4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
2XBMA 2L4MA 4GC5A 2YTZA 5K0JA 1R5GA 4CKEA 2CMGA 2QYOA 1VIDA 2ZIEA 3HA7A 4DA4A 3GCZA 4CXMA 4ON0A 2OKCA 5KVRA 2ISZA 4KICA 3R60A 4BY9E 1BI0A 2PLYA 4U0VA 4YIIA 1G60A 3J81Z 1LDDA 2XV4S 3IKVA 2C7OA 4RB2C 1UIRA 3EVFA 3ELUA 1NW6A 5EC8A 3RKYA 3F6OA 2W84A 5D6EA 4RAYA 3LCCA 3MTIA 4RTMA 2UZ4A 2GXGA 1J9IA 2VT3A 1RJFA 5L3BA 5HIMA 3AY0A 3KKZA 2AOTB 3I0TA 4POOA 5DTMA 5D1HA 4PYQA 5H20A 2NXNA 3B02A 4C06A 4I01A 3HCDA 5GP1A 5FA5A 2IBTA 3ECHA 2Q0OA 3EYIA 3IHTA 1T98A 3SZPA 5L3DA 5LQNA 3I64A 3RYPA 1YFJA 1H1DA 3GFLA 2L54A 3DXXA 2BR5A 3E05A 5K0LA 2J5PA 4LJZF 3N97A 2YXLA 1NHAA 4DQ0A 3KE2A 3MERA 4KDPA 4ZYHA 3V97A 2EV6A 3DXJF 2FRHA 5E1DA 4X60A 2Z99A 3LQQA 1FYKA 1QAOA 4V0RA 2W24A 1TLHB 5DRYA 2MA3A 3HRTA 3CJTA 3J80K 1KQ0A 3SHFA 4HDUA 5KYGA 3M33A 1O3RA 2M5WA 3KEQA 2ZJ2A 1WQ2A 4ESBA 3DXZA 3G5TA 4G8XA 2BM9A 3G8AA 2ZIGA 3LDFA 5E1BA 3ZMVA 3IKTA 1B9MA 4L5IA 2P5LC 5F6FA 1MJ9A 4ZYDA 2YX1A 2HWKA 1XCBA 3TQNA 1VQ1A 5TRDA 4ENMA 1X3UA 5F2KA 4IVNA 1D8JA 3FTFA 2XVCA 2PWPA 5CLSA 2IPQX 4E70A 1Z05A 2GB4A 4HOBA 5DM4A 3CBGA 3GZ6A 5U4XA 4DM3A 4DCGA 5K0BA 1IRGA 2V1XA 5LGTA 2H6BA 1FLIA 3P9NA 2VE8A 1Q0SA 2B2CA 1P39A 3W6KB 5EIWA 3TMAA 4HG2A 2ZXJA 2JPCA 3U81A 3WTWC 2EA2A 2R7FA 4ZYEA 5EZQA 2Z3YA 2UZKA 1Z3CA 3B3JA 1K6OA 2ZNYA 2Q2EA 2QBYB 1YLFA 3MZHA 1E17A 2IT0A 2HTEA 2QUFA 1TTYA 2YX4A 3E5QA 2FHPA 1IZ1A 3QU6A 1HW1A 1JG3A 1ZGJA 3MEXA 2CMHA 3F8FA 3OFKA 4PIPA 4YUXA 3ORHA 1R1VA 1OMIA 4IWNA 3LCUA 2EA4A 3M9AA 4HRAA 1D3YA 3GRYA 4RTOA 2VN2A 2R3SA 2QRVB 3FXRA 2JT1A 3IEIA 4EM0B 2WA2A 5LHGA 1HNNA 4I2OA 3B7PA 2PN6A 2DPMA 3LCVB 4GOOD 5EPEA 1JQDA 2YSRA 1JHFA 4QLCU 4DQ2A 3BPVA 5TJJA 1GXPA 1I6XA 2QQBA 3FPEA 4YV1A 3HRUA 1XMAA 4XCXA 5A2QZ 5DT2A 3D2LA 4DCMA 1QZYA 4HQMA 5BW4A 3ISPA 4U88A 1FT9A 1QGPA 3VSEA 5DSTA 5E9QA 2NXEA 3PTAA 1F3LA 3PFHA 3LHDA 2K86A 4Q47A 3BWYA 4DKJA 4RTLA 5CJ9A 3V8LA 4C4AA 1FC3A 4IJAA 3GIWA 1C0WA 1G55A 3RODA 4LG0A 4C05A 2HV9A 2VC0A 1R58A 3HUGA 4I0AA 2GA2A 3E23A 2P8TA 1IW7F 4KMFA 5GINE 4A2UA 3AWIA 5C0OE 4AIHA 1P6RA 3PQJA 2C6YA 2OU2A 5LSAA 3SGLA 5LQUA 1LEBA 3BWCA 3HTXA 3FZVA 5K09A 5CD1A 5HFJA 4N9HA 1L3CA 1M6EX 2XYRA 4GYGA 4NQWA 2PXCA 1V39A 1SD4A 3E5UA 10MHA 1J59A 4PCQA 3DEUA 3T0YA 1HXDA 2ZMEA 1QYRA 3W6JB 4CWAA 5D5XB 1LDJA 1KQ8A 2P41A 3R4KA 3L09A 4OOIA 5DM2A 2O57A 1WY7A 2HYFA 2PX8A 4RTPA 1D5VA 3EVZA 3FUVA 2GQQA 3FRIA 2LNBA 3HVHA 2XAGA 4AZSA 3OV8A 3J81K 2JG3A 1YUBA 4HQEA 2OZVA 2K7LA 3VC1A 5FLXZ 4RB3C 3MAGA 3BUSA 5DWQA 4B09A 4C07A 4YV0A 2FK8A 1XTPA 3UJ8A 4L9TA 2Z6AA 1E2XA 2IDJA 1K78B 3L00A 3NVKI 3UA4A 2WC2A 2HQRA 5E1WA 3KEOA 3K1NA 1EJ6A 4E2ZA 1XDZA 5T6BA 2VBWA 3X0DA 3FTCA 3G89A 3RKWA 4PYNA 1NKVA 2PEXA 5EKXA 1MKMA 4RWZA 1TQMA 1F4KA 1DP7P 3GW2A 4LGWA 3UJ9A 3O6BB 2ZCWA 1MDMB 1BI1A 2M87A 2RN7A 4IV8A 2IA0A 2VC1A 1SUIA 3BT7A 1ON2A 3ZMSA 1X1CA 1RI1A 1BI3A 2RQPA 4BLVA 1MDMA 3HCFA 2HR1A 2EFNA 3CCFA 3TM5A 1LNWA 3KP6A 3ABTA 1SUSA 4M73A 5E8GA 4CGZA 2LDUA 2F5CA 2YVLA 3LKZA 1JXSA 5JUWA 5LEJA 4HDVA 5L3EA 3HYIA 5JFRA 4C04A 4ER0A 1TW3A 3M8FA 3QP6A 5BQTA 2F2EA 4Q4ZF 1IN4A 2L02A 1SFUA 3AXSA 5IT3A 3HP7A 3TQSA 5E9JA 2Z5UA 4XUEA 3ZMDA 3JSPA 4KW7A 2VDWA 5K05A 4FR0A 2PGXA 4GUAA 4WWCA 4MEYF 3TGNA 2HS5A 4M71A 3G73A 3BWGA 5HDKA 5EKUA 2DAOA 2F5DA 1N2XA 3HEMA 2G7UA 2UYCA 1QZZA 4O5VA 4QWQA 3U9GA 4UVCA 1FY7A 3K0BA 1M6YA 2KJCA 3CJQA 1MHTA 2DULA 3GX4X 3R6SA 5FADA 1EIZA 1KIAA 4AIKA 4CDGA 2EK5A 2AN4A 1ON1A 2V79A 1NBIA 5M5BA 3C3PA 3TRKA 3KP2A 2PVCA 4FT4A 5L3CA 2G7HA 4PDKA 2PG4A 4GOLD 3G2OA 4RVGA 1HKTA 4B8XA 3JWHA 3OFJA 4G56A 2UXNA 1DCTA 1V4RA 4HLXA 2O61A 2FXAA 3E97A 3KP7A 1YQAA 2AOTA 4UNOA 1YB2A 1ZLKA 5CVUA 1BOOA 4UV8A 1IXCA 3ZMTA 2FYTA 2I6GA 4LLLA 4HYEA 5LGNA 3BY6A 4G9YA 3PFIA 2KIUA 3GUDA 3JSOA 2O05A 3BKXA 2HQNA 4GYIA 5LQKA 3EVEA 2XYQA 3TOSA 5E20A 2Q41A 5EMMA 3VEPA 4KA4A 1UHMA 1JG4A 3WU1B 1I5ZA 3OE4A 5FULA 2CW0F 1X19A 3FM5A 5FHQA 3RDIA 5GIPE 4L0ZB 1BC5A 5BS6A 3K6RA 3LDGA 8MHTA 2EJRA 3K69A 5HLGA 5ILUA 3O4FA 4LMYA 2AOUB 3FWEA 2PMUA 5EHIA 1U2ZA 2GIVA 1YZHA 3H3UA 4Y30A 2AZTA 1NW7A 4YV2A 4I0BA 3WU0A 2P3LA 4Y15A 3P2KA 5HEKA 2LF7A 4R1HA 5DDGA 4KRGA 1Z7UA 3EPPA 3OE5A 2NNNA 3L9FA 4U0YA 4NB5A 3SSMA 2NYUA 1W5TA 2DLLA 4M9SA 3FYCA 4AIJA 3M70A 3ZQ7A 4AUKA 2O6GE 3CC8A 3EQLF 2G72A 2JHCA 3LSTA 2RV8A 4S05A 3E6CC 4RS8A 3DPLC 2GWRA 1RUOA 1XSVA 3RPQA 4FP9A 3BWMA 1ONVA 2EFWA 3KQOA 2FNAA 5FGMA 3M4XA 2CQKA 1I1NA 4O3MA 4K6MA 2CL5A 1SFEA 1HMYA 4LK0F 5CCBA 2D1HA 3NQOA 1KGSA 2CGPA 5ILVA 3RPUA 1T43A 1IXSB 3FUUA 3KHKA 1S7AA 3WTTC 2A5YB 5KK1A 2BH2A 3KPUA 3QU3A 2UYOA 3ZMZA 2XAQA 4LFUA 2X4HA 4YIFA 3FXQA 3IHUA 2HFHA 5K1YA 5HOQA 2GXBA 3BKWA 2EX4A 3SXJA 1A04A 1WI9A 2VBZA 2PQ8A 3LWFA 2E7WA 2L4AA 4GQBA 4F85A 3P9IA 1WZNA 1TW2A 4FS8A 3HSRA 4LLGF 4MTLA 1XD7A 2NXJA 4U7TB 5CVEA 4FSXA 4OA8A 2ADUA 3DULA 2KJBA 5EEHA 4MIKA 2JRTA 3CLOA 4PINA 1LJ9A 3F4KA 2PX4A 5BXYA 2G9WA 2BR3A 3Q87B 4YUYA 4OIQF 3RKXA 3MTEA 4BHPA 4GEKA 4MWZA 4F86A 3UJBA 3I54A 1UHWA 5FQOA 4IRIA 1G6NA 2M45A 4WK8F 2A69F 2IW5A 2YX7A 3P9CA 4XUCA 1ZH5A 4KDCA 4QVGA 3P97A 3VODA 2YXDA 3LAPA 3CO7C 3ERED 1KR5A 3KPWA 3TKAA 4DMGA 5LQCA 2K27A 5BPIA 1JTEA 5GIOE 2JH9A 1R74A 5E1OA 3T7SA 3HNRA 3IWFA 2JHAA 2I9KA 4KT5C 3OOPA 3FF5A 5LQJA 3G88A 2XAFA 1P4XA 1EH7A 3L7WA 5HVQC 5HIKA 1QPMA 5CCXA 3HVJA 4XUDA 5ICFA 3ZN0A 4H0NA 2XKOA 1XCJA 1T2KA 4A5NA 5KQRA 2P8JA 4EVIA 2VDUE 2BM8A 2FMLA 1NV8A 1R00A 3LECA 4QVKA 2YXEA 5LRRA 3P9KA 3PX2A 2GAFA 3CUQC 2JTVA 3C7JA 2HZTA 1T0FA 5CVJA 4Y13A 2JJQA 4LD5A 1YTYA 3BGDA 1SD5A 1Z6RA 1JR4A 2EB7A 3DMFA 1NT2A 3UJCA 3DFGA 1LEAA 4KN4X 5E8JA 5DV5A 5E8IA 4RTRA 3S2WA 1R8YA 2R6ZA 4HF2A 4OQDA 4R8RA 4IPAA 4RTQA 2P5VA 3QOXA 5H6RA 3S68A 2F5FA 3IYLW 1Q0TA 4E30A 4IHSA 5K03A 2OA4A 3HHHA 3SSOA 2XROA 1L3IA 1YIOA 4CKCA 3HIFA 4MHGA 2H6CA 2BEOA 2ELHA 2R7DA 1EV7A 1O3SA 2ESHA 3EVAA 3U1DA 1ZN2A 5D4RA 3A7EA 4G7OF 2KW5A 3KR1A 4BLUA 5ERIA 1HKQA 3KPYA 4RTKA 2STTA 3COAC 1HKSA 3ID6C 4HTFA 1SD7A 3R0JA 1XVAA 4RV9A 3FPGA 4KFCA 2ZBKA 4PYKA 3JWIA 3ABUA 1BM9A 1XDSA 1OYWA 1D8KA 3O2PE 1P92A 2HYGD 1J0RA 2P6SA 3A25A 2VS1A 3K2ZA 3V7SA 2F8LA 2PXAA 4LB6B 2UYQA 3OPNA 2FMYA 2L3DA 3HCAA 3TM4A 4I98B 5BW5A 5LGUA 5HS9A 2GLUA 4EQQA 1O54A 3RYRA 3SSNA 3MZYA 5FFZA 3DR5A 4Q48A 4H0EA 1UB9A 5FWDA 2NXCA 4QPPA 3B89A 5GM1A 1YS6A 3I59A 1ZG5A 3WTUC 4G94A 3G2PA 5LHHA 3KQTA 2ZWAA 2MLGA 3V7CA 5HILA 4XBFA 3IWZA 3G8BA 2DBBA 5E2BA 1JTFA 3QAHA 5F64A 3TKYA 3F22A 1FYLA 1D2HA 4GOMD 3NRVA 1QO0D 4E31A 4YUVA 2MC3A 3FZGA 1G8SA 4WF2A 1KHHA 5ICEA 4OIOF 1Z1DA 2XVMA 4CYDA 3KQQA 1XDUA 2OD5A 2OXTA 5DM0A 1Z91A 2ZFUA 4GXOA 4RVHA 3P71T 1ZARA 2KIMA 3KZZA 1FZPB 4IRGA 3HRMA 4OMYA 4ISCA 4EK9A 2BBYA 3C1DA 1AWCA 2HR3A 3H2BA 4U7BA 2E1CA 4HAMA 1U8RA 4YFNF 1K79A 3MCTA 4CXFA 3HA3A 5HIJA 3K1PA 1PP8F 2GS9A 5K5RA 1TQPA 1R36A 2IBSA 1UFMA 3CJRA 3CUQA 3VOEA 5LQAA 3MQ2A 3ML6A 4PYOA 4HW0A 3K9TA 1R6AA 3F21A 2ZBRA 4LECA 1P91A 3GZ5A 4HX8A 2GA1A 4RX1A 3R9XB 1WXWA 2CWEA 3SMQA 4QDKA 3HSFA 1K7AA 2P7CB 4B17A 3SZTA 3BGIA 3LBYA 4RSRA 2RKHA 4M6YA 2NP7A 2EV5A 3K1MA 2AXLA 2DQRA 2B78A 3DOUA 3VB2A 2XUBA 2MBFA 3HTSB 4PYJA 1IRFA 1B59A 1IY9A 3SM3A 4IRHA 4HGYA 2Y1XA 1OYIA 1DUXC 2PX5A 4KVZA 1UFKA 1ZHFA 2ORED 2XRNA 4BLWA 2FE3A 4AVPA 3DMHA 5F2OA 1SQFA 2BYVE 3KU1A 2V9VA 3FUWA 2XGXA 1KU2A 1KPHA 4HA8A 5H02A 3HHGA 5DYMA 3AXTA 5BMZA 1SQGA 2XAJA 1R1TA 2O8XA 3FRHA 2Q8KA 3TOBA 4N9IA 2PMHA 3GO5A 1B9NA 5FTWA 3GFMA 4L9NA 2FRXA 4O6JA 3SQNA 5FLXK 1J75A 3GYHX 3N4MA 2MD5A 2K4MA 4K2EA 2CFXA 5LQRA 4M7RA 2ADMA 3CTAA 1IN7A 5HZMA 3R3HA 3NJRA 2Z33A 1XGOA 5DM1A 1FYMA 4UUVA 3I58A 2ONYA 2A07F 1ZREA 1VBFA 2ZIFA 1SVUA 2DK5A 5BOXA 5J6XA 1Z6TA 4YUZA 2IDKA 4MQ4A 4ESFA 3MCZA 1WXXA 4WXDA 5DCMA 2E7XA 4FX0A 3JWGA 4I02A 3FM3A 2AVDA 3HOTA 4GGGA 1WWXA 3UA3A 1G6Q1 4ATNA 5FB2A 2ZZMA 2GA9A 3SR4A 3HTUA 1G4DA 3KZYA 5K0NA 4AZTA 4CKBA 5CIYA 1NE2A 2IH2A 2STWA 4YG2F 3EDPA 3GRVA 1KYZA 4R8SA 2P1DA 3FYDA 2XIGA 3M6VA 1BIBA 3CJNA 2GAUA 2AVNA 4JQFA 5FO5A 1JGSA 2NNWB 3C3YA 4R05A 4OX9Y 2O0LA 4LB5A 4GO1A 2JHPA 2ZWVA 5ED4A 5AONA 3I9FA 3O3KA 1SMTA 5HDGA 2HMYB 3DLIA 4RVDA 4BP1A 2QQ9A 3C6MA 1TNTA 1R22A 1FBQA 2AS0A 4RTJA 1JG1A 4DF3A 1T6SA 4KIFA 2P3QA 5CVRA 1X1AA 3KQSA 3V8VA 4TV7A 4OINF 2Y48A 2ZULA 2HKXA 4YFKF 4ZH4F 5CM2Z 1W7PA 1L0OC 3OZSA 1LQ1A 1BBYA 3R0AA 4JXJA 1DL5A 3REOA 3GFIA 2B0LA 5K0EA 2ERCA 2TDXA 3SXYA 2PBFA 4FGZA 1T39A 5DUKA 2I7CA 1KPIA 1B42A 1ZG3A 2PXXA 5HLHA 1KU7A 4UOEA 1HQCA 4RTSA 3GF2A 3NEUA 2IA2A 4LG0B 5BP7A 4R6XA 3ERCA 2AOWA 1PP7U 1IXRC 2QQAA 4F7ZA 5LBQA 1G8AA 1Q1HA 1O3QA 1XN7A 4RYLA 4ER7A 1XSDA 4FT2A 2KKOA 1IN6A 1S8NA 2MH2A 4UVAA 5MHTA 4GCVA 3ROUA 4M9ZA 3KR9A 3UJDA 1G38A 1MJAA 2H1RA 3I5UA 4BAYA 4EJVA 2P35A 5JVTA 5G02A 3TPZA 3WSTA 2A6HF 5DUIA 4BYYA 3IV6A 3PLAE 1U5TA 2IIPA 4OBXA 4OMZA 2K02A 4OA5A 3PFGA 4V0QA 4MHTA 4EV0A 3FUXA 3RTRA 3HOSA 2A61A 1IUYA 1BC7C 1YYVA 2XKPA 5DCMB 1JSZA 1YFLA 1FP2A 1AF7A 1JG2A 3ELWA 5LLQA 3A27A 2Y0MA 1W7PB 2EV0A 2FU4A 1R7JA 2EJUA 4Y17A 2X0LA 3LQRA 2UWMA 2XYVA 3G5LA 1NW5A 3WODF 2B9EA 1W7PD 1FP1D 1YF3A 3EUHA 3DH0A 2OAZA 4YMHA 2LD4A 1UCRA 3O7WA 2ZFWA 3M6WA 5HOOA 2HWVA 2EJTA 2OB2A 5ICCA 1NBHA 5DPMA 5E8RA 4M6XA 1Y8CA 1FX7A 3H3ZA 1ORHA 4R6WA 2YU3A 3KR0A 2VOPA 3LA7A 2OBPA 5CUQA 2AS5F 1V3FA 3LPMA 4E2WA 3F3XA 1CGPA 3WE3A 1EG2A 1G3SA 4M36A 4QQKA 1PUEE 3EYYA 2KIFA 3TO7A 2V1DA 4A12A 3NDJA 3RIRA 2JPBA 2FF4A 4IKPA 4GF5A 2XHKA 2VBXA 2G71A 2Z9OA 2FBIA 4KUMA 1XB4A 2QRVA 1RNLA 2V74B 3BJAA 1SAXA 3FPFA 1NV9A 4KIBA 4C03A 5K0GA 3IRQA 2PY6A 1P4AA 1JQ3A 2LF8A 3KQYA 2VZ9A 5IKMA 3KQPA 2H27A 3WTVC 3KPVA 2E1NA 1KP9A 5ICGA 3BGVA 5K01A 4ER5A 4ZZDA 1PJZA 1I9GA 2P40A 1R8XA 4RTNA 1IAWA 5DEQA 3OU6A 3A26A 2QE6A 3OZRA 4L7VA 2C7PA 2DK8A 1J7KA 1BC8C 3T0IA 1O7LA 2OY0A 2ZKZA 2L01A 3M6XA 1PDNC 3E6BA 1QQIA 1AQIA 1JHHA 2M8EA 1ZLJA 2Z6UA 5L3GA 3H92A 2UYHA 4E33A 2QM3A 3ELKA 3QP5A 4XLNF 1W5SA 1N7JA 3FMQA 1RJEA 2IRFG 1XXLA 2IP2A 1QAQA 4EJUA 1LDKB 5P8WA 3JAMZ 5CVDA 2JZYA 1I27A 3VYWA 4N0BA 3BWBA 3PT9A 2P4WA 3EVGA 4P7KA 3FPHA 5EOVA 2FSWA 1O3TA 1O9GA 1WRJA 2BE5F 3R24A 3UJ6A 4OU0A 2ZCJA 3B73A 1VPTA 1Y0UA 1KQ9A 1KYWA 4HZFA 5J8CA 2VP3A 2VE9A 2O3FA 1K78A 3OU2A 4ER3A 3R6TA 2VBYA 1JE8A 5EMJA 4YFXF 3ER8A 1XSXA 6PAXA 2ZZKA 4Y2HA 4PYLA 3WGGA 3TO9A 2NNYA 3EGEA 4PNEA 2VOOA 3AAFA 3KP4A 5K8VA 4WXCA 4M72A 2IVMA 3TO6A 2YPRA 4YMGA 2HGCA 1ZKDA 4KIGA 3B5IA 3LA3A 4OIRF 1F38A 4OBWA 3FMRA 3GDHA 2EG5A 3JWJA 2QWWA 4JK1X 3T5XA 3I59B 2UXXA 3I53A 4P5OA 3LX6A 4MTDA 1RUNA 2EFQA 5T64A 3P2IA 4HLYA 5E9WA 3ER9A 3G2QA 4DNCA 2ISYA 3UBTA 1BHJA 4U7PB 3BOQA 3T8TA 4A6EA 4EJTA 2O07A 3PB3A 3BROA 3QPHA 3E7PA 2ZTHA 4UHTA 1XCVA 1EH6A 4RVFA 3FTEA 1JSXA 5KVAA 3Q9SA 3V8JA 3BJOA 5FQNA 3TDZC 4HX7A 4P58A 3ULQB 2NS0A 3CUOA 1GVJA 1FSEA 2FOKA 1IM8A 3SVZA 5K0FA 3P8ZA 1INLA 3DKWA 1NW3A 3M6UA 2FA5A 3MGGA 2N47A 4G7ZF 3LA2A 2F5EA 3PS9A 1ZRCA 3WTSC 2DQLA 4PZJA 5IT9K 3HVIA 3M1EA 1G3TA 2QLZA 3P2EA 1AV6A 3EMDA 1OKRA 3P7NA 2WTEA 2RGVA 4KDRA 1D2GA 1OR8A 2EFOA 2AN3A 1U2WA 2QENA 4E32A 2CO5A 4IHTA 3GFJA 1L9KA 4PGHA 2FNPA 3CGGA 2GZWA 4EM1A 4AWXB 3QPTA 4R79A 4GC9A 1XMKA 1R5HA 4RGUA 2IA1A 2A3SA 1B1BA 3FXUA 4BP3A 2XASA 2PBIA 4MGRA 1VTNC 1FBUA 7MHTA 1CF7B 3LL7A 1BKYA 4E2YA 4IV0A 9MHTA 2QBYA 2CG4A 1HSJA 1G3WA 4LK1F 3RI4A 3GU3A 3IC7A 5DXAA 4P96A 1RJGA 1R23A 5EVJA 5FWAA 1RI4A 3UZUA 4XSXF 4QTUB 2QZ8A 1Z9CA 5D8KB 3WTXC 3ELYA 2OO3A 2W85A 5DTQA 3WGHA 2ONZA 4HBLA 4PWYA 3RW9A 4Q5SF 1KU9A 4O29A 5ILSA 4ENNA 4AD9A 4E2XA 4BHCA 2JSCA 3J80Z 4UXNA 3EGVA 4QPNA 2C7RA 2CKDA 2NAZA 2YQZA 2WWYA 3LDUA 2M1BA 5IH3A 1ZG1A 4KN7X 4M9XA 5EEGA 5EQJB 3V8KA 2HTSA 2XAHA 3GNLA 3C6KA 5DX8A 1FWZA 5E18F 2ESRA 3E6DA 2A14A 2O0YA 1XGSA 4M74A 1L1EA 3OCJA 1FPQA 4G7HF 5IT9Z 3KQWA 3WTZA 1YS7A 3BPXA 3MWMA 3B3GA 3SFZA 1IF1A 3F23A 3DXYA 2ETHA 1ZAOA 2QVOA 4P9UA 3ZPLA 2WK1A 5KQSA 2O06A 3BXOA 1F1ZA 3T1BA 1RJDA 3TDUC 2OBFA 3QOWA 5D5UB 3TFWA 5D5VB 4U7DA 5D4SA 1KPGA 2XVAA 3VFZA 1T38A 2ZW9A 2CWWA 4IXAA 3KQMA 2IH4A 5JHUA 2VXZA 1L3BA 2E5WA 5A2QK 1AOYA 1DPRA 1DPUA 3EEYA 3CVOA 1TBXA 4ENKA 3UWPA 1ZYRF 4A6DA 4QTTB 3VC2A 1P1BA 2HOEA 5HIIA 2KRFA 3FPJA 5EMKA 3GXOA 4D0PA 4G6DA 1VL5A 3IRRA 2FPOA 4HSGA 2K4JA 1VLMA 4HF1A 5E2AA 4CHUA 4YUWA 3U2RA 1YW7A 2YR0A 3HCBA 3GWZA 5E1ZB 5D5WB 3E5XA 5D8LB 3L8DA 3DP7A 1FJXA 5DLYA 2COMA 5E17F 4AZVA 1BIAA 3HSEA 4MQVA 3GRUA 3R0QA 3QRFF 5FFXA 3OZTA 3V7RA 4L9VA 3F6VA 3TLJA 2PWYA 5DX0A 3PQKA 1HSTA 5D1NA 2VODA 2ZMEB 3ZN1A 3A4TA 1TQIA 2PX2A 2FBHA 4PCAA 4X41A 2P7IA 1CF7A 4UVBA 3L2CA 1N7IA 1HW5A 1USTA 1S29A 4S04A 2PFBA 1REPC 2PLWA 5EHGA 3JTHA 4RB1A 2NP6A 3KQVA 2DFIA 1J5YA 1QAMA 1XCLA 1VP3A 2G8NA 1SFXA 1QBJA 3ME5A 2EFPA 4EMSA 4HV6A 1AQJA 2YUIA 2YR2A 1MGTA 1EJ0A 3D0SA 3JW4A 4PCLA 3GRRA 5E1XA 5E1MA 4ZTBA 3ZMUA 1BOAA 5JI6A 4M37A 3K0LA 2WA1A 4EM2A 2PKWA 2DTRA 3M8EA 4JBAA 3EGIA 2ZSUA 2IFTA 1VP9A 1HW2A 3T8RA 2IH5A 4U0WA 2P6TA 4KMUX 5EZSA 3G3ZA 1IXKA 3WE2A 1X1DA 1BJAA 5HS8A 4A0YA 3HCCA 4XRFA 1XJ5A 3QV2A 1X1BA 1W4MA 2P7HA 2Y75A 1F9NA 1XGNA 2DPUA 4QQNA 1U3EM 2AN5A 1S3JA 4XSZF 3F8BA 1PRYA 4P7JA 4EQZA 5ERGB 5DXJA 4FHTA 4OIPF 1RI7A 2M30A 4MTEA 1U78A 5LRSA 2BGCA 3CKKA 1OR7A 3THRA 1YW9A 5LR6A 2PI0A 1B6AA 1U5TC 3KETA 2CSOA 1P1CA 3JTGA 5EMLA 1SKMA 1H9GA 3KP5A 1IN8A 1USSA 2J5OA 3DPTA 2D45A 3EETA 2AOUA 2LKPA 2VDVE 4MEXF 1MD0A 4ESJA 4P9FA 1H0MA 5DD8A 4AZWA 5FD5A 1M0EA 4BNCA 1ORIA 2EWNA 2BR4A 3DV8A 4LWOA 2FQ3A 4MNUA 5GM2A 4EKGA 1YG2A 3UJ7A 3WTYC 2NRAC 3ECOA 2RVCA 4EGYA 3TR6A 3FUTA 4BHBA 1YW8A 1WKMA 3BZ6A 4HTFB 3T7RA 4M38A 3HVKA 4L9JA 4BQAA 1YZ3A 3HRSA 3QOPA 4X63A 1RZ4A 4RGRA 4CZZA 1P2FA 3LAJA 4RAZA 3V4GA 2G70A 2H94A 3DLCA 1ZRDA 3ELDA 2GH1A 2PV0A 4GOND 4PYMA 1OYYA 4WVLA 1QNTA 3M7GA 4UV9A 1RI5A 1FSHA 5FUBA 1GXQA 3MFKA 5K5QA 3HCEA 4NHJA 1I1GA 2HTJA 2OZUA 2CYYA 4I7HA 3DF8A 3E3VA 2DO7A 5CVVA 3KR2A 3MHTA 3Q5FA 2HEOA 2V6CA 1KU3A 1SD6A 2A6EF 5KS2A 4IF4A 3C3WA 3RJPA 3CDHA 2H11A 5T67A 1OPCA 1LB2A 2FK7A 4DZRA 3GEZA 1EQAA 3IL2A 2PT6A 2ZVJA 3WG9A 3FMSA 2HDCA 2DPDA 3GRZA 5GWXA 1O9HA 2RDPA 1BI2A 4P55A 3FTDA 4HH4A 2P5KA 5C1IA 5AIPA 1FNNA 4HX4A 4EJWA 4HF0A 3MAJA 1MZBA 2FBKA 2I62A 2ACJA 2NYXA 2W57A 2ZNZA 1KXZA 3EVDA 2AOVA 4X1OA 2HKOA 1ZGAA 1FBNA 1F5TA 5EG5A 4MQ9F 5FCDA 3E6MA 2FEZA 1ULYA 1SG9A 1ZQ9A 2OB1A 3I71A 3CO6C 5FA8A 5FHRA 4KYWA 4Z2YA 5EGSA 5FD6A 1DDNA 5BPDA 4R8HA 1L3LA 1YO5C 1R18A 3NDIA 5F1RA 3C18A 5B1SA 1IN5A 2Y1WA 2IPXA 2JH8A 5DRTA 3PVCA 3FHZA 5HDNA 5HS7A 4CTJA 3E8SA 3KPJA 3KCCA 5K0CA 4BXUA 4NECA 1MJFA 4PIMA 3TOAA 5HLIA 1RI2A 4A5MA 4ER6A 1TNSA 2H00A 4L0YB 3NW9A 1BN5A 5CYVA 1QANA 1FBSA 4LWPA 2D1VA 3WGIA 3D5LA 3DUWA 5J8FA 3RIEA 5K5OA 3LBFA 2LSOA 3BJ6A 2MLKA 3LFKA 4RGXA 3G7UA 3DMGA 1I1SA 4EKIA 3B3FA 1U6GA 3EVBA 4P7FA 3KLNA 1U5TB 2MH9A 4RB0A 1UWVA 3Q7EA 2DT5A 4CTKA 4A0ZA 4WXHA 2B25A 3GO4A 1GHCA 2OPBA 3ZP5A 3UJAA 2B3TA 3F8CA 3GLXA 4EGZA 4WX9A 1O57A 3T7TA 3F72A 3O31A 2VONA 1D2CA 3THSA 4G6QA 2P3OA 2IJLA 5LEKA 3NTVA 4ETSA 1ZRFA 5DD4A 3AJDA 3LKDA 1JQEA 3PX3A 2EFJA 2ESNA 4I09A 3BZBA 3NMUF 1YFHA 2IGTA 5EIFA 4BH9A 2V1UA 4KNYA 1EH8A 1S7OA 3SX0A 3DQVC 2PT9A 2BV6A 2OQRA 1HBXG 5DTRA 1RI3A 2PJDA 1MJBA 1LVAA 4EJOA 3MB5A 1XGMA 3J7AO 1SMYF 4WCGA 2DI3A 5L3FA 3CUQB 3F8NA 1I4WA 2ZZNA 2GPYA 1ODDA 1WSUA 4P7GA 2D2WA 3NWBA 2ZLBA 1EAMA 2Z6QA 3DTNA 2DU9A 5AIQA 3EEOA 2FCAA 4QDJA 2H09A 3I4PA 3MQ0A 4ZYGA 5D6FA 4C08A 2OZ6A 2A68F 3OU7A 3GGDA 3ANXA 1STZA 1H9TA 3HM2A 1FOKA 2BZGA 3R61A 3NVMB 2HNKA 2WV0A 4GBED 5C9ZA 5DCFA 4RGSA 4OQEA 4LG1A 3BP8A 5F2NA 1RIOH 4HC4A 3BDDA 4A0XA 4FZVA 2ZBQA 4ENJA 2W25A 3JAMK 1DUSA 3G2MA 5CVIA 1O7FA 2PSSA 4AX8A 1S6LA 1NW8A 4KWCA 4L5JA 3A7DA 3FX3A 4FSDA 3EVCA 4PONA 3KP3A 4X61A 3KLOA 2PJPA 2G1PA 2ZBPA 5LHIA 2OQGA 4CICA 2O03A 3UFBA 2P7VB 2K4BA 2DW4A 5H6QA 2OYRA 1R1UA 4FT8A 5DX1A 1G3YA 4F84A 1J2XA 2V7EA 4HGZA 2ZO4A 3EMBA 4L18B 4FX4A 1TPYA 2AR0A 3LGAA 1VE3A 3GJYA 4CO8A 4PYIA 3HA5A 1KA8A 2VT2A 2RC4A 4XLPF 2AOXA 3C0KA 4PGGA 5GOZA 1WS6A 2QY6A 4LLNA 5DSXA 4ASNA 3KFWX 4HV5A 3GVAA 1B4AA 4ZZLA 1WG8A 5JR3A 3NWEA 1P4WA 2C7QA 3F8MA 3Q9VA 2RNJA
chains in the Genus database with same CATH superfamily
3LKVA 4GC5A 3FMOB 4XJXA 3TB6A 2GHQA 2YTZA 4P2GA 5K0JA 1FFWA 2J3KA 4PX5A 2ZSAA 1NJ2A 1BW9B 1YONA 2ZIEA 3U3KA 3ZEIA 4BAZA 4DDHA 5L51A 4DA4A 4K3VA 4ON0A 1V3VA 3HBAA 2OKCA 5AKYA 5TV2A 2O8FB 4KICA 3R60A 3SHOA 4ESHA 5TQJA 5KUTA 3AVXA 4BPRA 1L5QA 3KEMA 2NOJB 1IVNA 3EISA 3K32A 1GZ6A 3M1AA 1BI0A 4JB0A 4LTNA 3PIIA 3D6UA 2YVQA 3QWHA 5FNZA 4X65B 5D5HA 2WZCA 3L0IB 2N1MA 1WZUA 3VDMA 1L4HA 1H6DA 3BXFA 6AT1A 3JRWA 1A4RA 4J49A 4Y33A 4YN3A 2D5AA 4FFRA 4FHFA 1YJ5A 2Y76A 4OLAA 3CC2I 1SZJG 1KJIA 4OJYA 4PEVA 1E94E 3HGGA 1VC2A 2O8DA 1W0KD 4REOA 3DKPA 3F6OA 1XJ0A 3K2EA 3TLZA 4RTMA 3NDBB 1H2XA 4OAZA 2GXGA 2ZVPX 2W8ZA 3R7FA 3I34X 2VT3A 2J3DA 1O0SA 3AY0A 3RJMA 3I0TA 4YX9A 2VCEA 1QE3A 5D1HA 1GYQA 1MBFA 1AZLA 5GAGJ 1Z36A 2E5ZA 2GO1A 4I01A 3LU1A 4QHYA 4EA9A 5HUQA 1Y9ZA 3DE7X 5DHSA 1Q92A 4TN1A 5GONA 4WCFB 1UWKA 3F5FA 3GXBA 1GG2A 4MWOA 2IBTA 2EARA 2XWSA 2RD2A 1D04A 3SZPA 5L3DA 4B7XA 2I34A 2XIQA 3I64A 3ABQB 2QNIA 3A14A 1VQ5I 3K15A 1NGSA 2L54A 2VYVA 4CU5A 1U65A 4C7MA 3DWEX 2QP3A 5FDFA 1SQ5A 1WX1A 3GEMA 4FZJA 5KNCH 2J5PA 1N92A 1B3RA 2LRHA 3N97A 2WAAA 2COEA 2MU1A 5E0KB 1QV9A 1NF8A 1AKEA 1JIQA 2H9AA 3ZNOA 5C8DA 1GRRA 1J2YA 1XTKA 1ZISA 1UJBA 2OBMA 4HWKA 4LOHA 4ZAXA 1DG1G 2HPMA 1VJ1A 1V7PC 2DTXA 4ZT5A 1YO6A 2DG2A 4TKMA 1P9RA 5BSHA 4ZYHA 4JT9A 4JYMA 4C9BA 4ZGBA 4NWIA 1SUAA 4YO7A 2FRHA 2XE8A 2R1TB 2C3YA 2R6DA 1BWPA 4IFBA 1DO2A 1QIKA 3ZXUB 5H9VA 1Z77A 1QAOA 4B4UA 2VP5A 3ZWVA 2ZJOA 5FRNA 3ROQA 4V0RA 3OTQA 4EYGA 3ASVA 3JQQA 2BEVA 5B53A 4LSWA 2RK3A 2MA3A 5DRYA 3HRTA 2FB9A 1DTSA 4Q4AA 2L7MP 3AR2A 1C7RA 1XP8A 3GV0A 2PCLA 2YWHA 4YMIA 5F9MA 2M5WA 3HOXJ 1DNPA 2CCGA 2PMCA 5FLXA 2ZJ2A 1G63A 4G81A 1WQ2A 4QELA 1RRCA 1C7IA 1G4HA 4C5CA 5M34A 3QBJA 2ZJPF 3QV1A 2XHZA 1W76A 2BM9A 1O08A 2REXB 1DKLA 2BVMA 1L8AA 2A33A 4TT8A 1E0SA 4ZOLA 2VA9A 3LP5A 1R15A 4L5IA 1NR1A 1JVSA 1S6YA 1SCBA 4GGOA 4N0QA 3AKCA 4UC0A 3U48A 2X19A 3O4VA 3G79A 3ADDA 1T5IA 4D80A 4NV0A 1QLHA 2EOAA 2YX1A 4OSOA 2HWKA 4YIKA 1JUSA 4OHWA 1W1WA 4DB4A 1DIGA 3AEKB 3EUHC 2FMFA 1UFQA 2VATA 1XD2A 4CMKA 5F2KA 2IX3A 1LC3A 2I55A 1D8JA 2WMYA 3DTYA 4UEKA 3B60A 1EQUA 2XVCA 1A50B 1WQ1R 2FP4A 4BMPB 2PGAA 2FEWB 3P9SA 4I66A 4GKKB 4E70A 1GOTA 2Y05A 5F27A 4DW6A 2ZJ8A 3DBHA 3B78A 3S99A 1ZM7A 1BYUA 4Q9JA 3GZ6A 3SCZA 3V1YA 3VR1A 3QEAZ 3VU1A 3ZBPA 3MNFA 4OXQA 5FUQA 5KTPA 1T2NA 2FE4A 2GNOA 2BSAA 4R2MA 3P9NA 4WN9B 5MGBA 2JGRA 1M8KA 1Q0SA 1XZEA 2G88A 4P4LA 1HX7A 3Q8LA 2B2CA 5BRAA 1GSAA 2DPHA 3S1MJ 1W4ZA 4DLBA 2DRIA 4FUTA 1Z9BA 4ESEA 2I1VB 3LP6A 2ZXJA 3L6OO 1FSPA 2GRJA 1IBKB 1LI4A 1MMAA 3IALA 2BKXA 4K40A 2OILA 3WGLA 2R7FA 3NAGA 1Y1VJ 1GZ7A 2Z3YA 1LWOA 1QS0A 2FWIA 2CNKA 2QLFA 1A9XB 2UVPB 3B6EA 1QO0A 3I37X 2A0YA 4Z86A 5FPTA 4RW0A 3FHTA 1RAHA 2PQMA 4DMUB 4H0FA 1VCOA 1TT5B 5DNCA 2WJGA 1E17A 1Y4DE 2F1HA 2BMJA 2QUFA 5AHXA 2WR8A 3GAAA 1ENPA 2H16A 3PHHA 4FDLA 2E5LB 1WQ4A 2VJ4A 3E5QA 2VQFB 1DAPA 2F3UA 4IDPA 1FEXA 3WKDA 1M6VA 5FI5A 2CMHA 4INOA 1J90A 2RHGB 2Z56A 5FT9A 4QT0A 2KFDA 4MCAA 1XLTA 3ORHA 4MQ5A 4ZU3A 1P72A 1AA6A 4ITUA 2KQUA 4X1YB 2WB4A 2FF7A 2Z3ZA 1ZH0A 4ZAYA 3RNLA 4DLNA 2O0HA 1YITI 1PN3A 1XHEA 2W2TA 1ZP6A 1PQUA 3DZGA 3IMKA 2FR8C 3OD5A 3RF6A 2QTBA 3SS9X 4YR7A 3G2LA 3MWJA 3UF0A 4RTOA 2M3AA 1BJZA 1WP4A 1M6VB 1BX0A 1YWGO 3CLVA 3HOYJ 2VCHA 3M3HA 3WGNA 1G2HA 1NRWA 1K83J 2EWVA 2DH5A 3I05A 4ISBA 3RS7A 4ZK6A 3RUFA 2QZPA 3IEIA 2CN1A 1HLFA 3OCZA 4I2OA 4BMZA 5LIPA 3JR7A 2B0JA 2D6FA 4V1CI 4NRDA 1JWAB 5AK0A 1V1RB 3JZMA 1NWCA 1KE2A 2XY4A 4KQ2A 4X6XA 3NHMA 4NPHA 4DW8A 3ZDEA 2P2ZA 1HTTA 3ILHA 4HQ0A 2G67A 3H1AA 1EA7A 3B3AA 4TLCA 4QLCU 1LTQA 1S0UA 4GDMA 1JW9B 4D79A 4K2HA 1GXPA 3BCUA 3FPEA 4AY3A 4ETNA 1T0JB 2H52A 2ZSIA 5H8WA 1ULAA 1GV5A 3KKNA 1M2FA 4XLFA 1Y89A 1KFEB 4EZEA 1TCAA 5IAKA 3TAXA 3NYIA 3DVQX 1U2RA 5DT2A 4DCMA 1ECBA 2VDRB 3GH1A 4IM7A 1RZ3A 3QVTA 3ISPA 4U88A 1M1XB 4I4IA 2Q7OE 3RHTA 3Q0VA 1JFVA 1R0ZA 1HG0A 3VSEA 4AJ4A 3U7GA 1IPFA 3VVBA 1XG1A 1KI8A 3ABMH 1QNLA 1XXHE 2O3UA 2JKYA 2OR3A 3PEUA 2I33A 4RFLA 3T5TA 3W2AA 1LVUA 1F3LA 1N1DA 3AUJB 3AWDA 5B6IA 2VP0A 3LHDA 2K86A 4GXNA 5HG0A 1D4AA 3VHQA 2EEZA 1JAZA 2RMKA 3KCNA 4OLJA 1FC3A 2V7XA 4N4AA 5SICE 2YJ3A 4LG0A 1HT2E 4MPDA 1QH1A 4WT7A 1WMFA 2FPLA 3GJ5A 1WU7A 2YUTA 2VC0A 3HUGA 1BE1A 1G4AE 1MIHA 1G8MA 1N3IA 1NQTA 4KMFA 1WMEA 2CFRA 2PSFA 3D54D 4LJYA 2YXBA 5A03A 5C0OE 3FCYA 3F2VA 4RCVA 3U37A 1AGPA 1FNSA 1SN7A 2IZ0A 1YQQA 4P3PA 3USES 4X1YA 1UK6A 1JDBB 2L69A 1EVIA 4BVJA 2C6YA 1A82A 2FR1A 2NTYC 2M32A 1GRVA 2R8PA 1QVTA 4GQAA 1NVMB 4C2TA 4JWTA 4UZFA 2R11A 3FZVA 1U98A 1KS9A 1OI4A 2IYNA 4L57A 4JENA 5HBRA 2IF2A 4LRSB 1QK5A 4A5SA 4P53A 4XPIA 2RGYA 3BTJA 1M6EX 2GN4A 2YQ4A 4QU5A 4GYGA 4B4WA 5B1IA 4I76A 1SD4A 3DZBA 5BVHA 10MHA 2VLBA 1J59A 4LZOA 4PCQA 2C82A 3CF6R 4BYMA 1W30A 3HKEA 1PFGA 3W6JB 3H8WA 4CWAA 4DRXA 3Q9LA 1JLSA 1FP4B 1KQ8A 3HYCA 3S0JA 4CLOB 4F5DA 2JLVA 4GL2A 1ZXBA 2P41A 3R4KA 2OTJI 1O0BA 3L09A 3C5WP 5J1UA 2R7WA 1VB5A 2V7GA 3NNDA 5CTAA 4EG1A 4OYLA 4RJLA 1KH3A 3UGQA 2HYFA 4CM9D 2B6NA 4CRWB 2ODNA 3NCHA 2BFEA 3SXPA 4EGAA 4B74A 4R9SA 1D5VA 3B6AA 1CS0B 4RVOA 2VJMA 3LT2A 2GMWA 3DAGA 3ONWA 4KBGA 2ISSD 5E4JA 3BEDA 4D4GA 1OX5A 4WWHA 2VHTA 5ECGC 5ALNA 4KXYA 3KVRA 4Q66C 4XONA 4GPAA 1V9SA 4UE2A 1AXGA 4R8MA 1PJQA 1DRVA 2R7KA 1YJ8A 2VDJA 1X1SA 3EUWA 3J81K 3WLEA 4C4SA 2JG3A 1C8KA 1K68A 2GEJA 2OZVA 4WSOA 4NG5A 4I4CA 4JA0A 4HGNA 4Q9NA 4RB3C 4BMNA 4QM6A 3GFRA 4GLOA 3AVTA 3WXBA 5BWBA 2BFOA 3BMOB 1NG7A 1Z39A 2PKCA 3PL8A 1QXSA 3ZIAA 3JTMA 5CG1A 5GZ1A 4BO5A 1JQJC 5D6NA 2PUWA 2ORWA 1NY5A 4L85A 3NOXA 1TK3A 2DETA 5HQ3B 8ATCA 4L9TA 5DJ5A 3BR0A 1XYVA 1DAHA 1SBYA 1RYZA 2FAXA 2WF6A 2E4YA 2ZBDA 2PSHA 4TVKA 3H3XA 2DKFA 3PEFA 3D7NA 4ROTA 1FFSA 5C7IO 1EB8A 3BCHA 3L00A 3UMFA 4YJ2A 3PEVA 3A1WA 3L93A 4BKXA 4KWHA 3QELB 4ZI3A 2HQRA 4JQOA 4H7PA 3FFTA 4HNUA 1KEVA 4AMVA 1ITZA 4OQYA 3IQGX 4RFSA 3LK6A 3GLHB 3GGGA 3JQ6A 1WOYA 3FTCA 1JQAA 3L43A 3X0DA 4L8GA 1UINA 3N8KA 1XF1A 4FGWA 1QC5A 3TI9A 1JH9A 3AVWA 3PEYA 5EKXA 1IWBB 2PUJA 4HDKB 3L84A 1Y33E 4D9EA 4RFVA 5KJ6A 4HWRA 1F4KA 4DKXA 4JX4A 3S3NA 1IV6A 1ZVMA 2IYAA 5HCUA 5H3HA 721PA 3SZGA 1QF7A 1MHPA 3EPZA 2CFTA 4DAEA 2OCXA 3EA5A 3K71B 2M87A 1E98A 1HDOA 1IBMB 5AK6A 2O8CB 1IY0A 3PM1A 2I99A 3X1XA 2IA0A 3FRJA 1OFUA 1ON2A 3ZMSA 1JHDA 5F7ZA 1RI1A 3GQBA 3OEYA 5EIBC 3AERA 4EI9A 4DDUA 3DF9A 3OG9A 4DDMA 3FSRA 4XLEA 1DJPA 2GWHA 5KQMA 1I7DA 4W1QA 3EVNA 4JC0A 3WISA 3DL7A 5DYWA 4H3SA 4M3EA 1CYDA 3ZXIA 1P7ZA 1I14A 3IFSA 3SC2A 3WQRA 4R2XA 1M7GA 1LRKA 1L4YA 2QE7A 3HCFA 5AVWA 2AZMA 3HKZA 4G0XA 1R6TA 4K3UA 4GWLA 4C0HA 1GD1O 4NONA 1OZHA 2F90A 2J3IA 4A8JA 1QTQA 1K0UA 3NHUA 3KP6A 1IJEA 2OC6A 3CUEF 3QFSA 1ZM4A 4HVAA 2DOFA 1SUSA 3LOQA 4MV6A 4Q15A 5F1KA 4ALMA 4AY6A 2J6HA 4IRMA 4DCNA 2D1YA 1IZ9A 5IVPA 5DBIA 3UANA 3G17A 1QRRA 1IJWC 1Y48E 1F51E 3B13B 4L28A 5JUWA 2CD9A 2JCBA 3EIQA 3S2UA 2L0KA 2YS7A 5DM6F 1GUZA 3K5IA 1O6BA 3QP6A 2GBPA 4CMAA 1TIBA 3BXHA 4CCNA 2ECQA 1B23P 1T1IA 3NNSA 3DTVB 1SFUA 3BAZA 4WBNF 3OSFA 4XFJA 4G5SA 2FWNA 1NJ6A 1J5EB 2FPSA 3H2GA 1XV5A 4P0QB 3URMA 3ZNNA 2ZRGA 3KJHA 3L2RA 4KR9A 4YRBA 3E2PA 2QN9A 4WJKB 2O2ZA 2VDWA 1EFLA 1DJNA 4DWOA 4FR0A 2PGXA 4GUAA 4L2IB 4WWCA 1PEYA 3RGGA 4DG8A 1KH2A 3AHHA 3GBVA 3K1JA 4FB4A 3MJSA 1XU4A 4IHJA 1MSEC 1C4XA 4Q7LA 1BVUA 5CNMA 3N7TA 1DGWY 2DAOA 2Z2YA 4BCCA 1PL7A 4QGFA 1N2XA 4UUQA 4AG3A 3HEMA 5FEMA 3T0GA 1WUHS 1UPBA 1QORA 1YRHA 1I7PA 1X77A 4GUDA 2C4VA 4QUJA 2Q5JA 1KDZA 4O5VA 4QWQA 3BM5A 4IGEA 4JJ8A 2LV8A 3C15C 1M6YA 1JR3A 3E82A 4JUIA 5JYBA 3NV9A 4M49A 4G9GA 1K06A 1MHTA 2B37A 3G59A 3MS2A 1XBTA 3R6SA 4AVZA 3TQIA 5JLXA 1PWZA 1ZA2A 2VK8A 4X8OA 3CNBA 3ESXA 4OFXA 5DNDA 3ESYA 1UBJS 1BRMA 3HJHA 2JEYA 4GU5A 1ST3A 5CA0B 3F6RA 2DUUA 1DKPA 1IMOA 1SKYB 5L6MB 1HZZA 3ZVMA 1ODSA 4FT4A 4HT3B 4FHZA 5L3CA 3OP4A 2W9XA 4PDKA 4GOLD 4MUFA 1TYZA 1O5OA 2CW5A 2NVBA 3B5EA 3O8OA 4RAFA 1ACLA 4B8XA 3H9GA 1CDOA 2C96A 2EIHA 2LFBA 1KZHA 3RPUD 2UZ0A 3COWA 3BFXA 5AVTA 2IDJA 4I1VA 4DCCA 4HB0A 3FE2A 4L5EA 4Q4HB 2Z08A 3UUEA 3MT0A 4U2GA 4X62B 3ZQHA 5CVUA 4XK4A 1ZLKA 1BOOA 1FDVA 2MR5A 2NO0A 3QNWA 3QH4A 1J8MF 3GFSA 5H3CA 4BNJA 4C4TA 3VAZA 1Y4SA 2WIBA 3VNAA 3LBIA 5LMUB 3THWB 3A4YA 3L6DA 1NMYA 5F4BA 2EKPA 2QE7D 1XQWA 3O2JA 5IP7J 2X58A 3NT4A 5JDCA 2KIUA 2B98A 1E5QA 2O05A 1TL7C 2ZE7A 1J8FA 1U1IA 1T2VA 2C5BA 2HQNA 2B0CA 3CZ4A 2DA6A 5E20A 3DFFA 3TOSA 621PA 5HR5A 2QF7A 1C5KA 3VEPA 4KA4A 1UHMA 1N2BA 2WA0A 2X1EA 1S01A 2G1KA 3DW3X 3F6EX 3R3VA 1J20A 3PLNA 2H3HA 5C5CA 4G1CA 5FULA 5F7XA 1X19A 2BL4A 1Y1SA 1T8WA 1OLUA 3L2WA 1Z3XA 5FHQA 3RDIA 1OCTC 5GIPE 2I91A 2B4TO 1V8DA 1BC5A 4Z9FA 1PGPA 1GTRA 3LDGA 1ECJA 1QBKC 1D5YA 1P9WA 2EJRA 2HLHA 3LF1A 4HDRB 5TPWA 5M04A 4CQJA 3DO8A 1EJBA 1P7YA 2BP7A 3HYSA 2X41A 2JCSA 1S2LA 1U1FA 2YS9A 8OHMA 4LVCA 5IVIA 2CSXA 2H1IA 3LX8A 1YOBA 2XOKA 3UUWA 2Q4TA 5GJCA 1D9XA 3K4BA 3HH8A 3LCJA 2VPIA 3AOEA 1B0AA 3U1KA 4U1RA 3C6BA 3DGEC 3F5MA 3GA5A 3GT4A 2M6LA 4N40A 4J0CA 2XECA 4HX9A 4YV2A 1U7TA 4A16A 3AFMA 1NE7A 1BSVA 3BSYA 4JVOA 3WK7A 4B6OA 2WYOA 5DDGA 3DJYA 1CJBA 3Q3GE 4J0DA 1WOMA 4RGBA 3W8DA 4KRGA 3PQEA 3C3AA 1BGVA 4N3NA 5J2TA 4B4VA 1M8FA 4NB5A 2ODTX 3H4MA 2QT9A 3SSMA 1ZXLA 4BP8A 5DFAA 2DLLA 1BU8A 2GXUA 4UUTA 4D96A 3PDHA 4FLMA 4ZOEA 5ALWA 1OB2A 2QW8A 4MFDA 4PZ9A 4QDXA 4B31A 4AUKA 1E7MA 1ZQ1A 3CC8A 2ACEA 3I4MJ 2IYOA 2VAPA 1QKKA 1BL0A 3JCZA 2Y6UA 3V8PA 3ZBUA 3HC7A 1MX3A 3ZVRA 3GP8A 1E7WA 2W11A 2HD4A 3C8UA 3LWDA 4KAAA 4W1UA 2GWRA 2WD8A 1RUOA 2JHFA 3O6VA 2PZ8A 4C6SA 3MCUA 5AVQA 2PMEA 1IL0A 2IW3A 4MS1B 1LF5A 1R10A 4N6GA 2OCBA 5ALDA 4YONB 4LE2A 1GKUB 1XVUA 3P20A 3H3VK 3JQ9C 3HGQA 2RAFA 2EFWA 3OYIA 1LQ2A 3IPLA 1U5AA 2EC5A 2FNAA 3M4XA 4FGJA 4WECA 1I1NA 3VX3A 3Q8WA 4O3MA 4WN9A 1DCFA 2C4TA 3L8EA 1S8OA 1ZIDA 4EJSA 4OI0A 1N6HA 1RJ9A 3IUSA 3MJTA 1WL8A 4TUYF 4FZRA 1HMYA 3HP1A 4MH0R 4WK0B 2EGUA 2R7TA 3AVPA 1R4ZA 3FGOA 3HSYA 1Z25A 2R7UA 2AG6A 4OUKX 1JSLA 4ETIA 1ZCAA 2XF7A 2YDXA 1GZ3A 2X1HA 2XVYA 3HFRA 6LDHA 1DEKA 3WFZA 1S7AA 5K2MA 2VVTA 3TEFA 1L6IA 5T6MA 2ZU6A 1JHAA 4BOYA 4WKBA 4PJMA 5KK1A 3JQRA 4TROA 5AKIA 1WCV1 5B7NA 3KPUA 4WPGA 3QU3A 1YZYA 1UDRA 2OD2A 2XAQA 1KAGA 2TECE 4LFUA 1V96A 1G3UA 2GYUA 3OUUA 5K1YA 5K3FB 2GXBA 3BKWA 4UFPA 2O20A 1WI9A 2EJWA 1JIUA 1OTYA 2PQ8A 1SUWA 4YQYA 5EIBD 5J47A 3LWFA 1RBQA 4L5AA 2QJFA 4EF6A 2HSZA 4WZAB 3VR6H 1M1YE 5FPQA 3RAPR 1PVDA 1HORA 4BBZA 4ZZ1A 7REQA 3BQZA 1H5NA 4QYMA 4GZMA 4J94A 4LZAA 2ZB3A 3I83A 3OESA 1A97A 2VYND 4KQGA 5JPIA 1G3RA 1XAHA 2NVOA 4QSHA 1QUFA 1UBLS 1L4KA 2NXJA 4A91A 1ZVJA 4BNYA 3MVPA 4D0NA 3OIGA 3N6RA 5DDIP 4UHEA 5FR1A 5CEFA 3CUVA 3UNXA 3CQZJ 2DQYA 4PSCA 2OJED 3R3JA 4W5JA 5ALUA 1T33A 5EWJA 3TZKA 2ZUEA 4X0GA 4YRCA 3CLOA 1Z28A 2DFPA 1O5TA 2OM6A 2GK7A 4EY7A 3VPGA 4XB6B 2SCUB 4IDQA 1VJ0A 3AUKA 4OIQF 5DHRA 4GEKA 4Y3UA 2IV7A 4A23A 1NATA 4YAGA 5B5SA 2OXRA 1CDZA 1EGAA 2WSLA 1SXJB 3ZHCA 3ZCVA 3MRTA 1U0OC 1J8QA 1I32A 1Y4AE 3OOJA 2QL9A 1NDQA 1FX0B 2IW5A 4HRIA 4ILKA 2CVFA 1ZH5A 1QQ7A 3K0AA 3Q98A 1FK8A 5C1PA 1IG3A 1YRWA 4DZTA 2J4CA 3EG9A 5KDDA 1NUHA 1AD2A 2YXDA 1QHHD 3ERED 2BFMA 3I09A 2ZSHA 1L2TA 1KR5A 2HOTA 3AO0B 2I5PO 5FTKA 2PH7A 2EU8A 2PJUA 2K9MA 4W7HA 1IGNA 1CUIA 4Y2SA 4CIVA 1R74A 3CLRC 3WYGA 1C2YA 4B8WA 1RYEA 3OPYB 5IG2A 3OR2C 1U8EA 2PMZN 2QZJA 1U8AA 3HNRA 1GYRA 1TQHA 4J7CA 4ZYVA 2FE1A 4KO3S 5CR9A 1DBWA 5JVDB 5JAPA 4M1SA 2XKKA 2JHAA 5FH9A 3JSXA 2P9EA 2X7XA 4NBSA 2DMPA 1KIFA 1I10A 3I6ZA 3PFFA 3ZGKA 3K94A 4FHDA 2YHSA 2ZAYA 3CCYA 3GT7A 2UZ1B 1RRKA 2GX6A 2YMMA 5FKMA 2ZE8A 3L7WA 2HX1A 1GFWA 2PA0A 5HVQC 3AUAA 3B36A 2V54A 3D6FA 4I1SA 1DIAA 1N5KA 4WCFC 3UG6A 3VDQA 4JI8B 3H84A 2EV9A 3T9AA 1XQ9A 5I7SA 4PRKA 1WPRA 3A4NA 3GP3A 4UB8C 1DG3A 4JDUA 4WZBB 2BY0A 1WZCA 1ZK1A 2ECKA 4FYKA 4H0NA 2H1CA 2BI8A 1C8VB 2DQZA 3KIPA 4MIYA 9ATCA 3KOYA 4CMIB 3WYFA 1MIOA 4LG3A 4IWYA 4CV0A 1U8UA 5KZMB 2JS7A 1RYYA 1MH9A 1OFTA 1I39A 1W46A 2BM8A 2FMLA 1JU4A 1NV8A 1VE1A 2QLLA 2VNSA 3ZDXB 5IUNC 3EZNA 1TVKA 2P2CA 3GLRA 3M9LA 1EVEA 4JL6A 4O4HF 4P0TA 3P9KA 4B3RB 1M83A 2ILTA 3ZI4A 3OYFA 2C61A 2CJXA 3LQFA 3ZK8A 4F5ZA 4X1IB 4FW9A 4QDTA 4TYQA 4HH0A 4YRJA 3C7JA 2AUTA 3PUKA 4GT1A 1RLTA 1VPLA 1XRMA 3CN7A 5GP1A 2J3HA 3UGKA 4E03A 4EGCB 1TDJA 1RXWA 5CVJA 4PAQA 3JQ9A 2C8VA 3WC4A 4YXFA 3K0SA 1U3WA 1IY1A 3VZQA 3ASNH 4OI2A 2EB7A 4MVJP 1VECA 3KAJA 1KQOA 4FGLA 3VH1A 2C9CA 3M49A 3DFGA 3UJCA 3L0SA 4YAUA 4BY7J 1CB0A 1RC8A 3MMPA 3VV3A 5F3WB 2AEMA 3C1AA 4V3BA 1FPMA 3RQIA 2R6ZA 1S3IA 1F4LA 4OQDA 4IP0A 5IYDJ 1XD8A 4IPAA 3CP2A 1Z6XA 4RE6A 3OF2A 1WMDA 2F5FA 4IQ4A 1JZQA 1PZFA 1T5HX 1R4NB 4H4KC 4KMMA 3T3OA 1FVHA 4C4PA 4I5DA 2LDXA 5CFOA 5DP2A 2DTZA 4LPKA 1KVTA 2OA4A 1Z68A 1YIOA 3OY2A 4M7OA 1SURA 4X3CA 1YGPA 2AQ8A 4DY4A 1YAJA 1ISJA 3CG4A 4MXDA 4DA0A 3CKMA 3K4CA 2JATA 3LSRA 1A76A 2R79A 3HIFA 3OQJA 4A8PA 4CJXA 1V7QA 2VJKA 3S3MA 3AOEC 3DFKA 4QARA 4BTLA 1E2UA 2BEOA 4V3CA 1OI2A 2PH5A 3JQEA 1EV7A 1GDDA 1OZAA 1IRIA 4P33A 3GHHA 4KSYA 1WCIB 3VSAA 2R8ZA 3HHPA 3U1DA 1Z22A 5BNZA 2MYTA 1P2TA 1XZFA 4EJ2A 1Q2UA 4DR5B 3F9IA 1TEZA 1G8FA 4BLUA 4D9BA 3EIHA 3FPLA 5AJWA 2YWEA 4JBYA 3KB1A 4YVFA 1JKXA 1UP6A 2CQQA 2O5CA 1K7SN 1NFFA 1Y6JA 3QXXA 4RLFA 4IWXA 2NV6A 1DRWA 1BHSA 1HKSA 1L1FA 3EFEA 1U9NA 2VDKB 3ID6C 4BECA 5H5JA 2H4FA 2HZDA 1Y6ZA 3GDWA 3EPKA 3L9WA 3M83A 1NY6A 2AHQA 1ENOA 1W25A 5JSKA 1VLLA 2PFKA 3S3OA 3BL8A 4QATA 2EW8A 3T3EA 4HZUA 3ZZUA 1KC1A 1UBCA 2Q0HA 3MRXA 4IIXA 3RFCA 1TUEA 2IEIA 2CVOA 3L02A 3QVOA 4PYKA 4XA8A 1BM9A 1MH4A 2CFOA 1CUXA 2P4QA 4GPD1 4HPWA 4UEQA 1D8KA 2QRGA 3NBQA 4GD3Q 3VZRA 4ZHSA 1P92A 1SVNA 3DOIA 3R6WA 4NYIQ 2JFZA 4A8JB 2JAWA 1I2AA 3GMTA 2P6SA 3JVDA 1FW6A 1EWQA 4A15A 4KQIA 2HLDA 2YC4C 3ITKA 4KQ6A 4L0QA 2BGMA 4MRSA 1ZD2P 2BY1A 2IX9A 4GWGA 2PXAA 3NNNA 4LB6B 3OPNA 2HBQA 4QTYA 2R8OA 2JRLA 3ECAA 5AXAA 4KR7A 2ZROA 2J9GA 3W7BA 4QKQA 5AW8A 3VNQA 2IYWA 4EPRA 1GZDA 1W2HA 3K9CA 1ATZA 5IC6A 2HBRA 1YRAA 4Y9UA 4HAIA 3QPCA 4MWGA 1KBZA 2X3FA 1X1QA 3BK2A 2E55A 2CL7X 3RARA 1F6WA 3BMXA 2DVMA 5FFZA 2B4QA 3U31A 3OQIB 1WAMA 2PZEA 1U9OA 1XTVA 1C7ZA 3OTHA 4JXKA 2WOOA 2NXCA 4EY8A 5A06A 1CVIA 1WLYA 5GM1A 3SZOA 1BEUB 1UDAA 3NONA 2QT0A 4M7PA 4AX4A 1J70A 2MLGA 4CA0A 1GTG1 1TYBE 1OFIA 3GN2A 3IWZA 4MCHA 4OUDA 4B2YA 1BFUA 4JYZA 1J25A 4HDSB 2QQ0A 1PJ8A 1JTFA 4PFQA 1EUZA 1TRHA 3PNLA 3ZGOA 3AETA 1JV2B 1YZUA 3DM5A 3F22A 1FYLA 1GG5A 3G1WA 3O3CA 4BNFA 5I9LA 4AO8A 5LQDA 2GYWA 2ROQA 2H18A 2XKBA 4RAQA 4RSMA 3QNMA 5CT4A 4D42A 4UOZA 4YRQA 4LJ5A 3AEUB 4ZI7A 1AE1A 2ID6A 1G8SA 1PL0A 1VLJA 2YJ4A 1O2DA 1NR7A 5ICEA 4FGUA 4GLLA 5IC4A 4QPQA 4XUGB 1Z1DA 2Q2OA 4GVXA 4JR2A 1VFNA 2QVBA 2XGEA 4CYDA 5TR9A 1QGOA 4MRNA 4B8ZA 2Q4OA 2WFZA 1C8BA 3KKQA 3MW8A 3R40A 2OXTA 1MO3A 2XUDA 2COBA 4U63A 5DM0A 3SOZA 4IHAA 4ARSA 4BN4A 1Z91A 4HQOA 5KYYB 5C3MA 4ZA2A 3WDSA 3STWA 3KYJB 3P71T 1P9LA 2EEPA 2XNCA 2HIAA 3KZZA 2OCEA 1XDWA 4REQA 4MDYA 2O2DA 2BP7B 1Y8RB 1TUGA 1W49A 1ATIA 4DEYA 1KVSA 3A10A 1VJCA 3OOHA 4KXFB 3N58A 4G9EA 1KAMA 4O2AB 4OHXA 5D00A 3TN7A 2Q7DA 4EIWA 1M9NA 1IDZA 2ORIA 1WH7A 2HKIA 2BEJA 2WKRA 2X8JA 1X6VA 3NHKA 2VJLA 2XA9A 3B52X 5A1TA 3R74A 2PYZA 3TPZA 1CQPA 2XVZA 2HWXA 1K79A 4I1YA 4NHEA 1H4QA 4II3A 4UM9B 2F59A 3U1BA 1PYVA 5EJ4A 3ZKAA 2V4ZA 2VNHA 3M6FA 5HIJA 3K1PA 4ZDOA 4JBLA 1PP8F 1V4VA 3V7WA 1UPAA 1DT3A 1ZELA 2R5YA 1RW4A 1I3NA 4TLDA 5B3AA 1E2NA 1W75A 5L4LA 1ADBA 3CJRA 3FXOA 1HSOA 1OY1A 1NRIA 2B61A 2EZ8A 2N42A 2WM9B 3AV0B 3HU2A 4P5EA 2CE2X 4WCVA 3PKJA 2PUEA 1JQKA 3MQ2A 3OCXA 3DHYA 5I48A 1Y3FE 1Y42X 2OD9A 1BX3A 1A27A 4RY2A 4AKSA 2NTNA 4P08A 2FZ5A 1LI5A 1FUUA 1HG1A 2R8XA 4MS3A 3D4IA 1OXMA 5IDYA 4F5YA 4RDUA 5FXMA 4ZXPA 2CZGA 1GZSA 1WXWA 3KKEA 3UXEA 2Q6KA 3PF8A 3PYLA 4HRYA 1SUCA 5DBEX 3SMQA 2EPFA 1WDKA 4MKHA 3HSFA 1K7AA 2XQIA 3F98A 4NEGA 3SZTA 4QULA 3X2SA 3WQBA 4RSRA 3FGNA 3PXCX 3KXKA 1AKWA 4LYDA 3RBXA 4DMLA 3Q5DA 1L5LA 4XN0A 2FUNB 3S2SA 1GGHA 1O94A 1WB6A 1JHRA 3OVMA 3AQIA 4LXTA 2QG6A 4MEJA 1CZUA 1HWYA 1OBFO 3BSFA 3E7XA 1CUEA 3VNBA 1Z0JA 3RRYA 1QHHA 3TIFA 1FVXA 3HTSB 1B59A 1KYQA 2XSDC 1M0TA 3TP3A 1W88B 2B30A 2C1EA 2PKEA 1KI6A 3ETEA 4G8BA 4HD8A 4TL7A 4G6TB 1ABFA 2IWHA 4X64B 2OV6A 5JU6A 3L6BA 2I66A 3ILSA 1I33A 1QG2A 1KEZA 1UZNA 2PX5A 4KVZA 4YMSA 2Q5EA 1P0PA 4QFDA 1XS9A 2JA1A 2FW7A 3E2IA 1OU4A 2GAAA 2XRZA 3ENWA 2C03A 1KA9H 1Z5OA 4A6PA 8LDHA 1QH8B 1PTJC 5F2OA 3IAM6 2ZJBA 2BYVE 3VTFA 1MIJA 3KU1A 4JWKA 4WHMA 1A36A 1A5ZA 1OWNA 3GRFA 2IHKA 1E0DA 4K1LA 2XF8A 4W5WA 1KU2A 3ISJA 3STUA 3BJEA 3T9EA 1UXHA 2FOWA 5DYMA 3EASA 5BMZA 1DFGA 3SYLA 1FDTA 2XI4A 1TZKA 4PTZA 3UV6A 1R1TA 2O8XA 3H9JA 4J01A 2QTCA 4U2BA 4AN0A 1V11B 5YASA 3E9EA 4ED9A 4GE0A 1PZGA 5FTWA 3GFMA 1ICIA 3A6DA 3SYKA 4L9NA 3HHEA 3R0VA 1VFPA 4DHEA 2DFHA 3SQNA 4YFVA 3NR2A 5FLXK 4FCVA 3GYHX 4JELA 2MD5A 2K4MA 1W5FA 1BQEA 4B84A 4ZDKA 4K2EA 4JB3A 1V48A 4DMRA 2PMWB 1M0SA 5JI3E 2ADMA 5IEJA 3CTAA 5BSWA 1JBQA 5HZMA 3BC1A 5JRZA 5F51A 1FTZA 1SAYA 1XTAA 2VHXA 3G1MA 2Z33A 1X7GA 3GHYA 3HBMA 3JVEA 3NJRA 1I6MA 1PV2A 2NV2B 3RSOA 2WAYA 2DYSH 3UTCA 1PF7E 1UBOS 3SNKA 4DMFA 3AINA 4AJLA 4UUVA 1RQ7A 1U7XA 3OHSX 4AYXA 1Y80A 2A07F 2C58A 1C30B 4HDOB 3JRHA 4FDVA 5BT9A 3UB4A 1VBFA 3S6JA 2H2FA 4G5RA 1NM5A 2OVBA 2VL7A 5IVKA 2DGDA 4BAGA 5FOWA 5JYDA 1IBLB 4JHLA 3U44B 2B2NA 1QR6A 4ESFA 3MCZA 3NWSA 1C3XA 2IDKA 1JXAA 1WXXA 4MQ4A 4EA8A 1MEJA 3GTOJ 4HFJA 4XCQA 3D02A 3QPWA 4FPXA 4RVSA 1VGRA 4TXMA 1GUYA 2CLFB 2KRHA 2ME6A 1XYYA 3DZDA 3EWIA 3FYUB 4MUXA 4TQUS 3ZCXA 4J8PA 5ALOA 2O3JA 4I02A 1Z4OA 2CHEA 3GBPA 3UWMA 2FUCA 1L4BA 3LG2A 3ASOH 4Q9HA 2FX0A 3F78A 1NR5A 5EZYB 5HM8A 2QRNA 2AO9A 2YFHA 4P84A 2VHEA 4XE5A 3RHFA 2PX9A 3ZIUA 4KE8A 4FDTA 4BWYA 5FB2A 4NHOA 2R44A 1RXUA 3CRZA 3SR4A 3HTUA 3QE9Y 4IEFB 3C48A 1E3DA 1N6IA 3TEDA 5K0NA 3H18A 4XD2A 3B38A 5HNKA 4EA6A 1IPHA 1GN9A 1JF8A 3HJAA 4WTOA 1WSBA 4Q3DA 4CLDA 2IH2A 3AGPA 5ILOA 3RAJA 2ZBFA 3BMCA 3ND9A 4G1UC 1YOVA 4YG2F 3D3QA 4W7IA 5BOSB 1KYZA 1QTIA 1X0VA 2QUJA 4ZDIA 1WZIA 3IBTA 2P0AA 2P1DA 3FYDA 2M6KA 1I5OA 1G16A 3A2NA 3M6VA 1GZ4A 3FWNA 2LKDA 2Y1DA 2GAUA 2AVNA 4YP7A 1DAIA 1PLKA 1A3CA 3OETA 3ROFA 2OKGA 2YMPA 1QFSA 4FEAA 4CR7A 3V34A 5JAUA 4YCNA 2DEUA 1R9JA 2PLNA 2Q3DA 4HEQA 3E9QA 4C0WA 5LC1A 1A7JA 3NDPA 1A9ZA 3SHVA 4OX9Y 1D1TA 2SHKA 1WETA 2XXAA 2O0LA 3ZV3A 4ZMSA 2X8JB 2CT8A 3VU3A 2QN8A 3DPUA 1OTHA 2VEDA 3X43A 3Q0IA 4DV1B 2AZXA 3QMPA 3HOVJ 4CL8A 2FQXA 2QQ9A 3S2YA 3CS3A 4AW9A 3HI4A 4UDNA 2YWXA 5E4FA 1WUIS 1JG1A 4G89A 4KIFA 3RSCA 1BVHA 2P3QA 4KCGA 4QUHA 2I78A 2LR0A 4IXNA 2CK3A 1ACJA 3REGA 3VR6A 3OQNA 3UJPA 1QH0A 1P31A 3DPIA 4LRXA 2ZIXB 3H0EA 4R3NA 2O7QA 5BNWA 2ZULA 4YFKF 2FXVA 3LZCA 4M6WA 1W7PA 2IY7A 2XBLA 1BBYA 3ABSB 4JXJA 1YR8A 5EGNA 3P2JA 5EE1A 4Z0PA 5HK8A 3REOA 3GFIA 1K9SA 4AIDA 2PWZA 4E1AA 3A4MA 5JDIA 3WA7A 4QICA 4Y9TA 3QVVA 1UR5A 3E81A 1S9DA 3KQLA 2H3EA 3IKLA 3MS7A 4RMGA 5K7FA 3MTQA 1LGYA 2AJCA 3PSAA 1HDXA 4QSMA 2ZZMA 5IF9A 2C5FA 1D1SA 2HU7A 1A8PA 2PMFA 5LU8A 5ES3A 3T41A 3W4IA 1UADA 4TV8B 2FR8A 1E18A 2IYTA 2DX7A 2YHUA 2Y2ZA 2PUCA 2TMDA 5IWCA 5A6SA 5DLEA 3OMWA 5HSGA 1QYVA 5K3EA 3F8WA 5AVSA 5LBQA 4F7ZA 2VQGA 4QUDA 1XN7A 5AQ1A 2QDKA 1XTRA 3RPEA 1A88A 3K9QO 5HE8A 1S8NA 2IV3A 3TD6A 4AICA 1VMAA 4WBNB 4KE6A 1E2LA 2PBZA 2XYHA 1E62A 5D5QA 4J0EA 2SKDA 1DXHA 5HMMA 3UJDA 1F7UA 4FFPA 3CF4A 1G38A 3DO6A 4JT8A 1GHTA 2H1RA 3OO1A 4U8HA 4BAYA 1E1DA 4M55A 2VP6A 1EVYA 2E82A 2SICE 1Y8QB 1BGWA 3MBIA 3WSTA 4IG4A 1BRTA 5C52B 1M1UA 3RG8A 5K7ZA 3SDSA 4F6CA 3IESA 3AEXA 5BVHB 2VKVA 1E77A 3JALA 3LBAA 3GCXA 4FYMA 5TPZD 3GY0A 1MB2A 4UE3S 1AKMA 4W1PA 5CFPA 3ETLA 4OMZA 4MYCA 2K02A 3DDCA 2NO6A 3RHZA 4ZO4A 1E1YA 3PFGA 5I5GA 3S93A 1P4SA 5KNBA 4BQPA 2BMFA 1P45A 3HOSA 5LD2C 1FTGA 2A61A 1ZUNA 2QYHA 4PC7A 3QLUC 4B7UA 5JNVA 3SMVA 3OZ7A 2NN3C 1UQUA 1YFLA 4MCJA 3VTZA 3ELWA 3ESBA 5LLQA 1E7RA 3ZQFA 3A27A 5KWEA 3LPLA 2EDCA 3OUZA 2W2KB 3R0IA 4G07A 4KOEC 5DCLA 4Y17A 5DXFA 4F12A 4ZMBA 1BW9A 4BDYA 2XYVA 3G5LA 3Q7RA 4NBUA 2O8NA 2OPHA 5KTNA 5F5NA 3WODF 2PIAA 1TQ6A 5E3HA 2MTBA 5KBYA 1GPKA 1RM5A 3F47A 1K3FA 3M3PA 1FP1D 1ZU5A 1HDRA 3P45A 3EUHA 4P93A 3P9PA 1DO0A 3LNQA 2CJFA 3LVQE 2OAZA 1NVTA 3LW8A 1X1EA 4IS2A 1G0OA 4JP5A 1BTOA 4YMHA 3CWZA 1EGHA 3O7WA 1JR3D 1ADCA 1PGNA 4KLNA 3IT2A 3M6WA 4YI3A 2QROA 1YB7A 3GC6A 2HWVA 3KBOA 1S3SA 2PL1A 3ZV7A 2QVGA 2WFLA 3FN4A 4JLUA 1NBHA 1KAHA 2Y99A 1V8PA 5TEWA 4YYEA 4QOIA 3NRCA 2P9JA 2AN1A 1DEXA 3PPXA 2AJDA 5KSZA 1TIPA 1XX6A 2EQ5A 1O58A 2LDBA 4LZWA 3KR0A 4CUKA 1IUNA 1FFDA 2HRBA 1C81A 3HWX1 4FC6A 2XT0A 2OBPA 1FQJA 2FZKA 4M99A 1GAWA 1VE6A 2YH2A 5BW8A 3F8SA 3KYCB 5KYUA 3T5MA 1SEPA 4NBWA 5LZ7A 4ZAZA 2AKYA 2ZSKA 2M0CA 5BT8A 4F60A 1CGPA 4M76B 4K28A 1EG2A 2FP3A 2P1RA 2JGIA 2FSPA 2Q2WA 3FZEA 1OH6A 3ZQIA 1U04A 3UW1A 3EYYA 2V6EA 3VSDA 2ZAIA 2BFWA 2LWIA 2COKA 2JK0A 2ORVA 3D3KA 3FBTA 4LBZA 4RZUA 3IBSA 3KV3O 4M53A 3WK6A 5I5EA 3O1IC 3LPAA 2VBXA 5J40A 4BUCA 3S70A 2CYAA 2Z9OA 5I51A 4OGKA 2QL6A 2RCNA 2JLQA 1IHOA 3PHCA 2KRCA 4BE1A 1RNLA 2HOAA 3BJAA 2E35A 2V74B 4DLTA 2CMKA 1YQWA 3LSJA 5AJHA 5AMXA 4ZRMA 2GPAA 4EFMA 4M22A 4EEXA 1ODCA 1FYVA 2Z16A 1UPXA 2LVBA 4PXYA 1XX5A 2LF8A 3W9UA 5B30A 5IKMA 3W04A 1ESMA 3E4DA 2VK1A 2H27A 3SQMA 1XWFA 3WTVC 2KI5A 3KPVA 1T1RA 4FEEA 4MV1A 2P11A 2YN2A 3ZZ1A 2BFBB 3I6YA 5D3ZA 1U94A 1IAWA 1YHZA 5DEQA 2QXUA 1G59A 2G63A 4IX1A 2QE6A 4G0WA 1ONSA 5BSKA 5GONF 1BC8C 4JUAA 1H23A 4LJAA 1QCCA 1WPXA 2OY0A 4Y7DA 5ECWA 2W6PA 3EPLA 1EI9A 3IAHA 4IFIA 2VDPB 3H6GA 3UHJA 4ABTA 1TADA 5CT9A 2XPVA 2P27A 4B1RA 4YP6A 2VL8A 1Z3YA 5DOVA 1JHHA 1GUFA 2ZWIA 4FWIB 4AYBA 5KYTA 1Q1EA 2IVFA 3H92A 1RKQA 2HF9A 3FVVA 3BVPA 1SRQA 1MCZA 2QM3A 1XROA 1KU0A 3QP5A 5TRTA 3V8MA 3WKAA 1N7JA 1VQ6I 3SIRA 3SD7A 1RJEA 3GD7A 2FR0A 2BJHA 1ZK3A 2I29A 2ZUDA 2GAOA 4YA6A 4DBZA 2UUAB 2W4MA 4OJQA 1XXLA 3HUFA 3TSYA 5CXUA 4EJUA 2QX4A 5P8WA 1CIJA 1XCGB 2CXOA 2JDID 3O91A 3QJ5A 3VZBA 2I1LA 5AW2A 1QQBA 2H9YA 2DMQA 2WSBA 2XMBA 2ZCUA 4IJQA 2EKLA 4ND6A 5EA2A 4ZVKA 1QIIA 3E22A 3LPNA 3SF0A 3GROA 4GMDA 2WHPB 2D2EA 2B8TA 1I5RA 2I2XB 3CH4B 1WSAA 3FPHA 4P7KA 4IAOA 1WMBA 1ZSYA 2ZETA 2ACWA 2YXNA 3AW9A 3R24A 2BE5F 4QLAA 1RIFA 1SHTX 2Y93A 2WQ7A 1U7DA 1Y0UA 7AT1A 4NSNA 5TLSA 1BO6A 4I4TF 1BS2A 1XTSA 1ZUNB 4L1KA 1GVNB 3HJRA 5B55A 1K78A 3OU2A 3SJCA 4FLEA 1I2CA 4OX9B 5FKLA 1FLVA 1G20A 1XRQA 1XSXA 2C07A 1EX6A 2CNWA 2OCIA 4ASUA 3QWAA 4GWKA 2FRVA 4H16A 4MPRA 3WGGA 1HF0A 1QIEA 2ON6A 2NNYA 1M3SA 3ENQA 3UJ3X 4PNEA 4FYIA 4R1QA 1KJ8A 3KS9A 3TZHA 3ZLUA 2X2FA 1IOLA 1LFBA 2IVMA 3TO6A 2YPRA 2HSEA 4QNRA 5BR7A 3U1TA 4HL6A 1ZKDA 5MGNA 4FGSA 3PFYA 1IHDA 3I6BA 1SD1A 3DKIA 5L4NA 3KZNA 3KQUA 1FRVA 1TZMA 5CLFA 3RUPA 2AX4A 3LHIA 1R5NA 2AG0A 2G06A 4ZOBA 1RC0A 5ECDA 5F04A 2OA0A 2DZDA 5L7YA 2QWWA 6Q21A 4FHCA 1HFEL 2O2IA 3I59B 3OS0A 1IU9A 2M6SA 3I53A 2WF5A 2O2JA 1CZHA 2SKEA 2Q0SA 3AEQB 1H2EA 1Y7HA 2W2OA 2NO5A 2WUDA 1CQIA 1W5BA 3M7IA 3UXMA 2EFQA 4F72A 3CSUA 4ZYLA 1RKBA 3P2IA 3ER9A 2UUPA 1N0IA 3D5TA 3G2QA 1OUMA 3FISA 3GLKA 4IJVA 4MW4A 5CB4F 4AO7A 2C04A 2YS6A 3N8IA 3EG9B 3ZU5A 4LF9B 3HL2A 3BROA 3QPHA 3KXDA 2A6TA 5EG0B 3CNEA 2PWBA 3BHJA 3L18A 4LCEA 3RKSA 1OKKD 2ZTHA 1UT6A 4NZ9A 3WS7A 5JEEA 2D2VA 5DGDA 1AS2A 3BDIA 5BWLA 4UU7A 2P5UA 2IU4A 3F7OA 3W3AD 1JSXA 1XJWA 5BSRA 4A2WA 3NP7A 2D4HA 2ONKA 2WHYA 4Q3OA 4R68A 2VASA 5KVAA 1BAPA 2VJQA 3OT4A 1WO8A 1H0RA 3EDYA 3TDZC 2WB2A 3OEED 1U2EA 2PZLA 1HE3A 4X8MA 1U7HA 5EJGA 5HM6A 4AJIA 2NS0A 1H05A 3CUOA 3THOA 4MS1A 1PT6A 3CZQA 1RKUA 2PFGA 2M2EA 1FSEA 1RHQA 2HWYA 2I4NA 1AM4D 3A4VA 3RTEA 3IPRA 2FFRA 3ZWDA 1HFKA 4OJMX 4OP3A 4OU5A 4Z4CA 5JH7B 4AKIA 2KLOA 5K0FA 3C5EA 3M6UA 5BN4A 2MINB 2KHMA 1B72A 5I7UA 3HKBB 4HSTA 1ODLA 2WKSA 3HJUA 4TX1A 4U7FA 3T7AA 4EARA 4YIHA 1MX1A 3LA2A 2GZRA 16PKA 2WPDA 3FPAA 1I36A 5C3EJ 3IO3A 3VKVA 1Z6AA 5DO9A 1QG6A 1RBZA 4D8WA 3WTSC 4UFOA 4EKNB 1P2SA 3UAYA 3M1EA 3WMGA 4QOJA 1DBRA 3DE2X 3C8ZA 2QLZA 2WIJA 3P2EA 3QHPA 4YACA 3U3XA 2VUSA 3BH7A 3ZD8A 1NMQA 2A1TS 2F62A 2OHVA 2RIPA 1V47A 1G7TA 6ABPA 3HO8A 3AHIA 4DIUA 4HTAA 3N75A 4QQFA 4E32A 4CM6A 4KMSA 3K4JA 3W4JA 1TL8A 3B1YA 2Y30A 4IDCA 4O4LB 4AO6A 3GFJA 1GNVA 2B5OA 4KFSA 1U8CB 2FW8A 1OHHD 3BFJA 5CVCA 1DC6A 1ISGA 1N2GA 1P7VA 5SY4A 2FFAA 1U3VA 2FG6C 2GZWA 3VBCA 3ABZA 1P6UA 3VYVA 2ZPUA 5TPWB 1J9GA 4DSOA 1ZWLA 3QPTA 3L7BA 3FLBA 5JISA 3ROZA 3ZGZA 1LNZA 4MO2A 1KP2A 1R5HA 3PNBA 2DODA 3F3KA 4EQ6B 5KWIA 2DSNA 4BTVA 1NI4B 3THWA 2A3SA 1H9BA 3D0KA 3EQ7A 5HBGA 3ZS8A 2QZ9A 4PBRA 5KCZA 3IUPA 2DT6A 2REBA 4J91A 3FXUA 3KJIA 4WCFA 2PMZA 2V98A 4LE1A 3BCAA 1GUDA 2PBIA 1MQ8B 5CLHA 3RRNA 5DYGA 5C7LO 3F3MA 1T10A 3DWFA 1II8A 4ZC3A 1WULS 3LL7A 3AK4A 4MJLA 2KJQA 2GHIA 3OTOB 1RWXA 3JRAA 1WNTA 5G0SA 3KSUA 3T5BA 1Z2PX 3U4HA 3BZCA 3BWEA 2QBYA 1S02A 3MKZA 1ST2A 3C6XA 3DCNA 3PHGA 3M4ZA 4LK1F 1G3WA 3RI4A 3OX3A 1WUYA 4A1OA 1W0JD 1IXZA 4DV3B 3JZFA 1G7RA 3AJEA 4KKVA 4P22A 5ALEA 3V8RA 3WP0A 5L4SA 4JMLA 2BRUA 1RJGA 3IA7A 2W6NA 1QSGA 2XD9A 4YECA 5EVJA 5FWAA 4EMTA 1BWRA 1ILWA 2ZEJA 3FTPA 1TX4B 2HZ7A 1J2UA <