2D1HA

Crystal structure of st1889 protein from thermoacidophilic archaeon sulfolobus tokodaii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
102
Chain Sequence
b'MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYSISSNILEKIRNDLLNCAKRMELAAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 109aa long hypothetical transcriptional regulator
publication title The putative DNA-binding protein Sto12a from the thermoacidophilic archaeon Sulfolobus tokodaii contains intrachain and interchain disulfide bonds.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 32
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d1hA00
2EWNA 3GVAA 1YQAA 1Z9CA 4MQVA 1ODDA 4AIHA 2D45A 3IRRA 5D4RA 2YX7A 1OYWA 5LLQA 4IXAA 3V7SA 3KCCA 4IHTA 1XSDA 2HZTA 1BI0A 4HLYA 4Y15A 1UB9A 5D8KB 3V7RA 4ZYHA 3I53A 4I09A 1RZ4A 3LAJA 2DFIA 2VBWA 5A2QZ 3TO7A 1XN7A 3WTSC 2GA1A 5E1ZB 1IN7A 3LSTA 4ETSA 1ZREA 2OU2A 2ZMEA 3V8LA 5HS7A 4I7HA 3O6BB 3K1PA 3IWFA 1KYWA 4BHBA 3F8MA 3I0TA 5FGMA 2EB7A 2F5EA 3K69A 3QAHA 4HDVA 5IT9Z 4FX0A 2OZUA 5F64A 4FHTA 4L9VA 5D6FA 4A2UA 4PGGA 1G3SA 3RKXA 3T8TA 4ESJA 1FOKA 2R3SA 4CO8A 3OOPA 1QZYA 2OBPA 2Q2EA 2A3SA 3L2CA 3H3ZA 4UUVA 1EH8A 1XGOA 2Z3YA 4MHGA 2L54A 5DYMA 2M30A 3E5QA 1O3RA 1D8KA 1R00A 4RGSA 1HW2A 2OAZA 4GCVA 2XRNA 1O7LA 1G4DA 1U5TC 1K6OA 1U6GA 4KMFA 1HKQA 2ZNZA 4EQQA 1FSHA 4M9XA 2DO7A 2V9VA 2OD5A 3Q5FA 3SZPA 4BQAA 1BM9A 1UHMA 2ZKZA 1HW1A 4U0VA 1L3LA 4OU0A 2V79A 2NYXA 3QPHA 4ASNA 4LD5A 3PQKA 1FX7A 1S8NA 3BOQA 3GEZA 4BXUA 1FP2A 3RYRA 3CUQA 2KJCA 2XVCA 2UZKA 2K7LA 2O3FA 2WV0A 1DDNA 4YFNF 1SAXA 1YW8A 3TO6A 2FRHA 3BZ6A 1WQ2A 3I4PA 4WX9A 4EJVA 3ZMTA 4LMYA 4F7ZA 1XGSA 5BQTA 4EJWA 3BJ6A 2A69F 4PCQA 5EEGA 2DQLA 4KDPA 2HYFA 3EETA 4LB6B 2XKPA 4B8XA 5DCMA 2G7HA 1QO0D 3WU0A 1J75A 2EJRA 3WGGA 1TW2A 2EFWA 2P5LC 5A2QK 1WSUA 1FYMA 3JSPA 3K9TA 4P96A 2PBIA 3MCZA 4O3MA 1H0MA 2MBFA 3F8BA 2HKXA 2DLLA 4KT5C 1AOYA 3HTSB 3RTRA 2MH9A 3F21A 2FEZA 2CO5A 3WTTC 2DK5A 2K4JA 4ON0A 1BOAA 1W4MA 5IT9K 2F5FA 2KIUA 1BI1A 3M7GA 1MDMA 3HHHA 5HLGA 5HS9A 1BC7C 1MGTA 4WXDA 1DP7P 5H6QA 4WK8F 4WWCA 2QBYA 1FBSA 1W5TA 2RN7A 2P5VA 2ETHA 3E5XA 4LLLA 4CICA 3I71A 1ZG5A 5H6RA 1FY7A 2XROA 4L9JA 3LQQA 4DNCA 4FX4A 2FMYA 4XSXF 1XGNA 1XMAA 4WF2A 5DUIA 4HAMA 5H20A 2YX4A 2E7WA 5AIPA 4P9UA 2RNJA 4KYWA 3C3WA 3ZMSA 2MLGA 1IN5A 3E3VA 4EMSA 3E6BA 2E1CA 4LGWA 4LLNA 2VBXA 3FMRA 4XLPF 3IL2A 3H3UA 1I1SA 5JR3A 4KUMA 1YS6A 4LJZF 1FPQA 2DPUA 1D8JA 4IVNA 4I02A 5HDKA 2PMHA 4EJTA 1R23A 2HYGD 2JT1A 1TNTA 2W24A 1S29A 3FXQA 3MZYA 2LF7A 1SD5A 3ZPLA 4EGZA 3DQVC 3KP6A 1ON2A 3F23A 1P92A 3C7JA 3WTUC 4ESBA 3GUDA 2KKOA 3FMSA 4KN7X 4XSZF 1RUOA 1UCRA 4AVPA 3U2RA 5J8FA 5HOOA 2E1NA 3COAC 5JFRA 3G3ZA 2GXBA 1F1ZA 1DUXC 4UVCA 1KQ0A 4I98B 1I1GA 1I5ZA 1REPC 1LB2A 5HLHA 2D1VA 3I58A 3T1BA 2XAJA 2DPDA 1XCBA 4QWQA 2MH2A 1B9NA 5K1YA 2EFNA 2WC2A 2ELHA 5DDGA 2LKPA 5BMZA 1R5HA 2A6EF 4H0EA 3CUQB 1W7PD 3TOAA 2D1HA 1TBXA 3J81Z 3BWGA 4LFUA 1F5TA 2F5DA 2KIMA 4AWXB 2PG4A 3BPVA 4HX7A 3MAJA 1GXPA 2XHKA 2YU3A 4Q48A 4IJAA 4XLNF 5ILUA 5BPDA 3DFGA 4R1HA 1SMTA 1FYLA 3T5XA 4B09A 1V4RA 2A68F 2EV0A 1S7AA 2HQNA 1W7PA 3R4KA 2JZYA 3C1DA 4IRHA 2STWA 3ISPA 1XD7A 5DD4A 2DT5A 2HDCA 2XIGA 5HDNA 3K1MA 1BC8C 2DTRA 3ZMDA 2IA1A 4ENNA 1O57A 5HDGA 4ZZDA 2X0LA 2DAOA 5ILVA 1KU3A 1OYYA 5FO5A 3CDHA 3DV8A 4L5JA 2L4AA 4ZH4F 4P5OA 5CLSA 3BPXA 5F1RA 1K78B 2BGCA 5DV5A 2QQBA 1P6RA 4YFXF 1TQPA 1Z05A 2XAGA 4BHCA 3GLXA 3KP3A 4EJOA 2A6HF 3VFZA 3EYIA 4L0ZB 4HF1A 2NNYA 3VEPA 3HRSA 2GXGA 2V6CA 2O61A 1QNTA 3QP5A 2ESHA 5E8GA 2CWEA 3P7NA 3KETA 2FOKA 3IC7A 2STTA 4JQFA 2QWWA 5LRRA 3NQOA 3CO6C 3M8EA 3IKTA 3QOPA 1KQ9A 3FHZA 3ERED 2AS5F 1MJAA 2YPRA 2M87A 1HSJA 2L3DA 3DEUA 1F4KA 2K4BA 3OV8A 3LWFA 1SD4A 4S05A 1USSA 2IVMA 2HEOA 5HS8A 3KP5A 2HS5A 1B4AA 3H92A 4R79A 4RAYA 3VOEA 5K5QA 2UXXA 2O8XA 2IA0A 1U2WA 2EFPA 4ZYEA 1G3TA 3FX3A 4M72A 6PAXA 4KFCA 3J81K 5HVQC 4QLCU 1IAWA 1BBYA 3GZ6A 1YIOA 1QQIA 1U8RA 1GXQA 3DF8A 4A0ZA 3WTXC 3BROA 1ULYA 1RUNA 2EFQA 5LBQA 1XCVA 2R7FA 5LHGA 3HSRA 3PFIA 1TQIA 3FXRA 1SD6A 1VTNC 1U5TB 4I0AA 2ZBKA 1T2KA 2H94A 4CDGA 1FC3A 1JXSA 4EJUA 2V1DA 1OPCA 2VT2A 4M73A 3O2PE 1OYIA 3LQRA 1DPUA 1YW7A 2QZ8A 3E6DA 1WKMA 3GFMA 4UXNA 1YW9A 4M6YA 1XB4A 4KN4X 2VT3A 3MEXA 4AD9A 5AONA 2EA4A 4YIFA 3N4MA 3HTUA 3I59B 2P7VB 1MZBA 3ZMZA 2DQRA 4NHJA 2FQ3A 1IN8A 1BJAA 2QM3A 5ILSA 4PGHA 3BP8A 2GWRA 1WRJA 3IKVA 1B6AA 3CO7C 2X4HA 3RKWA 1IXCA 1FBQA 1FSEA 1R36A 2P8TA 4MQ9F 3F22A 3VB2A 3E6CC 3ML6A 1F9NA 4HQMA 4ESFA 1JGSA 2GAUA 2XAHA 3TOBA 5DD8A 1KU2A 2VE9A 3J7AO 2UWMA 1FBUA 1W7PB 5BPIA 2VN2A 3P9IA 5L3CA 1PUEE 3FM5A 1Z6TA 2VONA 3VODA 4L5IA 1PP8F 3GFIA 5L3DA 2J5PA 3RKYA 4G7OF 3KEQA 5LGNA 4HF0A 2COMA 2P6TA 1SMYF 2CSOA 2Z9OA 5LGUA 3B02A 3LA2A 4BH9A 2EK5A 3FZVA 3K0LA 2RC4A 2W85A 1RI7A 2QYOA 3HOSA 2XAQA 4CZZA 2JPCA 3L9FA 1H9TA 2BEOA 2ZXJA 1R22A 4KIGA 1FP1D 1LDJA 1STZA 5LEKA 3JTGA 3O3KA 3M9AA 4HQEA 4A6DA 4RAZA 2NNNA 3JAMZ 1BI3A 3ZMUA 4LB5A 2XV4S 1K78A 4I0BA 4I01A 1ZGAA 3F72A 4Q47A 4EV0A 5EEHA 2ISYA 2P6SA 2H27A 3E97A 4HX8A 2K27A 5CVUA 4ZZLA 1ZG1A 2HTJA 1J0RA 2VC1A 3RJPA 3DPLC 2NS0A 2B0LA 4M71A 4ENMA 2C6YA 3JW4A 4P9FA 4LK0F 3ZN0A 5TRDA 1CF7B 4BAYA 3ZMVA 1H9GA 3M8FA 5J8CA 5F6FA 3T8RA 5ERIA 4UHTA 4KA4A 2FBKA 3GX4X 4RB1A 5FD6A 4HF2A 2MD5A 1YFHA 1QBJA 1MD0A 2VXZA 3LA3A 2ESNA 3SQNA 2F2EA 1ZG3A 5HLIA 1GVJA 1RNLA 4GYGA 1R5GA 1RIOH 3HSFA 2CFXA 2QQ9A 1KQ8A 4ENJA 3RIRA 4UV9A 1YTYA 4MNUA 1AWCA 4Y17A 2IP2A 2IJLA 1HSTA 2M45A 2HFHA 3W6KB 5FLXZ 1HBXG 2H6CA 2LF8A 5IT3A 3HIFA 3P9CA 1MJ9A 3WTVC 5JI6A 4ENKA 3HSEA 4G94A 2CQKA 2HKOA 4G6DA 3TQNA 2W84A 3FM3A 3CLOA 1QZZA 4MEXF 4MTEA 3ZP5A 1ZLJA 4XBFA 4RB0A 4U0YA 2Z33A 4Z2YA 2ZJ2A 4RS8A 1B9MA 5L3FA 1SD7A 2IRFG 3LFKA 5K5RA 2EV6A 1L0OC 4O6JA 1C0WA 3Q9SA 1U5TA 2ISZA 1LDKB 2FBHA 2QENA 3EQLF 3HUGA 2Q8KA 2R7DA 4OMZA 2YSRA 3WE2A 1ZYRF 5TJJA 3N97A 1A04A 4RB3C 3MQ0A 1IRFA 1JE8A 2ADUA 3DXJF 4L18B 4RGUA 2HR3A 3T0YA 5ED4A 3I59A 3ULQB 4EGYA 2P5KA 3WU1B 3JAMK 3NEUA 2CW0F 1QGPA 5FFXA 2UXNA 1KU9A 2OQRA 5FB2A 4AIJA 4D0PA 5D6EA 3CTAA 1ZH5A 3LAPA 1ZARA 1R7JA 3KZZA 1P4XA 4WCGA 3KE2A 4YIIA 4RGXA 1IUYA 2A5YB 1WWXA 2Z99A 1K7AA 2M8EA 1J59A 3R60A 1BIBA 1XSXA 1SFUA 4OINF 1G3YA 1R1TA 5JHUA 1ZHFA 3GF2A 1I27A 3EDPA 1TQMA 4OOIA 2L4MA 2ACJA 4NQWA 1SFXA 2XAFA 5D5XB 4BNCA 1FLIA 4O5VA 2HWVA 1IF1A 2IA2A 2JSCA 4LG0A 4U88A 3V7CA 1HW5A 2PN6A 3W6JB 2HTSA 4PZJA 3FXUA 3R0JA 5CVVA 1T38A 3F6VA 1IXRC 2CYYA 2BV6A 2PJPA 3GXOA 5CVJA 4M74A 4EM0B 2FNPA 4G6QA 1T0FA 3HRMA 1J5YA 2DI3A 5E20A 3M1EA 2K86A 4U7DA 1J7KA 5L3BA 5KVRA 1D5VA 3KLOA 1HQCA 1ZLKA 3MFKA 2AXLA 3DP7A 3SHFA 3ABUA 1Z1DA 5CJ9A 2FMLA 1Q1HA 3V8KA 1D3YA 3KEOA 3D5LA 1ZRCA 3ZQ7A 2P7CB 4HV6A 1FZPB 1ZRFA 1R58A 1O3SA 2JTVA 1J9IA 1CF7A 2MLKA 1JHHA 4IRIA 4EM2A 3U9GA 5BOXA 3QU6A 1ON1A 3MWMA 1XDSA 2HQRA 5CVIA 2WWYA 5BS6A 1YLFA 2HGCA 1CGPA 2DU9A 5KK1A 1B59A 3GFLA 3V4GA 2G9WA 3TKYA 1IW7F 2QVOA 3GYHX 1LVAA 1S3JA 1DPRA 1EH7A 2P4WA 3BJAA 3GW2A 3KLNA 1YYVA 1XGMA 2G7UA 3ROUA 4R8HA 4M9SA 2OZ6A 1P2FA 4JK1X 2JPBA 2VBZA 4HV5A 2PMUA 2OA4A 3BDDA 3ABTA 4LK1F 2VE8A 1LQ1A 3G73A 4CYDA 3RPQA 2Z5UA 3I64A 1LEAA 2M1BA 4P55A 2J5OA 2VBYA 5LRSA 4G8XA 5DUKA 1OR7A 3WODF 5LHIA 2DK8A 3GO5A 1SFEA 3ECHA 1KA8A 1GHCA 2DBBA 5AIQA 2V1UA 3R0AA 4A0XA 2XGXA 3PQJA 3RDIA 4IRGA 1V3FA 1ZRDA 3QP6A 1QPMA 4XRFA 4A6EA 5E18F 3IHUA 2PQ8A 1Y0UA 4RGRA 4GXOA 1HKTA 4HYEA 5FFZA 4HZFA 2V1XA 1E17A 3BY6A 1Z7UA 1HKSA 4CHUA 3WTZA 2PI0A 5FD5A 1Z6RA 1T98A 4TV7A 1FNNA 3KP7A 3REOA 2O6GE 4KIFA 1TLHB 2LNBA 1FWZA 5D5VB 4LG0B 3E5UA 4EM1A 2QUFA 5DEQA 4OMYA 2W25A 1IN4A 4G9YA 1KGSA 2XUBA 1TTYA 4WXHA 3Q9VA 2LDUA 2OQGA 3K2ZA 1G6NA 3R6SA 4OIOF 2FU4A 3FF5A 3WG9A 1YS7A 2M5WA 1ONVA 3WTWC 3MZHA 3LA7A 3P9KA 2MA3A 2Y48A 4CGZA 3SZTA 1I6XA 2GIVA 1P4WA 2E7XA 4HBLA 1NHAA 4U7BA 4Q4ZF 3DKWA 1UFMA 3IWZA 1U3EM 3I5UA 3WTYC 1O3TA 2W57A 5D5UB 2BYVE 4ZYGA 2RDPA 3F8NA 4MEYF 1EH6A 3WGHA 1TW3A 4U0WA 1BIAA 2EV5A 4HX4A 5ICCA 3ZN1A 2D2WA 1IN6A 1LEBA 2FXAA 4K2EA 2MC3A 1KYZA 3L7WA 2RVCA 3F8CA 5K5OA 3HRUA 2VODA 3BJOA 4A12A 2NRAC 2XASA 2EA2A 4A5NA 5ICEA 3I54A 2GZWA 4EVIA 4KNYA 1X3UA 4N9HA 5D4SA 4WXCA 1XMKA 4UNOA 3J80Z 3RI4A 5JVTA 2VC0A 1LJ9A 2A07F 3WGIA 4UV8A 2ZMEB 4I2OA 2YR2A 2H09A 3NRVA 3RPUA 1WI9A 3EUHA 2FF4A 3ELKA 4UVAA 4AIKA 1ZAOA 3HRTA 3KFWX 2Y75A 3L09A 4M9ZA 3GWZA 1OMIA 3TGNA 2KJBA 1IXSB 2IPQX 1Z91A 4FT8A 1R1VA 2HOEA 4GGGA 4L9TA 2JRTA 4NB5A 1O7FA 3SFZA 3V8JA 4IHSA 2FE3A 4OIQF 1PP7U 1S6LA 3KZYA 4ZYDA 1UHWA 1B1BA 1IZ1A 3QPTA 2L01A 4KIBA 4M6XA 3HHGA 2O03A 1FYKA 4L0YB 2CGPA 4S04A 5DCFA 4GO1A 2GQQA 4IPAA 4MGRA 1YG2A 4IF4A 5CYVA 2L02A 2DW4A 4GYIA 2LSOA 4G7HF 1ZN2A 3TDUC 4YFKF 1TNSA 4KMUX 1KU7A 1EV7A 2K02A 4DQ2A 2A61A 1T39A 4OIPF 1R1UA 3QU3A 2VOPA 4YG2F 3FWEA 4N0BA 1BN5A 1S7OA 3S2WA 3F3XA 2ZNYA 4PDKA 5L3EA 2O0YA 1BI2A 4HW0A 5LGTA 3SXYA 3KP4A 2EFOA 1W5SA 2KRFA 5J6XA 2FBIA 3CJNA 1MKMA 3GFJA 3R61A 2NAZA 3JTHA 4L9NA 5CVRA 5D8LB 3E6MA 2IT0A 5L3GA 2RGVA 5E8IA 1P4AA 4BYYA 3JSOA 2CG4A 2FSWA 2KIFA 3TDZC 3F6OA 2QLZA 4HDUA 1FT9A 1XSVA 5DCMB 3U1DA 1K79A 1USTA 4G7ZF 5ICFA 2TDXA 3GZ5A 4LLGF 3CUQC 5ICGA 3DPTA 3L00A 3J80K 3TO9A 2PEXA 2ZO4A 3B73A 3CUOA 2RQPA 5E1XA 5FLXK 4HA8A 1LNWA 1HXDA 4KICA 3AAFA 1LDDA 2GA2A 1J2XA 4HLXA 5E17F 2BBYA 3C18A 3F8FA 4E70A 1IRGA 1O3QA 3K1NA 5LHHA 2BE5F 2WTEA 4RB2C 2QQAA 3RYPA 1MDMB 1XDUA 3IRQA 5D5WB 2QBYB 1G3WA 3FMQA 3WE3A 2RKHA 2VOOA 4A0YA 4A5MA 4Y13A 1OKRA 2IW5A 3D0SA 4UVBA 4N9IA 1PDNC 1E2XA 1U78A 2Q0OA 1YO5C 3EYYA 4HOBA 1MJBA 2H6BA 2ZCWA 2XKOA 4JBAA 3HOTA 2FA5A 4BHPA 1JHFA 2F5CA 3KP2A 4OIRF 4CXFA 4Q5SF 5LEJA 5E1WA 4MTDA 2ZFWA 2PFBA 2RV8A 2FNAA 3ECOA 3HYIA 1T6SA 3QRFF 2PLYA 2Y0MA 1ZGJA
chains in the Genus database with same CATH superfamily
2EWNA 3GVAA 1YQAA 3DPUA 1Z9CA 3H5NA 2CQXA 4N4OB 4MQVA 1ODDA 3DU5A 4UB8C 4AIHA 2D45A 1APLC 3IRRA 3CCLI 1YX3A 5D4RA 1Z3YA 1QRYA 4EATA 2BOLA 2YX7A 1OYWA 5LLQA 4IXAA 3F9KA 3V7SA 3KCCA 1S72I 4IHTA 3C2GA 2MW8A 3H0GJ 1XSDA 2HZTA 1BI0A 4BXFA 4HLYA 1U0JA 4Y15A 1UB9A 5D8KB 3V7RA 4ZYHA 3H5RA 3I53A 1ACIA 1VQ9I 4I09A 1AA7A 1BJZA 2PMZN 1RZ4A 3LAJA 2DFIA 1WZ2A 2VBWA 5A2QZ 3TO7A 3S2HJ 1XN7A 3WTSC 1SVMA 2BHYA 2GM4A 2GA1A 2L5QA 5E1ZB 1IN7A 3LSTA 4ETSA 1ZREA 4G12A 1QZEA 2OU2A 3OYBA 2ZMEA 3V8LA 1ETWA 1FMVA 3QYEA 4I7HA 4XOPA 5HS7A 3OYKA 3O6BB 3LNQA 3K1PA 3IWFA 1AU7A 1KYWA 4BHBA 2E2IJ 2M2EA 3F8MA 4PJNA 3I0TA 1E3PA 5FGMA 2EB7A 2F5EA 1YRNA 3K69A 3QAHA 4FISA 4HDVA 4CCKA 4FX0A 5IT9Z 2IEKA 2OZUA 5F64A 4FHTA 1KZHA 2HVRA 4XLEA 4L9VA 5D6FA 3FBIB 3W2AA 4A2UA 1VQMI 3U1KA 4PGGA 4A93J 1J09A 1G3SA 4QIWN 2ZB9A 3PJRA 2LP0A 4QPQA 3RKXA 1ORKA 2F48A 2IGNA 3T8TA 1X58A 1OCPA 4ESJA 4IZZA 1XPXA 3BR5A 1FOKA 4D1QA 2R3SA 4CO8A 3OOPA 1QZYA 2OBPA 3JRGA 1IJWC 4W97A 2Q2EA 1MSFC 3I9V2 2DTZA 1QU3A 2A3SA 3L2CA 4NNJA 1R4NB 3H3ZA 2EBIA 3EUAA 1D0ZA 4UUVA 2E5ZA 5M5YJ 1BW6A 1EH8A 1GLNA 1MMGA 1XGOA 2Z3YA 3HPHA 2L54A 4MHGA 3SFIA 5DYMA 2H1KA 2M30A 4BY1J 3E5QA 1O3RA 1OQYA 1D8KA 1Z77A 1R00A 4RGSA 3KYCB 3HOXJ 3S1RJ 1HW2A 2OAZA 1LKXA 3OOUA 3DBHB 4GCVA 3ZQLA 2XRNA 3CD6I 1K61A 1O7LA 2X6WA 4ZJZA 2R7XA 5F1JA 3HKZN 4E7ZA 2K3PA 2KL4A 1G4DA 1QPIA 1U5TC 1WJEA 3GTOJ 3RZOJ 2NS7A 2RREA 1K6OA 3OYHA 1H89C 1P7IA 1U6GA 4KMFA 2X51A 3QOEA 1HKQA 5EGOA 3CCJI 1RETA 2ZNZA 1BA5A 2E1MB 4EQQA 1FSHA 4M9XA 1ZR2A 2DO7A 2V9VA 2OD5A 3Q5FA 1X3ZB 1E0EA 3FXLA 2Y69H 2O8KA 2FUG2 2EH3A 3MVPA 4AYBN 3SZPA 4BQAA 1BM9A 1UHMA 1UZCA 2ZKZA 1HW1A 4U0VA 1YJWI 2EZIA 1L3LA 4OU0A 4ZDOA 4IEJA 2V79A 1NTCA 2NYXA 3QPHA 2WB1A 4ASNA 1D5YA 4LIVA 2O9LA 4LD5A 4G6TB 3PQKA 4DBRA 1FX7A 1S8NA 2BHZA 2YU9J 3BOQA 3GEZA 2HOTA 4BXUA 3GTLJ 1FP2A 4Y4RA 3RYRA 5GAGJ 3CUQA 2KJCA 2DFEA 4A3MJ 2XVCA 2K7LA 2O3FA 2UZKA 2WV0A 4RM3A 1DDNA 2QSFX 4YFNF 1IO2A 1CQTA 2HPIA 1SAXA 1YW8A 5DS9A 3TO6A 1MBKA 2FRHA 3BZ6A 2R4GA 1U9NA 3SDBA 1S9HA 1TWHJ 3DU6A 1WQ2A 2BXYA 4FE4A 5KNLA 3I4PA 4WX9A 4EJVA 4HNVA 3ZMTA 3MD2A 3CZ6A 2R7OA 3CMAI 4LMYA 4F7ZA 2KZGA 3GTQJ 3G71I 1XGSA 4UUSA 3DBRB 5BQTA 3TMOA 4EJWA 2V9KA 1G8XA 3BJ6A 3ABLH 3S15J 2A69F 2ECBA 4PCQA 5EEGA 2DQLA 4KDPA 3CDLA 2HYFA 3EETA 3ZCOA 4LB6B 2W82A 2ZFUA 2XKPA 4B8XA 5DCMA 2G7HA 2VUMJ 4IHWA 3K2AA 1QO0D 3WU0A 1J75A 2EJRA 3WGGA 2V7FA 4IHYA 2V6EA 1XS9A 1NH3A 1TW2A 1JJ6C 1Z21A 2EFWA 3BCAA 4BQQA 2P5LC 3BG7A 5A2QK 5IYCJ 2JRMA 1WSUA 3HZJA 1FYMA 3JSPA 3K9TA 2JA5J 3I4NJ 4P96A 2IXSA 2PBIA 3UKGA 3MCZA 1H8AC 4O3MA 1H0MA 2MBFA 3F8BA 5HODA 1VNDA 2HKXA 5F0FA 1VZ0A 1X3WB 5HNFA 2HOSA 3FDYA 2CU7A 2DLLA 4KT5C 1AOYA 3HTSB 2E71A 1SVOA 4LITA 3RTRA 4BKXA 2MH9A 3F21A 3HOWJ 2CQ7A 3ASNH 2K9NA 2FEZA 5B5EC 2R7TA 2CO5A 3WTTC 2DK5A 2KP6A 2K4JA 1MBFA 4ON0A 3CJTB 1BOAA 1W4MA 1W36C 2GLOA 5IT9K 2F5FA 2KIUA 1BI1A 3M7GA 1ETVA 2AO9A 1MDMA 3HHHA 3BG5A 2HU9A 3EUKL 2MC4A 5HLGA 2L9NA 5HS9A 4DYCA 1BC7C 1MGTA 4IOCF 4WXDA 2Y9YA 1DP7P 5H6QA 4WK8F 4WWCA 2QBYA 1FBSA 1R5ID 1DP3A 1MBJA 3CP2A 1W5TA 2RN7A 2IS6A 2P5VA 2ETHA 3DLLF 4GDFA 4RAGA 3E5XA 4LLLA 2XPUA 1MBEA 1Y6IA 4CICA 3I71A 1SANA 4NC8A 1SC7A 1ZG5A 5H6RA 1P7JA 5JHFA 4BACA 5EJCA 1FY7A 3AL0B 4L9JA 5EDNA 3LQQA 4DNCA 2XROA 4FX4A 2FMYA 3CC2I 2OJED 4XSXF 1D1BA 1XGNA 1Y8RB 3DCFA 1YI2I 1KONA 2JA7J 1XMAA 4WF2A 4XORA 5DUIA 3GTMJ 2X6OA 4HAMA 2HQAA 5H20A 4CCOA 2YX4A 2HDDA 2E7WA 2Y31A 5AIPA 1JKPC 1UHSA 4P9UA 2LG4A 2RNJA 3HOUJ 4KYWA 2X1CA 5J4YA 2VLAA 3C3WA 2EZHA 3ZMSA 3S3OA 2MLGA 4XRSA 1PJRA 3D1NI 4C30A 1IN5A 2OUMA 1NG6A 3E3VA 3SEQA 4EMSA 3E6BA 4BS9A 2E1CA 3CJRB 3OYAA 4LGWA 4LLNA 2VBXA 3FMRA 1T95A 1R6RA 3H3UA 4XLPF 3IL2A 1I1SA 3TW7A 5JR3A 4KUMA 1YS6A 4LJZF 5E79C 1FPQA 2DPUA 1D8JA 3N05A 3VYSB 4IVNA 4I02A 4OAYA 5HDKA 2PMHA 4KISA 2XF7A 2JN6A 4EJTA 4ANJA 1R23A 2HYGD 1SVLA 2JT1A 4RBOA 1TNTA 5M3FJ 4BXXJ 2W24A 2XGCA 1S29A 3TEDA 1LUJB 3FXQA 3MZYA 2LF7A 1SD5A 2EIKH 4NC6A 3Q3SA 5FLMJ 3ZPLA 3M07A 4AC0A 4EGZA 3DQVC 3KP6A 4E7SA 2JA8J 1ON2A 5FKNA 3F23A 1VQ5I 1MH3A 1P92A 3C7JA 4ESBA 3WTUC 3GUDA 1PUFB 2KKOA 3FMSA 4KN7X 4XSZF 3HB9A 1RUOA 1UCRA 3S32A 1LVKA 2R0QC 2A05A 4AVPA 1D1CA 3G1OA 3U2RA 3QODA 5J8FA 5HOOA 3HG9A 5C4JJ 3BR2A 1AHDP 3PFYA 2JJ7A 2E1NA 4A69C 2NOJB 3COAC 3FISA 1V55H 5JFRA 3CQZJ 3JRAA 1TWGJ 3G3ZA 4E7HA 5F08A 3CF5F 5IOZA 2NVYJ 2NVXJ 5FKKA 2GXBA 2XPWA 4DOZA 3LSHA 1F1ZA 4C2TA 1IDYA 1DUXC 4UVCA 3RQIA 2X1DA 3ABKH 1KQ0A 4I98B 2LC2A 1I1GA 2ZXWH 2AXTC 3OL4A 3OYCA 1YJ9I 1I5ZA 5IP6A 1REPC 1LB2A 5HLHA 4XN3A 3E1SA 2KFDA 3VWBA 2D1VA 3OSGA 2E19A 3I58A 3T1BA 2DMNA 3K6GA 2E5NA 3ABMH 2XAJA 1PVEA 4YEJA 3RSNA 2DPDA 4BBSJ 3A2KA 1XCBA 4QWQA 4QSHA 2MH2A 1B9NA 5K1YA 5C3EJ 2EFNA 2KLOA 2WC2A 2Z1DA 3K70D 1I50J 2ELHA 3L2WA 1AKHB 4IQJA 2ID3A 2VPRA 3VPRA 5DDGA 3FBNB 2WB1N 3HOVJ 2LKPA 5BMZA 1R5HA 2A6EF 5JLXA 4H0EA 2HXIA 2KT0A 1DQUA 2F4IA 5IY5H 3CUQB 3S1MJ 1W7PD 1Z0XA 2MD0A 1IRZA 3TOAA 2D1HA 3LSIA 1TBXA 2I10A 3DKYA 3J81Z 3BWGA 3KPHA 4LFUA 1F5TA 2F5DA 2KIMA 4AWXB 3E7LA 2PG4A 1U8BA 3ZQQA 3BPVA 4HX7A 3MAJA 1GXPA 2W4SA 2XHKA 5K7HA 2YU3A 4Q48A 3L2QA 4IJAA 2M4GA 4XLNF 5ILUA 2V1NA 5BPDA 3Q0UA 1FIPA 3LSMA 3SEZA 3DFGA 4R1HA 2DMTA 1SMTA 3TL4X 2I5UA 3T5XA 2VKVA 1FYLA 5EF6A 1W36D 4B09A 3U21A 1V4RA 1EKEA 2A68F 1JJ8C 3BR3A 1TP4A 2EV0A 1S7AA 2E34A 2HQNA 5E3NA 1NK2P 4KT6A 3BG9A 3H0DA 1W7PA 3R4KA 3HC7A 2ZJRF 2JZYA 2VKHA 4B4CA 3CCYA 3C1DA 3O8GA 4IRHA 3FXMA 2STWA 3ISPA 1XD7A 3CP8A 1T56A 5DD4A 3ZQHA 1FEXA 3KYDB 1YE9A 2XF6A 2DT5A 2HDCA 2XIGA 5HDNA 4II2A 4V2GA 3K1MA 3JR9A 4E7JA 1W1WE 1BC8C 2CV1A 3OYGA 2DTRA 3ZMDA 2IA1A 4ENNA 3QYFA 5CKTA 1XMXA 2CW7A 1O57A 5HDGA 2NVQJ 4ZZDA 2X0LA 2DAOA 5ILVA 3Q0WA 2ZC2A 1KU3A 4X6AJ 1OYYA 5FO5A 3CDHA 3HPGA 3DV8A 4L5JA 5DM6F 1X4OA 2L4AA 3CJQB 4ZH4F 4PJJA 4HEA2 4P5OA 5CLSA 2PJRB 5M3MJ 3BPXA 1U9OA 5F1RA 1K78B 1BR4A 3VYRB 2BGCA 5DV5A 2QQBA 2DFHA 3H5AA 3H9JA 4XICA 1P6RA 3WHBA 1TQPA 5GPAA 4YFXF 2JWTA 1Z05A 2XAGA 2Y30A 3GLXA 3KP3A 4BHCA 3BG6A 4EJOA 5DM7F 5E3OA 2A6HF 4XR6A 4X0GA 3VFZA 5EZGA 3EYIA 3K4JA 3X2QH 1RC9A 4Y7NJ 2B63J 4L0ZB 1XTAA 4HF1A 2NNYA 3VEPA 1VFCA 2WV1A 3HRSA 2GXGA 2EPFA 2V6CA 2O61A 3HJEA 1QNTA 1W5CC 3QP5A 3OYDA 2ESHA 5E8GA 1QVTA 2CWEA 2LY9A 2ME0A 3P7NA 1WHUA 1GUUA 3KETA 3FIWA 2FOKA 4XNFA 3IC7A 4HPQA 2VJ5A 2STTA 2MSYA 4JQFA 2QWWA 5LRRA 3NQOA 3CO6C 3M8EA 5J1UA 3FKIJ 1IUFA 2DN0A 3IKTA 3QOPA 1KQ9A 3GMEA 4XQFA 3FHZA 3ERED 1O4XA 2AS5F 4JX5A 2OPTA 1MJAA 2K9SA 2MFZA 3JRFA 4D5CA 3EPZA 3BT9A 2Y2ZA 2YPRA 2XGEA 2IGOA 2M87A 1HSJA 5F27A 1OCZH 2L3DA 3DEUA 1Z67A 1F4KA 1NG7A 2K4BA 3OV8A 1DU6A 3BQZA 3LWFA 4UB6C 1SD4A 1FOYA 1USSA 4S05A 2LREA 3I4MJ 2IVMA 2HEOA 5HS8A 3KP5A 2HS5A 4HRIA 1B4AA 3H92A 4R79A 4ZTJA 4PJLA 2KDOA 4RAYA 3VOEA 5K5QA 4GFBA 2UXXA 2O8XA 4DZPA 2IA0A 1U2WA 2EFPA 4ZYEA 3J7ZI 1G3TA 2MYSA 2X6YA 3FX3A 4M72A 4BJ5C 1YOVB 3S16J 6PAXA 4KFCA 3J81K 5HVQC 5EEAA 4QLCU 3OY9A 1K4SA 2CUFA 1IAWA 3PO2J 1BBYA 2K9QA 3GZ6A 1ZTRA 1FIAA 1YIOA 1QQIA 1W0TA 1U8RA 1R4MB 1GXQA 3DF8A 4A0ZA 3WTXC 3BROA 2FX0A 2K9MA 1ULYA 1RUNA 4XLAA 2EFQA 3ONQA 4A3EJ 4D7NA 5TGTA 5LBQA 1XCVA 2R7FA 5LHGA 3HSRA 1VQKI 3IUOA 3PFIA 4HSRA 1TQIA 1GV5A 1T8IA 3FXRA 2KHMA 1SD6A 1VTNC 1U5TB 4E7LA 4I0AA 2ZBKA 1T2KA 2W48A 2H94A 4XOTA 3BC8A 4CDGA 1FC3A 1VQ7I 1JXSA 4IX7A 2M3AA 2UUZA 4EJUA 5JLWA 3HUGB 3EUHC 3A0HC 2V1DA 1OPCA 2VT2A 3QPLA 4M73A 4C3JJ 3O2PE 1OYIA 1SEUA 3LQRA 1ZELA 4FQGA 4BDYA 1PUFA 2KMUA 1DPUA 2XSDC 4DYQA 1YW7A 2QZ8A 3E6DA 1WKMA 3SDGA 1XX5A 1GT0C 1I3AA 2XB0X 2BY3A 4NC7A 3GFMA 2V4JC 5M5WJ 4UXNA 1YW9A 4M6YA 5KHDA 1XB4A 3CCUI 4KN4X 2VT3A 3IAM2 3MEXA 4I99C 2CW8A 2V9PA 4AD9A 2LLKA 3VYUB 5AONA 2EA4A 4D7MA 2E35A 4YIFA 3OYJA 3N4MA 2K9LA 3HTUA 3I59B 3IH4A 3RQ4A 2P7VB 1MZBA 2Y0SA 3ZMZA 2DQRA 2XRLA 2FQ4A 4NHJA 3OYFA 3IH3A 1QHHD 2VPLA 2FQ3A 1IN8A 1BJAA 2QM3A 4XRMA 1FOXA 2F5VA 4MFEA 2IAIA 5ILSA 4CCJA 4PGHA 1D0YA 3BP8A 2GWRA 3S3NA 3F0CA 1WRJA 3IKVA 1B6AA 3K10A 3CO7C 2X4HA 2G0EA 3DEEA 2VXDA 3A01B 3RKWA 1MMNA 1IXCA 3VYTB 1FBQA 1Y39A 1FSEA 1R36A 3PNTA 3OL3A 2P8TA 2WAQA 3HGYA 1OCCH 1WVRA 4MQ9F 3OYIA 2H8RA 2LTPA 3F22A 3VB2A 2DJNA 3C2BA 3CCEI 3E6CC 1AKHA 2LH9A 3ML6A 2DA7A 1F9NA 2XF5A 1R71A 4HQMA 3HL2A 2LBFB 4ESFA 2X6XA 1JGSA 2GAUA 3K7AJ 2XAHA 3TOBA 5DD8A 1G59A 4HNUA 1KU2A 3GTPJ 2VE9A 1VQLI 3J7AO 2QEXI 2UWMA 1FBUA 1W7PB 3HDDA 2LMDA 5BPIA 2VN2A 3P9IA 5L3CA 1PUEE 3FM5A 1Z6TA 2VONA 5IYDJ 3VODA 3HOZJ 5F0HA 4L5IA 2DA2A 4NBQA 2W00A 1PP8F 4NQWB 3GFIA 2DYRH 3PNYA 1N77A 3DWLE 5L3DA 2J5PA 2OCCH 4BQNA 3RKYA 1ETYA 4G7OF 3KEQA 5LGNA 4HF0A 2COMA 2P6TA 1SMYF 3MKLA 3PUFA 1T08B 1GVDA 1OJLA 1JUSA 2LKSA 4CZCA 2CSOA 3K70C 2Z9OA 5LGUA 3B02A 1YX5A 1ZQ3P 3G1LA 3I55I 3LA2A 1ETXA 2DA6A 5FRNA 1EF4A 4PFPA 4BH9A 4EEFG 2EK5A 1IRXA 3FZVA 3K0LA 2RC4A 4E6KG 2W85A 1RI7A 2QYOA 3HOSA 1WJDA 3GZNB 2XAQA 2L9SA 3P5JA 4I6ZA 4HSTA 1W0UA 4BU2A 4CZZA 2JPCA 4GRIA 4CYCB 3L9FA 3UNGC 1H9TA 1MSEC 2BEOA 2ZXJA 2M0CA 4DZJA 1R22A 4II3A 4BL0B 4KIGA 1FP1D 1LDJA 1STZA 5J40A 2E2HJ 5LEKA 1F36A 3JTGA 3I3LA 3O3KA 1MNEA 3M9AA 5JVGF 4HQEA 4A6DA 1FMWA 4V19K 2JUGA 2ZXIA 3S2DJ 4PFOA 4BJ6C 4RAZA 2NNNA 3JAMZ 1BI3A 2X85A 5FKLA 3ZMUA 3HXLA 4LB5A 1JT6A 2XV4S 1IDZA 3L2UA 1VQOI 4M6VA 2PJRA 1K78A 4I0BA 4I01A 4B48A 5FJ8J 1ZGAA 3F72A 4Q47A 4EV0A 5EEHA 2GIZA 3H9QA 3CMYA 1QVUA 3FXKA 1LPQA 2BW3B 2ISYA 1WI3A 4AUXA 2P6SA 2H27A 2TCTA 2XSJC 2B7EA 3E97A 4HX8A 1T0FC 2QGUA 2LYCA 2KDZA 1FOWA 2K27A 4XLCA 5CVUA 4ZZLA 1ZG1A 2NVUB 2HTJA 1J0RA 2VC1A 3FKJA 3RJPA 3DPLC 4U87A 2NS0A 2Q1ZB 2B0LA 4M71A 4ENMA 5J4VA 2C6YA 3JW4A 4P9FA 4LK0F 3LSPA 3ZN0A 5TRDA 1CF7B 4BAYA 3JRHA 3ZMVA 1H9GA 3M8FA 5J8CA 4PK4A 5IPAA 5F6FA 3T8RA 5ERIA 2VIXA 2F4MB 3J7AY 4UHTA 4KA4A 1I6HJ 3OIOA 2FBKA 3GX4X 4RB1A 3TW6A 5FD6A 2R7ZJ 1WJ5A 2R7RA 4FTHA 4HF2A 3BTLA 3CDIA 2MD5A 1YFHA 2LVSA 2VQLA 3L2RA 5B1AH 1QBJA 1MD0A 4P1WA 5B1BH 2VXZA 2ESNA 3LA3A 3VSKA 2KZVA 3SQNA 2F2EA 3RPUD 1ZG3A 5HLIA 1Y56A 3ASOH 3HOYJ 1GVJA 1RNLA 1HF0A 1X1CA 4GYGA 1R5GA 1RIOH 2Z16A 3HSFA 1XC5A 3ZXSA 2CFXA 1S5LC 3ZQFA 2QQ9A 4RAFA 1QA6A 2JVHA 5TISC 1KQ8A 4LG3A 3RIRA 4ENJA 4UV9A 4B3AA 4FASD 4MNUA 1YTYA 1AWCA 4Y17A 3MKYB 2IP2A 1IC8A 3IP4B 3A4CA 2IJLA 2VKEA 3CCMI 1Z7LA 2CRGA 1HSTA 1MMSA 2M45A 2HFHA 3W6KB 1R9TJ 1VQ4I 4FETA 4XMYA 3ZRGA 3QPSA 5FLXZ 1HBXG 2H6CA 2LF8A 5E3LA 3TP3A 5IT3A 1JI8A 3HIFA 3P9CA 3BR6A 1MJ9A 3WTVC 1RR8C 2DT7B 5JI6A 4ENKA 3HSEA 4G94A 4MLOA 2CQKA 2HKOA 4G6DA 3TQNA 4D9JA 2YUSA 3G1MA 2ME6A 2R7UA 2PMZA 2W84A 3M8JA 3FM3A 3CLOA 1OCOH 1QZZA 3LFUA 4M3FA 4HG2A 3PIOF 1JGGA 4MEXF 4B3XA 2QKLB 4B47A 4MTEA 3ZP5A 1JKOC 1ZLJA 4XBFA 4RB0A 4U0YA 2Z33A 3OIPA 3ZR8X 4Z2YA 4S0HB 2ZJ2A 4RS8A 1B9MA 5L3FA 1HCRA 1RKTA 2L7KA 1HDPA 2DXIA 1SD7A 1X4PA 1MMAA 2IRFG 4DGWB 1I39A 2LRDA 1EA3A 3LFKA 5K5RA 4IKFA 2EV6A 1L0OC 2CUEA 3RZDJ 4O6JA 1C0WA 3Q9SA 1U5TA 2ISZA 4RMNA 2K3FA 1LDKB 2ZMEC 5GP9A 2MABA 2FBHA 2QENA 5E3MA 3EQLF 1HDDC 1H88C 3HUGA 2Q8KA 2R7DA 4OMZA 2YSRA 3BZKA 3H35A 1UG0A 4NDLA 3WE2A 1WCMJ 1ZYRF 5K7ZA 5TJJA 2XDVA 3N97A 1A04A 1JTXA 4RB3C 3OS2A 3KEYA 3MQ0A 2FD5A 1K4TA 2DT6A 2M7AA 1IRFA 3MZ8A 1JE8A 1V54H 2VQCA 2ADUA 3DXJF 4JX6A 4XKCA 3E0JB 4L18B 3B6CA 4RGUA 2HR3A 5H2FC 3T0YA 3O8HA 1TL8A 3GBGA 5IYBJ 5ED4A 3I59A 2EZKA 3ULQB 3OR1C 4EGYA 2P5KA 3WU1B 3JAMK 3HGGA 3NEUA 1MMDA 2CW0F 3BCBA 1QGPA 4RLQA 4QTRA 2MG4A 3OIQA 5FFXA 3IV5A 2WAQN 1ENHA 2CS3A 2MGQA 2UXNA 1OR7C 1KU9A 3AG1H 2LD5A 2OQRA 5FB2A 4AIJA 4D0PA 5D6EA 3HKZA 3CTAA 1RRJA 3S17J 1X1PA 1WFXA 1V5GA 1ZH5A 3LAPA 1ZARA 2QCOA 4IOAF 3OWTA 4M3EA 2QKMB 3D5RC 1R7JA 3KZZA 1P4XA 3A01A 4WCGA 2OTJI 2DA3A 2FOWA 2W1OA 3KE2A 4YIIA 4RGXA 1MBHA 1IUYA 4YELA 2A5YB 2HDWA 1WWXA 2BY0A 2Z99A 1K7AA 1XG1A 2M8EA 1J59A 1YITI 5LD2C 3R60A 4Z6YA 4BE2A 4A3CJ 1BIBA 1XSXA 2LBFA 4BDZA 1SFUA 3H3VK 4KITB 4OINF 1I3QJ 1G3YA 1R1TA 2H1LA 5JHUA 1ZHFA 3GF2A 1I27A 3EDPA 1SAUA 2NXNB 2P0WA 1TQMA 2DOFA 1RPWA 4OOIA 3A1YA 2L4MA 2ACJA 1ETQA 5GPCA 4ABZA 3UR3C 4NQWA 4CCNA 5M5XJ 3SYTA 1SFXA 1IV8A 2VASA 2XAFA 5D5XB 4BNCA 1FLIA 4O5VA 2OCEA 3DTKA 2HWVA 1IF1A 2IA2A 2HQ5A 2JSCA 4LG0A 2AQEA 3OYNA 4U88A 3V7CA 3V42A 4DIQA 1HW5A 2HZDA 2PN6A 2IS4A 3W6JB 2A5WA 2HTSA 3DBLB 4KJZA 4PZJA 1N25A 2QSHX 2RQQA 3FXUA 3R0JA 5CVVA 1T38A 3WU2C 2CFOA 2OC6A 5J1YA 1NK3P 4FE7A 2JK3A 2VB6A 4DYRA 3TP0A 3F6VA 1IXRC 1B72B 2CYYA 2BV6A 2PJPA 2L7FP 4CYCA 3GXOA 5CVJA 3ZQCA 4M74A 2FNPA 4EM0B 4G6QA 1T0FA 3HRMA 3KIOA 1J5YA 2DI3A 3CC7I 5E20A 1LFPA 1Y1VJ 3M1EA 2X48A 4XL9A 2BY2A 5J3LA 1OCTC 1Z3XA 2K86A 4U7DA 1J7KA 3H36A 5L3BA 4A3LJ 2ZXHA 2JVGA 5KVRA 2XC7A 1SFOJ 3OSFA 1D5VA 2WAEA 3MKWB 4X1EA 2KIQA 3K4KA 1E3OC 3KLOA 1HQCA 2OF7A 3S8PA 2E1OA 5KAIC 1ZLKA 3MFKA 2AXLA 4XIDA 3DP7A 3WHCA 1TWAJ 3SHFA 3ABUA 1Z1DA 5CJ9A 2FMLA 1Q1HA 2O5RA 3V8KA 1D3YA 2YS9A 4J00A 4F93B 3KEOA 3D5LA 2BW3A 2DMUA 1X1BA 1VQPI 4LOCA 1ZRCA 3ZQ7A 4V2FA 3S3MA 2EZLA 2P7CB 4HV6A 2LKXA 4XN0A 5IOYA 4MO7A 1LE8B 1FZPB 1UELB 1ZRFA 1R58A 1O3SA 2UV1A 4C2UA 2JTVA 1J9IA 4J01A 1RKWA 3M4OJ 1CF7A 2IGKA 1TWFJ 2MLKA 1JHHA 4IRIA 2L7MP 2DOAA 4EM2A 3U9GA 5FLVA 2K40A 4C9YA 5BOXA 3QU6A 2QF7A 1ON1A 1WGXA 1XDSA 2K85A 3MWMA 1X2NA 2LY1A 2HQRA 5CVIA 2WWYA 3GCMA 3BR0A 3ESWB 5BS6A 1YLFA 2QA4I 1UJ8A 2N8GA 3AG2H 2NS8A 2CV2A 2HGCA 4M3BA 1CGPA 3FK6A 1WJFA 4E7IA 2DU9A 5KK1A 4N4NB 2BXZA 1B59A 3BTJA 3QQAA 3GFLA 3J7YJ 5F0CA 4E7KA 3GTJJ 3BTIA 2HPMA 5EZHA 4PUSA 3V4GA 4AIDA 2G9WA 1ZR4A 1MH4A 1ZGWA 3TKYA 4J19A 2DFFA 5FROA 3OYLA 2VJIA 5IP7J 1IW7F 1QHGA 3CMMA 2QVOA 3GYHX 1LVAA 2DA4A 1S3JA 1DPRA 3W2WA 1EH7A 2EINH 3PIPF 2P4WA 2VKDA 3BJAA 2JQ7A 4A3IJ 2AHQA 4XKVA 3GW2A 3KLNA 1YYVA 2BY1A 2GOXB 1XGMA 3NWTA 2G7UA 1JTYA 3ROUA 1IG7A 1G2HA 4IQ4A 4R8HA 4M9SA 2OZ6A 1P2FA 5C44J 4JK1X 2K5CA 2IS1A 1VF9A 2JPBA 2VBZA 4HV5A 2D5VA 2EIMH 4XRSG 2PMUA 2P81A 3OYEA 2QQ8A 2CH0A 5C4XJ 1A6QA 2OA4A 3BDDA 4XM3A 2IBDA 4BEHB 3ABTA 4LK1F 4BY7J 2X9DA 3PSIA 5KAFC 2VE8A 1LQ1A 1BR2A 1MNDA 1BL0A 3G73A 4CYDA 3HM5A 3H9GA 3RPQA 2Z5UA 2L9RA 3I64A 2L9VA 1VQNI 2JUCA 1LEAA 2M1BA 1ZK8A 4P55A 2J5OA 1TT5B 3LMMA 2VBYA 3A0BC 1Y0NA 5LRSA 2O7OA 4A3KJ 4G8XA 3ZQGA 3H1CA 2DOEA 4CSWA 5DUKA 1OR7A 3WODF 5LHIA 4A3DJ 2HYJA 4A3GJ 2DK8A 5GTIC 3GO5A 1TZLA 4BBRJ 4MIMA 1V5FA 4BUPA 2QSGX 4F52A 1SFEA 3MKZA 4BQOA 1VQ6I 4RLFA 3ECHA 3HEFA 1KA8A 3DTIA 2DBBA 1GHCA 5AIQA 4ZYAA 5BNGA 2V1UA 2LK2A 3R0AA 1X1DA 3W2VA 3BQYA 4A0XA 2XGXA 3PQJA 3RDIA 3FXJA 4CA0A 2DA1A 4IRGA 3LSKA 2WBMA 1V3FA 1ZRDA 3QP6A 4ZTFA 1QPMA 2HXOA 4XRFA 4A6EA 2M34A 2CQQA 5E18F 3IHUA 2EILH 3G2BA 4YRVA 2LY2A 2PQ8A 1Y0UA 4C3IJ 4RGRA 4GXOA 1HKTA 4B44A 1WJBA 2R93J 4HYEA 5FFZA 4HZFA 2V1XA 4UUTA 3ZOBA 2XAUA 1E17A 4L5EA 4CCMA 3LSJA 4XONA 5LFAA 2H8WA 3BY6A 1Z7UA 1HKSA 4CHUA 3WTZA 2LR8A 2PI0A 1WH5A 1Z6RA 5FD5A 2JSPA 3PL8A 1GDTA 1T98A 1MNMC 4TV7A 4XLFA 1DGRM 4C3HJ 1FNNA 3W3CA 3G6EI 3BLYA 3KP7A 4W1UA 3REOA 5EG0B 1TWCJ 2KPMA 4CCLA 2X1EA 3KYLA 2O6GE 3IAS2 3OS1A 4KIFA 1HOMA 4ITVA 1TLHB 2LNBA 2CUJA 1FWZA 5D5VB 3LSRA 4LG0B 4BJTA 3E5UA 4JOMA 4Y3OA 4EM1A 2E1MC 2QUFA 2ZJQF 4B43A 2LFBA 5DEQA 4OMYA 2KRCA 2CQNA 3W6VA 3JRBA 1MW7A 2W25A 1IN4A 4G9YA 1KGSA 2XUBA 1TTYA 4WXHA 3JREA 4IO9F 1HA8A 2DCEA 3Q9VA 1FTTA 4XLHA 2LDUA 2OQGA 4M3DA 3K2ZA 4H4KC 4C2MJ 1X2MA 4F3QA 2JA6J 1G6NA 2LOOA 1Y1WJ 3R6SA 4OIOF 2FU4A 3FF5A 3KX2A 1Y8QB 1WH7A 3WG9A 1A31A 2CV0A 1YS7A 3PSFA 2F6CA 4BE0A 4E4HA 2JA2A 4IHVA 2M5WA 1BW5A 1ONVA 3WTWC 3IH2A 1D0XA 4IHXA 3MZHA 3LA7A 3P9KA 2R7WA 3OR2C 3JCUC 2MA3A 2Y48A 3BG3A 3L2VA 2R5ZB 4CGZA 3S1NJ 1B72A 3SZTA 1I6XA 1B8IB 4PJMA 1JUPA 2ID6A 2XB5A 2GIVA 1SFKA 1P4WA 2E7XA 2M9HA 2M0MA 4CH7A 3S1QJ 4HBLA 2VJJA 1BR1A 4A3FJ 1NHAA 4U7BA 4HNTA 4Q4ZF 4FCYA 3K4CA 2VQGA 2DJIA 3OYMA 1A36A 3DKWA 1UFMA 3IWZA 1U3EM 3I5UA 3CC4I 4JYKA 1WJCA 4CUGA 2EQRA 3WTYC 1O3TA 2W57A 4B1RA 5D5UB 2BYVE 1ERDA 2R92J 2XPVA 4ZYGA 4BE1A 2RDPA 3F8NA 2COBA 3KZIC 4JX4A 4MEYF 4RDUA 1EH6A 3WGHA 1TW3A 4U0WA 1BIAA 3MMYB 3JRIA 2R5YB 1R49A 1HLVA 2EV5A 1TC3C 2JMWA 4HX4A 5ICCA 3ZN1A 3QYBA 1S7EA 2D2WA 1IN6A 2AQFA 1LEBA 4Y33A 2FXAA 1RR7A 4K2EA 5K7FA 2MC3A 1V5EA 1KYZA 3L7WA 2E36A 3ZQIA 1BOBA 1M1EB 3C2HA 1FJLA 2RVCA 3F8CA 4RA2A 1LE8A 5K5OA 5HNHA 2ZJPF 3HRUA 1Q1VA 3DTEA 2VODA 3BJOA 5KCMA 5IP9J 4A12A 2NRAC 3S14J 2XASA 2EA2A 4A5NA 5ICEA 3I54A 2GZWA 1X19A 4EVIA 4A3JJ 4KNYA 2R7VA 1X3UA 5B66C 3M3YJ 3CCSI 3M1CA 4N9HA 1DGWY 2NOGA 5D4SA 4WXCA 1JKRC 1XMKA 3AG4H 3HBLA 4UNOA 3J80Z 3RI4A 5JVTA 1K6YA 2VC0A 3AG3H 1JKQC 2DMQA 1LJ9A 2A07F 3WGIA 3K4BA 5GTHC 1ZKGA 1WJAA 3PUBA 4UV8A 2HI3A 2ZMEB 5GAHJ 3I56I 4I2OA 3PO3J 2YR2A 2H09A 3NRVA 2VL8A 3RPUA 1WI9A 3G4SI 3CCVI 3AL0C 3EUHA 5CPRB 5HLTA 1OISA 2FF4A 2KRHA 3OS0A 3ELKA 2VI6A 3ZGKA 4UVAA 1YRNB 4AIKA 1VQ8I 1ZAOA 4ZDPA 1OFCX 3HRTA 3KFWX 2Y75A 2FJ1A 2M7BA 3LOCA 3ERMA 3L09A 5F04A 4M9ZA 3GWZA 1OMIA 2Z2SB 2KJBA 1IXSB 3TGNA 1T33A 1UG2A 2IPQX 1Z91A 4FT8A 4DBQA 1R1VA 2L0KA 2HOEA 2E60A 4GGGA 4DW6A 1X1AA 4L9TA 2CJJA 2JRTA 4NB5A 1O7FA 1IGNA 3SFZA 3V8JA 2ELKA 4RM2A 4IHSA 2FE3A 4OIQF 4PSWA 3A03A 1PP7U 2ECCA 3CF2A 2DYSH 1YJNI 2Q2EB 2BVLA 2W7NA 1S6LA 3KZYA 4ZYDA 1UHWA 2HOAA 3CMEI 1LFBA 3K4MA 1B1BA 1IZ1A 2B9SA 2Y0SN 3QPTA 2L01A 4KIBA 4M6XA 5DTDA 2VQHA 2WY8Q 3HHGA 3FHNA 2ELJA 2O03A 3RKQA 1FYKA 4DJAA 5CQGA 2EIJH 4BEHA 4L0YB 3RCOA 2CGPA 4S04A 3FXOA 5DCFA 2BZTA 4GO1A 1EJ9A 2GQQA 2CMPA 4IPAA 4MGRA 1YG2A 2M4KA 4I76A 4IF4A 5CYVA 1D1AA 2L02A 1POGA 3MN2A 3NAUA 5EGOB 5FKOA 2E2JJ 4YIRX 2DODA 3VSLA 2DW4A 4GYIA 2LSOA 2RAEA 4MFDA 4G7HF 3WG7H 2KISA 4BGDA 2ZSIB 3A02A 1ZN2A 3B6AA 3TDUC 1TNSA 4KMUX 3VDXA 4YFKF 1KU7A 1EV7A 3D5SC 1JT0A 3JRCA 1LFUP 2K02A 1GV2A 4DQ2A 2A61A 3AFHA 1T39A 4OIPF 3GLLA 1HC8A 1UAAA 1R1UA 2DMPA 3K4NA 2V26A 3DLAA 3QU3A 4ZDLA 2VOPA 4YG2F 3FWEA 4N0BA 1BN5A 1S7OA 1UMQA 1F43A 1PYVA 2HVQA 3S2WA 3F3XA 2ZNYA 3S93A 4PDKA 5L3EA 2O0YA 1MIJA 1BI2A 4AYBA 1YHQI 4HW0A 5LGTA 2VJ4A 2TRTA 4F92B 2IGMA 2BVMA 2R7SA 3SXYA 3KP4A 2EFOA 1W5SA 2KRFA 5J6XA 3LSGA 2FBIA 4XKBA 3CJNA 1MKMA 3CCQI 4ZC3A 1ETKA 1VI0A 1A6IA 3PNVA 3CCRI 2NVTJ 3GFJA 4AVZA 3R61A 2HNHA 2NAZA 3JTHA 3JRDA 1N75A 2GOMA 4L9NA 5CVRA 5D8LB 3E6MA 1YIJI 2IT0A 4LIUA 5L3GA 2L2OA 2DA5A 2RGVA 4PJ0C 5E8IA 2DDBA 4UUSB 2M8GX 1P4AA 4BYYA 3JSOA 2CUZA 5EG0A 2CG4A 1OLTA 2FSWA 2KIFA 3TDZC 5J1RA 2WAFA 2ZSHB 3F6OA 1N78A 2QLZA 4NUBA 4HDUA 1FT9A 2A6TA 1XSVA 4PSXA 5CQEA 5DCMB 5FKMA 3U1DA 1K79A 3CLQA 1USTA 4IL6C 4G7ZF 5ICFA 2TDXA 3GZ5A 4LLGF 3CUQC 5B3SH 3BZCA 1DU0A 4UY8I 5ICGA 1A5JA 3DPTA 3L00A 3QWLA 1ETOA 3J80K 2Y9ZA 3TO9A 5J47A 1A35A 4F55A 2F4OB 3FK7A 3DKXA 2PEXA 2ZO4A 3B73A 3CUOA 4OAZA 1JUMA 2RQPA 5E1XA 5FLXK 4HA8A 1IV6A 1LNWA 1HXDA 4KICA 3AAFA 1LDDA 3GTKJ 2GA2A 1J2XA 2R7QA 4HLXA 1ITYA 4AM3A 2GBYA 2BBYA 3AKZA 5E17F 3C18A 9ANTA 3F8FA 3NARA 5GADJ 5FRMA 4E70A 1IRGA 2IS2A 3OMYA 1O3QA 3K1NA 2I8DA 2L7ZA 3NWSA 1E3HA 5LHHA 2BE5F 2WTEA 3CESA 4QPOA 4RB2C 4OWRB 4M3GA 2QQAA 1P9QC 4Y52J 4JP0A 4XKWA 3RYPA 1MDMB 4XK4A 4AU7A 1XDUA 3IRQA 2WADA 3L1PA 3SZGA 3Q0VA 5EYRA 5D5WB 2R5ZA 2QBYB 1B8IA 1G3WA 2OTLI 3FMQA 3WE3A 3GTGJ 2RKHA 2VOOA 3PM1A 4A0YA 4A5MA 1OCRH 4Y13A 2RNGA 1OKRA 3BR1A 2IW5A 2WA0A 3D0SA 3BTCA 5GAEJ 4UVBA 4N9IA 1PDNC 2PX9A 1E2XA 1FTZA 2XGDA 1U78A 2Q0OA 1YO5C 3EYYA 4HOBA 1MJBA 2H6BA 2ZCWA 2KQRA 2XKOA 4JBAA 4D5FA 3TBIA 3HOTA 2FA5A 3LL7A 3DEWA 4BHPA 1JHFA 1TT0A 2F5CA 3KP2A 2WY7Q 2OV7A 4OIRF 4CXFA 4A3BJ 4Q5SF 2DDAA 5LEJA 5E1WA 4MTDA 1K83J 2ZFWA 2R5YA 2PFBA 2RV8A 2FNAA 3SJMA 3ECOA 3K4LA 3HYIA 1T6SA 2ICWG 3QRFF 2GXAA 4F91B 1WPKA 1MBGA 1RESA 2PLYA 2Y0MA 1ZGJA 2HVSA
chains in the Genus database with same CATH topology
2EWNA 3GVAA 1YQAA 1Z9CA 4MQVA 1ODDA 4AIHA 2D45A 3IRRA 5D4RA 2YX7A 1OYWA 5LLQA 4IXAA 3V7SA 3KCCA 4IHTA 1XSDA 2HZTA 1BI0A 4HLYA 4Y15A 1UB9A 5D8KB 3V7RA 4ZYHA 3I53A 4I09A 1RZ4A 3LAJA 2DFIA 2VBWA 5A2QZ 3TO7A 1XN7A 3WTSC 2GA1A 5E1ZB 1IN7A 3LSTA 4ETSA 1ZREA 2OU2A 2ZMEA 3V8LA 5HS7A 4I7HA 3O6BB 3K1PA 3IWFA 1KYWA 4BHBA 3F8MA 3I0TA 5FGMA 2EB7A 2F5EA 3K69A 3QAHA 4HDVA 5IT9Z 4FX0A 2OZUA 5F64A 4FHTA 4L9VA 5D6FA 4A2UA 4PGGA 1G3SA 3RKXA 3T8TA 4ESJA 1FOKA 2R3SA 4CO8A 3OOPA 1QZYA 2OBPA 2Q2EA 2A3SA 3L2CA 3H3ZA 4UUVA 1EH8A 1XGOA 2Z3YA 4MHGA 2L54A 5DYMA 2M30A 3E5QA 1O3RA 1D8KA 1R00A 4RGSA 1HW2A 2OAZA 4GCVA 2XRNA 1O7LA 1G4DA 1U5TC 1K6OA 1U6GA 4KMFA 1HKQA 2ZNZA 4EQQA 1FSHA 4M9XA 2DO7A 2V9VA 2OD5A 3Q5FA 3SZPA 4BQAA 1BM9A 1UHMA 2ZKZA 1HW1A 4U0VA 1L3LA 4OU0A 2V79A 2NYXA 3QPHA 4ASNA 4LD5A 3PQKA 1FX7A 1S8NA 3BOQA 3GEZA 4BXUA 1FP2A 3RYRA 3CUQA 2KJCA 2XVCA 2UZKA 2K7LA 2O3FA 2WV0A 1DDNA 4YFNF 1SAXA 1YW8A 3TO6A 2FRHA 3BZ6A 1WQ2A 3I4PA 4WX9A 4EJVA 3ZMTA 4LMYA 4F7ZA 1XGSA 5BQTA 4EJWA 3BJ6A 2A69F 4PCQA 5EEGA 2DQLA 4KDPA 2HYFA 3EETA 4LB6B 2XKPA 4B8XA 5DCMA 2G7HA 1QO0D 3WU0A 1J75A 2EJRA 3WGGA 1TW2A 2EFWA 2P5LC 5A2QK 1WSUA 1FYMA 3JSPA 3K9TA 4P96A 2PBIA 3MCZA 4O3MA 1H0MA 2MBFA 3F8BA 2HKXA 2DLLA 4KT5C 1AOYA 3HTSB 3RTRA 2MH9A 3F21A 2FEZA 2CO5A 3WTTC 2DK5A 2K4JA 4ON0A 1BOAA 1W4MA 5IT9K 2F5FA 2KIUA 1BI1A 3M7GA 1MDMA 3HHHA 5HLGA 5HS9A 1BC7C 1MGTA 4WXDA 1DP7P 5H6QA 4WK8F 4WWCA 2QBYA 1FBSA 1W5TA 2RN7A 2P5VA 2ETHA 3E5XA 4LLLA 4CICA 3I71A 1ZG5A 5H6RA 1FY7A 2XROA 4L9JA 3LQQA 4DNCA 4FX4A 2FMYA 4XSXF 1XGNA 1XMAA 4WF2A 5DUIA 4HAMA 5H20A 2YX4A 2E7WA 5AIPA 4P9UA 2RNJA 4KYWA 3C3WA 3ZMSA 2MLGA 1IN5A 3E3VA 4EMSA 3E6BA 2E1CA 4LGWA 4LLNA 2VBXA 3FMRA 4XLPF 3IL2A 3H3UA 1I1SA 5JR3A 4KUMA 1YS6A 4LJZF 1FPQA 2DPUA 1D8JA 4IVNA 4I02A 5HDKA 2PMHA 4EJTA 1R23A 2HYGD 2JT1A 1TNTA 2W24A 1S29A 3FXQA 3MZYA 2LF7A 1SD5A 3ZPLA 4EGZA 3DQVC 3KP6A 1ON2A 3F23A 1P92A 3C7JA 3WTUC 4ESBA 3GUDA 2KKOA 3FMSA 4KN7X 4XSZF 1RUOA 1UCRA 4AVPA 3U2RA 5J8FA 5HOOA 2E1NA 3COAC 5JFRA 3G3ZA 2GXBA 1F1ZA 1DUXC 4UVCA 1KQ0A 4I98B 1I1GA 1I5ZA 1REPC 1LB2A 5HLHA 2D1VA 3I58A 3T1BA 2XAJA 2DPDA 1XCBA 4QWQA 2MH2A 1B9NA 5K1YA 2EFNA 2WC2A 2ELHA 5DDGA 2LKPA 5BMZA 1R5HA 2A6EF 4H0EA 3CUQB 1W7PD 3TOAA 2D1HA 1TBXA 3J81Z 3BWGA 4LFUA 1F5TA 2F5DA 2KIMA 4AWXB 2PG4A 3BPVA 4HX7A 3MAJA 1GXPA 2XHKA 2YU3A 4Q48A 4IJAA 4XLNF 5ILUA 5BPDA 3DFGA 4R1HA 1SMTA 1FYLA 3T5XA 4B09A 1V4RA 2A68F 2EV0A 1S7AA 2HQNA 1W7PA 3R4KA 2JZYA 3C1DA 4IRHA 2STWA 3ISPA 1XD7A 5DD4A 2DT5A 2HDCA 2XIGA 5HDNA 3K1MA 1BC8C 2DTRA 3ZMDA 2IA1A 4ENNA 1O57A 5HDGA 4ZZDA 2X0LA 2DAOA 5ILVA 1KU3A 1OYYA 5FO5A 3CDHA 3DV8A 4L5JA 2L4AA 4ZH4F 4P5OA 5CLSA 3BPXA 5F1RA 1K78B 2BGCA 5DV5A 2QQBA 1P6RA 4YFXF 1TQPA 1Z05A 2XAGA 4BHCA 3GLXA 3KP3A 4EJOA 2A6HF 3VFZA 3EYIA 4L0ZB 4HF1A 2NNYA 3VEPA 3HRSA 2GXGA 2V6CA 2O61A 1QNTA 3QP5A 2ESHA 5E8GA 2CWEA 3P7NA 3KETA 2FOKA 3IC7A 2STTA 4JQFA 2QWWA 5LRRA 3NQOA 3CO6C 3M8EA 3IKTA 3QOPA 1KQ9A 3FHZA 3ERED 2AS5F 1MJAA 2YPRA 2M87A 1HSJA 2L3DA 3DEUA 1F4KA 2K4BA 3OV8A 3LWFA 1SD4A 4S05A 1USSA 2IVMA 2HEOA 5HS8A 3KP5A 2HS5A 1B4AA 3H92A 4R79A 4RAYA 3VOEA 5K5QA 2UXXA 2O8XA 2IA0A 1U2WA 2EFPA 4ZYEA 1G3TA 3FX3A 4M72A 6PAXA 4KFCA 3J81K 5HVQC 4QLCU 1IAWA 1BBYA 3GZ6A 1YIOA 1QQIA 1U8RA 1GXQA 3DF8A 4A0ZA 3WTXC 3BROA 1ULYA 1RUNA 2EFQA 5LBQA 1XCVA 2R7FA 5LHGA 3HSRA 3PFIA 1TQIA 3FXRA 1SD6A 1VTNC 1U5TB 4I0AA 2ZBKA 1T2KA 2H94A 4CDGA 1FC3A 1JXSA 4EJUA 2V1DA 1OPCA 2VT2A 4M73A 3O2PE 1OYIA 3LQRA 1DPUA 1YW7A 2QZ8A 3E6DA 1WKMA 3GFMA 4UXNA 1YW9A 4M6YA 1XB4A 4KN4X 2VT3A 3MEXA 4AD9A 5AONA 2EA4A 4YIFA 3N4MA 3HTUA 3I59B 2P7VB 1MZBA 3ZMZA 2DQRA 4NHJA 2FQ3A 1IN8A 1BJAA 2QM3A 5ILSA 4PGHA 3BP8A 2GWRA 1WRJA 3IKVA 1B6AA 3CO7C 2X4HA 3RKWA 1IXCA 1FBQA 1FSEA 1R36A 2P8TA 4MQ9F 3F22A 3VB2A 3E6CC 3ML6A 1F9NA 4HQMA 4ESFA 1JGSA 2GAUA 2XAHA 3TOBA 5DD8A 1KU2A 2VE9A 3J7AO 2UWMA 1FBUA 1W7PB 5BPIA 2VN2A 3P9IA 5L3CA 1PUEE 3FM5A 1Z6TA 2VONA 3VODA 4L5IA 1PP8F 3GFIA 5L3DA 2J5PA 3RKYA 4G7OF 3KEQA 5LGNA 4HF0A 2COMA 2P6TA 1SMYF 2CSOA 2Z9OA 5LGUA 3B02A 3LA2A 4BH9A 2EK5A 3FZVA 3K0LA 2RC4A 2W85A 1RI7A 2QYOA 3HOSA 2XAQA 4CZZA 2JPCA 3L9FA 1H9TA 2BEOA 2ZXJA 1R22A 4KIGA 1FP1D 1LDJA 1STZA 5LEKA 3JTGA 3O3KA 3M9AA 4HQEA 4A6DA 4RAZA 2NNNA 3JAMZ 1BI3A 3ZMUA 4LB5A 2XV4S 1K78A 4I0BA 4I01A 1ZGAA 3F72A 4Q47A 4EV0A 5EEHA 2ISYA 2P6SA 2H27A 3E97A 4HX8A 2K27A 5CVUA 4ZZLA 1ZG1A 2HTJA 1J0RA 2VC1A 3RJPA 3DPLC 2NS0A 2B0LA 4M71A 4ENMA 2C6YA 3JW4A 4P9FA 4LK0F 3ZN0A 5TRDA 1CF7B 4BAYA 3ZMVA 1H9GA 3M8FA 5J8CA 5F6FA 3T8RA 5ERIA 4UHTA 4KA4A 2FBKA 3GX4X 4RB1A 5FD6A 4HF2A 2MD5A 1YFHA 1QBJA 1MD0A 2VXZA 3LA3A 2ESNA 3SQNA 2F2EA 1ZG3A 5HLIA 1GVJA 1RNLA 4GYGA 1R5GA 1RIOH 3HSFA 2CFXA 2QQ9A 1KQ8A 4ENJA 3RIRA 4UV9A 1YTYA 4MNUA 1AWCA 4Y17A 2IP2A 2IJLA 1HSTA 2M45A 2HFHA 3W6KB 5FLXZ 1HBXG 2H6CA 2LF8A 5IT3A 3HIFA 3P9CA 1MJ9A 3WTVC 5JI6A 4ENKA 3HSEA 4G94A 2CQKA 2HKOA 4G6DA 3TQNA 2W84A 3FM3A 3CLOA 1QZZA 4MEXF 4MTEA 3ZP5A 1ZLJA 4XBFA 4RB0A 4U0YA 2Z33A 4Z2YA 2ZJ2A 4RS8A 1B9MA 5L3FA 1SD7A 2IRFG 3LFKA 5K5RA 2EV6A 1L0OC 4O6JA 1C0WA 3Q9SA 1U5TA 2ISZA 1LDKB 2FBHA 2QENA 3EQLF 3HUGA 2Q8KA 2R7DA 4OMZA 2YSRA 3WE2A 1ZYRF 5TJJA 3N97A 1A04A 4RB3C 3MQ0A 1IRFA 1JE8A 2ADUA 3DXJF 4L18B 4RGUA 2HR3A 3T0YA 5ED4A 3I59A 3ULQB 4EGYA 2P5KA 3WU1B 3JAMK 3NEUA 2CW0F 1QGPA 5FFXA 2UXNA 1KU9A 2OQRA 5FB2A 4AIJA 4D0PA 5D6EA 3CTAA 1ZH5A 3LAPA 1ZARA 1R7JA 3KZZA 1P4XA 4WCGA 3KE2A 4YIIA 4RGXA 1IUYA 2A5YB 1WWXA 2Z99A 1K7AA 2M8EA 1J59A 3R60A 1BIBA 1XSXA 1SFUA 4OINF 1G3YA 1R1TA 5JHUA 1ZHFA 3GF2A 1I27A 3EDPA 1TQMA 4OOIA 2L4MA 2ACJA 4NQWA 1SFXA 2XAFA 5D5XB 4BNCA 1FLIA 4O5VA 2HWVA 1IF1A 2IA2A 2JSCA 4LG0A 4U88A 3V7CA 1HW5A 2PN6A 3W6JB 2HTSA 4PZJA 3FXUA 3R0JA 5CVVA 1T38A 3F6VA 1IXRC 2CYYA 2BV6A 2PJPA 3GXOA 5CVJA 4M74A 4EM0B 2FNPA 4G6QA 1T0FA 3HRMA 1J5YA 2DI3A 5E20A 3M1EA 2K86A 4U7DA 1J7KA 5L3BA 5KVRA 1D5VA 3KLOA 1HQCA 1ZLKA 3MFKA 2AXLA 3DP7A 3SHFA 3ABUA 1Z1DA 5CJ9A 2FMLA 1Q1HA 3V8KA 1D3YA 3KEOA 3D5LA 1ZRCA 3ZQ7A 2P7CB 4HV6A 1FZPB 1ZRFA 1R58A 1O3SA 2JTVA 1J9IA 1CF7A 2MLKA 1JHHA 4IRIA 4EM2A 3U9GA 5BOXA 3QU6A 1ON1A 3MWMA 1XDSA 2HQRA 5CVIA 2WWYA 5BS6A 1YLFA 2HGCA 1CGPA 2DU9A 5KK1A 1B59A 3GFLA 3V4GA 2G9WA 3TKYA 1IW7F 2QVOA 3GYHX 1LVAA 1S3JA 1DPRA 1EH7A 2P4WA 3BJAA 3GW2A 3KLNA 1YYVA 1XGMA 2G7UA 3ROUA 4R8HA 4M9SA 2OZ6A 1P2FA 4JK1X 2JPBA 2VBZA 4HV5A 2PMUA 2OA4A 3BDDA 3ABTA 4LK1F 2VE8A 1LQ1A 3G73A 4CYDA 3RPQA 2Z5UA 3I64A 1LEAA 2M1BA 4P55A 2J5OA 2VBYA 5LRSA 4G8XA 5DUKA 1OR7A 3WODF 5LHIA 2DK8A 3GO5A 1SFEA 3ECHA 1KA8A 1GHCA 2DBBA 5AIQA 2V1UA 3R0AA 4A0XA 2XGXA 3PQJA 3RDIA 4IRGA 1V3FA 1ZRDA 3QP6A 1QPMA 4XRFA 4A6EA 5E18F 3IHUA 2PQ8A 1Y0UA 4RGRA 4GXOA 1HKTA 4HYEA 5FFZA 4HZFA 2V1XA 1E17A 3BY6A 1Z7UA 1HKSA 4CHUA 3WTZA 2PI0A 5FD5A 1Z6RA 1T98A 4TV7A 1FNNA 3KP7A 3REOA 2O6GE 4KIFA 1TLHB 2LNBA 1FWZA 5D5VB 4LG0B 3E5UA 4EM1A 2QUFA 5DEQA 4OMYA 2W25A 1IN4A 4G9YA 1KGSA 2XUBA 1TTYA 4WXHA 3Q9VA 2LDUA 2OQGA 3K2ZA 1G6NA 3R6SA 4OIOF 2FU4A 3FF5A 3WG9A 1YS7A 2M5WA 1ONVA 3WTWC 3MZHA 3LA7A 3P9KA 2MA3A 2Y48A 4CGZA 3SZTA 1I6XA 2GIVA 1P4WA 2E7XA 4HBLA 1NHAA 4U7BA 4Q4ZF 3DKWA 1UFMA 3IWZA 1U3EM 3I5UA 3WTYC 1O3TA 2W57A 5D5UB 2BYVE 4ZYGA 2RDPA 3F8NA 4MEYF 1EH6A 3WGHA 1TW3A 4U0WA 1BIAA 2EV5A 4HX4A 5ICCA 3ZN1A 2D2WA 1IN6A 1LEBA 2FXAA 4K2EA 2MC3A 1KYZA 3L7WA 2RVCA 3F8CA 5K5OA 3HRUA 2VODA 3BJOA 4A12A 2NRAC 2XASA 2EA2A 4A5NA 5ICEA 3I54A 2GZWA 4EVIA 4KNYA 1X3UA 4N9HA 5D4SA 4WXCA 1XMKA 4UNOA 3J80Z 3RI4A 5JVTA 2VC0A 1LJ9A 2A07F 3WGIA 4UV8A 2ZMEB 4I2OA 2YR2A 2H09A 3NRVA 3RPUA 1WI9A 3EUHA 2FF4A 3ELKA 4UVAA 4AIKA 1ZAOA 3HRTA 3KFWX 2Y75A 3L09A 4M9ZA 3GWZA 1OMIA 3TGNA 2KJBA 1IXSB 2IPQX 1Z91A 4FT8A 1R1VA 2HOEA 4GGGA 4L9TA 2JRTA 4NB5A 1O7FA 3SFZA 3V8JA 4IHSA 2FE3A 4OIQF 1PP7U 1S6LA 3KZYA 4ZYDA 1UHWA 1B1BA 1IZ1A 3QPTA 2L01A 4KIBA 4M6XA 3HHGA 2O03A 1FYKA 4L0YB 2CGPA 4S04A 5DCFA 4GO1A 2GQQA 4IPAA 4MGRA 1YG2A 4IF4A 5CYVA 2L02A 2DW4A 4GYIA 2LSOA 4G7HF 1ZN2A 3TDUC 4YFKF 1TNSA 4KMUX 1KU7A 1EV7A 2K02A 4DQ2A 2A61A 1T39A 4OIPF 1R1UA 3QU3A 2VOPA 4YG2F 3FWEA 4N0BA 1BN5A 1S7OA 3S2WA 3F3XA 2ZNYA 4PDKA 5L3EA 2O0YA 1BI2A 4HW0A 5LGTA 3SXYA 3KP4A 2EFOA 1W5SA 2KRFA 5J6XA 2FBIA 3CJNA 1MKMA 3GFJA 3R61A 2NAZA 3JTHA 4L9NA 5CVRA 5D8LB 3E6MA 2IT0A 5L3GA 2RGVA 5E8IA 1P4AA 4BYYA 3JSOA 2CG4A 2FSWA 2KIFA 3TDZC 3F6OA 2QLZA 4HDUA 1FT9A 1XSVA 5DCMB 3U1DA 1K79A 1USTA 4G7ZF 5ICFA 2TDXA 3GZ5A 4LLGF 3CUQC 5ICGA 3DPTA 3L00A 3J80K 3TO9A 2PEXA 2ZO4A 3B73A 3CUOA 2RQPA 5E1XA 5FLXK 4HA8A 1LNWA 1HXDA 4KICA 3AAFA 1LDDA 2GA2A 1J2XA 4HLXA 5E17F 2BBYA 3C18A 3F8FA 4E70A 1IRGA 1O3QA 3K1NA 5LHHA 2BE5F 2WTEA 4RB2C 2QQAA 3RYPA 1MDMB 1XDUA 3IRQA 5D5WB 2QBYB 1G3WA 3FMQA 3WE3A 2RKHA 2VOOA 4A0YA 4A5MA 4Y13A 1OKRA 2IW5A 3D0SA 4UVBA 4N9IA 1PDNC 1E2XA 1U78A 2Q0OA 1YO5C 3EYYA 4HOBA 1MJBA 2H6BA 2ZCWA 2XKOA 4JBAA 3HOTA 2FA5A 4BHPA 1JHFA 2F5CA 3KP2A 4OIRF 4CXFA 4Q5SF 5LEJA 5E1WA 4MTDA 2ZFWA 2PFBA 2RV8A 2FNAA 3ECOA 3HYIA 1T6SA 3QRFF 2PLYA 2Y0MA 1ZGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  3GVA A;  1YQA A;  1Z9C A;  4MQV A;  1ODD A;  4AIH A;  2D45 A;  3IRR A;  5D4R A;  2YX7 A;  1OYW A;  5LLQ A;  4IXA A;  3V7S A;  3KCC A;  4IHT A;  1XSD A;  2HZT A;  1BI0 A;  4HLY A;  4Y15 A;  1UB9 A;  5D8K B;  3V7R A;  4ZYH A;  3I53 A;  4I09 A;  1RZ4 A;  3LAJ A;  2DFI A;  2VBW A;  5A2Q Z;  3TO7 A;  1XN7 A;  3WTS C;  2GA1 A;  5E1Z B;  1IN7 A;  3LST A;  4ETS A;  1ZRE A;  2OU2 A;  2ZME A;  3V8L A;  5HS7 A;  4I7H A;  3O6B B;  3K1P A;  3IWF A;  1KYW A;  4BHB A;  3F8M A;  3I0T A;  5FGM A;  2EB7 A;  2F5E A;  3K69 A;  3QAH A;  4HDV A;  5IT9 Z;  4FX0 A;  2OZU A;  5F64 A;  4FHT A;  4L9V A;  5D6F A;  4A2U A;  4PGG A;  1G3S A;  3RKX A;  3T8T A;  4ESJ A;  1FOK A;  2R3S A;  4CO8 A;  3OOP A;  1QZY A;  2OBP A;  2Q2E A;  2A3S A;  3L2C A;  3H3Z A;  4UUV A;  1EH8 A;  1XGO A;  2Z3Y A;  4MHG A;  2L54 A;  5DYM A;  2M30 A;  3E5Q A;  1O3R A;  1D8K A;  1R00 A;  4RGS A;  1HW2 A;  2OAZ A;  4GCV A;  2XRN A;  1O7L A;  1G4D A;  1U5T C;  1K6O A;  1U6G A;  4KMF A;  1HKQ A;  2ZNZ A;  4EQQ A;  1FSH A;  4M9X A;  2DO7 A;  2V9V A;  2OD5 A;  3Q5F A;  3SZP A;  4BQA A;  1BM9 A;  1UHM A;  2ZKZ A;  1HW1 A;  4U0V A;  1L3L A;  4OU0 A;  2V79 A;  2NYX A;  3QPH A;  4ASN A;  4LD5 A;  3PQK A;  1FX7 A;  1S8N A;  3BOQ A;  3GEZ A;  4BXU A;  1FP2 A;  3RYR A;  3CUQ A;  2KJC A;  2XVC A;  2UZK A;  2K7L A;  2O3F A;  2WV0 A;  1DDN A;  4YFN F;  1SAX A;  1YW8 A;  3TO6 A;  2FRH A;  3BZ6 A;  1WQ2 A;  3I4P A;  4WX9 A;  4EJV A;  3ZMT A;  4LMY A;  4F7Z A;  1XGS A;  5BQT A;  4EJW A;  3BJ6 A;  2A69 F;  4PCQ A;  5EEG A;  2DQL A;  4KDP A;  2HYF A;  3EET A;  4LB6 B;  2XKP A;  4B8X A;  5DCM A;  2G7H A;  1QO0 D;  3WU0 A;  1J75 A;  2EJR A;  3WGG A;  1TW2 A;  2EFW A;  2P5L C;  5A2Q K;  1WSU A;  1FYM A;  3JSP A;  3K9T A;  4P96 A;  2PBI A;  3MCZ A;  4O3M A;  1H0M A;  2MBF A;  3F8B A;  2HKX A;  2DLL A;  4KT5 C;  1AOY A;  3HTS B;  3RTR A;  2MH9 A;  3F21 A;  2FEZ A;  2CO5 A;  3WTT C;  2DK5 A;  2K4J A;  4ON0 A;  1BOA A;  1W4M A;  5IT9 K;  2F5F A;  2KIU A;  1BI1 A;  3M7G A;  1MDM A;  3HHH A;  5HLG A;  5HS9 A;  1BC7 C;  1MGT A;  4WXD A;  1DP7 P;  5H6Q A;  4WK8 F;  4WWC A;  2QBY A;  1FBS A;  1W5T A;  2RN7 A;  2P5V A;  2ETH A;  3E5X A;  4LLL A;  4CIC A;  3I71 A;  1ZG5 A;  5H6R A;  1FY7 A;  2XRO A;  4L9J A;  3LQQ A;  4DNC A;  4FX4 A;  2FMY A;  4XSX F;  1XGN A;  1XMA A;  4WF2 A;  5DUI A;  4HAM A;  5H20 A;  2YX4 A;  2E7W A;  5AIP A;  4P9U A;  2RNJ A;  4KYW A;  3C3W A;  3ZMS A;  2MLG A;  1IN5 A;  3E3V A;  4EMS A;  3E6B A;  2E1C A;  4LGW A;  4LLN A;  2VBX A;  3FMR A;  4XLP F;  3IL2 A;  3H3U A;  1I1S A;  5JR3 A;  4KUM A;  1YS6 A;  4LJZ F;  1FPQ A;  2DPU A;  1D8J A;  4IVN A;  4I02 A;  5HDK A;  2PMH A;  4EJT A;  1R23 A;  2HYG D;  2JT1 A;  1TNT A;  2W24 A;  1S29 A;  3FXQ A;  3MZY A;  2LF7 A;  1SD5 A;  3ZPL A;  4EGZ A;  3DQV C;  3KP6 A;  1ON2 A;  3F23 A;  1P92 A;  3C7J A;  3WTU C;  4ESB A;  3GUD A;  2KKO A;  3FMS A;  4KN7 X;  4XSZ F;  1RUO A;  1UCR A;  4AVP A;  3U2R A;  5J8F A;  5HOO A;  2E1N A;  3COA C;  5JFR A;  3G3Z A;  2GXB A;  1F1Z A;  1DUX C;  4UVC A;  1KQ0 A;  4I98 B;  1I1G A;  1I5Z A;  1REP C;  1LB2 A;  5HLH A;  2D1V A;  3I58 A;  3T1B A;  2XAJ A;  2DPD A;  1XCB A;  4QWQ A;  2MH2 A;  1B9N A;  5K1Y A;  2EFN A;  2WC2 A;  2ELH A;  5DDG A;  2LKP A;  5BMZ A;  1R5H A;  2A6E F;  4H0E A;  3CUQ B;  1W7P D;  3TOA A;  2D1H A;  1TBX A;  3J81 Z;  3BWG A;  4LFU A;  1F5T A;  2F5D A;  2KIM A;  4AWX B;  2PG4 A;  3BPV A;  4HX7 A;  3MAJ A;  1GXP A;  2XHK A;  2YU3 A;  4Q48 A;  4IJA A;  4XLN F;  5ILU A;  5BPD A;  3DFG A;  4R1H A;  1SMT A;  1FYL A;  3T5X A;  4B09 A;  1V4R A;  2A68 F;  2EV0 A;  1S7A A;  2HQN A;  1W7P A;  3R4K A;  2JZY A;  3C1D A;  4IRH A;  2STW A;  3ISP A;  1XD7 A;  5DD4 A;  2DT5 A;  2HDC A;  2XIG A;  5HDN A;  3K1M A;  1BC8 C;  2DTR A;  3ZMD A;  2IA1 A;  4ENN A;  1O57 A;  5HDG A;  4ZZD A;  2X0L A;  2DAO A;  5ILV A;  1KU3 A;  1OYY A;  5FO5 A;  3CDH A;  3DV8 A;  4L5J A;  2L4A A;  4ZH4 F;  4P5O A;  5CLS A;  3BPX A;  5F1R A;  1K78 B;  2BGC A;  5DV5 A;  2QQB A;  1P6R A;  4YFX F;  1TQP A;  1Z05 A;  2XAG A;  4BHC A;  3GLX A;  3KP3 A;  4EJO A;  2A6H F;  3VFZ A;  3EYI A;  4L0Z B;  4HF1 A;  2NNY A;  3VEP A;  3HRS A;  2GXG A;  2V6C A;  2O61 A;  1QNT A;  3QP5 A;  2ESH A;  5E8G A;  2CWE A;  3P7N A;  3KET A;  2FOK A;  3IC7 A;  2STT A;  4JQF A;  2QWW A;  5LRR A;  3NQO A;  3CO6 C;  3M8E A;  3IKT A;  3QOP A;  1KQ9 A;  3FHZ A;  3ERE D;  2AS5 F;  1MJA A;  2YPR A;  2M87 A;  1HSJ A;  2L3D A;  3DEU A;  1F4K A;  2K4B A;  3OV8 A;  3LWF A;  1SD4 A;  4S05 A;  1USS A;  2IVM A;  2HEO A;  5HS8 A;  3KP5 A;  2HS5 A;  1B4A A;  3H92 A;  4R79 A;  4RAY A;  3VOE A;  5K5Q A;  2UXX A;  2O8X A;  2IA0 A;  1U2W A;  2EFP A;  4ZYE A;  1G3T A;  3FX3 A;  4M72 A;  6PAX A;  4KFC A;  3J81 K;  5HVQ C;  4QLC U;  1IAW A;  1BBY A;  3GZ6 A;  1YIO A;  1QQI A;  1U8R A;  1GXQ A;  3DF8 A;  4A0Z A;  3WTX C;  3BRO A;  1ULY A;  1RUN A;  2EFQ A;  5LBQ A;  1XCV A;  2R7F A;  5LHG A;  3HSR A;  3PFI A;  1TQI A;  3FXR A;  1SD6 A;  1VTN C;  1U5T B;  4I0A A;  2ZBK A;  1T2K A;  2H94 A;  4CDG A;  1FC3 A;  1JXS A;  4EJU A;  2V1D A;  1OPC A;  2VT2 A;  4M73 A;  3O2P E;  1OYI A;  3LQR A;  1DPU A;  1YW7 A;  2QZ8 A;  3E6D A;  1WKM A;  3GFM A;  4UXN A;  1YW9 A;  4M6Y A;  1XB4 A;  4KN4 X;  2VT3 A;  3MEX A;  4AD9 A;  5AON A;  2EA4 A;  4YIF A;  3N4M A;  3HTU A;  3I59 B;  2P7V B;  1MZB A;  3ZMZ A;  2DQR A;  4NHJ A;  2FQ3 A;  1IN8 A;  1BJA A;  2QM3 A;  5ILS A;  4PGH A;  3BP8 A;  2GWR A;  1WRJ A;  3IKV A;  1B6A A;  3CO7 C;  2X4H A;  3RKW A;  1IXC A;  1FBQ A;  1FSE A;  1R36 A;  2P8T A;  4MQ9 F;  3F22 A;  3VB2 A;  3E6C C;  3ML6 A;  1F9N A;  4HQM A;  4ESF A;  1JGS A;  2GAU A;  2XAH A;  3TOB A;  5DD8 A;  1KU2 A;  2VE9 A;  3J7A O;  2UWM A;  1FBU A;  1W7P B;  5BPI A;  2VN2 A;  3P9I A;  5L3C A;  1PUE E;  3FM5 A;  1Z6T A;  2VON A;  3VOD A;  4L5I A;  1PP8 F;  3GFI A;  5L3D A;  2J5P A;  3RKY A;  4G7O F;  3KEQ A;  5LGN A;  4HF0 A;  2COM A;  2P6T A;  1SMY F;  2CSO A;  2Z9O A;  5LGU A;  3B02 A;  3LA2 A;  4BH9 A;  2EK5 A;  3FZV A;  3K0L A;  2RC4 A;  2W85 A;  1RI7 A;  2QYO A;  3HOS A;  2XAQ A;  4CZZ A;  2JPC A;  3L9F A;  1H9T A;  2BEO A;  2ZXJ A;  1R22 A;  4KIG A;  1FP1 D;  1LDJ A;  1STZ A;  5LEK A;  3JTG A;  3O3K A;  3M9A A;  4HQE A;  4A6D A;  4RAZ A;  2NNN A;  3JAM Z;  1BI3 A;  3ZMU A;  4LB5 A;  2XV4 S;  1K78 A;  4I0B A;  4I01 A;  1ZGA A;  3F72 A;  4Q47 A;  4EV0 A;  5EEH A;  2ISY A;  2P6S A;  2H27 A;  3E97 A;  4HX8 A;  2K27 A;  5CVU A;  4ZZL A;  1ZG1 A;  2HTJ A;  1J0R A;  2VC1 A;  3RJP A;  3DPL C;  2NS0 A;  2B0L A;  4M71 A;  4ENM A;  2C6Y A;  3JW4 A;  4P9F A;  4LK0 F;  3ZN0 A;  5TRD A;  1CF7 B;  4BAY A;  3ZMV A;  1H9G A;  3M8F A;  5J8C A;  5F6F A;  3T8R A;  5ERI A;  4UHT A;  4KA4 A;  2FBK A;  3GX4 X;  4RB1 A;  5FD6 A;  4HF2 A;  2MD5 A;  1YFH A;  1QBJ A;  1MD0 A;  2VXZ A;  3LA3 A;  2ESN A;  3SQN A;  2F2E A;  1ZG3 A;  5HLI A;  1GVJ A;  1RNL A;  4GYG A;  1R5G A;  1RIO H;  3HSF A;  2CFX A;  2QQ9 A;  1KQ8 A;  4ENJ A;  3RIR A;  4UV9 A;  1YTY A;  4MNU A;  1AWC A;  4Y17 A;  2IP2 A;  2IJL A;  1HST A;  2M45 A;  2HFH A;  3W6K B;  5FLX Z;  1HBX G;  2H6C A;  2LF8 A;  5IT3 A;  3HIF A;  3P9C A;  1MJ9 A;  3WTV C;  5JI6 A;  4ENK A;  3HSE A;  4G94 A;  2CQK A;  2HKO A;  4G6D A;  3TQN A;  2W84 A;  3FM3 A;  3CLO A;  1QZZ A;  4MEX F;  4MTE A;  3ZP5 A;  1ZLJ A;  4XBF A;  4RB0 A;  4U0Y A;  2Z33 A;  4Z2Y A;  2ZJ2 A;  4RS8 A;  1B9M A;  5L3F A;  1SD7 A;  2IRF G;  3LFK A;  5K5R A;  2EV6 A;  1L0O C;  4O6J A;  1C0W A;  3Q9S A;  1U5T A;  2ISZ A;  1LDK B;  2FBH A;  2QEN A;  3EQL F;  3HUG A;  2Q8K A;  2R7D A;  4OMZ A;  2YSR A;  3WE2 A;  1ZYR F;  5TJJ A;  3N97 A;  1A04 A;  4RB3 C;  3MQ0 A;  1IRF A;  1JE8 A;  2ADU A;  3DXJ F;  4L18 B;  4RGU A;  2HR3 A;  3T0Y A;  5ED4 A;  3I59 A;  3ULQ B;  4EGY A;  2P5K A;  3WU1 B;  3JAM K;  3NEU A;  2CW0 F;  1QGP A;  5FFX A;  2UXN A;  1KU9 A;  2OQR A;  5FB2 A;  4AIJ A;  4D0P A;  5D6E A;  3CTA A;  1ZH5 A;  3LAP A;  1ZAR A;  1R7J A;  3KZZ A;  1P4X A;  4WCG A;  3KE2 A;  4YII A;  4RGX A;  1IUY A;  2A5Y B;  1WWX A;  2Z99 A;  1K7A A;  2M8E A;  1J59 A;  3R60 A;  1BIB A;  1XSX A;  1SFU A;  4OIN F;  1G3Y A;  1R1T A;  5JHU A;  1ZHF A;  3GF2 A;  1I27 A;  3EDP A;  1TQM A;  4OOI A;  2L4M A;  2ACJ A;  4NQW A;  1SFX A;  2XAF A;  5D5X B;  4BNC A;  1FLI A;  4O5V A;  2HWV A;  1IF1 A;  2IA2 A;  2JSC A;  4LG0 A;  4U88 A;  3V7C A;  1HW5 A;  2PN6 A;  3W6J B;  2HTS A;  4PZJ A;  3FXU A;  3R0J A;  5CVV A;  1T38 A;  3F6V A;  1IXR C;  2CYY A;  2BV6 A;  2PJP A;  3GXO A;  5CVJ A;  4M74 A;  4EM0 B;  2FNP A;  4G6Q A;  1T0F A;  3HRM A;  1J5Y A;  2DI3 A;  5E20 A;  3M1E A;  2K86 A;  4U7D A;  1J7K A;  5L3B A;  5KVR A;  1D5V A;  3KLO A;  1HQC A;  1ZLK A;  3MFK A;  2AXL A;  3DP7 A;  3SHF A;  3ABU A;  1Z1D A;  5CJ9 A;  2FML A;  1Q1H A;  3V8K A;  1D3Y A;  3KEO A;  3D5L A;  1ZRC A;  3ZQ7 A;  2P7C B;  4HV6 A;  1FZP B;  1ZRF A;  1R58 A;  1O3S A;  2JTV A;  1J9I A;  1CF7 A;  2MLK A;  1JHH A;  4IRI A;  4EM2 A;  3U9G A;  5BOX A;  3QU6 A;  1ON1 A;  3MWM A;  1XDS A;  2HQR A;  5CVI A;  2WWY A;  5BS6 A;  1YLF A;  2HGC A;  1CGP A;  2DU9 A;  5KK1 A;  1B59 A;  3GFL A;  3V4G A;  2G9W A;  3TKY A;  1IW7 F;  2QVO A;  3GYH X;  1LVA A;  1S3J A;  1DPR A;  1EH7 A;  2P4W A;  3BJA A;  3GW2 A;  3KLN A;  1YYV A;  1XGM A;  2G7U A;  3ROU A;  4R8H A;  4M9S A;  2OZ6 A;  1P2F A;  4JK1 X;  2JPB A;  2VBZ A;  4HV5 A;  2PMU A;  2OA4 A;  3BDD A;  3ABT A;  4LK1 F;  2VE8 A;  1LQ1 A;  3G73 A;  4CYD A;  3RPQ A;  2Z5U A;  3I64 A;  1LEA A;  2M1B A;  4P55 A;  2J5O A;  2VBY A;  5LRS A;  4G8X A;  5DUK A;  1OR7 A;  3WOD F;  5LHI A;  2DK8 A;  3GO5 A;  1SFE A;  3ECH A;  1KA8 A;  1GHC A;  2DBB A;  5AIQ A;  2V1U A;  3R0A A;  4A0X A;  2XGX A;  3PQJ A;  3RDI A;  4IRG A;  1V3F A;  1ZRD A;  3QP6 A;  1QPM A;  4XRF A;  4A6E A;  5E18 F;  3IHU A;  2PQ8 A;  1Y0U A;  4RGR A;  4GXO A;  1HKT A;  4HYE A;  5FFZ A;  4HZF A;  2V1X A;  1E17 A;  3BY6 A;  1Z7U A;  1HKS A;  4CHU A;  3WTZ A;  2PI0 A;  5FD5 A;  1Z6R A;  1T98 A;  4TV7 A;  1FNN A;  3KP7 A;  3REO A;  2O6G E;  4KIF A;  1TLH B;  2LNB A;  1FWZ A;  5D5V B;  4LG0 B;  3E5U A;  4EM1 A;  2QUF A;  5DEQ A;  4OMY A;  2W25 A;  1IN4 A;  4G9Y A;  1KGS A;  2XUB A;  1TTY A;  4WXH A;  3Q9V A;  2LDU A;  2OQG A;  3K2Z A;  1G6N A;  3R6S A;  4OIO F;  2FU4 A;  3FF5 A;  3WG9 A;  1YS7 A;  2M5W A;  1ONV A;  3WTW C;  3MZH A;  3LA7 A;  3P9K A;  2MA3 A;  2Y48 A;  4CGZ A;  3SZT A;  1I6X A;  2GIV A;  1P4W A;  2E7X A;  4HBL A;  1NHA A;  4U7B A;  4Q4Z F;  3DKW A;  1UFM A;  3IWZ A;  1U3E M;  3I5U A;  3WTY C;  1O3T A;  2W57 A;  5D5U B;  2BYV E;  4ZYG A;  2RDP A;  3F8N A;  4MEY F;  1EH6 A;  3WGH A;  1TW3 A;  4U0W A;  1BIA A;  2EV5 A;  4HX4 A;  5ICC A;  3ZN1 A;  2D2W A;  1IN6 A;  1LEB A;  2FXA A;  4K2E A;  2MC3 A;  1KYZ A;  3L7W A;  2RVC A;  3F8C A;  5K5O A;  3HRU A;  2VOD A;  3BJO A;  4A12 A;  2NRA C;  2XAS A;  2EA2 A;  4A5N A;  5ICE A;  3I54 A;  2GZW A;  4EVI A;  4KNY A;  1X3U A;  4N9H A;  5D4S A;  4WXC A;  1XMK A;  4UNO A;  3J80 Z;  3RI4 A;  5JVT A;  2VC0 A;  1LJ9 A;  2A07 F;  3WGI A;  4UV8 A;  2ZME B;  4I2O A;  2YR2 A;  2H09 A;  3NRV A;  3RPU A;  1WI9 A;  3EUH A;  2FF4 A;  3ELK A;  4UVA A;  4AIK A;  1ZAO A;  3HRT A;  3KFW X;  2Y75 A;  3L09 A;  4M9Z A;  3GWZ A;  1OMI A;  3TGN A;  2KJB A;  1IXS B;  2IPQ X;  1Z91 A;  4FT8 A;  1R1V A;  2HOE A;  4GGG A;  4L9T A;  2JRT A;  4NB5 A;  1O7F A;  3SFZ A;  3V8J A;  4IHS A;  2FE3 A;  4OIQ F;  1PP7 U;  1S6L A;  3KZY A;  4ZYD A;  1UHW A;  1B1B A;  1IZ1 A;  3QPT A;  2L01 A;  4KIB A;  4M6X A;  3HHG A;  2O03 A;  1FYK A;  4L0Y B;  2CGP A;  4S04 A;  5DCF A;  4GO1 A;  2GQQ A;  4IPA A;  4MGR A;  1YG2 A;  4IF4 A;  5CYV A;  2L02 A;  2DW4 A;  4GYI A;  2LSO A;  4G7H F;  1ZN2 A;  3TDU C;  4YFK F;  1TNS A;  4KMU X;  1KU7 A;  1EV7 A;  2K02 A;  4DQ2 A;  2A61 A;  1T39 A;  4OIP F;  1R1U A;  3QU3 A;  2VOP A;  4YG2 F;  3FWE A;  4N0B A;  1BN5 A;  1S7O A;  3S2W A;  3F3X A;  2ZNY A;  4PDK A;  5L3E A;  2O0Y A;  1BI2 A;  4HW0 A;  5LGT A;  3SXY A;  3KP4 A;  2EFO A;  1W5S A;  2KRF A;  5J6X A;  2FBI A;  3CJN A;  1MKM A;  3GFJ A;  3R61 A;  2NAZ A;  3JTH A;  4L9N A;  5CVR A;  5D8L B;  3E6M A;  2IT0 A;  5L3G A;  2RGV A;  5E8I A;  1P4A A;  4BYY A;  3JSO A;  2CG4 A;  2FSW A;  2KIF A;  3TDZ C;  3F6O A;  2QLZ A;  4HDU A;  1FT9 A;  1XSV A;  5DCM B;  3U1D A;  1K79 A;  1UST A;  4G7Z F;  5ICF A;  2TDX A;  3GZ5 A;  4LLG F;  3CUQ C;  5ICG A;  3DPT A;  3L00 A;  3J80 K;  3TO9 A;  2PEX A;  2ZO4 A;  3B73 A;  3CUO A;  2RQP A;  5E1X A;  5FLX K;  4HA8 A;  1LNW A;  1HXD A;  4KIC A;  3AAF A;  1LDD A;  2GA2 A;  1J2X A;  4HLX A;  5E17 F;  2BBY A;  3C18 A;  3F8F A;  4E70 A;  1IRG A;  1O3Q A;  3K1N A;  5LHH A;  2BE5 F;  2WTE A;  4RB2 C;  2QQA A;  3RYP A;  1MDM B;  1XDU A;  3IRQ A;  5D5W B;  2QBY B;  1G3W A;  3FMQ A;  3WE3 A;  2RKH A;  2VOO A;  4A0Y A;  4A5M A;  4Y13 A;  1OKR A;  2IW5 A;  3D0S A;  4UVB A;  4N9I A;  1PDN C;  1E2X A;  1U78 A;  2Q0O A;  1YO5 C;  3EYY A;  4HOB A;  1MJB A;  2H6B A;  2ZCW A;  2XKO A;  4JBA A;  3HOT A;  2FA5 A;  4BHP A;  1JHF A;  2F5C A;  3KP2 A;  4OIR F;  4CXF A;  4Q5S F;  5LEJ A;  5E1W A;  4MTD A;  2ZFW A;  2PFB A;  2RV8 A;  2FNA A;  3ECO A;  3HYI A;  1T6S A;  3QRF F;  2PLY A;  2Y0M A;  1ZGJ A; 
#chains in the Genus database with same CATH topology
 2EWN A;  3GVA A;  1YQA A;  3DPU A;  1Z9C A;  3H5N A;  2CQX A;  4N4O B;  4MQV A;  1ODD A;  3DU5 A;  4UB8 C;  4AIH A;  2D45 A;  1APL C;  3IRR A;  3CCL I;  1YX3 A;  5D4R A;  1Z3Y A;  1QRY A;  4EAT A;  2BOL A;  2YX7 A;  1OYW A;  5LLQ A;  4IXA A;  3F9K A;  3V7S A;  3KCC A;  1S72 I;  4IHT A;  3C2G A;  2MW8 A;  3H0G J;  1XSD A;  2HZT A;  1BI0 A;  4BXF A;  4HLY A;  1U0J A;  4Y15 A;  1UB9 A;  5D8K B;  3V7R A;  4ZYH A;  3H5R A;  3I53 A;  1ACI A;  1VQ9 I;  4I09 A;  1AA7 A;  1BJZ A;  2PMZ N;  1RZ4 A;  3LAJ A;  2DFI A;  1WZ2 A;  2VBW A;  5A2Q Z;  3TO7 A;  3S2H J;  1XN7 A;  3WTS C;  1SVM A;  2BHY A;  2GM4 A;  2GA1 A;  2L5Q A;  5E1Z B;  1IN7 A;  3LST A;  4ETS A;  1ZRE A;  4G12 A;  1QZE A;  2OU2 A;  3OYB A;  2ZME A;  3V8L A;  1ETW A;  1FMV A;  3QYE A;  4I7H A;  4XOP A;  5HS7 A;  3OYK A;  3O6B B;  3LNQ A;  3K1P A;  3IWF A;  1AU7 A;  1KYW A;  4BHB A;  2E2I J;  2M2E A;  3F8M A;  4PJN A;  3I0T A;  1E3P A;  5FGM A;  2EB7 A;  2F5E A;  1YRN A;  3K69 A;  3QAH A;  4FIS A;  4HDV A;  4CCK A;  4FX0 A;  5IT9 Z;  2IEK A;  2OZU A;  5F64 A;  4FHT A;  1KZH A;  2HVR A;  4XLE A;  4L9V A;  5D6F A;  3FBI B;  3W2A A;  4A2U A;  1VQM I;  3U1K A;  4PGG A;  4A93 J;  1J09 A;  1G3S A;  4QIW N;  2ZB9 A;  3PJR A;  2LP0 A;  4QPQ A;  3RKX A;  1ORK A;  2F48 A;  2IGN A;  3T8T A;  1X58 A;  1OCP A;  4ESJ A;  4IZZ A;  1XPX A;  3BR5 A;  1FOK A;  4D1Q A;  2R3S A;  4CO8 A;  3OOP A;  1QZY A;  2OBP A;  3JRG A;  1IJW C;  4W97 A;  2Q2E A;  1MSF C;  3I9V 2;  2DTZ A;  1QU3 A;  2A3S A;  3L2C A;  4NNJ A;  1R4N B;  3H3Z A;  2EBI A;  3EUA A;  1D0Z A;  4UUV A;  2E5Z A;  5M5Y J;  1BW6 A;  1EH8 A;  1GLN A;  1MMG A;  1XGO A;  2Z3Y A;  3HPH A;  2L54 A;  4MHG A;  3SFI A;  5DYM A;  2H1K A;  2M30 A;  4BY1 J;  3E5Q A;  1O3R A;  1OQY A;  1D8K A;  1Z77 A;  1R00 A;  4RGS A;  3KYC B;  3HOX J;  3S1R J;  1HW2 A;  2OAZ A;  1LKX A;  3OOU A;  3DBH B;  4GCV A;  3ZQL A;  2XRN A;  3CD6 I;  1K61 A;  1O7L A;  2X6W A;  4ZJZ A;  2R7X A;  5F1J A;  3HKZ N;  4E7Z A;  2K3P A;  2KL4 A;  1G4D A;  1QPI A;  1U5T C;  1WJE A;  3GTO J;  3RZO J;  2NS7 A;  2RRE A;  1K6O A;  3OYH A;  1H89 C;  1P7I A;  1U6G A;  4KMF A;  2X51 A;  3QOE A;  1HKQ A;  5EGO A;  3CCJ I;  1RET A;  2ZNZ A;  1BA5 A;  2E1M B;  4EQQ A;  1FSH A;  4M9X A;  1ZR2 A;  2DO7 A;  2V9V A;  2OD5 A;  3Q5F A;  1X3Z B;  1E0E A;  3FXL A;  2Y69 H;  2O8K A;  2FUG 2;  2EH3 A;  3MVP A;  4AYB N;  3SZP A;  4BQA A;  1BM9 A;  1UHM A;  1UZC A;  2ZKZ A;  1HW1 A;  4U0V A;  1YJW I;  2EZI A;  1L3L A;  4OU0 A;  4ZDO A;  4IEJ A;  2V79 A;  1NTC A;  2NYX A;  3QPH A;  2WB1 A;  4ASN A;  1D5Y A;  4LIV A;  2O9L A;  4LD5 A;  4G6T B;  3PQK A;  4DBR A;  1FX7 A;  1S8N A;  2BHZ A;  2YU9 J;  3BOQ A;  3GEZ A;  2HOT A;  4BXU A;  3GTL J;  1FP2 A;  4Y4R A;  3RYR A;  5GAG J;  3CUQ A;  2KJC A;  2DFE A;  4A3M J;  2XVC A;  2K7L A;  2O3F A;  2UZK A;  2WV0 A;  4RM3 A;  1DDN A;  2QSF X;  4YFN F;  1IO2 A;  1CQT A;  2HPI A;  1SAX A;  1YW8 A;  5DS9 A;  3TO6 A;  1MBK A;  2FRH A;  3BZ6 A;  2R4G A;  1U9N A;  3SDB A;  1S9H A;  1TWH J;  3DU6 A;  1WQ2 A;  2BXY A;  4FE4 A;  5KNL A;  3I4P A;  4WX9 A;  4EJV A;  4HNV A;  3ZMT A;  3MD2 A;  3CZ6 A;  2R7O A;  3CMA I;  4LMY A;  4F7Z A;  2KZG A;  3GTQ J;  3G71 I;  1XGS A;  4UUS A;  3DBR B;  5BQT A;  3TMO A;  4EJW A;  2V9K A;  1G8X A;  3BJ6 A;  3ABL H;  3S15 J;  2A69 F;  2ECB A;  4PCQ A;  5EEG A;  2DQL A;  4KDP A;  3CDL A;  2HYF A;  3EET A;  3ZCO A;  4LB6 B;  2W82 A;  2ZFU A;  2XKP A;  4B8X A;  5DCM A;  2G7H A;  2VUM J;  4IHW A;  3K2A A;  1QO0 D;  3WU0 A;  1J75 A;  2EJR A;  3WGG A;  2V7F A;  4IHY A;  2V6E A;  1XS9 A;  1NH3 A;  1TW2 A;  1JJ6 C;  1Z21 A;  2EFW A;  3BCA A;  4BQQ A;  2P5L C;  3BG7 A;  5A2Q K;  5IYC J;  2JRM A;  1WSU A;  3HZJ A;  1FYM A;  3JSP A;  3K9T A;  2JA5 J;  3I4N J;  4P96 A;  2IXS A;  2PBI A;  3UKG A;  3MCZ A;  1H8A C;  4O3M A;  1H0M A;  2MBF A;  3F8B A;  5HOD A;  1VND A;  2HKX A;  5F0F A;  1VZ0 A;  1X3W B;  5HNF A;  2HOS A;  3FDY A;  2CU7 A;  2DLL A;  4KT5 C;  1AOY A;  3HTS B;  2E71 A;  1SVO A;  4LIT A;  3RTR A;  4BKX A;  2MH9 A;  3F21 A;  3HOW J;  2CQ7 A;  3ASN H;  2K9N A;  2FEZ A;  5B5E C;  2R7T A;  2CO5 A;  3WTT C;  2DK5 A;  2KP6 A;  2K4J A;  1MBF A;  4ON0 A;  3CJT B;  1BOA A;  1W4M A;  1W36 C;  2GLO A;  5IT9 K;  2F5F A;  2KIU A;  1BI1 A;  3M7G A;  1ETV A;  2AO9 A;  1MDM A;  3HHH A;  3BG5 A;  2HU9 A;  3EUK L;  2MC4 A;  5HLG A;  2L9N A;  5HS9 A;  4DYC A;  1BC7 C;  1MGT A;  4IOC F;  4WXD A;  2Y9Y A;  1DP7 P;  5H6Q A;  4WK8 F;  4WWC A;  2QBY A;  1FBS A;  1R5I D;  1DP3 A;  1MBJ A;  3CP2 A;  1W5T A;  2RN7 A;  2IS6 A;  2P5V A;  2ETH A;  3DLL F;  4GDF A;  4RAG A;  3E5X A;  4LLL A;  2XPU A;  1MBE A;  1Y6I A;  4CIC A;  3I71 A;  1SAN A;  4NC8 A;  1SC7 A;  1ZG5 A;  5H6R A;  1P7J A;  5JHF A;  4BAC A;  5EJC A;  1FY7 A;  3AL0 B;  4L9J A;  5EDN A;  3LQQ A;  4DNC A;  2XRO A;  4FX4 A;  2FMY A;  3CC2 I;  2OJE D;  4XSX F;  1D1B A;  1XGN A;  1Y8R B;  3DCF A;  1YI2 I;  1KON A;  2JA7 J;  1XMA A;  4WF2 A;  4XOR A;  5DUI A;  3GTM J;  2X6O A;  4HAM A;  2HQA A;  5H20 A;  4CCO A;  2YX4 A;  2HDD A;  2E7W A;  2Y31 A;  5AIP A;  1JKP C;  1UHS A;  4P9U A;  2LG4 A;  2RNJ A;  3HOU J;  4KYW A;  2X1C A;  5J4Y A;  2VLA A;  3C3W A;  2EZH A;  3ZMS A;  3S3O A;  2MLG A;  4XRS A;  1PJR A;  3D1N I;  4C30 A;  1IN5 A;  2OUM A;  1NG6 A;  3E3V A;  3SEQ A;  4EMS A;  3E6B A;  4BS9 A;  2E1C A;  3CJR B;  3OYA A;  4LGW A;  4LLN A;  2VBX A;  3FMR A;  1T95 A;  1R6R A;  3H3U A;  4XLP F;  3IL2 A;  1I1S A;  3TW7 A;  5JR3 A;  4KUM A;  1YS6 A;  4LJZ F;  5E79 C;  1FPQ A;  2DPU A;  1D8J A;  3N05 A;  3VYS B;  4IVN A;  4I02 A;  4OAY A;  5HDK A;  2PMH A;  4KIS A;  2XF7 A;  2JN6 A;  4EJT A;  4ANJ A;  1R23 A;  2HYG D;  1SVL A;  2JT1 A;  4RBO A;  1TNT A;  5M3F J;  4BXX J;  2W24 A;  2XGC A;  1S29 A;  3TED A;  1LUJ B;  3FXQ A;  3MZY A;  2LF7 A;  1SD5 A;  2EIK H;  4NC6 A;  3Q3S A;  5FLM J;  3ZPL A;  3M07 A;  4AC0 A;  4EGZ A;  3DQV C;  3KP6 A;  4E7S A;  2JA8 J;  1ON2 A;  5FKN A;  3F23 A;  1VQ5 I;  1MH3 A;  1P92 A;  3C7J A;  4ESB A;  3WTU C;  3GUD A;  1PUF B;  2KKO A;  3FMS A;  4KN7 X;  4XSZ F;  3HB9 A;  1RUO A;  1UCR A;  3S32 A;  1LVK A;  2R0Q C;  2A05 A;  4AVP A;  1D1C A;  3G1O A;  3U2R A;  3QOD A;  5J8F A;  5HOO A;  3HG9 A;  5C4J J;  3BR2 A;  1AHD P;  3PFY A;  2JJ7 A;  2E1N A;  4A69 C;  2NOJ B;  3COA C;  3FIS A;  1V55 H;  5JFR A;  3CQZ J;  3JRA A;  1TWG J;  3G3Z A;  4E7H A;  5F08 A;  3CF5 F;  5IOZ A;  2NVY J;  2NVX J;  5FKK A;  2GXB A;  2XPW A;  4DOZ A;  3LSH A;  1F1Z A;  4C2T A;  1IDY A;  1DUX C;  4UVC A;  3RQI A;  2X1D A;  3ABK H;  1KQ0 A;  4I98 B;  2LC2 A;  1I1G A;  2ZXW H;  2AXT C;  3OL4 A;  3OYC A;  1YJ9 I;  1I5Z A;  5IP6 A;  1REP C;  1LB2 A;  5HLH A;  4XN3 A;  3E1S A;  2KFD A;  3VWB A;  2D1V A;  3OSG A;  2E19 A;  3I58 A;  3T1B A;  2DMN A;  3K6G A;  2E5N A;  3ABM H;  2XAJ A;  1PVE A;  4YEJ A;  3RSN A;  2DPD A;  4BBS J;  3A2K A;  1XCB A;  4QWQ A;  4QSH A;  2MH2 A;  1B9N A;  5K1Y A;  5C3E J;  2EFN A;  2KLO A;  2WC2 A;  2Z1D A;  3K70 D;  1I50 J;  2ELH A;  3L2W A;  1AKH B;  4IQJ A;  2ID3 A;  2VPR A;  3VPR A;  5DDG A;  3FBN B;  2WB1 N;  3HOV J;  2LKP A;  5BMZ A;  1R5H A;  2A6E F;  5JLX A;  4H0E A;  2HXI A;  2KT0 A;  1DQU A;  2F4I A;  5IY5 H;  3CUQ B;  3S1M J;  1W7P D;  1Z0X A;  2MD0 A;  1IRZ A;  3TOA A;  2D1H A;  3LSI A;  1TBX A;  2I10 A;  3DKY A;  3J81 Z;  3BWG A;  3KPH A;  4LFU A;  1F5T A;  2F5D A;  2KIM A;  4AWX B;  3E7L A;  2PG4 A;  1U8B A;  3ZQQ A;  3BPV A;  4HX7 A;  3MAJ A;  1GXP A;  2W4S A;  2XHK A;  5K7H A;  2YU3 A;  4Q48 A;  3L2Q A;  4IJA A;  2M4G A;  4XLN F;  5ILU A;  2V1N A;  5BPD A;  3Q0U A;  1FIP A;  3LSM A;  3SEZ A;  3DFG A;  4R1H A;  2DMT A;  1SMT A;  3TL4 X;  2I5U A;  3T5X A;  2VKV A;  1FYL A;  5EF6 A;  1W36 D;  4B09 A;  3U21 A;  1V4R A;  1EKE A;  2A68 F;  1JJ8 C;  3BR3 A;  1TP4 A;  2EV0 A;  1S7A A;  2E34 A;  2HQN A;  5E3N A;  1NK2 P;  4KT6 A;  3BG9 A;  3H0D A;  1W7P A;  3R4K A;  3HC7 A;  2ZJR F;  2JZY A;  2VKH A;  4B4C A;  3CCY A;  3C1D A;  3O8G A;  4IRH A;  3FXM A;  2STW A;  3ISP A;  1XD7 A;  3CP8 A;  1T56 A;  5DD4 A;  3ZQH A;  1FEX A;  3KYD B;  1YE9 A;  2XF6 A;  2DT5 A;  2HDC A;  2XIG A;  5HDN A;  4II2 A;  4V2G A;  3K1M A;  3JR9 A;  4E7J A;  1W1W E;  1BC8 C;  2CV1 A;  3OYG A;  2DTR A;  3ZMD A;  2IA1 A;  4ENN A;  3QYF A;  5CKT A;  1XMX A;  2CW7 A;  1O57 A;  5HDG A;  2NVQ J;  4ZZD A;  2X0L A;  2DAO A;  5ILV A;  3Q0W A;  2ZC2 A;  1KU3 A;  4X6A J;  1OYY A;  5FO5 A;  3CDH A;  3HPG A;  3DV8 A;  4L5J A;  5DM6 F;  1X4O A;  2L4A A;  3CJQ B;  4ZH4 F;  4PJJ A;  4HEA 2;  4P5O A;  5CLS A;  2PJR B;  5M3M J;  3BPX A;  1U9O A;  5F1R A;  1K78 B;  1BR4 A;  3VYR B;  2BGC A;  5DV5 A;  2QQB A;  2DFH A;  3H5A A;  3H9J A;  4XIC A;  1P6R A;  3WHB A;  1TQP A;  5GPA A;  4YFX F;  2JWT A;  1Z05 A;  2XAG A;  2Y30 A;  3GLX A;  3KP3 A;  4BHC A;  3BG6 A;  4EJO A;  5DM7 F;  5E3O A;  2A6H F;  4XR6 A;  4X0G A;  3VFZ A;  5EZG A;  3EYI A;  3K4J A;  3X2Q H;  1RC9 A;  4Y7N J;  2B63 J;  4L0Z B;  1XTA A;  4HF1 A;  2NNY A;  3VEP A;  1VFC A;  2WV1 A;  3HRS A;  2GXG A;  2EPF A;  2V6C A;  2O61 A;  3HJE A;  1QNT A;  1W5C C;  3QP5 A;  3OYD A;  2ESH A;  5E8G A;  1QVT A;  2CWE A;  2LY9 A;  2ME0 A;  3P7N A;  1WHU A;  1GUU A;  3KET A;  3FIW A;  2FOK A;  4XNF A;  3IC7 A;  4HPQ A;  2VJ5 A;  2STT A;  2MSY A;  4JQF A;  2QWW A;  5LRR A;  3NQO A;  3CO6 C;  3M8E A;  5J1U A;  3FKI J;  1IUF A;  2DN0 A;  3IKT A;  3QOP A;  1KQ9 A;  3GME A;  4XQF A;  3FHZ A;  3ERE D;  1O4X A;  2AS5 F;  4JX5 A;  2OPT A;  1MJA A;  2K9S A;  2MFZ A;  3JRF A;  4D5C A;  3EPZ A;  3BT9 A;  2Y2Z A;  2YPR A;  2XGE A;  2IGO A;  2M87 A;  1HSJ A;  5F27 A;  1OCZ H;  2L3D A;  3DEU A;  1Z67 A;  1F4K A;  1NG7 A;  2K4B A;  3OV8 A;  1DU6 A;  3BQZ A;  3LWF A;  4UB6 C;  1SD4 A;  1FOY A;  1USS A;  4S05 A;  2LRE A;  3I4M J;  2IVM A;  2HEO A;  5HS8 A;  3KP5 A;  2HS5 A;  4HRI A;  1B4A A;  3H92 A;  4R79 A;  4ZTJ A;  4PJL A;  2KDO A;  4RAY A;  3VOE A;  5K5Q A;  4GFB A;  2UXX A;  2O8X A;  4DZP A;  2IA0 A;  1U2W A;  2EFP A;  4ZYE A;  3J7Z I;  1G3T A;  2MYS A;  2X6Y A;  3FX3 A;  4M72 A;  4BJ5 C;  1YOV B;  3S16 J;  6PAX A;  4KFC A;  3J81 K;  5HVQ C;  5EEA A;  4QLC U;  3OY9 A;  1K4S A;  2CUF A;  1IAW A;  3PO2 J;  1BBY A;  2K9Q A;  3GZ6 A;  1ZTR A;  1FIA A;  1YIO A;  1QQI A;  1W0T A;  1U8R A;  1R4M B;  1GXQ A;  3DF8 A;  4A0Z A;  3WTX C;  3BRO A;  2FX0 A;  2K9M A;  1ULY A;  1RUN A;  4XLA A;  2EFQ A;  3ONQ A;  4A3E J;  4D7N A;  5TGT A;  5LBQ A;  1XCV A;  2R7F A;  5LHG A;  3HSR A;  1VQK I;  3IUO A;  3PFI A;  4HSR A;  1TQI A;  1GV5 A;  1T8I A;  3FXR A;  2KHM A;  1SD6 A;  1VTN C;  1U5T B;  4E7L A;  4I0A A;  2ZBK A;  1T2K A;  2W48 A;  2H94 A;  4XOT A;  3BC8 A;  4CDG A;  1FC3 A;  1VQ7 I;  1JXS A;  4IX7 A;  2M3A A;  2UUZ A;  4EJU A;  5JLW A;  3HUG B;  3EUH C;  3A0H C;  2V1D A;  1OPC A;  2VT2 A;  3QPL A;  4M73 A;  4C3J J;  3O2P E;  1OYI A;  1SEU A;  3LQR A;  1ZEL A;  4FQG A;  4BDY A;  1PUF A;  2KMU A;  1DPU A;  2XSD C;  4DYQ A;  1YW7 A;  2QZ8 A;  3E6D A;  1WKM A;  3SDG A;  1XX5 A;  1GT0 C;  1I3A A;  2XB0 X;  2BY3 A;  4NC7 A;  3GFM A;  2V4J C;  5M5W J;  4UXN A;  1YW9 A;  4M6Y A;  5KHD A;  1XB4 A;  3CCU I;  4KN4 X;  2VT3 A;  3IAM 2;  3MEX A;  4I99 C;  2CW8 A;  2V9P A;  4AD9 A;  2LLK A;  3VYU B;  5AON A;  2EA4 A;  4D7M A;  2E35 A;  4YIF A;  3OYJ A;  3N4M A;  2K9L A;  3HTU A;  3I59 B;  3IH4 A;  3RQ4 A;  2P7V B;  1MZB A;  2Y0S A;  3ZMZ A;  2DQR A;  2XRL A;  2FQ4 A;  4NHJ A;  3OYF A;  3IH3 A;  1QHH D;  2VPL A;  2FQ3 A;  1IN8 A;  1BJA A;  2QM3 A;  4XRM A;  1FOX A;  2F5V A;  4MFE A;  2IAI A;  5ILS A;  4CCJ A;  4PGH A;  1D0Y A;  3BP8 A;  2GWR A;  3S3N A;  3F0C A;  1WRJ A;  3IKV A;  1B6A A;  3K10 A;  3CO7 C;  2X4H A;  2G0E A;  3DEE A;  2VXD A;  3A01 B;  3RKW A;  1MMN A;  1IXC A;  3VYT B;  1FBQ A;  1Y39 A;  1FSE A;  1R36 A;  3PNT A;  3OL3 A;  2P8T A;  2WAQ A;  3HGY A;  1OCC H;  1WVR A;  4MQ9 F;  3OYI A;  2H8R A;  2LTP A;  3F22 A;  3VB2 A;  2DJN A;  3C2B A;  3CCE I;  3E6C C;  1AKH A;  2LH9 A;  3ML6 A;  2DA7 A;  1F9N A;  2XF5 A;  1R71 A;  4HQM A;  3HL2 A;  2LBF B;  4ESF A;  2X6X A;  1JGS A;  2GAU A;  3K7A J;  2XAH A;  3TOB A;  5DD8 A;  1G59 A;  4HNU A;  1KU2 A;  3GTP J;  2VE9 A;  1VQL I;  3J7A O;  2QEX I;  2UWM A;  1FBU A;  1W7P B;  3HDD A;  2LMD A;  5BPI A;  2VN2 A;  3P9I A;  5L3C A;  1PUE E;  3FM5 A;  1Z6T A;  2VON A;  5IYD J;  3VOD A;  3HOZ J;  5F0H A;  4L5I A;  2DA2 A;  4NBQ A;  2W00 A;  1PP8 F;  4NQW B;  3GFI A;  2DYR H;  3PNY A;  1N77 A;  3DWL E;  5L3D A;  2J5P A;  2OCC H;  4BQN A;  3RKY A;  1ETY A;  4G7O F;  3KEQ A;  5LGN A;  4HF0 A;  2COM A;  2P6T A;  1SMY F;  3MKL A;  3PUF A;  1T08 B;  1GVD A;  1OJL A;  1JUS A;  2LKS A;  4CZC A;  2CSO A;  3K70 C;  2Z9O A;  5LGU A;  3B02 A;  1YX5 A;  1ZQ3 P;  3G1L A;  3I55 I;  3LA2 A;  1ETX A;  2DA6 A;  5FRN A;  1EF4 A;  4PFP A;  4BH9 A;  4EEF G;  2EK5 A;  1IRX A;  3FZV A;  3K0L A;  2RC4 A;  4E6K G;  2W85 A;  1RI7 A;  2QYO A;  3HOS A;  1WJD A;  3GZN B;  2XAQ A;  2L9S A;  3P5J A;  4I6Z A;  4HST A;  1W0U A;  4BU2 A;  4CZZ A;  2JPC A;  4GRI A;  4CYC B;  3L9F A;  3UNG C;  1H9T A;  1MSE C;  2BEO A;  2ZXJ A;  2M0C A;  4DZJ A;  1R22 A;  4II3 A;  4BL0 B;  4KIG A;  1FP1 D;  1LDJ A;  1STZ A;  5J40 A;  2E2H J;  5LEK A;  1F36 A;  3JTG A;  3I3L A;  3O3K A;  1MNE A;  3M9A A;  5JVG F;  4HQE A;  4A6D A;  1FMW A;  4V19 K;  2JUG A;  2ZXI A;  3S2D J;  4PFO A;  4BJ6 C;  4RAZ A;  2NNN A;  3JAM Z;  1BI3 A;  2X85 A;  5FKL A;  3ZMU A;  3HXL A;  4LB5 A;  1JT6 A;  2XV4 S;  1IDZ A;  3L2U A;  1VQO I;  4M6V A;  2PJR A;  1K78 A;  4I0B A;  4I01 A;  4B48 A;  5FJ8 J;  1ZGA A;  3F72 A;  4Q47 A;  4EV0 A;  5EEH A;  2GIZ A;  3H9Q A;  3CMY A;  1QVU A;  3FXK A;  1LPQ A;  2BW3 B;  2ISY A;  1WI3 A;  4AUX A;  2P6S A;  2H27 A;  2TCT A;  2XSJ C;  2B7E A;  3E97 A;  4HX8 A;  1T0F C;  2QGU A;  2LYC A;  2KDZ A;  1FOW A;  2K27 A;  4XLC A;  5CVU A;  4ZZL A;  1ZG1 A;  2NVU B;  2HTJ A;  1J0R A;  2VC1 A;  3FKJ A;  3RJP A;  3DPL C;  4U87 A;  2NS0 A;  2Q1Z B;  2B0L A;  4M71 A;  4ENM A;  5J4V A;  2C6Y A;  3JW4 A;  4P9F A;  4LK0 F;  3LSP A;  3ZN0 A;  5TRD A;  1CF7 B;  4BAY A;  3JRH A;  3ZMV A;  1H9G A;  3M8F A;  5J8C A;  4PK4 A;  5IPA A;  5F6F A;  3T8R A;  5ERI A;  2VIX A;  2F4M B;  3J7A Y;  4UHT A;  4KA4 A;  1I6H J;  3OIO A;  2FBK A;  3GX4 X;  4RB1 A;  3TW6 A;  5FD6 A;  2R7Z J;  1WJ5 A;  2R7R A;  4FTH A;  4HF2 A;  3BTL A;  3CDI A;  2MD5 A;  1YFH A;  2LVS A;  2VQL A;  3L2R A;  5B1A H;  1QBJ A;  1MD0 A;  4P1W A;  5B1B H;  2VXZ A;  2ESN A;  3LA3 A;  3VSK A;  2KZV A;  3SQN A;  2F2E A;  3RPU D;  1ZG3 A;  5HLI A;  1Y56 A;  3ASO H;  3HOY J;  1GVJ A;  1RNL A;  1HF0 A;  1X1C A;  4GYG A;  1R5G A;  1RIO H;  2Z16 A;  3HSF A;  1XC5 A;  3ZXS A;  2CFX A;  1S5L C;  3ZQF A;  2QQ9 A;  4RAF A;  1QA6 A;  2JVH A;  5TIS C;  1KQ8 A;  4LG3 A;  3RIR A;  4ENJ A;  4UV9 A;  4B3A A;  4FAS D;  4MNU A;  1YTY A;  1AWC A;  4Y17 A;  3MKY B;  2IP2 A;  1IC8 A;  3IP4 B;  3A4C A;  2IJL A;  2VKE A;  3CCM I;  1Z7L A;  2CRG A;  1HST A;  1MMS A;  2M45 A;  2HFH A;  3W6K B;  1R9T J;  1VQ4 I;  4FET A;  4XMY A;  3ZRG A;  3QPS A;  5FLX Z;  1HBX G;  2H6C A;  2LF8 A;  5E3L A;  3TP3 A;  5IT3 A;  1JI8 A;  3HIF A;  3P9C A;  3BR6 A;  1MJ9 A;  3WTV C;  1RR8 C;  2DT7 B;  5JI6 A;  4ENK A;  3HSE A;  4G94 A;  4MLO A;  2CQK A;  2HKO A;  4G6D A;  3TQN A;  4D9J A;  2YUS A;  3G1M A;  2ME6 A;  2R7U A;  2PMZ A;  2W84 A;  3M8J A;  3FM3 A;  3CLO A;  1OCO H;  1QZZ A;  3LFU A;  4M3F A;  4HG2 A;  3PIO F;  1JGG A;  4MEX F;  4B3X A;  2QKL B;  4B47 A;  4MTE A;  3ZP5 A;  1JKO C;  1ZLJ A;  4XBF A;  4RB0 A;  4U0Y A;  2Z33 A;  3OIP A;  3ZR8 X;  4Z2Y A;  4S0H B;  2ZJ2 A;  4RS8 A;  1B9M A;  5L3F A;  1HCR A;  1RKT A;  2L7K A;  1HDP A;  2DXI A;  1SD7 A;  1X4P A;  1MMA A;  2IRF G;  4DGW B;  1I39 A;  2LRD A;  1EA3 A;  3LFK A;  5K5R A;  4IKF A;  2EV6 A;  1L0O C;  2CUE A;  3RZD J;  4O6J A;  1C0W A;  3Q9S A;  1U5T A;  2ISZ A;  4RMN A;  2K3F A;  1LDK B;  2ZME C;  5GP9 A;  2MAB A;  2FBH A;  2QEN A;  5E3M A;  3EQL F;  1HDD C;  1H88 C;  3HUG A;  2Q8K A;  2R7D A;  4OMZ A;  2YSR A;  3BZK A;  3H35 A;  1UG0 A;  4NDL A;  3WE2 A;  1WCM J;  1ZYR F;  5K7Z A;  5TJJ A;  2XDV A;  3N97 A;  1A04 A;  1JTX A;  4RB3 C;  3OS2 A;  3KEY A;  3MQ0 A;  2FD5 A;  1K4T A;  2DT6 A;  2M7A A;  1IRF A;  3MZ8 A;  1JE8 A;  1V54 H;  2VQC A;  2ADU A;  3DXJ F;  4JX6 A;  4XKC A;  3E0J B;  4L18 B;  3B6C A;  4RGU A;  2HR3 A;  5H2F C;  3T0Y A;  3O8H A;  1TL8 A;  3GBG A;  5IYB J;  5ED4 A;  3I59 A;  2EZK A;  3ULQ B;  3OR1 C;  4EGY A;  2P5K A;  3WU1 B;  3JAM K;  3HGG A;  3NEU A;  1MMD A;  2CW0 F;  3BCB A;  1QGP A;  4RLQ A;  4QTR A;  2MG4 A;  3OIQ A;  5FFX A;  3IV5 A;  2WAQ N;  1ENH A;  2CS3 A;  2MGQ A;  2UXN A;  1OR7 C;  1KU9 A;  3AG1 H;  2LD5 A;  2OQR A;  5FB2 A;  4AIJ A;  4D0P A;  5D6E A;  3HKZ A;  3CTA A;  1RRJ A;  3S17 J;  1X1P A;  1WFX A;  1V5G A;  1ZH5 A;  3LAP A;  1ZAR A;  2QCO A;  4IOA F;  3OWT A;  4M3E A;  2QKM B;  3D5R C;  1R7J A;  3KZZ A;  1P4X A;  3A01 A;  4WCG A;  2OTJ I;  2DA3 A;  2FOW A;  2W1O A;  3KE2 A;  4YII A;  4RGX A;  1MBH A;  1IUY A;  4YEL A;  2A5Y B;  2HDW A;  1WWX A;  2BY0 A;  2Z99 A;  1K7A A;  1XG1 A;  2M8E A;  1J59 A;  1YIT I;  5LD2 C;  3R60 A;  4Z6Y A;  4BE2 A;  4A3C J;  1BIB A;  1XSX A;  2LBF A;  4BDZ A;  1SFU A;  3H3V K;  4KIT B;  4OIN F;  1I3Q J;  1G3Y A;  1R1T A;  2H1L A;  5JHU A;  1ZHF A;  3GF2 A;  1I27 A;  3EDP A;  1SAU A;  2NXN B;  2P0W A;  1TQM A;  2DOF A;  1RPW A;  4OOI A;  3A1Y A;  2L4M A;  2ACJ A;  1ETQ A;  5GPC A;  4ABZ A;  3UR3 C;  4NQW A;  4CCN A;  5M5X J;  3SYT A;  1SFX A;  1IV8 A;  2VAS A;  2XAF A;  5D5X B;  4BNC A;  1FLI A;  4O5V A;  2OCE A;  3DTK A;  2HWV A;  1IF1 A;  2IA2 A;  2HQ5 A;  2JSC A;  4LG0 A;  2AQE A;  3OYN A;  4U88 A;  3V7C A;  3V42 A;  4DIQ A;  1HW5 A;  2HZD A;  2PN6 A;  2IS4 A;  3W6J B;  2A5W A;  2HTS A;  3DBL B;  4KJZ A;  4PZJ A;  1N25 A;  2QSH X;  2RQQ A;  3FXU A;  3R0J A;  5CVV A;  1T38 A;  3WU2 C;  2CFO A;  2OC6 A;  5J1Y A;  1NK3 P;  4FE7 A;  2JK3 A;  2VB6 A;  4DYR A;  3TP0 A;  3F6V A;  1IXR C;  1B72 B;  2CYY A;  2BV6 A;  2PJP A;  2L7F P;  4CYC A;  3GXO A;  5CVJ A;  3ZQC A;  4M74 A;  2FNP A;  4EM0 B;  4G6Q A;  1T0F A;  3HRM A;  3KIO A;  1J5Y A;  2DI3 A;  3CC7 I;  5E20 A;  1LFP A;  1Y1V J;  3M1E A;  2X48 A;  4XL9 A;  2BY2 A;  5J3L A;  1OCT C;  1Z3X A;  2K86 A;  4U7D A;  1J7K A;  3H36 A;  5L3B A;  4A3L J;  2ZXH A;  2JVG A;  5KVR A;  2XC7 A;  1SFO J;  3OSF A;  1D5V A;  2WAE A;  3MKW B;  4X1E A;  2KIQ A;  3K4K A;  1E3O C;  3KLO A;  1HQC A;  2OF7 A;  3S8P A;  2E1O A;  5KAI C;  1ZLK A;  3MFK A;  2AXL A;  4XID A;  3DP7 A;  3WHC A;  1TWA J;  3SHF A;  3ABU A;  1Z1D A;  5CJ9 A;  2FML A;  1Q1H A;  2O5R A;  3V8K A;  1D3Y A;  2YS9 A;  4J00 A;  4F93 B;  3KEO A;  3D5L A;  2BW3 A;  2DMU A;  1X1B A;  1VQP I;  4LOC A;  1ZRC A;  3ZQ7 A;  4V2F A;  3S3M A;  2EZL A;  2P7C B;  4HV6 A;  2LKX A;  4XN0 A;  5IOY A;  4MO7 A;  1LE8 B;  1FZP B;  1UEL B;  1ZRF A;  1R58 A;  1O3S A;  2UV1 A;  4C2U A;  2JTV A;  1J9I A;  4J01 A;  1RKW A;  3M4O J;  1CF7 A;  2IGK A;  1TWF J;  2MLK A;  1JHH A;  4IRI A;  2L7M P;  2DOA A;  4EM2 A;  3U9G A;  5FLV A;  2K40 A;  4C9Y A;  5BOX A;  3QU6 A;  2QF7 A;  1ON1 A;  1WGX A;  1XDS A;  2K85 A;  3MWM A;  1X2N A;  2LY1 A;  2HQR A;  5CVI A;  2WWY A;  3GCM A;  3BR0 A;  3ESW B;  5BS6 A;  1YLF A;  2QA4 I;  1UJ8 A;  2N8G A;  3AG2 H;  2NS8 A;  2CV2 A;  2HGC A;  4M3B A;  1CGP A;  3FK6 A;  1WJF A;  4E7I A;  2DU9 A;  5KK1 A;  4N4N B;  2BXZ A;  1B59 A;  3BTJ A;  3QQA A;  3GFL A;  3J7Y J;  5F0C A;  4E7K A;  3GTJ J;  3BTI A;  2HPM A;  5EZH A;  4PUS A;  3V4G A;  4AID A;  2G9W A;  1ZR4 A;  1MH4 A;  1ZGW A;  3TKY A;  4J19 A;  2DFF A;  5FRO A;  3OYL A;  2VJI A;  5IP7 J;  1IW7 F;  1QHG A;  3CMM A;  2QVO A;  3GYH X;  1LVA A;  2DA4 A;  1S3J A;  1DPR A;  3W2W A;  1EH7 A;  2EIN H;  3PIP F;  2P4W A;  2VKD A;  3BJA A;  2JQ7 A;  4A3I J;  2AHQ A;  4XKV A;  3GW2 A;  3KLN A;  1YYV A;  2BY1 A;  2GOX B;  1XGM A;  3NWT A;  2G7U A;  1JTY A;  3ROU A;  1IG7 A;  1G2H A;  4IQ4 A;  4R8H A;  4M9S A;  2OZ6 A;  1P2F A;  5C44 J;  4JK1 X;  2K5C A;  2IS1 A;  1VF9 A;  2JPB A;  2VBZ A;  4HV5 A;  2D5V A;  2EIM H;  4XRS G;  2PMU A;  2P81 A;  3OYE A;  2QQ8 A;  2CH0 A;  5C4X J;  1A6Q A;  2OA4 A;  3BDD A;  4XM3 A;  2IBD A;  4BEH B;  3ABT A;  4LK1 F;  4BY7 J;  2X9D A;  3PSI A;  5KAF C;  2VE8 A;  1LQ1 A;  1BR2 A;  1MND A;  1BL0 A;  3G73 A;  4CYD A;  3HM5 A;  3H9G A;  3RPQ A;  2Z5U A;  2L9R A;  3I64 A;  2L9V A;  1VQN I;  2JUC A;  1LEA A;  2M1B A;  1ZK8 A;  4P55 A;  2J5O A;  1TT5 B;  3LMM A;  2VBY A;  3A0B C;  1Y0N A;  5LRS A;  2O7O A;  4A3K J;  4G8X A;  3ZQG A;  3H1C A;  2DOE A;  4CSW A;  5DUK A;  1OR7 A;  3WOD F;  5LHI A;  4A3D J;  2HYJ A;  4A3G J;  2DK8 A;  5GTI C;  3GO5 A;  1TZL A;  4BBR J;  4MIM A;  1V5F A;  4BUP A;  2QSG X;  4F52 A;  1SFE A;  3MKZ A;  4BQO A;  1VQ6 I;  4RLF A;  3ECH A;  3HEF A;  1KA8 A;  3DTI A;  2DBB A;  1GHC A;  5AIQ A;  4ZYA A;  5BNG A;  2V1U A;  2LK2 A;  3R0A A;  1X1D A;  3W2V A;  3BQY A;  4A0X A;  2XGX A;  3PQJ A;  3RDI A;  3FXJ A;  4CA0 A;  2DA1 A;  4IRG A;  3LSK A;  2WBM A;  1V3F A;  1ZRD A;  3QP6 A;  4ZTF A;  1QPM A;  2HXO A;  4XRF A;  4A6E A;  2M34 A;  2CQQ A;  5E18 F;  3IHU A;  2EIL H;  3G2B A;  4YRV A;  2LY2 A;  2PQ8 A;  1Y0U A;  4C3I J;  4RGR A;  4GXO A;  1HKT A;  4B44 A;  1WJB A;  2R93 J;  4HYE A;  5FFZ A;  4HZF A;  2V1X A;  4UUT A;  3ZOB A;  2XAU A;  1E17 A;  4L5E A;  4CCM A;  3LSJ A;  4XON A;  5LFA A;  2H8W A;  3BY6 A;  1Z7U A;  1HKS A;  4CHU A;  3WTZ A;  2LR8 A;  2PI0 A;  1WH5 A;  1Z6R A;  5FD5 A;  2JSP A;  3PL8 A;  1GDT A;  1T98 A;  1MNM C;  4TV7 A;  4XLF A;  1DGR M;  4C3H J;  1FNN A;  3W3C A;  3G6E I;  3BLY A;  3KP7 A;  4W1U A;  3REO A;  5EG0 B;  1TWC J;  2KPM A;  4CCL A;  2X1E A;  3KYL A;  2O6G E;  3IAS 2;  3OS1 A;  4KIF A;  1HOM A;  4ITV A;  1TLH B;  2LNB A;  2CUJ A;  1FWZ A;  5D5V B;  3LSR A;  4LG0 B;  4BJT A;  3E5U A;  4JOM A;  4Y3O A;  4EM1 A;  2E1M C;  2QUF A;  2ZJQ F;  4B43 A;  2LFB A;  5DEQ A;  4OMY A;  2KRC A;  2CQN A;  3W6V A;  3JRB A;  1MW7 A;  2W25 A;  1IN4 A;  4G9Y A;  1KGS A;  2XUB A;  1TTY A;  4WXH A;  3JRE A;  4IO9 F;  1HA8 A;  2DCE A;  3Q9V A;  1FTT A;  4XLH A;  2LDU A;  2OQG A;  4M3D A;  3K2Z A;  4H4K C;  4C2M J;  1X2M A;  4F3Q A;  2JA6 J;  1G6N A;  2LOO A;  1Y1W J;  3R6S A;  4OIO F;  2FU4 A;  3FF5 A;  3KX2 A;  1Y8Q B;  1WH7 A;  3WG9 A;  1A31 A;  2CV0 A;  1YS7 A;  3PSF A;  2F6C A;  4BE0 A;  4E4H A;  2JA2 A;  4IHV A;  2M5W A;  1BW5 A;  1ONV A;  3WTW C;  3IH2 A;  1D0X A;  4IHX A;  3MZH A;  3LA7 A;  3P9K A;  2R7W A;  3OR2 C;  3JCU C;  2MA3 A;  2Y48 A;  3BG3 A;  3L2V A;  2R5Z B;  4CGZ A;  3S1N J;  1B72 A;  3SZT A;  1I6X A;  1B8I B;  4PJM A;  1JUP A;  2ID6 A;  2XB5 A;  2GIV A;  1SFK A;  1P4W A;  2E7X A;  2M9H A;  2M0M A;  4CH7 A;  3S1Q J;  4HBL A;  2VJJ A;  1BR1 A;  4A3F J;  1NHA A;  4U7B A;  4HNT A;  4Q4Z F;  4FCY A;  3K4C A;  2VQG A;  2DJI A;  3OYM A;  1A36 A;  3DKW A;  1UFM A;  3IWZ A;  1U3E M;  3I5U A;  3CC4 I;  4JYK A;  1WJC A;  4CUG A;  2EQR A;  3WTY C;  1O3T A;  2W57 A;  4B1R A;  5D5U B;  2BYV E;  1ERD A;  2R92 J;  2XPV A;  4ZYG A;  4BE1 A;  2RDP A;  3F8N A;  2COB A;  3KZI C;  4JX4 A;  4MEY F;  4RDU A;  1EH6 A;  3WGH A;  1TW3 A;  4U0W A;  1BIA A;  3MMY B;  3JRI A;  2R5Y B;  1R49 A;  1HLV A;  2EV5 A;  1TC3 C;  2JMW A;  4HX4 A;  5ICC A;  3ZN1 A;  3QYB A;  1S7E A;  2D2W A;  1IN6 A;  2AQF A;  1LEB A;  4Y33 A;  2FXA A;  1RR7 A;  4K2E A;  5K7F A;  2MC3 A;  1V5E A;  1KYZ A;  3L7W A;  2E36 A;  3ZQI A;  1BOB A;  1M1E B;  3C2H A;  1FJL A;  2RVC A;  3F8C A;  4RA2 A;  1LE8 A;  5K5O A;  5HNH A;  2ZJP F;  3HRU A;  1Q1V A;  3DTE A;  2VOD A;  3BJO A;  5KCM A;  5IP9 J;  4A12 A;  2NRA C;  3S14 J;  2XAS A;  2EA2 A;  4A5N A;  5ICE A;  3I54 A;  2GZW A;  1X19 A;  4EVI A;  4A3J J;  4KNY A;  2R7V A;  1X3U A;  5B66 C;  3M3Y J;  3CCS I;  3M1C A;  4N9H A;  1DGW Y;  2NOG A;  5D4S A;  4WXC A;  1JKR C;  1XMK A;  3AG4 H;  3HBL A;  4UNO A;  3J80 Z;  3RI4 A;  5JVT A;  1K6Y A;  2VC0 A;  3AG3 H;  1JKQ C;  2DMQ A;  1LJ9 A;  2A07 F;  3WGI A;  3K4B A;  5GTH C;  1ZKG A;  1WJA A;  3PUB A;  4UV8 A;  2HI3 A;  2ZME B;  5GAH J;  3I56 I;  4I2O A;  3PO3 J;  2YR2 A;  2H09 A;  3NRV A;  2VL8 A;  3RPU A;  1WI9 A;  3G4S I;  3CCV I;  3AL0 C;  3EUH A;  5CPR B;  5HLT A;  1OIS A;  2FF4 A;  2KRH A;  3OS0 A;  3ELK A;  2VI6 A;  3ZGK A;  4UVA A;  1YRN B;  4AIK A;  1VQ8 I;  1ZAO A;  4ZDP A;  1OFC X;  3HRT A;  3KFW X;  2Y75 A;  2FJ1 A;  2M7B A;  3LOC A;  3ERM A;  3L09 A;  5F04 A;  4M9Z A;  3GWZ A;  1OMI A;  2Z2S B;  2KJB A;  1IXS B;  3TGN A;  1T33 A;  1UG2 A;  2IPQ X;  1Z91 A;  4FT8 A;  4DBQ A;  1R1V A;  2L0K A;  2HOE A;  2E60 A;  4GGG A;  4DW6 A;  1X1A A;  4L9T A;  2CJJ A;  2JRT A;  4NB5 A;  1O7F A;  1IGN A;  3SFZ A;  3V8J A;  2ELK A;  4RM2 A;  4IHS A;  2FE3 A;  4OIQ F;  4PSW A;  3A03 A;  1PP7 U;  2ECC A;  3CF2 A;  2DYS H;  1YJN I;  2Q2E B;  2BVL A;  2W7N A;  1S6L A;  3KZY A;  4ZYD A;  1UHW A;  2HOA A;  3CME I;  1LFB A;  3K4M A;  1B1B A;  1IZ1 A;  2B9S A;  2Y0S N;  3QPT A;  2L01 A;  4KIB A;  4M6X A;  5DTD A;  2VQH A;  2WY8 Q;  3HHG A;  3FHN A;  2ELJ A;  2O03 A;  3RKQ A;  1FYK A;  4DJA A;  5CQG A;  2EIJ H;  4BEH A;  4L0Y B;  3RCO A;  2CGP A;  4S04 A;  3FXO A;  5DCF A;  2BZT A;  4GO1 A;  1EJ9 A;  2GQQ A;  2CMP A;  4IPA A;  4MGR A;  1YG2 A;  2M4K A;  4I76 A;  4IF4 A;  5CYV A;  1D1A A;  2L02 A;  1POG A;  3MN2 A;  3NAU A;  5EGO B;  5FKO A;  2E2J J;  4YIR X;  2DOD A;  3VSL A;  2DW4 A;  4GYI A;  2LSO A;  2RAE A;  4MFD A;  4G7H F;  3WG7 H;  2KIS A;  4BGD A;  2ZSI B;  3A02 A;  1ZN2 A;  3B6A A;  3TDU C;  1TNS A;  4KMU X;  3VDX A;  4YFK F;  1KU7 A;  1EV7 A;  3D5S C;  1JT0 A;  3JRC A;  1LFU P;  2K02 A;  1GV2 A;  4DQ2 A;  2A61 A;  3AFH A;  1T39 A;  4OIP F;  3GLL A;  1HC8 A;  1UAA A;  1R1U A;  2DMP A;  3K4N A;  2V26 A;  3DLA A;  3QU3 A;  4ZDL A;  2VOP A;  4YG2 F;  3FWE A;  4N0B A;  1BN5 A;  1S7O A;  1UMQ A;  1F43 A;  1PYV A;  2HVQ A;  3S2W A;  3F3X A;  2ZNY A;  3S93 A;  4PDK A;  5L3E A;  2O0Y A;  1MIJ A;  1BI2 A;  4AYB A;  1YHQ I;  4HW0 A;  5LGT A;  2VJ4 A;  2TRT A;  4F92 B;  2IGM A;  2BVM A;  2R7S A;  3SXY A;  3KP4 A;  2EFO A;  1W5S A;  2KRF A;  5J6X A;  3LSG A;  2FBI A;  4XKB A;  3CJN A;  1MKM A;  3CCQ I;  4ZC3 A;  1ETK A;  1VI0 A;  1A6I A;  3PNV A;  3CCR I;  2NVT J;  3GFJ A;  4AVZ A;  3R61 A;  2HNH A;  2NAZ A;  3JTH A;  3JRD A;  1N75 A;  2GOM A;  4L9N A;  5CVR A;  5D8L B;  3E6M A;  1YIJ I;  2IT0 A;  4LIU A;  5L3G A;  2L2O A;  2DA5 A;  2RGV A;  4PJ0 C;  5E8I A;  2DDB A;  4UUS B;  2M8G X;  1P4A A;  4BYY A;  3JSO A;  2CUZ A;  5EG0 A;  2CG4 A;  1OLT A;  2FSW A;  2KIF A;  3TDZ C;  5J1R A;  2WAF A;  2ZSH B;  3F6O A;  1N78 A;  2QLZ A;  4NUB A;  4HDU A;  1FT9 A;  2A6T A;  1XSV A;  4PSX A;  5CQE A;  5DCM B;  5FKM A;  3U1D A;  1K79 A;  3CLQ A;  1UST A;  4IL6 C;  4G7Z F;  5ICF A;  2TDX A;  3GZ5 A;  4LLG F;  3CUQ C;  5B3S H;  3BZC A;  1DU0 A;  4UY8 I;  5ICG A;  1A5J A;  3DPT A;  3L00 A;  3QWL A;  1ETO A;  3J80 K;  2Y9Z A;  3TO9 A;  5J47 A;  1A35 A;  4F55 A;  2F4O B;  3FK7 A;  3DKX A;  2PEX A;  2ZO4 A;  3B73 A;  3CUO A;  4OAZ A;  1JUM A;  2RQP A;  5E1X A;  5FLX K;  4HA8 A;  1IV6 A;  1LNW A;  1HXD A;  4KIC A;  3AAF A;  1LDD A;  3GTK J;  2GA2 A;  1J2X A;  2R7Q A;  4HLX A;  1ITY A;  4AM3 A;  2GBY A;  2BBY A;  3AKZ A;  5E17 F;  3C18 A;  9ANT A;  3F8F A;  3NAR A;  5GAD J;  5FRM A;  4E70 A;  1IRG A;  2IS2 A;  3OMY A;  1O3Q A;  3K1N A;  2I8D A;  2L7Z A;  3NWS A;  1E3H A;  5LHH A;  2BE5 F;  2WTE A;  3CES A;  4QPO A;  4RB2 C;  4OWR B;  4M3G A;  2QQA A;  1P9Q C;  4Y52 J;  4JP0 A;  4XKW A;  3RYP A;  1MDM B;  4XK4 A;  4AU7 A;  1XDU A;  3IRQ A;  2WAD A;  3L1P A;  3SZG A;  3Q0V A;  5EYR A;  5D5W B;  2R5Z A;  2QBY B;  1B8I A;  1G3W A;  2OTL I;  3FMQ A;  3WE3 A;  3GTG J;  2RKH A;  2VOO A;  3PM1 A;  4A0Y A;  4A5M A;  1OCR H;  4Y13 A;  2RNG A;  1OKR A;  3BR1 A;  2IW5 A;  2WA0 A;  3D0S A;  3BTC A;  5GAE J;  4UVB A;  4N9I A;  1PDN C;  2PX9 A;  1E2X A;  1FTZ A;  2XGD A;  1U78 A;  2Q0O A;  1YO5 C;  3EYY A;  4HOB A;  1MJB A;  2H6B A;  2ZCW A;  2KQR A;  2XKO A;  4JBA A;  4D5F A;  3TBI A;  3HOT A;  2FA5 A;  3LL7 A;  3DEW A;  4BHP A;  1JHF A;  1TT0 A;  2F5C A;  3KP2 A;  2WY7 Q;  2OV7 A;  4OIR F;  4CXF A;  4A3B J;  4Q5S F;  2DDA A;  5LEJ A;  5E1W A;  4MTD A;  1K83 J;  2ZFW A;  2R5Y A;  2PFB A;  2RV8 A;  2FNA A;  3SJM A;  3ECO A;  3K4L A;  3HYI A;  1T6S A;  2ICW G;  3QRF F;  2GXA A;  4F91 B;  1WPK A;  1MBG A;  1RES A;  2PLY A;  2Y0M A;  1ZGJ A;  2HVS A; 
#chains in the Genus database with same CATH homology
 2EWN A;  3GVA A;  1YQA A;  1Z9C A;  4MQV A;  1ODD A;  4AIH A;  2D45 A;  3IRR A;  5D4R A;  2YX7 A;  1OYW A;  5LLQ A;  4IXA A;  3V7S A;  3KCC A;  4IHT A;  1XSD A;  2HZT A;  1BI0 A;  4HLY A;  4Y15 A;  1UB9 A;  5D8K B;  3V7R A;  4ZYH A;  3I53 A;  4I09 A;  1RZ4 A;  3LAJ A;  2DFI A;  2VBW A;  5A2Q Z;  3TO7 A;  1XN7 A;  3WTS C;  2GA1 A;  5E1Z B;  1IN7 A;  3LST A;  4ETS A;  1ZRE A;  2OU2 A;  2ZME A;  3V8L A;  5HS7 A;  4I7H A;  3O6B B;  3K1P A;  3IWF A;  1KYW A;  4BHB A;  3F8M A;  3I0T A;  5FGM A;  2EB7 A;  2F5E A;  3K69 A;  3QAH A;  4HDV A;  5IT9 Z;  4FX0 A;  2OZU A;  5F64 A;  4FHT A;  4L9V A;  5D6F A;  4A2U A;  4PGG A;  1G3S A;  3RKX A;  3T8T A;  4ESJ A;  1FOK A;  2R3S A;  4CO8 A;  3OOP A;  1QZY A;  2OBP A;  2Q2E A;  2A3S A;  3L2C A;  3H3Z A;  4UUV A;  1EH8 A;  1XGO A;  2Z3Y A;  4MHG A;  2L54 A;  5DYM A;  2M30 A;  3E5Q A;  1O3R A;  1D8K A;  1R00 A;  4RGS A;  1HW2 A;  2OAZ A;  4GCV A;  2XRN A;  1O7L A;  1G4D A;  1U5T C;  1K6O A;  1U6G A;  4KMF A;  1HKQ A;  2ZNZ A;  4EQQ A;  1FSH A;  4M9X A;  2DO7 A;  2V9V A;  2OD5 A;  3Q5F A;  3SZP A;  4BQA A;  1BM9 A;  1UHM A;  2ZKZ A;  1HW1 A;  4U0V A;  1L3L A;  4OU0 A;  2V79 A;  2NYX A;  3QPH A;  4ASN A;  4LD5 A;  3PQK A;  1FX7 A;  1S8N A;  3BOQ A;  3GEZ A;  4BXU A;  1FP2 A;  3RYR A;  3CUQ A;  2KJC A;  2XVC A;  2UZK A;  2K7L A;  2O3F A;  2WV0 A;  1DDN A;  4YFN F;  1SAX A;  1YW8 A;  3TO6 A;  2FRH A;  3BZ6 A;  1WQ2 A;  3I4P A;  4WX9 A;  4EJV A;  3ZMT A;  4LMY A;  4F7Z A;  1XGS A;  5BQT A;  4EJW A;  3BJ6 A;  2A69 F;  4PCQ A;  5EEG A;  2DQL A;  4KDP A;  2HYF A;  3EET A;  4LB6 B;  2XKP A;  4B8X A;  5DCM A;  2G7H A;  1QO0 D;  3WU0 A;  1J75 A;  2EJR A;  3WGG A;  1TW2 A;  2EFW A;  2P5L C;  5A2Q K;  1WSU A;  1FYM A;  3JSP A;  3K9T A;  4P96 A;  2PBI A;  3MCZ A;  4O3M A;  1H0M A;  2MBF A;  3F8B A;  2HKX A;  2DLL A;  4KT5 C;  1AOY A;  3HTS B;  3RTR A;  2MH9 A;  3F21 A;  2FEZ A;  2CO5 A;  3WTT C;  2DK5 A;  2K4J A;  4ON0 A;  1BOA A;  1W4M A;  5IT9 K;  2F5F A;  2KIU A;  1BI1 A;  3M7G A;  1MDM A;  3HHH A;  5HLG A;  5HS9 A;  1BC7 C;  1MGT A;  4WXD A;  1DP7 P;  5H6Q A;  4WK8 F;  4WWC A;  2QBY A;  1FBS A;  1W5T A;  2RN7 A;  2P5V A;  2ETH A;  3E5X A;  4LLL A;  4CIC A;  3I71 A;  1ZG5 A;  5H6R A;  1FY7 A;  2XRO A;  4L9J A;  3LQQ A;  4DNC A;  4FX4 A;  2FMY A;  4XSX F;  1XGN A;  1XMA A;  4WF2 A;  5DUI A;  4HAM A;  5H20 A;  2YX4 A;  2E7W A;  5AIP A;  4P9U A;  2RNJ A;  4KYW A;  3C3W A;  3ZMS A;  2MLG A;  1IN5 A;  3E3V A;  4EMS A;  3E6B A;  2E1C A;  4LGW A;  4LLN A;  2VBX A;  3FMR A;  4XLP F;  3IL2 A;  3H3U A;  1I1S A;  5JR3 A;  4KUM A;  1YS6 A;  4LJZ F;  1FPQ A;  2DPU A;  1D8J A;  4IVN A;  4I02 A;  5HDK A;  2PMH A;  4EJT A;  1R23 A;  2HYG D;  2JT1 A;  1TNT A;  2W24 A;  1S29 A;  3FXQ A;  3MZY A;  2LF7 A;  1SD5 A;  3ZPL A;  4EGZ A;  3DQV C;  3KP6 A;  1ON2 A;  3F23 A;  1P92 A;  3C7J A;  3WTU C;  4ESB A;  3GUD A;  2KKO A;  3FMS A;  4KN7 X;  4XSZ F;  1RUO A;  1UCR A;  4AVP A;  3U2R A;  5J8F A;  5HOO A;  2E1N A;  3COA C;  5JFR A;  3G3Z A;  2GXB A;  1F1Z A;  1DUX C;  4UVC A;  1KQ0 A;  4I98 B;  1I1G A;  1I5Z A;  1REP C;  1LB2 A;  5HLH A;  2D1V A;  3I58 A;  3T1B A;  2XAJ A;  2DPD A;  1XCB A;  4QWQ A;  2MH2 A;  1B9N A;  5K1Y A;  2EFN A;  2WC2 A;  2ELH A;  5DDG A;  2LKP A;  5BMZ A;  1R5H A;  2A6E F;  4H0E A;  3CUQ B;  1W7P D;  3TOA A;  2D1H A;  1TBX A;  3J81 Z;  3BWG A;  4LFU A;  1F5T A;  2F5D A;  2KIM A;  4AWX B;  2PG4 A;  3BPV A;  4HX7 A;  3MAJ A;  1GXP A;  2XHK A;  2YU3 A;  4Q48 A;  4IJA A;  4XLN F;  5ILU A;  5BPD A;  3DFG A;  4R1H A;  1SMT A;  1FYL A;  3T5X A;  4B09 A;  1V4R A;  2A68 F;  2EV0 A;  1S7A A;  2HQN A;  1W7P A;  3R4K A;  2JZY A;  3C1D A;  4IRH A;  2STW A;  3ISP A;  1XD7 A;  5DD4 A;  2DT5 A;  2HDC A;  2XIG A;  5HDN A;  3K1M A;  1BC8 C;  2DTR A;  3ZMD A;  2IA1 A;  4ENN A;  1O57 A;  5HDG A;  4ZZD A;  2X0L A;  2DAO A;  5ILV A;  1KU3 A;  1OYY A;  5FO5 A;  3CDH A;  3DV8 A;  4L5J A;  2L4A A;  4ZH4 F;  4P5O A;  5CLS A;  3BPX A;  5F1R A;  1K78 B;  2BGC A;  5DV5 A;  2QQB A;  1P6R A;  4YFX F;  1TQP A;  1Z05 A;  2XAG A;  4BHC A;  3GLX A;  3KP3 A;  4EJO A;  2A6H F;  3VFZ A;  3EYI A;  4L0Z B;  4HF1 A;  2NNY A;  3VEP A;  3HRS A;  2GXG A;  2V6C A;  2O61 A;  1QNT A;  3QP5 A;  2ESH A;  5E8G A;  2CWE A;  3P7N A;  3KET A;  2FOK A;  3IC7 A;  2STT A;  4JQF A;  2QWW A;  5LRR A;  3NQO A;  3CO6 C;  3M8E A;  3IKT A;  3QOP A;  1KQ9 A;  3FHZ A;  3ERE D;  2AS5 F;  1MJA A;  2YPR A;  2M87 A;  1HSJ A;  2L3D A;  3DEU A;  1F4K A;  2K4B A;  3OV8 A;  3LWF A;  1SD4 A;  4S05 A;  1USS A;  2IVM A;  2HEO A;  5HS8 A;  3KP5 A;  2HS5 A;  1B4A A;  3H92 A;  4R79 A;  4RAY A;  3VOE A;  5K5Q A;  2UXX A;  2O8X A;  2IA0 A;  1U2W A;  2EFP A;  4ZYE A;  1G3T A;  3FX3 A;  4M72 A;  6PAX A;  4KFC A;  3J81 K;  5HVQ C;  4QLC U;  1IAW A;  1BBY A;  3GZ6 A;  1YIO A;  1QQI A;  1U8R A;  1GXQ A;  3DF8 A;  4A0Z A;  3WTX C;  3BRO A;  1ULY A;  1RUN A;  2EFQ A;  5LBQ A;  1XCV A;  2R7F A;  5LHG A;  3HSR A;  3PFI A;  1TQI A;  3FXR A;  1SD6 A;  1VTN C;  1U5T B;  4I0A A;  2ZBK A;  1T2K A;  2H94 A;  4CDG A;  1FC3 A;  1JXS A;  4EJU A;  2V1D A;  1OPC A;  2VT2 A;  4M73 A;  3O2P E;  1OYI A;  3LQR A;  1DPU A;  1YW7 A;  2QZ8 A;  3E6D A;  1WKM A;  3GFM A;  4UXN A;  1YW9 A;  4M6Y A;  1XB4 A;  4KN4 X;  2VT3 A;  3MEX A;  4AD9 A;  5AON A;  2EA4 A;  4YIF A;  3N4M A;  3HTU A;  3I59 B;  2P7V B;  1MZB A;  3ZMZ A;  2DQR A;  4NHJ A;  2FQ3 A;  1IN8 A;  1BJA A;  2QM3 A;  5ILS A;  4PGH A;  3BP8 A;  2GWR A;  1WRJ A;  3IKV A;  1B6A A;  3CO7 C;  2X4H A;  3RKW A;  1IXC A;  1FBQ A;  1FSE A;  1R36 A;  2P8T A;  4MQ9 F;  3F22 A;  3VB2 A;  3E6C C;  3ML6 A;  1F9N A;  4HQM A;  4ESF A;  1JGS A;  2GAU A;  2XAH A;  3TOB A;  5DD8 A;  1KU2 A;  2VE9 A;  3J7A O;  2UWM A;  1FBU A;  1W7P B;  5BPI A;  2VN2 A;  3P9I A;  5L3C A;  1PUE E;  3FM5 A;  1Z6T A;  2VON A;  3VOD A;  4L5I A;  1PP8 F;  3GFI A;  5L3D A;  2J5P A;  3RKY A;  4G7O F;  3KEQ A;  5LGN A;  4HF0 A;  2COM A;  2P6T A;  1SMY F;  2CSO A;  2Z9O A;  5LGU A;  3B02 A;  3LA2 A;  4BH9 A;  2EK5 A;  3FZV A;  3K0L A;  2RC4 A;  2W85 A;  1RI7 A;  2QYO A;  3HOS A;  2XAQ A;  4CZZ A;  2JPC A;  3L9F A;  1H9T A;  2BEO A;  2ZXJ A;  1R22 A;  4KIG A;  1FP1 D;  1LDJ A;  1STZ A;  5LEK A;  3JTG A;  3O3K A;  3M9A A;  4HQE A;  4A6D A;  4RAZ A;  2NNN A;  3JAM Z;  1BI3 A;  3ZMU A;  4LB5 A;  2XV4 S;  1K78 A;  4I0B A;  4I01 A;  1ZGA A;  3F72 A;  4Q47 A;  4EV0 A;  5EEH A;  2ISY A;  2P6S A;  2H27 A;  3E97 A;  4HX8 A;  2K27 A;  5CVU A;  4ZZL A;  1ZG1 A;  2HTJ A;  1J0R A;  2VC1 A;  3RJP A;  3DPL C;  2NS0 A;  2B0L A;  4M71 A;  4ENM A;  2C6Y A;  3JW4 A;  4P9F A;  4LK0 F;  3ZN0 A;  5TRD A;  1CF7 B;  4BAY A;  3ZMV A;  1H9G A;  3M8F A;  5J8C A;  5F6F A;  3T8R A;  5ERI A;  4UHT A;  4KA4 A;  2FBK A;  3GX4 X;  4RB1 A;  5FD6 A;  4HF2 A;  2MD5 A;  1YFH A;  1QBJ A;  1MD0 A;  2VXZ A;  3LA3 A;  2ESN A;  3SQN A;  2F2E A;  1ZG3 A;  5HLI A;  1GVJ A;  1RNL A;  4GYG A;  1R5G A;  1RIO H;  3HSF A;  2CFX A;  2QQ9 A;  1KQ8 A;  4ENJ A;  3RIR A;  4UV9 A;  1YTY A;  4MNU A;  1AWC A;  4Y17 A;  2IP2 A;  2IJL A;  1HST A;  2M45 A;  2HFH A;  3W6K B;  5FLX Z;  1HBX G;  2H6C A;  2LF8 A;  5IT3 A;  3HIF A;  3P9C A;  1MJ9 A;  3WTV C;  5JI6 A;  4ENK A;  3HSE A;  4G94 A;  2CQK A;  2HKO A;  4G6D A;  3TQN A;  2W84 A;  3FM3 A;  3CLO A;  1QZZ A;  4MEX F;  4MTE A;  3ZP5 A;  1ZLJ A;  4XBF A;  4RB0 A;  4U0Y A;  2Z33 A;  4Z2Y A;  2ZJ2 A;  4RS8 A;  1B9M A;  5L3F A;  1SD7 A;  2IRF G;  3LFK A;  5K5R A;  2EV6 A;  1L0O C;  4O6J A;  1C0W A;  3Q9S A;  1U5T A;  2ISZ A;  1LDK B;  2FBH A;  2QEN A;  3EQL F;  3HUG A;  2Q8K A;  2R7D A;  4OMZ A;  2YSR A;  3WE2 A;  1ZYR F;  5TJJ A;  3N97 A;  1A04 A;  4RB3 C;  3MQ0 A;  1IRF A;  1JE8 A;  2ADU A;  3DXJ F;  4L18 B;  4RGU A;  2HR3 A;  3T0Y A;  5ED4 A;  3I59 A;  3ULQ B;  4EGY A;  2P5K A;  3WU1 B;  3JAM K;  3NEU A;  2CW0 F;  1QGP A;  5FFX A;  2UXN A;  1KU9 A;  2OQR A;  5FB2 A;  4AIJ A;  4D0P A;  5D6E A;  3CTA A;  1ZH5 A;  3LAP A;  1ZAR A;  1R7J A;  3KZZ A;  1P4X A;  4WCG A;  3KE2 A;  4YII A;  4RGX A;  1IUY A;  2A5Y B;  1WWX A;  2Z99 A;  1K7A A;  2M8E A;  1J59 A;  3R60 A;  1BIB A;  1XSX A;  1SFU A;  4OIN F;  1G3Y A;  1R1T A;  5JHU A;  1ZHF A;  3GF2 A;  1I27 A;  3EDP A;  1TQM A;  4OOI A;  2L4M A;  2ACJ A;  4NQW A;  1SFX A;  2XAF A;  5D5X B;  4BNC A;  1FLI A;  4O5V A;  2HWV A;  1IF1 A;  2IA2 A;  2JSC A;  4LG0 A;  4U88 A;  3V7C A;  1HW5 A;  2PN6 A;  3W6J B;  2HTS A;  4PZJ A;  3FXU A;  3R0J A;  5CVV A;  1T38 A;  3F6V A;  1IXR C;  2CYY A;  2BV6 A;  2PJP A;  3GXO A;  5CVJ A;  4M74 A;  4EM0 B;  2FNP A;  4G6Q A;  1T0F A;  3HRM A;  1J5Y A;  2DI3 A;  5E20 A;  3M1E A;  2K86 A;  4U7D A;  1J7K A;  5L3B A;  5KVR A;  1D5V A;  3KLO A;  1HQC A;  1ZLK A;  3MFK A;  2AXL A;  3DP7 A;  3SHF A;  3ABU A;  1Z1D A;  5CJ9 A;  2FML A;  1Q1H A;  3V8K A;  1D3Y A;  3KEO A;  3D5L A;  1ZRC A;  3ZQ7 A;  2P7C B;  4HV6 A;  1FZP B;  1ZRF A;  1R58 A;  1O3S A;  2JTV A;  1J9I A;  1CF7 A;  2MLK A;  1JHH A;  4IRI A;  4EM2 A;  3U9G A;  5BOX A;  3QU6 A;  1ON1 A;  3MWM A;  1XDS A;  2HQR A;  5CVI A;  2WWY A;  5BS6 A;  1YLF A;  2HGC A;  1CGP A;  2DU9 A;  5KK1 A;  1B59 A;  3GFL A;  3V4G A;  2G9W A;  3TKY A;  1IW7 F;  2QVO A;  3GYH X;  1LVA A;  1S3J A;  1DPR A;  1EH7 A;  2P4W A;  3BJA A;  3GW2 A;  3KLN A;  1YYV A;  1XGM A;  2G7U A;  3ROU A;  4R8H A;  4M9S A;  2OZ6 A;  1P2F A;  4JK1 X;  2JPB A;  2VBZ A;  4HV5 A;  2PMU A;  2OA4 A;  3BDD A;  3ABT A;  4LK1 F;  2VE8 A;  1LQ1 A;  3G73 A;  4CYD A;  3RPQ A;  2Z5U A;  3I64 A;  1LEA A;  2M1B A;  4P55 A;  2J5O A;  2VBY A;  5LRS A;  4G8X A;  5DUK A;  1OR7 A;  3WOD F;  5LHI A;  2DK8 A;  3GO5 A;  1SFE A;  3ECH A;  1KA8 A;  1GHC A;  2DBB A;  5AIQ A;  2V1U A;  3R0A A;  4A0X A;  2XGX A;  3PQJ A;  3RDI A;  4IRG A;  1V3F A;  1ZRD A;  3QP6 A;  1QPM A;  4XRF A;  4A6E A;  5E18 F;  3IHU A;  2PQ8 A;  1Y0U A;  4RGR A;  4GXO A;  1HKT A;  4HYE A;  5FFZ A;  4HZF A;  2V1X A;  1E17 A;  3BY6 A;  1Z7U A;  1HKS A;  4CHU A;  3WTZ A;  2PI0 A;  5FD5 A;  1Z6R A;  1T98 A;  4TV7 A;  1FNN A;  3KP7 A;  3REO A;  2O6G E;  4KIF A;  1TLH B;  2LNB A;  1FWZ A;  5D5V B;  4LG0 B;  3E5U A;  4EM1 A;  2QUF A;  5DEQ A;  4OMY A;  2W25 A;  1IN4 A;  4G9Y A;  1KGS A;  2XUB A;  1TTY A;  4WXH A;  3Q9V A;  2LDU A;  2OQG A;  3K2Z A;  1G6N A;  3R6S A;  4OIO F;  2FU4 A;  3FF5 A;  3WG9 A;  1YS7 A;  2M5W A;  1ONV A;  3WTW C;  3MZH A;  3LA7 A;  3P9K A;  2MA3 A;  2Y48 A;  4CGZ A;  3SZT A;  1I6X A;  2GIV A;  1P4W A;  2E7X A;  4HBL A;  1NHA A;  4U7B A;  4Q4Z F;  3DKW A;  1UFM A;  3IWZ A;  1U3E M;  3I5U A;  3WTY C;  1O3T A;  2W57 A;  5D5U B;  2BYV E;  4ZYG A;  2RDP A;  3F8N A;  4MEY F;  1EH6 A;  3WGH A;  1TW3 A;  4U0W A;  1BIA A;  2EV5 A;  4HX4 A;  5ICC A;  3ZN1 A;  2D2W A;  1IN6 A;  1LEB A;  2FXA A;  4K2E A;  2MC3 A;  1KYZ A;  3L7W A;  2RVC A;  3F8C A;  5K5O A;  3HRU A;  2VOD A;  3BJO A;  4A12 A;  2NRA C;  2XAS A;  2EA2 A;  4A5N A;  5ICE A;  3I54 A;  2GZW A;  4EVI A;  4KNY A;  1X3U A;  4N9H A;  5D4S A;  4WXC A;  1XMK A;  4UNO A;  3J80 Z;  3RI4 A;  5JVT A;  2VC0 A;  1LJ9 A;  2A07 F;  3WGI A;  4UV8 A;  2ZME B;  4I2O A;  2YR2 A;  2H09 A;  3NRV A;  3RPU A;  1WI9 A;  3EUH A;  2FF4 A;  3ELK A;  4UVA A;  4AIK A;  1ZAO A;  3HRT A;  3KFW X;  2Y75 A;  3L09 A;  4M9Z A;  3GWZ A;  1OMI A;  3TGN A;  2KJB A;  1IXS B;  2IPQ X;  1Z91 A;  4FT8 A;  1R1V A;  2HOE A;  4GGG A;  4L9T A;  2JRT A;  4NB5 A;  1O7F A;  3SFZ A;  3V8J A;  4IHS A;  2FE3 A;  4OIQ F;  1PP7 U;  1S6L A;  3KZY A;  4ZYD A;  1UHW A;  1B1B A;  1IZ1 A;  3QPT A;  2L01 A;  4KIB A;  4M6X A;  3HHG A;  2O03 A;  1FYK A;  4L0Y B;  2CGP A;  4S04 A;  5DCF A;  4GO1 A;  2GQQ A;  4IPA A;  4MGR A;  1YG2 A;  4IF4 A;  5CYV A;  2L02 A;  2DW4 A;  4GYI A;  2LSO A;  4G7H F;  1ZN2 A;  3TDU C;  4YFK F;  1TNS A;  4KMU X;  1KU7 A;  1EV7 A;  2K02 A;  4DQ2 A;  2A61 A;  1T39 A;  4OIP F;  1R1U A;  3QU3 A;  2VOP A;  4YG2 F;  3FWE A;  4N0B A;  1BN5 A;  1S7O A;  3S2W A;  3F3X A;  2ZNY A;  4PDK A;  5L3E A;  2O0Y A;  1BI2 A;  4HW0 A;  5LGT A;  3SXY A;  3KP4 A;  2EFO A;  1W5S A;  2KRF A;  5J6X A;  2FBI A;  3CJN A;  1MKM A;  3GFJ A;  3R61 A;  2NAZ A;  3JTH A;  4L9N A;  5CVR A;  5D8L B;  3E6M A;  2IT0 A;  5L3G A;  2RGV A;  5E8I A;  1P4A A;  4BYY A;  3JSO A;  2CG4 A;  2FSW A;  2KIF A;  3TDZ C;  3F6O A;  2QLZ A;  4HDU A;  1FT9 A;  1XSV A;  5DCM B;  3U1D A;  1K79 A;  1UST A;  4G7Z F;  5ICF A;  2TDX A;  3GZ5 A;  4LLG F;  3CUQ C;  5ICG A;  3DPT A;  3L00 A;  3J80 K;  3TO9 A;  2PEX A;  2ZO4 A;  3B73 A;  3CUO A;  2RQP A;  5E1X A;  5FLX K;  4HA8 A;  1LNW A;  1HXD A;  4KIC A;  3AAF A;  1LDD A;  2GA2 A;  1J2X A;  4HLX A;  5E17 F;  2BBY A;  3C18 A;  3F8F A;  4E70 A;  1IRG A;  1O3Q A;  3K1N A;  5LHH A;  2BE5 F;  2WTE A;  4RB2 C;  2QQA A;  3RYP A;  1MDM B;  1XDU A;  3IRQ A;  5D5W B;  2QBY B;  1G3W A;  3FMQ A;  3WE3 A;  2RKH A;  2VOO A;  4A0Y A;  4A5M A;  4Y13 A;  1OKR A;  2IW5 A;  3D0S A;  4UVB A;  4N9I A;  1PDN C;  1E2X A;  1U78 A;  2Q0O A;  1YO5 C;  3EYY A;  4HOB A;  1MJB A;  2H6B A;  2ZCW A;  2XKO A;  4JBA A;  3HOT A;  2FA5 A;  4BHP A;  1JHF A;  2F5C A;  3KP2 A;  4OIR F;  4CXF A;  4Q5S F;  5LEJ A;  5E1W A;  4MTD A;  2ZFW A;  2PFB A;  2RV8 A;  2FNA A;  3ECO A;  3HYI A;  1T6S A;  3QRF F;  2PLY A;  2Y0M A;  1ZGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...