1NHAA

Solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Carboxyl-Terminal Domain of RAP74 and NMR Characterization of the FCP1-Binding Sites of RAP74 and Human TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription initiation factor IIF, alpha subunit
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1nhaA00
4CZZA 4G6QA 3J80K 5JI6A 1USTA 1UFMA 4CGZA 2OZ6A 2OQRA 5CLSA 3C18A 2MH2A 1IXSB 3FF5A 1PP7U 2HOEA 2EJRA 4KNYA 1RIOH 2ZO4A 2ZXJA 2P7VB 4A0YA 2G7UA 5LEKA 1QNTA 4GGGA 3KLNA 5D4RA 4Y15A 2V79A 5BOXA 3BPXA 4KA4A 4BAYA 5D6EA 3COAC 1BC8C 1FZPB 3BWGA 3ZPLA 2QQ9A 4RB1A 3B02A 2FBIA 5HOOA 3FXUA 3WGHA 3LQRA 2DFIA 4JBAA 4KN4X 3FXRA 1I6XA 4I02A 1XCVA 2O03A 1MD0A 5E18F 5DCMB 5EEGA 4LB6B 2MD5A 2VOPA 3ZMZA 1F5TA 1LVAA 2VONA 3RTRA 2J5PA 1YLFA 2K4JA 2TDXA 3I58A 5HLHA 3CO7C 1YYVA 2DK8A 2XGXA 2RKHA 2QVOA 4ETSA 1J9IA 1VTNC 3E5QA 1PDNC 2A6EF 3SHFA 2HTJA 1HKSA 3KP2A 4OIOF 3NRVA 2Q8KA 3IC7A 3GZ6A 4L5IA 3GVAA 2PBIA 4RAYA 2ISYA 3ABUA 3RJPA 1I1SA 1STZA 2O61A 3SZPA 4RB2C 4B8XA 4KMFA 4U0VA 3IL2A 2VC0A 4GYIA 1BI0A 3WU1B 2ESNA 4HF1A 1LEBA 3WTVC 3F8CA 1MDMA 3HSFA 4KFCA 2PEXA 5AONA 3VB2A 1KQ0A 5LGTA 2IA1A 3U2RA 2WV0A 2Y0MA 2V9VA 3GXOA 3H92A 2RGVA 2VT2A 1FT9A 5HVQC 3M8FA 4U0WA 5HS8A 3LAJA 2Z99A 4AD9A 4OU0A 2JRTA 3TDZC 4WXCA 4DQ2A 2HDCA 4QWQA 1YQAA 1FSEA 4LD5A 4EGZA 5EEHA 5E20A 3IKTA 5BPDA 4M9XA 4CDGA 1W5SA 4XRFA 2NS0A 2CFXA 1WWXA 1ZAOA 3HTSB 3GEZA 2IW5A 2YSRA 2A07F 2WTEA 4EQQA 3TO6A 4RGXA 1FYMA 3HRSA 4OIPF 1IXCA 4ENKA 1OR7A 3DFGA 2IRFG 1LQ1A 4HQEA 3SXYA 3V7CA 2XV4S 4Y13A 3G73A 1OPCA 1J2XA 1FP1D 3DKWA 3C7JA 4CHUA 3MEXA 4ZZDA 1C0WA 1NHAA 2L3DA 5L3EA 1XGMA 2JSCA 5DCFA 5KK1A 1KGSA 4ESJA 3HTUA 3HHHA 4KICA 5HS7A 4G7ZF 1AOYA 4O5VA 1QZYA 2GIVA 2EWNA 1BC7C 1FC3A 2QWWA 2EK5A 3REOA 3CDHA 3G3ZA 4LK0F 2WWYA 2EA2A 1T98A 5JVTA 1ZARA 5CVRA 1T0FA 4B09A 3F22A 1S6LA 3LFKA 5LBQA 2ADUA 4RB3C 2D2WA 1XDSA 5JR3A 1SD4A 4M6YA 2MC3A 2YR2A 3DV8A 2EFQA 3QP5A 1XGSA 2ZJ2A 1W7PD 1GHCA 2CQKA 4P5OA 4KIBA 4I01A 4BYYA 3T8RA 3FM5A 2GZWA 1Q1HA 1ODDA 2CO5A 4EGYA 3OV8A 4HX4A 1F1ZA 1O7FA 4IPAA 2K7LA 4XSZF 1J7KA 4YFKF 4IRGA 1U6GA 1YW7A 4BHBA 3E3VA 2A69F 4AIHA 2A5YB 3CUQA 1HXDA 4M9SA 1XDUA 4OOIA 4JK1X 4HAMA 2PJPA 4I09A 1H9GA 2XKOA 2FQ3A 2HYFA 3FWEA 5E1WA 3TOAA 3TO7A 3EQLF 5J8FA 3K1MA 1V4RA 4M73A 4HYEA 4I2OA 1ZRFA 2ZMEB 2VBZA 4M72A 4QLCU 4XLNF 1QQIA 2EFWA 2KJBA 5L3DA 3HIFA 4CXFA 4UNOA 2XUBA 1O3TA 1SD6A 3F8FA 2D45A 1BIAA 4LFUA 2GWRA 3MZYA 2FNPA 3SZTA 4Q47A 4KIFA 3ZMUA 2NNNA 4LJZF 3K0LA 2W84A 3HRMA 1QGPA 4A5NA 2P7CB 4L9JA 1XSVA 1HSTA 4ZYEA 2KIUA 2CW0F 1LDDA 4ON0A 2W24A 2QUFA 3ZQ7A 3EYIA 4A2UA 4EMSA 3LQQA 3F23A 4IVNA 1P2FA 2GA1A 4HLXA 3E97A 3WU0A 4NQWA 3QP6A 3R60A 1SFXA 2DAOA 1FP2A 1HW1A 2IA2A 5CVVA 3DPLC 2K86A 5L3FA 2BV6A 5FFZA 2DO7A 4EV0A 4N9HA 2E1CA 2JZYA 5E8IA 1ZLKA 2GAUA 2NNYA 1CF7A 1KYWA 2P5LC 1T38A 4MHGA 3DXJF 2G9WA 3OOPA 1ZYRF 2BE5F 2H94A 4L0ZB 5H6RA 4LG0B 2F5CA 1WKMA 4ENMA 2FRHA 4HF0A 3KZYA 3U9GA 4OIRF 2H09A 4WXDA 1HSJA 4ZYHA 3V7SA 2LNBA 1IN8A 1KU3A 2M30A 2ETHA 1IZ1A 3HUGA 3BY6A 1ZRDA 1KU9A 3GUDA 2ACJA 4L5JA 4G9YA 3J7AO 2R3SA 3M8EA 2FEZA 5D6FA 1J5YA 1LNWA 3GFLA 1MJAA 1W7PB 3RIRA 4U7BA 1BM9A 1OYWA 2PG4A 5IT9Z 1FSHA 4BH9A 3O3KA 3RPUA 4KT5C 3P9IA 1SD7A 1QBJA 5LGUA 1XGNA 2GQQA 1IXRC 2RN7A 2DW4A 5A2QK 1S8NA 2VT3A 1KYZA 2EFPA 2ISZA 1S3JA 3KEQA 4A0XA 3CLOA 3GF2A 5DV5A 2CGPA 3MZHA 1HBXG 3SQNA 3F8NA 3RDIA 3RKYA 5BMZA 1YIOA 5E8GA 5ILVA 2L01A 1XD7A 2FOKA 1ON2A 3WE2A 2PN6A 1U8RA 3PQJA 4N9IA 3KCCA 4L9NA 1TW2A 1MJ9A 3KP5A 3TGNA 3I4PA 2EB7A 2P8TA 1XN7A 2DBBA 3WTSC 1IUYA 1OKRA 5LHGA 3WTZA 1U78A 3CUQC 1IN7A 4KN7X 3HOSA 3L09A 5HDKA 4ZZLA 4WK8F 2V1DA 3GZ5A 1R36A 5ICCA 2KIFA 2JPBA 4RB0A 1DP7P 3F8MA 4BNCA 1L3LA 1R1UA 4ASNA 5ICEA 4HF2A 1FLIA 4UV8A 3KFWX 1Z9CA 1TNTA 4GCVA 1K78A 2W57A 2RQPA 4G6DA 2FE3A 2W25A 4ENJA 5DUKA 4L18B 2XAHA 2Z5UA 3I59A 2EV0A 4FX0A 3DEUA 2OAZA 3K1NA 3L9FA 1UCRA 4HX7A 4MNUA 3HOTA 4DNCA 1Z7UA 2VOOA 2J5OA 1SAXA 2XAQA 4RAZA 4UXNA 1EV7A 1P92A 2COMA 2VXZA 1ZG3A 2XAGA 4S04A 3N97A 2EFNA 3WGGA 4HV6A 2LF8A 3ZMTA 2KRFA 1GXQA 1K7AA 4HW0A 3IHUA 5L3BA 1Z1DA 1B59A 4FHTA 3TDUC 3HSEA 5DD4A 2QENA 5D8LB 3ZP5A 5K5QA 5A2QZ 1BIBA 3ROUA 2O0YA 3E5XA 1Z6RA 2YPRA 2D1HA 5D5XB 2LF7A 3I0TA 4FT8A 3WTUC 3EETA 3H3ZA 3WG9A 2KIMA 3ULQB 1HQCA 1P4XA 3QOPA 2GA2A 2LDUA 3BDDA 3MFKA 3IWFA 1B9MA 1TQMA 1G6NA 4YFNF 4IRHA 1ZREA 5FB2A 3IRRA 4L9VA 3DQVC 3E6MA 4ESBA 4CO8A 2WC2A 2QM3A 4P55A 2ZBKA 5LRSA 3FM3A 5KVRA 3S2WA 3ZMVA 4WX9A 3E5UA 2HS5A 1ZHFA 2EV6A 3TQNA 3L2CA 1IN6A 3WTWC 3TO9A 1REPC 1Z6TA 5E17F 3KP3A 4UVAA 4RS8A 2JTVA 4A0ZA 3ZN0A 5BS6A 3NEUA 3M9AA 4LLGF 3CJNA 3VFZA 2JT1A 1YG2A 2VE8A 3LWFA 1QPMA 2QBYB 3R0AA 1FBUA 2IJLA 2H6BA 4EM2A 1WI9A 2CYYA 2L4MA 1JHHA 2Z9OA 2LSOA 1R1TA 4UV9A 3I54A 2JPCA 2GXGA 4R1HA 1TQPA 2E1NA 1HW5A 1EH6A 1R7JA 1GVJA 4M71A 4XSXF 1R22A 1KU2A 1W7PA 4I0BA 4IRIA 3RYPA 3JTHA 5AIPA 2P6TA 5DD8A 3LA7A 2XHKA 1DDNA 3VOEA 5J8CA 3VEPA 3QU6A 3QAHA 2FMYA 4WXHA 3HRTA 3F21A 2KJCA 4MEYF 1AWCA 2EFOA 5CYVA 3J81Z 1XCBA 3NQOA 1IW7F 4LLLA 2HGCA 3J80Z 2MH9A 3IRQA 1KQ9A 2Y48A 3V8JA 2R7FA 2M45A 1Z05A 3I53A 2OZUA 2ZFWA 1TTYA 1RUOA 1FNNA 3T5XA 4JQFA 4M6XA 4AVPA 4E70A 1I1GA 3IWZA 3DPTA 3P9CA 4ZYDA 2STWA 4LB5A 2XAJA 4EM0B 2G7HA 3CTAA 5FLXK 1SMTA 4MEXF 1OMIA 3ABTA 1XGOA 3FHZA 3FMSA 1MDMB 3V7RA 1ZG5A 4Q48A 3TOBA 2V1XA 3L7WA 2STTA 1K79A 3R6SA 1R5GA 1FX7A 1V3FA 1KQ8A 2K4BA 4EM1A 4O6JA 5CVIA 1FY7A 3N4MA 5BPIA 3C3WA 3K2ZA 4P9UA 2XIGA 4U88A 4EJUA 2F2EA 2XASA 3FX3A 4MTDA 1F9NA 2GXBA 1ONVA 4MQ9F 4R79A 4Q4ZF 3PFIA 2PMHA 1FYLA 4IHTA 1XSDA 1SMYF 3GWZA 1KA8A 2V1UA 1UHMA 3QPTA 4R8HA 2VE9A 4XLPF 1U5TA 3E6DA 4U7DA 1FPQA 5ICGA 5ED4A 4Z2YA 3DP7A 6PAXA 3GFMA 3SFZA 5LGNA 2YU3A 2DI3A 3BJAA 4RGRA 2HR3A 2D1VA 3K1PA 3MQ0A 1BI2A 2CSOA 5HLGA 4FX4A 1MJBA 4PGHA 2RVCA 2VODA 4PCQA 5IT3A 3KE2A 2VBYA 1U5TC 1J59A 1XB4A 1GXPA 4HLYA 3P9KA 1LDJA 1D8KA 4L9TA 5AIQA 3GFIA 4EVIA 3T1BA 1BJAA 2HWVA 1IN4A 3P7NA 2Q0OA 2C6YA 2AS5F 2QYOA 4NHJA 3R4KA 3VODA 4D0PA 1G3TA 1Z91A 2PQ8A 1Y0UA 2DLLA 1H9TA 3L00A 5HS9A 1MGTA 4I0AA 1D3YA 4LG0A 5D5WB 3ML6A 2M8EA 3U1DA 3QPHA 4A5MA 4RGUA 3K69A 3GFJA 2HFHA 5FD6A 3RPQA 1R5HA 4G7HF 4GYGA 5K5OA 5CVJA 1S29A 2BYVE 3RKWA 2W85A 3AAFA 3Q9SA 4BHCA 1ON1A 5TRDA 2XRNA 5ERIA 3BZ6A 2KKOA 1IRFA 3HSRA 3WODF 1MZBA 2O8XA 1F4KA 3V4GA 4UUVA 4IJAA 3GO5A 1R00A 4UVCA 2QQBA 3R0JA 2QBYA 2OU2A 3RI4A 4EJTA 5JFRA 2BEOA 2P4WA 3EDPA 1JHFA 4PGGA 4KYWA 1R1VA 3ELKA 1I5ZA 5H6QA 1ZG1A 1U2WA 2PLYA 5TJJA 1ZLJA 2RDPA 4BQAA 1RI7A 4AIKA 3ZN1A 3E6BA 1XSXA 3BROA 2PI0A 4KIGA 1O3SA 5DCMA 1L0OC 5F1RA 1G3WA 1IAWA 4G94A 1FYKA 2IT0A 4S05A 2DQRA 2XAFA 3MCZA 3KP7A 1W4MA 5CVUA 1O3RA 2NYXA 1O57A 4HV5A 4A6EA 1JGSA 1LEAA 3ERED 2FBKA 1KU7A 1UB9A 2EA4A 2MBFA 4GO1A 3FXQA 3F8BA 1EH7A 2HQNA 5H20A 5K1YA 5J6XA 3I59B 2B0LA 3E6CC 3KLOA 4L0YB 2M5WA 5HLIA 4YIIA 5FGMA 2E7WA 3CUOA 4HDUA 5E1ZB 2NAZA 4CICA 4WF2A 2QZ8A 4LMYA 4UVBA 2YX7A 5F64A 2VC1A 4AIJA 4MQVA 1PUEE 2ZMEA 2BGCA 3WGIA 3LA2A 2CWEA 3FMRA 5FD5A 3WE3A 3JW4A 2HEOA 2VBXA 3LSTA 4OMYA 3FMQA 1TNSA 4ENNA 3BP8A 1DPRA 2V6CA 2XROA 1J0RA 3KZZA 4HOBA 4P96A 1B9NA 1IF1A 1EH8A 1XMAA 4NB5A 2L02A 3JSPA 1XMKA 4OIQF 4EJOA 3JSOA 4OINF 2MLKA 1S7OA 5K5RA 4P9FA 2HYGD 1E17A 2BBYA 4U0YA 1TLHB 1CGPA 1D5VA 1U3EM 3KP4A 4PZJA 2P6SA 1ZGAA 2E7XA 3M1EA 3JTGA 3H3UA 1ZN2A 1FOKA 2A3SA 3I5UA 3ISPA 4XBFA 4KMUX 2OA4A 4PDKA 1RZ4A 1WQ2A 1WSUA 4WWCA 3I64A 4TV7A 2A68F 2L4AA 1ZGJA 2K27A 3HYIA 2NRAC 1S7AA 4A6DA 4GXOA 2DPDA 4YIFA 1FBQA 3F6VA 4Q5SF 1IRGA 2VBWA 2CG4A 3F3XA 1CF7B 3W6JB 1YW8A 3ZMSA 2UXXA 3ECOA 4CYDA 3JAMK 1BN5A 3D5LA 4I98B 2L54A 2ZNYA 4BXUA 3WTYC 1H0MA 3ECHA 2Q2EA 2R7DA 2RC4A 1HKQA 4HX8A 2HZTA 5JHUA 4M74A 1YS7A 1OYIA 2O3FA 3Q5FA 5D5VB 1R23A 3J81K 1A04A 4HDVA 2IVMA 4IHSA 4YG2F 1FWZA 1BI1A 1BI3A 4N0BA 4EJWA 4HQMA 5IT9K 4A12A 2HQRA 1YW9A 3BPVA 2HKXA 1P6RA 3O2PE 1IN5A 3IKVA 1DPUA 3QRFF 4IF4A 5LRRA 3I71A 5CJ9A 3D0SA 2DK5A 3W6KB 1T39A 4LLNA 1LDKB 2IA0A 1E2XA 3V8KA 2OD5A 2H27A 1HW2A 1RNLA 4K2EA 5BQTA 5L3GA 3BJOA 5FFXA 2OQGA 3TKYA 2XVCA 4ZH4F 1YTYA 2A6HF 3GLXA 3PQKA 4KUMA 3HHGA 5ICFA 1O3QA 3CO6C 2RV8A 3KEOA 2DU9A 3B73A 1ZH5A 1K78B 1O7LA 2IPQX 1SFUA 1U5TB 2DTRA 5D4SA 4MGRA 1I27A 3MWMA 3V8LA 1G4DA 4HZFA 5F6FA 4EJVA 2FMLA 2F5DA 4F7ZA 3T8TA 2M1BA 2M87A 3M7GA 2A61A 5LEJA 3KP6A 1QZZA 3O6BB 3QU3A 1JE8A 4ZYGA 3MAJA 1B1BA 1QO0D 5E1XA 3Q9VA 2FXAA 2OBPA 1JXSA 2ZKZA 1OYYA 1SD5A 1WRJA 5D8KB 5DUIA 3RYRA 2DQLA 4OMZA 4IXAA 2QQAA 2RNJA 3GX4X 2FU4A 2P5KA 1P4WA 1YS6A 2DT5A 1B4AA 2Z33A 4UHTA 1W5TA 4I7HA 3KETA 1FBSA 5D5UB 2UZKA 2FA5A 4M9ZA 3T0YA 1MKMA 4HBLA 2X4HA 2PMUA 3RKXA 2UXNA 4LGWA 3ZMDA 2FBHA 4G7OF 5FO5A 1R58A 1YFHA 2FNAA 2X0LA 4Y17A 5DEQA 1YO5C 3LAPA 5HDNA 1TBXA 2ZNZA 1P4AA 3GW2A 2HKOA 1X3UA 2Y75A 1G3YA 1LJ9A 1SFEA 3DF8A 3HRUA 2ELHA 1HKTA 3BJ6A 3EUHA 2EV5A 1PP8F 5ILUA 5HDGA 3EYYA 1G3SA 2QLZA 5DDGA 2LKPA 4HA8A 4LK1F 4KDPA 2P5VA 3F6OA 3LA3A 2YX4A 4ESFA 1K6OA 1T6SA 3CUQB 2FF4A 3C1DA 5L3CA 2VN2A 2O6GE 2MA3A 4WCGA 2XKPA 2IP2A 3R61A 3GYHX 2FSWA 5ILSA 5LLQA 2H6CA 1D8JA 4G8XA 3WTXC 1BBYA 2ESHA 3F72A 4H0EA 2F5EA 2ZCWA 5LHIA 2UWMA 4AWXB 3JAMZ 2AXLA 5DYMA 1J75A 2K02A 3BOQA 4RGSA 1UHWA 1DUXC 2PFBA 2MLGA 2HTSA 1LB2A 1USSA 1TQIA 4YFXF 2Z3YA 3K9TA 3WTTC 1T2KA 1TW3A 5FLXZ 4MTEA 1RUNA 4O3MA 5LHHA 3FZVA 2F5FA 1ZRCA 1BOAA 4BHPA 1ULYA 2DPUA 1B6AA
chains in the Genus database with same CATH superfamily
4CZZA 4G6QA 4HNTA 3J80K 4BEHA 5JI6A 3SYTA 5J1RA 1USTA 4ZC3A 3K7AJ 1UFMA 4J00A 4CGZA 1ZELA 3AG1H 2OZ6A 2OQRA 5CLSA 2VQCA 3C18A 2MH2A 3S2DJ 1IXSB 3ONQA 3FF5A 1PP7U 1ZQ3P 2HOEA 5CQEA 2EJRA 3ZQIA 4KNYA 1RIOH 2ZO4A 1BW5A 2ZXJA 1X19A 1Y56A 2P7VB 4JP0A 4A0YA 4BE2A 1ETYA 2G7UA 2E5ZA 5LEKA 1QNTA 4GGGA 3KLNA 3BG7A 2K40A 5D4RA 2QKLB 3ABMH 5FKOA 4Y15A 2V79A 5BOXA 2DA5A 3BPXA 3OIOA 4KA4A 3G1OA 4BAYA 1EF4A 5D6EA 3S93A 3JRFA 2JA8J 3S3MA 2IS2A 2VKEA 3COAC 2ZSHB 1BC8C 1FZPB 3BWGA 5KNLA 3ZPLA 2QQ9A 4RB1A 5FRNA 5FKLA 3B02A 4A3GJ 2IAIA 2FBIA 5HOOA 3FXUA 2NXNB 3WGHA 3HL2A 2CQQA 3LQRA 2DFIA 4XR6A 3AG2H 4JBAA 4KN4X 3FXRA 1I6XA 4I02A 1XCVA 2YS9A 2O03A 1MD0A 5E18F 2ZXHA 4X6AJ 1OCZH 1FMVA 3Q3SA 4F91B 5DCMB 3A01A 5GPAA 1OCRH 5EEGA 4LB6B 2I8DA 2M34A 3ASOH 2EQRA 2MD5A 2N8GA 2VOPA 3ZMZA 1F5TA 1OLTA 1LVAA 2Z1DA 1MSEC 2VONA 3RTRA 2IBDA 1W1WE 3CP2A 4D5FA 2J5PA 1YLFA 2K4JA 2TDXA 2Y0SA 3I58A 1B72B 5HLHA 1Y1WJ 3CO7C 1YYVA 2DK8A 2XGXA 2RKHA 1VF9A 1MH4A 2QVOA 4ETSA 1J9IA 1VTNC 3E5QA 1PDNC 2A6EF 3SHFA 2EINH 2HTJA 1HKSA 3KP2A 4OIOF 3NRVA 1V54H 1WVRA 2Q8KA 3IC7A 1VQPI 3GZ6A 2K85A 4L5IA 1VZ0A 3GVAA 4OAYA 4AIDA 4Z6YA 1MBFA 5H2FC 2JSPA 1WJEA 2PBIA 2L7KA 1S9HA 2JJ7A 4RAYA 2ISYA 2R5ZA 3ABUA 1ETKA 2EZHA 3VYUB 5JVGF 3OL3A 3RJPA 1I1SA 3FISA 3C2GA 2DA6A 1P7JA 4X1EA 5M3MJ 1Y1VJ 1STZA 2O61A 3K70D 3SZPA 2MW8A 3IH2A 4HSRA 5JHFA 4RB2C 3CJQB 4B8XA 4KMFA 4HPQA 4U0VA 4I99C 3IL2A 3M3YJ 2IS6A 4KITB 2VC0A 1MMSA 4E7HA 3DTEA 4GYIA 1BI0A 3WU1B 4YRVA 2ESNA 4HF1A 1LEBA 3WTVC 3OS2A 1LFPA 1WJDA 1N25A 3F8CA 1AHDP 1MDMA 3HSFA 4KFCA 2PEXA 3K4LA 2TRTA 3EUAA 5AONA 3WHCA 1SVOA 1KQ0A 3VB2A 5LGTA 1D1CA 2IA1A 3UNGC 4RM3A 3U2RA 2WV0A 2Y0MA 2R0QC 5E3OA 1EA3A 1RKWA 4D7MA 2ECBA 4QTRA 2V9VA 2W4SA 3GXOA 3H92A 2G0EA 3MMYB 1JUSA 2F6CA 2RGVA 3OOUA 2KZGA 2VT2A 1FT9A 2H8WA 2V7FA 2GIZA 5HVQC 4N4OB 4B48A 3CESA 2Y9YA 2KL4A 5B5EC 2P0WA 3M8FA 2DDAA 4U0WA 3HG9A 5HS8A 1YX5A 3LAJA 2Z99A 4AD9A 4DZJA 1RETA 3LL7A 4OU0A 2JRTA 3JRIA 2V6EA 3TDZC 4WXCA 1SVMA 3K4JA 3LNQA 1JGGA 4UY8I 1OR7C 4DQ2A 4M3EA 3HXLA 3FHNA 2HDCA 4QWQA 1FOYA 1YQAA 1FSEA 4LD5A 4J19A 4EGZA 2L9NA 5F08A 5EEHA 5E20A 3HGGA 3IKTA 3K2AA 5BPDA 4M9XA 4D7NA 4CDGA 1W5SA 4XRFA 1Z3YA 2WAQN 3LSKA 2NS0A 2CFXA 4G6TB 1WWXA 3FDYA 2R93J 3GLLA 3S1RJ 1ZAOA 3HTSB 3GEZA 2IW5A 4XM3A 4IEJA 1APLC 2BXZA 2YSRA 4ITVA 1IJWC 5FJ8J 2A07F 2WTEA 4EQQA 3IH3A 4V2FA 3TO6A 4I6ZA 4RGXA 2AHQA 1FYMA 3HRSA 4OIPF 4AU7A 1IDYA 1J09A 1IXCA 4ENKA 1OR7A 3DFGA 2IRFG 1LQ1A 2AXTC 4RLFA 4HQEA 1FOXA 2HYJA 3SXYA 5DS9A 3V7CA 2XV4S 4Y13A 3G73A 1SC7A 3PFYA 2ICWG 1OPCA 1J2XA 1FP1D 3DKWA 3C7JA 2BY3A 3S32A 4CHUA 3RZOJ 2DTZA 3MEXA 4ZZDA 3JR9A 1AKHB 1OQYA 2OJED 1C0WA 1NH3A 3NARA 3ABLH 3OYFA 1NHAA 3J7AY 2L3DA 3GMEA 1LFUP 2DA2A 1VQMI 2X48A 4V2GA 4D1QA 5L3EA 1YJWI 1XGMA 2NVYJ 2VJ5A 2JSCA 2A5WA 3DKYA 1R4NB 5DCFA 5KK1A 1KGSA 3U21A 3HUGB 4E7JA 1T56A 2BW3A 2ZXIA 4ESJA 2L5QA 3H9JA 3QODA 1R6RA 4FETA 4BDZA 4A93J 3HTUA 3HHHA 2Z2SB 1XG1A 4KICA 5HS7A 5IYCJ 4G7ZF 1AOYA 2IXSA 1N75A 2HU9A 4O5VA 4D9JA 2Y9ZA 1QZYA 2GIVA 4CCNA 3CF5F 4MFDA 2EWNA 1BC7C 1FC3A 2EZIA 4II2A 2QWWA 4A69C 1U8BA 2EK5A 3LSHA 3O8GA 3REOA 1FTTA 2D5VA 3CDHA 3G3ZA 3M07A 4M3DA 4LK0F 2WWYA 2EA2A 1T98A 1Q1VA 5JVTA 1TL8A 1RR8C 3HOUJ 1ZARA 1I6HJ 5CVRA 1T0FA 4B09A 3F22A 4W1UA 1A35A 5M5WJ 3IP4B 1T0FC 3BR2A 1S6LA 4E6KG 1D5YA 3LFKA 2E1MC 5LBQA 2A05A 2XB5A 2ADUA 3PSFA 4RB3C 1SANA 4RMNA 2D2WA 1AU7A 1XDSA 1MW7A 5JR3A 1FTZA 4OWRB 1SD4A 4M6YA 2MC3A 5FROA 2YR2A 3A2KA 1A6QA 3DV8A 4XONA 2KT0A 2EFQA 3QP5A 4B47A 4BL0B 1XGSA 2VKDA 5IP7J 2BW3B 3RSNA 2ZJ2A 2WAEA 1W7PD 2Z16A 4A3MJ 2PJRB 4IHYA 1GHCA 2OTLI 2CQKA 4NC8A 5C3EJ 4P5OA 4KIBA 4I01A 4BYYA 4FTHA 3HM5A 2W82A 4B4CA 3T8RA 5E3NA 2FD5A 3FM5A 2GZWA 1UG2A 1Q1HA 1KONA 4U87A 1ODDA 3KPHA 2CO5A 3I55I 4EGYA 2KDZA 3OYMA 2LMDA 2F48A 3OV8A 4HX4A 1GDTA 1F1ZA 2QKMB 1O7FA 3PO2J 4IPAA 2K7LA 4XSZF 1J7KA 2EH3A 3HKZN 4IRGA 4YFKF 4PK4A 3OS1A 2L2OA 4XLAA 2DA7A 1U6GA 1YW7A 3VDXA 4LIVA 4BHBA 4CSWA 1Z3XA 3E3VA 2A69F 5IYDJ 4AIHA 1ZR2A 2A5YB 3CUQA 1HXDA 4M9SA 2VPLA 1XDUA 2WAQA 3BCAA 4OOIA 5CQGA 2WADA 3FXOA 3PJRA 2K3FA 4JK1X 4HAMA 3OYIA 2XF6A 2PJPA 3BR6A 5F04A 4I09A 1H9GA 2XKOA 1AKHA 1H88C 2FQ3A 2HYFA 3FWEA 5E1WA 3E0JB 2BY0A 3TOAA 2CUEA 3IUOA 1Y6IA 2XAUA 3TO7A 3EQLF 4XL9A 5J8FA 3K1MA 5C4XJ 1V4RA 5FLMJ 4BBSJ 2LBFA 2WB1N 1PVEA 2XPUA 4M73A 3CCUI 4HYEA 3L1PA 1DU6A 4KJZA 4FISA 1T08B 4I2OA 1ZRFA 2ZMEB 2VBZA 4M72A 4XK4A 4QLCU 1BR1A 4XLNF 1QQIA 1ZTRA 2EFWA 1IGNA 3OYGA 2KJBA 4B3AA 5L3DA 2HXOA 3HIFA 5FKKA 4CXFA 1R4MB 4NBQA 2HQAA 2XUBA 4UNOA 1O3TA 3K4KA 1SD6A 3HJEA 3F8FA 1X3WB 3OR1C 2W1OA 2D45A 4HNVA 1PUFA 2R7ZJ 3ZQQA 1MMDA 5EZGA 1BIAA 4LFUA 2VKVA 2GWRA 5IPAA 3UKGA 2FNPA 3MZYA 3SZTA 4Q47A 4KIFA 3ZMUA 2NNNA 4LJZF 4Y3OA 3K0LA 2W84A 3HRMA 1QGPA 4A5NA 3A0BC 4DBQA 1VQ5I 2P7CB 4CA0A 2XGCA 4XMYA 3HPHA 5J4YA 3DBHB 3MN2A 3LSRA 2LKXA 1BA5A 4L9JA 2VQHA 2IGNA 1XSVA 1HSTA 4ZYEA 2KIUA 2QQ8A 2CW0F 4MLOA 2MABA 3C2HA 1LDDA 1NG6A 1YITI 1H89C 2ZSIB 3OS0A 4ON0A 2W24A 2QUFA 5TGTA 3JRCA 3L2WA 3ZR8X 3ZQ7A 3EYIA 4XRMA 4A2UA 1VQ4I 4EMSA 3LQQA 3F23A 1N78A 4II3A 4IVNA 2X9DA 1P2FA 2DYRH 2GA1A 3W3CA 3KYDB 2OUMA 4HLXA 3E97A 1FEXA 1ZK8A 2VJJA 3HZJA 3WU0A 5DTDA 4NQWA 3QP6A 1OCOH 3R60A 1SFXA 2DAOA 1FP2A 1HW1A 1WFXA 2IA2A 3DPLC 5CVVA 2E19A 5FKMA 3S3OA 2K86A 2M0CA 2BY1A 3LFUA 3OYJA 3CCVI 5L3FA 2BV6A 5FFZA 2DO7A 4EV0A 4N9HA 2E1CA 3H9GA 1UAAA 9ANTA 2JZYA 5E8IA 1ZLKA 2R7SA 3HGYA 1YI2I 2GAUA 2NNYA 4LITA 2CQXA 3DWLE 1CF7A 1KYWA 2K9LA 4KT6A 2P5LC 1T38A 2E35A 3AKZA 3SZGA 4MHGA 2XDVA 3DXJF 1X2NA 2OCEA 2G9WA 3OOPA 1ZYRF 1HCRA 3G1LA 1XS9A 2BE5F 2H94A 5B1BH 3ZOBA 4L0ZB 5H6RA 3RQ4A 2QEXI 1ZKGA 2F5CA 1JKQC 4LG0B 1WKMA 4XKWA 2CW8A 3GTKJ 2ID6A 2IS4A 4ENMA 4MIMA 2FRHA 3J7YJ 2K9MA 4F93B 4HF0A 3KZYA 3U9GA 1IRXA 5B1AH 4OIRF 2H09A 1G8XA 3ZQHA 4WXDA 2NVUB 2KLOA 2IGOA 1HSJA 2KP6A 3U1KA 4BJTA 4ZYHA 3V7SA 2LNBA 3OYLA 1IN8A 4RAFA 1WJBA 4A3JJ 1KU3A 3C2BA 3CCJI 1HF0A 1OISA 2ZXWH 2M30A 3H0DA 3HBLA 3PO3J 5GADJ 1K4SA 1POGA 2ETHA 1UELB 1IZ1A 4C3JJ 3HUGA 3BY6A 1ZRDA 4M6VA 3BC8A 1KU9A 3GUDA 2ACJA 4L5JA 4G9YA 5HODA 3J7AO 2R3SA 2X6YA 3M8EA 2FEZA 5D6FA 4JX5A 1X1PA 2GM4A 1J5YA 1LNWA 3VSLA 2XGEA 5LFAA 2OC6A 2LREA 3GFLA 1WCMJ 1MJAA 3ASNH 1W7PB 3RIRA 1A5JA 4U7BA 3DKXA 3DBRB 4B44A 1BM9A 1OYWA 3OL4A 4DZPA 2PG4A 1GVDA 5IT9Z 1FSHA 1R5ID 4BH9A 5E3LA 3O3KA 3RPUA 3L2RA 1MBKA 4KT5C 1IV6A 3P9IA 3I9V2 2BXYA 5GTIC 1SD7A 3EUHC 3IAM2 3G2BA 1QBJA 5LGUA 1XGNA 3PUFA 2RQQA 2GQQA 1IXRC 2W7NA 3CJRB 4X0GA 2RN7A 2DW4A 5A2QK 1S8NA 2KMUA 2VT3A 1Y39A 2LBFB 1KYZA 2CQNA 1MBGA 2EFPA 2DOAA 4FASD 2K3PA 2ISZA 2KISA 1S3JA 3KEQA 2R92J 4A0XA 3CLOA 4XOPA 3RKQA 4IKFA 3GF2A 5DV5A 1YOVB 2CGPA 2DA3A 3NWSA 1SEUA 3MZHA 4PFOA 1HBXG 3SQNA 3F8NA 3RDIA 3RKYA 5F0HA 5BMZA 3VYSB 1YIOA 3FXMA 5E8GA 5ILVA 5IOYA 2R7VA 2BOLA 2L01A 5EEAA 3CMEI 3OSGA 1XD7A 2FOKA 1ON2A 3WE2A 2PN6A 4FCYA 1U8RA 3PQJA 3JRAA 4N9IA 3RZDJ 3KCCA 2F5VA 4L9NA 1TW2A 1MJ9A 2OV7A 3EPZA 3KP5A 2EIKH 3TGNA 3I4PA 2IGMA 2EB7A 1TWHJ 1E3HA 1XN7A 2P8TA 4RAGA 2DBBA 2KIQA 5EF6A 3WTSC 1IUYA 1MNEA 1OKRA 5LHGA 3WTZA 1U78A 3S1QJ 3CUQC 5KCMA 1IN7A 4KN7X 3HOSA 3L09A 1DGWY 5HDKA 1T33A 4ZZLA 4DW6A 4WK8F 2V1DA 5CKTA 4QPQA 3OY9A 3GZ5A 2XC7A 2AO9A 2X1DA 1R36A 5ICCA 1X1BA 2KIFA 2VUMJ 2JPBA 4RB0A 3OYHA 1DP7P 3WU2C 3S16J 1BOBA 3F8MA 3DLLF 4BNCA 1L3LA 1R1UA 3O8HA 4ZDPA 4ASNA 5ICEA 4HF2A 1FLIA 4UV8A 3KFWX 2M4GA 3PM1A 1Z9CA 1TNTA 2EZKA 4GCVA 3BZKA 1K78A 3CC7I 2W57A 3ZQFA 1TT5B 3OIPA 2RQPA 1MBEA 3FBNB 2KRCA 5IP9J 2CH0A 4G6DA 3DLAA 1QPIA 2FE3A 2WAFA 2NOJB 2E34A 2MC4A 2W25A 2E1OA 4ENJA 1FJLA 2EBIA 3QPLA 5DUKA 4IOCF 4RM2A 4L18B 2XAHA 1JJ8C 1B72A 4PFPA 2YU9J 2Z5UA 1YJ9I 3I59A 3VYTB 2EV0A 1ETQA 2ZJQF 1W36D 2MYSA 4FX0A 3DEUA 1PJRA 1QVUA 3PNTA 2OAZA 3K1NA 3L9FA 3ZQGA 1UCRA 3QYBA 1F43A 4HX7A 2XPVA 4MNUA 3HOTA 2R5ZB 2XRLA 4BXXJ 4HSTA 3H5AA 3G71I 3FK7A 4DNCA 5GPCA 3S3NA 3PUBA 1Z7UA 2VOOA 1V5EA 2J5OA 3MVPA 4BQQA 1SAXA 2AQEA 3HOZJ 2XAQA 4RAZA 4UXNA 1VI0A 1LE8B 3K4CA 3Q0VA 1EV7A 1LKXA 1P92A 2COMA 4V19K 2EPFA 1WH7A 2VXZA 1ZG3A 2XAGA 4S04A 3N97A 2EFNA 4H4KC 3WGGA 4HV6A 1HC8A 2LF8A 1DGRM 2DT7B 1Z0XA 3ZMTA 3FXJA 2KRFA 4PJNA 4RA2A 4A3BJ 2CV1A 1HLVA 1OJLA 1GXQA 2OPTA 1K7AA 1BL0A 1P9QC 4HW0A 2GBYA 4JYKA 3TP3A 3IHUA 5L3BA 1JT6A 1B59A 1Z1DA 4FHTA 3SEQA 4UUSB 2FOWA 3TDUC 3HSEA 5DD4A 2QENA 5D8LB 2TCTA 2H1KA 1VQ6I 4A3DJ 4AM3A 1QHHD 3ZP5A 5K5QA 3W2AA 5A2QZ 2HVRA 1BIBA 3ROUA 3JRHA 2I10A 2O0YA 3E5XA 3MKZA 1Z6RA 1V5GA 2YPRA 2D1HA 2JMWA 5EG0B 3WG7H 5D5XB 2LF7A 2DA4A 3I0TA 4FT8A 3WTUC 4BEHB 4M3FA 1FMWA 3EETA 3H3ZA 3WG9A 2KIMA 3ULQB 1HQCA 2DJIA 3CDIA 2LRDA 4E7LA 4BY1J 1P4XA 1MMAA 2DYSH 3SJMA 3QOPA 2GA2A 3HC7A 2LDUA 3BDDA 3MFKA 3IWFA 4BQNA 1B9MA 1TQMA 2UV1A 1G6NA 4YFNF 4IRHA 4MO7A 2DMTA 1ZREA 3SDBA 3BG3A 3CMAI 2VLAA 5FB2A 3IRRA 4L9VA 4XRSA 3DQVC 3E6MA 4BGDA 2KDOA 1Z67A 4ESBA 3BTIA 4CO8A 2ID3A 2WC2A 4KISA 4DBRA 2QM3A 4P55A 2ZBKA 4ZYAA 3FM3A 5KVRA 3S2WA 3ZMVA 5LRSA 3E1SA 2HXIA 2CW7A 2K9NA 4WX9A 3E5UA 5FRMA 2HS5A 1ZHFA 2EV6A 2JUGA 2VJ4A 3TQNA 5J3LA 4CCOA 3L2CA 4C2UA 1IN6A 1JUMA 2CFOA 1K83J 4BE0A 1FIPA 3WTWC 3TO9A 1DQUA 2JUCA 3F0CA 1REPC 1Z6TA 2ECCA 5E17F 5FLVA 3KP3A 5J47A 5DM6F 4UVAA 4RS8A 2JTVA 4A0ZA 3BCBA 3ZN0A 4XNFA 5BS6A 3NEUA 3GTQJ 1UHSA 3M9AA 2X85A 3LSMA 3GCMA 4LLGF 3CJNA 3LMMA 1T8IA 3VFZA 2JT1A 1YG2A 2VE8A 3LWFA 4AYBN 1D0ZA 1QPMA 2VPRA 2QBYB 1PYVA 1FBUA 3NWTA 3R0AA 2LTPA 2IJLA 1DP3A 2H6BA 4EM2A 1WI9A 2V4JC 2CYYA 2L4MA 3W2WA 1E3PA 3GTJJ 1JHHA 2BY2A 2Z9OA 2LSOA 1R1TA 4CYCA 4IQ4A 4UV9A 4XN3A 1G2HA 5HNFA 2VKHA 4IO9F 3I54A 1X4PA 2KRHA 2JPCA 5EGOA 2GXGA 2B7EA 1W5CC 4R1HA 3LSIA 3S8PA 1SVLA 3OYDA 1TQPA 2E1NA 1HW5A 4QIWN 1EH6A 3DCFA 2O5RA 2H8RA 1R7JA 1GVJA 1XTAA 4UB8C 4M71A 2GOXB 1X1AA 4XSXF 2CMPA 3SEZA 2DMPA 3A01B 4F52A 2K9QA 1QZEA 1UG0A 3OR2C 4XLCA 1R22A 3TEDA 2CU7A 3ABKH 2WV1A 3FIWA 3TW6A 3CJTB 5C4JJ 1KU2A 1W7PA 4I0BA 2L9VA 4IRIA 3RYPA 2VB6A 2L0KA 3JTHA 5AIPA 3ZGKA 2P6TA 3J7ZI 4Y7NJ 2R7XA 5DD8A 3LA7A 2XHKA 1DDNA 2Y69H 2HQ5A 3ERMA 3VOEA 5J8CA 3VEPA 2KZVA 3QU6A 3QAHA 2FMYA 4WXHA 1I50J 3HRTA 2COBA 3F21A 2L9SA 2KJCA 5J40A 3CQZJ 4MEYF 1AWCA 5EJCA 1Z21A 2EFOA 2MD0A 5CYVA 1JUPA 3J81Z 1XCBA 3NQOA 2GLOA 3QOEA 1IW7F 4LLLA 2LY9A 2HGCA 1VQKI 2Q2EB 3J80Z 5E3MA 2LLKA 2JK3A 4DYCA 2MH9A 2X6XA 3OYBA 1JT0A 1A31A 1ETOA 4ZDLA 1MBJA 1KQ9A 2Y48A 3IRQA 4FE7A 3BG5A 3V8JA 4A3CJ 2M7AA 2R7FA 2M45A 5EG0A 1Z05A 3OYNA 4IHVA 1LVKA 3BR3A 3I53A 2OZUA 2ZFWA 1TTYA 5F27A 1RUOA 1FNNA 1EJ9A 3DTKA 1TZLA 3T5XA 4NUBA 4JQFA 1IDZA 4M6XA 4AVPA 3M4OJ 5C44J 2NVTJ 4E70A 1I1GA 2EIMH 3IWZA 3DPTA 3P9CA 3LOCA 4ZYDA 2STWA 4LB5A 2XAJA 4EM0B 3ZQLA 2G7HA 3VPRA 3CTAA 2VASA 3CCRI 5FLXK 3GTGJ 1SMTA 2E1MB 4MEXF 1OMIA 2MG4A 3ABTA 3HKZA 3HB9A 3QQAA 4N4NB 1XGOA 2CQ7A 4BU2A 1FOWA 3OWTA 2B9SA 2IGKA 4OAZA 2BHYA 2RREA 3Q0UA 4C2MJ 5HLTA 3FHZA 3FMSA 1MDMB 3V7RA 3SFIA 1QVTA 2ELJA 2XSJC 1ZG5A 4Q48A 3TOBA 3NAUA 3K70C 2V1XA 3L7WA 2CS3A 2STTA 4DYRA 1K79A 5CPRB 3R6SA 1R5GA 1FX7A 1V3FA 1KQ8A 4CH7A 4JX4A 2VI6A 5LD2C 2K4BA 4EM1A 4O6JA 2NVQJ 5GP9A 3DPUA 4JX6A 3LSGA 5CVIA 2HZDA 2F4IA 1GT0C 1FY7A 4CCJA 3N4MA 5BPIA 2KHMA 3C3WA 3K2ZA 4P9UA 2ZJPF 2XIGA 2BZTA 2VIXA 2VL8A 4U88A 3JREA 4EJUA 2HVSA 2F2EA 2XASA 3FX3A 5GAGJ 1ITYA 1M1EB 3I3LA 4MTDA 3LSPA 4A3IJ 1RRJA 1F9NA 2B63J 2GXBA 1ONVA 1WI3A 4ZTJA 2HNHA 4MQ9F 4F3QA 3ESWB 4LG3A 4R79A 4UUTA 5GTHC 1IUFA 2XPWA 3SDGA 4Q4ZF 1D1AA 2XF7A 4NNJA 2E71A 3PFIA 2PMHA 3ZRGA 1FYLA 2QCOA 1XSDA 4IHTA 1SMYF 3GTLJ 1E3OC 3GWZA 3I4NJ 1KA8A 2R7RA 3CCQI 2V1UA 1UHMA 2V9KA 3BTCA 3QPTA 4DGWB 4XIDA 4R8HA 3HOXJ 2VE9A 4XLPF 1U5TA 3E6DA 1WJ5A 4U7DA 2LR8A 1FPQA 3CC4I 5ICGA 4P1WA 5ED4A 3A0HC 3ZXSA 4Z2YA 3DP7A 3RQIA 6PAXA 3GFMA 4PJ0C 4J01A 3SFZA 5LGNA 1JJ6C 2YU3A 2DI3A 1X1CA 3BJAA 5JLXA 4RGRA 2HR3A 3CDLA 4BXFA 4BS9A 4IOAF 2LYCA 2D1VA 5M5XJ 1VQOI 1TC3C 4DYQA 1QU3A 3K1PA 3MD2A 3MQ0A 1UZCA 1BI2A 2CSOA 5HLGA 5IYBJ 1U9NA 4FX4A 1MJBA 1MBHA 2L7ZA 2X6WA 4C2TA 1GV5A 4PGHA 3A03A 2GOMA 4E4HA 2RVCA 5F1JA 2VODA 1IG7A 2CJJA 4PCQA 3S17J 5IT3A 2HDWA 1QHGA 3KE2A 1HDPA 4UUSA 3FKIJ 2VBYA 2HOAA 2R4GA 4QSHA 5M3FJ 1U5TC 1J59A 1XB4A 3D5RC 1WZ2A 1GXPA 4HLYA 3D1NI 2E2IJ 3P9KA 2A6TA 1LDJA 3H5RA 1D8KA 3P5JA 3BG6A 4L9TA 4NC7A 4B1RA 5AIQA 1JKOC 1NG7A 3GFIA 3A1YA 2LC2A 4EVIA 3T1BA 1BJAA 2HWVA 4CCMA 1IN4A 2R7UA 3P7NA 2Q0OA 4DJAA 5JLWA 2C6YA 1SFKA 2M7BA 3UR3C 2R7TA 1HDDC 2M9HA 2QYOA 4CUGA 2AS5F 4NHJA 3K6GA 1AA7A 4XRSG 4B3XA 3R4KA 3VODA 4D0PA 2FUG2 1G3TA 4FE4A 1Z91A 4DIQA 3JCUC 2PQ8A 2E2JJ 2R7QA 1Y0UA 3AFHA 1ZR4A 2DLLA 1H9TA 1P7IA 3PIOF 1T95A 3L00A 2GXAA 5HS9A 1MGTA 4I0AA 1D3YA 3CCLI 2E5NA 1YRNA 4LG0A 5D5WB 4BKXA 3ML6A 3BR1A 2M8EA 3GZNB 1NTCA 3U1DA 3S15J 2V1NA 3QPHA 4A5MA 2WBMA 4RGUA 3K69A 3GFJA 5J4VA 2HFHA 5FD6A 1BJZA 3RPQA 1R5HA 1QRYA 1WGXA 4G7HF 4E7IA 4GYGA 5K5OA 1LPQA 2E2HJ 2X1EA 5CVJA 1S29A 1K61A 2BYVE 2DOFA 3RKWA 3BTJA 2W85A 3AAFA 3HOWJ 5F0FA 3Q9SA 4BHCA 1ON1A 5TRDA 2XRNA 4PJLA 5ERIA 2W00A 2V9PA 3BZ6A 2EZLA 2QSHX 2QGUA 2KKOA 1IRFA 3HSRA 4A3KJ 3WODF 1MZBA 1TP4A 3LSJA 2O8XA 2DA1A 1F4KA 3V4GA 4UUVA 2CV2A 2LY1A 3CCSI 3B6AA 1XC5A 2L7FP 3H5NA 4PSXA 4IJAA 3GO5A 1K6YA 3W2VA 3KZIC 1R00A 1U9OA 4UVCA 2QQBA 3R0JA 2QBYA 2OU2A 2HVQA 4GRIA 4LIUA 3RI4A 4IX7A 4EJTA 1S5LC 3TMOA 4ANJA 5JFRA 2BEOA 3BG9A 2P4WA 3EDPA 1JHFA 3ZQCA 3M1CA 4PGGA 4BJ6C 1R1VA 4KYWA 3AL0C 3ELKA 4HEA2 3BZCA 1I5ZA 5H6QA 4BACA 1ZG1A 1U2WA 2PLYA 1BR2A 5TJJA 1ZLJA 1DU0A 4EATA 3Q0WA 1X4OA 2RDPA 4LOCA 4BQAA 3HOVJ 3MKWB 1RI7A 4AIKA 3H9QA 3ZN1A 3E6BA 1XSXA 2O7OA 3BROA 2PI0A 1HA8A 2OTJI 3BTLA 1VQLI 3BLYA 4KIGA 2VXDA 1O3SA 5J1YA 5DM7F 3S14J 5DCMA 1L0OC 5F1RA 1TWCJ 2JVHA 1G3WA 1IAWA 4G94A 1EKEA 3DU5A 1FYKA 4S05A 2IT0A 2QSGX 2DQRA 2XAFA 3MCZA 5J1UA 3KP7A 1N77A 1IV8A 1W4MA 5CVUA 1O3RA 2NYXA 2WY7Q 3QWLA 1O57A 4HV5A 3G4SI 1RR7A 2W48A 4I76A 2H1LA 2M8GX 4A6EA 1ZGWA 1JGSA 1LEAA 3ERED 2LVSA 1ORKA 2FBKA 3FXKA 1KU7A 1LE8A 5K7FA 4HG2A 1Z77A 1UB9A 2EA4A 2MBFA 2PX9A 3L2QA 4GO1A 1D1BA 4F55A 2WA0A 2K5CA 3FXQA 5F0CA 4M3GA 3F8BA 1EH7A 2HQNA 2R7WA 5H20A 5K1YA 1B8IB 5J6XA 2LOOA 1FIAA 2XB0X 5EYRA 2ZJRF 3I59B 2B0LA 1MH3A 3E6CC 3KLOA 4L0YB 5GAHJ 2K9SA 2XSDC 2M5WA 5HLIA 3VSKA 4YIIA 4BE1A 1IC8A 5FGMA 1RPWA 3S1NJ 4IL6C 2HI3A 2E7WA 3CUOA 4HDUA 5E1ZB 2NAZA 2R5YA 4CICA 1WJCA 4WF2A 4AYBA 3M8JA 1XX5A 2QZ8A 4LMYA 4UVBA 2YX7A 5F64A 2VC1A 4M3BA 4AIJA 4MQVA 1PUEE 2ZMEA 3CCEI 2BGCA 3WGIA 3BR5A 3LA2A 2QA4I 2CWEA 3FMRA 5FD5A 3WE3A 3JW4A 2HEOA 2VBXA 3TP0A 3KYLA 3FKJA 3CF2A 1W36C 3LSTA 1XPXA 2JWTA 4OMYA 3FMQA 1TNSA 4CZCA 4BQOA 4ENNA 3BP8A 2LH9A 1DPRA 2DJNA 1JTXA 2V6CA 2XROA 2IEKA 2X1CA 3V42A 1J0RA 1K4TA 3KZZA 1IRZA 4HOBA 1A36A 1U0JA 2JN6A 1B9NA 4P96A 4Y4RA 1ACIA 1IF1A 1EH8A 2LKSA 1OCTC 1XMAA 1TWFJ 4NB5A 2ME0A 2L02A 1VQ8I 4XLEA 3JSPA 1XMKA 4CYCB 4C9YA 4OIQF 1MNDA 4EJOA 3JSOA 4OINF 2LG4A 1Y8RB 2MLKA 2HPMA 1V5FA 1S7OA 2L9RA 3VYRB 5K5RA 4P9FA 1A6IA 2HYGD 1E17A 2BBYA 4U0YA 3PIPF 2EILH 3CMMA 4NQWB 2ZMEC 4B43A 1TLHB 1CGPA 2HOTA 1D5VA 1U3EM 3KP4A 4XLFA 4PZJA 2P6SA 2JRMA 3WHBA 5HNHA 5K7ZA 4YIRX 1S7EA 1ZGAA 2E7XA 2JVGA 3M1EA 3H0GJ 3KX2A 1S72I 4IHWA 3JTGA 3H3UA 1ZN2A 1FOKA 2A3SA 3I5UA 3VWBA 3ISPA 4XBFA 1W0UA 3G6EI 4KMUX 2DCEA 2OA4A 2PJRA 2AQFA 4PDKA 1RZ4A 1WQ2A 1Y8QB 2WB1A 1WSUA 3CP8A 4WWCA 1ERDA 3OIQA 3I64A 4AC0A 4TV7A 5B66C 4GDFA 4C30A 2A68F 2L4AA 3CMYA 1ZGJA 2K27A 4ZTFA 3HYIA 2NRAC 1S7AA 4BUPA 1ETWA 1SAUA 2IS1A 4A6DA 2Y30A 1VQNI 2BVMA 4GXOA 2DPDA 4YIFA 1FBQA 4XKVA 3K4NA 3F6VA 4Q5SF 2JA7J 1MMNA 2ZC2A 2XF5A 1IRGA 2VBWA 2CG4A 4ZDOA 2QSFX 3F3XA 1X3ZB 1MMGA 1CF7B 3W6JB 2L7MP 1YW8A 3ZMSA 2UXXA 2OF7A 1RKTA 2CRGA 2LK2A 2VQGA 2RNGA 3ECOA 3W6VA 4CYDA 2VJIA 1UMQA 2DFEA 3AG3H 3JAMK 3QPSA 1BN5A 3D5LA 4I98B 4PSWA 3CLQA 2L54A 2ZNYA 4IZZA 4BXUA 3WTYC 1H0MA 3ECHA 2Q2EA 2R7DA 2RC4A 4RBOA 1JKPC 1HKQA 3OYAA 4A3FJ 4A3LJ 4Y52J 4HX8A 3JRBA 2HZTA 5JHUA 1WHUA 4M74A 4RLQA 4UB6C 1YS7A 1OYIA 2O3FA 3BQYA 3OSFA 3Q5FA 5D5VB 1R23A 4XQFA 1R71A 3J81K 1A04A 3JRDA 3OYEA 4HDVA 2IVMA 1X58A 4FQGA 4IHSA 4YG2F 3I56I 1FWZA 1BI1A 3KIOA 5KHDA 1BI3A 1JKRC 3MKLA 4N0BA 3FK6A 4EJWA 4HQMA 2KPMA 2LD5A 1PUFB 5IT9K 4A12A 2DMNA 2HQRA 3G1MA 1YW9A 4ABZA 2E36A 1OCPA 1YJNI 3BPVA 2HKXA 5EGOB 1P6RA 3O2PE 4QPOA 2DODA 1WPKA 3K4BA 1YE9A 4A3EJ 4F92B 1IN5A 3IKVA 1DPUA 1XMXA 2Q1ZB 3QRFF 5B3SH 1BW6A 4IF4A 5LRRA 3I71A 2DMQA 2JA2A 5CJ9A 2Y2ZA 4E7KA 2CUJA 3D0SA 1YIJI 2DK5A 3W6KB 4HRIA 3H1CA 1T39A 2OCCH 4LLNA 1LDKB 2KFDA 2M4KA 2IA0A 1E2XA 3V8KA 2OD5A 2H27A 1HW2A 1RNLA 2F4OB 3GTMJ 3FXLA 4K2EA 4IQJA 3TW7A 3QYFA 1E0EA 3PNYA 5BQTA 4XICA 2PMZA 3CCYA 3DTIA 4XLHA 1TWGJ 2O9LA 5L3GA 3BJOA 5FFXA 3GTOJ 2OQGA 3TKYA 2Y31A 4XORA 2XVCA 4MFEA 2HOSA 4ZH4F 4BY7J 4S0HB 2CV0A 1F36A 4CCLA 1YTYA 2DMUA 2A6HF 3GLXA 4IHXA 4XKCA 1V55H 3PQKA 4KUMA 2NS7A 4BJ5C 4D5CA 4C3HJ 4E7ZA 1ENHA 3HHGA 5ICFA 4ZJZA 1B8IA 1O3QA 3CO6C 4BDYA 2RV8A 3BR0A 3F9KA 3B6CA 2DU9A 3B73A 3KEOA 4PUSA 1YX3A 1ZH5A 1K78B 3OYKA 2LP0A 1O7LA 2IPQX 2ELKA 3A02A 4AVZA 1SFUA 3OYCA 2O8KA 5IP6A 4NDLA 2MSYA 3KYCB 2FJ1A 3PL8A 4RDUA 1U5TB 1GLNA 2HDDA 2DTRA 1NK2P 5D4SA 4MGRA 1VQ9I 1I27A 3MWMA 2DN0A 3V8LA 1G4DA 3TBIA 1WJFA 3D5SC 4HZFA 5F6FA 4EJVA 2ZFUA 1TWAJ 5TISC 4C3IJ 2FMLA 2JQ7A 2MGQA 4YELA 2F5DA 4F7ZA 1Y0NA 3T8TA 2M1BA 2M87A 3M7GA 1NK3P 2A61A 5LEJA 3KEYA 3KP6A 3AL0B 1ETVA 2DOEA 2X6OA 3BT9A 1I3AA 1QZZA 3O6BB 3QU3A 4Y33A 3MKYB 1JE8A 2DXIA 4ZYGA 1LFBA 3A4CA 3MAJA 2NVXJ 2F4MB 4XN0A 5IY5H 1B1BA 1WJAA 1QO0D 5E1XA 3Q9VA 2FXAA 2OBPA 1RESA 1JXSA 2YUSA 5GAEJ 2ZKZA 1OYYA 4XOTA 5BNGA 1SD5A 1WRJA 4AUXA 1OFCX 5D8KB 5DUIA 3CZ6A 3RYRA 2DQLA 3CC2I 4OMZA 5KAIC 2FX0A 3DEWA 4IXAA 1I39A 2QQAA 2RNJA 3GX4X 2DDBA 2NOGA 2FQ4A 2FU4A 2P5KA 3RCOA 4CCKA 1P4WA 3JRGA 2PMZN 1VQ7I 2CUFA 1YS6A 3IH4A 2DT5A 1D0XA 1B6AA 1B4AA 3CD6I 2Z33A 3N05A 4UHTA 1HOMA 1W5TA 4I7HA 1FBSA 5D5UB 5M5YJ 3KETA 2UZKA 3PSIA 2R7OA 2FA5A 4M9ZA 3T0YA 1MKMA 4G12A 3GBGA 3FBIB 3H36A 4HBLA 4JOMA 3MZ8A 5FKNA 2X4HA 2PMUA 1OCCH 3RKXA 2UXNA 2VQLA 3IAS2 4LGWA 3ZMDA 4BBRJ 1G59A 2FBHA 3PNVA 1UJ8A 4G7OF 1JTYA 5EDNA 4PJJA 5FO5A 3QYEA 1R58A 1YFHA 2FNAA 2X0LA 2NS8A 2DFFA 4Y17A 4PJMA 3E7LA 2RAEA 2DFHA 5DEQA 1YO5C 3L2VA 3LAPA 5HDNA 1TBXA 2ZNZA 1LUJB 1Z7LA 1X1DA 1QA6A 1KZHA 1BR4A 2R5YB 3HPGA 3L2UA 1P4AA 3X2QH 1VFCA 3GW2A 1SFOJ 2HKOA 3EUKL 1YRNB 1GV2A 1X3UA 2Y75A 1G3YA 1LJ9A 1SFEA 2DT6A 3DF8A 1R49A 3HRUA 2ELHA 1HKTA 3BJ6A 2M0MA 3EUHA 2UUZA 5EZHA 2EV5A 1PP8F 5ILUA 1X2MA 5HDGA 3EYYA 1G3SA 2QLZA 2Y0SN 5DDGA 1MNMC 2LKPA 4HA8A 4LK1F 4KDPA 3H35A 2P5VA 2V26A 3F6OA 3AG4H 3LA3A 5K7HA 2YX4A 4EEFG 1YHQI 4ESFA 1K6OA 1T6SA 3GTPJ 3CUQB 2FF4A 3C1DA 2XGDA 5L3CA 3K10A 1W0TA 2ZB9A 2VN2A 2ME6A 3DBLB 2O6GE 2MA3A 4NC6A 4WCGA 2XKPA 3CCMI 2IP2A 4W97A 2P81A 3BQZA 3I4MJ 2JA6J 3R61A 1IO2A 3GYHX 1TT0A 2FSWA 5E79C 5ILSA 5LLQA 2H6CA 2QF7A 3H3VK 4YEJA 4XKBA 2BHZA 1D8JA 2LFBA 4G8XA 3WTXC 1BBYA 3F72A 2ESHA 4H0EA 2F5EA 2ZCWA 3K4MA 5LHIA 2UWMA 2E60A 3RPUD 4AWXB 3JAMZ 2AXLA 5DYMA 2LY2A 1J75A 1VNDA 2K02A 1MIJA 2I5UA 2CUZA 3IV5A 3S1MJ 1R9TJ 3BOQA 2MFZA 4E7SA 4RGSA 1UHWA 3HOYJ 1DUXC 2PFBA 2MLGA 2HTSA 3OMYA 2WY8Q 1LB2A 1USSA 4GFBA 4DOZA 1TQIA 2X51A 3HDDA 4YFXF 4HNUA 1RC9A 2BVLA 3ZCOA 3TL4X 2Z3YA 3K9TA 5IOZA 5KAFC 3WTTC 2JA5J 1GUUA 1T2KA 1D0YA 1ETXA 1TW3A 5FLXZ 1CQTA 3DEEA 4MTEA 2M3AA 3S2HJ 1MSFC 1H8AC 1RUNA 4O3MA 2HPIA 5LHHA 3FZVA 3DU6A 3HEFA 2F5FA 1ZRCA 1WH5A 2EIJH 1BOAA 1JI8A 4BHPA 1ULYA 1O4XA 1I3QJ 2DPUA 2KQRA 4L5EA 2M2EA
chains in the Genus database with same CATH topology
4CZZA 4G6QA 3J80K 5JI6A 1USTA 1UFMA 4CGZA 2OZ6A 2OQRA 5CLSA 3C18A 2MH2A 1IXSB 3FF5A 1PP7U 2HOEA 2EJRA 4KNYA 1RIOH 2ZO4A 2ZXJA 2P7VB 4A0YA 2G7UA 5LEKA 1QNTA 4GGGA 3KLNA 5D4RA 4Y15A 2V79A 5BOXA 3BPXA 4KA4A 4BAYA 5D6EA 3COAC 1BC8C 1FZPB 3BWGA 3ZPLA 2QQ9A 4RB1A 3B02A 2FBIA 5HOOA 3FXUA 3WGHA 3LQRA 2DFIA 4JBAA 4KN4X 3FXRA 1I6XA 4I02A 1XCVA 2O03A 1MD0A 5E18F 5DCMB 5EEGA 4LB6B 2MD5A 2VOPA 3ZMZA 1F5TA 1LVAA 2VONA 3RTRA 2J5PA 1YLFA 2K4JA 2TDXA 3I58A 5HLHA 3CO7C 1YYVA 2DK8A 2XGXA 2RKHA 2QVOA 4ETSA 1J9IA 1VTNC 3E5QA 1PDNC 2A6EF 3SHFA 2HTJA 1HKSA 3KP2A 4OIOF 3NRVA 2Q8KA 3IC7A 3GZ6A 4L5IA 3GVAA 2PBIA 4RAYA 2ISYA 3ABUA 3RJPA 1I1SA 1STZA 2O61A 3SZPA 4RB2C 4B8XA 4KMFA 4U0VA 3IL2A 2VC0A 4GYIA 1BI0A 3WU1B 2ESNA 4HF1A 1LEBA 3WTVC 3F8CA 1MDMA 3HSFA 4KFCA 2PEXA 5AONA 3VB2A 1KQ0A 5LGTA 2IA1A 3U2RA 2WV0A 2Y0MA 2V9VA 3GXOA 3H92A 2RGVA 2VT2A 1FT9A 5HVQC 3M8FA 4U0WA 5HS8A 3LAJA 2Z99A 4AD9A 4OU0A 2JRTA 3TDZC 4WXCA 4DQ2A 2HDCA 4QWQA 1YQAA 1FSEA 4LD5A 4EGZA 5EEHA 5E20A 3IKTA 5BPDA 4M9XA 4CDGA 1W5SA 4XRFA 2NS0A 2CFXA 1WWXA 1ZAOA 3HTSB 3GEZA 2IW5A 2YSRA 2A07F 2WTEA 4EQQA 3TO6A 4RGXA 1FYMA 3HRSA 4OIPF 1IXCA 4ENKA 1OR7A 3DFGA 2IRFG 1LQ1A 4HQEA 3SXYA 3V7CA 2XV4S 4Y13A 3G73A 1OPCA 1J2XA 1FP1D 3DKWA 3C7JA 4CHUA 3MEXA 4ZZDA 1C0WA 1NHAA 2L3DA 5L3EA 1XGMA 2JSCA 5DCFA 5KK1A 1KGSA 4ESJA 3HTUA 3HHHA 4KICA 5HS7A 4G7ZF 1AOYA 4O5VA 1QZYA 2GIVA 2EWNA 1BC7C 1FC3A 2QWWA 2EK5A 3REOA 3CDHA 3G3ZA 4LK0F 2WWYA 2EA2A 1T98A 5JVTA 1ZARA 5CVRA 1T0FA 4B09A 3F22A 1S6LA 3LFKA 5LBQA 2ADUA 4RB3C 2D2WA 1XDSA 5JR3A 1SD4A 4M6YA 2MC3A 2YR2A 3DV8A 2EFQA 3QP5A 1XGSA 2ZJ2A 1W7PD 1GHCA 2CQKA 4P5OA 4KIBA 4I01A 4BYYA 3T8RA 3FM5A 2GZWA 1Q1HA 1ODDA 2CO5A 4EGYA 3OV8A 4HX4A 1F1ZA 1O7FA 4IPAA 2K7LA 4XSZF 1J7KA 4YFKF 4IRGA 1U6GA 1YW7A 4BHBA 3E3VA 2A69F 4AIHA 2A5YB 3CUQA 1HXDA 4M9SA 1XDUA 4OOIA 4JK1X 4HAMA 2PJPA 4I09A 1H9GA 2XKOA 2FQ3A 2HYFA 3FWEA 5E1WA 3TOAA 3TO7A 3EQLF 5J8FA 3K1MA 1V4RA 4M73A 4HYEA 4I2OA 1ZRFA 2ZMEB 2VBZA 4M72A 4QLCU 4XLNF 1QQIA 2EFWA 2KJBA 5L3DA 3HIFA 4CXFA 4UNOA 2XUBA 1O3TA 1SD6A 3F8FA 2D45A 1BIAA 4LFUA 2GWRA 3MZYA 2FNPA 3SZTA 4Q47A 4KIFA 3ZMUA 2NNNA 4LJZF 3K0LA 2W84A 3HRMA 1QGPA 4A5NA 2P7CB 4L9JA 1XSVA 1HSTA 4ZYEA 2KIUA 2CW0F 1LDDA 4ON0A 2W24A 2QUFA 3ZQ7A 3EYIA 4A2UA 4EMSA 3LQQA 3F23A 4IVNA 1P2FA 2GA1A 4HLXA 3E97A 3WU0A 4NQWA 3QP6A 3R60A 1SFXA 2DAOA 1FP2A 1HW1A 2IA2A 5CVVA 3DPLC 2K86A 5L3FA 2BV6A 5FFZA 2DO7A 4EV0A 4N9HA 2E1CA 2JZYA 5E8IA 1ZLKA 2GAUA 2NNYA 1CF7A 1KYWA 2P5LC 1T38A 4MHGA 3DXJF 2G9WA 3OOPA 1ZYRF 2BE5F 2H94A 4L0ZB 5H6RA 4LG0B 2F5CA 1WKMA 4ENMA 2FRHA 4HF0A 3KZYA 3U9GA 4OIRF 2H09A 4WXDA 1HSJA 4ZYHA 3V7SA 2LNBA 1IN8A 1KU3A 2M30A 2ETHA 1IZ1A 3HUGA 3BY6A 1ZRDA 1KU9A 3GUDA 2ACJA 4L5JA 4G9YA 3J7AO 2R3SA 3M8EA 2FEZA 5D6FA 1J5YA 1LNWA 3GFLA 1MJAA 1W7PB 3RIRA 4U7BA 1BM9A 1OYWA 2PG4A 5IT9Z 1FSHA 4BH9A 3O3KA 3RPUA 4KT5C 3P9IA 1SD7A 1QBJA 5LGUA 1XGNA 2GQQA 1IXRC 2RN7A 2DW4A 5A2QK 1S8NA 2VT3A 1KYZA 2EFPA 2ISZA 1S3JA 3KEQA 4A0XA 3CLOA 3GF2A 5DV5A 2CGPA 3MZHA 1HBXG 3SQNA 3F8NA 3RDIA 3RKYA 5BMZA 1YIOA 5E8GA 5ILVA 2L01A 1XD7A 2FOKA 1ON2A 3WE2A 2PN6A 1U8RA 3PQJA 4N9IA 3KCCA 4L9NA 1TW2A 1MJ9A 3KP5A 3TGNA 3I4PA 2EB7A 2P8TA 1XN7A 2DBBA 3WTSC 1IUYA 1OKRA 5LHGA 3WTZA 1U78A 3CUQC 1IN7A 4KN7X 3HOSA 3L09A 5HDKA 4ZZLA 4WK8F 2V1DA 3GZ5A 1R36A 5ICCA 2KIFA 2JPBA 4RB0A 1DP7P 3F8MA 4BNCA 1L3LA 1R1UA 4ASNA 5ICEA 4HF2A 1FLIA 4UV8A 3KFWX 1Z9CA 1TNTA 4GCVA 1K78A 2W57A 2RQPA 4G6DA 2FE3A 2W25A 4ENJA 5DUKA 4L18B 2XAHA 2Z5UA 3I59A 2EV0A 4FX0A 3DEUA 2OAZA 3K1NA 3L9FA 1UCRA 4HX7A 4MNUA 3HOTA 4DNCA 1Z7UA 2VOOA 2J5OA 1SAXA 2XAQA 4RAZA 4UXNA 1EV7A 1P92A 2COMA 2VXZA 1ZG3A 2XAGA 4S04A 3N97A 2EFNA 3WGGA 4HV6A 2LF8A 3ZMTA 2KRFA 1GXQA 1K7AA 4HW0A 3IHUA 5L3BA 1Z1DA 1B59A 4FHTA 3TDUC 3HSEA 5DD4A 2QENA 5D8LB 3ZP5A 5K5QA 5A2QZ 1BIBA 3ROUA 2O0YA 3E5XA 1Z6RA 2YPRA 2D1HA 5D5XB 2LF7A 3I0TA 4FT8A 3WTUC 3EETA 3H3ZA 3WG9A 2KIMA 3ULQB 1HQCA 1P4XA 3QOPA 2GA2A 2LDUA 3BDDA 3MFKA 3IWFA 1B9MA 1TQMA 1G6NA 4YFNF 4IRHA 1ZREA 5FB2A 3IRRA 4L9VA 3DQVC 3E6MA 4ESBA 4CO8A 2WC2A 2QM3A 4P55A 2ZBKA 5LRSA 3FM3A 5KVRA 3S2WA 3ZMVA 4WX9A 3E5UA 2HS5A 1ZHFA 2EV6A 3TQNA 3L2CA 1IN6A 3WTWC 3TO9A 1REPC 1Z6TA 5E17F 3KP3A 4UVAA 4RS8A 2JTVA 4A0ZA 3ZN0A 5BS6A 3NEUA 3M9AA 4LLGF 3CJNA 3VFZA 2JT1A 1YG2A 2VE8A 3LWFA 1QPMA 2QBYB 3R0AA 1FBUA 2IJLA 2H6BA 4EM2A 1WI9A 2CYYA 2L4MA 1JHHA 2Z9OA 2LSOA 1R1TA 4UV9A 3I54A 2JPCA 2GXGA 4R1HA 1TQPA 2E1NA 1HW5A 1EH6A 1R7JA 1GVJA 4M71A 4XSXF 1R22A 1KU2A 1W7PA 4I0BA 4IRIA 3RYPA 3JTHA 5AIPA 2P6TA 5DD8A 3LA7A 2XHKA 1DDNA 3VOEA 5J8CA 3VEPA 3QU6A 3QAHA 2FMYA 4WXHA 3HRTA 3F21A 2KJCA 4MEYF 1AWCA 2EFOA 5CYVA 3J81Z 1XCBA 3NQOA 1IW7F 4LLLA 2HGCA 3J80Z 2MH9A 3IRQA 1KQ9A 2Y48A 3V8JA 2R7FA 2M45A 1Z05A 3I53A 2OZUA 2ZFWA 1TTYA 1RUOA 1FNNA 3T5XA 4JQFA 4M6XA 4AVPA 4E70A 1I1GA 3IWZA 3DPTA 3P9CA 4ZYDA 2STWA 4LB5A 2XAJA 4EM0B 2G7HA 3CTAA 5FLXK 1SMTA 4MEXF 1OMIA 3ABTA 1XGOA 3FHZA 3FMSA 1MDMB 3V7RA 1ZG5A 4Q48A 3TOBA 2V1XA 3L7WA 2STTA 1K79A 3R6SA 1R5GA 1FX7A 1V3FA 1KQ8A 2K4BA 4EM1A 4O6JA 5CVIA 1FY7A 3N4MA 5BPIA 3C3WA 3K2ZA 4P9UA 2XIGA 4U88A 4EJUA 2F2EA 2XASA 3FX3A 4MTDA 1F9NA 2GXBA 1ONVA 4MQ9F 4R79A 4Q4ZF 3PFIA 2PMHA 1FYLA 4IHTA 1XSDA 1SMYF 3GWZA 1KA8A 2V1UA 1UHMA 3QPTA 4R8HA 2VE9A 4XLPF 1U5TA 3E6DA 4U7DA 1FPQA 5ICGA 5ED4A 4Z2YA 3DP7A 6PAXA 3GFMA 3SFZA 5LGNA 2YU3A 2DI3A 3BJAA 4RGRA 2HR3A 2D1VA 3K1PA 3MQ0A 1BI2A 2CSOA 5HLGA 4FX4A 1MJBA 4PGHA 2RVCA 2VODA 4PCQA 5IT3A 3KE2A 2VBYA 1U5TC 1J59A 1XB4A 1GXPA 4HLYA 3P9KA 1LDJA 1D8KA 4L9TA 5AIQA 3GFIA 4EVIA 3T1BA 1BJAA 2HWVA 1IN4A 3P7NA 2Q0OA 2C6YA 2AS5F 2QYOA 4NHJA 3R4KA 3VODA 4D0PA 1G3TA 1Z91A 2PQ8A 1Y0UA 2DLLA 1H9TA 3L00A 5HS9A 1MGTA 4I0AA 1D3YA 4LG0A 5D5WB 3ML6A 2M8EA 3U1DA 3QPHA 4A5MA 4RGUA 3K69A 3GFJA 2HFHA 5FD6A 3RPQA 1R5HA 4G7HF 4GYGA 5K5OA 5CVJA 1S29A 2BYVE 3RKWA 2W85A 3AAFA 3Q9SA 4BHCA 1ON1A 5TRDA 2XRNA 5ERIA 3BZ6A 2KKOA 1IRFA 3HSRA 3WODF 1MZBA 2O8XA 1F4KA 3V4GA 4UUVA 4IJAA 3GO5A 1R00A 4UVCA 2QQBA 3R0JA 2QBYA 2OU2A 3RI4A 4EJTA 5JFRA 2BEOA 2P4WA 3EDPA 1JHFA 4PGGA 4KYWA 1R1VA 3ELKA 1I5ZA 5H6QA 1ZG1A 1U2WA 2PLYA 5TJJA 1ZLJA 2RDPA 4BQAA 1RI7A 4AIKA 3ZN1A 3E6BA 1XSXA 3BROA 2PI0A 4KIGA 1O3SA 5DCMA 1L0OC 5F1RA 1G3WA 1IAWA 4G94A 1FYKA 2IT0A 4S05A 2DQRA 2XAFA 3MCZA 3KP7A 1W4MA 5CVUA 1O3RA 2NYXA 1O57A 4HV5A 4A6EA 1JGSA 1LEAA 3ERED 2FBKA 1KU7A 1UB9A 2EA4A 2MBFA 4GO1A 3FXQA 3F8BA 1EH7A 2HQNA 5H20A 5K1YA 5J6XA 3I59B 2B0LA 3E6CC 3KLOA 4L0YB 2M5WA 5HLIA 4YIIA 5FGMA 2E7WA 3CUOA 4HDUA 5E1ZB 2NAZA 4CICA 4WF2A 2QZ8A 4LMYA 4UVBA 2YX7A 5F64A 2VC1A 4AIJA 4MQVA 1PUEE 2ZMEA 2BGCA 3WGIA 3LA2A 2CWEA 3FMRA 5FD5A 3WE3A 3JW4A 2HEOA 2VBXA 3LSTA 4OMYA 3FMQA 1TNSA 4ENNA 3BP8A 1DPRA 2V6CA 2XROA 1J0RA 3KZZA 4HOBA 4P96A 1B9NA 1IF1A 1EH8A 1XMAA 4NB5A 2L02A 3JSPA 1XMKA 4OIQF 4EJOA 3JSOA 4OINF 2MLKA 1S7OA 5K5RA 4P9FA 2HYGD 1E17A 2BBYA 4U0YA 1TLHB 1CGPA 1D5VA 1U3EM 3KP4A 4PZJA 2P6SA 1ZGAA 2E7XA 3M1EA 3JTGA 3H3UA 1ZN2A 1FOKA 2A3SA 3I5UA 3ISPA 4XBFA 4KMUX 2OA4A 4PDKA 1RZ4A 1WQ2A 1WSUA 4WWCA 3I64A 4TV7A 2A68F 2L4AA 1ZGJA 2K27A 3HYIA 2NRAC 1S7AA 4A6DA 4GXOA 2DPDA 4YIFA 1FBQA 3F6VA 4Q5SF 1IRGA 2VBWA 2CG4A 3F3XA 1CF7B 3W6JB 1YW8A 3ZMSA 2UXXA 3ECOA 4CYDA 3JAMK 1BN5A 3D5LA 4I98B 2L54A 2ZNYA 4BXUA 3WTYC 1H0MA 3ECHA 2Q2EA 2R7DA 2RC4A 1HKQA 4HX8A 2HZTA 5JHUA 4M74A 1YS7A 1OYIA 2O3FA 3Q5FA 5D5VB 1R23A 3J81K 1A04A 4HDVA 2IVMA 4IHSA 4YG2F 1FWZA 1BI1A 1BI3A 4N0BA 4EJWA 4HQMA 5IT9K 4A12A 2HQRA 1YW9A 3BPVA 2HKXA 1P6RA 3O2PE 1IN5A 3IKVA 1DPUA 3QRFF 4IF4A 5LRRA 3I71A 5CJ9A 3D0SA 2DK5A 3W6KB 1T39A 4LLNA 1LDKB 2IA0A 1E2XA 3V8KA 2OD5A 2H27A 1HW2A 1RNLA 4K2EA 5BQTA 5L3GA 3BJOA 5FFXA 2OQGA 3TKYA 2XVCA 4ZH4F 1YTYA 2A6HF 3GLXA 3PQKA 4KUMA 3HHGA 5ICFA 1O3QA 3CO6C 2RV8A 3KEOA 2DU9A 3B73A 1ZH5A 1K78B 1O7LA 2IPQX 1SFUA 1U5TB 2DTRA 5D4SA 4MGRA 1I27A 3MWMA 3V8LA 1G4DA 4HZFA 5F6FA 4EJVA 2FMLA 2F5DA 4F7ZA 3T8TA 2M1BA 2M87A 3M7GA 2A61A 5LEJA 3KP6A 1QZZA 3O6BB 3QU3A 1JE8A 4ZYGA 3MAJA 1B1BA 1QO0D 5E1XA 3Q9VA 2FXAA 2OBPA 1JXSA 2ZKZA 1OYYA 1SD5A 1WRJA 5D8KB 5DUIA 3RYRA 2DQLA 4OMZA 4IXAA 2QQAA 2RNJA 3GX4X 2FU4A 2P5KA 1P4WA 1YS6A 2DT5A 1B4AA 2Z33A 4UHTA 1W5TA 4I7HA 3KETA 1FBSA 5D5UB 2UZKA 2FA5A 4M9ZA 3T0YA 1MKMA 4HBLA 2X4HA 2PMUA 3RKXA 2UXNA 4LGWA 3ZMDA 2FBHA 4G7OF 5FO5A 1R58A 1YFHA 2FNAA 2X0LA 4Y17A 5DEQA 1YO5C 3LAPA 5HDNA 1TBXA 2ZNZA 1P4AA 3GW2A 2HKOA 1X3UA 2Y75A 1G3YA 1LJ9A 1SFEA 3DF8A 3HRUA 2ELHA 1HKTA 3BJ6A 3EUHA 2EV5A 1PP8F 5ILUA 5HDGA 3EYYA 1G3SA 2QLZA 5DDGA 2LKPA 4HA8A 4LK1F 4KDPA 2P5VA 3F6OA 3LA3A 2YX4A 4ESFA 1K6OA 1T6SA 3CUQB 2FF4A 3C1DA 5L3CA 2VN2A 2O6GE 2MA3A 4WCGA 2XKPA 2IP2A 3R61A 3GYHX 2FSWA 5ILSA 5LLQA 2H6CA 1D8JA 4G8XA 3WTXC 1BBYA 2ESHA 3F72A 4H0EA 2F5EA 2ZCWA 5LHIA 2UWMA 4AWXB 3JAMZ 2AXLA 5DYMA 1J75A 2K02A 3BOQA 4RGSA 1UHWA 1DUXC 2PFBA 2MLGA 2HTSA 1LB2A 1USSA 1TQIA 4YFXF 2Z3YA 3K9TA 3WTTC 1T2KA 1TW3A 5FLXZ 4MTEA 1RUNA 4O3MA 5LHHA 3FZVA 2F5FA 1ZRCA 1BOAA 4BHPA 1ULYA 2DPUA 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZZ A;  4G6Q A;  3J80 K;  5JI6 A;  1UST A;  1UFM A;  4CGZ A;  2OZ6 A;  2OQR A;  5CLS A;  3C18 A;  2MH2 A;  1IXS B;  3FF5 A;  1PP7 U;  2HOE A;  2EJR A;  4KNY A;  1RIO H;  2ZO4 A;  2ZXJ A;  2P7V B;  4A0Y A;  2G7U A;  5LEK A;  1QNT A;  4GGG A;  3KLN A;  5D4R A;  4Y15 A;  2V79 A;  5BOX A;  3BPX A;  4KA4 A;  4BAY A;  5D6E A;  3COA C;  1BC8 C;  1FZP B;  3BWG A;  3ZPL A;  2QQ9 A;  4RB1 A;  3B02 A;  2FBI A;  5HOO A;  3FXU A;  3WGH A;  3LQR A;  2DFI A;  4JBA A;  4KN4 X;  3FXR A;  1I6X A;  4I02 A;  1XCV A;  2O03 A;  1MD0 A;  5E18 F;  5DCM B;  5EEG A;  4LB6 B;  2MD5 A;  2VOP A;  3ZMZ A;  1F5T A;  1LVA A;  2VON A;  3RTR A;  2J5P A;  1YLF A;  2K4J A;  2TDX A;  3I58 A;  5HLH A;  3CO7 C;  1YYV A;  2DK8 A;  2XGX A;  2RKH A;  2QVO A;  4ETS A;  1J9I A;  1VTN C;  3E5Q A;  1PDN C;  2A6E F;  3SHF A;  2HTJ A;  1HKS A;  3KP2 A;  4OIO F;  3NRV A;  2Q8K A;  3IC7 A;  3GZ6 A;  4L5I A;  3GVA A;  2PBI A;  4RAY A;  2ISY A;  3ABU A;  3RJP A;  1I1S A;  1STZ A;  2O61 A;  3SZP A;  4RB2 C;  4B8X A;  4KMF A;  4U0V A;  3IL2 A;  2VC0 A;  4GYI A;  1BI0 A;  3WU1 B;  2ESN A;  4HF1 A;  1LEB A;  3WTV C;  3F8C A;  1MDM A;  3HSF A;  4KFC A;  2PEX A;  5AON A;  3VB2 A;  1KQ0 A;  5LGT A;  2IA1 A;  3U2R A;  2WV0 A;  2Y0M A;  2V9V A;  3GXO A;  3H92 A;  2RGV A;  2VT2 A;  1FT9 A;  5HVQ C;  3M8F A;  4U0W A;  5HS8 A;  3LAJ A;  2Z99 A;  4AD9 A;  4OU0 A;  2JRT A;  3TDZ C;  4WXC A;  4DQ2 A;  2HDC A;  4QWQ A;  1YQA A;  1FSE A;  4LD5 A;  4EGZ A;  5EEH A;  5E20 A;  3IKT A;  5BPD A;  4M9X A;  4CDG A;  1W5S A;  4XRF A;  2NS0 A;  2CFX A;  1WWX A;  1ZAO A;  3HTS B;  3GEZ A;  2IW5 A;  2YSR A;  2A07 F;  2WTE A;  4EQQ A;  3TO6 A;  4RGX A;  1FYM A;  3HRS A;  4OIP F;  1IXC A;  4ENK A;  1OR7 A;  3DFG A;  2IRF G;  1LQ1 A;  4HQE A;  3SXY A;  3V7C A;  2XV4 S;  4Y13 A;  3G73 A;  1OPC A;  1J2X A;  1FP1 D;  3DKW A;  3C7J A;  4CHU A;  3MEX A;  4ZZD A;  1C0W A;  1NHA A;  2L3D A;  5L3E A;  1XGM A;  2JSC A;  5DCF A;  5KK1 A;  1KGS A;  4ESJ A;  3HTU A;  3HHH A;  4KIC A;  5HS7 A;  4G7Z F;  1AOY A;  4O5V A;  1QZY A;  2GIV A;  2EWN A;  1BC7 C;  1FC3 A;  2QWW A;  2EK5 A;  3REO A;  3CDH A;  3G3Z A;  4LK0 F;  2WWY A;  2EA2 A;  1T98 A;  5JVT A;  1ZAR A;  5CVR A;  1T0F A;  4B09 A;  3F22 A;  1S6L A;  3LFK A;  5LBQ A;  2ADU A;  4RB3 C;  2D2W A;  1XDS A;  5JR3 A;  1SD4 A;  4M6Y A;  2MC3 A;  2YR2 A;  3DV8 A;  2EFQ A;  3QP5 A;  1XGS A;  2ZJ2 A;  1W7P D;  1GHC A;  2CQK A;  4P5O A;  4KIB A;  4I01 A;  4BYY A;  3T8R A;  3FM5 A;  2GZW A;  1Q1H A;  1ODD A;  2CO5 A;  4EGY A;  3OV8 A;  4HX4 A;  1F1Z A;  1O7F A;  4IPA A;  2K7L A;  4XSZ F;  1J7K A;  4YFK F;  4IRG A;  1U6G A;  1YW7 A;  4BHB A;  3E3V A;  2A69 F;  4AIH A;  2A5Y B;  3CUQ A;  1HXD A;  4M9S A;  1XDU A;  4OOI A;  4JK1 X;  4HAM A;  2PJP A;  4I09 A;  1H9G A;  2XKO A;  2FQ3 A;  2HYF A;  3FWE A;  5E1W A;  3TOA A;  3TO7 A;  3EQL F;  5J8F A;  3K1M A;  1V4R A;  4M73 A;  4HYE A;  4I2O A;  1ZRF A;  2ZME B;  2VBZ A;  4M72 A;  4QLC U;  4XLN F;  1QQI A;  2EFW A;  2KJB A;  5L3D A;  3HIF A;  4CXF A;  4UNO A;  2XUB A;  1O3T A;  1SD6 A;  3F8F A;  2D45 A;  1BIA A;  4LFU A;  2GWR A;  3MZY A;  2FNP A;  3SZT A;  4Q47 A;  4KIF A;  3ZMU A;  2NNN A;  4LJZ F;  3K0L A;  2W84 A;  3HRM A;  1QGP A;  4A5N A;  2P7C B;  4L9J A;  1XSV A;  1HST A;  4ZYE A;  2KIU A;  2CW0 F;  1LDD A;  4ON0 A;  2W24 A;  2QUF A;  3ZQ7 A;  3EYI A;  4A2U A;  4EMS A;  3LQQ A;  3F23 A;  4IVN A;  1P2F A;  2GA1 A;  4HLX A;  3E97 A;  3WU0 A;  4NQW A;  3QP6 A;  3R60 A;  1SFX A;  2DAO A;  1FP2 A;  1HW1 A;  2IA2 A;  5CVV A;  3DPL C;  2K86 A;  5L3F A;  2BV6 A;  5FFZ A;  2DO7 A;  4EV0 A;  4N9H A;  2E1C A;  2JZY A;  5E8I A;  1ZLK A;  2GAU A;  2NNY A;  1CF7 A;  1KYW A;  2P5L C;  1T38 A;  4MHG A;  3DXJ F;  2G9W A;  3OOP A;  1ZYR F;  2BE5 F;  2H94 A;  4L0Z B;  5H6R A;  4LG0 B;  2F5C A;  1WKM A;  4ENM A;  2FRH A;  4HF0 A;  3KZY A;  3U9G A;  4OIR F;  2H09 A;  4WXD A;  1HSJ A;  4ZYH A;  3V7S A;  2LNB A;  1IN8 A;  1KU3 A;  2M30 A;  2ETH A;  1IZ1 A;  3HUG A;  3BY6 A;  1ZRD A;  1KU9 A;  3GUD A;  2ACJ A;  4L5J A;  4G9Y A;  3J7A O;  2R3S A;  3M8E A;  2FEZ A;  5D6F A;  1J5Y A;  1LNW A;  3GFL A;  1MJA A;  1W7P B;  3RIR A;  4U7B A;  1BM9 A;  1OYW A;  2PG4 A;  5IT9 Z;  1FSH A;  4BH9 A;  3O3K A;  3RPU A;  4KT5 C;  3P9I A;  1SD7 A;  1QBJ A;  5LGU A;  1XGN A;  2GQQ A;  1IXR C;  2RN7 A;  2DW4 A;  5A2Q K;  1S8N A;  2VT3 A;  1KYZ A;  2EFP A;  2ISZ A;  1S3J A;  3KEQ A;  4A0X A;  3CLO A;  3GF2 A;  5DV5 A;  2CGP A;  3MZH A;  1HBX G;  3SQN A;  3F8N A;  3RDI A;  3RKY A;  5BMZ A;  1YIO A;  5E8G A;  5ILV A;  2L01 A;  1XD7 A;  2FOK A;  1ON2 A;  3WE2 A;  2PN6 A;  1U8R A;  3PQJ A;  4N9I A;  3KCC A;  4L9N A;  1TW2 A;  1MJ9 A;  3KP5 A;  3TGN A;  3I4P A;  2EB7 A;  2P8T A;  1XN7 A;  2DBB A;  3WTS C;  1IUY A;  1OKR A;  5LHG A;  3WTZ A;  1U78 A;  3CUQ C;  1IN7 A;  4KN7 X;  3HOS A;  3L09 A;  5HDK A;  4ZZL A;  4WK8 F;  2V1D A;  3GZ5 A;  1R36 A;  5ICC A;  2KIF A;  2JPB A;  4RB0 A;  1DP7 P;  3F8M A;  4BNC A;  1L3L A;  1R1U A;  4ASN A;  5ICE A;  4HF2 A;  1FLI A;  4UV8 A;  3KFW X;  1Z9C A;  1TNT A;  4GCV A;  1K78 A;  2W57 A;  2RQP A;  4G6D A;  2FE3 A;  2W25 A;  4ENJ A;  5DUK A;  4L18 B;  2XAH A;  2Z5U A;  3I59 A;  2EV0 A;  4FX0 A;  3DEU A;  2OAZ A;  3K1N A;  3L9F A;  1UCR A;  4HX7 A;  4MNU A;  3HOT A;  4DNC A;  1Z7U A;  2VOO A;  2J5O A;  1SAX A;  2XAQ A;  4RAZ A;  4UXN A;  1EV7 A;  1P92 A;  2COM A;  2VXZ A;  1ZG3 A;  2XAG A;  4S04 A;  3N97 A;  2EFN A;  3WGG A;  4HV6 A;  2LF8 A;  3ZMT A;  2KRF A;  1GXQ A;  1K7A A;  4HW0 A;  3IHU A;  5L3B A;  1Z1D A;  1B59 A;  4FHT A;  3TDU C;  3HSE A;  5DD4 A;  2QEN A;  5D8L B;  3ZP5 A;  5K5Q A;  5A2Q Z;  1BIB A;  3ROU A;  2O0Y A;  3E5X A;  1Z6R A;  2YPR A;  2D1H A;  5D5X B;  2LF7 A;  3I0T A;  4FT8 A;  3WTU C;  3EET A;  3H3Z A;  3WG9 A;  2KIM A;  3ULQ B;  1HQC A;  1P4X A;  3QOP A;  2GA2 A;  2LDU A;  3BDD A;  3MFK A;  3IWF A;  1B9M A;  1TQM A;  1G6N A;  4YFN F;  4IRH A;  1ZRE A;  5FB2 A;  3IRR A;  4L9V A;  3DQV C;  3E6M A;  4ESB A;  4CO8 A;  2WC2 A;  2QM3 A;  4P55 A;  2ZBK A;  5LRS A;  3FM3 A;  5KVR A;  3S2W A;  3ZMV A;  4WX9 A;  3E5U A;  2HS5 A;  1ZHF A;  2EV6 A;  3TQN A;  3L2C A;  1IN6 A;  3WTW C;  3TO9 A;  1REP C;  1Z6T A;  5E17 F;  3KP3 A;  4UVA A;  4RS8 A;  2JTV A;  4A0Z A;  3ZN0 A;  5BS6 A;  3NEU A;  3M9A A;  4LLG F;  3CJN A;  3VFZ A;  2JT1 A;  1YG2 A;  2VE8 A;  3LWF A;  1QPM A;  2QBY B;  3R0A A;  1FBU A;  2IJL A;  2H6B A;  4EM2 A;  1WI9 A;  2CYY A;  2L4M A;  1JHH A;  2Z9O A;  2LSO A;  1R1T A;  4UV9 A;  3I54 A;  2JPC A;  2GXG A;  4R1H A;  1TQP A;  2E1N A;  1HW5 A;  1EH6 A;  1R7J A;  1GVJ A;  4M71 A;  4XSX F;  1R22 A;  1KU2 A;  1W7P A;  4I0B A;  4IRI A;  3RYP A;  3JTH A;  5AIP A;  2P6T A;  5DD8 A;  3LA7 A;  2XHK A;  1DDN A;  3VOE A;  5J8C A;  3VEP A;  3QU6 A;  3QAH A;  2FMY A;  4WXH A;  3HRT A;  3F21 A;  2KJC A;  4MEY F;  1AWC A;  2EFO A;  5CYV A;  3J81 Z;  1XCB A;  3NQO A;  1IW7 F;  4LLL A;  2HGC A;  3J80 Z;  2MH9 A;  3IRQ A;  1KQ9 A;  2Y48 A;  3V8J A;  2R7F A;  2M45 A;  1Z05 A;  3I53 A;  2OZU A;  2ZFW A;  1TTY A;  1RUO A;  1FNN A;  3T5X A;  4JQF A;  4M6X A;  4AVP A;  4E70 A;  1I1G A;  3IWZ A;  3DPT A;  3P9C A;  4ZYD A;  2STW A;  4LB5 A;  2XAJ A;  4EM0 B;  2G7H A;  3CTA A;  5FLX K;  1SMT A;  4MEX F;  1OMI A;  3ABT A;  1XGO A;  3FHZ A;  3FMS A;  1MDM B;  3V7R A;  1ZG5 A;  4Q48 A;  3TOB A;  2V1X A;  3L7W A;  2STT A;  1K79 A;  3R6S A;  1R5G A;  1FX7 A;  1V3F A;  1KQ8 A;  2K4B A;  4EM1 A;  4O6J A;  5CVI A;  1FY7 A;  3N4M A;  5BPI A;  3C3W A;  3K2Z A;  4P9U A;  2XIG A;  4U88 A;  4EJU A;  2F2E A;  2XAS A;  3FX3 A;  4MTD A;  1F9N A;  2GXB A;  1ONV A;  4MQ9 F;  4R79 A;  4Q4Z F;  3PFI A;  2PMH A;  1FYL A;  4IHT A;  1XSD A;  1SMY F;  3GWZ A;  1KA8 A;  2V1U A;  1UHM A;  3QPT A;  4R8H A;  2VE9 A;  4XLP F;  1U5T A;  3E6D A;  4U7D A;  1FPQ A;  5ICG A;  5ED4 A;  4Z2Y A;  3DP7 A;  6PAX A;  3GFM A;  3SFZ A;  5LGN A;  2YU3 A;  2DI3 A;  3BJA A;  4RGR A;  2HR3 A;  2D1V A;  3K1P A;  3MQ0 A;  1BI2 A;  2CSO A;  5HLG A;  4FX4 A;  1MJB A;  4PGH A;  2RVC A;  2VOD A;  4PCQ A;  5IT3 A;  3KE2 A;  2VBY A;  1U5T C;  1J59 A;  1XB4 A;  1GXP A;  4HLY A;  3P9K A;  1LDJ A;  1D8K A;  4L9T A;  5AIQ A;  3GFI A;  4EVI A;  3T1B A;  1BJA A;  2HWV A;  1IN4 A;  3P7N A;  2Q0O A;  2C6Y A;  2AS5 F;  2QYO A;  4NHJ A;  3R4K A;  3VOD A;  4D0P A;  1G3T A;  1Z91 A;  2PQ8 A;  1Y0U A;  2DLL A;  1H9T A;  3L00 A;  5HS9 A;  1MGT A;  4I0A A;  1D3Y A;  4LG0 A;  5D5W B;  3ML6 A;  2M8E A;  3U1D A;  3QPH A;  4A5M A;  4RGU A;  3K69 A;  3GFJ A;  2HFH A;  5FD6 A;  3RPQ A;  1R5H A;  4G7H F;  4GYG A;  5K5O A;  5CVJ A;  1S29 A;  2BYV E;  3RKW A;  2W85 A;  3AAF A;  3Q9S A;  4BHC A;  1ON1 A;  5TRD A;  2XRN A;  5ERI A;  3BZ6 A;  2KKO A;  1IRF A;  3HSR A;  3WOD F;  1MZB A;  2O8X A;  1F4K A;  3V4G A;  4UUV A;  4IJA A;  3GO5 A;  1R00 A;  4UVC A;  2QQB A;  3R0J A;  2QBY A;  2OU2 A;  3RI4 A;  4EJT A;  5JFR A;  2BEO A;  2P4W A;  3EDP A;  1JHF A;  4PGG A;  4KYW A;  1R1V A;  3ELK A;  1I5Z A;  5H6Q A;  1ZG1 A;  1U2W A;  2PLY A;  5TJJ A;  1ZLJ A;  2RDP A;  4BQA A;  1RI7 A;  4AIK A;  3ZN1 A;  3E6B A;  1XSX A;  3BRO A;  2PI0 A;  4KIG A;  1O3S A;  5DCM A;  1L0O C;  5F1R A;  1G3W A;  1IAW A;  4G94 A;  1FYK A;  2IT0 A;  4S05 A;  2DQR A;  2XAF A;  3MCZ A;  3KP7 A;  1W4M A;  5CVU A;  1O3R A;  2NYX A;  1O57 A;  4HV5 A;  4A6E A;  1JGS A;  1LEA A;  3ERE D;  2FBK A;  1KU7 A;  1UB9 A;  2EA4 A;  2MBF A;  4GO1 A;  3FXQ A;  3F8B A;  1EH7 A;  2HQN A;  5H20 A;  5K1Y A;  5J6X A;  3I59 B;  2B0L A;  3E6C C;  3KLO A;  4L0Y B;  2M5W A;  5HLI A;  4YII A;  5FGM A;  2E7W A;  3CUO A;  4HDU A;  5E1Z B;  2NAZ A;  4CIC A;  4WF2 A;  2QZ8 A;  4LMY A;  4UVB A;  2YX7 A;  5F64 A;  2VC1 A;  4AIJ A;  4MQV A;  1PUE E;  2ZME A;  2BGC A;  3WGI A;  3LA2 A;  2CWE A;  3FMR A;  5FD5 A;  3WE3 A;  3JW4 A;  2HEO A;  2VBX A;  3LST A;  4OMY A;  3FMQ A;  1TNS A;  4ENN A;  3BP8 A;  1DPR A;  2V6C A;  2XRO A;  1J0R A;  3KZZ A;  4HOB A;  4P96 A;  1B9N A;  1IF1 A;  1EH8 A;  1XMA A;  4NB5 A;  2L02 A;  3JSP A;  1XMK A;  4OIQ F;  4EJO A;  3JSO A;  4OIN F;  2MLK A;  1S7O A;  5K5R A;  4P9F A;  2HYG D;  1E17 A;  2BBY A;  4U0Y A;  1TLH B;  1CGP A;  1D5V A;  1U3E M;  3KP4 A;  4PZJ A;  2P6S A;  1ZGA A;  2E7X A;  3M1E A;  3JTG A;  3H3U A;  1ZN2 A;  1FOK A;  2A3S A;  3I5U A;  3ISP A;  4XBF A;  4KMU X;  2OA4 A;  4PDK A;  1RZ4 A;  1WQ2 A;  1WSU A;  4WWC A;  3I64 A;  4TV7 A;  2A68 F;  2L4A A;  1ZGJ A;  2K27 A;  3HYI A;  2NRA C;  1S7A A;  4A6D A;  4GXO A;  2DPD A;  4YIF A;  1FBQ A;  3F6V A;  4Q5S F;  1IRG A;  2VBW A;  2CG4 A;  3F3X A;  1CF7 B;  3W6J B;  1YW8 A;  3ZMS A;  2UXX A;  3ECO A;  4CYD A;  3JAM K;  1BN5 A;  3D5L A;  4I98 B;  2L54 A;  2ZNY A;  4BXU A;  3WTY C;  1H0M A;  3ECH A;  2Q2E A;  2R7D A;  2RC4 A;  1HKQ A;  4HX8 A;  2HZT A;  5JHU A;  4M74 A;  1YS7 A;  1OYI A;  2O3F A;  3Q5F A;  5D5V B;  1R23 A;  3J81 K;  1A04 A;  4HDV A;  2IVM A;  4IHS A;  4YG2 F;  1FWZ A;  1BI1 A;  1BI3 A;  4N0B A;  4EJW A;  4HQM A;  5IT9 K;  4A12 A;  2HQR A;  1YW9 A;  3BPV A;  2HKX A;  1P6R A;  3O2P E;  1IN5 A;  3IKV A;  1DPU A;  3QRF F;  4IF4 A;  5LRR A;  3I71 A;  5CJ9 A;  3D0S A;  2DK5 A;  3W6K B;  1T39 A;  4LLN A;  1LDK B;  2IA0 A;  1E2X A;  3V8K A;  2OD5 A;  2H27 A;  1HW2 A;  1RNL A;  4K2E A;  5BQT A;  5L3G A;  3BJO A;  5FFX A;  2OQG A;  3TKY A;  2XVC A;  4ZH4 F;  1YTY A;  2A6H F;  3GLX A;  3PQK A;  4KUM A;  3HHG A;  5ICF A;  1O3Q A;  3CO6 C;  2RV8 A;  3KEO A;  2DU9 A;  3B73 A;  1ZH5 A;  1K78 B;  1O7L A;  2IPQ X;  1SFU A;  1U5T B;  2DTR A;  5D4S A;  4MGR A;  1I27 A;  3MWM A;  3V8L A;  1G4D A;  4HZF A;  5F6F A;  4EJV A;  2FML A;  2F5D A;  4F7Z A;  3T8T A;  2M1B A;  2M87 A;  3M7G A;  2A61 A;  5LEJ A;  3KP6 A;  1QZZ A;  3O6B B;  3QU3 A;  1JE8 A;  4ZYG A;  3MAJ A;  1B1B A;  1QO0 D;  5E1X A;  3Q9V A;  2FXA A;  2OBP A;  1JXS A;  2ZKZ A;  1OYY A;  1SD5 A;  1WRJ A;  5D8K B;  5DUI A;  3RYR A;  2DQL A;  4OMZ A;  4IXA A;  2QQA A;  2RNJ A;  3GX4 X;  2FU4 A;  2P5K A;  1P4W A;  1YS6 A;  2DT5 A;  1B4A A;  2Z33 A;  4UHT A;  1W5T A;  4I7H A;  3KET A;  1FBS A;  5D5U B;  2UZK A;  2FA5 A;  4M9Z A;  3T0Y A;  1MKM A;  4HBL A;  2X4H A;  2PMU A;  3RKX A;  2UXN A;  4LGW A;  3ZMD A;  2FBH A;  4G7O F;  5FO5 A;  1R58 A;  1YFH A;  2FNA A;  2X0L A;  4Y17 A;  5DEQ A;  1YO5 C;  3LAP A;  5HDN A;  1TBX A;  2ZNZ A;  1P4A A;  3GW2 A;  2HKO A;  1X3U A;  2Y75 A;  1G3Y A;  1LJ9 A;  1SFE A;  3DF8 A;  3HRU A;  2ELH A;  1HKT A;  3BJ6 A;  3EUH A;  2EV5 A;  1PP8 F;  5ILU A;  5HDG A;  3EYY A;  1G3S A;  2QLZ A;  5DDG A;  2LKP A;  4HA8 A;  4LK1 F;  4KDP A;  2P5V A;  3F6O A;  3LA3 A;  2YX4 A;  4ESF A;  1K6O A;  1T6S A;  3CUQ B;  2FF4 A;  3C1D A;  5L3C A;  2VN2 A;  2O6G E;  2MA3 A;  4WCG A;  2XKP A;  2IP2 A;  3R61 A;  3GYH X;  2FSW A;  5ILS A;  5LLQ A;  2H6C A;  1D8J A;  4G8X A;  3WTX C;  1BBY A;  2ESH A;  3F72 A;  4H0E A;  2F5E A;  2ZCW A;  5LHI A;  2UWM A;  4AWX B;  3JAM Z;  2AXL A;  5DYM A;  1J75 A;  2K02 A;  3BOQ A;  4RGS A;  1UHW A;  1DUX C;  2PFB A;  2MLG A;  2HTS A;  1LB2 A;  1USS A;  1TQI A;  4YFX F;  2Z3Y A;  3K9T A;  3WTT C;  1T2K A;  1TW3 A;  5FLX Z;  4MTE A;  1RUN A;  4O3M A;  5LHH A;  3FZV A;  2F5F A;  1ZRC A;  1BOA A;  4BHP A;  1ULY A;  2DPU A;  1B6A A; 
#chains in the Genus database with same CATH topology
 4CZZ A;  4G6Q A;  4HNT A;  3J80 K;  4BEH A;  5JI6 A;  3SYT A;  5J1R A;  1UST A;  4ZC3 A;  3K7A J;  1UFM A;  4J00 A;  4CGZ A;  1ZEL A;  3AG1 H;  2OZ6 A;  2OQR A;  5CLS A;  2VQC A;  3C18 A;  2MH2 A;  3S2D J;  1IXS B;  3ONQ A;  3FF5 A;  1PP7 U;  1ZQ3 P;  2HOE A;  5CQE A;  2EJR A;  3ZQI A;  4KNY A;  1RIO H;  2ZO4 A;  1BW5 A;  2ZXJ A;  1X19 A;  1Y56 A;  2P7V B;  4JP0 A;  4A0Y A;  4BE2 A;  1ETY A;  2G7U A;  2E5Z A;  5LEK A;  1QNT A;  4GGG A;  3KLN A;  3BG7 A;  2K40 A;  5D4R A;  2QKL B;  3ABM H;  5FKO A;  4Y15 A;  2V79 A;  5BOX A;  2DA5 A;  3BPX A;  3OIO A;  4KA4 A;  3G1O A;  4BAY A;  1EF4 A;  5D6E A;  3S93 A;  3JRF A;  2JA8 J;  3S3M A;  2IS2 A;  2VKE A;  3COA C;  2ZSH B;  1BC8 C;  1FZP B;  3BWG A;  5KNL A;  3ZPL A;  2QQ9 A;  4RB1 A;  5FRN A;  5FKL A;  3B02 A;  4A3G J;  2IAI A;  2FBI A;  5HOO A;  3FXU A;  2NXN B;  3WGH A;  3HL2 A;  2CQQ A;  3LQR A;  2DFI A;  4XR6 A;  3AG2 H;  4JBA A;  4KN4 X;  3FXR A;  1I6X A;  4I02 A;  1XCV A;  2YS9 A;  2O03 A;  1MD0 A;  5E18 F;  2ZXH A;  4X6A J;  1OCZ H;  1FMV A;  3Q3S A;  4F91 B;  5DCM B;  3A01 A;  5GPA A;  1OCR H;  5EEG A;  4LB6 B;  2I8D A;  2M34 A;  3ASO H;  2EQR A;  2MD5 A;  2N8G A;  2VOP A;  3ZMZ A;  1F5T A;  1OLT A;  1LVA A;  2Z1D A;  1MSE C;  2VON A;  3RTR A;  2IBD A;  1W1W E;  3CP2 A;  4D5F A;  2J5P A;  1YLF A;  2K4J A;  2TDX A;  2Y0S A;  3I58 A;  1B72 B;  5HLH A;  1Y1W J;  3CO7 C;  1YYV A;  2DK8 A;  2XGX A;  2RKH A;  1VF9 A;  1MH4 A;  2QVO A;  4ETS A;  1J9I A;  1VTN C;  3E5Q A;  1PDN C;  2A6E F;  3SHF A;  2EIN H;  2HTJ A;  1HKS A;  3KP2 A;  4OIO F;  3NRV A;  1V54 H;  1WVR A;  2Q8K A;  3IC7 A;  1VQP I;  3GZ6 A;  2K85 A;  4L5I A;  1VZ0 A;  3GVA A;  4OAY A;  4AID A;  4Z6Y A;  1MBF A;  5H2F C;  2JSP A;  1WJE A;  2PBI A;  2L7K A;  1S9H A;  2JJ7 A;  4RAY A;  2ISY A;  2R5Z A;  3ABU A;  1ETK A;  2EZH A;  3VYU B;  5JVG F;  3OL3 A;  3RJP A;  1I1S A;  3FIS A;  3C2G A;  2DA6 A;  1P7J A;  4X1E A;  5M3M J;  1Y1V J;  1STZ A;  2O61 A;  3K70 D;  3SZP A;  2MW8 A;  3IH2 A;  4HSR A;  5JHF A;  4RB2 C;  3CJQ B;  4B8X A;  4KMF A;  4HPQ A;  4U0V A;  4I99 C;  3IL2 A;  3M3Y J;  2IS6 A;  4KIT B;  2VC0 A;  1MMS A;  4E7H A;  3DTE A;  4GYI A;  1BI0 A;  3WU1 B;  4YRV A;  2ESN A;  4HF1 A;  1LEB A;  3WTV C;  3OS2 A;  1LFP A;  1WJD A;  1N25 A;  3F8C A;  1AHD P;  1MDM A;  3HSF A;  4KFC A;  2PEX A;  3K4L A;  2TRT A;  3EUA A;  5AON A;  3WHC A;  1SVO A;  1KQ0 A;  3VB2 A;  5LGT A;  1D1C A;  2IA1 A;  3UNG C;  4RM3 A;  3U2R A;  2WV0 A;  2Y0M A;  2R0Q C;  5E3O A;  1EA3 A;  1RKW A;  4D7M A;  2ECB A;  4QTR A;  2V9V A;  2W4S A;  3GXO A;  3H92 A;  2G0E A;  3MMY B;  1JUS A;  2F6C A;  2RGV A;  3OOU A;  2KZG A;  2VT2 A;  1FT9 A;  2H8W A;  2V7F A;  2GIZ A;  5HVQ C;  4N4O B;  4B48 A;  3CES A;  2Y9Y A;  2KL4 A;  5B5E C;  2P0W A;  3M8F A;  2DDA A;  4U0W A;  3HG9 A;  5HS8 A;  1YX5 A;  3LAJ A;  2Z99 A;  4AD9 A;  4DZJ A;  1RET A;  3LL7 A;  4OU0 A;  2JRT A;  3JRI A;  2V6E A;  3TDZ C;  4WXC A;  1SVM A;  3K4J A;  3LNQ A;  1JGG A;  4UY8 I;  1OR7 C;  4DQ2 A;  4M3E A;  3HXL A;  3FHN A;  2HDC A;  4QWQ A;  1FOY A;  1YQA A;  1FSE A;  4LD5 A;  4J19 A;  4EGZ A;  2L9N A;  5F08 A;  5EEH A;  5E20 A;  3HGG A;  3IKT A;  3K2A A;  5BPD A;  4M9X A;  4D7N A;  4CDG A;  1W5S A;  4XRF A;  1Z3Y A;  2WAQ N;  3LSK A;  2NS0 A;  2CFX A;  4G6T B;  1WWX A;  3FDY A;  2R93 J;  3GLL A;  3S1R J;  1ZAO A;  3HTS B;  3GEZ A;  2IW5 A;  4XM3 A;  4IEJ A;  1APL C;  2BXZ A;  2YSR A;  4ITV A;  1IJW C;  5FJ8 J;  2A07 F;  2WTE A;  4EQQ A;  3IH3 A;  4V2F A;  3TO6 A;  4I6Z A;  4RGX A;  2AHQ A;  1FYM A;  3HRS A;  4OIP F;  4AU7 A;  1IDY A;  1J09 A;  1IXC A;  4ENK A;  1OR7 A;  3DFG A;  2IRF G;  1LQ1 A;  2AXT C;  4RLF A;  4HQE A;  1FOX A;  2HYJ A;  3SXY A;  5DS9 A;  3V7C A;  2XV4 S;  4Y13 A;  3G73 A;  1SC7 A;  3PFY A;  2ICW G;  1OPC A;  1J2X A;  1FP1 D;  3DKW A;  3C7J A;  2BY3 A;  3S32 A;  4CHU A;  3RZO J;  2DTZ A;  3MEX A;  4ZZD A;  3JR9 A;  1AKH B;  1OQY A;  2OJE D;  1C0W A;  1NH3 A;  3NAR A;  3ABL H;  3OYF A;  1NHA A;  3J7A Y;  2L3D A;  3GME A;  1LFU P;  2DA2 A;  1VQM I;  2X48 A;  4V2G A;  4D1Q A;  5L3E A;  1YJW I;  1XGM A;  2NVY J;  2VJ5 A;  2JSC A;  2A5W A;  3DKY A;  1R4N B;  5DCF A;  5KK1 A;  1KGS A;  3U21 A;  3HUG B;  4E7J A;  1T56 A;  2BW3 A;  2ZXI A;  4ESJ A;  2L5Q A;  3H9J A;  3QOD A;  1R6R A;  4FET A;  4BDZ A;  4A93 J;  3HTU A;  3HHH A;  2Z2S B;  1XG1 A;  4KIC A;  5HS7 A;  5IYC J;  4G7Z F;  1AOY A;  2IXS A;  1N75 A;  2HU9 A;  4O5V A;  4D9J A;  2Y9Z A;  1QZY A;  2GIV A;  4CCN A;  3CF5 F;  4MFD A;  2EWN A;  1BC7 C;  1FC3 A;  2EZI A;  4II2 A;  2QWW A;  4A69 C;  1U8B A;  2EK5 A;  3LSH A;  3O8G A;  3REO A;  1FTT A;  2D5V A;  3CDH A;  3G3Z A;  3M07 A;  4M3D A;  4LK0 F;  2WWY A;  2EA2 A;  1T98 A;  1Q1V A;  5JVT A;  1TL8 A;  1RR8 C;  3HOU J;  1ZAR A;  1I6H J;  5CVR A;  1T0F A;  4B09 A;  3F22 A;  4W1U A;  1A35 A;  5M5W J;  3IP4 B;  1T0F C;  3BR2 A;  1S6L A;  4E6K G;  1D5Y A;  3LFK A;  2E1M C;  5LBQ A;  2A05 A;  2XB5 A;  2ADU A;  3PSF A;  4RB3 C;  1SAN A;  4RMN A;  2D2W A;  1AU7 A;  1XDS A;  1MW7 A;  5JR3 A;  1FTZ A;  4OWR B;  1SD4 A;  4M6Y A;  2MC3 A;  5FRO A;  2YR2 A;  3A2K A;  1A6Q A;  3DV8 A;  4XON A;  2KT0 A;  2EFQ A;  3QP5 A;  4B47 A;  4BL0 B;  1XGS A;  2VKD A;  5IP7 J;  2BW3 B;  3RSN A;  2ZJ2 A;  2WAE A;  1W7P D;  2Z16 A;  4A3M J;  2PJR B;  4IHY A;  1GHC A;  2OTL I;  2CQK A;  4NC8 A;  5C3E J;  4P5O A;  4KIB A;  4I01 A;  4BYY A;  4FTH A;  3HM5 A;  2W82 A;  4B4C A;  3T8R A;  5E3N A;  2FD5 A;  3FM5 A;  2GZW A;  1UG2 A;  1Q1H A;  1KON A;  4U87 A;  1ODD A;  3KPH A;  2CO5 A;  3I55 I;  4EGY A;  2KDZ A;  3OYM A;  2LMD A;  2F48 A;  3OV8 A;  4HX4 A;  1GDT A;  1F1Z A;  2QKM B;  1O7F A;  3PO2 J;  4IPA A;  2K7L A;  4XSZ F;  1J7K A;  2EH3 A;  3HKZ N;  4IRG A;  4YFK F;  4PK4 A;  3OS1 A;  2L2O A;  4XLA A;  2DA7 A;  1U6G A;  1YW7 A;  3VDX A;  4LIV A;  4BHB A;  4CSW A;  1Z3X A;  3E3V A;  2A69 F;  5IYD J;  4AIH A;  1ZR2 A;  2A5Y B;  3CUQ A;  1HXD A;  4M9S A;  2VPL A;  1XDU A;  2WAQ A;  3BCA A;  4OOI A;  5CQG A;  2WAD A;  3FXO A;  3PJR A;  2K3F A;  4JK1 X;  4HAM A;  3OYI A;  2XF6 A;  2PJP A;  3BR6 A;  5F04 A;  4I09 A;  1H9G A;  2XKO A;  1AKH A;  1H88 C;  2FQ3 A;  2HYF A;  3FWE A;  5E1W A;  3E0J B;  2BY0 A;  3TOA A;  2CUE A;  3IUO A;  1Y6I A;  2XAU A;  3TO7 A;  3EQL F;  4XL9 A;  5J8F A;  3K1M A;  5C4X J;  1V4R A;  5FLM J;  4BBS J;  2LBF A;  2WB1 N;  1PVE A;  2XPU A;  4M73 A;  3CCU I;  4HYE A;  3L1P A;  1DU6 A;  4KJZ A;  4FIS A;  1T08 B;  4I2O A;  1ZRF A;  2ZME B;  2VBZ A;  4M72 A;  4XK4 A;  4QLC U;  1BR1 A;  4XLN F;  1QQI A;  1ZTR A;  2EFW A;  1IGN A;  3OYG A;  2KJB A;  4B3A A;  5L3D A;  2HXO A;  3HIF A;  5FKK A;  4CXF A;  1R4M B;  4NBQ A;  2HQA A;  2XUB A;  4UNO A;  1O3T A;  3K4K A;  1SD6 A;  3HJE A;  3F8F A;  1X3W B;  3OR1 C;  2W1O A;  2D45 A;  4HNV A;  1PUF A;  2R7Z J;  3ZQQ A;  1MMD A;  5EZG A;  1BIA A;  4LFU A;  2VKV A;  2GWR A;  5IPA A;  3UKG A;  2FNP A;  3MZY A;  3SZT A;  4Q47 A;  4KIF A;  3ZMU A;  2NNN A;  4LJZ F;  4Y3O A;  3K0L A;  2W84 A;  3HRM A;  1QGP A;  4A5N A;  3A0B C;  4DBQ A;  1VQ5 I;  2P7C B;  4CA0 A;  2XGC A;  4XMY A;  3HPH A;  5J4Y A;  3DBH B;  3MN2 A;  3LSR A;  2LKX A;  1BA5 A;  4L9J A;  2VQH A;  2IGN A;  1XSV A;  1HST A;  4ZYE A;  2KIU A;  2QQ8 A;  2CW0 F;  4MLO A;  2MAB A;  3C2H A;  1LDD A;  1NG6 A;  1YIT I;  1H89 C;  2ZSI B;  3OS0 A;  4ON0 A;  2W24 A;  2QUF A;  5TGT A;  3JRC A;  3L2W A;  3ZR8 X;  3ZQ7 A;  3EYI A;  4XRM A;  4A2U A;  1VQ4 I;  4EMS A;  3LQQ A;  3F23 A;  1N78 A;  4II3 A;  4IVN A;  2X9D A;  1P2F A;  2DYR H;  2GA1 A;  3W3C A;  3KYD B;  2OUM A;  4HLX A;  3E97 A;  1FEX A;  1ZK8 A;  2VJJ A;  3HZJ A;  3WU0 A;  5DTD A;  4NQW A;  3QP6 A;  1OCO H;  3R60 A;  1SFX A;  2DAO A;  1FP2 A;  1HW1 A;  1WFX A;  2IA2 A;  3DPL C;  5CVV A;  2E19 A;  5FKM A;  3S3O A;  2K86 A;  2M0C A;  2BY1 A;  3LFU A;  3OYJ A;  3CCV I;  5L3F A;  2BV6 A;  5FFZ A;  2DO7 A;  4EV0 A;  4N9H A;  2E1C A;  3H9G A;  1UAA A;  9ANT A;  2JZY A;  5E8I A;  1ZLK A;  2R7S A;  3HGY A;  1YI2 I;  2GAU A;  2NNY A;  4LIT A;  2CQX A;  3DWL E;  1CF7 A;  1KYW A;  2K9L A;  4KT6 A;  2P5L C;  1T38 A;  2E35 A;  3AKZ A;  3SZG A;  4MHG A;  2XDV A;  3DXJ F;  1X2N A;  2OCE A;  2G9W A;  3OOP A;  1ZYR F;  1HCR A;  3G1L A;  1XS9 A;  2BE5 F;  2H94 A;  5B1B H;  3ZOB A;  4L0Z B;  5H6R A;  3RQ4 A;  2QEX I;  1ZKG A;  2F5C A;  1JKQ C;  4LG0 B;  1WKM A;  4XKW A;  2CW8 A;  3GTK J;  2ID6 A;  2IS4 A;  4ENM A;  4MIM A;  2FRH A;  3J7Y J;  2K9M A;  4F93 B;  4HF0 A;  3KZY A;  3U9G A;  1IRX A;  5B1A H;  4OIR F;  2H09 A;  1G8X A;  3ZQH A;  4WXD A;  2NVU B;  2KLO A;  2IGO A;  1HSJ A;  2KP6 A;  3U1K A;  4BJT A;  4ZYH A;  3V7S A;  2LNB A;  3OYL A;  1IN8 A;  4RAF A;  1WJB A;  4A3J J;  1KU3 A;  3C2B A;  3CCJ I;  1HF0 A;  1OIS A;  2ZXW H;  2M30 A;  3H0D A;  3HBL A;  3PO3 J;  5GAD J;  1K4S A;  1POG A;  2ETH A;  1UEL B;  1IZ1 A;  4C3J J;  3HUG A;  3BY6 A;  1ZRD A;  4M6V A;  3BC8 A;  1KU9 A;  3GUD A;  2ACJ A;  4L5J A;  4G9Y A;  5HOD A;  3J7A O;  2R3S A;  2X6Y A;  3M8E A;  2FEZ A;  5D6F A;  4JX5 A;  1X1P A;  2GM4 A;  1J5Y A;  1LNW A;  3VSL A;  2XGE A;  5LFA A;  2OC6 A;  2LRE A;  3GFL A;  1WCM J;  1MJA A;  3ASN H;  1W7P B;  3RIR A;  1A5J A;  4U7B A;  3DKX A;  3DBR B;  4B44 A;  1BM9 A;  1OYW A;  3OL4 A;  4DZP A;  2PG4 A;  1GVD A;  5IT9 Z;  1FSH A;  1R5I D;  4BH9 A;  5E3L A;  3O3K A;  3RPU A;  3L2R A;  1MBK A;  4KT5 C;  1IV6 A;  3P9I A;  3I9V 2;  2BXY A;  5GTI C;  1SD7 A;  3EUH C;  3IAM 2;  3G2B A;  1QBJ A;  5LGU A;  1XGN A;  3PUF A;  2RQQ A;  2GQQ A;  1IXR C;  2W7N A;  3CJR B;  4X0G A;  2RN7 A;  2DW4 A;  5A2Q K;  1S8N A;  2KMU A;  2VT3 A;  1Y39 A;  2LBF B;  1KYZ A;  2CQN A;  1MBG A;  2EFP A;  2DOA A;  4FAS D;  2K3P A;  2ISZ A;  2KIS A;  1S3J A;  3KEQ A;  2R92 J;  4A0X A;  3CLO A;  4XOP A;  3RKQ A;  4IKF A;  3GF2 A;  5DV5 A;  1YOV B;  2CGP A;  2DA3 A;  3NWS A;  1SEU A;  3MZH A;  4PFO A;  1HBX G;  3SQN A;  3F8N A;  3RDI A;  3RKY A;  5F0H A;  5BMZ A;  3VYS B;  1YIO A;  3FXM A;  5E8G A;  5ILV A;  5IOY A;  2R7V A;  2BOL A;  2L01 A;  5EEA A;  3CME I;  3OSG A;  1XD7 A;  2FOK A;  1ON2 A;  3WE2 A;  2PN6 A;  4FCY A;  1U8R A;  3PQJ A;  3JRA A;  4N9I A;  3RZD J;  3KCC A;  2F5V A;  4L9N A;  1TW2 A;  1MJ9 A;  2OV7 A;  3EPZ A;  3KP5 A;  2EIK H;  3TGN A;  3I4P A;  2IGM A;  2EB7 A;  1TWH J;  1E3H A;  1XN7 A;  2P8T A;  4RAG A;  2DBB A;  2KIQ A;  5EF6 A;  3WTS C;  1IUY A;  1MNE A;  1OKR A;  5LHG A;  3WTZ A;  1U78 A;  3S1Q J;  3CUQ C;  5KCM A;  1IN7 A;  4KN7 X;  3HOS A;  3L09 A;  1DGW Y;  5HDK A;  1T33 A;  4ZZL A;  4DW6 A;  4WK8 F;  2V1D A;  5CKT A;  4QPQ A;  3OY9 A;  3GZ5 A;  2XC7 A;  2AO9 A;  2X1D A;  1R36 A;  5ICC A;  1X1B A;  2KIF A;  2VUM J;  2JPB A;  4RB0 A;  3OYH A;  1DP7 P;  3WU2 C;  3S16 J;  1BOB A;  3F8M A;  3DLL F;  4BNC A;  1L3L A;  1R1U A;  3O8H A;  4ZDP A;  4ASN A;  5ICE A;  4HF2 A;  1FLI A;  4UV8 A;  3KFW X;  2M4G A;  3PM1 A;  1Z9C A;  1TNT A;  2EZK A;  4GCV A;  3BZK A;  1K78 A;  3CC7 I;  2W57 A;  3ZQF A;  1TT5 B;  3OIP A;  2RQP A;  1MBE A;  3FBN B;  2KRC A;  5IP9 J;  2CH0 A;  4G6D A;  3DLA A;  1QPI A;  2FE3 A;  2WAF A;  2NOJ B;  2E34 A;  2MC4 A;  2W25 A;  2E1O A;  4ENJ A;  1FJL A;  2EBI A;  3QPL A;  5DUK A;  4IOC F;  4RM2 A;  4L18 B;  2XAH A;  1JJ8 C;  1B72 A;  4PFP A;  2YU9 J;  2Z5U A;  1YJ9 I;  3I59 A;  3VYT B;  2EV0 A;  1ETQ A;  2ZJQ F;  1W36 D;  2MYS A;  4FX0 A;  3DEU A;  1PJR A;  1QVU A;  3PNT A;  2OAZ A;  3K1N A;  3L9F A;  3ZQG A;  1UCR A;  3QYB A;  1F43 A;  4HX7 A;  2XPV A;  4MNU A;  3HOT A;  2R5Z B;  2XRL A;  4BXX J;  4HST A;  3H5A A;  3G71 I;  3FK7 A;  4DNC A;  5GPC A;  3S3N A;  3PUB A;  1Z7U A;  2VOO A;  1V5E A;  2J5O A;  3MVP A;  4BQQ A;  1SAX A;  2AQE A;  3HOZ J;  2XAQ A;  4RAZ A;  4UXN A;  1VI0 A;  1LE8 B;  3K4C A;  3Q0V A;  1EV7 A;  1LKX A;  1P92 A;  2COM A;  4V19 K;  2EPF A;  1WH7 A;  2VXZ A;  1ZG3 A;  2XAG A;  4S04 A;  3N97 A;  2EFN A;  4H4K C;  3WGG A;  4HV6 A;  1HC8 A;  2LF8 A;  1DGR M;  2DT7 B;  1Z0X A;  3ZMT A;  3FXJ A;  2KRF A;  4PJN A;  4RA2 A;  4A3B J;  2CV1 A;  1HLV A;  1OJL A;  1GXQ A;  2OPT A;  1K7A A;  1BL0 A;  1P9Q C;  4HW0 A;  2GBY A;  4JYK A;  3TP3 A;  3IHU A;  5L3B A;  1JT6 A;  1B59 A;  1Z1D A;  4FHT A;  3SEQ A;  4UUS B;  2FOW A;  3TDU C;  3HSE A;  5DD4 A;  2QEN A;  5D8L B;  2TCT A;  2H1K A;  1VQ6 I;  4A3D J;  4AM3 A;  1QHH D;  3ZP5 A;  5K5Q A;  3W2A A;  5A2Q Z;  2HVR A;  1BIB A;  3ROU A;  3JRH A;  2I10 A;  2O0Y A;  3E5X A;  3MKZ A;  1Z6R A;  1V5G A;  2YPR A;  2D1H A;  2JMW A;  5EG0 B;  3WG7 H;  5D5X B;  2LF7 A;  2DA4 A;  3I0T A;  4FT8 A;  3WTU C;  4BEH B;  4M3F A;  1FMW A;  3EET A;  3H3Z A;  3WG9 A;  2KIM A;  3ULQ B;  1HQC A;  2DJI A;  3CDI A;  2LRD A;  4E7L A;  4BY1 J;  1P4X A;  1MMA A;  2DYS H;  3SJM A;  3QOP A;  2GA2 A;  3HC7 A;  2LDU A;  3BDD A;  3MFK A;  3IWF A;  4BQN A;  1B9M A;  1TQM A;  2UV1 A;  1G6N A;  4YFN F;  4IRH A;  4MO7 A;  2DMT A;  1ZRE A;  3SDB A;  3BG3 A;  3CMA I;  2VLA A;  5FB2 A;  3IRR A;  4L9V A;  4XRS A;  3DQV C;  3E6M A;  4BGD A;  2KDO A;  1Z67 A;  4ESB A;  3BTI A;  4CO8 A;  2ID3 A;  2WC2 A;  4KIS A;  4DBR A;  2QM3 A;  4P55 A;  2ZBK A;  4ZYA A;  3FM3 A;  5KVR A;  3S2W A;  3ZMV A;  5LRS A;  3E1S A;  2HXI A;  2CW7 A;  2K9N A;  4WX9 A;  3E5U A;  5FRM A;  2HS5 A;  1ZHF A;  2EV6 A;  2JUG A;  2VJ4 A;  3TQN A;  5J3L A;  4CCO A;  3L2C A;  4C2U A;  1IN6 A;  1JUM A;  2CFO A;  1K83 J;  4BE0 A;  1FIP A;  3WTW C;  3TO9 A;  1DQU A;  2JUC A;  3F0C A;  1REP C;  1Z6T A;  2ECC A;  5E17 F;  5FLV A;  3KP3 A;  5J47 A;  5DM6 F;  4UVA A;  4RS8 A;  2JTV A;  4A0Z A;  3BCB A;  3ZN0 A;  4XNF A;  5BS6 A;  3NEU A;  3GTQ J;  1UHS A;  3M9A A;  2X85 A;  3LSM A;  3GCM A;  4LLG F;  3CJN A;  3LMM A;  1T8I A;  3VFZ A;  2JT1 A;  1YG2 A;  2VE8 A;  3LWF A;  4AYB N;  1D0Z A;  1QPM A;  2VPR A;  2QBY B;  1PYV A;  1FBU A;  3NWT A;  3R0A A;  2LTP A;  2IJL A;  1DP3 A;  2H6B A;  4EM2 A;  1WI9 A;  2V4J C;  2CYY A;  2L4M A;  3W2W A;  1E3P A;  3GTJ J;  1JHH A;  2BY2 A;  2Z9O A;  2LSO A;  1R1T A;  4CYC A;  4IQ4 A;  4UV9 A;  4XN3 A;  1G2H A;  5HNF A;  2VKH A;  4IO9 F;  3I54 A;  1X4P A;  2KRH A;  2JPC A;  5EGO A;  2GXG A;  2B7E A;  1W5C C;  4R1H A;  3LSI A;  3S8P A;  1SVL A;  3OYD A;  1TQP A;  2E1N A;  1HW5 A;  4QIW N;  1EH6 A;  3DCF A;  2O5R A;  2H8R A;  1R7J A;  1GVJ A;  1XTA A;  4UB8 C;  4M71 A;  2GOX B;  1X1A A;  4XSX F;  2CMP A;  3SEZ A;  2DMP A;  3A01 B;  4F52 A;  2K9Q A;  1QZE A;  1UG0 A;  3OR2 C;  4XLC A;  1R22 A;  3TED A;  2CU7 A;  3ABK H;  2WV1 A;  3FIW A;  3TW6 A;  3CJT B;  5C4J J;  1KU2 A;  1W7P A;  4I0B A;  2L9V A;  4IRI A;  3RYP A;  2VB6 A;  2L0K A;  3JTH A;  5AIP A;  3ZGK A;  2P6T A;  3J7Z I;  4Y7N J;  2R7X A;  5DD8 A;  3LA7 A;  2XHK A;  1DDN A;  2Y69 H;  2HQ5 A;  3ERM A;  3VOE A;  5J8C A;  3VEP A;  2KZV A;  3QU6 A;  3QAH A;  2FMY A;  4WXH A;  1I50 J;  3HRT A;  2COB A;  3F21 A;  2L9S A;  2KJC A;  5J40 A;  3CQZ J;  4MEY F;  1AWC A;  5EJC A;  1Z21 A;  2EFO A;  2MD0 A;  5CYV A;  1JUP A;  3J81 Z;  1XCB A;  3NQO A;  2GLO A;  3QOE A;  1IW7 F;  4LLL A;  2LY9 A;  2HGC A;  1VQK I;  2Q2E B;  3J80 Z;  5E3M A;  2LLK A;  2JK3 A;  4DYC A;  2MH9 A;  2X6X A;  3OYB A;  1JT0 A;  1A31 A;  1ETO A;  4ZDL A;  1MBJ A;  1KQ9 A;  2Y48 A;  3IRQ A;  4FE7 A;  3BG5 A;  3V8J A;  4A3C J;  2M7A A;  2R7F A;  2M45 A;  5EG0 A;  1Z05 A;  3OYN A;  4IHV A;  1LVK A;  3BR3 A;  3I53 A;  2OZU A;  2ZFW A;  1TTY A;  5F27 A;  1RUO A;  1FNN A;  1EJ9 A;  3DTK A;  1TZL A;  3T5X A;  4NUB A;  4JQF A;  1IDZ A;  4M6X A;  4AVP A;  3M4O J;  5C44 J;  2NVT J;  4E70 A;  1I1G A;  2EIM H;  3IWZ A;  3DPT A;  3P9C A;  3LOC A;  4ZYD A;  2STW A;  4LB5 A;  2XAJ A;  4EM0 B;  3ZQL A;  2G7H A;  3VPR A;  3CTA A;  2VAS A;  3CCR I;  5FLX K;  3GTG J;  1SMT A;  2E1M B;  4MEX F;  1OMI A;  2MG4 A;  3ABT A;  3HKZ A;  3HB9 A;  3QQA A;  4N4N B;  1XGO A;  2CQ7 A;  4BU2 A;  1FOW A;  3OWT A;  2B9S A;  2IGK A;  4OAZ A;  2BHY A;  2RRE A;  3Q0U A;  4C2M J;  5HLT A;  3FHZ A;  3FMS A;  1MDM B;  3V7R A;  3SFI A;  1QVT A;  2ELJ A;  2XSJ C;  1ZG5 A;  4Q48 A;  3TOB A;  3NAU A;  3K70 C;  2V1X A;  3L7W A;  2CS3 A;  2STT A;  4DYR A;  1K79 A;  5CPR B;  3R6S A;  1R5G A;  1FX7 A;  1V3F A;  1KQ8 A;  4CH7 A;  4JX4 A;  2VI6 A;  5LD2 C;  2K4B A;  4EM1 A;  4O6J A;  2NVQ J;  5GP9 A;  3DPU A;  4JX6 A;  3LSG A;  5CVI A;  2HZD A;  2F4I A;  1GT0 C;  1FY7 A;  4CCJ A;  3N4M A;  5BPI A;  2KHM A;  3C3W A;  3K2Z A;  4P9U A;  2ZJP F;  2XIG A;  2BZT A;  2VIX A;  2VL8 A;  4U88 A;  3JRE A;  4EJU A;  2HVS A;  2F2E A;  2XAS A;  3FX3 A;  5GAG J;  1ITY A;  1M1E B;  3I3L A;  4MTD A;  3LSP A;  4A3I J;  1RRJ A;  1F9N A;  2B63 J;  2GXB A;  1ONV A;  1WI3 A;  4ZTJ A;  2HNH A;  4MQ9 F;  4F3Q A;  3ESW B;  4LG3 A;  4R79 A;  4UUT A;  5GTH C;  1IUF A;  2XPW A;  3SDG A;  4Q4Z F;  1D1A A;  2XF7 A;  4NNJ A;  2E71 A;  3PFI A;  2PMH A;  3ZRG A;  1FYL A;  2QCO A;  1XSD A;  4IHT A;  1SMY F;  3GTL J;  1E3O C;  3GWZ A;  3I4N J;  1KA8 A;  2R7R A;  3CCQ I;  2V1U A;  1UHM A;  2V9K A;  3BTC A;  3QPT A;  4DGW B;  4XID A;  4R8H A;  3HOX J;  2VE9 A;  4XLP F;  1U5T A;  3E6D A;  1WJ5 A;  4U7D A;  2LR8 A;  1FPQ A;  3CC4 I;  5ICG A;  4P1W A;  5ED4 A;  3A0H C;  3ZXS A;  4Z2Y A;  3DP7 A;  3RQI A;  6PAX A;  3GFM A;  4PJ0 C;  4J01 A;  3SFZ A;  5LGN A;  1JJ6 C;  2YU3 A;  2DI3 A;  1X1C A;  3BJA A;  5JLX A;  4RGR A;  2HR3 A;  3CDL A;  4BXF A;  4BS9 A;  4IOA F;  2LYC A;  2D1V A;  5M5X J;  1VQO I;  1TC3 C;  4DYQ A;  1QU3 A;  3K1P A;  3MD2 A;  3MQ0 A;  1UZC A;  1BI2 A;  2CSO A;  5HLG A;  5IYB J;  1U9N A;  4FX4 A;  1MJB A;  1MBH A;  2L7Z A;  2X6W A;  4C2T A;  1GV5 A;  4PGH A;  3A03 A;  2GOM A;  4E4H A;  2RVC A;  5F1J A;  2VOD A;  1IG7 A;  2CJJ A;  4PCQ A;  3S17 J;  5IT3 A;  2HDW A;  1QHG A;  3KE2 A;  1HDP A;  4UUS A;  3FKI J;  2VBY A;  2HOA A;  2R4G A;  4QSH A;  5M3F J;  1U5T C;  1J59 A;  1XB4 A;  3D5R C;  1WZ2 A;  1GXP A;  4HLY A;  3D1N I;  2E2I J;  3P9K A;  2A6T A;  1LDJ A;  3H5R A;  1D8K A;  3P5J A;  3BG6 A;  4L9T A;  4NC7 A;  4B1R A;  5AIQ A;  1JKO C;  1NG7 A;  3GFI A;  3A1Y A;  2LC2 A;  4EVI A;  3T1B A;  1BJA A;  2HWV A;  4CCM A;  1IN4 A;  2R7U A;  3P7N A;  2Q0O A;  4DJA A;  5JLW A;  2C6Y A;  1SFK A;  2M7B A;  3UR3 C;  2R7T A;  1HDD C;  2M9H A;  2QYO A;  4CUG A;  2AS5 F;  4NHJ A;  3K6G A;  1AA7 A;  4XRS G;  4B3X A;  3R4K A;  3VOD A;  4D0P A;  2FUG 2;  1G3T A;  4FE4 A;  1Z91 A;  4DIQ A;  3JCU C;  2PQ8 A;  2E2J J;  2R7Q A;  1Y0U A;  3AFH A;  1ZR4 A;  2DLL A;  1H9T A;  1P7I A;  3PIO F;  1T95 A;  3L00 A;  2GXA A;  5HS9 A;  1MGT A;  4I0A A;  1D3Y A;  3CCL I;  2E5N A;  1YRN A;  4LG0 A;  5D5W B;  4BKX A;  3ML6 A;  3BR1 A;  2M8E A;  3GZN B;  1NTC A;  3U1D A;  3S15 J;  2V1N A;  3QPH A;  4A5M A;  2WBM A;  4RGU A;  3K69 A;  3GFJ A;  5J4V A;  2HFH A;  5FD6 A;  1BJZ A;  3RPQ A;  1R5H A;  1QRY A;  1WGX A;  4G7H F;  4E7I A;  4GYG A;  5K5O A;  1LPQ A;  2E2H J;  2X1E A;  5CVJ A;  1S29 A;  1K61 A;  2BYV E;  2DOF A;  3RKW A;  3BTJ A;  2W85 A;  3AAF A;  3HOW J;  5F0F A;  3Q9S A;  4BHC A;  1ON1 A;  5TRD A;  2XRN A;  4PJL A;  5ERI A;  2W00 A;  2V9P A;  3BZ6 A;  2EZL A;  2QSH X;  2QGU A;  2KKO A;  1IRF A;  3HSR A;  4A3K J;  3WOD F;  1MZB A;  1TP4 A;  3LSJ A;  2O8X A;  2DA1 A;  1F4K A;  3V4G A;  4UUV A;  2CV2 A;  2LY1 A;  3CCS I;  3B6A A;  1XC5 A;  2L7F P;  3H5N A;  4PSX A;  4IJA A;  3GO5 A;  1K6Y A;  3W2V A;  3KZI C;  1R00 A;  1U9O A;  4UVC A;  2QQB A;  3R0J A;  2QBY A;  2OU2 A;  2HVQ A;  4GRI A;  4LIU A;  3RI4 A;  4IX7 A;  4EJT A;  1S5L C;  3TMO A;  4ANJ A;  5JFR A;  2BEO A;  3BG9 A;  2P4W A;  3EDP A;  1JHF A;  3ZQC A;  3M1C A;  4PGG A;  4BJ6 C;  1R1V A;  4KYW A;  3AL0 C;  3ELK A;  4HEA 2;  3BZC A;  1I5Z A;  5H6Q A;  4BAC A;  1ZG1 A;  1U2W A;  2PLY A;  1BR2 A;  5TJJ A;  1ZLJ A;  1DU0 A;  4EAT A;  3Q0W A;  1X4O A;  2RDP A;  4LOC A;  4BQA A;  3HOV J;  3MKW B;  1RI7 A;  4AIK A;  3H9Q A;  3ZN1 A;  3E6B A;  1XSX A;  2O7O A;  3BRO A;  2PI0 A;  1HA8 A;  2OTJ I;  3BTL A;  1VQL I;  3BLY A;  4KIG A;  2VXD A;  1O3S A;  5J1Y A;  5DM7 F;  3S14 J;  5DCM A;  1L0O C;  5F1R A;  1TWC J;  2JVH A;  1G3W A;  1IAW A;  4G94 A;  1EKE A;  3DU5 A;  1FYK A;  4S05 A;  2IT0 A;  2QSG X;  2DQR A;  2XAF A;  3MCZ A;  5J1U A;  3KP7 A;  1N77 A;  1IV8 A;  1W4M A;  5CVU A;  1O3R A;  2NYX A;  2WY7 Q;  3QWL A;  1O57 A;  4HV5 A;  3G4S I;  1RR7 A;  2W48 A;  4I76 A;  2H1L A;  2M8G X;  4A6E A;  1ZGW A;  1JGS A;  1LEA A;  3ERE D;  2LVS A;  1ORK A;  2FBK A;  3FXK A;  1KU7 A;  1LE8 A;  5K7F A;  4HG2 A;  1Z77 A;  1UB9 A;  2EA4 A;  2MBF A;  2PX9 A;  3L2Q A;  4GO1 A;  1D1B A;  4F55 A;  2WA0 A;  2K5C A;  3FXQ A;  5F0C A;  4M3G A;  3F8B A;  1EH7 A;  2HQN A;  2R7W A;  5H20 A;  5K1Y A;  1B8I B;  5J6X A;  2LOO A;  1FIA A;  2XB0 X;  5EYR A;  2ZJR F;  3I59 B;  2B0L A;  1MH3 A;  3E6C C;  3KLO A;  4L0Y B;  5GAH J;  2K9S A;  2XSD C;  2M5W A;  5HLI A;  3VSK A;  4YII A;  4BE1 A;  1IC8 A;  5FGM A;  1RPW A;  3S1N J;  4IL6 C;  2HI3 A;  2E7W A;  3CUO A;  4HDU A;  5E1Z B;  2NAZ A;  2R5Y A;  4CIC A;  1WJC A;  4WF2 A;  4AYB A;  3M8J A;  1XX5 A;  2QZ8 A;  4LMY A;  4UVB A;  2YX7 A;  5F64 A;  2VC1 A;  4M3B A;  4AIJ A;  4MQV A;  1PUE E;  2ZME A;  3CCE I;  2BGC A;  3WGI A;  3BR5 A;  3LA2 A;  2QA4 I;  2CWE A;  3FMR A;  5FD5 A;  3WE3 A;  3JW4 A;  2HEO A;  2VBX A;  3TP0 A;  3KYL A;  3FKJ A;  3CF2 A;  1W36 C;  3LST A;  1XPX A;  2JWT A;  4OMY A;  3FMQ A;  1TNS A;  4CZC A;  4BQO A;  4ENN A;  3BP8 A;  2LH9 A;  1DPR A;  2DJN A;  1JTX A;  2V6C A;  2XRO A;  2IEK A;  2X1C A;  3V42 A;  1J0R A;  1K4T A;  3KZZ A;  1IRZ A;  4HOB A;  1A36 A;  1U0J A;  2JN6 A;  1B9N A;  4P96 A;  4Y4R A;  1ACI A;  1IF1 A;  1EH8 A;  2LKS A;  1OCT C;  1XMA A;  1TWF J;  4NB5 A;  2ME0 A;  2L02 A;  1VQ8 I;  4XLE A;  3JSP A;  1XMK A;  4CYC B;  4C9Y A;  4OIQ F;  1MND A;  4EJO A;  3JSO A;  4OIN F;  2LG4 A;  1Y8R B;  2MLK A;  2HPM A;  1V5F A;  1S7O A;  2L9R A;  3VYR B;  5K5R A;  4P9F A;  1A6I A;  2HYG D;  1E17 A;  2BBY A;  4U0Y A;  3PIP F;  2EIL H;  3CMM A;  4NQW B;  2ZME C;  4B43 A;  1TLH B;  1CGP A;  2HOT A;  1D5V A;  1U3E M;  3KP4 A;  4XLF A;  4PZJ A;  2P6S A;  2JRM A;  3WHB A;  5HNH A;  5K7Z A;  4YIR X;  1S7E A;  1ZGA A;  2E7X A;  2JVG A;  3M1E A;  3H0G J;  3KX2 A;  1S72 I;  4IHW A;  3JTG A;  3H3U A;  1ZN2 A;  1FOK A;  2A3S A;  3I5U A;  3VWB A;  3ISP A;  4XBF A;  1W0U A;  3G6E I;  4KMU X;  2DCE A;  2OA4 A;  2PJR A;  2AQF A;  4PDK A;  1RZ4 A;  1WQ2 A;  1Y8Q B;  2WB1 A;  1WSU A;  3CP8 A;  4WWC A;  1ERD A;  3OIQ A;  3I64 A;  4AC0 A;  4TV7 A;  5B66 C;  4GDF A;  4C30 A;  2A68 F;  2L4A A;  3CMY A;  1ZGJ A;  2K27 A;  4ZTF A;  3HYI A;  2NRA C;  1S7A A;  4BUP A;  1ETW A;  1SAU A;  2IS1 A;  4A6D A;  2Y30 A;  1VQN I;  2BVM A;  4GXO A;  2DPD A;  4YIF A;  1FBQ A;  4XKV A;  3K4N A;  3F6V A;  4Q5S F;  2JA7 J;  1MMN A;  2ZC2 A;  2XF5 A;  1IRG A;  2VBW A;  2CG4 A;  4ZDO A;  2QSF X;  3F3X A;  1X3Z B;  1MMG A;  1CF7 B;  3W6J B;  2L7M P;  1YW8 A;  3ZMS A;  2UXX A;  2OF7 A;  1RKT A;  2CRG A;  2LK2 A;  2VQG A;  2RNG A;  3ECO A;  3W6V A;  4CYD A;  2VJI A;  1UMQ A;  2DFE A;  3AG3 H;  3JAM K;  3QPS A;  1BN5 A;  3D5L A;  4I98 B;  4PSW A;  3CLQ A;  2L54 A;  2ZNY A;  4IZZ A;  4BXU A;  3WTY C;  1H0M A;  3ECH A;  2Q2E A;  2R7D A;  2RC4 A;  4RBO A;  1JKP C;  1HKQ A;  3OYA A;  4A3F J;  4A3L J;  4Y52 J;  4HX8 A;  3JRB A;  2HZT A;  5JHU A;  1WHU A;  4M74 A;  4RLQ A;  4UB6 C;  1YS7 A;  1OYI A;  2O3F A;  3BQY A;  3OSF A;  3Q5F A;  5D5V B;  1R23 A;  4XQF A;  1R71 A;  3J81 K;  1A04 A;  3JRD A;  3OYE A;  4HDV A;  2IVM A;  1X58 A;  4FQG A;  4IHS A;  4YG2 F;  3I56 I;  1FWZ A;  1BI1 A;  3KIO A;  5KHD A;  1BI3 A;  1JKR C;  3MKL A;  4N0B A;  3FK6 A;  4EJW A;  4HQM A;  2KPM A;  2LD5 A;  1PUF B;  5IT9 K;  4A12 A;  2DMN A;  2HQR A;  3G1M A;  1YW9 A;  4ABZ A;  2E36 A;  1OCP A;  1YJN I;  3BPV A;  2HKX A;  5EGO B;  1P6R A;  3O2P E;  4QPO A;  2DOD A;  1WPK A;  3K4B A;  1YE9 A;  4A3E J;  4F92 B;  1IN5 A;  3IKV A;  1DPU A;  1XMX A;  2Q1Z B;  3QRF F;  5B3S H;  1BW6 A;  4IF4 A;  5LRR A;  3I71 A;  2DMQ A;  2JA2 A;  5CJ9 A;  2Y2Z A;  4E7K A;  2CUJ A;  3D0S A;  1YIJ I;  2DK5 A;  3W6K B;  4HRI A;  3H1C A;  1T39 A;  2OCC H;  4LLN A;  1LDK B;  2KFD A;  2M4K A;  2IA0 A;  1E2X A;  3V8K A;  2OD5 A;  2H27 A;  1HW2 A;  1RNL A;  2F4O B;  3GTM J;  3FXL A;  4K2E A;  4IQJ A;  3TW7 A;  3QYF A;  1E0E A;  3PNY A;  5BQT A;  4XIC A;  2PMZ A;  3CCY A;  3DTI A;  4XLH A;  1TWG J;  2O9L A;  5L3G A;  3BJO A;  5FFX A;  3GTO J;  2OQG A;  3TKY A;  2Y31 A;  4XOR A;  2XVC A;  4MFE A;  2HOS A;  4ZH4 F;  4BY7 J;  4S0H B;  2CV0 A;  1F36 A;  4CCL A;  1YTY A;  2DMU A;  2A6H F;  3GLX A;  4IHX A;  4XKC A;  1V55 H;  3PQK A;  4KUM A;  2NS7 A;  4BJ5 C;  4D5C A;  4C3H J;  4E7Z A;  1ENH A;  3HHG A;  5ICF A;  4ZJZ A;  1B8I A;  1O3Q A;  3CO6 C;  4BDY A;  2RV8 A;  3BR0 A;  3F9K A;  3B6C A;  2DU9 A;  3B73 A;  3KEO A;  4PUS A;  1YX3 A;  1ZH5 A;  1K78 B;  3OYK A;  2LP0 A;  1O7L A;  2IPQ X;  2ELK A;  3A02 A;  4AVZ A;  1SFU A;  3OYC A;  2O8K A;  5IP6 A;  4NDL A;  2MSY A;  3KYC B;  2FJ1 A;  3PL8 A;  4RDU A;  1U5T B;  1GLN A;  2HDD A;  2DTR A;  1NK2 P;  5D4S A;  4MGR A;  1VQ9 I;  1I27 A;  3MWM A;  2DN0 A;  3V8L A;  1G4D A;  3TBI A;  1WJF A;  3D5S C;  4HZF A;  5F6F A;  4EJV A;  2ZFU A;  1TWA J;  5TIS C;  4C3I J;  2FML A;  2JQ7 A;  2MGQ A;  4YEL A;  2F5D A;  4F7Z A;  1Y0N A;  3T8T A;  2M1B A;  2M87 A;  3M7G A;  1NK3 P;  2A61 A;  5LEJ A;  3KEY A;  3KP6 A;  3AL0 B;  1ETV A;  2DOE A;  2X6O A;  3BT9 A;  1I3A A;  1QZZ A;  3O6B B;  3QU3 A;  4Y33 A;  3MKY B;  1JE8 A;  2DXI A;  4ZYG A;  1LFB A;  3A4C A;  3MAJ A;  2NVX J;  2F4M B;  4XN0 A;  5IY5 H;  1B1B A;  1WJA A;  1QO0 D;  5E1X A;  3Q9V A;  2FXA A;  2OBP A;  1RES A;  1JXS A;  2YUS A;  5GAE J;  2ZKZ A;  1OYY A;  4XOT A;  5BNG A;  1SD5 A;  1WRJ A;  4AUX A;  1OFC X;  5D8K B;  5DUI A;  3CZ6 A;  3RYR A;  2DQL A;  3CC2 I;  4OMZ A;  5KAI C;  2FX0 A;  3DEW A;  4IXA A;  1I39 A;  2QQA A;  2RNJ A;  3GX4 X;  2DDB A;  2NOG A;  2FQ4 A;  2FU4 A;  2P5K A;  3RCO A;  4CCK A;  1P4W A;  3JRG A;  2PMZ N;  1VQ7 I;  2CUF A;  1YS6 A;  3IH4 A;  2DT5 A;  1D0X A;  1B6A A;  1B4A A;  3CD6 I;  2Z33 A;  3N05 A;  4UHT A;  1HOM A;  1W5T A;  4I7H A;  1FBS A;  5D5U B;  5M5Y J;  3KET A;  2UZK A;  3PSI A;  2R7O A;  2FA5 A;  4M9Z A;  3T0Y A;  1MKM A;  4G12 A;  3GBG A;  3FBI B;  3H36 A;  4HBL A;  4JOM A;  3MZ8 A;  5FKN A;  2X4H A;  2PMU A;  1OCC H;  3RKX A;  2UXN A;  2VQL A;  3IAS 2;  4LGW A;  3ZMD A;  4BBR J;  1G59 A;  2FBH A;  3PNV A;  1UJ8 A;  4G7O F;  1JTY A;  5EDN A;  4PJJ A;  5FO5 A;  3QYE A;  1R58 A;  1YFH A;  2FNA A;  2X0L A;  2NS8 A;  2DFF A;  4Y17 A;  4PJM A;  3E7L A;  2RAE A;  2DFH A;  5DEQ A;  1YO5 C;  3L2V A;  3LAP A;  5HDN A;  1TBX A;  2ZNZ A;  1LUJ B;  1Z7L A;  1X1D A;  1QA6 A;  1KZH A;  1BR4 A;  2R5Y B;  3HPG A;  3L2U A;  1P4A A;  3X2Q H;  1VFC A;  3GW2 A;  1SFO J;  2HKO A;  3EUK L;  1YRN B;  1GV2 A;  1X3U A;  2Y75 A;  1G3Y A;  1LJ9 A;  1SFE A;  2DT6 A;  3DF8 A;  1R49 A;  3HRU A;  2ELH A;  1HKT A;  3BJ6 A;  2M0M A;  3EUH A;  2UUZ A;  5EZH A;  2EV5 A;  1PP8 F;  5ILU A;  1X2M A;  5HDG A;  3EYY A;  1G3S A;  2QLZ A;  2Y0S N;  5DDG A;  1MNM C;  2LKP A;  4HA8 A;  4LK1 F;  4KDP A;  3H35 A;  2P5V A;  2V26 A;  3F6O A;  3AG4 H;  3LA3 A;  5K7H A;  2YX4 A;  4EEF G;  1YHQ I;  4ESF A;  1K6O A;  1T6S A;  3GTP J;  3CUQ B;  2FF4 A;  3C1D A;  2XGD A;  5L3C A;  3K10 A;  1W0T A;  2ZB9 A;  2VN2 A;  2ME6 A;  3DBL B;  2O6G E;  2MA3 A;  4NC6 A;  4WCG A;  2XKP A;  3CCM I;  2IP2 A;  4W97 A;  2P81 A;  3BQZ A;  3I4M J;  2JA6 J;  3R61 A;  1IO2 A;  3GYH X;  1TT0 A;  2FSW A;  5E79 C;  5ILS A;  5LLQ A;  2H6C A;  2QF7 A;  3H3V K;  4YEJ A;  4XKB A;  2BHZ A;  1D8J A;  2LFB A;  4G8X A;  3WTX C;  1BBY A;  3F72 A;  2ESH A;  4H0E A;  2F5E A;  2ZCW A;  3K4M A;  5LHI A;  2UWM A;  2E60 A;  3RPU D;  4AWX B;  3JAM Z;  2AXL A;  5DYM A;  2LY2 A;  1J75 A;  1VND A;  2K02 A;  1MIJ A;  2I5U A;  2CUZ A;  3IV5 A;  3S1M J;  1R9T J;  3BOQ A;  2MFZ A;  4E7S A;  4RGS A;  1UHW A;  3HOY J;  1DUX C;  2PFB A;  2MLG A;  2HTS A;  3OMY A;  2WY8 Q;  1LB2 A;  1USS A;  4GFB A;  4DOZ A;  1TQI A;  2X51 A;  3HDD A;  4YFX F;  4HNU A;  1RC9 A;  2BVL A;  3ZCO A;  3TL4 X;  2Z3Y A;  3K9T A;  5IOZ A;  5KAF C;  3WTT C;  2JA5 J;  1GUU A;  1T2K A;  1D0Y A;  1ETX A;  1TW3 A;  5FLX Z;  1CQT A;  3DEE A;  4MTE A;  2M3A A;  3S2H J;  1MSF C;  1H8A C;  1RUN A;  4O3M A;  2HPI A;  5LHH A;  3FZV A;  3DU6 A;  3HEF A;  2F5F A;  1ZRC A;  1WH5 A;  2EIJ H;  1BOA A;  1JI8 A;  4BHP A;  1ULY A;  1O4X A;  1I3Q J;  2DPU A;  2KQR A;  4L5E A;  2M2E A; 
#chains in the Genus database with same CATH homology
 4CZZ A;  4G6Q A;  3J80 K;  5JI6 A;  1UST A;  1UFM A;  4CGZ A;  2OZ6 A;  2OQR A;  5CLS A;  3C18 A;  2MH2 A;  1IXS B;  3FF5 A;  1PP7 U;  2HOE A;  2EJR A;  4KNY A;  1RIO H;  2ZO4 A;  2ZXJ A;  2P7V B;  4A0Y A;  2G7U A;  5LEK A;  1QNT A;  4GGG A;  3KLN A;  5D4R A;  4Y15 A;  2V79 A;  5BOX A;  3BPX A;  4KA4 A;  4BAY A;  5D6E A;  3COA C;  1BC8 C;  1FZP B;  3BWG A;  3ZPL A;  2QQ9 A;  4RB1 A;  3B02 A;  2FBI A;  5HOO A;  3FXU A;  3WGH A;  3LQR A;  2DFI A;  4JBA A;  4KN4 X;  3FXR A;  1I6X A;  4I02 A;  1XCV A;  2O03 A;  1MD0 A;  5E18 F;  5DCM B;  5EEG A;  4LB6 B;  2MD5 A;  2VOP A;  3ZMZ A;  1F5T A;  1LVA A;  2VON A;  3RTR A;  2J5P A;  1YLF A;  2K4J A;  2TDX A;  3I58 A;  5HLH A;  3CO7 C;  1YYV A;  2DK8 A;  2XGX A;  2RKH A;  2QVO A;  4ETS A;  1J9I A;  1VTN C;  3E5Q A;  1PDN C;  2A6E F;  3SHF A;  2HTJ A;  1HKS A;  3KP2 A;  4OIO F;  3NRV A;  2Q8K A;  3IC7 A;  3GZ6 A;  4L5I A;  3GVA A;  2PBI A;  4RAY A;  2ISY A;  3ABU A;  3RJP A;  1I1S A;  1STZ A;  2O61 A;  3SZP A;  4RB2 C;  4B8X A;  4KMF A;  4U0V A;  3IL2 A;  2VC0 A;  4GYI A;  1BI0 A;  3WU1 B;  2ESN A;  4HF1 A;  1LEB A;  3WTV C;  3F8C A;  1MDM A;  3HSF A;  4KFC A;  2PEX A;  5AON A;  3VB2 A;  1KQ0 A;  5LGT A;  2IA1 A;  3U2R A;  2WV0 A;  2Y0M A;  2V9V A;  3GXO A;  3H92 A;  2RGV A;  2VT2 A;  1FT9 A;  5HVQ C;  3M8F A;  4U0W A;  5HS8 A;  3LAJ A;  2Z99 A;  4AD9 A;  4OU0 A;  2JRT A;  3TDZ C;  4WXC A;  4DQ2 A;  2HDC A;  4QWQ A;  1YQA A;  1FSE A;  4LD5 A;  4EGZ A;  5EEH A;  5E20 A;  3IKT A;  5BPD A;  4M9X A;  4CDG A;  1W5S A;  4XRF A;  2NS0 A;  2CFX A;  1WWX A;  1ZAO A;  3HTS B;  3GEZ A;  2IW5 A;  2YSR A;  2A07 F;  2WTE A;  4EQQ A;  3TO6 A;  4RGX A;  1FYM A;  3HRS A;  4OIP F;  1IXC A;  4ENK A;  1OR7 A;  3DFG A;  2IRF G;  1LQ1 A;  4HQE A;  3SXY A;  3V7C A;  2XV4 S;  4Y13 A;  3G73 A;  1OPC A;  1J2X A;  1FP1 D;  3DKW A;  3C7J A;  4CHU A;  3MEX A;  4ZZD A;  1C0W A;  1NHA A;  2L3D A;  5L3E A;  1XGM A;  2JSC A;  5DCF A;  5KK1 A;  1KGS A;  4ESJ A;  3HTU A;  3HHH A;  4KIC A;  5HS7 A;  4G7Z F;  1AOY A;  4O5V A;  1QZY A;  2GIV A;  2EWN A;  1BC7 C;  1FC3 A;  2QWW A;  2EK5 A;  3REO A;  3CDH A;  3G3Z A;  4LK0 F;  2WWY A;  2EA2 A;  1T98 A;  5JVT A;  1ZAR A;  5CVR A;  1T0F A;  4B09 A;  3F22 A;  1S6L A;  3LFK A;  5LBQ A;  2ADU A;  4RB3 C;  2D2W A;  1XDS A;  5JR3 A;  1SD4 A;  4M6Y A;  2MC3 A;  2YR2 A;  3DV8 A;  2EFQ A;  3QP5 A;  1XGS A;  2ZJ2 A;  1W7P D;  1GHC A;  2CQK A;  4P5O A;  4KIB A;  4I01 A;  4BYY A;  3T8R A;  3FM5 A;  2GZW A;  1Q1H A;  1ODD A;  2CO5 A;  4EGY A;  3OV8 A;  4HX4 A;  1F1Z A;  1O7F A;  4IPA A;  2K7L A;  4XSZ F;  1J7K A;  4YFK F;  4IRG A;  1U6G A;  1YW7 A;  4BHB A;  3E3V A;  2A69 F;  4AIH A;  2A5Y B;  3CUQ A;  1HXD A;  4M9S A;  1XDU A;  4OOI A;  4JK1 X;  4HAM A;  2PJP A;  4I09 A;  1H9G A;  2XKO A;  2FQ3 A;  2HYF A;  3FWE A;  5E1W A;  3TOA A;  3TO7 A;  3EQL F;  5J8F A;  3K1M A;  1V4R A;  4M73 A;  4HYE A;  4I2O A;  1ZRF A;  2ZME B;  2VBZ A;  4M72 A;  4QLC U;  4XLN F;  1QQI A;  2EFW A;  2KJB A;  5L3D A;  3HIF A;  4CXF A;  4UNO A;  2XUB A;  1O3T A;  1SD6 A;  3F8F A;  2D45 A;  1BIA A;  4LFU A;  2GWR A;  3MZY A;  2FNP A;  3SZT A;  4Q47 A;  4KIF A;  3ZMU A;  2NNN A;  4LJZ F;  3K0L A;  2W84 A;  3HRM A;  1QGP A;  4A5N A;  2P7C B;  4L9J A;  1XSV A;  1HST A;  4ZYE A;  2KIU A;  2CW0 F;  1LDD A;  4ON0 A;  2W24 A;  2QUF A;  3ZQ7 A;  3EYI A;  4A2U A;  4EMS A;  3LQQ A;  3F23 A;  4IVN A;  1P2F A;  2GA1 A;  4HLX A;  3E97 A;  3WU0 A;  4NQW A;  3QP6 A;  3R60 A;  1SFX A;  2DAO A;  1FP2 A;  1HW1 A;  2IA2 A;  5CVV A;  3DPL C;  2K86 A;  5L3F A;  2BV6 A;  5FFZ A;  2DO7 A;  4EV0 A;  4N9H A;  2E1C A;  2JZY A;  5E8I A;  1ZLK A;  2GAU A;  2NNY A;  1CF7 A;  1KYW A;  2P5L C;  1T38 A;  4MHG A;  3DXJ F;  2G9W A;  3OOP A;  1ZYR F;  2BE5 F;  2H94 A;  4L0Z B;  5H6R A;  4LG0 B;  2F5C A;  1WKM A;  4ENM A;  2FRH A;  4HF0 A;  3KZY A;  3U9G A;  4OIR F;  2H09 A;  4WXD A;  1HSJ A;  4ZYH A;  3V7S A;  2LNB A;  1IN8 A;  1KU3 A;  2M30 A;  2ETH A;  1IZ1 A;  3HUG A;  3BY6 A;  1ZRD A;  1KU9 A;  3GUD A;  2ACJ A;  4L5J A;  4G9Y A;  3J7A O;  2R3S A;  3M8E A;  2FEZ A;  5D6F A;  1J5Y A;  1LNW A;  3GFL A;  1MJA A;  1W7P B;  3RIR A;  4U7B A;  1BM9 A;  1OYW A;  2PG4 A;  5IT9 Z;  1FSH A;  4BH9 A;  3O3K A;  3RPU A;  4KT5 C;  3P9I A;  1SD7 A;  1QBJ A;  5LGU A;  1XGN A;  2GQQ A;  1IXR C;  2RN7 A;  2DW4 A;  5A2Q K;  1S8N A;  2VT3 A;  1KYZ A;  2EFP A;  2ISZ A;  1S3J A;  3KEQ A;  4A0X A;  3CLO A;  3GF2 A;  5DV5 A;  2CGP A;  3MZH A;  1HBX G;  3SQN A;  3F8N A;  3RDI A;  3RKY A;  5BMZ A;  1YIO A;  5E8G A;  5ILV A;  2L01 A;  1XD7 A;  2FOK A;  1ON2 A;  3WE2 A;  2PN6 A;  1U8R A;  3PQJ A;  4N9I A;  3KCC A;  4L9N A;  1TW2 A;  1MJ9 A;  3KP5 A;  3TGN A;  3I4P A;  2EB7 A;  2P8T A;  1XN7 A;  2DBB A;  3WTS C;  1IUY A;  1OKR A;  5LHG A;  3WTZ A;  1U78 A;  3CUQ C;  1IN7 A;  4KN7 X;  3HOS A;  3L09 A;  5HDK A;  4ZZL A;  4WK8 F;  2V1D A;  3GZ5 A;  1R36 A;  5ICC A;  2KIF A;  2JPB A;  4RB0 A;  1DP7 P;  3F8M A;  4BNC A;  1L3L A;  1R1U A;  4ASN A;  5ICE A;  4HF2 A;  1FLI A;  4UV8 A;  3KFW X;  1Z9C A;  1TNT A;  4GCV A;  1K78 A;  2W57 A;  2RQP A;  4G6D A;  2FE3 A;  2W25 A;  4ENJ A;  5DUK A;  4L18 B;  2XAH A;  2Z5U A;  3I59 A;  2EV0 A;  4FX0 A;  3DEU A;  2OAZ A;  3K1N A;  3L9F A;  1UCR A;  4HX7 A;  4MNU A;  3HOT A;  4DNC A;  1Z7U A;  2VOO A;  2J5O A;  1SAX A;  2XAQ A;  4RAZ A;  4UXN A;  1EV7 A;  1P92 A;  2COM A;  2VXZ A;  1ZG3 A;  2XAG A;  4S04 A;  3N97 A;  2EFN A;  3WGG A;  4HV6 A;  2LF8 A;  3ZMT A;  2KRF A;  1GXQ A;  1K7A A;  4HW0 A;  3IHU A;  5L3B A;  1Z1D A;  1B59 A;  4FHT A;  3TDU C;  3HSE A;  5DD4 A;  2QEN A;  5D8L B;  3ZP5 A;  5K5Q A;  5A2Q Z;  1BIB A;  3ROU A;  2O0Y A;  3E5X A;  1Z6R A;  2YPR A;  2D1H A;  5D5X B;  2LF7 A;  3I0T A;  4FT8 A;  3WTU C;  3EET A;  3H3Z A;  3WG9 A;  2KIM A;  3ULQ B;  1HQC A;  1P4X A;  3QOP A;  2GA2 A;  2LDU A;  3BDD A;  3MFK A;  3IWF A;  1B9M A;  1TQM A;  1G6N A;  4YFN F;  4IRH A;  1ZRE A;  5FB2 A;  3IRR A;  4L9V A;  3DQV C;  3E6M A;  4ESB A;  4CO8 A;  2WC2 A;  2QM3 A;  4P55 A;  2ZBK A;  5LRS A;  3FM3 A;  5KVR A;  3S2W A;  3ZMV A;  4WX9 A;  3E5U A;  2HS5 A;  1ZHF A;  2EV6 A;  3TQN A;  3L2C A;  1IN6 A;  3WTW C;  3TO9 A;  1REP C;  1Z6T A;  5E17 F;  3KP3 A;  4UVA A;  4RS8 A;  2JTV A;  4A0Z A;  3ZN0 A;  5BS6 A;  3NEU A;  3M9A A;  4LLG F;  3CJN A;  3VFZ A;  2JT1 A;  1YG2 A;  2VE8 A;  3LWF A;  1QPM A;  2QBY B;  3R0A A;  1FBU A;  2IJL A;  2H6B A;  4EM2 A;  1WI9 A;  2CYY A;  2L4M A;  1JHH A;  2Z9O A;  2LSO A;  1R1T A;  4UV9 A;  3I54 A;  2JPC A;  2GXG A;  4R1H A;  1TQP A;  2E1N A;  1HW5 A;  1EH6 A;  1R7J A;  1GVJ A;  4M71 A;  4XSX F;  1R22 A;  1KU2 A;  1W7P A;  4I0B A;  4IRI A;  3RYP A;  3JTH A;  5AIP A;  2P6T A;  5DD8 A;  3LA7 A;  2XHK A;  1DDN A;  3VOE A;  5J8C A;  3VEP A;  3QU6 A;  3QAH A;  2FMY A;  4WXH A;  3HRT A;  3F21 A;  2KJC A;  4MEY F;  1AWC A;  2EFO A;  5CYV A;  3J81 Z;  1XCB A;  3NQO A;  1IW7 F;  4LLL A;  2HGC A;  3J80 Z;  2MH9 A;  3IRQ A;  1KQ9 A;  2Y48 A;  3V8J A;  2R7F A;  2M45 A;  1Z05 A;  3I53 A;  2OZU A;  2ZFW A;  1TTY A;  1RUO A;  1FNN A;  3T5X A;  4JQF A;  4M6X A;  4AVP A;  4E70 A;  1I1G A;  3IWZ A;  3DPT A;  3P9C A;  4ZYD A;  2STW A;  4LB5 A;  2XAJ A;  4EM0 B;  2G7H A;  3CTA A;  5FLX K;  1SMT A;  4MEX F;  1OMI A;  3ABT A;  1XGO A;  3FHZ A;  3FMS A;  1MDM B;  3V7R A;  1ZG5 A;  4Q48 A;  3TOB A;  2V1X A;  3L7W A;  2STT A;  1K79 A;  3R6S A;  1R5G A;  1FX7 A;  1V3F A;  1KQ8 A;  2K4B A;  4EM1 A;  4O6J A;  5CVI A;  1FY7 A;  3N4M A;  5BPI A;  3C3W A;  3K2Z A;  4P9U A;  2XIG A;  4U88 A;  4EJU A;  2F2E A;  2XAS A;  3FX3 A;  4MTD A;  1F9N A;  2GXB A;  1ONV A;  4MQ9 F;  4R79 A;  4Q4Z F;  3PFI A;  2PMH A;  1FYL A;  4IHT A;  1XSD A;  1SMY F;  3GWZ A;  1KA8 A;  2V1U A;  1UHM A;  3QPT A;  4R8H A;  2VE9 A;  4XLP F;  1U5T A;  3E6D A;  4U7D A;  1FPQ A;  5ICG A;  5ED4 A;  4Z2Y A;  3DP7 A;  6PAX A;  3GFM A;  3SFZ A;  5LGN A;  2YU3 A;  2DI3 A;  3BJA A;  4RGR A;  2HR3 A;  2D1V A;  3K1P A;  3MQ0 A;  1BI2 A;  2CSO A;  5HLG A;  4FX4 A;  1MJB A;  4PGH A;  2RVC A;  2VOD A;  4PCQ A;  5IT3 A;  3KE2 A;  2VBY A;  1U5T C;  1J59 A;  1XB4 A;  1GXP A;  4HLY A;  3P9K A;  1LDJ A;  1D8K A;  4L9T A;  5AIQ A;  3GFI A;  4EVI A;  3T1B A;  1BJA A;  2HWV A;  1IN4 A;  3P7N A;  2Q0O A;  2C6Y A;  2AS5 F;  2QYO A;  4NHJ A;  3R4K A;  3VOD A;  4D0P A;  1G3T A;  1Z91 A;  2PQ8 A;  1Y0U A;  2DLL A;  1H9T A;  3L00 A;  5HS9 A;  1MGT A;  4I0A A;  1D3Y A;  4LG0 A;  5D5W B;  3ML6 A;  2M8E A;  3U1D A;  3QPH A;  4A5M A;  4RGU A;  3K69 A;  3GFJ A;  2HFH A;  5FD6 A;  3RPQ A;  1R5H A;  4G7H F;  4GYG A;  5K5O A;  5CVJ A;  1S29 A;  2BYV E;  3RKW A;  2W85 A;  3AAF A;  3Q9S A;  4BHC A;  1ON1 A;  5TRD A;  2XRN A;  5ERI A;  3BZ6 A;  2KKO A;  1IRF A;  3HSR A;  3WOD F;  1MZB A;  2O8X A;  1F4K A;  3V4G A;  4UUV A;  4IJA A;  3GO5 A;  1R00 A;  4UVC A;  2QQB A;  3R0J A;  2QBY A;  2OU2 A;  3RI4 A;  4EJT A;  5JFR A;  2BEO A;  2P4W A;  3EDP A;  1JHF A;  4PGG A;  4KYW A;  1R1V A;  3ELK A;  1I5Z A;  5H6Q A;  1ZG1 A;  1U2W A;  2PLY A;  5TJJ A;  1ZLJ A;  2RDP A;  4BQA A;  1RI7 A;  4AIK A;  3ZN1 A;  3E6B A;  1XSX A;  3BRO A;  2PI0 A;  4KIG A;  1O3S A;  5DCM A;  1L0O C;  5F1R A;  1G3W A;  1IAW A;  4G94 A;  1FYK A;  2IT0 A;  4S05 A;  2DQR A;  2XAF A;  3MCZ A;  3KP7 A;  1W4M A;  5CVU A;  1O3R A;  2NYX A;  1O57 A;  4HV5 A;  4A6E A;  1JGS A;  1LEA A;  3ERE D;  2FBK A;  1KU7 A;  1UB9 A;  2EA4 A;  2MBF A;  4GO1 A;  3FXQ A;  3F8B A;  1EH7 A;  2HQN A;  5H20 A;  5K1Y A;  5J6X A;  3I59 B;  2B0L A;  3E6C C;  3KLO A;  4L0Y B;  2M5W A;  5HLI A;  4YII A;  5FGM A;  2E7W A;  3CUO A;  4HDU A;  5E1Z B;  2NAZ A;  4CIC A;  4WF2 A;  2QZ8 A;  4LMY A;  4UVB A;  2YX7 A;  5F64 A;  2VC1 A;  4AIJ A;  4MQV A;  1PUE E;  2ZME A;  2BGC A;  3WGI A;  3LA2 A;  2CWE A;  3FMR A;  5FD5 A;  3WE3 A;  3JW4 A;  2HEO A;  2VBX A;  3LST A;  4OMY A;  3FMQ A;  1TNS A;  4ENN A;  3BP8 A;  1DPR A;  2V6C A;  2XRO A;  1J0R A;  3KZZ A;  4HOB A;  4P96 A;  1B9N A;  1IF1 A;  1EH8 A;  1XMA A;  4NB5 A;  2L02 A;  3JSP A;  1XMK A;  4OIQ F;  4EJO A;  3JSO A;  4OIN F;  2MLK A;  1S7O A;  5K5R A;  4P9F A;  2HYG D;  1E17 A;  2BBY A;  4U0Y A;  1TLH B;  1CGP A;  1D5V A;  1U3E M;  3KP4 A;  4PZJ A;  2P6S A;  1ZGA A;  2E7X A;  3M1E A;  3JTG A;  3H3U A;  1ZN2 A;  1FOK A;  2A3S A;  3I5U A;  3ISP A;  4XBF A;  4KMU X;  2OA4 A;  4PDK A;  1RZ4 A;  1WQ2 A;  1WSU A;  4WWC A;  3I64 A;  4TV7 A;  2A68 F;  2L4A A;  1ZGJ A;  2K27 A;  3HYI A;  2NRA C;  1S7A A;  4A6D A;  4GXO A;  2DPD A;  4YIF A;  1FBQ A;  3F6V A;  4Q5S F;  1IRG A;  2VBW A;  2CG4 A;  3F3X A;  1CF7 B;  3W6J B;  1YW8 A;  3ZMS A;  2UXX A;  3ECO A;  4CYD A;  3JAM K;  1BN5 A;  3D5L A;  4I98 B;  2L54 A;  2ZNY A;  4BXU A;  3WTY C;  1H0M A;  3ECH A;  2Q2E A;  2R7D A;  2RC4 A;  1HKQ A;  4HX8 A;  2HZT A;  5JHU A;  4M74 A;  1YS7 A;  1OYI A;  2O3F A;  3Q5F A;  5D5V B;  1R23 A;  3J81 K;  1A04 A;  4HDV A;  2IVM A;  4IHS A;  4YG2 F;  1FWZ A;  1BI1 A;  1BI3 A;  4N0B A;  4EJW A;  4HQM A;  5IT9 K;  4A12 A;  2HQR A;  1YW9 A;  3BPV A;  2HKX A;  1P6R A;  3O2P E;  1IN5 A;  3IKV A;  1DPU A;  3QRF F;  4IF4 A;  5LRR A;  3I71 A;  5CJ9 A;  3D0S A;  2DK5 A;  3W6K B;  1T39 A;  4LLN A;  1LDK B;  2IA0 A;  1E2X A;  3V8K A;  2OD5 A;  2H27 A;  1HW2 A;  1RNL A;  4K2E A;  5BQT A;  5L3G A;  3BJO A;  5FFX A;  2OQG A;  3TKY A;  2XVC A;  4ZH4 F;  1YTY A;  2A6H F;  3GLX A;  3PQK A;  4KUM A;  3HHG A;  5ICF A;  1O3Q A;  3CO6 C;  2RV8 A;  3KEO A;  2DU9 A;  3B73 A;  1ZH5 A;  1K78 B;  1O7L A;  2IPQ X;  1SFU A;  1U5T B;  2DTR A;  5D4S A;  4MGR A;  1I27 A;  3MWM A;  3V8L A;  1G4D A;  4HZF A;  5F6F A;  4EJV A;  2FML A;  2F5D A;  4F7Z A;  3T8T A;  2M1B A;  2M87 A;  3M7G A;  2A61 A;  5LEJ A;  3KP6 A;  1QZZ A;  3O6B B;  3QU3 A;  1JE8 A;  4ZYG A;  3MAJ A;  1B1B A;  1QO0 D;  5E1X A;  3Q9V A;  2FXA A;  2OBP A;  1JXS A;  2ZKZ A;  1OYY A;  1SD5 A;  1WRJ A;  5D8K B;  5DUI A;  3RYR A;  2DQL A;  4OMZ A;  4IXA A;  2QQA A;  2RNJ A;  3GX4 X;  2FU4 A;  2P5K A;  1P4W A;  1YS6 A;  2DT5 A;  1B4A A;  2Z33 A;  4UHT A;  1W5T A;  4I7H A;  3KET A;  1FBS A;  5D5U B;  2UZK A;  2FA5 A;  4M9Z A;  3T0Y A;  1MKM A;  4HBL A;  2X4H A;  2PMU A;  3RKX A;  2UXN A;  4LGW A;  3ZMD A;  2FBH A;  4G7O F;  5FO5 A;  1R58 A;  1YFH A;  2FNA A;  2X0L A;  4Y17 A;  5DEQ A;  1YO5 C;  3LAP A;  5HDN A;  1TBX A;  2ZNZ A;  1P4A A;  3GW2 A;  2HKO A;  1X3U A;  2Y75 A;  1G3Y A;  1LJ9 A;  1SFE A;  3DF8 A;  3HRU A;  2ELH A;  1HKT A;  3BJ6 A;  3EUH A;  2EV5 A;  1PP8 F;  5ILU A;  5HDG A;  3EYY A;  1G3S A;  2QLZ A;  5DDG A;  2LKP A;  4HA8 A;  4LK1 F;  4KDP A;  2P5V A;  3F6O A;  3LA3 A;  2YX4 A;  4ESF A;  1K6O A;  1T6S A;  3CUQ B;  2FF4 A;  3C1D A;  5L3C A;  2VN2 A;  2O6G E;  2MA3 A;  4WCG A;  2XKP A;  2IP2 A;  3R61 A;  3GYH X;  2FSW A;  5ILS A;  5LLQ A;  2H6C A;  1D8J A;  4G8X A;  3WTX C;  1BBY A;  2ESH A;  3F72 A;  4H0E A;  2F5E A;  2ZCW A;  5LHI A;  2UWM A;  4AWX B;  3JAM Z;  2AXL A;  5DYM A;  1J75 A;  2K02 A;  3BOQ A;  4RGS A;  1UHW A;  1DUX C;  2PFB A;  2MLG A;  2HTS A;  1LB2 A;  1USS A;  1TQI A;  4YFX F;  2Z3Y A;  3K9T A;  3WTT C;  1T2K A;  1TW3 A;  5FLX Z;  4MTE A;  1RUN A;  4O3M A;  5LHH A;  3FZV A;  2F5F A;  1ZRC A;  1BOA A;  4BHP A;  1ULY A;  2DPU A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...