUO A;  4KNY A;  2NVT J;  3LWF A;  3N05 A;  2KL4 A;  3GWZ A;  4M3D A;  3DV8 A;  2IJL A;  1IN7 A;  4EEF G;  4Q47 A;  2VKE A;  2HFH A;  1G2H A;  2ID3 A;  1D8J A;  3EUH C;  5LGT A;  1S7A A;  1D1A A;  4UUS A;  3JW4 A;  1SFK A;  4A0Y A;  3PUB A;  5C4X J;  1B6A A;  3JRF A;  1POG A;  2VJJ A;  4ZYG A;  2HQA A;  5L3C A;  1YI2 I;  5M5Y J;  4Y4R A;  4ZYE A;  1XB4 A;  1EA3 A;  1V5E A;  4BJ6 C;  1B72 A;  5ED4 A;  1JKQ C;  2O9L A;  1K6O A;  3E6C C;  5L3B A;  2K9N A;  2EFW A;  5FFZ A;  3AL0 C;  3ZCO A;  1A5J A;  3F8B A;  3L2Q A;  2Q1Z B;  1MNE A;  2OZU A;  2UZK A;  4YEL A;  3QAH A;  2LRD A;  2YX4 A;  3HOX J;  3M1E A;  4I7H A;  1ONV A;  5JVG F;  2XAS A;  4ZYH A;  2E2J J;  2V1X A;  3W2A A;  3LMM A;  1GXP A;  2Z5U A;  2JMW A;  4I0B A;  1DUX C;  1BBY A;  1IV8 A;  5JR3 A;  3GYH X;  1XPX A;  3L2U A;  2E1C A;  4KUM A;  4OIR F;  2QA4 I;  5B5E C;  3Q5F A;  4AYB N;  3L2W A;  2LVS A;  4X0G A;  1W5C C;  3GCM A;  2AO9 A;  4H4K C;  3JTH A;  4LMY A;  2DOD A;  3IRR A;  5D4R A;  1R5H A;  5BOX A;  2NNN A;  3R0J A;  1JHH A;  4XKB A;  3E6B A;  4RAG A;  2X1D A;  3HOT A;  4HSR A;  1FOY A;  5D6E A;  4IEJ A;  1BJZ A;  3HRU A;  3MKY B;  3CP2 A;  1UHS A;  3UNG C;  1I3Q J;  3T5X A;  3K10 A;  4WX9 A;  3BJ6 A;  1JUM A;  2ZME A;  3LST A;  3RQI A;  4C2U A;  3FBN B;  2DPU A;  5IP9 J;  3ZN0 A;  3FXM A;  1GVD A;  5DV5 A;  3OYJ A;  4A6D A;  1ZQ3 P;  4AWX B;  1APL C;  2QKL B;  2P8T A;  3LQQ A;  2FX0 A;  4ZYD A;  2H1L A;  4M3B A;  3CP8 A;  3TED A;  1W36 C;  1L3L A;  1GDT A;  3J7Z I;  4HF2 A;  3KX2 A;  1YG2 A;  4XRS A;  4EQQ A;  2QQB A;  4B09 A;  3JRD A;  1TQM A;  2BXY A;  3DU5 A;  2PFB A;  2VQC A;  4UUT A;  3OYH A;  2KIS A;  2P0W A;  2HEO A;  1A6Q A;  2W85 A;  5EYR A;  1P9Q C;  3OV8 A;  3CCY A;  3IH4 A;  1F9N A;  5H6Q A;  4E7J A;  2XUB A;  2HYF A;  2QQA A;  1E3H A;  3NQO A;  4LJZ F;  3A01 B;  1N78 A;  1MMN A;  2X9D A;  4A2U A;  3ZQL A;  4WXD A;  5HNH A;  5EG0 A;  3GTQ J;  4XID A;  1MBJ A;  1W5S A;  5CVJ A;  2FEZ A;  2JUG A;  4A3C J;  4IL6 C;  1B1B A;  1DGR M;  3E97 A;  1N77 A;  1FBU A;  4RAF A;  4KA4 A;  3LSP A;  4GO1 A;  4XKV A;  1ORK A;  2DFH A;  2M0C A;  3I71 A;  1IF1 A;  2CUZ A;  3OYL A;  1XMA A;  4YFN F;  3OWT A;  1JI8 A;  2UUZ A;  1LVA A;  3MZ8 A;  4Y3O A;  4XOT A;  2E2H J;  1BW6 A;  3A1Y A;  1T2K A;  2HOE A;  5LFA A;  3WOD F;  3L2V A;  3A2K A;  4KIF A;  1X1C A;  4BDZ A;  1OCZ H;  1Z7U A;  1UHW A;  4ZZL A;  4BHP A;  1FSH A;  1OCR H;  4GXO A;  2EJR A;  4A69 C;  3E5U A;  3EET A;  3ZMU A;  4PGG A;  2L02 A;  4N4O B;  1JT0 A;  2DYR H;  1YYV A;  4NUB A;  2DA1 A;  1X3U A;  1XS9 A;  2L9V A;  4XOR A;  1H88 C;  1YS6 A;  4N0B A;  2IGN A;  3RKX A;  5E20 A;  4NQW A;  5HLI A;  1K4S A;  1SD6 A;  4HG2 A;  2QYO A;  5EEH A;  5C3E J;  3JRG A;  5KCM A;  3GTO J;  4AVZ A;  2VJ5 A;  2QM3 A;  1IN4 A;  4DOZ A;  1H89 C;  1F43 A;  4I99 C;  1R4M B;  4PDK A;  3SQN A;  3I55 I;  1BJA A;  1MJB A;  5CVR A;  2X6O A;  4HX7 A;  1O7F A;  3A03 A;  4OAZ A;  1UMQ A;  4A3E J;  2VC1 A;  5ICE A;  3MFK A;  1ZAR A;  3KCC A;  3VPR A;  1O3R A;  2OUM A;  3RYP A;  1GLN A;  2O8X A;  1UB9 A;  4YG2 F;  2IGK A;  3OR1 C;  5FRO A;  4HQE A;  4XN3 A;  3CMA I;  4L5E A;  1MMG A;  2B0L A;  2MD0 A;  5BMZ A;  4BJT A;  2DAO A;  2DK8 A;  3FHZ A;  2HGC A;  3ZMT A;  3L9F A;  4DQ2 A;  1YS7 A;  2O61 A;  1X1P A;  4LLN A;  3FM5 A;  2V1N A;  2LF8 A;  4KIB A;  5GAE J;  4BYY A;  5KHD A;  2WY8 Q;  2HS5 A;  2E36 A;  3LFK A;  4L18 B;  1K83 J;  2JT1 A;  5FLX Z;  3S3M A;  2L2O A;  2EBI A;  2F5F A;  5ILS A;  4RB1 A;  1NK3 P;  2HOT A;  4F92 B;  5A2Q Z;  2W00 A;  2CQK A;  2FE3 A;  3S93 A;  1PDN C;  2DA3 A;  5LEK A;  2Z33 A;  4BXX J;  1MBG A;  2V79 A;  5IOY A;  4ETS A;  2PQ8 A;  2CQ7 A;  3GZN B;  4L9J A;  3BY6 A;  2IT0 A;  3SZP A;  2A5W A;  3CJN A;  2JTV A;  5CQE A;  3RIR A;  3JRH A;  2K5C A;  3DKY A;  2TCT A;  2RKH A;  2XAQ A;  2X6W A;  2V1U A;  2PMH A;  3H3U A;  4LIU A;  5GPC A;  2E7W A;  4XLH A;  2JJ7 A;  1TWG J;  1SVM A;  3ZPL A;  3BR5 A;  3M7G A;  3HOV J;  1I50 J;  1JUP A;  4M3F A;  5FKM A;  2MBF A;  4KYW A;  1SVO A;  2WC2 A;  5LGN A;  1A31 A;  3FKI J;  4NC8 A;  4P96 A;  3G71 I;  2PMU A;  1QNT A;  4PJL A;  3QOE A;  4AD9 A;  1YE9 A;  5JLX A;  2PEX A;  3IKV A;  4CH7 A;  2TRT A;  1BIB A;  1WFX A;  2I5U A;  2DA4 A;  4MQ9 F;  4E70 A;  1DPU A;  2LRE A;  3CUQ C;  1SFE A;  4KIG A;  5FKK A;  2BY2 A;  2OBP A;  2KQR A;  1ON1 A;  1K7A A;  5HS9 A;  3ELK A;  4PFO A;  3I56 I;  5EF6 A;  1AKH A;  3SEQ A;  4J19 A;  3CDI A;  3T1B A;  4I6Z A;  4PSW A;  5DTD A;  1OR7 C;  4G6T B;  3TO7 A;  2ZBK A;  4M71 A;  3OYB A;  5F27 A;  4GFB A;  2CFO A;  1J75 A;  2IA2 A;  3RPU D;  1IAW A;  4EJV A;  4M3G A;  2JRT A;  1Z91 A;  2BY1 A;  2KFD A;  2OU2 A;  2M9H A;  2LTP A;  2RRE A;  3CMM A;  3FMR A;  2H1K A;  2ISZ A;  2NVU B;  1FTZ A;  1ZRF A;  5HVQ C;  1WI9 A;  1F36 A;  2V6E A;  5K7Z A;  4XK4 A;  2IGM A;  1QZZ A;  3B02 A;  3I9V 2;  2CQQ A;  2L4M A;  2XGX A;  4FIS A;  4BHB A;  2QUF A;  5D8K B;  1QVU A;  3J7A Y;  2W1O A;  1QVT A;  2QLZ A;  3HSF A;  2CG4 A;  1MSE C;  2ZFW A;  1KU2 A;  2E35 A;  1R1U A;  2RV8 A;  2XAJ A;  1REP C;  2LBF A;  3R0A A;  4BEH B;  3GXO A;  3WTX C;  3CME I;  4X6A J;  1O7L A;  3JCU C;  2FOW A;  3OIO A;  3F9K A;  2EIK H;  3W2W A;  2JVG A;  5HOD A;  4L9V A;  4ZC3 A;  3ULQ B;  1FOW A;  2RGV A;  2FJ1 A;  2MC3 A;  5GTH C;  2CGP A;  2M8G X;  3T8R A;  4N9I A;  2W57 A;  3OOU A;  5K7H A;  4U88 A;  3K6G A;  1HSJ A;  4BE1 A;  2EV5 A;  2XF6 A;  3H36 A;  3OL4 A;  4E7L A;  1V3F A;  3ZMS A;  1MIJ A;  2L5Q A;  2VXD A;  2BXZ A;  2FOK A;  2XF7 A;  2R7S A;  4A5N A;  2R7T A;  2CYY A;  2YUS A;  1YW8 A;  2BV6 A;  2JPB A;  1W5T A;  1B4A A;  2NS8 A;  1BR1 A;  2X48 A;  1H0M A;  2GXA A;  2E2I J;  4JK1 X;  2MYS A;  3OYA A;  3LL7 A;  1UST A;  4N4N B;  1A35 A;  2JUC A;  3TL4 X;  4LB5 A;  2XKP A;  1T98 A;  4DZJ A;  5DEQ A;  2DLL A;  3Q0U A;  2NVX J;  4D7M A;  1QA6 A;  2R93 J;  1YW9 A;  5H2F C;  3OYD A;  3WGG A;  3ZMD A;  1XD7 A;  1JGG A;  2OCE A;  4KDP A;  2R7Z J;  4YII A;  2JA2 A;  1DU0 A;  1X3W B;  4MEY F;  2V9K A;  2DMQ A;  4LIV A;  2DN0 A;  1IN5 A;  2LY9 A;  1BA5 A;  3MKZ A;  2QSF X;  3WE3 A;  3I4N J;  4TV7 A;  5BNG A;  1I1G A;  3QWL A;  1MKM A;  2K86 A;  3BC8 A;  3MZH A;  5FD5 A;  2CH0 A;  5DM7 F;  2NVQ J;  1MDM A;  1SAN A;  1QO0 D;  1XGN A;  2RNG A;  3ABT A;  4CYC A;  3WTU C;  4ZDP A;  4JBA A;  1LE8 A;  3PFI A;  4O3M A;  4IX7 A;  3KP7 A;  1I1S A;  3I59 B;  2MC4 A;  5KAI C;  3F22 A;  2BOL A;  2HPI A;  4HAM A;  1MBE A;  4IXA A;  3MAJ A;  4EJO A;  2UWM A;  2DA5 A;  3NAR A;  3MKW B;  4P5O A;  1W7P D;  3PIO F;  3CLQ A;  4BXU A;  4UNO A;  5TJJ A;  1U9O A;  3QQA A;  4EGY A;  5FJ8 J;  1XDS A;  3F3X A;  1OCP A;  1RET A;  3SDB A;  1I6X A;  5LD2 C;  2NNY A;  5E1W A;  1K61 A;  4PJM A;  1BIA A;  4FET A;  5FLM J;  2P7C B;  1OQY A;  5B1B H;  4D1Q A;  4C9Y A;  3KIO A;  5JFR A;  1U5T A;  2R4G A;  4FE4 A;  4A3F J;  4BE0 A;  3A02 A;  2OTL I;  2H6B A;  2WAD A;  3CCL I;  1ULY A;  4BE2 A;  1LEB A;  5HDG A;  1STZ A;  2AQE A;  2Y0S A;  4HQM A;  2AQF A;  2XIG A;  3LQR A;  2DQR A;  1LQ1 A;  1BC7 C;  4WWC A;  3DLA A;  4I09 A;  4RDU A;  3H1C A;  4NNJ A;  2ESH A;  1VQL I;  2GZW A;  4N9H A;  3ZQF A;  2YPR A;  4OIP F;  1HDP A;  2VE8 A;  3BP8 A;  4Z2Y A;  1IRG A;  1MDM B;  1IC8 A;  2NAZ A;  3RYR A;  4BQO A;  4IOA F;  1OYI A;  1KU3 A;  2LSO A;  1G4D A;  1ON2 A;  1E3P A;  4CSW A;  4XLE A;  1CF7 A;  1HKT A;  3RDI A;  2FXA A;  1IXR C;  3TO6 A;  4HX4 A;  4HF0 A;  2LDU A;  3V4G A;  2VBW A;  3QOD A;  3PO2 J;  3CUQ B;  3CCR I;  5K5Q A;  1OCO H;  3O6B B;  3I58 A;  3R61 A;  4ZH4 F;  1F4K A;  3BWG A;  2L7M P;  1RIO H;  1BI0 A;  3LSI A;  1S72 I;  3H0G J;  2M45 A;  1DU6 A;  3IL2 A;  1UJ8 A;  3FDY A;  1HXD A;  1R5G A;  1LE8 B;  1ZG5 A;  4OIQ F;  3A4C A;  5HDN A;  5E3N A;  3ABL H;  5IOZ A;  2OD5 A;  4X1E A;  2AXL A;  3LAJ A;  3V42 A;  4IJA A;  4PJJ A;  4AU7 A;  2KZG A;  4ENN A;  4CCN A;  1FZP B;  4NDL A;  4AC0 A;  1XMX A;  3V8K A;  1MMD A;  1KYZ A;  1IN8 A;  5KK1 A;  1V4R A;  1UEL B;  3KLN A;  2CV0 A;  2YSR A;  3HRM A;  1TT5 B;  5LBQ A;  2E1O A;  4ZDO A;  2KKO A;  2VQG A;  2CV2 A;  2WAQ A;  4EM2 A;  2XHK A;  5DYM A;  4IPA A;  2X85 A;  2VON A;  1JTY A;  3F6O A;  2QCO A;  2FF4 A;  3M1C A;  4LLG F;  3IKT A;  3WG7 H;  2Y9Z A;  5EGO B;  4F91 B;  4F7Z A;  1FYM A;  4F52 A;  1TP4 A;  3SHF A;  2IGO A;  2NS7 A;  2VB6 A;  4GYI A;  2I10 A;  1R71 A;  3CJQ B;  2O5R A;  2BY3 A;  1KYW A;  4A3J J;  5HDK A;  3L09 A;  4BY1 J;  3K4C A;  1CQT A;  3DTK A;  4F55 A;  4Y33 A;  4OIN F;  3COA C;  5IT9 Z;  3W6J B;  1LVK A;  1WVR A;  1MH3 A;  3BT9 A;  3RPQ A;  5E3L A;  5HS8 A;  1X1D A;  4M72 A;  1LFU P;  4IRG A;  1IDY A;  4A12 A;  3Q9S A;  3PSI A;  1YHQ I;  2A61 A;  2VJI A;  3BG7 A;  1ZLK A;  4HNU A;  3CCQ I;  5BPI A;  1IZ1 A;  4WXC A;  5DUI A;  1HKS A;  4MTE A;  2EIL H;  2W82 A;  5JHF A;  3C3W A;  4Y7N J;  2FML A;  2VAS A;  2HQR A;  4G12 A;  4FCY A;  3FZV A;  3DP7 A;  3H3Z A;  4PZJ A;  1T56 A;  2XAG A;  4RAZ A;  4C30 A;  3LFU A;  2Z2S B;  1IG7 A;  2NVY J;  1ZRD A;  1QHG A;  4BBR J;  2KIQ A;  3ECH A;  2K3P A;  3E7L A;  1IDZ A;  4BBS J;  2Q0O A;  2A05 A;  2IP2 A;  1TNS A;  2IPQ X;  1PP7 U;  1JUS A;  5AIP A;  1FBS A;  3ML6 A;  1PUF B;  1W7P A;  2JPC A;  3FIW A;  3TDZ C;  1NH3 A;  1SFX A;  3S17 J;  4HEA 2;  2HKO A;  3CCE I;  4M73 A;  1Y8Q B;  1B9N A;  2OQG A;  4NB5 A;  2XC7 A;  1RRJ A;  1ZTR A;  3PQJ A;  4QSH A;  3ZQH A;  1P92 A;  2V9V A;  2KIU A;  4RGS A;  3RKY A;  2HOS A;  1D1C A;  2MFZ A;  3P9C A;  3JTG A;  4GDF A;  3BTC A;  4DZP A;  2BZT A;  3V7R A;  4B48 A;  4A3G J;  2NOG A;  3TO9 A;  3BTI A;  4OOI A;  2IS4 A;  2VL8 A;  2LR8 A;  1D3Y A;  2HZT A;  1HW1 A;  1YX5 A;  4XR6 A;  5FB2 A;  2DFF A;  5E8G A;  2COB A;  1HOM A;  4IHY A;  3A01 A;  2ELK A;  3E6D A;  3P5J A;  3N97 A;  1Z3Y A;  4QIW N;  5LRS A;  1SEU A;  3W6K B;  4HNV A;  5JI6 A;  4G6D A;  2IA1 A;  3EYI A;  1RUN A;  4PK4 A;  2NOJ B;  1FT9 A;  2DPD A;  2FRH A;  1FYK A;  2HQN A;  3QYB A;  2W4S A;  3GTM J;  3S1M J;  1LFP A;  3K4K A;  2W48 A;  1U9N A;  3I3L A;  2Z1D A;  4PSX A;  4BAY A;  1MW7 A;  3ESW B;  3HG9 A;  4HF1 A;  2CMP A;  2CWE A;  2D1H A;  3IV5 A;  5IYB J;  5D5U B;  2VXZ A;  4XQF A;  3S14 J;  2A6H F;  3E3V A;  2KZV A;  1T0F A;  3DPU A;  3D0S A;  5DD4 A;  3NRV A;  4KIT B;  4G7H F;  4C2M J;  3T0Y A;  3OYM A;  2EFQ A;  2L54 A;  3K4M A;  4UVC A;  3U21 A;  2XSD C;  2BVL A;  2FNP A;  2CQN A;  3RZD J;  1NHA A;  4UB6 C;  1QBJ A;  1DP7 P;  1ZGA A;  4M9S A;  3K70 C;  3OR2 C;  1OLT A;  3CLO A;  2OV7 A;  2HDW A;  4YFK F;  3S2H J;  1Z77 A;  3H92 A;  2ETH A;  2JVH A;  5CVV A;  1Z3X A;  3H0D A;  4U0W A;  4RMN A;  3J80 Z;  3G2B A;  3PNT A;  3WTZ A;  3HUG B;  3WGI A;  1YIJ I;  1I3A A;  1FLI A;  1MMA A;  3S3O A;  1RC9 A;  1EH7 A;  3MWM A;  1P4W A;  5K5O A;  3FMS A;  1TWA J;  3CES A;  4RM3 A;  3GX4 X;  1T95 A;  1BR4 A;  2K85 A;  4GGG A;  2LG4 A;  2WWY A;  1U78 A;  2F6C A;  3HXL A;  3LSK A;  1GVJ A;  2K9M A;  4WF2 A;  2WY7 Q;  3LNQ A;  2Z3Y A;  3D5S C;  2ZXJ A;  3ZMZ A;  2F5E A;  2JQ7 A;  2H94 A;  2ME6 A;  2W84 A;  4PCQ A;  1U3E M;  2O8K A;  2ZME B;  5L3G A;  2L3D A;  3RPU A;  2X51 A;  3QRF F;  3LSH A;  2QGU A;  3QPS A;  2NXN B;  2LNB A;  3C1D A;  1VZ0 A;  4BHC A;  3FMQ A;  3M8J A;  4S0H B;  1WCM J;  4WCG A;  2F4M B;  1CF7 B;  3B73 A;  2DOE A;  4HPQ A;  3TW6 A;  2DMU A;  4OMY A;  1ETO A;  3EPZ A;  3K69 A;  2CJJ A;  1YRN B;  1ACI A;  3BRO A;  4DJA A;  1LUJ B;  3SEZ A;  3PJR A;  3IP4 B;  5CLS A;  1VQ8 I;  3FF5 A;  4U0Y A;  1TWH J;  4HLY A;  4RS8 A;  1XX5 A;  3J81 K;  1Y1W J;  2XPV A;  2G7U A;  3Q9V A;  3JR9 A;  3DWL E;  1ETW A;  2ZJQ F;  1V54 H;  1WJB A;  1HQC A;  2X4H A;  2R3S A;  2HNH A;  2VIX A;  3H5A A;  1R1V A;  2KP6 A;  3CDL A;  3KZI C;  1T8I A;  1WJA A;  2OQR A;  3EDP A;  4XN0 A;  2V6C A;  2GAU A;  4EAT A;  1FYL A;  1OR7 A;  2GIZ A;  2XV4 S;  3MZY A;  3ZXS A;  1W1W E;  3KP3 A;  2M30 A;  1S8N A;  4HRI A;  2EFN A;  3WG9 A;  2DDB A;  3BG5 A;  3BPV A;  1G3W A;  5C4J J;  2XSJ C;  1SD5 A;  2Q8K A;  3M8F A;  4JQF A;  3TKY A;  3CQZ J;  3DBR B;  5CJ9 A;  3RCO A;  4CYC B;  2ME0 A;  2R7R A;  5M3F J;  4BL0 B;  2F48 A;  1PUF A;  4HA8 A;  3CCU I;  3ASN H;  5J40 A;  3TMO A;  4DBQ A;  4ABZ A;  4DBR A;  2H09 A;  4HLX A;  3HB9 A;  1Y0N A;  4ZZD A;  2X0L A;  3OSG A;  1FY7 A;  1Z7L A;  5JHU A;  2CV1 A;  2VPL A;  3DPL C;  4DYQ A;  4PJ0 C;  4IHW A;  3HL2 A;  1XDU A;  5F64 A;  3DTE A;  1O57 A;  2X1C A;  4G8X A;  3L00 A;  1ODD A;  3PQK A;  2KRC A;  4IOC F;  2UXN A;  1J0R A;  5AON A;  4UUV A;  3VYT B;  4B8X A;  1BOA A;  3PM1 A;  2ZFU A;  1DP3 A;  1I6H J;  2PBI A;  3REO A;  3EQL F;  1BC8 C;  2HVR A;  1E2X A;  2ISY A;  1IRF A;  1X58 A;  1EV7 A;  1ENH A;  1XN7 A;  4CZC A;  3U1D A;  2ACJ A;  5IPA A;  4QLC U;  1QRY A;  2A07 F;  4CIC A;  5E1X A;  4YRV A;  3OYE A;  1VQ4 I;  3F8C A;  3O3K A;  1JT6 A;  3EUA A;  3BQZ A;  4DNC A;  1OPC A;  5EEG A;  5F08 A;  5D5V B;  2MLG A;  3HM5 A;  4HBL A;  1W0T A;  3OYN A;  3M3Y J;  3WGH A;  2R0Q C;  1NK2 P;  3HRS A;  1R4N B;  4AIH A;  5IT9 K;  3BPX A;  2L7F P;  3AG4 H;  1QHH D;  3VB2 A;  4AIK A;  1ZG3 A;  1W36 D;  3BG9 A;  3D1N I;  1UFM A;  4UVA A;  3CF5 F;  2K40 A;  1YX3 A;  2VN2 A;  1TTY A;  5GTI C;  1QZY A;  1W0U A;  3F8M A;  1H9T A;  5F0H A;  3E5Q A;  3S16 J;  4D0P A;  5A2Q K;  1J09 A;  2KJB A;  1OCT C;  2DMP A;  4CCK A;  1IRX A;  3BR3 A;  2Y2Z A;  3F0C A;  1XTA A;  1XMK A;  4JX5 A;  4IHS A;  3CO6 C;  4I01 A;  2AS5 F;  1R9T J;  4RLQ A;  1YJ9 I;  3PO3 J;  1IXS B;  3G1L A;  1KU9 A;  2Y0M A;  2YU3 A;  3CDH A;  2K02 A;  3S2D J;  1OKR A;  2Y31 A;  4I02 A;  2DI3 A;  4XMY A;  5ERI A;  2KT0 A;  4ENJ A;  2EV0 A;  1HC8 A;  3FXK A;  4UUS B;  5FRM A;  1VF9 A;  5EJC A;  4DIQ A;  1V5F A;  4OAY A;  2CQX A;  3TBI A;  3FXR A;  2MSY A;  5EEA A;  4MTD A;  2IVM A;  2M87 A;  2O3F A;  2M2E A;  2Z9O A;  4XRM A;  3K0L A;  3W3C A;  4DW6 A;  3MEX A;  2BGC A;  1XSX A;  2W7N A;  5E8I A;  4IVN A;  4UVB A;  3NWT A;  1VI0 A;  4E7H A;  2BE5 F;  1VQ6 I;  2XKO A;  3K1M A;  2YS9 A;  4UY8 I;  4AIJ A;  2HVQ A;  3K4J A;  5J1R A;  4XM3 A;  4IRH A;  2K4J A;  1W7P B;  1GT0 C;  4XSX F;  1MBH A;  2K4B A;  1JKR C;  3H5R A;  2WV0 A;  3BCB A;  5EGO A;  1SC7 A;  2EH3 A;  4HV5 A;  4E7I A;  3L1P A;  4C2T A;  4IHX A;  3GUD A;  5B3S H;  4KIC A;  1WI3 A;  2H6C A;  2VBY A;  5E18 F;  3ZP5 A;  1Y8R B;  4ENM A;  2P7V B;  4LIT A;  2L9N A;  1VQM I;  3H9Q A;  2V4J C;  4Y15 A;  1OFC X;  3HIF A;  3F23 A;  3T8T A;  3ZOB A;  4AID A;  3ZQC A;  3OIP A;  2YR2 A;  1G3Y A;  1U6G A;  2P81 A;  1SFU A;  2FMY A;  4CCL A;  2XRO A;  3QYE A;  5EZG A;  1BI3 A;  3OYI A;  1KQ8 A;  3UKG A;  4B3A A;  1WJC A;  1ZR2 A;  2LLK A;  3FXU A;  1IUY A;  1XG1 A;  1ETV A;  3VYR B;  2MGQ A;  3PUF A;  4EJU A;  1HA8 A;  1YW7 A;  4XBF A;  2E1N A;  1TL8 A;  2X1E A;  3C7J A;  1ZN2 A;  3WU0 A;  1A36 A;  3DXJ F;  1R58 A;  1YJW I;  3TOA A;  4FX0 A;  1YTY A;  2M4K A;  3SXY A;  4A3K J;  4YFX F;  2R7D A;  3K1P A;  2G7H A;  1Y1V J;  1YIT I;  2KLO A;  5ICF A;  2K9S A;  3IHU A;  2H8R A;  3GEZ A;  3G3Z A;  4EVI A;  4Q5S F;  2R5Z B;  1Z9C A;  2B9S A;  2XF5 A;  2R5Y B;  2VUM J;  3C2B A;  3HZJ A;  2DTZ A;  3JRE A;  2XAU A;  2QKM B;  2DYS H;  4LK0 F;  1HW5 A;  5TIS C;  1T6S A;  4B1R A;  2G0E A;  4A3I J;  4QPQ A;  1OYW A;  3EUH A;  2ID6 A;  3GF2 A;  1X2M A;  2UV1 A;  2RAE A;  2DA7 A;  3DEW A;  3HYI A;  3ONQ A;  5E3O A;  3IRQ A;  2MAB A;  4B3X A;  4QTR A;  4A5M A;  2NRA C;  1S29 A;  5LRR A;  2WAQ N;  4II3 A;  1FJL A;  2K9L A;  4CCM A;  3EYY A;  2PJP A;  3J80 K;  3NWS A;  5EG0 B;  2XVC A;  3RQ4 A;  2VPR A;  1RR8 C;  1RZ4 A;  1G59 A;  3CF2 A;  2VQL A;  4C3J J;  3H9J A;  5FD6 A;  1B59 A;  2FU4 A;  4GRI A;  2R92 J;  1QPM A;  1HLV A;  1P4A A;  1ZR4 A;  1P2F A;  2CRG A;  5CPR B;  1JE8 A;  3VOD A;  3CCJ I;  1FOX A;  2VE9 A;  3I53 A;  1LPQ A;  1HCR A;  4Y52 J;  4CZZ A;  4U7D A;  2DFE A;  2MH9 A;  5GAH J;  5M5W J;  1CGP A;  1R00 A;  3HOS A;  3QP5 A;  2A69 F;  3CJT B;  5C44 J;  3KFW X;  3V7C A;  2LMD A;  4JX6 A;  2E5N A;  4B47 A;  4HDV A;  3RTR A;  3K4N A;  5KAF C;  2W24 A;  3DU6 A;  1R22 A;  5DCM B;  1IJW C;  1IN6 A;  2O03 A;  3DQV C;  2ZSH B;  3HSE A;  2HTJ A;  4FT8 A;  2L01 A;  2D5V A;  1D5V A;  3FK7 A;  3ERE D;  1H9G A;  4A0Z A;  4FAS D;  5ICG A;  4R8H A;  3MN2 A;  1B8I A;  4UHT A;  4CXF A;  1OCC H;  3GVA A;  1JJ6 C;  4IF4 A;  2XAH A;  1T0F C;  2EZL A;  3I4P A;  1FP1 D;  1SD4 A;  2E19 A;  4XKW A;  1PYV A;  5DUK A;  3RI4 A;  2ICW G;  4CGZ A;  2BBY A;  4XLC A;  3BOQ A;  3MD2 A;  1WWX A;  3OIQ A;  2IW5 A;  2GXG A;  2EV6 A;  1KGS A;  4LOC A;  3CMY A;  4PUS A;  4JOM A;  3TQN A;  4BQA A;  3AG1 H;  2EQR A;  1UZC A;  4J00 A;  4HX8 A;  3RSN A;  4XRS G;  1XGS A;  1ZG1 A;  2P5K A;  4FTH A;  2O6G E;  1BOB A;  2WB1 A;  2VJ4 A;  1X4O A;  4HNT A;  4RGR A;  3AFH A;  1KZH A;  5DDG A;  1UG0 A;  1FEX A;  3J7A O;  1ZLJ A;  2XGD A;  4XRF A;  2M5W A;  4BDY A;  1E3O C;  4NC7 A;  1O3T A;  2GM4 A;  1T08 B;  3QU6 A;  3AKZ A;  3GTK J;  3FXQ A;  5FKL A;  1BI2 A;  2EPF A;  2E1M B;  2L9R A;  2P6T A;  2CUF A;  1LFB A;  1S9H A;  3LAP A;  2HU9 A;  3WTS C;  2L7Z A;  4E6K G;  4PFP A;  2PMZ N;  3I5U A;  4BEH A;  2JA5 J;  2BHY A;  2F5V A;  3HC7 A;  1WHU A;  3QU3 A;  1LDK B;  2ELJ A;  4NBQ A;  1T39 A;  1VQK I;  3A0H C;  4FX4 A;  3F8F A;  4MHG A;  2QSH X;  2GLO A;  5HNF A;  3IH2 A;  3ZGK A;  1C0W A;  2ECB A;  2CUE A;  3FWE A;  2BY0 A;  1PP8 F;  1TWF J;  3K2Z A;  1TWC J;  4P9U A;  1O3S A;  1RPW A;  3R60 A;  5D4S A;  2EIM H;  3GTP J;  3LSG A;  1ETQ A;  4KIS A;  4CCO A;  2DJN A;  5B1A H;  3B6A A;  2ZXW H;  2G9W A;  2IXS A;  3HUG A;  3FX3 A;  3ISP A;  3HHH A;  1HF0 A;  3MQ0 A;  1AU7 A;  4I2O A;  2XB5 A;  2WA0 A;  2BYV E;  2KPM A;  4EM0 B;  2WBM A;  2TDX A;  4BS9 A;  3E6M A;  5LHG A;  4RB3 C;  4BAC A;  5F0F A;  2FNA A;  4I0A A;  4UV9 A;  1GUU A;  4W1U A;  2XPW A;  1S5L C;  3TP0 A;  4RGX A;  3I59 A;  5FKO A;  2CU7 A;  4G6Q A;  4HST A;  5JVT A;  3CC7 I;  2XRL A;  1FMW A;  3FXO A;  3TW7 A;  1K4T A;  3BR6 A;  3ZQQ A;  1XCV A;  1TT0 A;  2WTE A;  3HKZ N;  2EA2 A;  5LGU A;  2MH2 A;  3I64 A;  4L9T A;  2HDD A;  3QPT A;  3DTI A;  2P6S A;  1MSF C;  4F93 B;  3QYF A;  1WJ5 A;  4UV8 A;  3LA7 A;  4XON A;  1HKQ A;  1JKP C;  3GME A;  5H6R A;  4EGZ A;  2QEN A;  5J3L A;  2OPT A;  1WJD A;  2HR3 A;  4J01 A;  5KVR A;  4AVP A;  4OWR B;  3E0J B;  2B7E A;  2DA2 A;  4LG0 A;  4A3M J;  4HOB A;  3S1Q J;  9ANT A;  4XOP A;  3S3N A;  1EF4 A;  3M9A A;  2ZJP F;  3GZ5 A;  4RM2 A;  4M9X A;  1U8R A;  2ZO4 A;  3M4O J;  1T33 A;  1N25 A;  1SFO J;  4GYG A;  2F2E A;  1Z05 A;  3KP6 A;  2M3A A;  2ZNZ A;  1EH8 A;  4KT6 A;  4BNC A;  2EK5 A;  2LY2 A;  1ZGW A;  3FKJ A;  3NAU A;  4QPO A;  3F8N A;  3CTA A;  4Y13 A;  5GAG J;  1WH5 A;  3ZR8 X;  1SMY F;  2X6X A;  5B66 C;  1RKW A;  4O6J A;  4EJW A;  3WTW C;  3JRA A;  2VOD A;  2HOA A;  2HYG D;  3KP5 A; 
#chains in the Genus database with same CATH homology
 4XIC A;  1RKT A;  4J19 A;  4I6Z A;  5DTD A;  2IAI A;  3BR2 A;  1TWH J;  5J1Y A;  5F27 A;  4GFB A;  2R5Z A;  1Y1W J;  2XPV A;  3JR9 A;  1RES A;  2R5Y A;  1ETW A;  2HXI A;  5FKN A;  4M3G A;  3S1R J;  1P7J A;  2LKX A;  3HOW J;  2M9H A;  2LTP A;  2OF7 A;  3CDL A;  1HDD C;  2H1K A;  2XB0 X;  1WGX A;  3BR0 A;  1FTZ A;  1VFC A;  2FQ4 A;  1F36 A;  2M34 A;  5K7Z A;  4XK4 A;  2CQQ A;  2QF7 A;  3BG5 A;  4FIS A;  3JRI A;  5C4J J;  4A3D J;  1QVU A;  3CQZ J;  1QVT A;  2B63 J;  3IH3 A;  3HEF A;  4CYC B;  2ME0 A;  5M3F J;  1MSE C;  1PUF A;  3K2A A;  1WH7 A;  1A6I A;  1D5Y A;  4ABZ A;  4X6A J;  1JTX A;  3FK6 A;  3HB9 A;  3OSG A;  3OIO A;  4DYQ A;  4IHW A;  5IP6 A;  5HOD A;  3W6V A;  3LSR A;  4MIM A;  2FJ1 A;  3WHC A;  2M8G X;  3OOU A;  5K7H A;  3JRC A;  2JA8 J;  3PM1 A;  2VI6 A;  4B4C A;  1I6H J;  3BQY A;  2HYJ A;  3GBG A;  5GP9 A;  3DCF A;  1X58 A;  1ENH A;  5IPA A;  1QRY A;  2JN6 A;  2YUS A;  3S1N J;  2LD5 A;  1ZKG A;  1JT6 A;  2NS8 A;  3BQZ A;  4A93 J;  3GTJ J;  2FD5 A;  3O8H A;  2X48 A;  4DYR A;  2E2I J;  5F08 A;  3HM5 A;  4AUX A;  1W0T A;  2EZK A;  3K7A J;  3SJM A;  1H8A C;  3M3Y J;  2R0Q C;  1NK2 P;  4BKX A;  1O4X A;  4M3E A;  4DZJ A;  1QPI A;  2GBY A;  2L7F P;  3Q0U A;  2NVX J;  4JX4 A;  3BG9 A;  4D7M A;  3D1N I;  5F04 A;  1MH4 A;  2R93 J;  2K40 A;  1JGG A;  5JLW A;  2R7Z J;  1W0U A;  1DU0 A;  5F0H A;  2LK2 A;  2XGC A;  1UG2 A;  3BR1 A;  3S16 J;  4JYK A;  2DMQ A;  1FTT A;  2DN0 A;  4I76 A;  2LY9 A;  1BA5 A;  1OCT C;  2DMP A;  4D5F A;  3BR3 A;  3F0C A;  1ETK A;  2Y2Z A;  3TP3 A;  3I4N J;  4JX5 A;  5BNG A;  2ZB9 A;  1R9T J;  2NVQ J;  3PO3 J;  3G1L A;  3S2D J;  1SAN A;  4MO7 A;  2Y31 A;  4CYC A;  5IYD J;  1IGN A;  2KT0 A;  1LE8 A;  1IUF A;  1MNM C;  1WPK A;  4V2F A;  2ECC A;  4UUS B;  1MBF A;  2DA6 A;  5E3M A;  1VF9 A;  3O8G A;  2K9Q A;  1MBE A;  5K7F A;  2CQX A;  1FIP A;  1ETY A;  5EEA A;  2MSY A;  2DA5 A;  2M2E A;  3NAR A;  4XRM A;  4DW6 A;  2DMT A;  1GV2 A;  1U9O A;  3QQA A;  5M5X J;  3LOC A;  1VI0 A;  5FJ8 J;  1OCP A;  1RET A;  3MVP A;  1NTC A;  1K61 A;  3HOZ J;  2YS9 A;  4FE7 A;  4C3I J;  5FLM J;  5J1R A;  2HI3 A;  3GTG J;  3Q3S A;  2JK3 A;  1GT0 C;  4FE4 A;  1MBH A;  3I4M J;  3ZQI A;  1JKR C;  4A3F J;  3A02 A;  5EGO A;  1X2N A;  5DS9 A;  2EH3 A;  1YRN A;  2HXO A;  3L1P A;  3S15 J;  4IHX A;  4JP0 A;  1ZK8 A;  1WI3 A;  3RZO J;  2NVT J;  4M3D A;  4RDU A;  4EEF G;  2VKE A;  1G2H A;  1OFC X;  3ZQF A;  2ID3 A;  3ZOB A;  1HDP A;  3ZQC A;  2P81 A;  4UUS A;  5EZG A;  5J1U A;  3WHB A;  1IC8 A;  3UKG A;  5C4X J;  3JRF A;  1POG A;  4B3A A;  5M5Y J;  1ZR2 A;  1FIA A;  2LLK A;  1B72 A;  1JKQ C;  2O9L A;  1XG1 A;  1ETV A;  2Y30 A;  2EZI A;  2MGQ A;  3SFI A;  2K9N A;  1A5J A;  1Q1V A;  3PO2 J;  2WB1 N;  4A3K J;  2L7M P;  3HOX J;  1Y1V J;  3H0G J;  2K9S A;  1DU6 A;  4W97 A;  2H8R A;  2YU9 J;  4A3L J;  2E2J J;  2R5Z B;  2HQ5 A;  1LE8 B;  2JMW A;  2R5Y B;  2VUM J;  3C2B A;  3JRE A;  2DTZ A;  2O7O A;  5E3N A;  3OSF A;  4D5C A;  4B1R A;  2VKV A;  5IOZ A;  2G0E A;  4X1E A;  4A3I J;  3JRB A;  2ID6 A;  4AYB N;  1X2M A;  2LVS A;  2RAE A;  4NDL A;  2AO9 A;  2DA7 A;  3DEW A;  2AHQ A;  4AC0 A;  4D7N A;  3RKQ A;  5E3O A;  4QTR A;  2WAQ N;  2E1O A;  3G1M A;  1FJL A;  4IEJ A;  1JTY A;  1BJZ A;  2QCO A;  5EG0 B;  1UHS A;  1TC3 C;  1I3Q J;  2VPR A;  3Q0V A;  2Y9Z A;  5EGO B;  1JUM A;  3RQI A;  4C3J J;  5IP9 J;  1IV6 A;  3HOY J;  2R92 J;  1GVD A;  1HLV A;  1ZR4 A;  2CRG A;  1ZQ3 P;  4M6V A;  2NS7 A;  1APL C;  3ZQG A;  2I10 A;  1HCR A;  2FX0 A;  4M3B A;  4RBO A;  3TED A;  1GDT A;  4A3J J;  4Y52 J;  4BY1 J;  2DMN A;  2JA7 J;  1CQT A;  1VND A;  4XRS A;  5C44 J;  3GTL J;  1MH3 A;  3BT9 A;  2KDZ A;  5E3L A;  3JRD A;  4JX6 A;  1LFU P;  4C3H J;  1IDY A;  4UUT A;  3HOU J;  1IJW C;  2JA6 J;  2D5V A;  5EYR A;  3FK7 A;  3CCY A;  3IH4 A;  3MN2 A;  1B8I A;  2Y9Y A;  3A01 B;  4Y7N J;  2X9D A;  4G12 A;  1JJ6 C;  4FCY A;  3ZQL A;  5EG0 A;  5IYC J;  5M5W J;  1T56 A;  3G1O A;  1MBJ A;  4XID A;  1MBK A;  3GTQ J;  2EZL A;  4A3C J;  2E19 A;  1BL0 A;  1IG7 A;  2NVY J;  4BBR J;  1IDZ A;  3E7L A;  3LSP A;  4BBS J;  1ITY A;  1BW5 A;  3BTJ A;  1ORK A;  4LOC A;  2M0C A;  3CMY A;  2XGE A;  1JUS A;  1IRZ A;  1PUF B;  2WV1 A;  3FIW A;  2EQR A;  4XRS G;  4V2G A;  3S17 J;  4FTH A;  2E2H J;  1BW6 A;  1FEX A;  1ZTR A;  4QSH A;  2XGD A;  3ZQH A;  1E3O C;  2GM4 A;  3GTK J;  5FKL A;  2HOS A;  4A69 C;  2L9R A;  1OJL A;  2CUF A;  3BTC A;  1LFB A;  4DZP A;  4IHV A;  2IBD A;  4A3G J;  2NOG A;  5F0C A;  1JT0 A;  2L7Z A;  3BTI A;  2DA1 A;  2PMZ N;  4MFE A;  1XS9 A;  2JA5 J;  1H88 C;  2LR8 A;  1AHD P;  1P7I A;  3BG3 A;  1RR7 A;  5EDN A;  4DYC A;  2XPU A;  2COB A;  2GLO A;  3HBL A;  1HOM A;  5C3E J;  3JRG A;  4IHY A;  3A01 A;  2ELK A;  3GTO J;  3IH2 A;  2ECB A;  2CUE A;  3Q0W A;  4QIW N;  5F1J A;  1H89 C;  1F43 A;  1TWF J;  1TWC J;  4HNV A;  2X6O A;  1RPW A;  3A03 A;  3GTP J;  1UMQ A;  4A3E J;  3LSG A;  1ETQ A;  3VPR A;  2DJN A;  3BTL A;  3B6A A;  3GTM J;  3S1M J;  2W48 A;  1U9N A;  2EZH A;  1HF0 A;  1AU7 A;  2XB5 A;  5GPA A;  1JJ8 C;  4L5E A;  3IV5 A;  5IYB J;  1GV5 A;  3S14 J;  5FLV A;  3B6C A;  5F0F A;  4A3B J;  3TP0 A;  1GUU A;  4W1U A;  2XPW A;  5EZH A;  2MG4 A;  4C2M J;  2XSD C;  5FKO A;  1K83 J;  2CU7 A;  3RZD J;  2LP0 A;  3HDD A;  2EBI A;  2XRL A;  2HOT A;  1NK3 P;  3TW7 A;  3BR6 A;  1AKH B;  2JWT A;  3HGY A;  1U8B A;  3HKZ N;  2DA3 A;  3S2H J;  2HDD A;  1Z77 A;  5M3M J;  4BXX J;  1MSF C;  2MW8 A;  1MBG A;  3LSJ A;  5IOY A;  1Z0X A;  2N8G A;  4MLO A;  1JKP C;  1JKO C;  4MFD A;  3JRH A;  5J3L A;  2OPT A;  2TCT A;  2DA2 A;  4A3M J;  1TWA J;  5IP7 J;  5GPC A;  3S1Q J;  3HOV J;  2JJ7 A;  1TWG J;  1U78 A;  3BR5 A;  1I50 J;  1JUP A;  4M3F A;  9ANT A;  2L0K A;  5FKM A;  3SDG A;  4BY7 J;  3LNQ A;  1EF4 A;  3H3V K;  2ME6 A;  2LFB A;  3FKI J;  2O8K A;  1XC5 A;  1ETX A;  2Y0S N;  3M4O J;  1T33 A;  1SFO J;  3MKL A;  3QPS A;  5JLX A;  1S7E A;  4S0H B;  1ZGW A;  2TRT A;  3NAU A;  1WCM J;  2DA4 A;  3HGG A;  3FIS A;  1B8I B;  1WH5 A;  5FKK A;  3TW6 A;  2DMU A;  1ETO A;  1RKW A;  3JRA A;  2CJJ A;  2IEK A;  1YRN B;  3QPL A;  5EF6 A;  1AKH A;  2HOA A;  1B72 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...