4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
1QAMA 1KP9A 2ZCWA 4LK1F 3MERA 1WS6A 1R8XA 2AXLA 1ONVA 3FPEA 4YFXF 3TKYA 3DMHA 1XJ5A 2VE8A 3T5XA 2RDPA 4RB1A 2OZUA 4IHSA 1XGOA 3THRA 3F72A 3F8NA 3FYDA 1FX7A 2P7IA 3I64A 3HA5A 3HCCA 2ISZA 5EMMA 5E1OA 4HGYA 5HEKA 3HSEA 5LRRA 5T64A 2ZBRA 1ODDA 3DMGA 3CGGA 3IWZA 2HQRA 1XTPA 3IHTA 5ILUA 2Q8KA 3J7AO 4HOBA 5LHGA 2F5FA 4U7TB 3BJ6A 1RI7A 1X1DA 5E2AA 1RI2A 1R1TA 2PMUA 1JQDA 1R6AA 1DL5A 5EKXA 2FK8A 4HLYA 3T0IA 3P2EA 4EGZA 1K79A 4LG0B 2IW5A 3FTFA 1RI1A 3ZP5A 1GHCA 1F9NA 3B3JA 3A7DA 3A7EA 1LDJA 1TTYA 3V8JA 4CO8A 1RZ4A 1K78B 2MBFA 3EETA 1CF7A 3MFKA 3QRFF 5CM2Z 3I9FA 2QY6A 2FNPA 2ZNZA 4YUZA 1D2HA 3QAHA 3MCZA 3KR0A 3QOWA 2DI3A 3GUDA 3CJNA 1KU2A 4AZWA 2P8JA 2ZZMA 2K7LA 1ZAOA 2JPBA 2IH2A 5FLXK 1DP7P 3THSA 4DM3A 2NP6A 2KJBA 1IZ1A 2PVCA 2AZTA 1O57A 3I0TA 3AY0A 1MD0A 3V97A 4C4AA 1O3QA 3GCZA 2TDXA 4Y15A 3ORHA 4M6XA 1MJFA 4P7GA 1FPQA 2CFXA 4KT5C 1BI2A 2OYRA 1R8YA 4B17A 1G3YA 2RV8A 5D6EA 1RI3A 1VBFA 4PCAA 3DPLC 3JWJA 2R6ZA 2O0YA 3RW9A 5FFZA 1F4KA 3L2CA 3OCJA 2A69F 2B78A 1NV8A 1QPMA 4AIKA 5DTRA 4EQZA 2VBYA 3VSEA 2VDVE 2AN3A 2IIPA 2CL5A 3ELWA 3G73A 1G60A 3ML6A 4Q4ZF 4I01A 4I98B 4AZVA 2XV4S 1AV6A 2M30A 1G4DA 3DULA 4YFNF 2Y75A 2YXEA 1CF7B 3FUVA 3L8DA 1FNNA 3ELYA 1ZHFA 2CMGA 3KQSA 2NXCA 4KMUX 3EGIA 2P4WA 3HCEA 2HS5A 2PV0A 4MQ9F 3EVBA 1HKTA 1XGSA 3RDIA 9MHTA 3UJAA 2VONA 3LFKA 2JHAA 7MHTA 2W85A 5E8GA 3PX3A 5U4XA 1P91A 1F3LA 3GFMA 2GB4A 4P9FA 2V1DA 3SVZA 5D5VB 2EFJA 3LDGA 3NW9A 2H00A 1JTEA 3WGIA 1D8JA 1KHHA 2HWVA 2XKPA 5JI6A 3BDDA 4PIMA 1I27A 2D2WA 5H20A 2PX5A 4IPAA 5HLHA 1IXSB 2HZTA 3I53A 1XD7A 4GO1A 1O7LA 4OIQF 2YR0A 3QP6A 1FOKA 3FTCA 4DMGA 5LLQA 3H2BA 2PJPA 1V39A 5F6FA 5CVIA 5ICGA 1K7AA 1RJDA 2GAFA 1XSDA 1JE8A 4A0ZA 4R8SA 2E7WA 4L0ZB 5D1NA 2EA2A 1DDNA 3IHUA 4PGGA 4OA8A 5GINE 4QTUB 3JSOA 2OZ6A 4OINF 3NMUF 4GCVA 1HKQA 1JSZA 2LF7A 3SZTA 1IRGA 2BR4A 3KZYA 5LGUA 3JAMK 1ZGJA 2MLGA 3ZMDA 1OPCA 4A12A 1TNTA 4C03A 2M45A 5L3GA 2VBWA 5EG5A 1JTFA 3RTRA 5EMLA 1D2CA 3P2KA 5H02A 1HXDA 5DCMA 4TV7A 2UYHA 3JWGA 2Q41A 3M4XA 2STWA 2IA0A 1ZRDA 3CJRA 5B1SA 4BHBA 2IRFG 1YUBA 2BYVE 2JZYA 1B9NA 4O3MA 4IRHA 3FMRA 3Q7EA 2OB2A 3LGAA 2UYOA 2FHPA 2B9EA 5HIKA 5K0LA 4BLUA 5A2QZ 1KA8A 3EYIA 2IBTA 4HGZA 2HKOA 4UHTA 3G88A 4L9NA 2AVDA 1LDDA 2FOKA 4HV5A 5DXJA 1R5GA 2IA1A 2LDUA 3MZHA 4L0YB 3GVAA 5J8FA 2LF8A 1HQCA 5FO5A 1M6EX 2AVNA 4E30A 5FWDA 1YYVA 4GBED 1NW3A 5DM2A 3BROA 1LDKB 4KA4A 1NT2A 3V7SA 4Y17A 3R60A 2QWWA 3KP3A 3C1DA 3G7UA 1I6XA 4EKGA 5K0FA 3L09A 4UVAA 1T6SA 1W7PD 5FHRA 4G7HF 4OBWA 2Z3YA 4MIKA 5DXAA 1YS7A 4Q47A 4E2YA 2A3SA 1QANA 5FA5A 2K02A 4CKEA 4RTPA 4UV9A 3E6DA 3GLXA 2FYTA 2IH4A 1Z7UA 2HQNA 1KPGA 4L5IA 4HQEA 1HW5A 1IN4A 3PS9A 2XROA 2IDJA 5DX1A 2DFIA 1IN5A 4M6YA 2OKCA 2ISYA 5DCMB 2EFQA 3KQTA 1SVUA 4LGWA 3KZZA 1M6YA 4LJZF 2D1HA 2VZ9A 4A0YA 1TQIA 2P5VA 1Q1HA 5IH3A 3HSFA 2EK5A 1B4AA 3K0BA 2OD5A 2P1DA 2DULA 3P9KA 1L3CA 3H92A 5BQTA 3HUGA 3FWEA 2AS0A 5HLGA 3GRZA 2QE6A 5EMKA 1S3JA 2BGCA 4PZJA 1W5TA 1YIOA 3HCFA 1EQAA 5DX0A 2W84A 5E1WA 3E6MA 3WTWC 2ZXJA 1JG3A 2PLYA 1USTA 4HF0A 2GA1A 5IT9K 3B73A 1NW5A 5BOXA 4RAZA 3DTNA 4E2ZA 1FWZA 3M8FA 4XUDA 5HS8A 1X1CA 2DU9A 1ZH5A 3HEMA 2ZZNA 5CD1A 3V8VA 1ZREA 3BZBA 4U88A 4UNOA 3DXXA 4U7DA 3QV2A 3RKYA 2QZ8A 2PXAA 3SHFA 3BP8A 3IKTA 3G2PA 2A68F 4RB3C 4OMZA 1M0EA 4WVLA 4PYMA 3RI4A 2HYFA 1H9GA 2E1CA 4CXFA 2GA2A 3KLOA 4G8XA 2NYUA 5EKUA 4LB6B 5EIFA 4XBFA 3ZQ7A 2GXBA 2AOTA 3OZSA 1O9HA 4EVIA 3LQQA 4NHJA 2I62A 4CKBA 3JTGA 1WXWA 2ETHA 3DR5A 4FS8A 3O6BB 2BZGA 3U1DA 1BHJA 3NVMB 1ZQ9A 4YV1A 1J5YA 3ELDA 2BR3A 2ZZKA 4G7ZF 5LHIA 3E05A 3K6RA 4FZVA 4R6WA 4C08A 3BKWA 5EEGA 2WA1A 1JHHA 3HRSA 2BM9A 3KPUA 5F64A 3R61A 3G3ZA 4HF1A 3BGIA 3B3GA 3SXYA 2Z33A 1XCJA 5K05A 5KS2A 1ORHA 2ZIGA 5E18F 3C0KA 2BV6A 3NWEA 4FSDA 3N97A 3EVFA 4K6MA 2L54A 3T7RA 2V9VA 2B0LA 3CTAA 4X63A 4AX8A 5M5BA 3ER8A 1Z6TA 1ZRFA 1XN7A 4RTOA 1YW9A 1VP9A 5HZMA 2ZCJA 1BI1A 5J8CA 3TR6A 4MEXF 3FUXA 2V74B 1D2GA 4I7HA 3E6BA 4FR0A 2K27A 2OQRA 2AOUA 5F2KA 3C3PA 4EM1A 5DX8A 4AZTA 4CZZA 2NP7A 2ZBKA 3BPVA 4XUEA 4X61A 2YSRA 2M87A 5E1XA 3KQYA 5D4RA 4PYJA 3LX6A 2W25A 4HW0A 1HW1A 4A2UA 2PXXA 2XAGA 5K5RA 3GXOA 3COAC 3F4KA 1IN8A 4WF2A 4DA4A 3BXOA 3EVGA 3SGLA 3PB3A 3GFLA 2ZWVA 1KQ8A 4ZZDA 2O3FA 3E5XA 3G8BA 1EH6A 2P7HA 4M9SA 2A61A 5K0BA 1G8AA 5L3BA 3A27A 1P39A 3EYYA 1JXSA 1SKMA 3ULQB 5CCBA 3ZPLA 3GZ5A 3H3ZA 2WK1A 4GQBA 3WE3A 3FF5A 2PBFA 3EVDA 4CXMA 2VOPA 3M6WA 5GIOE 4AD9A 1XB4A 3I54A 3GZ6A 4HTFA 1U5TC 4RGSA 3OZRA 3LBYA 3OU2A 3EQLF 3CDHA 2XYRA 5LGTA 3BY6A 2PN6A 1Y8CA 2KIUA 5D8LB 1PP8F 1KR5A 1FP2A 3K2ZA 2JHCA 3D5LA 1ZG3A 2PWPA 1YG2A 2AOUB 2Y1XA 3CUQA 4M9ZA 3K1MA 2QM3A 2DBBA 3HIFA 1XGNA 5K5QA 2JTVA 4L18B 3S68A 4MNUA 3D0SA 1ZG1A 4CKCA 3DFGA 1IXKA 3F21A 1YFLA 5HDGA 4AUKA 1HBXG 2EX4A 3KPYA 4HDVA 3Q9SA 4OOIA 4IKPA 4NB5A 1FT9A 5J6XA 3K0LA 4IXAA 4U0WA 3V7RA 3FUUA 5D1HA 2E5WA 5EOVA 2UWMA 5CVVA 5DWQA 5K0GA 2YX4A 3LSTA 2OPBA 1E2XA 3UJ8A 5CVDA 3MB5A 1TQPA 2IJLA 5ERGB 5FUBA 1XCBA 1T38A 3R0QA 3M1EA 3GDHA 3RIRA 2CGPA 1P92A 2YX7A 4ER5A 4D0PA 4DQ0A 1ULYA 3DUWA 4BYYA 4HTFB 4HX8A 3CUQC 2G71A 3HOTA 1WZNA 2PSSA 3KKZA 2LKPA 4JXJA 3SX0A 3CKKA 2RNJA 1R74A 1EJ0A 1RNLA 2AOXA 1P4AA 1OMIA 1RUNA 2C7RA 2XASA 2VS1A 3SR4A 1PJZA 2P6TA 3CUQB 2VDWA 2NXEA 3NWBA 3FTEA 3DP7A 1SFUA 3HA3A 1YZHA 1JQ3A 2FRXA 2M1BA 3M33A 3T8RA 4LECA 2QLZA 4KDPA 1LQ1A 4R8RA 1RI4A 1FBQA 3LL7A 4LWOA 1UHMA 1RUOA 1QNTA 2A6HF 2P40A 4WXDA 4A5MA 4ZH4F 1G8SA 1T0FA 1B9MA 5BW4A 4JQFA 1FBSA 3MGGA 4XRFA 2OBFA 2IA2A 4GOMD 2ZSUA 3BJOA 5LSAA 2P6SA 4U7PB 2VT2A 3KQWA 6PAXA 3DQVC 2GQQA 3M9AA 1Q0SA 3BWGA 1MZBA 5FGMA 1J9IA 3P9CA 5A2QK 4G9YA 5HOOA 1REPC 2IT0A 4NECA 2VN2A 5DDGA 3GRRA 4UXNA 2EFOA 1FLIA 2ZTHA 4G56A 4HSGA 1OYYA 1B1BA 2ZNYA 4DNCA 2IP2A 3FUTA 2M5WA 2F5CA 4JBAA 4YFKF 3HTSB 3E6CC 5FB2A 4P7KA 1J0RA 5K0EA 2AR0A 2Z6AA 3G8AA 3T7SA 4M7RA 1JG2A 3ISPA 1SMYF 2X4HA 2HOEA 4LB5A 3J80Z 10MHA 3FRHA 5KVRA 3E23A 2OBPA 2NRAC 1T2KA 3HVIA 1BM9A 3DOUA 2R3SA 1NBIA 2OA4A 4EM0B 4KIBA 4YV0A 4OIRF 1BKYA 2HTJA 5EIWA 3G2QA 1OR7A 4CTKA 3KR9A 2JT1A 1VQ1A 1VPTA 3F8MA 1VE3A 1NE2A 3D2LA 4F86A 1PRYA 2HR3A 4GXOA 1YS6A 1KQ0A 3L9FA 3KEQA 4Q5SF 4GYIA 2PI0A 1J7KA 4ATNA 2EV5A 1XMAA 3KEOA 4R05A 3B5IA 3ROUA 1SQFA 3R3HA 2JPCA 5TJJA 4RTRA 1LEAA 2YR2A 4OBXA 3LA3A 1VTNC 4LFUA 4PYOA 2O06A 2DPMA 4MWZA 3VC2A 4RTKA 3PTAA 2K4JA 1KQ9A 5D5XB 3TLJA 2C7PA 4P58A 2O07A 5T67A 5EPEA 4UVCA 1O3SA 1BI0A 1YO5C 3WTVC 3J81Z 3OFKA 4OX9Y 2IGTA 5HLIA 1DUSA 1BOOA 3GRUA 4CWAA 3PFIA 1XVAA 4I09A 3KQMA 1T43A 4GF5A 1J2XA 4Y13A 3JSPA 2ZFUA 5FD6A 4KRGA 1KGSA 3RIEA 4IWNA 2H6BA 4EJOA 3O7WA 2XRNA 3KP2A 5DSXA 4ZTBA 4XUCA 5H6QA 1SFXA 4EMSA 2HDCA 2ZWAA 5CVEA 1XDZA 2J5PA 1AOYA 3KCCA 1HKSA 3NQOA 2QQ9A 3BWCA 4HC4A 1S8NA 4EQQA 1H1DA 1RI5A 4P96A 4WX9A 1DUXC 5DM1A 3PVCA 1FP1D 4WK8F 3VB2A 1QAOA 1XCLA 2ZO4A 1FZPB 1SG9A 5EEHA 4HF2A 5HS7A 2FNAA 5K8VA 2C7QA 4RVGA 3WU0A 4YV2A 4LMYA 2AOVA 5DUIA 2UYCA 1QO0D 4MQ4A 4N9HA 1I4WA 5GP1A 2YVLA 5BP7A 2L3DA 5JR3A 2UZ4A 1FBUA 1J75A 5LRSA 2C7OA 1P2FA 2FPOA 4Y30A 2IVMA 3E8SA 3EVCA 4RTQA 3UJDA 2Q0OA 3I58A 2ZLBA 1R7JA 2XAQA 3KR2A 1R18A 3FXRA 5IKMA 4HA8A 1XSXA 3F6VA 5GM1A 3PX2A 2D1VA 5DM0A 2K4BA 1TNSA 2OXTA 2H27A 4IV0A 1I1NA 2XKOA 4CDGA 4LG1A 5CIYA 1G6NA 3GU3A 3HTXA 1W5SA 1U2ZA 3AJDA 2GWRA 1TBXA 1BN5A 1XSVA 4FSXA 3BWBA 2H09A 4PGHA 1KU3A 4QVKA 1O7FA 2D45A 1R5HA 3G2OA 3ID6C 5DUKA 4GOLD 2X0LA 2Y0MA 2PX4A 5L3CA 2OU2A 1XGMA 3O3KA 3GFIA 5E1DA 3HA7A 3F8CA 4PONA 3BUSA 4BH9A 5K01A 3V8KA 2UXNA 2ZIFA 1STZA 4IVNA 2FBKA 3ZMUA 2GIVA 4XSXF 1WY7A 1ON2A 3V7CA 4KIGA 3SZPA 3ERCA 2ZBQA 3FPGA 1ZG5A 2G9WA 4PYQA 2NYXA 3CJQA 3DXZA 4EM2A 5EZSA 4UV8A 2JSCA 2HTSA 3BWYA 5IT3A 5TRDA 5JFRA 4LLNA 1NV9A 1HMYA 2J5OA 2HMYB 1R36A 2WA2A 5ILVA 5BXYA 3TFWA 5DLYA 3RYRA 1R00A 3CLOA 3OFJA 1ZLKA 3LKDA 2BR5A 3HNRA 3REOA 2PFBA 3SFZA 4BY9E 4MQVA 1IM8A 1L3IA 2BM8A 4RVHA 5CJ9A 3GFJA 2OZVA 5HVQC 5P8WA 3HTUA 3HCDA 1G38A 1YQAA 3CO6C 4PYLA 2KRFA 2ESNA 3M7GA 1KU7A 2E1NA 4Y2HA 4V0QA 2PLWA 1DPUA 5E1MA 3HSRA 2PY6A 2V1UA 2QUFA 3QOXA 2OY0A 3IEIA 3OE4A 2MH9A 1P6RA 1F38A 2EFPA 4KMFA 5LQCA 3UFBA 2PEXA 3C7JA 2QENA 4YUYA 5D6FA 4BAYA 1XDSA 2DK5A 4EGYA 5E1ZB 3AXSA 3NVKI 4ESJA 1OR8A 2EJRA 3MWMA 4MHGA 3EUHA 3GX4X 1EJ6A 3LKZA 2ZVJA 1S6LA 4QQKA 2ZIEA 2Z9OA 3GIWA 1S29A 3UBTA 2MLKA 1V3FA 2F5EA 3P8ZA 4E31A 2C6YA 3PFHA 1BC5A 3M70A 2YXDA 2F2EA 4IRGA 5D8KB 3HHHA 2XVAA 3E7PA 4LWPA 2VC0A 4MGRA 2ADMA 3A25A 3F23A 3IL2A 2G7UA 2P7VB 5C0OE 2OQGA 2XVCA 1EV7A 3TPZA 3ERED 3FM3A 4N9IA 1EIZA 2XUBA 2L02A 4A6DA 4PINA 1BI3A 1UHWA 3R4KA 1U8RA 1I1GA 2ZMEA 3LBFA 4YMHA 2G8NA 3HOSA 3WTZA 3G2MA 4G6DA 1X3UA 5LQKA 1G3TA 5T6BA 3EVEA 2I9KA 1WI9A 4EJVA 4QLCU 1JG1A 2IDKA 4O29A 3TO9A 3NRVA 1I5ZA 3W6KB 3R0JA 3E5QA 2PT9A 1SD4A 1LEBA 4WWCA 1BC7C 4HYEA 4BHPA 3WTTC 1VIDA 3KP7A 1TLHB 2RKHA 2WTEA 1NW7A 4I0AA 3B02A 2UYQA 2XAFA 3PT9A 1SQGA 2KW5A 3DH0A 1FSEA 4RTJA 3DMFA 1Z3CA 4RGXA 1PDNC 2VODA 3KU1A 3QU3A 2FU4A 4O6JA 4R1HA 3DXJF 3IV6A 1OYWA 2N47A 3PQKA 3HRMA 2ZFWA 1WQ2A 1R58A 3R0AA 3CVOA 5HOQA 2XYQA 2MA3A 5K5OA 2DTRA 1VP3A 2OB1A 1R1VA 4KW7A 4H0EA 4E2WA 1SMTA 4HDUA 3OZTA 4V0RA 3K1NA 5BW5A 5K0NA 4BLWA 1NHAA 2NNNA 5DCFA 3MAJA 2JRTA 1KYZA 2V6CA 3HRUA 2CSOA 5FHQA 2KJCA 1P4XA 2ZMEB 3RPQA 1T98A 4BXUA 3U81A 3FMSA 3FHZA 2L01A 1U6GA 4PNEA 3PQJA 3FXQA 1FY7A 3KLNA 2FMLA 3ZMZA 5LEJA 3CUOA 3CJTA 4NQWA 4BP3A 5F1RA 1JGSA 5HDNA 5K03A 4P55A 1FSHA 3GF2A 4FT2A 1J59A 3KR1A 3J80K 4E33A 1D8KA 2HWKA 2Z6QA 4HRAA 3WODF 3EDPA 3VYWA 2EV0A 4X41A 5FQOA 3SXJA 1AWCA 3C6KA 1X1AA 1MJAA 4HBLA 2QRVA 5E8IA 1VL5A 5KK1A 3WG9A 1JQEA 3BPXA 4E70A 5CLSA 1YF3A 3HVHA 4HZFA 1JSXA 1PP7U 1YLFA 4I02A 3KPVA 5ERIA 3H3UA 5HS9A 4IRIA 2JJQA 3M6XA 4G7OF 1YW8A 3SSNA 3GJYA 4GUAA 2MH2A 5AIPA 2ONZA 3F6OA 2DAOA 1UCRA 2O0LA 2P3OA 4RVFA 4U0YA 5HIMA 3KQOA 2QYOA 1N7JA 1FYKA 5BS6A 3P71T 2V7EA 2Y48A 4OMYA 5HFJA 3TQNA 4K2EA 3T7TA 3MTIA 3KP6A 2ADUA 4LD5A 5JVTA 3NTVA 4EJTA 3DLIA 4QDJA 4PCQA 4ER0A 3Q9VA 3J81K 2DW4A 2VBZA 3MZYA 3BGVA 2A07F 4CICA 4RGUA 3RKWA 3B89A 3M6VA 4FT8A 3T1BA 1UIRA 2P5KA 4U0VA 2ONYA 1N2XA 3OPNA 2GZWA 4CHUA 2QRVB 1NW6A 2LSOA 3SSMA 3TM5A 1R1UA 3R6TA 3E5UA 3GEZA 3WGHA 2YPRA 3I5UA 3O31A 3CC8A 5FCDA 4ON0A 5DEQA 4O5VA 2P8TA 4RTLA 4ENMA 1I9GA 2XBMA 4RX1A 3QP5A 1MDMA 3OV8A 5EMJA 5K0JA 5LHHA 2DPUA 2P3LA 4HQMA 4ZZLA 2OO3A 2VE9A 4FX4A 3W6JB 3TM4A 3DPTA 4CYDA 4DCMA 3R9XB 5F2OA 3F3XA 4ESBA 5ICFA 3BOQA 1QYRA 5EVJA 3TOBA 1KPHA 2FF4A 4UVBA 3ELUA 4XCXA 1GVJA 5ICCA 4M37A 1CGPA 3K1PA 2XGXA 3EVAA 1XMKA 3GO4A 1O54A 4G94A 4RB2C 4RS8A 2HGCA 1SD7A 1TW2A 4M72A 2PQ8A 2P3QA 2GLUA 1BBYA 3KP5A 5AONA 4C04A 1HW2A 1UB9A 2G70A 5K09A 4Q48A 2YQZA 3KPJA 4AZSA 2VOOA 2ELHA 3F8FA 5K0CA 4X60A 1R22A 2QQAA 2MC3A 1YB2A 5E9QA 2DT5A 2L4AA 1NKVA 4L7VA 3DXYA 3EEOA 3HHGA 3UA4A 2FMYA 4IHTA 3MQ0A 3ZMVA 2PGXA 2JH8A 2PXCA 3BJAA 2W57A 1MDMB 3O4FA 3P9NA 4M38A 2XIGA 4PWYA 5MHTA 3HVJA 2F5DA 2DLLA 2ESHA 4BHCA 3P7NA 3LCCA 3K9TA 2G7HA 2HEOA 3VEPA 3DV8A 1LB2A 5EGSA 2WC2A 2FEZA 3QOPA 2P41A 2CO5A 1WWXA 5KYGA 1D5VA 2PX2A 3UJBA 3V8LA 1B42A 5CVRA 3QPHA 5AIQA 3IRQA 2EB7A 5FWAA 1G3SA 3N4MA 1HSJA 3HM2A 3WTUC 5KVAA 4BQAA 5LGNA 1EH7A 2CQKA 4ESFA 2PJDA 4MTEA 2JHPA 2FK7A 3HCAA 4R79A 3PFGA 3A4TA 4RAYA 1R23A 4ZYGA 3RPUA 2EA4A 2YU3A 3M8EA 5ILSA 3HCBA 1ZGAA 4R8HA 1YTYA 1IF1A 1UFKA 2VDUE 4KWCA 3KPWA 3I4PA 3JW4A 3G5TA 4P9UA 3FPJA 4P7FA 3OE5A 4L9VA 4FT4A 3UJ6A 1IW7F 4RVDA 2ZBPA 1P4WA 4IJAA 1EH8A 4PCLA 2DK8A 4F84A 4R6XA 5LQRA 2IPQX 3ABUA 5KQRA 1ZN2A 1VLMA 2R7FA 4ENJA 5CVUA 1QBJA 4RWZA 4KIFA 1MGTA 1TPYA 2HKXA 1X1BA 2K86A 1L3LA 3PLAE 4ENNA 4ENKA 2QVOA 4XSZF 2BE5F 2CKDA 2EV6A 3C18A 1XCVA 1HSTA 3TOSA 1ZKDA 4KFCA 4PYKA 2KIMA 2FBHA 2RN7A 2VXZA 2HTEA 2IPXA 3AWIA 3FPFA 2E7XA 2VP3A 5FQNA 4MHTA 3UWPA 2FXAA 5E9WA 1Y0UA 5JUWA 2CG4A 2HNKA 1TW3A 2ZJ2A 2O61A 5E2BA 3DEUA 5ICEA 3GW2A 2COMA 3EEYA 2FE3A 3LAPA 4HH4A 4C05A 5DSTA 5EHIA 2WV0A 4HG2A 3VODA 2NXNA 3FX3A 3ELKA 4XLPF 4GYGA 2H6CA 2RGVA 4OQEA 5GWXA 3TRKA 1G55A 3JWHA 4PYNA 2PBIA 5FFXA 1KIAA 3C3WA 5C1IA 1MJBA 3OU7A 4FX0A 1Z05A 4IV8A 3FYCA 3GGDA 4E32A 3BWMA 3WU1B 1ZYRF 4GOOD 2G1PA 5DTMA 3ANXA 5HDKA 4RSRA 5LQJA 2O05A 1JG4A 3WTXC 4YG2F 1YW7A 3ZN1A 5GIPE 4HAMA 1XDUA 1ORIA 3GO5A 1BC8C 4FHTA 1IXCA 1HNNA 1BIAA 4GOND 3WTYC 3TO7A 5DD8A 4QQNA 2JG3A 2QBYA 5E17F 3LHDA 3DLCA 3NJRA 3JWIA 3LQRA 2IFTA 3TO6A 3SQNA 4QPPA 4OA5A 4Z2YA 2YXLA 2BEOA 2P7CB 4F7ZA 2FQ3A 1YZ3A 1NBHA 4MTLA 4RGRA 1RJFA 2ORED 1GXQA 5FA8A 2G72A 5D5UB 2A14A 3A26A 5LQUA 3GWZA 2YUIA 4KUMA 2GH1A 1BOAA 4KICA 4AIHA 3OU6A 1QGPA 2YTZA 3WE2A 3AXTA 4LLGF 2HR1A 2NXJA 2ERCA 3ECHA 5L3EA 2HFHA 2BBYA 1O3TA 2PG4A 5GOZA 3WTSC 2W24A 4ZYEA 1ON1A 5FTWA 2NNYA 3QPTA 2FSWA 3LPMA 5CYVA 5JHUA 3EGEA 3P2IA 2PKWA 1D3YA 1Z6RA 2DO7A 3FXUA 1U2WA 3E97A 2FBIA 2H1RA 2I7CA 4OIOF 4ASNA 3SMQA 2K4MA 1C0WA 5F2NA 4EKIA 1IN6A 5DD4A 4YIIA 1WG8A 4QVGA 4UUVA 1P1BA 1IN7A 5FULA 3LAJA 2FCAA 2QBYB 5DTQA 2R7DA 1L9KA 5EQJB 1AF7A 4M9XA 3TMAA 4WXCA 3MEXA 1QAQA 4FGZA 4RB0A 5LEKA 4U7BA 3KQQA 5DRTA 1IUYA 1QZYA 3Q87B 3Q5FA 2EJUA 3K69A 2IBSA 5E8RA 4MEYF 1SAXA 3HVKA 2LNBA 2VT3A 5EHGA 5LR6A 3KE2A 4HX7A 2NAZA 3QU6A 4EJUA 4S05A 4PIPA 2RVCA 3FPHA 3KFWX 2DPDA 1QQIA 4B8XA 4G6QA 1A04A 2CWEA 4P5OA 1NW8A 1SFEA 2M8EA 1UWVA 3FM5A 2AN4A 2XVMA 3L00A 4AVPA 3EMDA 4XLNF 2RC4A 1SD5A 3TOAA 2CMHA 3AAFA 3GRYA 2WWYA 4E2XA 2ZKZA 2EJTA 4RV9A 1LJ9A 4OQDA 2ZW9A 2GS9A 2GA9A 1L0OC 3HRTA 1FC3A 4HV6A 5CCXA 1GXPA 4BNCA 2GPYA 5L3FA 2Z6UA 3RYPA 3HP7A 4KN4X 3U9GA 4DQ2A 3IRRA 2PX8A 2HYGD 2YX1A 1H0MA 5BPIA 4ER6A 3FZVA 2H11A 5FLXZ 4JK1X 5BPDA 3LWFA 2NNWB 4L5JA 1WRJA 5FADA 4M73A 1IXRC 4PYIA 3MCTA 3UJ9A 3MTEA 2UXXA 2GAUA 4BLVA 4C06A 1WKMA 3LA2A 1W7PA 5DYMA 4ER7A 3UA3A 4A0XA 1WXXA 4F85A 2UZKA 5LQAA 1ZRCA 5E8JA 2MD5A 3NEUA 3EPPA 4KVZA 4DKJA 4EV0A 5KQSA 1DCTA 4M71A 3S2WA 1YFJA 1KU9A 2XAHA 5ED4A 1I1SA 3RKXA 4B09A 5HIJA 1FYLA 1RJGA 2EFNA 1ZARA 3MHTA 3P9IA 4OU0A 4WCGA 4PDKA 1LVAA 3ER9A 3M6UA 1IY9A 3L7WA 3TQSA 3LECA 2A5YB 5GM2A 4QPNA 4KYWA 1U78A 2DQLA 3C6MA 1L1EA 3FRIA 4ISCA 1USSA 1S7AA 4GC5A 4KN7X 4N0BA 2BH2A 4CTJA 1G6Q1 3BGDA 4RYLA 5FD5A 2I6GA 2A6EF 4P7JA 3NDIA 2EG5A 3FUWA 4WXHA 2JH9A 2OAZA 2CWWA 2IH5A 3ZMSA 4A5NA 4QTTB 3I59A 1JHFA 2EWNA 2CW0F 4AIJA 3R24A 4L9TA 2QQBA 1Z9CA 1JR4A 1W7PB 3TDUC 3BKXA 4POOA 4HX4A 1BJAA 1SD6A 1LNWA 4CGZA 1KYWA 3F8BA 1O9GA 1P1CA 2AS5F 5DT2A 3B7PA 3P97A 2HV9A 3SM3A 3VC1A 3X0DA 3NDJA 1X19A 3VFZA 1MJ9A 4KNYA 4QDKA 1N7IA 2PMHA 1Z91A 3GRVA 3JAMZ 2RQPA 3DKWA 5EZQA 5G02A 4M74A 1U5TA 5DV5A 3WGGA 4GGGA 1TQMA 4DZRA 3WSTA 1O3RA 2AOTB 1DPRA 1W4MA 4HLXA 5DRYA 3E3VA 3KQPA 5D5WB 2F8LA 5E20A 4ER3A 4QWQA 1BIBA 4I0BA 1V4RA 3IC7A 2ESRA 1T39A 5D4SA 5LBQA 5DM4A 4I2OA 3LDFA 2PT6A 3FMQA 3T0YA 5HIIA 2KIFA 3MAGA 5K1YA 2Q2EA 1QZZA 3LDUA 3I59B 3DF8A 1AQJA 4LLLA 3EGVA 5HILA 2VC1A 3O2PE 3KQVA 3IYLW 2STTA 3ZMTA 2DQRA 2H94A 2XHKA 1EAMA 3UJCA 3LCVB 3C3YA 3G89A 2Z5UA 1L3BA 5H6RA 1IRFA 1Z1DA 2GXGA 1INLA 5EC8A 3TKAA 3TDZC 4RTMA 5C9ZA 4AWXB 5LQNA 2P5LC 1S7OA 5L3DA 1B6AA 3G5LA 4X1OA 1XXLA 2O57A 2O6GE 4RTSA 3ECOA 2XAJA 3F22A 1IAWA 3LA7A 5E1BA 4FP9A 3FZGA 1B59A 2O03A 2LD4A 3T8TA 4S04A 4YMGA 1U5TB 3KP4A 2XYVA 1PUEE 2KKOA 3BT7A 4KDCA 2O8XA 1F1ZA 3IWFA 1RJEA 2L4MA 1FJXA 1MHTA 4YUXA 3KHKA 4DF3A 3I71A 1AQIA 4YIFA 1ZLJA 1SUSA 1EG2A 2V79A 3VOEA 2ZULA 4UOEA 3LCUA 4KDRA 4EK9A 5BMZA 2AOWA 4M36A 2EFWA 4LK0F 1KXZA 1OYIA 2ACJA 4A6EA 3EMBA 8MHTA 3V4GA 2V1XA 1G3WA 2AN5A 2P35A 3UJ7A 4BP1A 3CCFA 1FYMA 4L9JA 1K6OA 3RODA 3SSOA 1H9TA 1E17A 1YFHA 5IT9Z 2VBXA 4YUVA 1KPIA 4ZYDA 3GNLA 4MTDA 2CYYA 3JTHA 1RIOH 2Z99A 3CBGA 2FRHA 3ZN0A 5DPMA 4RTNA 3R6SA 3U2RA 5E9JA 1OKRA 4EJWA 2B25A 2FA5A 2Y1WA 3KETA 1FBNA 5CUQA 4IF4A 3EVZA 4DCGA 3TGNA 3UZUA 2B2CA 1WSUA 3BZ6A 1MKMA 5CVJA 3FTDA 4GEKA 3B3FA 3IKVA 4YUWA 3ME5A 4H0NA 1F5TA 2B3TA 3OOPA 1SUIA 1UFMA 3CO7C 4ETSA 3HYIA 4ZYHA 3ABTA 1U3EM 4LG0A 3MQ2A 1Q0TA 4GC9A 3GYHX 4C07A 2NS0A 2PWYA 3RJPA 4OIPF 1K78A
chains in the Genus database with same CATH superfamily
3H1BA 1QAMA 2ZRDA 1IY1A 5CBKA 3QXGA 4OB8A 5JAZA 5T4BA 4QWWA 4FGKA 2FVXA 3U3OA 2J3MA 2G5CA 2RDPA 1GGFA 3PCTA 2L82A 2CV0A 3EF1A 5DSZA 2SKCA 4BO7A 1LJ8A 1IFXA 1W49A 3OQJA 3TMYA 2BRUC 1PGNA 4H7HA 4P0QB 4HNQA 1K75A 3A9CA 2XGJA 2FOXA 1ZUD1 3T0IA 2IC5A 5LP6B 1JS1X 3FISA 1WUHS 1FYEA 1NBAA 5B1AH 1TTYA 1NF2A 2WRZA 1RKVA 2FNPA 1YIAA 1BU8A 4JB3A 1D2HA 2IXBA 4DQKA 2WD9A 3SIRA 2QVZX 2G1AA 3HJBA 2IH2A 2EFDB 1CHDA 2GRUA 4UJ3A 3D0QA 2OHXA 3R6GA 4YMLA 1GR0A 1G3YA 1CR4A 1F4KA 1CU1A 3OCJA 3GTLJ 2DECA 2VBYA 4OLJA 1CJVC 1T9KA 2GNOA 2VA9A 3IMCA 3CE9A 4X0GA 1Q74A 2XJ4A 2L42A 1LDMA 1I94B 3QBDA 4H3HB 2YCLA 4LIPD 3V4VB 4TMYA 2QRNA 4YUAA 1SUCA 1QHXA 2FWRA 1XGSA 1GTVA 1RPWA 1PWXA 4UUQA 1ZGBA 2G40A 3OOJA 5FUYA 1Z39A 4DT1A 2Z58A 4F3TA 3VVCA 4N5NA 1IB0A 1IXSB 4HB3A 3HEBA 5BNTA 3FTCA 3IRVA 1QIEA 4CEJA 1DQZA 1K7AA 2A5GA 5AK0A 4G41A 2OBXA 4IDFA 1DDNA 1Q1VA 1C3VA 2LDBA 2CMFA 3L9WA 1JQ5A 3SZTA 1IRGA 1KARA 2EKLA 2J3EA 5JSYA 3FWYA 1GLVA 3B6JA 4A12A 3MWLA 5LIRA 5L3GA 3P2KA 3VQTA 2RSLA 4PPYA 5B1SA 2IUEA 3UTDA 2B94A 3B85A 4RNCA 1DDGA 1H93A 1DT3A 3U6BA 3G88A 3KBBA 1YR7A 3JRGA 1D2AA 3C2QA 2C7BA 1Z0JA 3ANSA 1L4MA 2CT8A 5JEEA 4HYQA 1NW3A 1LDKB 3UGTA 4KQMA 4REMA 3GFOA 2AL7A 1B8NA 4A3DJ 2GN6A 1IHYA 3GZJA 1T6SA 4RD4A 2Z3YA 5DXAA 3NHFA 1X4PA 1EWRA 3ZWYA 2WZCA 1UL1X 1QANA 3EA5A 3GLXA 3IQIX 1YHZA 4WCFA 4TLDA 2XXJA 2DFIA 2RIPA 4Q03A 5DCMB 1S1CA 1M6YA 1C7ZA 3FTNA 2WIFA 1J49A 1GM5A 1Q1HA 4L4ZA 5H80A 3HOYJ 3A58B 3A6PC 2P1DA 1UKEA 3RTAA 4GUDA 3QBJA 5DNCA 3A1DA 3G5UA 1X1CA 1ZH5A 1L4FA 5DLDA 2JA6J 4F5YA 2DTDA 1WCMJ 5INTA 2JRLA 3DXXA 1FFGA 3KYIB 2ZQZA 1FRNA 2ZSDA 3CW2A 3FDFA 5LZ5A 5F1PA 2XUZA 2HRBA 5E7JA 3DTYA 2B4AA 4CKBA 2GVNA 2GQ0A 3UMJA 3OY9A 2BGJA 5E0OA 4QYWA 3OFND 4CSWA 2ACWA 3B38A 4FYJA 1UT8A 2AJDA 5B58T 3M0EA 5F64A 3R61A 5L4NA 3VBCA 3E6AA 4NQRA 5B37A 4KMMA 3OIUA 2IZZA 1ETXA 3AUXA 1CDZA 2A1TS 2IXEA 4DREA 3D0RA 5KVVA 3TR6A 3FUXA 4L8YA 4DBVO 3AP2A 5F2KA 3C3PA 3BPVA 2O8VA 4XUEA 4L07A 2I3DA 5I8ZA 1EX6A 4G12A 4WXPA 1M6WA 4GPZA 1U0SY 2XDQA 4WA7A 4I99A 4P3XA 1W9HA 2QUBA 3NJ8A 5IDXA 3BCRA 4Q15A 4JNCA 3LTEA 4K0RA 1BS1A 3HM5A 2J59A 4CKWA 1CLEA 2VP2A 4KUGA 4HTFA 2O1XA 1U5BA 4TMVA 3E8XA 5E3OA 2DKFA 2BW3B 2X1MA 1HM5A 1ZC4A 3HKCB 1OWMA 2JHCA 5B55A 4N12A 4N9QA 1KI6B 2WHPA 2J5QA 1HLGA 1IXKA 3DVRX 3VKWA 3R40A 3Q9SA 4LF4B 4Y3UA 4U0WA 4MQMA 4HUTA 2PCJA 3EF0A 1LNQA 3LSTA 3VR1A 2IJLA 5FPKA 1J09A 2CGPA 3AEXA 3LIIA 4BP9A 3D3WA 5KQGA 2CVHA 2EARA 4J0DA 2G71A 4D80A 2PZBA 1ZMTA 1XTQA 4MQFB 3PF8A 4HRXA 4CL3A 1U63A 4L8GA 1RNLA 4BAUA 5JAIA 3U4DA 5JD4A 3IP3A 2PSJA 4PO3X 1WCIA 3NWBA 1G9XA 5A9SB 3ZG6A 5D3MB 4A9AA 3WRXA 4NEHB 4XIFA 3Q10A 3T3DA 3DD1A 1AGPA 1NJGA 3UOGA 2ZDQA 4I76A 3O8OB 4EEKA 4OM7A 3KVYA 5A2QK 1QFJA 3AFNA 4XVHA 5K4GA 4YAKA 1U02A 3QH4A 4XB1A 4JBAA 3M82A 4P7KA 5M04A 1YB7A 3SF8A 1JG2A 1NR7A 4R7GA 5EZGA 2M6RA 5KX5F 4ILEA 4ENSA 3HACA 1ZWLA 2J5XA 4YV0A 5JCJA 2PM8A 4NCIA 3G2QA 3NHRA 4EP1A 4JU9A 2D2VA 1Y1WJ 1V47A 3T7EA 4R51A 3PHGA 4KAFA 2X9DA 3OICA 4XOUA 2F3UA 3TLAA 4AN4A 2YFHA 4LK2A 1SXJB 1BWRA 5IT9A 1TKRA 2YR2A 4OGFA 5HZKA 1L7RA 4E21A 3PTAA 3FWHA 1UBKS 3KSAC 2QF7A 2JUCA 3OFKA 3A9WA 4LRWA 1Z7GA 1RAHA 3D3JA 5C7OO 4RE5A 1ETOA 3QKSB 2PMZN 2NACA 3FCEA 1P33A 4D0RA 2AQFA 1OFHA 4MQLA 2RGEA 1YNSA 4UBLA 2J32A 1OHHA 3PC8A 1Z8HA 4BMYA 3BWCA 5J5AA 1DUXC 3LLMA 1XCLA 4QLAA 3T5AA 1K1EA 4AS1A 1I4WA 5IABA 1FUKA 4Z9FA 1Z47A 1W93A 1N0UA 1BD4A 4QULA 3GLSA 1RKXA 1H8HA 3MUEA 1XSXA 3O84A 3OF5A 4R9UC 2FE4A 5LZ2A 2AN1A 4CZ2A 3GU3A 4BGDA 1W5SA 2AD1A 2QN2A 2DUWA 3ETHA 3OCVA 1CKEA 1NNI1 1HY3A 1R5HA 1LE8B 4CYCB 1P7CA 4RACA 2AXNA 2ET6A 5DP1A 3F8CA 4OQNA 1K6MA 3ROZA 5AHXA 4EG0A 2O8DB 3I2IA 2XRYA 3M81A 5EWMB 3ZWVA 3V32A 5DMHA 3KL4A 1ZG5A 4K3VA 1P7PA 1S2NA 4JBYA 1WABA 1EXDA 4ENQA 3DXZA 3WU2C 5EZSA 4C4RA 3ZWMA 2ENWA 1TF2A 1U98A 4JI6B 3NONA 4C4XA 3KSDO 2XODA 3X1WA 4V0NA 1ZK1A 3LKDA 4URUR 3VYVA 3REOA 2IK8A 4BY9E 4MV8A 1KYQA 4L75A 2P69A 4QUBA 3ZOZA 1QOPB 5F73A 1DPUA 1T29A 3ZGNA 5TQ2A 3KKQA 4DMLA 1ACIA 2OQIA 4A93J 3ASZA 3JQAD 1ZVMA 1Q1QA 3AHDA 4K2HA 3GX4X 4M9RA 4ESHA 3CSSA 2XTAA 1TLLA 4F21A 1YB6A 4ML3A 3P8ZA 1Z4PX 4EITA 4M3FA 3PFHA 2F2EA 1YVRA 3VDNB 5DGHA 3FBGA 4BBPA 4KCGA 4WZAB 1TM1E 3L0OA 1VLLA 1L8OA 1XL1A 2QA5A 1XZNA 3TLXA 1VJ1A 4CE6A 1UHWA 1X3SA 1XZIA 3W4JA 1X3UA 3EVEA 2VCEA 3AF4A 1ZW6A 3UAYA 2WF7A 3W6KB 1SD4A 5HMMA 4K2AA 1UDCA 1FP4B 3QPDA 4UUNA 3TQCA 4BHPA 4M53A 3TG8A 5JJKA 3ZN2A 1HLDA 3EPZA 5ALOA 4LCJA 1K4SA 2E34A 1R58A 4H0EA 1IBLB 1RPJA 5EZYB 1SPBS 2HSWA 5FIUA 2F00A 2VJKA 2UXCB 4M1OA 3F5FA 4P4NA 2V7PA 1P4XA 3RPQA 1JIJA 4N6NA 5TEVA 3C16C 1K6IA 4MDHA 3KLNA 3RB8A 1A5SB 2XBLA 4NP6A 5E4YA 5KAPA 5B1YA 3K1ZA 5JSZB 3FSJX 4WXMA 2J7KA 4FT2A 2VOEA 4N3CA 1KAEA 1M1EB 2C4KA 2Q99A 1TF7A 4H4CA 3L18A 3PPWA 4KIJA 2F62A 2WJIA 3QE4A 2HBZA 2Y67A 1NRJB 3D7SA 4OSPA 2O0LA 4RA9B 2DC1A 5GZ3A 1PGPA 3K16A 4Q7JB 3EBPA 3LT2A 3UANA 1EP2B 5CYGA 1G20B 4X6XA 3A6GA 4EJTA 3G2HA 3KKOA 3GLLA 2CCKA 2Y92A 2W6IA 3Q9UA 1EB9A 2XMQA 2ONYA 1UMDB 3ZEAA 2Q27A 5BURA 1VI6A 2KL4A 5B3AA 4DKXA 3GEZA 5C44J 3MINA 3PL5A 4BMXA 4BNVA 2QL6A 1E3SA 4IJMA 4RX1A 3C7KA 4U2GA 4FUQA 2D8MA 2P3LA 3H99A 3FKIJ 4ZZLA 3SYKA 2BI8A 2FEKA 4GPAA 4RGVA 4CYDA 5GONB 1QUFA 4PW0A 2DHCA 2YV2A 1XWIA 1JT9A 2V4ZA 2JLXA 2CYBA 3AIIA 1MXFA 4PZEA 2W2LD 4MVJH 4ZPJA 3EVAA 5JXIA 4OJKA 1WV1A 2VBGA 3PRJA 3VC7A 4ZZ3A 3FZEA 1EXNA 6Q21A 1QS0A 4BHTA 1JEDA 5DZSA 3OE7A 1ZR4A 3V6LA 4IR7A 3RLFA 3IUSA 2FMYA 4LVOA 2JH8A 2P1ZA 3P9NA 2HGZA 1N92A 3ZI0A 2F5DA 2H4WA 3ACDA 4XRGA 3OOHA 1E1KA 2SCUB 3BMXA 1I7LA 3S1RJ 1MOZA 5TF0A 4JLVA 4G1BA 4GOJA 5AIBA 3EPRA 2DWOA 2IJGX 4DAEA 2X1EA 3ZWWA 4QPDA 2WIDA 1MX1A 1FOEB 2JD0A 4BMOB 4F7DA 3EZ7A 5I4CA 4DW8A 4R79A 1USWA 4RKFA 2C96A 4L0QA 2H3HA 2CLEB 4R8HA 1CNFA 2WP8J 4XCQA 2VDUE 3WMGA 3KPWA 3JW4A 4NEGA 2KRHA 4P7FA 4K88A 4H7IA 5AW4A 5HCIA 2RC6A 1ECPA 1IOZA 5GVSA 2Y69H 1GOTA 2PMBA 4F84A 3TECE 4WEQA 3VXKA 3IV5A 1MVLA 4XQGA 1M2HA 4MRAA 5GPCA 4U8GA 2FUKA 3KD2A 3FTQA 2FLKA 2JIBA 4U6SA 1Y0UA 5C4GB 3K8QA 1S4QA 2YIDA 3C5HA 3QYJA 4PVCA 2UVPA 2FPSA 2WM3A 4AC9A 2RJNA 1G55A 4CLXA 1OPRA 4HS4A 1P0QA 1H69A 1Z2PX 4YCBA 1L5YA 4WHMA 2G1PA 3ETGA 3N8KA 2Q29A 4KBFA 4RSRA 4ZDJA 1IY0A 3TYXA 2O3RA 3PUJA 2JQ7A 4FHTA 3KQHA 1CY2A 3CQZJ 3N0XA 3P4XA 2FZWA 2YXLA 2FOIA 1Y3AA 2FX3A 3B3QA 2GFHA 5KOJA 1QJCA 1QWSA 2EKZA 1XPXA 3M5PA 4XYGA 1QJ4A 1N0VC 2WINI 2R7SA 1W76A 4BVBA 4KXYA 1C3OB 2VP9A 2NOAA 4I5EA 1WKCA 2A67A 1LD3A 1Y3CE 3U7QA 5GOZA 2C61A 1OLSB 1O2DA 3JCZA 1IQRA 3UMVA 1YULA 3VU9B 1WZ2A 3WLIA 1OXTA 2IGBA 2OV2A 4FD2A 2VHCA 2F3RA 3A4VA 1M72A 1L9KA 4YT5A 4M9XA 3GEGA 4RB0A 1FSSA 4JXZA 1H5UA 4HCJA 2YY6A 1MTOA 2FGKA 4Q9KA 1N8NA 1RXSA 4OAPA 2VT3A 4BNDA 3KE2A 2E36A 4KT6A 1MO6A 1DG3A 3HN6A 5CLLA 3F73A 1N32B 4DLKA 4WADA 4OSEA 5BN5A 2R00C 4ZAGA 3WOVA 2R4GA 1UWVA 4BIIA 5IC6A 2RC4A 2CMHA 2JJ2D 4IZ6A 3A3PA 2O3JA 4E2XA 2ZC2A 2DFDA 4D44A 4M0UA 4Z0PA 2RDMA 2GA9A 3KWLA 2B83A 5IC5A 3GG2A 4JWKA 4JP3A 3PHHA 4X91A 4R54A 4G4IA 1RC9A 3BDAA 2IE8A 2RKWA 2DR3A 5FADA 2C4WA 1OGYA 4E13A 5LP6F 4IIEA 3AR8A 3EW7A 1H65A 2VPQA 3OQIB 2GAUA 2WMYA 2Z5FA 5F04A 3LA2A 1UDWA 3FGZA 5IMSA 5HQ3B 3EA4A 1LA2A 1ZRCA 3L8EA 1SBQA 1AGXA 2ZWIA 1KFBB 2O1EA 3OC0A 1Y5MA 4E7ZA 3T9BA 1J33A 3ROGA 1S3GA 4TTPA 3K0CA 4AJ2A 1UFVA 1C1DA 3UW1A 4W5TA 2JBAB 1TVEA 1JEQA 3LECA 4LDNA 5L3SA 4PV7A 3KXDA 4FINA 4TRRA 3CTMA 4AM8A 1DGWY 2WY7Q 1CX9B 4PAQA 2I6GA 4FLMA 4GPIB 1WJDA 1Y6FA 3FUWA 2VXBA 4RENA 3AUKA 3E58A 4K9NA 1JHFA 2CW0F 1QB8A 1WTCA 2J9ZB 3BKXA 2QM7A 2WVHA 4ENRA 5JAPA 3IUMA 2BFDB 1V96A 2GEFA 2BV3A 1Z91A 4TZ0A 2XT6A 3W1VA 3QLVA 2XE6A 2DCMA 4XSGA 4XX1A 1Q3KA 1HO3A 4ZTJA 4AULA 4J0IA 4TM8A 3LTNC 4JDPA 4X8LA 2QUJA 4YCLA 3HBNA 3ZV3A 3EUEA 4XLZA 5EHZA 3B1XA 1QHIA 3IYLW 3GLGB 2DQRA 1EAMA 3UJCA 4AD8A 5EC8A 5IC4A 4NE9A 4B3BA 3C3CA 3OYKA 2O7RA 5BSVA 4X1OA 4RDXA 1QP7A 3TTSA 3CYFA 1Q21A 4F3KA 2NWQA 4F9GA 1GPLA 3M1AA 5ICSA 3BD9A 4IJQA 3UG7A 2KKOA 2QUIA 3P5BA 1JPUA 3ZTYA 3ZI7A 2R93J 4OMDA 2WLSA 5DHPA 2CL6X 1QVUA 3L41A 3LCUA 3GDFA 1AZTA 4ITUA 3OWHA 5AVSA 4ND3A 1I7PA 2MYTA 1D6JA 4H7PA 5H70A 1LXCA 1U2DC 1GQQA 4A0FA 1CUAA 4RSMA 4TUYF 4NE7A 4R5MA 2ZKLA 2VNHA 3URMA 2HIGA 3FX2A 2QXYA 4RHXA 4BASA 2B25A 5KSWB 2J0EA 4CM3A 2DJNA 4BFSA 3WB1A 3H9GA 1ZM2A 2EBWA 4GEKA 1GGJA 3O1JC 2GOYA 1R6RA 5B57C 5A3JA 1CR0A 2QLMA 3ABTA 2Q0XA 1EJ2A 2GHQA 2HA3A 3A1SA 3TQFA 2PUAA 1W88B 2R60A 2X7JA 3GA7A 3TNJA 4EPYA 3SBXA 3ZDXB 4E3ZA 2XSZA 3BBPA 3RAFC 4MVWA 1RTKA 2QJWA 4G1UC 3OBIA 4A73A 1L7BA 2ZYHA 5KTKA 4PC2A 1NYQA 1CF9A 3PRKE 3EZNA 3GGPA 3JZFA 4O59O 3MGBA 1M3SA 1Z0DA 1NN3A 4RA6A 1QR6A 5HKOA 1FSFA 1RZ3A 4C3HJ 1Y1VJ 4E5NA 3KKKA 1R9NA 3FPBA 1LLFA 5E2IA 3BJ6A 2WJ6A 2A30A 1KZHA 1YA6A 2IHBA 3IBFA 4WLVA 4Q4AB 1TOAA 3D59A 4QGFA 2ZR7A 1G9TA 5C1OA 2NO0A 1HL3A 3W9BA 2IXGA 3JYHA 1SELA 5D3QA 4G84A 4X7BA 4Z99A 4H6PA 1BS9A 3KR0A 4C9YA 3LSHA 4P4LA 3L4EA 1DOAA 4LF7B 3SYTA 1ABEA 1DMSA 4ZQHA 3G0HA 1XEFA 2TDXA 2Z8YM 1LFUP 4XH9B 5KYVA 4UMEA 1D09A 2CNNA 4C76A 3G5AA 5FFZA 3C45A 2ZE5A 3AR4A 3WA7A 1JKQC 3TLGA 2G0AA 1ZMXA 3OPYI 1G60A 4ID9A 3E9QA 1ULUA 3PCXA 2EF1A 1VSQA 1RS0A 1EGQA 3FDXA 2YOGA 4IXTA 2QW1A 4LN1A 2HS5A 3ITNA 3D54D 4CQNA 1CQJB 2V4JC 3O1IC 2VUUA 2B7BA 1GKIA 2HB6A 2MSNA 4MUNA 2Y2VA 5D5VB 4FONA 2KMLA 4A8JB 4EUNA 3V4LA 3NEYA 3FNQA 5HLHA 4OHUA 2FR0A 1JLHA 4WZ6A 3V8BA 1JX6A 2EGUA 4C0AC 5ICGA 1E2MA 1I7NA 1Z4NA 4KSYA 1JE8A 3D4BA 4YJGA 2QRMA 2H54A 4OA8A 2VNAA 4RESA 5FLEX 4M8SA 1XMOB 4ZT6A 2AMYA 4PPNA 4RAQA 1G1AA 2JIRA 2GZSA 3CU5A 4I5DA 5JSQA 1FFSA 4ZP1A 4HUQA 3WIOA 3TOXA 5J59A 2X0RA 3JU3A 4NXMB 2BYVE 2VAMA 1DRVA 2G9UA 4O3MA 5FNVF 2ZB3A 2V59A 3FMRA 3OC6A 2VPWA 3GP5A 2VOJA 4MW6A 1FFWA 4R83A 5K0LA 3A4NA 3TCNA 4CM9D 4HV5A 3IKMB 4L7QA 3W8EA 4PS1A 3LKVA 1KI9A 4EEFG 1VDMA 1NHGA 3HMKA 3I01A 4EYQA 3R60A 3MT7A 4MUXA 1A9XB 4XJSA 3QLJA 2OECA 4MDFA 2OC9A 1GNSA 2Z43A 1YS7A 1VCHA 4XFKA 1KPGA 1AO0A 4D41A 3PXEA 4TMXA 1GTMA 3Q3SA 2DLNA 1NXWA 2AI1A 4X1YB 1E92A 3N3AC 4GT1A 2H8KA 1KMHA 4TMFA 2F6CA 1UPTA 1XJ0A 4OHRA 3KJFA 3P9KA 4D56A 1J99A 1L1FA 3IURA 4JDUA 1QH0A 5E1WA 3U3ZA 1FYVA 2E71A 2E55A 4E2ZA 3NOXA 2VQFB 4GW3A 4M55A 1FOXA 4UHJA 5LL6P 3R3JA 1OX6A 3IVXA 1O6ZA 4B2LA 2PUHA 4L15A 5KTOA 1ZH8A 2FQQA 2HJWA 3VH2A 3UUWA 3SHFA 3BP8A 3UCEA 2E49A 4FEYA 3PP8A 1JDPA 2WJWA 5DMXA 4L5EA 2DFPA 3RUIA 5IWAB 1PUXA 1ZZGA 5KTPA 3SM9A 1X80B 1NA5A 4UULA 3CRRA 4L3OA 1L5RA 4X8OA 4M8NE 3U1DA 1YX3A 2C84A 2R7WA 1OAAA 2G04A 1FMCA 4A15A 4GI7A 4ESEA 3HRSA 2XITA 1IO2A 4MQEB 4Y2JA 3G3ZA 3IUPA 1Q57A 3MS7A 2O14A 4W5RA 2NAPA 3IC5A 2BTOA 4YV7A 3GK3A 2Q5QA 3GUYA 3DGEC 4BO2A 4V1CB 3W06A 4K6MA 3OJWA 2GZDA 1XRSB 4X63A 5KJ6A 1BXRB 1IUFA 4U87A 3CDIA 3DZKA 5F9MA 4AWAA 5IULC 1N2SA 3I2GA 4FWIB 2G6BA 2OQRA 2R7AA 2ZBKA 2NUTB 2YSRA 3LOUA 2CMPA 2DOFA 4LF5B 3BZUA 4QGHA 2HVSA 3I9KA 2JIZD 2DERA 2VYND 4ZRNA 3M1YA 1IN8A 5FLXA 4N18A 3DEAA 4CFZA 1D2NA 2UDPA 3DKKA 4YWJA 1QHHA 1Z3IX 4FILA 2ODAA 3G0CA 3E9ZA 5ED0A 3ZPLA 4WXYB 2WABA 1S72I 3TUJC 3KFLA 2WWWA 1IEVA 1SXPA 4JXXA 3CIFA 2DSTA 3PUWA 3CF2A 2ZG6A 3QYFA 2PWPA 3SD7A 1BGVA 3I6IA 3W5JA 3HIFA 5K5QA 4ZTFA 4EO7A 1A27A 4BOYA 2Q5CA 3OIPA 2W4IA 3WFZA 3F8WA 3K2BA 4M0KA 3MHPA 2G08A 3H1TA 4DRYA 1VPWA 4B2PA 5K0GA 2FRVA 4KO8A 5BRNA 2VJQA 3HZHA 4AYBN 2B5OA 1TQPA 4JJFA 1WHUA 5E3MA 5IP7J 3CKYA 1P92A 1GZHB 3K4PA 4DQ0A 1D4OA 4G8CA 1NBEA 3RWMB 2VUHB 3H2ZA 3QHPA 3UB4A 4AVYA 1NDQA 1IQUA 2PR7A 3FFTA 3AEZA 4AUMA 3TDMA 5JASA 2X86A 4MSUA 2FOWA 2VS1A 3SQXA 2YN2A 5F0CA 4EYOA 2YHIA 5IEBA 1YK0A 1PUFA 4EHHA 5BSEA 3NWOA 3RYFB 3LFHA 3KZIC 5JC8A 2UU9B 2YHAA 1II8A 5LSAA 4U7PB 4S1OA 1BD3A 2FSPA 4C7VA 1JYSA 4QOGA 2COKA 3C41J 5HX7A 1GAJA 2C9BA 1SKBA 1JXAA 3KZMA 1M74A 3AB7A 5JSHA 2KSQA 3CTPA 3AG1H 4DBLE 1B1BA 3JYQA 5F2EA 2O2IA 1I3KA 3K35A 1MC4A 1CE8B 3DCYA 2HOEA 4TQAA 2C99A 1O95A 1QHEA 3E23A 1T2KA 5EZYF 1AK2A 2EEZA 3MIZA 5CB8A 4MLCA 4CNBA 5IKPA 1KAGA 2P1RA 4PC7A 3C6BA 3V7UA 3K6SA 3IQXA 1SXJC 4JBNA 1ENHA 4IO1A 1J7KA 3AVUA 3N2GA 1IGNA 4D9HA 1SQFA 2IZOA 4XQ0A 3H9BA 3W9UA 2DCEA 4AY3A 4HDQB 5KVSA 4E03A 1CQTA 1QIHA 1GL6A 1XP5A 4PVDA 3WTVC 2FJPA 1ZXLA 2AO9A 2W1OA 3AH8A 4I09A 4CQMA 2YBDA 3ZXYA 3AZQA 2XRNA 4PFQA 5JATA 3NARA 2XDYA 5HCUA 2BJWA 3KCCA 1E2NA 4AJPA 5JNVA 3NQOA 1LK5A 2HJ9A 1H1DA 1GGKA 1RYBA 1EKEA 4WK8F 2WUGA 3BB3A 5DYIA 1YQUA 4MAFA 3TQQA 1U9YA 5A4KA 4X8MA 4KPEC 1ISIA 3FKSD 2AOVA 4HF7A 3L1JA 5EJMA 3NM4A 1WJFA 2C7OA 4D9BA 3GTGJ 1OIVA 2DH6A 2IVMA 5DHQA 2ZLBA 2BKXA 4RO0A 2W2VA 2HD4A 2QSZA 3F6VA 1EEXB 3RYIA 4C0XA 3JS5A 4J9UE 2OXTA 1QORA 2JI9A 2DKOA 4BATA 1Z75A 2Y9YA 2LY2A 4JC5A 4UY8I 1KU3A 4MR9A 1H6AA 1YJCA 4S2EA 5GONF 4IO9F 3HK2A 3TEDA 3BM5A 1A4UA 3DFIA 3RC7A 1NUHA 4MQ5A 1BX3A 4HNAA 2QGNA 1XTAA 1X3LA 4MS3B 2GIVA 1HOTA 4DLXA 3HXOA 4JY7A 4BS9A 1XLUA 1T0PA 2O2CA 3CEHA 4QJIA 2EX1A 3CJQA 3IEUA 1EK5A 5FD8A 5J1YA 4LLNA 2NVTJ 1JDUA 3BHNA 3PXGA 4YI5A 1T33A 3OQ1A 4F4DA 3T15A 4RVHA 5BV0A 2BFBB 3COSA 3RBZA 1BE1A 4PYLA 2R85A 2V1UA 2HBQA 4BVGA 3OE4A 3ES9A 1RR6A 3OZIA 2PEXA 4X5OA 4YUYA 5D6FA 1TZKA 4INZA 3D4IA 1RQRA 3EISA 1YU9A 4II7A 5ALVA 2XE7A 2TCTA 4R81A 1WMAA 2KZVA 3A1UA 3EGXA 2G7UA 1VFPA 1UJ6A 2QTCA 1YRWA 1GT6A 4F9FA 3PD7A 4PINA 1VG8A 2F67A 1BI3A 5F9FA 2RGDA 4CT0A 4ENPA 2ZMEA 3ROEA 1V1RB 4O2LA 3KTFA 1YE9A 1BN7A 1HH4A 4UB6C 5AI9A 1IB6A 2CXUA 2ODEA 1TWCJ 1E6CA 1WXDA 4HYEA 3ZQIA 3WTTC 3F6CA 3MGKA 4UFNA 3EJ6A 4TLLB 2CXSA 2JDIA 2F3SA 5DNEA 5GAEJ 4IVRA 3WNBA 4O6JA 3STHA 3VUFA 5G3YA 2XYQA 3DVSX 2OVFA 1UOEA 1XS9A 1SMTA 2HWUA 1F5NA 4OLHA 3C8DA 1MB0A 2X8WA 3PDWA 4HRVA 4NZNA 2H4FA 3HYRA 4MJ7A 3O8GA 2GK7A 4AB1A 2FMLA 5D01A 3ZMZA 1N1EA 4Q4LA 4S1WA 4INAA 5K03A 2R5ZA 1C30A 1I3MA 1E1MA 3WODF 1RACA 3CEMA 4TMTA 1XD2A 2JCBA 3T3IA 1XF9A 1A4IA 3L0SA 5E8IA 4G01B 4PXAA 4WFKA 4G26A 3PYMA 4RIFA 3KZCA 1Z34A 2C2XA 2GK6A 4IYRA 1E0EA 2Z9CA 4BLTA 3F6OA 5EPOA 3WSWA 2DT6A 3S1MJ 2GXUA 4RVFA 4GDMA 3CX7A 2ZSBA 3Q7TA 4OMYA 3HWRA 3PT5A 3NNSA 4ZOEA 3C3JA 1U3WA 4MPTA 5A71A 1IYZA 4CTMA 4ETIA 2HU9A 2O8FB 1H05A 1MPXA 1ZELA 2BGUA 7ABPA 5LD2B 3FDZA 1XKXA 2GZWA 1UBOS 3TM5A 1YZYA 2IYVA 3ZV6A 1U7ZA 3MS2A 3GBPA 5CB6A 2P8TA 3MA0A 3NKVA 2WAQA 2GYYA 2PBLA 2RH4A 2GR9A 5LHHA 3T6KA 3F6YA 4OLAA 1PYDA 3WO0A 3DPTA 2ZYSA 3RUEA 4GMDA 4TVKA 4S0XA 3WLFA 1EUDB 5CA0B 1XCPA 2FG6C 2XGXA 5BUCA 2X9QA 1DXHA 5DM70 3CW8X 1WJ5A 4N40A 3O73A 3WJAA 4JJKA 3RUDA 2AD5A 1XXHB 4AZSA 3S8EA 1IWOA 1A36A 2X3FA 3D8BA 4XIYA 3HHGA 4LE1A 4G81A 3OT1B 1YB1A 3ESQA 1PR9A 1Y98A 3BJAA 1JDJA 1R4MB 4PQYA 3OKFA 1RBYA 5K20A 3VPSA 3QOPA 4XA8A 4TLBA 2X15A 1FNDA 1FJHA 1NZFA 4B6FA 3U0VA 1S2DA 1EFVB 3U19A 4AYTA 3Q4GA 2CV1A 5KVAA 3KZVA 2FW1A 3VTZA 1E1DA 1NBMA 1DX9A 4H17A 3AIKA 4XWOA 4MTEA 1YR8A 3PQ3A 2XWPA 2IZ1A 5KHDA 1T0IA 2R6GA 1RABA 1ZN8A 3L0YA 4OP1A 2WWVD 4LW8A 2WB4A 3JALB 3QXCA 1CERA 1H94A 2OAP1 1S2IA 1GGNA 2PBRA 5H1YA 1J0CA 4MV7A 2W37A 1QBJA 5BQPA 2WYUA 1VI5A 3TOSA 1MPTA 2DEUA 3FUCA 2VXZA 3U3DA 4RDCA 1FTGA 2VP3A 1AXEA 1ZI9A 2GO7A 3ETDA 4IIHA 3GVCA 5FX2A 2HDWA 2Z30A 2F43B 1XZDA 3TZLA 2FU5C 4ZANA 4IDAA 2IYSA 5TE9A 4C05A 1NUAA 3MCAA 3FB1A 1VIAA 1MA3A 1NQUA 1W581 5AKEA 2DQYA 2IA5A 4J90A 3KC2A 4IIYA 4XLPF 3AETB 1PL8A 1KJQA 4JX5A 5CMLA 4X6LA 4Y98A 3DDNA 5AW1A 1VLVA 4EA9A 4H3VA 2HF2A 3Q8MA 4V2UA 2DAPA 2BY4A 3OU7A 4IL6C 1ZYRF 5E4FA 2Q1UA 1SC1A 4B3FX 1SB8A 5J47A 5LQJA 5FLKA 1QOZA 4URFA 2ZT5A 1EE1A 1HNWB 4HAMA 1R5BA 1JWLA 2XDVA 1BC8C 1BDJA 2GT1A 3K96A 4N7RA 4C7OB 1XU7A 2QV0A 5CURA 2I7XA 3WG7H 1N5RA 1ADBA 4CM5A 2CUZA 1JB9A 4PRZA 2LCIA 3DBLA 2X1LA 2NXNB 4RH1A 3OJFA 4JI0B 5TT1A 3BZKA 4MXDA 2XTJA 2ZRQA 5JVDF 2L9SA 2HPAA 3WE2A 3VZCA 2HR1A 1EE9A 4G9EA 5FTWA 2AB0A 5SV2A 4I9FA 4I81A 4C0JA 1WX1A 3L7BA 2C4NA 1JAYA 1YSCA 5FWNA 1P1BA 4MRSA 2J6CA 2QT9A 3P0EA 3PENA 3O3MB 2DQSA 2JLCA 2C03A 1QAQA 2LP0A 4OUKX 4U7BA 2R7OA 1BAPA 4TTSA 3PYLA 4BU0A 2LNBA 1GRVA 4NBLA 1H88C 4B3TB 1FLNA 2CQ7A 2NAZA 3HL4A 4BQRA 2XXAA 2Q49A 1U8EA 2VDOB 1LDEA 4B3HA 3QW4B 4P5OA 2IHKA 3TG2A 3AFMA 3QJ5A 4Y2XA 4JOMA 3L02A 3ZNOA 3CT6A 1LDNA 4RKWA 3EARA 2QR2A 1LJ9A 1V7PC 1S7GA 2VAWA 3L7OA 3OQMA 2UUBB 1VCOA 2IOFK 2AFVA 4Y8VA 4CI9A 3LX4A 3DBHB 4NZZA 2ZAMA 3O8RA 1KYYA 4RAGA 5IT4A 2C1EA 2YWDA 2AYZA 4D3ZA 1W4ZA 5DYMA 3ECAA 2PS0A 2C92A 4CCOA 2RE8A 1DCTA 1YFJA 1VJCA 2FSHA 3F5SA 1RJGA 1CJCA 2XCRB 4EQ6B 4JOQA 2DFKB 1XZQA 1MV5A 4C6SA 3K0AB 4FFPA 1ZONA 5JD6A 2OG2A 1KH1A 3K1AB 4K9RA 5DHSA 2ZJ6A 2VQ3A 2P9BA 2PIDA 4Y2RA 4LDZA 2HCRA 4CL2A 3V7NA 1BVYF 4WXHA 2JH9A 1U3CA 4UXHA 2PG3A 4QTTB 3SJCA 4HDSA 1PD0A 2OD2A 1BJAA 4D96A 4CGZA 2TMYA 4LZPA 3D4PA 1KDVA 5H83A 1W6RA 4J7XA 3VC1A 3WYAA 1AQNA 4E7HA 4LY0A 3I9MA 1SKYE 2Y4OA 5CB4F 3JAMZ 1FFBA 4FCWA 4M74A 2QR5A 3GQBA 4FZ3A 5UKDA 4E4RA 1Z06A 4IHJF 3DMTA 1AZWA 1NI3A 3NUGA 2AHRA 2WIJA 1A35A 1OA0A 3FMQA 1BEZA 1LI5A 4MS4B 2Y66A 3PRYA 4OKNA 3B7WA 3ZDRA 3IQHX 3W6PA 3IODA 4EM6A 2JFHA 2PDAA 4X6AJ 4BCBA 4EPRA 4NOLA 2STTA 2LY9A 1BHO1 4NZ9A 4BNGA 1PVEA 2Q3DA 3AR3A 2IXSA 1S7OA 4CUZA 3I4LA 1T2DA 2O57A 4D92A 1XZLA 5E1BA 1B59A 3CZ9A 4O2BA 1GUZA 1C7FA 3P9QA 2CDRA 3UHFA 1PQPA 2R7XA 3SZGA 3AZOA 3M4NA 3UF0A 2O8XA 4CUKA 3DPIA 3LSRA 2HPMA 4ENTA 3I71A 5CYFA 4ZJUA 1PWYE 2QUAA 1I3NA 3BCUA 1L4KA 1QH1A 4CKXA 2I3GA 3NH9A 4HGNA 3WP0A 2X13A 4CH7A 1PI3A 2MYPA 4DC1A 4IM7A 4NDZA 5EWLB 3K4BA 1DC6A 4BP1A 3QLEA 3RODA 1H9TA 5BWLA 4R16A 4TLMB 3JTHA 5DLPA 1RE1A 3D4NA 4RTNA 4L2IB 4OXXA 1E4OA 3N5KA 3UWSA 4D8WA 1G4UR 3LZDA 1TDJA 2XPUA 4MUBA 2CY0A 1S7EA 4YUWA 2P0YA 2Y8EA 3RZDJ 1Q0TA 3EZ9A 2IIVA 3TIIA 3RVOA 4Y9TA 2X6TA 3D8SA 3HOXJ 4YQZA 4EA8A 1PLKA 4IXWA 2QQ0A 1ONVA 2LOOA 5KJFA 4IGKA 2VE8A 2IYRA 3CUUA 3TOVA 2H4ZA 4DC9A 1QZUA 3AUAA 2P7IA 3HA5A 4RABA 1FFXB 3HSEA 1WMDA 2EILH 3CLSD 4GVPA 1ODDA 3DBRB 4R8LA 5EJ7A 3NRBA 2HQRA 1XTPA 2IEBA 4RKQA 2A9PA 5C8YB 1P31A 3ZCVA 1R6AA 3NLLA 4PGMA 4UPDA 1ZCAA 4ZQEA 3UCXA 1PSWA 1V45E 5AM3A 4JLMA 2BL4A 3GH1A 1T4CB 2W0SA 2R7RA 3A7DA 4BE1A 1P0CA 3CMMA 3ZJVA 1ULBA 4UNQA 3JQCA 5AW3A 1YI0A 1C9KA 1DEOA 3EGDA 1CF2O 2WMNB 3GLTA 2VP6A 4ABTA 3UBMA 3THSA 3MB8A 5D7NA 2C5SA 1TZJA 4YRJA 2WWHA 3V97A 4J7CA 1GQSA 4P1ZA 4X20A 1CZUA 4BX9A 4B17A 1EMDA 2ID7A 4MP6A 1ORWA 1JLMA 5TGZA 1QPMA 5DTRA 3NV9A 3VSEA 2VDVE 2AN3A 3PXUA 4W9MC 3ML6A 3VAAA 2LY1A 2M30A 2EWWA 4O1HA 3DULA 1USKA 3CNHA 2Y75A 1QFZA 3ONWA 2DYKA 1P44A 1P4RA 3G17A 3P32A 2EFEB 1JHQA 2HWXA 4A8JC 1XV5A 1H4SA 4FCVA 1YRNB 3JW8A 1DXQA 3WHIA 3Q6IA 3S1LA 4RGQA 2NZ2A 3BL6A 3OOWA 3H2BA 5TPWB 2BLLA 2J5KA 2EG9A 3DONA 1OLUB 3N7AA 5ARDA 4PGGA 1Y3HA 4DJFC 1Q0PA 1HG0A 1IPEA 1GFWA 2IT1A 3WWOA 5DIZA 2JGDA 5D8DA 2CJWB 1JTFA 1NNUA 4L8VA 5EG0A 3L1VA 1TWGJ 4FCCA 2STWA 3CJRA 3M9WA 4BHBA 4JNKA 5F7OA 3MGCA 3Q9LA 2E1PA 2WZDA 5LUAA 3IXMA 3R2JA 3UV3A 2BCJQ 4J0QA 1OX5A 2AVDA 2A5LA 4ARVA 2C88A 5CEEA 3GVAA 2VLBA 2ZRBA 1BKDR 1YQWA 5C5IA 3KP3A 5K8TA 2PQMA 2QT1A 3M5CA 4OBWA 1XELA 2XY4A 4MIKA 2CFRA 2Z56A 1M1UA 3OX4A 1LRLA 1W4CA 2JEYA 1KMQA 2KP6A 4LYFA 1J20A 1OXXK 3S3MA 3ZR4B 5CJPA 3PS9A 5LXTF 4YXFA 4TV9B 3CSDA 4PAMA 4N48A 1OWOA 2O48X 2O2EA 5KYUA 1Y3BE 4GPEA 2B20A 3K9GA 5KZMB 4PZLA 2GA8A 4QO8A 3ABMH 3M9LA 1CZOA 2IYYA 5HLGA 1YJAA 1YIOA 2HQ1A 4TZTA 3VTKA 5DX0A 1W4RA 2WHRA 4HAYA 1TC1A 2H5JA 1TCCA 1WCYA 5ES3A 2ZZNA 1I6WA 3UENA 2CJJA 2GAOA 2CUEA 2E60A 1R9MA 2BMEA 4JI4B 2V5UA 1W48A 3MWYW 1J9GA 4PYMA 1H9GA 3VPDA 2WJZB 4CXFA 3F6RA 1KEKA 3RABA 4MKFA 4YX9A 3NM6B 3FPAA 5M3MJ 3NT4A 2AFHB 3GNSA 2ETHA 1SCIA 2XECA 2I66A 1ZQ9A 8AT1A 4C08A 4R6WA 3WBFA 4FD3A 3QVWA 3WHBA 4IJ6A 1W2GA 5COBA 2ZR0A 1ADYA 2VRBA 1DE0A 4EYEA 2ICWG 3NATA 3ZD9A 1U7WA 3EA0A 2PL9A 3QWLA 1RQPA 5A62A 3NWEA 4QTXA 4L5BA 2ABWA 2GXQA 2WUEA 5K3EA 1P3DA 4HQRA 3C5VA 1YW9A 2DR0A 5HZMA 4NU8X 3OJEA 3MMNA 4AY4A 1K6EA 2DWUA 2VF8A 3INRA 4BGVA 1WJCA 4GBJA 5E6SB 4BCDA 1I32A 3FVTA 3HNPA 4M8KA 4FGWA 4L6AA 3ABZA 4WF2A 2ZRCA 3BXOA 2DODA 3DL2A 4LVUA 4ZZDA 1PZXA 4K6GA 1A72A 2LVBA 4B5LA 3JASA 3RREA 2NO7A 4DJDC 1HYQA 2WI8A 1OI4A 1EFRA 3IPYA 2I3ZA 3EVDA 5JQGB 4D5FA 3ZH9B 7REQA 2CUTA 3CDHA 1CJMA 5LGTA 1GN8A 2D5BA 5T41A 2KIUA 4F4UA 5KQMA 4WESA 4CN9A 5A4DA 1MNMC 4A5OA 3S2HJ 1NRWA 2GCPA 1JFSA 5FBWB 1T4GA 4EW6A 3DAPA 4MNUA 3G9UA 4Q9NA 2NVXJ 3SIXA 4CKCA 3SJMA 3RK0A 2WYVA 4ENUA 5T8KA 1D1TA 2AW3A 1TVMA 4HDVA 1FT9A 4B6PA 2ZIXA 2FEPA 4WX2B 1HE5A 2PX6A 3DGFC 2W6MA 2PEYA 1WPKA 2XWBF 4JROA 3S16J 2IEIA 3RVDA 3OR1C 2HRCA 1RWVA 3C8UA 3WLEA 3NFRA 4BFTA 4CEIB 4AUXA 1QYDA 3BX1A 2CCJA 3GPBA 3ABRB 1KS2A 1NHWA 2IX3A 1RUNA 2EDAA 2CE7A 1QC5A 1JUMA 2CLLB 4G1FA 2M1BA 1TX4B 1RRPA 3H5AA 4I14A 1RLMA 5F3DA 3CLVA 4D9NA 3HZJA 4ZH4F 5BW4A 1FBSA 3HFRA 2YWCA 1DUIA 2NMVA 4XRFA 3N2EA 3AESA 4O4IA 1P6UA 3CISA 4E5YA 2QTAA 1PVDA 1EYZA 4G9YA 2FZLA 4F6RB 4G56A 3V4OA 1OSNA 1EFKA 6LDHA 4BTVA 3L0DA 1VIMA 2K7ZA 1C8BA 3SHQA 3UPUA 4KU4A 1S3FA 1FY2A 4WGFA 2WJAA 3GLKA 3SJ7A 1AGYA 4NBNA 5HXAA 1C3LA 4Y2YA 4ZT5A 3E9EA 4DZJA 4MRPA 3TGLA 4TS1A 3PNOA 5MFPA 1TO2E 1N2GA 4IY1A 1VQ1A 4AKSA 3TTTA 4LXGA 1JKRC 3GRKA 4NBKA 4DSTA 1Y1PA 1A77A 4CZCA 1THZA 1A9QA 3ILSA 3GLUA 3VV3A 1NVUQ 3EODA 4IMJB 1SVSA 2JPCA 4BJ6C 1EVKA 3NYIA 2ZSJA 3VR2A 3C6QA 3MMYB 1L6IA 3O93A 4PYOA 2JK1A 4WINA 2R7QA 1UODA 5DWVA 5EQFA 3RSLA 2K4JA 2C7PA 2OM6A 4TMKA 4Z1MD 3DZ8A 4Y6OA 2CLMB 2AKEA 4HVAA 1HZZA 1DFIA 4IEEA 2ZFUA 1UAGA 4F3CA 5M5XJ 3JQBA 2F1OA 2HK6A 2ZWAA 3IPAA 1TEVA 1FUIA 3KM0A 1KKMA 5CEFA 3EFEA 4O1MA 5FOTA 4IO0A 1BH6A 1D5WA 1PQUA 4R69A 3AVVA 4RVGA 4OFBA 4ZZ0A 3B2EA 1ZW1A 2UYCA 1NOIA 4FYVA 2OPHA 2VKDA 3VSLA 1WV0A 2G9RA 4NMHA 3KR2A 2XLBA 2NZVG 3JYLA 2OLEA 4ZVTA 4G5XA 3IH4A 2H27A 4U7WA 2XWJI 2J41A 1UMCB 3AJDA 2DFTA 4FSXA 3E7DA 1NULA 1G1MA 3CRVA 4CW7A 2V6MA 4IWYA 4GOLD 4KJZA 3WGOA 5IOZA 2Q1TA 5EZ6B 2AEJA 1FDOA 4IVNA 3AR9A 5CVCA 5CA0F 3KEYA 3W3AH 3SE7A 2ZBQA 4QBTA 2ISQA 3FPGA 4V03A 2LIPA 2YMMA 2ORWA 1ZCFA 2HTSA 4DG8A 5TRDA 4DJEC 4J6EA 3PEEA 2O50A 3K4JA 4U3JA 4JR1A 1SURA 5EWJA 2W43A 1WHTA 1IM8A 1ONOA 1D4ZA 5D3ZA 5HVQC 4D9EA 1YQAA 3HHPA 4MVYA 2PQ6A 1QZXA 2KRFA 3CR7A 1U7PA 4TKLA 3SY8A 2E9SA 1P6RA 4FDVA 5B4TA 4I1YA 2V7XA 2YRXA 2AQIA 2OXRA 2BUAA 1KK1A 1NOJA 4IEIA 1RAIA 2ZIEA 1F8YA 1U3FA 5FP0A 3FROA 3UAGA 3IULA 1KDZA 2QVXX 3AQIA 5AJHA 1OB2A 4IRGA 4BGEA 2HA4A 3GUZA 2XVCA 4TVSA 1UDXA 1KEEB 4XLFA 5LCXA 1RPAA 4A6DA 1DV1A 3S29A 1KO7A 3ZW7A 5HKAA 1DUVG 1YRAA 5T6BA 3DV2A 4BACA 4PBRA 5E95A 1I5ZA 2NYVA 3PQ5A 5K5EA 1Q0ZA 2X40A 5K3BA 3ERMA 3F90A 2ZRNA 2PANA 5DBGA 4YJ3A 4XLLA 3BTIA 4JS0A 2FR1A 3TJRA 1XRPA 2DGDA 1U80A 3S2SA 1Q22A 3CVYA 5FTKA 3DJFA 4PU0A 1ZX1A 3KHSA 3KSMA 2P67A 4EELA 2QTLA 2VASA 1VE5A 3OSFA 5K0NA 3VPBA 4F38A 2VDNB 1KYZA 3AFHA 2EP7A 1UP4A 2NQ2C 1KBZA 4KWHA 5F1RA 1JGSA 1G21A 5JAUA 4WKGA 1FSHA 4KTVE 1D8KA 1PEKE 4B0PA 3SXJA 4HBGA 3HJRA 1Q12A 1UWLA 3D8HA 4BBSJ 4G2TA 1YNOA 4MI1A 1E9VA 4LJ9A 5I9NA 1BFDA 3EGWA 5ESRA 1JW9B 2PUCA 4YRNA 1T1JA 4BUCA 3GJYA 1UHSA 1RAAA 3DCFA 2NX2A 2ONZA 1MGOA 3FD8A 1UCRA 4OHCA 3NUZA 3ZYCA 3ORQA 1N7JA 5BS6A 2BAGA 1T8RA 2R8BA 1R8SA 2Q3JA 3M3YJ 2J4DA 1VPLA 2VC2B 5LD2C 4BE4A 3BSSA 4PG7A 4W8HA 1CJUC 1ZJ6A 4CICA 1M8PA 3ZQ4A 3M83A 2MABA 1ZFNA 3KPHA 3ICWA 3U2QA 3V46A 3S2IA 1KQPA 1E3PA 3MTGA 2QRVB 4MIOA 1QVRA 2BGNA 3HDYA 3DQZA 2DXIA 5B1HA 2M98A 5DNVA 2VHWA 4HRIA 3WGVA 5MN4A 3MN2A 4KO1S 3VX4A 5DV9A 1V0JA 2KPOA 4HI0E 2OV7A 1CRZA 2HQSA 5EVJA 1PS8A 1UEXC 4ZCRA 4XVRA 3J81k 4JCCA 3OO0A 3DHVA 1K9SA 2I67A 3PHIA 4CNQA 4B32A 1K5DA 3SYMA 2ZSHB 3CC4I 3U3KA 1TZLA 3CNQS 1YOVA 2R1ZA 4Q48A 3QV1A 4ND2A 4R9VA 3CURA 2ST1A 3ZOKA 4HNGA 1TK3A 2PGXA 5TMEA 1Q19A 3E7FA 1EP1B 4J8PA 4FXOA 1XU9A 2C9DA 3EGCA 2QNBA 3VR5H 3H3XA 2P41A 2J67A 1MBFA 4DLBA 3L9XA 5E3LA 3KELA 3QPSA 4L9SA 2G9NA 5KU7A 1DU4A 4QTRA 1FP6A 2XQIA 3KLMX 5CXQA 4YFVA 1Z12A 5ICMA 4ESFA 1J0XO 4QBGB 2FE1A 4Q7KA 3R7FA 5AW0A 2BFMA 4FN4A 3K32A 2PJZA 3OZFA 4P9NA 2VUMJ 1ISGA 2WBMA 3EQ9A 4O63O 1T5DX 4FJ0A 1TAUA 2I4RA 2IPQX 3C1AA 2PK3A 3R0VA 1JIUA 3CW9A 1MGTA 5KJEA 5TARA 1Z7YA 4RZQA 1Q7RA 1HSTA 3JQDA 3VR4A 1UMKA 4EGAA 2RN7A 3W2VA 2C0CA 4YP1A 5FQNA 3HABA 3E3MA 3DEUA 2GCNA 1L1RA 1AUOA 3BFPA 4C0QC 1JGGA 1AF4A 3K4CA 1K0UA 1G3MA 2DHRA 3FAKA 3L1PA 1Y8QB 3G68A 4JKOA 4Q7LA 5KVQA 2C5EA 4I4TA 1MJBA 3ONVA 2WY2D 1T1GA 2R1TB 4IV8A 2CXRA 3V1LA 5EJ2A 1ENPA 3DT6A 4GYJA 4WTOA 3DE7X 5CX1B 4H7FA 5HRCA 3D3KA 5DBFA 2XB9A 4GOND 4YAFA 3CCCA 4DSOA 3GRFA 1E3QA 4NBVA 2XUPA 1BDBA 5G0VA 3D4LA 2IU0A 3ENQA 1RJFA 2ORED 3RHFA 3L8YA 5D7BA 5D5UB 5LQUA 2D5CA 2E4XA 2JD1A 2FY8A 3TNFA 3DZIA 4KICA 2A9KA 5AJUA 5KNDH 4K87A 5CNMA 1J2RA 4OHKA 1XNRB 2ZI5A 1U3DA 2NNYA 1L6RA 5CYVA 3L4BC 1CTQA 1D3YA 2Y77A 3DJYA 1IN6A 1QRTA 4J00A 1E3HA 4XI9A 3NUQA 2QBYB 2Q21A 2WYWA 1KMIY 4DSUA 3J81A 4FSHA 5DCYA 3CVJA 4OHOA 3PQDA 3JREA 4O4HA 4PHGA 3SC2B 5DTJA 5CAEA 3I30X 5E8RA 4X8HA 3HVKA 2D8AA 5CFNA 4P4SB 1V5EA 2RGAA 2YV1A 1DQYA 3HXKA 3C85A 2G82A 4NNJA 3PL1A 1OILA 3EMDA 2NS7A 4C1BA 4UUSA 1GPNA 3AI2A 2ZKZA 1Q6ZA 2VZ8A 3K9FC 3U39A 3H35A 1AKVA 1UADA 5C8YF 1HLFA 5MGNA 2PX8A 2QYTA 1R64A 1JEYB 2XYPA 3OZDA 4JK1X