1NHAA

Solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor IIF, alpha subunit
publication title Solution Structure of the Carboxyl-Terminal Domain of RAP74 and NMR Characterization of the FCP1-Binding Sites of RAP74 and Human TFIIB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1nhaA00
5ED4A 4EJTA 1IXCA 1O57A 2XAFA 1HQCA 1W7PB 5ICFA 2DK5A 4GO1A 3TO7A 1K78B 4UVBA 5D4SA 3GZ5A 4A6DA 2L54A 6PAXA 2LNBA 2E7XA 1SD4A 2EFNA 2B0LA 4IXAA 1FOKA 3IRQA 1D8KA 4A0YA 2G7HA 1IF1A 1YW8A 4OIQF 1OYIA 5BMZA 4LB5A 4HX8A 3TKYA 3GEZA 4A0ZA 1YFHA 4BNCA 1I1SA 3H3UA 1BC8C 2Q2EA 2P6TA 1S3JA 1P4AA 2D1HA 1R1TA 5LGNA 1TW2A 2M30A 3EQLF 4PGHA 4I0AA 1XGSA 2M8EA 3G3ZA 4PZJA 2IRFG 4M6XA 5IT3A 5ILVA 1ZYRF 2DFIA 2V9VA 4AIKA 1O7FA 3HSEA 2HFHA 3RKWA 4R1HA 4XRFA 1K79A 2PMHA 1FBSA 1P6RA 2MLGA 3V8LA 4I02A 1YTYA 3ABTA 3ZMUA 5DYMA 3GFJA 4ZYGA 3F8NA 3IKVA 3MQ0A 3RTRA 4ENJA 1T39A 1CGPA 4L18B 2QM3A 2VE8A 1BI1A 1G3WA 1CF7B 2ZKZA 3R61A 2EV5A 5IT9Z 4ZYDA 1KU9A 4EJWA 4L5JA 3MAJA 3I53A 1ZN2A 3BWGA 1SAXA 2Y48A 2PI0A 3HRSA 3LA7A 1I5ZA 2QENA 2G7UA 2PG4A 3GWZA 1WKMA 2W85A 3RYPA 2HOEA 2FU4A 3K1NA 4WF2A 4HLXA 1U3EM 1LQ1A 4KNYA 3HRTA 1P2FA 4HA8A 5J8FA 3F21A 2NYXA 1L0OC 2KIFA 2XIGA 3IHUA 1TQPA 2DLLA 4I7HA 3R0JA 1HSTA 1HBXG 4LLGF 3MZYA 4AD9A 1QPMA 3OV8A 3WTWC 1BC7C 5FO5A 3H92A 1FZPB 2O61A 2A07F 5BQTA 2DK8A 3FXQA 4CHUA 5BPIA 2HR3A 3CDHA 5L3BA 1S7OA 4L9VA 5L3FA 2FMLA 3LSTA 2OBPA 1XCVA 2V1XA 4S05A 4A2UA 4Q47A 3RI4A 1REPC 1XDUA 1XD7A 1FWZA 1KU2A 2FRHA 4NB5A 5JHUA 3V8JA 3QU3A 4B09A 5D6FA 2STTA 1Z7UA 2IP2A 3R60A 3WE2A 3MZHA 3TOAA 3KCCA 3V7SA 1B1BA 1BBYA 2P6SA 4NHJA 3DFGA 5F6FA 2Z99A 4RAZA 3TDZC 5BPDA 4U7DA 2DT5A 2LDUA 4HLYA 2RKHA 4IF4A 2D1VA 3QPTA 3CO7C 4RGXA 4EGZA 3JSPA 4N9HA 2W25A 1PP7U 3EYYA 3BPXA 2QQ9A 4EVIA 1LNWA 4RB2C 5BS6A 2IVMA 4JQFA 4LMYA 1XSXA 2E1NA 1IN4A 5JFRA 3LQRA 4IPAA 3IKTA 3WGHA 2O0YA 1ONVA 1LVAA 4HDUA 2H6CA 2A6HF 2W24A 1DP7P 5DCMB 2EV6A 2ZMEA 4A0XA 5F64A 4P55A 1Z9CA 4U0VA 2XHKA 3T5XA 1GHCA 1B4AA 1LEBA 2VXZA 4HQEA 2ESHA 4EMSA 2IJLA 4G7OF 3Q9SA 2ISYA 4KUMA 1G4DA 3L2CA 1KU3A 5E18F 4LG0A 3J80K 2FBIA 5LGUA 3I54A 2K02A 1EH7A 1W5SA 5FFZA 1I6XA 1R58A 3DEUA 5E1XA 5D8KB 3KETA 5H6RA 3IWZA 1O3SA 5HDKA 1H0MA 1D8JA 1U5TB 4XSZF 1HW5A 1YLFA 2H94A 5A2QK 3ZMTA 2FSWA 5TJJA 5DCFA 1ZH5A 4QLCU 3V4GA 4RGRA 1HW2A 2A68F 3IRRA 2LKPA 3H3ZA 2OZ6A 2BYVE 4XBFA 3T8RA 2YX4A 2CW0F 4P9FA 4U7BA 1D3YA 2CG4A 2IA2A 2EFOA 2QBYB 3M7GA 4LK1F 4TV7A 3TOBA 4Y17A 3E5XA 3W6JB 1SD5A 4Z2YA 1ZLJA 3WGIA 3RPUA 5E8IA 1ZARA 3P9CA 3ZMDA 3SZTA 3NEUA 4R79A 2BV6A 4S04A 5H6QA 4G6QA 3SXYA 3BOQA 4IRIA 1YQAA 1BOAA 4HDVA 5D5VB 3F8FA 4UHTA 3F22A 1IXRC 2FEZA 2VC1A 3WGGA 5CLSA 5FB2A 4ESBA 2HKXA 4A6EA 4CDGA 3L7WA 4PDKA 3LFKA 4EM0B 4OIPF 3HTUA 4Q5SF 3FX3A 5DEQA 3I0TA 3GXOA 1H9TA 1PUEE 1QGPA 2KIMA 1O7LA 2FNAA 1IN7A 2XUBA 3I4PA 3L00A 2TDXA 1FLIA 2IPQX 1MDMA 4KA4A 1TW3A 2BE5F 3CLOA 5CYVA 2VONA 4ENNA 2K4BA 2EK5A 2ESNA 1F1ZA 3HHGA 5LEKA 2GZWA 3ELKA 3F8BA 2CYYA 2PBIA 2UWMA 2HQNA 1FBUA 3ULQB 1ODDA 1IN5A 1MZBA 4KDPA 2JSCA 4U0YA 2DAOA 5ICGA 3GFIA 3DV8A 2P5KA 3HRUA 4M9XA 4MHGA 3J81K 1VTNC 2A3SA 4P9UA 2LSOA 4HV5A 3KP2A 3KE2A 3O2PE 3QU6A 3E6CC 1K78A 4Y13A 5J6XA 3M8FA 4HF0A 3JSOA 3HTSB 3HRMA 2ZO4A 2K86A 2J5PA 2ZBKA 1E17A 3EUHA 5AIQA 4BAYA 3TGNA 3GFLA 3ZQ7A 5CVIA 2JRTA 1QZYA 2MH2A 1MJAA 2DU9A 2VC0A 1IRGA 5HLHA 2WC2A 1R7JA 4G94A 3SZPA 1OKRA 1R00A 4EJVA 1LB2A 4KYWA 4GYGA 2IA0A 5J8CA 1EV7A 3HOSA 3U9GA 3GW2A 2PJPA 2F5CA 3KP7A 1TNTA 3WTVC 2OU2A 1J75A 1FX7A 5LHHA 1OPCA 3CTAA 1WWXA 2M1BA 2Q0OA 3K9TA 1QBJA 2OAZA 1S6LA 4HAMA 3RKXA 2M5WA 5HVQC 4BYYA 2A6EF 4U88A 2VBXA 4WXHA 3BPVA 3I5UA 3K69A 3KEOA 2F5DA 3WG9A 1CF7A 2C6YA 4IJAA 3CO6C 3HSRA 4Y15A 4LLNA 2MH9A 1ULYA 2K4JA 2ZNZA 5L3DA 4UVAA 1LDDA 3ZMSA 4EM2A 1FNNA 5D5UB 2EFWA 3LWFA 4M73A 2OZUA 4LGWA 3VOEA 3FXUA 3IC7A 5K5OA 2EFQA 4IHTA 4F7ZA 5AIPA 5LHIA 1V3FA 1BN5A 1SFEA 3KZZA 3N97A 2VOPA 1WSUA 4L0YB 1YG2A 3JTHA 5HDNA 2QYOA 2OD5A 2DPUA 2VBWA 1TQIA 3L9FA 5D8LB 4ZH4F 3FM5A 5LEJA 1IN6A 1SD7A 1F5TA 1KU7A 4E70A 2EJRA 1QQIA 3E6MA 1SMYF 2MA3A 3HHHA 2QQBA 2EV0A 1MKMA 2UZKA 2E1CA 1JHFA 2PFBA 4GGGA 3VEPA 2ZCWA 4AIHA 4KN4X 3LAJA 1SFUA 4UV8A 4OMYA 3DPTA 2DW4A 3E5QA 4N9IA 4UV9A 1BIBA 2CSOA 3I58A 4RAYA 2VE9A 2G9WA 3EETA 2LF7A 2RVCA 4L0ZB 2A61A 2EFPA 3WTUC 3HYIA 3ZPLA 1IW7F 3L09A 3ZMZA 1TNSA 2KRFA 1H9GA 2HKOA 2OQGA 2X0LA 3RJPA 4XLNF 4EM1A 4L5IA 5BOXA 3FZVA 1UFMA 1WQ2A 4HBLA 1JHHA 3GFMA 4EQQA 4O5VA 4CO8A 2ZFWA 3GVAA 4FX4A 4M71A 2QWWA 5L3CA 3AAFA 4PCQA 3M1EA 4ZZLA 1PDNC 3WE3A 1L3LA 3D5LA 3BJ6A 1U8RA 1IRFA 5DUIA 2V1UA 5FD5A 2LF8A 3ZP5A 3K2ZA 2MC3A 4GCVA 1FY7A 5DCMA 4EV0A 1HXDA 1YW9A 3CUQA 2RGVA 1HKSA 2YSRA 1HKQA 5LRSA 4MNUA 4OIRF 3ROUA 4G6DA 1S8NA 3KP4A 4YG2F 1ZGJA 4RGSA 3ECOA 3GYHX 2P7CB 5HS8A 3RKYA 3J7AO 1XGMA 3WTTC 2L4MA 2P5LC 1UHWA 4YFXF 5JR3A 1U5TA 4BH9A 1MGTA 1XMKA 3BJAA 3F8CA 4ZZDA 2GAUA 3ZN1A 2H6BA 4OIOF 1RIOH 3FM3A 4OOIA 3QRFF 3U2RA 2ZXJA 2K27A 1BIAA 1BI2A 1XGNA 1R1UA 4MGRA 5FD6A 1G6NA 5EEHA 3KZYA 1KQ9A 4EJUA 4LLLA 4KFCA 3MEXA 5DDGA 2DPDA 2CWEA 1YYVA 1G3TA 4JK1X 2NRAC 4WXDA 3ML6A 1BI3A 4HX4A 1O3QA 4UNOA 2HTJA 5HS9A 1ZG5A 4NQWA 4MEXF 4U0WA 1BI0A 1TQMA 1DPUA 3QP6A 3BP8A 2YX7A 1F4KA 4YIFA 5L3GA 1XSVA 4ON0A 4HYEA 1IN8A 2XAHA 2D2WA 5L3EA 3DPLC 5HOOA 2V79A 4LG0B 2YPRA 3CJNA 5E20A 4L9TA 3KP5A 3LAPA 4IHSA 3U1DA 2O6GE 2HQRA 2P5VA 2VBZA 2P4WA 2E7WA 4HV6A 2XAQA 2PLYA 2HEOA 1LDKB 2XKPA 4UXNA 2F5FA 2O03A 1GVJA 3TDUC 1KYWA 4FX0A 3NQOA 4L9NA 4UUVA 3J80Z 1QO0D 3K0LA 1WRJA 1RUOA 3WTXC 2DO7A 1KYZA 3KP6A 3ERED 2CFXA 2Q8KA 5FLXK 2JZYA 1USTA 4Q4ZF 4BXUA 2GWRA 4MQVA 1DDNA 4XSXF 3KLOA 2ETHA 3EYIA 2JPCA 3ABUA 3JAMK 1UHMA 3WU1B 2Y75A 5A2QZ 5K1YA 5DUKA 4LK0F 4KIGA 2QVOA 1P4XA 1SMTA 4MEYF 4BHCA 4LFUA 5LRRA 1XGOA 1Z6RA 1SFXA 5EEGA 2ISZA 2KJBA 4ESFA 2DQRA 1G3YA 4OINF 1GXPA 1W4MA 2H09A 1FSHA 3KFWX 5JI6A 3KEQA 3REOA 3F6OA 4A5NA 3C18A 3QAHA 4FHTA 3TQNA 3R6SA 3M9AA 2NNYA 2Z5UA 5E8GA 2DTRA 2J5OA 1BM9A 1U6GA 2IA1A 2RDPA 2FQ3A 2OA4A 3VB2A 2DBBA 1W7PA 4LB6B 1TTYA 1XCBA 5CVVA 3JTGA 1JXSA 1DUXC 3HIFA 1LDJA 2YU3A 2ACJA 3T0YA 1Z6TA 1FT9A 1G3SA 1C0WA 1AOYA 1OYYA 4WWCA 1D5VA 3MCZA 2AS5F 4ASNA 1Y0UA 2HYFA 3I59B 4OMZA 3CUOA 2VOOA 3O3KA 3ECHA 4A5MA 1FYLA 2BEOA 3VODA 3TO9A 2WWYA 4CXFA 2QZ8A 3RIRA 3P9IA 3K1PA 5E17F 3S2WA 2FNPA 5DD8A 4G9YA 3FMQA 1IUYA 3KP3A 3LQQA 5ERIA 1RNLA 1DPRA 2WV0A 5AONA 4PGGA 5IT9K 1Q1HA 1P92A 1ZG1A 5HLGA 5E1ZB 4H0EA 1T38A 2VT2A 2A5YB 1XMAA 2KIUA 2FF4A 2FMYA 2NAZA 3J81Z 3E6BA 2JT1A 2AXLA 2O3FA 3E5UA 3F3XA 1AWCA 5LLQA 2COMA 3WU0A 1P4WA 5CVRA 4KMFA 2QQAA 1T0FA 1K6OA 2Z3YA 2GXBA 3E3VA 2FE3A 1X3UA 1R1VA 3MWMA 3WTSC 1A04A 1MD0A 5HS7A 2QLZA 2W84A 2NNNA 1PP8F 1TLHB 2FBKA 2MLKA 4LJZF 4DNCA 1J0RA 1U2WA 1QZZA 3FF5A 3BDDA 1EH8A 2FA5A 2RQPA 3I64A 4HOBA 1W5TA 4GYIA 4AWXB 3ISPA 5E1WA 5TRDA 4G8XA 2RV8A 1MJ9A 2XROA 4B8XA 4IRGA 1RZ4A 2CO5A 4L9JA 1XN7A 4N0BA 3WODF 3GX4X 2D45A 4JBAA 2HWVA 1GXQA 2M45A 1Z05A 2M87A 3DP7A 1S7AA 1FC3A 3FMSA 2VN2A 4DQ2A 1HSJA 2F5EA 4P5OA 3QP5A 4ENKA 4A12A 4I98B 3SQNA 2OQRA 3GUDA 4RS8A 3DXJF 2GIVA 4ENMA 1XDSA 1YO5C 3B02A 1ZAOA 4HX7A 1XSDA 4ETSA 3WTZA 2L01A 4P96A 1ZRDA 1S29A 1MJBA 4MTEA 5H20A 5D5XB 4R8HA 1J9IA 1W7PD 3DF8A 1T98A 4IVNA 4WK8F 3N4MA 2VT3A 1USSA 2XAGA 2PEXA 1TBXA 3M8EA 1YIOA 4QWQA 4K2EA 1HW1A 1I27A 4AVPA 1F9NA 3RDIA 3HSFA 4RB1A 3Q5FA 2VBYA 3V7RA 2FBHA 5ICEA 3FXRA 1I1GA 3F72A 3P9KA 5CVJA 3SFZA 3PQKA 2UXXA 2PMUA 4M9ZA 2Z33A 5DD4A 3PFIA 2H27A 4IRHA 3BJOA 1NHAA 1BJAA 1K7AA 5KK1A 1IAWA 4HZFA 2R3SA 3JW4A 4M9SA 4HQMA 1LEAA 2WTEA 1FYKA 3K1MA 2FOKA 3FWEA 2RNJA 4CZZA 3P7NA 1LJ9A 2XASA 2GQQA 4KIBA 1J5YA 4M72A 4Q48A 2JPBA 2XV4S 4O6JA 2O8XA 3F23A 1IZ1A 2XRNA 4YIIA 4EGYA 5KVRA 4ZYEA 3LA2A 3V7CA 1J7KA 3GF2A 3C7JA 1ZRCA 4I01A 1YS7A 2R7FA 2ZJ2A 1KQ0A 2A69F 3E97A 4WXCA 3Q9VA 2XVCA 1B6AA 3I71A 4HW0A 5FGMA 3T8TA 3CUQB 5F1RA 3FMRA 4MTDA 3DKWA 2X4HA 2DI3A 4BQAA 2HS5A 3ZMVA 4CGZA 4KN7X 2ELHA 2ADUA 1T6SA 1QNTA 3IL2A 2PQ8A 1ZRFA 2QBYA 4M74A 1Z1DA 2F2EA 2KKOA 3LA3A 1JGSA 2BGCA 3W6KB 1FSEA 1FP2A 1R36A 1T2KA 5FFXA 4CICA 1B9MA 3TO6A 2ZMEB 5K5RA 3OOPA 3GO5A 1KGSA 1ON1A 4KIFA 3ZN0A 3VFZA 1J59A 2VODA 1ON2A 3D0SA 3GZ6A 1V4RA 4KMUX 2W57A 2HDCA 2XKOA 2YR2A 2PN6A 5K5QA 3QPHA 3HOTA 4HF1A 2CGPA 2DQLA 3GLXA 1WI9A 4KICA 2Y0MA 5CJ9A 3V8KA 4G7ZF 2JTVA 1STZA 2IW5A 2RC4A 2XAJA 3R0AA 4RGUA 3RYRA 1B9NA 1ZHFA 4I09A 5ICCA 3T1BA 4ZYHA 3B73A 2MBFA 5D5WB 2IT0A 1E2XA 2MD5A 5HLIA 1HKTA 5JVTA 2HZTA 5D4RA 1KA8A 2V1DA 2HGCA 1B59A 3C3WA 2KJCA 3RPQA 1Z91A 4O3MA 4CYDA 4KT5C 1OYWA 4OU0A 3EDPA 2Z9OA 2EA4A 1R5GA 1RI7A 3E6DA 3DQVC 2STWA 2BBYA 2RN7A 1ZG3A 1FYMA 5HDGA 2HTSA 1FPQA 3O6BB 3SHFA 2K7LA 4I2OA 1R22A 1JE8A 3NRVA 4I0BA 5ILUA 2GXGA 2EB7A 1XB4A 4MQ9F 4GXOA 2HYGD 4WX9A 3BY6A 1ZREA 4HF2A 1O3RA 2CQKA 3CUQC 3PQJA 1KQ8A 1EH6A 3C1DA 3FHZA 1O3TA 1ZLKA 2EWNA 1U78A 2QUFA 4AIJA 3BZ6A 4FT8A 1R23A 3I59A 3MFKA 3G73A 4RB0A 2UXNA 4G7HF 4WCGA 4D0PA 3WTYC 1J2XA 1YS6A 5LGTA 1UB9A 5ILSA 4BHBA 1YW7A 4M6YA 1FP1D 5LHGA 4ESJA 2GA1A 2L3DA 5LBQA 1RUNA 1SD6A 3KLNA 1MDMB 1U5TC 2ZNYA 3COAC 4LD5A 2XGXA 4BHPA 5CVUA 1IXSB 4EJOA 5FLXZ 1UCRA 3BROA 2P8TA 4YFKF 1ZGAA 2FXAA 3JAMZ 2GA2A 1OR7A 1FBQA 5D6EA 1OMIA 2EA2A 2P7VB 3F6VA 2L02A 3R4KA 4YFNF 3HUGA 3QOPA 3IWFA 5DV5A 4XLPF 2V6CA 2L4AA 4UVCA 3F8MA 2NS0A 4RB3C 1R5HA 2R7DA
chains in the Genus database with same CATH superfamily
5ED4A 4EJTA 1IXCA 1O57A 5C4JJ 2L5QA 2A5WA 2CW7A 1D1AA 2XAFA 1GT0C 1HQCA 1W7PB 5ICFA 4DOZA 2DK5A 4GO1A 3TO7A 4CZCA 4UVBA 3G6EI 1K78B 3S14J 5D4SA 3GZ5A 3DU6A 4A6DA 2L54A 6PAXA 2LNBA 2E7XA 1SD4A 3MD2A 1Z7LA 2DFHA 1WPKA 2EFNA 2B0LA 2X6OA 3PIOF 4IXAA 1ETXA 3ASNH 1K6YA 4PFOA 1FOKA 3IRQA 1D8KA 3OYCA 1MNMC 4A0YA 4XN0A 4DJAA 3BTIA 2G7HA 2JN6A 1IF1A 3LSPA 1Y1WJ 1YW8A 4OIQF 1MH3A 1OYIA 2DT6A 5BMZA 4HX8A 4LB5A 2K9MA 1YX5A 3ZGKA 3TKYA 3S8PA 4BS9A 3W2AA 3AL0B 3GEZA 3HEFA 1OFCX 3S15J 4A0ZA 3JR9A 4HRIA 4IHXA 1YFHA 5K7HA 4BNCA 3HM5A 1KONA 1I1SA 3H3UA 1BC8C 2Q2EA 2LMDA 2P6TA 1S3JA 3NAUA 4CYCB 2G0EA 1P4AA 2VJ5A 2QKLB 3BR6A 1W0TA 2D1HA 5F08A 1RR7A 1CQTA 3ZCOA 1NG7A 1R1TA 5IOZA 5LGNA 3A01B 1TW2A 2M30A 3EQLF 2LREA 4PGHA 2LR8A 4I0AA 3O8GA 2JK3A 3L2WA 1XGSA 2M8EA 3G3ZA 4PZJA 1D1CA 3KIOA 3LSKA 3K10A 2IRFG 4ZYAA 1OCCH 3C2GA 2N8GA 2XC7A 2JRMA 2K9NA 4M6XA 4II3A 4PJNA 5IT3A 2DXIA 3CCQI 5ILVA 1ZYRF 2DFIA 2V9VA 3OL4A 3J7ZI 4AIKA 1O7FA 3HSEA 2HFHA 4CCLA 3RKWA 3PUFA 4R1HA 4XRFA 4I6ZA 1K79A 1M1EB 2PMHA 1FBSA 4IHWA 1P6RA 2MLGA 1TWGJ 3V8LA 3FKJA 2O9LA 5KAIC 4I02A 1YTYA 3ABTA 3ZMUA 5DYMA 3GFJA 4ZYGA 4G12A 3F8NA 1SVMA 3IKVA 3MQ0A 3RTRA 4ENJA 4XLAA 1S5LC 1T39A 1CGPA 4L18B 3HPGA 3ZQCA 2EIKH 2QM3A 2VE8A 1BI1A 5GPAA 5HNFA 1G3WA 4B43A 1CF7B 1QHHD 4NBQA 2ZKZA 2KDOA 3R61A 2EV5A 3L1PA 5IT9Z 4ZYDA 1KU9A 2LG4A 3D5SC 4EJWA 4L5JA 2E35A 3JRAA 3MAJA 3I53A 1ZN2A 3BWGA 1PJRA 1SAXA 2Y48A 2JA8J 1SC7A 2IXSA 2PI0A 3HRSA 2L0KA 3LA7A 1XS9A 1I5ZA 3E7LA 2QENA 3I3LA 4RBOA 3CD6I 1VQ8I 2G7UA 2PG4A 3GWZA 2OF7A 1WKMA 2VJIA 2W85A 3G1MA 1VQMI 1OCTC 3RYPA 2HOTA 2PX9A 2HOEA 2FU4A 3K1NA 4HEA2 4WF2A 1IG7A 3M3YJ 5JHFA 3ONQA 4HLXA 1U3EM 4JX5A 3CLQA 1LQ1A 3HRTA 4KNYA 2JMWA 3I56I 4J01A 2VPLA 1P2FA 4HA8A 1FMWA 2LKSA 5J8FA 2V6EA 3F21A 2NYXA 1L0OC 2KIFA 2XIGA 2ZXWH 2E34A 2JA7J 3IHUA 1TQPA 2LK2A 3ZQQA 2LH9A 2IAIA 3LSGA 5DM7F 2LOOA 3BTLA 2MGQA 5K7ZA 2IS6A 2DLLA 1IRZA 4I7HA 2H8WA 3R0JA 4E7ZA 2DDAA 1HSTA 1TC3C 3S1RJ 4M6VA 3BC8A 1HBXG 4LLGF 2GBYA 3MZYA 1A6QA 2IGNA 1Y0NA 4AD9A 1QPMA 3OV8A 3WTWC 3WU2C 1MMAA 5FO5A 3H92A 1BC7C 1FZPB 1P7JA 2M4KA 2WV1A 2E36A 2O61A 2BVLA 1N77A 5BQTA 2K85A 2A07F 2DK8A 3H0DA 2CU7A 2KQRA 1SAUA 1RC9A 3FXQA 4CHUA 5BPIA 4A3BJ 2HR3A 3CDHA 2DYSH 4QPQA 5L3BA 2ELKA 3AL0C 2DYRH 1S7OA 4L9VA 3DKXA 5L3FA 3L2VA 2FMLA 1TT5B 3LSTA 4UB6C 2OBPA 2R92J 4B3AA 1XCVA 2V1XA 4S05A 4A2UA 4Q47A 3A4CA 3K4LA 3BR5A 2RNGA 3RI4A 1REPC 1B8IA 1XDUA 3FISA 4RM2A 1XD7A 1FWZA 1KU2A 1BW6A 2VUMJ 2FRHA 4NB5A 5JHUA 2LVSA 3V8JA 3QU3A 1WI3A 4B09A 4PJLA 3OIPA 3K6GA 4IL6C 2ZFUA 5D6FA 2STTA 5J3LA 1Z7UA 3HGYA 1ZK8A 3SDGA 2DMNA 2IP2A 3FBIB 3R60A 3WE2A 3MZHA 3TOAA 2GLOA 1X4PA 3KCCA 3FXOA 3V7SA 1TL8A 4V19K 3L2UA 1B1BA 1BBYA 2P6SA 4NHJA 3DFGA 3AFHA 5F6FA 3F9KA 1NK2P 2K3PA 2WB1A 2Z99A 2IGOA 4RAZA 2DOFA 3TDZC 4U7DA 5BPDA 2DT5A 1ERDA 2EZHA 2LDUA 2JSPA 1E3PA 4IOCF 2LD5A 4HLYA 1MSEC 1BW5A 2RKHA 2HDDA 2OCEA 4IF4A 2D1VA 1YI2I 3QPTA 3CO7C 2DFFA 4RGXA 4EGZA 1T33A 4XKWA 3JSPA 1V5FA 3HKZA 4N9HA 2W25A 3FXJA 1PP7U 1ENHA 3EYYA 3S3MA 3P5JA 3BPXA 1D1BA 2QQ9A 4EVIA 2L7KA 1LNWA 4RB2C 4BBSJ 3VYUB 5BS6A 1V5EA 2IVMA 4JQFA 2EPFA 4LMYA 1TWHJ 1XSXA 2E1NA 1IN4A 5JFRA 2O5RA 2VKHA 3LQRA 4IPAA 2R7OA 3DLLF 3BR3A 5IPAA 3IKTA 3PJRA 4PJ0C 3WGHA 2CRGA 2O0YA 1ONVA 3FXKA 4MFDA 4AU7A 1T0FC 4MFEA 1FOXA 1LVAA 2K9QA 4PSXA 4HDUA 2H6CA 3QOEA 2A6HF 3CCUI 2W24A 1DP7P 1WJFA 5DCMB 1VNDA 4XL9A 2DJIA 3H5RA 3CCMI 2EV6A 2ZMEA 3BR2A 4ANJA 4A0XA 2ZJQF 5F64A 4P55A 4YEJA 3PM1A 1Z9CA 4U0VA 2XHKA 3T5XA 3PSIA 1GHCA 1NK3P 1B4AA 3O8HA 1LEBA 2VXZA 2QSFX 4HQEA 3RZOJ 1QVTA 2ESHA 4EMSA 3SEZA 3RKQA 1QVUA 3EPZA 2IJLA 4G7OF 3Q9SA 2ISYA 4KUMA 4XLHA 3RQ4A 5F1JA 1G4DA 3L2CA 1KU3A 4XM3A 5E18F 2CV0A 4LG0A 3J80K 1W36D 4FCYA 2FBIA 2LBFB 5EDNA 3OYKA 5LGUA 4IOAF 2RQQA 3I54A 2K02A 2F6CA 1EH7A 1W5SA 5FFZA 1I6XA 1R58A 2ZXHA 2CUZA 1JKPC 3DEUA 2D5VA 5E1XA 2AXTC 5D8KB 3KETA 3HPHA 5H6RA 2CH0A 3IWZA 3MMYB 1O3SA 2DOEA 5HDKA 2QQ8A 1RRJA 1ETKA 2BW3B 1H0MA 2QSGX 3CMYA 1D8JA 5JVGF 2XB5A 1U5TB 5J1YA 1OCPA 1XMXA 2VL8A 2ELJA 1K83J 4XSZF 1HW5A 1YLFA 1IV6A 2H94A 5A2QK 3HDDA 3ZMTA 2FSWA 3S32A 5TJJA 4XMYA 1HDDC 3J7AY 5DCFA 1ZH5A 4L5EA 2XRLA 4JYKA 4BKXA 4QLCU 1HF0A 3V4GA 2OUMA 4RGRA 2IGMA 4E7HA 1HW2A 2X51A 2A68F 2BXYA 3I55I 3IRRA 4DYCA 2K9SA 1EKEA 2LKPA 3H3ZA 2OZ6A 3OS0A 2BYVE 4XBFA 4E7IA 3T8RA 2YX4A 2CW0F 4P9FA 2YS9A 4U7BA 1D3YA 1X2NA 3CCEI 1GLNA 2CG4A 2IA2A 2EFOA 1OCRH 3M7GA 4LK1F 2QBYB 3ZQHA 4TV7A 4YELA 3TOBA 5FLMJ 4A3LJ 4Y17A 3E5XA 1W5CC 2NOGA 3W6JB 1SD5A 2NOJB 1U9OA 1R4MB 4Z2YA 1ZLJA 2LFBA 2ZXIA 3TL4X 4BE0A 3WGIA 1FJLA 2CV1A 3RPUA 5E8IA 5LD2C 1ZARA 3P9CA 1K61A 3ZMDA 1JJ6C 2I10A 4A3MJ 2K5CA 3G1LA 4XOPA 5GAHJ 3SZTA 3NEUA 2QGUA 4PFPA 4R79A 2BV6A 2WA0A 4HSRA 4S04A 5FKOA 5H6QA 2FX0A 1WJDA 4G6QA 3SXYA 3BOQA 4IRIA 1YQAA 1BOAA 3IP4B 4IHVA 2W82A 4CCOA 4HDVA 2Y0SA 2DN0A 5D5VB 2IS4A 3F8FA 4DYQA 2E2IJ 2WB1N 4UHTA 1ETQA 3F22A 1IXRC 3Q0WA 3H9GA 4HNUA 3K7AJ 2FEZA 1UHSA 3LFUA 3GTKJ 2VC1A 3WGGA 5CLSA 5FB2A 2JQ7A 4ESBA 2HKXA 4A6EA 4CDGA 2XAUA 4XKCA 3L7WA 1WZ2A 1AU7A 4PDKA 2VB6A 3LFKA 3LSIA 4EM0B 4OIPF 3CMMA 3HTUA 4XQFA 3AG2H 3KYLA 4Q5SF 3FX3A 5DEQA 3I0TA 3GXOA 1YITI 3ASOH 1H9TA 1QGPA 2KIMA 1LKXA 4DBRA 1PUEE 4A69C 1X58A 1O7LA 4M3FA 1IJWC 2CQQA 2FNAA 1MSFC 5FRNA 4U87A 1IN7A 2XUBA 3I4PA 2L7FP 3L00A 2TDXA 1FLIA 2IPQX 4IX7A 1MDMA 4KA4A 1TW3A 1MBFA 2BE5F 3CLOA 2WAEA 2HPIA 2DMTA 5CYVA 3WHBA 3LOCA 2VONA 4ENNA 2K4BA 2EK5A 3D5RC 4BL0B 2DA2A 1YIJI 3CCVI 3PNYA 4C2TA 2ESNA 5IYBJ 2X6WA 1F1ZA 3HHGA 5LEKA 2A05A 4QIWN 2GZWA 3ELKA 5CPRB 3A0HC 3A1YA 3OIQA 3ABKH 1Z3XA 3RCOA 4ZDLA 4F91B 3CP8A 3K4KA 2LTPA 3F8BA 2CYYA 1IO2A 2PBIA 2UWMA 3DTIA 1MMGA 3BCAA 2HQNA 2E19A 3FXLA 4XOTA 1R49A 1FBUA 3ULQB 1ODDA 1IN5A 1MZBA 2IBDA 2JSCA 5M5YJ 4KDPA 1I39A 4U0YA 2DAOA 5ICGA 3GFIA 3DV8A 5M5WJ 1H88C 3DEWA 2P5KA 3HRUA 2AQFA 4QPOA 4M9XA 4MHGA 5IP9J 3J81K 1VTNC 2A3SA 4P9UA 2LSOA 4HV5A 3KP2A 5DS9A 2M34A 2V4JC 3KE2A 3O2PE 1LVKA 3QU6A 3E6CC 1K78A 5GAEJ 4Y13A 5J6XA 3M8FA 4HF0A 3JSOA 3HTSB 5BNGA 3HRMA 2JVHA 2K86A 2ZO4A 2J5PA 2ZBKA 4F3QA 3EUHA 5AIQA 1E17A 2F4MB 4BAYA 1OLTA 3TGNA 3GFLA 3ZQ7A 1VQPI 5CVIA 1ETWA 2WBMA 2JRTA 3DWLE 4HG2A 1QZYA 2MH2A 1MJAA 2LY9A 4M3DA 4BQQA 2LKXA 4FETA 2DU9A 2VC0A 3DBLB 1ORKA 1IRGA 3OYMA 2R7SA 5HLHA 1GV2A 2WC2A 1R7JA 3CJTB 4IZZA 1FIPA 4G94A 4UY8I 3SZPA 1OKRA 2XF6A 1R00A 4BJ5C 4XR6A 4X1EA 4EJVA 4OAYA 1XC5A 3JREA 1LB2A 4NNJA 1MH4A 2W7NA 3HG9A 1RKWA 4HPQA 4CYCA 2Y31A 4KYWA 4GYGA 2IGKA 2IA0A 5C44J 4RLQA 3QYFA 5J8CA 1EV7A 5FROA 4DZJA 3HOSA 1JKRC 2M0MA 3U9GA 4A3GJ 3A01A 3GW2A 2P81A 1R5ID 2ID6A 1VQOI 2PJPA 2F5CA 2KZGA 3KP7A 4RAGA 3HBLA 1TNTA 3WTVC 2OU2A 1J75A 1FX7A 1VQ7I 5LHHA 1OPCA 3CTAA 1JI8A 3I9V2 1WWXA 3EUAA 2M1BA 1DU0A 3UKGA 4A3FJ 4ABZA 2Q0OA 2Y9YA 5E3OA 3CP2A 2E2JJ 3K9TA 1QBJA 2OAZA 3BZKA 3ZR8X 1S6LA 3VSLA 4HAMA 5FJ8J 2KRCA 3RKXA 4LITA 3L2QA 2M5WA 2MSYA 1RPWA 3HUGB 5HVQC 4BYYA 2A6EF 1N78A 4D7MA 2DA3A 4U88A 2DMQA 3JRGA 1MIJA 2AO9A 2VBXA 4WXHA 3X2QH 3JRIA 3KYDB 2HQ5A 3BPVA 3GMEA 2ZJPF 5IP6A 3I5UA 3K69A 3KEOA 2KP6A 3L2RA 2F5DA 2OJED 2JWTA 3WG9A 1CF7A 2C6YA 4IJAA 1FOWA 1ZR2A 4DYRA 3D1NI 3CO6C 4ZJZA 3JRCA 3ERMA 3ZQLA 3ZQFA 3HSRA 3MVPA 3FXMA 1LFBA 2VQHA 4Y15A 5EGOB 4LLNA 4JX6A 2MH9A 1ULYA 2K4JA 2ZNZA 4BDZA 5L3DA 4UVAA 1LDDA 3ZMSA 2HPMA 1ZQ3P 4EM2A 1EJ9A 1FNNA 2NVXJ 5D5UB 2M7AA 3LWFA 2EFWA 2R5YB 4M73A 2L7ZA 1UZCA 2OZUA 4LGWA 3VOEA 3FXUA 3IC7A 3C2HA 5K5OA 4C3IJ 2EFQA 4IHTA 4F7ZA 3TP3A 5AIPA 1FIAA 2QCOA 5LHIA 5IYDJ 1V3FA 1BN5A 1SFEA 3KZZA 1OCOH 3N97A 1OCZH 2VOPA 1WSUA 2OC6A 3V42A 2ICWG 4L0YB 1YG2A 3JTHA 4Y4RA 2QSHX 3OYJA 5HDNA 2QYOA 4C30A 4M3EA 1BA5A 2JA5J 2PMZN 1U9NA 2OD5A 2OCCH 2Q2EB 1N75A 2DPUA 1QRYA 2CW8A 2VBWA 3QYBA 4NC8A 1G59A 1TQIA 3L9FA 4IQJA 5D8LB 4ZH4F 2TRTA 2XGEA 3FM5A 3OL3A 5LEJA 3K4BA 1IN6A 2F4OB 4D7NA 3CMEI 1SD7A 2X6YA 2NVTJ 1F5TA 1KU7A 2KRHA 4E70A 2EJRA 1QQIA 3E6MA 2H1KA 1SMYF 2MA3A 3HHHA 2QQBA 4LOCA 4N4NB 2EV0A 2MFZA 1MKMA 5FKMA 2B63J 3KZIC 2E5ZA 2UZKA 3IH2A 2E1CA 4BU2A 1JHFA 3M4OJ 2PFBA 3ESWB 4GGGA 2W00A 3VEPA 2ZCWA 3FDYA 4AIHA 1YJNI 4KN4X 3CF5F 1LFPA 3LAJA 2EZLA 1SFUA 4UV8A 4OMYA 3DPTA 2DW4A 1UG2A 1YOVB 2JUGA 3E5QA 4A3KJ 2XPUA 4N9IA 4UV9A 1BIBA 3AG1H 4FTHA 2CSOA 2X6XA 3I58A 5EJCA 4RAYA 4B1RA 3PNTA 3W2WA 2EBIA 2VE9A 3F0CA 2G9WA 2XF7A 1ETOA 1T08B 3EETA 5FLVA 1U8BA 4Y33A 2KMUA 3TMOA 1DQUA 5E3MA 1BR4A 2LF7A 2RVCA 1BJZA 3QWLA 1QA6A 3UNGC 4L0ZB 2A61A 2EFPA 2B9SA 3WTUC 3HYIA 2ZB9A 2DCEA 4NDLA 1ACIA 1D0ZA 3ZPLA 1IW7F 1R6RA 1T95A 3L09A 3ZMZA 2X48A 3OS2A 1TNSA 2KRFA 1H9GA 1SFKA 2HKOA 1Z77A 2OQGA 4II2A 4BY7J 5GADJ 2X0LA 3RJPA 2JA6J 4XLNF 3I4NJ 4EM1A 4BE2A 5B1BH 4BDYA 4L5IA 5BOXA 3FZVA 1UFMA 1WQ2A 4HBLA 1JHHA 3GFMA 4FE4A 4EQQA 2DA4A 3HGGA 4O5VA 5E79C 4CO8A 2ZFWA 3GVAA 4FX4A 4M71A 1IDZA 1JUPA 2QWWA 3H5NA 5L3CA 3AAFA 3HXLA 1Q1VA 1B72B 4PCQA 2BHYA 3M1EA 4ZZLA 1PDNC 3WE3A 2X9DA 3BR1A 3IUOA 2R7WA 1L3LA 3D5LA 5B5EC 3OYLA 2CQNA 3BJ6A 1U8RA 4AYBA 1IRFA 5DUIA 3PNVA 4MO7A 4PSWA 1MNDA 5E3LA 2VQCA 4BQNA 2H8RA 2M3AA 3CQZJ 5LFAA 1JUMA 2JVGA 4Z6YA 2V1UA 3BG6A 5FD5A 2VIXA 2LF8A 3ZP5A 3K2ZA 1JGGA 3TEDA 2MC3A 4GCVA 1FY7A 2V9KA 5DCMA 4EV0A 3BG3A 2F4IA 1HXDA 1G8XA 3MKWB 3GTJJ 1YW9A 4PUSA 3SYTA 3GTQJ 3VPRA 4ZDOA 3CUQA 4NC6A 3S17J 4XRMA 2OTJI 4J19A 2RGVA 4ZDPA 1HKSA 4G6TB 1S72I 4A3DJ 2YSRA 1HKQA 5LRSA 2M4GA 5IYCJ 2VI6A 4MNUA 2KZVA 2KLOA 2BY1A 3DBHB 1J09A 4W1UA 1JTXA 4OIRF 1LUJB 1N25A 1ZR4A 4DBQA 1TT0A 1B8IB 2HXIA 3QYEA 4G6DA 3ROUA 1S8NA 3KP4A 4YG2F 5GPCA 1ZGJA 2LBFA 4RGSA 3S1QJ 3ECOA 3GYHX 3CDIA 1WJCA 2EIJH 2P7CB 2CMPA 5HS8A 5DM6F 3CMAI 3RKYA 4HSTA 4PJJA 1XGMA 4F52A 3WTTC 3HOZJ 3J7AO 4ZC3A 3VWBA 2L4MA 1PUFB 2VQGA 3A02A 2P5LC 1VQ6I 2DOAA 1UHWA 1O4XA 4YFXF 2K9LA 1JT0A 3CCRI 3HOUJ 2BW3A 1Y6IA 1UJ8A 5JR3A 1YJWI 3OR2C 5EG0A 1U5TA 5EYRA 4BH9A 1MGTA 1K4SA 1XMKA 3BTCA 3BJAA 3F8CA 3FIWA 4ZZDA 1W36C 4X6AJ 2GAUA 3GCMA 2H6BA 3MKLA 3ZN1A 4OIOF 2KFDA 1RIOH 3FM3A 4OOIA 3QRFF 3U2RA 2ZXJA 2K27A 1BIAA 3VYRB 1BI2A 1XGNA 2JA2A 1R1UA 2Z2SB 1LPQA 2R7VA 2PJRB 1Y1VJ 4MGRA 5FD6A 2Z16A 3H3VK 2WADA 5F0CA 1G6NA 5EEHA 3KZYA 1KQ9A 3E1SA 4EJUA 1R4NB 2Y69H 2NS8A 1VI0A 4BJ6C 4BQOA 4LLLA 1UAAA 4KFCA 3M07A 3MEXA 1K4TA 3CC7I 1TWFJ 2R4GA 2CJJA 2W4SA 2DT7B 5CQEA 5DDGA 3TP0A 3OIOA 2DPDA 2CWEA 2DFEA 3M1CA 1YYVA 1G3TA 4XLCA 1ETYA 4JK1X 3VYSB 2NRAC 1MBJA 1NG6A 4WXDA 1A31A 3GTOJ 1I3QJ 2LY1A 2FJ1A 3K4NA 3ML6A 1BI3A 4HX4A 1O3QA 4UNOA 2R7QA 2XGDA 2HTJA 2QEXI 5HS9A 3FBNB 4YIRX 1ZG5A 4NQWA 4UUTA 4C3HJ 4H4KC 1Z0XA 4MEXF 2R7XA 4D1QA 4U0WA 5EZGA 1BI0A 1TQMA 1DPUA 3QP6A 4M3BA 4B44A 3BP8A 4KJZA 2YX7A 1F4KA 1QZEA 4GRIA 4YIFA 3K4JA 5L3GA 1XSVA 4S0HB 2NVUB 3K70C 4ON0A 4HYEA 1IN8A 2XAHA 2D2WA 5L3EA 1JTYA 1IUFA 3DPLC 3K70D 5HOOA 2V79A 1OISA 4LG0B 2YPRA 3CJNA 1X1BA 5E20A 1MMDA 4L9TA 3KP5A 3LAPA 4IHSA 3U1DA 4IQ4A 2O6GE 2HQRA 3QQAA 1SVOA 2P5VA 2VBZA 2P4WA 2XSJC 5TISC 3BQZA 5DTDA 2E7WA 4HV6A 2XAQA 1JT6A 1Z21A 1FEXA 2PLYA 4BE1A 2HEOA 1GVDA 1LDKB 2XKPA 4UXNA 2F5FA 2O03A 3N05A 1GVJA 4AYBN 3TDUC 1LE8B 1KYWA 4FX0A 3NQOA 2BHZA 2VXDA 4C9YA 4L9NA 1WJ5A 3FK7A 4UUVA 1BR1A 4XONA 2VKVA 3J80Z 1QO0D 2OPTA 3OOUA 3K0LA 1KZHA 1WRJA 2CQ7A 2NS7A 1RUOA 3WTXC 3GTLJ 2COBA 4AC0A 2DO7A 3PUBA 1FTZA 2O8KA 1KYZA 3KP6A 4RA2A 5J1UA 2CFXA 3ERED 4CCMA 4LIVA 2Q8KA 3OYIA 1D5YA 2HU9A 2M9HA 4CH7A 5FLXK 1WHUA 2HZDA 4FE7A 3HKZN 2JZYA 1USTA 4Q4ZF 1D0XA 1DU6A 4BXUA 1X3WB 2GWRA 4MQVA 2R7TA 2DDBA 1QU3A 1MW7A 1DDNA 2CUEA 2WAFA 4XSXF 3KLOA 2ETHA 3EYIA 2JPCA 3ABUA 3JAMK 1UHMA 1WJAA 3WHCA 5M5XJ 1F36A 3WU1B 2X1EA 4FASD 3CJRB 1X2MA 2Y75A 5A2QZ 3PO3J 4I76A 2E1MB 1GDTA 1WCMJ 5K1YA 2UUZA 2L7MP 4XKBA 3ZQGA 5DUKA 3GTMJ 4LK0F 5KHDA 4KIGA 2QVOA 1P4XA 4RLFA 1SMTA 4MEYF 3ZOBA 2ID3A 3GLLA 4BHCA 3JRBA 1FMVA 4LFUA 1VQKI 5LRRA 1XGOA 3VDXA 3LSMA 3BLYA 1Z6RA 1W0UA 4QSHA 1SFXA 3NARA 4I99C 2EH3A 5EEGA 4AVZA 2ISZA 2KJBA 4ESFA 2DQRA 1G3YA 1YRNB 2F48A 4XIDA 4UUSB 4OINF 1GXPA 1W4MA 2H09A 1FSHA 1T56A 3KFWX 5JI6A 2P0WA 1WFXA 3KEQA 3REOA 4A3CJ 3F6OA 1MBHA 2X1CA 2VLAA 1DGWY 5M3MJ 2HVRA 1X1AA 3C18A 2MG4A 3QAHA 4FHTA 3R6SA 3M9AA 3TQNA 4A5NA 2Z5UA 2DMUA 2R5ZB 1S9HA 5E8GA 4IKFA 2DTRA 2KHMA 4EEFG 3G4SI 3PFYA 4BEHA 2J5OA 1R71A 1BM9A 1U6GA 2IA1A 5F04A 1ZTRA 3H35A 2RDPA 2Q1ZB 4JP0A 2FQ3A 3OMYA 4P1WA 4V2GA 1LFUP 4AM3A 2OA4A 2ECCA 3VB2A 4ITVA 2BY3A 1VQ9I 2ZMEC 3SFIA 3G71I 2DBBA 1W7PA 4LB6B 3WG7H 2R7ZJ 2ZJRF 1TTYA 1XCBA 5CVVA 1UELB 3JTGA 1JXSA 1DUXC 2DJNA 3HIFA 1OJLA 3A03A 1I50J 4DIQA 1LDJA 2YU3A 2ACJA 4A93J 3T0YA 1Z6TA 1FT9A 2KISA 4CSWA 1HCRA 5F0FA 3OSFA 1G3SA 1C0WA 1AOYA 2V1NA 1AKHB 1OYYA 4WWCA 4NUBA 1D5VA 3Q0UA 2E60A 4XICA 2DA6A 3MCZA 4W97A 4ASNA 2AS5F 1Y0UA 2HYFA 1VF9A 3I59B 4OMZA 1Z67A 3CUOA 2VOOA 1RKTA 3O3KA 3ECHA 4B48A 1AHDP 3BZCA 3CCSI 4A5MA 1IGNA 4DW6A 1FYLA 2BEOA 3VODA 5KCMA 4MLOA 2HDWA 5B3SH 3TO9A 1I3AA 2WWYA 1A6IA 4CXFA 2JJ7A 2QZ8A 4DZPA 3RIRA 2X85A 2LYCA 3P9IA 3K1PA 5E17F 2VASA 4XLEA 3S2WA 3OYHA 2FNPA 5DD8A 4G9YA 3FMQA 3JCUC 2XGCA 1IUYA 3KP3A 3LQQA 5ERIA 1RNLA 3RSNA 2Y9ZA 1DPRA 2WV0A 3SJMA 2R7UA 5AONA 3OYAA 1QPIA 3DBRB 1OQYA 4PK4A 4E7LA 5EGOA 4PGGA 5IT9K 1Q1HA 3H36A 1P92A 1ZG1A 5HLGA 3LSHA 1TWAJ 3S2HJ 1JJ8C 2Y0SN 5E1ZB 2R5YA 4UB8C 4H0EA 1MMSA 4BXFA 5M3FJ 2HVQA 1T38A 4D5CA 2VT2A 2A5YB 2K40A 3IAM2 2LLKA 4JOMA 1XMAA 2KIUA 1HDPA 5JLXA 2FF4A 2FMYA 2NAZA 3S3OA 3J81Z 2E1MC 1JKQC 3E6BA 5GTIC 2JT1A 2AXLA 2Y2ZA 2O3FA 2KPMA 4Y52J 5J4VA 3E5UA 2BZTA 2MD0A 3F3XA 1AWCA 5LLQA 2COMA 3OYFA 3WU0A 3OYEA 1P4WA 3LL7A 3RPUD 3DCFA 5HODA 5TGTA 3ZXSA 5CVRA 3GZNB 1F43A 3MKYB 4KMFA 2QQAA 5IP7J 2TCTA 1T0FA 2YU9J 1VQLI 1K6OA 2VJ4A 2DTZA 3OYDA 2Z3YA 2GXBA 3E3VA 2QA4I 2FE3A 2ZSHB 1X3UA 3CDLA 1R1VA 2NVQJ 3K2AA 3MWMA 1H89C 2FOWA 3MKZA 3HOXJ 3WTSC 1A04A 1MD0A 3IH4A 4C2UA 5HS7A 3CCYA 3HZJA 2ECBA 2EILH 2QLZA 2IS1A 2BY2A 2W84A 3S1NJ 2NNNA 1PP8F 1TLHB 2FBKA 2MLKA 4KISA 3AG4H 1ZGWA 4LJZF 4DNCA 1J0RA 1U2WA 3HJEA 1QZZA 3FF5A 3BDDA 1EH8A 4OAZA 1X4OA 3IH3A 1A35A 2XB0X 3CJQB 1ZELA 2FA5A 2RQPA 3H0GJ 3I64A 3OYBA 4HOBA 1W5TA 4GYIA 4AWXB 2I8DA 2CFOA 3ISPA 2YUSA 3BR0A 4E7SA 3HOYJ 5E1WA 3DLAA 1G2HA 2LC2A 4LG3A 5TRDA 1SANA 4G8XA 2RV8A 3S1MJ 3W2VA 1MJ9A 1X19A 2XROA 4B8XA 1TZLA 4E4HA 4IRGA 3PIPF 4F93B 3E0JB 1RZ4A 2CO5A 4L9JA 1XN7A 4N0BA 3WODF 3GX4X 2D45A 4JBAA 2HWVA 1GXQA 2M45A 1IDYA 1Z05A 2M87A 3DP7A 5JLWA 2ME6A 1S7AA 3TW7A 2LRDA 1HC8A 1FC3A 2HNHA 3FMSA 2CUJA 5J1RA 1VQ5I 3DTEA 2VN2A 1GV5A 4D5FA 4DQ2A 4BJTA 1TWCJ 1HSJA 2KL4A 2AQEA 2FUG2 1APLC 1YHQI 2F5EA 4P5OA 3QP5A 4HNVA 4BACA 4ENKA 3VYTB 4A12A 4I98B 1ITYA 3SQNA 3LNQA 4CCNA 1YX3A 4IO9F 2OQRA 3LSRA 2VKEA 3AG3H 3GUDA 4RS8A 1A36A 4F92B 3J7YJ 2DA7A 3DXJF 2GIVA 4ENMA 1XDSA 2WAQA 3B02A 1ZAOA 3K4CA 1YO5C 4HX7A 1XSDA 1B72A 4ETSA 3TBIA 4GFBA 4AUXA 1WH5A 3WTZA 4E7KA 2L01A 4P96A 1ZRDA 1S29A 3HB9A 1MJBA 3SDBA 1V5GA 4MTEA 1QHGA 1X1PA 5H20A 5D5XB 4R8HA 1J9IA 2Z1DA 3CC4I 1W7PD 2M8GX 3DF8A 4JX4A 2BVMA 5IY5H 4B3XA 4QTRA 1T98A 1OR7C 4RM3A 3EUHC 4IVNA 1NTCA 4WK8F 1ZKGA 3M8JA 1YJ9I 3N4MA 2GM4A 2WY7Q 4BY1J 1R9TJ 1EF4A 2VT3A 2I5UA 1USSA 2XAGA 2O7OA 1TBXA 2PEXA 4RDUA 2HVSA 3M8EA 1YIOA 3ZRGA 1Y39A 3BG7A 4K2EA 1HW1A 1I27A 4QWQA 4XRSA 5IOYA 4AVPA 1F9NA 3RDIA 1BOBA 3HSFA 2CS3A 4RB1A 3Q5FA 3ABLH 2VBYA 1VZ0A 3DTKA 3PO2J 5FKNA 2R93J 3H5AA 4A3EJ 1VQ4I 2GOXB 3V7RA 2FBHA 5ICEA 1P7IA 3FXRA 1I1GA 2OTLI 1POGA 2EZKA 2XPWA 3F72A 3P9KA 2QF7A 5CVJA 4IEJA 3SFZA 3PQKA 3QODA 3MZ8A 4NC7A 1X1CA 2UXXA 5B1AH 3OWTA 2PMUA 2ME0A 4M9ZA 2BY0A 2Z33A 5DD4A 2L9SA 2HOSA 3PFIA 2H27A 1XX5A 1MBKA 1PUFA 1HLVA 3DKYA 5KAFC 4IRHA 2VPRA 5F0HA 3BJOA 1NHAA 3K4MA 2K3FA 1BJAA 1K7AA 1Y8QB 5KK1A 1IAWA 4HZFA 2XPVA 3GBGA 2R3SA 3JW4A 4HQMA 4M9SA 1LEAA 2WTEA 1FYKA 2DA1A 3I4MJ 2UV1A 3K1MA 2FOKA 2EZIA 3FWEA 2RNJA 3BT9A 4A3JJ 4CZZA 4XKVA 3P7NA 5B66C 1LJ9A 2MABA 3ABMH 5EZHA 2XASA 2GQQA 3HC7A 4BXXJ 4MIMA 4KIBA 1J5YA 4M72A 4Q48A 5K7FA 1V55H 3Q0VA 2PJRA 1WVRA 5EF6A 4XORA 2L2OA 2JPBA 2XV4S 3H1CA 2W48A 4O6JA 2O8XA 3F23A 1ETVA 1IZ1A 2DA5A 9ANTA 1Y8RB 2XRNA 4YIIA 2CV2A 4CCKA 3CCJI 4EGYA 2E5NA 5KVRA 4ZYEA 5FKLA 3RZDJ 3LA2A 3V7CA 4ZTJA 3S16J 3SZGA 3AKZA 2L9RA 4EATA 1J7KA 3IAS2 1I6HJ 3GF2A 3C7JA 1D0YA 4I01A 1ZRCA 1YS7A 1MBEA 1WH7A 5CQGA 3S93A 2R7FA 2ZJ2A 1KQ0A 2A69F 2DMPA 1VQNI 3E97A 4WXCA 3Q9VA 2XVCA 1PVEA 2BXZA 2F5VA 1B6AA 2W1OA 3I71A 4HW0A 3BTJA 5FGMA 3T8TA 5HLTA 3CUQB 5F1RA 3A0BC 3PSFA 3FMRA 4MTDA 3S2DJ 3DKWA 2X4HA 4N4OB 3SEQA 3CC2I 3W6VA 2DI3A 4BQAA 1FTTA 2HS5A 4Y7NJ 1U0JA 3KX2A 3ZMVA 2B7EA 5E3NA 5J47A 4X0GA 3JRDA 4KN7X 4CGZA 3HOVJ 2ELHA 3JRHA 2ADUA 2HI3A 4FQGA 4XRSG 1T6SA 1QNTA 3BQYA 3IL2A 1RETA 2PQ8A 1ZRFA 2QBYA 4M74A 1Z1DA 1IRXA 2F2EA 2KKOA 3NWSA 1RR8C 3LA3A 4GDFA 1JGSA 2FQ4A 4Y3OA 1E3OC 2BGCA 3W6KB 4CUGA 2WAQN 1FSEA 1FP2A 3FK6A 3LSJA 1R36A 1T2KA 5FFXA 3ZQIA 1B9MA 4CICA 3TO6A 2A6TA 2ZMEB 5K5RA 3VSKA 1WGXA 3DEEA 3OS1A 1A5JA 3OOPA 3GO5A 2VKDA 1KGSA 5EEAA 1ON1A 4KIFA 1LE8A 3MN2A 4C2MJ 2KIQA 3ZN0A 5EG0B 4XK4A 3VFZA 1PYVA 2WY8Q 5GP9A 1J59A 1ON2A 2VODA 1P9QC 3D0SA 2X1DA 1X3ZB 3GZ6A 1V4RA 1GUUA 2QKMB 1T8IA 4KMUX 2W57A 1X1DA 1SVLA 3GTGJ 2XSDC 2HDCA 2XKOA 2YR2A 2PN6A 5K5QA 2NVYJ 4E6KG 2L9VA 2L9NA 1EA3A 3QPHA 3HOTA 4D9JA 4HF1A 4J00A 4KT6A 2CGPA 3BG9A 1XPXA 2DQLA 3GLXA 1WI9A 3H9QA 2Y0MA 4KICA 1V54H 2LY2A 1MNEA 5CJ9A 4CA0A 2DODA 1Z3YA 2RAEA 3V8KA 2KDZA 5J4YA 2Y30A 2HYJA 4G7ZF 2JTVA 1STZA 2E71A 3TW6A 5C4XJ 5CKTA 2IW5A 2RC4A 2XAJA 3R0AA 4RGUA 3B6CA 3RYRA 2XDVA 1B9NA 1ZHFA 4I09A 2VJJA 5ICCA 1H8AC 4YRVA 3T1BA 2GIZA 3B73A 4ZYHA 4IHYA 2MBFA 5D5WB 1S7EA 2IT0A 1E2XA 2MD5A 5HLIA 4CCJA 1HKTA 1BL0A 5JVTA 2HZTA 4BUPA 5D4RA 1HOMA 1KA8A 2V1DA 2HGCA 4NQWB 1B59A 3B6AA 2KJCA 3C3WA 3RPQA 2V26A 5F27A 1Z91A 2CUFA 2XF5A 4O3MA 4XNFA 4CYDA 2ZC2A 3KYCB 4KT5C 4E7JA 1OYWA 4LIUA 4OU0A 3EDPA 4A3IJ 1YRNA 2Z9OA 4UUSA 4PJMA 2EA4A 1R5GA 1JUSA 2LP0A 2MW8A 1RI7A 3E6DA 3DQVC 2STWA 2BBYA 2RN7A 1ZG3A 1FYMA 5C3EJ 5HDGA 2R7RA 2M2EA 1MMNA 2HTSA 3OSGA 3OYGA 4XLFA 2EQRA 1FPQA 2HQAA 3O6BB 3SHFA 3CCLI 2K7LA 4V2FA 4I2OA 1R22A 1FOYA 1JE8A 5KNLA 4B47A 5GAGJ 2VQLA 3RQIA 3JRFA 2R5ZA 3NRVA 4I0BA 5ILUA 2EIMH 5FKKA 2GXGA 2EB7A 1RESA 2RREA 1YE9A 3OY9A 1E3HA 2M7BA 4BBRJ 3G1OA 1XB4A 1W1WE 4MQ9F 4GXOA 2V9PA 5FRMA 3OYNA 2HYGD 4WX9A 3BY6A 3H9JA 1MBGA 1ZREA 4BGDA 4HF2A 3C2BA 1O3RA 2CQKA 3CESA 3CUQC 4FISA 3PQJA 1KQ8A 2BOLA 3QPLA 2E1OA 3CZ6A 2HXOA 1Y56A 2R0QC 1EH6A 3C1DA 3FHZA 3Q3SA 1O3TA 1VFCA 3DU5A 1ZLKA 2MC4A 3OR1C 2EWNA 1U78A 3IV5A 2AHQA 1AKHA 2QUFA 3A2KA 4AIJA 5GTHC 3BZ6A 3G2BA 1R23A 4FT8A 1SFOJ 3I59A 4F55A 3MFKA 3G73A 2JUCA 4RB0A 2NXNB 2UXNA 1DGRM 4G7HF 1XTAA 5J40A 1UMQA 4D0PA 4WCGA 3WTYC 2PMZA 1J2XA 1YS6A 4DGWB 5LGTA 1UB9A 3FKIJ 5ILSA 1YW7A 4BHBA 4M6YA 1FP1D 5LHGA 4ESJA 3GTPJ 4M3GA 1IC8A 1E0EA 3CF2A 4KITB 2GA1A 2E2HJ 1SEUA 3S3NA 2L3DA 1WJEA 5LBQA 2FD5A 3HL2A 1RUNA 3W3CA 2IS2A 2MYSA 1SD6A 3KLNA 1MDMB 1DP3A 1U5TC 2ZNYA 3COAC 4LD5A 1HA8A 1TP4A 2XGXA 4BHPA 5CVUA 1IXSB 1XG1A 2CQXA 4AIDA 4EJOA 5FLXZ 1UCRA 3BROA 2P8TA 3NWTA 2H1LA 2HOAA 4OWRB 4YFKF 4B4CA 1ZGAA 4HNTA 2FXAA 4ZTFA 3QPSA 3BCBA 2GOMA 1AA7A 2KT0A 3LMMA 3JAMZ 2V7FA 5H2FC 1UG0A 2GA2A 2M0CA 3U1KA 1OR7A 2NNYA 1FBQA 5D6EA 4RMNA 1OMIA 4RAFA 2EA2A 2OV7A 1NH3A 2P7VB 1BR2A 3DPUA 1WJBA 2EINH 3BG5A 3F6VA 2L02A 3FHNA 3KEYA 3KPHA 3R4KA 4YFNF 2IEKA 3HOWJ 3U21A 3HUGA 3QOPA 3IWFA 5DV5A 3PL8A 1IV8A 4XLPF 3UR3C 1JKOC 2V6CA 2L4AA 4UVCA 2GXAA 3F8MA 2NS0A 3EUKL 4XN3A 5HNHA 4BEHB 4RB3C 1R5HA 4C3JJ 2R7DA 2ZSIB
chains in the Genus database with same CATH topology
5ED4A 4EJTA 1IXCA 1O57A 2XAFA 1HQCA 1W7PB 5ICFA 2DK5A 4GO1A 3TO7A 1K78B 4UVBA 5D4SA 3GZ5A 4A6DA 2L54A 6PAXA 2LNBA 2E7XA 1SD4A 2EFNA 2B0LA 4IXAA 1FOKA 3IRQA 1D8KA 4A0YA 2G7HA 1IF1A 1YW8A 4OIQF 1OYIA 5BMZA 4LB5A 4HX8A 3TKYA 3GEZA 4A0ZA 1YFHA 4BNCA 1I1SA 3H3UA 1BC8C 2Q2EA 2P6TA 1S3JA 1P4AA 2D1HA 1R1TA 5LGNA 1TW2A 2M30A 3EQLF 4PGHA 4I0AA 1XGSA 2M8EA 3G3ZA 4PZJA 2IRFG 4M6XA 5IT3A 5ILVA 1ZYRF 2DFIA 2V9VA 4AIKA 1O7FA 3HSEA 2HFHA 3RKWA 4R1HA 4XRFA 1K79A 2PMHA 1FBSA 1P6RA 2MLGA 3V8LA 4I02A 1YTYA 3ABTA 3ZMUA 5DYMA 3GFJA 4ZYGA 3F8NA 3IKVA 3MQ0A 3RTRA 4ENJA 1T39A 1CGPA 4L18B 2QM3A 2VE8A 1BI1A 1G3WA 1CF7B 2ZKZA 3R61A 2EV5A 5IT9Z 4ZYDA 1KU9A 4EJWA 4L5JA 3MAJA 3I53A 1ZN2A 3BWGA 1SAXA 2Y48A 2PI0A 3HRSA 3LA7A 1I5ZA 2QENA 2G7UA 2PG4A 3GWZA 1WKMA 2W85A 3RYPA 2HOEA 2FU4A 3K1NA 4WF2A 4HLXA 1U3EM 1LQ1A 4KNYA 3HRTA 1P2FA 4HA8A 5J8FA 3F21A 2NYXA 1L0OC 2KIFA 2XIGA 3IHUA 1TQPA 2DLLA 4I7HA 3R0JA 1HSTA 1HBXG 4LLGF 3MZYA 4AD9A 1QPMA 3OV8A 3WTWC 1BC7C 5FO5A 3H92A 1FZPB 2O61A 2A07F 5BQTA 2DK8A 3FXQA 4CHUA 5BPIA 2HR3A 3CDHA 5L3BA 1S7OA 4L9VA 5L3FA 2FMLA 3LSTA 2OBPA 1XCVA 2V1XA 4S05A 4A2UA 4Q47A 3RI4A 1REPC 1XDUA 1XD7A 1FWZA 1KU2A 2FRHA 4NB5A 5JHUA 3V8JA 3QU3A 4B09A 5D6FA 2STTA 1Z7UA 2IP2A 3R60A 3WE2A 3MZHA 3TOAA 3KCCA 3V7SA 1B1BA 1BBYA 2P6SA 4NHJA 3DFGA 5F6FA 2Z99A 4RAZA 3TDZC 5BPDA 4U7DA 2DT5A 2LDUA 4HLYA 2RKHA 4IF4A 2D1VA 3QPTA 3CO7C 4RGXA 4EGZA 3JSPA 4N9HA 2W25A 1PP7U 3EYYA 3BPXA 2QQ9A 4EVIA 1LNWA 4RB2C 5BS6A 2IVMA 4JQFA 4LMYA 1XSXA 2E1NA 1IN4A 5JFRA 3LQRA 4IPAA 3IKTA 3WGHA 2O0YA 1ONVA 1LVAA 4HDUA 2H6CA 2A6HF 2W24A 1DP7P 5DCMB 2EV6A 2ZMEA 4A0XA 5F64A 4P55A 1Z9CA 4U0VA 2XHKA 3T5XA 1GHCA 1B4AA 1LEBA 2VXZA 4HQEA 2ESHA 4EMSA 2IJLA 4G7OF 3Q9SA 2ISYA 4KUMA 1G4DA 3L2CA 1KU3A 5E18F 4LG0A 3J80K 2FBIA 5LGUA 3I54A 2K02A 1EH7A 1W5SA 5FFZA 1I6XA 1R58A 3DEUA 5E1XA 5D8KB 3KETA 5H6RA 3IWZA 1O3SA 5HDKA 1H0MA 1D8JA 1U5TB 4XSZF 1HW5A 1YLFA 2H94A 5A2QK 3ZMTA 2FSWA 5TJJA 5DCFA 1ZH5A 4QLCU 3V4GA 4RGRA 1HW2A 2A68F 3IRRA 2LKPA 3H3ZA 2OZ6A 2BYVE 4XBFA 3T8RA 2YX4A 2CW0F 4P9FA 4U7BA 1D3YA 2CG4A 2IA2A 2EFOA 2QBYB 3M7GA 4LK1F 4TV7A 3TOBA 4Y17A 3E5XA 3W6JB 1SD5A 4Z2YA 1ZLJA 3WGIA 3RPUA 5E8IA 1ZARA 3P9CA 3ZMDA 3SZTA 3NEUA 4R79A 2BV6A 4S04A 5H6QA 4G6QA 3SXYA 3BOQA 4IRIA 1YQAA 1BOAA 4HDVA 5D5VB 3F8FA 4UHTA 3F22A 1IXRC 2FEZA 2VC1A 3WGGA 5CLSA 5FB2A 4ESBA 2HKXA 4A6EA 4CDGA 3L7WA 4PDKA 3LFKA 4EM0B 4OIPF 3HTUA 4Q5SF 3FX3A 5DEQA 3I0TA 3GXOA 1H9TA 1PUEE 1QGPA 2KIMA 1O7LA 2FNAA 1IN7A 2XUBA 3I4PA 3L00A 2TDXA 1FLIA 2IPQX 1MDMA 4KA4A 1TW3A 2BE5F 3CLOA 5CYVA 2VONA 4ENNA 2K4BA 2EK5A 2ESNA 1F1ZA 3HHGA 5LEKA 2GZWA 3ELKA 3F8BA 2CYYA 2PBIA 2UWMA 2HQNA 1FBUA 3ULQB 1ODDA 1IN5A 1MZBA 4KDPA 2JSCA 4U0YA 2DAOA 5ICGA 3GFIA 3DV8A 2P5KA 3HRUA 4M9XA 4MHGA 3J81K 1VTNC 2A3SA 4P9UA 2LSOA 4HV5A 3KP2A 3KE2A 3O2PE 3QU6A 3E6CC 1K78A 4Y13A 5J6XA 3M8FA 4HF0A 3JSOA 3HTSB 3HRMA 2ZO4A 2K86A 2J5PA 2ZBKA 1E17A 3EUHA 5AIQA 4BAYA 3TGNA 3GFLA 3ZQ7A 5CVIA 2JRTA 1QZYA 2MH2A 1MJAA 2DU9A 2VC0A 1IRGA 5HLHA 2WC2A 1R7JA 4G94A 3SZPA 1OKRA 1R00A 4EJVA 1LB2A 4KYWA 4GYGA 2IA0A 5J8CA 1EV7A 3HOSA 3U9GA 3GW2A 2PJPA 2F5CA 3KP7A 1TNTA 3WTVC 2OU2A 1J75A 1FX7A 5LHHA 1OPCA 3CTAA 1WWXA 2M1BA 2Q0OA 3K9TA 1QBJA 2OAZA 1S6LA 4HAMA 3RKXA 2M5WA 5HVQC 4BYYA 2A6EF 4U88A 2VBXA 4WXHA 3BPVA 3I5UA 3K69A 3KEOA 2F5DA 3WG9A 1CF7A 2C6YA 4IJAA 3CO6C 3HSRA 4Y15A 4LLNA 2MH9A 1ULYA 2K4JA 2ZNZA 5L3DA 4UVAA 1LDDA 3ZMSA 4EM2A 1FNNA 5D5UB 2EFWA 3LWFA 4M73A 2OZUA 4LGWA 3VOEA 3FXUA 3IC7A 5K5OA 2EFQA 4IHTA 4F7ZA 5AIPA 5LHIA 1V3FA 1BN5A 1SFEA 3KZZA 3N97A 2VOPA 1WSUA 4L0YB 1YG2A 3JTHA 5HDNA 2QYOA 2OD5A 2DPUA 2VBWA 1TQIA 3L9FA 5D8LB 4ZH4F 3FM5A 5LEJA 1IN6A 1SD7A 1F5TA 1KU7A 4E70A 2EJRA 1QQIA 3E6MA 1SMYF 2MA3A 3HHHA 2QQBA 2EV0A 1MKMA 2UZKA 2E1CA 1JHFA 2PFBA 4GGGA 3VEPA 2ZCWA 4AIHA 4KN4X 3LAJA 1SFUA 4UV8A 4OMYA 3DPTA 2DW4A 3E5QA 4N9IA 4UV9A 1BIBA 2CSOA 3I58A 4RAYA 2VE9A 2G9WA 3EETA 2LF7A 2RVCA 4L0ZB 2A61A 2EFPA 3WTUC 3HYIA 3ZPLA 1IW7F 3L09A 3ZMZA 1TNSA 2KRFA 1H9GA 2HKOA 2OQGA 2X0LA 3RJPA 4XLNF 4EM1A 4L5IA 5BOXA 3FZVA 1UFMA 1WQ2A 4HBLA 1JHHA 3GFMA 4EQQA 4O5VA 4CO8A 2ZFWA 3GVAA 4FX4A 4M71A 2QWWA 5L3CA 3AAFA 4PCQA 3M1EA 4ZZLA 1PDNC 3WE3A 1L3LA 3D5LA 3BJ6A 1U8RA 1IRFA 5DUIA 2V1UA 5FD5A 2LF8A 3ZP5A 3K2ZA 2MC3A 4GCVA 1FY7A 5DCMA 4EV0A 1HXDA 1YW9A 3CUQA 2RGVA 1HKSA 2YSRA 1HKQA 5LRSA 4MNUA 4OIRF 3ROUA 4G6DA 1S8NA 3KP4A 4YG2F 1ZGJA 4RGSA 3ECOA 3GYHX 2P7CB 5HS8A 3RKYA 3J7AO 1XGMA 3WTTC 2L4MA 2P5LC 1UHWA 4YFXF 5JR3A 1U5TA 4BH9A 1MGTA 1XMKA 3BJAA 3F8CA 4ZZDA 2GAUA 3ZN1A 2H6BA 4OIOF 1RIOH 3FM3A 4OOIA 3QRFF 3U2RA 2ZXJA 2K27A 1BIAA 1BI2A 1XGNA 1R1UA 4MGRA 5FD6A 1G6NA 5EEHA 3KZYA 1KQ9A 4EJUA 4LLLA 4KFCA 3MEXA 5DDGA 2DPDA 2CWEA 1YYVA 1G3TA 4JK1X 2NRAC 4WXDA 3ML6A 1BI3A 4HX4A 1O3QA 4UNOA 2HTJA 5HS9A 1ZG5A 4NQWA 4MEXF 4U0WA 1BI0A 1TQMA 1DPUA 3QP6A 3BP8A 2YX7A 1F4KA 4YIFA 5L3GA 1XSVA 4ON0A 4HYEA 1IN8A 2XAHA 2D2WA 5L3EA 3DPLC 5HOOA 2V79A 4LG0B 2YPRA 3CJNA 5E20A 4L9TA 3KP5A 3LAPA 4IHSA 3U1DA 2O6GE 2HQRA 2P5VA 2VBZA 2P4WA 2E7WA 4HV6A 2XAQA 2PLYA 2HEOA 1LDKB 2XKPA 4UXNA 2F5FA 2O03A 1GVJA 3TDUC 1KYWA 4FX0A 3NQOA 4L9NA 4UUVA 3J80Z 1QO0D 3K0LA 1WRJA 1RUOA 3WTXC 2DO7A 1KYZA 3KP6A 3ERED 2CFXA 2Q8KA 5FLXK 2JZYA 1USTA 4Q4ZF 4BXUA 2GWRA 4MQVA 1DDNA 4XSXF 3KLOA 2ETHA 3EYIA 2JPCA 3ABUA 3JAMK 1UHMA 3WU1B 2Y75A 5A2QZ 5K1YA 5DUKA 4LK0F 4KIGA 2QVOA 1P4XA 1SMTA 4MEYF 4BHCA 4LFUA 5LRRA 1XGOA 1Z6RA 1SFXA 5EEGA 2ISZA 2KJBA 4ESFA 2DQRA 1G3YA 4OINF 1GXPA 1W4MA 2H09A 1FSHA 3KFWX 5JI6A 3KEQA 3REOA 3F6OA 4A5NA 3C18A 3QAHA 4FHTA 3TQNA 3R6SA 3M9AA 2NNYA 2Z5UA 5E8GA 2DTRA 2J5OA 1BM9A 1U6GA 2IA1A 2RDPA 2FQ3A 2OA4A 3VB2A 2DBBA 1W7PA 4LB6B 1TTYA 1XCBA 5CVVA 3JTGA 1JXSA 1DUXC 3HIFA 1LDJA 2YU3A 2ACJA 3T0YA 1Z6TA 1FT9A 1G3SA 1C0WA 1AOYA 1OYYA 4WWCA 1D5VA 3MCZA 2AS5F 4ASNA 1Y0UA 2HYFA 3I59B 4OMZA 3CUOA 2VOOA 3O3KA 3ECHA 4A5MA 1FYLA 2BEOA 3VODA 3TO9A 2WWYA 4CXFA 2QZ8A 3RIRA 3P9IA 3K1PA 5E17F 3S2WA 2FNPA 5DD8A 4G9YA 3FMQA 1IUYA 3KP3A 3LQQA 5ERIA 1RNLA 1DPRA 2WV0A 5AONA 4PGGA 5IT9K 1Q1HA 1P92A 1ZG1A 5HLGA 5E1ZB 4H0EA 1T38A 2VT2A 2A5YB 1XMAA 2KIUA 2FF4A 2FMYA 2NAZA 3J81Z 3E6BA 2JT1A 2AXLA 2O3FA 3E5UA 3F3XA 1AWCA 5LLQA 2COMA 3WU0A 1P4WA 5CVRA 4KMFA 2QQAA 1T0FA 1K6OA 2Z3YA 2GXBA 3E3VA 2FE3A 1X3UA 1R1VA 3MWMA 3WTSC 1A04A 1MD0A 5HS7A 2QLZA 2W84A 2NNNA 1PP8F 1TLHB 2FBKA 2MLKA 4LJZF 4DNCA 1J0RA 1U2WA 1QZZA 3FF5A 3BDDA 1EH8A 2FA5A 2RQPA 3I64A 4HOBA 1W5TA 4GYIA 4AWXB 3ISPA 5E1WA 5TRDA 4G8XA 2RV8A 1MJ9A 2XROA 4B8XA 4IRGA 1RZ4A 2CO5A 4L9JA 1XN7A 4N0BA 3WODF 3GX4X 2D45A 4JBAA 2HWVA 1GXQA 2M45A 1Z05A 2M87A 3DP7A 1S7AA 1FC3A 3FMSA 2VN2A 4DQ2A 1HSJA 2F5EA 4P5OA 3QP5A 4ENKA 4A12A 4I98B 3SQNA 2OQRA 3GUDA 4RS8A 3DXJF 2GIVA 4ENMA 1XDSA 1YO5C 3B02A 1ZAOA 4HX7A 1XSDA 4ETSA 3WTZA 2L01A 4P96A 1ZRDA 1S29A 1MJBA 4MTEA 5H20A 5D5XB 4R8HA 1J9IA 1W7PD 3DF8A 1T98A 4IVNA 4WK8F 3N4MA 2VT3A 1USSA 2XAGA 2PEXA 1TBXA 3M8EA 1YIOA 4QWQA 4K2EA 1HW1A 1I27A 4AVPA 1F9NA 3RDIA 3HSFA 4RB1A 3Q5FA 2VBYA 3V7RA 2FBHA 5ICEA 3FXRA 1I1GA 3F72A 3P9KA 5CVJA 3SFZA 3PQKA 2UXXA 2PMUA 4M9ZA 2Z33A 5DD4A 3PFIA 2H27A 4IRHA 3BJOA 1NHAA 1BJAA 1K7AA 5KK1A 1IAWA 4HZFA 2R3SA 3JW4A 4M9SA 4HQMA 1LEAA 2WTEA 1FYKA 3K1MA 2FOKA 3FWEA 2RNJA 4CZZA 3P7NA 1LJ9A 2XASA 2GQQA 4KIBA 1J5YA 4M72A 4Q48A 2JPBA 2XV4S 4O6JA 2O8XA 3F23A 1IZ1A 2XRNA 4YIIA 4EGYA 5KVRA 4ZYEA 3LA2A 3V7CA 1J7KA 3GF2A 3C7JA 1ZRCA 4I01A 1YS7A 2R7FA 2ZJ2A 1KQ0A 2A69F 3E97A 4WXCA 3Q9VA 2XVCA 1B6AA 3I71A 4HW0A 5FGMA 3T8TA 3CUQB 5F1RA 3FMRA 4MTDA 3DKWA 2X4HA 2DI3A 4BQAA 2HS5A 3ZMVA 4CGZA 4KN7X 2ELHA 2ADUA 1T6SA 1QNTA 3IL2A 2PQ8A 1ZRFA 2QBYA 4M74A 1Z1DA 2F2EA 2KKOA 3LA3A 1JGSA 2BGCA 3W6KB 1FSEA 1FP2A 1R36A 1T2KA 5FFXA 4CICA 1B9MA 3TO6A 2ZMEB 5K5RA 3OOPA 3GO5A 1KGSA 1ON1A 4KIFA 3ZN0A 3VFZA 1J59A 2VODA 1ON2A 3D0SA 3GZ6A 1V4RA 4KMUX 2W57A 2HDCA 2XKOA 2YR2A 2PN6A 5K5QA 3QPHA 3HOTA 4HF1A 2CGPA 2DQLA 3GLXA 1WI9A 4KICA 2Y0MA 5CJ9A 3V8KA 4G7ZF 2JTVA 1STZA 2IW5A 2RC4A 2XAJA 3R0AA 4RGUA 3RYRA 1B9NA 1ZHFA 4I09A 5ICCA 3T1BA 4ZYHA 3B73A 2MBFA 5D5WB 2IT0A 1E2XA 2MD5A 5HLIA 1HKTA 5JVTA 2HZTA 5D4RA 1KA8A 2V1DA 2HGCA 1B59A 3C3WA 2KJCA 3RPQA 1Z91A 4O3MA 4CYDA 4KT5C 1OYWA 4OU0A 3EDPA 2Z9OA 2EA4A 1R5GA 1RI7A 3E6DA 3DQVC 2STWA 2BBYA 2RN7A 1ZG3A 1FYMA 5HDGA 2HTSA 1FPQA 3O6BB 3SHFA 2K7LA 4I2OA 1R22A 1JE8A 3NRVA 4I0BA 5ILUA 2GXGA 2EB7A 1XB4A 4MQ9F 4GXOA 2HYGD 4WX9A 3BY6A 1ZREA 4HF2A 1O3RA 2CQKA 3CUQC 3PQJA 1KQ8A 1EH6A 3C1DA 3FHZA 1O3TA 1ZLKA 2EWNA 1U78A 2QUFA 4AIJA 3BZ6A 4FT8A 1R23A 3I59A 3MFKA 3G73A 4RB0A 2UXNA 4G7HF 4WCGA 4D0PA 3WTYC 1J2XA 1YS6A 5LGTA 1UB9A 5ILSA 4BHBA 1YW7A 4M6YA 1FP1D 5LHGA 4ESJA 2GA1A 2L3DA 5LBQA 1RUNA 1SD6A 3KLNA 1MDMB 1U5TC 2ZNYA 3COAC 4LD5A 2XGXA 4BHPA 5CVUA 1IXSB 4EJOA 5FLXZ 1UCRA 3BROA 2P8TA 4YFKF 1ZGAA 2FXAA 3JAMZ 2GA2A 1OR7A 1FBQA 5D6EA 1OMIA 2EA2A 2P7VB 3F6VA 2L02A 3R4KA 4YFNF 3HUGA 3QOPA 3IWFA 5DV5A 4XLPF 2V6CA 2L4AA 4UVCA 3F8MA 2NS0A 4RB3C 1R5HA 2R7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ED4 A;  4EJT A;  1IXC A;  1O57 A;  2XAF A;  1HQC A;  1W7P B;  5ICF A;  2DK5 A;  4GO1 A;  3TO7 A;  1K78 B;  4UVB A;  5D4S A;  3GZ5 A;  4A6D A;  2L54 A;  6PAX A;  2LNB A;  2E7X A;  1SD4 A;  2EFN A;  2B0L A;  4IXA A;  1FOK A;  3IRQ A;  1D8K A;  4A0Y A;  2G7H A;  1IF1 A;  1YW8 A;  4OIQ F;  1OYI A;  5BMZ A;  4LB5 A;  4HX8 A;  3TKY A;  3GEZ A;  4A0Z A;  1YFH A;  4BNC A;  1I1S A;  3H3U A;  1BC8 C;  2Q2E A;  2P6T A;  1S3J A;  1P4A A;  2D1H A;  1R1T A;  5LGN A;  1TW2 A;  2M30 A;  3EQL F;  4PGH A;  4I0A A;  1XGS A;  2M8E A;  3G3Z A;  4PZJ A;  2IRF G;  4M6X A;  5IT3 A;  5ILV A;  1ZYR F;  2DFI A;  2V9V A;  4AIK A;  1O7F A;  3HSE A;  2HFH A;  3RKW A;  4R1H A;  4XRF A;  1K79 A;  2PMH A;  1FBS A;  1P6R A;  2MLG A;  3V8L A;  4I02 A;  1YTY A;  3ABT A;  3ZMU A;  5DYM A;  3GFJ A;  4ZYG A;  3F8N A;  3IKV A;  3MQ0 A;  3RTR A;  4ENJ A;  1T39 A;  1CGP A;  4L18 B;  2QM3 A;  2VE8 A;  1BI1 A;  1G3W A;  1CF7 B;  2ZKZ A;  3R61 A;  2EV5 A;  5IT9 Z;  4ZYD A;  1KU9 A;  4EJW A;  4L5J A;  3MAJ A;  3I53 A;  1ZN2 A;  3BWG A;  1SAX A;  2Y48 A;  2PI0 A;  3HRS A;  3LA7 A;  1I5Z A;  2QEN A;  2G7U A;  2PG4 A;  3GWZ A;  1WKM A;  2W85 A;  3RYP A;  2HOE A;  2FU4 A;  3K1N A;  4WF2 A;  4HLX A;  1U3E M;  1LQ1 A;  4KNY A;  3HRT A;  1P2F A;  4HA8 A;  5J8F A;  3F21 A;  2NYX A;  1L0O C;  2KIF A;  2XIG A;  3IHU A;  1TQP A;  2DLL A;  4I7H A;  3R0J A;  1HST A;  1HBX G;  4LLG F;  3MZY A;  4AD9 A;  1QPM A;  3OV8 A;  3WTW C;  1BC7 C;  5FO5 A;  3H92 A;  1FZP B;  2O61 A;  2A07 F;  5BQT A;  2DK8 A;  3FXQ A;  4CHU A;  5BPI A;  2HR3 A;  3CDH A;  5L3B A;  1S7O A;  4L9V A;  5L3F A;  2FML A;  3LST A;  2OBP A;  1XCV A;  2V1X A;  4S05 A;  4A2U A;  4Q47 A;  3RI4 A;  1REP C;  1XDU A;  1XD7 A;  1FWZ A;  1KU2 A;  2FRH A;  4NB5 A;  5JHU A;  3V8J A;  3QU3 A;  4B09 A;  5D6F A;  2STT A;  1Z7U A;  2IP2 A;  3R60 A;  3WE2 A;  3MZH A;  3TOA A;  3KCC A;  3V7S A;  1B1B A;  1BBY A;  2P6S A;  4NHJ A;  3DFG A;  5F6F A;  2Z99 A;  4RAZ A;  3TDZ C;  5BPD A;  4U7D A;  2DT5 A;  2LDU A;  4HLY A;  2RKH A;  4IF4 A;  2D1V A;  3QPT A;  3CO7 C;  4RGX A;  4EGZ A;  3JSP A;  4N9H A;  2W25 A;  1PP7 U;  3EYY A;  3BPX A;  2QQ9 A;  4EVI A;  1LNW A;  4RB2 C;  5BS6 A;  2IVM A;  4JQF A;  4LMY A;  1XSX A;  2E1N A;  1IN4 A;  5JFR A;  3LQR A;  4IPA A;  3IKT A;  3WGH A;  2O0Y A;  1ONV A;  1LVA A;  4HDU A;  2H6C A;  2A6H F;  2W24 A;  1DP7 P;  5DCM B;  2EV6 A;  2ZME A;  4A0X A;  5F64 A;  4P55 A;  1Z9C A;  4U0V A;  2XHK A;  3T5X A;  1GHC A;  1B4A A;  1LEB A;  2VXZ A;  4HQE A;  2ESH A;  4EMS A;  2IJL A;  4G7O F;  3Q9S A;  2ISY A;  4KUM A;  1G4D A;  3L2C A;  1KU3 A;  5E18 F;  4LG0 A;  3J80 K;  2FBI A;  5LGU A;  3I54 A;  2K02 A;  1EH7 A;  1W5S A;  5FFZ A;  1I6X A;  1R58 A;  3DEU A;  5E1X A;  5D8K B;  3KET A;  5H6R A;  3IWZ A;  1O3S A;  5HDK A;  1H0M A;  1D8J A;  1U5T B;  4XSZ F;  1HW5 A;  1YLF A;  2H94 A;  5A2Q K;  3ZMT A;  2FSW A;  5TJJ A;  5DCF A;  1ZH5 A;  4QLC U;  3V4G A;  4RGR A;  1HW2 A;  2A68 F;  3IRR A;  2LKP A;  3H3Z A;  2OZ6 A;  2BYV E;  4XBF A;  3T8R A;  2YX4 A;  2CW0 F;  4P9F A;  4U7B A;  1D3Y A;  2CG4 A;  2IA2 A;  2EFO A;  2QBY B;  3M7G A;  4LK1 F;  4TV7 A;  3TOB A;  4Y17 A;  3E5X A;  3W6J B;  1SD5 A;  4Z2Y A;  1ZLJ A;  3WGI A;  3RPU A;  5E8I A;  1ZAR A;  3P9C A;  3ZMD A;  3SZT A;  3NEU A;  4R79 A;  2BV6 A;  4S04 A;  5H6Q A;  4G6Q A;  3SXY A;  3BOQ A;  4IRI A;  1YQA A;  1BOA A;  4HDV A;  5D5V B;  3F8F A;  4UHT A;  3F22 A;  1IXR C;  2FEZ A;  2VC1 A;  3WGG A;  5CLS A;  5FB2 A;  4ESB A;  2HKX A;  4A6E A;  4CDG A;  3L7W A;  4PDK A;  3LFK A;  4EM0 B;  4OIP F;  3HTU A;  4Q5S F;  3FX3 A;  5DEQ A;  3I0T A;  3GXO A;  1H9T A;  1PUE E;  1QGP A;  2KIM A;  1O7L A;  2FNA A;  1IN7 A;  2XUB A;  3I4P A;  3L00 A;  2TDX A;  1FLI A;  2IPQ X;  1MDM A;  4KA4 A;  1TW3 A;  2BE5 F;  3CLO A;  5CYV A;  2VON A;  4ENN A;  2K4B A;  2EK5 A;  2ESN A;  1F1Z A;  3HHG A;  5LEK A;  2GZW A;  3ELK A;  3F8B A;  2CYY A;  2PBI A;  2UWM A;  2HQN A;  1FBU A;  3ULQ B;  1ODD A;  1IN5 A;  1MZB A;  4KDP A;  2JSC A;  4U0Y A;  2DAO A;  5ICG A;  3GFI A;  3DV8 A;  2P5K A;  3HRU A;  4M9X A;  4MHG A;  3J81 K;  1VTN C;  2A3S A;  4P9U A;  2LSO A;  4HV5 A;  3KP2 A;  3KE2 A;  3O2P E;  3QU6 A;  3E6C C;  1K78 A;  4Y13 A;  5J6X A;  3M8F A;  4HF0 A;  3JSO A;  3HTS B;  3HRM A;  2ZO4 A;  2K86 A;  2J5P A;  2ZBK A;  1E17 A;  3EUH A;  5AIQ A;  4BAY A;  3TGN A;  3GFL A;  3ZQ7 A;  5CVI A;  2JRT A;  1QZY A;  2MH2 A;  1MJA A;  2DU9 A;  2VC0 A;  1IRG A;  5HLH A;  2WC2 A;  1R7J A;  4G94 A;  3SZP A;  1OKR A;  1R00 A;  4EJV A;  1LB2 A;  4KYW A;  4GYG A;  2IA0 A;  5J8C A;  1EV7 A;  3HOS A;  3U9G A;  3GW2 A;  2PJP A;  2F5C A;  3KP7 A;  1TNT A;  3WTV C;  2OU2 A;  1J75 A;  1FX7 A;  5LHH A;  1OPC A;  3CTA A;  1WWX A;  2M1B A;  2Q0O A;  3K9T A;  1QBJ A;  2OAZ A;  1S6L A;  4HAM A;  3RKX A;  2M5W A;  5HVQ C;  4BYY A;  2A6E F;  4U88 A;  2VBX A;  4WXH A;  3BPV A;  3I5U A;  3K69 A;  3KEO A;  2F5D A;  3WG9 A;  1CF7 A;  2C6Y A;  4IJA A;  3CO6 C;  3HSR A;  4Y15 A;  4LLN A;  2MH9 A;  1ULY A;  2K4J A;  2ZNZ A;  5L3D A;  4UVA A;  1LDD A;  3ZMS A;  4EM2 A;  1FNN A;  5D5U B;  2EFW A;  3LWF A;  4M73 A;  2OZU A;  4LGW A;  3VOE A;  3FXU A;  3IC7 A;  5K5O A;  2EFQ A;  4IHT A;  4F7Z A;  5AIP A;  5LHI A;  1V3F A;  1BN5 A;  1SFE A;  3KZZ A;  3N97 A;  2VOP A;  1WSU A;  4L0Y B;  1YG2 A;  3JTH A;  5HDN A;  2QYO A;  2OD5 A;  2DPU A;  2VBW A;  1TQI A;  3L9F A;  5D8L B;  4ZH4 F;  3FM5 A;  5LEJ A;  1IN6 A;  1SD7 A;  1F5T A;  1KU7 A;  4E70 A;  2EJR A;  1QQI A;  3E6M A;  1SMY F;  2MA3 A;  3HHH A;  2QQB A;  2EV0 A;  1MKM A;  2UZK A;  2E1C A;  1JHF A;  2PFB A;  4GGG A;  3VEP A;  2ZCW A;  4AIH A;  4KN4 X;  3LAJ A;  1SFU A;  4UV8 A;  4OMY A;  3DPT A;  2DW4 A;  3E5Q A;  4N9I A;  4UV9 A;  1BIB A;  2CSO A;  3I58 A;  4RAY A;  2VE9 A;  2G9W A;  3EET A;  2LF7 A;  2RVC A;  4L0Z B;  2A61 A;  2EFP A;  3WTU C;  3HYI A;  3ZPL A;  1IW7 F;  3L09 A;  3ZMZ A;  1TNS A;  2KRF A;  1H9G A;  2HKO A;  2OQG A;  2X0L A;  3RJP A;  4XLN F;  4EM1 A;  4L5I A;  5BOX A;  3FZV A;  1UFM A;  1WQ2 A;  4HBL A;  1JHH A;  3GFM A;  4EQQ A;  4O5V A;  4CO8 A;  2ZFW A;  3GVA A;  4FX4 A;  4M71 A;  2QWW A;  5L3C A;  3AAF A;  4PCQ A;  3M1E A;  4ZZL A;  1PDN C;  3WE3 A;  1L3L A;  3D5L A;  3BJ6 A;  1U8R A;  1IRF A;  5DUI A;  2V1U A;  5FD5 A;  2LF8 A;  3ZP5 A;  3K2Z A;  2MC3 A;  4GCV A;  1FY7 A;  5DCM A;  4EV0 A;  1HXD A;  1YW9 A;  3CUQ A;  2RGV A;  1HKS A;  2YSR A;  1HKQ A;  5LRS A;  4MNU A;  4OIR F;  3ROU A;  4G6D A;  1S8N A;  3KP4 A;  4YG2 F;  1ZGJ A;  4RGS A;  3ECO A;  3GYH X;  2P7C B;  5HS8 A;  3RKY A;  3J7A O;  1XGM A;  3WTT C;  2L4M A;  2P5L C;  1UHW A;  4YFX F;  5JR3 A;  1U5T A;  4BH9 A;  1MGT A;  1XMK A;  3BJA A;  3F8C A;  4ZZD A;  2GAU A;  3ZN1 A;  2H6B A;  4OIO F;  1RIO H;  3FM3 A;  4OOI A;  3QRF F;  3U2R A;  2ZXJ A;  2K27 A;  1BIA A;  1BI2 A;  1XGN A;  1R1U A;  4MGR A;  5FD6 A;  1G6N A;  5EEH A;  3KZY A;  1KQ9 A;  4EJU A;  4LLL A;  4KFC A;  3MEX A;  5DDG A;  2DPD A;  2CWE A;  1YYV A;  1G3T A;  4JK1 X;  2NRA C;  4WXD A;  3ML6 A;  1BI3 A;  4HX4 A;  1O3Q A;  4UNO A;  2HTJ A;  5HS9 A;  1ZG5 A;  4NQW A;  4MEX F;  4U0W A;  1BI0 A;  1TQM A;  1DPU A;  3QP6 A;  3BP8 A;  2YX7 A;  1F4K A;  4YIF A;  5L3G A;  1XSV A;  4ON0 A;  4HYE A;  1IN8 A;  2XAH A;  2D2W A;  5L3E A;  3DPL C;  5HOO A;  2V79 A;  4LG0 B;  2YPR A;  3CJN A;  5E20 A;  4L9T A;  3KP5 A;  3LAP A;  4IHS A;  3U1D A;  2O6G E;  2HQR A;  2P5V A;  2VBZ A;  2P4W A;  2E7W A;  4HV6 A;  2XAQ A;  2PLY A;  2HEO A;  1LDK B;  2XKP A;  4UXN A;  2F5F A;  2O03 A;  1GVJ A;  3TDU C;  1KYW A;  4FX0 A;  3NQO A;  4L9N A;  4UUV A;  3J80 Z;  1QO0 D;  3K0L A;  1WRJ A;  1RUO A;  3WTX C;  2DO7 A;  1KYZ A;  3KP6 A;  3ERE D;  2CFX A;  2Q8K A;  5FLX K;  2JZY A;  1UST A;  4Q4Z F;  4BXU A;  2GWR A;  4MQV A;  1DDN A;  4XSX F;  3KLO A;  2ETH A;  3EYI A;  2JPC A;  3ABU A;  3JAM K;  1UHM A;  3WU1 B;  2Y75 A;  5A2Q Z;  5K1Y A;  5DUK A;  4LK0 F;  4KIG A;  2QVO A;  1P4X A;  1SMT A;  4MEY F;  4BHC A;  4LFU A;  5LRR A;  1XGO A;  1Z6R A;  1SFX A;  5EEG A;  2ISZ A;  2KJB A;  4ESF A;  2DQR A;  1G3Y A;  4OIN F;  1GXP A;  1W4M A;  2H09 A;  1FSH A;  3KFW X;  5JI6 A;  3KEQ A;  3REO A;  3F6O A;  4A5N A;  3C18 A;  3QAH A;  4FHT A;  3TQN A;  3R6S A;  3M9A A;  2NNY A;  2Z5U A;  5E8G A;  2DTR A;  2J5O A;  1BM9 A;  1U6G A;  2IA1 A;  2RDP A;  2FQ3 A;  2OA4 A;  3VB2 A;  2DBB A;  1W7P A;  4LB6 B;  1TTY A;  1XCB A;  5CVV A;  3JTG A;  1JXS A;  1DUX C;  3HIF A;  1LDJ A;  2YU3 A;  2ACJ A;  3T0Y A;  1Z6T A;  1FT9 A;  1G3S A;  1C0W A;  1AOY A;  1OYY A;  4WWC A;  1D5V A;  3MCZ A;  2AS5 F;  4ASN A;  1Y0U A;  2HYF A;  3I59 B;  4OMZ A;  3CUO A;  2VOO A;  3O3K A;  3ECH A;  4A5M A;  1FYL A;  2BEO A;  3VOD A;  3TO9 A;  2WWY A;  4CXF A;  2QZ8 A;  3RIR A;  3P9I A;  3K1P A;  5E17 F;  3S2W A;  2FNP A;  5DD8 A;  4G9Y A;  3FMQ A;  1IUY A;  3KP3 A;  3LQQ A;  5ERI A;  1RNL A;  1DPR A;  2WV0 A;  5AON A;  4PGG A;  5IT9 K;  1Q1H A;  1P92 A;  1ZG1 A;  5HLG A;  5E1Z B;  4H0E A;  1T38 A;  2VT2 A;  2A5Y B;  1XMA A;  2KIU A;  2FF4 A;  2FMY A;  2NAZ A;  3J81 Z;  3E6B A;  2JT1 A;  2AXL A;  2O3F A;  3E5U A;  3F3X A;  1AWC A;  5LLQ A;  2COM A;  3WU0 A;  1P4W A;  5CVR A;  4KMF A;  2QQA A;  1T0F A;  1K6O A;  2Z3Y A;  2GXB A;  3E3V A;  2FE3 A;  1X3U A;  1R1V A;  3MWM A;  3WTS C;  1A04 A;  1MD0 A;  5HS7 A;  2QLZ A;  2W84 A;  2NNN A;  1PP8 F;  1TLH B;  2FBK A;  2MLK A;  4LJZ F;  4DNC A;  1J0R A;  1U2W A;  1QZZ A;  3FF5 A;  3BDD A;  1EH8 A;  2FA5 A;  2RQP A;  3I64 A;  4HOB A;  1W5T A;  4GYI A;  4AWX B;  3ISP A;  5E1W A;  5TRD A;  4G8X A;  2RV8 A;  1MJ9 A;  2XRO A;  4B8X A;  4IRG A;  1RZ4 A;  2CO5 A;  4L9J A;  1XN7 A;  4N0B A;  3WOD F;  3GX4 X;  2D45 A;  4JBA A;  2HWV A;  1GXQ A;  2M45 A;  1Z05 A;  2M87 A;  3DP7 A;  1S7A A;  1FC3 A;  3FMS A;  2VN2 A;  4DQ2 A;  1HSJ A;  2F5E A;  4P5O A;  3QP5 A;  4ENK A;  4A12 A;  4I98 B;  3SQN A;  2OQR A;  3GUD A;  4RS8 A;  3DXJ F;  2GIV A;  4ENM A;  1XDS A;  1YO5 C;  3B02 A;  1ZAO A;  4HX7 A;  1XSD A;  4ETS A;  3WTZ A;  2L01 A;  4P96 A;  1ZRD A;  1S29 A;  1MJB A;  4MTE A;  5H20 A;  5D5X B;  4R8H A;  1J9I A;  1W7P D;  3DF8 A;  1T98 A;  4IVN A;  4WK8 F;  3N4M A;  2VT3 A;  1USS A;  2XAG A;  2PEX A;  1TBX A;  3M8E A;  1YIO A;  4QWQ A;  4K2E A;  1HW1 A;  1I27 A;  4AVP A;  1F9N A;  3RDI A;  3HSF A;  4RB1 A;  3Q5F A;  2VBY A;  3V7R A;  2FBH A;  5ICE A;  3FXR A;  1I1G A;  3F72 A;  3P9K A;  5CVJ A;  3SFZ A;  3PQK A;  2UXX A;  2PMU A;  4M9Z A;  2Z33 A;  5DD4 A;  3PFI A;  2H27 A;  4IRH A;  3BJO A;  1NHA A;  1BJA A;  1K7A A;  5KK1 A;  1IAW A;  4HZF A;  2R3S A;  3JW4 A;  4M9S A;  4HQM A;  1LEA A;  2WTE A;  1FYK A;  3K1M A;  2FOK A;  3FWE A;  2RNJ A;  4CZZ A;  3P7N A;  1LJ9 A;  2XAS A;  2GQQ A;  4KIB A;  1J5Y A;  4M72 A;  4Q48 A;  2JPB A;  2XV4 S;  4O6J A;  2O8X A;  3F23 A;  1IZ1 A;  2XRN A;  4YII A;  4EGY A;  5KVR A;  4ZYE A;  3LA2 A;  3V7C A;  1J7K A;  3GF2 A;  3C7J A;  1ZRC A;  4I01 A;  1YS7 A;  2R7F A;  2ZJ2 A;  1KQ0 A;  2A69 F;  3E97 A;  4WXC A;  3Q9V A;  2XVC A;  1B6A A;  3I71 A;  4HW0 A;  5FGM A;  3T8T A;  3CUQ B;  5F1R A;  3FMR A;  4MTD A;  3DKW A;  2X4H A;  2DI3 A;  4BQA A;  2HS5 A;  3ZMV A;  4CGZ A;  4KN7 X;  2ELH A;  2ADU A;  1T6S A;  1QNT A;  3IL2 A;  2PQ8 A;  1ZRF A;  2QBY A;  4M74 A;  1Z1D A;  2F2E A;  2KKO A;  3LA3 A;  1JGS A;  2BGC A;  3W6K B;  1FSE A;  1FP2 A;  1R36 A;  1T2K A;  5FFX A;  4CIC A;  1B9M A;  3TO6 A;  2ZME B;  5K5R A;  3OOP A;  3GO5 A;  1KGS A;  1ON1 A;  4KIF A;  3ZN0 A;  3VFZ A;  1J59 A;  2VOD A;  1ON2 A;  3D0S A;  3GZ6 A;  1V4R A;  4KMU X;  2W57 A;  2HDC A;  2XKO A;  2YR2 A;  2PN6 A;  5K5Q A;  3QPH A;  3HOT A;  4HF1 A;  2CGP A;  2DQL A;  3GLX A;  1WI9 A;  4KIC A;  2Y0M A;  5CJ9 A;  3V8K A;  4G7Z F;  2JTV A;  1STZ A;  2IW5 A;  2RC4 A;  2XAJ A;  3R0A A;  4RGU A;  3RYR A;  1B9N A;  1ZHF A;  4I09 A;  5ICC A;  3T1B A;  4ZYH A;  3B73 A;  2MBF A;  5D5W B;  2IT0 A;  1E2X A;  2MD5 A;  5HLI A;  1HKT A;  5JVT A;  2HZT A;  5D4R A;  1KA8 A;  2V1D A;  2HGC A;  1B59 A;  3C3W A;  2KJC A;  3RPQ A;  1Z91 A;  4O3M A;  4CYD A;  4KT5 C;  1OYW A;  4OU0 A;  3EDP A;  2Z9O A;  2EA4 A;  1R5G A;  1RI7 A;  3E6D A;  3DQV C;  2STW A;  2BBY A;  2RN7 A;  1ZG3 A;  1FYM A;  5HDG A;  2HTS A;  1FPQ A;  3O6B B;  3SHF A;  2K7L A;  4I2O A;  1R22 A;  1JE8 A;  3NRV A;  4I0B A;  5ILU A;  2GXG A;  2EB7 A;  1XB4 A;  4MQ9 F;  4GXO A;  2HYG D;  4WX9 A;  3BY6 A;  1ZRE A;  4HF2 A;  1O3R A;  2CQK A;  3CUQ C;  3PQJ A;  1KQ8 A;  1EH6 A;  3C1D A;  3FHZ A;  1O3T A;  1ZLK A;  2EWN A;  1U78 A;  2QUF A;  4AIJ A;  3BZ6 A;  4FT8 A;  1R23 A;  3I59 A;  3MFK A;  3G73 A;  4RB0 A;  2UXN A;  4G7H F;  4WCG A;  4D0P A;  3WTY C;  1J2X A;  1YS6 A;  5LGT A;  1UB9 A;  5ILS A;  4BHB A;  1YW7 A;  4M6Y A;  1FP1 D;  5LHG A;  4ESJ A;  2GA1 A;  2L3D A;  5LBQ A;  1RUN A;  1SD6 A;  3KLN A;  1MDM B;  1U5T C;  2ZNY A;  3COA C;  4LD5 A;  2XGX A;  4BHP A;  5CVU A;  1IXS B;  4EJO A;  5FLX Z;  1UCR A;  3BRO A;  2P8T A;  4YFK F;  1ZGA A;  2FXA A;  3JAM Z;  2GA2 A;  1OR7 A;  1FBQ A;  5D6E A;  1OMI A;  2EA2 A;  2P7V B;  3F6V A;  2L02 A;  3R4K A;  4YFN F;  3HUG A;  3QOP A;  3IWF A;  5DV5 A;  4XLP F;  2V6C A;  2L4A A;  4UVC A;  3F8M A;  2NS0 A;  4RB3 C;  1R5H A;  2R7D A; 
#chains in the Genus database with same CATH topology
 5ED4 A;  4EJT A;  1IXC A;  1O57 A;  5C4J J;  2L5Q A;  2A5W A;  2CW7 A;  1D1A A;  2XAF A;  1GT0 C;  1HQC A;  1W7P B;  5ICF A;  4DOZ A;  2DK5 A;  4GO1 A;  3TO7 A;  4CZC A;  4UVB A;  3G6E I;  1K78 B;  3S14 J;  5D4S A;  3GZ5 A;  3DU6 A;  4A6D A;  2L54 A;  6PAX A;  2LNB A;  2E7X A;  1SD4 A;  3MD2 A;  1Z7L A;  2DFH A;  1WPK A;  2EFN A;  2B0L A;  2X6O A;  3PIO F;  4IXA A;  1ETX A;  3ASN H;  1K6Y A;  4PFO A;  1FOK A;  3IRQ A;  1D8K A;  3OYC A;  1MNM C;  4A0Y A;  4XN0 A;  4DJA A;  3BTI A;  2G7H A;  2JN6 A;  1IF1 A;  3LSP A;  1Y1W J;  1YW8 A;  4OIQ F;  1MH3 A;  1OYI A;  2DT6 A;  5BMZ A;  4HX8 A;  4LB5 A;  2K9M A;  1YX5 A;  3ZGK A;  3TKY A;  3S8P A;  4BS9 A;  3W2A A;  3AL0 B;  3GEZ A;  3HEF A;  1OFC X;  3S15 J;  4A0Z A;  3JR9 A;  4HRI A;  4IHX A;  1YFH A;  5K7H A;  4BNC A;  3HM5 A;  1KON A;  1I1S A;  3H3U A;  1BC8 C;  2Q2E A;  2LMD A;  2P6T A;  1S3J A;  3NAU A;  4CYC B;  2G0E A;  1P4A A;  2VJ5 A;  2QKL B;  3BR6 A;  1W0T A;  2D1H A;  5F08 A;  1RR7 A;  1CQT A;  3ZCO A;  1NG7 A;  1R1T A;  5IOZ A;  5LGN A;  3A01 B;  1TW2 A;  2M30 A;  3EQL F;  2LRE A;  4PGH A;  2LR8 A;  4I0A A;  3O8G A;  2JK3 A;  3L2W A;  1XGS A;  2M8E A;  3G3Z A;  4PZJ A;  1D1C A;  3KIO A;  3LSK A;  3K10 A;  2IRF G;  4ZYA A;  1OCC H;  3C2G A;  2N8G A;  2XC7 A;  2JRM A;  2K9N A;  4M6X A;  4II3 A;  4PJN A;  5IT3 A;  2DXI A;  3CCQ I;  5ILV A;  1ZYR F;  2DFI A;  2V9V A;  3OL4 A;  3J7Z I;  4AIK A;  1O7F A;  3HSE A;  2HFH A;  4CCL A;  3RKW A;  3PUF A;  4R1H A;  4XRF A;  4I6Z A;  1K79 A;  1M1E B;  2PMH A;  1FBS A;  4IHW A;  1P6R A;  2MLG A;  1TWG J;  3V8L A;  3FKJ A;  2O9L A;  5KAI C;  4I02 A;  1YTY A;  3ABT A;  3ZMU A;  5DYM A;  3GFJ A;  4ZYG A;  4G12 A;  3F8N A;  1SVM A;  3IKV A;  3MQ0 A;  3RTR A;  4ENJ A;  4XLA A;  1S5L C;  1T39 A;  1CGP A;  4L18 B;  3HPG A;  3ZQC A;  2EIK H;  2QM3 A;  2VE8 A;  1BI1 A;  5GPA A;  5HNF A;  1G3W A;  4B43 A;  1CF7 B;  1QHH D;  4NBQ A;  2ZKZ A;  2KDO A;  3R61 A;  2EV5 A;  3L1P A;  5IT9 Z;  4ZYD A;  1KU9 A;  2LG4 A;  3D5S C;  4EJW A;  4L5J A;  2E35 A;  3JRA A;  3MAJ A;  3I53 A;  1ZN2 A;  3BWG A;  1PJR A;  1SAX A;  2Y48 A;  2JA8 J;  1SC7 A;  2IXS A;  2PI0 A;  3HRS A;  2L0K A;  3LA7 A;  1XS9 A;  1I5Z A;  3E7L A;  2QEN A;  3I3L A;  4RBO A;  3CD6 I;  1VQ8 I;  2G7U A;  2PG4 A;  3GWZ A;  2OF7 A;  1WKM A;  2VJI A;  2W85 A;  3G1M A;  1VQM I;  1OCT C;  3RYP A;  2HOT A;  2PX9 A;  2HOE A;  2FU4 A;  3K1N A;  4HEA 2;  4WF2 A;  1IG7 A;  3M3Y J;  5JHF A;  3ONQ A;  4HLX A;  1U3E M;  4JX5 A;  3CLQ A;  1LQ1 A;  3HRT A;  4KNY A;  2JMW A;  3I56 I;  4J01 A;  2VPL A;  1P2F A;  4HA8 A;  1FMW A;  2LKS A;  5J8F A;  2V6E A;  3F21 A;  2NYX A;  1L0O C;  2KIF A;  2XIG A;  2ZXW H;  2E34 A;  2JA7 J;  3IHU A;  1TQP A;  2LK2 A;  3ZQQ A;  2LH9 A;  2IAI A;  3LSG A;  5DM7 F;  2LOO A;  3BTL A;  2MGQ A;  5K7Z A;  2IS6 A;  2DLL A;  1IRZ A;  4I7H A;  2H8W A;  3R0J A;  4E7Z A;  2DDA A;  1HST A;  1TC3 C;  3S1R J;  4M6V A;  3BC8 A;  1HBX G;  4LLG F;  2GBY A;  3MZY A;  1A6Q A;  2IGN A;  1Y0N A;  4AD9 A;  1QPM A;  3OV8 A;  3WTW C;  3WU2 C;  1MMA A;  5FO5 A;  3H92 A;  1BC7 C;  1FZP B;  1P7J A;  2M4K A;  2WV1 A;  2E36 A;  2O61 A;  2BVL A;  1N77 A;  5BQT A;  2K85 A;  2A07 F;  2DK8 A;  3H0D A;  2CU7 A;  2KQR A;  1SAU A;  1RC9 A;  3FXQ A;  4CHU A;  5BPI A;  4A3B J;  2HR3 A;  3CDH A;  2DYS H;  4QPQ A;  5L3B A;  2ELK A;  3AL0 C;  2DYR H;  1S7O A;  4L9V A;  3DKX A;  5L3F A;  3L2V A;  2FML A;  1TT5 B;  3LST A;  4UB6 C;  2OBP A;  2R92 J;  4B3A A;  1XCV A;  2V1X A;  4S05 A;  4A2U A;  4Q47 A;  3A4C A;  3K4L A;  3BR5 A;  2RNG A;  3RI4 A;  1REP C;  1B8I A;  1XDU A;  3FIS A;  4RM2 A;  1XD7 A;  1FWZ A;  1KU2 A;  1BW6 A;  2VUM J;  2FRH A;  4NB5 A;  5JHU A;  2LVS A;  3V8J A;  3QU3 A;  1WI3 A;  4B09 A;  4PJL A;  3OIP A;  3K6G A;  4IL6 C;  2ZFU A;  5D6F A;  2STT A;  5J3L A;  1Z7U A;  3HGY A;  1ZK8 A;  3SDG A;  2DMN A;  2IP2 A;  3FBI B;  3R60 A;  3WE2 A;  3MZH A;  3TOA A;  2GLO A;  1X4P A;  3KCC A;  3FXO A;  3V7S A;  1TL8 A;  4V19 K;  3L2U A;  1B1B A;  1BBY A;  2P6S A;  4NHJ A;  3DFG A;  3AFH A;  5F6F A;  3F9K A;  1NK2 P;  2K3P A;  2WB1 A;  2Z99 A;  2IGO A;  4RAZ A;  2DOF A;  3TDZ C;  4U7D A;  5BPD A;  2DT5 A;  1ERD A;  2EZH A;  2LDU A;  2JSP A;  1E3P A;  4IOC F;  2LD5 A;  4HLY A;  1MSE C;  1BW5 A;  2RKH A;  2HDD A;  2OCE A;  4IF4 A;  2D1V A;  1YI2 I;  3QPT A;  3CO7 C;  2DFF A;  4RGX A;  4EGZ A;  1T33 A;  4XKW A;  3JSP A;  1V5F A;  3HKZ A;  4N9H A;  2W25 A;  3FXJ A;  1PP7 U;  1ENH A;  3EYY A;  3S3M A;  3P5J A;  3BPX A;  1D1B A;  2QQ9 A;  4EVI A;  2L7K A;  1LNW A;  4RB2 C;  4BBS J;  3VYU B;  5BS6 A;  1V5E A;  2IVM A;  4JQF A;  2EPF A;  4LMY A;  1TWH J;  1XSX A;  2E1N A;  1IN4 A;  5JFR A;  2O5R A;  2VKH A;  3LQR A;  4IPA A;  2R7O A;  3DLL F;  3BR3 A;  5IPA A;  3IKT A;  3PJR A;  4PJ0 C;  3WGH A;  2CRG A;  2O0Y A;  1ONV A;  3FXK A;  4MFD A;  4AU7 A;  1T0F C;  4MFE A;  1FOX A;  1LVA A;  2K9Q A;  4PSX A;  4HDU A;  2H6C A;  3QOE A;  2A6H F;  3CCU I;  2W24 A;  1DP7 P;  1WJF A;  5DCM B;  1VND A;  4XL9 A;  2DJI A;  3H5R A;  3CCM I;  2EV6 A;  2ZME A;  3BR2 A;  4ANJ A;  4A0X A;  2ZJQ F;  5F64 A;  4P55 A;  4YEJ A;  3PM1 A;  1Z9C A;  4U0V A;  2XHK A;  3T5X A;  3PSI A;  1GHC A;  1NK3 P;  1B4A A;  3O8H A;  1LEB A;  2VXZ A;  2QSF X;  4HQE A;  3RZO J;  1QVT A;  2ESH A;  4EMS A;  3SEZ A;  3RKQ A;  1QVU A;  3EPZ A;  2IJL A;  4G7O F;  3Q9S A;  2ISY A;  4KUM A;  4XLH A;  3RQ4 A;  5F1J A;  1G4D A;  3L2C A;  1KU3 A;  4XM3 A;  5E18 F;  2CV0 A;  4LG0 A;  3J80 K;  1W36 D;  4FCY A;  2FBI A;  2LBF B;  5EDN A;  3OYK A;  5LGU A;  4IOA F;  2RQQ A;  3I54 A;  2K02 A;  2F6C A;  1EH7 A;  1W5S A;  5FFZ A;  1I6X A;  1R58 A;  2ZXH A;  2CUZ A;  1JKP C;  3DEU A;  2D5V A;  5E1X A;  2AXT C;  5D8K B;  3KET A;  3HPH A;  5H6R A;  2CH0 A;  3IWZ A;  3MMY B;  1O3S A;  2DOE A;  5HDK A;  2QQ8 A;  1RRJ A;  1ETK A;  2BW3 B;  1H0M A;  2QSG X;  3CMY A;  1D8J A;  5JVG F;  2XB5 A;  1U5T B;  5J1Y A;  1OCP A;  1XMX A;  2VL8 A;  2ELJ A;  1K83 J;  4XSZ F;  1HW5 A;  1YLF A;  1IV6 A;  2H94 A;  5A2Q K;  3HDD A;  3ZMT A;  2FSW A;  3S32 A;  5TJJ A;  4XMY A;  1HDD C;  3J7A Y;  5DCF A;  1ZH5 A;  4L5E A;  2XRL A;  4JYK A;  4BKX A;  4QLC U;  1HF0 A;  3V4G A;  2OUM A;  4RGR A;  2IGM A;  4E7H A;  1HW2 A;  2X51 A;  2A68 F;  2BXY A;  3I55 I;  3IRR A;  4DYC A;  2K9S A;  1EKE A;  2LKP A;  3H3Z A;  2OZ6 A;  3OS0 A;  2BYV E;  4XBF A;  4E7I A;  3T8R A;  2YX4 A;  2CW0 F;  4P9F A;  2YS9 A;  4U7B A;  1D3Y A;  1X2N A;  3CCE I;  1GLN A;  2CG4 A;  2IA2 A;  2EFO A;  1OCR H;  3M7G A;  4LK1 F;  2QBY B;  3ZQH A;  4TV7 A;  4YEL A;  3TOB A;  5FLM J;  4A3L J;  4Y17 A;  3E5X A;  1W5C C;  2NOG A;  3W6J B;  1SD5 A;  2NOJ B;  1U9O A;  1R4M B;  4Z2Y A;  1ZLJ A;  2LFB A;  2ZXI A;  3TL4 X;  4BE0 A;  3WGI A;  1FJL A;  2CV1 A;  3RPU A;  5E8I A;  5LD2 C;  1ZAR A;  3P9C A;  1K61 A;  3ZMD A;  1JJ6 C;  2I10 A;  4A3M J;  2K5C A;  3G1L A;  4XOP A;  5GAH J;  3SZT A;  3NEU A;  2QGU A;  4PFP A;  4R79 A;  2BV6 A;  2WA0 A;  4HSR A;  4S04 A;  5FKO A;  5H6Q A;  2FX0 A;  1WJD A;  4G6Q A;  3SXY A;  3BOQ A;  4IRI A;  1YQA A;  1BOA A;  3IP4 B;  4IHV A;  2W82 A;  4CCO A;  4HDV A;  2Y0S A;  2DN0 A;  5D5V B;  2IS4 A;  3F8F A;  4DYQ A;  2E2I J;  2WB1 N;  4UHT A;  1ETQ A;  3F22 A;  1IXR C;  3Q0W A;  3H9G A;  4HNU A;  3K7A J;  2FEZ A;  1UHS A;  3LFU A;  3GTK J;  2VC1 A;  3WGG A;  5CLS A;  5FB2 A;  2JQ7 A;  4ESB A;  2HKX A;  4A6E A;  4CDG A;  2XAU A;  4XKC A;  3L7W A;  1WZ2 A;  1AU7 A;  4PDK A;  2VB6 A;  3LFK A;  3LSI A;  4EM0 B;  4OIP F;  3CMM A;  3HTU A;  4XQF A;  3AG2 H;  3KYL A;  4Q5S F;  3FX3 A;  5DEQ A;  3I0T A;  3GXO A;  1YIT I;  3ASO H;  1H9T A;  1QGP A;  2KIM A;  1LKX A;  4DBR A;  1PUE E;  4A69 C;  1X58 A;  1O7L A;  4M3F A;  1IJW C;  2CQQ A;  2FNA A;  1MSF C;  5FRN A;  4U87 A;  1IN7 A;  2XUB A;  3I4P A;  2L7F P;  3L00 A;  2TDX A;  1FLI A;  2IPQ X;  4IX7 A;  1MDM A;  4KA4 A;  1TW3 A;  1MBF A;  2BE5 F;  3CLO A;  2WAE A;  2HPI A;  2DMT A;  5CYV A;  3WHB A;  3LOC A;  2VON A;  4ENN A;  2K4B A;  2EK5 A;  3D5R C;  4BL0 B;  2DA2 A;  1YIJ I;  3CCV I;  3PNY A;  4C2T A;  2ESN A;  5IYB J;  2X6W A;  1F1Z A;  3HHG A;  5LEK A;  2A05 A;  4QIW N;  2GZW A;  3ELK A;  5CPR B;  3A0H C;  3A1Y A;  3OIQ A;  3ABK H;  1Z3X A;  3RCO A;  4ZDL A;  4F91 B;  3CP8 A;  3K4K A;  2LTP A;  3F8B A;  2CYY A;  1IO2 A;  2PBI A;  2UWM A;  3DTI A;  1MMG A;  3BCA A;  2HQN A;  2E19 A;  3FXL A;  4XOT A;  1R49 A;  1FBU A;  3ULQ B;  1ODD A;  1IN5 A;  1MZB A;  2IBD A;  2JSC A;  5M5Y J;  4KDP A;  1I39 A;  4U0Y A;  2DAO A;  5ICG A;  3GFI A;  3DV8 A;  5M5W J;  1H88 C;  3DEW A;  2P5K A;  3HRU A;  2AQF A;  4QPO A;  4M9X A;  4MHG A;  5IP9 J;  3J81 K;  1VTN C;  2A3S A;  4P9U A;  2LSO A;  4HV5 A;  3KP2 A;  5DS9 A;  2M34 A;  2V4J C;  3KE2 A;  3O2P E;  1LVK A;  3QU6 A;  3E6C C;  1K78 A;  5GAE J;  4Y13 A;  5J6X A;  3M8F A;  4HF0 A;  3JSO A;  3HTS B;  5BNG A;  3HRM A;  2JVH A;  2K86 A;  2ZO4 A;  2J5P A;  2ZBK A;  4F3Q A;  3EUH A;  5AIQ A;  1E17 A;  2F4M B;  4BAY A;  1OLT A;  3TGN A;  3GFL A;  3ZQ7 A;  1VQP I;  5CVI A;  1ETW A;  2WBM A;  2JRT A;  3DWL E;  4HG2 A;  1QZY A;  2MH2 A;  1MJA A;  2LY9 A;  4M3D A;  4BQQ A;  2LKX A;  4FET A;  2DU9 A;  2VC0 A;  3DBL B;  1ORK A;  1IRG A;  3OYM A;  2R7S A;  5HLH A;  1GV2 A;  2WC2 A;  1R7J A;  3CJT B;  4IZZ A;  1FIP A;  4G94 A;  4UY8 I;  3SZP A;  1OKR A;  2XF6 A;  1R00 A;  4BJ5 C;  4XR6 A;  4X1E A;  4EJV A;  4OAY A;  1XC5 A;  3JRE A;  1LB2 A;  4NNJ A;  1MH4 A;  2W7N A;  3HG9 A;  1RKW A;  4HPQ A;  4CYC A;  2Y31 A;  4KYW A;  4GYG A;  2IGK A;  2IA0 A;  5C44 J;  4RLQ A;  3QYF A;  5J8C A;  1EV7 A;  5FRO A;  4DZJ A;  3HOS A;  1JKR C;  2M0M A;  3U9G A;  4A3G J;  3A01 A;  3GW2 A;  2P81 A;  1R5I D;  2ID6 A;  1VQO I;  2PJP A;  2F5C A;  2KZG A;  3KP7 A;  4RAG A;  3HBL A;  1TNT A;  3WTV C;  2OU2 A;  1J75 A;  1FX7 A;  1VQ7 I;  5LHH A;  1OPC A;  3CTA A;  1JI8 A;  3I9V 2;  1WWX A;  3EUA A;  2M1B A;  1DU0 A;  3UKG A;  4A3F J;  4ABZ A;  2Q0O A;  2Y9Y A;  5E3O A;  3CP2 A;  2E2J J;  3K9T A;  1QBJ A;  2OAZ A;  3BZK A;  3ZR8 X;  1S6L A;  3VSL A;  4HAM A;  5FJ8 J;  2KRC A;  3RKX A;  4LIT A;  3L2Q A;  2M5W A;  2MSY A;  1RPW A;  3HUG B;  5HVQ C;  4BYY A;  2A6E F;  1N78 A;  4D7M A;  2DA3 A;  4U88 A;  2DMQ A;  3JRG A;  1MIJ A;  2AO9 A;  2VBX A;  4WXH A;  3X2Q H;  3JRI A;  3KYD B;  2HQ5 A;  3BPV A;  3GME A;  2ZJP F;  5IP6 A;  3I5U A;  3K69 A;  3KEO A;  2KP6 A;  3L2R A;  2F5D A;  2OJE D;  2JWT A;  3WG9 A;  1CF7 A;  2C6Y A;  4IJA A;  1FOW A;  1ZR2 A;  4DYR A;  3D1N I;  3CO6 C;  4ZJZ A;  3JRC A;  3ERM A;  3ZQL A;  3ZQF A;  3HSR A;  3MVP A;  3FXM A;  1LFB A;  2VQH A;  4Y15 A;  5EGO B;  4LLN A;  4JX6 A;  2MH9 A;  1ULY A;  2K4J A;  2ZNZ A;  4BDZ A;  5L3D A;  4UVA A;  1LDD A;  3ZMS A;  2HPM A;  1ZQ3 P;  4EM2 A;  1EJ9 A;  1FNN A;  2NVX J;  5D5U B;  2M7A A;  3LWF A;  2EFW A;  2R5Y B;  4M73 A;  2L7Z A;  1UZC A;  2OZU A;  4LGW A;  3VOE A;  3FXU A;  3IC7 A;  3C2H A;  5K5O A;  4C3I J;  2EFQ A;  4IHT A;  4F7Z A;  3TP3 A;  5AIP A;  1FIA A;  2QCO A;  5LHI A;  5IYD J;  1V3F A;  1BN5 A;  1SFE A;  3KZZ A;  1OCO H;  3N97 A;  1OCZ H;  2VOP A;  1WSU A;  2OC6 A;  3V42 A;  2ICW G;  4L0Y B;  1YG2 A;  3JTH A;  4Y4R A;  2QSH X;  3OYJ A;  5HDN A;  2QYO A;  4C30 A;  4M3E A;  1BA5 A;  2JA5 J;  2PMZ N;  1U9N A;  2OD5 A;  2OCC H;  2Q2E B;  1N75 A;  2DPU A;  1QRY A;  2CW8 A;  2VBW A;  3QYB A;  4NC8 A;  1G59 A;  1TQI A;  3L9F A;  4IQJ A;  5D8L B;  4ZH4 F;  2TRT A;  2XGE A;  3FM5 A;  3OL3 A;  5LEJ A;  3K4B A;  1IN6 A;  2F4O B;  4D7N A;  3CME I;  1SD7 A;  2X6Y A;  2NVT J;  1F5T A;  1KU7 A;  2KRH A;  4E70 A;  2EJR A;  1QQI A;  3E6M A;  2H1K A;  1SMY F;  2MA3 A;  3HHH A;  2QQB A;  4LOC A;  4N4N B;  2EV0 A;  2MFZ A;  1MKM A;  5FKM A;  2B63 J;  3KZI C;  2E5Z A;  2UZK A;  3IH2 A;  2E1C A;  4BU2 A;  1JHF A;  3M4O J;  2PFB A;  3ESW B;  4GGG A;  2W00 A;  3VEP A;  2ZCW A;  3FDY A;  4AIH A;  1YJN I;  4KN4 X;  3CF5 F;  1LFP A;  3LAJ A;  2EZL A;  1SFU A;  4UV8 A;  4OMY A;  3DPT A;  2DW4 A;  1UG2 A;  1YOV B;  2JUG A;  3E5Q A;  4A3K J;  2XPU A;  4N9I A;  4UV9 A;  1BIB A;  3AG1 H;  4FTH A;  2CSO A;  2X6X A;  3I58 A;  5EJC A;  4RAY A;  4B1R A;  3PNT A;  3W2W A;  2EBI A;  2VE9 A;  3F0C A;  2G9W A;  2XF7 A;  1ETO A;  1T08 B;  3EET A;  5FLV A;  1U8B A;  4Y33 A;  2KMU A;  3TMO A;  1DQU A;  5E3M A;  1BR4 A;  2LF7 A;  2RVC A;  1BJZ A;  3QWL A;  1QA6 A;  3UNG C;  4L0Z B;  2A61 A;  2EFP A;  2B9S A;  3WTU C;  3HYI A;  2ZB9 A;  2DCE A;  4NDL A;  1ACI A;  1D0Z A;  3ZPL A;  1IW7 F;  1R6R A;  1T95 A;  3L09 A;  3ZMZ A;  2X48 A;  3OS2 A;  1TNS A;  2KRF A;  1H9G A;  1SFK A;  2HKO A;  1Z77 A;  2OQG A;  4II2 A;  4BY7 J;  5GAD J;  2X0L A;  3RJP A;  2JA6 J;  4XLN F;  3I4N J;  4EM1 A;  4BE2 A;  5B1B H;  4BDY A;  4L5I A;  5BOX A;  3FZV A;  1UFM A;  1WQ2 A;  4HBL A;  1JHH A;  3GFM A;  4FE4 A;  4EQQ A;  2DA4 A;  3HGG A;  4O5V A;  5E79 C;  4CO8 A;  2ZFW A;  3GVA A;  4FX4 A;  4M71 A;  1IDZ A;  1JUP A;  2QWW A;  3H5N A;  5L3C A;  3AAF A;  3HXL A;  1Q1V A;  1B72 B;  4PCQ A;  2BHY A;  3M1E A;  4ZZL A;  1PDN C;  3WE3 A;  2X9D A;  3BR1 A;  3IUO A;  2R7W A;  1L3L A;  3D5L A;  5B5E C;  3OYL A;  2CQN A;  3BJ6 A;  1U8R A;  4AYB A;  1IRF A;  5DUI A;  3PNV A;  4MO7 A;  4PSW A;  1MND A;  5E3L A;  2VQC A;  4BQN A;  2H8R A;  2M3A A;  3CQZ J;  5LFA A;  1JUM A;  2JVG A;  4Z6Y A;  2V1U A;  3BG6 A;  5FD5 A;  2VIX A;  2LF8 A;  3ZP5 A;  3K2Z A;  1JGG A;  3TED A;  2MC3 A;  4GCV A;  1FY7 A;  2V9K A;  5DCM A;  4EV0 A;  3BG3 A;  2F4I A;  1HXD A;  1G8X A;  3MKW B;  3GTJ J;  1YW9 A;  4PUS A;  3SYT A;  3GTQ J;  3VPR A;  4ZDO A;  3CUQ A;  4NC6 A;  3S17 J;  4XRM A;  2OTJ I;  4J19 A;  2RGV A;  4ZDP A;  1HKS A;  4G6T B;  1S72 I;  4A3D J;  2YSR A;  1HKQ A;  5LRS A;  2M4G A;  5IYC J;  2VI6 A;  4MNU A;  2KZV A;  2KLO A;  2BY1 A;  3DBH B;  1J09 A;  4W1U A;  1JTX A;  4OIR F;  1LUJ B;  1N25 A;  1ZR4 A;  4DBQ A;  1TT0 A;  1B8I B;  2HXI A;  3QYE A;  4G6D A;  3ROU A;  1S8N A;  3KP4 A;  4YG2 F;  5GPC A;  1ZGJ A;  2LBF A;  4RGS A;  3S1Q J;  3ECO A;  3GYH X;  3CDI A;  1WJC A;  2EIJ H;  2P7C B;  2CMP A;  5HS8 A;  5DM6 F;  3CMA I;  3RKY A;  4HST A;  4PJJ A;  1XGM A;  4F52 A;  3WTT C;  3HOZ J;  3J7A O;  4ZC3 A;  3VWB A;  2L4M A;  1PUF B;  2VQG A;  3A02 A;  2P5L C;  1VQ6 I;  2DOA A;  1UHW A;  1O4X A;  4YFX F;  2K9L A;  1JT0 A;  3CCR I;  3HOU J;  2BW3 A;  1Y6I A;  1UJ8 A;  5JR3 A;  1YJW I;  3OR2 C;  5EG0 A;  1U5T A;  5EYR A;  4BH9 A;  1MGT A;  1K4S A;  1XMK A;  3BTC A;  3BJA A;  3F8C A;  3FIW A;  4ZZD A;  1W36 C;  4X6A J;  2GAU A;  3GCM A;  2H6B A;  3MKL A;  3ZN1 A;  4OIO F;  2KFD A;  1RIO H;  3FM3 A;  4OOI A;  3QRF F;  3U2R A;  2ZXJ A;  2K27 A;  1BIA A;  3VYR B;  1BI2 A;  1XGN A;  2JA2 A;  1R1U A;  2Z2S B;  1LPQ A;  2R7V A;  2PJR B;  1Y1V J;  4MGR A;  5FD6 A;  2Z16 A;  3H3V K;  2WAD A;  5F0C A;  1G6N A;  5EEH A;  3KZY A;  1KQ9 A;  3E1S A;  4EJU A;  1R4N B;  2Y69 H;  2NS8 A;  1VI0 A;  4BJ6 C;  4BQO A;  4LLL A;  1UAA A;  4KFC A;  3M07 A;  3MEX A;  1K4T A;  3CC7 I;  1TWF J;  2R4G A;  2CJJ A;  2W4S A;  2DT7 B;  5CQE A;  5DDG A;  3TP0 A;  3OIO A;  2DPD A;  2CWE A;  2DFE A;  3M1C A;  1YYV A;  1G3T A;  4XLC A;  1ETY A;  4JK1 X;  3VYS B;  2NRA C;  1MBJ A;  1NG6 A;  4WXD A;  1A31 A;  3GTO J;  1I3Q J;  2LY1 A;  2FJ1 A;  3K4N A;  3ML6 A;  1BI3 A;  4HX4 A;  1O3Q A;  4UNO A;  2R7Q A;  2XGD A;  2HTJ A;  2QEX I;  5HS9 A;  3FBN B;  4YIR X;  1ZG5 A;  4NQW A;  4UUT A;  4C3H J;  4H4K C;  1Z0X A;  4MEX F;  2R7X A;  4D1Q A;  4U0W A;  5EZG A;  1BI0 A;  1TQM A;  1DPU A;  3QP6 A;  4M3B A;  4B44 A;  3BP8 A;  4KJZ A;  2YX7 A;  1F4K A;  1QZE A;  4GRI A;  4YIF A;  3K4J A;  5L3G A;  1XSV A;  4S0H B;  2NVU B;  3K70 C;  4ON0 A;  4HYE A;  1IN8 A;  2XAH A;  2D2W A;  5L3E A;  1JTY A;  1IUF A;  3DPL C;  3K70 D;  5HOO A;  2V79 A;  1OIS A;  4LG0 B;  2YPR A;  3CJN A;  1X1B A;  5E20 A;  1MMD A;  4L9T A;  3KP5 A;  3LAP A;  4IHS A;  3U1D A;  4IQ4 A;  2O6G E;  2HQR A;  3QQA A;  1SVO A;  2P5V A;  2VBZ A;  2P4W A;  2XSJ C;  5TIS C;  3BQZ A;  5DTD A;  2E7W A;  4HV6 A;  2XAQ A;  1JT6 A;  1Z21 A;  1FEX A;  2PLY A;  4BE1 A;  2HEO A;  1GVD A;  1LDK B;  2XKP A;  4UXN A;  2F5F A;  2O03 A;  3N05 A;  1GVJ A;  4AYB N;  3TDU C;  1LE8 B;  1KYW A;  4FX0 A;  3NQO A;  2BHZ A;  2VXD A;  4C9Y A;  4L9N A;  1WJ5 A;  3FK7 A;  4UUV A;  1BR1 A;  4XON A;  2VKV A;  3J80 Z;  1QO0 D;  2OPT A;  3OOU A;  3K0L A;  1KZH A;  1WRJ A;  2CQ7 A;  2NS7 A;  1RUO A;  3WTX C;  3GTL J;  2COB A;  4AC0 A;  2DO7 A;  3PUB A;  1FTZ A;  2O8K A;  1KYZ A;  3KP6 A;  4RA2 A;  5J1U A;  2CFX A;  3ERE D;  4CCM A;  4LIV A;  2Q8K A;  3OYI A;  1D5Y A;  2HU9 A;  2M9H A;  4CH7 A;  5FLX K;  1WHU A;  2HZD A;  4FE7 A;  3HKZ N;  2JZY A;  1UST A;  4Q4Z F;  1D0X A;  1DU6 A;  4BXU A;  1X3W B;  2GWR A;  4MQV A;  2R7T A;  2DDB A;  1QU3 A;  1MW7 A;  1DDN A;  2CUE A;  2WAF A;  4XSX F;  3KLO A;  2ETH A;  3EYI A;  2JPC A;  3ABU A;  3JAM K;  1UHM A;  1WJA A;  3WHC A;  5M5X J;  1F36 A;  3WU1 B;  2X1E A;  4FAS D;  3CJR B;  1X2M A;  2Y75 A;  5A2Q Z;  3PO3 J;  4I76 A;  2E1M B;  1GDT A;  1WCM J;  5K1Y A;  2UUZ A;  2L7M P;  4XKB A;  3ZQG A;  5DUK A;  3GTM J;  4LK0 F;  5KHD A;  4KIG A;  2QVO A;  1P4X A;  4RLF A;  1SMT A;  4MEY F;  3ZOB A;  2ID3 A;  3GLL A;  4BHC A;  3JRB A;  1FMV A;  4LFU A;  1VQK I;  5LRR A;  1XGO A;  3VDX A;  3LSM A;  3BLY A;  1Z6R A;  1W0U A;  4QSH A;  1SFX A;  3NAR A;  4I99 C;  2EH3 A;  5EEG A;  4AVZ A;  2ISZ A;  2KJB A;  4ESF A;  2DQR A;  1G3Y A;  1YRN B;  2F48 A;  4XID A;  4UUS B;  4OIN F;  1GXP A;  1W4M A;  2H09 A;  1FSH A;  1T56 A;  3KFW X;  5JI6 A;  2P0W A;  1WFX A;  3KEQ A;  3REO A;  4A3C J;  3F6O A;  1MBH A;  2X1C A;  2VLA A;  1DGW Y;  5M3M J;  2HVR A;  1X1A A;  3C18 A;  2MG4 A;  3QAH A;  4FHT A;  3R6S A;  3M9A A;  3TQN A;  4A5N A;  2Z5U A;  2DMU A;  2R5Z B;  1S9H A;  5E8G A;  4IKF A;  2DTR A;  2KHM A;  4EEF G;  3G4S I;  3PFY A;  4BEH A;  2J5O A;  1R71 A;  1BM9 A;  1U6G A;  2IA1 A;  5F04 A;  1ZTR A;  3H35 A;  2RDP A;  2Q1Z B;  4JP0 A;  2FQ3 A;  3OMY A;  4P1W A;  4V2G A;  1LFU P;  4AM3 A;  2OA4 A;  2ECC A;  3VB2 A;  4ITV A;  2BY3 A;  1VQ9 I;  2ZME C;  3SFI A;  3G71 I;  2DBB A;  1W7P A;  4LB6 B;  3WG7 H;  2R7Z J;  2ZJR F;  1TTY A;  1XCB A;  5CVV A;  1UEL B;  3JTG A;  1JXS A;  1DUX C;  2DJN A;  3HIF A;  1OJL A;  3A03 A;  1I50 J;  4DIQ A;  1LDJ A;  2YU3 A;  2ACJ A;  4A93 J;  3T0Y A;  1Z6T A;  1FT9 A;  2KIS A;  4CSW A;  1HCR A;  5F0F A;  3OSF A;  1G3S A;  1C0W A;  1AOY A;  2V1N A;  1AKH B;  1OYY A;  4WWC A;  4NUB A;  1D5V A;  3Q0U A;  2E60 A;  4XIC A;  2DA6 A;  3MCZ A;  4W97 A;  4ASN A;  2AS5 F;  1Y0U A;  2HYF A;  1VF9 A;  3I59 B;  4OMZ A;  1Z67 A;  3CUO A;  2VOO A;  1RKT A;  3O3K A;  3ECH A;  4B48 A;  1AHD P;  3BZC A;  3CCS I;  4A5M A;  1IGN A;  4DW6 A;  1FYL A;  2BEO A;  3VOD A;  5KCM A;  4MLO A;  2HDW A;  5B3S H;  3TO9 A;  1I3A A;  2WWY A;  1A6I A;  4CXF A;  2JJ7 A;  2QZ8 A;  4DZP A;  3RIR A;  2X85 A;  2LYC A;  3P9I A;  3K1P A;  5E17 F;  2VAS A;  4XLE A;  3S2W A;  3OYH A;  2FNP A;  5DD8 A;  4G9Y A;  3FMQ A;  3JCU C;  2XGC A;  1IUY A;  3KP3 A;  3LQQ A;  5ERI A;  1RNL A;  3RSN A;  2Y9Z A;  1DPR A;  2WV0 A;  3SJM A;  2R7U A;  5AON A;  3OYA A;  1QPI A;  3DBR B;  1OQY A;  4PK4 A;  4E7L A;  5EGO A;  4PGG A;  5IT9 K;  1Q1H A;  3H36 A;  1P92 A;  1ZG1 A;  5HLG A;  3LSH A;  1TWA J;  3S2H J;  1JJ8 C;  2Y0S N;  5E1Z B;  2R5Y A;  4UB8 C;  4H0E A;  1MMS A;  4BXF A;  5M3F J;  2HVQ A;  1T38 A;  4D5C A;  2VT2 A;  2A5Y B;  2K40 A;  3IAM 2;  2LLK A;  4JOM A;  1XMA A;  2KIU A;  1HDP A;  5JLX A;  2FF4 A;  2FMY A;  2NAZ A;  3S3O A;  3J81 Z;  2E1M C;  1JKQ C;  3E6B A;  5GTI C;  2JT1 A;  2AXL A;  2Y2Z A;  2O3F A;  2KPM A;  4Y52 J;  5J4V A;  3E5U A;  2BZT A;  2MD0 A;  3F3X A;  1AWC A;  5LLQ A;  2COM A;  3OYF A;  3WU0 A;  3OYE A;  1P4W A;  3LL7 A;  3RPU D;  3DCF A;  5HOD A;  5TGT A;  3ZXS A;  5CVR A;  3GZN B;  1F43 A;  3MKY B;  4KMF A;  2QQA A;  5IP7 J;  2TCT A;  1T0F A;  2YU9 J;  1VQL I;  1K6O A;  2VJ4 A;  2DTZ A;  3OYD A;  2Z3Y A;  2GXB A;  3E3V A;  2QA4 I;  2FE3 A;  2ZSH B;  1X3U A;  3CDL A;  1R1V A;  2NVQ J;  3K2A A;  3MWM A;  1H89 C;  2FOW A;  3MKZ A;  3HOX J;  3WTS C;  1A04 A;  1MD0 A;  3IH4 A;  4C2U A;  5HS7 A;  3CCY A;  3HZJ A;  2ECB A;  2EIL H;  2QLZ A;  2IS1 A;  2BY2 A;  2W84 A;  3S1N J;  2NNN A;  1PP8 F;  1TLH B;  2FBK A;  2MLK A;  4KIS A;  3AG4 H;  1ZGW A;  4LJZ F;  4DNC A;  1J0R A;  1U2W A;  3HJE A;  1QZZ A;  3FF5 A;  3BDD A;  1EH8 A;  4OAZ A;  1X4O A;  3IH3 A;  1A35 A;  2XB0 X;  3CJQ B;  1ZEL A;  2FA5 A;  2RQP A;  3H0G J;  3I64 A;  3OYB A;  4HOB A;  1W5T A;  4GYI A;  4AWX B;  2I8D A;  2CFO A;  3ISP A;  2YUS A;  3BR0 A;  4E7S A;  3HOY J;  5E1W A;  3DLA A;  1G2H A;  2LC2 A;  4LG3 A;  5TRD A;  1SAN A;  4G8X A;  2RV8 A;  3S1M J;  3W2V A;  1MJ9 A;  1X19 A;  2XRO A;  4B8X A;  1TZL A;  4E4H A;  4IRG A;  3PIP F;  4F93 B;  3E0J B;  1RZ4 A;  2CO5 A;  4L9J A;  1XN7 A;  4N0B A;  3WOD F;  3GX4 X;  2D45 A;  4JBA A;  2HWV A;  1GXQ A;  2M45 A;  1IDY A;  1Z05 A;  2M87 A;  3DP7 A;  5JLW A;  2ME6 A;  1S7A A;  3TW7 A;  2LRD A;  1HC8 A;  1FC3 A;  2HNH A;  3FMS A;  2CUJ A;  5J1R A;  1VQ5 I;  3DTE A;  2VN2 A;  1GV5 A;  4D5F A;  4DQ2 A;  4BJT A;  1TWC J;  1HSJ A;  2KL4 A;  2AQE A;  2FUG 2;  1APL C;  1YHQ I;  2F5E A;  4P5O A;  3QP5 A;  4HNV A;  4BAC A;  4ENK A;  3VYT B;  4A12 A;  4I98 B;  1ITY A;  3SQN A;  3LNQ A;  4CCN A;  1YX3 A;  4IO9 F;  2OQR A;  3LSR A;  2VKE A;  3AG3 H;  3GUD A;  4RS8 A;  1A36 A;  4F92 B;  3J7Y J;  2DA7 A;  3DXJ F;  2GIV A;  4ENM A;  1XDS A;  2WAQ A;  3B02 A;  1ZAO A;  3K4C A;  1YO5 C;  4HX7 A;  1XSD A;  1B72 A;  4ETS A;  3TBI A;  4GFB A;  4AUX A;  1WH5 A;  3WTZ A;  4E7K A;  2L01 A;  4P96 A;  1ZRD A;  1S29 A;  3HB9 A;  1MJB A;  3SDB A;  1V5G A;  4MTE A;  1QHG A;  1X1P A;  5H20 A;  5D5X B;  4R8H A;  1J9I A;  2Z1D A;  3CC4 I;  1W7P D;  2M8G X;  3DF8 A;  4JX4 A;  2BVM A;  5IY5 H;  4B3X A;  4QTR A;  1T98 A;  1OR7 C;  4RM3 A;  3EUH C;  4IVN A;  1NTC A;  4WK8 F;  1ZKG A;  3M8J A;  1YJ9 I;  3N4M A;  2GM4 A;  2WY7 Q;  4BY1 J;  1R9T J;  1EF4 A;  2VT3 A;  2I5U A;  1USS A;  2XAG A;  2O7O A;  1TBX A;  2PEX A;  4RDU A;  2HVS A;  3M8E A;  1YIO A;  3ZRG A;  1Y39 A;  3BG7 A;  4K2E A;  1HW1 A;  1I27 A;  4QWQ A;  4XRS A;  5IOY A;  4AVP A;  1F9N A;  3RDI A;  1BOB A;  3HSF A;  2CS3 A;  4RB1 A;  3Q5F A;  3ABL H;  2VBY A;  1VZ0 A;  3DTK A;  3PO2 J;  5FKN A;  2R93 J;  3H5A A;  4A3E J;  1VQ4 I;  2GOX B;  3V7R A;  2FBH A;  5ICE A;  1P7I A;  3FXR A;  1I1G A;  2OTL I;  1POG A;  2EZK A;  2XPW A;  3F72 A;  3P9K A;  2QF7 A;  5CVJ A;  4IEJ A;  3SFZ A;  3PQK A;  3QOD A;  3MZ8 A;  4NC7 A;  1X1C A;  2UXX A;  5B1A H;  3OWT A;  2PMU A;  2ME0 A;  4M9Z A;  2BY0 A;  2Z33 A;  5DD4 A;  2L9S A;  2HOS A;  3PFI A;  2H27 A;  1XX5 A;  1MBK A;  1PUF A;  1HLV A;  3DKY A;  5KAF C;  4IRH A;  2VPR A;  5F0H A;  3BJO A;  1NHA A;  3K4M A;  2K3F A;  1BJA A;  1K7A A;  1Y8Q B;  5KK1 A;  1IAW A;  4HZF A;  2XPV A;  3GBG A;  2R3S A;  3JW4 A;  4HQM A;  4M9S A;  1LEA A;  2WTE A;  1FYK A;  2DA1 A;  3I4M J;  2UV1 A;  3K1M A;  2FOK A;  2EZI A;  3FWE A;  2RNJ A;  3BT9 A;  4A3J J;  4CZZ A;  4XKV A;  3P7N A;  5B66 C;  1LJ9 A;  2MAB A;  3ABM H;  5EZH A;  2XAS A;  2GQQ A;  3HC7 A;  4BXX J;  4MIM A;  4KIB A;  1J5Y A;  4M72 A;  4Q48 A;  5K7F A;  1V55 H;  3Q0V A;  2PJR A;  1WVR A;  5EF6 A;  4XOR A;  2L2O A;  2JPB A;  2XV4 S;  3H1C A;  2W48 A;  4O6J A;  2O8X A;  3F23 A;  1ETV A;  1IZ1 A;  2DA5 A;  9ANT A;  1Y8R B;  2XRN A;  4YII A;  2CV2 A;  4CCK A;  3CCJ I;  4EGY A;  2E5N A;  5KVR A;  4ZYE A;  5FKL A;  3RZD J;  3LA2 A;  3V7C A;  4ZTJ A;  3S16 J;  3SZG A;  3AKZ A;  2L9R A;  4EAT A;  1J7K A;  3IAS 2;  1I6H J;  3GF2 A;  3C7J A;  1D0Y A;  4I01 A;  1ZRC A;  1YS7 A;  1MBE A;  1WH7 A;  5CQG A;  3S93 A;  2R7F A;  2ZJ2 A;  1KQ0 A;  2A69 F;  2DMP A;  1VQN I;  3E97 A;  4WXC A;  3Q9V A;  2XVC A;  1PVE A;  2BXZ A;  2F5V A;  1B6A A;  2W1O A;  3I71 A;  4HW0 A;  3BTJ A;  5FGM A;  3T8T A;  5HLT A;  3CUQ B;  5F1R A;  3A0B C;  3PSF A;  3FMR A;  4MTD A;  3S2D J;  3DKW A;  2X4H A;  4N4O B;  3SEQ A;  3CC2 I;  3W6V A;  2DI3 A;  4BQA A;  1FTT A;  2HS5 A;  4Y7N J;  1U0J A;  3KX2 A;  3ZMV A;  2B7E A;  5E3N A;  5J47 A;  4X0G A;  3JRD A;  4KN7 X;  4CGZ A;  3HOV J;  2ELH A;  3JRH A;  2ADU A;  2HI3 A;  4FQG A;  4XRS G;  1T6S A;  1QNT A;  3BQY A;  3IL2 A;  1RET A;  2PQ8 A;  1ZRF A;  2QBY A;  4M74 A;  1Z1D A;  1IRX A;  2F2E A;  2KKO A;  3NWS A;  1RR8 C;  3LA3 A;  4GDF A;  1JGS A;  2FQ4 A;  4Y3O A;  1E3O C;  2BGC A;  3W6K B;  4CUG A;  2WAQ N;  1FSE A;  1FP2 A;  3FK6 A;  3LSJ A;  1R36 A;  1T2K A;  5FFX A;  3ZQI A;  1B9M A;  4CIC A;  3TO6 A;  2A6T A;  2ZME B;  5K5R A;  3VSK A;  1WGX A;  3DEE A;  3OS1 A;  1A5J A;  3OOP A;  3GO5 A;  2VKD A;  1KGS A;  5EEA A;  1ON1 A;  4KIF A;  1LE8 A;  3MN2 A;  4C2M J;  2KIQ A;  3ZN0 A;  5EG0 B;  4XK4 A;  3VFZ A;  1PYV A;  2WY8 Q;  5GP9 A;  1J59 A;  1ON2 A;  2VOD A;  1P9Q C;  3D0S A;  2X1D A;  1X3Z B;  3GZ6 A;  1V4R A;  1GUU A;  2QKM B;  1T8I A;  4KMU X;  2W57 A;  1X1D A;  1SVL A;  3GTG J;  2XSD C;  2HDC A;  2XKO A;  2YR2 A;  2PN6 A;  5K5Q A;  2NVY J;  4E6K G;  2L9V A;  2L9N A;  1EA3 A;  3QPH A;  3HOT A;  4D9J A;  4HF1 A;  4J00 A;  4KT6 A;  2CGP A;  3BG9 A;  1XPX A;  2DQL A;  3GLX A;  1WI9 A;  3H9Q A;  2Y0M A;  4KIC A;  1V54 H;  2LY2 A;  1MNE A;  5CJ9 A;  4CA0 A;  2DOD A;  1Z3Y A;  2RAE A;  3V8K A;  2KDZ A;  5J4Y A;  2Y30 A;  2HYJ A;  4G7Z F;  2JTV A;  1STZ A;  2E71 A;  3TW6 A;  5C4X J;  5CKT A;  2IW5 A;  2RC4 A;  2XAJ A;  3R0A A;  4RGU A;  3B6C A;  3RYR A;  2XDV A;  1B9N A;  1ZHF A;  4I09 A;  2VJJ A;  5ICC A;  1H8A C;  4YRV A;  3T1B A;  2GIZ A;  3B73 A;  4ZYH A;  4IHY A;  2MBF A;  5D5W B;  1S7E A;  2IT0 A;  1E2X A;  2MD5 A;  5HLI A;  4CCJ A;  1HKT A;  1BL0 A;  5JVT A;  2HZT A;  4BUP A;  5D4R A;  1HOM A;  1KA8 A;  2V1D A;  2HGC A;  4NQW B;  1B59 A;  3B6A A;  2KJC A;  3C3W A;  3RPQ A;  2V26 A;  5F27 A;  1Z91 A;  2CUF A;  2XF5 A;  4O3M A;  4XNF A;  4CYD A;  2ZC2 A;  3KYC B;  4KT5 C;  4E7J A;  1OYW A;  4LIU A;  4OU0 A;  3EDP A;  4A3I J;  1YRN A;  2Z9O A;  4UUS A;  4PJM A;  2EA4 A;  1R5G A;  1JUS A;  2LP0 A;  2MW8 A;  1RI7 A;  3E6D A;  3DQV C;  2STW A;  2BBY A;  2RN7 A;  1ZG3 A;  1FYM A;  5C3E J;  5HDG A;  2R7R A;  2M2E A;  1MMN A;  2HTS A;  3OSG A;  3OYG A;  4XLF A;  2EQR A;  1FPQ A;  2HQA A;  3O6B B;  3SHF A;  3CCL I;  2K7L A;  4V2F A;  4I2O A;  1R22 A;  1FOY A;  1JE8 A;  5KNL A;  4B47 A;  5GAG J;  2VQL A;  3RQI A;  3JRF A;  2R5Z A;  3NRV A;  4I0B A;  5ILU A;  2EIM H;  5FKK A;  2GXG A;  2EB7 A;  1RES A;  2RRE A;  1YE9 A;  3OY9 A;  1E3H A;  2M7B A;  4BBR J;  3G1O A;  1XB4 A;  1W1W E;  4MQ9 F;  4GXO A;  2V9P A;  5FRM A;  3OYN A;  2HYG D;  4WX9 A;  3BY6 A;  3H9J A;  1MBG A;  1ZRE A;  4BGD A;  4HF2 A;  3C2B A;  1O3R A;  2CQK A;  3CES A;  3CUQ C;  4FIS A;  3PQJ A;  1KQ8 A;  2BOL A;  3QPL A;  2E1O A;  3CZ6 A;  2HXO A;  1Y56 A;  2R0Q C;  1EH6 A;  3C1D A;  3FHZ A;  3Q3S A;  1O3T A;  1VFC A;  3DU5 A;  1ZLK A;  2MC4 A;  3OR1 C;  2EWN A;  1U78 A;  3IV5 A;  2AHQ A;  1AKH A;  2QUF A;  3A2K A;  4AIJ A;  5GTH C;  3BZ6 A;  3G2B A;  1R23 A;  4FT8 A;  1SFO J;  3I59 A;  4F55 A;  3MFK A;  3G73 A;  2JUC A;  4RB0 A;  2NXN B;  2UXN A;  1DGR M;  4G7H F;  1XTA A;  5J40 A;  1UMQ A;  4D0P A;  4WCG A;  3WTY C;  2PMZ A;  1J2X A;  1YS6 A;  4DGW B;  5LGT A;  1UB9 A;  3FKI J;  5ILS A;  1YW7 A;  4BHB A;  4M6Y A;  1FP1 D;  5LHG A;  4ESJ A;  3GTP J;  4M3G A;  1IC8 A;  1E0E A;  3CF2 A;  4KIT B;  2GA1 A;  2E2H J;  1SEU A;  3S3N A;  2L3D A;  1WJE A;  5LBQ A;  2FD5 A;  3HL2 A;  1RUN A;  3W3C A;  2IS2 A;  2MYS A;  1SD6 A;  3KLN A;  1MDM B;  1DP3 A;  1U5T C;  2ZNY A;  3COA C;  4LD5 A;  1HA8 A;  1TP4 A;  2XGX A;  4BHP A;  5CVU A;  1IXS B;  1XG1 A;  2CQX A;  4AID A;  4EJO A;  5FLX Z;  1UCR A;  3BRO A;  2P8T A;  3NWT A;  2H1L A;  2HOA A;  4OWR B;  4YFK F;  4B4C A;  1ZGA A;  4HNT A;  2FXA A;  4ZTF A;  3QPS A;  3BCB A;  2GOM A;  1AA7 A;  2KT0 A;  3LMM A;  3JAM Z;  2V7F A;  5H2F C;  1UG0 A;  2GA2 A;  2M0C A;  3U1K A;  1OR7 A;  2NNY A;  1FBQ A;  5D6E A;  4RMN A;  1OMI A;  4RAF A;  2EA2 A;  2OV7 A;  1NH3 A;  2P7V B;  1BR2 A;  3DPU A;  1WJB A;  2EIN H;  3BG5 A;  3F6V A;  2L02 A;  3FHN A;  3KEY A;  3KPH A;  3R4K A;  4YFN F;  2IEK A;  3HOW J;  3U21 A;  3HUG A;  3QOP A;  3IWF A;  5DV5 A;  3PL8 A;  1IV8 A;  4XLP F;  3UR3 C;  1JKO C;  2V6C A;  2L4A A;  4UVC A;  2GXA A;  3F8M A;  2NS0 A;  3EUK L;  4XN3 A;  5HNH A;  4BEH B;  4RB3 C;  1R5H A;  4C3J J;  2R7D A;  2ZSI B; 
#chains in the Genus database with same CATH homology
 5ED4 A;  4EJT A;  1IXC A;  1O57 A;  2XAF A;  1HQC A;  1W7P B;  5ICF A;  2DK5 A;  4GO1 A;  3TO7 A;  1K78 B;  4UVB A;  5D4S A;  3GZ5 A;  4A6D A;  2L54 A;  6PAX A;  2LNB A;  2E7X A;  1SD4 A;  2EFN A;  2B0L A;  4IXA A;  1FOK A;  3IRQ A;  1D8K A;  4A0Y A;  2G7H A;  1IF1 A;  1YW8 A;  4OIQ F;  1OYI A;  5BMZ A;  4LB5 A;  4HX8 A;  3TKY A;  3GEZ A;  4A0Z A;  1YFH A;  4BNC A;  1I1S A;  3H3U A;  1BC8 C;  2Q2E A;  2P6T A;  1S3J A;  1P4A A;  2D1H A;  1R1T A;  5LGN A;  1TW2 A;  2M30 A;  3EQL F;  4PGH A;  4I0A A;  1XGS A;  2M8E A;  3G3Z A;  4PZJ A;  2IRF G;  4M6X A;  5IT3 A;  5ILV A;  1ZYR F;  2DFI A;  2V9V A;  4AIK A;  1O7F A;  3HSE A;  2HFH A;  3RKW A;  4R1H A;  4XRF A;  1K79 A;  2PMH A;  1FBS A;  1P6R A;  2MLG A;  3V8L A;  4I02 A;  1YTY A;  3ABT A;  3ZMU A;  5DYM A;  3GFJ A;  4ZYG A;  3F8N A;  3IKV A;  3MQ0 A;  3RTR A;  4ENJ A;  1T39 A;  1CGP A;  4L18 B;  2QM3 A;  2VE8 A;  1BI1 A;  1G3W A;  1CF7 B;  2ZKZ A;  3R61 A;  2EV5 A;  5IT9 Z;  4ZYD A;  1KU9 A;  4EJW A;  4L5J A;  3MAJ A;  3I53 A;  1ZN2 A;  3BWG A;  1SAX A;  2Y48 A;  2PI0 A;  3HRS A;  3LA7 A;  1I5Z A;  2QEN A;  2G7U A;  2PG4 A;  3GWZ A;  1WKM A;  2W85 A;  3RYP A;  2HOE A;  2FU4 A;  3K1N A;  4WF2 A;  4HLX A;  1U3E M;  1LQ1 A;  4KNY A;  3HRT A;  1P2F A;  4HA8 A;  5J8F A;  3F21 A;  2NYX A;  1L0O C;  2KIF A;  2XIG A;  3IHU A;  1TQP A;  2DLL A;  4I7H A;  3R0J A;  1HST A;  1HBX G;  4LLG F;  3MZY A;  4AD9 A;  1QPM A;  3OV8 A;  3WTW C;  1BC7 C;  5FO5 A;  3H92 A;  1FZP B;  2O61 A;  2A07 F;  5BQT A;  2DK8 A;  3FXQ A;  4CHU A;  5BPI A;  2HR3 A;  3CDH A;  5L3B A;  1S7O A;  4L9V A;  5L3F A;  2FML A;  3LST A;  2OBP A;  1XCV A;  2V1X A;  4S05 A;  4A2U A;  4Q47 A;  3RI4 A;  1REP C;  1XDU A;  1XD7 A;  1FWZ A;  1KU2 A;  2FRH A;  4NB5 A;  5JHU A;  3V8J A;  3QU3 A;  4B09 A;  5D6F A;  2STT A;  1Z7U A;  2IP2 A;  3R60 A;  3WE2 A;  3MZH A;  3TOA A;  3KCC A;  3V7S A;  1B1B A;  1BBY A;  2P6S A;  4NHJ A;  3DFG A;  5F6F A;  2Z99 A;  4RAZ A;  3TDZ C;  5BPD A;  4U7D A;  2DT5 A;  2LDU A;  4HLY A;  2RKH A;  4IF4 A;  2D1V A;  3QPT A;  3CO7 C;  4RGX A;  4EGZ A;  3JSP A;  4N9H A;  2W25 A;  1PP7 U;  3EYY A;  3BPX A;  2QQ9 A;  4EVI A;  1LNW A;  4RB2 C;  5BS6 A;  2IVM A;  4JQF A;  4LMY A;  1XSX A;  2E1N A;  1IN4 A;  5JFR A;  3LQR A;  4IPA A;  3IKT A;  3WGH A;  2O0Y A;  1ONV A;  1LVA A;  4HDU A;  2H6C A;  2A6H F;  2W24 A;  1DP7 P;  5DCM B;  2EV6 A;  2ZME A;  4A0X A;  5F64 A;  4P55 A;  1Z9C A;  4U0V A;  2XHK A;  3T5X A;  1GHC A;  1B4A A;  1LEB A;  2VXZ A;  4HQE A;  2ESH A;  4EMS A;  2IJL A;  4G7O F;  3Q9S A;  2ISY A;  4KUM A;  1G4D A;  3L2C A;  1KU3 A;  5E18 F;  4LG0 A;  3J80 K;  2FBI A;  5LGU A;  3I54 A;  2K02 A;  1EH7 A;  1W5S A;  5FFZ A;  1I6X A;  1R58 A;  3DEU A;  5E1X A;  5D8K B;  3KET A;  5H6R A;  3IWZ A;  1O3S A;  5HDK A;  1H0M A;  1D8J A;  1U5T B;  4XSZ F;  1HW5 A;  1YLF A;  2H94 A;  5A2Q K;  3ZMT A;  2FSW A;  5TJJ A;  5DCF A;  1ZH5 A;  4QLC U;  3V4G A;  4RGR A;  1HW2 A;  2A68 F;  3IRR A;  2LKP A;  3H3Z A;  2OZ6 A;  2BYV E;  4XBF A;  3T8R A;  2YX4 A;  2CW0 F;  4P9F A;  4U7B A;  1D3Y A;  2CG4 A;  2IA2 A;  2EFO A;  2QBY B;  3M7G A;  4LK1 F;  4TV7 A;  3TOB A;  4Y17 A;  3E5X A;  3W6J B;  1SD5 A;  4Z2Y A;  1ZLJ A;  3WGI A;  3RPU A;  5E8I A;  1ZAR A;  3P9C A;  3ZMD A;  3SZT A;  3NEU A;  4R79 A;  2BV6 A;  4S04 A;  5H6Q A;  4G6Q A;  3SXY A;  3BOQ A;  4IRI A;  1YQA A;  1BOA A;  4HDV A;  5D5V B;  3F8F A;  4UHT A;  3F22 A;  1IXR C;  2FEZ A;  2VC1 A;  3WGG A;  5CLS A;  5FB2 A;  4ESB A;  2HKX A;  4A6E A;  4CDG A;  3L7W A;  4PDK A;  3LFK A;  4EM0 B;  4OIP F;  3HTU A;  4Q5S F;  3FX3 A;  5DEQ A;  3I0T A;  3GXO A;  1H9T A;  1PUE E;  1QGP A;  2KIM A;  1O7L A;  2FNA A;  1IN7 A;  2XUB A;  3I4P A;  3L00 A;  2TDX A;  1FLI A;  2IPQ X;  1MDM A;  4KA4 A;  1TW3 A;  2BE5 F;  3CLO A;  5CYV A;  2VON A;  4ENN A;  2K4B A;  2EK5 A;  2ESN A;  1F1Z A;  3HHG A;  5LEK A;  2GZW A;  3ELK A;  3F8B A;  2CYY A;  2PBI A;  2UWM A;  2HQN A;  1FBU A;  3ULQ B;  1ODD A;  1IN5 A;  1MZB A;  4KDP A;  2JSC A;  4U0Y A;  2DAO A;  5ICG A;  3GFI A;  3DV8 A;  2P5K A;  3HRU A;  4M9X A;  4MHG A;  3J81 K;  1VTN C;  2A3S A;  4P9U A;  2LSO A;  4HV5 A;  3KP2 A;  3KE2 A;  3O2P E;  3QU6 A;  3E6C C;  1K78 A;  4Y13 A;  5J6X A;  3M8F A;  4HF0 A;  3JSO A;  3HTS B;  3HRM A;  2ZO4 A;  2K86 A;  2J5P A;  2ZBK A;  1E17 A;  3EUH A;  5AIQ A;  4BAY A;  3TGN A;  3GFL A;  3ZQ7 A;  5CVI A;  2JRT A;  1QZY A;  2MH2 A;  1MJA A;  2DU9 A;  2VC0 A;  1IRG A;  5HLH A;  2WC2 A;  1R7J A;  4G94 A;  3SZP A;  1OKR A;  1R00 A;  4EJV A;  1LB2 A;  4KYW A;  4GYG A;  2IA0 A;  5J8C A;  1EV7 A;  3HOS A;  3U9G A;  3GW2 A;  2PJP A;  2F5C A;  3KP7 A;  1TNT A;  3WTV C;  2OU2 A;  1J75 A;  1FX7 A;  5LHH A;  1OPC A;  3CTA A;  1WWX A;  2M1B A;  2Q0O A;  3K9T A;  1QBJ A;  2OAZ A;  1S6L A;  4HAM A;  3RKX A;  2M5W A;  5HVQ C;  4BYY A;  2A6E F;  4U88 A;  2VBX A;  4WXH A;  3BPV A;  3I5U A;  3K69 A;  3KEO A;  2F5D A;  3WG9 A;  1CF7 A;  2C6Y A;  4IJA A;  3CO6 C;  3HSR A;  4Y15 A;  4LLN A;  2MH9 A;  1ULY A;  2K4J A;  2ZNZ A;  5L3D A;  4UVA A;  1LDD A;  3ZMS A;  4EM2 A;  1FNN A;  5D5U B;  2EFW A;  3LWF A;  4M73 A;  2OZU A;  4LGW A;  3VOE A;  3FXU A;  3IC7 A;  5K5O A;  2EFQ A;  4IHT A;  4F7Z A;  5AIP A;  5LHI A;  1V3F A;  1BN5 A;  1SFE A;  3KZZ A;  3N97 A;  2VOP A;  1WSU A;  4L0Y B;  1YG2 A;  3JTH A;  5HDN A;  2QYO A;  2OD5 A;  2DPU A;  2VBW A;  1TQI A;  3L9F A;  5D8L B;  4ZH4 F;  3FM5 A;  5LEJ A;  1IN6 A;  1SD7 A;  1F5T A;  1KU7 A;  4E70 A;  2EJR A;  1QQI A;  3E6M A;  1SMY F;  2MA3 A;  3HHH A;  2QQB A;  2EV0 A;  1MKM A;  2UZK A;  2E1C A;  1JHF A;  2PFB A;  4GGG A;  3VEP A;  2ZCW A;  4AIH A;  4KN4 X;  3LAJ A;  1SFU A;  4UV8 A;  4OMY A;  3DPT A;  2DW4 A;  3E5Q A;  4N9I A;  4UV9 A;  1BIB A;  2CSO A;  3I58 A;  4RAY A;  2VE9 A;  2G9W A;  3EET A;  2LF7 A;  2RVC A;  4L0Z B;  2A61 A;  2EFP A;  3WTU C;  3HYI A;  3ZPL A;  1IW7 F;  3L09 A;  3ZMZ A;  1TNS A;  2KRF A;  1H9G A;  2HKO A;  2OQG A;  2X0L A;  3RJP A;  4XLN F;  4EM1 A;  4L5I A;  5BOX A;  3FZV A;  1UFM A;  1WQ2 A;  4HBL A;  1JHH A;  3GFM A;  4EQQ A;  4O5V A;  4CO8 A;  2ZFW A;  3GVA A;  4FX4 A;  4M71 A;  2QWW A;  5L3C A;  3AAF A;  4PCQ A;  3M1E A;  4ZZL A;  1PDN C;  3WE3 A;  1L3L A;  3D5L A;  3BJ6 A;  1U8R A;  1IRF A;  5DUI A;  2V1U A;  5FD5 A;  2LF8 A;  3ZP5 A;  3K2Z A;  2MC3 A;  4GCV A;  1FY7 A;  5DCM A;  4EV0 A;  1HXD A;  1YW9 A;  3CUQ A;  2RGV A;  1HKS A;  2YSR A;  1HKQ A;  5LRS A;  4MNU A;  4OIR F;  3ROU A;  4G6D A;  1S8N A;  3KP4 A;  4YG2 F;  1ZGJ A;  4RGS A;  3ECO A;  3GYH X;  2P7C B;  5HS8 A;  3RKY A;  3J7A O;  1XGM A;  3WTT C;  2L4M A;  2P5L C;  1UHW A;  4YFX F;  5JR3 A;  1U5T A;  4BH9 A;  1MGT A;  1XMK A;  3BJA A;  3F8C A;  4ZZD A;  2GAU A;  3ZN1 A;  2H6B A;  4OIO F;  1RIO H;  3FM3 A;  4OOI A;  3QRF F;  3U2R A;  2ZXJ A;  2K27 A;  1BIA A;  1BI2 A;  1XGN A;  1R1U A;  4MGR A;  5FD6 A;  1G6N A;  5EEH A;  3KZY A;  1KQ9 A;  4EJU A;  4LLL A;  4KFC A;  3MEX A;  5DDG A;  2DPD A;  2CWE A;  1YYV A;  1G3T A;  4JK1 X;  2NRA C;  4WXD A;  3ML6 A;  1BI3 A;  4HX4 A;  1O3Q A;  4UNO A;  2HTJ A;  5HS9 A;  1ZG5 A;  4NQW A;  4MEX F;  4U0W A;  1BI0 A;  1TQM A;  1DPU A;  3QP6 A;  3BP8 A;  2YX7 A;  1F4K A;  4YIF A;  5L3G A;  1XSV A;  4ON0 A;  4HYE A;  1IN8 A;  2XAH A;  2D2W A;  5L3E A;  3DPL C;  5HOO A;  2V79 A;  4LG0 B;  2YPR A;  3CJN A;  5E20 A;  4L9T A;  3KP5 A;  3LAP A;  4IHS A;  3U1D A;  2O6G E;  2HQR A;  2P5V A;  2VBZ A;  2P4W A;  2E7W A;  4HV6 A;  2XAQ A;  2PLY A;  2HEO A;  1LDK B;  2XKP A;  4UXN A;  2F5F A;  2O03 A;  1GVJ A;  3TDU C;  1KYW A;  4FX0 A;  3NQO A;  4L9N A;  4UUV A;  3J80 Z;  1QO0 D;  3K0L A;  1WRJ A;  1RUO A;  3WTX C;  2DO7 A;  1KYZ A;  3KP6 A;  3ERE D;  2CFX A;  2Q8K A;  5FLX K;  2JZY A;  1UST A;  4Q4Z F;  4BXU A;  2GWR A;  4MQV A;  1DDN A;  4XSX F;  3KLO A;  2ETH A;  3EYI A;  2JPC A;  3ABU A;  3JAM K;  1UHM A;  3WU1 B;  2Y75 A;  5A2Q Z;  5K1Y A;  5DUK A;  4LK0 F;  4KIG A;  2QVO A;  1P4X A;  1SMT A;  4MEY F;  4BHC A;  4LFU A;  5LRR A;  1XGO A;  1Z6R A;  1SFX A;  5EEG A;  2ISZ A;  2KJB A;  4ESF A;  2DQR A;  1G3Y A;  4OIN F;  1GXP A;  1W4M A;  2H09 A;  1FSH A;  3KFW X;  5JI6 A;  3KEQ A;  3REO A;  3F6O A;  4A5N A;  3C18 A;  3QAH A;  4FHT A;  3TQN A;  3R6S A;  3M9A A;  2NNY A;  2Z5U A;  5E8G A;  2DTR A;  2J5O A;  1BM9 A;  1U6G A;  2IA1 A;  2RDP A;  2FQ3 A;  2OA4 A;  3VB2 A;  2DBB A;  1W7P A;  4LB6 B;  1TTY A;  1XCB A;  5CVV A;  3JTG A;  1JXS A;  1DUX C;  3HIF A;  1LDJ A;  2YU3 A;  2ACJ A;  3T0Y A;  1Z6T A;  1FT9 A;  1G3S A;  1C0W A;  1AOY A;  1OYY A;  4WWC A;  1D5V A;  3MCZ A;  2AS5 F;  4ASN A;  1Y0U A;  2HYF A;  3I59 B;  4OMZ A;  3CUO A;  2VOO A;  3O3K A;  3ECH A;  4A5M A;  1FYL A;  2BEO A;  3VOD A;  3TO9 A;  2WWY A;  4CXF A;  2QZ8 A;  3RIR A;  3P9I A;  3K1P A;  5E17 F;  3S2W A;  2FNP A;  5DD8 A;  4G9Y A;  3FMQ A;  1IUY A;  3KP3 A;  3LQQ A;  5ERI A;  1RNL A;  1DPR A;  2WV0 A;  5AON A;  4PGG A;  5IT9 K;  1Q1H A;  1P92 A;  1ZG1 A;  5HLG A;  5E1Z B;  4H0E A;  1T38 A;  2VT2 A;  2A5Y B;  1XMA A;  2KIU A;  2FF4 A;  2FMY A;  2NAZ A;  3J81 Z;  3E6B A;  2JT1 A;  2AXL A;  2O3F A;  3E5U A;  3F3X A;  1AWC A;  5LLQ A;  2COM A;  3WU0 A;  1P4W A;  5CVR A;  4KMF A;  2QQA A;  1T0F A;  1K6O A;  2Z3Y A;  2GXB A;  3E3V A;  2FE3 A;  1X3U A;  1R1V A;  3MWM A;  3WTS C;  1A04 A;  1MD0 A;  5HS7 A;  2QLZ A;  2W84 A;  2NNN A;  1PP8 F;  1TLH B;  2FBK A;  2MLK A;  4LJZ F;  4DNC A;  1J0R A;  1U2W A;  1QZZ A;  3FF5 A;  3BDD A;  1EH8 A;  2FA5 A;  2RQP A;  3I64 A;  4HOB A;  1W5T A;  4GYI A;  4AWX B;  3ISP A;  5E1W A;  5TRD A;  4G8X A;  2RV8 A;  1MJ9 A;  2XRO A;  4B8X A;  4IRG A;  1RZ4 A;  2CO5 A;  4L9J A;  1XN7 A;  4N0B A;  3WOD F;  3GX4 X;  2D45 A;  4JBA A;  2HWV A;  1GXQ A;  2M45 A;  1Z05 A;  2M87 A;  3DP7 A;  1S7A A;  1FC3 A;  3FMS A;  2VN2 A;  4DQ2 A;  1HSJ A;  2F5E A;  4P5O A;  3QP5 A;  4ENK A;  4A12 A;  4I98 B;  3SQN A;  2OQR A;  3GUD A;  4RS8 A;  3DXJ F;  2GIV A;  4ENM A;  1XDS A;  1YO5 C;  3B02 A;  1ZAO A;  4HX7 A;  1XSD A;  4ETS A;  3WTZ A;  2L01 A;  4P96 A;  1ZRD A;  1S29 A;  1MJB A;  4MTE A;  5H20 A;  5D5X B;  4R8H A;  1J9I A;  1W7P D;  3DF8 A;  1T98 A;  4IVN A;  4WK8 F;  3N4M A;  2VT3 A;  1USS A;  2XAG A;  2PEX A;  1TBX A;  3M8E A;  1YIO A;  4QWQ A;  4K2E A;  1HW1 A;  1I27 A;  4AVP A;  1F9N A;  3RDI A;  3HSF A;  4RB1 A;  3Q5F A;  2VBY A;  3V7R A;  2FBH A;  5ICE A;  3FXR A;  1I1G A;  3F72 A;  3P9K A;  5CVJ A;  3SFZ A;  3PQK A;  2UXX A;  2PMU A;  4M9Z A;  2Z33 A;  5DD4 A;  3PFI A;  2H27 A;  4IRH A;  3BJO A;  1NHA A;  1BJA A;  1K7A A;  5KK1 A;  1IAW A;  4HZF A;  2R3S A;  3JW4 A;  4M9S A;  4HQM A;  1LEA A;  2WTE A;  1FYK A;  3K1M A;  2FOK A;  3FWE A;  2RNJ A;  4CZZ A;  3P7N A;  1LJ9 A;  2XAS A;  2GQQ A;  4KIB A;  1J5Y A;  4M72 A;  4Q48 A;  2JPB A;  2XV4 S;  4O6J A;  2O8X A;  3F23 A;  1IZ1 A;  2XRN A;  4YII A;  4EGY A;  5KVR A;  4ZYE A;  3LA2 A;  3V7C A;  1J7K A;  3GF2 A;  3C7J A;  1ZRC A;  4I01 A;  1YS7 A;  2R7F A;  2ZJ2 A;  1KQ0 A;  2A69 F;  3E97 A;  4WXC A;  3Q9V A;  2XVC A;  1B6A A;  3I71 A;  4HW0 A;  5FGM A;  3T8T A;  3CUQ B;  5F1R A;  3FMR A;  4MTD A;  3DKW A;  2X4H A;  2DI3 A;  4BQA A;  2HS5 A;  3ZMV A;  4CGZ A;  4KN7 X;  2ELH A;  2ADU A;  1T6S A;  1QNT A;  3IL2 A;  2PQ8 A;  1ZRF A;  2QBY A;  4M74 A;  1Z1D A;  2F2E A;  2KKO A;  3LA3 A;  1JGS A;  2BGC A;  3W6K B;  1FSE A;  1FP2 A;  1R36 A;  1T2K A;  5FFX A;  4CIC A;  1B9M A;  3TO6 A;  2ZME B;  5K5R A;  3OOP A;  3GO5 A;  1KGS A;  1ON1 A;  4KIF A;  3ZN0 A;  3VFZ A;  1J59 A;  2VOD A;  1ON2 A;  3D0S A;  3GZ6 A;  1V4R A;  4KMU X;  2W57 A;  2HDC A;  2XKO A;  2YR2 A;  2PN6 A;  5K5Q A;  3QPH A;  3HOT A;  4HF1 A;  2CGP A;  2DQL A;  3GLX A;  1WI9 A;  4KIC A;  2Y0M A;  5CJ9 A;  3V8K A;  4G7Z F;  2JTV A;  1STZ A;  2IW5 A;  2RC4 A;  2XAJ A;  3R0A A;  4RGU A;  3RYR A;  1B9N A;  1ZHF A;  4I09 A;  5ICC A;  3T1B A;  4ZYH A;  3B73 A;  2MBF A;  5D5W B;  2IT0 A;  1E2X A;  2MD5 A;  5HLI A;  1HKT A;  5JVT A;  2HZT A;  5D4R A;  1KA8 A;  2V1D A;  2HGC A;  1B59 A;  3C3W A;  2KJC A;  3RPQ A;  1Z91 A;  4O3M A;  4CYD A;  4KT5 C;  1OYW A;  4OU0 A;  3EDP A;  2Z9O A;  2EA4 A;  1R5G A;  1RI7 A;  3E6D A;  3DQV C;  2STW A;  2BBY A;  2RN7 A;  1ZG3 A;  1FYM A;  5HDG A;  2HTS A;  1FPQ A;  3O6B B;  3SHF A;  2K7L A;  4I2O A;  1R22 A;  1JE8 A;  3NRV A;  4I0B A;  5ILU A;  2GXG A;  2EB7 A;  1XB4 A;  4MQ9 F;  4GXO A;  2HYG D;  4WX9 A;  3BY6 A;  1ZRE A;  4HF2 A;  1O3R A;  2CQK A;  3CUQ C;  3PQJ A;  1KQ8 A;  1EH6 A;  3C1D A;  3FHZ A;  1O3T A;  1ZLK A;  2EWN A;  1U78 A;  2QUF A;  4AIJ A;  3BZ6 A;  4FT8 A;  1R23 A;  3I59 A;  3MFK A;  3G73 A;  4RB0 A;  2UXN A;  4G7H F;  4WCG A;  4D0P A;  3WTY C;  1J2X A;  1YS6 A;  5LGT A;  1UB9 A;  5ILS A;  4BHB A;  1YW7 A;  4M6Y A;  1FP1 D;  5LHG A;  4ESJ A;  2GA1 A;  2L3D A;  5LBQ A;  1RUN A;  1SD6 A;  3KLN A;  1MDM B;  1U5T C;  2ZNY A;  3COA C;  4LD5 A;  2XGX A;  4BHP A;  5CVU A;  1IXS B;  4EJO A;  5FLX Z;  1UCR A;  3BRO A;  2P8T A;  4YFK F;  1ZGA A;  2FXA A;  3JAM Z;  2GA2 A;  1OR7 A;  1FBQ A;  5D6E A;  1OMI A;  2EA2 A;  2P7V B;  3F6V A;  2L02 A;  3R4K A;  4YFN F;  3HUG A;  3QOP A;  3IWF A;  5DV5 A;  4XLP F;  2V6C A;  2L4A A;  4UVC A;  3F8M A;  2NS0 A;  4RB3 C;  1R5H A;  2R7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...