4IHTA

Crystal structure of benm_dbd/bena site 1 dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator BenM
publication title The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
pubmed doi rcsb
source organism Acinetobacter sp.
total genus 34
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ihtA00
2P6TA 5JR3A 1IXSB 3HIFA 3O6BB 3ABUA 4ZZLA 1I1SA 1YW9A 2VC1A 1BI0A 3IC7A 3ERED 1BM9A 5CJ9A 3WODF 2WWYA 2FU4A 2V1XA 2XIGA 3CLOA 2FF4A 2EA4A 3FXQA 1P92A 4L9JA 4KMUX 1J7KA 2EFOA 4EMSA 2VC0A 3TGNA 2FEZA 5E1XA 3CDHA 3GW2A 4HX7A 1RUNA 3G3ZA 3FF5A 1KA8A 5BQTA 2ZNYA 3R61A 1B9NA 1ZGAA 1FP2A 2FXAA 2OAZA 4LLLA 2BGCA 5CYVA 2ZMEB 3OV8A 4CICA 2L01A 1IN6A 3MFKA 3M8EA 2ZCWA 3HRSA 3T1BA 3HSFA 4L5JA 1GXQA 1B59A 2O03A 4RGSA 2Z99A 5H6RA 3FMSA 5LEJA 2VXZA 3BJOA 1ZG1A 3J81Z 1ON1A 2GIVA 4P9FA 1K79A 2H27A 2FQ3A 2RV8A 1YO5C 3CO7C 1FSHA 3P7NA 4EQQA 3ISPA 2HYGD 5D5UB 1ZGJA 5E8GA 2IW5A 1I27A 3KEQA 5ICFA 4LB6B 1HSTA 4BYYA 3GUDA 4PGGA 2FNPA 5DEQA 1I1GA 4XSZF 1TW2A 5HLIA 3DKWA 5HS7A 4HZFA 2CW0F 3ECOA 4BHBA 3FXUA 2R7DA 4EM2A 4YFNF 3RKXA 2ACJA 2RKHA 2PI0A 3BJAA 3P9CA 3I59A 3ZN0A 1S8NA 2A6HF 1Q1HA 1XGNA 3LWFA 2NRAC 1U8RA 4NHJA 4CZZA 1T2KA 1ON2A 4PZJA 2XRNA 4OIRF 2E7WA 2ETHA 4MEXF 3Q9VA 4JK1X 3J81K 2IP2A 4EJUA 4U0VA 4HOBA 3WTZA 3F8CA 2H09A 4ENKA 3BY6A 2GXGA 3SQNA 3RKYA 4EM0B 3W6JB 2PG4A 2W57A 1YG2A 3HHHA 3ELKA 5D8LB 3DXJF 1EH7A 1O7FA 2F5FA 3JW4A 4OOIA 4JQFA 2IPQX 2UZKA 3MCZA 3SXYA 4IRHA 3WE3A 2XVCA 1EH8A 2OZUA 3BZ6A 3FM5A 1EH6A 4ZYHA 2G9WA 4RAZA 2M30A 4ENMA 3LA2A 1IUYA 3KE2A 2Y0MA 5LBQA 1XSXA 4L9TA 2QBYA 2IA2A 3L9FA 4HF1A 2MD5A 2NNNA 2CWEA 1FWZA 1TNTA 1GHCA 4HW0A 3F23A 2GXBA 2EJRA 4WWCA 3HUGA 1FT9A 1CGPA 2XAJA 4IJAA 1Z91A 3T5XA 1QGPA 1J2XA 4WF2A 4PCQA 1YLFA 3GF2A 2IRFG 1FYMA 1ZARA 4HF2A 1YFHA 2XAFA 2RVCA 1R1TA 2OQGA 4MQ9F 1QNTA 1XMKA 4N0BA 3GFLA 1DPRA 4ESBA 2PJPA 5ILUA 1J0RA 3QOPA 4NQWA 1SMYF 3DQVC 3O3KA 2HKOA 3F8NA 4MTEA 4Y17A 4LJZF 4AIJA 4AWXB 3J80Z 2FNAA 3ML6A 2W25A 3GEZA 4UVCA 4S05A 3JTGA 2UWMA 1S7OA 1FLIA 2JPCA 2ISZA 2G7UA 4OU0A 3WU0A 1TW3A 1S6LA 4G7OF 1KQ0A 2JSCA 1U2WA 1E17A 2AXLA 5ICGA 5FFXA 3WTWC 3V8JA 3ZMUA 5LEKA 4P5OA 1XDSA 2DPUA 4IHSA 1OMIA 5DD4A 1QZZA 2K86A 4AIKA 4MEYF 2F5DA 5JHUA 1P6RA 2OU2A 4KIBA 1K78A 3HTSB 2NYXA 3LAJA 2VBWA 3GZ6A 2KIMA 2HTSA 5ICCA 3RYPA 5BS6A 3GLXA 3FHZA 4AD9A 1QQIA 1DP7P 1J9IA 5HLGA 1XB4A 3LFKA 1LDKB 2WTEA 5HDGA 2W24A 4ESFA 4GXOA 3H92A 2KIFA 3DFGA 2FSWA 2VT2A 1W7PB 3REOA 3MWMA 1S29A 3N97A 1YW7A 1BC8C 1SD4A 4RGRA 2OBPA 1WKMA 5CVRA 2COMA 2W85A 2BV6A 1ZG3A 2ESHA 3DV8A 1P4XA 3K9TA 3M9AA 4GGGA 4XRFA 4HA8A 2FBKA 1SFXA 2YX7A 2CYYA 1IRFA 5TRDA 3C3WA 5JI6A 4BXUA 5E18F 1ZN2A 4BAYA 1CF7B 1JXSA 3KP7A 2Z33A 3TQNA 4D0PA 2DT5A 3EETA 4A0YA 1K7AA 3GFIA 2UXXA 5IT9Z 3NEUA 4O6JA 5CVIA 3TOAA 2QLZA 1FZPB 1U78A 2STWA 3LAPA 3E5UA 2GAUA 3IKTA 1SD6A 4IVNA 1MDMB 1ZRCA 4UV9A 1ONVA 4HQMA 3B02A 3LQQA 3ROUA 2P6SA 3L00A 1H0MA 4HV6A 1DPUA 3F6VA 1FSEA 4LMYA 4LK1F 2XAGA 4RGXA 1O3QA 2VODA 1HW1A 2KJCA 2VONA 1Z6RA 2O6GE 3WU1B 2LKPA 3FX3A 1X3UA 4MGRA 5LGNA 5DV5A 5HOOA 3L09A 4G7HF 3I0TA 5JVTA 2K7LA 2Q2EA 3MZHA 2D1VA 3HOSA 1PP7U 2CO5A 3KP2A 2EV6A 5D8KB 3QU3A 2ESNA 1EV7A 4AIHA 1XMAA 1REPC 4M74A 2MBFA 5D6FA 1HW5A 4HLXA 2G7HA 4ON0A 4M6YA 3QP5A 5J6XA 4LGWA 2HEOA 2DBBA 1FNNA 2QZ8A 2DK8A 3OOPA 5HS8A 1TBXA 2RGVA 1WWXA 4KFCA 1ZREA 2VN2A 4KYWA 1SFEA 2FRHA 2E1NA 1IXCA 4YIFA 3KETA 3V7SA 1UFMA 2RN7A 4RB1A 4IHTA 3DEUA 2QYOA 1U3EM 3ZPLA 5IT3A 2HS5A 2IJLA 4KDPA 1LJ9A 2LF7A 3RKWA 4I0AA 2RQPA 5D4SA 3U1DA 3E5XA 3ZP5A 3HOTA 1RIOH 1D5VA 4RGUA 2LSOA 3C7JA 4HDUA 1ZAOA 2Z5UA 5D6EA 5FLXZ 2J5OA 1PUEE 4CGZA 2PFBA 2QM3A 2LNBA 2VOPA 1H9TA 2QVOA 1IW7F 4WXCA 1KGSA 1LVAA 3ULQB 3IRQA 3E6CC 2HQNA 1G3WA 5L3BA 1KU9A 3K0LA 4LLNA 3K2ZA 2P5VA 1YW8A 2HGCA 2CGPA 2P5KA 3NRVA 1MD0A 1T98A 3WTYC 3KZYA 1B4AA 2YX4A 5DCMA 5DCFA 2L4AA 4LFUA 3VFZA 3DPTA 3BPVA 5E17F 1U5TC 4R8HA 2CQKA 1YYVA 2HKXA 2IA0A 4IRGA 3I54A 4CHUA 3VEPA 4HLYA 4ZH4F 2CG4A 4XLPF 4CDGA 3QRFF 5HLHA 2QQAA 3W6KB 4MTDA 3F8BA 4ENJA 2M5WA 5F1RA 4OIOF 1ZYRF 1JE8A 2A69F 3T8RA 2LDUA 5FLXK 2KJBA 4GCVA 5FB2A 1O3TA 3WGGA 2EB7A 2X0LA 2HZTA 4M73A 5BPIA 4ENNA 3F8MA 2PBIA 4EGYA 1LEAA 2V6CA 5J8CA 3P9IA 3HRUA 1IF1A 2L54A 1A04A 1FY7A 4A2UA 4HAMA 2JRTA 1LDDA 3I5UA 2XGXA 3E97A 3EUHA 1KYZA 1R58A 5DD8A 4EM1A 1G3SA 4LG0B 2QUFA 4HBLA 2IT0A 4WX9A 2O0YA 1L0OC 5LHIA 3BWGA 3EYYA 3RJPA 3HYIA 2Y48A 2P8TA 2L02A 2VBXA 1BI2A 2F5CA 2K4JA 2PEXA 4ETSA 4EJTA 4I98B 2XAQA 2PQ8A 2ZMEA 2VE9A 3FXRA 1SAXA 3H3ZA 4TV7A 3S2WA 5FD6A 1AOYA 4XBFA 2RDPA 4G94A 2B0LA 5A2QZ 1B1BA 3ECHA 1IRGA 1SMTA 5ED4A 1O3SA 3WGHA 3HTUA 3ZMSA 4M9XA 2QENA 1J75A 3VOEA 1F4KA 4KNYA 3GXOA 5L3DA 2RC4A 3V8LA 2HDCA 1R23A 3TOBA 2EV5A 4QLCU 3WTUC 2Q0OA 4LD5A 3WTSC 1XD7A 1SFUA 3RI4A 4HX4A 2L3DA 1FBUA 3ZN1A 3F21A 3FZVA 4E70A 4Q5SF 2HWVA 4RAYA 3EQLF 3F8FA 1KYWA 1UHWA 4LK0F 3K1MA 3RDIA 1WRJA 1R5HA 4L18B 3KP5A 2OD5A 1H9GA 1W7PD 1QPMA 3RPQA 4ZYGA 1WI9A 2ZKZA 3FMRA 5K5RA 1PP8F 3M8FA 1D3YA 4GO1A 4EV0A 2JPBA 2ISYA 1V4RA 4YIIA 5A2QK 4LG0A 5TJJA 1I5ZA 3SZTA 2XKPA 5F64A 2R7FA 4BHPA 1HQCA 3IRRA 1RUOA 1TQIA 4RB0A 1D8JA 3BDDA 4R1HA 4U0WA 3SFZA 1I6XA 3BP8A 2EFWA 2EFPA 4BNCA 2VBYA 1MZBA 3GFMA 2HOEA 2H6CA 4FT8A 3LA3A 4R79A 5L3FA 1OR7A 1QO0D 3EDPA 4DNCA 5KK1A 3TDUC 3FMQA 2K02A 3JTHA 1LNWA 4RS8A 3R0JA 3CUQB 3CUQC 2XKOA 5AIQA 5F6FA 3KEOA 2JT1A 3N4MA 2XASA 2BE5F 2QQBA 1BN5A 2MA3A 2F2EA 2M45A 2BEOA 2V1UA 3LSTA 4L0YB 3BROA 5BOXA 2QQ9A 1Z1DA 2XUBA 3Q9SA 3T0YA 5D4RA 2FE3A 5FGMA 1YS7A 4BH9A 4WK8F 2KKOA 2CFXA 2DAOA 3COAC 4RB2C 1FP1D 4EVIA 4YFXF 2DQLA 3J80K 3F22A 4IF4A 4ESJA 2D1HA 1G3TA 2EWNA 4Q4ZF 5KVRA 3IL2A 1J5YA 3WTXC 4O3MA 3ZQ7A 1YS6A 4M71A 5E1ZB 1FYLA 4WXHA 1HBXG 4P55A 1ZLJA 5FO5A 2LF8A 4KN7X 3HRTA 1XGMA 2RNJA 5LLQA 2HR3A 5L3GA 2NS0A 2A3SA 1HKTA 4UHTA 4ASNA 1G6NA 3LQRA 1BC7C 1OYWA 3G73A 1F9NA 4U7BA 1TNSA 4IXAA 2UXNA 3ABTA 2WV0A 5ERIA 1R1UA 1T38A 2YSRA 3E6BA 1WQ2A 1R5GA 4M6XA 2FBIA 5E8IA 2VBZA 4NB5A 3KP3A 1S3JA 4HV5A 4PDKA 1BBYA 4EJVA 4JBAA 5CLSA 4YFKF 1HW2A 3NQOA 1VTNC 3JAMZ 6PAXA 2P7CB 1DDNA 1RZ4A 4HF0A 2W84A 3RTRA 2ZNZA 3O2PE 5ICEA 4WCGA 5E20A 3KLOA 1WSUA 2DFIA 1KQ8A 1FOKA 2K4BA 2M1BA 4ZYDA 4UVAA 1MJ9A 1KU7A 3E6MA 3QPTA 3F72A 3RIRA 1G4DA 1W7PA 1O57A 1W5TA 2MH2A 3SZPA 3Q5FA 4G6QA 2FOKA 1MJBA 5IT9K 2ELHA 2A61A 4MNUA 4FX4A 2BYVE 2Z3YA 1FC3A 1XSDA 4F7ZA 2EFQA 1Z05A 2MLKA 5BMZA 1ZHFA 5D5WB 1OYIA 1PDNC 5HDNA 3BPXA 2DU9A 5EEHA 5LHGA 2NNYA 1YIOA 4B8XA 1W4MA 4MHGA 4UXNA 1D8KA 3IHUA 1P4AA 3LA7A 5K1YA 4KT5C 1CF7A 1XGOA 4A5NA 1BOAA 1ZLKA 4L0ZB 1SD5A 4UUVA 1ULYA 1OPCA 4A6DA 3JAMK 1P4WA 3PQJA 4OINF 4U7DA 2HTJA 1C0WA 3HHGA 3L7WA 4I2OA 3I59B 3RYRA 1J59A 2FMLA 2YPRA 4U0YA 2P7VB 2C6YA 3KFWX 5H6QA 2A07F 3TDZC 2STTA 3R4KA 4I02A 3MQ0A 3WGIA 1MDMA 3VODA 3D0SA 2EK5A 1Z9CA 1B6AA 3GWZA 3QPHA 1F1ZA 4IRIA 3TO9A 2X4HA 2MC3A 1OKRA 3JSOA 3DPLC 1HKSA 2NAZA 2ZJ2A 4Y15A 1R1VA 3U9GA 2JTVA 5CVVA 1R7JA 3R0AA 1OYYA 1QZYA 3U2RA 4GYGA 3C18A 3VB2A 1T0FA 2Y75A 3K1NA 1U5TB 5D5XB 1LEBA 1IZ1A 4EJOA 2ZBKA 4IPAA 1SD7A 1U6GA 1UB9A 3GVAA 2XHKA 1ZG5A 1YTYA 3QP6A 4A12A 2TDXA 3WTTC 3AAFA 3MAJA 4G6DA 2QBYB 2GQQA 1V3FA 4LB5A 3V8KA 1RNLA 4KN4X 1UCRA 3GYHX 4WXDA 2A6EF 2YU3A 3P9KA 4N9IA 1IN4A 4M72A 3ZMVA 1R22A 2R3SA 1R00A 1IN5A 1TLHB 4I01A 5LGTA 2PLYA 2A68F 4O5VA 1Z6TA 2HYFA 3CUOA 4Z2YA 4A0ZA 2OZ6A 2M87A 4Y13A 3V7RA 2PN6A 2IVMA 2D45A 5H20A 1O7LA 3GO5A 2QWWA 3V4GA 4KIGA 4MQVA 1GXPA 4CO8A 4DQ2A 2DW4A 3HSEA 2PMUA 4KIFA 4I09A 3PFIA 1BIBA 3CO6C 1K6OA 1B9MA 3ZMTA 5LGUA 3TO6A 4KMFA 2GWRA 2M8EA 2VT3A 2XV4S 4A5MA 3E3VA 1KU2A 1E2XA 1T6SA 3BOQA 3I4PA 1KU3A 3PQKA 2ZO4A 3IWFA 4G9YA 3WG9A 3B73A 1YQAA 4L9NA 4M9ZA 1K78B 1S7AA 4I0BA 3D5LA 1U5TA 4HDVA 1FX7A 2P4WA 1STZA 4P9UA 1USSA 4UNOA 5K5OA 1HXDA 3KP4A 4OMZA 5FFZA 2XAHA 4H0EA 2GZWA 3TO7A 1BJAA 1KQ9A 2Z9OA 3RPUA 2OA4A 2ZXJA 2VOOA 1DUXC 4B09A 3C1DA 3KLNA 4YG2F 4HYEA 3FM3A 3E6DA 2V9VA 1XSVA 3V7CA 2WC2A 2O8XA 4G8XA 5JFRA 1NHAA 1TQMA 3GFJA 3ZMZA 1IXRC 2KIUA 5DUIA 2O61A 1XGSA 3FWEA 3JSPA 1JHHA 4K2EA 3E5QA 3HRMA 1IN7A 3H3UA 4AVPA 2DTRA 1LQ1A 2XROA 2E1CA 3QAHA 4N9HA 2Q8KA 2EV0A 2GA2A 1JHFA 5K5QA 2MH9A 4FHTA 4RB3C 1TQPA 2FMYA 4OMYA 4P96A 3TKYA 2H6BA 1FYKA 2V79A 4KUMA 3IWZA 4EGZA 3R60A 1W5SA 1LDJA 4I7HA 2MLGA 3QU6A 3J7AO 3DF8A 3K69A 2J5PA 5LRSA 5DYMA 3KCCA 3IKVA 5DDGA 2DPDA 2GA1A 3I71A 1MGTA 4L9VA 4KA4A 1TTYA 2CSOA 5E1WA 4S04A 3F3XA 2AS5F 2O3FA 1RI7A 4XLNF 2F5EA 2E7XA 1LB2A 1HSJA 2FA5A 1FPQA 1F5TA 3CTAA 2BBYA 4Q48A 3MZYA 2L4MA 1XDUA 5ILSA 4CYDA 2ADUA 2D2WA 5DUKA 1Z7UA 3GX4X 4OIQF 1BI1A 2A5YB 4M9SA 3WE2A 2FBHA 2OQRA 2EFNA 2V1DA 1MKMA 5AIPA 2ZFWA 3HSRA 2VE8A 2JZYA 3M1EA 1ZRFA 3T8TA 3KZZA 3EYIA 2DI3A 3CJNA 1MJAA 4Q47A 4EJWA 2DLLA 3M7GA 5J8FA 4HQEA 5BPDA 3R6SA 1FBQA 5CVJA 4KICA 4U88A 4ZZDA 4UV8A 1ZRDA 1O3RA 4ZYEA 5L3EA 3F6OA 2DK5A 5L3CA 1AWCA 4UVBA 1QBJA 3I64A 5D5VB 2K27A 3DP7A 1XCVA 2DO7A 5LHHA 2IA1A 1IN8A 1FBSA 3BJ6A 5FD5A 3L2CA 4BHCA 1L3LA 2HQRA 1UHMA 3MEXA 2P5LC 3CUQA 4CXFA 3I58A 1G3YA 2EA2A 4HX8A 1IAWA 3KP6A 5HVQC 1BI3A 5LRRA 4LLGF 3SHFA 5CVUA 2DQRA 4OIPF 1HKQA 2H94A 1R36A 1GVJA 1T39A 1XN7A 4L5IA 1JGSA 4G7ZF 5HDKA 5AONA 4PGHA 4A0XA 3ZMDA 3GZ5A 1ODDA 5DCMB 3K1PA 2KRFA 1P2FA 5EEGA 4A6EA 1XCBA 1Y0UA 4BQAA 2HFHA 4FX0A 3WTVC 1ZH5A 4XSXF 5ILVA 4QWQA 4GYIA 2PMHA 1USTA 3I53A 2YR2A 1BIAA 5HS9A
chains in the Genus database with same CATH superfamily
4F52A 2P6TA 3HOYJ 3S16J 5JR3A 1YHQI 1IXSB 3HIFA 1WZ2A 1KONA 4HRIA 3O6BB 1WJDA 3DCFA 1MBHA 2XPUA 3ABUA 4ZZLA 5FLVA 4BACA 1OCPA 1I1SA 2L7MP 3G71I 2WY7Q 2HDDA 3A1YA 4S0HB 1YW9A 2VC1A 1BI0A 3IC7A 3ERED 1BM9A 5CJ9A 3LSGA 3WODF 1OCCH 4ZYAA 3FHNA 2LY1A 4FISA 1D1AA 2WWYA 2H8RA 5CQGA 2FU4A 2V1XA 2XIGA 4BEHB 3SJMA 1RR8C 3CLOA 2FF4A 2QKLB 2EA4A 1P7JA 3FXQA 1P92A 4L9JA 2X1EA 2JQ7A 3EUHC 4KMUX 4BE2A 1J7KA 2LKXA 2EFOA 2Y0SA 2KZVA 4EMSA 3ZGKA 4A3KJ 3ABMH 2R0QC 5EF6A 3L2UA 2VC0A 3JCUC 3TGNA 1A31A 3HOXJ 2KP6A 3G6EI 2FEZA 3X2QH 3VYRB 5E1XA 5CQEA 3CDHA 3GW2A 4HX7A 4OAZA 1RUNA 1B8IA 1VQ8I 1JUPA 3G3ZA 3FF5A 3W3CA 1KA8A 5BQTA 3HB9A 2ZNYA 1IO2A 1T56A 2LFBA 2XF7A 3R61A 1B9NA 5KCMA 1ZGAA 1FP2A 3S93A 2FXAA 1GLNA 1AKHB 4I99C 2OAZA 1G8XA 4LLLA 1P7IA 4CA0A 1T33A 2BGCA 4BXFA 2B63J 2IGMA 2L0KA 3I4MJ 5CYVA 2ZMEB 3E7LA 3OV8A 3BG5A 2AXTC 4CICA 3S14J 2R5ZB 1GVDA 1Z3XA 2L01A 1IN6A 1TC3C 3ABKH 3ZOBA 5HODA 3MFKA 3MZ8A 3M8EA 2W4SA 2ZCWA 1AA7A 3HRSA 1BOBA 3M4OJ 2W1OA 3HSFA 2DMPA 3T1BA 5GPAA 2HYJA 4L5JA 5FKNA 2KDOA 5GADJ 2MW8A 1GXQA 1R6RA 2DDAA 1B59A 2O03A 1IG7A 4RGSA 2Z99A 5GAGJ 5H6RA 3FMSA 5LEJA 2VXZA 3BJOA 3OYGA 1ZG1A 3KX2A 2M7AA 3J81Z 3L1PA 1YJNI 1ON1A 2E34A 2GIVA 4P9FA 1K79A 2H27A 2FQ3A 2F4IA 2RV8A 1YO5C 3CESA 1YRNB 2ZXWH 3CO7C 1FSHA 3P7NA 4EQQA 3ISPA 4X1EA 2HYGD 2AHQA 5D5UB 4RBOA 4BJ6C 2JA7J 1ZGJA 1Z21A 1Y8QB 5E8GA 2O5RA 4CCMA 3SEZA 3FISA 2IW5A 3ASOH 2Y0SN 1I27A 4UY8I 3KEQA 3CP2A 5ICFA 4LB6B 1HSTA 2K9MA 2MC4A 4BYYA 1FTZA 5GP9A 3GUDA 5B1AH 4PGGA 2FNPA 3C2BA 1OCOH 5DEQA 1R49A 2GIZA 4OAYA 3AL0B 3AL0C 1I1GA 1WJCA 3CCYA 4XSZF 1TW2A 3FXJA 5E3NA 5HLIA 2JA8J 3IAM2 3DKWA 5HS7A 4HZFA 4LIVA 3M1CA 2CW0F 2JUGA 3K4KA 1IRXA 1OFCX 2ZFUA 4Y52J 3ECOA 3BG7A 4BHBA 1FOYA 3FXUA 4II3A 1XX5A 4M3EA 4NQWB 3GTLJ 2R7DA 4EM2A 4YFNF 3RKXA 2ACJA 4G6TB 2DMQA 2Q1ZB 2RKHA 2PI0A 3BJAA 1OJLA 5J3LA 3P9CA 4DZJA 3I59A 1VQLI 2OPTA 3ZN0A 4BS9A 4UUSB 1S8NA 3OYFA 1PJRA 1S7EA 1Q1HA 2A6HF 3NWSA 2NVQJ 1XGNA 3LWFA 4V2FA 2WY8Q 1K4TA 3GTOJ 2NRAC 1U8RA 2VJ4A 4NHJA 2X85A 4CZZA 2ELJA 1T2KA 5IYDJ 1JJ6C 1ON2A 3QYBA 3G1OA 3OR1C 1ETKA 1VFCA 4Y33A 1ZK8A 2XRNA 4PZJA 4PK4A 4OIRF 2E7WA 2ETHA 2OV7A 1ETXA 4MEXF 2H1KA 3H5AA 4J01A 3FDYA 3Q9VA 1SVOA 1JUMA 4JK1X 3J81K 2R7OA 2IS6A 2IP2A 5IP6A 4EJUA 4U0VA 4HOBA 3WTZA 3F8CA 2H09A 1X1AA 1RESA 1I39A 4ENKA 2JA2A 3BY6A 2GXGA 3SQNA 3RKYA 4B44A 2BY0A 2N8GA 4EM0B 3W6JB 1OR7C 1VQNI 1WJFA 2PG4A 1BR4A 2W57A 1YG2A 2XPWA 3HHHA 2GOMA 3ELKA 5D8LB 1EJ9A 3DXJF 2M34A 2X6WA 2IS2A 1EH7A 1O7FA 1F36A 1ETYA 5J4VA 2F5FA 2R5ZA 3JW4A 3MKLA 2HPMA 1Y0NA 1JJ8C 4OOIA 1A35A 1X4PA 1FMVA 2Y9YA 2M9HA 4JQFA 2BVMA 2IPQX 2UZKA 3MCZA 3SXYA 4IRHA 3WE3A 2XVCA 1EH8A 2OZUA 4B47A 4Y7NJ 2VPRA 3BZ6A 2KISA 2XGEA 3FM5A 1EH6A 4ZYHA 3CD6I 2VPLA 2G9WA 4RAZA 2M30A 5EDNA 1MNEA 3LA2A 4ENMA 1IUYA 3KE2A 1B72A 2Y0MA 5LBQA 1XSXA 4C2MJ 1ETVA 1FIPA 4L9TA 2ZJQF 2QBYA 2IA2A 3L9FA 4HF1A 2MD5A 2NNNA 4XOTA 1D0ZA 2R4GA 2CWEA 3MKZA 1RC9A 4HSRA 3VWBA 1FWZA 1A6QA 1TNTA 2DA5A 2EBIA 3G4SI 1GHCA 4HW0A 3F23A 1JTYA 4GRIA 2GXBA 2EJRA 4WWCA 3HUGA 4XRMA 2HU9A 1MSEC 1FT9A 1CGPA 1G2HA 2BY3A 2XAJA 4IJAA 1Z91A 3T5XA 4X0GA 1QGPA 2K85A 1J2XA 4WF2A 1BR1A 1XPXA 1VZ0A 1J09A 2NS8A 4PCQA 2E2HJ 4C3HJ 1YLFA 3GF2A 3CCMI 2LTPA 1RKTA 1FYMA 2IRFG 4D5CA 1ZARA 2NVYJ 4HF2A 1YFHA 2XAFA 2RVCA 1R1TA 2OQGA 4H4KC 4MQ9F 1QNTA 1XMKA 4XLEA 4N0BA 5E3LA 2B9SA 3GFLA 1DPRA 4ESBA 2PJPA 3PO2J 4HSTA 5ILUA 1J0RA 2KHMA 3HPHA 3QOPA 4NQWA 1SMYF 3HOVJ 3DQVC 5GAHJ 4IX7A 5CPRB 3S1NJ 3O3KA 2HKOA 3F8NA 4JYKA 4MTEA 4Y17A 4LJZF 3PO3J 4AIJA 1EKEA 4AWXB 3J80Z 2BOLA 4F55A 3TP3A 2FNAA 2K9SA 3BCAA 3WG7H 3ML6A 2W25A 3GEZA 3DEEA 4UVCA 1W0UA 3CMAI 3BR5A 2QGUA 1OQYA 4S05A 2TCTA 3HGGA 3JTGA 2UWMA 1S7OA 2K40A 1FLIA 2JPCA 1I3QJ 2ISZA 2G7UA 4OU0A 3WU0A 1TW3A 2R7WA 1S6LA 3BR0A 4G7OF 1KQ0A 2JSCA 1U2WA 2KIQA 1U8BA 3RQ4A 9ANTA 1E17A 2AXLA 5ICGA 2DOFA 5FFXA 3WTWC 2D5VA 3BR2A 5FJ8J 3V8JA 3ZMUA 2BXYA 1TP4A 2LH9A 5LEKA 2DA3A 4P5OA 1XDSA 3GLLA 2FQ4A 2DPUA 4IHSA 1OMIA 5DD4A 1QZZA 2PJRA 2K86A 4AIKA 4MEYF 1K6YA 2F5DA 5JHUA 3CF2A 1P6RA 3JRBA 4V2GA 2OU2A 4EATA 4KIBA 1K78A 3HTSB 2NYXA 3ZQHA 3LAJA 5FKKA 2VBWA 2DMTA 3B6AA 4RAFA 3K4JA 2ID3A 2KIMA 3GZ6A 2HTSA 2QA4I 4BE0A 3IH2A 1MBEA 5ICCA 1MH3A 3RYPA 4BGDA 4PJJA 4DIQA 5BS6A 3OYCA 3GLXA 3FHZA 4AD9A 1QQIA 1DP7P 1J9IA 2CV1A 5HLGA 2P0WA 1TT0A 2QSFX 4QIWN 3IH4A 3S1MJ 4HPQA 1XB4A 3AG1H 3LSIA 1Q1VA 2VIXA 3LFKA 2V26A 3MVPA 1LDKB 1MBGA 2VKDA 2GOXB 2WTEA 5HDGA 2W24A 4ESFA 3W2AA 2HDWA 4GXOA 5FLMJ 5IYBJ 3H92A 4XOPA 2KIFA 3DFGA 1VNDA 2FSWA 3MD2A 1MH4A 1BJZA 2VT2A 1W36D 2JWTA 1W7PB 3REOA 3MWMA 1S29A 3K4NA 3NWTA 3N97A 1YW7A 5E3OA 1YJ9I 1ETQA 1BC8C 1SD4A 1HDPA 1JKQC 1I6HJ 4RGRA 4BJTA 1MMDA 3F0CA 4N4NB 2E71A 2OBPA 2R5YA 1WKMA 3CCRI 5CVRA 2COMA 4JOMA 3LSHA 3OS2A 3JRIA 4ZTFA 2W85A 2BV6A 1ZG3A 2VJIA 2IS1A 2ESHA 3DV8A 1TWAJ 1P4XA 3J7AY 3K9TA 3M9AA 5EGOB 4GGGA 4XRFA 4HA8A 2FBKA 3H36A 1SFXA 2YX7A 4RDUA 3VSKA 1N75A 2CYYA 1IRFA 4MLOA 3CP8A 4IOAF 5TRDA 2CW8A 4YIRX 3C3WA 5JI6A 2KLOA 1Z7LA 3QODA 4BJ5C 2R93J 4BXUA 5E18F 1ZN2A 1LPQA 4C3IJ 2YUSA 4BAYA 3DKXA 2DA7A 2Y2ZA 1CF7B 1JXSA 3KP7A 3S32A 2Z33A 3S1RJ 4C3JJ 2ZSIB 3TQNA 3U1KA 4D0PA 2DT5A 2DCEA 3EETA 4A0YA 1K7AA 5IY5H 1S72I 3GFIA 2E35A 4PJNA 4IQ4A 1VQ7I 2UXXA 4ZDOA 5IT9Z 2XSJC 3NEUA 4O6JA 3ZQGA 1QZEA 2JK3A 3OYBA 3CCEI 5CVIA 3TOAA 3ESWB 4PSWA 5C4JJ 2QLZA 2QF7A 1FZPB 3PM1A 1U78A 2STWA 4AU7A 4XN3A 3LAPA 2NXNB 4ZJZA 3E5UA 4JX5A 4XNFA 2ELKA 2GAUA 3IKTA 2Z2SB 1SD6A 4IVNA 3S3MA 3BR3A 1MDMB 1ZRCA 4UV9A 1ONVA 4HQMA 4M3DA 3B02A 1LFUP 2DA4A 3LQQA 4FETA 3ROUA 2P6SA 3L00A 2JA5J 1H0MA 1MMAA 2GXAA 2ME0A 4HV6A 1DPUA 3F6VA 1FSEA 3KYCB 4LMYA 1UJ8A 4LK1F 3TBIA 1POGA 3VYSB 2XAGA 2Y9ZA 2XB0X 4RGXA 1O3QA 2VODA 5CKTA 3OYAA 3CMEI 1HW1A 2KJCA 2VONA 2XF6A 1Z6RA 4ZDLA 4PUSA 2QQ8A 2QEXI 2BXZA 2MD0A 3TMOA 2O6GE 2DFFA 3Q0UA 3WU1B 2LKPA 4BQOA 3FX3A 2CV0A 1X3UA 4MGRA 2DJNA 5LGNA 5DV5A 3Q0WA 3GTKJ 2JN6A 5HOOA 3L09A 4G7HF 4XICA 4M3BA 3I0TA 1ENHA 5JVTA 2K7LA 2L9RA 2Q2EA 4CUGA 1V55H 4XN0A 1WPKA 2Z16A 2D1VA 3MZHA 4IO9F 1HDDC 4E7ZA 3HOSA 1PP7U 2EZKA 2CO5A 3KP2A 2MYSA 2EV6A 3LSKA 2LBFB 2BW3A 5D8KB 3QU3A 2ESNA 4C30A 3FBNB 1EV7A 3DKYA 5KNLA 3JREA 2NOJB 4AIHA 2HQ5A 1XMAA 1REPC 4M74A 2MBFA 3A02A 5D6FA 1HW5A 4HLXA 2G7HA 2VQGA 4ZC3A 4ON0A 2DT7B 1X3WB 4KT6A 3QP5A 3HBLA 4M6YA 5J6XA 4LGWA 2HEOA 1FEXA 2DBBA 1FNNA 2ZJPF 4XQFA 2QZ8A 2O8KA 5IOZA 1WH7A 2DK8A 2L9VA 3OOPA 5HS8A 1TBXA 3KZIC 5C4XJ 2RGVA 1WWXA 1PYVA 4KFCA 1ZREA 2VN2A 3CMMA 4KYWA 5IP7J 1SFEA 2FRHA 2E1NA 1IXCA 4PJMA 4YIFA 3KETA 2VQHA 4RMNA 3V7SA 1UFMA 2ICWG 4B1RA 2RN7A 4RB1A 1N77A 4IHTA 2OTJI 3DEUA 2QYOA 1VQOI 1U3EM 3ZPLA 4IQJA 1LE8A 4IKFA 2DA1A 2JRMA 1Y8RB 5IT3A 2HS5A 3A4CA 2IJLA 4KDPA 4BBRJ 1LJ9A 2LF7A 2MSYA 3RKWA 1BR2A 2HOAA 3RPUD 2V9PA 3ABLH 1NH3A 4I0AA 2RQPA 5D4SA 3U1DA 3E5XA 3ZP5A 2LC2A 3HOTA 5F04A 4E7HA 1RIOH 1HA8A 1D5VA 4RGUA 3WHBA 2LSOA 3C7JA 4HDUA 1ZAOA 2Z5UA 4ABZA 4DOZA 2EIJH 5D6EA 4D5FA 5FLXZ 2J5OA 1RR7A 3L2QA 2NVTJ 2R92J 3LOCA 1PUEE 4CGZA 2PFBA 2QM3A 2LR8A 2LNBA 4CH7A 2VOPA 1H9TA 2QVOA 1IW7F 3HKZA 5EG0B 4AM3A 5E3MA 4WXCA 1KGSA 1LVAA 1UHSA 1XG1A 3ULQB 3IRQA 5LD2C 2NVUB 2ZSHB 5B3SH 1E3HA 3E6CC 3K4LA 4AIDA 2HQNA 1G3WA 5L3BA 3C2GA 1QPIA 1KU9A 3CCUI 3SDGA 1DGWY 4CYCA 1MBJA 5K7FA 2BY2A 1WVRA 3OYJA 3K0LA 2Y31A 4NNJA 2KDZA 4CCLA 4PFOA 2HVQA 5DS9A 3K2ZA 4LLNA 1LVKA 2CQNA 1JKPC 2QKMB 2P5VA 1WJEA 1YW8A 2HGCA 5DM7F 2CGPA 2P5KA 3NRVA 1MD0A 4A3JJ 2XSDC 1QU3A 1T98A 3WTYC 3CCQI 2HQAA 3KZYA 1X3ZB 1B4AA 2YX4A 5DCMA 5DCFA 1UG2A 2L4AA 4E7LA 1W5CC 4LFUA 4NC6A 4JX4A 2WAEA 3VFZA 3W2VA 1EA3A 3M07A 3DPTA 3BPVA 3GTMJ 4DYQA 5E17F 1U5TC 2OJED 3K4BA 3A01B 4R8HA 3RSNA 2CQKA 1YYVA 2WV1A 1H88C 2F6CA 2HKXA 2IA0A 4DYRA 2XB5A 4IRGA 3I54A 4CHUA 3VEPA 5C44J 4HLYA 2KPMA 5J47A 4ZH4F 2CG4A 4XLPF 4CDGA 3QRFF 5HLHA 2QQAA 3W6KB 4MTDA 2LG4A 4DJAA 1T95A 1Z77A 3F8BA 4ENJA 2M5WA 5F1RA 4NDLA 3I56I 4OIOF 3BLYA 4IHVA 1ZYRF 1JE8A 2A69F 3T8RA 3BG3A 1YI2I 2LDUA 5FLXK 1KZHA 2KJBA 3HOWJ 4GCVA 5FB2A 1O3TA 4A93J 3WGGA 2EB7A 2X0LA 2IEKA 2M8GX 2HZTA 1DU6A 2CV2A 4BY7J 4KITB 4A3MJ 1F43A 1OCZH 4M73A 3HKZN 1VQPI 5BPIA 4W1UA 3F8MA 4ENNA 2PBIA 2JVHA 1IRZA 4EGYA 2DTZA 1LEAA 4E7IA 2V6CA 5J8CA 3P9IA 2HXIA 1S9HA 3HOZJ 3HRUA 4BEHA 2X6YA 1IF1A 2VL8A 1ZELA 2L54A 1A04A 3OYEA 1FY7A 4A2UA 3MMYB 4HAMA 3OL3A 2JRTA 4PJLA 1LDDA 3I5UA 2XGXA 3E97A 3EUHA 3S17J 3TW7A 1KYZA 1R58A 5DD8A 4EM1A 1G3SA 4LG0B 2QUFA 2WBMA 4HBLA 3WU2C 2IT0A 2UUZA 4WX9A 1RRJA 2HXOA 2O0YA 3EUAA 1L0OC 2FOWA 3VSLA 4BE1A 5LHIA 1UG0A 2M4KA 2W7NA 2K5CA 3BWGA 3FXMA 3EYYA 4RLFA 3Q3SA 3RJPA 2KFDA 3HYIA 3S3NA 2Y48A 2GM4A 2XF5A 4BQNA 2P8TA 4B3AA 2L02A 2VBXA 3H1CA 4OWRB 1AKHA 1BI2A 1TWCJ 2F5CA 1SEUA 2K4JA 1HCRA 2RQQA 2PEXA 4AC0A 4ETSA 4EJTA 4I98B 2XAQA 2EIMH 2LOOA 2PQ8A 2ZMEA 1Y1VJ 1JT0A 3E0JB 2O9LA 2VE9A 1IV6A 2JJ7A 3FXRA 1SAXA 1QVUA 2GLOA 1O4XA 3H3ZA 2CUZA 4TV7A 3S2WA 2EZIA 5FD6A 1AOYA 4XBFA 2RDPA 3FXKA 4G94A 1HLVA 1R9TJ 2CUEA 5HNHA 2KL4A 2B0LA 5A2QZ 1B1BA 3ECHA 1JGGA 4B4CA 1IRGA 3OYHA 3P5JA 1SMTA 5ED4A 1O3SA 3ZQLA 3WGHA 3PNTA 3HDDA 3CDLA 5EYRA 4E6KG 3HTUA 3ZMSA 1AHDP 3BCBA 4M9XA 3SYTA 2QENA 1J75A 4XL9A 3VOEA 1F4KA 4KNYA 3HZJA 1ACIA 1XS9A 3GXOA 1YRNA 5L3DA 3LSPA 2RC4A 3FK6A 3OS0A 3V8LA 1JUSA 2HDCA 1R23A 4NBQA 3SZGA 3TOBA 2EV5A 4QLCU 3WTUC 3K4MA 2Q0OA 4LD5A 2R7XA 3WTSC 1XD7A 1D5YA 3CCSI 1SFUA 2RNGA 4JP0A 3RI4A 2M0MA 4HX4A 2L3DA 1FBUA 4XLCA 3ZN1A 5F1JA 3F21A 1VQ9I 1A36A 3FZVA 4E70A 4Q5SF 2HWVA 2OCCH 4RAYA 3EQLF 1IUFA 3F8FA 2EINH 3DBRB 3GTJJ 1KYWA 4XK4A 1UHWA 3QPSA 4LK0F 3K1MA 3RDIA 4A3EJ 1WRJA 1R5HA 3RZDJ 2L7FP 4L18B 2H8WA 3KP5A 2OD5A 4EEFG 1H9GA 3IH3A 1R4MB 1Y1WJ 1HF0A 1GT0C 4BL0B 3UKGA 1QHGA 4F93B 1FOWA 3PNYA 1W7PD 1QPMA 4I76A 4Y4RA 3RPQA 4ZYGA 1JKRC 3H5RA 1WI9A 4MFEA 2ZKZA 3DPUA 3HJEA 1IC8A 3FMRA 3W6VA 3HXLA 5K5RA 1PP8F 4HEA2 3M8FA 5F0FA 4FTHA 1LKXA 1D3YA 2L7KA 4GO1A 4UUSA 3RKQA 4EV0A 4C9YA 2JPBA 3OR2C 2ISYA 3CC7I 2DA6A 1V4RA 4YIIA 5A2QK 2EILH 4LG0A 3RQIA 3AFHA 1I5ZA 2X9DA 5TJJA 3SZTA 2XKPA 5F64A 2R7FA 1EF4A 4BHPA 1HQCA 2I8DA 3IRRA 1IDYA 4IHXA 1WFXA 2F5VA 1LFBA 1FMWA 1TQIA 3DLLF 1RUOA 4RB0A 4N4OB 1D8JA 3BDDA 5F0CA 4R1HA 4XKCA 2O7OA 4U0WA 2DMUA 3SFZA 1MIJA 1QHHD 1Y6IA 4A3BJ 1I6XA 3BP8A 2EFWA 2EFPA 4U87A 2ZB9A 4BNCA 2VBYA 1MZBA 3TP0A 4D7MA 3GFMA 2HOEA 3OL4A 2H6CA 4FT8A 4QSHA 3LA3A 4R79A 5L3FA 1YITI 1OR7A 1QO0D 3EDPA 4DNCA 5FKLA 1RETA 5KK1A 3TDUC 2EIKH 3FMQA 2FD5A 1Z67A 2K02A 3JTHA 1D0XA 1LNWA 2LYCA 3G1MA 4RS8A 3R0JA 3CUQB 1IV8A 3K6GA 1OLTA 2XKOA 3CUQC 5AIQA 1AU7A 4M6VA 5F6FA 2QCOA 1X1BA 3KEOA 1SANA 5H2FC 5JLWA 2F4MB 2JT1A 3N4MA 2XASA 2BE5F 2QQBA 2NOGA 4V19K 2KQRA 1OCTC 1BN5A 2MA3A 5LFAA 3H0DA 2F2EA 2M45A 2BEOA 4CSWA 2V1UA 3LSTA 4L0YB 3BROA 3BTCA 4DBRA 2QQ9A 5BOXA 2CQXA 1Z1DA 3CZ6A 4BDZA 4KISA 2L9SA 1BA5A 5C3EJ 2XUBA 3BTLA 3Q9SA 3T0YA 1TWHJ 1VQKI 3DTIA 5D4RA 2FE3A 5FGMA 5B66C 2X6OA 1YS7A 2EZLA 3OYIA 4BH9A 4WK8F 2W82A 2KKOA 2CFXA 3K4CA 5B1BH 2DAOA 3COAC 1ORKA 4RB2C 1FP1D 4JX6A 4B3XA 4EVIA 4YFXF 2DQLA 3J80K 3F22A 4XKBA 2L9NA 3PNVA 1QA6A 4IF4A 3CJRB 1PUFB 1WJAA 4ESJA 4QPOA 3K70C 3DU6A 2D1HA 1G3TA 1ITYA 3FKJA 3UR3C 1ZQ3P 3QPLA 2ECCA 2I10A 2EWNA 3PUBA 4Q4ZF 3N05A 3MKYB 5KVRA 3IL2A 2CQQA 1J5YA 4Y3OA 3WTXC 4CCOA 1GUUA 3HPGA 4O3MA 5EZHA 3ZQ7A 1YX5A 2K9LA 4PSXA 4CCNA 3A2KA 1YS6A 4M71A 5E1ZB 1HC8A 1FYLA 4PJ0C 4WXHA 1HBXG 4HNTA 4P55A 3G2BA 4RM2A 1W1WE 1ZLJA 4M3GA 5FO5A 2LF8A 4KN7X 3HRTA 1XGMA 4HNVA 1MMSA 1MW7A 3S3OA 1K61A 2WAQA 2RNJA 1TZLA 3WHCA 1VQ5I 3B6CA 5LLQA 2HR3A 3DWLE 5L3GA 2NS0A 2A3SA 1HKTA 2QSHX 4UHTA 2VASA 3H0GJ 3D5SC 4ASNA 1G6NA 3LQRA 5M5XJ 2LD5A 1OYWA 1BC7C 3G73A 1F9NA 3TW6A 4U7BA 3OIQA 3ZQIA 2LK2A 2A05A 1TNSA 4D7NA 1XMXA 4A3IJ 4IXAA 4ZTJA 2UXNA 3ABTA 1Y56A 2L7ZA 2WV0A 3M3YJ 3QWLA 3CLQA 4D1QA 5ERIA 1K83J 2MG4A 2DDBA 2CS3A 2MGQA 1DP3A 2OTLI 1R1UA 4BKXA 3CC4I 1T38A 2LRDA 3PFYA 2DMNA 3DEWA 2YSRA 1G59A 3E6BA 4F3QA 2V1NA 1WQ2A 4J00A 1R5GA 2DYSH 1LUJB 4M6XA 2KMUA 3HOUJ 2FBIA 5E8IA 1XC5A 1ZGWA 2QSGX 1B8IB 3D1NI 5KAFC 2VBZA 4NB5A 3OYDA 3KP3A 1S3JA 2KRHA 3ERMA 4HV5A 2ID6A 2DYRH 2M7BA 4PDKA 1BBYA 2V9KA 4EJVA 2M2EA 4JBAA 5CLSA 4YFKF 2VKHA 3OSGA 1HW2A 2DJIA 1IDZA 2CH0A 2A5WA 2K3FA 3J7YJ 1MMGA 3C2HA 3NQOA 4BBSJ 3UNGC 4RM3A 3JRGA 1MBFA 1VTNC 3OOUA 4QPQA 3JAMZ 5EJCA 6PAXA 2P7CB 1DDNA 4AYBA 2VB6A 1RZ4A 1WHUA 4HF0A 2W84A 4YEJA 2R7VA 3RTRA 2ZNZA 3O2PE 5ICEA 4WCGA 2COBA 5E20A 3KLOA 1WSUA 1JKOC 2R7SA 2DFIA 1BW6A 1KQ8A 2WAQN 3KYDB 1UELB 1FOKA 2K4BA 2ECBA 2M1BA 4LG3A 4ZYDA 1QRYA 1A6IA 2WADA 5M3MJ 3I3LA 1U0JA 4UVAA 1SAUA 1MJ9A 1KU7A 3ZCOA 2OCEA 3E6MA 3QPTA 3F72A 3RIRA 1G4DA 1W7PA 1O57A 2BY1A 1W5TA 2MH2A 2RAEA 3SZPA 4YELA 2F4OB 4E7JA 1H8AC 3I4NJ 4BXXJ 3Q5FA 3H9GA 2VLAA 4G6QA 2FOKA 1ZR4A 3F9KA 2DXIA 1RPWA 1MJBA 5IT9K 4RA2A 2ME6A 4XORA 2A6TA 2DFHA 2E5NA 2ELHA 2A61A 4MNUA 2OC6A 5J1YA 1UZCA 1V5GA 2BYVE 4FX4A 3CCVI 2Z3YA 1FC3A 1XSDA 2IBDA 4F7ZA 4XLHA 2EFQA 3H9JA 5FKOA 3PIOF 1VQMI 1T08B 1Z05A 2IXSA 2MLKA 5EGOA 5BMZA 2HVSA 5M5YJ 1WGXA 1ZHFA 5D5WB 1OYIA 4C2TA 1PDNC 1XTAA 2LVSA 4A3DJ 4LITA 5HDNA 3S1QJ 3BPXA 1V54H 2DU9A 5JLXA 3BR1A 5EEHA 4II2A 3VPRA 1X19A 2CMPA 3K7AJ 5LHGA 2NNYA 2NS7A 5GPCA 2R7QA 3DLAA 2DA2A 1YIOA 4F91B 1FOXA 4B8XA 4DYCA 3GZNB 1W4MA 4MHGA 4UXNA 1D8KA 3IHUA 1P4AA 2JVGA 3ZQCA 3LA7A 3LSJA 1FTTA 5K1YA 1IGNA 4KT5C 1CF7A 3CJQB 1XGOA 4A5NA 1NK2P 1BOAA 1ZLKA 4L0ZB 2GBYA 3ZQQA 4E7SA 1SD5A 4UUVA 1ULYA 3IP4B 3QQAA 2L2OA 1OPCA 4A6DA 5HLTA 3JAMK 1P4WA 4XIDA 3PQJA 4OINF 2IGOA 2X1CA 5IP9J 1WI3A 3HEFA 1X1CA 4U7DA 2HTJA 2KT0A 3HHGA 3L7WA 4AYBN 1C0WA 2R7RA 4I2OA 3I59B 3RYRA 5FRMA 1J59A 3G1LA 2FMLA 1D0YA 1E3PA 1NG6A 4YRVA 2YPRA 4U0YA 3CCJI 2P7VB 2C6YA 3BQYA 3KFWX 5H6QA 3FBIB 2A07F 2LREA 5JVGF 3TDZC 2STTA 3R4KA 4I02A 3DTEA 3MQ0A 3WGIA 2IGNA 4UUTA 3OMYA 1MDMA 3VODA 1VI0A 3D0SA 4AUXA 2EK5A 4XRSG 5K7ZA 1Z9CA 4XKWA 1B6AA 3GWZA 3VDXA 2K9NA 3QPHA 5EEAA 2DODA 5EZGA 2AQFA 1F1ZA 4IRIA 2E1MB 3TO9A 2X4HA 2MC3A 2E1MC 1OKRA 4FE7A 5HNFA 1TWGJ 3OYNA 1D1BA 5DM6F 3JSOA 2Y69H 3DPLC 1HKSA 2R7ZJ 2NAZA 2ZJ2A 4Y15A 3GTQJ 1R1VA 3U9GA 2JTVA 4XM3A 5CVVA 5FRNA 2DOAA 1QVTA 1R7JA 2M3AA 1ERDA 2ZMEC 5M5WJ 1TL8A 3R0AA 1OYYA 1QZYA 3U2RA 4E4HA 1SVMA 4GYGA 3BZKA 1UMQA 3HM5A 3PSFA 3C18A 3VB2A 3VYTB 1TT5B 1T0FA 2IGKA 2Y75A 3K1NA 1U5TB 5D5XB 1LEBA 1IZ1A 4EJOA 2KZGA 4A3CJ 2ZBKA 2EH3A 2HPIA 3IV5A 3L2WA 4IPAA 1SD7A 1U6GA 1UB9A 3GVAA 2XHKA 4PFPA 1ZG5A 1YTYA 1N78A 3QP6A 4DZPA 1E3OC 4A12A 2TDXA 1B72B 2X48A 2ZXHA 3WTTC 2LBFA 3LMMA 3AAFA 4G12A 1DGRM 3MAJA 4G6DA 1ZR2A 2QBYB 3CF5F 2GQQA 3QOEA 1V3FA 4BY1J 4LB5A 3V8KA 2R7UA 1RNLA 4A3LJ 1YJWI 4UB8C 4KN4X 1UCRA 3GYHX 4KJZA 1FJLA 4WXDA 2Z1DA 1D1CA 2LMDA 1OISA 2A6EF 3JRHA 2YU3A 3P9KA 3QYEA 4N9IA 1IN4A 3HUGB 4M72A 3ZMVA 1R22A 2R3SA 1R00A 3AG4H 1ETWA 4XLFA 3TEDA 3BZCA 2E2JJ 3BR6A 1IN5A 1TLHB 1R71A 1GDTA 1RKWA 4I01A 2CUFA 3FIWA 5E79C 4C2UA 4NUBA 5LGTA 5J40A 5M3FJ 1MBKA 1YX3A 2PLYA 3LL7A 2A68F 3S8PA 4O5VA 3H5NA 5B5EC 3AKZA 1N25A 1Z6TA 2HYFA 2RREA 1P9QC 3CUOA 5GAEJ 4DBQA 4Z2YA 4A0ZA 2OZ6A 2M87A 1VQ4I 5FROA 5GTHC 4Y13A 3V7RA 2JUCA 2PN6A 4FCYA 4DW6A 3FK7A 2G0EA 4P1WA 2IVMA 5TGTA 3OIOA 2D45A 3NARA 5H20A 1O7LA 4HG2A 3BTJA 1VQ6I 3GO5A 2QWWA 3AG3H 4RLQA 3U21A 3V4GA 5KHDA 4KIGA 1VF9A 1M1EB 4MQVA 1GXPA 4CO8A 4DQ2A 3DU5A 4CCKA 3Q0VA 2HVRA 2W00A 3KIOA 1JI8A 2DFEA 1IJWC 2DW4A 3HSEA 2PMUA 3CC2I 5EG0A 3SFIA 2F48A 4KIFA 3I55I 3MN2A 4BDYA 3JRCA 2WA0A 2E60A 3PFIA 4I09A 1BIBA 1U9OA 4D9JA 1T8IA 3CO6C 1K6OA 1NK3P 1B9MA 3ZMTA 5LGUA 3TO6A 4KMFA 2GWRA 2M8EA 1V5FA 2VT3A 3GTGJ 3HG9A 2AO9A 2XV4S 4A5MA 2XPVA 3E3VA 1KU2A 3HL2A 2HOTA 3K10A 1E2XA 2XGDA 1T6SA 3BOQA 2X51A 2WB1A 3I4PA 2H1LA 1SFKA 1KU3A 4MFDA 2Y30A 3H9QA 4IOCF 1NG7A 3PQKA 2ZO4A 2BHZA 3IWFA 4G9YA 2BHYA 2PJRB 5JHFA 3WG9A 3B73A 4IHYA 1YQAA 3GBGA 4L9NA 4M9ZA 2WAFA 1K78B 1A5JA 1S7AA 4I0BA 3D5LA 3IUOA 4UB6C 1WCMJ 3FXLA 1U5TA 4HDVA 1FX7A 3A01A 2P4WA 2VQLA 4J19A 2HOSA 1STZA 3E1SA 1I3AA 4P9UA 3KPHA 1USSA 4UNOA 4BQQA 5K5OA 1HXDA 3KP4A 4OMZA 4IL6C 5FFZA 2VQCA 3BG9A 2XAHA 4H0EA 1X58A 3O8HA 2GZWA 3TO7A 3LNQA 1BJAA 1BL0A 4ZDPA 1KQ9A 1SVLA 5IOYA 5K7HA 3OS1A 3I9V2 4A3FJ 4XKVA 4F92B 3ZR8X 2Z9OA 2K9QA 3RPUA 2OA4A 2ZXJA 3OWTA 2VOOA 1FIAA 1E0EA 1DUXC 4B09A 3C1DA 3HGYA 3OYKA 3KLNA 4YG2F 1HOMA 1WH5A 4HYEA 1WJ5A 3EUKL 4XMYA 3FM3A 3E6DA 2R5YB 2V9VA 2XRLA 1BW5A 1MNMC 1XSVA 3V7CA 4FASD 2WC2A 3K70D 2CRGA 2O8XA 2BZTA 1U9NA 4G8XA 1MNDA 3RZOJ 5JFRA 2HNHA 1NHAA 1ZKGA 1TQMA 3GFJA 2PX9A 1H89C 3BG6A 3SEQA 3ZMZA 1IXRC 2AQEA 1X2MA 3GCMA 2L5QA 2KIUA 5DUIA 2WB1N 3QYFA 2O61A 1DU0A 3K2AA 1XGSA 2X1DA 4FE4A 3OYLA 2EZHA 3FWEA 3GMEA 3JSPA 4FQGA 1I50J 1JHHA 3OSFA 4K2EA 2V4JC 3E5QA 3SDBA 1Z0XA 3HRMA 1IN7A 3H3UA 4I6ZA 4AVPA 2CFOA 2DTRA 1LQ1A 2NVXJ 1GV5A 2XGCA 2XROA 3GTPJ 4A3GJ 2HI3A 2UV1A 2E1CA 3QAHA 2OF7A 3CDIA 2I5UA 4N9HA 2Q8KA 2EV0A 2GA2A 1JHFA 5K5QA 2CUJA 2MH9A 4FHTA 3O8GA 1NTCA 4AVZA 4RB3C 1TQPA 2FMYA 2VJJA 4OMYA 2LP0A 4P96A 3TKYA 3CCLI 2H6BA 3LFUA 2LY2A 4A69C 2V79A 2DOEA 1FYKA 4KUMA 2VJ5A 3IWZA 4EGZA 3PSIA 2IS4A 1LFPA 2K3PA 2V7FA 3R60A 1W5SA 1LDJA 4I7HA 2MLGA 4XRSA 3FKIJ 3JRAA 3OY9A 3J7ZI 3QU6A 3A0HC 3J7AO 3DF8A 3K69A 3RCOA 3JRDA 2J5PA 1SC7A 3KEYA 5LRSA 4NC7A 3CQZJ 5DYMA 3KCCA 3A0BC 1TWFJ 3M8JA 3IKVA 2E36A 5DDGA 3PJRA 4BU2A 1SFOJ 2FX0A 2DPDA 2GA1A 5BNGA 3FXOA 3I71A 3JR9A 1MGTA 2VKEA 1W0TA 4L9VA 3BT9A 4KA4A 1TTYA 5F08A 2CSOA 2CJJA 5E1WA 5TISC 3S2DJ 5FKMA 4S04A 3F3XA 2V6EA 2AS5F 2M0CA 1ZTRA 2O3FA 3ONQA 2E5ZA 2FUG2 4E7KA 3DTKA 1RI7A 4XLNF 1V5EA 2CQ7A 4IEJA 2F5EA 3ZXSA 2Q2EB 2E7XA 1LB2A 2VXDA 1HSJA 1GV2A 2FA5A 1FPQA 2HZDA 1F5TA 3CTAA 2BW3B 2BBYA 4Q48A 3VYUB 1CQTA 2XC7A 3MZYA 3DBLB 2IAIA 2L4MA 1XDUA 2ZXIA 5DTDA 5ILSA 4CYDA 2ADUA 2D2WA 5DUKA 1Z7UA 3GX4X 4OIQF 2P81A 4B48A 1BI1A 2A5YB 4M9SA 3WE2A 2FBHA 2OQRA 3BTIA 2EFNA 2EQRA 2V1DA 4MO7A 1S5LC 3BQZA 1MKMA 1X2NA 2XDVA 2ZFWA 3D5RC 5AIPA 3HSRA 1JTXA 2VE8A 3S2HJ 2JZYA 1Z3YA 3M1EA 1ZRFA 3T8TA 3KZZA 5KAIC 3ZQFA 3EYIA 3BC8A 2B7EA 2DI3A 2BVLA 3CJNA 1MJAA 4Q47A 4EJWA 5GTIC 3MKWB 1PVEA 2DLLA 3M7GA 2X6XA 5J8FA 4RAGA 4HQEA 5BPDA 3R6SA 2ZJRF 1FBQA 5CVJA 4QTRA 3NAUA 4KICA 4U88A 1LE8B 4ZZDA 4UV8A 1ZRDA 3HC7A 1O3RA 3ZRGA 4ZYEA 1APLC 5L3EA 3F6OA 3KYLA 4BUPA 1YIJI 2JMWA 2XAUA 3DBHB 2DK5A 5L3CA 1AWCA 4UVBA 2ZC2A 2PMZA 2CW7A 1MSFC 1QBJA 3I64A 5D5VB 1WJBA 2DN0A 2K27A 3DP7A 1XCVA 2DO7A 3W2WA 2YU9J 5J1RA 5LHHA 2LY9A 2IA1A 1IN8A 3ASNH 1FBSA 3IAS2 3BJ6A 2LLKA 5FD5A 3S15J 3L2CA 2M4GA 4BHCA 4GFBA 4CCJA 1MMNA 1L3LA 2HQRA 1UHMA 3OYMA 3MEXA 2P5LC 4IHWA 3CUQA 4GDFA 4MIMA 4CXFA 3I58A 2JA6J 2TRTA 3EPZA 1G3YA 5J1UA 5IYCJ 3L2RA 3PIPF 2EA2A 4HX8A 1IAWA 3KP6A 5HVQC 4W97A 4B43A 3JRFA 3PUFA 1BI3A 3CMYA 2CU7A 4X6AJ 3A03A 5LRRA 1ETOA 4LLGF 5CVUA 2DQRA 3SHFA 2KRCA 4OIPF 3LSRA 5IPAA 1JT6A 4XR6A 1UAAA 2VI6A 5F0HA 1HKQA 4CYCB 2E2IJ 2H94A 3AG2H 4LIUA 1R36A 5J4YA 2R7TA 4Z6YA 2E19A 1DQUA 1GVJA 2LKSA 1R4NB 1T39A 1XN7A 3PL8A 4L5IA 1R5ID 1JGSA 1W36C 1K4SA 4IZZA 2MFZA 4XONA 4G7ZF 1X1DA 5HDKA 1X1PA 2JSPA 4PGHA 5AONA 4A0XA 3ZMDA 4LOCA 3GZ5A 1ODDA 1YOVB 2VKVA 4HNUA 5DCMB 3K1PA 2DT6A 2KRFA 1PUFA 1P2FA 2MABA 4L5EA 4XLAA 4ANJA 5EEGA 4CZCA 3V42A 1YE9A 1OCRH 4A6EA 1T0FC 3CJTB 4ITVA 3H35A 1XCBA 1Y0UA 4NC8A 2W48A 4BQAA 4DGWB 2EPFA 2HFHA 3H3VK 5F27A 3L2VA 4FX0A 3TL4X 2YS9A 3WTVC 4M3FA 3OIPA 1ZH5A 4XSXF 2E1OA 5ILVA 3LSMA 4QWQA 4GYIA 2PMHA 1USTA 1Y39A 2OUMA 3I53A 2YR2A 1BIAA 5HS9A 2VUMJ 1X4OA 2PMZN 2FJ1A
chains in the Genus database with same CATH topology
2P6TA 5JR3A 1IXSB 3HIFA 3O6BB 3ABUA 4ZZLA 1I1SA 1YW9A 2VC1A 1BI0A 3IC7A 3ERED 1BM9A 5CJ9A 3WODF 2WWYA 2FU4A 2V1XA 2XIGA 3CLOA 2FF4A 2EA4A 3FXQA 1P92A 4L9JA 4KMUX 1J7KA 2EFOA 4EMSA 2VC0A 3TGNA 2FEZA 5E1XA 3CDHA 3GW2A 4HX7A 1RUNA 3G3ZA 3FF5A 1KA8A 5BQTA 2ZNYA 3R61A 1B9NA 1ZGAA 1FP2A 2FXAA 2OAZA 4LLLA 2BGCA 5CYVA 2ZMEB 3OV8A 4CICA 2L01A 1IN6A 3MFKA 3M8EA 2ZCWA 3HRSA 3T1BA 3HSFA 4L5JA 1GXQA 1B59A 2O03A 4RGSA 2Z99A 5H6RA 3FMSA 5LEJA 2VXZA 3BJOA 1ZG1A 3J81Z 1ON1A 2GIVA 4P9FA 1K79A 2H27A 2FQ3A 2RV8A 1YO5C 3CO7C 1FSHA 3P7NA 4EQQA 3ISPA 2HYGD 5D5UB 1ZGJA 5E8GA 2IW5A 1I27A 3KEQA 5ICFA 4LB6B 1HSTA 4BYYA 3GUDA 4PGGA 2FNPA 5DEQA 1I1GA 4XSZF 1TW2A 5HLIA 3DKWA 5HS7A 4HZFA 2CW0F 3ECOA 4BHBA 3FXUA 2R7DA 4EM2A 4YFNF 3RKXA 2ACJA 2RKHA 2PI0A 3BJAA 3P9CA 3I59A 3ZN0A 1S8NA 2A6HF 1Q1HA 1XGNA 3LWFA 2NRAC 1U8RA 4NHJA 4CZZA 1T2KA 1ON2A 4PZJA 2XRNA 4OIRF 2E7WA 2ETHA 4MEXF 3Q9VA 4JK1X 3J81K 2IP2A 4EJUA 4U0VA 4HOBA 3WTZA 3F8CA 2H09A 4ENKA 3BY6A 2GXGA 3SQNA 3RKYA 4EM0B 3W6JB 2PG4A 2W57A 1YG2A 3HHHA 3ELKA 5D8LB 3DXJF 1EH7A 1O7FA 2F5FA 3JW4A 4OOIA 4JQFA 2IPQX 2UZKA 3MCZA 3SXYA 4IRHA 3WE3A 2XVCA 1EH8A 2OZUA 3BZ6A 3FM5A 1EH6A 4ZYHA 2G9WA 4RAZA 2M30A 4ENMA 3LA2A 1IUYA 3KE2A 2Y0MA 5LBQA 1XSXA 4L9TA 2QBYA 2IA2A 3L9FA 4HF1A 2MD5A 2NNNA 2CWEA 1FWZA 1TNTA 1GHCA 4HW0A 3F23A 2GXBA 2EJRA 4WWCA 3HUGA 1FT9A 1CGPA 2XAJA 4IJAA 1Z91A 3T5XA 1QGPA 1J2XA 4WF2A 4PCQA 1YLFA 3GF2A 2IRFG 1FYMA 1ZARA 4HF2A 1YFHA 2XAFA 2RVCA 1R1TA 2OQGA 4MQ9F 1QNTA 1XMKA 4N0BA 3GFLA 1DPRA 4ESBA 2PJPA 5ILUA 1J0RA 3QOPA 4NQWA 1SMYF 3DQVC 3O3KA 2HKOA 3F8NA 4MTEA 4Y17A 4LJZF 4AIJA 4AWXB 3J80Z 2FNAA 3ML6A 2W25A 3GEZA 4UVCA 4S05A 3JTGA 2UWMA 1S7OA 1FLIA 2JPCA 2ISZA 2G7UA 4OU0A 3WU0A 1TW3A 1S6LA 4G7OF 1KQ0A 2JSCA 1U2WA 1E17A 2AXLA 5ICGA 5FFXA 3WTWC 3V8JA 3ZMUA 5LEKA 4P5OA 1XDSA 2DPUA 4IHSA 1OMIA 5DD4A 1QZZA 2K86A 4AIKA 4MEYF 2F5DA 5JHUA 1P6RA 2OU2A 4KIBA 1K78A 3HTSB 2NYXA 3LAJA 2VBWA 3GZ6A 2KIMA 2HTSA 5ICCA 3RYPA 5BS6A 3GLXA 3FHZA 4AD9A 1QQIA 1DP7P 1J9IA 5HLGA 1XB4A 3LFKA 1LDKB 2WTEA 5HDGA 2W24A 4ESFA 4GXOA 3H92A 2KIFA 3DFGA 2FSWA 2VT2A 1W7PB 3REOA 3MWMA 1S29A 3N97A 1YW7A 1BC8C 1SD4A 4RGRA 2OBPA 1WKMA 5CVRA 2COMA 2W85A 2BV6A 1ZG3A 2ESHA 3DV8A 1P4XA 3K9TA 3M9AA 4GGGA 4XRFA 4HA8A 2FBKA 1SFXA 2YX7A 2CYYA 1IRFA 5TRDA 3C3WA 5JI6A 4BXUA 5E18F 1ZN2A 4BAYA 1CF7B 1JXSA 3KP7A 2Z33A 3TQNA 4D0PA 2DT5A 3EETA 4A0YA 1K7AA 3GFIA 2UXXA 5IT9Z 3NEUA 4O6JA 5CVIA 3TOAA 2QLZA 1FZPB 1U78A 2STWA 3LAPA 3E5UA 2GAUA 3IKTA 1SD6A 4IVNA 1MDMB 1ZRCA 4UV9A 1ONVA 4HQMA 3B02A 3LQQA 3ROUA 2P6SA 3L00A 1H0MA 4HV6A 1DPUA 3F6VA 1FSEA 4LMYA 4LK1F 2XAGA 4RGXA 1O3QA 2VODA 1HW1A 2KJCA 2VONA 1Z6RA 2O6GE 3WU1B 2LKPA 3FX3A 1X3UA 4MGRA 5LGNA 5DV5A 5HOOA 3L09A 4G7HF 3I0TA 5JVTA 2K7LA 2Q2EA 3MZHA 2D1VA 3HOSA 1PP7U 2CO5A 3KP2A 2EV6A 5D8KB 3QU3A 2ESNA 1EV7A 4AIHA 1XMAA 1REPC 4M74A 2MBFA 5D6FA 1HW5A 4HLXA 2G7HA 4ON0A 4M6YA 3QP5A 5J6XA 4LGWA 2HEOA 2DBBA 1FNNA 2QZ8A 2DK8A 3OOPA 5HS8A 1TBXA 2RGVA 1WWXA 4KFCA 1ZREA 2VN2A 4KYWA 1SFEA 2FRHA 2E1NA 1IXCA 4YIFA 3KETA 3V7SA 1UFMA 2RN7A 4RB1A 4IHTA 3DEUA 2QYOA 1U3EM 3ZPLA 5IT3A 2HS5A 2IJLA 4KDPA 1LJ9A 2LF7A 3RKWA 4I0AA 2RQPA 5D4SA 3U1DA 3E5XA 3ZP5A 3HOTA 1RIOH 1D5VA 4RGUA 2LSOA 3C7JA 4HDUA 1ZAOA 2Z5UA 5D6EA 5FLXZ 2J5OA 1PUEE 4CGZA 2PFBA 2QM3A 2LNBA 2VOPA 1H9TA 2QVOA 1IW7F 4WXCA 1KGSA 1LVAA 3ULQB 3IRQA 3E6CC 2HQNA 1G3WA 5L3BA 1KU9A 3K0LA 4LLNA 3K2ZA 2P5VA 1YW8A 2HGCA 2CGPA 2P5KA 3NRVA 1MD0A 1T98A 3WTYC 3KZYA 1B4AA 2YX4A 5DCMA 5DCFA 2L4AA 4LFUA 3VFZA 3DPTA 3BPVA 5E17F 1U5TC 4R8HA 2CQKA 1YYVA 2HKXA 2IA0A 4IRGA 3I54A 4CHUA 3VEPA 4HLYA 4ZH4F 2CG4A 4XLPF 4CDGA 3QRFF 5HLHA 2QQAA 3W6KB 4MTDA 3F8BA 4ENJA 2M5WA 5F1RA 4OIOF 1ZYRF 1JE8A 2A69F 3T8RA 2LDUA 5FLXK 2KJBA 4GCVA 5FB2A 1O3TA 3WGGA 2EB7A 2X0LA 2HZTA 4M73A 5BPIA 4ENNA 3F8MA 2PBIA 4EGYA 1LEAA 2V6CA 5J8CA 3P9IA 3HRUA 1IF1A 2L54A 1A04A 1FY7A 4A2UA 4HAMA 2JRTA 1LDDA 3I5UA 2XGXA 3E97A 3EUHA 1KYZA 1R58A 5DD8A 4EM1A 1G3SA 4LG0B 2QUFA 4HBLA 2IT0A 4WX9A 2O0YA 1L0OC 5LHIA 3BWGA 3EYYA 3RJPA 3HYIA 2Y48A 2P8TA 2L02A 2VBXA 1BI2A 2F5CA 2K4JA 2PEXA 4ETSA 4EJTA 4I98B 2XAQA 2PQ8A 2ZMEA 2VE9A 3FXRA 1SAXA 3H3ZA 4TV7A 3S2WA 5FD6A 1AOYA 4XBFA 2RDPA 4G94A 2B0LA 5A2QZ 1B1BA 3ECHA 1IRGA 1SMTA 5ED4A 1O3SA 3WGHA 3HTUA 3ZMSA 4M9XA 2QENA 1J75A 3VOEA 1F4KA 4KNYA 3GXOA 5L3DA 2RC4A 3V8LA 2HDCA 1R23A 3TOBA 2EV5A 4QLCU 3WTUC 2Q0OA 4LD5A 3WTSC 1XD7A 1SFUA 3RI4A 4HX4A 2L3DA 1FBUA 3ZN1A 3F21A 3FZVA 4E70A 4Q5SF 2HWVA 4RAYA 3EQLF 3F8FA 1KYWA 1UHWA 4LK0F 3K1MA 3RDIA 1WRJA 1R5HA 4L18B 3KP5A 2OD5A 1H9GA 1W7PD 1QPMA 3RPQA 4ZYGA 1WI9A 2ZKZA 3FMRA 5K5RA 1PP8F 3M8FA 1D3YA 4GO1A 4EV0A 2JPBA 2ISYA 1V4RA 4YIIA 5A2QK 4LG0A 5TJJA 1I5ZA 3SZTA 2XKPA 5F64A 2R7FA 4BHPA 1HQCA 3IRRA 1RUOA 1TQIA 4RB0A 1D8JA 3BDDA 4R1HA 4U0WA 3SFZA 1I6XA 3BP8A 2EFWA 2EFPA 4BNCA 2VBYA 1MZBA 3GFMA 2HOEA 2H6CA 4FT8A 3LA3A 4R79A 5L3FA 1OR7A 1QO0D 3EDPA 4DNCA 5KK1A 3TDUC 3FMQA 2K02A 3JTHA 1LNWA 4RS8A 3R0JA 3CUQB 3CUQC 2XKOA 5AIQA 5F6FA 3KEOA 2JT1A 3N4MA 2XASA 2BE5F 2QQBA 1BN5A 2MA3A 2F2EA 2M45A 2BEOA 2V1UA 3LSTA 4L0YB 3BROA 5BOXA 2QQ9A 1Z1DA 2XUBA 3Q9SA 3T0YA 5D4RA 2FE3A 5FGMA 1YS7A 4BH9A 4WK8F 2KKOA 2CFXA 2DAOA 3COAC 4RB2C 1FP1D 4EVIA 4YFXF 2DQLA 3J80K 3F22A 4IF4A 4ESJA 2D1HA 1G3TA 2EWNA 4Q4ZF 5KVRA 3IL2A 1J5YA 3WTXC 4O3MA 3ZQ7A 1YS6A 4M71A 5E1ZB 1FYLA 4WXHA 1HBXG 4P55A 1ZLJA 5FO5A 2LF8A 4KN7X 3HRTA 1XGMA 2RNJA 5LLQA 2HR3A 5L3GA 2NS0A 2A3SA 1HKTA 4UHTA 4ASNA 1G6NA 3LQRA 1BC7C 1OYWA 3G73A 1F9NA 4U7BA 1TNSA 4IXAA 2UXNA 3ABTA 2WV0A 5ERIA 1R1UA 1T38A 2YSRA 3E6BA 1WQ2A 1R5GA 4M6XA 2FBIA 5E8IA 2VBZA 4NB5A 3KP3A 1S3JA 4HV5A 4PDKA 1BBYA 4EJVA 4JBAA 5CLSA 4YFKF 1HW2A 3NQOA 1VTNC 3JAMZ 6PAXA 2P7CB 1DDNA 1RZ4A 4HF0A 2W84A 3RTRA 2ZNZA 3O2PE 5ICEA 4WCGA 5E20A 3KLOA 1WSUA 2DFIA 1KQ8A 1FOKA 2K4BA 2M1BA 4ZYDA 4UVAA 1MJ9A 1KU7A 3E6MA 3QPTA 3F72A 3RIRA 1G4DA 1W7PA 1O57A 1W5TA 2MH2A 3SZPA 3Q5FA 4G6QA 2FOKA 1MJBA 5IT9K 2ELHA 2A61A 4MNUA 4FX4A 2BYVE 2Z3YA 1FC3A 1XSDA 4F7ZA 2EFQA 1Z05A 2MLKA 5BMZA 1ZHFA 5D5WB 1OYIA 1PDNC 5HDNA 3BPXA 2DU9A 5EEHA 5LHGA 2NNYA 1YIOA 4B8XA 1W4MA 4MHGA 4UXNA 1D8KA 3IHUA 1P4AA 3LA7A 5K1YA 4KT5C 1CF7A 1XGOA 4A5NA 1BOAA 1ZLKA 4L0ZB 1SD5A 4UUVA 1ULYA 1OPCA 4A6DA 3JAMK 1P4WA 3PQJA 4OINF 4U7DA 2HTJA 1C0WA 3HHGA 3L7WA 4I2OA 3I59B 3RYRA 1J59A 2FMLA 2YPRA 4U0YA 2P7VB 2C6YA 3KFWX 5H6QA 2A07F 3TDZC 2STTA 3R4KA 4I02A 3MQ0A 3WGIA 1MDMA 3VODA 3D0SA 2EK5A 1Z9CA 1B6AA 3GWZA 3QPHA 1F1ZA 4IRIA 3TO9A 2X4HA 2MC3A 1OKRA 3JSOA 3DPLC 1HKSA 2NAZA 2ZJ2A 4Y15A 1R1VA 3U9GA 2JTVA 5CVVA 1R7JA 3R0AA 1OYYA 1QZYA 3U2RA 4GYGA 3C18A 3VB2A 1T0FA 2Y75A 3K1NA 1U5TB 5D5XB 1LEBA 1IZ1A 4EJOA 2ZBKA 4IPAA 1SD7A 1U6GA 1UB9A 3GVAA 2XHKA 1ZG5A 1YTYA 3QP6A 4A12A 2TDXA 3WTTC 3AAFA 3MAJA 4G6DA 2QBYB 2GQQA 1V3FA 4LB5A 3V8KA 1RNLA 4KN4X 1UCRA 3GYHX 4WXDA 2A6EF 2YU3A 3P9KA 4N9IA 1IN4A 4M72A 3ZMVA 1R22A 2R3SA 1R00A 1IN5A 1TLHB 4I01A 5LGTA 2PLYA 2A68F 4O5VA 1Z6TA 2HYFA 3CUOA 4Z2YA 4A0ZA 2OZ6A 2M87A 4Y13A 3V7RA 2PN6A 2IVMA 2D45A 5H20A 1O7LA 3GO5A 2QWWA 3V4GA 4KIGA 4MQVA 1GXPA 4CO8A 4DQ2A 2DW4A 3HSEA 2PMUA 4KIFA 4I09A 3PFIA 1BIBA 3CO6C 1K6OA 1B9MA 3ZMTA 5LGUA 3TO6A 4KMFA 2GWRA 2M8EA 2VT3A 2XV4S 4A5MA 3E3VA 1KU2A 1E2XA 1T6SA 3BOQA 3I4PA 1KU3A 3PQKA 2ZO4A 3IWFA 4G9YA 3WG9A 3B73A 1YQAA 4L9NA 4M9ZA 1K78B 1S7AA 4I0BA 3D5LA 1U5TA 4HDVA 1FX7A 2P4WA 1STZA 4P9UA 1USSA 4UNOA 5K5OA 1HXDA 3KP4A 4OMZA 5FFZA 2XAHA 4H0EA 2GZWA 3TO7A 1BJAA 1KQ9A 2Z9OA 3RPUA 2OA4A 2ZXJA 2VOOA 1DUXC 4B09A 3C1DA 3KLNA 4YG2F 4HYEA 3FM3A 3E6DA 2V9VA 1XSVA 3V7CA 2WC2A 2O8XA 4G8XA 5JFRA 1NHAA 1TQMA 3GFJA 3ZMZA 1IXRC 2KIUA 5DUIA 2O61A 1XGSA 3FWEA 3JSPA 1JHHA 4K2EA 3E5QA 3HRMA 1IN7A 3H3UA 4AVPA 2DTRA 1LQ1A 2XROA 2E1CA 3QAHA 4N9HA 2Q8KA 2EV0A 2GA2A 1JHFA 5K5QA 2MH9A 4FHTA 4RB3C 1TQPA 2FMYA 4OMYA 4P96A 3TKYA 2H6BA 1FYKA 2V79A 4KUMA 3IWZA 4EGZA 3R60A 1W5SA 1LDJA 4I7HA 2MLGA 3QU6A 3J7AO 3DF8A 3K69A 2J5PA 5LRSA 5DYMA 3KCCA 3IKVA 5DDGA 2DPDA 2GA1A 3I71A 1MGTA 4L9VA 4KA4A 1TTYA 2CSOA 5E1WA 4S04A 3F3XA 2AS5F 2O3FA 1RI7A 4XLNF 2F5EA 2E7XA 1LB2A 1HSJA 2FA5A 1FPQA 1F5TA 3CTAA 2BBYA 4Q48A 3MZYA 2L4MA 1XDUA 5ILSA 4CYDA 2ADUA 2D2WA 5DUKA 1Z7UA 3GX4X 4OIQF 1BI1A 2A5YB 4M9SA 3WE2A 2FBHA 2OQRA 2EFNA 2V1DA 1MKMA 5AIPA 2ZFWA 3HSRA 2VE8A 2JZYA 3M1EA 1ZRFA 3T8TA 3KZZA 3EYIA 2DI3A 3CJNA 1MJAA 4Q47A 4EJWA 2DLLA 3M7GA 5J8FA 4HQEA 5BPDA 3R6SA 1FBQA 5CVJA 4KICA 4U88A 4ZZDA 4UV8A 1ZRDA 1O3RA 4ZYEA 5L3EA 3F6OA 2DK5A 5L3CA 1AWCA 4UVBA 1QBJA 3I64A 5D5VB 2K27A 3DP7A 1XCVA 2DO7A 5LHHA 2IA1A 1IN8A 1FBSA 3BJ6A 5FD5A 3L2CA 4BHCA 1L3LA 2HQRA 1UHMA 3MEXA 2P5LC 3CUQA 4CXFA 3I58A 1G3YA 2EA2A 4HX8A 1IAWA 3KP6A 5HVQC 1BI3A 5LRRA 4LLGF 3SHFA 5CVUA 2DQRA 4OIPF 1HKQA 2H94A 1R36A 1GVJA 1T39A 1XN7A 4L5IA 1JGSA 4G7ZF 5HDKA 5AONA 4PGHA 4A0XA 3ZMDA 3GZ5A 1ODDA 5DCMB 3K1PA 2KRFA 1P2FA 5EEGA 4A6EA 1XCBA 1Y0UA 4BQAA 2HFHA 4FX0A 3WTVC 1ZH5A 4XSXF 5ILVA 4QWQA 4GYIA 2PMHA 1USTA 3I53A 2YR2A 1BIAA 5HS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6T A;  5JR3 A;  1IXS B;  3HIF A;  3O6B B;  3ABU A;  4ZZL A;  1I1S A;  1YW9 A;  2VC1 A;  1BI0 A;  3IC7 A;  3ERE D;  1BM9 A;  5CJ9 A;  3WOD F;  2WWY A;  2FU4 A;  2V1X A;  2XIG A;  3CLO A;  2FF4 A;  2EA4 A;  3FXQ A;  1P92 A;  4L9J A;  4KMU X;  1J7K A;  2EFO A;  4EMS A;  2VC0 A;  3TGN A;  2FEZ A;  5E1X A;  3CDH A;  3GW2 A;  4HX7 A;  1RUN A;  3G3Z A;  3FF5 A;  1KA8 A;  5BQT A;  2ZNY A;  3R61 A;  1B9N A;  1ZGA A;  1FP2 A;  2FXA A;  2OAZ A;  4LLL A;  2BGC A;  5CYV A;  2ZME B;  3OV8 A;  4CIC A;  2L01 A;  1IN6 A;  3MFK A;  3M8E A;  2ZCW A;  3HRS A;  3T1B A;  3HSF A;  4L5J A;  1GXQ A;  1B59 A;  2O03 A;  4RGS A;  2Z99 A;  5H6R A;  3FMS A;  5LEJ A;  2VXZ A;  3BJO A;  1ZG1 A;  3J81 Z;  1ON1 A;  2GIV A;  4P9F A;  1K79 A;  2H27 A;  2FQ3 A;  2RV8 A;  1YO5 C;  3CO7 C;  1FSH A;  3P7N A;  4EQQ A;  3ISP A;  2HYG D;  5D5U B;  1ZGJ A;  5E8G A;  2IW5 A;  1I27 A;  3KEQ A;  5ICF A;  4LB6 B;  1HST A;  4BYY A;  3GUD A;  4PGG A;  2FNP A;  5DEQ A;  1I1G A;  4XSZ F;  1TW2 A;  5HLI A;  3DKW A;  5HS7 A;  4HZF A;  2CW0 F;  3ECO A;  4BHB A;  3FXU A;  2R7D A;  4EM2 A;  4YFN F;  3RKX A;  2ACJ A;  2RKH A;  2PI0 A;  3BJA A;  3P9C A;  3I59 A;  3ZN0 A;  1S8N A;  2A6H F;  1Q1H A;  1XGN A;  3LWF A;  2NRA C;  1U8R A;  4NHJ A;  4CZZ A;  1T2K A;  1ON2 A;  4PZJ A;  2XRN A;  4OIR F;  2E7W A;  2ETH A;  4MEX F;  3Q9V A;  4JK1 X;  3J81 K;  2IP2 A;  4EJU A;  4U0V A;  4HOB A;  3WTZ A;  3F8C A;  2H09 A;  4ENK A;  3BY6 A;  2GXG A;  3SQN A;  3RKY A;  4EM0 B;  3W6J B;  2PG4 A;  2W57 A;  1YG2 A;  3HHH A;  3ELK A;  5D8L B;  3DXJ F;  1EH7 A;  1O7F A;  2F5F A;  3JW4 A;  4OOI A;  4JQF A;  2IPQ X;  2UZK A;  3MCZ A;  3SXY A;  4IRH A;  3WE3 A;  2XVC A;  1EH8 A;  2OZU A;  3BZ6 A;  3FM5 A;  1EH6 A;  4ZYH A;  2G9W A;  4RAZ A;  2M30 A;  4ENM A;  3LA2 A;  1IUY A;  3KE2 A;  2Y0M A;  5LBQ A;  1XSX A;  4L9T A;  2QBY A;  2IA2 A;  3L9F A;  4HF1 A;  2MD5 A;  2NNN A;  2CWE A;  1FWZ A;  1TNT A;  1GHC A;  4HW0 A;  3F23 A;  2GXB A;  2EJR A;  4WWC A;  3HUG A;  1FT9 A;  1CGP A;  2XAJ A;  4IJA A;  1Z91 A;  3T5X A;  1QGP A;  1J2X A;  4WF2 A;  4PCQ A;  1YLF A;  3GF2 A;  2IRF G;  1FYM A;  1ZAR A;  4HF2 A;  1YFH A;  2XAF A;  2RVC A;  1R1T A;  2OQG A;  4MQ9 F;  1QNT A;  1XMK A;  4N0B A;  3GFL A;  1DPR A;  4ESB A;  2PJP A;  5ILU A;  1J0R A;  3QOP A;  4NQW A;  1SMY F;  3DQV C;  3O3K A;  2HKO A;  3F8N A;  4MTE A;  4Y17 A;  4LJZ F;  4AIJ A;  4AWX B;  3J80 Z;  2FNA A;  3ML6 A;  2W25 A;  3GEZ A;  4UVC A;  4S05 A;  3JTG A;  2UWM A;  1S7O A;  1FLI A;  2JPC A;  2ISZ A;  2G7U A;  4OU0 A;  3WU0 A;  1TW3 A;  1S6L A;  4G7O F;  1KQ0 A;  2JSC A;  1U2W A;  1E17 A;  2AXL A;  5ICG A;  5FFX A;  3WTW C;  3V8J A;  3ZMU A;  5LEK A;  4P5O A;  1XDS A;  2DPU A;  4IHS A;  1OMI A;  5DD4 A;  1QZZ A;  2K86 A;  4AIK A;  4MEY F;  2F5D A;  5JHU A;  1P6R A;  2OU2 A;  4KIB A;  1K78 A;  3HTS B;  2NYX A;  3LAJ A;  2VBW A;  3GZ6 A;  2KIM A;  2HTS A;  5ICC A;  3RYP A;  5BS6 A;  3GLX A;  3FHZ A;  4AD9 A;  1QQI A;  1DP7 P;  1J9I A;  5HLG A;  1XB4 A;  3LFK A;  1LDK B;  2WTE A;  5HDG A;  2W24 A;  4ESF A;  4GXO A;  3H92 A;  2KIF A;  3DFG A;  2FSW A;  2VT2 A;  1W7P B;  3REO A;  3MWM A;  1S29 A;  3N97 A;  1YW7 A;  1BC8 C;  1SD4 A;  4RGR A;  2OBP A;  1WKM A;  5CVR A;  2COM A;  2W85 A;  2BV6 A;  1ZG3 A;  2ESH A;  3DV8 A;  1P4X A;  3K9T A;  3M9A A;  4GGG A;  4XRF A;  4HA8 A;  2FBK A;  1SFX A;  2YX7 A;  2CYY A;  1IRF A;  5TRD A;  3C3W A;  5JI6 A;  4BXU A;  5E18 F;  1ZN2 A;  4BAY A;  1CF7 B;  1JXS A;  3KP7 A;  2Z33 A;  3TQN A;  4D0P A;  2DT5 A;  3EET A;  4A0Y A;  1K7A A;  3GFI A;  2UXX A;  5IT9 Z;  3NEU A;  4O6J A;  5CVI A;  3TOA A;  2QLZ A;  1FZP B;  1U78 A;  2STW A;  3LAP A;  3E5U A;  2GAU A;  3IKT A;  1SD6 A;  4IVN A;  1MDM B;  1ZRC A;  4UV9 A;  1ONV A;  4HQM A;  3B02 A;  3LQQ A;  3ROU A;  2P6S A;  3L00 A;  1H0M A;  4HV6 A;  1DPU A;  3F6V A;  1FSE A;  4LMY A;  4LK1 F;  2XAG A;  4RGX A;  1O3Q A;  2VOD A;  1HW1 A;  2KJC A;  2VON A;  1Z6R A;  2O6G E;  3WU1 B;  2LKP A;  3FX3 A;  1X3U A;  4MGR A;  5LGN A;  5DV5 A;  5HOO A;  3L09 A;  4G7H F;  3I0T A;  5JVT A;  2K7L A;  2Q2E A;  3MZH A;  2D1V A;  3HOS A;  1PP7 U;  2CO5 A;  3KP2 A;  2EV6 A;  5D8K B;  3QU3 A;  2ESN A;  1EV7 A;  4AIH A;  1XMA A;  1REP C;  4M74 A;  2MBF A;  5D6F A;  1HW5 A;  4HLX A;  2G7H A;  4ON0 A;  4M6Y A;  3QP5 A;  5J6X A;  4LGW A;  2HEO A;  2DBB A;  1FNN A;  2QZ8 A;  2DK8 A;  3OOP A;  5HS8 A;  1TBX A;  2RGV A;  1WWX A;  4KFC A;  1ZRE A;  2VN2 A;  4KYW A;  1SFE A;  2FRH A;  2E1N A;  1IXC A;  4YIF A;  3KET A;  3V7S A;  1UFM A;  2RN7 A;  4RB1 A;  4IHT A;  3DEU A;  2QYO A;  1U3E M;  3ZPL A;  5IT3 A;  2HS5 A;  2IJL A;  4KDP A;  1LJ9 A;  2LF7 A;  3RKW A;  4I0A A;  2RQP A;  5D4S A;  3U1D A;  3E5X A;  3ZP5 A;  3HOT A;  1RIO H;  1D5V A;  4RGU A;  2LSO A;  3C7J A;  4HDU A;  1ZAO A;  2Z5U A;  5D6E A;  5FLX Z;  2J5O A;  1PUE E;  4CGZ A;  2PFB A;  2QM3 A;  2LNB A;  2VOP A;  1H9T A;  2QVO A;  1IW7 F;  4WXC A;  1KGS A;  1LVA A;  3ULQ B;  3IRQ A;  3E6C C;  2HQN A;  1G3W A;  5L3B A;  1KU9 A;  3K0L A;  4LLN A;  3K2Z A;  2P5V A;  1YW8 A;  2HGC A;  2CGP A;  2P5K A;  3NRV A;  1MD0 A;  1T98 A;  3WTY C;  3KZY A;  1B4A A;  2YX4 A;  5DCM A;  5DCF A;  2L4A A;  4LFU A;  3VFZ A;  3DPT A;  3BPV A;  5E17 F;  1U5T C;  4R8H A;  2CQK A;  1YYV A;  2HKX A;  2IA0 A;  4IRG A;  3I54 A;  4CHU A;  3VEP A;  4HLY A;  4ZH4 F;  2CG4 A;  4XLP F;  4CDG A;  3QRF F;  5HLH A;  2QQA A;  3W6K B;  4MTD A;  3F8B A;  4ENJ A;  2M5W A;  5F1R A;  4OIO F;  1ZYR F;  1JE8 A;  2A69 F;  3T8R A;  2LDU A;  5FLX K;  2KJB A;  4GCV A;  5FB2 A;  1O3T A;  3WGG A;  2EB7 A;  2X0L A;  2HZT A;  4M73 A;  5BPI A;  4ENN A;  3F8M A;  2PBI A;  4EGY A;  1LEA A;  2V6C A;  5J8C A;  3P9I A;  3HRU A;  1IF1 A;  2L54 A;  1A04 A;  1FY7 A;  4A2U A;  4HAM A;  2JRT A;  1LDD A;  3I5U A;  2XGX A;  3E97 A;  3EUH A;  1KYZ A;  1R58 A;  5DD8 A;  4EM1 A;  1G3S A;  4LG0 B;  2QUF A;  4HBL A;  2IT0 A;  4WX9 A;  2O0Y A;  1L0O C;  5LHI A;  3BWG A;  3EYY A;  3RJP A;  3HYI A;  2Y48 A;  2P8T A;  2L02 A;  2VBX A;  1BI2 A;  2F5C A;  2K4J A;  2PEX A;  4ETS A;  4EJT A;  4I98 B;  2XAQ A;  2PQ8 A;  2ZME A;  2VE9 A;  3FXR A;  1SAX A;  3H3Z A;  4TV7 A;  3S2W A;  5FD6 A;  1AOY A;  4XBF A;  2RDP A;  4G94 A;  2B0L A;  5A2Q Z;  1B1B A;  3ECH A;  1IRG A;  1SMT A;  5ED4 A;  1O3S A;  3WGH A;  3HTU A;  3ZMS A;  4M9X A;  2QEN A;  1J75 A;  3VOE A;  1F4K A;  4KNY A;  3GXO A;  5L3D A;  2RC4 A;  3V8L A;  2HDC A;  1R23 A;  3TOB A;  2EV5 A;  4QLC U;  3WTU C;  2Q0O A;  4LD5 A;  3WTS C;  1XD7 A;  1SFU A;  3RI4 A;  4HX4 A;  2L3D A;  1FBU A;  3ZN1 A;  3F21 A;  3FZV A;  4E70 A;  4Q5S F;  2HWV A;  4RAY A;  3EQL F;  3F8F A;  1KYW A;  1UHW A;  4LK0 F;  3K1M A;  3RDI A;  1WRJ A;  1R5H A;  4L18 B;  3KP5 A;  2OD5 A;  1H9G A;  1W7P D;  1QPM A;  3RPQ A;  4ZYG A;  1WI9 A;  2ZKZ A;  3FMR A;  5K5R A;  1PP8 F;  3M8F A;  1D3Y A;  4GO1 A;  4EV0 A;  2JPB A;  2ISY A;  1V4R A;  4YII A;  5A2Q K;  4LG0 A;  5TJJ A;  1I5Z A;  3SZT A;  2XKP A;  5F64 A;  2R7F A;  4BHP A;  1HQC A;  3IRR A;  1RUO A;  1TQI A;  4RB0 A;  1D8J A;  3BDD A;  4R1H A;  4U0W A;  3SFZ A;  1I6X A;  3BP8 A;  2EFW A;  2EFP A;  4BNC A;  2VBY A;  1MZB A;  3GFM A;  2HOE A;  2H6C A;  4FT8 A;  3LA3 A;  4R79 A;  5L3F A;  1OR7 A;  1QO0 D;  3EDP A;  4DNC A;  5KK1 A;  3TDU C;  3FMQ A;  2K02 A;  3JTH A;  1LNW A;  4RS8 A;  3R0J A;  3CUQ B;  3CUQ C;  2XKO A;  5AIQ A;  5F6F A;  3KEO A;  2JT1 A;  3N4M A;  2XAS A;  2BE5 F;  2QQB A;  1BN5 A;  2MA3 A;  2F2E A;  2M45 A;  2BEO A;  2V1U A;  3LST A;  4L0Y B;  3BRO A;  5BOX A;  2QQ9 A;  1Z1D A;  2XUB A;  3Q9S A;  3T0Y A;  5D4R A;  2FE3 A;  5FGM A;  1YS7 A;  4BH9 A;  4WK8 F;  2KKO A;  2CFX A;  2DAO A;  3COA C;  4RB2 C;  1FP1 D;  4EVI A;  4YFX F;  2DQL A;  3J80 K;  3F22 A;  4IF4 A;  4ESJ A;  2D1H A;  1G3T A;  2EWN A;  4Q4Z F;  5KVR A;  3IL2 A;  1J5Y A;  3WTX C;  4O3M A;  3ZQ7 A;  1YS6 A;  4M71 A;  5E1Z B;  1FYL A;  4WXH A;  1HBX G;  4P55 A;  1ZLJ A;  5FO5 A;  2LF8 A;  4KN7 X;  3HRT A;  1XGM A;  2RNJ A;  5LLQ A;  2HR3 A;  5L3G A;  2NS0 A;  2A3S A;  1HKT A;  4UHT A;  4ASN A;  1G6N A;  3LQR A;  1BC7 C;  1OYW A;  3G73 A;  1F9N A;  4U7B A;  1TNS A;  4IXA A;  2UXN A;  3ABT A;  2WV0 A;  5ERI A;  1R1U A;  1T38 A;  2YSR A;  3E6B A;  1WQ2 A;  1R5G A;  4M6X A;  2FBI A;  5E8I A;  2VBZ A;  4NB5 A;  3KP3 A;  1S3J A;  4HV5 A;  4PDK A;  1BBY A;  4EJV A;  4JBA A;  5CLS A;  4YFK F;  1HW2 A;  3NQO A;  1VTN C;  3JAM Z;  6PAX A;  2P7C B;  1DDN A;  1RZ4 A;  4HF0 A;  2W84 A;  3RTR A;  2ZNZ A;  3O2P E;  5ICE A;  4WCG A;  5E20 A;  3KLO A;  1WSU A;  2DFI A;  1KQ8 A;  1FOK A;  2K4B A;  2M1B A;  4ZYD A;  4UVA A;  1MJ9 A;  1KU7 A;  3E6M A;  3QPT A;  3F72 A;  3RIR A;  1G4D A;  1W7P A;  1O57 A;  1W5T A;  2MH2 A;  3SZP A;  3Q5F A;  4G6Q A;  2FOK A;  1MJB A;  5IT9 K;  2ELH A;  2A61 A;  4MNU A;  4FX4 A;  2BYV E;  2Z3Y A;  1FC3 A;  1XSD A;  4F7Z A;  2EFQ A;  1Z05 A;  2MLK A;  5BMZ A;  1ZHF A;  5D5W B;  1OYI A;  1PDN C;  5HDN A;  3BPX A;  2DU9 A;  5EEH A;  5LHG A;  2NNY A;  1YIO A;  4B8X A;  1W4M A;  4MHG A;  4UXN A;  1D8K A;  3IHU A;  1P4A A;  3LA7 A;  5K1Y A;  4KT5 C;  1CF7 A;  1XGO A;  4A5N A;  1BOA A;  1ZLK A;  4L0Z B;  1SD5 A;  4UUV A;  1ULY A;  1OPC A;  4A6D A;  3JAM K;  1P4W A;  3PQJ A;  4OIN F;  4U7D A;  2HTJ A;  1C0W A;  3HHG A;  3L7W A;  4I2O A;  3I59 B;  3RYR A;  1J59 A;  2FML A;  2YPR A;  4U0Y A;  2P7V B;  2C6Y A;  3KFW X;  5H6Q A;  2A07 F;  3TDZ C;  2STT A;  3R4K A;  4I02 A;  3MQ0 A;  3WGI A;  1MDM A;  3VOD A;  3D0S A;  2EK5 A;  1Z9C A;  1B6A A;  3GWZ A;  3QPH A;  1F1Z A;  4IRI A;  3TO9 A;  2X4H A;  2MC3 A;  1OKR A;  3JSO A;  3DPL C;  1HKS A;  2NAZ A;  2ZJ2 A;  4Y15 A;  1R1V A;  3U9G A;  2JTV A;  5CVV A;  1R7J A;  3R0A A;  1OYY A;  1QZY A;  3U2R A;  4GYG A;  3C18 A;  3VB2 A;  1T0F A;  2Y75 A;  3K1N A;  1U5T B;  5D5X B;  1LEB A;  1IZ1 A;  4EJO A;  2ZBK A;  4IPA A;  1SD7 A;  1U6G A;  1UB9 A;  3GVA A;  2XHK A;  1ZG5 A;  1YTY A;  3QP6 A;  4A12 A;  2TDX A;  3WTT C;  3AAF A;  3MAJ A;  4G6D A;  2QBY B;  2GQQ A;  1V3F A;  4LB5 A;  3V8K A;  1RNL A;  4KN4 X;  1UCR A;  3GYH X;  4WXD A;  2A6E F;  2YU3 A;  3P9K A;  4N9I A;  1IN4 A;  4M72 A;  3ZMV A;  1R22 A;  2R3S A;  1R00 A;  1IN5 A;  1TLH B;  4I01 A;  5LGT A;  2PLY A;  2A68 F;  4O5V A;  1Z6T A;  2HYF A;  3CUO A;  4Z2Y A;  4A0Z A;  2OZ6 A;  2M87 A;  4Y13 A;  3V7R A;  2PN6 A;  2IVM A;  2D45 A;  5H20 A;  1O7L A;  3GO5 A;  2QWW A;  3V4G A;  4KIG A;  4MQV A;  1GXP A;  4CO8 A;  4DQ2 A;  2DW4 A;  3HSE A;  2PMU A;  4KIF A;  4I09 A;  3PFI A;  1BIB A;  3CO6 C;  1K6O A;  1B9M A;  3ZMT A;  5LGU A;  3TO6 A;  4KMF A;  2GWR A;  2M8E A;  2VT3 A;  2XV4 S;  4A5M A;  3E3V A;  1KU2 A;  1E2X A;  1T6S A;  3BOQ A;  3I4P A;  1KU3 A;  3PQK A;  2ZO4 A;  3IWF A;  4G9Y A;  3WG9 A;  3B73 A;  1YQA A;  4L9N A;  4M9Z A;  1K78 B;  1S7A A;  4I0B A;  3D5L A;  1U5T A;  4HDV A;  1FX7 A;  2P4W A;  1STZ A;  4P9U A;  1USS A;  4UNO A;  5K5O A;  1HXD A;  3KP4 A;  4OMZ A;  5FFZ A;  2XAH A;  4H0E A;  2GZW A;  3TO7 A;  1BJA A;  1KQ9 A;  2Z9O A;  3RPU A;  2OA4 A;  2ZXJ A;  2VOO A;  1DUX C;  4B09 A;  3C1D A;  3KLN A;  4YG2 F;  4HYE A;  3FM3 A;  3E6D A;  2V9V A;  1XSV A;  3V7C A;  2WC2 A;  2O8X A;  4G8X A;  5JFR A;  1NHA A;  1TQM A;  3GFJ A;  3ZMZ A;  1IXR C;  2KIU A;  5DUI A;  2O61 A;  1XGS A;  3FWE A;  3JSP A;  1JHH A;  4K2E A;  3E5Q A;  3HRM A;  1IN7 A;  3H3U A;  4AVP A;  2DTR A;  1LQ1 A;  2XRO A;  2E1C A;  3QAH A;  4N9H A;  2Q8K A;  2EV0 A;  2GA2 A;  1JHF A;  5K5Q A;  2MH9 A;  4FHT A;  4RB3 C;  1TQP A;  2FMY A;  4OMY A;  4P96 A;  3TKY A;  2H6B A;  1FYK A;  2V79 A;  4KUM A;  3IWZ A;  4EGZ A;  3R60 A;  1W5S A;  1LDJ A;  4I7H A;  2MLG A;  3QU6 A;  3J7A O;  3DF8 A;  3K69 A;  2J5P A;  5LRS A;  5DYM A;  3KCC A;  3IKV A;  5DDG A;  2DPD A;  2GA1 A;  3I71 A;  1MGT A;  4L9V A;  4KA4 A;  1TTY A;  2CSO A;  5E1W A;  4S04 A;  3F3X A;  2AS5 F;  2O3F A;  1RI7 A;  4XLN F;  2F5E A;  2E7X A;  1LB2 A;  1HSJ A;  2FA5 A;  1FPQ A;  1F5T A;  3CTA A;  2BBY A;  4Q48 A;  3MZY A;  2L4M A;  1XDU A;  5ILS A;  4CYD A;  2ADU A;  2D2W A;  5DUK A;  1Z7U A;  3GX4 X;  4OIQ F;  1BI1 A;  2A5Y B;  4M9S A;  3WE2 A;  2FBH A;  2OQR A;  2EFN A;  2V1D A;  1MKM A;  5AIP A;  2ZFW A;  3HSR A;  2VE8 A;  2JZY A;  3M1E A;  1ZRF A;  3T8T A;  3KZZ A;  3EYI A;  2DI3 A;  3CJN A;  1MJA A;  4Q47 A;  4EJW A;  2DLL A;  3M7G A;  5J8F A;  4HQE A;  5BPD A;  3R6S A;  1FBQ A;  5CVJ A;  4KIC A;  4U88 A;  4ZZD A;  4UV8 A;  1ZRD A;  1O3R A;  4ZYE A;  5L3E A;  3F6O A;  2DK5 A;  5L3C A;  1AWC A;  4UVB A;  1QBJ A;  3I64 A;  5D5V B;  2K27 A;  3DP7 A;  1XCV A;  2DO7 A;  5LHH A;  2IA1 A;  1IN8 A;  1FBS A;  3BJ6 A;  5FD5 A;  3L2C A;  4BHC A;  1L3L A;  2HQR A;  1UHM A;  3MEX A;  2P5L C;  3CUQ A;  4CXF A;  3I58 A;  1G3Y A;  2EA2 A;  4HX8 A;  1IAW A;  3KP6 A;  5HVQ C;  1BI3 A;  5LRR A;  4LLG F;  3SHF A;  5CVU A;  2DQR A;  4OIP F;  1HKQ A;  2H94 A;  1R36 A;  1GVJ A;  1T39 A;  1XN7 A;  4L5I A;  1JGS A;  4G7Z F;  5HDK A;  5AON A;  4PGH A;  4A0X A;  3ZMD A;  3GZ5 A;  1ODD A;  5DCM B;  3K1P A;  2KRF A;  1P2F A;  5EEG A;  4A6E A;  1XCB A;  1Y0U A;  4BQA A;  2HFH A;  4FX0 A;  3WTV C;  1ZH5 A;  4XSX F;  5ILV A;  4QWQ A;  4GYI A;  2PMH A;  1UST A;  3I53 A;  2YR2 A;  1BIA A;  5HS9 A; 
#chains in the Genus database with same CATH topology
 4F52 A;  2P6T A;  3HOY J;  3S16 J;  5JR3 A;  1YHQ I;  1IXS B;  3HIF A;  1WZ2 A;  1KON A;  4HRI A;  3O6B B;  1WJD A;  3DCF A;  1MBH A;  2XPU A;  3ABU A;  4ZZL A;  5FLV A;  4BAC A;  1OCP A;  1I1S A;  2L7M P;  3G71 I;  2WY7 Q;  2HDD A;  3A1Y A;  4S0H B;  1YW9 A;  2VC1 A;  1BI0 A;  3IC7 A;  3ERE D;  1BM9 A;  5CJ9 A;  3LSG A;  3WOD F;  1OCC H;  4ZYA A;  3FHN A;  2LY1 A;  4FIS A;  1D1A A;  2WWY A;  2H8R A;  5CQG A;  2FU4 A;  2V1X A;  2XIG A;  4BEH B;  3SJM A;  1RR8 C;  3CLO A;  2FF4 A;  2QKL B;  2EA4 A;  1P7J A;  3FXQ A;  1P92 A;  4L9J A;  2X1E A;  2JQ7 A;  3EUH C;  4KMU X;  4BE2 A;  1J7K A;  2LKX A;  2EFO A;  2Y0S A;  2KZV A;  4EMS A;  3ZGK A;  4A3K J;  3ABM H;  2R0Q C;  5EF6 A;  3L2U A;  2VC0 A;  3JCU C;  3TGN A;  1A31 A;  3HOX J;  2KP6 A;  3G6E I;  2FEZ A;  3X2Q H;  3VYR B;  5E1X A;  5CQE A;  3CDH A;  3GW2 A;  4HX7 A;  4OAZ A;  1RUN A;  1B8I A;  1VQ8 I;  1JUP A;  3G3Z A;  3FF5 A;  3W3C A;  1KA8 A;  5BQT A;  3HB9 A;  2ZNY A;  1IO2 A;  1T56 A;  2LFB A;  2XF7 A;  3R61 A;  1B9N A;  5KCM A;  1ZGA A;  1FP2 A;  3S93 A;  2FXA A;  1GLN A;  1AKH B;  4I99 C;  2OAZ A;  1G8X A;  4LLL A;  1P7I A;  4CA0 A;  1T33 A;  2BGC A;  4BXF A;  2B63 J;  2IGM A;  2L0K A;  3I4M J;  5CYV A;  2ZME B;  3E7L A;  3OV8 A;  3BG5 A;  2AXT C;  4CIC A;  3S14 J;  2R5Z B;  1GVD A;  1Z3X A;  2L01 A;  1IN6 A;  1TC3 C;  3ABK H;  3ZOB A;  5HOD A;  3MFK A;  3MZ8 A;  3M8E A;  2W4S A;  2ZCW A;  1AA7 A;  3HRS A;  1BOB A;  3M4O J;  2W1O A;  3HSF A;  2DMP A;  3T1B A;  5GPA A;  2HYJ A;  4L5J A;  5FKN A;  2KDO A;  5GAD J;  2MW8 A;  1GXQ A;  1R6R A;  2DDA A;  1B59 A;  2O03 A;  1IG7 A;  4RGS A;  2Z99 A;  5GAG J;  5H6R A;  3FMS A;  5LEJ A;  2VXZ A;  3BJO A;  3OYG A;  1ZG1 A;  3KX2 A;  2M7A A;  3J81 Z;  3L1P A;  1YJN I;  1ON1 A;  2E34 A;  2GIV A;  4P9F A;  1K79 A;  2H27 A;  2FQ3 A;  2F4I A;  2RV8 A;  1YO5 C;  3CES A;  1YRN B;  2ZXW H;  3CO7 C;  1FSH A;  3P7N A;  4EQQ A;  3ISP A;  4X1E A;  2HYG D;  2AHQ A;  5D5U B;  4RBO A;  4BJ6 C;  2JA7 J;  1ZGJ A;  1Z21 A;  1Y8Q B;  5E8G A;  2O5R A;  4CCM A;  3SEZ A;  3FIS A;  2IW5 A;  3ASO H;  2Y0S N;  1I27 A;  4UY8 I;  3KEQ A;  3CP2 A;  5ICF A;  4LB6 B;  1HST A;  2K9M A;  2MC4 A;  4BYY A;  1FTZ A;  5GP9 A;  3GUD A;  5B1A H;  4PGG A;  2FNP A;  3C2B A;  1OCO H;  5DEQ A;  1R49 A;  2GIZ A;  4OAY A;  3AL0 B;  3AL0 C;  1I1G A;  1WJC A;  3CCY A;  4XSZ F;  1TW2 A;  3FXJ A;  5E3N A;  5HLI A;  2JA8 J;  3IAM 2;  3DKW A;  5HS7 A;  4HZF A;  4LIV A;  3M1C A;  2CW0 F;  2JUG A;  3K4K A;  1IRX A;  1OFC X;  2ZFU A;  4Y52 J;  3ECO A;  3BG7 A;  4BHB A;  1FOY A;  3FXU A;  4II3 A;  1XX5 A;  4M3E A;  4NQW B;  3GTL J;  2R7D A;  4EM2 A;  4YFN F;  3RKX A;  2ACJ A;  4G6T B;  2DMQ A;  2Q1Z B;  2RKH A;  2PI0 A;  3BJA A;  1OJL A;  5J3L A;  3P9C A;  4DZJ A;  3I59 A;  1VQL I;  2OPT A;  3ZN0 A;  4BS9 A;  4UUS B;  1S8N A;  3OYF A;  1PJR A;  1S7E A;  1Q1H A;  2A6H F;  3NWS A;  2NVQ J;  1XGN A;  3LWF A;  4V2F A;  2WY8 Q;  1K4T A;  3GTO J;  2NRA C;  1U8R A;  2VJ4 A;  4NHJ A;  2X85 A;  4CZZ A;  2ELJ A;  1T2K A;  5IYD J;  1JJ6 C;  1ON2 A;  3QYB A;  3G1O A;  3OR1 C;  1ETK A;  1VFC A;  4Y33 A;  1ZK8 A;  2XRN A;  4PZJ A;  4PK4 A;  4OIR F;  2E7W A;  2ETH A;  2OV7 A;  1ETX A;  4MEX F;  2H1K A;  3H5A A;  4J01 A;  3FDY A;  3Q9V A;  1SVO A;  1JUM A;  4JK1 X;  3J81 K;  2R7O A;  2IS6 A;  2IP2 A;  5IP6 A;  4EJU A;  4U0V A;  4HOB A;  3WTZ A;  3F8C A;  2H09 A;  1X1A A;  1RES A;  1I39 A;  4ENK A;  2JA2 A;  3BY6 A;  2GXG A;  3SQN A;  3RKY A;  4B44 A;  2BY0 A;  2N8G A;  4EM0 B;  3W6J B;  1OR7 C;  1VQN I;  1WJF A;  2PG4 A;  1BR4 A;  2W57 A;  1YG2 A;  2XPW A;  3HHH A;  2GOM A;  3ELK A;  5D8L B;  1EJ9 A;  3DXJ F;  2M34 A;  2X6W A;  2IS2 A;  1EH7 A;  1O7F A;  1F36 A;  1ETY A;  5J4V A;  2F5F A;  2R5Z A;  3JW4 A;  3MKL A;  2HPM A;  1Y0N A;  1JJ8 C;  4OOI A;  1A35 A;  1X4P A;  1FMV A;  2Y9Y A;  2M9H A;  4JQF A;  2BVM A;  2IPQ X;  2UZK A;  3MCZ A;  3SXY A;  4IRH A;  3WE3 A;  2XVC A;  1EH8 A;  2OZU A;  4B47 A;  4Y7N J;  2VPR A;  3BZ6 A;  2KIS A;  2XGE A;  3FM5 A;  1EH6 A;  4ZYH A;  3CD6 I;  2VPL A;  2G9W A;  4RAZ A;  2M30 A;  5EDN A;  1MNE A;  3LA2 A;  4ENM A;  1IUY A;  3KE2 A;  1B72 A;  2Y0M A;  5LBQ A;  1XSX A;  4C2M J;  1ETV A;  1FIP A;  4L9T A;  2ZJQ F;  2QBY A;  2IA2 A;  3L9F A;  4HF1 A;  2MD5 A;  2NNN A;  4XOT A;  1D0Z A;  2R4G A;  2CWE A;  3MKZ A;  1RC9 A;  4HSR A;  3VWB A;  1FWZ A;  1A6Q A;  1TNT A;  2DA5 A;  2EBI A;  3G4S I;  1GHC A;  4HW0 A;  3F23 A;  1JTY A;  4GRI A;  2GXB A;  2EJR A;  4WWC A;  3HUG A;  4XRM A;  2HU9 A;  1MSE C;  1FT9 A;  1CGP A;  1G2H A;  2BY3 A;  2XAJ A;  4IJA A;  1Z91 A;  3T5X A;  4X0G A;  1QGP A;  2K85 A;  1J2X A;  4WF2 A;  1BR1 A;  1XPX A;  1VZ0 A;  1J09 A;  2NS8 A;  4PCQ A;  2E2H J;  4C3H J;  1YLF A;  3GF2 A;  3CCM I;  2LTP A;  1RKT A;  1FYM A;  2IRF G;  4D5C A;  1ZAR A;  2NVY J;  4HF2 A;  1YFH A;  2XAF A;  2RVC A;  1R1T A;  2OQG A;  4H4K C;  4MQ9 F;  1QNT A;  1XMK A;  4XLE A;  4N0B A;  5E3L A;  2B9S A;  3GFL A;  1DPR A;  4ESB A;  2PJP A;  3PO2 J;  4HST A;  5ILU A;  1J0R A;  2KHM A;  3HPH A;  3QOP A;  4NQW A;  1SMY F;  3HOV J;  3DQV C;  5GAH J;  4IX7 A;  5CPR B;  3S1N J;  3O3K A;  2HKO A;  3F8N A;  4JYK A;  4MTE A;  4Y17 A;  4LJZ F;  3PO3 J;  4AIJ A;  1EKE A;  4AWX B;  3J80 Z;  2BOL A;  4F55 A;  3TP3 A;  2FNA A;  2K9S A;  3BCA A;  3WG7 H;  3ML6 A;  2W25 A;  3GEZ A;  3DEE A;  4UVC A;  1W0U A;  3CMA I;  3BR5 A;  2QGU A;  1OQY A;  4S05 A;  2TCT A;  3HGG A;  3JTG A;  2UWM A;  1S7O A;  2K40 A;  1FLI A;  2JPC A;  1I3Q J;  2ISZ A;  2G7U A;  4OU0 A;  3WU0 A;  1TW3 A;  2R7W A;  1S6L A;  3BR0 A;  4G7O F;  1KQ0 A;  2JSC A;  1U2W A;  2KIQ A;  1U8B A;  3RQ4 A;  9ANT A;  1E17 A;  2AXL A;  5ICG A;  2DOF A;  5FFX A;  3WTW C;  2D5V A;  3BR2 A;  5FJ8 J;  3V8J A;  3ZMU A;  2BXY A;  1TP4 A;  2LH9 A;  5LEK A;  2DA3 A;  4P5O A;  1XDS A;  3GLL A;  2FQ4 A;  2DPU A;  4IHS A;  1OMI A;  5DD4 A;  1QZZ A;  2PJR A;  2K86 A;  4AIK A;  4MEY F;  1K6Y A;  2F5D A;  5JHU A;  3CF2 A;  1P6R A;  3JRB A;  4V2G A;  2OU2 A;  4EAT A;  4KIB A;  1K78 A;  3HTS B;  2NYX A;  3ZQH A;  3LAJ A;  5FKK A;  2VBW A;  2DMT A;  3B6A A;  4RAF A;  3K4J A;  2ID3 A;  2KIM A;  3GZ6 A;  2HTS A;  2QA4 I;  4BE0 A;  3IH2 A;  1MBE A;  5ICC A;  1MH3 A;  3RYP A;  4BGD A;  4PJJ A;  4DIQ A;  5BS6 A;  3OYC A;  3GLX A;  3FHZ A;  4AD9 A;  1QQI A;  1DP7 P;  1J9I A;  2CV1 A;  5HLG A;  2P0W A;  1TT0 A;  2QSF X;  4QIW N;  3IH4 A;  3S1M J;  4HPQ A;  1XB4 A;  3AG1 H;  3LSI A;  1Q1V A;  2VIX A;  3LFK A;  2V26 A;  3MVP A;  1LDK B;  1MBG A;  2VKD A;  2GOX B;  2WTE A;  5HDG A;  2W24 A;  4ESF A;  3W2A A;  2HDW A;  4GXO A;  5FLM J;  5IYB J;  3H92 A;  4XOP A;  2KIF A;  3DFG A;  1VND A;  2FSW A;  3MD2 A;  1MH4 A;  1BJZ A;  2VT2 A;  1W36 D;  2JWT A;  1W7P B;  3REO A;  3MWM A;  1S29 A;  3K4N A;  3NWT A;  3N97 A;  1YW7 A;  5E3O A;  1YJ9 I;  1ETQ A;  1BC8 C;  1SD4 A;  1HDP A;  1JKQ C;  1I6H J;  4RGR A;  4BJT A;  1MMD A;  3F0C A;  4N4N B;  2E71 A;  2OBP A;  2R5Y A;  1WKM A;  3CCR I;  5CVR A;  2COM A;  4JOM A;  3LSH A;  3OS2 A;  3JRI A;  4ZTF A;  2W85 A;  2BV6 A;  1ZG3 A;  2VJI A;  2IS1 A;  2ESH A;  3DV8 A;  1TWA J;  1P4X A;  3J7A Y;  3K9T A;  3M9A A;  5EGO B;  4GGG A;  4XRF A;  4HA8 A;  2FBK A;  3H36 A;  1SFX A;  2YX7 A;  4RDU A;  3VSK A;  1N75 A;  2CYY A;  1IRF A;  4MLO A;  3CP8 A;  4IOA F;  5TRD A;  2CW8 A;  4YIR X;  3C3W A;  5JI6 A;  2KLO A;  1Z7L A;  3QOD A;  4BJ5 C;  2R93 J;  4BXU A;  5E18 F;  1ZN2 A;  1LPQ A;  4C3I J;  2YUS A;  4BAY A;  3DKX A;  2DA7 A;  2Y2Z A;  1CF7 B;  1JXS A;  3KP7 A;  3S32 A;  2Z33 A;  3S1R J;  4C3J J;  2ZSI B;  3TQN A;  3U1K A;  4D0P A;  2DT5 A;  2DCE A;  3EET A;  4A0Y A;  1K7A A;  5IY5 H;  1S72 I;  3GFI A;  2E35 A;  4PJN A;  4IQ4 A;  1VQ7 I;  2UXX A;  4ZDO A;  5IT9 Z;  2XSJ C;  3NEU A;  4O6J A;  3ZQG A;  1QZE A;  2JK3 A;  3OYB A;  3CCE I;  5CVI A;  3TOA A;  3ESW B;  4PSW A;  5C4J J;  2QLZ A;  2QF7 A;  1FZP B;  3PM1 A;  1U78 A;  2STW A;  4AU7 A;  4XN3 A;  3LAP A;  2NXN B;  4ZJZ A;  3E5U A;  4JX5 A;  4XNF A;  2ELK A;  2GAU A;  3IKT A;  2Z2S B;  1SD6 A;  4IVN A;  3S3M A;  3BR3 A;  1MDM B;  1ZRC A;  4UV9 A;  1ONV A;  4HQM A;  4M3D A;  3B02 A;  1LFU P;  2DA4 A;  3LQQ A;  4FET A;  3ROU A;  2P6S A;  3L00 A;  2JA5 J;  1H0M A;  1MMA A;  2GXA A;  2ME0 A;  4HV6 A;  1DPU A;  3F6V A;  1FSE A;  3KYC B;  4LMY A;  1UJ8 A;  4LK1 F;  3TBI A;  1POG A;  3VYS B;  2XAG A;  2Y9Z A;  2XB0 X;  4RGX A;  1O3Q A;  2VOD A;  5CKT A;  3OYA A;  3CME I;  1HW1 A;  2KJC A;  2VON A;  2XF6 A;  1Z6R A;  4ZDL A;  4PUS A;  2QQ8 A;  2QEX I;  2BXZ A;  2MD0 A;  3TMO A;  2O6G E;  2DFF A;  3Q0U A;  3WU1 B;  2LKP A;  4BQO A;  3FX3 A;  2CV0 A;  1X3U A;  4MGR A;  2DJN A;  5LGN A;  5DV5 A;  3Q0W A;  3GTK J;  2JN6 A;  5HOO A;  3L09 A;  4G7H F;  4XIC A;  4M3B A;  3I0T A;  1ENH A;  5JVT A;  2K7L A;  2L9R A;  2Q2E A;  4CUG A;  1V55 H;  4XN0 A;  1WPK A;  2Z16 A;  2D1V A;  3MZH A;  4IO9 F;  1HDD C;  4E7Z A;  3HOS A;  1PP7 U;  2EZK A;  2CO5 A;  3KP2 A;  2MYS A;  2EV6 A;  3LSK A;  2LBF B;  2BW3 A;  5D8K B;  3QU3 A;  2ESN A;  4C30 A;  3FBN B;  1EV7 A;  3DKY A;  5KNL A;  3JRE A;  2NOJ B;  4AIH A;  2HQ5 A;  1XMA A;  1REP C;  4M74 A;  2MBF A;  3A02 A;  5D6F A;  1HW5 A;  4HLX A;  2G7H A;  2VQG A;  4ZC3 A;  4ON0 A;  2DT7 B;  1X3W B;  4KT6 A;  3QP5 A;  3HBL A;  4M6Y A;  5J6X A;  4LGW A;  2HEO A;  1FEX A;  2DBB A;  1FNN A;  2ZJP F;  4XQF A;  2QZ8 A;  2O8K A;  5IOZ A;  1WH7 A;  2DK8 A;  2L9V A;  3OOP A;  5HS8 A;  1TBX A;  3KZI C;  5C4X J;  2RGV A;  1WWX A;  1PYV A;  4KFC A;  1ZRE A;  2VN2 A;  3CMM A;  4KYW A;  5IP7 J;  1SFE A;  2FRH A;  2E1N A;  1IXC A;  4PJM A;  4YIF A;  3KET A;  2VQH A;  4RMN A;  3V7S A;  1UFM A;  2ICW G;  4B1R A;  2RN7 A;  4RB1 A;  1N77 A;  4IHT A;  2OTJ I;  3DEU A;  2QYO A;  1VQO I;  1U3E M;  3ZPL A;  4IQJ A;  1LE8 A;  4IKF A;  2DA1 A;  2JRM A;  1Y8R B;  5IT3 A;  2HS5 A;  3A4C A;  2IJL A;  4KDP A;  4BBR J;  1LJ9 A;  2LF7 A;  2MSY A;  3RKW A;  1BR2 A;  2HOA A;  3RPU D;  2V9P A;  3ABL H;  1NH3 A;  4I0A A;  2RQP A;  5D4S A;  3U1D A;  3E5X A;  3ZP5 A;  2LC2 A;  3HOT A;  5F04 A;  4E7H A;  1RIO H;  1HA8 A;  1D5V A;  4RGU A;  3WHB A;  2LSO A;  3C7J A;  4HDU A;  1ZAO A;  2Z5U A;  4ABZ A;  4DOZ A;  2EIJ H;  5D6E A;  4D5F A;  5FLX Z;  2J5O A;  1RR7 A;  3L2Q A;  2NVT J;  2R92 J;  3LOC A;  1PUE E;  4CGZ A;  2PFB A;  2QM3 A;  2LR8 A;  2LNB A;  4CH7 A;  2VOP A;  1H9T A;  2QVO A;  1IW7 F;  3HKZ A;  5EG0 B;  4AM3 A;  5E3M A;  4WXC A;  1KGS A;  1LVA A;  1UHS A;  1XG1 A;  3ULQ B;  3IRQ A;  5LD2 C;  2NVU B;  2ZSH B;  5B3S H;  1E3H A;  3E6C C;  3K4L A;  4AID A;  2HQN A;  1G3W A;  5L3B A;  3C2G A;  1QPI A;  1KU9 A;  3CCU I;  3SDG A;  1DGW Y;  4CYC A;  1MBJ A;  5K7F A;  2BY2 A;  1WVR A;  3OYJ A;  3K0L A;  2Y31 A;  4NNJ A;  2KDZ A;  4CCL A;  4PFO A;  2HVQ A;  5DS9 A;  3K2Z A;  4LLN A;  1LVK A;  2CQN A;  1JKP C;  2QKM B;  2P5V A;  1WJE A;  1YW8 A;  2HGC A;  5DM7 F;  2CGP A;  2P5K A;  3NRV A;  1MD0 A;  4A3J J;  2XSD C;  1QU3 A;  1T98 A;  3WTY C;  3CCQ I;  2HQA A;  3KZY A;  1X3Z B;  1B4A A;  2YX4 A;  5DCM A;  5DCF A;  1UG2 A;  2L4A A;  4E7L A;  1W5C C;  4LFU A;  4NC6 A;  4JX4 A;  2WAE A;  3VFZ A;  3W2V A;  1EA3 A;  3M07 A;  3DPT A;  3BPV A;  3GTM J;  4DYQ A;  5E17 F;  1U5T C;  2OJE D;  3K4B A;  3A01 B;  4R8H A;  3RSN A;  2CQK A;  1YYV A;  2WV1 A;  1H88 C;  2F6C A;  2HKX A;  2IA0 A;  4DYR A;  2XB5 A;  4IRG A;  3I54 A;  4CHU A;  3VEP A;  5C44 J;  4HLY A;  2KPM A;  5J47 A;  4ZH4 F;  2CG4 A;  4XLP F;  4CDG A;  3QRF F;  5HLH A;  2QQA A;  3W6K B;  4MTD A;  2LG4 A;  4DJA A;  1T95 A;  1Z77 A;  3F8B A;  4ENJ A;  2M5W A;  5F1R A;  4NDL A;  3I56 I;  4OIO F;  3BLY A;  4IHV A;  1ZYR F;  1JE8 A;  2A69 F;  3T8R A;  3BG3 A;  1YI2 I;  2LDU A;  5FLX K;  1KZH A;  2KJB A;  3HOW J;  4GCV A;  5FB2 A;  1O3T A;  4A93 J;  3WGG A;  2EB7 A;  2X0L A;  2IEK A;  2M8G X;  2HZT A;  1DU6 A;  2CV2 A;  4BY7 J;  4KIT B;  4A3M J;  1F43 A;  1OCZ H;  4M73 A;  3HKZ N;  1VQP I;  5BPI A;  4W1U A;  3F8M A;  4ENN A;  2PBI A;  2JVH A;  1IRZ A;  4EGY A;  2DTZ A;  1LEA A;  4E7I A;  2V6C A;  5J8C A;  3P9I A;  2HXI A;  1S9H A;  3HOZ J;  3HRU A;  4BEH A;  2X6Y A;  1IF1 A;  2VL8 A;  1ZEL A;  2L54 A;  1A04 A;  3OYE A;  1FY7 A;  4A2U A;  3MMY B;  4HAM A;  3OL3 A;  2JRT A;  4PJL A;  1LDD A;  3I5U A;  2XGX A;  3E97 A;  3EUH A;  3S17 J;  3TW7 A;  1KYZ A;  1R58 A;  5DD8 A;  4EM1 A;  1G3S A;  4LG0 B;  2QUF A;  2WBM A;  4HBL A;  3WU2 C;  2IT0 A;  2UUZ A;  4WX9 A;  1RRJ A;  2HXO A;  2O0Y A;  3EUA A;  1L0O C;  2FOW A;  3VSL A;  4BE1 A;  5LHI A;  1UG0 A;  2M4K A;  2W7N A;  2K5C A;  3BWG A;  3FXM A;  3EYY A;  4RLF A;  3Q3S A;  3RJP A;  2KFD A;  3HYI A;  3S3N A;  2Y48 A;  2GM4 A;  2XF5 A;  4BQN A;  2P8T A;  4B3A A;  2L02 A;  2VBX A;  3H1C A;  4OWR B;  1AKH A;  1BI2 A;  1TWC J;  2F5C A;  1SEU A;  2K4J A;  1HCR A;  2RQQ A;  2PEX A;  4AC0 A;  4ETS A;  4EJT A;  4I98 B;  2XAQ A;  2EIM H;  2LOO A;  2PQ8 A;  2ZME A;  1Y1V J;  1JT0 A;  3E0J B;  2O9L A;  2VE9 A;  1IV6 A;  2JJ7 A;  3FXR A;  1SAX A;  1QVU A;  2GLO A;  1O4X A;  3H3Z A;  2CUZ A;  4TV7 A;  3S2W A;  2EZI A;  5FD6 A;  1AOY A;  4XBF A;  2RDP A;  3FXK A;  4G94 A;  1HLV A;  1R9T J;  2CUE A;  5HNH A;  2KL4 A;  2B0L A;  5A2Q Z;  1B1B A;  3ECH A;  1JGG A;  4B4C A;  1IRG A;  3OYH A;  3P5J A;  1SMT A;  5ED4 A;  1O3S A;  3ZQL A;  3WGH A;  3PNT A;  3HDD A;  3CDL A;  5EYR A;  4E6K G;  3HTU A;  3ZMS A;  1AHD P;  3BCB A;  4M9X A;  3SYT A;  2QEN A;  1J75 A;  4XL9 A;  3VOE A;  1F4K A;  4KNY A;  3HZJ A;  1ACI A;  1XS9 A;  3GXO A;  1YRN A;  5L3D A;  3LSP A;  2RC4 A;  3FK6 A;  3OS0 A;  3V8L A;  1JUS A;  2HDC A;  1R23 A;  4NBQ A;  3SZG A;  3TOB A;  2EV5 A;  4QLC U;  3WTU C;  3K4M A;  2Q0O A;  4LD5 A;  2R7X A;  3WTS C;  1XD7 A;  1D5Y A;  3CCS I;  1SFU A;  2RNG A;  4JP0 A;  3RI4 A;  2M0M A;  4HX4 A;  2L3D A;  1FBU A;  4XLC A;  3ZN1 A;  5F1J A;  3F21 A;  1VQ9 I;  1A36 A;  3FZV A;  4E70 A;  4Q5S F;  2HWV A;  2OCC H;  4RAY A;  3EQL F;  1IUF A;  3F8F A;  2EIN H;  3DBR B;  3GTJ J;  1KYW A;  4XK4 A;  1UHW A;  3QPS A;  4LK0 F;  3K1M A;  3RDI A;  4A3E J;  1WRJ A;  1R5H A;  3RZD J;  2L7F P;  4L18 B;  2H8W A;  3KP5 A;  2OD5 A;  4EEF G;  1H9G A;  3IH3 A;  1R4M B;  1Y1W J;  1HF0 A;  1GT0 C;  4BL0 B;  3UKG A;  1QHG A;  4F93 B;  1FOW A;  3PNY A;  1W7P D;  1QPM A;  4I76 A;  4Y4R A;  3RPQ A;  4ZYG A;  1JKR C;  3H5R A;  1WI9 A;  4MFE A;  2ZKZ A;  3DPU A;  3HJE A;  1IC8 A;  3FMR A;  3W6V A;  3HXL A;  5K5R A;  1PP8 F;  4HEA 2;  3M8F A;  5F0F A;  4FTH A;  1LKX A;  1D3Y A;  2L7K A;  4GO1 A;  4UUS A;  3RKQ A;  4EV0 A;  4C9Y A;  2JPB A;  3OR2 C;  2ISY A;  3CC7 I;  2DA6 A;  1V4R A;  4YII A;  5A2Q K;  2EIL H;  4LG0 A;  3RQI A;  3AFH A;  1I5Z A;  2X9D A;  5TJJ A;  3SZT A;  2XKP A;  5F64 A;  2R7F A;  1EF4 A;  4BHP A;  1HQC A;  2I8D A;  3IRR A;  1IDY A;  4IHX A;  1WFX A;  2F5V A;  1LFB A;  1FMW A;  1TQI A;  3DLL F;  1RUO A;  4RB0 A;  4N4O B;  1D8J A;  3BDD A;  5F0C A;  4R1H A;  4XKC A;  2O7O A;  4U0W A;  2DMU A;  3SFZ A;  1MIJ A;  1QHH D;  1Y6I A;  4A3B J;  1I6X A;  3BP8 A;  2EFW A;  2EFP A;  4U87 A;  2ZB9 A;  4BNC A;  2VBY A;  1MZB A;  3TP0 A;  4D7M A;  3GFM A;  2HOE A;  3OL4 A;  2H6C A;  4FT8 A;  4QSH A;  3LA3 A;  4R79 A;  5L3F A;  1YIT I;  1OR7 A;  1QO0 D;  3EDP A;  4DNC A;  5FKL A;  1RET A;  5KK1 A;  3TDU C;  2EIK H;  3FMQ A;  2FD5 A;  1Z67 A;  2K02 A;  3JTH A;  1D0X A;  1LNW A;  2LYC A;  3G1M A;  4RS8 A;  3R0J A;  3CUQ B;  1IV8 A;  3K6G A;  1OLT A;  2XKO A;  3CUQ C;  5AIQ A;  1AU7 A;  4M6V A;  5F6F A;  2QCO A;  1X1B A;  3KEO A;  1SAN A;  5H2F C;  5JLW A;  2F4M B;  2JT1 A;  3N4M A;  2XAS A;  2BE5 F;  2QQB A;  2NOG A;  4V19 K;  2KQR A;  1OCT C;  1BN5 A;  2MA3 A;  5LFA A;  3H0D A;  2F2E A;  2M45 A;  2BEO A;  4CSW A;  2V1U A;  3LST A;  4L0Y B;  3BRO A;  3BTC A;  4DBR A;  2QQ9 A;  5BOX A;  2CQX A;  1Z1D A;  3CZ6 A;  4BDZ A;  4KIS A;  2L9S A;  1BA5 A;  5C3E J;  2XUB A;  3BTL A;  3Q9S A;  3T0Y A;  1TWH J;  1VQK I;  3DTI A;  5D4R A;  2FE3 A;  5FGM A;  5B66 C;  2X6O A;  1YS7 A;  2EZL A;  3OYI A;  4BH9 A;  4WK8 F;  2W82 A;  2KKO A;  2CFX A;  3K4C A;  5B1B H;  2DAO A;  3COA C;  1ORK A;  4RB2 C;  1FP1 D;  4JX6 A;  4B3X A;  4EVI A;  4YFX F;  2DQL A;  3J80 K;  3F22 A;  4XKB A;  2L9N A;  3PNV A;  1QA6 A;  4IF4 A;  3CJR B;  1PUF B;  1WJA A;  4ESJ A;  4QPO A;  3K70 C;  3DU6 A;  2D1H A;  1G3T A;  1ITY A;  3FKJ A;  3UR3 C;  1ZQ3 P;  3QPL A;  2ECC A;  2I10 A;  2EWN A;  3PUB A;  4Q4Z F;  3N05 A;  3MKY B;  5KVR A;  3IL2 A;  2CQQ A;  1J5Y A;  4Y3O A;  3WTX C;  4CCO A;  1GUU A;  3HPG A;  4O3M A;  5EZH A;  3ZQ7 A;  1YX5 A;  2K9L A;  4PSX A;  4CCN A;  3A2K A;  1YS6 A;  4M71 A;  5E1Z B;  1HC8 A;  1FYL A;  4PJ0 C;  4WXH A;  1HBX G;  4HNT A;  4P55 A;  3G2B A;  4RM2 A;  1W1W E;  1ZLJ A;  4M3G A;  5FO5 A;  2LF8 A;  4KN7 X;  3HRT A;  1XGM A;  4HNV A;  1MMS A;  1MW7 A;  3S3O A;  1K61 A;  2WAQ A;  2RNJ A;  1TZL A;  3WHC A;  1VQ5 I;  3B6C A;  5LLQ A;  2HR3 A;  3DWL E;  5L3G A;  2NS0 A;  2A3S A;  1HKT A;  2QSH X;  4UHT A;  2VAS A;  3H0G J;  3D5S C;  4ASN A;  1G6N A;  3LQR A;  5M5X J;  2LD5 A;  1OYW A;  1BC7 C;  3G73 A;  1F9N A;  3TW6 A;  4U7B A;  3OIQ A;  3ZQI A;  2LK2 A;  2A05 A;  1TNS A;  4D7N A;  1XMX A;  4A3I J;  4IXA A;  4ZTJ A;  2UXN A;  3ABT A;  1Y56 A;  2L7Z A;  2WV0 A;  3M3Y J;  3QWL A;  3CLQ A;  4D1Q A;  5ERI A;  1K83 J;  2MG4 A;  2DDB A;  2CS3 A;  2MGQ A;  1DP3 A;  2OTL I;  1R1U A;  4BKX A;  3CC4 I;  1T38 A;  2LRD A;  3PFY A;  2DMN A;  3DEW A;  2YSR A;  1G59 A;  3E6B A;  4F3Q A;  2V1N A;  1WQ2 A;  4J00 A;  1R5G A;  2DYS H;  1LUJ B;  4M6X A;  2KMU A;  3HOU J;  2FBI A;  5E8I A;  1XC5 A;  1ZGW A;  2QSG X;  1B8I B;  3D1N I;  5KAF C;  2VBZ A;  4NB5 A;  3OYD A;  3KP3 A;  1S3J A;  2KRH A;  3ERM A;  4HV5 A;  2ID6 A;  2DYR H;  2M7B A;  4PDK A;  1BBY A;  2V9K A;  4EJV A;  2M2E A;  4JBA A;  5CLS A;  4YFK F;  2VKH A;  3OSG A;  1HW2 A;  2DJI A;  1IDZ A;  2CH0 A;  2A5W A;  2K3F A;  3J7Y J;  1MMG A;  3C2H A;  3NQO A;  4BBS J;  3UNG C;  4RM3 A;  3JRG A;  1MBF A;  1VTN C;  3OOU A;  4QPQ A;  3JAM Z;  5EJC A;  6PAX A;  2P7C B;  1DDN A;  4AYB A;  2VB6 A;  1RZ4 A;  1WHU A;  4HF0 A;  2W84 A;  4YEJ A;  2R7V A;  3RTR A;  2ZNZ A;  3O2P E;  5ICE A;  4WCG A;  2COB A;  5E20 A;  3KLO A;  1WSU A;  1JKO C;  2R7S A;  2DFI A;  1BW6 A;  1KQ8 A;  2WAQ N;  3KYD B;  1UEL B;  1FOK A;  2K4B A;  2ECB A;  2M1B A;  4LG3 A;  4ZYD A;  1QRY A;  1A6I A;  2WAD A;  5M3M J;  3I3L A;  1U0J A;  4UVA A;  1SAU A;  1MJ9 A;  1KU7 A;  3ZCO A;  2OCE A;  3E6M A;  3QPT A;  3F72 A;  3RIR A;  1G4D A;  1W7P A;  1O57 A;  2BY1 A;  1W5T A;  2MH2 A;  2RAE A;  3SZP A;  4YEL A;  2F4O B;  4E7J A;  1H8A C;  3I4N J;  4BXX J;  3Q5F A;  3H9G A;  2VLA A;  4G6Q A;  2FOK A;  1ZR4 A;  3F9K A;  2DXI A;  1RPW A;  1MJB A;  5IT9 K;  4RA2 A;  2ME6 A;  4XOR A;  2A6T A;  2DFH A;  2E5N A;  2ELH A;  2A61 A;  4MNU A;  2OC6 A;  5J1Y A;  1UZC A;  1V5G A;  2BYV E;  4FX4 A;  3CCV I;  2Z3Y A;  1FC3 A;  1XSD A;  2IBD A;  4F7Z A;  4XLH A;  2EFQ A;  3H9J A;  5FKO A;  3PIO F;  1VQM I;  1T08 B;  1Z05 A;  2IXS A;  2MLK A;  5EGO A;  5BMZ A;  2HVS A;  5M5Y J;  1WGX A;  1ZHF A;  5D5W B;  1OYI A;  4C2T A;  1PDN C;  1XTA A;  2LVS A;  4A3D J;  4LIT A;  5HDN A;  3S1Q J;  3BPX A;  1V54 H;  2DU9 A;  5JLX A;  3BR1 A;  5EEH A;  4II2 A;  3VPR A;  1X19 A;  2CMP A;  3K7A J;  5LHG A;  2NNY A;  2NS7 A;  5GPC A;  2R7Q A;  3DLA A;  2DA2 A;  1YIO A;  4F91 B;  1FOX A;  4B8X A;  4DYC A;  3GZN B;  1W4M A;  4MHG A;  4UXN A;  1D8K A;  3IHU A;  1P4A A;  2JVG A;  3ZQC A;  3LA7 A;  3LSJ A;  1FTT A;  5K1Y A;  1IGN A;  4KT5 C;  1CF7 A;  3CJQ B;  1XGO A;  4A5N A;  1NK2 P;  1BOA A;  1ZLK A;  4L0Z B;  2GBY A;  3ZQQ A;  4E7S A;  1SD5 A;  4UUV A;  1ULY A;  3IP4 B;  3QQA A;  2L2O A;  1OPC A;  4A6D A;  5HLT A;  3JAM K;  1P4W A;  4XID A;  3PQJ A;  4OIN F;  2IGO A;  2X1C A;  5IP9 J;  1WI3 A;  3HEF A;  1X1C A;  4U7D A;  2HTJ A;  2KT0 A;  3HHG A;  3L7W A;  4AYB N;  1C0W A;  2R7R A;  4I2O A;  3I59 B;  3RYR A;  5FRM A;  1J59 A;  3G1L A;  2FML A;  1D0Y A;  1E3P A;  1NG6 A;  4YRV A;  2YPR A;  4U0Y A;  3CCJ I;  2P7V B;  2C6Y A;  3BQY A;  3KFW X;  5H6Q A;  3FBI B;  2A07 F;  2LRE A;  5JVG F;  3TDZ C;  2STT A;  3R4K A;  4I02 A;  3DTE A;  3MQ0 A;  3WGI A;  2IGN A;  4UUT A;  3OMY A;  1MDM A;  3VOD A;  1VI0 A;  3D0S A;  4AUX A;  2EK5 A;  4XRS G;  5K7Z A;  1Z9C A;  4XKW A;  1B6A A;  3GWZ A;  3VDX A;  2K9N A;  3QPH A;  5EEA A;  2DOD A;  5EZG A;  2AQF A;  1F1Z A;  4IRI A;  2E1M B;  3TO9 A;  2X4H A;  2MC3 A;  2E1M C;  1OKR A;  4FE7 A;  5HNF A;  1TWG J;  3OYN A;  1D1B A;  5DM6 F;  3JSO A;  2Y69 H;  3DPL C;  1HKS A;  2R7Z J;  2NAZ A;  2ZJ2 A;  4Y15 A;  3GTQ J;  1R1V A;  3U9G A;  2JTV A;  4XM3 A;  5CVV A;  5FRN A;  2DOA A;  1QVT A;  1R7J A;  2M3A A;  1ERD A;  2ZME C;  5M5W J;  1TL8 A;  3R0A A;  1OYY A;  1QZY A;  3U2R A;  4E4H A;  1SVM A;  4GYG A;  3BZK A;  1UMQ A;  3HM5 A;  3PSF A;  3C18 A;  3VB2 A;  3VYT B;  1TT5 B;  1T0F A;  2IGK A;  2Y75 A;  3K1N A;  1U5T B;  5D5X B;  1LEB A;  1IZ1 A;  4EJO A;  2KZG A;  4A3C J;  2ZBK A;  2EH3 A;  2HPI A;  3IV5 A;  3L2W A;  4IPA A;  1SD7 A;  1U6G A;  1UB9 A;  3GVA A;  2XHK A;  4PFP A;  1ZG5 A;  1YTY A;  1N78 A;  3QP6 A;  4DZP A;  1E3O C;  4A12 A;  2TDX A;  1B72 B;  2X48 A;  2ZXH A;  3WTT C;  2LBF A;  3LMM A;  3AAF A;  4G12 A;  1DGR M;  3MAJ A;  4G6D A;  1ZR2 A;  2QBY B;  3CF5 F;  2GQQ A;  3QOE A;  1V3F A;  4BY1 J;  4LB5 A;  3V8K A;  2R7U A;  1RNL A;  4A3L J;  1YJW I;  4UB8 C;  4KN4 X;  1UCR A;  3GYH X;  4KJZ A;  1FJL A;  4WXD A;  2Z1D A;  1D1C A;  2LMD A;  1OIS A;  2A6E F;  3JRH A;  2YU3 A;  3P9K A;  3QYE A;  4N9I A;  1IN4 A;  3HUG B;  4M72 A;  3ZMV A;  1R22 A;  2R3S A;  1R00 A;  3AG4 H;  1ETW A;  4XLF A;  3TED A;  3BZC A;  2E2J J;  3BR6 A;  1IN5 A;  1TLH B;  1R71 A;  1GDT A;  1RKW A;  4I01 A;  2CUF A;  3FIW A;  5E79 C;  4C2U A;  4NUB A;  5LGT A;  5J40 A;  5M3F J;  1MBK A;  1YX3 A;  2PLY A;  3LL7 A;  2A68 F;  3S8P A;  4O5V A;  3H5N A;  5B5E C;  3AKZ A;  1N25 A;  1Z6T A;  2HYF A;  2RRE A;  1P9Q C;  3CUO A;  5GAE J;  4DBQ A;  4Z2Y A;  4A0Z A;  2OZ6 A;  2M87 A;  1VQ4 I;  5FRO A;  5GTH C;  4Y13 A;  3V7R A;  2JUC A;  2PN6 A;  4FCY A;  4DW6 A;  3FK7 A;  2G0E A;  4P1W A;  2IVM A;  5TGT A;  3OIO A;  2D45 A;  3NAR A;  5H20 A;  1O7L A;  4HG2 A;  3BTJ A;  1VQ6 I;  3GO5 A;  2QWW A;  3AG3 H;  4RLQ A;  3U21 A;  3V4G A;  5KHD A;  4KIG A;  1VF9 A;  1M1E B;  4MQV A;  1GXP A;  4CO8 A;  4DQ2 A;  3DU5 A;  4CCK A;  3Q0V A;  2HVR A;  2W00 A;  3KIO A;  1JI8 A;  2DFE A;  1IJW C;  2DW4 A;  3HSE A;  2PMU A;  3CC2 I;  5EG0 A;  3SFI A;  2F48 A;  4KIF A;  3I55 I;  3MN2 A;  4BDY A;  3JRC A;  2WA0 A;  2E60 A;  3PFI A;  4I09 A;  1BIB A;  1U9O A;  4D9J A;  1T8I A;  3CO6 C;  1K6O A;  1NK3 P;  1B9M A;  3ZMT A;  5LGU A;  3TO6 A;  4KMF A;  2GWR A;  2M8E A;  1V5F A;  2VT3 A;  3GTG J;  3HG9 A;  2AO9 A;  2XV4 S;  4A5M A;  2XPV A;  3E3V A;  1KU2 A;  3HL2 A;  2HOT A;  3K10 A;  1E2X A;  2XGD A;  1T6S A;  3BOQ A;  2X51 A;  2WB1 A;  3I4P A;  2H1L A;  1SFK A;  1KU3 A;  4MFD A;  2Y30 A;  3H9Q A;  4IOC F;  1NG7 A;  3PQK A;  2ZO4 A;  2BHZ A;  3IWF A;  4G9Y A;  2BHY A;  2PJR B;  5JHF A;  3WG9 A;  3B73 A;  4IHY A;  1YQA A;  3GBG A;  4L9N A;  4M9Z A;  2WAF A;  1K78 B;  1A5J A;  1S7A A;  4I0B A;  3D5L A;  3IUO A;  4UB6 C;  1WCM J;  3FXL A;  1U5T A;  4HDV A;  1FX7 A;  3A01 A;  2P4W A;  2VQL A;  4J19 A;  2HOS A;  1STZ A;  3E1S A;  1I3A A;  4P9U A;  3KPH A;  1USS A;  4UNO A;  4BQQ A;  5K5O A;  1HXD A;  3KP4 A;  4OMZ A;  4IL6 C;  5FFZ A;  2VQC A;  3BG9 A;  2XAH A;  4H0E A;  1X58 A;  3O8H A;  2GZW A;  3TO7 A;  3LNQ A;  1BJA A;  1BL0 A;  4ZDP A;  1KQ9 A;  1SVL A;  5IOY A;  5K7H A;  3OS1 A;  3I9V 2;  4A3F J;  4XKV A;  4F92 B;  3ZR8 X;  2Z9O A;  2K9Q A;  3RPU A;  2OA4 A;  2ZXJ A;  3OWT A;  2VOO A;  1FIA A;  1E0E A;  1DUX C;  4B09 A;  3C1D A;  3HGY A;  3OYK A;  3KLN A;  4YG2 F;  1HOM A;  1WH5 A;  4HYE A;  1WJ5 A;  3EUK L;  4XMY A;  3FM3 A;  3E6D A;  2R5Y B;  2V9V A;  2XRL A;  1BW5 A;  1MNM C;  1XSV A;  3V7C A;  4FAS D;  2WC2 A;  3K70 D;  2CRG A;  2O8X A;  2BZT A;  1U9N A;  4G8X A;  1MND A;  3RZO J;  5JFR A;  2HNH A;  1NHA A;  1ZKG A;  1TQM A;  3GFJ A;  2PX9 A;  1H89 C;  3BG6 A;  3SEQ A;  3ZMZ A;  1IXR C;  2AQE A;  1X2M A;  3GCM A;  2L5Q A;  2KIU A;  5DUI A;  2WB1 N;  3QYF A;  2O61 A;  1DU0 A;  3K2A A;  1XGS A;  2X1D A;  4FE4 A;  3OYL A;  2EZH A;  3FWE A;  3GME A;  3JSP A;  4FQG A;  1I50 J;  1JHH A;  3OSF A;  4K2E A;  2V4J C;  3E5Q A;  3SDB A;  1Z0X A;  3HRM A;  1IN7 A;  3H3U A;  4I6Z A;  4AVP A;  2CFO A;  2DTR A;  1LQ1 A;  2NVX J;  1GV5 A;  2XGC A;  2XRO A;  3GTP J;  4A3G J;  2HI3 A;  2UV1 A;  2E1C A;  3QAH A;  2OF7 A;  3CDI A;  2I5U A;  4N9H A;  2Q8K A;  2EV0 A;  2GA2 A;  1JHF A;  5K5Q A;  2CUJ A;  2MH9 A;  4FHT A;  3O8G A;  1NTC A;  4AVZ A;  4RB3 C;  1TQP A;  2FMY A;  2VJJ A;  4OMY A;  2LP0 A;  4P96 A;  3TKY A;  3CCL I;  2H6B A;  3LFU A;  2LY2 A;  4A69 C;  2V79 A;  2DOE A;  1FYK A;  4KUM A;  2VJ5 A;  3IWZ A;  4EGZ A;  3PSI A;  2IS4 A;  1LFP A;  2K3P A;  2V7F A;  3R60 A;  1W5S A;  1LDJ A;  4I7H A;  2MLG A;  4XRS A;  3FKI J;  3JRA A;  3OY9 A;  3J7Z I;  3QU6 A;  3A0H C;  3J7A O;  3DF8 A;  3K69 A;  3RCO A;  3JRD A;  2J5P A;  1SC7 A;  3KEY A;  5LRS A;  4NC7 A;  3CQZ J;  5DYM A;  3KCC A;  3A0B C;  1TWF J;  3M8J A;  3IKV A;  2E36 A;  5DDG A;  3PJR A;  4BU2 A;  1SFO J;  2FX0 A;  2DPD A;  2GA1 A;  5BNG A;  3FXO A;  3I71 A;  3JR9 A;  1MGT A;  2VKE A;  1W0T A;  4L9V A;  3BT9 A;  4KA4 A;  1TTY A;  5F08 A;  2CSO A;  2CJJ A;  5E1W A;  5TIS C;  3S2D J;  5FKM A;  4S04 A;  3F3X A;  2V6E A;  2AS5 F;  2M0C A;  1ZTR A;  2O3F A;  3ONQ A;  2E5Z A;  2FUG 2;  4E7K A;  3DTK A;  1RI7 A;  4XLN F;  1V5E A;  2CQ7 A;  4IEJ A;  2F5E A;  3ZXS A;  2Q2E B;  2E7X A;  1LB2 A;  2VXD A;  1HSJ A;  1GV2 A;  2FA5 A;  1FPQ A;  2HZD A;  1F5T A;  3CTA A;  2BW3 B;  2BBY A;  4Q48 A;  3VYU B;  1CQT A;  2XC7 A;  3MZY A;  3DBL B;  2IAI A;  2L4M A;  1XDU A;  2ZXI A;  5DTD A;  5ILS A;  4CYD A;  2ADU A;  2D2W A;  5DUK A;  1Z7U A;  3GX4 X;  4OIQ F;  2P81 A;  4B48 A;  1BI1 A;  2A5Y B;  4M9S A;  3WE2 A;  2FBH A;  2OQR A;  3BTI A;  2EFN A;  2EQR A;  2V1D A;  4MO7 A;  1S5L C;  3BQZ A;  1MKM A;  1X2N A;  2XDV A;  2ZFW A;  3D5R C;  5AIP A;  3HSR A;  1JTX A;  2VE8 A;  3S2H J;  2JZY A;  1Z3Y A;  3M1E A;  1ZRF A;  3T8T A;  3KZZ A;  5KAI C;  3ZQF A;  3EYI A;  3BC8 A;  2B7E A;  2DI3 A;  2BVL A;  3CJN A;  1MJA A;  4Q47 A;  4EJW A;  5GTI C;  3MKW B;  1PVE A;  2DLL A;  3M7G A;  2X6X A;  5J8F A;  4RAG A;  4HQE A;  5BPD A;  3R6S A;  2ZJR F;  1FBQ A;  5CVJ A;  4QTR A;  3NAU A;  4KIC A;  4U88 A;  1LE8 B;  4ZZD A;  4UV8 A;  1ZRD A;  3HC7 A;  1O3R A;  3ZRG A;  4ZYE A;  1APL C;  5L3E A;  3F6O A;  3KYL A;  4BUP A;  1YIJ I;  2JMW A;  2XAU A;  3DBH B;  2DK5 A;  5L3C A;  1AWC A;  4UVB A;  2ZC2 A;  2PMZ A;  2CW7 A;  1MSF C;  1QBJ A;  3I64 A;  5D5V B;  1WJB A;  2DN0 A;  2K27 A;  3DP7 A;  1XCV A;  2DO7 A;  3W2W A;  2YU9 J;  5J1R A;  5LHH A;  2LY9 A;  2IA1 A;  1IN8 A;  3ASN H;  1FBS A;  3IAS 2;  3BJ6 A;  2LLK A;  5FD5 A;  3S15 J;  3L2C A;  2M4G A;  4BHC A;  4GFB A;  4CCJ A;  1MMN A;  1L3L A;  2HQR A;  1UHM A;  3OYM A;  3MEX A;  2P5L C;  4IHW A;  3CUQ A;  4GDF A;  4MIM A;  4CXF A;  3I58 A;  2JA6 J;  2TRT A;  3EPZ A;  1G3Y A;  5J1U A;  5IYC J;  3L2R A;  3PIP F;  2EA2 A;  4HX8 A;  1IAW A;  3KP6 A;  5HVQ C;  4W97 A;  4B43 A;  3JRF A;  3PUF A;  1BI3 A;  3CMY A;  2CU7 A;  4X6A J;  3A03 A;  5LRR A;  1ETO A;  4LLG F;  5CVU A;  2DQR A;  3SHF A;  2KRC A;  4OIP F;  3LSR A;  5IPA A;  1JT6 A;  4XR6 A;  1UAA A;  2VI6 A;  5F0H A;  1HKQ A;  4CYC B;  2E2I J;  2H94 A;  3AG2 H;  4LIU A;  1R36 A;  5J4Y A;  2R7T A;  4Z6Y A;  2E19 A;  1DQU A;  1GVJ A;  2LKS A;  1R4N B;  1T39 A;  1XN7 A;  3PL8 A;  4L5I A;  1R5I D;  1JGS A;  1W36 C;  1K4S A;  4IZZ A;  2MFZ A;  4XON A;  4G7Z F;  1X1D A;  5HDK A;  1X1P A;  2JSP A;  4PGH A;  5AON A;  4A0X A;  3ZMD A;  4LOC A;  3GZ5 A;  1ODD A;  1YOV B;  2VKV A;  4HNU A;  5DCM B;  3K1P A;  2DT6 A;  2KRF A;  1PUF A;  1P2F A;  2MAB A;  4L5E A;  4XLA A;  4ANJ A;  5EEG A;  4CZC A;  3V42 A;  1YE9 A;  1OCR H;  4A6E A;  1T0F C;  3CJT B;  4ITV A;  3H35 A;  1XCB A;  1Y0U A;  4NC8 A;  2W48 A;  4BQA A;  4DGW B;  2EPF A;  2HFH A;  3H3V K;  5F27 A;  3L2V A;  4FX0 A;  3TL4 X;  2YS9 A;  3WTV C;  4M3F A;  3OIP A;  1ZH5 A;  4XSX F;  2E1O A;  5ILV A;  3LSM A;  4QWQ A;  4GYI A;  2PMH A;  1UST A;  1Y39 A;  2OUM A;  3I53 A;  2YR2 A;  1BIA A;  5HS9 A;  2VUM J;  1X4O A;  2PMZ N;  2FJ1 A; 
#chains in the Genus database with same CATH homology
 2P6T A;  5JR3 A;  1IXS B;  3HIF A;  3O6B B;  3ABU A;  4ZZL A;  1I1S A;  1YW9 A;  2VC1 A;  1BI0 A;  3IC7 A;  3ERE D;  1BM9 A;  5CJ9 A;  3WOD F;  2WWY A;  2FU4 A;  2V1X A;  2XIG A;  3CLO A;  2FF4 A;  2EA4 A;  3FXQ A;  1P92 A;  4L9J A;  4KMU X;  1J7K A;  2EFO A;  4EMS A;  2VC0 A;  3TGN A;  2FEZ A;  5E1X A;  3CDH A;  3GW2 A;  4HX7 A;  1RUN A;  3G3Z A;  3FF5 A;  1KA8 A;  5BQT A;  2ZNY A;  3R61 A;  1B9N A;  1ZGA A;  1FP2 A;  2FXA A;  2OAZ A;  4LLL A;  2BGC A;  5CYV A;  2ZME B;  3OV8 A;  4CIC A;  2L01 A;  1IN6 A;  3MFK A;  3M8E A;  2ZCW A;  3HRS A;  3T1B A;  3HSF A;  4L5J A;  1GXQ A;  1B59 A;  2O03 A;  4RGS A;  2Z99 A;  5H6R A;  3FMS A;  5LEJ A;  2VXZ A;  3BJO A;  1ZG1 A;  3J81 Z;  1ON1 A;  2GIV A;  4P9F A;  1K79 A;  2H27 A;  2FQ3 A;  2RV8 A;  1YO5 C;  3CO7 C;  1FSH A;  3P7N A;  4EQQ A;  3ISP A;  2HYG D;  5D5U B;  1ZGJ A;  5E8G A;  2IW5 A;  1I27 A;  3KEQ A;  5ICF A;  4LB6 B;  1HST A;  4BYY A;  3GUD A;  4PGG A;  2FNP A;  5DEQ A;  1I1G A;  4XSZ F;  1TW2 A;  5HLI A;  3DKW A;  5HS7 A;  4HZF A;  2CW0 F;  3ECO A;  4BHB A;  3FXU A;  2R7D A;  4EM2 A;  4YFN F;  3RKX A;  2ACJ A;  2RKH A;  2PI0 A;  3BJA A;  3P9C A;  3I59 A;  3ZN0 A;  1S8N A;  2A6H F;  1Q1H A;  1XGN A;  3LWF A;  2NRA C;  1U8R A;  4NHJ A;  4CZZ A;  1T2K A;  1ON2 A;  4PZJ A;  2XRN A;  4OIR F;  2E7W A;  2ETH A;  4MEX F;  3Q9V A;  4JK1 X;  3J81 K;  2IP2 A;  4EJU A;  4U0V A;  4HOB A;  3WTZ A;  3F8C A;  2H09 A;  4ENK A;  3BY6 A;  2GXG A;  3SQN A;  3RKY A;  4EM0 B;  3W6J B;  2PG4 A;  2W57 A;  1YG2 A;  3HHH A;  3ELK A;  5D8L B;  3DXJ F;  1EH7 A;  1O7F A;  2F5F A;  3JW4 A;  4OOI A;  4JQF A;  2IPQ X;  2UZK A;  3MCZ A;  3SXY A;  4IRH A;  3WE3 A;  2XVC A;  1EH8 A;  2OZU A;  3BZ6 A;  3FM5 A;  1EH6 A;  4ZYH A;  2G9W A;  4RAZ A;  2M30 A;  4ENM A;  3LA2 A;  1IUY A;  3KE2 A;  2Y0M A;  5LBQ A;  1XSX A;  4L9T A;  2QBY A;  2IA2 A;  3L9F A;  4HF1 A;  2MD5 A;  2NNN A;  2CWE A;  1FWZ A;  1TNT A;  1GHC A;  4HW0 A;  3F23 A;  2GXB A;  2EJR A;  4WWC A;  3HUG A;  1FT9 A;  1CGP A;  2XAJ A;  4IJA A;  1Z91 A;  3T5X A;  1QGP A;  1J2X A;  4WF2 A;  4PCQ A;  1YLF A;  3GF2 A;  2IRF G;  1FYM A;  1ZAR A;  4HF2 A;  1YFH A;  2XAF A;  2RVC A;  1R1T A;  2OQG A;  4MQ9 F;  1QNT A;  1XMK A;  4N0B A;  3GFL A;  1DPR A;  4ESB A;  2PJP A;  5ILU A;  1J0R A;  3QOP A;  4NQW A;  1SMY F;  3DQV C;  3O3K A;  2HKO A;  3F8N A;  4MTE A;  4Y17 A;  4LJZ F;  4AIJ A;  4AWX B;  3J80 Z;  2FNA A;  3ML6 A;  2W25 A;  3GEZ A;  4UVC A;  4S05 A;  3JTG A;  2UWM A;  1S7O A;  1FLI A;  2JPC A;  2ISZ A;  2G7U A;  4OU0 A;  3WU0 A;  1TW3 A;  1S6L A;  4G7O F;  1KQ0 A;  2JSC A;  1U2W A;  1E17 A;  2AXL A;  5ICG A;  5FFX A;  3WTW C;  3V8J A;  3ZMU A;  5LEK A;  4P5O A;  1XDS A;  2DPU A;  4IHS A;  1OMI A;  5DD4 A;  1QZZ A;  2K86 A;  4AIK A;  4MEY F;  2F5D A;  5JHU A;  1P6R A;  2OU2 A;  4KIB A;  1K78 A;  3HTS B;  2NYX A;  3LAJ A;  2VBW A;  3GZ6 A;  2KIM A;  2HTS A;  5ICC A;  3RYP A;  5BS6 A;  3GLX A;  3FHZ A;  4AD9 A;  1QQI A;  1DP7 P;  1J9I A;  5HLG A;  1XB4 A;  3LFK A;  1LDK B;  2WTE A;  5HDG A;  2W24 A;  4ESF A;  4GXO A;  3H92 A;  2KIF A;  3DFG A;  2FSW A;  2VT2 A;  1W7P B;  3REO A;  3MWM A;  1S29 A;  3N97 A;  1YW7 A;  1BC8 C;  1SD4 A;  4RGR A;  2OBP A;  1WKM A;  5CVR A;  2COM A;  2W85 A;  2BV6 A;  1ZG3 A;  2ESH A;  3DV8 A;  1P4X A;  3K9T A;  3M9A A;  4GGG A;  4XRF A;  4HA8 A;  2FBK A;  1SFX A;  2YX7 A;  2CYY A;  1IRF A;  5TRD A;  3C3W A;  5JI6 A;  4BXU A;  5E18 F;  1ZN2 A;  4BAY A;  1CF7 B;  1JXS A;  3KP7 A;  2Z33 A;  3TQN A;  4D0P A;  2DT5 A;  3EET A;  4A0Y A;  1K7A A;  3GFI A;  2UXX A;  5IT9 Z;  3NEU A;  4O6J A;  5CVI A;  3TOA A;  2QLZ A;  1FZP B;  1U78 A;  2STW A;  3LAP A;  3E5U A;  2GAU A;  3IKT A;  1SD6 A;  4IVN A;  1MDM B;  1ZRC A;  4UV9 A;  1ONV A;  4HQM A;  3B02 A;  3LQQ A;  3ROU A;  2P6S A;  3L00 A;  1H0M A;  4HV6 A;  1DPU A;  3F6V A;  1FSE A;  4LMY A;  4LK1 F;  2XAG A;  4RGX A;  1O3Q A;  2VOD A;  1HW1 A;  2KJC A;  2VON A;  1Z6R A;  2O6G E;  3WU1 B;  2LKP A;  3FX3 A;  1X3U A;  4MGR A;  5LGN A;  5DV5 A;  5HOO A;  3L09 A;  4G7H F;  3I0T A;  5JVT A;  2K7L A;  2Q2E A;  3MZH A;  2D1V A;  3HOS A;  1PP7 U;  2CO5 A;  3KP2 A;  2EV6 A;  5D8K B;  3QU3 A;  2ESN A;  1EV7 A;  4AIH A;  1XMA A;  1REP C;  4M74 A;  2MBF A;  5D6F A;  1HW5 A;  4HLX A;  2G7H A;  4ON0 A;  4M6Y A;  3QP5 A;  5J6X A;  4LGW A;  2HEO A;  2DBB A;  1FNN A;  2QZ8 A;  2DK8 A;  3OOP A;  5HS8 A;  1TBX A;  2RGV A;  1WWX A;  4KFC A;  1ZRE A;  2VN2 A;  4KYW A;  1SFE A;  2FRH A;  2E1N A;  1IXC A;  4YIF A;  3KET A;  3V7S A;  1UFM A;  2RN7 A;  4RB1 A;  4IHT A;  3DEU A;  2QYO A;  1U3E M;  3ZPL A;  5IT3 A;  2HS5 A;  2IJL A;  4KDP A;  1LJ9 A;  2LF7 A;  3RKW A;  4I0A A;  2RQP A;  5D4S A;  3U1D A;  3E5X A;  3ZP5 A;  3HOT A;  1RIO H;  1D5V A;  4RGU A;  2LSO A;  3C7J A;  4HDU A;  1ZAO A;  2Z5U A;  5D6E A;  5FLX Z;  2J5O A;  1PUE E;  4CGZ A;  2PFB A;  2QM3 A;  2LNB A;  2VOP A;  1H9T A;  2QVO A;  1IW7 F;  4WXC A;  1KGS A;  1LVA A;  3ULQ B;  3IRQ A;  3E6C C;  2HQN A;  1G3W A;  5L3B A;  1KU9 A;  3K0L A;  4LLN A;  3K2Z A;  2P5V A;  1YW8 A;  2HGC A;  2CGP A;  2P5K A;  3NRV A;  1MD0 A;  1T98 A;  3WTY C;  3KZY A;  1B4A A;  2YX4 A;  5DCM A;  5DCF A;  2L4A A;  4LFU A;  3VFZ A;  3DPT A;  3BPV A;  5E17 F;  1U5T C;  4R8H A;  2CQK A;  1YYV A;  2HKX A;  2IA0 A;  4IRG A;  3I54 A;  4CHU A;  3VEP A;  4HLY A;  4ZH4 F;  2CG4 A;  4XLP F;  4CDG A;  3QRF F;  5HLH A;  2QQA A;  3W6K B;  4MTD A;  3F8B A;  4ENJ A;  2M5W A;  5F1R A;  4OIO F;  1ZYR F;  1JE8 A;  2A69 F;  3T8R A;  2LDU A;  5FLX K;  2KJB A;  4GCV A;  5FB2 A;  1O3T A;  3WGG A;  2EB7 A;  2X0L A;  2HZT A;  4M73 A;  5BPI A;  4ENN A;  3F8M A;  2PBI A;  4EGY A;  1LEA A;  2V6C A;  5J8C A;  3P9I A;  3HRU A;  1IF1 A;  2L54 A;  1A04 A;  1FY7 A;  4A2U A;  4HAM A;  2JRT A;  1LDD A;  3I5U A;  2XGX A;  3E97 A;  3EUH A;  1KYZ A;  1R58 A;  5DD8 A;  4EM1 A;  1G3S A;  4LG0 B;  2QUF A;  4HBL A;  2IT0 A;  4WX9 A;  2O0Y A;  1L0O C;  5LHI A;  3BWG A;  3EYY A;  3RJP A;  3HYI A;  2Y48 A;  2P8T A;  2L02 A;  2VBX A;  1BI2 A;  2F5C A;  2K4J A;  2PEX A;  4ETS A;  4EJT A;  4I98 B;  2XAQ A;  2PQ8 A;  2ZME A;  2VE9 A;  3FXR A;  1SAX A;  3H3Z A;  4TV7 A;  3S2W A;  5FD6 A;  1AOY A;  4XBF A;  2RDP A;  4G94 A;  2B0L A;  5A2Q Z;  1B1B A;  3ECH A;  1IRG A;  1SMT A;  5ED4 A;  1O3S A;  3WGH A;  3HTU A;  3ZMS A;  4M9X A;  2QEN A;  1J75 A;  3VOE A;  1F4K A;  4KNY A;  3GXO A;  5L3D A;  2RC4 A;  3V8L A;  2HDC A;  1R23 A;  3TOB A;  2EV5 A;  4QLC U;  3WTU C;  2Q0O A;  4LD5 A;  3WTS C;  1XD7 A;  1SFU A;  3RI4 A;  4HX4 A;  2L3D A;  1FBU A;  3ZN1 A;  3F21 A;  3FZV A;  4E70 A;  4Q5S F;  2HWV A;  4RAY A;  3EQL F;  3F8F A;  1KYW A;  1UHW A;  4LK0 F;  3K1M A;  3RDI A;  1WRJ A;  1R5H A;  4L18 B;  3KP5 A;  2OD5 A;  1H9G A;  1W7P D;  1QPM A;  3RPQ A;  4ZYG A;  1WI9 A;  2ZKZ A;  3FMR A;  5K5R A;  1PP8 F;  3M8F A;  1D3Y A;  4GO1 A;  4EV0 A;  2JPB A;  2ISY A;  1V4R A;  4YII A;  5A2Q K;  4LG0 A;  5TJJ A;  1I5Z A;  3SZT A;  2XKP A;  5F64 A;  2R7F A;  4BHP A;  1HQC A;  3IRR A;  1RUO A;  1TQI A;  4RB0 A;  1D8J A;  3BDD A;  4R1H A;  4U0W A;  3SFZ A;  1I6X A;  3BP8 A;  2EFW A;  2EFP A;  4BNC A;  2VBY A;  1MZB A;  3GFM A;  2HOE A;  2H6C A;  4FT8 A;  3LA3 A;  4R79 A;  5L3F A;  1OR7 A;  1QO0 D;  3EDP A;  4DNC A;  5KK1 A;  3TDU C;  3FMQ A;  2K02 A;  3JTH A;  1LNW A;  4RS8 A;  3R0J A;  3CUQ B;  3CUQ C;  2XKO A;  5AIQ A;  5F6F A;  3KEO A;  2JT1 A;  3N4M A;  2XAS A;  2BE5 F;  2QQB A;  1BN5 A;  2MA3 A;  2F2E A;  2M45 A;  2BEO A;  2V1U A;  3LST A;  4L0Y B;  3BRO A;  5BOX A;  2QQ9 A;  1Z1D A;  2XUB A;  3Q9S A;  3T0Y A;  5D4R A;  2FE3 A;  5FGM A;  1YS7 A;  4BH9 A;  4WK8 F;  2KKO A;  2CFX A;  2DAO A;  3COA C;  4RB2 C;  1FP1 D;  4EVI A;  4YFX F;  2DQL A;  3J80 K;  3F22 A;  4IF4 A;  4ESJ A;  2D1H A;  1G3T A;  2EWN A;  4Q4Z F;  5KVR A;  3IL2 A;  1J5Y A;  3WTX C;  4O3M A;  3ZQ7 A;  1YS6 A;  4M71 A;  5E1Z B;  1FYL A;  4WXH A;  1HBX G;  4P55 A;  1ZLJ A;  5FO5 A;  2LF8 A;  4KN7 X;  3HRT A;  1XGM A;  2RNJ A;  5LLQ A;  2HR3 A;  5L3G A;  2NS0 A;  2A3S A;  1HKT A;  4UHT A;  4ASN A;  1G6N A;  3LQR A;  1BC7 C;  1OYW A;  3G73 A;  1F9N A;  4U7B A;  1TNS A;  4IXA A;  2UXN A;  3ABT A;  2WV0 A;  5ERI A;  1R1U A;  1T38 A;  2YSR A;  3E6B A;  1WQ2 A;  1R5G A;  4M6X A;  2FBI A;  5E8I A;  2VBZ A;  4NB5 A;  3KP3 A;  1S3J A;  4HV5 A;  4PDK A;  1BBY A;  4EJV A;  4JBA A;  5CLS A;  4YFK F;  1HW2 A;  3NQO A;  1VTN C;  3JAM Z;  6PAX A;  2P7C B;  1DDN A;  1RZ4 A;  4HF0 A;  2W84 A;  3RTR A;  2ZNZ A;  3O2P E;  5ICE A;  4WCG A;  5E20 A;  3KLO A;  1WSU A;  2DFI A;  1KQ8 A;  1FOK A;  2K4B A;  2M1B A;  4ZYD A;  4UVA A;  1MJ9 A;  1KU7 A;  3E6M A;  3QPT A;  3F72 A;  3RIR A;  1G4D A;  1W7P A;  1O57 A;  1W5T A;  2MH2 A;  3SZP A;  3Q5F A;  4G6Q A;  2FOK A;  1MJB A;  5IT9 K;  2ELH A;  2A61 A;  4MNU A;  4FX4 A;  2BYV E;  2Z3Y A;  1FC3 A;  1XSD A;  4F7Z A;  2EFQ A;  1Z05 A;  2MLK A;  5BMZ A;  1ZHF A;  5D5W B;  1OYI A;  1PDN C;  5HDN A;  3BPX A;  2DU9 A;  5EEH A;  5LHG A;  2NNY A;  1YIO A;  4B8X A;  1W4M A;  4MHG A;  4UXN A;  1D8K A;  3IHU A;  1P4A A;  3LA7 A;  5K1Y A;  4KT5 C;  1CF7 A;  1XGO A;  4A5N A;  1BOA A;  1ZLK A;  4L0Z B;  1SD5 A;  4UUV A;  1ULY A;  1OPC A;  4A6D A;  3JAM K;  1P4W A;  3PQJ A;  4OIN F;  4U7D A;  2HTJ A;  1C0W A;  3HHG A;  3L7W A;  4I2O A;  3I59 B;  3RYR A;  1J59 A;  2FML A;  2YPR A;  4U0Y A;  2P7V B;  2C6Y A;  3KFW X;  5H6Q A;  2A07 F;  3TDZ C;  2STT A;  3R4K A;  4I02 A;  3MQ0 A;  3WGI A;  1MDM A;  3VOD A;  3D0S A;  2EK5 A;  1Z9C A;  1B6A A;  3GWZ A;  3QPH A;  1F1Z A;  4IRI A;  3TO9 A;  2X4H A;  2MC3 A;  1OKR A;  3JSO A;  3DPL C;  1HKS A;  2NAZ A;  2ZJ2 A;  4Y15 A;  1R1V A;  3U9G A;  2JTV A;  5CVV A;  1R7J A;  3R0A A;  1OYY A;  1QZY A;  3U2R A;  4GYG A;  3C18 A;  3VB2 A;  1T0F A;  2Y75 A;  3K1N A;  1U5T B;  5D5X B;  1LEB A;  1IZ1 A;  4EJO A;  2ZBK A;  4IPA A;  1SD7 A;  1U6G A;  1UB9 A;  3GVA A;  2XHK A;  1ZG5 A;  1YTY A;  3QP6 A;  4A12 A;  2TDX A;  3WTT C;  3AAF A;  3MAJ A;  4G6D A;  2QBY B;  2GQQ A;  1V3F A;  4LB5 A;  3V8K A;  1RNL A;  4KN4 X;  1UCR A;  3GYH X;  4WXD A;  2A6E F;  2YU3 A;  3P9K A;  4N9I A;  1IN4 A;  4M72 A;  3ZMV A;  1R22 A;  2R3S A;  1R00 A;  1IN5 A;  1TLH B;  4I01 A;  5LGT A;  2PLY A;  2A68 F;  4O5V A;  1Z6T A;  2HYF A;  3CUO A;  4Z2Y A;  4A0Z A;  2OZ6 A;  2M87 A;  4Y13 A;  3V7R A;  2PN6 A;  2IVM A;  2D45 A;  5H20 A;  1O7L A;  3GO5 A;  2QWW A;  3V4G A;  4KIG A;  4MQV A;  1GXP A;  4CO8 A;  4DQ2 A;  2DW4 A;  3HSE A;  2PMU A;  4KIF A;  4I09 A;  3PFI A;  1BIB A;  3CO6 C;  1K6O A;  1B9M A;  3ZMT A;  5LGU A;  3TO6 A;  4KMF A;  2GWR A;  2M8E A;  2VT3 A;  2XV4 S;  4A5M A;  3E3V A;  1KU2 A;  1E2X A;  1T6S A;  3BOQ A;  3I4P A;  1KU3 A;  3PQK A;  2ZO4 A;  3IWF A;  4G9Y A;  3WG9 A;  3B73 A;  1YQA A;  4L9N A;  4M9Z A;  1K78 B;  1S7A A;  4I0B A;  3D5L A;  1U5T A;  4HDV A;  1FX7 A;  2P4W A;  1STZ A;  4P9U A;  1USS A;  4UNO A;  5K5O A;  1HXD A;  3KP4 A;  4OMZ A;  5FFZ A;  2XAH A;  4H0E A;  2GZW A;  3TO7 A;  1BJA A;  1KQ9 A;  2Z9O A;  3RPU A;  2OA4 A;  2ZXJ A;  2VOO A;  1DUX C;  4B09 A;  3C1D A;  3KLN A;  4YG2 F;  4HYE A;  3FM3 A;  3E6D A;  2V9V A;  1XSV A;  3V7C A;  2WC2 A;  2O8X A;  4G8X A;  5JFR A;  1NHA A;  1TQM A;  3GFJ A;  3ZMZ A;  1IXR C;  2KIU A;  5DUI A;  2O61 A;  1XGS A;  3FWE A;  3JSP A;  1JHH A;  4K2E A;  3E5Q A;  3HRM A;  1IN7 A;  3H3U A;  4AVP A;  2DTR A;  1LQ1 A;  2XRO A;  2E1C A;  3QAH A;  4N9H A;  2Q8K A;  2EV0 A;  2GA2 A;  1JHF A;  5K5Q A;  2MH9 A;  4FHT A;  4RB3 C;  1TQP A;  2FMY A;  4OMY A;  4P96 A;  3TKY A;  2H6B A;  1FYK A;  2V79 A;  4KUM A;  3IWZ A;  4EGZ A;  3R60 A;  1W5S A;  1LDJ A;  4I7H A;  2MLG A;  3QU6 A;  3J7A O;  3DF8 A;  3K69 A;  2J5P A;  5LRS A;  5DYM A;  3KCC A;  3IKV A;  5DDG A;  2DPD A;  2GA1 A;  3I71 A;  1MGT A;  4L9V A;  4KA4 A;  1TTY A;  2CSO A;  5E1W A;  4S04 A;  3F3X A;  2AS5 F;  2O3F A;  1RI7 A;  4XLN F;  2F5E A;  2E7X A;  1LB2 A;  1HSJ A;  2FA5 A;  1FPQ A;  1F5T A;  3CTA A;  2BBY A;  4Q48 A;  3MZY A;  2L4M A;  1XDU A;  5ILS A;  4CYD A;  2ADU A;  2D2W A;  5DUK A;  1Z7U A;  3GX4 X;  4OIQ F;  1BI1 A;  2A5Y B;  4M9S A;  3WE2 A;  2FBH A;  2OQR A;  2EFN A;  2V1D A;  1MKM A;  5AIP A;  2ZFW A;  3HSR A;  2VE8 A;  2JZY A;  3M1E A;  1ZRF A;  3T8T A;  3KZZ A;  3EYI A;  2DI3 A;  3CJN A;  1MJA A;  4Q47 A;  4EJW A;  2DLL A;  3M7G A;  5J8F A;  4HQE A;  5BPD A;  3R6S A;  1FBQ A;  5CVJ A;  4KIC A;  4U88 A;  4ZZD A;  4UV8 A;  1ZRD A;  1O3R A;  4ZYE A;  5L3E A;  3F6O A;  2DK5 A;  5L3C A;  1AWC A;  4UVB A;  1QBJ A;  3I64 A;  5D5V B;  2K27 A;  3DP7 A;  1XCV A;  2DO7 A;  5LHH A;  2IA1 A;  1IN8 A;  1FBS A;  3BJ6 A;  5FD5 A;  3L2C A;  4BHC A;  1L3L A;  2HQR A;  1UHM A;  3MEX A;  2P5L C;  3CUQ A;  4CXF A;  3I58 A;  1G3Y A;  2EA2 A;  4HX8 A;  1IAW A;  3KP6 A;  5HVQ C;  1BI3 A;  5LRR A;  4LLG F;  3SHF A;  5CVU A;  2DQR A;  4OIP F;  1HKQ A;  2H94 A;  1R36 A;  1GVJ A;  1T39 A;  1XN7 A;  4L5I A;  1JGS A;  4G7Z F;  5HDK A;  5AON A;  4PGH A;  4A0X A;  3ZMD A;  3GZ5 A;  1ODD A;  5DCM B;  3K1P A;  2KRF A;  1P2F A;  5EEG A;  4A6E A;  1XCB A;  1Y0U A;  4BQA A;  2HFH A;  4FX0 A;  3WTV C;  1ZH5 A;  4XSX F;  5ILV A;  4QWQ A;  4GYI A;  2PMH A;  1UST A;  3I53 A;  2YR2 A;  1BIA A;  5HS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...