4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
1YF3A 2GLUA 3UJDA 3BJ6A 1RJEA 3AXTA 3OFJA 4O5VA 3J80Z 1AV6A 2R7DA 5FGMA 2AS0A 3MERA 3TRKA 3W6JB 5HIJA 5C9ZA 5K0LA 2L02A 1L0OC 1Y0UA 2NXCA 2PT9A 2G72A 3BUSA 2L3DA 5BPIA 3MHTA 1PUEE 3P9KA 4BH9A 1L3CA 2MBFA 2IVMA 3HOSA 2I6GA 5HS7A 3NRVA 5K0GA 5K5RA 3ER9A 2EFJA 2ZO4A 5BS6A 1U6GA 2YQZA 1W7PD 4MTEA 4GQBA 5D5WB 4PONA 2EV6A 3MAJA 2EJTA 3E05A 1R22A 4QLCU 1I4WA 1O9HA 3RDIA 4C04A 2NS0A 3ZMDA 5AIQA 5KYGA 4HF1A 5E9WA 2ISZA 2ZW9A 3F8CA 4YFKF 5E2AA 3P2KA 1T39A 3ME5A 3PTAA 3J81K 3F6OA 5DD4A 1KA8A 3GDHA 5J8CA 3OPNA 3V8VA 2HYFA 5D1NA 2ZFWA 1UIRA 2P7CB 3DQVC 3FYDA 2FSWA 2QWWA 1L3BA 3RTRA 2FBIA 2F5EA 3HRTA 4RAYA 3RODA 5DX8A 2ZZNA 2IH5A 4PINA 2BM8A 3OE4A 1P39A 3CUQC 2O0YA 2ORED 3M6WA 1NE2A 2PXAA 1Z3CA 1ZH5A 5LQAA 2AOVA 3HUGA 4R05A 5CVEA 4F86A 3IYLW 1XCLA 1ZQ9A 4P96A 4ZTBA 2DLLA 2PMHA 5LEJA 2LD4A 5HOOA 3GIWA 4KDRA 5LBQA 2O3FA 1T0FA 1G3SA 2BH2A 5CCXA 3VSEA 2GIVA 3EVFA 2DAOA 3MZHA 4BQAA 2COMA 2QYOA 2CO5A 3SVZA 2ZNZA 2QZ8A 4OA5A 4NECA 4EM0B 2GA1A 4OBXA 5DX0A 3IEIA 1RI1A 1X1CA 3GRVA 3E5UA 5DSXA 5HZMA 4L9JA 3LBYA 1SFXA 3KR9A 5FFZA 4OIQF 5CYVA 1VPTA 4OQDA 1STZA 3EYIA 1JQEA 3TFWA 3RYRA 3WTTC 1DUSA 2RGVA 4HYEA 2FXAA 3ELKA 3VOEA 4E30A 2QQ9A 4QTUB 4KRGA 1U78A 2HV9A 2NYXA 3BKXA 1YYVA 5HILA 4I0AA 1WG8A 4X61A 4KFCA 1O3TA 3TMAA 3LDGA 3SSNA 1DPUA 4FGZA 3DXYA 2KRFA 1NBHA 1AQIA 3T0IA 3FTEA 4M37A 1B9MA 1P4XA 5D5VB 3TPZA 3V7RA 1YFHA 3R4KA 1O3RA 5EMJA 5JUWA 1BC8C 3Q5FA 2XAJA 5E20A 3QP6A 3GZ6A 3PFIA 1P4AA 1I27A 4MNUA 1ZLJA 5CCBA 2UXXA 4C07A 5JR3A 5E1MA 2P6TA 2BYVE 4G56A 1IF1A 3MCTA 3HM2A 5JI6A 3C3WA 5A2QK 1JHFA 2A5YB 3RKXA 4HQEA 3LPMA 3NVKI 1LB2A 3BWCA 3NJRA 5DXAA 3ABUA 4LLGF 2IDKA 4ETSA 2QRVB 2NNNA 2JH9A 2AN5A 2PSSA 4B8XA 4CZZA 3LAJA 2W25A 1MJBA 4X63A 4O29A 1SFUA 3GF2A 2HEOA 5E9QA 2R7FA 3MTIA 3ELUA 2UXNA 2OBFA 1L3LA 4OOIA 3CGGA 2DK5A 1YZHA 3HA3A 2G1PA 2E1NA 1GVJA 4IWNA 4F7ZA 2G70A 4U7TB 5BQTA 1SMTA 5LHIA 2AOTA 4EJTA 2ZBKA 1RI4A 1FZPB 1TNSA 1O3QA 2QQAA 2ETHA 2R3SA 1WWXA 4PYMA 4DCGA 4DQ2A 3IWZA 4RVFA 4PYOA 1YS6A 3WTWC 2W84A 1ZRDA 2K7LA 2Z33A 1X3UA 4M6YA 3U81A 1ZG3A 2YXEA 2NYUA 1R00A 1OKRA 1YFJA 2MC3A 4IRGA 1BI1A 3WG9A 1FT9A 3UJCA 3R6TA 3Q87B 3KZYA 2RN7A 4QQKA 4EK9A 1RI2A 4LK0F 2D1VA 5C0OE 2G7HA 3E5QA 3V7CA 2MH9A 3DKWA 3NDJA 3SXJA 4IV8A 1D3YA 3ZN0A 3HTXA 2KIUA 1ZREA 3D5LA 3U1DA 5BXYA 3S2WA 3DMGA 3M6XA 4MIKA 3EQLF 4L5JA 3C0KA 4YUYA 1ZLKA 2FOKA 4R8HA 3UA4A 2M8EA 1I1NA 3WODF 4GYIA 2D45A 4L18B 5HIMA 1PP8F 4RVHA 3KE2A 2YX1A 3LQQA 3F8BA 3RYPA 3K2ZA 4UV8A 4LWOA 2JJQA 3BT7A 2YR2A 1ZG1A 3JAMZ 2G7UA 2ESRA 2HMYB 3WGHA 4MQVA 4LWPA 3KP4A 2VBYA 3JWJA 1M0EA 5FLXZ 2GA2A 1U2WA 1HKTA 2DQLA 4IV0A 2Q0OA 3KPYA 5BP7A 1EG2A 2L01A 2YPRA 3GYHX 3CO7C 3W6KB 1R1UA 3RI4A 4UOEA 5T6BA 3R60A 4OBWA 4BY9E 1XGNA 4PYKA 1FNNA 1QANA 1B4AA 2F8LA 1XSVA 2B2CA 3SR4A 3FF5A 4ENJA 2PN6A 2VBXA 5F2NA 2BZGA 4YFNF 4ESFA 1XSDA 2O0LA 2L4MA 2ZJ2A 2EV0A 1N2XA 3IRQA 2ZZKA 3KQTA 4XSXF 1VP9A 3T8RA 3F3XA 4WK8F 3DXZA 2H1RA 3NW9A 1L9KA 4ZYEA 4Z2YA 3O31A 3TOAA 4HDVA 3QOWA 1IM8A 4X41A 5EC8A 4KN7X 4R1HA 2EX4A 1OR7A 3K0LA 5C1IA 5CM2Z 2B0LA 5EQJB 2BM9A 1BM9A 1TTYA 3DTNA 4YV2A 1P2FA 1HW1A 1QAMA 4DMGA 5DM0A 2A6EF 2CFXA 1O54A 1TW3A 3EYYA 1FSHA 2EFWA 3FMSA 2IFTA 3KQWA 2IA2A 3EVZA 4WXDA 1FYMA 2B78A 4ATNA 2K27A 3UJ9A 2EFNA 2P35A 5D6EA 3B5IA 5E9JA 2Y1WA 2YR0A 3ANXA 4PYJA 2K4JA 3KETA 1R74A 1SD5A 4OA8A 2H6CA 1KPHA 1WKMA 2VT2A 3K69A 3QOXA 4HLYA 1GHCA 3RIEA 1T38A 1B9NA 1J7KA 2HQRA 3B73A 3LCCA 5K05A 1HW2A 1EJ6A 1FY7A 2NP7A 4GF5A 4PIMA 2I62A 3PQJA 1MKMA 4L0YB 3EMBA 5FWDA 2R6ZA 1NW8A 3EEYA 3KPJA 2DU9A 2FEZA 1FC3A 2MD5A 1IXKA 1G60A 3BXOA 3JW4A 2EA2A 3K9TA 4AZTA 1W7PB 3J81Z 1FP2A 3WU0A 1QZYA 5F2KA 5GP1A 1G8SA 5LRRA 1F1ZA 3OU2A 5EHIA 5LR6A 2VT3A 2H09A 4FSDA 1PDNC 1P1BA 4DF3A 3CLOA 3LCUA 5CVVA 5DUIA 1IUYA 3G5TA 1Q1HA 5ILSA 3P9CA 4V0RA 4AX8A 5E8RA 3RIRA 3HRMA 2PT6A 3HOTA 2QY6A 3GFLA 4A2UA 2ZXJA 1TNTA 3M70A 4HLXA 4QWQA 2OA4A 1NW3A 2CMGA 5LQKA 1O7LA 1W5TA 1XMAA 1DPRA 3ZMSA 2CWEA 4A5NA 1R8YA 1O7FA 4CTJA 1ZYRF 1UCRA 4V0QA 1D2CA 2Z9OA 5ICFA 1J75A 4RTOA 4Y13A 1XJ5A 2IH2A 3M8FA 1H9TA 1YB2A 3ML6A 2CQKA 5E1BA 2PBIA 2W85A 4N9HA 1RJFA 1ZRCA 1NW5A 3DLCA 3KPVA 1Z1DA 3GWZA 5GINE 1NHAA 4FR0A 3BWGA 3FM3A 3C3PA 3LDFA 2HTJA 3GX4X 2HR1A 2OY0A 4OQEA 3FUWA 3FUUA 4XLNF 3KQOA 4EGZA 3FMQA 3UJAA 5K0JA 2CSOA 2H00A 3KKZA 4IXAA 2PX2A 3T7SA 2PWPA 4A0ZA 4HW0A 2OQGA 1UB9A 2WC2A 3GZ5A 3SQNA 4U88A 3NQOA 4CXFA 2ISYA 3BPXA 3I5UA 2XHKA 2VZ9A 4RAZA 1IAWA 4JQFA 3E6BA 5E8JA 4IRIA 2O6GE 1YG2A 3FXUA 1R5GA 4X1OA 3BP8A 3BY6A 1I9GA 4BNCA 4L9VA 1KPIA 1FX7A 4OIRF 1P1CA 3G2MA 5EZSA 3LDUA 1CF7B 4FS8A 1SD4A 2XBMA 5D5XB 3EPPA 2XASA 3ABTA 3FRIA 1ONVA 1SQGA 4L9TA 1JE8A 5H20A 2XYRA 4G7OF 1INLA 2IPQX 1U8RA 2CYYA 5EEGA 5CVDA 1ZN2A 3PB3A 3E6CC 3PX3A 2UZKA 1HNNA 4PWYA 4G6DA 5D8LB 3PQKA 1ZRFA 4ZZDA 1ZGJA 4BHBA 3HVHA 3ECOA 4KA4A 3P71T 1HMYA 1AOYA 2P7IA 4ER6A 4MTDA 2XRNA 1GXPA 2FA5A 4BLUA 1ZGAA 1WRJA 3WTXC 3ZMTA 3O6BB 3TKYA 3JAMK 1ZKDA 2WTEA 3EGVA 5LLQA 2FNAA 2KJCA 3PLAE 4PCQA 4HX7A 4M6XA 5L3GA 2IBSA 4KNYA 3HA7A 4A6DA 2JH8A 3TOBA 3CUQA 3J7AO 3AXSA 1MZBA 2K4BA 4ER7A 2HS5A 1KYZA 3JWGA 3M6UA 4GBED 4IJAA 4JBAA 1H1DA 3F4KA 3ELWA 4HF0A 1U3EM 3LX6A 5E1ZB 1LJ9A 4OX9Y 1I1SA 2IPXA 3M6VA 3T5XA 4JXJA 1G3YA 3ID6C 3IHUA 4I2OA 2P1DA 4HGZA 4QQNA 3UJ7A 4I7HA 2ZIEA 1EH8A 3P2IA 3Q7EA 2AOUB 2V74B 2MLKA 3A26A 5AONA 1BI2A 1R23A 1HSTA 3O4FA 2H94A 4EV0A 4ENKA 3KQYA 1R5HA 3F22A 5KS2A 2CWWA 1QNTA 3TO6A 3KU1A 2E7WA 1KR5A 2DPDA 4G94A 2ZKZA 2JHCA 3I59A 2GAUA 4MHGA 3TDUC 2PMUA 4P5OA 3E8SA 1K7AA 2JPCA 3MCZA 2O06A 3GCZA 3GJYA 3FM5A 2HTSA 2P3QA 4Y30A 2A6HF 5D4SA 2BBYA 2V1XA 4UVAA 5LEKA 5K0NA 2JT1A 2DW4A 2FYTA 1G8AA 1SMYF 4G8XA 2UYQA 3UWPA 2CG4A 5MHTA 4OIOF 1VIDA 5B1SA 1M6YA 4TV7A 5CUQA 3JSOA 2O05A 3VC2A 3TOSA 4GOMD 3DOUA 2JSCA 2KIFA 4P9FA 2WV0A 5DLYA 1F4KA 3A7DA 3N4MA 1BOAA 3T0YA 1FP1D 2Y1XA 3BGVA 1ULYA 2HTEA 2ZCWA 5FLXK 3OZSA 4A5MA 1FYKA 5E1DA 3GFMA 4I09A 4CKBA 4RTJA 4AIHA 2QBYB 1IW7F 5E18F 1B42A 2YUIA 1L1EA 2P5KA 1RJGA 3KQQA 4FSXA 4P58A 5KVAA 5DXJA 5EMLA 5LSAA 3K6RA 3LFKA 4YFXF 3G8AA 3FPGA 4IF4A 1YS7A 1XDSA 1TPYA 4ER5A 1RI3A 5H6QA 1G3TA 4K2EA 4GUAA 2ZFUA 2F5CA 3KP7A 3SSOA 2GWRA 1ZARA 3FTFA 3HRSA 1N7JA 1XGSA 2GAFA 4WVLA 5HEKA 2NP6A 4PCLA 3OZTA 3LKZA 4ENMA 2BGCA 2P3OA 2MLGA 5ILVA 5F64A 1LEBA 2NNYA 1FLIA 1IN4A 4FX4A 5E17F 2VBWA 3MQ2A 4RVGA 4E2XA 1CF7A 1NW7A 2JRTA 4PGHA 3GNLA 4KMFA 2AOUA 4XBFA 5LQJA 3DPTA 4I02A 4RTPA 3UA3A 2PX5A 3DH0A 4L7VA 1KQ9A 3KQMA 2FBHA 1R1TA 5ICCA 1TLHB 2RC4A 4L5IA 1JG4A 4HZFA 3B02A 3FPHA 3AAFA 2WA2A 4M71A 4M73A 3UFBA 2P8JA 5D1HA 4WXHA 4EKIA 1AQJA 2Q8KA 4OMZA 3KZZA 2B3TA 4G6QA 4RB2C 3HSEA 2AOWA 4PYIA 3DUWA 3TM5A 2DQRA 5K0CA 4G7ZF 3GW2A 4GOLD 3BROA 2H11A 1REPC 3COAC 3I58A 5DWQA 5K0EA 1RJDA 2D1HA 4CGZA 2VDWA 1KHHA 2E5WA 1BBYA 5IH3A 5HLHA 4AZVA 3G3ZA 1NV8A 2HR3A 4ZYHA 2YX7A 4CHUA 5ICGA 2FK8A 3E5XA 2Z6UA 3A27A 3UJBA 1MD0A 4RB3C 4BAYA 4RS8A 3EVCA 2O07A 4HOBA 5FQNA 3HVIA 1O3SA 3HEMA 4Y17A 3HTSB 1P6RA 1YZ3A 3TR6A 1LDKB 2ZIFA 4ER3A 4N0BA 1U5TA 2KKOA 4A12A 1D2HA 2FHPA 4KMUX 4K6MA 3WSTA 2QENA 3GO5A 3MGGA 4AIJA 2ELHA 2LDUA 2OB1A 2BR5A 1DUXC 3FUXA 5FHQA 4KIGA 2VOPA 3NTVA 1YUBA 3HA5A 2F5FA 1P4WA 2QQBA 1KQ8A 1FPQA 4WWCA 1V3FA 2PLYA 3TQSA 3RPUA 5EEHA 3P7NA 5E1XA 5LGTA 2KJBA 3V7SA 1WS6A 3DEUA 1OYWA 4E2WA 2D2WA 4LLLA 1XVAA 3NVMB 1JHHA 4UV9A 3LBFA 2O03A 5GM2A 3CCFA 1XCBA 2JHAA 3T7RA 5LQUA 4U7DA 2ZZMA 1MDMB 1XGOA 1YO5C 1S8NA 5K03A 2HGCA 1JG2A 3LKDA 1V4RA 2Z5UA 3WE2A 2GB4A 4GOND 2EFOA 2PJPA 4O3MA 4A0YA 4PZJA 2ZWVA 2EFQA 5IT9Z 3GFIA 5E2BA 2UYOA 3IV6A 3G2PA 1TBXA 3QV2A 5DPMA 3EGEA 2WWYA 5BMZA 2O8XA 3BJOA 4CWAA 4IHSA 2V1UA 2RV8A 1JSXA 1PJZA 3R9XB 3LL7A 3TO9A 1LNWA 3H3ZA 1IY9A 3PX2A 2AZTA 3ELDA 5L3BA 4U0YA 2HDCA 2BE5F 3J80K 1ZAOA 2XKPA 2A68F 4RWZA 2P5VA 1DL5A 4E2ZA 5LHGA 4PYLA 1BIAA 2OYRA 2G8NA 3A25A 1YW9A 4C03A 2NXNA 1QBJA 2W57A 3NMUF 3K1MA 2O61A 2PKWA 4BYYA 4KT5C 4LJZF 3UZUA 1SUSA 4I98B 1KU3A 1SD7A 4WF2A 4B17A 1JGSA 3WGGA 1X1BA 3RPQA 1TQPA 4EGYA 3G2QA 3E23A 1PRYA 1ORHA 3EVEA 3EETA 3QU6A 2C7OA 5A2QZ 2LNBA 5DM1A 2VXZA 5IT9K 2C6YA 5HS9A 2PQ8A 4YIIA 5JHUA 5F2OA 3C6KA 3JTGA 2XYVA 3F23A 4GO1A 2AOTB 2IBTA 4HH4A 3EGIA 3KPUA 3KPWA 1RI7A 4DKJA 3EVDA 2P6SA 4CDGA 3BZ6A 4L0ZB 2QRVA 1MJAA 3ECHA 5EG5A 3WTZA 4R79A 3EDPA 1IRGA 4KUMA 4IRHA 3IKVA 4HBLA 5J8FA 4HV6A 1R18A 2JZYA 2PFBA 2VE8A 4KWCA 8MHTA 1KP9A 1P91A 5ERIA 6PAXA 2NRAC 1JTFA 1YLFA 3KEOA 1O9GA 5TJJA 5HDKA 4RTNA 4QPPA 2CW0F 4AUKA 3M8EA 4E70A 2Z99A 2ACJA 2QUFA 2VBZA 4KICA 5FA8A 3I54A 3IC7A 4FT8A 3QOPA 2M5WA 4FZVA 1CGPA 5CVUA 3MFKA 1FBSA 4RYLA 1G6NA 4P7KA 4O6JA 3FPJA 3G7UA 1QQIA 3O3KA 1IN5A 3B7PA 3F72A 2P3LA 5ERGB 5KQSA 1WQ2A 4FX0A 3RJPA 1YW8A 4OMYA 3REOA 3ERCA 2F5DA 3KQVA 3S68A 2IP2A 5FULA 2VDVE 3LHDA 1R1VA 2HNKA 4UVCA 3BGIA 4AD9A 2P5LC 2LF8A 3KCCA 1J59A 2FPOA 4R6XA 1BI0A 4RTLA 5CVRA 3ZMZA 1ODDA 3F8NA 1K78B 3WTSC 3G73A 5DTMA 3M1EA 2F2EA 2OBPA 2ZBPA 1G6Q1 4XUCA 2I9KA 3F8MA 1H9GA 2STWA 1U5TC 2XV4S 3SFZA 4AZSA 1RZ4A 4KDCA 1XD7A 2VODA 1U2ZA 3B3GA 4R8SA 4M9SA 3HSFA 4M74A 1ORIA 3T7TA 2C7RA 2CGPA 3FUVA 2LF7A 5IKMA 1GXQA 3KP2A 1WI9A 3V97A 5CIYA 4DCMA 1J9IA 2IDJA 3O7WA 1MJ9A 4EJVA 1USTA 3SZPA 4RSRA 4Q47A 1HKQA 5E1WA 3HCFA 4P55A 2QE6A 1OPCA 3KR1A 4ESJA 4GOOD 5TRDA 4QPNA 3KR0A 3WGIA 4OU0A 3FZGA 2ZIGA 2VONA 2DK8A 4L9NA 2N47A 4GCVA 4EM2A 3Q9VA 5L3FA 4MGRA 3AJDA 3VFZA 1W7PA 2VS1A 3IRRA 2BV6A 4RTKA 1HKSA 2HFHA 4AIKA 4E31A 3IWFA 1SQFA 1KU9A 3DP7A 4YG2F 2E7XA 4C4AA 5DSTA 5AIPA 3EVGA 4ASNA 2MA3A 2J5PA 3VODA 1Z91A 2RDPA 2X0LA 1WY7A 5CJ9A 1JR4A 3GRYA 3HHGA 1B6AA 1HBXG 1EV7A 4POOA 4UVBA 1IRFA 3Q9SA 3CDHA 3A4TA 2IRFG 3THRA 1T2KA 2ADUA 2RKHA 5K0BA 2OZUA 5BPDA 3VYWA 3IKTA 5FCDA 1YIOA 4WCGA 3KLOA 1E17A 5EGSA 4R6WA 4FT2A 2QBYA 2C7PA 2M45A 4NQWA 2OZVA 3GEZA 3TO7A 3P2EA 3LCVB 3LWFA 3G89A 3BWBA 4BHPA 3ROUA 1G38A 4Y2HA 2W24A 5FWAA 2FMLA 1Q0SA 3OE5A 3FPEA 1S3JA 4HF2A 5DM4A 1RUNA 5K5OA 1NW6A 2XAGA 1K6OA 3P8ZA 3PVCA 3JTHA 4RGUA 1LQ1A 5H02A 5FA5A 3HCEA 5ILUA 3R3HA 2PGXA 1FBUA 1D8KA 3TKAA 4F84A 3KFWX 1I5ZA 2ZMEA 3K1NA 2AOXA 1QAQA 2GQQA 1TQIA 4S05A 1BN5A 2M87A 3O2PE 4JK1X 2EB7A 4HDUA 4A0XA 3BZBA 2H27A 1T98A 3FZVA 3ZMUA 1M6EX 4CKEA 4E32A 2FE3A 5H6RA 1JQ3A 3LA7A 1JG3A 4ISCA 3QU3A 3OCJA 1G3WA 2HYGD 1UWVA 2WA1A 2QM3A 4EJOA 3GRZA 1HQCA 1FBQA 1Z7UA 3FHZA 1BKYA 5CVIA 2XAFA 4AZWA 1Q0TA 5EPEA 3HYIA 2A07F 3DR5A 4G9YA 2M30A 5EVJA 3I64A 3ZN1A 1OR8A 2ZSUA 3HVKA 4EVIA 1I1GA 3ZP5A 2ESHA 4B09A 2FRXA 2IIPA 2NXEA 3LECA 5KVRA 5DYMA 5BW4A 3VEPA 2XAQA 2AXLA 2XAHA 4YUXA 4ZZLA 2UWMA 3PFHA 3OOPA 4QDKA 3HNRA 4I01A 4C06A 2ZBRA 3C6MA 1XCJA 4LK1F 2HWKA 1EH6A 4PYNA 4EM1A 3TGNA 2XVMA 4GC5A 3R0AA 5K09A 4OINF 2EK5A 4C05A 1D8JA 4DQ0A 10MHA 3KP5A 1WZNA 5HS8A 4LD5A 2IJLA 1W5SA 5K1YA 5LQNA 2CMHA 3IHTA 2B9EA 4MEYF 3SMQA 1U5TB 3M33A 3P9IA 3HCDA 4HX4A 5LGNA 3A7EA 3C1DA 5EOVA 3UJ6A 3FMRA 2LSOA 2V6CA 3VB2A 3WU1B 1XB4A 4ON0A 1RI5A 2OXTA 2EJUA 2PX4A 3TM4A 2XIGA 3LSTA 2OQRA 2EWNA 2ONZA 2ZULA 5HLGA 1QPMA 2FMYA 5EIWA 3LA2A 3DULA 4QTTB 1Z9CA 2CL5A 4UXNA 1HW5A 1S7OA 2VN2A 2EJRA 2P41A 2DT5A 2DI3A 2OO3A 2ONYA 5CLSA 3MTEA 5DX1A 3AWIA 1EH7A 4DZRA 2FNPA 1EIZA 3WE3A 5DEQA 5HVQC 3SSMA 3G2OA 1F9NA 4LG0B 5DDGA 4RTSA 1KGSA 3LA3A 1EJ0A 4XUDA 1BIBA 3BKWA 5U4XA 3P97A 3LGAA 5GOZA 2XUBA 3L00A 3HCCA 2NAZA 9MHTA 4M38A 1IN8A 2Y0MA 2AS5F 3MQ0A 4IHTA 1X1AA 4P7JA 4MQ9F 2KIMA 4UHTA 4LGWA 1X19A 4N9IA 1FYLA 4LB5A 1KU7A 3E3VA 1BJAA 3L2CA 4KVZA 3FXRA 3HIFA 5HLIA 2P4WA 4HQMA 3TLJA 2OB2A 4EJWA 2JPBA 4CICA 3LAPA 2C7QA 2PI0A 1NT2A 3KHKA 2KW5A 1UHWA 2V1DA 3KP3A 3G5LA 5LRSA 1VTNC 2DPMA 4ENNA 4H0NA 3C7JA 2FK7A 1V39A 4A6EA 4U0WA 3E6MA 2YSRA 1R8XA 2PJDA 3EEOA 4I0BA 4RB1A 5LHHA 4UNOA 2ZVJA 4XLPF 3ZMVA 2AR0A 2PEXA 2YXLA 1L3IA 1XN7A 2GZWA 4HAMA 1RNLA 3QPTA 5FUBA 5BW5A 3KP6A 2GXGA 1I6XA 3V4GA 2PV0A 4BLVA 1Y8CA 3JWIA 1BI3A 5FD5A 5ICEA 1XXLA 2J5OA 2ADMA 1LEAA 1LDJA 4LFUA 4HTFB 5HIIA 2ZCJA 1SFEA 4XRFA 2A14A 2Y48A 4CO8A 1WSUA 3M7GA 3HSRA 5DV5A 1IN7A 5FD6A 1YW7A 3CJNA 3R24A 2AVNA 4FP9A 1KXZA 3V8JA 4P7GA 4NHJA 2PBFA 3F21A 4RV9A 4DA4A 1MHTA 2XGXA 4KIFA 3PT9A 1AWCA 1K78A 3GFJA 3IL2A 2PXXA 3WTVC 1K79A 1F38A 2PWYA 1SUIA 1R7JA 2YU3A 3BOQA 5DCMA 3CC8A 4CTKA 1R36A 1S6LA 3T8TA 4FT4A 3DFGA 1F5TA 2G71A 3KLNA 3DXXA 5T67A 4M9XA 4RX1A 2PVCA 3HHHA 1XDUA 2VDUE 2XVCA 4BHCA 5M5BA 2VC1A 3FXQA 1X1DA 4LECA 3FYCA 1MDMA 2Z3YA 1T43A 5LQCA 3GUDA 3ERED 1J5YA 3V8LA 4HV5A 5BOXA 4BP3A 2YX4A 2PXCA 4P9UA 5EMKA 1R58A 2HWVA 3HRUA 4IKPA 1VP3A 2GPYA 3EUHA 3MB5A 2RVCA 5L3EA 1J0RA 3GRRA 3GGDA 3UJ8A 4MHTA 1OMIA 2GS9A 4R8RA 3KQSA 2DO7A 2Q2EA 4KN4X 2DULA 2A69F 3SHFA 2P7VB 4M36A 2YXDA 5LQRA 5HFJA 4GC9A 5FQOA 5JFRA 3L9FA 1DP7P 1XTPA 2PG4A 2RNJA 3BJAA 2GXBA 3FRHA 1YQAA 4PIPA 1Z6RA 3BDDA 1D5VA 5K8VA 2VP3A 4MEXF 1P92A 1B1BA 3SGLA 2UYHA 2UYCA 2A3SA 3GLXA 4ZYGA 2IH4A 1D2GA 1IZ1A 2Z6QA 1UFKA 2IA0A 3SM3A 4U7PB 1BHJA 2HKXA 5HDGA 5T64A 1B59A 4FHTA 5P8WA 3DXJF 3AY0A 4CYDA 5FB2A 2JHPA 3GO4A 3SZTA 3V8KA 4YUWA 1TQMA 2AVDA 4AVPA 3FX3A 3CUOA 3SXYA 2V7EA 3CBGA 1OYIA 1WXWA 3OZRA 4ER0A 1IXRC 1VE3A 3DV8A 2E1CA 3WTYC 1NV9A 3CJQA 3LQRA 1XCVA 5LGUA 2ZNYA 2O57A 3KR2A 4EKGA 1FJXA 4RB0A 2HZTA 2OZ6A 5IT3A 1A04A 2V79A 5G02A 3MWMA 2CKDA 2QVOA 3DMHA 4XSZF 3FUTA 1XGMA 2QLZA 2STTA 4KDPA 1KU2A 3NWEA 4HTFA 2FU4A 3UBTA 3PFGA 3FPFA 4GXOA 1XDZA 1SD6A 3H3UA 5KK1A 1Z6TA 4HGYA 3QRFF 2B25A 5ED4A 5CD1A 1JG1A 3U2RA 4BP1A 1LDDA 4ESBA 1JTEA 3CVOA 4HRAA 3I9FA 2ERCA 2ESNA 3L09A 4Y15A 4P7FA 2XROA 3G88A 1WXXA 1QZZA 5KQRA 3HTUA 4Q4ZF 3MEXA 5F6FA 3CJRA 2FQ3A 3GXOA 3QPHA 3HP7A 3R0JA 4KYWA 3N97A 3ZPLA 2AN4A 3I71A 4ZYDA 1SG9A 3OV8A 4RGXA 1FBNA 4RTRA 2XYQA 2V9VA 3VC1A 2JG3A 7MHTA 4BLWA 2ZMEB 2X4HA 4M9ZA 2OKCA 4CXMA 5D4RA 5DCMB 3NEUA 3R0QA 1MJFA 5FTWA 3D0SA 4KIBA 3P9NA 1QAOA 5HIKA 5D5UB 5GM1A 3ZQ7A 1PP7U 4RGSA 1JXSA 1SKMA 4LG1A 4PNEA 5F1RA 2I7CA 3MZYA 1USSA 1JSZA 3MAGA 3QAHA 1FOKA 2K4MA 1FWZA 3K1PA 1QO0D 3WTUC 4HA8A 3NWBA 4X60A 2JTVA 2PY6A 3KEQA 4GGGA 3BWYA 4PYQA 4M72A 3EVAA 4QVGA 1HXDA 1VQ1A 4MWZA 1E2XA 4YMHA 3CO6C 4EQZA 3THSA 4F85A 4H0EA 3TQNA 3M9AA 3CJTA 3DLIA 5EKXA 4U7BA 3X0DA 1G4DA 2EFPA 3BPVA 3ISPA 1S29A 3JSPA 1T6SA 1KPGA 1ON2A 2Q41A 4LB6B 3B3FA 4E2YA 1S7AA 4MTLA 3I59B 3L7WA 5DUKA 2L4AA 3I4PA 2FF4A 2BR4A 4PDKA 3ER8A 1BC5A 4E33A 4AWXB 3FWEA 4CKCA 2YVLA 2BEOA 2NXJA 4DNCA 2M1BA 2DFIA 2OD5A 4GEKA 2TDXA 1EQAA 4S04A 1KYWA 2IT0A 2P40A 1OYYA 2FCAA 5DCFA 2ZTHA 4DM3A 1ON1A 5FFXA 2FBKA 4G7HF 5E1OA 3CKKA 1G55A 2VC0A 3RKYA 4Q48A 5L3CA 1IXSB 2K86A 1W4MA 4HC4A 2HQNA 1KQ0A 4QDJA 4RVDA 5EMMA 3I0TA 5CVJA 1AF7A 4M7RA 5K5QA 3R61A 4XUEA 4ZH4F 5L3DA 1H0MA 3L8DA 3SX0A 1RIOH 1N7IA 2VE9A 2ZLBA 3OU7A 4LG0A 3G8BA 3PS9A 2L54A 4RTQA 5JVTA 3FTDA 3CUQB 4LMYA 4MQ4A 2OU2A 3E7PA 5DTRA 4YUZA 3EMDA 1NBIA 2VOOA 4IVNA 1FSEA 5FHRA 4WXCA 5EHGA 5DTQA 2PX8A 2XVAA 4EMSA 3DF8A 3ORHA 5HOQA 1ZHFA 4LLNA 1MGTA 2GA9A 5E8IA 3HCBA 3E97A 3BGDA 3GRUA 4EQQA 1IN6A 5DD8A 2IW5A 2EG5A 3HVJA 1JQDA 3I53A 5GIOE 2P8TA 3ELYA 2Y75A 5J6XA 3B3JA 3OFKA 2ZWAA 5GWXA 5K01A 5HDNA 4Q5SF 3CTAA 2ZBQA 3JWHA 4HSGA 2GH1A 1SVUA 3B89A 4IPAA 1R6AA 1VL5A 4U0VA 3ULQB 2XKOA 3RW9A 1BC7C 4HG2A 1BOOA 1EAMA 3C18A 2MH2A 1Z05A 1C0WA 1SAXA 3M4XA 2IGTA 2K02A 2PLWA 2EV5A 3FTCA 1DCTA 1NKVA 3H2BA 1DDNA 3NDIA 3D2LA 1YFLA 1J2XA 2NNWB 2IA1A 1QYRA 3DPLC 1XMKA 4EJUA 1YTYA 4PGGA 4HX8A 3RKWA 5D8KB 2HKOA 4BXUA 4RGRA 2DTRA 2P7HA 1VLMA 3DMFA 5DM2A 4NB5A 4RTMA 2HOEA 4YUVA 1TW2A 4YMGA 2LKPA 3BWMA 3F8FA 3K0BA 1VBFA 1RUOA 2OAZA 4PCAA 4YV1A 2G9WA 3GVAA 4D0PA 2YTZA 2H6BA 1QGPA 2RQPA 2UZ4A 4GYGA 3OU6A 5DT2A 3QP5A 2EA4A 2BR3A 2FRHA 2DPUA 1O57A 1KIAA 3EVBA 5K0FA 4OIPF 5GIPE 3R6SA 3U9GA 1IXCA 4WX9A 3C3YA 3F6VA 2WK1A 3TDZC 5D6FA 2OPBA 3KQPA 3H92A 1F3LA 5EZQA 4KW7A 3HCAA 1XSXA 5EIFA 4QVKA 1HSJA 3E6DA 4C08A 4XCXA 1ZG5A 3T1BA 2Z6AA 4UUVA 2AN3A 5DRYA 5EKUA 1UFMA 3GU3A 4YIFA 5DRTA 1LVAA 2A61A 1UHMA 5E8GA 5FO5A 4YV0A 2DBBA 5FADA
chains in the Genus database with same CATH superfamily
3IPXA 1EA5A 2BFEB 1LCIA 3LPNA 3QBEA 5CDFA 1KI9A 3U1BA 3AXTA 3OFJA 4WXYB 3J80Z 2ZSBA 3KL4A 2QW8A 3LMMA 4KO1S 2R7DA 3T52A 5FGMA 1EUDB 2XB4A 2X2PA 4BE7B 4OYYA 2FW8A 4S1NA 1GCGA 3DZIA 1CE8A 1WCIA 2VPXA 4GX0A 3W6JB 1N2ZA 1T2DA 3P32A 5CDTA 5JASA 1XQWA 1QC5B 1BH6A 4MIEA 4EHNA 1PK7A 3M81A 2FF7A 4ZOCA 2YZGA 4JL8A 1U94A 2JD1A 4YRJA 3UYKA 2HSZA 4GEGA 1W4AA 2G77B 3QPLA 1PJ4A 2G63A 3HR8A 3DBIA 5FLEX 1L9XA 4E4RA 2YHBA 3SEFA 2IVMA 4ZYAA 2I6GA 2EDAA 3CW9A 3UCXA 3VRHA 3M3PA 2WP8J 4O33A 3TVTA 2WTNA 3NNNA 4R1UA 4P4SB 3ZU5A 2P6PA 3JRNA 2JNWA 2R9VA 3L5KA 4LRUA 1RTTA 4YJKA 4EHDA 5BPHA 2FMTA 4MTEA 2X77A 5KB3A 1PZFA 2RGXA 1KSFX 4J0EA 4IPTA 1E9DA 4M1QA 4PONA 4WPGA 1AQLA 3NKFA 3MAJA 3Q0UA 2EJTA 3DV0B 4FIZA 4JLVA 3E05A 1R22A 5HQ3A 5ELXA 1I4WA 2K87A 1DAFA 5KQPA 1ZJYA 2EG9A 5F3WB 4RK5A 3ZMDA 3STYA 3IP4B 4MUHA 3CCLI 4XJVA 3OZWA 5BNIA 4HX5A 2MD0A 3PGKA 4L0QA 1NW4A 4X44A 1GSIA 3B8EA 4BKMA 1A4UA 3O3OB 3HL2A 1GZHB 4HZUA 4GXRA 5J2UF 4ZJZA 3CUUA 2ISZA 2ZW9A 1S02A 3F8CA 4FASD 3CSUA 1GARA 1FU4A 3J81K 3DVSX 2MABA 2I4MA 3E0QA 3IJPA 4AJEA 4MJ3A 3U1KA 1YAJA 3QF7A 4BAUA 5EWJA 4EI9A 3GJSA 1Q22A 4IMRA 1P29A 1G63A 4YP1A 5HS6A 2D3TA 1K6EA 3DGEC 4A10A 2ZFWA 1B14A 1UIRA 1R6BX 3HCOA 4B7UA 3U31A 2VUTA 3CNLA 3DQVC 1RRPA 1P60A 3MYYA 5AKEA 4M1SA 2FSWA 1L3BA 3FGPA 4LZLA 1W1IA 2FOXA 3PHIA 2FBIA 3GH1A 3QQ5A 4I5IA 3T3EA 3V80A 4BPRA 3WLAA 3GLVA 3JQAD 3HKEA 1BXRB 4GVLA 3JARB 2BGNA 4IIBA 2ZZNA 1NI3A 2JJ2A 1UZUA 2AZDA 2OHOA 3K16A 4JMPA 4HZIA 2QT9A 3BE4A 4P4NA 3OE4A 4QBIA 2J3EA 3HL0A 2QLBA 1P39A 3IQGX 1J2EA 1GT6A 1NVFA 2DFVA 2O0YA 4FUQA 4WT7A 5H7XA 2WD7A 5B6JA 1A9XB 1NE2A 4P3OA 2DM6A 1DE0A 2ZYUX 3GFFA 4C0SA 4P0QB 2BZ1A 3KXLA 1OAOA 3GFQA 5KX5A 5F04A 2OECA 2QRLA 2AOVA 2F6CA 1C3EA 5GTIC 1KH3A 1KMCA 1SC1A 2A7XA 1TAGA 2CXQA 2GBIA 1X3WB 3L0ZA 4G25A 2EBIA 5DCYA 3IFSA 1QFYA 4OXQA 1YXMA 2J5RA 4KBGA 4UBJA 3PSIA 3IYLW 4ACAA 3QE9Y 5BWMA 1GPDG 1RWBA 1WCYA 2OD2A 3D4LA 2WIDA 3EXHB 2C92A 4RIGA 3I92A 4FE3A 5DP1A 4ZTBA 5LEJA 3IVMA 3MUNA 4D92A 1H22A 1O94D 1BVUA 5DTJA 3RFUA 5ALQA 3WWCA 1K92A 1KI1A 1M2JA 4XLFA 3IAM2 2EFEB 2O3FA 1RLIA 4ETIA 5JH7B 1JIXA 5DIZA 1T0FA 1WOMA 5DISB 2JIRA 2B61A 5CA0A 5M29A 5D3MA 3WJ1A 1LH0A 4WFQA 3F5MA 1JMKC 1QH9A 2AE2A 4PZ9A 1E6WA 1K2WA 4H7DA 1BWQA 3K94A 1T5OA 3EAGA 2FGJA 2QYOA 4TOIA 2CO5A 1CDDA 1QTIA 4KI7A 5LB4A 1RRCA 4E09A 1NOJA 2ZUVA 4OA5A 3LHFA 5KMGB 3ZZ1A 1BA5A 1Z0UA 2CVHA 3JAKA 1Q1AA 3IQIX 4R2IA 2O2CA 1Z75A 3RUHA 5IXYA 2I1WA 1MIOB 1X1CA 1Y7HA 4E13A 2NGRA 13PKA 2XIQA 3RT9A 1A88A 2C54A 2D4AA 2ECOA 4LV8B 3OFND 1IIBA 4B1FA 4XYBA 2G9UA 1E4EB 4QDZA 2MU1A 1N2JA 3JS5A 4C7BA 4XDGA 4L22A 1F5SA 3HJAA 4HYEA 2NQ8A 4L02A 5TMEA 3ELKA 2R8PA 1NPYA 4BMOB 3CUWA 5DLQC 4QTUB 1Y3AA 2FPSA 1EFKA 4IEFB 4YA6A 2RREA 1SXJA 3QBTA 4FMPA 3O4HA 4LWZA 1YYVA 5EMNA 5HILA 4MW7A 2ES4A 3ENKA 4O5OA 4FCTA 4RIHA 4WADA 4Z6KA 3AT1A 1WG8A 1YULA 1X15A 4X61A 4CM3A 1C0LA 4UNQA 5KYWA 3GAAA 3ZNPA 1K06A 1UH5A 2IRWA 3SSNA 2WSSD 4Q3CA 3JARA 4UHFA 2AXTC 1QV6A 2XT0A 4Y9TA 5AVSA 2C9ZA 2PCLA 3OJOA 4MS1A 2KRFA 1J6UA 1NBHA 5A71A 3HBAA 1Z2AA 2Q45A 2PT5A 2Z3VA 3DMNA 3FTEA 5D5VB 2CNNA 3JRGA 2Q6IA 1QU3A 1YFHA 1O3RA 2JAXA 4G4SO 4R9UC 3D3WB 5FYQA 5E20A 1DAEA 1Y9EA 3WMFA 2Q0QA 3ITKA 5DWDA 2Z8YA 3H8JA 4J29A 5A9SB 1PR6A 1HFKA 4BFYA 1I27A 4MNUA 1Y1WJ 5CX1B 1XMQB 3HXLA 2Q3MA 4C9YA 1GR1A 4TXNA 5CCBA 2WUDA 5JFTA 2UXXA 4K7JA 3UC9A 5JR3A 1J8MF 2YWBA 5E1MA 3CG4A 1A95A 3RC1A 2BYVE 2VH1A 2A86A 1IF1A 3KZOA 3MCTA 3RR2A 5JI6A 5CA1A 4YCNA 3WAKA 4MWEA 3LPMA 4J9VA 2ZJ1A 2B1RA 1LLFA 2A2ZA 3JRHA 2QRPA 3BTCA 4Y52J 5BN3B 1TWGJ 1E1MA 2J6IA 2P9JA 3L93A 3PBKA 3UN1A 2GZRA 1BFDA 4R9VA 3WGNA 2IDKA 3K6KA 1JHUA 1XBTA 2H63A 2PGJA 2EJCA 4D0RA 3PI7A 1QP7A 5JCJD 2WMDA 1RYEA 5J2UA 4QUDA 3ZW9A 3HC7A 5J9FA 3TMYA 2PUDA 1N25A 4B8XA 1GUBA 3U2QA 3B85A 5HUJA 1W6UA 4PS0A 3LAJA 2FW9A 1QJCA 2FZ4A 1VE9A 2JCVA 1MJBA 1X94A 1RWMA 2HSDA 2NG1A 3OLCX 3PVZA 4PICA 2DVMA 4PRYA 1HRKA 1SFUA 1MGOA 3FWYA 1BXKA 2RH9B 1M1NB 3R3JA 4YR7A 1KDOA 1ERDA 3CQZJ 3DG9A 1MOZA 2HEOA 3IEPA 4OIMA 4WASA 2Z83A 1ZNXA 2UXCB 4AMYA 4NC9A 1QYCA 2FW0A 3CGGA 2DKNA 4HSTA 2AEEA 3AJEA 3CLSD 3KZNA 3MBKA 4KQXA 1XRRA 1I3OA 1GPAA 2PNFA 3K1YA 3MRVA 1X1TA 3IXQA 1YVDA 2Y9MB 1JJ7A 4IWNA 1NQAO 2ONJA 3VR3D 3WTCA 2G70A 1UXHA 3HGYA 4ZI3A 5KYWB 1ISMA 2CL6X 1V11A 2EPFA 2XUOA 4YJHB 2AOTA 2Z2IA 3B78A 2ZBKA 3CZRA 1UDBA 3N3BC 3PSHA 3R20A 1JLHA 4L28A 1SVMA 3T3PB 3DMYA 3MUOA 2QQAA 2G4VA 4CSWA 3AC0A 5HNFA 5KCZA 1O58A 3OJFA 5C1BA 2NACA 4L9AA 1GGVA 2WSLA 2PQMA 4PYOA 3P0EA 4BNNA 1VYTA 3R5TA 1ZRDA 3DCIA 3JYOA 4HXFB 2F5VA 4RXTA 2C2KA 4IIJB 3LSGA 1OF1A 3OSGA 1OBFO 2LLKA 2JL1A 2OC4A 2CLEB 4DR6B 1KFKB 2H07A 4MUAA 3CX4A 3WWOA 4D9NA 1NG1A 5C53B 2J08A 1H2AS 1HDCA 1K68A 1NZDA 1OILA 1YFJA 2WWWA 1HTTA 1Q20A 4A0FA 2GDZA 1G7SA 1BI1A 2CYAA 3MBOA 4MUIA 4X6LA 3TLGA 3UJCA 3VC7A 1CS4C 5HKBA 3Q87B 5T7BA 2HDHA 4MEBA 1LS1A 4PCUA 2XXAA 2C57A 4OKSA 4ERNA 1V9CA 3FKQA 2G7HA 3QBVA 4XPZA 2HOAA 5K51A 3KEGA 2K7ZA 4BJTA 3ZN0A 2W7NA 1SXIA 2RMKA 3W4JA 1MG5A 4P3NA 3UUWA 1DGRM 4YT8A 5GPCA 2W4MA 2VKDA 2PMFA 5BWLA 1Q3HA 3R76A 1IE3A 2OM6A 3DTIA 1ZK2A 3DOFA 3IAFA 2C4WA 4UEJA 1LVKA 1K5HA 2ODTX 3DMGA 2ME0A 5AP9A 3ZHVA 1VLHA 2GYWA 2PAAA 2AXQA 5LDDC 3MUEA 1JG6A 3TGLA 3T9EA 5BVHA 2VDOB 4UVGA 5KYYA 2EYUA 3WMRA 5CFRA 3TNJA 3FCOA 4YRMA 1NULA 1B8IB 4KFSA 1Q1BA 4UVIA 3KJHA 2IBDA 5HIMA 1SCKA 4CUGA 3ISJA 3QLTA 1K63A 2ZUTA 2WT9A 2JRMA 3LQQA 3MD2A 4MX8A 3RYPA 2E48A 4IICA 5J2TF 1IAQA 2FRVA 4O1HA 3EF0A 1SB8A 4FEGA 4WN3A 1CD5A 3DZDA 1H2ZA 3HLYA 4M21A 4W1RA 1L5LA 1E3TA 3IR6A 2G7UA 5IDYA 4C3HJ 1SVLA 2PU5A 3KFVA 2O6LA 5FOUA 3TXYA 4LWPA 3KIOA 4LC0A 5AI8A 4PG4A 5CA0F 2ANCA 2HVQA 1S3FA 3JWJA 1BWRA 1DXYA 1M7BA 2WD7B 3BDAA 4MS4B 1SUWA 3KUCA 4PX9A 1V48A 3OIOA 1R5NA 4UUTA 2AH5A 2Q3BA 2WYVA 4A69C 4NAUA 4F4IA 3AQIA 3RS8A 4RMHA 4ESEA 4ZEWA 2G8LA 4ZVRA 1Q7BA 3SDSA 5BP7A 3VR6H 1LC0A 3WIVA 3VPCA 3VR4D 5AR1A 1X14A 3EEFA 2I4IA 5G41A 4G85A 2YPRA 2FSVA 1CY1A 2NV2B 1C50A 4LWQA 4YRKA 2Q28A 1RZRA 4GRIA 1U9YA 4LQ4A 4II7A 1Y98A 3SF8B 3CCVI 4K0KB 2VAPA 1XAHA 4TMVA 1W8IA 2A6PA 2F3SA 3CLTC 1TMKA 1F6WA 3R60A 4OBWA 1ML4A 3HB1A 3V1NA 5C4IA 2JEZA 2B1IA 3A6HA 5T3YA 4ARZA 2BYTA 1M67A 3BD7A 3PHCA 3FDZB 1B4AA 3AHHA 2EU8A 2OA0A 3WDKA 1QHNA 5JXIA 3Q5EA 1Y5IA 3GGCA 1NLUA 5ELMA 2OHJA 2VDQB 5SZIA 1LUJB 1MO2A 4IGFA 1U7TA 4OHBA 3RQ4A 4ESFA 1WZIA 4DBRA 3ANYB 5DMHA 3L4BC 2O0LA 4Q1AA 5L3RA 5IM4F 2DFHA 1UKZA 2GPJA 1RPNA 2R25B 1SXJE 2EV0A 3N87A 3UCFA 2O8NA 1OD6A 3PUYA 4JVMA 4FB4A 2LKSA 2Z56A 3LYAA 1V7QA 4QBKA 4NYJR 7ADHA 1ZICA 3ASUA 2WPNA 4M0LA 2GK6A 2YNMD 2YYYA 2HA0A 2EARA 2H1RA 3AJ9A 1L9KA 3THWB 2YWDA 4DC1A 2DKFA 2ELKA 1NW9B 4FMDF 1SBHA 4FONA 3A6KA 1GNVA 4QUKA 2NU8A 1R0KA 1P7WA 1U3TA 2GRJA 1IM8A 3KQNA 1O4XA 3SQWA 2XNHA 2Q6OA 2A5DA 3USZA 5CM8B 4CCJA 1DBWA 1BS2A 3KOUA 1J9EA 4TM7A 4X41A 4KN7X 3D7RA 1ZOSA 3FSGA 1OR7A 1ENZA 3DD5A 5CXSA 3W7BA 3G1MA 1I4TD 2NUPB 4LK2A 3HPGA 3ROQA 3ZDAA 4R68A 1Y6QA 4DOZA 2CXHA 2A92A 2XQIA 721PA 1N9GA 3SZUA 1GKKA 4FGSA 1JPVA 1T95A 4I50A 1GL9B 1Y4DE 2BM9A 1KVQA 2O1SA 2PFKA 4TRMA 3LGSA 3SJMA 2PA0A 4K81B 4Y2QA 3QW2A 1B2RA 1B3BA 2D06A 4RV5A 4IIJA 4XNFA 4OP3A 1M2EA 2VJCA 4X20A 2YMQA 3H9GA 4Q6BA 2A6EF 2EKDA 3EUFA 4AECA 1TW3A 1EXMA 2OZKA 1BR2A 2DTXA 2XE6A 3DV9A 4PBTA 1FSHA 4Q34A 4X62B 2BT4A 1NN3A 4L15A 1CUYA 3FMSA 1JEDA 3L6BA 1IHYA 2GZ1A 4QPZA 3SFTA 4YEDA 1E79A 1AKVA 4JUIA 2XD9A 1I6MA 5FPYA 2B78A 2R7OA 1A5ZA 4AN4A 2Y1OA 2EFNA 3GLHB 2G17A 1E5QA 3B5IA 2ORWA 2ZG6A 5DTDA 1N2CB 1Z06A 3PNKA 2ZTUA 4OHVA 4TS1A 5BW6B 2K4JA 1RPZA 3INGA 4NPAA 4PHTA 1R74A 1XTJA 3D4IA 1WZEA 1DRUA 5T8KC 4ALNA 2ZJQF 1GG9A 3WFIA 3DU6A 4DPMA 3DEJA 5L6MB 2Z1NA 1WKMA 3QOXA 2HVRA 1ZRNA 2P9HA 4V3CA 3V6MA 4EHBA 3BE8A 1P7PA 5C8YF 1J2YA 1G291 1B9NA 1J7KA 3CF2A 4F1KA 4C76A 4IGEA 4E07A 1HW2A 1DRJA 4KTTE 1QCYA 3NCHA 2C8LA 2QAGC 3HNPA 4GF5A 5E3IA 4NC6A 1TWHJ 4JOMA 2BOVA 3LFHA 3OX1A 1W5BA 3Q15C 5FFNA 3AV3A 3B6ZA 2GSWA 2OCEA 3DUFB 2RB4A 1FZQA 1ZJZA 1NW8A 1Q7TA 4UC0A 3STVA 3VTAA 4F06A 3KPJA 2CVFA 1K4SA 2DU9A 4B3SB 3P9SA 2IJGX 4J8PA 3ZGKA 1G60A 3BXOA 1I1QB 2JGAA 2LW7A 1Z37A 3PC4A 1SOAA 1W7PB 4AZTA 3WU0A 2VSNA 2MCFA 1PJQA 3FXLA 5E3JA 5GP1A 1GHTA 3ZE6A 3ZWVA 1N78A 4FB5A 2PRYA 2XTMA 5G4LA 3CLTD 5IT0A 1FSPA 2BFBA 3F7TA 3LO8A 4JJIA 5LR6A 1LLDA 5FBZA 2EFHB 3I30X 4XWTA 5J59A 1RCTE 5EIBC 3M6IA 4N7MA 2I8CA 1I7PA 3KYDA 3MT8A 4K2AA 4TMWA 1JT2A 1ZUWA 1X2EA 1YJAA 3G5TA 3QP9A 4WZ6A 5ALWA 2FN3A 3FKSA 2HA5A 2Z1DA 3LSRA 2HXSA 3V7NA 5FWYA 2GKOA 3V46A 1WJCA 4V0MA 4AX8A 2BEJA 2W2XA 1ZINA 5IBRA 1FS4A 1YZLA 2DJNA 4MCJA 4N5MA 4AY4A 1F2TA 2C5EA 5CYFA 1RKVA 3WLEA 2ZB7A 2RDMA 5JSHA 2X6XA 4I2NA 2EV9A 3ADOA 4CQJA 4B7CA 4FISA 1Z5ZA 3QPUA 4Q19A 4ABYA 4W7IA 5B7PA 3JAWA 4CF4A 1LPMA 4UD6A 2C4HA 3L4KA 1BQEA 1XNGA 4GP9A 1E5LA 4BVEA 4QWQA 4QIWN 3LCRA 4C0LA 1TWAJ 1NW3A 2JIPA 4UEOA 4R3NA 3ZWCA 2Y27A 2QSJA 3FCEA 5BN4A 5LQKA 3BFPA 2VWHA 2YBDA 3G6WA 1XMAA 1XI2A 5JD3A 3LNCA 4ZTZB 1VGVA 3O26A 4H6XA 3H3XA 5FAXA 2AHRA 5FPQA 3H9QA 2ODQA 4R40A 3JV7A 2FUEA 2M9MA 4FJ0A 4R1NA 1PFQA 3RHFA 3FMOB 4TL7A 5KZMB 2Z9OA 1OKKD 3CCJI 1N8NA 4YP6A 4GI1A 3W3AA 2F4NA 2WG1A 1JKMA 4NMLA 3U7EB 4CODB 1MVOA 4BLQA 4Y13A 1XJ5A 3VSLA 1YKFA 2CNOA 1T0FC 2Y93A 3PXCX 1WKCA 1H9TA 4JB0A 1E58A 4LX8A 4OXRA 4N12A 3N7TA 5DOVA 5E1BA 1C8VB 3VU3A 5AO9A 3R7SA 1SANA 4G0PA 1UBHS 2NTVA 3S2DJ 1RJFA 3PGMA 1XVUA 4QM6A 3MKYB 1TWCJ 3PR1A 1KJ8A 3PC8C 4JYKA 5FLYA 3E5NA 3ITDA 4I5EA 3LDHA 4OM8A 4OUDB 1J21A 1R50A 3B1WA 3FYSA 4I66A 4ZYXA 1VZ2A 3AKDA 1XV5A 4NTZA 2R96A 3IH3A 5AXDA 2J4FA 4R5HA 2JJ1A 4YAEA 4MP3A 4Q37A 3LC7O 2BGRA 1RC8A 2BHLA 5JBNA 3QU7A 1KU6A 2OY0A 3AEUB 3SVTA 1XRJA 2JCYA 5TT0A 3KTAB 2QJRA 3EN0A 3KQOA 3ZS9A 3PICA 4B8YA 5IPFA 2B9VA 1D6SA 1QHGA 3BHJA 4EUKA 5EIEA 5K0JA 1G42A 2F1OA 2O5CA 1E2QA 2B7LA 2H00A 3FK7A 4J19A 1JHAA 4NZYA 1C4XA 3PFWO 4ZDWA 3P27A 1ZFNA 5HCIA 1E5XA 4BFUA 2OMEA 5F0FA 2VAWA 2UYYA 2OQGA 2Y0BA 2CHGA 3QMPA 5JXHA 1E96A 1Q3TA 1XUOA 1YMVA 2VH2A 3MRTA 2RONA 3D8UA 1WQ3A 4BO8A 1CZKA 1T3ZA 2KM1A 3CW8X 4IXDA 1BVYF 3SOZA 1N9ZA 2XSZA 3I5UA 1NIJA 3KZIC 3TUJC 2C96A 2Z98A 4DDWA 2JUGA 4URZR 2VZ9A 4RAZA 2XTZA 5E6SB 1WM1A 2ODEA 4FI3F 1NQ5A 4IRIA 2O6GE 1YG2A 3FXUA 3VC3A 5IZCA 1E3PA 3BP8A 4K26A 4LDQA 1I9GA 3JRCA 1EGAA 1VJGA 5IYZF 2Z5GA 2R7UA 1Y3IA 4YAGA 4ZDLA 1VZ3A 1VF9A 2QLJA 3QUQA 5F1KA 1AXEA 3BK2A 4JKYA 4UUMA 1GCOA 5EZSA 5FTJA 1HK7A 4HN9A 3ZHYA 5LBUA 4KPYA 2PSEA 2O9JA 4TZ6A 5D5XB 2YL2A 4MQUA 4MDYA 2BKUA 2XASA 2YJ5A 4N01A 4V2IA 3TTSA 1GQFA 1UC9A 3PEUA 5H20A 1YJCA 5DULA 3IP6A 3L7YA 2IPQX 1E2UA 1NF2A 3WA6A 1DZ3A 1WXDA 2QTGA 2M7AA 2DQKA 5CVDA 1T6YA 1ZN2A 1MBEA 1EBBA 1WDWB 1I7LA 4UPVA 2KLBA 3TINA 3CNBA 3CDIA 2AQFA 2JGIA 2KMLA 1JVBA 1PG5A 2WSYB 1HNNA 3IVRA 1KBZA 3AEKA 3H11B 2F3PA 3I6QA 1GL3A 3L02A 3P19A 3PQKA 1U28A 1DO8A 1EFCA 3H3JA 3U3RA 2Q6TA 2RG7A 4F2GA 3AERA 5DT9A 3S8MA 3SHVA 5IVKA 4DY6A 2RKOA 4ETNA 3PQFA 1XZGA 2G1KA 1AKTA 4KWHA 5LLSA 3BJEA 4BDTA 4EF4A 2A0YA 3AEQB 2JIBA 4N6OA 1OH8A 2Y1LA 2XRNA 3IKJA 2F43A 4Y7CA 1BKDR 2MSNA 1PJLA 3T41A 1R6UA 1ZGAA 1ZU5A 1KAGA 3EC1A 1R37A 3WTXC 1RLTA 2HWYA 1W8DA 2XF7A 3ONVA 3RVMA 1NZJA 2XWSA 3HWRA 1C7QA 2QP3A 3JR7A 3WS7A 5AM1A 2WTEA 1JHOA 3OZDA 4LXIA 4LZNA 2JC3A 3U80A 4F04A 2KJCA 5BRJA 3M1YA 5C37A 3PU6A 3F6CA 4DIUA 1KRXA 1R4ZA 4YRVA 3H0CA 1ZXXA 2HW8A 1K97A 4M6XA 1AZSC 3NAGA 3KSBC 2IBSA 3HA7A 1HL7A 3CLKA 3KO8A 4BV3A 4DT1A 1K66A 1FVXA 3UWKA 2W4SA 2B36A 3AXSA 3A2LA 1BGXT 4J91A 4JT2A 4X90A 4Y2XA 2BFEA 1KYZA 3K15A 4ZO7A 4BWFB 4TYQA 3NARA 2X7HA 4BQSA 4GBED 1Q14A 3FOEC 1GPWB 2IU4A 4CE6A 2OCIA 4Y2UA 2WKSA 3OPYB 3S7TA 1OAAA 3TECE 1WLYA 4H1VA 3O82A 1W48A 3UHJA 1JFTA 2HRCA 3K09A 5E1ZB 3UICA 1GNLA 3JQRA 4QOIA 4OX9Y 1RWKA 1JIVA 2DWQA 2IZOA 4MVJA 2ZREA 2IPXA 4TN1A 4ENSA 4KQKA 2PZEA 4WKGA 1EIWA 1VPEA 3AVXA 3R5HA 2XCRB 5CU7A 3IHUA 3DYBA 5GJCA 3LBHA 2BTEA 2Q6VA 3DB2A 1LDMA 2IPMA 4GYYA 2WC1A 3NTRA 3DKRA 2PKQO 4Q05A 5H3LA 1M2NA 4ALKA 2JKZA 3JQAA 2K7FA 3NHSA 3L4BA 4HT3B 3IIEA 3V4PB 3A26A 2CLDX 1R23A 4RL6A 2MSLA 2NZYA 4KGVA 3HS3A 4J7XA 4O8ZA 3O4FA 4W6QA 3LIPA 4AO6A 4ENRA 2VTBA 1AKHB 4ENKA 3C87A 4B4CA 2MINA 2PQ6A 3NV7A 1XJ0A 4JYCA 1R27A 2RHBA 3M6LA 1MABA 2CWWA 2PWZA 1CR0A 1IUFA 1NFQA 2FP4B 4TROA 4ZGGA 3AINA 4BMZA 1Y6IA 3K10A 2REXB 3FXAA 3QWIA 5CT9A 1OGIA 3D6NB 4DLUA 3WGMA 4G94A 4EZBA 4QULA 2JHCA 3I59A 1FDSA 3BAFA 5F5LA 5LYYA 4J2TA 5L40A 4B79A 3E8SA 2M7BA 5PGMA 1JAYA 2ZWIA 3W9UA 1ZR2A 2OTJI 1IC6A 2HXYA 3VI4B 3HHPA 1EFVB 2FR0A 4HNAB 1JUPA 1R3UA 2C7GA 2HA3A 4V2GA 3GCZA 3GJYA 2CFSA 2E85A 5CJ2A 5ANRB 2P3QA 1L5MA 3OY2A 5D4SA 2BBYA 4ZVUA 3GD7A 1IBKB 4DLLA 3OYGA 4K9MA 3PGXA 4B5LA 4TZKA 2NU7B 2GZDA 1PZMA 4X1YB 3C2GA 2CLFB 2LOOA 3HU2A 3VKFA 1C7FA 2Z9CA 3DBVO 3DLPX 4G8DA 3ROKA 3MKLA 4NZMA 5TQVA 1C1XB 4CGYA 4ZOBA 5KYKA 4BBAA 2WZBA 2DBYA 2KMUA 2RI1A 1SVKA 2H85A 4CBVA 4Y2SA 3RYCB 1VI2A 1W1UA 1VIDA 2XUJA 2OPHA 3KK0A 5HMLA 3VO2A 4D8XA 2PPLA 3LVFO 3O2NA 2DETA 4NK4A 2G9RA 2ZYHA 4GOMD 5HA5A 1U5AA 4PLGA 2KIFA 4P9FA 3OC6A 4NMMA 4CCKA 3VPHA 2WV0A 1XZAA 2D2IA 1D1AA 2WIBA 3A7DA 1O96B 3R23A 3FXOA 4BS9A 3QE3A 4Q93A 4RS3A 1BOAA 4XWGA 3T0YA 1JHDA 1M6VA 4FLMA 4I1RA 2IX9A 3T15A 5CGQB 5BMVA 5E0KB 3EQ8A 5HKOA 2WAFA 1ULYA 1XRPA 2BD0A 2HTEA 5J3LA 4JC5A 3K0KA 1BW9B 3L6EA 2CJXA 1A2OA 4RMGA 3LK7A 4D7MA 2BBTA 1CUHA 2J4DA 2YIVX 2IAIA 4TMZA 4D4JA 2F1RA 4X95A 5JBQA 5ITWA 2POCA 4OREX 5E1DA 3A05A 3QPCA 3GFMA 1T29A 4CKBA 3O9VA 1NJFA 3BMCB 1M2WA 1RFGE 3EASA 3K1AB 4OB6A 5JNRA 5JSKA 4CTMA 1MH3A 1UC4B 3S8PA 1XX5A 2X8BA 3E53A 1ZOIA 4U39A 3BHNA 1FYXA 5FUVA 3HFGA 2IW3A 3R6WA 3RCOA 4FSXA 1K5DA 1RQNA 2ZIXB 3CN9A 4P58A 2QD3A 1PZHA 1A6QA 3JVVA 3LE8A 1NLZA 2B8WA 1I10A 3OM1A 2AE1A 4LNAA 2KDZA 4YDHB 4WK2B 1TTQB 3Q98A 1JSRA 5I3CA 1JMVA 2D1FA 1JECA 3HK2A 2IUEA 3IEKA 4IL5A 3S27A 3ZHBA 2BVMA 1E3JA 4UTZA 5D5QA 1CZLA 1DAOA 2YRFA 3NM6B 1L7AA 3Q2OA 4YP5A 2KSQA 5DI3B 5H6QA 5DBHX 1USVA 1G3TA 4K2EA 3TP3A 3AUFA 5CEJA 3KP7A 3OYIA 2QUIA 1A7AA 2GWRA 1NRXA 5COQA 5CXQA 1RETA 4JDPA 1EX1A 4WVLA 2D1QA 1T9DA 2VJAA 1U9ZA 3CTMA 3WGOA 4OXKA 5I7UA 4TL8A 1FLAA 5TQ0B 3AR8A 4MPRA 5K3AA 2QN8A 1GGKA 3BRWD 3CLQA 1NN5A 4H7JA 5IAGA 2P3OA 5ILVA 1LEBA 2VAXA 3QTBA 1G5PA 3QMVA 4N18A 1T8PA 4ZCPA 2M6KA 1FLIA 3CZMA 4AMVA 3KLBA 1WMBA 4YWJA 1ZNZA 3KJIA 2F1IA 3MQ2A 4QEZA 5DCWA 3IUSA 1LQTA 3IV5A 3FROA 3IQZA 4LVOA 3UBMA 4XWAA 1H4SA 5SYAA 3KT3A 1NW7A 2JRTA 1EWYA 5BNGA 3GNLA 4KMFA 1LBQA 4LJSA 4XBFA 2X15A 4P22A 1GUAA 1CY8A 3HO8A 3DH0A 1DU6A 1VL6A 2PFSA 3QXCA 4TVSA 4AY6A 4ZMBA 4JA0A 3GPIA 4BUCA 1KQ9A 3IEMA 1NC1A 3LT1A 4EJSA 4Q0MA 2OPTA 1R1TA 1MC5A 1NSTA 4G89A 1TLHB 1VJ0A 2DP4E 1DCMA 4EFNA 2LTAA 2RC4A 4L5IA 2MSCB 2YVQA 5LU9A 1JG4A 1K75A 1CUXA 1POGA 1NG6A 5CPBA 5CB0A 4HZFA 1P19A 3B02A 3RZDJ 1AXGA 1TRKA 2FPRA 1I2CA 3AAFA 1I6WA 1VYUA 3M83A 2VA9A 4XGNA 1L5HA 4ZVMA 3QELA 3NXSA 4XM2A 4ZXPA 1EZ4A 2Z1MA 4PLHA 4L72A 1Z4MA 4LFCB 2IIBA 4CHGA 3MJ4A 1XVVA 1FDRA 4GLFA 2BMFA 4ARAA 3I0MA 4P81A 2ID3A 3IP5A 1NQOA 1PD1A 4FDVA 1Z62A 3T5TA 2NZJA 3K6JA 2WAOA 1E69A 2B3TA 4KN5A 1GRCA 1B4DA 1U0EA 2EGHA 3HSEA 1E6CA 3EXFA 4GGMX 4HBGA 2LK2A 2GEBA 3IIKA 2R44A 1P2SA 1L7VC 2DQRA 1LBSA 2AI1A 2VBIA 5DIFA 5JCJA 2VBFA 2F90A 1MGPA 2DY0A 2SNIE 2UYGA 4W1UA 3BMOB 2NQ2C 4OV6B 3RVQA 3CVYA 1M5RA 1REPC 2OV1A 3COAC 3I58A 1IAVA 5DWQA 5K0EA 3RVOA 2REBA 1TMYA 1RJDA 1TZBA 3QX8A 2ZRFA 2C9DA 4B7XA 1JPNA 3DLBA 2P0WA 1DP4A 2Q1XA 3ANNA 3PPVA 4XE5A 1BBYA 5IYBJ 4HEA2 1RP1A 1S8OA 1NBME 2AQHA 2PUHA 2J9FA 3PI6A 5HCNA 1QGZA 1T1IA 3G3ZA 2Q5LA 2VQ3A 1NV8A 2JHFA 2PL3A 4TKZA 5FBHA 2R6AA 1CB7A 4KCGA 1F3OA 4D2IA 4XTCS 4ZYHA 3O8RA 2C7VA 1FDWA 1ZSYA 4J3FA 4I50B 5ICGA 4JSRA 1M0EA 1FTQA 4YV7A 1X1QA 2FSSA 1R4NB 2Z6UA 5EXDA 3SF0A 3ZN2A 4K6GA 2HHHB 3ABLH 3S81A 3OWOA 16PKA 2D0OB 3VNVA 1JHZA 3DDHA 4IEIA 3G0IA 2IEIA 3USES 4MUFA 1AS3A 3UPUA 2FQWA 3RFVA 3RC7A 3KU4A 5AW7A 1MMSA 4EB6B 1RRVA 4JYZA 2HI3A 2ZU6A 4M53A 5EZYA 4W7SA 3HEMA 4DCJA 4Y17A 3AYZB 4FDMA 4PC7A 5CB6A 4ZODA 5I45A 3HTSB 5IJ9B 1F2UB 4MR7A 2GCOB 3TR6A 3VR3A 3WK7A 5IN4A 3EULA 3LPLA 3J7AY 1MR3F 2NVWA 3AV0B 4LSZA 2VUIB 2ZDGA 4B4UA 4MYDA 4C3UA 2ADOA 2PEZA 2KKOA 4MZXA 2FHPA 4XJXA 2BUCA 4BQFA 1JW9B 5FT9A 4JB8A 3CCYA 1OFTA 1ZM4A 2QENA 3MGGA 2JCGA 1VQ5I 4JC4A 4OL0A 3DM9B 3UV7A 3P9YA 4J75A 1LPOA 1TJPB 2JLUA 3ICQB 4HEA1 4PTLA 4GL4A 3QU9A 2ZYSA 4YCAA 5K3SA 1E3HA 2PLYA 1H8HD 1E1QD 4NJEA 3O1HB 1GOTA 1FYFA 4L0DA 3STWA 3TQSA 3TTXA 5M3MJ 1OPRA 4W8HA 3DEKA 3PF9A 2IYAA 1AT1A 5EEHA 1PW5A 5FBRB 4JI0B 4YAIA 2RAVA 3L7KA 4K6OA 3D4PA 1GSHA 3A02A 1P3JA 1DJMA 3WMGA 2H4FA 3CX8A 3G1OA 4V38A 2GOYA 1T5DX 1UT6A 4X84A 2D2WA 3RC2A 4AJLA 3S8EA 1E2JA 2YVKA 4BJ3A 3CPSA 1WQ1R 3NVMB 3RJ9A 4DLXA 4LHYA 4MV7A 2QP9X 5KX5F 1D3AA 2E71A 2LR8A 3HJTA 3OKCA 1LRJA 5CQEA 2ODWA 1YGYA 3OWXA 4QBHA 3T7RA 1NONA 5TY0A 3KV1A 1E9EA 2ZXFA 3G9UA 5DV9A 5JRJA 5KPJA 4OKIA 1THTA 3TUZC 1S8NA 4J7UA 1F51E 5FPHA 5F77A 3JCUC 4H6PA 2BTOA 4RKWA 1U7HA 2HL6A 1ONBA 1U8XX 1PU2A 4Q4HB 1O0CA 5F9HA 2HYJA 1H6AA 3HL4A 4ZRMA 1SXQA 2GERA 1UAGA 3N2GB 1WBBA 4J00A 3OTWA 2WKQA 2PJPA 2BJHA 1VM6A 3D31A 4P31A 4R7TA 2C94A 2H4XA 4MKGA 3VR2D 2AFIB 4WD3A 2BSXA 4WGFA 4WVFA 5IT9Z 1HT3A 4CV1A 1DAKA 5DEIA 5E2BA 2UYOA 3IV6A 4MKFA 4LJRA 1KSJA 4B5KA 4DIMA 4NOMA 4BIMA 3AM4A 4UHBA 3CCEI 1YBAA 1A8UA 2YXPX 4MULA 3G1UA 4TKMA 2RV8A 1H94A 2X1DA 1JSXA 1MX9A 3UAOA 3OJLA 4PFKA 4XIGS 3WNDA 4NFLA 1DWOA 2ET6A 2FPIA 3DE4X 2HT1A 2VHXA 1C30A 1I0LA 2CFIA 1D07A 5ISMA 4WKNA 3UQZA 4TTJA 5TARA 3L01A 2WB1N 2BFMA 4TV8F 2BE5F 3B6CA 1VJTA 4OMFG 1YS1X 4RWZA 5T4HA 3CPEA 2P5VA 1KJJA 2FZVA 1ES9A 5GP9A 3UF0A 2O8CB 1J39A 4KTVE 4KSCA 3UMMA 1BIAA 2VASA 3O0DA 2OCGA 1II0A 1ZH2A 3K0EA 1QVRA 3S2HJ 2WF5A 1SULA 3CRNA 2NXNA 2J32A 2W57A 2Q49A 4PN7A 3K1MA 4HAVA 1OCCH 3ECSA 4CKZA 5FEUA 1LK5A 1XXHB 2PKWA 1PS0A 4QXQA 5AI0A 5H9VA 4F7DA 5H4GA 1HR0B 1YIAA 3UZUA 1X6VA 3ZZNA 3ASNH 5F2NA 3F73A 1OTHA 1P5HA 3VHRA 2C84A 3GJ0A 4NXNB 3SFIA 3KAJA 2XUFA 5H4HA 1SD7A 4WF2A 2HD4A 2XH8A 1JGSA 1Z6ZA 4WV3A 2JKYA 3UB4A 5FLVA 2IYTA 5INTA 1IULA 1KS2A 2M4KA 1RLMA 3RFTA 3ZH9B 4BB5A 4TLEA 1H2FA 3E23A 3TOCA 4FD2A 4NU6A 1PRYA 1ORHA 2C1XA 1HOTA 4LY6A 3NRJA 1JI8A 4X91A 4F2PA 4DUYB 1TZCA 1ODFA 1TM4E 4IH4A 3PO2J 2X51A 1G8MA 4MWDA 4WDRA 5C8DA 3KSUA 4NU0A 2PQ8A 3DKPA 4JX9A 1PQPA 3O21A 3ADKA 3O4VA 3C6KA 5F2OA 3QXGA 5B5EC 1KVSA 1NY6A 2BUAA 4DW8A 1BGVA 1YSCA 2AOTB 2IOYA 3INRA 2ENUA 2BGIA 1JU9A 2HF2A 4L3OA 5GTHC 4UUSB 1TF5A 2GJAA 3JVEA 3KPUA 1UBJS 3N75A 2ACKA 5E6RB 4DKJA 4H3SA 1U7UA 4F38A 1UJ5A 4AKHA 1EFUA 5EG5A 2BHSA 1TKAA 1Z4LA 3EDPA 2REQB 3SLKA 4A2WA 4EA8A 1IRGA 1V43A 2GX6A 4Y2PA 1XAIA 4HGNA 5DK6A 4TXHA 3W34A 1A5BB 2ECQA 4BO2A 3HUUA 5B58C 2WV1A 4W5NA 3JASA 1R18A 4C7JA 4A16A 2AEMA 1ZM2A 3D64A 3EBLA 3P5BA 2I91A 1HA8A 2VE8A 1RHQA 8MHTA 2DOAA 1VQ7I 3EZNA 2IS2A 3WK8A 5EG0B 2AG6A 3GV0A 1UKEA 2RGEA 2XCQA 4PLYA 4TL9A 1D5WA 2IHYA 1JTFA 2CVZA 3RIXA 2DQ4A 3RSSA 1R5ID 3J81k 3AF3A 1AGYA 4ASUA 1Q5PA 3UB3A 5HDKA 3WNVA 3CT4A 4ZQEA 5LXTB 4OXNA 3BTUA 3QLVA 2CW0F 1PJBA 2VJKA 4TKVA 3M49A 2XCSB 3EIHA 5C18A 2A9JA 5P21A 1A9ZA 1O5TA 5BUZA 2VR1A 2QUFA 1GT0C 4J3JA 1LTQA 3GT3A 3T34A 1KDTA 1WJFA 3FETA 4CFSA 3I54A 4Y0VA 4Q3KA 5CH8A 5ITZA 4GE3A 2ZUFA 3ZHXA 5EJ8A 4M60A 4UE6A 2NVQJ 5ALVA 1OCTC 4AJ9A 4TTQA 4BKOA 1W47A 3W7AA 2PUTA 3RHTA 4UTVA 3KOMA 3DE3X 3Q9LA 3A2NA 1J5EB 1A6IA 4P7KA 2KZVA 4O6JA 1S4MA 3MT0A 4FMCB 2L0XA 4UHHA 4L5BA 3WRWA 3EZLA 1AUXA 2P4UA 4RHYA 1KJIA 4BO6A 1EBUA 4ISBA 1Z45A 5BW8A 2GEVA 4EW1A 3I42A 1RHMA 3HMKA 5ERGB 4B3FX 1A2QA 1DC6A 3HY3A 4BGUA 2JFVA 4OMYA 1YW8A 2J9ZB 2NIPA 2OUKA 5AJHA 3VNBA 1NOIA 1YJXA 1ZU4A 1AGRA 1C80A 2FSFA 3KQVA 4HEJA 4RDUA 4BMSA 2J3JA 3N3AC 1MB3A 1CW2B 4D3ZA 3VDNB 2AG5A 4YY3B 3LHDA 4YH1A 3CC2I 2GBPA 5D7NA 2QPTA 5JWOA 2GJKA 3ZE2B 4OQYA 4AD9A 2P5LC 1HYEA 2YYAA 4KE7A 5EIBD 2D1SA 3WWDA 4DR5B 2EGGA 1QV7A 1CJBA 1Y6RA 4CLOA 4BXOA 2H9IA 4B2PA 4EIWA 2M34A 1XU9A 3RRNA 1T9GS 4AT1A 5AUPB 3F8NA 1K78B 2BFWA 1LSJA 1XZLA 1UWKA 3G73A 1YJ9I 1W4ZA 1Y81A 2J3KA 2V8BA 3HSSA 2F2EA 3PJDA 1QRYA 1HPLA 2RKWA 2ZBPA 4XIJA 1KDZA 3X1MA 3W8DA 4ARBA 2CJWA 2J0UB 3E81A 2IQ5A 4IHJA 4R0NA 3EOBI 4RU1A 4XARA 5CK4A 2CHEA 3WLNA 3TZ6A 4JEHA 5B6PA 4M4SA 4YDQA 1U2ZA 4R8SA 1R4AA 4EUEA 3FAKA 2WTBA 4WK6A 5KMGA 1M73E 4A9AA 2NZ2A 2R84A 4M74A 2CGPA 4UNNA 5EP2A 3GLHE 2XVXA 1DVRA 1Z16A 3FUVA 3TIFA 2OV4A 1G59A 1FTGA 1RWVA 4ZAVA 4Y9SA 1QYIA 4OHOA 3UPDA 4EQ6A 1RYZA 3T1TA 5CIYA 3IBYA 1GPUA 4NFSA 3IDZA 5CLJA 3NLLA 4EJVA 4FCYA 4GKJB 4K9NA 3AR7A 3CWCA 4N6NA 1SWVA 2VWGA 2FMUA 3B51X 2DHEA 3Q8MA 3ILXA 2IXTA 3R7WB 2FR1A 3VZDA 1T13A 5JVDB 1GADO 2GZMA 2XQKA 3L7OA 4TYNA 4D4HA 3L4JA 1DKNA 1QUEA 1RC0A 1Y4SA 1V1RB 4XB2A 3ZBQA 4UBMA 4JLDA 3GTLJ 4EMBA 1C9NA 1ESMA 5JJBA 2YWGA 3AFHA 1DJNA 3EQ6A 1FFEA 3SEAA 3NDPA 4F7WA 2C61A 4AKEA 1U0GA 3I8SA 2VEDA 4LWOA 2NZVG 2C2WA 4HXYA 4QEDA 1J4AA 3JXEA 5A03A 4DV0B 5KWJA 1A77A 1EK5A 4DDVA 2QPAA 3CZAA 3EC2A 4LRXA 2GXSA 2CBXA 5ED0A 3HSYA 1V54H 2ZIGA 3TD9A 3X3HA 2J0QA 2L2OA 4OPMA 1K89A 2MR5A 1IHPA 1CKEA 1D1QA 3D0OA 2VT7A 3LIIA 5ER6A 1E8MA 1YVUA 5C8XA 1SEVA 5D3QA 5AW1A 4N48A 4JS0A 4MGRA 3OLVA 4MI1A 2EHJA 3MTGA 4RPIA 4QA9A 1OB2A 1YR1A 1T4BA 4EHHA 2C2XA 1HKSA 4HQRA 2HFHA 4GPBA 3OQPA 1NLMA 2PL9A 2YWXA 2VNJA 1SQFA 5CA1B 2A84A 2XVYA 1KU9A 3CB2A 3QQAA 3DP7A 1RJ9B 4AF7A 4DV6B 3EVGA 3SKXA 1S9DA 2Q5CA 4WNAB 4B80A 1CCWA 5EE9A 3F8SA 3VR2A 3ZWAA 5EG0A 4WZAE 4F3YA 2PQ2A 3GROA 4AYTA 2MA3A 3HRKA 1W35A 4G86A 2QG6A 1KYYA 1LX6A 3CM0A 2X1VA 4YFYA 5JS1A 4L95C 1X80A 1UZAA 2C00A 2RDPA 2R1TA 3HDYA 3LVQE 3RLFA 3UENA 2YCLA 2AB0A 4RPGA 5JNVA 1U2DC 2WF7A 4PPYA 2KT0A 3RG8A 2MFZA 2BDTA 3VH2A 4D4MA 2J9GA 4EO9A 4UVBA 3PXXA 4FFBA 2GXUA 3FF1A 3Q9SA 3AIMA 4GSYA 4IOJA 3CDHA 1U9IC 5GGXA 1KU0A 1EUCB 3F8TA 2DDBA 1SA0A 3O84A 3THRA 4P92A 1G4HA 4EH1A 2CXPA 3CF0A 3KXPA 3FA2A 3L1PA 2ZUBA 2WYIA 3S99A 2H1FA 2OLEA 1PTJC 4RWEA 5BPDA 2DFPA 2W2QA 3N53A 4G5GA 2VYCA 3AVWA 2ATXA 4QHTA 1UZLA 4GFBA 3CPHA 1VYHA 4XX0B 5HQTA 3ZV7A 3GN1A 2FJUA 3KCNA 3KLOA 3V9AA 5DYWA 2AC4A 5EGSA 2GCPA 1ZJJA 3AJ8A 3L40A 2QBYA 1D6JA 4R6WA 3DTEA 4U2DA 5EXEA 3QVMA 2PMZN 1YE8A 5F33A 2V7FA 1AS0A 2WHXA 3R7WA 2GEUA 2QD2A 1DC5A 4O2BA 3TO7A 2DJ5A 5JSYA 3ZIAD 3HR4A 4NY1A 4IINA 3U4HA 4CF5A 1CZOA 3LWFA 2E4YA 3G89A 3PNSA 4TKUB 2P6OA 1A9PA 4HDSB 5B53A 1G38A 1TI7A 3AF2A 2WR8A 4PLZA 1DJLA 1FTNA 4WWHA 3FPEA 2NXNB 1JHPA 1FNSA 2QKMB 1AUPA 5BMVB 4HF2A 5DM4A 4IILA 1RUNA 4L7QA 5BUSA 1NW6A 4Q01A 5AVZA 5FPKA 3PVCA 3AG1H 3JTHA 3S93A 3PIOF 1LQ1A 3KSRA 4EHAA 2GHTA 4EG8A 3ZXIA 2COUA 4E7KA 3AQ4A 5THXA 4GECA 1L7DA 4POAA 2TECE 4GWKA 5K8UA 4P0PB 2R7WA 2P90A 1SKUA 1XK6A 4F84A 1A69A 2AJBA 1IRXA 1ZTRA 3UMRA 3IAHA 2ZMEA 3K1NA 2AOXA 4X65B 3S40A 3GBGA 3DNMA 1K4MA 3E35A 5DLEA 4BO3A 1EP2B 1PQYA 1QXSA 5LMUB 5DYYA 3AP3A 3QPVA 4PHFA 1T98A 3GA7A 4MVJM 4BYGA 3FZVA 1M1XB 1YZNA 2GAJA 4RULA 4TRNA 3LAWA 3W6OA 1AA6A 4CQLA 2YZMA 1QG6A 4JMLA 3LKVA 2FE3A 1IO2A 3CSSA 3SG0A 3K9QO 5H6RA 1L1QA 2NOAA 4JR1A 4V0KA 5BN1A 2I6FA 2NMVA 4KRYA 2VQEB 3B36A 4TGLA 4K0RA 1E5DA 1TU4A 1UWVA 2ETVA 5AW0A 1HDZA 3I3SR 4EJOA 2WYOA 2BXYA 1TAQA 3EUAA 2OV2A 3FHZA 1J8YF 1QH0A 2P27A 2R00A 3ZQGA 3K7AJ 4AZWA 3EQ9A 3IAUA 1OBHA 4NEHB 2Q2NA 2Y1KA 3F2VA 3NX4A 1QE5A 1P0QA 5A1JA 4RABA 1NE7A 2JFFA 3DR5A 1NWHA 1IRIA 4N54A 5IN5A 1SVSA 5H70A 3H1EA 3A1TA 3HVKA 2D0PB 3EGDA 4D57A 1U2QA 2WI8A 3TW0A 2ESHA 3HUGB 4B09A 2FXVA 2IIPA 2VTDA 3QVJA 4FJ1A 3S55A 2LBFB 3RABA 4ACBA 1L5QA 1U7ZA 3U19A 5BW4A 4WCFC 1KF0A 2ZE7A 4IKFA 4A3IJ 4GZ6A 3TSWA 4O63O 3IV7A 5DYGA 1XSEA 4JXZA 5COBA 3OYEA 4HDNB 2D59A 1JBQA 8ABPA 2VJLA 7REQB 2XAUA 2ZI7A 1MJGA 1EH6A 5HJ2A 3KAPA 1ZA2A 2XVMA 4FFPA 1EDZA 1L8QA 2O2XA 4BX2A 4NMWA 3Q2KA 3WIUA 1B0AA 2GK7A 3BJMA 4E5KA 3RDPA 4QZVA 5I4IA 3CKMA 1NTOA 3WL5A 2J9YB 3FBNB 4RA9A 4DQ0A 1TUBB 3KP5A 10MHA 4BLOA 2QD4A 1K7EB 4FQGA 5HS8A 2C59A 4ANJA 1W5SA 3HQ4O 3B6MA 3KL2A 4F3KA 1U63A 2NXWA 6Q21A 2BCJQ 2D1RA 3T4EA 3NBXX 4KXLA 3IHTA 4M8IA 4AS3A 1G2HA 4MEYF 1W73A 1O3YA 3O94A 3Q3GE 4LIPD 3SMQA 2RGUA 1MCZA 3GJXC 1IM5A 4GXQA 5ENDA 2RIRA 4YLYA 1R0ZA 3PDIB 1VJDA 2FU5C 2JVJA 3GG2A 4CCOA 2FJ0A 3L8EA 4YO8A 3VHXA 1DC4A 5EOVA 1L7NA 2LKCA 2VUUA 1MMDA 1VHQA 3UJ6A 3TQCA 3S1LA 3VMMA 3PEFA 3LUCA 3ETHA 4EKDA 5EAIA 4RV4A 4S35A 1XB4A 1X7YB 3BSFA 3GUUA 2VA8A 2X40A 3RKUA 4UDXX 1XU7A 2JEOA 4FFRA 4IDBA 1FTSA 2OHXA 1C81A 4R2XA 4H1WA 5BT8A 2EJUA 1GZ5A 2DTEA 3U4GA 4BE2A 1Q0HA 3TM4A 1JIJA 2R5YB 2X13A 4ALLA 1H5UA 4E4YA 3AHDA 3FLMA 1NDUA 3GVHA 2CEKA 4UHCA 3GJ3A 1Y39A 5DZSA 2X9GA 5KNBD 4OFBA 2DC1A 4GX2A 1TMOA 4PTZA 1QPMA 3U56A 2FMYA 1PKEA 3FHTA 1OR7C 2NZ8A 421PA 1Z9CA 4DTCA 4FOPA 1AX9A 1T9GR 4FHCA 3RVJA 4DS3A 2W5UA 1B1AA 2IGMA 3IUJA 4ROTA 5FTMA 3RIHA 4BFWA 3QVUA 4B45A 4BZZA 2B69A 2DGDA 2P41A 3KUUA 1XL0A 3C6BA 3QI7A 4JKOA 3TE7A 3ZWWA 5I7EA 1A3CA 4UUBA 1PD0A 3SBDA 5C5DA 4CTNA 4G6TB 3MTEA 2FOWA 4F93B 3AWIA 4OYLA 1CY0A 5B4TA <