4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
2HDCA 2NYXA 3OE5A 4UUVA 5DTMA 3TPZA 4DNCA 3ZMTA 3ELDA 1O57A 3MQ0A 3K0BA 1YYVA 1UCRA 3FM5A 3SZTA 2HR3A 3EMDA 4HRAA 3KQPA 1H9GA 5CVRA 5FQNA 3AXTA 4YFKF 1NBIA 1U2ZA 3DF8A 2IH4A 2EJRA 3UJBA 3O3KA 4KMUX 4ZH4F 4POOA 1S7AA 2CO5A 3QU3A 4GYGA 2IDKA 4KRGA 1IXCA 1XGSA 2R7DA 2STTA 5EKXA 4QWQA 4R6XA 2BE5F 3F8BA 1WWXA 2XAQA 5TJJA 2OU2A 1Z3CA 1F4KA 3F8FA 4BYYA 1HNNA 5DPMA 5CVJA 3M70A 4QVKA 3GF2A 4PYOA 5D5UB 5DRYA 1FYMA 2RV8A 4OIRF 2ZIFA 5F2OA 4BNCA 4KNYA 1I4WA 4JQFA 4CHUA 1LEAA 4E32A 4CWAA 1ZRFA 3ME5A 2O03A 4B8XA 1I6XA 1YS7A 4IRHA 3CKKA 1IRFA 3WGHA 1T39A 2M30A 4N9IA 4FP9A 4UVAA 1Y8CA 4ER6A 1X1DA 3I9FA 2ELHA 1YZHA 1HW1A 3GYHX 4FGZA 3RKXA 2QUFA 2BR4A 3T7RA 3K6RA 1ZGAA 2YR2A 1RZ4A 2A6HF 4GOMD 1BIAA 2K7LA 1BC5A 4ENKA 5HS7A 4Y2HA 2EB7A 2ZMEA 1SKMA 2A5YB 3T7SA 3E8SA 4YV1A 2IA1A 4GF5A 3KHKA 3FF5A 1XCBA 3RIEA 4Q48A 1KHHA 1R23A 3VYWA 3GEZA 2YX4A 4ZZLA 1KXZA 5GWXA 2GB4A 1EIZA 5H6RA 4U0YA 2VC1A 2YXEA 3JWHA 2DW4A 2FSWA 3PX2A 2P5KA 3FRIA 3E5QA 5J6XA 5D5WB 2EFWA 1R1VA 3R6SA 3C1DA 3PX3A 2BR3A 4EKIA 4PGGA 2NNYA 2AR0A 2DK5A 4EM2A 4ENNA 1G6Q1 1WY7A 3E6CC 2P6SA 2RN7A 4M73A 4RTLA 1FC3A 3E3VA 4OIQF 3OU7A 2EV5A 2XAGA 3QPTA 1J7KA 4E2ZA 3LA2A 1RUOA 2HMYB 5FULA 3P9NA 3P9IA 1D8JA 2IA0A 4B17A 1ZARA 4RGRA 5L3DA 3ZMZA 2JHCA 3VC2A 4HTFB 4KA4A 1BKYA 3GGDA 4OIPF 2EFNA 1ZRCA 3I64A 3ELUA 1UIRA 3UA3A 1Z05A 1JQEA 2UYCA 1BC7C 4PWYA 4DM3A 1H9TA 2F2EA 2E7WA 2XUBA 3MZYA 2UYHA 3C3YA 2K4MA 3V7CA 2WA2A 3BGIA 5DX8A 2GXBA 3VB2A 4YFXF 3R0QA 3U1DA 5HLIA 3RKWA 3LDFA 2HQNA 5E1XA 1BHJA 3P7NA 3ZN0A 1XGOA 2OB2A 1N7IA 3SXJA 1BJAA 3UJ8A 2O61A 2JT1A 5FA5A 4MWZA 3DXXA 4MQVA 4R79A 4MEYF 2CWWA 2A07F 5KVAA 4M74A 5HZMA 1HW2A 2YPRA 1SD6A 1L1EA 2ZULA 3DPTA 2V6CA 5GOZA 1IY9A 3G2OA 2ESRA 4WXDA 3IKTA 5DLYA 1IN8A 1B9MA 4EK9A 4FX4A 1RI2A 3V8LA 2PT6A 5JFRA 3HHHA 3ROUA 4HV6A 1FOKA 2YUIA 2JRTA 1A04A 1L3IA 2YTZA 1YO5C 1YIOA 3KP6A 3JTHA 3SR4A 3IRRA 4OQEA 4U7BA 3OV8A 3W6KB 4I2OA 4HC4A 3P97A 1UWVA 2JJQA 4C06A 2OZ6A 1VQ1A 5M5BA 3KR0A 2X4HA 4A0YA 3F3XA 2UXNA 5K5RA 1GVJA 1X19A 1O3RA 2PGXA 5KVRA 3TM4A 1KP9A 4A5NA 3IV6A 1ZYRF 3BZBA 2QQ9A 2YSRA 2O05A 1KU7A 4QTTB 5K0JA 5KS2A 3LDGA 5K5QA 4QDKA 3LA7A 1ZRDA 5EIWA 2KW5A 4PYJA 3CLOA 4G94A 5AONA 1J2XA 2B2CA 3B89A 4ZYEA 4I7HA 3FXRA 2I7CA 5E18F 2LKPA 2XAFA 2YX7A 8MHTA 3DR5A 1TTYA 4I0BA 5D5XB 3KR9A 4Y13A 1T6SA 4M9XA 4GUAA 2NXCA 2IH2A 5C0OE 3LAJA 2QBYB 3IHUA 4MHTA 5DRTA 3FUUA 3FPHA 4IKPA 3FM3A 1TW3A 3JWJA 5TRDA 2D1VA 3AY0A 2O07A 2CFXA 1YF3A 2EJUA 5KK1A 1OR7A 4RTOA 5HOOA 2PI0A 2K86A 4RGXA 3JSOA 3HCEA 3BXOA 2G7HA 1L0OC 4R05A 2XBMA 1D2HA 1HKTA 3RPUA 3FXQA 5DM0A 1D3YA 1GXQA 3HOSA 5EGSA 2YQZA 2CMHA 1Q1HA 2P5VA 5LSAA 3THSA 4UNOA 5DEQA 3WTUC 3TLJA 3DH0A 3BWYA 3PVCA 2CQKA 3HP7A 4CTJA 4XCXA 3MCZA 3IYLW 3LCCA 4AZVA 3A26A 4Z2YA 3A4TA 3SGLA 2CL5A 3V4GA 3KP4A 1FBUA 1W5TA 3IL2A 2PBIA 2V79A 2P8JA 3B02A 4ZZDA 2JHAA 4P5OA 3T7TA 4E2YA 4M38A 5FWDA 3AXSA 3WODF 5D5VB 2FK7A 2JHPA 2L54A 5EEHA 1IRGA 1JSXA 3HVJA 5HLHA 2AOXA 3I54A 2QLZA 3FZVA 2WV0A 3O31A 3EMBA 3TQSA 1UFKA 3ISPA 2AOTB 4F86A 2IBSA 1E2XA 2RDPA 2ORED 3ANXA 2XIGA 4NHJA 1MZBA 5BPIA 4NQWA 1KPGA 3GO5A 1SFXA 4EV0A 1R1UA 4O6JA 1XTPA 4GQBA 5EOVA 5FFXA 3VOEA 2NP6A 3HYIA 4BLWA 3F8NA 3K1PA 3UBTA 3FTEA 2Z9OA 4KIFA 3GO4A 3LL7A 1L3CA 1REPC 3F4KA 1KQ8A 3KCCA 5DM4A 5J8CA 4OOIA 3FRHA 2FU4A 4X61A 3PS9A 1S7OA 1EH8A 3QOWA 4PYIA 5E1ZB 3SMQA 3GRZA 3NDIA 2PXAA 2ZFWA 5DD4A 5EZQA 3CTAA 3UZUA 4P9UA 5K0BA 1G38A 3SFZA 1KGSA 4HTFA 2BR5A 5GINE 2NAZA 3BWBA 3G2PA 1MJ9A 1FWZA 3BY6A 2NNNA 4I0AA 3GFMA 3LWFA 5CUQA 3HCFA 5MHTA 3G2MA 1P1CA 1LNWA 2PVCA 2V1DA 2I9KA 2G9WA 5K03A 3JWIA 3ZMDA 5C1IA 1OKRA 1NV8A 3QAHA 4HX8A 2J5OA 1BI2A 2OB1A 4FT4A 4YIIA 2LF8A 1IN7A 1QNTA 2ZFUA 1AOYA 1U2WA 2GA9A 4PYNA 3FMQA 3GRRA 1YFLA 3F6VA 2E5WA 3KQWA 1KU9A 2QWWA 5H6QA 3TOSA 2P4WA 5L3BA 2BH2A 2ZBRA 5EC8A 1USSA 1V3FA 1YFHA 3ER8A 1STZA 4ESBA 1P6RA 3HUGA 1ON1A 2A6EF 4AIHA 4BAYA 2F8LA 5FD5A 2AN3A 4OX9Y 4N0BA 1FYKA 3OOPA 4EM1A 5EZSA 1O7FA 5LBQA 5F2NA 2RQPA 2IW5A 2RC4A 2ZZMA 5E8IA 1XSVA 4JK1X 1R74A 2V1UA 4B09A 2V7EA 2FPOA 3ULQB 3WTVC 4WCGA 3EEOA 3K9TA 5ICEA 4AIKA 3KEOA 3LCUA 2M45A 3ECOA 4Q4ZF 1R7JA 3T0YA 1U8RA 4GOLD 4EJWA 1QPMA 3V8KA 1IF1A 1J0RA 3J7AO 2W85A 1K78B 4L18B 4RYLA 3M33A 4OMZA 3REOA 2G8NA 1NW7A 3CUQB 5DTRA 1FX7A 5D4SA 1KU3A 1TW2A 3G8AA 1W7PD 1XJ5A 1R36A 2Z5UA 2GAFA 4OQDA 1O9HA 4UVCA 1JG2A 4YV0A 2ZBPA 1NHAA 2QRVB 1R8YA 1ORHA 1NKVA 2JG3A 2RVCA 1RIOH 3BKWA 1M6YA 2BEOA 1KQ0A 4LG0A 4E70A 3KP7A 2HR1A 2EK5A 1I1GA 5ILUA 4YUVA 1TNSA 1KPHA 3T8TA 2M8EA 5DT2A 2WK1A 3EVCA 5FB2A 2MC3A 5IT9K 2HFHA 1WZNA 4PDKA 4ENMA 1X1BA 3EGEA 1NW8A 3HM2A 3ABTA 3HTXA 1MDMB 4QPPA 3IWZA 3FYDA 1XCVA 4P55A 1DPUA 3MWMA 2B9EA 3R61A 3FXUA 3H3UA 3TDUC 5EMMA 1EH7A 3ZQ7A 5IT3A 3ZP5A 3FYCA 1QBJA 1KYWA 1F9NA 1J5YA 2QY6A 3WE3A 3HCAA 4U88A 1RJDA 3L00A 3WSTA 3TOBA 5HDKA 5HIKA 3FPGA 2LSOA 2FMYA 1BI1A 1IN4A 2PX5A 2AZTA 4P7KA 4RAZA 2QZ8A 2UZKA 1G55A 4BHBA 3KQOA 1G3SA 1RJEA 5FO5A 5E8GA 1IZ1A 4DZRA 4GCVA 4BY9E 5IKMA 3PB3A 1XSDA 4GOOD 4JXJA 5DSTA 2HOEA 3U2RA 3A27A 5HILA 1GXPA 4M37A 3F6OA 2QE6A 2MLGA 1JSZA 3GCZA 4EQQA 3HVIA 3FX3A 3LHDA 5DCMB 4AZSA 3ZMVA 1Z7UA 4Y30A 4KMFA 3AWIA 4C03A 2OKCA 4U0VA 3P9KA 3OZTA 2Y1WA 4C04A 1W4MA 1FSHA 5LRSA 2UZ4A 4KIGA 2H00A 2ISYA 2LNBA 3LKZA 3PTAA 4LD5A 4L5IA 1J9IA 2P5LC 4ISCA 4EJUA 5LQJA 2PMHA 4LK1F 2ZW9A 4G6DA 2J5PA 5T6BA 4XLNF 3OPNA 2JH8A 3EPPA 3HVHA 2XYRA 3ML6A 2GA2A 2TDXA 4YIFA 5LHGA 4OA8A 3WTTC 2G71A 1NW5A 5HIMA 4PIMA 2AOUB 3VC1A 1I9GA 4KICA 5CVEA 4RTSA 3KEQA 1M6EX 2DPUA 5HDNA 2XHKA 1RI7A 1JE8A 2PT9A 3K1MA 3KQQA 2OYRA 4MHGA 5CVDA 1XGMA 1NW6A 5GM1A 4P7FA 2V1XA 1LB2A 4KT5C 4G6QA 3UJ9A 1ONVA 3DXYA 3OFKA 2QENA 4DQ2A 4IWNA 4KUMA 2XAHA 3RODA 4PNEA 1R22A 4G7ZF 2VODA 1YQAA 3NEUA 5K0LA 3ECHA 3F23A 1QAMA 1TQMA 2AS0A 3EVBA 2FEZA 5DWQA 3HCCA 5HDGA 2H27A 2HEOA 3GDHA 1Q0SA 4ESJA 2NXEA 4X63A 1SMTA 4R1HA 5HS9A 4RTPA 3TO6A 2B3TA 1XDZA 1RJFA 3G89A 3KE2A 3BZ6A 4G8XA 2W57A 4U0WA 3LKDA 3TRKA 3MHTA 5F64A 1B59A 4HV5A 4BHCA 2HNKA 4YUWA 2PJPA 2AN4A 3M9AA 5DUKA 3DTNA 1TLHB 2YXLA 2A14A 1U5TC 3TDZC 2HKXA 2L02A 4FR0A 4R8HA 4BHPA 4D0PA 2BGCA 2HWVA 2ZXJA 5EMLA 1K79A 2EWNA 4E31A 2CWEA 3A25A 1T0FA 5ILSA 3BROA 1K6OA 4RVFA 2UXXA 4IRGA 3U9GA 2K4JA 3H2BA 1EG2A 3HSEA 2UYOA 4ETSA 2G70A 2IBTA 2B0LA 4MGRA 4IHTA 4QQNA 1T43A 5K01A 4CTKA 4U7DA 2W84A 3DLIA 1K78A 2ZBQA 1M0EA 1DUXC 1R5GA 1ZQ9A 1W7PB 4GYIA 3CUQA 4CYDA 1ZG5A 2P1DA 3COAC 1G3WA 3PFGA 4LLLA 4M71A 1Z1DA 1WXWA 4L9VA 3EYYA 5ED4A 2ZBKA 4EVIA 5HIJA 3CO6C 4U7PB 3C3PA 2FNPA 4GOND 5DX1A 4NECA 5EQJB 1DPRA 5E17F 3IRQA 4HF1A 1EV7A 2X0LA 1B4AA 4F85A 4PYMA 1N2XA 1P4WA 3IEIA 2Q2EA 5DYMA 1O3TA 3EVEA 1RI4A 2XAJA 3HRSA 2I6GA 4MQ9F 2PX2A 4BQAA 3E5XA 2WC2A 4RTKA 1LVAA 4RVHA 3KP3A 5GP1A 1MDMA 5EHGA 4FT8A 3OCJA 1R18A 3TO7A 3KQSA 4QPNA 3RI4A 4A0ZA 5FWAA 4CKBA 1XMKA 1NW3A 1R8XA 1BM9A 1SVUA 4ER3A 1PJZA 2C7RA 3WU1B 3QOPA 2Z3YA 3SZPA 2FOKA 5HS8A 5DM2A 2FYTA 3EGVA 4MNUA 4DQ0A 1D2CA 4XSZF 2DI3A 4C08A 5L3GA 1G8AA 3RPQA 1RI3A 1USTA 2GWRA 4RGSA 4FSXA 5JHUA 3FPEA 5K0GA 5LLQA 1W5SA 4PINA 1LQ1A 4CZZA 1K7AA 1SFEA 3HRMA 1MD0A 2M1BA 3MFKA 3D0SA 1R1TA 4M7RA 4HX4A 3ID6C 2MA3A 3UJAA 3HOTA 1FT9A 2YU3A 4LFUA 1SQFA 2VS1A 3HTUA 2FRHA 3GRVA 2FXAA 3LSTA 1X1CA 2Y0MA 1YS6A 4ASNA 5L3EA 1ZG1A 3A7DA 3J80Z 4HLXA 3ABUA 1JXSA 5CM2Z 3ERED 2ERCA 1LDKB 2VOOA 3SSNA 4PGHA 4CDGA 2QVOA 1SUIA 3CC8A 3DXZA 3NWBA 2MH9A 3L9FA 3MEXA 1P39A 3E6MA 1ODDA 2IIPA 3M6VA 2P7IA 4A5MA 1ORIA 3GJYA 4PCAA 3O7WA 4ZYHA 3RYPA 3B73A 3P8ZA 4HW0A 4CXMA 1SD5A 4DA4A 1OYIA 2UYQA 3ZMUA 2GIVA 1CF7B 3NDJA 2DBBA 4UV9A 3E7PA 3UJ7A 4G7HF 1FP2A 3N4MA 3P2KA 4LWPA 5EEGA 2EFPA 4OINF 3HA3A 3CO7C 2OXTA 2XVCA 2IP2A 4KFCA 2VOPA 2OY0A 3LPMA 1PP7U 1HSJA 3M8FA 3UWPA 2ZNZA 3VSEA 3A7EA 1XDSA 1MJBA 2DQRA 3GFIA 5K0CA 4HQEA 4RGUA 2Z99A 1EQAA 4RTMA 4XSXF 4PZJA 3EVGA 2R6ZA 2VBZA 3LBYA 4BP1A 3PT9A 5FTWA 2P3OA 3PQJA 5GIPE 1OYWA 4G56A 4AUKA 2A69F 2ZCWA 1YG2A 4L9TA 3LX6A 5GIOE 3R9XB 1LEBA 5L3CA 4E33A 4HBLA 3TOAA 3G7UA 2GPYA 1UFMA 3I0TA 3J81Z 5BQTA 4M72A 3WU0A 3W6JB 3Q9SA 4FX0A 3TMAA 3D2LA 3C6KA 2W25A 3I71A 4DCMA 5F6FA 1IXKA 3NVMB 2WWYA 3ELKA 2PX4A 3K0LA 9MHTA 3N97A 2C7QA 4FS8A 3GNLA 3MAJA 2G7UA 6PAXA 1X3UA 2M87A 1YW9A 5ICCA 3SXYA 2IH5A 2O8XA 3R0JA 4UV8A 4BLVA 2C7PA 4BH9A 3QPHA 4GEKA 5E9WA 1NT2A 1KA8A 1F5TA 5K8VA 3LCVB 4O5VA 4O3MA 3ELWA 3UJ6A 4M36A 4OIOF 3E97A 1F1ZA 2VZ9A 1HSTA 4QTUB 2Z6QA 2NP7A 1ZAOA 3BP8A 3GFJA 5EIFA 1W7PA 5DSXA 2HKOA 1S29A 4V0QA 4IXAA 2ISZA 3P2EA 1FPQA 4XRFA 4Q47A 2VONA 2HYFA 5LGUA 2L4AA 1WI9A 2Y48A 3JAMZ 1ZH5A 4E2WA 1FLIA 2PXCA 4MTLA 3CJRA 4E30A 5A2QZ 5H02A 3I59B 4L0ZB 2ADUA 4EM0B 3BPXA 3NMUF 3DMFA 3WGGA 4S05A 3OE4A 3TM5A 5E8JA 3TKYA 3EUHA 1AWCA 1F38A 4R8RA 3BPVA 3ELYA 4YV2A 5E1WA 2AVDA 5EPEA 1JHFA 1ON2A 3G5LA 1HKSA 1S3JA 3B3GA 2VBXA 3SVZA 3GLXA 3KLNA 3KETA 2IRFG 4X60A 1XCLA 1G3TA 2P41A 2DTRA 4YUXA 4EQZA 4IRIA 2P35A 2ZZKA 3QOXA 1AV6A 4LLNA 3BGDA 1XB4A 3KPYA 3KPVA 1YUBA 4IVNA 3L09A 4PYLA 3BJOA 1WG8A 3K69A 3VEPA 5CYVA 2A61A 1IXRC 1VIDA 4HAMA 4XUEA 1I1NA 4KDPA 4KDCA 1ZKDA 1QQIA 2CYYA 5EKUA 1IN5A 4M9SA 4IV0A 3Q9VA 4AZTA 4H0EA 4OBWA 5AIPA 2OAZA 3G73A 3FZGA 4HSGA 5B1SA 4HA8A 1RUNA 1DL5A 4LJZF 5IH3A 1VLMA 1GHCA 1B6AA 3O2PE 4HZFA 4XUCA 3M8EA 4ZYGA 4RB0A 1BN5A 5LGNA 3FHZA 5D4RA 3FUWA 1S8NA 2E1NA 2O3FA 3THRA 3C3WA 1R6AA 4EMSA 3F8MA 4PYQA 5E2AA 1AQIA 3J81K 3R60A 3I5UA 4GGGA 1JG1A 2XV4S 1P1BA 1G6NA 3DFGA 5FADA 3KPJA 1WS6A 3T0IA 1I1SA 4AIJA 4HF0A 2P8TA 4XLPF 3KLOA 2IDJA 1CF7A 3SSOA 3GVAA 3FWEA 1FBNA 1QANA 5ILVA 1XCJA 5LHHA 2OZUA 3OU2A 2P40A 2O57A 4MEXF 2NS0A 4L9JA 3NQOA 4GC5A 4PCLA 4LB6B 4CKCA 2Z33A 2IJLA 4A12A 2QBYA 2P3LA 1FNNA 4YMHA 1SG9A 5CIYA 2KKOA 3DQVC 1Z9CA 2DFIA 2OPBA 2ZO4A 3GZ6A 1MGTA 3LGAA 2FBIA 2PFBA 4RTJA 3FMRA 1SAXA 4LG1A 3HRUA 3M6XA 1H1DA 2LF7A 2RKHA 3GFLA 2ZIGA 3MQ2A 4BLUA 2EV6A 2GS9A 5BPDA 4YFNF 1PUEE 3GRYA 3HSRA 2JTVA 4A2UA 1IM8A 3OU6A 2PXXA 4BXUA 4RB3C 1YZ3A 4IJAA 1J59A 2K02A 4I02A 5ERGB 3HVKA 10MHA 5JVTA 4KN4X 5E9QA 2ZKZA 3ER9A 5CVVA 1QZZA 1WKMA 2BYVE 2JSCA 3HTSB 3OFJA 2AXLA 3CJTA 4CICA 3TR6A 1O3QA 2FA5A 5A2QK 2FCAA 3FTDA 2F5DA 2PV0A 2HZTA 2OQGA 1OYYA 2OBPA 3X0DA 1JHHA 4F7ZA 4HH4A 2XYVA 3R0AA 3CJQA 1L3BA 4C4AA 5DXJA 2HTJA 1J75A 3M1EA 2STWA 3R24A 4RS8A 4KVZA 1Y0UA 3FTFA 1HW5A 2AOTA 4EJOA 2QQBA 3CGGA 2DQLA 3EETA 4HX7A 3BOQA 5E2BA 1QGPA 2VBYA 1HMYA 4EGZA 2FE3A 2MBFA 1XVAA 3CDHA 2Q8KA 3GWZA 5LRRA 3M6WA 4RB1A 1DDNA 5K05A 3K2ZA 1WQ2A 3DPLC 4LGWA 1YB2A 2GQQA 3KP2A 3DUWA 3P71T 3VODA 3V97A 3BJ6A 4KWCA 3F21A 1KYZA 2KIMA 2A3SA 2BM8A 2VBWA 3JW4A 5LEKA 4EKGA 4AVPA 2ESNA 2EFOA 4UVBA 2O6GE 2CG4A 1KIAA 2DO7A 2O0YA 4CO8A 3LA3A 4BP3A 4I09A 5DX0A 3I59A 1YTYA 4C05A 4Y15A 2NXNA 1B1BA 3TQNA 1OMIA 1XSXA 3K1NA 4G7OF 3EVZA 5E1BA 3LBFA 1TQPA 2CMGA 3KQVA 4WF2A 4HDVA 5CVIA 3WE2A 4AX8A 2XVAA 2F5CA 2DK8A 2CW0F 3DXJF 3MB5A 3C0KA 5DM1A 3RW9A 4K6MA 2H6CA 2IGTA 4R8SA 3BGVA 3Q7EA 1F3LA 5FCDA 2FBKA 4UHTA 4IF4A 2BM9A 1VTNC 1T98A 5CJ9A 4DCGA 5BW4A 4OMYA 2EFQA 5BS6A 1NV9A 2RNJA 3VFZA 5H20A 2H94A 3AAFA 4PCQA 3FUVA 1FY7A 3ZN1A 1UHMA 2FQ3A 4RTNA 1FBQA 5DD8A 2EJTA 4LWOA 2AS5F 1SUSA 3T5XA 3KPWA 4RSRA 5ICFA 2M5WA 5JI6A 2ZSUA 5E9JA 2VP3A 3DKWA 2PN6A 1XD7A 1DUSA 4YUZA 2EG5A 5C9ZA 2GA1A 3GX4X 2FHPA 1KR5A 2VE8A 1BIBA 5HIIA 5FQOA 4L5JA 2VT3A 5K5OA 1ZN2A 4GO1A 2ZJ2A 4KIBA 5K1YA 3FTCA 4MTDA 3JWGA 5FA8A 4X41A 1JGSA 3MGGA 1FYLA 5K0EA 2VC0A 3ZMSA 4WXCA 3S2WA 4FZVA 3IKVA 3EVDA 1I5ZA 2COMA 2GLUA 3G2QA 3CVOA 3B3FA 3UA4A 3RTRA 3ZPLA 2B25A 4ER7A 5D6FA 1UB9A 4PONA 4QLCU 4RVGA 5JR3A 2DU9A 5T64A 1V39A 2P6TA 5DUIA 3P9CA 2PMUA 2CKDA 4UOEA 4G9YA 1WRJA 2H1RA 3PQKA 2PLWA 4EGYA 1U5TB 4XUDA 2I62A 1KPIA 2XYQA 3BWMA 1ULYA 5E20A 5FUBA 2QRVA 2ONZA 2NXJA 3CUOA 1BOOA 3E6DA 2Y1XA 4LLGF 4AD9A 2JZYA 2OBFA 2VDWA 3C18A 4ON0A 4O29A 3UFBA 5D1HA 2XROA 2DAOA 4CGZA 4P58A 4WVLA 3KR1A 4I01A 2DT5A 1BC8C 5KYGA 2ADMA 1IUYA 1QO0D 3I58A 7MHTA 2XKOA 2AOVA 3BT7A 1TNTA 5ICGA 3KFWX 3NWEA 5D8KB 3V8JA 3TGNA 2NRAC 1MKMA 5HLGA 3E5UA 2D1HA 4P96A 3DEUA 4YMGA 1MHTA 3QV2A 2PEXA 1X1AA 5J8FA 2NNWB 4HGYA 2ETHA 2PX8A 1G8SA 3MAGA 1MJFA 2Q41A 2PKWA 1SD4A 4WWCA 4OA5A 3F72A 2KRFA 3SHFA 3IWFA 1HXDA 3GUDA 1JR4A 4FSDA 3R6TA 2BBYA 1R5HA 2R3SA 1U78A 5LQRA 2DPDA 3HHGA 1T2KA 4HYEA 2K27A 4Q5SF 2A68F 1IAWA 4MTEA 3RYRA 4HQMA 5CLSA 5DCMA 1IW7F 2GZWA 2P3QA 2PG4A 1ZLKA 1VL5A 2ZVJA 1O3SA 3QP5A 5E1OA 1INLA 5HEKA 5FLXZ 3DP7A 1JTFA 2G1PA 3EYIA 3WTZA 1VE3A 1KQ9A 1JQDA 2H6BA 2BV6A 2Y75A 4YG2F 2AOWA 4RTQA 2ZLBA 2P7HA 4QVGA 4RB2C 3EDPA 4LMYA 4MQ4A 2HYGD 1Z6RA 5FHQA 3H3ZA 3R4KA 1FSEA 1XXLA 3L8DA 2EA2A 4KN7X 5FD6A 3ERCA 1P91A 1O7LA 3JSPA 1AF7A 5E1DA 1RI1A 2JPCA 3QRFF 4R6WA 1XMAA 3SX0A 3KZZA 3HA7A 3V7RA 1D5VA 4N9HA 3WTYC 1YFJA 1BI3A 3L7WA 1UHWA 4HOBA 1ZG3A 2AOUA 2XKPA 3EVAA 3QP6A 3F8CA 4HF2A 1RNLA 5E1MA 2IPQX 4U7TB 1P92A 1G60A 2MD5A 1EH6A 3KR2A 3C6MA 3KQYA 1XGNA 3TO9A 2IVMA 4I98B 1O9GA 2PJDA 4OU0A 3LFKA 3FPFA 1OPCA 4KDRA 1Z91A 2IPXA 3HRTA 1AQJA 5LQNA 4LG0B 1ZREA 1FP1D 5LQCA 1P2FA 1HBXG 2EFJA 4IV8A 4S04A 1JQ3A 1MJAA 2F5EA 4ER5A 3RDIA 3V8VA 4ENJA 3IHTA 3SQNA 2GAUA 2OA4A 1D8KA 2EA4A 4KW7A 1IXSB 3HSFA 2ZWAA 3FUTA 4KYWA 1VBFA 5FFZA 3NTVA 2QQAA 5F1RA 4H0NA 1R58A 2B78A 4P9FA 5LQKA 2FMLA 3L2CA 3OZSA 1VP3A 2AVNA 2YVLA 3NJRA 1I27A 2ESHA 1PP8F 3UJCA 4RTRA 5LQUA 4HGZA 1P4XA 5LR6A 3GW2A 1O54A 2PWPA 1B42A 1R00A 3WTWC 5EVJA 1N7JA 4QQKA 2EX4A 3BDDA 2NYUA 4WK8F 2Z6AA 4XBFA 1KU2A 4TV7A 3MCTA 5CCBA 5BXYA 2HWKA 3OZRA 3EVFA 3LQQA 3LQRA 3CBGA 2YX1A 3SSMA 5EMKA 1S6LA 5U4XA 4FHTA 1DCTA 2JPBA 5FGMA 2C7OA 3B3JA 2PSSA 3FPJA 4WXHA 5IT9Z 4AWXB 4MIKA 3GZ5A 2HGCA 1TPYA 1U5TA 2P7VB 1Z6TA 1U3EM 5D1NA 1JG4A 4LB5A 5F2KA 2CGPA 3GIWA 1Q0TA 4OBXA 4L9NA 5DV5A 2O0LA 5LHIA 3UJDA 1L9KA 1EJ0A 3T1BA 3WTXC 3HEMA 3RJPA 4QDJA 2VDVE 2Q0OA 3G8BA 5K09A 2WA1A 2MH2A 3DMHA 3E05A 3DMGA 1ZGJA 3WGIA 2O06A 2C6YA 5DTQA 1QZYA 1G4DA 4DMGA 3HCBA 2WTEA 2OZVA 4C07A 1TQIA 2HTEA 2VDUE 4NB5A 3J80K 1JG3A 5FLXK 3DLCA 5EHIA 1BBYA 3PFHA 5EMJA 3BJAA 2H11A 1CGPA 2MLKA 2JH9A 5HOQA 3V7SA 3IC7A 2P7CB 1SD7A 3GXOA 4EJTA 4IPAA 3G88A 3GRUA 4PYKA 5DCFA 2ZTHA 2ONYA 3KU1A 4X1OA 5LEJA 4L0YB 2AN5A 4GXOA 3WG9A 2GXGA 2KJBA 2PLYA 2N47A 2XVMA 1V4RA 3BUSA 5L3FA 1FJXA 2D2WA 1LDDA 2L3DA 2OO3A 3ORHA 2FF4A 4E2XA 3JTGA 2W24A 2E1CA 2K4BA 3D5LA 5FHRA 3EEYA 2VN2A 1NE2A 1U6GA 5BMZA 2IT0A 4V0RA 3DOUA 4EJVA 3TFWA 3HIFA 3F22A 5CVUA 4IHSA 4LECA 1QYRA 2D45A 4YUYA 5GM2A 1E17A 2R7FA 1QAQA 2IFTA 5G02A 3G3ZA 1G3YA 3EQLF 2V9VA 2H09A 2XASA 1RJGA 2PY6A 2ZNYA 3MZHA 4ATNA 3AJDA 1LJ9A 1OR8A 3BWGA 2PWYA 5CD1A 5CCXA 5K0NA 3KQTA 4DF3A 3B7PA 3CUQC 5EG5A 3CCFA 2ZWVA 2ZMEB 5KQSA 4HDUA 2FRXA 3E23A 2ZCJA 5HVQC 1BOAA 2FNAA 2VXZA 4DKJA 4A6DA 3LAPA 4RX1A 3GU3A 1NBHA 2HTSA 5LGTA 1ZHFA 4PIPA 5T67A 3PFIA 4WX9A 1QAOA 3BWCA 2HQRA 2FBHA 3WTSC 3MTEA 4LK0F 1WXXA 2ACJA 2L4MA 5D8LB 5DDGA 3NW9A 2XRNA 5JUWA 2DPMA 4ER0A 4P7JA 3KKZA 3LDUA 4ZYDA 2HV9A 5AIQA 2EV0A 4HG2A 1B9NA 4UXNA 4JBAA 1VPTA 3I53A 5BOXA 4M9ZA 1PDNC 3S68A 3SM3A 2QYOA 4RAYA 3QU6A 3RIRA 2Z6UA 1VP9A 1SFUA 4A0XA 1SQGA 2L01A 2YR0A 4RVDA 2DULA 4K2EA 3TKAA 1FZPB 4ZTBA 3CJNA 2VE9A 3HNRA 1P4AA 3HA5A 4RV9A 3G5TA 1YW8A 4CKEA 3M6UA 2FK8A 3FMSA 4FT2A 4RWZA 2QM3A 2UWMA 2GH1A 1HQCA 4M6YA 3Q87B 5HFJA 1C0WA 3JAMK 1EJ6A 3P2IA 3NVKI 3I4PA 1BI0A 5P8WA 5E8RA 3KZYA 2DLLA 4F84A 2KJCA 4P7GA 2LD4A 2YXDA 1JTEA 1FBSA 4A6EA 5D6EA 3Q5FA 3FUXA 1TBXA 1IN6A 2HS5A 3O4FA 2IA2A 3RKYA 1WSUA 4HLYA 1DP7P 1XDUA 1LDJA 1RI5A 4AZWA 5K0FA 3LECA 3M7GA 3H92A 3O6BB 2ZIEA 3NRVA 2E7XA 2F5FA 3PLAE 5ERIA 2VT2A 5DXAA 3BKXA 5BW5A 1PRYA 3DULA 3U81A 5BP7A 1YLFA 2V74B 2KIFA 2KIUA 3B5IA 3MTIA 4Y17A 2OQRA 4M6XA 1YW7A 1T38A 1H0MA 3T8RA 2BZGA 2G72A 5LQAA 3C7JA 4GBED 4ESFA 1ZLJA 3HCDA 1D2GA 3KPUA 5KQRA 3DV8A 4CXFA 3E6BA 3KQMA 2XGXA 1L3LA 1HKQA 3R3HA 3MERA 2LDUA 2OD5A 3KP5A 4GC9A 3M4XA 2RGVA 1SMYF 2CSOA 3EGIA 2PBFA 4L7VA 1XN7A 1EAMA 2PQ8A 2ZZNA
chains in the Genus database with same CATH superfamily
1QH1B 5J9FA 2MMGA 4A92A 1MQ9A 5AHRA 3VZQA 2Z4SA 3EMDA 3CCUI 2K3FA 1LDNA 1NP6A 1NBIA 1QRUA 3KSRA 2AHOA 5EWMB 4M21A 3QVOA 4FOOA 1DE0A 4EYEA 2RGYA 4Q4JA 4NC7A 1DXYA 2HDOA 4LXQA 3W5UA 4RAGA 1O08A 5A03A 5DPMA 3HEAA 1YA4A 4D6YA 1L5LA 5F98A 5EUMA 4RA2A 3DD1A 4F06A 3QOFA 3MS4A 3FWKA 4YGYA 5CB8A 4F96A 4MUFA 3EZGA 3EHDA 4WASA 3GYHX 2FLWA 2QUFA 2Z57A 3OX2A 2LCQA 3OOJA 2HXIA 3DLPX 5B3SH 1JBEA 3PXXA 1YS2X 8ATCA 2CSUA 1F2UA 4F91B 1KHHA 4KRXA 4FR2A 3FCEA 2VP5A 3IX7A 4GWKA 1ZQ3P 5AKZA 1Y3IA 2VF8A 4EHNA 1KU6A 5EP4A 1FFHA 1D7OA 1N8TA 3R6SA 4L5YA 2HN9A 3QHPA 3PX3A 1G1AA 2BR3A 2EGHA 2PU7A 3H6GA 1E8DA 1MFZA 5TPWA 3DBLB 2X9DA 3U3ZA 6GPBA 2EV5A 3GLIB 3M4NA 2H16A 1A5TA 4E2ZA 3ENNA 3B1XA 4FGUA 3FZNA 3TP0A 3GGDA 1WHTB 2EFHB 4IQ4A 3O5AA 3S1AB 4P2BA 1J6UA 5LD2C 1O94D 2O5VA 3ETJA 2BJVA 1YDGA 5DX8A 3E2PA 1NG1A 5D5PA 4UTPA 3L7YA 4DAOA 2GN4A 4COKA 5F08A 2G77B 3AEQA 1A4IA 4ZGBA 3AYXB 4MWZA 3LC2O 2CWWA 1M34B 4LY9A 2X0KA 2QTHA 4EL0A 1DU4A 2GPTA 4EK9A 3H8SA 5IAOA 2GZMA 1UCFA 3E5RA 3M5PA 2LDBA 5L3QA 1CJSA 4HV6A 1WV1A 2JRTA 2XOEA 4YWJA 4L5EA 4BEBA 5D7NA 3ROQA 1L5VA 4ZC8A 2VJ4A 1Y3CE 4QO8A 1V7CA 5A62A 2X4HA 3ZCRA 4D9BA 5LDHA 2J5RA 1BXRA 3TLMA 1LTHR 4B81A 1ZYRF 3TG2A 3P2OA 4QDKA 1ZRDA 2B0JA 1GLGA 3CO5A 2OSVA 5K6TA 2IU3A 2XAFA 2VCEA 3FHJA 5D5XB 3CUVA 3QKRA 4Q9JA 2DXIA 2FEMA 4LGMA 1OZFA 1P3Y1 3G1TA 3QMVA 3AY0A 4CN9A 1DTSA 3CV3A 1PL7A 1WL8A 1Z26A 3HOSA 4E7JA 2X0JA 4K40A 4L0MA 3GUCA 2YYZA 2VPLA 3IPRA 3UYKA 4PG7A 1ZVMA 4E7ZA 1KARA 5DLDA 4GPBA 5LUAA 1XD2A 4TYWA 4JJ4A 1TA0A 2ORWA 3HWRA 4NHEA 1WKCA 4M1KA 1EP9A 2OG1A 2JHAA 2JFBA 3D8RA 2R1VB 1XKLA 2CLMB 1JSXA 1ZAYA 4JOBA 2WV0A 3V4LA 4L15A 2P5UA 2AOTB 4LYAA 1E2XA 3NHPA 3PO3J 1MZBA 5B6PA 2D7CA 2QTRA 3CXRA 3E7XA 4S35A 4FC7A 1Z56C 3RAFC 1IEQA 3QU4A 4ASUA 5DBOA 4TUYB 5DM4A 1PQ4A 1DRJA 1Z6GA 2Q1XA 4JP3A 3AFHA 2AQIA 3SMQA 3R5SA 2VP4A 4GZMA 3IP1A 5BPFA 5IANA 2ZJ3A 4HLUC 1OBCA 2QZ4A 2PS3A 5B1DA 1GT0C 3AR6A 1KS2A 2Z8ZA 4TM7A 3KZIC 5EHXA 3ZDAA 2FXVA 3BY6A 1EVJA 421PA 3T1VA 3WNDA 5A6SA 2IV3A 4BNIA 2JKZA 1Y7LA 3HE3A 1WR8A 3MM4A 4A26A 4D79A 4RESA 3FWHA 4FT4A 1BI2A 1UEJA 1I5RA 4M1OA 4EMTA 5C8DA 1AOYA 1C7EA 1YFLA 2JZOA 3F6VA 3TOSA 3DTVB 2DA3A 3PUFA 1N7HA 2AW3A 3OKFA 2BGUA 3LPDA 2ET6A 1ON1A 4UUNA 4PZDA 3RTAA 1FYKA 4YROA 3EHEA 3ANSA 3ONNA 3CIFA 1W47A 4DLTA 2CRGA 3N8NA 3TDKA 4DIMA 3AHCA 2GD0A 4Q5IA 3LSMA 2NZUG 2ON6A 3LCUA 2X22A 3BMOA 4RZ2A 1TOAA 3GEMA 1J0RA 3AVOA 3BPSA 3BX1A 3HJUA 1LZKA 4EKNB 1KU3A 4PAMA 4AYBA 3MG9A 3KUDA 4CMEC 3UKGA 2HRRA 3HDJA 4OXNA 4RFLA 2WAFA 3IUBA 2V8OA 1Z35A 3F7NA 3R4CA 1P74A 4ZRNA 1Y5NA 4MYDA 2GXSA 1RXIA 2WK1A 3AONB 3MJHA 4WOBA 4IJMA 4L28A 4DLXA 1XIVA 3IWZA 1ZCJA 4B71A 4AP6A 4CEHB 4Y2UA 3TDUC 5I8WA 2QRLA 3ZQ7A 3ZP5A 3VVCA 1THZA 3WE3A 3W2WA 4M6VA 3PXGA 1X7DA 3EPLA 3JVVA 2ATVA 4UC0A 1BI1A 1IN4A 4OFXA 3HCNA 2VPRA 3VPGA 1ETQA 1WNTA 2CHUA 2H4JA 4QD3A 3TEDA 3GEGA 4BJ6C 1ONBA 2MLGA 2RHDA 1XZHA 3VBCA 3UANA 1HT2E 4M60A 5CDFA 1ZGZA 1IOVA 3C3AA 1EXNA 1H93A 1V8PA 2LNBA 1N3YA 4HCJA 1IUOA 4L22A 4YJGB 3L1VA 2PZJA 1BU8A 4F8EA 3N39C 2A0FA 3A8TA 1A82A 4OA8A 4YP1A 4Z6YA 4CODB 1WLSA 3WTTC 2G71A 3UUFA 3QWIA 3RVNA 1D3AA 2DPUA 1RC0A 3C4VA 2Y6VA 3PFNA 4B3BA 1ETYA 4FFDA 1PS0A 4B3DA 1DQNA 1SU7A 4XPIA 3ZJUA 2ODBA 1RQPA 3SY8A 3S28A 3DMTA 3GH1A 4V1CB 2E5LB 5ESRA 1WBDA 4IVPA 1N2HA 3QQAA 3F23A 2HWYA 4YLGA 3SR0A 1BE0A 1SMTA 1JW9B 1KQPA 3NX4A 1HYQA 3R7LA 4BS9A 1VSBA 2FEWB 2PJPA 2VYVD 4WFJA 1XCPA 5AVTA 4BYMA 1JAZA 2LP4Y 3U2QA 3ORYA 4GVLA 1LFPA 3N05A 2V59A 3LVBA 2M0MA 3PR1A 3BROA 2HXSA 3CIOA 2IBTA 3DHVA 5K01A 4CG3A 1GL7A 1YBHA 2IYYA 1VGRA 5A5EA 5CB4B 4FYYA 4LHEA 1Z1DA 1CPYA 4EVIA 5LZ8A 1Z0IA 4U7PB 3PJRA 4YELA 1CUIA 4O2BF 1HYGA 4KVGA 1RC1A 5CYPA 3KKMA 4EF5A 2Q28A 3E5XA 3N1UA 4BE0A 5EHGA 4UBNA 1DOAA 4PJMA 2PRYA 4UHHA 3I4NJ 1ZVQA 1PGNA 4PC3A 1TUIA 5C5DA 4GECA 2H8KA 3GNQA 1H0HA 4MW1A 4UBMA 3EGVA 2GFHA 5AI9A 5GMOA 2YJTD 2C3MA 4OV6B 4CZZA 1N2CE 5I9SA 2A3NA 2A9PA 2VJJA 4M0CA 1BU5A 1N34B 5F7ZA 3TLEA 2HU8A 4JLPA 2P5SA 4JI2B 3U61B 3ND7A 4Y2TA 2WYUA 1U11A 2KHMA 5LFAA 3MT9A 4HLXA 3Q8WA 4II3A 1U5CA 3WIDA 1XTSA 1JR3D 4P81A 4ZODA 1J8YF 1GNSA 4XJSA 3PZRA 2XMCA 1BROA 2V6FA 3KTAA 1M6VB 1F1JA 1I7QB 5DHTA 4FHEA 2ZYTX 2AF3C 1AS2A 3UC5A 2GILA 5E4YA 1XTZA 2FSPA 3I0ZA 1LWOA 2OCKA 3X1JA 1IZ9A 5LDDC 2HEIA 5H80A 3IDOA 1E4EB 4OXQA 4FASD 4FUTA 4I6JA 3UWPA 4GLFA 1SXJD 4G5GA 1RWNA 4P22A 2PRKA 3C3BA 2VBZA 3HWWA 2MFZA 3CZ6A 3UHPA 3R9XB 1E1QD 4LSZA 4E33A 2XWBF 3A9WA 2ZRCA 2B1QA 3J81Z 1LDBA 2FUCA 2GXUA 1GQOA 3UHOA 4YAGA 1YFKA 1SVMA 2ZQYA 3BFJA 3K9WA 3KOOA 3NVMB 4ZYTA 3KZMA 3PDJA 4C6RA 3JYOA 4W99A 4QYWA 2IAIA 2GWHA 4O4LF 2C58A 3G68A 4LYFA 4R8VA 3TXXA 4GEKA 3I6IA 3LCVB 4HHEA 1FLVA 3PGMA 5DASA 2PKQO 4R9VA 3E97A 1F1ZA 4XRMA 2P6RA 4QBFA 2OXFA 4W7HA 1P17A 4ZQFA 2HKOA 3PL1A 3LYHA 1FPQA 1FRQA 4BACA 3TH5A 3BL6A 4OHZA 3GDGA 4BV9A 4MW0A 4O8ZA 1ND6A 2VJMB 3VA7A 4OP3A 2O2YA 1DT5A 2CFIA 4KPEC 4NR0A 2VAVA 3TKYA 4M3DA 4UOZA 3G5LA 3BMXA 4B74A 3KLNA 1Z77A 1T1SA 3CUTA 3HHEA 4X66B 1MUUA 2ZZKA 1VFNA 2A92A 2G06A 2ALJA 3WQQA 1YUBA 4WBNB 4DBQA 2B6NA 1EVYA 1VIDA 3ZIAA 3RABA 2GVZC 4JJAA 2YOGA 2NZ8A 2GAJA 4D9GA 4MR9B 6AT1A 4HA8A 1PS8A 4QIHA 1DAHA 4A8HA 3RSFA 4UUMA 3DB1A 4JYKA 821PA 13PKA 1LBHA 3R60A 3JX9A 4XRRA 1UZAA 1M1ZA 3ZW7A 1F7VA 1N36B 4E5YA 1T5DX 2BKLA 3HJBA 3VM6A 5E2IA 5A04A 2CCKA 4BMDA 2NS0A 3Q0TA 1Q3HA 1TWAJ 1ECFA 5CA0B 5IYBJ 5FOXA 6REQA 4N82A 1MC4A 1S2MA 2WJIA 4YEDA 5LKAA 4MRNA 1GNQA 2ZO4A 5EIEA 4BO5A 1JDVA 1FUUA 4G6ZA 3ZDFA 3EY9A 1WHSB 4IL6C 1N6LA 4RB3C 2IEAA 4NUBA 2IEKA 4QFBA 4H7IA 2BYVE 4X62B 1K63A 1JHOA 4BMNA 1NBMA 2VJQA 4R1UA 5A2QK 1J0XO 4N41A 2VAXA 1OYYA 1VBNA 3RSCA 5IXJA 1PT5A 1LI5A 1I2AA 3OUUA 4XN3A 4LTMA 3ICWA 3M1EA 2II6A 5BQ3A 1EVQA 3FN4A 1BXGA 4FR5A 3WGKA 5EXPA 5LP6B 5DLEA 1W46A 3RWMB 2CDCA 4HQFA 1KS9A 4EGZA 2FE3A 1QJCA 3PUWA 1PJLA 2AHQA 1IO2A 4MVCA 2ME0A 3QE0A 1NIPA 1WQ2A 4GL4A 2ISSD 4O0LA 2E36A 3O0TA 3EEFA 2PJZA 5J2UF 2O0YA 3O1HB 4Z8XA 4I09A 4F9TA 3TQNA 3O74A 3FXLA 4F4HA 3OPMA 2TCTA 1R0ZA 3OSFA 2H6CA 3TOZA 3UM9A 1HYEA 2OMKA 2B34A 4DT1A 2FFQA 3VFZA 5F04A 3DKVA 4HEQA 3AAFA 1UHMA 3KZNA 2VKDA 3RFCA 2D1QA 3ESQA 4Z7JA 2W6IA 2C4HA 3GX1A 1HDPA 2GHRA 3AR2A 4HDNB 3V46A 1V11A 4LTDA 4I1UA 2B83A 4PFJA 1A8IA 3BIFA 2VC0A 1NRJB 2VP9A 4PLVA 2YYAA 4V3CA 3CVXA 3ORSA 3TQHA 2JCBA 2QX7A 3U7QB 3I39X 5GZ1A 1WRJA 2FPSA 2XHEA 3E15A 3PQKA 2G0TA 2SNIE 2BRUC 1QHHB 4LF9B 1YBVA 5ITVA 1KPIA 4MVJP 2XF7A 2NXJA 3U9LA 3CUOA 4RV4A 2ADOA 2HLHA 5F76A 2F3SA 3DCJA 5LMCA 1LTKA 4B2PA 1DKPA 3FJYA 4PXAA 1MBGA 1EM8A 2DBYA 5GAGJ 3R23A 4ZCIA 1UFOA 3WGNA 3C1UA 2PKWA 4X1YA 2WB4A 1JSCA 3WKBA 3MC1A 2KRFA 3WYDA 3IWFA 4YDSA 1E64A 1JR4A 4FSDA 1R5HA 1QPBA 3AVVA 1U9OA 1C3JA 4QFMA 2QSJA 2J67A 4KQ2A 5AM5A 4A7PA 2I5UA 5FJIA 4FQ8A 1R71A 2GZWA 3R40A 3ZNNA 5HEKA 3MINA 3DP7A 3WTZA 2WQ7A 4L57A 1FUKA 3PRHA 5MFZA 2P2SA 3D64A 4QA9A 1Z6RA 4ARAA 4N6NA 3S40A 3S55A 2HHCA 3LT4A 4CTOA 2ZPUA 4IJ5A 3CLUC 5FBQB 3L04A 1QYCA 2HOAA 5BOVA 3IEPA 4DS3A 1EH6A 2XWPA 3TO9A 2G5TA 4ENTA 3IJ5A 1K4SA 1GGNA 1V0JA 2G07A 4DIKA 1KNXA 3EXHB 3A1WA 5JJLA 1GPNA 2O6LA 5DGCA 1NJFA 2HDDA 1QC5B 2GAUA 3UKOA 2VQDA 4FSHA 2EBUA 1MZPA 3ECAA 2EW8A 3THYB 1ARZA 4LK2A 2XCUA 4WESA 3TW7A 2WJVA 2FFBA 2AJTA 2YVLA 4KIUA 3NHUA 3GQVA 1O54A 3HKEA 2ORVA 1WW8A 4A1OA 3DEEA 4WK8F 2R6DA 2OFPA 4YCNA 5FI3A 3S2EA 4CYCB 1K4YA 1IY1A 4BN5A 4YCAA 3OZRA 2QLMA 1XKTA 3CBGA 3OZWA 3VRHA 3SSMA 4FHTA 2JPBA 1C41A 3B3JA 2BFEB 3FSJX 2CFCA 3N2IA 5HW0A 3FPJA 4AM8A 4MIKA 1A8SA 1Z6TA 2CGPA 1P8AA 3T3MB 5EYPB 1OZ0A 5BN5A 5LQMA 4WUTA 1PNRA 1ISPA 4I6ZA 4KWTA 1NF9A 3HGYA 5HYVA 3GL9A 1Z2NX 2JCVA 1JI8A 4C07A 4HN9A 4L8LA 1PS9A 1SVOA 4MQEA 4MCJA 3BJAA 2WOJA 4KK4A 2C2BA 5HOQA 2Z3VA 2WY2D 2YFKA 4PZPA 5GP9A 1POWA 4MW7A 3PWSA 1WE2A 2XXBA 2PLYA 2N47A 4IDOA 1HKUA 2OO3A 4KVAA 1M54A 3RRJA 4BGUA 3DWGA 9ANTA 1U6GA 3ENWA 4EATA 1A8HA 5HDBB 3FHNA 4J4TA 5LOVB 1QYRA 4EJFA 4NXNB 5AOCA 1IBRA 4NPCA 2R7FA 4OH7A 5LMNB 2H1VA 2ODQA 2OXRA 3EC7A 2W1OA 2PY6A 3SQDA 1Q7CA 2QR5A 2WAQA 3KSMA 3O8CA 4HDUA 2V7UA 1R6VA 1MR3F 2FNAA 1LVUA 3WFIA 4D5CA 1V7QA 4HNUA 3DFZA 2AMFA 5T67A 1JFVA 1PG5A 4HFJA 3OY2A 3NARA 1EA7A 2AXQA 1UP7A 2DPMA 3M1IA 1T3TA 3Q5EA 3KKZA 4LMPA 2HV9A 3RFUA 1A4XA 2GUGA 1E1CB 5B7PA 3I53A 4DLNA 4KBGA 2O8FA 2QYOA 4NOJA 4QODA 3RYIA 2R5ZA 2NSHA 4YR9A 3VKHA 3GRKA 3HNRA 1L4KA 1NMZA 3KD3A 3H4VA 1TA9A 1HQCA 3GTPJ 1QQBA 2HDNB 1T8TA 2OHVA 3NVKI 1DRUA 2BL4A 3PI7A 4ZKEA 1YH3A 5J3JA 1G2IA 1GAJA 1ZNYA 4IIVA 1NN5A 3H05A 1WSUA 1RPJA 3KYDB 4I7EA 5JDCA 3QYJA 1XDUA 4WA8A 2VVTA 1D4FA 1PJBA 4UXIA 2CQ7A 5AH0A 3AUYA 2JJ1D 5FWNA 4Q1DA 4KOEC 4LRTB 3D7NA 2EZTA 1QE5A 5A06A 1Z0DA 5CT9A 4BC0A 3U39A 3TBHA 4ETNA 3KP5A 5K3CA 1ZOLA 3A01B 4L7VA 1EAMA 4Y0NA 4YRBA 2YIVX 2IYVA 2HZ7A 1RZUA 3AHFA 4FBGA 4DNCA 5GOTA 1JLRA 2B3DA 4EY3A 1E6UA 1ZIYA 1E92A 2AR7A 1ZL0A 5TR9A 2F8SA 1S7AA 3OH8A 2P30A 3E2MA 2I2XB 3TLXA 4QWQA 3AOGA 3V3KA 2BE5F 4EDHA 1EUDA 5SZIA 1WEKA 2ZYVX 1LF5A 1LQTA 3D5SC 1XWWA 4QYIB 4PQGA 4BNCA 4KH0A 1Z28A 1U8BA 1ORVA 2QN2A 1RBYA 1XG1A 4FS3A 4IILA 4IYRA 3BQ9A 1J0CA 1NN1A 1CEXA 2BFNA 3ORRA 1VL2A 3QH4A 2X9LA 1N92A 3KJNA 1SXPA 2QW0X 5FFFA 3U4CA 5ALQA 4Z49A 4I1YA 1K6MA 5TQVA 3H5WA 4YHHB 3KHKA 4B3RB 4R7GA 2PO5A 5IJ0A 1QP8A 5BR4A 3QVLA 3JWHA 2DW4A 4LZZA 4YV7A 1A8QA 2J6HA 1CY4A 1GZ4A 4ALJA 2C5FA 2C1ZA 1UELB 3C1DA 1AA6A 2M8GX 4Q7EA 2QN6A 5C3MA 1JIKA 2RE8A 4JDUA 1JP7A 1GUDA 4X94A 1K68A 3T61A 4WBSA 2QRZA 1Z6QA 4A16A 3P19A 3HFRA 1IHDA 3VC2A 2JHCA 4JSRA 3KJZA 4OI4A 1DFGA 4FYMA 1CS0A 4E13A 4RHUA 2Q7DA 3GCXA 3Q2IA 1C3XA 3ZWMA 3VB2A 4R83A 5JD4A 1Y0BA 1N7IA 4PS1A 1TZ2A 3F3MA 2JT1A 3C2BA 2EBHX 3GBSA 3MCAA 4CNBA 4YRVA 3MGBA 2ZULA 3DPTA 3LVQE 3VR3A 5CMLA 2ESRA 1Y1WJ 3ESRA 1B9MA 4FX4A 3BTOA 4J1TC 1GZHB 1MG5A 4B4CA 4HUQB 2RIRA 2NVOA 2XUJA 2DSTA 1L3IA 3LO8A 3BFKA 5LN1A 1AUXA 2XZPA 1PR9A 2RI0A 1E9FA 1UWVA 2L19A 1T0UA 5DMXA 4WAUA 1O3RA 1X7YA 5TV2A 2P79A 2HPAA 3IOEA 3OPYA 2WABA 5AKIA 2ZJAA 1TMKA 721PA 1TKBA 2XB0X 3RFXA 4Y4RA 5BWOA 1J2XA 3I6ZA 1A96A 3PHLA 1V48A 1JF8A 4A73A 2IXSA 4Y13A 3GELA 2B8JA 3JRAA 3T4EA 4IKPA 3FM3A 4DTCA 1IBKB 5CIQA 1YF3A 5HOOA 3UK1A 5BNIA 3VR1A 2P67A 1S7CA 2XNJA 2H0QA 2P5YA 3ZJ4A 3FNGA 2VQFB 1GTZA 4O25A 2IUEA 4B4VA 4LKOA 3TL2A 3KVRA 1ZSVA 1AUVA 4L6CA 1QVWA 3CYFA 2R6R1 3I9KA 3IL2A 4A8PA 4CFSA 4BMXA 4MPTA 1QYIA 3T3OA 4OMCA 1UEXC 3PUZA 2LR0A 4IRXA 3D5EA 1DP3A 1GSIA 2G40A 1YUNA 1UADA 3DU5A 2MSNA 5KKAA 3B9PA 3ZHTA 2JFNA 3CPHA 3JYPA 2ZUVA 3TW4A 5DBIA 4GYKA 3A6HA 2WTNA 3BH6A 4M0MA 1YV9A 4KIFA 5JMPA 4HLDA 3AU8A 1LE8B 3EIFA 2I4RA 4AY3A 4BQIA 3QF4B 2OOKA 1DT3A 4X90A 1YQGA 5KYKA 2AG0A 4TQ9A 5EZQA 5T6MA 4P9UA 3UT5B 4ZO6A 3J7AC 4BLTA 4MVJA 4IX9A 5AVJA 2PVCA 1GZ5A 2G9WA 2GCOA 3OZEA 4IH9A 2D2VA 4QBGB 4OHYA 4EGFA 3LZCA 3LUHA 1P6XA 4K9MA 1Q2XA 2ZFUA 3RNLA 3ETHA 3IT2A 3LU1A 3GRRA 2ZRDA 1KMIY 1HBJA 5L3BA 3NTOA 5AJHA 3IHLA 3T1QA 4DQUA 4FONA 3CVYA 4X71A 2CK3A 3CQ9A 1YC2A 3VH2A 4J03A 4BV2A 2PUHA 2O59A 3PQ6A 1KE2A 4GP7A 1GP2A 3BSFA 2NPFA 2FPOA 1BA2A 1IZZA 3EEOA 4C2AA 1FQWA 2IUTA 3V8KA 2Q46A 1P7VA 3GQBB 1OKKA 1WUKS 3VAZA 5BSGA 5D4SA 4G65A 1CQJB 1TVKA 3CKYA 3NEPX 1DIAA 1TW2A 1W7PD 1H65A 2Y4OA 2M9MA 2E6KA 4RS4A 2I0FA 4L02A 1TNSA 1ECCA 1W0JD 4NMMA 3S1RJ 3T99A 1AMNA 1MDMB 3MWMA 2XMZA 1PUFA 3FXUA 1HEUA 3W78A 5EMMA 3NTXA 1RJDA 3TOBA 4EABA 3YASA 3EGDA 4LOIA 1G3SA 1K66A 5EESA 3NHSA 3SYMA 4B3HA 3OQBA 3FMVA 3VPXA 3GY0A 3BCSA 1VJGA 1IHPA 3H1GA 3CUWA 3N8HA 1MO6A 1OBHA 5IJXA 1YWGO 3A9UA 1UKZA 1T6ZA 2ISYA 1BW9B 2LVBA 1ZR4A 3PTAA 1M2HA 3B8EA 4XVCA 2P5LC 4HRYA 3WGYA 2JH8A 1JGGA 3ZWYA 3VR4H 5K0TA 2CUFA 4J0CA 3ETEA 3OP1A 5A3QA 5DISB 4ARZB 4HAZA 2GLOA 4YMTA 2XHKA 1C8KA 4UCQA 4LNHA 1M2JA 4P5EA 1Y9AA 3LQFA 1FS6A 4WNYA 4DYVA 1PSDA 3NBFA 2QENA 1H42A 2BZ1A 3ZQFA 3JR7A 3KAPA 5K8CA 3ECHA 3BRSA 5KQMA 2I66A 2VATA 4JLBA 5A7FA 4OSPA 5ILGA 4QPQA 1U5AA 3M9AA 2FSIA 2A14A 1K6EA 5KDOA 2EILH 5F7XA 3DBHA 1U0OC 4Y3OA 2UXXA 3Q6MA 2UYOA 4G8BA 3CTPA 5D85A 3ADBA 2HGZA 4BC1A 1CF2O 1B1AA 4WFIA 2HIMA 1PBNA 5TIIA 4R9RA 2ZBKA 1CQPA 1UBGA 4Q1EA 4NJOA 2O2SA 1J8VA 5EQJB 2BFMA 2WSIA 3SBOA 4FTWA 1OI4A 4DCOA 4Y0AA 3GLGB 2GLTA 1L4FA 2DBVO 5TMEA 4TMTA 3ZCPA 3TPCA 4UTNA 4JLJA 3TO7A 3HJNA 2A88A 4CQLA 5HM8A 4NBRA 1GD1O 3IKJA 3KVOA 3L2WA 2YJ5A 4DQ0A 1Y1PA 3HG9A 3WA6A 2C94A 2JEOA 5KTKA 1SFEA 1M7HA 3IAM6 3RVOA 3MFKA 1ZVJA 3UG7A 3I12A 3TO5A 3RRNA 4M8IA 1PHRA 2HA5A 2WJGA 3JQCA 3NC0C 1FT9A 1SQFA 2UKDA 1ZG1A 3ZKWA 1EBUA 1T9DA 3J80Z 1IVSA 2M6KA 2R7TA 5CM2Z 2BUAA 2ERCA 2J9RA 1CUXA 3ZHCA 3NWBA 5EWJA 5T8KC 1ODDA 3TEJA 1Q83A 2P7IA 4YCLA 1O96B 3IQGX 4JN6B 2BY0A 4LZLA 4BDYA 4XD2A 4L8GA 3N4MA 3P2KA 5INTA 3L77A 2GK7A 3OPYI 2I10A 1LPSA 1D4ZA 5HS6A 4BMOB 5FO0A 4QAJA 1CY6A 4MOWA 1HE5A 1E3OC 3E53A 2P9BA 2VPYA 4RGUA 2CW8A 5DI3A 3F9CA 3PT9A 3C14C 5FTWA 3PQJA 4E15A 3DOIA 5KOIA 3FOAA 2DN0A 3LUJA 1XQWA 4AK9A 4BKUA 3LX6A 1F7UA 3BRCA 4UNPA 2WB1N 1OFTA 4XX0B 4HSRA 3SSAA 2P0YA 1N9GB 4WD3A 4L75A 1QOQB 1V5EA 3TRIA 3RAPR 5DN6D 4BJ5C 3WFZA 1T9ZA 3UFXA 1U1CA 1LNQA 3GNLA 1XCGB 2JFPA 6PAXA 3COYA 2CNKA 4AUMA 3SD7A 3AI3A 4BQFA 3R0JA 3FJ1A 3P0HA 1NVVR 1F5TA 4X20B 2OM2A 4O5VA 1YVUA 4UEOA 1ODJA 4TS3A 2ZR8A 4PLWA 2Z6QA 4LK3A 3THOA 3P4YA 4X9XA 3K9CA 2Z5LA 3DPIA 3TL3A 1V96A 3PCTA 4N5MA 2FWBA 2J0VA 1ODKA 3BICA 1TTQB 3C7TA 1USKA 3T5DA 3L4SO 3PL5A 1Z5GA 2G5PA 5C7IO 2HSJA 1POXA 1S9DA 3ONVA 1M1XB 4CLOB 5B7NA 2ZR9A 2ZUDA 3ZY3A 2CN1A 3LUCA 3FBTA 3O1LA 2MINB 5G1PA 4BY1J 3MMYB 4AJOA 4I5IA 4IXTA 1MJGM 3OCUA 5TGTA 4CZ2A 4S1OA 5FAXA 4I4TA 3G7SA 1T6NA 2KRHA 2X9QA 1NH3A 4NZ9A 4RGYA 4L78A 4EHHA 4EYSA 2O14A 4TTRA 3KFLA 5HQJA 5F73A 4PYLA 3D8UA 2Z9CA 1CQZA 2XB8A 3LOQA 4CUJA 1T0BA 2VK2A 3AVTA 2HD4A 1MGOA 1JKQC 3EC2A 5IH3A 1U8XX 4EY6A 2QP9X 1GPKA 2QNIA 2VL8A 1LNZA 1AQUA 3TLYA 2YHUA 4YAOA 3DM9B 3CDLA 4M3EA 1ZEMA 4LF8B 3WLAA 3IEUA 2HVSA 3M1AA 1TK3A 3GVAA 3OU2A 4HMOA 2B7EA 2O57A 2EKDA 4CM8B 4CF3A 3EDRA 3NQOA 1Y3BE 1IHXA 5H81A 1Y63A 3LF2A 3K96A 1HFKA 1PUIA 4L3OA 4FW8A 2FQYA 4Z4IA 2QPAA 4ND7A 3DOFA 1P4GA 1AN9A 3GZ6A 4CLHA 3QXHA 4G0XA 2Z56A 1WB9A 5GGXA 3GFLA 1R0XA 1PUEE 1G2PA 3U4QB 1RE1A 4DTIA 3OU6A 3J7YJ 4P4TA 2LD5A 4ZVUA 4IZ6A 3PNTA 5AKYA 1RD4A 2R85A 2PSDA 1ERDA 1QVZA 4NJEA 1JHHA 4G9BA 3IUYA 3O9VA 1Z75A 1GTVA 2X5OA 1QF7A 3LWDA 1E2FA 3OZGA 3FPCA 1FTZA 2DWCA 3L0DA 1AOXA 4ZARA 2JAQA 3BTVA 1QS0A 1DDNA 1PR2A 1D0IA 3W6UA 1N1MA 2PMZN 4LGWA 5J23A 2BP7A 1KYZA 1HRDA 3VKGA 3CX3A 1VJTA 4NU6A 2XB9A 1Y6JA 4NEQA 5EF6A 4MPRA 3BE8A 3FETA 2XNHA 5DM6F 3LBFA 1LW7A 2BCJQ 4ZQEA 2AJCA 1GYPA 1N2EA 1PFGA 1U3FA 2F5CA 2EQ5A 4UHDA 2IF2A 5D8DA 4XYEA 4XN0A 3WB2A 3SKYA 3DTKA 4GPTA 5E3NA 3OTGA 4N8DA 2XODA 3R4VA 3E9QA 5ALTA 2WBMA 1XQ9A 4MUKA 2H4FA 2BM0A 1YOBA 2BLLA 3E3NA 1E98A 1M2KA 2FQ3A 2GVNA 4MLCA 4DXAA 2JRLA 2FSUA 4RCVA 3RREA 5F0HA 1GPWB 2OUMA 1EUCA 2Q45A 4OIMA 1FVFA 2V0CA 2YV2A 5F51A 3ZJVA 1KMCA 1SFRA 2R62A 1C80A 1FYLA 1GT6A 2GD1O 3HVRA 4QHYA 3HM9A 3NDBB 3FYHA 2WICA 3EVDA 3PQ3A 3A0BC 3V34A 1O58A 2P9ZA 3DEHA 3PVSA 5CW2A 1U5BB 3ZH2A 4G0VA 3VGJA 4KN6A 1WDLA 1W9MA 3BFVA 4MICA 1JJ6C 1UMDA 2HSWA 1D2AA 1E3TA 4C30A 4ZOAA 4LOJA 3NKVA 4DC9A 4GZ3A 3UFBA 1YRWA 4OFWA 2XQVA 1GPAA 2QT1A 3SQXA 2GRAA 3AV0B 1Q1ZA 2PZAA 2Q62A 2WUVA 2XJ4A 3BT7A 4RNCA 1K4TA 3CZ4A 1U9IA 3V8JA 1T9BA 2H4XA 2E55A 3PEFA 1DJQA 4IXMA 5H4HA 1UBHS 2ANBA 2GAOA 1ZELA 4ACAA 1WZIA 5B12A 1ORRA 3RSHA 5I45A 4OATA 1EIWA 2QU7A 5TS3A 3TZEA 3O82A 2R3SA 4NENA 1JIIA 1LA2A 2DPDA 1OPXA 1YL5A 4N0EA 2BBOA 3LDHA 4HYEA 3KOUA 5G0SA 3FB1A 3SM9A 5A4IS 2P3QA 3ZBPA 3PIDA 2UUCB 4FMPA 2FSHA 1Z7YA 1H2AS 5HGXA 3F7OA 2J33A 4YP5A 1JQDA 3LO5A 3W5BA 3HKCB 1XZNA 1XXLA 1EHIA 3IIIA 5DNCA 1U0HC 3AM5A 2FP3A 1R6BX 3TIGA 1CV2A 3S1QJ 3H11B 4R6WA 4Y18A 4BUJA 5TS2A 1R0WA 1D5VA 1RYHA 1YFJA 4X97A 3QLEA 1ZG3A 1NYRA 2CF5A 3MYYA 5FAKA 4GIBA 2WE7A 1M6NA 4GX5A 3M4JA 4I98B 4X1KB 5FJJA 5BYJA 2IPXA 3QVXA 2J6IA 3Q41A 3A10A 2JJ2A 4MWGA 4G1EB 1Q5PA 4N3NA 1K2VN 4ENJA 4CQMA 1BKDR 3HSFA 1DXOA 5FFZA 1PX0A 3VISA 3LNCA 3EXEA 4MGEA 1JVSA 3OF3A 2WD9A 1CR2A 1NWCA 1LUJB 3K6KA 4M0LA 4CM9A 3N28A 5AKJA 4F55A 2FHSA 1B72B 3N2KB 1NDQA 4OGGA 1DBQA 3EPRA 4X24A 3CHYA 2CFSA 2HOTA 1UPFA 1Y1SA 1U0TA 3KXKA 2ADFA 1U6KA 4IL5A 3EWNA 1ZUD1 1FDTA 1S6LA 4CIAA 3MT7A 5KJEA 4ZAWA 1Z3YA 4HUTA 1Z0XA 3HSSA 4DGSA 4BU1A 2YS9A 3WTBA 4JIMA 2ZDQA 1U5TA 1U3EM 5F2KA 2VJIA 1IRIA 1EGVB 2HT1A 1L9KA 2BHRA 2WA1A 4JGGA 3DMHA 5EKTA 4LGCA 1QYWA 3RKSA 4M22A 1NFRA 2WTEA 1ZOIA 4QASA 1K6JA 3L3BA 1PN3A 6Q21A 1YE3A 2HQ5A 3BTSA 2NVTJ 1FL9A 4RIFA 5DCFA 4BRSA 3L0IB 5ECYA 3T9CA 4DLSA 1KDZA 3UW3A 5FRMA 3O3OB 2DDBA 3VDXA 3QNMA 4F6LA 5I7FA 2CSXA 4MQFA 3KYLA 2FETA 3IQZA 1AJEA 2PNJA 4JHXA 2AFIA 4G0NA 1OWNA 3LK7A 3ZS8A 1Q7EA 4CMIA 2CLFB 1RKWA 3NWPA 1FDIA 1OT5A 4MDYA 3CD6I 1VECA 1ZGGA 5IAAA 1SBHA 3T5CA 3BWGA 1QRYA 4XWYA 3KQTA 1WD7A 5JCZA 4WLFA 3RUDA 2ZWVA 3OECA 3QUSA 2D7DA 1JR6A 4DKJA 4IDQA 5HKBA 3IP6A 2HTSA 3DHWC 4KYVA 2DT7B 1B2LA 2JFVA 3BG3A 1YAJA 3HRKA 5BURA 1JPVA 4EJSA 4JB2A 3ABZA 2NU8A 4ER0A 3NB0A 5TEWA 1ZRHA 3WLNA 1E58A 1A98A 5BSVA 3AR7A 1DLIA 3TRJA 3ZQIA 3REQB 1T4DA 1OUMA 1QZ3A 1RMQA 3OQ1A 3QU6A 1Z3IX 2G4CA 1E79A 3ETNA 4P4LA 5EJ7A 2DLCX 5JARA 1NF3A 3GAFA 2G36A 2JK1A 1YK0A 1F8FA 3BR1A 3KV1A 2W83A 3KSDO 1Z18A 4MWCA 1FBSA 4FFMA 5HNFA 2B69A 3GPBA 3IHKA 3N2EA 3X1XA 4ENRA 3KIPA 3IVAA 4J0EA 2VT2A 3SEQA 3JQPA 1BMQA 2W9XA 1YLFA 4IW3B 1J5PA 1W36D 3CZRA 1D2GA 3DZBA 4C3ZA 3MERA 3EH1A 2N1MA 1JI3A 1LBSA 1P1KA 3EA0A 3W1VA 3FJOA 5B5EC 2PQ8A 1DGQA 2HDCA 2BWJA 1R0BA 4CL3A 3SE0A 3J7TA 3LT1A 1BVRA 2UU9B 3K0BA 1M2FA 2HR3A 2IF0A 4QC2A 1ZZGA 4WY2A 2Q9UA 3FGPA 2CO5A 4QNRA 4B6PA 3IV9A 1JNXX 1XR3A 3CE9A 3GT3A 2PR7A 4IBOA 5GPBA 4B4OA 4PYOA 1M5RA 3INNA 5D5UB 2HSGA 3D3KA 5GGYA 3CX4A 1JHDA 2BGMA 1XRMA 3OE7A 1BMFA 4CWAA 5TARA 3NIGB 2ECCA 3WYEA 4HWOA 2ODPA 2M30A 3LYUA 3DPSA 1QRAA 1NI3A 5EEAA 1HW1A 3BMCA 4ZK6A 4NL4H 4W5HA 5ALJA 1ZGAA 5IAGA 1ISFA 2IOHA 3PWZA 1SUDA 2GAAA 4X85A 1WXHA 2QVXX 1FIPA 2CJJA 2GPAA 2EZ4A 3OIYA 3FDJA 1KXZA 1GPYA 3Q9LA 4NQWB 2HA3A 2KQUA 5B3JA 1TX4B 3LY7A 4GOKA 1RC8A 3AEXA 1T6BY 3X2EA 4AZ0A 2X6XA 2YVAA 2XQFA 4P6VF 4BJHB 1E3EA 4BNDA 2PE5A 5AVZA 1CXZA 1RYEA 5JHHB 4OIQF 1H2FA 2H31A 4JC8A 4NSNA 1D8JA 4B17A 4MQ6A 2XNDA 4WLNA 2A0XA 3I52A 3EFOB 2AFHE 1H9TA 1V6AA 3UAYA 2PZGA 1G8MA 3WDKA 3UPDA 4IIGA 2Y8EA 2CNNA 3OKAA 1YCFA 3U1DA 2WTMA 2W4IA 4J91A 4DOMA 3VSLA 1KEEB 1V16B 3DE7X 4CT5A 1Q17A 2XUAA 4MQVA 2WJZB 4MR7B 3KB6A 2GI4A 2YY7A 1A31A 1ICIA 4QGGA 1U0RA 2ZUWA 4RM2A 3R3WA 5HMLA 2Q5OA 1FCJA 4TWAA 4MCHA 2VJYA 3IRRA 5JS2A 1AVTA 1R49A 2IU0A 5D3KA 1OCRH 3QKWA 3ZGLA 1ZVKA 5JDIA 4LOKA 3BCAA 2E4AA 3FIWA 3ZXXA 3TSZA 3LA7A 2PBZA 2NUTA 2IYSA 1DGWY 1FFGA 3VPSA 1JHMA 1VZ0A 5FUVA 4E03A 1AX9A 3A1DA 1MTZA 1Y6IA 3DR5A 3R6DA 2AMJA 3KR9A 5BWLA 4CF7A 4YECA 4ZMSA 1WUHS 1OE0A 3WIBA 2G76A 3OMXA 3FPHA 1BKSB 4UUSB 2LTPA 2RH9B 5BSHA 4W9NC 3RS8A 5A9SB 2CXPA 5KU1A 1NW9B 1NDHA 4FCTA 1Y8QB 2RGUA 4X0GA 3B78A 3VOAA 5DBHX 4WOPA 3ST7A 2IU6A 5AUPB 2PA3A 4EJMA 1WDTA 2HX1A 1V4BA 3Q7QA 2JLYA 1K8RA 2R8YA 2PLAA 3LHSA 4YIRX 3SZLA 2P69A 4B8WA 2RH5A 3FWPA 4EGCB 2P8JA 2J48A 4MWOA 1ZD9A 3H1EA 4JBIA 1X4PA 1CUAA 2KQRA 1U0GA 5KO2A 1DAFA 4FZJA 3RAJA 2W2LD 1ANKA 2PGAA 2XIGA 1G64A 3ZI7A 2XMPA 3F9IA 3OJXA 4YVFA 1RRPA 3IMCA 5AI4A 1W73A 5ESWA 3TMKA 1G7SA 2AI2A 2R97A 4CCNA 2A5JA 2Q07A 1QUFA 4W82A 5DIFA 4WRRA 3FRHA 3IDSA 1YXMA 4V39A 2PJRB 2CLHB 4PYIA 2UXBB 3OT1B 1LXCA 3W9BA 1UJNA 1OCCH 1MJHA 1WLYA 2ID4A 3G2PA 4WOCA 2NNNA 4GVXA 1EVLA 4XXHA 4EHFA 1RTTA 2X40A 1Z9BA 2RONA 2V1DA 4FYJA 3ZHBA 3CF0A 3G71I 3TB6A 2E0IA 1UUFA 2IEDA 1YDEA 2AT1A 1IN7A 2BEVA 1V8OA 1PK8A 3GUVA 3K9BA 5HUJA 2DY0A 3NPMA 1ZINA 3DV0B 4YJHB 1N5MA 1UM9A 5M5YJ 1Y6ZA 2GSDA 4OLJA 4RGQA 3CWCA 3Q3SA 2BGTA 1O7FA 5ADWA 4NK5A 5JANA 2AZXA 1N2BA 2WG2A 2WG1A 3GNTA 2LPMA 4PR3A 1XWIA 1IF1A 4L18B 3L8ZA 2PD6A 4IOLA 1C2TA 2FW0A 3QIVA 4PSVA 3VMFA 4A15A 5J5CA 2Z5UA 3B6IA 5FI0B 4UVCA 1C29B 5F5NA 4ABZA 3TJMA 3DBVO 2QRVB 1V6SA 4ETMA 2NU9B 5EP1A 1VIAA 3B6EA 4H6WA 3I3SR 3DZCA 5KYNA 1Z7GA 4LQ4A 3EVCA 2ZI7A 1XPJA 4PDKA 1U8ZA 2XLBA 1MG0A 3JREA 3O4VA 5LM3A 1U65A 4LYYA 1M72A 4P92A 3SQWA 1UBOS 3IH4A 4XLAA 3H3UA 3T7KA 2JSPA 4YMUA 1G8FA 2X3FA 1YTUA 2DUMA 5HDKA 4H1TA 5HIKA 4WKOA 2WHPA 2UVQA 1EINA 3BMNA 1WVRA 4P7KA 1T9CA 2UZKA 5AJZA 3TW8B 4ZU6X 5HWSA 1EDZA 1PFKA 2PZ8A 2HOEA 1NX6A 3PNPA 1K6YA 2EDCA 1VYUA 2ZRJA 3IR5A 4K9QA 1NR7A 3ZDEA 3OYFA 1OH6A 3PDIA 4U0VA 1GLNA 3WWZA 3NBUA 1OZHA 2ZJPF 2ICAA 4E09A 3Q8LA 3DWLE 3FNFA 2XYHA 4NYMR 4ISCA 5LQJA 3E3LA 4JD5A 3UT6A 5HKAA 2JHFA 4KWIA 5UKDA 4QUJA 2C83A 5LDGA 4E88A 1UK8A 3PXEA 4C14A 1BRMA 5DGTA 3W2VA 4B80A 2JC3A 2QL7A 3I73A 3S32A 2OCEA 4X1EA 5LQSA 4Q24A 3ZQCA 1BE8A 3V1YA 2BVMA 4MHGA 2HA7A 1QHGA 5GM1A 3VR4D 2QLNA 4KT5C 3HJAA 1ZY2A 4NONA 4AL4A 4IMIB 4KR9A 4RA9A 4NAHA 4MWEA 5EQFA 1YQAA 3M82A 2MC4A 2FEZA 1OMOA 2PX6A 1C0IA 1E3HA 3GLHE 5LU9A 4X63A 2QRJA 3PF9A 1Y6FA 4AD8A 1C0KA 3Q72A 3RHTA 1TLFA 3TO6A 3G89A 4BEWA 3IE1A 2IS6A 4M3NA 2PMKA 5IKXA 2VR1A 1LGYA 5A0FA 5AW6A 1BOBA 4J43A 1OXKB 3DAYA 4B3CA 5KKNB 1P31A 4AJ4A 1FDOA 3TDZC 2FX0A 1RXYA 2VDRB 3AJ8A 1E62A 2BFCA 1RZ3A 1EAYA 4H6XA 3GP5A 2BFBA 1HDXA 3NO4A 2G70A 2B0LA 3VPBA 4IHTA 1JEQB 3ZBUA 4DXDA 1K0FA 1ZG5A 3COAC 4LXYA 4ERXA 4PPQA 4N03A 1TADA 4CMAA 3PX7A 3PQ8A 2BFFB 2J4FA 2OEPA 2F5VA 4MH0R 3EBOA 3ZQ4A 3HRSA 2W5UA 2VBFA 3FKSD 1R50A 4TLMB 4RVHA 4HNHA 2F62A 2RGNA 1JJIA 3HP1A 2R92J 2AZDA 1QJ4A 3OCJA 3QITA 1M2WA 1T8PA 3HCPA 4L50A 4QPNA 3RI4A 3Q0VA 3TZQA 4TMVA 4ZEVA 4AW9A 3QOPA 1TB4A 4LNUA 1HETA 5CLIA 5HS8A 3EG5A 2D74A 5DM2A 1SKQA 3JYLA 4XSZF 4C08A 1G8AA 4G1MB 3RPQA 3SDZA 3T5MA 2WM8A 5LLQA 2ZS7A 1SD2A 1K7AA 4MITA 1ZICA 1C4XA 4C4OA 1Y8AA 1JZTA 2GEDA 3HXMA 4HYQA 2KZGA 3Q8XB 1CP3A 3LSYA 2DHEA 4JQOA 3EIQA 1EZ1A 4RZIA 2IOYA 1RMTA 2UAGA 4FMDB 1IAQA 1CUYA 2ECKA 3A6DA 1YRNA 3WK9A 4PGHA 2ZJ5A 2NVXJ 3A06A 4OHXA 4EY7A 2NZWA 4HLQB 1V4NA 3L2RA 1GUZA 2R6HA 3WL6A 2PWBA 3SXPA 1VGQA 3LK6A 1NQOA 1FF9A 1KKUA 1PD1A 2PKQP 2PFSA 2L7FP 5EEGA 5KYXB 4OINF 4MRMB 4RKFA 1EX1A 3QX3A 4PQYA 1F2VA 4QBIA 1JG6A 3V1NA 4M1YA 4NQRA 4Y1GA 3W4KA 4S1PA 2XOKD 1ZMBA 3RF6A 3E82A 3N2GB 1B76A 3DVQX 4H4CA 6PFKA 3O75A 1I3LA 3G3EA 1WJBA 3WK6A 4G56A 5CCDA 3D6FA 2OV1A 3BRWA 2GPYA 3GLKA 4MJ7A 3W5SA 4DCVA 4RU1A 3UJNA 3GVIA 1SEPA 4J76A 3ICQB 1WSDA 5LXTB 2WE8A 1M67A 4ZCQA 9MHTA 3Q2KA 2R5YA 2RG7A 5FOQA 3DEWA 1MTOA 4N65A 3OQVA 1R66A 3E9DA 1H5QA 3HMQA 2JLBA 4Z6KA 1JLSA 3HADA 2I8AA 4Q05A 4BLVA 3OQHA 1E6KA 4YO7A 2G25A 2FPIB 1KYIA 3OLCX 4HD8A 4X5OA 4OIOF 1QXSA 2C3YA 1QK4A 4U39A 2W71A 1FRZA 1ZAOA 4JX8A 1SQSA 3FWNA 3L7OA 3WWCA 3P2EA 1A9TA 4LHSA 1YASA 1YZGA 4IHQA 2IY9A 1J99A 4URHA 2H1OA 4NP6A 3B60A 2ADUA 1T8YA 4NNPA 3CR8A 3ZIUA 5E8JA 5HRAA 3OBIA 4FMCB 3G2BA 4HZUA 3BPVA 3EDCA 1U6IA 1W5CC 4MS1B 1U7UA 1KAEA 3WSWA 2YJ6A 5JT1A 1O3YA 1L5GB 4RLQA 1IJFA 2KPOA 2NNLD 3KPVA 2BGJA 4F5YA 3RYCA 2I1VB 1NURA 3HFSA 4KXUA 4Z0TA 2Y9ZA 2Q27A 4HXFB 4IVRA 4DUGD 4IDGA 2MYTA 4HUJA 2CYYA 2L69A 3U5ZB 1U2TA 3GWGA 1AG9A 3N5CA 2O7OA 4G1BA 4R2IA 1DL5A 1GHCA 1E99A 1XMIA 4B35A 3FVQA 2XH8A 4ZYGA 5D4RA 3P9PA 3S2GA 2AUTA 2H4YA 2XXJA 1K8ZB 4YASA 3KYCB 1P1BA 4DLLA 5U4QA 3DFGA 4TKZA 1HH4A 5IJ9A 3KPJA 1DC7A 4YUAA 1AKTA 1T2EA 1SCAA 1NF8A 3KLOA 1M0WA 3M3HA 2I22A 3HN2A 4RJTA 3HK2A 3ZNOA 2JLZA 1HFJA 1GUYA 1NBAA 1M66A 1Z15A 1ZI9A 2P3LA 1FNNA 5DMHA 3R0XA 3V1LA 4PQFA 4YYEA 3KKLA 3T5PA 2C04A 4LXHA 2J9ZB 4LG1A 4A3GJ 1RMYA 1RBMA 1R10A 1DC3A 3BREA 4JJ6A 4MUHA 4N12A 1SOAA 1B73A 3NWJA 1MT3A 5E9QA 1WKMA 3HTSB 1GV0A 1AKEA 3DDNA 3FZYA 1BCRA 3FTDA 4URUR 2HZTA 2PH1A 4HVAA 2WV9A 2J3KA 1VLQA 1JT2A 3OHMA 4DCUA 3HY4A 2STWA 1Y0UA 1WVMA 5COAA 5AR1A 1W29A 3EOBI 2DQLA 2AEJA 5CJJA 4YRMA 4XR9A 2MBFA 1QYVA 5EJIA 3K3PA 3L8MA 4AQDA 4KWCA 4YQZA 2A3SA 3JW4A 5LEKA 1C8VB 3OYIA 4QSHA 3AR5A 4XWOA 4DM7A 4Y15A 4I1OA 4E7IA 2IXDA 1XSXA 1PDWA 2F6CA 1EM6A 4P98A 1QGYA 4HDVA 4QUBA 1ESCA 3SQOA 4S1TA 4AX8A 4YPVA 5F1OA 5JSQA 3DXJF 4YJDA 1XRNA 2ZATA 2FKAA 4XA8A 2QX8A 1PBTA 3G0HA 4EIWA 3KZXA 4IF4A 1JUSA 3CE6A 5FNVB 2JLRA 1V1RA 2H94A 4PCQA 3DE4X 1MW7A 4RTNA 2HK6A 3RUAA 2REQB 3KPWA 1H2EA 3TJZA 2ZSUA 1FFSA 3RC2A 3H5LA 4JUFA 4K9LA 2V7GA 5HIIA 3E58A 1BW6A 3DV2A 2Q3EA 5DHPA 3UR3C 2H63A 3ZK8A 3VH1A 2JFGA 5AI5A 2FUG6 2FEPA 4KIBA 1CZUA 2OOSA 1GNTA 2VNHA 3BQNB 2BEKA 3UA4A 1MXFA 4CMKA 4U00A 1GPJA 1XLWA 4IJQA 1TQ6A 2BZTA 1ML4A 5BSUA 2H1RA 4CTNA 2CZCA 1PQUA 3HBNA 4MVJF 3U4HA 4K2HA 3MPOA 2B92A 3BWMA 1QIJA 3L0YA 4E5KA 2YC4C 1K89A 4UDXX 5D1HA 3PVZA 4QM7A 2ZSKA 5L3SA 3GCDA 1E2GA 4IWYA 3V9AA 2ADMA 1ZBQA 2OGWA 1QO0D 3QKSB 5DBEX 4K88A 3GR6A 5HLGA 2E4VA 2D54A 4OYLA 4UULA 1KEVA 1SKUA 1WPGA 1G8SA 3B2EA 2IQ5A 2Q41A 1ZITA 1WDMA 1SBQA 1L7NA 1NNUA 1P4SA 3JXEA 4J2OA 4E08A 1DIGA 1G3RA 1UKVY 5F3WB 3ZDDA 1VMEA 3V7WA 3V80A 1B00A 4IIYA 4ZCSA 3UUWA 1VE3A 1E63A 2IYWA 3AHDA 1DV2A 4ZU1X 5KINB 3LUGA 4UNQA 3LPCA 1MMG