4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
b'MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
4ER0A 1V3FA 1ZN2A 2EFPA 1FYKA 4L9VA 2YX4A 4KT5C 3ECOA 4AZTA 3G8AA 3PLAE 2PT6A 1R1UA 4PYIA 1OMIA 4OIRF 3EETA 4QDJA 4DCGA 5E17F 4HGYA 5ERGB 2FCAA 4P7FA 3AWIA 2HR1A 3ABUA 3TOAA 2FA5A 3GRRA 3K9TA 4Y15A 3FRIA 4XSZF 2IP2A 2ZO4A 2HTSA 4FT4A 2YXDA 4DQ0A 5E9WA 3PVCA 1DPUA 1GHCA 3E8SA 4C03A 2YR2A 3EVCA 4PCLA 3KE2A 4IRHA 2Y0MA 4AVPA 4KW7A 5EQJB 5AIQA 2PFBA 2IPQX 4KNYA 3I9FA 2X4HA 3ORHA 2H1RA 5HLHA 5DTRA 1TTYA 2MLKA 5GIPE 3GDHA 2PN6A 5JVTA 3DOUA 3SGLA 1XCLA 4IWNA 3SSOA 3HCDA 2LSOA 3WGGA 4HGZA 1FSHA 4WXCA 4WXHA 1FBSA 3GFJA 1J7KA 2GZWA 2IBTA 1YW7A 2FMYA 3RPQA 4X61A 4YG2F 3MEXA 2DU9A 3HSRA 3JWIA 3NJRA 4KWCA 3KR9A 1SFEA 3EVEA 2A6EF 1D3YA 1R5GA 5F2NA 4U88A 2ZBKA 3E6BA 2UZ4A 2FSWA 3Q87B 3CUQA 3JWHA 3OU6A 2L4MA 3KP7A 4RGSA 5LR6A 2CWEA 2CGPA 1JQDA 3SM3A 3GW2A 4QPNA 2OB2A 3E5UA 2Z6AA 4RTJA 1O9GA 3KEQA 1Y0UA 4R6WA 2PMHA 4QLCU 3G73A 4IV8A 2UWMA 1XB4A 4PYLA 4L9TA 2F5EA 2PX8A 2K4MA 1FYLA 4HLXA 2XROA 1RJGA 1FLIA 3T7SA 4HDVA 4FT2A 2PT9A 4HTFB 3G8BA 4AIJA 2AOVA 1HSJA 3NQOA 3B7PA 3HA3A 1KU3A 1IZ1A 3KPWA 2XRNA 4UVAA 2PMUA 5K1YA 4EK9A 5HFJA 2QVOA 5FUBA 3A26A 5K0FA 2QQBA 2ZSUA 3LQQA 2XASA 1XGNA 2ZBPA 4QPPA 2ZNYA 3B89A 4QVGA 2FNPA 3LGAA 4WXDA 3LA7A 2WC2A 3KR0A 5HIJA 3O3KA 2LNBA 2D45A 2GQQA 1SUSA 3HTXA 4XBFA 1UWVA 2OKCA 2ACJA 4JK1X 2VODA 2VC0A 2VN2A 3P2IA 2ZBRA 4F7ZA 3ELDA 3HCEA 1EH6A 2IDKA 2NNWB 1XSXA 2BH2A 4DM3A 4KDPA 1K78B 3ROUA 3EVGA 3UWPA 1YQAA 3WTUC 2XAQA 3MAJA 5FLXK 1P92A 4R8SA 4P9UA 3ECHA 2ZTHA 2GA9A 2HTEA 2ADMA 4Y30A 4DA4A 3ZMZA 5CD1A 5HOOA 1L9KA 3J80K 1KGSA 2K27A 1ZG5A 3FPEA 4GGGA 2YX1A 5CCBA 4OBWA 1IW7F 4CHUA 4LB5A 2I62A 3TMAA 1X3UA 2FPOA 2JG3A 1N2XA 3F72A 5U4XA 3T7RA 4OA5A 1I6XA 2WA2A 4KIFA 4LWPA 2VT2A 2UYQA 1QAOA 4N9HA 4B8XA 3L00A 3E5XA 5FD6A 3NWBA 2QRVA 1L3IA 3P97A 3T5XA 3EMDA 4P7KA 3GFIA 4XUEA 4ER3A 2QY6A 2P3LA 3LBFA 1IAWA 1JG4A 2R6ZA 4R8HA 2A6HF 5DT2A 1KU9A 2BM8A 1T2KA 4UVCA 2ZWAA 3C3PA 3WU1B 5CVVA 3DV8A 2PWYA 1KHHA 3W6JB 4HOBA 3BWYA 2QENA 2PV0A 3AXTA 2V1DA 2J5PA 2G72A 5D5UB 3F6OA 2STWA 3T8RA 2OQRA 1YB2A 5GM1A 4ER7A 1WXWA 3DF8A 2BM9A 1RI7A 4A5NA 2HQNA 1YS6A 5AIPA 3KP3A 1L3BA 2PWPA 3HRMA 1D8JA 1BI1A 3JW4A 3HTSB 1X1CA 2YQZA 3R3HA 2BR5A 2YXEA 1K6OA 2H09A 2JRTA 2IDJA 2XYQA 4KN4X 3GU3A 10MHA 3V7RA 1GVJA 2CG4A 4OA8A 3UJ7A 2O3FA 4GOMD 5L3DA 3KQQA 3P9NA 2V9VA 3HTUA 2Y75A 5DUKA 1I27A 1XGSA 1YFJA 4BYYA 3HCBA 3ID6C 4HQEA 1USTA 3OPNA 1DDNA 3TFWA 1F4KA 5BOXA 5BW5A 1ZGAA 1N7JA 5FCDA 5H6RA 2NXCA 5CYVA 3GRUA 5DX0A 5IT9K 2R7DA 1XMAA 3K69A 4Q48A 2YR0A 4YV1A 3VOEA 4L18B 1JQ3A 1UFKA 2E1NA 3GFMA 2JPBA 3SXJA 2EFJA 3DUWA 4HX8A 3WTXC 2BEOA 4BLUA 1JG3A 4JXJA 3G2OA 1QZYA 3M1EA 1UFMA 4HRAA 3TOBA 5KS2A 2ELHA 2FHPA 3QOPA 4YUWA 2OBFA 3DFGA 2DBBA 3UJBA 3LQRA 4L7VA 2OXTA 3EQLF 1V39A 2H11A 3HHHA 1B9MA 2GXGA 1XTPA 3PT9A 3E6DA 1Z9CA 4ER6A 1OYYA 3DXJF 3DKWA 1BI2A 2W25A 1KPGA 3HA7A 2AVNA 3SHFA 3VC2A 5H6QA 2PX5A 1U2ZA 2VP3A 4I02A 4PNEA 3TO9A 4PINA 4HZFA 1KU7A 3OV8A 2ZJ2A 3QP6A 5MHTA 1QGPA 4FSDA 5CLSA 4Q4ZF 3W6KB 3GFLA 4F86A 5FA5A 2ZCJA 2FRHA 1QAMA 4LG1A 3FYDA 2A5YB 1FBUA 2DFIA 1XXLA 3M6WA 4RGUA 4ZYEA 3BDDA 2HWKA 3HIFA 3AY0A 2ZFWA 5E8GA 1SD4A 5CVIA 1U3EM 2Z6UA 2YX7A 1OYIA 4RB3C 3P9IA 3O6BB 1WY7A 1FNNA 2AOTB 3G89A 4QTTB 2RV8A 1PP7U 2AOTA 4P7JA 4PYJA 4L9JA 2AOUA 4ATNA 3GIWA 3HRSA 2QQ9A 1SD6A 5E18F 5CUQA 5EHGA 2K86A 1QYRA 2P35A 4D0PA 2HFHA 3P2EA 4Y17A 4GOLD 3KEOA 4POOA 4H0NA 4GCVA 5LLQA 5CVJA 3ERED 3EGEA 5FFZA 1W7PB 4PCAA 5D4SA 5DCMB 1R00A 4YUXA 1W7PA 2IH5A 4C4AA 5EEGA 3LAPA 3KLNA 3BKXA 1S7AA 3NVKI 1ORIA 3J81K 5JHUA 1BC7C 1VPTA 5CIYA 3V97A 4RTOA 2ZULA 1OKRA 1M6YA 4EM2A 2AOXA 5E8RA 1G3YA 2EV5A 1QPMA 2BE5F 2FBHA 5CVEA 5EZSA 4PIPA 1FZPB 5EZQA 1SMYF 3ER8A 3ZMUA 5EEHA 3MCTA 2P4WA 2R7FA 1DUXC 1FP2A 2DI3A 2PLWA 3CCFA 3KQTA 3FWEA 5P8WA 1VTNC 4BP3A 3PX2A 2ONYA 5EC8A 3MZYA 4YUYA 4C08A 5K5OA 2IA0A 4WF2A 4LLLA 2L02A 1S3JA 2HGCA 4O6JA 4RB0A 2C6YA 4RTKA 3LPMA 3NW9A 4Q5SF 4NHJA 3OZRA 2PVCA 2STTA 3G3ZA 2VOPA 2M45A 3VFZA 4U0VA 4YUVA 2P7VB 5T6BA 1R7JA 2P5LC 1YFLA 1EJ6A 3EGVA 1P4AA 3CTAA 4M6XA 1XJ5A 4HH4A 5EMMA 4G8XA 3MQ2A 3JTHA 4O5VA 4Z2YA 3FPGA 3PX3A 5KVRA 4KICA 4HV5A 4UNOA 2N47A 3UZUA 1Z91A 2M8EA 1SG9A 2QUFA 3BY6A 1T6SA 1JXSA 1X1AA 3EVDA 4H0EA 1PUEE 5CVDA 1OR7A 1EAMA 4MTDA 3U81A 2PY6A 1NV9A 3FX3A 3MTIA 2V6CA 4HYEA 4PDKA 5ICCA 1D2CA 1NW7A 5E9JA 1VBFA 2WK1A 2IVMA 3ME5A 1NW5A 2X0LA 5L3EA 3CJNA 2ORED 5HS9A 2PBIA 3B5IA 1G3SA 5D5WB 3IRQA 3DLIA 5FTWA 1BIBA 4GF5A 5KK1A 1JG1A 5DXJA 1N7IA 1HW2A 1KYZA 3HCAA 1MJAA 3GLXA 1B59A 4U7BA 2AVDA 3MFKA 5HS8A 2VOOA 1MZBA 3C0KA 4OOIA 3K6RA 5HDKA 3NDIA 1EH7A 3QU3A 3SX0A 3C3YA 3DPLC 3VB2A 2E7XA 4G6DA 1VP9A 3QOXA 3M9AA 5GM2A 1F3LA 2EV0A 2P8JA 5JI6A 4YMGA 3I0TA 2UYHA 2ISYA 9MHTA 4QWQA 1RI3A 3S68A 3WTZA 1JG2A 2G8NA 3F4KA 2EFWA 3NDJA 3KPYA 2RN7A 1PDNC 3RDIA 3HP7A 4HQMA 4KUMA 2BZGA 3TKAA 3WSTA 1X1DA 5TJJA 4E32A 1VQ1A 1MJBA 3QRFF 4XRFA 4WK8F 3A7EA 4ZH4F 4WWCA 2NYXA 4LB6B 3IWZA 1ON2A 2WA1A 2AR0A 4RB2C 3GX4X 2ZVJA 5E1OA 3WG9A 2MC3A 2ZNZA 3ERCA 3H3ZA 4MGRA 2XVAA 1G6Q1 3P8ZA 2P40A 5EG5A 3B73A 2OYRA 5C0OE 3RW9A 4P96A 4YUZA 2DQLA 2E1CA 3KQSA 4U0WA 3V7SA 3OFJA 5FQNA 2OZVA 1NBIA 2O0YA 1WQ2A 3L7WA 5K0GA 1W7PD 4MIKA 2ZIEA 3OOPA 3F8MA 3F23A 3R6SA 3ISPA 2DPMA 2NAZA 3I5UA 2GPYA 3U2RA 4EJUA 3IRRA 2NXEA 1BI3A 1BI0A 1G38A 1K79A 3BWMA 3BJAA 5IT3A 3FM3A 5E9QA 1J2XA 4U7PB 5EMJA 3O2PE 2KJCA 2RKHA 2MBFA 2XYRA 1XSDA 3K1MA 2JPCA 3C6MA 1Y8CA 3VC1A 4PGGA 5JUWA 2K4JA 3BT7A 5FADA 2W57A 4DQ2A 2GA1A 1F9NA 2JTVA 2ZXJA 4HW0A 5J6XA 1EV7A 4MQ9F 3EMBA 4EKGA 2FNAA 3I58A 1RJDA 4FGZA 3M6UA 1MKMA 2MD5A 2Z9OA 4AZSA 3NVMB 4FZVA 4CKEA 2YTZA 1ZAOA 2CSOA 5D6EA 1JR4A 1M0EA 3BPXA 4IHSA 3VYWA 2P6SA 2YU3A 1QAQA 5DRTA 5K01A 3TLJA 4B09A 3BWGA 5IH3A 4DCMA 3FXQA 5FHRA 3WTSC 3WTWC 3VODA 1F38A 1ODDA 2VBWA 4MTEA 3D2LA 3LCUA 4N9IA 3T0YA 2OA4A 3TO7A 1VL5A 4HX7A 4ZYGA 4ESBA 2P7CB 1ZRFA 1H1DA 3FPHA 3M4XA 1JSZA 2KIUA 1SUIA 1HSTA 1LDDA 1OPCA 5DSTA 3CUQB 3L9FA 4OIOF 1KP9A 5D1HA 2A61A 4L0YB 2FK8A 1T0FA 4PYMA 5DD4A 5E20A 5CCXA 4LWOA 2GA2A 2W84A 2HDCA 2PG4A 2Q0OA 5HIIA 3F6VA 1MJ9A 3V8KA 1VE3A 1R1VA 3DEUA 4EV0A 4IHTA 3KPUA 1WS6A 3GZ6A 2V1UA 4DKJA 4CDGA 1ZQ9A 5LQUA 3CJTA 5B1SA 3KPJA 3CC8A 3SZPA 3KCCA 5BW4A 5DM2A 3FHZA 2C7PA 1BBYA 2EFQA 3I64A 2DULA 1D2HA 2GAUA 4HLYA 3NRVA 3DMGA 3IKVA 3IHTA 2Y48A 1LNWA 3KR2A 4ISCA 5E1WA 3DMHA 4EM1A 1QZZA 1IXCA 3G2QA 1OYWA 3EDPA 1TQMA 4M9ZA 1B42A 4KA4A 1UB9A 2G7UA 5LQJA 3IEIA 5HILA 2XHKA 1MDMA 2B0LA 3M6XA 3OCJA 1Z1DA 4LG0A 4AIKA 2OO3A 2IBSA 2HS5A 2HV9A 2LF8A 3V8JA 2O05A 4MHGA 4PWYA 2WV0A 5E1ZB 1WSUA 2M87A 2DW4A 1F5TA 3HNRA 3JAMK 2O61A 1R6AA 5FD5A 5LGUA 2CW0F 1KQ8A 2Z99A 3MERA 4KMFA 3DP7A 4M74A 3RJPA 2B9EA 2CKDA 5JFRA 5LHGA 2UYCA 1MGTA 5GOZA 1XSVA 1XCJA 4PCQA 2FRXA 3A7DA 5KQRA 2G1PA 3R6TA 3OFKA 3K0LA 1S7OA 1INLA 4DZRA 4BH9A 5BS6A 1BN5A 5J8FA 1ZYRF 4GOND 1YZ3A 5E1MA 4ESFA 2PJPA 4CKCA 5EGSA 1WI9A 5JR3A 5C1IA 2LKPA 3JWJA 4ENJA 1HW1A 1YF3A 1R1TA 4BHBA 3ELWA 4S05A 2B78A 1P1CA 3B3JA 1L1EA 4GEKA 1XMKA 3F3XA 5K5QA 2F2EA 1VIDA 3H2BA 3THRA 3WE2A 4E2ZA 1VLMA 1AV6A 2QRVB 5FA8A 2PEXA 3DQVC 3NTVA 2QYOA 2JH8A 3FMQA 3UJCA 2EJRA 1H9GA 5LEKA 1FJXA 4YIIA 3MGGA 5DCFA 2PXXA 1YW8A 1R23A 5CJ9A 4PONA 4E2YA 2YSRA 1LQ1A 2DTRA 2BV6A 4RAYA 4U0YA 3HM2A 4CO8A 4PYKA 2G70A 3OU7A 2K02A 5ILVA 2C7QA 1W5SA 4BQAA 1BKYA 2CMGA 1F1ZA 2IJLA 2RNJA 4RGRA 3U1DA 5T64A 1IXSB 1L0OC 5LHHA 1HBXG 3ULQB 2D2WA 4HF0A 1YLFA 3RYPA 4KYWA 2VE9A 4OIQF 2ZMEA 5BXYA 4LD5A 4JBAA 2XVMA 5GP1A 4IF4A 4UV8A 3DXXA 1TPYA 4IV0A 3BKWA 3RKXA 4C04A 3F22A 2OQGA 4M9XA 4CGZA 1KPIA 3RIEA 1O3QA 1FOKA 4RTNA 1O3TA 3CUQC 4GYIA 5L3CA 5K0NA 5K5RA 2ZZMA 3MB5A 1I1SA 4P9FA 1P1BA 5FWDA 3NEUA 4U7TB 4EQZA 3R24A 1XGMA 2D1HA 5DEQA 2F5CA 1LJ9A 2QM3A 3Q5FA 3WODF 4EKIA 2ZW9A 3DXYA 1I5ZA 1G3WA 2YVLA 2CYYA 3WTYC 1TLHB 3HYIA 2Z33A 4A5MA 3UJDA 3ZMVA 1RI4A 2QBYA 2W24A 2HTJA 2VONA 3G2PA 3QOWA 3E6CC 2VZ9A 3F8NA 4F84A 3G88A 1KPHA 4ESJA 5BPDA 5D5VB 4BP1A 3CKKA 1B9NA 3UFBA 4GC9A 4EM0B 3RPUA 4M6YA 4YV0A 4MQVA 4EJWA 4UOEA 2OY0A 4A0ZA 5ICGA 5L3GA 7MHTA 4EQQA 4M7RA 1KA8A 2A3SA 5BP7A 5DLYA 1P4XA 1J0RA 3FTEA 1IXRC 1XDSA 2HYGD 5CM2Z 3LFKA 5HLGA 1B6AA 2PXCA 1ONVA 4BXUA 3HA5A 2AN3A 4A2UA 3O4FA 3CJQA 4HF1A 1ZG3A 1CF7A 4EMSA 2TDXA 3T0IA 5FQOA 3GYHX 4O29A 3WE3A 4Y13A 2K4BA 3N97A 3LAJA 1ZRDA 3FUTA 1SD7A 1I4WA 1FPQA 3BP8A 4ENMA 4YFKF 3KQWA 2B3TA 2P7HA 3FPFA 2L01A 4PZJA 1IXKA 1SAXA 4QQNA 4IVNA 1XGOA 3KQYA 1U5TB 2MA3A 5HOQA 1P6RA 2ZIFA 2FXAA 3P71T 1U5TA 1HNNA 4GUAA 2AOUB 2DPUA 1D2GA 5DM4A 3KP4A 3GO4A 1NBHA 1TQIA 2COMA 3OZTA 2EK5A 1HXDA 4V0QA 1TNTA 2RVCA 2I9KA 1UIRA 1DUSA 2CWWA 1USSA 3HHGA 2E5WA 3FXRA 2YUIA 1Z7UA 4BNCA 1SFUA 1HKQA 1TBXA 2JT1A 2O6GE 5F2OA 5E8IA 2OZUA 3JWGA 2WWYA 2OBPA 3EUHA 1O7FA 2F5FA 2I7CA 3O7WA 3GEZA 4MTLA 2O06A 1I1GA 3E97A 1DP7P 2BR4A 3BXOA 4M9SA 4L5IA 2XAHA 4I2OA 2P6TA 1XN7A 5EIFA 4C07A 3E05A 1WXXA 2CQKA 2VE8A 4S04A 1AOYA 3HVJA 3ZMDA 2GWRA 3H92A 3DLCA 1S8NA 2EJUA 3Q9SA 2M1BA 2PQ8A 3BJOA 3E6MA 1X19A 1AQIA 4U7DA 3DULA 2H6CA 3KQMA 3I53A 4R05A 3BZBA 4FX4A 3B3FA 5K0JA 2Z6QA 4M37A 5DX1A 4Q47A 4I01A 3K1PA 3M33A 3BZ6A 4QQKA 5EKUA 1SMTA 2ZIGA 5FGMA 5CVUA 4PGHA 2EFNA 3HEMA 3GGDA 1HQCA 2NNYA 5E1BA 3GRYA 1QO0D 4EJTA 5EMKA 3CLOA 4HBLA 2B25A 2D1VA 2Z3YA 2DQRA 1O57A 5D8KB 5HIMA 5K0CA 3T8TA 3C18A 1TW2A 5K0EA 1D5VA 1O3RA 3QAHA 3G2MA 2QQAA 2FBIA 3KZYA 1Z3CA 4AX8A 2OZ6A 3LDFA 4BAYA 1YG2A 3EVAA 4HX4A 4C06A 2IRFG 1LEBA 1JSXA 4QTUB 3HUGA 2PJDA 2BYVE 2UXXA 4PYOA 2W85A 1P91A 4ER5A 3L8DA 1ZGJA 4NQWA 2IW5A 1BC8C 4OX9Y 1UCRA 1HMYA 5KVAA 5H02A 4I98B 2EA4A 4RTQA 2PBFA 3FUUA 3IKTA 1EQAA 1J9IA 2KIMA 5D8LB 1M6EX 3FXUA 1DPRA 1STZA 3HRTA 3A25A 3BGVA 3SFZA 4FT8A 3KFWX 2HKXA 5DM0A 4E2XA 4KMUX 2EJTA 4OINF 3LKZA 4RTLA 4E2WA 3LSTA 3FF5A 2AOWA 1R58A 1JTFA 2HQRA 4YMHA 1JGSA 2VT3A 1G3TA 1A04A 1R5HA 2OD5A 1B4AA 3EVZA 3RIRA 1RIOH 2XAJA 3EEYA 2BBYA 3RODA 1KIAA 1MHTA 4FSXA 3KP5A 4MEYF 3KR1A 2AS0A 5HLIA 3RI4A 3QPTA 4LGWA 4XUCA 2RC4A 4I7HA 4O3MA 2WTEA 5DM1A 2NYUA 3A4TA 5ERIA 3HOTA 1E17A 4GC5A 2XIGA 5TRDA 2QLZA 2ETHA 4AZWA 1IRGA 2FK7A 2OAZA 1IN4A 5T67A 3TOSA 1FC3A 4XLNF 2NNNA 1NW8A 3PB3A 3BPVA 1U5TC 4CTKA 4ZYDA 4E30A 3WU0A 1R8XA 4RVHA 3R61A 3F8FA 3KLOA 3S2WA 4M73A 1HKSA 3CDHA 1ULYA 3WGIA 3TKYA 2GS9A 5G02A 2NS0A 5GINE 1DL5A 3ELUA 3U9GA 5ILSA 1TW3A 2XAFA 3NMUF 1BOOA 1YZHA 2MLGA 3IWFA 4FP9A 2XAGA 4G94A 2J5OA 3FTDA 5K0LA 4CXMA 2HOEA 1NV8A 5BPIA 1R36A 3I4PA 3KZZA 3V8LA 3GXOA 1IUYA 3EVBA 3SQNA 3R0JA 1MD0A 4BLVA 1G4DA 1FX7A 3HVHA 1EIZA 4A0YA 5DWQA 4MWZA 3GRZA 4OBXA 5FULA 2XGXA 3R4KA 2C7OA 5A2QZ 4G7HF 3CO7C 1PRYA 1Q0SA 4BLWA 4IRIA 3MZHA 4A6DA 1RI1A 1V4RA 5F2KA 1BJAA 2FEZA 4AD9A 3R9XB 4A6EA 1X1BA 2JJQA 3J81Z 2V7EA 2AXLA 3BOQA 4K6MA 4L5JA 2O57A 4M71A 3OU2A 4M38A 4YV2A 1LVAA 4LFUA 3ZMSA 1W4MA 4ETSA 3GO5A 4N0BA 2ZLBA 2ZCWA 3VEPA 5IKMA 1AF7A 1IN5A 3I54A 2LD4A 2M5WA 5F1RA 3LDUA 4HF2A 2NXNA 5E1XA 2GIVA 1W5TA 4X1OA 1NHAA 4AWXB 1FSEA 3ML6A 1J59A 2EB7A 2VS1A 5ICFA 4CICA 1Q1HA 3D5LA 1P4WA 4I0BA 1S6LA 3MHTA 1RI2A 4OMZA 1NW3A 4LK1F 3EPPA 5DDGA 1CGPA 5HDGA 5FHQA 2IGTA 3M8EA 3ZPLA 3AXSA 2FU4A 2L4AA 3SSNA 1YS7A 5HVQC 1GXPA 1YIOA 3L09A 2XKOA 1SD5A 5K03A 4OQDA 2HKOA 4DNCA 4PYQA 4P55A 3R0QA 4ZZDA 2PSSA 5EMLA 1K7AA 3M8FA 3GF2A 1G60A 1BM9A 2G71A 3PQJA 4UHTA 4MEXF 3M70A 1Z05A 1BC5A 1WWXA 1I1NA 2FE3A 2EFOA 3FRHA 5FO5A 4KVZA 3GCZA 2JHPA 2QZ8A 4R79A 1EJ0A 2K7LA 2GH1A 2RQPA 3IC7A 3TGNA 3TO6A 2JZYA 3N4MA 1R18A 1NKVA 2C7RA 1MDMB 2IA2A 1O3SA 1SKMA 3GUDA 4E70A 4LG0B 4RX1A 1XD7A 4HTFA 4XUDA 5LHIA 4P58A 3HSFA 1G55A 3K1NA 5BQTA 3C6KA 3PTAA 2XBMA 1ZG1A 2CO5A 1OR8A 3SMQA 1KQ9A 4A0XA 3TRKA 1FT9A 2KRFA 4ENNA 1NT2A 4RTPA 4KFCA 3K0BA 5GWXA 3BWBA 2EV6A 3FZVA 3RKYA 5D1NA 2ZFUA 4R1HA 2G9WA 3TPZA 4G9YA 4XCXA 2F5DA 2FBKA 2LDUA 2OU2A 3ELKA 2DK8A 1BHJA 5HDNA 5LGNA 2NRAC 2JSCA 4KIBA 4R8RA 1YFHA 3SZTA 1AQJA 5K8VA 3FTFA 3TQSA 3LX6A 3O31A 3ZMTA 3PFHA 2EA2A 3H3UA 2BR3A 5DX8A 2A14A 1KR5A 1B1BA 3GRVA 1UHMA 3Q9VA 3GVAA 2Y1XA 1J75A 4LLGF 3MTEA 4RYLA 2V74B 1EG2A 1H9TA 3KQVA 1IN6A 3V7CA 1SQFA 5HIKA 2MH2A 2BGCA 2V79A 3KETA 2HZTA 5DTQA 3FM5A 4MNUA 2XVCA 4KIGA 4RV9A 3T7TA 2P5KA 3FUVA 1K78A 2GB4A 3FPJA 4OQEA 3DPTA 3E3VA 2EG5A 4ZZLA 1GXQA 3CO6C 4KDRA 3EEOA 2ZBQA 5LBQA 5K05A 4HV6A 1JTEA 4TV7A 3P7NA 3BROA 3A27A 3Q7EA 2QWWA 3WGHA 2PKWA 4M72A 3CBGA 3EGIA 5FFXA 5LRRA 2XV4S 2ONZA 2ERCA 5LQRA 1PJZA 3PS9A 1LB2A 3LWFA 4CZZA 2KW5A 1LDKB 4BHCA 1FY7A 3TDZC 3UJ6A 1TQPA 2P1DA 2VDWA 3CGGA 4YFXF 4UVBA 2V1XA 3FMSA 1IY9A 3V4GA 1RJEA 4EJVA 3P9KA 1YYVA 1XDZA 2FF4A 4E33A 2ZMEB 2CL5A 1XDUA 3KQOA 1U2WA 4HC4A 3FUXA 1FBNA 1O9HA 3HSEA 1RNLA 2IH4A 4LMYA 3IV6A 2IH2A 1O7LA 1YW9A 4IXAA 5EKXA 3LBYA 1UHWA 2ZWVA 3IYLW 2B2CA 1LDJA 2VC1A 2IFTA 5E1DA 2KKOA 1BIAA 3HCFA 4RGXA 4CWAA 1L3LA 2DK5A 2PGXA 3WTVC 3C1DA 1YUBA 2PI0A 3DMFA 2YPRA 1U6GA 2XUBA 3AJDA 5FWAA 3KQPA 3EYIA 4FR0A 3LCVB 2VBXA 3V8VA 3GWZA 4P5OA 5DV5A 1DCTA 2QBYB 3F21A 4HAMA 5L3FA 2JH9A 1QBJA 2XKPA 5K09A 2EX4A 5K0BA 2Q8KA 1QQIA 4FHTA 4G56A 3ANXA 2KIFA 3UA3A 3BWCA 6PAXA 4M36A 2VBYA 4RWZA 2DAOA 3QPHA 1HKTA 1NW6A 4HG2A 1P2FA 1IM8A 3FUWA 3UBTA 1NE2A 3M7GA 4LLNA 2O0LA 3D0SA 4G7ZF 1QANA 5DXAA 3UJAA 3OE5A 3E7PA 1J5YA 1FP1D 5AONA 1KXZA 1ORHA 5ED4A 5FB2A 4A12A 3EVFA 1KQ0A 5LQAA 1FWZA 1RUNA 3MAGA 5KQSA 1VP3A 2Q2EA 1IN7A 2L54A 3M6VA 4HSGA 4HA8A 2P3OA 2A07F 1CF7B 2VBZA 3MCZA 4DMGA 1IF1A 2FQ3A 4LJZF 1ZHFA 3PFIA 3DR5A 8MHTA 3C7JA 4XSXF 5LGTA 3ZN0A 2UXNA 3SSMA 3KPVA 4UXNA 4HDUA 4I0AA 2O8XA 5DYMA 2HYFA 2H94A 2AS5F 3PQKA 4V0RA 3F8BA 4PYNA 4DF3A 1YO5C 1ZREA 1R74A 4ENKA 2IA1A 1G8SA 2PXAA 5LEJA 4JQFA 4XLPF 1E2XA 5J8CA 2DO7A 1YTYA 1RJFA 4R6XA 4IJAA 2HR3A 1O54A 2XYVA 4I09A 3OZSA 1G6NA 3REOA 3JAMZ 3MWMA 2FMLA 1XCVA 2FOKA 1ON1A 1P39A 3IHUA 5HS7A 4G6QA 2L3DA 2AN4A 3KP2A 3ER9A 1JQEA 3UJ9A 2FYTA 3TM5A 1AWCA 2IPXA 2JHAA 2UZKA 2H6BA 5EOVA 4F85A 1WKMA 4FS8A 3LA3A 3SXYA 4B17A 4CTJA 1FBQA 1Q0TA 3SVZA 2GXBA 4YIFA 5FLXZ 5BMZA 2AN5A 4EJOA 4K2EA 3B02A 3LL7A 2OPBA 5A2QK 4LECA 4BHPA 3J80Z 4MHTA 1SFXA 5CVRA 5EVJA 1T38A 4IRGA 5ILUA 3OE4A 3RTRA 3DTNA 4GOOD 3HCCA 3I71A 3FZGA 5DCMA 5LQNA 4WX9A 3COAC 4QVKA 4UUVA 2CMHA 2RGVA 5DPMA 4G7OF 2HWVA 2EWNA 4X41A 3VSEA 1XCBA 3ZQ7A 3ABTA 1WRJA 5DD8A 2DT5A 1RUOA 2OB1A 3BUSA 2JHCA 1SVUA 4CKBA 5GIOE 5EIWA 3ZP5A 3QP5A 2UYOA 4GYGA 1KYWA 4BY9E 3HOSA 4RSRA 5C9ZA 3TR6A 5LQCA 2GAFA 4GO1A 5H20A 5D4RA 3KHKA 3AAFA 5ICEA 5M5BA 3T1BA 2ESHA 2H27A 4EVIA 3J7AO 3GZ5A 3DH0A 2A68F 2CFXA 2A69F 2Z5UA 2VDUE 3JSOA 1PP8F 2HMYB 3DXZA 4AUKA 1IN8A 1LEAA 5EPEA 1T39A 3CJRA 3C3WA 1REPC 4CXFA 5LRSA 1I9GA 4IKPA 4PIMA 3BGDA 4AZVA 4RTSA 2PLYA 1MJFA 3K2ZA 4CYDA 5HZMA 1JE8A 3UJ8A 3ZN1A 2NP7A 4L9NA 4C05A 1ZH5A 1G8AA 3RKWA 4YFNF 3QU6A 4IPAA 2YXLA 1JHFA 5LSAA 4E31A 3G5LA 4QDKA 3FYCA 3X0DA 1T43A 2ZZKA 4RVDA 1R22A 1HW5A 3LDGA 1S29A 4ON0A 4RVFA 4ASNA 4OIPF 2Y1WA 1ZLKA 5DTMA 5IT9Z 3ELYA 2PX2A 5D6FA 3PFGA 3KP6A 3P9CA 3R0AA 3E5QA 2ADUA 2M30A 3MQ0A 1ZLJA 4KN7X 2Q41A 3LCCA 4WCGA 1IRFA 2ESRA 3GJYA 3CUOA 1EH8A 4RAZA 4OMYA 2QE6A 5E2AA 4UV9A 1T98A 1U78A 2KJBA 2AZTA 3G7UA 5EHIA 3L2CA 2P5VA 3BGIA 2G7HA 3TM4A 2R3SA 4P7GA 3HVIA 3EYYA 4FX0A 3R60A 2HEOA 3TDUC 4RTRA 1C0WA 2PX4A 3CVOA 2DPDA 4X60A 4LK0F 4X63A 3FTCA 2H00A 3LECA 4OU0A 5F6FA 2HNKA 2RDPA 3THSA 3RYRA 5DRYA 1H0MA 1Z6RA 2IT0A 1XVAA 2ZKZA 2P7IA 3P2KA 5F64A 2LF7A 5E8JA 2ZZNA 1L3CA 5D5XB 4RTMA 1SQGA 5KYGA 3TQNA 4GBED 4RB1A 3BJ6A 5HEKA 5LQKA 3LKDA 1Z6TA 3LA2A 1WZNA 3I59B 3FMRA 3I59A 2VXZA 1R8YA 1D8KA 1ZARA 2VDVE 1WG8A 4KDCA 4MQ4A 1JHHA 2I6GA 3JSPA 2ISZA 4AIHA 1RZ4A 4EGZA 2NXJA 1ZKDA 3WTTC 3IL2A 2F8LA 2NP6A 3LHDA 3UA4A 2P41A 4GQBA 3G5TA 2DLLA 3HRUA 1QNTA 1FYMA 1KU2A 4Y2HA 1RI5A 2IIPA 4ZTBA 3GNLA 1BOAA 4RVGA 2O03A 2O07A 5DUIA 2ESNA 3KKZA 3QV2A 4RS8A 4WVLA 2E7WA 5E2BA 4NECA 3F8CA 1TNSA 1U8RA 4GXOA 2P8TA 3NWEA 2MH9A 3JTGA 3E23A 3HVKA 4EGYA 3SR4A 2P3QA 4L0ZB 3B3GA 2GLUA 5DSXA 4KRGA 1ZRCA 3KU1A 4ZYHA 5L3BA 4NB5A
chains in the Genus database with same CATH superfamily
1BMFD 5GZ1A 1P5RA 3PLAE 4GLLA 4G86A 4YJ2A 1G3RA 2NVUA 4MJ3A 2EPFA 3FRIA 1PLKA 1X38A 3ZU5A 5KTOA 3LPNA 1NONA 1DPUA 4ZEOA 3EVCA 4WJZA 4UTZA 3ZDZB 1SC6A 2IEBA 1JA0A 5CLLA 2HOQA 2NVOA 3BILA 1RE1A 2Q3FA 2IBTA 2R8BA 3ACBA 3FTQA 4YHBA 3C3EA 1ZYUA 3SBXA 1PI3A 1QCYA 4OG2A 1YUMA 4QHSA 2E5LB 1FMCA 1JWAB 5LR6A 1NURA 1GL9B 2NX2A 2AHOA 4Y2JA 3GMTA 4AYWA 4H3HB 3KEYA 1FYLA 1P9NA 4HDVA 4FT2A 4HTFB 3FWZA 4AIJA 3UUWA 1UBGA 2CL0X 4Q3CA 4ZVUA 2E89A 4HEA1 4W8HA 3NRCA 1PNVA 4NCBA 2AJTA 1ZIXA 1OZGA 3CHYA 2PMUA 2M9HA 2VTBA 1UHSA 1CY4A 1YB4A 2X8BA 4FDLA 2KLBA 3UCFA 4FUQA 4L74A 1HG0A 2VCYA 4PO1A 2XGMA 3U3XA 4GFBA 1FXSA 3L1KA 3IV9A 4D43A 2QE7D 2C5EA 3WGQA 4DM3A 1US8A 3L4SO 3UWPA 2XAQA 1YUNA 3ZKAA 2JBAB 1W8IA 2B92A 1YBVA 3C3JA 3STHA 2QG4A 5M5YJ 2C7GA 3S16J 3IQZA 4U2DA 3IP4B 1NR7A 5BN3A 4D26A 1YQDA 2MSKA 1N4DA 1Z82A 3WL6A 2HHAA 2XQKA 2W2LD 2Z5GA 3L49A 5JYEA 1QAOA 2ZJYA 4P98A 4B8XA 2WHEA 2QRVA 4P7KA 3H4TA 3LBFA 4LC0A 2M4KA 3BE4A 1LC3A 1UMDA 3HRHA 4G5OA 3AVVA 3A70A 2JJ7A 1W5BA 3WSWA 1KHHA 1VMKA 3SJCA 3BWYA 2VDNB 1JE0A 2XEDA 1DWUA 1H93A 1JJ8C 4DSUA 5FV4A 4P4NA 3L07A 2RBEA 1RI7A 4A5NA 1RJ9A 1L8LA 4WCVA 3A1WA 1YJWI 1A1SA 3W05A 3RC2A 1J8DA 2YQZA 4G6TB 1Q84A 4MPRA 1CVIA 1RM3A 4KN4X 3UJ7A 1JMKC 4CHTA 2IZZA 2Y75A 1PR3A 2W6OA 3DMTC 4P4SA 4HQEA 1Y37A 5BMVA 1CRWG 4KSYA 5FCDA 1A4IA 2ZIAA 3N2GB 4RA6B 4HRXA 1XMAA 1QZXA 3EASA 2YCBA 2YYAA 4N0DA 3GFMA 1WJFA 3SPXA 4EG3A 3CCUI 3DMPA 4QJIA 4FWBA 2DBBA 2KQRA 4BMNA 1X13A 4GYWA 2X1HA 3E6DA 3DLAA 3T7IA 2FMIA 5ALLA 521PA 3DKWA 1YR8A 2YWBA 3T6KA 5JHFA 4ZJYA 5L6MB 3PEEA 3GJSA 1FXUA 2QPOA 3OV8A 1ZNWA 3JQ7A 3LSPA 2AT1A 4OU4A 1ZOPA 1WXDA 3TEMA 3IDZA 4I99C 1OHHA 5EWLA 1WLSA 3MS2A 5JNSA 4Y6RA 1E7QA 1QG6A 4YJFB 3M6FA 4CM3A 2Z1NA 3H75A 2Z6UA 4PGFA 5HGJA 2I4IA 2AOTA 3SHOA 4GUDA 4LJAA 1G5TA 3G0GA 1ZA1A 1UR5A 2P35A 1EVIA 5DO9A 1K63A 4Z3DA 3KCQA 3F1LA 4OHYA 3H0DA 2ZUVA 4HWGA 4GVPA 1ARZA 4N41A 2J6IA 4EGSA 4GT1A 5AVXA 4COOA 1YIAA 5J4YA 3NC0C 1BC7C 2A9OA 3V97A 2J7PA 5LNK1 1J49A 2BGLA 1U8EA 4BLOA 1GPLA 4C87A 4RUKA 4ABZA 4U0JA 1UPUA 3E9YA 1E6UA 3KQTA 1WDMA 1HZZA 3U7FB 5HPYB 4K81B 3FR8A 4S0XA 2HCBA 5CXUA 2QKYA 3OZRA 1MB9A 1GUZA 4I5FA 4GSYA 4JBGA 1MNEA 3VFZA 4B7ZA 3RQ4A 5MN6A 4LRXA 1QZEA 3CH7A 2P5LC 4H4DA 4N7MA 3D81A 3DYBA 4I6JA 5KVRA 2QX4A 3HZHA 2QNBA 1GQSA 4OGGA 1T6SA 3AL0C 1W19A 1OR7A 3PD1A 3EXFA 1NV9A 5JCOC 4NYMR 2JFYA 3RZOJ 2X85A 1CZNA 1KJWA 3QSGA 3ME5A 1NW5A 1CUFA 2BZ0A 3CJNA 1GY8A 2HIGA 1DB3A 3FGPA 5H3LA 2Q7DA 3ZW9A 3UMVA 1DIBA 3I2KA 3I0NA 4N4AA 3V4LA 3JRXA 3OUTA 4XYMA 4KMRA 4FM9A 2E7XA 2NW6A 4AM8A 2O8EA 1CR6A 3L6CA 1M8JA 2JGFA 1MT0A 1YK0A 1JPNA 4V0SA 1KZHA 4QDZA 4D0NA 4MHOA 4WWCA 1AZSC 3EGDA 1E94E 1QBKC 3OD1A 4KQKA 5IANA 3D43A 1E1YA 4JR1A 1R8QA 1SXJD 4OAQA 2XVAA 2SNIE 2B6HA 3ETJA 4U7HA 1XA0A 1UDWA 4HQ0A 4IV5A 3QYEA 3OOPA 3KYCA 3W1EA 4IM7A 4PIVA 2PMDA 2CDAA 3DVAA 3DE5X 4U7PB 5SYMA 1V5WA 1Y8CA 2A8YA 2R7ZJ 3E7XA 3EGCA 1F9NA 1SVNA 4ARZB 2ZROA 1SHTX 3RSLA 1NVUQ 4AQDA 3R6WA 4G1BA 1VG1A 1Z5WA 3Q3CA 4AZSA 3KVOA 1R64A 1FTSA 1PG5A 2C2GA 2F62A 3IERA 4ZKEA 4A1OA 5K01A 5D3ZA 1H2EA 1XTIA 3LCUA 1UXJA 2FTKE 3SC6A 3T4PA 4IJWA 5FBLB 3JR9A 2H07A 3ZY4A 1A76A 4CLXA 1NOKA 2QD3A 1WCXA 1M2GA 3BB1A 2KDZA 5FH9A 1Y0NA 2UZ1A 1P5HA 1RM0A 4DR7B 5AMXA 4IPTA 3ZCXA 4RPCA 3ZTYA 3F6VA 1AQLA 1CR1A 1WS6A 5IDWA 3KEFA 3ER6A 1FS4A 3KPJA 1WJEA 1N1DA 4PQRA 2V4UA 3I64A 5EY5B 1D2HA 4BKQA 2P67A 4FZJA 5BWMA 4QOJA 1Y7TA 4QXOA 2O8FA 2G7UA 1EVYA 4LOAA 1Y6FA 5JG7A 3NPMA 4LG0A 1DNPA 1E6KA 4RC9A 1PL6A 5AESA 2I3DA 5GJBA 3BULA 1XYVA 5FOTA 2DW4A 4E0BA 2X40A 4BVLA 3WIEA 1Y9JA 1PKXA 1NXWA 1KQ8A 1WO8A 3MERA 3FJ1A 4KVFA 3S2ZA 2O1EA 3GDOA 2RK3A 2PFSA 1ADJA 4DZRA 5BS6A 1OXKB 4KODA 4GOND 1A77A 1UJBA 4YCLA 1JEJA 3H1TA 3CSUA 5EGSA 4FHCA 3G0OA 4NK5A 4KPFC 1ONOA 3AEXA 4PSUA 5F7XA 2OCDA 3B3JA 3QU7A 2XDQA 4IRMA 4BXFA 3SOZA 1W46A 2BHYA 4E2ZA 3L7LA 5L4LA 2CJJA 1VLMA 1AV6A 3C70A 3LX5A 2VUTA 1Z4JA 4BGVA 3AI1A 1F2UA 4EHAA 1DC6A 3D6AA 2V7PA 5C8ZA 4PONA 3RKSA 2YSRA 3FDZA 1Y7LA 4TN5A 5SY6A 5THQA 5DTEA 1N8SA 2G70A 1II0A 3FROA 2RNJA 4RPKA 1X7XA 2D2IA 3MELA 2NSHA 5HA5A 1WLYA 2EJVA 4NYJQ 1DIHA 1NFRA 5AKXA 1E4YA 2GD6A 2VNIA 3CC7I 1PZHA 3OIQA 3C6XA 3CUQC 2ZIUB 3TNFA 4JYBA 1XELA 2JFXA 2H3EA 4P9FA 3VDRA 1Q15A 5C34B 4KIWA 4LF6B 1GVNB 3CCRI 1J4AA 3WGUA 1M8FA 3MWKA 2W24A 3WLKX 4BPRA 1CZOA 4D8YA 1Q1VA 2D2EA 1IMOA 2XLBA 2DFEA 4UTPA 3O4HA 1SXJE 2WWHA 1R15A 4M7RA 2HYJA 4TL6A 1E7WA 1FFGA 5JAUA 1IXRC 3MC1A 1U8ZA 2NQ8A 4RM2A 3AU9A 3IALA 4GLOA 3ZBUA 1GZVA 4X44A 4BXUA 4RIHA 2EF0A 2C8KA 4WIAA 2GERA 1RXEA 3PGMA 5B3JA 3V1KA 3HQ4O 1JIQA 1ZH0A 3H5VA 1C2TA 3ZQ6A 2XMZA 1ZUHA 3SK0A 3WKCA 4P38A 3LUHA 1NXSA 5A9SB 5J5VA 4QUDA 4IZIA 1USKA 3KALA 3KQNA 3JQ9A 1UXGA 1SG6A 2OZUA 1YACA 5BUCA 1H85A 2I7CA 2F1IA 1SCKA 2Q0QA 4G8DA 4PLGA 5JAHA 1DP7P 3BCRA 1F06A 3QEKA 2J67A 5L8VA 2XAHA 3QQ5A 1PJLA 3NAMA 4WZBE 1M2KA 3OF2A 1Y1LA 3UH0A 4PS1A 3T1HB 4C07A 3M6LA 4HLUC 1Y6RA 1Y1TA 1FFAA 4N47A 3H92A 3FOAA 1NXXA 1C9KA 2M1BA 1CTQA 4MWGA 2IGBA 5T41A 3TVTA 1PTKA 2LW7A 1QQ6A 1EA3A 3W6UA 1XB2A 2PRZA 2YNMC 3TLGB 1DE0A 3HABA 3CX4A 4L78A 3OSZA 2AXEA 2B25A 3L41A 3TPFA 1OU0A 4PQYA 2FBIA 2C29D 1ZZEA 2DA2A 5KX5B 4LK3A 4BAYA 3IP1A 1CY0A 4IJVA 2BYVE 3V46A 1OFGA 2FMUA 3TK1A 4N3GA 3T7EA 3T9CA 3AOGA 2IUTA 4WA8A 3RUIA 4D9JA 2OOSA 5LD2C 1IBSA 3I4FA 1Q20A 4JNCA 4LZOA 3WFZA 1CQZA 4PQEA 4UNRA 4FD2A 4GX1A 2OGWA 2VK4A 4JP3A 4F60A 3TQQA 4QBTA 2IIBA 1DZIA 3IH4A 5FRDA 1A36A 1GGVA 3QPTA 4O3MA 1CP3A 1A9OA 5IHPA 3OE1A 3RVPA 5JVDA 2FK7A 3F8TA 3TOSA 4EG0A 4F1WA 2CFTA 3T7KA 2ZREA 4DXAA 2Z16A 4MRSA 5F9MA 1ULYA 2Q5JA 2ABWA 1LU9A 4LRTB 5G02A 5GINE 1DL5A 4ARAA 5AKYA 4TV8B 1K4MA 1PWEA 1LZLA 2GXAA 1VHDA 2QW0X 1TAHA 2E4WA 4RDUA 1PT9A 4U7JA 5BW6B 3ZWMA 4L72A 5EERA 4TTIA 2Y9MB 5TR9A 1RFLA 3H4VA 2QTMA 2ZI6A 5C46F 1SEUA 1E3QA 1O6GA 1NLZA 1OTYA 4YCNA 4G4SP 3GRZA 4A8HA 1NVXQ 3SYRA 2C7OA 2V03A 5KNLA 1RI1A 1V4RA 4FR5A 4WECA 1NVFA 1QHYA 4LTMA 5THKA 5KB3A 1ZNQO 3FOCA 2C8JA 3M9WA 1EDDA 3QVTA 5FX2A 3CW2A 3F6PA 3WRVA 2B4YA 3DZDA 2EOAA 4DDKA 1QRUA 1GPMA 4G5HA 4Q3BA 1KEVA 1Q12A 2ZCWA 4GI3A 4EF6A 4RKFA 2JLYA 3RIXA 1F20A 4I9FA 4TM8A 2IQ5A 1G20A 3TBHA 4M0EA 4HB0A 1MJ5A 4WK2B 1MENA 2OSBA 3GFOA 1P1HA 3VU0A 3CC2I 5AM1A 3D5LA 4R1OA 2LP4Y 3T5TA 1ZUD1 5AM3A 1FTZA 1VG0B 9ANTA 4OQDA 1RPNA 4OXYA 4R8MA 4XICA 1ZP6A 3WIVA 4B34A 2YHIA 2F3SA 3HDQA 1VSTA 3S2GA 2CFOA 4J29A 4UHTA 2COEA 1FCJA 2FE3A 4OJKA 4EQ6B 1QP8A 1XNGA 5K99A 4LYAA 1G9XA 3IEMA 4DDVA 1C41A 2IHNA 2NZYA 2E48A 1YI0A 4EGFA 1M67A 3UBMA 4EUSA 1AVTA 3N8IA 4NOJA 1W6RA 2ZG6A 1RSZA 3UT5A 1G55A 3L02A 1GZUA 3KWJA 3DOIA 3INYA 3BCBA 3SXUA 1XZLA 3ZZMA 4A0XA 1WCV1 2HA0A 4ND8B 3RKYA 2ASVA 1LDYA 2JA2A 2ZSJA 3I6MA 3QLTA 2F5DA 5CP8A 4KQXA 4RZXA 2D7CA 1JI3A 4KX5A 2YRXA 1TU3A 5G3YA 5AM0A 1V95A 3R5TA 3INTA 1IN1A 3MT0A 5CXQA 1XN1A 5JIBA 2WA0A 1H9TA 3FWYA 1GPBA 1SUDA 2PD4A 2HZTA 5CTAA 1ZNYA 4R3UC 1KMIY 1MEOA 3QLUC 4R7GA 2VPRA 2I5PO 4UZEA 4HV6A 2Y0SA 1OBHA 1Z17A 4WD3A 1EM8A 4V0NA 5THXA 1ZIDA 5BSKA 4EHBA 4FGKA 4NNPA 3QVMA 4M76B 4D7MA 1IMJA 4UVBA 1CE8A 3ZLTA 4UPVA 3EN0A 4UY8I 5EP3A 5HFNA 4K7JA 2W37A 4HC4A 1O97C 4TKVA 4D98A 3CMCO 1NVTA 1RNLA 5BN4A 4LJ9A 3NXSA 4IXAA 4IUDS 1ZMXA 1HKHA 2I4RA 4MRNA 4BFZA 4I50F 4JBNA 2X3YA 3MGBA 4US2R 3V8VA 4CDRA 2JH9A 5JDIA 3TOVA 5K8LA 3E7DA 4F3NA 3ZWVA 2VJKA 4M36A 3O21A 4RWZA 2OUMA 2JEYA 3X2QH 3DAYA 3D0SA 2LBFA 1K4SA 1HI9A 1BMQA 1MH4A 1FFSA 1MAUA 1UBJS 5GZ6A 1TM2A 1HSOA 5LQAA 3TLEA 5KQSA 1IN7A 4HSGA 4TKZA 3BR3A 4Q7QA 3NHBA 2XGGA 2GD1O 3HFSA 1ZHFA 2XKAA 1CJSA 1TUIA 4IP0A 2H94A 1NLUA 2NVQJ 1E18A 2KHMA 5LZ9A 4GR9A 5AKEA 2Y1LA 2IA1A 2QW1A 4KVGA 4R6XA 3QTLA 3A2KA 5ADUS 1O54A 3EVTA 3REOA 3Q7PA 3T5GA 4AJIA 1TMOA 4E7LA 1DC8A 5K51A 3PNBA 3GCMA 4HWSA 4YCMA 2RMKA 3S2DJ 1VLJA 3BXZA 4NYMQ 5HJEA 2PL9A 2IEYA 5LZ5A 2MR6A 5KINB 4WLOA 2I1VB 3H5NA 5C1PA 3GLHA 4KXUA 4QGHA 5GPAA 4BVBA 5HZHA 3WL7A 3COAC 5I8PA 2AUMA 3ZQQA 4OK6A 5MDHA 3WNBA 4G1UC 3GHYA 4QLBA 4BX2A 1CQIB 3PR2B 1YDHA 1QV9A 4CKBA 3RTAA 3PHJA 5B1AH 4J91A 1HCRA 1U7TA 4DW6A 1UJNA 1VLQA 4OQFA 1PZXA 3SBEA 3H5IA 2BEUB 2FR8C 1L7DA 5IM5A 2HZ7A 4AL4A 2VHWA 1H89C 4WAUA 3GY0A 1O96A 3O3OB 2A0KA 3O75A 1U02A 1NR5A 2RGRA 1H8HA 3TG8A 1D1QA 2XOEA 2FE1A 2X41A 4NFHA 2R47A 1QHIA 1CS4C 2WJ6A 5KTSA 2J3HA 4LMRA 1P7CA 4Y2UA 2YXLA 3WAJA 3PGKA 4DA9A 2G6BA 3LHSA 4INPA 5KTYA 2Q45A 2HCTA 2M0MA 1CY1A 1OI7A 2KPMA 1HFJA 3QKRB 3DDUA 4Y0AA 1KY3A 4KN7X 4LZWA 3TZEA 1J2YA 1J0AA 4RAZA 4RHXA 1OZAA 1EAYA 3DV0B 4C3JJ 4PC7A 3R60A 1IATA 1KARA 5BPHA 2C9ZA 3RRFA 3H8JA 1ZM3A 2AQEA 2I65A 1N2IA 1D7OA 3OT1A 2QROA 3R3SA 5LYJA 2XGSA 2YIMA 5C52B 3KQUA 3S15J 4Q9AA 2Y6VA 4J75A 4C01A 4OREX 1L3CA 1QOQB 2OV4A 3EBOA 4KYTA 5HEKA 2VJCA 4TRJA 2B5WA 2CL6X 1X7HA 1QVZA 1WZNA 3ZPXA 1CK4A 1FNBA 1H1LB 5IUNC 4DLAA 1AQUA 3K9WA 1A2BA 1LS1A 2EKLA 2PEYA 2DTDA 4KAXA 4YXWD 2IX3A 3DTIA 4CCJA 4UNIA 1M0TA 4AO7A 5ENDA 3KAJA 4FGWA 3RIMA 4BDTA 4NMMA 5A5VA 1RQXA 2MH9A 2IYLD 1Z36A 2HQSA 1FOWA 2XF7A 2PKYX 3MTBA 4NB5A 5JVGF 1FIAA 4LXYA 2R7XA 1P6XA 4ASUA 4IIDA 5ARDA 2DOEA 3ABUA 4ZODA 4Y15A 2YYYA 5FOXA 1VMAA 3CCQI 4GGOA 1SVKA 3WQQA 5DTRA 1UK6A 2PRIA 1J7KA 4Q3NA 5KYWB 3Q6MA 1ISGA 2NSYA 2BIFA 3MILA 3NJRA 3A1YA 2E4XA 4WNCA 1NP7A 1P7WA 5BV7A 7MDHA 3R3XA 2FSWA 1BO6A 3E2IA 3CUQA 1NDQA 2HK7A 3C5VA 3D3JA 1V1MB 3I92A 4RGSA 2L18A 4P22A 4N3NA 3B6KA 3M4ZA 2E4ZA 1GKKA 3VI3B 2VKDA 3I2IA 2OC6A 1F2DA 2PX8A 1VCNA 3MTQA 1U8UA 3GUYA 1V8BA 4XGKA 1L7BA 4RF5A 3DGEC 4MINA 1E1CA 3ZJVA 4LZAA 3N7TA 3HXMA 1SELA 3GJZA 4UU0A 4OLAA 4XN3A 2IUYA 5I9IA 5DN9A 1TT7A 1I7PA 1Q14A 3QEOA 4ENPA 2M8GX 1BD3A 3ODPA 4E4YA 2C82A 3O8CA 3C3MA 5E4TA 3WDMA 2YICA 1VQ5I 3L1IA 4B48A 2MINB 1YR1A 4KDPA 3DB2A 4I6EA 1TCAA 1XPJA 2IEDA 1QKKA 4L4RA 4L7QA 1EFRD 3CZMA 1U9ZA 1JS1X 1HC7A 4RHUA 4Y7NJ 1PFQA 4YMIA 3L40A 2PMWB 3IAS1 3OO0A 3PEUA 2B8WA 1H65A 1KIFA 2R65A 3KJXA 4LB5A 1WIWA 1IUFA 3H19A 3CUUA 4YRTA 1OF1A 1U3UA 1IQPA 4XUEA 3CF0A 4CMEA 3EODA 2XMBA 2PKQP 2E1MC 2FQQA 3IPYA 1T6XA 1T2KA 4CEHA 2JLVA 3DZIA 3RTDA 3RF6A 3DXFA 3QA3E 4NG5A 3W5UA 5L7YA 3AYXB 2J08A 1UEXC 3KVNA 2XGOA 3J7YJ 2H09A 5CLGA 4BKRA 1Z15A 3CR8A 2CJYA 2ZR7A 3HTUA 2ZYRA 5C18A 1X7WB 2OOKA 1WE2A 3IUPA 2WYUA 1T2FA 1Z5VA 1ZGAA 2IYAA 1IQ0A 3DE7X 2R7DA 4IFEA 4JHLA 4HADA 4DBZA 3B78A 1MABB 3RHTA 1A2QA 5CB6A 1Q5PA 5SY4A 4LYFA 2B83A 4L0CA 2CY0A 2ELHA 4MWDA 4NTZA 4GP7A 1BHO1 1QU2A 4AVYA 2ZIXB 5TQJA 1A8SA 5DM60 2KQUA 2X7HA 2X0EA 3IIKA 3PEYA 4DXHA 4TXMA 4N39A 2OECA 2I3ZA 4PE5B 4PNEA 2ZJFA 1VQKI 3DC2A 3BFKA 3CUWA 4HDOB 1E2UA 4CM7A 4ZGWA 4YCJA 3MMNA 4C0JA 1FBUA 3FVRA 5JDCA 3RVOA 3BDDA 4O8ZA 3UK6A 1VJ0A 5JCJA 1M8GA 4L2IB 4WBSA 4B85A 2HMTA 3DWGA 4K3VA 5E18F 3KYJB 3PX7A 2OWDA 4Y17A 4ZXPA 3H3JA 2PDAA 5FFZA 3EFOB 3QEBZ 2JGAA 2DGDA 3OZCA 3KSDO 5DTJA 3C85A 1OKRA 2ECFA 1M6YA 1W4RA 1QQBA 3HDTA 3WKAA 4MP6A 4XD7D 1OFHA 5EEHA 3MCTA 3W2HA 3BL6A 3H99A 5B3KA 5J58A 4HN4B 5H68A 4BP3A 1W0TA 4L6AA 1F8UA 4MZDA 3BRWA 4J2HA 3OJCA 4JUDX 1V4BA 3G3ZA 4IRXA 4YYEA 2M45A 3ZX5A 4EEXA 4FISA 1EJ6A 3ONEA 3WL5A 5IP5A 5DYNA 4BKXA 3CX6A 1WD7A 4JFAA 4JT4A 1X1AA 3BY6A 1U2SA 4H0EA 3G59A 4XWGA 1XTJA 1IJWC 2PY6A 5F76A 3LHKA 2JVKA 1SNYA 3AVTA 5CAEA 1VBFA 2AEEA 1R71A 2Y2VA 2HDWA 4D9CA 1G3SA 1FOEB 2XNDA 1GRQA 3IRQA 1NBMA 1SC4A 1YWGO 1Z74A 1ZD4A 1TYEB 1HK7A 2EJWA 4CT0A 3HJFA 1BX1A 4I1YA 2ZTLA 3HXTA 1DJOA 1MBZA 1C7JA 3K6RA 2BKVA 1WDKA 4B3AA 1JDVA 4RK5A 5L3SB 4BMXA 2CHUA 4I08A 1TQDA 5SV2A 2PNJA 1R9NA 2UYHA 3GAMA 3RZDJ 2ISYA 3B6JA 9MHTA 1VRCA 2G8NA 4L5EA 3F4KA 4REMA 1GLGA 4D46A 3OWOA 1WUTA 5A4JA 2BZGA 3PGXA 2JCGA 1K7FB 1C3EA 1PQ4A 3SE7A 1L4EA 3A7EA 3ICPA 5K4AA 4YV7A 1R9TJ 2Z04A 4TUYB 2A5FA 2AR0A 4UE2A 5AVOA 1G6Q1 3QEMA 3B73A 3KQSA 1ZSVA 3N8NA 2JI8A 2OZVA 4D0SA 4NU5A 2Z56A 4KNVA 2PZKA 3LSYA 3A28A 3I5UA 3LUPA 1JT2A 3K20A 2YUSA 3O1HB 5K4HA 3VR3D 4DIMA 3QM1A 4XSHA 2JLUA 4H17A 1XSDA 5JNRA 3ZJYA 2JFOA 2W57A 3PL1A 4FFWA 1SVWA 3UYLA 1HZZC 1IO2A 2HH9A 5DTDA 3VDNB 2N75A 4MQ9F 2GZRA 5KSWB 4C1NA 1F9EA 3M6UA 5D84A 1Z37A 5L7WA 2XF6A 4QYTA 4IHSA 1PT7A 2WB4A 5C4IA 1SKBA 3JQAB 3GCXA 3GJ3A 1BFDA 3RFVA 1P3Y1 1YDEA 5IK2D 5IX8A 3KJEA 1P29A 2Q4EA 2JFNA 2B8JA 3OF5A 4IEIA 2O2EA 2GBPA 4M88A 4B0PA 3MFYA 4AMYA 1OI3A 3EE6A 2QNRA 1QFXA 4A0QA 1B76A 1N6NA 4TVBA 5HIIA 3J81A 2VSOA 1R1VA 3R9KA 4CM9D 2O5RA 3WU2C 3QE4A 3BSSA 2DX7A 2IF2A 1K06A 2CHVA 1LNWA 2P4QA 4QRHA 4ISCA 1QZZA 4BNDB 4V1CI 1UB9A 1GRCA 3STUA 4G0VA 2E5ZA 1MDMA 1GPDG 2JFUA 2XE8A 3Q9UA 4LXGA 2GN1A 3AEKA 2HS5A 3NCTA 4MHGA 3W8NA 3H1BA 5JD3A 4UNSA 5FD5A 4KMFA 3R0IA 2V0NA 3EWAA 2VL8A 3JRDA 1AKYA 3BHNA 1LSJA 1GTSA 4PTYA 3EAQA 1LD3A 4XZ3A 4R1NA 1TA9A 4AG3A 4D42A 4CCYB 2V4MA 3H9CA 5IVPA 2UVPB 4RU1A 5FO1A 5DISB 1PUJA 3LE8A 1EGHA 1UXHA 1DWOA 1GU1A 1GJRA 4JP8A 3KEMA 2HHLA 3DZJA 5K5QA 2VHQA 4OLHA 1TD9A 2C3YA 1NDUA 2A05A 1JNYA 4G9GA 5K0ZA 4K6OA 1J07A 5AI8A 1O87A 1KZ4A 1AB5A 3P52A 2ZSFA 1P7YA 4NWIA 2BISA 1H2WA 1ADBA 3ZG6A 1OOEA 4IG4A 3HM2A 3GPLA 2PTGA 4F8YA 2C7QA 4C88A 3REQA 3TX6A 4F0JA 1L0OC 1NOIA 4B74A 4IIVA 1AZTA 3CC4I 4HF0A 2GLOA 4ZTUB 4PYRA 4GI5A 1CP2A 3AUXA 4MO7A 5DCYA 2RHJA 1FOKA 2P6MA 3SIWA 3ROZA 5K5RA 1ABFA 2JIDA 3HXLA 2KYRA 2YRFA 1P1BA 3KE8A 2G5TA 1SHJA 4Y4RA 3KYDA 1QYDA 4GPBA 4II2A 2ZW9A 3IBTA 3HPQA 3GTPJ 4DCOA 4L5AA 2AR7A 2O3JA 1UG0A 3F8NA 2JFQA 1XZPA 2QP9X 5LU9A 1OWOA 3DCFA 1WFXA 4K86A 2X5XA 5G4KB 1E1NA 3LU1A 3ESYA 3UNGC 4YV0A 3A2LA 3I32A 4J0FA 4A0ZA 4DR5B 3FOBA 4EQQA 4M3EA 3GVCA 3OIGA 3IEKA 1O77A 5BSUA 421PA 2DOAA 4P4TA 1VJCA 4EVRA 1M7BA 2GEFA 3N8GA 2LIVA 1OLTA 2ZS7A 4LV6A 3LF1A 1QZTA 1T2DA 3Q15C 4DR3B 4IUBS 3UCEA 3TMYA 3M83A 3U7GA 3FUTA 3CQZJ 3NM4A 1RWKA 3R77A 3TBFA 5JYDA 1AA9A 4A92A 4MB2A 1U63A 3AJ9A 1J0EA 3F4LA 3KQYA 1G4AE 3LYHA 2JFBA 1U99A 1T6ZA 4YRJA 3HP4A 3OYBA 1FLDA 3OKCA 3C39A 1HKQA 1VE6A 5E8IA 1KEEB 1NMXA 1SULA 1QPGA 1U0EA 2GOMA 2RHBA 3IESA 2LG4A 3ONQA 1J23A 3TLKA 4RAQA 3E97A 3QMMA 2LY2A 3NTRA 3ZH9B 2HQ1A 4M22A 2IOFA 2DBZA 4WXMA 3HCOA 3CDIA 2W4SA 4HATA 4EMBA 4PG6A 3T5MA 1SFKA 1AMOA 3HVJA 3D4LA 2EJUA 5DLEA 1KAGA 1X2BA 4NESA 2JPDA 4NCJA 2F4OB 3UIEA 5JSYA 1YFKA 2AFVA 3ZWWA 3R9IA 3FTPA 3QKSA 5B5SA 2LWIA 5AIBA 1VL2A 1VTKA 4DLKA 2FOLA 4B7AA 5A7GA 4TYYA 4QU9A 3D8NA 2V8BA 1KRWA 1O3RA 1T4CB 3KXIA 2WAXA 3JQGB 3OI7A 3FX2A 1ZI9A 1Z3CA 3I39X 1I2CA 1R9GA 3OP1A 2JGIA 1NU6A 3FCEA 3UAWA 2HSEA 3BDAA 2Q3BA 4EITA 1ZN7A 3RTEA 1WZCA 4M98A 2W85A 5ILOA 2JSPA 2H1OA 5IJ0A 3VNSA 3C24A 3NOXA 4O2AA 1DRUA 3FUUA 1EQAA 1RRMA 4ZVQA 4NP6A 5JJIA 4ON9A 1STZA 2B9VA 5EAIA 3S70A 3KZNA 2FRVA 4BE9A 4TYMA 4N5HX 5DGXA 1KU6A 4YMHA 3VKGA 4N40A 4NCXA 3EYWA 2PEZA 4PFOA 1DQNA 3EVZA 5JNTA 1AXGA 1TEVA 4IIJF 1ZQ3P 1BQ4A 5FD8A 3GT4A 4UDOA 3A4TA 2Q3MA 3T4EA 2X2PA 1TM5E 3GX1A 5A5EA 2YV4A 3VR4H 4RVHA 5FT9A 3R61A 3S2WA 3H2KA 4NENA 4KUGA 3TFOA 5KOHA 3IUSA 1E2QA 1KDOA 3ZOBA 5ILSA 2H31A 4E88A 3JQ9C 3TPCA 1V4VA 4ZYUA 2OQIA 3C3AA 1N6IA 5M3FJ 3RRYA 2RC5A 3HNPA 1G4DA 3I2FA 5K3EA 1YIDA 1B1AA 4QSMA 2BEVB 2UUCB 1OCTC 5A2QZ 3KAQA 2HHJA 3OMYA 4IRIA 3KD2A 3DZHA 3AG2H 3ZQCA 3EVNA 3ZX4A 1NUSA 1RBZA 1WCWA 4WUVA 4E6EA 4YV2A 4EY7A 4QFDA 3LFHA 3CTPA 3W4JA 1IPEA 2XCUA 2JVJA 1KXJA 2QLJA 3IOMA 3CDLA 3U49A 3S3MA 4OMFG 5DYIA 3JD2A 4CV3A 2I03A 2RGWA 5DGCA 1MFZA 1GRVA 2NZ8A 1C0PA 3ZV3A 5TPWA 3WRXA 3NNDA 3FDJA 2HJVA 4OHRA 4J4TA 2E4UA 1EXNA 1EFHA 2PSSA 1S89A 2IOYA 4CZ2A 4E5NA 1Q17A 5E6UB 1OWMA 4Q05A 5IJZA 4U6SA 1YR6A 4GYJA 4X8OA 3ZI4A 3NIDB 3WMWA 1X80B 4RIFA 4DIEA 4MV0A 1SU6A 4RLSA 3L0ZA 1Y5RA 1ZCZA 3IC7A 1MX5A 4P35A 4IIEA 2E21A 1NKVA 2JVGA 1OBFO 4X20A 3BQMB 2HLDD 1MX1A 4Z53A 1HT2E 1KQ9A 3LS2A 1XQYA 5C81A 3FZVA 2ZFUA 1WSDA 3IIMA 4DCTA 3C6QA 1RZVA 3AB3A 4XASA 2XOKD 2FWAA 4FB4A 3ANYB 3OE7D 4JLPA 3MAAC 4A4DA 3ZI7A 1ECFA 1OLUA 2GFIA 1UDCA 2SCUA 4E6PA 4UQPA 3H3UA 3GLIB 1D5YA 4KREA 5F12A 1EA5A 2UV8A 3Q9VA 3CMYA 1HURA 2J4DA 2B94A 2V74B 5AUOB 4ZC8A 3M82A 4G8JA 1PJBA 2IYXA 3W2FA 4LWQA 2YRWA 1UZMA 1C7QA 5EINA 1BH6A 1Y5IA 3H87A 4CJXA 2N8GA 3CBGA 1U8TA 2PCLA 1PVOA 2R4QA 1FUEA 1T5BA 3UUGA 3D59A 1G5FA 2CLOB 2VQDA 2F3UA 1MMGA 2LDXA 3V2HA 5COAA 2J9XB 3NH9A 1NJSA 4G6ZA 4Z54A 1PSZA 3B6EA 3V4GA 4LKRA 4C7OB 3IOBA 4PGMA 1Z29A 4BFVA 2FF4A 4DDHA 2CL5A 4E7KA 2A84A 1U2WA 2YXPX 1XAIA 4K9DA 1A9TA 5EHXA 3IV6A 5KAIC 2QZSA 5AP9A 3W7VA 3D5EA 3I5AA 4RK1A 4MVJP 2KKOA 1EQ2A 1WHTA 1FQWA 1SGWA 4RGXA 3A4CA 3AOEC 4RZHA 3VNRA 4FR0A 1ETUA 1RVDA 4CZCA 2R5NA 4FFNA 5SY9A 3ZVKA 1NNUA 2J07A 3D4BA 4RKYA 1P2FA 3CB4A 1VI5A 3OQMA 3P2JA 2A35A 4EY6A 2IDMA 1E3OC 1OCCH 3I6BA 4Q16A 3OYJA 1KAEA 2TMYA 4DT1A 4HK4A 1RUNA 1Z4IA 5EHNA 1LSUA 2ZITA 3EBLA 4CM8B 2YWXA 3DTVB 1MMAA 5FBVB 1D0VA 5CTJA 3AEZA 1MBKA 1CF7B 2DYSH 2PPLA 2EF1A 3O7MA 3FH0A 4GX5A 4XSXF 3DJYA 4UXNA 4DEVA 4I0AA 4XD2A 1T9DA 1EGMB 1R74A 4CL2A 2H5LA 4JQFA 4WXEA 4ZA2A 1YTYA 5H82A 3R8CA 3OZEA 5I5GA 2ISSD 2X7XA 4MR7A 2FMLA 1WUKS 1P39A 2XCQA 2X4GA 1AXRA 2AN4A 1FP7A 1C1HA 3NOQA 1N0HA 1VE1A 3D1NI 3C43A 1F0YA 3O3NB 4L3VA 2I1QA 3LT4A 2TRTA 5DNVA 4MGHA 1KOLA 3PXBA 3LSIA 3VYTB 4BHPA 4EB3A 5FJ8J 3PR3A 5ILUA 1VQLI 1I7QB 5DCMA 2QXUA 2J6BA 2FPWA 3P2YA 1N5IA 4JYKA 4KVAA 4X41A 2EGHA 1S1MA 3NIFB 4HDQB 1MIJA 3QJGA 1JMVA 1YDWA 1LB1B 1VFPA 5EXSA 2RH8A 3ZJ4A 4US1R 2JHCA 1SVUA 5GIOE 3DE1X 3QP5A 2UYOA 1XHLA 1GAQA 5C9ZA 4BECA 4TT3D 3R7WA 4F4DA 2W2NA 4PN7A 4GO1A 4DV4B 1C9MA 2H3HA 2W2QA 5BQXA 5AHOA 1BA2A 1PP8F 2XYPA 3V4PB 1JHDA 1H2AS 5EZYA 4IOKA 3OZVA 2C57A 3U4QA 5JDIC 4QQFA 3SD7A 3UGQA 1JHFA 3A6GA 2HO5A 4DRYA 4L73A 3K0FA 2L17A 1PJ2A 3TTXA 4NBRA 1JECA 3W6PA 1F5SA 3CF4A 2GRAA 5FPSA 4OQXA 4ZO8A 4MDHA 1WXEA 1ZLJA 3LCCA 1EH8A 3STTA 1YA6A 4WNAB 2JLCA 3G7UA 1J9ZA 4O4JF 3EDOA 5AJWA 4RETA 1HM5A 3DT6A 4X7MA 3DDWA 1T15A 3QKIA 4Q7JB 4GOJA 4XLFA 2QMZA 3AF2A 2IT0A 1L8AA 4F9TA 1YL5A 2QV7A 3BMCA 1LBTA 4ZYVA 2XHZA 3THWB 5B2ZA 4ZZ0A 3K0KA 2HB6A 5JLWA 3UGKA 1DIGA 4D4LA 1IWBB 2IYUA 4JEMA 2B30A 2VDVE 3GDWA 4KDCA 4OXQA 4LGMA 4AIHA 4KWEA 3PDUA 4ACBA 2RBGA 3DFUA 4NBTA 3ESWB 1KU2A 1F1JA 1E2PA 3GNLA 1BOAA 2A5DA 5A0FA 2XRYA 4ALKA 5M34A 2H2DA 3JVVA 5JNUA 2QM7A 1EXWA 4B3MB 4GPTA 3CZ5A 1ZJZA 5FUVA 1GZDA 3R7AA 4QO8A 4L0ZB 4KRGA 2DFNA 2R5YA 1QS0A 3E18A 5GONB 4Q1CA 1E9RA 1L7AA 1L7OA 1EUCA 3GUUA 4K46A 1D0ZA 4HGYA 3UAZA 4IEJA 5K3AA 2VI6A 4INZA 5E9WA 4D79A 4M0MA 2EAUA 1RZRA 4MUKA 3V7FA 5JY1A 3ORHA 2H1RA 2XB9A 1TTYA 5L53A 3NZEA 3LKVA 4FJ0A 4NH4A 1PZGA 5EWMA 3TNLA 5EPUA 3QZUA 1R10A 2ME0A 4XVCA 3NHPA 1JR6A 1IBRA 4JBLA 1P2DA 1IJBA 4DJDC 4KWCA 3KR9A 5I4KA 1P7IA 1A96A 2A6EF 2WSYB 2QK4A 1D03A 4UM9D 3OTWA 1E7YA 4H1HA 2FQXA 3ONDA 4DIKA 3NVDA 4IEEA 4RQAA 4BNWA 2IW1A 1FLIA 3T7SA 3QKWA 5ILQA 2B3DA 1XP8A 1KU3A 3L8MA 1O95A 1E9EA 4QYIA 2X1DA 2ACEA 1SKQA 4LA4A 2VKTA 1NQOA 4CIYA 3W06A 5K7FA 1V5EA 4QGSA 4RD1A 1XGNA 3NB0A 1WWKA 4EH1A 4ZK6A 4WXDA 4A16A 3GNQA 2R68A 3A6EA 5JZMA 3PNKA 3LT5A 4EA7A 2R7OA 3U39A 2ZKLA 4XBFA 2OKCA 5SICE 1LLQA 3TMKA 1J1UA 4YJ2F 2WVJA 1SPBS 4Q37A 4DW8A 1RPWA 4WL0A 1LPOA 4P9UA 3HADA 3OFSA 5JV5A 1W88B 3L1PA 4KYVA 4OBWA 1U7HA 3TMAA 4P0QB 4OP2A 1KDPA 4FCVA 1N2XA 1COWD 3QF4A 5U4XA 4W5RA 2Z98A 3S1AA 5JCPA 4N9HA 2VXCA 5FD6A 2GFQA 3C6BA 3NWBA 4D0RA 3CNOA 1T34A 3NHJA 4EI2A 1IAWA 1M0WA 2ZXWH 2GUGA 3M5WA 3FKQA 4MZXA 4WKOA 3W6JB 2E5NA 2C5LA 2B8NA 4E7SA 1XTTA 3F6OA 4ZMSA 1TL7C 2HQNA 1E3JA 3EPLA 2UAGA 2OD7A 1V6AA 4C4ZA 4DIUA 3AIKA 3CRVA 5CR9A 5CLJA 1XEXB 4UCXA 4CLRB 3QP9A 1JFTA 5JS7A 7REQB 5EXDA 3ASZA 2XB5A 5EE3A 1TK2A 1L8OA 2C2KA 4UM8B 4S1VA 4EZEA 5AW2A 3DUWA 5CA1A 4YC7A 4YAUA 4PO8A 3PEWA 4D3DA 4Y6OA 4JI8B 4NJMA 1DUVG 4YUWA 4D9HA 1U0NA 3ZCRA 3LSRA 2DFTA 4X7PA 1UOOA 3HSSA 1WPQA 4LVUA 4ER6A 4V3CA 3W5SA 3G2NA 2R7WA 2QRQA 4WN3A 1OI2A 4IILA 1PO7A 3L7IA 4RESA 1K8ZB 4J0QA 1VRVA 1U2ZA 3ZC3A 1R0KA 4CFZA 2F00A 3I8OA 2CYCA 1DKLA 5CLSA 2FF7A 3R8XA 4LHZA 4UUTA 3NBXX 1UPBA 2DT6A 5TT0A 1NKTA 1FFYA 3SVLA 1WZIA 3D0RA 1GV0A 3AY0A 4K88A 2Q4TA 3PUZA 5F35A 3JU3A 4TXJA 1TUBB 4I3FA 4MQFA 3ZK7A 2F9FA 4C4YA 1XTZA 4ATNA 2QTLA 3HRSA 1PVEA 4EAAA 3HS3A 4D0PA 3ORFA 3FFXA 1RWMA 1V43A 5FFNA 2F9LA 4D9MA 1W7PB 2NQ2C 5J1RA 4EKDA 3A03A 4BFLA 3QNWA 3TAHA 4CMEC 3WLLA 3BKXA 3L2OB 3LOPA 2XGDA 5CFRA 5E8RA 5BMVF 4BZZA 1G3YA 2EV5A 1QPMA 3S55A 5EZQA 2JJMA 3RKQA 3IXMA 4Q9LA 1I6LA 1NUAA 4WXPA 1MAWA 1VTNC 1FVOA 2CJPA 5CT6A 2HRDA 5TV2A 4C08A 3N2IA 1QVTA 4CDMA 4TMZA 2G06A 3DKYA 2STTA 2GJAA 4GE3A 1EBBA 2P7VB 2YXNA 5DHTA 3BYZA 4M6XA 4DWJA 5A04A 2VHEA 2JARA 4UNOA 3TYXA 2HFJA 4D6YA 4BTLA 2BFFB 2X51A 2C1XA 2V6CA 2RONA 3UW3A 4B3SB 1Q11A 3RSCA 1V16B 4N9QA 5J1YA 3RK1A 3KBBA 3JZAA 4HXYA 2CYBA 4HEA6 3N2LA 3R7FA 4CF3A 3HCAA 1AUQA 4OAPA 2V59A 1T6NA 3C0KA 5HDKA 3C3YA 4G6DA 3QOXA 3M9AA 3NHRA 4YMUA 1F3LA 1HNXB 4PO3X 2Z5LA 4CU2A 5ER9A 4RH1A 3WIUA 2B69A 4WUTA 2ZXEA 3CR7A 3MXOA 3ZCPA 1XJCA 2WB1N 1BXRB 2JAHA 1M8KA 4HQMA 2GPSA 5JDCC 2GXUA 5BNFA 5HKKD 4BP9A 2HNAA 2IS4A 1RYZA 2AN1A 3VMFA 4YGXB 2IDZA 1E9FA 3CIFA 1VQNI 2P40A 5TPZA 5IDVA 2J30A 3CNLA 2OXIA 4BCCA 4I6ZA 4B4KA 5B6IA 1XNQB 2XPUA 2B2NA 1IV8A 1RYHA 3AV0B 2AFHA 1AQYA 2A1IA 2NXEA 4FFBA 2X6WA 5IZCA 4J94A 4PLYA 4LXHA 4UUSA 1ZN8A 1P3DA 1E4EB 2E82A 3HWWA 3IDSA 1XNHA 4X7RA 5JUWA 1OCZH 4Y3UA 4G0PA 1CUHA 1WXGA 5IYCJ 4WEOA 4OQNA 2EWMA 1MBJA 4Y6LA 2Z9OA 3A6PC 4FR2A 4JQSA 1MGPA 1T6YA 2OR3A 1U6IA 3W5BA 4UAJA 1A88A 4MGZR 2DOKA 4Q4AA 4DCMA 3UGTA 4TT8A 4G5RA 5G3ZA 3D2LA 4LZPA 1FFBA 2PZ8A 3R3VA 4ECAA 2R66A 2RAEA 1P45A 4R41A 2BT4A 4XJSA 1QCZA 5KVQA 4G2NA 1T0FA 2QLMA 1B0ZA 3RYIA 4LWOA 4MKGA 2XXBA 3TSAA 2QSFX 2WOJA 3VUEA 3DCNA 3AOEA 2P6UA 1ZQ9A 1SB9A 4BHTA 2G4LA 2ZAYA 2EFQA 4S35A 3PA8A 3IAXA 4BMPB 5C8YB 3FMFA 3THYA 5PGMA 1TMYA 4DLPA 5ALOA 1TQMA 4KO3S 4YS6A 1HQKA 5JALA 4S0HB 5CX1A 1MOQA 1JG6A 2Y0DA 1E32A 5JSQA 5EE1A 2UUOA 1IOVA 2ZTUA 1F8XA 4ESHA 3T34A 1IUPA 1PX0A 1F5TA 3AIMA 3HNRA 4QUBA 5LGUA 1T5IA 4GX0A 5JXWA 4EX6A 3E5HA 3PL8A 1XEAA 3AVWA 4F3YA 4LZLA 3TRHA 1FUYB 3WXBA 2P4SA 5E1MA 2GD2A 3L43A 4NYIR 3IJPA 1HW1A 5FI3A 4MV7A 2IBDA 4BHBA 1R4MB 2BTQB 5LNK6 1TJPB 1SBQA 3TP0A 3ZVMA 4Z4EA 2HXSA 4G9BA 3GL9A 2ZRQA 5FUMA 4O6VA 2DLNA 4JIMA 5J40A 4JR0A 3WA7A 2HQOA 1SKYB 2ZM6B 1NTOA 2CJWB 1B8IB 5HTOA 5BQFA 3K4PA 2R7RA 2FSHA 4E2YA 3F9IA 4ANJA 1BHSA 2WZCA 4ZHQB 3EBPA 2IJLA 4M6WB 4Q1EA 2YWJA 4UMFA 4E7PA 3HFRA 2XVMA 3DXXA 3JAWA 3BKWA 3DO6A 2RC6A 4R81A 4TYWA 1DEOA 4ZVVA 5L3CA 3TD6A 4JYPA 4IIHA 4HN2A 2BDTA 4D7AA 3AR7A 2DPXA 4JDUA 1XGMA 1DG9A 4HYYA 4KQ9A 2HIMA 4URZR 4HNRA 1YJXA 4F93B 3PEFA 2NU7B 4MWEA 4DSOA 3BTLA 3NAZA 3G2PA 3V7WA 5AVUA 5BT9A 1MO6A 2ZC2A 1R0WA 5BPDA 3AVPA 2JJ1A 4M8SA 5KSZA 2QTZA 4PFJA 3SNKA 2FPKA 5KJFA 5LWHA 2NV2B 5B5EC 3BK2A 2O7QA 3PSIA 1YA8A 3IE2A 4MO9A 1CBUA 3BBPA 2C2BA 4UREA 1XRPA 2HSJA 3L6EA 3QI7A 2WJ3A 5AOAA 1UELB 2C9DA 4U9HS 3WDSA 4O5AA 4ENMA 2WYVA 2L01A 4IVNA 1XGOA 4MKZA 1LCIA 3LT1A 4WBXC 2KBEA 5HOQA 1A1VA 3TTSA 2XIJA 4GUAA 3R7DA 3GO4A 2VP6A 3VVCA 4ZVTA 3MUNA 3KFXA 4WTOA 1JBEA 1ISFA 1L6RA 2YIJA 4M7OA 4C3IJ 3OKFA 4OQ4A 4JSRA 2W2VA 3U1TA 4U7WA 3B13B 4XWAA 4N12A 4DZZA 5NLLA 2VE8A 4S04A 1GG2A 1EGVB 5BSTA 3SLKA 2GVZC 4JAVC 5AW7A 3E6MA 1OKKD 2VP4A 1R7RA 2CB0A 1AXEA 2BN4A 1U7ZA 5B2FA 4GKBA 2FZ4A 2XGCA 3JRCA 4EY5A 4AY3A 1AKTA 3L06A 2D5IA 2Z3YA 3LCRA 1VYTA 4RH0A 2PJRB 2QQAA 4C6TA 1WJBA 3PEVA 1E98A 5TF4A 1DMSA 2X8JB 2IY9A 4HX4A 1UBSB 4KGZA 3USZA 1B93A 1XZDA 3SX4A 2R8YA 1DBIA 2WM3A 1ZGJA 3JRWA 4F9EA 4ERXA 3QEJA 2W7TA 4LJSA 4N3AA 1JYFA 4RVCA 5J3JA 3PD0A 2EA4A 3PJEA 3M7IA 4RMJA 3ITKA 3A25A 4AZ0A 2F43A 4RCVA 3FF5A 3OYAA 1U3TA 1JGSA 1EDOA 1QYVA 4YECA 2MOKA 1GSOA 2A94A 2JIMA 1S0UA 4IDHA 4Z9BA 2ADOA 1YGPA 2ZJQF 4O4HB 3NR2A 3C2QA 3TNJA 2QORA 5K6AA 4NAUA 4TQAA 2QZ4A 4BMCA 2GFHA 3CH6A 5JSKA 2Y1FA 3CVVA 2OCAA 4BCBA 2O5VA 4M0CA 4FI3C 1PYDA 1K4TA 1GNSA 3MD0A 1UKAA 1AU7A 3KOZA 2GS9A 1VJRA 3R3UA 1FXWA 1P77A 2O3TA 5TJ9A 3EIUA 4D8WA 1JQ5A 2WMNB 3G79A 4Z51A 1R36A 2F64A 1OCPA 3Q7RA 2QT1A 4H16A 2V6IA 2FWIA 2W2TA 1FX7A 1Q3TA 5CM9C 5DWQA 3ZE0B 4NHOA 1T26A 3KKQA 1D2MA 4M1OA 4QPJC 1Q0SA 1GZ7A 1UZAA 4DANA 3OZDA 1AKNA 2QA5A 4BN5A 1NASA 4UHJA 4PXAA 4XONA 4IXTA 3VJRA 1V48A 1ZFNA 2DFDA 1S5LC 3IDQA 3KT0A 2M6RA 3DDHA 3SDZA 1G5IA 1LFPA 3AEYA 3PWSA 1VZ0A 2LD4A 3O47A 1M1YE 5ECGC 4DR4B 1PDVA 3FI0A 4FMCB 4KXXA 4YTEA 1J59A 3CNEA 2WUDA 4CICA 3RS9A 3RC9A 2PS0A 1GCOA 5JVDF 2JL1A 2XKOA 3D6HA 1ODTC 1FUKA 1UJ5A 4P55A 4RDIA 3AR4A 3LSHA 1GZHB 2C9YA 2G71A 4XRRA 3KB8A 1BC5A 1Y8RA 3BR6A 4HB4A 1L5HA 1XV5A 3NHYA 4FBGA 2P4UA 5KMGA 1EJ0A 1N5OX 2GH1A 1RTTA 3P20A 1QHXA 2WAYA 4PZPA 4WK4B 4QEDA 2XIQA 1GFSA 1L4UA 4LMAA 5T4FA 5BQTA 2YFKA 4D4MA 1NT2A 3VHLB 1ZCFA 5ICSA 4ZAZA 3S17J 4M9CA 4ZXFA 2E36A 4M3DA 2HAEA 4D4GA 5F2EA 1PV1A 3A6ZA 1VQ8I 1MOSA 3D7RA 4X5OA 3OS2A 3GTGJ 5JD5A 4Q9KA 2RD2A 3O31A 2R9VA 4V2GA 2CWDA 3VH4A 4CKCB 2Y68A 4L8GA 1U5CA 5FR2A 5TVKA 1AHNA 5D5PA 1ZWLA 1U04A 1M75A 1NMZA 1GD1O 1RWNA 1NA5A 2ZYSA 4CL0A 1JALA 5EJ4A 1MBGA 3A4MA 4ZVOA 3FHJA 4JBXA 4E5DA 1YJQA 2YV3A 2R8PA 2BHTA 121PA 3IHLA 3EGIA 5CMLA