4EMSA

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
368
structure length
358
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 127
structure length 358
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4emsA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4emsA02
3QP5A 1U2WA 2JPCA 1JHFA 4ZTBA 1O57A 2BYVE 4A0ZA 2JJQA 3P9CA 3CDHA 1REPC 4JQFA 1J5YA 3HVJA 2EK5A 4LK0F 3HSFA 4S04A 5EZQA 3H2BA 2HS5A 3HOSA 3DULA 4ZZDA 4BHBA 4BH9A 2VC1A 4Y15A 3SVZA 4OX9Y 4IKPA 1DP7P 1RZ4A 3T5XA 1IN5A 3EDPA 2FNAA 3K1MA 2K4JA 3Q7EA 1MJBA 2CL5A 2P3OA 4Z2YA 5HIMA 3LQRA 4Y13A 3UJBA 3GX4X 1AQJA 2Q0OA 3PB3A 2P7CB 1R7JA 2ZSUA 4M73A 5K8VA 2VE8A 1K78A 3OFKA 5DRYA 3P7NA 1FP2A 1LB2A 2ESRA 1BI3A 4Q47A 5D1NA 3TQSA 2RV8A 3T8RA 5IT9K 5K5QA 1P2FA 4AZTA 2VT3A 1AF7A 2AN3A 4H0NA 4L5IA 2PMUA 1VPTA 5BW4A 1P6RA 1PP7U 1G55A 3F3XA 2HR1A 2VDWA 3LA3A 2GQQA 2CQKA 4ENKA 3MQ2A 4QDJA 3JTHA 3A25A 3HA5A 3CJQA 3KP5A 5LGNA 2YUIA 1MZBA 2LF8A 3DXJF 3L7WA 2XYRA 1XMAA 4GOMD 1XGOA 4YV0A 4YG2F 1BOAA 3ZPLA 2GWRA 4DCMA 3H3ZA 10MHA 1ZQ9A 3LCCA 1U3EM 5FQNA 3M6WA 2DFIA 5E1XA 1V3FA 2B78A 3KE2A 3I59B 5FLXK 5HLGA 2XVMA 3P9IA 1TNTA 3DR5A 1BC8C 3RODA 3BROA 3G3ZA 3C18A 4N0BA 4KRGA 5GM2A 1W5TA 3C3WA 4OMZA 3TGNA 3NMUF 2Z33A 3FTCA 4MHGA 2BV6A 3CC8A 1YO5C 1FBQA 3LAJA 2P3LA 3F72A 5EMLA 1SG9A 3HSRA 5E1ZB 4OU0A 1XSVA 3C3YA 5E1MA 1ZGJA 5GP1A 3LDGA 2W57A 3GWZA 5J8CA 1WKMA 1L3CA 1KQ0A 5LGUA 4LLNA 2ZIEA 4WX9A 2NXEA 3VOEA 3FZGA 2V6CA 3FUWA 5FWAA 3RI4A 3W6KB 2YXLA 1SUIA 2DO7A 3A26A 4G9YA 1BJAA 2KIMA 5EIFA 3JWHA 3BWMA 1HKTA 1X3UA 3JWGA 3PFIA 1YF3A 1INLA 3KPVA 3K69A 4PNEA 2NP6A 2RDPA 1TBXA 4ER3A 3LSTA 3LBFA 3HRTA 2ACJA 3NJRA 1G4DA 5E2BA 2YX1A 3MTEA 5FFXA 5ICCA 5IKMA 4MQ9F 1LDDA 5DCMA 2BH2A 3BP8A 5HILA 1SFXA 1DL5A 1TW2A 3HP7A 5JHUA 5DT2A 3TLJA 5LRSA 2PXAA 3SMQA 4G8XA 4HOBA 3FF5A 1SMTA 1W4MA 4YV1A 3KZZA 4Y30A 5FWDA 5ED4A 1P1BA 4EGYA 3K1PA 1RIOH 4EKIA 1NHAA 3IC7A 1DCTA 4ZYEA 3B02A 4EM1A 1AOYA 3IRRA 1ORIA 5LBQA 3DF8A 2G71A 5H02A 5DRTA 3DLCA 1ORHA 2VBYA 5K0JA 1Z1DA 2Z6AA 2FHPA 3J7AO 2QWWA 3R61A 2YXDA 4PIPA 1VL5A 5CCXA 3FYCA 2ZXJA 1O54A 5HDNA 3OFJA 1ON2A 4M36A 7MHTA 4LLGF 3P97A 2VDUE 4HRAA 2C7OA 1YS6A 2O0LA 4YUYA 4ESFA 3BPVA 5JVTA 1I1NA 2QVOA 4Q5SF 3DV8A 3KPYA 2H09A 3GO4A 4QQKA 1QAMA 3G8AA 1JGSA 3EVDA 2HDCA 3WTTC 2GLUA 4F85A 4OIRF 1ZHFA 2JPBA 2IP2A 5KVRA 4E33A 3EQLF 2QM3A 3HOTA 3E5QA 1Z05A 4ZYHA 4AX8A 1HSJA 3E97A 2GPYA 3OE5A 1Z3CA 1YZHA 4K2EA 1X1BA 1RJFA 1HKSA 2Y0MA 2PX2A 4HX7A 4LLLA 2VXZA 4OBWA 5HIJA 1G6NA 3KCCA 1R6AA 3HCEA 4L9VA 4GOLD 3FX3A 3V8KA 2XIGA 4R6XA 3RIEA 3BJOA 3OCJA 2GIVA 1O3TA 3CJNA 2JHCA 3F4KA 1B59A 4CICA 3AY0A 4LECA 2V1DA 1S29A 2GAUA 2ZBKA 5DEQA 3DMFA 4LB5A 4C08A 1KU3A 1JQ3A 4E2ZA 3GLXA 2P8TA 5DCMB 3WTUC 3K6RA 4I01A 4EV0A 4NECA 3GGDA 1CF7B 4RTLA 3TR6A 2P7VB 1WZNA 4E31A 1VP9A 2B0LA 2JG3A 4UVAA 1FY7A 3GFIA 2K27A 2H27A 3WU0A 4EVIA 4M74A 2BE5F 2FEZA 4ENJA 4P5OA 2L02A 3M70A 5HDGA 1NV9A 3L2CA 1FT9A 3ZMZA 2XAFA 3C7JA 4RV9A 1UIRA 3LDFA 2G70A 3FPFA 1I9GA 5FFZA 4L0ZB 1Q0TA 3BWGA 2D45A 2P5KA 4YUZA 2PBIA 4GXOA 3EVCA 3HCBA 1NE2A 1F1ZA 3CJTA 4ISCA 3KZYA 4FX4A 3HCFA 1J59A 2PG4A 2W84A 1ZYRF 2JZYA 5DCFA 2VE9A 2NNYA 1P4AA 2NXCA 3LX6A 2VDVE 4RVFA 4L7VA 1IN6A 3LWFA 1IRFA 3C6KA 5DXAA 3UA3A 1JSZA 1DDNA 1ZG3A 5H20A 1YIOA 3MEXA 3ZN1A 2Y1XA 2PWPA 1ZH5A 3G2QA 4Y2HA 2OA4A 3CUQC 2PV0A 2EV0A 3KP7A 3S2WA 1NT2A 1VLMA 4IVNA 1FX7A 3WSTA 3IWZA 4YUXA 3LECA 1FWZA 1KXZA 4HW0A 4E30A 3BGIA 4IWNA 2MBFA 2OKCA 5FHQA 2G72A 3NQOA 1R36A 3PFGA 2AS5F 2HNKA 4NHJA 2AVDA 2H00A 2YVLA 4RS8A 2B3TA 3DXYA 4FGZA 1R1TA 4CHUA 3LCVB 3F8NA 3MWMA 2NNWB 5HS7A 5JR3A 3FTEA 4LJZF 4LFUA 3HVHA 5T64A 4KIBA 2IVMA 2Q2EA 3ULQB 2PKWA 2VT2A 2PFBA 2XASA 2OZVA 4FS8A 4QTUB 5D4RA 2FBKA 1L1EA 2IT0A 3HVIA 3F6VA 3V97A 4HV6A 3LKZA 2HQRA 2AZTA 2A3SA 3BGVA 3G8BA 2W85A 4HG2A 2AOTA 1DPRA 4YMHA 3JW4A 2A68F 3LCUA 1AV6A 2DAOA 1GHCA 3B89A 3AJDA 3RYPA 3R60A 5K05A 1BIAA 5DPMA 4BXUA 3WTWC 3SQNA 2EFJA 5DD8A 5D5WB 3ZMSA 4U7DA 3GVAA 1SD7A 2HMYB 4KT5C 2KJBA 2K4MA 5ILVA 4HLYA 1OYWA 4ENNA 4KVZA 4RTOA 2RC4A 5T6BA 2O8XA 2FU4A 1MDMA 4AZSA 5D5XB 1VQ1A 4CKCA 2NYXA 3C0KA 4GQBA 3M1EA 1RJDA 1K79A 1R1UA 3E3VA 2ESHA 3B7PA 4LWOA 4YFKF 1ULYA 2ZWVA 3MB5A 5EEGA 4G7ZF 1NV8A 5KYGA 5E18F 3I58A 4FT8A 2ZBPA 4FR0A 1K6OA 2GS9A 3D2LA 1P39A 5D8LB 4YV2A 1XCLA 5EPEA 2PEXA 4RTPA 1UHMA 2XYVA 2GAFA 4WVLA 3LDUA 4L9NA 3BOQA 4WXDA 4EMSA 3KEQA 1KP9A 3T0IA 5EZSA 4DQ0A 2OB2A 3FTDA 2LDUA 2AN5A 3FUVA 3ZMUA 2M87A 1PJZA 1T6SA 1UFKA 3DTNA 4MQVA 3TDZC 3C6MA 2JH8A 3SM3A 3GU3A 5K09A 4EQZA 3LL7A 3OE4A 4P7GA 4EK9A 4ZH4F 1P4WA 3VB2A 2KW5A 1KHHA 2M1BA 1H9GA 3R0QA 3K1NA 4FP9A 3LAPA 1FZPB 1KPIA 3B3JA 5DUIA 1NBIA 5LEKA 4B8XA 5FA5A 4R8SA 3ERED 2LKPA 3UJ8A 3F8CA 3GRZA 3E6MA 5FA8A 3HEMA 3RPUA 1NKVA 4RTJA 1ZARA 1ZN2A 3E5UA 2AOXA 3GCZA 4CDGA 2HQNA 2ORED 3M8FA 4OIOF 3EUHA 1WXXA 3CO7C 3E6CC 1KGSA 2JRTA 1MJFA 1TQMA 3OU7A 3MFKA 1NW7A 3HA7A 3F8BA 2I6GA 2UYQA 1KIAA 2HYFA 1JE8A 1N7JA 2KRFA 4RAZA 5FHRA 3ELYA 2UZKA 1YW7A 1S6LA 1G3SA 4LD5A 2FF4A 5D8KB 5L3BA 5FLXZ 2PX8A 4L18B 3ID6C 5CYVA 1PRYA 3V8VA 1OR7A 5LQNA 1JG2A 2ZNZA 1EIZA 5U4XA 5DXJA 4R8HA 5DM2A 4ESJA 4DKJA 2DTRA 3FM3A 5HIIA 4FHTA 5EKUA 4B17A 2M30A 3TOAA 2FNPA 4YIFA 4WWCA 3P2KA 3A4TA 3UFBA 3R3HA 2ADUA 5CVRA 4UV8A 4ASNA 2QBYA 5BW5A 3COAC 3ZMDA 1L0OC 4WXHA 1T38A 3Q9VA 3CGGA 4PCQA 1R1VA 1I27A 4PYQA 4MHTA 1XDZA 1ZRDA 4N9HA 2D2WA 3BWYA 2HR3A 4AZWA 1ZREA 5ILSA 3IHTA 3DEUA 3QV2A 4KWCA 3I5UA 2ZJ2A 5ICGA 3I64A 3Q9SA 2HFHA 3NTVA 4HF0A 2F2EA 4KNYA 2V1UA 4GC5A 5F1RA 2BM8A 1RI5A 2VBZA 4HBLA 1FJXA 2DU9A 5DX8A 5D1HA 2QRVA 1G3YA 2DK8A 1UHWA 5L3CA 2L4AA 2QBYB 1FYLA 2QQ9A 3E5XA 4PCLA 4C03A 1SAXA 2RNJA 3NEUA 4U0YA 5EIWA 2XUBA 4GUAA 1WG8A 1W7PD 2YTZA 5F2OA 1SD5A 2KIFA 3GZ5A 3ZMVA 3SZPA 4WCGA 4CKBA 4ETSA 4PZJA 3JSOA 1V4RA 5E8GA 1I1SA 3THRA 4Q48A 4PINA 5FTWA 2HWVA 4UVCA 2FPOA 1BM9A 1UB9A 1IXKA 1HW2A 2FK8A 4RVGA 2XRNA 4RGXA 4XLNF 2Z6UA 2CYYA 5CVIA 4PIMA 3KHKA 2YX4A 1J7KA 2ZCJA 4F84A 3ELKA 2BEOA 3R4KA 2XBMA 2EV6A 3SHFA 2ELHA 2VC0A 2NS0A 4U88A 2IBTA 5DM4A 4E32A 5EC8A 1R18A 3GRVA 2MD5A 4LG0B 1RI4A 2XAHA 3ELDA 2MC3A 5A2QK 2L4MA 3RKYA 3U2RA 4UNOA 3ABUA 3GO5A 2CG4A 2JT1A 5BQTA 4RTNA 4JXJA 5K0BA 3UZUA 1USTA 3X0DA 2ZO4A 3P2EA 1B1BA 2ZLBA 2TDXA 4KDRA 5KQSA 4IHSA 1CGPA 4HDUA 3CUQB 4XLPF 2RN7A 4GGGA 1QNTA 1G60A 1TQPA 3GFLA 2AOVA 2O6GE 3G2PA 4CKEA 4I98B 1M0EA 3L9FA 2P5LC 1JXSA 3K2ZA 2ZULA 2AOWA 5EHIA 3AXSA 5AIQA 1FBNA 2PVCA 1XGMA 3PT9A 1BC5A 2N47A 2EJUA 3HIFA 1YFLA 2Z6QA 3M6VA 1MGTA 4IPAA 4UVBA 2AOTB 1U2ZA 3ERCA 1NW5A 4MGRA 5D4SA 3R0JA 2YX7A 3NVMB 5DX1A 2ETHA 2F5EA 1HW5A 2I9KA 2GA2A 4I0AA 5K0CA 4M6XA 3CUOA 1ZLJA 3QP6A 3HNRA 3GXOA 4YFXF 2K02A 4RWZA 3M7GA 5LQJA 3FXRA 4XBFA 4BY9E 2W25A 4O3MA 4EM0B 4GCVA 3GRYA 4M9XA 2I7CA 5GM1A 3TOBA 5TRDA 3PFHA 1XMKA 1Z6TA 4BHPA 3HRMA 3UJ9A 1JQDA 2VODA 1M6EX 5K03A 3FUUA 2P7HA 3JWIA 3ECOA 3M4XA 5FCDA 2XKPA 3MGGA 4AWXB 2XAGA 3BPXA 2ONYA 1WRJA 1W7PA 3WU1B 4ZYGA 4AIHA 3WODF 3WTYC 3EVGA 1R5GA 4HX8A 5ICEA 2ZFWA 2CSOA 1RJEA 5HIKA 2P1DA 2PGXA 4MQ4A 2H94A 5DM0A 5EOVA 2DULA 2Z5UA 4EGZA 3MERA 2YXEA 4LWPA 1RI3A 1JG4A 2RQPA 4O29A 3FZVA 5LLQA 4X63A 5HZMA 5CIYA 5DX0A 3E23A 3WTVC 2YR2A 1W7PB 1EH8A 4MEXF 1T2KA 2DI3A 3P8ZA 2M5WA 5LEJA 1USSA 1LDKB 3KLNA 2F8LA 4QTTB 1HSTA 4U7PB 1Y8CA 3G2OA 2B25A 2DW4A 4PYKA 2RKHA 1O3RA 2V1XA 2UZ4A 1BI2A 2HTSA 3OV8A 5K0GA 4G6DA 1NW8A 2P35A 3OU6A 3FUXA 3G5LA 3SSMA 1QGPA 2ESNA 4A0YA 1J9IA 4I7HA 3BGDA 2NRAC 4XRFA 1I5ZA 3FTFA 3B73A 1YLFA 5D5UB 4G56A 3A7EA 4C04A 2D1HA 1IF1A 3IKVA 4CTJA 1E2XA 2EFOA 1B9MA 2GA1A 4IRGA 3DQVC 5BS6A 1L3IA 2AN4A 5E9JA 5E17F 2JH9A 3BJ6A 3QU6A 2DQRA 2GXGA 1FNNA 2IA1A 3KLOA 3DXZA 2H6BA 2PWYA 3O31A 4HGZA 2G7HA 5KQRA 3TFWA 1QBJA 2OBFA 5LQCA 4EJTA 1L3BA 2A6EF 3LKDA 1KQ8A 2MH9A 2MH2A 4R6WA 2E1NA 3TPZA 3V8JA 4WF2A 3EETA 3TKAA 4MTLA 5GOZA 3HCDA 3JAMK 3E6DA 5IT3A 3LA2A 1IM8A 1FPQA 3D5LA 4I02A 1U78A 5D5VB 3KR0A 2ZIGA 3M6UA 4RX1A 2ZCWA 2PI0A 3G7UA 3HA3A 2CW0F 1VIDA 4GBED 3GUDA 4PGHA 5F64A 2D1VA 1M6YA 4QWQA 3TOSA 4PGGA 5GIOE 4ER6A 3RJPA 1IRGA 2OO3A 3KQQA 1R23A 4YIIA 2F5CA 4C06A 1HNNA 5L3EA 1KU9A 2O06A 3NDIA 4A6EA 3R0AA 4BHCA 2VS1A 3G5TA 1F4KA 5D6FA 2IA0A 3HCCA 4GC9A 2C7QA 4L0YB 2CO5A 2FBIA 4RB3C 2G8NA 3EEYA 5CM2Z 3EPPA 5AIPA 3WE3A 5EMJA 2RVCA 2W24A 1Z7UA 5DV5A 3IV6A 3Q5FA 3P2IA 1JR4A 2F5DA 1RI1A 1EV7A 3I71A 3TO9A 4CGZA 4RTRA 5E1WA 5GINE 3HSEA 1D3YA 4EJUA 3V7SA 1FSEA 3KKZA 5BOXA 4FT2A 3FHZA 5GIPE 2CGPA 2IPQX 2VBWA 1ZG5A 3JWJA 3T7SA 1RUNA 1TW3A 3BXOA 3QPHA 3I53A 2IH5A 5K0EA 2IPXA 2FE3A 1FSHA 2GA9A 3ZP5A 4KDPA 3E8SA 1JTEA 4GEKA 4DMGA 2FA5A 1N7IA 2J5OA 3ER9A 3KP3A 5DTRA 3SXYA 4OIPF 5LQRA 4KMUX 1IAWA 3GDHA 4L9JA 4BLUA 1ZKDA 2LNBA 2CMGA 3VODA 3O6BB 1P91A 3W6JB 5JI6A 3MZYA 2QQAA 3VC1A 2ZZKA 1SVUA 3PX2A 5K5RA 4A6DA 3TRKA 4DF3A 3V7RA 2EFPA 3F21A 2E5WA 1FOKA 1S7AA 4CXMA 3WTXC 4BP3A 3U9GA 2FRHA 2FOKA 4MTDA 2PLWA 2VOOA 2LF7A 1ODDA 4FZVA 4KFCA 5HFJA 3FM5A 1WI9A 2NP7A 3BDDA 1G8AA 4MWZA 1O9GA 4KA4A 2G7UA 3KP4A 4GYIA 1CF7A 3G88A 1UFMA 2PY6A 5HLIA 1C0WA 1OMIA 2P8JA 3K0LA 3V4GA 3FUTA 2IFTA 5DM1A 2AOUB 5EMMA 2P40A 2M45A 1NW3A 1ONVA 2P4WA 3U81A 3WTZA 3IL2A 3NW9A 2XAJA 3LFKA 1RUOA 4YUVA 2GXBA 3ZN0A 3MAJA 3PX3A 4AIKA 2CWEA 1T0FA 3KEOA 2PJPA 5CVDA 1QPMA 3C1DA 5FB2A 3DXXA 1K78B 4KIGA 4O5VA 2XVAA 2K86A 3KQSA 4MIKA 4R05A 5MHTA 2EFQA 4KYWA 2PT9A 1IN7A 1EQAA 4IF4A 1OR8A 3NRVA 1XSDA 2GH1A 4EJWA 3FPEA 3DLIA 3L00A 4POOA 3ISPA 3L8DA 3AAFA 1XTPA 3J81Z 4ATNA 1EAMA 3QOWA 1XCJA 1J2XA 5EGSA 3MZHA 3GJYA 3HHGA 3FRHA 3OPNA 1D5VA 3RTRA 4CWAA 4R8RA 2PJDA 4NQWA 1R8YA 3EGEA 3WG9A 3TMAA 2VONA 2NYUA 3ABTA 3TO7A 3ME5A 3WGIA 4CXFA 2NAZA 2YU3A 2ZZMA 3NWEA 1PP8F 1BOOA 2XKOA 1IY9A 2P7IA 5LQUA 3QOXA 4FT4A 5K01A 3VSEA 3KPUA 1G3WA 4QLCU 2CWWA 3QOPA 3GIWA 1SMYF 4ON0A 5DWQA 1R8XA 2DQLA 3GRRA 4MTEA 4A12A 1Q1HA 1L3LA 3BWCA 3I9FA 2C7PA 4PDKA 3ELUA 4CYDA 2EWNA 1XVAA 2HV9A 4P96A 4KW7A 1QZYA 1LVAA 4E2XA 4R1HA 4ER7A 3SFZA 4OA5A 4QVGA 1MD0A 5F2NA 2HOEA 3SXJA 1ZGAA 3F23A 2MA3A 1UCRA 1AWCA 2V74B 2YR0A 2V9VA 2OYRA 5LSAA 5HDKA 3HTUA 3EVAA 3HCAA 1T98A 3H92A 3JAMZ 1XXLA 1G38A 2ZWAA 2EJRA 2HKOA 2OU2A 4YUWA 3Q87B 5LQKA 1QAOA 2VN2A 4NB5A 3PTAA 1OKRA 2A69F 4N9IA 3SSNA 2EFNA 3M9AA 1W5SA 1WWXA 1HMYA 2XV4S 4C05A 1MKMA 1V39A 4HYEA 5EEHA 3ZMTA 1D8KA 2AR0A 3O7WA 1DUXC 3K0BA 3HTXA 3IKTA 1IZ1A 3I54A 4M9SA 2HGCA 2X0LA 4HZFA 1OPCA 3U1DA 3DPTA 4AUKA 4TV7A 2STWA 2EA2A 1H9TA 2O61A 3HHHA 4GOOD 4F86A 3T7RA 5E1BA 3ELWA 5J8FA 1BN5A 2HYGD 4U7BA 2AOUA 4XUDA 1T43A 1U5TA 2O07A 2UYHA 3FPHA 1YZ3A 5HOQA 3PVCA 3I4PA 3G89A 4OQEA 5LHGA 3ML6A 3PLAE 1JQEA 4KN7X 3IRQA 3B5IA 1LNWA 4L9TA 1P1CA 1WXWA 5DD4A 4PWYA 3F8FA 3NDJA 3JTGA 4PYIA 4LG1A 2ISZA 2C7RA 1RJGA 5E1OA 3HVKA 3EVFA 3FXQA 4AVPA 4P7FA 2J5PA 4M38A 4LMYA 2ZKZA 2IJLA 5E8IA 1AQIA 1B6AA 2IW5A 3I0TA 3KR2A 3EEOA 2EB7A 2FMLA 2GZWA 2PX5A 2H6CA 3LHDA 3BT7A 3B3FA 3V7CA 5E1DA 4ER5A 1Z6RA 1ZLKA 3FPJA 1J75A 3DKWA 2WA1A 3FPGA 1D2CA 2KKOA 3FXUA 2A14A 3T1BA 1QQIA 3BZBA 3KQMA 1QAQA 3O4FA 4HF2A 1RI7A 3CCFA 5IT9Z 4I2OA 4BAYA 2PLYA 8MHTA 3L09A 1BI1A 1OYYA 3IEIA 4M6YA 4O6JA 5HS9A 1F5TA 3OU2A 2VOPA 3BUSA 3VYWA 1WY7A 5FD6A 3CBGA 1Z91A 5C0OE 1O3QA 1KYWA 2YSRA 4ENMA 2BZGA 4K6MA 3E6BA 4HA8A 1JHHA 5K5OA 1U8RA 2QENA 4UHTA 1SUSA 3ECHA 4Y17A 5IH3A 2FYTA 3T7TA 1XGNA 1XJ5A 2WK1A 2FXAA 1XGSA 3UBTA 5G02A 1QANA 1QYRA 2EJTA 4V0QA 1TQIA 1SQFA 2DT5A 1YUBA 4ZYDA 4IV0A 2CFXA 1VP3A 3B3GA 5LR6A 1YS7A 2CKDA 3UWPA 4EJOA 2E7WA 1EH6A 5TJJA 3GZ6A 1D2GA 1LDJA 4KUMA 4M71A 3P9KA 3GYHX 3G73A 2FRXA 2OZUA 1JSXA 3MHTA 4V0RA 2A6HF 1HXDA 5A2QZ 3RW9A 3BZ6A 1U5TB 2O57A 5L3FA 4JK1X 3BWBA 2ZIFA 5K0NA 3ZQ7A 1O7FA 4QQNA 5KS2A 4OQDA 6PAXA 1G6Q1 5ICFA 3THSA 1QO0D 3R24A 3P71T 2XAQA 3HYIA 2A61A 2WTEA 1SFEA 3M8EA 1H1DA 5LGTA 2EX4A 2ZTHA 5FGMA 4CTKA 3IYLW 5HLHA 4QDKA 3EYIA 1TPYA 1EG2A 3HRUA 3GFMA 5D6EA 4ZZLA 5DTQA 3UJ7A 2IDJA 1FC3A 2Z9OA 2ZNYA 4PYOA 1RNLA 1XD7A 3EVZA 1I4WA 2XVCA 2WC2A 3WE2A 2JTVA 1F38A 2OXTA 4BLVA 1U5TC 4DQ2A 4IRIA 1SFUA 2X4HA 4OIQF 4OA8A 2WV0A 4EKGA 2XYQA 2WA2A 2EA4A 3T8TA 1LEBA 4HQMA 5FD5A 1PUEE 2PXXA 2Y48A 3GRUA 2HTJA 1ZRCA 3AXTA 3A7DA 4GYGA 4PCAA 4KIFA 3QPTA 3KP6A 2ZW9A 5J6XA 1YW8A 5E20A 1XDSA 4QVKA 2FCAA 4DZRA 4MEYF 2P6TA 2PT6A 3H3UA 2HKXA 4QPNA 1D8JA 4G7OF 2NXJA 4X41A 1IN4A 2V79A 2FMYA 2ZBQA 2BR5A 4E2YA 2O03A 2R7FA 1R5HA 2QY6A 2UYOA 4RTSA 4P58A 1MJAA 2RGVA 3CJRA 3O3KA 3OZTA 3AWIA 5DDGA 1TLHB 2YQZA 2LSOA 1OYIA 2M8EA 3E7PA 3IHUA 2VP3A 5JUWA 4X1OA 3MCZA 5FQOA 1KR5A 4RGUA 2VBXA 4HH4A 3VC2A 1D2HA 4IRHA 2Y1WA 4KN4X 5L3DA 2QRVB 4FSDA 3SSOA 2QUFA 2XGXA 4RTKA 3PQKA 3EGIA 1IN8A 1XSXA 3UJ6A 3CUQA 4I0BA 4RGRA 4P7JA 5CD1A 2QQBA 4HSGA 2QYOA 1MDMB 1O7LA 3F8MA 4M9ZA 4HGYA 2JSCA 3LGAA 5KVAA 4XCXA 3E05A 5CVJA 2ZBRA 1STZA 2UYCA 2L3DA 2R7DA 2ZVJA 3I59A 3KPWA 3LA7A 2IH2A 2E1CA 4KDCA 1KPGA 3GF2A 4RB1A 2CMHA 2OQRA 1FBUA 4GOND 2IIPA 2HTEA 2QE6A 2O05A 1FBSA 4IXAA 1SD4A 4UOEA 4M37A 2DBBA 3R6TA 1IXCA 1PDNC 4OBXA 4F7ZA 2OAZA 3CVOA 2EV5A 2OY0A 2L01A 3PS9A 5C1IA 4P9FA 1HBXG 4UV9A 4A5NA 2PSSA 4Q4ZF 3HTSB 3DPLC 3T0YA 1K7AA 4PYNA 3J80Z 1P92A 3RKXA 1VTNC 1EJ6A 1FLIA 2A07F 1DUSA 3K9TA 4FX0A 4P9UA 3SGLA 1ZG1A 1YFHA 1XB4A 3R6SA 1BI0A 5EMKA 5HS8A 3SR4A 1KPHA 2G1PA 3QAHA 1O3SA 3FMRA 2P3QA 5EG5A 1SKMA 2H11A 4WXCA 3RYRA 5DLYA 1GVJA 1P4XA 2P6SA 2ISYA 4RSRA 5E8JA 1U6GA 2K4BA 4G7HF 5C9ZA 2WWYA 2PMHA 3KQWA 2IGTA 2QLZA 2JHAA 3GFJA 4IV8A 1YG2A 2BGCA 4RTMA 4DCGA 4RB0A 3SX0A 5CVVA 2AS0A 3F6OA 2FSWA 1HQCA 3PQJA 5CVEA 2HWKA 1G3TA 2R6ZA 2DPDA 1S7OA 1XCBA 5DTMA 5CVUA 2A5YB 3RIRA 3C3PA 5DSTA 3KQOA 5E8RA 5E9QA 2XHKA 1LEAA 3EMDA 2OB1A 2FBHA 3QU3A 1X1DA 1LJ9A 4KMFA 3TDUC 4LK1F 1N2XA 3MQ0A 4UXNA 3QRFF 3RDIA 5CJ9A 4A0XA 1QZZA 2ONZA 3TM5A 5K0LA 3ANXA 2HZTA 4P7KA 1GXQA 3HM2A 4E2WA 4JBAA 3V8LA 5EHGA 3KETA 5GWXA 5ERGB 1RI2A 3R9XB 2JHPA 4IHTA 2C6YA 4RYLA 5E2AA 5K1YA 4RB2C 2V7EA 3GNLA 3MTIA 1KYZA 1BIBA 3CKKA 1MHTA 5DUKA 5B1SA 1R22A 4BNCA 3TM4A 3REOA 1YB2A 2ZMEA 4E70A 4HC4A 5F2KA 1VE3A 2PXCA 1GXPA 4PYJA 3UJAA 2OD5A 4AZVA 4RVDA 2P41A 1KU7A 5K0FA 5BP7A 4G6QA 4PYLA 2P5VA 2DPMA 2ADMA 1B9NA 3IWFA 3KPJA 5M5BA 1X19A 3MCTA 5CUQA 3ER8A 2R3SA 2COMA 3KQPA 2YPRA 2FQ3A 1JG1A 5EKXA 5JFRA 4XSXF 3UJCA 2VZ9A 1J0RA 1S8NA 4B09A 2BM9A 1HKQA 2QZ8A 3LBYA 1HW1A 4LG0A 4KICA 3FYDA 1ON1A 3TQNA 4EQQA 1I1GA 3KR9A 1FP1D 2EG5A 5LHHA 2IH4A 4U0VA 1FYKA 4D0PA 2OZ6A 3HUGA 9MHTA 2ZMEB 3DMHA 4GO1A 1SQGA 1BHJA 2I62A 2BR3A 5T67A 1TTYA 1O9HA 2BR4A 4HTFB 4HX4A 3CTAA 1TNSA 1YFJA 2AXLA 4BQAA 3J80K 2XROA 1IXSB 3RPQA 1B42A 5E9WA 4OOIA 5DYMA 1NBHA 2PN6A 4BYYA 1NW6A 4DA4A 1BBYA 1MJ9A 3P9NA 5FUBA 3WGGA 2MLKA 2B9EA 1H0MA 3BKWA 4A5MA 2BBYA 2DLLA 1EJ0A 3TKYA 3OZSA 3WGHA 3N4MA 3CO6C 1UWVA 1SD6A 2DPUA 1YYVA 3D0SA 3EYYA 3EMBA 1KQ9A 2ERCA 3A27A 3FWEA 1X1CA 4EJVA 4A2UA 4AIJA 4OINF 2UWMA 4EM2A 3FRIA 3NWBA 3BJAA 5EVJA 4C4AA 4RGSA 1BKYA 4U0WA 5AONA 1X1AA 4P55A 2F5FA 1EH7A 4UUVA 5ERIA 1XCVA 3LQQA 5CLSA 2OBPA 4PONA 1XN7A 1G8SA 2Y75A 1A04A 1B4AA 2G9WA 4X60A 4CO8A 4HV5A 2UXNA 4RAYA 5HEKA 3KR1A 3FMQA 4GF5A 3BY6A 3ORHA 4M72A 5HOOA 2Z3YA 2LD4A 1KU2A 5FO5A 4OMYA 5LHIA 3DOUA 5ILUA 2OQGA 1Y0UA 1DPUA 1FYMA 5L3GA 2O0YA 3WTSC 4HDVA 5BPDA 2O3FA 1R00A 2PX4A 3J81K 4QPPA 5FADA 4HQEA 2IBSA 3HRSA 2GB4A 3VFZA 3KQYA 4ER0A 3KP2A 1LQ1A 5F6FA 4CZZA 5LQAA 1WS6A 2Q8KA 3MAGA 3TO6A 1E17A 3KU1A 2Z99A 3G2MA 3OOPA 2HEOA 1I6XA 4H0EA 3JSPA 2ZZNA 3FMSA 1Q0SA 1YQAA 4M7RA 4AD9A 2IDKA 1IXRC 1T39A 4BP1A 3KQVA 2L54A 4C07A 3SZTA 3KFWX 2IA2A 1VBFA 3RKWA 1WSUA 5EQJB 2H1RA 4BLWA 3DP7A 4IJAA 3ROUA 2EFWA 1R74A 5H6QA 3EVBA 4HTFA 1R58A 3M33A 4R79A 3DMGA 3UA4A 4DNCA 5BMZA 3GW2A 4I09A 4RTQA 5BXYA 4XUCA 4XSZF 2MLGA 3N97A 5LRRA 2PQ8A 4FSXA 1ZAOA 2B2CA 1YTYA 1IUYA 3CLOA 3EGVA 5KK1A 3DUWA 4S05A 5DSXA 2KIUA 1BC7C 1JG3A 5P8WA 1WQ2A 4LGWA 5BPIA 3GEZA 2OPBA 4ESBA 1JTFA 1XDUA 2K7LA 2AVNA 2STTA 3DH0A 3M6XA 3OZRA 2PBFA 2E7XA 4G94A 3F22A 1F3LA 1ZRFA 4HF1A 2IRFG 3UJDA 1Z9CA 4X61A 5CCBA 1F9NA 1S3JA 2FK7A 2DK5A 4HAMA 4PYMA 3EVEA 3BKXA 4LB6B 2ZFUA 2Q41A 4L5JA 4YMGA 1YW9A 4WK8F 3DFGA 3KQTA 3LPMA 4U7TB 3VEPA 2NNNA 4DM3A 1L9KA 4HLXA 2UXXA 2KJCA 4YFNF 1KA8A 3S68A 1IW7F 5HVQC 4XUEA 4MNUA 4RVHA 2NXNA 5FULA 3NVKI 5H6RA 3O2PE
chains in the Genus database with same CATH superfamily
2JPCA 1HTWA 1V16B 4NAHA 3COZA 1O57A 2CQ7A 3EULA 4NPCA 4R3NA 2VJJA 1JDPA 1XO1A 2QL6A 3FPCA 4WLVA 1TMGE 3CDHA 1REPC 2DFLA 3OC6A 1H66A 2EKBA 3HSFA 1L5RA 1Y6RA 3CX8A 4XICA 2PWAA 3EG9B 5EZQA 2Q7DA 2GEDA 1RXUA 2X3YA 1FVXA 3DULA 4G5SA 1FDVA 3FSRA 4M83A 4ZZDA 2W6ZA 3QKRA 1P9RA 3BIOA 1YCGA 2XB6A 2P4HX 1FSGA 2RHLA 3E3AA 3HFRA 1RTTA 1MUUA 3M4OJ 3KC2A 2X58A 5E3HA 1HKHA 4LBYA 5I9BA 1N9ZA 1B8PA 4US0R 3EFBA 1OIWA 1VHWA 2O2DA 5KSWB 1ORDA 4LRTB 1XRPA 3T5XA 3QEJA 2JIQA 5B1IA 1ZN7A 2FNAA 4N76A 4RK6A 3K1MA 4Y2JA 2B4TO 2CL5A 2IITA 1A77A 2P3OA 2ZUUA 3CPSA 3LQRA 4Y13A 3ETJA 5HIMA 3ZLBA 1I9CA 1TP4A 2V4JC 2Q0OA 1ZWLA 3PB3A 1DWPA 5DP1A 4UFPA 3MUNA 4M73A 2HA6A 3ZU6A 2BKLA 3PXGA 4IDAA 1JXMA 1WMSA 4RY0A 4KR6A 3LRPA 4FHCA 4QD3A 4UTOA 1A8SA 1J1ZA 2KSQA 2QDKA 4Y3OA 4UUOA 3ZJVA 4XDGA 1BCSB 1USUA 2ZKLA 3UICA 1BI3A 2M9MA 1Z17A 2J8ZA 2OHVA 3ACDA 4UU0A 1Y3FE 3KYIB 2BMVA 2EAUA 5D1NA 4PPFA 5EN4A 5ALNA 2EQ5A 3FIJA 3CCMI 2I2XB 5IT9K 1T10A 5K5QA 4F91B 1XLUA 2CFSA 5DS9A 2VT3A 2HYDA 4BZWA 1AF7A 4E22A 2EWWA 5JY6A 1D4ZA 1MPTA 3G9QA 3LQ2A 3MRTA 2DPYA 3DR3A 3MRVA 3NVAA 4IDQA 4RE5A 5DYYA 5ABPA 4I4CA 4X64B 3VSAA 1QKIA 2B8WA 4KDFA 1A0OA 2OCCH 3T41A 2VDWA 3GFTA 3A9WA 4QXAA 1YX5A 2GQQA 2F1IA 3J81A 3DLHA 4TUYF 2Q07A 2Y9PB 4AQDA 3JTHA 3PUYA 4W5WA 2KM1A 3FXKA 1Q74A 1OFGA 2M98A 3ZDZB 1O5TA 2D4AA 1XGOA 1LSUA 1WX1A 5JUWA 4YG2F 1BOAA 3ZPLA 1I2BA 3N59A 1WDKA 3I4MJ 1EVKA 3DYIA 1G8HA 2HT6A 2VYND 4LJYA 3WG7H 4AUEA 3FAZA 3LRXA 4DLXA 3TS1A 3CO0S 2NPIA 3K5PA 1U3EM 2GN6A 1MO2A 2FN3A 2DFIA 3NOXA 1JDTA 4MPJA 5FQNA 3T9EA 1WJEA 2CJWA 4XIIA 4W9RA 3A0HC 2HFKA 5FLXK 4JS0A 2BTQB 4CR7A 2GPWA 1BC8C 1OLOA 2LY1A 3RODA 1OU4A 1FNBA 1WSWA 1V16A 5MFZA 2ZJ5A 3N2GA 4PNHA 2V6MA 4CG3A 3I9V1 3OX1A 1Z62A 2C7BA 2VT7A 3V2HA 1WVMA 2XYGA 4IUBS 3QMMA 4DYHA 5BV2P 5IXJA 2ZUSA 5KSYA 2EIHA 5DKFA 1D0YA 1DAOA 2ZJBA 3FJOA 1QGZA 3NHPA 3KKNA 4IOJA 3CC8A 2ZT7A 3OTHA 1EBUA 1YO5C 5KTRA 1AJEA 3KB6A 4JELA 4M99A 1XKTA 4RMIA 5LBTA 4C2UA 1XTTA 1SWVA 2YRWA 5JJLA 1PR2A 4AS3A 3KT3A 4DMFA 2CJFA 3ABSB 2F43A 4OU0A 4XOTA 4G89A 6REQA 2LP0A 1AA7A 3K6JA 5D8DA 3GEMA 4H31A 2WD8A 2QPLA 4OM7A 2Q5JA 4A3BJ 3AEZA 1HL3A 1QTNA 1YS2X 5CT5A 5E1MA 4XB1A 4HN4B 4AJLA 5BVGA 1ULTA 1JEYA 4Y1GA 3LDGA 1FMJA 2WTXA 2PL5A 4FYJA 3TMYA 3WRYA 4A92A 5KQPA 3ZOBA 1MLDA 3R7WB 3E0QA 1P8AA 1WKMA 3DT6A 5ARBA 3QPCA 2XE8A 3X2SA 2IEKA 1L3CA 1REQB 1UBGA 3N9IA 2RG7A 3A6DA 3GZTB 1O6FA 4HTAA 3SZUA 3TB6A 1R6VA 2Q1UA 4BEWA 1HR0B 2NXEA 1JQBA 4LV8B 3K0FA 4J0IA 1CY6A 1ZJ5A 2IQIA 5FWAA 4MDFA 3RI4A 3RDPA 1U0LA 2NUBA 4R2MA 4QYIA 2XZOA 5GJBA 2CUJA 4NCAA 2XUKA 4B8ZA 3HJAA 2ASVA 1SEUA 2Q1XA 1HKTA 2AG8A 4F4UA 2D2IA 2A1TR 2KJQA 4X44A 2H8RA 3BERA 5HZHA 1IHOA 1H0KA 3BXGA 3UJNA 4A1FA 4GPBA 1B14A 1HPLA 1K3TA 2Y0PA 1NXOA 1SHTX 5AJHA 4CDMA 4D4IA 4EDHA 4HGQA 2A9PA 3I72A 1JU4A 1JR6A 3JQEA 1R10A 6PFKA 5BQFA 4DLKA 3Q0EA 4YCNA 4ER3A 3LSTA 2P6NA 4GHWA 3AH8A 1ZPDA 1U6IA 1KI4A 4D0LB 4A3MJ 1UXOA 1JEQB 1LS1A 3HUFA 4UE3S 3ZXSA 2F3PA 4BWYA 4Q4DA 3QLUC 2ACJA 3ORSA 1JHAA 3ZK7A 1Z28A 2YX1A 4JP3A 5FFXA 4X1EA 5ICCA 2NZ2A 4EL5A 2DHDA 1W75A 1JL3A 1L8QA 4AP5A 1XDWA 4FU0A 4NAVA 4RVOA 4XJXA 5DCMA 3MWJA 4ZO4A 3W7AA 3OESA 4G0MA 4I1YA 4JLDA 4P35A 1AGYA 1SFXA 1H6CA 1QIEA 2YS7A 4BU2A 1TW2A 1DL5A 3G0IA 1W35A 3QPAA 4KO4S 4LCEA 3ZJTA 4MA0A 2XLBA 4DJAA 1XYYA 5EF6A 5G0VA 3H16A 1TZJA 3VWBA 1LCIA 3DOEA 3FCSB 4IXTA 4UTXA 4HOBA 3NH6A 4M3EA 2XWSA 5NLLA 2F59A 1YMVA 1W4MA 1ZFNA 2OCPA 3MMPA 3OJXA 5T5QA 1RPAA 3FGPA 4Y30A 1U8CB 3A02A 1YJ8A 4HDNB 3WJ7A 4EG1A 4JJ8A 1BFKA 1UH5A 4O2AB 4C29A 3SVLA 1P1BA 3EIWA 2BFPA 3I6QA 3IC7A 3ZWXA 3ZU2A 4ZYEA 1UOQA 3B02A 2L9NA 3IT1A 1A95A 3G17A 5LBQA 4UAUA 4UUMA 1RHUA 3DF8A 1VCOA 1K5HA 3KPHA 3H0EA 4UZSA 1ENYA 3JQFC 5H02A 3FROA 5DRTA 2Y1FA 2X8AA 4DZPA 4CT4B 2P0YA 5GJCA 4LCJA 2C83A 1MABB 4OI1A 4PAWA 3ILSA 4KGXA 5K0JA 1NWHA 1OILA 1Z1DA 1KTVA 1TTHA 4JUDX 2XPVA 4H3HB 3VO9A 2Z6AA 2IOYA 1XL1A 2FHPA 4B7UA 4NCKA 3SZOA 3H2GA 3J7AO 1N57A 2DN0A 3ZVNA 1W30A 4BXXJ 3W2FA 2DBRA 3KUDA 1O54A 2GCOA 2NM0A 1LBQA 4LIUA 2D3TA 2IGMA 3CXUA 3W8DA 1OZFA 3R6DA 4M36A 2EIKH 2IY7A 4L85A 4OAYA 4HRAA 3TQHA 1QX4A 5FPSA 4X6YA 1WB6A 2FEXA 2H7CA 4G36A 2FDCA 3ZDBA 5L40A 4ESFA 1PVVA 1VL6A 1MR3F 4MZXA 5JVTA 2AH5A 2ZSEA 4QOJA 4WZBB 2R7WA 4WKGA 4ZKDA 4G0YA 2GJ4A 2XTZA 5A5FA 1QONA 1VL0A 3HFGA 1VL8A 3OOHA 4PC3A 1L7DA 1KZ7B 2DG2A 1QOZA 4DLVA 2HVSA 3SFVA 4LDAA 3DU5A 1G3UA 3A9CA 5I7RA 2BUAA 3GVCA 2HDCA 2V5UA 2ZIAA 1ADGA 2ZRDA 3E53A 4B48A 5FORA 3PPYA 4IO1A 5C7YA 4CKEB 1IOWA 2E4UA 1WKCA 5KVRA 5BSKA 1EX9A 3JD3A 3O95A 2W4IA 4E33A 4F9EA 3U4MA 2M1ZA 1NMYA 4BKPA 5B64A 1QO0A 1Z05A 2FSFA 2EPFA 1M6VB 4YHBA 721PA 1GFIA 1MX5A 1V3TA 3RBZA 5JVDF 3AUAA 1HSJA 4QXQA 4LFCB 2WR8A 3E97A 1BE6A 1N3BA 2QPOA 4JVNA 4N6NA 1P0FA 2PBZA 2UDPA 5AOCA 3BMOA 4HEJA 2H1WA 2FZ4A 3BJZA 3KJNA 4UEQA 3AW8A 4KR0A 1Z3CA 1ZD9A 1YB4A 4HZIA 1V8ZA 4ESVA 4K2EA 1LRLA 1GDHA 2YV1A 2Y0BA 1ZYUA 4ETMA 1RJFA 2XCLA 3WZLA 5CNIA 1D2RA 3ZQQA 1AS0A 5HIJA 3W1EA 1G6NA 2IQ5A 3KCCA 1GVHA 1XYVA 2H7XA 5C8VA 2ACKA 5BRJA 4Y6LA 4TZ0A 4GOLD 1MXFA 3FX3A 4UHEA 5FTNA 2XIGA 4R6XA 2X4LA 3GYBA 2JFXA 1DX9A 3NCTA 4UASA 2VJAA 3BJOA 3ZCRA 4W5OA 2XZPA 1E92A 4DPKA 3S27A 2XMZA 3CF4G 2NU6A 3HUTA 1MOSA 1H0HA 5FAXA 2F4VB 4MCAA 1ZGGA 3AY0A 3PZRA 1G20E 1L4GA 2GBIA 3QW2A 4LFBB 4E4HA 2ZRFA 5DEQA 2JAWA 3ZE1B 4LB5A 2PG3A 1RQRA 2ENWA 2Q5FA 4I81A 4KQ6A 1YL6A 2WMYA 4DTIA 2YZNA 1OZGA 5CG2A 1TVMA 2AA3A 5COQA 4BWFB 5LZ2A 4PC1A 1RRCA 1CF7B 1KQNA 3P1JA 3SM9A 3OP4A 1J07A 5EVCA 3OF3A 1CYDA 1M7BA 1U8BA 4HLQB 4YGYA 2XE7A 4KN8A 3D3JA 2BEUB 2RK3A 3R5KA 3GFIA 1K9SA 1QZXA 2A2ZA 5ULLA 3T4PA 5EP2A 9ATCA 4GNRA 5EIAA 1V48A 3BTOA 5CBPA 4JROA 2BE5F 4ENJA 2R92J 3CT4A 4YJKA 5BMVF 3DUFA 3OR1C 3KOUA 3O3NB 2EDCA 3GDFA 5ERYA 1NV9A 2HH9A 3L2CA 3M1IA 2Z2IA 4TLBA 5D3MA 1KU6A 4AN0A 4NXMB 4FFVA 2GFHA 4HX5A 4G09A 4BNHA 4D2IA 1QCDA 1XBTA 1YS1X 2NXNB 2GCEA 1P4RA 1ZLYA 3D59A 2VJOA 3PGLA 2AXPA 2M0MA 3FPFA 2L5QA 3HUGB 3NNNA 1KE2A 5JHHB 1Z4QA 4G81A 4KVFA 3CC7I 3BWGA 3STYA 1JA1A 1W85A 4JIMA 4TWIA 4RF3A 4YUZA 2PBIA 4GXOA 4UCXA 4F8YA 2YIJA 4MUHA 4PZ9A 3DDHA 3S40A 3GEIA 3RABA 2ISCA 1IJBA 1ZA2A 2PGJA 3FI9A 3NBQA 1XCGB 4NXNB 1QUEA 4FX4A 2HL6A 4NDAA 3C6ZA 4BE7B 2IOFA 2WD7A 3CH4B 4LKOA 4U1RA 2FZGA 3OIOA 1RC0A 3CSUA 5H68A 2RE8A 3PCRB 2CXQA 2WPDD 3HLTA 2ZUTA 3LX6A 2ID8A 2KX7A 3CRQA 3RC2A 4L7VA 1VBMA 1BDBA 3OS0A 3FSEA 2OAP1 2Y92A 2YINC 3L92A 3JQGB 4H3KB 4RA6B 5DXAA 1JSZA 3KZ1E 4AJJA 4I6GA 1M1EB 3GLFE 4REQA 1JZQA 3JATB 3R3SA 4MCIA 4FBMA 4JI7B 2VQLA 5IXSA 2PGDA 2QN2A 2QMZA 2YHAA 3RS5A 3WI7A 1IJKA 1OFUX 4Y2HA 2JBWA 2TYSB 2XCIA 3BFXA 3VDRA 1RBQA 1R27A 1Z2CA 3U4IA 5LMUB 2X6WA 5G0UA 4QFMA 4HB0A 4C0JA 4WFJA 5IEJA 4QIHA 5THXA 3CUQC 2C2ZA 3S8MA 3DBLB 3S2WA 2WFLA 5KNBA 1T6XA 4Y33A 3AYZB 2XYHA 4PANA 4Z86A 4AQYB 1TKBA 4EX6A 3B6ZA 2I22A 3AI2A 3HPHA 5F3RA 2IT1A 2JS7A 4FGUA 4XW2A 4OHXA 3DEEA 3UXEA 4BNFA 4DR6B 3UPTA 4JQYA 1FX7A 1YRLA 1FX1A 2QL5A 5BXQC 1FNSA 5C4JJ 1XF1A 4LJRA 4OQNA 2Z9CA 3KP1A 1KXZA 4QNMA 4L8WB 4E30A 2XXAA 2G0AA 5K7FA 3CC2I 3BGIA 4IWNA 1T95A 4OU4A 2PUDA 1GSAA 3TINA 3ABZA 4URXR 3ASZA 3RUHA 2ZR7A 3KM0A 1ZNQO 2JASA 1IL0A 4NHJA 1ZONA 2VNAA 4TMVA 2WSMA 4Q03A 1MIOA 1PK9A 4J7CA 2P6PA 2D2VA 2DFEA 2O1SA 2WFLB 1G4UR 3HJHA 4FGZA 4CHUA 4Q1FA 1GD1O 1OXMA 3EQ6A 4X8MA 4TTSA 1OAAA 3VR2A 1UZLA 2X6XA 4LJZF 1K4MA 1ZW1A 2VP9A 1OBCA 4MX8A 1JI0A 3DOOA 5T64A 3SIPA 5C31A 5HJ7A 4KIBA 2IVMA 2PUVA 4AUNA 3N0RA 4Z7OB 2HJVA 2XDVA 1E2EA 1K8YB 1IVNA 1S5PA 1ZUHA 2XASA 1I13A 1UPXA 3D4BA 1DAMA 1X1PA 3KELA 4QTUB 4YRPA 1GUDA 4JLJA 2X0DA 4CIYA 2RJOA 3BCUA 2Z8YM 2C3PA 2G80A 3F5DA 4ANJA 2CYBA 3V97A 3PO2J 4UBOA 2G04A 1XF9A 3BGVA 1VHJA 3L1JA 4EHIA 1C3JA 1B73A 3CUTA 3E7DA 2MABA 1IV6A 1J23A 3AF1A 3NATA 1TQ2A 3KSMA 3NP7A 4RD2A 4TSFA 4ZYXA 2A68F 1U0FA 3G5AA 1S8AA 4D7NA 2O2HA 2DAOA 3LCUA 5B1BH 3BM5A 4KMOA 3MKZA 5FRDA 2R96A 4AY4A 3WYDA 2CEKA 1Y0BA 5DPMA 4C43A 1LLCA 4BXUA 3WTWC 4DIQA 1ACIA 1RBMA 4IG4A 2QNIA 2BP7A 1Z34A 5DD8A 2QV0A 1SHJA 3W04A 5K6AC 1HM5A 3ZMSA 4JN6B 3RC3A 3OE1A 5LL6P 4UBIA 3QF7A 3JSAA 2XZLA 1OYWA 1O6CA 1JDBB 2FMKA 2OD2A 3QPDA 4KVZA 5EXXA 2RC4A 3R74A 2O8XA 4EGSA 3LUAA 4XFKA 4PK4A 4JLWA 4CKCA 4MVXA 4WNAA 3W2VA 1USKA 4RSHA 3RAPR 2HEGA 3DOIA 5KOJA 2QF7A 5DNUA 4FFBA 4IFIA 3MMXA 3R5TA 3RYIA 1R1UA 1SVKA 4B73A 3PJRA 2RKOA 3B7PA 4LWOA 2HWWA 4M7WA 3UNXA 2C84A 1NA5A 2PFSA 4L95C 4S3MA 4TQUS 4IL6C 2ZWVA 3LLUA 5DZSA 1JEYB 4HWPA 2C9BA 2FW6A 5EEGA 3IUNA 4RD1A 3F98A 5DMXA 2FR8A 3OH8A 4OU5A 1IDZA 2XMPA 3LOQA 5E18F 1K7FB 3ZGZA 2FUNB 2F2TA 4NH0A 1I3NA 4FMDB 1P39A 4DRXA 5FOQA 3PNVA 1J4AA 1E79A 4CM4B 5DWVA 3LSIA 1SC9A 2J1LA 2Z56A 2VH1A 1S9DA 4IHJA 3VR5A 4K9SA 2ICAA 1RRFA 2VJQA 3UY4A 2L9RA 1F2VA 1PG2A 3CPHA 5ITZA 1U2TA 4L6AA 4L9NA 4KTTE 4I19A 3GV0A 4NBLA 4MWTA 4AURA 1U9IA 1NJ2A 3DDOA 2R8ZA 1KP9A 4JI2B 3T0IA 2FE4A 3CUUA 5I9IA 3DMYA 1RE1A 4LFAB 4PJMA 3CR7A 3I01M 2PQ2A 3VDQA 1M5RA 2O4UX 2XT6A 2FWNA 2AN5A 3PHBE 3HYTA 4FK8A 2PL1A 1YI1A 4PO8A 3K4LA 1BJKA 1DG3A 1FX0A 1O03A 2XOXA 3IR5A 4D4LA 4M0KA 4WUTA 3WAJA 4QUJA 1JXQA 1OCTC 1ZWKA 3TDZC 3DTNA 3P2MA 4GDMA 1JMKC 2JH8A 2UYGA 4WOBA 3SM3A 4PJNA 3GU3A 4H4DA 1YOBA 5K09A 2D06A 4RLSA 3OE4A 4C89A 2J3QA 1R0WA 2OZEA 1CG6A 2AIRA 2PYIA 1Z0JA 5B1YA 5I5EA 2B8EA 3OM0A 1Y3AA 4YYZA 3BF7A 1W4RA 1XD8A 3QFCA 3R8FA 1JPJA 1P4GA 2HPVA 3G59A 3KHUA 3VB2A 4NY1A 5F21A 2M1BA 3M8KA 2ECBA 2CF5A 2EZ8A 2O1EA 4LOAA 3R0QA 3H84A 4TT3D 3ZIAA 1M1NA 3KZIC 1FZPB 3ESYA 1KPIA 4GMKA 3LCMA 5K51A 2FOIA 4E5DA 3OQOA 5CEJA 5LEKA 1UAYA 2MSKA 1F7UA 4MFEA 3KYJB 3U3KA 4XUGB 1VMKA 2BF4A 3L6UA 1DHRA 1U4SA 1X9GA 4R8SA 5AUNB 1LPMA 5E3JA 2Q1TA 3A6HA 1W0KD 1KSHA 1Y81A 1QHFA 3HP4A 3NANA 3PEFA 4J0FA 2B82A 4M6VA 1XN4A 2D5IA 3JQPA 3QFHA 5D5HA 3HEMA 3SF8A 3BL8A 3CVWA 4MUEA 3PC8A 4HNSA 5JS1A 4PRZA 5L95A 2YWEA 3RPUA 2AQFA 2KP6A 4IQ0A 3OYMA 1Q6YA 2FI1A 3EPRA 3H5LA 3NHJA 4F2WA 5JU6A 2AOXA 2J9FB 4W7IA 2FPLA 2DPLA 4KIWA 5H3LA 1FRFS 4BPBA 5AJYA 2XDYA 2D5AA 3MKLA 5FLMJ 2HY7A 2ZJ7A 3OJLA 5K1ZA 3RNLA 2XQKA 3ODGA 3T7KA 4GAEA 1H3EA 1Z36A 3I2GA 3AG2H 3OU7A 3SJBA 1GTSA 1PFKA 2LR0A 3LY5A 4EG5A 4FLMA 1JJ6C 3K8ZA 1HE5A 1I7PA 2EGHA 2H31A 1RPTA 4GPZA 1MD9A 5FNVF 1C9KA 3UIEA 2C9ZA 2XJ9A 4EYQA 4JJ4A 1VKHA 1UMKA 2JZCA 2XLCA 2ZJ4A 1QRAA 3H83A 3U5TA 2FFQA 3O8QB 1CJMA 4G1MB 4D4KA 1KIAA 2HYFA 2I5PO 4LSWA 2P81A 1E2HA 2YDXA 4AS2A 2KRFA 2WAQA 4QAJA 4QWWA 4HVLA 1GZSA 5FHRA 4IFBA 3HBAA 5M3BA 2W00A 2F8MA 3WGZA 2R7NA 5AOVA 1OTXA 1K63A 3EDRA 3ML1A 2H1SA 2FF4A 2HD4A 5L3BA 3VR6A 2OK7A 3GLIA 1QA6A 3HCPA 4EF6A 1DIHA 2FSUA 2FPWA 3HGYA 1DINA 4OP3A 2GD6A 3IEXA 1VXOA 2JB9A 2BGRA 2ZJ0A 3V8VA 2PD3A 1OR7A 4DM4A 1AURA 1N34B 1DKRA 3AR4A 1WJCA 3RRYA 4INAA 1E4EA 3DVAB 1A5AB 1EIZA 4E7IA 5U4XA 1RYEA 1K7XB 3JQ8B 4R8HA 4LDZA 4X7MA 3GJSA 1XWIA 2DTRA 4B31A 1DCMA 1ZNZA 3FM3A 1G21E 3D0RA 1OZAA 3B1VA 4MPRA 4M9UA 1JLKA 2DMNA 16PKA 2EZUA 4FINA 2ZJZA 4DRYA 4ZA2A 1UM9B 3CUSA 3D54D 2BDEA 2OQIA 2IS6A 2M30A 2P0AA 2DBQA 3LPLA 1EFTA 5IABA 3SAJA 5M29A 3A01A 4WWCA 1DFIA 3OLQA 1A9XA 2CZGA 4WXMA 2JI4A 2GOMA 2B8NA 3C14C 1Z73A 2ADUA 3U3JA 3VFDA 3GLLA 5A7FA 1DVRA 3GVPA 3N2KA 5ECYA 3GEEA 2D4HA 3SZLA 4C0QC 4YMTA 2QYTA 1NJGA 1L0OC 4GPD1 1D9ZA 3H36A 1GPLA 2F1OA 3MGKA 4FYMA 1CR1A 2OVBA 3FISA 4ZD6A 3I3OA 1AZSC 1MN6A 3E4CA 3LA8A 1ZRDA 3BPSA 1S7EA 3DE5X 4TROA 3RVKA 1IQPA 2VQDA 2VH5R 1ZREA 5TPZD 1R0KA 2V98A 5ILSA 2X9NA 3FR7A 3TWOA 5J1SB 3QV2A 1C2YA 1RRPA 2ZJ2A 2WD9A 2XY4A 4YT5A 2FSGA 4BNGA 2XUPA 3R5FA 3Q9SA 1WV0A 3LPDA 2A9FA 4XTCS 3A1FA 2J3DA 4LVUA 2CC2A 3AKCA 2DKNA 4DA7A 4KNYA 2GWHA 3OUZA 4N03A 5F1RA 4YDRA 3ZU5A 2WICA 2QAIA 2BY1A 5KX5F 3LY8A 2GK3A 4X93A 2KBFA 2DA4A 4OJKA 1U1CA 5DX8A 5C53B 2FWBA 1CFJA 1ZZGA 2BFNA 3IESA 4MRAA 4CYCA 2DWQA 4HWGA 2IPAB 4K9DA 5HK8A 4WZ6A 1FIUA 1SU6A 2VPWA 3OUUA 2G09A 3G2KA 2RJ3A 2GN4A 4QGAA 1FYLA 3K4QA 2P2NA 3H05A 3MW8A 3VOAA 2VP0A 3GJ8A 2CZCA 3O4HA 1BD4A 4GX0A 1LH0A 4MGYR 3L7KA 4YRBA 4ESEA 2Y1CA 5EIWA 3EA4A 5KKCA 4I55B 4M1EA 3TDKA 3GFPA 5FBKA 1MB3A 5GOZA 1TKRA 1XZMA 4JT9A 2YWDA 5HCNA 5JS2A 4A10A 4ENSA 4YXFA 1E4YA 2IF0A 2KIFA 1GG2A 3PR1A 4K88A 1DFHA 1T9ZA 2Q5QA 1UFOA 3IURA 4JX6A 1Z18A 1RWWA 4M9RA 5EE1A 1JLMA 3VPBA 4R1PA 1I1SA 1OLSA 2YZ7A 3L8FA 4R9RA 1J2EA 1DAEA 1S8OA 4IXMA 3GZ4A 4PAOA 4UHBA 1EGAA 4N7JA 1DQNA 2EIJH 3V2IA 4IHWA 4A8HA 2AKEA 4PF1A 1BM9A 1UB9A 1K06A 4BO2A 2FK8A 3DQZA 2XRNA 1MAWA 4RGXA 5F77A 3UAYA 2UU9B 3BR6A 3UATA 4GMDA 5DI3A 1NTOA 1XEFA 3WYGA 2JFNA 4A3SA 5B7NA 2RCYA 5KOHA 3PPWA 2YX4A 4L6CA 3HM5A 3G9XA 5AKKA 2OEPA 4AU7A 3ND6A 1GPWB 4A0FA 4N12A 4BZZA 2ZCJA 2GF2A 5KJ1A 1XXHB 3R4KA 4GI2A 3NEJA 3L1PA 1GYQA 5CDSA 3IE1A 1VYUA 1X0VA 3FDJA 2QSHX 5IX8A 2VC0A 2NS0A 1I51A 3TLEA 3T1VA 5A04A 4ZQHA 1M83A 4PG5A 5EC8A 1XXHE 1A72A 1UQTA 3DU6A 2YJ3A 1GA4A 2XC7A 2DPXA 5FJ8J 1RPJA 4MDEA 1KI9A 5A2QK 1VA5A 1L4KA 3BGOS 1LFDB 3QX3A 4MKXA 2PRJA 4M98A 3TKLA 1X7XB 4QGSA 5C32A 1X13A 2HF8A 2CG4A 1MP0A 3E84A 2V4MA 4YAWA 3WQQA 3IBFA 5F98A 3ADDA 1BTOA 3WSVA 4RTNA 3LHSA 3UPUA 3OECA 2HKIA 2QUJA 4XPIA 5ALXA 5K0BA 3EUHC 1HDZA 5TLSA 2WF9A 2LYCA 3X0DA 4RTQA 5JAZA 1Y6JA 4KQGA 4MYCA 4TXLA 4E21A 1CYEA 1I3MA 2B4YA 4M87A 2AMJA 2WADA 2QNBA 4XYLA 4CIAA 1LBIA 2BD0A 2TDXA 2HF9A 3EF1A 1KO7A 3IP3A 4KDRA 4ES6A 2FG5A 4J03A 4XLPF 4MAFA 3WISA 2VVTA 4TS1A 4W6QA 4GGGA 1QNTA 3OZAA 1TQPA 3GFLA 4C9YA 1II0A 1QM5A 3IA2A 4LRXA 1JIQA 1CZKA 1ILWA 3G2PA 4CKEA 3NNDA 3CE9A 2JFYA 2JIMA 5JIBA 2OXIA 2HT1A 1ZKGA 1UK9A 1V9CA 2GM4A 1MIHA 4DLYA 1AQLA 2JL1A 1XZKA 1GU7A 2ZULA 1N6RA 3AHFA 5E38A 4B80A 4DY4A 3AC0A 3ZJUA 2N47A 2B0CA 3F9IA 3EYAA 3BZCA 2IPMA 1MGTA 1FDSA 4MUXA 2AOTB 3ROZA 3LOUA 2FAXA 1U2ZA 3CJTB 4ZWNA 2RIRA 4CHTA 5K3OA 5D4SA 1N5LA 2EIMH 4Q4LA 4JEMA 2FPSA 4IHJF 1NQAO 1HW5A 3CJRB 1JYFA 2VPZA 1RHKA 3SDZA 5ADVA 5K0CA 1ZR4A 3KSBC 1Z5NA 3FPSA 2DFNA 4HPQA 2B34A 4QO7A 3N5CA 3NUGA 3HK2A 1Q7BA 2DB3A 3ZE7A 5LN1A 1EP9A 3NRCA 4IQ8A 3QKRB 5BNIA 4C01A 4Z4QA 3LNTA 5L3RA 4RACA 1SWWA 1NI4B 1J8YF 5FLEX 2DQKA 4EEXA 4YV7A 4XBFA 3AT1A 2C5EA 2I76A 1R8JA 2FR1A 1L8LA 3GP5A 4UAVA 3GT0A 3PQ2A 1IY2A 4JUAA 1ZUNA 4ZO8A 1ZCZA 2CLOB 5D3QA 3A4IA 1E3TA 4GCVA 1NRXA 4J3FA 3R3VA 1TRHA 2Q4EA 2I7CA 4L72A 4QPDA 3USCS 4IJ6A 5CH8A 5TRDA 2PZKA 3MEQA 2ACVA 1X58A 1U02A 1UUFA 3BWEA 1CUUA 4TV9A 2WV9A 1TFUA 3UJ9A 1R6TA 1HZJA 3K9BA 4HAWA 4ND1A 4F56A 2VODA 2XX3A 4PFOA 2V7BA 2EZ4A 3D4NA 3FUUA 3O2SB 2VZEA 2ZUVA 3JAWB 4BO7A 5LWHA 1W4AA 3EOZA 4L3WA 1DP3A 5DNYB 5IY5H 1N5OX 3QSGA 4HJXA 1B0PA 1VJDA 3A3PA 1V37A 2VKDA 5ENVA 1U28A 4TMWA 5FCDA 5AKJA 2XKPA 3H75A 1EX1A 2HQOA 2Y99A 3N0VA 1YQGA 2HU2A 3BD6A 3QEMB 5BNZA 3ZWOA 4OX9B 1M6VA 3MWDA 3QA9A 4DR5B 4GYWA 2IRWA 3JD1A 4PGMA 5ALDA 3ESAA 1JWLA 2BKXA 3LBAA 4LDPA 2C9DA 4S0ZA 3WTYC 1E2KA 3EVGA 1RWPA 2B2XA 3GGSA 3S1RJ 4TKZA 5AJVB 4E5VA 2EXXA 4UOZA 1M74A 2DFHA 4WDRA 1RXSA 1M1ZA 3AUUA 2W6JA 5JI3E 3QX9A 1BSVA 2ZFWA 2CSOA 4J4TA 1YONA 1U0NA 3OA0A 2C54A 3FF4A 5AKZA 5HIKA 5AQ1A 3BXPA 4MYDA 4XQFA 1KETA 5AVXA 3EQ2A 3IVXA 2OFXA 3F9KA 1W46A 2OFPA 1BW9B 3B6AA 2JFPA 2OORA 4Q1VA 3TPFA 3WMXA 3HBJA 2DHEA 2KS6A 3FFWA 5GZ3A 3AILA 3IHLA 1RI3A 4LVOA 2RQPA 4MV9A 2NO0A 4QGBA 4C6RA 2PUGA 2XOEA 5JJ5A 3MCUA 2CFOA 3KSAC 3H5AA 1K61A 3M34A 5DX0A 4B9EA 1GUUA 3PFCA 3WTVC 2YR2A 3DV9A 1DC7A 2BH9A 1PVEA 1W7PB 2VPLA 3LSRA 1GL9B 3KEFA 4J6EA 3G6WA 1G8PA 5IZCA 1D1TA 3F3KA 4LYGA 2M5WA 1BOBA 4LJ6A 1A76A 3I52A 1W36C 3SX2A 4YJHA 2RHTA 3BTJA 1LDKB 3IERA 4XIDA 1K6YA 1E6WA 1H23A 4DBQA 3H9BA 1RAFA 3OQMA 3LFTA 3C1UA 3T5CA 1JW9B 2B25A 3R7LA 4ZVUA 4PYKA 4QG3A 4Z7JA 4NJMB 1BI2A 1G5HA 4GKKB 2HTSA 3OV8A 1YHYA 4BQNA 1TE2A 2REOA 2Z30A 4H7JA 2CNNA 4RD4A 4WJKB 2CU7A 1NW8A 3TW8B 1AH2A 9GPBA 3RFVA 1NWCA 2P35A 4JY7A 1LNSA 2XODA 2MGQA 3QYPA 5TXGA 1UC8A 1GUBA 4KWHA 5AJTA 3DHWC 3WLSA 3EZNA 3HLYA 3HXPA 5CBPB 5KU1A 2DA5A 5DHSA 4FI3F 4O2RA 2F43B 3U4GA 1T9DA 2MDTA 1OTHA 1AU9A 3W2AA 1FP7A 1NX6A 1SXJE 3QOFA 4QUAA 3L1KA 4YP0A 1EP1B 3QFFA 1KDRA 2NRAC 2C59A 3ONFA 4LY6A 1L4YA 3RG8A 5A4JA 4ARCA 2YC4C 1XTAA 3VKHA 1G1MA 1XZIA 3QELA 4K9QA 1P73A 4G56A 3A7EA 4M3NA 3QOYA 5D6NA 2PTGA 1Y3CE 5IJ9A 4GM1A 4C04A 4MOWA 4NU0A 2D1HA 4J3JA 4QBHA 3IKVA 2UVPA 4JNKA 4CTJA 4ID3A 2CVHA 1Y9JA 2HSJA 3PC8C 4RK4A 1PGQA 4C7KA 1B8OA 4ZCRA 1HE8B 2K9LA 3P9XA 2IYVA 1ID1A 1L3IA 1OAKA 1YAHA 2O1XA 3W5BA 5KNBH 1MO3A 1ZH2A 2JH9A 1GV5A 4RXMA 3BJ6A 3U26A 3VR6D 3OZGA 4I4TF 2DQRA 5AP9A 2P67A 1OHHA 3I6IA 4LNUA 3TL2A 4ZDKA 2R6HA 5JYBA 1FNNA 1E2JA 1RC8A 4W8GA 1MBKA 1UMDB 1X7ZB 4R2IA 1GPDG 4M76B 1JT9A 1R5NA 2HC9A 2A4KA 3OJOA 3KSUA 2H5JA 3CU5A 3K32A 5FDFA 2PWYA 3LNCA 4OHBA 4Q6BA 4N8SA 3HOVJ 3EISA 3TFWA 4NE9A 5JC8A 2WAAA 2OCKA 3BR1A 3KUKA 4NS4A 1XWFA 3LKDA 4HP8A 1Y6QA 4PX3A 3SZMA 4PQRA 2VKTA 1KQ8A 1IDYA 1UIMA 3CRMA 3FW1A 1NNI1 2BEJA 2PH5A 1NFFA 3BSWA 4WOCA 3EETA 3TRDA 2E82A 5JCZA 3ROGA 3L7CA 3ZIUA 4LPSA 3NHMA 1UDWA 5GGYA 3NBYC 4E3WA 1CY7A 2VYVA 3RSCA 1EBBA 1N7HA 4CLOB 3HKEA 3JAMK 1NP6A 3E6DA 2FEWB 5EGNA 4JENA 3FAKA 3LA2A 3E9RA 2HZBA 1FPQA 1TZBA 2Z58A 3IOYA 3UXYA 2Y2ZA 1PW7A 4CM3A 4JXKA 3CZQA 1EB9A 1WUYA 1IZ7A 2XJ4A 1U78A 2V54A 2O3RA 2YMMA 3JQAB 3TRIA 1T4MA 2QV7A 3M2TA 2C3OA 2B30A 3BQNB 1BVRA 5EA2A 3ACBA 4RX1A 1JKJA 1UMBB 4RJ2A 5JAIA 2W6PA 4O2BA 4ZOLF 2PBRA 3ZV7A 2DBYA 3HA3A 2CW0F 3I92A 1X8JA 4FCVA 4ZT6A 3GEGA 4PV7A 2BDUA 3GUDA 5CKTA 1J56A 2WNIA 3ZBUA 5JAPA 3TLZA 3B6CA 3PO3J 4RXTA 3TOSA 2DOFA 4PGGA 3SLKA 1Z0ZA 5HMLA 4DW8A 1I3LA 3GPLA 5AHXA 3RJPA 4C0HA 3CF2A 5E3NA 4MUBA 3UV7A 2V96A 3W34A 1R23A 1E2UA 4C06A 2ZAIA 4K9RA 3U1TA 2I1VB 4XKWA 2O06A 4MICA 4GKJB 3EODA 1UFVA 2TS1A 3F96A 3VOBA 2VS1A 3G5TA 4W82A 1IZ0A 4TX1A 4I4IA 7YASA 1SFOJ 1VI5A 1E3QA 2Z1NA 1NY6A 3HCCA 2YFKA 1DAGA 5H70A 5EMNA 3UWSA 5TC4A 2V58A 3GXBA 1FRNA 4Y2GA 4Q1AA 4FIDA 4TWZA 5D87A 5CM2Z 4BNDB 3EPPA 4KG7A 1LV8A 1D4OA 1U0EA 4MUFA 1NKTA 3WDKA 2WSYB 5EMJA 1T9KA 1L7PA 2ZJ6A 4O8ZA 1CR2A 2BBTA 2W24A 2Q6OA 4HF7A 3IRVA 3HO1A 1LI7A 3D1JA 3IQXA 4GLJA 3CONA 2E1RA 3TLYA 4DSZA 1K5DA 4LRQA 2AL7A 2FVXA 3P2IA 4WCFA 3KOOA 3MWEB 1BX1A 3FYTA 4K81B 5FAKA 1KMMA 4O6VA 1ZR2A 4RTRA 1E7MA 1D3YA 2JVGA 4EUSA 1PD1A 1FSEA 1EZ1A 5BOXA 3UFXA 4E09A 4OK6A 1TYCA 3AV3A 5E4FA 4R9VA 4FYVA 4QO8A 3ZZ1A 3FHZA 4CQLA 4RMJA 1GNTA 2XUAA 4OXIA 2BRUC 3CUWA 4EJ2A 1VI2A 3LOCA 1F17A 3M5PA 4RDIA 5EHNA 1JUSA 3ZR4B 1ZRSA 2YWJA 3BXOA 3LX5A 3ZY6A 5KINB 2IH5A 1E1MA 2FE3A 1FSHA 1YZKA 1TF2A 1PJRA 2GA9A 3K4BA 1XRJA 2IPXA 3A1DA 3E8SA 1UBOS 3GJQA 5DVZA 5K8LA 3ER9A 3KP3A 1CJSA 3J7ZI 4LI3X 1YRBA 4FGJA 2HMUA 3U80A 1AY0A 4L9JA 3RS8A 1HLGA 3S7ZA 4BLUA 4DAOA 2JLUA 3T1YB 1S2DA 2D5LA 2E2WA 3D8HA 1D0IA 1U0SY 2ZT5A 3ONWA 4MTCA 5DTEA 2AK2A 3VODA 4QC2A 3TEMA 2Y27A 3O6BB 3W6JB 1U5BA 5DLQC 4U2BA 3U1BA 5K8UA 1MENA 1RAIA 3VC1A 1RPWA 1SVUA 2LP4Y 2Y1KA 1HFEL 2DFPA 3PX2A 2LIPA 3HNOA 4BJTA 4JB8A 3JRGA 4FFSA 3TRKA 5EL0A 3U7RA 2HNAA 2KHMA 2QU8A 2R11A 3CCJI 4AG5A 4DF3A 4DSOA 4YRIA 3ZGOA 3RAFC 4FXOA 3UJHA 5K0ZA 1XZCA 1ZN9A 1S7AA 4TSFD 4WY2A 3S2IA 3WWZA 1A71A 1ZSYA 1HH4A 1YCFA 3A1VA 3L41A 3QTLA 2PWBA 4D0RA 3WAGA 3QMWA 2NAPA 3VJLA 2WT9A 3V1KA 3DEWA 5EWMB 2PBLA 4YXWD 4M1ZA 5KEIA 2G3YA 4QULA 2BCEA 3ROQA 5HM6A 4L9WA 2CXXA 2QTGA 2W8BA 4YRMA 3QOEA 3Q2OA 2J6IA 1Y8AA 1BXGB 5JISA 5K20A 3SXUA 1CF7A 1GNVA 1U94A 3CURA 4PVDA 4YLEA 4HDSB 3V4RA 4DE5A 5F08A 1LY1A 2P8JA 3PXBA 4FHGA 2MCFA 3DMNA 3X1XA 3VR2D 3UANA 4KXWA 2IS1A 2WWFA 3HCNA 3RPEA 3LIPA 1P3JA 4QEZA 1D0ZA 3K0LA 3KZXA 1RMTA 2BOVA 1WETA 2JEOA 1EKXA 4M7PA 4KUHA 4ZOEA 2H48A 1OREA 2H1IA 3KTFA 3JD2A 5EMMA 2XRFA 3H3XA 2FD5A 3ZN2A 4CKYA 2WAOA 2P40A 2BGGA 1IQ0A 1EWVA 1PUIA 2WWGA 2ZR9A 5J1RA 3E1GA 2ZT6A 4UMEA 2XD9A 4KWIA 1P1HA 4BWVA 5JH7F 2XGJA 4GFBA 4M89A 5IVDA 4A0HA 4D9EA 4X85A 1COWD 3GLFB 4YUVA 2FZLA 1H2FA 2MYNA 1K8XB 4DMUB 2WHXA 2Q1YA 3GRKA 3H42B 3K94A 3VNAA 5TMPA 1RS0A 3GDGA 4I1IA 2FLKA 3DV2A 4UZFA 3PX3A 2AX4A 2DA1A 2I8CA 3Q41A 1M1YB 1Q12A 4NULA 5HJEA 2ZRKA 4HPJB 2G67A 4XOPA 2XRLA 4U2KA 5HFNA 2ODBA 1WLYA 3S93A 1M75A 3C7DB 4N49A 3RTDA 3DXXA 3VU0A 4YAOA 4Z51A 4MYSA 1K78B 4KIGA 1P0QA 3RPUD 1YITI 4ZEXA 4EPXA 3CEPB 4B6RA 4MIKA 2W2XA 2VRBA 3HXMA 2VXOA 1YBFA 5AW0A 1O1YA 1AUXA 2JN6A 2EZTA 2BJHA 2AMVA 3NONA 4U3JA 3CMCO 1YHNA 1YJBA 3MTBA 1VGRA 1BFUA 2PZLA 5LNK6 2AI2A 2H0RA 2VDNB 5DH9A 5A0FA 3KLBA 4QGHA 1CV2A 2P77A 3KCNA 3VQTA 1UG2A 5ENDA 1TT5A 4XVQA 3F6RA 4M3GA 4ESOA 3FBIB 1EDDA 5KYTA 1LDGA 2DFFA 4ZRDA 5DM70 3DLIA 4PICA 3ZBPA 4POOA 5BN4A 2O8EA 3L8DA 1K4KA 1K4YA 2CNKA 3V2GA 3W5DA 3J81Z 5F1JA 2ORIA 4UHFA 5EGSA 4Y7NJ 1MSEC 3FRHA 4JMPA 4I9HA 4QG7A 1E63A 5CJPA 3V33A 4GR9A 3WGKA 4AWXA 1CNFA 2XMSA 2CDNA 3QMPA 4CWAA 5COBA 2PJDA 2O1WA 3WG9A 4MS3A 4WI1A 4E5NA 2VONA 1EWYA 2N3ZA 2X9GA 3MTGA 5TMEA 2FSHA 4EVQA 1V5IA 4R40A 5H3HA 3G5MA 4C2AA 5JZMA 2J32A 5F9FA 2GNOA 2IW1A 4JH0A 1K2WA 4UBLA 3K8YA 4YMSA 1YCDA 2QM8A 3LNQA 1POGA 3NWEA 4YROA 5CUQA 1CY8A 1IUKA 2WIDA 3DDZX 4RFVA 3RJZA 1VQ5I 1GSIA 5T4HA 1EUQA 1QGUA 1X1SA 3LUGA 1B0ZA 1F0NA 3FN4A 3PFBA 4MW7A 3BE5A 4OSEA 3QOPA 2BFFB 1KIFA 3L4BA 2E21A 4FX2A 4ZEVA 5CLJA 1A6QA 3QEOA 5ED0A 4PFJA 1FIPA 3DEZA 2JGEA 1Q1HA 4EI9A 3IMFA 3E0XA 1BNCA 1ZHOA 2PZJA 2H1FA 2ZXEA 3KTAA 1JX6A 2EWNA 1E4VA 3EZ9A 1HSZA 4KW7A 1QZYA 4LWZA 4PW0A 1LVAA 4IUYA 3TIFA 3UHAA 4R1HA 1R5BA 4PGFA 2WHYA 1E61A 2PNFA 4L28A 4TZKA 4B3JA 5H82A 2Y6VA 1PI3A 1ZM9A 3DFMA 4QVGA 2QGNA 3EY4A 4EF5A 3EX7C 1PYGA 5HDBB 2ZKIA 2DA6A 2VCEA 3IVMA 2MA3A 2V74B 3A9SA 1V3QE 4KX5A 1Y33E 3BRCA 2ODAA 2LY9A 3Q85A 5BN3B 4LOJA 2DDBA 1XROA 5IAJA 1JR2A 5HDKA 1HOMA 1YB1A 4ZTJA 4H17A 1MORA 1NIJA 1T1GA 4DCPA 3HCAA 3QPSA 1HT3A 3CEJA 3OLCX 1VB3A 1VLQA 3H92A 1NAIA 2JANA 3KJXA 1SA0B 3EUAA 3KYCB 1P0CA 1Q7EA 2G40A 2PMCA 2V3WA 3HJBA 4H1VA 4P6VF 4RIEA 5AI4A 2G9UA 5TMBA 4YYEA 1DQZA 3A4NA 4NYIQ 1A96A 2FOXA 3W8EA 3OPYB 3TZ6A 4UTPA 2EJRA 2HKOA 1BR2A 2X5JO 2OU2A 3E82A 3BMXA 1PBTA 3I2KA 2P6OA 4A93J 1UDCA 2X3FA 3AJ8A 3JAWA 3GH1A 1BCRB 2EFNA 1KDZA 3M9AA 2HF7A 4NYJR 4OYLA 3RC9A 4EGFA 4ZI2A 1WWXA 4MV6A 1F0YA 1T6YA 2XV4S 2O20A 4JSRA 3DE6X 4CU2A 2M4KA 4K6OA 4DV2B 4RBOA 2HIAA 3IIEA 4X91A 5HR5A 4CPDA 2QRQA 3FWNA 3U9TA 5EEHA 1D8KA 5IDQA 4NABA 4BVKA 1V7CA 2XWBF 2AQIA 3K0BA 4RF5A 5CX1B 2PE5A 2HI0A 2CQNA 3IKTA 1CUWA 2G1KA 1IHUA 1KZ4A 1HNZB 1IZ1A 1NVMB 1YS9A 4ETIA 1N1DA 5EJ8A 5G4KB 2FKNA 2R9VA 5CLIA 5BT8A 3U1DA 3N8NA 1QCCA 1TL8A 4MV3A 1UK6A 2H8GA 1TZCA 4WLFA 2Q8QA 4AUKA 3NWPA 3ND7A 1M76A 1QCYA 1DKOA 1TLLA 2WOOA 2ZTLA 4GOOD 2ZQZA 4LJ7A 4F86A 2A1IA 2ZJ3A 3ES9A 3WKBA 2XB2A 1FNMA 2L69A 5DT9A 4XVUA 3FLEA 3G1UA 4MUJA 1E7WA 1BN5A 421PA 2HYGD 5J2UF 2NSHA 4IOAF 1ZJWA 1KO5A 1P33A 2DFDA 2GT1A 3GVXA 4L8LA 3DEAA 2AQHA 5KTPA 4QBIA 2UYHA 3AR8A 4IIJF 4HWOA 3PVCA 5EXSA 3UAGA 3IQGX 4HGRA 3G89A 4HNTA 4QL3A 3S2FA 3IPCA 3C4QA 4LZAA 3WV5A 3FYSA 2VHVA 5H2FC 3B5IA 3CR8A 4NOKA 4BZPA 4L9TA 3I3SR 4Y2YA 1MO6A 5MN4A 1TUGA 1WXWA 1E32A 2ID9A 2DX7A 2PT5A 3PXEA 3F8FA 4GGOA 1KOFA 2AQKA 3TCKA 4CM9D 2BUCA 1NJFA 2HA7A 2Q9CA 2BTEA 2JIZD 3OLYA 3PCTA 4K6GA 5ALOA 5M34A 4DCJA 4LXXA 4Q9LA 1WWKA 2J5PA 2AZ4A 1EPUA 4F0JA 2O2JA 3NBKA 4TYYA 2YOHA 3H2JA 5IN5A 2IJLA 2A0YA 2IUSA 1B6AA 2IW5A 4HN2A 4DC9A 1HEYA 4X66B 2Q62A 2FMLA 2GZWA 2VI6A 3BT7A 2H6CA 3TLMA 1YQQA 1P18A 4BX2A 1VZ2A 1GZ7A 2Q21A 4I55A 4ME6A 4NENA 2A5DA 3I23A 1TEXA 3PF9A 4EQ6A 5BNFA 4JD5A 4EO4A 1CEQA 5CQGA 4DA6A 1NYLA 4BFYA 3X3HA 3HBFA 2ZJOA 1X2NA 3Q1KA 1JKRC 1DOAA 1NP3A 1IBMB 2A9JA 2WA1A 4MQFA 3S81A 3O8BA 4CMKA 2KKOA 2APJA 1SCAA 3H0CA 3ZEAA 4HQOA 2NOGA 3T1BA 4LHZA 2WAYA 1D9XA 3L9XA 3BZBA 4CVNA 1JP7A 3EZFA 3SR0A 4A0QA 2FPMA 3OPVA 3JQBC 1DC4A 1RI7A 3PQCA 2DT7B 5F1PA 5FBQB 1ISMA 3MMZA 4CKZA 5LD2C 1U2EA 3Q3JB 3Q98A 1OI4A 2XRMA 2KZVA 4KUEA 1OYYA 3IEIA 2IV3A 1QH8B 4XKVA 1W8IA 5BSMA 1GPH1 5IF3A 1VI6A 2F48A 5EWLA 4JOBA 1ODSA 1MEEA 1YJXA 3GG9A 3KXDA 3L1VA 1NDUA 4XWAA 1TC3C 5G1OA 1WOMA 5GTDA 4D02A 2TCTA 4H4CA 3K6SA 3C5EA 1E1LA 1RIFA 1OIXA 5GPCA 2YV4A 3TW0A 4OHPA 1CJCA 1U90A 1C8LA 3ORYA 1PTJA 4IYRA 1KEUA 1MMAA 3I4NJ 1WCWA 1YDWA 4XLHA 2C1EA 2UVQA 3EWAA 4JSTA 4KKVA 5J3LA 2QENA 4ACBA 3ZQGA 4DXHA 3LL4A 1PWZA 1SUSA 4I3FA 1EDOA 1U8YA 1UZUA 1HY3A 2E4YA 4MV5A 4JI4B 4ARZB 2WTMA 3E9CA 3SZRA 4V2UA 3OQIB 1Y98A 3L7NA 2GRJA 2IPOA 3PEYA 2FXAA 1FSSA 1ZHHA 4GVXA 4DSTA 5AVUA 5G02A 3R3YA 2W9XA 1B74A 1SCQA 2FWAA 4OAPA 1DPFA 4P4NA 4V0QA 3RRZA 4E2FA 2VIXA 1B26A 2HQSA 3GAFA 3N3BC 1MG0A 2IZ5A 3QBJA 5NULA 1VKZA 1SXJA 2WYIA 3JQ8A 2CFXA 1P1IA 2BPOA 4IV0A 4NBWA 1ATZA 1LPSA 1N6OA 4PLWA 3SFTA 4BUJA 4KLRA 4LW8A 4MRVA 4GU5A 3W6UA 3FCXA 4EJOA 2H2WA 1MZVA 5EUQB 3ZJ5A 4CLHA 2EG9A 1DP4A 1L4EA 4U02A 4NARA 4CH7A 5TJJA 1KP2A 3WP1B 1GGVA 1T9BA 4M71A 3AI3A 5T7BA 3CY6A 3WBJA 4ZDJA 3Q6IA 4FFRA 2IXGA 5CFPA 4AO8A 1CY2A 2OZUA 2JK0A 4IQJA 2Y77A 4HEQA 1UT5A 1LRJA 4QU5A 3SKXA 3BZ6A 1U5TB 3MHTA 1K68A 2O57A 1NSTA 2PL3A 3W79A 1Q1GA 3OVMA 4IXWA 1WOYA 4CEHB 5JSYA 1YK0A 5K0NA 4EARA 5B57C 2W6JD 5JQWA 3DD1A 4G1CA 4GIBA 4X92A 4KV7A 3BRQA 3I6MA 6PAXA 1G6Q1 3FVVA <