4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
4LG0A 1LEAA 3R60A 1ZG5A 4GOLD 5DM4A 2RDPA 2P6SA 4E2XA 4RS8A 2AOWA 3KQSA 1LNWA 1HW2A 4LWPA 3X0DA 4HQEA 1L1EA 4CICA 2ACJA 1N7JA 3FM3A 1SAXA 2QRVB 3BOQA 3FF5A 5FADA 5GINE 3GIWA 2XKPA 2WA1A 3EGIA 3EYYA 2PV0A 4IRIA 3CC8A 2CWWA 1D2CA 1HXDA 2DK5A 1YUBA 4ZZLA 4KUMA 3KQVA 3FXRA 5HZMA 2C7QA 4FSDA 1NKVA 4R8SA 5K5QA 1JHFA 5L3EA 2K86A 1F3LA 2HWKA 4M9XA 5D6FA 2AOTB 2DU9A 4PCQA 5DRYA 4IJAA 3JAMZ 3HYIA 2VP3A 4GC9A 3FRIA 5EMMA 1D3YA 4IWNA 2O05A 4LGWA 2QE6A 3FPHA 1H9GA 3FMQA 1DL5A 1N7IA 5GWXA 5CIYA 5DDGA 5FWAA 1EH7A 2O03A 1ZRDA 4OOIA 4K2EA 3KQWA 3MWMA 5DXAA 5E8RA 5EVJA 5LLQA 1LQ1A 4BH9A 3HSEA 1FYKA 4OA8A 3CUQC 4LFUA 1IN5A 5BW4A 4PGGA 5KYGA 4EJUA 2C6YA 1D5VA 2VE8A 1DUXC 4CTJA 1K79A 2BYVE 4BY9E 5FFXA 2AVDA 2C7PA 2NP6A 4XBFA 2CWEA 1KPGA 4I7HA 1XDSA 4S04A 1CF7B 4RVFA 2V6CA 3ZN1A 3J7AO 1TNSA 3HHGA 3CBGA 5BPDA 2D1HA 2PX8A 5DSXA 5LQRA 2QBYA 1HBXG 4LB5A 2O8XA 3SXYA 4ASNA 3FYDA 1HNNA 2YQZA 2BEOA 2H6BA 4HTFA 1X1AA 2AN5A 3V4GA 3CO6C 4M7RA 3OZRA 4Y30A 3F21A 4NB5A 2B0LA 2WC2A 3NWEA 1W7PB 1JG1A 5KQRA 1I1NA 3K1NA 2EJUA 2JPBA 2BE5F 2ZBRA 4AX8A 1YW7A 4ZTBA 4JQFA 4E70A 4YFNF 5D6EA 1JSZA 2HQNA 3SZTA 2GS9A 3P9KA 3M6VA 3R0AA 4X41A 4RB2C 3M1EA 1P4WA 2JPCA 1RI3A 1VPTA 5E1OA 4ER6A 3WTTC 5E9JA 5HDNA 2XRNA 3K0LA 5FD5A 3EEOA 4JK1X 3FM5A 4C03A 2G7HA 1ORIA 3H92A 3I5UA 4DM3A 2EJTA 1XGOA 2QBYB 3B02A 3KR0A 1WG8A 3KPVA 1Q0TA 5DTRA 1CF7A 4CXFA 2CO5A 3BWYA 5H6RA 4DKJA 1G6Q1 3MTEA 1XD7A 3NEUA 5EOVA 1XCVA 2P3OA 5E8JA 5F64A 4YMHA 1G4DA 1KYWA 1MHTA 4PYQA 4HLXA 5E2BA 2UYQA 3HOSA 2UYOA 3UJCA 4I02A 2DULA 3TMAA 1W7PA 4BP3A 3LECA 1B1BA 2ESRA 4L18B 4HBLA 4IHSA 4AIKA 3GO4A 3DXJF 3GDHA 5ERIA 4R8HA 2PT6A 4HA8A 4OMZA 4KT5C 5GP1A 1IN6A 5JUWA 2B3TA 1KPIA 3N4MA 1TW3A 2JZYA 2RKHA 5DD8A 3KPJA 4A0XA 1SD6A 4EGYA 3PQKA 4YMGA 4AZSA 4A5MA 2RNJA 3L7WA 3T5XA 1BIBA 3CGGA 2YR0A 3RDIA 2PJDA 4IVNA 5JVTA 2P4WA 3L2CA 1JTEA 4GC5A 5J6XA 1R8YA 4QQNA 5DUKA 1AOYA 1RJDA 4KVZA 2UXNA 4RGUA 5A2QZ 2NNWB 3KP6A 2P5LC 5DSTA 3DF8A 1XB4A 4RGSA 5D4RA 2BR3A 2FBHA 4JBAA 3LCUA 3MGGA 3VC1A 4G6DA 5GM2A 5L3DA 2ISZA 1QAMA 4EV0A 3OFKA 3G2MA 2FU4A 2VDUE 3F3XA 3QV2A 1A04A 2MH9A 2VONA 1IRGA 3WTZA 3AAFA 1KA8A 3KCCA 1X19A 4GBED 2XGXA 3UWPA 1FSHA 4HF2A 3OOPA 3QU3A 3KP7A 2QWWA 4RTMA 4FX4A 2VE9A 4M37A 5K0BA 2G9WA 3ELWA 5LEKA 4XLPF 4F84A 5FA5A 2OBPA 2GH1A 1YFLA 2HTEA 2G7UA 2R7DA 1R22A 4L5JA 4EKGA 3T7RA 1P39A 2HWVA 4ZYGA 3R24A 3EYIA 4KYWA 5HS9A 5E1MA 1EH8A 2FNPA 1EJ6A 1S6LA 2BM8A 3CJTA 3L09A 2QRVA 3TQNA 4HC4A 4HGZA 3E5UA 3GW2A 3P9IA 2IH4A 2EV5A 4M72A 1MDMB 1ZRCA 5H20A 3R6SA 1XGMA 2GQQA 4PGHA 2AXLA 4CO8A 5LBQA 3TM5A 1LVAA 3DFGA 1QANA 1WXXA 4LG0B 3KPWA 1EQAA 3KETA 4PIPA 3MCTA 5H6QA 4HDUA 2VT3A 2PX2A 3UJAA 1SD4A 4R05A 3CUQB 1HW1A 2CG4A 3JWHA 3M8FA 5LGTA 1OR8A 2OPBA 4I0BA 5DT2A 1YFHA 3PQJA 4LK0F 1B6AA 2VXZA 4XSXF 3LA3A 4YIIA 1EJ0A 3UZUA 3IKTA 5CVEA 3G2OA 4UV8A 4CWAA 4ER0A 3TO6A 5DM0A 2ONZA 2ZNZA 3F6OA 2DBBA 2HKXA 3OV8A 3ZMUA 3BXOA 5CVVA 3U1DA 3EVCA 4O5VA 3I9FA 2GA1A 3C6KA 2Z99A 3BGIA 3IKVA 3LAPA 2G8NA 5FD6A 2J5OA 2ZWVA 3HCFA 2F2EA 2V1XA 1R36A 2PXXA 1SFEA 3QOXA 6PAXA 2JH9A 1SMYF 5HLIA 4A2UA 5CD1A 9MHTA 1IAWA 3W6JB 1O7FA 2NXJA 4LJZF 3Q9VA 3KR2A 1WQ2A 4C05A 1BC8C 3JSPA 2GWRA 1YIOA 2GAFA 3UJBA 1U78A 3TDZC 2HR1A 3G5LA 4RYLA 2V79A 4R1HA 1WS6A 4L9VA 3RODA 3KP3A 4UXNA 3HRTA 4PDKA 1OYWA 1S8NA 3F22A 5JR3A 1B59A 1RJGA 3BUSA 4ER3A 3B7PA 5CVIA 2FBIA 4E2ZA 1I27A 3ABUA 3ZMZA 2ZFUA 3C3WA 1ZQ9A 3IWZA 3TO7A 3R3HA 2DO7A 3LBYA 1V3FA 2QQAA 5E9QA 1ZAOA 1XVAA 3LSTA 4P55A 4GYGA 4U0VA 2G1PA 3DV8A 1XGSA 4EM0B 3MB5A 4C07A 1XMAA 5E1BA 2ZIFA 5ERGB 3ERED 2QENA 4O29A 4CTKA 5TRDA 4Y15A 3OZSA 2HGCA 4RTOA 4YV1A 3LCCA 1PDNC 3SR4A 2QY6A 1GVJA 3SHFA 3O6BB 3VC2A 2NNYA 2A3SA 3I4PA 4FT4A 5LGUA 3GRUA 1F1ZA 4LMYA 1BC5A 4LLLA 2XROA 5EIWA 1TNTA 1T98A 2VDVE 1N2XA 1UHMA 3IHUA 1VP9A 4AZWA 4PYKA 1YQAA 2VC0A 3HRUA 3RYRA 1R23A 1HKTA 3OU6A 2CFXA 4L7VA 1UWVA 1ZREA 2P5KA 2XASA 1P2FA 2JHPA 3KPYA 3VSEA 3DP7A 3SZPA 4Y2HA 4BLVA 3RPUA 4IXAA 4S05A 1O3QA 1XN7A 2A68F 1TW2A 1L0OC 3T8TA 1FOKA 3IL2A 3Q7EA 1R7JA 1E2XA 3F8MA 2ZULA 2K4BA 4KA4A 1KPHA 2W57A 1R8XA 3LHDA 1FPQA 1EIZA 4M38A 3IRRA 2Z33A 2LD4A 3DPLC 4LWOA 4E33A 3FTEA 2O0YA 2IVMA 3PT9A 2ONYA 2ZIEA 3VEPA 3TKYA 3JTGA 5LRSA 3H2BA 4XLNF 5F1RA 2I7CA 4QQKA 2DPDA 1RNLA 1IN4A 2D1VA 3KLNA 3PVCA 2AN3A 2VODA 1G3WA 5HLGA 5ILSA 3WTYC 3C6MA 3F72A 3IEIA 1BOAA 3TM4A 3FUWA 4E30A 2OY0A 4A6DA 3BJ6A 1U8RA 4RAZA 2EFJA 1C0WA 2R6ZA 3BZBA 1EH6A 3ML6A 3EVAA 4OIRF 2FF4A 4HG2A 5FO5A 4EVIA 1QYRA 4QPNA 2YXDA 5HFJA 1W5SA 4GYIA 5DRTA 3BKXA 1I4WA 1HKQA 5FULA 2R3SA 4QLCU 3JSOA 2Q2EA 5FWDA 3HCEA 1JTFA 2YU3A 4M6XA 3EGVA 1YB2A 3P7NA 3HTXA 5DD4A 1INLA 2UYHA 4OIOF 3GVAA 1YW8A 3B73A 5EMKA 4V0QA 5GM1A 2FEZA 3F8CA 3MQ2A 2GPYA 1ONVA 3FZGA 2ZZKA 4EK9A 2V74B 4HV6A 2EB7A 3RKWA 5EQJB 3F8NA 1FT9A 2MD5A 4U7PB 5K8VA 3C3YA 3E05A 2HTJA 5DXJA 1XXLA 4U7TB 4FT8A 1IN7A 2OZVA 3R4KA 2DPUA 4WK8F 3B3GA 1AQIA 1T43A 1G6NA 1OR7A 3R6TA 1RI7A 2GLUA 4IHTA 10MHA 2VT2A 1NV8A 2A14A 4Y13A 3K0BA 1FY7A 3LDUA 3LGAA 3WE3A 4MQ4A 2W24A 1O9HA 1MZBA 1SD7A 3CJQA 5J8FA 5EKUA 1FBNA 2DLLA 2LSOA 1SUIA 5FCDA 5DPMA 1RZ4A 1BN5A 2PGXA 1SG9A 2PKWA 4MHTA 2E7WA 3NVKI 1AV6A 3RJPA 3COAC 4EJOA 4RSRA 2UXXA 3V7SA 2O61A 3Q5FA 4YV0A 4M74A 1J2XA 5F2OA 2B78A 3FRHA 4TV7A 1PJZA 3OE5A 3TR6A 2L54A 3W6KB 4WVLA 3ZPLA 3HHHA 1P6RA 2OB1A 4G7ZF 3V8KA 3C3PA 1LDKB 1XCBA 4B09A 1WSUA 4HZFA 3K9TA 2EG5A 2XVAA 4AVPA 2A61A 4A12A 1UIRA 3JWJA 3RW9A 3E5XA 1YS6A 1UFKA 1JR4A 3G2QA 3ORHA 2XAGA 1NBHA 3KE2A 5ICEA 4KRGA 1SD5A 3CDHA 2OZUA 4L0YB 2ESHA 5GIPE 2KIMA 4X61A 3PS9A 3BROA 2WWYA 5K0EA 1YTYA 2BR5A 3EDPA 1NW8A 1E17A 5LRRA 2QUFA 4BXUA 4I09A 1BI1A 5DX0A 1T0FA 5IKMA 3A26A 4OQEA 1WZNA 4QWQA 1MDMA 1WWXA 1MJAA 4DA4A 1BKYA 1JQDA 2N47A 2Y1XA 1P4XA 1G55A 3L00A 1SKMA 1R1TA 1X1CA 1K7AA 4RTJA 3MFKA 5DM1A 2IBTA 1PP8F 4ENNA 2NXNA 3JTHA 5HS7A 2PQ8A 1XTPA 4V0RA 4C04A 1IUYA 3M6UA 1D2GA 4CKCA 2DT5A 3LX6A 3DH0A 1D8JA 3IRQA 2EV6A 3GRRA 1JXSA 4FS8A 4DZRA 5JHUA 1H1DA 1Z6RA 3F6VA 4E2WA 3TFWA 1OPCA 3HVHA 4IV8A 1S29A 4OQDA 3GLXA 1Q0SA 3DR5A 1F38A 5EGSA 2IA1A 2VBYA 4A0ZA 2IW5A 1HQCA 1R5HA 5IT9Z 3H3ZA 1U6GA 3ER8A 4P58A 3F8FA 2RGVA 4QVGA 2ZVJA 3SFZA 2K4JA 4GOOD 2BZGA 4UVAA 5BMZA 1FZPB 4G9YA 2WTEA 3J81K 5E18F 4UV9A 4UVCA 4AD9A 3TOSA 3C1DA 5HILA 2AOXA 4Q5SF 5D1NA 1RI4A 1YF3A 3G89A 3UJ8A 1ZRFA 2XKOA 4KNYA 1M0EA 1TPYA 3UA4A 1LEBA 5AIQA 3LDGA 3I64A 3HA7A 2M1BA 4ZYDA 1MJ9A 3GFIA 3RYPA 2KIUA 1SQFA 3MAGA 2Y1WA 2E1NA 2JH8A 2IBSA 4DF3A 4BHCA 4KN7X 4RV9A 3M6WA 3PLAE 3WU0A 1IXCA 5EZQA 4HSGA 2PLWA 2OA4A 4HQMA 2PXCA 1G3SA 3EPPA 1SFUA 2KJCA 5F6FA 1BIAA 3FUVA 1JG2A 2GA9A 1ULYA 5DTMA 2GZWA 3F8BA 1IW7F 3SSNA 4L5IA 5L3GA 2IFTA 5K05A 3DPTA 2PMUA 2PMHA 5DYMA 1FP1D 2JJQA 3LQRA 3EEYA 2QYOA 5MHTA 5T6BA 3LDFA 1KXZA 1KR5A 5K0NA 2Z6QA 2NXEA 3K6RA 1NW3A 1USSA 1L9KA 4YG2F 3VOEA 2PX5A 2EFWA 3B3JA 5E1WA 2A6EF 2Y0MA 1Z05A 5P8WA 3K1MA 3H3UA 3GO5A 2IDJA 4JXJA 2F8LA 5CVJA 3JW4A 2ZWAA 3T7TA 4NHJA 3OPNA 3OFJA 4R79A 2H09A 2H94A 4YUXA 5BW5A 1BJAA 1RI5A 3NDIA 3BWMA 4ENJA 2L3DA 2AOVA 4RB1A 1F4KA 3E3VA 2Y75A 3BPXA 4L9TA 3SX0A 1QGPA 4P9FA 2DI3A 1NE2A 2YX1A 2YPRA 3DMFA 1ZHFA 3OU2A 1BBYA 2PWPA 2ZMEB 3SM3A 2M45A 3GFJA 1ZKDA 4X63A 4M73A 2STWA 2UZKA 2E5WA 1XCLA 2YXLA 2EFQA 5HDGA 1G3YA 2FOKA 2K7LA 3HVJA 1X1DA 2M87A 3UBTA 3GEZA 1OYIA 3G3ZA 2YUIA 2FA5A 4X60A 5CLSA 4EQZA 3I54A 4HTFB 1FYMA 2HS5A 3IC7A 5EEGA 1J0RA 4BYYA 3J81Z 3VYWA 5KQSA 4BQAA 2F5FA 4X1OA 3S68A 4OIPF 1ON1A 4ESJA 5K01A 1ZARA 5BOXA 3E5QA 2P7VB 4C06A 1R18A 2XBMA 5EG5A 4MHGA 1VLMA 1HSJA 1G38A 4OMYA 4NQWA 5BP7A 1Z9CA 2ERCA 2OYRA 5E9WA 3C18A 3KQYA 4PIMA 3E23A 2ZJ2A 4DCGA 5LEJA 3G2PA 5EZSA 4Y17A 3GZ6A 4HW0A 2P7HA 4HX4A 2D2WA 3PFGA 5L3FA 2V7EA 2YX7A 1O9GA 2IT0A 2AOTA 4KDPA 3GRZA 3ER9A 2ZSUA 4LG1A 1SMTA 3U2RA 2O6GE 2ZW9A 3EVDA 4HH4A 5F2KA 5EMLA 3T8RA 5L3CA 2HQRA 2P8JA 3EMBA 2BH2A 4R6XA 3NQOA 1Y8CA 3TKAA 4FT2A 2FNAA 4A0YA 2BGCA 3GRYA 1IY9A 1ZGJA 4KW7A 3AXTA 3GCZA 3TGNA 1YZ3A 4L0ZB 4DMGA 1Y0UA 4LECA 4LLGF 5E20A 3RIRA 1FC3A 2OZ6A 2Z6UA 4CHUA 1ZN2A 1UHWA 3D2LA 3P8ZA 2KKOA 4B8XA 2DAOA 3SSOA 3T1BA 3CUOA 4QTTB 4EMSA 1JQ3A 1ZGAA 5CM2Z 4OU0A 4G8XA 4QDJA 4ZH4F 3LCVB 5LQUA 2IPQX 2AVNA 4YFXF 2QQBA 2A69F 4ESBA 2B25A 2WA2A 2DW4A 3SQNA 3QP6A 3HTUA 5HVQC 3HIFA 4YUWA 1TQMA 3HNRA 3MZHA 3A7EA 3E97A 4P7KA 3UJ9A 2AOUA 4QDKA 1QZYA 1WI9A 4GGGA 5GOZA 3TDUC 3R0JA 1FSEA 2UWMA 2H6CA 1HMYA 3P2IA 4CGZA 4PYJA 2A5YB 3V8VA 5FHQA 3JAMK 2WV0A 4ENMA 2CW0F 1J5YA 2OB2A 1HW5A 4CYDA 2I9KA 3HCDA 4FP9A 3DLCA 4WXCA 1VIDA 5FGMA 3CCFA 3UFBA 4EJWA 8MHTA 3NMUF 4CKBA 3SSMA 4DNCA 4QTUB 2HOEA 1S7OA 2ZLBA 3U81A 3QU6A 2Z6AA 4OINF 1J9IA 4AUKA 4MQ9F 3UA3A 3FTFA 3HP7A 1B42A 3WGIA 3WTSC 1WY7A 1J75A 3NWBA 3SMQA 3E6BA 2EWNA 3FWEA 5K5RA 1RUOA 3WSTA 4KDRA 2AS5F 1FWZA 2XAHA 3IV6A 4PYMA 2MLKA 4MTLA 2BV6A 3VB2A 2OU2A 4MEYF 3F23A 5U4XA 3T7SA 5BXYA 2EV0A 3IWFA 3DLIA 4UNOA 3LL7A 1VL5A 2FHPA 3HVKA 2JHAA 1BM9A 3E6DA 3SVZA 2P41A 3NW9A 4RTKA 2TDXA 3WTWC 1O3SA 5CCBA 4N9IA 1I1GA 2W85A 4N9HA 1JGSA 4ENKA 2IA0A 2J5PA 4ESFA 5ICGA 4PYIA 3P2EA 3QPHA 4Q47A 4H0EA 3HOTA 3I59B 2PWYA 2DPMA 2PN6A 4GXOA 2V1UA 1D8KA 3V8JA 4U7DA 4KIBA 3NDJA 4YUVA 2IH2A 1AWCA 3OZTA 4RVDA 4KMUX 1TQIA 5ILUA 3B89A 3K1PA 2LF8A 3P97A 3BWGA 1IN8A 3HCAA 2NP7A 2NAZA 4WXHA 1LDJA 1YG2A 3HM2A 2VC1A 3GX4X 3AXSA 1R1VA 4IKPA 2B2CA 4P7GA 1KQ9A 3CKKA 1NV9A 3KU1A 4F86A 1FNNA 2CSOA 1SFXA 2X4HA 3ME5A 4PYOA 3FTDA 2P6TA 2DQRA 2Q8KA 2VZ9A 3KP2A 5CUQA 1IM8A 1ZG1A 1P92A 3BWCA 2VOOA 1RI1A 3KEQA 2G72A 2GB4A 3G7UA 4RTNA 2L4AA 4CDGA 3NVMB 5K0JA 1KU7A 4AIJA 4MEXF 1ZH5A 2NRAC 2XYVA 2P7IA 5IT9K 3QOWA 5EKXA 2L02A 3UJ6A 3HRMA 4EJVA 1KIAA 1X3UA 1FBQA 4XUDA 3GFLA 3N97A 1GHCA 1SVUA 3EETA 2B9EA 2YTZA 3TRKA 5LQNA 1K78B 5LGNA 3T0IA 5E8GA 3JWGA 2CL5A 3KPUA 3EVFA 4OIQF 3LA7A 2RV8A 2IJLA 5CVRA 3CTAA 4CKEA 1DUSA 3J80Z 3RTRA 4UOEA 2QVOA 2AOUB 2LDUA 5K0CA 1XSVA 1XMKA 3QOPA 3ECHA 3DULA 4KMFA 2ZIGA 1RJFA 2W84A 1Z6TA 1YS7A 3THSA 1RJEA 2X0LA 1Z3CA 2FRXA 2RN7A 1F5TA 2E1CA 5DCFA 5ICFA 2I62A 3DEUA 4RVHA 1QNTA 1OYYA 4YV2A 5HOOA 4MTDA 2ZBQA 4P96A 4OBWA 3HEMA 1QPMA 3BPVA 4CZZA 2LNBA 1JQEA 3RPQA 3LFKA 4HX7A 4IF4A 3ZP5A 3I59A 1IRFA 1ZG3A 4RTSA 1I5ZA 5DEQA 5LQCA 4IPAA 2F5CA 4M9SA 1VP3A 2JG3A 4P5OA 4PONA 1T6SA 1KU3A 4ER7A 3QAHA 4U7BA 4HX8A 2O07A 2GA2A 1WXWA 3D5LA 2ADMA 1BI0A 3MZYA 1HKSA 1VBFA 1XGNA 1B4AA 2EA4A 2G70A 2O57A 1R6AA 4HDVA 2DTRA 4GOMD 5LHIA 1Q1HA 3ELKA 2EX4A 1TBXA 2P1DA 1SQGA 3AWIA 3BDDA 3LBFA 3ECOA 1L3IA 2CMGA 4MIKA 4EKIA 2ZZMA 1TTYA 2P3QA 2AN4A 2FRHA 3WG9A 2OQGA 3BGVA 5D5WB 5EMJA 3DMGA 5F2NA 3U9GA 4YFKF 4M71A 3E6CC 1NW5A 5LR6A 3G5TA 4E31A 1MJBA 2YVLA 3P71T 2XYQA 1KU9A 2XV4S 4MTEA 1FP2A 1IXKA 5C9ZA 2M8EA 3I53A 2WK1A 2ZBKA 2VBXA 1JE8A 3FMSA 1JG3A 3KP4A 1S7AA 3FXQA 3HCCA 4FSXA 2EFNA 2HR3A 4ZZDA 4WX9A 1MGTA 2EK5A 5HDKA 1DPUA 2BBYA 1ZLJA 3GFMA 1FBUA 2QQ9A 3LQQA 4Q48A 2H1RA 1JG4A 4ZYEA 3ABTA 2A07F 5D5UB 2QLZA 2IP2A 3IYLW 3ZMSA 5DLYA 1IF1A 4KDCA 3O2PE 1ODDA 3DXZA 2ZFWA 2XIGA 3RI4A 3C0KA 1K6OA 4YIFA 3BKWA 1B9NA 5KVRA 3FPGA 5ED4A 3M7GA 4LB6B 4QVKA 4FZVA 2P5VA 3KHKA 3G8AA 3KZYA 4WXDA 2NNNA 2V1DA 4KIGA 1R58A 4O6JA 2PLYA 4MNUA 3VFZA 1R00A 3GJYA 1PP7U 3P2KA 4HYEA 2FK8A 3TO9A 1QZZA 3ID6C 7MHTA 3BT7A 3QRFF 2CKDA 5IH3A 2BM9A 3MAJA 4YUZA 5HIJA 2DK8A 4HOBA 1MKMA 2XYRA 2PI0A 3M4XA 1YLFA 1FBSA 1DPRA 2HKOA 4N0BA 3E8SA 2Z3YA 5E1ZB 3KQQA 2GXGA 5D4SA 3EVZA 3E6MA 3WTVC 1L3LA 2M30A 5LQKA 2VDWA 1MJFA 4BHPA 5DCMA 2VBZA 4ISCA 4HAMA 2P7CB 4G7OF 5TJJA 2OBFA 2R7FA 4AWXB 3CJRA 3IHTA 5E1DA 2H27A 3KQMA 1WRJA 4GF5A 2FQ3A 3FYCA 4HV5A 1V39A 2Q0OA 3M9AA 5HIMA 4POOA 5LHGA 2PXAA 3KZZA 3OCJA 3WGHA 3QPTA 3B3FA 3ZQ7A 3Q87B 4P7JA 4PCLA 1F9NA 5DTQA 2F5EA 1YW9A 1U5TC 1AF7A 1NBIA 1NW7A 1U2ZA 3WE2A 4GEKA 2YXEA 5LQAA 5HIKA 2L01A 2E7XA 3CUQA 3PX2A 3DXYA 5G02A 4LLNA 1CGPA 2AR0A 3BJAA 5GIOE 1G8SA 1BI2A 3PTAA 1O7LA 2PEXA 2PX4A 5HLHA 3WTXC 1NT2A 1BOOA 4AZTA 5EHIA 2Z5UA 4UUVA 5J8CA 3EVBA 2KJBA 3PFHA 4I2OA 4KICA 5D5XB 1Z7UA 1I1SA 1PRYA 2FK7A 5FQNA 1VQ1A 1K78A 4HGYA 1P91A 5AONA 2UYCA 4EM1A 4PWYA 3HRSA 2P8TA 3V7RA 2HEOA 2PBIA 2H11A 3KQPA 2FE3A 1FX7A 1XJ5A 4XCXA 1UB9A 1LDDA 1HSTA 3DMHA 4C08A 4E2YA 3JWIA 1R74A 2NYUA 4RWZA 2GXBA 5K0LA 2VBWA 5C1IA 5AIPA 3C7JA 5BQTA 1VE3A 2XAQA 1XDZA 3BZ6A 3GUDA 2GAUA 3HVIA 5HEKA 2A6HF 3ZN0A 3Q9SA 3KQTA 3ERCA 1J59A 2OXTA 1R5GA 5EEHA 3O31A 5C0OE 2EJRA 1ZLKA 3O7WA 1MD0A 4Q4ZF 1M6YA 1V4RA 5T64A 1LB2A 3I71A 5K09A 1KYZA 4OBXA 4P9UA 2PT9A 3GF2A 2HNKA 3A27A 3QP5A 4D0PA 3UJDA 2OKCA 4UVBA 3BY6A 4PCAA 1IXRC 5FQOA 2CQKA 3TPZA 1EG2A 3FXUA 3PFIA 3GZ5A 2JHCA 2FMLA 4KN4X 5E8IA 5KVAA 4KFCA 2IGTA 1TLHB 2HYFA 5D1HA 1PUEE 3WU1B 2ORED 5ICCA 5JI6A 4G56A 1GXQA 3MHTA 1ORHA 1QAOA 1M6EX 3BJOA 4I0AA 2P3LA 1XSDA 2OD5A 1BC7C 3ZMTA 3TOAA 3DQVC 1UCRA 3L9FA 2YR2A 4BLWA 1J7KA 1Z91A 2K27A 3VODA 3WGGA 4MQVA 4U0WA 5DCMB 2STTA 3KEOA 3THRA 3DTNA 2ESNA 4OX9Y 3M8EA 4C4AA 1UFMA 4G6QA 3DXXA 5LHHA 4XRFA 5D8KB 2HDCA 3DKWA 3ULQB 4RVGA 1KHHA 4R8RA 5LQJA 2CYYA 4RTPA 3MQ0A 4A6EA 4P7FA 4EQQA 5DUIA 1P1CA 1Z1DA 2CMHA 5B1SA 2COMA 2ZCWA 4GQBA 4BNCA 4H0NA 4RTRA 2VN2A 4BAYA 2HMYB 3R0QA 1TQPA 1FYLA 5A2QK 5FHRA 4EM2A 3B5IA 2MBFA 1DP7P 2K02A 2KIFA 1KP9A 3GGDA 1O54A 2IH5A 5LSAA 2QZ8A 1YFJA 2ZBPA 3MCZA 1W4MA 3K69A 3AJDA 1AQJA 2JSCA 3TOBA 2UZ4A 2RC4A 5CYVA 4YUYA 4EGZA 1RUNA 1U5TB 4LK1F 5DV5A 2XVMA 4M9ZA 1G8AA 2MA3A 5EHGA 4EJTA 2ZNYA 2Y48A 4E32A 3KLOA 1DDNA 5M5BA 4F7ZA 1H0MA 3RKXA 2ZKZA 2KRFA 3FHZA 4AZVA 4B17A 5IT3A 2FMYA 2VOPA 4CXMA 2ZXJA 2D45A 1L3CA 1WKMA 5DX8A 5K0GA 3FZVA 4L9NA 5E2AA 3M70A 3ZMVA 1W5TA 2FXAA 3A25A 1VTNC 3WTUC 2O3FA 3EVEA 3LWFA 3HA3A 1S3JA 5FTWA 2LF7A 4DQ2A 4DQ0A 2O0LA 3O4FA 3WODF 1XCJA 2G71A 3FPJA 3OE4A 3ELDA 2Q41A 4BP1A 2XUBA 4QPPA 1G3TA 4RGXA 1REPC 2W25A 3PX3A 4PYLA 1L3BA 4HRAA 2F5DA 5K1YA 2EA2A 2JRTA 2MC3A 2QM3A 3RIEA 3KP5A 2HV9A 3MEXA 5D5VB 5FLXZ 2FYTA 4XUEA 4UHTA 1QBJA 2JT1A 4AIHA 4ZYHA 1KQ0A 5HIIA 4ATNA 1G60A 1GXPA 3HSRA 2XAJA 3TLJA 3LKDA 2K4MA 1I6XA 4O3MA 3M6XA 3CVOA 1U2WA 3KKZA 3G88A 3CJNA 2P35A 2I6GA 1RIOH 4KIFA 4M36A 2Z9OA 4Z2YA 1EV7A 2FCAA 3GNLA 3MTIA 5CCXA 3KFWX 1NHAA 4I01A 1YZHA 3REOA 1P4AA 3MERA 3TQSA 1P1BA 2PVCA 3EGEA 3K2ZA 4HF0A 5L3BA 1ZYRF 3BP8A 1FLIA 4U0YA 5CVUA 1I9GA 5BPIA 5EIFA 2ISYA 3CO7C 4HLYA 2MLGA 3S2WA 5FB2A 2RVCA 1NW6A 1USTA 3V97A 3T0YA 4G7HF 5FUBA 2MH2A 4BLUA 4PNEA 2ZMEA 5KS2A 3NJRA 3FUTA 3D0SA 1O3RA 3HSFA 4PYNA 4A5NA 2BR4A 4XUCA 5KK1A 1EAMA 2VS1A 5K03A 2ZCJA 2H00A 4GOND 2YX4A 2GIVA 5DX1A 4G94A 2HYGD 3EVGA 1XDUA 1O57A 4RAYA 3G8BA 3LA2A 4PINA 2IIPA 1B9MA 3GWZA 5CVDA 4BHBA 2L4MA 3LKZA 2V9VA 3I58A 2OQRA 4RGRA 2IPXA 2ETHA 5DWQA 1H9TA 4RTLA 2PY6A 3BGDA 5CJ9A 3FMRA 2O06A 4R6WA 1IZ1A 5EPEA 2XAFA 2HFHA 3ANXA 3FUXA 3FPEA 1ON2A 1X1BA 5T67A 4WF2A 3A4TA 3KQOA 3LAJA 5HS8A 4KWCA 5E17F 4F85A 2AS0A 4WWCA 2DFIA 4HF1A 1XSXA 4MWZA 4RX1A 4GCVA 2C7RA 2EFPA 5K0FA 2PJPA 3I0TA 2OO3A 1DCTA 5FA8A 4LD5A 2PFBA 1U3EM 1BHJA 3NRVA 2ADUA 1U5TA 2CGPA 2KW5A 2NXCA 3CLOA 2M5WA 4L9JA 1YYVA 3EMDA 3FPFA 1OMIA 1YO5C 3G73A 3J80K 3GRVA 5K5OA 5FLXK 5FFZA 3GYHX 1RI2A 2FSWA 1QAQA 3EQLF 3OU7A 3GXOA 3HUGA 4I98B 4M6YA 4ON0A 2ZO4A 4GO1A 2PBFA 3ZMDA 4IRHA 4OA5A 3UJ7A 4DCMA 2P40A 3R61A 4PZJA 4MGRA 3ISPA 5ILVA 1KGSA 5DM2A 2AZTA 3DOUA 1R1UA 3NTVA 3ROUA 5H02A 2IDKA 2NS0A 2YSRA 5E1XA 3P9NA 3FTCA 3EUHA 4FX0A 5D8LB 3A7DA 2PG4A 2FBKA 1T39A 3GU3A 3KR1A 2OAZA 3ELUA 1QO0D 3BWBA 4FHTA 3PB3A 2EFOA 1KQ8A 4GUAA 2LKPA 2HTSA 1T2KA 4RB0A 2JTVA 3L8DA 1FJXA 4RB3C 1KU2A 5HOQA 4IV0A 5JFRA 4FGZA 2DQLA 1QQIA 5BS6A 2HZTA 1OKRA 1W7PD 1SUSA 3V8LA 4K6MA 2ZTHA 4ETSA 3E7PA 2ZZNA 3R9XB 2IA2A 2RQPA 3O3KA 3RKYA 4NECA 5EC8A 3HCBA 2C7OA 1STZA 3FUUA 1LJ9A 4XSZF 1JHHA 3FX3A 4IRGA 3HA5A 3P9CA 2ELHA 2NYXA 1T38A 3LPMA 4ER5A 1BI3A 1D2HA 2XVCA 3AY0A 4FR0A 4RTQA 3M33A 3SXJA 2PSSA 1IXSB 3F4KA 4WCGA 3ELYA 3KR9A 3DUWA 2XHKA 2FPOA 4U88A 3SGLA 1O3TA 3V7CA 3HTSB 1JSXA 2IRFG
chains in the Genus database with same CATH superfamily
1CQZA 3EZFA 1RAAA 2VKQA 3QNUA 1P7IA 4KODA 5GY7A 1OFUA 2RDPA 2GAOA 4FOOA 1NJ6A 1ZCFA 4PCUA 4EWLA 4Q4JB 2ZAOA 4KQIA 4E2XA 3KBOA 2A5WA 4FCVA 2AOWA 3NHSA 3JATB 5LUBA 5FDFA 3FIWA 1U0NA 2IP1A 2POQX 3GRPA 4N65A 4NQRA 4XIFA 1KE1A 4LWPA 2DT6A 5IMBA 2WABA 2QP3A 1D4AA 2CDRA 5F33A 4WBNF 2CJJA 4UTNA 2ZT8A 3GAMA 1R6UA 3HBNA 3KBBA 4RF5A 1T9GS 2ZBDA 4PZAA 5DV9A 1D9ZA 3B9BA 4GMHA 3UV3A 3GVXA 4CICA 2ACJA 2NO5A 3PQ7A 3QWBA 5ILOA 5HNFA 4B4UA 5HKBA 4G01B 3RCOA 4E5DA 4H1HA 3PSAA 5KTTA 3A28A 3E6AA 4X7PA 4TKUA 1VHTA 2WU8A 1C50A 4F60A 1GU0A 5IDQA 1W36D 3UKOA 3ZYZA 4ARUA 5AH0A 4CU5A 1P9NA 1YUBA 1Y8ZA 1GXSB 4KLNA 1T35A 4Y18A 1PZFA 1Z5PA 2ZXEA 3OWOA 4BAGA 5KJ6A 4YCDA 3FXRA 16PKA 2O1EA 3CG0A 1ONNA 4FSDA 5JD4A 4PRZA 5D2CA 1R9JA 4URUR 1GCAA 2YC4C 3TSYA 5KYWB 1K2WA 1YU9A 2AJBA 4V0KA 3T1VA 3C39A 5B7NA 2I5PO 5D6FA 4EB0A 3CDLA 2B8NA 4D3FA 1ZUNA 5IU6A 4BX0A 1A5JA 2JEOA 4PCQA 2MR5A 2YJGA 3JAMZ 4NZ9A 2C04A 2H31A 3HYIA 4ZQHA 3ZIUA 2C8KA 5DT9A 3P20A 3PXCX 5F76A 3PD7A 4QULA 2QE6A 2LKCA 3IMFA 3KZ1E 3KU4A 1QIKA 4L75A 1ZRNA 1QVVA 2QRKA 4E5KA 4MPRA 1N7IA 4PJ0C 4LY3A 5FL7A 3THYB 1EXWA 4ILKA 3SWWA 5CIYA 4P53A 3MWKA 3F3MA 2VI5A 5C3EJ 5FWAA 3ZGVA 1EH7A 2WINI 3AF4A 1SAUA 1B2RA 4OOIA 1FJ2A 4LBVA 2NVUB 1AHHA 1U2PA 4K6KA 1SRQA 1V4BA 4QBFA 3LT1A 3WK6A 2R8ZA 5EVJA 4D79A 4F4JA 1LQ1A 2WFAA 2JZOA 3CINA 4M7WA 1FBTA 4WX2B 3VH3A 2LUOA 4OHZA 4BKQA 4D3ZA 4M9QA 4M3NA 4PN7A 2XMSA 1IN5A 2M7AA 2Y9ZA 4JENA 1ZEJA 1GPMA 2W6NA 4XGIA 5TSDA 3I55I 1ESCA 5BW4A 5A1TA 2C6YA 4LMPA 5KYGA 1CVIA 3QBEA 3MOSA 1DUXC 3GD5A 2M4GA 5CNIA 2GDJA 3IEXA 2IUUA 3UK6A 4D98A 4D4GA 5M5YJ 2Q3BA 4ECEA 1KH3A 2AVDA 3TINA 4XBFA 3CLSC 4TROA 3RU9A 3DTKA 4OXKA 4RK6A 3PU6A 5SZKB 1E7QA 3ZH2A 1FPMA 3MGKA 4RVFA 4GKAA 1HE5A 2QAGA 1XDWA 1TUIA 3J7AO 1OI7A 4XDGA 3DM9B 1JHQA 2EJWA 2DMQA 2I9PA 2RAVA 3V7WA 5FAKA 5BPDA 5BVHA 4HNAA 1SCQA 4DJAA 3KEMA 1KGDA 4HAOA 2O8XA 2LV8A 5CW1A 4IHVA 4A0QA 3FYDA 1HNNA 1T2AA 5EXTA 2YQZA 3TIGA 3OYNA 4Q4CA 2PWBA 3AUAA 3C3DA 4HZUB 2H6BA 1XXHE 1Z0UA 2GCGA 2ZDHA 4HTFA 5EJEA 2H0AA 2DB3A 1A9TA 2JGKA 2YJZA 1XD2B 4ESHA 4I1RA 4B8WA 3DKPA 5JLJA 4H6PA 1RM4A 3ANNA 4I5IA 4LKRA 3G02A 3FPSA 2QVLA 3KUUA 2R66A 3N2EA 3OZRA 5UKDA 5JQGF 2YBEA 3QYFA 1R66A 3C1TA 2M4KA 4I4TA 2D7JA 5C3MA 2FOIA 4QELA 1ZSVA 3K2QA 4MKGA 3E8XA 5JZSA 1B72A 2WC2A 2ZYRA 4J9UE 3TEJA 5M5WJ 1B6RA 1E1NA 1N6NA 1LE8A 4XUGB 2VQLA 4FFPA 2M7BA 1JUMA 3K1NA 3WMFA 3WY9A 2ZBRA 3V1LA 1BKDR 1YW7A 1HQDA 4BFXA 5CR9A 3TLCA 5JSZA 4FILA 4LY6A 4JQFA 4E70A 4WLVA 4KPGA 3EIEA 4N4AA 1VKJA 1NSYA 1U7WA 4QYWA 5BT8A 2PUHA 3I2HA 3ZY4A 4DZPA 4R1TA 3VPSA 3GN1A 1XQ1A 2FU5C 1GZ4A 3SOZA 4QPZA 2R8OA 5ARCA 4MYHA 3W2HA 2AQHA 3PENA 3QMWA 4UNQA 4C7BA 4X1IA 3RT1A 5FTMA 3KVVA 1ESEA 3GCDA 4JBIA 4W99A 2XQJA 2O9JA 3AEKB 2QUBA 4WK0B 1N9ZA 1ZI8A 1RI3A 2OR3A 1EHIA 2R8PA 2Q1XA 3Q8WA 3PG5A 4ZT4A 1N1GA 5LIPA 1Q0QA 1L4FA 2WD9A 1QYXA 2XRNA 3L4KA 3KYDA 4JK1X 1FX0B 1N32B 1V1MA 3W2GA 4BTVA 5C80A 1ORIA 3Q9UA 3ZJ4A 2QX7A 4DM3A 1OXKB 1L5ZA 3KR0A 3OEEA 3JQ8A 2DYRH 3M34A 3K92A 5AVYA 5K5EA 5DTRA 3H8VA 3IQZA 4ZKDA 1G7CA 1QMPA 3TD2A 1T8UA 3Q8LA 1ZONA 2QJOA 3ZCPA 2XSJC 3NGXA 1G6Q1 1XD7A 1R88A 5EOVA 1CDOA 2WU1A 4Z9BA 4O2BF 1XVLA 2EZKA 4C7VA 4RORA 1W34A 2O8EB 1OXVA 4GU5A 1JW9B 3OEED 2GBIA 4FGUA 4QO7A 1EUZA 7YASA 1B6SA 1FFGA 5FUWA 5LMCA 3OZ7A 1KYWA 2OTCA 5T6MA 2FOWA 1T9AA 4QJ5A 2F00A 3W2WA 2ENUA 4O8CA 2OD9A 3HGQA 2HIMA 1WJ5A 2HVRA 4PYQA 2XBLA 1MJ5A 2VJQA 3C15C 4QGHA 3H8JA 1WLYA 3ESRA 4XVHA 4TTJA 3DWIA 4OIMA 2EL7A 5GMOA 3WMGA 3UJCA 3AEUA 4F6CA 3Q7TA 4IGAA 4C0QC 2DULA 4XQ9A 3UPDA 1JMVA 4D0NA 1W7PA 4BP3A 1SVLA 3F8WA 3I9JA 4YASA 3UWSA 1UJMA 1H2EA 3EUEA 4I3HA 4A6XA 5TRTA 3CUWA 4L16A 1M6WA 2ABWA 2W90A 4PY2A 1IHDA 3GTJJ 1QH1A 4UHEA 1RETA 3GEPA 3O4JA 3IDFA 4Z99A 4BXOB 3I45A 3OZEA 4OMZA 5T8KA 3UMCA 1BL0A 3VYRB 3G9XA 1HLDA 1N2ZA 1YKGA 1ZK0A 3A58B 3M0EA 4HZIA 3TZQA 2C0CA 1DO8A 3CPJB 2I3DA 3WKEA 1REQB 3N4MA 4LS3A 4GQAA 3IIJA 2WJPA 2BGRA 4J94A 1AN0A 4AZSA 2DQKA 5BXQC 3I4MJ 2QG6A 1AS0A 3PUJA 4Z4FA 2D1TA 2E1RA 2IAIA 4MUAA 5T8KC 3DZFA 2WJJA 2PJDA 3GRCA 4E94A 3Q0IA 4JUBA 2VKDA 3DEJA 5JLAA 4GX0A 4B9EA 2W48A 4F7DA 3OMWA 4Q9JA 2ZG6A 2Z1DA 2VWHA 1E1LA 4GC5A 1CVLA 2WMNB 2EVWX 3GDGA 3I9MA 3JRFA 4LOAA 3X2FA 2IOFA 4BO7A 2PGJA 2WJ4A 5DUKA 1AOYA 2IHJA 4OHOA 4ZYXA 4KVZA 2L19A 2EBIA 1SPBS 4OI2A 3DBOB 3DUFA 5JD6A 3HDVA 5JISA 4Y9UA 3H1GA 1Y6JA 1BWRA 4MCIA 4QFDA 3C5WP 2HWWA 1E6KA 3Q5DA 2HCFA 1SMKA 1W0TA 4TKMA 5LJIA 1SXPA 3K0AA 1SXJC 4JBAA 4MW1A 2YJ5A 3MGGA 3DE7X 1R5JA 3L1PA 1FFBA 4XGNA 4TGLA 1XKXA 4J1TA 1TVKB 2OJED 3PF8A 2VDUE 4WCDA 1QHGA 1KSFX 3MJHA 2E4XA 4D9EA 2BTOA 2DPYA 3WNDA 5K2OA 1IRGA 4U3JA 3LSGA 4ZDOA 4BVEA 1QIJA 3GUCA 1X19A 2ZRKA 4GP9A 5EYPB 3DOOA 2HJVA 5EJ8A 4IMRA 1FSHA 4JB0A 5LU9A 1DXYA 4JAVC 4HRIA 1UF9A 4LVCA 1B7GO 2C9CA 1V6CA 4IY1A 5DHSA 2V7FA 1GKKA 3INGA 5BWNA 4OQMA 3OLQA 2G9WA 1TQ8A 1UK6A 3IE1A 1UZAA 1ACIA 2JVJA 4NBWA 5FA5A 2IITA 3OM1A 5DYNA 3QIVA 2OBPA 3ZTTA 1C41A 1OLOA 2GH1A 2HRDA 2HY7A 4BEWA 1YFLA 3HM5A 2G7UA 2HTEA 3M4JA 3X1MA 1QIEA 1VMEA 2FZWA 5BSFA 3KQKA 1E8DA 4K9RA 4QXQA 4DG8A 3PNSA 3QVSA 3HU1A 1MGPA 1JG7A 3WA6A 4K9OA 4TYWA 2HWVA 2W6IA 4QDXA 3W8FA 4HF7A 4XGQA 3GLUA 2VI6A 1EMDA 2NTYC 1XPOA 2W6QA 1CFZA 4KYWA 2DP4E 2GXSA 2OSVA 1YQTA 3HDGA 4C4RA 4EUSA 1EH8A 1R5OA 4TMTA 1R8JA 3EZ9A 1VPEA 3CZ4A 3K8OE 4RSMA 1TAGA 3RF7A 3EFHA 1TWFJ 2COUA 2RKWA 4JSTA 1TP4A 2QRVA 3U0VA 1T33A 3IAS6 4IUBS 1FRVA 2E5FA 1RABA 5AVJA 3P9IA 3WL6A 2VDLB 3A3YA 4GW3A 1K83J 2LY9A 1MDMB 4TYNA 1ZRCA 3R6SA 4XWOA 1NULA 2P27A 4FGWA 5DNAA 2UZ3A 1UT8A 1XGMA 4JJ6A 1T8PA 1UMCA 2VPXA 3V8PA 4PGHA 2AXLA 2NO4A 2VH5R 3QWHA 4M89A 4AL4A 2JAXA 4WERA 2TCTA 1Z2CA 4FGSA 2NIPA 1P6UA 2ID7A 1E3HA 4MR9A 4YMTA 5J1RA 5BRNA 1LVAA 3DFGA 3KAPA 3PNKA 3IUOA 4DCJA 4UHCA 1IJWC 1WEKA 3QVKA 3CTMA 3MMSA 1PIWA 4KFSA 2R7WA 1MBKA 3ICCA 1EDOA 4FZ3A 2JN6A 3BL5A 3CX6A 1N4AA 1W9HA 3CA8A 4J29A 4C01A 3UB2A 5BN5A 2LNDA 1NXVA 1JIJA 5IVKA 2H1OA 1QRSA 2WSSD 4L07A 2EAUA 2HK6A 4F2DA 4PC1A 2O19A 4BFUA 2CG4A 1SC6A 3M8FA 5LGTA 4NDLA 1IULA 1OR8A 2NSDA 2Q50A 2W2VA 3JWHA 2FXVA 2OV1A 1QIGA 2JCYA 3PQJA 2G07A 2UV8A 2W00A 5KHOC 3EXIB 4OJKA 2HJSA 2QRLA 1SB8A 3OYDA 3VO1A 1XKLA 3WL7A 3SC6A 3WQRA 5GTIC 5KJCA 3G2OA 4UV8A 3PC2A 4GKJB 3OQBA 4LHSA 3GV0A 3BRCA 1SD1A 3DV9A 3NNSA 2X14A 4RD4A 4WY5A 5K3DA 5B3LA 4EX7A 2X4GA 1YI1A 2DBBA 4NCXA 3QW2A 1VSVA 3BREA 3HWX1 2IS4A 1VBNA 3QSGA 2PGDA 3D59A 2HXGA 3N87A 2DA3A 3ZU4A 1X7XB 1Y6GA 1OWMA 3P9ZA 1DO0A 1IU9A 1KZ7B 3CZMA 3I9FA 5KINB 1A76A 2VTBA 1V9LA 3SBXA 4XEHA 5GZ3A 4ZIRB 4WOKA 2ZQ5A 3D6MA 3LFTA 4KXNA 1EQUA 1G8FA 2Z99A 3BGIA 4R1PA 2OYCA 3SZ3A 3KOOA 1P5FA 1NBWB 3A11A 3SI7A 3ZX5A 2QUJA 3BTOA 2G8NA 1E0AA 1DIOB 4X54A 1XFAA 2IEIA 1SPXA 2Q3HA 3CU5A 4MK4A 1YJQA 1FTWA 3EEBA 3L07A 4O4IA 2PLFA 3VTAA 3U3MA 1NY6A 4DSTA 4V24A 3D2CA 3OIGA 4CTNA 2C3PA 6PAXA 2IYXA 2WF6A 2FP3A 3EDRA 3N53A 4X8MA 1U2QA 1SMYF 1ZELA 1NYRA 1QWSA 2EKPA 3LE8A 3TAHA 2BGIA 4NVRA 3TTUA 3KDPA 4A2UA 2JAWA 5FFNA 3UB4A 5CD1A 3KQUA 3MMYB 3Q3SA 1O7JA 1IAWA 2X9GA 4U87A 3CT6A 5IN5A 1XZFA 2GBGA 1LEHA 1O7FA 3GEHA 4LJZF 1YMQA 3EVTA 5G0UA 5CT5A 1Q17A 1PL8A 3ANLA 3D7NA 4QECA 4BTEA 4D5GA 1JVBA 2GAFA 3L8HA 1U78A 4G0QA 1N5JA 1QRAA 2ZWIA 3BGSA 3G5LA 3GDFA 3SKVA 2JWTA 2VHYA 1OZHA 4R1HA 1WS6A 3K4LA 1TCBA 2WD7B 3GFSA 2QS9A 2NZ2A 3NJ4A 2PCJA 4X1KB 3WRVA 5LVAA 4UBNA 5K45A 3FM9A 5I7HA 1Y8RA 4UXNA 3EC1A 4C4TA 4N9QA 3QYJA 3SPXA 3S8EA 5FBKA 3W6NA 2WYUA 3F22A 2VUSA 3DD1A 5KYUB 2IWHA 3UW3A 2BEWB 4GWGA 1RRKA 5T41A 5CXUA 5GJCA 3WBJA 2BHTA 4BFCA 5DMHA 2EZ9A 3RYCB 2WIJA 3M83A 3FPKA 4QTZA 3MJVA 5EXPA 1YA4A 2EP8A 2FBIA 1H3NA 3DNMA 3EE6A 5HE9A 4ZDWA 1UOPA 2WJHA 4Q9HA 3KJGA 5CG1A 3ZMZA 2A9QA 1ETHA 3QXCA 2E5LB 3DPIA 1N5RA 1ZQ9A 4PR3A 4DJDC 2DO7A 4WWHA 5EE5B 3OPYI 2AJDA 2JVIA 5JG7A 1V3FA 2QQAA 1ORTA 5E9QA 5IFKA 1ZAOA 1XVAA 4UDNA 4C0XA 4AF7A 5JJ5A 2RGBA 2LW7A 3INNA 4GYGA 2YKGA 1T4BA 3AZQA 1HSOA 2P4EA 1A6QA 1R3UA 2PSDA 1BDIA 4RETA 3ZQ4A 5T5QA 2YWEA 3TQOA 1OXXK 2V7XA 1E3QA 3PGA1 1D2NA 3ETHA 2HYIC 1UK9A 2J9RA 5ERGB 1R4MA 2AW3A 3AOEA 3QBDA 2K9MA 4RE5A 4F9FA 4Y15A 5KBYA 4W1SA 5E7IA 1PSZA 2OWEA 3KZIC 3OZSA 5FOXA 1DJOA 1RT9A 2PD3A 3MF4A 2EEPA 3K5IA 3AEZA 1ISSA 4B7XA 3ZZ0A 4IZHA 2WAMA 4QM6A 2QY6A 1M74A 2AMFA 1M8FA 2FOLA 3JAWA 4JT2A 5DVZA 3UB3A 4EHHA 2G82A 1O0CA 2FP4A 2B1JA 1E89A 1JEYA 2F64A 2H7CA 1FW6A 4F4IA 1Z83A 1J49A 2DGDA 1XZAA 2PYZA 4ZXFA 3F5SA 2NNYA 2A3SA 3I4PA 4U6QA 3ZHZA 4DWVA 1A5SB 5IH3A 2FWAA 1TZCA 2XUFA 1I3LA 1YX5A 1TWAJ 4TZKA 3SHWA 5EIWA 1TNTA 1CUZA 1WB6A 3G6EI 1Y7PA 3WXBA 5CA0B 3F90A 3KO8A 3U3KA 3RU7A 3KIOA 4QATA 1YQAA 3PYLA 3VDXA 5JY1A 2Z8YM 1HKTA 2PGIA 3FGPA 4KREA 1QHHB 4LVUA 4LXGA 1YL6A 2WJIA 3VNSA 5BYKA 4FISA 4HX5A 1ZREA 1Z4JA 5D8DA 4AG5A 1JV2B 2EW8A 4C4YA 3UIEA 4EOGA 1N3BA 1JR3E 4ND2A 3VRHA 4D6XA 5HGXA 3ZWWA 4DW8A 3L6DA 1I1HA 4GECA 2R1VB 5B7QA 4Y2HA 1V8PA 3BYZA 3ZXIA 4DPLA 3RC7A 4BZXA 4EB6B 1I5EA 5KTRA 4KN6A 4DN6A 1YZKA 2A68F 4CLXA 3UGJA 2WB4A 2Y66A 1UKBA 3Q7EA 3JARB 4P4GA 2I4TA 1K3TA 3OKAA 2ZQZA 3LNCA 1FFXB 3DCJA 3VPHA 5G53C 4ENTA 1MT3A 2LK2A 1QK3A 3TW7A 1ZINA 1R8XA 5E6RB 3TGLA 2DT7B 1BN7A 1SHZA 3E48A 4M38A 1C7IA 1E0DA 3AJ8A 1YBFA 2OENG 2ZSHA 3O5AA 1VKZA 2A1TR 4LWOA 3VXKA 3FTEA 3WLHA 1MSFC 1NUPA 2BV3A 3E5RA 3TKYA 2NOJB 2EGUA 3O94A 4WCVA 1H5NA 2WMOB 5FUVA 3FKSA 2W7TA 3H2BA 3LOPA 1EINA 3H2YA 3L0OA 3JVEA 5AHRA 1Y6FA 5C81A 3H5TA 3Q3JB 4FNMA 4Q00A 4LPKA 1Z2EA 2MINA 4A23A 4F1WA 7ADHA 1F12A 1MBZA 1XN4A 5HF5A 3V9AA 2CUNA 1Z0FA 4IHYA 2GN1A 1YE9A 1TAHA 2VJBA 1JUPA 3T1QA 1IUFA 1WHTB 1JU4A 2H0RA 4L85A 4UEKA 2JLCA 3HJEA 2JD2A 4RZ2A 2ZRMA 4XB1A 1IRIA 1IO2A 5G0VA 3DW1X 5KREA 3RRNA 2AN3A 3WL4A 2VODA 1G3WA 2AO9A 1Y4SA 2B1RA 4RC9A 1ODIA 3JS5A 4R84A 3WTYC 4WINA 5ALNA 5IKEA 1IWPB 1NOJA 3C6MA 3F72A 3PNBA 4NNJA 3IP5A 2MOKA 3TLBA 1PNOA 3B13B 3FUWA 1E79A 1PFYA 4Y2TA 4DMHA 4UMDA 2GZ2A 3DCNA 4UHHA 1YJNI 1RP7A 4A6DA 1XLTA 1U8RA 1YS1X 2ORIA 2ZBEA 4HQLA 4J16A 1OXTA 1JAZA 3MQFA 2AUMA 1UBEA 5EA2A 3LQFA 1J6UA 4F5YA 2EFJA 1C0WA 4C7OA 3LF2A 2I7TA 4OIRF 1CEEA 4B3SB 1CUVA 2MYSA 1KU0A 4Q7EA 3RKQA 1A0OA 4V38A 4K28A 2FLVA 1FX0A 3LHFA 3VDQA 4YECA 3SF8B 1OT3A 1XVUA 1M1NA 5MGBA 5A05A 3TSZA 2ZYDA 4OYRA 2AN9A 5B1IA 1T6BY 4MLOA 1GARA 3U7QB 3SIPA 4QPNA 5HM8A 1KOFA 2YXDA 3CUUA 5HFJA 4LQDA 1JGGA 2ID3A 1QCCA 5DRTA 3BIFA 2P9ZA 3BKXA 1WSBA 1QP0A 1HETA 2G0NA 4OSPA 3JSOA 4QLCU 3QBTA 4X0EA 5CCDA 1NRJB 1TRKA 4TWJA 2YU3A 1XVVA 3VFDA 3QHQA 2AZDA 3SE0A 3AETB 5AJXA 3MWJA 3DU6A 4E5NA 3CNNA 1ETVA 2P90A 1KP3A 2UYHA 1INLA 5JVDF 5DTIA 3GVAA 3DO6A 1QA6A 1YR2A 1HTBA 1XRJA 4U2KA 4PHHA 2UYGA 5H7XA 3F5QA 5LOVB 1NK3P 3OWTA 3U4MA 1Q0PA 5JXGA 2ETVA 3W6ZA 1O95D 1P0FA 2WADA 2RHOA 4HV6A 1M54A 4N7BA 2CHGA 4ALMA 4BQQA 1DKOA 1ZMOA 1V3UA 2RK4A 2I1QA 3V1NA 1U7DA 1OA0A 4LZJA 2HTJA 1W4RA 4HJXA 1V2HE 5EPUA 3R74A 1NQWA 1NXXA 2ZDQA 3FHLA 1IN7A 3MHPA 2EC5A 4JX6A 2OZVA 5HP4A 3WBBA 5HJ5A 1K9SA 2MGQA 5EIXA 1AQIA 1DX4A 4JROA 4D25A 4HAWA 1KIMA 2C2WA 2OAGA 3ZD9A 1THZA 1OR7A 3TEDA 1PNTA 2G1AA 2XY4A 3R6TA 4HN9A 4RV5A 5DNEA 5FJJA 4EHNA 2X5OA 1TJ3A 1DJPA 4DBLC 3JQFA 4Y13A 1QIFA 1M1YB 1NJGA 1S7EA 3K0BA 3EDYA 3LBAA 1WXQA 3FKQA 3LDUA 4HTAA 3GQBA 1MBFA 1O5OA 4LQCA 2QN1A 5DJ5A 3WE3A 2K7FA 1GZSA 1CDDA 3QY0A 4U5XA 1MZBA 4TXHA 4HNTA 1RAGA 1XC7A 8AT1A 4Q4DA 4F3RA 1YOVB 4H18A 3RBXA 1FBNA 2OCPA 4GXTA 5A2GA 3CT4A 2RKBA 2WU3A 5JCOC 1G8YA 2BGJA 1UMBB 2IE8A 5ALJA 1QRRA 2ZMEC 1BA3A 2QI9F 2PGXA 3UPUA 5CEFA 4F2GA 2OM6A 2HLDA 5B30A 5K7HA 3HH8A 1H0SA 1CY4A 4CMGA 1H6AA 1XZPA 1NH3A 4EG3A 4MW4A 2JC3A 4YV0A 2O61A 4YAIA 3M3PA 2H5LA 2FEOA 1J2XA 3B1FA 3QVUA 1X94A 3LSRA 2B78A 4N5LA 3TZEA 3UMFA 2P11A 3FRHA 621PA 3ZOZA 2V9ZA 3OE5A 4TUYB 3W6KB 1G6KA 4R69A 1E5TA 4GZMA 2P3SA 2D59A 3ZPLA 2B4QA 1V4NA 5D7NA 1BQEA 4IFBA 4H7DA 4NYMR 2OHHA 4DANA 2OB1A 1DAPA 3IERA 2X1MA 3QENA 3RE1A 5BMVF 2YMLA 3QF4A 1Y6RA 1NLFA 1C30B 5HJEA 3L8YA 4KYIB 5JOQA 4B09A 5IP7J 2PQ0A 3JRNA 4B6EA 3AF6A 3T4EA 2EG5A 1ZS9A 1VJGA 3I2IA 4FQGA 5LLTA 2O6LA 1V47A 2A61A 3WHLA 4D41A 1VECA 1YBHA 1T2UA 1CEYA 2IYUA 4XA8A 3N2GA 3A2KA 4GI3A 5LDDC 3RW9A 2A5DA 4MVJD 3WYBA 3GCMA 1DJLA 2CDAA 1E63A 3G2QA 4GI7A 3T5MA 2EJVA 1EKXA 3ESCA 4FX2A 4M22A 1R0SA 3U61B 2RNGA 4D3XA 1XTRA 4ZDJA 4ZYVA 1MPXA 2RGAA 2Q2EB 1H2ZA 3ZDZB 5JYCA 4L0YB 3G1LA 2OCGA 4BGEA 4FQ8A 2IYQA 5DASA 3T4PA 5LZ8A 3N8DA 4L0QA 3BROA 2WWYA 1RKBA 3WLIA 4L78A 1YTYA 4E4YA 1CYDA 1PV2A 1Y4AE 3U7GA 4CQNA 3QK7A 3U48A 1NW8A 4EUKA 2GM4A 5LRRA 1E17A 1BG6A 2ZBUA 4QFMA 4YC7A 2IYVA 2FG6C 5SY9A 2ME0A 2RHHA 2NZYA 1MJGA 3P5BA 2M0MA 1BH6A 2HOQA 3STTA 4BB0A 5K8CA 5EJ7A 4I09A 1QJCA 3PSIA 1LBHA 1NPYA 1YVRA 4IX9A 4YCAA 4IBOA 1UFRA 4W82A 3AEYA 3M2PA 1G64A 1N5DA 1WZNA 2PX9A 2QN9A 4YWJA 3RROA 3WYFA 1MDMA 2O8CA 1APBA 2B4TO 1DKPA 1I7PA 1NYLA 2IQIA 4KQWA 4WXEA 5HDQA 1P2DA 1YHQI 3OEHD 4MYRA 1M0SA 4ZC8A 1D5WA 1DWUA 4FFBA 3ZIAA 1R4AA 2RI6A 1DAMA 3O26A 3QEJA 3TCKA 1SKMA 4ON9A 1I36A 3LQYA 3DLLF 2ECFA 2I7DA 4N1AA 1N8KA 2OQ2A 2I2WA 4OXXA 3CF4G 4H7JA 2FSVA 4RHTA 5AVOA 2IBTA 1TLFA 2RB4A 2VAPA 1PP8F 1XN1A 2LPMA 4FBLA 5HUHA 3AQ4A 4I2NA 4Z7JA 2PQ8A 1IIBA 1SKBA 4C04A 5DHQA 3H6HA 3WJAA 1IUYA 1GNSA 4IQ4A 2OCXA 1WHUA 3BJMA 4Z9YA 4CKCA 1LPAB 5CB0A 5CB4F 2VYND 4TUYA 4D0GA 2O0JA 3I5MA 4FE4A 3BTCA 3H2JA 4D80A 4JC0A 3GRRA 4MR8A 5DYIA 1JTXA 4ZZ1A 4EHIA 3KB6A 5KIAA 1H1DA 3NPAA 4X91A 1CRWG 2BHYA 2MHCA 2FEXA 4UBLA 1HURA 4OY3A 2COKA 5LD2C 1ZYUA 1OPCA 1E20A 5AQEA 2P0YA 2JCSA 1Q19A 1UDBA 3HY3A 4UVGA 4AB1A 1S2NA 4OBEA 4LDQA 3GLXA 4RESA 4Y6QA 5K6AC 1LFUP 4AYTA 1W19A 1Q74A 1FIPA 4JH0A 4MMYB 1FMCA 4PHTA 4BNMA 3ZQLA 1ELOA 2DUWA 2IVFA 1CD5A 2VBYA 1JNXX 1TA9A 3L4BC 4S2UA 5FRDA 5SYNA 4AMVA 3T34A 3EUHC 4BVLA 2ELKA 4AMGA 2DA7A 1KZ4A 1UPUA 1A6IA 1HQCA 1EEXB 5KJFA 5IT9Z 2OCKA 2VBFA 3EG5A 4I4LA 3WWYA 4OFXA 1U6GA 2ZUDA 1NG1A 3F8FA 3OOSA 4P58A 5A3VA 3AJRA 4WE3A 5CCBA 1QTQA 1ZD9A 4K9QA 4WV3A 2K4JA 4ZVQA 3OQHA 3B1WA 3WKAA 3IEMA 3MKZA 1BW9B 2W2LD 2XKAA 4YI5A 2VDNB 1CQIB 5ICSA 1FZPB 2VQ6A 5LC1A 3S5JA 1BX0A 2HZBA 1Z3YA 3AIIA 2JFBA 5K4GA 1BEZA 4WZBA 3FK7A 1BE8A 3O8QA 2Y0DA 3W2FA 1RQLA 2P9EA 1P0IA 1U8BA 1Y1QA 3EQ6A 4FX5A 4JL8A 2OSBA 3GP5A 3KZNA 4R0VA 5DHFA 1U90A 2I7VA 3O2QB 3UA4A 4AK9A 5BMOA 1VYVA 3VISA 2B94A 2O2EA 4YAOA 5CT9A 3T1NA 2XNKA 5C2JB 1AMUA 2BI7A 1Y3IA 1AHNA 2ZYTX 1MW9X 1UK7A 1W29A 1JP7A 3PNLA 3WMRA 2D13A 4D97A 4ZJZA 3GFIA 2X40A 4YGXB 2XGGA 1QGYA 3RYPA 2QG9A 3HUGB 2JFYA 3DFMA 4PLHA 4HMOA 5B6IA 2E1NA 1ODKA 3CN9A 3C70A 4X97A 3FHJA 4ABYA 4BHCA 4I99C 1CNFA 2Z2IA 2UUOA 4RV9A 2JI9A 4ND6A 3DOCA 2H2DA 2AA3A 4KVGA 3RC1A 1RRCA 2I1VB 1MQAA 2QLFA 5F5LA 2C99A 3V7FA 1EDEA 4BJ6A 3EZYA 4S3MA 2OOSA 1SOVA 1OFVA 3TBIA 3MMZA 1G3SA 5D84A 4CCYA 3ZDBA 1YB7A 3C1OA 4KN9S 1E9VA 5KU7A 1V3VA 3HCRA 4BNVA 1I7SB 2Q7DA 3AVVA 3E9DA 2PL1A 2IX9A 3I9V2 4LE2A 5F6FA 3ZCXA 1OCEA 1CW2B 3CDIA 1T10A 3KD3A 5H8WA 1U80A 2ZUWA 2F9FA 3EULA 2GZWA 2BEJA 3OECA 3PA6A 4OMUA 4UHDA 2TSYB 3OL3A 1T3GA 3F8BA 1IAVA 1ZA2A 2FN9A 2YHAA 2HLHA 4RQUA 3HCWA 4UCQA 2I71A 2REQB 2DFDA 3DPTA 2E2JJ 3GTOJ 2Y6VA 1NVWQ 2PMUA 2L2QA 1QPZA 3O74A 2QTAA 3PI7A 1QX3A 4TQGA 4H6WA 1PUFB 1QVTA 5T6BA 2E89A 5BSTA 3A3NA 4QBTA 5I7VA 1U6JA 2B8TA 5F5XA 1PZHA 2Q9AA 5IARA 3K6RA 4B3HA 1NW3A 3B9QA 1QPGA 3SIRA 1UC4B 4WZAA 4TWRA 3CSUA 3IPAA 2Q8PA 2PMWB 3B6KA 1L4LA 2EFWA 4NBTA 1MMSA 1FZQA 5KOYA 4PF1A 1BCSB 1OQAA 3OHMA 3PQDA 4AKGA 2CXRA 3PKIA 4G2NA 1G1AA 5P8WA 4LIPD 1WOMA 5H68A 4N03A 2IDJA 5CEEA 4WL0A 2DYSH 2BOVA 2PYDA 4IGKA 1M1EB 3U4GA 4BV9A 3H5LA 1IM2A 2IZ7A 2GEBA 1CB0A 1MOSA 4NHJA 1HDPA 3VSKA 1DFIA 2NPIA 3BXXA 3OPNA 2EWVA 3K10A 4B4OA 4DIKA 1UDRA 1KO7A 1JXOA 1K7CA 4NCHA 1U9IC 3IJRA 1FB5A 5EE9A 2H94A 1I4OA 3VPAA 4YUXA 5BW5A 3VSCA 2NVYJ 2GAAA 3RRJA 2EBFX 1R6VA 3NDIA 4DR2B 3CZRA 2YMMA 2BY4A 2OFFA 1E98A 4ENJA 1DCKA 1WDKA 2E6UX 3CO0S 5K8TA 2L3DA 4A0RA 3C97A 5IAAA 3TRJA 1OH8A 3KVOA 4OSOA 4QYIA 4F0JA 1KEVA 1U8FO 2Y75A 3OY7A 3SDSA 4L9TA 3H2GA 1JBQA 1IJEA 2JD1A 2YYYA 3AHGA 3GJXC 3WMXA 3ND6A 1FTZA 1NE2A 1RRJA 2PLAA 3X2SA 1H9CA 3BSFA 4F5ZA 1WZIA 1LNQA 2ZITA 2YPRA 3KLPX 4Y98A 1JBEA 1LS1A 1XHFA 3GUUA 2YVAA 4KSBA 3RV4A 1TT5B 3OU2A 4CQJA 4HV4A 1COWD 5KYVA 3V55A 5MFZA 1LBEA 3F9IA 2FAXA 2JCGA 2LXNA 3ETGA 2ZMEB 4KUHA 4V0ME 4YV7A 3WHCA 1JA9A 4PV7A 3SM3A 1T1GA 4IS3A 5FI3A 3CJTB 2KFDA 2LVSA 3FZYA 3GFQA 4JIMA 1QRTA 2Y31A 2YXLA 1W9MA 4U02A 2EFQA 4IDPA 4QHYA 5C53B 2E60A 2YZ2A 4GL4A 2P75A 2JLXA 3GEZA 4EUFA 4OEHA 4FU0A 5JQGB 2XXAB 2C0QA 2PUAA 2YIJA 4G37A 2YUIA 3H84A 1SWVA 2FA5A 1J2TA 1I30A 1CJVC 1XD2A 1D2AA 2GZDA 1XIVA 1QQ7A 2ZROA 2D6FA 3I54A 1PR6A 2B1QA 4HTFB 4DA0A 2FPWA 1DBPA 4PIVA 3IC7A 2IYLD 4UUBA 1J0RA 1JWAB 3GPCA 4QNNA 3TTWA 4ALIA 3ZHVA 3J81Z 4L0DA 1EHYA 1SOAA 1ULBA 2FJUA 3C24A 3D3WA 4OHXA 4Q5IA 3R7SA 3DHEA 1UKCA 3I1FA 3AC0A 4BFTA 3OX3A 1ETYA 1KYQA 1X7WB 4JU9A 4X1OA 4OIPF 4OSEA 3AB8A 4OMCA 1D09A 1FDIA 2ILTA 1XDBA 4J7AA 5JAPA 4US1R 3B1JA 4OK6A 4RDHA 3BCBA 2AXNA 2EARA 4DYQA 5BOXA 1Z0JA 1WAMA 3ITKA 4V1CA 4UM7A 5BWOA 4RF2A 5DNUA 2IX3A 1ADFA 4EO7A 4I4IA 4EZEA 1TO6A 1KAMA 3LDAA 1HSJA 4C87A 4C3HJ 1XPUA 5TJHA 2K40A 3TL3A 3PA8A 3MN1A 1L7PA 2R7KA 2P9TA 3IA2A 4L57A 4AUMA 1PJRA 4KFTA 1PT6A 2ORYA 2Q5LA 4N18A 3VHXB 1Z9CA 3OG9A 3I30X 4ABTA 5TQ2A 2HKIA 3PYXA 2IHTA 2JFXA 3DJYA 3FG9A 1GZDA 2ZJ2A 2DPXA 3OD1A 4WUVA 5IVPA 2O2JA 4I9FA 2IEYA 2XB8A 1JKRC 1DHRA 2PAAA 3G2PA 4U8GA 2Z9DA 4AZ0B 4HW0A 2VBGA 4ZCMA 2P7HA 2Z04A 3N74A 2DFFA 1J06A 2L7MP 4HX4A 1DTWB 1R0ZA 1ZD4A 2GARA 1UZNA 2X6TA 2X5NA 3DE3X 3JZFA 3MT7A 1M2GA 2FMUA 3OETA 2PMEA 1P5RA 3FHNA 2IT0A 5IJWA 4ZMBA 3KQLA 3F6SA 2PZKA 5IK2D 1SVMA 4QDTA 3CLQA 4QXRA 3T5DA 4CR8A 3I4FA 1G4AE 4LK2A 2A5GA 4UARA 3K9FC 1Z74A 4CCOA 3GMTA 1D0IA 1QPBA 3U2RA 1FVXA 1Q0UA 5CDFA 3MBIA 2ZUUA 1X9IA 3R3UA 3IMCA 2ZW9A 3EVDA 4HH4A 3DE1X 4W7IA 2FA9A 2DQYA 3FOWA 3IPYA 4IHWA 1KMCA 2OO7A 3DG9A 4G4IA 4OP1A 3RVBA 3SC2B 2X0NA 3KZKA 5FD8A 2A88A 2YYSA 4NJEB 4ZVPA 2WA0A 3EGWA 2FNAA 4HDSA 1EK1A 4JMPA 3BIJA 4KUEA 4WXMA 4XLLA 2XCQA 3NV7A 1ZGJA 1JA1A 3O1IC 6ADHA 3EN0A 5ALHA 4KAJA 5KYNA 3AXTA 4K9KA 1AGXA 4TLBA 1GEGA 1ZI6A 4OBBA 4LECA 5DNCA 5E20A 1L5OA 1PD1A 1XTVA 1FC3A 1IJBA 2OZ6A 3AHJA 2LBFA 1YASA 3KTDA 3V5NA 3UTCA 5GONB 1YBMA 3BTIA 1R27A 4EHAA 1JI0A 3COVA 1GTZA 1B15A 4MVJP 1EBUA 1O89A 4EY6A 5AM4A 3U4HA 2YCLA 5IJ9A 4I6GA 1RC1A 5K7ZA 2R1VA 5KCZA 1X7ZB 4B48A 3GBPA 3MWDB 1OHHD 2BKXA 1ZITA 4Y7NJ 3SSOA 3W4KA 1BYUA 5LQDA 1IXZA 4WECA 2ALJA 2R60A 4XWTA 5LUAA 3T7CA 1JQ3A 1D0ZA 1ZGAA 1OW3B 5KYYB 1H89C 2ZK7A 2GM5A 1EBFA 4IMIB 3ASYA 4TN1A 1MENA 2IPQX 5DP1A 4YFXF 4KVFA 1MG0A 3GLIE 4R5HA 4E7KA 4JBYA 3T9AA 2FPGA 3GRFA 1DQNA 3FWKA 3SAJA 3NWSA 4BDZA 1QOPB 1WD5A 1PD0A 3U4QB 1AUPA 4G89A 2O8BA 4GDFA 1YZYA 1P74A 4UY8I 2JKZA 4KXWA 3UJ9A 4D4LA 4EG5A 3R0VA 1HZJA 2F62A 1WI9A 3TZLA 4EG8A 2VASA 5GOZA 1UL1X 3F6CA 3OZXA 3EDCA 4X45A 2J67A 4D8VA 1OZAA 2EGGA 3ZVMA 4HDNB 2YN4A 4ZDLA 4YCJA 5CB4B 5I5GA 3AERB 5FHQA 1EZZA 2SHKA 1N6LA 4Z4EA 4P1WA 1J5YA 3VI4B 4JI6B 1MTOA 5JBIA 4L5EA 3LRPA 2QYSA 4CYDA 3PRKE 3P45A 2OFWA 3QHAA 1GA4A 2DFNA 2Z3WA 4RAGA 1EFPB 1K8ZB 1Z13A 3HCDA 3HSYA 4NARA 4CV3A 3T1TA 3QJ5A 1FLAA 5LKAA 5FGMA 2N0SA 3JRAA 1Z4PX 2NV6A 4M0MA 4DZJA 4PQRA 2PG3A 3I3OA 4WLOA 3EZLA 4FQ7A 4Q7JB 1RMTA 1C3XA 2PMFA 1Q1GA 2IHVA 3Q8XB 4QTUB 4M6WA 3DEEA 4OCZA 4WXRA 2Q3EA 3P52A 2QAJA 3AR9A 4OINF 4K05A 5I8ZA 3SHQA 5GZ1A 1J9IA 2CNDA 1O4VA 1PT9A 3QPBA 3KZOA 2IU4A 4D4HA 4QKQA 1B42A 3GLGB 3FTFA 2WF9A 4L74A 4WESA 4R9SA 2NSJA 4D9JA 5A02A 5K5RA 2VTDA 3R3VA 4CZ2A 4PPGA 4C0LA 3FDZA 1RUOA 2XHEA 2FETA 5JYDA 3MM4A 4HX9A 2GBLC 4KDRA 3DOIA 5JSHA 4ZCSA 1D2RA 1J20A 1G5QA 5F52A 1SKAA 1YK1A 4FK8A 1GUZA 3AL0C 3HKZN 3H6GA 1VPDA 4RKEA 1GR0A 3EWIA 4TXNA 5ES3A 2J4FA 4EITA 2XAHA 4IDGA 4PYMA 3CF2A 4LYDA 5E3HA 5KNDH 3PRJA 5FOUA 5G3ZA 2R7MA 3L04A 4XLZA 3EGCA 1QGED 4LNUB 3M5DA 4N7JA 3T7SA 5AVSA 2FP4B 5BXYA 1JEAA 3OIFA 3UAZA 5KOJB 2ADOA 4PBTA 4X66B 3DAGA 4HDOB 4UMEA 4WZAB 5YASA 1XQVA 3KSMA 3U37A 3WBKA 3LVQE 4HGRA 4TTPA 3ZHRA 1VL5A 1DJMA 1OH5A 2OWDA 3L7BA 1EUYA 2FHPA 5IN4A 3NKLA 3Q9LA 1ZCZA 5ERYA 5FPSA 2M6LA 3J7ZI 2P41A 1B4DA 2IY9A 2WKQA 3NW9A 2X6WA 1CR6A 2G88A 2A1IA 2AT1A 2XUKA 2TDXA 1QE5A 3CFYA 3FETA 2IOHA 2KSQA 4N9IA 3ILHA 3MS7A 1P2VA 3O8DA 3O8LA 4QJ4A 1TZ2A 4MSUA 2W85A 1MEOA 4JVMA 3B6MA 2J5PA 1ODCA 3GJ5A 4PYIA 3PEUA 1Y3DE 4YEDA 4YQYA 3QVMA 3TZHA 1KQGA 4H0EA 4DCPA 5IOZA 3QOEA 1OWPA 3UVEA 2PN6A 1TC3C 3OR2C 1Z07A 4R40A 5JMWA 3OM9A 2JGRA 4EPXA 4XICA 1TKCA 4EHBA 3ZXUB 5JNVA 2XRZA 4U7DA 2Y1KA 1E7YA 1EE9A 1W8IA 2Q1WA 3BD8A 1AWCA 4WNIA 4A93J 4IQ8A 5FOQA 3SKXA 1GSIA 2I8DA 3L7OA 1IIRA 3MCAA 4JYCA 2FUG6 1TL8A 2AK3A 5JAMA 3OX2A 1JQBA 3P4XA 1KAOA 4JVOA 2NP7A 2PMKA 2D1FA 2FVYA 1P72A 4HSTA 2VC1A 3OEYA 5F1KA 5JAIA 5DI3A 1JKIA 1LZLA 1VMKA 1T34A 2O20A 2ZGVA 4QPJC 3EZ7A 4RANA 5TPZA 2AMVA 2QW0X 4U7FA 2B2CA 1RSZA 3CD6I 2XYGA 3LLVA 1BH2A 4C22A 4HMQA 2XH8A 1A8IA 1AUXA 2YRWA 2P6TA 3FKIJ 4JCOA 2Q8KA 2YWJA 2M0CA 2BEVA 4E7SA 2VDMB 2VZ9A 4GX1A 4OGWA 1A82A 5GV8A 1TYBE 2AXPA 2QM0A 1P92A 4ZYUA 5KTSA 1RC0A 3K35A 3Q72A 1KIFA 3B9PA 4H6VA 4D9HA 3EGXB 5IHPA 2B36A 4C2TA 2AG5A 2G72A 2RAFA 2WHXA 1KR2A 2NZVG 1I2CA 3QQ5A 1M2EA 2OCEA 1NVEA 4MCJA 4Q3DA 3CKYA 5HA5A 3TAUA 1EFLA 5JNTA 4JLJA 5LMZA 2ANCA 4R01A 1QRDA 3N1UA 1JJBA 3SS7X 4LYAA 3I8OA 4DIFA 4ENRA 3WICA 4AIJA 2P65A 3BC8A 2NRAC 3O3MB 4UBJA 3G2IA 5AJYA 1OY1A 4YK7A 4G85A 5DGXA 3NTUA 3NATA 3PFYA 2OZLB 2L02A 5D7BA 3ZG6A 4RS4A 4N0EA 1WMAA 3UJ6A 3HRMA 1YQDA 4I9NA 4CPDA 4ZMRA 1Y4DE 2VNSA 1O3YA 4EJVA 4G81A 1Q92A 3Q6NA 1KIAA 4IWYA 4J4BA 1X3UA 2VKTA 4WNYA 1DIGA 4CQLA 3EWSA 1OFHA 2KLBA 3GFLA 1SVUA 2QMEA 3UAVA 3EETA 1N2CB 5EGOB 1GPH1 1L4NA 1RLTA 1K78B 2DTDA 2CF5A 2LFBA 2E0IA 2WI8A 1ZIXA 3S70A 4BCBA 4CUZA 1L5QA 1SU6A 1KC3A 4O2AA 2HSWA 3T3MB 4EYEA 4QAJA 4ENWA 1M5RA 1PGOA 2X77A 2HCBA 1NP6A 2P6UA 3LNQA 1PTKA 5JMOA 1JL3A 3OTQA 3B6IA 1GTVA 1K27A 1XU9A 4AX4A 1MVLA 4CKEA 1NL3A 3NR2A 1EJBA 5DDIP 4HSRA 4C3JJ 1HEUA 1XRLA 2H6EA 2ZJZA 4UOEA 4E5MA 3RU3A 4QRIA 4DJTA 4EA9A 1WI3A 1CZHA 1FOXA 2C5GA 4NJMA 1XRQA 2OG1A 1GNVA 1A1VA 1H6CA 2Z5LA 2LDUA 5SICE 4FDMA 1E2NA 1P75A 4HAZA 1XMKA 4XX0A 3ECHA 2JFQA 3PGKA 4CM7A 1RJWA 3K15A 4KMFA 1UKVY 3UWMA 4MO2A 3TXYA 4QNMA 3VHQA 1YS7A 2O6HA 4KO1S 3AW9A 4R7ZA 3LXUX 4TTTS 4QFBA 1PWEA 1ZJZA 2RJOA 2Y9PB 3JCZA 2RN7A 1F5TA 1RTTA 4KVAA 1E2LA 1LDYA 2YWDA 5DCFA 1LSOA 3GT7A 4FM9A 3MCWA 4HT3B 4IMPA 1SHLA 4W5JA 1DRWA 2FPGB 5TS3A 4BZQA 4C43A 4D42A 4KRXA 4YV2A 2PUBA 4MTDA 3MFYA 1BJKA 1O0SA 3TQHA 3N8IA 3EXAA 5H81A 4TXMA 2X1CA 3SDGA 1T5SA 1MOPA 1WQ3A 2OV6A 4P96A 4OUDA 1OTXA 2SBTA 2K3FA 4W97A 1IC8A 2NQTA 2WT4A 3LPNA 3VKWA 3M8KA 4I1OA 3VZSA 3W5HA 2AWOA 4HEJA 4G23A 4HP8A 3FBNB 4I81A 2BF4A 4NAUA 4Q24A 4YRQA 1MJNA 1QTNA 2XVYA 1UQTA 4DYDA 3IP8A 4B6OA 2WJWA 2R7NA 3R0XA 4RMGA 2PUCA 4DA6A 4IF4A 3ZP5A 1YA8A 4HH0A 1BXRA 4MTCA 3B60A 5BV8A 1CHDA 2O8KA 2V3VA 3SC4A 4YRKA 4BUPA 2F5CA 2F1KA 2IC5A 2OO5A 1EZ4A 2XRFA 3GEBA 1QBKC 4QOGA 4M9SA 2D06A 3ZWBA 2PZLA 1LPSA 2AI2A 2TECE 5ALFA 1XA0A 4Q19A 2DPGA 4PONA 4WY2A 1B8IB 1KONA 4XDYA 2HMWA 2HPIA 4BBSJ 3DQZA 3M3DA 1VG0B 3T35A 3L93A 2VLIA 5TQVA 3QAHA 1KZYC 1ACMA 1F2UB 5I9NA 1QIMA 2PO7A 5F3DA 3ONFA 4EJ6A 3BFJA 4F71A 3T52A 2WHEA 2GA2A 1LVUA 1C1DA 5KNCD 1BEEA 1XGKA 3EY4A 3OJLA 2ADMA 1VQLI 1K75A 1BA2A 3BMXA 3EGOA 4MRRA 1YRHA 2ID6A 2IYPA 2BGNA 1TUBA 3V8QA 2G70A 2O57A 3PFKA 3F74A 3CESA 2YNMC 2LREA 1A7KA 1AA9A 3ZZTA 4HDVA 2NTVA 4RSGA 2W6JA 1J0XO 3BTVA 1QH9A 1XMXA 4I8XA 1PSDA 2ORWA 1E77A 2RGGA 5HCNA 4LGVA 2G08A 5HPYB 5JDCA 4KRFA 2O5CA 2YS9A 1G8PA 1SQGA 3KAQA 3P94A 5A5DA 4ZAGA 3IQEA 3HZJA 4HVTA 4PBSA 4RL6A 4BBRJ 4TM8A 1ZA1A 5L95A 3TG8A 3VQTA 3N8NA 1R49A 4EKIA 5J4YA 1H22A 1IUNA 2ZZMA 5H3CA 3S1RJ 3V1UA 4LV6A 1SHTX 4QUAA 2FRHA 1M10A 3F3YA 3O0TA 3N8HA 3GLFB 2NZWA 3VU8A 1TLLA 2B5VA 2ZTMA 1GR1A 1U1GA 4XTCS 3D4LA 5A9SA 5EIHA 2AZXA 1BMDA 1I6MA 1VYHA 4IQJA 1ENOA 2DOKA 2DHEA 3HSKA 1X3WB 3HU3A 3OAAD 2FWJA 3C8DA 3HABA 4BQFA 4ZI7B 3GAAA 5LR6A 5REQB 3SYNA 3N6XA 4IJVA 1CNMA 1PGQA 4I1YA 1FDRA 1NXQA 1X1RA 2ISSD 3CB2A 1FP2A 1IXKA 3CG4A 3L2QA 4KLAA 1KQNA 1G4HA 3VDNB 2PHZA 4N0QA 1MV8A 2WK1A 3FCAA 3DZKA 1E2EA 3FNHA 2OQVA 4RJTA 1RQRA 1JE8A 2P4SA 5EIEA 1BFKA 1JG3A 1V5EA 3FXQA 1QLHA 1MQSA 5LKRA 3EQ8A 1VQKI 4FDVA 1MGTA 5HDKA 2KHMA 5B1AH 4TVKA 1IQRA 2VSOA 1KAGA 2XQFA 4ENQA 1U1IA 4W5QA 1W1WA 1AJEA 5IY5H 5KCMA 1EQ2A 3RUAA 1UPTA 4ZYEA 3F8TA 4J49A 3ABTA 3E9CA 3O2JA 1DGQA 4DNPA 4EA6A 3DC7A 3L8CA 2O50A 5IF3A 5JASA 3H16A 1VGQA 5GGYA 5D5UB 2QLZA 1VIVA 1SFKA 4LXYA 2X6OA 1Q3TA 3P2OA 4O4JB 4XB2A 4JVLA 5CYOA 4PLPA 1CZUA 4F1KA 2E35A 2Q3FA 3IYLW 1Y9DA 3AEKA 2DLNA 2CVOA 2H1WA 3BERA 3AT1A 3OKPA 2WJ6A 3DXZA 2VJOA 4FEYA 3ES9A 4DNOA 5A3QA 4OHFA 2GKSA 3D6UA 5EN4A 1K6OA 1CQJA 1ZTRA 3CCUI 3KL2A 3Q3EA 3QVGA 4JFAA 3M7GA 4LB6B 3RKUA 1G5HA 3BCSA 3KHKA 1G17A 4OYLA 1C1XB 1NDQA 4AMYA 2HK7A 4M7PA 2GERA 3D43A 2NNNA 1SCDA <