1NHAA

Solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
b'DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIF, alpha subunit
publication title Solution Structure of the Carboxyl-Terminal Domain of RAP74 and NMR Characterization of the FCP1-Binding Sites of RAP74 and Human TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1nhaA00
5H6RA 2OD5A 2V1XA 2M45A 2W57A 2DW4A 3JAMZ 4LB6B 4YFKF 5ILSA 1PP8F 4IRGA 3K69A 3IWFA 1H9GA 2LF7A 4IHTA 2DU9A 2XAJA 4B8XA 4CO8A 1XN7A 3MZYA 3MEXA 1ZARA 2FOKA 2EJRA 3E5XA 3COAC 1YLFA 3CDHA 1D3YA 3F6OA 3MWMA 2DK8A 4IXAA 2XIGA 3PQKA 1I5ZA 3KLOA 5ICCA 2UZKA 5IT3A 5BS6A 3GYHX 2MLKA 2V9VA 2PFBA 3M8EA 2OQRA 3GFMA 4KIBA 1WWXA 1IXSB 3T1BA 1BIBA 1LEBA 1V3FA 4ESBA 3GXOA 4ZYEA 1F1ZA 1G6NA 3L00A 4LJZF 3ZN1A 4ESFA 3DKWA 3L7WA 5ICFA 3WTVC 2EFQA 2F5FA 1FLIA 2IA0A 5DD8A 2LF8A 3FF5A 3ABTA 1W7PB 4U0VA 5DCMA 3FM5A 2HFHA 1OR7A 4OMZA 4Y15A 1J9IA 2IPQX 3HYIA 1K6OA 1LVAA 3OV8A 1R1UA 5E8IA 3MCZA 3IKTA 3FMRA 1MDMA 5E18F 2R3SA 1ZYRF 4CDGA 1T6SA 3EUHA 3SXYA 3FX3A 3J81Z 4PZJA 4KNYA 2D1HA 1SFUA 2QZ8A 2WWYA 2EV6A 2J5OA 3E6BA 1W7PA 4Y17A 3CLOA 3T8TA 2XAGA 1P92A 1QGPA 3SZPA 3HHHA 2HOEA 3Q5FA 1MJBA 1IXRC 1LQ1A 4BHBA 2DQLA 1FZPB 1SFEA 2B0LA 3I53A 4U0YA 2BE5F 3TDUC 3ZMZA 2RQPA 1XCBA 2M87A 4HF1A 3DV8A 1FYMA 4A5MA 1DPRA 1QPMA 2MA3A 3R60A 4FHTA 1YW9A 2A61A 2HQNA 5E1WA 3M1EA 5HDKA 1YIOA 3LA3A 2IVMA 2Z3YA 2HDCA 1L0OC 4OIRF 4RB2C 1S3JA 3WODF 2KJBA 1S29A 1LJ9A 4A6DA 2RGVA 2FMLA 4RGRA 3I71A 4WXHA 5CVJA 4HLYA 2XRNA 4ZYDA 2EB7A 1B59A 1O7LA 1W5TA 1OKRA 2KJCA 2HEOA 1AWCA 3J81K 1G4DA 2RDPA 2XGXA 3GW2A 5BMZA 1F9NA 4HBLA 3B02A 4EM1A 5D5UB 3LQQA 4OIQF 1TQIA 1JXSA 2VT3A 1FYKA 4LK0F 2XUBA 2ZFWA 1H0MA 3K1NA 2HKOA 2W24A 4ENMA 1ONVA 2KIMA 1R1TA 1EH7A 3BPXA 3QP5A 3GZ5A 2IRFG 2HR3A 2QQ9A 3ZMUA 2JRTA 1J0RA 2HWVA 3QAHA 2PN6A 3U2RA 3F3XA 1Z9CA 2GIVA 5FO5A 1D8KA 4ENKA 4EJUA 2Q0OA 3EYYA 1OMIA 2GA1A 4P5OA 2XKOA 4CHUA 5HS8A 3WGIA 4XSXF 1T38A 2L4AA 4EJOA 4R1HA 4TV7A 1S7OA 4KYWA 2VOOA 4KN4X 2M30A 2ZNZA 3ULQB 1YTYA 1QZZA 5BOXA 2BBYA 2VBWA 1SMTA 3V7RA 2OZ6A 4LG0B 2IP2A 4U0WA 3SFZA 3JW4A 1FNNA 5DEQA 4LLLA 2ZNYA 3FHZA 2G7UA 2A68F 5HDNA 4WK8F 5K5OA 4ZZLA 3C18A 4OIOF 4B09A 5CVIA 4AVPA 1RNLA 3F21A 3M7GA 2H6CA 1IZ1A 3RKYA 2STWA 1XGOA 3TO7A 4L9TA 3WE3A 4DNCA 3HUGA 5LBQA 3GX4X 1FC3A 2KIFA 4LG0A 3GLXA 1I6XA 4A0ZA 1ON1A 4HX7A 3GFIA 5FB2A 2KKOA 5ILVA 2DI3A 1MZBA 1U2WA 2ACJA 4UVBA 1T39A 2KIUA 4KIGA 3FZVA 3R4KA 3WU0A 3ZPLA 1S8NA 5HDGA 1FT9A 2FNPA 4L18B 2JPCA 3WTUC 5EEHA 5H6QA 4E70A 4NB5A 3AAFA 3KETA 3WGHA 4OOIA 4LK1F 4I98B 3TO9A 2OQGA 1DPUA 2P8TA 4MQVA 3HSFA 4P96A 1BN5A 2XAHA 4EM0B 1U8RA 1G3YA 2O3FA 5E20A 2FBIA 5JHUA 2Y0MA 4LGWA 1DUXC 1ZGAA 4CXFA 2KRFA 2RV8A 1BOAA 2VXZA 2ZBKA 1NHAA 2EK5A 2A6HF 4RAZA 1ZHFA 4GYIA 1R1VA 1XGMA 1KU9A 2CWEA 3FWEA 3W6KB 1ZGJA 4ZZDA 3DQVC 5DV5A 3QOPA 2GAUA 1G3TA 5F1RA 5FFZA 5BPIA 3W6JB 4I0AA 1USSA 3F23A 1KU7A 3BDDA 3P9CA 4HQMA 4YG2F 3ZQ7A 2OU2A 5KK1A 3KCCA 1WI9A 1XSXA 5D5XB 2DTRA 1S6LA 1TW3A 4IF4A 1BIAA 4CICA 3L2CA 4LD5A 3KZYA 4RGXA 5LHIA 4BHPA 1IN8A 1K7AA 4Q47A 3LAJA 2JT1A 3GO5A 5CYVA 2XROA 1H9TA 1YO5C 4S05A 2GA2A 2O61A 3HIFA 2CG4A 1KQ0A 3FXUA 1ZG5A 5HVQC 1Z6RA 4LMYA 4ENNA 4MQ9F 1KQ9A 5F6FA 3DEUA 2D1VA 5FFXA 1KGSA 5HS7A 2W25A 2EFNA 1HSTA 4XLPF 1RI7A 1USTA 2HQRA 5D5WB 3IHUA 1GHCA 2CW0F 1WKMA 3KEQA 2V79A 3DP7A 2DPDA 1J7KA 2O6GE 3K1MA 1RIOH 4I0BA 4EVIA 4LLNA 1Z05A 1ZRFA 5DDGA 4OU0A 3CJNA 3ML6A 2PLYA 1DP7P 5DCMB 3NQOA 4UXNA 4OINF 4ETSA 3IL2A 2UXXA 3J7AO 1UHMA 4UHTA 2GQQA 1FY7A 2A07F 3O2PE 3N4MA 3RPUA 1MDMB 4M6XA 3ECHA 1U78A 3KP7A 1HW5A 4MEYF 3P9KA 3GFJA 4LFUA 4HDUA 1F5TA 2LDUA 4S04A 3MQ0A 4NHJA 1IAWA 2DPUA 3F8NA 4D0PA 1I1GA 1IRGA 1CGPA 4GYGA 5J8CA 4ON0A 1FP2A 3DF8A 1G3WA 3NRVA 1MD0A 1YG2A 4MNUA 4HOBA 3E3VA 3C3WA 4UVCA 2Q8KA 4UV8A 1R58A 3R6SA 1IN6A 2JSCA 3KP2A 1AOYA 1HQCA 2M8EA 2L02A 2M5WA 4WX9A 5DCFA 2Z5UA 2JPBA 1KU2A 3RTRA 1QQIA 2ESHA 5D8LB 4KDPA 3LFKA 3JAMK 3TOBA 2YX4A 3TO6A 5HLGA 5E8GA 2X0LA 3HRSA 3D0SA 4HV5A 2PBIA 3MAJA 3OOPA 2H09A 1ZH5A 2HGCA 3F8MA 2J5PA 3ERED 2P7CB 3H92A 2H6BA 3HRTA 1XB4A 3LA7A 2F5DA 2O8XA 2L54A 2BEOA 1U6GA 3SZTA 2LNBA 2DLLA 5E1XA 2VBYA 3K9TA 1TLHB 1QZYA 1YFHA 3K0LA 1IRFA 3L9FA 4GCVA 1D5VA 1HKTA 1L3LA 4WCGA 2VE9A 4LB5A 1R23A 1IN5A 4KUMA 4OIPF 2OAZA 4U7DA 4AIJA 3F8BA 2DK5A 5DD4A 2CGPA 3LAPA 1FP1D 3I5UA 4HF2A 1I1SA 1QO0D 1B4AA 1BBYA 4Y13A 5D4SA 3QPTA 2FMYA 3QRFF 1BI2A 1WRJA 2IJLA 2CQKA 3ELKA 4R8HA 4HYEA 2Z99A 3HSRA 5LEKA 3R61A 2VE8A 3M9AA 4KICA 2QQAA 1SD7A 4EMSA 1SFXA 1R5GA 2CFXA 1WQ2A 5D4RA 4WF2A 4FX4A 2ZO4A 1D8JA 3LQRA 2NAZA 2P4WA 3JTGA 4EGZA 4OMYA 2HYGD 2XAFA 2WV0A 1YS6A 2ADUA 4O3MA 5K5RA 1P4XA 3G73A 1MKMA 1Z7UA 3GZ6A 4UVAA 3BJAA 2MC3A 4AIHA 4EJWA 2P6TA 2FU4A 3F8FA 2FXAA 4M9SA 1RUNA 1KQ8A 2ELHA 1FBUA 1RUOA 2A6EF 1PUEE 2FA5A 4AIKA 1XDSA 1IN7A 4L5JA 1FOKA 2P7VB 4GO1A 5D5VB 2A3SA 5E1ZB 4MHGA 4BQAA 1HKSA 5D6EA 2OBPA 1OYWA 2MD5A 5J6XA 3NEUA 3V8LA 3JTHA 4KFCA 1R7JA 4UV9A 1ZLJA 2DAOA 2R7FA 4KA4A 4M73A 2WC2A 2Z33A 4NQWA 4YIIA 1FSEA 3F6VA 1YW8A 2QVOA 2E7XA 1XD7A 2CSOA 2GWRA 2ISZA 2YPRA 1XSDA 1LB2A 4N9IA 1SD6A 1O3TA 2K02A 5FLXZ 3MZHA 2Q2EA 4HDVA 2IT0A 3HOSA 1J2XA 3BOQA 3ZMTA 4GXOA 3QU3A 1TTYA 1QBJA 2K27A 5FD6A 3H3UA 3TGNA 3EYIA 5AIPA 1ZRDA 4MTEA 3V8KA 4U7BA 4I09A 4XLNF 2DT5A 1A04A 3E6DA 4BAYA 2L3DA 4IRIA 2O03A 2HKXA 2QM3A 2GXGA 5KVRA 4A12A 4I02A 1R22A 2A5YB 1BJAA 4HA8A 1LEAA 1XSVA 3T5XA 1O57A 4WXDA 5JFRA 1BI0A 5LLQA 4O5VA 5JI6A 1STZA 1TW2A 2AS5F 2QBYA 1FYLA 1UB9A 1O3RA 1W7PD 3J80Z 1SMYF 1T0FA 4I2OA 2YR2A 1VTNC 5H20A 1LDDA 3GF2A 3SHFA 4G9YA 5LHGA 2D45A 3D5LA 1Q1HA 2P5KA 3BROA 5CJ9A 3RYPA 2OA4A 2STTA 4XRFA 2VC0A 1ON2A 4CZZA 1W5SA 2VBXA 2VC1A 5BQTA 5FLXK 1W4MA 5ICEA 3PFIA 1HKQA 1CF7B 3EQLF 2QLZA 1B6AA 3KZZA 3M8FA 3VEPA 5LGTA 3IKVA 3F8CA 1HSJA 3E6CC 2L01A 3F72A 4HLXA 3I59A 4G7HF 4O6JA 3GVAA 3LA2A 4K2EA 1R36A 3HRUA 2NRAC 4IPAA 5LRSA 3V7CA 4L9JA 3TDZC 2CYYA 4G7ZF 4RGSA 1R5HA 3ZMSA 3BY6A 3KP4A 5CLSA 1GVJA 2X4HA 2P5LC 1CF7A 2F2EA 2XAQA 1ODDA 3WTZA 3ZN0A 1KYWA 2V6CA 1O7FA 1IF1A 3BJ6A 4PDKA 2FBHA 3E6MA 5F64A 5K1YA 4JK1X 4UUVA 2PMHA 2PI0A 4HX4A 4M74A 4HF0A 1Z91A 3J80K 2HTJA 1XCVA 3DPLC 1KU3A 4RB3C 1LNWA 3RJPA 3U1DA 1J75A 2VODA 2VONA 1C0WA 3I64A 1YW7A 3ISPA 1FSHA 1FPQA 2EV0A 2XKPA 6PAXA 1ULYA 4L9NA 2JTVA 1SD5A 2V1UA 4FX0A 2F5CA 1V4RA 1JHFA 1Z6TA 4G8XA 1Y0UA 5DUIA 2GZWA 4RB1A 2NNYA 4H0EA 1MJAA 3WTXC 1K78B 2WTEA 1EV7A 2E7WA 1P4WA 3F22A 3BP8A 2RC4A 4HX8A 1E2XA 3IRRA 4IVNA 1XGNA 4GGGA 1EH8A 2NS0A 4P9FA 4PGHA 3JSPA 4FT8A 3HTSB 4G6DA 2ESNA 4F7ZA 2PEXA 4BYYA 1B9NA 3KLNA 4IJAA 1U3EM 1P6RA 5L3EA 1LDKB 3U9GA 3CUQB 1S7AA 4EV0A 3MFKA 3VB2A 2BYVE 1RZ4A 1QNTA 3HTUA 3GEZA 3H3ZA 1J59A 3O3KA 5FGMA 2A69F 1K78A 4KMUX 2DBBA 1IN4A 5LGNA 3ZP5A 1Z1DA 1PDNC 3PQJA 1FBSA 2PJPA 1SD4A 3P9IA 2QQBA 2LKPA 1BC7C 1BI1A 1YQAA 3GFLA 2XHKA 2Z9OA 4IHSA 2VT2A 4LLGF 2ZMEB 3CUQA 4EJVA 4G6QA 4JBAA 1OYYA 2PMUA 2DQRA 2ZKZA 3QU6A 3VFZA 4AWXB 3WU1B 4A0XA 2E1CA 2IW5A 2PG4A 5ERIA 3JSOA 4HAMA 3HSEA 1ZRCA 4RS8A 3P7NA 1IW7F 3T8RA 3VOEA 1MGTA 1IXCA 2FEZA 4P55A 4CYDA 5LGUA 4A0YA 1KYZA 1REPC 5LRRA 5L3DA 3T0YA 5CVUA 2K4BA 3TOAA 1MJ9A 2R7DA 2XASA 3ECOA 2ZMEA 3C1DA 3RDIA 2VN2A 1XMKA 4RB0A 4RAYA 1IUYA 3IC7A 1TQPA 5JVTA 1BC8C 1GXQA 3E5UA 3WTTC 1G3SA 2FNAA 1F4KA 3KE2A 3I4PA 4M6YA 4WXCA 3IRQA 3E5QA 4ENJA 5L3BA 2PQ8A 3I54A 4L9VA 5A2QZ 1ZAOA 2K86A 4MTDA 4BHCA 2C6YA 5D8KB 5K5QA 2Y48A 2ETHA 1U5TB 3CTAA 3REOA 1PP7U 2L4MA 4KT5C 1GXPA 5IT9Z 3ZMVA 3HHGA 1BI3A 2FE3A 3CO6C 1ZN2A 1YS7A 2HZTA 2FRHA 2IA2A 3FMQA 4M9ZA 4ESJA 3WG9A 3WTWC 2CO5A 3G3ZA 2QWWA 4MEXF 3Q9VA 2IA1A 4N9HA 4HQEA 2ZCWA 1SAXA 3BJOA 3QP6A 5LHHA 1JHHA 3R0JA 1P2FA 5FD5A 2M1BA 2EV5A 1U5TA 4A5NA 2MH9A 3CUOA 2QYOA 4WWCA 5AIQA 2EFPA 3BWGA 4R79A 2LSOA 3RI4A 5TRDA 3RKXA 5J8FA 5LEJA 2NYXA 3GUDA 1XGSA 5D6FA 2DO7A 3Q9SA 2YU3A 1X3UA 3ABUA 3B73A 1HW1A 4XBFA 3TQNA 3V8JA 2MLGA 3KP5A 3LWFA 3WGGA 3FXQA 2H27A 2VBZA 5DYMA 5A2QK 3BZ6A 4ZYGA 2HTSA 4Z2YA 3RKWA 1R00A 2OZUA 4YFXF 1OYIA 3VODA 4MGRA 3KEOA 1XDUA 4PGGA 2EA4A 1LDJA 4BXUA 1FBQA 2QBYB 4ZH4F 5IT9K 1XMAA 3S2WA 3R0AA 1B1BA 1K79A 4DQ2A 1FX7A 4YIFA 4BNCA 3KP6A 1TBXA 5ILUA 2EA2A 2RVCA 3WTYC 3CUQC 2F5EA 2G9WA 2HS5A 2FQ3A 2TDXA 2HYFA 3KFWX 2Y75A 3I58A 3EDPA 4RGUA 1T98A 4N0BA 2QENA 5L3GA 1DDNA 4U88A 2RNJA 3TKYA 3BPVA 4A2UA 2JZYA 1TNTA 2NNNA 2E1NA 3SQNA 1TNSA 3V7SA 4IRHA 3FM3A 2XVCA 2K7LA 5HLIA 2G7HA 3K2ZA 1OPCA 1O3QA 1O3SA 3DPTA 1B9MA 4HV6A 4CGZA 3FMSA 2QUFA 1BM9A 3I59B 2W84A 1UFMA 5ICGA 1KA8A 4JQFA 4ASNA 1T2KA 2EFWA 2RN7A 4L0ZB 2MBFA 3WTSC 3CO7C 3O6BB 4EGYA 2MH2A 1HXDA 5E17F 4L0YB 4M72A 3RYRA 5L3FA 3LSTA 2ZXJA 2BGCA 4EJTA 3K1PA 4KIFA 3L09A 1TQMA 1J5YA 2EWNA 2W85A 3ROUA 1HBXG 2K4JA 2ZJ2A 3HRMA 4M71A 5DUKA 4P9UA 4Q48A 5L3CA 4EM2A 4KMFA 3C7JA 2FSWA 4PCQA 1FWZA 3DFGA 4L5IA 4UNOA 2XV4S 1WSUA 2COMA 2VOPA 4HW0A 3DXJF 5AONA 2UXNA 1ZLKA 2FF4A 2GXBA 5ED4A 3EETA 1ZG3A 5TJJA 1E17A 4QLCU 4HZFA 2RKHA 1YYVA 4I7HA 4Q4ZF 4ZYHA 4KN7X 2EFOA 4Q5SF 2P5VA 5HLHA 1ZREA 1JGSA 2YSRA 5CVVA 1HW2A 2P6SA 4G94A 2YX7A 5EEGA 3ZMDA 2ISYA 1P4AA 1ZG1A 5HOOA 1JE8A 1U5TC 3FXRA 3N97A 1UHWA 4M9XA 5BPDA 1EH6A 3WE2A 2AXLA 3KP3A 3IWZA 2FBKA 2DFIA 5JR3A 3RIRA 3GWZA 3I0TA 2D2WA 4YFNF 3V4GA 2H94A 4AD9A 4G7OF 3QPHA 2UWMA 4I01A 5CVRA 1UCRA 3RPQA 4BH9A 4XSZF 4EQQA 3HOTA 2O0YA 3E97A 4A6EA 2BV6A 2V1DA 1I27A 5HS9A 4QWQA
chains in the Genus database with same CATH superfamily
5H6RA 1I3QJ 2OD5A 4YRVA 1VQOI 3DTKA 2V1XA 2KDZA 2M45A 1IV6A 5FKLA 2W57A 1JT0A 2DW4A 3JAMZ 4LB6B 4B4CA 4YFKF 5ILSA 1PP8F 3GTOJ 1IUFA 5EEAA 3L2UA 1NG6A 4IRGA 2OV7A 3K69A 3IWFA 1H9GA 2LF7A 1YX5A 4IHTA 2DMTA 2DU9A 2XAJA 3MKLA 4B8XA 3PL8A 4CO8A 1EF4A 1WI3A 3SEZA 1XN7A 3MZYA 2L7FP 3MEXA 1XMXA 1ZARA 2FOKA 3HKZN 4A3CJ 5IPAA 2EJRA 3E5XA 3GMEA 3COAC 1YLFA 3HKZA 3CDHA 1D3YA 1ETKA 2B7EA 3GTKJ 3F6OA 3HOUJ 3MWMA 2DK8A 1OCZH 4E7ZA 4IXAA 2XIGA 3PQKA 3W2AA 1I5ZA 3KLOA 3ZGKA 5ICCA 2UZKA 5IT3A 5BS6A 3H9QA 1H8AC 3GYHX 2MLKA 2V9VA 3S15J 1TWHJ 2PFBA 3AL0C 4XN3A 3M8EA 1D5YA 2OQRA 3OSGA 3GFMA 1DQUA 5CKTA 2WY8Q 4BGDA 2RAEA 4BY7J 2BY0A 4KIBA 1WWXA 2R7VA 4A93J 1IXSB 1ZGWA 3T1BA 2KHMA 1BIBA 3CMAI 1LEBA 1V3FA 1J09A 4ESBA 3GXOA 1YJWI 1QU3A 1XC5A 4XLCA 4ZYEA 1F1ZA 1G6NA 3L00A 4XR6A 1Z67A 4LJZF 2OTLI 3ZN1A 2NVQJ 3FKIJ 4X0GA 4ESFA 3DKWA 3L7WA 5ICFA 3WTVC 1LFUP 2EFQA 2F5FA 3ZCOA 1FLIA 2IA0A 3S1QJ 5DD8A 2LF8A 3FF5A 3ABTA 1W7PB 4U0VA 2QF7A 3DTEA 3U1KA 1IJWC 4BUPA 2ZXIA 2VKDA 5DCMA 2AHQA 3FM5A 2VJJA 2HFHA 1OR7A 1T0FC 3FKJA 1WH7A 1RR7A 4OMZA 4E7SA 3L2RA 4Y15A 1J9IA 2IPQX 3HYIA 1K6OA 1LVAA 3OV8A 3VWBA 1Z3XA 3ASNH 3HJEA 1R1UA 4E7JA 1HOMA 4HSTA 1I3AA 3DU5A 5E8IA 3MCZA 3IKTA 2V9KA 3FMRA 2PMZN 1MDMA 3VSKA 4G6TB 2PMZA 2R7WA 5E18F 3JRGA 2R3SA 1ZYRF 3VYTB 2VQLA 4P1WA 3CCRI 2BXZA 4CDGA 1R5ID 1T6SA 3HEFA 3FHNA 3M1CA 3EUHA 3BQYA 3SXYA 4HRIA 3FX3A 3MD2A 3J81Z 4PZJA 4KNYA 5K7HA 2D1HA 2E19A 2Y9YA 1SFUA 2QZ8A 5C4JJ 2ID6A 2WWYA 2EV6A 1FJLA 4ZTJA 2J5OA 3E6BA 2KZGA 1W7PA 4Y17A 2FJ1A 3UNGC 3CLOA 2VL8A 5KAIC 3T8TA 2XAGA 5F0FA 2XPUA 1P92A 1S5LC 2V6EA 1QGPA 3K7AJ 1V54H 2ZFUA 3SZPA 5KNLA 1T33A 3HHHA 3OYHA 2HOEA 3Q5FA 1MJBA 1R9TJ 1IXRC 1LQ1A 4BHBA 2DQLA 1VQ6I 4A3IJ 3CP2A 1FZPB 1SFEA 2B0LA 5KAFC 1WJFA 1TWAJ 3I53A 3G1MA 4U0YA 2BE5F 1ZRCA 2CQXA 3TDUC 2VPRA 3ZMZA 2RQPA 3SEQA 1R4MB 2F4IA 1XCBA 1FOWA 3V42A 1VQ4I 2M87A 4HF1A 3PJRA 2CV1A 5F08A 3RQIA 3DV8A 1BR4A 2DFHA 1FYMA 4A5MA 1DPRA 5E3LA 2LG4A 1QPMA 3BR2A 2DA3A 2VJ5A 2WAQN 2PX9A 2MA3A 1GUUA 2LREA 3R60A 3EUKL 2O9LA 4FHTA 1YW9A 3H9GA 4OAYA 4PK4A 2A61A 3ZR8X 2HQNA 5E1WA 3PM1A 2HVQA 3FISA 2E5ZA 3M1EA 5HDKA 1YIOA 2BY2A 3LA3A 2KLOA 1OQYA 1UG2A 2IVMA 2Z3YA 4RBOA 2HDCA 1L0OC 4OIRF 4RB2C 4RLFA 1S3JA 3WODF 2KJBA 3PNYA 1S29A 1LJ9A 2Z16A 4A6DA 4BQOA 2COBA 3BTLA 3KZIC 3HOZJ 2RGVA 4NC7A 2FMLA 4RGRA 3VPRA 3I71A 4WXHA 5CVJA 4HLYA 2LRDA 2XRNA 2K5CA 4ZYDA 3VSLA 2EB7A 1B59A 2VB6A 1RKTA 1O7LA 3UR3C 5E79C 2O5RA 4BQNA 4A3KJ 1MBKA 1Q1VA 1W5TA 2CW7A 2X6OA 1V5EA 1OKRA 1A36A 1MBFA 2KJCA 2E2IJ 2HEOA 5FRMA 1AWCA 2HXIA 3DWLE 3HGGA 2LY2A 4ZDLA 3J81K 1G4DA 2RDPA 2EILH 2H8RA 1W0TA 4C2MJ 3QODA 4PJLA 3RSNA 4ANJA 3A02A 2L7MP 5GAHJ 2XGXA 3GW2A 5BMZA 3PSIA 3TMOA 1ZTRA 1A35A 1F9NA 4HBLA 3B02A 1YITI 4EM1A 5D5UB 2NOJB 2IS4A 3LQQA 4OIQF 5E3NA 1TQIA 3SDBA 4M3EA 1JXSA 4RDUA 2E1MB 1BW5A 2VT3A 2W82A 3LSGA 2XPVA 1FYKA 5FRNA 3JR9A 1ETOA 4LK0F 3GZNB 2XUBA 2ZFWA 3GLLA 4X1EA 2ZC2A 1H0MA 3K1NA 2HKOA 3S1NJ 2W24A 4ENMA 1ETVA 1ONVA 2KIMA 1R1TA 1EH7A 4DZPA 3BPXA 3QP5A 1GVDA 1V5FA 3GZ5A 1X1PA 1QVUA 2IRFG 4IQJA 2HR3A 2QQ9A 1RPWA 3ZMUA 2JRTA 1J0RA 2HWVA 3QAHA 2PN6A 2LH9A 3U2RA 5B66C 4XICA 3F3XA 1Z9CA 3PIOF 2GIVA 2ME6A 5FO5A 3H0DA 5K7FA 1D8KA 3ABMH 3L1PA 4XONA 4ENKA 4EJUA 2Q0OA 5F0CA 3EYYA 3DCFA 1OMIA 3O8GA 2GA1A 1PYVA 4P5OA 1A31A 2XKOA 4CHUA 5HS8A 3WGIA 4XSXF 1OCTC 1Y1VJ 1T38A 1S7EA 2L4AA 4EJOA 5JLWA 4R1HA 4IHVA 4TV7A 2X6XA 1S7OA 5C44J 4KYWA 1VQPI 1E3PA 1WJ5A 3OL3A 2VOOA 4KN4X 1WCMJ 2M0MA 4C2UA 2M30A 2ZNZA 3ULQB 1YTYA 3G71I 2TCTA 1QZZA 5BOXA 2E36A 2BBYA 2VBWA 2JJ7A 3JRIA 1SMTA 3HUGB 3V7RA 2OZ6A 1OISA 2CU7A 4LG0B 2IP2A 3E1SA 4JYKA 3DU6A 3PUFA 4M3FA 4U0WA 3SFZA 2M8GX 2KZVA 2EQRA 5M5YJ 3J7AY 3JW4A 1FNNA 3FIWA 3OIOA 5DEQA 4LLLA 2ZNYA 2XRLA 2M34A 3FHZA 2G7UA 2HZDA 2IS6A 2A68F 5HDNA 4WK8F 5K5OA 3W2VA 2K9SA 2KRHA 4ZZLA 1XPXA 3LSRA 9ANTA 2BZTA 2HQ5A 1UG0A 4PJJA 3C18A 3BC8A 4KT6A 4OIOF 4B09A 3OY9A 1FMVA 3OIQA 1MBGA 1VNDA 5CVIA 4AVPA 4XKBA 5IP7J 2KMUA 1RNLA 5GPCA 1U9OA 2EZKA 3EUHC 5CQEA 3F21A 3M7GA 3CESA 2HI3A 2H6CA 2YUSA 1IZ1A 3RKYA 2STWA 3IH3A 5H2FC 2WY7Q 2DA2A 1XGOA 3G1OA 3Q3SA 3KEYA 4V2FA 3TO7A 2L9SA 4L9TA 2H8WA 3WE3A 4DNCA 3RZOJ 3HUGA 1JGGA 1G59A 1R4NB 3OYIA 5LBQA 3GX4X 1LPQA 4M3DA 1FC3A 2KIFA 4LG0A 2VKVA 4XRSA 3GLXA 4IX7A 1OFCX 3AG4H 1I6XA 4A0ZA 2DJIA 4CCJA 1ON1A 2CH0A 4HX7A 3GFIA 2Y0SA 4I76A 5FB2A 1I50J 2KKOA 3K4LA 5ILVA 4Y4RA 2DI3A 1MZBA 2A05A 5GTIC 1U2WA 2ACJA 4BEHB 4UVBA 1T39A 2KIUA 1A6QA 4KIGA 4GDFA 3FZVA 3R4KA 3WU0A 2FQ4A 3ZPLA 1U9NA 4XLAA 1S8NA 5HDGA 1MH4A 1FT9A 2FNPA 3HC7A 3LMMA 4L18B 2JPCA 1HA8A 3WTUC 1OCOH 5EEHA 4ZYAA 3K4KA 2K40A 4HEA2 3OYFA 3H3VK 2P81A 3BTCA 5H6QA 4E70A 1HF0A 4NB5A 3AAFA 3H36A 1DP3A 3KETA 2NS8A 3WGHA 4OOIA 2FD5A 4LK1F 2DFEA 4I98B 3TO9A 2OQGA 1DPUA 2JA8J 2KFDA 2P8TA 1Z0XA 4MQVA 1JKRC 3HSFA 4M3BA 2IGOA 4P96A 2E2HJ 1BN5A 2XAHA 3PFYA 4EM0B 1U8RA 3FK6A 1W1WE 1G3YA 2O3FA 3K6GA 2FBIA 5E20A 5JHUA 2Y0MA 4LGWA 1DUXC 3WHCA 3CMMA 1ZGAA 3NAUA 2NXNB 4CXFA 4B1RA 3FBIB 2KRFA 5EF6A 2RV8A 1BOAA 2CUEA 2PJRB 4BEHA 4JX6A 2VXZA 2ZBKA 2UUZA 2LD5A 4ZTFA 1NHAA 2EK5A 5GP9A 2A6HF 3S32A 4RAZA 1ZHFA 5C3EJ 4GYIA 1R1VA 1XGMA 1KU9A 2ZSIB 4HG2A 2CWEA 3FWEA 1NH3A 1ACIA 2WAEA 3W6KB 1ZGJA 1X1DA 4ZZDA 3U21A 3DQVC 5DV5A 3QOPA 3OYDA 2GAUA 4BDYA 1G3TA 4B44A 1FIPA 1MNEA 5F1RA 5FFZA 5BPIA 4XMYA 4EATA 2KDOA 4NUBA 3W6JB 2KPMA 3K4BA 2X1DA 2JA5J 4I0AA 1USSA 2NS7A 3F23A 1UZCA 3AKZA 1KU7A 3BDDA 3P9CA 2X6YA 4HQMA 4YG2F 2JRMA 1BJZA 4BE0A 2MC4A 3ZQ7A 1MNMC 2HOAA 2OU2A 3JRFA 2XPWA 5KK1A 3FBNB 3KCCA 1WI9A 1PUFB 1FOYA 1XSXA 2X6WA 5D5XB 4BY1J 4M3GA 2DTRA 3D1NI 1S6LA 1TW3A 1H89C 4IF4A 2PJRA 2DXIA 1BIAA 4CICA 3L2CA 4LD5A 3KZYA 4RGXA 2QSGX 4PFPA 5LHIA 3A4CA 4BHPA 3HPGA 1IN8A 1K7AA 4Q47A 4LITA 2JT1A 3GO5A 4GRIA 5CYVA 3LAJA 3CMEI 2XROA 1H9TA 2JQ7A 2E35A 1YO5C 4FETA 3AG3H 4S05A 2GA2A 3Q0VA 2O61A 4C30A 3HIFA 2CG4A 1KQ0A 3FXUA 2X9DA 1ZG5A 5DM6F 5HVQC 1Z6RA 3Q0UA 2CFOA 2EINH 4LMYA 4ENNA 2BY1A 2WBMA 4MQ9F 3QQAA 1KQ9A 3C2GA 5F6FA 5DM7F 5EGOB 3DEUA 2D1VA 3L2QA 5FFXA 3ZQGA 3ERMA 1KGSA 5HS7A 3G4SI 2W25A 2EFNA 2VJ4A 1HSTA 2LP0A 2M9HA 4PSWA 2EZIA 4XLPF 1RI7A 1USTA 2HQRA 1PUFA 1AKHB 5D5WB 3IHUA 1GHCA 1Y56A 1JKQC 2CW0F 1WKMA 2O8KA 1OJLA 3KEQA 3SFIA 3I4NJ 2V79A 3DP7A 2DPDA 2E1MC 4BACA 2N8GA 1J7KA 4XM3A 1U0JA 1QA6A 2MABA 4DYQA 3OMYA 3N05A 2O6GE 3K1MA 1RIOH 2L9VA 4I0BA 5JLXA 4EVIA 4LLNA 4YIRX 1W36C 3H1CA 1Z05A 3LL7A 1ZRFA 3NARA 5DDGA 2CJJA 4OU0A 3CJNA 3K4CA 1MMDA 4LOCA 3ML6A 4IOCF 2PLYA 1RETA 2BXYA 3NQOA 5DCMB 1DP7P 4UXNA 4NNJA 4OINF 4ETSA 3IL2A 2DT7B 2UXXA 2NOGA 3J7AO 1UHMA 4UHTA 2GQQA 5DS9A 1FY7A 4CYCB 5EGOA 3PNVA 1D1BA 3OR1C 2A07F 4J00A 4I99C 3O2PE 4B43A 2R5ZB 1IDYA 3MVPA 4A3EJ 3N4MA 3RPUA 1MDMB 4M6XA 3ECHA 4A3LJ 2KQRA 1IG7A 1F43A 1AKHA 1U78A 3KP7A 1HW5A 2XB5A 4MEYF 3ZRGA 3P9KA 2F4OB 3GFJA 3CC7I 1PJRA 2GOMA 3OS2A 3DLLF 3DKYA 4LFUA 3PNTA 1MMNA 4HDUA 1VQMI 1BOBA 2VQHA 3LSHA 2DOFA 2VLAA 1F5TA 1X1CA 2X85A 2JA6J 2L9NA 3LNQA 4IEJA 4RLQA 3CJQB 2LDUA 3GTLJ 3JRCA 1R49A 1VQNI 3HOWJ 4S04A 2L7ZA 3MQ0A 3ZXSA 5EZHA 4NHJA 3IH2A 1DU0A 2IGKA 2MG4A 3Q0WA 1IAWA 2GM4A 2DPUA 3F8NA 4BDZA 4V2GA 3IP4B 2W4SA 3MZ8A 1WJBA 1ITYA 4CYCA 4D0PA 3IH4A 2AXTC 4DIQA 4IOAF 1I1GA 2KL4A 1IRGA 1CGPA 4MIMA 4GYGA 5J47A 5J8CA 2JSPA 3CCVI 4ON0A 2R5ZA 1QHGA 1FP2A 3DF8A 1G3WA 3NRVA 2A5WA 1MD0A 1YG2A 2MGQA 4MNUA 2AQFA 3DEWA 4HOBA 3E3VA 3OIPA 3C3WA 4UVCA 2Q8KA 4UV8A 2NVTJ 1R58A 5J1UA 3R6SA 1IN6A 4XOTA 2JSCA 1Y8RB 3KP2A 2XSDC 2Q1ZB 1AOYA 1HQCA 2M8EA 4E4HA 2K85A 2L02A 2M5WA 1M1EB 3JRBA 4WX9A 5DCFA 2Z5UA 4PJMA 2KRCA 2JPBA 1KU2A 3RTRA 1X19A 3CJTB 2GXAA 1QQIA 2ESHA 2E60A 5D8LB 1RR8C 4KDPA 3G6EI 3LFKA 3JAMK 3TOBA 2YX4A 3TO6A 5HLGA 4J19A 5E8GA 3CC2I 4RM3A 2X0LA 3HRSA 3D0SA 4HV5A 2PBIA 3K4JA 1LE8B 3ZQIA 3MAJA 3OOPA 3OYBA 2H09A 1LUJB 3ZQFA 1ZQ3P 1ZH5A 2HGCA 5FLVA 3LSIA 3F8MA 2J5PA 2DN0A 4RA2A 3ERED 4E7IA 2P7CB 3GBGA 3JRDA 3H92A 2H6BA 3HRTA 2EH3A 3OYGA 3FXJA 3JRAA 1XB4A 3K2AA 2I8DA 3LA7A 1NTCA 2EIMH 2F5DA 3A0HC 2O8XA 2DA6A 2L54A 4DW6A 3DKXA 2BEOA 2L5QA 4OAZA 2CV0A 1U6GA 5M5XJ 3SZTA 2ELJA 1F36A 2LNBA 2VKHA 3MMYB 2DLLA 5E1XA 2VBYA 1WJAA 2M7AA 3K9TA 1TLHB 1QZYA 2CQ7A 1YFHA 3K0LA 1IRFA 3L9FA 4GCVA 2QCOA 1D5VA 1HKTA 1L3LA 3CLQA 3ABLH 2JA7J 4WCGA 2VE9A 4LB5A 3B6AA 1R23A 1IN5A 4KUMA 4QSHA 1TT0A 4OIPF 3HOXJ 2OAZA 4U7DA 1TWCJ 2BHYA 4PJ0C 3KPHA 4AIJA 3F8BA 2DK5A 5DD4A 2CGPA 2W1OA 1POGA 3BR6A 2HXOA 5IYCJ 1LE8A 3LAPA 3O8HA 3S1MJ 1FP1D 3I5UA 4F92B 1IV8A 4PJNA 4HF2A 1X2MA 3RZDJ 3A1YA 1HCRA 1I1SA 3WG7H 2X1EA 1QO0D 2BOLA 1YI2I 4IHWA 5FJ8J 1B4AA 4NBQA 1FEXA 1BBYA 4Y13A 1SFKA 2I10A 4BKXA 5D4SA 1P9QC 3BG7A 2K9LA 3QPTA 2FMYA 3QRFF 1BI2A 3RCOA 4RAGA 2ID3A 3BG5A 1D0ZA 5KHDA 1WRJA 2E71A 3ONQA 2DYRH 2IJLA 2CQKA 3HG9A 3ELKA 4R8HA 4HYEA 2XF7A 2Z99A 3HSRA 5LEKA 3R61A 2VE8A 1XX5A 2JVGA 5GPAA 3M9AA 4KICA 2QQAA 4BU2A 3KIOA 1SD7A 4EMSA 1SFXA 1R5GA 2CFXA 1WQ2A 1PVEA 2Y69H 3JCUC 4FCYA 5D4RA 3S16J 2LY1A 1H88C 4WF2A 4FX4A 3OOUA 2ZO4A 2KISA 3PO2J 4AM3A 4UY8I 1D1AA 3FXOA 1D8JA 3LQRA 2NAZA 2P4WA 3JTGA 3SDGA 4EGZA 4BE2A 4OMYA 4DBQA 2HYGD 2XAFA 4OWRB 3HGYA 3BTIA 2V9PA 4CSWA 2WV0A 1YS6A 2ADUA 4NQWB 4O3MA 5K5RA 2HVSA 2FOWA 1TZLA 1P4XA 4W1UA 3OYJA 3G73A 1MKMA 1Z7UA 3GZ6A 4UVAA 3BJAA 2MC3A 4AIHA 1SANA 2DDBA 4EJWA 2P6TA 2FU4A 4LIVA 3S8PA 2DA1A 3F8FA 4AYBA 3HB9A 2FXAA 4M9SA 1RUNA 1KQ8A 2IS1A 5DTDA 2ELHA 1FBUA 1RUOA 2A6EF 3OYEA 2VQGA 3OYCA 1PUEE 2E2JJ 2FA5A 4AIKA 1XDSA 1IN7A 4L5JA 4ZC3A 3H5NA 2R7QA 3L2VA 2Q2EB 3TP3A 3CCLI 1FOKA 2P7VB 3ZQHA 1WFXA 4GO1A 5D5VB 1GV5A 2HYJA 1D0XA 2A3SA 5E1ZB 4MHGA 4BQAA 1OCCH 2G0EA 1X1AA 1HKSA 1Z21A 5D6EA 4QWQA 2LYCA 2M3AA 2JK3A 2OBPA 2CUFA 2MD5A 1OYWA 2H1LA 3WHBA 5J6XA 3NEUA 4XORA 3V8LA 3JTHA 4CCOA 3BR1A 4KFCA 1N25A 1R7JA 4D5FA 2CV2A 4UV9A 1ZLJA 4D1QA 2DAOA 1JT6A 2R7FA 4XLFA 3CCMI 4M73A 4KA4A 2WC2A 4BJTA 2Z33A 4NQWA 3K4MA 4YIIA 1FSEA 1BR1A 4CCNA 4E7HA 3F6VA 1YW8A 3M3YJ 4BBRJ 4PUSA 1NK3P 1YRNB 2QVOA 5HNFA 3OYNA 4AUXA 2E7XA 1DU6A 1XD7A 1R71A 2CSOA 3JREA 2GWRA 2IBDA 5EDNA 2ZJRF 2R0QC 2FX0A 3HM5A 2ISZA 1MIJA 1D1CA 2YPRA 1SVMA 2AO9A 1XSDA 1LB2A 4N9IA 1SD6A 1WH5A 1JTXA 1ZR4A 1O3TA 3RPUD 1DGWY 2K02A 1OR7C 5FLXZ 3RQ4A 2YU9J 1Y0NA 2Q2EA 3MZHA 4HDVA 1W5CC 3TW6A 2IT0A 3CCEI 3HOSA 2KIQA 1J2XA 5EG0B 3BOQA 3ZMTA 4YELA 4XRMA 4BXFA 2LY9A 4GXOA 1IGNA 3BTJA 3QU3A 4RM2A 1TTYA 1QBJA 3MKYB 3L2WA 2K27A 5FD6A 3H3UA 3TGNA 2YS9A 1TC3C 3EYIA 5AIPA 1ZRDA 2IAIA 2QEXI 4S0HB 2HU9A 4MTEA 3V8KA 4U7BA 1AA7A 4I09A 4XLNF 2DA4A 1Z77A 2DT5A 1WJCA 1XTAA 2DMQA 1A04A 1YRNA 3E6DA 4BAYA 1X2NA 2L3DA 1TP4A 3A03A 1BL0A 4IRIA 3HOYJ 2O03A 2W00A 3KYCB 2HKXA 3LOCA 3HZJA 1IO2A 2QM3A 3JRHA 2GXGA 4DGWB 5KVRA 4A12A 1FIAA 4I02A 1R22A 4LG3A 2A5YB 2Y0SN 1BJAA 4HA8A 3AG2H 1LEAA 1X1BA 2L0KA 1XSVA 1TT5B 2VJIA 3T5XA 1O57A 4WXDA 5JFRA 5EG0A 3OSFA 4XRSG 1BI0A 2GIZA 2QKLB 2WAFA 5LLQA 4O5VA 3C2HA 5JI6A 3PO3J 1STZA 1K4SA 1TW2A 3UKGA 2AS5F 2QBYA 3BCBA 2R92J 1FYLA 1UB9A 1O3RA 1W7PD 3J80Z 1SMYF 1IRZA 1T0FA 3MKZA 4ZDOA 3TW7A 4I2OA 2V1NA 2YR2A 3GCMA 1VTNC 5H20A 3G1LA 3H0GJ 4FASD 1LDDA 3GF2A 4D7NA 3SHFA 3CF2A 4G9YA 5LHGA 2D45A 3D5LA 4PSXA 1Q1HA 4V19K 2P5KA 4Y3OA 3BROA 3RKQA 5CJ9A 3RYPA 2OA4A 2STTA 4XRFA 2VC0A 1ETQA 1K6YA 1ON2A 4CZZA 2GBYA 1W5SA 1V55H 2P0WA 2F4MB 2VBXA 4E7KA 2VC1A 5M5WJ 5BQTA 5FLXK 1W4MA 5ICEA 3PFIA 4II3A 2Y30A 1HKQA 2EBIA 3CZ6A 1JTYA 1IC8A 1JJ6C 1CF7B 3EQLF 2Z1DA 4D5CA 2QLZA 1B72B 2LC2A 1B6AA 3KZZA 3M8FA 3ESWB 3VEPA 5JVGF 4Z6YA 5LGTA 4DOZA 3IKVA 3F8CA 1VQ8I 1HSJA 3E6CC 5JHFA 4B48A 2L01A 3F72A 2ZSHB 1FMWA 4HLXA 4W97A 3I59A 4ZJZA 3BQZA 3E7LA 1K83J 4G7HF 4O6JA 2M0CA 3GVAA 3LA2A 1MMGA 4K2EA 4AU7A 4A3JJ 2BVMA 5B1BH 1R36A 4BJ6C 1SVLA 5GAGJ 3HRUA 4CA0A 4UUSB 2NRAC 2XF6A 3M4OJ 4IHYA 4IPAA 4NC6A 5LRSA 2ECCA 2XB0X 3V7CA 4L9JA 3TDZC 1D0YA 3P5JA 2CYYA 4G7ZF 4RGSA 3TEDA 1R5HA 3ZMSA 2EZLA 3H5AA 3BY6A 1YHQI 1T56A 3KP4A 2DOEA 4IHXA 5CLSA 1GVJA 1SAUA 2X4HA 4MLOA 3OYAA 2P5LC 1CF7A 2F2EA 1ORKA 2LOOA 2TRTA 2BVLA 1ODDA 2XAQA 1B72A 3S3MA 1DGRM 3WTZA 3ZN0A 5M3FJ 1MSEC 1KYWA 2ECBA 2V6CA 1O7FA 1IF1A 3BJ6A 3AG1H 4BXXJ 4PDKA 4KISA 2V7FA 3QWLA 2FBHA 3E6MA 5F64A 4KITB 2LLKA 5K1YA 4E7LA 1BA5A 3KYLA 5EJCA 4JK1X 1ZKGA 2PMHA 3HDDA 4UUVA 1WJEA 2PI0A 4HX4A 4XLEA 4M74A 3S17J 4BL0B 1KONA 4HF0A 1Z91A 3CDLA 1TL8A 3S1RJ 3J80K 2XAUA 2VXDA 1GDTA 2HTJA 1XCVA 4UUSA 4HNVA 2F6CA 3DPLC 1KU3A 4RB3C 1RKWA 3BG6A 1LNWA 1UMQA 2K3PA 3RJPA 3U1DA 1J75A 2IGMA 4ITVA 2VODA 3HL2A 2VONA 1C0WA 3I64A 1N78A 1YW7A 3SJMA 1A6IA 3ISPA 1FSHA 4DYRA 1FPQA 4X6AJ 2EV0A 2XKPA 6PAXA 1ULYA 3HPHA 2QA4I 1BW6A 1TWFJ 4CCMA 4IO9F 5HODA 2D5VA 4L9NA 2JTVA 5HNHA 2BW3B 1ENHA 1SD5A 3SYTA 2V1UA 4FX0A 3IAM2 2F5CA 1V4RA 3VYRB 1QVTA 2HPIA 1JHFA 1Z6TA 5BNGA 4G8XA 2X48A 2KT0A 1Y6IA 3CDIA 1Y0UA 5DUIA 2GZWA 4RB1A 2NNYA 4HPQA 4H0EA 1MJAA 4B3XA 3WTXC 1K78B 2WTEA 1MSFC 1EV7A 2MW8A 1EA3A 3TBIA 3S2HJ 1YOVB 2E7WA 4F52A 1P4WA 3F22A 4QPOA 2DA7A 3BP8A 2RC4A 1RESA 4HX8A 1JI8A 1E2XA 3IRRA 2F5VA 4IVNA 2VIXA 1XGNA 2CRGA 1XG1A 3DPUA 2WA0A 3WU2C 4GGGA 1EH8A 2NS0A 4P9FA 1HDPA 5K7ZA 4PGHA 3JSPA 3ASOH 2NVUB 4FT8A 1W36D 5F1JA 4G6DA 3HTSB 2LMDA 1I39A 2ICWG 4B47A 4MFEA 1Y39A 2LVSA 2R7UA 2XF5A 2ESNA 4F7ZA 2B63J 2PEXA 4BYYA 5GAEJ 1B9NA 1ETYA 3KLNA 4IJAA 1U3EM 1P6RA 5L3EA 1LDKB 2BW3A 3QYEA 3TL4X 3I55I 3U9GA 2XC7A 4CCLA 3CUQB 3CD6I 5C4XJ 4XK4A 3I9V2 1S7AA 2QQ8A 3NWSA 4EV0A 3MFKA 3FDYA 3VB2A 2BYVE 2OUMA 4EEFG 4BBSJ 2M4KA 2HVRA 3CJRB 1RZ4A 1QNTA 1Z3YA 3X2QH 3HTUA 3GEZA 3H3ZA 3OYLA 1J59A 3O3KA 5FGMA 1MBEA 2A69F 1K78A 3A01B 2M4GA 2ME0A 3ZQQA 1VF9A 3CMYA 1UAAA 1R6RA 4KMUX 2DBBA 1SC7A 1IN4A 5IOYA 5LGNA 4DYCA 1S9HA 3ZP5A 3J7ZI 1Z1DA 1VZ0A 3PQJA 1PDNC 1KZHA 1FBSA 1LFPA 2XSJC 3C2BA 5HLTA 2PJPA 4Y7NJ 1SD4A 1JKOC 3P9IA 1JUPA 4XN0A 2L2OA 2QQBA 2LKPA 1BC7C 4A69C 1BI1A 1YQAA 3GFLA 3HXLA 4E6KG 3CCJI 2K9NA 1YIJI 1QZEA 1UJ8A 5J4YA 5B3SH 2F48A 2XHKA 2LBFB 3DLAA 3LSKA 1ZK8A 2X51A 2Z9OA 2HOTA 4IHSA 5KCMA 2VT2A 4LLGF 4IZZA 3QPSA 2ZMEB 3CUQA 4EJVA 1QPIA 2R7ZJ 4FTHA 1FTTA 1YE9A 5E3OA 2O7OA 4G6QA 2XGDA 4JBAA 1OYYA 2PMUA 1N77A 2DQRA 2DFFA 4UUTA 2ZKZA 3CCUI 4A3BJ 3QU6A 3PIPF 3VFZA 3A01A 4AWXB 1FTZA 3WU1B 4A0XA 2E1CA 1G8XA 3FXKA 2IW5A 1VQ7I 2PG4A 5ERIA 3JSOA 5J1YA 1MNDA 4HAMA 5B1AH 5M3MJ 3HSEA 2HPMA 4JP0A 4RS8A 2M7BA 3P7NA 1IW7F 3T8RA 5TGTA 2HDWA 3VOEA 1MGTA 2HDDA 2CUZA 5FKKA 1IXCA 2FEZA 4P55A 4CYDA 2VKEA 2MSYA 5LGUA 4A0YA 2XGCA 1KYZA 4BJ5C 4B3AA 1N75A 1REPC 5LRRA 4C3HJ 2MD0A 4MO7A 4D7MA 3GTPJ 5L3DA 2GLOA 2LBFA 3T0YA 5CVUA 2K4BA 4F93B 4RMNA 3DBHB 4IL6C 4PFOA 1UHSA 5FLMJ 3TOAA 1MJ9A 2R7DA 2XASA 3ECOA 2ZMEA 3C1DA 3RDIA 1AHDP 2VN2A 1XMKA 4RB0A 2L9RA 1OLTA 4RAYA 1IUYA 3CF5F 3F9KA 4A3DJ 3IC7A 1EKEA 2OCCH 1TQPA 5JVTA 2V26A 4Y33A 1BC8C 3W3CA 2R93J 1GXQA 3E5UA 4AVZA 3WTTC 4XL9A 3ABKH 3FXLA 2WAQA 4DJAA 1QHHD 2JVHA 1RC9A 1G3SA 3LFUA 2FNAA 4XKVA 1F4KA 3KE2A 1WVRA 3I4PA 3S93A 4XOPA 4M6YA 4WXCA 3OYKA 3E5QA 3IRQA 4ENJA 3KYDB 4JX5A 5L3BA 2PQ8A 3I54A 4IQ4A 4L9VA 5J3LA 5A2QZ 1MH3A 1ZAOA 1VQ9I 2K86A 5GADJ 2DA5A 1SEUA 1FOXA 2B9SA 1SFOJ 1X58A 5EYRA 4MTDA 2OPTA 4BHCA 2C6YA 1B8IB 5IP6A 4M6VA 3BR0A 5D8KB 5K5QA 3ZOBA 2R7RA 3ZQCA 2Y48A 2ETHA 1U5TB 3HBLA 3CTAA 3REOA 5J40A 1PP7U 2L4MA 4KT5C 4C3IJ 1GXPA 2R7SA 2GOXB 5IT9Z 3BR5A 5IP9J 3ZMVA 4C2TA 1WPKA 3HHGA 1BI3A 2FE3A 1U8BA 3S2DJ 2R5YB 3CO6C 2WB1N 4JOMA 1ZN2A 1YS7A 2RNGA 2HZTA 3K4NA 1MW7A 2FRHA 2IA2A 2WB1A 3FMQA 4M9ZA 2IEKA 3WG9A 3WTWC 4ESJA 1HDDC 1OCRH 1WGXA 2CO5A 3G3ZA 2QWWA 4MEXF 5J4VA 3Q9VA 2IA1A 1P7JA 2OF7A 3BG3A 1HC8A 2LR8A 2WV1A 2EZHA 2OJED 4N9HA 3GTJJ 2ELKA 3NWTA 5CQGA 1LVKA 5TISC 1IRXA 3DEEA 2R7XA 4I6ZA 1T08B 4AYBN 3PUBA 5J1RA 4HQEA 2ZCWA 1RRJA 1SAXA 3BJOA 3QYBA 1G2HA 3QP6A 5LHHA 1AU7A 1BR2A 4N4NB 2XDVA 3GTGJ 1JHHA 3R0JA 2EIJH 1B8IA 1X4OA 1P2FA 5FD5A 5FKNA 2M1BA 3OS1A 3OWTA 4AIDA 2EV5A 1U5TA 2CQNA 3W2WA 3M07A 3E0JB 4KJZA 4A5NA 5B5EC 2Y9ZA 3BT9A 1EJ9A 4LIUA 1GLNA 2MH9A 3CUOA 2QYOA 2DDAA 4WWCA 3CCQI 4F55A 3VYUB 1QRYA 5AIQA 4DBRA 5FROA 2R5YA 1T95A 2ZXWH 2EFPA 3BWGA 3OR2C 4D9JA 1Y1WJ 4R79A 2LSOA 3BG9A 4FE7A 2R7TA 3BR3A 3RI4A 1JUMA 5TRDA 3RKXA 4YEJA 4ABZA 5J8FA 4BS9A 2NYXA 5LEJA 2E34A 2L7KA 3GUDA 1XGSA 5D6FA 3I3LA 3A2KA 2DO7A 3Q9SA 2IS2A 2YU3A 1X3UA 2K9MA 3MKWB 3ABUA 2R4GA 3B73A 2QSHX 1HW1A 4XBFA 3TQNA 3V8JA 4UB8C 3PSFA 2MLGA 3KP5A 2K3FA 3LWFA 4J01A 1WJDA 2MYSA 1MBHA 3SZGA 2KP6A 3WGGA 1TWGJ 1Y8QB 1YX3A 2VASA 2DOAA 3AL0B 3FXQA 2NVXJ 5FKMA 2IGNA 2H27A 5E3MA 2NVYJ 2V4JC 2VBZA 5DYMA 5A2QK 3GTMJ 3BZ6A 2A6TA 4HSRA 4NC8A 4XLHA 4ZYGA 2HTSA 4Z2YA 3RKWA 1R00A 2HOSA 4FISA 2DODA 2OZUA 4C9YA 4YFXF 1OYIA 3CQZJ 2UV1A 2CS3A 1GT0C 3VODA 4FE4A 4N4OB 4MGRA 3KEOA 1XDUA 3QPLA 3QYFA 4PGGA 5FKOA 2EA4A 2DMNA 1LDJA 3BZCA 1X3WB 3H9JA 1YJNI 4BXUA 2JWTA 4CUGA 1E0EA 4L5EA 3DBRB 2RQQA 1FBQA 2QBYB 4ZH4F 5IT9K 1XMAA 4CZCA 3GTQJ 4U87A 3S2WA 4II2A 3R0AA 1X3ZB 1B1BA 1K79A 1MMAA 1A5JA 4DQ2A 3LSJA 1FX7A 4YIFA 2LKXA 1APLC 1VQLI 4BNCA 3KP6A 1TBXA 2W7NA 5ILUA 2EA2A 2RVCA 3WTYC 3S3NA 3D5RC 3CUQC 2F5EA 2G9WA 2HS5A 5LD2C 2FQ3A 2TDXA 2HYFA 4UB6C 3KFWX 2Y75A 3F0CA 4A3FJ 1VQKI 3I58A 3J7YJ 3EDPA 2EPFA 4RGUA 2VUMJ 4CCKA 1T98A 4N0BA 1K4TA 4BQQA 1T8IA 2QENA 1YJ9I 2H1KA 5L3GA 1DDNA 4U88A 2RNJA 4NDLA 3BCAA 4JX4A 3TKYA 3H5RA 3BPVA 4A2UA 2JZYA 2OC6A 2DMPA 1TNTA 2NNNA 3G2BA 2E1NA 3SQNA 1IDZA 2Y31A 3DTIA 1TNSA 3V7SA 4IRHA 2OCEA 1ERDA 3FM3A 2XVCA 2K7LA 5HLIA 2QGUA 2G7HA 2VPLA 3K2ZA 4GFBA 2LTPA 1OPCA 3BZKA 1O3QA 1O3SA 4Y52J 2JUGA 4MFDA 3DPTA 1B9MA 2DYSH 4HV6A 5F0HA 5GTHC 2M2EA 4CGZA 2DT6A 2LK2A 3FK7A 4XQFA 3FMSA 3OS0A 1LFBA 2QUFA 3AFHA 1BM9A 3I59B 2E1OA 2W84A 1UFMA 3ZQLA 4QPQA 1VFCA 4XNFA 5ICGA 1KA8A 2ZJQF 1JJ8C 3I4MJ 1VI0A 4JQFA 4ASNA 2ZMEC 2JA2A 3CCYA 2DTZA 1T2KA 2EFWA 2RN7A 4L0ZB 2MBFA 4HNTA 3WTSC 3CO7C 2X1CA 3CCSI 3O6BB 4CH7A 4EGYA 1X4PA 2K9QA 2MH2A 2VQCA 1HXDA 5E17F 3D5SC 2I5UA 3A0BC 4L0YB 3H35A 3DBLB 4M72A 3RYRA 5L3FA 3LSTA 2ZXJA 2BGCA 4EJTA 2CUJA 2VI6A 3B6CA 3K1PA 1S72I 2E5NA 4KIFA 3L09A 3CC4I 2Z2SB 1TQMA 1P7IA 2ZXHA 1MBJA 1J5YA 2EWNA 2W85A 3ROUA 1HBXG 4XIDA 3KX2A 2K4JA 2ZJ2A 3HRMA 1K61A 4M71A 5F04A 5DUKA 5CPRB 4Q48A 4P9UA 5L3CA 2EIKH 4G12A 2WADA 2CW8A 4EM2A 3IUOA 4KMFA 5F27A 3K70C 3C7JA 4FQGA 2FSWA 4PCQA 1FWZA 3DFGA 4L5IA 1SVOA 4RAFA 3VYSB 1UELB 3EUAA 4UNOA 2FUG2 2XV4S 1O4XA 1WSUA 3LSPA 2COMA 1GV2A 2QKMB 3S3OA 3IAS2 1ZR2A 2HNHA 2VOPA 1I6HJ 4HW0A 3DXJF 3S14J 2DCEA 5AONA 1WHUA 1LKXA 2BHZA 2UXNA 1ZLKA 2CQQA 2FF4A 2GXBA 5ED4A 3EETA 3QOEA 3OL4A 2R7OA 1ZG3A 2XGEA 3I56I 3FXMA 5TJJA 4H4KC 3K70D 1E17A 4QLCU 4HZFA 3OYMA 2RKHA 1YYVA 1E3OC 3W6VA 1JUSA 4I7HA 4Q4ZF 1V5GA 2ZB9A 4BE1A 5LFAA 3M8JA 4ZYHA 2RREA 4KN7X 1XS9A 2EFOA 4DZJA 4F3QA 5IYBJ 1NK2P 1OCPA 4Q5SF 1ETXA 2P5VA 5HLHA 1E3HA 2IXSA 4ZDPA 4QTRA 1ZREA 2CMPA 1JGSA 2YSRA 5CVVA 1HW2A 2LFBA 2P6SA 3CP8A 4G94A 2YX7A 1VQ5I 5IYDJ 3MN2A 1ETWA 5EEGA 3ZMDA 2ISYA 1P4AA 1ZG1A 4QIWN 5HOOA 3VDXA 1JE8A 1U5TC 3FXRA 3N97A 2DJNA 2BY3A 4XKWA 1UHWA 4M9XA 5BPDA 1EH6A 3WE2A 2AXLA 3KP3A 2W48A 2AQEA 3IWZA 2FBKA 2DFIA 3LSMA 5IOZA 5JR3A 2HQAA 1JKPC 3RIRA 4A3MJ 3GWZA 3I0TA 2D2WA 2JUCA 4YFNF 2MFZA 2JN6A 3V4GA 2H94A 4AD9A 4G7OF 4C3JJ 1MMSA 3QPHA 2UWMA 1Z7LA 4I01A 4XKCA 4A3GJ 5CVRA 4IKFA 1HLVA 1WZ2A 1UCRA 3RPQA 1W0UA 1NG7A 4BH9A 4AC0A 4XSZF 4EQQA 4F91B 3HOVJ 3HOTA 2QSFX 2LKSA 2ZJPF 2O0YA 3BLYA 1CQTA 4HNUA 3E97A 5EZGA 3TP0A 2Y2ZA 2JMWA 3EPZA 2OTJI 4A6EA 2BV6A 2DMUA 3IV5A 2V1DA 1I27A 1ZELA 5HS9A 3K10A 5IY5H
chains in the Genus database with same CATH topology
5H6RA 2OD5A 2V1XA 2M45A 2W57A 2DW4A 3JAMZ 4LB6B 4YFKF 5ILSA 1PP8F 4IRGA 3K69A 3IWFA 1H9GA 2LF7A 4IHTA 2DU9A 2XAJA 4B8XA 4CO8A 1XN7A 3MZYA 3MEXA 1ZARA 2FOKA 2EJRA 3E5XA 3COAC 1YLFA 3CDHA 1D3YA 3F6OA 3MWMA 2DK8A 4IXAA 2XIGA 3PQKA 1I5ZA 3KLOA 5ICCA 2UZKA 5IT3A 5BS6A 3GYHX 2MLKA 2V9VA 2PFBA 3M8EA 2OQRA 3GFMA 4KIBA 1WWXA 1IXSB 3T1BA 1BIBA 1LEBA 1V3FA 4ESBA 3GXOA 4ZYEA 1F1ZA 1G6NA 3L00A 4LJZF 3ZN1A 4ESFA 3DKWA 3L7WA 5ICFA 3WTVC 2EFQA 2F5FA 1FLIA 2IA0A 5DD8A 2LF8A 3FF5A 3ABTA 1W7PB 4U0VA 5DCMA 3FM5A 2HFHA 1OR7A 4OMZA 4Y15A 1J9IA 2IPQX 3HYIA 1K6OA 1LVAA 3OV8A 1R1UA 5E8IA 3MCZA 3IKTA 3FMRA 1MDMA 5E18F 2R3SA 1ZYRF 4CDGA 1T6SA 3EUHA 3SXYA 3FX3A 3J81Z 4PZJA 4KNYA 2D1HA 1SFUA 2QZ8A 2WWYA 2EV6A 2J5OA 3E6BA 1W7PA 4Y17A 3CLOA 3T8TA 2XAGA 1P92A 1QGPA 3SZPA 3HHHA 2HOEA 3Q5FA 1MJBA 1IXRC 1LQ1A 4BHBA 2DQLA 1FZPB 1SFEA 2B0LA 3I53A 4U0YA 2BE5F 3TDUC 3ZMZA 2RQPA 1XCBA 2M87A 4HF1A 3DV8A 1FYMA 4A5MA 1DPRA 1QPMA 2MA3A 3R60A 4FHTA 1YW9A 2A61A 2HQNA 5E1WA 3M1EA 5HDKA 1YIOA 3LA3A 2IVMA 2Z3YA 2HDCA 1L0OC 4OIRF 4RB2C 1S3JA 3WODF 2KJBA 1S29A 1LJ9A 4A6DA 2RGVA 2FMLA 4RGRA 3I71A 4WXHA 5CVJA 4HLYA 2XRNA 4ZYDA 2EB7A 1B59A 1O7LA 1W5TA 1OKRA 2KJCA 2HEOA 1AWCA 3J81K 1G4DA 2RDPA 2XGXA 3GW2A 5BMZA 1F9NA 4HBLA 3B02A 4EM1A 5D5UB 3LQQA 4OIQF 1TQIA 1JXSA 2VT3A 1FYKA 4LK0F 2XUBA 2ZFWA 1H0MA 3K1NA 2HKOA 2W24A 4ENMA 1ONVA 2KIMA 1R1TA 1EH7A 3BPXA 3QP5A 3GZ5A 2IRFG 2HR3A 2QQ9A 3ZMUA 2JRTA 1J0RA 2HWVA 3QAHA 2PN6A 3U2RA 3F3XA 1Z9CA 2GIVA 5FO5A 1D8KA 4ENKA 4EJUA 2Q0OA 3EYYA 1OMIA 2GA1A 4P5OA 2XKOA 4CHUA 5HS8A 3WGIA 4XSXF 1T38A 2L4AA 4EJOA 4R1HA 4TV7A 1S7OA 4KYWA 2VOOA 4KN4X 2M30A 2ZNZA 3ULQB 1YTYA 1QZZA 5BOXA 2BBYA 2VBWA 1SMTA 3V7RA 2OZ6A 4LG0B 2IP2A 4U0WA 3SFZA 3JW4A 1FNNA 5DEQA 4LLLA 2ZNYA 3FHZA 2G7UA 2A68F 5HDNA 4WK8F 5K5OA 4ZZLA 3C18A 4OIOF 4B09A 5CVIA 4AVPA 1RNLA 3F21A 3M7GA 2H6CA 1IZ1A 3RKYA 2STWA 1XGOA 3TO7A 4L9TA 3WE3A 4DNCA 3HUGA 5LBQA 3GX4X 1FC3A 2KIFA 4LG0A 3GLXA 1I6XA 4A0ZA 1ON1A 4HX7A 3GFIA 5FB2A 2KKOA 5ILVA 2DI3A 1MZBA 1U2WA 2ACJA 4UVBA 1T39A 2KIUA 4KIGA 3FZVA 3R4KA 3WU0A 3ZPLA 1S8NA 5HDGA 1FT9A 2FNPA 4L18B 2JPCA 3WTUC 5EEHA 5H6QA 4E70A 4NB5A 3AAFA 3KETA 3WGHA 4OOIA 4LK1F 4I98B 3TO9A 2OQGA 1DPUA 2P8TA 4MQVA 3HSFA 4P96A 1BN5A 2XAHA 4EM0B 1U8RA 1G3YA 2O3FA 5E20A 2FBIA 5JHUA 2Y0MA 4LGWA 1DUXC 1ZGAA 4CXFA 2KRFA 2RV8A 1BOAA 2VXZA 2ZBKA 1NHAA 2EK5A 2A6HF 4RAZA 1ZHFA 4GYIA 1R1VA 1XGMA 1KU9A 2CWEA 3FWEA 3W6KB 1ZGJA 4ZZDA 3DQVC 5DV5A 3QOPA 2GAUA 1G3TA 5F1RA 5FFZA 5BPIA 3W6JB 4I0AA 1USSA 3F23A 1KU7A 3BDDA 3P9CA 4HQMA 4YG2F 3ZQ7A 2OU2A 5KK1A 3KCCA 1WI9A 1XSXA 5D5XB 2DTRA 1S6LA 1TW3A 4IF4A 1BIAA 4CICA 3L2CA 4LD5A 3KZYA 4RGXA 5LHIA 4BHPA 1IN8A 1K7AA 4Q47A 3LAJA 2JT1A 3GO5A 5CYVA 2XROA 1H9TA 1YO5C 4S05A 2GA2A 2O61A 3HIFA 2CG4A 1KQ0A 3FXUA 1ZG5A 5HVQC 1Z6RA 4LMYA 4ENNA 4MQ9F 1KQ9A 5F6FA 3DEUA 2D1VA 5FFXA 1KGSA 5HS7A 2W25A 2EFNA 1HSTA 4XLPF 1RI7A 1USTA 2HQRA 5D5WB 3IHUA 1GHCA 2CW0F 1WKMA 3KEQA 2V79A 3DP7A 2DPDA 1J7KA 2O6GE 3K1MA 1RIOH 4I0BA 4EVIA 4LLNA 1Z05A 1ZRFA 5DDGA 4OU0A 3CJNA 3ML6A 2PLYA 1DP7P 5DCMB 3NQOA 4UXNA 4OINF 4ETSA 3IL2A 2UXXA 3J7AO 1UHMA 4UHTA 2GQQA 1FY7A 2A07F 3O2PE 3N4MA 3RPUA 1MDMB 4M6XA 3ECHA 1U78A 3KP7A 1HW5A 4MEYF 3P9KA 3GFJA 4LFUA 4HDUA 1F5TA 2LDUA 4S04A 3MQ0A 4NHJA 1IAWA 2DPUA 3F8NA 4D0PA 1I1GA 1IRGA 1CGPA 4GYGA 5J8CA 4ON0A 1FP2A 3DF8A 1G3WA 3NRVA 1MD0A 1YG2A 4MNUA 4HOBA 3E3VA 3C3WA 4UVCA 2Q8KA 4UV8A 1R58A 3R6SA 1IN6A 2JSCA 3KP2A 1AOYA 1HQCA 2M8EA 2L02A 2M5WA 4WX9A 5DCFA 2Z5UA 2JPBA 1KU2A 3RTRA 1QQIA 2ESHA 5D8LB 4KDPA 3LFKA 3JAMK 3TOBA 2YX4A 3TO6A 5HLGA 5E8GA 2X0LA 3HRSA 3D0SA 4HV5A 2PBIA 3MAJA 3OOPA 2H09A 1ZH5A 2HGCA 3F8MA 2J5PA 3ERED 2P7CB 3H92A 2H6BA 3HRTA 1XB4A 3LA7A 2F5DA 2O8XA 2L54A 2BEOA 1U6GA 3SZTA 2LNBA 2DLLA 5E1XA 2VBYA 3K9TA 1TLHB 1QZYA 1YFHA 3K0LA 1IRFA 3L9FA 4GCVA 1D5VA 1HKTA 1L3LA 4WCGA 2VE9A 4LB5A 1R23A 1IN5A 4KUMA 4OIPF 2OAZA 4U7DA 4AIJA 3F8BA 2DK5A 5DD4A 2CGPA 3LAPA 1FP1D 3I5UA 4HF2A 1I1SA 1QO0D 1B4AA 1BBYA 4Y13A 5D4SA 3QPTA 2FMYA 3QRFF 1BI2A 1WRJA 2IJLA 2CQKA 3ELKA 4R8HA 4HYEA 2Z99A 3HSRA 5LEKA 3R61A 2VE8A 3M9AA 4KICA 2QQAA 1SD7A 4EMSA 1SFXA 1R5GA 2CFXA 1WQ2A 5D4RA 4WF2A 4FX4A 2ZO4A 1D8JA 3LQRA 2NAZA 2P4WA 3JTGA 4EGZA 4OMYA 2HYGD 2XAFA 2WV0A 1YS6A 2ADUA 4O3MA 5K5RA 1P4XA 3G73A 1MKMA 1Z7UA 3GZ6A 4UVAA 3BJAA 2MC3A 4AIHA 4EJWA 2P6TA 2FU4A 3F8FA 2FXAA 4M9SA 1RUNA 1KQ8A 2ELHA 1FBUA 1RUOA 2A6EF 1PUEE 2FA5A 4AIKA 1XDSA 1IN7A 4L5JA 1FOKA 2P7VB 4GO1A 5D5VB 2A3SA 5E1ZB 4MHGA 4BQAA 1HKSA 5D6EA 2OBPA 1OYWA 2MD5A 5J6XA 3NEUA 3V8LA 3JTHA 4KFCA 1R7JA 4UV9A 1ZLJA 2DAOA 2R7FA 4KA4A 4M73A 2WC2A 2Z33A 4NQWA 4YIIA 1FSEA 3F6VA 1YW8A 2QVOA 2E7XA 1XD7A 2CSOA 2GWRA 2ISZA 2YPRA 1XSDA 1LB2A 4N9IA 1SD6A 1O3TA 2K02A 5FLXZ 3MZHA 2Q2EA 4HDVA 2IT0A 3HOSA 1J2XA 3BOQA 3ZMTA 4GXOA 3QU3A 1TTYA 1QBJA 2K27A 5FD6A 3H3UA 3TGNA 3EYIA 5AIPA 1ZRDA 4MTEA 3V8KA 4U7BA 4I09A 4XLNF 2DT5A 1A04A 3E6DA 4BAYA 2L3DA 4IRIA 2O03A 2HKXA 2QM3A 2GXGA 5KVRA 4A12A 4I02A 1R22A 2A5YB 1BJAA 4HA8A 1LEAA 1XSVA 3T5XA 1O57A 4WXDA 5JFRA 1BI0A 5LLQA 4O5VA 5JI6A 1STZA 1TW2A 2AS5F 2QBYA 1FYLA 1UB9A 1O3RA 1W7PD 3J80Z 1SMYF 1T0FA 4I2OA 2YR2A 1VTNC 5H20A 1LDDA 3GF2A 3SHFA 4G9YA 5LHGA 2D45A 3D5LA 1Q1HA 2P5KA 3BROA 5CJ9A 3RYPA 2OA4A 2STTA 4XRFA 2VC0A 1ON2A 4CZZA 1W5SA 2VBXA 2VC1A 5BQTA 5FLXK 1W4MA 5ICEA 3PFIA 1HKQA 1CF7B 3EQLF 2QLZA 1B6AA 3KZZA 3M8FA 3VEPA 5LGTA 3IKVA 3F8CA 1HSJA 3E6CC 2L01A 3F72A 4HLXA 3I59A 4G7HF 4O6JA 3GVAA 3LA2A 4K2EA 1R36A 3HRUA 2NRAC 4IPAA 5LRSA 3V7CA 4L9JA 3TDZC 2CYYA 4G7ZF 4RGSA 1R5HA 3ZMSA 3BY6A 3KP4A 5CLSA 1GVJA 2X4HA 2P5LC 1CF7A 2F2EA 2XAQA 1ODDA 3WTZA 3ZN0A 1KYWA 2V6CA 1O7FA 1IF1A 3BJ6A 4PDKA 2FBHA 3E6MA 5F64A 5K1YA 4JK1X 4UUVA 2PMHA 2PI0A 4HX4A 4M74A 4HF0A 1Z91A 3J80K 2HTJA 1XCVA 3DPLC 1KU3A 4RB3C 1LNWA 3RJPA 3U1DA 1J75A 2VODA 2VONA 1C0WA 3I64A 1YW7A 3ISPA 1FSHA 1FPQA 2EV0A 2XKPA 6PAXA 1ULYA 4L9NA 2JTVA 1SD5A 2V1UA 4FX0A 2F5CA 1V4RA 1JHFA 1Z6TA 4G8XA 1Y0UA 5DUIA 2GZWA 4RB1A 2NNYA 4H0EA 1MJAA 3WTXC 1K78B 2WTEA 1EV7A 2E7WA 1P4WA 3F22A 3BP8A 2RC4A 4HX8A 1E2XA 3IRRA 4IVNA 1XGNA 4GGGA 1EH8A 2NS0A 4P9FA 4PGHA 3JSPA 4FT8A 3HTSB 4G6DA 2ESNA 4F7ZA 2PEXA 4BYYA 1B9NA 3KLNA 4IJAA 1U3EM 1P6RA 5L3EA 1LDKB 3U9GA 3CUQB 1S7AA 4EV0A 3MFKA 3VB2A 2BYVE 1RZ4A 1QNTA 3HTUA 3GEZA 3H3ZA 1J59A 3O3KA 5FGMA 2A69F 1K78A 4KMUX 2DBBA 1IN4A 5LGNA 3ZP5A 1Z1DA 1PDNC 3PQJA 1FBSA 2PJPA 1SD4A 3P9IA 2QQBA 2LKPA 1BC7C 1BI1A 1YQAA 3GFLA 2XHKA 2Z9OA 4IHSA 2VT2A 4LLGF 2ZMEB 3CUQA 4EJVA 4G6QA 4JBAA 1OYYA 2PMUA 2DQRA 2ZKZA 3QU6A 3VFZA 4AWXB 3WU1B 4A0XA 2E1CA 2IW5A 2PG4A 5ERIA 3JSOA 4HAMA 3HSEA 1ZRCA 4RS8A 3P7NA 1IW7F 3T8RA 3VOEA 1MGTA 1IXCA 2FEZA 4P55A 4CYDA 5LGUA 4A0YA 1KYZA 1REPC 5LRRA 5L3DA 3T0YA 5CVUA 2K4BA 3TOAA 1MJ9A 2R7DA 2XASA 3ECOA 2ZMEA 3C1DA 3RDIA 2VN2A 1XMKA 4RB0A 4RAYA 1IUYA 3IC7A 1TQPA 5JVTA 1BC8C 1GXQA 3E5UA 3WTTC 1G3SA 2FNAA 1F4KA 3KE2A 3I4PA 4M6YA 4WXCA 3IRQA 3E5QA 4ENJA 5L3BA 2PQ8A 3I54A 4L9VA 5A2QZ 1ZAOA 2K86A 4MTDA 4BHCA 2C6YA 5D8KB 5K5QA 2Y48A 2ETHA 1U5TB 3CTAA 3REOA 1PP7U 2L4MA 4KT5C 1GXPA 5IT9Z 3ZMVA 3HHGA 1BI3A 2FE3A 3CO6C 1ZN2A 1YS7A 2HZTA 2FRHA 2IA2A 3FMQA 4M9ZA 4ESJA 3WG9A 3WTWC 2CO5A 3G3ZA 2QWWA 4MEXF 3Q9VA 2IA1A 4N9HA 4HQEA 2ZCWA 1SAXA 3BJOA 3QP6A 5LHHA 1JHHA 3R0JA 1P2FA 5FD5A 2M1BA 2EV5A 1U5TA 4A5NA 2MH9A 3CUOA 2QYOA 4WWCA 5AIQA 2EFPA 3BWGA 4R79A 2LSOA 3RI4A 5TRDA 3RKXA 5J8FA 5LEJA 2NYXA 3GUDA 1XGSA 5D6FA 2DO7A 3Q9SA 2YU3A 1X3UA 3ABUA 3B73A 1HW1A 4XBFA 3TQNA 3V8JA 2MLGA 3KP5A 3LWFA 3WGGA 3FXQA 2H27A 2VBZA 5DYMA 5A2QK 3BZ6A 4ZYGA 2HTSA 4Z2YA 3RKWA 1R00A 2OZUA 4YFXF 1OYIA 3VODA 4MGRA 3KEOA 1XDUA 4PGGA 2EA4A 1LDJA 4BXUA 1FBQA 2QBYB 4ZH4F 5IT9K 1XMAA 3S2WA 3R0AA 1B1BA 1K79A 4DQ2A 1FX7A 4YIFA 4BNCA 3KP6A 1TBXA 5ILUA 2EA2A 2RVCA 3WTYC 3CUQC 2F5EA 2G9WA 2HS5A 2FQ3A 2TDXA 2HYFA 3KFWX 2Y75A 3I58A 3EDPA 4RGUA 1T98A 4N0BA 2QENA 5L3GA 1DDNA 4U88A 2RNJA 3TKYA 3BPVA 4A2UA 2JZYA 1TNTA 2NNNA 2E1NA 3SQNA 1TNSA 3V7SA 4IRHA 3FM3A 2XVCA 2K7LA 5HLIA 2G7HA 3K2ZA 1OPCA 1O3QA 1O3SA 3DPTA 1B9MA 4HV6A 4CGZA 3FMSA 2QUFA 1BM9A 3I59B 2W84A 1UFMA 5ICGA 1KA8A 4JQFA 4ASNA 1T2KA 2EFWA 2RN7A 4L0ZB 2MBFA 3WTSC 3CO7C 3O6BB 4EGYA 2MH2A 1HXDA 5E17F 4L0YB 4M72A 3RYRA 5L3FA 3LSTA 2ZXJA 2BGCA 4EJTA 3K1PA 4KIFA 3L09A 1TQMA 1J5YA 2EWNA 2W85A 3ROUA 1HBXG 2K4JA 2ZJ2A 3HRMA 4M71A 5DUKA 4P9UA 4Q48A 5L3CA 4EM2A 4KMFA 3C7JA 2FSWA 4PCQA 1FWZA 3DFGA 4L5IA 4UNOA 2XV4S 1WSUA 2COMA 2VOPA 4HW0A 3DXJF 5AONA 2UXNA 1ZLKA 2FF4A 2GXBA 5ED4A 3EETA 1ZG3A 5TJJA 1E17A 4QLCU 4HZFA 2RKHA 1YYVA 4I7HA 4Q4ZF 4ZYHA 4KN7X 2EFOA 4Q5SF 2P5VA 5HLHA 1ZREA 1JGSA 2YSRA 5CVVA 1HW2A 2P6SA 4G94A 2YX7A 5EEGA 3ZMDA 2ISYA 1P4AA 1ZG1A 5HOOA 1JE8A 1U5TC 3FXRA 3N97A 1UHWA 4M9XA 5BPDA 1EH6A 3WE2A 2AXLA 3KP3A 3IWZA 2FBKA 2DFIA 5JR3A 3RIRA 3GWZA 3I0TA 2D2WA 4YFNF 3V4GA 2H94A 4AD9A 4G7OF 3QPHA 2UWMA 4I01A 5CVRA 1UCRA 3RPQA 4BH9A 4XSZF 4EQQA 3HOTA 2O0YA 3E97A 4A6EA 2BV6A 2V1DA 1I27A 5HS9A 4QWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H6R A;  2OD5 A;  2V1X A;  2M45 A;  2W57 A;  2DW4 A;  3JAM Z;  4LB6 B;  4YFK F;  5ILS A;  1PP8 F;  4IRG A;  3K69 A;  3IWF A;  1H9G A;  2LF7 A;  4IHT A;  2DU9 A;  2XAJ A;  4B8X A;  4CO8 A;  1XN7 A;  3MZY A;  3MEX A;  1ZAR A;  2FOK A;  2EJR A;  3E5X A;  3COA C;  1YLF A;  3CDH A;  1D3Y A;  3F6O A;  3MWM A;  2DK8 A;  4IXA A;  2XIG A;  3PQK A;  1I5Z A;  3KLO A;  5ICC A;  2UZK A;  5IT3 A;  5BS6 A;  3GYH X;  2MLK A;  2V9V A;  2PFB A;  3M8E A;  2OQR A;  3GFM A;  4KIB A;  1WWX A;  1IXS B;  3T1B A;  1BIB A;  1LEB A;  1V3F A;  4ESB A;  3GXO A;  4ZYE A;  1F1Z A;  1G6N A;  3L00 A;  4LJZ F;  3ZN1 A;  4ESF A;  3DKW A;  3L7W A;  5ICF A;  3WTV C;  2EFQ A;  2F5F A;  1FLI A;  2IA0 A;  5DD8 A;  2LF8 A;  3FF5 A;  3ABT A;  1W7P B;  4U0V A;  5DCM A;  3FM5 A;  2HFH A;  1OR7 A;  4OMZ A;  4Y15 A;  1J9I A;  2IPQ X;  3HYI A;  1K6O A;  1LVA A;  3OV8 A;  1R1U A;  5E8I A;  3MCZ A;  3IKT A;  3FMR A;  1MDM A;  5E18 F;  2R3S A;  1ZYR F;  4CDG A;  1T6S A;  3EUH A;  3SXY A;  3FX3 A;  3J81 Z;  4PZJ A;  4KNY A;  2D1H A;  1SFU A;  2QZ8 A;  2WWY A;  2EV6 A;  2J5O A;  3E6B A;  1W7P A;  4Y17 A;  3CLO A;  3T8T A;  2XAG A;  1P92 A;  1QGP A;  3SZP A;  3HHH A;  2HOE A;  3Q5F A;  1MJB A;  1IXR C;  1LQ1 A;  4BHB A;  2DQL A;  1FZP B;  1SFE A;  2B0L A;  3I53 A;  4U0Y A;  2BE5 F;  3TDU C;  3ZMZ A;  2RQP A;  1XCB A;  2M87 A;  4HF1 A;  3DV8 A;  1FYM A;  4A5M A;  1DPR A;  1QPM A;  2MA3 A;  3R60 A;  4FHT A;  1YW9 A;  2A61 A;  2HQN A;  5E1W A;  3M1E A;  5HDK A;  1YIO A;  3LA3 A;  2IVM A;  2Z3Y A;  2HDC A;  1L0O C;  4OIR F;  4RB2 C;  1S3J A;  3WOD F;  2KJB A;  1S29 A;  1LJ9 A;  4A6D A;  2RGV A;  2FML A;  4RGR A;  3I71 A;  4WXH A;  5CVJ A;  4HLY A;  2XRN A;  4ZYD A;  2EB7 A;  1B59 A;  1O7L A;  1W5T A;  1OKR A;  2KJC A;  2HEO A;  1AWC A;  3J81 K;  1G4D A;  2RDP A;  2XGX A;  3GW2 A;  5BMZ A;  1F9N A;  4HBL A;  3B02 A;  4EM1 A;  5D5U B;  3LQQ A;  4OIQ F;  1TQI A;  1JXS A;  2VT3 A;  1FYK A;  4LK0 F;  2XUB A;  2ZFW A;  1H0M A;  3K1N A;  2HKO A;  2W24 A;  4ENM A;  1ONV A;  2KIM A;  1R1T A;  1EH7 A;  3BPX A;  3QP5 A;  3GZ5 A;  2IRF G;  2HR3 A;  2QQ9 A;  3ZMU A;  2JRT A;  1J0R A;  2HWV A;  3QAH A;  2PN6 A;  3U2R A;  3F3X A;  1Z9C A;  2GIV A;  5FO5 A;  1D8K A;  4ENK A;  4EJU A;  2Q0O A;  3EYY A;  1OMI A;  2GA1 A;  4P5O A;  2XKO A;  4CHU A;  5HS8 A;  3WGI A;  4XSX F;  1T38 A;  2L4A A;  4EJO A;  4R1H A;  4TV7 A;  1S7O A;  4KYW A;  2VOO A;  4KN4 X;  2M30 A;  2ZNZ A;  3ULQ B;  1YTY A;  1QZZ A;  5BOX A;  2BBY A;  2VBW A;  1SMT A;  3V7R A;  2OZ6 A;  4LG0 B;  2IP2 A;  4U0W A;  3SFZ A;  3JW4 A;  1FNN A;  5DEQ A;  4LLL A;  2ZNY A;  3FHZ A;  2G7U A;  2A68 F;  5HDN A;  4WK8 F;  5K5O A;  4ZZL A;  3C18 A;  4OIO F;  4B09 A;  5CVI A;  4AVP A;  1RNL A;  3F21 A;  3M7G A;  2H6C A;  1IZ1 A;  3RKY A;  2STW A;  1XGO A;  3TO7 A;  4L9T A;  3WE3 A;  4DNC A;  3HUG A;  5LBQ A;  3GX4 X;  1FC3 A;  2KIF A;  4LG0 A;  3GLX A;  1I6X A;  4A0Z A;  1ON1 A;  4HX7 A;  3GFI A;  5FB2 A;  2KKO A;  5ILV A;  2DI3 A;  1MZB A;  1U2W A;  2ACJ A;  4UVB A;  1T39 A;  2KIU A;  4KIG A;  3FZV A;  3R4K A;  3WU0 A;  3ZPL A;  1S8N A;  5HDG A;  1FT9 A;  2FNP A;  4L18 B;  2JPC A;  3WTU C;  5EEH A;  5H6Q A;  4E70 A;  4NB5 A;  3AAF A;  3KET A;  3WGH A;  4OOI A;  4LK1 F;  4I98 B;  3TO9 A;  2OQG A;  1DPU A;  2P8T A;  4MQV A;  3HSF A;  4P96 A;  1BN5 A;  2XAH A;  4EM0 B;  1U8R A;  1G3Y A;  2O3F A;  5E20 A;  2FBI A;  5JHU A;  2Y0M A;  4LGW A;  1DUX C;  1ZGA A;  4CXF A;  2KRF A;  2RV8 A;  1BOA A;  2VXZ A;  2ZBK A;  1NHA A;  2EK5 A;  2A6H F;  4RAZ A;  1ZHF A;  4GYI A;  1R1V A;  1XGM A;  1KU9 A;  2CWE A;  3FWE A;  3W6K B;  1ZGJ A;  4ZZD A;  3DQV C;  5DV5 A;  3QOP A;  2GAU A;  1G3T A;  5F1R A;  5FFZ A;  5BPI A;  3W6J B;  4I0A A;  1USS A;  3F23 A;  1KU7 A;  3BDD A;  3P9C A;  4HQM A;  4YG2 F;  3ZQ7 A;  2OU2 A;  5KK1 A;  3KCC A;  1WI9 A;  1XSX A;  5D5X B;  2DTR A;  1S6L A;  1TW3 A;  4IF4 A;  1BIA A;  4CIC A;  3L2C A;  4LD5 A;  3KZY A;  4RGX A;  5LHI A;  4BHP A;  1IN8 A;  1K7A A;  4Q47 A;  3LAJ A;  2JT1 A;  3GO5 A;  5CYV A;  2XRO A;  1H9T A;  1YO5 C;  4S05 A;  2GA2 A;  2O61 A;  3HIF A;  2CG4 A;  1KQ0 A;  3FXU A;  1ZG5 A;  5HVQ C;  1Z6R A;  4LMY A;  4ENN A;  4MQ9 F;  1KQ9 A;  5F6F A;  3DEU A;  2D1V A;  5FFX A;  1KGS A;  5HS7 A;  2W25 A;  2EFN A;  1HST A;  4XLP F;  1RI7 A;  1UST A;  2HQR A;  5D5W B;  3IHU A;  1GHC A;  2CW0 F;  1WKM A;  3KEQ A;  2V79 A;  3DP7 A;  2DPD A;  1J7K A;  2O6G E;  3K1M A;  1RIO H;  4I0B A;  4EVI A;  4LLN A;  1Z05 A;  1ZRF A;  5DDG A;  4OU0 A;  3CJN A;  3ML6 A;  2PLY A;  1DP7 P;  5DCM B;  3NQO A;  4UXN A;  4OIN F;  4ETS A;  3IL2 A;  2UXX A;  3J7A O;  1UHM A;  4UHT A;  2GQQ A;  1FY7 A;  2A07 F;  3O2P E;  3N4M A;  3RPU A;  1MDM B;  4M6X A;  3ECH A;  1U78 A;  3KP7 A;  1HW5 A;  4MEY F;  3P9K A;  3GFJ A;  4LFU A;  4HDU A;  1F5T A;  2LDU A;  4S04 A;  3MQ0 A;  4NHJ A;  1IAW A;  2DPU A;  3F8N A;  4D0P A;  1I1G A;  1IRG A;  1CGP A;  4GYG A;  5J8C A;  4ON0 A;  1FP2 A;  3DF8 A;  1G3W A;  3NRV A;  1MD0 A;  1YG2 A;  4MNU A;  4HOB A;  3E3V A;  3C3W A;  4UVC A;  2Q8K A;  4UV8 A;  1R58 A;  3R6S A;  1IN6 A;  2JSC A;  3KP2 A;  1AOY A;  1HQC A;  2M8E A;  2L02 A;  2M5W A;  4WX9 A;  5DCF A;  2Z5U A;  2JPB A;  1KU2 A;  3RTR A;  1QQI A;  2ESH A;  5D8L B;  4KDP A;  3LFK A;  3JAM K;  3TOB A;  2YX4 A;  3TO6 A;  5HLG A;  5E8G A;  2X0L A;  3HRS A;  3D0S A;  4HV5 A;  2PBI A;  3MAJ A;  3OOP A;  2H09 A;  1ZH5 A;  2HGC A;  3F8M A;  2J5P A;  3ERE D;  2P7C B;  3H92 A;  2H6B A;  3HRT A;  1XB4 A;  3LA7 A;  2F5D A;  2O8X A;  2L54 A;  2BEO A;  1U6G A;  3SZT A;  2LNB A;  2DLL A;  5E1X A;  2VBY A;  3K9T A;  1TLH B;  1QZY A;  1YFH A;  3K0L A;  1IRF A;  3L9F A;  4GCV A;  1D5V A;  1HKT A;  1L3L A;  4WCG A;  2VE9 A;  4LB5 A;  1R23 A;  1IN5 A;  4KUM A;  4OIP F;  2OAZ A;  4U7D A;  4AIJ A;  3F8B A;  2DK5 A;  5DD4 A;  2CGP A;  3LAP A;  1FP1 D;  3I5U A;  4HF2 A;  1I1S A;  1QO0 D;  1B4A A;  1BBY A;  4Y13 A;  5D4S A;  3QPT A;  2FMY A;  3QRF F;  1BI2 A;  1WRJ A;  2IJL A;  2CQK A;  3ELK A;  4R8H A;  4HYE A;  2Z99 A;  3HSR A;  5LEK A;  3R61 A;  2VE8 A;  3M9A A;  4KIC A;  2QQA A;  1SD7 A;  4EMS A;  1SFX A;  1R5G A;  2CFX A;  1WQ2 A;  5D4R A;  4WF2 A;  4FX4 A;  2ZO4 A;  1D8J A;  3LQR A;  2NAZ A;  2P4W A;  3JTG A;  4EGZ A;  4OMY A;  2HYG D;  2XAF A;  2WV0 A;  1YS6 A;  2ADU A;  4O3M A;  5K5R A;  1P4X A;  3G73 A;  1MKM A;  1Z7U A;  3GZ6 A;  4UVA A;  3BJA A;  2MC3 A;  4AIH A;  4EJW A;  2P6T A;  2FU4 A;  3F8F A;  2FXA A;  4M9S A;  1RUN A;  1KQ8 A;  2ELH A;  1FBU A;  1RUO A;  2A6E F;  1PUE E;  2FA5 A;  4AIK A;  1XDS A;  1IN7 A;  4L5J A;  1FOK A;  2P7V B;  4GO1 A;  5D5V B;  2A3S A;  5E1Z B;  4MHG A;  4BQA A;  1HKS A;  5D6E A;  2OBP A;  1OYW A;  2MD5 A;  5J6X A;  3NEU A;  3V8L A;  3JTH A;  4KFC A;  1R7J A;  4UV9 A;  1ZLJ A;  2DAO A;  2R7F A;  4KA4 A;  4M73 A;  2WC2 A;  2Z33 A;  4NQW A;  4YII A;  1FSE A;  3F6V A;  1YW8 A;  2QVO A;  2E7X A;  1XD7 A;  2CSO A;  2GWR A;  2ISZ A;  2YPR A;  1XSD A;  1LB2 A;  4N9I A;  1SD6 A;  1O3T A;  2K02 A;  5FLX Z;  3MZH A;  2Q2E A;  4HDV A;  2IT0 A;  3HOS A;  1J2X A;  3BOQ A;  3ZMT A;  4GXO A;  3QU3 A;  1TTY A;  1QBJ A;  2K27 A;  5FD6 A;  3H3U A;  3TGN A;  3EYI A;  5AIP A;  1ZRD A;  4MTE A;  3V8K A;  4U7B A;  4I09 A;  4XLN F;  2DT5 A;  1A04 A;  3E6D A;  4BAY A;  2L3D A;  4IRI A;  2O03 A;  2HKX A;  2QM3 A;  2GXG A;  5KVR A;  4A12 A;  4I02 A;  1R22 A;  2A5Y B;  1BJA A;  4HA8 A;  1LEA A;  1XSV A;  3T5X A;  1O57 A;  4WXD A;  5JFR A;  1BI0 A;  5LLQ A;  4O5V A;  5JI6 A;  1STZ A;  1TW2 A;  2AS5 F;  2QBY A;  1FYL A;  1UB9 A;  1O3R A;  1W7P D;  3J80 Z;  1SMY F;  1T0F A;  4I2O A;  2YR2 A;  1VTN C;  5H20 A;  1LDD A;  3GF2 A;  3SHF A;  4G9Y A;  5LHG A;  2D45 A;  3D5L A;  1Q1H A;  2P5K A;  3BRO A;  5CJ9 A;  3RYP A;  2OA4 A;  2STT A;  4XRF A;  2VC0 A;  1ON2 A;  4CZZ A;  1W5S A;  2VBX A;  2VC1 A;  5BQT A;  5FLX K;  1W4M A;  5ICE A;  3PFI A;  1HKQ A;  1CF7 B;  3EQL F;  2QLZ A;  1B6A A;  3KZZ A;  3M8F A;  3VEP A;  5LGT A;  3IKV A;  3F8C A;  1HSJ A;  3E6C C;  2L01 A;  3F72 A;  4HLX A;  3I59 A;  4G7H F;  4O6J A;  3GVA A;  3LA2 A;  4K2E A;  1R36 A;  3HRU A;  2NRA C;  4IPA A;  5LRS A;  3V7C A;  4L9J A;  3TDZ C;  2CYY A;  4G7Z F;  4RGS A;  1R5H A;  3ZMS A;  3BY6 A;  3KP4 A;  5CLS A;  1GVJ A;  2X4H A;  2P5L C;  1CF7 A;  2F2E A;  2XAQ A;  1ODD A;  3WTZ A;  3ZN0 A;  1KYW A;  2V6C A;  1O7F A;  1IF1 A;  3BJ6 A;  4PDK A;  2FBH A;  3E6M A;  5F64 A;  5K1Y A;  4JK1 X;  4UUV A;  2PMH A;  2PI0 A;  4HX4 A;  4M74 A;  4HF0 A;  1Z91 A;  3J80 K;  2HTJ A;  1XCV A;  3DPL C;  1KU3 A;  4RB3 C;  1LNW A;  3RJP A;  3U1D A;  1J75 A;  2VOD A;  2VON A;  1C0W A;  3I64 A;  1YW7 A;  3ISP A;  1FSH A;  1FPQ A;  2EV0 A;  2XKP A;  6PAX A;  1ULY A;  4L9N A;  2JTV A;  1SD5 A;  2V1U A;  4FX0 A;  2F5C A;  1V4R A;  1JHF A;  1Z6T A;  4G8X A;  1Y0U A;  5DUI A;  2GZW A;  4RB1 A;  2NNY A;  4H0E A;  1MJA A;  3WTX C;  1K78 B;  2WTE A;  1EV7 A;  2E7W A;  1P4W A;  3F22 A;  3BP8 A;  2RC4 A;  4HX8 A;  1E2X A;  3IRR A;  4IVN A;  1XGN A;  4GGG A;  1EH8 A;  2NS0 A;  4P9F A;  4PGH A;  3JSP A;  4FT8 A;  3HTS B;  4G6D A;  2ESN A;  4F7Z A;  2PEX A;  4BYY A;  1B9N A;  3KLN A;  4IJA A;  1U3E M;  1P6R A;  5L3E A;  1LDK B;  3U9G A;  3CUQ B;  1S7A A;  4EV0 A;  3MFK A;  3VB2 A;  2BYV E;  1RZ4 A;  1QNT A;  3HTU A;  3GEZ A;  3H3Z A;  1J59 A;  3O3K A;  5FGM A;  2A69 F;  1K78 A;  4KMU X;  2DBB A;  1IN4 A;  5LGN A;  3ZP5 A;  1Z1D A;  1PDN C;  3PQJ A;  1FBS A;  2PJP A;  1SD4 A;  3P9I A;  2QQB A;  2LKP A;  1BC7 C;  1BI1 A;  1YQA A;  3GFL A;  2XHK A;  2Z9O A;  4IHS A;  2VT2 A;  4LLG F;  2ZME B;  3CUQ A;  4EJV A;  4G6Q A;  4JBA A;  1OYY A;  2PMU A;  2DQR A;  2ZKZ A;  3QU6 A;  3VFZ A;  4AWX B;  3WU1 B;  4A0X A;  2E1C A;  2IW5 A;  2PG4 A;  5ERI A;  3JSO A;  4HAM A;  3HSE A;  1ZRC A;  4RS8 A;  3P7N A;  1IW7 F;  3T8R A;  3VOE A;  1MGT A;  1IXC A;  2FEZ A;  4P55 A;  4CYD A;  5LGU A;  4A0Y A;  1KYZ A;  1REP C;  5LRR A;  5L3D A;  3T0Y A;  5CVU A;  2K4B A;  3TOA A;  1MJ9 A;  2R7D A;  2XAS A;  3ECO A;  2ZME A;  3C1D A;  3RDI A;  2VN2 A;  1XMK A;  4RB0 A;  4RAY A;  1IUY A;  3IC7 A;  1TQP A;  5JVT A;  1BC8 C;  1GXQ A;  3E5U A;  3WTT C;  1G3S A;  2FNA A;  1F4K A;  3KE2 A;  3I4P A;  4M6Y A;  4WXC A;  3IRQ A;  3E5Q A;  4ENJ A;  5L3B A;  2PQ8 A;  3I54 A;  4L9V A;  5A2Q Z;  1ZAO A;  2K86 A;  4MTD A;  4BHC A;  2C6Y A;  5D8K B;  5K5Q A;  2Y48 A;  2ETH A;  1U5T B;  3CTA A;  3REO A;  1PP7 U;  2L4M A;  4KT5 C;  1GXP A;  5IT9 Z;  3ZMV A;  3HHG A;  1BI3 A;  2FE3 A;  3CO6 C;  1ZN2 A;  1YS7 A;  2HZT A;  2FRH A;  2IA2 A;  3FMQ A;  4M9Z A;  4ESJ A;  3WG9 A;  3WTW C;  2CO5 A;  3G3Z A;  2QWW A;  4MEX F;  3Q9V A;  2IA1 A;  4N9H A;  4HQE A;  2ZCW A;  1SAX A;  3BJO A;  3QP6 A;  5LHH A;  1JHH A;  3R0J A;  1P2F A;  5FD5 A;  2M1B A;  2EV5 A;  1U5T A;  4A5N A;  2MH9 A;  3CUO A;  2QYO A;  4WWC A;  5AIQ A;  2EFP A;  3BWG A;  4R79 A;  2LSO A;  3RI4 A;  5TRD A;  3RKX A;  5J8F A;  5LEJ A;  2NYX A;  3GUD A;  1XGS A;  5D6F A;  2DO7 A;  3Q9S A;  2YU3 A;  1X3U A;  3ABU A;  3B73 A;  1HW1 A;  4XBF A;  3TQN A;  3V8J A;  2MLG A;  3KP5 A;  3LWF A;  3WGG A;  3FXQ A;  2H27 A;  2VBZ A;  5DYM A;  5A2Q K;  3BZ6 A;  4ZYG A;  2HTS A;  4Z2Y A;  3RKW A;  1R00 A;  2OZU A;  4YFX F;  1OYI A;  3VOD A;  4MGR A;  3KEO A;  1XDU A;  4PGG A;  2EA4 A;  1LDJ A;  4BXU A;  1FBQ A;  2QBY B;  4ZH4 F;  5IT9 K;  1XMA A;  3S2W A;  3R0A A;  1B1B A;  1K79 A;  4DQ2 A;  1FX7 A;  4YIF A;  4BNC A;  3KP6 A;  1TBX A;  5ILU A;  2EA2 A;  2RVC A;  3WTY C;  3CUQ C;  2F5E A;  2G9W A;  2HS5 A;  2FQ3 A;  2TDX A;  2HYF A;  3KFW X;  2Y75 A;  3I58 A;  3EDP A;  4RGU A;  1T98 A;  4N0B A;  2QEN A;  5L3G A;  1DDN A;  4U88 A;  2RNJ A;  3TKY A;  3BPV A;  4A2U A;  2JZY A;  1TNT A;  2NNN A;  2E1N A;  3SQN A;  1TNS A;  3V7S A;  4IRH A;  3FM3 A;  2XVC A;  2K7L A;  5HLI A;  2G7H A;  3K2Z A;  1OPC A;  1O3Q A;  1O3S A;  3DPT A;  1B9M A;  4HV6 A;  4CGZ A;  3FMS A;  2QUF A;  1BM9 A;  3I59 B;  2W84 A;  1UFM A;  5ICG A;  1KA8 A;  4JQF A;  4ASN A;  1T2K A;  2EFW A;  2RN7 A;  4L0Z B;  2MBF A;  3WTS C;  3CO7 C;  3O6B B;  4EGY A;  2MH2 A;  1HXD A;  5E17 F;  4L0Y B;  4M72 A;  3RYR A;  5L3F A;  3LST A;  2ZXJ A;  2BGC A;  4EJT A;  3K1P A;  4KIF A;  3L09 A;  1TQM A;  1J5Y A;  2EWN A;  2W85 A;  3ROU A;  1HBX G;  2K4J A;  2ZJ2 A;  3HRM A;  4M71 A;  5DUK A;  4P9U A;  4Q48 A;  5L3C A;  4EM2 A;  4KMF A;  3C7J A;  2FSW A;  4PCQ A;  1FWZ A;  3DFG A;  4L5I A;  4UNO A;  2XV4 S;  1WSU A;  2COM A;  2VOP A;  4HW0 A;  3DXJ F;  5AON A;  2UXN A;  1ZLK A;  2FF4 A;  2GXB A;  5ED4 A;  3EET A;  1ZG3 A;  5TJJ A;  1E17 A;  4QLC U;  4HZF A;  2RKH A;  1YYV A;  4I7H A;  4Q4Z F;  4ZYH A;  4KN7 X;  2EFO A;  4Q5S F;  2P5V A;  5HLH A;  1ZRE A;  1JGS A;  2YSR A;  5CVV A;  1HW2 A;  2P6S A;  4G94 A;  2YX7 A;  5EEG A;  3ZMD A;  2ISY A;  1P4A A;  1ZG1 A;  5HOO A;  1JE8 A;  1U5T C;  3FXR A;  3N97 A;  1UHW A;  4M9X A;  5BPD A;  1EH6 A;  3WE2 A;  2AXL A;  3KP3 A;  3IWZ A;  2FBK A;  2DFI A;  5JR3 A;  3RIR A;  3GWZ A;  3I0T A;  2D2W A;  4YFN F;  3V4G A;  2H94 A;  4AD9 A;  4G7O F;  3QPH A;  2UWM A;  4I01 A;  5CVR A;  1UCR A;  3RPQ A;  4BH9 A;  4XSZ F;  4EQQ A;  3HOT A;  2O0Y A;  3E97 A;  4A6E A;  2BV6 A;  2V1D A;  1I27 A;  5HS9 A;  4QWQ A; 
#chains in the Genus database with same CATH topology
 5H6R A;  1I3Q J;  2OD5 A;  4YRV A;  1VQO I;  3DTK A;  2V1X A;  2KDZ A;  2M45 A;  1IV6 A;  5FKL A;  2W57 A;  1JT0 A;  2DW4 A;  3JAM Z;  4LB6 B;  4B4C A;  4YFK F;  5ILS A;  1PP8 F;  3GTO J;  1IUF A;  5EEA A;  3L2U A;  1NG6 A;  4IRG A;  2OV7 A;  3K69 A;  3IWF A;  1H9G A;  2LF7 A;  1YX5 A;  4IHT A;  2DMT A;  2DU9 A;  2XAJ A;  3MKL A;  4B8X A;  3PL8 A;  4CO8 A;  1EF4 A;  1WI3 A;  3SEZ A;  1XN7 A;  3MZY A;  2L7F P;  3MEX A;  1XMX A;  1ZAR A;  2FOK A;  3HKZ N;  4A3C J;  5IPA A;  2EJR A;  3E5X A;  3GME A;  3COA C;  1YLF A;  3HKZ A;  3CDH A;  1D3Y A;  1ETK A;  2B7E A;  3GTK J;  3F6O A;  3HOU J;  3MWM A;  2DK8 A;  1OCZ H;  4E7Z A;  4IXA A;  2XIG A;  3PQK A;  3W2A A;  1I5Z A;  3KLO A;  3ZGK A;  5ICC A;  2UZK A;  5IT3 A;  5BS6 A;  3H9Q A;  1H8A C;  3GYH X;  2MLK A;  2V9V A;  3S15 J;  1TWH J;  2PFB A;  3AL0 C;  4XN3 A;  3M8E A;  1D5Y A;  2OQR A;  3OSG A;  3GFM A;  1DQU A;  5CKT A;  2WY8 Q;  4BGD A;  2RAE A;  4BY7 J;  2BY0 A;  4KIB A;  1WWX A;  2R7V A;  4A93 J;  1IXS B;  1ZGW A;  3T1B A;  2KHM A;  1BIB A;  3CMA I;  1LEB A;  1V3F A;  1J09 A;  4ESB A;  3GXO A;  1YJW I;  1QU3 A;  1XC5 A;  4XLC A;  4ZYE A;  1F1Z A;  1G6N A;  3L00 A;  4XR6 A;  1Z67 A;  4LJZ F;  2OTL I;  3ZN1 A;  2NVQ J;  3FKI J;  4X0G A;  4ESF A;  3DKW A;  3L7W A;  5ICF A;  3WTV C;  1LFU P;  2EFQ A;  2F5F A;  3ZCO A;  1FLI A;  2IA0 A;  3S1Q J;  5DD8 A;  2LF8 A;  3FF5 A;  3ABT A;  1W7P B;  4U0V A;  2QF7 A;  3DTE A;  3U1K A;  1IJW C;  4BUP A;  2ZXI A;  2VKD A;  5DCM A;  2AHQ A;  3FM5 A;  2VJJ A;  2HFH A;  1OR7 A;  1T0F C;  3FKJ A;  1WH7 A;  1RR7 A;  4OMZ A;  4E7S A;  3L2R A;  4Y15 A;  1J9I A;  2IPQ X;  3HYI A;  1K6O A;  1LVA A;  3OV8 A;  3VWB A;  1Z3X A;  3ASN H;  3HJE A;  1R1U A;  4E7J A;  1HOM A;  4HST A;  1I3A A;  3DU5 A;  5E8I A;  3MCZ A;  3IKT A;  2V9K A;  3FMR A;  2PMZ N;  1MDM A;  3VSK A;  4G6T B;  2PMZ A;  2R7W A;  5E18 F;  3JRG A;  2R3S A;  1ZYR F;  3VYT B;  2VQL A;  4P1W A;  3CCR I;  2BXZ A;  4CDG A;  1R5I D;  1T6S A;  3HEF A;  3FHN A;  3M1C A;  3EUH A;  3BQY A;  3SXY A;  4HRI A;  3FX3 A;  3MD2 A;  3J81 Z;  4PZJ A;  4KNY A;  5K7H A;  2D1H A;  2E19 A;  2Y9Y A;  1SFU A;  2QZ8 A;  5C4J J;  2ID6 A;  2WWY A;  2EV6 A;  1FJL A;  4ZTJ A;  2J5O A;  3E6B A;  2KZG A;  1W7P A;  4Y17 A;  2FJ1 A;  3UNG C;  3CLO A;  2VL8 A;  5KAI C;  3T8T A;  2XAG A;  5F0F A;  2XPU A;  1P92 A;  1S5L C;  2V6E A;  1QGP A;  3K7A J;  1V54 H;  2ZFU A;  3SZP A;  5KNL A;  1T33 A;  3HHH A;  3OYH A;  2HOE A;  3Q5F A;  1MJB A;  1R9T J;  1IXR C;  1LQ1 A;  4BHB A;  2DQL A;  1VQ6 I;  4A3I J;  3CP2 A;  1FZP B;  1SFE A;  2B0L A;  5KAF C;  1WJF A;  1TWA J;  3I53 A;  3G1M A;  4U0Y A;  2BE5 F;  1ZRC A;  2CQX A;  3TDU C;  2VPR A;  3ZMZ A;  2RQP A;  3SEQ A;  1R4M B;  2F4I A;  1XCB A;  1FOW A;  3V42 A;  1VQ4 I;  2M87 A;  4HF1 A;  3PJR A;  2CV1 A;  5F08 A;  3RQI A;  3DV8 A;  1BR4 A;  2DFH A;  1FYM A;  4A5M A;  1DPR A;  5E3L A;  2LG4 A;  1QPM A;  3BR2 A;  2DA3 A;  2VJ5 A;  2WAQ N;  2PX9 A;  2MA3 A;  1GUU A;  2LRE A;  3R60 A;  3EUK L;  2O9L A;  4FHT A;  1YW9 A;  3H9G A;  4OAY A;  4PK4 A;  2A61 A;  3ZR8 X;  2HQN A;  5E1W A;  3PM1 A;  2HVQ A;  3FIS A;  2E5Z A;  3M1E A;  5HDK A;  1YIO A;  2BY2 A;  3LA3 A;  2KLO A;  1OQY A;  1UG2 A;  2IVM A;  2Z3Y A;  4RBO A;  2HDC A;  1L0O C;  4OIR F;  4RB2 C;  4RLF A;  1S3J A;  3WOD F;  2KJB A;  3PNY A;  1S29 A;  1LJ9 A;  2Z16 A;  4A6D A;  4BQO A;  2COB A;  3BTL A;  3KZI C;  3HOZ J;  2RGV A;  4NC7 A;  2FML A;  4RGR A;  3VPR A;  3I71 A;  4WXH A;  5CVJ A;  4HLY A;  2LRD A;  2XRN A;  2K5C A;  4ZYD A;  3VSL A;  2EB7 A;  1B59 A;  2VB6 A;  1RKT A;  1O7L A;  3UR3 C;  5E79 C;  2O5R A;  4BQN A;  4A3K J;  1MBK A;  1Q1V A;  1W5T A;  2CW7 A;  2X6O A;  1V5E A;  1OKR A;  1A36 A;  1MBF A;  2KJC A;  2E2I J;  2HEO A;  5FRM A;  1AWC A;  2HXI A;  3DWL E;  3HGG A;  2LY2 A;  4ZDL A;  3J81 K;  1G4D A;  2RDP A;  2EIL H;  2H8R A;  1W0T A;  4C2M J;  3QOD A;  4PJL A;  3RSN A;  4ANJ A;  3A02 A;  2L7M P;  5GAH J;  2XGX A;  3GW2 A;  5BMZ A;  3PSI A;  3TMO A;  1ZTR A;  1A35 A;  1F9N A;  4HBL A;  3B02 A;  1YIT I;  4EM1 A;  5D5U B;  2NOJ B;  2IS4 A;  3LQQ A;  4OIQ F;  5E3N A;  1TQI A;  3SDB A;  4M3E A;  1JXS A;  4RDU A;  2E1M B;  1BW5 A;  2VT3 A;  2W82 A;  3LSG A;  2XPV A;  1FYK A;  5FRN A;  3JR9 A;  1ETO A;  4LK0 F;  3GZN B;  2XUB A;  2ZFW A;  3GLL A;  4X1E A;  2ZC2 A;  1H0M A;  3K1N A;  2HKO A;  3S1N J;  2W24 A;  4ENM A;  1ETV A;  1ONV A;  2KIM A;  1R1T A;  1EH7 A;  4DZP A;  3BPX A;  3QP5 A;  1GVD A;  1V5F A;  3GZ5 A;  1X1P A;  1QVU A;  2IRF G;  4IQJ A;  2HR3 A;  2QQ9 A;  1RPW A;  3ZMU A;  2JRT A;  1J0R A;  2HWV A;  3QAH A;  2PN6 A;  2LH9 A;  3U2R A;  5B66 C;  4XIC A;  3F3X A;  1Z9C A;  3PIO F;  2GIV A;  2ME6 A;  5FO5 A;  3H0D A;  5K7F A;  1D8K A;  3ABM H;  3L1P A;  4XON A;  4ENK A;  4EJU A;  2Q0O A;  5F0C A;  3EYY A;  3DCF A;  1OMI A;  3O8G A;  2GA1 A;  1PYV A;  4P5O A;  1A31 A;  2XKO A;  4CHU A;  5HS8 A;  3WGI A;  4XSX F;  1OCT C;  1Y1V J;  1T38 A;  1S7E A;  2L4A A;  4EJO A;  5JLW A;  4R1H A;  4IHV A;  4TV7 A;  2X6X A;  1S7O A;  5C44 J;  4KYW A;  1VQP I;  1E3P A;  1WJ5 A;  3OL3 A;  2VOO A;  4KN4 X;  1WCM J;  2M0M A;  4C2U A;  2M30 A;  2ZNZ A;  3ULQ B;  1YTY A;  3G71 I;  2TCT A;  1QZZ A;  5BOX A;  2E36 A;  2BBY A;  2VBW A;  2JJ7 A;  3JRI A;  1SMT A;  3HUG B;  3V7R A;  2OZ6 A;  1OIS A;  2CU7 A;  4LG0 B;  2IP2 A;  3E1S A;  4JYK A;  3DU6 A;  3PUF A;  4M3F A;  4U0W A;  3SFZ A;  2M8G X;  2KZV A;  2EQR A;  5M5Y J;  3J7A Y;  3JW4 A;  1FNN A;  3FIW A;  3OIO A;  5DEQ A;  4LLL A;  2ZNY A;  2XRL A;  2M34 A;  3FHZ A;  2G7U A;  2HZD A;  2IS6 A;  2A68 F;  5HDN A;  4WK8 F;  5K5O A;  3W2V A;  2K9S A;  2KRH A;  4ZZL A;  1XPX A;  3LSR A;  9ANT A;  2BZT A;  2HQ5 A;  1UG0 A;  4PJJ A;  3C18 A;  3BC8 A;  4KT6 A;  4OIO F;  4B09 A;  3OY9 A;  1FMV A;  3OIQ A;  1MBG A;  1VND A;  5CVI A;  4AVP A;  4XKB A;  5IP7 J;  2KMU A;  1RNL A;  5GPC A;  1U9O A;  2EZK A;  3EUH C;  5CQE A;  3F21 A;  3M7G A;  3CES A;  2HI3 A;  2H6C A;  2YUS A;  1IZ1 A;  3RKY A;  2STW A;  3IH3 A;  5H2F C;  2WY7 Q;  2DA2 A;  1XGO A;  3G1O A;  3Q3S A;  3KEY A;  4V2F A;  3TO7 A;  2L9S A;  4L9T A;  2H8W A;  3WE3 A;  4DNC A;  3RZO J;  3HUG A;  1JGG A;  1G59 A;  1R4N B;  3OYI A;  5LBQ A;  3GX4 X;  1LPQ A;  4M3D A;  1FC3 A;  2KIF A;  4LG0 A;  2VKV A;  4XRS A;  3GLX A;  4IX7 A;  1OFC X;  3AG4 H;  1I6X A;  4A0Z A;  2DJI A;  4CCJ A;  1ON1 A;  2CH0 A;  4HX7 A;  3GFI A;  2Y0S A;  4I76 A;  5FB2 A;  1I50 J;  2KKO A;  3K4L A;  5ILV A;  4Y4R A;  2DI3 A;  1MZB A;  2A05 A;  5GTI C;  1U2W A;  2ACJ A;  4BEH B;  4UVB A;  1T39 A;  2KIU A;  1A6Q A;  4KIG A;  4GDF A;  3FZV A;  3R4K A;  3WU0 A;  2FQ4 A;  3ZPL A;  1U9N A;  4XLA A;  1S8N A;  5HDG A;  1MH4 A;  1FT9 A;  2FNP A;  3HC7 A;  3LMM A;  4L18 B;  2JPC A;  1HA8 A;  3WTU C;  1OCO H;  5EEH A;  4ZYA A;  3K4K A;  2K40 A;  4HEA 2;  3OYF A;  3H3V K;  2P81 A;  3BTC A;  5H6Q A;  4E70 A;  1HF0 A;  4NB5 A;  3AAF A;  3H36 A;  1DP3 A;  3KET A;  2NS8 A;  3WGH A;  4OOI A;  2FD5 A;  4LK1 F;  2DFE A;  4I98 B;  3TO9 A;  2OQG A;  1DPU A;  2JA8 J;  2KFD A;  2P8T A;  1Z0X A;  4MQV A;  1JKR C;  3HSF A;  4M3B A;  2IGO A;  4P96 A;  2E2H J;  1BN5 A;  2XAH A;  3PFY A;  4EM0 B;  1U8R A;  3FK6 A;  1W1W E;  1G3Y A;  2O3F A;  3K6G A;  2FBI A;  5E20 A;  5JHU A;  2Y0M A;  4LGW A;  1DUX C;  3WHC A;  3CMM A;  1ZGA A;  3NAU A;  2NXN B;  4CXF A;  4B1R A;  3FBI B;  2KRF A;  5EF6 A;  2RV8 A;  1BOA A;  2CUE A;  2PJR B;  4BEH A;  4JX6 A;  2VXZ A;  2ZBK A;  2UUZ A;  2LD5 A;  4ZTF A;  1NHA A;  2EK5 A;  5GP9 A;  2A6H F;  3S32 A;  4RAZ A;  1ZHF A;  5C3E J;  4GYI A;  1R1V A;  1XGM A;  1KU9 A;  2ZSI B;  4HG2 A;  2CWE A;  3FWE A;  1NH3 A;  1ACI A;  2WAE A;  3W6K B;  1ZGJ A;  1X1D A;  4ZZD A;  3U21 A;  3DQV C;  5DV5 A;  3QOP A;  3OYD A;  2GAU A;  4BDY A;  1G3T A;  4B44 A;  1FIP A;  1MNE A;  5F1R A;  5FFZ A;  5BPI A;  4XMY A;  4EAT A;  2KDO A;  4NUB A;  3W6J B;  2KPM A;  3K4B A;  2X1D A;  2JA5 J;  4I0A A;  1USS A;  2NS7 A;  3F23 A;  1UZC A;  3AKZ A;  1KU7 A;  3BDD A;  3P9C A;  2X6Y A;  4HQM A;  4YG2 F;  2JRM A;  1BJZ A;  4BE0 A;  2MC4 A;  3ZQ7 A;  1MNM C;  2HOA A;  2OU2 A;  3JRF A;  2XPW A;  5KK1 A;  3FBN B;  3KCC A;  1WI9 A;  1PUF B;  1FOY A;  1XSX A;  2X6W A;  5D5X B;  4BY1 J;  4M3G A;  2DTR A;  3D1N I;  1S6L A;  1TW3 A;  1H89 C;  4IF4 A;  2PJR A;  2DXI A;  1BIA A;  4CIC A;  3L2C A;  4LD5 A;  3KZY A;  4RGX A;  2QSG X;  4PFP A;  5LHI A;  3A4C A;  4BHP A;  3HPG A;  1IN8 A;  1K7A A;  4Q47 A;  4LIT A;  2JT1 A;  3GO5 A;  4GRI A;  5CYV A;  3LAJ A;  3CME I;  2XRO A;  1H9T A;  2JQ7 A;  2E35 A;  1YO5 C;  4FET A;  3AG3 H;  4S05 A;  2GA2 A;  3Q0V A;  2O61 A;  4C30 A;  3HIF A;  2CG4 A;  1KQ0 A;  3FXU A;  2X9D A;  1ZG5 A;  5DM6 F;  5HVQ C;  1Z6R A;  3Q0U A;  2CFO A;  2EIN H;  4LMY A;  4ENN A;  2BY1 A;  2WBM A;  4MQ9 F;  3QQA A;  1KQ9 A;  3C2G A;  5F6F A;  5DM7 F;  5EGO B;  3DEU A;  2D1V A;  3L2Q A;  5FFX A;  3ZQG A;  3ERM A;  1KGS A;  5HS7 A;  3G4S I;  2W25 A;  2EFN A;  2VJ4 A;  1HST A;  2LP0 A;  2M9H A;  4PSW A;  2EZI A;  4XLP F;  1RI7 A;  1UST A;  2HQR A;  1PUF A;  1AKH B;  5D5W B;  3IHU A;  1GHC A;  1Y56 A;  1JKQ C;  2CW0 F;  1WKM A;  2O8K A;  1OJL A;  3KEQ A;  3SFI A;  3I4N J;  2V79 A;  3DP7 A;  2DPD A;  2E1M C;  4BAC A;  2N8G A;  1J7K A;  4XM3 A;  1U0J A;  1QA6 A;  2MAB A;  4DYQ A;  3OMY A;  3N05 A;  2O6G E;  3K1M A;  1RIO H;  2L9V A;  4I0B A;  5JLX A;  4EVI A;  4LLN A;  4YIR X;  1W36 C;  3H1C A;  1Z05 A;  3LL7 A;  1ZRF A;  3NAR A;  5DDG A;  2CJJ A;  4OU0 A;  3CJN A;  3K4C A;  1MMD A;  4LOC A;  3ML6 A;  4IOC F;  2PLY A;  1RET A;  2BXY A;  3NQO A;  5DCM B;  1DP7 P;  4UXN A;  4NNJ A;  4OIN F;  4ETS A;  3IL2 A;  2DT7 B;  2UXX A;  2NOG A;  3J7A O;  1UHM A;  4UHT A;  2GQQ A;  5DS9 A;  1FY7 A;  4CYC B;  5EGO A;  3PNV A;  1D1B A;  3OR1 C;  2A07 F;  4J00 A;  4I99 C;  3O2P E;  4B43 A;  2R5Z B;  1IDY A;  3MVP A;  4A3E J;  3N4M A;  3RPU A;  1MDM B;  4M6X A;  3ECH A;  4A3L J;  2KQR A;  1IG7 A;  1F43 A;  1AKH A;  1U78 A;  3KP7 A;  1HW5 A;  2XB5 A;  4MEY F;  3ZRG A;  3P9K A;  2F4O B;  3GFJ A;  3CC7 I;  1PJR A;  2GOM A;  3OS2 A;  3DLL F;  3DKY A;  4LFU A;  3PNT A;  1MMN A;  4HDU A;  1VQM I;  1BOB A;  2VQH A;  3LSH A;  2DOF A;  2VLA A;  1F5T A;  1X1C A;  2X85 A;  2JA6 J;  2L9N A;  3LNQ A;  4IEJ A;  4RLQ A;  3CJQ B;  2LDU A;  3GTL J;  3JRC A;  1R49 A;  1VQN I;  3HOW J;  4S04 A;  2L7Z A;  3MQ0 A;  3ZXS A;  5EZH A;  4NHJ A;  3IH2 A;  1DU0 A;  2IGK A;  2MG4 A;  3Q0W A;  1IAW A;  2GM4 A;  2DPU A;  3F8N A;  4BDZ A;  4V2G A;  3IP4 B;  2W4S A;  3MZ8 A;  1WJB A;  1ITY A;  4CYC A;  4D0P A;  3IH4 A;  2AXT C;  4DIQ A;  4IOA F;  1I1G A;  2KL4 A;  1IRG A;  1CGP A;  4MIM A;  4GYG A;  5J47 A;  5J8C A;  2JSP A;  3CCV I;  4ON0 A;  2R5Z A;  1QHG A;  1FP2 A;  3DF8 A;  1G3W A;  3NRV A;  2A5W A;  1MD0 A;  1YG2 A;  2MGQ A;  4MNU A;  2AQF A;  3DEW A;  4HOB A;  3E3V A;  3OIP A;  3C3W A;  4UVC A;  2Q8K A;  4UV8 A;  2NVT J;  1R58 A;  5J1U A;  3R6S A;  1IN6 A;  4XOT A;  2JSC A;  1Y8R B;  3KP2 A;  2XSD C;  2Q1Z B;  1AOY A;  1HQC A;  2M8E A;  4E4H A;  2K85 A;  2L02 A;  2M5W A;  1M1E B;  3JRB A;  4WX9 A;  5DCF A;  2Z5U A;  4PJM A;  2KRC A;  2JPB A;  1KU2 A;  3RTR A;  1X19 A;  3CJT B;  2GXA A;  1QQI A;  2ESH A;  2E60 A;  5D8L B;  1RR8 C;  4KDP A;  3G6E I;  3LFK A;  3JAM K;  3TOB A;  2YX4 A;  3TO6 A;  5HLG A;  4J19 A;  5E8G A;  3CC2 I;  4RM3 A;  2X0L A;  3HRS A;  3D0S A;  4HV5 A;  2PBI A;  3K4J A;  1LE8 B;  3ZQI A;  3MAJ A;  3OOP A;  3OYB A;  2H09 A;  1LUJ B;  3ZQF A;  1ZQ3 P;  1ZH5 A;  2HGC A;  5FLV A;  3LSI A;  3F8M A;  2J5P A;  2DN0 A;  4RA2 A;  3ERE D;  4E7I A;  2P7C B;  3GBG A;  3JRD A;  3H92 A;  2H6B A;  3HRT A;  2EH3 A;  3OYG A;  3FXJ A;  3JRA A;  1XB4 A;  3K2A A;  2I8D A;  3LA7 A;  1NTC A;  2EIM H;  2F5D A;  3A0H C;  2O8X A;  2DA6 A;  2L54 A;  4DW6 A;  3DKX A;  2BEO A;  2L5Q A;  4OAZ A;  2CV0 A;  1U6G A;  5M5X J;  3SZT A;  2ELJ A;  1F36 A;  2LNB A;  2VKH A;  3MMY B;  2DLL A;  5E1X A;  2VBY A;  1WJA A;  2M7A A;  3K9T A;  1TLH B;  1QZY A;  2CQ7 A;  1YFH A;  3K0L A;  1IRF A;  3L9F A;  4GCV A;  2QCO A;  1D5V A;  1HKT A;  1L3L A;  3CLQ A;  3ABL H;  2JA7 J;  4WCG A;  2VE9 A;  4LB5 A;  3B6A A;  1R23 A;  1IN5 A;  4KUM A;  4QSH A;  1TT0 A;  4OIP F;  3HOX J;  2OAZ A;  4U7D A;  1TWC J;  2BHY A;  4PJ0 C;  3KPH A;  4AIJ A;  3F8B A;  2DK5 A;  5DD4 A;  2CGP A;  2W1O A;  1POG A;  3BR6 A;  2HXO A;  5IYC J;  1LE8 A;  3LAP A;  3O8H A;  3S1M J;  1FP1 D;  3I5U A;  4F92 B;  1IV8 A;  4PJN A;  4HF2 A;  1X2M A;  3RZD J;  3A1Y A;  1HCR A;  1I1S A;  3WG7 H;  2X1E A;  1QO0 D;  2BOL A;  1YI2 I;  4IHW A;  5FJ8 J;  1B4A A;  4NBQ A;  1FEX A;  1BBY A;  4Y13 A;  1SFK A;  2I10 A;  4BKX A;  5D4S A;  1P9Q C;  3BG7 A;  2K9L A;  3QPT A;  2FMY A;  3QRF F;  1BI2 A;  3RCO A;  4RAG A;  2ID3 A;  3BG5 A;  1D0Z A;  5KHD A;  1WRJ A;  2E71 A;  3ONQ A;  2DYR H;  2IJL A;  2CQK A;  3HG9 A;  3ELK A;  4R8H A;  4HYE A;  2XF7 A;  2Z99 A;  3HSR A;  5LEK A;  3R61 A;  2VE8 A;  1XX5 A;  2JVG A;  5GPA A;  3M9A A;  4KIC A;  2QQA A;  4BU2 A;  3KIO A;  1SD7 A;  4EMS A;  1SFX A;  1R5G A;  2CFX A;  1WQ2 A;  1PVE A;  2Y69 H;  3JCU C;  4FCY A;  5D4R A;  3S16 J;  2LY1 A;  1H88 C;  4WF2 A;  4FX4 A;  3OOU A;  2ZO4 A;  2KIS A;  3PO2 J;  4AM3 A;  4UY8 I;  1D1A A;  3FXO A;  1D8J A;  3LQR A;  2NAZ A;  2P4W A;  3JTG A;  3SDG A;  4EGZ A;  4BE2 A;  4OMY A;  4DBQ A;  2HYG D;  2XAF A;  4OWR B;  3HGY A;  3BTI A;  2V9P A;  4CSW A;  2WV0 A;  1YS6 A;  2ADU A;  4NQW B;  4O3M A;  5K5R A;  2HVS A;  2FOW A;  1TZL A;  1P4X A;  4W1U A;  3OYJ A;  3G73 A;  1MKM A;  1Z7U A;  3GZ6 A;  4UVA A;  3BJA A;  2MC3 A;  4AIH A;  1SAN A;  2DDB A;  4EJW A;  2P6T A;  2FU4 A;  4LIV A;  3S8P A;  2DA1 A;  3F8F A;  4AYB A;  3HB9 A;  2FXA A;  4M9S A;  1RUN A;  1KQ8 A;  2IS1 A;  5DTD A;  2ELH A;  1FBU A;  1RUO A;  2A6E F;  3OYE A;  2VQG A;  3OYC A;  1PUE E;  2E2J J;  2FA5 A;  4AIK A;  1XDS A;  1IN7 A;  4L5J A;  4ZC3 A;  3H5N A;  2R7Q A;  3L2V A;  2Q2E B;  3TP3 A;  3CCL I;  1FOK A;  2P7V B;  3ZQH A;  1WFX A;  4GO1 A;  5D5V B;  1GV5 A;  2HYJ A;  1D0X A;  2A3S A;  5E1Z B;  4MHG A;  4BQA A;  1OCC H;  2G0E A;  1X1A A;  1HKS A;  1Z21 A;  5D6E A;  4QWQ A;  2LYC A;  2M3A A;  2JK3 A;  2OBP A;  2CUF A;  2MD5 A;  1OYW A;  2H1L A;  3WHB A;  5J6X A;  3NEU A;  4XOR A;  3V8L A;  3JTH A;  4CCO A;  3BR1 A;  4KFC A;  1N25 A;  1R7J A;  4D5F A;  2CV2 A;  4UV9 A;  1ZLJ A;  4D1Q A;  2DAO A;  1JT6 A;  2R7F A;  4XLF A;  3CCM I;  4M73 A;  4KA4 A;  2WC2 A;  4BJT A;  2Z33 A;  4NQW A;  3K4M A;  4YII A;  1FSE A;  1BR1 A;  4CCN A;  4E7H A;  3F6V A;  1YW8 A;  3M3Y J;  4BBR J;  4PUS A;  1NK3 P;  1YRN B;  2QVO A;  5HNF A;  3OYN A;  4AUX A;  2E7X A;  1DU6 A;  1XD7 A;  1R71 A;  2CSO A;  3JRE A;  2GWR A;  2IBD A;  5EDN A;  2ZJR F;  2R0Q C;  2FX0 A;  3HM5 A;  2ISZ A;  1MIJ A;  1D1C A;  2YPR A;  1SVM A;  2AO9 A;  1XSD A;  1LB2 A;  4N9I A;  1SD6 A;  1WH5 A;  1JTX A;  1ZR4 A;  1O3T A;  3RPU D;  1DGW Y;  2K02 A;  1OR7 C;  5FLX Z;  3RQ4 A;  2YU9 J;  1Y0N A;  2Q2E A;  3MZH A;  4HDV A;  1W5C C;  3TW6 A;  2IT0 A;  3CCE I;  3HOS A;  2KIQ A;  1J2X A;  5EG0 B;  3BOQ A;  3ZMT A;  4YEL A;  4XRM A;  4BXF A;  2LY9 A;  4GXO A;  1IGN A;  3BTJ A;  3QU3 A;  4RM2 A;  1TTY A;  1QBJ A;  3MKY B;  3L2W A;  2K27 A;  5FD6 A;  3H3U A;  3TGN A;  2YS9 A;  1TC3 C;  3EYI A;  5AIP A;  1ZRD A;  2IAI A;  2QEX I;  4S0H B;  2HU9 A;  4MTE A;  3V8K A;  4U7B A;  1AA7 A;  4I09 A;  4XLN F;  2DA4 A;  1Z77 A;  2DT5 A;  1WJC A;  1XTA A;  2DMQ A;  1A04 A;  1YRN A;  3E6D A;  4BAY A;  1X2N A;  2L3D A;  1TP4 A;  3A03 A;  1BL0 A;  4IRI A;  3HOY J;  2O03 A;  2W00 A;  3KYC B;  2HKX A;  3LOC A;  3HZJ A;  1IO2 A;  2QM3 A;  3JRH A;  2GXG A;  4DGW B;  5KVR A;  4A12 A;  1FIA A;  4I02 A;  1R22 A;  4LG3 A;  2A5Y B;  2Y0S N;  1BJA A;  4HA8 A;  3AG2 H;  1LEA A;  1X1B A;  2L0K A;  1XSV A;  1TT5 B;  2VJI A;  3T5X A;  1O57 A;  4WXD A;  5JFR A;  5EG0 A;  3OSF A;  4XRS G;  1BI0 A;  2GIZ A;  2QKL B;  2WAF A;  5LLQ A;  4O5V A;  3C2H A;  5JI6 A;  3PO3 J;  1STZ A;  1K4S A;  1TW2 A;  3UKG A;  2AS5 F;  2QBY A;  3BCB A;  2R92 J;  1FYL A;  1UB9 A;  1O3R A;  1W7P D;  3J80 Z;  1SMY F;  1IRZ A;  1T0F A;  3MKZ A;  4ZDO A;  3TW7 A;  4I2O A;  2V1N A;  2YR2 A;  3GCM A;  1VTN C;  5H20 A;  3G1L A;  3H0G J;  4FAS D;  1LDD A;  3GF2 A;  4D7N A;  3SHF A;  3CF2 A;  4G9Y A;  5LHG A;  2D45 A;  3D5L A;  4PSX A;  1Q1H A;  4V19 K;  2P5K A;  4Y3O A;  3BRO A;  3RKQ A;  5CJ9 A;  3RYP A;  2OA4 A;  2STT A;  4XRF A;  2VC0 A;  1ETQ A;  1K6Y A;  1ON2 A;  4CZZ A;  2GBY A;  1W5S A;  1V55 H;  2P0W A;  2F4M B;  2VBX A;  4E7K A;  2VC1 A;  5M5W J;  5BQT A;  5FLX K;  1W4M A;  5ICE A;  3PFI A;  4II3 A;  2Y30 A;  1HKQ A;  2EBI A;  3CZ6 A;  1JTY A;  1IC8 A;  1JJ6 C;  1CF7 B;  3EQL F;  2Z1D A;  4D5C A;  2QLZ A;  1B72 B;  2LC2 A;  1B6A A;  3KZZ A;  3M8F A;  3ESW B;  3VEP A;  5JVG F;  4Z6Y A;  5LGT A;  4DOZ A;  3IKV A;  3F8C A;  1VQ8 I;  1HSJ A;  3E6C C;  5JHF A;  4B48 A;  2L01 A;  3F72 A;  2ZSH B;  1FMW A;  4HLX A;  4W97 A;  3I59 A;  4ZJZ A;  3BQZ A;  3E7L A;  1K83 J;  4G7H F;  4O6J A;  2M0C A;  3GVA A;  3LA2 A;  1MMG A;  4K2E A;  4AU7 A;  4A3J J;  2BVM A;  5B1B H;  1R36 A;  4BJ6 C;  1SVL A;  5GAG J;  3HRU A;  4CA0 A;  4UUS B;  2NRA C;  2XF6 A;  3M4O J;  4IHY A;  4IPA A;  4NC6 A;  5LRS A;  2ECC A;  2XB0 X;  3V7C A;  4L9J A;  3TDZ C;  1D0Y A;  3P5J A;  2CYY A;  4G7Z F;  4RGS A;  3TED A;  1R5H A;  3ZMS A;  2EZL A;  3H5A A;  3BY6 A;  1YHQ I;  1T56 A;  3KP4 A;  2DOE A;  4IHX A;  5CLS A;  1GVJ A;  1SAU A;  2X4H A;  4MLO A;  3OYA A;  2P5L C;  1CF7 A;  2F2E A;  1ORK A;  2LOO A;  2TRT A;  2BVL A;  1ODD A;  2XAQ A;  1B72 A;  3S3M A;  1DGR M;  3WTZ A;  3ZN0 A;  5M3F J;  1MSE C;  1KYW A;  2ECB A;  2V6C A;  1O7F A;  1IF1 A;  3BJ6 A;  3AG1 H;  4BXX J;  4PDK A;  4KIS A;  2V7F A;  3QWL A;  2FBH A;  3E6M A;  5F64 A;  4KIT B;  2LLK A;  5K1Y A;  4E7L A;  1BA5 A;  3KYL A;  5EJC A;  4JK1 X;  1ZKG A;  2PMH A;  3HDD A;  4UUV A;  1WJE A;  2PI0 A;  4HX4 A;  4XLE A;  4M74 A;  3S17 J;  4BL0 B;  1KON A;  4HF0 A;  1Z91 A;  3CDL A;  1TL8 A;  3S1R J;  3J80 K;  2XAU A;  2VXD A;  1GDT A;  2HTJ A;  1XCV A;  4UUS A;  4HNV A;  2F6C A;  3DPL C;  1KU3 A;  4RB3 C;  1RKW A;  3BG6 A;  1LNW A;  1UMQ A;  2K3P A;  3RJP A;  3U1D A;  1J75 A;  2IGM A;  4ITV A;  2VOD A;  3HL2 A;  2VON A;  1C0W A;  3I64 A;  1N78 A;  1YW7 A;  3SJM A;  1A6I A;  3ISP A;  1FSH A;  4DYR A;  1FPQ A;  4X6A J;  2EV0 A;  2XKP A;  6PAX A;  1ULY A;  3HPH A;  2QA4 I;  1BW6 A;  1TWF J;  4CCM A;  4IO9 F;  5HOD A;  2D5V A;  4L9N A;  2JTV A;  5HNH A;  2BW3 B;  1ENH A;  1SD5 A;  3SYT A;  2V1U A;  4FX0 A;  3IAM 2;  2F5C A;  1V4R A;  3VYR B;  1QVT A;  2HPI A;  1JHF A;  1Z6T A;  5BNG A;  4G8X A;  2X48 A;  2KT0 A;  1Y6I A;  3CDI A;  1Y0U A;  5DUI A;  2GZW A;  4RB1 A;  2NNY A;  4HPQ A;  4H0E A;  1MJA A;  4B3X A;  3WTX C;  1K78 B;  2WTE A;  1MSF C;  1EV7 A;  2MW8 A;  1EA3 A;  3TBI A;  3S2H J;  1YOV B;  2E7W A;  4F52 A;  1P4W A;  3F22 A;  4QPO A;  2DA7 A;  3BP8 A;  2RC4 A;  1RES A;  4HX8 A;  1JI8 A;  1E2X A;  3IRR A;  2F5V A;  4IVN A;  2VIX A;  1XGN A;  2CRG A;  1XG1 A;  3DPU A;  2WA0 A;  3WU2 C;  4GGG A;  1EH8 A;  2NS0 A;  4P9F A;  1HDP A;  5K7Z A;  4PGH A;  3JSP A;  3ASO H;  2NVU B;  4FT8 A;  1W36 D;  5F1J A;  4G6D A;  3HTS B;  2LMD A;  1I39 A;  2ICW G;  4B47 A;  4MFE A;  1Y39 A;  2LVS A;  2R7U A;  2XF5 A;  2ESN A;  4F7Z A;  2B63 J;  2PEX A;  4BYY A;  5GAE J;  1B9N A;  1ETY A;  3KLN A;  4IJA A;  1U3E M;  1P6R A;  5L3E A;  1LDK B;  2BW3 A;  3QYE A;  3TL4 X;  3I55 I;  3U9G A;  2XC7 A;  4CCL A;  3CUQ B;  3CD6 I;  5C4X J;  4XK4 A;  3I9V 2;  1S7A A;  2QQ8 A;  3NWS A;  4EV0 A;  3MFK A;  3FDY A;  3VB2 A;  2BYV E;  2OUM A;  4EEF G;  4BBS J;  2M4K A;  2HVR A;  3CJR B;  1RZ4 A;  1QNT A;  1Z3Y A;  3X2Q H;  3HTU A;  3GEZ A;  3H3Z A;  3OYL A;  1J59 A;  3O3K A;  5FGM A;  1MBE A;  2A69 F;  1K78 A;  3A01 B;  2M4G A;  2ME0 A;  3ZQQ A;  1VF9 A;  3CMY A;  1UAA A;  1R6R A;  4KMU X;  2DBB A;  1SC7 A;  1IN4 A;  5IOY A;  5LGN A;  4DYC A;  1S9H A;  3ZP5 A;  3J7Z I;  1Z1D A;  1VZ0 A;  3PQJ A;  1PDN C;  1KZH A;  1FBS A;  1LFP A;  2XSJ C;  3C2B A;  5HLT A;  2PJP A;  4Y7N J;  1SD4 A;  1JKO C;  3P9I A;  1JUP A;  4XN0 A;  2L2O A;  2QQB A;  2LKP A;  1BC7 C;  4A69 C;  1BI1 A;  1YQA A;  3GFL A;  3HXL A;  4E6K G;  3CCJ I;  2K9N A;  1YIJ I;  1QZE A;  1UJ8 A;  5J4Y A;  5B3S H;  2F48 A;  2XHK A;  2LBF B;  3DLA A;  3LSK A;  1ZK8 A;  2X51 A;  2Z9O A;  2HOT A;  4IHS A;  5KCM A;  2VT2 A;  4LLG F;  4IZZ A;  3QPS A;  2ZME B;  3CUQ A;  4EJV A;  1QPI A;  2R7Z J;  4FTH A;  1FTT A;  1YE9 A;  5E3O A;  2O7O A;  4G6Q A;  2XGD A;  4JBA A;  1OYY A;  2PMU A;  1N77 A;  2DQR A;  2DFF A;  4UUT A;  2ZKZ A;  3CCU I;  4A3B J;  3QU6 A;  3PIP F;  3VFZ A;  3A01 A;  4AWX B;  1FTZ A;  3WU1 B;  4A0X A;  2E1C A;  1G8X A;  3FXK A;  2IW5 A;  1VQ7 I;  2PG4 A;  5ERI A;  3JSO A;  5J1Y A;  1MND A;  4HAM A;  5B1A H;  5M3M J;  3HSE A;  2HPM A;  4JP0 A;  4RS8 A;  2M7B A;  3P7N A;  1IW7 F;  3T8R A;  5TGT A;  2HDW A;  3VOE A;  1MGT A;  2HDD A;  2CUZ A;  5FKK A;  1IXC A;  2FEZ A;  4P55 A;  4CYD A;  2VKE A;  2MSY A;  5LGU A;  4A0Y A;  2XGC A;  1KYZ A;  4BJ5 C;  4B3A A;  1N75 A;  1REP C;  5LRR A;  4C3H J;  2MD0 A;  4MO7 A;  4D7M A;  3GTP J;  5L3D A;  2GLO A;  2LBF A;  3T0Y A;  5CVU A;  2K4B A;  4F93 B;  4RMN A;  3DBH B;  4IL6 C;  4PFO A;  1UHS A;  5FLM J;  3TOA A;  1MJ9 A;  2R7D A;  2XAS A;  3ECO A;  2ZME A;  3C1D A;  3RDI A;  1AHD P;  2VN2 A;  1XMK A;  4RB0 A;  2L9R A;  1OLT A;  4RAY A;  1IUY A;  3CF5 F;  3F9K A;  4A3D J;  3IC7 A;  1EKE A;  2OCC H;  1TQP A;  5JVT A;  2V26 A;  4Y33 A;  1BC8 C;  3W3C A;  2R93 J;  1GXQ A;  3E5U A;  4AVZ A;  3WTT C;  4XL9 A;  3ABK H;  3FXL A;  2WAQ A;  4DJA A;  1QHH D;  2JVH A;  1RC9 A;  1G3S A;  3LFU A;  2FNA A;  4XKV A;  1F4K A;  3KE2 A;  1WVR A;  3I4P A;  3S93 A;  4XOP A;  4M6Y A;  4WXC A;  3OYK A;  3E5Q A;  3IRQ A;  4ENJ A;  3KYD B;  4JX5 A;  5L3B A;  2PQ8 A;  3I54 A;  4IQ4 A;  4L9V A;  5J3L A;  5A2Q Z;  1MH3 A;  1ZAO A;  1VQ9 I;  2K86 A;  5GAD J;  2DA5 A;  1SEU A;  1FOX A;  2B9S A;  1SFO J;  1X58 A;  5EYR A;  4MTD A;  2OPT A;  4BHC A;  2C6Y A;  1B8I B;  5IP6 A;  4M6V A;  3BR0 A;  5D8K B;  5K5Q A;  3ZOB A;  2R7R A;  3ZQC A;  2Y48 A;  2ETH A;  1U5T B;  3HBL A;  3CTA A;  3REO A;  5J40 A;  1PP7 U;  2L4M A;  4KT5 C;  4C3I J;  1GXP A;  2R7S A;  2GOX B;  5IT9 Z;  3BR5 A;  5IP9 J;  3ZMV A;  4C2T A;  1WPK A;  3HHG A;  1BI3 A;  2FE3 A;  1U8B A;  3S2D J;  2R5Y B;  3CO6 C;  2WB1 N;  4JOM A;  1ZN2 A;  1YS7 A;  2RNG A;  2HZT A;  3K4N A;  1MW7 A;  2FRH A;  2IA2 A;  2WB1 A;  3FMQ A;  4M9Z A;  2IEK A;  3WG9 A;  3WTW C;  4ESJ A;  1HDD C;  1OCR H;  1WGX A;  2CO5 A;  3G3Z A;  2QWW A;  4MEX F;  5J4V A;  3Q9V A;  2IA1 A;  1P7J A;  2OF7 A;  3BG3 A;  1HC8 A;  2LR8 A;  2WV1 A;  2EZH A;  2OJE D;  4N9H A;  3GTJ J;  2ELK A;  3NWT A;  5CQG A;  1LVK A;  5TIS C;  1IRX A;  3DEE A;  2R7X A;  4I6Z A;  1T08 B;  4AYB N;  3PUB A;  5J1R A;  4HQE A;  2ZCW A;  1RRJ A;  1SAX A;  3BJO A;  3QYB A;  1G2H A;  3QP6 A;  5LHH A;  1AU7 A;  1BR2 A;  4N4N B;  2XDV A;  3GTG J;  1JHH A;  3R0J A;  2EIJ H;  1B8I A;  1X4O A;  1P2F A;  5FD5 A;  5FKN A;  2M1B A;  3OS1 A;  3OWT A;  4AID A;  2EV5 A;  1U5T A;  2CQN A;  3W2W A;  3M07 A;  3E0J B;  4KJZ A;  4A5N A;  5B5E C;  2Y9Z A;  3BT9 A;  1EJ9 A;  4LIU A;  1GLN A;  2MH9 A;  3CUO A;  2QYO A;  2DDA A;  4WWC A;  3CCQ I;  4F55 A;  3VYU B;  1QRY A;  5AIQ A;  4DBR A;  5FRO A;  2R5Y A;  1T95 A;  2ZXW H;  2EFP A;  3BWG A;  3OR2 C;  4D9J A;  1Y1W J;  4R79 A;  2LSO A;  3BG9 A;  4FE7 A;  2R7T A;  3BR3 A;  3RI4 A;  1JUM A;  5TRD A;  3RKX A;  4YEJ A;  4ABZ A;  5J8F A;  4BS9 A;  2NYX A;  5LEJ A;  2E34 A;  2L7K A;  3GUD A;  1XGS A;  5D6F A;  3I3L A;  3A2K A;  2DO7 A;  3Q9S A;  2IS2 A;  2YU3 A;  1X3U A;  2K9M A;  3MKW B;  3ABU A;  2R4G A;  3B73 A;  2QSH X;  1HW1 A;  4XBF A;  3TQN A;  3V8J A;  4UB8 C;  3PSF A;  2MLG A;  3KP5 A;  2K3F A;  3LWF A;  4J01 A;  1WJD A;  2MYS A;  1MBH A;  3SZG A;  2KP6 A;  3WGG A;  1TWG J;  1Y8Q B;  1YX3 A;  2VAS A;  2DOA A;  3AL0 B;  3FXQ A;  2NVX J;  5FKM A;  2IGN A;  2H27 A;  5E3M A;  2NVY J;  2V4J C;  2VBZ A;  5DYM A;  5A2Q K;  3GTM J;  3BZ6 A;  2A6T A;  4HSR A;  4NC8 A;  4XLH A;  4ZYG A;  2HTS A;  4Z2Y A;  3RKW A;  1R00 A;  2HOS A;  4FIS A;  2DOD A;  2OZU A;  4C9Y A;  4YFX F;  1OYI A;  3CQZ J;  2UV1 A;  2CS3 A;  1GT0 C;  3VOD A;  4FE4 A;  4N4O B;  4MGR A;  3KEO A;  1XDU A;  3QPL A;  3QYF A;  4PGG A;  5FKO A;  2EA4 A;  2DMN A;  1LDJ A;  3BZC A;  1X3W B;  3H9J A;  1YJN I;  4BXU A;  2JWT A;  4CUG A;  1E0E A;  4L5E A;  3DBR B;  2RQQ A;  1FBQ A;  2QBY B;  4ZH4 F;  5IT9 K;  1XMA A;  4CZC A;  3GTQ J;  4U87 A;  3S2W A;  4II2 A;  3R0A A;  1X3Z B;  1B1B A;  1K79 A;  1MMA A;  1A5J A;  4DQ2 A;  3LSJ A;  1FX7 A;  4YIF A;  2LKX A;  1APL C;  1VQL I;  4BNC A;  3KP6 A;  1TBX A;  2W7N A;  5ILU A;  2EA2 A;  2RVC A;  3WTY C;  3S3N A;  3D5R C;  3CUQ C;  2F5E A;  2G9W A;  2HS5 A;  5LD2 C;  2FQ3 A;  2TDX A;  2HYF A;  4UB6 C;  3KFW X;  2Y75 A;  3F0C A;  4A3F J;  1VQK I;  3I58 A;  3J7Y J;  3EDP A;  2EPF A;  4RGU A;  2VUM J;  4CCK A;  1T98 A;  4N0B A;  1K4T A;  4BQQ A;  1T8I A;  2QEN A;  1YJ9 I;  2H1K A;  5L3G A;  1DDN A;  4U88 A;  2RNJ A;  4NDL A;  3BCA A;  4JX4 A;  3TKY A;  3H5R A;  3BPV A;  4A2U A;  2JZY A;  2OC6 A;  2DMP A;  1TNT A;  2NNN A;  3G2B A;  2E1N A;  3SQN A;  1IDZ A;  2Y31 A;  3DTI A;  1TNS A;  3V7S A;  4IRH A;  2OCE A;  1ERD A;  3FM3 A;  2XVC A;  2K7L A;  5HLI A;  2QGU A;  2G7H A;  2VPL A;  3K2Z A;  4GFB A;  2LTP A;  1OPC A;  3BZK A;  1O3Q A;  1O3S A;  4Y52 J;  2JUG A;  4MFD A;  3DPT A;  1B9M A;  2DYS H;  4HV6 A;  5F0H A;  5GTH C;  2M2E A;  4CGZ A;  2DT6 A;  2LK2 A;  3FK7 A;  4XQF A;  3FMS A;  3OS0 A;  1LFB A;  2QUF A;  3AFH A;  1BM9 A;  3I59 B;  2E1O A;  2W84 A;  1UFM A;  3ZQL A;  4QPQ A;  1VFC A;  4XNF A;  5ICG A;  1KA8 A;  2ZJQ F;  1JJ8 C;  3I4M J;  1VI0 A;  4JQF A;  4ASN A;  2ZME C;  2JA2 A;  3CCY A;  2DTZ A;  1T2K A;  2EFW A;  2RN7 A;  4L0Z B;  2MBF A;  4HNT A;  3WTS C;  3CO7 C;  2X1C A;  3CCS I;  3O6B B;  4CH7 A;  4EGY A;  1X4P A;  2K9Q A;  2MH2 A;  2VQC A;  1HXD A;  5E17 F;  3D5S C;  2I5U A;  3A0B C;  4L0Y B;  3H35 A;  3DBL B;  4M72 A;  3RYR A;  5L3F A;  3LST A;  2ZXJ A;  2BGC A;  4EJT A;  2CUJ A;  2VI6 A;  3B6C A;  3K1P A;  1S72 I;  2E5N A;  4KIF A;  3L09 A;  3CC4 I;  2Z2S B;  1TQM A;  1P7I A;  2ZXH A;  1MBJ A;  1J5Y A;  2EWN A;  2W85 A;  3ROU A;  1HBX G;  4XID A;  3KX2 A;  2K4J A;  2ZJ2 A;  3HRM A;  1K61 A;  4M71 A;  5F04 A;  5DUK A;  5CPR B;  4Q48 A;  4P9U A;  5L3C A;  2EIK H;  4G12 A;  2WAD A;  2CW8 A;  4EM2 A;  3IUO A;  4KMF A;  5F27 A;  3K70 C;  3C7J A;  4FQG A;  2FSW A;  4PCQ A;  1FWZ A;  3DFG A;  4L5I A;  1SVO A;  4RAF A;  3VYS B;  1UEL B;  3EUA A;  4UNO A;  2FUG 2;  2XV4 S;  1O4X A;  1WSU A;  3LSP A;  2COM A;  1GV2 A;  2QKM B;  3S3O A;  3IAS 2;  1ZR2 A;  2HNH A;  2VOP A;  1I6H J;  4HW0 A;  3DXJ F;  3S14 J;  2DCE A;  5AON A;  1WHU A;  1LKX A;  2BHZ A;  2UXN A;  1ZLK A;  2CQQ A;  2FF4 A;  2GXB A;  5ED4 A;  3EET A;  3QOE A;  3OL4 A;  2R7O A;  1ZG3 A;  2XGE A;  3I56 I;  3FXM A;  5TJJ A;  4H4K C;  3K70 D;  1E17 A;  4QLC U;  4HZF A;  3OYM A;  2RKH A;  1YYV A;  1E3O C;  3W6V A;  1JUS A;  4I7H A;  4Q4Z F;  1V5G A;  2ZB9 A;  4BE1 A;  5LFA A;  3M8J A;  4ZYH A;  2RRE A;  4KN7 X;  1XS9 A;  2EFO A;  4DZJ A;  4F3Q A;  5IYB J;  1NK2 P;  1OCP A;  4Q5S F;  1ETX A;  2P5V A;  5HLH A;  1E3H A;  2IXS A;  4ZDP A;  4QTR A;  1ZRE A;  2CMP A;  1JGS A;  2YSR A;  5CVV A;  1HW2 A;  2LFB A;  2P6S A;  3CP8 A;  4G94 A;  2YX7 A;  1VQ5 I;  5IYD J;  3MN2 A;  1ETW A;  5EEG A;  3ZMD A;  2ISY A;  1P4A A;  1ZG1 A;  4QIW N;  5HOO A;  3VDX A;  1JE8 A;  1U5T C;  3FXR A;  3N97 A;  2DJN A;  2BY3 A;  4XKW A;  1UHW A;  4M9X A;  5BPD A;  1EH6 A;  3WE2 A;  2AXL A;  3KP3 A;  2W48 A;  2AQE A;  3IWZ A;  2FBK A;  2DFI A;  3LSM A;  5IOZ A;  5JR3 A;  2HQA A;  1JKP C;  3RIR A;  4A3M J;  3GWZ A;  3I0T A;  2D2W A;  2JUC A;  4YFN F;  2MFZ A;  2JN6 A;  3V4G A;  2H94 A;  4AD9 A;  4G7O F;  4C3J J;  1MMS A;  3QPH A;  2UWM A;  1Z7L A;  4I01 A;  4XKC A;  4A3G J;  5CVR A;  4IKF A;  1HLV A;  1WZ2 A;  1UCR A;  3RPQ A;  1W0U A;  1NG7 A;  4BH9 A;  4AC0 A;  4XSZ F;  4EQQ A;  4F91 B;  3HOV J;  3HOT A;  2QSF X;  2LKS A;  2ZJP F;  2O0Y A;  3BLY A;  1CQT A;  4HNU A;  3E97 A;  5EZG A;  3TP0 A;  2Y2Z A;  2JMW A;  3EPZ A;  2OTJ I;  4A6E A;  2BV6 A;  2DMU A;  3IV5 A;  2V1D A;  1I27 A;  1ZEL A;  5HS9 A;  3K10 A;  5IY5 H; 
#chains in the Genus database with same CATH homology
 5H6R A;  2OD5 A;  2V1X A;  2M45 A;  2W57 A;  2DW4 A;  3JAM Z;  4LB6 B;  4YFK F;  5ILS A;  1PP8 F;  4IRG A;  3K69 A;  3IWF A;  1H9G A;  2LF7 A;  4IHT A;  2DU9 A;  2XAJ A;  4B8X A;  4CO8 A;  1XN7 A;  3MZY A;  3MEX A;  1ZAR A;  2FOK A;  2EJR A;  3E5X A;  3COA C;  1YLF A;  3CDH A;  1D3Y A;  3F6O A;  3MWM A;  2DK8 A;  4IXA A;  2XIG A;  3PQK A;  1I5Z A;  3KLO A;  5ICC A;  2UZK A;  5IT3 A;  5BS6 A;  3GYH X;  2MLK A;  2V9V A;  2PFB A;  3M8E A;  2OQR A;  3GFM A;  4KIB A;  1WWX A;  1IXS B;  3T1B A;  1BIB A;  1LEB A;  1V3F A;  4ESB A;  3GXO A;  4ZYE A;  1F1Z A;  1G6N A;  3L00 A;  4LJZ F;  3ZN1 A;  4ESF A;  3DKW A;  3L7W A;  5ICF A;  3WTV C;  2EFQ A;  2F5F A;  1FLI A;  2IA0 A;  5DD8 A;  2LF8 A;  3FF5 A;  3ABT A;  1W7P B;  4U0V A;  5DCM A;  3FM5 A;  2HFH A;  1OR7 A;  4OMZ A;  4Y15 A;  1J9I A;  2IPQ X;  3HYI A;  1K6O A;  1LVA A;  3OV8 A;  1R1U A;  5E8I A;  3MCZ A;  3IKT A;  3FMR A;  1MDM A;  5E18 F;  2R3S A;  1ZYR F;  4CDG A;  1T6S A;  3EUH A;  3SXY A;  3FX3 A;  3J81 Z;  4PZJ A;  4KNY A;  2D1H A;  1SFU A;  2QZ8 A;  2WWY A;  2EV6 A;  2J5O A;  3E6B A;  1W7P A;  4Y17 A;  3CLO A;  3T8T A;  2XAG A;  1P92 A;  1QGP A;  3SZP A;  3HHH A;  2HOE A;  3Q5F A;  1MJB A;  1IXR C;  1LQ1 A;  4BHB A;  2DQL A;  1FZP B;  1SFE A;  2B0L A;  3I53 A;  4U0Y A;  2BE5 F;  3TDU C;  3ZMZ A;  2RQP A;  1XCB A;  2M87 A;  4HF1 A;  3DV8 A;  1FYM A;  4A5M A;  1DPR A;  1QPM A;  2MA3 A;  3R60 A;  4FHT A;  1YW9 A;  2A61 A;  2HQN A;  5E1W A;  3M1E A;  5HDK A;  1YIO A;  3LA3 A;  2IVM A;  2Z3Y A;  2HDC A;  1L0O C;  4OIR F;  4RB2 C;  1S3J A;  3WOD F;  2KJB A;  1S29 A;  1LJ9 A;  4A6D A;  2RGV A;  2FML A;  4RGR A;  3I71 A;  4WXH A;  5CVJ A;  4HLY A;  2XRN A;  4ZYD A;  2EB7 A;  1B59 A;  1O7L A;  1W5T A;  1OKR A;  2KJC A;  2HEO A;  1AWC A;  3J81 K;  1G4D A;  2RDP A;  2XGX A;  3GW2 A;  5BMZ A;  1F9N A;  4HBL A;  3B02 A;  4EM1 A;  5D5U B;  3LQQ A;  4OIQ F;  1TQI A;  1JXS A;  2VT3 A;  1FYK A;  4LK0 F;  2XUB A;  2ZFW A;  1H0M A;  3K1N A;  2HKO A;  2W24 A;  4ENM A;  1ONV A;  2KIM A;  1R1T A;  1EH7 A;  3BPX A;  3QP5 A;  3GZ5 A;  2IRF G;  2HR3 A;  2QQ9 A;  3ZMU A;  2JRT A;  1J0R A;  2HWV A;  3QAH A;  2PN6 A;  3U2R A;  3F3X A;  1Z9C A;  2GIV A;  5FO5 A;  1D8K A;  4ENK A;  4EJU A;  2Q0O A;  3EYY A;  1OMI A;  2GA1 A;  4P5O A;  2XKO A;  4CHU A;  5HS8 A;  3WGI A;  4XSX F;  1T38 A;  2L4A A;  4EJO A;  4R1H A;  4TV7 A;  1S7O A;  4KYW A;  2VOO A;  4KN4 X;  2M30 A;  2ZNZ A;  3ULQ B;  1YTY A;  1QZZ A;  5BOX A;  2BBY A;  2VBW A;  1SMT A;  3V7R A;  2OZ6 A;  4LG0 B;  2IP2 A;  4U0W A;  3SFZ A;  3JW4 A;  1FNN A;  5DEQ A;  4LLL A;  2ZNY A;  3FHZ A;  2G7U A;  2A68 F;  5HDN A;  4WK8 F;  5K5O A;  4ZZL A;  3C18 A;  4OIO F;  4B09 A;  5CVI A;  4AVP A;  1RNL A;  3F21 A;  3M7G A;  2H6C A;  1IZ1 A;  3RKY A;  2STW A;  1XGO A;  3TO7 A;  4L9T A;  3WE3 A;  4DNC A;  3HUG A;  5LBQ A;  3GX4 X;  1FC3 A;  2KIF A;  4LG0 A;  3GLX A;  1I6X A;  4A0Z A;  1ON1 A;  4HX7 A;  3GFI A;  5FB2 A;  2KKO A;  5ILV A;  2DI3 A;  1MZB A;  1U2W A;  2ACJ A;  4UVB A;  1T39 A;  2KIU A;  4KIG A;  3FZV A;  3R4K A;  3WU0 A;  3ZPL A;  1S8N A;  5HDG A;  1FT9 A;  2FNP A;  4L18 B;  2JPC A;  3WTU C;  5EEH A;  5H6Q A;  4E70 A;  4NB5 A;  3AAF A;  3KET A;  3WGH A;  4OOI A;  4LK1 F;  4I98 B;  3TO9 A;  2OQG A;  1DPU A;  2P8T A;  4MQV A;  3HSF A;  4P96 A;  1BN5 A;  2XAH A;  4EM0 B;  1U8R A;  1G3Y A;  2O3F A;  5E20 A;  2FBI A;  5JHU A;  2Y0M A;  4LGW A;  1DUX C;  1ZGA A;  4CXF A;  2KRF A;  2RV8 A;  1BOA A;  2VXZ A;  2ZBK A;  1NHA A;  2EK5 A;  2A6H F;  4RAZ A;  1ZHF A;  4GYI A;  1R1V A;  1XGM A;  1KU9 A;  2CWE A;  3FWE A;  3W6K B;  1ZGJ A;  4ZZD A;  3DQV C;  5DV5 A;  3QOP A;  2GAU A;  1G3T A;  5F1R A;  5FFZ A;  5BPI A;  3W6J B;  4I0A A;  1USS A;  3F23 A;  1KU7 A;  3BDD A;  3P9C A;  4HQM A;  4YG2 F;  3ZQ7 A;  2OU2 A;  5KK1 A;  3KCC A;  1WI9 A;  1XSX A;  5D5X B;  2DTR A;  1S6L A;  1TW3 A;  4IF4 A;  1BIA A;  4CIC A;  3L2C A;  4LD5 A;  3KZY A;  4RGX A;  5LHI A;  4BHP A;  1IN8 A;  1K7A A;  4Q47 A;  3LAJ A;  2JT1 A;  3GO5 A;  5CYV A;  2XRO A;  1H9T A;  1YO5 C;  4S05 A;  2GA2 A;  2O61 A;  3HIF A;  2CG4 A;  1KQ0 A;  3FXU A;  1ZG5 A;  5HVQ C;  1Z6R A;  4LMY A;  4ENN A;  4MQ9 F;  1KQ9 A;  5F6F A;  3DEU A;  2D1V A;  5FFX A;  1KGS A;  5HS7 A;  2W25 A;  2EFN A;  1HST A;  4XLP F;  1RI7 A;  1UST A;  2HQR A;  5D5W B;  3IHU A;  1GHC A;  2CW0 F;  1WKM A;  3KEQ A;  2V79 A;  3DP7 A;  2DPD A;  1J7K A;  2O6G E;  3K1M A;  1RIO H;  4I0B A;  4EVI A;  4LLN A;  1Z05 A;  1ZRF A;  5DDG A;  4OU0 A;  3CJN A;  3ML6 A;  2PLY A;  1DP7 P;  5DCM B;  3NQO A;  4UXN A;  4OIN F;  4ETS A;  3IL2 A;  2UXX A;  3J7A O;  1UHM A;  4UHT A;  2GQQ A;  1FY7 A;  2A07 F;  3O2P E;  3N4M A;  3RPU A;  1MDM B;  4M6X A;  3ECH A;  1U78 A;  3KP7 A;  1HW5 A;  4MEY F;  3P9K A;  3GFJ A;  4LFU A;  4HDU A;  1F5T A;  2LDU A;  4S04 A;  3MQ0 A;  4NHJ A;  1IAW A;  2DPU A;  3F8N A;  4D0P A;  1I1G A;  1IRG A;  1CGP A;  4GYG A;  5J8C A;  4ON0 A;  1FP2 A;  3DF8 A;  1G3W A;  3NRV A;  1MD0 A;  1YG2 A;  4MNU A;  4HOB A;  3E3V A;  3C3W A;  4UVC A;  2Q8K A;  4UV8 A;  1R58 A;  3R6S A;  1IN6 A;  2JSC A;  3KP2 A;  1AOY A;  1HQC A;  2M8E A;  2L02 A;  2M5W A;  4WX9 A;  5DCF A;  2Z5U A;  2JPB A;  1KU2 A;  3RTR A;  1QQI A;  2ESH A;  5D8L B;  4KDP A;  3LFK A;  3JAM K;  3TOB A;  2YX4 A;  3TO6 A;  5HLG A;  5E8G A;  2X0L A;  3HRS A;  3D0S A;  4HV5 A;  2PBI A;  3MAJ A;  3OOP A;  2H09 A;  1ZH5 A;  2HGC A;  3F8M A;  2J5P A;  3ERE D;  2P7C B;  3H92 A;  2H6B A;  3HRT A;  1XB4 A;  3LA7 A;  2F5D A;  2O8X A;  2L54 A;  2BEO A;  1U6G A;  3SZT A;  2LNB A;  2DLL A;  5E1X A;  2VBY A;  3K9T A;  1TLH B;  1QZY A;  1YFH A;  3K0L A;  1IRF A;  3L9F A;  4GCV A;  1D5V A;  1HKT A;  1L3L A;  4WCG A;  2VE9 A;  4LB5 A;  1R23 A;  1IN5 A;  4KUM A;  4OIP F;  2OAZ A;  4U7D A;  4AIJ A;  3F8B A;  2DK5 A;  5DD4 A;  2CGP A;  3LAP A;  1FP1 D;  3I5U A;  4HF2 A;  1I1S A;  1QO0 D;  1B4A A;  1BBY A;  4Y13 A;  5D4S A;  3QPT A;  2FMY A;  3QRF F;  1BI2 A;  1WRJ A;  2IJL A;  2CQK A;  3ELK A;  4R8H A;  4HYE A;  2Z99 A;  3HSR A;  5LEK A;  3R61 A;  2VE8 A;  3M9A A;  4KIC A;  2QQA A;  1SD7 A;  4EMS A;  1SFX A;  1R5G A;  2CFX A;  1WQ2 A;  5D4R A;  4WF2 A;  4FX4 A;  2ZO4 A;  1D8J A;  3LQR A;  2NAZ A;  2P4W A;  3JTG A;  4EGZ A;  4OMY A;  2HYG D;  2XAF A;  2WV0 A;  1YS6 A;  2ADU A;  4O3M A;  5K5R A;  1P4X A;  3G73 A;  1MKM A;  1Z7U A;  3GZ6 A;  4UVA A;  3BJA A;  2MC3 A;  4AIH A;  4EJW A;  2P6T A;  2FU4 A;  3F8F A;  2FXA A;  4M9S A;  1RUN A;  1KQ8 A;  2ELH A;  1FBU A;  1RUO A;  2A6E F;  1PUE E;  2FA5 A;  4AIK A;  1XDS A;  1IN7 A;  4L5J A;  1FOK A;  2P7V B;  4GO1 A;  5D5V B;  2A3S A;  5E1Z B;  4MHG A;  4BQA A;  1HKS A;  5D6E A;  2OBP A;  1OYW A;  2MD5 A;  5J6X A;  3NEU A;  3V8L A;  3JTH A;  4KFC A;  1R7J A;  4UV9 A;  1ZLJ A;  2DAO A;  2R7F A;  4KA4 A;  4M73 A;  2WC2 A;  2Z33 A;  4NQW A;  4YII A;  1FSE A;  3F6V A;  1YW8 A;  2QVO A;  2E7X A;  1XD7 A;  2CSO A;  2GWR A;  2ISZ A;  2YPR A;  1XSD A;  1LB2 A;  4N9I A;  1SD6 A;  1O3T A;  2K02 A;  5FLX Z;  3MZH A;  2Q2E A;  4HDV A;  2IT0 A;  3HOS A;  1J2X A;  3BOQ A;  3ZMT A;  4GXO A;  3QU3 A;  1TTY A;  1QBJ A;  2K27 A;  5FD6 A;  3H3U A;  3TGN A;  3EYI A;  5AIP A;  1ZRD A;  4MTE A;  3V8K A;  4U7B A;  4I09 A;  4XLN F;  2DT5 A;  1A04 A;  3E6D A;  4BAY A;  2L3D A;  4IRI A;  2O03 A;  2HKX A;  2QM3 A;  2GXG A;  5KVR A;  4A12 A;  4I02 A;  1R22 A;  2A5Y B;  1BJA A;  4HA8 A;  1LEA A;  1XSV A;  3T5X A;  1O57 A;  4WXD A;  5JFR A;  1BI0 A;  5LLQ A;  4O5V A;  5JI6 A;  1STZ A;  1TW2 A;  2AS5 F;  2QBY A;  1FYL A;  1UB9 A;  1O3R A;  1W7P D;  3J80 Z;  1SMY F;  1T0F A;  4I2O A;  2YR2 A;  1VTN C;  5H20 A;  1LDD A;  3GF2 A;  3SHF A;  4G9Y A;  5LHG A;  2D45 A;  3D5L A;  1Q1H A;  2P5K A;  3BRO A;  5CJ9 A;  3RYP A;  2OA4 A;  2STT A;  4XRF A;  2VC0 A;  1ON2 A;  4CZZ A;  1W5S A;  2VBX A;  2VC1 A;  5BQT A;  5FLX K;  1W4M A;  5ICE A;  3PFI A;  1HKQ A;  1CF7 B;  3EQL F;  2QLZ A;  1B6A A;  3KZZ A;  3M8F A;  3VEP A;  5LGT A;  3IKV A;  3F8C A;  1HSJ A;  3E6C C;  2L01 A;  3F72 A;  4HLX A;  3I59 A;  4G7H F;  4O6J A;  3GVA A;  3LA2 A;  4K2E A;  1R36 A;  3HRU A;  2NRA C;  4IPA A;  5LRS A;  3V7C A;  4L9J A;  3TDZ C;  2CYY A;  4G7Z F;  4RGS A;  1R5H A;  3ZMS A;  3BY6 A;  3KP4 A;  5CLS A;  1GVJ A;  2X4H A;  2P5L C;  1CF7 A;  2F2E A;  2XAQ A;  1ODD A;  3WTZ A;  3ZN0 A;  1KYW A;  2V6C A;  1O7F A;  1IF1 A;  3BJ6 A;  4PDK A;  2FBH A;  3E6M A;  5F64 A;  5K1Y A;  4JK1 X;  4UUV A;  2PMH A;  2PI0 A;  4HX4 A;  4M74 A;  4HF0 A;  1Z91 A;  3J80 K;  2HTJ A;  1XCV A;  3DPL C;  1KU3 A;  4RB3 C;  1LNW A;  3RJP A;  3U1D A;  1J75 A;  2VOD A;  2VON A;  1C0W A;  3I64 A;  1YW7 A;  3ISP A;  1FSH A;  1FPQ A;  2EV0 A;  2XKP A;  6PAX A;  1ULY A;  4L9N A;  2JTV A;  1SD5 A;  2V1U A;  4FX0 A;  2F5C A;  1V4R A;  1JHF A;  1Z6T A;  4G8X A;  1Y0U A;  5DUI A;  2GZW A;  4RB1 A;  2NNY A;  4H0E A;  1MJA A;  3WTX C;  1K78 B;  2WTE A;  1EV7 A;  2E7W A;  1P4W A;  3F22 A;  3BP8 A;  2RC4 A;  4HX8 A;  1E2X A;  3IRR A;  4IVN A;  1XGN A;  4GGG A;  1EH8 A;  2NS0 A;  4P9F A;  4PGH A;  3JSP A;  4FT8 A;  3HTS B;  4G6D A;  2ESN A;  4F7Z A;  2PEX A;  4BYY A;  1B9N A;  3KLN A;  4IJA A;  1U3E M;  1P6R A;  5L3E A;  1LDK B;  3U9G A;  3CUQ B;  1S7A A;  4EV0 A;  3MFK A;  3VB2 A;  2BYV E;  1RZ4 A;  1QNT A;  3HTU A;  3GEZ A;  3H3Z A;  1J59 A;  3O3K A;  5FGM A;  2A69 F;  1K78 A;  4KMU X;  2DBB A;  1IN4 A;  5LGN A;  3ZP5 A;  1Z1D A;  1PDN C;  3PQJ A;  1FBS A;  2PJP A;  1SD4 A;  3P9I A;  2QQB A;  2LKP A;  1BC7 C;  1BI1 A;  1YQA A;  3GFL A;  2XHK A;  2Z9O A;  4IHS A;  2VT2 A;  4LLG F;  2ZME B;  3CUQ A;  4EJV A;  4G6Q A;  4JBA A;  1OYY A;  2PMU A;  2DQR A;  2ZKZ A;  3QU6 A;  3VFZ A;  4AWX B;  3WU1 B;  4A0X A;  2E1C A;  2IW5 A;  2PG4 A;  5ERI A;  3JSO A;  4HAM A;  3HSE A;  1ZRC A;  4RS8 A;  3P7N A;  1IW7 F;  3T8R A;  3VOE A;  1MGT A;  1IXC A;  2FEZ A;  4P55 A;  4CYD A;  5LGU A;  4A0Y A;  1KYZ A;  1REP C;  5LRR A;  5L3D A;  3T0Y A;  5CVU A;  2K4B A;  3TOA A;  1MJ9 A;  2R7D A;  2XAS A;  3ECO A;  2ZME A;  3C1D A;  3RDI A;  2VN2 A;  1XMK A;  4RB0 A;  4RAY A;  1IUY A;  3IC7 A;  1TQP A;  5JVT A;  1BC8 C;  1GXQ A;  3E5U A;  3WTT C;  1G3S A;  2FNA A;  1F4K A;  3KE2 A;  3I4P A;  4M6Y A;  4WXC A;  3IRQ A;  3E5Q A;  4ENJ A;  5L3B A;  2PQ8 A;  3I54 A;  4L9V A;  5A2Q Z;  1ZAO A;  2K86 A;  4MTD A;  4BHC A;  2C6Y A;  5D8K B;  5K5Q A;  2Y48 A;  2ETH A;  1U5T B;  3CTA A;  3REO A;  1PP7 U;  2L4M A;  4KT5 C;  1GXP A;  5IT9 Z;  3ZMV A;  3HHG A;  1BI3 A;  2FE3 A;  3CO6 C;  1ZN2 A;  1YS7 A;  2HZT A;  2FRH A;  2IA2 A;  3FMQ A;  4M9Z A;  4ESJ A;  3WG9 A;  3WTW C;  2CO5 A;  3G3Z A;  2QWW A;  4MEX F;  3Q9V A;  2IA1 A;  4N9H A;  4HQE A;  2ZCW A;  1SAX A;  3BJO A;  3QP6 A;  5LHH A;  1JHH A;  3R0J A;  1P2F A;  5FD5 A;  2M1B A;  2EV5 A;  1U5T A;  4A5N A;  2MH9 A;  3CUO A;  2QYO A;  4WWC A;  5AIQ A;  2EFP A;  3BWG A;  4R79 A;  2LSO A;  3RI4 A;  5TRD A;  3RKX A;  5J8F A;  5LEJ A;  2NYX A;  3GUD A;  1XGS A;  5D6F A;  2DO7 A;  3Q9S A;  2YU3 A;  1X3U A;  3ABU A;  3B73 A;  1HW1 A;  4XBF A;  3TQN A;  3V8J A;  2MLG A;  3KP5 A;  3LWF A;  3WGG A;  3FXQ A;  2H27 A;  2VBZ A;  5DYM A;  5A2Q K;  3BZ6 A;  4ZYG A;  2HTS A;  4Z2Y A;  3RKW A;  1R00 A;  2OZU A;  4YFX F;  1OYI A;  3VOD A;  4MGR A;  3KEO A;  1XDU A;  4PGG A;  2EA4 A;  1LDJ A;  4BXU A;  1FBQ A;  2QBY B;  4ZH4 F;  5IT9 K;  1XMA A;  3S2W A;  3R0A A;  1B1B A;  1K79 A;  4DQ2 A;  1FX7 A;  4YIF A;  4BNC A;  3KP6 A;  1TBX A;  5ILU A;  2EA2 A;  2RVC A;  3WTY C;  3CUQ C;  2F5E A;  2G9W A;  2HS5 A;  2FQ3 A;  2TDX A;  2HYF A;  3KFW X;  2Y75 A;  3I58 A;  3EDP A;  4RGU A;  1T98 A;  4N0B A;  2QEN A;  5L3G A;  1DDN A;  4U88 A;  2RNJ A;  3TKY A;  3BPV A;  4A2U A;  2JZY A;  1TNT A;  2NNN A;  2E1N A;  3SQN A;  1TNS A;  3V7S A;  4IRH A;  3FM3 A;  2XVC A;  2K7L A;  5HLI A;  2G7H A;  3K2Z A;  1OPC A;  1O3Q A;  1O3S A;  3DPT A;  1B9M A;  4HV6 A;  4CGZ A;  3FMS A;  2QUF A;  1BM9 A;  3I59 B;  2W84 A;  1UFM A;  5ICG A;  1KA8 A;  4JQF A;  4ASN A;  1T2K A;  2EFW A;  2RN7 A;  4L0Z B;  2MBF A;  3WTS C;  3CO7 C;  3O6B B;  4EGY A;  2MH2 A;  1HXD A;  5E17 F;  4L0Y B;  4M72 A;  3RYR A;  5L3F A;  3LST A;  2ZXJ A;  2BGC A;  4EJT A;  3K1P A;  4KIF A;  3L09 A;  1TQM A;  1J5Y A;  2EWN A;  2W85 A;  3ROU A;  1HBX G;  2K4J A;  2ZJ2 A;  3HRM A;  4M71 A;  5DUK A;  4P9U A;  4Q48 A;  5L3C A;  4EM2 A;  4KMF A;  3C7J A;  2FSW A;  4PCQ A;  1FWZ A;  3DFG A;  4L5I A;  4UNO A;  2XV4 S;  1WSU A;  2COM A;  2VOP A;  4HW0 A;  3DXJ F;  5AON A;  2UXN A;  1ZLK A;  2FF4 A;  2GXB A;  5ED4 A;  3EET A;  1ZG3 A;  5TJJ A;  1E17 A;  4QLC U;  4HZF A;  2RKH A;  1YYV A;  4I7H A;  4Q4Z F;  4ZYH A;  4KN7 X;  2EFO A;  4Q5S F;  2P5V A;  5HLH A;  1ZRE A;  1JGS A;  2YSR A;  5CVV A;  1HW2 A;  2P6S A;  4G94 A;  2YX7 A;  5EEG A;  3ZMD A;  2ISY A;  1P4A A;  1ZG1 A;  5HOO A;  1JE8 A;  1U5T C;  3FXR A;  3N97 A;  1UHW A;  4M9X A;  5BPD A;  1EH6 A;  3WE2 A;  2AXL A;  3KP3 A;  3IWZ A;  2FBK A;  2DFI A;  5JR3 A;  3RIR A;  3GWZ A;  3I0T A;  2D2W A;  4YFN F;  3V4G A;  2H94 A;  4AD9 A;  4G7O F;  3QPH A;  2UWM A;  4I01 A;  5CVR A;  1UCR A;  3RPQ A;  4BH9 A;  4XSZ F;  4EQQ A;  3HOT A;  2O0Y A;  3E97 A;  4A6E A;  2BV6 A;  2V1D A;  1I27 A;  5HS9 A;  4QWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...