1NHAA

Solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription initiation factor IIF, alpha subunit
publication title Solution Structure of the Carboxyl-Terminal Domain of RAP74 and NMR Characterization of the FCP1-Binding Sites of RAP74 and Human TFIIB.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1nhaA00
5IT9Z 1YFHA 4L18B 4A6DA 3TO9A 4M6XA 1GVJA 4UVCA 3BJ6A 1QBJA 2L3DA 3HSRA 3B02A 2YPRA 5LBQA 3GXOA 3QRFF 2DQRA 2EFNA 2ZO4A 4KN4X 4LD5A 3R61A 3LQQA 2MLKA 4UV9A 4KDPA 1FZPB 2J5PA 2XIGA 3IWFA 2M1BA 2A5YB 4KNYA 4KUMA 3I71A 5CJ9A 2FMLA 1X3UA 2DI3A 3GFLA 1YS6A 3ZN0A 5L3BA 1YG2A 2CG4A 1MGTA 1MJAA 5K1YA 1LNWA 3RDIA 2V9VA 4ESFA 1FNNA 1XGNA 2EFPA 3RKWA 1U78A 4HV5A 2Z33A 4L9TA 1FP1D 2K4JA 4JBAA 5J8FA 2RKHA 2MD5A 5FFZA 2YU3A 2K02A 1GXPA 3FHZA 1OR7A 5ILSA 1S29A 2HQRA 4P5OA 4HLXA 4HBLA 1DDNA 1DPRA 3NQOA 5ICEA 4HX8A 4A0ZA 5ERIA 1BIAA 1HW5A 1C0WA 1G4DA 3HYIA 3WTUC 2O6GE 4Q48A 2FBIA 1ZG3A 4IJAA 4ZZLA 4L9NA 3Q9VA 2V6CA 2HQNA 1O3QA 1IN5A 4P96A 3CUQC 2FE3A 2AXLA 4NB5A 1S7AA 1ZRDA 4U0VA 5CVJA 3FXRA 3I54A 3E97A 5HDNA 4OIQF 3JSPA 4BHBA 4CHUA 3RPUA 4KT5C 1IUYA 1FP2A 4M74A 4IVNA 4HX4A 2XGXA 4ENKA 1WSUA 4I09A 4CO8A 4UXNA 1HW1A 2V79A 3T1BA 2KJCA 3F3XA 4AIHA 5J8CA 1Z6TA 4Z2YA 3L09A 2RN7A 2DTRA 5LHIA 1FOKA 3C7JA 1FBUA 4YIIA 1G3WA 4ESBA 1D8JA 2RC4A 3D0SA 2YR2A 1ZREA 2Y0MA 4RB0A 4KFCA 3ZMZA 2K4BA 2XASA 2QQBA 4BNCA 3J80Z 2TDXA 2OBPA 1IXCA 2FBHA 4EJTA 3DEUA 4O5VA 4GYIA 3TQNA 4CZZA 1ZRFA 2BEOA 1Y0UA 2P5VA 3E5QA 4M9ZA 1I6XA 4ENJA 5LGUA 4DQ2A 3LA7A 2L01A 5AIQA 4RGXA 1K78B 2WC2A 4A0XA 3DFGA 2NRAC 2A6EF 2L4AA 1UFMA 3IHUA 2P6SA 4YFXF 1T39A 4HDUA 2DO7A 3DQVC 1LVAA 4KMFA 4HA8A 3K1PA 2ZMEB 1TNTA 4LLGF 1LJ9A 3RKYA 3VFZA 5DCFA 4IHTA 1CGPA 2GIVA 4BHPA 4AIJA 3SFZA 2A07F 1XSXA 5HS9A 3KP2A 5FD6A 5BOXA 3LWFA 2E7WA 1D8KA 5DCMA 4B09A 1IN6A 2V1UA 1ZYRF 1J9IA 3V8LA 2NNYA 3ABUA 4LLNA 1BI3A 3RYRA 4A12A 1RI7A 2FSWA 4AVPA 2XROA 2NYXA 5E1WA 3T8TA 2QLZA 3NRVA 2H27A 4HYEA 4A2UA 2BV6A 2H6BA 3ZPLA 1WI9A 2HTSA 5HLGA 3DP7A 2JZYA 2D1VA 1Z9CA 2JPCA 5F64A 2Z99A 1PUEE 3WTYC 1RUNA 4N0BA 5BQTA 2MC3A 3G73A 5HVQC 3GW2A 1Z05A 3RPQA 4P9UA 2CO5A 3ML6A 4P9FA 4RGUA 2LDUA 5FD5A 2P5LC 3ABTA 1KA8A 2AS5F 3CO7C 4WWCA 3SZPA 2DFIA 4G7HF 5FB2A 4XRFA 3FM3A 3FXQA 3ULQB 5ED4A 2NAZA 3HRMA 3MWMA 3ZP5A 4E70A 1JHHA 5KVRA 1T38A 4ESJA 1B9NA 5DYMA 4HF1A 1Z6RA 2W85A 2DU9A 3PFIA 4I2OA 1JXSA 1MJ9A 1H0MA 4RGSA 5ICCA 1WWXA 2R7DA 4I0BA 1QQIA 1W5SA 5DV5A 2QUFA 2WTEA 2PEXA 2XRNA 2F5CA 1EH8A 3EUHA 2CW0F 3KP6A 2ZCWA 4A6EA 2IJLA 4OIPF 3G3ZA 2K7LA 3JSOA 4LFUA 1R36A 1TBXA 1ZGJA 5LGTA 1YIOA 5LEKA 2GAUA 3F8CA 3C1DA 5ILUA 5HS8A 4MEXF 2OZ6A 2VBYA 3WG9A 5AONA 2XV4S 1RZ4A 1ZHFA 3COAC 4IF4A 1FBSA 2LKPA 2DPUA 1B59A 3CUQA 1FYKA 2HGCA 4KN7X 4HLYA 2W25A 3I4PA 4I01A 2VE8A 4F7ZA 3T0YA 3CJNA 4HF0A 5E8GA 3CUQB 3CO6C 2M45A 3EYYA 1HXDA 1H9TA 3OV8A 4I98B 3K1MA 2ISZA 4BH9A 2H6CA 1I1GA 1FBQA 1SFXA 2P7CB 1LDKB 5F6FA 1FC3A 3V7RA 1S8NA 3ELKA 3T8RA 3E5XA 3QP5A 3TGNA 4EM1A 4ETSA 1EH6A 3QPTA 2O0YA 3W6KB 3FXUA 2BE5F 6PAXA 2VC0A 4MGRA 4LK1F 2DBBA 3JTHA 3DPTA 5D4RA 2L4MA 2GZWA 3KLOA 4IPAA 4S05A 3KETA 3F8BA 1ZAOA 3KCCA 4CDGA 1FYLA 5HLHA 3F6VA 5D5WB 1HSJA 5DD8A 3TO7A 3M8FA 3TOBA 1F5TA 2DQLA 4CXFA 3HTUA 4Q5SF 2NS0A 3E6MA 4LG0A 3O3KA 1WQ2A 1KGSA 1KQ8A 2IVMA 3I64A 1O3SA 4HX7A 4LG0B 3GZ5A 3AAFA 2FMYA 4LB6B 2Z5UA 2ACJA 2HKOA 3ZMDA 3BOQA 2DPDA 4M72A 2MH9A 1IRFA 2F5EA 2IP2A 3F21A 5EEGA 2PI0A 2OQGA 5E17F 3D5LA 4UUVA 1YQAA 4GGGA 1OYIA 5E1XA 3U9GA 1BN5A 4XLNF 2VE9A 4YG2F 1I5ZA 3ZMVA 3HRTA 4OINF 3LA2A 3PQKA 2FNAA 2VBWA 2WWYA 2O3FA 1QZZA 1V4RA 5E1ZB 3ECHA 1JGSA 3EDPA 4OIOF 5CYVA 1J5YA 1KU9A 3WTZA 4D0PA 4L5JA 2UXXA 2DLLA 4A5MA 2BYVE 2C6YA 1R5GA 3HHGA 3JW4A 5FLXK 2R7FA 1KU7A 4UVBA 3B73A 4WXDA 1IW7F 4RB1A 3ZMTA 1ZN2A 2ZFWA 2RVCA 5D6FA 4G7ZF 1SMYF 1TQMA 2Y48A 2COMA 2VN2A 1WKMA 3ROUA 4WXHA 5D5UB 5FGMA 3RI4A 2XAHA 2YSRA 2EFQA 4AIKA 5A2QK 2RNJA 3CDHA 3L9FA 2IW5A 2GA1A 2IA1A 5CVVA 2QYOA 3LFKA 2KJBA 2YX4A 1JE8A 1XSVA 2P6TA 1MZBA 2HDCA 3SQNA 4XSXF 2UZKA 1XMKA 4KMUX 2ZJ2A 4O6JA 1HSTA 4MHGA 4LLLA 3F8MA 3W6JB 4XLPF 3QAHA 1IZ1A 1RIOH 3WTWC 4CYDA 2FF4A 4MEYF 4AWXB 3S2WA 2WV0A 1W4MA 3MEXA 2DT5A 1O7LA 3FMQA 4GXOA 1R1TA 4M6YA 1T6SA 1P6RA 1TW3A 3WGGA 2EFWA 3KZYA 4OMYA 2VC1A 1V3FA 3C18A 3IWZA 4ZZDA 2FQ3A 2E7XA 2EA2A 2LF7A 2FOKA 5E18F 3WTTC 2R3SA 3M1EA 2G7HA 2EK5A 3JTGA 1S3JA 2HKXA 2VXZA 4KA4A 4DNCA 2Y75A 2PFBA 2EA4A 3ECOA 2OA4A 4JQFA 1B6AA 2IA0A 1ZG5A 4ZYDA 1DP7P 1JHFA 1XDUA 3WGHA 5LRRA 1K78A 3RYPA 4ON0A 4K2EA 3R0JA 2W57A 4OU0A 1OYYA 4GYGA 4HW0A 3WTVC 1W7PA 2IA2A 3EQLF 3WTXC 5D4SA 2VOPA 1FWZA 2A3SA 3WTSC 1XB4A 4KIGA 3BROA 1F9NA 1W7PB 5BPDA 2ZMEA 4G9YA 5J6XA 1S7OA 3IL2A 2YX7A 1QPMA 1MDMA 2LF8A 3GLXA 4ZH4F 5TRDA 1YO5C 5JFRA 3Q9SA 1R5HA 4U7DA 4UVAA 1MDMB 3BPVA 1USTA 3K2ZA 4KIFA 3ZQ7A 3ZN1A 3E6CC 2MA3A 1FSEA 1NHAA 2EJRA 2IPQX 3MCZA 1ZLJA 4IRHA 4BQAA 2PLYA 3GFIA 3FX3A 5ICFA 1ZLKA 1XCVA 2MH2A 4Y17A 1A04A 2UWMA 4FX0A 4IRGA 2UXNA 4BXUA 2D45A 4UHTA 2H94A 2V1DA 2HZTA 3WE2A 3V8KA 2QQAA 2M5WA 5D5VB 2XAJA 1R1UA 3MAJA 3I53A 2F5FA 5HOOA 4UNOA 1YS7A 3KFWX 5CVRA 1FLIA 2ZNZA 1TLHB 3KZZA 5CLSA 3K9TA 2J5OA 4MQVA 1SD5A 1GHCA 2W24A 2EB7A 3WGIA 1J7KA 3U1DA 5A2QZ 1KYZA 1U6GA 2EWNA 1O57A 2FA5A 2XAQA 3F8NA 4I02A 1SFUA 2RV8A 4EJWA 4WX9A 4HAMA 3P9IA 1KQ0A 3GEZA 1R58A 4LGWA 5IT9K 4G94A 1MKMA 2OZUA 5K5RA 1E17A 2HTJA 2HEOA 2QM3A 1HKSA 4YFKF 3GO5A 4HQMA 4U7BA 1R22A 2G7UA 2HOEA 1XGMA 2CWEA 2O8XA 3CLOA 1PP8F 4L0YB 3J7AO 3C3WA 3H3UA 3LQRA 4LJZF 5FO5A 3F23A 3BJAA 4I7HA 2BGCA 2A61A 5LHHA 5DEQA 3ZMSA 2GQQA 4U0WA 3WU0A 1ONVA 3P7NA 2B0LA 5JR3A 2PQ8A 3BDDA 1T0FA 2RGVA 5DUIA 1IN4A 3H92A 1R1VA 3BWGA 1P4XA 3R6SA 2PMUA 1QZYA 1P2FA 3TO6A 4EQQA 2RDPA 4R8HA 1YTYA 1UCRA 2JTVA 2KIMA 2EV0A 1YW7A 3EETA 4O3MA 1I27A 1W5TA 2PJPA 2HYGD 5F1RA 3KEQA 4EVIA 5E8IA 4KIBA 5L3GA 3BPXA 2FNPA 1HBXG 1P4AA 3F72A 1FPQA 1J0RA 4HDVA 1Z1DA 2ELHA 1P4WA 5HS7A 1SD7A 3RTRA 5ICGA 1CF7A 4ASNA 3VEPA 5L3CA 1D5VA 1QO0D 2VT2A 2QWWA 1OMIA 1U8RA 4EV0A 2O61A 1CF7B 2QENA 1ZG1A 1BI0A 4UV8A 4BHCA 1RNLA 1IXRC 3BZ6A 4ENMA 2K86A 3LAJA 1FSHA 4MTEA 3TDUC 5D6EA 1GXQA 4PDKA 4G6DA 5IT3A 5LGNA 4N9IA 4I0AA 2O03A 3GF2A 5LHGA 4PCQA 2ZBKA 1BJAA 3P9CA 2ADUA 1STZA 1AWCA 2VONA 3M8EA 1SAXA 4L9JA 3RJPA 1BC8C 2XKPA 2BBYA 1E2XA 1FT9A 4WCGA 3HHHA 3J80K 2KIUA 1TQPA 1G3SA 3QU6A 2M8EA 2PMHA 1DUXC 3TKYA 2ETHA 5AIPA 1TW2A 2FXAA 2F2EA 4EMSA 3Q5FA 2HS5A 4N9HA 4L5IA 4FHTA 3J81K 4OOIA 2STWA 1B1BA 3KEOA 3F8FA 2D2WA 1Z7UA 1EV7A 4HV6A 3BP8A 1KU3A 2FEZA 3IRQA 2VOOA 1TNSA 2M30A 4A0YA 1F1ZA 3KP4A 2XKOA 4LK0F 3K0LA 3TDZC 4GCVA 4FX4A 3R60A 1YW8A 1HKQA 2EV5A 1XD7A 3HRSA 1REPC 1HW2A 1FX7A 3MZYA 2ESHA 1FY7A 1RUOA 2Q0OA 3F6OA 1SD4A 3CTAA 1O3RA 4HQEA 3GWZA 1AOYA 4Y13A 2RQPA 3MQ0A 3DKWA 4BYYA 5L3EA 1O3TA 4PGHA 1XDSA 4HF2A 1YYVA 1TTYA 1BM9A 4M73A 2A68F 1BIBA 3IKVA 4MNUA 3PQJA 4TV7A 5HDKA 3I5UA 4ZYEA 4FT8A 1QNTA 3HOTA 5BPIA 4XBFA 1KQ9A 5HLIA 3GZ6A 2GA2A 3I58A 4RS8A 5E20A 4NHJA 1XSDA 3QU3A 4CGZA 1ZH5A 2XVCA 2ISYA 1QGPA 3QOPA 1BI1A 2Z3YA 2IT0A 1OYWA 3OOPA 2VODA 3M7GA 4R1HA 2QQ9A 3EYIA 2DK5A 1BI2A 5BS6A 1ON2A 1U5TC 2GWRA 1K7AA 3U2RA 4ZYGA 3IRRA 2Q8KA 3M9AA 1Z91A 2PN6A 4EM0B 5DUKA 5HDGA 2XAFA 1IF1A 1PP7U 2L02A 3FMRA 5H6QA 2JPBA 3WODF 3NEUA 4JK1X 2LNBA 2H09A 3E6BA 3ZMUA 1H9GA 1L3LA 3KLNA 4G6QA 3HRUA 3WE3A 5LEJA 1XCBA 5KK1A 4LMYA 2QVOA 5ILVA 1VTNC 3R4KA 2A69F 3GFJA 1BBYA 1OKRA 3GFMA 2JSCA 1MJBA 3SXYA 1IN7A 1S6LA 3FF5A 2DW4A 4Y15A 2JRTA 1L0OC 1IN8A 3HTSB 4RAZA 3N4MA 1ZGAA 3DV8A 3TOAA 4M9SA 2X0LA 1IAWA 2EV6A 2M87A 1XGOA 3FM5A 1LEAA 2XAGA 2P7VB 3HSEA 3J81Z 1KU2A 3DXJF 1WRJA 3REOA 4G8XA 5D8LB 1KYWA 2QBYA 1B9MA 2MBFA 1UHMA 4G7OF 2OD5A 3FZVA 5D5XB 5TJJA 4BAYA 4PZJA 2QBYB 1D3YA 1LDDA 1I1SA 1USSA 1ODDA 4EJUA 1BC7C 3LAPA 4CICA 3HUGA 4EM2A 2LSOA 1IXSB 5LRSA 2E1NA 5FLXZ 3N97A 3O2PE 4M9XA 2EFOA 3IC7A 1BOAA 4HZFA 4WK8F 4NQWA 4OMZA 3JAMK 3ERED 1IRGA 2P8TA 1UHWA 3GX4X 2VBZA 3E5UA 3GVAA 2JT1A 4B8XA 5DCMB 3I59A 5H6RA 5DD4A 4MTDA 3BY6A 2ESNA 1LEBA 3LSTA 1R7JA 5EEHA 5JVTA 1J2XA 1J75A 5BMZA 3I59B 1F4KA 3QPHA 1SFEA 4RAYA 2QZ8A 4RB2C 1MD0A 3V7CA 2IRFG 3VB2A 2CYYA 3I0TA 2G9WA 4WF2A 4IHSA 2P5KA 1HQCA 1B4AA 2ZXJA 2HR3A 3F22A 1G3YA 5L3DA 3SZTA 5K5QA 1R00A 4IRIA 4P55A 2A6HF 4KYWA 2K27A 4L0ZB 2HYFA 4L9VA 3V7SA 3V8JA 4KICA 4AD9A 2NNNA 2L54A 3SHFA 2ZNYA 3HSFA 3WU1B 1ON1A 2D1HA 4QLCU 4R79A 3L2CA 2DAOA 4H0EA 5FFXA 4QWQA 3IKTA 2PBIA 3FWEA 4S04A 3H3ZA 2W84A 2OAZA 2PG4A 2GXBA 1YW9A 1FYMA 1U3EM 3K69A 3GUDA 2KIFA 2DK8A 2FBKA 2E1CA 4EGYA 1LDJA 3RKXA 1G6NA 1ZARA 2CQKA 5DDGA 2HFHA 5JHUA 5L3FA 1P92A 4ZYHA 4IXAA 4GO1A 3E6DA 1K6OA 4YIFA 2HWVA 5JI6A 4XSZF 2OQRA 1K79A 4M71A 1LB2A 4U0YA 4OIRF 1ULYA 5D8KB 1PDNC 3KP5A 2XUBA 4HOBA 3HOSA 1U5TA 1XGSA 2KKOA 2MLGA 1T2KA 2FRHA 1O7FA 3O6BB 3KE2A 4A5NA 3DF8A 1U2WA 2Q2EA 4PGGA 1TQIA 1U5TB 2XHKA 5CVIA 3RIRA 2VBXA 2ZKZA 2CFXA 1HKTA 3MFKA 3LA3A 2KRFA 3T5XA 3MZHA 3FMSA 4U88A 4YFNF 4ENNA 5CVUA 2FU4A 2OU2A 5H20A 1XN7A 4MQ9F 4EJVA 2VT3A 4EGZA 2Z9OA 3DPLC 1T98A 1W7PD 1ZRCA 4EJOA 3KP3A 3HIFA 1SD6A 3P9KA 1R23A 1YLFA 2CSOA 2STTA 3R0AA 4Q47A 2V1XA 4RB3C 1EH7A 3QP6A 1UB9A 4RGRA 4LB5A 3JAMZ 3GYHX 5K5OA 2CGPA 1J59A 1LQ1A 1SMTA 3ISPA 1DPUA 1OPCA 3BJOA 3L00A 5LLQA 3V4GA 3E3VA 2X4HA 1Q1HA 3K1NA 2P4WA 1XMAA 3L7WA 2GXGA 1G3TA 3VODA 3KP7A 4Q4ZF 3VOEA 3CUOA 4WXCA 2F5DA
chains in the Genus database with same CATH superfamily
3B6AA 5GP9A 2M7BA 3MN2A 5IT9Z 1YFHA 4L18B 2DYSH 2X85A 4A6DA 3TO9A 3ZQCA 4BXFA 4M6XA 4QSHA 1GVJA 3DTKA 3OIPA 4BEHA 2JN6A 2JWTA 4UVCA 3BJ6A 1QBJA 3S15J 4NC6A 2JVHA 2L3DA 3HSRA 3ZQFA 3B02A 1VFCA 2YPRA 5LBQA 1S72I 4Y33A 2TCTA 2DOFA 2I8DA 3GXOA 4C2TA 1RKWA 3CF2A 3AFHA 4HEA2 3QRFF 2DQRA 2EFNA 4NC8A 4Y4RA 2ZO4A 2Q1ZB 4KN4X 4V2FA 1OISA 4LD5A 2N8GA 3R61A 3LQQA 1R4MB 3TW7A 5B1AH 1IRZA 1A35A 1LPQA 3HJEA 3I4MJ 2MLKA 4UV9A 2KRCA 4KDPA 2HPIA 1FZPB 2DXIA 2J5PA 2XIGA 3IWFA 3RSNA 2M1BA 5JLWA 2A5YB 2LKSA 3TW6A 4KNYA 3HGYA 2L7KA 4KUMA 3I71A 3JRCA 5GPAA 2FD5A 3K6GA 5CJ9A 2FMLA 1X3UA 2DI3A 1I6HJ 3GFLA 2YU9J 3X2QH 1YS6A 3FXJA 3ZN0A 4F3QA 5L3BA 2JA6J 1BOBA 1YG2A 3IV5A 4Y7NJ 3OYDA 1GT0C 2CG4A 3BQYA 1MGTA 1MJAA 5K1YA 2WADA 1LNWA 5FKNA 2JRMA 3RDIA 3W2VA 2NVQJ 2V9VA 4ESFA 1FNNA 3ASOH 1OCCH 1Z3YA 1XGNA 2F48A 1X4OA 2EFPA 3PNVA 3RKWA 3S1RJ 3DU5A 1ETQA 2F4OB 1U8BA 1WJ5A 2BXYA 5EG0A 1U78A 4X0GA 4XNFA 4HV5A 2Z33A 3TP3A 4L9TA 2VXDA 1FP1D 2K4JA 1DGRM 4JBAA 5J8FA 2EIKH 5IYCJ 1FMWA 2LREA 2RKHA 2MD5A 5F0FA 2PMZA 5EG0B 1QHHD 5FFZA 3SEQA 2YU3A 2JA5J 4DGWB 2K02A 1GXPA 1UHSA 3FIWA 1ETOA 1IV6A 3FHZA 2WAEA 1OR7A 5ILSA 4B44A 1AHDP 4XRSG 1X4PA 5EGOB 1S29A 2HQRA 1V5EA 2KLOA 3BTLA 4CYCB 3EUHC 2M0CA 4P5OA 1MH4A 3SFIA 4HLXA 5M3FJ 1R49A 4F55A 4HBLA 3KIOA 3KX2A 5KCMA 1DDNA 1DPRA 2M8GX 3NQOA 5ICEA 4HX8A 4A0ZA 3BR2A 3H3VK 5ERIA 1BIAA 1HW5A 2VUMJ 1W0TA 2XSDC 1C0WA 1G4DA 3HYIA 3WTUC 2O6GE 1GVDA 3JRGA 4AC0A 4Q48A 2FBIA 1ZG3A 3MZ8A 1MMNA 4IJAA 3RQIA 4ZZLA 3H35A 1TWFJ 4L9NA 4A3GJ 1IUFA 3Q9VA 2V6CA 2QCOA 2HQNA 1O3QA 1IN5A 4P96A 4XLCA 3CUQC 1U0JA 1YITI 2FE3A 2AXLA 4NB5A 1S7AA 4PJ0C 1ZRDA 4U0VA 3A01B 5CVJA 3FXRA 1SVOA 1V5GA 3I54A 2LC2A 3N05A 3E97A 5HDNA 3BG7A 4OIQF 3JSPA 4BHBA 2LK2A 3OL4A 4CHUA 3LNQA 3RPUA 1D0ZA 4YELA 4KT5C 3BTIA 2CJJA 5IOYA 1IUYA 3LMMA 1FP2A 1ZELA 4M74A 4IVNA 4HX4A 2XGXA 4ENKA 1WSUA 3L2VA 4I09A 4CO8A 4FQGA 4UXNA 1HW1A 3DBHB 3DLLF 4PFOA 2DYRH 2EQRA 2V79A 4KISA 4EEFG 3T1BA 1X1PA 1Y39A 2KJCA 3F3XA 4AIHA 5J8CA 1QHGA 1Z6TA 4Z2YA 3L09A 4E7HA 2K9MA 2CS3A 2RN7A 2DTRA 3AL0C 5LHIA 1FOKA 3C7JA 2CUZA 1FBUA 3SYTA 4BQOA 1WH7A 1NG7A 3ABKH 3BC8A 4YIIA 2ZSHB 1G3WA 2KRHA 2M4KA 4ESBA 2UUZA 1D8JA 1ORKA 2RC4A 3D0SA 2LP0A 2YR2A 3BCAA 4BU2A 4E7IA 1ZREA 2Y0MA 1Y0NA 4RB0A 4ZC3A 2E1OA 4EATA 4HSRA 4KFCA 3ZMZA 2E35A 3LSGA 2K4BA 1HA8A 2XASA 2QQBA 4B47A 4BNCA 3J80Z 2TDXA 2OBPA 1GV2A 2EZLA 3HPGA 1IXCA 2FBHA 2LBFA 3EUAA 4EJTA 3DEUA 4O5VA 4GYIA 3TQNA 4CZZA 1ZRFA 2EH3A 2BEOA 2CUJA 1Y0UA 2P5VA 3E5QA 4M9ZA 1X19A 1UELB 1I6XA 4RAGA 2LMDA 4ENJA 5LGUA 4DQ2A 4F91B 2DA6A 1PUFB 3E7LA 3DEEA 3FBIB 3LA7A 2L01A 5AIQA 4MFDA 1KZHA 4RGXA 1K78B 2WC2A 4A0XA 5CQEA 4E6KG 3DFGA 5EYRA 1WHUA 2NRAC 2Y9ZA 2A6EF 2L4AA 4IX7A 5HNFA 2E1MC 4BDZA 1UFMA 3IHUA 2P6SA 4YFXF 1T39A 2CQQA 3PUBA 4HDUA 3IP4B 5F1JA 1D1AA 2DO7A 3DQVC 1LVAA 4KMFA 2ME6A 4HA8A 2HPMA 3K1PA 3OYMA 2ZMEB 1TNTA 4LIUA 1LJ9A 4LLGF 3RKYA 3VFZA 1K4SA 3DKYA 1T33A 5DCFA 3I56I 4IHTA 4NDLA 2LOOA 2E2IJ 1CGPA 2GIVA 4BHPA 1VZ0A 3VWBA 4AIJA 1JKPC 3SFZA 3PO3J 1D1CA 2MD0A 2A07F 3S2HJ 1XSXA 1I3AA 4KT6A 1MH3A 5HS9A 3KP2A 5FD6A 4BDYA 5BOXA 1R5ID 1VQ4I 3LWFA 3Q0WA 4S0HB 1Z0XA 2E7WA 1VNDA 4M3FA 1D8KA 5DCMA 4B3AA 4B09A 1IN6A 2V1UA 1ZYRF 1QZEA 3HZJA 3AG1H 1J9IA 4M3DA 3V8LA 2NNYA 3BTCA 3ABUA 4LLNA 4JX5A 1BI3A 3RYRA 4A12A 1RI7A 2FSWA 4AVPA 3Q0VA 2M3AA 2NYXA 3FXOA 5E1WA 3T8TA 2QLZA 2XROA 2BVLA 3NRVA 2K3PA 1WJEA 3MD2A 2H27A 3CC4I 4HYEA 4A2UA 2BV6A 1XPXA 3ERMA 4AIDA 2H6BA 3KZIC 3ZPLA 1WI9A 2L9VA 1OCOH 2M34A 2Y30A 5E3NA 2HTSA 5HLGA 3DP7A 5E3MA 3BT9A 2X48A 2O9LA 1RC9A 2QKMB 2JZYA 1WJCA 2D1VA 1Z9CA 5GAEJ 2Z1DA 1MW7A 5FLVA 1X1AA 5M5WJ 2JPCA 5F64A 2Z99A 3GTMJ 3SDBA 5FLMJ 2W00A 1PUEE 2M0MA 4BKXA 3WTYC 2MC4A 3ZGKA 3W2AA 4BXXJ 1ETWA 5J4VA 1RUNA 2Z2SB 4N0BA 5BQTA 1APLC 2X1EA 2MC3A 3G73A 5HVQC 3GW2A 1Z05A 3RPQA 4BL0B 5F04A 2QQ8A 4D1QA 4P9UA 2CO5A 3ML6A 4P9FA 1WJDA 1N25A 1X1BA 2CQ7A 1OR7C 3JREA 4RGUA 2LDUA 3H9GA 5FD5A 4F92B 1S7EA 3SEZA 2P5LC 1R71A 3ABTA 1KA8A 3HGGA 4UY8I 2AS5F 3CO7C 2CRGA 4WWCA 3G71I 3SZPA 2K9SA 2DFIA 4G7HF 2V4JC 4XRFA 5FB2A 3IUOA 2LRDA 3FM3A 1PJRA 3FXQA 3ULQB 5ED4A 2NAZA 3HRMA 3MWMA 3ZP5A 2JK3A 4E70A 1JHHA 2DTZA 3CESA 2AHQA 4E7SA 3D1NI 5KVRA 3P5JA 1T38A 3BR5A 1LFUP 4XIDA 1YRNA 2OCCH 1X2MA 3QWLA 4ESJA 1B9NA 5DYMA 4HF1A 3CCRI 1Z6RA 2W85A 3TBIA 3GLLA 2DU9A 3PFIA 4B3XA 4FCYA 4I2OA 1JXSA 2OCEA 1MJ9A 3OS1A 1H0MA 4RGSA 3M1CA 4QPQA 5ICCA 1WWXA 2R7DA 3LSJA 4I0BA 1YJNI 1MMGA 1QQIA 1W5SA 3K4JA 5DV5A 2QUFA 1QVTA 4JX4A 2ZSIB 2KFDA 2WTEA 2PEXA 2XRNA 2F5CA 1EH8A 1TWCJ 2W82A 3EUHA 2Y0SA 3K4CA 4DOZA 1RETA 2CW0F 1EJ9A 3KP6A 2ZCWA 4A6EA 2MGQA 1X58A 2IJLA 3DTIA 4OIPF 1BW6A 3G3ZA 2K7LA 3M3YJ 3TMOA 2F4IA 3JSOA 2WAQA 3H9QA 1WJFA 3LL7A 1R36A 4LFUA 5KHDA 1TBXA 1K83J 1ZGJA 1B72B 4MLOA 5LGTA 1YIOA 5LEKA 1IC8A 2DMNA 5M5YJ 4HG2A 2GAUA 3F8CA 3C1DA 5ILUA 5HS8A 4MEXF 2OZ6A 2VBYA 3WG9A 5AONA 2XV4S 2XSJC 1RZ4A 3ZOBA 2ID3A 1ZHFA 2CQNA 3COAC 4IF4A 1FBSA 2VLAA 2LKPA 2ECCA 3KYDB 2DPUA 1B59A 3CUQA 1FYKA 4BJ6C 3HDDA 2HGCA 4NC7A 4KN7X 4HLYA 2W25A 3I4PA 3OYIA 4I01A 2VE8A 3GTGJ 1NK3P 2BZTA 4F7ZA 3T0YA 3VSKA 4LITA 3CJNA 4HF0A 5E8GA 4CA0A 1WJAA 3IH4A 3CUQB 2VQHA 5IP9J 3CO6C 2M45A 3EYYA 1HXDA 2X51A 1H9TA 4QTRA 2VQCA 3OV8A 2HZDA 4A3MJ 1JUMA 4I98B 1R9TJ 3K1MA 2ISZA 3U1KA 1I50J 3AG2H 4BH9A 4BBRJ 2H6CA 4UB6C 4N4OB 1I1GA 2Z16A 3ZXSA 1FBQA 1ZK8A 1SFXA 2P7CB 1MBHA 1LDKB 1ETVA 1FC3A 5F6FA 3V7RA 2IS2A 1S8NA 3ELKA 3T8RA 4CZCA 2ZMEC 3CCSI 5IYDJ 2ZJPF 5C3EJ 3E5XA 3QP5A 3TGNA 2E34A 4EM1A 4A3LJ 2R5ZA 4CCNA 4ETSA 1EH6A 2HYJA 3OMYA 1OCPA 2O0YA 3QPTA 1E3OC 3AL0B 3W6KB 3FXUA 3C2GA 2BE5F 5J1YA 1VQ9I 1WPKA 1DP3A 4MIMA 4F52A 6PAXA 2VC0A 4MGRA 4LK1F 3JRBA 2R5ZB 2DBBA 1F43A 3JTHA 3DPTA 1M1EB 3L2WA 5D4RA 3OYFA 2VJ5A 1VQ7I 2L4MA 2GZWA 3KLOA 3BG5A 2X1CA 4IPAA 4S05A 3KETA 3F8BA 4X1EA 5GAGJ 1ZAOA 3K70D 3KCCA 2H1KA 2VKEA 4CDGA 4UUSB 4UUTA 1FYLA 1BJZA 2XAUA 3HBLA 4DBQA 5HLHA 5F27A 3F6VA 5EF6A 5D5WB 1HSJA 3H9JA 5B66C 5DD8A 5JHFA 3TO7A 2ZXIA 3M8FA 3TOBA 4DW6A 1F5TA 2DQLA 4CXFA 3HTUA 3V42A 3SJMA 4Q5SF 2NS0A 1U9NA 4RM2A 3E6MA 2R7XA 4LG0A 2EBIA 3H5AA 3O3KA 3VYRB 1JKOC 1WQ2A 2ICWG 2L0KA 4AYBA 2GIZA 1WI3A 3OYJA 3J7AY 1KGSA 1QVUA 1BL0A 2IS6A 1KQ8A 2CW7A 2IVMA 3PIPF 3I64A 1O3SA 3PL8A 4HX7A 4LG0B 2VJJA 3GZ5A 1WVRA 2LH9A 3AAFA 1TC3C 1X1DA 5K7FA 4J01A 2FMYA 2DJNA 4LB6B 2WY8Q 2Z5UA 2NVXJ 3BQZA 2ACJA 2E1MB 1D0YA 2HKOA 2KISA 2L5QA 3BOQA 1Y8QB 3GMEA 3ZMDA 4M72A 2DPDA 1ACIA 2MH9A 1IRFA 3GCMA 5IP7J 2F5EA 2IP2A 1TP4A 3F21A 5EEGA 2PI0A 2OQGA 5E17F 3D5LA 4UUVA 1YQAA 1X1CA 3CQZJ 3LSPA 4GGGA 5LD2C 1OYIA 5E1XA 4E4HA 1A36A 3U9GA 1BN5A 4XLNF 3FXKA 2VE9A 5M5XJ 4YG2F 3DEWA 4QPOA 1I5ZA 2QA4I 3ZMVA 1MNMC 3HRTA 4OINF 2RQQA 1U9OA 3LA2A 3PQKA 2FNAA 2VBWA 2WWYA 4D7MA 2OC6A 2O3FA 1QZZA 4A3DJ 2XPVA 3H36A 2DT6A 5EDNA 5IYBJ 3O8GA 1V4RA 1G59A 5E1ZB 4B48A 3ECHA 1JGSA 5EZHA 1O4XA 1H89C 4NUBA 2IS1A 5C44J 3EDPA 3CCJI 1SFOJ 4OIOF 3HC7A 4GDFA 5K7HA 3HOVJ 1PVEA 5J47A 4XICA 5CYVA 3C2BA 1J5YA 3L2UA 1R4NB 1KU9A 3CD6I 3WTZA 1PYVA 4II3A 4D0PA 2LY9A 2ZJRF 1SVMA 4L5JA 4BY1J 2V9PA 2JMWA 2UXXA 2DLLA 4A5MA 3GZNB 2BYVE 2C6YA 5FKOA 1R5GA 4DBRA 3HHGA 4UB8C 2KP6A 3CC7I 3JW4A 5FLXK 2R7FA 4XOPA 1KU7A 2EILH 4UVBA 3B73A 4WXDA 1IW7F 5EEAA 2GOMA 1YIJI 4RB1A 5JLXA 3ZMTA 3RZDJ 1DQUA 1ZN2A 2UV1A 2ZFWA 2COBA 5EGOA 1OCTC 2KDOA 2NVYJ 4C9YA 4CYCA 2RVCA 5D6FA 2HVSA 1SMYF 1TQMA 2HOAA 2Y48A 2COMA 4G7ZF 2VN2A 2ME0A 1WKMA 3CCQI 2R7TA 3ROUA 4WXHA 2DDAA 1Q1VA 5D5UB 3CLQA 5FGMA 3RI4A 3A02A 3HL2A 1WFXA 3A0HC 2XAHA 2YSRA 2EFQA 4RDUA 1FIAA 3VYTB 4AIKA 3CMEI 3H5NA 5A2QK 2RNJA 3CDHA 3L9FA 4ZTFA 2H8WA 2IW5A 3HM5A 3MKLA 2GA1A 2IA1A 1T0FC 5CVVA 2QYOA 3LFKA 2KJBA 2YX4A 1MNEA 2RNGA 1JE8A 1XSVA 3A2KA 2P6TA 3HOYJ 1TWAJ 1POGA 1RKTA 1MMAA 1MZBA 2VKDA 2HDCA 3SQNA 2HI3A 3OYKA 5DM6F 4HRIA 4XSXF 2UZKA 1XMKA 1RESA 3CP8A 4KMUX 3IH3A 2ZJ2A 1E3HA 4O6JA 2VPLA 3A01A 4BJ5C 1B8IA 1HSTA 4MHGA 4LLLA 5HNHA 5F0HA 3F8MA 4L5EA 4HNUA 3W6JB 4XLPF 2BY2A 3QAHA 1IZ1A 1RIOH 3WTWC 4CCOA 1QA6A 4CUGA 3G4SI 4Y3OA 1XS9A 4CYDA 5C4XJ 2DFHA 2FF4A 4MEYF 4AWXB 3S2WA 3PJRA 1TZLA 3S32A 2WV0A 1B8IB 1W4MA 2XF5A 2R0QC 3MEXA 3CMMA 2DT5A 1O7LA 3CF5F 2BY0A 2W7NA 3FMQA 4GXOA 1R1TA 4M6YA 1T6SA 1P6RA 1K61A 2MG4A 4E7KA 3LFUA 1TW3A 3AG3H 3E1SA 3WGGA 2EFWA 3FXLA 3KZYA 3I9V2 3WHCA 1ETYA 4OMYA 2VC1A 1V3FA 3C18A 3IWZA 4C30A 4ZZDA 2BHZA 2XGCA 1JT0A 4AUXA 2FQ3A 2E7XA 1IJWC 2EA2A 4PJNA 4MFEA 4GFBA 2LF7A 2FOKA 1V55H 1HDDC 2NOJB 5E18F 3WTTC 2DOAA 2R3SA 3OYLA 3M1EA 2G7HA 2EK5A 3DTEA 3L1PA 3JTGA 1VQ6I 1S3JA 2HKXA 2VXZA 3GTJJ 5FROA 2HQ5A 2VKHA 4DNCA 3CCVI 4KA4A 2Y75A 4ZTJA 1T08B 2EA4A 2M7AA 2PFBA 3ECOA 3CCLI 1G2HA 2OA4A 1S9HA 1XMXA 5FKKA 3I3LA 4JQFA 1B6AA 2IA0A 1ZG5A 4ZYDA 1DP7P 2IGMA 1JHFA 4W1UA 2A05A 1XDUA 2WB1N 2Y31A 2E5ZA 3WGHA 1FOWA 1PUFA 1IRXA 3LSMA 5LRRA 4CCMA 3UKGA 3HEFA 1K78A 3RYPA 4ON0A 3S3MA 4K2EA 2QKLB 3SDGA 3VYSB 3R0JA 2W57A 4OU0A 1YI2I 2JA2A 1OYYA 4GYGA 2AXTC 4HW0A 1W7PA 3WTVC 2IA2A 2QSHX 3EQLF 4XN0A 3WTXC 5D4SA 3K4NA 1ZR2A 4A69C 2VOPA 4XL9A 1FWZA 2A3SA 2QF7A 3WTSC 1HOMA 1XB4A 4KIGA 1VQMI 2HVRA 2H8RA 5IPAA 1LKXA 4BS9A 3BROA 1F9NA 3K7AJ 2M2EA 1W7PB 2F5VA 2ZMEA 4YIRX 5BPDA 1FOXA 4G9YA 5J6XA 1S7OA 3D5RC 3IL2A 3BCBA 5KAIC 3JCUC 3GTLJ 2VJIA 4A3BJ 2YX7A 2VKVA 1QPMA 3S1MJ 1MDMA 1HCRA 4IZZA 2EIMH 3G1OA 3HOWJ 2LF8A 1WGXA 3GLXA 3PM1A 4ZH4F 1VQPI 3ABLH 4LOCA 5TRDA 2R7OA 1YO5C 5JFRA 2CFOA 1NK2P 3Q9SA 1R5HA 4U7DA 2VQGA 4UVAA 4DIQA 1MDMB 3BPVA 1USTA 4BE1A 3K2ZA 2MSYA 4KIFA 3ZQ7A 3NWTA 1UJ8A 3VDXA 4CSWA 3ZN1A 3E6CC 2MA3A 1FSEA 1NHAA 2EJRA 2IPQX 3MCZA 1W1WE 1ZLJA 4IRHA 4BQAA 2PLYA 5E79C 2K40A 3GFIA 4IHVA 3FX3A 4XKBA 5ICFA 1ZLKA 3I4NJ 1XCVA 2MH2A 4Y17A 1A04A 3UR3C 2DA3A 2UWMA 2WA0A 2IAIA 4FX0A 4IRGA 2FX0A 5B1BH 2UXNA 2Y2ZA 4BXUA 2D45A 3QPSA 3W3CA 1H8AC 4UHTA 2H94A 2V1DA 2HZTA 3WE2A 4XLHA 3TEDA 1VF9A 3V8KA 2QQAA 2M5WA 5D5VB 1SVLA 2XAJA 2NVUB 1IO2A 2JA8J 3K4KA 1R1UA 3MAJA 3VYUB 2Y69H 2MFZA 3I53A 3BR0A 1V5FA 2L7ZA 1T56A 2ZFUA 3DLAA 3HUGB 3HKZN 3H5RA 2F5FA 5HOOA 3LOCA 2V9KA 1GV5A 4UNOA 1YS7A 3KFWX 2AQEA 5CVRA 1FLIA 2ZNZA 1TLHB 1ZGWA 3KZZA 5CLSA 3K9TA 1XX5A 2J5OA 1W36D 4MQVA 1SD5A 3RCOA 1GHCA 2LVSA 2W24A 3K4BA 1IDYA 1Z7LA 2EB7A 1QPIA 1JTXA 4XK4A 3WGIA 5GAHJ 1J7KA 3U1DA 1HDPA 3PFYA 2OPTA 5A2QZ 1KYZA 1U6GA 1FIPA 1Y8RB 2EWNA 1O57A 4CCJA 2FA5A 2XAQA 3F8NA 4I02A 1SFUA 2RV8A 4EJWA 4WX9A 4E7JA 4II2A 3L2RA 2HVQA 1GLNA 4FISA 3VSLA 1FTTA 2R7VA 4HAMA 2DFEA 3P9IA 2HOSA 2O5RA 1KQ0A 1NG6A 3GEZA 4BJTA 1R58A 4IHYA 1OCZH 1S5LC 4LGWA 5H2FC 2WBMA 5IT9K 4C2MJ 2LLKA 2VIXA 2CV0A 4FE4A 4G94A 1MKMA 2OZUA 3PUFA 5K5RA 3KYCB 2IGOA 2RAEA 1LE8B 1E17A 2HTJA 4NNJA 3K10A 1W0UA 2HEOA 4PSWA 3HOXJ 3I55I 1H88C 3H0DA 1ERDA 5DM7F 2WAFA 2QM3A 4IHXA 3FDYA 1HKSA 4XM3A 4YFKF 3GO5A 4HQMA 3ZCOA 4U7BA 1R22A 3FISA 1LUJB 2G7UA 2HOEA 1XGMA 2DA5A 1SFKA 2CWEA 4YRVA 2O8XA 3K4MA 1A6QA 3CLOA 1PP8F 2DA2A 2IXSA 4L0YB 3J7AO 1E0EA 3C3WA 3H3UA 3LQRA 3FXMA 2OV7A 5HLTA 4LJZF 5FO5A 1ITYA 3F23A 3BJAA 4XQFA 4I7HA 2BGCA 2A61A 3QYFA 5LHHA 1N75A 2DDBA 3C2HA 5DEQA 2GQQA 3ZMSA 4U0WA 3WU0A 1MIJA 1ONVA 3P7NA 2B0LA 2VL8A 3BR1A 5JR3A 3S17J 2P81A 1D1BA 1B72A 2PQ8A 4AYBN 4DYRA 5TISC 3BDDA 4CCKA 2ID6A 1T0FA 2RGVA 5DUIA 1IN4A 3H92A 3KEYA 1F36A 4C3JJ 4XKVA 1R1VA 2HNHA 3BWGA 1VQKI 4B4CA 1SAUA 1P4XA 3R6SA 5IOZA 1UMQA 1FOYA 2PMUA 3MVPA 4PUSA 1QZYA 1P2FA 3TO6A 5FJ8J 4EQQA 3QPLA 2R92J 2MW8A 2RDPA 4R8HA 2I5UA 1YTYA 1UCRA 2JTVA 2KIMA 4C2UA 2EV0A 1A31A 1WJBA 4IO9F 3RPUD 2ECBA 1YW7A 3EETA 4O3MA 1I27A 3KYLA 1W5TA 2XF6A 4I6ZA 2PJPA 2HYGD 5F1RA 3KEQA 4EVIA 1P7IA 5E8IA 3HOUJ 1TT5B 2A5WA 4PJLA 4KIBA 4XR6A 2ZB9A 1GUUA 5L3GA 2HXIA 2DMUA 3BPXA 4XLAA 1JUPA 1MBFA 2FNPA 1HBXG 1JUSA 1P4AA 3F72A 3J7YJ 3OYEA 1P9QC 1FPQA 1JTYA 5LFAA 3MKWB 1J0RA 4HDVA 2XB5A 1Z1DA 2ELHA 1P4WA 2LY2A 5HS7A 4XKWA 1SD7A 1W5CC 3RTRA 2X9DA 3NWSA 5ICGA 2IEKA 3ZQHA 3EUKL 3U21A 3OYHA 1CF7A 4ASNA 3VEPA 4W97A 5L3CA 2B9SA 1ZR4A 1MBEA 1QO0D 3QQAA 2VT2A 2QWWA 4U87A 2BXZA 1D5VA 1OMIA 1U8RA 4IQ4A 5E3LA 3W2WA 4EV0A 3K70C 3OIQA 2DMQA 2O61A 3H1CA 2XB0X 1RRJA 1CF7B 3ZRGA 2QENA 4UUSA 1ZG1A 1WH5A 1BI0A 2KT0A 4UV8A 2QSGX 4BHCA 1JGGA 4ABZA 1DU6A 3LSRA 1RNLA 1D5YA 3S2DJ 5K7ZA 3TP0A 1IXRC 5IY5H 2BVMA 3IAM2 1Z77A 3BZ6A 4XLEA 3CDIA 2K86A 4ENMA 3LAJA 1FSHA 4MTEA 3TDUC 3AKZA 2PMZN 5D6EA 3CCUI 1ZKGA 1GXQA 4PDKA 4G6DA 5IT3A 5LGNA 4N9IA 3M07A 2OJED 4I0AA 3F9KA 2O03A 3GF2A 5LHGA 4PCQA 4ZJZA 2JQ7A 3RKQA 2ZBKA 1BJAA 3HPHA 2WY7Q 4ITVA 3P9CA 4Z6YA 4H4KC 2ADUA 3QODA 2MYSA 1STZA 1AWCA 2VONA 1YJWI 3M8EA 3JRFA 3GTQJ 2BY1A 2H1LA 1SAXA 2HQAA 3FKIJ 4L9JA 2VB6A 3RJPA 1TWGJ 2K9LA 3HOZJ 2K85A 4E7LA 1BC8C 2EZHA 2XKPA 2BBYA 1E2XA 3DBLB 1FT9A 4JP0A 4WCGA 3FK6A 3HHHA 3J80K 1Y1WJ 3G1LA 2KIUA 4ZYAA 2KIQA 4DYCA 5EJCA 3OR2C 5FKLA 4M3EA 1DU0A 1TQPA 1MBJA 1G3SA 2JSPA 3OSFA 4IQJA 3CCYA 1WZ2A 3QU6A 2FQ4A 2M4GA 2M8EA 2JVGA 2PMHA 3MKZA 3D5SC 1IG7A 1DUXC 4AVZA 3TKYA 3ZQGA 3HB9A 2ETHA 2DOEA 3BZCA 5AIPA 1TW2A 5GTIC 2FXAA 1FMVA 3WHBA 4B43A 2F2EA 4EMSA 3Q5FA 2HS5A 4N9HA 4L5IA 2NS8A 1Y56A 2LR8A 5EZGA 4FHTA 3J81K 4OOIA 2V7FA 3MKYB 1T95A 2DA4A 4GRIA 2IS4A 2ZXHA 4AU7A 2STWA 1B1BA 3WU2C 3KEOA 5HODA 3JR9A 2XF7A 3F8FA 1D0XA 2LY1A 2DCEA 4IOCF 3GBGA 2L9NA 4JYKA 2D2WA 4CCLA 3CMAI 4P1WA 4BEHB 1TWHJ 1Z7UA 4D5CA 1EV7A 1HF0A 4J19A 4HV6A 3BR6A 3IH2A 3BP8A 4HNTA 1KU3A 2FEZA 3OSGA 2R93J 5B5EC 3IRQA 2VOOA 4DYQA 4BBSJ 4KJZA 1TNSA 4NBQA 2HXOA 2M30A 4A0YA 4OWRB 5IP6A 1F1ZA 2KL4A 3KP4A 2XKOA 4LK0F 1ENHA 3K0LA 3TDZC 3G1MA 4GCVA 4FX4A 5JVGF 3JRHA 1YOVB 2E71A 1E3PA 2KZGA 3OS2A 3R60A 1YW8A 1HKQA 2EV5A 4G6TB 4J00A 1YHQI 1XD7A 1VQ5I 1AKHA 1OFCX 3BR3A 3HRSA 3LSHA 1REPC 1ETKA 1HW2A 3S16J 1FX7A 2KHMA 4PFPA 3MZYA 2ESHA 3HG9A 2HDWA 1FY7A 1RUOA 1MSEC 2Q0OA 3F6OA 1VQLI 1SD4A 1IV8A 2DJIA 3PSFA 4A3EJ 3CTAA 1AKHB 1O3RA 4DZPA 4FTHA 2DA7A 4HQEA 3GWZA 4IHWA 1AOYA 1TT0A 4Y13A 1QRYA 2RQPA 3MQ0A 1JT6A 3JRAA 3DKWA 4BYYA 5L3EA 4C3HJ 2DN0A 1O3TA 4PGHA 4QIWN 1XDSA 2LKXA 4HF2A 1YYVA 1TTYA 1P7JA 1T8IA 2EPFA 2DA1A 1BM9A 2W4SA 2A68F 4M73A 1FJLA 1BIBA 3IKVA 2XGDA 2PJRA 1JKRC 4MNUA 3PQJA 3CDLA 4TV7A 3FK7A 2V26A 4CH7A 5HDKA 3ASNH 3I5UA 4ZYEA 1J09A 4XRMA 2R7QA 4LIVA 4XMYA 2CQXA 5CPRB 4FT8A 2YS9A 1QNTA 3HOTA 2ZC2A 5BPIA 4XBFA 1KQ9A 2R5YA 5HLIA 1OCRH 2NVTJ 3GZ6A 3M4OJ 2GA2A 3I58A 4RS8A 4PJMA 2JUCA 5E20A 2PJRB 4NHJA 4C3IJ 3QU3A 1XSDA 4CGZA 1ZH5A 2OF7A 3Q3SA 1HC8A 2XVCA 1OQYA 4RM3A 3ZQQA 2ISYA 3TL4X 1MNDA 2F4MB 2Y9YA 3LSIA 2R5YB 1QGPA 3QOPA 1BI1A 2Z3YA 4RMNA 2IT0A 2R4GA 2OUMA 1XG1A 1OYWA 3OOPA 5C4JJ 2L9SA 2VODA 3M7GA 2AO9A 2QGUA 4R1HA 2QQ9A 2GXAA 1A6IA 3EYIA 2DK5A 5CQGA 1ETXA 1BI2A 1X3WB 5BS6A 3JRDA 1ON2A 1U5TC 2GWRA 1K7AA 3CC2I 3J7ZI 2JA7J 1K4TA 1RR7A 2DMTA 3KPHA 3U2RA 4ZYGA 3IRRA 2Q8KA 1BW5A 1V54H 1CQTA 3M9AA 2DT7B 4HNVA 3ZQLA 3FBNB 1Z91A 4FE7A 2PN6A 4EM0B 5DUKA 5KNLA 3GTOJ 1VQ8I 4XKCA 4AM3A 2IGKA 2LFBA 2R7UA 5HDGA 2XAFA 1IF1A 2KQRA 4KITB 1BR1A 1PP7U 2L02A 3FMRA 3QOEA 5H6QA 4G12A 2W48A 2X6OA 2GM4A 3DCFA 2CMPA 2JPBA 2VI6A 3WODF 3NEUA 4JK1X 5FRNA 2LTPA 2LNBA 2H09A 1BR2A 2QEXI 3E6BA 3ZMUA 5J1RA 2XGEA 4RBOA 1YX3A 1H9GA 4IEJA 1L3LA 4V19K 1XC5A 3KLNA 1WCMJ 3O8HA 1X3ZB 2RREA 4G6QA 3OY9A 3HRUA 3OIOA 3SZGA 3WE3A 1Y1VJ 1XCBA 5LEJA 1MMSA 1Z67A 5KK1A 4LMYA 2L7FP 2QVOA 3ESWB 5ILVA 1SEUA 3F0CA 1VTNC 3ABMH 2IBDA 3R4KA 4PK4A 2KMUA 2A69F 1VI0A 4HSTA 3GFJA 2X6WA 2G0EA 1YE9A 2XRLA 5FKMA 1BBYA 1OKRA 3GFMA 2O7OA 2VASA 1LVKA 2JSCA 4PJJA 1MJBA 3G2BA 3SXYA 2DODA 1IN7A 1S6LA 3FF5A 2DW4A 3HXLA 3G6EI 1VQNI 3AG4H 4RAFA 2VQLA 4Y15A 3CJTB 3RQ4A 2JRTA 1L0OC 4XN3A 3NARA 1IN8A 1AA7A 3BLYA 3HTSB 1MBKA 3K2AA 4RAZA 2E36A 3N4MA 1QU3A 2CUEA 2JJ7A 1AU7A 1ZGAA 3DV8A 3TOAA 4M9SA 2O8KA 2X0LA 1IAWA 2EV6A 2M87A 2LBFB 1XGOA 1NTCA 4A93J 2EINH 3FM5A 1LEAA 3OWTA 2XAGA 2DMPA 2CV1A 4LG3A 5J1UA 2P7VB 3CJRB 3HSEA 3J81Z 4FASD 3UNGC 1KU2A 3DXJF 2CV2A 1WRJA 3REOA 3BG9A 4G8XA 2LD5A 4OAZA 5D8LB 1KYWA 2YUSA 4BQQA 2QBYA 4RLQA 1B9MA 2CU7A 1MMDA 1UHMA 2MBFA 1OLTA 4G7OF 4F93B 3PSIA 5J3LA 2OD5A 3FZVA 2KDZA 5D5XB 4OAYA 5TJJA 2K5CA 4BAYA 4I99C 1YJ9I 1ZQ3P 4PZJA 2QBYB 1D3YA 2OTJI 1LDDA 2QSFX 4MO7A 3GTKJ 2GOXB 1I1SA 1USSA 1ODDA 3ONQA 2Y0SN 4EJUA 3OS0A 1BC7C 3LAPA 4D7NA 4CICA 2BW3A 3HUGA 3EPZA 4EM2A 4JX6A 2WAQN 5GTHC 2LSOA 3OR1C 5FRMA 1IXSB 5LRSA 4ANJA 2MABA 2E1NA 5FLXZ 3N97A 3B6CA 3O2PE 4M9XA 2EFOA 1W36C 3OYGA 5F08A 2BW3B 4I76A 3IC7A 1BOAA 3PO2J 2IGNA 4HZFA 2PX9A 3MMYB 4NQWA 5E3OA 4WK8F 4OMZA 3GTPJ 3JAMK 1DGWY 3BZKA 3ERED 4RA2A 1HLVA 1IRGA 2P8TA 1UHWA 3GX4X 2VBZA 3E5UA 1K6YA 3GVAA 2HOTA 2JT1A 4B8XA 2EZKA 5DCMB 1NH3A 3PIOF 3I59A 5H6RA 2F6CA 4NQWB 5DD4A 4Y52J 4MTDA 3BY6A 3DWLE 2ESNA 3IAS2 1LEBA 3LSTA 1R7JA 5EEHA 5JVTA 4BY7J 1J2XA 1J75A 1FEXA 5BMZA 2XPUA 2R7ZJ 1RPWA 3QYEA 2EZIA 3I59B 1F4KA 3QPHA 2ZXWH 1SFEA 4M3GA 3OYAA 2ELKA 3LSKA 2QZ8A 4RAYA 2I10A 4RB2C 4D9JA 1A5JA 1LFBA 1G8XA 1MD0A 3V7CA 4DJAA 3NAUA 2IRFG 3VB2A 2CYYA 3I0TA 3W6VA 2G9WA 1LE8A 3OL3A 1KONA 4WF2A 4ZDPA 3ZR8X 1GDTA 4A3CJ 5DTDA 4IHSA 3FKJA 2WB1A 4XOTA 3K4LA 2P5KA 1HQCA 1B4AA 2ZXJA 2HR3A 4M6VA 1G3YA 3F22A 5L3DA 3SZTA 3DKXA 1MBGA 5K5QA 4HPQA 3DBRB 1R00A 4IRIA 4P55A 2A6HF 2XPWA 2K27A 4KYWA 4L0ZB 2X1DA 2HYFA 4L9VA 3V7SA 3V8JA 4KICA 4AD9A 2NNNA 3A03A 3S1NJ 2L54A 3OYBA 3SHFA 2FUG2 2ZNYA 3HSFA 2X6YA 1X2NA 4ZDOA 2NXNB 5CKTA 3WU1B 3S8PA 1ON1A 4YEJA 2K9QA 2D1HA 4QLCU 4BE0A 1UG2A 4R79A 3L2CA 2VJ4A 3H0GJ 4XLFA 2FOWA 4DZJA 2DAOA 4H0EA 3FHNA 4QWQA 5FFXA 3IKTA 2PBIA 1VQOI 3OYNA 3A1YA 3FWEA 1BR4A 2JUGA 4S04A 3H3ZA 2W84A 2OAZA 3DU6A 3QYBA 4BACA 2X6XA 1EA3A 1SANA 2PG4A 2GXBA 2NS7A 4V2GA 4D5FA 1YW9A 1FYMA 1YRNB 1U3EM 3K69A 3GUDA 2KIFA 3BG6A 1IGNA 2DK8A 2FBKA 3L2QA 3M8JA 2E1CA 4EGYA 1LDJA 3RKXA 1G6NA 2E60A 4XONA 5KAFC 4FETA 2LYCA 1ZARA 3ZQIA 2CQKA 3DPUA 2GBYA 5DDGA 5B3SH 2HFHA 3BG3A 2XC7A 5JHUA 4A3KJ 5L3FA 1P92A 1JKQC 3S93A 4ZYHA 4IXAA 4GO1A 3CZ6A 3E6DA 5DS9A 1K6OA 4YIFA 2HWVA 4IKFA 9ANTA 1I39A 5JI6A 4XSZF 1BA5A 2K3FA 2XDVA 4IOAF 4E7ZA 2OQRA 1N77A 2R7SA 1K79A 4M71A 1LB2A 1EKEA 4N4NB 4U0YA 4OIRF 1ULYA 5D8KB 1PDNC 3HKZA 5BNGA 3KP5A 4XRSA 1SC7A 2XUBA 2L2OA 2E2HJ 4HOBA 3CJQB 3HOSA 1Z3XA 1U5TA 1XGSA 2KKOA 2MLGA 1T2KA 2FRHA 1O7FA 2D5VA 3O6BB 2CH0A 3KE2A 4A5NA 4BQNA 2GLOA 5GPCA 2P0WA 3DF8A 1U2WA 2Q2EA 1JI8A 4PGGA 4BGDA 2CUFA 2KPMA 2DFFA 2LG4A 1TQIA 1U5TB 2FJ1A 2XHKA 5CVIA 1JJ6C 2HU9A 2VBXA 2ZKZA 1UG0A 2CFXA 3OOUA 3RIRA 3MFKA 3LA3A 1HKTA 2KRFA 3T5XA 3MZHA 2NOGA 3FMSA 4U88A 3CP2A 2K9NA 3JRIA 1MSFC 4PSXA 2R7RA 2Q2EB 5GADJ 4YFNF 4A3FJ 1IDZA 4ENNA 5CVUA 2V6EA 1XTAA 4RLFA 2FU4A 5J4YA 1YX5A 1Y6IA 3RZOJ 1I3QJ 2OU2A 3CCEI 4A3JJ 5H20A 3A0BC 1XN7A 4MQ9F 4IL6C 1ZTRA 3WG7H 4EJVA 2VT3A 4EGZA 2Z9OA 3DPLC 3CCMI 2KZVA 2M9HA 2OTLI 4XORA 3E0JB 1T98A 2L7MP 2HDDA 1W7PD 2BY3A 1ZRCA 2WV1A 1FTZA 4EJOA 2B7EA 3KP3A 2EIJH 3PNYA 3HIFA 3OYCA 2TRTA 1Z21A 3S3NA 1SD6A 3VPRA 2E5NA 2L9RA 3P9KA 1R23A 1YLFA 2CSOA 2STTA 2A6TA 2CW8A 3R0AA 4Q47A 2V1XA 3S1QJ 1N78A 4RB3C 1RR8C 1EH7A 3QP6A 1UB9A 1TL8A 4M3BA 3S14J 4RGRA 5J40A 4LB5A 2VPRA 5TGTA 3JAMZ 3GYHX 1EF4A 3Q0UA 5K5OA 4BE2A 5F0CA 1LQ1A 1SMTA 3PNTA 1J59A 2CGPA 1OJLA 1UAAA 2AQFA 3ISPA 4JOMA 4B1RA 1LFPA 2B63J 2ELJA 4BUPA 3CMYA 2E2JJ 1DPUA 1OPCA 2V1NA 3BJOA 3L00A 1UZCA 5LLQA 3V4GA 5M3MJ 4X6AJ 3E3VA 2BOLA 1R6RA 3BTJA 2X4HA 1Q1HA 3K1NA 2P4WA 2BHYA 2W1OA 1XMAA 2ZJQF 3L7WA 3S3OA 2GXGA 1G3TA 3VODA 1JJ8C 2E19A 3KP7A 4A3IJ 4Q4ZF 3VOEA 3CUOA 3A4CA 4WXCA 2R7WA 2F5DA 4ZDLA
chains in the Genus database with same CATH topology
5IT9Z 1YFHA 4L18B 4A6DA 3TO9A 4M6XA 1GVJA 4UVCA 3BJ6A 1QBJA 2L3DA 3HSRA 3B02A 2YPRA 5LBQA 3GXOA 3QRFF 2DQRA 2EFNA 2ZO4A 4KN4X 4LD5A 3R61A 3LQQA 2MLKA 4UV9A 4KDPA 1FZPB 2J5PA 2XIGA 3IWFA 2M1BA 2A5YB 4KNYA 4KUMA 3I71A 5CJ9A 2FMLA 1X3UA 2DI3A 3GFLA 1YS6A 3ZN0A 5L3BA 1YG2A 2CG4A 1MGTA 1MJAA 5K1YA 1LNWA 3RDIA 2V9VA 4ESFA 1FNNA 1XGNA 2EFPA 3RKWA 1U78A 4HV5A 2Z33A 4L9TA 1FP1D 2K4JA 4JBAA 5J8FA 2RKHA 2MD5A 5FFZA 2YU3A 2K02A 1GXPA 3FHZA 1OR7A 5ILSA 1S29A 2HQRA 4P5OA 4HLXA 4HBLA 1DDNA 1DPRA 3NQOA 5ICEA 4HX8A 4A0ZA 5ERIA 1BIAA 1HW5A 1C0WA 1G4DA 3HYIA 3WTUC 2O6GE 4Q48A 2FBIA 1ZG3A 4IJAA 4ZZLA 4L9NA 3Q9VA 2V6CA 2HQNA 1O3QA 1IN5A 4P96A 3CUQC 2FE3A 2AXLA 4NB5A 1S7AA 1ZRDA 4U0VA 5CVJA 3FXRA 3I54A 3E97A 5HDNA 4OIQF 3JSPA 4BHBA 4CHUA 3RPUA 4KT5C 1IUYA 1FP2A 4M74A 4IVNA 4HX4A 2XGXA 4ENKA 1WSUA 4I09A 4CO8A 4UXNA 1HW1A 2V79A 3T1BA 2KJCA 3F3XA 4AIHA 5J8CA 1Z6TA 4Z2YA 3L09A 2RN7A 2DTRA 5LHIA 1FOKA 3C7JA 1FBUA 4YIIA 1G3WA 4ESBA 1D8JA 2RC4A 3D0SA 2YR2A 1ZREA 2Y0MA 4RB0A 4KFCA 3ZMZA 2K4BA 2XASA 2QQBA 4BNCA 3J80Z 2TDXA 2OBPA 1IXCA 2FBHA 4EJTA 3DEUA 4O5VA 4GYIA 3TQNA 4CZZA 1ZRFA 2BEOA 1Y0UA 2P5VA 3E5QA 4M9ZA 1I6XA 4ENJA 5LGUA 4DQ2A 3LA7A 2L01A 5AIQA 4RGXA 1K78B 2WC2A 4A0XA 3DFGA 2NRAC 2A6EF 2L4AA 1UFMA 3IHUA 2P6SA 4YFXF 1T39A 4HDUA 2DO7A 3DQVC 1LVAA 4KMFA 4HA8A 3K1PA 2ZMEB 1TNTA 4LLGF 1LJ9A 3RKYA 3VFZA 5DCFA 4IHTA 1CGPA 2GIVA 4BHPA 4AIJA 3SFZA 2A07F 1XSXA 5HS9A 3KP2A 5FD6A 5BOXA 3LWFA 2E7WA 1D8KA 5DCMA 4B09A 1IN6A 2V1UA 1ZYRF 1J9IA 3V8LA 2NNYA 3ABUA 4LLNA 1BI3A 3RYRA 4A12A 1RI7A 2FSWA 4AVPA 2XROA 2NYXA 5E1WA 3T8TA 2QLZA 3NRVA 2H27A 4HYEA 4A2UA 2BV6A 2H6BA 3ZPLA 1WI9A 2HTSA 5HLGA 3DP7A 2JZYA 2D1VA 1Z9CA 2JPCA 5F64A 2Z99A 1PUEE 3WTYC 1RUNA 4N0BA 5BQTA 2MC3A 3G73A 5HVQC 3GW2A 1Z05A 3RPQA 4P9UA 2CO5A 3ML6A 4P9FA 4RGUA 2LDUA 5FD5A 2P5LC 3ABTA 1KA8A 2AS5F 3CO7C 4WWCA 3SZPA 2DFIA 4G7HF 5FB2A 4XRFA 3FM3A 3FXQA 3ULQB 5ED4A 2NAZA 3HRMA 3MWMA 3ZP5A 4E70A 1JHHA 5KVRA 1T38A 4ESJA 1B9NA 5DYMA 4HF1A 1Z6RA 2W85A 2DU9A 3PFIA 4I2OA 1JXSA 1MJ9A 1H0MA 4RGSA 5ICCA 1WWXA 2R7DA 4I0BA 1QQIA 1W5SA 5DV5A 2QUFA 2WTEA 2PEXA 2XRNA 2F5CA 1EH8A 3EUHA 2CW0F 3KP6A 2ZCWA 4A6EA 2IJLA 4OIPF 3G3ZA 2K7LA 3JSOA 4LFUA 1R36A 1TBXA 1ZGJA 5LGTA 1YIOA 5LEKA 2GAUA 3F8CA 3C1DA 5ILUA 5HS8A 4MEXF 2OZ6A 2VBYA 3WG9A 5AONA 2XV4S 1RZ4A 1ZHFA 3COAC 4IF4A 1FBSA 2LKPA 2DPUA 1B59A 3CUQA 1FYKA 2HGCA 4KN7X 4HLYA 2W25A 3I4PA 4I01A 2VE8A 4F7ZA 3T0YA 3CJNA 4HF0A 5E8GA 3CUQB 3CO6C 2M45A 3EYYA 1HXDA 1H9TA 3OV8A 4I98B 3K1MA 2ISZA 4BH9A 2H6CA 1I1GA 1FBQA 1SFXA 2P7CB 1LDKB 5F6FA 1FC3A 3V7RA 1S8NA 3ELKA 3T8RA 3E5XA 3QP5A 3TGNA 4EM1A 4ETSA 1EH6A 3QPTA 2O0YA 3W6KB 3FXUA 2BE5F 6PAXA 2VC0A 4MGRA 4LK1F 2DBBA 3JTHA 3DPTA 5D4RA 2L4MA 2GZWA 3KLOA 4IPAA 4S05A 3KETA 3F8BA 1ZAOA 3KCCA 4CDGA 1FYLA 5HLHA 3F6VA 5D5WB 1HSJA 5DD8A 3TO7A 3M8FA 3TOBA 1F5TA 2DQLA 4CXFA 3HTUA 4Q5SF 2NS0A 3E6MA 4LG0A 3O3KA 1WQ2A 1KGSA 1KQ8A 2IVMA 3I64A 1O3SA 4HX7A 4LG0B 3GZ5A 3AAFA 2FMYA 4LB6B 2Z5UA 2ACJA 2HKOA 3ZMDA 3BOQA 2DPDA 4M72A 2MH9A 1IRFA 2F5EA 2IP2A 3F21A 5EEGA 2PI0A 2OQGA 5E17F 3D5LA 4UUVA 1YQAA 4GGGA 1OYIA 5E1XA 3U9GA 1BN5A 4XLNF 2VE9A 4YG2F 1I5ZA 3ZMVA 3HRTA 4OINF 3LA2A 3PQKA 2FNAA 2VBWA 2WWYA 2O3FA 1QZZA 1V4RA 5E1ZB 3ECHA 1JGSA 3EDPA 4OIOF 5CYVA 1J5YA 1KU9A 3WTZA 4D0PA 4L5JA 2UXXA 2DLLA 4A5MA 2BYVE 2C6YA 1R5GA 3HHGA 3JW4A 5FLXK 2R7FA 1KU7A 4UVBA 3B73A 4WXDA 1IW7F 4RB1A 3ZMTA 1ZN2A 2ZFWA 2RVCA 5D6FA 4G7ZF 1SMYF 1TQMA 2Y48A 2COMA 2VN2A 1WKMA 3ROUA 4WXHA 5D5UB 5FGMA 3RI4A 2XAHA 2YSRA 2EFQA 4AIKA 5A2QK 2RNJA 3CDHA 3L9FA 2IW5A 2GA1A 2IA1A 5CVVA 2QYOA 3LFKA 2KJBA 2YX4A 1JE8A 1XSVA 2P6TA 1MZBA 2HDCA 3SQNA 4XSXF 2UZKA 1XMKA 4KMUX 2ZJ2A 4O6JA 1HSTA 4MHGA 4LLLA 3F8MA 3W6JB 4XLPF 3QAHA 1IZ1A 1RIOH 3WTWC 4CYDA 2FF4A 4MEYF 4AWXB 3S2WA 2WV0A 1W4MA 3MEXA 2DT5A 1O7LA 3FMQA 4GXOA 1R1TA 4M6YA 1T6SA 1P6RA 1TW3A 3WGGA 2EFWA 3KZYA 4OMYA 2VC1A 1V3FA 3C18A 3IWZA 4ZZDA 2FQ3A 2E7XA 2EA2A 2LF7A 2FOKA 5E18F 3WTTC 2R3SA 3M1EA 2G7HA 2EK5A 3JTGA 1S3JA 2HKXA 2VXZA 4KA4A 4DNCA 2Y75A 2PFBA 2EA4A 3ECOA 2OA4A 4JQFA 1B6AA 2IA0A 1ZG5A 4ZYDA 1DP7P 1JHFA 1XDUA 3WGHA 5LRRA 1K78A 3RYPA 4ON0A 4K2EA 3R0JA 2W57A 4OU0A 1OYYA 4GYGA 4HW0A 3WTVC 1W7PA 2IA2A 3EQLF 3WTXC 5D4SA 2VOPA 1FWZA 2A3SA 3WTSC 1XB4A 4KIGA 3BROA 1F9NA 1W7PB 5BPDA 2ZMEA 4G9YA 5J6XA 1S7OA 3IL2A 2YX7A 1QPMA 1MDMA 2LF8A 3GLXA 4ZH4F 5TRDA 1YO5C 5JFRA 3Q9SA 1R5HA 4U7DA 4UVAA 1MDMB 3BPVA 1USTA 3K2ZA 4KIFA 3ZQ7A 3ZN1A 3E6CC 2MA3A 1FSEA 1NHAA 2EJRA 2IPQX 3MCZA 1ZLJA 4IRHA 4BQAA 2PLYA 3GFIA 3FX3A 5ICFA 1ZLKA 1XCVA 2MH2A 4Y17A 1A04A 2UWMA 4FX0A 4IRGA 2UXNA 4BXUA 2D45A 4UHTA 2H94A 2V1DA 2HZTA 3WE2A 3V8KA 2QQAA 2M5WA 5D5VB 2XAJA 1R1UA 3MAJA 3I53A 2F5FA 5HOOA 4UNOA 1YS7A 3KFWX 5CVRA 1FLIA 2ZNZA 1TLHB 3KZZA 5CLSA 3K9TA 2J5OA 4MQVA 1SD5A 1GHCA 2W24A 2EB7A 3WGIA 1J7KA 3U1DA 5A2QZ 1KYZA 1U6GA 2EWNA 1O57A 2FA5A 2XAQA 3F8NA 4I02A 1SFUA 2RV8A 4EJWA 4WX9A 4HAMA 3P9IA 1KQ0A 3GEZA 1R58A 4LGWA 5IT9K 4G94A 1MKMA 2OZUA 5K5RA 1E17A 2HTJA 2HEOA 2QM3A 1HKSA 4YFKF 3GO5A 4HQMA 4U7BA 1R22A 2G7UA 2HOEA 1XGMA 2CWEA 2O8XA 3CLOA 1PP8F 4L0YB 3J7AO 3C3WA 3H3UA 3LQRA 4LJZF 5FO5A 3F23A 3BJAA 4I7HA 2BGCA 2A61A 5LHHA 5DEQA 3ZMSA 2GQQA 4U0WA 3WU0A 1ONVA 3P7NA 2B0LA 5JR3A 2PQ8A 3BDDA 1T0FA 2RGVA 5DUIA 1IN4A 3H92A 1R1VA 3BWGA 1P4XA 3R6SA 2PMUA 1QZYA 1P2FA 3TO6A 4EQQA 2RDPA 4R8HA 1YTYA 1UCRA 2JTVA 2KIMA 2EV0A 1YW7A 3EETA 4O3MA 1I27A 1W5TA 2PJPA 2HYGD 5F1RA 3KEQA 4EVIA 5E8IA 4KIBA 5L3GA 3BPXA 2FNPA 1HBXG 1P4AA 3F72A 1FPQA 1J0RA 4HDVA 1Z1DA 2ELHA 1P4WA 5HS7A 1SD7A 3RTRA 5ICGA 1CF7A 4ASNA 3VEPA 5L3CA 1D5VA 1QO0D 2VT2A 2QWWA 1OMIA 1U8RA 4EV0A 2O61A 1CF7B 2QENA 1ZG1A 1BI0A 4UV8A 4BHCA 1RNLA 1IXRC 3BZ6A 4ENMA 2K86A 3LAJA 1FSHA 4MTEA 3TDUC 5D6EA 1GXQA 4PDKA 4G6DA 5IT3A 5LGNA 4N9IA 4I0AA 2O03A 3GF2A 5LHGA 4PCQA 2ZBKA 1BJAA 3P9CA 2ADUA 1STZA 1AWCA 2VONA 3M8EA 1SAXA 4L9JA 3RJPA 1BC8C 2XKPA 2BBYA 1E2XA 1FT9A 4WCGA 3HHHA 3J80K 2KIUA 1TQPA 1G3SA 3QU6A 2M8EA 2PMHA 1DUXC 3TKYA 2ETHA 5AIPA 1TW2A 2FXAA 2F2EA 4EMSA 3Q5FA 2HS5A 4N9HA 4L5IA 4FHTA 3J81K 4OOIA 2STWA 1B1BA 3KEOA 3F8FA 2D2WA 1Z7UA 1EV7A 4HV6A 3BP8A 1KU3A 2FEZA 3IRQA 2VOOA 1TNSA 2M30A 4A0YA 1F1ZA 3KP4A 2XKOA 4LK0F 3K0LA 3TDZC 4GCVA 4FX4A 3R60A 1YW8A 1HKQA 2EV5A 1XD7A 3HRSA 1REPC 1HW2A 1FX7A 3MZYA 2ESHA 1FY7A 1RUOA 2Q0OA 3F6OA 1SD4A 3CTAA 1O3RA 4HQEA 3GWZA 1AOYA 4Y13A 2RQPA 3MQ0A 3DKWA 4BYYA 5L3EA 1O3TA 4PGHA 1XDSA 4HF2A 1YYVA 1TTYA 1BM9A 4M73A 2A68F 1BIBA 3IKVA 4MNUA 3PQJA 4TV7A 5HDKA 3I5UA 4ZYEA 4FT8A 1QNTA 3HOTA 5BPIA 4XBFA 1KQ9A 5HLIA 3GZ6A 2GA2A 3I58A 4RS8A 5E20A 4NHJA 1XSDA 3QU3A 4CGZA 1ZH5A 2XVCA 2ISYA 1QGPA 3QOPA 1BI1A 2Z3YA 2IT0A 1OYWA 3OOPA 2VODA 3M7GA 4R1HA 2QQ9A 3EYIA 2DK5A 1BI2A 5BS6A 1ON2A 1U5TC 2GWRA 1K7AA 3U2RA 4ZYGA 3IRRA 2Q8KA 3M9AA 1Z91A 2PN6A 4EM0B 5DUKA 5HDGA 2XAFA 1IF1A 1PP7U 2L02A 3FMRA 5H6QA 2JPBA 3WODF 3NEUA 4JK1X 2LNBA 2H09A 3E6BA 3ZMUA 1H9GA 1L3LA 3KLNA 4G6QA 3HRUA 3WE3A 5LEJA 1XCBA 5KK1A 4LMYA 2QVOA 5ILVA 1VTNC 3R4KA 2A69F 3GFJA 1BBYA 1OKRA 3GFMA 2JSCA 1MJBA 3SXYA 1IN7A 1S6LA 3FF5A 2DW4A 4Y15A 2JRTA 1L0OC 1IN8A 3HTSB 4RAZA 3N4MA 1ZGAA 3DV8A 3TOAA 4M9SA 2X0LA 1IAWA 2EV6A 2M87A 1XGOA 3FM5A 1LEAA 2XAGA 2P7VB 3HSEA 3J81Z 1KU2A 3DXJF 1WRJA 3REOA 4G8XA 5D8LB 1KYWA 2QBYA 1B9MA 2MBFA 1UHMA 4G7OF 2OD5A 3FZVA 5D5XB 5TJJA 4BAYA 4PZJA 2QBYB 1D3YA 1LDDA 1I1SA 1USSA 1ODDA 4EJUA 1BC7C 3LAPA 4CICA 3HUGA 4EM2A 2LSOA 1IXSB 5LRSA 2E1NA 5FLXZ 3N97A 3O2PE 4M9XA 2EFOA 3IC7A 1BOAA 4HZFA 4WK8F 4NQWA 4OMZA 3JAMK 3ERED 1IRGA 2P8TA 1UHWA 3GX4X 2VBZA 3E5UA 3GVAA 2JT1A 4B8XA 5DCMB 3I59A 5H6RA 5DD4A 4MTDA 3BY6A 2ESNA 1LEBA 3LSTA 1R7JA 5EEHA 5JVTA 1J2XA 1J75A 5BMZA 3I59B 1F4KA 3QPHA 1SFEA 4RAYA 2QZ8A 4RB2C 1MD0A 3V7CA 2IRFG 3VB2A 2CYYA 3I0TA 2G9WA 4WF2A 4IHSA 2P5KA 1HQCA 1B4AA 2ZXJA 2HR3A 3F22A 1G3YA 5L3DA 3SZTA 5K5QA 1R00A 4IRIA 4P55A 2A6HF 4KYWA 2K27A 4L0ZB 2HYFA 4L9VA 3V7SA 3V8JA 4KICA 4AD9A 2NNNA 2L54A 3SHFA 2ZNYA 3HSFA 3WU1B 1ON1A 2D1HA 4QLCU 4R79A 3L2CA 2DAOA 4H0EA 5FFXA 4QWQA 3IKTA 2PBIA 3FWEA 4S04A 3H3ZA 2W84A 2OAZA 2PG4A 2GXBA 1YW9A 1FYMA 1U3EM 3K69A 3GUDA 2KIFA 2DK8A 2FBKA 2E1CA 4EGYA 1LDJA 3RKXA 1G6NA 1ZARA 2CQKA 5DDGA 2HFHA 5JHUA 5L3FA 1P92A 4ZYHA 4IXAA 4GO1A 3E6DA 1K6OA 4YIFA 2HWVA 5JI6A 4XSZF 2OQRA 1K79A 4M71A 1LB2A 4U0YA 4OIRF 1ULYA 5D8KB 1PDNC 3KP5A 2XUBA 4HOBA 3HOSA 1U5TA 1XGSA 2KKOA 2MLGA 1T2KA 2FRHA 1O7FA 3O6BB 3KE2A 4A5NA 3DF8A 1U2WA 2Q2EA 4PGGA 1TQIA 1U5TB 2XHKA 5CVIA 3RIRA 2VBXA 2ZKZA 2CFXA 1HKTA 3MFKA 3LA3A 2KRFA 3T5XA 3MZHA 3FMSA 4U88A 4YFNF 4ENNA 5CVUA 2FU4A 2OU2A 5H20A 1XN7A 4MQ9F 4EJVA 2VT3A 4EGZA 2Z9OA 3DPLC 1T98A 1W7PD 1ZRCA 4EJOA 3KP3A 3HIFA 1SD6A 3P9KA 1R23A 1YLFA 2CSOA 2STTA 3R0AA 4Q47A 2V1XA 4RB3C 1EH7A 3QP6A 1UB9A 4RGRA 4LB5A 3JAMZ 3GYHX 5K5OA 2CGPA 1J59A 1LQ1A 1SMTA 3ISPA 1DPUA 1OPCA 3BJOA 3L00A 5LLQA 3V4GA 3E3VA 2X4HA 1Q1HA 3K1NA 2P4WA 1XMAA 3L7WA 2GXGA 1G3TA 3VODA 3KP7A 4Q4ZF 3VOEA 3CUOA 4WXCA 2F5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 Z;  1YFH A;  4L18 B;  4A6D A;  3TO9 A;  4M6X A;  1GVJ A;  4UVC A;  3BJ6 A;  1QBJ A;  2L3D A;  3HSR A;  3B02 A;  2YPR A;  5LBQ A;  3GXO A;  3QRF F;  2DQR A;  2EFN A;  2ZO4 A;  4KN4 X;  4LD5 A;  3R61 A;  3LQQ A;  2MLK A;  4UV9 A;  4KDP A;  1FZP B;  2J5P A;  2XIG A;  3IWF A;  2M1B A;  2A5Y B;  4KNY A;  4KUM A;  3I71 A;  5CJ9 A;  2FML A;  1X3U A;  2DI3 A;  3GFL A;  1YS6 A;  3ZN0 A;  5L3B A;  1YG2 A;  2CG4 A;  1MGT A;  1MJA A;  5K1Y A;  1LNW A;  3RDI A;  2V9V A;  4ESF A;  1FNN A;  1XGN A;  2EFP A;  3RKW A;  1U78 A;  4HV5 A;  2Z33 A;  4L9T A;  1FP1 D;  2K4J A;  4JBA A;  5J8F A;  2RKH A;  2MD5 A;  5FFZ A;  2YU3 A;  2K02 A;  1GXP A;  3FHZ A;  1OR7 A;  5ILS A;  1S29 A;  2HQR A;  4P5O A;  4HLX A;  4HBL A;  1DDN A;  1DPR A;  3NQO A;  5ICE A;  4HX8 A;  4A0Z A;  5ERI A;  1BIA A;  1HW5 A;  1C0W A;  1G4D A;  3HYI A;  3WTU C;  2O6G E;  4Q48 A;  2FBI A;  1ZG3 A;  4IJA A;  4ZZL A;  4L9N A;  3Q9V A;  2V6C A;  2HQN A;  1O3Q A;  1IN5 A;  4P96 A;  3CUQ C;  2FE3 A;  2AXL A;  4NB5 A;  1S7A A;  1ZRD A;  4U0V A;  5CVJ A;  3FXR A;  3I54 A;  3E97 A;  5HDN A;  4OIQ F;  3JSP A;  4BHB A;  4CHU A;  3RPU A;  4KT5 C;  1IUY A;  1FP2 A;  4M74 A;  4IVN A;  4HX4 A;  2XGX A;  4ENK A;  1WSU A;  4I09 A;  4CO8 A;  4UXN A;  1HW1 A;  2V79 A;  3T1B A;  2KJC A;  3F3X A;  4AIH A;  5J8C A;  1Z6T A;  4Z2Y A;  3L09 A;  2RN7 A;  2DTR A;  5LHI A;  1FOK A;  3C7J A;  1FBU A;  4YII A;  1G3W A;  4ESB A;  1D8J A;  2RC4 A;  3D0S A;  2YR2 A;  1ZRE A;  2Y0M A;  4RB0 A;  4KFC A;  3ZMZ A;  2K4B A;  2XAS A;  2QQB A;  4BNC A;  3J80 Z;  2TDX A;  2OBP A;  1IXC A;  2FBH A;  4EJT A;  3DEU A;  4O5V A;  4GYI A;  3TQN A;  4CZZ A;  1ZRF A;  2BEO A;  1Y0U A;  2P5V A;  3E5Q A;  4M9Z A;  1I6X A;  4ENJ A;  5LGU A;  4DQ2 A;  3LA7 A;  2L01 A;  5AIQ A;  4RGX A;  1K78 B;  2WC2 A;  4A0X A;  3DFG A;  2NRA C;  2A6E F;  2L4A A;  1UFM A;  3IHU A;  2P6S A;  4YFX F;  1T39 A;  4HDU A;  2DO7 A;  3DQV C;  1LVA A;  4KMF A;  4HA8 A;  3K1P A;  2ZME B;  1TNT A;  4LLG F;  1LJ9 A;  3RKY A;  3VFZ A;  5DCF A;  4IHT A;  1CGP A;  2GIV A;  4BHP A;  4AIJ A;  3SFZ A;  2A07 F;  1XSX A;  5HS9 A;  3KP2 A;  5FD6 A;  5BOX A;  3LWF A;  2E7W A;  1D8K A;  5DCM A;  4B09 A;  1IN6 A;  2V1U A;  1ZYR F;  1J9I A;  3V8L A;  2NNY A;  3ABU A;  4LLN A;  1BI3 A;  3RYR A;  4A12 A;  1RI7 A;  2FSW A;  4AVP A;  2XRO A;  2NYX A;  5E1W A;  3T8T A;  2QLZ A;  3NRV A;  2H27 A;  4HYE A;  4A2U A;  2BV6 A;  2H6B A;  3ZPL A;  1WI9 A;  2HTS A;  5HLG A;  3DP7 A;  2JZY A;  2D1V A;  1Z9C A;  2JPC A;  5F64 A;  2Z99 A;  1PUE E;  3WTY C;  1RUN A;  4N0B A;  5BQT A;  2MC3 A;  3G73 A;  5HVQ C;  3GW2 A;  1Z05 A;  3RPQ A;  4P9U A;  2CO5 A;  3ML6 A;  4P9F A;  4RGU A;  2LDU A;  5FD5 A;  2P5L C;  3ABT A;  1KA8 A;  2AS5 F;  3CO7 C;  4WWC A;  3SZP A;  2DFI A;  4G7H F;  5FB2 A;  4XRF A;  3FM3 A;  3FXQ A;  3ULQ B;  5ED4 A;  2NAZ A;  3HRM A;  3MWM A;  3ZP5 A;  4E70 A;  1JHH A;  5KVR A;  1T38 A;  4ESJ A;  1B9N A;  5DYM A;  4HF1 A;  1Z6R A;  2W85 A;  2DU9 A;  3PFI A;  4I2O A;  1JXS A;  1MJ9 A;  1H0M A;  4RGS A;  5ICC A;  1WWX A;  2R7D A;  4I0B A;  1QQI A;  1W5S A;  5DV5 A;  2QUF A;  2WTE A;  2PEX A;  2XRN A;  2F5C A;  1EH8 A;  3EUH A;  2CW0 F;  3KP6 A;  2ZCW A;  4A6E A;  2IJL A;  4OIP F;  3G3Z A;  2K7L A;  3JSO A;  4LFU A;  1R36 A;  1TBX A;  1ZGJ A;  5LGT A;  1YIO A;  5LEK A;  2GAU A;  3F8C A;  3C1D A;  5ILU A;  5HS8 A;  4MEX F;  2OZ6 A;  2VBY A;  3WG9 A;  5AON A;  2XV4 S;  1RZ4 A;  1ZHF A;  3COA C;  4IF4 A;  1FBS A;  2LKP A;  2DPU A;  1B59 A;  3CUQ A;  1FYK A;  2HGC A;  4KN7 X;  4HLY A;  2W25 A;  3I4P A;  4I01 A;  2VE8 A;  4F7Z A;  3T0Y A;  3CJN A;  4HF0 A;  5E8G A;  3CUQ B;  3CO6 C;  2M45 A;  3EYY A;  1HXD A;  1H9T A;  3OV8 A;  4I98 B;  3K1M A;  2ISZ A;  4BH9 A;  2H6C A;  1I1G A;  1FBQ A;  1SFX A;  2P7C B;  1LDK B;  5F6F A;  1FC3 A;  3V7R A;  1S8N A;  3ELK A;  3T8R A;  3E5X A;  3QP5 A;  3TGN A;  4EM1 A;  4ETS A;  1EH6 A;  3QPT A;  2O0Y A;  3W6K B;  3FXU A;  2BE5 F;  6PAX A;  2VC0 A;  4MGR A;  4LK1 F;  2DBB A;  3JTH A;  3DPT A;  5D4R A;  2L4M A;  2GZW A;  3KLO A;  4IPA A;  4S05 A;  3KET A;  3F8B A;  1ZAO A;  3KCC A;  4CDG A;  1FYL A;  5HLH A;  3F6V A;  5D5W B;  1HSJ A;  5DD8 A;  3TO7 A;  3M8F A;  3TOB A;  1F5T A;  2DQL A;  4CXF A;  3HTU A;  4Q5S F;  2NS0 A;  3E6M A;  4LG0 A;  3O3K A;  1WQ2 A;  1KGS A;  1KQ8 A;  2IVM A;  3I64 A;  1O3S A;  4HX7 A;  4LG0 B;  3GZ5 A;  3AAF A;  2FMY A;  4LB6 B;  2Z5U A;  2ACJ A;  2HKO A;  3ZMD A;  3BOQ A;  2DPD A;  4M72 A;  2MH9 A;  1IRF A;  2F5E A;  2IP2 A;  3F21 A;  5EEG A;  2PI0 A;  2OQG A;  5E17 F;  3D5L A;  4UUV A;  1YQA A;  4GGG A;  1OYI A;  5E1X A;  3U9G A;  1BN5 A;  4XLN F;  2VE9 A;  4YG2 F;  1I5Z A;  3ZMV A;  3HRT A;  4OIN F;  3LA2 A;  3PQK A;  2FNA A;  2VBW A;  2WWY A;  2O3F A;  1QZZ A;  1V4R A;  5E1Z B;  3ECH A;  1JGS A;  3EDP A;  4OIO F;  5CYV A;  1J5Y A;  1KU9 A;  3WTZ A;  4D0P A;  4L5J A;  2UXX A;  2DLL A;  4A5M A;  2BYV E;  2C6Y A;  1R5G A;  3HHG A;  3JW4 A;  5FLX K;  2R7F A;  1KU7 A;  4UVB A;  3B73 A;  4WXD A;  1IW7 F;  4RB1 A;  3ZMT A;  1ZN2 A;  2ZFW A;  2RVC A;  5D6F A;  4G7Z F;  1SMY F;  1TQM A;  2Y48 A;  2COM A;  2VN2 A;  1WKM A;  3ROU A;  4WXH A;  5D5U B;  5FGM A;  3RI4 A;  2XAH A;  2YSR A;  2EFQ A;  4AIK A;  5A2Q K;  2RNJ A;  3CDH A;  3L9F A;  2IW5 A;  2GA1 A;  2IA1 A;  5CVV A;  2QYO A;  3LFK A;  2KJB A;  2YX4 A;  1JE8 A;  1XSV A;  2P6T A;  1MZB A;  2HDC A;  3SQN A;  4XSX F;  2UZK A;  1XMK A;  4KMU X;  2ZJ2 A;  4O6J A;  1HST A;  4MHG A;  4LLL A;  3F8M A;  3W6J B;  4XLP F;  3QAH A;  1IZ1 A;  1RIO H;  3WTW C;  4CYD A;  2FF4 A;  4MEY F;  4AWX B;  3S2W A;  2WV0 A;  1W4M A;  3MEX A;  2DT5 A;  1O7L A;  3FMQ A;  4GXO A;  1R1T A;  4M6Y A;  1T6S A;  1P6R A;  1TW3 A;  3WGG A;  2EFW A;  3KZY A;  4OMY A;  2VC1 A;  1V3F A;  3C18 A;  3IWZ A;  4ZZD A;  2FQ3 A;  2E7X A;  2EA2 A;  2LF7 A;  2FOK A;  5E18 F;  3WTT C;  2R3S A;  3M1E A;  2G7H A;  2EK5 A;  3JTG A;  1S3J A;  2HKX A;  2VXZ A;  4KA4 A;  4DNC A;  2Y75 A;  2PFB A;  2EA4 A;  3ECO A;  2OA4 A;  4JQF A;  1B6A A;  2IA0 A;  1ZG5 A;  4ZYD A;  1DP7 P;  1JHF A;  1XDU A;  3WGH A;  5LRR A;  1K78 A;  3RYP A;  4ON0 A;  4K2E A;  3R0J A;  2W57 A;  4OU0 A;  1OYY A;  4GYG A;  4HW0 A;  3WTV C;  1W7P A;  2IA2 A;  3EQL F;  3WTX C;  5D4S A;  2VOP A;  1FWZ A;  2A3S A;  3WTS C;  1XB4 A;  4KIG A;  3BRO A;  1F9N A;  1W7P B;  5BPD A;  2ZME A;  4G9Y A;  5J6X A;  1S7O A;  3IL2 A;  2YX7 A;  1QPM A;  1MDM A;  2LF8 A;  3GLX A;  4ZH4 F;  5TRD A;  1YO5 C;  5JFR A;  3Q9S A;  1R5H A;  4U7D A;  4UVA A;  1MDM B;  3BPV A;  1UST A;  3K2Z A;  4KIF A;  3ZQ7 A;  3ZN1 A;  3E6C C;  2MA3 A;  1FSE A;  1NHA A;  2EJR A;  2IPQ X;  3MCZ A;  1ZLJ A;  4IRH A;  4BQA A;  2PLY A;  3GFI A;  3FX3 A;  5ICF A;  1ZLK A;  1XCV A;  2MH2 A;  4Y17 A;  1A04 A;  2UWM A;  4FX0 A;  4IRG A;  2UXN A;  4BXU A;  2D45 A;  4UHT A;  2H94 A;  2V1D A;  2HZT A;  3WE2 A;  3V8K A;  2QQA A;  2M5W A;  5D5V B;  2XAJ A;  1R1U A;  3MAJ A;  3I53 A;  2F5F A;  5HOO A;  4UNO A;  1YS7 A;  3KFW X;  5CVR A;  1FLI A;  2ZNZ A;  1TLH B;  3KZZ A;  5CLS A;  3K9T A;  2J5O A;  4MQV A;  1SD5 A;  1GHC A;  2W24 A;  2EB7 A;  3WGI A;  1J7K A;  3U1D A;  5A2Q Z;  1KYZ A;  1U6G A;  2EWN A;  1O57 A;  2FA5 A;  2XAQ A;  3F8N A;  4I02 A;  1SFU A;  2RV8 A;  4EJW A;  4WX9 A;  4HAM A;  3P9I A;  1KQ0 A;  3GEZ A;  1R58 A;  4LGW A;  5IT9 K;  4G94 A;  1MKM A;  2OZU A;  5K5R A;  1E17 A;  2HTJ A;  2HEO A;  2QM3 A;  1HKS A;  4YFK F;  3GO5 A;  4HQM A;  4U7B A;  1R22 A;  2G7U A;  2HOE A;  1XGM A;  2CWE A;  2O8X A;  3CLO A;  1PP8 F;  4L0Y B;  3J7A O;  3C3W A;  3H3U A;  3LQR A;  4LJZ F;  5FO5 A;  3F23 A;  3BJA A;  4I7H A;  2BGC A;  2A61 A;  5LHH A;  5DEQ A;  3ZMS A;  2GQQ A;  4U0W A;  3WU0 A;  1ONV A;  3P7N A;  2B0L A;  5JR3 A;  2PQ8 A;  3BDD A;  1T0F A;  2RGV A;  5DUI A;  1IN4 A;  3H92 A;  1R1V A;  3BWG A;  1P4X A;  3R6S A;  2PMU A;  1QZY A;  1P2F A;  3TO6 A;  4EQQ A;  2RDP A;  4R8H A;  1YTY A;  1UCR A;  2JTV A;  2KIM A;  2EV0 A;  1YW7 A;  3EET A;  4O3M A;  1I27 A;  1W5T A;  2PJP A;  2HYG D;  5F1R A;  3KEQ A;  4EVI A;  5E8I A;  4KIB A;  5L3G A;  3BPX A;  2FNP A;  1HBX G;  1P4A A;  3F72 A;  1FPQ A;  1J0R A;  4HDV A;  1Z1D A;  2ELH A;  1P4W A;  5HS7 A;  1SD7 A;  3RTR A;  5ICG A;  1CF7 A;  4ASN A;  3VEP A;  5L3C A;  1D5V A;  1QO0 D;  2VT2 A;  2QWW A;  1OMI A;  1U8R A;  4EV0 A;  2O61 A;  1CF7 B;  2QEN A;  1ZG1 A;  1BI0 A;  4UV8 A;  4BHC A;  1RNL A;  1IXR C;  3BZ6 A;  4ENM A;  2K86 A;  3LAJ A;  1FSH A;  4MTE A;  3TDU C;  5D6E A;  1GXQ A;  4PDK A;  4G6D A;  5IT3 A;  5LGN A;  4N9I A;  4I0A A;  2O03 A;  3GF2 A;  5LHG A;  4PCQ A;  2ZBK A;  1BJA A;  3P9C A;  2ADU A;  1STZ A;  1AWC A;  2VON A;  3M8E A;  1SAX A;  4L9J A;  3RJP A;  1BC8 C;  2XKP A;  2BBY A;  1E2X A;  1FT9 A;  4WCG A;  3HHH A;  3J80 K;  2KIU A;  1TQP A;  1G3S A;  3QU6 A;  2M8E A;  2PMH A;  1DUX C;  3TKY A;  2ETH A;  5AIP A;  1TW2 A;  2FXA A;  2F2E A;  4EMS A;  3Q5F A;  2HS5 A;  4N9H A;  4L5I A;  4FHT A;  3J81 K;  4OOI A;  2STW A;  1B1B A;  3KEO A;  3F8F A;  2D2W A;  1Z7U A;  1EV7 A;  4HV6 A;  3BP8 A;  1KU3 A;  2FEZ A;  3IRQ A;  2VOO A;  1TNS A;  2M30 A;  4A0Y A;  1F1Z A;  3KP4 A;  2XKO A;  4LK0 F;  3K0L A;  3TDZ C;  4GCV A;  4FX4 A;  3R60 A;  1YW8 A;  1HKQ A;  2EV5 A;  1XD7 A;  3HRS A;  1REP C;  1HW2 A;  1FX7 A;  3MZY A;  2ESH A;  1FY7 A;  1RUO A;  2Q0O A;  3F6O A;  1SD4 A;  3CTA A;  1O3R A;  4HQE A;  3GWZ A;  1AOY A;  4Y13 A;  2RQP A;  3MQ0 A;  3DKW A;  4BYY A;  5L3E A;  1O3T A;  4PGH A;  1XDS A;  4HF2 A;  1YYV A;  1TTY A;  1BM9 A;  4M73 A;  2A68 F;  1BIB A;  3IKV A;  4MNU A;  3PQJ A;  4TV7 A;  5HDK A;  3I5U A;  4ZYE A;  4FT8 A;  1QNT A;  3HOT A;  5BPI A;  4XBF A;  1KQ9 A;  5HLI A;  3GZ6 A;  2GA2 A;  3I58 A;  4RS8 A;  5E20 A;  4NHJ A;  1XSD A;  3QU3 A;  4CGZ A;  1ZH5 A;  2XVC A;  2ISY A;  1QGP A;  3QOP A;  1BI1 A;  2Z3Y A;  2IT0 A;  1OYW A;  3OOP A;  2VOD A;  3M7G A;  4R1H A;  2QQ9 A;  3EYI A;  2DK5 A;  1BI2 A;  5BS6 A;  1ON2 A;  1U5T C;  2GWR A;  1K7A A;  3U2R A;  4ZYG A;  3IRR A;  2Q8K A;  3M9A A;  1Z91 A;  2PN6 A;  4EM0 B;  5DUK A;  5HDG A;  2XAF A;  1IF1 A;  1PP7 U;  2L02 A;  3FMR A;  5H6Q A;  2JPB A;  3WOD F;  3NEU A;  4JK1 X;  2LNB A;  2H09 A;  3E6B A;  3ZMU A;  1H9G A;  1L3L A;  3KLN A;  4G6Q A;  3HRU A;  3WE3 A;  5LEJ A;  1XCB A;  5KK1 A;  4LMY A;  2QVO A;  5ILV A;  1VTN C;  3R4K A;  2A69 F;  3GFJ A;  1BBY A;  1OKR A;  3GFM A;  2JSC A;  1MJB A;  3SXY A;  1IN7 A;  1S6L A;  3FF5 A;  2DW4 A;  4Y15 A;  2JRT A;  1L0O C;  1IN8 A;  3HTS B;  4RAZ A;  3N4M A;  1ZGA A;  3DV8 A;  3TOA A;  4M9S A;  2X0L A;  1IAW A;  2EV6 A;  2M87 A;  1XGO A;  3FM5 A;  1LEA A;  2XAG A;  2P7V B;  3HSE A;  3J81 Z;  1KU2 A;  3DXJ F;  1WRJ A;  3REO A;  4G8X A;  5D8L B;  1KYW A;  2QBY A;  1B9M A;  2MBF A;  1UHM A;  4G7O F;  2OD5 A;  3FZV A;  5D5X B;  5TJJ A;  4BAY A;  4PZJ A;  2QBY B;  1D3Y A;  1LDD A;  1I1S A;  1USS A;  1ODD A;  4EJU A;  1BC7 C;  3LAP A;  4CIC A;  3HUG A;  4EM2 A;  2LSO A;  1IXS B;  5LRS A;  2E1N A;  5FLX Z;  3N97 A;  3O2P E;  4M9X A;  2EFO A;  3IC7 A;  1BOA A;  4HZF A;  4WK8 F;  4NQW A;  4OMZ A;  3JAM K;  3ERE D;  1IRG A;  2P8T A;  1UHW A;  3GX4 X;  2VBZ A;  3E5U A;  3GVA A;  2JT1 A;  4B8X A;  5DCM B;  3I59 A;  5H6R A;  5DD4 A;  4MTD A;  3BY6 A;  2ESN A;  1LEB A;  3LST A;  1R7J A;  5EEH A;  5JVT A;  1J2X A;  1J75 A;  5BMZ A;  3I59 B;  1F4K A;  3QPH A;  1SFE A;  4RAY A;  2QZ8 A;  4RB2 C;  1MD0 A;  3V7C A;  2IRF G;  3VB2 A;  2CYY A;  3I0T A;  2G9W A;  4WF2 A;  4IHS A;  2P5K A;  1HQC A;  1B4A A;  2ZXJ A;  2HR3 A;  3F22 A;  1G3Y A;  5L3D A;  3SZT A;  5K5Q A;  1R00 A;  4IRI A;  4P55 A;  2A6H F;  4KYW A;  2K27 A;  4L0Z B;  2HYF A;  4L9V A;  3V7S A;  3V8J A;  4KIC A;  4AD9 A;  2NNN A;  2L54 A;  3SHF A;  2ZNY A;  3HSF A;  3WU1 B;  1ON1 A;  2D1H A;  4QLC U;  4R79 A;  3L2C A;  2DAO A;  4H0E A;  5FFX A;  4QWQ A;  3IKT A;  2PBI A;  3FWE A;  4S04 A;  3H3Z A;  2W84 A;  2OAZ A;  2PG4 A;  2GXB A;  1YW9 A;  1FYM A;  1U3E M;  3K69 A;  3GUD A;  2KIF A;  2DK8 A;  2FBK A;  2E1C A;  4EGY A;  1LDJ A;  3RKX A;  1G6N A;  1ZAR A;  2CQK A;  5DDG A;  2HFH A;  5JHU A;  5L3F A;  1P92 A;  4ZYH A;  4IXA A;  4GO1 A;  3E6D A;  1K6O A;  4YIF A;  2HWV A;  5JI6 A;  4XSZ F;  2OQR A;  1K79 A;  4M71 A;  1LB2 A;  4U0Y A;  4OIR F;  1ULY A;  5D8K B;  1PDN C;  3KP5 A;  2XUB A;  4HOB A;  3HOS A;  1U5T A;  1XGS A;  2KKO A;  2MLG A;  1T2K A;  2FRH A;  1O7F A;  3O6B B;  3KE2 A;  4A5N A;  3DF8 A;  1U2W A;  2Q2E A;  4PGG A;  1TQI A;  1U5T B;  2XHK A;  5CVI A;  3RIR A;  2VBX A;  2ZKZ A;  2CFX A;  1HKT A;  3MFK A;  3LA3 A;  2KRF A;  3T5X A;  3MZH A;  3FMS A;  4U88 A;  4YFN F;  4ENN A;  5CVU A;  2FU4 A;  2OU2 A;  5H20 A;  1XN7 A;  4MQ9 F;  4EJV A;  2VT3 A;  4EGZ A;  2Z9O A;  3DPL C;  1T98 A;  1W7P D;  1ZRC A;  4EJO A;  3KP3 A;  3HIF A;  1SD6 A;  3P9K A;  1R23 A;  1YLF A;  2CSO A;  2STT A;  3R0A A;  4Q47 A;  2V1X A;  4RB3 C;  1EH7 A;  3QP6 A;  1UB9 A;  4RGR A;  4LB5 A;  3JAM Z;  3GYH X;  5K5O A;  2CGP A;  1J59 A;  1LQ1 A;  1SMT A;  3ISP A;  1DPU A;  1OPC A;  3BJO A;  3L00 A;  5LLQ A;  3V4G A;  3E3V A;  2X4H A;  1Q1H A;  3K1N A;  2P4W A;  1XMA A;  3L7W A;  2GXG A;  1G3T A;  3VOD A;  3KP7 A;  4Q4Z F;  3VOE A;  3CUO A;  4WXC A;  2F5D A; 
#chains in the Genus database with same CATH topology
 3B6A A;  5GP9 A;  2M7B A;  3MN2 A;  5IT9 Z;  1YFH A;  4L18 B;  2DYS H;  2X85 A;  4A6D A;  3TO9 A;  3ZQC A;  4BXF A;  4M6X A;  4QSH A;  1GVJ A;  3DTK A;  3OIP A;  4BEH A;  2JN6 A;  2JWT A;  4UVC A;  3BJ6 A;  1QBJ A;  3S15 J;  4NC6 A;  2JVH A;  2L3D A;  3HSR A;  3ZQF A;  3B02 A;  1VFC A;  2YPR A;  5LBQ A;  1S72 I;  4Y33 A;  2TCT A;  2DOF A;  2I8D A;  3GXO A;  4C2T A;  1RKW A;  3CF2 A;  3AFH A;  4HEA 2;  3QRF F;  2DQR A;  2EFN A;  4NC8 A;  4Y4R A;  2ZO4 A;  2Q1Z B;  4KN4 X;  4V2F A;  1OIS A;  4LD5 A;  2N8G A;  3R61 A;  3LQQ A;  1R4M B;  3TW7 A;  5B1A H;  1IRZ A;  1A35 A;  1LPQ A;  3HJE A;  3I4M J;  2MLK A;  4UV9 A;  2KRC A;  4KDP A;  2HPI A;  1FZP B;  2DXI A;  2J5P A;  2XIG A;  3IWF A;  3RSN A;  2M1B A;  5JLW A;  2A5Y B;  2LKS A;  3TW6 A;  4KNY A;  3HGY A;  2L7K A;  4KUM A;  3I71 A;  3JRC A;  5GPA A;  2FD5 A;  3K6G A;  5CJ9 A;  2FML A;  1X3U A;  2DI3 A;  1I6H J;  3GFL A;  2YU9 J;  3X2Q H;  1YS6 A;  3FXJ A;  3ZN0 A;  4F3Q A;  5L3B A;  2JA6 J;  1BOB A;  1YG2 A;  3IV5 A;  4Y7N J;  3OYD A;  1GT0 C;  2CG4 A;  3BQY A;  1MGT A;  1MJA A;  5K1Y A;  2WAD A;  1LNW A;  5FKN A;  2JRM A;  3RDI A;  3W2V A;  2NVQ J;  2V9V A;  4ESF A;  1FNN A;  3ASO H;  1OCC H;  1Z3Y A;  1XGN A;  2F48 A;  1X4O A;  2EFP A;  3PNV A;  3RKW A;  3S1R J;  3DU5 A;  1ETQ A;  2F4O B;  1U8B A;  1WJ5 A;  2BXY A;  5EG0 A;  1U78 A;  4X0G A;  4XNF A;  4HV5 A;  2Z33 A;  3TP3 A;  4L9T A;  2VXD A;  1FP1 D;  2K4J A;  1DGR M;  4JBA A;  5J8F A;  2EIK H;  5IYC J;  1FMW A;  2LRE A;  2RKH A;  2MD5 A;  5F0F A;  2PMZ A;  5EG0 B;  1QHH D;  5FFZ A;  3SEQ A;  2YU3 A;  2JA5 J;  4DGW B;  2K02 A;  1GXP A;  1UHS A;  3FIW A;  1ETO A;  1IV6 A;  3FHZ A;  2WAE A;  1OR7 A;  5ILS A;  4B44 A;  1AHD P;  4XRS G;  1X4P A;  5EGO B;  1S29 A;  2HQR A;  1V5E A;  2KLO A;  3BTL A;  4CYC B;  3EUH C;  2M0C A;  4P5O A;  1MH4 A;  3SFI A;  4HLX A;  5M3F J;  1R49 A;  4F55 A;  4HBL A;  3KIO A;  3KX2 A;  5KCM A;  1DDN A;  1DPR A;  2M8G X;  3NQO A;  5ICE A;  4HX8 A;  4A0Z A;  3BR2 A;  3H3V K;  5ERI A;  1BIA A;  1HW5 A;  2VUM J;  1W0T A;  2XSD C;  1C0W A;  1G4D A;  3HYI A;  3WTU C;  2O6G E;  1GVD A;  3JRG A;  4AC0 A;  4Q48 A;  2FBI A;  1ZG3 A;  3MZ8 A;  1MMN A;  4IJA A;  3RQI A;  4ZZL A;  3H35 A;  1TWF J;  4L9N A;  4A3G J;  1IUF A;  3Q9V A;  2V6C A;  2QCO A;  2HQN A;  1O3Q A;  1IN5 A;  4P96 A;  4XLC A;  3CUQ C;  1U0J A;  1YIT I;  2FE3 A;  2AXL A;  4NB5 A;  1S7A A;  4PJ0 C;  1ZRD A;  4U0V A;  3A01 B;  5CVJ A;  3FXR A;  1SVO A;  1V5G A;  3I54 A;  2LC2 A;  3N05 A;  3E97 A;  5HDN A;  3BG7 A;  4OIQ F;  3JSP A;  4BHB A;  2LK2 A;  3OL4 A;  4CHU A;  3LNQ A;  3RPU A;  1D0Z A;  4YEL A;  4KT5 C;  3BTI A;  2CJJ A;  5IOY A;  1IUY A;  3LMM A;  1FP2 A;  1ZEL A;  4M74 A;  4IVN A;  4HX4 A;  2XGX A;  4ENK A;  1WSU A;  3L2V A;  4I09 A;  4CO8 A;  4FQG A;  4UXN A;  1HW1 A;  3DBH B;  3DLL F;  4PFO A;  2DYR H;  2EQR A;  2V79 A;  4KIS A;  4EEF G;  3T1B A;  1X1P A;  1Y39 A;  2KJC A;  3F3X A;  4AIH A;  5J8C A;  1QHG A;  1Z6T A;  4Z2Y A;  3L09 A;  4E7H A;  2K9M A;  2CS3 A;  2RN7 A;  2DTR A;  3AL0 C;  5LHI A;  1FOK A;  3C7J A;  2CUZ A;  1FBU A;  3SYT A;  4BQO A;  1WH7 A;  1NG7 A;  3ABK H;  3BC8 A;  4YII A;  2ZSH B;  1G3W A;  2KRH A;  2M4K A;  4ESB A;  2UUZ A;  1D8J A;  1ORK A;  2RC4 A;  3D0S A;  2LP0 A;  2YR2 A;  3BCA A;  4BU2 A;  4E7I A;  1ZRE A;  2Y0M A;  1Y0N A;  4RB0 A;  4ZC3 A;  2E1O A;  4EAT A;  4HSR A;  4KFC A;  3ZMZ A;  2E35 A;  3LSG A;  2K4B A;  1HA8 A;  2XAS A;  2QQB A;  4B47 A;  4BNC A;  3J80 Z;  2TDX A;  2OBP A;  1GV2 A;  2EZL A;  3HPG A;  1IXC A;  2FBH A;  2LBF A;  3EUA A;  4EJT A;  3DEU A;  4O5V A;  4GYI A;  3TQN A;  4CZZ A;  1ZRF A;  2EH3 A;  2BEO A;  2CUJ A;  1Y0U A;  2P5V A;  3E5Q A;  4M9Z A;  1X19 A;  1UEL B;  1I6X A;  4RAG A;  2LMD A;  4ENJ A;  5LGU A;  4DQ2 A;  4F91 B;  2DA6 A;  1PUF B;  3E7L A;  3DEE A;  3FBI B;  3LA7 A;  2L01 A;  5AIQ A;  4MFD A;  1KZH A;  4RGX A;  1K78 B;  2WC2 A;  4A0X A;  5CQE A;  4E6K G;  3DFG A;  5EYR A;  1WHU A;  2NRA C;  2Y9Z A;  2A6E F;  2L4A A;  4IX7 A;  5HNF A;  2E1M C;  4BDZ A;  1UFM A;  3IHU A;  2P6S A;  4YFX F;  1T39 A;  2CQQ A;  3PUB A;  4HDU A;  3IP4 B;  5F1J A;  1D1A A;  2DO7 A;  3DQV C;  1LVA A;  4KMF A;  2ME6 A;  4HA8 A;  2HPM A;  3K1P A;  3OYM A;  2ZME B;  1TNT A;  4LIU A;  1LJ9 A;  4LLG F;  3RKY A;  3VFZ A;  1K4S A;  3DKY A;  1T33 A;  5DCF A;  3I56 I;  4IHT A;  4NDL A;  2LOO A;  2E2I J;  1CGP A;  2GIV A;  4BHP A;  1VZ0 A;  3VWB A;  4AIJ A;  1JKP C;  3SFZ A;  3PO3 J;  1D1C A;  2MD0 A;  2A07 F;  3S2H J;  1XSX A;  1I3A A;  4KT6 A;  1MH3 A;  5HS9 A;  3KP2 A;  5FD6 A;  4BDY A;  5BOX A;  1R5I D;  1VQ4 I;  3LWF A;  3Q0W A;  4S0H B;  1Z0X A;  2E7W A;  1VND A;  4M3F A;  1D8K A;  5DCM A;  4B3A A;  4B09 A;  1IN6 A;  2V1U A;  1ZYR F;  1QZE A;  3HZJ A;  3AG1 H;  1J9I A;  4M3D A;  3V8L A;  2NNY A;  3BTC A;  3ABU A;  4LLN A;  4JX5 A;  1BI3 A;  3RYR A;  4A12 A;  1RI7 A;  2FSW A;  4AVP A;  3Q0V A;  2M3A A;  2NYX A;  3FXO A;  5E1W A;  3T8T A;  2QLZ A;  2XRO A;  2BVL A;  3NRV A;  2K3P A;  1WJE A;  3MD2 A;  2H27 A;  3CC4 I;  4HYE A;  4A2U A;  2BV6 A;  1XPX A;  3ERM A;  4AID A;  2H6B A;  3KZI C;  3ZPL A;  1WI9 A;  2L9V A;  1OCO H;  2M34 A;  2Y30 A;  5E3N A;  2HTS A;  5HLG A;  3DP7 A;  5E3M A;  3BT9 A;  2X48 A;  2O9L A;  1RC9 A;  2QKM B;  2JZY A;  1WJC A;  2D1V A;  1Z9C A;  5GAE J;  2Z1D A;  1MW7 A;  5FLV A;  1X1A A;  5M5W J;  2JPC A;  5F64 A;  2Z99 A;  3GTM J;  3SDB A;  5FLM J;  2W00 A;  1PUE E;  2M0M A;  4BKX A;  3WTY C;  2MC4 A;  3ZGK A;  3W2A A;  4BXX J;  1ETW A;  5J4V A;  1RUN A;  2Z2S B;  4N0B A;  5BQT A;  1APL C;  2X1E A;  2MC3 A;  3G73 A;  5HVQ C;  3GW2 A;  1Z05 A;  3RPQ A;  4BL0 B;  5F04 A;  2QQ8 A;  4D1Q A;  4P9U A;  2CO5 A;  3ML6 A;  4P9F A;  1WJD A;  1N25 A;  1X1B A;  2CQ7 A;  1OR7 C;  3JRE A;  4RGU A;  2LDU A;  3H9G A;  5FD5 A;  4F92 B;  1S7E A;  3SEZ A;  2P5L C;  1R71 A;  3ABT A;  1KA8 A;  3HGG A;  4UY8 I;  2AS5 F;  3CO7 C;  2CRG A;  4WWC A;  3G71 I;  3SZP A;  2K9S A;  2DFI A;  4G7H F;  2V4J C;  4XRF A;  5FB2 A;  3IUO A;  2LRD A;  3FM3 A;  1PJR A;  3FXQ A;  3ULQ B;  5ED4 A;  2NAZ A;  3HRM A;  3MWM A;  3ZP5 A;  2JK3 A;  4E70 A;  1JHH A;  2DTZ A;  3CES A;  2AHQ A;  4E7S A;  3D1N I;  5KVR A;  3P5J A;  1T38 A;  3BR5 A;  1LFU P;  4XID A;  1YRN A;  2OCC H;  1X2M A;  3QWL A;  4ESJ A;  1B9N A;  5DYM A;  4HF1 A;  3CCR I;  1Z6R A;  2W85 A;  3TBI A;  3GLL A;  2DU9 A;  3PFI A;  4B3X A;  4FCY A;  4I2O A;  1JXS A;  2OCE A;  1MJ9 A;  3OS1 A;  1H0M A;  4RGS A;  3M1C A;  4QPQ A;  5ICC A;  1WWX A;  2R7D A;  3LSJ A;  4I0B A;  1YJN I;  1MMG A;  1QQI A;  1W5S A;  3K4J A;  5DV5 A;  2QUF A;  1QVT A;  4JX4 A;  2ZSI B;  2KFD A;  2WTE A;  2PEX A;  2XRN A;  2F5C A;  1EH8 A;  1TWC J;  2W82 A;  3EUH A;  2Y0S A;  3K4C A;  4DOZ A;  1RET A;  2CW0 F;  1EJ9 A;  3KP6 A;  2ZCW A;  4A6E A;  2MGQ A;  1X58 A;  2IJL A;  3DTI A;  4OIP F;  1BW6 A;  3G3Z A;  2K7L A;  3M3Y J;  3TMO A;  2F4I A;  3JSO A;  2WAQ A;  3H9Q A;  1WJF A;  3LL7 A;  1R36 A;  4LFU A;  5KHD A;  1TBX A;  1K83 J;  1ZGJ A;  1B72 B;  4MLO A;  5LGT A;  1YIO A;  5LEK A;  1IC8 A;  2DMN A;  5M5Y J;  4HG2 A;  2GAU A;  3F8C A;  3C1D A;  5ILU A;  5HS8 A;  4MEX F;  2OZ6 A;  2VBY A;  3WG9 A;  5AON A;  2XV4 S;  2XSJ C;  1RZ4 A;  3ZOB A;  2ID3 A;  1ZHF A;  2CQN A;  3COA C;  4IF4 A;  1FBS A;  2VLA A;  2LKP A;  2ECC A;  3KYD B;  2DPU A;  1B59 A;  3CUQ A;  1FYK A;  4BJ6 C;  3HDD A;  2HGC A;  4NC7 A;  4KN7 X;  4HLY A;  2W25 A;  3I4P A;  3OYI A;  4I01 A;  2VE8 A;  3GTG J;  1NK3 P;  2BZT A;  4F7Z A;  3T0Y A;  3VSK A;  4LIT A;  3CJN A;  4HF0 A;  5E8G A;  4CA0 A;  1WJA A;  3IH4 A;  3CUQ B;  2VQH A;  5IP9 J;  3CO6 C;  2M45 A;  3EYY A;  1HXD A;  2X51 A;  1H9T A;  4QTR A;  2VQC A;  3OV8 A;  2HZD A;  4A3M J;  1JUM A;  4I98 B;  1R9T J;  3K1M A;  2ISZ A;  3U1K A;  1I50 J;  3AG2 H;  4BH9 A;  4BBR J;  2H6C A;  4UB6 C;  4N4O B;  1I1G A;  2Z16 A;  3ZXS A;  1FBQ A;  1ZK8 A;  1SFX A;  2P7C B;  1MBH A;  1LDK B;  1ETV A;  1FC3 A;  5F6F A;  3V7R A;  2IS2 A;  1S8N A;  3ELK A;  3T8R A;  4CZC A;  2ZME C;  3CCS I;  5IYD J;  2ZJP F;  5C3E J;  3E5X A;  3QP5 A;  3TGN A;  2E34 A;  4EM1 A;  4A3L J;  2R5Z A;  4CCN A;  4ETS A;  1EH6 A;  2HYJ A;  3OMY A;  1OCP A;  2O0Y A;  3QPT A;  1E3O C;  3AL0 B;  3W6K B;  3FXU A;  3C2G A;  2BE5 F;  5J1Y A;  1VQ9 I;  1WPK A;  1DP3 A;  4MIM A;  4F52 A;  6PAX A;  2VC0 A;  4MGR A;  4LK1 F;  3JRB A;  2R5Z B;  2DBB A;  1F43 A;  3JTH A;  3DPT A;  1M1E B;  3L2W A;  5D4R A;  3OYF A;  2VJ5 A;  1VQ7 I;  2L4M A;  2GZW A;  3KLO A;  3BG5 A;  2X1C A;  4IPA A;  4S05 A;  3KET A;  3F8B A;  4X1E A;  5GAG J;  1ZAO A;  3K70 D;  3KCC A;  2H1K A;  2VKE A;  4CDG A;  4UUS B;  4UUT A;  1FYL A;  1BJZ A;  2XAU A;  3HBL A;  4DBQ A;  5HLH A;  5F27 A;  3F6V A;  5EF6 A;  5D5W B;  1HSJ A;  3H9J A;  5B66 C;  5DD8 A;  5JHF A;  3TO7 A;  2ZXI A;  3M8F A;  3TOB A;  4DW6 A;  1F5T A;  2DQL A;  4CXF A;  3HTU A;  3V42 A;  3SJM A;  4Q5S F;  2NS0 A;  1U9N A;  4RM2 A;  3E6M A;  2R7X A;  4LG0 A;  2EBI A;  3H5A A;  3O3K A;  3VYR B;  1JKO C;  1WQ2 A;  2ICW G;  2L0K A;  4AYB A;  2GIZ A;  1WI3 A;  3OYJ A;  3J7A Y;  1KGS A;  1QVU A;  1BL0 A;  2IS6 A;  1KQ8 A;  2CW7 A;  2IVM A;  3PIP F;  3I64 A;  1O3S A;  3PL8 A;  4HX7 A;  4LG0 B;  2VJJ A;  3GZ5 A;  1WVR A;  2LH9 A;  3AAF A;  1TC3 C;  1X1D A;  5K7F A;  4J01 A;  2FMY A;  2DJN A;  4LB6 B;  2WY8 Q;  2Z5U A;  2NVX J;  3BQZ A;  2ACJ A;  2E1M B;  1D0Y A;  2HKO A;  2KIS A;  2L5Q A;  3BOQ A;  1Y8Q B;  3GME A;  3ZMD A;  4M72 A;  2DPD A;  1ACI A;  2MH9 A;  1IRF A;  3GCM A;  5IP7 J;  2F5E A;  2IP2 A;  1TP4 A;  3F21 A;  5EEG A;  2PI0 A;  2OQG A;  5E17 F;  3D5L A;  4UUV A;  1YQA A;  1X1C A;  3CQZ J;  3LSP A;  4GGG A;  5LD2 C;  1OYI A;  5E1X A;  4E4H A;  1A36 A;  3U9G A;  1BN5 A;  4XLN F;  3FXK A;  2VE9 A;  5M5X J;  4YG2 F;  3DEW A;  4QPO A;  1I5Z A;  2QA4 I;  3ZMV A;  1MNM C;  3HRT A;  4OIN F;  2RQQ A;  1U9O A;  3LA2 A;  3PQK A;  2FNA A;  2VBW A;  2WWY A;  4D7M A;  2OC6 A;  2O3F A;  1QZZ A;  4A3D J;  2XPV A;  3H36 A;  2DT6 A;  5EDN A;  5IYB J;  3O8G A;  1V4R A;  1G59 A;  5E1Z B;  4B48 A;  3ECH A;  1JGS A;  5EZH A;  1O4X A;  1H89 C;  4NUB A;  2IS1 A;  5C44 J;  3EDP A;  3CCJ I;  1SFO J;  4OIO F;  3HC7 A;  4GDF A;  5K7H A;  3HOV J;  1PVE A;  5J47 A;  4XIC A;  5CYV A;  3C2B A;  1J5Y A;  3L2U A;  1R4N B;  1KU9 A;  3CD6 I;  3WTZ A;  1PYV A;  4II3 A;  4D0P A;  2LY9 A;  2ZJR F;  1SVM A;  4L5J A;  4BY1 J;  2V9P A;  2JMW A;  2UXX A;  2DLL A;  4A5M A;  3GZN B;  2BYV E;  2C6Y A;  5FKO A;  1R5G A;  4DBR A;  3HHG A;  4UB8 C;  2KP6 A;  3CC7 I;  3JW4 A;  5FLX K;  2R7F A;  4XOP A;  1KU7 A;  2EIL H;  4UVB A;  3B73 A;  4WXD A;  1IW7 F;  5EEA A;  2GOM A;  1YIJ I;  4RB1 A;  5JLX A;  3ZMT A;  3RZD J;  1DQU A;  1ZN2 A;  2UV1 A;  2ZFW A;  2COB A;  5EGO A;  1OCT C;  2KDO A;  2NVY J;  4C9Y A;  4CYC A;  2RVC A;  5D6F A;  2HVS A;  1SMY F;  1TQM A;  2HOA A;  2Y48 A;  2COM A;  4G7Z F;  2VN2 A;  2ME0 A;  1WKM A;  3CCQ I;  2R7T A;  3ROU A;  4WXH A;  2DDA A;  1Q1V A;  5D5U B;  3CLQ A;  5FGM A;  3RI4 A;  3A02 A;  3HL2 A;  1WFX A;  3A0H C;  2XAH A;  2YSR A;  2EFQ A;  4RDU A;  1FIA A;  3VYT B;  4AIK A;  3CME I;  3H5N A;  5A2Q K;  2RNJ A;  3CDH A;  3L9F A;  4ZTF A;  2H8W A;  2IW5 A;  3HM5 A;  3MKL A;  2GA1 A;  2IA1 A;  1T0F C;  5CVV A;  2QYO A;  3LFK A;  2KJB A;  2YX4 A;  1MNE A;  2RNG A;  1JE8 A;  1XSV A;  3A2K A;  2P6T A;  3HOY J;  1TWA J;  1POG A;  1RKT A;  1MMA A;  1MZB A;  2VKD A;  2HDC A;  3SQN A;  2HI3 A;  3OYK A;  5DM6 F;  4HRI A;  4XSX F;  2UZK A;  1XMK A;  1RES A;  3CP8 A;  4KMU X;  3IH3 A;  2ZJ2 A;  1E3H A;  4O6J A;  2VPL A;  3A01 A;  4BJ5 C;  1B8I A;  1HST A;  4MHG A;  4LLL A;  5HNH A;  5F0H A;  3F8M A;  4L5E A;  4HNU A;  3W6J B;  4XLP F;  2BY2 A;  3QAH A;  1IZ1 A;  1RIO H;  3WTW C;  4CCO A;  1QA6 A;  4CUG A;  3G4S I;  4Y3O A;  1XS9 A;  4CYD A;  5C4X J;  2DFH A;  2FF4 A;  4MEY F;  4AWX B;  3S2W A;  3PJR A;  1TZL A;  3S32 A;  2WV0 A;  1B8I B;  1W4M A;  2XF5 A;  2R0Q C;  3MEX A;  3CMM A;  2DT5 A;  1O7L A;  3CF5 F;  2BY0 A;  2W7N A;  3FMQ A;  4GXO A;  1R1T A;  4M6Y A;  1T6S A;  1P6R A;  1K61 A;  2MG4 A;  4E7K A;  3LFU A;  1TW3 A;  3AG3 H;  3E1S A;  3WGG A;  2EFW A;  3FXL A;  3KZY A;  3I9V 2;  3WHC A;  1ETY A;  4OMY A;  2VC1 A;  1V3F A;  3C18 A;  3IWZ A;  4C30 A;  4ZZD A;  2BHZ A;  2XGC A;  1JT0 A;  4AUX A;  2FQ3 A;  2E7X A;  1IJW C;  2EA2 A;  4PJN A;  4MFE A;  4GFB A;  2LF7 A;  2FOK A;  1V55 H;  1HDD C;  2NOJ B;  5E18 F;  3WTT C;  2DOA A;  2R3S A;  3OYL A;  3M1E A;  2G7H A;  2EK5 A;  3DTE A;  3L1P A;  3JTG A;  1VQ6 I;  1S3J A;  2HKX A;  2VXZ A;  3GTJ J;  5FRO A;  2HQ5 A;  2VKH A;  4DNC A;  3CCV I;  4KA4 A;  2Y75 A;  4ZTJ A;  1T08 B;  2EA4 A;  2M7A A;  2PFB A;  3ECO A;  3CCL I;  1G2H A;  2OA4 A;  1S9H A;  1XMX A;  5FKK A;  3I3L A;  4JQF A;  1B6A A;  2IA0 A;  1ZG5 A;  4ZYD A;  1DP7 P;  2IGM A;  1JHF A;  4W1U A;  2A05 A;  1XDU A;  2WB1 N;  2Y31 A;  2E5Z A;  3WGH A;  1FOW A;  1PUF A;  1IRX A;  3LSM A;  5LRR A;  4CCM A;  3UKG A;  3HEF A;  1K78 A;  3RYP A;  4ON0 A;  3S3M A;  4K2E A;  2QKL B;  3SDG A;  3VYS B;  3R0J A;  2W57 A;  4OU0 A;  1YI2 I;  2JA2 A;  1OYY A;  4GYG A;  2AXT C;  4HW0 A;  1W7P A;  3WTV C;  2IA2 A;  2QSH X;  3EQL F;  4XN0 A;  3WTX C;  5D4S A;  3K4N A;  1ZR2 A;  4A69 C;  2VOP A;  4XL9 A;  1FWZ A;  2A3S A;  2QF7 A;  3WTS C;  1HOM A;  1XB4 A;  4KIG A;  1VQM I;  2HVR A;  2H8R A;  5IPA A;  1LKX A;  4BS9 A;  3BRO A;  1F9N A;  3K7A J;  2M2E A;  1W7P B;  2F5V A;  2ZME A;  4YIR X;  5BPD A;  1FOX A;  4G9Y A;  5J6X A;  1S7O A;  3D5R C;  3IL2 A;  3BCB A;  5KAI C;  3JCU C;  3GTL J;  2VJI A;  4A3B J;  2YX7 A;  2VKV A;  1QPM A;  3S1M J;  1MDM A;  1HCR A;  4IZZ A;  2EIM H;  3G1O A;  3HOW J;  2LF8 A;  1WGX A;  3GLX A;  3PM1 A;  4ZH4 F;  1VQP I;  3ABL H;  4LOC A;  5TRD A;  2R7O A;  1YO5 C;  5JFR A;  2CFO A;  1NK2 P;  3Q9S A;  1R5H A;  4U7D A;  2VQG A;  4UVA A;  4DIQ A;  1MDM B;  3BPV A;  1UST A;  4BE1 A;  3K2Z A;  2MSY A;  4KIF A;  3ZQ7 A;  3NWT A;  1UJ8 A;  3VDX A;  4CSW A;  3ZN1 A;  3E6C C;  2MA3 A;  1FSE A;  1NHA A;  2EJR A;  2IPQ X;  3MCZ A;  1W1W E;  1ZLJ A;  4IRH A;  4BQA A;  2PLY A;  5E79 C;  2K40 A;  3GFI A;  4IHV A;  3FX3 A;  4XKB A;  5ICF A;  1ZLK A;  3I4N J;  1XCV A;  2MH2 A;  4Y17 A;  1A04 A;  3UR3 C;  2DA3 A;  2UWM A;  2WA0 A;  2IAI A;  4FX0 A;  4IRG A;  2FX0 A;  5B1B H;  2UXN A;  2Y2Z A;  4BXU A;  2D45 A;  3QPS A;  3W3C A;  1H8A C;  4UHT A;  2H94 A;  2V1D A;  2HZT A;  3WE2 A;  4XLH A;  3TED A;  1VF9 A;  3V8K A;  2QQA A;  2M5W A;  5D5V B;  1SVL A;  2XAJ A;  2NVU B;  1IO2 A;  2JA8 J;  3K4K A;  1R1U A;  3MAJ A;  3VYU B;  2Y69 H;  2MFZ A;  3I53 A;  3BR0 A;  1V5F A;  2L7Z A;  1T56 A;  2ZFU A;  3DLA A;  3HUG B;  3HKZ N;  3H5R A;  2F5F A;  5HOO A;  3LOC A;  2V9K A;  1GV5 A;  4UNO A;  1YS7 A;  3KFW X;  2AQE A;  5CVR A;  1FLI A;  2ZNZ A;  1TLH B;  1ZGW A;  3KZZ A;  5CLS A;  3K9T A;  1XX5 A;  2J5O A;  1W36 D;  4MQV A;  1SD5 A;  3RCO A;  1GHC A;  2LVS A;  2W24 A;  3K4B A;  1IDY A;  1Z7L A;  2EB7 A;  1QPI A;  1JTX A;  4XK4 A;  3WGI A;  5GAH J;  1J7K A;  3U1D A;  1HDP A;  3PFY A;  2OPT A;  5A2Q Z;  1KYZ A;  1U6G A;  1FIP A;  1Y8R B;  2EWN A;  1O57 A;  4CCJ A;  2FA5 A;  2XAQ A;  3F8N A;  4I02 A;  1SFU A;  2RV8 A;  4EJW A;  4WX9 A;  4E7J A;  4II2 A;  3L2R A;  2HVQ A;  1GLN A;  4FIS A;  3VSL A;  1FTT A;  2R7V A;  4HAM A;  2DFE A;  3P9I A;  2HOS A;  2O5R A;  1KQ0 A;  1NG6 A;  3GEZ A;  4BJT A;  1R58 A;  4IHY A;  1OCZ H;  1S5L C;  4LGW A;  5H2F C;  2WBM A;  5IT9 K;  4C2M J;  2LLK A;  2VIX A;  2CV0 A;  4FE4 A;  4G94 A;  1MKM A;  2OZU A;  3PUF A;  5K5R A;  3KYC B;  2IGO A;  2RAE A;  1LE8 B;  1E17 A;  2HTJ A;  4NNJ A;  3K10 A;  1W0U A;  2HEO A;  4PSW A;  3HOX J;  3I55 I;  1H88 C;  3H0D A;  1ERD A;  5DM7 F;  2WAF A;  2QM3 A;  4IHX A;  3FDY A;  1HKS A;  4XM3 A;  4YFK F;  3GO5 A;  4HQM A;  3ZCO A;  4U7B A;  1R22 A;  3FIS A;  1LUJ B;  2G7U A;  2HOE A;  1XGM A;  2DA5 A;  1SFK A;  2CWE A;  4YRV A;  2O8X A;  3K4M A;  1A6Q A;  3CLO A;  1PP8 F;  2DA2 A;  2IXS A;  4L0Y B;  3J7A O;  1E0E A;  3C3W A;  3H3U A;  3LQR A;  3FXM A;  2OV7 A;  5HLT A;  4LJZ F;  5FO5 A;  1ITY A;  3F23 A;  3BJA A;  4XQF A;  4I7H A;  2BGC A;  2A61 A;  3QYF A;  5LHH A;  1N75 A;  2DDB A;  3C2H A;  5DEQ A;  2GQQ A;  3ZMS A;  4U0W A;  3WU0 A;  1MIJ A;  1ONV A;  3P7N A;  2B0L A;  2VL8 A;  3BR1 A;  5JR3 A;  3S17 J;  2P81 A;  1D1B A;  1B72 A;  2PQ8 A;  4AYB N;  4DYR A;  5TIS C;  3BDD A;  4CCK A;  2ID6 A;  1T0F A;  2RGV A;  5DUI A;  1IN4 A;  3H92 A;  3KEY A;  1F36 A;  4C3J J;  4XKV A;  1R1V A;  2HNH A;  3BWG A;  1VQK I;  4B4C A;  1SAU A;  1P4X A;  3R6S A;  5IOZ A;  1UMQ A;  1FOY A;  2PMU A;  3MVP A;  4PUS A;  1QZY A;  1P2F A;  3TO6 A;  5FJ8 J;  4EQQ A;  3QPL A;  2R92 J;  2MW8 A;  2RDP A;  4R8H A;  2I5U A;  1YTY A;  1UCR A;  2JTV A;  2KIM A;  4C2U A;  2EV0 A;  1A31 A;  1WJB A;  4IO9 F;  3RPU D;  2ECB A;  1YW7 A;  3EET A;  4O3M A;  1I27 A;  3KYL A;  1W5T A;  2XF6 A;  4I6Z A;  2PJP A;  2HYG D;  5F1R A;  3KEQ A;  4EVI A;  1P7I A;  5E8I A;  3HOU J;  1TT5 B;  2A5W A;  4PJL A;  4KIB A;  4XR6 A;  2ZB9 A;  1GUU A;  5L3G A;  2HXI A;  2DMU A;  3BPX A;  4XLA A;  1JUP A;  1MBF A;  2FNP A;  1HBX G;  1JUS A;  1P4A A;  3F72 A;  3J7Y J;  3OYE A;  1P9Q C;  1FPQ A;  1JTY A;  5LFA A;  3MKW B;  1J0R A;  4HDV A;  2XB5 A;  1Z1D A;  2ELH A;  1P4W A;  2LY2 A;  5HS7 A;  4XKW A;  1SD7 A;  1W5C C;  3RTR A;  2X9D A;  3NWS A;  5ICG A;  2IEK A;  3ZQH A;  3EUK L;  3U21 A;  3OYH A;  1CF7 A;  4ASN A;  3VEP A;  4W97 A;  5L3C A;  2B9S A;  1ZR4 A;  1MBE A;  1QO0 D;  3QQA A;  2VT2 A;  2QWW A;  4U87 A;  2BXZ A;  1D5V A;  1OMI A;  1U8R A;  4IQ4 A;  5E3L A;  3W2W A;  4EV0 A;  3K70 C;  3OIQ A;  2DMQ A;  2O61 A;  3H1C A;  2XB0 X;  1RRJ A;  1CF7 B;  3ZRG A;  2QEN A;  4UUS A;  1ZG1 A;  1WH5 A;  1BI0 A;  2KT0 A;  4UV8 A;  2QSG X;  4BHC A;  1JGG A;  4ABZ A;  1DU6 A;  3LSR A;  1RNL A;  1D5Y A;  3S2D J;  5K7Z A;  3TP0 A;  1IXR C;  5IY5 H;  2BVM A;  3IAM 2;  1Z77 A;  3BZ6 A;  4XLE A;  3CDI A;  2K86 A;  4ENM A;  3LAJ A;  1FSH A;  4MTE A;  3TDU C;  3AKZ A;  2PMZ N;  5D6E A;  3CCU I;  1ZKG A;  1GXQ A;  4PDK A;  4G6D A;  5IT3 A;  5LGN A;  4N9I A;  3M07 A;  2OJE D;  4I0A A;  3F9K A;  2O03 A;  3GF2 A;  5LHG A;  4PCQ A;  4ZJZ A;  2JQ7 A;  3RKQ A;  2ZBK A;  1BJA A;  3HPH A;  2WY7 Q;  4ITV A;  3P9C A;  4Z6Y A;  4H4K C;  2ADU A;  3QOD A;  2MYS A;  1STZ A;  1AWC A;  2VON A;  1YJW I;  3M8E A;  3JRF A;  3GTQ J;  2BY1 A;  2H1L A;  1SAX A;  2HQA A;  3FKI J;  4L9J A;  2VB6 A;  3RJP A;  1TWG J;  2K9L A;  3HOZ J;  2K85 A;  4E7L A;  1BC8 C;  2EZH A;  2XKP A;  2BBY A;  1E2X A;  3DBL B;  1FT9 A;  4JP0 A;  4WCG A;  3FK6 A;  3HHH A;  3J80 K;  1Y1W J;  3G1L A;  2KIU A;  4ZYA A;  2KIQ A;  4DYC A;  5EJC A;  3OR2 C;  5FKL A;  4M3E A;  1DU0 A;  1TQP A;  1MBJ A;  1G3S A;  2JSP A;  3OSF A;  4IQJ A;  3CCY A;  1WZ2 A;  3QU6 A;  2FQ4 A;  2M4G A;  2M8E A;  2JVG A;  2PMH A;  3MKZ A;  3D5S C;  1IG7 A;  1DUX C;  4AVZ A;  3TKY A;  3ZQG A;  3HB9 A;  2ETH A;  2DOE A;  3BZC A;  5AIP A;  1TW2 A;  5GTI C;  2FXA A;  1FMV A;  3WHB A;  4B43 A;  2F2E A;  4EMS A;  3Q5F A;  2HS5 A;  4N9H A;  4L5I A;  2NS8 A;  1Y56 A;  2LR8 A;  5EZG A;  4FHT A;  3J81 K;  4OOI A;  2V7F A;  3MKY B;  1T95 A;  2DA4 A;  4GRI A;  2IS4 A;  2ZXH A;  4AU7 A;  2STW A;  1B1B A;  3WU2 C;  3KEO A;  5HOD A;  3JR9 A;  2XF7 A;  3F8F A;  1D0X A;  2LY1 A;  2DCE A;  4IOC F;  3GBG A;  2L9N A;  4JYK A;  2D2W A;  4CCL A;  3CMA I;  4P1W A;  4BEH B;  1TWH J;  1Z7U A;  4D5C A;  1EV7 A;  1HF0 A;  4J19 A;  4HV6 A;  3BR6 A;  3IH2 A;  3BP8 A;  4HNT A;  1KU3 A;  2FEZ A;  3OSG A;  2R93 J;  5B5E C;  3IRQ A;  2VOO A;  4DYQ A;  4BBS J;  4KJZ A;  1TNS A;  4NBQ A;  2HXO A;  2M30 A;  4A0Y A;  4OWR B;  5IP6 A;  1F1Z A;  2KL4 A;  3KP4 A;  2XKO A;  4LK0 F;  1ENH A;  3K0L A;  3TDZ C;  3G1M A;  4GCV A;  4FX4 A;  5JVG F;  3JRH A;  1YOV B;  2E71 A;  1E3P A;  2KZG A;  3OS2 A;  3R60 A;  1YW8 A;  1HKQ A;  2EV5 A;  4G6T B;  4J00 A;  1YHQ I;  1XD7 A;  1VQ5 I;  1AKH A;  1OFC X;  3BR3 A;  3HRS A;  3LSH A;  1REP C;  1ETK A;  1HW2 A;  3S16 J;  1FX7 A;  2KHM A;  4PFP A;  3MZY A;  2ESH A;  3HG9 A;  2HDW A;  1FY7 A;  1RUO A;  1MSE C;  2Q0O A;  3F6O A;  1VQL I;  1SD4 A;  1IV8 A;  2DJI A;  3PSF A;  4A3E J;  3CTA A;  1AKH B;  1O3R A;  4DZP A;  4FTH A;  2DA7 A;  4HQE A;  3GWZ A;  4IHW A;  1AOY A;  1TT0 A;  4Y13 A;  1QRY A;  2RQP A;  3MQ0 A;  1JT6 A;  3JRA A;  3DKW A;  4BYY A;  5L3E A;  4C3H J;  2DN0 A;  1O3T A;  4PGH A;  4QIW N;  1XDS A;  2LKX A;  4HF2 A;  1YYV A;  1TTY A;  1P7J A;  1T8I A;  2EPF A;  2DA1 A;  1BM9 A;  2W4S A;  2A68 F;  4M73 A;  1FJL A;  1BIB A;  3IKV A;  2XGD A;  2PJR A;  1JKR C;  4MNU A;  3PQJ A;  3CDL A;  4TV7 A;  3FK7 A;  2V26 A;  4CH7 A;  5HDK A;  3ASN H;  3I5U A;  4ZYE A;  1J09 A;  4XRM A;  2R7Q A;  4LIV A;  4XMY A;  2CQX A;  5CPR B;  4FT8 A;  2YS9 A;  1QNT A;  3HOT A;  2ZC2 A;  5BPI A;  4XBF A;  1KQ9 A;  2R5Y A;  5HLI A;  1OCR H;  2NVT J;  3GZ6 A;  3M4O J;  2GA2 A;  3I58 A;  4RS8 A;  4PJM A;  2JUC A;  5E20 A;  2PJR B;  4NHJ A;  4C3I J;  3QU3 A;  1XSD A;  4CGZ A;  1ZH5 A;  2OF7 A;  3Q3S A;  1HC8 A;  2XVC A;  1OQY A;  4RM3 A;  3ZQQ A;  2ISY A;  3TL4 X;  1MND A;  2F4M B;  2Y9Y A;  3LSI A;  2R5Y B;  1QGP A;  3QOP A;  1BI1 A;  2Z3Y A;  4RMN A;  2IT0 A;  2R4G A;  2OUM A;  1XG1 A;  1OYW A;  3OOP A;  5C4J J;  2L9S A;  2VOD A;  3M7G A;  2AO9 A;  2QGU A;  4R1H A;  2QQ9 A;  2GXA A;  1A6I A;  3EYI A;  2DK5 A;  5CQG A;  1ETX A;  1BI2 A;  1X3W B;  5BS6 A;  3JRD A;  1ON2 A;  1U5T C;  2GWR A;  1K7A A;  3CC2 I;  3J7Z I;  2JA7 J;  1K4T A;  1RR7 A;  2DMT A;  3KPH A;  3U2R A;  4ZYG A;  3IRR A;  2Q8K A;  1BW5 A;  1V54 H;  1CQT A;  3M9A A;  2DT7 B;  4HNV A;  3ZQL A;  3FBN B;  1Z91 A;  4FE7 A;  2PN6 A;  4EM0 B;  5DUK A;  5KNL A;  3GTO J;  1VQ8 I;  4XKC A;  4AM3 A;  2IGK A;  2LFB A;  2R7U A;  5HDG A;  2XAF A;  1IF1 A;  2KQR A;  4KIT B;  1BR1 A;  1PP7 U;  2L02 A;  3FMR A;  3QOE A;  5H6Q A;  4G12 A;  2W48 A;  2X6O A;  2GM4 A;  3DCF A;  2CMP A;  2JPB A;  2VI6 A;  3WOD F;  3NEU A;  4JK1 X;  5FRN A;  2LTP A;  2LNB A;  2H09 A;  1BR2 A;  2QEX I;  3E6B A;  3ZMU A;  5J1R A;  2XGE A;  4RBO A;  1YX3 A;  1H9G A;  4IEJ A;  1L3L A;  4V19 K;  1XC5 A;  3KLN A;  1WCM J;  3O8H A;  1X3Z B;  2RRE A;  4G6Q A;  3OY9 A;  3HRU A;  3OIO A;  3SZG A;  3WE3 A;  1Y1V J;  1XCB A;  5LEJ A;  1MMS A;  1Z67 A;  5KK1 A;  4LMY A;  2L7F P;  2QVO A;  3ESW B;  5ILV A;  1SEU A;  3F0C A;  1VTN C;  3ABM H;  2IBD A;  3R4K A;  4PK4 A;  2KMU A;  2A69 F;  1VI0 A;  4HST A;  3GFJ A;  2X6W A;  2G0E A;  1YE9 A;  2XRL A;  5FKM A;  1BBY A;  1OKR A;  3GFM A;  2O7O A;  2VAS A;  1LVK A;  2JSC A;  4PJJ A;  1MJB A;  3G2B A;  3SXY A;  2DOD A;  1IN7 A;  1S6L A;  3FF5 A;  2DW4 A;  3HXL A;  3G6E I;  1VQN I;  3AG4 H;  4RAF A;  2VQL A;  4Y15 A;  3CJT B;  3RQ4 A;  2JRT A;  1L0O C;  4XN3 A;  3NAR A;  1IN8 A;  1AA7 A;  3BLY A;  3HTS B;  1MBK A;  3K2A A;  4RAZ A;  2E36 A;  3N4M A;  1QU3 A;  2CUE A;  2JJ7 A;  1AU7 A;  1ZGA A;  3DV8 A;  3TOA A;  4M9S A;  2O8K A;  2X0L A;  1IAW A;  2EV6 A;  2M87 A;  2LBF B;  1XGO A;  1NTC A;  4A93 J;  2EIN H;  3FM5 A;  1LEA A;  3OWT A;  2XAG A;  2DMP A;  2CV1 A;  4LG3 A;  5J1U A;  2P7V B;  3CJR B;  3HSE A;  3J81 Z;  4FAS D;  3UNG C;  1KU2 A;  3DXJ F;  2CV2 A;  1WRJ A;  3REO A;  3BG9 A;  4G8X A;  2LD5 A;  4OAZ A;  5D8L B;  1KYW A;  2YUS A;  4BQQ A;  2QBY A;  4RLQ A;  1B9M A;  2CU7 A;  1MMD A;  1UHM A;  2MBF A;  1OLT A;  4G7O F;  4F93 B;  3PSI A;  5J3L A;  2OD5 A;  3FZV A;  2KDZ A;  5D5X B;  4OAY A;  5TJJ A;  2K5C A;  4BAY A;  4I99 C;  1YJ9 I;  1ZQ3 P;  4PZJ A;  2QBY B;  1D3Y A;  2OTJ I;  1LDD A;  2QSF X;  4MO7 A;  3GTK J;  2GOX B;  1I1S A;  1USS A;  1ODD A;  3ONQ A;  2Y0S N;  4EJU A;  3OS0 A;  1BC7 C;  3LAP A;  4D7N A;  4CIC A;  2BW3 A;  3HUG A;  3EPZ A;  4EM2 A;  4JX6 A;  2WAQ N;  5GTH C;  2LSO A;  3OR1 C;  5FRM A;  1IXS B;  5LRS A;  4ANJ A;  2MAB A;  2E1N A;  5FLX Z;  3N97 A;  3B6C A;  3O2P E;  4M9X A;  2EFO A;  1W36 C;  3OYG A;  5F08 A;  2BW3 B;  4I76 A;  3IC7 A;  1BOA A;  3PO2 J;  2IGN A;  4HZF A;  2PX9 A;  3MMY B;  4NQW A;  5E3O A;  4WK8 F;  4OMZ A;  3GTP J;  3JAM K;  1DGW Y;  3BZK A;  3ERE D;  4RA2 A;  1HLV A;  1IRG A;  2P8T A;  1UHW A;  3GX4 X;  2VBZ A;  3E5U A;  1K6Y A;  3GVA A;  2HOT A;  2JT1 A;  4B8X A;  2EZK A;  5DCM B;  1NH3 A;  3PIO F;  3I59 A;  5H6R A;  2F6C A;  4NQW B;  5DD4 A;  4Y52 J;  4MTD A;  3BY6 A;  3DWL E;  2ESN A;  3IAS 2;  1LEB A;  3LST A;  1R7J A;  5EEH A;  5JVT A;  4BY7 J;  1J2X A;  1J75 A;  1FEX A;  5BMZ A;  2XPU A;  2R7Z J;  1RPW A;  3QYE A;  2EZI A;  3I59 B;  1F4K A;  3QPH A;  2ZXW H;  1SFE A;  4M3G A;  3OYA A;  2ELK A;  3LSK A;  2QZ8 A;  4RAY A;  2I10 A;  4RB2 C;  4D9J A;  1A5J A;  1LFB A;  1G8X A;  1MD0 A;  3V7C A;  4DJA A;  3NAU A;  2IRF G;  3VB2 A;  2CYY A;  3I0T A;  3W6V A;  2G9W A;  1LE8 A;  3OL3 A;  1KON A;  4WF2 A;  4ZDP A;  3ZR8 X;  1GDT A;  4A3C J;  5DTD A;  4IHS A;  3FKJ A;  2WB1 A;  4XOT A;  3K4L A;  2P5K A;  1HQC A;  1B4A A;  2ZXJ A;  2HR3 A;  4M6V A;  1G3Y A;  3F22 A;  5L3D A;  3SZT A;  3DKX A;  1MBG A;  5K5Q A;  4HPQ A;  3DBR B;  1R00 A;  4IRI A;  4P55 A;  2A6H F;  2XPW A;  2K27 A;  4KYW A;  4L0Z B;  2X1D A;  2HYF A;  4L9V A;  3V7S A;  3V8J A;  4KIC A;  4AD9 A;  2NNN A;  3A03 A;  3S1N J;  2L54 A;  3OYB A;  3SHF A;  2FUG 2;  2ZNY A;  3HSF A;  2X6Y A;  1X2N A;  4ZDO A;  2NXN B;  5CKT A;  3WU1 B;  3S8P A;  1ON1 A;  4YEJ A;  2K9Q A;  2D1H A;  4QLC U;  4BE0 A;  1UG2 A;  4R79 A;  3L2C A;  2VJ4 A;  3H0G J;  4XLF A;  2FOW A;  4DZJ A;  2DAO A;  4H0E A;  3FHN A;  4QWQ A;  5FFX A;  3IKT A;  2PBI A;  1VQO I;  3OYN A;  3A1Y A;  3FWE A;  1BR4 A;  2JUG A;  4S04 A;  3H3Z A;  2W84 A;  2OAZ A;  3DU6 A;  3QYB A;  4BAC A;  2X6X A;  1EA3 A;  1SAN A;  2PG4 A;  2GXB A;  2NS7 A;  4V2G A;  4D5F A;  1YW9 A;  1FYM A;  1YRN B;  1U3E M;  3K69 A;  3GUD A;  2KIF A;  3BG6 A;  1IGN A;  2DK8 A;  2FBK A;  3L2Q A;  3M8J A;  2E1C A;  4EGY A;  1LDJ A;  3RKX A;  1G6N A;  2E60 A;  4XON A;  5KAF C;  4FET A;  2LYC A;  1ZAR A;  3ZQI A;  2CQK A;  3DPU A;  2GBY A;  5DDG A;  5B3S H;  2HFH A;  3BG3 A;  2XC7 A;  5JHU A;  4A3K J;  5L3F A;  1P92 A;  1JKQ C;  3S93 A;  4ZYH A;  4IXA A;  4GO1 A;  3CZ6 A;  3E6D A;  5DS9 A;  1K6O A;  4YIF A;  2HWV A;  4IKF A;  9ANT A;  1I39 A;  5JI6 A;  4XSZ F;  1BA5 A;  2K3F A;  2XDV A;  4IOA F;  4E7Z A;  2OQR A;  1N77 A;  2R7S A;  1K79 A;  4M71 A;  1LB2 A;  1EKE A;  4N4N B;  4U0Y A;  4OIR F;  1ULY A;  5D8K B;  1PDN C;  3HKZ A;  5BNG A;  3KP5 A;  4XRS A;  1SC7 A;  2XUB A;  2L2O A;  2E2H J;  4HOB A;  3CJQ B;  3HOS A;  1Z3X A;  1U5T A;  1XGS A;  2KKO A;  2MLG A;  1T2K A;  2FRH A;  1O7F A;  2D5V A;  3O6B B;  2CH0 A;  3KE2 A;  4A5N A;  4BQN A;  2GLO A;  5GPC A;  2P0W A;  3DF8 A;  1U2W A;  2Q2E A;  1JI8 A;  4PGG A;  4BGD A;  2CUF A;  2KPM A;  2DFF A;  2LG4 A;  1TQI A;  1U5T B;  2FJ1 A;  2XHK A;  5CVI A;  1JJ6 C;  2HU9 A;  2VBX A;  2ZKZ A;  1UG0 A;  2CFX A;  3OOU A;  3RIR A;  3MFK A;  3LA3 A;  1HKT A;  2KRF A;  3T5X A;  3MZH A;  2NOG A;  3FMS A;  4U88 A;  3CP2 A;  2K9N A;  3JRI A;  1MSF C;  4PSX A;  2R7R A;  2Q2E B;  5GAD J;  4YFN F;  4A3F J;  1IDZ A;  4ENN A;  5CVU A;  2V6E A;  1XTA A;  4RLF A;  2FU4 A;  5J4Y A;  1YX5 A;  1Y6I A;  3RZO J;  1I3Q J;  2OU2 A;  3CCE I;  4A3J J;  5H20 A;  3A0B C;  1XN7 A;  4MQ9 F;  4IL6 C;  1ZTR A;  3WG7 H;  4EJV A;  2VT3 A;  4EGZ A;  2Z9O A;  3DPL C;  3CCM I;  2KZV A;  2M9H A;  2OTL I;  4XOR A;  3E0J B;  1T98 A;  2L7M P;  2HDD A;  1W7P D;  2BY3 A;  1ZRC A;  2WV1 A;  1FTZ A;  4EJO A;  2B7E A;  3KP3 A;  2EIJ H;  3PNY A;  3HIF A;  3OYC A;  2TRT A;  1Z21 A;  3S3N A;  1SD6 A;  3VPR A;  2E5N A;  2L9R A;  3P9K A;  1R23 A;  1YLF A;  2CSO A;  2STT A;  2A6T A;  2CW8 A;  3R0A A;  4Q47 A;  2V1X A;  3S1Q J;  1N78 A;  4RB3 C;  1RR8 C;  1EH7 A;  3QP6 A;  1UB9 A;  1TL8 A;  4M3B A;  3S14 J;  4RGR A;  5J40 A;  4LB5 A;  2VPR A;  5TGT A;  3JAM Z;  3GYH X;  1EF4 A;  3Q0U A;  5K5O A;  4BE2 A;  5F0C A;  1LQ1 A;  1SMT A;  3PNT A;  1J59 A;  2CGP A;  1OJL A;  1UAA A;  2AQF A;  3ISP A;  4JOM A;  4B1R A;  1LFP A;  2B63 J;  2ELJ A;  4BUP A;  3CMY A;  2E2J J;  1DPU A;  1OPC A;  2V1N A;  3BJO A;  3L00 A;  1UZC A;  5LLQ A;  3V4G A;  5M3M J;  4X6A J;  3E3V A;  2BOL A;  1R6R A;  3BTJ A;  2X4H A;  1Q1H A;  3K1N A;  2P4W A;  2BHY A;  2W1O A;  1XMA A;  2ZJQ F;  3L7W A;  3S3O A;  2GXG A;  1G3T A;  3VOD A;  1JJ8 C;  2E19 A;  3KP7 A;  4A3I J;  4Q4Z F;  3VOE A;  3CUO A;  3A4C A;  4WXC A;  2R7W A;  2F5D A;  4ZDL A; 
#chains in the Genus database with same CATH homology
 5IT9 Z;  1YFH A;  4L18 B;  4A6D A;  3TO9 A;  4M6X A;  1GVJ A;  4UVC A;  3BJ6 A;  1QBJ A;  2L3D A;  3HSR A;  3B02 A;  2YPR A;  5LBQ A;  3GXO A;  3QRF F;  2DQR A;  2EFN A;  2ZO4 A;  4KN4 X;  4LD5 A;  3R61 A;  3LQQ A;  2MLK A;  4UV9 A;  4KDP A;  1FZP B;  2J5P A;  2XIG A;  3IWF A;  2M1B A;  2A5Y B;  4KNY A;  4KUM A;  3I71 A;  5CJ9 A;  2FML A;  1X3U A;  2DI3 A;  3GFL A;  1YS6 A;  3ZN0 A;  5L3B A;  1YG2 A;  2CG4 A;  1MGT A;  1MJA A;  5K1Y A;  1LNW A;  3RDI A;  2V9V A;  4ESF A;  1FNN A;  1XGN A;  2EFP A;  3RKW A;  1U78 A;  4HV5 A;  2Z33 A;  4L9T A;  1FP1 D;  2K4J A;  4JBA A;  5J8F A;  2RKH A;  2MD5 A;  5FFZ A;  2YU3 A;  2K02 A;  1GXP A;  3FHZ A;  1OR7 A;  5ILS A;  1S29 A;  2HQR A;  4P5O A;  4HLX A;  4HBL A;  1DDN A;  1DPR A;  3NQO A;  5ICE A;  4HX8 A;  4A0Z A;  5ERI A;  1BIA A;  1HW5 A;  1C0W A;  1G4D A;  3HYI A;  3WTU C;  2O6G E;  4Q48 A;  2FBI A;  1ZG3 A;  4IJA A;  4ZZL A;  4L9N A;  3Q9V A;  2V6C A;  2HQN A;  1O3Q A;  1IN5 A;  4P96 A;  3CUQ C;  2FE3 A;  2AXL A;  4NB5 A;  1S7A A;  1ZRD A;  4U0V A;  5CVJ A;  3FXR A;  3I54 A;  3E97 A;  5HDN A;  4OIQ F;  3JSP A;  4BHB A;  4CHU A;  3RPU A;  4KT5 C;  1IUY A;  1FP2 A;  4M74 A;  4IVN A;  4HX4 A;  2XGX A;  4ENK A;  1WSU A;  4I09 A;  4CO8 A;  4UXN A;  1HW1 A;  2V79 A;  3T1B A;  2KJC A;  3F3X A;  4AIH A;  5J8C A;  1Z6T A;  4Z2Y A;  3L09 A;  2RN7 A;  2DTR A;  5LHI A;  1FOK A;  3C7J A;  1FBU A;  4YII A;  1G3W A;  4ESB A;  1D8J A;  2RC4 A;  3D0S A;  2YR2 A;  1ZRE A;  2Y0M A;  4RB0 A;  4KFC A;  3ZMZ A;  2K4B A;  2XAS A;  2QQB A;  4BNC A;  3J80 Z;  2TDX A;  2OBP A;  1IXC A;  2FBH A;  4EJT A;  3DEU A;  4O5V A;  4GYI A;  3TQN A;  4CZZ A;  1ZRF A;  2BEO A;  1Y0U A;  2P5V A;  3E5Q A;  4M9Z A;  1I6X A;  4ENJ A;  5LGU A;  4DQ2 A;  3LA7 A;  2L01 A;  5AIQ A;  4RGX A;  1K78 B;  2WC2 A;  4A0X A;  3DFG A;  2NRA C;  2A6E F;  2L4A A;  1UFM A;  3IHU A;  2P6S A;  4YFX F;  1T39 A;  4HDU A;  2DO7 A;  3DQV C;  1LVA A;  4KMF A;  4HA8 A;  3K1P A;  2ZME B;  1TNT A;  4LLG F;  1LJ9 A;  3RKY A;  3VFZ A;  5DCF A;  4IHT A;  1CGP A;  2GIV A;  4BHP A;  4AIJ A;  3SFZ A;  2A07 F;  1XSX A;  5HS9 A;  3KP2 A;  5FD6 A;  5BOX A;  3LWF A;  2E7W A;  1D8K A;  5DCM A;  4B09 A;  1IN6 A;  2V1U A;  1ZYR F;  1J9I A;  3V8L A;  2NNY A;  3ABU A;  4LLN A;  1BI3 A;  3RYR A;  4A12 A;  1RI7 A;  2FSW A;  4AVP A;  2XRO A;  2NYX A;  5E1W A;  3T8T A;  2QLZ A;  3NRV A;  2H27 A;  4HYE A;  4A2U A;  2BV6 A;  2H6B A;  3ZPL A;  1WI9 A;  2HTS A;  5HLG A;  3DP7 A;  2JZY A;  2D1V A;  1Z9C A;  2JPC A;  5F64 A;  2Z99 A;  1PUE E;  3WTY C;  1RUN A;  4N0B A;  5BQT A;  2MC3 A;  3G73 A;  5HVQ C;  3GW2 A;  1Z05 A;  3RPQ A;  4P9U A;  2CO5 A;  3ML6 A;  4P9F A;  4RGU A;  2LDU A;  5FD5 A;  2P5L C;  3ABT A;  1KA8 A;  2AS5 F;  3CO7 C;  4WWC A;  3SZP A;  2DFI A;  4G7H F;  5FB2 A;  4XRF A;  3FM3 A;  3FXQ A;  3ULQ B;  5ED4 A;  2NAZ A;  3HRM A;  3MWM A;  3ZP5 A;  4E70 A;  1JHH A;  5KVR A;  1T38 A;  4ESJ A;  1B9N A;  5DYM A;  4HF1 A;  1Z6R A;  2W85 A;  2DU9 A;  3PFI A;  4I2O A;  1JXS A;  1MJ9 A;  1H0M A;  4RGS A;  5ICC A;  1WWX A;  2R7D A;  4I0B A;  1QQI A;  1W5S A;  5DV5 A;  2QUF A;  2WTE A;  2PEX A;  2XRN A;  2F5C A;  1EH8 A;  3EUH A;  2CW0 F;  3KP6 A;  2ZCW A;  4A6E A;  2IJL A;  4OIP F;  3G3Z A;  2K7L A;  3JSO A;  4LFU A;  1R36 A;  1TBX A;  1ZGJ A;  5LGT A;  1YIO A;  5LEK A;  2GAU A;  3F8C A;  3C1D A;  5ILU A;  5HS8 A;  4MEX F;  2OZ6 A;  2VBY A;  3WG9 A;  5AON A;  2XV4 S;  1RZ4 A;  1ZHF A;  3COA C;  4IF4 A;  1FBS A;  2LKP A;  2DPU A;  1B59 A;  3CUQ A;  1FYK A;  2HGC A;  4KN7 X;  4HLY A;  2W25 A;  3I4P A;  4I01 A;  2VE8 A;  4F7Z A;  3T0Y A;  3CJN A;  4HF0 A;  5E8G A;  3CUQ B;  3CO6 C;  2M45 A;  3EYY A;  1HXD A;  1H9T A;  3OV8 A;  4I98 B;  3K1M A;  2ISZ A;  4BH9 A;  2H6C A;  1I1G A;  1FBQ A;  1SFX A;  2P7C B;  1LDK B;  5F6F A;  1FC3 A;  3V7R A;  1S8N A;  3ELK A;  3T8R A;  3E5X A;  3QP5 A;  3TGN A;  4EM1 A;  4ETS A;  1EH6 A;  3QPT A;  2O0Y A;  3W6K B;  3FXU A;  2BE5 F;  6PAX A;  2VC0 A;  4MGR A;  4LK1 F;  2DBB A;  3JTH A;  3DPT A;  5D4R A;  2L4M A;  2GZW A;  3KLO A;  4IPA A;  4S05 A;  3KET A;  3F8B A;  1ZAO A;  3KCC A;  4CDG A;  1FYL A;  5HLH A;  3F6V A;  5D5W B;  1HSJ A;  5DD8 A;  3TO7 A;  3M8F A;  3TOB A;  1F5T A;  2DQL A;  4CXF A;  3HTU A;  4Q5S F;  2NS0 A;  3E6M A;  4LG0 A;  3O3K A;  1WQ2 A;  1KGS A;  1KQ8 A;  2IVM A;  3I64 A;  1O3S A;  4HX7 A;  4LG0 B;  3GZ5 A;  3AAF A;  2FMY A;  4LB6 B;  2Z5U A;  2ACJ A;  2HKO A;  3ZMD A;  3BOQ A;  2DPD A;  4M72 A;  2MH9 A;  1IRF A;  2F5E A;  2IP2 A;  3F21 A;  5EEG A;  2PI0 A;  2OQG A;  5E17 F;  3D5L A;  4UUV A;  1YQA A;  4GGG A;  1OYI A;  5E1X A;  3U9G A;  1BN5 A;  4XLN F;  2VE9 A;  4YG2 F;  1I5Z A;  3ZMV A;  3HRT A;  4OIN F;  3LA2 A;  3PQK A;  2FNA A;  2VBW A;  2WWY A;  2O3F A;  1QZZ A;  1V4R A;  5E1Z B;  3ECH A;  1JGS A;  3EDP A;  4OIO F;  5CYV A;  1J5Y A;  1KU9 A;  3WTZ A;  4D0P A;  4L5J A;  2UXX A;  2DLL A;  4A5M A;  2BYV E;  2C6Y A;  1R5G A;  3HHG A;  3JW4 A;  5FLX K;  2R7F A;  1KU7 A;  4UVB A;  3B73 A;  4WXD A;  1IW7 F;  4RB1 A;  3ZMT A;  1ZN2 A;  2ZFW A;  2RVC A;  5D6F A;  4G7Z F;  1SMY F;  1TQM A;  2Y48 A;  2COM A;  2VN2 A;  1WKM A;  3ROU A;  4WXH A;  5D5U B;  5FGM A;  3RI4 A;  2XAH A;  2YSR A;  2EFQ A;  4AIK A;  5A2Q K;  2RNJ A;  3CDH A;  3L9F A;  2IW5 A;  2GA1 A;  2IA1 A;  5CVV A;  2QYO A;  3LFK A;  2KJB A;  2YX4 A;  1JE8 A;  1XSV A;  2P6T A;  1MZB A;  2HDC A;  3SQN A;  4XSX F;  2UZK A;  1XMK A;  4KMU X;  2ZJ2 A;  4O6J A;  1HST A;  4MHG A;  4LLL A;  3F8M A;  3W6J B;  4XLP F;  3QAH A;  1IZ1 A;  1RIO H;  3WTW C;  4CYD A;  2FF4 A;  4MEY F;  4AWX B;  3S2W A;  2WV0 A;  1W4M A;  3MEX A;  2DT5 A;  1O7L A;  3FMQ A;  4GXO A;  1R1T A;  4M6Y A;  1T6S A;  1P6R A;  1TW3 A;  3WGG A;  2EFW A;  3KZY A;  4OMY A;  2VC1 A;  1V3F A;  3C18 A;  3IWZ A;  4ZZD A;  2FQ3 A;  2E7X A;  2EA2 A;  2LF7 A;  2FOK A;  5E18 F;  3WTT C;  2R3S A;  3M1E A;  2G7H A;  2EK5 A;  3JTG A;  1S3J A;  2HKX A;  2VXZ A;  4KA4 A;  4DNC A;  2Y75 A;  2PFB A;  2EA4 A;  3ECO A;  2OA4 A;  4JQF A;  1B6A A;  2IA0 A;  1ZG5 A;  4ZYD A;  1DP7 P;  1JHF A;  1XDU A;  3WGH A;  5LRR A;  1K78 A;  3RYP A;  4ON0 A;  4K2E A;  3R0J A;  2W57 A;  4OU0 A;  1OYY A;  4GYG A;  4HW0 A;  3WTV C;  1W7P A;  2IA2 A;  3EQL F;  3WTX C;  5D4S A;  2VOP A;  1FWZ A;  2A3S A;  3WTS C;  1XB4 A;  4KIG A;  3BRO A;  1F9N A;  1W7P B;  5BPD A;  2ZME A;  4G9Y A;  5J6X A;  1S7O A;  3IL2 A;  2YX7 A;  1QPM A;  1MDM A;  2LF8 A;  3GLX A;  4ZH4 F;  5TRD A;  1YO5 C;  5JFR A;  3Q9S A;  1R5H A;  4U7D A;  4UVA A;  1MDM B;  3BPV A;  1UST A;  3K2Z A;  4KIF A;  3ZQ7 A;  3ZN1 A;  3E6C C;  2MA3 A;  1FSE A;  1NHA A;  2EJR A;  2IPQ X;  3MCZ A;  1ZLJ A;  4IRH A;  4BQA A;  2PLY A;  3GFI A;  3FX3 A;  5ICF A;  1ZLK A;  1XCV A;  2MH2 A;  4Y17 A;  1A04 A;  2UWM A;  4FX0 A;  4IRG A;  2UXN A;  4BXU A;  2D45 A;  4UHT A;  2H94 A;  2V1D A;  2HZT A;  3WE2 A;  3V8K A;  2QQA A;  2M5W A;  5D5V B;  2XAJ A;  1R1U A;  3MAJ A;  3I53 A;  2F5F A;  5HOO A;  4UNO A;  1YS7 A;  3KFW X;  5CVR A;  1FLI A;  2ZNZ A;  1TLH B;  3KZZ A;  5CLS A;  3K9T A;  2J5O A;  4MQV A;  1SD5 A;  1GHC A;  2W24 A;  2EB7 A;  3WGI A;  1J7K A;  3U1D A;  5A2Q Z;  1KYZ A;  1U6G A;  2EWN A;  1O57 A;  2FA5 A;  2XAQ A;  3F8N A;  4I02 A;  1SFU A;  2RV8 A;  4EJW A;  4WX9 A;  4HAM A;  3P9I A;  1KQ0 A;  3GEZ A;  1R58 A;  4LGW A;  5IT9 K;  4G94 A;  1MKM A;  2OZU A;  5K5R A;  1E17 A;  2HTJ A;  2HEO A;  2QM3 A;  1HKS A;  4YFK F;  3GO5 A;  4HQM A;  4U7B A;  1R22 A;  2G7U A;  2HOE A;  1XGM A;  2CWE A;  2O8X A;  3CLO A;  1PP8 F;  4L0Y B;  3J7A O;  3C3W A;  3H3U A;  3LQR A;  4LJZ F;  5FO5 A;  3F23 A;  3BJA A;  4I7H A;  2BGC A;  2A61 A;  5LHH A;  5DEQ A;  3ZMS A;  2GQQ A;  4U0W A;  3WU0 A;  1ONV A;  3P7N A;  2B0L A;  5JR3 A;  2PQ8 A;  3BDD A;  1T0F A;  2RGV A;  5DUI A;  1IN4 A;  3H92 A;  1R1V A;  3BWG A;  1P4X A;  3R6S A;  2PMU A;  1QZY A;  1P2F A;  3TO6 A;  4EQQ A;  2RDP A;  4R8H A;  1YTY A;  1UCR A;  2JTV A;  2KIM A;  2EV0 A;  1YW7 A;  3EET A;  4O3M A;  1I27 A;  1W5T A;  2PJP A;  2HYG D;  5F1R A;  3KEQ A;  4EVI A;  5E8I A;  4KIB A;  5L3G A;  3BPX A;  2FNP A;  1HBX G;  1P4A A;  3F72 A;  1FPQ A;  1J0R A;  4HDV A;  1Z1D A;  2ELH A;  1P4W A;  5HS7 A;  1SD7 A;  3RTR A;  5ICG A;  1CF7 A;  4ASN A;  3VEP A;  5L3C A;  1D5V A;  1QO0 D;  2VT2 A;  2QWW A;  1OMI A;  1U8R A;  4EV0 A;  2O61 A;  1CF7 B;  2QEN A;  1ZG1 A;  1BI0 A;  4UV8 A;  4BHC A;  1RNL A;  1IXR C;  3BZ6 A;  4ENM A;  2K86 A;  3LAJ A;  1FSH A;  4MTE A;  3TDU C;  5D6E A;  1GXQ A;  4PDK A;  4G6D A;  5IT3 A;  5LGN A;  4N9I A;  4I0A A;  2O03 A;  3GF2 A;  5LHG A;  4PCQ A;  2ZBK A;  1BJA A;  3P9C A;  2ADU A;  1STZ A;  1AWC A;  2VON A;  3M8E A;  1SAX A;  4L9J A;  3RJP A;  1BC8 C;  2XKP A;  2BBY A;  1E2X A;  1FT9 A;  4WCG A;  3HHH A;  3J80 K;  2KIU A;  1TQP A;  1G3S A;  3QU6 A;  2M8E A;  2PMH A;  1DUX C;  3TKY A;  2ETH A;  5AIP A;  1TW2 A;  2FXA A;  2F2E A;  4EMS A;  3Q5F A;  2HS5 A;  4N9H A;  4L5I A;  4FHT A;  3J81 K;  4OOI A;  2STW A;  1B1B A;  3KEO A;  3F8F A;  2D2W A;  1Z7U A;  1EV7 A;  4HV6 A;  3BP8 A;  1KU3 A;  2FEZ A;  3IRQ A;  2VOO A;  1TNS A;  2M30 A;  4A0Y A;  1F1Z A;  3KP4 A;  2XKO A;  4LK0 F;  3K0L A;  3TDZ C;  4GCV A;  4FX4 A;  3R60 A;  1YW8 A;  1HKQ A;  2EV5 A;  1XD7 A;  3HRS A;  1REP C;  1HW2 A;  1FX7 A;  3MZY A;  2ESH A;  1FY7 A;  1RUO A;  2Q0O A;  3F6O A;  1SD4 A;  3CTA A;  1O3R A;  4HQE A;  3GWZ A;  1AOY A;  4Y13 A;  2RQP A;  3MQ0 A;  3DKW A;  4BYY A;  5L3E A;  1O3T A;  4PGH A;  1XDS A;  4HF2 A;  1YYV A;  1TTY A;  1BM9 A;  4M73 A;  2A68 F;  1BIB A;  3IKV A;  4MNU A;  3PQJ A;  4TV7 A;  5HDK A;  3I5U A;  4ZYE A;  4FT8 A;  1QNT A;  3HOT A;  5BPI A;  4XBF A;  1KQ9 A;  5HLI A;  3GZ6 A;  2GA2 A;  3I58 A;  4RS8 A;  5E20 A;  4NHJ A;  1XSD A;  3QU3 A;  4CGZ A;  1ZH5 A;  2XVC A;  2ISY A;  1QGP A;  3QOP A;  1BI1 A;  2Z3Y A;  2IT0 A;  1OYW A;  3OOP A;  2VOD A;  3M7G A;  4R1H A;  2QQ9 A;  3EYI A;  2DK5 A;  1BI2 A;  5BS6 A;  1ON2 A;  1U5T C;  2GWR A;  1K7A A;  3U2R A;  4ZYG A;  3IRR A;  2Q8K A;  3M9A A;  1Z91 A;  2PN6 A;  4EM0 B;  5DUK A;  5HDG A;  2XAF A;  1IF1 A;  1PP7 U;  2L02 A;  3FMR A;  5H6Q A;  2JPB A;  3WOD F;  3NEU A;  4JK1 X;  2LNB A;  2H09 A;  3E6B A;  3ZMU A;  1H9G A;  1L3L A;  3KLN A;  4G6Q A;  3HRU A;  3WE3 A;  5LEJ A;  1XCB A;  5KK1 A;  4LMY A;  2QVO A;  5ILV A;  1VTN C;  3R4K A;  2A69 F;  3GFJ A;  1BBY A;  1OKR A;  3GFM A;  2JSC A;  1MJB A;  3SXY A;  1IN7 A;  1S6L A;  3FF5 A;  2DW4 A;  4Y15 A;  2JRT A;  1L0O C;  1IN8 A;  3HTS B;  4RAZ A;  3N4M A;  1ZGA A;  3DV8 A;  3TOA A;  4M9S A;  2X0L A;  1IAW A;  2EV6 A;  2M87 A;  1XGO A;  3FM5 A;  1LEA A;  2XAG A;  2P7V B;  3HSE A;  3J81 Z;  1KU2 A;  3DXJ F;  1WRJ A;  3REO A;  4G8X A;  5D8L B;  1KYW A;  2QBY A;  1B9M A;  2MBF A;  1UHM A;  4G7O F;  2OD5 A;  3FZV A;  5D5X B;  5TJJ A;  4BAY A;  4PZJ A;  2QBY B;  1D3Y A;  1LDD A;  1I1S A;  1USS A;  1ODD A;  4EJU A;  1BC7 C;  3LAP A;  4CIC A;  3HUG A;  4EM2 A;  2LSO A;  1IXS B;  5LRS A;  2E1N A;  5FLX Z;  3N97 A;  3O2P E;  4M9X A;  2EFO A;  3IC7 A;  1BOA A;  4HZF A;  4WK8 F;  4NQW A;  4OMZ A;  3JAM K;  3ERE D;  1IRG A;  2P8T A;  1UHW A;  3GX4 X;  2VBZ A;  3E5U A;  3GVA A;  2JT1 A;  4B8X A;  5DCM B;  3I59 A;  5H6R A;  5DD4 A;  4MTD A;  3BY6 A;  2ESN A;  1LEB A;  3LST A;  1R7J A;  5EEH A;  5JVT A;  1J2X A;  1J75 A;  5BMZ A;  3I59 B;  1F4K A;  3QPH A;  1SFE A;  4RAY A;  2QZ8 A;  4RB2 C;  1MD0 A;  3V7C A;  2IRF G;  3VB2 A;  2CYY A;  3I0T A;  2G9W A;  4WF2 A;  4IHS A;  2P5K A;  1HQC A;  1B4A A;  2ZXJ A;  2HR3 A;  3F22 A;  1G3Y A;  5L3D A;  3SZT A;  5K5Q A;  1R00 A;  4IRI A;  4P55 A;  2A6H F;  4KYW A;  2K27 A;  4L0Z B;  2HYF A;  4L9V A;  3V7S A;  3V8J A;  4KIC A;  4AD9 A;  2NNN A;  2L54 A;  3SHF A;  2ZNY A;  3HSF A;  3WU1 B;  1ON1 A;  2D1H A;  4QLC U;  4R79 A;  3L2C A;  2DAO A;  4H0E A;  5FFX A;  4QWQ A;  3IKT A;  2PBI A;  3FWE A;  4S04 A;  3H3Z A;  2W84 A;  2OAZ A;  2PG4 A;  2GXB A;  1YW9 A;  1FYM A;  1U3E M;  3K69 A;  3GUD A;  2KIF A;  2DK8 A;  2FBK A;  2E1C A;  4EGY A;  1LDJ A;  3RKX A;  1G6N A;  1ZAR A;  2CQK A;  5DDG A;  2HFH A;  5JHU A;  5L3F A;  1P92 A;  4ZYH A;  4IXA A;  4GO1 A;  3E6D A;  1K6O A;  4YIF A;  2HWV A;  5JI6 A;  4XSZ F;  2OQR A;  1K79 A;  4M71 A;  1LB2 A;  4U0Y A;  4OIR F;  1ULY A;  5D8K B;  1PDN C;  3KP5 A;  2XUB A;  4HOB A;  3HOS A;  1U5T A;  1XGS A;  2KKO A;  2MLG A;  1T2K A;  2FRH A;  1O7F A;  3O6B B;  3KE2 A;  4A5N A;  3DF8 A;  1U2W A;  2Q2E A;  4PGG A;  1TQI A;  1U5T B;  2XHK A;  5CVI A;  3RIR A;  2VBX A;  2ZKZ A;  2CFX A;  1HKT A;  3MFK A;  3LA3 A;  2KRF A;  3T5X A;  3MZH A;  3FMS A;  4U88 A;  4YFN F;  4ENN A;  5CVU A;  2FU4 A;  2OU2 A;  5H20 A;  1XN7 A;  4MQ9 F;  4EJV A;  2VT3 A;  4EGZ A;  2Z9O A;  3DPL C;  1T98 A;  1W7P D;  1ZRC A;  4EJO A;  3KP3 A;  3HIF A;  1SD6 A;  3P9K A;  1R23 A;  1YLF A;  2CSO A;  2STT A;  3R0A A;  4Q47 A;  2V1X A;  4RB3 C;  1EH7 A;  3QP6 A;  1UB9 A;  4RGR A;  4LB5 A;  3JAM Z;  3GYH X;  5K5O A;  2CGP A;  1J59 A;  1LQ1 A;  1SMT A;  3ISP A;  1DPU A;  1OPC A;  3BJO A;  3L00 A;  5LLQ A;  3V4G A;  3E3V A;  2X4H A;  1Q1H A;  3K1N A;  2P4W A;  1XMA A;  3L7W A;  2GXG A;  1G3T A;  3VOD A;  3KP7 A;  4Q4Z F;  3VOE A;  3CUO A;  4WXC A;  2F5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...