2D1HA

Crystal structure of st1889 protein from thermoacidophilic archaeon sulfolobus tokodaii
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
102
Chain Sequence
MMKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTPKYYYSISSNILEKIRNDLLNCAKRMELAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 109aa long hypothetical transcriptional regulator
publication title The putative DNA-binding protein Sto12a from the thermoacidophilic archaeon Sulfolobus tokodaii contains intrachain and interchain disulfide bonds.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 32
structure length 102
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01978 TrmB Sugar-specific transcriptional regulator TrmB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2d1hA00
3DPLC 1YLFA 4MEYF 2OU2A 1BN5A 5AONA 2DPUA 1Y0UA 4XLPF 4P9FA 1JXSA 3KEOA 1I27A 2VBYA 2EK5A 1KQ9A 2NNNA 3M9AA 2ZXJA 3CDHA 3I0TA 2STTA 1ZH5A 1BC8C 2QUFA 3ML6A 3E6BA 3TDUC 2A69F 4A0ZA 6PAXA 1U5TC 1LDJA 3KZYA 1QZYA 1B4AA 4A2UA 1TW2A 1MKMA 3TOAA 1ZRCA 4TV7A 5H6QA 3GF2A 4O5VA 1FBSA 1XDUA 2O8XA 3L00A 1D3YA 2BEOA 2O0YA 2HR3A 4U0VA 3SZPA 4HAMA 2FRHA 5E1ZB 3I59A 2IA2A 4IHTA 2RGVA 3CUQB 1FC3A 2ADUA 1QGPA 3ELKA 2Z9OA 4L0YB 4AIHA 1S3JA 4MGRA 4BHCA 3GFMA 1ZG1A 2YX4A 4ETSA 5L3BA 1A04A 3DEUA 4KN4X 2QZ8A 5KK1A 3U2RA 4LG0B 3GFIA 1ZARA 1U2WA 2HZTA 2DI3A 3MCZA 2P5LC 3H92A 2CW0F 3MAJA 2EV6A 3KZZA 4EM1A 4ESJA 4GYIA 4LK0F 3RIRA 3GUDA 2DQRA 1O3RA 1Z9CA 1ZRFA 1K7AA 1H9GA 2ISZA 1BIAA 1K78B 4S05A 2HGCA 2A68F 1XGNA 3KP4A 5DCMB 1J0RA 4LB6B 3JAMK 4HYEA 2ZFWA 3LWFA 3R4KA 1R00A 1E2XA 4I0AA 2DK8A 2FNAA 2WTEA 3F8FA 4I0BA 2J5PA 2L01A 5HOOA 3JSOA 1FYKA 5IT9K 4G8XA 1ZREA 2MLKA 1FP2A 5JVTA 3T8RA 1MD0A 1HKTA 5DUIA 5CVIA 1RNLA 2X4HA 2PG4A 2GXGA 4AIKA 5EEHA 4LD5A 1BI0A 2RDPA 4M6XA 5FFZA 4XSZF 2AS5F 1TNTA 3C18A 3E5UA 1IW7F 5JFRA 1FNNA 2EFNA 2DW4A 3HRTA 2FF4A 3ZP5A 1BM9A 2FA5A 4EVIA 4L5JA 2PLYA 4HF1A 3TGNA 2LSOA 1J9IA 2KKOA 3D0SA 3K1MA 4MEXF 3KP6A 3QU6A 3I64A 1ULYA 3F8NA 1SMYF 3W6KB 1IN7A 1KQ8A 3HRMA 1V4RA 2IJLA 2P5VA 2PEXA 2F5CA 4BAYA 2H27A 3N4MA 2EV5A 5D5WB 4KFCA 1QPMA 4U7DA 2K86A 3FM5A 5LHIA 2KRFA 1G3WA 1UHMA 5K1YA 1FYMA 4LB5A 1XSDA 3LFKA 3ULQB 3R0AA 3WU1B 1DPUA 3OOPA 4G6QA 4I01A 1PP8F 2A6HF 1BOAA 3HSRA 5CVJA 3ABUA 1I1GA 5H20A 5E20A 5ICEA 4UVBA 5LLQA 3H3ZA 4UNOA 1T2KA 3TO9A 1ZN2A 2Q0OA 2PBIA 3BOQA 1D8JA 1MZBA 3ZN0A 1ON2A 3AAFA 1O3SA 1B59A 2FSWA 4RB3C 4CZZA 2HDCA 2F2EA 4IRGA 4BYYA 1SMTA 3LA2A 1FT9A 1I1SA 5ED4A 5TRDA 1WKMA 2XIGA 4A5MA 1B1BA 4PGGA 3VB2A 3QPTA 5DV5A 2M1BA 2DLLA 4WF2A 5LRSA 4M74A 2QVOA 1ONVA 5H6RA 3IC7A 2H94A 1J7KA 1USTA 5ERIA 2EFOA 4L9JA 1P4XA 2RVCA 1MJBA 1WQ2A 1XD7A 3EYIA 2IW5A 4YG2F 4IJAA 4LLNA 4NHJA 1IN8A 4RGUA 2VXZA 1O3TA 2VE9A 1IAWA 3KEQA 2FMLA 4MTDA 2FEZA 2VONA 3P9IA 1MDMB 1Z6TA 4BH9A 4I7HA 5DUKA 4EJWA 3COAC 3F8BA 5BOXA 4B8XA 3FHZA 3RKYA 4HX4A 3SXYA 4JBAA 3JTHA 2EFPA 5F1RA 3RI4A 3SQNA 2FBIA 3JSPA 1ZHFA 4ZH4F 1FBQA 3WTZA 2PI0A 1ZGJA 2BE5F 2Q8KA 5LEJA 5HDGA 2FOKA 4ON0A 1ZRDA 4GO1A 4BHPA 4HX7A 2BGCA 1P6RA 1FZPB 1U8RA 3GW2A 3I5UA 3KCCA 4Y15A 5JR3A 5HDKA 1B9MA 2YSRA 1I5ZA 4LGWA 1IN6A 3DF8A 5CVVA 1F4KA 4ENKA 3BWGA 4N9IA 4U7BA 4CO8A 3DV8A 3RYPA 5FD5A 1XCBA 4HLXA 3EETA 4MHGA 2ESHA 4M9SA 1OYWA 1RUOA 3SFZA 4CXFA 3ZN1A 4WX9A 4EV0A 3ZMUA 2VC0A 4DNCA 1YFHA 1HW2A 2QM3A 1CF7B 1PDNC 5E1WA 3ERED 3TQNA 3F8CA 3U1DA 3RDIA 4HZFA 1KU3A 5L3EA 3GXOA 4HF0A 3PFIA 5BPIA 2LKPA 1YG2A 1SD6A 1U3EM 3J81K 4ZYDA 1HBXG 1Z91A 3I53A 1KU7A 3BJOA 3E6CC 5KVRA 1YW8A 5DCFA 1LJ9A 3FXQA 2YX7A 4UVAA 1XSXA 4S04A 2H6CA 2ZNYA 3B02A 1KYZA 3HTUA 4BXUA 3CTAA 5TJJA 4GYGA 4GXOA 1DDNA 3F22A 1GXQA 2XAGA 3WE3A 2HYFA 2PJPA 1FSHA 5LBQA 3LAJA 2VT2A 2GIVA 4N0BA 4YFNF 2OBPA 4L5IA 5AIPA 3CJNA 1HKQA 2VC1A 2OZUA 1B9NA 3WGIA 4RGXA 3IRRA 1W7PA 1IRGA 4KDPA 2O6GE 2KIFA 2KJBA 3J81Z 2HQNA 2XV4S 1L3LA 5D5XB 4PCQA 1TW3A 3QAHA 4ZZLA 4OU0A 3WE2A 1ZLJA 3WODF 2J5OA 1ZGAA 1QO0D 5HVQC 2GA1A 2P8TA 3L2CA 1KU2A 3FZVA 1EV7A 4GGGA 4A6EA 4Y17A 2Q2EA 3L9FA 4O3MA 2RN7A 3BJ6A 1FP1D 1LNWA 2CO5A 3I71A 4ZZDA 3M8FA 3K9TA 1I6XA 4RS8A 2Y75A 2NRAC 2MH2A 1TQMA 4LK1F 1STZA 4B09A 4EM2A 4CYDA 4OIPF 2XKOA 3HOSA 2CGPA 1LDDA 4MTEA 4FX0A 2CQKA 2Y0MA 3RYRA 3DKWA 4RAZA 1IZ1A 3ZQ7A 4UXNA 4XRFA 3TOBA 2ZNZA 1Z6RA 1HXDA 2WV0A 3WGHA 2HKXA 1NHAA 3ISPA 2QWWA 1IXCA 4Q4ZF 4U0WA 3GEZA 1O3QA 3GFLA 1SD4A 3O3KA 1QZZA 3IHUA 3CUOA 1XMAA 2E1CA 5ILUA 3M1EA 1KGSA 2RC4A 3G73A 2TDXA 2IP2A 4EJVA 2M45A 5D8KB 3E6MA 1YS6A 2A61A 2V9VA 2EA2A 1OYYA 3F72A 2OA4A 5J8FA 1O57A 4H0EA 2HKOA 3WGGA 4KICA 2CG4A 2DT5A 5FGMA 1UB9A 5LGUA 3T5XA 4RB2C 2LNBA 3GYHX 1K78A 2BV6A 3P7NA 3VOEA 4FHTA 5D4RA 3WG9A 4BQAA 3GLXA 1FOKA 3IL2A 5A2QK 2V1XA 1RZ4A 4K2EA 1S7OA 4KIBA 2V1UA 4G7HF 2FBHA 4KT5C 1XGSA 2R7FA 1BI2A 4EJOA 4YFKF 3LA3A 2W84A 3LQRA 2V1DA 1R58A 2FNPA 4P96A 3REOA 4BHBA 1TLHB 2XVCA 5L3CA 5CVUA 2KIUA 3HSFA 2FBKA 1E17A 3QPHA 2P7CB 4NQWA 2GXBA 2W85A 4CGZA 4ENNA 1EH7A 3V8KA 1DPRA 1Z1DA 4KA4A 2UXXA 3HHGA 1GVJA 3ROUA 4WWCA 1YO5C 5LHHA 1G6NA 4CHUA 3JAMZ 4N9HA 5A2QZ 5FD6A 2DPDA 4BNCA 2IRFG 1P92A 3L09A 5IT9Z 3MEXA 5F6FA 2DTRA 1O7LA 4G94A 2STWA 3JTGA 2HQRA 2D1VA 1PP7U 2IA1A 2DU9A 3W6JB 4HQEA 5DD4A 2GWRA 3EQLF 4IRHA 1S8NA 2FE3A 2ZJ2A 2F5DA 2XROA 1C0WA 1Q1HA 3KP7A 1IXRC 3JW4A 1EH8A 1AOYA 3GWZA 1TQIA 2A6EF 1T6SA 2MH9A 3QU3A 3LAPA 1R1TA 1WWXA 1F1ZA 3LQQA 3IWFA 3BROA 5ICCA 3HRSA 2B0LA 2VOOA 2ZCWA 2VBZA 3NRVA 5L3DA 2QBYA 3M8EA 3WTXC 4M6YA 4EGYA 3J7AO 4M72A 2ELHA 2EJRA 1LEBA 2E1NA 2JSCA 1T98A 2Z5UA 4HA8A 2IPQX 5E17F 5ILSA 3D5LA 5D4SA 5HLIA 2HOEA 2XGXA 3EDPA 2G7HA 2L02A 4ZYHA 4U88A 2GQQA 4XLNF 2WC2A 2IVMA 2R3SA 3V8LA 3WTWC 4WCGA 2QYOA 4MQVA 5LGTA 3ZMVA 2K7LA 2HWVA 4U0YA 5LEKA 3V7RA 4A5NA 1WI9A 1JGSA 2NYXA 5LRRA 2DO7A 2RKHA 1R22A 5FB2A 3RPUA 1U6GA 2XKPA 3KP2A 1ZG3A 4OOIA 1MDMA 5K5QA 3BJAA 4IPAA 1XGMA 1HSJA 1KA8A 5HDNA 1W5SA 1R23A 1J59A 4UV8A 3V4GA 5DYMA 3WTVC 2KIMA 4KYWA 2DAOA 2XUBA 2VBXA 5ILVA 4RGRA 1RI7A 5CVRA 2G7UA 4I98B 3IWZA 3F6VA 2FXAA 3DP7A 1OKRA 1U78A 5L3FA 2PQ8A 2QQAA 1G4DA 2W24A 4P55A 3ECOA 4WXCA 4HQMA 2OAZA 3GVAA 3BDDA 3R6SA 4P5OA 1FWZA 2A3SA 3J80K 3C1DA 4QLCU 1Z05A 3HOTA 4CICA 4OMYA 2QENA 4LJZF 2COMA 2GZWA 2Z99A 4RB0A 5ICGA 1Z7UA 3MWMA 4M73A 4FT8A 2A5YB 2OZ6A 2M8EA 1RIOH 1JHHA 4R8HA 2VN2A 1BI3A 1TNSA 4HW0A 1UHWA 4HV6A 4XBFA 2L3DA 3GX4X 2CSOA 2L54A 5FFXA 4Q5SF 1XSVA 2JPBA 2IT0A 5D5UB 4L9VA 4HF2A 4O6JA 4KN7X 5BS6A 4ASNA 3ABTA 3QP6A 2ZMEA 5FO5A 1CF7A 4OINF 1FX7A 3MQ0A 3IKTA 3MFKA 1P2FA 4L0ZB 2FMYA 4GCVA 4EMSA 1UFMA 3C7JA 4AD9A 1YW7A 2K02A 4A6DA 3LA7A 2JRTA 3HYIA 2HEOA 3TO6A 2EA4A 1SAXA 4R1HA 3J80Z 2OQGA 4L9NA 2Y48A 3RJPA 2FQ3A 2XHKA 1OYIA 5E8GA 3T1BA 2XRNA 1IN5A 3R60A 3FX3A 4AVPA 2HTJA 1U5TB 1BIBA 4I2OA 3QOPA 2EWNA 2LF7A 2P6TA 3FF5A 1IRFA 4IVNA 5HS8A 3WTTC 2K27A 2MD5A 3HSEA 1W7PD 3VODA 3BPVA 2P6SA 2EFWA 1R36A 1J5YA 4YFXF 2G9WA 5K5OA 2VOPA 5BPDA 1D5VA 1G3TA 5K5RA 1QNTA 4WK8F 4OIOF 4IF4A 2HYGD 1YQAA 2D45A 1REPC 4M9XA 2JTVA 2M5WA 1R5HA 4F7ZA 1SD5A 3ZMZA 4G9YA 5E1XA 4QWQA 1YW9A 3ZMTA 3R61A 3E5XA 1IN4A 1ZAOA 1BI1A 1MJ9A 3HHHA 2K4BA 2YU3A 3FMQA 1XMKA 1FYLA 3WTSC 3V7SA 4LFUA 1G3YA 5E8IA 1VTNC 2FU4A 2OD5A 2CFXA 2ZO4A 2P5KA 4M9ZA 3GZ5A 2VE8A 2ACJA 1MGTA 3NEUA 3PQJA 3RPQA 4LLLA 2YR2A 3DQVC 2MA3A 3PQKA 1WSUA 3ZPLA 2M30A 5LGNA 4YIIA 1T38A 1OR7A 4PDKA 3IRQA 3KP5A 5IT3A 4DQ2A 1XN7A 3CUQA 5JHUA 1TQPA 5HS9A 1JE8A 1F9NA 1HKSA 1BJAA 3KLNA 3F3XA 1H9TA 2AXLA 3K0LA 3I59B 2XAFA 3I58A 1WRJA 4LG0A 4WXDA 3K1NA 4IHSA 1XGOA 2EFQA 2RV8A 4AIJA 2H6BA 4EJTA 4EJUA 4UV9A 3DXJF 4ZYEA 4G7ZF 4G7OF 4I02A 3OV8A 3IKVA 1SFXA 2K4JA 3FMRA 3F21A 3E6DA 3EYYA 2BYVE 5EEGA 2UXNA 4HOBA 3RTRA 4EQQA 2D2WA 2QQ9A 4CDGA 3WTUC 3E3VA 2HFHA 5DCMA 4YIFA 1ZYRF 2CWEA 2WWYA 2VODA 1GXPA 4ENMA 2O3FA 1R7JA 3VEPA 3K1PA 4EM0B 2JPCA 2R7DA 2XASA 1CGPA 2JT1A 3BP8A 5D6EA 1LQ1A 4P9UA 2LF8A 2A07F 4MNUA 4FX4A 2PN6A 1FPQA 1ODDA 5L3GA 1XB4A 1KU9A 2PMHA 3CUQC 3K2ZA 3V8JA 3GZ6A 4G6DA 4WXHA 2V79A 1W5TA 5DD8A 2PMUA 4HDVA 2RQPA 2DFIA 3E97A 4A0YA 1T39A 3L7WA 5CJ9A 4KMUX 3FXRA 3ZMDA 5HLGA 5E18F 1L0OC 5D8LB 1LB2A 3KLOA 1IUYA 2HTSA 3R0JA 1PUEE 2E7XA 2YPRA 3TKYA 5DDGA 1IXSB 2W25A 3GFJA 1ZG5A 2H09A 1KYWA 4JK1X 3KETA 3O2PE 2VT3A 1J75A 1RUNA 2UZKA 4E70A 2VBWA 1USSA 2CYYA 2ETHA 2DK5A 3KFWX 1H0MA 1JHFA 3WU0A 4ENJA 3LSTA 4OIRF 4LMYA 3H3UA 3QP5A 1DP7P 3QRFF 1HW1A 1P4AA 3DFGA 4ESFA 1K6OA 1ON1A 2QLZA 3KP3A 4D0PA 3KE2A 2L4AA 4XSXF 2ZBKA 2KJCA 1OMIA 3MZYA 1FSEA 3T0YA 3NQOA 3TDZC 2IA0A 4Z2YA 3T8TA 1HSTA 3B73A 4OIQF 2RNJA 4KIFA 1FBUA 5CYVA 3Q5FA 1GHCA 2L4MA 4HX8A 2QBYB 5J8CA 2EV0A 3P9CA 4ESBA 3FM3A 4HDUA 2EB7A 1UCRA 3C3WA 3F6OA 3HUGA 1YYVA 4RAYA 3G3ZA 4ZYGA 2C6YA 1KQ0A 5J6XA 1AWCA 4A0XA 1LEAA 5JI6A 1QQIA 3CO6C 4LLGF 3K69A 1HW5A 3ECHA 3EUHA 1O7FA 1P4WA 2UWMA 1TBXA 2F5EA 2Z33A 2GA2A 2OQRA 2MC3A 4AWXB 4Q47A 1D8KA 4M71A 3F23A 1K79A 1QBJA 2Z3YA 4RGSA 3HIFA 3MZHA 1V3FA 4IXAA 3RKWA 4I09A 3VFZA 3BY6A 4UHTA 4OMZA 5F64A 2NAZA 2F5FA 3P9KA 3U9GA 2ESNA 4HBLA 1YIOA 1TTYA 4IRIA 3BPXA 4MQ9F 3S2WA 2DQLA 2DBBA 5D5VB 4L9TA 5LHGA 1YTYA 3V7CA 1S7AA 4UVCA 3RKXA 1R5GA 1S29A 1B6AA 3TO7A 2GAUA 4A12A 2ISYA 5BQTA 4Q48A 3HTSB 2V6CA 2XAJA 4KUMA 4UUVA 4JQFA 1T0FA 4Y13A 1BBYA 1W4MA 4KNYA 1FLIA 2M87A 2X0LA 4HV5A 2HS5A 1SFUA 4RB1A 5HLHA 1R1VA 2P4WA 1FY7A 3ZMSA 2QQBA 1X3UA 3WTYC 1XCVA 3I54A 5AIQA 4PZJA 2JZYA 5DEQA 4L18B 2O61A 2ZMEB 1F5TA 3O6BB 5FLXK 5CLSA 1IF1A 3I4PA 2D1HA 5BMZA 3Q9SA 3GO5A 2O03A 3SZTA 2XAHA 3HRUA 2P7VB 4KMFA 1ZLKA 4EGZA 3Q9VA 1DUXC 1U5TA 3FXUA 2NS0A 1LVAA 2BBYA 4NB5A 4HLYA 1OPCA 1LDKB 5HS7A 2ZKZA 2PFBA 1MJAA 3SHFA 2E7WA 2NNYA 1YS7A 1EH6A 3BZ6A 1SD7A 2MBFA 3F8MA 5ICFA 3CO7C 1G3SA 3DPTA 1HQCA 4PGHA 2W57A 3E5QA 1J2XA 1S6LA 4KIGA 5FLXZ 3FWEA 1SFEA 4R79A 2LDUA 1BC7C 3FMSA 3CLOA 1XDSA 2MLGA 1W7PB 2XAQA 3M7GA 3N97A 5D6FA 1R1UA
chains in the Genus database with same CATH superfamily
2KRCA 3DPLC 1YLFA 4MEYF 3HGGA 5EZGA 2OU2A 1BN5A 2X1EA 5AONA 2DPUA 1RKTA 1X3ZB 2HOSA 1Y0UA 2VQCA 4PJ0C 4XLPF 2X6XA 5IYCJ 2R5YB 2O5RA 4P9FA 3E0JB 4A3JJ 1JXSA 1B72B 3KEOA 1I27A 2VBYA 2EK5A 4BXXJ 2E2JJ 1KQ9A 1FMVA 2NNNA 2ZXJA 3CDHA 3M9AA 3OIPA 3I0TA 3VSLA 2STTA 3S1RJ 1ZH5A 2ZB9A 1BC8C 1Z67A 3E7LA 5KHDA 1XMXA 2Q2EB 5TGTA 2QUFA 3ML6A 1MMNA 3E6BA 5CQEA 1ZELA 4IHXA 3TDUC 3PUFA 3K6GA 2LFBA 1ACIA 4M3GA 4XONA 2A69F 2X48A 4A0ZA 2ZXIA 3SFIA 6PAXA 1U5TC 3FXMA 4CCMA 1LDJA 1IG7A 4XN0A 5M5WJ 1OCPA 3KZYA 1AU7A 1QZYA 1FOWA 2JUCA 4IQJA 1B4AA 1ERDA 4A2UA 2CQNA 1HOMA 1TW2A 1MKMA 3UKGA 3TOAA 4C3JJ 2E1OA 2WAEA 1ZRCA 2DYRH 4TV7A 3H0DA 5H6QA 3GF2A 2VQGA 4O5VA 1EKEA 1FBSA 4CCNA 1Y39A 3AG2H 1XDUA 4II2A 1F43A 5EJCA 2Y30A 2O8XA 1X4OA 3L00A 3RZOJ 1D3YA 2BEOA 2O0YA 3OIQA 2HR3A 2PMZN 2Z1DA 2WB1N 1B8IB 3OYLA 4U0VA 5K7ZA 3G1LA 3LOCA 3SZPA 4HAMA 4CYCB 5F08A 4X0GA 3ASOH 3A03A 1SFKA 2FRHA 4RAFA 1WZ2A 1MH4A 5E1ZB 3I59A 2IA2A 4IHTA 2RGVA 1R6RA 3CUQB 2ME6A 3TL4X 1FC3A 2O9LA 2ADUA 4V2FA 1QGPA 1MNMC 1LFBA 3ELKA 2MC4A 1ZK8A 2Z9OA 1VQ8I 4AIHA 1S3JA 4L0YB 4MGRA 4BHCA 3GFMA 1ZG1A 3S3MA 2M4GA 4ZTFA 1HLVA 2YX4A 4ETSA 1IGNA 5L3BA 1JKRC 1TC3C 1A04A 1JT0A 3DEUA 4KN4X 4W97A 1MSFC 3JRCA 1EJ9A 2QZ8A 4HEA2 5F27A 5KK1A 2IS2A 3U2RA 2GOMA 2R7TA 3PO2J 2NOJB 4LG0B 3GFIA 3VYSB 3CCYA 2VXDA 2R7QA 2F6CA 2K85A 1ZARA 1U2WA 2HZTA 2R7UA 3UNGC 2KQRA 2DI3A 3M4OJ 2X9DA 3MCZA 4RLFA 2P5LC 3H92A 2CW0F 3MAJA 1IV6A 1MBEA 1UJ8A 3C2GA 4PFPA 2EV6A 3KZZA 5FKNA 4EM1A 4ESJA 4GYIA 3BTLA 3JR9A 5EG0A 3HJEA 4LK0F 3AL0B 3RIRA 3S17J 3BR3A 3GUDA 2DQRA 4XKCA 1O3RA 1Z9CA 2M4KA 1ZRFA 2VUMJ 1APLC 3B6AA 2I5UA 1K7AA 1GUUA 1OFCX 1UAAA 1WJEA 3MMYB 4AM3A 1H9GA 2ISZA 3QWLA 5B5EC 1BIAA 1LPQA 1K78B 4S05A 2HGCA 2L7KA 2A68F 1XGNA 2DOFA 1T33A 3KYLA 3TP3A 2MG4A 3KP4A 5DCMB 1LUJB 3HGYA 1J0RA 3CP8A 4MLOA 2IS4A 4PJLA 3I4NJ 4LB6B 1A36A 3JAMK 2OUMA 4HYEA 4RDUA 2ZFWA 3PO3J 3LWFA 3R4KA 4NUBA 1R00A 1E2XA 4I0AA 3OYJA 2DK8A 2VPLA 2FNAA 2WTEA 3F8FA 4I0BA 2V7FA 2J5PA 2L01A 1KZHA 4B3AA 5HOOA 3JSOA 4NC7A 4IZZA 2E34A 1FYKA 5IT9K 4G8XA 5DM6F 1ZREA 4BEHA 3HG9A 3BR6A 2MLKA 1FP2A 2LBFB 5JVTA 3T8RA 3RZDJ 1MD0A 1HKTA 3OL4A 5DUIA 2A6TA 1JKPC 5CVIA 1RNLA 2JN6A 2X4HA 2PG4A 1S9HA 1FTTA 2GXGA 4AIKA 5IYBJ 2PX9A 5EEHA 4LD5A 4D9JA 1BI0A 3FK6A 2RDPA 4M6XA 3PSFA 5FFZA 4XSZF 4QSHA 2AS5F 1TNTA 3C18A 4BQQA 2X6OA 3E5UA 3HEFA 1IW7F 2CV0A 5JFRA 5CPRB 1FNNA 2EFNA 4M3FA 1JUMA 2DW4A 3HRTA 4HRIA 2FF4A 3ZP5A 1BM9A 2FA5A 4EVIA 3H9JA 1D5YA 2EIKH 1I39A 4L5JA 2PLYA 4HF1A 3TGNA 2LSOA 4XLFA 2EBIA 1TP4A 3A4CA 2DT6A 3OYHA 2KKOA 3D0SA 3K1MA 4XORA 3KP6A 1X1BA 3QU6A 1LE8B 2M0CA 3LNQA 3K4NA 2YUSA 3MD2A 3I64A 3OL3A 3L2RA 1ULYA 2HZDA 3F8NA 1SMYF 3W6KB 1IN7A 1KQ8A 3HRMA 2WY7Q 3ONQA 1V4RA 1W5CC 2IJLA 4LITA 5FRMA 3FXJA 2OF7A 2DFHA 1WI3A 2P5VA 1V5GA 2R7WA 2PEXA 2F5CA 3S3NA 4PUSA 3S1NJ 4BAYA 2H27A 3A0HC 3N4MA 3IAS2 1OCOH 1S5LC 3MVPA 1XX5A 3AG1H 5GAGJ 2EV5A 5D5WB 3CF2A 3FIWA 1QPMA 4U7DA 2HVSA 4KFCA 1FIAA 2K86A 3FM5A 2CUJA 5LHIA 2KRFA 2NVTJ 3G1MA 1J09A 1G3WA 1UHMA 5K1YA 3WHCA 1FYMA 2KDOA 1XSDA 2LY1A 4LB5A 3LFKA 3ULQB 2ZJQF 1TWAJ 3R0AA 3WU1B 3IUOA 1DPUA 3OOPA 4G6QA 4I01A 1BR1A 2A6HF 1PP8F 1BOAA 2HOTA 2L9SA 4IHYA 3HSRA 3GMEA 2CUEA 5CVJA 3LSKA 3ABUA 1I1GA 1AHDP 1T8IA 5H20A 3NWSA 5E20A 1VQLI 5ICEA 1NG6A 4UVBA 1YJNI 5LLQA 3H3ZA 4UNOA 3GTMJ 4BGDA 1T2KA 3TO9A 2CRGA 3HXLA 2M7AA 1ZN2A 5DS9A 2LRDA 4YEJA 2Q0OA 1I6HJ 2PBIA 2CW7A 3K2AA 4FE7A 1WJCA 2NXNB 3BOQA 1D8JA 2F4OB 1MZBA 3ZN0A 4E7SA 4LIVA 1ON2A 1DGRM 3AAFA 1O3SA 1B59A 3S14J 2FSWA 4RB3C 4CZZA 3CP2A 4BL0B 2HDCA 4MFEA 4GDFA 2F2EA 1SEUA 4IRGA 2IAIA 4BYYA 4N4NB 1SMTA 4Y7NJ 3LA2A 2KRHA 1FT9A 1I1SA 4GRIA 5ED4A 5TRDA 4XK4A 2Y0SN 1WKMA 4A3FJ 1EA3A 2XIGA 5J1UA 1DP3A 4A5MA 1B1BA 4PGGA 5JHFA 1SFOJ 1MMDA 4ABZA 3VB2A 3QPTA 5DV5A 2M1BA 2DLLA 2O7OA 4WF2A 5LRSA 1Y56A 4M74A 2OPTA 2QVOA 1FMWA 3DWLE 2E2HJ 4DYRA 1JUPA 1ONVA 2Z16A 3S8PA 3HL2A 3BR0A 2PJRA 3SDGA 2L7FP 3S16J 5H6RA 3IC7A 3HUGB 2L9RA 2H94A 1PVEA 1J7KA 2R7VA 5C44J 1USTA 5ERIA 2EFOA 4L9JA 1P4XA 1MBGA 2RVCA 2W1OA 1MJBA 4XLEA 1G59A 2EH3A 5B3SH 1WQ2A 3D1NI 2HXIA 1XD7A 3EYIA 2IW5A 2QGUA 4YG2F 4IJAA 4LLNA 4NHJA 1IN8A 4ZDOA 2E60A 2IGKA 4M6VA 4UB8C 5JVGF 4D7NA 4A3EJ 4AUXA 3LFUA 2VXZA 4RGUA 1O3TA 4CCJA 2V6EA 3FK7A 2VE9A 1VQ4I 4E7JA 4YRVA 3I3LA 1QVTA 3KEQA 1IAWA 2CQ7A 2FMLA 4MTDA 2FEZA 4A3IJ 2VONA 2GLOA 3P9IA 1MDMB 2LC2A 5GADJ 1Z6TA 2GXAA 5E3LA 2OTJI 4BH9A 3LSMA 4I7HA 2NS7A 1LVKA 2VQHA 4DBQA 5DUKA 2EZIA 1QZEA 2P0WA 4EJWA 1HCRA 3COAC 3F8BA 5BOXA 2LK2A 2ELKA 1V5EA 4B8XA 3FHZA 3RKYA 4HX4A 3SXYA 4KJZA 4D5CA 4JBAA 3JTHA 3EPZA 3QYBA 2EFPA 5F1RA 3RI4A 1G2HA 3SQNA 3OYAA 2FBIA 3JSPA 5C4JJ 3G1OA 1ZHFA 4ZH4F 1FBQA 3PNYA 3WTZA 2PI0A 1ZGJA 2BE5F 2MW8A 2E19A 4DYQA 4J00A 3HPHA 5IY5H 2Q8KA 5LEJA 2CW8A 1FJLA 5HDGA 2YS9A 2CV2A 2FOKA 1PUFA 1RR7A 3DBHB 2IGNA 3S32A 3LSRA 3CMEI 4B44A 4ON0A 1YIJI 1ZRDA 4A3LJ 4GO1A 2HDDA 4BHPA 4HX7A 3OYEA 1VQOI 2BGCA 2G0EA 1VFCA 1W36D 4I76A 3NARA 1P6RA 4CUGA 1FZPB 1U8RA 3IH2A 5EGOB 3GW2A 3I5UA 3H9QA 3KCCA 3M8JA 2LY9A 4Y15A 5JR3A 2E5ZA 5HDKA 1B9MA 2YSRA 1Z7LA 1I5ZA 4LGWA 2DYSH 4B43A 3VDXA 2V26A 4GFBA 2V9KA 1M1EB 2NOGA 3W2AA 1IN6A 2EIJH 3DF8A 2M2EA 1PJRA 5CVVA 1F4KA 3A1YA 3BWGA 3L2QA 2BXYA 4ENKA 1V5FA 4N9IA 1BJZA 4ZJZA 4QPOA 2V9PA 4XOPA 3IV5A 2FOWA 4U7BA 4A69C 1VQKI 2E1MB 3OOUA 4CO8A 3DV8A 3RYPA 1R5ID 4C3HJ 4RM3A 5FD5A 1XCBA 4HLXA 3EETA 4MHGA 2ESHA 2L9VA 4B47A 1JTYA 5E3MA 3H0GJ 5FLVA 4M9SA 3RQIA 1OYWA 1RUOA 3OYKA 3SFZA 4A3MJ 3JRAA 1WJDA 3DTEA 3JRHA 4CXFA 3ZN1A 1BA5A 4F91B 1D0ZA 1IRXA 4WX9A 4EV0A 3ZMUA 2VC0A 4DNCA 5GAEJ 3GTQJ 1YFHA 2L0KA 2ZXWH 1OQYA 1HW2A 2QM3A 1CF7B 1PDNC 5E1WA 3ERED 2KDZA 3TQNA 2GBYA 3JRBA 3F8CA 3U1DA 3K4BA 3RDIA 3QQAA 4HZFA 1KU3A 3IAM2 1QHGA 5L3EA 3OYBA 3BG9A 3GXOA 4HF0A 3PFIA 2FQ4A 4IX7A 2HVRA 1YHQI 5B1AH 2V1NA 5BPIA 1U9NA 2LKPA 5M3FJ 1YG2A 1SD6A 1U3EM 3J81K 3BQZA 3LSHA 4ZYDA 1HBXG 1Z91A 2ZSHB 3I53A 1KU7A 5B66C 3BJOA 3E6CC 4IOCF 5KVRA 1YW8A 5DCFA 1LJ9A 2IS6A 3GZNB 3FXQA 2YX7A 4UVAA 1O4XA 1XSXA 1ETOA 1TT0A 2LY2A 4DOZA 4S04A 2H6CA 2ZNYA 3B02A 1KYZA 3HTUA 1IC8A 1A6QA 4BXUA 3CTAA 5TJJA 3JRDA 4CCOA 4E4HA 4GYGA 1ZR2A 4GXOA 1HDDC 1DDNA 3F22A 1GXQA 2XAGA 3DU5A 3WE3A 3ZRGA 2E36A 2HYFA 2PJPA 1FSHA 5LBQA 1G8XA 3LAJA 3TBIA 2VT2A 1X1CA 1VQ5I 1D0XA 3E1SA 2GIVA 4N0BA 4ZTJA 4YFNF 3RQ4A 3ABLH 2OBPA 3PNVA 4L5IA 1A5JA 5AIPA 3CJNA 1HKQA 3OSGA 3LSGA 2VC1A 3V42A 1W36C 2OZUA 4XIDA 1B9NA 3WGIA 1UMQA 4RGXA 3IRRA 1BR4A 1W7PA 5GPAA 2DA2A 1IRGA 1Y1WJ 4KDPA 2O6GE 1X58A 3W2WA 2KIFA 1Z3YA 2CJJA 2L5QA 2KJBA 3J81Z 2HQNA 2XV4S 2H8RA 2R93J 1L3LA 3OYMA 1FOXA 3G2BA 4PCQA 5D5XB 1TW3A 3QAHA 4BUPA 2BW3A 2WV1A 4OU0A 3WE2A 3NAUA 4AYBA 4ZZLA 1ZLJA 3WODF 2J5OA 1ZGAA 1QO0D 5HVQC 2GA1A 4W1UA 1SC7A 2P8TA 3L2CA 4J19A 2DA7A 2R5YA 4MEXF 5IP7J 1KU2A 4KISA 2VI6A 3SJMA 1XC5A 3FZVA 1TT5B 1YX5A 1EV7A 3KYDB 1MBFA 4PJNA 2EZHA 4GGGA 3HOWJ 4A6EA 4Y17A 4BKXA 2Q2EA 3L9FA 4HNTA 4O3MA 1CQTA 3HPGA 2WA0A 1PYVA 2KISA 2RN7A 3BJ6A 1FP1D 1LNWA 5CKTA 4RBOA 3BZCA 1MNDA 2HDWA 5J4YA 2CO5A 1FTZA 3O8HA 4AC0A 3I71A 4ZZDA 3DEWA 3M8FA 2LH9A 3K9TA 1I6XA 4IL6C 4RS8A 2Y75A 2NRAC 1MMSA 2MH2A 1TWHJ 1TQMA 1QVUA 2BHYA 1STZA 4LK1F 4B09A 4CSWA 4CYDA 4EM2A 4RA2A 2X51A 4OIPF 2DDAA 5IOYA 1OCZH 2IGMA 3OYFA 2TCTA 5JLXA 2FX0A 2OC6A 1V55H 1TZLA 1JJ8C 4I6ZA 2WAQA 5GP9A 2LD5A 2XKOA 2K40A 1HA8A 3HOSA 2CGPA 1LDDA 5LD2C 3RKQA 1XS9A 2CV1A 4MTEA 3I4MJ 1UHSA 2H1KA 4FX0A 4CYCA 2CQKA 2HPMA 5KAIC 3OR2C 1ETYA 3VSKA 2Y0MA 3L1PA 3RYRA 1I3AA 2AQFA 3DKWA 1U9OA 4RAZA 1IZ1A 1IO2A 3ZQ7A 4XLAA 4UXNA 4XRFA 4DZPA 3TOBA 2ZNZA 3ABMH 3QOEA 2IGOA 1Z6RA 1HXDA 2WV0A 1WJFA 5EZHA 4CCKA 3J7ZI 3WGHA 2HKXA 1NHAA 4A3GJ 3KPHA 3ISPA 2QWWA 1IXCA 4Q4ZF 4U0WA 5C4XJ 2XB5A 3GEZA 1O3QA 3GFLA 2QCOA 1SD4A 3O3KA 4OAZA 1QZZA 3IHUA 3CUOA 3K10A 4XLHA 1XMAA 3CJQB 1H89C 3BQYA 2E1CA 4F3QA 5ILUA 3M1EA 3CC7I 1KGSA 2RC4A 3G73A 2QSHX 2TDXA 4DYCA 3OYIA 2IP2A 4EJVA 2EILH 2M45A 2JMWA 5D8KB 2VJ5A 3E6MA 1YS6A 2A61A 2V9VA 4NC6A 2KIQA 4AIDA 2EA2A 1OYYA 3F72A 2KT0A 2OA4A 5J8FA 2FJ1A 3OYDA 1O57A 4F92B 4H0EA 2EQRA 2HKOA 1MNEA 4RAGA 3WGGA 3LSIA 4KICA 2CG4A 4B48A 4BY1J 1GVDA 2DT5A 5FGMA 1UB9A 5LGUA 3T5XA 2BHZA 4RB2C 2LNBA 3GYHX 4C9YA 1K78A 5J40A 5EG0B 2R5ZB 2BV6A 3CCJI 3P7NA 3VOEA 4FHTA 5D4RA 3WG9A 4BQAA 3GLXA 2XPWA 1FOKA 3IL2A 4V19K 1X1DA 5A2QK 2VASA 1BOBA 2RNGA 2V1XA 1RZ4A 4K2EA 2FD5A 1QHHD 1S7OA 4KIBA 2V1UA 4G7HF 5BNGA 1DU0A 3RCOA 3DPUA 2FBHA 3IP4B 3LSJA 4DBRA 1VI0A 4KT5C 1XGSA 3BTCA 2R7FA 1BI2A 4EJOA 2LBFA 4YFKF 2R0QC 1QPIA 5DM7F 3LA3A 2W84A 4IHWA 3LQRA 4QIWN 2V1DA 1R58A 3FISA 3CCEI 2FNPA 4UUSA 4P96A 3H5NA 3DLLF 1OR7C 4BEHB 2CU7A 3REOA 4BHBA 1TLHB 3HOXJ 1TL8A 2H8WA 3ZQFA 2XVCA 3PFYA 5L3CA 5CVUA 2KIUA 5TISC 3HSFA 5EEAA 2K3PA 2FBKA 2R7ZJ 2QF7A 1E17A 2Z2SB 1GT0C 3QPHA 3I55I 2P7CB 3BT9A 3CQZJ 4NQWA 2GXBA 2BOLA 2W85A 2MD0A 4BE0A 1HDPA 2K9QA 4CGZA 4ENNA 1EH7A 2RAEA 4BJ5C 2O8KA 3V8KA 3G4SI 1DPRA 1Z1DA 4KA4A 1TWGJ 2UXXA 2HI3A 3HHGA 1VQ6I 1GVJA 2ECBA 3ROUA 1X1AA 4WWCA 1YO5C 5LHHA 1G6NA 4CHUA 1D1CA 3DLAA 3JAMZ 4N9HA 2KFDA 5A2QZ 4BU2A 5FD6A 3OSFA 2DPDA 1RPWA 2IRFG 4BNCA 1SAUA 1P92A 3FXLA 3OS1A 3L09A 5IT9Z 1WVRA 2VL8A 3MEXA 5F6FA 2DTRA 1Z0XA 3AL0C 2VPRA 1O7LA 4G94A 2STWA 1YJ9I 3JTGA 1RETA 3IH4A 3DKXA 2XSDC 5F1JA 1Z77A 1OISA 2F5VA 2HQRA 2JK3A 2D1VA 3FKIJ 1PP7U 2IA1A 2DOEA 2DU9A 3W6JB 2NVXJ 3K4JA 4HQEA 5DD4A 2GWRA 3EQLF 4B3XA 4IRHA 1S8NA 2FE3A 2ZJ2A 2F5DA 4LG3A 3P5JA 2XROA 1C0WA 1Q1HA 4N4OB 2P81A 4LIUA 3KP7A 4Y4RA 1IXRC 3JW4A 1BW6A 2XPVA 1EH8A 2DN0A 1AOYA 2XSJC 3GWZA 3K7AJ 4H4KC 1WJAA 1TQIA 1JUSA 2XPUA 3G71I 2YU9J 3CC2I 2ME0A 3VYRB 2DMPA 5KCMA 2A6EF 3GBGA 1T6SA 1ZQ3P 2MH9A 1Y0NA 3QU3A 4FASD 1R1TA 3LAPA 4UY8I 1WWXA 4A3CJ 4G6TB 1F1ZA 3LQQA 5GPCA 3IWFA 4JOMA 3BROA 5ICCA 3A02A 3CJRB 4BDYA 3HRSA 2B0LA 2VOOA 2ZCWA 3S1QJ 4PSWA 5HNFA 4M3BA 2VBZA 1BR2A 3NRVA 5L3DA 2QBYA 3FHNA 3M8EA 3WTXC 4M6YA 4EGYA 3J7AO 4XLCA 2NVUB 4M72A 2X1DA 3MKYB 2ELHA 2DMTA 2EJRA 3FBIB 4XOTA 1LEBA 2E1NA 2DA3A 2JSCA 1ORKA 1T98A 2Z5UA 5CQGA 4HA8A 1TWFJ 5FKKA 3NWTA 2IPQX 2K9MA 3WHBA 1S72I 2VB6A 3ZQIA 5E17F 5FJ8J 5ILSA 3D5LA 5D4SA 5HLIA 2HOEA 2XGXA 3OIOA 3EDPA 4IHVA 1MBHA 2G7HA 2H1LA 2L02A 4U88A 2GQQA 4ZYHA 2BY2A 4XLNF 2WC2A 2IVMA 4AYBN 2R3SA 4ZC3A 2KPMA 3CDLA 3V8LA 3S2HJ 2Y31A 3WTWC 3GTOJ 5IP9J 4WCGA 3QPLA 2JQ7A 2F4IA 2K3FA 2QYOA 4MQVA 3RPUD 1F36A 5LGTA 3ZMVA 4IO9F 3S3OA 4FCYA 2K7LA 2VKHA 2WBMA 2HWVA 2CFOA 4U0YA 5LEKA 3V7RA 4BJ6C 4A5NA 2AQEA 1WI9A 1JGSA 2NYXA 2QKMB 4X6AJ 4Y3OA 2VKDA 4Y33A 9ANTA 2HQ5A 5LRRA 2DO7A 2RKHA 1R22A 3L2VA 5FB2A 4DW6A 3RPUA 1U6GA 4F55A 4HPQA 2XKPA 3KP2A 2DXIA 3DEEA 1ZG3A 2KLOA 3W6VA 4OOIA 2XF5A 5J3LA 5K5QA 5EDNA 1ZR4A 1MDMA 3BJAA 1IRZA 2K5CA 2AHQA 1YJWI 4IPAA 1XGMA 1HSJA 1KA8A 2F4MB 2I8DA 4G12A 5HDNA 4BQOA 3BR1A 1W5SA 1R23A 1J59A 4UV8A 4PK4A 2CQQA 1WGXA 2W7NA 1FIPA 3V4GA 5DYMA 3WTVC 2KIMA 4KYWA 3JCUC 2ELJA 2WAQN 2DAOA 2XUBA 2VBXA 1OJLA 5ILVA 4RGRA 1RI7A 5CVRA 2G7UA 4BDZA 3GCMA 4DJAA 5E79C 1AKHB 4I98B 1R4MB 1RESA 2ZFUA 3IWZA 3FXKA 3F6VA 2FXAA 4E7ZA 2KZGA 3GLLA 3DP7A 3OS0A 4F93B 3PIOF 1OKRA 4FISA 1WJBA 1U78A 5L3FA 2PQ8A 2QQAA 1G4DA 2HNHA 2W24A 4P55A 3CESA 3ECOA 4WXCA 1FOYA 4HQMA 4PSXA 1S7EA 2OAZA 2ID6A 3GVAA 4MIMA 3BDDA 3R6SA 4P5OA 2L9NA 1FWZA 2A3SA 2R4GA 4S0HB 3J80K 1E3PA 3C1DA 2LOOA 5EGOA 4QLCU 4A3BJ 1Z05A 3HOTA 4CICA 1PUFB 4OMYA 2QENA 4LJZF 2COMA 2GIZA 2CS3A 2HU9A 4PFOA 2K9LA 2GZWA 2Z99A 4RB0A 5ICGA 2R7SA 1WH7A 4PJMA 1Z7UA 3MWMA 4M73A 5E3OA 1VQ7I 4LOCA 4FT8A 2A5YB 2OZ6A 3HOZJ 2M8EA 1RIOH 1JHHA 4R8HA 2VN2A 1BI3A 1TNSA 2KMUA 4HW0A 5FLMJ 3CMMA 1UHWA 4HV6A 1W0UA 1WFXA 1P9QC 4XBFA 3KX2A 3A0BC 4BE1A 4XR6A 2L3DA 3JREA 3GX4X 2CSOA 1JGGA 2L54A 4JX5A 5FFXA 4XICA 4Q5SF 1XSVA 2JPBA 2IT0A 5D5UB 4L9VA 3TP0A 4HF2A 4O6JA 1ETQA 1XPXA 2DTZA 5EF6A 4KN7X 5BS6A 3CCLI 4XRSA 2X6WA 4ASNA 3ABTA 5K7FA 1YRNA 3QP6A 3S93A 4RLQA 2ZMEA 5FO5A 1CF7A 1JTXA 3M3YJ 4OINF 2ZC2A 2JA5J 1FX7A 3MQ0A 2BY3A 2GOXB 1P2FA 3MFKA 3IKTA 4L0ZB 2FMYA 4GCVA 4EMSA 1UFMA 3GTLJ 1WH5A 2EZLA 3C7JA 3HZJA 4AD9A 1YW7A 2K02A 1X1PA 4A6DA 3LA7A 2JRTA 2DFEA 3VYTB 3HYIA 3BC8A 3HDDA 4YELA 2HEOA 3TO6A 2HQAA 2W48A 2EA4A 1SAXA 1X2MA 4R1HA 3J80Z 3BR2A 2OQGA 1A35A 4IEJA 4L9NA 2Y48A 2E35A 3A2KA 1GV5A 3RJPA 3TEDA 2FQ3A 3ABKH 2XHKA 5FKOA 2W4SA 3FKJA 2D5VA 4B4CA 2L7MP 1OYIA 2WADA 2DMUA 2ZSIB 3K4LA 4XRSG 1K83J 3Q0UA 5E8GA 3T1BA 1N77A 4PJJA 2JVHA 1W0TA 2XRNA 1IN5A 3R60A 4BE2A 1NK2P 3FX3A 1E3OC 4AVPA 2HTJA 4UB6C 1U5TB 1UZCA 1BIBA 1Y8RB 2K9SA 1K4SA 4I2OA 4A3DJ 1SANA 3QOPA 2EWNA 2CUZA 2LF7A 2P6TA 3FF5A 2IBDA 1IRFA 4IVNA 5HS8A 3WTTC 3OR1C 2QKLB 2EZKA 2K27A 1K6YA 2MD5A 5GTIC 4XRMA 3HKZA 1X4PA 2JWTA 3HSEA 3ZQLA 1W7PD 3VODA 2R7XA 3DTKA 4D7MA 2L2OA 3BPVA 4ZDLA 2P6SA 2EFWA 1R36A 1J5YA 4YFXF 2G9WA 3U21A 3A01B 5K5OA 2VOPA 5BPDA 1RRJA 1D5VA 1GDTA 3ZQHA 1G3TA 2ECCA 5K5RA 1QNTA 2OV7A 4WK8F 4OIOF 4IF4A 2HYGD 3BTIA 3ZGKA 1R49A 1VQ9I 1YQAA 2D45A 2B9SA 1REPC 4M9XA 2JVGA 4XNFA 2JTVA 5EYRA 2M5WA 1R5HA 2BXZA 1OCRH 4F7ZA 1HF0A 1SD5A 1GV2A 3ZMZA 2MYSA 2Y9ZA 3OWTA 3S1MJ 1UELB 4I99C 4EATA 1FEXA 2NVYJ 4G9YA 2OCCH 5E1XA 2LVSA 4AVZA 4QWQA 1KONA 3K4MA 1NK3P 2ZMEC 1MMAA 1YW9A 3ZQGA 3ZMTA 3GTGJ 3ERMA 3CCQI 3CCUI 1B72A 3R61A 4D1QA 3E5XA 1IN4A 3PM1A 4Z6YA 5LFAA 3N05A 1ZAOA 1BI1A 4DIQA 3HC7A 1MJ9A 2BW3B 3CF5F 2XRLA 5IPAA 3HHHA 1YX3A 2K4BA 3EUAA 1ZTRA 3KZIC 2DMNA 2JSPA 3U1KA 4A93J 2YU3A 4Y52J 3FMQA 4NDLA 1XMKA 3Q0WA 4FTHA 1FYLA 1UG2A 3WTSC 1VQMI 3V7SA 3K70C 5K7HA 2W82A 4LFUA 2LLKA 2MFZA 3MZ8A 1UG0A 2KP6A 3KEYA 4XQFA 5H2FC 1TWCJ 2JA7J 1G3YA 5E8IA 3H5RA 1VTNC 2FU4A 2OD5A 2CFXA 2ZO4A 2JA8J 2P5KA 4M9ZA 5M3MJ 3GZ5A 2LTPA 2VE8A 3DTIA 4C3IJ 3ZCOA 2E71A 2ACJA 1MGTA 2I10A 3TW7A 1MW7A 4DGWB 3NEUA 3PQJA 3PUBA 3RPQA 1V54H 1MMGA 4HSRA 4LLLA 1B8IA 1N75A 1A6IA 2LKSA 2YR2A 3DQVC 3KYCB 5F0FA 2NVQJ 2MA3A 1E0EA 1GLNA 3PQKA 1WSUA 3ZPLA 2M30A 4BBSJ 5LGNA 4BY7J 3CCVI 1OCTC 4YIIA 1T38A 2LYCA 2ICWG 1OR7A 2R7OA 4PDKA 3IRQA 3KP5A 5IT3A 4DQ2A 1XN7A 3CUQA 5JHUA 1TQPA 2WAFA 1H8AC 5HS9A 1IDZA 1JE8A 2JA2A 1N78A 1F9NA 1HKSA 1BJAA 3SDBA 3CCRI 3KLNA 3F3XA 1H9TA 2AXLA 3K0LA 2DA5A 2X6YA 3I59B 1P7JA 1X2NA 2XAFA 3I58A 4D5FA 1Q1VA 5HNHA 1WRJA 4LG0A 4WXDA 3K1NA 2QSFX 3L2WA 2MSYA 2Q1ZB 2XB0X 4IHSA 1XGOA 2VJ4A 2EFQA 3WG7H 2RV8A 4AIJA 2H6BA 4EJTA 4RMNA 3TMOA 4CA0A 4EJUA 2VIXA 4UV9A 3DXJF 4ZYEA 4G7ZF 4G7OF 4I02A 4XKVA 3OV8A 3IKVA 2XC7A 1SFXA 2K4JA 2XF6A 3FMRA 2HOAA 1OCCH 2E2IJ 3F21A 3E6DA 2JUGA 5J4VA 3EYYA 2X85A 2BYVE 2B7EA 5EEGA 3CD6I 4XM3A 2UXNA 4HOBA 2R5ZA 3RTRA 4EQQA 2D2WA 2QQ9A 4CDGA 4C2TA 3WTUC 3E3VA 5F0CA 2HFHA 1EF4A 5DCMA 4YIFA 1ZYRF 4BACA 3CMAI 2CWEA 1DQUA 2WWYA 2VODA 1GXPA 4ENMA 2O3FA 3I9V2 1R7JA 3D5SC 3VEPA 3K1PA 4EM0B 2JPCA 2R7DA 2XASA 2A5WA 3DBLB 3ZR8X 1CGPA 2JT1A 3BP8A 4EEFG 5D6EA 3CMYA 5IYDJ 1LQ1A 3S15J 4P9UA 1P7IA 2LF8A 2A07F 2Y9YA 4MNUA 4FX4A 2PN6A 1FPQA 2UUZA 2DA4A 3AG4H 1YITI 1ODDA 5L3GA 1XB4A 1KU9A 2PMHA 3PJRA 3CUQC 3K2ZA 1ETWA 5DTDA 3V8JA 3GZ6A 4G6DA 3BLYA 4WXHA 2V79A 3DU6A 1W5TA 4BS9A 5DD8A 3GTJJ 2JRMA 3M1CA 2PMUA 4HDVA 2RQPA 1Y1VJ 1Y6IA 1D1AA 2DFIA 3E97A 3M07A 4UUSB 2DA6A 5E3NA 2TRTA 1QU3A 3IH3A 4A0YA 2Y69H 4B1RA 3ESWB 1T39A 3L7WA 2DCEA 5CJ9A 4KMUX 3FXRA 3ZMDA 2EPFA 5HLGA 5E18F 4UUTA 1L0OC 2LKXA 5D8LB 1LB2A 3KLOA 1K4TA 1DGWY 1IUYA 3DKYA 4E6KG 2HTSA 3R0JA 4NQWB 2E7XA 1PUEE 2L7ZA 1SVOA 1QA6A 2R92J 1LE8A 3H9GA 2YPRA 1XG1A 3TKYA 5DDGA 1IXSB 2DODA 2W25A 3GFJA 1D0YA 1ZG5A 1RC9A 2H09A 3MN2A 3HOVJ 1JJ6C 1MSEC 1KYWA 4JK1X 2DJIA 3PSIA 2LR8A 3KETA 2N8GA 3O2PE 1VF9A 2VT3A 1J75A 1RUNA 2X1CA 2GM4A 3CLQA 3DBRB 2QQ8A 4BJTA 5IP6A 4V2GA 1IV8A 2UZKA 4E70A 1I50J 2VBWA 3FBNB 4E7IA 3GTKJ 1USSA 2CYYA 2ETHA 4C2UA 2DK5A 3KFWX 2ZXHA 1YE9A 1H0MA 3RSNA 3Q0VA 4MFDA 4HNUA 5FRNA 3C2BA 1JHFA 3WU0A 2RREA 4NBQA 4NNJA 2XGDA 4ENJA 3LSTA 4OIRF 5M5XJ 2KZVA 4CCLA 4LMYA 3J7YJ 3H3UA 4HSTA 5JLWA 1WHUA 2LP0A 3QP5A 1DP7P 3QRFF 1VQPI 5M5YJ 1HW1A 1P4AA 3DFGA 3H1CA 5B1BH 1ON1A 2QLZA 4KT6A 4ESFA 1K6OA 3KP3A 2CMPA 4D0PA 3KE2A 3CCSI 2L4AA 4XSXF 2ZBKA 2KJCA 3W3CA 3H3VK 3HKZN 1OMIA 5GAHJ 3MZYA 1FSEA 1RKWA 1IUFA 4ANJA 2UV1A 2XF7A 3T0YA 3PNTA 2B63J 3NQOA 3AFHA 4M3EA 3TDZC 4L5EA 4HNVA 4XN3A 2IA0A 4Z2YA 3T8TA 4F52A 1HSTA 1NH3A 3B73A 1MBKA 4OIQF 2RNJA 1SVLA 3OMYA 4KIFA 1ETKA 1FBUA 5CYVA 3Q5FA 1GHCA 2L4MA 4HX8A 2QA4I 1X19A 2BY1A 2ZJRF 1K61A 3QYEA 2QBYB 3BG5A 4BBRJ 2PMZA 5J8CA 2WB1A 1U0JA 2EV0A 3KIOA 2XDVA 1Z3XA 1LFUP 1YOVB 2RQQA 5KAFC 3P9CA 4ESBA 3G6EI 1X3WB 1R9TJ 4IKFA 3CJTB 3FM3A 4HDUA 2EB7A 4JX6A 1MIJA 1UCRA 2M3AA 4P1WA 5IOZA 3OYCA 3ASNH 3C3WA 3F6OA 3HUGA 3CCMI 1YYVA 4RAYA 3G3ZA 4ZYGA 2C6YA 1E3HA 2XGCA 1KQ0A 3HOUJ 3O8GA 1WPKA 1T95A 2VLAA 2ZJPF 5J6XA 1AWCA 4A0XA 1LEAA 5JI6A 2PJRB 1QQIA 4XKBA 1Y8QB 1ITYA 3CO6C 2AXTC 2DFFA 5KNLA 4YIRX 2M0MA 1HC8A 1WJ5A 2M8GX 4LLGF 1JI8A 3K69A 1HW5A 4NC8A 4C2MJ 3ECHA 3EUHA 3F0CA 1O7FA 1P4WA 4QTRA 3K4CA 2UWMA 1TBXA 4U87A 5FROA 2KHMA 2F5EA 3OS2A 2Z33A 4DZJA 2GA2A 2OQRA 2MC3A 4AWXB 1MH3A 3HBLA 4Q47A 2CQXA 1D8KA 4M71A 3JRFA 3F23A 4ZDPA 5J47A 1K79A 1QBJA 1AA7A 2Z3YA 3FXOA 2VKVA 4RGSA 3ZXSA 4BQNA 3HIFA 3HB9A 4XKWA 3H36A 3WU2C 1AKHA 3MZHA 1V3FA 2HYJA 3D5RC 4IXAA 1J9IA 3RKWA 3LSPA 2W00A 3QODA 3BY6A 4I09A 3SEQA 4UHTA 4OMZA 1NG7A 4MO7A 3VFZA 5F64A 3CC4I 3VWBA 2HPIA 2M7BA 3MKLA 2JJ7A 1XTAA 1JKOC 1A31A 2NAZA 2F5FA 3P9KA 3U9GA 2ESNA 4HBLA 1YIOA 2WY8Q 5F0HA 2QSGX 4CZCA 1TTYA 1Z21A 4IRIA 1JT6A 3BPXA 3K4KA 1POGA 4MQ9F 2HVQA 3JRIA 3S2WA 3OYNA 2DQLA 2LREA 1DU6A 2LG4A 2DBBA 5D5VB 4L9TA 4XL9A 5LHGA 3L2UA 1YTYA 3V7CA 2IS1A 1S7AA 4UVCA 3ZQQA 3RKXA 1R5GA 1S29A 1B6AA 4RM2A 5J1RA 3TO7A 2HXOA 2XAUA 4FETA 5HODA 2GAUA 4A12A 4E7KA 2ISYA 1IDYA 1OLTA 5BQTA 2VJJA 2DA1A 1U8BA 4Q48A 4BXFA 4E7HA 1MBJA 1VZ0A 4IQ4A 3HTSB 2MABA 1D1BA 2F48A 3BCBA 2JA6J 2V6CA 2XAJA 3ZOBA 1VNDA 3BG3A 4FE4A 2M34A 1H88C 3GTPJ 4KUMA 4UUVA 2BY0A 2BVMA 4JQFA 3TW6A 1T0FA 2DT7B 3VPRA 4Y13A 2IEKA 4KITB 1I3QJ 5HLTA 1BBYA 1W4MA 3LL7A 4KNYA 1FLIA 2M87A 3DCFA 2X0LA 4HG2A 4HV5A 1T56A 2KL4A 4J01A 2HS5A 2IXSA 1SFUA 4RB1A 5HLHA 3K70D 1R4NB 1R1VA 2P4WA 1FY7A 4C30A 3EUHC 2LMDA 1RR8C 2AO9A 3JRGA 1ETVA 2QQBA 3ZMSA 1X3UA 3BG7A 3LMMA 3WTYC 2COBA 2ID3A 3AKZA 2Y2ZA 4M3DA 3BR5A 1XCVA 3QYFA 3I54A 1T08B 4II3A 4CH7A 5AIQA 4PZJA 2JZYA 4X1EA 2EIMH 5DEQA 1YRNB 4L18B 2O61A 2ZMEB 1F5TA 3PIPF 1NTCA 3O6BB 5FLXK 1ENHA 2CUFA 5CLSA 2VQLA 2QEXI 3HM5A 2BZTA 3Q3SA 3BCAA 1IF1A 3B6CA 1W1WE 3QPSA 3SZGA 2A05A 4XMYA 3I4PA 1YI2I 2XGEA 2D1HA 5BMZA 2DJNA 3Q9SA 3GO5A 1QRYA 2O03A 4FQGA 3SZTA 3HOYJ 2XAHA 1SVMA 4QPQA 3HRUA 3UR3C 2P7VB 4OAYA 4KMFA 1ZLKA 4EGZA 1IJWC 3Q9VA 1DUXC 3F9KA 1U5TA 5GTHC 3FXUA 2DOAA 3BTJA 3I56I 4A3KJ 4ZYAA 1BW5A 2NS0A 1LVAA 2BBYA 4NB5A 4HLYA 4OWRB 1OPCA 3VYUB 1LDKB 3X2QH 5HS7A 2ZKZA 3OYGA 2OCEA 3C2HA 2PFBA 5FKLA 1MJAA 1LFPA 3MKWB 3J7AY 3SHFA 2E7WA 2NNYA 1YS7A 2OJED 1VQNI 2NS8A 3A01A 5F04A 4JP0A 1EH6A 3BZ6A 3H5AA 1JKQC 3ZQCA 1SD7A 2CH0A 3CDIA 4ITVA 3BG6A 3FDYA 1ZKGA 2MBFA 3F8MA 3AG3H 2R7RA 3SYTA 5ICFA 3CO7C 4IOAF 1G3SA 3DPTA 5J1YA 1HQCA 2MGQA 2E1MC 3H35A 4PGHA 2E5NA 2W57A 3E5QA 4JYKA 1J2XA 2VKEA 5C3EJ 1S6LA 4KIGA 5FLXZ 3FWEA 1SFEA 2DMQA 4R79A 2LDUA 3S2DJ 2M9HA 3EUKL 2DDBA 1T0FC 1BC7C 3FMSA 4JX4A 3CZ6A 2Y0SA 3CLOA 1BL0A 2OTLI 3MKZA 1N25A 1XDSA 2EINH 1ZGWA 3W2VA 3PL8A 2MLGA 1R71A 3BZKA 2VJIA 4E7LA 1ETXA 1W7PB 2V4JC 1LKXA 2XAQA 4AU7A 3M7GA 3N97A 3SEZA 2BVLA 3OY9A 5D6FA 1R1UA 1WCMJ 5FKMA 2K9NA 2FUG2
chains in the Genus database with same CATH topology
3DPLC 1YLFA 4MEYF 2OU2A 1BN5A 5AONA 2DPUA 1Y0UA 4XLPF 4P9FA 1JXSA 3KEOA 1I27A 2VBYA 2EK5A 1KQ9A 2NNNA 3M9AA 2ZXJA 3CDHA 3I0TA 2STTA 1ZH5A 1BC8C 2QUFA 3ML6A 3E6BA 3TDUC 2A69F 4A0ZA 6PAXA 1U5TC 1LDJA 3KZYA 1QZYA 1B4AA 4A2UA 1TW2A 1MKMA 3TOAA 1ZRCA 4TV7A 5H6QA 3GF2A 4O5VA 1FBSA 1XDUA 2O8XA 3L00A 1D3YA 2BEOA 2O0YA 2HR3A 4U0VA 3SZPA 4HAMA 2FRHA 5E1ZB 3I59A 2IA2A 4IHTA 2RGVA 3CUQB 1FC3A 2ADUA 1QGPA 3ELKA 2Z9OA 4L0YB 4AIHA 1S3JA 4MGRA 4BHCA 3GFMA 1ZG1A 2YX4A 4ETSA 5L3BA 1A04A 3DEUA 4KN4X 2QZ8A 5KK1A 3U2RA 4LG0B 3GFIA 1ZARA 1U2WA 2HZTA 2DI3A 3MCZA 2P5LC 3H92A 2CW0F 3MAJA 2EV6A 3KZZA 4EM1A 4ESJA 4GYIA 4LK0F 3RIRA 3GUDA 2DQRA 1O3RA 1Z9CA 1ZRFA 1K7AA 1H9GA 2ISZA 1BIAA 1K78B 4S05A 2HGCA 2A68F 1XGNA 3KP4A 5DCMB 1J0RA 4LB6B 3JAMK 4HYEA 2ZFWA 3LWFA 3R4KA 1R00A 1E2XA 4I0AA 2DK8A 2FNAA 2WTEA 3F8FA 4I0BA 2J5PA 2L01A 5HOOA 3JSOA 1FYKA 5IT9K 4G8XA 1ZREA 2MLKA 1FP2A 5JVTA 3T8RA 1MD0A 1HKTA 5DUIA 5CVIA 1RNLA 2X4HA 2PG4A 2GXGA 4AIKA 5EEHA 4LD5A 1BI0A 2RDPA 4M6XA 5FFZA 4XSZF 2AS5F 1TNTA 3C18A 3E5UA 1IW7F 5JFRA 1FNNA 2EFNA 2DW4A 3HRTA 2FF4A 3ZP5A 1BM9A 2FA5A 4EVIA 4L5JA 2PLYA 4HF1A 3TGNA 2LSOA 1J9IA 2KKOA 3D0SA 3K1MA 4MEXF 3KP6A 3QU6A 3I64A 1ULYA 3F8NA 1SMYF 3W6KB 1IN7A 1KQ8A 3HRMA 1V4RA 2IJLA 2P5VA 2PEXA 2F5CA 4BAYA 2H27A 3N4MA 2EV5A 5D5WB 4KFCA 1QPMA 4U7DA 2K86A 3FM5A 5LHIA 2KRFA 1G3WA 1UHMA 5K1YA 1FYMA 4LB5A 1XSDA 3LFKA 3ULQB 3R0AA 3WU1B 1DPUA 3OOPA 4G6QA 4I01A 1PP8F 2A6HF 1BOAA 3HSRA 5CVJA 3ABUA 1I1GA 5H20A 5E20A 5ICEA 4UVBA 5LLQA 3H3ZA 4UNOA 1T2KA 3TO9A 1ZN2A 2Q0OA 2PBIA 3BOQA 1D8JA 1MZBA 3ZN0A 1ON2A 3AAFA 1O3SA 1B59A 2FSWA 4RB3C 4CZZA 2HDCA 2F2EA 4IRGA 4BYYA 1SMTA 3LA2A 1FT9A 1I1SA 5ED4A 5TRDA 1WKMA 2XIGA 4A5MA 1B1BA 4PGGA 3VB2A 3QPTA 5DV5A 2M1BA 2DLLA 4WF2A 5LRSA 4M74A 2QVOA 1ONVA 5H6RA 3IC7A 2H94A 1J7KA 1USTA 5ERIA 2EFOA 4L9JA 1P4XA 2RVCA 1MJBA 1WQ2A 1XD7A 3EYIA 2IW5A 4YG2F 4IJAA 4LLNA 4NHJA 1IN8A 4RGUA 2VXZA 1O3TA 2VE9A 1IAWA 3KEQA 2FMLA 4MTDA 2FEZA 2VONA 3P9IA 1MDMB 1Z6TA 4BH9A 4I7HA 5DUKA 4EJWA 3COAC 3F8BA 5BOXA 4B8XA 3FHZA 3RKYA 4HX4A 3SXYA 4JBAA 3JTHA 2EFPA 5F1RA 3RI4A 3SQNA 2FBIA 3JSPA 1ZHFA 4ZH4F 1FBQA 3WTZA 2PI0A 1ZGJA 2BE5F 2Q8KA 5LEJA 5HDGA 2FOKA 4ON0A 1ZRDA 4GO1A 4BHPA 4HX7A 2BGCA 1P6RA 1FZPB 1U8RA 3GW2A 3I5UA 3KCCA 4Y15A 5JR3A 5HDKA 1B9MA 2YSRA 1I5ZA 4LGWA 1IN6A 3DF8A 5CVVA 1F4KA 4ENKA 3BWGA 4N9IA 4U7BA 4CO8A 3DV8A 3RYPA 5FD5A 1XCBA 4HLXA 3EETA 4MHGA 2ESHA 4M9SA 1OYWA 1RUOA 3SFZA 4CXFA 3ZN1A 4WX9A 4EV0A 3ZMUA 2VC0A 4DNCA 1YFHA 1HW2A 2QM3A 1CF7B 1PDNC 5E1WA 3ERED 3TQNA 3F8CA 3U1DA 3RDIA 4HZFA 1KU3A 5L3EA 3GXOA 4HF0A 3PFIA 5BPIA 2LKPA 1YG2A 1SD6A 1U3EM 3J81K 4ZYDA 1HBXG 1Z91A 3I53A 1KU7A 3BJOA 3E6CC 5KVRA 1YW8A 5DCFA 1LJ9A 3FXQA 2YX7A 4UVAA 1XSXA 4S04A 2H6CA 2ZNYA 3B02A 1KYZA 3HTUA 4BXUA 3CTAA 5TJJA 4GYGA 4GXOA 1DDNA 3F22A 1GXQA 2XAGA 3WE3A 2HYFA 2PJPA 1FSHA 5LBQA 3LAJA 2VT2A 2GIVA 4N0BA 4YFNF 2OBPA 4L5IA 5AIPA 3CJNA 1HKQA 2VC1A 2OZUA 1B9NA 3WGIA 4RGXA 3IRRA 1W7PA 1IRGA 4KDPA 2O6GE 2KIFA 2KJBA 3J81Z 2HQNA 2XV4S 1L3LA 5D5XB 4PCQA 1TW3A 3QAHA 4ZZLA 4OU0A 3WE2A 1ZLJA 3WODF 2J5OA 1ZGAA 1QO0D 5HVQC 2GA1A 2P8TA 3L2CA 1KU2A 3FZVA 1EV7A 4GGGA 4A6EA 4Y17A 2Q2EA 3L9FA 4O3MA 2RN7A 3BJ6A 1FP1D 1LNWA 2CO5A 3I71A 4ZZDA 3M8FA 3K9TA 1I6XA 4RS8A 2Y75A 2NRAC 2MH2A 1TQMA 4LK1F 1STZA 4B09A 4EM2A 4CYDA 4OIPF 2XKOA 3HOSA 2CGPA 1LDDA 4MTEA 4FX0A 2CQKA 2Y0MA 3RYRA 3DKWA 4RAZA 1IZ1A 3ZQ7A 4UXNA 4XRFA 3TOBA 2ZNZA 1Z6RA 1HXDA 2WV0A 3WGHA 2HKXA 1NHAA 3ISPA 2QWWA 1IXCA 4Q4ZF 4U0WA 3GEZA 1O3QA 3GFLA 1SD4A 3O3KA 1QZZA 3IHUA 3CUOA 1XMAA 2E1CA 5ILUA 3M1EA 1KGSA 2RC4A 3G73A 2TDXA 2IP2A 4EJVA 2M45A 5D8KB 3E6MA 1YS6A 2A61A 2V9VA 2EA2A 1OYYA 3F72A 2OA4A 5J8FA 1O57A 4H0EA 2HKOA 3WGGA 4KICA 2CG4A 2DT5A 5FGMA 1UB9A 5LGUA 3T5XA 4RB2C 2LNBA 3GYHX 1K78A 2BV6A 3P7NA 3VOEA 4FHTA 5D4RA 3WG9A 4BQAA 3GLXA 1FOKA 3IL2A 5A2QK 2V1XA 1RZ4A 4K2EA 1S7OA 4KIBA 2V1UA 4G7HF 2FBHA 4KT5C 1XGSA 2R7FA 1BI2A 4EJOA 4YFKF 3LA3A 2W84A 3LQRA 2V1DA 1R58A 2FNPA 4P96A 3REOA 4BHBA 1TLHB 2XVCA 5L3CA 5CVUA 2KIUA 3HSFA 2FBKA 1E17A 3QPHA 2P7CB 4NQWA 2GXBA 2W85A 4CGZA 4ENNA 1EH7A 3V8KA 1DPRA 1Z1DA 4KA4A 2UXXA 3HHGA 1GVJA 3ROUA 4WWCA 1YO5C 5LHHA 1G6NA 4CHUA 3JAMZ 4N9HA 5A2QZ 5FD6A 2DPDA 4BNCA 2IRFG 1P92A 3L09A 5IT9Z 3MEXA 5F6FA 2DTRA 1O7LA 4G94A 2STWA 3JTGA 2HQRA 2D1VA 1PP7U 2IA1A 2DU9A 3W6JB 4HQEA 5DD4A 2GWRA 3EQLF 4IRHA 1S8NA 2FE3A 2ZJ2A 2F5DA 2XROA 1C0WA 1Q1HA 3KP7A 1IXRC 3JW4A 1EH8A 1AOYA 3GWZA 1TQIA 2A6EF 1T6SA 2MH9A 3QU3A 3LAPA 1R1TA 1WWXA 1F1ZA 3LQQA 3IWFA 3BROA 5ICCA 3HRSA 2B0LA 2VOOA 2ZCWA 2VBZA 3NRVA 5L3DA 2QBYA 3M8EA 3WTXC 4M6YA 4EGYA 3J7AO 4M72A 2ELHA 2EJRA 1LEBA 2E1NA 2JSCA 1T98A 2Z5UA 4HA8A 2IPQX 5E17F 5ILSA 3D5LA 5D4SA 5HLIA 2HOEA 2XGXA 3EDPA 2G7HA 2L02A 4ZYHA 4U88A 2GQQA 4XLNF 2WC2A 2IVMA 2R3SA 3V8LA 3WTWC 4WCGA 2QYOA 4MQVA 5LGTA 3ZMVA 2K7LA 2HWVA 4U0YA 5LEKA 3V7RA 4A5NA 1WI9A 1JGSA 2NYXA 5LRRA 2DO7A 2RKHA 1R22A 5FB2A 3RPUA 1U6GA 2XKPA 3KP2A 1ZG3A 4OOIA 1MDMA 5K5QA 3BJAA 4IPAA 1XGMA 1HSJA 1KA8A 5HDNA 1W5SA 1R23A 1J59A 4UV8A 3V4GA 5DYMA 3WTVC 2KIMA 4KYWA 2DAOA 2XUBA 2VBXA 5ILVA 4RGRA 1RI7A 5CVRA 2G7UA 4I98B 3IWZA 3F6VA 2FXAA 3DP7A 1OKRA 1U78A 5L3FA 2PQ8A 2QQAA 1G4DA 2W24A 4P55A 3ECOA 4WXCA 4HQMA 2OAZA 3GVAA 3BDDA 3R6SA 4P5OA 1FWZA 2A3SA 3J80K 3C1DA 4QLCU 1Z05A 3HOTA 4CICA 4OMYA 2QENA 4LJZF 2COMA 2GZWA 2Z99A 4RB0A 5ICGA 1Z7UA 3MWMA 4M73A 4FT8A 2A5YB 2OZ6A 2M8EA 1RIOH 1JHHA 4R8HA 2VN2A 1BI3A 1TNSA 4HW0A 1UHWA 4HV6A 4XBFA 2L3DA 3GX4X 2CSOA 2L54A 5FFXA 4Q5SF 1XSVA 2JPBA 2IT0A 5D5UB 4L9VA 4HF2A 4O6JA 4KN7X 5BS6A 4ASNA 3ABTA 3QP6A 2ZMEA 5FO5A 1CF7A 4OINF 1FX7A 3MQ0A 3IKTA 3MFKA 1P2FA 4L0ZB 2FMYA 4GCVA 4EMSA 1UFMA 3C7JA 4AD9A 1YW7A 2K02A 4A6DA 3LA7A 2JRTA 3HYIA 2HEOA 3TO6A 2EA4A 1SAXA 4R1HA 3J80Z 2OQGA 4L9NA 2Y48A 3RJPA 2FQ3A 2XHKA 1OYIA 5E8GA 3T1BA 2XRNA 1IN5A 3R60A 3FX3A 4AVPA 2HTJA 1U5TB 1BIBA 4I2OA 3QOPA 2EWNA 2LF7A 2P6TA 3FF5A 1IRFA 4IVNA 5HS8A 3WTTC 2K27A 2MD5A 3HSEA 1W7PD 3VODA 3BPVA 2P6SA 2EFWA 1R36A 1J5YA 4YFXF 2G9WA 5K5OA 2VOPA 5BPDA 1D5VA 1G3TA 5K5RA 1QNTA 4WK8F 4OIOF 4IF4A 2HYGD 1YQAA 2D45A 1REPC 4M9XA 2JTVA 2M5WA 1R5HA 4F7ZA 1SD5A 3ZMZA 4G9YA 5E1XA 4QWQA 1YW9A 3ZMTA 3R61A 3E5XA 1IN4A 1ZAOA 1BI1A 1MJ9A 3HHHA 2K4BA 2YU3A 3FMQA 1XMKA 1FYLA 3WTSC 3V7SA 4LFUA 1G3YA 5E8IA 1VTNC 2FU4A 2OD5A 2CFXA 2ZO4A 2P5KA 4M9ZA 3GZ5A 2VE8A 2ACJA 1MGTA 3NEUA 3PQJA 3RPQA 4LLLA 2YR2A 3DQVC 2MA3A 3PQKA 1WSUA 3ZPLA 2M30A 5LGNA 4YIIA 1T38A 1OR7A 4PDKA 3IRQA 3KP5A 5IT3A 4DQ2A 1XN7A 3CUQA 5JHUA 1TQPA 5HS9A 1JE8A 1F9NA 1HKSA 1BJAA 3KLNA 3F3XA 1H9TA 2AXLA 3K0LA 3I59B 2XAFA 3I58A 1WRJA 4LG0A 4WXDA 3K1NA 4IHSA 1XGOA 2EFQA 2RV8A 4AIJA 2H6BA 4EJTA 4EJUA 4UV9A 3DXJF 4ZYEA 4G7ZF 4G7OF 4I02A 3OV8A 3IKVA 1SFXA 2K4JA 3FMRA 3F21A 3E6DA 3EYYA 2BYVE 5EEGA 2UXNA 4HOBA 3RTRA 4EQQA 2D2WA 2QQ9A 4CDGA 3WTUC 3E3VA 2HFHA 5DCMA 4YIFA 1ZYRF 2CWEA 2WWYA 2VODA 1GXPA 4ENMA 2O3FA 1R7JA 3VEPA 3K1PA 4EM0B 2JPCA 2R7DA 2XASA 1CGPA 2JT1A 3BP8A 5D6EA 1LQ1A 4P9UA 2LF8A 2A07F 4MNUA 4FX4A 2PN6A 1FPQA 1ODDA 5L3GA 1XB4A 1KU9A 2PMHA 3CUQC 3K2ZA 3V8JA 3GZ6A 4G6DA 4WXHA 2V79A 1W5TA 5DD8A 2PMUA 4HDVA 2RQPA 2DFIA 3E97A 4A0YA 1T39A 3L7WA 5CJ9A 4KMUX 3FXRA 3ZMDA 5HLGA 5E18F 1L0OC 5D8LB 1LB2A 3KLOA 1IUYA 2HTSA 3R0JA 1PUEE 2E7XA 2YPRA 3TKYA 5DDGA 1IXSB 2W25A 3GFJA 1ZG5A 2H09A 1KYWA 4JK1X 3KETA 3O2PE 2VT3A 1J75A 1RUNA 2UZKA 4E70A 2VBWA 1USSA 2CYYA 2ETHA 2DK5A 3KFWX 1H0MA 1JHFA 3WU0A 4ENJA 3LSTA 4OIRF 4LMYA 3H3UA 3QP5A 1DP7P 3QRFF 1HW1A 1P4AA 3DFGA 4ESFA 1K6OA 1ON1A 2QLZA 3KP3A 4D0PA 3KE2A 2L4AA 4XSXF 2ZBKA 2KJCA 1OMIA 3MZYA 1FSEA 3T0YA 3NQOA 3TDZC 2IA0A 4Z2YA 3T8TA 1HSTA 3B73A 4OIQF 2RNJA 4KIFA 1FBUA 5CYVA 3Q5FA 1GHCA 2L4MA 4HX8A 2QBYB 5J8CA 2EV0A 3P9CA 4ESBA 3FM3A 4HDUA 2EB7A 1UCRA 3C3WA 3F6OA 3HUGA 1YYVA 4RAYA 3G3ZA 4ZYGA 2C6YA 1KQ0A 5J6XA 1AWCA 4A0XA 1LEAA 5JI6A 1QQIA 3CO6C 4LLGF 3K69A 1HW5A 3ECHA 3EUHA 1O7FA 1P4WA 2UWMA 1TBXA 2F5EA 2Z33A 2GA2A 2OQRA 2MC3A 4AWXB 4Q47A 1D8KA 4M71A 3F23A 1K79A 1QBJA 2Z3YA 4RGSA 3HIFA 3MZHA 1V3FA 4IXAA 3RKWA 4I09A 3VFZA 3BY6A 4UHTA 4OMZA 5F64A 2NAZA 2F5FA 3P9KA 3U9GA 2ESNA 4HBLA 1YIOA 1TTYA 4IRIA 3BPXA 4MQ9F 3S2WA 2DQLA 2DBBA 5D5VB 4L9TA 5LHGA 1YTYA 3V7CA 1S7AA 4UVCA 3RKXA 1R5GA 1S29A 1B6AA 3TO7A 2GAUA 4A12A 2ISYA 5BQTA 4Q48A 3HTSB 2V6CA 2XAJA 4KUMA 4UUVA 4JQFA 1T0FA 4Y13A 1BBYA 1W4MA 4KNYA 1FLIA 2M87A 2X0LA 4HV5A 2HS5A 1SFUA 4RB1A 5HLHA 1R1VA 2P4WA 1FY7A 3ZMSA 2QQBA 1X3UA 3WTYC 1XCVA 3I54A 5AIQA 4PZJA 2JZYA 5DEQA 4L18B 2O61A 2ZMEB 1F5TA 3O6BB 5FLXK 5CLSA 1IF1A 3I4PA 2D1HA 5BMZA 3Q9SA 3GO5A 2O03A 3SZTA 2XAHA 3HRUA 2P7VB 4KMFA 1ZLKA 4EGZA 3Q9VA 1DUXC 1U5TA 3FXUA 2NS0A 1LVAA 2BBYA 4NB5A 4HLYA 1OPCA 1LDKB 5HS7A 2ZKZA 2PFBA 1MJAA 3SHFA 2E7WA 2NNYA 1YS7A 1EH6A 3BZ6A 1SD7A 2MBFA 3F8MA 5ICFA 3CO7C 1G3SA 3DPTA 1HQCA 4PGHA 2W57A 3E5QA 1J2XA 1S6LA 4KIGA 5FLXZ 3FWEA 1SFEA 4R79A 2LDUA 1BC7C 3FMSA 3CLOA 1XDSA 2MLGA 1W7PB 2XAQA 3M7GA 3N97A 5D6FA 1R1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPL C;  1YLF A;  4MEY F;  2OU2 A;  1BN5 A;  5AON A;  2DPU A;  1Y0U A;  4XLP F;  4P9F A;  1JXS A;  3KEO A;  1I27 A;  2VBY A;  2EK5 A;  1KQ9 A;  2NNN A;  3M9A A;  2ZXJ A;  3CDH A;  3I0T A;  2STT A;  1ZH5 A;  1BC8 C;  2QUF A;  3ML6 A;  3E6B A;  3TDU C;  2A69 F;  4A0Z A;  6PAX A;  1U5T C;  1LDJ A;  3KZY A;  1QZY A;  1B4A A;  4A2U A;  1TW2 A;  1MKM A;  3TOA A;  1ZRC A;  4TV7 A;  5H6Q A;  3GF2 A;  4O5V A;  1FBS A;  1XDU A;  2O8X A;  3L00 A;  1D3Y A;  2BEO A;  2O0Y A;  2HR3 A;  4U0V A;  3SZP A;  4HAM A;  2FRH A;  5E1Z B;  3I59 A;  2IA2 A;  4IHT A;  2RGV A;  3CUQ B;  1FC3 A;  2ADU A;  1QGP A;  3ELK A;  2Z9O A;  4L0Y B;  4AIH A;  1S3J A;  4MGR A;  4BHC A;  3GFM A;  1ZG1 A;  2YX4 A;  4ETS A;  5L3B A;  1A04 A;  3DEU A;  4KN4 X;  2QZ8 A;  5KK1 A;  3U2R A;  4LG0 B;  3GFI A;  1ZAR A;  1U2W A;  2HZT A;  2DI3 A;  3MCZ A;  2P5L C;  3H92 A;  2CW0 F;  3MAJ A;  2EV6 A;  3KZZ A;  4EM1 A;  4ESJ A;  4GYI A;  4LK0 F;  3RIR A;  3GUD A;  2DQR A;  1O3R A;  1Z9C A;  1ZRF A;  1K7A A;  1H9G A;  2ISZ A;  1BIA A;  1K78 B;  4S05 A;  2HGC A;  2A68 F;  1XGN A;  3KP4 A;  5DCM B;  1J0R A;  4LB6 B;  3JAM K;  4HYE A;  2ZFW A;  3LWF A;  3R4K A;  1R00 A;  1E2X A;  4I0A A;  2DK8 A;  2FNA A;  2WTE A;  3F8F A;  4I0B A;  2J5P A;  2L01 A;  5HOO A;  3JSO A;  1FYK A;  5IT9 K;  4G8X A;  1ZRE A;  2MLK A;  1FP2 A;  5JVT A;  3T8R A;  1MD0 A;  1HKT A;  5DUI A;  5CVI A;  1RNL A;  2X4H A;  2PG4 A;  2GXG A;  4AIK A;  5EEH A;  4LD5 A;  1BI0 A;  2RDP A;  4M6X A;  5FFZ A;  4XSZ F;  2AS5 F;  1TNT A;  3C18 A;  3E5U A;  1IW7 F;  5JFR A;  1FNN A;  2EFN A;  2DW4 A;  3HRT A;  2FF4 A;  3ZP5 A;  1BM9 A;  2FA5 A;  4EVI A;  4L5J A;  2PLY A;  4HF1 A;  3TGN A;  2LSO A;  1J9I A;  2KKO A;  3D0S A;  3K1M A;  4MEX F;  3KP6 A;  3QU6 A;  3I64 A;  1ULY A;  3F8N A;  1SMY F;  3W6K B;  1IN7 A;  1KQ8 A;  3HRM A;  1V4R A;  2IJL A;  2P5V A;  2PEX A;  2F5C A;  4BAY A;  2H27 A;  3N4M A;  2EV5 A;  5D5W B;  4KFC A;  1QPM A;  4U7D A;  2K86 A;  3FM5 A;  5LHI A;  2KRF A;  1G3W A;  1UHM A;  5K1Y A;  1FYM A;  4LB5 A;  1XSD A;  3LFK A;  3ULQ B;  3R0A A;  3WU1 B;  1DPU A;  3OOP A;  4G6Q A;  4I01 A;  1PP8 F;  2A6H F;  1BOA A;  3HSR A;  5CVJ A;  3ABU A;  1I1G A;  5H20 A;  5E20 A;  5ICE A;  4UVB A;  5LLQ A;  3H3Z A;  4UNO A;  1T2K A;  3TO9 A;  1ZN2 A;  2Q0O A;  2PBI A;  3BOQ A;  1D8J A;  1MZB A;  3ZN0 A;  1ON2 A;  3AAF A;  1O3S A;  1B59 A;  2FSW A;  4RB3 C;  4CZZ A;  2HDC A;  2F2E A;  4IRG A;  4BYY A;  1SMT A;  3LA2 A;  1FT9 A;  1I1S A;  5ED4 A;  5TRD A;  1WKM A;  2XIG A;  4A5M A;  1B1B A;  4PGG A;  3VB2 A;  3QPT A;  5DV5 A;  2M1B A;  2DLL A;  4WF2 A;  5LRS A;  4M74 A;  2QVO A;  1ONV A;  5H6R A;  3IC7 A;  2H94 A;  1J7K A;  1UST A;  5ERI A;  2EFO A;  4L9J A;  1P4X A;  2RVC A;  1MJB A;  1WQ2 A;  1XD7 A;  3EYI A;  2IW5 A;  4YG2 F;  4IJA A;  4LLN A;  4NHJ A;  1IN8 A;  4RGU A;  2VXZ A;  1O3T A;  2VE9 A;  1IAW A;  3KEQ A;  2FML A;  4MTD A;  2FEZ A;  2VON A;  3P9I A;  1MDM B;  1Z6T A;  4BH9 A;  4I7H A;  5DUK A;  4EJW A;  3COA C;  3F8B A;  5BOX A;  4B8X A;  3FHZ A;  3RKY A;  4HX4 A;  3SXY A;  4JBA A;  3JTH A;  2EFP A;  5F1R A;  3RI4 A;  3SQN A;  2FBI A;  3JSP A;  1ZHF A;  4ZH4 F;  1FBQ A;  3WTZ A;  2PI0 A;  1ZGJ A;  2BE5 F;  2Q8K A;  5LEJ A;  5HDG A;  2FOK A;  4ON0 A;  1ZRD A;  4GO1 A;  4BHP A;  4HX7 A;  2BGC A;  1P6R A;  1FZP B;  1U8R A;  3GW2 A;  3I5U A;  3KCC A;  4Y15 A;  5JR3 A;  5HDK A;  1B9M A;  2YSR A;  1I5Z A;  4LGW A;  1IN6 A;  3DF8 A;  5CVV A;  1F4K A;  4ENK A;  3BWG A;  4N9I A;  4U7B A;  4CO8 A;  3DV8 A;  3RYP A;  5FD5 A;  1XCB A;  4HLX A;  3EET A;  4MHG A;  2ESH A;  4M9S A;  1OYW A;  1RUO A;  3SFZ A;  4CXF A;  3ZN1 A;  4WX9 A;  4EV0 A;  3ZMU A;  2VC0 A;  4DNC A;  1YFH A;  1HW2 A;  2QM3 A;  1CF7 B;  1PDN C;  5E1W A;  3ERE D;  3TQN A;  3F8C A;  3U1D A;  3RDI A;  4HZF A;  1KU3 A;  5L3E A;  3GXO A;  4HF0 A;  3PFI A;  5BPI A;  2LKP A;  1YG2 A;  1SD6 A;  1U3E M;  3J81 K;  4ZYD A;  1HBX G;  1Z91 A;  3I53 A;  1KU7 A;  3BJO A;  3E6C C;  5KVR A;  1YW8 A;  5DCF A;  1LJ9 A;  3FXQ A;  2YX7 A;  4UVA A;  1XSX A;  4S04 A;  2H6C A;  2ZNY A;  3B02 A;  1KYZ A;  3HTU A;  4BXU A;  3CTA A;  5TJJ A;  4GYG A;  4GXO A;  1DDN A;  3F22 A;  1GXQ A;  2XAG A;  3WE3 A;  2HYF A;  2PJP A;  1FSH A;  5LBQ A;  3LAJ A;  2VT2 A;  2GIV A;  4N0B A;  4YFN F;  2OBP A;  4L5I A;  5AIP A;  3CJN A;  1HKQ A;  2VC1 A;  2OZU A;  1B9N A;  3WGI A;  4RGX A;  3IRR A;  1W7P A;  1IRG A;  4KDP A;  2O6G E;  2KIF A;  2KJB A;  3J81 Z;  2HQN A;  2XV4 S;  1L3L A;  5D5X B;  4PCQ A;  1TW3 A;  3QAH A;  4ZZL A;  4OU0 A;  3WE2 A;  1ZLJ A;  3WOD F;  2J5O A;  1ZGA A;  1QO0 D;  5HVQ C;  2GA1 A;  2P8T A;  3L2C A;  1KU2 A;  3FZV A;  1EV7 A;  4GGG A;  4A6E A;  4Y17 A;  2Q2E A;  3L9F A;  4O3M A;  2RN7 A;  3BJ6 A;  1FP1 D;  1LNW A;  2CO5 A;  3I71 A;  4ZZD A;  3M8F A;  3K9T A;  1I6X A;  4RS8 A;  2Y75 A;  2NRA C;  2MH2 A;  1TQM A;  4LK1 F;  1STZ A;  4B09 A;  4EM2 A;  4CYD A;  4OIP F;  2XKO A;  3HOS A;  2CGP A;  1LDD A;  4MTE A;  4FX0 A;  2CQK A;  2Y0M A;  3RYR A;  3DKW A;  4RAZ A;  1IZ1 A;  3ZQ7 A;  4UXN A;  4XRF A;  3TOB A;  2ZNZ A;  1Z6R A;  1HXD A;  2WV0 A;  3WGH A;  2HKX A;  1NHA A;  3ISP A;  2QWW A;  1IXC A;  4Q4Z F;  4U0W A;  3GEZ A;  1O3Q A;  3GFL A;  1SD4 A;  3O3K A;  1QZZ A;  3IHU A;  3CUO A;  1XMA A;  2E1C A;  5ILU A;  3M1E A;  1KGS A;  2RC4 A;  3G73 A;  2TDX A;  2IP2 A;  4EJV A;  2M45 A;  5D8K B;  3E6M A;  1YS6 A;  2A61 A;  2V9V A;  2EA2 A;  1OYY A;  3F72 A;  2OA4 A;  5J8F A;  1O57 A;  4H0E A;  2HKO A;  3WGG A;  4KIC A;  2CG4 A;  2DT5 A;  5FGM A;  1UB9 A;  5LGU A;  3T5X A;  4RB2 C;  2LNB A;  3GYH X;  1K78 A;  2BV6 A;  3P7N A;  3VOE A;  4FHT A;  5D4R A;  3WG9 A;  4BQA A;  3GLX A;  1FOK A;  3IL2 A;  5A2Q K;  2V1X A;  1RZ4 A;  4K2E A;  1S7O A;  4KIB A;  2V1U A;  4G7H F;  2FBH A;  4KT5 C;  1XGS A;  2R7F A;  1BI2 A;  4EJO A;  4YFK F;  3LA3 A;  2W84 A;  3LQR A;  2V1D A;  1R58 A;  2FNP A;  4P96 A;  3REO A;  4BHB A;  1TLH B;  2XVC A;  5L3C A;  5CVU A;  2KIU A;  3HSF A;  2FBK A;  1E17 A;  3QPH A;  2P7C B;  4NQW A;  2GXB A;  2W85 A;  4CGZ A;  4ENN A;  1EH7 A;  3V8K A;  1DPR A;  1Z1D A;  4KA4 A;  2UXX A;  3HHG A;  1GVJ A;  3ROU A;  4WWC A;  1YO5 C;  5LHH A;  1G6N A;  4CHU A;  3JAM Z;  4N9H A;  5A2Q Z;  5FD6 A;  2DPD A;  4BNC A;  2IRF G;  1P92 A;  3L09 A;  5IT9 Z;  3MEX A;  5F6F A;  2DTR A;  1O7L A;  4G94 A;  2STW A;  3JTG A;  2HQR A;  2D1V A;  1PP7 U;  2IA1 A;  2DU9 A;  3W6J B;  4HQE A;  5DD4 A;  2GWR A;  3EQL F;  4IRH A;  1S8N A;  2FE3 A;  2ZJ2 A;  2F5D A;  2XRO A;  1C0W A;  1Q1H A;  3KP7 A;  1IXR C;  3JW4 A;  1EH8 A;  1AOY A;  3GWZ A;  1TQI A;  2A6E F;  1T6S A;  2MH9 A;  3QU3 A;  3LAP A;  1R1T A;  1WWX A;  1F1Z A;  3LQQ A;  3IWF A;  3BRO A;  5ICC A;  3HRS A;  2B0L A;  2VOO A;  2ZCW A;  2VBZ A;  3NRV A;  5L3D A;  2QBY A;  3M8E A;  3WTX C;  4M6Y A;  4EGY A;  3J7A O;  4M72 A;  2ELH A;  2EJR A;  1LEB A;  2E1N A;  2JSC A;  1T98 A;  2Z5U A;  4HA8 A;  2IPQ X;  5E17 F;  5ILS A;  3D5L A;  5D4S A;  5HLI A;  2HOE A;  2XGX A;  3EDP A;  2G7H A;  2L02 A;  4ZYH A;  4U88 A;  2GQQ A;  4XLN F;  2WC2 A;  2IVM A;  2R3S A;  3V8L A;  3WTW C;  4WCG A;  2QYO A;  4MQV A;  5LGT A;  3ZMV A;  2K7L A;  2HWV A;  4U0Y A;  5LEK A;  3V7R A;  4A5N A;  1WI9 A;  1JGS A;  2NYX A;  5LRR A;  2DO7 A;  2RKH A;  1R22 A;  5FB2 A;  3RPU A;  1U6G A;  2XKP A;  3KP2 A;  1ZG3 A;  4OOI A;  1MDM A;  5K5Q A;  3BJA A;  4IPA A;  1XGM A;  1HSJ A;  1KA8 A;  5HDN A;  1W5S A;  1R23 A;  1J59 A;  4UV8 A;  3V4G A;  5DYM A;  3WTV C;  2KIM A;  4KYW A;  2DAO A;  2XUB A;  2VBX A;  5ILV A;  4RGR A;  1RI7 A;  5CVR A;  2G7U A;  4I98 B;  3IWZ A;  3F6V A;  2FXA A;  3DP7 A;  1OKR A;  1U78 A;  5L3F A;  2PQ8 A;  2QQA A;  1G4D A;  2W24 A;  4P55 A;  3ECO A;  4WXC A;  4HQM A;  2OAZ A;  3GVA A;  3BDD A;  3R6S A;  4P5O A;  1FWZ A;  2A3S A;  3J80 K;  3C1D A;  4QLC U;  1Z05 A;  3HOT A;  4CIC A;  4OMY A;  2QEN A;  4LJZ F;  2COM A;  2GZW A;  2Z99 A;  4RB0 A;  5ICG A;  1Z7U A;  3MWM A;  4M73 A;  4FT8 A;  2A5Y B;  2OZ6 A;  2M8E A;  1RIO H;  1JHH A;  4R8H A;  2VN2 A;  1BI3 A;  1TNS A;  4HW0 A;  1UHW A;  4HV6 A;  4XBF A;  2L3D A;  3GX4 X;  2CSO A;  2L54 A;  5FFX A;  4Q5S F;  1XSV A;  2JPB A;  2IT0 A;  5D5U B;  4L9V A;  4HF2 A;  4O6J A;  4KN7 X;  5BS6 A;  4ASN A;  3ABT A;  3QP6 A;  2ZME A;  5FO5 A;  1CF7 A;  4OIN F;  1FX7 A;  3MQ0 A;  3IKT A;  3MFK A;  1P2F A;  4L0Z B;  2FMY A;  4GCV A;  4EMS A;  1UFM A;  3C7J A;  4AD9 A;  1YW7 A;  2K02 A;  4A6D A;  3LA7 A;  2JRT A;  3HYI A;  2HEO A;  3TO6 A;  2EA4 A;  1SAX A;  4R1H A;  3J80 Z;  2OQG A;  4L9N A;  2Y48 A;  3RJP A;  2FQ3 A;  2XHK A;  1OYI A;  5E8G A;  3T1B A;  2XRN A;  1IN5 A;  3R60 A;  3FX3 A;  4AVP A;  2HTJ A;  1U5T B;  1BIB A;  4I2O A;  3QOP A;  2EWN A;  2LF7 A;  2P6T A;  3FF5 A;  1IRF A;  4IVN A;  5HS8 A;  3WTT C;  2K27 A;  2MD5 A;  3HSE A;  1W7P D;  3VOD A;  3BPV A;  2P6S A;  2EFW A;  1R36 A;  1J5Y A;  4YFX F;  2G9W A;  5K5O A;  2VOP A;  5BPD A;  1D5V A;  1G3T A;  5K5R A;  1QNT A;  4WK8 F;  4OIO F;  4IF4 A;  2HYG D;  1YQA A;  2D45 A;  1REP C;  4M9X A;  2JTV A;  2M5W A;  1R5H A;  4F7Z A;  1SD5 A;  3ZMZ A;  4G9Y A;  5E1X A;  4QWQ A;  1YW9 A;  3ZMT A;  3R61 A;  3E5X A;  1IN4 A;  1ZAO A;  1BI1 A;  1MJ9 A;  3HHH A;  2K4B A;  2YU3 A;  3FMQ A;  1XMK A;  1FYL A;  3WTS C;  3V7S A;  4LFU A;  1G3Y A;  5E8I A;  1VTN C;  2FU4 A;  2OD5 A;  2CFX A;  2ZO4 A;  2P5K A;  4M9Z A;  3GZ5 A;  2VE8 A;  2ACJ A;  1MGT A;  3NEU A;  3PQJ A;  3RPQ A;  4LLL A;  2YR2 A;  3DQV C;  2MA3 A;  3PQK A;  1WSU A;  3ZPL A;  2M30 A;  5LGN A;  4YII A;  1T38 A;  1OR7 A;  4PDK A;  3IRQ A;  3KP5 A;  5IT3 A;  4DQ2 A;  1XN7 A;  3CUQ A;  5JHU A;  1TQP A;  5HS9 A;  1JE8 A;  1F9N A;  1HKS A;  1BJA A;  3KLN A;  3F3X A;  1H9T A;  2AXL A;  3K0L A;  3I59 B;  2XAF A;  3I58 A;  1WRJ A;  4LG0 A;  4WXD A;  3K1N A;  4IHS A;  1XGO A;  2EFQ A;  2RV8 A;  4AIJ A;  2H6B A;  4EJT A;  4EJU A;  4UV9 A;  3DXJ F;  4ZYE A;  4G7Z F;  4G7O F;  4I02 A;  3OV8 A;  3IKV A;  1SFX A;  2K4J A;  3FMR A;  3F21 A;  3E6D A;  3EYY A;  2BYV E;  5EEG A;  2UXN A;  4HOB A;  3RTR A;  4EQQ A;  2D2W A;  2QQ9 A;  4CDG A;  3WTU C;  3E3V A;  2HFH A;  5DCM A;  4YIF A;  1ZYR F;  2CWE A;  2WWY A;  2VOD A;  1GXP A;  4ENM A;  2O3F A;  1R7J A;  3VEP A;  3K1P A;  4EM0 B;  2JPC A;  2R7D A;  2XAS A;  1CGP A;  2JT1 A;  3BP8 A;  5D6E A;  1LQ1 A;  4P9U A;  2LF8 A;  2A07 F;  4MNU A;  4FX4 A;  2PN6 A;  1FPQ A;  1ODD A;  5L3G A;  1XB4 A;  1KU9 A;  2PMH A;  3CUQ C;  3K2Z A;  3V8J A;  3GZ6 A;  4G6D A;  4WXH A;  2V79 A;  1W5T A;  5DD8 A;  2PMU A;  4HDV A;  2RQP A;  2DFI A;  3E97 A;  4A0Y A;  1T39 A;  3L7W A;  5CJ9 A;  4KMU X;  3FXR A;  3ZMD A;  5HLG A;  5E18 F;  1L0O C;  5D8L B;  1LB2 A;  3KLO A;  1IUY A;  2HTS A;  3R0J A;  1PUE E;  2E7X A;  2YPR A;  3TKY A;  5DDG A;  1IXS B;  2W25 A;  3GFJ A;  1ZG5 A;  2H09 A;  1KYW A;  4JK1 X;  3KET A;  3O2P E;  2VT3 A;  1J75 A;  1RUN A;  2UZK A;  4E70 A;  2VBW A;  1USS A;  2CYY A;  2ETH A;  2DK5 A;  3KFW X;  1H0M A;  1JHF A;  3WU0 A;  4ENJ A;  3LST A;  4OIR F;  4LMY A;  3H3U A;  3QP5 A;  1DP7 P;  3QRF F;  1HW1 A;  1P4A A;  3DFG A;  4ESF A;  1K6O A;  1ON1 A;  2QLZ A;  3KP3 A;  4D0P A;  3KE2 A;  2L4A A;  4XSX F;  2ZBK A;  2KJC A;  1OMI A;  3MZY A;  1FSE A;  3T0Y A;  3NQO A;  3TDZ C;  2IA0 A;  4Z2Y A;  3T8T A;  1HST A;  3B73 A;  4OIQ F;  2RNJ A;  4KIF A;  1FBU A;  5CYV A;  3Q5F A;  1GHC A;  2L4M A;  4HX8 A;  2QBY B;  5J8C A;  2EV0 A;  3P9C A;  4ESB A;  3FM3 A;  4HDU A;  2EB7 A;  1UCR A;  3C3W A;  3F6O A;  3HUG A;  1YYV A;  4RAY A;  3G3Z A;  4ZYG A;  2C6Y A;  1KQ0 A;  5J6X A;  1AWC A;  4A0X A;  1LEA A;  5JI6 A;  1QQI A;  3CO6 C;  4LLG F;  3K69 A;  1HW5 A;  3ECH A;  3EUH A;  1O7F A;  1P4W A;  2UWM A;  1TBX A;  2F5E A;  2Z33 A;  2GA2 A;  2OQR A;  2MC3 A;  4AWX B;  4Q47 A;  1D8K A;  4M71 A;  3F23 A;  1K79 A;  1QBJ A;  2Z3Y A;  4RGS A;  3HIF A;  3MZH A;  1V3F A;  4IXA A;  3RKW A;  4I09 A;  3VFZ A;  3BY6 A;  4UHT A;  4OMZ A;  5F64 A;  2NAZ A;  2F5F A;  3P9K A;  3U9G A;  2ESN A;  4HBL A;  1YIO A;  1TTY A;  4IRI A;  3BPX A;  4MQ9 F;  3S2W A;  2DQL A;  2DBB A;  5D5V B;  4L9T A;  5LHG A;  1YTY A;  3V7C A;  1S7A A;  4UVC A;  3RKX A;  1R5G A;  1S29 A;  1B6A A;  3TO7 A;  2GAU A;  4A12 A;  2ISY A;  5BQT A;  4Q48 A;  3HTS B;  2V6C A;  2XAJ A;  4KUM A;  4UUV A;  4JQF A;  1T0F A;  4Y13 A;  1BBY A;  1W4M A;  4KNY A;  1FLI A;  2M87 A;  2X0L A;  4HV5 A;  2HS5 A;  1SFU A;  4RB1 A;  5HLH A;  1R1V A;  2P4W A;  1FY7 A;  3ZMS A;  2QQB A;  1X3U A;  3WTY C;  1XCV A;  3I54 A;  5AIQ A;  4PZJ A;  2JZY A;  5DEQ A;  4L18 B;  2O61 A;  2ZME B;  1F5T A;  3O6B B;  5FLX K;  5CLS A;  1IF1 A;  3I4P A;  2D1H A;  5BMZ A;  3Q9S A;  3GO5 A;  2O03 A;  3SZT A;  2XAH A;  3HRU A;  2P7V B;  4KMF A;  1ZLK A;  4EGZ A;  3Q9V A;  1DUX C;  1U5T A;  3FXU A;  2NS0 A;  1LVA A;  2BBY A;  4NB5 A;  4HLY A;  1OPC A;  1LDK B;  5HS7 A;  2ZKZ A;  2PFB A;  1MJA A;  3SHF A;  2E7W A;  2NNY A;  1YS7 A;  1EH6 A;  3BZ6 A;  1SD7 A;  2MBF A;  3F8M A;  5ICF A;  3CO7 C;  1G3S A;  3DPT A;  1HQC A;  4PGH A;  2W57 A;  3E5Q A;  1J2X A;  1S6L A;  4KIG A;  5FLX Z;  3FWE A;  1SFE A;  4R79 A;  2LDU A;  1BC7 C;  3FMS A;  3CLO A;  1XDS A;  2MLG A;  1W7P B;  2XAQ A;  3M7G A;  3N97 A;  5D6F A;  1R1U A; 
#chains in the Genus database with same CATH topology
 2KRC A;  3DPL C;  1YLF A;  4MEY F;  3HGG A;  5EZG A;  2OU2 A;  1BN5 A;  2X1E A;  5AON A;  2DPU A;  1RKT A;  1X3Z B;  2HOS A;  1Y0U A;  2VQC A;  4PJ0 C;  4XLP F;  2X6X A;  5IYC J;  2R5Y B;  2O5R A;  4P9F A;  3E0J B;  4A3J J;  1JXS A;  1B72 B;  3KEO A;  1I27 A;  2VBY A;  2EK5 A;  4BXX J;  2E2J J;  1KQ9 A;  1FMV A;  2NNN A;  2ZXJ A;  3CDH A;  3M9A A;  3OIP A;  3I0T A;  3VSL A;  2STT A;  3S1R J;  1ZH5 A;  2ZB9 A;  1BC8 C;  1Z67 A;  3E7L A;  5KHD A;  1XMX A;  2Q2E B;  5TGT A;  2QUF A;  3ML6 A;  1MMN A;  3E6B A;  5CQE A;  1ZEL A;  4IHX A;  3TDU C;  3PUF A;  3K6G A;  2LFB A;  1ACI A;  4M3G A;  4XON A;  2A69 F;  2X48 A;  4A0Z A;  2ZXI A;  3SFI A;  6PAX A;  1U5T C;  3FXM A;  4CCM A;  1LDJ A;  1IG7 A;  4XN0 A;  5M5W J;  1OCP A;  3KZY A;  1AU7 A;  1QZY A;  1FOW A;  2JUC A;  4IQJ A;  1B4A A;  1ERD A;  4A2U A;  2CQN A;  1HOM A;  1TW2 A;  1MKM A;  3UKG A;  3TOA A;  4C3J J;  2E1O A;  2WAE A;  1ZRC A;  2DYR H;  4TV7 A;  3H0D A;  5H6Q A;  3GF2 A;  2VQG A;  4O5V A;  1EKE A;  1FBS A;  4CCN A;  1Y39 A;  3AG2 H;  1XDU A;  4II2 A;  1F43 A;  5EJC A;  2Y30 A;  2O8X A;  1X4O A;  3L00 A;  3RZO J;  1D3Y A;  2BEO A;  2O0Y A;  3OIQ A;  2HR3 A;  2PMZ N;  2Z1D A;  2WB1 N;  1B8I B;  3OYL A;  4U0V A;  5K7Z A;  3G1L A;  3LOC A;  3SZP A;  4HAM A;  4CYC B;  5F08 A;  4X0G A;  3ASO H;  3A03 A;  1SFK A;  2FRH A;  4RAF A;  1WZ2 A;  1MH4 A;  5E1Z B;  3I59 A;  2IA2 A;  4IHT A;  2RGV A;  1R6R A;  3CUQ B;  2ME6 A;  3TL4 X;  1FC3 A;  2O9L A;  2ADU A;  4V2F A;  1QGP A;  1MNM C;  1LFB A;  3ELK A;  2MC4 A;  1ZK8 A;  2Z9O A;  1VQ8 I;  4AIH A;  1S3J A;  4L0Y B;  4MGR A;  4BHC A;  3GFM A;  1ZG1 A;  3S3M A;  2M4G A;  4ZTF A;  1HLV A;  2YX4 A;  4ETS A;  1IGN A;  5L3B A;  1JKR C;  1TC3 C;  1A04 A;  1JT0 A;  3DEU A;  4KN4 X;  4W97 A;  1MSF C;  3JRC A;  1EJ9 A;  2QZ8 A;  4HEA 2;  5F27 A;  5KK1 A;  2IS2 A;  3U2R A;  2GOM A;  2R7T A;  3PO2 J;  2NOJ B;  4LG0 B;  3GFI A;  3VYS B;  3CCY A;  2VXD A;  2R7Q A;  2F6C A;  2K85 A;  1ZAR A;  1U2W A;  2HZT A;  2R7U A;  3UNG C;  2KQR A;  2DI3 A;  3M4O J;  2X9D A;  3MCZ A;  4RLF A;  2P5L C;  3H92 A;  2CW0 F;  3MAJ A;  1IV6 A;  1MBE A;  1UJ8 A;  3C2G A;  4PFP A;  2EV6 A;  3KZZ A;  5FKN A;  4EM1 A;  4ESJ A;  4GYI A;  3BTL A;  3JR9 A;  5EG0 A;  3HJE A;  4LK0 F;  3AL0 B;  3RIR A;  3S17 J;  3BR3 A;  3GUD A;  2DQR A;  4XKC A;  1O3R A;  1Z9C A;  2M4K A;  1ZRF A;  2VUM J;  1APL C;  3B6A A;  2I5U A;  1K7A A;  1GUU A;  1OFC X;  1UAA A;  1WJE A;  3MMY B;  4AM3 A;  1H9G A;  2ISZ A;  3QWL A;  5B5E C;  1BIA A;  1LPQ A;  1K78 B;  4S05 A;  2HGC A;  2L7K A;  2A68 F;  1XGN A;  2DOF A;  1T33 A;  3KYL A;  3TP3 A;  2MG4 A;  3KP4 A;  5DCM B;  1LUJ B;  3HGY A;  1J0R A;  3CP8 A;  4MLO A;  2IS4 A;  4PJL A;  3I4N J;  4LB6 B;  1A36 A;  3JAM K;  2OUM A;  4HYE A;  4RDU A;  2ZFW A;  3PO3 J;  3LWF A;  3R4K A;  4NUB A;  1R00 A;  1E2X A;  4I0A A;  3OYJ A;  2DK8 A;  2VPL A;  2FNA A;  2WTE A;  3F8F A;  4I0B A;  2V7F A;  2J5P A;  2L01 A;  1KZH A;  4B3A A;  5HOO A;  3JSO A;  4NC7 A;  4IZZ A;  2E34 A;  1FYK A;  5IT9 K;  4G8X A;  5DM6 F;  1ZRE A;  4BEH A;  3HG9 A;  3BR6 A;  2MLK A;  1FP2 A;  2LBF B;  5JVT A;  3T8R A;  3RZD J;  1MD0 A;  1HKT A;  3OL4 A;  5DUI A;  2A6T A;  1JKP C;  5CVI A;  1RNL A;  2JN6 A;  2X4H A;  2PG4 A;  1S9H A;  1FTT A;  2GXG A;  4AIK A;  5IYB J;  2PX9 A;  5EEH A;  4LD5 A;  4D9J A;  1BI0 A;  3FK6 A;  2RDP A;  4M6X A;  3PSF A;  5FFZ A;  4XSZ F;  4QSH A;  2AS5 F;  1TNT A;  3C18 A;  4BQQ A;  2X6O A;  3E5U A;  3HEF A;  1IW7 F;  2CV0 A;  5JFR A;  5CPR B;  1FNN A;  2EFN A;  4M3F A;  1JUM A;  2DW4 A;  3HRT A;  4HRI A;  2FF4 A;  3ZP5 A;  1BM9 A;  2FA5 A;  4EVI A;  3H9J A;  1D5Y A;  2EIK H;  1I39 A;  4L5J A;  2PLY A;  4HF1 A;  3TGN A;  2LSO A;  4XLF A;  2EBI A;  1TP4 A;  3A4C A;  2DT6 A;  3OYH A;  2KKO A;  3D0S A;  3K1M A;  4XOR A;  3KP6 A;  1X1B A;  3QU6 A;  1LE8 B;  2M0C A;  3LNQ A;  3K4N A;  2YUS A;  3MD2 A;  3I64 A;  3OL3 A;  3L2R A;  1ULY A;  2HZD A;  3F8N A;  1SMY F;  3W6K B;  1IN7 A;  1KQ8 A;  3HRM A;  2WY7 Q;  3ONQ A;  1V4R A;  1W5C C;  2IJL A;  4LIT A;  5FRM A;  3FXJ A;  2OF7 A;  2DFH A;  1WI3 A;  2P5V A;  1V5G A;  2R7W A;  2PEX A;  2F5C A;  3S3N A;  4PUS A;  3S1N J;  4BAY A;  2H27 A;  3A0H C;  3N4M A;  3IAS 2;  1OCO H;  1S5L C;  3MVP A;  1XX5 A;  3AG1 H;  5GAG J;  2EV5 A;  5D5W B;  3CF2 A;  3FIW A;  1QPM A;  4U7D A;  2HVS A;  4KFC A;  1FIA A;  2K86 A;  3FM5 A;  2CUJ A;  5LHI A;  2KRF A;  2NVT J;  3G1M A;  1J09 A;  1G3W A;  1UHM A;  5K1Y A;  3WHC A;  1FYM A;  2KDO A;  1XSD A;  2LY1 A;  4LB5 A;  3LFK A;  3ULQ B;  2ZJQ F;  1TWA J;  3R0A A;  3WU1 B;  3IUO A;  1DPU A;  3OOP A;  4G6Q A;  4I01 A;  1BR1 A;  2A6H F;  1PP8 F;  1BOA A;  2HOT A;  2L9S A;  4IHY A;  3HSR A;  3GME A;  2CUE A;  5CVJ A;  3LSK A;  3ABU A;  1I1G A;  1AHD P;  1T8I A;  5H20 A;  3NWS A;  5E20 A;  1VQL I;  5ICE A;  1NG6 A;  4UVB A;  1YJN I;  5LLQ A;  3H3Z A;  4UNO A;  3GTM J;  4BGD A;  1T2K A;  3TO9 A;  2CRG A;  3HXL A;  2M7A A;  1ZN2 A;  5DS9 A;  2LRD A;  4YEJ A;  2Q0O A;  1I6H J;  2PBI A;  2CW7 A;  3K2A A;  4FE7 A;  1WJC A;  2NXN B;  3BOQ A;  1D8J A;  2F4O B;  1MZB A;  3ZN0 A;  4E7S A;  4LIV A;  1ON2 A;  1DGR M;  3AAF A;  1O3S A;  1B59 A;  3S14 J;  2FSW A;  4RB3 C;  4CZZ A;  3CP2 A;  4BL0 B;  2HDC A;  4MFE A;  4GDF A;  2F2E A;  1SEU A;  4IRG A;  2IAI A;  4BYY A;  4N4N B;  1SMT A;  4Y7N J;  3LA2 A;  2KRH A;  1FT9 A;  1I1S A;  4GRI A;  5ED4 A;  5TRD A;  4XK4 A;  2Y0S N;  1WKM A;  4A3F J;  1EA3 A;  2XIG A;  5J1U A;  1DP3 A;  4A5M A;  1B1B A;  4PGG A;  5JHF A;  1SFO J;  1MMD A;  4ABZ A;  3VB2 A;  3QPT A;  5DV5 A;  2M1B A;  2DLL A;  2O7O A;  4WF2 A;  5LRS A;  1Y56 A;  4M74 A;  2OPT A;  2QVO A;  1FMW A;  3DWL E;  2E2H J;  4DYR A;  1JUP A;  1ONV A;  2Z16 A;  3S8P A;  3HL2 A;  3BR0 A;  2PJR A;  3SDG A;  2L7F P;  3S16 J;  5H6R A;  3IC7 A;  3HUG B;  2L9R A;  2H94 A;  1PVE A;  1J7K A;  2R7V A;  5C44 J;  1UST A;  5ERI A;  2EFO A;  4L9J A;  1P4X A;  1MBG A;  2RVC A;  2W1O A;  1MJB A;  4XLE A;  1G59 A;  2EH3 A;  5B3S H;  1WQ2 A;  3D1N I;  2HXI A;  1XD7 A;  3EYI A;  2IW5 A;  2QGU A;  4YG2 F;  4IJA A;  4LLN A;  4NHJ A;  1IN8 A;  4ZDO A;  2E60 A;  2IGK A;  4M6V A;  4UB8 C;  5JVG F;  4D7N A;  4A3E J;  4AUX A;  3LFU A;  2VXZ A;  4RGU A;  1O3T A;  4CCJ A;  2V6E A;  3FK7 A;  2VE9 A;  1VQ4 I;  4E7J A;  4YRV A;  3I3L A;  1QVT A;  3KEQ A;  1IAW A;  2CQ7 A;  2FML A;  4MTD A;  2FEZ A;  4A3I J;  2VON A;  2GLO A;  3P9I A;  1MDM B;  2LC2 A;  5GAD J;  1Z6T A;  2GXA A;  5E3L A;  2OTJ I;  4BH9 A;  3LSM A;  4I7H A;  2NS7 A;  1LVK A;  2VQH A;  4DBQ A;  5DUK A;  2EZI A;  1QZE A;  2P0W A;  4EJW A;  1HCR A;  3COA C;  3F8B A;  5BOX A;  2LK2 A;  2ELK A;  1V5E A;  4B8X A;  3FHZ A;  3RKY A;  4HX4 A;  3SXY A;  4KJZ A;  4D5C A;  4JBA A;  3JTH A;  3EPZ A;  3QYB A;  2EFP A;  5F1R A;  3RI4 A;  1G2H A;  3SQN A;  3OYA A;  2FBI A;  3JSP A;  5C4J J;  3G1O A;  1ZHF A;  4ZH4 F;  1FBQ A;  3PNY A;  3WTZ A;  2PI0 A;  1ZGJ A;  2BE5 F;  2MW8 A;  2E19 A;  4DYQ A;  4J00 A;  3HPH A;  5IY5 H;  2Q8K A;  5LEJ A;  2CW8 A;  1FJL A;  5HDG A;  2YS9 A;  2CV2 A;  2FOK A;  1PUF A;  1RR7 A;  3DBH B;  2IGN A;  3S32 A;  3LSR A;  3CME I;  4B44 A;  4ON0 A;  1YIJ I;  1ZRD A;  4A3L J;  4GO1 A;  2HDD A;  4BHP A;  4HX7 A;  3OYE A;  1VQO I;  2BGC A;  2G0E A;  1VFC A;  1W36 D;  4I76 A;  3NAR A;  1P6R A;  4CUG A;  1FZP B;  1U8R A;  3IH2 A;  5EGO B;  3GW2 A;  3I5U A;  3H9Q A;  3KCC A;  3M8J A;  2LY9 A;  4Y15 A;  5JR3 A;  2E5Z A;  5HDK A;  1B9M A;  2YSR A;  1Z7L A;  1I5Z A;  4LGW A;  2DYS H;  4B43 A;  3VDX A;  2V26 A;  4GFB A;  2V9K A;  1M1E B;  2NOG A;  3W2A A;  1IN6 A;  2EIJ H;  3DF8 A;  2M2E A;  1PJR A;  5CVV A;  1F4K A;  3A1Y A;  3BWG A;  3L2Q A;  2BXY A;  4ENK A;  1V5F A;  4N9I A;  1BJZ A;  4ZJZ A;  4QPO A;  2V9P A;  4XOP A;  3IV5 A;  2FOW A;  4U7B A;  4A69 C;  1VQK I;  2E1M B;  3OOU A;  4CO8 A;  3DV8 A;  3RYP A;  1R5I D;  4C3H J;  4RM3 A;  5FD5 A;  1XCB A;  4HLX A;  3EET A;  4MHG A;  2ESH A;  2L9V A;  4B47 A;  1JTY A;  5E3M A;  3H0G J;  5FLV A;  4M9S A;  3RQI A;  1OYW A;  1RUO A;  3OYK A;  3SFZ A;  4A3M J;  3JRA A;  1WJD A;  3DTE A;  3JRH A;  4CXF A;  3ZN1 A;  1BA5 A;  4F91 B;  1D0Z A;  1IRX A;  4WX9 A;  4EV0 A;  3ZMU A;  2VC0 A;  4DNC A;  5GAE J;  3GTQ J;  1YFH A;  2L0K A;  2ZXW H;  1OQY A;  1HW2 A;  2QM3 A;  1CF7 B;  1PDN C;  5E1W A;  3ERE D;  2KDZ A;  3TQN A;  2GBY A;  3JRB A;  3F8C A;  3U1D A;  3K4B A;  3RDI A;  3QQA A;  4HZF A;  1KU3 A;  3IAM 2;  1QHG A;  5L3E A;  3OYB A;  3BG9 A;  3GXO A;  4HF0 A;  3PFI A;  2FQ4 A;  4IX7 A;  2HVR A;  1YHQ I;  5B1A H;  2V1N A;  5BPI A;  1U9N A;  2LKP A;  5M3F J;  1YG2 A;  1SD6 A;  1U3E M;  3J81 K;  3BQZ A;  3LSH A;  4ZYD A;  1HBX G;  1Z91 A;  2ZSH B;  3I53 A;  1KU7 A;  5B66 C;  3BJO A;  3E6C C;  4IOC F;  5KVR A;  1YW8 A;  5DCF A;  1LJ9 A;  2IS6 A;  3GZN B;  3FXQ A;  2YX7 A;  4UVA A;  1O4X A;  1XSX A;  1ETO A;  1TT0 A;  2LY2 A;  4DOZ A;  4S04 A;  2H6C A;  2ZNY A;  3B02 A;  1KYZ A;  3HTU A;  1IC8 A;  1A6Q A;  4BXU A;  3CTA A;  5TJJ A;  3JRD A;  4CCO A;  4E4H A;  4GYG A;  1ZR2 A;  4GXO A;  1HDD C;  1DDN A;  3F22 A;  1GXQ A;  2XAG A;  3DU5 A;  3WE3 A;  3ZRG A;  2E36 A;  2HYF A;  2PJP A;  1FSH A;  5LBQ A;  1G8X A;  3LAJ A;  3TBI A;  2VT2 A;  1X1C A;  1VQ5 I;  1D0X A;  3E1S A;  2GIV A;  4N0B A;  4ZTJ A;  4YFN F;  3RQ4 A;  3ABL H;  2OBP A;  3PNV A;  4L5I A;  1A5J A;  5AIP A;  3CJN A;  1HKQ A;  3OSG A;  3LSG A;  2VC1 A;  3V42 A;  1W36 C;  2OZU A;  4XID A;  1B9N A;  3WGI A;  1UMQ A;  4RGX A;  3IRR A;  1BR4 A;  1W7P A;  5GPA A;  2DA2 A;  1IRG A;  1Y1W J;  4KDP A;  2O6G E;  1X58 A;  3W2W A;  2KIF A;  1Z3Y A;  2CJJ A;  2L5Q A;  2KJB A;  3J81 Z;  2HQN A;  2XV4 S;  2H8R A;  2R93 J;  1L3L A;  3OYM A;  1FOX A;  3G2B A;  4PCQ A;  5D5X B;  1TW3 A;  3QAH A;  4BUP A;  2BW3 A;  2WV1 A;  4OU0 A;  3WE2 A;  3NAU A;  4AYB A;  4ZZL A;  1ZLJ A;  3WOD F;  2J5O A;  1ZGA A;  1QO0 D;  5HVQ C;  2GA1 A;  4W1U A;  1SC7 A;  2P8T A;  3L2C A;  4J19 A;  2DA7 A;  2R5Y A;  4MEX F;  5IP7 J;  1KU2 A;  4KIS A;  2VI6 A;  3SJM A;  1XC5 A;  3FZV A;  1TT5 B;  1YX5 A;  1EV7 A;  3KYD B;  1MBF A;  4PJN A;  2EZH A;  4GGG A;  3HOW J;  4A6E A;  4Y17 A;  4BKX A;  2Q2E A;  3L9F A;  4HNT A;  4O3M A;  1CQT A;  3HPG A;  2WA0 A;  1PYV A;  2KIS A;  2RN7 A;  3BJ6 A;  1FP1 D;  1LNW A;  5CKT A;  4RBO A;  3BZC A;  1MND A;  2HDW A;  5J4Y A;  2CO5 A;  1FTZ A;  3O8H A;  4AC0 A;  3I71 A;  4ZZD A;  3DEW A;  3M8F A;  2LH9 A;  3K9T A;  1I6X A;  4IL6 C;  4RS8 A;  2Y75 A;  2NRA C;  1MMS A;  2MH2 A;  1TWH J;  1TQM A;  1QVU A;  2BHY A;  1STZ A;  4LK1 F;  4B09 A;  4CSW A;  4CYD A;  4EM2 A;  4RA2 A;  2X51 A;  4OIP F;  2DDA A;  5IOY A;  1OCZ H;  2IGM A;  3OYF A;  2TCT A;  5JLX A;  2FX0 A;  2OC6 A;  1V55 H;  1TZL A;  1JJ8 C;  4I6Z A;  2WAQ A;  5GP9 A;  2LD5 A;  2XKO A;  2K40 A;  1HA8 A;  3HOS A;  2CGP A;  1LDD A;  5LD2 C;  3RKQ A;  1XS9 A;  2CV1 A;  4MTE A;  3I4M J;  1UHS A;  2H1K A;  4FX0 A;  4CYC A;  2CQK A;  2HPM A;  5KAI C;  3OR2 C;  1ETY A;  3VSK A;  2Y0M A;  3L1P A;  3RYR A;  1I3A A;  2AQF A;  3DKW A;  1U9O A;  4RAZ A;  1IZ1 A;  1IO2 A;  3ZQ7 A;  4XLA A;  4UXN A;  4XRF A;  4DZP A;  3TOB A;  2ZNZ A;  3ABM H;  3QOE A;  2IGO A;  1Z6R A;  1HXD A;  2WV0 A;  1WJF A;  5EZH A;  4CCK A;  3J7Z I;  3WGH A;  2HKX A;  1NHA A;  4A3G J;  3KPH A;  3ISP A;  2QWW A;  1IXC A;  4Q4Z F;  4U0W A;  5C4X J;  2XB5 A;  3GEZ A;  1O3Q A;  3GFL A;  2QCO A;  1SD4 A;  3O3K A;  4OAZ A;  1QZZ A;  3IHU A;  3CUO A;  3K10 A;  4XLH A;  1XMA A;  3CJQ B;  1H89 C;  3BQY A;  2E1C A;  4F3Q A;  5ILU A;  3M1E A;  3CC7 I;  1KGS A;  2RC4 A;  3G73 A;  2QSH X;  2TDX A;  4DYC A;  3OYI A;  2IP2 A;  4EJV A;  2EIL H;  2M45 A;  2JMW A;  5D8K B;  2VJ5 A;  3E6M A;  1YS6 A;  2A61 A;  2V9V A;  4NC6 A;  2KIQ A;  4AID A;  2EA2 A;  1OYY A;  3F72 A;  2KT0 A;  2OA4 A;  5J8F A;  2FJ1 A;  3OYD A;  1O57 A;  4F92 B;  4H0E A;  2EQR A;  2HKO A;  1MNE A;  4RAG A;  3WGG A;  3LSI A;  4KIC A;  2CG4 A;  4B48 A;  4BY1 J;  1GVD A;  2DT5 A;  5FGM A;  1UB9 A;  5LGU A;  3T5X A;  2BHZ A;  4RB2 C;  2LNB A;  3GYH X;  4C9Y A;  1K78 A;  5J40 A;  5EG0 B;  2R5Z B;  2BV6 A;  3CCJ I;  3P7N A;  3VOE A;  4FHT A;  5D4R A;  3WG9 A;  4BQA A;  3GLX A;  2XPW A;  1FOK A;  3IL2 A;  4V19 K;  1X1D A;  5A2Q K;  2VAS A;  1BOB A;  2RNG A;  2V1X A;  1RZ4 A;  4K2E A;  2FD5 A;  1QHH D;  1S7O A;  4KIB A;  2V1U A;  4G7H F;  5BNG A;  1DU0 A;  3RCO A;  3DPU A;  2FBH A;  3IP4 B;  3LSJ A;  4DBR A;  1VI0 A;  4KT5 C;  1XGS A;  3BTC A;  2R7F A;  1BI2 A;  4EJO A;  2LBF A;  4YFK F;  2R0Q C;  1QPI A;  5DM7 F;  3LA3 A;  2W84 A;  4IHW A;  3LQR A;  4QIW N;  2V1D A;  1R58 A;  3FIS A;  3CCE I;  2FNP A;  4UUS A;  4P96 A;  3H5N A;  3DLL F;  1OR7 C;  4BEH B;  2CU7 A;  3REO A;  4BHB A;  1TLH B;  3HOX J;  1TL8 A;  2H8W A;  3ZQF A;  2XVC A;  3PFY A;  5L3C A;  5CVU A;  2KIU A;  5TIS C;  3HSF A;  5EEA A;  2K3P A;  2FBK A;  2R7Z J;  2QF7 A;  1E17 A;  2Z2S B;  1GT0 C;  3QPH A;  3I55 I;  2P7C B;  3BT9 A;  3CQZ J;  4NQW A;  2GXB A;  2BOL A;  2W85 A;  2MD0 A;  4BE0 A;  1HDP A;  2K9Q A;  4CGZ A;  4ENN A;  1EH7 A;  2RAE A;  4BJ5 C;  2O8K A;  3V8K A;  3G4S I;  1DPR A;  1Z1D A;  4KA4 A;  1TWG J;  2UXX A;  2HI3 A;  3HHG A;  1VQ6 I;  1GVJ A;  2ECB A;  3ROU A;  1X1A A;  4WWC A;  1YO5 C;  5LHH A;  1G6N A;  4CHU A;  1D1C A;  3DLA A;  3JAM Z;  4N9H A;  2KFD A;  5A2Q Z;  4BU2 A;  5FD6 A;  3OSF A;  2DPD A;  1RPW A;  2IRF G;  4BNC A;  1SAU A;  1P92 A;  3FXL A;  3OS1 A;  3L09 A;  5IT9 Z;  1WVR A;  2VL8 A;  3MEX A;  5F6F A;  2DTR A;  1Z0X A;  3AL0 C;  2VPR A;  1O7L A;  4G94 A;  2STW A;  1YJ9 I;  3JTG A;  1RET A;  3IH4 A;  3DKX A;  2XSD C;  5F1J A;  1Z77 A;  1OIS A;  2F5V A;  2HQR A;  2JK3 A;  2D1V A;  3FKI J;  1PP7 U;  2IA1 A;  2DOE A;  2DU9 A;  3W6J B;  2NVX J;  3K4J A;  4HQE A;  5DD4 A;  2GWR A;  3EQL F;  4B3X A;  4IRH A;  1S8N A;  2FE3 A;  2ZJ2 A;  2F5D A;  4LG3 A;  3P5J A;  2XRO A;  1C0W A;  1Q1H A;  4N4O B;  2P81 A;  4LIU A;  3KP7 A;  4Y4R A;  1IXR C;  3JW4 A;  1BW6 A;  2XPV A;  1EH8 A;  2DN0 A;  1AOY A;  2XSJ C;  3GWZ A;  3K7A J;  4H4K C;  1WJA A;  1TQI A;  1JUS A;  2XPU A;  3G71 I;  2YU9 J;  3CC2 I;  2ME0 A;  3VYR B;  2DMP A;  5KCM A;  2A6E F;  3GBG A;  1T6S A;  1ZQ3 P;  2MH9 A;  1Y0N A;  3QU3 A;  4FAS D;  1R1T A;  3LAP A;  4UY8 I;  1WWX A;  4A3C J;  4G6T B;  1F1Z A;  3LQQ A;  5GPC A;  3IWF A;  4JOM A;  3BRO A;  5ICC A;  3A02 A;  3CJR B;  4BDY A;  3HRS A;  2B0L A;  2VOO A;  2ZCW A;  3S1Q J;  4PSW A;  5HNF A;  4M3B A;  2VBZ A;  1BR2 A;  3NRV A;  5L3D A;  2QBY A;  3FHN A;  3M8E A;  3WTX C;  4M6Y A;  4EGY A;  3J7A O;  4XLC A;  2NVU B;  4M72 A;  2X1D A;  3MKY B;  2ELH A;  2DMT A;  2EJR A;  3FBI B;  4XOT A;  1LEB A;  2E1N A;  2DA3 A;  2JSC A;  1ORK A;  1T98 A;  2Z5U A;  5CQG A;  4HA8 A;  1TWF J;  5FKK A;  3NWT A;  2IPQ X;  2K9M A;  3WHB A;  1S72 I;  2VB6 A;  3ZQI A;  5E17 F;  5FJ8 J;  5ILS A;  3D5L A;  5D4S A;  5HLI A;  2HOE A;  2XGX A;  3OIO A;  3EDP A;  4IHV A;  1MBH A;  2G7H A;  2H1L A;  2L02 A;  4U88 A;  2GQQ A;  4ZYH A;  2BY2 A;  4XLN F;  2WC2 A;  2IVM A;  4AYB N;  2R3S A;  4ZC3 A;  2KPM A;  3CDL A;  3V8L A;  3S2H J;  2Y31 A;  3WTW C;  3GTO J;  5IP9 J;  4WCG A;  3QPL A;  2JQ7 A;  2F4I A;  2K3F A;  2QYO A;  4MQV A;  3RPU D;  1F36 A;  5LGT A;  3ZMV A;  4IO9 F;  3S3O A;  4FCY A;  2K7L A;  2VKH A;  2WBM A;  2HWV A;  2CFO A;  4U0Y A;  5LEK A;  3V7R A;  4BJ6 C;  4A5N A;  2AQE A;  1WI9 A;  1JGS A;  2NYX A;  2QKM B;  4X6A J;  4Y3O A;  2VKD A;  4Y33 A;  9ANT A;  2HQ5 A;  5LRR A;  2DO7 A;  2RKH A;  1R22 A;  3L2V A;  5FB2 A;  4DW6 A;  3RPU A;  1U6G A;  4F55 A;  4HPQ A;  2XKP A;  3KP2 A;  2DXI A;  3DEE A;  1ZG3 A;  2KLO A;  3W6V A;  4OOI A;  2XF5 A;  5J3L A;  5K5Q A;  5EDN A;  1ZR4 A;  1MDM A;  3BJA A;  1IRZ A;  2K5C A;  2AHQ A;  1YJW I;  4IPA A;  1XGM A;  1HSJ A;  1KA8 A;  2F4M B;  2I8D A;  4G12 A;  5HDN A;  4BQO A;  3BR1 A;  1W5S A;  1R23 A;  1J59 A;  4UV8 A;  4PK4 A;  2CQQ A;  1WGX A;  2W7N A;  1FIP A;  3V4G A;  5DYM A;  3WTV C;  2KIM A;  4KYW A;  3JCU C;  2ELJ A;  2WAQ N;  2DAO A;  2XUB A;  2VBX A;  1OJL A;  5ILV A;  4RGR A;  1RI7 A;  5CVR A;  2G7U A;  4BDZ A;  3GCM A;  4DJA A;  5E79 C;  1AKH B;  4I98 B;  1R4M B;  1RES A;  2ZFU A;  3IWZ A;  3FXK A;  3F6V A;  2FXA A;  4E7Z A;  2KZG A;  3GLL A;  3DP7 A;  3OS0 A;  4F93 B;  3PIO F;  1OKR A;  4FIS A;  1WJB A;  1U78 A;  5L3F A;  2PQ8 A;  2QQA A;  1G4D A;  2HNH A;  2W24 A;  4P55 A;  3CES A;  3ECO A;  4WXC A;  1FOY A;  4HQM A;  4PSX A;  1S7E A;  2OAZ A;  2ID6 A;  3GVA A;  4MIM A;  3BDD A;  3R6S A;  4P5O A;  2L9N A;  1FWZ A;  2A3S A;  2R4G A;  4S0H B;  3J80 K;  1E3P A;  3C1D A;  2LOO A;  5EGO A;  4QLC U;  4A3B J;  1Z05 A;  3HOT A;  4CIC A;  1PUF B;  4OMY A;  2QEN A;  4LJZ F;  2COM A;  2GIZ A;  2CS3 A;  2HU9 A;  4PFO A;  2K9L A;  2GZW A;  2Z99 A;  4RB0 A;  5ICG A;  2R7S A;  1WH7 A;  4PJM A;  1Z7U A;  3MWM A;  4M73 A;  5E3O A;  1VQ7 I;  4LOC A;  4FT8 A;  2A5Y B;  2OZ6 A;  3HOZ J;  2M8E A;  1RIO H;  1JHH A;  4R8H A;  2VN2 A;  1BI3 A;  1TNS A;  2KMU A;  4HW0 A;  5FLM J;  3CMM A;  1UHW A;  4HV6 A;  1W0U A;  1WFX A;  1P9Q C;  4XBF A;  3KX2 A;  3A0B C;  4BE1 A;  4XR6 A;  2L3D A;  3JRE A;  3GX4 X;  2CSO A;  1JGG A;  2L54 A;  4JX5 A;  5FFX A;  4XIC A;  4Q5S F;  1XSV A;  2JPB A;  2IT0 A;  5D5U B;  4L9V A;  3TP0 A;  4HF2 A;  4O6J A;  1ETQ A;  1XPX A;  2DTZ A;  5EF6 A;  4KN7 X;  5BS6 A;  3CCL I;  4XRS A;  2X6W A;  4ASN A;  3ABT A;  5K7F A;  1YRN A;  3QP6 A;  3S93 A;  4RLQ A;  2ZME A;  5FO5 A;  1CF7 A;  1JTX A;  3M3Y J;  4OIN F;  2ZC2 A;  2JA5 J;  1FX7 A;  3MQ0 A;  2BY3 A;  2GOX B;  1P2F A;  3MFK A;  3IKT A;  4L0Z B;  2FMY A;  4GCV A;  4EMS A;  1UFM A;  3GTL J;  1WH5 A;  2EZL A;  3C7J A;  3HZJ A;  4AD9 A;  1YW7 A;  2K02 A;  1X1P A;  4A6D A;  3LA7 A;  2JRT A;  2DFE A;  3VYT B;  3HYI A;  3BC8 A;  3HDD A;  4YEL A;  2HEO A;  3TO6 A;  2HQA A;  2W48 A;  2EA4 A;  1SAX A;  1X2M A;  4R1H A;  3J80 Z;  3BR2 A;  2OQG A;  1A35 A;  4IEJ A;  4L9N A;  2Y48 A;  2E35 A;  3A2K A;  1GV5 A;  3RJP A;  3TED A;  2FQ3 A;  3ABK H;  2XHK A;  5FKO A;  2W4S A;  3FKJ A;  2D5V A;  4B4C A;  2L7M P;  1OYI A;  2WAD A;  2DMU A;  2ZSI B;  3K4L A;  4XRS G;  1K83 J;  3Q0U A;  5E8G A;  3T1B A;  1N77 A;  4PJJ A;  2JVH A;  1W0T A;  2XRN A;  1IN5 A;  3R60 A;  4BE2 A;  1NK2 P;  3FX3 A;  1E3O C;  4AVP A;  2HTJ A;  4UB6 C;  1U5T B;  1UZC A;  1BIB A;  1Y8R B;  2K9S A;  1K4S A;  4I2O A;  4A3D J;  1SAN A;  3QOP A;  2EWN A;  2CUZ A;  2LF7 A;  2P6T A;  3FF5 A;  2IBD A;  1IRF A;  4IVN A;  5HS8 A;  3WTT C;  3OR1 C;  2QKL B;  2EZK A;  2K27 A;  1K6Y A;  2MD5 A;  5GTI C;  4XRM A;  3HKZ A;  1X4P A;  2JWT A;  3HSE A;  3ZQL A;  1W7P D;  3VOD A;  2R7X A;  3DTK A;  4D7M A;  2L2O A;  3BPV A;  4ZDL A;  2P6S A;  2EFW A;  1R36 A;  1J5Y A;  4YFX F;  2G9W A;  3U21 A;  3A01 B;  5K5O A;  2VOP A;  5BPD A;  1RRJ A;  1D5V A;  1GDT A;  3ZQH A;  1G3T A;  2ECC A;  5K5R A;  1QNT A;  2OV7 A;  4WK8 F;  4OIO F;  4IF4 A;  2HYG D;  3BTI A;  3ZGK A;  1R49 A;  1VQ9 I;  1YQA A;  2D45 A;  2B9S A;  1REP C;  4M9X A;  2JVG A;  4XNF A;  2JTV A;  5EYR A;  2M5W A;  1R5H A;  2BXZ A;  1OCR H;  4F7Z A;  1HF0 A;  1SD5 A;  1GV2 A;  3ZMZ A;  2MYS A;  2Y9Z A;  3OWT A;  3S1M J;  1UEL B;  4I99 C;  4EAT A;  1FEX A;  2NVY J;  4G9Y A;  2OCC H;  5E1X A;  2LVS A;  4AVZ A;  4QWQ A;  1KON A;  3K4M A;  1NK3 P;  2ZME C;  1MMA A;  1YW9 A;  3ZQG A;  3ZMT A;  3GTG J;  3ERM A;  3CCQ I;  3CCU I;  1B72 A;  3R61 A;  4D1Q A;  3E5X A;  1IN4 A;  3PM1 A;  4Z6Y A;  5LFA A;  3N05 A;  1ZAO A;  1BI1 A;  4DIQ A;  3HC7 A;  1MJ9 A;  2BW3 B;  3CF5 F;  2XRL A;  5IPA A;  3HHH A;  1YX3 A;  2K4B A;  3EUA A;  1ZTR A;  3KZI C;  2DMN A;  2JSP A;  3U1K A;  4A93 J;  2YU3 A;  4Y52 J;  3FMQ A;  4NDL A;  1XMK A;  3Q0W A;  4FTH A;  1FYL A;  1UG2 A;  3WTS C;  1VQM I;  3V7S A;  3K70 C;  5K7H A;  2W82 A;  4LFU A;  2LLK A;  2MFZ A;  3MZ8 A;  1UG0 A;  2KP6 A;  3KEY A;  4XQF A;  5H2F C;  1TWC J;  2JA7 J;  1G3Y A;  5E8I A;  3H5R A;  1VTN C;  2FU4 A;  2OD5 A;  2CFX A;  2ZO4 A;  2JA8 J;  2P5K A;  4M9Z A;  5M3M J;  3GZ5 A;  2LTP A;  2VE8 A;  3DTI A;  4C3I J;  3ZCO A;  2E71 A;  2ACJ A;  1MGT A;  2I10 A;  3TW7 A;  1MW7 A;  4DGW B;  3NEU A;  3PQJ A;  3PUB A;  3RPQ A;  1V54 H;  1MMG A;  4HSR A;  4LLL A;  1B8I A;  1N75 A;  1A6I A;  2LKS A;  2YR2 A;  3DQV C;  3KYC B;  5F0F A;  2NVQ J;  2MA3 A;  1E0E A;  1GLN A;  3PQK A;  1WSU A;  3ZPL A;  2M30 A;  4BBS J;  5LGN A;  4BY7 J;  3CCV I;  1OCT C;  4YII A;  1T38 A;  2LYC A;  2ICW G;  1OR7 A;  2R7O A;  4PDK A;  3IRQ A;  3KP5 A;  5IT3 A;  4DQ2 A;  1XN7 A;  3CUQ A;  5JHU A;  1TQP A;  2WAF A;  1H8A C;  5HS9 A;  1IDZ A;  1JE8 A;  2JA2 A;  1N78 A;  1F9N A;  1HKS A;  1BJA A;  3SDB A;  3CCR I;  3KLN A;  3F3X A;  1H9T A;  2AXL A;  3K0L A;  2DA5 A;  2X6Y A;  3I59 B;  1P7J A;  1X2N A;  2XAF A;  3I58 A;  4D5F A;  1Q1V A;  5HNH A;  1WRJ A;  4LG0 A;  4WXD A;  3K1N A;  2QSF X;  3L2W A;  2MSY A;  2Q1Z B;  2XB0 X;  4IHS A;  1XGO A;  2VJ4 A;  2EFQ A;  3WG7 H;  2RV8 A;  4AIJ A;  2H6B A;  4EJT A;  4RMN A;  3TMO A;  4CA0 A;  4EJU A;  2VIX A;  4UV9 A;  3DXJ F;  4ZYE A;  4G7Z F;  4G7O F;  4I02 A;  4XKV A;  3OV8 A;  3IKV A;  2XC7 A;  1SFX A;  2K4J A;  2XF6 A;  3FMR A;  2HOA A;  1OCC H;  2E2I J;  3F21 A;  3E6D A;  2JUG A;  5J4V A;  3EYY A;  2X85 A;  2BYV E;  2B7E A;  5EEG A;  3CD6 I;  4XM3 A;  2UXN A;  4HOB A;  2R5Z A;  3RTR A;  4EQQ A;  2D2W A;  2QQ9 A;  4CDG A;  4C2T A;  3WTU C;  3E3V A;  5F0C A;  2HFH A;  1EF4 A;  5DCM A;  4YIF A;  1ZYR F;  4BAC A;  3CMA I;  2CWE A;  1DQU A;  2WWY A;  2VOD A;  1GXP A;  4ENM A;  2O3F A;  3I9V 2;  1R7J A;  3D5S C;  3VEP A;  3K1P A;  4EM0 B;  2JPC A;  2R7D A;  2XAS A;  2A5W A;  3DBL B;  3ZR8 X;  1CGP A;  2JT1 A;  3BP8 A;  4EEF G;  5D6E A;  3CMY A;  5IYD J;  1LQ1 A;  3S15 J;  4P9U A;  1P7I A;  2LF8 A;  2A07 F;  2Y9Y A;  4MNU A;  4FX4 A;  2PN6 A;  1FPQ A;  2UUZ A;  2DA4 A;  3AG4 H;  1YIT I;  1ODD A;  5L3G A;  1XB4 A;  1KU9 A;  2PMH A;  3PJR A;  3CUQ C;  3K2Z A;  1ETW A;  5DTD A;  3V8J A;  3GZ6 A;  4G6D A;  3BLY A;  4WXH A;  2V79 A;  3DU6 A;  1W5T A;  4BS9 A;  5DD8 A;  3GTJ J;  2JRM A;  3M1C A;  2PMU A;  4HDV A;  2RQP A;  1Y1V J;  1Y6I A;  1D1A A;  2DFI A;  3E97 A;  3M07 A;  4UUS B;  2DA6 A;  5E3N A;  2TRT A;  1QU3 A;  3IH3 A;  4A0Y A;  2Y69 H;  4B1R A;  3ESW B;  1T39 A;  3L7W A;  2DCE A;  5CJ9 A;  4KMU X;  3FXR A;  3ZMD A;  2EPF A;  5HLG A;  5E18 F;  4UUT A;  1L0O C;  2LKX A;  5D8L B;  1LB2 A;  3KLO A;  1K4T A;  1DGW Y;  1IUY A;  3DKY A;  4E6K G;  2HTS A;  3R0J A;  4NQW B;  2E7X A;  1PUE E;  2L7Z A;  1SVO A;  1QA6 A;  2R92 J;  1LE8 A;  3H9G A;  2YPR A;  1XG1 A;  3TKY A;  5DDG A;  1IXS B;  2DOD A;  2W25 A;  3GFJ A;  1D0Y A;  1ZG5 A;  1RC9 A;  2H09 A;  3MN2 A;  3HOV J;  1JJ6 C;  1MSE C;  1KYW A;  4JK1 X;  2DJI A;  3PSI A;  2LR8 A;  3KET A;  2N8G A;  3O2P E;  1VF9 A;  2VT3 A;  1J75 A;  1RUN A;  2X1C A;  2GM4 A;  3CLQ A;  3DBR B;  2QQ8 A;  4BJT A;  5IP6 A;  4V2G A;  1IV8 A;  2UZK A;  4E70 A;  1I50 J;  2VBW A;  3FBN B;  4E7I A;  3GTK J;  1USS A;  2CYY A;  2ETH A;  4C2U A;  2DK5 A;  3KFW X;  2ZXH A;  1YE9 A;  1H0M A;  3RSN A;  3Q0V A;  4MFD A;  4HNU A;  5FRN A;  3C2B A;  1JHF A;  3WU0 A;  2RRE A;  4NBQ A;  4NNJ A;  2XGD A;  4ENJ A;  3LST A;  4OIR F;  5M5X J;  2KZV A;  4CCL A;  4LMY A;  3J7Y J;  3H3U A;  4HST A;  5JLW A;  1WHU A;  2LP0 A;  3QP5 A;  1DP7 P;  3QRF F;  1VQP I;  5M5Y J;  1HW1 A;  1P4A A;  3DFG A;  3H1C A;  5B1B H;  1ON1 A;  2QLZ A;  4KT6 A;  4ESF A;  1K6O A;  3KP3 A;  2CMP A;  4D0P A;  3KE2 A;  3CCS I;  2L4A A;  4XSX F;  2ZBK A;  2KJC A;  3W3C A;  3H3V K;  3HKZ N;  1OMI A;  5GAH J;  3MZY A;  1FSE A;  1RKW A;  1IUF A;  4ANJ A;  2UV1 A;  2XF7 A;  3T0Y A;  3PNT A;  2B63 J;  3NQO A;  3AFH A;  4M3E A;  3TDZ C;  4L5E A;  4HNV A;  4XN3 A;  2IA0 A;  4Z2Y A;  3T8T A;  4F52 A;  1HST A;  1NH3 A;  3B73 A;  1MBK A;  4OIQ F;  2RNJ A;  1SVL A;  3OMY A;  4KIF A;  1ETK A;  1FBU A;  5CYV A;  3Q5F A;  1GHC A;  2L4M A;  4HX8 A;  2QA4 I;  1X19 A;  2BY1 A;  2ZJR F;  1K61 A;  3QYE A;  2QBY B;  3BG5 A;  4BBR J;  2PMZ A;  5J8C A;  2WB1 A;  1U0J A;  2EV0 A;  3KIO A;  2XDV A;  1Z3X A;  1LFU P;  1YOV B;  2RQQ A;  5KAF C;  3P9C A;  4ESB A;  3G6E I;  1X3W B;  1R9T J;  4IKF A;  3CJT B;  3FM3 A;  4HDU A;  2EB7 A;  4JX6 A;  1MIJ A;  1UCR A;  2M3A A;  4P1W A;  5IOZ A;  3OYC A;  3ASN H;  3C3W A;  3F6O A;  3HUG A;  3CCM I;  1YYV A;  4RAY A;  3G3Z A;  4ZYG A;  2C6Y A;  1E3H A;  2XGC A;  1KQ0 A;  3HOU J;  3O8G A;  1WPK A;  1T95 A;  2VLA A;  2ZJP F;  5J6X A;  1AWC A;  4A0X A;  1LEA A;  5JI6 A;  2PJR B;  1QQI A;  4XKB A;  1Y8Q B;  1ITY A;  3CO6 C;  2AXT C;  2DFF A;  5KNL A;  4YIR X;  2M0M A;  1HC8 A;  1WJ5 A;  2M8G X;  4LLG F;  1JI8 A;  3K69 A;  1HW5 A;  4NC8 A;  4C2M J;  3ECH A;  3EUH A;  3F0C A;  1O7F A;  1P4W A;  4QTR A;  3K4C A;  2UWM A;  1TBX A;  4U87 A;  5FRO A;  2KHM A;  2F5E A;  3OS2 A;  2Z33 A;  4DZJ A;  2GA2 A;  2OQR A;  2MC3 A;  4AWX B;  1MH3 A;  3HBL A;  4Q47 A;  2CQX A;  1D8K A;  4M71 A;  3JRF A;  3F23 A;  4ZDP A;  5J47 A;  1K79 A;  1QBJ A;  1AA7 A;  2Z3Y A;  3FXO A;  2VKV A;  4RGS A;  3ZXS A;  4BQN A;  3HIF A;  3HB9 A;  4XKW A;  3H36 A;  3WU2 C;  1AKH A;  3MZH A;  1V3F A;  2HYJ A;  3D5R C;  4IXA A;  1J9I A;  3RKW A;  3LSP A;  2W00 A;  3QOD A;  3BY6 A;  4I09 A;  3SEQ A;  4UHT A;  4OMZ A;  1NG7 A;  4MO7 A;  3VFZ A;  5F64 A;  3CC4 I;  3VWB A;  2HPI A;  2M7B A;  3MKL A;  2JJ7 A;  1XTA A;  1JKO C;  1A31 A;  2NAZ A;  2F5F A;  3P9K A;  3U9G A;  2ESN A;  4HBL A;  1YIO A;  2WY8 Q;  5F0H A;  2QSG X;  4CZC A;  1TTY A;  1Z21 A;  4IRI A;  1JT6 A;  3BPX A;  3K4K A;  1POG A;  4MQ9 F;  2HVQ A;  3JRI A;  3S2W A;  3OYN A;  2DQL A;  2LRE A;  1DU6 A;  2LG4 A;  2DBB A;  5D5V B;  4L9T A;  4XL9 A;  5LHG A;  3L2U A;  1YTY A;  3V7C A;  2IS1 A;  1S7A A;  4UVC A;  3ZQQ A;  3RKX A;  1R5G A;  1S29 A;  1B6A A;  4RM2 A;  5J1R A;  3TO7 A;  2HXO A;  2XAU A;  4FET A;  5HOD A;  2GAU A;  4A12 A;  4E7K A;  2ISY A;  1IDY A;  1OLT A;  5BQT A;  2VJJ A;  2DA1 A;  1U8B A;  4Q48 A;  4BXF A;  4E7H A;  1MBJ A;  1VZ0 A;  4IQ4 A;  3HTS B;  2MAB A;  1D1B A;  2F48 A;  3BCB A;  2JA6 J;  2V6C A;  2XAJ A;  3ZOB A;  1VND A;  3BG3 A;  4FE4 A;  2M34 A;  1H88 C;  3GTP J;  4KUM A;  4UUV A;  2BY0 A;  2BVM A;  4JQF A;  3TW6 A;  1T0F A;  2DT7 B;  3VPR A;  4Y13 A;  2IEK A;  4KIT B;  1I3Q J;  5HLT A;  1BBY A;  1W4M A;  3LL7 A;  4KNY A;  1FLI A;  2M87 A;  3DCF A;  2X0L A;  4HG2 A;  4HV5 A;  1T56 A;  2KL4 A;  4J01 A;  2HS5 A;  2IXS A;  1SFU A;  4RB1 A;  5HLH A;  3K70 D;  1R4N B;  1R1V A;  2P4W A;  1FY7 A;  4C30 A;  3EUH C;  2LMD A;  1RR8 C;  2AO9 A;  3JRG A;  1ETV A;  2QQB A;  3ZMS A;  1X3U A;  3BG7 A;  3LMM A;  3WTY C;  2COB A;  2ID3 A;  3AKZ A;  2Y2Z A;  4M3D A;  3BR5 A;  1XCV A;  3QYF A;  3I54 A;  1T08 B;  4II3 A;  4CH7 A;  5AIQ A;  4PZJ A;  2JZY A;  4X1E A;  2EIM H;  5DEQ A;  1YRN B;  4L18 B;  2O61 A;  2ZME B;  1F5T A;  3PIP F;  1NTC A;  3O6B B;  5FLX K;  1ENH A;  2CUF A;  5CLS A;  2VQL A;  2QEX I;  3HM5 A;  2BZT A;  3Q3S A;  3BCA A;  1IF1 A;  3B6C A;  1W1W E;  3QPS A;  3SZG A;  2A05 A;  4XMY A;  3I4P A;  1YI2 I;  2XGE A;  2D1H A;  5BMZ A;  2DJN A;  3Q9S A;  3GO5 A;  1QRY A;  2O03 A;  4FQG A;  3SZT A;  3HOY J;  2XAH A;  1SVM A;  4QPQ A;  3HRU A;  3UR3 C;  2P7V B;  4OAY A;  4KMF A;  1ZLK A;  4EGZ A;  1IJW C;  3Q9V A;  1DUX C;  3F9K A;  1U5T A;  5GTH C;  3FXU A;  2DOA A;  3BTJ A;  3I56 I;  4A3K J;  4ZYA A;  1BW5 A;  2NS0 A;  1LVA A;  2BBY A;  4NB5 A;  4HLY A;  4OWR B;  1OPC A;  3VYU B;  1LDK B;  3X2Q H;  5HS7 A;  2ZKZ A;  3OYG A;  2OCE A;  3C2H A;  2PFB A;  5FKL A;  1MJA A;  1LFP A;  3MKW B;  3J7A Y;  3SHF A;  2E7W A;  2NNY A;  1YS7 A;  2OJE D;  1VQN I;  2NS8 A;  3A01 A;  5F04 A;  4JP0 A;  1EH6 A;  3BZ6 A;  3H5A A;  1JKQ C;  3ZQC A;  1SD7 A;  2CH0 A;  3CDI A;  4ITV A;  3BG6 A;  3FDY A;  1ZKG A;  2MBF A;  3F8M A;  3AG3 H;  2R7R A;  3SYT A;  5ICF A;  3CO7 C;  4IOA F;  1G3S A;  3DPT A;  5J1Y A;  1HQC A;  2MGQ A;  2E1M C;  3H35 A;  4PGH A;  2E5N A;  2W57 A;  3E5Q A;  4JYK A;  1J2X A;  2VKE A;  5C3E J;  1S6L A;  4KIG A;  5FLX Z;  3FWE A;  1SFE A;  2DMQ A;  4R79 A;  2LDU A;  3S2D J;  2M9H A;  3EUK L;  2DDB A;  1T0F C;  1BC7 C;  3FMS A;  4JX4 A;  3CZ6 A;  2Y0S A;  3CLO A;  1BL0 A;  2OTL I;  3MKZ A;  1N25 A;  1XDS A;  2EIN H;  1ZGW A;  3W2V A;  3PL8 A;  2MLG A;  1R71 A;  3BZK A;  2VJI A;  4E7L A;  1ETX A;  1W7P B;  2V4J C;  1LKX A;  2XAQ A;  4AU7 A;  3M7G A;  3N97 A;  3SEZ A;  2BVL A;  3OY9 A;  5D6F A;  1R1U A;  1WCM J;  5FKM A;  2K9N A;  2FUG 2; 
#chains in the Genus database with same CATH homology
 3DPL C;  1YLF A;  4MEY F;  2OU2 A;  1BN5 A;  5AON A;  2DPU A;  1Y0U A;  4XLP F;  4P9F A;  1JXS A;  3KEO A;  1I27 A;  2VBY A;  2EK5 A;  1KQ9 A;  2NNN A;  3M9A A;  2ZXJ A;  3CDH A;  3I0T A;  2STT A;  1ZH5 A;  1BC8 C;  2QUF A;  3ML6 A;  3E6B A;  3TDU C;  2A69 F;  4A0Z A;  6PAX A;  1U5T C;  1LDJ A;  3KZY A;  1QZY A;  1B4A A;  4A2U A;  1TW2 A;  1MKM A;  3TOA A;  1ZRC A;  4TV7 A;  5H6Q A;  3GF2 A;  4O5V A;  1FBS A;  1XDU A;  2O8X A;  3L00 A;  1D3Y A;  2BEO A;  2O0Y A;  2HR3 A;  4U0V A;  3SZP A;  4HAM A;  2FRH A;  5E1Z B;  3I59 A;  2IA2 A;  4IHT A;  2RGV A;  3CUQ B;  1FC3 A;  2ADU A;  1QGP A;  3ELK A;  2Z9O A;  4L0Y B;  4AIH A;  1S3J A;  4MGR A;  4BHC A;  3GFM A;  1ZG1 A;  2YX4 A;  4ETS A;  5L3B A;  1A04 A;  3DEU A;  4KN4 X;  2QZ8 A;  5KK1 A;  3U2R A;  4LG0 B;  3GFI A;  1ZAR A;  1U2W A;  2HZT A;  2DI3 A;  3MCZ A;  2P5L C;  3H92 A;  2CW0 F;  3MAJ A;  2EV6 A;  3KZZ A;  4EM1 A;  4ESJ A;  4GYI A;  4LK0 F;  3RIR A;  3GUD A;  2DQR A;  1O3R A;  1Z9C A;  1ZRF A;  1K7A A;  1H9G A;  2ISZ A;  1BIA A;  1K78 B;  4S05 A;  2HGC A;  2A68 F;  1XGN A;  3KP4 A;  5DCM B;  1J0R A;  4LB6 B;  3JAM K;  4HYE A;  2ZFW A;  3LWF A;  3R4K A;  1R00 A;  1E2X A;  4I0A A;  2DK8 A;  2FNA A;  2WTE A;  3F8F A;  4I0B A;  2J5P A;  2L01 A;  5HOO A;  3JSO A;  1FYK A;  5IT9 K;  4G8X A;  1ZRE A;  2MLK A;  1FP2 A;  5JVT A;  3T8R A;  1MD0 A;  1HKT A;  5DUI A;  5CVI A;  1RNL A;  2X4H A;  2PG4 A;  2GXG A;  4AIK A;  5EEH A;  4LD5 A;  1BI0 A;  2RDP A;  4M6X A;  5FFZ A;  4XSZ F;  2AS5 F;  1TNT A;  3C18 A;  3E5U A;  1IW7 F;  5JFR A;  1FNN A;  2EFN A;  2DW4 A;  3HRT A;  2FF4 A;  3ZP5 A;  1BM9 A;  2FA5 A;  4EVI A;  4L5J A;  2PLY A;  4HF1 A;  3TGN A;  2LSO A;  1J9I A;  2KKO A;  3D0S A;  3K1M A;  4MEX F;  3KP6 A;  3QU6 A;  3I64 A;  1ULY A;  3F8N A;  1SMY F;  3W6K B;  1IN7 A;  1KQ8 A;  3HRM A;  1V4R A;  2IJL A;  2P5V A;  2PEX A;  2F5C A;  4BAY A;  2H27 A;  3N4M A;  2EV5 A;  5D5W B;  4KFC A;  1QPM A;  4U7D A;  2K86 A;  3FM5 A;  5LHI A;  2KRF A;  1G3W A;  1UHM A;  5K1Y A;  1FYM A;  4LB5 A;  1XSD A;  3LFK A;  3ULQ B;  3R0A A;  3WU1 B;  1DPU A;  3OOP A;  4G6Q A;  4I01 A;  1PP8 F;  2A6H F;  1BOA A;  3HSR A;  5CVJ A;  3ABU A;  1I1G A;  5H20 A;  5E20 A;  5ICE A;  4UVB A;  5LLQ A;  3H3Z A;  4UNO A;  1T2K A;  3TO9 A;  1ZN2 A;  2Q0O A;  2PBI A;  3BOQ A;  1D8J A;  1MZB A;  3ZN0 A;  1ON2 A;  3AAF A;  1O3S A;  1B59 A;  2FSW A;  4RB3 C;  4CZZ A;  2HDC A;  2F2E A;  4IRG A;  4BYY A;  1SMT A;  3LA2 A;  1FT9 A;  1I1S A;  5ED4 A;  5TRD A;  1WKM A;  2XIG A;  4A5M A;  1B1B A;  4PGG A;  3VB2 A;  3QPT A;  5DV5 A;  2M1B A;  2DLL A;  4WF2 A;  5LRS A;  4M74 A;  2QVO A;  1ONV A;  5H6R A;  3IC7 A;  2H94 A;  1J7K A;  1UST A;  5ERI A;  2EFO A;  4L9J A;  1P4X A;  2RVC A;  1MJB A;  1WQ2 A;  1XD7 A;  3EYI A;  2IW5 A;  4YG2 F;  4IJA A;  4LLN A;  4NHJ A;  1IN8 A;  4RGU A;  2VXZ A;  1O3T A;  2VE9 A;  1IAW A;  3KEQ A;  2FML A;  4MTD A;  2FEZ A;  2VON A;  3P9I A;  1MDM B;  1Z6T A;  4BH9 A;  4I7H A;  5DUK A;  4EJW A;  3COA C;  3F8B A;  5BOX A;  4B8X A;  3FHZ A;  3RKY A;  4HX4 A;  3SXY A;  4JBA A;  3JTH A;  2EFP A;  5F1R A;  3RI4 A;  3SQN A;  2FBI A;  3JSP A;  1ZHF A;  4ZH4 F;  1FBQ A;  3WTZ A;  2PI0 A;  1ZGJ A;  2BE5 F;  2Q8K A;  5LEJ A;  5HDG A;  2FOK A;  4ON0 A;  1ZRD A;  4GO1 A;  4BHP A;  4HX7 A;  2BGC A;  1P6R A;  1FZP B;  1U8R A;  3GW2 A;  3I5U A;  3KCC A;  4Y15 A;  5JR3 A;  5HDK A;  1B9M A;  2YSR A;  1I5Z A;  4LGW A;  1IN6 A;  3DF8 A;  5CVV A;  1F4K A;  4ENK A;  3BWG A;  4N9I A;  4U7B A;  4CO8 A;  3DV8 A;  3RYP A;  5FD5 A;  1XCB A;  4HLX A;  3EET A;  4MHG A;  2ESH A;  4M9S A;  1OYW A;  1RUO A;  3SFZ A;  4CXF A;  3ZN1 A;  4WX9 A;  4EV0 A;  3ZMU A;  2VC0 A;  4DNC A;  1YFH A;  1HW2 A;  2QM3 A;  1CF7 B;  1PDN C;  5E1W A;  3ERE D;  3TQN A;  3F8C A;  3U1D A;  3RDI A;  4HZF A;  1KU3 A;  5L3E A;  3GXO A;  4HF0 A;  3PFI A;  5BPI A;  2LKP A;  1YG2 A;  1SD6 A;  1U3E M;  3J81 K;  4ZYD A;  1HBX G;  1Z91 A;  3I53 A;  1KU7 A;  3BJO A;  3E6C C;  5KVR A;  1YW8 A;  5DCF A;  1LJ9 A;  3FXQ A;  2YX7 A;  4UVA A;  1XSX A;  4S04 A;  2H6C A;  2ZNY A;  3B02 A;  1KYZ A;  3HTU A;  4BXU A;  3CTA A;  5TJJ A;  4GYG A;  4GXO A;  1DDN A;  3F22 A;  1GXQ A;  2XAG A;  3WE3 A;  2HYF A;  2PJP A;  1FSH A;  5LBQ A;  3LAJ A;  2VT2 A;  2GIV A;  4N0B A;  4YFN F;  2OBP A;  4L5I A;  5AIP A;  3CJN A;  1HKQ A;  2VC1 A;  2OZU A;  1B9N A;  3WGI A;  4RGX A;  3IRR A;  1W7P A;  1IRG A;  4KDP A;  2O6G E;  2KIF A;  2KJB A;  3J81 Z;  2HQN A;  2XV4 S;  1L3L A;  5D5X B;  4PCQ A;  1TW3 A;  3QAH A;  4ZZL A;  4OU0 A;  3WE2 A;  1ZLJ A;  3WOD F;  2J5O A;  1ZGA A;  1QO0 D;  5HVQ C;  2GA1 A;  2P8T A;  3L2C A;  1KU2 A;  3FZV A;  1EV7 A;  4GGG A;  4A6E A;  4Y17 A;  2Q2E A;  3L9F A;  4O3M A;  2RN7 A;  3BJ6 A;  1FP1 D;  1LNW A;  2CO5 A;  3I71 A;  4ZZD A;  3M8F A;  3K9T A;  1I6X A;  4RS8 A;  2Y75 A;  2NRA C;  2MH2 A;  1TQM A;  4LK1 F;  1STZ A;  4B09 A;  4EM2 A;  4CYD A;  4OIP F;  2XKO A;  3HOS A;  2CGP A;  1LDD A;  4MTE A;  4FX0 A;  2CQK A;  2Y0M A;  3RYR A;  3DKW A;  4RAZ A;  1IZ1 A;  3ZQ7 A;  4UXN A;  4XRF A;  3TOB A;  2ZNZ A;  1Z6R A;  1HXD A;  2WV0 A;  3WGH A;  2HKX A;  1NHA A;  3ISP A;  2QWW A;  1IXC A;  4Q4Z F;  4U0W A;  3GEZ A;  1O3Q A;  3GFL A;  1SD4 A;  3O3K A;  1QZZ A;  3IHU A;  3CUO A;  1XMA A;  2E1C A;  5ILU A;  3M1E A;  1KGS A;  2RC4 A;  3G73 A;  2TDX A;  2IP2 A;  4EJV A;  2M45 A;  5D8K B;  3E6M A;  1YS6 A;  2A61 A;  2V9V A;  2EA2 A;  1OYY A;  3F72 A;  2OA4 A;  5J8F A;  1O57 A;  4H0E A;  2HKO A;  3WGG A;  4KIC A;  2CG4 A;  2DT5 A;  5FGM A;  1UB9 A;  5LGU A;  3T5X A;  4RB2 C;  2LNB A;  3GYH X;  1K78 A;  2BV6 A;  3P7N A;  3VOE A;  4FHT A;  5D4R A;  3WG9 A;  4BQA A;  3GLX A;  1FOK A;  3IL2 A;  5A2Q K;  2V1X A;  1RZ4 A;  4K2E A;  1S7O A;  4KIB A;  2V1U A;  4G7H F;  2FBH A;  4KT5 C;  1XGS A;  2R7F A;  1BI2 A;  4EJO A;  4YFK F;  3LA3 A;  2W84 A;  3LQR A;  2V1D A;  1R58 A;  2FNP A;  4P96 A;  3REO A;  4BHB A;  1TLH B;  2XVC A;  5L3C A;  5CVU A;  2KIU A;  3HSF A;  2FBK A;  1E17 A;  3QPH A;  2P7C B;  4NQW A;  2GXB A;  2W85 A;  4CGZ A;  4ENN A;  1EH7 A;  3V8K A;  1DPR A;  1Z1D A;  4KA4 A;  2UXX A;  3HHG A;  1GVJ A;  3ROU A;  4WWC A;  1YO5 C;  5LHH A;  1G6N A;  4CHU A;  3JAM Z;  4N9H A;  5A2Q Z;  5FD6 A;  2DPD A;  4BNC A;  2IRF G;  1P92 A;  3L09 A;  5IT9 Z;  3MEX A;  5F6F A;  2DTR A;  1O7L A;  4G94 A;  2STW A;  3JTG A;  2HQR A;  2D1V A;  1PP7 U;  2IA1 A;  2DU9 A;  3W6J B;  4HQE A;  5DD4 A;  2GWR A;  3EQL F;  4IRH A;  1S8N A;  2FE3 A;  2ZJ2 A;  2F5D A;  2XRO A;  1C0W A;  1Q1H A;  3KP7 A;  1IXR C;  3JW4 A;  1EH8 A;  1AOY A;  3GWZ A;  1TQI A;  2A6E F;  1T6S A;  2MH9 A;  3QU3 A;  3LAP A;  1R1T A;  1WWX A;  1F1Z A;  3LQQ A;  3IWF A;  3BRO A;  5ICC A;  3HRS A;  2B0L A;  2VOO A;  2ZCW A;  2VBZ A;  3NRV A;  5L3D A;  2QBY A;  3M8E A;  3WTX C;  4M6Y A;  4EGY A;  3J7A O;  4M72 A;  2ELH A;  2EJR A;  1LEB A;  2E1N A;  2JSC A;  1T98 A;  2Z5U A;  4HA8 A;  2IPQ X;  5E17 F;  5ILS A;  3D5L A;  5D4S A;  5HLI A;  2HOE A;  2XGX A;  3EDP A;  2G7H A;  2L02 A;  4ZYH A;  4U88 A;  2GQQ A;  4XLN F;  2WC2 A;  2IVM A;  2R3S A;  3V8L A;  3WTW C;  4WCG A;  2QYO A;  4MQV A;  5LGT A;  3ZMV A;  2K7L A;  2HWV A;  4U0Y A;  5LEK A;  3V7R A;  4A5N A;  1WI9 A;  1JGS A;  2NYX A;  5LRR A;  2DO7 A;  2RKH A;  1R22 A;  5FB2 A;  3RPU A;  1U6G A;  2XKP A;  3KP2 A;  1ZG3 A;  4OOI A;  1MDM A;  5K5Q A;  3BJA A;  4IPA A;  1XGM A;  1HSJ A;  1KA8 A;  5HDN A;  1W5S A;  1R23 A;  1J59 A;  4UV8 A;  3V4G A;  5DYM A;  3WTV C;  2KIM A;  4KYW A;  2DAO A;  2XUB A;  2VBX A;  5ILV A;  4RGR A;  1RI7 A;  5CVR A;  2G7U A;  4I98 B;  3IWZ A;  3F6V A;  2FXA A;  3DP7 A;  1OKR A;  1U78 A;  5L3F A;  2PQ8 A;  2QQA A;  1G4D A;  2W24 A;  4P55 A;  3ECO A;  4WXC A;  4HQM A;  2OAZ A;  3GVA A;  3BDD A;  3R6S A;  4P5O A;  1FWZ A;  2A3S A;  3J80 K;  3C1D A;  4QLC U;  1Z05 A;  3HOT A;  4CIC A;  4OMY A;  2QEN A;  4LJZ F;  2COM A;  2GZW A;  2Z99 A;  4RB0 A;  5ICG A;  1Z7U A;  3MWM A;  4M73 A;  4FT8 A;  2A5Y B;  2OZ6 A;  2M8E A;  1RIO H;  1JHH A;  4R8H A;  2VN2 A;  1BI3 A;  1TNS A;  4HW0 A;  1UHW A;  4HV6 A;  4XBF A;  2L3D A;  3GX4 X;  2CSO A;  2L54 A;  5FFX A;  4Q5S F;  1XSV A;  2JPB A;  2IT0 A;  5D5U B;  4L9V A;  4HF2 A;  4O6J A;  4KN7 X;  5BS6 A;  4ASN A;  3ABT A;  3QP6 A;  2ZME A;  5FO5 A;  1CF7 A;  4OIN F;  1FX7 A;  3MQ0 A;  3IKT A;  3MFK A;  1P2F A;  4L0Z B;  2FMY A;  4GCV A;  4EMS A;  1UFM A;  3C7J A;  4AD9 A;  1YW7 A;  2K02 A;  4A6D A;  3LA7 A;  2JRT A;  3HYI A;  2HEO A;  3TO6 A;  2EA4 A;  1SAX A;  4R1H A;  3J80 Z;  2OQG A;  4L9N A;  2Y48 A;  3RJP A;  2FQ3 A;  2XHK A;  1OYI A;  5E8G A;  3T1B A;  2XRN A;  1IN5 A;  3R60 A;  3FX3 A;  4AVP A;  2HTJ A;  1U5T B;  1BIB A;  4I2O A;  3QOP A;  2EWN A;  2LF7 A;  2P6T A;  3FF5 A;  1IRF A;  4IVN A;  5HS8 A;  3WTT C;  2K27 A;  2MD5 A;  3HSE A;  1W7P D;  3VOD A;  3BPV A;  2P6S A;  2EFW A;  1R36 A;  1J5Y A;  4YFX F;  2G9W A;  5K5O A;  2VOP A;  5BPD A;  1D5V A;  1G3T A;  5K5R A;  1QNT A;  4WK8 F;  4OIO F;  4IF4 A;  2HYG D;  1YQA A;  2D45 A;  1REP C;  4M9X A;  2JTV A;  2M5W A;  1R5H A;  4F7Z A;  1SD5 A;  3ZMZ A;  4G9Y A;  5E1X A;  4QWQ A;  1YW9 A;  3ZMT A;  3R61 A;  3E5X A;  1IN4 A;  1ZAO A;  1BI1 A;  1MJ9 A;  3HHH A;  2K4B A;  2YU3 A;  3FMQ A;  1XMK A;  1FYL A;  3WTS C;  3V7S A;  4LFU A;  1G3Y A;  5E8I A;  1VTN C;  2FU4 A;  2OD5 A;  2CFX A;  2ZO4 A;  2P5K A;  4M9Z A;  3GZ5 A;  2VE8 A;  2ACJ A;  1MGT A;  3NEU A;  3PQJ A;  3RPQ A;  4LLL A;  2YR2 A;  3DQV C;  2MA3 A;  3PQK A;  1WSU A;  3ZPL A;  2M30 A;  5LGN A;  4YII A;  1T38 A;  1OR7 A;  4PDK A;  3IRQ A;  3KP5 A;  5IT3 A;  4DQ2 A;  1XN7 A;  3CUQ A;  5JHU A;  1TQP A;  5HS9 A;  1JE8 A;  1F9N A;  1HKS A;  1BJA A;  3KLN A;  3F3X A;  1H9T A;  2AXL A;  3K0L A;  3I59 B;  2XAF A;  3I58 A;  1WRJ A;  4LG0 A;  4WXD A;  3K1N A;  4IHS A;  1XGO A;  2EFQ A;  2RV8 A;  4AIJ A;  2H6B A;  4EJT A;  4EJU A;  4UV9 A;  3DXJ F;  4ZYE A;  4G7Z F;  4G7O F;  4I02 A;  3OV8 A;  3IKV A;  1SFX A;  2K4J A;  3FMR A;  3F21 A;  3E6D A;  3EYY A;  2BYV E;  5EEG A;  2UXN A;  4HOB A;  3RTR A;  4EQQ A;  2D2W A;  2QQ9 A;  4CDG A;  3WTU C;  3E3V A;  2HFH A;  5DCM A;  4YIF A;  1ZYR F;  2CWE A;  2WWY A;  2VOD A;  1GXP A;  4ENM A;  2O3F A;  1R7J A;  3VEP A;  3K1P A;  4EM0 B;  2JPC A;  2R7D A;  2XAS A;  1CGP A;  2JT1 A;  3BP8 A;  5D6E A;  1LQ1 A;  4P9U A;  2LF8 A;  2A07 F;  4MNU A;  4FX4 A;  2PN6 A;  1FPQ A;  1ODD A;  5L3G A;  1XB4 A;  1KU9 A;  2PMH A;  3CUQ C;  3K2Z A;  3V8J A;  3GZ6 A;  4G6D A;  4WXH A;  2V79 A;  1W5T A;  5DD8 A;  2PMU A;  4HDV A;  2RQP A;  2DFI A;  3E97 A;  4A0Y A;  1T39 A;  3L7W A;  5CJ9 A;  4KMU X;  3FXR A;  3ZMD A;  5HLG A;  5E18 F;  1L0O C;  5D8L B;  1LB2 A;  3KLO A;  1IUY A;  2HTS A;  3R0J A;  1PUE E;  2E7X A;  2YPR A;  3TKY A;  5DDG A;  1IXS B;  2W25 A;  3GFJ A;  1ZG5 A;  2H09 A;  1KYW A;  4JK1 X;  3KET A;  3O2P E;  2VT3 A;  1J75 A;  1RUN A;  2UZK A;  4E70 A;  2VBW A;  1USS A;  2CYY A;  2ETH A;  2DK5 A;  3KFW X;  1H0M A;  1JHF A;  3WU0 A;  4ENJ A;  3LST A;  4OIR F;  4LMY A;  3H3U A;  3QP5 A;  1DP7 P;  3QRF F;  1HW1 A;  1P4A A;  3DFG A;  4ESF A;  1K6O A;  1ON1 A;  2QLZ A;  3KP3 A;  4D0P A;  3KE2 A;  2L4A A;  4XSX F;  2ZBK A;  2KJC A;  1OMI A;  3MZY A;  1FSE A;  3T0Y A;  3NQO A;  3TDZ C;  2IA0 A;  4Z2Y A;  3T8T A;  1HST A;  3B73 A;  4OIQ F;  2RNJ A;  4KIF A;  1FBU A;  5CYV A;  3Q5F A;  1GHC A;  2L4M A;  4HX8 A;  2QBY B;  5J8C A;  2EV0 A;  3P9C A;  4ESB A;  3FM3 A;  4HDU A;  2EB7 A;  1UCR A;  3C3W A;  3F6O A;  3HUG A;  1YYV A;  4RAY A;  3G3Z A;  4ZYG A;  2C6Y A;  1KQ0 A;  5J6X A;  1AWC A;  4A0X A;  1LEA A;  5JI6 A;  1QQI A;  3CO6 C;  4LLG F;  3K69 A;  1HW5 A;  3ECH A;  3EUH A;  1O7F A;  1P4W A;  2UWM A;  1TBX A;  2F5E A;  2Z33 A;  2GA2 A;  2OQR A;  2MC3 A;  4AWX B;  4Q47 A;  1D8K A;  4M71 A;  3F23 A;  1K79 A;  1QBJ A;  2Z3Y A;  4RGS A;  3HIF A;  3MZH A;  1V3F A;  4IXA A;  3RKW A;  4I09 A;  3VFZ A;  3BY6 A;  4UHT A;  4OMZ A;  5F64 A;  2NAZ A;  2F5F A;  3P9K A;  3U9G A;  2ESN A;  4HBL A;  1YIO A;  1TTY A;  4IRI A;  3BPX A;  4MQ9 F;  3S2W A;  2DQL A;  2DBB A;  5D5V B;  4L9T A;  5LHG A;  1YTY A;  3V7C A;  1S7A A;  4UVC A;  3RKX A;  1R5G A;  1S29 A;  1B6A A;  3TO7 A;  2GAU A;  4A12 A;  2ISY A;  5BQT A;  4Q48 A;  3HTS B;  2V6C A;  2XAJ A;  4KUM A;  4UUV A;  4JQF A;  1T0F A;  4Y13 A;  1BBY A;  1W4M A;  4KNY A;  1FLI A;  2M87 A;  2X0L A;  4HV5 A;  2HS5 A;  1SFU A;  4RB1 A;  5HLH A;  1R1V A;  2P4W A;  1FY7 A;  3ZMS A;  2QQB A;  1X3U A;  3WTY C;  1XCV A;  3I54 A;  5AIQ A;  4PZJ A;  2JZY A;  5DEQ A;  4L18 B;  2O61 A;  2ZME B;  1F5T A;  3O6B B;  5FLX K;  5CLS A;  1IF1 A;  3I4P A;  2D1H A;  5BMZ A;  3Q9S A;  3GO5 A;  2O03 A;  3SZT A;  2XAH A;  3HRU A;  2P7V B;  4KMF A;  1ZLK A;  4EGZ A;  3Q9V A;  1DUX C;  1U5T A;  3FXU A;  2NS0 A;  1LVA A;  2BBY A;  4NB5 A;  4HLY A;  1OPC A;  1LDK B;  5HS7 A;  2ZKZ A;  2PFB A;  1MJA A;  3SHF A;  2E7W A;  2NNY A;  1YS7 A;  1EH6 A;  3BZ6 A;  1SD7 A;  2MBF A;  3F8M A;  5ICF A;  3CO7 C;  1G3S A;  3DPT A;  1HQC A;  4PGH A;  2W57 A;  3E5Q A;  1J2X A;  1S6L A;  4KIG A;  5FLX Z;  3FWE A;  1SFE A;  4R79 A;  2LDU A;  1BC7 C;  3FMS A;  3CLO A;  1XDS A;  2MLG A;  1W7P B;  2XAQ A;  3M7G A;  3N97 A;  5D6F A;  1R1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...