4IHTA

Crystal structure of benm_dbd/bena site 1 dna complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator BenM
publication title The DNA-binding domain of BenM reveals the structural basis for the recognition of a T-N11-A sequence motif by LysR-type transcriptional regulators.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription/dna
total genus 34
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ihtA00
2DAOA 2DBBA 4RGSA 2AS5F 1SMTA 3ZMTA 5ICGA 2RKHA 2H94A 5LHIA 4WXDA 4Q5SF 5H6QA 4KA4A 1BC7C 2PN6A 1OMIA 3C7JA 4YFNF 3WTSC 3TO9A 1U2WA 4U88A 3TO7A 4ZYEA 2QQAA 2H27A 4I2OA 2K4BA 3KP2A 1O7LA 4L5IA 2DQLA 3GEZA 1ODDA 3F21A 3M8EA 2R7DA 2FSWA 2GXBA 2E7XA 1FBSA 3VOEA 4G6QA 5LLQA 3WU0A 4KUMA 2DT5A 1XB4A 3QP6A 1XMKA 3KCCA 4I0AA 4NHJA 1JHHA 2ZO4A 2FU4A 1P2FA 2RN7A 2VT3A 5H20A 4L18B 1FOKA 1R58A 1FYLA 2P4WA 5DEQA 2BV6A 1R36A 3O2PE 1T39A 2W84A 1HKQA 4IRHA 5LEJA 3KP7A 1KU2A 4IRGA 4G6DA 1EV7A 2P5KA 5E17F 2HOEA 2HS5A 2IPQX 3FXRA 1KQ0A 2OZUA 5LHGA 1A04A 5CJ9A 2HQNA 1ZREA 2EV0A 4HX4A 3JAMZ 2FBKA 4OMYA 3CO6C 4L0ZB 2L4AA 3I64A 3ABUA 3TDUC 4N0BA 5E1XA 5D5WB 1FX7A 1QNTA 1FP1D 1R5GA 2L01A 1LNWA 2YR2A 5J8FA 5IT3A 4KDPA 2IA0A 5L3FA 4LG0A 3DV8A 4MQ9F 2VE8A 4LMYA 3C1DA 4LG0B 4UHTA 3TDZC 3WTTC 1XGSA 2EA2A 4Y13A 4GCVA 3BWGA 4EJTA 1K6OA 1DPRA 1YW9A 2QZ8A 1RUNA 1LDKB 4XLPF 3IKVA 5E8IA 1BI3A 3EUHA 5K5QA 2D1HA 3MWMA 1YS6A 1NHAA 5DUIA 2O8XA 4EQQA 4FX0A 2RVCA 1PP7U 3FZVA 2O6GE 4RGUA 1TLHB 3L00A 1K7AA 1XN7A 1LEAA 1P6RA 3B73A 5DD4A 2CYYA 1TQMA 2Y75A 3I53A 1RIOH 3WE2A 4OINF 3SQNA 3KP4A 2A61A 1IUYA 3F8CA 1IRGA 2MLKA 1WI9A 3CLOA 3RKYA 2O03A 4CICA 2CWEA 4LB6B 1J7KA 2PI0A 4PDKA 5L3GA 4LGWA 3ZQ7A 1ZH5A 3HSRA 2FQ3A 1HKSA 1BIBA 5FB2A 3M7GA 3R60A 1U6GA 2JSCA 2NAZA 2AXLA 2Z5UA 3J81K 3CTAA 1CGPA 3E3VA 2E7WA 4R1HA 5E18F 4L9NA 2A6HF 2VC1A 1K78B 3OV8A 2H09A 2HYFA 3DFGA 2Q0OA 5CVUA 1YTYA 1XGOA 3IHUA 3HSEA 2K4JA 2RNJA 1P4AA 4ASNA 3W6KB 5ICFA 1G3SA 2ISZA 4BHPA 2KIUA 3WTVC 3E5XA 5TJJA 5HLGA 3HIFA 2NRAC 4BQAA 4HAMA 4ZZLA 2LNBA 4TV7A 4LB5A 4UVCA 3U9GA 3LAJA 4OIOF 4M6YA 3I54A 1PDNC 1P4WA 3F8NA 4N9IA 1YG2A 1XSVA 1MGTA 1SD5A 3D5LA 3PFIA 3FMQA 5D5XB 4F7ZA 2XROA 3E6BA 2P6SA 2V6CA 4IJAA 4OIRF 2V9VA 1ZLKA 4HA8A 3LAPA 3DP7A 1HSTA 4HQEA 1R00A 2VXZA 5ILSA 1FYMA 3LA2A 5JI6A 1H0MA 4L9JA 1ZG1A 1JXSA 5AIPA 2H6BA 2XAGA 1HSJA 1XDSA 2UWMA 3RIRA 4RAZA 1FZPB 1HW2A 3NQOA 2PLYA 1O3SA 3JTGA 1MDMB 4E70A 2DW4A 4HBLA 3FXUA 4LJZF 2WC2A 4IHTA 2EV5A 1C0WA 4G7ZF 2K02A 3M8FA 1LB2A 1F5TA 4HYEA 4CO8A 4KN7X 1W7PA 1FYKA 3WGHA 1S7OA 3R4KA 1D3YA 1PP8F 5E8GA 3H92A 3M9AA 1DPUA 1J59A 3NRVA 1S6LA 3JSPA 4MGRA 2QQBA 1BM9A 2P7VB 1QZYA 3GFMA 4L5JA 1AWCA 4CDGA 3ELKA 5HS7A 4Y17A 2CSOA 1XGNA 3PQKA 4HV5A 2ISYA 2ZFWA 5LHHA 1YQAA 3DEUA 2G7UA 4I09A 3K69A 1XCBA 4OIQF 4GXOA 1QQIA 2EFPA 4HW0A 1UHMA 2HEOA 5F6FA 3SZTA 5DDGA 2GWRA 2EK5A 5K1YA 3BPXA 4KMUX 2HQRA 4CHUA 4HLYA 1FBQA 1B9MA 3RJPA 2COMA 1TNSA 5D5UB 1F9NA 1T2KA 3K1PA 3KZZA 1UFMA 3ZMZA 2W25A 3BY6A 4EMSA 4H0EA 4KYWA 2YX7A 4KICA 4UXNA 1FY7A 2HZTA 4U0YA 1HKTA 4I7HA 4P9FA 4O6JA 4EGZA 1EH8A 3QU3A 2C6YA 4NQWA 3RYPA 5HDGA 4A2UA 1T0FA 3HYIA 3DPLC 3CO7C 4ESJA 2DU9A 5HOOA 2FE3A 3K1MA 1CF7B 3BROA 2HDCA 3Q9VA 3GW2A 2XRNA 3QU6A 2MBFA 3QPTA 3T5XA 2XUBA 4M73A 4EV0A 5BPIA 2Z9OA 4R79A 1FP2A 2RC4A 2IP2A 4HOBA 2VBXA 2IW5A 4LLLA 3GFJA 1RI7A 4K2EA 2HR3A 3WE3A 1ZHFA 1XMAA 2CFXA 2HWVA 2EFOA 2IJLA 2NS0A 3SFZA 3DXJF 5HS9A 2A69F 4AIKA 3GZ5A 5KK1A 4ENJA 3MCZA 3P9IA 3KLNA 5DCFA 3QAHA 4IRIA 5JFRA 4HF2A 4M9SA 1F1ZA 1SD7A 3GWZA 1FC3A 2ZMEA 3B02A 3ECHA 1O3QA 2XVCA 1G4DA 5DYMA 2MH2A 5D4RA 1TQPA 1ZRDA 3G73A 4KMFA 3J81Z 2XASA 2E1CA 3RKXA 4O5VA 3G3ZA 2NYXA 3P7NA 3RI4A 1O3TA 4G8XA 2BBYA 2LDUA 4P55A 3GXOA 2UXXA 4A6DA 1QZZA 4LK0F 1ZGJA 3E97A 2FXAA 1ZRFA 1R1UA 2K7LA 2RQPA 5DUKA 2F5EA 5LEKA 5BMZA 3W6JB 3BP8A 3IWFA 1RUOA 3RKWA 4N9HA 3TKYA 4U7DA 3KE2A 4YIFA 2A07F 2KIFA 4OU0A 3SXYA 2XGXA 2EJRA 3VB2A 1TTYA 3T8TA 1ON2A 2XAJA 3IRRA 1OYWA 3O6BB 2ESHA 1V4RA 4S04A 2ZXJA 3BPVA 2IT0A 1LDDA 2ZKZA 4ON0A 3H3ZA 2HKOA 2QM3A 3R6SA 3EDPA 1YW7A 3EQLF 3I71A 1U5TC 4MTDA 1BI1A 4EJWA 4YG2F 2OBPA 1GXQA 4WXCA 1K79A 2ESNA 1I1GA 2VOPA 3HTSB 1Z7UA 2YPRA 2M8EA 1WKMA 3F8BA 2GZWA 1EH6A 2QQ9A 4A0ZA 1BBYA 4RB1A 4ZYDA 1SFXA 3VFZA 1G3TA 5TRDA 5FLXK 2JPBA 3QRFF 4UNOA 2G7HA 3HHHA 3KETA 3GX4X 3EYYA 4G94A 1XCVA 2Z3YA 1KYZA 3H3UA 2OAZA 1AOYA 3VODA 2A6EF 2ADUA 2PJPA 1T6SA 3GVAA 3NEUA 2VT2A 2P6TA 1XD7A 1S29A 1IRFA 2CG4A 2MLGA 4L9VA 2XV4S 3AAFA 2ELHA 1YW8A 4A5NA 1BI2A 2OQRA 3RTRA 3WTYC 1UHWA 4BH9A 1QGPA 2F5CA 2MH9A 5DCMA 1V3FA 2A3SA 2UXNA 3BJOA 3IRQA 4A12A 3F8FA 3ZMUA 1HQCA 4PGHA 4ENNA 4KIFA 3T0YA 2W57A 1WWXA 1JHFA 2JPCA 3FWEA 5D5VB 2EA4A 1SAXA 5CVJA 3ZPLA 1ZG5A 4I0BA 4CGZA 5ED4A 2QENA 5FD6A 1B4AA 2L3DA 2H6CA 1BN5A 1IN7A 4ENMA 1KU3A 2P5VA 5K5OA 3HRTA 1U5TA 1G3YA 3IL2A 3OOPA 4Q48A 4KNYA 2EFQA 5CVVA 3HOSA 2LF7A 3CDHA 1KQ8A 4JBAA 3CUQC 1IN5A 2K27A 4MEXF 1IAWA 4IXAA 1I5ZA 2O3FA 1ZAOA 1Z1DA 1KGSA 1IN4A 4PCQA 2L54A 1S3JA 2QUFA 1IXCA 2WV0A 3KP6A 2W85A 2JZYA 2GAUA 3F72A 2QYOA 4AIJA 1IXSB 2HGCA 2HFHA 2L02A 2KKOA 3S2WA 3CJNA 4AD9A 3R0JA 4CYDA 4M74A 3F23A 2B0LA 2VONA 2ZJ2A 4EVIA 2IA1A 4BHBA 4YFKF 5EEHA 2DFIA 1YYVA 4EJUA 4IPAA 2Q8KA 1OKRA 2FRHA 1BOAA 1T38A 1RNLA 1HBXG 1OPCA 1UB9A 2FMLA 1S8NA 2XKPA 1YO5C 1U8RA 4QLCU 4P96A 4UUVA 3LQRA 2V1XA 1ZYRF 4GO1A 1FT9A 5LRRA 2CW0F 2KJBA 5HDNA 1U3EM 5L3DA 4HLXA 4BHCA 4HF0A 1IZ1A 4ETSA 2BGCA 3GO5A 1MJAA 4HDVA 1W7PB 1PUEE 1OYIA 1QBJA 4M9XA 1D5VA 2FEZA 3L09A 2TDXA 3HOTA 2GIVA 1JGSA 2R7FA 3WTWC 2CO5A 4YFXF 1B59A 3BOQA 1XGMA 1Z6TA 1DUXC 3JW4A 1ZLJA 2HTSA 3DKWA 2D1VA 1H9TA 2DI3A 4CZZA 3E6DA 1MJBA 3BJ6A 3T8RA 2STTA 3V8JA 2PG4A 3I0TA 3REOA 5ILVA 3K2ZA 3R0AA 2FOKA 1W5TA 4WK8F 3HRSA 5LGNA 2IVMA 1GVJA 4G7OF 2M30A 3CUQA 5DD8A 2ZBKA 2STWA 4HF1A 2XAHA 1J0RA 3WODF 1X3UA 2Z33A 2ZCWA 2DPDA 3IKTA 1FNNA 4MNUA 2EB7A 1R5HA 1FSHA 3WG9A 2J5OA 4HX8A 2FBHA 2KJCA 1TQIA 4ZH4F 2P8TA 5F64A 2O0YA 5KVRA 1SFEA 4ESFA 3QPHA 4EJOA 4OMZA 3K1NA 1I1SA 3HTUA 4ZZDA 4I01A 5CLSA 5IT9Z 3V4GA 1XDUA 2V1UA 1J9IA 2GA2A 5D4SA 1TBXA 3P9KA 1REPC 1FBUA 4M72A 5FLXZ 2VOOA 1OYYA 4RB2C 3ECOA 4A0XA 2LKPA 4FX4A 1I27A 1EH7A 4IF4A 2OU2A 4MEYF 3WTZA 2DK8A 2M1BA 3KZYA 4KFCA 3GFIA 2R3SA 1WSUA 1WRJA 5E1WA 3ZMVA 2WTEA 2KIMA 1O57A 3I58A 1R22A 3LQQA 4A5MA 4LFUA 1YFHA 3E6CC 4PGGA 1DDNA 4AVPA 4ZYGA 3IC7A 3LSTA 3GYHX 2V1DA 2EFNA 2RGVA 1L0OC 3F6OA 4Z2YA 2RDPA 2ZMEB 4BXUA 3LWFA 4UVAA 1KQ9A 4Y15A 2BYVE 2DLLA 2PFBA 3FHZA 5D6FA 4Q47A 3TGNA 5FGMA 1OR7A 3MFKA 4ENKA 3MZYA 4G9YA 3ZP5A 2FNAA 4RGXA 3BZ6A 4U0WA 5L3EA 2PMHA 2ZNZA 4XBFA 2Y48A 1D8KA 4M6XA 3HRUA 3WTUC 1ZARA 2F5DA 5ILUA 1KA8A 4M71A 2VN2A 4GGGA 3RPQA 1HXDA 5D8LB 1T98A 3ML6A 1D8JA 3MAJA 1ZN2A 1XSDA 2JT1A 3CUOA 2O61A 2M45A 5FFXA 2XAQA 2PQ8A 3F22A 4LLNA 4RAYA 2FA5A 1IF1A 2XIGA 3FMRA 4MQVA 2W24A 2OQGA 5BS6A 4BYYA 3ROUA 4WX9A 5LGTA 1SD4A 2OD5A 1IW7F 4U7BA 3J80Z 1XSXA 2FF4A 5IT9K 3TO6A 5BQTA 2PEXA 3E6MA 3FM5A 2X0LA 1TNTA 6PAXA 1KYWA 3FXQA 2DO7A 3KEQA 3KLOA 3J7AO 4RB0A 3WTXC 4DQ2A 3I4PA 4D0PA 3KP5A 2K86A 4JK1X 1R1VA 1MZBA 4WXHA 1FWZA 4XLNF 1J5YA 2VODA 5ERIA 4RS8A 1UCRA 2E1NA 3FF5A 4FT8A 2QWWA 5F1RA 3Q9SA 2OA4A 3TQNA 4UV8A 2KRFA 5HS8A 4FHTA 4Q4ZF 3TOAA 3RYRA 3WGGA 3K0LA 4WWCA 2Q2EA 1Y0UA 2NNNA 1B9NA 1YS7A 5H6RA 4KIGA 2G9WA 2RV8A 1USTA 4BAYA 4OOIA 1STZA 5HLHA 4S05A 1LVAA 4LK1F 4XSXF 5A2QZ 5BPDA 1QO0D 3DPTA 3WGIA 1F4KA 4P9UA 2VBWA 2IRFG 3ISPA 3ZN1A 2ACJA 1WQ2A 3V7CA 3EYIA 4B09A 2YU3A 4IVNA 4AIHA 5DCMB 3ZMDA 4LD5A 3SHFA 3JTHA 3GF2A 4U0VA 5LRSA 1FLIA 3FX3A 3FM3A 3DQVC 2A68F 2EFWA 3DF8A 4UVBA 3V8KA 2OZ6A 3ULQB 3P9CA 5E1ZB 2XHKA 5AIQA 4WCGA 5EEGA 3VEPA 1SD6A 1K78A 5D8KB 1ZG3A 2F5FA 2P7CB 4CXFA 1LDJA 3LA7A 4O3MA 1J75A 1O7FA 2GA1A 1W5SA 3E5QA 4NB5A 1VTNC 3RDIA 3HRMA 3F6VA 4P5OA 3MZHA 3QOPA 4GYGA 3L2CA 3V7RA 3ABTA 2VC0A 2Z99A 2HTJA 1U5TB 3IWZA 3KFWX 1P92A 1R7JA 1DP7P 3PQJA 4I98B 3WU1B 5FFZA 2D45A 5J6XA 1E17A 4EGYA 1KU7A 1H9GA 3JSOA 2FMYA 5AONA 1BJAA 3R61A 4HZFA 3JAMK 2Y0MA 4EM0B 2VBYA 1MD0A 3J80K 2NNYA 2J5PA 1G6NA 2EV6A 1ZRCA 4L0YB 3ZMSA 3KP3A 5LGUA 1MKMA 4WF2A 4KN4X 3ERED 1TW2A 3V7SA 1BIAA 3F8MA 1MJ9A 4LLGF 1RZ4A 5D6EA 5FO5A 2YSRA 1QPMA 1SFUA 2BE5F 4EM1A 5LBQA 2EWNA 2M87A 1LEBA 1J2XA 2XKOA 2GXGA 1L3LA 4AWXB 2ZNYA 1MDMA 3HHGA 4KIBA 1TW3A 1R1TA 3M1EA 4QWQA 2BEOA 4EJVA 4G7HF 1O3RA 3LA3A 1YLFA 2CGPA 1BI0A 2HKXA 1R23A 5CVIA 3RPUA 1Z6RA 3V8LA 2HYGD 3C18A 4OIPF 2PMUA 5BOXA 1Q1HA 2MA3A 1ULYA 3QP5A 4HX7A 2JRTA 3GFLA 3I59A 5L3BA 2F2EA 5A2QK 3U1DA 1SMYF 3N4MA 1LQ1A 4HQMA 1HW1A 2DTRA 1I6XA 3I59B 3T1BA 2LF8A 3K9TA 2V79A 1HW5A 1S7AA 4L9TA 5ICCA 4JQFA 4GYIA 5J8CA 3MQ0A 2CQKA 3ZN0A 1ZGAA 2QLZA 4XRFA 4HV6A 2M5WA 1JE8A 2DQRA 2X4HA 4KT5C 1E2XA 3L7WA 3U2RA 1W4MA 2VE9A 2ETHA 1IXRC 1U78A 1IN8A 4MTEA 4A6EA 5HLIA 2PBIA 2IA2A 3I5UA 1YIOA 3D0SA 3CUQB 3TOBA 3F3XA 3GLXA 2WWYA 5HVQC 2A5YB 5CYVA 2VBZA 5K5RA 1BC8C 1Z9CA 3FMSA 5HDKA 4RB3C 1KU9A 1ON1A 4M9ZA 4XSZF 4HDUA 2JTVA 1B1BA 3C3WA 3HSFA 1W7PD 4DNCA 4A0YA 5E20A 5CVRA 3BDDA 4B8XA 4EM2A 2LSOA 3N97A 1Z05A 4BNCA 5ICEA 2QVOA 3MEXA 1CF7A 1G3WA 2QBYA 1FPQA 3HUGA 2D2WA 2FNPA 5JVTA 1FSEA 4YIIA 1Z91A 1P4XA 2QBYB 4ESBA 1LJ9A 5DV5A 2YX4A 1IN6A 1ONVA 3GZ6A 4IHSA 3BJAA 5JR3A 2MD5A 2GQQA 4I02A 5L3CA 3L9FA 4MHGA 2L4MA 2UZKA 4PZJA 5FD5A 4ZYHA 1GHCA 2XAFA 3SZPA 2DPUA 3KEOA 4R8HA 3E5UA 1GXPA 1USSA 3GUDA 3LFKA 3Q5FA 2DK5A 3EETA 4UV9A 2MC3A 4RGRA 1B6AA 5JHUA 3O3KA 2FBIA 3COAC 2P5LC
chains in the Genus database with same CATH superfamily
4LIVA 2DAOA 2DBBA 5GPCA 4BBRJ 4RGSA 2AS5F 2CFOA 2CUFA 3AL0C 2KZVA 1FMWA 1SMTA 4W1UA 3ZMTA 4PJ0C 5ICGA 2RKHA 2WY7Q 3M3YJ 2H94A 3EUHC 1A35A 5IP7J 5LHIA 2LY2A 2Y69H 3TP3A 1R49A 4WXDA 1V54H 5M3MJ 4Q5SF 5H6QA 1SVOA 1QHHD 4KA4A 4UY8I 1BC7C 2PN6A 1OMIA 3C7JA 4YFNF 3WTSC 4XRMA 3TO9A 1U2WA 2WAQA 3AG3H 4U88A 2CJJA 3QODA 1JKQC 4CA0A 3TO7A 4ZYEA 2QQAA 2KISA 3HEFA 2H27A 4BEHB 2TCTA 4I2OA 4RBOA 2K4BA 3KP2A 4PFPA 1O7LA 4ZTJA 4L5IA 2H8WA 2DQLA 3GEZA 1MBGA 1ODDA 4NDLA 3JREA 3F21A 4XMYA 2JA5J 3M8EA 4XLEA 1FIPA 2R7DA 2FSWA 4V2GA 2GXBA 2R0QC 2E7XA 1FBSA 2FX0A 1E3PA 4CZCA 1A6QA 5FJ8J 2M4KA 3VOEA 1JKPC 4G6QA 3FXJA 1OFCX 5LLQA 3SZGA 3OYCA 3WU0A 2GXAA 4E7SA 1SC7A 3PJRA 4KUMA 2DT5A 2LBFB 5TGTA 2F4IA 3BR3A 1XB4A 3QP6A 4JX5A 1XMKA 3KCCA 4IQ4A 4IQJA 2LVSA 4I0AA 4NHJA 1V5EA 1MNEA 2QEXI 3I55I 1JHHA 2ZO4A 3FIWA 4LG3A 2FU4A 1P2FA 2RN7A 2VT3A 3FBNB 4XK4A 5H20A 3VSLA 4L18B 1FOKA 1R58A 1FYLA 2OV7A 2P4WA 5DEQA 2BV6A 1R36A 4BL0B 3O2PE 1T39A 2W84A 1QZEA 1HKQA 4H4KC 4IRHA 5LEJA 3KP7A 2W48A 1KU2A 4IRGA 4G6DA 2HI3A 2CQ7A 1EV7A 3U21A 2P5KA 5E17F 2HOEA 2HS5A 2IPQX 3FXRA 1KQ0A 2OZUA 5LHGA 1A04A 5CJ9A 1IO2A 3CJRB 2HQNA 3GTKJ 1JGGA 3C2GA 5HNFA 1ZREA 2EV0A 4HX4A 5F0CA 1NTCA 2FBKA 3JAMZ 3CO6C 4OMYA 4ABZA 4L0ZB 2L4AA 2OTLI 3I64A 1QVTA 5F0FA 3HJEA 1VI0A 2O7OA 3ABUA 1E3HA 3FDYA 4HPQA 1ZTRA 3TDUC 4N0BA 5E1XA 5D5WB 1FX7A 5HLTA 1QNTA 1FP1D 1R5GA 2CH0A 2L01A 1LNWA 3CCJI 2KPMA 2YR2A 5J8FA 5IT3A 4KDPA 2R7TA 2IA0A 5L3FA 1TC3C 3BG3A 4LG0A 4MFEA 1RC9A 5FKNA 2XGCA 3BG9A 2HOTA 2GIZA 3DV8A 3N05A 4MQ9F 2VE8A 1JUPA 4LMYA 3I56I 3OOUA 3C1DA 3HOWJ 4DJAA 1UG0A 4LG0B 4XLAA 4UHTA 3TDZC 3MZ8A 3WTTC 2RAEA 3ZQLA 2KDOA 1XGSA 2EA2A 4Y13A 4GCVA 3BWGA 4EJTA 3I4NJ 1K6OA 3HBLA 1D5YA 4D9JA 4I6ZA 1DPRA 2CV2A 4XKWA 1YW9A 1MMSA 2QZ8A 1RUNA 1LDKB 2NS7A 4I99C 4E7HA 2DOAA 4XLPF 2LP0A 4X0GA 3IKVA 5E8IA 1BI3A 3EUHA 3SEQA 1TWCJ 5K5QA 2DMUA 2D1HA 3MWMA 4A3GJ 1XTAA 1YS6A 1NHAA 3L2UA 3S93A 5DUIA 2O8XA 3IH2A 3DU5A 4EQQA 1MMDA 2LKSA 4FX0A 5J47A 2RVCA 1PP7U 3FZVA 1TWHJ 1HDDC 3O8HA 4B3XA 2O6GE 4RGUA 1TLHB 1WJBA 3CC7I 1Y0NA 3L00A 2Q2EB 1K7AA 4UUSB 3P5JA 1XN7A 1LEAA 1P6RA 4Y4RA 1PUFA 3B73A 5DD4A 2CYYA 1TQMA 2Y75A 3I53A 1RIOH 2UV1A 2CV0A 2KFDA 2GOMA 5F08A 3WE2A 4OINF 3SQNA 1JT0A 3KP4A 2A61A 2HXIA 1IGNA 1IUYA 3F8CA 3HB9A 1IRGA 1MH4A 3FXKA 2YU9J 3PO3J 3DEWA 1R6RA 4XRSA 2MD0A 3LSIA 2V4JC 2MLKA 2ECCA 4HG2A 1V55H 4XLFA 1WI9A 5EG0A 3CLOA 1WJ5A 3RKYA 3BT9A 3CMMA 1OCOH 2O03A 2BVLA 4CICA 2CWEA 4LB6B 3NWTA 4FCYA 2E36A 1J7KA 2PI0A 3HKZA 5IYBJ 4HNTA 3NAUA 4PDKA 1I39A 1K4SA 2PJRA 5L3GA 2A05A 2JWTA 4LGWA 3ZQ7A 1ZH5A 4E7ZA 3HSRA 2FQ3A 1HKSA 1BIBA 5FB2A 3M7GA 1PYVA 1FOWA 2E71A 2IAIA 3K2AA 3R60A 1U6GA 4V19K 2RQQA 2JSCA 2NAZA 2AXLA 2Z5UA 3J81K 3CTAA 1CGPA 3E3VA 2E7WA 4R1HA 5E18F 3QYFA 2MYSA 4L9NA 2A6HF 4PK4A 3M07A 2VC1A 1K78B 3OV8A 4BACA 2H09A 4PUSA 2HYFA 4BE0A 4BBSJ 3DFGA 2Q0OA 5CVUA 3E0JB 1YTYA 2KDZA 2V9PA 1Y56A 1XGOA 3IHUA 4IX7A 3HSEA 2QQ8A 2K4JA 2RNJA 1P4AA 3FKIJ 3PO2J 2V26A 4ASNA 3W6KB 5ICFA 1I50J 1G3SA 2ISZA 3HGYA 1SFKA 1WFXA 2LYCA 4BHPA 2KIUA 3ABMH 3PL8A 3WTVC 3E5XA 2DFEA 1VQPI 5TJJA 5HLGA 3HIFA 3MKLA 4J01A 2NRAC 4BQAA 4HAMA 4B3AA 4ZZLA 4BQOA 1OCTC 2DYRH 2F4OB 2LNBA 4TV7A 4LB5A 3GLLA 2OF7A 4UVCA 3U9GA 3LAJA 2EIMH 4OIOF 4JOMA 2JQ7A 3ERMA 3I54A 4M6YA 4IEJA 4IHXA 1PDNC 1P4WA 1SEUA 2QKMB 3F8NA 4N9IA 1YG2A 3GBGA 1XSVA 1MGTA 1SD5A 3D5LA 1A5JA 1X1AA 1WJAA 2GOXB 1N77A 3PFIA 3GMEA 2EZIA 3FMQA 2XPWA 2QKLB 5D5XB 4F7ZA 3AKZA 2XROA 1W5CC 3E6BA 2P6SA 2V6CA 4DZJA 1JJ8C 4IJAA 4OIRF 3A03A 2V9VA 5DM6F 4BJTA 3OYHA 1ZLKA 3H3VK 2FD5A 4B47A 4HA8A 3LAPA 3DP7A 1HSTA 4HQEA 1T0FC 5J3LA 2ID3A 3BR5A 1R00A 2DA4A 1IV8A 3D5RC 2VXZA 5ILSA 2O5RA 3E1SA 1FYMA 2MFZA 2D5VA 3LA2A 2A6TA 5JI6A 4NBQA 1X1BA 1H0MA 3PNVA 1MIJA 4L9JA 4A3IJ 5E3OA 1ZG1A 4CYCA 1Z7LA 4AYBN 5AIPA 4X6AJ 1JXSA 2H6BA 2DT6A 2XAGA 3D5SC 1HSJA 2BXZA 3PNTA 2R5ZB 1XDSA 2UWMA 3BTJA 3RIRA 4RAZA 1FZPB 5F04A 1B8IA 1HW2A 1Y6IA 3S2HJ 2XF6A 2NVTJ 2W82A 3NQOA 3W2WA 2PLYA 3MMYB 1O3SA 3G71I 3MD2A 3JTGA 2JK3A 1MDMB 4E70A 2DW4A 4HBLA 3FXUA 4LJZF 3QWLA 2WC2A 3ESWB 1VFCA 3HZJA 2CU7A 2OTJI 2F48A 4IHTA 3DBHB 2EV5A 1C0WA 4G7ZF 1OCRH 2XGEA 2K02A 2JA2A 3M8FA 1LB2A 1F5TA 4HYEA 4CO8A 2CQNA 3DEEA 4KN7X 2JA7J 1W7PA 1FYKA 2E1MB 3WGHA 2V7FA 1S7OA 2XSJC 1H88C 2L7FP 3R4KA 1D3YA 1UMQA 1PP8F 3OIQA 4DIQA 5E8GA 3H92A 2Y9ZA 1T8IA 3M9AA 1DPUA 1J59A 4XRSG 3NRVA 5KAIC 1F36A 5CQGA 3SJMA 1S6LA 3VYRB 2R4GA 4MGRA 2QQBA 3QQAA 4V2FA 3JSPA 2DOFA 2EINH 1BM9A 2FQ4A 2P7VB 1EJ9A 1FEXA 1VQ6I 4AC0A 4DZPA 2BHZA 1QZYA 3GFMA 2MW8A 3BCBA 2W4SA 4L5JA 1UELB 1AWCA 4CDGA 2M7BA 3C2BA 5DTDA 3GTJJ 3L2RA 2LG4A 2CUJA 2ZMEC 3B6CA 4YIRX 2XB0X 4Y7NJ 1UAAA 3VYSB 1TP4A 1XC5A 1GUUA 3ELKA 5HS7A 4BJ6C 2XRLA 4CH7A 4Y17A 2CSOA 2R7WA 1XGNA 1MH3A 1GV5A 3PQKA 4HV5A 2ISYA 2ZFWA 4C30A 2M0MA 3JRIA 5LHHA 1YQAA 3DEUA 2G7UA 4I09A 1YRNA 4YEJA 3ZR8X 3IH4A 3K69A 2CMPA 1FMVA 1XCBA 4OIQF 1OR7C 4GXOA 1QQIA 2EFPA 1BR4A 4HW0A 1UHMA 2HEOA 3HG9A 5F6FA 3SZTA 5DDGA 2QA4I 2GWRA 2EK5A 4NUBA 5K1YA 2PMZA 1OISA 3BPXA 1R4NB 4KMUX 1VNDA 3JRGA 2HQRA 4CHUA 4HLYA 2E60A 1FBQA 1B9MA 3RJPA 2COMA 5JVGF 4JX6A 1TNSA 5D5UB 3JRCA 1F9NA 1T2KA 2KZGA 1ETVA 3OY9A 3A01B 3DBLB 3K1PA 3KZZA 1UFMA 2FUG2 3ZMZA 2W25A 3BY6A 4EMSA 4H0EA 4KYWA 2YX7A 2RNGA 3LSGA 4KICA 2EZHA 4ZTFA 4UXNA 1FY7A 2HZTA 4U0YA 1HKTA 4I7HA 1OQYA 1K6YA 1RESA 3EUKL 4N4NB 4P9FA 4ZJZA 4O6JA 3CZ6A 5B5EC 1EH8A 4EGZA 3BR2A 1GLNA 3QU3A 2C6YA 2VI6A 4BDZA 3Q0VA 4NQWA 1R71A 3RYPA 5HDGA 2VQHA 3VYTB 4A2UA 1NH3A 4XR6A 1T0FA 3HYIA 3S1NJ 3DPLC 3CO7C 4ESJA 2DU9A 2X1DA 5HOOA 2FE3A 3OL3A 3K1MA 4EEFG 1CF7B 4C2TA 3CQZJ 3BROA 2DMQA 3H9JA 2F6CA 3HUGB 4IHWA 2HDCA 1XG1A 3DLAA 3Q9VA 3IV5A 3GW2A 2VQCA 2XPVA 3PFYA 2XRNA 3QU6A 4A3FJ 1ZR2A 4D7NA 2MBFA 3QPTA 3T5XA 2HQAA 3SEZA 2M34A 2XUBA 5C4JJ 4PJJA 4M73A 4YRVA 4QTRA 4EV0A 5BPIA 5M5YJ 2LOOA 4R79A 2Z9OA 2DMPA 3ZQQA 1FP2A 2RC4A 2IP2A 3DKXA 3AG2H 4HOBA 2B9SA 2VBXA 3S2DJ 1SAUA 2IW5A 1Q1VA 1I3AA 4LLLA 3GFJA 2XSDC 4PJLA 1RI7A 4K2EA 1Y1WJ 2X51A 1X2NA 2HR3A 3WE3A 1ZHFA 3ZQCA 1DP3A 1XMAA 2CFXA 3BG6A 2HWVA 2EFOA 2IJLA 2NS0A 3SFZA 3DXJF 5HS9A 2HYJA 2A69F 1ETOA 2CRGA 2ELKA 4AIKA 2L9RA 4NC8A 3GZ5A 5KK1A 4ENJA 3MCZA 3K7AJ 4E7IA 3P9IA 3OIOA 3GTQJ 3KLNA 5DCFA 3K70D 2DJIA 2L9NA 4LIUA 3QAHA 4IRIA 5JFRA 3K4KA 4HF2A 1T08B 4M9SA 2IGOA 5GP9A 1F1ZA 1SD7A 2MC4A 1S72I 2W00A 3GWZA 5J1UA 1FC3A 2XF7A 1Z3XA 2ZMEA 3B02A 3BQZA 3ECHA 3K4JA 1O3QA 2XVCA 5LFAA 1G4DA 1EA3A 3ZQHA 2XAUA 3TBIA 5HODA 5DYMA 3PIPF 2OCEA 2MH2A 3M4OJ 2VKVA 5D4RA 1X1CA 3A1YA 4HRIA 1TQPA 4F52A 1ZRDA 2YUSA 3G73A 4KMFA 3J81Z 2XASA 2E1CA 3RKXA 2O8KA 4O5VA 3G3ZA 2NYXA 3P7NA 3RI4A 1O3TA 2JA6J 2KRCA 2VIXA 4G8XA 2BBYA 2LDUA 2VJIA 4NC7A 5H2FC 4BQNA 3DTEA 4P55A 1BW5A 4CCOA 2E19A 3GXOA 3OL4A 2UXXA 2X6XA 3KEYA 4A6DA 1QZZA 1G2HA 4BGDA 5KHDA 4P1WA 4LK0F 1ZGJA 3E97A 2FXAA 1ZRFA 1R1UA 2K7LA 2RQPA 3HXLA 2F5EA 5DUKA 5J4VA 5LEKA 4J00A 3OYDA 3W6JB 5BMZA 2R7OA 3BP8A 5EDNA 3IWFA 1RUOA 2OCCH 3RKWA 4N9HA 3TKYA 2V9KA 4U7DA 2WY8Q 5BNGA 3KE2A 4YIFA 9ANTA 2A07F 3K4CA 2K9QA 2KIFA 2LLKA 2AHQA 4OU0A 3SXYA 2XGXA 2EJRA 4A69C 3VB2A 1TTYA 3T8TA 3CD6I 2GLOA 3BTLA 1ON2A 2XAJA 3DWLE 2MABA 3OYMA 5E3MA 4AUXA 3IRRA 1YIJI 1OYWA 3VWBA 3O6BB 5FKLA 2ESHA 3CCEI 1V4RA 3DTIA 4S04A 4HSTA 3L2WA 2ZXJA 3BPVA 4OWRB 2IT0A 1LDDA 2ZKZA 4ON0A 1HLVA 2ZJRF 2OJED 2XGDA 3H3ZA 2HKOA 2QM3A 1K61A 3R6SA 4CCMA 3EDPA 1YW7A 3EQLF 2Z1DA 2EBIA 3I71A 4M3FA 1U5TC 4MTDA 4S0HB 1BI1A 4IO9F 4CCNA 4EJWA 4MLOA 4YG2F 1QU3A 1Z21A 2OBPA 1SANA 2R93J 1GXQA 4WXCA 2K9LA 1K79A 2R7SA 3OS2A 2ESNA 1I1GA 5IOYA 2VOPA 3GZNB 3JRHA 2DA5A 2ME0A 3HTSB 5FKOA 4DYQA 1Z7UA 2YPRA 2M8EA 3BTIA 3K4MA 4C3JJ 1GDTA 1WKMA 3F8BA 1N25A 3F0CA 1IG7A 4C3HJ 2GZWA 4Y33A 3BQYA 4M3EA 3TEDA 1EH6A 2Z2SB 2ZJPF 2KHMA 1CQTA 2Y0SA 1FTTA 2LMDA 2QQ9A 2ZJQF 3GTGJ 4A0ZA 2JJ7A 4FISA 4RM3A 1BBYA 4RB1A 4A3CJ 4ZYDA 3HM5A 1SFXA 2NOGA 3VFZA 2Y2ZA 1WVRA 1G3TA 2X85A 1MNMC 5TRDA 5FLXK 2KMUA 2I10A 1X4PA 2JPBA 3H0GJ 3LSPA 2ZXIA 3QRFF 4UNOA 4DYCA 2G7HA 4C9YA 2YS9A 2WB1N 4LOCA 2HVQA 3AL0B 4E6KG 3HHHA 3FK7A 3KETA 3GX4X 4A3MJ 3EYYA 3HGGA 3BG5A 1NG6A 1T33A 4G94A 2DFFA 1XCVA 2Z3YA 1KYZA 3H3UA 1APLC 2OAZA 1AOYA 3VODA 4XKBA 2A6EF 3LFUA 2ADUA 3OR2C 2QSFX 3BC8A 3QYBA 5EZHA 1TZLA 4GFBA 1T6SA 1U9OA 3GVAA 3NEUA 3FISA 2KP6A 4I76A 4F93B 2M9HA 2VT2A 4NNJA 2P6TA 2XDVA 1XD7A 1S29A 1TT5B 3JR9A 4NC6A 3SDBA 1IRFA 2CG4A 3LSMA 2CS3A 2MLGA 1K4TA 4L9VA 2DOEA 1DU0A 3MN2A 2KQRA 4MFDA 4BU2A 3L2QA 1H89C 1PUFB 1X2MA 1O4XA 2XV4S 3AAFA 2ELHA 2X9DA 4BDYA 1YW8A 3DPUA 2BY1A 4A5NA 4XONA 4QPQA 1BI2A 1TWFJ 2OQRA 1E3OC 1WGXA 5CQEA 3RTRA 4FTHA 4DYRA 3WTYC 1UHWA 3TL4X 4BXXJ 4BH9A 4ZDOA 1QGPA 2F5CA 2MH9A 3OYJA 5DCMA 5GAGJ 2KIQA 3RQ4A 1R4MB 1UHSA 1V3FA 4MO7A 2A3SA 2UXNA 2X1CA 3BJOA 4PSWA 3FXLA 5EG0B 1IDYA 3IRQA 5KNLA 4A12A 1QHGA 3KX2A 1GT0C 1ZK8A 3F8FA 3ZMUA 1YE9A 1HQCA 4PGHA 4ENNA 4KIFA 3T0YA 2W57A 5IYDJ 1WWXA 1MBHA 2AO9A 2Y30A 2LKXA 2PJRB 1R5ID 1Z67A 1RPWA 4GDFA 2VKHA 3MKWB 2BVMA 2HNHA 1JHFA 1TWGJ 2N8GA 2X48A 3HOXJ 3PIOF 3G1LA 2IS6A 4DGWB 2JPCA 3LSKA 2H1LA 1VF9A 3FWEA 5D5VB 2EA4A 4C2UA 3CMAI 1SAXA 2K3FA 2WAQN 5CVJA 3ZPLA 1ZG5A 2HDWA 2ZB9A 1MBJA 4I0BA 3JRAA 2HOSA 4CGZA 4D1QA 3CC2I 5ED4A 2W1OA 2QENA 3RSNA 4E7KA 3PUBA 3Q3SA 3S16J 5FD6A 3H0DA 1B4AA 3VPRA 2DYSH 1XMXA 2LD5A 2L3DA 3FXMA 2H6CA 2VKDA 2LFBA 1BN5A 1IN7A 4DOZA 1AA7A 4ENMA 1KU3A 2P5VA 5EJCA 5F0HA 5K5OA 3HRTA 1U5TA 1G3YA 2CQQA 3IL2A 3OOPA 4Q48A 4BKXA 4KNYA 4HNUA 2EFQA 2Q1ZB 1IUFA 5CVVA 1SVMA 1ZQ3P 3DU6A 2CUZA 4C3IJ 4A3EJ 5DM7F 3HOSA 5FLMJ 3IAS2 2F5VA 2LF7A 3CDHA 1KQ8A 1IDZA 2BOLA 4JBAA 3CUQC 4XL9A 1F43A 3BZKA 1IN5A 3CCQI 2JRMA 2K27A 5FRMA 4MEXF 1IAWA 4IXAA 1I5ZA 2O3FA 3BR0A 1ZAOA 3H35A 3GTMJ 1Z1DA 1ETKA 1VQLI 2DA2A 1KGSA 1IN4A 1S9HA 1JJ6C 2DDAA 1JKRC 2X6YA 4PCQA 2L54A 3O8GA 1S3JA 2QUFA 1X3WB 1G59A 2K3PA 1IXCA 2WV0A 3H36A 4ANJA 3HOUJ 3KP6A 1LE8A 3RQIA 2WAEA 2BY2A 2W85A 2JZYA 2M0CA 2GAUA 2K85A 3F72A 2B7EA 4EATA 5K7FA 2QYOA 3ASOH 4AIJA 1QA6A 1IXSB 2E34A 2HGCA 2HFHA 3CCSI 3TW6A 2L02A 3K70C 4RAGA 2KKOA 3S2WA 3TMOA 2BXYA 5J1YA 5IY5H 1LE8B 3CJNA 4AD9A 3R0JA 4CYDA 4M74A 3F23A 2B0LA 2VONA 5GAHJ 2DXIA 3PSIA 1KONA 3KPHA 5IP9J 2ZJ2A 4EVIA 2IA1A 4BHBA 1RETA 1DGRM 4YFKF 5EEHA 2ME6A 2DFIA 1AKHA 1YYVA 3OMYA 4EJUA 4XLHA 3A4CA 1X4OA 1XX5A 4IPAA 2Q8KA 1OKRA 5B3SH 2FRHA 2AQEA 1A36A 2L7ZA 4PFOA 4DW6A 1D1BA 1LFPA 4B48A 5KAFC 1J09A 1VQOI 2VKEA 1BOAA 1OLTA 5DS9A 4CYCB 1T38A 1RNLA 1HBXG 1FJLA 1OPCA 1UB9A 2FMLA 2BW3A 1S8NA 2XKPA 2CV1A 2DFHA 1YO5C 4KITB 3I3LA 1U8RA 1B8IB 4QLCU 1PJRA 4P96A 3I4MJ 3JRBA 4UUVA 3LQRA 2V1XA 5JHFA 4CSWA 1ZYRF 2BW3B 2DA3A 1IJWC 1D0ZA 4GO1A 1FT9A 5LRRA 2VL8A 2CW0F 2KJBA 5HDNA 4XIDA 1U3EM 5L3DA 4HLXA 4IOAF 3FXOA 2L0KA 2HXOA 1Z77A 2RREA 4BHCA 4HF0A 1X58A 1IZ1A 2VQLA 4BUPA 4ETSA 2BGCA 3WHCA 5EEAA 3GO5A 1MJAA 1T56A 3QPSA 2QSGX 1WZ2A 3OYAA 4HDVA 1W7PB 1ZR4A 1PUEE 2R7XA 1OYIA 1QBJA 4CCLA 3QOEA 2V1NA 1WHUA 3E7LA 2FEZA 4M9XA 1D5VA 3L09A 2TDXA 1WJDA 3HOTA 2A5WA 1JGSA 2GIVA 2R7FA 3WTWC 2O9LA 2CO5A 3NARA 1XPXA 4XN0A 4UUTA 1B59A 3BOQA 4YFXF 1XGMA 1W36D 5CKTA 1Z6TA 2VASA 2TRTA 1DUXC 1WPKA 4F55A 3CLQA 3JW4A 3AFHA 4XOTA 1ZLJA 2HTSA 2M2EA 1G8XA 1LUJB 3DKWA 2D1VA 1LVKA 4CUGA 2CW8A 3S3MA 1QVUA 3K4LA 1H9TA 2DI3A 5GPAA 2NS8A 1HCRA 2MSYA 4OAZA 4CZZA 3E6DA 1POGA 3HC7A 1MJBA 3BJ6A 3T8RA 3IP4B 3BR1A 2STTA 3V8JA 5E3LA 4BJ5C 2PG4A 3I0TA 2CW7A 3REOA 2BY3A 5ILVA 3K2ZA 3R0AA 1VQKI 2FOKA 1W5TA 3LSRA 4WK8F 5FROA 1HDPA 3HRSA 3LNQA 5LGNA 1YRNB 2IVMA 1GVJA 2HVSA 2EQRA 4G7OF 3LL7A 3WU2C 2M30A 4RLFA 2NVYJ 1Y39A 3CUQA 2EILH 2NXNB 4IZZA 5DD8A 2ZBKA 3HKZN 3KZIC 3CMEI 2STWA 2XAHA 4HF1A 1J0RA 2UUZA 3WODF 1X3UA 2Z33A 2ZCWA 4PJMA 4B44A 2DPDA 2LRDA 1OCZH 3IKTA 3ZOBA 3AG1H 1BR1A 1FNNA 4MNUA 3RPUD 1I3QJ 3CF5F 2EB7A 1SFOJ 1R5HA 1FSHA 3S8PA 2E2IJ 3VYUB 3WG9A 2WBMA 2J5OA 3BR6A 2FBHA 4HX8A 2KJCA 1MW7A 1TQIA 2R5YA 4ZH4F 2P8TA 5F64A 2O0YA 5KVRA 1SFEA 4ESFA 4E7JA 2NVXJ 1MNDA 3QPHA 4EJOA 4OMZA 4XICA 2MG4A 3K1NA 1V5GA 3PM1A 1D1CA 1I1SA 3HTUA 5IYCJ 4ZZDA 4I01A 5CLSA 5IT9Z 1ETQA 5LD2C 1WJEA 1BJZA 4NQWB 3V4GA 1XDUA 3LSHA 2LY9A 5EYRA 3BG7A 2V1UA 1J9IA 2DT7B 1W0TA 4XNFA 1B72A 2IGKA 2GA2A 3OYBA 3AG4H 5GTIC 1OCPA 1TWAJ 5B1BH 5D4SA 1TBXA 1B72B 2COBA 5C4XJ 5F1JA 3P9KA 1REPC 1Y8QB 3FK6A 1FBUA 1GVDA 3A0HC 4KT6A 5M5WJ 4M72A 5FLXZ 2X6OA 2VOOA 1OYYA 1NK3P 4RB2C 3ECOA 3SYTA 3MKYB 1W1WE 5J1RA 4A0XA 2LKPA 3H5NA 4FX4A 1RR8C 1DU6A 1I27A 1YOVB 1EH7A 2FJ1A 2R7VA 2ELJA 1HOMA 4IF4A 1X3ZB 3ZXSA 2OU2A 4MEYF 4FETA 3WTZA 1UZCA 2DK8A 1ETYA 5HNHA 1ERDA 2AQFA 4KJZA 3ZGKA 2M1BA 3KZYA 4KFCA 3GFIA 2R3SA 1WSUA 1A31A 1WRJA 2NOJB 5K7ZA 1N75A 5E1WA 3ZMVA 2WTEA 1IRZA 2KIMA 2X6WA 3OSFA 1O57A 3HPHA 3I58A 1R22A 5GTHC 3W3CA 2ZC2A 2LTPA 2EIKH 1WJCA 3LQQA 1S5LC 4A5MA 3OS1A 3W6VA 4LFUA 3IAM2 1BL0A 4FQGA 1YFHA 3E6CC 2K9NA 4M3DA 4PGGA 1DDNA 4G6TB 3SFIA 4AVPA 4ZYGA 3IC7A 2H8RA 3LSTA 3GYHX 3X2QH 2V1DA 3MVPA 5EGOA 3J7YJ 1VQMI 2EFNA 3RKQA 2RGVA 2H1KA 3J7AY 1L0OC 3K4NA 2KLOA 1U9NA 3F6OA 4Z2YA 2VQGA 2WAFA 2RDPA 2K9MA 2ZMEB 4BEHA 4BXUA 5EGOB 3LWFA 4UVAA 1KQ9A 3ASNH 4Y15A 2PX9A 2BYVE 2DLLA 2PFBA 1MSEC 3FHZA 5D6FA 4Q47A 3OYFA 3TGNA 1JKOC 4A3JJ 5FGMA 1P7IA 1OR7A 3MFKA 4ENKA 4IKFA 3MZYA 4G9YA 3K6GA 2EPFA 4B1RA 2LH9A 3ZQFA 4BE2A 3ZP5A 4LITA 2QCOA 2FNAA 4RGXA 2L2OA 3BZ6A 4U0WA 1ETXA 1MBFA 5L3EA 2PMHA 3H9QA 5FKMA 2ZNZA 4XBFA 2Y48A 1D8KA 3NWSA 3MKZA 3ZQIA 4M6XA 2LBFA 3HRUA 3WTUC 2PJPA 1ZARA 4M3GA 2F5DA 5ILUA 4FE7A 1KA8A 4M71A 2VN2A 3J7ZI 2XC7A 4GGGA 4D7MA 3OWTA 1DQUA 1HXDA 3IUOA 3RPQA 5D8LB 4UB6C 1T98A 3ML6A 3W2VA 1WCMJ 4A93J 2VPLA 1WH7A 3F9KA 1D8JA 3MAJA 4RDUA 2E2HJ 2L9SA 3HPGA 1ZN2A 1XSDA 1D1AA 3JCUC 2JT1A 1Y8RB 3OYLA 1S7EA 2VLAA 3CUOA 2O61A 2M45A 5FFXA 3RZDJ 2CQXA 2XAQA 3KIOA 3OS0A 2PQ8A 4XORA 3F22A 4ZDLA 4LLNA 4GRIA 1ORKA 4RAYA 2FA5A 5TISC 3OSGA 1IF1A 2XIGA 2ECBA 1QRYA 3FMRA 4PSXA 3S15J 2JMWA 2VJ4A 3VSKA 4RLQA 3VDXA 4DBQA 5GAEJ 2ZFUA 2DODA 1LFBA 4MQVA 2W24A 3KYLA 1BW6A 2OQGA 5BS6A 3OYKA 3OYIA 2E35A 4BYYA 3DKYA 2B63J 3ROUA 1RKTA 4WX9A 3L1PA 5LGTA 1SD4A 3CF2A 2OD5A 4AVZA 1IW7F 1U0JA 2JSPA 4U7BA 1WJFA 3J80Z 3CJQB 4BS9A 1HC8A 3LMMA 2PMZN 1ETWA 3CESA 1XSXA 2FF4A 4AYBA 2IXSA 5IT9K 3TO6A 2JVHA 4II3A 2IEKA 5BQTA 1IC8A 1LKXA 2Y9YA 1FOXA 2PEXA 3E6MA 3FM5A 2ZSHB 2X0LA 2BY0A 1TNTA 3TP0A 2DN0A 1HF0A 6PAXA 1KYWA 3FXQA 3CCMI 2DO7A 2M3AA 3H1CA 4BY7J 3KEQA 3KLOA 2F4MB 2EH3A 4XQFA 3J7AO 3I9V2 5J40A 1ZELA 3ZRGA 4RB0A 3WTXC 4DQ2A 3I4PA 4D0PA 4RM2A 3KP5A 2K86A 4JK1X 5IOZA 1R1VA 1MZBA 4WXHA 1FWZA 4QIWN 3CMYA 4XLNF 1J5YA 3S1MJ 1RR7A 2VODA 2LK2A 2VPRA 5ERIA 1M1EB 1Z0XA 5B66C 4RS8A 3ZQGA 1RRJA 1U8BA 1OJLA 1UCRA 2BHYA 2E1NA 3H5RA 3FF5A 4FT8A 2QWWA 3JRFA 1W36C 5F1RA 3Q9SA 4AM3A 2DMTA 2OA4A 3TQNA 4F3QA 2M4GA 2ICWG 2EIJH 2HU9A 2L7MP 3PUFA 4CCJA 3EUAA 4UV8A 3G1MA 1I6HJ 2KRFA 5HS8A 4FHTA 1MBEA 4Q4ZF 3TOAA 3K10A 3RYRA 3ZCOA 5FLVA 4HEA2 3WGGA 4KISA 3K0LA 1YJWI 4WWCA 2Q2EA 3LSJA 4U87A 3OYEA 4UUSA 1NK2P 1Y0UA 2NNNA 4D5CA 5CPRB 4E7LA 1B9NA 3EPZA 1YS7A 1T95A 5H6RA 4KIGA 2G9WA 2RV8A 1USTA 4BAYA 4OOIA 1STZA 5HLHA 2LC2A 4S05A 1LVAA 1WI3A 4LK1F 4F92B 5EZGA 5J4YA 4XSXF 5A2QZ 4IOCF 2P81A 5BPDA 1QO0D 3G2BA 3DPTA 3WGIA 1F4KA 4P9UA 2VBWA 2IRFG 2HZDA 4QSHA 3CC4I 2W7NA 3ISPA 3ZN1A 3CP2A 2LY1A 2G0EA 2ACJA 1WQ2A 3V7CA 3EYIA 4N4OB 4B09A 3HOVJ 2YU3A 4IVNA 4AIHA 1FOYA 4IL6C 1YHQI 5DCMB 3ZMDA 2E1MC 5JLWA 2I5UA 2E5ZA 3CCVI 1RKWA 4LD5A 3C2HA 2JA8J 3SHFA 3G1OA 3JTHA 3GF2A 4U0VA 5LRSA 4ITVA 1FLIA 3FX3A 3SDGA 1Y1VJ 3FM3A 1YX5A 3DQVC 2A68F 2L7KA 1MBKA 3CCYA 2EFWA 1R9TJ 3A0BC 4RA2A 2ZXHA 3DF8A 4UVBA 3OYNA 1VQNI 5FKKA 4L5EA 2Z16A 2OZ6A 3V8KA 1ZGWA 3ULQB 3P9CA 3RZOJ 5E1ZB 2XHKA 5AIQA 1MMGA 5E3NA 1JI8A 1VQ5I 4WCGA 5EEGA 3VEPA 1SD6A 5B1AH 5D8KB 1K78A 5E79C 4OAYA 1ZG3A 2F5FA 2ZSIB 2P7CB 4CXFA 1LDJA 3DTKA 3LA7A 3WHBA 2XB5A 3HL2A 1J75A 3WG7H 4O3MA 1O7FA 2GA1A 1A6IA 4A3BJ 1W5SA 3S3NA 3E5QA 2NVUB 5EF6A 2HDDA 3QYEA 4NB5A 1VTNC 3RDIA 3HRMA 3F6VA 3S3OA 3ONQA 4P5OA 3RCOA 1EKEA 2M7AA 3QOPA 4GYGA 3L2CA 3MZHA 3V7RA 3CDIA 3ABTA 2IS1A 2IGNA 2VC0A 4A3KJ 2Z99A 2HTJA 1U5TB 4Y52J 4HSRA 3IWZA 3KFWX 1P92A 1IV6A 1N78A 2OPTA 1R7JA 1DP7P 3PQJA 3UR3C 3BZCA 4JP0A 2K5CA 2DCEA 1MSFC 1V5FA 4I98B 3WU1B 4IHYA 5FFZA 2D45A 1ZKGA 3V42A 5J6XA 2IGMA 3UKGA 1E17A 2LR8A 3ABLH 4EGYA 2IBDA 2VJ5A 1KU7A 2M8GX 1H9GA 3ABKH 4G12A 3JSOA 2FMYA 1YX3A 5AONA 4Z6YA 1BJAA 2CUEA 3R61A 1Z3YA 3BLYA 1BOBA 4HZFA 4FE4A 3JAMK 2JUCA 2Y0MA 4EM0B 2VBYA 1H8AC 1MD0A 3Q0UA 3PSFA 4HNVA 3G4SI 3J80K 2NNYA 2VUMJ 1GV2A 5GADJ 3S32A 2ID6A 2GBYA 2J5PA 2K40A 1G6NA 2EV6A 3PNYA 5FRNA 3HOZJ 1ZRCA 4L0YB 3A2KA 3ZMSA 3FKJA 2DDBA 3KP3A 5LGUA 1MKMA 4WF2A 1MMAA 4ZYAA 2HOAA 1QPIA 4KN4X 1TL8A 3ERED 1TW2A 4JX4A 3V7SA 3DBRB 1UJ8A 1BIAA 2DJNA 3F8MA 4XM3A 1MJ9A 3S1RJ 4LLGF 1AKHB 2Y31A 1RZ4A 4B4CA 3S1QJ 5D6EA 2R5ZA 5FO5A 2HVRA 2YSRA 1QPMA 1SFUA 2BE5F 4EM1A 5LBQA 2EWNA 2XPUA 3OIPA 2M87A 1LEBA 1J2XA 4D5FA 2XKOA 2GXGA 2JN6A 1L3LA 4AWXB 5IP6A 3H9GA 4XLCA 2L9VA 2ZNYA 3K4BA 1MDMA 2R7ZJ 3HHGA 4KIBA 1TW3A 5K7HA 5M5XJ 2V6EA 4XOPA 3CCLI 1R1TA 3M1EA 4QWQA 3CP8A 2BEOA 4EJVA 1XS9A 2DA6A 4G7HF 1O3RA 4Y3OA 2ZXWH 1OCCH 2I8DA 5F27A 3LA3A 1YLFA 2CGPA 3BTCA 2Y0SN 1EF4A 1BI0A 2HKXA 1R23A 5CVIA 5C44J 4X1EA 3RPUA 1Z6RA 3V8LA 3OR1C 4W97A 1FTZA 2HPIA 2HYGD 1LPQA 3JRDA 4BE1A 3C18A 4OIPF 1VQ8I 2PMUA 5BOXA 1VQ7I 1Q1HA 2XF5A 2MA3A 1ULYA 3QP5A 5M3FJ 2E5NA 4HX7A 2IS2A 2JRTA 3GFLA 1WH5A 1BR2A 1MMNA 1TT0A 3I59A 3KYCB 5L3BA 2F2EA 2FOWA 5A2QK 3U1DA 1SMYF 2WV1A 3N4MA 1LQ1A 4HQMA 1HW1A 2DA7A 2DMNA 2DTRA 2K9SA 1I6XA 3CCUI 3I59B 1K83J 3T1BA 2LF8A 3K9TA 3M1CA 2V79A 1BA5A 1HW5A 2L5QA 1PVEA 1X19A 2WA0A 4B43A 1S7AA 4L9TA 2JVGA 5ICCA 4JQFA 1AHDP 4GYIA 1HA8A 4BY1J 4MIMA 5J8CA 3L2VA 1YJNI 3CJTB 3MQ0A 2CQKA 3CCRI 4PJNA 5IPAA 3ZN0A 1ZGAA 5C3EJ 2MGQA 2QF7A 2OC6A 2QLZA 4XRFA 4HV6A 4AIDA 2M5WA 1JE8A 2KL4A 2DQRA 2X4HA 4RMNA 4KT5C 1E0EA 1VQ9I 3A02A 2AXTC 1E2XA 3L7WA 3U2RA 4C2MJ 1W4MA 1SVLA 3TW7A 2VE9A 2ETHA 1ENHA 3GTOJ 3DCFA 4E4HA 1IXRC 1ACIA 4FASD 1U78A 3DLLF 1IN8A 3QPLA 2VJJA 2X1EA 4MTEA 3GTLJ 2HQ5A 4A6EA 1JUMA 5HLIA 2PBIA 5KCMA 1AU7A 1NG7A 2IA2A 3I5UA 1YIOA 1YITI 2R92J 2E2JJ 2WADA 3D0SA 3G6EI 3CUQB 3M8JA 3U1KA 3OYGA 3A01A 5JLXA 3TOBA 3HOYJ 3F3XA 3D1NI 3GLXA 2WWYA 5HVQC 2A5YB 5CYVA 2VBZA 4II2A 5K5RA 1YJ9I 1BC8C 4BQQA 1Z9CA 2NVQJ 3S14J 3FMSA 1D0XA 5HDKA 4RB3C 3CDLA 1KU9A 1ON1A 1VZ0A 4M9ZA 4XSZF 4HDUA 2HPMA 2JTVA 1B1BA 3C3WA 3HSFA 1W7PD 2QGUA 4DNCA 1UG2A 4A0YA 5E20A 4QPOA 2BZTA 5CVRA 3BDDA 2R5YB 4B8XA 4EM2A 1LFUP 2LSOA 3N97A 1Z05A 4BNCA 4ZC3A 2EZKA 5ICEA 4YELA 2GM4A 2QVOA 2EZLA 3H5AA 3UNGC 2R7UA 3MEXA 2R7QA 1CF7A 1ITYA 1G3WA 3LOCA 4M6VA 2QBYA 4XKCA 1X1PA 1FPQA 3HUGA 2D2WA 4CCKA 2FNPA 4F91B 2WB1A 5JVTA 1FSEA 4YIIA 1P7JA 1Z91A 2JUGA 4A3DJ 2E1OA 4ZDPA 2QSHX 3W2AA 1P4XA 4J19A 2QBYB 4ESBA 1LJ9A 4XKVA 3KYDB 1JTXA 1YI2I 2KRHA 2DA1A 2P0WA 3S17J 1JUSA 5DV5A 2YX4A 1IN6A 1ONVA 4RAFA 3GZ6A 4IHSA 2KT0A 2IS4A 2DTZA 3BJAA 3IH3A 3Q0WA 1JT6A 3BCAA 5JR3A 1JTYA 4DBRA 4AU7A 2MD5A 2GQQA 3B6AA 1D0YA 4XN3A 4I02A 1P9QC 5L3CA 3L9FA 3FBIB 3FHNA 4MHGA 2L4MA 2UZKA 4JYKA 4PZJA 2OUMA 2R7RA 2VB6A 5FD5A 4ZYHA 1GHCA 2XAFA 3SZPA 2DPUA 1W0UA 3GCMA 3KEOA 4R8HA 3E5UA 1X1DA 1GXPA 1USSA 3GUDA 3LFKA 4BXFA 3Q5FA 4UB8C 2DK5A 1KZHA 2VXDA 3GTPJ 3EETA 4UV9A 2MC3A 4IHVA 1FIAA 4RGRA 3HDDA 1B6AA 1DGWY 2LREA 5JHUA 4M3BA 4A3LJ 3O3KA 2FBIA 3COAC 2P5LC 1VQ4I 1IRXA
chains in the Genus database with same CATH topology
2DAOA 2DBBA 4RGSA 2AS5F 1SMTA 3ZMTA 5ICGA 2RKHA 2H94A 5LHIA 4WXDA 4Q5SF 5H6QA 4KA4A 1BC7C 2PN6A 1OMIA 3C7JA 4YFNF 3WTSC 3TO9A 1U2WA 4U88A 3TO7A 4ZYEA 2QQAA 2H27A 4I2OA 2K4BA 3KP2A 1O7LA 4L5IA 2DQLA 3GEZA 1ODDA 3F21A 3M8EA 2R7DA 2FSWA 2GXBA 2E7XA 1FBSA 3VOEA 4G6QA 5LLQA 3WU0A 4KUMA 2DT5A 1XB4A 3QP6A 1XMKA 3KCCA 4I0AA 4NHJA 1JHHA 2ZO4A 2FU4A 1P2FA 2RN7A 2VT3A 5H20A 4L18B 1FOKA 1R58A 1FYLA 2P4WA 5DEQA 2BV6A 1R36A 3O2PE 1T39A 2W84A 1HKQA 4IRHA 5LEJA 3KP7A 1KU2A 4IRGA 4G6DA 1EV7A 2P5KA 5E17F 2HOEA 2HS5A 2IPQX 3FXRA 1KQ0A 2OZUA 5LHGA 1A04A 5CJ9A 2HQNA 1ZREA 2EV0A 4HX4A 3JAMZ 2FBKA 4OMYA 3CO6C 4L0ZB 2L4AA 3I64A 3ABUA 3TDUC 4N0BA 5E1XA 5D5WB 1FX7A 1QNTA 1FP1D 1R5GA 2L01A 1LNWA 2YR2A 5J8FA 5IT3A 4KDPA 2IA0A 5L3FA 4LG0A 3DV8A 4MQ9F 2VE8A 4LMYA 3C1DA 4LG0B 4UHTA 3TDZC 3WTTC 1XGSA 2EA2A 4Y13A 4GCVA 3BWGA 4EJTA 1K6OA 1DPRA 1YW9A 2QZ8A 1RUNA 1LDKB 4XLPF 3IKVA 5E8IA 1BI3A 3EUHA 5K5QA 2D1HA 3MWMA 1YS6A 1NHAA 5DUIA 2O8XA 4EQQA 4FX0A 2RVCA 1PP7U 3FZVA 2O6GE 4RGUA 1TLHB 3L00A 1K7AA 1XN7A 1LEAA 1P6RA 3B73A 5DD4A 2CYYA 1TQMA 2Y75A 3I53A 1RIOH 3WE2A 4OINF 3SQNA 3KP4A 2A61A 1IUYA 3F8CA 1IRGA 2MLKA 1WI9A 3CLOA 3RKYA 2O03A 4CICA 2CWEA 4LB6B 1J7KA 2PI0A 4PDKA 5L3GA 4LGWA 3ZQ7A 1ZH5A 3HSRA 2FQ3A 1HKSA 1BIBA 5FB2A 3M7GA 3R60A 1U6GA 2JSCA 2NAZA 2AXLA 2Z5UA 3J81K 3CTAA 1CGPA 3E3VA 2E7WA 4R1HA 5E18F 4L9NA 2A6HF 2VC1A 1K78B 3OV8A 2H09A 2HYFA 3DFGA 2Q0OA 5CVUA 1YTYA 1XGOA 3IHUA 3HSEA 2K4JA 2RNJA 1P4AA 4ASNA 3W6KB 5ICFA 1G3SA 2ISZA 4BHPA 2KIUA 3WTVC 3E5XA 5TJJA 5HLGA 3HIFA 2NRAC 4BQAA 4HAMA 4ZZLA 2LNBA 4TV7A 4LB5A 4UVCA 3U9GA 3LAJA 4OIOF 4M6YA 3I54A 1PDNC 1P4WA 3F8NA 4N9IA 1YG2A 1XSVA 1MGTA 1SD5A 3D5LA 3PFIA 3FMQA 5D5XB 4F7ZA 2XROA 3E6BA 2P6SA 2V6CA 4IJAA 4OIRF 2V9VA 1ZLKA 4HA8A 3LAPA 3DP7A 1HSTA 4HQEA 1R00A 2VXZA 5ILSA 1FYMA 3LA2A 5JI6A 1H0MA 4L9JA 1ZG1A 1JXSA 5AIPA 2H6BA 2XAGA 1HSJA 1XDSA 2UWMA 3RIRA 4RAZA 1FZPB 1HW2A 3NQOA 2PLYA 1O3SA 3JTGA 1MDMB 4E70A 2DW4A 4HBLA 3FXUA 4LJZF 2WC2A 4IHTA 2EV5A 1C0WA 4G7ZF 2K02A 3M8FA 1LB2A 1F5TA 4HYEA 4CO8A 4KN7X 1W7PA 1FYKA 3WGHA 1S7OA 3R4KA 1D3YA 1PP8F 5E8GA 3H92A 3M9AA 1DPUA 1J59A 3NRVA 1S6LA 3JSPA 4MGRA 2QQBA 1BM9A 2P7VB 1QZYA 3GFMA 4L5JA 1AWCA 4CDGA 3ELKA 5HS7A 4Y17A 2CSOA 1XGNA 3PQKA 4HV5A 2ISYA 2ZFWA 5LHHA 1YQAA 3DEUA 2G7UA 4I09A 3K69A 1XCBA 4OIQF 4GXOA 1QQIA 2EFPA 4HW0A 1UHMA 2HEOA 5F6FA 3SZTA 5DDGA 2GWRA 2EK5A 5K1YA 3BPXA 4KMUX 2HQRA 4CHUA 4HLYA 1FBQA 1B9MA 3RJPA 2COMA 1TNSA 5D5UB 1F9NA 1T2KA 3K1PA 3KZZA 1UFMA 3ZMZA 2W25A 3BY6A 4EMSA 4H0EA 4KYWA 2YX7A 4KICA 4UXNA 1FY7A 2HZTA 4U0YA 1HKTA 4I7HA 4P9FA 4O6JA 4EGZA 1EH8A 3QU3A 2C6YA 4NQWA 3RYPA 5HDGA 4A2UA 1T0FA 3HYIA 3DPLC 3CO7C 4ESJA 2DU9A 5HOOA 2FE3A 3K1MA 1CF7B 3BROA 2HDCA 3Q9VA 3GW2A 2XRNA 3QU6A 2MBFA 3QPTA 3T5XA 2XUBA 4M73A 4EV0A 5BPIA 2Z9OA 4R79A 1FP2A 2RC4A 2IP2A 4HOBA 2VBXA 2IW5A 4LLLA 3GFJA 1RI7A 4K2EA 2HR3A 3WE3A 1ZHFA 1XMAA 2CFXA 2HWVA 2EFOA 2IJLA 2NS0A 3SFZA 3DXJF 5HS9A 2A69F 4AIKA 3GZ5A 5KK1A 4ENJA 3MCZA 3P9IA 3KLNA 5DCFA 3QAHA 4IRIA 5JFRA 4HF2A 4M9SA 1F1ZA 1SD7A 3GWZA 1FC3A 2ZMEA 3B02A 3ECHA 1O3QA 2XVCA 1G4DA 5DYMA 2MH2A 5D4RA 1TQPA 1ZRDA 3G73A 4KMFA 3J81Z 2XASA 2E1CA 3RKXA 4O5VA 3G3ZA 2NYXA 3P7NA 3RI4A 1O3TA 4G8XA 2BBYA 2LDUA 4P55A 3GXOA 2UXXA 4A6DA 1QZZA 4LK0F 1ZGJA 3E97A 2FXAA 1ZRFA 1R1UA 2K7LA 2RQPA 5DUKA 2F5EA 5LEKA 5BMZA 3W6JB 3BP8A 3IWFA 1RUOA 3RKWA 4N9HA 3TKYA 4U7DA 3KE2A 4YIFA 2A07F 2KIFA 4OU0A 3SXYA 2XGXA 2EJRA 3VB2A 1TTYA 3T8TA 1ON2A 2XAJA 3IRRA 1OYWA 3O6BB 2ESHA 1V4RA 4S04A 2ZXJA 3BPVA 2IT0A 1LDDA 2ZKZA 4ON0A 3H3ZA 2HKOA 2QM3A 3R6SA 3EDPA 1YW7A 3EQLF 3I71A 1U5TC 4MTDA 1BI1A 4EJWA 4YG2F 2OBPA 1GXQA 4WXCA 1K79A 2ESNA 1I1GA 2VOPA 3HTSB 1Z7UA 2YPRA 2M8EA 1WKMA 3F8BA 2GZWA 1EH6A 2QQ9A 4A0ZA 1BBYA 4RB1A 4ZYDA 1SFXA 3VFZA 1G3TA 5TRDA 5FLXK 2JPBA 3QRFF 4UNOA 2G7HA 3HHHA 3KETA 3GX4X 3EYYA 4G94A 1XCVA 2Z3YA 1KYZA 3H3UA 2OAZA 1AOYA 3VODA 2A6EF 2ADUA 2PJPA 1T6SA 3GVAA 3NEUA 2VT2A 2P6TA 1XD7A 1S29A 1IRFA 2CG4A 2MLGA 4L9VA 2XV4S 3AAFA 2ELHA 1YW8A 4A5NA 1BI2A 2OQRA 3RTRA 3WTYC 1UHWA 4BH9A 1QGPA 2F5CA 2MH9A 5DCMA 1V3FA 2A3SA 2UXNA 3BJOA 3IRQA 4A12A 3F8FA 3ZMUA 1HQCA 4PGHA 4ENNA 4KIFA 3T0YA 2W57A 1WWXA 1JHFA 2JPCA 3FWEA 5D5VB 2EA4A 1SAXA 5CVJA 3ZPLA 1ZG5A 4I0BA 4CGZA 5ED4A 2QENA 5FD6A 1B4AA 2L3DA 2H6CA 1BN5A 1IN7A 4ENMA 1KU3A 2P5VA 5K5OA 3HRTA 1U5TA 1G3YA 3IL2A 3OOPA 4Q48A 4KNYA 2EFQA 5CVVA 3HOSA 2LF7A 3CDHA 1KQ8A 4JBAA 3CUQC 1IN5A 2K27A 4MEXF 1IAWA 4IXAA 1I5ZA 2O3FA 1ZAOA 1Z1DA 1KGSA 1IN4A 4PCQA 2L54A 1S3JA 2QUFA 1IXCA 2WV0A 3KP6A 2W85A 2JZYA 2GAUA 3F72A 2QYOA 4AIJA 1IXSB 2HGCA 2HFHA 2L02A 2KKOA 3S2WA 3CJNA 4AD9A 3R0JA 4CYDA 4M74A 3F23A 2B0LA 2VONA 2ZJ2A 4EVIA 2IA1A 4BHBA 4YFKF 5EEHA 2DFIA 1YYVA 4EJUA 4IPAA 2Q8KA 1OKRA 2FRHA 1BOAA 1T38A 1RNLA 1HBXG 1OPCA 1UB9A 2FMLA 1S8NA 2XKPA 1YO5C 1U8RA 4QLCU 4P96A 4UUVA 3LQRA 2V1XA 1ZYRF 4GO1A 1FT9A 5LRRA 2CW0F 2KJBA 5HDNA 1U3EM 5L3DA 4HLXA 4BHCA 4HF0A 1IZ1A 4ETSA 2BGCA 3GO5A 1MJAA 4HDVA 1W7PB 1PUEE 1OYIA 1QBJA 4M9XA 1D5VA 2FEZA 3L09A 2TDXA 3HOTA 2GIVA 1JGSA 2R7FA 3WTWC 2CO5A 4YFXF 1B59A 3BOQA 1XGMA 1Z6TA 1DUXC 3JW4A 1ZLJA 2HTSA 3DKWA 2D1VA 1H9TA 2DI3A 4CZZA 3E6DA 1MJBA 3BJ6A 3T8RA 2STTA 3V8JA 2PG4A 3I0TA 3REOA 5ILVA 3K2ZA 3R0AA 2FOKA 1W5TA 4WK8F 3HRSA 5LGNA 2IVMA 1GVJA 4G7OF 2M30A 3CUQA 5DD8A 2ZBKA 2STWA 4HF1A 2XAHA 1J0RA 3WODF 1X3UA 2Z33A 2ZCWA 2DPDA 3IKTA 1FNNA 4MNUA 2EB7A 1R5HA 1FSHA 3WG9A 2J5OA 4HX8A 2FBHA 2KJCA 1TQIA 4ZH4F 2P8TA 5F64A 2O0YA 5KVRA 1SFEA 4ESFA 3QPHA 4EJOA 4OMZA 3K1NA 1I1SA 3HTUA 4ZZDA 4I01A 5CLSA 5IT9Z 3V4GA 1XDUA 2V1UA 1J9IA 2GA2A 5D4SA 1TBXA 3P9KA 1REPC 1FBUA 4M72A 5FLXZ 2VOOA 1OYYA 4RB2C 3ECOA 4A0XA 2LKPA 4FX4A 1I27A 1EH7A 4IF4A 2OU2A 4MEYF 3WTZA 2DK8A 2M1BA 3KZYA 4KFCA 3GFIA 2R3SA 1WSUA 1WRJA 5E1WA 3ZMVA 2WTEA 2KIMA 1O57A 3I58A 1R22A 3LQQA 4A5MA 4LFUA 1YFHA 3E6CC 4PGGA 1DDNA 4AVPA 4ZYGA 3IC7A 3LSTA 3GYHX 2V1DA 2EFNA 2RGVA 1L0OC 3F6OA 4Z2YA 2RDPA 2ZMEB 4BXUA 3LWFA 4UVAA 1KQ9A 4Y15A 2BYVE 2DLLA 2PFBA 3FHZA 5D6FA 4Q47A 3TGNA 5FGMA 1OR7A 3MFKA 4ENKA 3MZYA 4G9YA 3ZP5A 2FNAA 4RGXA 3BZ6A 4U0WA 5L3EA 2PMHA 2ZNZA 4XBFA 2Y48A 1D8KA 4M6XA 3HRUA 3WTUC 1ZARA 2F5DA 5ILUA 1KA8A 4M71A 2VN2A 4GGGA 3RPQA 1HXDA 5D8LB 1T98A 3ML6A 1D8JA 3MAJA 1ZN2A 1XSDA 2JT1A 3CUOA 2O61A 2M45A 5FFXA 2XAQA 2PQ8A 3F22A 4LLNA 4RAYA 2FA5A 1IF1A 2XIGA 3FMRA 4MQVA 2W24A 2OQGA 5BS6A 4BYYA 3ROUA 4WX9A 5LGTA 1SD4A 2OD5A 1IW7F 4U7BA 3J80Z 1XSXA 2FF4A 5IT9K 3TO6A 5BQTA 2PEXA 3E6MA 3FM5A 2X0LA 1TNTA 6PAXA 1KYWA 3FXQA 2DO7A 3KEQA 3KLOA 3J7AO 4RB0A 3WTXC 4DQ2A 3I4PA 4D0PA 3KP5A 2K86A 4JK1X 1R1VA 1MZBA 4WXHA 1FWZA 4XLNF 1J5YA 2VODA 5ERIA 4RS8A 1UCRA 2E1NA 3FF5A 4FT8A 2QWWA 5F1RA 3Q9SA 2OA4A 3TQNA 4UV8A 2KRFA 5HS8A 4FHTA 4Q4ZF 3TOAA 3RYRA 3WGGA 3K0LA 4WWCA 2Q2EA 1Y0UA 2NNNA 1B9NA 1YS7A 5H6RA 4KIGA 2G9WA 2RV8A 1USTA 4BAYA 4OOIA 1STZA 5HLHA 4S05A 1LVAA 4LK1F 4XSXF 5A2QZ 5BPDA 1QO0D 3DPTA 3WGIA 1F4KA 4P9UA 2VBWA 2IRFG 3ISPA 3ZN1A 2ACJA 1WQ2A 3V7CA 3EYIA 4B09A 2YU3A 4IVNA 4AIHA 5DCMB 3ZMDA 4LD5A 3SHFA 3JTHA 3GF2A 4U0VA 5LRSA 1FLIA 3FX3A 3FM3A 3DQVC 2A68F 2EFWA 3DF8A 4UVBA 3V8KA 2OZ6A 3ULQB 3P9CA 5E1ZB 2XHKA 5AIQA 4WCGA 5EEGA 3VEPA 1SD6A 1K78A 5D8KB 1ZG3A 2F5FA 2P7CB 4CXFA 1LDJA 3LA7A 4O3MA 1J75A 1O7FA 2GA1A 1W5SA 3E5QA 4NB5A 1VTNC 3RDIA 3HRMA 3F6VA 4P5OA 3MZHA 3QOPA 4GYGA 3L2CA 3V7RA 3ABTA 2VC0A 2Z99A 2HTJA 1U5TB 3IWZA 3KFWX 1P92A 1R7JA 1DP7P 3PQJA 4I98B 3WU1B 5FFZA 2D45A 5J6XA 1E17A 4EGYA 1KU7A 1H9GA 3JSOA 2FMYA 5AONA 1BJAA 3R61A 4HZFA 3JAMK 2Y0MA 4EM0B 2VBYA 1MD0A 3J80K 2NNYA 2J5PA 1G6NA 2EV6A 1ZRCA 4L0YB 3ZMSA 3KP3A 5LGUA 1MKMA 4WF2A 4KN4X 3ERED 1TW2A 3V7SA 1BIAA 3F8MA 1MJ9A 4LLGF 1RZ4A 5D6EA 5FO5A 2YSRA 1QPMA 1SFUA 2BE5F 4EM1A 5LBQA 2EWNA 2M87A 1LEBA 1J2XA 2XKOA 2GXGA 1L3LA 4AWXB 2ZNYA 1MDMA 3HHGA 4KIBA 1TW3A 1R1TA 3M1EA 4QWQA 2BEOA 4EJVA 4G7HF 1O3RA 3LA3A 1YLFA 2CGPA 1BI0A 2HKXA 1R23A 5CVIA 3RPUA 1Z6RA 3V8LA 2HYGD 3C18A 4OIPF 2PMUA 5BOXA 1Q1HA 2MA3A 1ULYA 3QP5A 4HX7A 2JRTA 3GFLA 3I59A 5L3BA 2F2EA 5A2QK 3U1DA 1SMYF 3N4MA 1LQ1A 4HQMA 1HW1A 2DTRA 1I6XA 3I59B 3T1BA 2LF8A 3K9TA 2V79A 1HW5A 1S7AA 4L9TA 5ICCA 4JQFA 4GYIA 5J8CA 3MQ0A 2CQKA 3ZN0A 1ZGAA 2QLZA 4XRFA 4HV6A 2M5WA 1JE8A 2DQRA 2X4HA 4KT5C 1E2XA 3L7WA 3U2RA 1W4MA 2VE9A 2ETHA 1IXRC 1U78A 1IN8A 4MTEA 4A6EA 5HLIA 2PBIA 2IA2A 3I5UA 1YIOA 3D0SA 3CUQB 3TOBA 3F3XA 3GLXA 2WWYA 5HVQC 2A5YB 5CYVA 2VBZA 5K5RA 1BC8C 1Z9CA 3FMSA 5HDKA 4RB3C 1KU9A 1ON1A 4M9ZA 4XSZF 4HDUA 2JTVA 1B1BA 3C3WA 3HSFA 1W7PD 4DNCA 4A0YA 5E20A 5CVRA 3BDDA 4B8XA 4EM2A 2LSOA 3N97A 1Z05A 4BNCA 5ICEA 2QVOA 3MEXA 1CF7A 1G3WA 2QBYA 1FPQA 3HUGA 2D2WA 2FNPA 5JVTA 1FSEA 4YIIA 1Z91A 1P4XA 2QBYB 4ESBA 1LJ9A 5DV5A 2YX4A 1IN6A 1ONVA 3GZ6A 4IHSA 3BJAA 5JR3A 2MD5A 2GQQA 4I02A 5L3CA 3L9FA 4MHGA 2L4MA 2UZKA 4PZJA 5FD5A 4ZYHA 1GHCA 2XAFA 3SZPA 2DPUA 3KEOA 4R8HA 3E5UA 1GXPA 1USSA 3GUDA 3LFKA 3Q5FA 2DK5A 3EETA 4UV9A 2MC3A 4RGRA 1B6AA 5JHUA 3O3KA 2FBIA 3COAC 2P5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAO A;  2DBB A;  4RGS A;  2AS5 F;  1SMT A;  3ZMT A;  5ICG A;  2RKH A;  2H94 A;  5LHI A;  4WXD A;  4Q5S F;  5H6Q A;  4KA4 A;  1BC7 C;  2PN6 A;  1OMI A;  3C7J A;  4YFN F;  3WTS C;  3TO9 A;  1U2W A;  4U88 A;  3TO7 A;  4ZYE A;  2QQA A;  2H27 A;  4I2O A;  2K4B A;  3KP2 A;  1O7L A;  4L5I A;  2DQL A;  3GEZ A;  1ODD A;  3F21 A;  3M8E A;  2R7D A;  2FSW A;  2GXB A;  2E7X A;  1FBS A;  3VOE A;  4G6Q A;  5LLQ A;  3WU0 A;  4KUM A;  2DT5 A;  1XB4 A;  3QP6 A;  1XMK A;  3KCC A;  4I0A A;  4NHJ A;  1JHH A;  2ZO4 A;  2FU4 A;  1P2F A;  2RN7 A;  2VT3 A;  5H20 A;  4L18 B;  1FOK A;  1R58 A;  1FYL A;  2P4W A;  5DEQ A;  2BV6 A;  1R36 A;  3O2P E;  1T39 A;  2W84 A;  1HKQ A;  4IRH A;  5LEJ A;  3KP7 A;  1KU2 A;  4IRG A;  4G6D A;  1EV7 A;  2P5K A;  5E17 F;  2HOE A;  2HS5 A;  2IPQ X;  3FXR A;  1KQ0 A;  2OZU A;  5LHG A;  1A04 A;  5CJ9 A;  2HQN A;  1ZRE A;  2EV0 A;  4HX4 A;  3JAM Z;  2FBK A;  4OMY A;  3CO6 C;  4L0Z B;  2L4A A;  3I64 A;  3ABU A;  3TDU C;  4N0B A;  5E1X A;  5D5W B;  1FX7 A;  1QNT A;  1FP1 D;  1R5G A;  2L01 A;  1LNW A;  2YR2 A;  5J8F A;  5IT3 A;  4KDP A;  2IA0 A;  5L3F A;  4LG0 A;  3DV8 A;  4MQ9 F;  2VE8 A;  4LMY A;  3C1D A;  4LG0 B;  4UHT A;  3TDZ C;  3WTT C;  1XGS A;  2EA2 A;  4Y13 A;  4GCV A;  3BWG A;  4EJT A;  1K6O A;  1DPR A;  1YW9 A;  2QZ8 A;  1RUN A;  1LDK B;  4XLP F;  3IKV A;  5E8I A;  1BI3 A;  3EUH A;  5K5Q A;  2D1H A;  3MWM A;  1YS6 A;  1NHA A;  5DUI A;  2O8X A;  4EQQ A;  4FX0 A;  2RVC A;  1PP7 U;  3FZV A;  2O6G E;  4RGU A;  1TLH B;  3L00 A;  1K7A A;  1XN7 A;  1LEA A;  1P6R A;  3B73 A;  5DD4 A;  2CYY A;  1TQM A;  2Y75 A;  3I53 A;  1RIO H;  3WE2 A;  4OIN F;  3SQN A;  3KP4 A;  2A61 A;  1IUY A;  3F8C A;  1IRG A;  2MLK A;  1WI9 A;  3CLO A;  3RKY A;  2O03 A;  4CIC A;  2CWE A;  4LB6 B;  1J7K A;  2PI0 A;  4PDK A;  5L3G A;  4LGW A;  3ZQ7 A;  1ZH5 A;  3HSR A;  2FQ3 A;  1HKS A;  1BIB A;  5FB2 A;  3M7G A;  3R60 A;  1U6G A;  2JSC A;  2NAZ A;  2AXL A;  2Z5U A;  3J81 K;  3CTA A;  1CGP A;  3E3V A;  2E7W A;  4R1H A;  5E18 F;  4L9N A;  2A6H F;  2VC1 A;  1K78 B;  3OV8 A;  2H09 A;  2HYF A;  3DFG A;  2Q0O A;  5CVU A;  1YTY A;  1XGO A;  3IHU A;  3HSE A;  2K4J A;  2RNJ A;  1P4A A;  4ASN A;  3W6K B;  5ICF A;  1G3S A;  2ISZ A;  4BHP A;  2KIU A;  3WTV C;  3E5X A;  5TJJ A;  5HLG A;  3HIF A;  2NRA C;  4BQA A;  4HAM A;  4ZZL A;  2LNB A;  4TV7 A;  4LB5 A;  4UVC A;  3U9G A;  3LAJ A;  4OIO F;  4M6Y A;  3I54 A;  1PDN C;  1P4W A;  3F8N A;  4N9I A;  1YG2 A;  1XSV A;  1MGT A;  1SD5 A;  3D5L A;  3PFI A;  3FMQ A;  5D5X B;  4F7Z A;  2XRO A;  3E6B A;  2P6S A;  2V6C A;  4IJA A;  4OIR F;  2V9V A;  1ZLK A;  4HA8 A;  3LAP A;  3DP7 A;  1HST A;  4HQE A;  1R00 A;  2VXZ A;  5ILS A;  1FYM A;  3LA2 A;  5JI6 A;  1H0M A;  4L9J A;  1ZG1 A;  1JXS A;  5AIP A;  2H6B A;  2XAG A;  1HSJ A;  1XDS A;  2UWM A;  3RIR A;  4RAZ A;  1FZP B;  1HW2 A;  3NQO A;  2PLY A;  1O3S A;  3JTG A;  1MDM B;  4E70 A;  2DW4 A;  4HBL A;  3FXU A;  4LJZ F;  2WC2 A;  4IHT A;  2EV5 A;  1C0W A;  4G7Z F;  2K02 A;  3M8F A;  1LB2 A;  1F5T A;  4HYE A;  4CO8 A;  4KN7 X;  1W7P A;  1FYK A;  3WGH A;  1S7O A;  3R4K A;  1D3Y A;  1PP8 F;  5E8G A;  3H92 A;  3M9A A;  1DPU A;  1J59 A;  3NRV A;  1S6L A;  3JSP A;  4MGR A;  2QQB A;  1BM9 A;  2P7V B;  1QZY A;  3GFM A;  4L5J A;  1AWC A;  4CDG A;  3ELK A;  5HS7 A;  4Y17 A;  2CSO A;  1XGN A;  3PQK A;  4HV5 A;  2ISY A;  2ZFW A;  5LHH A;  1YQA A;  3DEU A;  2G7U A;  4I09 A;  3K69 A;  1XCB A;  4OIQ F;  4GXO A;  1QQI A;  2EFP A;  4HW0 A;  1UHM A;  2HEO A;  5F6F A;  3SZT A;  5DDG A;  2GWR A;  2EK5 A;  5K1Y A;  3BPX A;  4KMU X;  2HQR A;  4CHU A;  4HLY A;  1FBQ A;  1B9M A;  3RJP A;  2COM A;  1TNS A;  5D5U B;  1F9N A;  1T2K A;  3K1P A;  3KZZ A;  1UFM A;  3ZMZ A;  2W25 A;  3BY6 A;  4EMS A;  4H0E A;  4KYW A;  2YX7 A;  4KIC A;  4UXN A;  1FY7 A;  2HZT A;  4U0Y A;  1HKT A;  4I7H A;  4P9F A;  4O6J A;  4EGZ A;  1EH8 A;  3QU3 A;  2C6Y A;  4NQW A;  3RYP A;  5HDG A;  4A2U A;  1T0F A;  3HYI A;  3DPL C;  3CO7 C;  4ESJ A;  2DU9 A;  5HOO A;  2FE3 A;  3K1M A;  1CF7 B;  3BRO A;  2HDC A;  3Q9V A;  3GW2 A;  2XRN A;  3QU6 A;  2MBF A;  3QPT A;  3T5X A;  2XUB A;  4M73 A;  4EV0 A;  5BPI A;  2Z9O A;  4R79 A;  1FP2 A;  2RC4 A;  2IP2 A;  4HOB A;  2VBX A;  2IW5 A;  4LLL A;  3GFJ A;  1RI7 A;  4K2E A;  2HR3 A;  3WE3 A;  1ZHF A;  1XMA A;  2CFX A;  2HWV A;  2EFO A;  2IJL A;  2NS0 A;  3SFZ A;  3DXJ F;  5HS9 A;  2A69 F;  4AIK A;  3GZ5 A;  5KK1 A;  4ENJ A;  3MCZ A;  3P9I A;  3KLN A;  5DCF A;  3QAH A;  4IRI A;  5JFR A;  4HF2 A;  4M9S A;  1F1Z A;  1SD7 A;  3GWZ A;  1FC3 A;  2ZME A;  3B02 A;  3ECH A;  1O3Q A;  2XVC A;  1G4D A;  5DYM A;  2MH2 A;  5D4R A;  1TQP A;  1ZRD A;  3G73 A;  4KMF A;  3J81 Z;  2XAS A;  2E1C A;  3RKX A;  4O5V A;  3G3Z A;  2NYX A;  3P7N A;  3RI4 A;  1O3T A;  4G8X A;  2BBY A;  2LDU A;  4P55 A;  3GXO A;  2UXX A;  4A6D A;  1QZZ A;  4LK0 F;  1ZGJ A;  3E97 A;  2FXA A;  1ZRF A;  1R1U A;  2K7L A;  2RQP A;  5DUK A;  2F5E A;  5LEK A;  5BMZ A;  3W6J B;  3BP8 A;  3IWF A;  1RUO A;  3RKW A;  4N9H A;  3TKY A;  4U7D A;  3KE2 A;  4YIF A;  2A07 F;  2KIF A;  4OU0 A;  3SXY A;  2XGX A;  2EJR A;  3VB2 A;  1TTY A;  3T8T A;  1ON2 A;  2XAJ A;  3IRR A;  1OYW A;  3O6B B;  2ESH A;  1V4R A;  4S04 A;  2ZXJ A;  3BPV A;  2IT0 A;  1LDD A;  2ZKZ A;  4ON0 A;  3H3Z A;  2HKO A;  2QM3 A;  3R6S A;  3EDP A;  1YW7 A;  3EQL F;  3I71 A;  1U5T C;  4MTD A;  1BI1 A;  4EJW A;  4YG2 F;  2OBP A;  1GXQ A;  4WXC A;  1K79 A;  2ESN A;  1I1G A;  2VOP A;  3HTS B;  1Z7U A;  2YPR A;  2M8E A;  1WKM A;  3F8B A;  2GZW A;  1EH6 A;  2QQ9 A;  4A0Z A;  1BBY A;  4RB1 A;  4ZYD A;  1SFX A;  3VFZ A;  1G3T A;  5TRD A;  5FLX K;  2JPB A;  3QRF F;  4UNO A;  2G7H A;  3HHH A;  3KET A;  3GX4 X;  3EYY A;  4G94 A;  1XCV A;  2Z3Y A;  1KYZ A;  3H3U A;  2OAZ A;  1AOY A;  3VOD A;  2A6E F;  2ADU A;  2PJP A;  1T6S A;  3GVA A;  3NEU A;  2VT2 A;  2P6T A;  1XD7 A;  1S29 A;  1IRF A;  2CG4 A;  2MLG A;  4L9V A;  2XV4 S;  3AAF A;  2ELH A;  1YW8 A;  4A5N A;  1BI2 A;  2OQR A;  3RTR A;  3WTY C;  1UHW A;  4BH9 A;  1QGP A;  2F5C A;  2MH9 A;  5DCM A;  1V3F A;  2A3S A;  2UXN A;  3BJO A;  3IRQ A;  4A12 A;  3F8F A;  3ZMU A;  1HQC A;  4PGH A;  4ENN A;  4KIF A;  3T0Y A;  2W57 A;  1WWX A;  1JHF A;  2JPC A;  3FWE A;  5D5V B;  2EA4 A;  1SAX A;  5CVJ A;  3ZPL A;  1ZG5 A;  4I0B A;  4CGZ A;  5ED4 A;  2QEN A;  5FD6 A;  1B4A A;  2L3D A;  2H6C A;  1BN5 A;  1IN7 A;  4ENM A;  1KU3 A;  2P5V A;  5K5O A;  3HRT A;  1U5T A;  1G3Y A;  3IL2 A;  3OOP A;  4Q48 A;  4KNY A;  2EFQ A;  5CVV A;  3HOS A;  2LF7 A;  3CDH A;  1KQ8 A;  4JBA A;  3CUQ C;  1IN5 A;  2K27 A;  4MEX F;  1IAW A;  4IXA A;  1I5Z A;  2O3F A;  1ZAO A;  1Z1D A;  1KGS A;  1IN4 A;  4PCQ A;  2L54 A;  1S3J A;  2QUF A;  1IXC A;  2WV0 A;  3KP6 A;  2W85 A;  2JZY A;  2GAU A;  3F72 A;  2QYO A;  4AIJ A;  1IXS B;  2HGC A;  2HFH A;  2L02 A;  2KKO A;  3S2W A;  3CJN A;  4AD9 A;  3R0J A;  4CYD A;  4M74 A;  3F23 A;  2B0L A;  2VON A;  2ZJ2 A;  4EVI A;  2IA1 A;  4BHB A;  4YFK F;  5EEH A;  2DFI A;  1YYV A;  4EJU A;  4IPA A;  2Q8K A;  1OKR A;  2FRH A;  1BOA A;  1T38 A;  1RNL A;  1HBX G;  1OPC A;  1UB9 A;  2FML A;  1S8N A;  2XKP A;  1YO5 C;  1U8R A;  4QLC U;  4P96 A;  4UUV A;  3LQR A;  2V1X A;  1ZYR F;  4GO1 A;  1FT9 A;  5LRR A;  2CW0 F;  2KJB A;  5HDN A;  1U3E M;  5L3D A;  4HLX A;  4BHC A;  4HF0 A;  1IZ1 A;  4ETS A;  2BGC A;  3GO5 A;  1MJA A;  4HDV A;  1W7P B;  1PUE E;  1OYI A;  1QBJ A;  4M9X A;  1D5V A;  2FEZ A;  3L09 A;  2TDX A;  3HOT A;  2GIV A;  1JGS A;  2R7F A;  3WTW C;  2CO5 A;  4YFX F;  1B59 A;  3BOQ A;  1XGM A;  1Z6T A;  1DUX C;  3JW4 A;  1ZLJ A;  2HTS A;  3DKW A;  2D1V A;  1H9T A;  2DI3 A;  4CZZ A;  3E6D A;  1MJB A;  3BJ6 A;  3T8R A;  2STT A;  3V8J A;  2PG4 A;  3I0T A;  3REO A;  5ILV A;  3K2Z A;  3R0A A;  2FOK A;  1W5T A;  4WK8 F;  3HRS A;  5LGN A;  2IVM A;  1GVJ A;  4G7O F;  2M30 A;  3CUQ A;  5DD8 A;  2ZBK A;  2STW A;  4HF1 A;  2XAH A;  1J0R A;  3WOD F;  1X3U A;  2Z33 A;  2ZCW A;  2DPD A;  3IKT A;  1FNN A;  4MNU A;  2EB7 A;  1R5H A;  1FSH A;  3WG9 A;  2J5O A;  4HX8 A;  2FBH A;  2KJC A;  1TQI A;  4ZH4 F;  2P8T A;  5F64 A;  2O0Y A;  5KVR A;  1SFE A;  4ESF A;  3QPH A;  4EJO A;  4OMZ A;  3K1N A;  1I1S A;  3HTU A;  4ZZD A;  4I01 A;  5CLS A;  5IT9 Z;  3V4G A;  1XDU A;  2V1U A;  1J9I A;  2GA2 A;  5D4S A;  1TBX A;  3P9K A;  1REP C;  1FBU A;  4M72 A;  5FLX Z;  2VOO A;  1OYY A;  4RB2 C;  3ECO A;  4A0X A;  2LKP A;  4FX4 A;  1I27 A;  1EH7 A;  4IF4 A;  2OU2 A;  4MEY F;  3WTZ A;  2DK8 A;  2M1B A;  3KZY A;  4KFC A;  3GFI A;  2R3S A;  1WSU A;  1WRJ A;  5E1W A;  3ZMV A;  2WTE A;  2KIM A;  1O57 A;  3I58 A;  1R22 A;  3LQQ A;  4A5M A;  4LFU A;  1YFH A;  3E6C C;  4PGG A;  1DDN A;  4AVP A;  4ZYG A;  3IC7 A;  3LST A;  3GYH X;  2V1D A;  2EFN A;  2RGV A;  1L0O C;  3F6O A;  4Z2Y A;  2RDP A;  2ZME B;  4BXU A;  3LWF A;  4UVA A;  1KQ9 A;  4Y15 A;  2BYV E;  2DLL A;  2PFB A;  3FHZ A;  5D6F A;  4Q47 A;  3TGN A;  5FGM A;  1OR7 A;  3MFK A;  4ENK A;  3MZY A;  4G9Y A;  3ZP5 A;  2FNA A;  4RGX A;  3BZ6 A;  4U0W A;  5L3E A;  2PMH A;  2ZNZ A;  4XBF A;  2Y48 A;  1D8K A;  4M6X A;  3HRU A;  3WTU C;  1ZAR A;  2F5D A;  5ILU A;  1KA8 A;  4M71 A;  2VN2 A;  4GGG A;  3RPQ A;  1HXD A;  5D8L B;  1T98 A;  3ML6 A;  1D8J A;  3MAJ A;  1ZN2 A;  1XSD A;  2JT1 A;  3CUO A;  2O61 A;  2M45 A;  5FFX A;  2XAQ A;  2PQ8 A;  3F22 A;  4LLN A;  4RAY A;  2FA5 A;  1IF1 A;  2XIG A;  3FMR A;  4MQV A;  2W24 A;  2OQG A;  5BS6 A;  4BYY A;  3ROU A;  4WX9 A;  5LGT A;  1SD4 A;  2OD5 A;  1IW7 F;  4U7B A;  3J80 Z;  1XSX A;  2FF4 A;  5IT9 K;  3TO6 A;  5BQT A;  2PEX A;  3E6M A;  3FM5 A;  2X0L A;  1TNT A;  6PAX A;  1KYW A;  3FXQ A;  2DO7 A;  3KEQ A;  3KLO A;  3J7A O;  4RB0 A;  3WTX C;  4DQ2 A;  3I4P A;  4D0P A;  3KP5 A;  2K86 A;  4JK1 X;  1R1V A;  1MZB A;  4WXH A;  1FWZ A;  4XLN F;  1J5Y A;  2VOD A;  5ERI A;  4RS8 A;  1UCR A;  2E1N A;  3FF5 A;  4FT8 A;  2QWW A;  5F1R A;  3Q9S A;  2OA4 A;  3TQN A;  4UV8 A;  2KRF A;  5HS8 A;  4FHT A;  4Q4Z F;  3TOA A;  3RYR A;  3WGG A;  3K0L A;  4WWC A;  2Q2E A;  1Y0U A;  2NNN A;  1B9N A;  1YS7 A;  5H6R A;  4KIG A;  2G9W A;  2RV8 A;  1UST A;  4BAY A;  4OOI A;  1STZ A;  5HLH A;  4S05 A;  1LVA A;  4LK1 F;  4XSX F;  5A2Q Z;  5BPD A;  1QO0 D;  3DPT A;  3WGI A;  1F4K A;  4P9U A;  2VBW A;  2IRF G;  3ISP A;  3ZN1 A;  2ACJ A;  1WQ2 A;  3V7C A;  3EYI A;  4B09 A;  2YU3 A;  4IVN A;  4AIH A;  5DCM B;  3ZMD A;  4LD5 A;  3SHF A;  3JTH A;  3GF2 A;  4U0V A;  5LRS A;  1FLI A;  3FX3 A;  3FM3 A;  3DQV C;  2A68 F;  2EFW A;  3DF8 A;  4UVB A;  3V8K A;  2OZ6 A;  3ULQ B;  3P9C A;  5E1Z B;  2XHK A;  5AIQ A;  4WCG A;  5EEG A;  3VEP A;  1SD6 A;  1K78 A;  5D8K B;  1ZG3 A;  2F5F A;  2P7C B;  4CXF A;  1LDJ A;  3LA7 A;  4O3M A;  1J75 A;  1O7F A;  2GA1 A;  1W5S A;  3E5Q A;  4NB5 A;  1VTN C;  3RDI A;  3HRM A;  3F6V A;  4P5O A;  3MZH A;  3QOP A;  4GYG A;  3L2C A;  3V7R A;  3ABT A;  2VC0 A;  2Z99 A;  2HTJ A;  1U5T B;  3IWZ A;  3KFW X;  1P92 A;  1R7J A;  1DP7 P;  3PQJ A;  4I98 B;  3WU1 B;  5FFZ A;  2D45 A;  5J6X A;  1E17 A;  4EGY A;  1KU7 A;  1H9G A;  3JSO A;  2FMY A;  5AON A;  1BJA A;  3R61 A;  4HZF A;  3JAM K;  2Y0M A;  4EM0 B;  2VBY A;  1MD0 A;  3J80 K;  2NNY A;  2J5P A;  1G6N A;  2EV6 A;  1ZRC A;  4L0Y B;  3ZMS A;  3KP3 A;  5LGU A;  1MKM A;  4WF2 A;  4KN4 X;  3ERE D;  1TW2 A;  3V7S A;  1BIA A;  3F8M A;  1MJ9 A;  4LLG F;  1RZ4 A;  5D6E A;  5FO5 A;  2YSR A;  1QPM A;  1SFU A;  2BE5 F;  4EM1 A;  5LBQ A;  2EWN A;  2M87 A;  1LEB A;  1J2X A;  2XKO A;  2GXG A;  1L3L A;  4AWX B;  2ZNY A;  1MDM A;  3HHG A;  4KIB A;  1TW3 A;  1R1T A;  3M1E A;  4QWQ A;  2BEO A;  4EJV A;  4G7H F;  1O3R A;  3LA3 A;  1YLF A;  2CGP A;  1BI0 A;  2HKX A;  1R23 A;  5CVI A;  3RPU A;  1Z6R A;  3V8L A;  2HYG D;  3C18 A;  4OIP F;  2PMU A;  5BOX A;  1Q1H A;  2MA3 A;  1ULY A;  3QP5 A;  4HX7 A;  2JRT A;  3GFL A;  3I59 A;  5L3B A;  2F2E A;  5A2Q K;  3U1D A;  1SMY F;  3N4M A;  1LQ1 A;  4HQM A;  1HW1 A;  2DTR A;  1I6X A;  3I59 B;  3T1B A;  2LF8 A;  3K9T A;  2V79 A;  1HW5 A;  1S7A A;  4L9T A;  5ICC A;  4JQF A;  4GYI A;  5J8C A;  3MQ0 A;  2CQK A;  3ZN0 A;  1ZGA A;  2QLZ A;  4XRF A;  4HV6 A;  2M5W A;  1JE8 A;  2DQR A;  2X4H A;  4KT5 C;  1E2X A;  3L7W A;  3U2R A;  1W4M A;  2VE9 A;  2ETH A;  1IXR C;  1U78 A;  1IN8 A;  4MTE A;  4A6E A;  5HLI A;  2PBI A;  2IA2 A;  3I5U A;  1YIO A;  3D0S A;  3CUQ B;  3TOB A;  3F3X A;  3GLX A;  2WWY A;  5HVQ C;  2A5Y B;  5CYV A;  2VBZ A;  5K5R A;  1BC8 C;  1Z9C A;  3FMS A;  5HDK A;  4RB3 C;  1KU9 A;  1ON1 A;  4M9Z A;  4XSZ F;  4HDU A;  2JTV A;  1B1B A;  3C3W A;  3HSF A;  1W7P D;  4DNC A;  4A0Y A;  5E20 A;  5CVR A;  3BDD A;  4B8X A;  4EM2 A;  2LSO A;  3N97 A;  1Z05 A;  4BNC A;  5ICE A;  2QVO A;  3MEX A;  1CF7 A;  1G3W A;  2QBY A;  1FPQ A;  3HUG A;  2D2W A;  2FNP A;  5JVT A;  1FSE A;  4YII A;  1Z91 A;  1P4X A;  2QBY B;  4ESB A;  1LJ9 A;  5DV5 A;  2YX4 A;  1IN6 A;  1ONV A;  3GZ6 A;  4IHS A;  3BJA A;  5JR3 A;  2MD5 A;  2GQQ A;  4I02 A;  5L3C A;  3L9F A;  4MHG A;  2L4M A;  2UZK A;  4PZJ A;  5FD5 A;  4ZYH A;  1GHC A;  2XAF A;  3SZP A;  2DPU A;  3KEO A;  4R8H A;  3E5U A;  1GXP A;  1USS A;  3GUD A;  3LFK A;  3Q5F A;  2DK5 A;  3EET A;  4UV9 A;  2MC3 A;  4RGR A;  1B6A A;  5JHU A;  3O3K A;  2FBI A;  3COA C;  2P5L C; 
#chains in the Genus database with same CATH topology
 4LIV A;  2DAO A;  2DBB A;  5GPC A;  4BBR J;  4RGS A;  2AS5 F;  2CFO A;  2CUF A;  3AL0 C;  2KZV A;  1FMW A;  1SMT A;  4W1U A;  3ZMT A;  4PJ0 C;  5ICG A;  2RKH A;  2WY7 Q;  3M3Y J;  2H94 A;  3EUH C;  1A35 A;  5IP7 J;  5LHI A;  2LY2 A;  2Y69 H;  3TP3 A;  1R49 A;  4WXD A;  1V54 H;  5M3M J;  4Q5S F;  5H6Q A;  1SVO A;  1QHH D;  4KA4 A;  4UY8 I;  1BC7 C;  2PN6 A;  1OMI A;  3C7J A;  4YFN F;  3WTS C;  4XRM A;  3TO9 A;  1U2W A;  2WAQ A;  3AG3 H;  4U88 A;  2CJJ A;  3QOD A;  1JKQ C;  4CA0 A;  3TO7 A;  4ZYE A;  2QQA A;  2KIS A;  3HEF A;  2H27 A;  4BEH B;  2TCT A;  4I2O A;  4RBO A;  2K4B A;  3KP2 A;  4PFP A;  1O7L A;  4ZTJ A;  4L5I A;  2H8W A;  2DQL A;  3GEZ A;  1MBG A;  1ODD A;  4NDL A;  3JRE A;  3F21 A;  4XMY A;  2JA5 J;  3M8E A;  4XLE A;  1FIP A;  2R7D A;  2FSW A;  4V2G A;  2GXB A;  2R0Q C;  2E7X A;  1FBS A;  2FX0 A;  1E3P A;  4CZC A;  1A6Q A;  5FJ8 J;  2M4K A;  3VOE A;  1JKP C;  4G6Q A;  3FXJ A;  1OFC X;  5LLQ A;  3SZG A;  3OYC A;  3WU0 A;  2GXA A;  4E7S A;  1SC7 A;  3PJR A;  4KUM A;  2DT5 A;  2LBF B;  5TGT A;  2F4I A;  3BR3 A;  1XB4 A;  3QP6 A;  4JX5 A;  1XMK A;  3KCC A;  4IQ4 A;  4IQJ A;  2LVS A;  4I0A A;  4NHJ A;  1V5E A;  1MNE A;  2QEX I;  3I55 I;  1JHH A;  2ZO4 A;  3FIW A;  4LG3 A;  2FU4 A;  1P2F A;  2RN7 A;  2VT3 A;  3FBN B;  4XK4 A;  5H20 A;  3VSL A;  4L18 B;  1FOK A;  1R58 A;  1FYL A;  2OV7 A;  2P4W A;  5DEQ A;  2BV6 A;  1R36 A;  4BL0 B;  3O2P E;  1T39 A;  2W84 A;  1QZE A;  1HKQ A;  4H4K C;  4IRH A;  5LEJ A;  3KP7 A;  2W48 A;  1KU2 A;  4IRG A;  4G6D A;  2HI3 A;  2CQ7 A;  1EV7 A;  3U21 A;  2P5K A;  5E17 F;  2HOE A;  2HS5 A;  2IPQ X;  3FXR A;  1KQ0 A;  2OZU A;  5LHG A;  1A04 A;  5CJ9 A;  1IO2 A;  3CJR B;  2HQN A;  3GTK J;  1JGG A;  3C2G A;  5HNF A;  1ZRE A;  2EV0 A;  4HX4 A;  5F0C A;  1NTC A;  2FBK A;  3JAM Z;  3CO6 C;  4OMY A;  4ABZ A;  4L0Z B;  2L4A A;  2OTL I;  3I64 A;  1QVT A;  5F0F A;  3HJE A;  1VI0 A;  2O7O A;  3ABU A;  1E3H A;  3FDY A;  4HPQ A;  1ZTR A;  3TDU C;  4N0B A;  5E1X A;  5D5W B;  1FX7 A;  5HLT A;  1QNT A;  1FP1 D;  1R5G A;  2CH0 A;  2L01 A;  1LNW A;  3CCJ I;  2KPM A;  2YR2 A;  5J8F A;  5IT3 A;  4KDP A;  2R7T A;  2IA0 A;  5L3F A;  1TC3 C;  3BG3 A;  4LG0 A;  4MFE A;  1RC9 A;  5FKN A;  2XGC A;  3BG9 A;  2HOT A;  2GIZ A;  3DV8 A;  3N05 A;  4MQ9 F;  2VE8 A;  1JUP A;  4LMY A;  3I56 I;  3OOU A;  3C1D A;  3HOW J;  4DJA A;  1UG0 A;  4LG0 B;  4XLA A;  4UHT A;  3TDZ C;  3MZ8 A;  3WTT C;  2RAE A;  3ZQL A;  2KDO A;  1XGS A;  2EA2 A;  4Y13 A;  4GCV A;  3BWG A;  4EJT A;  3I4N J;  1K6O A;  3HBL A;  1D5Y A;  4D9J A;  4I6Z A;  1DPR A;  2CV2 A;  4XKW A;  1YW9 A;  1MMS A;  2QZ8 A;  1RUN A;  1LDK B;  2NS7 A;  4I99 C;  4E7H A;  2DOA A;  4XLP F;  2LP0 A;  4X0G A;  3IKV A;  5E8I A;  1BI3 A;  3EUH A;  3SEQ A;  1TWC J;  5K5Q A;  2DMU A;  2D1H A;  3MWM A;  4A3G J;  1XTA A;  1YS6 A;  1NHA A;  3L2U A;  3S93 A;  5DUI A;  2O8X A;  3IH2 A;  3DU5 A;  4EQQ A;  1MMD A;  2LKS A;  4FX0 A;  5J47 A;  2RVC A;  1PP7 U;  3FZV A;  1TWH J;  1HDD C;  3O8H A;  4B3X A;  2O6G E;  4RGU A;  1TLH B;  1WJB A;  3CC7 I;  1Y0N A;  3L00 A;  2Q2E B;  1K7A A;  4UUS B;  3P5J A;  1XN7 A;  1LEA A;  1P6R A;  4Y4R A;  1PUF A;  3B73 A;  5DD4 A;  2CYY A;  1TQM A;  2Y75 A;  3I53 A;  1RIO H;  2UV1 A;  2CV0 A;  2KFD A;  2GOM A;  5F08 A;  3WE2 A;  4OIN F;  3SQN A;  1JT0 A;  3KP4 A;  2A61 A;  2HXI A;  1IGN A;  1IUY A;  3F8C A;  3HB9 A;  1IRG A;  1MH4 A;  3FXK A;  2YU9 J;  3PO3 J;  3DEW A;  1R6R A;  4XRS A;  2MD0 A;  3LSI A;  2V4J C;  2MLK A;  2ECC A;  4HG2 A;  1V55 H;  4XLF A;  1WI9 A;  5EG0 A;  3CLO A;  1WJ5 A;  3RKY A;  3BT9 A;  3CMM A;  1OCO H;  2O03 A;  2BVL A;  4CIC A;  2CWE A;  4LB6 B;  3NWT A;  4FCY A;  2E36 A;  1J7K A;  2PI0 A;  3HKZ A;  5IYB J;  4HNT A;  3NAU A;  4PDK A;  1I39 A;  1K4S A;  2PJR A;  5L3G A;  2A05 A;  2JWT A;  4LGW A;  3ZQ7 A;  1ZH5 A;  4E7Z A;  3HSR A;  2FQ3 A;  1HKS A;  1BIB A;  5FB2 A;  3M7G A;  1PYV A;  1FOW A;  2E71 A;  2IAI A;  3K2A A;  3R60 A;  1U6G A;  4V19 K;  2RQQ A;  2JSC A;  2NAZ A;  2AXL A;  2Z5U A;  3J81 K;  3CTA A;  1CGP A;  3E3V A;  2E7W A;  4R1H A;  5E18 F;  3QYF A;  2MYS A;  4L9N A;  2A6H F;  4PK4 A;  3M07 A;  2VC1 A;  1K78 B;  3OV8 A;  4BAC A;  2H09 A;  4PUS A;  2HYF A;  4BE0 A;  4BBS J;  3DFG A;  2Q0O A;  5CVU A;  3E0J B;  1YTY A;  2KDZ A;  2V9P A;  1Y56 A;  1XGO A;  3IHU A;  4IX7 A;  3HSE A;  2QQ8 A;  2K4J A;  2RNJ A;  1P4A A;  3FKI J;  3PO2 J;  2V26 A;  4ASN A;  3W6K B;  5ICF A;  1I50 J;  1G3S A;  2ISZ A;  3HGY A;  1SFK A;  1WFX A;  2LYC A;  4BHP A;  2KIU A;  3ABM H;  3PL8 A;  3WTV C;  3E5X A;  2DFE A;  1VQP I;  5TJJ A;  5HLG A;  3HIF A;  3MKL A;  4J01 A;  2NRA C;  4BQA A;  4HAM A;  4B3A A;  4ZZL A;  4BQO A;  1OCT C;  2DYR H;  2F4O B;  2LNB A;  4TV7 A;  4LB5 A;  3GLL A;  2OF7 A;  4UVC A;  3U9G A;  3LAJ A;  2EIM H;  4OIO F;  4JOM A;  2JQ7 A;  3ERM A;  3I54 A;  4M6Y A;  4IEJ A;  4IHX A;  1PDN C;  1P4W A;  1SEU A;  2QKM B;  3F8N A;  4N9I A;  1YG2 A;  3GBG A;  1XSV A;  1MGT A;  1SD5 A;  3D5L A;  1A5J A;  1X1A A;  1WJA A;  2GOX B;  1N77 A;  3PFI A;  3GME A;  2EZI A;  3FMQ A;  2XPW A;  2QKL B;  5D5X B;  4F7Z A;  3AKZ A;  2XRO A;  1W5C C;  3E6B A;  2P6S A;  2V6C A;  4DZJ A;  1JJ8 C;  4IJA A;  4OIR F;  3A03 A;  2V9V A;  5DM6 F;  4BJT A;  3OYH A;  1ZLK A;  3H3V K;  2FD5 A;  4B47 A;  4HA8 A;  3LAP A;  3DP7 A;  1HST A;  4HQE A;  1T0F C;  5J3L A;  2ID3 A;  3BR5 A;  1R00 A;  2DA4 A;  1IV8 A;  3D5R C;  2VXZ A;  5ILS A;  2O5R A;  3E1S A;  1FYM A;  2MFZ A;  2D5V A;  3LA2 A;  2A6T A;  5JI6 A;  4NBQ A;  1X1B A;  1H0M A;  3PNV A;  1MIJ A;  4L9J A;  4A3I J;  5E3O A;  1ZG1 A;  4CYC A;  1Z7L A;  4AYB N;  5AIP A;  4X6A J;  1JXS A;  2H6B A;  2DT6 A;  2XAG A;  3D5S C;  1HSJ A;  2BXZ A;  3PNT A;  2R5Z B;  1XDS A;  2UWM A;  3BTJ A;  3RIR A;  4RAZ A;  1FZP B;  5F04 A;  1B8I A;  1HW2 A;  1Y6I A;  3S2H J;  2XF6 A;  2NVT J;  2W82 A;  3NQO A;  3W2W A;  2PLY A;  3MMY B;  1O3S A;  3G71 I;  3MD2 A;  3JTG A;  2JK3 A;  1MDM B;  4E70 A;  2DW4 A;  4HBL A;  3FXU A;  4LJZ F;  3QWL A;  2WC2 A;  3ESW B;  1VFC A;  3HZJ A;  2CU7 A;  2OTJ I;  2F48 A;  4IHT A;  3DBH B;  2EV5 A;  1C0W A;  4G7Z F;  1OCR H;  2XGE A;  2K02 A;  2JA2 A;  3M8F A;  1LB2 A;  1F5T A;  4HYE A;  4CO8 A;  2CQN A;  3DEE A;  4KN7 X;  2JA7 J;  1W7P A;  1FYK A;  2E1M B;  3WGH A;  2V7F A;  1S7O A;  2XSJ C;  1H88 C;  2L7F P;  3R4K A;  1D3Y A;  1UMQ A;  1PP8 F;  3OIQ A;  4DIQ A;  5E8G A;  3H92 A;  2Y9Z A;  1T8I A;  3M9A A;  1DPU A;  1J59 A;  4XRS G;  3NRV A;  5KAI C;  1F36 A;  5CQG A;  3SJM A;  1S6L A;  3VYR B;  2R4G A;  4MGR A;  2QQB A;  3QQA A;  4V2F A;  3JSP A;  2DOF A;  2EIN H;  1BM9 A;  2FQ4 A;  2P7V B;  1EJ9 A;  1FEX A;  1VQ6 I;  4AC0 A;  4DZP A;  2BHZ A;  1QZY A;  3GFM A;  2MW8 A;  3BCB A;  2W4S A;  4L5J A;  1UEL B;  1AWC A;  4CDG A;  2M7B A;  3C2B A;  5DTD A;  3GTJ J;  3L2R A;  2LG4 A;  2CUJ A;  2ZME C;  3B6C A;  4YIR X;  2XB0 X;  4Y7N J;  1UAA A;  3VYS B;  1TP4 A;  1XC5 A;  1GUU A;  3ELK A;  5HS7 A;  4BJ6 C;  2XRL A;  4CH7 A;  4Y17 A;  2CSO A;  2R7W A;  1XGN A;  1MH3 A;  1GV5 A;  3PQK A;  4HV5 A;  2ISY A;  2ZFW A;  4C30 A;  2M0M A;  3JRI A;  5LHH A;  1YQA A;  3DEU A;  2G7U A;  4I09 A;  1YRN A;  4YEJ A;  3ZR8 X;  3IH4 A;  3K69 A;  2CMP A;  1FMV A;  1XCB A;  4OIQ F;  1OR7 C;  4GXO A;  1QQI A;  2EFP A;  1BR4 A;  4HW0 A;  1UHM A;  2HEO A;  3HG9 A;  5F6F A;  3SZT A;  5DDG A;  2QA4 I;  2GWR A;  2EK5 A;  4NUB A;  5K1Y A;  2PMZ A;  1OIS A;  3BPX A;  1R4N B;  4KMU X;  1VND A;  3JRG A;  2HQR A;  4CHU A;  4HLY A;  2E60 A;  1FBQ A;  1B9M A;  3RJP A;  2COM A;  5JVG F;  4JX6 A;  1TNS A;  5D5U B;  3JRC A;  1F9N A;  1T2K A;  2KZG A;  1ETV A;  3OY9 A;  3A01 B;  3DBL B;  3K1P A;  3KZZ A;  1UFM A;  2FUG 2;  3ZMZ A;  2W25 A;  3BY6 A;  4EMS A;  4H0E A;  4KYW A;  2YX7 A;  2RNG A;  3LSG A;  4KIC A;  2EZH A;  4ZTF A;  4UXN A;  1FY7 A;  2HZT A;  4U0Y A;  1HKT A;  4I7H A;  1OQY A;  1K6Y A;  1RES A;  3EUK L;  4N4N B;  4P9F A;  4ZJZ A;  4O6J A;  3CZ6 A;  5B5E C;  1EH8 A;  4EGZ A;  3BR2 A;  1GLN A;  3QU3 A;  2C6Y A;  2VI6 A;  4BDZ A;  3Q0V A;  4NQW A;  1R71 A;  3RYP A;  5HDG A;  2VQH A;  3VYT B;  4A2U A;  1NH3 A;  4XR6 A;  1T0F A;  3HYI A;  3S1N J;  3DPL C;  3CO7 C;  4ESJ A;  2DU9 A;  2X1D A;  5HOO A;  2FE3 A;  3OL3 A;  3K1M A;  4EEF G;  1CF7 B;  4C2T A;  3CQZ J;  3BRO A;  2DMQ A;  3H9J A;  2F6C A;  3HUG B;  4IHW A;  2HDC A;  1XG1 A;  3DLA A;  3Q9V A;  3IV5 A;  3GW2 A;  2VQC A;  2XPV A;  3PFY A;  2XRN A;  3QU6 A;  4A3F J;  1ZR2 A;  4D7N A;  2MBF A;  3QPT A;  3T5X A;  2HQA A;  3SEZ A;  2M34 A;  2XUB A;  5C4J J;  4PJJ A;  4M73 A;  4YRV A;  4QTR A;  4EV0 A;  5BPI A;  5M5Y J;  2LOO A;  4R79 A;  2Z9O A;  2DMP A;  3ZQQ A;  1FP2 A;  2RC4 A;  2IP2 A;  3DKX A;  3AG2 H;  4HOB A;  2B9S A;  2VBX A;  3S2D J;  1SAU A;  2IW5 A;  1Q1V A;  1I3A A;  4LLL A;  3GFJ A;  2XSD C;  4PJL A;  1RI7 A;  4K2E A;  1Y1W J;  2X51 A;  1X2N A;  2HR3 A;  3WE3 A;  1ZHF A;  3ZQC A;  1DP3 A;  1XMA A;  2CFX A;  3BG6 A;  2HWV A;  2EFO A;  2IJL A;  2NS0 A;  3SFZ A;  3DXJ F;  5HS9 A;  2HYJ A;  2A69 F;  1ETO A;  2CRG A;  2ELK A;  4AIK A;  2L9R A;  4NC8 A;  3GZ5 A;  5KK1 A;  4ENJ A;  3MCZ A;  3K7A J;  4E7I A;  3P9I A;  3OIO A;  3GTQ J;  3KLN A;  5DCF A;  3K70 D;  2DJI A;  2L9N A;  4LIU A;  3QAH A;  4IRI A;  5JFR A;  3K4K A;  4HF2 A;  1T08 B;  4M9S A;  2IGO A;  5GP9 A;  1F1Z A;  1SD7 A;  2MC4 A;  1S72 I;  2W00 A;  3GWZ A;  5J1U A;  1FC3 A;  2XF7 A;  1Z3X A;  2ZME A;  3B02 A;  3BQZ A;  3ECH A;  3K4J A;  1O3Q A;  2XVC A;  5LFA A;  1G4D A;  1EA3 A;  3ZQH A;  2XAU A;  3TBI A;  5HOD A;  5DYM A;  3PIP F;  2OCE A;  2MH2 A;  3M4O J;  2VKV A;  5D4R A;  1X1C A;  3A1Y A;  4HRI A;  1TQP A;  4F52 A;  1ZRD A;  2YUS A;  3G73 A;  4KMF A;  3J81 Z;  2XAS A;  2E1C A;  3RKX A;  2O8K A;  4O5V A;  3G3Z A;  2NYX A;  3P7N A;  3RI4 A;  1O3T A;  2JA6 J;  2KRC A;  2VIX A;  4G8X A;  2BBY A;  2LDU A;  2VJI A;  4NC7 A;  5H2F C;  4BQN A;  3DTE A;  4P55 A;  1BW5 A;  4CCO A;  2E19 A;  3GXO A;  3OL4 A;  2UXX A;  2X6X A;  3KEY A;  4A6D A;  1QZZ A;  1G2H A;  4BGD A;  5KHD A;  4P1W A;  4LK0 F;  1ZGJ A;  3E97 A;  2FXA A;  1ZRF A;  1R1U A;  2K7L A;  2RQP A;  3HXL A;  2F5E A;  5DUK A;  5J4V A;  5LEK A;  4J00 A;  3OYD A;  3W6J B;  5BMZ A;  2R7O A;  3BP8 A;  5EDN A;  3IWF A;  1RUO A;  2OCC H;  3RKW A;  4N9H A;  3TKY A;  2V9K A;  4U7D A;  2WY8 Q;  5BNG A;  3KE2 A;  4YIF A;  9ANT A;  2A07 F;  3K4C A;  2K9Q A;  2KIF A;  2LLK A;  2AHQ A;  4OU0 A;  3SXY A;  2XGX A;  2EJR A;  4A69 C;  3VB2 A;  1TTY A;  3T8T A;  3CD6 I;  2GLO A;  3BTL A;  1ON2 A;  2XAJ A;  3DWL E;  2MAB A;  3OYM A;  5E3M A;  4AUX A;  3IRR A;  1YIJ I;  1OYW A;  3VWB A;  3O6B B;  5FKL A;  2ESH A;  3CCE I;  1V4R A;  3DTI A;  4S04 A;  4HST A;  3L2W A;  2ZXJ A;  3BPV A;  4OWR B;  2IT0 A;  1LDD A;  2ZKZ A;  4ON0 A;  1HLV A;  2ZJR F;  2OJE D;  2XGD A;  3H3Z A;  2HKO A;  2QM3 A;  1K61 A;  3R6S A;  4CCM A;  3EDP A;  1YW7 A;  3EQL F;  2Z1D A;  2EBI A;  3I71 A;  4M3F A;  1U5T C;  4MTD A;  4S0H B;  1BI1 A;  4IO9 F;  4CCN A;  4EJW A;  4MLO A;  4YG2 F;  1QU3 A;  1Z21 A;  2OBP A;  1SAN A;  2R93 J;  1GXQ A;  4WXC A;  2K9L A;  1K79 A;  2R7S A;  3OS2 A;  2ESN A;  1I1G A;  5IOY A;  2VOP A;  3GZN B;  3JRH A;  2DA5 A;  2ME0 A;  3HTS B;  5FKO A;  4DYQ A;  1Z7U A;  2YPR A;  2M8E A;  3BTI A;  3K4M A;  4C3J J;  1GDT A;  1WKM A;  3F8B A;  1N25 A;  3F0C A;  1IG7 A;  4C3H J;  2GZW A;  4Y33 A;  3BQY A;  4M3E A;  3TED A;  1EH6 A;  2Z2S B;  2ZJP F;  2KHM A;  1CQT A;  2Y0S A;  1FTT A;  2LMD A;  2QQ9 A;  2ZJQ F;  3GTG J;  4A0Z A;  2JJ7 A;  4FIS A;  4RM3 A;  1BBY A;  4RB1 A;  4A3C J;  4ZYD A;  3HM5 A;  1SFX A;  2NOG A;  3VFZ A;  2Y2Z A;  1WVR A;  1G3T A;  2X85 A;  1MNM C;  5TRD A;  5FLX K;  2KMU A;  2I10 A;  1X4P A;  2JPB A;  3H0G J;  3LSP A;  2ZXI A;  3QRF F;  4UNO A;  4DYC A;  2G7H A;  4C9Y A;  2YS9 A;  2WB1 N;  4LOC A;  2HVQ A;  3AL0 B;  4E6K G;  3HHH A;  3FK7 A;  3KET A;  3GX4 X;  4A3M J;  3EYY A;  3HGG A;  3BG5 A;  1NG6 A;  1T33 A;  4G94 A;  2DFF A;  1XCV A;  2Z3Y A;  1KYZ A;  3H3U A;  1APL C;  2OAZ A;  1AOY A;  3VOD A;  4XKB A;  2A6E F;  3LFU A;  2ADU A;  3OR2 C;  2QSF X;  3BC8 A;  3QYB A;  5EZH A;  1TZL A;  4GFB A;  1T6S A;  1U9O A;  3GVA A;  3NEU A;  3FIS A;  2KP6 A;  4I76 A;  4F93 B;  2M9H A;  2VT2 A;  4NNJ A;  2P6T A;  2XDV A;  1XD7 A;  1S29 A;  1TT5 B;  3JR9 A;  4NC6 A;  3SDB A;  1IRF A;  2CG4 A;  3LSM A;  2CS3 A;  2MLG A;  1K4T A;  4L9V A;  2DOE A;  1DU0 A;  3MN2 A;  2KQR A;  4MFD A;  4BU2 A;  3L2Q A;  1H89 C;  1PUF B;  1X2M A;  1O4X A;  2XV4 S;  3AAF A;  2ELH A;  2X9D A;  4BDY A;  1YW8 A;  3DPU A;  2BY1 A;  4A5N A;  4XON A;  4QPQ A;  1BI2 A;  1TWF J;  2OQR A;  1E3O C;  1WGX A;  5CQE A;  3RTR A;  4FTH A;  4DYR A;  3WTY C;  1UHW A;  3TL4 X;  4BXX J;  4BH9 A;  4ZDO A;  1QGP A;  2F5C A;  2MH9 A;  3OYJ A;  5DCM A;  5GAG J;  2KIQ A;  3RQ4 A;  1R4M B;  1UHS A;  1V3F A;  4MO7 A;  2A3S A;  2UXN A;  2X1C A;  3BJO A;  4PSW A;  3FXL A;  5EG0 B;  1IDY A;  3IRQ A;  5KNL A;  4A12 A;  1QHG A;  3KX2 A;  1GT0 C;  1ZK8 A;  3F8F A;  3ZMU A;  1YE9 A;  1HQC A;  4PGH A;  4ENN A;  4KIF A;  3T0Y A;  2W57 A;  5IYD J;  1WWX A;  1MBH A;  2AO9 A;  2Y30 A;  2LKX A;  2PJR B;  1R5I D;  1Z67 A;  1RPW A;  4GDF A;  2VKH A;  3MKW B;  2BVM A;  2HNH A;  1JHF A;  1TWG J;  2N8G A;  2X48 A;  3HOX J;  3PIO F;  3G1L A;  2IS6 A;  4DGW B;  2JPC A;  3LSK A;  2H1L A;  1VF9 A;  3FWE A;  5D5V B;  2EA4 A;  4C2U A;  3CMA I;  1SAX A;  2K3F A;  2WAQ N;  5CVJ A;  3ZPL A;  1ZG5 A;  2HDW A;  2ZB9 A;  1MBJ A;  4I0B A;  3JRA A;  2HOS A;  4CGZ A;  4D1Q A;  3CC2 I;  5ED4 A;  2W1O A;  2QEN A;  3RSN A;  4E7K A;  3PUB A;  3Q3S A;  3S16 J;  5FD6 A;  3H0D A;  1B4A A;  3VPR A;  2DYS H;  1XMX A;  2LD5 A;  2L3D A;  3FXM A;  2H6C A;  2VKD A;  2LFB A;  1BN5 A;  1IN7 A;  4DOZ A;  1AA7 A;  4ENM A;  1KU3 A;  2P5V A;  5EJC A;  5F0H A;  5K5O A;  3HRT A;  1U5T A;  1G3Y A;  2CQQ A;  3IL2 A;  3OOP A;  4Q48 A;  4BKX A;  4KNY A;  4HNU A;  2EFQ A;  2Q1Z B;  1IUF A;  5CVV A;  1SVM A;  1ZQ3 P;  3DU6 A;  2CUZ A;  4C3I J;  4A3E J;  5DM7 F;  3HOS A;  5FLM J;  3IAS 2;  2F5V A;  2LF7 A;  3CDH A;  1KQ8 A;  1IDZ A;  2BOL A;  4JBA A;  3CUQ C;  4XL9 A;  1F43 A;  3BZK A;  1IN5 A;  3CCQ I;  2JRM A;  2K27 A;  5FRM A;  4MEX F;  1IAW A;  4IXA A;  1I5Z A;  2O3F A;  3BR0 A;  1ZAO A;  3H35 A;  3GTM J;  1Z1D A;  1ETK A;  1VQL I;  2DA2 A;  1KGS A;  1IN4 A;  1S9H A;  1JJ6 C;  2DDA A;  1JKR C;  2X6Y A;  4PCQ A;  2L54 A;  3O8G A;  1S3J A;  2QUF A;  1X3W B;  1G59 A;  2K3P A;  1IXC A;  2WV0 A;  3H36 A;  4ANJ A;  3HOU J;  3KP6 A;  1LE8 A;  3RQI A;  2WAE A;  2BY2 A;  2W85 A;  2JZY A;  2M0C A;  2GAU A;  2K85 A;  3F72 A;  2B7E A;  4EAT A;  5K7F A;  2QYO A;  3ASO H;  4AIJ A;  1QA6 A;  1IXS B;  2E34 A;  2HGC A;  2HFH A;  3CCS I;  3TW6 A;  2L02 A;  3K70 C;  4RAG A;  2KKO A;  3S2W A;  3TMO A;  2BXY A;  5J1Y A;  5IY5 H;  1LE8 B;  3CJN A;  4AD9 A;  3R0J A;  4CYD A;  4M74 A;  3F23 A;  2B0L A;  2VON A;  5GAH J;  2DXI A;  3PSI A;  1KON A;  3KPH A;  5IP9 J;  2ZJ2 A;  4EVI A;  2IA1 A;  4BHB A;  1RET A;  1DGR M;  4YFK F;  5EEH A;  2ME6 A;  2DFI A;  1AKH A;  1YYV A;  3OMY A;  4EJU A;  4XLH A;  3A4C A;  1X4O A;  1XX5 A;  4IPA A;  2Q8K A;  1OKR A;  5B3S H;  2FRH A;  2AQE A;  1A36 A;  2L7Z A;  4PFO A;  4DW6 A;  1D1B A;  1LFP A;  4B48 A;  5KAF C;  1J09 A;  1VQO I;  2VKE A;  1BOA A;  1OLT A;  5DS9 A;  4CYC B;  1T38 A;  1RNL A;  1HBX G;  1FJL A;  1OPC A;  1UB9 A;  2FML A;  2BW3 A;  1S8N A;  2XKP A;  2CV1 A;  2DFH A;  1YO5 C;  4KIT B;  3I3L A;  1U8R A;  1B8I B;  4QLC U;  1PJR A;  4P96 A;  3I4M J;  3JRB A;  4UUV A;  3LQR A;  2V1X A;  5JHF A;  4CSW A;  1ZYR F;  2BW3 B;  2DA3 A;  1IJW C;  1D0Z A;  4GO1 A;  1FT9 A;  5LRR A;  2VL8 A;  2CW0 F;  2KJB A;  5HDN A;  4XID A;  1U3E M;  5L3D A;  4HLX A;  4IOA F;  3FXO A;  2L0K A;  2HXO A;  1Z77 A;  2RRE A;  4BHC A;  4HF0 A;  1X58 A;  1IZ1 A;  2VQL A;  4BUP A;  4ETS A;  2BGC A;  3WHC A;  5EEA A;  3GO5 A;  1MJA A;  1T56 A;  3QPS A;  2QSG X;  1WZ2 A;  3OYA A;  4HDV A;  1W7P B;  1ZR4 A;  1PUE E;  2R7X A;  1OYI A;  1QBJ A;  4CCL A;  3QOE A;  2V1N A;  1WHU A;  3E7L A;  2FEZ A;  4M9X A;  1D5V A;  3L09 A;  2TDX A;  1WJD A;  3HOT A;  2A5W A;  1JGS A;  2GIV A;  2R7F A;  3WTW C;  2O9L A;  2CO5 A;  3NAR A;  1XPX A;  4XN0 A;  4UUT A;  1B59 A;  3BOQ A;  4YFX F;  1XGM A;  1W36 D;  5CKT A;  1Z6T A;  2VAS A;  2TRT A;  1DUX C;  1WPK A;  4F55 A;  3CLQ A;  3JW4 A;  3AFH A;  4XOT A;  1ZLJ A;  2HTS A;  2M2E A;  1G8X A;  1LUJ B;  3DKW A;  2D1V A;  1LVK A;  4CUG A;  2CW8 A;  3S3M A;  1QVU A;  3K4L A;  1H9T A;  2DI3 A;  5GPA A;  2NS8 A;  1HCR A;  2MSY A;  4OAZ A;  4CZZ A;  3E6D A;  1POG A;  3HC7 A;  1MJB A;  3BJ6 A;  3T8R A;  3IP4 B;  3BR1 A;  2STT A;  3V8J A;  5E3L A;  4BJ5 C;  2PG4 A;  3I0T A;  2CW7 A;  3REO A;  2BY3 A;  5ILV A;  3K2Z A;  3R0A A;  1VQK I;  2FOK A;  1W5T A;  3LSR A;  4WK8 F;  5FRO A;  1HDP A;  3HRS A;  3LNQ A;  5LGN A;  1YRN B;  2IVM A;  1GVJ A;  2HVS A;  2EQR A;  4G7O F;  3LL7 A;  3WU2 C;  2M30 A;  4RLF A;  2NVY J;  1Y39 A;  3CUQ A;  2EIL H;  2NXN B;  4IZZ A;  5DD8 A;  2ZBK A;  3HKZ N;  3KZI C;  3CME I;  2STW A;  2XAH A;  4HF1 A;  1J0R A;  2UUZ A;  3WOD F;  1X3U A;  2Z33 A;  2ZCW A;  4PJM A;  4B44 A;  2DPD A;  2LRD A;  1OCZ H;  3IKT A;  3ZOB A;  3AG1 H;  1BR1 A;  1FNN A;  4MNU A;  3RPU D;  1I3Q J;  3CF5 F;  2EB7 A;  1SFO J;  1R5H A;  1FSH A;  3S8P A;  2E2I J;  3VYU B;  3WG9 A;  2WBM A;  2J5O A;  3BR6 A;  2FBH A;  4HX8 A;  2KJC A;  1MW7 A;  1TQI A;  2R5Y A;  4ZH4 F;  2P8T A;  5F64 A;  2O0Y A;  5KVR A;  1SFE A;  4ESF A;  4E7J A;  2NVX J;  1MND A;  3QPH A;  4EJO A;  4OMZ A;  4XIC A;  2MG4 A;  3K1N A;  1V5G A;  3PM1 A;  1D1C A;  1I1S A;  3HTU A;  5IYC J;  4ZZD A;  4I01 A;  5CLS A;  5IT9 Z;  1ETQ A;  5LD2 C;  1WJE A;  1BJZ A;  4NQW B;  3V4G A;  1XDU A;  3LSH A;  2LY9 A;  5EYR A;  3BG7 A;  2V1U A;  1J9I A;  2DT7 B;  1W0T A;  4XNF A;  1B72 A;  2IGK A;  2GA2 A;  3OYB A;  3AG4 H;  5GTI C;  1OCP A;  1TWA J;  5B1B H;  5D4S A;  1TBX A;  1B72 B;  2COB A;  5C4X J;  5F1J A;  3P9K A;  1REP C;  1Y8Q B;  3FK6 A;  1FBU A;  1GVD A;  3A0H C;  4KT6 A;  5M5W J;  4M72 A;  5FLX Z;  2X6O A;  2VOO A;  1OYY A;  1NK3 P;  4RB2 C;  3ECO A;  3SYT A;  3MKY B;  1W1W E;  5J1R A;  4A0X A;  2LKP A;  3H5N A;  4FX4 A;  1RR8 C;  1DU6 A;  1I27 A;  1YOV B;  1EH7 A;  2FJ1 A;  2R7V A;  2ELJ A;  1HOM A;  4IF4 A;  1X3Z B;  3ZXS A;  2OU2 A;  4MEY F;  4FET A;  3WTZ A;  1UZC A;  2DK8 A;  1ETY A;  5HNH A;  1ERD A;  2AQF A;  4KJZ A;  3ZGK A;  2M1B A;  3KZY A;  4KFC A;  3GFI A;  2R3S A;  1WSU A;  1A31 A;  1WRJ A;  2NOJ B;  5K7Z A;  1N75 A;  5E1W A;  3ZMV A;  2WTE A;  1IRZ A;  2KIM A;  2X6W A;  3OSF A;  1O57 A;  3HPH A;  3I58 A;  1R22 A;  5GTH C;  3W3C A;  2ZC2 A;  2LTP A;  2EIK H;  1WJC A;  3LQQ A;  1S5L C;  4A5M A;  3OS1 A;  3W6V A;  4LFU A;  3IAM 2;  1BL0 A;  4FQG A;  1YFH A;  3E6C C;  2K9N A;  4M3D A;  4PGG A;  1DDN A;  4G6T B;  3SFI A;  4AVP A;  4ZYG A;  3IC7 A;  2H8R A;  3LST A;  3GYH X;  3X2Q H;  2V1D A;  3MVP A;  5EGO A;  3J7Y J;  1VQM I;  2EFN A;  3RKQ A;  2RGV A;  2H1K A;  3J7A Y;  1L0O C;  3K4N A;  2KLO A;  1U9N A;  3F6O A;  4Z2Y A;  2VQG A;  2WAF A;  2RDP A;  2K9M A;  2ZME B;  4BEH A;  4BXU A;  5EGO B;  3LWF A;  4UVA A;  1KQ9 A;  3ASN H;  4Y15 A;  2PX9 A;  2BYV E;  2DLL A;  2PFB A;  1MSE C;  3FHZ A;  5D6F A;  4Q47 A;  3OYF A;  3TGN A;  1JKO C;  4A3J J;  5FGM A;  1P7I A;  1OR7 A;  3MFK A;  4ENK A;  4IKF A;  3MZY A;  4G9Y A;  3K6G A;  2EPF A;  4B1R A;  2LH9 A;  3ZQF A;  4BE2 A;  3ZP5 A;  4LIT A;  2QCO A;  2FNA A;  4RGX A;  2L2O A;  3BZ6 A;  4U0W A;  1ETX A;  1MBF A;  5L3E A;  2PMH A;  3H9Q A;  5FKM A;  2ZNZ A;  4XBF A;  2Y48 A;  1D8K A;  3NWS A;  3MKZ A;  3ZQI A;  4M6X A;  2LBF A;  3HRU A;  3WTU C;  2PJP A;  1ZAR A;  4M3G A;  2F5D A;  5ILU A;  4FE7 A;  1KA8 A;  4M71 A;  2VN2 A;  3J7Z I;  2XC7 A;  4GGG A;  4D7M A;  3OWT A;  1DQU A;  1HXD A;  3IUO A;  3RPQ A;  5D8L B;  4UB6 C;  1T98 A;  3ML6 A;  3W2V A;  1WCM J;  4A93 J;  2VPL A;  1WH7 A;  3F9K A;  1D8J A;  3MAJ A;  4RDU A;  2E2H J;  2L9S A;  3HPG A;  1ZN2 A;  1XSD A;  1D1A A;  3JCU C;  2JT1 A;  1Y8R B;  3OYL A;  1S7E A;  2VLA A;  3CUO A;  2O61 A;  2M45 A;  5FFX A;  3RZD J;  2CQX A;  2XAQ A;  3KIO A;  3OS0 A;  2PQ8 A;  4XOR A;  3F22 A;  4ZDL A;  4LLN A;  4GRI A;  1ORK A;  4RAY A;  2FA5 A;  5TIS C;  3OSG A;  1IF1 A;  2XIG A;  2ECB A;  1QRY A;  3FMR A;  4PSX A;  3S15 J;  2JMW A;  2VJ4 A;  3VSK A;  4RLQ A;  3VDX A;  4DBQ A;  5GAE J;  2ZFU A;  2DOD A;  1LFB A;  4MQV A;  2W24 A;  3KYL A;  1BW6 A;  2OQG A;  5BS6 A;  3OYK A;  3OYI A;  2E35 A;  4BYY A;  3DKY A;  2B63 J;  3ROU A;  1RKT A;  4WX9 A;  3L1P A;  5LGT A;  1SD4 A;  3CF2 A;  2OD5 A;  4AVZ A;  1IW7 F;  1U0J A;  2JSP A;  4U7B A;  1WJF A;  3J80 Z;  3CJQ B;  4BS9 A;  1HC8 A;  3LMM A;  2PMZ N;  1ETW A;  3CES A;  1XSX A;  2FF4 A;  4AYB A;  2IXS A;  5IT9 K;  3TO6 A;  2JVH A;  4II3 A;  2IEK A;  5BQT A;  1IC8 A;  1LKX A;  2Y9Y A;  1FOX A;  2PEX A;  3E6M A;  3FM5 A;  2ZSH B;  2X0L A;  2BY0 A;  1TNT A;  3TP0 A;  2DN0 A;  1HF0 A;  6PAX A;  1KYW A;  3FXQ A;  3CCM I;  2DO7 A;  2M3A A;  3H1C A;  4BY7 J;  3KEQ A;  3KLO A;  2F4M B;  2EH3 A;  4XQF A;  3J7A O;  3I9V 2;  5J40 A;  1ZEL A;  3ZRG A;  4RB0 A;  3WTX C;  4DQ2 A;  3I4P A;  4D0P A;  4RM2 A;  3KP5 A;  2K86 A;  4JK1 X;  5IOZ A;  1R1V A;  1MZB A;  4WXH A;  1FWZ A;  4QIW N;  3CMY A;  4XLN F;  1J5Y A;  3S1M J;  1RR7 A;  2VOD A;  2LK2 A;  2VPR A;  5ERI A;  1M1E B;  1Z0X A;  5B66 C;  4RS8 A;  3ZQG A;  1RRJ A;  1U8B A;  1OJL A;  1UCR A;  2BHY A;  2E1N A;  3H5R A;  3FF5 A;  4FT8 A;  2QWW A;  3JRF A;  1W36 C;  5F1R A;  3Q9S A;  4AM3 A;  2DMT A;  2OA4 A;  3TQN A;  4F3Q A;  2M4G A;  2ICW G;  2EIJ H;  2HU9 A;  2L7M P;  3PUF A;  4CCJ A;  3EUA A;  4UV8 A;  3G1M A;  1I6H J;  2KRF A;  5HS8 A;  4FHT A;  1MBE A;  4Q4Z F;  3TOA A;  3K10 A;  3RYR A;  3ZCO A;  5FLV A;  4HEA 2;  3WGG A;  4KIS A;  3K0L A;  1YJW I;  4WWC A;  2Q2E A;  3LSJ A;  4U87 A;  3OYE A;  4UUS A;  1NK2 P;  1Y0U A;  2NNN A;  4D5C A;  5CPR B;  4E7L A;  1B9N A;  3EPZ A;  1YS7 A;  1T95 A;  5H6R A;  4KIG A;  2G9W A;  2RV8 A;  1UST A;  4BAY A;  4OOI A;  1STZ A;  5HLH A;  2LC2 A;  4S05 A;  1LVA A;  1WI3 A;  4LK1 F;  4F92 B;  5EZG A;  5J4Y A;  4XSX F;  5A2Q Z;  4IOC F;  2P81 A;  5BPD A;  1QO0 D;  3G2B A;  3DPT A;  3WGI A;  1F4K A;  4P9U A;  2VBW A;  2IRF G;  2HZD A;  4QSH A;  3CC4 I;  2W7N A;  3ISP A;  3ZN1 A;  3CP2 A;  2LY1 A;  2G0E A;  2ACJ A;  1WQ2 A;  3V7C A;  3EYI A;  4N4O B;  4B09 A;  3HOV J;  2YU3 A;  4IVN A;  4AIH A;  1FOY A;  4IL6 C;  1YHQ I;  5DCM B;  3ZMD A;  2E1M C;  5JLW A;  2I5U A;  2E5Z A;  3CCV I;  1RKW A;  4LD5 A;  3C2H A;  2JA8 J;  3SHF A;  3G1O A;  3JTH A;  3GF2 A;  4U0V A;  5LRS A;  4ITV A;  1FLI A;  3FX3 A;  3SDG A;  1Y1V J;  3FM3 A;  1YX5 A;  3DQV C;  2A68 F;  2L7K A;  1MBK A;  3CCY A;  2EFW A;  1R9T J;  3A0B C;  4RA2 A;  2ZXH A;  3DF8 A;  4UVB A;  3OYN A;  1VQN I;  5FKK A;  4L5E A;  2Z16 A;  2OZ6 A;  3V8K A;  1ZGW A;  3ULQ B;  3P9C A;  3RZO J;  5E1Z B;  2XHK A;  5AIQ A;  1MMG A;  5E3N A;  1JI8 A;  1VQ5 I;  4WCG A;  5EEG A;  3VEP A;  1SD6 A;  5B1A H;  5D8K B;  1K78 A;  5E79 C;  4OAY A;  1ZG3 A;  2F5F A;  2ZSI B;  2P7C B;  4CXF A;  1LDJ A;  3DTK A;  3LA7 A;  3WHB A;  2XB5 A;  3HL2 A;  1J75 A;  3WG7 H;  4O3M A;  1O7F A;  2GA1 A;  1A6I A;  4A3B J;  1W5S A;  3S3N A;  3E5Q A;  2NVU B;  5EF6 A;  2HDD A;  3QYE A;  4NB5 A;  1VTN C;  3RDI A;  3HRM A;  3F6V A;  3S3O A;  3ONQ A;  4P5O A;  3RCO A;  1EKE A;  2M7A A;  3QOP A;  4GYG A;  3L2C A;  3MZH A;  3V7R A;  3CDI A;  3ABT A;  2IS1 A;  2IGN A;  2VC0 A;  4A3K J;  2Z99 A;  2HTJ A;  1U5T B;  4Y52 J;  4HSR A;  3IWZ A;  3KFW X;  1P92 A;  1IV6 A;  1N78 A;  2OPT A;  1R7J A;  1DP7 P;  3PQJ A;  3UR3 C;  3BZC A;  4JP0 A;  2K5C A;  2DCE A;  1MSF C;  1V5F A;  4I98 B;  3WU1 B;  4IHY A;  5FFZ A;  2D45 A;  1ZKG A;  3V42 A;  5J6X A;  2IGM A;  3UKG A;  1E17 A;  2LR8 A;  3ABL H;  4EGY A;  2IBD A;  2VJ5 A;  1KU7 A;  2M8G X;  1H9G A;  3ABK H;  4G12 A;  3JSO A;  2FMY A;  1YX3 A;  5AON A;  4Z6Y A;  1BJA A;  2CUE A;  3R61 A;  1Z3Y A;  3BLY A;  1BOB A;  4HZF A;  4FE4 A;  3JAM K;  2JUC A;  2Y0M A;  4EM0 B;  2VBY A;  1H8A C;  1MD0 A;  3Q0U A;  3PSF A;  4HNV A;  3G4S I;  3J80 K;  2NNY A;  2VUM J;  1GV2 A;  5GAD J;  3S32 A;  2ID6 A;  2GBY A;  2J5P A;  2K40 A;  1G6N A;  2EV6 A;  3PNY A;  5FRN A;  3HOZ J;  1ZRC A;  4L0Y B;  3A2K A;  3ZMS A;  3FKJ A;  2DDB A;  3KP3 A;  5LGU A;  1MKM A;  4WF2 A;  1MMA A;  4ZYA A;  2HOA A;  1QPI A;  4KN4 X;  1TL8 A;  3ERE D;  1TW2 A;  4JX4 A;  3V7S A;  3DBR B;  1UJ8 A;  1BIA A;  2DJN A;  3F8M A;  4XM3 A;  1MJ9 A;  3S1R J;  4LLG F;  1AKH B;  2Y31 A;  1RZ4 A;  4B4C A;  3S1Q J;  5D6E A;  2R5Z A;  5FO5 A;  2HVR A;  2YSR A;  1QPM A;  1SFU A;  2BE5 F;  4EM1 A;  5LBQ A;  2EWN A;  2XPU A;  3OIP A;  2M87 A;  1LEB A;  1J2X A;  4D5F A;  2XKO A;  2GXG A;  2JN6 A;  1L3L A;  4AWX B;  5IP6 A;  3H9G A;  4XLC A;  2L9V A;  2ZNY A;  3K4B A;  1MDM A;  2R7Z J;  3HHG A;  4KIB A;  1TW3 A;  5K7H A;  5M5X J;  2V6E A;  4XOP A;  3CCL I;  1R1T A;  3M1E A;  4QWQ A;  3CP8 A;  2BEO A;  4EJV A;  1XS9 A;  2DA6 A;  4G7H F;  1O3R A;  4Y3O A;  2ZXW H;  1OCC H;  2I8D A;  5F27 A;  3LA3 A;  1YLF A;  2CGP A;  3BTC A;  2Y0S N;  1EF4 A;  1BI0 A;  2HKX A;  1R23 A;  5CVI A;  5C44 J;  4X1E A;  3RPU A;  1Z6R A;  3V8L A;  3OR1 C;  4W97 A;  1FTZ A;  2HPI A;  2HYG D;  1LPQ A;  3JRD A;  4BE1 A;  3C18 A;  4OIP F;  1VQ8 I;  2PMU A;  5BOX A;  1VQ7 I;  1Q1H A;  2XF5 A;  2MA3 A;  1ULY A;  3QP5 A;  5M3F J;  2E5N A;  4HX7 A;  2IS2 A;  2JRT A;  3GFL A;  1WH5 A;  1BR2 A;  1MMN A;  1TT0 A;  3I59 A;  3KYC B;  5L3B A;  2F2E A;  2FOW A;  5A2Q K;  3U1D A;  1SMY F;  2WV1 A;  3N4M A;  1LQ1 A;  4HQM A;  1HW1 A;  2DA7 A;  2DMN A;  2DTR A;  2K9S A;  1I6X A;  3CCU I;  3I59 B;  1K83 J;  3T1B A;  2LF8 A;  3K9T A;  3M1C A;  2V79 A;  1BA5 A;  1HW5 A;  2L5Q A;  1PVE A;  1X19 A;  2WA0 A;  4B43 A;  1S7A A;  4L9T A;  2JVG A;  5ICC A;  4JQF A;  1AHD P;  4GYI A;  1HA8 A;  4BY1 J;  4MIM A;  5J8C A;  3L2V A;  1YJN I;  3CJT B;  3MQ0 A;  2CQK A;  3CCR I;  4PJN A;  5IPA A;  3ZN0 A;  1ZGA A;  5C3E J;  2MGQ A;  2QF7 A;  2OC6 A;  2QLZ A;  4XRF A;  4HV6 A;  4AID A;  2M5W A;  1JE8 A;  2KL4 A;  2DQR A;  2X4H A;  4RMN A;  4KT5 C;  1E0E A;  1VQ9 I;  3A02 A;  2AXT C;  1E2X A;  3L7W A;  3U2R A;  4C2M J;  1W4M A;  1SVL A;  3TW7 A;  2VE9 A;  2ETH A;  1ENH A;  3GTO J;  3DCF A;  4E4H A;  1IXR C;  1ACI A;  4FAS D;  1U78 A;  3DLL F;  1IN8 A;  3QPL A;  2VJJ A;  2X1E A;  4MTE A;  3GTL J;  2HQ5 A;  4A6E A;  1JUM A;  5HLI A;  2PBI A;  5KCM A;  1AU7 A;  1NG7 A;  2IA2 A;  3I5U A;  1YIO A;  1YIT I;  2R92 J;  2E2J J;  2WAD A;  3D0S A;  3G6E I;  3CUQ B;  3M8J A;  3U1K A;  3OYG A;  3A01 A;  5JLX A;  3TOB A;  3HOY J;  3F3X A;  3D1N I;  3GLX A;  2WWY A;  5HVQ C;  2A5Y B;  5CYV A;  2VBZ A;  4II2 A;  5K5R A;  1YJ9 I;  1BC8 C;  4BQQ A;  1Z9C A;  2NVQ J;  3S14 J;  3FMS A;  1D0X A;  5HDK A;  4RB3 C;  3CDL A;  1KU9 A;  1ON1 A;  1VZ0 A;  4M9Z A;  4XSZ F;  4HDU A;  2HPM A;  2JTV A;  1B1B A;  3C3W A;  3HSF A;  1W7P D;  2QGU A;  4DNC A;  1UG2 A;  4A0Y A;  5E20 A;  4QPO A;  2BZT A;  5CVR A;  3BDD A;  2R5Y B;  4B8X A;  4EM2 A;  1LFU P;  2LSO A;  3N97 A;  1Z05 A;  4BNC A;  4ZC3 A;  2EZK A;  5ICE A;  4YEL A;  2GM4 A;  2QVO A;  2EZL A;  3H5A A;  3UNG C;  2R7U A;  3MEX A;  2R7Q A;  1CF7 A;  1ITY A;  1G3W A;  3LOC A;  4M6V A;  2QBY A;  4XKC A;  1X1P A;  1FPQ A;  3HUG A;  2D2W A;  4CCK A;  2FNP A;  4F91 B;  2WB1 A;  5JVT A;  1FSE A;  4YII A;  1P7J A;  1Z91 A;  2JUG A;  4A3D J;  2E1O A;  4ZDP A;  2QSH X;  3W2A A;  1P4X A;  4J19 A;  2QBY B;  4ESB A;  1LJ9 A;  4XKV A;  3KYD B;  1JTX A;  1YI2 I;  2KRH A;  2DA1 A;  2P0W A;  3S17 J;  1JUS A;  5DV5 A;  2YX4 A;  1IN6 A;  1ONV A;  4RAF A;  3GZ6 A;  4IHS A;  2KT0 A;  2IS4 A;  2DTZ A;  3BJA A;  3IH3 A;  3Q0W A;  1JT6 A;  3BCA A;  5JR3 A;  1JTY A;  4DBR A;  4AU7 A;  2MD5 A;  2GQQ A;  3B6A A;  1D0Y A;  4XN3 A;  4I02 A;  1P9Q C;  5L3C A;  3L9F A;  3FBI B;  3FHN A;  4MHG A;  2L4M A;  2UZK A;  4JYK A;  4PZJ A;  2OUM A;  2R7R A;  2VB6 A;  5FD5 A;  4ZYH A;  1GHC A;  2XAF A;  3SZP A;  2DPU A;  1W0U A;  3GCM A;  3KEO A;  4R8H A;  3E5U A;  1X1D A;  1GXP A;  1USS A;  3GUD A;  3LFK A;  4BXF A;  3Q5F A;  4UB8 C;  2DK5 A;  1KZH A;  2VXD A;  3GTP J;  3EET A;  4UV9 A;  2MC3 A;  4IHV A;  1FIA A;  4RGR A;  3HDD A;  1B6A A;  1DGW Y;  2LRE A;  5JHU A;  4M3B A;  4A3L J;  3O3K A;  2FBI A;  3COA C;  2P5L C;  1VQ4 I;  1IRX A; 
#chains in the Genus database with same CATH homology
 2DAO A;  2DBB A;  4RGS A;  2AS5 F;  1SMT A;  3ZMT A;  5ICG A;  2RKH A;  2H94 A;  5LHI A;  4WXD A;  4Q5S F;  5H6Q A;  4KA4 A;  1BC7 C;  2PN6 A;  1OMI A;  3C7J A;  4YFN F;  3WTS C;  3TO9 A;  1U2W A;  4U88 A;  3TO7 A;  4ZYE A;  2QQA A;  2H27 A;  4I2O A;  2K4B A;  3KP2 A;  1O7L A;  4L5I A;  2DQL A;  3GEZ A;  1ODD A;  3F21 A;  3M8E A;  2R7D A;  2FSW A;  2GXB A;  2E7X A;  1FBS A;  3VOE A;  4G6Q A;  5LLQ A;  3WU0 A;  4KUM A;  2DT5 A;  1XB4 A;  3QP6 A;  1XMK A;  3KCC A;  4I0A A;  4NHJ A;  1JHH A;  2ZO4 A;  2FU4 A;  1P2F A;  2RN7 A;  2VT3 A;  5H20 A;  4L18 B;  1FOK A;  1R58 A;  1FYL A;  2P4W A;  5DEQ A;  2BV6 A;  1R36 A;  3O2P E;  1T39 A;  2W84 A;  1HKQ A;  4IRH A;  5LEJ A;  3KP7 A;  1KU2 A;  4IRG A;  4G6D A;  1EV7 A;  2P5K A;  5E17 F;  2HOE A;  2HS5 A;  2IPQ X;  3FXR A;  1KQ0 A;  2OZU A;  5LHG A;  1A04 A;  5CJ9 A;  2HQN A;  1ZRE A;  2EV0 A;  4HX4 A;  3JAM Z;  2FBK A;  4OMY A;  3CO6 C;  4L0Z B;  2L4A A;  3I64 A;  3ABU A;  3TDU C;  4N0B A;  5E1X A;  5D5W B;  1FX7 A;  1QNT A;  1FP1 D;  1R5G A;  2L01 A;  1LNW A;  2YR2 A;  5J8F A;  5IT3 A;  4KDP A;  2IA0 A;  5L3F A;  4LG0 A;  3DV8 A;  4MQ9 F;  2VE8 A;  4LMY A;  3C1D A;  4LG0 B;  4UHT A;  3TDZ C;  3WTT C;  1XGS A;  2EA2 A;  4Y13 A;  4GCV A;  3BWG A;  4EJT A;  1K6O A;  1DPR A;  1YW9 A;  2QZ8 A;  1RUN A;  1LDK B;  4XLP F;  3IKV A;  5E8I A;  1BI3 A;  3EUH A;  5K5Q A;  2D1H A;  3MWM A;  1YS6 A;  1NHA A;  5DUI A;  2O8X A;  4EQQ A;  4FX0 A;  2RVC A;  1PP7 U;  3FZV A;  2O6G E;  4RGU A;  1TLH B;  3L00 A;  1K7A A;  1XN7 A;  1LEA A;  1P6R A;  3B73 A;  5DD4 A;  2CYY A;  1TQM A;  2Y75 A;  3I53 A;  1RIO H;  3WE2 A;  4OIN F;  3SQN A;  3KP4 A;  2A61 A;  1IUY A;  3F8C A;  1IRG A;  2MLK A;  1WI9 A;  3CLO A;  3RKY A;  2O03 A;  4CIC A;  2CWE A;  4LB6 B;  1J7K A;  2PI0 A;  4PDK A;  5L3G A;  4LGW A;  3ZQ7 A;  1ZH5 A;  3HSR A;  2FQ3 A;  1HKS A;  1BIB A;  5FB2 A;  3M7G A;  3R60 A;  1U6G A;  2JSC A;  2NAZ A;  2AXL A;  2Z5U A;  3J81 K;  3CTA A;  1CGP A;  3E3V A;  2E7W A;  4R1H A;  5E18 F;  4L9N A;  2A6H F;  2VC1 A;  1K78 B;  3OV8 A;  2H09 A;  2HYF A;  3DFG A;  2Q0O A;  5CVU A;  1YTY A;  1XGO A;  3IHU A;  3HSE A;  2K4J A;  2RNJ A;  1P4A A;  4ASN A;  3W6K B;  5ICF A;  1G3S A;  2ISZ A;  4BHP A;  2KIU A;  3WTV C;  3E5X A;  5TJJ A;  5HLG A;  3HIF A;  2NRA C;  4BQA A;  4HAM A;  4ZZL A;  2LNB A;  4TV7 A;  4LB5 A;  4UVC A;  3U9G A;  3LAJ A;  4OIO F;  4M6Y A;  3I54 A;  1PDN C;  1P4W A;  3F8N A;  4N9I A;  1YG2 A;  1XSV A;  1MGT A;  1SD5 A;  3D5L A;  3PFI A;  3FMQ A;  5D5X B;  4F7Z A;  2XRO A;  3E6B A;  2P6S A;  2V6C A;  4IJA A;  4OIR F;  2V9V A;  1ZLK A;  4HA8 A;  3LAP A;  3DP7 A;  1HST A;  4HQE A;  1R00 A;  2VXZ A;  5ILS A;  1FYM A;  3LA2 A;  5JI6 A;  1H0M A;  4L9J A;  1ZG1 A;  1JXS A;  5AIP A;  2H6B A;  2XAG A;  1HSJ A;  1XDS A;  2UWM A;  3RIR A;  4RAZ A;  1FZP B;  1HW2 A;  3NQO A;  2PLY A;  1O3S A;  3JTG A;  1MDM B;  4E70 A;  2DW4 A;  4HBL A;  3FXU A;  4LJZ F;  2WC2 A;  4IHT A;  2EV5 A;  1C0W A;  4G7Z F;  2K02 A;  3M8F A;  1LB2 A;  1F5T A;  4HYE A;  4CO8 A;  4KN7 X;  1W7P A;  1FYK A;  3WGH A;  1S7O A;  3R4K A;  1D3Y A;  1PP8 F;  5E8G A;  3H92 A;  3M9A A;  1DPU A;  1J59 A;  3NRV A;  1S6L A;  3JSP A;  4MGR A;  2QQB A;  1BM9 A;  2P7V B;  1QZY A;  3GFM A;  4L5J A;  1AWC A;  4CDG A;  3ELK A;  5HS7 A;  4Y17 A;  2CSO A;  1XGN A;  3PQK A;  4HV5 A;  2ISY A;  2ZFW A;  5LHH A;  1YQA A;  3DEU A;  2G7U A;  4I09 A;  3K69 A;  1XCB A;  4OIQ F;  4GXO A;  1QQI A;  2EFP A;  4HW0 A;  1UHM A;  2HEO A;  5F6F A;  3SZT A;  5DDG A;  2GWR A;  2EK5 A;  5K1Y A;  3BPX A;  4KMU X;  2HQR A;  4CHU A;  4HLY A;  1FBQ A;  1B9M A;  3RJP A;  2COM A;  1TNS A;  5D5U B;  1F9N A;  1T2K A;  3K1P A;  3KZZ A;  1UFM A;  3ZMZ A;  2W25 A;  3BY6 A;  4EMS A;  4H0E A;  4KYW A;  2YX7 A;  4KIC A;  4UXN A;  1FY7 A;  2HZT A;  4U0Y A;  1HKT A;  4I7H A;  4P9F A;  4O6J A;  4EGZ A;  1EH8 A;  3QU3 A;  2C6Y A;  4NQW A;  3RYP A;  5HDG A;  4A2U A;  1T0F A;  3HYI A;  3DPL C;  3CO7 C;  4ESJ A;  2DU9 A;  5HOO A;  2FE3 A;  3K1M A;  1CF7 B;  3BRO A;  2HDC A;  3Q9V A;  3GW2 A;  2XRN A;  3QU6 A;  2MBF A;  3QPT A;  3T5X A;  2XUB A;  4M73 A;  4EV0 A;  5BPI A;  2Z9O A;  4R79 A;  1FP2 A;  2RC4 A;  2IP2 A;  4HOB A;  2VBX A;  2IW5 A;  4LLL A;  3GFJ A;  1RI7 A;  4K2E A;  2HR3 A;  3WE3 A;  1ZHF A;  1XMA A;  2CFX A;  2HWV A;  2EFO A;  2IJL A;  2NS0 A;  3SFZ A;  3DXJ F;  5HS9 A;  2A69 F;  4AIK A;  3GZ5 A;  5KK1 A;  4ENJ A;  3MCZ A;  3P9I A;  3KLN A;  5DCF A;  3QAH A;  4IRI A;  5JFR A;  4HF2 A;  4M9S A;  1F1Z A;  1SD7 A;  3GWZ A;  1FC3 A;  2ZME A;  3B02 A;  3ECH A;  1O3Q A;  2XVC A;  1G4D A;  5DYM A;  2MH2 A;  5D4R A;  1TQP A;  1ZRD A;  3G73 A;  4KMF A;  3J81 Z;  2XAS A;  2E1C A;  3RKX A;  4O5V A;  3G3Z A;  2NYX A;  3P7N A;  3RI4 A;  1O3T A;  4G8X A;  2BBY A;  2LDU A;  4P55 A;  3GXO A;  2UXX A;  4A6D A;  1QZZ A;  4LK0 F;  1ZGJ A;  3E97 A;  2FXA A;  1ZRF A;  1R1U A;  2K7L A;  2RQP A;  5DUK A;  2F5E A;  5LEK A;  5BMZ A;  3W6J B;  3BP8 A;  3IWF A;  1RUO A;  3RKW A;  4N9H A;  3TKY A;  4U7D A;  3KE2 A;  4YIF A;  2A07 F;  2KIF A;  4OU0 A;  3SXY A;  2XGX A;  2EJR A;  3VB2 A;  1TTY A;  3T8T A;  1ON2 A;  2XAJ A;  3IRR A;  1OYW A;  3O6B B;  2ESH A;  1V4R A;  4S04 A;  2ZXJ A;  3BPV A;  2IT0 A;  1LDD A;  2ZKZ A;  4ON0 A;  3H3Z A;  2HKO A;  2QM3 A;  3R6S A;  3EDP A;  1YW7 A;  3EQL F;  3I71 A;  1U5T C;  4MTD A;  1BI1 A;  4EJW A;  4YG2 F;  2OBP A;  1GXQ A;  4WXC A;  1K79 A;  2ESN A;  1I1G A;  2VOP A;  3HTS B;  1Z7U A;  2YPR A;  2M8E A;  1WKM A;  3F8B A;  2GZW A;  1EH6 A;  2QQ9 A;  4A0Z A;  1BBY A;  4RB1 A;  4ZYD A;  1SFX A;  3VFZ A;  1G3T A;  5TRD A;  5FLX K;  2JPB A;  3QRF F;  4UNO A;  2G7H A;  3HHH A;  3KET A;  3GX4 X;  3EYY A;  4G94 A;  1XCV A;  2Z3Y A;  1KYZ A;  3H3U A;  2OAZ A;  1AOY A;  3VOD A;  2A6E F;  2ADU A;  2PJP A;  1T6S A;  3GVA A;  3NEU A;  2VT2 A;  2P6T A;  1XD7 A;  1S29 A;  1IRF A;  2CG4 A;  2MLG A;  4L9V A;  2XV4 S;  3AAF A;  2ELH A;  1YW8 A;  4A5N A;  1BI2 A;  2OQR A;  3RTR A;  3WTY C;  1UHW A;  4BH9 A;  1QGP A;  2F5C A;  2MH9 A;  5DCM A;  1V3F A;  2A3S A;  2UXN A;  3BJO A;  3IRQ A;  4A12 A;  3F8F A;  3ZMU A;  1HQC A;  4PGH A;  4ENN A;  4KIF A;  3T0Y A;  2W57 A;  1WWX A;  1JHF A;  2JPC A;  3FWE A;  5D5V B;  2EA4 A;  1SAX A;  5CVJ A;  3ZPL A;  1ZG5 A;  4I0B A;  4CGZ A;  5ED4 A;  2QEN A;  5FD6 A;  1B4A A;  2L3D A;  2H6C A;  1BN5 A;  1IN7 A;  4ENM A;  1KU3 A;  2P5V A;  5K5O A;  3HRT A;  1U5T A;  1G3Y A;  3IL2 A;  3OOP A;  4Q48 A;  4KNY A;  2EFQ A;  5CVV A;  3HOS A;  2LF7 A;  3CDH A;  1KQ8 A;  4JBA A;  3CUQ C;  1IN5 A;  2K27 A;  4MEX F;  1IAW A;  4IXA A;  1I5Z A;  2O3F A;  1ZAO A;  1Z1D A;  1KGS A;  1IN4 A;  4PCQ A;  2L54 A;  1S3J A;  2QUF A;  1IXC A;  2WV0 A;  3KP6 A;  2W85 A;  2JZY A;  2GAU A;  3F72 A;  2QYO A;  4AIJ A;  1IXS B;  2HGC A;  2HFH A;  2L02 A;  2KKO A;  3S2W A;  3CJN A;  4AD9 A;  3R0J A;  4CYD A;  4M74 A;  3F23 A;  2B0L A;  2VON A;  2ZJ2 A;  4EVI A;  2IA1 A;  4BHB A;  4YFK F;  5EEH A;  2DFI A;  1YYV A;  4EJU A;  4IPA A;  2Q8K A;  1OKR A;  2FRH A;  1BOA A;  1T38 A;  1RNL A;  1HBX G;  1OPC A;  1UB9 A;  2FML A;  1S8N A;  2XKP A;  1YO5 C;  1U8R A;  4QLC U;  4P96 A;  4UUV A;  3LQR A;  2V1X A;  1ZYR F;  4GO1 A;  1FT9 A;  5LRR A;  2CW0 F;  2KJB A;  5HDN A;  1U3E M;  5L3D A;  4HLX A;  4BHC A;  4HF0 A;  1IZ1 A;  4ETS A;  2BGC A;  3GO5 A;  1MJA A;  4HDV A;  1W7P B;  1PUE E;  1OYI A;  1QBJ A;  4M9X A;  1D5V A;  2FEZ A;  3L09 A;  2TDX A;  3HOT A;  2GIV A;  1JGS A;  2R7F A;  3WTW C;  2CO5 A;  4YFX F;  1B59 A;  3BOQ A;  1XGM A;  1Z6T A;  1DUX C;  3JW4 A;  1ZLJ A;  2HTS A;  3DKW A;  2D1V A;  1H9T A;  2DI3 A;  4CZZ A;  3E6D A;  1MJB A;  3BJ6 A;  3T8R A;  2STT A;  3V8J A;  2PG4 A;  3I0T A;  3REO A;  5ILV A;  3K2Z A;  3R0A A;  2FOK A;  1W5T A;  4WK8 F;  3HRS A;  5LGN A;  2IVM A;  1GVJ A;  4G7O F;  2M30 A;  3CUQ A;  5DD8 A;  2ZBK A;  2STW A;  4HF1 A;  2XAH A;  1J0R A;  3WOD F;  1X3U A;  2Z33 A;  2ZCW A;  2DPD A;  3IKT A;  1FNN A;  4MNU A;  2EB7 A;  1R5H A;  1FSH A;  3WG9 A;  2J5O A;  4HX8 A;  2FBH A;  2KJC A;  1TQI A;  4ZH4 F;  2P8T A;  5F64 A;  2O0Y A;  5KVR A;  1SFE A;  4ESF A;  3QPH A;  4EJO A;  4OMZ A;  3K1N A;  1I1S A;  3HTU A;  4ZZD A;  4I01 A;  5CLS A;  5IT9 Z;  3V4G A;  1XDU A;  2V1U A;  1J9I A;  2GA2 A;  5D4S A;  1TBX A;  3P9K A;  1REP C;  1FBU A;  4M72 A;  5FLX Z;  2VOO A;  1OYY A;  4RB2 C;  3ECO A;  4A0X A;  2LKP A;  4FX4 A;  1I27 A;  1EH7 A;  4IF4 A;  2OU2 A;  4MEY F;  3WTZ A;  2DK8 A;  2M1B A;  3KZY A;  4KFC A;  3GFI A;  2R3S A;  1WSU A;  1WRJ A;  5E1W A;  3ZMV A;  2WTE A;  2KIM A;  1O57 A;  3I58 A;  1R22 A;  3LQQ A;  4A5M A;  4LFU A;  1YFH A;  3E6C C;  4PGG A;  1DDN A;  4AVP A;  4ZYG A;  3IC7 A;  3LST A;  3GYH X;  2V1D A;  2EFN A;  2RGV A;  1L0O C;  3F6O A;  4Z2Y A;  2RDP A;  2ZME B;  4BXU A;  3LWF A;  4UVA A;  1KQ9 A;  4Y15 A;  2BYV E;  2DLL A;  2PFB A;  3FHZ A;  5D6F A;  4Q47 A;  3TGN A;  5FGM A;  1OR7 A;  3MFK A;  4ENK A;  3MZY A;  4G9Y A;  3ZP5 A;  2FNA A;  4RGX A;  3BZ6 A;  4U0W A;  5L3E A;  2PMH A;  2ZNZ A;  4XBF A;  2Y48 A;  1D8K A;  4M6X A;  3HRU A;  3WTU C;  1ZAR A;  2F5D A;  5ILU A;  1KA8 A;  4M71 A;  2VN2 A;  4GGG A;  3RPQ A;  1HXD A;  5D8L B;  1T98 A;  3ML6 A;  1D8J A;  3MAJ A;  1ZN2 A;  1XSD A;  2JT1 A;  3CUO A;  2O61 A;  2M45 A;  5FFX A;  2XAQ A;  2PQ8 A;  3F22 A;  4LLN A;  4RAY A;  2FA5 A;  1IF1 A;  2XIG A;  3FMR A;  4MQV A;  2W24 A;  2OQG A;  5BS6 A;  4BYY A;  3ROU A;  4WX9 A;  5LGT A;  1SD4 A;  2OD5 A;  1IW7 F;  4U7B A;  3J80 Z;  1XSX A;  2FF4 A;  5IT9 K;  3TO6 A;  5BQT A;  2PEX A;  3E6M A;  3FM5 A;  2X0L A;  1TNT A;  6PAX A;  1KYW A;  3FXQ A;  2DO7 A;  3KEQ A;  3KLO A;  3J7A O;  4RB0 A;  3WTX C;  4DQ2 A;  3I4P A;  4D0P A;  3KP5 A;  2K86 A;  4JK1 X;  1R1V A;  1MZB A;  4WXH A;  1FWZ A;  4XLN F;  1J5Y A;  2VOD A;  5ERI A;  4RS8 A;  1UCR A;  2E1N A;  3FF5 A;  4FT8 A;  2QWW A;  5F1R A;  3Q9S A;  2OA4 A;  3TQN A;  4UV8 A;  2KRF A;  5HS8 A;  4FHT A;  4Q4Z F;  3TOA A;  3RYR A;  3WGG A;  3K0L A;  4WWC A;  2Q2E A;  1Y0U A;  2NNN A;  1B9N A;  1YS7 A;  5H6R A;  4KIG A;  2G9W A;  2RV8 A;  1UST A;  4BAY A;  4OOI A;  1STZ A;  5HLH A;  4S05 A;  1LVA A;  4LK1 F;  4XSX F;  5A2Q Z;  5BPD A;  1QO0 D;  3DPT A;  3WGI A;  1F4K A;  4P9U A;  2VBW A;  2IRF G;  3ISP A;  3ZN1 A;  2ACJ A;  1WQ2 A;  3V7C A;  3EYI A;  4B09 A;  2YU3 A;  4IVN A;  4AIH A;  5DCM B;  3ZMD A;  4LD5 A;  3SHF A;  3JTH A;  3GF2 A;  4U0V A;  5LRS A;  1FLI A;  3FX3 A;  3FM3 A;  3DQV C;  2A68 F;  2EFW A;  3DF8 A;  4UVB A;  3V8K A;  2OZ6 A;  3ULQ B;  3P9C A;  5E1Z B;  2XHK A;  5AIQ A;  4WCG A;  5EEG A;  3VEP A;  1SD6 A;  1K78 A;  5D8K B;  1ZG3 A;  2F5F A;  2P7C B;  4CXF A;  1LDJ A;  3LA7 A;  4O3M A;  1J75 A;  1O7F A;  2GA1 A;  1W5S A;  3E5Q A;  4NB5 A;  1VTN C;  3RDI A;  3HRM A;  3F6V A;  4P5O A;  3MZH A;  3QOP A;  4GYG A;  3L2C A;  3V7R A;  3ABT A;  2VC0 A;  2Z99 A;  2HTJ A;  1U5T B;  3IWZ A;  3KFW X;  1P92 A;  1R7J A;  1DP7 P;  3PQJ A;  4I98 B;  3WU1 B;  5FFZ A;  2D45 A;  5J6X A;  1E17 A;  4EGY A;  1KU7 A;  1H9G A;  3JSO A;  2FMY A;  5AON A;  1BJA A;  3R61 A;  4HZF A;  3JAM K;  2Y0M A;  4EM0 B;  2VBY A;  1MD0 A;  3J80 K;  2NNY A;  2J5P A;  1G6N A;  2EV6 A;  1ZRC A;  4L0Y B;  3ZMS A;  3KP3 A;  5LGU A;  1MKM A;  4WF2 A;  4KN4 X;  3ERE D;  1TW2 A;  3V7S A;  1BIA A;  3F8M A;  1MJ9 A;  4LLG F;  1RZ4 A;  5D6E A;  5FO5 A;  2YSR A;  1QPM A;  1SFU A;  2BE5 F;  4EM1 A;  5LBQ A;  2EWN A;  2M87 A;  1LEB A;  1J2X A;  2XKO A;  2GXG A;  1L3L A;  4AWX B;  2ZNY A;  1MDM A;  3HHG A;  4KIB A;  1TW3 A;  1R1T A;  3M1E A;  4QWQ A;  2BEO A;  4EJV A;  4G7H F;  1O3R A;  3LA3 A;  1YLF A;  2CGP A;  1BI0 A;  2HKX A;  1R23 A;  5CVI A;  3RPU A;  1Z6R A;  3V8L A;  2HYG D;  3C18 A;  4OIP F;  2PMU A;  5BOX A;  1Q1H A;  2MA3 A;  1ULY A;  3QP5 A;  4HX7 A;  2JRT A;  3GFL A;  3I59 A;  5L3B A;  2F2E A;  5A2Q K;  3U1D A;  1SMY F;  3N4M A;  1LQ1 A;  4HQM A;  1HW1 A;  2DTR A;  1I6X A;  3I59 B;  3T1B A;  2LF8 A;  3K9T A;  2V79 A;  1HW5 A;  1S7A A;  4L9T A;  5ICC A;  4JQF A;  4GYI A;  5J8C A;  3MQ0 A;  2CQK A;  3ZN0 A;  1ZGA A;  2QLZ A;  4XRF A;  4HV6 A;  2M5W A;  1JE8 A;  2DQR A;  2X4H A;  4KT5 C;  1E2X A;  3L7W A;  3U2R A;  1W4M A;  2VE9 A;  2ETH A;  1IXR C;  1U78 A;  1IN8 A;  4MTE A;  4A6E A;  5HLI A;  2PBI A;  2IA2 A;  3I5U A;  1YIO A;  3D0S A;  3CUQ B;  3TOB A;  3F3X A;  3GLX A;  2WWY A;  5HVQ C;  2A5Y B;  5CYV A;  2VBZ A;  5K5R A;  1BC8 C;  1Z9C A;  3FMS A;  5HDK A;  4RB3 C;  1KU9 A;  1ON1 A;  4M9Z A;  4XSZ F;  4HDU A;  2JTV A;  1B1B A;  3C3W A;  3HSF A;  1W7P D;  4DNC A;  4A0Y A;  5E20 A;  5CVR A;  3BDD A;  4B8X A;  4EM2 A;  2LSO A;  3N97 A;  1Z05 A;  4BNC A;  5ICE A;  2QVO A;  3MEX A;  1CF7 A;  1G3W A;  2QBY A;  1FPQ A;  3HUG A;  2D2W A;  2FNP A;  5JVT A;  1FSE A;  4YII A;  1Z91 A;  1P4X A;  2QBY B;  4ESB A;  1LJ9 A;  5DV5 A;  2YX4 A;  1IN6 A;  1ONV A;  3GZ6 A;  4IHS A;  3BJA A;  5JR3 A;  2MD5 A;  2GQQ A;  4I02 A;  5L3C A;  3L9F A;  4MHG A;  2L4M A;  2UZK A;  4PZJ A;  5FD5 A;  4ZYH A;  1GHC A;  2XAF A;  3SZP A;  2DPU A;  3KEO A;  4R8H A;  3E5U A;  1GXP A;  1USS A;  3GUD A;  3LFK A;  3Q5F A;  2DK5 A;  3EET A;  4UV9 A;  2MC3 A;  4RGR A;  1B6A A;  5JHU A;  3O3K A;  2FBI A;  3COA C;  2P5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...