3NAUA

Crystal structure of zhx2 hd2 (zinc-fingers and homeoboxes protein 2, homeodomain 2)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
KTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc fingers and homeoboxes protein 2
publication title Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3nauA00
1XS9A 4DZJA 4M3GA 2LK2A 2KT0A 5M5XJ 1POGA 1ZKGA 1QRYA 2RAEA 4FE4A 4D5FA 2TRTA 3WHBA 3UKGA 5M3FJ 3HGYA 1RETA 1BL0A 2R5YB 5IPAA 3CMYA 1GUUA 2NS7A 2FQ4A 3JRCA 1TWHJ 2G0EA 4M3BA 5FKNA 1WH5A 1APLC 1LE8A 1MBGA 2HYJA 5EGOA 4DYRA 5EG0A 4A3BJ 3QPLA 1Y1WJ 3SDGA 5M5YJ 5FLVA 1MBJA 1MH3A 2Y0SN 2M8GX 4FTHA 3ZQGA 2K40A 4XRSA 5C4XJ 1GV5A 3S1MJ 3GTKJ 2HXOA 1MBEA 3A02A 3BR3A 4Y7NJ 3MVPA 4UUSA 1RR7A 2ID3A 3HOXJ 4AUXA 3NAUA 3B6AA 3RZOJ 2OF7A 1QVUA 3HBLA 1A6IA 3JRHA 2XPWA 1Q1VA 1JJ8C 3G1MA 1MH4A 1ZGWA 2HQ5A 4G12A 3M3YJ 4JX5A 1ETXA 2GBYA 3BQYA 3G1OA 3O8HA 3JRBA 2OPTA 2DA1A 2ID6A 2R7ZJ 3DEWA 2DA5A 5HODA 4FISA 2LVSA 4JX6A 1G2HA 3IH4A 2HDDA 1PUFB 1ZQ3P 2H1KA 5JLWA 3TW6A 3IH2A 3RZDJ 3GTLJ 4DW6A 3S17J 1S7EA 5F0CA 4AC0A 1Z0XA 4DYCA 2MGQA 1WGXA 1WH7A 3B6CA 4M6VA 2MSYA 1B72B 4IHYA 2I10A 2QCOA 5F08A 1OFCX 4BXXJ 2ME6A 4I76A 2NVXJ 3HOVJ 1JTXA 4A93J 2DMPA 2WAQN 9ANTA 1JGGA 4DYQA 1ETKA 2B63J 1HLVA 2L7ZA 2M9HA 1VNDA 5GPCA 3ZQLA 3TW7A 3BQZA 1GV2A 3D1NI 2EZLA 5K7FA 2N8GA 4DZPA 3BR0A 3Q0WA 1IGNA 5BNGA 2LKXA 1I6HJ 4MLOA 3BR2A 2K9QA 2WV1A 1RKTA 2YUSA 1BA5A 2XB5A 2CQXA 2GM4A 1X2NA 4GFBA 5IYDJ 3JREA 3S1NJ 3Q3SA 2W48A 4B4CA 1T33A 4IHWA 4B1RA 1RESA 2KDZA 4M3DA 1IUFA 4BY1J 3OIOA 5E3OA 4D7NA 1PUFA 2MG4A 4IEJA 5FKMA 5F0FA 1JUMA 4C3IJ 2IAIA 5E3MA 1ETYA 2XB0X 2LD5A 2JA7J 3CCYA 4MO7A 4ABZA 1HF0A 1NK3P 2VKEA 1FTZA 1ETVA 2JN6A 3CQZJ 3W6VA 4JX4A 2YU9J 4NDLA 2JMWA 5J3LA 2HOAA 1X58A 3BT9A 4S0HB 1MBHA 1P7JA 2XPUA 2COBA 1H88C 1BJZA 1FIAA 2HI3A 2CU7A 5IYBJ 2P81A 2L9RA 1HCRA 2K9SA 2HOSA 2E19A 1JTYA 4A3JJ 2Y9YA 1ZR4A 2R5ZA 3IH3A 1U78A 2E2IJ 4X6AJ 1K83J 5K7ZA 3A03A 2IEKA 5IYCJ 1ITYA 4BY7J 3A01B 2K9NA 1YRNB 2VI6A 2FD5A 2XGCA 2DMNA 5F04A 2DA3A 1HDDC 3I4NJ 3MKLA 1O4XA 4A69C 1A5JA 2EBIA 1UHSA 3S1QJ 1AKHB 4L5EA 1JKRC 4EEFG 4XICA 1FIPA 3BR5A 4BBSJ 3HM5A 1GDTA 2JWTA 2L0KA 2L7MP 1W0TA 5EZGA 1W0UA 5FKLA 3ZOBA 3FKIJ 5FLMJ 5K7HA 1CQTA 2DJNA 2LP0A 2NS8A 5FJ8J 5C3EJ 2R0QC 1X2MA 3ZQCA 4UUTA 1WPKA 4QTRA 3HGGA 3K2AA 1VFCA 2R92J 1FTTA 3DCFA 1Z77A 4QSHA 2VPRA 4A3LJ 2R93J 2AHQA 4A3KJ 3GBGA 3HKZN 2NVQJ 4LOCA 3E7LA 3O8GA 1I3QJ 2DA6A 2CJJA 2R5YA 1DU6A 1ENHA 4A3CJ 2JA8J 2XGDA 2Y2ZA 2DMQA 2LY9A 5E3LA 4V2FA 1RKWA 1H89C 3NARA 3PM1A 3BG3A 2X9DA 3F0CA 1ZTRA 1ETQA 4BBRJ 3S1RJ 1JJ6C 3HOZJ 2CUFA 1XC5A 4B3AA 4XIDA 1LFUP 2NVTJ 2FX0A 3Q0VA 1JKQC 3WHCA 5IOZA 4RDUA 3BG9A 5EYRA 3TEDA 2EZKA 3HOYJ 3H0GJ 2EZHA 1OCPA 1IG7A 3GTMJ 1B8IB 3PO3J 1GVDA 1IDYA 2VKVA 3RKQA 2EH3A 2LTPA 2IBDA 1BW5A 2PMZN 3FISA 5F27A 2JJ7A 5C4JJ 1ZR2A 1U8BA 4X1EA 3JRFA 3PO2J 3FIWA 5J1YA 1AU7A 1ETWA 1JT6A 1XG1A 1LE8B 3BTLA 3GTGJ 1U9NA 1WI3A 4A3IJ 4BKXA 5EGOB 2E2HJ 1FJLA 3MN2A 5FKKA 2Y30A 2M0CA 2O8KA 2EZIA 3HOWJ 2DA7A 4Y52J 2DA4A 2X6OA 3LSPA 3S16J 4MFDA 2O7OA 1UMQA 1FEXA 3JRAA 3FK6A 1EF4A 1T56A 2AO9A 1NTCA 2JK3A 4UUSB 5J1UA 2YS9A 5GPAA 1BW6A 1QPIA 4W97A 3TP0A 1WCMJ 3HEFA 1TWAJ 1IJWC 1B72A 3VPRA 1R9TJ 1IRZA 1F43A 1JUSA 3GTOJ 3LSRA 3LNQA 2XPVA 2ZB9A 3OSFA 2VUMJ 4A3DJ 3BR6A 4J19A 1E3OC 1OCTC 5F0HA 3LOCA 3HB9A 2L7FP 4IHVA 4A3MJ 3OOUA 1MBKA 4C2MJ 1B8IA 1F36A 3ZQFA 4MIMA 2TCTA 1IV6A 3H3VK 1HDPA 1NK2P 1HOMA 1ORKA 3C2BA 5FKOA 2HOTA 4JP0A 4QIWN 5J1RA 3M4OJ 3ZQHA 1JKOC 3HDDA 2M34A 3BR1A 4XRSG 1MBFA 1D5YA 4JYKA 5M3MJ 2CUEA 2FJ1A 2DN0A 1UG2A 4A3GJ 1ETOA 2M2EA 2NVYJ 2JA6J 2JA5J 2GLOA 3JRIA 4A3EJ 3BTJA 3JRGA 3L1PA 5DTDA 4XRMA 4HNVA 1QVTA 3S2DJ 1ZK8A 3SFIA 4MFEA 5IP6A 5EF6A 2H8RA 2XRLA 3LSJA 1TWFJ 5C44J 3IV5A 4C3JJ 4CYCB 3HOUJ 3GTJJ 1MSEC 1Y1VJ 2ELKA 4W1UA 4A3FJ 1SANA 1K61A 4D7MA 3CDLA 4FE7A 2O9LA 5GP9A 5IP9J 3RQIA 2QF7A 5JLXA 1U9OA 3S15J 4M3EA 1AHDP 3GTPJ 2DTZA 1TWGJ 1H8AC 2NOGA 1IC8A 4C3HJ 5EEAA 3SJMA 3GTQJ 5E3NA 2LR8A 3FK7A 2Y9ZA 5EZHA 1GT0C 1JT0A 3LSGA 3ZQIA 3A01A 2LLKA 2LFBA 1YRNA 3K7AJ 2WB1N 4V2GA 4XK4A 3S2HJ 1MSFC 2HXIA 1AKHA 3G1LA 5IOYA 1SFOJ 3BTCA 2EQRA 3BTIA 3TP3A 5IP7J 1TC3C 4D5CA 2ME0A 1JUPA 1LFBA 2ECCA 4AYBN 1P7IA 3S14J 5M5WJ 2CRGA 2E1OA 2CQQA 1JKPC 5EG0B 2X48A 4CYCA 1TWCJ 1OJLA 2XGEA 3JRDA 1I50J 2R5ZB 5EDNA 2DMUA 5F1JA 1DU0A 2MW8A 1IDZA 3Q0UA 3QQAA 2Y31A 4IHXA 2DA2A 2DMTA 1VF9A 5DS9A 4M3FA 3JR9A 2E2JJ 1MNMC 4RBOA 4FCYA 3QPSA 3OSGA 1VI0A 4I6ZA 2ECBA 3BG5A 2XSDC 3I4MJ 1RPWA 2D5VA
chains in the Genus database with same CATH superfamily
2Q8KA 3P5JA 1QZEA 4M3GA 2MH9A 2XGXA 2CUZA 2M45A 1UJ8A 3BROA 2V79A 2KT0A 1POGA 4ZYAA 2RAEA 4E7ZA 1FMWA 4FE4A 4D5FA 1VTNC 2ZCWA 3ZN1A 2TRTA 3WHBA 2EJRA 2QQAA 5GAEJ 5M3FJ 2DLLA 2ICWG 1PP7U 4RLFA 4PZJA 1WI9A 4ENKA 2KQRA 3KP7A 4BDZA 1X3WB 3MZYA 3M1CA 1YJWI 5IPAA 5J6XA 3CMYA 2V1XA 2NS7A 3PIPF 1SFEA 3C7JA 3CMMA 1APLC 3SEZA 3QYBA 1IZ1A 2E71A 3CCEI 1LE8A 4KN4X 1WJDA 3FXRA 1MBGA 3P7NA 1PUEE 2HYJA 1H9GA 4P9FA 2K5CA 5FD6A 2VONA 2IGKA 3QPLA 5DV5A 1LEBA 2KRFA 3F6VA 5M5YJ 3ECOA 3TOBA 2MC3A 2Y0SN 4FTHA 3RPQA 3K69A 1T38A 2CFXA 1UELB 5C4XJ 5FROA 4KDPA 5HS7A 4A0YA 4HF0A 3S1MJ 4LB6B 2HXOA 4CZCA 1IXCA 5DEQA 5ERIA 4UUSA 1RR7A 4EGYA 1T0FA 4YELA 4Z2YA 4G7OF 3W2VA 3CMEI 3QOPA 4IRGA 1BOAA 3DTEA 3GX4X 2QYOA 2VJ5A 2OQGA 4B3XA 1JJ8C 3R4KA 4GO1A 3ZR8X 1S8NA 1MH4A 2FNPA 1TT5B 3QP6A 4UNOA 3CUQA 1SAUA 2LF8A 3O2PE 2P5KA 4JX5A 4AIKA 1ETXA 2HS5A 2LBFB 4XLHA 3O8HA 3JRBA 4BEHA 4NB5A 4IO9F 2DA5A 4IZZA 2CS3A 1X1BA 2LVSA 3PFIA 3ZMZA 3FXLA 1PUFB 2GAUA 2V1NA 3KEOA 5JLWA 2H1KA 4KT6A 2M7BA 1P4XA 4JBAA 5LEJA 1MNEA 1XTAA 3G71I 3FXQA 3H9GA 1R1VA 1ZHFA 1Z0XA 3H92A 4U7DA 3IKTA 2VKDA 1WH7A 3B6CA 2JVHA 3Q9VA 2H09A 2MSYA 4LD5A 3TL4X 3ZRGA 4B09A 4WCGA 4G7HF 4IHYA 1J5YA 2X6WA 2G9WA 1JTXA 4ZZDA 3L2RA 3HOTA 1MD0A 9ANTA 1FOYA 4PFOA 5J8FA 3HIFA 1OR7C 1R5ID 3C2HA 3AG2H 2B0LA 1OKRA 2ZXIA 5EEGA 2M9HA 1QBJA 1P92A 2NNYA 4ENJA 1GV2A 2X6YA 2EZLA 3T1BA 2D2WA 2DOEA 1I5ZA 2EK5A 2IPQX 2L02A 3TMOA 3CCRI 2K4JA 1KYWA 2XKOA 2V1UA 3A2KA 3ROUA 2KJBA 3BR0A 5HOOA 3CD6I 1MDMA 4ZDOA 4PUSA 1XCBA 2K9QA 5B3SH 4GYIA 2X1EA 1V5EA 3KFWX 4J00A 1YX5A 5BPDA 3DBHB 1BOBA 2W48A 2CG4A 1BI0A 4XLFA 4QWQA 4UV9A 3S3OA 1RESA 1CF7B 2KDZA 1IUFA 3OIOA 2IJLA 3MEXA 5FKMA 1JUMA 2LYCA 4C3IJ 1BJAA 4DBRA 1ULYA 1YG2A 3F6OA 1SC7A 1D5VA 2H94A 2MC4A 3F8CA 1D3YA 4ABZA 1NK3P 3BCBA 2PG4A 2VKEA 1FTZA 2JQ7A 2XRNA 1ETVA 3E3VA 2P7CB 1QNTA 3CQZJ 3HL2A 1BIBA 3HHGA 2YU9J 4LJZF 3PUFA 3BOQA 2X1DA 1R1UA 3R0JA 3BT9A 1P7JA 2GZWA 2COBA 3LQQA 1KZHA 2ZSIB 3CLQA 2KIFA 2CU7A 5IYBJ 2P81A 4U0YA 2HOSA 3CMAI 1JTYA 4A3JJ 2RVCA 2Y9YA 4WK8F 1ZR4A 2R5ZA 2E2IJ 3GLLA 4WX9A 3KYLA 1BR4A 1K83J 2PJRB 1ITYA 1WWXA 1WJBA 3DP7A 2G7UA 2ZO4A 1FBSA 4BY7J 3SDBA 2L9VA 2YPRA 3K9TA 3A01B 1YRNB 3OYHA 1JI8A 3O3KA 4B48A 3HSRA 1G3YA 1OYWA 3I56I 2EILH 3JSOA 2ZJQF 2JWTA 2MD5A 4HBLA 5K7HA 3MKZA 4I02A 2DJNA 2KIQA 2NS8A 5C3EJ 5FJ8J 5FRMA 3CLOA 2KP6A 1ZARA 3QWLA 4B47A 1YIOA 2K85A 3KEYA 3WTVC 3K2AA 3IHUA 1FTTA 3DCFA 1Z77A 4BXUA 2F48A 1XPXA 3F72A 1I27A 2CV2A 4D1QA 3HRTA 4LOCA 1WJFA 4UY8I 1T98A 2D1VA 4G9YA 4RB3C 2O8XA 4HV5A 4F7ZA 2VE9A 2R5YA 1FY7A 1ENHA 3FKJA 1Z3YA 3K70D 2XGDA 3VODA 2LY9A 2ISZA 2FUG2 5E1ZB 1WJ5A 2HWVA 3E5QA 4DIQA 1FT9A 3PM1A 3BG3A 2K9LA 5FLXZ 2O6GE 4LLGF 1ETQA 3S1RJ 1YJNI 2UWMA 1XSXA 5LRSA 3OIPA 2VC1A 2FU4A 2FX0A 2A07F 2DQLA 3TEDA 1ON1A 3VB2A 5ILVA 3H5NA 3HOYJ 4M73A 1ZG3A 4NC6A 2EZHA 3LAPA 1B8IB 3QODA 3K10A 2QEXI 3DV8A 1DP3A 2OTLI 1GVDA 1P2FA 1T6SA 3EYYA 2EH3A 4BYYA 2BXZA 2IBDA 2NAZA 3FISA 5E8IA 2DODA 3QYFA 4PCQA 1I1SA 3MCZA 1ZR2A 4X1EA 1TBXA 1O7LA 1LDDA 4ZC3A 2ZC2A 2FE3A 3CDHA 2HDWA 3BPXA 1ETWA 2QLZA 2BY0A 5FO5A 5DUKA 1LE8B 1V4RA 1U9NA 1WI3A 4A3IJ 1QA6A 3MN2A 4ZYEA 1KONA 5D4RA 3ELKA 2O8KA 4IQ4A 5JVGF 4GXOA 4NQWA 2AXLA 1PDNC 3LSPA 4EM2A 5IT3A 1F9NA 3T0YA 1IXRC 1E3HA 3DKYA 2ACJA 1EF4A 1T56A 1NTCA 5L3EA 2M1BA 5L3DA 2DPDA 4UUSB 5J1UA 1VQMI 2VODA 1UHWA 3PQJA 5ICFA 3O6BB 1HQCA 1WCMJ 3HEFA 3TP0A 3WTZA 3JSPA 1ODDA 4A5NA 4IVNA 1R9TJ 4RS8A 4BGDA 2FRHA 5LBQA 3BC8A 1WFXA 1Z9CA 3CCMI 2E1NA 3CUQB 2GIZA 2CFOA 2XPVA 5AIQA 1FOKA 2I5UA 2VUMJ 4HX8A 1DPUA 4J19A 2XAGA 4H4KC 3VEPA 1HW2A 2KIUA 2CUJA 4UVBA 4BEHB 2CV1A 1KU3A 3FZVA 1F36A 4O6JA 4N9HA 2IS6A 5LGNA 3H3VK 2K7LA 1ORKA 3WGIA 3PFYA 4QPOA 2F5EA 5FKOA 2NXNB 4BQOA 3M4OJ 2A6HF 3H35A 3M7GA 3ZQHA 1SAXA 2M34A 1V55H 2OA4A 4RGRA 3V8LA 2V6EA 3DU6A 4CSWA 1UG2A 1XGOA 4ZYGA 2JA5J 2PX9A 2GLOA 4KIFA 4A3EJ 3PL8A 3L1PA 4YFXF 2F6CA 2R7OA 2XROA 1QVTA 3S2DJ 2QSFX 4IJAA 3KETA 2Y0MA 4MEXF 3IKVA 3OV8A 1UG0A 4MFEA 4UHTA 4ON0A 4A5MA 3C2GA 3IV5A 1XN7A 2DPUA 2VC0A 4CYCB 1BIAA 2W24A 4P1WA 1YITI 1TQMA 1IN5A 3HRMA 3EETA 5DCFA 3EUHA 1MDMB 2ELKA 3OS1A 2JPCA 4W1UA 4RAGA 3M8EA 3U2RA 4NC7A 4FE7A 4EJUA 3QPTA 3LSIA 3DBLB 3F9KA 1K7AA 2YX7A 3LFKA 4IXAA 2QF7A 2X51A 2VOPA 4BH9A 4XQFA 3LWFA 5LFAA 3SJMA 3GTQJ 2LR8A 3TDZC 1ON2A 3G3ZA 2Y9ZA 4XNFA 3PUBA 4U87A 1N75A 3ZMVA 3LSGA 4CGZA 2LFBA 5CVIA 3KPHA 3BWGA 4XK4A 1DGWY 5H6QA 4AIJA 2AQEA 2JRMA 1MSFC 4HDUA 2K9MA 2F5FA 2EQRA 2L9SA 5HLIA 1TW2A 2XAUA 1TNSA 1BI2A 1T2KA 1MMSA 1FOWA 2VXZA 5IP7J 2WWYA 4PSWA 2R4GA 4ZYHA 4DOZA 1U8RA 4WXCA 5GAGJ 3OR1C 1P7IA 1FYLA 4CICA 1ZRDA 3G6EI 4FETA 3FF5A 1E0EA 5LGUA 2HQRA 3DPUA 1QU3A 2EWNA 2DYRH 4LLLA 2VPLA 2E1OA 1OCOH 1FNNA 2CQQA 3OIQA 3NEUA 2IVMA 5EG0B 5A2QZ 1HKSA 3JRDA 2R5ZB 2XAJA 1VQ5I 3U21A 2PFBA 2DMUA 5JVTA 2W85A 3QQAA 4IHXA 2FBHA 3R60A 1VF9A 2EB7A 5DS9A 3F23A 4F52A 1R22A 4BQAA 4RB1A 2F4IA 2EFOA 3H5RA 3AL0C 1WJAA 4Q47A 5B1BH 3KP2A 2ECBA 3RCOA 2E5ZA 4E7HA 1GLNA 4PFPA 3HOSA 2UXXA 2G7HA 5H20A 1K6OA 2K4BA 4B8XA 4WXHA 5ICCA 3G73A 1W36C 5AONA 1LPQA 2AXTC 4II3A 5CVJA 3OYJA 2PN6A 4BE0A 3W6JB 1AOYA 1J09A 1ZKGA 1QRYA 2EIJH 2A3SA 1MIJA 2XV4S 4U88A 3V42A 5H6RA 1ZN2A 4CH7A 2JSPA 3M1EA 5EEHA 3L09A 3L7WA 1T39A 1RETA 3I5UA 2IA0A 2A61A 2R5YB 2E60A 4GDFA 5DUIA 1QGPA 3TO6A 1IN8A 3E5XA 5FKNA 4RM3A 3WTTC 3RPUD 4G6TB 1U6GA 4DYRA 1IF1A 1BBYA 4I98B 2OQRA 3CCJI 1USSA 4IOAF 2HNHA 4N4NB 5FGMA 4ANJA 1MBJA 1LDKB 2WY7Q 2M8GX 3E1SA 4PJJA 4XRSA 2OD5A 2HR3A 1DGRM 2DI3A 4D9JA 3K4MA 1IUYA 2HYGD 1MBEA 5TISC 1S9HA 2KZVA 3ABLH 3W2WA 3MVPA 3K70C 2VASA 2HDCA 3L2CA 3KP4A 4I7HA 2KJCA 4HV6A 4LG0A 2WAEA 3HPGA 4AUXA 2M8EA 1B4AA 3NAUA 2LF7A 3JTGA 2RQPA 3FXOA 4LB5A 2EA4A 1A6IA 3WTWC 3JRHA 2K02A 2XPWA 3L2QA 5E17F 3GZ5A 1I6XA 2L4AA 1OCZH 1D0XA 2K3FA 5E20A 2IGNA 3M3YJ 1WZ2A 3VYRB 1MW7A 1YW7A 4UVAA 2GBYA 1J59A 1O57A 2CW7A 3BQYA 3G1OA 1SD6A 1SD7A 5D5WB 2ID6A 2R7ZJ 2EFPA 1U5TC 4E7LA 3BPVA 4JX6A 4NQWB 2HDDA 5KAFC 2PMZA 3CJNA 1PJRA 4OMZA 3RZDJ 2ZJ2A 4XSXF 4DW6A 1VQNI 1S7EA 3BG6A 5HLGA 4HA8A 2HKXA 4DYCA 4P96A 4NUBA 5FFXA 2RQQA 4EJVA 2LKPA 2DU9A 5F08A 3I0TA 2YX4A 2LG4A 5F6FA 1OFCX 3ULQB 2ME6A 4I76A 4A6EA 4BS9A 3HOVJ 2HTSA 6PAXA 3M9AA 1HSTA 2DMPA 2STTA 4HSRA 1JGGA 4DYQA 2HTJA 3CJRB 2DFIA 3OYBA 4HW0A 1EKEA 2RC4A 2M87A 3FHZA 2OUMA 2LSOA 4RB2C 2Q0OA 5K7FA 1IW7F 1Y8RB 4MQ9F 1NH3A 2OJED 5HLHA 5KAIC 2BW3A 3H9JA 2XAQA 3TOAA 3QU6A 2LKXA 3LA2A 1O3SA 1I6HJ 1BC7C 3BR2A 3RKWA 5E1XA 5HLTA 2YUSA 2VQCA 4GFBA 5IYDJ 3JREA 2VBXA 2ZJPF 3S1NJ 2Z1DA 1T33A 2FXAA 3AAFA 4IL6C 3QU3A 4BY1J 2V1DA 5E3OA 4D7NA 2MG4A 4YFNF 3AG4H 3CCQI 1IAWA 2ZXWH 2XB0X 1S3JA 3I59B 3CCYA 2PMUA 2MH2A 3MD2A 2R7RA 1HF0A 3SZGA 4L0ZB 5FLXK 2HPIA 1OQYA 2JN6A 4OIPF 4II2A 4JX4A 4XBFA 2VJJA 3M8FA 4NDLA 3HSFA 5J3LA 1X58A 4CCLA 1MBHA 2CQNA 3GFMA 1K79A 3GWZA 4M74A 3OYKA 1H88C 3CZ6A 1FIAA 1DP7P 4F91B 1VQOI 1SFKA 4S04A 1HCRA 2P6SA 1O3QA 3KP6A 2E19A 1LDJA 2ETHA 3WE3A 3IH3A 2A5YB 2L54A 1AA7A 3GZNB 3IC7A 1WKMA 2DFEA 3RJPA 2F5DA 2QGUA 3J7AO 3QAHA 3K0LA 2VI6A 2BY1A 2JPBA 4BJ5C 3CUOA 2DA3A 1HDDC 3BZ6A 1Z3XA 1A5JA 2EBIA 1XMXA 1KA8A 1Z21A 4EEFG 1JKRC 1G59A 1R5GA 4JOMA 3NWTA 1LNWA 2YR2A 1J2XA 4MGRA 1B59A 2FOWA 1KGSA 3TKYA 5FKLA 3ZOBA 1W0UA 2EPFA 2P7VB 1RI7A 2BEOA 3IUOA 3TGNA 3LFUA 3VOEA 1WPKA 4QTRA 2V6CA 3MQ0A 2BV6A 3OR2C 4Q5SF 3WU0A 2MLKA 2R92J 2DQRA 1O3RA 3EPZA 4A3KJ 1ZRCA 3GBGA 4D0PA 2ZJRF 2NVQJ 2R7VA 4WXDA 1VQKI 1R00A 3SQNA 2XIGA 4AYBA 4P9UA 4A3CJ 1LEAA 1O7FA 3CP8A 5HDNA 1RKWA 2L9NA 4U0VA 1H89C 1W1WE 3UR3C 3CUQC 2QA4I 2FBIA 1JJ6C 5DCMA 3H36A 4GRIA 2CUFA 3DTKA 1S7OA 4XIDA 1W7PD 1CGPA 2E7WA 3N05A 3H5AA 1OR7A 1JKQC 5IOZA 3BG9A 3I58A 4M71A 5EYRA 3U9GA 2EZKA 1KYZA 2E5NA 2EV0A 1LB2A 1IG7A 4ZZLA 2C6YA 4HX4A 2QENA 2JT1A 1LKXA 4BE1A 2OCCH 1GXQA 5HNHA 1TLHB 2VKVA 3GFJA 2LTPA 3KZYA 3CESA 1YJ9I 1F5TA 5K5QA 2IP2A 2PMZN 5F27A 2CGPA 3SEQA 4ZDPA 3DEEA 3A1YA 1U0JA 2HFHA 3JRFA 1VQPI 1QO0D 1SVLA 5J1YA 4LLNA 4H0EA 3VDXA 3OL3A 4BKXA 1FJLA 1XB4A 2ZKZA 4WF2A 3EUKL 3C3WA 2Y30A 2M0CA 3DPTA 2EZIA 4Y52J 2DA7A 2GIVA 2DA4A 2WAFA 2X6OA 1U2WA 1D0ZA 1QHGA 2ZMEB 1UMQA 1R1TA 3BY6A 1FEXA 3W3CA 2BXYA 4O5VA 3NWSA 3RPUA 3WU1B 1ZLKA 1K78A 2JK3A 4LG0B 1YHQI 2L3DA 3IWZA 2A68F 1XSVA 1QPIA 1TWAJ 2A6EF 3DPLC 5JI6A 1E2XA 1T08B 1JUSA 4RGSA 4FHTA 2BY3A 3E97A 4UV8A 3S2WA 3LSRA 3SFZA 3I71A 4A3DJ 4KIGA 1E3OC 1OCTC 3LOCA 5KVRA 2L5QA 1P9QC 4UVCA 3WG7H 2L7FP 2OC6A 5ICEA 4IHVA 1TQPA 3OOUA 4YIRX 3P9KA 1MBKA 4C2MJ 2DFHA 3D5SC 1W36D 3L2VA 3PNVA 4A0ZA 3ABTA 4CCKA 2XF6A 2ZFWA 3BZKA 4M6XA 4QIWN 5J1RA 3F3XA 1JKOC 2E1CA 3BR1A 2E7XA 2VL8A 1LVKA 4CCMA 3KLOA 2XAFA 3ISPA 1Y39A 1ETOA 3K4CA 5A2QK 1R36A 1HKTA 4CCJA 1WQ2A 4HNVA 4YFKF 2OTJI 3V7RA 3ZMTA 4WWCA 3FXUA 4IF4A 4HDVA 2GXBA 5EF6A 3H3UA 2M7AA 3PQKA 2RDPA 3ML6A 3OYFA 1IN7A 4C3JJ 4HPQA 2GXAA 1V54H 3OS2A 2ESHA 3GTJJ 2HOEA 2CW8A 3I54A 2R7WA 1R49A 3D5LA 1LJ9A 1UCRA 1BM9A 2K27A 2M30A 1SD4A 4E6KG 3E0JB 2D45A 1EH8A 4PK4A 1Y56A 3C1DA 4D7MA 5GP9A 4HZFA 2EFQA 5IP9J 4HG2A 1PP8F 3OOPA 1HSJA 3GTPJ 2DTZA 4N0BA 4LIVA 5KCMA 2PMHA 4ZYDA 2NOGA 4PDKA 5FFZA 3EUAA 4C3HJ 3FK7A 4ESJA 2QQ9A 5BPIA 4C9YA 1GT0C 3FXKA 3ZQIA 4XL9A 2A5WA 2V26A 2FBKA 2OZUA 5L3GA 1B1BA 2VQHA 1K6YA 1AKHA 3G1LA 5IOYA 1XMAA 5J8CA 3BTCA 3GXOA 4RAZA 3W2AA 2FSWA 3K4LA 2LDUA 3JTHA 1LFPA 1Q1HA 2CH0A 4BQNA 4AIHA 2WA0A 1TC3C 2JVGA 3V8KA 1J75A 2ME0A 4Q4ZF 2RKHA 4AYBN 1R71A 3PSFA 1X4PA 5L3BA 1HXDA 1PYVA 2CRGA 3OL4A 4KMUX 1JKPC 1MJAA 4IRHA 2ZSHB 3SXYA 3V7CA 4OIQF 4PJMA 4HEA2 1SMYF 3QPHA 1OJLA 3DKWA 1YTYA 1VQ4I 3R61A 3QP5A 4OIRF 5EDNA 1V3FA 2IW5A 2MW8A 3F8NA 5CQEA 4HQMA 2DA2A 2MA3A 2BZTA 4M3FA 4CZZA 4FT8A 3ZXSA 1FYKA 4RBOA 3HTUA 3I4PA 1VI0A 3S3MA 1P6RA 3M07A 4F93B 4I09A 5FD5A 4HF2A 2UV1A 2CWEA 2PBIA 5KHDA 1QZYA 4EM0B 1YFHA 3I55I 3L2UA 3MMYB 2IRFG 4N9IA 1XS9A 4YEJA 2VN2A 2LK2A 3N97A 5M5XJ 5BMZA 2R7QA 1XMKA 3K4BA 1W5SA 4BHPA 3DLLF 3UKGA 2QBYA 3TBIA 1SEUA 1LQ1A 2TDXA 2FQ4A 4ESFA 1TWHJ 1Z67A 4A0XA 1GHCA 4M3BA 2Z33A 1WH5A 2DT6A 2W7NA 2QWWA 2CV0A 2WTEA 3OYNA 4L9NA 4ENMA 2VT3A 3M8JA 3I53A 3ZP5A 5DCMB 2W25A 3SDGA 1R5HA 2CQKA 1MH3A 2MABA 3CJTB 3ZMSA 3E6BA 3RSNA 5DM7F 3HC7A 5ICGA 1GV5A 3J7YJ 3GFLA 4F55A 4M9ZA 3HZJA 1BI1A 2W84A 3WTYC 4BXFA 3PNYA 3BR3A 3LAJA 1TW3A 2ID3A 4BU2A 4L5IA 4LIUA 1UFMA 1MMAA 1MKMA 3RZOJ 1E17A 1ZLJA 2DYSH 1QVUA 2RNGA 3HBLA 5CLSA 1YIJI 3OYIA 1Q1VA 3GMEA 1RNLA 3G1MA 3CC2I 1ZELA 4Y17A 1ZGWA 3CC4I 4G12A 3ZGKA 1X1CA 3BP8A 5DYMA 2VB6A 2B7EA 1EJ9A 4IQJA 2DA1A 4JK1X 3DEWA 5HODA 4Y33A 3C18A 2B9SA 4FISA 3KZZA 2DT7B 1G2HA 3LSTA 4ITVA 4BJTA 1BR1A 2R7DA 5HDKA 2KIMA 3L00A 5E1WA 5B1AH 2QSHX 5FB2A 4XLEA 1V5GA 3IH2A 1TTYA 3HHHA 3W6KB 2FOKA 1K78B 3F21A 3CO6C 3S17J 1G3SA 1R4MB 3ZMUA 4I0AA 5F0CA 2DDBA 3BJAA 1WGXA 4M6VA 2KISA 2I10A 2CYYA 2VE8A 1HA8A 2QCOA 1FYMA 1YX3A 2F5VA 2HYFA 4RGXA 5D6FA 1STZA 3WTSC 4A93J 3SZTA 4F92B 4Y15A 2ZNZA 3IAM2 2QQ8A 2CO5A 1VNDA 3ZQLA 1Y6IA 3BG7A 1ZG5A 2PJPA 1X3UA 3GCMA 3DEUA 2STWA 2N8GA 2DOAA 5J4YA 3WTUC 3Q0WA 1IGNA 5EJCA 4M6YA 3ZN0A 5J4VA 3WGGA 2QUFA 1G3TA 4EMSA 1TQIA 4GCVA 2NRAC 1FSEA 2VQLA 2KLOA 4DJAA 2W1OA 4KICA 4DQ2A 5LGTA 1UAAA 1ZGJA 2UZKA 1BA5A 1P4AA 4BUPA 2XB5A 3GW2A 1X2NA 1HKQA 2LBFA 4B4CA 2BHYA 3WG9A 4B1RA 1G3WA 4OOIA 5D8KB 2DOFA 3LA3A 2QSGX 4OMYA 2IS4A 2HZTA 5BQTA 1SVOA 1PUFA 1HW5A 2LOOA 1BI3A 2J5OA 2ZXJA 3FM3A 3IP4B 2V9KA 4S05A 2CSOA 1G4DA 2IAIA 5E3MA 1ZH5A 3ZMDA 2ESNA 2LD5A 2JZYA 4Y13A 1R23A 4CA0A 5CPRB 1REPC 1EV7A 3IRQA 3V4GA 3E6CC 2FF4A 3JW4A 3IL2A 2PQ8A 4R8HA 1WJEA 5CYVA 1QQIA 1JHFA 1DPRA 2FNAA 2BYVE 4MEYF 2Y48A 2HOAA 4XKBA 3DBRB 2X4HA 2XPUA 4R79A 4G6DA 3DKXA 3CO7C 1BC8C 4IHTA 1IV8A 4V19K 5E18F 2EFNA 3FXJA 2K9SA 1HW1A 1MMDA 4G94A 1U78A 2DTRA 1YS7A 3A03A 2IEKA 5K7ZA 4CYDA 1D0YA 3K1NA 1EH6A 1XDUA 2XGCA 4RB0A 1NHAA 3KX2A 2DMNA 3I4NJ 2GQQA 2NOJB 1YLFA 1A6QA 1A31A 3DFGA 3RDIA 4ZH4F 1AKHB 4LK1F 3S1QJ 5IT9K 2WADA 2LRDA 2V7FA 3BR5A 2E34A 1YQAA 3VYSB 5D4SA 4EVIA 4B43A 1W0TA 5EZGA 1MGTA 2OZ6A 1CF7A 1OLTA 1IRGA 2LP0A 3VFZA 1X2MA 2A6TA 2R3SA 3BZCA 3KYDB 4UUTA 2WB1A 3D0SA 4PJ0C 1JGSA 3ZCOA 2X0LA 3HGGA 1U5TA 2JUGA 2L7KA 2YSRA 3A4CA 3LL7A 3UNGC 1YS6A 4ENNA 2IT0A 1QPMA 4E7JA 1Z6RA 2ZMEC 1VFCA 2HZDA 3KIOA 2VPRA 1IRFA 4KT5C 2AHQA 2JTVA 4IHSA 2XF5A 3H1CA 3E7LA 3S3NA 3O8GA 1I3QJ 4JQFA 2DA6A 2P4WA 4KITB 1MJBA 5J47A 4CHUA 1DU6A 2XF7A 2JA8J 3OS0A 1WSUA 1FBUA 2Y2ZA 1E3PA 1Z05A 3FBIB 5E3LA 3ABUA 2W4SA 4V2FA 3NARA 2RGVA 5LRRA 1KU7A 2X9DA 2WBMA 5BS6A 3F0CA 1OCCH 3ASOH 3K4KA 4RMNA 2V9VA 2HQNA 3MFKA 4B3AA 1XC5A 4G7ZF 3EQLF 1LFUP 1H9TA 2NVTJ 1WVRA 2QZ8A 1F4KA 4XN0A 3Q0VA 3QOEA 2R7TA 3LA7A 4C2UA 5CJ9A 4XORA 3HRUA 2R7XA 1KU9A 5HDGA 4BE2A 1OCPA 2L01A 1UHMA 3ONQA 1X1PA 3RQ4A 3WE2A 3NRVA 3DWLE 4YRVA 1RR8C 1IDYA 4KMFA 1R7JA 4K2EA 1LUJB 4E4HA 1BW5A 3RI4A 2JJ7A 3T5XA 1U8BA 3AFHA 3FIWA 3OYEA 2KZGA 3DU5A 3F8BA 2KL4A 1JT6A 2E35A 4XLNF 1I39A 2E2HJ 3ABKH 1UZCA 2K86A 2KPMA 1V5FA 2VJ4A 3K1MA 3HG9A 3I64A 3HOWJ 2ZBKA 4R1HA 1DQUA 2DFFA 3BCAA 4MFDA 4CCNA 3GEZA 4UXNA 3D5RC 3JRAA 1JXSA 3FK6A 1B6AA 2E36A 1ZG1A 2X6XA 3OYCA 2YS9A 5L3FA 4CXFA 4KFCA 2Z9OA 4DBQA 4W97A 3CF2A 5K5RA 1IJWC 2XAHA 1B72A 3VPRA 1X19A 4EJWA 1IRZA 1LVAA 2XASA 3A0BC 1IN4A 2QM3A 1F43A 2JSCA 2M5WA 5DD8A 2HVSA 4RAYA 2P0WA 2M0MA 3OSFA 5D5VB 4I2OA 1XD7A 3BR6A 3H3ZA 3OWTA 5TGTA 2K3PA 1D8KA 1Y8QB 3GO5A 1C0WA 4OWRB 2R7SA 4IKFA 2R7UA 4EQQA 1FZPB 4EGZA 1B8IA 1R4NB 4DNCA 4MIMA 1HDPA 1NK2P 2EFWA 4X0GA 1UB9A 3MKWB 1XGMA 3BDDA 4ZDLA 1XGNA 2W00A 3H0DA 1MBFA 1D5YA 5K1YA 1O3TA 4JYKA 5M3MJ 1N78A 4A3GJ 2M2EA 2Z16A 3B02A 4AVPA 1G8XA 3JRIA 3JRGA 2VQGA 4I99C 4RLQA 5DTDA 2Y75A 3ASNH 3LMMA 2LKSA 4LMYA 2KKOA 2WY8Q 4MTDA 2O61A 2QKMB 1OCRH 3SFIA 5IP6A 2XRLA 3LSJA 2VBWA 1FSHA 2KRHA 2LC2A 4Z6YA 5C44J 2LMDA 4BAYA 3ESWB 1B9MA 3HOUJ 1MSEC 4AM3A 1Y1VJ 2DXIA 3WODF 1QHHD 1T0FC 2Q1ZB 2ISYA 1MMNA 1Z7LA 3P9IA 1K61A 4MHGA 1SANA 4A3FJ 3AL0B 2XUBA 4O3MA 3CDLA 1EA3A 2WAQA 4HOBA 3RQIA 4BHBA 5HNFA 2XVCA 4M3EA 3CF5F 3TDUC 1TWGJ 3ECHA 1H8AC 3QRFF 1Y0NA 5EEAA 2V4JC 5E3NA 1RUNA 5EZHA 4Y3OA 4OU0A 2DW4A 1JT0A 4L0YB 4UB8C 2LREA 2H8WA 3T8RA 2WB1N 1TL8A 3CCUI 3S2HJ 2GA1A 2WV0A 3KP3A 1JHHA 1ZGAA 2HXIA 1R58A 3U1KA 2IA1A 4XKVA 1BR2A 3TP3A 3TO7A 3IRRA 4D5CA 4BDYA 4RA2A 4AVZA 1X1DA 4IOCF 4AIDA 3S14J 4ZJZA 5IT9Z 2X48A 4CYCA 1TWCJ 2XGEA 2HU9A 3CJQB 3R6SA 2VLAA 5ILSA 1B9NA 2MYSA 3LQRA 2Y31A 3Q0UA 3PIOF 1IDZA 3V7SA 2GXGA 2MBFA 1I1GA 1ZRFA 4HF1A 3JR9A 2E2JJ 3CCLI 1MNMC 4HX7A 2RNJA 4YG2F 3FM5A 1X1AA 1DUXC 1FX7A 3QPSA 3OSGA 3HUGA 3LSHA 4I6ZA 2M4KA 4C2TA 4FQGA 2HPMA 1Y0UA 2XKPA 2VKHA 5CQGA 3MAJA 4C30A 2ZFUA 4XSZF 4EJOA 5D5XB 4DZJA 1IN6A 1FC3A 1U5TB 3FMRA 1KQ8A 3VWBA 2KHMA 3PSIA 3T8TA 1RUOA 3J81K 2VBYA 4EATA 3X2QH 1S29A 5D5UB 1OISA 2JA2A 4AU7A 1Z91A 2O03A 2W57A 3HGYA 1BL0A 2YU3A 1PVEA 3HPHA 4HNUA 1T8IA 5TJJA 4NNJA 1GUUA 4P5OA 3JRCA 2G0EA 2EA2A 1ACIA 2RV8A 1JE8A 1L0OC 3SZPA 2H6CA 5EGOA 2XC7A 4L9JA 5EG0A 4L18B 4A3BJ 4NBQA 1FP1D 2Q2EA 3S8PA 1Y1WJ 3GLXA 3HKZA 5FLVA 2Y69H 3RIRA 5ILUA 3ZPLA 1SFXA 3KP5A 1YYVA 3ZQGA 4UUVA 2K40A 3F8FA 4KUMA 4A12A 4N4OB 5D8LB 3GTKJ 4PSXA 3A02A 4Y7NJ 3IWFA 3AG3H 2P8TA 3J7ZI 2EINH 3DXJF 3HOXJ 4ZTJA 4BJ6C 2BHZA 3B6AA 1Z7UA 3GUDA 1MJ9A 2OF7A 3HJEA 4YIIA 2BW3B 2JRTA 1VQ6I 3KLNA 3COAC 2HVQA 1WJCA 2IXSA 3BLYA 4QPQA 4BHCA 4F3QA 2HQ5A 5GTHC 2E1MB 2FMLA 2P5LC 4PGGA 2P6TA 2OPTA 2CW0F 5K5OA 1VQ7I 4OAYA 2M3AA 4A2UA 1HBXG 3TQNA 5CVVA 3N4MA 4OIOF 2KFDA 3IH4A 1ZQ3P 1MMGA 3TW6A 3J7AY 3GTLJ 3FHNA 3OYDA 4XR6A 2O0YA 5F1RA 4L9VA 4FX0A 3SHFA 1QZZA 4AC0A 3K6GA 2MGQA 3J80K 2I8DA 3U1DA 5DD4A 3VYTB 2HVRA 2HKOA 3R0AA 1B72B 4MNUA 1G6NA 1BN5A 1OYIA 4BXXJ 3REOA 2ZXHA 2BY2A 3DQVC 5HS8A 2NVXJ 4EJTA 4KN7X 3MWMA 2WAQN 1Z6TA 1TNTA 2LY1A 3ABMH 2D1HA 1ETKA 2VJIA 3LSKA 2B63J 2DDAA 5AIPA 1HLVA 2L7ZA 2UXNA 3FXMA 5GPCA 5HS9A 3TW7A 2QQBA 3BQZA 1K4SA 3D1NI 1MZBA 4HLXA 1FLIA 2F2EA 3G4SI 1OMIA 4UB6C 5JR3A 4KISA 1VQ8I 2VOOA 2NS0A 4DZPA 1OYYA 4E7SA 4CDGA 4A6DA 1SMTA 2V9PA 5BNGA 3HSEA 2EIKH 4MLOA 1SFUA 3OYGA 3VSKA 1KQ0A 2WV1A 4HQEA 1RKTA 3CP2A 1FOXA 4XLAA 4EM1A 2CQXA 2GM4A 2HEOA 2RN7A 3Q3SA 2H27A 4IHWA 4RGUA 2OBPA 4AD9A 1WHUA 4M3DA 1IRXA 5GAHJ 2ADUA 4IEJA 1X3ZB 3HXLA 2RREA 1N77A 5F0FA 2L4MA 4KYWA 2KDOA 3I3LA 5LD2C 1ETYA 4LITA 1YOVB 2JA7J 3E6MA 4HAMA 4MO7A 3RYRA 5L3CA 3FBNB 4IRIA 4RAFA 1Z1DA 2NNNA 3K2ZA 2GOXB 2OCEA 3W6VA 2VIXA 2MFZA 2ELHA 2JMWA 1D8JA 3EDPA 4BACA 4S0HB 1R6RA 3OYMA 1XGSA 2BGCA 1BJZA 2F5CA 3CDIA 4KJZA 4XOTA 3MZHA 2HI3A 2KMUA 3RKXA 3CCSI 1YW9A 2DO7A 3FDYA 2L9RA 5LEKA 1IXSB 2Z5UA 3GVAA 3MZ8A 2GOMA 3G2BA 3CTAA 4XM3A 4X6AJ 4CUGA 1M1EB 1YO5C 5IYCJ 3PJRA 2K9NA 2FD5A 2DT5A 5F04A 5LHIA 3MKLA 1O4XA 4A69C 3JAMK 2JUCA 1UHSA 4XONA 4OAZA 4L5EA 4XICA 1FIPA 1GVJA 5LLQA 4M9SA 5D6EA 5FRNA 2QVOA 1TT0A 3HM5A 4BBSJ 1GDTA 1W7PA 3K1PA 2L2OA 5DDGA 2L0KA 2L7MP 4XKCA 3FKIJ 5FLMJ 1CQTA 2R0QC 4Q48A 3ZQCA 5E8GA 1P4WA 1A36A 4TV7A 1KQ9A 2LNBA 3I59A 4QSHA 4A3LJ 2R93J 2OU2A 2NYXA 3RKYA 3VSLA 3HKZN 2OAZA 4E7IA 4XN3A 2UUZA 1D1BA 2CJJA 5F64A 3K4JA 3KCCA 4XMYA 4E7KA 3LSMA 2FA5A 3EUHC 2Z99A 2DMQA 4XRFA 2BBYA 3J81Z 3S93A 4L9TA 4BQQA 3HUGB 3ZQQA 3FWEA 3KYCB 1W5CC 3HYIA 5GADJ 2X1CA 1ZTRA 4BBRJ 3HOZJ 2LH9A 4P55A 4LK0F 4B44A 1H0MA 4KA4A 2DK8A 5B5EC 5HVQC 3WHCA 4M72A 4RDUA 1GXPA 4HYEA 4XOPA 1VQLI 3Q9SA 3H0GJ 3GTMJ 1D1CA 3PO3J 2W82A 3OMYA 1W5TA 4NC8A 2OV7A 3RKQA 2DCEA 3CC7I 2HQAA 3A0HC 4LG3A 2CMPA 4BNCA 1VZ0A 5C4JJ 1RIOH 3PO2J 2BVLA 1YW8A 3F8MA 2GA2A 3P9CA 1AU7A 1XG1A 2BE5F 3BTLA 1F1ZA 3GTGJ 2AQFA 5EGOB 2F4MB 1S6LA 3I9V2 4E70A 4U7BA 1AWCA 4MTEA 2Q2EB 5FKKA 2CQ7A 2WC2A 2ELJA 2VXDA 1RC9A 1W4MA 3S16J 4Y4RA 5CVUA 2O7OA 2GWRA 3OYAA 1OPCA 2PLYA 1TZLA 3H9QA 5DM6F 1D1AA 4KNYA 2DK5A 3S32A 2AO9A 4YIFA 3GYHX 5LHHA 3E6DA 5CVRA 4ZTFA 5GPAA 2O5RA 4IPAA 1BW6A 1A35A 1SD5A 5JFRA 3HRSA 4OINF 2VT2A 4PJLA 4I01A 3L2WA 3ERED 3WU2C 2Y0SA 4DGWB 3BJOA 1XCVA 5E79C 1N25A 2EV6A 2NVUB 3WGHA 3F22A 3WTXC 1ONVA 1VQ9I 3GTOJ 3LNQA 2MD0A 2AS5F 2PEXA 2ZB9A 1DDNA 3FMQA 1L3LA 2EV5A 3KEQA 1ERDA 3GZ6A 5F0HA 3HB9A 3J80Z 2LY2A 4A3MJ 2DBBA 2EIMH 2O3FA 4QLCU 1A04A 2DJIA 4PGHA 2M4GA 1J9IA 3ZQFA 3K4NA 5LHGA 2TCTA 2P5VA 1IV6A 3DTIA 1HOMA 1RRJA 4CO8A 4ASNA 3C2BA 2QKLB 1FBQA 4JP0A 2HOTA 4NHJA 3FX3A 3HDDA 1J7KA 1NG7A 4ESBA 5KNLA 4J01A 2PI0A 4XRSG 1MNDA 1S5LC 4XLPF 2CUEA 2FJ1A 2DN0A 1U3EM 1K4TA 2NVYJ 3IAS2 5J40A 2JA6J 3BTJA 1ZREA 4XRMA 1ZYRF 1ZK8A 3Q5FA 2Z2SB 1FWZA 2ZMEA 2H8RA 1EH7A 1TWFJ 1SVMA 3DLAA 3MKYB 3ERMA 3AKZA 4M9XA 3BJ6A 2FQ3A 3OYLA 2FMYA 2A05A 2BOLA 4G8XA 2MLGA 4KIBA 2H1LA 2HGCA 4MQVA 4I0BA 2O9LA 5KK1A 4AWXB 5JLXA 5H2FC 1U9OA 3S15J 1AHDP 2KRCA 2DAOA 4HSTA 1IC8A 1S7AA 1IO2A 2PJRA 4U0WA 3EYIA 3E5UA 4LGWA 3A01A 2LLKA 4XKWA 1YRNA 3K7AJ 3ZQ7A 2H6BA 3L9FA 4V2GA 1RZ4A 2Z3YA 1FP2A 1USTA 4ETSA 2BVMA 4PJNA 2XHKA 5JHFA 3V8JA 4FASD 1SFOJ 3NQOA 4BL0B 2IS1A 1HC8A 3B73A 1X4OA 1YE9A 1XSDA 1J0RA 1YI2I 4IX7A 2XDVA 5JHUA 2QBYB 3FMSA 2J5PA 3DF8A 3BTIA 4G6QA 3RYPA 1XX5A 1I3AA 4GYGA 1NG6A 1JUPA 1LFBA 2ECCA 5CKTA 4FX4A 2A69F 3JAMZ 5B66C 5ED4A 1S72I 5M5WJ 4L5JA 1WRJA 3PNTA 3VYUB 3CCVI 2VBZA 1TP4A 4LFUA 2ZNYA 2FEZA 1T95A 3TO9A 2IGOA 1I50J 5IY5H 2F4OB 3KZIC 2X85A 5F1JA 1FMVA 3QYEA 1DU0A 4HRIA 2DMTA 2COMA 3AG1H 4EV0A 1ZAOA 3OY9A 4CCOA 4HLYA 2R7FA 3GF2A 4GGGA 4FCYA 3JCUC 3BG5A 2XSDC 1FPQA 1W7PB 4RM2A 3I4MJ 1XDSA 5GTIC 5TRDA 1RPWA 5BOXA 3KE2A 3RTRA 3SYTA 2IS2A 1KU2A 2E1MC 2IGMA 4XLCA 2D5VA 4HNTA 3GFIA 2IA2A 3HTSB 2XSJC
chains in the Genus database with same CATH topology
1XS9A 4DZJA 4M3GA 2LK2A 2KT0A 5M5XJ 1POGA 1ZKGA 1QRYA 2RAEA 4FE4A 4D5FA 2TRTA 3WHBA 3UKGA 5M3FJ 3HGYA 1RETA 1BL0A 2R5YB 5IPAA 3CMYA 1GUUA 2NS7A 2FQ4A 3JRCA 1TWHJ 2G0EA 4M3BA 5FKNA 1WH5A 1APLC 1LE8A 1MBGA 2HYJA 5EGOA 4DYRA 5EG0A 4A3BJ 3QPLA 1Y1WJ 3SDGA 5M5YJ 5FLVA 1MBJA 1MH3A 2Y0SN 2M8GX 4FTHA 3ZQGA 2K40A 4XRSA 5C4XJ 1GV5A 3S1MJ 3GTKJ 2HXOA 1MBEA 3A02A 3BR3A 4Y7NJ 3MVPA 4UUSA 1RR7A 2ID3A 3HOXJ 4AUXA 3NAUA 3B6AA 3RZOJ 2OF7A 1QVUA 3HBLA 1A6IA 3JRHA 2XPWA 1Q1VA 1JJ8C 3G1MA 1MH4A 1ZGWA 2HQ5A 4G12A 3M3YJ 4JX5A 1ETXA 2GBYA 3BQYA 3G1OA 3O8HA 3JRBA 2OPTA 2DA1A 2ID6A 2R7ZJ 3DEWA 2DA5A 5HODA 4FISA 2LVSA 4JX6A 1G2HA 3IH4A 2HDDA 1PUFB 1ZQ3P 2H1KA 5JLWA 3TW6A 3IH2A 3RZDJ 3GTLJ 4DW6A 3S17J 1S7EA 5F0CA 4AC0A 1Z0XA 4DYCA 2MGQA 1WGXA 1WH7A 3B6CA 4M6VA 2MSYA 1B72B 4IHYA 2I10A 2QCOA 5F08A 1OFCX 4BXXJ 2ME6A 4I76A 2NVXJ 3HOVJ 1JTXA 4A93J 2DMPA 2WAQN 9ANTA 1JGGA 4DYQA 1ETKA 2B63J 1HLVA 2L7ZA 2M9HA 1VNDA 5GPCA 3ZQLA 3TW7A 3BQZA 1GV2A 3D1NI 2EZLA 5K7FA 2N8GA 4DZPA 3BR0A 3Q0WA 1IGNA 5BNGA 2LKXA 1I6HJ 4MLOA 3BR2A 2K9QA 2WV1A 1RKTA 2YUSA 1BA5A 2XB5A 2CQXA 2GM4A 1X2NA 4GFBA 5IYDJ 3JREA 3S1NJ 3Q3SA 2W48A 4B4CA 1T33A 4IHWA 4B1RA 1RESA 2KDZA 4M3DA 1IUFA 4BY1J 3OIOA 5E3OA 4D7NA 1PUFA 2MG4A 4IEJA 5FKMA 5F0FA 1JUMA 4C3IJ 2IAIA 5E3MA 1ETYA 2XB0X 2LD5A 2JA7J 3CCYA 4MO7A 4ABZA 1HF0A 1NK3P 2VKEA 1FTZA 1ETVA 2JN6A 3CQZJ 3W6VA 4JX4A 2YU9J 4NDLA 2JMWA 5J3LA 2HOAA 1X58A 3BT9A 4S0HB 1MBHA 1P7JA 2XPUA 2COBA 1H88C 1BJZA 1FIAA 2HI3A 2CU7A 5IYBJ 2P81A 2L9RA 1HCRA 2K9SA 2HOSA 2E19A 1JTYA 4A3JJ 2Y9YA 1ZR4A 2R5ZA 3IH3A 1U78A 2E2IJ 4X6AJ 1K83J 5K7ZA 3A03A 2IEKA 5IYCJ 1ITYA 4BY7J 3A01B 2K9NA 1YRNB 2VI6A 2FD5A 2XGCA 2DMNA 5F04A 2DA3A 1HDDC 3I4NJ 3MKLA 1O4XA 4A69C 1A5JA 2EBIA 1UHSA 3S1QJ 1AKHB 4L5EA 1JKRC 4EEFG 4XICA 1FIPA 3BR5A 4BBSJ 3HM5A 1GDTA 2JWTA 2L0KA 2L7MP 1W0TA 5EZGA 1W0UA 5FKLA 3ZOBA 3FKIJ 5FLMJ 5K7HA 1CQTA 2DJNA 2LP0A 2NS8A 5FJ8J 5C3EJ 2R0QC 1X2MA 3ZQCA 4UUTA 1WPKA 4QTRA 3HGGA 3K2AA 1VFCA 2R92J 1FTTA 3DCFA 1Z77A 4QSHA 2VPRA 4A3LJ 2R93J 2AHQA 4A3KJ 3GBGA 3HKZN 2NVQJ 4LOCA 3E7LA 3O8GA 1I3QJ 2DA6A 2CJJA 2R5YA 1DU6A 1ENHA 4A3CJ 2JA8J 2XGDA 2Y2ZA 2DMQA 2LY9A 5E3LA 4V2FA 1RKWA 1H89C 3NARA 3PM1A 3BG3A 2X9DA 3F0CA 1ZTRA 1ETQA 4BBRJ 3S1RJ 1JJ6C 3HOZJ 2CUFA 1XC5A 4B3AA 4XIDA 1LFUP 2NVTJ 2FX0A 3Q0VA 1JKQC 3WHCA 5IOZA 4RDUA 3BG9A 5EYRA 3TEDA 2EZKA 3HOYJ 3H0GJ 2EZHA 1OCPA 1IG7A 3GTMJ 1B8IB 3PO3J 1GVDA 1IDYA 2VKVA 3RKQA 2EH3A 2LTPA 2IBDA 1BW5A 2PMZN 3FISA 5F27A 2JJ7A 5C4JJ 1ZR2A 1U8BA 4X1EA 3JRFA 3PO2J 3FIWA 5J1YA 1AU7A 1ETWA 1JT6A 1XG1A 1LE8B 3BTLA 3GTGJ 1U9NA 1WI3A 4A3IJ 4BKXA 5EGOB 2E2HJ 1FJLA 3MN2A 5FKKA 2Y30A 2M0CA 2O8KA 2EZIA 3HOWJ 2DA7A 4Y52J 2DA4A 2X6OA 3LSPA 3S16J 4MFDA 2O7OA 1UMQA 1FEXA 3JRAA 3FK6A 1EF4A 1T56A 2AO9A 1NTCA 2JK3A 4UUSB 5J1UA 2YS9A 5GPAA 1BW6A 1QPIA 4W97A 3TP0A 1WCMJ 3HEFA 1TWAJ 1IJWC 1B72A 3VPRA 1R9TJ 1IRZA 1F43A 1JUSA 3GTOJ 3LSRA 3LNQA 2XPVA 2ZB9A 3OSFA 2VUMJ 4A3DJ 3BR6A 4J19A 1E3OC 1OCTC 5F0HA 3LOCA 3HB9A 2L7FP 4IHVA 4A3MJ 3OOUA 1MBKA 4C2MJ 1B8IA 1F36A 3ZQFA 4MIMA 2TCTA 1IV6A 3H3VK 1HDPA 1NK2P 1HOMA 1ORKA 3C2BA 5FKOA 2HOTA 4JP0A 4QIWN 5J1RA 3M4OJ 3ZQHA 1JKOC 3HDDA 2M34A 3BR1A 4XRSG 1MBFA 1D5YA 4JYKA 5M3MJ 2CUEA 2FJ1A 2DN0A 1UG2A 4A3GJ 1ETOA 2M2EA 2NVYJ 2JA6J 2JA5J 2GLOA 3JRIA 4A3EJ 3BTJA 3JRGA 3L1PA 5DTDA 4XRMA 4HNVA 1QVTA 3S2DJ 1ZK8A 3SFIA 4MFEA 5IP6A 5EF6A 2H8RA 2XRLA 3LSJA 1TWFJ 5C44J 3IV5A 4C3JJ 4CYCB 3HOUJ 3GTJJ 1MSEC 1Y1VJ 2ELKA 4W1UA 4A3FJ 1SANA 1K61A 4D7MA 3CDLA 4FE7A 2O9LA 5GP9A 5IP9J 3RQIA 2QF7A 5JLXA 1U9OA 3S15J 4M3EA 1AHDP 3GTPJ 2DTZA 1TWGJ 1H8AC 2NOGA 1IC8A 4C3HJ 5EEAA 3SJMA 3GTQJ 5E3NA 2LR8A 3FK7A 2Y9ZA 5EZHA 1GT0C 1JT0A 3LSGA 3ZQIA 3A01A 2LLKA 2LFBA 1YRNA 3K7AJ 2WB1N 4V2GA 4XK4A 3S2HJ 1MSFC 2HXIA 1AKHA 3G1LA 5IOYA 1SFOJ 3BTCA 2EQRA 3BTIA 3TP3A 5IP7J 1TC3C 4D5CA 2ME0A 1JUPA 1LFBA 2ECCA 4AYBN 1P7IA 3S14J 5M5WJ 2CRGA 2E1OA 2CQQA 1JKPC 5EG0B 2X48A 4CYCA 1TWCJ 1OJLA 2XGEA 3JRDA 1I50J 2R5ZB 5EDNA 2DMUA 5F1JA 1DU0A 2MW8A 1IDZA 3Q0UA 3QQAA 2Y31A 4IHXA 2DA2A 2DMTA 1VF9A 5DS9A 4M3FA 3JR9A 2E2JJ 1MNMC 4RBOA 4FCYA 3QPSA 3OSGA 1VI0A 4I6ZA 2ECBA 3BG5A 2XSDC 3I4MJ 1RPWA 2D5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS9 A;  4DZJ A;  4M3G A;  2LK2 A;  2KT0 A;  5M5X J;  1POG A;  1ZKG A;  1QRY A;  2RAE A;  4FE4 A;  4D5F A;  2TRT A;  3WHB A;  3UKG A;  5M3F J;  3HGY A;  1RET A;  1BL0 A;  2R5Y B;  5IPA A;  3CMY A;  1GUU A;  2NS7 A;  2FQ4 A;  3JRC A;  1TWH J;  2G0E A;  4M3B A;  5FKN A;  1WH5 A;  1APL C;  1LE8 A;  1MBG A;  2HYJ A;  5EGO A;  4DYR A;  5EG0 A;  4A3B J;  3QPL A;  1Y1W J;  3SDG A;  5M5Y J;  5FLV A;  1MBJ A;  1MH3 A;  2Y0S N;  2M8G X;  4FTH A;  3ZQG A;  2K40 A;  4XRS A;  5C4X J;  1GV5 A;  3S1M J;  3GTK J;  2HXO A;  1MBE A;  3A02 A;  3BR3 A;  4Y7N J;  3MVP A;  4UUS A;  1RR7 A;  2ID3 A;  3HOX J;  4AUX A;  3NAU A;  3B6A A;  3RZO J;  2OF7 A;  1QVU A;  3HBL A;  1A6I A;  3JRH A;  2XPW A;  1Q1V A;  1JJ8 C;  3G1M A;  1MH4 A;  1ZGW A;  2HQ5 A;  4G12 A;  3M3Y J;  4JX5 A;  1ETX A;  2GBY A;  3BQY A;  3G1O A;  3O8H A;  3JRB A;  2OPT A;  2DA1 A;  2ID6 A;  2R7Z J;  3DEW A;  2DA5 A;  5HOD A;  4FIS A;  2LVS A;  4JX6 A;  1G2H A;  3IH4 A;  2HDD A;  1PUF B;  1ZQ3 P;  2H1K A;  5JLW A;  3TW6 A;  3IH2 A;  3RZD J;  3GTL J;  4DW6 A;  3S17 J;  1S7E A;  5F0C A;  4AC0 A;  1Z0X A;  4DYC A;  2MGQ A;  1WGX A;  1WH7 A;  3B6C A;  4M6V A;  2MSY A;  1B72 B;  4IHY A;  2I10 A;  2QCO A;  5F08 A;  1OFC X;  4BXX J;  2ME6 A;  4I76 A;  2NVX J;  3HOV J;  1JTX A;  4A93 J;  2DMP A;  2WAQ N;  9ANT A;  1JGG A;  4DYQ A;  1ETK A;  2B63 J;  1HLV A;  2L7Z A;  2M9H A;  1VND A;  5GPC A;  3ZQL A;  3TW7 A;  3BQZ A;  1GV2 A;  3D1N I;  2EZL A;  5K7F A;  2N8G A;  4DZP A;  3BR0 A;  3Q0W A;  1IGN A;  5BNG A;  2LKX A;  1I6H J;  4MLO A;  3BR2 A;  2K9Q A;  2WV1 A;  1RKT A;  2YUS A;  1BA5 A;  2XB5 A;  2CQX A;  2GM4 A;  1X2N A;  4GFB A;  5IYD J;  3JRE A;  3S1N J;  3Q3S A;  2W48 A;  4B4C A;  1T33 A;  4IHW A;  4B1R A;  1RES A;  2KDZ A;  4M3D A;  1IUF A;  4BY1 J;  3OIO A;  5E3O A;  4D7N A;  1PUF A;  2MG4 A;  4IEJ A;  5FKM A;  5F0F A;  1JUM A;  4C3I J;  2IAI A;  5E3M A;  1ETY A;  2XB0 X;  2LD5 A;  2JA7 J;  3CCY A;  4MO7 A;  4ABZ A;  1HF0 A;  1NK3 P;  2VKE A;  1FTZ A;  1ETV A;  2JN6 A;  3CQZ J;  3W6V A;  4JX4 A;  2YU9 J;  4NDL A;  2JMW A;  5J3L A;  2HOA A;  1X58 A;  3BT9 A;  4S0H B;  1MBH A;  1P7J A;  2XPU A;  2COB A;  1H88 C;  1BJZ A;  1FIA A;  2HI3 A;  2CU7 A;  5IYB J;  2P81 A;  2L9R A;  1HCR A;  2K9S A;  2HOS A;  2E19 A;  1JTY A;  4A3J J;  2Y9Y A;  1ZR4 A;  2R5Z A;  3IH3 A;  1U78 A;  2E2I J;  4X6A J;  1K83 J;  5K7Z A;  3A03 A;  2IEK A;  5IYC J;  1ITY A;  4BY7 J;  3A01 B;  2K9N A;  1YRN B;  2VI6 A;  2FD5 A;  2XGC A;  2DMN A;  5F04 A;  2DA3 A;  1HDD C;  3I4N J;  3MKL A;  1O4X A;  4A69 C;  1A5J A;  2EBI A;  1UHS A;  3S1Q J;  1AKH B;  4L5E A;  1JKR C;  4EEF G;  4XIC A;  1FIP A;  3BR5 A;  4BBS J;  3HM5 A;  1GDT A;  2JWT A;  2L0K A;  2L7M P;  1W0T A;  5EZG A;  1W0U A;  5FKL A;  3ZOB A;  3FKI J;  5FLM J;  5K7H A;  1CQT A;  2DJN A;  2LP0 A;  2NS8 A;  5FJ8 J;  5C3E J;  2R0Q C;  1X2M A;  3ZQC A;  4UUT A;  1WPK A;  4QTR A;  3HGG A;  3K2A A;  1VFC A;  2R92 J;  1FTT A;  3DCF A;  1Z77 A;  4QSH A;  2VPR A;  4A3L J;  2R93 J;  2AHQ A;  4A3K J;  3GBG A;  3HKZ N;  2NVQ J;  4LOC A;  3E7L A;  3O8G A;  1I3Q J;  2DA6 A;  2CJJ A;  2R5Y A;  1DU6 A;  1ENH A;  4A3C J;  2JA8 J;  2XGD A;  2Y2Z A;  2DMQ A;  2LY9 A;  5E3L A;  4V2F A;  1RKW A;  1H89 C;  3NAR A;  3PM1 A;  3BG3 A;  2X9D A;  3F0C A;  1ZTR A;  1ETQ A;  4BBR J;  3S1R J;  1JJ6 C;  3HOZ J;  2CUF A;  1XC5 A;  4B3A A;  4XID A;  1LFU P;  2NVT J;  2FX0 A;  3Q0V A;  1JKQ C;  3WHC A;  5IOZ A;  4RDU A;  3BG9 A;  5EYR A;  3TED A;  2EZK A;  3HOY J;  3H0G J;  2EZH A;  1OCP A;  1IG7 A;  3GTM J;  1B8I B;  3PO3 J;  1GVD A;  1IDY A;  2VKV A;  3RKQ A;  2EH3 A;  2LTP A;  2IBD A;  1BW5 A;  2PMZ N;  3FIS A;  5F27 A;  2JJ7 A;  5C4J J;  1ZR2 A;  1U8B A;  4X1E A;  3JRF A;  3PO2 J;  3FIW A;  5J1Y A;  1AU7 A;  1ETW A;  1JT6 A;  1XG1 A;  1LE8 B;  3BTL A;  3GTG J;  1U9N A;  1WI3 A;  4A3I J;  4BKX A;  5EGO B;  2E2H J;  1FJL A;  3MN2 A;  5FKK A;  2Y30 A;  2M0C A;  2O8K A;  2EZI A;  3HOW J;  2DA7 A;  4Y52 J;  2DA4 A;  2X6O A;  3LSP A;  3S16 J;  4MFD A;  2O7O A;  1UMQ A;  1FEX A;  3JRA A;  3FK6 A;  1EF4 A;  1T56 A;  2AO9 A;  1NTC A;  2JK3 A;  4UUS B;  5J1U A;  2YS9 A;  5GPA A;  1BW6 A;  1QPI A;  4W97 A;  3TP0 A;  1WCM J;  3HEF A;  1TWA J;  1IJW C;  1B72 A;  3VPR A;  1R9T J;  1IRZ A;  1F43 A;  1JUS A;  3GTO J;  3LSR A;  3LNQ A;  2XPV A;  2ZB9 A;  3OSF A;  2VUM J;  4A3D J;  3BR6 A;  4J19 A;  1E3O C;  1OCT C;  5F0H A;  3LOC A;  3HB9 A;  2L7F P;  4IHV A;  4A3M J;  3OOU A;  1MBK A;  4C2M J;  1B8I A;  1F36 A;  3ZQF A;  4MIM A;  2TCT A;  1IV6 A;  3H3V K;  1HDP A;  1NK2 P;  1HOM A;  1ORK A;  3C2B A;  5FKO A;  2HOT A;  4JP0 A;  4QIW N;  5J1R A;  3M4O J;  3ZQH A;  1JKO C;  3HDD A;  2M34 A;  3BR1 A;  4XRS G;  1MBF A;  1D5Y A;  4JYK A;  5M3M J;  2CUE A;  2FJ1 A;  2DN0 A;  1UG2 A;  4A3G J;  1ETO A;  2M2E A;  2NVY J;  2JA6 J;  2JA5 J;  2GLO A;  3JRI A;  4A3E J;  3BTJ A;  3JRG A;  3L1P A;  5DTD A;  4XRM A;  4HNV A;  1QVT A;  3S2D J;  1ZK8 A;  3SFI A;  4MFE A;  5IP6 A;  5EF6 A;  2H8R A;  2XRL A;  3LSJ A;  1TWF J;  5C44 J;  3IV5 A;  4C3J J;  4CYC B;  3HOU J;  3GTJ J;  1MSE C;  1Y1V J;  2ELK A;  4W1U A;  4A3F J;  1SAN A;  1K61 A;  4D7M A;  3CDL A;  4FE7 A;  2O9L A;  5GP9 A;  5IP9 J;  3RQI A;  2QF7 A;  5JLX A;  1U9O A;  3S15 J;  4M3E A;  1AHD P;  3GTP J;  2DTZ A;  1TWG J;  1H8A C;  2NOG A;  1IC8 A;  4C3H J;  5EEA A;  3SJM A;  3GTQ J;  5E3N A;  2LR8 A;  3FK7 A;  2Y9Z A;  5EZH A;  1GT0 C;  1JT0 A;  3LSG A;  3ZQI A;  3A01 A;  2LLK A;  2LFB A;  1YRN A;  3K7A J;  2WB1 N;  4V2G A;  4XK4 A;  3S2H J;  1MSF C;  2HXI A;  1AKH A;  3G1L A;  5IOY A;  1SFO J;  3BTC A;  2EQR A;  3BTI A;  3TP3 A;  5IP7 J;  1TC3 C;  4D5C A;  2ME0 A;  1JUP A;  1LFB A;  2ECC A;  4AYB N;  1P7I A;  3S14 J;  5M5W J;  2CRG A;  2E1O A;  2CQQ A;  1JKP C;  5EG0 B;  2X48 A;  4CYC A;  1TWC J;  1OJL A;  2XGE A;  3JRD A;  1I50 J;  2R5Z B;  5EDN A;  2DMU A;  5F1J A;  1DU0 A;  2MW8 A;  1IDZ A;  3Q0U A;  3QQA A;  2Y31 A;  4IHX A;  2DA2 A;  2DMT A;  1VF9 A;  5DS9 A;  4M3F A;  3JR9 A;  2E2J J;  1MNM C;  4RBO A;  4FCY A;  3QPS A;  3OSG A;  1VI0 A;  4I6Z A;  2ECB A;  3BG5 A;  2XSD C;  3I4M J;  1RPW A;  2D5V A; 
#chains in the Genus database with same CATH topology
 2Q8K A;  3P5J A;  1QZE A;  4M3G A;  2MH9 A;  2XGX A;  2CUZ A;  2M45 A;  1UJ8 A;  3BRO A;  2V79 A;  2KT0 A;  1POG A;  4ZYA A;  2RAE A;  4E7Z A;  1FMW A;  4FE4 A;  4D5F A;  1VTN C;  2ZCW A;  3ZN1 A;  2TRT A;  3WHB A;  2EJR A;  2QQA A;  5GAE J;  5M3F J;  2DLL A;  2ICW G;  1PP7 U;  4RLF A;  4PZJ A;  1WI9 A;  4ENK A;  2KQR A;  3KP7 A;  4BDZ A;  1X3W B;  3MZY A;  3M1C A;  1YJW I;  5IPA A;  5J6X A;  3CMY A;  2V1X A;  2NS7 A;  3PIP F;  1SFE A;  3C7J A;  3CMM A;  1APL C;  3SEZ A;  3QYB A;  1IZ1 A;  2E71 A;  3CCE I;  1LE8 A;  4KN4 X;  1WJD A;  3FXR A;  1MBG A;  3P7N A;  1PUE E;  2HYJ A;  1H9G A;  4P9F A;  2K5C A;  5FD6 A;  2VON A;  2IGK A;  3QPL A;  5DV5 A;  1LEB A;  2KRF A;  3F6V A;  5M5Y J;  3ECO A;  3TOB A;  2MC3 A;  2Y0S N;  4FTH A;  3RPQ A;  3K69 A;  1T38 A;  2CFX A;  1UEL B;  5C4X J;  5FRO A;  4KDP A;  5HS7 A;  4A0Y A;  4HF0 A;  3S1M J;  4LB6 B;  2HXO A;  4CZC A;  1IXC A;  5DEQ A;  5ERI A;  4UUS A;  1RR7 A;  4EGY A;  1T0F A;  4YEL A;  4Z2Y A;  4G7O F;  3W2V A;  3CME I;  3QOP A;  4IRG A;  1BOA A;  3DTE A;  3GX4 X;  2QYO A;  2VJ5 A;  2OQG A;  4B3X A;  1JJ8 C;  3R4K A;  4GO1 A;  3ZR8 X;  1S8N A;  1MH4 A;  2FNP A;  1TT5 B;  3QP6 A;  4UNO A;  3CUQ A;  1SAU A;  2LF8 A;  3O2P E;  2P5K A;  4JX5 A;  4AIK A;  1ETX A;  2HS5 A;  2LBF B;  4XLH A;  3O8H A;  3JRB A;  4BEH A;  4NB5 A;  4IO9 F;  2DA5 A;  4IZZ A;  2CS3 A;  1X1B A;  2LVS A;  3PFI A;  3ZMZ A;  3FXL A;  1PUF B;  2GAU A;  2V1N A;  3KEO A;  5JLW A;  2H1K A;  4KT6 A;  2M7B A;  1P4X A;  4JBA A;  5LEJ A;  1MNE A;  1XTA A;  3G71 I;  3FXQ A;  3H9G A;  1R1V A;  1ZHF A;  1Z0X A;  3H92 A;  4U7D A;  3IKT A;  2VKD A;  1WH7 A;  3B6C A;  2JVH A;  3Q9V A;  2H09 A;  2MSY A;  4LD5 A;  3TL4 X;  3ZRG A;  4B09 A;  4WCG A;  4G7H F;  4IHY A;  1J5Y A;  2X6W A;  2G9W A;  1JTX A;  4ZZD A;  3L2R A;  3HOT A;  1MD0 A;  9ANT A;  1FOY A;  4PFO A;  5J8F A;  3HIF A;  1OR7 C;  1R5I D;  3C2H A;  3AG2 H;  2B0L A;  1OKR A;  2ZXI A;  5EEG A;  2M9H A;  1QBJ A;  1P92 A;  2NNY A;  4ENJ A;  1GV2 A;  2X6Y A;  2EZL A;  3T1B A;  2D2W A;  2DOE A;  1I5Z A;  2EK5 A;  2IPQ X;  2L02 A;  3TMO A;  3CCR I;  2K4J A;  1KYW A;  2XKO A;  2V1U A;  3A2K A;  3ROU A;  2KJB A;  3BR0 A;  5HOO A;  3CD6 I;  1MDM A;  4ZDO A;  4PUS A;  1XCB A;  2K9Q A;  5B3S H;  4GYI A;  2X1E A;  1V5E A;  3KFW X;  4J00 A;  1YX5 A;  5BPD A;  3DBH B;  1BOB A;  2W48 A;  2CG4 A;  1BI0 A;  4XLF A;  4QWQ A;  4UV9 A;  3S3O A;  1RES A;  1CF7 B;  2KDZ A;  1IUF A;  3OIO A;  2IJL A;  3MEX A;  5FKM A;  1JUM A;  2LYC A;  4C3I J;  1BJA A;  4DBR A;  1ULY A;  1YG2 A;  3F6O A;  1SC7 A;  1D5V A;  2H94 A;  2MC4 A;  3F8C A;  1D3Y A;  4ABZ A;  1NK3 P;  3BCB A;  2PG4 A;  2VKE A;  1FTZ A;  2JQ7 A;  2XRN A;  1ETV A;  3E3V A;  2P7C B;  1QNT A;  3CQZ J;  3HL2 A;  1BIB A;  3HHG A;  2YU9 J;  4LJZ F;  3PUF A;  3BOQ A;  2X1D A;  1R1U A;  3R0J A;  3BT9 A;  1P7J A;  2GZW A;  2COB A;  3LQQ A;  1KZH A;  2ZSI B;  3CLQ A;  2KIF A;  2CU7 A;  5IYB J;  2P81 A;  4U0Y A;  2HOS A;  3CMA I;  1JTY A;  4A3J J;  2RVC A;  2Y9Y A;  4WK8 F;  1ZR4 A;  2R5Z A;  2E2I J;  3GLL A;  4WX9 A;  3KYL A;  1BR4 A;  1K83 J;  2PJR B;  1ITY A;  1WWX A;  1WJB A;  3DP7 A;  2G7U A;  2ZO4 A;  1FBS A;  4BY7 J;  3SDB A;  2L9V A;  2YPR A;  3K9T A;  3A01 B;  1YRN B;  3OYH A;  1JI8 A;  3O3K A;  4B48 A;  3HSR A;  1G3Y A;  1OYW A;  3I56 I;  2EIL H;  3JSO A;  2ZJQ F;  2JWT A;  2MD5 A;  4HBL A;  5K7H A;  3MKZ A;  4I02 A;  2DJN A;  2KIQ A;  2NS8 A;  5C3E J;  5FJ8 J;  5FRM A;  3CLO A;  2KP6 A;  1ZAR A;  3QWL A;  4B47 A;  1YIO A;  2K85 A;  3KEY A;  3WTV C;  3K2A A;  3IHU A;  1FTT A;  3DCF A;  1Z77 A;  4BXU A;  2F48 A;  1XPX A;  3F72 A;  1I27 A;  2CV2 A;  4D1Q A;  3HRT A;  4LOC A;  1WJF A;  4UY8 I;  1T98 A;  2D1V A;  4G9Y A;  4RB3 C;  2O8X A;  4HV5 A;  4F7Z A;  2VE9 A;  2R5Y A;  1FY7 A;  1ENH A;  3FKJ A;  1Z3Y A;  3K70 D;  2XGD A;  3VOD A;  2LY9 A;  2ISZ A;  2FUG 2;  5E1Z B;  1WJ5 A;  2HWV A;  3E5Q A;  4DIQ A;  1FT9 A;  3PM1 A;  3BG3 A;  2K9L A;  5FLX Z;  2O6G E;  4LLG F;  1ETQ A;  3S1R J;  1YJN I;  2UWM A;  1XSX A;  5LRS A;  3OIP A;  2VC1 A;  2FU4 A;  2FX0 A;  2A07 F;  2DQL A;  3TED A;  1ON1 A;  3VB2 A;  5ILV A;  3H5N A;  3HOY J;  4M73 A;  1ZG3 A;  4NC6 A;  2EZH A;  3LAP A;  1B8I B;  3QOD A;  3K10 A;  2QEX I;  3DV8 A;  1DP3 A;  2OTL I;  1GVD A;  1P2F A;  1T6S A;  3EYY A;  2EH3 A;  4BYY A;  2BXZ A;  2IBD A;  2NAZ A;  3FIS A;  5E8I A;  2DOD A;  3QYF A;  4PCQ A;  1I1S A;  3MCZ A;  1ZR2 A;  4X1E A;  1TBX A;  1O7L A;  1LDD A;  4ZC3 A;  2ZC2 A;  2FE3 A;  3CDH A;  2HDW A;  3BPX A;  1ETW A;  2QLZ A;  2BY0 A;  5FO5 A;  5DUK A;  1LE8 B;  1V4R A;  1U9N A;  1WI3 A;  4A3I J;  1QA6 A;  3MN2 A;  4ZYE A;  1KON A;  5D4R A;  3ELK A;  2O8K A;  4IQ4 A;  5JVG F;  4GXO A;  4NQW A;  2AXL A;  1PDN C;  3LSP A;  4EM2 A;  5IT3 A;  1F9N A;  3T0Y A;  1IXR C;  1E3H A;  3DKY A;  2ACJ A;  1EF4 A;  1T56 A;  1NTC A;  5L3E A;  2M1B A;  5L3D A;  2DPD A;  4UUS B;  5J1U A;  1VQM I;  2VOD A;  1UHW A;  3PQJ A;  5ICF A;  3O6B B;  1HQC A;  1WCM J;  3HEF A;  3TP0 A;  3WTZ A;  3JSP A;  1ODD A;  4A5N A;  4IVN A;  1R9T J;  4RS8 A;  4BGD A;  2FRH A;  5LBQ A;  3BC8 A;  1WFX A;  1Z9C A;  3CCM I;  2E1N A;  3CUQ B;  2GIZ A;  2CFO A;  2XPV A;  5AIQ A;  1FOK A;  2I5U A;  2VUM J;  4HX8 A;  1DPU A;  4J19 A;  2XAG A;  4H4K C;  3VEP A;  1HW2 A;  2KIU A;  2CUJ A;  4UVB A;  4BEH B;  2CV1 A;  1KU3 A;  3FZV A;  1F36 A;  4O6J A;  4N9H A;  2IS6 A;  5LGN A;  3H3V K;  2K7L A;  1ORK A;  3WGI A;  3PFY A;  4QPO A;  2F5E A;  5FKO A;  2NXN B;  4BQO A;  3M4O J;  2A6H F;  3H35 A;  3M7G A;  3ZQH A;  1SAX A;  2M34 A;  1V55 H;  2OA4 A;  4RGR A;  3V8L A;  2V6E A;  3DU6 A;  4CSW A;  1UG2 A;  1XGO A;  4ZYG A;  2JA5 J;  2PX9 A;  2GLO A;  4KIF A;  4A3E J;  3PL8 A;  3L1P A;  4YFX F;  2F6C A;  2R7O A;  2XRO A;  1QVT A;  3S2D J;  2QSF X;  4IJA A;  3KET A;  2Y0M A;  4MEX F;  3IKV A;  3OV8 A;  1UG0 A;  4MFE A;  4UHT A;  4ON0 A;  4A5M A;  3C2G A;  3IV5 A;  1XN7 A;  2DPU A;  2VC0 A;  4CYC B;  1BIA A;  2W24 A;  4P1W A;  1YIT I;  1TQM A;  1IN5 A;  3HRM A;  3EET A;  5DCF A;  3EUH A;  1MDM B;  2ELK A;  3OS1 A;  2JPC A;  4W1U A;  4RAG A;  3M8E A;  3U2R A;  4NC7 A;  4FE7 A;  4EJU A;  3QPT A;  3LSI A;  3DBL B;  3F9K A;  1K7A A;  2YX7 A;  3LFK A;  4IXA A;  2QF7 A;  2X51 A;  2VOP A;  4BH9 A;  4XQF A;  3LWF A;  5LFA A;  3SJM A;  3GTQ J;  2LR8 A;  3TDZ C;  1ON2 A;  3G3Z A;  2Y9Z A;  4XNF A;  3PUB A;  4U87 A;  1N75 A;  3ZMV A;  3LSG A;  4CGZ A;  2LFB A;  5CVI A;  3KPH A;  3BWG A;  4XK4 A;  1DGW Y;  5H6Q A;  4AIJ A;  2AQE A;  2JRM A;  1MSF C;  4HDU A;  2K9M A;  2F5F A;  2EQR A;  2L9S A;  5HLI A;  1TW2 A;  2XAU A;  1TNS A;  1BI2 A;  1T2K A;  1MMS A;  1FOW A;  2VXZ A;  5IP7 J;  2WWY A;  4PSW A;  2R4G A;  4ZYH A;  4DOZ A;  1U8R A;  4WXC A;  5GAG J;  3OR1 C;  1P7I A;  1FYL A;  4CIC A;  1ZRD A;  3G6E I;  4FET A;  3FF5 A;  1E0E A;  5LGU A;  2HQR A;  3DPU A;  1QU3 A;  2EWN A;  2DYR H;  4LLL A;  2VPL A;  2E1O A;  1OCO H;  1FNN A;  2CQQ A;  3OIQ A;  3NEU A;  2IVM A;  5EG0 B;  5A2Q Z;  1HKS A;  3JRD A;  2R5Z B;  2XAJ A;  1VQ5 I;  3U21 A;  2PFB A;  2DMU A;  5JVT A;  2W85 A;  3QQA A;  4IHX A;  2FBH A;  3R60 A;  1VF9 A;  2EB7 A;  5DS9 A;  3F23 A;  4F52 A;  1R22 A;  4BQA A;  4RB1 A;  2F4I A;  2EFO A;  3H5R A;  3AL0 C;  1WJA A;  4Q47 A;  5B1B H;  3KP2 A;  2ECB A;  3RCO A;  2E5Z A;  4E7H A;  1GLN A;  4PFP A;  3HOS A;  2UXX A;  2G7H A;  5H20 A;  1K6O A;  2K4B A;  4B8X A;  4WXH A;  5ICC A;  3G73 A;  1W36 C;  5AON A;  1LPQ A;  2AXT C;  4II3 A;  5CVJ A;  3OYJ A;  2PN6 A;  4BE0 A;  3W6J B;  1AOY A;  1J09 A;  1ZKG A;  1QRY A;  2EIJ H;  2A3S A;  1MIJ A;  2XV4 S;  4U88 A;  3V42 A;  5H6R A;  1ZN2 A;  4CH7 A;  2JSP A;  3M1E A;  5EEH A;  3L09 A;  3L7W A;  1T39 A;  1RET A;  3I5U A;  2IA0 A;  2A61 A;  2R5Y B;  2E60 A;  4GDF A;  5DUI A;  1QGP A;  3TO6 A;  1IN8 A;  3E5X A;  5FKN A;  4RM3 A;  3WTT C;  3RPU D;  4G6T B;  1U6G A;  4DYR A;  1IF1 A;  1BBY A;  4I98 B;  2OQR A;  3CCJ I;  1USS A;  4IOA F;  2HNH A;  4N4N B;  5FGM A;  4ANJ A;  1MBJ A;  1LDK B;  2WY7 Q;  2M8G X;  3E1S A;  4PJJ A;  4XRS A;  2OD5 A;  2HR3 A;  1DGR M;  2DI3 A;  4D9J A;  3K4M A;  1IUY A;  2HYG D;  1MBE A;  5TIS C;  1S9H A;  2KZV A;  3ABL H;  3W2W A;  3MVP A;  3K70 C;  2VAS A;  2HDC A;  3L2C A;  3KP4 A;  4I7H A;  2KJC A;  4HV6 A;  4LG0 A;  2WAE A;  3HPG A;  4AUX A;  2M8E A;  1B4A A;  3NAU A;  2LF7 A;  3JTG A;  2RQP A;  3FXO A;  4LB5 A;  2EA4 A;  1A6I A;  3WTW C;  3JRH A;  2K02 A;  2XPW A;  3L2Q A;  5E17 F;  3GZ5 A;  1I6X A;  2L4A A;  1OCZ H;  1D0X A;  2K3F A;  5E20 A;  2IGN A;  3M3Y J;  1WZ2 A;  3VYR B;  1MW7 A;  1YW7 A;  4UVA A;  2GBY A;  1J59 A;  1O57 A;  2CW7 A;  3BQY A;  3G1O A;  1SD6 A;  1SD7 A;  5D5W B;  2ID6 A;  2R7Z J;  2EFP A;  1U5T C;  4E7L A;  3BPV A;  4JX6 A;  4NQW B;  2HDD A;  5KAF C;  2PMZ A;  3CJN A;  1PJR A;  4OMZ A;  3RZD J;  2ZJ2 A;  4XSX F;  4DW6 A;  1VQN I;  1S7E A;  3BG6 A;  5HLG A;  4HA8 A;  2HKX A;  4DYC A;  4P96 A;  4NUB A;  5FFX A;  2RQQ A;  4EJV A;  2LKP A;  2DU9 A;  5F08 A;  3I0T A;  2YX4 A;  2LG4 A;  5F6F A;  1OFC X;  3ULQ B;  2ME6 A;  4I76 A;  4A6E A;  4BS9 A;  3HOV J;  2HTS A;  6PAX A;  3M9A A;  1HST A;  2DMP A;  2STT A;  4HSR A;  1JGG A;  4DYQ A;  2HTJ A;  3CJR B;  2DFI A;  3OYB A;  4HW0 A;  1EKE A;  2RC4 A;  2M87 A;  3FHZ A;  2OUM A;  2LSO A;  4RB2 C;  2Q0O A;  5K7F A;  1IW7 F;  1Y8R B;  4MQ9 F;  1NH3 A;  2OJE D;  5HLH A;  5KAI C;  2BW3 A;  3H9J A;  2XAQ A;  3TOA A;  3QU6 A;  2LKX A;  3LA2 A;  1O3S A;  1I6H J;  1BC7 C;  3BR2 A;  3RKW A;  5E1X A;  5HLT A;  2YUS A;  2VQC A;  4GFB A;  5IYD J;  3JRE A;  2VBX A;  2ZJP F;  3S1N J;  2Z1D A;  1T33 A;  2FXA A;  3AAF A;  4IL6 C;  3QU3 A;  4BY1 J;  2V1D A;  5E3O A;  4D7N A;  2MG4 A;  4YFN F;  3AG4 H;  3CCQ I;  1IAW A;  2ZXW H;  2XB0 X;  1S3J A;  3I59 B;  3CCY A;  2PMU A;  2MH2 A;  3MD2 A;  2R7R A;  1HF0 A;  3SZG A;  4L0Z B;  5FLX K;  2HPI A;  1OQY A;  2JN6 A;  4OIP F;  4II2 A;  4JX4 A;  4XBF A;  2VJJ A;  3M8F A;  4NDL A;  3HSF A;  5J3L A;  1X58 A;  4CCL A;  1MBH A;  2CQN A;  3GFM A;  1K79 A;  3GWZ A;  4M74 A;  3OYK A;  1H88 C;  3CZ6 A;  1FIA A;  1DP7 P;  4F91 B;  1VQO I;  1SFK A;  4S04 A;  1HCR A;  2P6S A;  1O3Q A;  3KP6 A;  2E19 A;  1LDJ A;  2ETH A;  3WE3 A;  3IH3 A;  2A5Y B;  2L54 A;  1AA7 A;  3GZN B;  3IC7 A;  1WKM A;  2DFE A;  3RJP A;  2F5D A;  2QGU A;  3J7A O;  3QAH A;  3K0L A;  2VI6 A;  2BY1 A;  2JPB A;  4BJ5 C;  3CUO A;  2DA3 A;  1HDD C;  3BZ6 A;  1Z3X A;  1A5J A;  2EBI A;  1XMX A;  1KA8 A;  1Z21 A;  4EEF G;  1JKR C;  1G59 A;  1R5G A;  4JOM A;  3NWT A;  1LNW A;  2YR2 A;  1J2X A;  4MGR A;  1B59 A;  2FOW A;  1KGS A;  3TKY A;  5FKL A;  3ZOB A;  1W0U A;  2EPF A;  2P7V B;  1RI7 A;  2BEO A;  3IUO A;  3TGN A;  3LFU A;  3VOE A;  1WPK A;  4QTR A;  2V6C A;  3MQ0 A;  2BV6 A;  3OR2 C;  4Q5S F;  3WU0 A;  2MLK A;  2R92 J;  2DQR A;  1O3R A;  3EPZ A;  4A3K J;  1ZRC A;  3GBG A;  4D0P A;  2ZJR F;  2NVQ J;  2R7V A;  4WXD A;  1VQK I;  1R00 A;  3SQN A;  2XIG A;  4AYB A;  4P9U A;  4A3C J;  1LEA A;  1O7F A;  3CP8 A;  5HDN A;  1RKW A;  2L9N A;  4U0V A;  1H89 C;  1W1W E;  3UR3 C;  3CUQ C;  2QA4 I;  2FBI A;  1JJ6 C;  5DCM A;  3H36 A;  4GRI A;  2CUF A;  3DTK A;  1S7O A;  4XID A;  1W7P D;  1CGP A;  2E7W A;  3N05 A;  3H5A A;  1OR7 A;  1JKQ C;  5IOZ A;  3BG9 A;  3I58 A;  4M71 A;  5EYR A;  3U9G A;  2EZK A;  1KYZ A;  2E5N A;  2EV0 A;  1LB2 A;  1IG7 A;  4ZZL A;  2C6Y A;  4HX4 A;  2QEN A;  2JT1 A;  1LKX A;  4BE1 A;  2OCC H;  1GXQ A;  5HNH A;  1TLH B;  2VKV A;  3GFJ A;  2LTP A;  3KZY A;  3CES A;  1YJ9 I;  1F5T A;  5K5Q A;  2IP2 A;  2PMZ N;  5F27 A;  2CGP A;  3SEQ A;  4ZDP A;  3DEE A;  3A1Y A;  1U0J A;  2HFH A;  3JRF A;  1VQP I;  1QO0 D;  1SVL A;  5J1Y A;  4LLN A;  4H0E A;  3VDX A;  3OL3 A;  4BKX A;  1FJL A;  1XB4 A;  2ZKZ A;  4WF2 A;  3EUK L;  3C3W A;  2Y30 A;  2M0C A;  3DPT A;  2EZI A;  4Y52 J;  2DA7 A;  2GIV A;  2DA4 A;  2WAF A;  2X6O A;  1U2W A;  1D0Z A;  1QHG A;  2ZME B;  1UMQ A;  1R1T A;  3BY6 A;  1FEX A;  3W3C A;  2BXY A;  4O5V A;  3NWS A;  3RPU A;  3WU1 B;  1ZLK A;  1K78 A;  2JK3 A;  4LG0 B;  1YHQ I;  2L3D A;  3IWZ A;  2A68 F;  1XSV A;  1QPI A;  1TWA J;  2A6E F;  3DPL C;  5JI6 A;  1E2X A;  1T08 B;  1JUS A;  4RGS A;  4FHT A;  2BY3 A;  3E97 A;  4UV8 A;  3S2W A;  3LSR A;  3SFZ A;  3I71 A;  4A3D J;  4KIG A;  1E3O C;  1OCT C;  3LOC A;  5KVR A;  2L5Q A;  1P9Q C;  4UVC A;  3WG7 H;  2L7F P;  2OC6 A;  5ICE A;  4IHV A;  1TQP A;  3OOU A;  4YIR X;  3P9K A;  1MBK A;  4C2M J;  2DFH A;  3D5S C;  1W36 D;  3L2V A;  3PNV A;  4A0Z A;  3ABT A;  4CCK A;  2XF6 A;  2ZFW A;  3BZK A;  4M6X A;  4QIW N;  5J1R A;  3F3X A;  1JKO C;  2E1C A;  3BR1 A;  2E7X A;  2VL8 A;  1LVK A;  4CCM A;  3KLO A;  2XAF A;  3ISP A;  1Y39 A;  1ETO A;  3K4C A;  5A2Q K;  1R36 A;  1HKT A;  4CCJ A;  1WQ2 A;  4HNV A;  4YFK F;  2OTJ I;  3V7R A;  3ZMT A;  4WWC A;  3FXU A;  4IF4 A;  4HDV A;  2GXB A;  5EF6 A;  3H3U A;  2M7A A;  3PQK A;  2RDP A;  3ML6 A;  3OYF A;  1IN7 A;  4C3J J;  4HPQ A;  2GXA A;  1V54 H;  3OS2 A;  2ESH A;  3GTJ J;  2HOE A;  2CW8 A;  3I54 A;  2R7W A;  1R49 A;  3D5L A;  1LJ9 A;  1UCR A;  1BM9 A;  2K27 A;  2M30 A;  1SD4 A;  4E6K G;  3E0J B;  2D45 A;  1EH8 A;  4PK4 A;  1Y56 A;  3C1D A;  4D7M A;  5GP9 A;  4HZF A;  2EFQ A;  5IP9 J;  4HG2 A;  1PP8 F;  3OOP A;  1HSJ A;  3GTP J;  2DTZ A;  4N0B A;  4LIV A;  5KCM A;  2PMH A;  4ZYD A;  2NOG A;  4PDK A;  5FFZ A;  3EUA A;  4C3H J;  3FK7 A;  4ESJ A;  2QQ9 A;  5BPI A;  4C9Y A;  1GT0 C;  3FXK A;  3ZQI A;  4XL9 A;  2A5W A;  2V26 A;  2FBK A;  2OZU A;  5L3G A;  1B1B A;  2VQH A;  1K6Y A;  1AKH A;  3G1L A;  5IOY A;  1XMA A;  5J8C A;  3BTC A;  3GXO A;  4RAZ A;  3W2A A;  2FSW A;  3K4L A;  2LDU A;  3JTH A;  1LFP A;  1Q1H A;  2CH0 A;  4BQN A;  4AIH A;  2WA0 A;  1TC3 C;  2JVG A;  3V8K A;  1J75 A;  2ME0 A;  4Q4Z F;  2RKH A;  4AYB N;  1R71 A;  3PSF A;  1X4P A;  5L3B A;  1HXD A;  1PYV A;  2CRG A;  3OL4 A;  4KMU X;  1JKP C;  1MJA A;  4IRH A;  2ZSH B;  3SXY A;  3V7C A;  4OIQ F;  4PJM A;  4HEA 2;  1SMY F;  3QPH A;  1OJL A;  3DKW A;  1YTY A;  1VQ4 I;  3R61 A;  3QP5 A;  4OIR F;  5EDN A;  1V3F A;  2IW5 A;  2MW8 A;  3F8N A;  5CQE A;  4HQM A;  2DA2 A;  2MA3 A;  2BZT A;  4M3F A;  4CZZ A;  4FT8 A;  3ZXS A;  1FYK A;  4RBO A;  3HTU A;  3I4P A;  1VI0 A;  3S3M A;  1P6R A;  3M07 A;  4F93 B;  4I09 A;  5FD5 A;  4HF2 A;  2UV1 A;  2CWE A;  2PBI A;  5KHD A;  1QZY A;  4EM0 B;  1YFH A;  3I55 I;  3L2U A;  3MMY B;  2IRF G;  4N9I A;  1XS9 A;  4YEJ A;  2VN2 A;  2LK2 A;  3N97 A;  5M5X J;  5BMZ A;  2R7Q A;  1XMK A;  3K4B A;  1W5S A;  4BHP A;  3DLL F;  3UKG A;  2QBY A;  3TBI A;  1SEU A;  1LQ1 A;  2TDX A;  2FQ4 A;  4ESF A;  1TWH J;  1Z67 A;  4A0X A;  1GHC A;  4M3B A;  2Z33 A;  1WH5 A;  2DT6 A;  2W7N A;  2QWW A;  2CV0 A;  2WTE A;  3OYN A;  4L9N A;  4ENM A;  2VT3 A;  3M8J A;  3I53 A;  3ZP5 A;  5DCM B;  2W25 A;  3SDG A;  1R5H A;  2CQK A;  1MH3 A;  2MAB A;  3CJT B;  3ZMS A;  3E6B A;  3RSN A;  5DM7 F;  3HC7 A;  5ICG A;  1GV5 A;  3J7Y J;  3GFL A;  4F55 A;  4M9Z A;  3HZJ A;  1BI1 A;  2W84 A;  3WTY C;  4BXF A;  3PNY A;  3BR3 A;  3LAJ A;  1TW3 A;  2ID3 A;  4BU2 A;  4L5I A;  4LIU A;  1UFM A;  1MMA A;  1MKM A;  3RZO J;  1E17 A;  1ZLJ A;  2DYS H;  1QVU A;  2RNG A;  3HBL A;  5CLS A;  1YIJ I;  3OYI A;  1Q1V A;  3GME A;  1RNL A;  3G1M A;  3CC2 I;  1ZEL A;  4Y17 A;  1ZGW A;  3CC4 I;  4G12 A;  3ZGK A;  1X1C A;  3BP8 A;  5DYM A;  2VB6 A;  2B7E A;  1EJ9 A;  4IQJ A;  2DA1 A;  4JK1 X;  3DEW A;  5HOD A;  4Y33 A;  3C18 A;  2B9S A;  4FIS A;  3KZZ A;  2DT7 B;  1G2H A;  3LST A;  4ITV A;  4BJT A;  1BR1 A;  2R7D A;  5HDK A;  2KIM A;  3L00 A;  5E1W A;  5B1A H;  2QSH X;  5FB2 A;  4XLE A;  1V5G A;  3IH2 A;  1TTY A;  3HHH A;  3W6K B;  2FOK A;  1K78 B;  3F21 A;  3CO6 C;  3S17 J;  1G3S A;  1R4M B;  3ZMU A;  4I0A A;  5F0C A;  2DDB A;  3BJA A;  1WGX A;  4M6V A;  2KIS A;  2I10 A;  2CYY A;  2VE8 A;  1HA8 A;  2QCO A;  1FYM A;  1YX3 A;  2F5V A;  2HYF A;  4RGX A;  5D6F A;  1STZ A;  3WTS C;  4A93 J;  3SZT A;  4F92 B;  4Y15 A;  2ZNZ A;  3IAM 2;  2QQ8 A;  2CO5 A;  1VND A;  3ZQL A;  1Y6I A;  3BG7 A;  1ZG5 A;  2PJP A;  1X3U A;  3GCM A;  3DEU A;  2STW A;  2N8G A;  2DOA A;  5J4Y A;  3WTU C;  3Q0W A;  1IGN A;  5EJC A;  4M6Y A;  3ZN0 A;  5J4V A;  3WGG A;  2QUF A;  1G3T A;  4EMS A;  1TQI A;  4GCV A;  2NRA C;  1FSE A;  2VQL A;  2KLO A;  4DJA A;  2W1O A;  4KIC A;  4DQ2 A;  5LGT A;  1UAA A;  1ZGJ A;  2UZK A;  1BA5 A;  1P4A A;  4BUP A;  2XB5 A;  3GW2 A;  1X2N A;  1HKQ A;  2LBF A;  4B4C A;  2BHY A;  3WG9 A;  4B1R A;  1G3W A;  4OOI A;  5D8K B;  2DOF A;  3LA3 A;  2QSG X;  4OMY A;  2IS4 A;  2HZT A;  5BQT A;  1SVO A;  1PUF A;  1HW5 A;  2LOO A;  1BI3 A;  2J5O A;  2ZXJ A;  3FM3 A;  3IP4 B;  2V9K A;  4S05 A;  2CSO A;  1G4D A;  2IAI A;  5E3M A;  1ZH5 A;  3ZMD A;  2ESN A;  2LD5 A;  2JZY A;  4Y13 A;  1R23 A;  4CA0 A;  5CPR B;  1REP C;  1EV7 A;  3IRQ A;  3V4G A;  3E6C C;  2FF4 A;  3JW4 A;  3IL2 A;  2PQ8 A;  4R8H A;  1WJE A;  5CYV A;  1QQI A;  1JHF A;  1DPR A;  2FNA A;  2BYV E;  4MEY F;  2Y48 A;  2HOA A;  4XKB A;  3DBR B;  2X4H A;  2XPU A;  4R79 A;  4G6D A;  3DKX A;  3CO7 C;  1BC8 C;  4IHT A;  1IV8 A;  4V19 K;  5E18 F;  2EFN A;  3FXJ A;  2K9S A;  1HW1 A;  1MMD A;  4G94 A;  1U78 A;  2DTR A;  1YS7 A;  3A03 A;  2IEK A;  5K7Z A;  4CYD A;  1D0Y A;  3K1N A;  1EH6 A;  1XDU A;  2XGC A;  4RB0 A;  1NHA A;  3KX2 A;  2DMN A;  3I4N J;  2GQQ A;  2NOJ B;  1YLF A;  1A6Q A;  1A31 A;  3DFG A;  3RDI A;  4ZH4 F;  1AKH B;  4LK1 F;  3S1Q J;  5IT9 K;  2WAD A;  2LRD A;  2V7F A;  3BR5 A;  2E34 A;  1YQA A;  3VYS B;  5D4S A;  4EVI A;  4B43 A;  1W0T A;  5EZG A;  1MGT A;  2OZ6 A;  1CF7 A;  1OLT A;  1IRG A;  2LP0 A;  3VFZ A;  1X2M A;  2A6T A;  2R3S A;  3BZC A;  3KYD B;  4UUT A;  2WB1 A;  3D0S A;  4PJ0 C;  1JGS A;  3ZCO A;  2X0L A;  3HGG A;  1U5T A;  2JUG A;  2L7K A;  2YSR A;  3A4C A;  3LL7 A;  3UNG C;  1YS6 A;  4ENN A;  2IT0 A;  1QPM A;  4E7J A;  1Z6R A;  2ZME C;  1VFC A;  2HZD A;  3KIO A;  2VPR A;  1IRF A;  4KT5 C;  2AHQ A;  2JTV A;  4IHS A;  2XF5 A;  3H1C A;  3E7L A;  3S3N A;  3O8G A;  1I3Q J;  4JQF A;  2DA6 A;  2P4W A;  4KIT B;  1MJB A;  5J47 A;  4CHU A;  1DU6 A;  2XF7 A;  2JA8 J;  3OS0 A;  1WSU A;  1FBU A;  2Y2Z A;  1E3P A;  1Z05 A;  3FBI B;  5E3L A;  3ABU A;  2W4S A;  4V2F A;  3NAR A;  2RGV A;  5LRR A;  1KU7 A;  2X9D A;  2WBM A;  5BS6 A;  3F0C A;  1OCC H;  3ASO H;  3K4K A;  4RMN A;  2V9V A;  2HQN A;  3MFK A;  4B3A A;  1XC5 A;  4G7Z F;  3EQL F;  1LFU P;  1H9T A;  2NVT J;  1WVR A;  2QZ8 A;  1F4K A;  4XN0 A;  3Q0V A;  3QOE A;  2R7T A;  3LA7 A;  4C2U A;  5CJ9 A;  4XOR A;  3HRU A;  2R7X A;  1KU9 A;  5HDG A;  4BE2 A;  1OCP A;  2L01 A;  1UHM A;  3ONQ A;  1X1P A;  3RQ4 A;  3WE2 A;  3NRV A;  3DWL E;  4YRV A;  1RR8 C;  1IDY A;  4KMF A;  1R7J A;  4K2E A;  1LUJ B;  4E4H A;  1BW5 A;  3RI4 A;  2JJ7 A;  3T5X A;  1U8B A;  3AFH A;  3FIW A;  3OYE A;  2KZG A;  3DU5 A;  3F8B A;  2KL4 A;  1JT6 A;  2E35 A;  4XLN F;  1I39 A;  2E2H J;  3ABK H;  1UZC A;  2K86 A;  2KPM A;  1V5F A;  2VJ4 A;  3K1M A;  3HG9 A;  3I64 A;  3HOW J;  2ZBK A;  4R1H A;  1DQU A;  2DFF A;  3BCA A;  4MFD A;  4CCN A;  3GEZ A;  4UXN A;  3D5R C;  3JRA A;  1JXS A;  3FK6 A;  1B6A A;  2E36 A;  1ZG1 A;  2X6X A;  3OYC A;  2YS9 A;  5L3F A;  4CXF A;  4KFC A;  2Z9O A;  4DBQ A;  4W97 A;  3CF2 A;  5K5R A;  1IJW C;  2XAH A;  1B72 A;  3VPR A;  1X19 A;  4EJW A;  1IRZ A;  1LVA A;  2XAS A;  3A0B C;  1IN4 A;  2QM3 A;  1F43 A;  2JSC A;  2M5W A;  5DD8 A;  2HVS A;  4RAY A;  2P0W A;  2M0M A;  3OSF A;  5D5V B;  4I2O A;  1XD7 A;  3BR6 A;  3H3Z A;  3OWT A;  5TGT A;  2K3P A;  1D8K A;  1Y8Q B;  3GO5 A;  1C0W A;  4OWR B;  2R7S A;  4IKF A;  2R7U A;  4EQQ A;  1FZP B;  4EGZ A;  1B8I A;  1R4N B;  4DNC A;  4MIM A;  1HDP A;  1NK2 P;  2EFW A;  4X0G A;  1UB9 A;  3MKW B;  1XGM A;  3BDD A;  4ZDL A;  1XGN A;  2W00 A;  3H0D A;  1MBF A;  1D5Y A;  5K1Y A;  1O3T A;  4JYK A;  5M3M J;  1N78 A;  4A3G J;  2M2E A;  2Z16 A;  3B02 A;  4AVP A;  1G8X A;  3JRI A;  3JRG A;  2VQG A;  4I99 C;  4RLQ A;  5DTD A;  2Y75 A;  3ASN H;  3LMM A;  2LKS A;  4LMY A;  2KKO A;  2WY8 Q;  4MTD A;  2O61 A;  2QKM B;  1OCR H;  3SFI A;  5IP6 A;  2XRL A;  3LSJ A;  2VBW A;  1FSH A;  2KRH A;  2LC2 A;  4Z6Y A;  5C44 J;  2LMD A;  4BAY A;  3ESW B;  1B9M A;  3HOU J;  1MSE C;  4AM3 A;  1Y1V J;  2DXI A;  3WOD F;  1QHH D;  1T0F C;  2Q1Z B;  2ISY A;  1MMN A;  1Z7L A;  3P9I A;  1K61 A;  4MHG A;  1SAN A;  4A3F J;  3AL0 B;  2XUB A;  4O3M A;  3CDL A;  1EA3 A;  2WAQ A;  4HOB A;  3RQI A;  4BHB A;  5HNF A;  2XVC A;  4M3E A;  3CF5 F;  3TDU C;  1TWG J;  3ECH A;  1H8A C;  3QRF F;  1Y0N A;  5EEA A;  2V4J C;  5E3N A;  1RUN A;  5EZH A;  4Y3O A;  4OU0 A;  2DW4 A;  1JT0 A;  4L0Y B;  4UB8 C;  2LRE A;  2H8W A;  3T8R A;  2WB1 N;  1TL8 A;  3CCU I;  3S2H J;  2GA1 A;  2WV0 A;  3KP3 A;  1JHH A;  1ZGA A;  2HXI A;  1R58 A;  3U1K A;  2IA1 A;  4XKV A;  1BR2 A;  3TP3 A;  3TO7 A;  3IRR A;  4D5C A;  4BDY A;  4RA2 A;  4AVZ A;  1X1D A;  4IOC F;  4AID A;  3S14 J;  4ZJZ A;  5IT9 Z;  2X48 A;  4CYC A;  1TWC J;  2XGE A;  2HU9 A;  3CJQ B;  3R6S A;  2VLA A;  5ILS A;  1B9N A;  2MYS A;  3LQR A;  2Y31 A;  3Q0U A;  3PIO F;  1IDZ A;  3V7S A;  2GXG A;  2MBF A;  1I1G A;  1ZRF A;  4HF1 A;  3JR9 A;  2E2J J;  3CCL I;  1MNM C;  4HX7 A;  2RNJ A;  4YG2 F;  3FM5 A;  1X1A A;  1DUX C;  1FX7 A;  3QPS A;  3OSG A;  3HUG A;  3LSH A;  4I6Z A;  2M4K A;  4C2T A;  4FQG A;  2HPM A;  1Y0U A;  2XKP A;  2VKH A;  5CQG A;  3MAJ A;  4C30 A;  2ZFU A;  4XSZ F;  4EJO A;  5D5X B;  4DZJ A;  1IN6 A;  1FC3 A;  1U5T B;  3FMR A;  1KQ8 A;  3VWB A;  2KHM A;  3PSI A;  3T8T A;  1RUO A;  3J81 K;  2VBY A;  4EAT A;  3X2Q H;  1S29 A;  5D5U B;  1OIS A;  2JA2 A;  4AU7 A;  1Z91 A;  2O03 A;  2W57 A;  3HGY A;  1BL0 A;  2YU3 A;  1PVE A;  3HPH A;  4HNU A;  1T8I A;  5TJJ A;  4NNJ A;  1GUU A;  4P5O A;  3JRC A;  2G0E A;  2EA2 A;  1ACI A;  2RV8 A;  1JE8 A;  1L0O C;  3SZP A;  2H6C A;  5EGO A;  2XC7 A;  4L9J A;  5EG0 A;  4L18 B;  4A3B J;  4NBQ A;  1FP1 D;  2Q2E A;  3S8P A;  1Y1W J;  3GLX A;  3HKZ A;  5FLV A;  2Y69 H;  3RIR A;  5ILU A;  3ZPL A;  1SFX A;  3KP5 A;  1YYV A;  3ZQG A;  4UUV A;  2K40 A;  3F8F A;  4KUM A;  4A12 A;  4N4O B;  5D8L B;  3GTK J;  4PSX A;  3A02 A;  4Y7N J;  3IWF A;  3AG3 H;  2P8T A;  3J7Z I;  2EIN H;  3DXJ F;  3HOX J;  4ZTJ A;  4BJ6 C;  2BHZ A;  3B6A A;  1Z7U A;  3GUD A;  1MJ9 A;  2OF7 A;  3HJE A;  4YII A;  2BW3 B;  2JRT A;  1VQ6 I;  3KLN A;  3COA C;  2HVQ A;  1WJC A;  2IXS A;  3BLY A;  4QPQ A;  4BHC A;  4F3Q A;  2HQ5 A;  5GTH C;  2E1M B;  2FML A;  2P5L C;  4PGG A;  2P6T A;  2OPT A;  2CW0 F;  5K5O A;  1VQ7 I;  4OAY A;  2M3A A;  4A2U A;  1HBX G;  3TQN A;  5CVV A;  3N4M A;  4OIO F;  2KFD A;  3IH4 A;  1ZQ3 P;  1MMG A;  3TW6 A;  3J7A Y;  3GTL J;  3FHN A;  3OYD A;  4XR6 A;  2O0Y A;  5F1R A;  4L9V A;  4FX0 A;  3SHF A;  1QZZ A;  4AC0 A;  3K6G A;  2MGQ A;  3J80 K;  2I8D A;  3U1D A;  5DD4 A;  3VYT B;  2HVR A;  2HKO A;  3R0A A;  1B72 B;  4MNU A;  1G6N A;  1BN5 A;  1OYI A;  4BXX J;  3REO A;  2ZXH A;  2BY2 A;  3DQV C;  5HS8 A;  2NVX J;  4EJT A;  4KN7 X;  3MWM A;  2WAQ N;  1Z6T A;  1TNT A;  2LY1 A;  3ABM H;  2D1H A;  1ETK A;  2VJI A;  3LSK A;  2B63 J;  2DDA A;  5AIP A;  1HLV A;  2L7Z A;  2UXN A;  3FXM A;  5GPC A;  5HS9 A;  3TW7 A;  2QQB A;  3BQZ A;  1K4S A;  3D1N I;  1MZB A;  4HLX A;  1FLI A;  2F2E A;  3G4S I;  1OMI A;  4UB6 C;  5JR3 A;  4KIS A;  1VQ8 I;  2VOO A;  2NS0 A;  4DZP A;  1OYY A;  4E7S A;  4CDG A;  4A6D A;  1SMT A;  2V9P A;  5BNG A;  3HSE A;  2EIK H;  4MLO A;  1SFU A;  3OYG A;  3VSK A;  1KQ0 A;  2WV1 A;  4HQE A;  1RKT A;  3CP2 A;  1FOX A;  4XLA A;  4EM1 A;  2CQX A;  2GM4 A;  2HEO A;  2RN7 A;  3Q3S A;  2H27 A;  4IHW A;  4RGU A;  2OBP A;  4AD9 A;  1WHU A;  4M3D A;  1IRX A;  5GAH J;  2ADU A;  4IEJ A;  1X3Z B;  3HXL A;  2RRE A;  1N77 A;  5F0F A;  2L4M A;  4KYW A;  2KDO A;  3I3L A;  5LD2 C;  1ETY A;  4LIT A;  1YOV B;  2JA7 J;  3E6M A;  4HAM A;  4MO7 A;  3RYR A;  5L3C A;  3FBN B;  4IRI A;  4RAF A;  1Z1D A;  2NNN A;  3K2Z A;  2GOX B;  2OCE A;  3W6V A;  2VIX A;  2MFZ A;  2ELH A;  2JMW A;  1D8J A;  3EDP A;  4BAC A;  4S0H B;  1R6R A;  3OYM A;  1XGS A;  2BGC A;  1BJZ A;  2F5C A;  3CDI A;  4KJZ A;  4XOT A;  3MZH A;  2HI3 A;  2KMU A;  3RKX A;  3CCS I;  1YW9 A;  2DO7 A;  3FDY A;  2L9R A;  5LEK A;  1IXS B;  2Z5U A;  3GVA A;  3MZ8 A;  2GOM A;  3G2B A;  3CTA A;  4XM3 A;  4X6A J;  4CUG A;  1M1E B;  1YO5 C;  5IYC J;  3PJR A;  2K9N A;  2FD5 A;  2DT5 A;  5F04 A;  5LHI A;  3MKL A;  1O4X A;  4A69 C;  3JAM K;  2JUC A;  1UHS A;  4XON A;  4OAZ A;  4L5E A;  4XIC A;  1FIP A;  1GVJ A;  5LLQ A;  4M9S A;  5D6E A;  5FRN A;  2QVO A;  1TT0 A;  3HM5 A;  4BBS J;  1GDT A;  1W7P A;  3K1P A;  2L2O A;  5DDG A;  2L0K A;  2L7M P;  4XKC A;  3FKI J;  5FLM J;  1CQT A;  2R0Q C;  4Q48 A;  3ZQC A;  5E8G A;  1P4W A;  1A36 A;  4TV7 A;  1KQ9 A;  2LNB A;  3I59 A;  4QSH A;  4A3L J;  2R93 J;  2OU2 A;  2NYX A;  3RKY A;  3VSL A;  3HKZ N;  2OAZ A;  4E7I A;  4XN3 A;  2UUZ A;  1D1B A;  2CJJ A;  5F64 A;  3K4J A;  3KCC A;  4XMY A;  4E7K A;  3LSM A;  2FA5 A;  3EUH C;  2Z99 A;  2DMQ A;  4XRF A;  2BBY A;  3J81 Z;  3S93 A;  4L9T A;  4BQQ A;  3HUG B;  3ZQQ A;  3FWE A;  3KYC B;  1W5C C;  3HYI A;  5GAD J;  2X1C A;  1ZTR A;  4BBR J;  3HOZ J;  2LH9 A;  4P55 A;  4LK0 F;  4B44 A;  1H0M A;  4KA4 A;  2DK8 A;  5B5E C;  5HVQ C;  3WHC A;  4M72 A;  4RDU A;  1GXP A;  4HYE A;  4XOP A;  1VQL I;  3Q9S A;  3H0G J;  3GTM J;  1D1C A;  3PO3 J;  2W82 A;  3OMY A;  1W5T A;  4NC8 A;  2OV7 A;  3RKQ A;  2DCE A;  3CC7 I;  2HQA A;  3A0H C;  4LG3 A;  2CMP A;  4BNC A;  1VZ0 A;  5C4J J;  1RIO H;  3PO2 J;  2BVL A;  1YW8 A;  3F8M A;  2GA2 A;  3P9C A;  1AU7 A;  1XG1 A;  2BE5 F;  3BTL A;  1F1Z A;  3GTG J;  2AQF A;  5EGO B;  2F4M B;  1S6L A;  3I9V 2;  4E70 A;  4U7B A;  1AWC A;  4MTE A;  2Q2E B;  5FKK A;  2CQ7 A;  2WC2 A;  2ELJ A;  2VXD A;  1RC9 A;  1W4M A;  3S16 J;  4Y4R A;  5CVU A;  2O7O A;  2GWR A;  3OYA A;  1OPC A;  2PLY A;  1TZL A;  3H9Q A;  5DM6 F;  1D1A A;  4KNY A;  2DK5 A;  3S32 A;  2AO9 A;  4YIF A;  3GYH X;  5LHH A;  3E6D A;  5CVR A;  4ZTF A;  5GPA A;  2O5R A;  4IPA A;  1BW6 A;  1A35 A;  1SD5 A;  5JFR A;  3HRS A;  4OIN F;  2VT2 A;  4PJL A;  4I01 A;  3L2W A;  3ERE D;  3WU2 C;  2Y0S A;  4DGW B;  3BJO A;  1XCV A;  5E79 C;  1N25 A;  2EV6 A;  2NVU B;  3WGH A;  3F22 A;  3WTX C;  1ONV A;  1VQ9 I;  3GTO J;  3LNQ A;  2MD0 A;  2AS5 F;  2PEX A;  2ZB9 A;  1DDN A;  3FMQ A;  1L3L A;  2EV5 A;  3KEQ A;  1ERD A;  3GZ6 A;  5F0H A;  3HB9 A;  3J80 Z;  2LY2 A;  4A3M J;  2DBB A;  2EIM H;  2O3F A;  4QLC U;  1A04 A;  2DJI A;  4PGH A;  2M4G A;  1J9I A;  3ZQF A;  3K4N A;  5LHG A;  2TCT A;  2P5V A;  1IV6 A;  3DTI A;  1HOM A;  1RRJ A;  4CO8 A;  4ASN A;  3C2B A;  2QKL B;  1FBQ A;  4JP0 A;  2HOT A;  4NHJ A;  3FX3 A;  3HDD A;  1J7K A;  1NG7 A;  4ESB A;  5KNL A;  4J01 A;  2PI0 A;  4XRS G;  1MND A;  1S5L C;  4XLP F;  2CUE A;  2FJ1 A;  2DN0 A;  1U3E M;  1K4T A;  2NVY J;  3IAS 2;  5J40 A;  2JA6 J;  3BTJ A;  1ZRE A;  4XRM A;  1ZYR F;  1ZK8 A;  3Q5F A;  2Z2S B;  1FWZ A;  2ZME A;  2H8R A;  1EH7 A;  1TWF J;  1SVM A;  3DLA A;  3MKY B;  3ERM A;  3AKZ A;  4M9X A;  3BJ6 A;  2FQ3 A;  3OYL A;  2FMY A;  2A05 A;  2BOL A;  4G8X A;  2MLG A;  4KIB A;  2H1L A;  2HGC A;  4MQV A;  4I0B A;  2O9L A;  5KK1 A;  4AWX B;  5JLX A;  5H2F C;  1U9O A;  3S15 J;  1AHD P;  2KRC A;  2DAO A;  4HST A;  1IC8 A;  1S7A A;  1IO2 A;  2PJR A;  4U0W A;  3EYI A;  3E5U A;  4LGW A;  3A01 A;  2LLK A;  4XKW A;  1YRN A;  3K7A J;  3ZQ7 A;  2H6B A;  3L9F A;  4V2G A;  1RZ4 A;  2Z3Y A;  1FP2 A;  1UST A;  4ETS A;  2BVM A;  4PJN A;  2XHK A;  5JHF A;  3V8J A;  4FAS D;  1SFO J;  3NQO A;  4BL0 B;  2IS1 A;  1HC8 A;  3B73 A;  1X4O A;  1YE9 A;  1XSD A;  1J0R A;  1YI2 I;  4IX7 A;  2XDV A;  5JHU A;  2QBY B;  3FMS A;  2J5P A;  3DF8 A;  3BTI A;  4G6Q A;  3RYP A;  1XX5 A;  1I3A A;  4GYG A;  1NG6 A;  1JUP A;  1LFB A;  2ECC A;  5CKT A;  4FX4 A;  2A69 F;  3JAM Z;  5B66 C;  5ED4 A;  1S72 I;  5M5W J;  4L5J A;  1WRJ A;  3PNT A;  3VYU B;  3CCV I;  2VBZ A;  1TP4 A;  4LFU A;  2ZNY A;  2FEZ A;  1T95 A;  3TO9 A;  2IGO A;  1I50 J;  5IY5 H;  2F4O B;  3KZI C;  2X85 A;  5F1J A;  1FMV A;  3QYE A;  1DU0 A;  4HRI A;  2DMT A;  2COM A;  3AG1 H;  4EV0 A;  1ZAO A;  3OY9 A;  4CCO A;  4HLY A;  2R7F A;  3GF2 A;  4GGG A;  4FCY A;  3JCU C;  3BG5 A;  2XSD C;  1FPQ A;  1W7P B;  4RM2 A;  3I4M J;  1XDS A;  5GTI C;  5TRD A;  1RPW A;  5BOX A;  3KE2 A;  3RTR A;  3SYT A;  2IS2 A;  1KU2 A;  2E1M C;  2IGM A;  4XLC A;  2D5V A;  4HNT A;  3GFI A;  2IA2 A;  3HTS B;  2XSJ C; 
#chains in the Genus database with same CATH homology
 1XS9 A;  4DZJ A;  4M3G A;  2LK2 A;  2KT0 A;  5M5X J;  1POG A;  1ZKG A;  1QRY A;  2RAE A;  4FE4 A;  4D5F A;  2TRT A;  3WHB A;  3UKG A;  5M3F J;  3HGY A;  1RET A;  1BL0 A;  2R5Y B;  5IPA A;  3CMY A;  1GUU A;  2NS7 A;  2FQ4 A;  3JRC A;  1TWH J;  2G0E A;  4M3B A;  5FKN A;  1WH5 A;  1APL C;  1LE8 A;  1MBG A;  2HYJ A;  5EGO A;  4DYR A;  5EG0 A;  4A3B J;  3QPL A;  1Y1W J;  3SDG A;  5M5Y J;  5FLV A;  1MBJ A;  1MH3 A;  2Y0S N;  2M8G X;  4FTH A;  3ZQG A;  2K40 A;  4XRS A;  5C4X J;  1GV5 A;  3S1M J;  3GTK J;  2HXO A;  1MBE A;  3A02 A;  3BR3 A;  4Y7N J;  3MVP A;  4UUS A;  1RR7 A;  2ID3 A;  3HOX J;  4AUX A;  3NAU A;  3B6A A;  3RZO J;  2OF7 A;  1QVU A;  3HBL A;  1A6I A;  3JRH A;  2XPW A;  1Q1V A;  1JJ8 C;  3G1M A;  1MH4 A;  1ZGW A;  2HQ5 A;  4G12 A;  3M3Y J;  4JX5 A;  1ETX A;  2GBY A;  3BQY A;  3G1O A;  3O8H A;  3JRB A;  2OPT A;  2DA1 A;  2ID6 A;  2R7Z J;  3DEW A;  2DA5 A;  5HOD A;  4FIS A;  2LVS A;  4JX6 A;  1G2H A;  3IH4 A;  2HDD A;  1PUF B;  1ZQ3 P;  2H1K A;  5JLW A;  3TW6 A;  3IH2 A;  3RZD J;  3GTL J;  4DW6 A;  3S17 J;  1S7E A;  5F0C A;  4AC0 A;  1Z0X A;  4DYC A;  2MGQ A;  1WGX A;  1WH7 A;  3B6C A;  4M6V A;  2MSY A;  1B72 B;  4IHY A;  2I10 A;  2QCO A;  5F08 A;  1OFC X;  4BXX J;  2ME6 A;  4I76 A;  2NVX J;  3HOV J;  1JTX A;  4A93 J;  2DMP A;  2WAQ N;  9ANT A;  1JGG A;  4DYQ A;  1ETK A;  2B63 J;  1HLV A;  2L7Z A;  2M9H A;  1VND A;  5GPC A;  3ZQL A;  3TW7 A;  3BQZ A;  1GV2 A;  3D1N I;  2EZL A;  5K7F A;  2N8G A;  4DZP A;  3BR0 A;  3Q0W A;  1IGN A;  5BNG A;  2LKX A;  1I6H J;  4MLO A;  3BR2 A;  2K9Q A;  2WV1 A;  1RKT A;  2YUS A;  1BA5 A;  2XB5 A;  2CQX A;  2GM4 A;  1X2N A;  4GFB A;  5IYD J;  3JRE A;  3S1N J;  3Q3S A;  2W48 A;  4B4C A;  1T33 A;  4IHW A;  4B1R A;  1RES A;  2KDZ A;  4M3D A;  1IUF A;  4BY1 J;  3OIO A;  5E3O A;  4D7N A;  1PUF A;  2MG4 A;  4IEJ A;  5FKM A;  5F0F A;  1JUM A;  4C3I J;  2IAI A;  5E3M A;  1ETY A;  2XB0 X;  2LD5 A;  2JA7 J;  3CCY A;  4MO7 A;  4ABZ A;  1HF0 A;  1NK3 P;  2VKE A;  1FTZ A;  1ETV A;  2JN6 A;  3CQZ J;  3W6V A;  4JX4 A;  2YU9 J;  4NDL A;  2JMW A;  5J3L A;  2HOA A;  1X58 A;  3BT9 A;  4S0H B;  1MBH A;  1P7J A;  2XPU A;  2COB A;  1H88 C;  1BJZ A;  1FIA A;  2HI3 A;  2CU7 A;  5IYB J;  2P81 A;  2L9R A;  1HCR A;  2K9S A;  2HOS A;  2E19 A;  1JTY A;  4A3J J;  2Y9Y A;  1ZR4 A;  2R5Z A;  3IH3 A;  1U78 A;  2E2I J;  4X6A J;  1K83 J;  5K7Z A;  3A03 A;  2IEK A;  5IYC J;  1ITY A;  4BY7 J;  3A01 B;  2K9N A;  1YRN B;  2VI6 A;  2FD5 A;  2XGC A;  2DMN A;  5F04 A;  2DA3 A;  1HDD C;  3I4N J;  3MKL A;  1O4X A;  4A69 C;  1A5J A;  2EBI A;  1UHS A;  3S1Q J;  1AKH B;  4L5E A;  1JKR C;  4EEF G;  4XIC A;  1FIP A;  3BR5 A;  4BBS J;  3HM5 A;  1GDT A;  2JWT A;  2L0K A;  2L7M P;  1W0T A;  5EZG A;  1W0U A;  5FKL A;  3ZOB A;  3FKI J;  5FLM J;  5K7H A;  1CQT A;  2DJN A;  2LP0 A;  2NS8 A;  5FJ8 J;  5C3E J;  2R0Q C;  1X2M A;  3ZQC A;  4UUT A;  1WPK A;  4QTR A;  3HGG A;  3K2A A;  1VFC A;  2R92 J;  1FTT A;  3DCF A;  1Z77 A;  4QSH A;  2VPR A;  4A3L J;  2R93 J;  2AHQ A;  4A3K J;  3GBG A;  3HKZ N;  2NVQ J;  4LOC A;  3E7L A;  3O8G A;  1I3Q J;  2DA6 A;  2CJJ A;  2R5Y A;  1DU6 A;  1ENH A;  4A3C J;  2JA8 J;  2XGD A;  2Y2Z A;  2DMQ A;  2LY9 A;  5E3L A;  4V2F A;  1RKW A;  1H89 C;  3NAR A;  3PM1 A;  3BG3 A;  2X9D A;  3F0C A;  1ZTR A;  1ETQ A;  4BBR J;  3S1R J;  1JJ6 C;  3HOZ J;  2CUF A;  1XC5 A;  4B3A A;  4XID A;  1LFU P;  2NVT J;  2FX0 A;  3Q0V A;  1JKQ C;  3WHC A;  5IOZ A;  4RDU A;  3BG9 A;  5EYR A;  3TED A;  2EZK A;  3HOY J;  3H0G J;  2EZH A;  1OCP A;  1IG7 A;  3GTM J;  1B8I B;  3PO3 J;  1GVD A;  1IDY A;  2VKV A;  3RKQ A;  2EH3 A;  2LTP A;  2IBD A;  1BW5 A;  2PMZ N;  3FIS A;  5F27 A;  2JJ7 A;  5C4J J;  1ZR2 A;  1U8B A;  4X1E A;  3JRF A;  3PO2 J;  3FIW A;  5J1Y A;  1AU7 A;  1ETW A;  1JT6 A;  1XG1 A;  1LE8 B;  3BTL A;  3GTG J;  1U9N A;  1WI3 A;  4A3I J;  4BKX A;  5EGO B;  2E2H J;  1FJL A;  3MN2 A;  5FKK A;  2Y30 A;  2M0C A;  2O8K A;  2EZI A;  3HOW J;  2DA7 A;  4Y52 J;  2DA4 A;  2X6O A;  3LSP A;  3S16 J;  4MFD A;  2O7O A;  1UMQ A;  1FEX A;  3JRA A;  3FK6 A;  1EF4 A;  1T56 A;  2AO9 A;  1NTC A;  2JK3 A;  4UUS B;  5J1U A;  2YS9 A;  5GPA A;  1BW6 A;  1QPI A;  4W97 A;  3TP0 A;  1WCM J;  3HEF A;  1TWA J;  1IJW C;  1B72 A;  3VPR A;  1R9T J;  1IRZ A;  1F43 A;  1JUS A;  3GTO J;  3LSR A;  3LNQ A;  2XPV A;  2ZB9 A;  3OSF A;  2VUM J;  4A3D J;  3BR6 A;  4J19 A;  1E3O C;  1OCT C;  5F0H A;  3LOC A;  3HB9 A;  2L7F P;  4IHV A;  4A3M J;  3OOU A;  1MBK A;  4C2M J;  1B8I A;  1F36 A;  3ZQF A;  4MIM A;  2TCT A;  1IV6 A;  3H3V K;  1HDP A;  1NK2 P;  1HOM A;  1ORK A;  3C2B A;  5FKO A;  2HOT A;  4JP0 A;  4QIW N;  5J1R A;  3M4O J;  3ZQH A;  1JKO C;  3HDD A;  2M34 A;  3BR1 A;  4XRS G;  1MBF A;  1D5Y A;  4JYK A;  5M3M J;  2CUE A;  2FJ1 A;  2DN0 A;  1UG2 A;  4A3G J;  1ETO A;  2M2E A;  2NVY J;  2JA6 J;  2JA5 J;  2GLO A;  3JRI A;  4A3E J;  3BTJ A;  3JRG A;  3L1P A;  5DTD A;  4XRM A;  4HNV A;  1QVT A;  3S2D J;  1ZK8 A;  3SFI A;  4MFE A;  5IP6 A;  5EF6 A;  2H8R A;  2XRL A;  3LSJ A;  1TWF J;  5C44 J;  3IV5 A;  4C3J J;  4CYC B;  3HOU J;  3GTJ J;  1MSE C;  1Y1V J;  2ELK A;  4W1U A;  4A3F J;  1SAN A;  1K61 A;  4D7M A;  3CDL A;  4FE7 A;  2O9L A;  5GP9 A;  5IP9 J;  3RQI A;  2QF7 A;  5JLX A;  1U9O A;  3S15 J;  4M3E A;  1AHD P;  3GTP J;  2DTZ A;  1TWG J;  1H8A C;  2NOG A;  1IC8 A;  4C3H J;  5EEA A;  3SJM A;  3GTQ J;  5E3N A;  2LR8 A;  3FK7 A;  2Y9Z A;  5EZH A;  1GT0 C;  1JT0 A;  3LSG A;  3ZQI A;  3A01 A;  2LLK A;  2LFB A;  1YRN A;  3K7A J;  2WB1 N;  4V2G A;  4XK4 A;  3S2H J;  1MSF C;  2HXI A;  1AKH A;  3G1L A;  5IOY A;  1SFO J;  3BTC A;  2EQR A;  3BTI A;  3TP3 A;  5IP7 J;  1TC3 C;  4D5C A;  2ME0 A;  1JUP A;  1LFB A;  2ECC A;  4AYB N;  1P7I A;  3S14 J;  5M5W J;  2CRG A;  2E1O A;  2CQQ A;  1JKP C;  5EG0 B;  2X48 A;  4CYC A;  1TWC J;  1OJL A;  2XGE A;  3JRD A;  1I50 J;  2R5Z B;  5EDN A;  2DMU A;  5F1J A;  1DU0 A;  2MW8 A;  1IDZ A;  3Q0U A;  3QQA A;  2Y31 A;  4IHX A;  2DA2 A;  2DMT A;  1VF9 A;  5DS9 A;  4M3F A;  3JR9 A;  2E2J J;  1MNM C;  4RBO A;  4FCY A;  3QPS A;  3OSG A;  1VI0 A;  4I6Z A;  2ECB A;  3BG5 A;  2XSD C;  3I4M J;  1RPW A;  2D5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...