3NEUA

The crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
NPTFHADKPIYSQISDWMKKQMITGEWKGEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMGSFVTSDKALFDQLKKELADAITERFLEEAKSIGLDDQTAIELLIKRSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a functionally-unknown protein lin1836 from Listeria innocua Clip11262
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin1836 protein
total genus 41
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3neuA01
2EFNA 1UFMA 2RQPA 3FF5A 1FP2A 2ZMEB 4LLLA 5ICEA 5D5XB 3MQ0A 1MJAA 3E3VA 2HGCA 3BROA 4CXFA 4PZJA 4OINF 2PN6A 1O3SA 3I53A 4LLNA 2HS5A 2MA3A 4HQMA 5FGMA 1FP1D 4CDGA 2Z3YA 2LSOA 1IW7F 2AS5F 3F6OA 1LQ1A 4AVPA 4DQ2A 3HYIA 3LQRA 4EM1A 2ZJ2A 1ON2A 1USSA 2EFWA 3B73A 3IHUA 3ERED 1ZGAA 3GFJA 3CUOA 2VOOA 4OU0A 2EFPA 1YO5C 1S7AA 5D4RA 1QPMA 3BY6A 4BH9A 1ZLJA 5ILSA 4OMZA 5K5RA 4Z2YA 1FSHA 5E18F 2XAGA 2OZ6A 4O6JA 4HQEA 2RGVA 1O57A 4IJAA 2XV4S 3ZP5A 1QNTA 1G4DA 5L3GA 5LEKA 1K78B 3TDZC 2RN7A 2IT0A 1Z1DA 3CTAA 4ZYEA 3L7WA 2H6BA 4UVBA 1WSUA 1O7LA 2GXBA 1U2WA 5JHUA 3LSTA 2FXAA 1ODDA 1ZRDA 4KNYA 3BJ6A 3CO7C 3I5UA 4UXNA 4RGRA 2ZCWA 2G7UA 2KIUA 3ML6A 2D45A 2XRNA 3WU1B 2MLKA 2IP2A 3KP4A 2CYYA 2OQRA 2L01A 4XLNF 3BPXA 3CJNA 3W6JB 1OKRA 2GA1A 2EV6A 1HKTA 2NNNA 1J0RA 4M74A 3QAHA 3CO6C 1ZG3A 1TBXA 5K5OA 4L5IA 3PQKA 4ZYDA 2FBHA 4NHJA 3R0AA 2P5KA 4EJOA 4M9ZA 3DQVC 3VOEA 5HS8A 2EWNA 4U7BA 1FC3A 3F22A 4MTDA 3SZTA 2QENA 1RUNA 3C18A 2QQBA 1B6AA 3ZMZA 2NYXA 1IRGA 3IC7A 1YS6A 1XCBA 3FWEA 2CQKA 1U5TA 1S6LA 1O3TA 4I0AA 1LDKB 2XGXA 4KA4A 1Z91A 4ZH4F 2O61A 1J9IA 3T8RA 2H27A 4WWCA 1IUYA 2EFQA 3U9GA 5F1RA 5DDGA 3F8FA 1U5TB 2FU4A 1FWZA 3IRRA 4R8HA 4MEXF 2FRHA 2BGCA 3M8EA 3DP7A 1SAXA 4KMUX 4HA8A 3GZ6A 2LNBA 2WWYA 1QZYA 4AIJA 4IF4A 3O3KA 2L54A 4UV8A 3I71A 5CVUA 2V6CA 2W57A 1ZLKA 2DU9A 5BS6A 3H92A 2ZKZA 1XN7A 3W6KB 4CYDA 2OAZA 1YQAA 4IPAA 4GCVA 3EDPA 1J2XA 3RJPA 3MZYA 2V1UA 1IXRC 4KUMA 3DXJF 3BZ6A 3KZZA 2PLYA 1IZ1A 2QM3A 4M9XA 1Y0UA 1MGTA 1YW7A 4Q47A 1J75A 2D1HA 4OMYA 3TDUC 1XB4A 3NQOA 5E1WA 4XSZF 2QLZA 4G6DA 4HOBA 2M1BA 5CVRA 1R1TA 1F1ZA 2JT1A 3FMRA 1YFHA 3RPQA 5AIPA 4RB2C 1QGPA 2PBIA 5DYMA 4ESFA 3ZMTA 1KYWA 3HIFA 4EJUA 3D5LA 2A6EF 4BXUA 4L9VA 2V1XA 1BIAA 1I1SA 2OA4A 2ZMEA 3DF8A 4XLPF 2UZKA 4MQVA 2V79A 1R1UA 4WXDA 3HSEA 1KGSA 3K1PA 3DPTA 1ZYRF 4KMFA 5DEQA 5J8FA 3C7JA 3J80K 5LGNA 2MLGA 1GVJA 4HF2A 4YIIA 5FLXK 3QPHA 4LB6B 4O5VA 3RYPA 4UUVA 2GZWA 1R1VA 2OBPA 4KICA 3HRUA 3FMQA 3BP8A 1T38A 1IN4A 2XIGA 1STZA 3KCCA 3V8KA 2FBIA 3F8CA 2DK8A 1JHHA 3ELKA 3WG9A 3K9TA 4G8XA 3IKTA 2PQ8A 2KIFA 4YIFA 5DD4A 2QBYB 4NB5A 1U5TC 2BEOA 2W25A 4IRIA 5IT9K 5HVQC 2CW0F 1EH7A 2H6CA 2A69F 1BC7C 1O7FA 3E5UA 3JW4A 1IN7A 2V9VA 2QVOA 2EV0A 3K1MA 4M9SA 2HYFA 4EMSA 1W7PB 4EM2A 3QU3A 4EJVA 4N0BA 2DLLA 2AXLA 3F8NA 2HQRA 1Q1HA 3TO6A 4HX4A 2IW5A 3MFKA 3FM3A 3WTVC 3P9IA 1B59A 2EJRA 2VXZA 1A04A 1XMKA 3P9KA 4HX7A 1BI3A 4Q48A 5LRRA 2P8TA 2VBWA 1WI9A 4IXAA 5F6FA 4WF2A 2HKXA 5DUKA 1TW3A 3VFZA 1F9NA 3GUDA 3KP6A 5CYVA 2EA2A 3KP5A 1SFXA 2XAFA 2YPRA 3DKWA 2K02A 2CWEA 1RI7A 2ESHA 2HZTA 4M71A 3ZMUA 3JTGA 3HOTA 1I5ZA 3L9FA 2BV6A 2DQRA 2NS0A 1YYVA 4UHTA 5AONA 5FFXA 2DPDA 3E6DA 5DV5A 1LDJA 2E1NA 4IRHA 1YLFA 1QZZA 4G9YA 5E1ZB 3M7GA 2EB7A 4JQFA 3RPUA 1XGNA 2HYGD 3E6CC 1REPC 1SD4A 1UCRA 1S29A 5DCFA 2L02A 4HX8A 1KU7A 5CLSA 1USTA 5ILVA 2D1VA 2ZNZA 4KIFA 5BPDA 2FA5A 2ZFWA 1L0OC 2P6SA 3EQLF 3T1BA 1RZ4A 1J59A 3KZYA 4LD5A 3F8BA 1ONVA 3CUQB 3N4MA 4HLXA 1FBSA 4LGWA 1ON1A 5L3FA 4RS8A 3KEQA 4HBLA 4I01A 4S04A 3WODF 2ACJA 3K0LA 2WC2A 2A07F 5BOXA 3PQJA 2MBFA 3L00A 2JSCA 2ZNYA 3F72A 2YU3A 2E7WA 4I0BA 1U78A 3SFZA 1V3FA 3GF2A 3SXYA 2VC1A 4HLYA 2VBZA 2C6YA 2W24A 4F7ZA 4L0ZB 3MEXA 3J81K 4HDVA 5LLQA 1FPQA 2IVMA 2E1CA 1PDNC 5D4SA 1G3YA 3GO5A 2HQNA 2QYOA 3KP2A 4GGGA 1W4MA 5H20A 3QPTA 3V8LA 4EGZA 2VT2A 1FYMA 2IJLA 4PCQA 1BIBA 3C3WA 3E6MA 3GX4X 1W5SA 2XKOA 1DPRA 4GYIA 4IHSA 1CF7B 3I58A 3TO7A 1F5TA 2ETHA 1WRJA 1ZREA 1T0FA 5HLHA 3WTWC 4PDKA 1JE8A 3IWFA 3VODA 5DUIA 4ENMA 2M5WA 4ON0A 4MQ9F 3O6BB 1BBYA 3I59A 4CHUA 5E17F 4A6DA 5HDNA 1BOAA 3NRVA 4A0ZA 1EH6A 2CFXA 4HF1A 2KJCA 4KFCA 4KYWA 3T0YA 2OZUA 3JSPA 4UVAA 3WTZA 2FMLA 3I59B 1AOYA 1V4RA 1BI1A 3HRMA 3WE3A 5JFRA 2QWWA 3HRSA 4MEYF 1G3WA 2GA2A 2XKPA 2K4BA 1ZN2A 1LDDA 2BYVE 2NNYA 1HW1A 4A6EA 5LHIA 3BJOA 3R0JA 3FMSA 3FXQA 1DPUA 1LEAA 4XBFA 5E20A 3JAMZ 1H0MA 3MAJA 2P5LC 1XSXA 5L3BA 2STWA 3ZMVA 3H3UA 1RNLA 3C1DA 5FLXZ 3F3XA 2Y0MA 2J5OA 1YG2A 2GIVA 2OD5A 3KFWX 1X3UA 3J7AO 1K7AA 3FXUA 5A2QZ 2PMHA 1YS7A 2P7CB 4HV5A 3V7RA 4A5MA 2RC4A 5D6FA 4UVCA 4S05A 2QQ9A 3LA3A 2K86A 4HV6A 4GYGA 4R79A 2B0LA 1Z05A 2F5FA 1XMAA 1FZPB 3G73A 3GW2A 2DT5A 5ED4A 2PMUA 4PGGA 5HS9A 4XSXF 1P4WA 4A0YA 5TRDA 3H3ZA 3J80Z 4I09A 2EK5A 3RIRA 3IL2A 1S3JA 2VC0A 1ZGJA 1IN8A 1XGOA 1QQIA 4EGYA 1S7OA 3HOSA 4HDUA 1D8JA 3FM5A 2QBYA 1Z6TA 3N97A 2ISYA 1KYZA 4EJWA 2HR3A 1U6GA 4ZYHA 3GFIA 4FT8A 4RAZA 4KIGA 1IRFA 2JPBA 2JRTA 1XCVA 3WGIA 4GO1A 3ZQ7A 1KU3A 2TDXA 4AWXB 5JI6A 5LHGA 2Z33A 1EH8A 1OYIA 3V7CA 2Z9OA 3K69A 1HXDA 5TJJA 1LB2A 1P4XA 3TO9A 4BAYA 1XGSA 3TQNA 4EVIA 4CO8A 3I0TA 4E70A 1HW2A 4JBAA 4M6YA 4RGUA 3MCZA 1TLHB 4AIHA 4YFNF 4IVNA 1FBUA 5LHHA 2A3SA 2VE9A 2VBXA 1D5VA 1LVAA 3CDHA 4KT5C 3ZPLA 2R3SA 3F6VA 4ZZDA 1FLIA 1ZG5A 3FZVA 4ETSA 1HSJA 5E8IA 4H0EA 1HKQA 1P4AA 5FD6A 4WXCA 1VTNC 4WK8F 1P2FA 2BE5F 2ESNA 4M72A 1TNTA 2K4JA 1E2XA 1G6NA 2UWMA 1OPCA 2VODA 2RDPA 3KETA 3MZHA 2ZBKA 3LA7A 1MDMA 2CSOA 5D8KB 5ERIA 4L18B 2O0YA 2IA0A 2HWVA 3IWZA 3HRTA 4RB1A 4P9FA 1HSTA 4K2EA 1R36A 3QU6A 1J5YA 2FNPA 5CJ9A 1BM9A 1FNNA 3ISPA 1I1GA 4U0WA 4O3MA 3ROUA 4ENJA 3HSFA 3T8TA 4LMYA 2BBYA 3B02A 3HTUA 5HLGA 3I4PA 4A12A 2X4HA 2OU2A 5KVRA 4G7OF 1BI0A 2ZO4A 3BPVA 1KQ9A 1R5HA 2DQLA 2UXXA 3QRFF 4G94A 1PP7U 4HZFA 1C0WA 4D0PA 2FMYA 1J7KA 4OIRF 3GYHX 2HTJA 3V8JA 1MJBA 1MD0A 1XGMA 1YIOA 1L3LA 2A68F 3WGGA 2W84A 3RDIA 1XDSA 3NEUA 2P7VB 2Q0OA 5D5VB 3GFMA 3DEUA 3WTSC 2F5EA 2KRFA 1CGPA 5EEHA 2UXNA 5D8LB 2DO7A 4B09A 1IN5A 1G3SA 1H9GA 3PFIA 4AIKA 2P5VA 4LJZF 1FX7A 3JSOA 1RIOH 1U3EM 3HSRA 4YFXF 5H6QA 2DTRA 4BHBA 1B1BA 2EFOA 2J5PA 3KP3A 4UNOA 3E5XA 1CF7A 1KU9A 3E97A 1WQ2A 1SMYF 1DDNA 3R60A 2CO5A 2A6HF 2HTSA 3EYYA 1IN6A 5L3DA 2VOPA 3WU0A 1SD7A 4KN4X 3RI4A 3Q5FA 3RKXA 1ZRCA 2RKHA 3QOPA 2ELHA 1R23A 2Y48A 2V1DA 2DI3A 1YW9A 4QLCU 4IHTA 3LAPA 2WTEA 1T98A 4UV9A 2A61A 1IAWA 1UHMA 3LFKA 3QP6A 5CVIA 3T5XA 3FX3A 3V4GA 2JZYA 2MH9A 3HTSB 1K79A 1T6SA 2XUBA 5L3CA 3AAFA 4EQQA 4MNUA 4ZYGA 1KQ0A 3P9CA 2CGPA 3F8MA 3CUQC 1I27A 3ZMSA 2IA1A 2FSWA 5E8GA 2DPUA 1B4AA 3MWMA 4XRFA 1UB9A 2LF8A 2K27A 3RKYA 1DUXC 2HEOA 2GAUA 3Q9VA 4B8XA 1I6XA 2PI0A 1O3QA 3KLOA 2FNAA 3ABUA 2YSRA 2M30A 4YG2F 3DV8A 3CUQA 3EETA 1YTYA 5F64A 3KP7A 1R58A 1KA8A 3ULQB 4ENNA 5L3EA 2CG4A 3ZMDA 2W85A 1SFUA 4NQWA 2FQ3A 1BJAA 4M6XA 5JR3A 3GZ5A 3RTRA 2K7LA 4BYYA 2HDCA 4CGZA 2FE3A 2PG4A 4P96A 4RB3C 4PGHA 3J81Z 4HYEA 5JVTA 4ZZLA 3FHZA 5CVVA 2O6GE 1R5GA 5HLIA 3WTUC 2PFBA 4MHGA 1HKSA 1FBQA 2GXGA 2MH2A 1GHCA 2O3FA 2KIMA 2DK5A 2KJBA 2H09A 3GXOA 3IKVA 5D5WB 5ICCA 4M73A 5FFZA 3JTHA 5DD8A 3REOA 1LEBA 2VONA 2F5CA 2D2WA 2M8EA 3WTXC 2Q2EA 2IA2A 2L3DA 2JPCA 2QQAA 3ECOA 1Z6RA 4OIQF 1AWCA 3K2ZA 3EYIA 5HS7A 2M45A 5HOOA 1D3YA 2LF7A 1FOKA 2MC3A 1W7PD 2G9WA 4HAMA 2NAZA 1YW8A 4LLGF 4OIOF 1SD6A 1RUOA 1ZH5A 3KE2A 3BDDA 1MJ9A 1U8RA 1TQIA 3KEOA 4DNCA 4G6QA 4FX0A 3L09A 1ZG1A 4KN7X 4EM0B 1HW5A 4AD9A 4L9JA 1FT9A 4L9NA 1ZAOA 1XDUA 5E1XA 2Q8KA 3R61A 5LGUA 2P6TA 1JGSA 5IT9Z 5CVJA 5H6RA 5BPIA 5IT3A 4BNCA 1B9NA 4GXOA 4A2UA 4IRGA 5LEJA 1H9TA 4LK1F 4OIPF 1W7PA 1WKMA 3RYRA 4ESJA 1QO0D 4RGSA 4L5JA 3LAJA 2XAHA 4Y13A 2LKPA 2DFIA 2O03A 2XVCA 4KIBA 3GVAA 3V7SA 1Z7UA 1GXPA 2EA4A 3HUGA 4QWQA 3EUHA 2E7XA 4U0VA 3TOAA 3SZPA 1IXCA 1BN5A 1KU2A 2L4MA 2OQGA 2ADUA 2PJPA 5HDKA 1IXSB 4Y17A 2DAOA 5J6XA 3OOPA 4I02A 1K78A 4Q5SF 2XAQA 4U88A 1OMIA 2KKOA 4G7ZF 1PP8F 2WV0A 1FY7A 2YR2A 4Y15A 2YX7A 1LJ9A 5LGTA 3RKWA 1S8NA 2A5YB 1TQPA 1R00A 3ECHA 2R7DA 1P6RA 2PEXA 1DP7P 1OYWA 1XSDA 2GQQA 2RVCA 3JAMK 3KLNA 4CICA 5K1YA 1EV7A 3Q9SA 1UHWA 4FHTA 1TNSA 3LA2A 3TOBA 2DW4A 2XASA 1XSVA 4KDPA 1OYYA 3SHFA 4P5OA 3LQQA 2Z99A 4U7DA 4CZZA 1LNWA 3P7NA 3WTTC 2IRFG 4TV7A 2YX4A 5AIQA 1BC8C 3R4KA 4ESBA 5BMZA 1SD5A 2VT3A 1G3TA 4BQAA 2VN2A 3GWZA 4I2OA 1ZARA 3SQNA 5HDGA 4MTEA 1FYKA 1JHFA 4HW0A 5BQTA 4P9UA 3M8FA 3I64A 2F5DA 2EV5A 2HOEA 5J8CA 3F23A 3BWGA 5LBQA 1W5TA 3S2WA 4RGXA 3U1DA 3R6SA 3M1EA 1QBJA 1NHAA 1SFEA 3ABTA 5D5UB 2G7HA 5EEGA 1MKMA 2STTA 2FBKA 4JK1X 4LFUA 3VB2A 4BHPA 4EJTA 1FYLA 1TQMA 3E6BA 4YFKF 4WXHA 1KQ8A 2P4WA 3L2CA 2H94A 3WTYC 1ZRFA 1TTYA 3COAC 2M87A 4MGRA 2FEZA 4BHCA 4LG0A 5FO5A 3ZN1A 1BI2A 1T39A 2HKOA 3DPLC 1XD7A 3GFLA 1HBXG 4LB5A 4WCGA 2DBBA 4L0YB 3U2RA 5LRSA 1HQCA 4I98B 2QZ8A 1O3RA 3FXRA 4N9HA 4U0YA 2JTVA 5FB2A 3WE2A 1SMTA 2FF4A 4OOIA 2QUFA 1R22A 2XHKA 3GLXA 5ILUA 4G7HF 2ISZA 3I54A 5KK1A 4A5NA 4ASNA 2FOKA 3K1NA 4WX9A 2GWRA 4Q4ZF 4EV0A 4LK0F 1OR7A 3HHGA 3HHHA 1IF1A 1FSEA 1ULYA 4R1HA 5DCMB 4I7HA 2VE8A 4RB0A 1Z9CA 3E5QA 4ENKA 5FD5A 1E17A 5DCMA 1R7JA 3O2PE 3VEPA 4A0XA 2F2EA 4LG0B 1JXSA 4HF0A 2RNJA 2IPQX 2LDUA 6PAXA 3BOQA 5ICGA 3D0SA 2L4AA 2X0LA 4N9IA 1WWXA 3DFGA 5ICFA 2Y75A 2O8XA 2Z5UA 1MZBA 1GXQA 3TKYA 4RAYA 2ZXJA 2VBYA 2NRAC 1D8KA 5K5QA 3OV8A 3BJAA 1ZHFA 2HFHA 4FX4A 3ZN0A 4L9TA 3IRQA 3CLOA 3QP5A 1PUEE 3M9AA 1T2KA 1MDMB 3TGNA 2XROA 4P55A 3WGHA 1TW2A 1P92A 2MD5A 5A2QK 3G3ZA 3GEZA 3F21A 1K6OA 2RV8A 2R7FA 1B9MA 2COMA 3LWFA 2XAJA 1F4KA 5D6EA
chains in the Genus database with same CATH superfamily
2XGEA 2EFNA 2ZSIB 2OF7A 3I55I 1UFMA 2CUEA 3JRBA 2RQPA 1P7IA 2M7AA 3FF5A 1FP2A 2ZMEB 2ZFUA 4LLLA 3SDBA 5ICEA 1PJRA 3A0HC 5D5XB 2L7MP 3MQ0A 2EILH 1MJAA 3H9GA 4B44A 4IOAF 4V2FA 3E3VA 2HGCA 3HL2A 2JA5J 3BROA 1UG0A 5F08A 5IP9J 4CXFA 4PZJA 3FK6A 4OINF 3OR1C 2DA2A 4IX7A 3CCSI 2PN6A 3ZGKA 1O3SA 1MBJA 3I53A 4LLNA 2D5VA 2HS5A 2JVHA 3JREA 2MA3A 5TISC 1AU7A 2LK2A 4HQMA 5FGMA 2HXIA 1FP1D 4CDGA 4E4HA 2Z3YA 2LSOA 1IW7F 3HJEA 2V9KA 4YRVA 1X58A 2MGQA 2AS5F 3AKZA 1X1DA 3F6OA 1LQ1A 4AVPA 4DQ2A 3GTQJ 3HYIA 1WVRA 2XPVA 1Z3YA 3LQRA 3OSGA 1OR7C 1XTAA 4EM1A 4JP0A 5C3EJ 4PJ0C 4RDUA 1SVMA 2ZJ2A 1ON2A 1VQNI 1USSA 1D5YA 2EFWA 3OL3A 5LFAA 1ORKA 5IP6A 3B73A 3IHUA 2Y30A 3ERED 1ZGAA 2CV1A 3GFJA 2M8GX 3CUOA 4OU0A 2E1MC 2VOOA 1XC5A 2EFPA 5E3OA 3CF5F 1YO5C 2R7VA 5FRMA 1S7AA 1Z7LA 4EEFG 5D4RA 1QPMA 3BY6A 4BH9A 4XNFA 2F48A 3WHBA 2PJRB 1ZLJA 2BY1A 3LMMA 5ILSA 4E7ZA 1N77A 5DM7F 5LD2C 4BXXJ 4OMZA 3H3VK 5K5RA 4Z2YA 1FSHA 2ZJPF 1B72A 3HGYA 5E18F 2XAGA 2OZ6A 2R5ZA 2JWTA 1POGA 3TEDA 2Z16A 4O6JA 4HQEA 2RGVA 1ZR2A 1O57A 5M5XJ 4IJAA 4QIWN 2GLOA 2XV4S 3ZP5A 2V9PA 2X6YA 2XF7A 1QNTA 2BXYA 3FKJA 1RKTA 1G4DA 3D5SC 5L3GA 4XLHA 3NWSA 5LEKA 1K78B 3TDZC 2RN7A 2IT0A 4B47A 3M07A 4DZJA 1Z1DA 5EG0B 3CTAA 1U0JA 4ZYEA 5EEAA 3L7WA 1MIJA 1RR8C 2H6BA 4UVBA 4LIUA 1WSUA 1BW6A 1FOWA 1O7LA 2GXBA 1ZGWA 1U2WA 1E3PA 1LUJB 4C9YA 5JHUA 5CQGA 3L2VA 1GV5A 3LSTA 4BE2A 3E1SA 2FXAA 1MBGA 1ODDA 4IEJA 1YI2I 3N05A 2X51A 1ZRDA 1MMDA 3BJ6A 3M8JA 4KNYA 4ANJA 3CO7C 2JUGA 3I5UA 4UXNA 3W2VA 4DJAA 4RGRA 2ZCWA 2ZXWH 4BDYA 2G7UA 2FJ1A 2KIUA 3ML6A 3OYEA 2EZKA 2XRNA 3WU1B 3A02A 2D45A 2MLKA 4BBRJ 2IP2A 3KP4A 2CYYA 2LD5A 2OQRA 2L01A 4XLNF 5GAGJ 1NG6A 3BPXA 3CMAI 1R71A 3CJNA 1AKHB 2HVSA 3OSFA 3W6JB 1OKRA 2VKHA 2GA1A 1S5LC 2CUZA 2Y0SN 1RKWA 2W82A 3CF2A 4PJMA 3CD6I 4C3IJ 3LNQA 1E3OC 2EV6A 1W0UA 1HKTA 2NNNA 2NOJB 5FRNA 1J0RA 5L3FA 4XOTA 2EPFA 4M74A 4B3AA 3QAHA 3CO6C 2CV0A 1QU3A 1ZG3A 1ACIA 1MW7A 1TBXA 5K5OA 4L5IA 3UR3C 3PQKA 1MH4A 4ZYDA 5FKKA 2FBHA 2E5ZA 1OQYA 4NHJA 2GXAA 3DBRB 3R0AA 2VPLA 2ELKA 1LFBA 2P5KA 2MYSA 3HZJA 4C2MJ 4J19A 2VASA 4EJOA 2W48A 4M9ZA 4DBRA 1ETVA 1V5EA 1I6HJ 2E71A 2E1MB 3DQVC 3VOEA 4HPQA 3UKGA 4XLEA 3S1QJ 4A3DJ 3PSIA 5HS8A 2EWNA 4U7BA 1Y39A 1JT0A 2JA7J 1FC3A 1XG1A 3F22A 1K4SA 4MTDA 3GBGA 3SZTA 4ZTFA 2QENA 4W1UA 2EQRA 5CQEA 2LY2A 4BE1A 1RUNA 3C18A 2QQBA 1B6AA 4PJNA 3ZMZA 2YS9A 1ETYA 2NYXA 4IO9F 4XOPA 1IRGA 3IC7A 1YS6A 1XCBA 4PJLA 4CYCB 3FWEA 1MNEA 1HOMA 2HOTA 2CQKA 1Z3XA 1U5TA 1S6LA 3CCJI 4NDLA 1ZK8A 1O3TA 4I0AA 1LDKB 2IS2A 2XGXA 4KA4A 2HOAA 1Z91A 3BCAA 4ZH4F 2O61A 1J9IA 2ZXIA 4PFOA 4UY8I 2KFDA 1MH3A 3T8RA 2CH0A 2IBDA 2H27A 4WWCA 4BUPA 1MSFC 2EFQA 3U9GA 5F1RA 1IUYA 5DDGA 3F8FA 1U5TB 2FU4A 4RBOA 5EZHA 5GPCA 5F04A 1FWZA 3IRRA 2BY3A 4R8HA 3GTKJ 4MEXF 2FRHA 2BGCA 2VXDA 3M8EA 4A3JJ 1WJCA 5FKMA 2CUFA 1MNDA 3DP7A 1SAXA 4CCJA 2XRLA 4E7JA 3ZQIA 4KMUX 4JX4A 1X1AA 4HA8A 2X6WA 2ECBA 4BQQA 2O7OA 3GZ6A 1V5FA 2LNBA 3LSIA 2WWYA 3UNGC 1TWFJ 2JQ7A 4IHWA 1QZYA 4AIJA 3DBLB 4IF4A 1Y8RB 2CQNA 2QSHX 3O3KA 2L54A 3ZOBA 4JYKA 2HVRA 4UV8A 3I71A 5CVUA 2V6CA 4NBQA 3OYFA 2W57A 3ZQLA 1ZLKA 2DU9A 2M9HA 5BS6A 3H92A 2L9NA 2ZKZA 3OS2A 1XN7A 3W6KB 4CYDA 1NTCA 2OAZA 1YQAA 4IPAA 3G4SI 2PX9A 4HSRA 2LMDA 4GCVA 3EDPA 1J2XA 2NVUB 2JMWA 3RJPA 1I3AA 1H89C 3MZYA 2V1UA 1IXRC 4KUMA 3DXJF 3BZ6A 3KZZA 2PLYA 3X2QH 5K7FA 1IZ1A 2QM3A 4PSXA 4M9XA 1Y0UA 1MGTA 1YW7A 4JX6A 2R92J 4Q47A 4D7NA 1J75A 2D1HA 4OMYA 4I76A 4M3FA 3TDUC 1XB4A 2JK3A 3ZQHA 3NQOA 1JJ8C 4FCYA 1E0EA 5E1WA 3OYBA 4XSZF 4B43A 2VJIA 2QLZA 4PK4A 4G6DA 4HOBA 1IDZA 2M1BA 1IRXA 2UUZA 4E6KG 5CVRA 5K7HA 5E79C 1R1TA 1DP3A 4EATA 1Z67A 1IG7A 1F1ZA 3HPHA 2DCEA 2JT1A 3FMRA 4RM2A 1YFHA 3RPQA 3BT9A 5AIPA 3CCQI 4RB2C 1QGPA 1UG2A 2PBIA 5DYMA 4ESFA 3ZMTA 1KYWA 3HIFA 2OCEA 4EJUA 3D5LA 2A6EF 4BXUA 4L9VA 2V1XA 2DMTA 4KT6A 1BIAA 1I1SA 2E36A 2OA4A 2ZMEA 1ZR4A 4B48A 2F6CA 3A0BC 2BVMA 1ETQA 4W97A 3DF8A 4XLPF 3PUFA 2R7ZJ 2UZKA 4MQVA 1F36A 2V79A 1R1UA 4WXDA 4D7MA 3HSEA 1PUFB 4IHXA 2X6OA 1DGRM 1KGSA 1OCOH 3K1PA 1T8IA 3H9QA 4BE0A 3Q3SA 1S7EA 1Q1VA 3DPTA 1ZYRF 3K4NA 4OAZA 2LBFB 2BHZA 2KL4A 4KMFA 5DEQA 1JUMA 5J8FA 3C7JA 3J80K 5LGNA 2MLGA 1PVEA 1GVJA 2QCOA 3WU2C 2TRTA 2LKXA 4HF2A 4YIIA 3PIPF 1ETKA 2LH9A 3C2BA 5FLXK 3DTEA 2XAUA 2KLOA 3QPHA 4LB6B 4IOCF 4O5VA 3RYPA 4UUVA 1MMGA 1D1CA 2GZWA 3JRHA 1R1VA 2VQLA 1YX3A 2OBPA 4KICA 5JVGF 3HRUA 2WAFA 3FMQA 2L7KA 4M3EA 4NQWB 3BP8A 3SYTA 4RMNA 1T38A 1IN4A 1T08B 4BXFA 2XIGA 3O8HA 2F4IA 3IH4A 2Z1DA 1STZA 3KCCA 3V8KA 1BL0A 2FBIA 1V5GA 3F8CA 3VYUB 2BZTA 2DK8A 1JHHA 2P0WA 3ELKA 1Y8QB 3K4BA 4BEHA 1SC7A 3WG9A 2NVXJ 4GRIA 2VIXA 3K9TA 4G8XA 2WB1A 4PJJA 5EDNA 3IKTA 2LY9A 3ESWB 2PQ8A 2KIFA 4YIFA 1WJDA 5B5EC 5DD4A 2QBYB 1N75A 1TWHJ 4NB5A 3L2QA 2B63J 1U5TC 2R7SA 2BEOA 2W25A 4IRIA 5IT9K 5HVQC 1BR2A 4M3DA 3BR5A 2CW7A 1X19A 1D0ZA 2CW0F 3Q0UA 2HYJA 1EH7A 2H6CA 2A69F 2TCTA 3M1CA 1BC7C 2H8RA 1O7FA 1VI0A 1BA5A 2IS4A 1JI8A 3E5UA 3LSRA 3JW4A 3G2BA 4G12A 1IN7A 2V9VA 4HEA2 2QVOA 1X2MA 2EV0A 1H8AC 3K1MA 4M9SA 4BDZA 2HYFA 3OIPA 4S0HB 1XPXA 3JRDA 4Y7NJ 4EMSA 1W7PB 4EM2A 1YX5A 3QU3A 4BJTA 4EJVA 4BY7J 3CC4I 4N0BA 2DLLA 2AXLA 2JVGA 3F8NA 2HQRA 3ZQCA 4BY1J 3DU6A 1Q1HA 3TO6A 4DBQA 4HX4A 2IW5A 3MFKA 4DYQA 3FM3A 3WTVC 2M0CA 3P9IA 1B59A 1SFKA 2EJRA 2VXZA 2ZXHA 1A04A 3RPUD 4AC0A 3HXLA 1XMKA 2R5YA 3P9KA 2OV7A 3C2HA 1BI3A 4HX7A 5J1YA 4Q48A 5LRRA 3I3LA 2P8TA 2VBWA 1S72I 1WI9A 1BR4A 3CJTB 4IXAA 3A1YA 4AU7A 5F6FA 4WF2A 3BG6A 2HKXA 5DUKA 1ETWA 1TP4A 3NARA 1TW3A 3QQAA 3VFZA 2R5YB 3KPHA 1SEUA 1VQ5I 1F9NA 4AUXA 2LYCA 3GUDA 3KP6A 5CYVA 2W1OA 1VQ8I 2EA2A 4X0GA 2PJRA 3FXLA 2ID6A 3JRFA 3HOVJ 3KP5A 1SFXA 2KMUA 2XAFA 4M3BA 4BQOA 3S1RJ 2YPRA 3DKWA 2K02A 2CWEA 2ID3A 1IO2A 4CCLA 3DLLF 1WHUA 2DTZA 1RI7A 2ESHA 3RQIA 1HCRA 2HZTA 4M71A 3ZMUA 2XDVA 3DTIA 4CSWA 2X9DA 3JTGA 3HOTA 3CDLA 1I5ZA 3L9FA 2BV6A 5GP9A 2I8DA 2DQRA 2NS0A 1YYVA 1K4TA 4UHTA 5AONA 3OYIA 5FFXA 1FOXA 2DPDA 4OAYA 3E6DA 3ZCOA 5DV5A 1LDJA 4YIRX 4CA0A 3CC7I 2E1NA 4IRHA 1TT5B 1YLFA 3RKQA 1QZZA 4G9YA 2VKEA 1GUUA 2V7FA 3HPGA 5E1ZB 2WAEA 3M7GA 3AFHA 2OC6A 2EB7A 4JQFA 3MKYB 1DGWY 1OCPA 3RPUA 1XGNA 4ZDLA 2CRGA 2HYGD 3LSMA 4BQNA 3E6CC 1REPC 1SD4A 3S1MJ 1UCRA 1S29A 5DCFA 2L02A 2H8WA 4HX8A 1KU7A 1RPWA 5E3MA 5CLSA 2X1CA 2HOSA 4LIVA 1USTA 5ILVA 2D1VA 4XRSA 4GDFA 2ZNZA 4QTRA 2XC7A 4KIFA 4F93B 2JRMA 4KJZA 3OWTA 5BPDA 1VQ4I 2FA5A 3LSKA 2ZFWA 1L0OC 3MN2A 3MKZA 2P6SA 3CJRB 2AQFA 3EQLF 3T1BA 1RZ4A 4XORA 1IRZA 2DXIA 3H1CA 1J59A 4AM3A 3KZYA 3ASOH 2L7FP 1QZEA 3AG2H 1ONVA 3F8BA 4LD5A 1K83J 3OYCA 3CUQB 2ZMEC 1WH5A 1IDYA 2MG4A 3N4MA 4HLXA 1FBSA 2VJJA 1OCRH 1ON1A 4LGWA 4RS8A 3GLLA 4UB6C 3VYRB 4PSWA 3KEQA 4HBLA 4I01A 4S04A 1D1AA 4XR6A 3WODF 3ABLH 2ACJA 3K0LA 1ERDA 5M5YJ 2H1LA 3CQZJ 4II3A 3GCMA 4F52A 4E7HA 5EG0A 2WC2A 2A07F 5BOXA 3PQJA 2VQHA 2MBFA 2KP6A 3HOWJ 3L00A 2CQXA 2JSCA 4XLCA 2QEXI 2DFHA 2ZNYA 3F72A 5J47A 2YU3A 1TWGJ 2E7WA 1WFXA 2OTJI 3JRIA 2HXOA 4FQGA 4I0BA 1U78A 3DCFA 2KRHA 3SFZA 1V3FA 3GF2A 3SXYA 2VI6A 2VC1A 1OISA 2W7NA 2VBZA 4HLYA 2JA6J 2C6YA 2Y0SA 2W24A 3HM5A 4NNJA 4F7ZA 4L0ZB 4ZTJA 4D5FA 3MEXA 3J81K 4HDVA 5LLQA 1FPQA 2IVMA 2E1CA 1PDNC 5D4SA 1G3YA 3GO5A 2HQNA 4H4KC 4NC7A 3KYDB 3FXJA 2QYOA 3KP2A 2O5RA 4GGGA 1QHHD 3B6CA 2K3FA 4B1RA 1W4MA 5H20A 4V19K 5FKNA 3CP8A 3QPTA 1GDTA 3V8LA 2L7ZA 4EGZA 3FBNB 3PNVA 2VT2A 2E19A 2IJLA 1FYMA 1RESA 3OYNA 2BW3B 4PCQA 1BIBA 5EGOA 2R7TA 1FTZA 3C3WA 4A3MJ 3ABKH 3E6MA 3GX4X 1W5SA 1I39A 2XKOA 1EA3A 2DA4A 3C2GA 5GTIC 1DPRA 4GYIA 4IHSA 1CF7B 3OS1A 5J1RA 2BY0A 3I58A 3BZCA 2WY7Q 2M0MA 3TO7A 1NG7A 1F5TA 2ETHA 1WRJA 5FROA 1ZREA 1T0FA 5HLHA 3WTWC 1D1BA 3BG5A 1VF9A 4PDKA 4CCOA 1JE8A 3OYDA 3IWFA 3VODA 5DUIA 4ENMA 2VKVA 2M5WA 3HUGB 3RQ4A 2Y9YA 3HC7A 3ZQQA 4ON0A 4MQ9F 4UB8C 3RZDJ 3CESA 3O6BB 5B1BH 3DBHB 2V6EA 2VUMJ 3VYSB 1BBYA 3I59A 4CHUA 5E17F 4A6DA 5HDNA 1BOAA 3NRVA 2UV1A 4A0ZA 1T33A 1EH6A 2CFXA 3DLAA 5J4VA 4CZCA 4HF1A 3JRGA 1LE8B 2KJCA 2FQ4A 4KFCA 4KYWA 3HGGA 3PJRA 3T0YA 2OZUA 3KYCB 5FLVA 4C2TA 4UUSA 3DTKA 4JOMA 3JSPA 4UVAA 3S1NJ 3WTZA 2LC2A 2FMLA 3I59B 1AOYA 3U21A 1MMAA 2M4KA 4X1EA 3EUKL 1V54H 1V4RA 1GLNA 1BI1A 3HRMA 1YJNI 3A2KA 3WE3A 5JFRA 1DU0A 5F0HA 3QWLA 2QWWA 3S3NA 2ME6A 3HRSA 4MEYF 1G3WA 2GA2A 2XKPA 1YITI 2K5CA 2WADA 3H5AA 1YE9A 2K4BA 1ZN2A 1LDDA 2BYVE 2NNYA 1B8IA 1HW1A 4A6EA 5LHIA 3BJOA 1YOVB 3K70D 3R0JA 3FIWA 3FMSA 3FXQA 1DPUA 1LEAA 4XBFA 5E20A 3JAMZ 3MAJA 2P5LC 1H0MA 1XSXA 3RCOA 2MC4A 5L3BA 2STWA 3ZMVA 5EGOB 5M3MJ 4XN3A 1NH3A 3H3UA 3CMYA 1RNLA 3MKLA 3C1DA 2LREA 3I9V2 5FLXZ 3IV5A 1FOYA 3F3XA 2Y0MA 2J5OA 4ZJZA 1YG2A 2GBYA 2GIVA 3CMMA 2ZSHB 4CCKA 2CUJA 4IQJA 2OD5A 3KEYA 3KFWX 1UAAA 1X3UA 4II2A 3PIOF 3J7AO 1K7AA 3HEFA 1A36A 3FXUA 4A3LJ 2LFBA 5A2QZ 4XKVA 2PMHA 5JLXA 5B66C 1W0TA 3ZQGA 3JRAA 1YS7A 2P7CB 4HV5A 3V7RA 2KQRA 4A5MA 2RC4A 5D6FA 4UVCA 2CS3A 2K85A 2QQ9A 3LA3A 4S05A 2F4MB 3LSGA 5TGTA 4KISA 2K86A 4HV6A 2VJ5A 4GYGA 4R79A 2DA5A 2LVSA 1EF4A 2B0LA 1A5JA 1Z05A 4FTHA 2F5FA 3HG9A 1XMAA 1FZPB 3G73A 3GW2A 3MZ8A 3SZGA 3ZQFA 3OYHA 2DT5A 5ED4A 2PMUA 4PGGA 5HS9A 4XSXF 3K4JA 2KDOA 2JSPA 3GTGJ 1P4WA 4A0YA 5TRDA 3OMYA 2VB6A 1VQMI 4MO7A 3H3ZA 2DMUA 3J80Z 2GM4A 4I09A 1WJBA 1JT6A 1FMVA 2EK5A 1VQ9I 3RIRA 3IL2A 2HZDA 1S3JA 2GOMA 2VC0A 4ZDOA 5DTDA 3MD2A 1ZGJA 2Q1ZB 1IN8A 1XGOA 1QQIA 4EGYA 1S7OA 2Y2ZA 3K4KA 3HOSA 2E1OA 4HDUA 1D8JA 3FM5A 2QBYA 4L5EA 1Z0XA 1Z6TA 2ELJA 3N97A 3KZIC 3MKWB 4XQFA 2ISYA 2DMNA 3HOXJ 1KYZA 2FUG2 4EJWA 2HR3A 1M1EB 1U6GA 4ZYHA 3MMYB 3GFIA 4FT8A 4RAZA 2CU7A 4KIGA 3BTCA 1IRFA 2JPBA 1PUFA 3LSPA 2GIZA 2JRTA 2KDZA 3EPZA 2HQ5A 2DFFA 3L2RA 1XCVA 2CW8A 2EIMH 3WGIA 1H88C 3GMEA 2W4SA 4GO1A 1GT0C 2LBFA 3DWLE 1FIAA 3ZQ7A 1KU3A 1LVKA 2TDXA 4AWXB 5JI6A 2A05A 2AO9A 5LHGA 1EH8A 2Z33A 3D5RC 2DYSH 3AG3H 1OYIA 3V7CA 2Z9OA 3K69A 1HXDA 5TJJA 1LB2A 3BQZA 2LTPA 1P4XA 2OUMA 3S3MA 3W3CA 1T56A 3TO9A 4BAYA 4AIDA 1U9NA 1XGSA 3TQNA 2MD0A 4EVIA 4CO8A 2EZLA 3I0TA 4BACA 4A3BJ 3LSJA 2EBIA 4E70A 1HW2A 4JBAA 4M6YA 5IPAA 4RGUA 2BOLA 4A3EJ 3MCZA 1OFCX 1TLHB 2DMPA 5EYRA 2QA4I 1P7JA 3H36A 4XL9A 4AIHA 1YRNB 2NXNB 4RA2A 4YFNF 2X1DA 4IVNA 1FBUA 5LHHA 2A3SA 3S16J 4XONA 2VE9A 1X1CA 2VBXA 2RQQA 3VPRA 1D5VA 1LVAA 3CDHA 4KT5C 3ZPLA 2R3SA 3F6VA 3LL7A 4ZZDA 1FLIA 1Y0NA 1ZG5A 1YRNA 3FZVA 2LP0A 4ETSA 1HSJA 3HDDA 5E8IA 1U8BA 2X6XA 4H0EA 1QVUA 1EKEA 2JN6A 1HKQA 1P4AA 5FD6A 4WXCA 1VTNC 4WK8F 1P2FA 2BE5F 2ESNA 4M72A 1TNTA 2K4JA 4IL6C 1E2XA 1G6NA 2UWMA 3BG9A 3B6AA 3BZKA 1OPCA 3W2AA 2VODA 4CUGA 2RDPA 3KETA 3TP0A 3PO2J 3MZHA 3OYAA 2ZBKA 3SJMA 1VFCA 3LA7A 1MDMA 2CSOA 5D8KB 1WI3A 2WAQA 5ERIA 5IYCJ 4L18B 2O0YA 2IA0A 4RLFA 2B9SA 2HWVA 3IWZA 3HRTA 3NWTA 2QKLB 4D9JA 4RB1A 2YUSA 5C4JJ 4P9FA 3A01B 1HSTA 1WJAA 2E34A 4K2EA 3S17J 1R36A 3CCRI 3QU6A 1J5YA 2FNPA 5CJ9A 1CQTA 2XF6A 3AG4H 1BM9A 1FNNA 3ISPA 1I1GA 1K6YA 4U0WA 4O3MA 1BJZA 3ROUA 4C3JJ 1Z77A 5IOZA 3H35A 4ENJA 3H0GJ 1DQUA 1FTTA 1UMQA 3HSFA 4HSTA 3T8TA 3S14J 2E60A 3S93A 4A69C 4LMYA 1NK3P 3Q0WA 3L1PA 2BBYA 3B02A 1IUFA 2R7XA 3LSHA 5E3LA 3HTUA 5HLGA 1ZTRA 3I4PA 2LY1A 2XSDC 4BBSJ 4A12A 1ITYA 1W5CC 2XB5A 2X4HA 3E0JB 2OU2A 1XX5A 3OYMA 3JRCA 5KVRA 4RM3A 1OLTA 2DA3A 4G7OF 3QPLA 1BI0A 1X3ZB 2R5ZB 5GAEJ 2ZO4A 3BPVA 1KQ9A 1WJ5A 1R5HA 2DQLA 2UXXA 5KHDA 3QRFF 4G94A 1PP7U 3AL0C 1R4NB 2IEKA 2WY8Q 4HZFA 1AHDP 1NK2P 4LG3A 1C0WA 3OYJA 4D0PA 2FMYA 1J7KA 1WPKA 4XKWA 1FMWA 2OJED 4OIRF 2LLKA 3GYHX 3LFUA 1OCTC 3RZOJ 2HTJA 1W36D 2K9QA 2QQ8A 1P9QC 1PYVA 3V8JA 2BVLA 3CCMI 1MJBA 5EZGA 1MD0A 1XGMA 3WHCA 1J09A 5J3LA 9ANTA 2QSFX 1YIOA 1L3LA 4DZPA 2A68F 2DDAA 2W84A 4XKBA 3RDIA 3WGGA 3LOCA 2LRDA 2WA0A 4P1WA 5BNGA 1XDSA 5FKLA 5DM6F 3NEUA 2P7VB 2Q0OA 2M3AA 3TP3A 5D5VB 3GFMA 3DEUA 3WTSC 2F5EA 4PUSA 2KRFA 3BC8A 5EF6A 1CGPA 1MSEC 3HOUJ 3HOYJ 3E7LA 5EEHA 2UXNA 5D8LB 3AL0B 2DO7A 3KYLA 4B09A 1WH7A 3IAM2 1IN5A 1G3SA 1H9GA 4A3IJ 2G0EA 4FE4A 3PFIA 4AIKA 2P5VA 3G1OA 3PM1A 3TMOA 4LJZF 3OL4A 4I6ZA 3FXMA 1FX7A 3QOEA 3JSOA 3CZ6A 1RIOH 1U3EM 3HSRA 3SEQA 4YFXF 5K7ZA 1BOBA 3F0CA 5H6QA 2DTRA 4BHBA 2DOEA 1B1BA 2EFOA 2J5PA 2WAQN 2FD5A 3KP3A 3J7YJ 4UNOA 4A3GJ 2Y69H 3E5XA 1CF7A 1KU9A 3E97A 1UZCA 1WQ2A 1SMYF 2F4OB 4C3HJ 1DDNA 3R60A 3K4MA 2CO5A 2WB1N 2A6HF 4HG2A 2HTSA 4XLAA 3S2HJ 4ITVA 3EYYA 4MFEA 1IN6A 4PFPA 1WZ2A 3IAS2 1HA8A 2XPWA 1BW5A 5L3DA 2VOPA 2Q2EB 3WU0A 1IV6A 4NC8A 4UUSB 1SD7A 4KN4X 3RI4A 3Q5FA 3RKXA 1A31A 4D5CA 3FXKA 1ZRCA 2RKHA 3QOPA 5EJCA 1G2HA 2ELHA 2K40A 2VL8A 3L2UA 1R23A 3K4LA 3BR1A 4AYBA 2Y48A 2R7UA 3IH2A 4NC6A 1IV8A 2VJ4A 3CMEI 4Z6YA 2V1DA 3IP4B 2DI3A 2A6TA 1W36C 2L9SA 1YW9A 2EH3A 4Y33A 4FE7A 1Y1WJ 2Y31A 4QLCU 3K10A 4IHTA 3LAPA 2WTEA 4OWRB 1T98A 4UV9A 2A61A 1IAWA 3O8GA 1UHMA 3LFKA 2X48A 1I3QJ 3QP6A 3ABMH 5CVIA 5GPAA 5F27A 3T5XA 3QYBA 2HPIA 2DA1A 3G6EI 2NOGA 3CDIA 3FX3A 1ZQ3P 5FLMJ 3M4OJ 4A3CJ 3V4GA 2JZYA 2MH9A 2Y9ZA 1JTYA 3CCYA 1B8IB 5F0CA 3CCLI 2KT0A 3HTSB 1K79A 1T6SA 2XUBA 4Y4RA 1I50J 5L3CA 3AAFA 2DOFA 4EQQA 4MNUA 1QRYA 4ZYGA 1KQ0A 3P9CA 2CGPA 3F8MA 2DN0A 2VPRA 2ZC2A 1I27A 3CUQC 2I10A 3K2AA 3HBLA 3ZMSA 2IA1A 2FSWA 1LPQA 5E8GA 2DPUA 5IYDJ 2BW3A 3VSKA 3P5JA 1HLVA 1HF0A 1B4AA 3MWMA 3EUAA 4XRFA 1UB9A 4B3XA 2LF8A 1FJLA 2K27A 3RKYA 3ERMA 3G1LA 1DUXC 2HEOA 1LE8A 2GAUA 3Q9VA 5M5WJ 3QODA 4B8XA 2QKMB 1I6XA 2M2EA 2PI0A 2OPTA 1O3QA 4HNUA 3KLOA 2FNAA 3ABUA 2YSRA 2IGMA 5GAHJ 2M30A 3K6GA 3FXOA 4YG2F 1G59A 1X3WB 3DV8A 1VQKI 1JKOC 3CUQA 1XMXA 3EETA 3F9KA 3TW7A 1YTYA 2AQEA 3BR3A 5F64A 3KP7A 3DPUA 1N25A 3BTJA 1R58A 2DA7A 1KA8A 2EZIA 3ULQB 4ENNA 2O8KA 1VQ6I 1G8XA 1ETXA 4RLQA 3CP2A 3QPSA 1OCCH 5L3EA 2CG4A 3ZMDA 2KISA 2W85A 2XF5A 1SFUA 4NQWA 2FQ3A 1BJAA 4M6XA 5JR3A 3GZ5A 4XK4A 3RTRA 2K7LA 4V2GA 4BYYA 2JA8J 2HDCA 3PFYA 4CGZA 2R0QC 2FE3A 2PG4A 4P96A 3K70C 1Z21A 4QPOA 4RB3C 4PGHA 4CYCA 1LFPA 3J81Z 1UJ8A 4HYEA 5JVTA 3HB9A 4ZZLA 4IZZA 3FHZA 5CVVA 1UELB 4J00A 1R5GA 2O6GE 3GTLJ 5HLIA 3PL8A 1RRJA 3CJQB 5IOYA 3WTUC 1ENHA 2PFBA 2OTLI 3GTJJ 3PSFA 4M6VA 2ZJRF 2CMPA 3BTIA 3IH3A 1HKSA 1FBQA 2GXGA 4MHGA 5E3NA 2MH2A 4ZYAA 1GHCA 2RAEA 5C44J 4J01A 2O3FA 2KIMA 2DK5A 2KJBA 1Y56A 1ETOA 2H09A 3GXOA 1AKHA 3IKVA 4IHYA 2K9MA 5D5WB 5ICCA 5B1AH 4M73A 4BJ5C 1VZ0A 3ZXSA 5FFZA 3JTHA 3H5RA 5DD8A 3OYGA 4DYCA 3REOA 3HOZJ 1LEBA 2VONA 1JKRC 3BQYA 3OOUA 3PO3J 2F5CA 4QSHA 3H9JA 4E7KA 1QHGA 3M3YJ 3TW6A 1SVLA 2D2WA 2M8EA 3WTXC 2Q2EA 2IA2A 1LFUP 4BGDA 3PNYA 1FEXA 2L3DA 4E7SA 2JPCA 2BY2A 1VQLI 3ECOA 2QQAA 3DKYA 1Z6RA 1AWCA 1IGNA 3K2ZA 4OIQF 2R93J 4IHVA 2MW8A 3EYIA 3K7AJ 5HS7A 2PMZN 2M45A 5HOOA 1D3YA 1SANA 2LF7A 2ECCA 1FOKA 2MC3A 5JLWA 1W7PD 1XS9A 2G9WA 4DW6A 4HAMA 3FK7A 1GV2A 4N4NB 1QVTA 3BR6A 2KPMA 2NAZA 4YEJA 1S9HA 3JR9A 4XIDA 2NVTJ 1YW8A 4ABZA 4LLGF 4OIOF 2K9LA 3DKXA 3VSLA 1SD6A 4XKCA 1D0YA 5HODA 3WG7H 1RUOA 1ZH5A 2DDBA 3KE2A 3BDDA 1MJ9A 1LKXA 4Y52J 1A6IA 4A3KJ 3IUOA 1U8RA 1TQIA 3KEOA 4DNCA 1A35A 1WCMJ 2V4JC 1R9TJ 3BG7A 2VLAA 4G6QA 4FX0A 2V26A 3L09A 1ZG1A 4KN7X 4EM0B 1HC8A 1HW5A 1B72B 3OYKA 4AD9A 4L9JA 4UUTA 1FT9A 4L9NA 2E35A 1ZAOA 1IJWC 2CJJA 1XDUA 4IKFA 4BEHB 5E1XA 5DS9A 3OR2C 2Q8KA 3R61A 1O4XA 5LGUA 1JKPC 2N8GA 2P6TA 1JGSA 5IT9Z 2P81A 5CVJA 3ZRGA 5H6RA 2DJIA 5IT3A 5BPIA 4BNCA 1B9NA 4GXOA 4A2UA 4IRGA 5LEJA 5FJ8J 1H9TA 4LK1F 4OIPF 2Z2SB 1W7PA 3A03A 4XMYA 3FISA 1WKMA 4BJ6C 3RYRA 1K61A 5HNHA 2KZVA 4ESJA 3J7AY 1QO0D 1SVOA 2HNHA 4RGSA 3VDXA 4L5JA 3LAJA 2XAHA 2B7EA 3S8PA 4Y13A 2LKPA 1R6RA 2DFIA 2O03A 5F1JA 1N78A 1QA6A 1APLC 1HDPA 2XVCA 3KIOA 2RREA 4F55A 4KIBA 3GVAA 1MMSA 3V7SA 1Z7UA 2M4GA 2ICWG 1GXPA 2EA4A 1D0XA 2XPUA 3HUGA 1DU6A 4QWQA 3EUHA 2E7XA 4U0VA 1GVDA 1TC3C 2IS6A 3CCUI 2EIJH 3TOAA 4MLOA 4A93J 4CH7A 5F0FA 3SZPA 2HDDA 1IXCA 1BN5A 2L0KA 1VQ7I 1KU2A 2ZB9A 5GTHC 3CCEI 2L4MA 2OQGA 3I4MJ 1WJFA 1YJ9I 1X2NA 4CCNA 4KITB 1R4MB 2ADUA 4HNVA 2PJPA 2K9NA 3GTPJ 5HDKA 2L9RA 1IXSB 4Y17A 5KNLA 2DAOA 2NS7A 5J6XA 3OOPA 2F5VA 4I02A 1K78A 2M7BA 3BG3A 4Q5SF 4FETA 2XAQA 4U88A 1OMIA 2KKOA 4G7ZF 2VQGA 1PP8F 2ZJQF 1F43A 2WV0A 1FY7A 2YR2A 4Y15A 2YX7A 1LJ9A 5LGTA 3RKWA 2OCCH 1S8NA 2IGOA 5IP7J 2A5YB 1A6QA 2JA2A 4CCMA 1TQPA 3AG1H 1R00A 2KZGA 3ECHA 5CPRB 1OCZH 2R7DA 1P6RA 1JTXA 3VYTB 2PEXA 2DYRH 1DP7P 1X1BA 4X6AJ 3D1NI 1OYWA 2FX0A 1X1PA 4D1QA 1XSDA 2GQQA 4XRMA 1TL8A 3GZNB 5J4YA 2RVCA 3JAMK 3ZR8X 3KLNA 2DT7B 1WGXA 2R7RA 2E2HJ 1MNMC 4CICA 3SEZA 5K1YA 1EV7A 3Q9SA 1UHWA 4FHTA 1TNSA 4FASD 3LA2A 3TOBA 2I5UA 2H1KA 3OS0A 2DW4A 2XASA 1XSVA 3QYEA 4KDPA 4G6TB 1OYYA 3SHFA 4FISA 5HLTA 4P5OA 1RETA 2Z99A 3LQQA 4U7DA 5KAIC 4CZZA 1LNWA 3DEEA 3P7NA 3WTTC 4TV7A 2YX4A 4RAGA 5AIQA 2IRFG 1BC8C 3R4KA 3BR2A 1KONA 1T0FC 4ESBA 3SFIA 2VQCA 3DEWA 1R5ID 1SD5A 4LOCA 4BL0B 5BMZA 3KX2A 1YIJI 2LR8A 2VT3A 1G3TA 5FKOA 4BQAA 2LG4A 2VN2A 3GWZA 2HVQA 3OIQA 4I2OA 4I99C 1ZARA 4HNTA 2COBA 4AVZA 1FIPA 3Q0VA 3SQNA 2HDWA 2PMZA 5HDGA 4MTEA 1FYKA 4XLFA 3MVPA 2K9SA 1TT0A 2HPMA 2IGNA 5IY5H 2DJNA 4DOZA 1JHFA 3OYLA 1EJ9A 1T95A 4HW0A 1U9OA 5BQTA 5B3SH 4P9UA 3M8FA 2IAIA 2W00A 3I64A 2R7OA 5KCMA 3GTMJ 2R7QA 2EV5A 2F5DA 4JX5A 2HOEA 3ONQA 5J8CA 3F23A 2K3PA 5M3FJ 2NS8A 3BWGA 2EIKH 1SAUA 5LBQA 5HNFA 1WJEA 1W5TA 2KHMA 3S2WA 2JUCA 4RGXA 4QPQA 3U1DA 3R6SA 2HU9A 2L5QA 3M1EA 4BS9A 1QBJA 2GOXB 2ME0A 2NVYJ 3FBIB 1NHAA 1SFEA 3ABTA 4MIMA 3TBIA 5D5UB 2X85A 2G7HA 1ZKGA 3DU5A 3PNTA 5EEGA 4B4CA 1MKMA 2STTA 2R4GA 2FBKA 4JK1X 4DYRA 4LFUA 3VB2A 1RR7A 5IYBJ 4BHPA 2M34A 5CKTA 1MBKA 4DGWB 5J40A 2DOAA 4EJTA 5KAFC 3FKIJ 1FYLA 1TQMA 2AHQA 3E6BA 4ZDPA 4YFKF 4WXHA 3K4CA 4XN0A 4NUBA 1KQ8A 2P4WA 3S3OA 4AYBN 3L2CA 4BKXA 2H94A 3WTYC 1ZRFA 1TTYA 2EINH 4A3FJ 3COAC 2M87A 4MGRA 1SFOJ 2FEZA 4BHCA 2BHYA 4LG0A 5FO5A 3ZN1A 3I56I 1BI2A 1T39A 2EZHA 3OY9A 2E2IJ 2JJ7A 2HKOA 3DPLC 1YHQI 1Y6IA 1XD7A 2IXSA 2MSYA 4C30A 2CQQA 1VQOI 3GFLA 1HBXG 4LB5A 4WCGA 2DBBA 1MMNA 4L0YB 3U2RA 4F92B 5JHFA 2HQAA 5LRSA 2DFEA 1HQCA 3FHNA 2CFOA 4I98B 2QZ8A 1O3RA 1JUPA 3BCBA 2CQ7A 3FXRA 4N9HA 4U0YA 4HRIA 2JTVA 5FB2A 4U87A 3S2DJ 3WE2A 2DA6A 3BTLA 2HI3A 4N4OB 1SMTA 3H0DA 2FF4A 3HKZN 2E5NA 4OOIA 1MBFA 2QUFA 1R22A 4RAFA 3A4CA 2LKSA 2XHKA 3HKZA 3VWBA 3GLXA 2XB0X 5ILUA 1X4PA 2L2OA 4G7HF 2DMQA 2ISZA 4YELA 4F91B 3I54A 3S32A 5KK1A 4A5NA 5C4XJ 3RSNA 3ASNH 1R49A 3W2WA 4ASNA 2FOKA 3K1NA 4WX9A 2WBMA 3PUBA 2BXZA 2GWRA 2IS1A 2L9VA 1YJWI 4Q4ZF 4EV0A 4DIQA 3SDGA 4LK0F 1OR7A 3CLQA 3W6VA 2IGKA 3HHGA 3HHHA 1IF1A 3U1KA 1FSEA 5GADJ 1ULYA 1X4OA 2KIQA 3V42A 1Y1VJ 4ZC3A 3QYFA 4R1HA 5DCMB 4I7HA 2VKDA 1UHSA 2XSJC 2VE8A 2X1EA 1TWAJ 4RB0A 1V55H 2YU9J 1Z9CA 2XGDA 3E5QA 3H5NA 2RNGA 4E7LA 3G1MA 4ENKA 5FD5A 1E17A 1MBEA 1JKQC 3A01A 3BLYA 5DCMA 1R7JA 5H2FC 2V1NA 3O2PE 3VEPA 4A0XA 2F2EA 2FOWA 4LG0B 2QGUA 1JXSA 4HF0A 1ZELA 1E3HA 2RNJA 2IPQX 2LDUA 2QF7A 3BOQA 6PAXA 3I4NJ 4C2UA 2CV2A 5ICGA 4F3QA 3J7ZI 1QPIA 2QSGX 3GTOJ 3D0SA 3OIOA 4LITA 2L4AA 1W1WE 3FDYA 2X0LA 4N9IA 1WWXA 1RC9A 1OJLA 2LOOA 3DFGA 4MFDA 1TWCJ 2XGCA 3NAUA 5J1UA 1IC8A 1JJ6C 1HDDC 5ICFA 2Y75A 2O8XA 2Z5UA 1MZBA 4E7IA 3BR0A 2MFZA 1GXQA 3TKYA 1VNDA 1VQPI 4RAYA 1JGGA 1MBHA 2ZXJA 2NVQJ 4BU2A 2VBYA 2R7WA 2NRAC 1D8KA 4M3GA 5K5QA 3OV8A 2DODA 3S15J 3BJAA 1ZHFA 2HFHA 4FX4A 4IQ4A 3ZN0A 4L9TA 3IRQA 3CC2I 3CLOA 3EUHC 1KZHA 1TZLA 4Y3OA 3QP5A 2WV1A 3G71I 1AA7A 1PUEE 3M9AA 1T2KA 1BR1A 3CCVI 3JCUC 1MDMB 2A5WA 3TGNA 2XROA 4P55A 2KRCA 4XM3A 3L2WA 3WGHA 3TL4X 2MABA 1TW2A 1JUSA 2O9LA 1P92A 2MD5A 5A2QK 4GFBA 3G3ZA 3GEZA 3F21A 1K6OA 2DT6A 2RV8A 2R7FA 1B9MA 2COMA 4XRSG 2E2JJ 3LWFA 2XAJA 1F4KA 5D6EA 2AXTC 4XICA
chains in the Genus database with same CATH topology
2EFNA 1UFMA 2RQPA 3FF5A 1FP2A 2ZMEB 4LLLA 5ICEA 5D5XB 3MQ0A 1MJAA 3E3VA 2HGCA 3BROA 4CXFA 4PZJA 4OINF 2PN6A 1O3SA 3I53A 4LLNA 2HS5A 2MA3A 4HQMA 5FGMA 1FP1D 4CDGA 2Z3YA 2LSOA 1IW7F 2AS5F 3F6OA 1LQ1A 4AVPA 4DQ2A 3HYIA 3LQRA 4EM1A 2ZJ2A 1ON2A 1USSA 2EFWA 3B73A 3IHUA 3ERED 1ZGAA 3GFJA 3CUOA 2VOOA 4OU0A 2EFPA 1YO5C 1S7AA 5D4RA 1QPMA 3BY6A 4BH9A 1ZLJA 5ILSA 4OMZA 5K5RA 4Z2YA 1FSHA 5E18F 2XAGA 2OZ6A 4O6JA 4HQEA 2RGVA 1O57A 4IJAA 2XV4S 3ZP5A 1QNTA 1G4DA 5L3GA 5LEKA 1K78B 3TDZC 2RN7A 2IT0A 1Z1DA 3CTAA 4ZYEA 3L7WA 2H6BA 4UVBA 1WSUA 1O7LA 2GXBA 1U2WA 5JHUA 3LSTA 2FXAA 1ODDA 1ZRDA 4KNYA 3BJ6A 3CO7C 3I5UA 4UXNA 4RGRA 2ZCWA 2G7UA 2KIUA 3ML6A 2D45A 2XRNA 3WU1B 2MLKA 2IP2A 3KP4A 2CYYA 2OQRA 2L01A 4XLNF 3BPXA 3CJNA 3W6JB 1OKRA 2GA1A 2EV6A 1HKTA 2NNNA 1J0RA 4M74A 3QAHA 3CO6C 1ZG3A 1TBXA 5K5OA 4L5IA 3PQKA 4ZYDA 2FBHA 4NHJA 3R0AA 2P5KA 4EJOA 4M9ZA 3DQVC 3VOEA 5HS8A 2EWNA 4U7BA 1FC3A 3F22A 4MTDA 3SZTA 2QENA 1RUNA 3C18A 2QQBA 1B6AA 3ZMZA 2NYXA 1IRGA 3IC7A 1YS6A 1XCBA 3FWEA 2CQKA 1U5TA 1S6LA 1O3TA 4I0AA 1LDKB 2XGXA 4KA4A 1Z91A 4ZH4F 2O61A 1J9IA 3T8RA 2H27A 4WWCA 1IUYA 2EFQA 3U9GA 5F1RA 5DDGA 3F8FA 1U5TB 2FU4A 1FWZA 3IRRA 4R8HA 4MEXF 2FRHA 2BGCA 3M8EA 3DP7A 1SAXA 4KMUX 4HA8A 3GZ6A 2LNBA 2WWYA 1QZYA 4AIJA 4IF4A 3O3KA 2L54A 4UV8A 3I71A 5CVUA 2V6CA 2W57A 1ZLKA 2DU9A 5BS6A 3H92A 2ZKZA 1XN7A 3W6KB 4CYDA 2OAZA 1YQAA 4IPAA 4GCVA 3EDPA 1J2XA 3RJPA 3MZYA 2V1UA 1IXRC 4KUMA 3DXJF 3BZ6A 3KZZA 2PLYA 1IZ1A 2QM3A 4M9XA 1Y0UA 1MGTA 1YW7A 4Q47A 1J75A 2D1HA 4OMYA 3TDUC 1XB4A 3NQOA 5E1WA 4XSZF 2QLZA 4G6DA 4HOBA 2M1BA 5CVRA 1R1TA 1F1ZA 2JT1A 3FMRA 1YFHA 3RPQA 5AIPA 4RB2C 1QGPA 2PBIA 5DYMA 4ESFA 3ZMTA 1KYWA 3HIFA 4EJUA 3D5LA 2A6EF 4BXUA 4L9VA 2V1XA 1BIAA 1I1SA 2OA4A 2ZMEA 3DF8A 4XLPF 2UZKA 4MQVA 2V79A 1R1UA 4WXDA 3HSEA 1KGSA 3K1PA 3DPTA 1ZYRF 4KMFA 5DEQA 5J8FA 3C7JA 3J80K 5LGNA 2MLGA 1GVJA 4HF2A 4YIIA 5FLXK 3QPHA 4LB6B 4O5VA 3RYPA 4UUVA 2GZWA 1R1VA 2OBPA 4KICA 3HRUA 3FMQA 3BP8A 1T38A 1IN4A 2XIGA 1STZA 3KCCA 3V8KA 2FBIA 3F8CA 2DK8A 1JHHA 3ELKA 3WG9A 3K9TA 4G8XA 3IKTA 2PQ8A 2KIFA 4YIFA 5DD4A 2QBYB 4NB5A 1U5TC 2BEOA 2W25A 4IRIA 5IT9K 5HVQC 2CW0F 1EH7A 2H6CA 2A69F 1BC7C 1O7FA 3E5UA 3JW4A 1IN7A 2V9VA 2QVOA 2EV0A 3K1MA 4M9SA 2HYFA 4EMSA 1W7PB 4EM2A 3QU3A 4EJVA 4N0BA 2DLLA 2AXLA 3F8NA 2HQRA 1Q1HA 3TO6A 4HX4A 2IW5A 3MFKA 3FM3A 3WTVC 3P9IA 1B59A 2EJRA 2VXZA 1A04A 1XMKA 3P9KA 4HX7A 1BI3A 4Q48A 5LRRA 2P8TA 2VBWA 1WI9A 4IXAA 5F6FA 4WF2A 2HKXA 5DUKA 1TW3A 3VFZA 1F9NA 3GUDA 3KP6A 5CYVA 2EA2A 3KP5A 1SFXA 2XAFA 2YPRA 3DKWA 2K02A 2CWEA 1RI7A 2ESHA 2HZTA 4M71A 3ZMUA 3JTGA 3HOTA 1I5ZA 3L9FA 2BV6A 2DQRA 2NS0A 1YYVA 4UHTA 5AONA 5FFXA 2DPDA 3E6DA 5DV5A 1LDJA 2E1NA 4IRHA 1YLFA 1QZZA 4G9YA 5E1ZB 3M7GA 2EB7A 4JQFA 3RPUA 1XGNA 2HYGD 3E6CC 1REPC 1SD4A 1UCRA 1S29A 5DCFA 2L02A 4HX8A 1KU7A 5CLSA 1USTA 5ILVA 2D1VA 2ZNZA 4KIFA 5BPDA 2FA5A 2ZFWA 1L0OC 2P6SA 3EQLF 3T1BA 1RZ4A 1J59A 3KZYA 4LD5A 3F8BA 1ONVA 3CUQB 3N4MA 4HLXA 1FBSA 4LGWA 1ON1A 5L3FA 4RS8A 3KEQA 4HBLA 4I01A 4S04A 3WODF 2ACJA 3K0LA 2WC2A 2A07F 5BOXA 3PQJA 2MBFA 3L00A 2JSCA 2ZNYA 3F72A 2YU3A 2E7WA 4I0BA 1U78A 3SFZA 1V3FA 3GF2A 3SXYA 2VC1A 4HLYA 2VBZA 2C6YA 2W24A 4F7ZA 4L0ZB 3MEXA 3J81K 4HDVA 5LLQA 1FPQA 2IVMA 2E1CA 1PDNC 5D4SA 1G3YA 3GO5A 2HQNA 2QYOA 3KP2A 4GGGA 1W4MA 5H20A 3QPTA 3V8LA 4EGZA 2VT2A 1FYMA 2IJLA 4PCQA 1BIBA 3C3WA 3E6MA 3GX4X 1W5SA 2XKOA 1DPRA 4GYIA 4IHSA 1CF7B 3I58A 3TO7A 1F5TA 2ETHA 1WRJA 1ZREA 1T0FA 5HLHA 3WTWC 4PDKA 1JE8A 3IWFA 3VODA 5DUIA 4ENMA 2M5WA 4ON0A 4MQ9F 3O6BB 1BBYA 3I59A 4CHUA 5E17F 4A6DA 5HDNA 1BOAA 3NRVA 4A0ZA 1EH6A 2CFXA 4HF1A 2KJCA 4KFCA 4KYWA 3T0YA 2OZUA 3JSPA 4UVAA 3WTZA 2FMLA 3I59B 1AOYA 1V4RA 1BI1A 3HRMA 3WE3A 5JFRA 2QWWA 3HRSA 4MEYF 1G3WA 2GA2A 2XKPA 2K4BA 1ZN2A 1LDDA 2BYVE 2NNYA 1HW1A 4A6EA 5LHIA 3BJOA 3R0JA 3FMSA 3FXQA 1DPUA 1LEAA 4XBFA 5E20A 3JAMZ 1H0MA 3MAJA 2P5LC 1XSXA 5L3BA 2STWA 3ZMVA 3H3UA 1RNLA 3C1DA 5FLXZ 3F3XA 2Y0MA 2J5OA 1YG2A 2GIVA 2OD5A 3KFWX 1X3UA 3J7AO 1K7AA 3FXUA 5A2QZ 2PMHA 1YS7A 2P7CB 4HV5A 3V7RA 4A5MA 2RC4A 5D6FA 4UVCA 4S05A 2QQ9A 3LA3A 2K86A 4HV6A 4GYGA 4R79A 2B0LA 1Z05A 2F5FA 1XMAA 1FZPB 3G73A 3GW2A 2DT5A 5ED4A 2PMUA 4PGGA 5HS9A 4XSXF 1P4WA 4A0YA 5TRDA 3H3ZA 3J80Z 4I09A 2EK5A 3RIRA 3IL2A 1S3JA 2VC0A 1ZGJA 1IN8A 1XGOA 1QQIA 4EGYA 1S7OA 3HOSA 4HDUA 1D8JA 3FM5A 2QBYA 1Z6TA 3N97A 2ISYA 1KYZA 4EJWA 2HR3A 1U6GA 4ZYHA 3GFIA 4FT8A 4RAZA 4KIGA 1IRFA 2JPBA 2JRTA 1XCVA 3WGIA 4GO1A 3ZQ7A 1KU3A 2TDXA 4AWXB 5JI6A 5LHGA 2Z33A 1EH8A 1OYIA 3V7CA 2Z9OA 3K69A 1HXDA 5TJJA 1LB2A 1P4XA 3TO9A 4BAYA 1XGSA 3TQNA 4EVIA 4CO8A 3I0TA 4E70A 1HW2A 4JBAA 4M6YA 4RGUA 3MCZA 1TLHB 4AIHA 4YFNF 4IVNA 1FBUA 5LHHA 2A3SA 2VE9A 2VBXA 1D5VA 1LVAA 3CDHA 4KT5C 3ZPLA 2R3SA 3F6VA 4ZZDA 1FLIA 1ZG5A 3FZVA 4ETSA 1HSJA 5E8IA 4H0EA 1HKQA 1P4AA 5FD6A 4WXCA 1VTNC 4WK8F 1P2FA 2BE5F 2ESNA 4M72A 1TNTA 2K4JA 1E2XA 1G6NA 2UWMA 1OPCA 2VODA 2RDPA 3KETA 3MZHA 2ZBKA 3LA7A 1MDMA 2CSOA 5D8KB 5ERIA 4L18B 2O0YA 2IA0A 2HWVA 3IWZA 3HRTA 4RB1A 4P9FA 1HSTA 4K2EA 1R36A 3QU6A 1J5YA 2FNPA 5CJ9A 1BM9A 1FNNA 3ISPA 1I1GA 4U0WA 4O3MA 3ROUA 4ENJA 3HSFA 3T8TA 4LMYA 2BBYA 3B02A 3HTUA 5HLGA 3I4PA 4A12A 2X4HA 2OU2A 5KVRA 4G7OF 1BI0A 2ZO4A 3BPVA 1KQ9A 1R5HA 2DQLA 2UXXA 3QRFF 4G94A 1PP7U 4HZFA 1C0WA 4D0PA 2FMYA 1J7KA 4OIRF 3GYHX 2HTJA 3V8JA 1MJBA 1MD0A 1XGMA 1YIOA 1L3LA 2A68F 3WGGA 2W84A 3RDIA 1XDSA 3NEUA 2P7VB 2Q0OA 5D5VB 3GFMA 3DEUA 3WTSC 2F5EA 2KRFA 1CGPA 5EEHA 2UXNA 5D8LB 2DO7A 4B09A 1IN5A 1G3SA 1H9GA 3PFIA 4AIKA 2P5VA 4LJZF 1FX7A 3JSOA 1RIOH 1U3EM 3HSRA 4YFXF 5H6QA 2DTRA 4BHBA 1B1BA 2EFOA 2J5PA 3KP3A 4UNOA 3E5XA 1CF7A 1KU9A 3E97A 1WQ2A 1SMYF 1DDNA 3R60A 2CO5A 2A6HF 2HTSA 3EYYA 1IN6A 5L3DA 2VOPA 3WU0A 1SD7A 4KN4X 3RI4A 3Q5FA 3RKXA 1ZRCA 2RKHA 3QOPA 2ELHA 1R23A 2Y48A 2V1DA 2DI3A 1YW9A 4QLCU 4IHTA 3LAPA 2WTEA 1T98A 4UV9A 2A61A 1IAWA 1UHMA 3LFKA 3QP6A 5CVIA 3T5XA 3FX3A 3V4GA 2JZYA 2MH9A 3HTSB 1K79A 1T6SA 2XUBA 5L3CA 3AAFA 4EQQA 4MNUA 4ZYGA 1KQ0A 3P9CA 2CGPA 3F8MA 3CUQC 1I27A 3ZMSA 2IA1A 2FSWA 5E8GA 2DPUA 1B4AA 3MWMA 4XRFA 1UB9A 2LF8A 2K27A 3RKYA 1DUXC 2HEOA 2GAUA 3Q9VA 4B8XA 1I6XA 2PI0A 1O3QA 3KLOA 2FNAA 3ABUA 2YSRA 2M30A 4YG2F 3DV8A 3CUQA 3EETA 1YTYA 5F64A 3KP7A 1R58A 1KA8A 3ULQB 4ENNA 5L3EA 2CG4A 3ZMDA 2W85A 1SFUA 4NQWA 2FQ3A 1BJAA 4M6XA 5JR3A 3GZ5A 3RTRA 2K7LA 4BYYA 2HDCA 4CGZA 2FE3A 2PG4A 4P96A 4RB3C 4PGHA 3J81Z 4HYEA 5JVTA 4ZZLA 3FHZA 5CVVA 2O6GE 1R5GA 5HLIA 3WTUC 2PFBA 4MHGA 1HKSA 1FBQA 2GXGA 2MH2A 1GHCA 2O3FA 2KIMA 2DK5A 2KJBA 2H09A 3GXOA 3IKVA 5D5WB 5ICCA 4M73A 5FFZA 3JTHA 5DD8A 3REOA 1LEBA 2VONA 2F5CA 2D2WA 2M8EA 3WTXC 2Q2EA 2IA2A 2L3DA 2JPCA 2QQAA 3ECOA 1Z6RA 4OIQF 1AWCA 3K2ZA 3EYIA 5HS7A 2M45A 5HOOA 1D3YA 2LF7A 1FOKA 2MC3A 1W7PD 2G9WA 4HAMA 2NAZA 1YW8A 4LLGF 4OIOF 1SD6A 1RUOA 1ZH5A 3KE2A 3BDDA 1MJ9A 1U8RA 1TQIA 3KEOA 4DNCA 4G6QA 4FX0A 3L09A 1ZG1A 4KN7X 4EM0B 1HW5A 4AD9A 4L9JA 1FT9A 4L9NA 1ZAOA 1XDUA 5E1XA 2Q8KA 3R61A 5LGUA 2P6TA 1JGSA 5IT9Z 5CVJA 5H6RA 5BPIA 5IT3A 4BNCA 1B9NA 4GXOA 4A2UA 4IRGA 5LEJA 1H9TA 4LK1F 4OIPF 1W7PA 1WKMA 3RYRA 4ESJA 1QO0D 4RGSA 4L5JA 3LAJA 2XAHA 4Y13A 2LKPA 2DFIA 2O03A 2XVCA 4KIBA 3GVAA 3V7SA 1Z7UA 1GXPA 2EA4A 3HUGA 4QWQA 3EUHA 2E7XA 4U0VA 3TOAA 3SZPA 1IXCA 1BN5A 1KU2A 2L4MA 2OQGA 2ADUA 2PJPA 5HDKA 1IXSB 4Y17A 2DAOA 5J6XA 3OOPA 4I02A 1K78A 4Q5SF 2XAQA 4U88A 1OMIA 2KKOA 4G7ZF 1PP8F 2WV0A 1FY7A 2YR2A 4Y15A 2YX7A 1LJ9A 5LGTA 3RKWA 1S8NA 2A5YB 1TQPA 1R00A 3ECHA 2R7DA 1P6RA 2PEXA 1DP7P 1OYWA 1XSDA 2GQQA 2RVCA 3JAMK 3KLNA 4CICA 5K1YA 1EV7A 3Q9SA 1UHWA 4FHTA 1TNSA 3LA2A 3TOBA 2DW4A 2XASA 1XSVA 4KDPA 1OYYA 3SHFA 4P5OA 3LQQA 2Z99A 4U7DA 4CZZA 1LNWA 3P7NA 3WTTC 2IRFG 4TV7A 2YX4A 5AIQA 1BC8C 3R4KA 4ESBA 5BMZA 1SD5A 2VT3A 1G3TA 4BQAA 2VN2A 3GWZA 4I2OA 1ZARA 3SQNA 5HDGA 4MTEA 1FYKA 1JHFA 4HW0A 5BQTA 4P9UA 3M8FA 3I64A 2F5DA 2EV5A 2HOEA 5J8CA 3F23A 3BWGA 5LBQA 1W5TA 3S2WA 4RGXA 3U1DA 3R6SA 3M1EA 1QBJA 1NHAA 1SFEA 3ABTA 5D5UB 2G7HA 5EEGA 1MKMA 2STTA 2FBKA 4JK1X 4LFUA 3VB2A 4BHPA 4EJTA 1FYLA 1TQMA 3E6BA 4YFKF 4WXHA 1KQ8A 2P4WA 3L2CA 2H94A 3WTYC 1ZRFA 1TTYA 3COAC 2M87A 4MGRA 2FEZA 4BHCA 4LG0A 5FO5A 3ZN1A 1BI2A 1T39A 2HKOA 3DPLC 1XD7A 3GFLA 1HBXG 4LB5A 4WCGA 2DBBA 4L0YB 3U2RA 5LRSA 1HQCA 4I98B 2QZ8A 1O3RA 3FXRA 4N9HA 4U0YA 2JTVA 5FB2A 3WE2A 1SMTA 2FF4A 4OOIA 2QUFA 1R22A 2XHKA 3GLXA 5ILUA 4G7HF 2ISZA 3I54A 5KK1A 4A5NA 4ASNA 2FOKA 3K1NA 4WX9A 2GWRA 4Q4ZF 4EV0A 4LK0F 1OR7A 3HHGA 3HHHA 1IF1A 1FSEA 1ULYA 4R1HA 5DCMB 4I7HA 2VE8A 4RB0A 1Z9CA 3E5QA 4ENKA 5FD5A 1E17A 5DCMA 1R7JA 3O2PE 3VEPA 4A0XA 2F2EA 4LG0B 1JXSA 4HF0A 2RNJA 2IPQX 2LDUA 6PAXA 3BOQA 5ICGA 3D0SA 2L4AA 2X0LA 4N9IA 1WWXA 3DFGA 5ICFA 2Y75A 2O8XA 2Z5UA 1MZBA 1GXQA 3TKYA 4RAYA 2ZXJA 2VBYA 2NRAC 1D8KA 5K5QA 3OV8A 3BJAA 1ZHFA 2HFHA 4FX4A 3ZN0A 4L9TA 3IRQA 3CLOA 3QP5A 1PUEE 3M9AA 1T2KA 1MDMB 3TGNA 2XROA 4P55A 3WGHA 1TW2A 1P92A 2MD5A 5A2QK 3G3ZA 3GEZA 3F21A 1K6OA 2RV8A 2R7FA 1B9MA 2COMA 3LWFA 2XAJA 1F4KA 5D6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFN A;  1UFM A;  2RQP A;  3FF5 A;  1FP2 A;  2ZME B;  4LLL A;  5ICE A;  5D5X B;  3MQ0 A;  1MJA A;  3E3V A;  2HGC A;  3BRO A;  4CXF A;  4PZJ A;  4OIN F;  2PN6 A;  1O3S A;  3I53 A;  4LLN A;  2HS5 A;  2MA3 A;  4HQM A;  5FGM A;  1FP1 D;  4CDG A;  2Z3Y A;  2LSO A;  1IW7 F;  2AS5 F;  3F6O A;  1LQ1 A;  4AVP A;  4DQ2 A;  3HYI A;  3LQR A;  4EM1 A;  2ZJ2 A;  1ON2 A;  1USS A;  2EFW A;  3B73 A;  3IHU A;  3ERE D;  1ZGA A;  3GFJ A;  3CUO A;  2VOO A;  4OU0 A;  2EFP A;  1YO5 C;  1S7A A;  5D4R A;  1QPM A;  3BY6 A;  4BH9 A;  1ZLJ A;  5ILS A;  4OMZ A;  5K5R A;  4Z2Y A;  1FSH A;  5E18 F;  2XAG A;  2OZ6 A;  4O6J A;  4HQE A;  2RGV A;  1O57 A;  4IJA A;  2XV4 S;  3ZP5 A;  1QNT A;  1G4D A;  5L3G A;  5LEK A;  1K78 B;  3TDZ C;  2RN7 A;  2IT0 A;  1Z1D A;  3CTA A;  4ZYE A;  3L7W A;  2H6B A;  4UVB A;  1WSU A;  1O7L A;  2GXB A;  1U2W A;  5JHU A;  3LST A;  2FXA A;  1ODD A;  1ZRD A;  4KNY A;  3BJ6 A;  3CO7 C;  3I5U A;  4UXN A;  4RGR A;  2ZCW A;  2G7U A;  2KIU A;  3ML6 A;  2D45 A;  2XRN A;  3WU1 B;  2MLK A;  2IP2 A;  3KP4 A;  2CYY A;  2OQR A;  2L01 A;  4XLN F;  3BPX A;  3CJN A;  3W6J B;  1OKR A;  2GA1 A;  2EV6 A;  1HKT A;  2NNN A;  1J0R A;  4M74 A;  3QAH A;  3CO6 C;  1ZG3 A;  1TBX A;  5K5O A;  4L5I A;  3PQK A;  4ZYD A;  2FBH A;  4NHJ A;  3R0A A;  2P5K A;  4EJO A;  4M9Z A;  3DQV C;  3VOE A;  5HS8 A;  2EWN A;  4U7B A;  1FC3 A;  3F22 A;  4MTD A;  3SZT A;  2QEN A;  1RUN A;  3C18 A;  2QQB A;  1B6A A;  3ZMZ A;  2NYX A;  1IRG A;  3IC7 A;  1YS6 A;  1XCB A;  3FWE A;  2CQK A;  1U5T A;  1S6L A;  1O3T A;  4I0A A;  1LDK B;  2XGX A;  4KA4 A;  1Z91 A;  4ZH4 F;  2O61 A;  1J9I A;  3T8R A;  2H27 A;  4WWC A;  1IUY A;  2EFQ A;  3U9G A;  5F1R A;  5DDG A;  3F8F A;  1U5T B;  2FU4 A;  1FWZ A;  3IRR A;  4R8H A;  4MEX F;  2FRH A;  2BGC A;  3M8E A;  3DP7 A;  1SAX A;  4KMU X;  4HA8 A;  3GZ6 A;  2LNB A;  2WWY A;  1QZY A;  4AIJ A;  4IF4 A;  3O3K A;  2L54 A;  4UV8 A;  3I71 A;  5CVU A;  2V6C A;  2W57 A;  1ZLK A;  2DU9 A;  5BS6 A;  3H92 A;  2ZKZ A;  1XN7 A;  3W6K B;  4CYD A;  2OAZ A;  1YQA A;  4IPA A;  4GCV A;  3EDP A;  1J2X A;  3RJP A;  3MZY A;  2V1U A;  1IXR C;  4KUM A;  3DXJ F;  3BZ6 A;  3KZZ A;  2PLY A;  1IZ1 A;  2QM3 A;  4M9X A;  1Y0U A;  1MGT A;  1YW7 A;  4Q47 A;  1J75 A;  2D1H A;  4OMY A;  3TDU C;  1XB4 A;  3NQO A;  5E1W A;  4XSZ F;  2QLZ A;  4G6D A;  4HOB A;  2M1B A;  5CVR A;  1R1T A;  1F1Z A;  2JT1 A;  3FMR A;  1YFH A;  3RPQ A;  5AIP A;  4RB2 C;  1QGP A;  2PBI A;  5DYM A;  4ESF A;  3ZMT A;  1KYW A;  3HIF A;  4EJU A;  3D5L A;  2A6E F;  4BXU A;  4L9V A;  2V1X A;  1BIA A;  1I1S A;  2OA4 A;  2ZME A;  3DF8 A;  4XLP F;  2UZK A;  4MQV A;  2V79 A;  1R1U A;  4WXD A;  3HSE A;  1KGS A;  3K1P A;  3DPT A;  1ZYR F;  4KMF A;  5DEQ A;  5J8F A;  3C7J A;  3J80 K;  5LGN A;  2MLG A;  1GVJ A;  4HF2 A;  4YII A;  5FLX K;  3QPH A;  4LB6 B;  4O5V A;  3RYP A;  4UUV A;  2GZW A;  1R1V A;  2OBP A;  4KIC A;  3HRU A;  3FMQ A;  3BP8 A;  1T38 A;  1IN4 A;  2XIG A;  1STZ A;  3KCC A;  3V8K A;  2FBI A;  3F8C A;  2DK8 A;  1JHH A;  3ELK A;  3WG9 A;  3K9T A;  4G8X A;  3IKT A;  2PQ8 A;  2KIF A;  4YIF A;  5DD4 A;  2QBY B;  4NB5 A;  1U5T C;  2BEO A;  2W25 A;  4IRI A;  5IT9 K;  5HVQ C;  2CW0 F;  1EH7 A;  2H6C A;  2A69 F;  1BC7 C;  1O7F A;  3E5U A;  3JW4 A;  1IN7 A;  2V9V A;  2QVO A;  2EV0 A;  3K1M A;  4M9S A;  2HYF A;  4EMS A;  1W7P B;  4EM2 A;  3QU3 A;  4EJV A;  4N0B A;  2DLL A;  2AXL A;  3F8N A;  2HQR A;  1Q1H A;  3TO6 A;  4HX4 A;  2IW5 A;  3MFK A;  3FM3 A;  3WTV C;  3P9I A;  1B59 A;  2EJR A;  2VXZ A;  1A04 A;  1XMK A;  3P9K A;  4HX7 A;  1BI3 A;  4Q48 A;  5LRR A;  2P8T A;  2VBW A;  1WI9 A;  4IXA A;  5F6F A;  4WF2 A;  2HKX A;  5DUK A;  1TW3 A;  3VFZ A;  1F9N A;  3GUD A;  3KP6 A;  5CYV A;  2EA2 A;  3KP5 A;  1SFX A;  2XAF A;  2YPR A;  3DKW A;  2K02 A;  2CWE A;  1RI7 A;  2ESH A;  2HZT A;  4M71 A;  3ZMU A;  3JTG A;  3HOT A;  1I5Z A;  3L9F A;  2BV6 A;  2DQR A;  2NS0 A;  1YYV A;  4UHT A;  5AON A;  5FFX A;  2DPD A;  3E6D A;  5DV5 A;  1LDJ A;  2E1N A;  4IRH A;  1YLF A;  1QZZ A;  4G9Y A;  5E1Z B;  3M7G A;  2EB7 A;  4JQF A;  3RPU A;  1XGN A;  2HYG D;  3E6C C;  1REP C;  1SD4 A;  1UCR A;  1S29 A;  5DCF A;  2L02 A;  4HX8 A;  1KU7 A;  5CLS A;  1UST A;  5ILV A;  2D1V A;  2ZNZ A;  4KIF A;  5BPD A;  2FA5 A;  2ZFW A;  1L0O C;  2P6S A;  3EQL F;  3T1B A;  1RZ4 A;  1J59 A;  3KZY A;  4LD5 A;  3F8B A;  1ONV A;  3CUQ B;  3N4M A;  4HLX A;  1FBS A;  4LGW A;  1ON1 A;  5L3F A;  4RS8 A;  3KEQ A;  4HBL A;  4I01 A;  4S04 A;  3WOD F;  2ACJ A;  3K0L A;  2WC2 A;  2A07 F;  5BOX A;  3PQJ A;  2MBF A;  3L00 A;  2JSC A;  2ZNY A;  3F72 A;  2YU3 A;  2E7W A;  4I0B A;  1U78 A;  3SFZ A;  1V3F A;  3GF2 A;  3SXY A;  2VC1 A;  4HLY A;  2VBZ A;  2C6Y A;  2W24 A;  4F7Z A;  4L0Z B;  3MEX A;  3J81 K;  4HDV A;  5LLQ A;  1FPQ A;  2IVM A;  2E1C A;  1PDN C;  5D4S A;  1G3Y A;  3GO5 A;  2HQN A;  2QYO A;  3KP2 A;  4GGG A;  1W4M A;  5H20 A;  3QPT A;  3V8L A;  4EGZ A;  2VT2 A;  1FYM A;  2IJL A;  4PCQ A;  1BIB A;  3C3W A;  3E6M A;  3GX4 X;  1W5S A;  2XKO A;  1DPR A;  4GYI A;  4IHS A;  1CF7 B;  3I58 A;  3TO7 A;  1F5T A;  2ETH A;  1WRJ A;  1ZRE A;  1T0F A;  5HLH A;  3WTW C;  4PDK A;  1JE8 A;  3IWF A;  3VOD A;  5DUI A;  4ENM A;  2M5W A;  4ON0 A;  4MQ9 F;  3O6B B;  1BBY A;  3I59 A;  4CHU A;  5E17 F;  4A6D A;  5HDN A;  1BOA A;  3NRV A;  4A0Z A;  1EH6 A;  2CFX A;  4HF1 A;  2KJC A;  4KFC A;  4KYW A;  3T0Y A;  2OZU A;  3JSP A;  4UVA A;  3WTZ A;  2FML A;  3I59 B;  1AOY A;  1V4R A;  1BI1 A;  3HRM A;  3WE3 A;  5JFR A;  2QWW A;  3HRS A;  4MEY F;  1G3W A;  2GA2 A;  2XKP A;  2K4B A;  1ZN2 A;  1LDD A;  2BYV E;  2NNY A;  1HW1 A;  4A6E A;  5LHI A;  3BJO A;  3R0J A;  3FMS A;  3FXQ A;  1DPU A;  1LEA A;  4XBF A;  5E20 A;  3JAM Z;  1H0M A;  3MAJ A;  2P5L C;  1XSX A;  5L3B A;  2STW A;  3ZMV A;  3H3U A;  1RNL A;  3C1D A;  5FLX Z;  3F3X A;  2Y0M A;  2J5O A;  1YG2 A;  2GIV A;  2OD5 A;  3KFW X;  1X3U A;  3J7A O;  1K7A A;  3FXU A;  5A2Q Z;  2PMH A;  1YS7 A;  2P7C B;  4HV5 A;  3V7R A;  4A5M A;  2RC4 A;  5D6F A;  4UVC A;  4S05 A;  2QQ9 A;  3LA3 A;  2K86 A;  4HV6 A;  4GYG A;  4R79 A;  2B0L A;  1Z05 A;  2F5F A;  1XMA A;  1FZP B;  3G73 A;  3GW2 A;  2DT5 A;  5ED4 A;  2PMU A;  4PGG A;  5HS9 A;  4XSX F;  1P4W A;  4A0Y A;  5TRD A;  3H3Z A;  3J80 Z;  4I09 A;  2EK5 A;  3RIR A;  3IL2 A;  1S3J A;  2VC0 A;  1ZGJ A;  1IN8 A;  1XGO A;  1QQI A;  4EGY A;  1S7O A;  3HOS A;  4HDU A;  1D8J A;  3FM5 A;  2QBY A;  1Z6T A;  3N97 A;  2ISY A;  1KYZ A;  4EJW A;  2HR3 A;  1U6G A;  4ZYH A;  3GFI A;  4FT8 A;  4RAZ A;  4KIG A;  1IRF A;  2JPB A;  2JRT A;  1XCV A;  3WGI A;  4GO1 A;  3ZQ7 A;  1KU3 A;  2TDX A;  4AWX B;  5JI6 A;  5LHG A;  2Z33 A;  1EH8 A;  1OYI A;  3V7C A;  2Z9O A;  3K69 A;  1HXD A;  5TJJ A;  1LB2 A;  1P4X A;  3TO9 A;  4BAY A;  1XGS A;  3TQN A;  4EVI A;  4CO8 A;  3I0T A;  4E70 A;  1HW2 A;  4JBA A;  4M6Y A;  4RGU A;  3MCZ A;  1TLH B;  4AIH A;  4YFN F;  4IVN A;  1FBU A;  5LHH A;  2A3S A;  2VE9 A;  2VBX A;  1D5V A;  1LVA A;  3CDH A;  4KT5 C;  3ZPL A;  2R3S A;  3F6V A;  4ZZD A;  1FLI A;  1ZG5 A;  3FZV A;  4ETS A;  1HSJ A;  5E8I A;  4H0E A;  1HKQ A;  1P4A A;  5FD6 A;  4WXC A;  1VTN C;  4WK8 F;  1P2F A;  2BE5 F;  2ESN A;  4M72 A;  1TNT A;  2K4J A;  1E2X A;  1G6N A;  2UWM A;  1OPC A;  2VOD A;  2RDP A;  3KET A;  3MZH A;  2ZBK A;  3LA7 A;  1MDM A;  2CSO A;  5D8K B;  5ERI A;  4L18 B;  2O0Y A;  2IA0 A;  2HWV A;  3IWZ A;  3HRT A;  4RB1 A;  4P9F A;  1HST A;  4K2E A;  1R36 A;  3QU6 A;  1J5Y A;  2FNP A;  5CJ9 A;  1BM9 A;  1FNN A;  3ISP A;  1I1G A;  4U0W A;  4O3M A;  3ROU A;  4ENJ A;  3HSF A;  3T8T A;  4LMY A;  2BBY A;  3B02 A;  3HTU A;  5HLG A;  3I4P A;  4A12 A;  2X4H A;  2OU2 A;  5KVR A;  4G7O F;  1BI0 A;  2ZO4 A;  3BPV A;  1KQ9 A;  1R5H A;  2DQL A;  2UXX A;  3QRF F;  4G94 A;  1PP7 U;  4HZF A;  1C0W A;  4D0P A;  2FMY A;  1J7K A;  4OIR F;  3GYH X;  2HTJ A;  3V8J A;  1MJB A;  1MD0 A;  1XGM A;  1YIO A;  1L3L A;  2A68 F;  3WGG A;  2W84 A;  3RDI A;  1XDS A;  3NEU A;  2P7V B;  2Q0O A;  5D5V B;  3GFM A;  3DEU A;  3WTS C;  2F5E A;  2KRF A;  1CGP A;  5EEH A;  2UXN A;  5D8L B;  2DO7 A;  4B09 A;  1IN5 A;  1G3S A;  1H9G A;  3PFI A;  4AIK A;  2P5V A;  4LJZ F;  1FX7 A;  3JSO A;  1RIO H;  1U3E M;  3HSR A;  4YFX F;  5H6Q A;  2DTR A;  4BHB A;  1B1B A;  2EFO A;  2J5P A;  3KP3 A;  4UNO A;  3E5X A;  1CF7 A;  1KU9 A;  3E97 A;  1WQ2 A;  1SMY F;  1DDN A;  3R60 A;  2CO5 A;  2A6H F;  2HTS A;  3EYY A;  1IN6 A;  5L3D A;  2VOP A;  3WU0 A;  1SD7 A;  4KN4 X;  3RI4 A;  3Q5F A;  3RKX A;  1ZRC A;  2RKH A;  3QOP A;  2ELH A;  1R23 A;  2Y48 A;  2V1D A;  2DI3 A;  1YW9 A;  4QLC U;  4IHT A;  3LAP A;  2WTE A;  1T98 A;  4UV9 A;  2A61 A;  1IAW A;  1UHM A;  3LFK A;  3QP6 A;  5CVI A;  3T5X A;  3FX3 A;  3V4G A;  2JZY A;  2MH9 A;  3HTS B;  1K79 A;  1T6S A;  2XUB A;  5L3C A;  3AAF A;  4EQQ A;  4MNU A;  4ZYG A;  1KQ0 A;  3P9C A;  2CGP A;  3F8M A;  3CUQ C;  1I27 A;  3ZMS A;  2IA1 A;  2FSW A;  5E8G A;  2DPU A;  1B4A A;  3MWM A;  4XRF A;  1UB9 A;  2LF8 A;  2K27 A;  3RKY A;  1DUX C;  2HEO A;  2GAU A;  3Q9V A;  4B8X A;  1I6X A;  2PI0 A;  1O3Q A;  3KLO A;  2FNA A;  3ABU A;  2YSR A;  2M30 A;  4YG2 F;  3DV8 A;  3CUQ A;  3EET A;  1YTY A;  5F64 A;  3KP7 A;  1R58 A;  1KA8 A;  3ULQ B;  4ENN A;  5L3E A;  2CG4 A;  3ZMD A;  2W85 A;  1SFU A;  4NQW A;  2FQ3 A;  1BJA A;  4M6X A;  5JR3 A;  3GZ5 A;  3RTR A;  2K7L A;  4BYY A;  2HDC A;  4CGZ A;  2FE3 A;  2PG4 A;  4P96 A;  4RB3 C;  4PGH A;  3J81 Z;  4HYE A;  5JVT A;  4ZZL A;  3FHZ A;  5CVV A;  2O6G E;  1R5G A;  5HLI A;  3WTU C;  2PFB A;  4MHG A;  1HKS A;  1FBQ A;  2GXG A;  2MH2 A;  1GHC A;  2O3F A;  2KIM A;  2DK5 A;  2KJB A;  2H09 A;  3GXO A;  3IKV A;  5D5W B;  5ICC A;  4M73 A;  5FFZ A;  3JTH A;  5DD8 A;  3REO A;  1LEB A;  2VON A;  2F5C A;  2D2W A;  2M8E A;  3WTX C;  2Q2E A;  2IA2 A;  2L3D A;  2JPC A;  2QQA A;  3ECO A;  1Z6R A;  4OIQ F;  1AWC A;  3K2Z A;  3EYI A;  5HS7 A;  2M45 A;  5HOO A;  1D3Y A;  2LF7 A;  1FOK A;  2MC3 A;  1W7P D;  2G9W A;  4HAM A;  2NAZ A;  1YW8 A;  4LLG F;  4OIO F;  1SD6 A;  1RUO A;  1ZH5 A;  3KE2 A;  3BDD A;  1MJ9 A;  1U8R A;  1TQI A;  3KEO A;  4DNC A;  4G6Q A;  4FX0 A;  3L09 A;  1ZG1 A;  4KN7 X;  4EM0 B;  1HW5 A;  4AD9 A;  4L9J A;  1FT9 A;  4L9N A;  1ZAO A;  1XDU A;  5E1X A;  2Q8K A;  3R61 A;  5LGU A;  2P6T A;  1JGS A;  5IT9 Z;  5CVJ A;  5H6R A;  5BPI A;  5IT3 A;  4BNC A;  1B9N A;  4GXO A;  4A2U A;  4IRG A;  5LEJ A;  1H9T A;  4LK1 F;  4OIP F;  1W7P A;  1WKM A;  3RYR A;  4ESJ A;  1QO0 D;  4RGS A;  4L5J A;  3LAJ A;  2XAH A;  4Y13 A;  2LKP A;  2DFI A;  2O03 A;  2XVC A;  4KIB A;  3GVA A;  3V7S A;  1Z7U A;  1GXP A;  2EA4 A;  3HUG A;  4QWQ A;  3EUH A;  2E7X A;  4U0V A;  3TOA A;  3SZP A;  1IXC A;  1BN5 A;  1KU2 A;  2L4M A;  2OQG A;  2ADU A;  2PJP A;  5HDK A;  1IXS B;  4Y17 A;  2DAO A;  5J6X A;  3OOP A;  4I02 A;  1K78 A;  4Q5S F;  2XAQ A;  4U88 A;  1OMI A;  2KKO A;  4G7Z F;  1PP8 F;  2WV0 A;  1FY7 A;  2YR2 A;  4Y15 A;  2YX7 A;  1LJ9 A;  5LGT A;  3RKW A;  1S8N A;  2A5Y B;  1TQP A;  1R00 A;  3ECH A;  2R7D A;  1P6R A;  2PEX A;  1DP7 P;  1OYW A;  1XSD A;  2GQQ A;  2RVC A;  3JAM K;  3KLN A;  4CIC A;  5K1Y A;  1EV7 A;  3Q9S A;  1UHW A;  4FHT A;  1TNS A;  3LA2 A;  3TOB A;  2DW4 A;  2XAS A;  1XSV A;  4KDP A;  1OYY A;  3SHF A;  4P5O A;  3LQQ A;  2Z99 A;  4U7D A;  4CZZ A;  1LNW A;  3P7N A;  3WTT C;  2IRF G;  4TV7 A;  2YX4 A;  5AIQ A;  1BC8 C;  3R4K A;  4ESB A;  5BMZ A;  1SD5 A;  2VT3 A;  1G3T A;  4BQA A;  2VN2 A;  3GWZ A;  4I2O A;  1ZAR A;  3SQN A;  5HDG A;  4MTE A;  1FYK A;  1JHF A;  4HW0 A;  5BQT A;  4P9U A;  3M8F A;  3I64 A;  2F5D A;  2EV5 A;  2HOE A;  5J8C A;  3F23 A;  3BWG A;  5LBQ A;  1W5T A;  3S2W A;  4RGX A;  3U1D A;  3R6S A;  3M1E A;  1QBJ A;  1NHA A;  1SFE A;  3ABT A;  5D5U B;  2G7H A;  5EEG A;  1MKM A;  2STT A;  2FBK A;  4JK1 X;  4LFU A;  3VB2 A;  4BHP A;  4EJT A;  1FYL A;  1TQM A;  3E6B A;  4YFK F;  4WXH A;  1KQ8 A;  2P4W A;  3L2C A;  2H94 A;  3WTY C;  1ZRF A;  1TTY A;  3COA C;  2M87 A;  4MGR A;  2FEZ A;  4BHC A;  4LG0 A;  5FO5 A;  3ZN1 A;  1BI2 A;  1T39 A;  2HKO A;  3DPL C;  1XD7 A;  3GFL A;  1HBX G;  4LB5 A;  4WCG A;  2DBB A;  4L0Y B;  3U2R A;  5LRS A;  1HQC A;  4I98 B;  2QZ8 A;  1O3R A;  3FXR A;  4N9H A;  4U0Y A;  2JTV A;  5FB2 A;  3WE2 A;  1SMT A;  2FF4 A;  4OOI A;  2QUF A;  1R22 A;  2XHK A;  3GLX A;  5ILU A;  4G7H F;  2ISZ A;  3I54 A;  5KK1 A;  4A5N A;  4ASN A;  2FOK A;  3K1N A;  4WX9 A;  2GWR A;  4Q4Z F;  4EV0 A;  4LK0 F;  1OR7 A;  3HHG A;  3HHH A;  1IF1 A;  1FSE A;  1ULY A;  4R1H A;  5DCM B;  4I7H A;  2VE8 A;  4RB0 A;  1Z9C A;  3E5Q A;  4ENK A;  5FD5 A;  1E17 A;  5DCM A;  1R7J A;  3O2P E;  3VEP A;  4A0X A;  2F2E A;  4LG0 B;  1JXS A;  4HF0 A;  2RNJ A;  2IPQ X;  2LDU A;  6PAX A;  3BOQ A;  5ICG A;  3D0S A;  2L4A A;  2X0L A;  4N9I A;  1WWX A;  3DFG A;  5ICF A;  2Y75 A;  2O8X A;  2Z5U A;  1MZB A;  1GXQ A;  3TKY A;  4RAY A;  2ZXJ A;  2VBY A;  2NRA C;  1D8K A;  5K5Q A;  3OV8 A;  3BJA A;  1ZHF A;  2HFH A;  4FX4 A;  3ZN0 A;  4L9T A;  3IRQ A;  3CLO A;  3QP5 A;  1PUE E;  3M9A A;  1T2K A;  1MDM B;  3TGN A;  2XRO A;  4P55 A;  3WGH A;  1TW2 A;  1P92 A;  2MD5 A;  5A2Q K;  3G3Z A;  3GEZ A;  3F21 A;  1K6O A;  2RV8 A;  2R7F A;  1B9M A;  2COM A;  3LWF A;  2XAJ A;  1F4K A;  5D6E A; 
#chains in the Genus database with same CATH topology
 2XGE A;  2EFN A;  2ZSI B;  2OF7 A;  3I55 I;  1UFM A;  2CUE A;  3JRB A;  2RQP A;  1P7I A;  2M7A A;  3FF5 A;  1FP2 A;  2ZME B;  2ZFU A;  4LLL A;  3SDB A;  5ICE A;  1PJR A;  3A0H C;  5D5X B;  2L7M P;  3MQ0 A;  2EIL H;  1MJA A;  3H9G A;  4B44 A;  4IOA F;  4V2F A;  3E3V A;  2HGC A;  3HL2 A;  2JA5 J;  3BRO A;  1UG0 A;  5F08 A;  5IP9 J;  4CXF A;  4PZJ A;  3FK6 A;  4OIN F;  3OR1 C;  2DA2 A;  4IX7 A;  3CCS I;  2PN6 A;  3ZGK A;  1O3S A;  1MBJ A;  3I53 A;  4LLN A;  2D5V A;  2HS5 A;  2JVH A;  3JRE A;  2MA3 A;  5TIS C;  1AU7 A;  2LK2 A;  4HQM A;  5FGM A;  2HXI A;  1FP1 D;  4CDG A;  4E4H A;  2Z3Y A;  2LSO A;  1IW7 F;  3HJE A;  2V9K A;  4YRV A;  1X58 A;  2MGQ A;  2AS5 F;  3AKZ A;  1X1D A;  3F6O A;  1LQ1 A;  4AVP A;  4DQ2 A;  3GTQ J;  3HYI A;  1WVR A;  2XPV A;  1Z3Y A;  3LQR A;  3OSG A;  1OR7 C;  1XTA A;  4EM1 A;  4JP0 A;  5C3E J;  4PJ0 C;  4RDU A;  1SVM A;  2ZJ2 A;  1ON2 A;  1VQN I;  1USS A;  1D5Y A;  2EFW A;  3OL3 A;  5LFA A;  1ORK A;  5IP6 A;  3B73 A;  3IHU A;  2Y30 A;  3ERE D;  1ZGA A;  2CV1 A;  3GFJ A;  2M8G X;  3CUO A;  4OU0 A;  2E1M C;  2VOO A;  1XC5 A;  2EFP A;  5E3O A;  3CF5 F;  1YO5 C;  2R7V A;  5FRM A;  1S7A A;  1Z7L A;  4EEF G;  5D4R A;  1QPM A;  3BY6 A;  4BH9 A;  4XNF A;  2F48 A;  3WHB A;  2PJR B;  1ZLJ A;  2BY1 A;  3LMM A;  5ILS A;  4E7Z A;  1N77 A;  5DM7 F;  5LD2 C;  4BXX J;  4OMZ A;  3H3V K;  5K5R A;  4Z2Y A;  1FSH A;  2ZJP F;  1B72 A;  3HGY A;  5E18 F;  2XAG A;  2OZ6 A;  2R5Z A;  2JWT A;  1POG A;  3TED A;  2Z16 A;  4O6J A;  4HQE A;  2RGV A;  1ZR2 A;  1O57 A;  5M5X J;  4IJA A;  4QIW N;  2GLO A;  2XV4 S;  3ZP5 A;  2V9P A;  2X6Y A;  2XF7 A;  1QNT A;  2BXY A;  3FKJ A;  1RKT A;  1G4D A;  3D5S C;  5L3G A;  4XLH A;  3NWS A;  5LEK A;  1K78 B;  3TDZ C;  2RN7 A;  2IT0 A;  4B47 A;  3M07 A;  4DZJ A;  1Z1D A;  5EG0 B;  3CTA A;  1U0J A;  4ZYE A;  5EEA A;  3L7W A;  1MIJ A;  1RR8 C;  2H6B A;  4UVB A;  4LIU A;  1WSU A;  1BW6 A;  1FOW A;  1O7L A;  2GXB A;  1ZGW A;  1U2W A;  1E3P A;  1LUJ B;  4C9Y A;  5JHU A;  5CQG A;  3L2V A;  1GV5 A;  3LST A;  4BE2 A;  3E1S A;  2FXA A;  1MBG A;  1ODD A;  4IEJ A;  1YI2 I;  3N05 A;  2X51 A;  1ZRD A;  1MMD A;  3BJ6 A;  3M8J A;  4KNY A;  4ANJ A;  3CO7 C;  2JUG A;  3I5U A;  4UXN A;  3W2V A;  4DJA A;  4RGR A;  2ZCW A;  2ZXW H;  4BDY A;  2G7U A;  2FJ1 A;  2KIU A;  3ML6 A;  3OYE A;  2EZK A;  2XRN A;  3WU1 B;  3A02 A;  2D45 A;  2MLK A;  4BBR J;  2IP2 A;  3KP4 A;  2CYY A;  2LD5 A;  2OQR A;  2L01 A;  4XLN F;  5GAG J;  1NG6 A;  3BPX A;  3CMA I;  1R71 A;  3CJN A;  1AKH B;  2HVS A;  3OSF A;  3W6J B;  1OKR A;  2VKH A;  2GA1 A;  1S5L C;  2CUZ A;  2Y0S N;  1RKW A;  2W82 A;  3CF2 A;  4PJM A;  3CD6 I;  4C3I J;  3LNQ A;  1E3O C;  2EV6 A;  1W0U A;  1HKT A;  2NNN A;  2NOJ B;  5FRN A;  1J0R A;  5L3F A;  4XOT A;  2EPF A;  4M74 A;  4B3A A;  3QAH A;  3CO6 C;  2CV0 A;  1QU3 A;  1ZG3 A;  1ACI A;  1MW7 A;  1TBX A;  5K5O A;  4L5I A;  3UR3 C;  3PQK A;  1MH4 A;  4ZYD A;  5FKK A;  2FBH A;  2E5Z A;  1OQY A;  4NHJ A;  2GXA A;  3DBR B;  3R0A A;  2VPL A;  2ELK A;  1LFB A;  2P5K A;  2MYS A;  3HZJ A;  4C2M J;  4J19 A;  2VAS A;  4EJO A;  2W48 A;  4M9Z A;  4DBR A;  1ETV A;  1V5E A;  1I6H J;  2E71 A;  2E1M B;  3DQV C;  3VOE A;  4HPQ A;  3UKG A;  4XLE A;  3S1Q J;  4A3D J;  3PSI A;  5HS8 A;  2EWN A;  4U7B A;  1Y39 A;  1JT0 A;  2JA7 J;  1FC3 A;  1XG1 A;  3F22 A;  1K4S A;  4MTD A;  3GBG A;  3SZT A;  4ZTF A;  2QEN A;  4W1U A;  2EQR A;  5CQE A;  2LY2 A;  4BE1 A;  1RUN A;  3C18 A;  2QQB A;  1B6A A;  4PJN A;  3ZMZ A;  2YS9 A;  1ETY A;  2NYX A;  4IO9 F;  4XOP A;  1IRG A;  3IC7 A;  1YS6 A;  1XCB A;  4PJL A;  4CYC B;  3FWE A;  1MNE A;  1HOM A;  2HOT A;  2CQK A;  1Z3X A;  1U5T A;  1S6L A;  3CCJ I;  4NDL A;  1ZK8 A;  1O3T A;  4I0A A;  1LDK B;  2IS2 A;  2XGX A;  4KA4 A;  2HOA A;  1Z91 A;  3BCA A;  4ZH4 F;  2O61 A;  1J9I A;  2ZXI A;  4PFO A;  4UY8 I;  2KFD A;  1MH3 A;  3T8R A;  2CH0 A;  2IBD A;  2H27 A;  4WWC A;  4BUP A;  1MSF C;  2EFQ A;  3U9G A;  5F1R A;  1IUY A;  5DDG A;  3F8F A;  1U5T B;  2FU4 A;  4RBO A;  5EZH A;  5GPC A;  5F04 A;  1FWZ A;  3IRR A;  2BY3 A;  4R8H A;  3GTK J;  4MEX F;  2FRH A;  2BGC A;  2VXD A;  3M8E A;  4A3J J;  1WJC A;  5FKM A;  2CUF A;  1MND A;  3DP7 A;  1SAX A;  4CCJ A;  2XRL A;  4E7J A;  3ZQI A;  4KMU X;  4JX4 A;  1X1A A;  4HA8 A;  2X6W A;  2ECB A;  4BQQ A;  2O7O A;  3GZ6 A;  1V5F A;  2LNB A;  3LSI A;  2WWY A;  3UNG C;  1TWF J;  2JQ7 A;  4IHW A;  1QZY A;  4AIJ A;  3DBL B;  4IF4 A;  1Y8R B;  2CQN A;  2QSH X;  3O3K A;  2L54 A;  3ZOB A;  4JYK A;  2HVR A;  4UV8 A;  3I71 A;  5CVU A;  2V6C A;  4NBQ A;  3OYF A;  2W57 A;  3ZQL A;  1ZLK A;  2DU9 A;  2M9H A;  5BS6 A;  3H92 A;  2L9N A;  2ZKZ A;  3OS2 A;  1XN7 A;  3W6K B;  4CYD A;  1NTC A;  2OAZ A;  1YQA A;  4IPA A;  3G4S I;  2PX9 A;  4HSR A;  2LMD A;  4GCV A;  3EDP A;  1J2X A;  2NVU B;  2JMW A;  3RJP A;  1I3A A;  1H89 C;  3MZY A;  2V1U A;  1IXR C;  4KUM A;  3DXJ F;  3BZ6 A;  3KZZ A;  2PLY A;  3X2Q H;  5K7F A;  1IZ1 A;  2QM3 A;  4PSX A;  4M9X A;  1Y0U A;  1MGT A;  1YW7 A;  4JX6 A;  2R92 J;  4Q47 A;  4D7N A;  1J75 A;  2D1H A;  4OMY A;  4I76 A;  4M3F A;  3TDU C;  1XB4 A;  2JK3 A;  3ZQH A;  3NQO A;  1JJ8 C;  4FCY A;  1E0E A;  5E1W A;  3OYB A;  4XSZ F;  4B43 A;  2VJI A;  2QLZ A;  4PK4 A;  4G6D A;  4HOB A;  1IDZ A;  2M1B A;  1IRX A;  2UUZ A;  4E6K G;  5CVR A;  5K7H A;  5E79 C;  1R1T A;  1DP3 A;  4EAT A;  1Z67 A;  1IG7 A;  1F1Z A;  3HPH A;  2DCE A;  2JT1 A;  3FMR A;  4RM2 A;  1YFH A;  3RPQ A;  3BT9 A;  5AIP A;  3CCQ I;  4RB2 C;  1QGP A;  1UG2 A;  2PBI A;  5DYM A;  4ESF A;  3ZMT A;  1KYW A;  3HIF A;  2OCE A;  4EJU A;  3D5L A;  2A6E F;  4BXU A;  4L9V A;  2V1X A;  2DMT A;  4KT6 A;  1BIA A;  1I1S A;  2E36 A;  2OA4 A;  2ZME A;  1ZR4 A;  4B48 A;  2F6C A;  3A0B C;  2BVM A;  1ETQ A;  4W97 A;  3DF8 A;  4XLP F;  3PUF A;  2R7Z J;  2UZK A;  4MQV A;  1F36 A;  2V79 A;  1R1U A;  4WXD A;  4D7M A;  3HSE A;  1PUF B;  4IHX A;  2X6O A;  1DGR M;  1KGS A;  1OCO H;  3K1P A;  1T8I A;  3H9Q A;  4BE0 A;  3Q3S A;  1S7E A;  1Q1V A;  3DPT A;  1ZYR F;  3K4N A;  4OAZ A;  2LBF B;  2BHZ A;  2KL4 A;  4KMF A;  5DEQ A;  1JUM A;  5J8F A;  3C7J A;  3J80 K;  5LGN A;  2MLG A;  1PVE A;  1GVJ A;  2QCO A;  3WU2 C;  2TRT A;  2LKX A;  4HF2 A;  4YII A;  3PIP F;  1ETK A;  2LH9 A;  3C2B A;  5FLX K;  3DTE A;  2XAU A;  2KLO A;  3QPH A;  4LB6 B;  4IOC F;  4O5V A;  3RYP A;  4UUV A;  1MMG A;  1D1C A;  2GZW A;  3JRH A;  1R1V A;  2VQL A;  1YX3 A;  2OBP A;  4KIC A;  5JVG F;  3HRU A;  2WAF A;  3FMQ A;  2L7K A;  4M3E A;  4NQW B;  3BP8 A;  3SYT A;  4RMN A;  1T38 A;  1IN4 A;  1T08 B;  4BXF A;  2XIG A;  3O8H A;  2F4I A;  3IH4 A;  2Z1D A;  1STZ A;  3KCC A;  3V8K A;  1BL0 A;  2FBI A;  1V5G A;  3F8C A;  3VYU B;  2BZT A;  2DK8 A;  1JHH A;  2P0W A;  3ELK A;  1Y8Q B;  3K4B A;  4BEH A;  1SC7 A;  3WG9 A;  2NVX J;  4GRI A;  2VIX A;  3K9T A;  4G8X A;  2WB1 A;  4PJJ A;  5EDN A;  3IKT A;  2LY9 A;  3ESW B;  2PQ8 A;  2KIF A;  4YIF A;  1WJD A;  5B5E C;  5DD4 A;  2QBY B;  1N75 A;  1TWH J;  4NB5 A;  3L2Q A;  2B63 J;  1U5T C;  2R7S A;  2BEO A;  2W25 A;  4IRI A;  5IT9 K;  5HVQ C;  1BR2 A;  4M3D A;  3BR5 A;  2CW7 A;  1X19 A;  1D0Z A;  2CW0 F;  3Q0U A;  2HYJ A;  1EH7 A;  2H6C A;  2A69 F;  2TCT A;  3M1C A;  1BC7 C;  2H8R A;  1O7F A;  1VI0 A;  1BA5 A;  2IS4 A;  1JI8 A;  3E5U A;  3LSR A;  3JW4 A;  3G2B A;  4G12 A;  1IN7 A;  2V9V A;  4HEA 2;  2QVO A;  1X2M A;  2EV0 A;  1H8A C;  3K1M A;  4M9S A;  4BDZ A;  2HYF A;  3OIP A;  4S0H B;  1XPX A;  3JRD A;  4Y7N J;  4EMS A;  1W7P B;  4EM2 A;  1YX5 A;  3QU3 A;  4BJT A;  4EJV A;  4BY7 J;  3CC4 I;  4N0B A;  2DLL A;  2AXL A;  2JVG A;  3F8N A;  2HQR A;  3ZQC A;  4BY1 J;  3DU6 A;  1Q1H A;  3TO6 A;  4DBQ A;  4HX4 A;  2IW5 A;  3MFK A;  4DYQ A;  3FM3 A;  3WTV C;  2M0C A;  3P9I A;  1B59 A;  1SFK A;  2EJR A;  2VXZ A;  2ZXH A;  1A04 A;  3RPU D;  4AC0 A;  3HXL A;  1XMK A;  2R5Y A;  3P9K A;  2OV7 A;  3C2H A;  1BI3 A;  4HX7 A;  5J1Y A;  4Q48 A;  5LRR A;  3I3L A;  2P8T A;  2VBW A;  1S72 I;  1WI9 A;  1BR4 A;  3CJT B;  4IXA A;  3A1Y A;  4AU7 A;  5F6F A;  4WF2 A;  3BG6 A;  2HKX A;  5DUK A;  1ETW A;  1TP4 A;  3NAR A;  1TW3 A;  3QQA A;  3VFZ A;  2R5Y B;  3KPH A;  1SEU A;  1VQ5 I;  1F9N A;  4AUX A;  2LYC A;  3GUD A;  3KP6 A;  5CYV A;  2W1O A;  1VQ8 I;  2EA2 A;  4X0G A;  2PJR A;  3FXL A;  2ID6 A;  3JRF A;  3HOV J;  3KP5 A;  1SFX A;  2KMU A;  2XAF A;  4M3B A;  4BQO A;  3S1R J;  2YPR A;  3DKW A;  2K02 A;  2CWE A;  2ID3 A;  1IO2 A;  4CCL A;  3DLL F;  1WHU A;  2DTZ A;  1RI7 A;  2ESH A;  3RQI A;  1HCR A;  2HZT A;  4M71 A;  3ZMU A;  2XDV A;  3DTI A;  4CSW A;  2X9D A;  3JTG A;  3HOT A;  3CDL A;  1I5Z A;  3L9F A;  2BV6 A;  5GP9 A;  2I8D A;  2DQR A;  2NS0 A;  1YYV A;  1K4T A;  4UHT A;  5AON A;  3OYI A;  5FFX A;  1FOX A;  2DPD A;  4OAY A;  3E6D A;  3ZCO A;  5DV5 A;  1LDJ A;  4YIR X;  4CA0 A;  3CC7 I;  2E1N A;  4IRH A;  1TT5 B;  1YLF A;  3RKQ A;  1QZZ A;  4G9Y A;  2VKE A;  1GUU A;  2V7F A;  3HPG A;  5E1Z B;  2WAE A;  3M7G A;  3AFH A;  2OC6 A;  2EB7 A;  4JQF A;  3MKY B;  1DGW Y;  1OCP A;  3RPU A;  1XGN A;  4ZDL A;  2CRG A;  2HYG D;  3LSM A;  4BQN A;  3E6C C;  1REP C;  1SD4 A;  3S1M J;  1UCR A;  1S29 A;  5DCF A;  2L02 A;  2H8W A;  4HX8 A;  1KU7 A;  1RPW A;  5E3M A;  5CLS A;  2X1C A;  2HOS A;  4LIV A;  1UST A;  5ILV A;  2D1V A;  4XRS A;  4GDF A;  2ZNZ A;  4QTR A;  2XC7 A;  4KIF A;  4F93 B;  2JRM A;  4KJZ A;  3OWT A;  5BPD A;  1VQ4 I;  2FA5 A;  3LSK A;  2ZFW A;  1L0O C;  3MN2 A;  3MKZ A;  2P6S A;  3CJR B;  2AQF A;  3EQL F;  3T1B A;  1RZ4 A;  4XOR A;  1IRZ A;  2DXI A;  3H1C A;  1J59 A;  4AM3 A;  3KZY A;  3ASO H;  2L7F P;  1QZE A;  3AG2 H;  1ONV A;  3F8B A;  4LD5 A;  1K83 J;  3OYC A;  3CUQ B;  2ZME C;  1WH5 A;  1IDY A;  2MG4 A;  3N4M A;  4HLX A;  1FBS A;  2VJJ A;  1OCR H;  1ON1 A;  4LGW A;  4RS8 A;  3GLL A;  4UB6 C;  3VYR B;  4PSW A;  3KEQ A;  4HBL A;  4I01 A;  4S04 A;  1D1A A;  4XR6 A;  3WOD F;  3ABL H;  2ACJ A;  3K0L A;  1ERD A;  5M5Y J;  2H1L A;  3CQZ J;  4II3 A;  3GCM A;  4F52 A;  4E7H A;  5EG0 A;  2WC2 A;  2A07 F;  5BOX A;  3PQJ A;  2VQH A;  2MBF A;  2KP6 A;  3HOW J;  3L00 A;  2CQX A;  2JSC A;  4XLC A;  2QEX I;  2DFH A;  2ZNY A;  3F72 A;  5J47 A;  2YU3 A;  1TWG J;  2E7W A;  1WFX A;  2OTJ I;  3JRI A;  2HXO A;  4FQG A;  4I0B A;  1U78 A;  3DCF A;  2KRH A;  3SFZ A;  1V3F A;  3GF2 A;  3SXY A;  2VI6 A;  2VC1 A;  1OIS A;  2W7N A;  2VBZ A;  4HLY A;  2JA6 J;  2C6Y A;  2Y0S A;  2W24 A;  3HM5 A;  4NNJ A;  4F7Z A;  4L0Z B;  4ZTJ A;  4D5F A;  3MEX A;  3J81 K;  4HDV A;  5LLQ A;  1FPQ A;  2IVM A;  2E1C A;  1PDN C;  5D4S A;  1G3Y A;  3GO5 A;  2HQN A;  4H4K C;  4NC7 A;  3KYD B;  3FXJ A;  2QYO A;  3KP2 A;  2O5R A;  4GGG A;  1QHH D;  3B6C A;  2K3F A;  4B1R A;  1W4M A;  5H20 A;  4V19 K;  5FKN A;  3CP8 A;  3QPT A;  1GDT A;  3V8L A;  2L7Z A;  4EGZ A;  3FBN B;  3PNV A;  2VT2 A;  2E19 A;  2IJL A;  1FYM A;  1RES A;  3OYN A;  2BW3 B;  4PCQ A;  1BIB A;  5EGO A;  2R7T A;  1FTZ A;  3C3W A;  4A3M J;  3ABK H;  3E6M A;  3GX4 X;  1W5S A;  1I39 A;  2XKO A;  1EA3 A;  2DA4 A;  3C2G A;  5GTI C;  1DPR A;  4GYI A;  4IHS A;  1CF7 B;  3OS1 A;  5J1R A;  2BY0 A;  3I58 A;  3BZC A;  2WY7 Q;  2M0M A;  3TO7 A;  1NG7 A;  1F5T A;  2ETH A;  1WRJ A;  5FRO A;  1ZRE A;  1T0F A;  5HLH A;  3WTW C;  1D1B A;  3BG5 A;  1VF9 A;  4PDK A;  4CCO A;  1JE8 A;  3OYD A;  3IWF A;  3VOD A;  5DUI A;  4ENM A;  2VKV A;  2M5W A;  3HUG B;  3RQ4 A;  2Y9Y A;  3HC7 A;  3ZQQ A;  4ON0 A;  4MQ9 F;  4UB8 C;  3RZD J;  3CES A;  3O6B B;  5B1B H;  3DBH B;  2V6E A;  2VUM J;  3VYS B;  1BBY A;  3I59 A;  4CHU A;  5E17 F;  4A6D A;  5HDN A;  1BOA A;  3NRV A;  2UV1 A;  4A0Z A;  1T33 A;  1EH6 A;  2CFX A;  3DLA A;  5J4V A;  4CZC A;  4HF1 A;  3JRG A;  1LE8 B;  2KJC A;  2FQ4 A;  4KFC A;  4KYW A;  3HGG A;  3PJR A;  3T0Y A;  2OZU A;  3KYC B;  5FLV A;  4C2T A;  4UUS A;  3DTK A;  4JOM A;  3JSP A;  4UVA A;  3S1N J;  3WTZ A;  2LC2 A;  2FML A;  3I59 B;  1AOY A;  3U21 A;  1MMA A;  2M4K A;  4X1E A;  3EUK L;  1V54 H;  1V4R A;  1GLN A;  1BI1 A;  3HRM A;  1YJN I;  3A2K A;  3WE3 A;  5JFR A;  1DU0 A;  5F0H A;  3QWL A;  2QWW A;  3S3N A;  2ME6 A;  3HRS A;  4MEY F;  1G3W A;  2GA2 A;  2XKP A;  1YIT I;  2K5C A;  2WAD A;  3H5A A;  1YE9 A;  2K4B A;  1ZN2 A;  1LDD A;  2BYV E;  2NNY A;  1B8I A;  1HW1 A;  4A6E A;  5LHI A;  3BJO A;  1YOV B;  3K70 D;  3R0J A;  3FIW A;  3FMS A;  3FXQ A;  1DPU A;  1LEA A;  4XBF A;  5E20 A;  3JAM Z;  3MAJ A;  2P5L C;  1H0M A;  1XSX A;  3RCO A;  2MC4 A;  5L3B A;  2STW A;  3ZMV A;  5EGO B;  5M3M J;  4XN3 A;  1NH3 A;  3H3U A;  3CMY A;  1RNL A;  3MKL A;  3C1D A;  2LRE A;  3I9V 2;  5FLX Z;  3IV5 A;  1FOY A;  3F3X A;  2Y0M A;  2J5O A;  4ZJZ A;  1YG2 A;  2GBY A;  2GIV A;  3CMM A;  2ZSH B;  4CCK A;  2CUJ A;  4IQJ A;  2OD5 A;  3KEY A;  3KFW X;  1UAA A;  1X3U A;  4II2 A;  3PIO F;  3J7A O;  1K7A A;  3HEF A;  1A36 A;  3FXU A;  4A3L J;  2LFB A;  5A2Q Z;  4XKV A;  2PMH A;  5JLX A;  5B66 C;  1W0T A;  3ZQG A;  3JRA A;  1YS7 A;  2P7C B;  4HV5 A;  3V7R A;  2KQR A;  4A5M A;  2RC4 A;  5D6F A;  4UVC A;  2CS3 A;  2K85 A;  2QQ9 A;  3LA3 A;  4S05 A;  2F4M B;  3LSG A;  5TGT A;  4KIS A;  2K86 A;  4HV6 A;  2VJ5 A;  4GYG A;  4R79 A;  2DA5 A;  2LVS A;  1EF4 A;  2B0L A;  1A5J A;  1Z05 A;  4FTH A;  2F5F A;  3HG9 A;  1XMA A;  1FZP B;  3G73 A;  3GW2 A;  3MZ8 A;  3SZG A;  3ZQF A;  3OYH A;  2DT5 A;  5ED4 A;  2PMU A;  4PGG A;  5HS9 A;  4XSX F;  3K4J A;  2KDO A;  2JSP A;  3GTG J;  1P4W A;  4A0Y A;  5TRD A;  3OMY A;  2VB6 A;  1VQM I;  4MO7 A;  3H3Z A;  2DMU A;  3J80 Z;  2GM4 A;  4I09 A;  1WJB A;  1JT6 A;  1FMV A;  2EK5 A;  1VQ9 I;  3RIR A;  3IL2 A;  2HZD A;  1S3J A;  2GOM A;  2VC0 A;  4ZDO A;  5DTD A;  3MD2 A;  1ZGJ A;  2Q1Z B;  1IN8 A;  1XGO A;  1QQI A;  4EGY A;  1S7O A;  2Y2Z A;  3K4K A;  3HOS A;  2E1O A;  4HDU A;  1D8J A;  3FM5 A;  2QBY A;  4L5E A;  1Z0X A;  1Z6T A;  2ELJ A;  3N97 A;  3KZI C;  3MKW B;  4XQF A;  2ISY A;  2DMN A;  3HOX J;  1KYZ A;  2FUG 2;  4EJW A;  2HR3 A;  1M1E B;  1U6G A;  4ZYH A;  3MMY B;  3GFI A;  4FT8 A;  4RAZ A;  2CU7 A;  4KIG A;  3BTC A;  1IRF A;  2JPB A;  1PUF A;  3LSP A;  2GIZ A;  2JRT A;  2KDZ A;  3EPZ A;  2HQ5 A;  2DFF A;  3L2R A;  1XCV A;  2CW8 A;  2EIM H;  3WGI A;  1H88 C;  3GME A;  2W4S A;  4GO1 A;  1GT0 C;  2LBF A;  3DWL E;  1FIA A;  3ZQ7 A;  1KU3 A;  1LVK A;  2TDX A;  4AWX B;  5JI6 A;  2A05 A;  2AO9 A;  5LHG A;  1EH8 A;  2Z33 A;  3D5R C;  2DYS H;  3AG3 H;  1OYI A;  3V7C A;  2Z9O A;  3K69 A;  1HXD A;  5TJJ A;  1LB2 A;  3BQZ A;  2LTP A;  1P4X A;  2OUM A;  3S3M A;  3W3C A;  1T56 A;  3TO9 A;  4BAY A;  4AID A;  1U9N A;  1XGS A;  3TQN A;  2MD0 A;  4EVI A;  4CO8 A;  2EZL A;  3I0T A;  4BAC A;  4A3B J;  3LSJ A;  2EBI A;  4E70 A;  1HW2 A;  4JBA A;  4M6Y A;  5IPA A;  4RGU A;  2BOL A;  4A3E J;  3MCZ A;  1OFC X;  1TLH B;  2DMP A;  5EYR A;  2QA4 I;  1P7J A;  3H36 A;  4XL9 A;  4AIH A;  1YRN B;  2NXN B;  4RA2 A;  4YFN F;  2X1D A;  4IVN A;  1FBU A;  5LHH A;  2A3S A;  3S16 J;  4XON A;  2VE9 A;  1X1C A;  2VBX A;  2RQQ A;  3VPR A;  1D5V A;  1LVA A;  3CDH A;  4KT5 C;  3ZPL A;  2R3S A;  3F6V A;  3LL7 A;  4ZZD A;  1FLI A;  1Y0N A;  1ZG5 A;  1YRN A;  3FZV A;  2LP0 A;  4ETS A;  1HSJ A;  3HDD A;  5E8I A;  1U8B A;  2X6X A;  4H0E A;  1QVU A;  1EKE A;  2JN6 A;  1HKQ A;  1P4A A;  5FD6 A;  4WXC A;  1VTN C;  4WK8 F;  1P2F A;  2BE5 F;  2ESN A;  4M72 A;  1TNT A;  2K4J A;  4IL6 C;  1E2X A;  1G6N A;  2UWM A;  3BG9 A;  3B6A A;  3BZK A;  1OPC A;  3W2A A;  2VOD A;  4CUG A;  2RDP A;  3KET A;  3TP0 A;  3PO2 J;  3MZH A;  3OYA A;  2ZBK A;  3SJM A;  1VFC A;  3LA7 A;  1MDM A;  2CSO A;  5D8K B;  1WI3 A;  2WAQ A;  5ERI A;  5IYC J;  4L18 B;  2O0Y A;  2IA0 A;  4RLF A;  2B9S A;  2HWV A;  3IWZ A;  3HRT A;  3NWT A;  2QKL B;  4D9J A;  4RB1 A;  2YUS A;  5C4J J;  4P9F A;  3A01 B;  1HST A;  1WJA A;  2E34 A;  4K2E A;  3S17 J;  1R36 A;  3CCR I;  3QU6 A;  1J5Y A;  2FNP A;  5CJ9 A;  1CQT A;  2XF6 A;  3AG4 H;  1BM9 A;  1FNN A;  3ISP A;  1I1G A;  1K6Y A;  4U0W A;  4O3M A;  1BJZ A;  3ROU A;  4C3J J;  1Z77 A;  5IOZ A;  3H35 A;  4ENJ A;  3H0G J;  1DQU A;  1FTT A;  1UMQ A;  3HSF A;  4HST A;  3T8T A;  3S14 J;  2E60 A;  3S93 A;  4A69 C;  4LMY A;  1NK3 P;  3Q0W A;  3L1P A;  2BBY A;  3B02 A;  1IUF A;  2R7X A;  3LSH A;  5E3L A;  3HTU A;  5HLG A;  1ZTR A;  3I4P A;  2LY1 A;  2XSD C;  4BBS J;  4A12 A;  1ITY A;  1W5C C;  2XB5 A;  2X4H A;  3E0J B;  2OU2 A;  1XX5 A;  3OYM A;  3JRC A;  5KVR A;  4RM3 A;  1OLT A;  2DA3 A;  4G7O F;  3QPL A;  1BI0 A;  1X3Z B;  2R5Z B;  5GAE J;  2ZO4 A;  3BPV A;  1KQ9 A;  1WJ5 A;  1R5H A;  2DQL A;  2UXX A;  5KHD A;  3QRF F;  4G94 A;  1PP7 U;  3AL0 C;  1R4N B;  2IEK A;  2WY8 Q;  4HZF A;  1AHD P;  1NK2 P;  4LG3 A;  1C0W A;  3OYJ A;  4D0P A;  2FMY A;  1J7K A;  1WPK A;  4XKW A;  1FMW A;  2OJE D;  4OIR F;  2LLK A;  3GYH X;  3LFU A;  1OCT C;  3RZO J;  2HTJ A;  1W36 D;  2K9Q A;  2QQ8 A;  1P9Q C;  1PYV A;  3V8J A;  2BVL A;  3CCM I;  1MJB A;  5EZG A;  1MD0 A;  1XGM A;  3WHC A;  1J09 A;  5J3L A;  9ANT A;  2QSF X;  1YIO A;  1L3L A;  4DZP A;  2A68 F;  2DDA A;  2W84 A;  4XKB A;  3RDI A;  3WGG A;  3LOC A;  2LRD A;  2WA0 A;  4P1W A;  5BNG A;  1XDS A;  5FKL A;  5DM6 F;  3NEU A;  2P7V B;  2Q0O A;  2M3A A;  3TP3 A;  5D5V B;  3GFM A;  3DEU A;  3WTS C;  2F5E A;  4PUS A;  2KRF A;  3BC8 A;  5EF6 A;  1CGP A;  1MSE C;  3HOU J;  3HOY J;  3E7L A;  5EEH A;  2UXN A;  5D8L B;  3AL0 B;  2DO7 A;  3KYL A;  4B09 A;  1WH7 A;  3IAM 2;  1IN5 A;  1G3S A;  1H9G A;  4A3I J;  2G0E A;  4FE4 A;  3PFI A;  4AIK A;  2P5V A;  3G1O A;  3PM1 A;  3TMO A;  4LJZ F;  3OL4 A;  4I6Z A;  3FXM A;  1FX7 A;  3QOE A;  3JSO A;  3CZ6 A;  1RIO H;  1U3E M;  3HSR A;  3SEQ A;  4YFX F;  5K7Z A;  1BOB A;  3F0C A;  5H6Q A;  2DTR A;  4BHB A;  2DOE A;  1B1B A;  2EFO A;  2J5P A;  2WAQ N;  2FD5 A;  3KP3 A;  3J7Y J;  4UNO A;  4A3G J;  2Y69 H;  3E5X A;  1CF7 A;  1KU9 A;  3E97 A;  1UZC A;  1WQ2 A;  1SMY F;  2F4O B;  4C3H J;  1DDN A;  3R60 A;  3K4M A;  2CO5 A;  2WB1 N;  2A6H F;  4HG2 A;  2HTS A;  4XLA A;  3S2H J;  4ITV A;  3EYY A;  4MFE A;  1IN6 A;  4PFP A;  1WZ2 A;  3IAS 2;  1HA8 A;  2XPW A;  1BW5 A;  5L3D A;  2VOP A;  2Q2E B;  3WU0 A;  1IV6 A;  4NC8 A;  4UUS B;  1SD7 A;  4KN4 X;  3RI4 A;  3Q5F A;  3RKX A;  1A31 A;  4D5C A;  3FXK A;  1ZRC A;  2RKH A;  3QOP A;  5EJC A;  1G2H A;  2ELH A;  2K40 A;  2VL8 A;  3L2U A;  1R23 A;  3K4L A;  3BR1 A;  4AYB A;  2Y48 A;  2R7U A;  3IH2 A;  4NC6 A;  1IV8 A;  2VJ4 A;  3CME I;  4Z6Y A;  2V1D A;  3IP4 B;  2DI3 A;  2A6T A;  1W36 C;  2L9S A;  1YW9 A;  2EH3 A;  4Y33 A;  4FE7 A;  1Y1W J;  2Y31 A;  4QLC U;  3K10 A;  4IHT A;  3LAP A;  2WTE A;  4OWR B;  1T98 A;  4UV9 A;  2A61 A;  1IAW A;  3O8G A;  1UHM A;  3LFK A;  2X48 A;  1I3Q J;  3QP6 A;  3ABM H;  5CVI A;  5GPA A;  5F27 A;  3T5X A;  3QYB A;  2HPI A;  2DA1 A;  3G6E I;  2NOG A;  3CDI A;  3FX3 A;  1ZQ3 P;  5FLM J;  3M4O J;  4A3C J;  3V4G A;  2JZY A;  2MH9 A;  2Y9Z A;  1JTY A;  3CCY A;  1B8I B;  5F0C A;  3CCL I;  2KT0 A;  3HTS B;  1K79 A;  1T6S A;  2XUB A;  4Y4R A;  1I50 J;  5L3C A;  3AAF A;  2DOF A;  4EQQ A;  4MNU A;  1QRY A;  4ZYG A;  1KQ0 A;  3P9C A;  2CGP A;  3F8M A;  2DN0 A;  2VPR A;  2ZC2 A;  1I27 A;  3CUQ C;  2I10 A;  3K2A A;  3HBL A;  3ZMS A;  2IA1 A;  2FSW A;  1LPQ A;  5E8G A;  2DPU A;  5IYD J;  2BW3 A;  3VSK A;  3P5J A;  1HLV A;  1HF0 A;  1B4A A;  3MWM A;  3EUA A;  4XRF A;  1UB9 A;  4B3X A;  2LF8 A;  1FJL A;  2K27 A;  3RKY A;  3ERM A;  3G1L A;  1DUX C;  2HEO A;  1LE8 A;  2GAU A;  3Q9V A;  5M5W J;  3QOD A;  4B8X A;  2QKM B;  1I6X A;  2M2E A;  2PI0 A;  2OPT A;  1O3Q A;  4HNU A;  3KLO A;  2FNA A;  3ABU A;  2YSR A;  2IGM A;  5GAH J;  2M30 A;  3K6G A;  3FXO A;  4YG2 F;  1G59 A;  1X3W B;  3DV8 A;  1VQK I;  1JKO C;  3CUQ A;  1XMX A;  3EET A;  3F9K A;  3TW7 A;  1YTY A;  2AQE A;  3BR3 A;  5F64 A;  3KP7 A;  3DPU A;  1N25 A;  3BTJ A;  1R58 A;  2DA7 A;  1KA8 A;  2EZI A;  3ULQ B;  4ENN A;  2O8K A;  1VQ6 I;  1G8X A;  1ETX A;  4RLQ A;  3CP2 A;  3QPS A;  1OCC H;  5L3E A;  2CG4 A;  3ZMD A;  2KIS A;  2W85 A;  2XF5 A;  1SFU A;  4NQW A;  2FQ3 A;  1BJA A;  4M6X A;  5JR3 A;  3GZ5 A;  4XK4 A;  3RTR A;  2K7L A;  4V2G A;  4BYY A;  2JA8 J;  2HDC A;  3PFY A;  4CGZ A;  2R0Q C;  2FE3 A;  2PG4 A;  4P96 A;  3K70 C;  1Z21 A;  4QPO A;  4RB3 C;  4PGH A;  4CYC A;  1LFP A;  3J81 Z;  1UJ8 A;  4HYE A;  5JVT A;  3HB9 A;  4ZZL A;  4IZZ A;  3FHZ A;  5CVV A;  1UEL B;  4J00 A;  1R5G A;  2O6G E;  3GTL J;  5HLI A;  3PL8 A;  1RRJ A;  3CJQ B;  5IOY A;  3WTU C;  1ENH A;  2PFB A;  2OTL I;  3GTJ J;  3PSF A;  4M6V A;  2ZJR F;  2CMP A;  3BTI A;  3IH3 A;  1HKS A;  1FBQ A;  2GXG A;  4MHG A;  5E3N A;  2MH2 A;  4ZYA A;  1GHC A;  2RAE A;  5C44 J;  4J01 A;  2O3F A;  2KIM A;  2DK5 A;  2KJB A;  1Y56 A;  1ETO A;  2H09 A;  3GXO A;  1AKH A;  3IKV A;  4IHY A;  2K9M A;  5D5W B;  5ICC A;  5B1A H;  4M73 A;  4BJ5 C;  1VZ0 A;  3ZXS A;  5FFZ A;  3JTH A;  3H5R A;  5DD8 A;  3OYG A;  4DYC A;  3REO A;  3HOZ J;  1LEB A;  2VON A;  1JKR C;  3BQY A;  3OOU A;  3PO3 J;  2F5C A;  4QSH A;  3H9J A;  4E7K A;  1QHG A;  3M3Y J;  3TW6 A;  1SVL A;  2D2W A;  2M8E A;  3WTX C;  2Q2E A;  2IA2 A;  1LFU P;  4BGD A;  3PNY A;  1FEX A;  2L3D A;  4E7S A;  2JPC A;  2BY2 A;  1VQL I;  3ECO A;  2QQA A;  3DKY A;  1Z6R A;  1AWC A;  1IGN A;  3K2Z A;  4OIQ F;  2R93 J;  4IHV A;  2MW8 A;  3EYI A;  3K7A J;  5HS7 A;  2PMZ N;  2M45 A;  5HOO A;  1D3Y A;  1SAN A;  2LF7 A;  2ECC A;  1FOK A;  2MC3 A;  5JLW A;  1W7P D;  1XS9 A;  2G9W A;  4DW6 A;  4HAM A;  3FK7 A;  1GV2 A;  4N4N B;  1QVT A;  3BR6 A;  2KPM A;  2NAZ A;  4YEJ A;  1S9H A;  3JR9 A;  4XID A;  2NVT J;  1YW8 A;  4ABZ A;  4LLG F;  4OIO F;  2K9L A;  3DKX A;  3VSL A;  1SD6 A;  4XKC A;  1D0Y A;  5HOD A;  3WG7 H;  1RUO A;  1ZH5 A;  2DDB A;  3KE2 A;  3BDD A;  1MJ9 A;  1LKX A;  4Y52 J;  1A6I A;  4A3K J;  3IUO A;  1U8R A;  1TQI A;  3KEO A;  4DNC A;  1A35 A;  1WCM J;  2V4J C;  1R9T J;  3BG7 A;  2VLA A;  4G6Q A;  4FX0 A;  2V26 A;  3L09 A;  1ZG1 A;  4KN7 X;  4EM0 B;  1HC8 A;  1HW5 A;  1B72 B;  3OYK A;  4AD9 A;  4L9J A;  4UUT A;  1FT9 A;  4L9N A;  2E35 A;  1ZAO A;  1IJW C;  2CJJ A;  1XDU A;  4IKF A;  4BEH B;  5E1X A;  5DS9 A;  3OR2 C;  2Q8K A;  3R61 A;  1O4X A;  5LGU A;  1JKP C;  2N8G A;  2P6T A;  1JGS A;  5IT9 Z;  2P81 A;  5CVJ A;  3ZRG A;  5H6R A;  2DJI A;  5IT3 A;  5BPI A;  4BNC A;  1B9N A;  4GXO A;  4A2U A;  4IRG A;  5LEJ A;  5FJ8 J;  1H9T A;  4LK1 F;  4OIP F;  2Z2S B;  1W7P A;  3A03 A;  4XMY A;  3FIS A;  1WKM A;  4BJ6 C;  3RYR A;  1K61 A;  5HNH A;  2KZV A;  4ESJ A;  3J7A Y;  1QO0 D;  1SVO A;  2HNH A;  4RGS A;  3VDX A;  4L5J A;  3LAJ A;  2XAH A;  2B7E A;  3S8P A;  4Y13 A;  2LKP A;  1R6R A;  2DFI A;  2O03 A;  5F1J A;  1N78 A;  1QA6 A;  1APL C;  1HDP A;  2XVC A;  3KIO A;  2RRE A;  4F55 A;  4KIB A;  3GVA A;  1MMS A;  3V7S A;  1Z7U A;  2M4G A;  2ICW G;  1GXP A;  2EA4 A;  1D0X A;  2XPU A;  3HUG A;  1DU6 A;  4QWQ A;  3EUH A;  2E7X A;  4U0V A;  1GVD A;  1TC3 C;  2IS6 A;  3CCU I;  2EIJ H;  3TOA A;  4MLO A;  4A93 J;  4CH7 A;  5F0F A;  3SZP A;  2HDD A;  1IXC A;  1BN5 A;  2L0K A;  1VQ7 I;  1KU2 A;  2ZB9 A;  5GTH C;  3CCE I;  2L4M A;  2OQG A;  3I4M J;  1WJF A;  1YJ9 I;  1X2N A;  4CCN A;  4KIT B;  1R4M B;  2ADU A;  4HNV A;  2PJP A;  2K9N A;  3GTP J;  5HDK A;  2L9R A;  1IXS B;  4Y17 A;  5KNL A;  2DAO A;  2NS7 A;  5J6X A;  3OOP A;  2F5V A;  4I02 A;  1K78 A;  2M7B A;  3BG3 A;  4Q5S F;  4FET A;  2XAQ A;  4U88 A;  1OMI A;  2KKO A;  4G7Z F;  2VQG A;  1PP8 F;  2ZJQ F;  1F43 A;  2WV0 A;  1FY7 A;  2YR2 A;  4Y15 A;  2YX7 A;  1LJ9 A;  5LGT A;  3RKW A;  2OCC H;  1S8N A;  2IGO A;  5IP7 J;  2A5Y B;  1A6Q A;  2JA2 A;  4CCM A;  1TQP A;  3AG1 H;  1R00 A;  2KZG A;  3ECH A;  5CPR B;  1OCZ H;  2R7D A;  1P6R A;  1JTX A;  3VYT B;  2PEX A;  2DYR H;  1DP7 P;  1X1B A;  4X6A J;  3D1N I;  1OYW A;  2FX0 A;  1X1P A;  4D1Q A;  1XSD A;  2GQQ A;  4XRM A;  1TL8 A;  3GZN B;  5J4Y A;  2RVC A;  3JAM K;  3ZR8 X;  3KLN A;  2DT7 B;  1WGX A;  2R7R A;  2E2H J;  1MNM C;  4CIC A;  3SEZ A;  5K1Y A;  1EV7 A;  3Q9S A;  1UHW A;  4FHT A;  1TNS A;  4FAS D;  3LA2 A;  3TOB A;  2I5U A;  2H1K A;  3OS0 A;  2DW4 A;  2XAS A;  1XSV A;  3QYE A;  4KDP A;  4G6T B;  1OYY A;  3SHF A;  4FIS A;  5HLT A;  4P5O A;  1RET A;  2Z99 A;  3LQQ A;  4U7D A;  5KAI C;  4CZZ A;  1LNW A;  3DEE A;  3P7N A;  3WTT C;  4TV7 A;  2YX4 A;  4RAG A;  5AIQ A;  2IRF G;  1BC8 C;  3R4K A;  3BR2 A;  1KON A;  1T0F C;  4ESB A;  3SFI A;  2VQC A;  3DEW A;  1R5I D;  1SD5 A;  4LOC A;  4BL0 B;  5BMZ A;  3KX2 A;  1YIJ I;  2LR8 A;  2VT3 A;  1G3T A;  5FKO A;  4BQA A;  2LG4 A;  2VN2 A;  3GWZ A;  2HVQ A;  3OIQ A;  4I2O A;  4I99 C;  1ZAR A;  4HNT A;  2COB A;  4AVZ A;  1FIP A;  3Q0V A;  3SQN A;  2HDW A;  2PMZ A;  5HDG A;  4MTE A;  1FYK A;  4XLF A;  3MVP A;  2K9S A;  1TT0 A;  2HPM A;  2IGN A;  5IY5 H;  2DJN A;  4DOZ A;  1JHF A;  3OYL A;  1EJ9 A;  1T95 A;  4HW0 A;  1U9O A;  5BQT A;  5B3S H;  4P9U A;  3M8F A;  2IAI A;  2W00 A;  3I64 A;  2R7O A;  5KCM A;  3GTM J;  2R7Q A;  2EV5 A;  2F5D A;  4JX5 A;  2HOE A;  3ONQ A;  5J8C A;  3F23 A;  2K3P A;  5M3F J;  2NS8 A;  3BWG A;  2EIK H;  1SAU A;  5LBQ A;  5HNF A;  1WJE A;  1W5T A;  2KHM A;  3S2W A;  2JUC A;  4RGX A;  4QPQ A;  3U1D A;  3R6S A;  2HU9 A;  2L5Q A;  3M1E A;  4BS9 A;  1QBJ A;  2GOX B;  2ME0 A;  2NVY J;  3FBI B;  1NHA A;  1SFE A;  3ABT A;  4MIM A;  3TBI A;  5D5U B;  2X85 A;  2G7H A;  1ZKG A;  3DU5 A;  3PNT A;  5EEG A;  4B4C A;  1MKM A;  2STT A;  2R4G A;  2FBK A;  4JK1 X;  4DYR A;  4LFU A;  3VB2 A;  1RR7 A;  5IYB J;  4BHP A;  2M34 A;  5CKT A;  1MBK A;  4DGW B;  5J40 A;  2DOA A;  4EJT A;  5KAF C;  3FKI J;  1FYL A;  1TQM A;  2AHQ A;  3E6B A;  4ZDP A;  4YFK F;  4WXH A;  3K4C A;  4XN0 A;  4NUB A;  1KQ8 A;  2P4W A;  3S3O A;  4AYB N;  3L2C A;  4BKX A;  2H94 A;  3WTY C;  1ZRF A;  1TTY A;  2EIN H;  4A3F J;  3COA C;  2M87 A;  4MGR A;  1SFO J;  2FEZ A;  4BHC A;  2BHY A;  4LG0 A;  5FO5 A;  3ZN1 A;  3I56 I;  1BI2 A;  1T39 A;  2EZH A;  3OY9 A;  2E2I J;  2JJ7 A;  2HKO A;  3DPL C;  1YHQ I;  1Y6I A;  1XD7 A;  2IXS A;  2MSY A;  4C30 A;  2CQQ A;  1VQO I;  3GFL A;  1HBX G;  4LB5 A;  4WCG A;  2DBB A;  1MMN A;  4L0Y B;  3U2R A;  4F92 B;  5JHF A;  2HQA A;  5LRS A;  2DFE A;  1HQC A;  3FHN A;  2CFO A;  4I98 B;  2QZ8 A;  1O3R A;  1JUP A;  3BCB A;  2CQ7 A;  3FXR A;  4N9H A;  4U0Y A;  4HRI A;  2JTV A;  5FB2 A;  4U87 A;  3S2D J;  3WE2 A;  2DA6 A;  3BTL A;  2HI3 A;  4N4O B;  1SMT A;  3H0D A;  2FF4 A;  3HKZ N;  2E5N A;  4OOI A;  1MBF A;  2QUF A;  1R22 A;  4RAF A;  3A4C A;  2LKS A;  2XHK A;  3HKZ A;  3VWB A;  3GLX A;  2XB0 X;  5ILU A;  1X4P A;  2L2O A;  4G7H F;  2DMQ A;  2ISZ A;  4YEL A;  4F91 B;  3I54 A;  3S32 A;  5KK1 A;  4A5N A;  5C4X J;  3RSN A;  3ASN H;  1R49 A;  3W2W A;  4ASN A;  2FOK A;  3K1N A;  4WX9 A;  2WBM A;  3PUB A;  2BXZ A;  2GWR A;  2IS1 A;  2L9V A;  1YJW I;  4Q4Z F;  4EV0 A;  4DIQ A;  3SDG A;  4LK0 F;  1OR7 A;  3CLQ A;  3W6V A;  2IGK A;  3HHG A;  3HHH A;  1IF1 A;  3U1K A;  1FSE A;  5GAD J;  1ULY A;  1X4O A;  2KIQ A;  3V42 A;  1Y1V J;  4ZC3 A;  3QYF A;  4R1H A;  5DCM B;  4I7H A;  2VKD A;  1UHS A;  2XSJ C;  2VE8 A;  2X1E A;  1TWA J;  4RB0 A;  1V55 H;  2YU9 J;  1Z9C A;  2XGD A;  3E5Q A;  3H5N A;  2RNG A;  4E7L A;  3G1M A;  4ENK A;  5FD5 A;  1E17 A;  1MBE A;  1JKQ C;  3A01 A;  3BLY A;  5DCM A;  1R7J A;  5H2F C;  2V1N A;  3O2P E;  3VEP A;  4A0X A;  2F2E A;  2FOW A;  4LG0 B;  2QGU A;  1JXS A;  4HF0 A;  1ZEL A;  1E3H A;  2RNJ A;  2IPQ X;  2LDU A;  2QF7 A;  3BOQ A;  6PAX A;  3I4N J;  4C2U A;  2CV2 A;  5ICG A;  4F3Q A;  3J7Z I;  1QPI A;  2QSG X;  3GTO J;  3D0S A;  3OIO A;  4LIT A;  2L4A A;  1W1W E;  3FDY A;  2X0L A;  4N9I A;  1WWX A;  1RC9 A;  1OJL A;  2LOO A;  3DFG A;  4MFD A;  1TWC J;  2XGC A;  3NAU A;  5J1U A;  1IC8 A;  1JJ6 C;  1HDD C;  5ICF A;  2Y75 A;  2O8X A;  2Z5U A;  1MZB A;  4E7I A;  3BR0 A;  2MFZ A;  1GXQ A;  3TKY A;  1VND A;  1VQP I;  4RAY A;  1JGG A;  1MBH A;  2ZXJ A;  2NVQ J;  4BU2 A;  2VBY A;  2R7W A;  2NRA C;  1D8K A;  4M3G A;  5K5Q A;  3OV8 A;  2DOD A;  3S15 J;  3BJA A;  1ZHF A;  2HFH A;  4FX4 A;  4IQ4 A;  3ZN0 A;  4L9T A;  3IRQ A;  3CC2 I;  3CLO A;  3EUH C;  1KZH A;  1TZL A;  4Y3O A;  3QP5 A;  2WV1 A;  3G71 I;  1AA7 A;  1PUE E;  3M9A A;  1T2K A;  1BR1 A;  3CCV I;  3JCU C;  1MDM B;  2A5W A;  3TGN A;  2XRO A;  4P55 A;  2KRC A;  4XM3 A;  3L2W A;  3WGH A;  3TL4 X;  2MAB A;  1TW2 A;  1JUS A;  2O9L A;  1P92 A;  2MD5 A;  5A2Q K;  4GFB A;  3G3Z A;  3GEZ A;  3F21 A;  1K6O A;  2DT6 A;  2RV8 A;  2R7F A;  1B9M A;  2COM A;  4XRS G;  2E2J J;  3LWF A;  2XAJ A;  1F4K A;  5D6E A;  2AXT C;  4XIC A; 
#chains in the Genus database with same CATH homology
 2EFN A;  1UFM A;  2RQP A;  3FF5 A;  1FP2 A;  2ZME B;  4LLL A;  5ICE A;  5D5X B;  3MQ0 A;  1MJA A;  3E3V A;  2HGC A;  3BRO A;  4CXF A;  4PZJ A;  4OIN F;  2PN6 A;  1O3S A;  3I53 A;  4LLN A;  2HS5 A;  2MA3 A;  4HQM A;  5FGM A;  1FP1 D;  4CDG A;  2Z3Y A;  2LSO A;  1IW7 F;  2AS5 F;  3F6O A;  1LQ1 A;  4AVP A;  4DQ2 A;  3HYI A;  3LQR A;  4EM1 A;  2ZJ2 A;  1ON2 A;  1USS A;  2EFW A;  3B73 A;  3IHU A;  3ERE D;  1ZGA A;  3GFJ A;  3CUO A;  2VOO A;  4OU0 A;  2EFP A;  1YO5 C;  1S7A A;  5D4R A;  1QPM A;  3BY6 A;  4BH9 A;  1ZLJ A;  5ILS A;  4OMZ A;  5K5R A;  4Z2Y A;  1FSH A;  5E18 F;  2XAG A;  2OZ6 A;  4O6J A;  4HQE A;  2RGV A;  1O57 A;  4IJA A;  2XV4 S;  3ZP5 A;  1QNT A;  1G4D A;  5L3G A;  5LEK A;  1K78 B;  3TDZ C;  2RN7 A;  2IT0 A;  1Z1D A;  3CTA A;  4ZYE A;  3L7W A;  2H6B A;  4UVB A;  1WSU A;  1O7L A;  2GXB A;  1U2W A;  5JHU A;  3LST A;  2FXA A;  1ODD A;  1ZRD A;  4KNY A;  3BJ6 A;  3CO7 C;  3I5U A;  4UXN A;  4RGR A;  2ZCW A;  2G7U A;  2KIU A;  3ML6 A;  2D45 A;  2XRN A;  3WU1 B;  2MLK A;  2IP2 A;  3KP4 A;  2CYY A;  2OQR A;  2L01 A;  4XLN F;  3BPX A;  3CJN A;  3W6J B;  1OKR A;  2GA1 A;  2EV6 A;  1HKT A;  2NNN A;  1J0R A;  4M74 A;  3QAH A;  3CO6 C;  1ZG3 A;  1TBX A;  5K5O A;  4L5I A;  3PQK A;  4ZYD A;  2FBH A;  4NHJ A;  3R0A A;  2P5K A;  4EJO A;  4M9Z A;  3DQV C;  3VOE A;  5HS8 A;  2EWN A;  4U7B A;  1FC3 A;  3F22 A;  4MTD A;  3SZT A;  2QEN A;  1RUN A;  3C18 A;  2QQB A;  1B6A A;  3ZMZ A;  2NYX A;  1IRG A;  3IC7 A;  1YS6 A;  1XCB A;  3FWE A;  2CQK A;  1U5T A;  1S6L A;  1O3T A;  4I0A A;  1LDK B;  2XGX A;  4KA4 A;  1Z91 A;  4ZH4 F;  2O61 A;  1J9I A;  3T8R A;  2H27 A;  4WWC A;  1IUY A;  2EFQ A;  3U9G A;  5F1R A;  5DDG A;  3F8F A;  1U5T B;  2FU4 A;  1FWZ A;  3IRR A;  4R8H A;  4MEX F;  2FRH A;  2BGC A;  3M8E A;  3DP7 A;  1SAX A;  4KMU X;  4HA8 A;  3GZ6 A;  2LNB A;  2WWY A;  1QZY A;  4AIJ A;  4IF4 A;  3O3K A;  2L54 A;  4UV8 A;  3I71 A;  5CVU A;  2V6C A;  2W57 A;  1ZLK A;  2DU9 A;  5BS6 A;  3H92 A;  2ZKZ A;  1XN7 A;  3W6K B;  4CYD A;  2OAZ A;  1YQA A;  4IPA A;  4GCV A;  3EDP A;  1J2X A;  3RJP A;  3MZY A;  2V1U A;  1IXR C;  4KUM A;  3DXJ F;  3BZ6 A;  3KZZ A;  2PLY A;  1IZ1 A;  2QM3 A;  4M9X A;  1Y0U A;  1MGT A;  1YW7 A;  4Q47 A;  1J75 A;  2D1H A;  4OMY A;  3TDU C;  1XB4 A;  3NQO A;  5E1W A;  4XSZ F;  2QLZ A;  4G6D A;  4HOB A;  2M1B A;  5CVR A;  1R1T A;  1F1Z A;  2JT1 A;  3FMR A;  1YFH A;  3RPQ A;  5AIP A;  4RB2 C;  1QGP A;  2PBI A;  5DYM A;  4ESF A;  3ZMT A;  1KYW A;  3HIF A;  4EJU A;  3D5L A;  2A6E F;  4BXU A;  4L9V A;  2V1X A;  1BIA A;  1I1S A;  2OA4 A;  2ZME A;  3DF8 A;  4XLP F;  2UZK A;  4MQV A;  2V79 A;  1R1U A;  4WXD A;  3HSE A;  1KGS A;  3K1P A;  3DPT A;  1ZYR F;  4KMF A;  5DEQ A;  5J8F A;  3C7J A;  3J80 K;  5LGN A;  2MLG A;  1GVJ A;  4HF2 A;  4YII A;  5FLX K;  3QPH A;  4LB6 B;  4O5V A;  3RYP A;  4UUV A;  2GZW A;  1R1V A;  2OBP A;  4KIC A;  3HRU A;  3FMQ A;  3BP8 A;  1T38 A;  1IN4 A;  2XIG A;  1STZ A;  3KCC A;  3V8K A;  2FBI A;  3F8C A;  2DK8 A;  1JHH A;  3ELK A;  3WG9 A;  3K9T A;  4G8X A;  3IKT A;  2PQ8 A;  2KIF A;  4YIF A;  5DD4 A;  2QBY B;  4NB5 A;  1U5T C;  2BEO A;  2W25 A;  4IRI A;  5IT9 K;  5HVQ C;  2CW0 F;  1EH7 A;  2H6C A;  2A69 F;  1BC7 C;  1O7F A;  3E5U A;  3JW4 A;  1IN7 A;  2V9V A;  2QVO A;  2EV0 A;  3K1M A;  4M9S A;  2HYF A;  4EMS A;  1W7P B;  4EM2 A;  3QU3 A;  4EJV A;  4N0B A;  2DLL A;  2AXL A;  3F8N A;  2HQR A;  1Q1H A;  3TO6 A;  4HX4 A;  2IW5 A;  3MFK A;  3FM3 A;  3WTV C;  3P9I A;  1B59 A;  2EJR A;  2VXZ A;  1A04 A;  1XMK A;  3P9K A;  4HX7 A;  1BI3 A;  4Q48 A;  5LRR A;  2P8T A;  2VBW A;  1WI9 A;  4IXA A;  5F6F A;  4WF2 A;  2HKX A;  5DUK A;  1TW3 A;  3VFZ A;  1F9N A;  3GUD A;  3KP6 A;  5CYV A;  2EA2 A;  3KP5 A;  1SFX A;  2XAF A;  2YPR A;  3DKW A;  2K02 A;  2CWE A;  1RI7 A;  2ESH A;  2HZT A;  4M71 A;  3ZMU A;  3JTG A;  3HOT A;  1I5Z A;  3L9F A;  2BV6 A;  2DQR A;  2NS0 A;  1YYV A;  4UHT A;  5AON A;  5FFX A;  2DPD A;  3E6D A;  5DV5 A;  1LDJ A;  2E1N A;  4IRH A;  1YLF A;  1QZZ A;  4G9Y A;  5E1Z B;  3M7G A;  2EB7 A;  4JQF A;  3RPU A;  1XGN A;  2HYG D;  3E6C C;  1REP C;  1SD4 A;  1UCR A;  1S29 A;  5DCF A;  2L02 A;  4HX8 A;  1KU7 A;  5CLS A;  1UST A;  5ILV A;  2D1V A;  2ZNZ A;  4KIF A;  5BPD A;  2FA5 A;  2ZFW A;  1L0O C;  2P6S A;  3EQL F;  3T1B A;  1RZ4 A;  1J59 A;  3KZY A;  4LD5 A;  3F8B A;  1ONV A;  3CUQ B;  3N4M A;  4HLX A;  1FBS A;  4LGW A;  1ON1 A;  5L3F A;  4RS8 A;  3KEQ A;  4HBL A;  4I01 A;  4S04 A;  3WOD F;  2ACJ A;  3K0L A;  2WC2 A;  2A07 F;  5BOX A;  3PQJ A;  2MBF A;  3L00 A;  2JSC A;  2ZNY A;  3F72 A;  2YU3 A;  2E7W A;  4I0B A;  1U78 A;  3SFZ A;  1V3F A;  3GF2 A;  3SXY A;  2VC1 A;  4HLY A;  2VBZ A;  2C6Y A;  2W24 A;  4F7Z A;  4L0Z B;  3MEX A;  3J81 K;  4HDV A;  5LLQ A;  1FPQ A;  2IVM A;  2E1C A;  1PDN C;  5D4S A;  1G3Y A;  3GO5 A;  2HQN A;  2QYO A;  3KP2 A;  4GGG A;  1W4M A;  5H20 A;  3QPT A;  3V8L A;  4EGZ A;  2VT2 A;  1FYM A;  2IJL A;  4PCQ A;  1BIB A;  3C3W A;  3E6M A;  3GX4 X;  1W5S A;  2XKO A;  1DPR A;  4GYI A;  4IHS A;  1CF7 B;  3I58 A;  3TO7 A;  1F5T A;  2ETH A;  1WRJ A;  1ZRE A;  1T0F A;  5HLH A;  3WTW C;  4PDK A;  1JE8 A;  3IWF A;  3VOD A;  5DUI A;  4ENM A;  2M5W A;  4ON0 A;  4MQ9 F;  3O6B B;  1BBY A;  3I59 A;  4CHU A;  5E17 F;  4A6D A;  5HDN A;  1BOA A;  3NRV A;  4A0Z A;  1EH6 A;  2CFX A;  4HF1 A;  2KJC A;  4KFC A;  4KYW A;  3T0Y A;  2OZU A;  3JSP A;  4UVA A;  3WTZ A;  2FML A;  3I59 B;  1AOY A;  1V4R A;  1BI1 A;  3HRM A;  3WE3 A;  5JFR A;  2QWW A;  3HRS A;  4MEY F;  1G3W A;  2GA2 A;  2XKP A;  2K4B A;  1ZN2 A;  1LDD A;  2BYV E;  2NNY A;  1HW1 A;  4A6E A;  5LHI A;  3BJO A;  3R0J A;  3FMS A;  3FXQ A;  1DPU A;  1LEA A;  4XBF A;  5E20 A;  3JAM Z;  1H0M A;  3MAJ A;  2P5L C;  1XSX A;  5L3B A;  2STW A;  3ZMV A;  3H3U A;  1RNL A;  3C1D A;  5FLX Z;  3F3X A;  2Y0M A;  2J5O A;  1YG2 A;  2GIV A;  2OD5 A;  3KFW X;  1X3U A;  3J7A O;  1K7A A;  3FXU A;  5A2Q Z;  2PMH A;  1YS7 A;  2P7C B;  4HV5 A;  3V7R A;  4A5M A;  2RC4 A;  5D6F A;  4UVC A;  4S05 A;  2QQ9 A;  3LA3 A;  2K86 A;  4HV6 A;  4GYG A;  4R79 A;  2B0L A;  1Z05 A;  2F5F A;  1XMA A;  1FZP B;  3G73 A;  3GW2 A;  2DT5 A;  5ED4 A;  2PMU A;  4PGG A;  5HS9 A;  4XSX F;  1P4W A;  4A0Y A;  5TRD A;  3H3Z A;  3J80 Z;  4I09 A;  2EK5 A;  3RIR A;  3IL2 A;  1S3J A;  2VC0 A;  1ZGJ A;  1IN8 A;  1XGO A;  1QQI A;  4EGY A;  1S7O A;  3HOS A;  4HDU A;  1D8J A;  3FM5 A;  2QBY A;  1Z6T A;  3N97 A;  2ISY A;  1KYZ A;  4EJW A;  2HR3 A;  1U6G A;  4ZYH A;  3GFI A;  4FT8 A;  4RAZ A;  4KIG A;  1IRF A;  2JPB A;  2JRT A;  1XCV A;  3WGI A;  4GO1 A;  3ZQ7 A;  1KU3 A;  2TDX A;  4AWX B;  5JI6 A;  5LHG A;  2Z33 A;  1EH8 A;  1OYI A;  3V7C A;  2Z9O A;  3K69 A;  1HXD A;  5TJJ A;  1LB2 A;  1P4X A;  3TO9 A;  4BAY A;  1XGS A;  3TQN A;  4EVI A;  4CO8 A;  3I0T A;  4E70 A;  1HW2 A;  4JBA A;  4M6Y A;  4RGU A;  3MCZ A;  1TLH B;  4AIH A;  4YFN F;  4IVN A;  1FBU A;  5LHH A;  2A3S A;  2VE9 A;  2VBX A;  1D5V A;  1LVA A;  3CDH A;  4KT5 C;  3ZPL A;  2R3S A;  3F6V A;  4ZZD A;  1FLI A;  1ZG5 A;  3FZV A;  4ETS A;  1HSJ A;  5E8I A;  4H0E A;  1HKQ A;  1P4A A;  5FD6 A;  4WXC A;  1VTN C;  4WK8 F;  1P2F A;  2BE5 F;  2ESN A;  4M72 A;  1TNT A;  2K4J A;  1E2X A;  1G6N A;  2UWM A;  1OPC A;  2VOD A;  2RDP A;  3KET A;  3MZH A;  2ZBK A;  3LA7 A;  1MDM A;  2CSO A;  5D8K B;  5ERI A;  4L18 B;  2O0Y A;  2IA0 A;  2HWV A;  3IWZ A;  3HRT A;  4RB1 A;  4P9F A;  1HST A;  4K2E A;  1R36 A;  3QU6 A;  1J5Y A;  2FNP A;  5CJ9 A;  1BM9 A;  1FNN A;  3ISP A;  1I1G A;  4U0W A;  4O3M A;  3ROU A;  4ENJ A;  3HSF A;  3T8T A;  4LMY A;  2BBY A;  3B02 A;  3HTU A;  5HLG A;  3I4P A;  4A12 A;  2X4H A;  2OU2 A;  5KVR A;  4G7O F;  1BI0 A;  2ZO4 A;  3BPV A;  1KQ9 A;  1R5H A;  2DQL A;  2UXX A;  3QRF F;  4G94 A;  1PP7 U;  4HZF A;  1C0W A;  4D0P A;  2FMY A;  1J7K A;  4OIR F;  3GYH X;  2HTJ A;  3V8J A;  1MJB A;  1MD0 A;  1XGM A;  1YIO A;  1L3L A;  2A68 F;  3WGG A;  2W84 A;  3RDI A;  1XDS A;  3NEU A;  2P7V B;  2Q0O A;  5D5V B;  3GFM A;  3DEU A;  3WTS C;  2F5E A;  2KRF A;  1CGP A;  5EEH A;  2UXN A;  5D8L B;  2DO7 A;  4B09 A;  1IN5 A;  1G3S A;  1H9G A;  3PFI A;  4AIK A;  2P5V A;  4LJZ F;  1FX7 A;  3JSO A;  1RIO H;  1U3E M;  3HSR A;  4YFX F;  5H6Q A;  2DTR A;  4BHB A;  1B1B A;  2EFO A;  2J5P A;  3KP3 A;  4UNO A;  3E5X A;  1CF7 A;  1KU9 A;  3E97 A;  1WQ2 A;  1SMY F;  1DDN A;  3R60 A;  2CO5 A;  2A6H F;  2HTS A;  3EYY A;  1IN6 A;  5L3D A;  2VOP A;  3WU0 A;  1SD7 A;  4KN4 X;  3RI4 A;  3Q5F A;  3RKX A;  1ZRC A;  2RKH A;  3QOP A;  2ELH A;  1R23 A;  2Y48 A;  2V1D A;  2DI3 A;  1YW9 A;  4QLC U;  4IHT A;  3LAP A;  2WTE A;  1T98 A;  4UV9 A;  2A61 A;  1IAW A;  1UHM A;  3LFK A;  3QP6 A;  5CVI A;  3T5X A;  3FX3 A;  3V4G A;  2JZY A;  2MH9 A;  3HTS B;  1K79 A;  1T6S A;  2XUB A;  5L3C A;  3AAF A;  4EQQ A;  4MNU A;  4ZYG A;  1KQ0 A;  3P9C A;  2CGP A;  3F8M A;  3CUQ C;  1I27 A;  3ZMS A;  2IA1 A;  2FSW A;  5E8G A;  2DPU A;  1B4A A;  3MWM A;  4XRF A;  1UB9 A;  2LF8 A;  2K27 A;  3RKY A;  1DUX C;  2HEO A;  2GAU A;  3Q9V A;  4B8X A;  1I6X A;  2PI0 A;  1O3Q A;  3KLO A;  2FNA A;  3ABU A;  2YSR A;  2M30 A;  4YG2 F;  3DV8 A;  3CUQ A;  3EET A;  1YTY A;  5F64 A;  3KP7 A;  1R58 A;  1KA8 A;  3ULQ B;  4ENN A;  5L3E A;  2CG4 A;  3ZMD A;  2W85 A;  1SFU A;  4NQW A;  2FQ3 A;  1BJA A;  4M6X A;  5JR3 A;  3GZ5 A;  3RTR A;  2K7L A;  4BYY A;  2HDC A;  4CGZ A;  2FE3 A;  2PG4 A;  4P96 A;  4RB3 C;  4PGH A;  3J81 Z;  4HYE A;  5JVT A;  4ZZL A;  3FHZ A;  5CVV A;  2O6G E;  1R5G A;  5HLI A;  3WTU C;  2PFB A;  4MHG A;  1HKS A;  1FBQ A;  2GXG A;  2MH2 A;  1GHC A;  2O3F A;  2KIM A;  2DK5 A;  2KJB A;  2H09 A;  3GXO A;  3IKV A;  5D5W B;  5ICC A;  4M73 A;  5FFZ A;  3JTH A;  5DD8 A;  3REO A;  1LEB A;  2VON A;  2F5C A;  2D2W A;  2M8E A;  3WTX C;  2Q2E A;  2IA2 A;  2L3D A;  2JPC A;  2QQA A;  3ECO A;  1Z6R A;  4OIQ F;  1AWC A;  3K2Z A;  3EYI A;  5HS7 A;  2M45 A;  5HOO A;  1D3Y A;  2LF7 A;  1FOK A;  2MC3 A;  1W7P D;  2G9W A;  4HAM A;  2NAZ A;  1YW8 A;  4LLG F;  4OIO F;  1SD6 A;  1RUO A;  1ZH5 A;  3KE2 A;  3BDD A;  1MJ9 A;  1U8R A;  1TQI A;  3KEO A;  4DNC A;  4G6Q A;  4FX0 A;  3L09 A;  1ZG1 A;  4KN7 X;  4EM0 B;  1HW5 A;  4AD9 A;  4L9J A;  1FT9 A;  4L9N A;  1ZAO A;  1XDU A;  5E1X A;  2Q8K A;  3R61 A;  5LGU A;  2P6T A;  1JGS A;  5IT9 Z;  5CVJ A;  5H6R A;  5BPI A;  5IT3 A;  4BNC A;  1B9N A;  4GXO A;  4A2U A;  4IRG A;  5LEJ A;  1H9T A;  4LK1 F;  4OIP F;  1W7P A;  1WKM A;  3RYR A;  4ESJ A;  1QO0 D;  4RGS A;  4L5J A;  3LAJ A;  2XAH A;  4Y13 A;  2LKP A;  2DFI A;  2O03 A;  2XVC A;  4KIB A;  3GVA A;  3V7S A;  1Z7U A;  1GXP A;  2EA4 A;  3HUG A;  4QWQ A;  3EUH A;  2E7X A;  4U0V A;  3TOA A;  3SZP A;  1IXC A;  1BN5 A;  1KU2 A;  2L4M A;  2OQG A;  2ADU A;  2PJP A;  5HDK A;  1IXS B;  4Y17 A;  2DAO A;  5J6X A;  3OOP A;  4I02 A;  1K78 A;  4Q5S F;  2XAQ A;  4U88 A;  1OMI A;  2KKO A;  4G7Z F;  1PP8 F;  2WV0 A;  1FY7 A;  2YR2 A;  4Y15 A;  2YX7 A;  1LJ9 A;  5LGT A;  3RKW A;  1S8N A;  2A5Y B;  1TQP A;  1R00 A;  3ECH A;  2R7D A;  1P6R A;  2PEX A;  1DP7 P;  1OYW A;  1XSD A;  2GQQ A;  2RVC A;  3JAM K;  3KLN A;  4CIC A;  5K1Y A;  1EV7 A;  3Q9S A;  1UHW A;  4FHT A;  1TNS A;  3LA2 A;  3TOB A;  2DW4 A;  2XAS A;  1XSV A;  4KDP A;  1OYY A;  3SHF A;  4P5O A;  3LQQ A;  2Z99 A;  4U7D A;  4CZZ A;  1LNW A;  3P7N A;  3WTT C;  2IRF G;  4TV7 A;  2YX4 A;  5AIQ A;  1BC8 C;  3R4K A;  4ESB A;  5BMZ A;  1SD5 A;  2VT3 A;  1G3T A;  4BQA A;  2VN2 A;  3GWZ A;  4I2O A;  1ZAR A;  3SQN A;  5HDG A;  4MTE A;  1FYK A;  1JHF A;  4HW0 A;  5BQT A;  4P9U A;  3M8F A;  3I64 A;  2F5D A;  2EV5 A;  2HOE A;  5J8C A;  3F23 A;  3BWG A;  5LBQ A;  1W5T A;  3S2W A;  4RGX A;  3U1D A;  3R6S A;  3M1E A;  1QBJ A;  1NHA A;  1SFE A;  3ABT A;  5D5U B;  2G7H A;  5EEG A;  1MKM A;  2STT A;  2FBK A;  4JK1 X;  4LFU A;  3VB2 A;  4BHP A;  4EJT A;  1FYL A;  1TQM A;  3E6B A;  4YFK F;  4WXH A;  1KQ8 A;  2P4W A;  3L2C A;  2H94 A;  3WTY C;  1ZRF A;  1TTY A;  3COA C;  2M87 A;  4MGR A;  2FEZ A;  4BHC A;  4LG0 A;  5FO5 A;  3ZN1 A;  1BI2 A;  1T39 A;  2HKO A;  3DPL C;  1XD7 A;  3GFL A;  1HBX G;  4LB5 A;  4WCG A;  2DBB A;  4L0Y B;  3U2R A;  5LRS A;  1HQC A;  4I98 B;  2QZ8 A;  1O3R A;  3FXR A;  4N9H A;  4U0Y A;  2JTV A;  5FB2 A;  3WE2 A;  1SMT A;  2FF4 A;  4OOI A;  2QUF A;  1R22 A;  2XHK A;  3GLX A;  5ILU A;  4G7H F;  2ISZ A;  3I54 A;  5KK1 A;  4A5N A;  4ASN A;  2FOK A;  3K1N A;  4WX9 A;  2GWR A;  4Q4Z F;  4EV0 A;  4LK0 F;  1OR7 A;  3HHG A;  3HHH A;  1IF1 A;  1FSE A;  1ULY A;  4R1H A;  5DCM B;  4I7H A;  2VE8 A;  4RB0 A;  1Z9C A;  3E5Q A;  4ENK A;  5FD5 A;  1E17 A;  5DCM A;  1R7J A;  3O2P E;  3VEP A;  4A0X A;  2F2E A;  4LG0 B;  1JXS A;  4HF0 A;  2RNJ A;  2IPQ X;  2LDU A;  6PAX A;  3BOQ A;  5ICG A;  3D0S A;  2L4A A;  2X0L A;  4N9I A;  1WWX A;  3DFG A;  5ICF A;  2Y75 A;  2O8X A;  2Z5U A;  1MZB A;  1GXQ A;  3TKY A;  4RAY A;  2ZXJ A;  2VBY A;  2NRA C;  1D8K A;  5K5Q A;  3OV8 A;  3BJA A;  1ZHF A;  2HFH A;  4FX4 A;  3ZN0 A;  4L9T A;  3IRQ A;  3CLO A;  3QP5 A;  1PUE E;  3M9A A;  1T2K A;  1MDM B;  3TGN A;  2XRO A;  4P55 A;  3WGH A;  1TW2 A;  1P92 A;  2MD5 A;  5A2Q K;  3G3Z A;  3GEZ A;  3F21 A;  1K6O A;  2RV8 A;  2R7F A;  1B9M A;  2COM A;  3LWF A;  2XAJ A;  1F4K A;  5D6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...