4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
2V9VA 3O7WA 1OYWA 3HUGA 2PGXA 4ZYDA 2FU4A 4N0BA 3EVEA 3C6MA 2HR1A 4QDJA 2NRAC 4PYOA 3EMBA 2GPYA 2ZBRA 2VONA 4F84A 2ZIEA 2VXZA 3P2KA 3OZSA 1AOYA 4EM1A 4E30A 1IF1A 1B42A 3FUWA 3RI4A 3V8KA 3P9NA 2O0YA 1IN8A 2PY6A 5F1RA 1I6XA 3KR1A 4OIPF 1F1ZA 1REPC 2GA2A 3TLJA 3ERCA 2UXNA 1PJZA 1BHJA 2PSSA 5C0OE 1NV8A 2Y75A 4WVLA 2OAZA 1Q0SA 4FS8A 4LWOA 5B1SA 2NNWB 3QU3A 8MHTA 5LQNA 5EZSA 5IH3A 3BGDA 3FPEA 3DXYA 1SD6A 1YLFA 1FBNA 3GFLA 1WG8A 1BBYA 4RGRA 4NHJA 4A0XA 3HTXA 4LG1A 3TO9A 5DM1A 4QPPA 2GWRA 5DYMA 3T7SA 3DP7A 1KGSA 5D1NA 2FF4A 3KETA 1Q0TA 2AZTA 4A5MA 3KHKA 2CKDA 3HA5A 5CJ9A 5DXAA 4GCVA 5LSAA 3DH0A 1D3YA 3V7RA 4KN7X 1MJ9A 3UJ7A 1L0OC 3S2WA 4YFKF 5L3GA 3ZP5A 1PP7U 2DTRA 4X41A 4PYIA 3AWIA 5K0CA 3FXRA 3VC1A 2NXNA 4RB0A 2FRHA 4BHCA 2PLYA 3SR4A 4DM3A 3G8BA 3IV6A 3GUDA 5LGTA 4U88A 2G72A 1IN6A 1R5GA 4BP3A 2IH4A 3QP5A 5D5UB 3FX3A 4C05A 4UHTA 1XVAA 1XN7A 3TDUC 5J6XA 3OU6A 4HRAA 3NTVA 3FF5A 4KMUX 3FPJA 4DQ0A 2MD5A 1TW2A 5DV5A 3J80Z 3TDZC 1L3IA 3MZHA 4RTQA 2FA5A 4EJOA 5EOVA 5E8RA 2W85A 2VODA 2VDWA 2E7WA 3AAFA 3ME5A 1CGPA 3FPGA 2DW4A 2DO7A 2Q0OA 4RAZA 5HS7A 4E2ZA 2CL5A 3EGVA 3P8ZA 4RGSA 1KPIA 4BYYA 3A4TA 1ZLKA 4GOOD 3OFJA 4JQFA 2RKHA 2ELHA 3TKAA 3T8TA 1ZQ9A 4P9FA 1R00A 3WTTC 4RB2C 5LRRA 5LRSA 4AZSA 1B9MA 3WTSC 3CJNA 4BLWA 5DX0A 1W5TA 2EX4A 1K7AA 4MQ4A 4G6QA 1FJXA 4L9VA 4EKGA 1ODDA 3NDIA 3HA3A 2OQRA 2JPBA 2OB1A 4KN4X 2XVAA 3E5QA 5F64A 1T38A 4O3MA 4PYMA 5FHQA 4AZWA 3BXOA 1XGMA 9MHTA 2Z6UA 3FTDA 1X19A 3E7PA 3LAPA 3F6OA 4ISCA 4ER7A 3TQNA 2G1PA 1MGTA 1Q1HA 4PYKA 4UVAA 3JTGA 3UZUA 2KIUA 3R61A 2PJDA 4RGUA 2G7UA 1NT2A 3HYIA 3DTNA 1B1BA 5EEGA 4YFXF 2FRXA 5M5BA 1QAMA 5KQRA 3E6BA 4RAYA 3TO7A 4CO8A 1BC5A 3A27A 3SVZA 2AS5F 3RPQA 5DRYA 3KFWX 4PYQA 3TOBA 1LDDA 4EM2A 3ZN1A 1YG2A 4BXUA 2PQ8A 2IA2A 3PFIA 3GRVA 3ELKA 2JHAA 1J9IA 3KQOA 3OU7A 1WWXA 1S8NA 2P5VA 1U2WA 4KUMA 3ZMTA 3PB3A 5T6BA 1O3RA 2PG4A 4GUAA 1YW9A 3UA3A 1S29A 1XDSA 2DAOA 1P6RA 1ZGJA 4ETSA 5CLSA 4P5OA 1XDZA 3H3ZA 3N4MA 3FXUA 3TOAA 4RVHA 5DDGA 5A2QZ 3IEIA 2MA3A 4BHPA 2B0LA 4LB5A 4EGYA 2BBYA 1U8RA 1H9GA 5L3EA 5EEHA 2K4BA 4PCQA 1VPTA 2XYRA 3GRRA 3ZMSA 1I1NA 3M4XA 2HTSA 3T8RA 5FGMA 4HTFB 2W57A 3REOA 3BOQA 2A07F 3G2QA 1LB2A 1JXSA 1JQ3A 3TRKA 4KIBA 3A26A 2V1XA 5GM2A 2GS9A 2Q41A 2O06A 4RTNA 4FR0A 5DXJA 3OPNA 4XSXF 4N9HA 4L9TA 1MJFA 4HAMA 4GC5A 4X61A 2DFIA 1INLA 2H94A 2P7VB 5E2BA 5EMMA 2IPXA 1D5VA 4A0ZA 4CZZA 3DXXA 1FBQA 2IDJA 2OO3A 1QZYA 1J75A 5H02A 5H6QA 2ZFWA 2FXAA 2HQNA 5GWXA 3I59B 4RSRA 3CLOA 5E9WA 3K9TA 4JXJA 2K02A 1JG2A 2PWYA 3DLIA 3C6KA 4RVDA 3BJOA 2F5FA 1HW2A 1ZREA 3OV8A 1ZRDA 4LECA 3E3VA 1ZRFA 4EJUA 5C9ZA 2BE5F 2M8EA 5EZQA 5EMKA 1FYLA 4NQWA 1VP3A 3WGIA 5FCDA 1HKSA 4QLCU 4EQQA 5E9JA 1AQJA 3KPJA 4GOND 5JR3A 4HTFA 1FYMA 3ID6C 3HIFA 2ZNYA 1Z05A 2A69F 1EJ6A 2O61A 1KP9A 5BOXA 2JJQA 3P2IA 1D2GA 3THRA 3BJ6A 1OPCA 3O31A 3R9XB 2EFWA 2AVDA 1P1CA 4RV9A 5EG5A 2JHPA 1ORIA 1XCVA 4HF1A 3FTFA 3DV8A 3FUVA 4RB1A 2ZLBA 1AV6A 4RTMA 1RIOH 3F8BA 3I59A 5HOQA 2KIFA 1TBXA 3AY0A 3I9FA 4KWCA 2RDPA 3TGNA 2D1VA 1HW5A 3KQVA 3WGHA 3EEOA 5HILA 1BM9A 2Z5UA 3PLAE 2X0LA 4KDPA 5F2KA 1HXDA 3P9KA 4WCGA 3HVJA 2QM3A 4A6EA 2JZYA 2OB2A 2FE3A 5FWAA 2YX4A 3A7EA 4OBWA 4MHTA 3FTEA 4I7HA 5LLQA 4RTJA 3OZTA 5CVVA 2O57A 3CJTA 4XUEA 2ZIFA 3MQ2A 1EH8A 3OE4A 2IJLA 2R7FA 3DFGA 3B3FA 2EK5A 3KPWA 2D1HA 2VC0A 4E70A 4M9SA 3SM3A 2P7CB 4HW0A 5H6RA 4UXNA 4YUWA 3K2ZA 4CXMA 3TO6A 1Z6TA 3GO5A 2MBFA 5CIYA 2LDUA 1T2KA 1FY7A 4CHUA 4RTPA 5C1IA 3LL7A 2A3SA 1RJEA 1T43A 3T0IA 3DQVC 1KYZA 3D0SA 5KVRA 5DM4A 3NRVA 2AOUA 4KW7A 1EIZA 4QVKA 2MH2A 1E17A 3GNLA 2PV0A 3M7GA 4LG0B 1LQ1A 4KNYA 1ZG5A 2O8XA 5FB2A 1MDMB 5K01A 3VSEA 2IDKA 2O05A 2XRNA 2OY0A 1U78A 5CUQA 2HV9A 4I02A 3KEOA 1YB2A 4KVZA 1H9TA 3KPYA 3B7PA 2XIGA 3HVKA 2Z9OA 3FZGA 3I58A 1L9KA 4U0YA 5FQOA 2V1DA 3GFMA 5LHGA 3MCTA 1LVAA 2EV6A 3Q5FA 5ICFA 4Y15A 5FULA 3EYYA 3M6WA 4E32A 2UYOA 2DPMA 1YW8A 4XLNF 4L0YB 3LBFA 3WE2A 3IYLW 3Q7EA 1R1VA 4AWXB 3BP8A 3EVDA 3NJRA 4G7HF 4PYNA 3KE2A 1O3TA 3FM5A 2P6TA 2JTVA 1PRYA 2ZBQA 2HKOA 1TPYA 3HM2A 4HG2A 1D2CA 3EYIA 4GYGA 1VIDA 2P40A 3LPMA 2OQGA 4RTSA 2YVLA 4OIRF 3RJPA 1WXXA 3FMQA 2XHKA 5E9QA 5CVRA 4IRIA 2EFPA 4HV5A 3QAHA 1IY9A 4P7JA 5DCFA 3C3YA 3LA3A 1ORHA 2KKOA 3CO7C 5E17F 1GVJA 4F7ZA 1NW7A 1NHAA 2VE8A 4EKIA 5K05A 4AX8A 4MQVA 1NV9A 2P41A 3G2MA 1EQAA 4HLXA 4P7FA 1SMYF 1MJBA 3ZMUA 3ZMZA 1L3CA 3KP5A 1MDMA 4YIFA 1IXCA 3KPVA 3R60A 2ZCWA 3KR9A 3BWMA 1HKTA 3IRRA 1WI9A 5K0NA 2ADUA 1PUEE 3CC8A 1KQ8A 4HF2A 4EMSA 5DD8A 2UZ4A 3MERA 1JG4A 5K5OA 3GFIA 2OKCA 5LEKA 3GCZA 3J80K 5T67A 4O5VA 1L3LA 5L3BA 1BN5A 1XB4A 2YU3A 4TV7A 3DMFA 2X4HA 3F8NA 5CYVA 5GM1A 1P4AA 4HDVA 4F86A 3K1MA 4YG2F 4MGRA 1EV7A 4U7TB 4M9XA 3WTXC 4LB6B 2V79A 1HSJA 3KKZA 3HNRA 4UOEA 3JAMZ 2PXXA 2O3FA 3SXJA 5LGNA 2UXXA 1G6Q1 2PWPA 2M87A 2HGCA 5CVEA 4FX4A 1JQDA 4IHTA 2OA4A 1OR8A 5HFJA 3P7NA 1X1AA 2IIPA 2XVMA 2E5WA 5CCBA 2OZ6A 2MLKA 3DPLC 2ZZMA 5E1ZB 3EUHA 4KA4A 4XSZF 3F23A 4LLNA 1XCLA 3C7JA 4A0YA 1J2XA 3O3KA 3K6RA 2LF7A 2EJTA 4YV2A 1GHCA 1KXZA 5EIWA 2YXLA 1JGSA 5E1OA 2UYHA 1ON2A 1S6LA 5FHRA 3ABUA 2YR2A 1IRGA 4POOA 3D2LA 4P7GA 3GU3A 5ICGA 3HRSA 4LK0F 2EV0A 1VBFA 3PTAA 2QRVB 3DKWA 3LAJA 3UJCA 1R7JA 3M6VA 2UYQA 1V39A 1FBUA 3GGDA 2KW5A 4WK8F 1G3YA 4N9IA 2L4AA 5ED4A 3M8FA 4ENMA 5HEKA 2EJRA 5DTRA 1S3JA 2RVCA 5HIJA 3KU1A 1O54A 5GIOE 1R58A 3A7DA 1Z9CA 2C7RA 2OZUA 3DPTA 2AVNA 3DEUA 4DCGA 1FBSA 3M9AA 2FHPA 3ISPA 5F6FA 2E1NA 4U0VA 1O9GA 1K6OA 2PMUA 2ZCJA 2OBFA 3UJ6A 4DF3A 4UVCA 2FEZA 1RUNA 2YR0A 4FP9A 3EEYA 5LHHA 2AOWA 2Q2EA 3UJ9A 4P9UA 3EETA 3KP6A 1DDNA 4KT5C 4DQ2A 3J81Z 1E2XA 3GX4X 1R36A 1YZ3A 2ERCA 1I5ZA 3ECOA 3FM3A 5DCMB 2PN6A 3RYRA 3NMUF 2QWWA 1FOKA 3V7SA 3JWHA 1SAXA 2AOVA 3BJAA 4AVPA 2AXLA 3KLNA 2QE6A 4HSGA 4HX8A 4I2OA 3HOTA 2B78A 2I7CA 2OXTA 5J8CA 5A2QK 1G55A 3L8DA 4ZH4F 4MWZA 4M73A 5L3DA 5HS9A 2QRVA 4X60A 5LGUA 3QRFF 4ENJA 3B89A 1QYRA 1B6AA 4R6XA 5IT9Z 2GAUA 1OR7A 3PX3A 3JSPA 5EKUA 5EGSA 1AQIA 2CYYA 3I71A 3HP7A 3NWBA 4PYLA 5E8GA 1SMTA 2NXJA 3GDHA 5KK1A 2WTEA 5D5XB 5J8FA 3FYCA 5DM0A 2R3SA 2VT2A 4QTUB 1TQMA 4PCLA 5EQJB 3PT9A 5LQCA 3BZBA 3T7TA 5DM2A 1FZPB 3DULA 5BW4A 1UIRA 2P7IA 2PVCA 3WSTA 2STWA 4Q48A 1XXLA 1BIBA 2M5WA 3LA2A 4HQEA 4BY9E 3R0AA 1ZKDA 2O07A 1MJAA 1IUYA 1IM8A 2JT1A 2Y0MA 4ATNA 2A5YB 2B3TA 3E5UA 3IC7A 3BY6A 4IPAA 2V7EA 1YF3A 3OFKA 1G6NA 3UJBA 3M33A 5FUBA 2Z6AA 3FRHA 5E1XA 1SQGA 2CQKA 3C3WA 3P2EA 4OMZA 1V4RA 4H0EA 4KIGA 4HOBA 2VBYA 1P91A 2EB7A 3MQ0A 2DULA 1ZHFA 3PVCA 2PBFA 5AIPA 4EVIA 1JHFA 3TOSA 3ECHA 3F21A 5FADA 5T64A 4EQZA 2ESRA 2ZVJA 4YV1A 1S7AA 4PIMA 3L7WA 4DZRA 4GF5A 4EJWA 4G8XA 4R1HA 5D6FA 4ZZDA 4RB3C 3E6DA 2LKPA 4G94A 1S7OA 3KQSA 4M37A 2I9KA 1BOOA 1XJ5A 3N97A 1VL5A 3M8EA 1FSEA 5LQKA 5CM2Z 1UCRA 2G71A 4L5JA 2AS0A 2L3DA 1IAWA 1BI1A 5DD4A 4KYWA 4G7OF 3HVIA 3SMQA 4UV8A 2ISZA 2BR5A 2C7PA 3FPHA 1F4KA 1BI3A 3LDFA 1GXPA 1XCJA 4KDRA 3M6XA 4R05A 5H20A 3ORHA 1OYIA 2VN2A 1HBXG 2RC4A 2CWWA 2YSRA 5GIPE 5FO5A 5BXYA 2GZWA 3JSOA 3ER8A 3L2CA 5D6EA 3B3GA 4JK1X 3EMDA 4HC4A 3U9GA 2ZJ2A 3MAGA 3I5UA 2HEOA 2HYGD 4Y2HA 2H1RA 1DUXC 3FUXA 2P5KA 5K0EA 2FMLA 1XGNA 5JI6A 5F2OA 3HCBA 3HCAA 4HLYA 4I09A 5HLHA 2H09A 1FC3A 3FWEA 4QQNA 2O0LA 1R1TA 2HTEA 4R79A 4MTLA 5KQSA 3DMGA 3X0DA 4OU0A 2HTJA 1VE3A 1GXQA 2VZ9A 1QAOA 1XSDA 4P96A 3MWMA 1WQ2A 2ESNA 2IFTA 1BIAA 3DMHA 2FNAA 1IXKA 4L7VA 1RI3A 1JTFA 3RTRA 4FX0A 3H92A 1BOAA 4RYLA 5AONA 4L9JA 3QU6A 3Q9VA 5K0BA 2N47A 2PKWA 4ZYHA 3Q9SA 3DXJF 1IXSB 4PIPA 3NVKI 1D2HA 2IBTA 3T5XA 2MLGA 2A68F 4YUZA 2XBMA 2DQLA 2QQAA 2Z33A 2STTA 3DLCA 3KLOA 1RJDA 4DA4A 4IXAA 4WXHA 1G4DA 4FGZA 1SFEA 4YUYA 4XCXA 5HS8A 5E18F 5GP1A 3LX6A 3BROA 2P8TA 4XLPF 2BR3A 4FT4A 3GW2A 2PX4A 2AOTB 3BKWA 2D45A 5U4XA 4G9YA 3HRMA 1RI2A 5HLIA 2A6HF 3LSTA 4CDGA 2EWNA 5DUKA 3B02A 4MIKA 2BEOA 1QBJA 5GOZA 1L3BA 2CG4A 3JWGA 2TDXA 3TKYA 3SSOA 3G73A 3COAC 2YX1A 1R8YA 1FYKA 5DWQA 1PDNC 1SD5A 2K4JA 2GAFA 4UUVA 1DUSA 4IRHA 1EAMA 2ONZA 4LFUA 3SGLA 2ZWAA 4AIJA 4RS8A 3HTSB 3LDGA 3NVMB 4DKJA 3TMAA 4FSXA 4YMHA 3ANXA 1JG3A 3IRQA 3J7AO 1DPUA 3RYPA 3HCCA 3IWZA 4OIOF 2NXCA 3WTUC 1N7JA 2K86A 3GZ5A 2P4WA 2H27A 4M6YA 2IT0A 2AOTA 3LKDA 2FK8A 3F72A 3R0JA 4U7BA 4DCMA 4G6DA 2Q8KA 1VTNC 2PI0A 4PWYA 5K1YA 1LDJA 4CTKA 4RTOA 1XGSA 1F9NA 3FMRA 1YFHA 2VDVE 4UNOA 1UHMA 2GXBA 3R6TA 5D8LB 2H11A 5CVIA 3K0BA 5DUIA 3LQQA 4RTRA 2A14A 3JAMK 1R23A 4LJZF 5EVJA 3RW9A 1G3TA 2VE9A 3KEQA 2P3LA 2Z3YA 3LFKA 4YMGA 5DTQA 4HZFA 2G70A 5DSTA 2XUBA 2IBSA 4UV9A 4AZVA 1M6EX 3BT7A 1KU2A 1WS6A 3I53A 5K8VA 2EA2A 3IHTA 5E20A 1FSHA 3JWIA 5K09A 2PJPA 5LBQA 3CDHA 2AN3A 1PP8F 2ZNZA 1W4MA 3OCJA 3OE5A 3FHZA 4Q47A 2YUIA 4IHSA 3MHTA 4YFNF 1X1CA 5BPIA 2ZFUA 1XMAA 3KP7A 5LR6A 2IW5A 2VT3A 2AN5A 4IV8A 4RGXA 4PCAA 2IH2A 3OOPA 1BKYA 3LHDA 3UJ8A 2PX5A 1IRFA 3EVGA 2XAJA 1EG2A 2ZTHA 4M7RA 1VP9A 3EGEA 2OZVA 3ML6A 3UJAA 1TTYA 3H2BA 3OZRA 3PQKA 1O3SA 2DI3A 3HHGA 1ZGAA 3HCFA 3GF2A 5EHGA 1TLHB 3L00A 4K2EA 2I6GA 1QGPA 1MZBA 2IVMA 4LLGF 1WY7A 3BWYA 1MKMA 4NB5A 4E33A 2W25A 2XV4S 2OD5A 3F22A 3HRTA 5CVDA 1B9NA 1USSA 3KQWA 3FUUA 3PQJA 2F2EA 4B17A 5D4RA 1U5TB 4BNCA 4HX7A 3J81K 1YQAA 2HQRA 1O7LA 3RKWA 3F8FA 3BGVA 2COMA 2Y1WA 1G3WA 5FTWA 5LQUA 1STZA 4C03A 4U7PB 2QLZA 3GVAA 4MQ9F 1EH6A 2V6CA 4PGHA 4PYJA 5P8WA 4MTDA 2P7HA 5BPDA 4HF0A 2MC3A 4A6DA 2ZULA 3NDJA 2V74B 5CD1A 2K4MA 1DP7P 3PX2A 4ON0A 3BPXA 1U3EM 1O7FA 5EMLA 4S05A 4CKBA 3HA7A 4HH4A 1TNSA 3PFHA 4Q4ZF 2WA2A 1FX7A 1JTEA 5IT9K 2L54A 4LG0A 2KJBA 4RX1A 5D1HA 5EPEA 1RJGA 1EJ0A 1J5YA 4U0WA 3C3PA 3NQOA 4RWZA 5E1BA 2M45A 3CBGA 1V3FA 3GWZA 1KU7A 4MEYF 5LEJA 4B09A 3ELYA 5D8KB 1ZAOA 4PDKA 2GH1A 3B5IA 2F8LA 1LEAA 1YFJA 4S04A 2WV0A 3LQRA 3SSMA 4K6MA 1I1GA 4XRFA 1MD0A 3U1DA 2C7QA 2P5LC 3G5TA 1UFMA 2DK8A 2L02A 3TFWA 5FLXZ 4CKCA 3KPUA 4YV0A 3DR5A 3DXZA 2NNNA 3KZZA 3V97A 4ZYGA 3FYDA 4AIKA 3SZPA 5EHIA 5DX8A 3ER9A 4WXCA 2VBZA 4L9NA 2R6ZA 1D8JA 4HBLA 5ICEA 1XSXA 3UA4A 2HDCA 1WKMA 2F5CA 2NS0A 2E7XA 5EMJA 5HIIA 4OQEA 1KYWA 2BGCA 4P58A 2IA0A 2PX8A 5EKXA 4JBAA 3P97A 3E6MA 1RI5A 2EJUA 1VQ1A 5KYGA 1UWVA 1Z1DA 1Z7UA 3SXYA 5DPMA 2E1CA 2NYXA 1LNWA 3WE3A 1SUSA 4GOMD 3HCDA 4GO1A 1G38A 3JWJA 1YIOA 1FWZA 3B73A 3LECA 2W24A 1P39A 2ZZNA 2P6SA 4M71A 1P4XA 4Y17A 1SFUA 4ENNA 5CVJA 1G60A 4KICA 5ILUA 3ZPLA 5LQAA 2M1BA 3WU0A 1BC8C 3QOWA 2FOKA 1X3UA 5FA8A 4QPNA 4D0PA 4P55A 3SX0A 3EPPA 3MTEA 1NW5A 2FK7A 1FP1D 2GIVA 2G8NA 2GB4A 4O29A 1MHTA 4OBXA 1YZHA 5ILVA 2CMGA 2JRTA 2H6CA 4OINF 2IP2A 1XD7A 3ULQB 4AIHA 2M30A 5LHIA 1LEBA 3GIWA 4G7ZF 3GRYA 1WZNA 3P9IA 5E8IA 4QQKA 5JVTA 1IN7A 2DK5A 4ESJA 3BWGA 4MNUA 1XTPA 5FA5A 4BLVA 1WRJA 4QWQA 3JW4A 4LGWA 5L3CA 4M72A 1SD7A 4Y30A 4LMYA 2AN4A 2ZWVA 4GEKA 2F5EA 4KFCA 4MEXF 3O6BB 5ILSA 2DLLA 1YO5C 3VYWA 3W6JB 6PAXA 3BKXA 3EVBA 3EDPA 2HWKA 4BAYA 3F3XA 5K5QA 2WA1A 4OOIA 1CF7B 2YTZA 2CW0F 3QOXA 3F8CA 3FUTA 2XROA 4LD5A 1DL5A 2FCAA 3ZN0A 2LD4A 2EFQA 4C07A 1C0WA 2C6YA 3C0KA 1JSXA 2MH9A 4E31A 2KRFA 4QVGA 2QBYB 2PT9A 2IRFG 3WGGA 3ELUA 3TM5A 3UWPA 5EC8A 3T7RA 3UBTA 3LCCA 2V1UA 5HOOA 5DX1A 3NW9A 4LWPA 4I0AA 2FBHA 3C1DA 2BR4A 3HEMA 2VDUE 2ZBPA 3QPTA 3ELWA 5MHTA 5JHUA 1ZG1A 5HVQC 4PNEA 4OX9Y 3KZYA 3PFGA 3G88A 4Y13A 5DT2A 5LQRA 4C06A 4IVNA 2HFHA 1FPQA 3BWBA 2VS1A 2YXEA 4EM0B 5FWDA 5HIKA 1YS7A 5E2AA 1SD4A 3FPFA 1SVUA 3KR0A 1HNNA 3I64A 2OPBA 4R8HA 5D4SA 2CO5A 5DCMA 5BMZA 3CGGA 1UB9A 1P1BA 3EVZA 3R0QA 2P3OA 3GEZA 2O6GE 3BDDA 3CJRA 4HYEA 5K0LA 4ASNA 3AXSA 1QQIA 1F3LA 2XYVA 5HDNA 3PS9A 1HSTA 1TQPA 1OMIA 1XCBA 2L4MA 1HKQA 3I4PA 4U7DA 1TQIA 3E8SA 3NWEA 4MHGA 1ZG3A 3CVOA 2IA1A 1Z91A 1CF7A 4OMYA 4WWCA 2VOOA 1YTYA 3G8AA 2IH5A 4HQMA 4AZTA 3F8MA 1P92A 3KQQA 2XGXA 3HSEA 1X1DA 3HVHA 3UFBA 3I54A 2EFNA 1T39A 1RUOA 1I9GA 3THSA 4C4AA 2ZKZA 3NEUA 7MHTA 2P8JA 1JE8A 2QBYA 3CTAA 3S68A 3GZ6A 2G7HA 1KU3A 3CKKA 4X1OA 4O6JA 3MTIA 2AOXA 5LQJA 1RI7A 1KQ9A 3I0TA 5TJJA 3O4FA 2DU9A 2CFXA 1KIAA 1SKMA 4KMFA 5FFZA 3UJDA 2XKPA 2K7LA 4LK1F 1IW7F 4IRGA 3L09A 1R8XA 3G3ZA 5D5WB 3P71T 3AXTA 3FRIA 4PONA 4YIIA 1W7PD 1L1EA 4OIQF 2C7OA 3RPUA 2DT5A 2R7DA 2K27A 2LSOA 5AIQA 4FHTA 2VOPA 4R8RA 1KPGA 4IKPA 5HZMA 1K78B 2KJCA 3SFZA 3VB2A 5L3FA 1J59A 2JG3A 4L18B 4KIFA 4R6WA 1UFKA 3SSNA 1TNTA 2QZ8A 2XYQA 5K0FA 2B9EA 2QYOA 3WU1B 1R6AA 2CMHA 2JH8A 4HGZA 3KP3A 2WC2A 5ERGB 2VBXA 1D8KA 3M1EA 3G7UA 5TRDA 2WWYA 1G8SA 3QV2A 4G56A 3LWFA 5HDGA 2XAHA 4I98B 1O3QA 3GFJA 2Z99A 3VODA 1Z3CA 1QO0D 3GJYA 1BI0A 3HCEA 5D5VB 2DPDA 4M9ZA 5HLGA 3V7CA 2HMYB 3R4KA 4ENKA 5E8JA 1HW1A 3ZMDA 3SZTA 3ZQ7A 4NECA 2DBBA 3RODA 5FD6A 4M6XA 1SFXA 1NE2A 4EV0A 4ESBA 2A6EF 4L5IA 5ICCA 1Y0UA 2JHCA 1HQCA 2QQ9A 2CSOA 4C04A 2P3QA 4A5NA 2DQRA 2ZXJA 1Y8CA 3R3HA 1NBIA 5FD5A 2FBIA 3P9CA 1WXWA 2EG5A 5JFRA 3EGIA 4HX4A 3C18A 5E1WA 3BPVA 5BQTA 1X1BA 4IJAA 1K78A 2NYUA 1LJ9A 1EH7A 4WF2A 4EJVA 4CGZA 5DSXA 2LF8A 2O03A 2ZMEB 4LLLA 1YS6A 2P1DA 1R1UA 5K0GA 2FNPA 5EIFA 3HRUA 4BHBA 3D5LA 3R6SA 4E2YA 4ER5A 1LDKB 3VOEA 4EJTA 4EGZA 3G2PA 2ISYA 3GYHX 3QPHA 3MCZA 3GRUA 5ERIA 1JSZA 1YUBA 2P35A 2QY6A 3RKYA 4UVBA 3AJDA 4GGGA 5K03A 10MHA 2UWMA 1RJFA 3CO6C 1USTA 3EVCA 4I0BA 2OBPA 2GLUA 5F2NA 1R74A 3BWCA 1O9HA 3KR2A 3BGIA 4MTEA 4GC9A 2QUFA 2QVOA 3HSFA 2PT6A 3QOPA 3Q87B 2XAFA 2BH2A 3GXOA 4PGGA 2PBIA 2PXAA 3MB5A 2XAQA 4YUVA 2YQZA 2IPQX 3K1PA 1YW7A 1DCTA 3KQMA 2FMYA 2BM9A 1KPHA 5BP7A 4H0NA 1KQ0A 4RVFA 2EV5A 4B8XA 2FSWA 4FT2A 5E1MA 5FFXA 3E23A 5CCXA 3RDIA 3MEXA 1SUIA 3IL2A 4I01A 4FT8A 1FT9A 1NKVA 2NP7A 1RNLA 3R24A 1AF7A 1W5SA 4OA8A 2ZMEA 3GLXA 4HDUA 3V8LA 3IKVA 1W7PB 5JUWA 4RTLA 4ER0A 1U6GA 5FLXK 2HYFA 2QQBA 3EVFA 4DNCA 2RV8A 1P2FA 3MAJA 5K0JA 4IF4A 4E2XA 1ZH5A 3W6KB 4KRGA 2JH9A 2W84A 3BZ6A 3TPZA 2YXDA 2AR0A 2AOUB 5CVUA 3WG9A 2HKXA 3HOSA 1ZYRF 4R8SA 2ADMA 4L0ZB 4C08A 3HHHA 3F6VA 2PLWA 1IN4A 1ULYA 2OYRA 2HS5A 4ZZLA 3TM4A 1F38A 2GQQA 1ZN2A 1P4WA 3MGGA 4Z2YA 4CICA 1O57A 1M6YA 2HZTA 4PZJA 5BS6A 5DTMA 3ELDA 3G2OA 3V8JA 1K79A 1NBHA 4YUXA 3FMSA 5FQNA 2H00A 3KQPA 1KR5A 3U2RA 5HDKA 4GBED 3ERED 3HTUA 3BUSA 2I62A 3FTCA 2EA4A 4EK9A 1H0MA 3SHFA 1YYVA 2UZKA 2XKOA 1W7PA 4M74A 2BZGA 1IZ1A 3TQSA 1Z6RA 2ZZKA 4HA8A 1F5TA 4XBFA 3RKXA 1RZ4A 2OU2A 2QENA 5DEQA 4QTTB 2ZBKA 2G9WA 3SQNA 4GQBA 4HGYA 3TR6A 1IXRC 4CKEA 1JG1A 1RI1A 2A61A 2HOEA 3KCCA 3LKZA 1QAQA 4CXFA 3M6UA 1VLMA 3V8VA 3LGAA 3MZYA 3CUQB 4XUCA 5KVAA 1BC7C 3CJQA 3VEPA 1AWCA 2BM8A 2Y48A 2H6BA 2KIMA 4GOLD 3LCVB 1FNNA 3CUQC 2VBWA 2ACJA 4DMGA 3EQLF 3FXQA 2FPOA 3GO4A 1U5TC 2EFOA 2HR3A 1ZARA 2ETHA 1QANA 4ESFA 3KQTA 1NW6A 2CWEA 1JHHA 4GYIA 3VFZA 1I1SA 1B4AA 4M38A 3WODF 2XAGA 1UHWA 3CCFA 4RTKA 1KU9A 3L9FA 2XVCA 1T98A 4V0QA 4RVGA 2Z6QA 2PEXA 1ZLJA 5IT3A 2FQ3A 2RQPA 2RGVA 1TW3A 4A12A 2ZW9A 1N2XA 1H1DA 4P7KA 4OA5A 4X63A 5BW5A 2XASA 3H3UA 2UYCA 4GXOA 3K0LA 5IKMA 4F85A 1WSUA 3WTWC 5HIMA 2YPRA 2IGTA 3LCUA 2ZSUA 1FLIA 1ZRCA 1BJAA 3KP2A 1SQFA 4KDCA 3IHUA 3LBYA 1R22A 3K69A 3ABTA 1M0EA 4CWAA 3O2PE 3CUQA 4BLUA 1NW3A 2J5PA 3RIEA 2VC1A 4HV6A 1U5TA 4Q5SF 4E2WA 1XDUA 4BH9A 1J0RA 3DOUA 2ESHA 1KA8A 2F5DA 3M70A 1OKRA 4BP1A 4ZTBA 3G89A 3DF8A 2J5OA 3WTYC 3QP6A 1G8AA 3LA7A 1BI2A 3U81A 2GXGA 2YX7A 1XGOA 3E5XA 3IWFA 1SG9A 4PINA 5DLYA 2FBKA 2GA9A 4IV0A 4ZYEA 2RNJA 3JTHA 1JR4A 1DPRA 1QNTA 1JQEA 1HMYA 1YFLA 4A2UA 2PMHA 3RIRA 3IKTA 4FSDA 3EVAA 2BYVE 2ONYA 2WK1A 5E1DA 1A04A 1T0FA 2CGPA 3T1BA 2EFJA 4ER3A 4CTJA 1FP2A 4FZVA 4XUDA 2BV6A 1RI4A 3DUWA 1T6SA 1ON1A 1XMKA 4WX9A 3B3JA 3FZVA 2LNBA 1U2ZA 2NXEA 2Y1XA 3LDUA 4BQAA 3ZMVA 2NAZA 3A25A 2PFBA 2ZO4A 4IWNA 1OYYA 2D2WA 3GRZA 1I4WA 1I27A 3KP4A 2HNKA 2PX2A 4WXDA 3MFKA 4QDKA 5K5RA 1ONVA 2HWVA 2GA1A 3E05A 1IN5A 3F4KA 3G5LA 5DRTA 1NW8A 2B25A 1B59A 1QPMA 1J7KA 3CUOA 1G3SA 1R5HA 3E6CC 4AD9A 3KQYA 5G02A 2ZIGA 4CYDA 5KS2A 4AUKA 2ORED 3VC2A 3V4GA 2B2CA 4OQDA 2NP6A 4M36A 3K1NA 4V0RA 2NNYA 3WTVC 2FYTA 5GINE 2JPCA 3OU2A 2VP3A 1N7IA 3ROUA 4ER6A 3HSRA 1R18A 2DPUA 2L01A 2RN7A 1KHHA 1QZZA 3WTZA 3T0YA 3E97A 2JSCA 2PXCA 1XSVA
chains in the Genus database with same CATH superfamily
3FPCA 4ZYDA 2PUVA 2BBOA 1KI4A 2XGEA 4BZZA 1SXPA 3J81k 1Q77A 2LKCA 2PY6A 5F0CA 1I6XA 4E13A 4GI1A 1A88A 4UDXX 1H6BA 2P67A 1MG5A 2NNWB 1TZBA 3M1CA 3DV0A 4BU2A 2O9JA 4C0SA 1IHOA 2RGWA 4MLCA 4YJKA 4DSOA 1FBNA 2HVRA 3F97A 3HTXA 2I3ZA 4BEJA 5JTTA 4UBIA 4TUYB 5KYKA 5DYMA 1VL6A 4CI9A 3H11B 2YWHA 3R23A 5CJ9A 3MBIA 3AGPA 1P5JA 4D0GA 5L3GA 1R0ZA 2BFOA 4HQOA 4A27A 2PLYA 1AKUA 5B7QA 1H5UA 3IHLA 1P7JA 4BP3A 3GLUA 1E77A 1U2EA 2OFWA 2LVBA 3STTA 2J07A 1P0QA 1BJTA 2C29D 2J6HA 5LD2C 1ZPDA 4GVXA 4PSCA 4QPQA 4PCUA 1IZZA 4LVCA 2DO7A 4O1MA 3TMKA 3TLYA 4XFKA 1KRWA 1LRKA 4I4IA 4P22A 2DFHA 4EHBA 4EI8A 1VPWA 1ZH6A 1Q44A 1ZGBA 2XVXA 3GLIA 4KR6A 1CB7A 3P4YA 3F6EX 4AZSA 4KDEA 2BRUC 3PR1A 3RV4A 3VHRA 4P84A 2Y67A 4AJKA 4E4HA 1ZXLA 3NDIA 1Y6ZA 4R2HA 4YRIA 2XVAA 4ZJPA 4EVRA 1M5RA 2E1MB 2J9FA 1SC6A 2QJFA 4EG8A 1XG5A 4KR9A 4UCFA 4YLEA 4JX5A 2JFXA 2KT0A 3ACCA 2V4ZA 1DDOA 2ZXEA 3L8FA 4V1CA 1XPXA 1QOZA 1AB5A 1EXMA 2D2IA 4A10A 5M5BA 2ZDHA 1U5BA 4INOA 1Z5NA 4UATA 3AUYA 5JSUA 1U5CA 3QBTA 1JJ7A 1G19A 1D1QA 3UV7A 3HDHA 4M1ZA 3UB3A 3RC8A 4BVJA 2FVXA 3H9JA 4IJUA 1S8NA 4OHXA 3G85A 4BRUA 2PG4A 4CSWA 1WVRA 3ADDA 2JCBA 3TKLA 5LC1A 4ETSA 5DHPA 1H65A 1Y42X 3C7AA 2H1KA 2A0XA 3CC2I 5F0FA 3AM4A 4GP7A 4KIUA 5FORA 5H5JA 5DCUA 2ZUTA 4XKVA 2K7ZA 4EJSB 3L1JA 2BHLA 3NG1A 1BX1A 2ZMEC 2WY8Q 3OS1A 5AVVA 1L8LA 1GRNA 5FYQA 4IVQA 3CZPA 1QDLB 3TSWA 2C5BA 2QIPA 1Z4PX 1YRBA 2P9JA 1FYEA 3INYA 1M75A 3BIJA 4JVLA 4ZAXA 4YJFB 4YP6A 4C6SA 4U3JA 2ECPA 1TA9A 3BJOA 2C4UA 1OLUA 4EYEA 2XNDD 4EBBA 3O4JA 4BQNA 5EWJB 4LECA 1ZS9A 1D0SA 2AI3A 1KZYC 3VYSB 2DBQA 4EQQA 2ZSDA 2EH3A 3ONQA 1ATIA 2FXVA 4CN9A 3OY7A 2A69F 3DVSX 4MFDA 1Y1PA 1FC0A 4JJFA 5AI4A 3JQ7B 2JH3A 4UUBA 3BJ6A 2DBRA 2QZ4A 4AJIA 3IMFA 4XX0B 5FV4A 2QY9A 4IZOA 2P2CA 4C29A 3T9CA 3L46A 1GT6A 2XQIA 5LZ7A 1ULUA 4HADA 1TL8A 4GUDA 5H9WA 1UODA 3BDVA 1HXDA 2F00A 3OJLA 2JZYA 2OB2A 4AMVA 4CV1A 2VC2B 4MHTA 1CRLA 3TXAA 2ZIFA 4H7JA 2B8EA 2YUTA 4E70A 2P7CB 3PC3A 2BEWB 1MC1A 3GLVA 1CHDA 4Q4AA 4OG2A 1FY7A 1T43A 3T94A 5FR1A 1PZMA 5DM4A 2OV3A 2AOUA 3M7GA 1LPNA 5TS2A 3RJ9A 2VTEA 5IM5A 1EU1A 1DOAA 5CUQA 3KEOA 1H2FA 4MQMA 5A5DA 4JLKA 3T1YB 5C1PA 4FFVA 5ICFA 1ZDMA 3B2EA 2UYOA 3OT1B 2WF6A 4CFSA 1VE9A 3IJ5A 4QUDA 3GCMA 1W4RA 2P9QA 4B4CA 3HJRA 1IZ0A 3OLYA 4QOHA 2PPVA 4HG2A 1P2SA 1SBTA 3UATA 5CCDA 5CEEA 4F4HA 1C0KA 2PZEA 3S14J 1P9RA 2YVAA 3Q7RA 2GN9A 1RD4A 3CO7C 4EKIA 5CVCA 3ABQB 4LF5B 3KT6A 3PNKA 4HJXA 3C3AA 3GXBA 4D4HA 2B1QA 1N0VC 1PUJA 4FBMA 1MNDA 4NOMA 1JEDA 1L9XA 3A3PA 3HLTA 1XQ1A 2HSEA 1O1YA 1NQUA 4FOOA 4L4ZA 1UT6A 1JE0A 5G0WA 1EIWA 1KZ6A 1N33B 2EJCA 2OKCA 3NIWA 1D0YA 4HDVA 1SHJA 2ZE7A 3F8SA 3EIQA 1LKZA 1ZRMA 1HH4A 4ESVA 4H17A 3OF2A 3SC2A 1ETYA 5BVHA 3GELA 2Q3FA 2M87A 3AH8A 4UPDA 5HFJA 3R4CA 2IIPA 2R1TA 3EDYA 3GPIA 2DKFA 2ZZMA 1W96A 2HIMA 4A1OA 3MPOA 4JZYA 2BW3A 2QRKA 5JZMA 4OHPA 2EJTA 5HKOA 1KXZA 1IOWA 5E1OA 2PUFA 1PT9A 2F8MA 1E59A 4M1OA 3R7DA 2EV0A 5D7NA 2KW5A 4TSFA 1FMCA 2DOKA 4ZANA 3TK1A 1FX0A 1MEJA 1VZ2A 3E3NA 5GIOE 3VR1A 3WMFA 5KCZA 2FHPA 3A2KA 3OZDA 4QOSA 3WWCA 3H5AA 2YZ7A 1M67A 5FWYA 1E32A 1WB4A 3CUKA 2RC6A 4DQ2A 1VYHA 3IAEA 1CVRA 3S2YA 3F5QA 2FEXA 4LG3A 1XDDA 2WAYA 5CFPA 2I7CA 1T26A 3RIHA 5F0HA 1X9IA 2NSLA 5AVTA 5CT6A 5IJXA 2GCOA 4KBGA 4YFVA 3WL7A 3PXAA 4TZTA 1UL1X 1XA0A 2ZRDA 3OF5A 3L49A 3JSPA 1EXDA 3U1TA 4EB6A 4ZARA 2UXBB 4CMIA 3AHJA 3WSTA 2NIPA 1RAFA 3IPRA 4S3MA 2OGTA 1BIBA 1T29A 5F5XA 3M3HA 2NT3A 2JT1A 3OX2A 3IC7A 4HUQA 3BY6A 4W1QA 1CY8A 2V7EA 2ZVDA 3AHIA 2R68A 2PR7A 1PZHA 4P1ZA 4D9NA 4ZOAA 2EB7A 3L2VA 4YRPA 2FMXA 1G9TA 2PBFA 5IDXA 1CDEA 3H04A 3R7LA 2G5GX 3VI4B 1I51A 4D8UA 4EI7A 4ZZDA 3ESWB 2YN4A 1RYZA 1RLJA 4PZYA 2VUHB 4EY3A 3V3KA 3WLSA 1VL5A 1I5EA 4W1SA 1LLDA 3BYZA 3W9BA 1LEHA 4B7ZA 3IP9A 2ZBGA 2CXQA 3IVRA 3PL1A 4K03A 1Q14A 3SHOA 1OLXB 5EWLB 2Q0SA 2EWMA 1WETA 3D0RA 1ESNA 5KYUB 5DYWA 1EP2B 1A9OA 4EHAA 3B3GA 2DA1A 1HE5A 4HC4A 4JI7B 2HYGD 3EGOA 4WL0A 5JI6A 5HRAA 3U21A 1YVEI 1OFHA 1QIJA 4PSDA 3I37X 4HAWA 2CDBA 2X22A 4NEQA 1JUMA 5I3CA 1WQ3A 5DS9A 3WZLA 1N6OA 1GXQA 4C4SA 3ZCTA 4XDHA 1YH3A 4KMOA 1U7ZA 1H6DA 1JTFA 4N0DA 3GFGA 3GT4A 4MRMA 3O93A 2YZNA 4KMSA 1VFPA 3EAGA 3Q9SA 4BFUA 3NI2A 4NZMA 4U2EA 2X0EA 3LT5A 4U7HA 1IBRA 1H8HD 3HWWA 3RSQA 3LX6A 1JXMA 4BC1A 4IXWA 1ICEA 1ZEJA 4MR8B 3JASA 1T6BY 3WLOA 1HDGO 4B1RA 4JLPA 3B48A 3AP1A 4CM9D 1L3BA 3OL3A 4F5ZA 4BFSA 1FYKA 5J1SB 3BC1A 4KIWA 3K92A 4BO4A 3ZE0B 5IFKA 3H9CA 2RGGA 1PAUA 3LDGA 2DH6A 4ZGGA 1Q1EA 1DPUA 5JASA 3G1UA 1L4MA 3BB4A 4LSMA 3WKBA 2JGIA 4ZC3A 3BMOB 1F0YA 2FJUA 2I8CA 2H27A 1KTVA 1HDDC 3RNLA 4M6YA 3SF0A 3NAMA 2EERA 1M6HA 1P9WA 3O8OA 4OREX 3RVSA 4I1RA 2AC7A 4MKIA 2ZJ1A 4MKHA 2YVQA 2IVFA 5IDWA 1KEPA 4FMDF 1YA6A 3H0KA 2IBSA 3BCBA 5ALJA 3IHTA 3GRPA 1UPCA 1FSHA 3LOCA 3VDRA 3HA2A 4CR7A 4RZXA 4YMLA 1FUYB 1RWQA 3ZG6A 3FXKA 2QVCA 2NW6A 4QXMA 1EA7A 4HRIA 4UVHA 1RYYA 4Q7LA 3CPSA 1EDEA 4WZAA 4QLBA 1RWPA 2IH2A 2EQ5A 3FNEA 1Y7IA 4FFMA 4EHKA 2R6FA 3CSUA 2ZTHA 4UE6A 3QITA 4JLJA 4F4JA 4FDUA 1YQUA 3OHPA 4CJXA 3L00A 4QTZA 1WY7A 1PP4A 1F4VA 3F6BX 1NNSA 1LBTA 4TS1A 3O8NA 1Y8RB 4D99A 1STZA 3GNTA 5IOYA 2NU6A 5BR7A 5CD1A 3OMXA 1I3AA 4ZODA 1GV1A 3BGSA 3B9PA 5FUWA 2GPAA 1VQ9I 4OAQA 1ZJWA 1M2NA 1AS3A 4OJMX 1CUZA 4OKSA 3O7MA 4WX2B 4U0WA 3PHJA 3S1LA 3KSUA 3E82A 1GDHA 5CFNA 1UMDB 3IXLA 4M3BA 3K1AB 1YZUA 1PIWA 3EH2A 4PDKA 3B5IA 3LXMA 5L3QA 3Q3HA 3SZ3A 1VLVA 2XOEA 1L4GA 3P9QA 5FBRB 4MUBA 2C7QA 3K1JA 1HDRA 2LBFA 2PAAA 3DXZA 1A4IA 4Z1MD 5J3LA 3MGKA 1OYVA 2X6WA 4LZNA 3P0JA 2R6ZA 4GWLA 4CUJA 1SFKA 2E7XA 3A28A 1WD5A 4OQEA 4FI3F 2B21A 1PFGA 1NGSA 2WD9A 821PA 4B8WA 2LY2A 4WRRA 2VT7A 5JHHB 5DW3A 2PUJA 2H7CA 1CQJA 3ONNA 4PTYA 1VHQA 3K9WA 5FPKA 3WMGA 3WICA 2AD1A 3N9IA 1D3AA 1PGJA 1NPYA 2XCOA 2F2TA 1AD2A 3H6HA 2Q6KA 4HN9A 4BN0A 3QLVA 2CJFA 2LW7A 4QPNA 2ZSFA 1RKQA 2D6FA 3U40A 2G8NA 5AHKA 1MHTA 3OURA 1S0UA 4P4SA 3OSZA 1PWXA 2MFZA 4BGVA 3EHDA 5JLXA 3O21A 1XNHA 5KB3A 5AM3A 4M76B 4ESJA 4HDNB 2VSOA 1PK7A 1GLNA 2H4FA 2TMKA 2RNGA 3OE7A 2IGOA 2FJPA 1GXSA 2D1YA 2PKCA 2IF0A 2EX1A 1EGAA 4DL9A 2HU7A 2LE0A 1EGVB 1JTYA 1SUAA 3QBJA 4N5IX 1GFWA 1MD9A 2WWGA 3PX7A 3EW9A 5EJ9A 1L1FA 1ZH0A 2GZHA 5FTMA 2N42A 2Y68A 4L9WA 1H9BA 3BG9A 4RY8A 4MARA 1FPQA 2E71A 1V54H 3GFVA 4W99A 3T7JA 1HNNA 2JZOA 1BS1A 4MLDA 2W5UA 1UB9A 1U0HC 4MR7B 3CJRA 4DMLA 5ITZA 4D44A 1XCBA 2IS6A 2BGLA 4ALLA 3AVWA 4WXEA 4BO2A 2D74A 1CF7A 4WWCA 1JIJA 4CCMA 4HB2A 3HKBB 3UFBA 1RUOA 4QL3A 5A3SA 4DR6B 3S68A 3QWAA 4FE4A 2DQYA 2IELA 1WH7A 3VAYA 4YRMA 1YZGA 3FYUA 2HVSA 2BGMA 3BIWA 3VVBA 1XNQB 2PMCA 4P4LA 5C51B 4LPSA 4D3XA 1BXRB 1KIAA 2BFCA 5ESRA 2BV3A 1KVUA 1OCTC 1P80A 3N07A 2GKSA 3SK0A 1C14A 3T6KA 3KU4A 3FLAA 1C7QA 4MV1A 1EMDA 3BWVA 3FRIA 2ZAOA 1CY2A 5BQPA 2HHLA 5B6JA 3ETHA 3CP2A 4FHTA 4YCAA 1KPGA 5K51A 1HEIA 3Q88A 4G5XA 5TQ2B 3SZGA 4L18B 4KIFA 3WS7A 5GZ3A 2ZIVB 1BQ3A 1M76A 5TRDA 4KSCA 1X7GA 1DEAA 3IT3A 4HN2A 5JPCA 3NDPA 1NF9A 3KZVA 2F59A 1W87A 4EF4A 3FOEC 3HCEA 2R6AA 5FL3A 2JLWA 1IAVA 4FK8A 3KZIC 3AIIA 3QA3E 5IYZB 4W5OA 1ZQ3P 2WC1A 4XQFA 4QECA 3NOQA 4LVNA 2BGRA 4A5NA 1MT3A 1Y8CA 3U4QA 4N4AA 3P9CA 2H0QA 3EGIA 4HX4A 1E1QD 4GECA 1K78A 3L7DA 3FCUB 4WF2A 2FQ4A 2O5EA 3D7MA 1KMHB 1F3OA 2CVOA 4O33A 1PGNA 2WADA 3BHIA 1OCOH 4EJTA 3D4OA 4EGZA 4B3TB 2JA2A 1KEVA 1K92A 2JFUA 3S8YA 5K03A 4RLQA 2I8AA 1C3JA 3BWCA 3SY8A 1M2OB 4EPWA 4MTEA 1FNDA 4RHCA 3DOFA 5L6MB 3QOPA 3HBJA 2RQQA 5B7NA 3CLTD 4YS6A 2YIMA 3TYXA 2YQZA 2IPQX 3KQMA 3TX6A 2C3OA 2P11A 2EV5A 3WAKA 2VAXA 2CFOA 3MEXA 1G2PA 1O0CA 4FT8A 4TMYA 2FUEA 3K9LA 3V8LA 4JKIA 5FIUA 3EVFA 4P31A 2HYJA 4LKOA 1GUFA 2HMUA 2X0NA 1L5ZA 4BMYA 2COUA 4TTQA 3N2GB 2PGJA 4RMGA 3UMCA 1NRWA 2ZUSA 4ARIA 4KLRA 2GZ2A 3O5AA 3STUA 3TQTA 1Q50A 4N6NA 3W2HA 1BEZA 3QKSA 1IN4A 5I6DA 1U2DC 2OYRA 4LYAA 3Q11A 4M89A 3AIOA 4QAQA 3AUAA 2VSFA 3PVZA 1ZICA 1ONBA 1X42A 3OMLA 2ZTUA 2H1IA 5AI9A 1J9ZA 1H0MA 2IVZA 4MR9A 1KU6A 3G9QA 4X6LA 3OQHA 2DFPA 4CG2A 1JR3A 3K9GA 4ERNA 1O7JA 3O8GA 2OAQ1 4DLUA 3HJHA 2HOEA 5EIBD 3GGSA 3LKZA 1V71A 2ZE6A 1U94A 4JJGA 2C5SA 4AF8A 3FZYA 2V58A 4MP3A 2P5UA 2QN6A 3GGCA 4ARZA 3TPCA 4LYDA 2HR3A 3JQBA 3ZWWA 2AQFA 1CZRA 1NW6A 4LDNA 2RREA 2QJOA 3QEMB 1WXGA 5J2UB 1SKBA 3GH1A 3WL8A 2OBMA 3CZ9A 3SLRA 3OPQA 1BH6A 1T0FC 3SD7A 5CDFA 1QIIA 3AESA 1D6NA 2AEEA 1GUDA 2YPRA 4BEHA 3B5JA 4RA9A 4KCGA 1XZGA 4DCTA 3KD2A 4KDCA 3WWEA 4OHMA 3P9YA 1C50A 5CG2A 4N49A 3RIEA 4QGBA 2IQIA 3DP9A 1KA8A 5TDHA 4GP9A 1MDFA 3QX7A 3E7DA 4HLCA 3DPUA 3QJYA 2I3GA 1QP0A 1AVTA 4C2BA 1JR4A 1IOZA 1QHNA 3OYLA 3R09A 4BZXA 3KB1A 3NTQA 4FXOA 2FE1A 4PRKA 1DKPA 1P2DA 3MFYA 4K9OA 4GLBA 3DZDA 4DLXA 1U4SA 2QU7A 2NXEA 2DXIA 3IB3A 4BE2A 1XZPA 1PYGA 4XRGA 2XY4A 1QP7A 4NR0A 4XX1A 3TWOA 2J3KA 1E2UA 4HY3A 1XHEA 2GJKA 1TUIA 2FOXA 2C4VA 1YZKA 2WAMA 2EFGA 1L4FA 3OBBA 3K1NA 4N3CA 5AFSA 4JJAA 2V0GA 4ER6A 1RWKA 3Q1KA 4J2OA 2L01A 3WTZA 2X77A 4IDGA 2JFQA 4MRSA 3I4LA 4RZIA 4EGFA 3GNSA 3JQ9A 2A33A 2QVYX 4ZAFA 2R7LA 2QROA 3X1XA 2NRAC 4BCBA 2A4MA 3BH7A 1L8QA 1GSAA 1HFJA 3CEJA 1YQQA 5EP2A 5ESXA 4MS1B 3RHTA 1LY1A 4RD0A 3OD1A 4H1HA 2BTQB 4MGEA 4TSRA 4ZVLA 3BJZA 1EM8A 1NV8A 5ENZA 1Q0SA 3I9MA 2CLIB 4C7BA 4PX3A 4URZR 4MRRA 2C2ZA 3GG9A 4QYIA 4YJDA 3SC6A 1BBYA 3OPYI 1KBOA 3B12A 1A5ZA 4LFAB 1R6XA 2E55A 4RF2A 1W30A 4R9UC 5C5IA 4KN7X 1Z2OX 3U19A 2RE8A 2MC4A 5I9NA 3FD8A 3PUHA 4IQJA 3PXBA 2B30A 3QBDA 3QFTA 1I0LA 2OCCH 3VR4A 4DYRA 2H8GA 5JXWA 4A3EJ 4RDXA 3KXLA 4DB2A 1Z22A 5HTKA 3BN3A 2HHCA 2G07A 2FTKE 4XWGA 5BVGA 9ATCA 4I4TB 3MZHA 1R0YA 4RTQA 3KKEA 4RL6A 1VCHA 1U5AA 5LLSA 2VDWA 2E7WA 3ME5A 2I65A 2R7WA 2KQRA 4W7IA 1B8UA 3B1VA 1ZUD1 1R00A 3ZQFA 2Q1XA 4NDLA 3QU9A 5TEWA 3AVOA 2E2IJ 1B9MA 3OCXA 3V4RA 3Q5EA 2BVNA 2CBXA 5HX7A 1XOIA 3ZCPA 2YJNA 4AC0A 3R3SA 5AW3A 4LRXA 5JYCA 1D1AA 1U3GA 3MJSA 4HNQA 1NRXA 3TZQA 1MGOA 5F4ZA 3NALA 3FKQA 3MMZA 2H18A 1HNXB 3EPHA 1WMDA 2OFFA 5J5VA 3FHOA 1L5RA 3HR8A 2PMWB 1I1OA 3NVDA 3WVNA 1N8NA 3TQFA 3OSGA 3DQQA 5LJIA 1A5BB 2YHIA 3FLMA 2FR0A 3OIGA 3AEZA 1ESEA 5GONF 4M7OA 4PYQA 4GX0A 2AEJA 5CU7A 1RZRD 1BW9A 1ADFA 2PQ8A 3L3BA 1RZVA 4L50A 4PR3A 4AJNA 2C2OA 4UD2A 4A3CJ 2H2DA 4AN4A 1NVXQ 4ZT2A 2WV1A 4OL9A 5IT9A 1ZGJA 4L2IB 2C88A 1PI3A 4F45A 4RK4A 2NQ2C 1HXHA 3IEIA 3EGWA 4GPEA 4OX9B 4AO7A 5GJVC 5DHAA 1C7ZA 4X1KA 2ID9A 4QPZA 3HH8A 3OIPA 1C8BA 4UHJA 2YV5A 2ELJA 3R7BA 3RS9A 3OE1A 2DFIA 5B3JA 3MT8A 2PFSA 3DXXA 1FBQA 1QZYA 5EWMB 1QH1B 3COWA 4RVDA 3Q8WA 4BVBA 4E2FA 4TMFA 3QGMA 3VPRA 5KKCA 4EJUA 3L43A 5DBEX 2L9NA 2XD9A 5C9ZA 1ZCJA 1WJ5A 1Z29A 3EC2A 4I8XA 1PS9A 4I55A 3KPJA 2Z2ZA 4RJLA 2ZNYA 2VZLA 2NZVG 1GUAA 3SJCA 4F8JA 3O31A 3M0EA 4OJQA 1SBZA 4B31A 4QXPA 3H18A 3SC4A 2VCHA 2PD3A 1MO2A 4G8DA 2RI1A 4AZ0B 2A94A 4EEKA 1OIWA 3YASA 4EG4A 3JRBA 3EGDA 3HYLA 4MWEA 2D1VA 2V7QA 5GVRA 1HCRA 3RC7A 5HILA 2Z5UA 2HB6A 1WCIB 4MPDA 4DQLA 5J2TB 4RTJA 2IXDA 3ND8A 1U80A 3CJTA 4DOZA 1ID1A 4BXFA 3KJHA 1JF8A 1FS6A 2QGFA 1USUA 2Q2NA 3GO5A 4PW0A 1UFQA 3DQVC 4DLNA 2XZLA 5KVRA 2B3DA 3CT4A 2B8WA 2PV0A 3AR9A 1JEQA 4PY2A 1X9HA 1NY6A 2CMKA 4MOWA 1UJ6A 1X86B 1D2AA 5DULA 1SKQA 3B7PA 4ZZ1A 5FQOA 1FTZA 3GFMA 2Q3CA 2W6CX 5FULA 4M0DA 2X9NA 1XK6A 1RMTA 2VF4X 1SKYB 2VPIA 4X45A 3DBVO 1R1VA 4AWXB 5HVNA 4V2FA 221PA 3ZQGA 3ZXYA 1QGED 4IY1A 1M34B 2YVLA 3WNQA 2ZR7A 2XHKA 2J85A 4I36A 2KHMA 1SPBS 3ZVRA 3HCRA 4B6GA 1GVJA 2YNMD 1Y9ZA 2P9BA 1MJBA 4YRSA 2QGNA 3VR6A 4A3DJ 2M34A 3O3MB 2H9IA 3FOAA 5C80A 1HKTA 3EQZA 5C32A 1US8B 1U0GA 4CV0A 3IH3A 1UINA 3MERA 1LUJB 1PK9A 4EEXA 4DUZB 1XPUA 1PKEA 3W5IA 3WQQA 5JSZA 1HT2E 4FD2A 4U7TB 3E2IA 4UOEA 3JAMZ 3EEQA 5JZVA 2ZI4A 1CUJA 4B4WA 4TYNA 5LB2A 3QP9A 3EUHA 4Q66C 1M66A 5L95A 4IEEA 3N3BC 1ZR4A 5CLHA 2QORA 3AQIA 3OR2C 4UVDA 5EIWA 1PN3A 3QWIA 4RZ3A 4TX1A 1EEHA 4ENSA 2UYHA 1S6LA 1GFSA 3D2LA 3KHTA 4P7GA 3NKFA 4NK5A 1UEXC 1ZISA 1VDMA 3QX9A 3PTAA 2AHQA 1E60A 1WB5A 2I2CA 4RKQA 1KYYA 1QG6A 1CUEA 2UUZA 5IJAA 1NUUA 4KZPA 3KEMA 2R62A 1X9GA 2C7RA 1NP6A 3PDHA 1G3QA 3AYXB 3L8CA 3PSAA 4QA9A 2FLWA 3KQNA 2N75A 2ZITA 1OFUA 1U8YA 3EEYA 4ZOBA 4PJLA 2AOWA 3U60B 3L6UA 1S4MA 1B73A 3ELBA 3PGVA 4FFDA 1V3TA 1Y8AA 1TMKA 3KTAB 2IHBA 1T1EA 1S7GA 2A1TR 1P1IA 2VNJA 3NHZA 2DHRA 3D6HA 4L4RA 2ZI3A 3ACDA 2ACWA 4LSWA 1O58A 1B41A 4UQLA 4X60A 2Z16A 4KQ9A 1WXHA 4GMXA 3JD1A 3PX3A 3GW8A 1IPEA 2JLUA 1XZKA 1KSFX 3P1JA 4XD7A 3O8QB 1PLKA 3SEZA 2WTEA 4R7TA 1FSFA 4RXTA 4FKMA 5BW4A 1P6UA 3VDMA 3RF6A 3BFPA 1QGAA 2M5WA 4AM3A 2DY1A 4QXOA 3VU9B 2Q49A 3AM5A 4TV8A 1G5RA 1X8XA 1LKXA 2ZB4A 2CFRA 5E1XA 4M1QA 2Y1FA 2YWJA 3A10A 3T99A 4KIGA 3MCUA 3MTDA 4CL8A 4I5DA 3U3ZA 1N9KA 4N0PA 2IKQA 1I2ZA 4R1HA 3F9IA 3U3DA 4GBMA 3E6DA 4BE4A 2LKPA 4BKPA 3IAM2 4HEJA 1BOOA 4P98A 4GMKA 3SQDA 1UCRA 4OMFG 1YRWA 3WO1A 5AK3A 1I2AA 3U3RA 2YWXA 5FNVF 1G20E 1BI3A 4UZFA 3FZQA 3FXAA 4X6XA 1HYEA 1NSFA 3W1VA 3HNOA 1MBHA 4IIDA 2WYUA 2HPAA 3EXEB 1RKBA 2HOQA 4U2DA 5K0EA 2FMLA 3FPSA 4GNKA 4Z4FA 1NTRA 1E4VA 3E53A 3AUJB 3EPJA 3DFUA 1K4YA 4OIMA 5LIPA 4H7IA 3L2UA 2HGSA 4AICA 1JB9A 1LD3A 4MDEA 4YWJA 1E3JA 3KPHA 4G12A 3NONA 3T34A 3KIPA 5FPTA 4RYLA 4G0NA 4IHAA 1FNMA 3UPUA 3ROPA 2EINH 4YCJA 3ZDXB 2IBTA 4KT6A 2QQAA 5I4KA 4TRJA 1KE1A 3F9KA 3C2BA 5GP1A 1OB5A 4CT0A 4QFDA 5B3KA 2PGNA 3FIJA 2HA2A 1RI2A 4IGKA 3BR1A 1E6MA 1YU6A 3QHPA 4UARA 2AFRA 4DCSA 3ZIAD 1RHJA 1FXWF 1DU6A 3GP5A 2K4JA 1E8MA 1XP8A 3AV3A 3IE2A 3AF4A 4KR3A 3G02A 1WP9A 3IDFA 2NXCA 1SJ9A 2QRPA 3OWHA 2H5JA 3AM1A 5BNGA 4DIQA 2P4WA 1EA3A 1GPNA 2FN9A 5DCYA 2X4IA 1Z0IA 2C92A 1P7IA 2ONKA 4HQRA 4RABA 3L1VA 1F9NA 3UICA 2JFWA 4HATA 1JKRC 4PO3X 2QR2A 3TO5A 1MAWA 1YAJA 3K0BA 2A14A 5FLKA 1OXVA 2EFCB 2BP7B 1E1RD 3GLFE 4EHJA 4XPZA 2ZXHA 4YAEA 1P6XA 3CEMA 2V55B 3HBAA 4WBNA 3O26A 4C2MJ 1OWNA 2VP9A 1ECBA 4Q3CA 4A3JJ 5JJLA 1ESZA 3TW8A 1N6PA 3RSZA 3P4UA 5IN5A 5CLJA 4MULA 1FVOA 2JBWA 4R8VA 5IHXA 2MG4A 5CLLA 4I3HA 3E9QA 3MWDA 1QX4A 4I1OA 5IH7A 3STXA 2GXUA 1IDN1 3MK31 5J63A 4PQRA 5FAKA 3TTVA 4XCVA 2XMQA 5KU1A 5CVDA 4XDYA 3AHDA 2I80A 1PTJA 1R16A 1MBGA 1U5TB 4PZAA 4HX7A 3OX1A 3R3YA 3QEKA 4BBJA 2Y1WA 3W2VA 3C8ZA 4HDQB 2ZRHA 3HXLA 5P8WA 3L7BA 3KTOA 3ZD6A 1UK8A 5EHNA 4PN3A 1E94E 4A6DA 2CNBA 4D8VA 3E27A 1M1NB 2W11A 2NO9A 4J94A 2JGAA 3G0OA 3HA7A 4IOJA 4H59A 4RA2A 1Z5PA 2B6NA 2VIXA 1ZOLA 2NVUB 4U2FA 1QMGA 1Y1VJ 2KJBA 3M4JA 2E5LB 4N41A 2QD1A 4Y9TA 5EPEA 4HDSB 4EHFA 4UUSB 2W37A 4P4NA 1SD1A 1B8OA 4YDSA 3PF8A 4HKTA 4FZ5A 2I2BA 3GEDA 2WV0A 1QHHA 2IEKA 2CS3A 3KQHA 2WU0A 1CY6A 3I9V6 4C30A 3L6CA 2XB0X 2GOMA 3LQYA 1OT3A 5M3FJ 3ER9A 4GLLA 5HLTA 2FP4B 4ZYXA 2A78A 4JV5B 2Q1WA 3ICOA 3SNHA 1RAEA 4K9MA 5F5NA 3AFGA 5J59A 4BNTA 4UNSA 3CDIA 1T1RA 2IXSA 3DEJA 2MSCB 1F51E 4GO1A 4A2PA 3DU6A 3QF7A 3CNBA 1JDUA 4EJFA 3PRYA 3P5BA 5IPAA 1QCZA 4GOXA 5CK4A 5CQGA 4LHEA 2ERXA 1ZHHA 2M1BA 1ZC3A 1X3UA 2UUAB 2B4QA 2FMTA 2CVHA 2R8YA 2PYDA 4WESB 3FPKA 2PV7A 1R10A 2JRTA 4OLJA 2FQ1A 5I7SA 1QYWA 4WK0B 3CUTA 4CLRB 1E9AA 2RHMA 4TQUS 4OLAA 5E8IA 3NVAA 5JVTA 4LC9A 3SFTA 3TZ6A 3B7GA 4Q15A 4GXNA 2AN4A 2VF7A 4OOEA 2NO0A 4LOIA 2WIAA 3BRQA 3FJYA 1PK8A 5CFRA 1FA9A 2JAXA 2ZIWB 2LXNA 1HORA 3TZCA 1R3DA 2YDXA 4FFLA 3AERB 3P96A 1M2JA 2BM1A 1UBCA 1C0WA 2C6YA 1C9NA 3BAFA 2HCBA 3CNNA 3MVEA 4ZTJA 1Y5MA 2EW2A 3UBTA 1HC8A 4N47A 1AIPA 3NW9A 4Q34A 4I5FA 4C4OA 3CUWA 2YS7A 1FIPA 4G6TB 3KXDA 3SHWA 2R4QA 5JD6A 3L40A 3WP1B 4MYTA 2XYHA 2BI4A 5IP5A 4E7LA 3FB4A 5H81A 4X66B 2QPLA 2W58A 5LMUB 3AXSA 3BQNB 2XQGA 1T3HA 1OMIA 1OBCA 1P31A 1KVQA 2IA1A 1DRWA 1GCGA 2IH5A 4EUKA 3FHTA 3LC2O 1FLVA 7MHTA 4Q4HB 3UAWA 2WUVA 3OP4A 5J5CA 1TYBE 3EC1A 5FLEX 5FLVA 1F36A 2CJXA 1W44A 1UKVY 3NRBA 1X6VA 2CFXA 4KH1A 1L0BA 4GW3A 4UXHA 1YMVA 1W93A 2EV9A 3WY9A 4KQFA 2IYZA 3KKLA 1GQQA 3SHTA 2Z09A 1DXQA 2HDNB 4F5WA 2ZAGA 1DNPA 2W6ID 2Y93A 5TMPA 1MNAA 2NPOA 1NUQA 1SUEA 3V7WA 1JFLA 3RV3A 1OH8A 1K27A 1JSLA 1JU4A 2Z99A 1T8YA 2NNLD 5HLGA 2HMYB 3LUBA 4A93J 1UPBA 3EMVA 3F49S 4J2TA 2WJJA 1UKZA 5KWVA 1HL3A 4DLYA 4IMPA 2CUEA 2WHYA 1U8EA 2JA5J 3A01B 1FK8A 4X00A 3A11A 2LF8A 3RS0A 3WA6A 1YS6A 2HKIA 1QQ7A 2XNKA 4AAYA 4BHBA 1GNVA 3GG2A 1RKVA 2CL7X 4CG0A 4MEBA 4BQEA 2DERA 2FFJA 4BFWA 3CW8X 5JMPA 2YU9J 3PGXA 1ZCFA 5AIBA 4M6VA 1GR1A 3HJTA 5HNHA 1P81A 4YUVA 4CTNA 4J7UA 1Z6PA 4WGFA 3TAXA 1MHPA 3MC1A 3QF4A 1P3DA 3TW6A 2ASEA 2H06A 4A2CA 1P0PA 5DLQC 3C14C 3HGQA 1EFRA 3M7IA 4D4LA 2ZJRF 4OA8A 4XGIA 4DLKA 2HXIA 2PUTA 2RI0A 2FPRA 4RHYA 2YZGA 4D0NA 2AR0A 3LXXA 5IMSA 2VRCD 1VIVA 1P3JA 4G5GA 1GA4A 4UHKA 2A6TA 3EZ6A 4C08A 3P9RA 4RHTA 1W0KD 5H8WA 1E1YA 2HADA 4LOKA 3ICEA 4ZYZA 1TTHA 1SVWA 3AG1H 7REQA 2DUWA 4B4DA 3G2OA 2FPMA 4QWMA 3QPCA 3QFFA 3OZUA 1TLLA 3RK4A 2L7MP 1Q74A 1P1HA 4U6NA 2EA4A 1S2DA 3MG9A 1GG5A 3CZCA 4M60A 2I4IA 2E1RA 3WLQA 2H1FA 2NUTA 1FIUA 3TBKA 2B83A 2HJVA 3ZE2B 2YINC 2A61A 2O7SA 1SAUA 1BJKA 2WQZA 4R68A 4CXFA 1U2DA 2XKKA 4JSRA 4D9HA 3ETLA 3GBVA 3ZW7A 4YRCA 4DCPA 2LCIA 2H6BA 4RF4A 2FWJA 2PBLA 2ACJA 3LSMA 1OJLA 2FPOA 1I2DA 2IIVA 3KUXA 1BGXT 1WRBA 4FNAA 2C9MA 5F33A 3FHNA 2G8LA 3L9FA 4YV7A 3RHSA 1D8AA 3KB6A 4J49A 3ZGXA 3FLEA 1YI2I 1ACJA 5FOVA 1BVUA 4JI8B 3CLTC 2J30A 4GXOA 3OCUA 4PPGA 1KSHA 1EUCB 5JMOA 3R5SA 1BGWA 1W85B 1QJ4A 5LP6F 1COWD 4CTOA 1S3SA 5JBIA 1YQDA 2BFMA 2G1JA 3RHFA 1G7RA 4BO9A 2P69A 3VR3D 3SIPA 4E2WA 1J0RA 2QLJA 1OKRA 5EXDA 4WINA 4TQGA 1B6RA 3I9OA 1Q91A 4LCEA 5JRZA 1UZLA 2O2SA 4EO7A 3M9WA 1TKCA 2HXYA 1QNTA 3RC1A 3PHHA 1T0FA 1TGYA 3HUGB 4MQ6A 2XSZD 4REMA 3MCVA 4XUDA 3RUAA 2IW3A 3B3JA 3RBZA 2JCSA 1LA2A 2VNHA 4YEDA 4KACA 1YRLA 3H5TA 2HNKA 4FGKA 2JLAA 4GXTA 3W6PA 1ONVA 4ME6A 3NHLA 4U7GA 1Y7PA 3FK6A 2XUGA 3OIOA 1J7KA 4X3OA 4C4XA 2ZYVX 3P0FA 5J4KA 4LOHA 1HURA 4IMIB 1KE2A 2ORED 3LRXA 2OFXA 3E3OA 2ZT6A 2JGJA 2IYQA 1WU8A 3H1GA 4MVJG 3IMKA 5EIBC 3LY8A 1R18A 1UPFA 4PLGA 1GQRA 4V3BA 1GGKA 5FBWB 1NP3A 5EXTA 1C9DB 2IYSA 1VQKI 3K9QO 1L1RA 3I55I 2R5NA 2CCKA 3G3EA 3INGA 3H0DA 3G0IA 4QDJA 1PV1A 1W1WE 1FDIA 2ZBRA 3S2GA 2V4MA 2CXTA 1J09A 3K8OE 3WLKX 1AOYA 1B42A 1NLZA 2Z2IA 2P9EA 3QOEA 1GZSA 3AIKA 4YT5A 5KSOA 4BMDA 1SU7A 3NYRA 3TAHA 3ZQ4A 2YVKA 3C97A 1IDOA 3L04A 3ZWKA 2OR3A 4D5FA 2O7VA 3BOSA 4LITA 2NS8A 4LJYA 1MXHA 3FPEA 1EZZA 1KBZA 5DM1A 4CYCA 3L0SA 2HRCA 2PH7A 3AR7A 4OQYA 3RLIA 4AFNA 1D3YA 4XZ3A 1Z08A 2LD5A 2RG7A 3OOUA 3AWIA 4BFYA 4QYMA 1XLTA 3VC1A 2NXNA 2XMPA 1CRWG 5KIAA 2CJYA 4AJEA 4DNPA 2RBEA 5HZKA 3DR3A 4KPYA 4OQLA 1I7SB 2C7GA 1W35A 2SICE 1HV8A 1BG6A 2ATVA 2W43A 3LBAA 1X2BA 2Z1NA 4E22A 1GAQA 5ALOA 1ZP6A 5FI3A 4JDPA 2KZGA 5BV2P 1IEQA 2P75A 1WD7A 4BQIA 4BYYA 5B7GA 1Y3IA 3RTDA 1G8KA 4XLLA 1VI5A 5JQGB 4JYAB 4Y67A 3HR7A 6YASA 3PE6A 4J4BA 2A92A 5DX0A 1K7AA 2A3NA 2WHQA 2QN9A 4LXYA 1ZXBA 4R2WA 2GAJA 3TUIC 4WVFA 3T7AA 4N3GA 5B58C 5DNUA 3ZUGA 3OZAA 4JI1B 4H18A 3W7VA 3E7PA 3ECCA 2YASA 4YUAA 4O2BA 1WV1A 1HDZA 3TLKA 3F90A 1MGTA 4R1UA 4UVAA 2VAMA 4Z5XA 4RGVA 1TK9A 3CQ9A 3CF6R 5FO1A 1J2TA 3R3JA 5KQRA 3VVLA 2KM1A 3ND6A 3SKXA 4AG5A 3E2PA 1LDDA 2OMEA 4KXYA 4BXUA 2BY3A 2IA2A 2R6CA 4GWGA 2HNAA 1OXXK 3IT2A 3IAFA 2A35A 3O4IA 2NU7A 1K66A 4ESEA 2XH8A 4IXMA 4JD5A 4B6JA 3PBKA 3E4CA 2FG7C 4TKUB 2R87A 2OOSA 5A4FS 2W93A 2HXOA 3CVVA 2ZXUA 3REOA 2Z4TA 5E9AA 1V6AA 3TRKA 5CT5A 3A26A 3E22A 4MIMA 3JCZA 1V48A 4JNKA 3BTVA 3TB4A 4XSXF 1TGVA 4LXGA 1ADYA 2WHPB 3BE5A 2NVBA 1J75A 2M6RA 4M1SA 2QVLA 2HQNA 1LW6E 1XMPA 3ZWMA 2WG0A 1TP4A 4B4KA 1QVWA 4O1IA 4RSHA 4ZDLA 1WW3A 1ZD4A 2ZB3A 1XO1A 1GP2A 3U13A 3HHEA 3V42A 2C58A 1J56A 3NHWA 1PJTA 3I1FA 3NUGA 1K5GA 1KIFA 5FCDA 5IJ0A 4C22A 2LP4Y 1CEQA 2LY1A 4IIJA 4K88A 2DFFA 3UT5B 4JX8A 4PNPA 1EJ6A 4G0UA 5TGZA 1F2UB 1VQ8I 1N7HA 2JJQA 4FBGA 5DN6D 3CX6A 2XXJA 4RC9A 3R9XB 2EFWA 2G06A 2C82A 5EE1A 3RIGA 4BO5A 1NOJA 2GQ0A 3E35A 2C2YA 4HRVA 3R44A 4DMRA 1VQOI 3A1NA 5L4LA 3AZPA 3QX3A 1QK3A 5G1NA 3SXPA 2X8JB 1SOUA 3FMPB 1HW5A 3DD5A 3FGNA 4FGSA 1V55H 1HR0B 5ESWA 4WCGA 5FWAA 4R2IA 3MQ2A 2GM4A 1U0RA 2IJLA 1VI2A 2BZ1A 1M2KA 2GXAA 4D57A 3MGBA 1E9SA 5H6RA 2A9OA 2QIOA 4OPMA 3K4HA 2YV2A 1E96A 2MBFA 4D5EA 3T8YA 4PV7A 2B5WA 4L8FA 4Y1FA 1E79D 1PYDA 1CJBA 1E17A 1WHTA 4ZOLF 5IP6A 1G16A 4MQFB 4HNSA 3I32A 2O05A 4XONA 1HDCA 1AG9A 4EW1A 1NXVA 1KJYA 2JGRA 1KTIA 2YKGA 3IUPA 2SECE 2Z9OA 5IM4F 5LHGA 1ODJA 1W1IA 3ZHXA 1EEXB 3M6WA 1YX3A 2OHOA 1XEXB 1JLMA 2OVBA 2P6TA 1QQ5A 3IDSA 4NXNB 1ND5A 4GYGA 5A1JA 3FMQA 1DKMA 4AY6A 1XHFA 5EEAA 1GZHB 3DYVA 2WYWA 2WJVA 1Q2XA 4XLZA 1RLTA 2WABA 1H2RS 2ZRPA 2XB9A 3KPVA 4WJKB 4NJMA 3NHMA 3V5NA 3VGJA 1X3LA 3QELB 2VYFA 1QHIA 2ZCWA 4MMYB 3IHKA 4PAMA 3DEKA 4ML3A 3GLTA 3QYJA 3DAHA 4QGFA 4UVEA 4LXQA 3V8MA 4A23A 2XNDA 1WHSB 5TR9A 3T5TA 1V3UA 4TWZA 5E7MA 7ABPA 4F86A 1TF2A 3CBQA 3LMKA 1BKSB 3OYIA 1IC8A 2Q21A 3DZ8A 2E5WA 4HZUB 5IG2A 2MWMA 4YCMA 1J2XA 1Q0LA 4YI3A 1LCIA 1C1YA 4ZIRA 5PGMA 1E5VA 1RXUA 1ON2A 4TS3A 2PK3A 3ABUA 4LJ9A 2UVPA 4DLRA 1ISFA 5BWBA 1CQTA 3DZKA 4EW6A 4ED9A 2CE7A 2QRVB 2FVYA 4ARVA 4ECAA 4YAGA 1ICIA 3OX3A 4LHXA 3QRWA 2L4AA 2HDHA 5HEKA 1VSVA 1V6CA 1TI7A 2NTYC 3U1BA 3M9AA 2JZCA 3RU9A 1KFEB 3QPBA 1YQGA 1YR7A 3E1GA 1R5BA 3UJ9A 3UWSA 4RCZA 3CH5A 4R9SA 2WYIA 1J99A 5IBPA 1RKWA 2Q3HA 2QWWA 1ELOA 1ODCA 1ISJA 1IHXA 3RVKA 1H23A 1Y7TA 3VSCA 5A2QK 4BFLA 4Z3KA 2YNMC 1D03A 2M4GA 1UCFA 4HLUC 2AXQA 5JH7F 5EGSA 5ARDA 1WBBA 1OUMA 2RKOA 1UXGA 1LE8A 5KK1A 2Q6OA 3CR7A 3IRVA 5K0TA 4C78A 1D1BA 4ANJA 4DLZA 3W5CA 2WSLA 4ATNA 3N70A 1G41A 3E5UA 3E9YA 5CHYA 1YR3A 4XUGB 3GUUA 1ONSA 2QHXA 2VCYA 1Y63A 4RVUA 3BDAA 4YRGA 5JT1A 1OW3B 1I24A 3A6PC 3PVCA 1QYIA 4EVIA 4MWSA 5FADA 1HF3A 1JIIA 1E0EA 1BSVA 2CXSA 4PIMA 5A06A 2OWEA 4G81A 5EPOA 3ML1A 2HSZA 3UFXA 1MVNA 3MT0A 4BS9A 1YJWI 5FP0A 2GILA 3T7IA 4G7OF 4CIAA 5EHZA 2ISZA 2Y99A 3M1AA 2XE7A 4KDRA 1KETA 4R05A 1A4RA 1G4AE 2EKQA 4UNQA 3PUYA 3IUQA 4P2BA 3OPVA 1VQMI 2B37A 3Q3CA 3RKSA 3MOGA 2PL5A 2P6UA 2Q07A 2VOEA 2VASA 5GJBA 4CCKA 3G1OA 2F43B 4DMFA 1TUBA 4JJZA 4R79A 2J6IA 4MTLA 1RBYA 4GBGA 3RAPR 1Z4KA 1QP8A 3INTA 2AK2A 1RXCA 4NZNA 4DIFA 2ESNA 1JJ6C 2CW8A 1E3OC 3HJGA 3AL0C 2KDZA 5LMCA 2D0DA 2OMKA 3NVKI 2L0XA 3SYTA 1GO2A 3IQEA 2BGKA 2AB0A 5FF9A 1DFGA 3VPHA 1EUYA 3R6LA 1VSTA 3JQGA 1A1SA 3BMQB 5HS8A 1GUBA 4L7QA 4GMGA 1X2EA 4HDMA 4B0PA 2PX4A 3E70C 1FFEA 3O83A 1FLDA 2A5LA 4A3MJ 3FKIJ 1F8YA 5HLIA 4NEGA 2R6GA 1KKMA 3LP8A 4NQRA 1LGYA 4GE3A 4LRYA 3G73A 3OPMA 2HA7A 2C5FA 5B30A 2WZDA 2G76A 1J2YA 2ZQZA 3IAHA 3IE1A 4FYHA 3WWPA 3M81A 2ZWAA 2IYPA 3HTSB 3NVMB 4JT9A 3GLSA 1PGQA 4MB6A 3S70A 1C80A 4EMTA 4I50B 4FFWA 4CM5A 3FCCA 1E5TA 5DNAA 3FROA 4HDCA 4J29A 1R4MA 3WHCA 2GZRA 5DJ5A 2DHQA 2IWRA 2O7QA 4RTOA 2HUNA 1C3VA 2Q6LA 3WHKA 1T1IA 1Q0RA 3C98A 1D6MA 3QI2A 3GTPJ 4HLQB 1QE3A 4YRJA 2GNPA 2Y4NA 1GPWB 5E6RA 1O89A 1XTKA 3RBVA 1LZKA 5LBQA 1PP8F 2CBGA 3OE5A 3FHZA 3TGPA 5KWIA 3CINA 1E2BA 1X1CA 3BAZA 3PGLA 5BPIA 1GGMA 3OIVA 4E7PA 1JXAA 4AS2A 3K73O 3MELA 3TNFA 3UJ8A 2PX5A 1DQUA 5FTJA 3RE1A 4U00A 5GOTA 3BA6A 4RKWA 1H4QA 4Z8YA 1DQSA 4IL5A 1QA6A 1M5TA 1TLHB 1QGPA 2IVMA 3BWYA 1T3TA 4WLVA 1W36B 2W25A 1VOTA 5BN4A 3QYPA 3FFWA 3OQPA 1K6JA 1H5NA 4BNCA 3J81K 1O7LA 2COMA 1PR6A 3AO0B 4F4FA 4OO3A 2V97A 3OQIA 1DBWA 1UIMA 3C2GA 3OUZA 4QPOA 3EC7A 1CG6A 3QPDA 3VNSA 3RSSA 5JSQA 2Z8YM 2WA0A 3ZV4A 5HF5A 4ZYYA 5JC1A 1BX3A 2ZSBA 5JCPA 3QE2A 3L79A 3FDYA 3K0KA 1H8HA 1WY5A 1GD1O 5D3KA 3CNQS 3THOA 5FWXB 5KTYA 3LP6A 2AW3A 4JVNA 1EJ0A 3C3PA 2FCRA 1XB2A 1LBSA 1NHGA 3IQXA 4RWEA 4UMEA 5C5DA 3LHFA 1CJVC 2IIQA 2HM7A 3ELYA 1EBBA 1N32B 4PBRA 4CM9A 3RCBA 4G0YA 5EQDA 4ZO9A 1F2TB 5HPYB 4AKGA 1HTTA 3T15A 3RHZA 4W63A 4D8WA 4BQFA 2HSJA 4D9GA 1N0UA 5C3UA 5KO2A 1QH9A 5DX8A 1T5TA 1F17A 4L9NA 3ZD8A 1DQRA 5CA1A 4GX2A 1NNI1 1MF7A 3ITDA 4TL6A 4OBBA 3VMFA 5CDTA 5EZYB 1GFIA 4LE2A 3C4QA 2EJUA 3WZ2A 2BOVA 4HTAA 1LI7A 1TO1E 5H7XA 3NOXA 3DDHA 3AVVA 5DBFA 2TS1A 1JJBA 3KBBA 1P39A 2W0SA 4Q9KA 4PFKA 2O8FA 1P4XA 4Y17A 4W9NA 4IFIA 5B1AH 5CVJA 2D5IA 1QGYA 3MWEA 5LQAA 1GKUB 1D07A 2Z95A 2QZJA 1JR6A 1XTVA 2FOKA 5L4SA 5ES4B 1JJAA 4HWPA 4OBXA 3CX4A 2VXDA 4Z6YA 3S2IA 5E7JA 3U7QB 4RMJA 3I8OA 2UAGA 2JAUA 4MVJM 2JIPA 5I9SA 3FXLA 1G20A 3P9IA 3WL5A 1T8PA 4HDRB 2VT6A 2Q9CA 4DG5A 4X5OA 4ZI7B 1H22A 1AKHB 3EXG2 4MEXF 5HNFA 4O25A 2DLLA 1YO5C 4XWOA 1HNWB 5DIFA 4UXJA 1GQOA 2ODQA 4L8YA 4CKWB 3H1BA 2FJ0A 2XROA 2JKVA 3FUCA 2OP0A 2GJSA 1W52X 3ZZMA 3JRGA 2OJED 1DRKA 1X74A 3UWPA 5EC8A 3ZVLA 1IVSA 4B3BA 4NC6A 2BR4A 4DR1B 2VDUE 4B48A 4CLOB 4EHIA 3QPLA 2IZ6A 4XRSG 4NLLA 4E09A 2RJOA 2Z8XA 1JAZA 1H4TA 3KR0A 3W5AA 2AFIE 2OPBA 1KQGA 2O6GE 1EFVA 3T54A 1ABEA 1IQ0A 2OCDA 2VP4A 3E8SA 1S2GA 1W8IA 2I2WA 4N8EA 1RLUA 2OO5C 1X1DA 1T39A 5K3DA 2ZKZA 3A06A 2JPDA 2PIAA 5CB4F 4D9FA 4K6GA 3ZJYA 4FNGA 2E85A 3I0TA 2C0CA 3ER6A 1GFZA 1PYOA 3D3EA 4Z1MA 3FI9A 5JXGA 3W9SA 3C3EA 4QBHA 5J1TB 3ON5A 2V9CA 5KOYA 1K9VF 2ZS9A 1T5BA 3DE1X 2PD6A 9LDBA 4GKKB 4XYGA 1B6SA 1UZUA 4A8PA 2MDTA 3B3QA 5DFAA 2F4VB 2K27A 4URHA 4QGGA 2K5UA 2R7NA 2BFBB 3DA8A 1VHDA 3ZBQA 2LRHA 3SFZA 3HRHA 1KQNA 1QV9A 3UQYS 2JG3A 1TNTA 3UMSA 4L27A 4XIJA 3CNHA 1A0OA 2R6JA 1Q3HA 4B4VA 1HC7A 1WZCA