4IHTA

Crystal structure of benm_dbd/bena site 1 dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription/dna
molecule keywords HTH-type transcriptional regulator BenM
total genus 34
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ihtA00
3SZPA 2EFNA 4DNCA 3G3ZA 2A3SA 5ICEA 4O6JA 3JW4A 2VC1A 4UHTA 1QPMA 2W25A 3HSEA 1JHHA 5J8FA 1FYKA 4HLYA 2PBIA 2DLLA 3WTXC 4RGXA 1KQ9A 1SFXA 4S04A 2F5CA 2GZWA 3V7RA 3SHFA 3F3XA 3KLOA 4RAZA 5JFRA 5F64A 3CO6C 2EV6A 2HQRA 3WTSC 3EYYA 5E17F 1MJAA 4GGGA 1TW3A 3HHGA 3GVAA 1HKSA 4GXOA 3F22A 2VODA 5BPDA 2FNAA 2P6SA 3MEXA 1B6AA 5CVVA 3ISPA 1P4AA 2K4BA 1X3UA 1L3LA 5D5VB 2J5PA 2JZYA 3JSOA 3PFIA 4KA4A 4CICA 3S2WA 2ZXJA 1HBXG 1FBUA 2IA2A 4KIFA 1PDNC 3J80K 1ZYRF 2O6GE 1ONVA 2Z5UA 3I64A 4WXHA 5E1WA 4EM2A 3M1EA 4RGSA 3M9AA 2XIGA 4KFCA 4U88A 1U5TB 4QLCU 2P4WA 3FM3A 4XSZF 4UUVA 2EV5A 1R1UA 3W6KB 5LRSA 4A6DA 4D0PA 4XRFA 3MZYA 3QRFF 1E2XA 3BY6A 4L5JA 1UB9A 3O2PE 3FMQA 3C3WA 2RC4A 1EH6A 2OU2A 1QBJA 3FF5A 3I5UA 1IN7A 2C6YA 2RKHA 2O61A 1R23A 1LQ1A 1I1GA 1MZBA 1ZLKA 2G7UA 4PGGA 2XKPA 1B9MA 2RV8A 2W57A 1YTYA 4Q4ZF 1Z6RA 2EFQA 4HF1A 1BC8C 4OIQF 2D45A 3HIFA 1G4DA 5AIQA 2OBPA 4HOBA 1T2KA 1IXCA 2FMYA 3E5UA 5A2QK 1P92A 3QP6A 4PCQA 3WU0A 1YW8A 3H92A 2PI0A 1K78A 2BYVE 3HRUA 1TQPA 3RKWA 2DW4A 2DI3A 2VOOA 2YX4A 2F5DA 2Z3YA 4U0VA 1FBQA 4U7DA 2WV0A 3TGNA 3K1MA 3GXOA 1FYLA 4L18B 1C0WA 2V79A 2KJBA 4G9YA 3WTVC 4LLLA 1Y0UA 2MBFA 3Q9VA 3IHUA 2XAJA 4JK1X 4EJUA 4ON0A 5DV5A 4ENKA 2M5WA 4A0XA 3ZMUA 1P2FA 1LDJA 2VT2A 2PN6A 4YFNF 3BZ6A 1Z1DA 3TOBA 2H27A 3LQRA 2E7XA 1T39A 1R1VA 3BJ6A 5HS8A 5JVTA 4XSXF 2P5LC 5CLSA 4ZZDA 4EV0A 4BNCA 1YIOA 1ZH5A 4EGZA 2VONA 2O3FA 2R7FA 1XGSA 4LK1F 2QLZA 3CTAA 5J6XA 2OQRA 2W24A 1XDSA 2ETHA 2WWYA 2XUBA 4LB5A 5HS7A 1KU7A 4BHCA 5H20A 1BIBA 1BJAA 2CSOA 3QAHA 2VBZA 2XVCA 2L01A 4O3MA 5A2QZ 2LKPA 5KVRA 2F5FA 5CVRA 3IKVA 3ZMZA 3F8BA 5L3EA 5E8GA 1GHCA 4P9FA 5D6EA 2ZBKA 1ZREA 2ZFWA 4EM0B 1USSA 4OIRF 2STWA 3R61A 5LHHA 1XCVA 5HVQC 4KMUX 2MLGA 5HDNA 2DPUA 2NNNA 3LA3A 5CVUA 4M6XA 5E1XA 1FOKA 3D5LA 3J81Z 2YU3A 3I54A 2CFXA 2DBBA 3DPTA 3I53A 3KP4A 1WWXA 3FMSA 4PGHA 1R00A 5HLHA 3HTSB 3FHZA 1OYWA 4PDKA 1IAWA 1IF1A 1F5TA 1MKMA 1FYMA 2XHKA 2F5EA 3KCCA 4Q5SF 3VEPA 2HDCA 2XRNA 1Q1HA 4ESJA 3KP3A 3KEQA 3RDIA 5LEKA 6PAXA 2AS5F 4H0EA 1KYZA 2YR2A 4G8XA 4ENMA 1OMIA 4HQMA 2IW5A 4L9VA 3F8FA 2HKOA 3ZN1A 3KP5A 4BHPA 5LGNA 2V9VA 4IRGA 2JPCA 1O3SA 4IRIA 2PMHA 1Z91A 5DEQA 4M9SA 4IF4A 2HFHA 3IKTA 5L3BA 1F1ZA 1FZPB 3CUQB 1KQ0A 2P5VA 5EEGA 4BXUA 3HTUA 1ON2A 1KU3A 2L4MA 1WKMA 5FGMA 5DD4A 2MH9A 4CZZA 4WK8F 1J5YA 3COAC 3BOQA 1ZGAA 1QNTA 3ERED 1J0RA 3SZTA 2CQKA 2OZ6A 1JE8A 2ZCWA 2KIFA 4GYIA 2ZKZA 2L4AA 1EH8A 1FX7A 2O8XA 1O57A 3ABTA 5HOOA 1FSHA 3M8FA 1XD7A 1H9GA 2HR3A 2EFWA 3BJAA 1ZLJA 4BH9A 3KP6A 3RTRA 2OAZA 1KU9A 4HQEA 4AD9A 2NAZA 2STTA 2O03A 1FSEA 1ZRCA 3L2CA 1J75A 1XSDA 2W84A 2ZMEB 1CF7A 4B8XA 1R22A 2FNPA 2JRTA 3P9IA 4RS8A 5D6FA 4ZH4F 2QZ8A 3H3UA 3WU1B 1TQMA 4OOIA 5FD6A 2P7VB 2GA2A 1R7JA 4KN7X 1IRFA 3CJNA 4KNYA 4Y13A 4ASNA 3P9KA 5CVIA 3RKYA 4I98B 2LNBA 1F4KA 5H6RA 2FBHA 1QZZA 3ULQB 4HX7A 2HTSA 1EV7A 1V4RA 1P4XA 5ILSA 4IHSA 3TO7A 1BC7C 3E5XA 3HOSA 4A5NA 5AIPA 3HUGA 2CG4A 5DD8A 1OYYA 1I27A 2FU4A 3DQVC 4HBLA 4ENNA 4P55A 3GZ6A 2EA2A 1UHWA 1DDNA 2VT3A 4YIFA 2D1VA 1K79A 2EA4A 3NRVA 5FLXZ 2VOPA 3WE2A 2H6CA 3E6CC 2FRHA 1IN8A 4CO8A 3U9GA 1O3TA 2ZO4A 4LB6B 2IA0A 2CGPA 3W6JB 3ZQ7A 3LQQA 4HV6A 3MAJA 3GX4X 4OIPF 3C7JA 1G6NA 4EJTA 3KETA 1S7AA 1LDDA 4HV5A 2EV0A 3F72A 2G9WA 2BEOA 2TDXA 3GZ5A 3MCZA 3R60A 1QQIA 2X0LA 4N9HA 4L0YB 2MH2A 2VC0A 3WTZA 5ILVA 1HSJA 1O7FA 2IPQX 1LJ9A 1HW1A 3D0SA 1RZ4A 4LLGF 4EGYA 3F6VA 3CDHA 2A6EF 3FXUA 1TNSA 4M72A 1WSUA 1O7LA 5FB2A 1MD0A 4MQVA 2JSCA 1P4WA 3QOPA 3U2RA 2CO5A 1LEAA 4CGZA 3RYRA 4BAYA 2FSWA 4UV8A 1S7OA 2WTEA 4JBAA 2DU9A 1ZAOA 2V1XA 4NB5A 2OA4A 4OMYA 2PG4A 3ZMTA 1TLHB 2DAOA 4OU0A 1R36A 4BHBA 2XKOA 5BPIA 1WI9A 3GO5A 1B1BA 3ZPLA 1WRJA 1JHFA 2NYXA 3WTWC 2VE8A 4KYWA 2ESHA 1U5TC 1Z9CA 2ELHA 2UXNA 3IRRA 4KT5C 1MJBA 2B0LA 1BIAA 1XCBA 1ULYA 2XGXA 5HLIA 3FX3A 5DCFA 4AIHA 2E7WA 1YFHA 3KZZA 3F8MA 5LEJA 3U1DA 4HF0A 1D8KA 3ZMDA 1VTNC 1HW5A 4UXNA 1D3YA 3Q5FA 3NEUA 3JAMK 1BI3A 1HKQA 4UVBA 1ZG5A 3HSRA 4RB3C 2VBWA 5TRDA 3K69A 1OYIA 2LSOA 2IA1A 3J81K 3GFMA 1ZHFA 2UZKA 4L5IA 1ZGJA 4RB0A 2LF8A 3IRQA 3F8NA 2QBYB 3IC7A 4A2UA 3RPQA 4YFKF 4YIIA 1J2XA 1R5HA 4KICA 1B4AA 1I6XA 1KQ8A 4M9ZA 5LBQA 5FD5A 4L9NA 5FFZA 3WTUC 3E97A 5F6FA 1LVAA 4RGRA 5FLXK 5BOXA 1SMYF 2L54A 4MNUA 1I1SA 1P6RA 2FBIA 4GCVA 1DP7P 3K9TA 1O3QA 1SFUA 1E17A 3SFZA 1BM9A 2NRAC 4WXCA 3E5QA 4P5OA 2ESNA 1TQIA 3DKWA 3ECOA 1K7AA 3EYIA 2GXGA 2ZNYA 1RNLA 1OR7A 4A5MA 1H0MA 1U5TA 3K1PA 3WODF 2IT0A 1U8RA 5D8LB 1A04A 2P6TA 3LA2A 4CHUA 4I09A 2GQQA 2M8EA 4HX4A 1K6OA 1XSVA 2J5OA 1G3YA 4OMZA 1U2WA 2HZTA 3V4GA 2FOKA 3IWZA 2HYGD 4Y17A 1FT9A 5L3GA 2Y75A 4U7BA 1U3EM 2H09A 1CF7B 4HYEA 2ZMEA 3EDPA 1U78A 1I5ZA 5L3FA 2EFPA 3GW2A 3L00A 2H94A 5ERIA 2DTRA 3O6BB 1T98A 2K02A 1SD5A 3KP7A 2XAHA 3V8KA 3EUHA 5DDGA 4I0AA 2FBKA 5TJJA 5BMZA 2EFOA 4R8HA 3T1BA 2P8TA 3TO9A 4A0YA 3P9CA 1SD6A 5FO5A 4ENJA 1S29A 5L3CA 3QU6A 2KJCA 4IXAA 3WTYC 4L0ZB 1JGSA 2A5YB 2RN7A 3CUOA 4LFUA 5ICCA 3ZN0A 4MGRA 5LHGA 2FQ3A 3N97A 3EQLF 2VXZA 3B02A 4HDVA 1USTA 3AAFA 1YS6A 2DO7A 4UVAA 2BGCA 3BP8A 1MGTA 2A61A 2XV4S 5DCMA 2DQLA 1YO5C 1R5GA 1SFEA 4FX0A 5CVJA 2EB7A 2V6CA 2IP2A 4Q48A 2CWEA 4L9JA 2OQGA 2JPBA 1TNTA 1L0OC 3BPXA 2ZJ2A 3MZHA 2HWVA 4AVPA 1FLIA 3VB2A 1FWZA 5BQTA 3HOTA 3QPTA 3QPHA 2HKXA 2COMA 2OZUA 2PJPA 1RUOA 1LNWA 3FWEA 3I4PA 3WGGA 4IRHA 4P96A 3T8RA 2YX7A 4FHTA 4R79A 1G3WA 1FPQA 1S8NA 1ODDA 4RB2C 3ELKA 3M8EA 3CUQA 1OKRA 5HDKA 2K27A 1TW2A 5JHUA 2PEXA 4UV9A 3WGHA 3CO7C 1B9NA 3RKXA 3DF8A 2EWNA 3K2ZA 2QENA 1XDUA 2UWMA 3DP7A 5D5UB 3C18A 4A0ZA 1YW9A 2M45A 2P5KA 3GF2A 4HAMA 4RGUA 4I01A 2YSRA 5CYVA 2FXAA 3DFGA 2V1UA 2GXBA 4GYGA 2ISZA 2K7LA 3RI4A 2Q0OA 3F21A 2KRFA 4E70A 2FE3A 2XAQA 4KMFA 5L3DA 3E6DA 5LRRA 4I0BA 3GYHX 2XAFA 5ED4A 5IT9Z 2ADUA 4M73A 5D5XB 2Z9OA 3K0LA 4LLNA 3J80Z 5DYMA 4B09A 4G6DA 3BPVA 4AIJA 3V8JA 5LGTA 4A12A 1MDMA 2WC2A 4HZFA 2FF4A 4HW0A 1FC3A 4LK0F 5HDGA 2A07F 3ZP5A 4LG0B 4M9XA 1IW7F 1FNNA 4EJWA 5AONA 4I02A 2QBYA 1BI2A 1YLFA 1DPRA 2ISYA 3I58A 3TOAA 3KFWX 3L9FA 4HF2A 1XMKA 1AOYA 3CUQC 1BI1A 3R6SA 2RQPA 4MTEA 1G3TA 2QUFA 3R0AA 1T6SA 3JTHA 3I59B 5K1YA 3GUDA 1B59A 4MHGA 2MD5A 1Z7UA 4EJVA 5ICGA 1LB2A 2ACJA 2RDPA 2E1CA 2HOEA 3E6BA 4PZJA 2HQNA 3HRSA 3ZMSA 5LHIA 1R1TA 4EM1A 3DEUA 1STZA 4M74A 3BROA 1KA8A 3OV8A 4N0BA 1U6GA 1OPCA 2QYOA 2PQ8A 1TBXA 4G7HF 1DUXC 1IXRC 3V7CA 3KZYA 1HKTA 5D8KB 3ZMVA 4O5VA 3GFLA 3L7WA 4CYDA 2P7CB 1ZN2A 2A6HF 5EEHA 1XN7A 2QWWA 4EJOA 2D1HA 3M7GA 1K78B 4HDUA 1F9NA 1W5TA 3MFKA 2OD5A 2QM3A 3E6MA 2GAUA 1T38A 3CLOA 4MEYF 2O0YA 5E18F 4G7ZF 1ON1A 4IPAA 4YG2F 4I2OA 2BBYA 2JT1A 4WCGA 3SXYA 3TDZC 5LLQA 3BWGA 4MQ9F 2QQ9A 4S05A 4WX9A 3LFKA 3SQNA 1IXSB 3BDDA 5JI6A 3DXJF 3OOPA 3F6OA 1IN4A 1W4MA 1W7PD 2VBXA 4LJZF 3REOA 4AIKA 2MA3A 2A69F 3KE2A 4KIBA 1XGNA 4DQ2A 3I71A 1ZG3A 5BS6A 2Q8KA 5D4SA 1MDMB 1UCRA 3N4MA 3TQNA 5CJ9A 3V7SA 2KIUA 3TO6A 3GLXA 1R58A 3VFZA 1PP8F 1J7KA 2CW0F 3FM5A 4XLPF 4P9UA 3WTTC 1FP1D 4EMSA 1J9IA 3I59A 4WWCA 3ECHA 4U0YA 2FA5A 4KN4X 4CXFA 1PUEE 4EQQA 1YS7A 2QQBA 5ICFA 5D5WB 3IL2A 2YPRA 3JAMZ 4K2EA 5FFXA 4XLNF 2XASA 2R3SA 1UFMA 2GA1A 4KDPA 1XSXA 4UVCA 4Q47A 5H6QA 3E3VA 4LG0A 1YW7A 2HYFA 1ZRFA 1BN5A 5DUIA 1GXQA 3ML6A 2VBYA 4QWQA 4ZYGA 2W85A 4LMYA 1DPUA 3ABUA 4HX8A 3B73A 3T8TA 3H3ZA 1FY7A 2IVMA 1S6LA 1YG2A 2VE9A 4OINF 1TTYA 4OIOF 3GFIA 4EVIA 2JTVA 3LAJA 2FEZA 4YFXF 2Y0MA 5E1ZB 2VN2A 1QZYA 4U0WA 1Z6TA 4LD5A 1G3SA 3IWFA 2E1NA 1YYVA 5IT3A 2DK5A 3RJPA 2AXLA 3RPUA 3EETA 2XAGA 3JTGA 3O3KA 1GVJA 5E20A 1BOAA 1SD4A 3HRTA 1NHAA 2DPDA 2M30A 1XGOA 4KIGA 4MEXF 2RVCA 1IZ1A 4WXDA 1MJ9A 2KKOA 4ZZLA 1BBYA 1YQAA 3V8LA 2BE5F 2Y48A 2GIVA 5DCMB 4RAYA 2QQAA 4UNOA 4LGWA 1IN6A 4ESFA 1GXPA 1QO0D 3NQOA 4CDGA 2A68F 4I7HA 1Z05A 5KK1A 1IUYA 3RYPA 3KEOA 4A6EA 4TV7A 3L09A 2PFBA 1UHMA 2XROA 1KYWA 2MC3A 2HGCA 2L02A 1V3FA 2QVOA 3LWFA 1SAXA 3QU3A 2GWRA 1AWCA 3MWMA 1XB4A 4L9TA 2G7HA 3FZVA 5J8CA 3K1NA 3TDUC 3ROUA 4IHTA 3VODA 1RIOH 1ZRDA 1QGPA 3QP5A 4Y15A 2HEOA 3PQJA 3KP2A 3LAPA 4G6QA 2PMUA 1EH7A 2Z99A 3P7NA 4ZYEA 4M71A 2RGVA 3LSTA 4BYYA 4G94A 2NNYA 4KUMA 1D8JA 2KIMA 2X4HA 5HLGA 1W7PB 1FP2A 5K5OA 3T0YA 5HS9A 1S3JA 3LA7A 4HLXA 2F2EA 2D2WA 3GWZA 3HSFA 2IJLA 2LF7A 1SMTA 3TKYA 1HSTA 4MTDA 5IT9K 2HTJA 4AWXB 2K4JA 4JQFA 3FMRA 4F7ZA 2ZNZA 3GEZA 5JR3A 2R7DA 2FMLA 2Q2EA 4RB1A 1KGSA 3DV8A 1W7PA 1XMAA 2M1BA 2UXXA 3FXQA 3BJOA 1LEBA 4NQWA 3WE3A 3MQ0A 1KU2A 3WGIA 5E8IA 4R1HA 2BV6A 4BQAA 3J7AO 3GFJA 3R4KA 3T5XA 2MLKA 1SD7A 3DPLC 3PQKA 1RI7A 5K5RA 4FX4A 2DT5A 4Z2YA 2V1DA 5K5QA 1JXSA 3G73A 4IVNA 3FXRA 2K86A 3HRMA 3RIRA 2PLYA 2L3DA 3VOEA 1ZARA 3HHHA 2M87A 1J59A 2LDUA 1RUNA 5F1RA 3F8CA 1H9TA 2H6BA 4N9IA 2RNJA 2HS5A 1PP7U 3HYIA 1IRGA 2DK8A 4G7OF 1WQ2A 3C1DA 3WG9A 3I0TA 3Q9SA 5DUKA 3JSPA 1O3RA 4M6YA 1BI0A 5LGUA 1ZG1A 4HA8A 1FBSA 1IN5A 1HXDA 4ETSA 2EJRA 4XBFA 5ILUA 4NHJA 3F23A 1D5VA 4ZYDA 4GO1A 3KLNA 1CGPA 5D4RA 2IRFG 2Z33A 2NS0A 4WF2A 1HW2A 1T0FA 1REPC 4ESBA 1HQCA 2CYYA 4IJAA 1LDKB 2DQRA 2EK5A 1W5SA 4ZYHA 4FT8A 2DFIA 3R0JA 1XGMA
chains in the Genus database with same CATH superfamily
1AHDP 2QEXI 1QRYA 3PFYA 3G71I 2KT0A 3SZPA 2EFNA 4BQNA 2NVXJ 4DNCA 1H8AC 1A31A 3G3ZA 1U9OA 2A3SA 5ICEA 5J3LA 3ZQFA 2MGQA 2IS2A 3OYBA 4O6JA 3JW4A 2VC1A 3S14J 4UHTA 1QPMA 5FKLA 4CUGA 3G1MA 2RQQA 1JI8A 2W25A 2R5ZB 2K3PA 3SYTA 5IY5H 1IDYA 1BR4A 3HSEA 1JHHA 5J8FA 1FYKA 4HLYA 1D0YA 2PBIA 2DLLA 3WTXC 4RGXA 1KQ9A 1SFXA 5J40A 2OC6A 1XPXA 2JA6J 4S04A 2MYSA 2LVSA 1X3ZB 2F5CA 4BUPA 2GZWA 3BC8A 3V7RA 3SHFA 3F3XA 1EKEA 3KLOA 1LFPA 3ZR8X 4RAZA 2RAEA 2X6OA 5JFRA 5F64A 3CO6C 2EV6A 1OCZH 2HQRA 3WTSC 1JGGA 3EYYA 3HUGB 5E17F 1MJAA 4GGGA 1TW3A 3QODA 2NVTJ 3HHGA 3GVAA 1TT0A 1HKSA 4GXOA 2KFDA 3F22A 2VODA 3MKZA 2LOOA 5BPDA 2ECBA 3K4KA 1Y1VJ 1HDDC 2FNAA 2P6SA 2LK2A 3MEXA 1B6AA 5C4JJ 5CVVA 3ISPA 1P4AA 2K4BA 1X3UA 5JLXA 1L3LA 1D1CA 3GTGJ 5D5VB 1JKOC 3OYDA 2J5PA 2JZYA 3S1QJ 1GUUA 3JSOA 2VL8A 3CMEI 3PFIA 4KA4A 2QKMB 2FJ1A 1SVLA 4CICA 3S2WA 1GVDA 2ZXJA 2KL4A 1HBXG 4E7SA 1FBUA 3AG1H 2IA2A 4KIFA 1PDNC 2M7BA 2Q1ZB 2O5RA 3J80K 4ZDOA 1ZYRF 1W5CC 2O6GE 4XLFA 2HOSA 1ONVA 2DOAA 2Z5UA 3I64A 3S1MJ 3C2GA 3S1RJ 2NOGA 3ABMH 4WXHA 4CCNA 3OYLA 5E1WA 3J7ZI 4EM2A 1D1AA 3DLLF 3M1EA 4RGSA 5EEAA 3M9AA 2GBYA 2BXYA 2IGOA 3UNGC 5M5YJ 2JMWA 2XIGA 4KFCA 4U88A 4A93J 4IQ4A 1U5TB 1UHSA 4QLCU 2P4WA 3FM3A 4XSZF 5FKKA 4UUVA 1R9TJ 2EV5A 3JRIA 1R1UA 1DGRM 2VJ4A 3W6KB 5LRSA 3CCQI 4A6DA 4D0PA 1KONA 3IP4B 4XRFA 4ZC3A 4A3KJ 3MZYA 3DTIA 3QRFF 5J1UA 1U9NA 1E2XA 3BY6A 3S93A 4L5JA 3L2VA 1VQ6I 1UB9A 3O2PE 4NC7A 3HOWJ 3FMQA 1FMWA 4L5EA 3OS1A 2L7KA 3C3WA 2F4OB 2XB5A 2RC4A 1BR2A 1EH6A 2NS8A 2OU2A 2NVUB 1X19A 3OYGA 2VQHA 3FF5A 1QBJA 4BEHB 3DU5A 1HF0A 3I5UA 1QVTA 5B3SH 1IN7A 3TP0A 2C6YA 2RKHA 1FJLA 2O61A 3ZQLA 1R23A 2IBDA 5GAEJ 4HNUA 1LQ1A 2X6YA 3GTLJ 1BW6A 1I1GA 3RQIA 4A3IJ 1MZBA 1ZLKA 2G7UA 1MH4A 3EUKL 2XKPA 4PGGA 4B3XA 5F0FA 1B9MA 2RV8A 4BDZA 3K70D 2W57A 2ICWG 1YTYA 4Q4ZF 1Z6RA 2EFQA 2HPIA 1BW5A 1VZ0A 4HF1A 1BC8C 5JVGF 4OIQF 2D45A 3HIFA 1V5EA 4QPQA 3W2AA 2H8WA 2XC7A 1G4DA 5AIQA 4FETA 3BT9A 1LFBA 4J01A 2V1NA 2OBPA 2ZFUA 3SDGA 4HOBA 1T2KA 1IXCA 2FMYA 3E5UA 4XKCA 5A2QK 1P92A 1ORKA 2QCOA 1AA7A 2EIKH 4F52A 3QP6A 4PCQA 5CQEA 3WU0A 4BQQA 1YW8A 3H92A 2PI0A 4RLFA 5FKNA 4IQJA 4J19A 1ETQA 1K78A 4KITB 1X1CA 2BYVE 1IRXA 3M8JA 2HDWA 2KIQA 3HRUA 1TQPA 3RKWA 1Q1VA 2DW4A 2LY2A 2DI3A 2QGUA 2VOOA 2YX4A 3H9GA 1VF9A 2OPTA 2L2OA 2F5DA 2Z3YA 4U0VA 1FBQA 1JKPC 2L9NA 4U7DA 2WV0A 3TGNA 3K1MA 3GXOA 1FYLA 3VDXA 1WJCA 5KCMA 4XRMA 4L18B 1C0WA 2V79A 2KJBA 4LOCA 1R71A 3RSNA 4G9YA 3VSLA 3A01A 2DDBA 3WTVC 3M3YJ 4LLLA 3LSIA 1Y0UA 2MBFA 3Q9VA 3IHUA 2M4KA 2XAJA 4JK1X 4EJUA 3HEFA 3SEQA 4ON0A 1UG2A 4M3BA 5DV5A 3PJRA 3AFHA 4ENKA 2M5WA 4A0XA 3ZMUA 1P2FA 4HEA2 1ETYA 4FASD 1ETWA 1LDJA 2CUEA 4KJZA 2VT2A 5CQGA 2W82A 3B6CA 2PN6A 3F9KA 4YFNF 2DDAA 3BZ6A 1Z1DA 1UMQA 3TOBA 3LQRA 2E7XA 2DA2A 1ZELA 1T39A 2H27A 4AUXA 1R1VA 3BJ6A 5HS8A 5JVTA 4XSXF 1X58A 4E7ZA 2P5LC 5CLSA 3RPUD 5EJCA 4ZZDA 4EV0A 4BNCA 4C2TA 1YIOA 2I5UA 1ZH5A 3H9QA 4EGZA 2VONA 2O3FA 5CKTA 2R7FA 1XGSA 3QQAA 2JJ7A 2BHZA 2CQNA 2F5VA 2EZHA 2N8GA 1IC8A 3S1NJ 1Z21A 4D9JA 4LK1F 2QLZA 3CTAA 5J6XA 1RC9A 2OQRA 2W24A 1XDSA 3K6GA 2ETHA 2WWYA 4H4KC 2XUBA 4IHVA 4LB5A 2LY9A 5HS7A 2M0MA 1KU7A 2CFOA 4BHCA 5H20A 1BIBA 1BJAA 5B1AH 2CSOA 3QAHA 4I76A 2VBZA 4BXFA 2XVCA 3DPUA 4PFPA 1MNMC 3I4MJ 2L01A 2PJRB 4O3MA 3K4MA 3JRGA 5A2QZ 2LKPA 5KVRA 3TW7A 3HGYA 2F5FA 3BTIA 4DYCA 3OYMA 2DMPA 2Y2ZA 5CVRA 3IKVA 3ZMZA 2DOFA 3F8BA 5L3EA 5E8GA 3O8HA 2KHMA 1GHCA 4P9FA 5D6EA 2ZBKA 3UR3C 1ZREA 2ZFWA 2WADA 4EM0B 1USSA 4OIRF 3KYCB 5E79C 2STWA 3R61A 5LHHA 2JN6A 3SFIA 1XCVA 5HVQC 4KMUX 3IH3A 3QYFA 4LIUA 3LSRA 4A69C 2MLGA 5HDNA 3CP2A 2DPUA 2EINH 4CSWA 2NNNA 3LA3A 5CVUA 3LSPA 4M6XA 5E1XA 1FOKA 2LMDA 3D5LA 3J81Z 2A6TA 2YU3A 2LH9A 3I54A 2R92J 3HL2A 2E2IJ 2CFXA 3DEEA 3RQ4A 2OTJI 3QWLA 2DBBA 3DPTA 3I53A 2M8GX 3KP4A 3BG3A 1WWXA 2KQRA 3CC2I 3FMSA 4PGHA 1R00A 2JVGA 5HLHA 2E1MC 2OCCH 2QA4I 3HTSB 3WG7H 2DOEA 1G59A 5EG0A 3FHZA 1OYWA 5DS9A 1PVEA 4HSRA 4PDKA 1IAWA 1IF1A 1F5TA 1UG0A 3HBLA 1MKMA 3D5RC 1FYMA 3GTPJ 1TC3C 2XHKA 5M3FJ 2F5EA 3KCCA 4Q5SF 5E3OA 3VEPA 1WHUA 2HDCA 1R4NB 2XRNA 1Q1HA 4ESJA 5C4XJ 3KP3A 3LNQA 3KEQA 3RDIA 5LEKA 3OS0A 6PAXA 1ETOA 5KNLA 2AS5F 4U87A 2OJED 4IHXA 4F91B 4H0EA 4LG3A 1KYZA 2XSJC 3O8GA 2LG4A 2L9RA 2LLKA 3OSGA 1HOMA 2YR2A 3GTMJ 2LRDA 3WHBA 4G8XA 2AO9A 1OMIA 4ENMA 1X2NA 1R5ID 4C30A 2WAEA 4HQMA 4XR6A 2Y9ZA 2IW5A 3OYJA 4L9VA 5B1BH 3F8FA 2HKOA 4ZYAA 5M5WJ 3ZN1A 3KP5A 3ONQA 4BHPA 5LGNA 3OYAA 2V9VA 5K7HA 2JPCA 4IRGA 1VQMI 1O3SA 4FCYA 4IRIA 2PMHA 1Z91A 3CMAI 4IHYA 5DEQA 4BJ5C 1A35A 3I9V2 4M9SA 4IF4A 4F93B 1SFKA 1V5FA 2HFHA 1MBEA 3G2BA 3IKTA 5L3BA 1F1ZA 3FIWA 1MBJA 1X1BA 1FZPB 3CUQB 1KQ0A 2E1MB 2P5VA 5EEGA 1PUFA 4BXUA 3HTUA 1ON2A 4RA2A 1VNDA 1KU3A 2L4MA 1R49A 1WKMA 5FGMA 1W0UA 5DD4A 2MH9A 4CZZA 4WK8F 1J5YA 3COAC 3BOQA 1XG1A 1ZGAA 1QNTA 3ERED 2LTPA 1J0RA 3SZTA 4XQFA 3ZRGA 3BQYA 2CQKA 2OZ6A 3H5NA 3CC7I 4DYRA 1Y1WJ 4HSTA 2ZCWA 2KIFA 4GYIA 1JE8A 2ZKZA 4YIRX 3DCFA 2L4AA 4NC6A 4F3QA 4M3EA 4C3IJ 1OQYA 1EH8A 1FX7A 2O8XA 3JCUC 1O57A 3A1YA 3ABTA 2R7UA 5HOOA 1FSHA 3CESA 3M8FA 1XD7A 2R93J 2BY0A 2HXOA 4FISA 1H9GA 1RR8C 3B6AA 2HR3A 2BY1A 2EFWA 3BG9A 3BJAA 1ZLJA 4B47A 4BH9A 3KP6A 3A01B 3P5JA 2XGDA 1OLTA 3RTRA 2OAZA 1KU9A 4HQEA 4AD9A 2JA2A 3I55I 3AKZA 3WU2C 5F0CA 4XICA 2NAZA 3FXJA 2STTA 2O03A 1FSEA 1ZRCA 3L2CA 3FDYA 1J75A 4FQGA 1XSDA 2W84A 2ZMEB 2L7ZA 4QSHA 3TMOA 2XDVA 1CF7A 5EZHA 4B8XA 1R22A 3L2RA 4BBSJ 2FNPA 3FBNB 2DXIA 2HQAA 2JRTA 1A5JA 3P9IA 3K4BA 2LR8A 4RS8A 4ZJZA 1LFUP 4CCJA 1FOYA 5D6FA 4ZH4F 2QZ8A 3H3UA 4DZJA 3WU1B 3IAS2 3KPHA 2M7AA 2DN0A 4C2UA 3Q3SA 4XM3A 1TQMA 4OOIA 5FD6A 2P7VB 2GIZA 2GA2A 5LFAA 1P7JA 1R7JA 2IAIA 4KN7X 1NG6A 4XKBA 1IRFA 2DA5A 4CYCB 3CJNA 1TP4A 3HOVJ 2KISA 3L2UA 4KNYA 2EIJH 1IGNA 4Y13A 4M6VA 5H2FC 4ZTJA 4ASNA 3P9KA 5CVIA 3RKYA 4I98B 2LNBA 4PJLA 1F4KA 5H6RA 2FBHA 1QZZA 3ULQB 4HX7A 2HTSA 3OYNA 1EV7A 2A05A 2JUGA 1V4RA 1P4XA 2ECCA 3V42A 4PJMA 5ILSA 4PJJA 4IHSA 3TO7A 1BC7C 3E5XA 3HOSA 4A5NA 1WJ5A 5AIPA 4ZDPA 3NAUA 3HUGA 2CG4A 4CH7A 4DYQA 3JRDA 1N77A 5DD8A 1OYYA 1I27A 4E4HA 2FU4A 2B63J 4Y3OA 3DQVC 1VQPI 4GFBA 5EZGA 4HBLA 4ENNA 4P55A 3HB9A 3GZ6A 2EA2A 2LYCA 1YX5A 3FK6A 1UHWA 2GXAA 3QYBA 1DDNA 4N4NB 3OYEA 2PX9A 2VT3A 4YIFA 2D1VA 1K79A 4AC0A 1X1AA 2EA4A 4CYCA 2XAUA 3G1LA 3NRVA 3VWBA 5FLXZ 1LE8B 2VOPA 2F4MB 1HLVA 4YELA 3WE2A 2H6CA 3E6CC 4IKFA 2MD0A 4IOCF 3GCMA 2FRHA 1IN8A 4CO8A 4ZDLA 3A2KA 2X6WA 3U9GA 2VASA 3S17J 2R7WA 1O3TA 2ZO4A 1XX5A 4XMYA 3S3NA 4LB6B 4B44A 3W2VA 3CJQB 2IA0A 1TWAJ 2CGPA 1TWCJ 2MC4A 3W6JB 5JHFA 3ZQ7A 1FOXA 1YHQI 2HVSA 3RZOJ 3LQQA 4YEJA 2RREA 4HV6A 3MAJA 3GX4X 2FUG2 4OIPF 1OFCX 3C7JA 1G6NA 4EJTA 5F27A 1S7AA 3M1CA 4HNTA 3KETA 1MBKA 3ZGKA 1GDTA 1LDDA 1Z67A 4HV5A 2EV0A 4AU7A 2E71A 5DM7F 3F72A 4RLQA 2G9WA 2BEOA 2TDXA 3GZ5A 3IH2A 3MCZA 1QQIA 3R60A 5F1JA 2X0LA 3ESWB 1RRJA 2DMQA 2GLOA 4N9HA 4L0YB 2JA8J 2MH2A 1U8BA 4BU2A 2VC0A 3WTZA 1LKXA 5B66C 5ILVA 2EZLA 1HSJA 1O7FA 3JRFA 1X1DA 1MBHA 1RKWA 1LJ9A 1HW1A 2IPQX 4CCOA 3D0SA 4IO9F 1RZ4A 4LLGF 4EGYA 3F6VA 3CDHA 4A3JJ 2BZTA 2VB6A 2A6EF 2V6EA 3FXUA 2LC2A 1TNSA 4M72A 2W4SA 2MFZA 5EG0B 1WSUA 2HOTA 3MMYB 3FKJA 3TEDA 1O7LA 5FB2A 1IV6A 1MD0A 4MQVA 2JSCA 1P4WA 3QOPA 2BW3B 1WH5A 3U2RA 4Y7NJ 2CO5A 3BR3A 1LEAA 1FOWA 4PSXA 1WJAA 5GTHC 4CGZA 3RYRA 1LVKA 1ZKGA 2HI3A 4II2A 3H9JA 4BAYA 2L7FP 1XS9A 2K3FA 2FSWA 2R7VA 4UV8A 1S7OA 3H5RA 2R7SA 2WTEA 3PNYA 4JBAA 4PJ0C 2DU9A 4HG2A 1ZAOA 2NOJB 2V1XA 4NB5A 3TW6A 2OA4A 3BCAA 3BTCA 5IP9J 4OMYA 3QPLA 2PG4A 3ZMTA 1TLHB 3HJEA 2DAOA 4OU0A 1BJZA 1JT6A 1R36A 4BHBA 1SC7A 2XKOA 3LFUA 1WI9A 3GO5A 5BPIA 1B1BA 3S16J 4DBQA 2LKXA 3ZPLA 2I8DA 1WRJA 1JHFA 3CCSI 2NYXA 3WTWC 2JWTA 2OUMA 3FK7A 2VE8A 4W1UA 1MNEA 1B8IB 4KYWA 3MN2A 2X48A 4D1QA 4V2GA 2ESHA 2HOAA 1U5TC 1Z9CA 3ZQGA 1NH3A 2E5NA 3M4OJ 2XB0X 2ELHA 1HA8A 2UXNA 3IRRA 4KT5C 2K40A 1MJBA 2B0LA 4FTHA 1AKHA 1BIAA 2K85A 2WB1A 1XCBA 2WY7Q 5EYRA 1ULYA 1YX3A 2XSDC 4UB8C 2XGXA 3FX3A 5HLIA 5DCFA 4AIHA 1ACIA 4DBRA 2E7WA 1YFHA 2CQXA 3KZZA 4RM2A 1VQNI 3F8MA 5LEJA 3U1DA 2DMNA 4HF0A 2EQRA 2CW8A 1Y56A 1D8KA 1HW5A 4UXNA 3ZMDA 1VTNC 1D3YA 3LSMA 2X9DA 3Q5FA 1VFCA 3NEUA 3JAMK 4A3GJ 3K10A 2KDZA 3OYCA 1MNDA 1BI3A 1HKQA 3KYLA 4UVBA 5IYDJ 3N05A 2Z16A 1ZG5A 2X1CA 4A3FJ 3HSRA 3EUAA 3CD6I 3OIOA 2V26A 4RB3C 2VBWA 1VQOI 5TRDA 1G8XA 3K69A 1OYIA 2LSOA 2IA1A 3CLQA 1VQ8I 3J81K 3GFMA 3PSIA 3OR2C 1ZHFA 2UZKA 1I50J 4L5IA 1ZGJA 2P81A 2ZMEC 4RB0A 3OY9A 2LF8A 1YJWI 3IRQA 3CCEI 3PNVA 3F8NA 1O4XA 2IGKA 5GPAA 3CCRI 2QBYB 2Q2EB 3IC7A 4A2UA 3IAM2 1TWFJ 5DM6F 3G4SI 3RPQA 4YFKF 4YIIA 1J2XA 1R5HA 4KICA 2R7OA 1XC5A 1HC8A 1B4AA 1I6XA 2DT7B 4PJNA 1KQ8A 4M9ZA 5LBQA 2K9NA 2IS4A 3PNTA 5FD5A 3HXLA 1W36D 4L9NA 1YRNB 5FFZA 3E97A 4FE4A 5F6FA 2L0KA 3WTUC 2Y0SN 2ZB9A 1MMAA 4ABZA 4BE0A 1LVAA 3MKYB 4E7HA 1JTYA 4RGRA 2FX0A 5BOXA 5FLXK 3EUHC 1SMYF 5J1RA 3NWSA 1S9HA 1XTAA 2L54A 4MNUA 1I1SA 1P6RA 2F4IA 2FBIA 2BXZA 1RETA 4GCVA 1DP7P 3K9TA 1O3QA 1SFUA 1E17A 3DEWA 3SFZA 4C9YA 1T8IA 1BM9A 2ME0A 2NRAC 4WXCA 3E5QA 4P5OA 5EGOB 2ESNA 1TQIA 2E35A 3DKWA 3ECOA 2OTLI 1K7AA 1VQKI 3EYIA 2E36A 2GXGA 2ZNYA 3SJMA 1IRZA 1RNLA 1TZLA 1X4PA 3PIOF 4GDFA 1OR7A 3BCBA 2E34A 3E1SA 1V55H 4UB6C 1ZTRA 4OWRB 3S32A 4A5MA 1H0MA 2CQQA 1U5TA 4RAFA 1XMXA 3DBRB 3ASOH 4JYKA 3K1PA 1WGXA 3WODF 2IT0A 2VKDA 2R5YA 1U8RA 2BW3A 1MMNA 5D8LB 1A04A 2P6TA 5E3MA 2CRGA 3LA2A 4CHUA 1E3PA 1F36A 3HKZA 4NNJA 3JRAA 3K4NA 2X51A 2KDOA 4I09A 2LD5A 1YOVB 2GQQA 2M8EA 2V7FA 4HX4A 5E3LA 2RNGA 2WAQN 2DYRH 1MSFC 4G12A 1K6OA 1XSVA 3OMYA 2H1KA 2WAQA 1K4TA 3MD2A 2J5OA 1G3YA 2CS3A 4OMZA 2NS7A 2DCEA 4XK4A 2M2EA 5K7FA 1U2WA 2HZTA 3C2BA 3IWZA 2FOKA 3V4GA 3FXLA 2HYGD 1ZK8A 4Y17A 4I6ZA 4MFDA 1W1WE 3ZOBA 1FT9A 2W48A 4XNFA 5L3GA 1Y6IA 2Y75A 4U7BA 1EJ9A 1YRNA 2ZC2A 1ZGWA 1U3EM 4DGWB 2K9LA 2H09A 2KZVA 1CF7B 4HYEA 3OR1C 2ZMEA 2R7QA 3EDPA 1U78A 3FXKA 3FISA 1I5ZA 5L3FA 2IGMA 5FRMA 2EFPA 1JT0A 3GW2A 3L00A 2H94A 5ERIA 2R7TA 2DTRA 3QOEA 2CV2A 2O8KA 3O6BB 4F92B 4AYBA 1X1PA 1I39A 1T98A 2X1EA 2DA6A 3VYUB 2DA1A 2QSGX 2L5QA 2K02A 1SD5A 1ZQ3P 3KP7A 2XAHA 3V8KA 3EUHA 1RPWA 2VPRA 3OL3A 3FKIJ 3I3LA 5DDGA 4I0AA 1R4MB 2FBKA 4E7IA 2HVQA 3DKXA 5TJJA 5BMZA 3K2AA 2EFOA 2G0EA 4R8HA 3T1BA 2P8TA 2V4JC 4X0GA 2V9KA 5K7ZA 3TO9A 4A0YA 2B9SA 4JP0A 3P9CA 4M3FA 2FD5A 3CCVI 1IUFA 1SD6A 5FO5A 4ENJA 1S29A 5L3CA 3QU6A 3CCJI 2KJCA 3CCYA 4IXAA 4IZZA 3WTYC 4PUSA 2DFHA 1VQ9I 5J4VA 3I56I 3KZIC 2P0WA 1E0EA 3HZJA 4L0ZB 2DJIA 1JGSA 5FLVA 2DFEA 2KP6A 9ANTA 1PUFB 2L7MP 3PO2J 2A5YB 2RN7A 3CUOA 4LFUA 5ICCA 2O7OA 3ZN0A 4MGRA 2CU7A 1E3OC 4KISA 4CCMA 5LHGA 3X2QH 1BL0A 3JR9A 5KAFC 2FQ3A 5EGOA 3N97A 2R4GA 3EQLF 2VXZA 3B02A 2DA4A 4HDVA 5DTDA 4XRSG 1USTA 3AAFA 3GTOJ 1YS6A 2DO7A 4XN3A 2TRTA 4PFOA 3NARA 3VYSB 3D1NI 4UVAA 2BGCA 3BTLA 2XPWA 2LP0A 3OYKA 3BP8A 2Z2SB 4AIDA 2R7XA 2ID3A 1Y0NA 3EPZA 3PM1A 3DBLB 1MGTA 4JX4A 2A61A 2VKVA 2XV4S 5C44J 4JX5A 5DCMA 2DQLA 1YO5C 1ERDA 1R5GA 1T56A 1SFEA 4HPQA 4FX0A 4B43A 1D5YA 5CPRB 5HLTA 5CVJA 3QYEA 2EB7A 3K4JA 2D5VA 3HOYJ 2V6CA 5J4YA 2IP2A 1ETKA 2LFBA 4Q48A 1R6RA 2CWEA 4L9JA 4A3DJ 2DMUA 2OQGA 2JPBA 3S3MA 1TNTA 3ERMA 1L0OC 3BPXA 2ZJ2A 2AQFA 3CJTB 3Q0VA 1FEXA 3D5SC 4OAYA 3MZHA 2HWVA 1FIPA 1NG7A 2E1OA 1SVMA 4AVPA 1FLIA 3VB2A 4IX7A 3GZNB 1FWZA 5BQTA 3HOTA 3QPTA 2VQGA 3QPHA 3VSKA 2HKXA 2COMA 2OZUA 2PJPA 1RUOA 1LNWA 2MABA 1MMSA 2CH0A 3FWEA 3I4PA 1BOBA 4IRHA 3WGGA 4QIWN 4P96A 3T8RA 2YX7A 4FHTA 4XOTA 4R79A 2E19A 4W97A 1G3WA 2HU9A 2W7NA 2IS6A 1NK3P 1FPQA 1S8NA 3KEYA 1ODDA 3S8PA 2R7ZJ 2HQ5A 1BA5A 1YIJI 4XL9A 4RB2C 3ELKA 3LSHA 3M8EA 1A6IA 2OF7A 3ABLH 4BE2A 2UUZA 3CUQA 3HGGA 2CUFA 4GRIA 4ANJA 2ZJRF 1OKRA 5HDKA 2K27A 1TW2A 5JHUA 2PEXA 4UV9A 3WGHA 3CO7C 1B9NA 4EATA 4FE7A 3RKXA 3GMEA 2K9MA 3FBIB 3DF8A 5FKOA 2EWNA 3JRBA 3A0BC 3K2ZA 1QA6A 2QENA 1XDUA 1SFOJ 1FTZA 3IUOA 5IPAA 2X85A 2UWMA 2PMZN 3DTEA 3J7YJ 3DP7A 2EBIA 1DP3A 1Y8QB 2KLOA 2QF7A 5D5UB 3C18A 4IOAF 4A0ZA 2IGNA 2H1LA 3OL4A 1YW9A 1YITI 3M07A 2M45A 3JRCA 4ITVA 4N4OB 3J7AY 3L2QA 2P5KA 3GF2A 4CCKA 3BG5A 4HAMA 3ZQCA 4NUBA 5KHDA 4RGUA 1BR1A 2ELJA 4I01A 5IP6A 2JK3A 3OYIA 1OCOH 2YSRA 1S5LC 5CYVA 2FXAA 3DFGA 1T0FC 2V1UA 2GXBA 4GYGA 3A0HC 4D7MA 2ISZA 5IOYA 2K7LA 3S2HJ 2FOWA 3RI4A 2Q0OA 5GAGJ 3F21A 2ZJQF 2KRFA 4E70A 2FE3A 2XAQA 4KMFA 2EILH 5L3DA 3OS2A 5GP9A 3E6DA 3TL4X 5LRRA 1JJ6C 4I0BA 3GYHX 2XAFA 3MVPA 2E2HJ 5ED4A 5FLMJ 5IT9Z 3HOUJ 2ADUA 4M73A 1TL8A 5D5XB 2Z9OA 3SZGA 3K0LA 3HPHA 1OCCH 4LLNA 1D1BA 3RZDJ 4AYBN 1K61A 3J80Z 3OWTA 4UUTA 5DYMA 4B09A 1IDZA 4G6DA 3BPVA 3KIOA 5M5XJ 4AIJA 3V8JA 5LGTA 4A12A 1MDMA 2M0CA 2WC2A 1A6QA 4HZFA 2FF4A 4HW0A 1FC3A 4LK0F 4BL0B 5HDGA 3W6VA 2A07F 3ZP5A 4LG0B 4PSWA 4M9XA 1IW7F 1TWGJ 1FNNA 2F6CA 4EJWA 5AONA 2ZJPF 3LOCA 4I02A 2QBYA 3W3CA 1BI2A 1YJNI 1YLFA 2VJ5A 1DPRA 1VQ4I 4XLCA 5C3EJ 2ISYA 2ZXHA 1N78A 3I58A 2CW7A 1GLNA 3TOAA 2MSYA 5HNFA 3KFWX 3CMMA 3L9FA 3AG2H 1XMKA 4HF2A 1AOYA 3CUQC 1BI1A 1AU7A 3R6SA 2RQPA 4OAZA 4MTEA 1G3TA 2QUFA 1WJBA 2M34A 3R0AA 1T6SA 3JTHA 3I59B 3AG3H 5K1YA 3CCUI 3OSFA 1DU0A 3GUDA 1B59A 4MHGA 2MD5A 1Z7UA 4XLHA 4EJVA 5ICGA 4E7KA 2HDDA 2YU9J 1JKQC 1LB2A 3PIPF 3DU6A 2ACJA 1J09A 2RDPA 2E1CA 5IP7J 3I4NJ 2HOEA 4NDLA 2BVMA 2DFFA 2WY8Q 3E6BA 4PZJA 2R5YB 2ELKA 3HRSA 2HQNA 1HDPA 1PYVA 4CZCA 1WH7A 2Y31A 3K4CA 3ZMSA 5LHIA 2XGEA 1GV5A 1R1TA 4EM1A 3DEUA 1QU3A 3A03A 2CUZA 1STZA 3BR6A 2VLAA 4CCLA 4M74A 1ETVA 3BROA 5EDNA 1KA8A 2JVHA 3OV8A 3OIPA 5M3MJ 1Y39A 4N0BA 1U6GA 1OPCA 2LBFA 5TGTA 1B72A 2QYOA 4Z6YA 2PQ8A 4B3AA 1FMVA 1TBXA 4MLOA 4G7HF 1DUXC 1IXRC 2DJNA 3V7CA 3KZYA 1HKTA 1A36A 1ZR2A 1D0ZA 5D8KB 3ZMVA 4O5VA 3GFLA 3L7WA 2E60A 4CYDA 2YS9A 1ZN2A 1T33A 2A6HF 5EEHA 2P7CB 4J00A 3FXOA 1XN7A 3JRHA 2EZIA 4HNVA 1T95A 4UUSB 2QWWA 2QQ8A 3HPGA 4EJOA 2D1HA 4F55A 4A3CJ 3SEZA 3M7GA 2NVQJ 3HOZJ 1K78B 4NQWB 4HDUA 1F9NA 1W5TA 3ZQHA 3MFKA 2M3AA 2OD5A 1WZ2A 3SDBA 2QM3A 3E6MA 2GAUA 2NXNB 1T38A 2QKLB 4RM3A 3ZXSA 1P9QC 3CLOA 4MEYF 3S2DJ 2O0YA 4QTRA 5E18F 4G7ZF 3H1CA 4JX6A 1ON1A 4IPAA 4YG2F 3OOUA 5BNGA 4I2OA 2K9QA 2BBYA 1OCRH 2JT1A 3CF2A 3RCOA 2OV7A 5FROA 1JUSA 4E7LA 2ZSIB 4WCGA 3SXYA 1GT0C 3A02A 3TDZC 1E3HA 2K5CA 1S7EA 5LLQA 1I3QJ 4IHWA 1DQUA 3BWGA 4MQ9F 2BY2A 1Y8RB 2DTZA 3HM5A 2QQ9A 4S05A 4WX9A 3LFKA 4D7NA 2XPUA 3SQNA 3L1PA 3ASNH 1IXSB 1Z7LA 1X4OA 3ZQIA 3BDDA 5JI6A 1LUJB 1MIJA 2Y30A 3BZCA 3DXJF 3KYDB 3OOPA 3F6OA 1IN4A 3CP8A 4M3GA 2VPLA 1W4MA 1W7PD 2M4GA 3H0DA 1W0TA 1WJFA 2VBXA 4LJZF 3REOA 4AIKA 1MMGA 2MA3A 1KZHA 2A69F 3KE2A 4KIBA 3AL0C 1XGNA 4DQ2A 3I71A 1ZG3A 1MMDA 5BS6A 2WB1N 2YUSA 2Q8KA 4D5CA 5IYCJ 4BBRJ 1P7IA 5D4SA 1MDMB 1UCRA 4A3BJ 1GV2A 3N4MA 3G1OA 3TQNA 5CJ9A 3PL8A 4DOZA 2JSPA 4X6AJ 5HODA 3V7SA 1D0XA 2KIUA 3VYTB 1HCRA 3TO6A 3GLXA 5HNHA 2WBMA 2NVYJ 1R58A 3VFZA 3ZCOA 3CCMI 5FJ8J 2CV0A 1PP8F 1J7KA 2BY3A 2CW0F 2CJJA 4MFEA 1YJ9I 3FM5A 3BG6A 3VPRA 4XLPF 4PK4A 4P9UA 2PJRA 4BJ6C 3WTTC 2F48A 4XKVA 1FP1D 4EMSA 3GTJJ 1J9IA 2EIMH 3I59A 4WWCA 3ECHA 4U0YA 2FA5A 3GLLA 3MKWB 1UAAA 3BTJA 4KN4X 1OCTC 1DGWY 2HZDA 4CXFA 1APLC 1PUEE 4EQQA 1X3WB 1YS7A 2QQBA 4X1EA 1OCPA 3NWTA 5ICFA 2JA7J 1MW7A 5D5WB 1QZEA 2EPFA 3IL2A 1MBGA 2YPRA 3JAMZ 1VQ7I 4NC8A 4BY7J 2AQEA 2VJIA 4K2EA 4Y4RA 5FFXA 4LIVA 4XLNF 2XASA 2XPVA 4XLAA 4DZPA 2R3SA 2ID6A 1WJEA 3C2HA 1UFMA 2HNHA 2GA1A 2ME6A 3TP3A 2A5WA 4KDPA 1XSXA 4UVCA 3G6EI 4Q47A 5H6QA 2HVRA 3E3VA 4LG0A 5J1YA 4C2MJ 1YW7A 3CDIA 1MH3A 2HYFA 3KX2A 4CA0A 1ZRFA 1YE9A 5FRNA 1BN5A 4V2FA 5DUIA 4XLEA 2CV1A 1GXQA 3ML6A 1JUMA 4BEHA 2GM4A 2VBYA 4QWQA 2VQCA 4ZYGA 1SAUA 4A3EJ 4XORA 2EH3A 2W85A 3K4LA 1FIAA 4LMYA 4QPOA 5JLWA 1DPUA 4RMNA 3ABUA 4HX8A 3B73A 5F08A 4BE1A 3IH4A 3T8TA 3H3ZA 1FY7A 3DWLE 2IVMA 1S6LA 1YG2A 2VE9A 4AVZA 4OINF 1JTXA 2I10A 1TTYA 3S3OA 4OIOF 3GFIA 2X1DA 4EVIA 2JTVA 3LAJA 2CMPA 2FEZA 2L9VA 4YFXF 3BR5A 4BGDA 1QHHD 1NTCA 2Y0MA 5E1ZB 5TISC 3H0GJ 2VN2A 1QZYA 3RKQA 2R7RA 2LY1A 1K6YA 4U0WA 1Z77A 2VJJA 1Z6TA 1POGA 2BVLA 1OJLA 4LD5A 1K4SA 4UY8I 2MG4A 1G3SA 3IWFA 3LSJA 2E1NA 1OR7C 1YYVA 2DA3A 5IT3A 1K83J 2DK5A 2V9PA 2W1OA 4LITA 3RJPA 2HPMA 2AXLA 3CDLA 1Z0XA 1EF4A 1PJRA 3Q0UA 3RPUA 3EETA 2XAGA 3JTGA 3VYRB 4ZTFA 3O3KA 1GVJA 5E20A 1BOAA 1SD4A 3HRTA 4V19K 2KPMA 3H5AA 4EEFG 4G6TB 3GTQJ 4BXXJ 1NHAA 3CZ6A 2DPDA 2M30A 1IO2A 1XGOA 4C3HJ 4KIGA 5LD2C 4MEXF 1ETXA 4DW6A 2R5ZA 2RVCA 1IZ1A 2VIXA 1IG7A 4WXDA 2JQ7A 1T08B 1N75A 2IEKA 1MJ9A 2KKOA 3AL0B 2KZGA 4ZZLA 2LBFB 5IOZA 1B72B 2IS1A 1BBYA 1YQAA 1EA3A 5GADJ 2XGCA 3V8LA 3ZQQA 2BE5F 2Y48A 2GIVA 5DCMB 4RAYA 4XRSA 2JUCA 2QQAA 4UNOA 4LGWA 2QSFX 1IN6A 3BLYA 4ESFA 2VUMJ 1GXPA 1QO0D 3NQOA 2Y69H 4CDGA 3DBHB 1WFXA 2A68F 4I7HA 1Z05A 3U21A 5E3NA 5KK1A 1IUYA 3PUBA 4NBQA 3GTKJ 3RYPA 3KEOA 4A6EA 4TV7A 4A3MJ 3L09A 2PFBA 1UHMA 5EF6A 2H8RA 2MW8A 2XROA 3BZKA 1KYWA 4BACA 2MC3A 3H35A 4II3A 2HGCA 2L02A 1V3FA 2QVOA 4B48A 1W36C 3LWFA 1SAXA 3QU3A 2XF5A 4AM3A 3HOXJ 2GWRA 1AWCA 4XOPA 3MWMA 1V5GA 1OISA 1XB4A 1RKTA 4L9TA 4IL6C 5J47A 3CCLI 1ZR4A 5F04A 2G7HA 2B7EA 5FKMA 1RESA 3QPSA 3FZVA 5J8CA 3FHNA 3K1NA 2JRMA 2AXTC 3TDUC 3ROUA 4IHTA 3VODA 1CQTA 2X6XA 1RIOH 1ZRDA 3CJRB 1QGPA 3QP5A 2AHQA 4Y15A 1S72I 3HKZN 2HEOA 3PQJA 3KP2A 1ENHA 3LAPA 4G6QA 2ZXIA 2PMUA 2K9SA 1EH7A 2Z99A 3P7NA 1AKHB 1X2MA 4ZYEA 1SEUA 4M71A 2RGVA 1QHGA 3LSTA 1VQ5I 4BYYA 4G94A 2NNYA 4KUMA 2VKHA 1D8JA 2KIMA 2X4HA 5F0HA 2DMTA 5HLGA 1W7PB 1FP2A 1WI3A 5K5OA 3CC4I 3T0YA 4A3LJ 2VI6A 5HS9A 2KRCA 1S3JA 3LA7A 2JA5J 5GTIC 4HLXA 4Y52J 2F2EA 2D2WA 3GWZA 1TWHJ 4C3JJ 3HSFA 1JJ8C 1UELB 2IJLA 2LF7A 4Y33A 4I99C 4B1RA 1SMTA 3TKYA 2XRLA 1Z3XA 2E2JJ 2M9HA 1NK2P 3LMMA 3DKYA 1HSTA 4MTDA 2LKSA 4BQOA 5IT9K 2WV1A 2HTJA 4AWXB 2K4JA 3DLAA 2XF6A 4JQFA 3FMRA 4YRVA 4F7ZA 2ZNZA 5GPCA 3GEZA 3MZ8A 2R7DA 5JR3A 2FMLA 4S0HB 2Q2EA 4BS9A 4RB1A 2O9LA 2GOMA 1WJDA 2Y0SA 3LSKA 1KGSA 3FXMA 3BR1A 2DT6A 3OIQA 3CF5F 1LPQA 1MSEC 1WPKA 3DV8A 1W7PA 4E6KG 1XMAA 3H3VK 3IV5A 4P1WA 2HYJA 2M1BA 2UXXA 3FXQA 1U0JA 3LSGA 1DU6A 1I6HJ 2Z1DA 3TBIA 2KMUA 3BJOA 1LEBA 4NQWA 1B8IA 3WE3A 1G2HA 3MKLA 3BR0A 3GBGA 3PO3J 2UV1A 1SANA 3MQ0A 1KU2A 4E7JA 3WGIA 5E8IA 2XF7A 4R1HA 3S15J 2BOLA 2L9SA 1JKRC 4RDUA 2BV6A 1UZCA 4BQAA 2BHYA 3J7AO 3GFJA 3R4KA 3UKGA 3T5XA 4IEJA 2MLKA 5GAHJ 1SD7A 3AG4H 3DPLC 1RI7A 3PQKA 5K5RA 4FX4A 2DT5A 2EZKA 4Z2YA 3BG7A 2V1DA 4KT6A 5K5QA 1JXSA 3G73A 4IVNA 4BDYA 3FXRA 4MO7A 2K86A 2KRHA 3HRMA 3RIRA 2R0QC 1N25A 3DTKA 4BKXA 4XN0A 2PLYA 2L3DA 3LL7A 5KAIC 3VOEA 1ZARA 3HHHA 1H89C 2M87A 1J59A 1F43A 5B5EC 2LDUA 1RUNA 4MIMA 5IYBJ 4JOMA 2COBA 1M1EB 1VQLI 1V54H 2LREA 3F8CA 5F1RA 2QSHX 1H9TA 2H6BA 4N9IA 3ABKH 2RNJA 2HS5A 1PP7U 1QVUA 2DYSH 3HYIA 3A4CA 2VQLA 2CQ7A 1IRGA 2E5ZA 4D5FA 2ZSHB 2DK8A 2HXIA 1RR7A 1WQ2A 3C1DA 4G7OF 3F0CA 4RAGA 3WG9A 3I0TA 1H88C 2W00A 2WA0A 3Q9SA 2GOXB 5DUKA 1ITYA 3JSPA 1O3RA 1YI2I 4DIQA 4M6YA 1BI0A 5LGUA 2DA7A 1ZG1A 4BY1J 1JUPA 2WAFA 1UJ8A 3JREA 4HA8A 3E0JB 1FBSA 3PUFA 1SVOA 1IN5A 1HXDA 2DODA 3H36A 3W2WA 4ETSA 2EJRA 4XBFA 2FQ4A 4M3DA 5ILUA 2TCTA 3HC7A 4NHJA 3F23A 1Z3YA 1D5VA 4ZYDA 2OCEA 2PMZA 3K7AJ 4GO1A 3OYHA 1WCMJ 1I3AA 3KLNA 1CGPA 5D4RA 2ZXWH 3OYFA 3HG9A 1LE8A 2CUJA 2Z33A 2IRFG 1MBFA 3Q0WA 1IJWC 2NS0A 3U1KA 1IV8A 2Y9YA 4RBOA 1VI0A 3BQZA 4WF2A 4XONA 3WHCA 4B4CA 3HDDA 3L2WA 1QPIA 4UUSA 1HW2A 3PSFA 1T0FA 3K70C 1REPC 1TT5B 1FTTA 1HQCA 2CYYA 4IJAA 3BR2A 1LDKB 4DJAA 2IXSA 4ESBA 4BJTA 2DQRA 2EK5A 3CMYA 1W5SA 4XKWA 4ZYHA 3E7LA 4FT8A 3CQZJ 2DFIA 2VKEA 3R0JA 4XIDA 2VXDA 4HRIA 1WVRA 1XGMA
chains in the Genus database with same CATH topology
3SZPA 2EFNA 4DNCA 3G3ZA 2A3SA 5ICEA 4O6JA 3JW4A 2VC1A 4UHTA 1QPMA 2W25A 3HSEA 1JHHA 5J8FA 1FYKA 4HLYA 2PBIA 2DLLA 3WTXC 4RGXA 1KQ9A 1SFXA 4S04A 2F5CA 2GZWA 3V7RA 3SHFA 3F3XA 3KLOA 4RAZA 5JFRA 5F64A 3CO6C 2EV6A 2HQRA 3WTSC 3EYYA 5E17F 1MJAA 4GGGA 1TW3A 3HHGA 3GVAA 1HKSA 4GXOA 3F22A 2VODA 5BPDA 2FNAA 2P6SA 3MEXA 1B6AA 5CVVA 3ISPA 1P4AA 2K4BA 1X3UA 1L3LA 5D5VB 2J5PA 2JZYA 3JSOA 3PFIA 4KA4A 4CICA 3S2WA 2ZXJA 1HBXG 1FBUA 2IA2A 4KIFA 1PDNC 3J80K 1ZYRF 2O6GE 1ONVA 2Z5UA 3I64A 4WXHA 5E1WA 4EM2A 3M1EA 4RGSA 3M9AA 2XIGA 4KFCA 4U88A 1U5TB 4QLCU 2P4WA 3FM3A 4XSZF 4UUVA 2EV5A 1R1UA 3W6KB 5LRSA 4A6DA 4D0PA 4XRFA 3MZYA 3QRFF 1E2XA 3BY6A 4L5JA 1UB9A 3O2PE 3FMQA 3C3WA 2RC4A 1EH6A 2OU2A 1QBJA 3FF5A 3I5UA 1IN7A 2C6YA 2RKHA 2O61A 1R23A 1LQ1A 1I1GA 1MZBA 1ZLKA 2G7UA 4PGGA 2XKPA 1B9MA 2RV8A 2W57A 1YTYA 4Q4ZF 1Z6RA 2EFQA 4HF1A 1BC8C 4OIQF 2D45A 3HIFA 1G4DA 5AIQA 2OBPA 4HOBA 1T2KA 1IXCA 2FMYA 3E5UA 5A2QK 1P92A 3QP6A 4PCQA 3WU0A 1YW8A 3H92A 2PI0A 1K78A 2BYVE 3HRUA 1TQPA 3RKWA 2DW4A 2DI3A 2VOOA 2YX4A 2F5DA 2Z3YA 4U0VA 1FBQA 4U7DA 2WV0A 3TGNA 3K1MA 3GXOA 1FYLA 4L18B 1C0WA 2V79A 2KJBA 4G9YA 3WTVC 4LLLA 1Y0UA 2MBFA 3Q9VA 3IHUA 2XAJA 4JK1X 4EJUA 4ON0A 5DV5A 4ENKA 2M5WA 4A0XA 3ZMUA 1P2FA 1LDJA 2VT2A 2PN6A 4YFNF 3BZ6A 1Z1DA 3TOBA 2H27A 3LQRA 2E7XA 1T39A 1R1VA 3BJ6A 5HS8A 5JVTA 4XSXF 2P5LC 5CLSA 4ZZDA 4EV0A 4BNCA 1YIOA 1ZH5A 4EGZA 2VONA 2O3FA 2R7FA 1XGSA 4LK1F 2QLZA 3CTAA 5J6XA 2OQRA 2W24A 1XDSA 2ETHA 2WWYA 2XUBA 4LB5A 5HS7A 1KU7A 4BHCA 5H20A 1BIBA 1BJAA 2CSOA 3QAHA 2VBZA 2XVCA 2L01A 4O3MA 5A2QZ 2LKPA 5KVRA 2F5FA 5CVRA 3IKVA 3ZMZA 3F8BA 5L3EA 5E8GA 1GHCA 4P9FA 5D6EA 2ZBKA 1ZREA 2ZFWA 4EM0B 1USSA 4OIRF 2STWA 3R61A 5LHHA 1XCVA 5HVQC 4KMUX 2MLGA 5HDNA 2DPUA 2NNNA 3LA3A 5CVUA 4M6XA 5E1XA 1FOKA 3D5LA 3J81Z 2YU3A 3I54A 2CFXA 2DBBA 3DPTA 3I53A 3KP4A 1WWXA 3FMSA 4PGHA 1R00A 5HLHA 3HTSB 3FHZA 1OYWA 4PDKA 1IAWA 1IF1A 1F5TA 1MKMA 1FYMA 2XHKA 2F5EA 3KCCA 4Q5SF 3VEPA 2HDCA 2XRNA 1Q1HA 4ESJA 3KP3A 3KEQA 3RDIA 5LEKA 6PAXA 2AS5F 4H0EA 1KYZA 2YR2A 4G8XA 4ENMA 1OMIA 4HQMA 2IW5A 4L9VA 3F8FA 2HKOA 3ZN1A 3KP5A 4BHPA 5LGNA 2V9VA 4IRGA 2JPCA 1O3SA 4IRIA 2PMHA 1Z91A 5DEQA 4M9SA 4IF4A 2HFHA 3IKTA 5L3BA 1F1ZA 1FZPB 3CUQB 1KQ0A 2P5VA 5EEGA 4BXUA 3HTUA 1ON2A 1KU3A 2L4MA 1WKMA 5FGMA 5DD4A 2MH9A 4CZZA 4WK8F 1J5YA 3COAC 3BOQA 1ZGAA 1QNTA 3ERED 1J0RA 3SZTA 2CQKA 2OZ6A 1JE8A 2ZCWA 2KIFA 4GYIA 2ZKZA 2L4AA 1EH8A 1FX7A 2O8XA 1O57A 3ABTA 5HOOA 1FSHA 3M8FA 1XD7A 1H9GA 2HR3A 2EFWA 3BJAA 1ZLJA 4BH9A 3KP6A 3RTRA 2OAZA 1KU9A 4HQEA 4AD9A 2NAZA 2STTA 2O03A 1FSEA 1ZRCA 3L2CA 1J75A 1XSDA 2W84A 2ZMEB 1CF7A 4B8XA 1R22A 2FNPA 2JRTA 3P9IA 4RS8A 5D6FA 4ZH4F 2QZ8A 3H3UA 3WU1B 1TQMA 4OOIA 5FD6A 2P7VB 2GA2A 1R7JA 4KN7X 1IRFA 3CJNA 4KNYA 4Y13A 4ASNA 3P9KA 5CVIA 3RKYA 4I98B 2LNBA 1F4KA 5H6RA 2FBHA 1QZZA 3ULQB 4HX7A 2HTSA 1EV7A 1V4RA 1P4XA 5ILSA 4IHSA 3TO7A 1BC7C 3E5XA 3HOSA 4A5NA 5AIPA 3HUGA 2CG4A 5DD8A 1OYYA 1I27A 2FU4A 3DQVC 4HBLA 4ENNA 4P55A 3GZ6A 2EA2A 1UHWA 1DDNA 2VT3A 4YIFA 2D1VA 1K79A 2EA4A 3NRVA 5FLXZ 2VOPA 3WE2A 2H6CA 3E6CC 2FRHA 1IN8A 4CO8A 3U9GA 1O3TA 2ZO4A 4LB6B 2IA0A 2CGPA 3W6JB 3ZQ7A 3LQQA 4HV6A 3MAJA 3GX4X 4OIPF 3C7JA 1G6NA 4EJTA 3KETA 1S7AA 1LDDA 4HV5A 2EV0A 3F72A 2G9WA 2BEOA 2TDXA 3GZ5A 3MCZA 3R60A 1QQIA 2X0LA 4N9HA 4L0YB 2MH2A 2VC0A 3WTZA 5ILVA 1HSJA 1O7FA 2IPQX 1LJ9A 1HW1A 3D0SA 1RZ4A 4LLGF 4EGYA 3F6VA 3CDHA 2A6EF 3FXUA 1TNSA 4M72A 1WSUA 1O7LA 5FB2A 1MD0A 4MQVA 2JSCA 1P4WA 3QOPA 3U2RA 2CO5A 1LEAA 4CGZA 3RYRA 4BAYA 2FSWA 4UV8A 1S7OA 2WTEA 4JBAA 2DU9A 1ZAOA 2V1XA 4NB5A 2OA4A 4OMYA 2PG4A 3ZMTA 1TLHB 2DAOA 4OU0A 1R36A 4BHBA 2XKOA 5BPIA 1WI9A 3GO5A 1B1BA 3ZPLA 1WRJA 1JHFA 2NYXA 3WTWC 2VE8A 4KYWA 2ESHA 1U5TC 1Z9CA 2ELHA 2UXNA 3IRRA 4KT5C 1MJBA 2B0LA 1BIAA 1XCBA 1ULYA 2XGXA 5HLIA 3FX3A 5DCFA 4AIHA 2E7WA 1YFHA 3KZZA 3F8MA 5LEJA 3U1DA 4HF0A 1D8KA 3ZMDA 1VTNC 1HW5A 4UXNA 1D3YA 3Q5FA 3NEUA 3JAMK 1BI3A 1HKQA 4UVBA 1ZG5A 3HSRA 4RB3C 2VBWA 5TRDA 3K69A 1OYIA 2LSOA 2IA1A 3J81K 3GFMA 1ZHFA 2UZKA 4L5IA 1ZGJA 4RB0A 2LF8A 3IRQA 3F8NA 2QBYB 3IC7A 4A2UA 3RPQA 4YFKF 4YIIA 1J2XA 1R5HA 4KICA 1B4AA 1I6XA 1KQ8A 4M9ZA 5LBQA 5FD5A 4L9NA 5FFZA 3WTUC 3E97A 5F6FA 1LVAA 4RGRA 5FLXK 5BOXA 1SMYF 2L54A 4MNUA 1I1SA 1P6RA 2FBIA 4GCVA 1DP7P 3K9TA 1O3QA 1SFUA 1E17A 3SFZA 1BM9A 2NRAC 4WXCA 3E5QA 4P5OA 2ESNA 1TQIA 3DKWA 3ECOA 1K7AA 3EYIA 2GXGA 2ZNYA 1RNLA 1OR7A 4A5MA 1H0MA 1U5TA 3K1PA 3WODF 2IT0A 1U8RA 5D8LB 1A04A 2P6TA 3LA2A 4CHUA 4I09A 2GQQA 2M8EA 4HX4A 1K6OA 1XSVA 2J5OA 1G3YA 4OMZA 1U2WA 2HZTA 3V4GA 2FOKA 3IWZA 2HYGD 4Y17A 1FT9A 5L3GA 2Y75A 4U7BA 1U3EM 2H09A 1CF7B 4HYEA 2ZMEA 3EDPA 1U78A 1I5ZA 5L3FA 2EFPA 3GW2A 3L00A 2H94A 5ERIA 2DTRA 3O6BB 1T98A 2K02A 1SD5A 3KP7A 2XAHA 3V8KA 3EUHA 5DDGA 4I0AA 2FBKA 5TJJA 5BMZA 2EFOA 4R8HA 3T1BA 2P8TA 3TO9A 4A0YA 3P9CA 1SD6A 5FO5A 4ENJA 1S29A 5L3CA 3QU6A 2KJCA 4IXAA 3WTYC 4L0ZB 1JGSA 2A5YB 2RN7A 3CUOA 4LFUA 5ICCA 3ZN0A 4MGRA 5LHGA 2FQ3A 3N97A 3EQLF 2VXZA 3B02A 4HDVA 1USTA 3AAFA 1YS6A 2DO7A 4UVAA 2BGCA 3BP8A 1MGTA 2A61A 2XV4S 5DCMA 2DQLA 1YO5C 1R5GA 1SFEA 4FX0A 5CVJA 2EB7A 2V6CA 2IP2A 4Q48A 2CWEA 4L9JA 2OQGA 2JPBA 1TNTA 1L0OC 3BPXA 2ZJ2A 3MZHA 2HWVA 4AVPA 1FLIA 3VB2A 1FWZA 5BQTA 3HOTA 3QPTA 3QPHA 2HKXA 2COMA 2OZUA 2PJPA 1RUOA 1LNWA 3FWEA 3I4PA 3WGGA 4IRHA 4P96A 3T8RA 2YX7A 4FHTA 4R79A 1G3WA 1FPQA 1S8NA 1ODDA 4RB2C 3ELKA 3M8EA 3CUQA 1OKRA 5HDKA 2K27A 1TW2A 5JHUA 2PEXA 4UV9A 3WGHA 3CO7C 1B9NA 3RKXA 3DF8A 2EWNA 3K2ZA 2QENA 1XDUA 2UWMA 3DP7A 5D5UB 3C18A 4A0ZA 1YW9A 2M45A 2P5KA 3GF2A 4HAMA 4RGUA 4I01A 2YSRA 5CYVA 2FXAA 3DFGA 2V1UA 2GXBA 4GYGA 2ISZA 2K7LA 3RI4A 2Q0OA 3F21A 2KRFA 4E70A 2FE3A 2XAQA 4KMFA 5L3DA 3E6DA 5LRRA 4I0BA 3GYHX 2XAFA 5ED4A 5IT9Z 2ADUA 4M73A 5D5XB 2Z9OA 3K0LA 4LLNA 3J80Z 5DYMA 4B09A 4G6DA 3BPVA 4AIJA 3V8JA 5LGTA 4A12A 1MDMA 2WC2A 4HZFA 2FF4A 4HW0A 1FC3A 4LK0F 5HDGA 2A07F 3ZP5A 4LG0B 4M9XA 1IW7F 1FNNA 4EJWA 5AONA 4I02A 2QBYA 1BI2A 1YLFA 1DPRA 2ISYA 3I58A 3TOAA 3KFWX 3L9FA 4HF2A 1XMKA 1AOYA 3CUQC 1BI1A 3R6SA 2RQPA 4MTEA 1G3TA 2QUFA 3R0AA 1T6SA 3JTHA 3I59B 5K1YA 3GUDA 1B59A 4MHGA 2MD5A 1Z7UA 4EJVA 5ICGA 1LB2A 2ACJA 2RDPA 2E1CA 2HOEA 3E6BA 4PZJA 2HQNA 3HRSA 3ZMSA 5LHIA 1R1TA 4EM1A 3DEUA 1STZA 4M74A 3BROA 1KA8A 3OV8A 4N0BA 1U6GA 1OPCA 2QYOA 2PQ8A 1TBXA 4G7HF 1DUXC 1IXRC 3V7CA 3KZYA 1HKTA 5D8KB 3ZMVA 4O5VA 3GFLA 3L7WA 4CYDA 2P7CB 1ZN2A 2A6HF 5EEHA 1XN7A 2QWWA 4EJOA 2D1HA 3M7GA 1K78B 4HDUA 1F9NA 1W5TA 3MFKA 2OD5A 2QM3A 3E6MA 2GAUA 1T38A 3CLOA 4MEYF 2O0YA 5E18F 4G7ZF 1ON1A 4IPAA 4YG2F 4I2OA 2BBYA 2JT1A 4WCGA 3SXYA 3TDZC 5LLQA 3BWGA 4MQ9F 2QQ9A 4S05A 4WX9A 3LFKA 3SQNA 1IXSB 3BDDA 5JI6A 3DXJF 3OOPA 3F6OA 1IN4A 1W4MA 1W7PD 2VBXA 4LJZF 3REOA 4AIKA 2MA3A 2A69F 3KE2A 4KIBA 1XGNA 4DQ2A 3I71A 1ZG3A 5BS6A 2Q8KA 5D4SA 1MDMB 1UCRA 3N4MA 3TQNA 5CJ9A 3V7SA 2KIUA 3TO6A 3GLXA 1R58A 3VFZA 1PP8F 1J7KA 2CW0F 3FM5A 4XLPF 4P9UA 3WTTC 1FP1D 4EMSA 1J9IA 3I59A 4WWCA 3ECHA 4U0YA 2FA5A 4KN4X 4CXFA 1PUEE 4EQQA 1YS7A 2QQBA 5ICFA 5D5WB 3IL2A 2YPRA 3JAMZ 4K2EA 5FFXA 4XLNF 2XASA 2R3SA 1UFMA 2GA1A 4KDPA 1XSXA 4UVCA 4Q47A 5H6QA 3E3VA 4LG0A 1YW7A 2HYFA 1ZRFA 1BN5A 5DUIA 1GXQA 3ML6A 2VBYA 4QWQA 4ZYGA 2W85A 4LMYA 1DPUA 3ABUA 4HX8A 3B73A 3T8TA 3H3ZA 1FY7A 2IVMA 1S6LA 1YG2A 2VE9A 4OINF 1TTYA 4OIOF 3GFIA 4EVIA 2JTVA 3LAJA 2FEZA 4YFXF 2Y0MA 5E1ZB 2VN2A 1QZYA 4U0WA 1Z6TA 4LD5A 1G3SA 3IWFA 2E1NA 1YYVA 5IT3A 2DK5A 3RJPA 2AXLA 3RPUA 3EETA 2XAGA 3JTGA 3O3KA 1GVJA 5E20A 1BOAA 1SD4A 3HRTA 1NHAA 2DPDA 2M30A 1XGOA 4KIGA 4MEXF 2RVCA 1IZ1A 4WXDA 1MJ9A 2KKOA 4ZZLA 1BBYA 1YQAA 3V8LA 2BE5F 2Y48A 2GIVA 5DCMB 4RAYA 2QQAA 4UNOA 4LGWA 1IN6A 4ESFA 1GXPA 1QO0D 3NQOA 4CDGA 2A68F 4I7HA 1Z05A 5KK1A 1IUYA 3RYPA 3KEOA 4A6EA 4TV7A 3L09A 2PFBA 1UHMA 2XROA 1KYWA 2MC3A 2HGCA 2L02A 1V3FA 2QVOA 3LWFA 1SAXA 3QU3A 2GWRA 1AWCA 3MWMA 1XB4A 4L9TA 2G7HA 3FZVA 5J8CA 3K1NA 3TDUC 3ROUA 4IHTA 3VODA 1RIOH 1ZRDA 1QGPA 3QP5A 4Y15A 2HEOA 3PQJA 3KP2A 3LAPA 4G6QA 2PMUA 1EH7A 2Z99A 3P7NA 4ZYEA 4M71A 2RGVA 3LSTA 4BYYA 4G94A 2NNYA 4KUMA 1D8JA 2KIMA 2X4HA 5HLGA 1W7PB 1FP2A 5K5OA 3T0YA 5HS9A 1S3JA 3LA7A 4HLXA 2F2EA 2D2WA 3GWZA 3HSFA 2IJLA 2LF7A 1SMTA 3TKYA 1HSTA 4MTDA 5IT9K 2HTJA 4AWXB 2K4JA 4JQFA 3FMRA 4F7ZA 2ZNZA 3GEZA 5JR3A 2R7DA 2FMLA 2Q2EA 4RB1A 1KGSA 3DV8A 1W7PA 1XMAA 2M1BA 2UXXA 3FXQA 3BJOA 1LEBA 4NQWA 3WE3A 3MQ0A 1KU2A 3WGIA 5E8IA 4R1HA 2BV6A 4BQAA 3J7AO 3GFJA 3R4KA 3T5XA 2MLKA 1SD7A 3DPLC 3PQKA 1RI7A 5K5RA 4FX4A 2DT5A 4Z2YA 2V1DA 5K5QA 1JXSA 3G73A 4IVNA 3FXRA 2K86A 3HRMA 3RIRA 2PLYA 2L3DA 3VOEA 1ZARA 3HHHA 2M87A 1J59A 2LDUA 1RUNA 5F1RA 3F8CA 1H9TA 2H6BA 4N9IA 2RNJA 2HS5A 1PP7U 3HYIA 1IRGA 2DK8A 4G7OF 1WQ2A 3C1DA 3WG9A 3I0TA 3Q9SA 5DUKA 3JSPA 1O3RA 4M6YA 1BI0A 5LGUA 1ZG1A 4HA8A 1FBSA 1IN5A 1HXDA 4ETSA 2EJRA 4XBFA 5ILUA 4NHJA 3F23A 1D5VA 4ZYDA 4GO1A 3KLNA 1CGPA 5D4RA 2IRFG 2Z33A 2NS0A 4WF2A 1HW2A 1T0FA 1REPC 4ESBA 1HQCA 2CYYA 4IJAA 1LDKB 2DQRA 2EK5A 1W5SA 4ZYHA 4FT8A 2DFIA 3R0JA 1XGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZP A;  2EFN A;  4DNC A;  3G3Z A;  2A3S A;  5ICE A;  4O6J A;  3JW4 A;  2VC1 A;  4UHT A;  1QPM A;  2W25 A;  3HSE A;  1JHH A;  5J8F A;  1FYK A;  4HLY A;  2PBI A;  2DLL A;  3WTX C;  4RGX A;  1KQ9 A;  1SFX A;  4S04 A;  2F5C A;  2GZW A;  3V7R A;  3SHF A;  3F3X A;  3KLO A;  4RAZ A;  5JFR A;  5F64 A;  3CO6 C;  2EV6 A;  2HQR A;  3WTS C;  3EYY A;  5E17 F;  1MJA A;  4GGG A;  1TW3 A;  3HHG A;  3GVA A;  1HKS A;  4GXO A;  3F22 A;  2VOD A;  5BPD A;  2FNA A;  2P6S A;  3MEX A;  1B6A A;  5CVV A;  3ISP A;  1P4A A;  2K4B A;  1X3U A;  1L3L A;  5D5V B;  2J5P A;  2JZY A;  3JSO A;  3PFI A;  4KA4 A;  4CIC A;  3S2W A;  2ZXJ A;  1HBX G;  1FBU A;  2IA2 A;  4KIF A;  1PDN C;  3J80 K;  1ZYR F;  2O6G E;  1ONV A;  2Z5U A;  3I64 A;  4WXH A;  5E1W A;  4EM2 A;  3M1E A;  4RGS A;  3M9A A;  2XIG A;  4KFC A;  4U88 A;  1U5T B;  4QLC U;  2P4W A;  3FM3 A;  4XSZ F;  4UUV A;  2EV5 A;  1R1U A;  3W6K B;  5LRS A;  4A6D A;  4D0P A;  4XRF A;  3MZY A;  3QRF F;  1E2X A;  3BY6 A;  4L5J A;  1UB9 A;  3O2P E;  3FMQ A;  3C3W A;  2RC4 A;  1EH6 A;  2OU2 A;  1QBJ A;  3FF5 A;  3I5U A;  1IN7 A;  2C6Y A;  2RKH A;  2O61 A;  1R23 A;  1LQ1 A;  1I1G A;  1MZB A;  1ZLK A;  2G7U A;  4PGG A;  2XKP A;  1B9M A;  2RV8 A;  2W57 A;  1YTY A;  4Q4Z F;  1Z6R A;  2EFQ A;  4HF1 A;  1BC8 C;  4OIQ F;  2D45 A;  3HIF A;  1G4D A;  5AIQ A;  2OBP A;  4HOB A;  1T2K A;  1IXC A;  2FMY A;  3E5U A;  5A2Q K;  1P92 A;  3QP6 A;  4PCQ A;  3WU0 A;  1YW8 A;  3H92 A;  2PI0 A;  1K78 A;  2BYV E;  3HRU A;  1TQP A;  3RKW A;  2DW4 A;  2DI3 A;  2VOO A;  2YX4 A;  2F5D A;  2Z3Y A;  4U0V A;  1FBQ A;  4U7D A;  2WV0 A;  3TGN A;  3K1M A;  3GXO A;  1FYL A;  4L18 B;  1C0W A;  2V79 A;  2KJB A;  4G9Y A;  3WTV C;  4LLL A;  1Y0U A;  2MBF A;  3Q9V A;  3IHU A;  2XAJ A;  4JK1 X;  4EJU A;  4ON0 A;  5DV5 A;  4ENK A;  2M5W A;  4A0X A;  3ZMU A;  1P2F A;  1LDJ A;  2VT2 A;  2PN6 A;  4YFN F;  3BZ6 A;  1Z1D A;  3TOB A;  2H27 A;  3LQR A;  2E7X A;  1T39 A;  1R1V A;  3BJ6 A;  5HS8 A;  5JVT A;  4XSX F;  2P5L C;  5CLS A;  4ZZD A;  4EV0 A;  4BNC A;  1YIO A;  1ZH5 A;  4EGZ A;  2VON A;  2O3F A;  2R7F A;  1XGS A;  4LK1 F;  2QLZ A;  3CTA A;  5J6X A;  2OQR A;  2W24 A;  1XDS A;  2ETH A;  2WWY A;  2XUB A;  4LB5 A;  5HS7 A;  1KU7 A;  4BHC A;  5H20 A;  1BIB A;  1BJA A;  2CSO A;  3QAH A;  2VBZ A;  2XVC A;  2L01 A;  4O3M A;  5A2Q Z;  2LKP A;  5KVR A;  2F5F A;  5CVR A;  3IKV A;  3ZMZ A;  3F8B A;  5L3E A;  5E8G A;  1GHC A;  4P9F A;  5D6E A;  2ZBK A;  1ZRE A;  2ZFW A;  4EM0 B;  1USS A;  4OIR F;  2STW A;  3R61 A;  5LHH A;  1XCV A;  5HVQ C;  4KMU X;  2MLG A;  5HDN A;  2DPU A;  2NNN A;  3LA3 A;  5CVU A;  4M6X A;  5E1X A;  1FOK A;  3D5L A;  3J81 Z;  2YU3 A;  3I54 A;  2CFX A;  2DBB A;  3DPT A;  3I53 A;  3KP4 A;  1WWX A;  3FMS A;  4PGH A;  1R00 A;  5HLH A;  3HTS B;  3FHZ A;  1OYW A;  4PDK A;  1IAW A;  1IF1 A;  1F5T A;  1MKM A;  1FYM A;  2XHK A;  2F5E A;  3KCC A;  4Q5S F;  3VEP A;  2HDC A;  2XRN A;  1Q1H A;  4ESJ A;  3KP3 A;  3KEQ A;  3RDI A;  5LEK A;  6PAX A;  2AS5 F;  4H0E A;  1KYZ A;  2YR2 A;  4G8X A;  4ENM A;  1OMI A;  4HQM A;  2IW5 A;  4L9V A;  3F8F A;  2HKO A;  3ZN1 A;  3KP5 A;  4BHP A;  5LGN A;  2V9V A;  4IRG A;  2JPC A;  1O3S A;  4IRI A;  2PMH A;  1Z91 A;  5DEQ A;  4M9S A;  4IF4 A;  2HFH A;  3IKT A;  5L3B A;  1F1Z A;  1FZP B;  3CUQ B;  1KQ0 A;  2P5V A;  5EEG A;  4BXU A;  3HTU A;  1ON2 A;  1KU3 A;  2L4M A;  1WKM A;  5FGM A;  5DD4 A;  2MH9 A;  4CZZ A;  4WK8 F;  1J5Y A;  3COA C;  3BOQ A;  1ZGA A;  1QNT A;  3ERE D;  1J0R A;  3SZT A;  2CQK A;  2OZ6 A;  1JE8 A;  2ZCW A;  2KIF A;  4GYI A;  2ZKZ A;  2L4A A;  1EH8 A;  1FX7 A;  2O8X A;  1O57 A;  3ABT A;  5HOO A;  1FSH A;  3M8F A;  1XD7 A;  1H9G A;  2HR3 A;  2EFW A;  3BJA A;  1ZLJ A;  4BH9 A;  3KP6 A;  3RTR A;  2OAZ A;  1KU9 A;  4HQE A;  4AD9 A;  2NAZ A;  2STT A;  2O03 A;  1FSE A;  1ZRC A;  3L2C A;  1J75 A;  1XSD A;  2W84 A;  2ZME B;  1CF7 A;  4B8X A;  1R22 A;  2FNP A;  2JRT A;  3P9I A;  4RS8 A;  5D6F A;  4ZH4 F;  2QZ8 A;  3H3U A;  3WU1 B;  1TQM A;  4OOI A;  5FD6 A;  2P7V B;  2GA2 A;  1R7J A;  4KN7 X;  1IRF A;  3CJN A;  4KNY A;  4Y13 A;  4ASN A;  3P9K A;  5CVI A;  3RKY A;  4I98 B;  2LNB A;  1F4K A;  5H6R A;  2FBH A;  1QZZ A;  3ULQ B;  4HX7 A;  2HTS A;  1EV7 A;  1V4R A;  1P4X A;  5ILS A;  4IHS A;  3TO7 A;  1BC7 C;  3E5X A;  3HOS A;  4A5N A;  5AIP A;  3HUG A;  2CG4 A;  5DD8 A;  1OYY A;  1I27 A;  2FU4 A;  3DQV C;  4HBL A;  4ENN A;  4P55 A;  3GZ6 A;  2EA2 A;  1UHW A;  1DDN A;  2VT3 A;  4YIF A;  2D1V A;  1K79 A;  2EA4 A;  3NRV A;  5FLX Z;  2VOP A;  3WE2 A;  2H6C A;  3E6C C;  2FRH A;  1IN8 A;  4CO8 A;  3U9G A;  1O3T A;  2ZO4 A;  4LB6 B;  2IA0 A;  2CGP A;  3W6J B;  3ZQ7 A;  3LQQ A;  4HV6 A;  3MAJ A;  3GX4 X;  4OIP F;  3C7J A;  1G6N A;  4EJT A;  3KET A;  1S7A A;  1LDD A;  4HV5 A;  2EV0 A;  3F72 A;  2G9W A;  2BEO A;  2TDX A;  3GZ5 A;  3MCZ A;  3R60 A;  1QQI A;  2X0L A;  4N9H A;  4L0Y B;  2MH2 A;  2VC0 A;  3WTZ A;  5ILV A;  1HSJ A;  1O7F A;  2IPQ X;  1LJ9 A;  1HW1 A;  3D0S A;  1RZ4 A;  4LLG F;  4EGY A;  3F6V A;  3CDH A;  2A6E F;  3FXU A;  1TNS A;  4M72 A;  1WSU A;  1O7L A;  5FB2 A;  1MD0 A;  4MQV A;  2JSC A;  1P4W A;  3QOP A;  3U2R A;  2CO5 A;  1LEA A;  4CGZ A;  3RYR A;  4BAY A;  2FSW A;  4UV8 A;  1S7O A;  2WTE A;  4JBA A;  2DU9 A;  1ZAO A;  2V1X A;  4NB5 A;  2OA4 A;  4OMY A;  2PG4 A;  3ZMT A;  1TLH B;  2DAO A;  4OU0 A;  1R36 A;  4BHB A;  2XKO A;  5BPI A;  1WI9 A;  3GO5 A;  1B1B A;  3ZPL A;  1WRJ A;  1JHF A;  2NYX A;  3WTW C;  2VE8 A;  4KYW A;  2ESH A;  1U5T C;  1Z9C A;  2ELH A;  2UXN A;  3IRR A;  4KT5 C;  1MJB A;  2B0L A;  1BIA A;  1XCB A;  1ULY A;  2XGX A;  5HLI A;  3FX3 A;  5DCF A;  4AIH A;  2E7W A;  1YFH A;  3KZZ A;  3F8M A;  5LEJ A;  3U1D A;  4HF0 A;  1D8K A;  3ZMD A;  1VTN C;  1HW5 A;  4UXN A;  1D3Y A;  3Q5F A;  3NEU A;  3JAM K;  1BI3 A;  1HKQ A;  4UVB A;  1ZG5 A;  3HSR A;  4RB3 C;  2VBW A;  5TRD A;  3K69 A;  1OYI A;  2LSO A;  2IA1 A;  3J81 K;  3GFM A;  1ZHF A;  2UZK A;  4L5I A;  1ZGJ A;  4RB0 A;  2LF8 A;  3IRQ A;  3F8N A;  2QBY B;  3IC7 A;  4A2U A;  3RPQ A;  4YFK F;  4YII A;  1J2X A;  1R5H A;  4KIC A;  1B4A A;  1I6X A;  1KQ8 A;  4M9Z A;  5LBQ A;  5FD5 A;  4L9N A;  5FFZ A;  3WTU C;  3E97 A;  5F6F A;  1LVA A;  4RGR A;  5FLX K;  5BOX A;  1SMY F;  2L54 A;  4MNU A;  1I1S A;  1P6R A;  2FBI A;  4GCV A;  1DP7 P;  3K9T A;  1O3Q A;  1SFU A;  1E17 A;  3SFZ A;  1BM9 A;  2NRA C;  4WXC A;  3E5Q A;  4P5O A;  2ESN A;  1TQI A;  3DKW A;  3ECO A;  1K7A A;  3EYI A;  2GXG A;  2ZNY A;  1RNL A;  1OR7 A;  4A5M A;  1H0M A;  1U5T A;  3K1P A;  3WOD F;  2IT0 A;  1U8R A;  5D8L B;  1A04 A;  2P6T A;  3LA2 A;  4CHU A;  4I09 A;  2GQQ A;  2M8E A;  4HX4 A;  1K6O A;  1XSV A;  2J5O A;  1G3Y A;  4OMZ A;  1U2W A;  2HZT A;  3V4G A;  2FOK A;  3IWZ A;  2HYG D;  4Y17 A;  1FT9 A;  5L3G A;  2Y75 A;  4U7B A;  1U3E M;  2H09 A;  1CF7 B;  4HYE A;  2ZME A;  3EDP A;  1U78 A;  1I5Z A;  5L3F A;  2EFP A;  3GW2 A;  3L00 A;  2H94 A;  5ERI A;  2DTR A;  3O6B B;  1T98 A;  2K02 A;  1SD5 A;  3KP7 A;  2XAH A;  3V8K A;  3EUH A;  5DDG A;  4I0A A;  2FBK A;  5TJJ A;  5BMZ A;  2EFO A;  4R8H A;  3T1B A;  2P8T A;  3TO9 A;  4A0Y A;  3P9C A;  1SD6 A;  5FO5 A;  4ENJ A;  1S29 A;  5L3C A;  3QU6 A;  2KJC A;  4IXA A;  3WTY C;  4L0Z B;  1JGS A;  2A5Y B;  2RN7 A;  3CUO A;  4LFU A;  5ICC A;  3ZN0 A;  4MGR A;  5LHG A;  2FQ3 A;  3N97 A;  3EQL F;  2VXZ A;  3B02 A;  4HDV A;  1UST A;  3AAF A;  1YS6 A;  2DO7 A;  4UVA A;  2BGC A;  3BP8 A;  1MGT A;  2A61 A;  2XV4 S;  5DCM A;  2DQL A;  1YO5 C;  1R5G A;  1SFE A;  4FX0 A;  5CVJ A;  2EB7 A;  2V6C A;  2IP2 A;  4Q48 A;  2CWE A;  4L9J A;  2OQG A;  2JPB A;  1TNT A;  1L0O C;  3BPX A;  2ZJ2 A;  3MZH A;  2HWV A;  4AVP A;  1FLI A;  3VB2 A;  1FWZ A;  5BQT A;  3HOT A;  3QPT A;  3QPH A;  2HKX A;  2COM A;  2OZU A;  2PJP A;  1RUO A;  1LNW A;  3FWE A;  3I4P A;  3WGG A;  4IRH A;  4P96 A;  3T8R A;  2YX7 A;  4FHT A;  4R79 A;  1G3W A;  1FPQ A;  1S8N A;  1ODD A;  4RB2 C;  3ELK A;  3M8E A;  3CUQ A;  1OKR A;  5HDK A;  2K27 A;  1TW2 A;  5JHU A;  2PEX A;  4UV9 A;  3WGH A;  3CO7 C;  1B9N A;  3RKX A;  3DF8 A;  2EWN A;  3K2Z A;  2QEN A;  1XDU A;  2UWM A;  3DP7 A;  5D5U B;  3C18 A;  4A0Z A;  1YW9 A;  2M45 A;  2P5K A;  3GF2 A;  4HAM A;  4RGU A;  4I01 A;  2YSR A;  5CYV A;  2FXA A;  3DFG A;  2V1U A;  2GXB A;  4GYG A;  2ISZ A;  2K7L A;  3RI4 A;  2Q0O A;  3F21 A;  2KRF A;  4E70 A;  2FE3 A;  2XAQ A;  4KMF A;  5L3D A;  3E6D A;  5LRR A;  4I0B A;  3GYH X;  2XAF A;  5ED4 A;  5IT9 Z;  2ADU A;  4M73 A;  5D5X B;  2Z9O A;  3K0L A;  4LLN A;  3J80 Z;  5DYM A;  4B09 A;  4G6D A;  3BPV A;  4AIJ A;  3V8J A;  5LGT A;  4A12 A;  1MDM A;  2WC2 A;  4HZF A;  2FF4 A;  4HW0 A;  1FC3 A;  4LK0 F;  5HDG A;  2A07 F;  3ZP5 A;  4LG0 B;  4M9X A;  1IW7 F;  1FNN A;  4EJW A;  5AON A;  4I02 A;  2QBY A;  1BI2 A;  1YLF A;  1DPR A;  2ISY A;  3I58 A;  3TOA A;  3KFW X;  3L9F A;  4HF2 A;  1XMK A;  1AOY A;  3CUQ C;  1BI1 A;  3R6S A;  2RQP A;  4MTE A;  1G3T A;  2QUF A;  3R0A A;  1T6S A;  3JTH A;  3I59 B;  5K1Y A;  3GUD A;  1B59 A;  4MHG A;  2MD5 A;  1Z7U A;  4EJV A;  5ICG A;  1LB2 A;  2ACJ A;  2RDP A;  2E1C A;  2HOE A;  3E6B A;  4PZJ A;  2HQN A;  3HRS A;  3ZMS A;  5LHI A;  1R1T A;  4EM1 A;  3DEU A;  1STZ A;  4M74 A;  3BRO A;  1KA8 A;  3OV8 A;  4N0B A;  1U6G A;  1OPC A;  2QYO A;  2PQ8 A;  1TBX A;  4G7H F;  1DUX C;  1IXR C;  3V7C A;  3KZY A;  1HKT A;  5D8K B;  3ZMV A;  4O5V A;  3GFL A;  3L7W A;  4CYD A;  2P7C B;  1ZN2 A;  2A6H F;  5EEH A;  1XN7 A;  2QWW A;  4EJO A;  2D1H A;  3M7G A;  1K78 B;  4HDU A;  1F9N A;  1W5T A;  3MFK A;  2OD5 A;  2QM3 A;  3E6M A;  2GAU A;  1T38 A;  3CLO A;  4MEY F;  2O0Y A;  5E18 F;  4G7Z F;  1ON1 A;  4IPA A;  4YG2 F;  4I2O A;  2BBY A;  2JT1 A;  4WCG A;  3SXY A;  3TDZ C;  5LLQ A;  3BWG A;  4MQ9 F;  2QQ9 A;  4S05 A;  4WX9 A;  3LFK A;  3SQN A;  1IXS B;  3BDD A;  5JI6 A;  3DXJ F;  3OOP A;  3F6O A;  1IN4 A;  1W4M A;  1W7P D;  2VBX A;  4LJZ F;  3REO A;  4AIK A;  2MA3 A;  2A69 F;  3KE2 A;  4KIB A;  1XGN A;  4DQ2 A;  3I71 A;  1ZG3 A;  5BS6 A;  2Q8K A;  5D4S A;  1MDM B;  1UCR A;  3N4M A;  3TQN A;  5CJ9 A;  3V7S A;  2KIU A;  3TO6 A;  3GLX A;  1R58 A;  3VFZ A;  1PP8 F;  1J7K A;  2CW0 F;  3FM5 A;  4XLP F;  4P9U A;  3WTT C;  1FP1 D;  4EMS A;  1J9I A;  3I59 A;  4WWC A;  3ECH A;  4U0Y A;  2FA5 A;  4KN4 X;  4CXF A;  1PUE E;  4EQQ A;  1YS7 A;  2QQB A;  5ICF A;  5D5W B;  3IL2 A;  2YPR A;  3JAM Z;  4K2E A;  5FFX A;  4XLN F;  2XAS A;  2R3S A;  1UFM A;  2GA1 A;  4KDP A;  1XSX A;  4UVC A;  4Q47 A;  5H6Q A;  3E3V A;  4LG0 A;  1YW7 A;  2HYF A;  1ZRF A;  1BN5 A;  5DUI A;  1GXQ A;  3ML6 A;  2VBY A;  4QWQ A;  4ZYG A;  2W85 A;  4LMY A;  1DPU A;  3ABU A;  4HX8 A;  3B73 A;  3T8T A;  3H3Z A;  1FY7 A;  2IVM A;  1S6L A;  1YG2 A;  2VE9 A;  4OIN F;  1TTY A;  4OIO F;  3GFI A;  4EVI A;  2JTV A;  3LAJ A;  2FEZ A;  4YFX F;  2Y0M A;  5E1Z B;  2VN2 A;  1QZY A;  4U0W A;  1Z6T A;  4LD5 A;  1G3S A;  3IWF A;  2E1N A;  1YYV A;  5IT3 A;  2DK5 A;  3RJP A;  2AXL A;  3RPU A;  3EET A;  2XAG A;  3JTG A;  3O3K A;  1GVJ A;  5E20 A;  1BOA A;  1SD4 A;  3HRT A;  1NHA A;  2DPD A;  2M30 A;  1XGO A;  4KIG A;  4MEX F;  2RVC A;  1IZ1 A;  4WXD A;  1MJ9 A;  2KKO A;  4ZZL A;  1BBY A;  1YQA A;  3V8L A;  2BE5 F;  2Y48 A;  2GIV A;  5DCM B;  4RAY A;  2QQA A;  4UNO A;  4LGW A;  1IN6 A;  4ESF A;  1GXP A;  1QO0 D;  3NQO A;  4CDG A;  2A68 F;  4I7H A;  1Z05 A;  5KK1 A;  1IUY A;  3RYP A;  3KEO A;  4A6E A;  4TV7 A;  3L09 A;  2PFB A;  1UHM A;  2XRO A;  1KYW A;  2MC3 A;  2HGC A;  2L02 A;  1V3F A;  2QVO A;  3LWF A;  1SAX A;  3QU3 A;  2GWR A;  1AWC A;  3MWM A;  1XB4 A;  4L9T A;  2G7H A;  3FZV A;  5J8C A;  3K1N A;  3TDU C;  3ROU A;  4IHT A;  3VOD A;  1RIO H;  1ZRD A;  1QGP A;  3QP5 A;  4Y15 A;  2HEO A;  3PQJ A;  3KP2 A;  3LAP A;  4G6Q A;  2PMU A;  1EH7 A;  2Z99 A;  3P7N A;  4ZYE A;  4M71 A;  2RGV A;  3LST A;  4BYY A;  4G94 A;  2NNY A;  4KUM A;  1D8J A;  2KIM A;  2X4H A;  5HLG A;  1W7P B;  1FP2 A;  5K5O A;  3T0Y A;  5HS9 A;  1S3J A;  3LA7 A;  4HLX A;  2F2E A;  2D2W A;  3GWZ A;  3HSF A;  2IJL A;  2LF7 A;  1SMT A;  3TKY A;  1HST A;  4MTD A;  5IT9 K;  2HTJ A;  4AWX B;  2K4J A;  4JQF A;  3FMR A;  4F7Z A;  2ZNZ A;  3GEZ A;  5JR3 A;  2R7D A;  2FML A;  2Q2E A;  4RB1 A;  1KGS A;  3DV8 A;  1W7P A;  1XMA A;  2M1B A;  2UXX A;  3FXQ A;  3BJO A;  1LEB A;  4NQW A;  3WE3 A;  3MQ0 A;  1KU2 A;  3WGI A;  5E8I A;  4R1H A;  2BV6 A;  4BQA A;  3J7A O;  3GFJ A;  3R4K A;  3T5X A;  2MLK A;  1SD7 A;  3DPL C;  3PQK A;  1RI7 A;  5K5R A;  4FX4 A;  2DT5 A;  4Z2Y A;  2V1D A;  5K5Q A;  1JXS A;  3G73 A;  4IVN A;  3FXR A;  2K86 A;  3HRM A;  3RIR A;  2PLY A;  2L3D A;  3VOE A;  1ZAR A;  3HHH A;  2M87 A;  1J59 A;  2LDU A;  1RUN A;  5F1R A;  3F8C A;  1H9T A;  2H6B A;  4N9I A;  2RNJ A;  2HS5 A;  1PP7 U;  3HYI A;  1IRG A;  2DK8 A;  4G7O F;  1WQ2 A;  3C1D A;  3WG9 A;  3I0T A;  3Q9S A;  5DUK A;  3JSP A;  1O3R A;  4M6Y A;  1BI0 A;  5LGU A;  1ZG1 A;  4HA8 A;  1FBS A;  1IN5 A;  1HXD A;  4ETS A;  2EJR A;  4XBF A;  5ILU A;  4NHJ A;  3F23 A;  1D5V A;  4ZYD A;  4GO1 A;  3KLN A;  1CGP A;  5D4R A;  2IRF G;  2Z33 A;  2NS0 A;  4WF2 A;  1HW2 A;  1T0F A;  1REP C;  4ESB A;  1HQC A;  2CYY A;  4IJA A;  1LDK B;  2DQR A;  2EK5 A;  1W5S A;  4ZYH A;  4FT8 A;  2DFI A;  3R0J A;  1XGM A; 
#chains in the Genus database with same CATH topology
 1AHD P;  2QEX I;  1QRY A;  3PFY A;  3G71 I;  2KT0 A;  3SZP A;  2EFN A;  4BQN A;  2NVX J;  4DNC A;  1H8A C;  1A31 A;  3G3Z A;  1U9O A;  2A3S A;  5ICE A;  5J3L A;  3ZQF A;  2MGQ A;  2IS2 A;  3OYB A;  4O6J A;  3JW4 A;  2VC1 A;  3S14 J;  4UHT A;  1QPM A;  5FKL A;  4CUG A;  3G1M A;  2RQQ A;  1JI8 A;  2W25 A;  2R5Z B;  2K3P A;  3SYT A;  5IY5 H;  1IDY A;  1BR4 A;  3HSE A;  1JHH A;  5J8F A;  1FYK A;  4HLY A;  1D0Y A;  2PBI A;  2DLL A;  3WTX C;  4RGX A;  1KQ9 A;  1SFX A;  5J40 A;  2OC6 A;  1XPX A;  2JA6 J;  4S04 A;  2MYS A;  2LVS A;  1X3Z B;  2F5C A;  4BUP A;  2GZW A;  3BC8 A;  3V7R A;  3SHF A;  3F3X A;  1EKE A;  3KLO A;  1LFP A;  3ZR8 X;  4RAZ A;  2RAE A;  2X6O A;  5JFR A;  5F64 A;  3CO6 C;  2EV6 A;  1OCZ H;  2HQR A;  3WTS C;  1JGG A;  3EYY A;  3HUG B;  5E17 F;  1MJA A;  4GGG A;  1TW3 A;  3QOD A;  2NVT J;  3HHG A;  3GVA A;  1TT0 A;  1HKS A;  4GXO A;  2KFD A;  3F22 A;  2VOD A;  3MKZ A;  2LOO A;  5BPD A;  2ECB A;  3K4K A;  1Y1V J;  1HDD C;  2FNA A;  2P6S A;  2LK2 A;  3MEX A;  1B6A A;  5C4J J;  5CVV A;  3ISP A;  1P4A A;  2K4B A;  1X3U A;  5JLX A;  1L3L A;  1D1C A;  3GTG J;  5D5V B;  1JKO C;  3OYD A;  2J5P A;  2JZY A;  3S1Q J;  1GUU A;  3JSO A;  2VL8 A;  3CME I;  3PFI A;  4KA4 A;  2QKM B;  2FJ1 A;  1SVL A;  4CIC A;  3S2W A;  1GVD A;  2ZXJ A;  2KL4 A;  1HBX G;  4E7S A;  1FBU A;  3AG1 H;  2IA2 A;  4KIF A;  1PDN C;  2M7B A;  2Q1Z B;  2O5R A;  3J80 K;  4ZDO A;  1ZYR F;  1W5C C;  2O6G E;  4XLF A;  2HOS A;  1ONV A;  2DOA A;  2Z5U A;  3I64 A;  3S1M J;  3C2G A;  3S1R J;  2NOG A;  3ABM H;  4WXH A;  4CCN A;  3OYL A;  5E1W A;  3J7Z I;  4EM2 A;  1D1A A;  3DLL F;  3M1E A;  4RGS A;  5EEA A;  3M9A A;  2GBY A;  2BXY A;  2IGO A;  3UNG C;  5M5Y J;  2JMW A;  2XIG A;  4KFC A;  4U88 A;  4A93 J;  4IQ4 A;  1U5T B;  1UHS A;  4QLC U;  2P4W A;  3FM3 A;  4XSZ F;  5FKK A;  4UUV A;  1R9T J;  2EV5 A;  3JRI A;  1R1U A;  1DGR M;  2VJ4 A;  3W6K B;  5LRS A;  3CCQ I;  4A6D A;  4D0P A;  1KON A;  3IP4 B;  4XRF A;  4ZC3 A;  4A3K J;  3MZY A;  3DTI A;  3QRF F;  5J1U A;  1U9N A;  1E2X A;  3BY6 A;  3S93 A;  4L5J A;  3L2V A;  1VQ6 I;  1UB9 A;  3O2P E;  4NC7 A;  3HOW J;  3FMQ A;  1FMW A;  4L5E A;  3OS1 A;  2L7K A;  3C3W A;  2F4O B;  2XB5 A;  2RC4 A;  1BR2 A;  1EH6 A;  2NS8 A;  2OU2 A;  2NVU B;  1X19 A;  3OYG A;  2VQH A;  3FF5 A;  1QBJ A;  4BEH B;  3DU5 A;  1HF0 A;  3I5U A;  1QVT A;  5B3S H;  1IN7 A;  3TP0 A;  2C6Y A;  2RKH A;  1FJL A;  2O61 A;  3ZQL A;  1R23 A;  2IBD A;  5GAE J;  4HNU A;  1LQ1 A;  2X6Y A;  3GTL J;  1BW6 A;  1I1G A;  3RQI A;  4A3I J;  1MZB A;  1ZLK A;  2G7U A;  1MH4 A;  3EUK L;  2XKP A;  4PGG A;  4B3X A;  5F0F A;  1B9M A;  2RV8 A;  4BDZ A;  3K70 D;  2W57 A;  2ICW G;  1YTY A;  4Q4Z F;  1Z6R A;  2EFQ A;  2HPI A;  1BW5 A;  1VZ0 A;  4HF1 A;  1BC8 C;  5JVG F;  4OIQ F;  2D45 A;  3HIF A;  1V5E A;  4QPQ A;  3W2A A;  2H8W A;  2XC7 A;  1G4D A;  5AIQ A;  4FET A;  3BT9 A;  1LFB A;  4J01 A;  2V1N A;  2OBP A;  2ZFU A;  3SDG A;  4HOB A;  1T2K A;  1IXC A;  2FMY A;  3E5U A;  4XKC A;  5A2Q K;  1P92 A;  1ORK A;  2QCO A;  1AA7 A;  2EIK H;  4F52 A;  3QP6 A;  4PCQ A;  5CQE A;  3WU0 A;  4BQQ A;  1YW8 A;  3H92 A;  2PI0 A;  4RLF A;  5FKN A;  4IQJ A;  4J19 A;  1ETQ A;  1K78 A;  4KIT B;  1X1C A;  2BYV E;  1IRX A;  3M8J A;  2HDW A;  2KIQ A;  3HRU A;  1TQP A;  3RKW A;  1Q1V A;  2DW4 A;  2LY2 A;  2DI3 A;  2QGU A;  2VOO A;  2YX4 A;  3H9G A;  1VF9 A;  2OPT A;  2L2O A;  2F5D A;  2Z3Y A;  4U0V A;  1FBQ A;  1JKP C;  2L9N A;  4U7D A;  2WV0 A;  3TGN A;  3K1M A;  3GXO A;  1FYL A;  3VDX A;  1WJC A;  5KCM A;  4XRM A;  4L18 B;  1C0W A;  2V79 A;  2KJB A;  4LOC A;  1R71 A;  3RSN A;  4G9Y A;  3VSL A;  3A01 A;  2DDB A;  3WTV C;  3M3Y J;  4LLL A;  3LSI A;  1Y0U A;  2MBF A;  3Q9V A;  3IHU A;  2M4K A;  2XAJ A;  4JK1 X;  4EJU A;  3HEF A;  3SEQ A;  4ON0 A;  1UG2 A;  4M3B A;  5DV5 A;  3PJR A;  3AFH A;  4ENK A;  2M5W A;  4A0X A;  3ZMU A;  1P2F A;  4HEA 2;  1ETY A;  4FAS D;  1ETW A;  1LDJ A;  2CUE A;  4KJZ A;  2VT2 A;  5CQG A;  2W82 A;  3B6C A;  2PN6 A;  3F9K A;  4YFN F;  2DDA A;  3BZ6 A;  1Z1D A;  1UMQ A;  3TOB A;  3LQR A;  2E7X A;  2DA2 A;  1ZEL A;  1T39 A;  2H27 A;  4AUX A;  1R1V A;  3BJ6 A;  5HS8 A;  5JVT A;  4XSX F;  1X58 A;  4E7Z A;  2P5L C;  5CLS A;  3RPU D;  5EJC A;  4ZZD A;  4EV0 A;  4BNC A;  4C2T A;  1YIO A;  2I5U A;  1ZH5 A;  3H9Q A;  4EGZ A;  2VON A;  2O3F A;  5CKT A;  2R7F A;  1XGS A;  3QQA A;  2JJ7 A;  2BHZ A;  2CQN A;  2F5V A;  2EZH A;  2N8G A;  1IC8 A;  3S1N J;  1Z21 A;  4D9J A;  4LK1 F;  2QLZ A;  3CTA A;  5J6X A;  1RC9 A;  2OQR A;  2W24 A;  1XDS A;  3K6G A;  2ETH A;  2WWY A;  4H4K C;  2XUB A;  4IHV A;  4LB5 A;  2LY9 A;  5HS7 A;  2M0M A;  1KU7 A;  2CFO A;  4BHC A;  5H20 A;  1BIB A;  1BJA A;  5B1A H;  2CSO A;  3QAH A;  4I76 A;  2VBZ A;  4BXF A;  2XVC A;  3DPU A;  4PFP A;  1MNM C;  3I4M J;  2L01 A;  2PJR B;  4O3M A;  3K4M A;  3JRG A;  5A2Q Z;  2LKP A;  5KVR A;  3TW7 A;  3HGY A;  2F5F A;  3BTI A;  4DYC A;  3OYM A;  2DMP A;  2Y2Z A;  5CVR A;  3IKV A;  3ZMZ A;  2DOF A;  3F8B A;  5L3E A;  5E8G A;  3O8H A;  2KHM A;  1GHC A;  4P9F A;  5D6E A;  2ZBK A;  3UR3 C;  1ZRE A;  2ZFW A;  2WAD A;  4EM0 B;  1USS A;  4OIR F;  3KYC B;  5E79 C;  2STW A;  3R61 A;  5LHH A;  2JN6 A;  3SFI A;  1XCV A;  5HVQ C;  4KMU X;  3IH3 A;  3QYF A;  4LIU A;  3LSR A;  4A69 C;  2MLG A;  5HDN A;  3CP2 A;  2DPU A;  2EIN H;  4CSW A;  2NNN A;  3LA3 A;  5CVU A;  3LSP A;  4M6X A;  5E1X A;  1FOK A;  2LMD A;  3D5L A;  3J81 Z;  2A6T A;  2YU3 A;  2LH9 A;  3I54 A;  2R92 J;  3HL2 A;  2E2I J;  2CFX A;  3DEE A;  3RQ4 A;  2OTJ I;  3QWL A;  2DBB A;  3DPT A;  3I53 A;  2M8G X;  3KP4 A;  3BG3 A;  1WWX A;  2KQR A;  3CC2 I;  3FMS A;  4PGH A;  1R00 A;  2JVG A;  5HLH A;  2E1M C;  2OCC H;  2QA4 I;  3HTS B;  3WG7 H;  2DOE A;  1G59 A;  5EG0 A;  3FHZ A;  1OYW A;  5DS9 A;  1PVE A;  4HSR A;  4PDK A;  1IAW A;  1IF1 A;  1F5T A;  1UG0 A;  3HBL A;  1MKM A;  3D5R C;  1FYM A;  3GTP J;  1TC3 C;  2XHK A;  5M3F J;  2F5E A;  3KCC A;  4Q5S F;  5E3O A;  3VEP A;  1WHU A;  2HDC A;  1R4N B;  2XRN A;  1Q1H A;  4ESJ A;  5C4X J;  3KP3 A;  3LNQ A;  3KEQ A;  3RDI A;  5LEK A;  3OS0 A;  6PAX A;  1ETO A;  5KNL A;  2AS5 F;  4U87 A;  2OJE D;  4IHX A;  4F91 B;  4H0E A;  4LG3 A;  1KYZ A;  2XSJ C;  3O8G A;  2LG4 A;  2L9R A;  2LLK A;  3OSG A;  1HOM A;  2YR2 A;  3GTM J;  2LRD A;  3WHB A;  4G8X A;  2AO9 A;  1OMI A;  4ENM A;  1X2N A;  1R5I D;  4C30 A;  2WAE A;  4HQM A;  4XR6 A;  2Y9Z A;  2IW5 A;  3OYJ A;  4L9V A;  5B1B H;  3F8F A;  2HKO A;  4ZYA A;  5M5W J;  3ZN1 A;  3KP5 A;  3ONQ A;  4BHP A;  5LGN A;  3OYA A;  2V9V A;  5K7H A;  2JPC A;  4IRG A;  1VQM I;  1O3S A;  4FCY A;  4IRI A;  2PMH A;  1Z91 A;  3CMA I;  4IHY A;  5DEQ A;  4BJ5 C;  1A35 A;  3I9V 2;  4M9S A;  4IF4 A;  4F93 B;  1SFK A;  1V5F A;  2HFH A;  1MBE A;  3G2B A;  3IKT A;  5L3B A;  1F1Z A;  3FIW A;  1MBJ A;  1X1B A;  1FZP B;  3CUQ B;  1KQ0 A;  2E1M B;  2P5V A;  5EEG A;  1PUF A;  4BXU A;  3HTU A;  1ON2 A;  4RA2 A;  1VND A;  1KU3 A;  2L4M A;  1R49 A;  1WKM A;  5FGM A;  1W0U A;  5DD4 A;  2MH9 A;  4CZZ A;  4WK8 F;  1J5Y A;  3COA C;  3BOQ A;  1XG1 A;  1ZGA A;  1QNT A;  3ERE D;  2LTP A;  1J0R A;  3SZT A;  4XQF A;  3ZRG A;  3BQY A;  2CQK A;  2OZ6 A;  3H5N A;  3CC7 I;  4DYR A;  1Y1W J;  4HST A;  2ZCW A;  2KIF A;  4GYI A;  1JE8 A;  2ZKZ A;  4YIR X;  3DCF A;  2L4A A;  4NC6 A;  4F3Q A;  4M3E A;  4C3I J;  1OQY A;  1EH8 A;  1FX7 A;  2O8X A;  3JCU C;  1O57 A;  3A1Y A;  3ABT A;  2R7U A;  5HOO A;  1FSH A;  3CES A;  3M8F A;  1XD7 A;  2R93 J;  2BY0 A;  2HXO A;  4FIS A;  1H9G A;  1RR8 C;  3B6A A;  2HR3 A;  2BY1 A;  2EFW A;  3BG9 A;  3BJA A;  1ZLJ A;  4B47 A;  4BH9 A;  3KP6 A;  3A01 B;  3P5J A;  2XGD A;  1OLT A;  3RTR A;  2OAZ A;  1KU9 A;  4HQE A;  4AD9 A;  2JA2 A;  3I55 I;  3AKZ A;  3WU2 C;  5F0C A;  4XIC A;  2NAZ A;  3FXJ A;  2STT A;  2O03 A;  1FSE A;  1ZRC A;  3L2C A;  3FDY A;  1J75 A;  4FQG A;  1XSD A;  2W84 A;  2ZME B;  2L7Z A;  4QSH A;  3TMO A;  2XDV A;  1CF7 A;  5EZH A;  4B8X A;  1R22 A;  3L2R A;  4BBS J;  2FNP A;  3FBN B;  2DXI A;  2HQA A;  2JRT A;  1A5J A;  3P9I A;  3K4B A;  2LR8 A;  4RS8 A;  4ZJZ A;  1LFU P;  4CCJ A;  1FOY A;  5D6F A;  4ZH4 F;  2QZ8 A;  3H3U A;  4DZJ A;  3WU1 B;  3IAS 2;  3KPH A;  2M7A A;  2DN0 A;  4C2U A;  3Q3S A;  4XM3 A;  1TQM A;  4OOI A;  5FD6 A;  2P7V B;  2GIZ A;  2GA2 A;  5LFA A;  1P7J A;  1R7J A;  2IAI A;  4KN7 X;  1NG6 A;  4XKB A;  1IRF A;  2DA5 A;  4CYC B;  3CJN A;  1TP4 A;  3HOV J;  2KIS A;  3L2U A;  4KNY A;  2EIJ H;  1IGN A;  4Y13 A;  4M6V A;  5H2F C;  4ZTJ A;  4ASN A;  3P9K A;  5CVI A;  3RKY A;  4I98 B;  2LNB A;  4PJL A;  1F4K A;  5H6R A;  2FBH A;  1QZZ A;  3ULQ B;  4HX7 A;  2HTS A;  3OYN A;  1EV7 A;  2A05 A;  2JUG A;  1V4R A;  1P4X A;  2ECC A;  3V42 A;  4PJM A;  5ILS A;  4PJJ A;  4IHS A;  3TO7 A;  1BC7 C;  3E5X A;  3HOS A;  4A5N A;  1WJ5 A;  5AIP A;  4ZDP A;  3NAU A;  3HUG A;  2CG4 A;  4CH7 A;  4DYQ A;  3JRD A;  1N77 A;  5DD8 A;  1OYY A;  1I27 A;  4E4H A;  2FU4 A;  2B63 J;  4Y3O A;  3DQV C;  1VQP I;  4GFB A;  5EZG A;  4HBL A;  4ENN A;  4P55 A;  3HB9 A;  3GZ6 A;  2EA2 A;  2LYC A;  1YX5 A;  3FK6 A;  1UHW A;  2GXA A;  3QYB A;  1DDN A;  4N4N B;  3OYE A;  2PX9 A;  2VT3 A;  4YIF A;  2D1V A;  1K79 A;  4AC0 A;  1X1A A;  2EA4 A;  4CYC A;  2XAU A;  3G1L A;  3NRV A;  3VWB A;  5FLX Z;  1LE8 B;  2VOP A;  2F4M B;  1HLV A;  4YEL A;  3WE2 A;  2H6C A;  3E6C C;  4IKF A;  2MD0 A;  4IOC F;  3GCM A;  2FRH A;  1IN8 A;  4CO8 A;  4ZDL A;  3A2K A;  2X6W A;  3U9G A;  2VAS A;  3S17 J;  2R7W A;  1O3T A;  2ZO4 A;  1XX5 A;  4XMY A;  3S3N A;  4LB6 B;  4B44 A;  3W2V A;  3CJQ B;  2IA0 A;  1TWA J;  2CGP A;  1TWC J;  2MC4 A;  3W6J B;  5JHF A;  3ZQ7 A;  1FOX A;  1YHQ I;  2HVS A;  3RZO J;  3LQQ A;  4YEJ A;  2RRE A;  4HV6 A;  3MAJ A;  3GX4 X;  2FUG 2;  4OIP F;  1OFC X;  3C7J A;  1G6N A;  4EJT A;  5F27 A;  1S7A A;  3M1C A;  4HNT A;  3KET A;  1MBK A;  3ZGK A;  1GDT A;  1LDD A;  1Z67 A;  4HV5 A;  2EV0 A;  4AU7 A;  2E71 A;  5DM7 F;  3F72 A;  4RLQ A;  2G9W A;  2BEO A;  2TDX A;  3GZ5 A;  3IH2 A;  3MCZ A;  1QQI A;  3R60 A;  5F1J A;  2X0L A;  3ESW B;  1RRJ A;  2DMQ A;  2GLO A;  4N9H A;  4L0Y B;  2JA8 J;  2MH2 A;  1U8B A;  4BU2 A;  2VC0 A;  3WTZ A;  1LKX A;  5B66 C;  5ILV A;  2EZL A;  1HSJ A;  1O7F A;  3JRF A;  1X1D A;  1MBH A;  1RKW A;  1LJ9 A;  1HW1 A;  2IPQ X;  4CCO A;  3D0S A;  4IO9 F;  1RZ4 A;  4LLG F;  4EGY A;  3F6V A;  3CDH A;  4A3J J;  2BZT A;  2VB6 A;  2A6E F;  2V6E A;  3FXU A;  2LC2 A;  1TNS A;  4M72 A;  2W4S A;  2MFZ A;  5EG0 B;  1WSU A;  2HOT A;  3MMY B;  3FKJ A;  3TED A;  1O7L A;  5FB2 A;  1IV6 A;  1MD0 A;  4MQV A;  2JSC A;  1P4W A;  3QOP A;  2BW3 B;  1WH5 A;  3U2R A;  4Y7N J;  2CO5 A;  3BR3 A;  1LEA A;  1FOW A;  4PSX A;  1WJA A;  5GTH C;  4CGZ A;  3RYR A;  1LVK A;  1ZKG A;  2HI3 A;  4II2 A;  3H9J A;  4BAY A;  2L7F P;  1XS9 A;  2K3F A;  2FSW A;  2R7V A;  4UV8 A;  1S7O A;  3H5R A;  2R7S A;  2WTE A;  3PNY A;  4JBA A;  4PJ0 C;  2DU9 A;  4HG2 A;  1ZAO A;  2NOJ B;  2V1X A;  4NB5 A;  3TW6 A;  2OA4 A;  3BCA A;  3BTC A;  5IP9 J;  4OMY A;  3QPL A;  2PG4 A;  3ZMT A;  1TLH B;  3HJE A;  2DAO A;  4OU0 A;  1BJZ A;  1JT6 A;  1R36 A;  4BHB A;  1SC7 A;  2XKO A;  3LFU A;  1WI9 A;  3GO5 A;  5BPI A;  1B1B A;  3S16 J;  4DBQ A;  2LKX A;  3ZPL A;  2I8D A;  1WRJ A;  1JHF A;  3CCS I;  2NYX A;  3WTW C;  2JWT A;  2OUM A;  3FK7 A;  2VE8 A;  4W1U A;  1MNE A;  1B8I B;  4KYW A;  3MN2 A;  2X48 A;  4D1Q A;  4V2G A;  2ESH A;  2HOA A;  1U5T C;  1Z9C A;  3ZQG A;  1NH3 A;  2E5N A;  3M4O J;  2XB0 X;  2ELH A;  1HA8 A;  2UXN A;  3IRR A;  4KT5 C;  2K40 A;  1MJB A;  2B0L A;  4FTH A;  1AKH A;  1BIA A;  2K85 A;  2WB1 A;  1XCB A;  2WY7 Q;  5EYR A;  1ULY A;  1YX3 A;  2XSD C;  4UB8 C;  2XGX A;  3FX3 A;  5HLI A;  5DCF A;  4AIH A;  1ACI A;  4DBR A;  2E7W A;  1YFH A;  2CQX A;  3KZZ A;  4RM2 A;  1VQN I;  3F8M A;  5LEJ A;  3U1D A;  2DMN A;  4HF0 A;  2EQR A;  2CW8 A;  1Y56 A;  1D8K A;  1HW5 A;  4UXN A;  3ZMD A;  1VTN C;  1D3Y A;  3LSM A;  2X9D A;  3Q5F A;  1VFC A;  3NEU A;  3JAM K;  4A3G J;  3K10 A;  2KDZ A;  3OYC A;  1MND A;  1BI3 A;  1HKQ A;  3KYL A;  4UVB A;  5IYD J;  3N05 A;  2Z16 A;  1ZG5 A;  2X1C A;  4A3F J;  3HSR A;  3EUA A;  3CD6 I;  3OIO A;  2V26 A;  4RB3 C;  2VBW A;  1VQO I;  5TRD A;  1G8X A;  3K69 A;  1OYI A;  2LSO A;  2IA1 A;  3CLQ A;  1VQ8 I;  3J81 K;  3GFM A;  3PSI A;  3OR2 C;  1ZHF A;  2UZK A;  1I50 J;  4L5I A;  1ZGJ A;  2P81 A;  2ZME C;  4RB0 A;  3OY9 A;  2LF8 A;  1YJW I;  3IRQ A;  3CCE I;  3PNV A;  3F8N A;  1O4X A;  2IGK A;  5GPA A;  3CCR I;  2QBY B;  2Q2E B;  3IC7 A;  4A2U A;  3IAM 2;  1TWF J;  5DM6 F;  3G4S I;  3RPQ A;  4YFK F;  4YII A;  1J2X A;  1R5H A;  4KIC A;  2R7O A;  1XC5 A;  1HC8 A;  1B4A A;  1I6X A;  2DT7 B;  4PJN A;  1KQ8 A;  4M9Z A;  5LBQ A;  2K9N A;  2IS4 A;  3PNT A;  5FD5 A;  3HXL A;  1W36 D;  4L9N A;  1YRN B;  5FFZ A;  3E97 A;  4FE4 A;  5F6F A;  2L0K A;  3WTU C;  2Y0S N;  2ZB9 A;  1MMA A;  4ABZ A;  4BE0 A;  1LVA A;  3MKY B;  4E7H A;  1JTY A;  4RGR A;  2FX0 A;  5BOX A;  5FLX K;  3EUH C;  1SMY F;  5J1R A;  3NWS A;  1S9H A;  1XTA A;  2L54 A;  4MNU A;  1I1S A;  1P6R A;  2F4I A;  2FBI A;  2BXZ A;  1RET A;  4GCV A;  1DP7 P;  3K9T A;  1O3Q A;  1SFU A;  1E17 A;  3DEW A;  3SFZ A;  4C9Y A;  1T8I A;  1BM9 A;  2ME0 A;  2NRA C;  4WXC A;  3E5Q A;  4P5O A;  5EGO B;  2ESN A;  1TQI A;  2E35 A;  3DKW A;  3ECO A;  2OTL I;  1K7A A;  1VQK I;  3EYI A;  2E36 A;  2GXG A;  2ZNY A;  3SJM A;  1IRZ A;  1RNL A;  1TZL A;  1X4P A;  3PIO F;  4GDF A;  1OR7 A;  3BCB A;  2E34 A;  3E1S A;  1V55 H;  4UB6 C;  1ZTR A;  4OWR B;  3S32 A;  4A5M A;  1H0M A;  2CQQ A;  1U5T A;  4RAF A;  1XMX A;  3DBR B;  3ASO H;  4JYK A;  3K1P A;  1WGX A;  3WOD F;  2IT0 A;  2VKD A;  2R5Y A;  1U8R A;  2BW3 A;  1MMN A;  5D8L B;  1A04 A;  2P6T A;  5E3M A;  2CRG A;  3LA2 A;  4CHU A;  1E3P A;  1F36 A;  3HKZ A;  4NNJ A;  3JRA A;  3K4N A;  2X51 A;  2KDO A;  4I09 A;  2LD5 A;  1YOV B;  2GQQ A;  2M8E A;  2V7F A;  4HX4 A;  5E3L A;  2RNG A;  2WAQ N;  2DYR H;  1MSF C;  4G12 A;  1K6O A;  1XSV A;  3OMY A;  2H1K A;  2WAQ A;  1K4T A;  3MD2 A;  2J5O A;  1G3Y A;  2CS3 A;  4OMZ A;  2NS7 A;  2DCE A;  4XK4 A;  2M2E A;  5K7F A;  1U2W A;  2HZT A;  3C2B A;  3IWZ A;  2FOK A;  3V4G A;  3FXL A;  2HYG D;  1ZK8 A;  4Y17 A;  4I6Z A;  4MFD A;  1W1W E;  3ZOB A;  1FT9 A;  2W48 A;  4XNF A;  5L3G A;  1Y6I A;  2Y75 A;  4U7B A;  1EJ9 A;  1YRN A;  2ZC2 A;  1ZGW A;  1U3E M;  4DGW B;  2K9L A;  2H09 A;  2KZV A;  1CF7 B;  4HYE A;  3OR1 C;  2ZME A;  2R7Q A;  3EDP A;  1U78 A;  3FXK A;  3FIS A;  1I5Z A;  5L3F A;  2IGM A;  5FRM A;  2EFP A;  1JT0 A;  3GW2 A;  3L00 A;  2H94 A;  5ERI A;  2R7T A;  2DTR A;  3QOE A;  2CV2 A;  2O8K A;  3O6B B;  4F92 B;  4AYB A;  1X1P A;  1I39 A;  1T98 A;  2X1E A;  2DA6 A;  3VYU B;  2DA1 A;  2QSG X;  2L5Q A;  2K02 A;  1SD5 A;  1ZQ3 P;  3KP7 A;  2XAH A;  3V8K A;  3EUH A;  1RPW A;  2VPR A;  3OL3 A;  3FKI J;  3I3L A;  5DDG A;  4I0A A;  1R4M B;  2FBK A;  4E7I A;  2HVQ A;  3DKX A;  5TJJ A;  5BMZ A;  3K2A A;  2EFO A;  2G0E A;  4R8H A;  3T1B A;  2P8T A;  2V4J C;  4X0G A;  2V9K A;  5K7Z A;  3TO9 A;  4A0Y A;  2B9S A;  4JP0 A;  3P9C A;  4M3F A;  2FD5 A;  3CCV I;  1IUF A;  1SD6 A;  5FO5 A;  4ENJ A;  1S29 A;  5L3C A;  3QU6 A;  3CCJ I;  2KJC A;  3CCY A;  4IXA A;  4IZZ A;  3WTY C;  4PUS A;  2DFH A;  1VQ9 I;  5J4V A;  3I56 I;  3KZI C;  2P0W A;  1E0E A;  3HZJ A;  4L0Z B;  2DJI A;  1JGS A;  5FLV A;  2DFE A;  2KP6 A;  9ANT A;  1PUF B;  2L7M P;  3PO2 J;  2A5Y B;  2RN7 A;  3CUO A;  4LFU A;  5ICC A;  2O7O A;  3ZN0 A;  4MGR A;  2CU7 A;  1E3O C;  4KIS A;  4CCM A;  5LHG A;  3X2Q H;  1BL0 A;  3JR9 A;  5KAF C;  2FQ3 A;  5EGO A;  3N97 A;  2R4G A;  3EQL F;  2VXZ A;  3B02 A;  2DA4 A;  4HDV A;  5DTD A;  4XRS G;  1UST A;  3AAF A;  3GTO J;  1YS6 A;  2DO7 A;  4XN3 A;  2TRT A;  4PFO A;  3NAR A;  3VYS B;  3D1N I;  4UVA A;  2BGC A;  3BTL A;  2XPW A;  2LP0 A;  3OYK A;  3BP8 A;  2Z2S B;  4AID A;  2R7X A;  2ID3 A;  1Y0N A;  3EPZ A;  3PM1 A;  3DBL B;  1MGT A;  4JX4 A;  2A61 A;  2VKV A;  2XV4 S;  5C44 J;  4JX5 A;  5DCM A;  2DQL A;  1YO5 C;  1ERD A;  1R5G A;  1T56 A;  1SFE A;  4HPQ A;  4FX0 A;  4B43 A;  1D5Y A;  5CPR B;  5HLT A;  5CVJ A;  3QYE A;  2EB7 A;  3K4J A;  2D5V A;  3HOY J;  2V6C A;  5J4Y A;  2IP2 A;  1ETK A;  2LFB A;  4Q48 A;  1R6R A;  2CWE A;  4L9J A;  4A3D J;  2DMU A;  2OQG A;  2JPB A;  3S3M A;  1TNT A;  3ERM A;  1L0O C;  3BPX A;  2ZJ2 A;  2AQF A;  3CJT B;  3Q0V A;  1FEX A;  3D5S C;  4OAY A;  3MZH A;  2HWV A;  1FIP A;  1NG7 A;  2E1O A;  1SVM A;  4AVP A;  1FLI A;  3VB2 A;  4IX7 A;  3GZN B;  1FWZ A;  5BQT A;  3HOT A;  3QPT A;  2VQG A;  3QPH A;  3VSK A;  2HKX A;  2COM A;  2OZU A;  2PJP A;  1RUO A;  1LNW A;  2MAB A;  1MMS A;  2CH0 A;  3FWE A;  3I4P A;  1BOB A;  4IRH A;  3WGG A;  4QIW N;  4P96 A;  3T8R A;  2YX7 A;  4FHT A;  4XOT A;  4R79 A;  2E19 A;  4W97 A;  1G3W A;  2HU9 A;  2W7N A;  2IS6 A;  1NK3 P;  1FPQ A;  1S8N A;  3KEY A;  1ODD A;  3S8P A;  2R7Z J;  2HQ5 A;  1BA5 A;  1YIJ I;  4XL9 A;  4RB2 C;  3ELK A;  3LSH A;  3M8E A;  1A6I A;  2OF7 A;  3ABL H;  4BE2 A;  2UUZ A;  3CUQ A;  3HGG A;  2CUF A;  4GRI A;  4ANJ A;  2ZJR F;  1OKR A;  5HDK A;  2K27 A;  1TW2 A;  5JHU A;  2PEX A;  4UV9 A;  3WGH A;  3CO7 C;  1B9N A;  4EAT A;  4FE7 A;  3RKX A;  3GME A;  2K9M A;  3FBI B;  3DF8 A;  5FKO A;  2EWN A;  3JRB A;  3A0B C;  3K2Z A;  1QA6 A;  2QEN A;  1XDU A;  1SFO J;  1FTZ A;  3IUO A;  5IPA A;  2X85 A;  2UWM A;  2PMZ N;  3DTE A;  3J7Y J;  3DP7 A;  2EBI A;  1DP3 A;  1Y8Q B;  2KLO A;  2QF7 A;  5D5U B;  3C18 A;  4IOA F;  4A0Z A;  2IGN A;  2H1L A;  3OL4 A;  1YW9 A;  1YIT I;  3M07 A;  2M45 A;  3JRC A;  4ITV A;  4N4O B;  3J7A Y;  3L2Q A;  2P5K A;  3GF2 A;  4CCK A;  3BG5 A;  4HAM A;  3ZQC A;  4NUB A;  5KHD A;  4RGU A;  1BR1 A;  2ELJ A;  4I01 A;  5IP6 A;  2JK3 A;  3OYI A;  1OCO H;  2YSR A;  1S5L C;  5CYV A;  2FXA A;  3DFG A;  1T0F C;  2V1U A;  2GXB A;  4GYG A;  3A0H C;  4D7M A;  2ISZ A;  5IOY A;  2K7L A;  3S2H J;  2FOW A;  3RI4 A;  2Q0O A;  5GAG J;  3F21 A;  2ZJQ F;  2KRF A;  4E70 A;  2FE3 A;  2XAQ A;  4KMF A;  2EIL H;  5L3D A;  3OS2 A;  5GP9 A;  3E6D A;  3TL4 X;  5LRR A;  1JJ6 C;  4I0B A;  3GYH X;  2XAF A;  3MVP A;  2E2H J;  5ED4 A;  5FLM J;  5IT9 Z;  3HOU J;  2ADU A;  4M73 A;  1TL8 A;  5D5X B;  2Z9O A;  3SZG A;  3K0L A;  3HPH A;  1OCC H;  4LLN A;  1D1B A;  3RZD J;  4AYB N;  1K61 A;  3J80 Z;  3OWT A;  4UUT A;  5DYM A;  4B09 A;  1IDZ A;  4G6D A;  3BPV A;  3KIO A;  5M5X J;  4AIJ A;  3V8J A;  5LGT A;  4A12 A;  1MDM A;  2M0C A;  2WC2 A;  1A6Q A;  4HZF A;  2FF4 A;  4HW0 A;  1FC3 A;  4LK0 F;  4BL0 B;  5HDG A;  3W6V A;  2A07 F;  3ZP5 A;  4LG0 B;  4PSW A;  4M9X A;  1IW7 F;  1TWG J;  1FNN A;  2F6C A;  4EJW A;  5AON A;  2ZJP F;  3LOC A;  4I02 A;  2QBY A;  3W3C A;  1BI2 A;  1YJN I;  1YLF A;  2VJ5 A;  1DPR A;  1VQ4 I;  4XLC A;  5C3E J;  2ISY A;  2ZXH A;  1N78 A;  3I58 A;  2CW7 A;  1GLN A;  3TOA A;  2MSY A;  5HNF A;  3KFW X;  3CMM A;  3L9F A;  3AG2 H;  1XMK A;  4HF2 A;  1AOY A;  3CUQ C;  1BI1 A;  1AU7 A;  3R6S A;  2RQP A;  4OAZ A;  4MTE A;  1G3T A;  2QUF A;  1WJB A;  2M34 A;  3R0A A;  1T6S A;  3JTH A;  3I59 B;  3AG3 H;  5K1Y A;  3CCU I;  3OSF A;  1DU0 A;  3GUD A;  1B59 A;  4MHG A;  2MD5 A;  1Z7U A;  4XLH A;  4EJV A;  5ICG A;  4E7K A;  2HDD A;  2YU9 J;  1JKQ C;  1LB2 A;  3PIP F;  3DU6 A;  2ACJ A;  1J09 A;  2RDP A;  2E1C A;  5IP7 J;  3I4N J;  2HOE A;  4NDL A;  2BVM A;  2DFF A;  2WY8 Q;  3E6B A;  4PZJ A;  2R5Y B;  2ELK A;  3HRS A;  2HQN A;  1HDP A;  1PYV A;  4CZC A;  1WH7 A;  2Y31 A;  3K4C A;  3ZMS A;  5LHI A;  2XGE A;  1GV5 A;  1R1T A;  4EM1 A;  3DEU A;  1QU3 A;  3A03 A;  2CUZ A;  1STZ A;  3BR6 A;  2VLA A;  4CCL A;  4M74 A;  1ETV A;  3BRO A;  5EDN A;  1KA8 A;  2JVH A;  3OV8 A;  3OIP A;  5M3M J;  1Y39 A;  4N0B A;  1U6G A;  1OPC A;  2LBF A;  5TGT A;  1B72 A;  2QYO A;  4Z6Y A;  2PQ8 A;  4B3A A;  1FMV A;  1TBX A;  4MLO A;  4G7H F;  1DUX C;  1IXR C;  2DJN A;  3V7C A;  3KZY A;  1HKT A;  1A36 A;  1ZR2 A;  1D0Z A;  5D8K B;  3ZMV A;  4O5V A;  3GFL A;  3L7W A;  2E60 A;  4CYD A;  2YS9 A;  1ZN2 A;  1T33 A;  2A6H F;  5EEH A;  2P7C B;  4J00 A;  3FXO A;  1XN7 A;  3JRH A;  2EZI A;  4HNV A;  1T95 A;  4UUS B;  2QWW A;  2QQ8 A;  3HPG A;  4EJO A;  2D1H A;  4F55 A;  4A3C J;  3SEZ A;  3M7G A;  2NVQ J;  3HOZ J;  1K78 B;  4NQW B;  4HDU A;  1F9N A;  1W5T A;  3ZQH A;  3MFK A;  2M3A A;  2OD5 A;  1WZ2 A;  3SDB A;  2QM3 A;  3E6M A;  2GAU A;  2NXN B;  1T38 A;  2QKL B;  4RM3 A;  3ZXS A;  1P9Q C;  3CLO A;  4MEY F;  3S2D J;  2O0Y A;  4QTR A;  5E18 F;  4G7Z F;  3H1C A;  4JX6 A;  1ON1 A;  4IPA A;  4YG2 F;  3OOU A;  5BNG A;  4I2O A;  2K9Q A;  2BBY A;  1OCR H;  2JT1 A;  3CF2 A;  3RCO A;  2OV7 A;  5FRO A;  1JUS A;  4E7L A;  2ZSI B;  4WCG A;  3SXY A;  1GT0 C;  3A02 A;  3TDZ C;  1E3H A;  2K5C A;  1S7E A;  5LLQ A;  1I3Q J;  4IHW A;  1DQU A;  3BWG A;  4MQ9 F;  2BY2 A;  1Y8R B;  2DTZ A;  3HM5 A;  2QQ9 A;  4S05 A;  4WX9 A;  3LFK A;  4D7N A;  2XPU A;  3SQN A;  3L1P A;  3ASN H;  1IXS B;  1Z7L A;  1X4O A;  3ZQI A;  3BDD A;  5JI6 A;  1LUJ B;  1MIJ A;  2Y30 A;  3BZC A;  3DXJ F;  3KYD B;  3OOP A;  3F6O A;  1IN4 A;  3CP8 A;  4M3G A;  2VPL A;  1W4M A;  1W7P D;  2M4G A;  3H0D A;  1W0T A;  1WJF A;  2VBX A;  4LJZ F;  3REO A;  4AIK A;  1MMG A;  2MA3 A;  1KZH A;  2A69 F;  3KE2 A;  4KIB A;  3AL0 C;  1XGN A;  4DQ2 A;  3I71 A;  1ZG3 A;  1MMD A;  5BS6 A;  2WB1 N;  2YUS A;  2Q8K A;  4D5C A;  5IYC J;  4BBR J;  1P7I A;  5D4S A;  1MDM B;  1UCR A;  4A3B J;  1GV2 A;  3N4M A;  3G1O A;  3TQN A;  5CJ9 A;  3PL8 A;  4DOZ A;  2JSP A;  4X6A J;  5HOD A;  3V7S A;  1D0X A;  2KIU A;  3VYT B;  1HCR A;  3TO6 A;  3GLX A;  5HNH A;  2WBM A;  2NVY J;  1R58 A;  3VFZ A;  3ZCO A;  3CCM I;  5FJ8 J;  2CV0 A;  1PP8 F;  1J7K A;  2BY3 A;  2CW0 F;  2CJJ A;  4MFE A;  1YJ9 I;  3FM5 A;  3BG6 A;  3VPR A;  4XLP F;  4PK4 A;  4P9U A;  2PJR A;  4BJ6 C;  3WTT C;  2F48 A;  4XKV A;  1FP1 D;  4EMS A;  3GTJ J;  1J9I A;  2EIM H;  3I59 A;  4WWC A;  3ECH A;  4U0Y A;  2FA5 A;  3GLL A;  3MKW B;  1UAA A;  3BTJ A;  4KN4 X;  1OCT C;  1DGW Y;  2HZD A;  4CXF A;  1APL C;  1PUE E;  4EQQ A;  1X3W B;  1YS7 A;  2QQB A;  4X1E A;  1OCP A;  3NWT A;  5ICF A;  2JA7 J;  1MW7 A;  5D5W B;  1QZE A;  2EPF A;  3IL2 A;  1MBG A;  2YPR A;  3JAM Z;  1VQ7 I;  4NC8 A;  4BY7 J;  2AQE A;  2VJI A;  4K2E A;  4Y4R A;  5FFX A;  4LIV A;  4XLN F;  2XAS A;  2XPV A;  4XLA A;  4DZP A;  2R3S A;  2ID6 A;  1WJE A;  3C2H A;  1UFM A;  2HNH A;  2GA1 A;  2ME6 A;  3TP3 A;  2A5W A;  4KDP A;  1XSX A;  4UVC A;  3G6E I;  4Q47 A;  5H6Q A;  2HVR A;  3E3V A;  4LG0 A;  5J1Y A;  4C2M J;  1YW7 A;  3CDI A;  1MH3 A;  2HYF A;  3KX2 A;  4CA0 A;  1ZRF A;  1YE9 A;  5FRN A;  1BN5 A;  4V2F A;  5DUI A;  4XLE A;  2CV1 A;  1GXQ A;  3ML6 A;  1JUM A;  4BEH A;  2GM4 A;  2VBY A;  4QWQ A;  2VQC A;  4ZYG A;  1SAU A;  4A3E J;  4XOR A;  2EH3 A;  2W85 A;  3K4L A;  1FIA A;  4LMY A;  4QPO A;  5JLW A;  1DPU A;  4RMN A;  3ABU A;  4HX8 A;  3B73 A;  5F08 A;  4BE1 A;  3IH4 A;  3T8T A;  3H3Z A;  1FY7 A;  3DWL E;  2IVM A;  1S6L A;  1YG2 A;  2VE9 A;  4AVZ A;  4OIN F;  1JTX A;  2I10 A;  1TTY A;  3S3O A;  4OIO F;  3GFI A;  2X1D A;  4EVI A;  2JTV A;  3LAJ A;  2CMP A;  2FEZ A;  2L9V A;  4YFX F;  3BR5 A;  4BGD A;  1QHH D;  1NTC A;  2Y0M A;  5E1Z B;  5TIS C;  3H0G J;  2VN2 A;  1QZY A;  3RKQ A;  2R7R A;  2LY1 A;  1K6Y A;  4U0W A;  1Z77 A;  2VJJ A;  1Z6T A;  1POG A;  2BVL A;  1OJL A;  4LD5 A;  1K4S A;  4UY8 I;  2MG4 A;  1G3S A;  3IWF A;  3LSJ A;  2E1N A;  1OR7 C;  1YYV A;  2DA3 A;  5IT3 A;  1K83 J;  2DK5 A;  2V9P A;  2W1O A;  4LIT A;  3RJP A;  2HPM A;  2AXL A;  3CDL A;  1Z0X A;  1EF4 A;  1PJR A;  3Q0U A;  3RPU A;  3EET A;  2XAG A;  3JTG A;  3VYR B;  4ZTF A;  3O3K A;  1GVJ A;  5E20 A;  1BOA A;  1SD4 A;  3HRT A;  4V19 K;  2KPM A;  3H5A A;  4EEF G;  4G6T B;  3GTQ J;  4BXX J;  1NHA A;  3CZ6 A;  2DPD A;  2M30 A;  1IO2 A;  1XGO A;  4C3H J;  4KIG A;  5LD2 C;  4MEX F;  1ETX A;  4DW6 A;  2R5Z A;  2RVC A;  1IZ1 A;  2VIX A;  1IG7 A;  4WXD A;  2JQ7 A;  1T08 B;  1N75 A;  2IEK A;  1MJ9 A;  2KKO A;  3AL0 B;  2KZG A;  4ZZL A;  2LBF B;  5IOZ A;  1B72 B;  2IS1 A;  1BBY A;  1YQA A;  1EA3 A;  5GAD J;  2XGC A;  3V8L A;  3ZQQ A;  2BE5 F;  2Y48 A;  2GIV A;  5DCM B;  4RAY A;  4XRS A;  2JUC A;  2QQA A;  4UNO A;  4LGW A;  2QSF X;  1IN6 A;  3BLY A;  4ESF A;  2VUM J;  1GXP A;  1QO0 D;  3NQO A;  2Y69 H;  4CDG A;  3DBH B;  1WFX A;  2A68 F;  4I7H A;  1Z05 A;  3U21 A;  5E3N A;  5KK1 A;  1IUY A;  3PUB A;  4NBQ A;  3GTK J;  3RYP A;  3KEO A;  4A6E A;  4TV7 A;  4A3M J;  3L09 A;  2PFB A;  1UHM A;  5EF6 A;  2H8R A;  2MW8 A;  2XRO A;  3BZK A;  1KYW A;  4BAC A;  2MC3 A;  3H35 A;  4II3 A;  2HGC A;  2L02 A;  1V3F A;  2QVO A;  4B48 A;  1W36 C;  3LWF A;  1SAX A;  3QU3 A;  2XF5 A;  4AM3 A;  3HOX J;  2GWR A;  1AWC A;  4XOP A;  3MWM A;  1V5G A;  1OIS A;  1XB4 A;  1RKT A;  4L9T A;  4IL6 C;  5J47 A;  3CCL I;  1ZR4 A;  5F04 A;  2G7H A;  2B7E A;  5FKM A;  1RES A;  3QPS A;  3FZV A;  5J8C A;  3FHN A;  3K1N A;  2JRM A;  2AXT C;  3TDU C;  3ROU A;  4IHT A;  3VOD A;  1CQT A;  2X6X A;  1RIO H;  1ZRD A;  3CJR B;  1QGP A;  3QP5 A;  2AHQ A;  4Y15 A;  1S72 I;  3HKZ N;  2HEO A;  3PQJ A;  3KP2 A;  1ENH A;  3LAP A;  4G6Q A;  2ZXI A;  2PMU A;  2K9S A;  1EH7 A;  2Z99 A;  3P7N A;  1AKH B;  1X2M A;  4ZYE A;  1SEU A;  4M71 A;  2RGV A;  1QHG A;  3LST A;  1VQ5 I;  4BYY A;  4G94 A;  2NNY A;  4KUM A;  2VKH A;  1D8J A;  2KIM A;  2X4H A;  5F0H A;  2DMT A;  5HLG A;  1W7P B;  1FP2 A;  1WI3 A;  5K5O A;  3CC4 I;  3T0Y A;  4A3L J;  2VI6 A;  5HS9 A;  2KRC A;  1S3J A;  3LA7 A;  2JA5 J;  5GTI C;  4HLX A;  4Y52 J;  2F2E A;  2D2W A;  3GWZ A;  1TWH J;  4C3J J;  3HSF A;  1JJ8 C;  1UEL B;  2IJL A;  2LF7 A;  4Y33 A;  4I99 C;  4B1R A;  1SMT A;  3TKY A;  2XRL A;  1Z3X A;  2E2J J;  2M9H A;  1NK2 P;  3LMM A;  3DKY A;  1HST A;  4MTD A;  2LKS A;  4BQO A;  5IT9 K;  2WV1 A;  2HTJ A;  4AWX B;  2K4J A;  3DLA A;  2XF6 A;  4JQF A;  3FMR A;  4YRV A;  4F7Z A;  2ZNZ A;  5GPC A;  3GEZ A;  3MZ8 A;  2R7D A;  5JR3 A;  2FML A;  4S0H B;  2Q2E A;  4BS9 A;  4RB1 A;  2O9L A;  2GOM A;  1WJD A;  2Y0S A;  3LSK A;  1KGS A;  3FXM A;  3BR1 A;  2DT6 A;  3OIQ A;  3CF5 F;  1LPQ A;  1MSE C;  1WPK A;  3DV8 A;  1W7P A;  4E6K G;  1XMA A;  3H3V K;  3IV5 A;  4P1W A;  2HYJ A;  2M1B A;  2UXX A;  3FXQ A;  1U0J A;  3LSG A;  1DU6 A;  1I6H J;  2Z1D A;  3TBI A;  2KMU A;  3BJO A;  1LEB A;  4NQW A;  1B8I A;  3WE3 A;  1G2H A;  3MKL A;  3BR0 A;  3GBG A;  3PO3 J;  2UV1 A;  1SAN A;  3MQ0 A;  1KU2 A;  4E7J A;  3WGI A;  5E8I A;  2XF7 A;  4R1H A;  3S15 J;  2BOL A;  2L9S A;  1JKR C;  4RDU A;  2BV6 A;  1UZC A;  4BQA A;  2BHY A;  3J7A O;  3GFJ A;  3R4K A;  3UKG A;  3T5X A;  4IEJ A;  2MLK A;  5GAH J;  1SD7 A;  3AG4 H;  3DPL C;  1RI7 A;  3PQK A;  5K5R A;  4FX4 A;  2DT5 A;  2EZK A;  4Z2Y A;  3BG7 A;  2V1D A;  4KT6 A;  5K5Q A;  1JXS A;  3G73 A;  4IVN A;  4BDY A;  3FXR A;  4MO7 A;  2K86 A;  2KRH A;  3HRM A;  3RIR A;  2R0Q C;  1N25 A;  3DTK A;  4BKX A;  4XN0 A;  2PLY A;  2L3D A;  3LL7 A;  5KAI C;  3VOE A;  1ZAR A;  3HHH A;  1H89 C;  2M87 A;  1J59 A;  1F43 A;  5B5E C;  2LDU A;  1RUN A;  4MIM A;  5IYB J;  4JOM A;  2COB A;  1M1E B;  1VQL I;  1V54 H;  2LRE A;  3F8C A;  5F1R A;  2QSH X;  1H9T A;  2H6B A;  4N9I A;  3ABK H;  2RNJ A;  2HS5 A;  1PP7 U;  1QVU A;  2DYS H;  3HYI A;  3A4C A;  2VQL A;  2CQ7 A;  1IRG A;  2E5Z A;  4D5F A;  2ZSH B;  2DK8 A;  2HXI A;  1RR7 A;  1WQ2 A;  3C1D A;  4G7O F;  3F0C A;  4RAG A;  3WG9 A;  3I0T A;  1H88 C;  2W00 A;  2WA0 A;  3Q9S A;  2GOX B;  5DUK A;  1ITY A;  3JSP A;  1O3R A;  1YI2 I;  4DIQ A;  4M6Y A;  1BI0 A;  5LGU A;  2DA7 A;  1ZG1 A;  4BY1 J;  1JUP A;  2WAF A;  1UJ8 A;  3JRE A;  4HA8 A;  3E0J B;  1FBS A;  3PUF A;  1SVO A;  1IN5 A;  1HXD A;  2DOD A;  3H36 A;  3W2W A;  4ETS A;  2EJR A;  4XBF A;  2FQ4 A;  4M3D A;  5ILU A;  2TCT A;  3HC7 A;  4NHJ A;  3F23 A;  1Z3Y A;  1D5V A;  4ZYD A;  2OCE A;  2PMZ A;  3K7A J;  4GO1 A;  3OYH A;  1WCM J;  1I3A A;  3KLN A;  1CGP A;  5D4R A;  2ZXW H;  3OYF A;  3HG9 A;  1LE8 A;  2CUJ A;  2Z33 A;  2IRF G;  1MBF A;  3Q0W A;  1IJW C;  2NS0 A;  3U1K A;  1IV8 A;  2Y9Y A;  4RBO A;  1VI0 A;  3BQZ A;  4WF2 A;  4XON A;  3WHC A;  4B4C A;  3HDD A;  3L2W A;  1QPI A;  4UUS A;  1HW2 A;  3PSF A;  1T0F A;  3K70 C;  1REP C;  1TT5 B;  1FTT A;  1HQC A;  2CYY A;  4IJA A;  3BR2 A;  1LDK B;  4DJA A;  2IXS A;  4ESB A;  4BJT A;  2DQR A;  2EK5 A;  3CMY A;  1W5S A;  4XKW A;  4ZYH A;  3E7L A;  4FT8 A;  3CQZ J;  2DFI A;  2VKE A;  3R0J A;  4XID A;  2VXD A;  4HRI A;  1WVR A;  1XGM A; 
#chains in the Genus database with same CATH homology
 3SZP A;  2EFN A;  4DNC A;  3G3Z A;  2A3S A;  5ICE A;  4O6J A;  3JW4 A;  2VC1 A;  4UHT A;  1QPM A;  2W25 A;  3HSE A;  1JHH A;  5J8F A;  1FYK A;  4HLY A;  2PBI A;  2DLL A;  3WTX C;  4RGX A;  1KQ9 A;  1SFX A;  4S04 A;  2F5C A;  2GZW A;  3V7R A;  3SHF A;  3F3X A;  3KLO A;  4RAZ A;  5JFR A;  5F64 A;  3CO6 C;  2EV6 A;  2HQR A;  3WTS C;  3EYY A;  5E17 F;  1MJA A;  4GGG A;  1TW3 A;  3HHG A;  3GVA A;  1HKS A;  4GXO A;  3F22 A;  2VOD A;  5BPD A;  2FNA A;  2P6S A;  3MEX A;  1B6A A;  5CVV A;  3ISP A;  1P4A A;  2K4B A;  1X3U A;  1L3L A;  5D5V B;  2J5P A;  2JZY A;  3JSO A;  3PFI A;  4KA4 A;  4CIC A;  3S2W A;  2ZXJ A;  1HBX G;  1FBU A;  2IA2 A;  4KIF A;  1PDN C;  3J80 K;  1ZYR F;  2O6G E;  1ONV A;  2Z5U A;  3I64 A;  4WXH A;  5E1W A;  4EM2 A;  3M1E A;  4RGS A;  3M9A A;  2XIG A;  4KFC A;  4U88 A;  1U5T B;  4QLC U;  2P4W A;  3FM3 A;  4XSZ F;  4UUV A;  2EV5 A;  1R1U A;  3W6K B;  5LRS A;  4A6D A;  4D0P A;  4XRF A;  3MZY A;  3QRF F;  1E2X A;  3BY6 A;  4L5J A;  1UB9 A;  3O2P E;  3FMQ A;  3C3W A;  2RC4 A;  1EH6 A;  2OU2 A;  1QBJ A;  3FF5 A;  3I5U A;  1IN7 A;  2C6Y A;  2RKH A;  2O61 A;  1R23 A;  1LQ1 A;  1I1G A;  1MZB A;  1ZLK A;  2G7U A;  4PGG A;  2XKP A;  1B9M A;  2RV8 A;  2W57 A;  1YTY A;  4Q4Z F;  1Z6R A;  2EFQ A;  4HF1 A;  1BC8 C;  4OIQ F;  2D45 A;  3HIF A;  1G4D A;  5AIQ A;  2OBP A;  4HOB A;  1T2K A;  1IXC A;  2FMY A;  3E5U A;  5A2Q K;  1P92 A;  3QP6 A;  4PCQ A;  3WU0 A;  1YW8 A;  3H92 A;  2PI0 A;  1K78 A;  2BYV E;  3HRU A;  1TQP A;  3RKW A;  2DW4 A;  2DI3 A;  2VOO A;  2YX4 A;  2F5D A;  2Z3Y A;  4U0V A;  1FBQ A;  4U7D A;  2WV0 A;  3TGN A;  3K1M A;  3GXO A;  1FYL A;  4L18 B;  1C0W A;  2V79 A;  2KJB A;  4G9Y A;  3WTV C;  4LLL A;  1Y0U A;  2MBF A;  3Q9V A;  3IHU A;  2XAJ A;  4JK1 X;  4EJU A;  4ON0 A;  5DV5 A;  4ENK A;  2M5W A;  4A0X A;  3ZMU A;  1P2F A;  1LDJ A;  2VT2 A;  2PN6 A;  4YFN F;  3BZ6 A;  1Z1D A;  3TOB A;  2H27 A;  3LQR A;  2E7X A;  1T39 A;  1R1V A;  3BJ6 A;  5HS8 A;  5JVT A;  4XSX F;  2P5L C;  5CLS A;  4ZZD A;  4EV0 A;  4BNC A;  1YIO A;  1ZH5 A;  4EGZ A;  2VON A;  2O3F A;  2R7F A;  1XGS A;  4LK1 F;  2QLZ A;  3CTA A;  5J6X A;  2OQR A;  2W24 A;  1XDS A;  2ETH A;  2WWY A;  2XUB A;  4LB5 A;  5HS7 A;  1KU7 A;  4BHC A;  5H20 A;  1BIB A;  1BJA A;  2CSO A;  3QAH A;  2VBZ A;  2XVC A;  2L01 A;  4O3M A;  5A2Q Z;  2LKP A;  5KVR A;  2F5F A;  5CVR A;  3IKV A;  3ZMZ A;  3F8B A;  5L3E A;  5E8G A;  1GHC A;  4P9F A;  5D6E A;  2ZBK A;  1ZRE A;  2ZFW A;  4EM0 B;  1USS A;  4OIR F;  2STW A;  3R61 A;  5LHH A;  1XCV A;  5HVQ C;  4KMU X;  2MLG A;  5HDN A;  2DPU A;  2NNN A;  3LA3 A;  5CVU A;  4M6X A;  5E1X A;  1FOK A;  3D5L A;  3J81 Z;  2YU3 A;  3I54 A;  2CFX A;  2DBB A;  3DPT A;  3I53 A;  3KP4 A;  1WWX A;  3FMS A;  4PGH A;  1R00 A;  5HLH A;  3HTS B;  3FHZ A;  1OYW A;  4PDK A;  1IAW A;  1IF1 A;  1F5T A;  1MKM A;  1FYM A;  2XHK A;  2F5E A;  3KCC A;  4Q5S F;  3VEP A;  2HDC A;  2XRN A;  1Q1H A;  4ESJ A;  3KP3 A;  3KEQ A;  3RDI A;  5LEK A;  6PAX A;  2AS5 F;  4H0E A;  1KYZ A;  2YR2 A;  4G8X A;  4ENM A;  1OMI A;  4HQM A;  2IW5 A;  4L9V A;  3F8F A;  2HKO A;  3ZN1 A;  3KP5 A;  4BHP A;  5LGN A;  2V9V A;  4IRG A;  2JPC A;  1O3S A;  4IRI A;  2PMH A;  1Z91 A;  5DEQ A;  4M9S A;  4IF4 A;  2HFH A;  3IKT A;  5L3B A;  1F1Z A;  1FZP B;  3CUQ B;  1KQ0 A;  2P5V A;  5EEG A;  4BXU A;  3HTU A;  1ON2 A;  1KU3 A;  2L4M A;  1WKM A;  5FGM A;  5DD4 A;  2MH9 A;  4CZZ A;  4WK8 F;  1J5Y A;  3COA C;  3BOQ A;  1ZGA A;  1QNT A;  3ERE D;  1J0R A;  3SZT A;  2CQK A;  2OZ6 A;  1JE8 A;  2ZCW A;  2KIF A;  4GYI A;  2ZKZ A;  2L4A A;  1EH8 A;  1FX7 A;  2O8X A;  1O57 A;  3ABT A;  5HOO A;  1FSH A;  3M8F A;  1XD7 A;  1H9G A;  2HR3 A;  2EFW A;  3BJA A;  1ZLJ A;  4BH9 A;  3KP6 A;  3RTR A;  2OAZ A;  1KU9 A;  4HQE A;  4AD9 A;  2NAZ A;  2STT A;  2O03 A;  1FSE A;  1ZRC A;  3L2C A;  1J75 A;  1XSD A;  2W84 A;  2ZME B;  1CF7 A;  4B8X A;  1R22 A;  2FNP A;  2JRT A;  3P9I A;  4RS8 A;  5D6F A;  4ZH4 F;  2QZ8 A;  3H3U A;  3WU1 B;  1TQM A;  4OOI A;  5FD6 A;  2P7V B;  2GA2 A;  1R7J A;  4KN7 X;  1IRF A;  3CJN A;  4KNY A;  4Y13 A;  4ASN A;  3P9K A;  5CVI A;  3RKY A;  4I98 B;  2LNB A;  1F4K A;  5H6R A;  2FBH A;  1QZZ A;  3ULQ B;  4HX7 A;  2HTS A;  1EV7 A;  1V4R A;  1P4X A;  5ILS A;  4IHS A;  3TO7 A;  1BC7 C;  3E5X A;  3HOS A;  4A5N A;  5AIP A;  3HUG A;  2CG4 A;  5DD8 A;  1OYY A;  1I27 A;  2FU4 A;  3DQV C;  4HBL A;  4ENN A;  4P55 A;  3GZ6 A;  2EA2 A;  1UHW A;  1DDN A;  2VT3 A;  4YIF A;  2D1V A;  1K79 A;  2EA4 A;  3NRV A;  5FLX Z;  2VOP A;  3WE2 A;  2H6C A;  3E6C C;  2FRH A;  1IN8 A;  4CO8 A;  3U9G A;  1O3T A;  2ZO4 A;  4LB6 B;  2IA0 A;  2CGP A;  3W6J B;  3ZQ7 A;  3LQQ A;  4HV6 A;  3MAJ A;  3GX4 X;  4OIP F;  3C7J A;  1G6N A;  4EJT A;  3KET A;  1S7A A;  1LDD A;  4HV5 A;  2EV0 A;  3F72 A;  2G9W A;  2BEO A;  2TDX A;  3GZ5 A;  3MCZ A;  3R60 A;  1QQI A;  2X0L A;  4N9H A;  4L0Y B;  2MH2 A;  2VC0 A;  3WTZ A;  5ILV A;  1HSJ A;  1O7F A;  2IPQ X;  1LJ9 A;  1HW1 A;  3D0S A;  1RZ4 A;  4LLG F;  4EGY A;  3F6V A;  3CDH A;  2A6E F;  3FXU A;  1TNS A;  4M72 A;  1WSU A;  1O7L A;  5FB2 A;  1MD0 A;  4MQV A;  2JSC A;  1P4W A;  3QOP A;  3U2R A;  2CO5 A;  1LEA A;  4CGZ A;  3RYR A;  4BAY A;  2FSW A;  4UV8 A;  1S7O A;  2WTE A;  4JBA A;  2DU9 A;  1ZAO A;  2V1X A;  4NB5 A;  2OA4 A;  4OMY A;  2PG4 A;  3ZMT A;  1TLH B;  2DAO A;  4OU0 A;  1R36 A;  4BHB A;  2XKO A;  5BPI A;  1WI9 A;  3GO5 A;  1B1B A;  3ZPL A;  1WRJ A;  1JHF A;  2NYX A;  3WTW C;  2VE8 A;  4KYW A;  2ESH A;  1U5T C;  1Z9C A;  2ELH A;  2UXN A;  3IRR A;  4KT5 C;  1MJB A;  2B0L A;  1BIA A;  1XCB A;  1ULY A;  2XGX A;  5HLI A;  3FX3 A;  5DCF A;  4AIH A;  2E7W A;  1YFH A;  3KZZ A;  3F8M A;  5LEJ A;  3U1D A;  4HF0 A;  1D8K A;  3ZMD A;  1VTN C;  1HW5 A;  4UXN A;  1D3Y A;  3Q5F A;  3NEU A;  3JAM K;  1BI3 A;  1HKQ A;  4UVB A;  1ZG5 A;  3HSR A;  4RB3 C;  2VBW A;  5TRD A;  3K69 A;  1OYI A;  2LSO A;  2IA1 A;  3J81 K;  3GFM A;  1ZHF A;  2UZK A;  4L5I A;  1ZGJ A;  4RB0 A;  2LF8 A;  3IRQ A;  3F8N A;  2QBY B;  3IC7 A;  4A2U A;  3RPQ A;  4YFK F;  4YII A;  1J2X A;  1R5H A;  4KIC A;  1B4A A;  1I6X A;  1KQ8 A;  4M9Z A;  5LBQ A;  5FD5 A;  4L9N A;  5FFZ A;  3WTU C;  3E97 A;  5F6F A;  1LVA A;  4RGR A;  5FLX K;  5BOX A;  1SMY F;  2L54 A;  4MNU A;  1I1S A;  1P6R A;  2FBI A;  4GCV A;  1DP7 P;  3K9T A;  1O3Q A;  1SFU A;  1E17 A;  3SFZ A;  1BM9 A;  2NRA C;  4WXC A;  3E5Q A;  4P5O A;  2ESN A;  1TQI A;  3DKW A;  3ECO A;  1K7A A;  3EYI A;  2GXG A;  2ZNY A;  1RNL A;  1OR7 A;  4A5M A;  1H0M A;  1U5T A;  3K1P A;  3WOD F;  2IT0 A;  1U8R A;  5D8L B;  1A04 A;  2P6T A;  3LA2 A;  4CHU A;  4I09 A;  2GQQ A;  2M8E A;  4HX4 A;  1K6O A;  1XSV A;  2J5O A;  1G3Y A;  4OMZ A;  1U2W A;  2HZT A;  3V4G A;  2FOK A;  3IWZ A;  2HYG D;  4Y17 A;  1FT9 A;  5L3G A;  2Y75 A;  4U7B A;  1U3E M;  2H09 A;  1CF7 B;  4HYE A;  2ZME A;  3EDP A;  1U78 A;  1I5Z A;  5L3F A;  2EFP A;  3GW2 A;  3L00 A;  2H94 A;  5ERI A;  2DTR A;  3O6B B;  1T98 A;  2K02 A;  1SD5 A;  3KP7 A;  2XAH A;  3V8K A;  3EUH A;  5DDG A;  4I0A A;  2FBK A;  5TJJ A;  5BMZ A;  2EFO A;  4R8H A;  3T1B A;  2P8T A;  3TO9 A;  4A0Y A;  3P9C A;  1SD6 A;  5FO5 A;  4ENJ A;  1S29 A;  5L3C A;  3QU6 A;  2KJC A;  4IXA A;  3WTY C;  4L0Z B;  1JGS A;  2A5Y B;  2RN7 A;  3CUO A;  4LFU A;  5ICC A;  3ZN0 A;  4MGR A;  5LHG A;  2FQ3 A;  3N97 A;  3EQL F;  2VXZ A;  3B02 A;  4HDV A;  1UST A;  3AAF A;  1YS6 A;  2DO7 A;  4UVA A;  2BGC A;  3BP8 A;  1MGT A;  2A61 A;  2XV4 S;  5DCM A;  2DQL A;  1YO5 C;  1R5G A;  1SFE A;  4FX0 A;  5CVJ A;  2EB7 A;  2V6C A;  2IP2 A;  4Q48 A;  2CWE A;  4L9J A;  2OQG A;  2JPB A;  1TNT A;  1L0O C;  3BPX A;  2ZJ2 A;  3MZH A;  2HWV A;  4AVP A;  1FLI A;  3VB2 A;  1FWZ A;  5BQT A;  3HOT A;  3QPT A;  3QPH A;  2HKX A;  2COM A;  2OZU A;  2PJP A;  1RUO A;  1LNW A;  3FWE A;  3I4P A;  3WGG A;  4IRH A;  4P96 A;  3T8R A;  2YX7 A;  4FHT A;  4R79 A;  1G3W A;  1FPQ A;  1S8N A;  1ODD A;  4RB2 C;  3ELK A;  3M8E A;  3CUQ A;  1OKR A;  5HDK A;  2K27 A;  1TW2 A;  5JHU A;  2PEX A;  4UV9 A;  3WGH A;  3CO7 C;  1B9N A;  3RKX A;  3DF8 A;  2EWN A;  3K2Z A;  2QEN A;  1XDU A;  2UWM A;  3DP7 A;  5D5U B;  3C18 A;  4A0Z A;  1YW9 A;  2M45 A;  2P5K A;  3GF2 A;  4HAM A;  4RGU A;  4I01 A;  2YSR A;  5CYV A;  2FXA A;  3DFG A;  2V1U A;  2GXB A;  4GYG A;  2ISZ A;  2K7L A;  3RI4 A;  2Q0O A;  3F21 A;  2KRF A;  4E70 A;  2FE3 A;  2XAQ A;  4KMF A;  5L3D A;  3E6D A;  5LRR A;  4I0B A;  3GYH X;  2XAF A;  5ED4 A;  5IT9 Z;  2ADU A;  4M73 A;  5D5X B;  2Z9O A;  3K0L A;  4LLN A;  3J80 Z;  5DYM A;  4B09 A;  4G6D A;  3BPV A;  4AIJ A;  3V8J A;  5LGT A;  4A12 A;  1MDM A;  2WC2 A;  4HZF A;  2FF4 A;  4HW0 A;  1FC3 A;  4LK0 F;  5HDG A;  2A07 F;  3ZP5 A;  4LG0 B;  4M9X A;  1IW7 F;  1FNN A;  4EJW A;  5AON A;  4I02 A;  2QBY A;  1BI2 A;  1YLF A;  1DPR A;  2ISY A;  3I58 A;  3TOA A;  3KFW X;  3L9F A;  4HF2 A;  1XMK A;  1AOY A;  3CUQ C;  1BI1 A;  3R6S A;  2RQP A;  4MTE A;  1G3T A;  2QUF A;  3R0A A;  1T6S A;  3JTH A;  3I59 B;  5K1Y A;  3GUD A;  1B59 A;  4MHG A;  2MD5 A;  1Z7U A;  4EJV A;  5ICG A;  1LB2 A;  2ACJ A;  2RDP A;  2E1C A;  2HOE A;  3E6B A;  4PZJ A;  2HQN A;  3HRS A;  3ZMS A;  5LHI A;  1R1T A;  4EM1 A;  3DEU A;  1STZ A;  4M74 A;  3BRO A;  1KA8 A;  3OV8 A;  4N0B A;  1U6G A;  1OPC A;  2QYO A;  2PQ8 A;  1TBX A;  4G7H F;  1DUX C;  1IXR C;  3V7C A;  3KZY A;  1HKT A;  5D8K B;  3ZMV A;  4O5V A;  3GFL A;  3L7W A;  4CYD A;  2P7C B;  1ZN2 A;  2A6H F;  5EEH A;  1XN7 A;  2QWW A;  4EJO A;  2D1H A;  3M7G A;  1K78 B;  4HDU A;  1F9N A;  1W5T A;  3MFK A;  2OD5 A;  2QM3 A;  3E6M A;  2GAU A;  1T38 A;  3CLO A;  4MEY F;  2O0Y A;  5E18 F;  4G7Z F;  1ON1 A;  4IPA A;  4YG2 F;  4I2O A;  2BBY A;  2JT1 A;  4WCG A;  3SXY A;  3TDZ C;  5LLQ A;  3BWG A;  4MQ9 F;  2QQ9 A;  4S05 A;  4WX9 A;  3LFK A;  3SQN A;  1IXS B;  3BDD A;  5JI6 A;  3DXJ F;  3OOP A;  3F6O A;  1IN4 A;  1W4M A;  1W7P D;  2VBX A;  4LJZ F;  3REO A;  4AIK A;  2MA3 A;  2A69 F;  3KE2 A;  4KIB A;  1XGN A;  4DQ2 A;  3I71 A;  1ZG3 A;  5BS6 A;  2Q8K A;  5D4S A;  1MDM B;  1UCR A;  3N4M A;  3TQN A;  5CJ9 A;  3V7S A;  2KIU A;  3TO6 A;  3GLX A;  1R58 A;  3VFZ A;  1PP8 F;  1J7K A;  2CW0 F;  3FM5 A;  4XLP F;  4P9U A;  3WTT C;  1FP1 D;  4EMS A;  1J9I A;  3I59 A;  4WWC A;  3ECH A;  4U0Y A;  2FA5 A;  4KN4 X;  4CXF A;  1PUE E;  4EQQ A;  1YS7 A;  2QQB A;  5ICF A;  5D5W B;  3IL2 A;  2YPR A;  3JAM Z;  4K2E A;  5FFX A;  4XLN F;  2XAS A;  2R3S A;  1UFM A;  2GA1 A;  4KDP A;  1XSX A;  4UVC A;  4Q47 A;  5H6Q A;  3E3V A;  4LG0 A;  1YW7 A;  2HYF A;  1ZRF A;  1BN5 A;  5DUI A;  1GXQ A;  3ML6 A;  2VBY A;  4QWQ A;  4ZYG A;  2W85 A;  4LMY A;  1DPU A;  3ABU A;  4HX8 A;  3B73 A;  3T8T A;  3H3Z A;  1FY7 A;  2IVM A;  1S6L A;  1YG2 A;  2VE9 A;  4OIN F;  1TTY A;  4OIO F;  3GFI A;  4EVI A;  2JTV A;  3LAJ A;  2FEZ A;  4YFX F;  2Y0M A;  5E1Z B;  2VN2 A;  1QZY A;  4U0W A;  1Z6T A;  4LD5 A;  1G3S A;  3IWF A;  2E1N A;  1YYV A;  5IT3 A;  2DK5 A;  3RJP A;  2AXL A;  3RPU A;  3EET A;  2XAG A;  3JTG A;  3O3K A;  1GVJ A;  5E20 A;  1BOA A;  1SD4 A;  3HRT A;  1NHA A;  2DPD A;  2M30 A;  1XGO A;  4KIG A;  4MEX F;  2RVC A;  1IZ1 A;  4WXD A;  1MJ9 A;  2KKO A;  4ZZL A;  1BBY A;  1YQA A;  3V8L A;  2BE5 F;  2Y48 A;  2GIV A;  5DCM B;  4RAY A;  2QQA A;  4UNO A;  4LGW A;  1IN6 A;  4ESF A;  1GXP A;  1QO0 D;  3NQO A;  4CDG A;  2A68 F;  4I7H A;  1Z05 A;  5KK1 A;  1IUY A;  3RYP A;  3KEO A;  4A6E A;  4TV7 A;  3L09 A;  2PFB A;  1UHM A;  2XRO A;  1KYW A;  2MC3 A;  2HGC A;  2L02 A;  1V3F A;  2QVO A;  3LWF A;  1SAX A;  3QU3 A;  2GWR A;  1AWC A;  3MWM A;  1XB4 A;  4L9T A;  2G7H A;  3FZV A;  5J8C A;  3K1N A;  3TDU C;  3ROU A;  4IHT A;  3VOD A;  1RIO H;  1ZRD A;  1QGP A;  3QP5 A;  4Y15 A;  2HEO A;  3PQJ A;  3KP2 A;  3LAP A;  4G6Q A;  2PMU A;  1EH7 A;  2Z99 A;  3P7N A;  4ZYE A;  4M71 A;  2RGV A;  3LST A;  4BYY A;  4G94 A;  2NNY A;  4KUM A;  1D8J A;  2KIM A;  2X4H A;  5HLG A;  1W7P B;  1FP2 A;  5K5O A;  3T0Y A;  5HS9 A;  1S3J A;  3LA7 A;  4HLX A;  2F2E A;  2D2W A;  3GWZ A;  3HSF A;  2IJL A;  2LF7 A;  1SMT A;  3TKY A;  1HST A;  4MTD A;  5IT9 K;  2HTJ A;  4AWX B;  2K4J A;  4JQF A;  3FMR A;  4F7Z A;  2ZNZ A;  3GEZ A;  5JR3 A;  2R7D A;  2FML A;  2Q2E A;  4RB1 A;  1KGS A;  3DV8 A;  1W7P A;  1XMA A;  2M1B A;  2UXX A;  3FXQ A;  3BJO A;  1LEB A;  4NQW A;  3WE3 A;  3MQ0 A;  1KU2 A;  3WGI A;  5E8I A;  4R1H A;  2BV6 A;  4BQA A;  3J7A O;  3GFJ A;  3R4K A;  3T5X A;  2MLK A;  1SD7 A;  3DPL C;  3PQK A;  1RI7 A;  5K5R A;  4FX4 A;  2DT5 A;  4Z2Y A;  2V1D A;  5K5Q A;  1JXS A;  3G73 A;  4IVN A;  3FXR A;  2K86 A;  3HRM A;  3RIR A;  2PLY A;  2L3D A;  3VOE A;  1ZAR A;  3HHH A;  2M87 A;  1J59 A;  2LDU A;  1RUN A;  5F1R A;  3F8C A;  1H9T A;  2H6B A;  4N9I A;  2RNJ A;  2HS5 A;  1PP7 U;  3HYI A;  1IRG A;  2DK8 A;  4G7O F;  1WQ2 A;  3C1D A;  3WG9 A;  3I0T A;  3Q9S A;  5DUK A;  3JSP A;  1O3R A;  4M6Y A;  1BI0 A;  5LGU A;  1ZG1 A;  4HA8 A;  1FBS A;  1IN5 A;  1HXD A;  4ETS A;  2EJR A;  4XBF A;  5ILU A;  4NHJ A;  3F23 A;  1D5V A;  4ZYD A;  4GO1 A;  3KLN A;  1CGP A;  5D4R A;  2IRF G;  2Z33 A;  2NS0 A;  4WF2 A;  1HW2 A;  1T0F A;  1REP C;  4ESB A;  1HQC A;  2CYY A;  4IJA A;  1LDK B;  2DQR A;  2EK5 A;  1W5S A;  4ZYH A;  4FT8 A;  2DFI A;  3R0J A;  1XGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...