3NEUA

The crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
NPTFHADKPIYSQISDWMKKQMITGEWKGEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMGSFVTSDKALFDQLKKELADAITERFLEEAKSIGLDDQTAIELLIKRSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lin1836 protein
publication title The crystal structure of a functionally-unknown protein lin1836 from Listeria innocua Clip11262
rcsb
source organism Listeria innocua
total genus 41
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3neuA01
1QGPA 5L3DA 3L9FA 1RIOH 3QPHA 3HSRA 5D6FA 1HW1A 1K7AA 1KU9A 1R5GA 1R7JA 4OMYA 4LG0B 3F21A 5DEQA 4UVCA 3HSEA 2H6BA 1FP2A 2H94A 3TKYA 3T8RA 5E18F 4AVPA 5HDNA 3M7GA 3JAMZ 1JHHA 1S6LA 3U9GA 2ETHA 2KKOA 1J5YA 1ZG5A 4MEXF 1XGSA 2K7LA 2BEOA 1XSVA 1NHAA 2HQRA 2MA3A 2VE9A 2ZNYA 2P5VA 1B9MA 4U0YA 2XGXA 3FMRA 5LGNA 3R0JA 1PDNC 1I6XA 4Z2YA 2DFIA 2YU3A 2OU2A 1GVJA 2CW0F 1A04A 2FMYA 1IN7A 2XHKA 2OAZA 2YR2A 3WTUC 2ZBKA 2R7FA 2CO5A 2ADUA 5D8LB 4IRHA 3Q9VA 5HLGA 1H0MA 1BIAA 4EJWA 1DDNA 2A6EF 2GZWA 3T8TA 3WTYC 2ZJ2A 3L2CA 2RKHA 4U0VA 1XGNA 5K5QA 3I4PA 3TGNA 2GXGA 1ZG3A 2HWVA 4FX4A 4A6EA 2OBPA 5J8FA 2O03A 1ULYA 1IRFA 1Z7UA 3JTGA 1YO5C 4A2UA 2Y48A 4KMFA 4GO1A 1USSA 5FD6A 4EJUA 4KICA 3PQKA 3L7WA 2GAUA 2JPBA 1YLFA 1E2XA 2F5FA 4EGZA 2VT3A 2EA2A 2A07F 3ZMSA 1I1GA 2XUBA 3JSOA 5J6XA 1HSTA 1IXSB 2W24A 4WCGA 2VXZA 4MTEA 3ERED 1C0WA 1U2WA 3EYYA 3ZMDA 3JW4A 3R0AA 1G3YA 2OZUA 2WWYA 2HS5A 2PQ8A 2EWNA 1ZRCA 3ZPLA 4G94A 3BJ6A 5LLQA 1KA8A 1TNSA 2NNNA 3FMQA 3KZZA 4Y13A 2QBYA 3F22A 2XKOA 4A0YA 1J2XA 2DI3A 5LEJA 2KJBA 4EVIA 3RJPA 4BHBA 1X3UA 4OMZA 3BJOA 3VFZA 1F5TA 2FBIA 2HZTA 3CLOA 4RAYA 1FYMA 4OU0A 4BH9A 3D0SA 4M73A 4HAMA 2OD5A 3DPTA 2LSOA 1RUOA 2COMA 3DEUA 2OQGA 1UHMA 3LAPA 5JHUA 3HOTA 4WXDA 5BMZA 2M45A 4WX9A 1XB4A 4RS8A 2DW4A 1BN5A 3D5LA 4GCVA 2KIUA 2UXXA 2L02A 1XCVA 2PG4A 3P9KA 2CYYA 3VODA 1KYWA 1R1TA 1LB2A 5F64A 5HS8A 1EH7A 5D8KB 2FOKA 4KN7X 5ICFA 2AXLA 3DPLC 3L00A 2RVCA 5EEHA 4LLNA 1R1VA 1U8RA 3WE3A 2RC4A 5ILSA 2DBBA 4R1HA 4KNYA 4N9HA 1G3TA 2CWEA 2AS5F 3QU3A 3BWGA 4R79A 1ZAOA 3IKTA 3ZP5A 1XD7A 2F2EA 2BV6A 4PGGA 1HW2A 2EK5A 3W6JB 3HRSA 2M87A 3F8CA 2R7DA 1IN4A 2HQNA 4RB1A 1RI7A 4FHTA 3J81K 4RB2C 2CQKA 4IVNA 1BOAA 4BHCA 3FXQA 4MHGA 2QQBA 4RGSA 1FPQA 3F8BA 1I1SA 1FBSA 4Q48A 1OYIA 2EA4A 3IC7A 4O5VA 1B4AA 2FRHA 1LEAA 5FB2A 4LMYA 1J7KA 4G7ZF 1TQMA 4E70A 2NAZA 3DKWA 3KCCA 4EGYA 3QRFF 2YPRA 2GWRA 4B09A 3U2RA 2Z33A 2MH9A 2PLYA 3TOAA 2XROA 2HKOA 2XV4S 3MZHA 4GYIA 1FP1D 1SFEA 3DXJF 4QLCU 4UV9A 2KIMA 3RIRA 1MDMA 1YIOA 2MBFA 2IVMA 2PJPA 3RPUA 2CFXA 2BGCA 3JTHA 4KA4A 3MFKA 3ULQB 3FXUA 2F5DA 3IKVA 4AD9A 1BM9A 3ZMUA 4HBLA 1EV7A 3I5UA 1SMTA 3RI4A 1U5TA 3I71A 4OINF 5IT9K 3MWMA 1OYYA 2DK8A 2FXAA 2FSWA 2GA1A 4BYYA 1HQCA 4BQAA 5DCMA 4OIRF 4IHSA 3TO7A 3O3KA 3J81Z 5FFXA 3CUQA 1KYZA 2E7WA 3K9TA 5K5OA 1CF7B 3GLXA 1R36A 5AONA 1O3RA 2YSRA 3CUOA 3BDDA 2ISZA 3E6CC 5ILUA 2BBYA 1KGSA 2NRAC 4N0BA 5AIQA 2M1BA 4U88A 3HIFA 2CG4A 5E1ZB 2CGPA 4L0ZB 2A61A 4LFUA 2EV6A 1MGTA 1Z05A 1MD0A 4I01A 3MQ0A 4PGHA 1P4AA 3WTVC 2Z9OA 1H9TA 3T5XA 1K78B 3K69A 1DP7P 1KQ8A 1SD5A 4IF4A 3BPXA 3IHUA 5DYMA 2G7UA 2OA4A 2Y0MA 2MLKA 4XSXF 4HF1A 2EB7A 4G7HF 3WTXC 2P4WA 3WTZA 1V4RA 1HSJA 1U5TC 2ZNZA 2VN2A 3T1BA 5JFRA 2LF8A 4IPAA 2VBZA 2DU9A 5ED4A 5D5WB 1T6SA 3EDPA 5IT9Z 3BROA 3Q5FA 3CUQC 2VBWA 3KLOA 3E97A 3HHGA 1LNWA 2ZFWA 4CHUA 2QLZA 4YFKF 1TNTA 5D5UB 2EJRA 2H6CA 5D4SA 2P5LC 4QWQA 4UVBA 2KJCA 3NRVA 4H0EA 3F8FA 4G6QA 2QM3A 5LRRA 2ACJA 4ETSA 4M9SA 3FHZA 3GZ5A 5ERIA 2YX4A 1MJAA 1TW2A 4HW0A 3VB2A 4ZYDA 5LHHA 4M71A 2Z99A 4YIIA 4DNCA 2O8XA 4ESBA 4I2OA 5LGUA 2JRTA 2LDUA 1IRGA 1SD7A 3F6VA 3BZ6A 5CVRA 3QAHA 1UFMA 2KIFA 3E6BA 4P55A 1QO0D 3LSTA 2DQRA 1BJAA 4Q47A 4BXUA 1P92A 2O6GE 2PBIA 2X0LA 3I54A 1F4KA 1PP7U 2QWWA 5E8GA 5E1XA 4BHPA 1OKRA 3ROUA 1XN7A 5DD4A 1ON2A 4R8HA 4S04A 2PI0A 5HVQC 4M9ZA 3HRUA 3H3UA 3KETA 3GVAA 2MH2A 3ELKA 4MQVA 3FX3A 4LK1F 2RDPA 2JSCA 3SZTA 4LLLA 3HRMA 2JPCA 4JK1X 1B9NA 1REPC 3GFMA 2FA5A 3GF2A 2KRFA 2V79A 4UHTA 2HTSA 3DV8A 3W6KB 2FBKA 2EV0A 3M1EA 3I59B 3H92A 5CYVA 2A6HF 2O0YA 1GXQA 4IXAA 1MJ9A 4D0PA 3BY6A 4L9TA 2QYOA 2XAFA 3CTAA 2VONA 1LDKB 1S7OA 2HTJA 5HDGA 4WWCA 2STTA 3AAFA 3DP7A 3QOPA 3RKXA 1ODDA 3G3ZA 3WE2A 2HGCA 2UXNA 3WODF 2K4JA 3VEPA 1FBQA 4O3MA 4WXHA 3K1PA 1P2FA 3V8KA 2HYFA 1QPMA 1USTA 2QENA 4BAYA 4ESJA 1TTYA 1ZG1A 3I58A 4HLYA 2A69F 3IRQA 5JR3A 4EJTA 2D1VA 4Y17A 4I09A 1D3YA 2FF4A 3BP8A 4P5OA 1FSEA 3SQNA 3LFKA 3FM3A 5ICCA 3P9IA 1XDSA 4PCQA 5DCMB 1R00A 4ASNA 1SD6A 3GZ6A 1W7PA 1O7LA 2BYVE 2B0LA 2IP2A 5H6RA 3KP6A 5FD5A 5E17F 3KEQA 3IL2A 3BJAA 3KFWX 4PZJA 1I27A 4EM1A 1SAXA 4WXCA 1R1UA 3E5XA 4A6DA 3KE2A 5FLXK 4IRGA 3RTRA 4YFNF 5CLSA 3B02A 1EH6A 1MJBA 1TQIA 1BBYA 3LA2A 2DTRA 5H20A 4I02A 3LA7A 4UNOA 3OOPA 3GWZA 4CXFA 2FMLA 2VOPA 4L0YB 1D5VA 3WTSC 5DUKA 1WRJA 2RQPA 1S29A 2RV8A 1FYLA 1R23A 2RN7A 1V3FA 4LG0A 2IA1A 1ONVA 4AIJA 4LB5A 2DO7A 5LRSA 2R3SA 4XSZF 5D4RA 4KMUX 3TO9A 2ZMEB 3GW2A 1YQAA 3WTTC 1SD4A 4UXNA 4HF2A 3ZN1A 3MEXA 1FNNA 3NEUA 2ELHA 1UHWA 3OV8A 1KQ0A 1IN6A 1YS6A 4KIGA 3ZMZA 2E7XA 3SFZA 3QPTA 4FX0A 4LD5A 2L3DA 4UV8A 5E20A 3LQRA 4A12A 3O6BB 3SHFA 3IRRA 3PQJA 1S3JA 2JTVA 5FLXZ 2A68F 3L09A 4I0AA 3REOA 1ZREA 1CGPA 5EEGA 5TRDA 4ZYHA 2XAGA 2NS0A 1GXPA 2HEOA 5DUIA 2IA0A 4P9FA 3CO6C 3DQVC 2FQ3A 3COAC 1O3QA 4WK8F 5J8CA 1OYWA 5L3EA 1O57A 1Y0UA 2FNAA 3I53A 1R5HA 3KP3A 4EQQA 4KYWA 1FOKA 2GXBA 4P96A 5TJJA 1IZ1A 2F5EA 1Z6TA 5FGMA 2V1DA 2IPQX 2P6TA 3G73A 2C6YA 4YIFA 3H3ZA 1HXDA 3GXOA 4KFCA 4A0ZA 2D45A 2IA2A 5IT3A 1IN5A 2W84A 3KEOA 5E8IA 4AIHA 2Z5UA 4F7ZA 2VBXA 5HS9A 3FWEA 3ZMTA 2NNYA 1K6OA 3V7SA 3VOEA 2L54A 2WC2A 1K79A 1QZZA 4HV6A 3E5UA 1FYKA 3LAJA 4ZYEA 3NQOA 3EUHA 1L0OC 3CO7C 1GHCA 1KQ9A 2O3FA 4EJOA 3GO5A 2Q8KA 3GUDA 1DUXC 2HKXA 1ZHFA 5CVVA 4HX8A 5L3FA 2X4HA 1D8KA 4ENKA 3N4MA 4YFXF 2XRNA 1W7PD 1T2KA 2PMUA 5HLHA 4GXOA 1IN8A 4KDPA 4L9NA 2A3SA 4L5JA 1O3TA 4UUVA 4KT5C 3CJNA 4RB3C 3RYRA 2Q2EA 5DCFA 3KP2A 3WU0A 4L18B 3ML6A 1Z91A 4HA8A 4M6YA 1VTNC 2LNBA 3LA3A 2PN6A 2QQAA 3E3VA 2UZKA 1F9NA 4XLNF 2VE8A 4RGRA 4A5NA 2QZ8A 5LBQA 2MD5A 1W7PB 4IRIA 4LK0F 2W85A 1R58A 3WTWC 2QBYB 4G6DA 2ZXJA 2L4MA 5ILVA 2IJLA 2NYXA 3F3XA 4HOBA 2FNPA 2XAHA 1BIBA 4LB6B 4OIQF 2ESNA 1YYVA 5HLIA 4JBAA 1ZN2A 1J75A 3J80K 1IUYA 5BPDA 3E6DA 2IRFG 4ENNA 3GYHX 4L9JA 1SMYF 1LJ9A 1XGMA 2XAQA 1BC7C 3Q9SA 4FT8A 2DK5A 1P4XA 1Z9CA 1UB9A 3EQLF 3U1DA 2H27A 1MKMA 3I64A 3K2ZA 3ZMVA 3V4GA 3KLNA 4ZH4F 1ON1A 4ENJA 2ESHA 4ZYGA 2E1NA 4NHJA 1ZGJA 5CVUA 1EH8A 4IJAA 2RNJA 1XMKA 2FE3A 3C7JA 2ISYA 2ZO4A 3GEZA 2DT5A 4MEYF 2P7CB 1DPRA 1YW7A 3TDUC 1XMAA 4YG2F 3HTUA 4DQ2A 4HF0A 1WKMA 4IHTA 3HTSB 2MC3A 1W5SA 3ECOA 3R60A 5ICGA 1UCRA 5F1RA 3CDHA 1ZH5A 4KIBA 3F8MA 2YX7A 4L5IA 3KP5A 2EFWA 4S05A 2VC0A 3FZVA 4LJZF 5A2QK 1XDUA 3P7NA 3MAJA 1XSXA 3J80Z 3QP5A 4I98B 2W25A 3SZPA 2Z3YA 2M5WA 2EV5A 2J5OA 1P6RA 6PAXA 3LQQA 4N9IA 5L3BA 2XVCA 1IXRC 5KVRA 5AIPA 3TOBA 3F6OA 1FLIA 3RYPA 3F23A 1OMIA 4RGUA 3C18A 2A5YB 1ZARA 4A0XA 5LGTA 2DQLA 3K1MA 3KZYA 5FO5A 1G6NA 3BPVA 4XRFA 4LGWA 2E1CA 1G3SA 4U7BA 4EMSA 5CVJA 3MZYA 5D5XB 5H6QA 1ZGAA 4UVAA 3TQNA 1FT9A 2UWMA 2EFQA 4M72A 1D8JA 3WGHA 1MDMB 1YG2A 1CF7A 2QUFA 4HX7A 1FSHA 2WV0A 3JSPA 4G9YA 3QU6A 2DPDA 4HDVA 2QQ9A 4HLXA 2GIVA 1IXCA 4AIKA 1WI9A 4OOIA 2JT1A 1YS7A 5DDGA 1SFUA 3M9AA 1BI0A 1FBUA 1XCBA 2BE5F 3ABTA 2D2WA 3R6SA 5LHIA 1U5TB 2XAJA 3ISPA 1YW9A 3WU1B 2L4AA 1FC3A 4JQFA 2OQRA 1W5TA 1OPCA 2EFNA 2XIGA 4CYDA 5A2QZ 2VT2A 1QQIA 2XKPA 3LWFA 2V9VA 4ZZDA 3CUQB 4I7HA 3BOQA 1XGOA 3ABUA 3ZN0A 1WWXA 1BI3A 3R4KA 4B8XA 1HW5A 1K78A 3RKYA 2VBYA 4CDGA 3MCZA 1HKSA 1R22A 2O61A 1U6GA 1S7AA 1I5ZA 4MTDA 3RPQA 5JI6A 3J7AO 4HDUA 1PP8F 2ZKZA 3RKWA 5HOOA 1ZRDA 2DPUA 2QVOA 1T0FA 1LQ1A 1FZPB 3C3WA 3RDIA 2FU4A 2PFBA 5DV5A 1RNLA 4KUMA 5KK1A 4O6JA 2M30A 1B6AA 2IT0A 1WQ2A 1BI1A 3FXRA 4RGXA 2PMHA 4ESFA 1Z6RA 4RAZA 2K4BA 2WTEA 5D5VB 3V8JA 2IW5A 1S8NA 1LDJA 1JHFA 3M8FA 1JXSA 1U3EM 3TDZC 3F72A 2Q0OA 5BQTA 2DLLA 1MZBA 4AWXB 1B59A 4BNCA 3K0LA 1PUEE 2F5CA 4G8XA 1T98A 4M6XA 3HSFA 2TDXA 3R61A 1G3WA 1T39A 3GX4X 1JE8A 2V6CA 3FF5A 3HHHA 2EFPA 5E1WA 2P7VB 4CICA 4LLGF 1E17A 3FM5A 1Z1DA 2JZYA 1O7FA 2CSOA 2H09A 3KP4A 3GFIA 2V1UA 2MLGA 3TO6A 3V7CA 1L3LA 4KN4X 1KU2A 1AWCA 3S2WA 1G4DA 4RB0A 3HUGA 3P9CA 4XBFA 2OZ6A 4EJVA 4Y15A 2G7HA 1KU7A 3HYIA 2HR3A 1U78A 1H9GA 5BOXA 4EM0B 4G7OF 1HKQA 2V1XA 2VC1A 5K5RA 1ZRFA 3GFJA 4K2EA 3I59A 3GFLA 3KP7A 4CZZA 1HBXG 3E5QA 1P4WA 4U7DA 4EV0A 1XSDA 1T38A 2GA2A 5JVTA 4CO8A 5LHGA 2STWA 3WGIA 4OIPF 1QZYA 4XLPF 3ECHA 4ENMA 4HYEA 1ZLJA 3PFIA 1Q1HA 3DFGA 2FBHA 1SFXA 2VOOA 1TQPA 2Y75A 4A5MA 4ON0A 5L3CA 2M8EA 4TV7A 1WSUA 4MQ9F 4KIFA 4NQWA 2J5PA 1YW8A 1LEBA 1TBXA 1TLHB 5D6EA 1TW3A 3IWZA 1F1ZA 3B73A 4M74A 5FFZA 3EETA 4Q4ZF 4HQEA 3QP6A 1YFHA 4HX4A 1KU3A 1DPUA 1OR7A 5BS6A 2P8TA 2HDCA 4I0BA 1RUNA 4EM2A 1LDDA 2ZCWA 4HQMA 4GGGA 1RZ4A 2VODA 2XASA 1BI2A 4GYGA 1FWZA 2EFOA 4Q5SF 5LEKA 2K02A 1IF1A 2HOEA 1ZLKA 1J59A 2HYGD 3HRTA 1QBJA 2K86A 2P5KA 2RGVA 4MNUA 3I0TA 4PDKA 2D1HA 3C1DA 5BPIA 3M8EA 3ZQ7A 1BC8C 3F8NA 3JAMK 2L01A 5CJ9A 4CGZA 2DAOA 2PEXA 3IWFA 1IW7F 5HS7A 4HZFA 1AOYA 1QNTA 3V8LA 5HDKA 1FX7A 4OIOF 5CVIA 4L9VA 5K1YA 1J0RA 1JGSA 5DD8A 2G9WA 3N97A 1FY7A 2LF7A 1J9IA 1O3SA 4WF2A 2FEZA 1STZA 3E6MA 3WGGA 1W4MA 2W57A 3V7RA 3FMSA 1IAWA 2K27A 4HV5A 3T0YA 3DF8A 3SXYA 4MGRA 2P6SA 1LVAA 2ZMEA 3K1NA 3HOSA 1HKTA 2GQQA 4NB5A 2HFHA 5ICEA 1B1BA 4U0WA 1ZYRF 4P9UA 4ZZLA 5L3GA 3EYIA 4M9XA 3O2PE 1YTYA 2LKPA 5F6FA 3WG9A
chains in the Genus database with same CATH superfamily
3S3NA 1QGPA 5L3DA 3L9FA 1RIOH 3QPHA 3HSRA 5D6FA 3HKZA 3CMEI 1HW1A 1K7AA 2KZGA 2K3PA 1YX3A 1KU9A 1UMQA 2OF7A 2I10A 1UELB 2IBDA 1OCCH 3S8PA 2DMQA 2NS7A 1R5GA 1EJ9A 1XG1A 1R7JA 4OMYA 2NVQJ 4LG0B 2A6TA 3F21A 1R71A 4CYCB 2IS4A 2W7NA 5DEQA 1A35A 4IHXA 4UVCA 3HSEA 2H6BA 1FP2A 1XS9A 2H94A 1UJ8A 3TKYA 3T8RA 2Y2ZA 5E18F 2VKVA 4AVPA 2M0MA 4FTHA 4NNJA 2LY9A 2JRMA 1GV5A 4RMNA 5HDNA 3S2DJ 2KFDA 2M0CA 1VQKI 3M7GA 3JAMZ 1JHHA 1S6LA 3U9GA 3ERMA 2ETHA 2KKOA 1G2HA 1J5YA 4U87A 1QVUA 1ZG5A 4MEXF 1XGSA 3X2QH 2K7LA 2BEOA 2FD5A 3ABKH 2QQ8A 2VI6A 4E7LA 4A3LJ 1XSVA 1NHAA 2HQRA 2MA3A 2VE9A 1VQPI 2ZNYA 2P5VA 4XN0A 1B9MA 4U0YA 3K6GA 2XGXA 3FMRA 4NC7A 5LGNA 2R7OA 3R0JA 3GTJJ 1I6XA 1PDNC 4Z2YA 2DFIA 1JJ6C 2L7MP 3G1LA 5EGOA 3GZNB 2LLKA 2YU3A 2LBFA 2K9NA 2OU2A 3K4KA 2M4GA 1GVJA 3BZKA 1K6YA 2HVQA 1J09A 1TWCJ 2CW0F 4PFPA 1A04A 4HNVA 2FMYA 1IN7A 4A3DJ 3H9JA 1QU3A 2XHKA 2OAZA 2YR2A 3WTUC 1FOXA 2HQ5A 2ZBKA 2CUFA 2IEKA 2R7FA 2CO5A 2ZSIB 1WVRA 3DLLF 2MFZA 4FISA 3DKYA 2ADUA 1M1EB 4XKVA 2M4KA 5D8LB 3WHCA 1APLC 4IRHA 3Q9VA 5HLGA 1H0MA 4ZDPA 2R92J 3ZQIA 4LIUA 1BIAA 3S1RJ 5EYRA 4DYQA 3BR3A 4EJWA 1DDNA 2A6EF 2FX0A 1IUFA 2W00A 2GZWA 1NG7A 3T8TA 3WTYC 2ZJ2A 3L2CA 2RKHA 4U0VA 4BQOA 1XGNA 5K5QA 3I4PA 4XIDA 3TGNA 1EA3A 2Y0SN 1TT0A 2GXGA 3OYIA 1ZG3A 2HWVA 4FX4A 3FDYA 2L7ZA 2OBPA 4A6EA 5J8FA 3EUAA 2O03A 1RR8C 4M3GA 2M7BA 3QOEA 1ULYA 4C2MJ 1IRFA 1Z7UA 3S17J 3JTGA 1V5FA 1YO5C 4A2UA 2H8RA 2X6OA 1LE8B 2Y48A 1QHHD 4GO1A 1USSA 4KMFA 5FD6A 3DBRB 4EJUA 3OS2A 3CCRI 4KICA 3PQKA 1FOYA 1RKTA 3PIPF 3J7ZI 3L7WA 5J4YA 2GAUA 1FOWA 2JPBA 1YLFA 1E2XA 2E2HJ 1MMDA 2F5FA 2VKHA 3EPZA 4AVZA 4EEFG 4EGZA 2VT3A 2EA2A 2A07F 3BCBA 3ZMSA 1I1GA 3FIWA 2XUBA 4DYCA 5F27A 5C44J 2R7UA 3LSJA 1QA6A 3JSOA 5J6XA 1HSTA 1X1PA 1IXSB 2W24A 3Q0WA 4WCGA 1POGA 2VXZA 4MTEA 3ERED 1D5YA 1C0WA 4XM3A 1U2WA 3EYYA 3ZMDA 2V9KA 3DBLB 3JW4A 4RA2A 2V4JC 3A2KA 3W2VA 1VFCA 3R0AA 1G3YA 2OZUA 2WWYA 2L2OA 3L2QA 5B5EC 2HS5A 3S16J 2PQ8A 3NWTA 5FJ8J 2EWNA 1YX5A 1ZRCA 3ZPLA 4G94A 1N25A 3BJ6A 5LLQA 1KA8A 3A01A 4OAZA 1TNSA 1D1CA 2NNNA 3FMQA 4B43A 1RESA 2E1MC 3BCAA 2YUSA 3SEQA 3KZZA 2LR8A 4Y13A 2QBYA 3A0HC 3RCOA 3ZQHA 3I4NJ 3KYLA 3F22A 2XKOA 4A0YA 1J2XA 2DI3A 3J7YJ 5LEJA 4E7KA 2KJBA 4EVIA 3RJPA 1E3PA 2HVRA 4BHBA 3JRHA 1X3UA 2Q2EB 2O9LA 5FRNA 2LMDA 2VJIA 3K4CA 4OMZA 2JVGA 3BJOA 3VFZA 1F5TA 2DT7B 2FBIA 2HZTA 1OLTA 3CLOA 4RAYA 1FYMA 4OU0A 4BH9A 1QRYA 3D0SA 2DYSH 4M73A 5KAIC 1MBFA 4HAMA 4RM3A 2OD5A 1BR1A 4XKBA 3DPTA 2V26A 1KONA 1MIJA 2LSOA 2P81A 3HZJA 1RUOA 2COMA 3DEUA 2CJJA 1UHMA 2OQGA 2W48A 2VPLA 3LAPA 2ECBA 3O8GA 5JHUA 3HOTA 4WXDA 4G6TB 1ZGWA 2ZSHB 2N8GA 5BMZA 2M45A 2O7OA 1PUFA 3E1SA 4WX9A 3CC2I 5EG0A 2MD0A 3OYDA 1XB4A 3G1MA 3JCUC 4RS8A 3ZOBA 4W97A 4F3QA 1HA8A 1SC7A 1N75A 3DTIA 3ONQA 4B3AA 3I55I 2DW4A 1BN5A 3D5LA 1B72A 5HNFA 4GCVA 1YOVB 2KIUA 2UXXA 2L02A 1XCVA 2VJ5A 1Y8QB 2PG4A 2XDVA 3P9KA 2CYYA 3K7AJ 4NBQA 3VODA 1KYWA 1R1TA 1LB2A 3RQIA 5F64A 4F92B 4JX6A 5HS8A 1EH7A 4C3HJ 2BY3A 4E7HA 2R4GA 3HXLA 2VB6A 5D8KB 4PJLA 2R7SA 3DU6A 2FOKA 1T56A 3E7LA 2AHQA 3GLLA 1SANA 4KN7X 5ICFA 1A6IA 2AXLA 3DPLC 3L00A 5JHFA 2DOAA 2RVCA 2DMPA 5EEHA 1R4NB 1R1VA 1Y39A 4LLNA 2TRTA 2BY2A 2HZDA 1VQOI 3PSFA 4AM3A 1U8RA 2ZFUA 3SEZA 3WE3A 1PVEA 3TW6A 2RC4A 5ILSA 2DBBA 1YIJI 1JT0A 1A36A 4R1HA 4KNYA 2BOLA 4N9HA 5FLMJ 3K4NA 3DLAA 2GOXB 1G3TA 2CWEA 2AS5F 3OIOA 1ZKGA 1X1CA 5H2FC 3QU3A 3BWGA 1SFKA 4R79A 2AXTC 1ZAOA 2R5ZB 1YI2I 3IKTA 3ZP5A 1YRNA 1XD7A 1R9TJ 2F2EA 3JRBA 2BV6A 4PGGA 2HPMA 1HW2A 2EK5A 3CQZJ 3W6JB 3CJQB 5FROA 5M5YJ 3HRSA 2M87A 3F8CA 4E7IA 2R7DA 1V54H 1IN4A 2HQNA 1H8AC 1X4OA 4RB1A 1WJFA 5FKNA 2MG4A 4M3EA 3AKZA 1R4MB 2EIMH 1RI7A 4II3A 4FHTA 3J81K 1GDTA 1YHQI 5F1JA 2WB1A 2CQKA 4RB2C 4IVNA 2XSJC 1BOAA 4BHCA 3FXQA 4MHGA 2QQBA 4IHYA 3A02A 2VKEA 4RGSA 1FPQA 4A3BJ 3DTEA 2DA2A 3F8BA 1I1SA 1FBSA 4JX5A 1OYIA 4Q48A 3OY9A 2V9PA 2EA4A 3IC7A 2DJNA 2IS2A 3OR2C 4O5VA 1B4AA 2XC7A 3HL2A 1JUPA 2FRHA 1LEAA 5FB2A 4LMYA 5IY5H 1J7KA 4G7ZF 1V55H 1TQMA 4E70A 2IGNA 2NAZA 3DKWA 3KCCA 4EGYA 3QRFF 3H1CA 2YPRA 5B1AH 2OTLI 2HOTA 2GWRA 4AYBA 1FMVA 4B09A 3U2RA 2Z33A 1LFBA 2ZB9A 2MH9A 2K3FA 2PLYA 1NK3P 3TOAA 3GTPJ 2XROA 2HKOA 2XV4S 3MZHA 4QTRA 4GYIA 1BL0A 2DDBA 3IAS2 1AKHA 1FP1D 1SFEA 3DXJF 1VQMI 2E2JJ 4QLCU 4UV9A 2KIMA 3FXOA 3RIRA 1MDMA 1YIOA 1JTYA 2MBFA 1OCRH 2IVMA 4IX7A 5J1RA 3GTKJ 3ZCOA 2PJPA 3RPUA 2CFXA 1XTAA 2BGCA 3JTHA 4XMYA 4KA4A 3MFKA 3ULQB 3FXUA 4KITB 5B3SH 2F5DA 2CUZA 1ETKA 3IKVA 1TL8A 4AD9A 1BM9A 3ZMUA 3ESWB 3OYNA 4JP0A 3OS1A 1SFOJ 4HBLA 3MKLA 4X1EA 2E1MB 2Z2SB 1MBHA 1EV7A 2F48A 3I5UA 4NC8A 1SMTA 4C3JJ 2L0KA 3RI4A 4BXFA 4E7SA 1D0YA 1U5TA 3I71A 4BL0B 4BDZA 4OINF 4HSRA 4BS9A 5IT9K 3MWMA 2Y9ZA 1OYYA 1FTZA 2DK8A 2FXAA 2FSWA 1MMGA 2GA1A 3RZOJ 5DM7F 4BYYA 1HQCA 4BQAA 5DCMA 3LSGA 4XN3A 2VIXA 1Z0XA 5FKLA 4JOMA 4OIRF 2PJRA 5FKOA 3FHNA 4IHSA 3TO7A 3O3KA 3GTOJ 3J81Z 5FFXA 4F52A 3CUQA 1RC9A 1KYZA 2E7WA 3K9TA 1I50J 5K5OA 1SEUA 2LG4A 2KMUA 1CF7B 3GLXA 4N4NB 1R36A 4XLEA 5AONA 1O3RA 2DMUA 2E1OA 4CCMA 2QF7A 1JUMA 4PUSA 5GPCA 1NH3A 2M8GX 2YSRA 3CUOA 3BDDA 3S3OA 2ISZA 3E6CC 2KDOA 1ETXA 4A3FJ 2JA6J 1P9QC 2LVSA 5LFAA 5ILUA 1N77A 5CQEA 2OV7A 2BBYA 1KGSA 2NRAC 4N0BA 3JRDA 3ZQLA 3VWBA 2HVSA 2CQQA 5AIQA 2M1BA 4U88A 3FISA 1A5JA 3HIFA 2CG4A 5E1ZB 2CGPA 4L0ZB 1ETWA 2A61A 3NWSA 3TW7A 4LFUA 2JVHA 2BY0A 2EV6A 1BA5A 1MGTA 1Z05A 4D7NA 4BBRJ 1OCZH 2CV0A 1X3ZB 2X85A 4YIRX 1MD0A 2EIKH 3MQ0A 4I01A 2B7EA 3GTLJ 1NG6A 3IH4A 4PGHA 1P4AA 1T33A 3WTVC 2B63J 4HPQA 2IS1A 2Z9OA 1H9TA 1X2NA 3T5XA 3VDXA 3ASNH 2ME6A 1S72I 1ZREA 5FLVA 1K78B 4CZCA 3K69A 1DP7P 2EILH 2JSPA 1KQ8A 1SD5A 1LPQA 4IF4A 3BPXA 2NS8A 3IHUA 5DYMA 3A01B 3UKGA 2G7UA 1G59A 3I4MJ 2DA1A 3OL4A 2OA4A 2Y0MA 2MLKA 4XSXF 4HF1A 2LOOA 2EB7A 1X58A 3BG7A 5K7FA 4G7HF 4IKFA 3IV5A 3Q3SA 1D1BA 3WTXC 2P4WA 3WTZA 1V4RA 2OC6A 1HSJA 4XK4A 4UB8C 1U5TC 2ZNZA 4QPQA 2VN2A 3T1BA 2NOJB 1ETYA 1F36A 5JFRA 2LF8A 4IPAA 1ITYA 4PSWA 1OR7C 2E60A 2I8DA 2VBZA 2DU9A 2X6YA 5BNGA 1SVMA 1X3WB 4H4KC 5ED4A 5D5WB 1A31A 1W5CC 1T6SA 4AYBN 2DT6A 3EDPA 5IT9Z 1JKRC 1ZK8A 3AL0C 3CDIA 3BROA 3GTGJ 3A4CA 3QODA 2L9VA 4IL6C 4ZJZA 3Q5FA 3CUQC 3KX2A 2VBWA 2NVYJ 3KLOA 3E97A 3HHGA 2Q1ZB 1LNWA 4GFBA 2ZFWA 4CHUA 2QLZA 4DJAA 5E79C 4YFKF 1TNTA 5D5UB 2EJRA 2H6CA 5D4SA 2P5LC 2E5ZA 2JN6A 2MGQA 4QWQA 4UVBA 2KJCA 3NRVA 4H0EA 3F8FA 2ZJRF 4G6QA 3D5SC 2QM3A 1I3AA 5EG0B 4CUGA 5LRRA 4MFDA 3CMAI 2X1DA 2ACJA 4ETSA 4M9SA 4FE7A 3FHZA 3GZ5A 1B8IB 3S1NJ 3O8HA 4PK4A 5ERIA 3JRGA 2YX4A 1MJAA 1TW2A 2W4SA 4HW0A 3VB2A 3UR3C 4ZYDA 5LHHA 2JA7J 2KHMA 4CCJA 3PIOF 4M71A 3OSFA 2Z99A 1TP4A 1X2MA 4YIIA 4CA0A 4DNCA 4KJZA 2O8XA 4ESBA 4I2OA 3PNVA 5LGUA 4UY8I 2JRTA 2LDUA 3D1NI 1GVDA 1SVOA 1SD7A 2F5VA 1IRGA 2Z16A 3F6VA 3W2WA 3BZ6A 5CVRA 3QAHA 4HNTA 1UFMA 2G0EA 4B44A 2KIFA 3E6BA 4P55A 1FEXA 5M5XJ 1QO0D 1MBGA 3LSTA 5C4JJ 3BZCA 1HC8A 2DQRA 1BJAA 3BG3A 4Q47A 4BXUA 1P92A 2CU7A 2O6GE 3PO2J 3W3CA 5IPAA 2PBIA 2X0LA 3I54A 1F4KA 4LIVA 5GADJ 1PP7U 3F0CA 2LP0A 4XRSG 2QWWA 2X51A 4AC0A 5E8GA 3CC4I 3DBHB 5E1XA 4BHPA 3FXJA 1OKRA 3D5RC 3ROUA 3F9KA 2CRGA 1XN7A 5DD4A 2FUG2 3BR0A 1DU0A 2M2EA 1D1AA 1ON2A 4R8HA 4S04A 3ABLH 2ZMEC 3VSKA 2PI0A 3HUGB 3OYCA 4A3KJ 4MO7A 5HVQC 4M9ZA 3FK6A 2RREA 3HRUA 2KIQA 1K4SA 3MVPA 3H3UA 3KETA 3GVAA 2MH2A 2EPFA 2ZXIA 3ELKA 3N05A 2ZXHA 1VI0A 3CCVI 2KLOA 4MQVA 1WPKA 3FX3A 1XX5A 4LK1F 3RPUD 2RDPA 2LK2A 2JSCA 4BJTA 3SZTA 4LLLA 3HRMA 2JPCA 4JK1X 2LKXA 1B9NA 1REPC 4AIDA 2BXYA 3GFMA 3OYJA 2FA5A 5CQGA 3GF2A 3MKYB 2JQ7A 2KRFA 2V79A 4UHTA 2HTSA 2LKSA 3DV8A 3W6KB 1Z77A 2FBKA 2VQHA 2EV0A 2DA4A 2XGDA 3M1EA 1HF0A 3I59B 3H92A 3LL7A 1VQNI 4XNFA 5CYVA 2A6HF 2O0YA 5GAEJ 1GXQA 2R7VA 3CF2A 4RBOA 4IXAA 1FJLA 1MJ9A 4D0PA 1SAUA 4JX4A 3BY6A 5IYBJ 3W2AA 4L9TA 2QYOA 2XAFA 3CTAA 1ZR2A 3KZIC 2VONA 4HEA2 4CCKA 1LDKB 3L1PA 1S7OA 1ZTRA 2HTJA 4Y3OA 4IQ4A 5HDGA 4WWCA 1LFPA 2BVLA 3MD2A 3IAM2 2STTA 3AAFA 4XR6A 3DP7A 3QOPA 3RKXA 4IEJA 2DXIA 1ODDA 3G3ZA 3WE2A 2JA2A 3S1QJ 2ZXWH 2M34A 2HGCA 2UXNA 3CCYA 2K4JA 3WODF 3VEPA 3PL8A 3OL3A 1FBQA 1LFUP 1MSFC 4O3MA 4WXHA 3AG4H 3K1PA 5C3EJ 1P2FA 4NQWB 1GUUA 3TEDA 2ID3A 3WHBA 1WJDA 2ID6A 2HYFA 1QPMA 3V8KA 4M6VA 1USTA 2QENA 4BAYA 1WJAA 4A3GJ 4MIMA 5J1UA 4ESJA 3H0GJ 4DZJA 1TTYA 4V2FA 1ZG1A 3I58A 3BT9A 2A69F 4HLYA 3IRQA 5JR3A 4EJTA 2D1VA 3HKZN 4Y17A 4I09A 2IXSA 3WU2C 1D3YA 2FF4A 3PSIA 3BP8A 4P5OA 1FSEA 3SQNA 2CW8A 4C30A 3LFKA 1ENHA 3FM3A 3FXLA 3IH3A 5ICCA 3P9IA 1XDSA 3BC8A 4PCQA 5DCMB 1R00A 4ASNA 2R7XA 1SD6A 5E3MA 2MW8A 3GZ6A 1W7PA 1O7LA 2BYVE 3DCFA 2R93J 2B0LA 1MNDA 3L2WA 2IP2A 5H6RA 2L9RA 2L5QA 3KP6A 3K4BA 4B4CA 1UG2A 5FD5A 2ZC2A 1TWGJ 4XKWA 1FTTA 2DOEA 2DODA 5E17F 5IP7J 4F91B 1MBJA 3KEQA 3IL2A 3BJAA 3KFWX 4PZJA 2K5CA 3AG2H 4RAFA 3PUBA 2ZJQF 1I27A 3C2BA 4EM1A 3OWTA 3QYFA 1DQUA 4LITA 4WXCA 1SAXA 1R1UA 3KEYA 3E5XA 4A6DA 5M3MJ 1IDYA 2BW3A 4KISA 3KE2A 2R5YA 4JYKA 4B48A 5FLXK 4IRGA 2O5RA 3RTRA 5CKTA 2JA5J 4YFNF 2K9SA 5CLSA 4Z6YA 3B02A 3JRIA 3GTMJ 1X4PA 2F4MB 2RQQA 1EH6A 1MJBA 3SYTA 4V2GA 2GIZA 1TQIA 1VZ0A 1Y8RB 2E19A 3M8JA 1BBYA 3A1YA 3LA2A 3NAUA 4XOPA 2DTRA 4HNUA 5H20A 2DOFA 4I02A 3U1KA 4A3CJ 3LA7A 3BG5A 4UNOA 2HYJA 4P1WA 2NVUB 1RKWA 3OYAA 3S3MA 2L7KA 2DMNA 3OOPA 3GWZA 2R0QC 4CXFA 2FMLA 2XSDC 1WGXA 2K85A 2VOPA 1DGWY 5K7HA 4L0YB 2DFEA 4OWRB 3WTSC 1D5VA 5DUKA 3HJEA 1ZQ3P 1WRJA 2BHYA 2F4OB 3L2UA 1CQTA 2JUGA 2RQPA 3TBIA 4S0HB 1S29A 3QPSA 4MLOA 2D5VA 1XC5A 2RV8A 1MSEC 1FYLA 1R23A 2RN7A 5F0FA 3ZRGA 2VLAA 1V3FA 3H5RA 1X1DA 1W0UA 4LG0A 2IA1A 1ONVA 4CYCA 4AIJA 3K4LA 1WH7A 2IGMA 4LB5A 2DO7A 1Q1VA 1OCOH 1IO2A 5LRSA 3CZ6A 3DWLE 2R3SA 4XSZF 2GXAA 5D4RA 1P7IA 4KMUX 3TO9A 2ZMEB 2L9NA 4L5EA 2XF7A 2XGEA 3GW2A 1UAAA 1YQAA 2VQCA 3WTTC 1SD4A 3LFUA 4UXNA 3PNTA 4HF2A 1YJ9I 4HG2A 2XGCA 5IYCJ 1MMSA 3CC7I 3OYEA 3G1OA 2LREA 3ZN1A 2M9HA 4BBSJ 2GBYA 3MEXA 1JI8A 1FNNA 1FMWA 3NEUA 1O4XA 3OYKA 2DYRH 2ELHA 1RPWA 1UHWA 1KQ0A 1IN6A 3OV8A 4C9YA 1YS6A 3U21A 4KIGA 3ZMZA 5M3FJ 1ZR4A 1IV6A 2EQRA 2E7XA 2EZIA 3SFZA 1VQLI 2CW7A 3PFYA 3QPTA 2VASA 4FX0A 1LVKA 4LD5A 2L3DA 4PSXA 1OISA 3LSHA 4XLHA 4UV8A 5E20A 3LQRA 4ZTFA 4A12A 4CCLA 3O6BB 5EDNA 2KT0A 2MC4A 3SHFA 3IRRA 3I3LA 1WJ5A 3PQJA 3CD6I 3CP2A 4IOCF 4D5FA 2AQFA 2VPRA 1S3JA 3GTQJ 2JTVA 5FLXZ 2A68F 1ORKA 2XF6A 3HG9A 3L09A 3S14J 4I0AA 5B1BH 3REOA 3OIPA 4N4OB 5EZGA 3I56I 1Z21A 1CGPA 2CQNA 5EEGA 3WG7H 5TRDA 1Y1VJ 4ZYHA 2EIJH 4PJ0C 2XAGA 2NS0A 1GXPA 2HEOA 3ZQFA 2IA0A 5DUIA 4P9FA 2M7AA 4M3FA 2MYSA 3CO6C 2CS3A 3DQVC 2FQ3A 1JT6A 3COAC 1O3QA 4A69C 1MMNA 4WK8F 3CMYA 5J8CA 2DDAA 1OYWA 5L3EA 2H1KA 1V5GA 1O57A 1Y0UA 2FNAA 3I53A 1R5HA 3BLYA 2GOMA 3KP3A 2V1NA 4EQQA 1F43A 4FASD 1FOKA 4KYWA 5DTDA 2GXBA 4P96A 5TJJA 2KRHA 3OYHA 3JRCA 1IZ1A 2F5EA 1Z6TA 5FGMA 3OS0A 2V1DA 5CPRB 2IPQX 2P6TA 2X1EA 5EGOB 1BOBA 3G73A 2C6YA 3CJTB 1HDPA 4XORA 4YIFA 1W36C 2LBFB 2EZKA 1HXDA 3GXOA 3H3ZA 4A0ZA 4KFCA 2D45A 2IA2A 1BR4A 5IT3A 1IN5A 2W84A 5KAFC 4BJ5C 5FRMA 3KEOA 4CH7A 2R7QA 5E8IA 2WAEA 4AIHA 4IQJA 2Z5UA 4F7ZA 3NARA 5DS9A 1LE8A 4NC6A 1ETQA 2VBXA 2NOGA 5HS9A 4M3DA 3FWEA 4QPOA 3ZMTA 2E71A 2DN0A 2R7ZJ 2NNYA 1WJEA 4DBQA 1K6OA 2B9SA 3V7SA 2LRDA 4A3JJ 3VOEA 3RQ4A 2L54A 2WC2A 1K79A 1QZZA 4HV6A 1Y0NA 1WHUA 1PJRA 5F0CA 2ME0A 3E5UA 1FYKA 1QPIA 3BTIA 3LAJA 4ZYEA 5DM6F 3NQOA 3EUHA 1L0OC 3CO7C 3CJRB 3ZR8X 3UNGC 4BE0A 1GHCA 2WBMA 1KQ9A 2O3FA 5TGTA 4EJOA 3DKXA 3GO5A 1I3QJ 3CCJI 2Q8KA 4GRIA 3GUDA 3EUKL 2IS6A 1DUXC 2HKXA 2JK3A 2VJJA 5FKKA 1E3HA 1ZHFA 3IH2A 2HI3A 5CVVA 4HX8A 1T95A 2WV1A 5L3FA 2X4HA 1D8KA 1S7EA 3PNYA 4ENKA 4BE2A 3N4MA 4BY1J 4YFXF 2XRNA 4DOZA 1W7PD 1T2KA 4BQQA 2PMUA 5HLHA 4GXOA 1IN8A 1MBKA 1ZELA 4KDPA 4L9NA 2A3SA 4IHVA 4L5JA 1E0EA 1O3TA 4UUVA 2XAUA 4KT5C 3CJNA 4RB3C 1PYVA 3S1MJ 5EF6A 3RYRA 2XB5A 4V19K 2Q2EA 5DCFA 2Y9YA 3BG9A 3GMEA 3KP2A 3LSMA 3WU0A 1XMXA 2DTZA 1DU6A 4L18B 3SZGA 2JMWA 3VYSB 4J01A 3ML6A 4YELA 1TWFJ 3JRAA 1Z91A 4HA8A 2YU9J 1DP3A 3VYTB 4M6YA 4Y33A 3LSKA 1VTNC 2LNBA 3LA3A 4BGDA 2PN6A 2QQAA 2KL4A 1D0ZA 5C4XJ 2WB1N 3E3VA 3CCUI 2W1OA 1F9NA 1QZEA 2UZKA 4A3EJ 2YS9A 4XLNF 1HCRA 2EINH 2VE8A 3PM1A 4RGRA 1IGNA 4MFEA 4A5NA 2QZ8A 5LBQA 2MD5A 1W7PB 3DEEA 2Y30A 4IRIA 4LK0F 2W85A 1R58A 3WTWC 2QBYB 1WJBA 4G6DA 2F6CA 2Y69H 4BACA 4ZTJA 9ANTA 4RLFA 3QWLA 4D1QA 2ZXJA 1BW6A 4I6ZA 3EUHC 4IHWA 2IGKA 2L4MA 2QKMB 5IP9J 5ILVA 1UZCA 2IJLA 2NYXA 3F3XA 4HOBA 2K9MA 2FNPA 2XAHA 4E6KG 4CCOA 1BIBA 2XPVA 5J1YA 3E0JB 4LB6B 4OIQF 2ESNA 1YYVA 5HLIA 4JBAA 1ZN2A 5F08A 1J75A 3J80K 1IUYA 5BPDA 3H0DA 1T8IA 3E6DA 1VQ8I 4XRSA 2IRFG 2VXDA 2OUMA 4ENNA 2BW3B 3GYHX 4L9JA 1SMYF 1LJ9A 3KPHA 1XGMA 2XAQA 3LSIA 1W36D 5B66C 1BC7C 1YJWI 4BEHA 2XRLA 3Q9SA 2MSYA 4XQFA 2KISA 4FT8A 1XPXA 1IRZA 2DK5A 1PUFB 4XRMA 2LC2A 1P4XA 2KQRA 3OR1C 1Z9CA 3C2GA 2H8WA 1UB9A 3EQLF 3U1DA 1I6HJ 2H27A 3AG1H 1MKMA 3I64A 3K2ZA 3ZMVA 5EEAA 1JTXA 3V4GA 4XLAA 1VQ5I 3KLNA 4ZH4F 1B72B 1ON1A 2L9SA 1Y6IA 4ENJA 2UV1A 4ZDLA 4I76A 2ESHA 4ZYGA 2E1NA 4AUXA 4NHJA 1ZGJA 1MH3A 2WA0A 3BQYA 3FKJA 5CVUA 1EH8A 4IJAA 2RNJA 1XMKA 2H1LA 2FE3A 3C7JA 1D0XA 1HOMA 5GTIC 1X19A 1VQ9I 2ISYA 2ZO4A 3GEZA 3L2RA 2DT5A 4MEYF 2P7CB 1DPRA 3MMYB 1YW7A 2CV2A 4IOAF 5M5WJ 3TDUC 1XMAA 1OQYA 1ERDA 1IV8A 1X1BA 3DEWA 3HTUA 4DZPA 4YG2F 1AU7A 1MBEA 4DQ2A 3L2VA 3HC7A 4HF0A 1T08B 1WKMA 2JUCA 4ABZA 4FETA 3ASOH 4IHTA 1W0TA 3HTSB 1NTCA 5KHDA 1K4TA 2MC3A 1W5SA 3MN2A 1RR7A 3ECOA 2XF5A 3R60A 2QSFX 5ICGA 1UCRA 5F1RA 1VQ4I 2CV1A 3CDHA 4BXXJ 1YRNB 4PFOA 1ZH5A 2NVTJ 5GTHC 3RSNA 2QKLB 4KIBA 1VQ7I 3F8MA 2LY1A 4BJ6C 3PJRA 2YX7A 4L5IA 3KP5A 2CMPA 3G71I 2EFWA 4S05A 2VC0A 2P0WA 3FZVA 3OYBA 2GLOA 4LJZF 2EZHA 5A2QK 1XDUA 3P7NA 3MAJA 1R5ID 4XONA 1XSXA 4I99C 3PO3J 4E7JA 3M3YJ 1ACIA 2E36A 4F55A 2JJ7A 3A03A 4B3XA 3G6EI 3J80Z 3CLQA 3QP5A 4M3BA 3HEFA 4I98B 2TCTA 2W25A 3SZPA 1S5LC 2PX9A 2Z3YA 3LSRA 1IDZA 2M5WA 3LSPA 2V6EA 2EV5A 2J5OA 2O8KA 4J19A 1P6RA 2RAEA 6PAXA 3HGYA 3HPHA 3LQQA 2HXOA 4N9IA 1IRXA 4XL9A 5L3BA 2BZTA 2XVCA 1IXRC 3LOCA 5KVRA 5AIPA 3TOBA 3DTKA 3F6OA 2DJIA 1FLIA 3RYPA 2CFOA 3F23A 1OMIA 4RGUA 3C18A 2A5YB 2HDWA 3TP3A 1ZARA 4A0XA 3K4MA 3AG3H 3S93A 1GLNA 3HOVJ 5LGTA 2BY1A 2V7FA 2DQLA 3K1MA 3KZYA 5FO5A 1G6NA 3BPVA 4XRFA 4LGWA 4E7ZA 2E1CA 2X6WA 1MNMC 1G3SA 4U7BA 4AU7A 4EMSA 3CF5F 3MKWB 1GT0C 1IJWC 1VQ6I 1R49A 5CVJA 3MZYA 5D5XB 2OJED 5H6QA 1ZGAA 3K4JA 4UVAA 4RAGA 2EZLA 2QSGX 1AKHB 3TQNA 1FT9A 2UWMA 3I9V2 4IO9F 2EFQA 4M72A 5HNHA 2Z1DA 2UUZA 1D8JA 3WGHA 1MDMB 1YG2A 3BR5A 3QYEA 1CF7A 2QUFA 3K70C 4HX7A 4NDLA 2QGUA 3QYBA 1FSHA 2WV0A 3JSPA 2R7RA 4G9YA 4Y4RA 4DYRA 3QU6A 5HLTA 2DPDA 4UUSA 1Z7LA 4CSWA 2QQ9A 4HDVA 4HLXA 2CUEA 2GIVA 2HOSA 1IXCA 2ZJPF 2Y31A 4AIKA 2JWTA 1WI9A 4OOIA 1HLVA 2JT1A 2KRCA 1YS7A 2CQ7A 5DDGA 3OYGA 3M9AA 1SFUA 1BI0A 1FBUA 2LTPA 1XCBA 2BE5F 5JLXA 1GV2A 1MW7A 1QHGA 2D2WA 3ABTA 3M1CA 4YRVA 3R6SA 5LHIA 3H36A 1U5TB 3B6CA 1OCPA 2XAJA 3ISPA 1EF4A 1YW9A 3WU1B 2L4AA 1FC3A 2AQEA 2OQRA 3BG6A 4JQFA 1JKPC 1W5TA 1OPCA 3S32A 3VYUB 2EFNA 2QEXI 2XIGA 2OPTA 5GAGJ 2VKDA 3AFHA 4ANJA 4CYDA 3C2HA 5A2QZ 2PJRB 2VT2A 3AL0B 1QQIA 2XKPA 3H3VK 4Y7NJ 3LWFA 2HDDA 2WY7Q 1JJ8C 2V9VA 4ZZDA 3CUQB 1X1AA 4I7HA 3BOQA 1XGOA 4FCYA 1EKEA 3K2AA 3ABUA 1Z67A 3ZN0A 1WWXA 4BQNA 3DU5A 1QVTA 1BI3A 3R4KA 4B8XA 1HW5A 4DW6A 1K78A 3B6AA 3RKYA 3QQAA 4DBRA 2VBYA 3HB9A 1OCTC 1VF9A 4CDGA 3MCZA 1NK2P 3LMMA 2AO9A 2NVXJ 2M3AA 3S15J 2EH3A 1HKSA 1R22A 4FE4A 4PJMA 3DPUA 1U6GA 2O61A 1S7AA 1W1WE 1I5ZA 4MTDA 3RKQA 4A3IJ 1JKOC 2OTJI 3RPQA 5JI6A 3J7AO 4HDUA 4XICA 2W82A 1PP8F 3FK7A 3GBGA 2ZKZA 3RKWA 5LD2C 5F0HA 5HOOA 1ZRDA 2DPUA 2QVOA 1I39A 5HODA 1T0FA 1LQ1A 4UUTA 1FZPB 3C3WA 1U0JA 1K61A 3RDIA 2FU4A 3P5JA 4QIWN 2PFBA 4UB6C 5DV5A 5GP9A 1RNLA 2A05A 3CCMI 4KUMA 5KK1A 4O6JA 2M30A 1B6AA 1YITI 2IT0A 1WQ2A 1BI1A 1R6RA 1Y56A 3FXRA 1WCMJ 4RGXA 2PMHA 1H89C 2DA6A 4ZYAA 1N78A 3ZQGA 4ESFA 1Z6RA 1BW5A 3H5AA 4RAZA 1RETA 2K4BA 3VPRA 2WTEA 2MABA 3SDGA 5KNLA 1A6QA 3Q0UA 3A0BC 5EZHA 5D5VB 1KZHA 3V8JA 2VJ4A 5K7ZA 2IW5A 4D9JA 2WAQA 1S8NA 1LDJA 2CQXA 2VUMJ 1JHFA 3M8FA 4NUBA 1U3EM 3TDZC 1TWHJ 1JXSA 3F72A 4XLFA 1B8IA 2R7WA 3G4SI 1YE9A 1Z3XA 2DLLA 2Q0OA 4B1RA 5BQTA 1MZBA 4AWXB 1B59A 4BNCA 2BHZA 3CCEI 1WFXA 2CUJA 3K0LA 1PUEE 5J4VA 4IZZA 2F5CA 4G8XA 3ABMH 3FBNB 1T98A 4B47A 3HGGA 2F4IA 3CMMA 3MZ8A 1TT5B 4M6XA 3HSFA 1DGRM 2TDXA 3R61A 4XLCA 1G3WA 1JKQC 1T39A 3JREA 3GX4X 1JE8A 3HOZJ 2V6CA 3FF5A 3HHHA 4DIQA 4ZDOA 3GCMA 4C2UA 3BR6A 4A93J 1WZ2A 2EFPA 5E1WA 2P7VB 2HOAA 4CICA 3K70D 4BEHB 4LLGF 2QCOA 4XKCA 1E17A 3FM5A 1Z1DA 3KYCB 2OCEA 2JZYA 1AHDP 3CDLA 4DGWB 1O7FA 2CSOA 2H09A 3KP4A 2WY8Q 3Q0VA 4GDFA 5GPAA 2IGOA 5J47A 3HOXJ 3GFIA 3CCSI 2ELJA 2DFFA 2V1UA 2MLGA 3TO6A 2PMZA 3OMYA 4KN4X 3V7CA 1L3LA 2X9DA 1KU2A 1ETOA 2X6XA 3CP8A 2KDZA 2LD5A 4YEJA 1AWCA 1T0FC 3S2WA 3IP4B 3V42A 1G4DA 4RB0A 3M4OJ 3OOUA 3HUGA 3P9CA 3HOWJ 4XBFA 2DA7A 1G8XA 2OZ6A 1SVLA 1IC8A 3PUFA 3H9GA 4ITVA 4EJVA 3HM5A 4PJNA 4Y15A 2VQLA 3KIOA 4FQGA 3BTJA 2K9LA 3HPGA 3TP0A 5E3OA 2G7HA 1MMAA 4BU2A 1KU7A 3HYIA 1HDDC 2HR3A 1IG7A 2FJ1A 5E3NA 1U78A 1H9GA 5BOXA 1U8BA 3G2BA 4EM0B 1V5EA 1HKQA 4G7OF 2V1XA 5IOZA 4X0GA 2VC1A 4BKXA 1BJZA 5K5RA 1ZRFA 5J3LA 1S9HA 3GFJA 4K2EA 3OYMA 3I59A 3GFLA 4W1UA 2ICWG 3KP7A 4CZZA 4KT6A 1LKXA 1HBXG 1UHSA 2E35A 4Y52J 2X48A 3E5QA 1P4WA 4U7DA 4EV0A 3H35A 1TZLA 3BTCA 3ZGKA 5EJCA 1XSDA 3RZDJ 5FKMA 2WADA 1T38A 2GA2A 5TISC 4HSTA 2EBIA 3ZQQA 4CO8A 5JVTA 3JRFA 3BQZA 1FIAA 5LHGA 2STWA 3WGIA 4OIPF 4X6AJ 1QZYA 2DA3A 1ETVA 3BR1A 4XLPF 3H5NA 3TL4X 4F93B 3ECHA 4HRIA 4ENMA 4HYEA 1ZLJA 2WAFA 3PFIA 1Q1HA 2DCEA 3DFGA 1JUSA 2FBHA 1SFXA 2VOOA 1TQPA 4D7MA 2Y75A 4A5MA 1JGGA 3HDDA 5F04A 4ON0A 5L3CA 2M8EA 3TMOA 4TV7A 1WSUA 4MQ9F 1Z3YA 4KIFA 3OYLA 2OCCH 4NQWA 2L7FP 3IUOA 4QSHA 3KYDB 5J40A 2J5PA 4BUPA 2VQGA 1YW8A 1LEBA 1TBXA 4CCNA 2K9QA 2RNGA 1MH4A 1UG0A 3OYFA 1TLHB 5D6EA 2WAQN 1TW3A 2IAIA 3BR2A 3IWZA 2QSHX 1F1ZA 5IYDJ 3B73A 4M74A 5FFZA 3EETA 4Q4ZF 4HQEA 3QP6A 1YFHA 2ELKA 4HX4A 5JLWA 3FXMA 1KU3A 1DPUA 1OR7A 4PJJA 2P8TA 3VYRB 2HXIA 4BY7J 5BS6A 2HDCA 2FOWA 4I0BA 1RUNA 3CESA 4XOTA 1Y1WJ 3SDBA 4RDUA 2E5NA 4EM2A 2JA8J 1LDDA 3ZXSA 2ZCWA 2DFHA 3VSLA 2HQAA 2LFBA 2VL8A 3QPLA 4II2A 4HQMA 3BTLA 4GGGA 1RZ4A 2VODA 2XASA 1BI2A 4GYGA 1FWZA 2EFOA 4Q5SF 5LEKA 2K02A 1IF1A 2HOEA 2COBA 1ZLKA 4UUSB 1J59A 2HYGD 4RLQA 3S2HJ 3M07A 4BE1A 4OAYA 3HRTA 3OSGA 1QBJA 2K86A 1OJLA 2P5KA 2RGVA 5IP6A 4ZC3A 2BVMA 2XPWA 4MNUA 3I0TA 4LOCA 2PMZN 1AA7A 4PDKA 3ZQCA 2A5WA 2D1HA 4BDYA 3C1DA 5BPIA 1H88C 3M8EA 3ZQ7A 1BC8C 2LYCA 3MKZA 3CCQI 4J00A 2R7TA 3SFIA 3OIQA 3JR9A 1U9NA 3F8NA 3JAMK 2KP6A 2L01A 5CJ9A 2LH9A 4CGZA 5GAHJ 2DAOA 3HOYJ 2PEXA 1YJNI 2BXZA 3SJMA 1WH5A 1K83J 2DA5A 1IW7F 3IWFA 1MNEA 5HS7A 4HZFA 1AOYA 1QNTA 3HBLA 3V8LA 5HDKA 1OFCX 1FX7A 4OIOF 2FQ4A 2ECCA 5CVIA 4L9VA 2DMTA 2XPUA 1J0RA 3K10A 5K1YA 1LUJB 1JGSA 5DD8A 2G9WA 3N97A 1RRJA 1FY7A 2LF7A 1J9IA 1O3SA 2KPMA 2KZVA 2FEZA 1STZA 3E6MA 4WF2A 4E4HA 4EATA 3WGGA 4RM2A 5E3LA 2K40A 2Y0SA 1W4MA 2W57A 4C3IJ 2E34A 3V7RA 2GM4A 1BR2A 2NXNB 2HNHA 3FMSA 1TWAJ 1IAWA 3H9QA 2K27A 4G12A 4HV5A 2R5YB 4A3MJ 3T0YA 5IOYA 3DF8A 3SXYA 1U9OA 5KCMA 3CCLI 1E3OC 3HOUJ 4MGRA 1VNDA 2P6SA 1LVAA 2ZMEA 2X1CA 3K1NA 3HOSA 2I5UA 3J7AY 2LY2A 1HKTA 2GQQA 1TC3C 4NB5A 3W6VA 2HFHA 2HPIA 1FIPA 1WJCA 5ICEA 2E2IJ 1P7JA 1B1BA 4U0WA 1WI3A 3FBIB 1ZYRF 4P9UA 4ZZLA 5L3GA 3EYIA 4M9XA 2QA4I 3O2PE 1YTYA 3FKIJ 2R5ZA 2LKPA 3LNQA 4LG3A 5JVGF 4D5CA 2XB0X 4C2TA 5F6FA 3FXKA 2CH0A 3WG9A 2HU9A
chains in the Genus database with same CATH topology
1QGPA 5L3DA 3L9FA 1RIOH 3QPHA 3HSRA 5D6FA 1HW1A 1K7AA 1KU9A 1R5GA 1R7JA 4OMYA 4LG0B 3F21A 5DEQA 4UVCA 3HSEA 2H6BA 1FP2A 2H94A 3TKYA 3T8RA 5E18F 4AVPA 5HDNA 3M7GA 3JAMZ 1JHHA 1S6LA 3U9GA 2ETHA 2KKOA 1J5YA 1ZG5A 4MEXF 1XGSA 2K7LA 2BEOA 1XSVA 1NHAA 2HQRA 2MA3A 2VE9A 2ZNYA 2P5VA 1B9MA 4U0YA 2XGXA 3FMRA 5LGNA 3R0JA 1PDNC 1I6XA 4Z2YA 2DFIA 2YU3A 2OU2A 1GVJA 2CW0F 1A04A 2FMYA 1IN7A 2XHKA 2OAZA 2YR2A 3WTUC 2ZBKA 2R7FA 2CO5A 2ADUA 5D8LB 4IRHA 3Q9VA 5HLGA 1H0MA 1BIAA 4EJWA 1DDNA 2A6EF 2GZWA 3T8TA 3WTYC 2ZJ2A 3L2CA 2RKHA 4U0VA 1XGNA 5K5QA 3I4PA 3TGNA 2GXGA 1ZG3A 2HWVA 4FX4A 4A6EA 2OBPA 5J8FA 2O03A 1ULYA 1IRFA 1Z7UA 3JTGA 1YO5C 4A2UA 2Y48A 4KMFA 4GO1A 1USSA 5FD6A 4EJUA 4KICA 3PQKA 3L7WA 2GAUA 2JPBA 1YLFA 1E2XA 2F5FA 4EGZA 2VT3A 2EA2A 2A07F 3ZMSA 1I1GA 2XUBA 3JSOA 5J6XA 1HSTA 1IXSB 2W24A 4WCGA 2VXZA 4MTEA 3ERED 1C0WA 1U2WA 3EYYA 3ZMDA 3JW4A 3R0AA 1G3YA 2OZUA 2WWYA 2HS5A 2PQ8A 2EWNA 1ZRCA 3ZPLA 4G94A 3BJ6A 5LLQA 1KA8A 1TNSA 2NNNA 3FMQA 3KZZA 4Y13A 2QBYA 3F22A 2XKOA 4A0YA 1J2XA 2DI3A 5LEJA 2KJBA 4EVIA 3RJPA 4BHBA 1X3UA 4OMZA 3BJOA 3VFZA 1F5TA 2FBIA 2HZTA 3CLOA 4RAYA 1FYMA 4OU0A 4BH9A 3D0SA 4M73A 4HAMA 2OD5A 3DPTA 2LSOA 1RUOA 2COMA 3DEUA 2OQGA 1UHMA 3LAPA 5JHUA 3HOTA 4WXDA 5BMZA 2M45A 4WX9A 1XB4A 4RS8A 2DW4A 1BN5A 3D5LA 4GCVA 2KIUA 2UXXA 2L02A 1XCVA 2PG4A 3P9KA 2CYYA 3VODA 1KYWA 1R1TA 1LB2A 5F64A 5HS8A 1EH7A 5D8KB 2FOKA 4KN7X 5ICFA 2AXLA 3DPLC 3L00A 2RVCA 5EEHA 4LLNA 1R1VA 1U8RA 3WE3A 2RC4A 5ILSA 2DBBA 4R1HA 4KNYA 4N9HA 1G3TA 2CWEA 2AS5F 3QU3A 3BWGA 4R79A 1ZAOA 3IKTA 3ZP5A 1XD7A 2F2EA 2BV6A 4PGGA 1HW2A 2EK5A 3W6JB 3HRSA 2M87A 3F8CA 2R7DA 1IN4A 2HQNA 4RB1A 1RI7A 4FHTA 3J81K 4RB2C 2CQKA 4IVNA 1BOAA 4BHCA 3FXQA 4MHGA 2QQBA 4RGSA 1FPQA 3F8BA 1I1SA 1FBSA 4Q48A 1OYIA 2EA4A 3IC7A 4O5VA 1B4AA 2FRHA 1LEAA 5FB2A 4LMYA 1J7KA 4G7ZF 1TQMA 4E70A 2NAZA 3DKWA 3KCCA 4EGYA 3QRFF 2YPRA 2GWRA 4B09A 3U2RA 2Z33A 2MH9A 2PLYA 3TOAA 2XROA 2HKOA 2XV4S 3MZHA 4GYIA 1FP1D 1SFEA 3DXJF 4QLCU 4UV9A 2KIMA 3RIRA 1MDMA 1YIOA 2MBFA 2IVMA 2PJPA 3RPUA 2CFXA 2BGCA 3JTHA 4KA4A 3MFKA 3ULQB 3FXUA 2F5DA 3IKVA 4AD9A 1BM9A 3ZMUA 4HBLA 1EV7A 3I5UA 1SMTA 3RI4A 1U5TA 3I71A 4OINF 5IT9K 3MWMA 1OYYA 2DK8A 2FXAA 2FSWA 2GA1A 4BYYA 1HQCA 4BQAA 5DCMA 4OIRF 4IHSA 3TO7A 3O3KA 3J81Z 5FFXA 3CUQA 1KYZA 2E7WA 3K9TA 5K5OA 1CF7B 3GLXA 1R36A 5AONA 1O3RA 2YSRA 3CUOA 3BDDA 2ISZA 3E6CC 5ILUA 2BBYA 1KGSA 2NRAC 4N0BA 5AIQA 2M1BA 4U88A 3HIFA 2CG4A 5E1ZB 2CGPA 4L0ZB 2A61A 4LFUA 2EV6A 1MGTA 1Z05A 1MD0A 4I01A 3MQ0A 4PGHA 1P4AA 3WTVC 2Z9OA 1H9TA 3T5XA 1K78B 3K69A 1DP7P 1KQ8A 1SD5A 4IF4A 3BPXA 3IHUA 5DYMA 2G7UA 2OA4A 2Y0MA 2MLKA 4XSXF 4HF1A 2EB7A 4G7HF 3WTXC 2P4WA 3WTZA 1V4RA 1HSJA 1U5TC 2ZNZA 2VN2A 3T1BA 5JFRA 2LF8A 4IPAA 2VBZA 2DU9A 5ED4A 5D5WB 1T6SA 3EDPA 5IT9Z 3BROA 3Q5FA 3CUQC 2VBWA 3KLOA 3E97A 3HHGA 1LNWA 2ZFWA 4CHUA 2QLZA 4YFKF 1TNTA 5D5UB 2EJRA 2H6CA 5D4SA 2P5LC 4QWQA 4UVBA 2KJCA 3NRVA 4H0EA 3F8FA 4G6QA 2QM3A 5LRRA 2ACJA 4ETSA 4M9SA 3FHZA 3GZ5A 5ERIA 2YX4A 1MJAA 1TW2A 4HW0A 3VB2A 4ZYDA 5LHHA 4M71A 2Z99A 4YIIA 4DNCA 2O8XA 4ESBA 4I2OA 5LGUA 2JRTA 2LDUA 1IRGA 1SD7A 3F6VA 3BZ6A 5CVRA 3QAHA 1UFMA 2KIFA 3E6BA 4P55A 1QO0D 3LSTA 2DQRA 1BJAA 4Q47A 4BXUA 1P92A 2O6GE 2PBIA 2X0LA 3I54A 1F4KA 1PP7U 2QWWA 5E8GA 5E1XA 4BHPA 1OKRA 3ROUA 1XN7A 5DD4A 1ON2A 4R8HA 4S04A 2PI0A 5HVQC 4M9ZA 3HRUA 3H3UA 3KETA 3GVAA 2MH2A 3ELKA 4MQVA 3FX3A 4LK1F 2RDPA 2JSCA 3SZTA 4LLLA 3HRMA 2JPCA 4JK1X 1B9NA 1REPC 3GFMA 2FA5A 3GF2A 2KRFA 2V79A 4UHTA 2HTSA 3DV8A 3W6KB 2FBKA 2EV0A 3M1EA 3I59B 3H92A 5CYVA 2A6HF 2O0YA 1GXQA 4IXAA 1MJ9A 4D0PA 3BY6A 4L9TA 2QYOA 2XAFA 3CTAA 2VONA 1LDKB 1S7OA 2HTJA 5HDGA 4WWCA 2STTA 3AAFA 3DP7A 3QOPA 3RKXA 1ODDA 3G3ZA 3WE2A 2HGCA 2UXNA 3WODF 2K4JA 3VEPA 1FBQA 4O3MA 4WXHA 3K1PA 1P2FA 3V8KA 2HYFA 1QPMA 1USTA 2QENA 4BAYA 4ESJA 1TTYA 1ZG1A 3I58A 4HLYA 2A69F 3IRQA 5JR3A 4EJTA 2D1VA 4Y17A 4I09A 1D3YA 2FF4A 3BP8A 4P5OA 1FSEA 3SQNA 3LFKA 3FM3A 5ICCA 3P9IA 1XDSA 4PCQA 5DCMB 1R00A 4ASNA 1SD6A 3GZ6A 1W7PA 1O7LA 2BYVE 2B0LA 2IP2A 5H6RA 3KP6A 5FD5A 5E17F 3KEQA 3IL2A 3BJAA 3KFWX 4PZJA 1I27A 4EM1A 1SAXA 4WXCA 1R1UA 3E5XA 4A6DA 3KE2A 5FLXK 4IRGA 3RTRA 4YFNF 5CLSA 3B02A 1EH6A 1MJBA 1TQIA 1BBYA 3LA2A 2DTRA 5H20A 4I02A 3LA7A 4UNOA 3OOPA 3GWZA 4CXFA 2FMLA 2VOPA 4L0YB 1D5VA 3WTSC 5DUKA 1WRJA 2RQPA 1S29A 2RV8A 1FYLA 1R23A 2RN7A 1V3FA 4LG0A 2IA1A 1ONVA 4AIJA 4LB5A 2DO7A 5LRSA 2R3SA 4XSZF 5D4RA 4KMUX 3TO9A 2ZMEB 3GW2A 1YQAA 3WTTC 1SD4A 4UXNA 4HF2A 3ZN1A 3MEXA 1FNNA 3NEUA 2ELHA 1UHWA 3OV8A 1KQ0A 1IN6A 1YS6A 4KIGA 3ZMZA 2E7XA 3SFZA 3QPTA 4FX0A 4LD5A 2L3DA 4UV8A 5E20A 3LQRA 4A12A 3O6BB 3SHFA 3IRRA 3PQJA 1S3JA 2JTVA 5FLXZ 2A68F 3L09A 4I0AA 3REOA 1ZREA 1CGPA 5EEGA 5TRDA 4ZYHA 2XAGA 2NS0A 1GXPA 2HEOA 5DUIA 2IA0A 4P9FA 3CO6C 3DQVC 2FQ3A 3COAC 1O3QA 4WK8F 5J8CA 1OYWA 5L3EA 1O57A 1Y0UA 2FNAA 3I53A 1R5HA 3KP3A 4EQQA 4KYWA 1FOKA 2GXBA 4P96A 5TJJA 1IZ1A 2F5EA 1Z6TA 5FGMA 2V1DA 2IPQX 2P6TA 3G73A 2C6YA 4YIFA 3H3ZA 1HXDA 3GXOA 4KFCA 4A0ZA 2D45A 2IA2A 5IT3A 1IN5A 2W84A 3KEOA 5E8IA 4AIHA 2Z5UA 4F7ZA 2VBXA 5HS9A 3FWEA 3ZMTA 2NNYA 1K6OA 3V7SA 3VOEA 2L54A 2WC2A 1K79A 1QZZA 4HV6A 3E5UA 1FYKA 3LAJA 4ZYEA 3NQOA 3EUHA 1L0OC 3CO7C 1GHCA 1KQ9A 2O3FA 4EJOA 3GO5A 2Q8KA 3GUDA 1DUXC 2HKXA 1ZHFA 5CVVA 4HX8A 5L3FA 2X4HA 1D8KA 4ENKA 3N4MA 4YFXF 2XRNA 1W7PD 1T2KA 2PMUA 5HLHA 4GXOA 1IN8A 4KDPA 4L9NA 2A3SA 4L5JA 1O3TA 4UUVA 4KT5C 3CJNA 4RB3C 3RYRA 2Q2EA 5DCFA 3KP2A 3WU0A 4L18B 3ML6A 1Z91A 4HA8A 4M6YA 1VTNC 2LNBA 3LA3A 2PN6A 2QQAA 3E3VA 2UZKA 1F9NA 4XLNF 2VE8A 4RGRA 4A5NA 2QZ8A 5LBQA 2MD5A 1W7PB 4IRIA 4LK0F 2W85A 1R58A 3WTWC 2QBYB 4G6DA 2ZXJA 2L4MA 5ILVA 2IJLA 2NYXA 3F3XA 4HOBA 2FNPA 2XAHA 1BIBA 4LB6B 4OIQF 2ESNA 1YYVA 5HLIA 4JBAA 1ZN2A 1J75A 3J80K 1IUYA 5BPDA 3E6DA 2IRFG 4ENNA 3GYHX 4L9JA 1SMYF 1LJ9A 1XGMA 2XAQA 1BC7C 3Q9SA 4FT8A 2DK5A 1P4XA 1Z9CA 1UB9A 3EQLF 3U1DA 2H27A 1MKMA 3I64A 3K2ZA 3ZMVA 3V4GA 3KLNA 4ZH4F 1ON1A 4ENJA 2ESHA 4ZYGA 2E1NA 4NHJA 1ZGJA 5CVUA 1EH8A 4IJAA 2RNJA 1XMKA 2FE3A 3C7JA 2ISYA 2ZO4A 3GEZA 2DT5A 4MEYF 2P7CB 1DPRA 1YW7A 3TDUC 1XMAA 4YG2F 3HTUA 4DQ2A 4HF0A 1WKMA 4IHTA 3HTSB 2MC3A 1W5SA 3ECOA 3R60A 5ICGA 1UCRA 5F1RA 3CDHA 1ZH5A 4KIBA 3F8MA 2YX7A 4L5IA 3KP5A 2EFWA 4S05A 2VC0A 3FZVA 4LJZF 5A2QK 1XDUA 3P7NA 3MAJA 1XSXA 3J80Z 3QP5A 4I98B 2W25A 3SZPA 2Z3YA 2M5WA 2EV5A 2J5OA 1P6RA 6PAXA 3LQQA 4N9IA 5L3BA 2XVCA 1IXRC 5KVRA 5AIPA 3TOBA 3F6OA 1FLIA 3RYPA 3F23A 1OMIA 4RGUA 3C18A 2A5YB 1ZARA 4A0XA 5LGTA 2DQLA 3K1MA 3KZYA 5FO5A 1G6NA 3BPVA 4XRFA 4LGWA 2E1CA 1G3SA 4U7BA 4EMSA 5CVJA 3MZYA 5D5XB 5H6QA 1ZGAA 4UVAA 3TQNA 1FT9A 2UWMA 2EFQA 4M72A 1D8JA 3WGHA 1MDMB 1YG2A 1CF7A 2QUFA 4HX7A 1FSHA 2WV0A 3JSPA 4G9YA 3QU6A 2DPDA 4HDVA 2QQ9A 4HLXA 2GIVA 1IXCA 4AIKA 1WI9A 4OOIA 2JT1A 1YS7A 5DDGA 1SFUA 3M9AA 1BI0A 1FBUA 1XCBA 2BE5F 3ABTA 2D2WA 3R6SA 5LHIA 1U5TB 2XAJA 3ISPA 1YW9A 3WU1B 2L4AA 1FC3A 4JQFA 2OQRA 1W5TA 1OPCA 2EFNA 2XIGA 4CYDA 5A2QZ 2VT2A 1QQIA 2XKPA 3LWFA 2V9VA 4ZZDA 3CUQB 4I7HA 3BOQA 1XGOA 3ABUA 3ZN0A 1WWXA 1BI3A 3R4KA 4B8XA 1HW5A 1K78A 3RKYA 2VBYA 4CDGA 3MCZA 1HKSA 1R22A 2O61A 1U6GA 1S7AA 1I5ZA 4MTDA 3RPQA 5JI6A 3J7AO 4HDUA 1PP8F 2ZKZA 3RKWA 5HOOA 1ZRDA 2DPUA 2QVOA 1T0FA 1LQ1A 1FZPB 3C3WA 3RDIA 2FU4A 2PFBA 5DV5A 1RNLA 4KUMA 5KK1A 4O6JA 2M30A 1B6AA 2IT0A 1WQ2A 1BI1A 3FXRA 4RGXA 2PMHA 4ESFA 1Z6RA 4RAZA 2K4BA 2WTEA 5D5VB 3V8JA 2IW5A 1S8NA 1LDJA 1JHFA 3M8FA 1JXSA 1U3EM 3TDZC 3F72A 2Q0OA 5BQTA 2DLLA 1MZBA 4AWXB 1B59A 4BNCA 3K0LA 1PUEE 2F5CA 4G8XA 1T98A 4M6XA 3HSFA 2TDXA 3R61A 1G3WA 1T39A 3GX4X 1JE8A 2V6CA 3FF5A 3HHHA 2EFPA 5E1WA 2P7VB 4CICA 4LLGF 1E17A 3FM5A 1Z1DA 2JZYA 1O7FA 2CSOA 2H09A 3KP4A 3GFIA 2V1UA 2MLGA 3TO6A 3V7CA 1L3LA 4KN4X 1KU2A 1AWCA 3S2WA 1G4DA 4RB0A 3HUGA 3P9CA 4XBFA 2OZ6A 4EJVA 4Y15A 2G7HA 1KU7A 3HYIA 2HR3A 1U78A 1H9GA 5BOXA 4EM0B 4G7OF 1HKQA 2V1XA 2VC1A 5K5RA 1ZRFA 3GFJA 4K2EA 3I59A 3GFLA 3KP7A 4CZZA 1HBXG 3E5QA 1P4WA 4U7DA 4EV0A 1XSDA 1T38A 2GA2A 5JVTA 4CO8A 5LHGA 2STWA 3WGIA 4OIPF 1QZYA 4XLPF 3ECHA 4ENMA 4HYEA 1ZLJA 3PFIA 1Q1HA 3DFGA 2FBHA 1SFXA 2VOOA 1TQPA 2Y75A 4A5MA 4ON0A 5L3CA 2M8EA 4TV7A 1WSUA 4MQ9F 4KIFA 4NQWA 2J5PA 1YW8A 1LEBA 1TBXA 1TLHB 5D6EA 1TW3A 3IWZA 1F1ZA 3B73A 4M74A 5FFZA 3EETA 4Q4ZF 4HQEA 3QP6A 1YFHA 4HX4A 1KU3A 1DPUA 1OR7A 5BS6A 2P8TA 2HDCA 4I0BA 1RUNA 4EM2A 1LDDA 2ZCWA 4HQMA 4GGGA 1RZ4A 2VODA 2XASA 1BI2A 4GYGA 1FWZA 2EFOA 4Q5SF 5LEKA 2K02A 1IF1A 2HOEA 1ZLKA 1J59A 2HYGD 3HRTA 1QBJA 2K86A 2P5KA 2RGVA 4MNUA 3I0TA 4PDKA 2D1HA 3C1DA 5BPIA 3M8EA 3ZQ7A 1BC8C 3F8NA 3JAMK 2L01A 5CJ9A 4CGZA 2DAOA 2PEXA 3IWFA 1IW7F 5HS7A 4HZFA 1AOYA 1QNTA 3V8LA 5HDKA 1FX7A 4OIOF 5CVIA 4L9VA 5K1YA 1J0RA 1JGSA 5DD8A 2G9WA 3N97A 1FY7A 2LF7A 1J9IA 1O3SA 4WF2A 2FEZA 1STZA 3E6MA 3WGGA 1W4MA 2W57A 3V7RA 3FMSA 1IAWA 2K27A 4HV5A 3T0YA 3DF8A 3SXYA 4MGRA 2P6SA 1LVAA 2ZMEA 3K1NA 3HOSA 1HKTA 2GQQA 4NB5A 2HFHA 5ICEA 1B1BA 4U0WA 1ZYRF 4P9UA 4ZZLA 5L3GA 3EYIA 4M9XA 3O2PE 1YTYA 2LKPA 5F6FA 3WG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGP A;  5L3D A;  3L9F A;  1RIO H;  3QPH A;  3HSR A;  5D6F A;  1HW1 A;  1K7A A;  1KU9 A;  1R5G A;  1R7J A;  4OMY A;  4LG0 B;  3F21 A;  5DEQ A;  4UVC A;  3HSE A;  2H6B A;  1FP2 A;  2H94 A;  3TKY A;  3T8R A;  5E18 F;  4AVP A;  5HDN A;  3M7G A;  3JAM Z;  1JHH A;  1S6L A;  3U9G A;  2ETH A;  2KKO A;  1J5Y A;  1ZG5 A;  4MEX F;  1XGS A;  2K7L A;  2BEO A;  1XSV A;  1NHA A;  2HQR A;  2MA3 A;  2VE9 A;  2ZNY A;  2P5V A;  1B9M A;  4U0Y A;  2XGX A;  3FMR A;  5LGN A;  3R0J A;  1PDN C;  1I6X A;  4Z2Y A;  2DFI A;  2YU3 A;  2OU2 A;  1GVJ A;  2CW0 F;  1A04 A;  2FMY A;  1IN7 A;  2XHK A;  2OAZ A;  2YR2 A;  3WTU C;  2ZBK A;  2R7F A;  2CO5 A;  2ADU A;  5D8L B;  4IRH A;  3Q9V A;  5HLG A;  1H0M A;  1BIA A;  4EJW A;  1DDN A;  2A6E F;  2GZW A;  3T8T A;  3WTY C;  2ZJ2 A;  3L2C A;  2RKH A;  4U0V A;  1XGN A;  5K5Q A;  3I4P A;  3TGN A;  2GXG A;  1ZG3 A;  2HWV A;  4FX4 A;  4A6E A;  2OBP A;  5J8F A;  2O03 A;  1ULY A;  1IRF A;  1Z7U A;  3JTG A;  1YO5 C;  4A2U A;  2Y48 A;  4KMF A;  4GO1 A;  1USS A;  5FD6 A;  4EJU A;  4KIC A;  3PQK A;  3L7W A;  2GAU A;  2JPB A;  1YLF A;  1E2X A;  2F5F A;  4EGZ A;  2VT3 A;  2EA2 A;  2A07 F;  3ZMS A;  1I1G A;  2XUB A;  3JSO A;  5J6X A;  1HST A;  1IXS B;  2W24 A;  4WCG A;  2VXZ A;  4MTE A;  3ERE D;  1C0W A;  1U2W A;  3EYY A;  3ZMD A;  3JW4 A;  3R0A A;  1G3Y A;  2OZU A;  2WWY A;  2HS5 A;  2PQ8 A;  2EWN A;  1ZRC A;  3ZPL A;  4G94 A;  3BJ6 A;  5LLQ A;  1KA8 A;  1TNS A;  2NNN A;  3FMQ A;  3KZZ A;  4Y13 A;  2QBY A;  3F22 A;  2XKO A;  4A0Y A;  1J2X A;  2DI3 A;  5LEJ A;  2KJB A;  4EVI A;  3RJP A;  4BHB A;  1X3U A;  4OMZ A;  3BJO A;  3VFZ A;  1F5T A;  2FBI A;  2HZT A;  3CLO A;  4RAY A;  1FYM A;  4OU0 A;  4BH9 A;  3D0S A;  4M73 A;  4HAM A;  2OD5 A;  3DPT A;  2LSO A;  1RUO A;  2COM A;  3DEU A;  2OQG A;  1UHM A;  3LAP A;  5JHU A;  3HOT A;  4WXD A;  5BMZ A;  2M45 A;  4WX9 A;  1XB4 A;  4RS8 A;  2DW4 A;  1BN5 A;  3D5L A;  4GCV A;  2KIU A;  2UXX A;  2L02 A;  1XCV A;  2PG4 A;  3P9K A;  2CYY A;  3VOD A;  1KYW A;  1R1T A;  1LB2 A;  5F64 A;  5HS8 A;  1EH7 A;  5D8K B;  2FOK A;  4KN7 X;  5ICF A;  2AXL A;  3DPL C;  3L00 A;  2RVC A;  5EEH A;  4LLN A;  1R1V A;  1U8R A;  3WE3 A;  2RC4 A;  5ILS A;  2DBB A;  4R1H A;  4KNY A;  4N9H A;  1G3T A;  2CWE A;  2AS5 F;  3QU3 A;  3BWG A;  4R79 A;  1ZAO A;  3IKT A;  3ZP5 A;  1XD7 A;  2F2E A;  2BV6 A;  4PGG A;  1HW2 A;  2EK5 A;  3W6J B;  3HRS A;  2M87 A;  3F8C A;  2R7D A;  1IN4 A;  2HQN A;  4RB1 A;  1RI7 A;  4FHT A;  3J81 K;  4RB2 C;  2CQK A;  4IVN A;  1BOA A;  4BHC A;  3FXQ A;  4MHG A;  2QQB A;  4RGS A;  1FPQ A;  3F8B A;  1I1S A;  1FBS A;  4Q48 A;  1OYI A;  2EA4 A;  3IC7 A;  4O5V A;  1B4A A;  2FRH A;  1LEA A;  5FB2 A;  4LMY A;  1J7K A;  4G7Z F;  1TQM A;  4E70 A;  2NAZ A;  3DKW A;  3KCC A;  4EGY A;  3QRF F;  2YPR A;  2GWR A;  4B09 A;  3U2R A;  2Z33 A;  2MH9 A;  2PLY A;  3TOA A;  2XRO A;  2HKO A;  2XV4 S;  3MZH A;  4GYI A;  1FP1 D;  1SFE A;  3DXJ F;  4QLC U;  4UV9 A;  2KIM A;  3RIR A;  1MDM A;  1YIO A;  2MBF A;  2IVM A;  2PJP A;  3RPU A;  2CFX A;  2BGC A;  3JTH A;  4KA4 A;  3MFK A;  3ULQ B;  3FXU A;  2F5D A;  3IKV A;  4AD9 A;  1BM9 A;  3ZMU A;  4HBL A;  1EV7 A;  3I5U A;  1SMT A;  3RI4 A;  1U5T A;  3I71 A;  4OIN F;  5IT9 K;  3MWM A;  1OYY A;  2DK8 A;  2FXA A;  2FSW A;  2GA1 A;  4BYY A;  1HQC A;  4BQA A;  5DCM A;  4OIR F;  4IHS A;  3TO7 A;  3O3K A;  3J81 Z;  5FFX A;  3CUQ A;  1KYZ A;  2E7W A;  3K9T A;  5K5O A;  1CF7 B;  3GLX A;  1R36 A;  5AON A;  1O3R A;  2YSR A;  3CUO A;  3BDD A;  2ISZ A;  3E6C C;  5ILU A;  2BBY A;  1KGS A;  2NRA C;  4N0B A;  5AIQ A;  2M1B A;  4U88 A;  3HIF A;  2CG4 A;  5E1Z B;  2CGP A;  4L0Z B;  2A61 A;  4LFU A;  2EV6 A;  1MGT A;  1Z05 A;  1MD0 A;  4I01 A;  3MQ0 A;  4PGH A;  1P4A A;  3WTV C;  2Z9O A;  1H9T A;  3T5X A;  1K78 B;  3K69 A;  1DP7 P;  1KQ8 A;  1SD5 A;  4IF4 A;  3BPX A;  3IHU A;  5DYM A;  2G7U A;  2OA4 A;  2Y0M A;  2MLK A;  4XSX F;  4HF1 A;  2EB7 A;  4G7H F;  3WTX C;  2P4W A;  3WTZ A;  1V4R A;  1HSJ A;  1U5T C;  2ZNZ A;  2VN2 A;  3T1B A;  5JFR A;  2LF8 A;  4IPA A;  2VBZ A;  2DU9 A;  5ED4 A;  5D5W B;  1T6S A;  3EDP A;  5IT9 Z;  3BRO A;  3Q5F A;  3CUQ C;  2VBW A;  3KLO A;  3E97 A;  3HHG A;  1LNW A;  2ZFW A;  4CHU A;  2QLZ A;  4YFK F;  1TNT A;  5D5U B;  2EJR A;  2H6C A;  5D4S A;  2P5L C;  4QWQ A;  4UVB A;  2KJC A;  3NRV A;  4H0E A;  3F8F A;  4G6Q A;  2QM3 A;  5LRR A;  2ACJ A;  4ETS A;  4M9S A;  3FHZ A;  3GZ5 A;  5ERI A;  2YX4 A;  1MJA A;  1TW2 A;  4HW0 A;  3VB2 A;  4ZYD A;  5LHH A;  4M71 A;  2Z99 A;  4YII A;  4DNC A;  2O8X A;  4ESB A;  4I2O A;  5LGU A;  2JRT A;  2LDU A;  1IRG A;  1SD7 A;  3F6V A;  3BZ6 A;  5CVR A;  3QAH A;  1UFM A;  2KIF A;  3E6B A;  4P55 A;  1QO0 D;  3LST A;  2DQR A;  1BJA A;  4Q47 A;  4BXU A;  1P92 A;  2O6G E;  2PBI A;  2X0L A;  3I54 A;  1F4K A;  1PP7 U;  2QWW A;  5E8G A;  5E1X A;  4BHP A;  1OKR A;  3ROU A;  1XN7 A;  5DD4 A;  1ON2 A;  4R8H A;  4S04 A;  2PI0 A;  5HVQ C;  4M9Z A;  3HRU A;  3H3U A;  3KET A;  3GVA A;  2MH2 A;  3ELK A;  4MQV A;  3FX3 A;  4LK1 F;  2RDP A;  2JSC A;  3SZT A;  4LLL A;  3HRM A;  2JPC A;  4JK1 X;  1B9N A;  1REP C;  3GFM A;  2FA5 A;  3GF2 A;  2KRF A;  2V79 A;  4UHT A;  2HTS A;  3DV8 A;  3W6K B;  2FBK A;  2EV0 A;  3M1E A;  3I59 B;  3H92 A;  5CYV A;  2A6H F;  2O0Y A;  1GXQ A;  4IXA A;  1MJ9 A;  4D0P A;  3BY6 A;  4L9T A;  2QYO A;  2XAF A;  3CTA A;  2VON A;  1LDK B;  1S7O A;  2HTJ A;  5HDG A;  4WWC A;  2STT A;  3AAF A;  3DP7 A;  3QOP A;  3RKX A;  1ODD A;  3G3Z A;  3WE2 A;  2HGC A;  2UXN A;  3WOD F;  2K4J A;  3VEP A;  1FBQ A;  4O3M A;  4WXH A;  3K1P A;  1P2F A;  3V8K A;  2HYF A;  1QPM A;  1UST A;  2QEN A;  4BAY A;  4ESJ A;  1TTY A;  1ZG1 A;  3I58 A;  4HLY A;  2A69 F;  3IRQ A;  5JR3 A;  4EJT A;  2D1V A;  4Y17 A;  4I09 A;  1D3Y A;  2FF4 A;  3BP8 A;  4P5O A;  1FSE A;  3SQN A;  3LFK A;  3FM3 A;  5ICC A;  3P9I A;  1XDS A;  4PCQ A;  5DCM B;  1R00 A;  4ASN A;  1SD6 A;  3GZ6 A;  1W7P A;  1O7L A;  2BYV E;  2B0L A;  2IP2 A;  5H6R A;  3KP6 A;  5FD5 A;  5E17 F;  3KEQ A;  3IL2 A;  3BJA A;  3KFW X;  4PZJ A;  1I27 A;  4EM1 A;  1SAX A;  4WXC A;  1R1U A;  3E5X A;  4A6D A;  3KE2 A;  5FLX K;  4IRG A;  3RTR A;  4YFN F;  5CLS A;  3B02 A;  1EH6 A;  1MJB A;  1TQI A;  1BBY A;  3LA2 A;  2DTR A;  5H20 A;  4I02 A;  3LA7 A;  4UNO A;  3OOP A;  3GWZ A;  4CXF A;  2FML A;  2VOP A;  4L0Y B;  1D5V A;  3WTS C;  5DUK A;  1WRJ A;  2RQP A;  1S29 A;  2RV8 A;  1FYL A;  1R23 A;  2RN7 A;  1V3F A;  4LG0 A;  2IA1 A;  1ONV A;  4AIJ A;  4LB5 A;  2DO7 A;  5LRS A;  2R3S A;  4XSZ F;  5D4R A;  4KMU X;  3TO9 A;  2ZME B;  3GW2 A;  1YQA A;  3WTT C;  1SD4 A;  4UXN A;  4HF2 A;  3ZN1 A;  3MEX A;  1FNN A;  3NEU A;  2ELH A;  1UHW A;  3OV8 A;  1KQ0 A;  1IN6 A;  1YS6 A;  4KIG A;  3ZMZ A;  2E7X A;  3SFZ A;  3QPT A;  4FX0 A;  4LD5 A;  2L3D A;  4UV8 A;  5E20 A;  3LQR A;  4A12 A;  3O6B B;  3SHF A;  3IRR A;  3PQJ A;  1S3J A;  2JTV A;  5FLX Z;  2A68 F;  3L09 A;  4I0A A;  3REO A;  1ZRE A;  1CGP A;  5EEG A;  5TRD A;  4ZYH A;  2XAG A;  2NS0 A;  1GXP A;  2HEO A;  5DUI A;  2IA0 A;  4P9F A;  3CO6 C;  3DQV C;  2FQ3 A;  3COA C;  1O3Q A;  4WK8 F;  5J8C A;  1OYW A;  5L3E A;  1O57 A;  1Y0U A;  2FNA A;  3I53 A;  1R5H A;  3KP3 A;  4EQQ A;  4KYW A;  1FOK A;  2GXB A;  4P96 A;  5TJJ A;  1IZ1 A;  2F5E A;  1Z6T A;  5FGM A;  2V1D A;  2IPQ X;  2P6T A;  3G73 A;  2C6Y A;  4YIF A;  3H3Z A;  1HXD A;  3GXO A;  4KFC A;  4A0Z A;  2D45 A;  2IA2 A;  5IT3 A;  1IN5 A;  2W84 A;  3KEO A;  5E8I A;  4AIH A;  2Z5U A;  4F7Z A;  2VBX A;  5HS9 A;  3FWE A;  3ZMT A;  2NNY A;  1K6O A;  3V7S A;  3VOE A;  2L54 A;  2WC2 A;  1K79 A;  1QZZ A;  4HV6 A;  3E5U A;  1FYK A;  3LAJ A;  4ZYE A;  3NQO A;  3EUH A;  1L0O C;  3CO7 C;  1GHC A;  1KQ9 A;  2O3F A;  4EJO A;  3GO5 A;  2Q8K A;  3GUD A;  1DUX C;  2HKX A;  1ZHF A;  5CVV A;  4HX8 A;  5L3F A;  2X4H A;  1D8K A;  4ENK A;  3N4M A;  4YFX F;  2XRN A;  1W7P D;  1T2K A;  2PMU A;  5HLH A;  4GXO A;  1IN8 A;  4KDP A;  4L9N A;  2A3S A;  4L5J A;  1O3T A;  4UUV A;  4KT5 C;  3CJN A;  4RB3 C;  3RYR A;  2Q2E A;  5DCF A;  3KP2 A;  3WU0 A;  4L18 B;  3ML6 A;  1Z91 A;  4HA8 A;  4M6Y A;  1VTN C;  2LNB A;  3LA3 A;  2PN6 A;  2QQA A;  3E3V A;  2UZK A;  1F9N A;  4XLN F;  2VE8 A;  4RGR A;  4A5N A;  2QZ8 A;  5LBQ A;  2MD5 A;  1W7P B;  4IRI A;  4LK0 F;  2W85 A;  1R58 A;  3WTW C;  2QBY B;  4G6D A;  2ZXJ A;  2L4M A;  5ILV A;  2IJL A;  2NYX A;  3F3X A;  4HOB A;  2FNP A;  2XAH A;  1BIB A;  4LB6 B;  4OIQ F;  2ESN A;  1YYV A;  5HLI A;  4JBA A;  1ZN2 A;  1J75 A;  3J80 K;  1IUY A;  5BPD A;  3E6D A;  2IRF G;  4ENN A;  3GYH X;  4L9J A;  1SMY F;  1LJ9 A;  1XGM A;  2XAQ A;  1BC7 C;  3Q9S A;  4FT8 A;  2DK5 A;  1P4X A;  1Z9C A;  1UB9 A;  3EQL F;  3U1D A;  2H27 A;  1MKM A;  3I64 A;  3K2Z A;  3ZMV A;  3V4G A;  3KLN A;  4ZH4 F;  1ON1 A;  4ENJ A;  2ESH A;  4ZYG A;  2E1N A;  4NHJ A;  1ZGJ A;  5CVU A;  1EH8 A;  4IJA A;  2RNJ A;  1XMK A;  2FE3 A;  3C7J A;  2ISY A;  2ZO4 A;  3GEZ A;  2DT5 A;  4MEY F;  2P7C B;  1DPR A;  1YW7 A;  3TDU C;  1XMA A;  4YG2 F;  3HTU A;  4DQ2 A;  4HF0 A;  1WKM A;  4IHT A;  3HTS B;  2MC3 A;  1W5S A;  3ECO A;  3R60 A;  5ICG A;  1UCR A;  5F1R A;  3CDH A;  1ZH5 A;  4KIB A;  3F8M A;  2YX7 A;  4L5I A;  3KP5 A;  2EFW A;  4S05 A;  2VC0 A;  3FZV A;  4LJZ F;  5A2Q K;  1XDU A;  3P7N A;  3MAJ A;  1XSX A;  3J80 Z;  3QP5 A;  4I98 B;  2W25 A;  3SZP A;  2Z3Y A;  2M5W A;  2EV5 A;  2J5O A;  1P6R A;  6PAX A;  3LQQ A;  4N9I A;  5L3B A;  2XVC A;  1IXR C;  5KVR A;  5AIP A;  3TOB A;  3F6O A;  1FLI A;  3RYP A;  3F23 A;  1OMI A;  4RGU A;  3C18 A;  2A5Y B;  1ZAR A;  4A0X A;  5LGT A;  2DQL A;  3K1M A;  3KZY A;  5FO5 A;  1G6N A;  3BPV A;  4XRF A;  4LGW A;  2E1C A;  1G3S A;  4U7B A;  4EMS A;  5CVJ A;  3MZY A;  5D5X B;  5H6Q A;  1ZGA A;  4UVA A;  3TQN A;  1FT9 A;  2UWM A;  2EFQ A;  4M72 A;  1D8J A;  3WGH A;  1MDM B;  1YG2 A;  1CF7 A;  2QUF A;  4HX7 A;  1FSH A;  2WV0 A;  3JSP A;  4G9Y A;  3QU6 A;  2DPD A;  4HDV A;  2QQ9 A;  4HLX A;  2GIV A;  1IXC A;  4AIK A;  1WI9 A;  4OOI A;  2JT1 A;  1YS7 A;  5DDG A;  1SFU A;  3M9A A;  1BI0 A;  1FBU A;  1XCB A;  2BE5 F;  3ABT A;  2D2W A;  3R6S A;  5LHI A;  1U5T B;  2XAJ A;  3ISP A;  1YW9 A;  3WU1 B;  2L4A A;  1FC3 A;  4JQF A;  2OQR A;  1W5T A;  1OPC A;  2EFN A;  2XIG A;  4CYD A;  5A2Q Z;  2VT2 A;  1QQI A;  2XKP A;  3LWF A;  2V9V A;  4ZZD A;  3CUQ B;  4I7H A;  3BOQ A;  1XGO A;  3ABU A;  3ZN0 A;  1WWX A;  1BI3 A;  3R4K A;  4B8X A;  1HW5 A;  1K78 A;  3RKY A;  2VBY A;  4CDG A;  3MCZ A;  1HKS A;  1R22 A;  2O61 A;  1U6G A;  1S7A A;  1I5Z A;  4MTD A;  3RPQ A;  5JI6 A;  3J7A O;  4HDU A;  1PP8 F;  2ZKZ A;  3RKW A;  5HOO A;  1ZRD A;  2DPU A;  2QVO A;  1T0F A;  1LQ1 A;  1FZP B;  3C3W A;  3RDI A;  2FU4 A;  2PFB A;  5DV5 A;  1RNL A;  4KUM A;  5KK1 A;  4O6J A;  2M30 A;  1B6A A;  2IT0 A;  1WQ2 A;  1BI1 A;  3FXR A;  4RGX A;  2PMH A;  4ESF A;  1Z6R A;  4RAZ A;  2K4B A;  2WTE A;  5D5V B;  3V8J A;  2IW5 A;  1S8N A;  1LDJ A;  1JHF A;  3M8F A;  1JXS A;  1U3E M;  3TDZ C;  3F72 A;  2Q0O A;  5BQT A;  2DLL A;  1MZB A;  4AWX B;  1B59 A;  4BNC A;  3K0L A;  1PUE E;  2F5C A;  4G8X A;  1T98 A;  4M6X A;  3HSF A;  2TDX A;  3R61 A;  1G3W A;  1T39 A;  3GX4 X;  1JE8 A;  2V6C A;  3FF5 A;  3HHH A;  2EFP A;  5E1W A;  2P7V B;  4CIC A;  4LLG F;  1E17 A;  3FM5 A;  1Z1D A;  2JZY A;  1O7F A;  2CSO A;  2H09 A;  3KP4 A;  3GFI A;  2V1U A;  2MLG A;  3TO6 A;  3V7C A;  1L3L A;  4KN4 X;  1KU2 A;  1AWC A;  3S2W A;  1G4D A;  4RB0 A;  3HUG A;  3P9C A;  4XBF A;  2OZ6 A;  4EJV A;  4Y15 A;  2G7H A;  1KU7 A;  3HYI A;  2HR3 A;  1U78 A;  1H9G A;  5BOX A;  4EM0 B;  4G7O F;  1HKQ A;  2V1X A;  2VC1 A;  5K5R A;  1ZRF A;  3GFJ A;  4K2E A;  3I59 A;  3GFL A;  3KP7 A;  4CZZ A;  1HBX G;  3E5Q A;  1P4W A;  4U7D A;  4EV0 A;  1XSD A;  1T38 A;  2GA2 A;  5JVT A;  4CO8 A;  5LHG A;  2STW A;  3WGI A;  4OIP F;  1QZY A;  4XLP F;  3ECH A;  4ENM A;  4HYE A;  1ZLJ A;  3PFI A;  1Q1H A;  3DFG A;  2FBH A;  1SFX A;  2VOO A;  1TQP A;  2Y75 A;  4A5M A;  4ON0 A;  5L3C A;  2M8E A;  4TV7 A;  1WSU A;  4MQ9 F;  4KIF A;  4NQW A;  2J5P A;  1YW8 A;  1LEB A;  1TBX A;  1TLH B;  5D6E A;  1TW3 A;  3IWZ A;  1F1Z A;  3B73 A;  4M74 A;  5FFZ A;  3EET A;  4Q4Z F;  4HQE A;  3QP6 A;  1YFH A;  4HX4 A;  1KU3 A;  1DPU A;  1OR7 A;  5BS6 A;  2P8T A;  2HDC A;  4I0B A;  1RUN A;  4EM2 A;  1LDD A;  2ZCW A;  4HQM A;  4GGG A;  1RZ4 A;  2VOD A;  2XAS A;  1BI2 A;  4GYG A;  1FWZ A;  2EFO A;  4Q5S F;  5LEK A;  2K02 A;  1IF1 A;  2HOE A;  1ZLK A;  1J59 A;  2HYG D;  3HRT A;  1QBJ A;  2K86 A;  2P5K A;  2RGV A;  4MNU A;  3I0T A;  4PDK A;  2D1H A;  3C1D A;  5BPI A;  3M8E A;  3ZQ7 A;  1BC8 C;  3F8N A;  3JAM K;  2L01 A;  5CJ9 A;  4CGZ A;  2DAO A;  2PEX A;  3IWF A;  1IW7 F;  5HS7 A;  4HZF A;  1AOY A;  1QNT A;  3V8L A;  5HDK A;  1FX7 A;  4OIO F;  5CVI A;  4L9V A;  5K1Y A;  1J0R A;  1JGS A;  5DD8 A;  2G9W A;  3N97 A;  1FY7 A;  2LF7 A;  1J9I A;  1O3S A;  4WF2 A;  2FEZ A;  1STZ A;  3E6M A;  3WGG A;  1W4M A;  2W57 A;  3V7R A;  3FMS A;  1IAW A;  2K27 A;  4HV5 A;  3T0Y A;  3DF8 A;  3SXY A;  4MGR A;  2P6S A;  1LVA A;  2ZME A;  3K1N A;  3HOS A;  1HKT A;  2GQQ A;  4NB5 A;  2HFH A;  5ICE A;  1B1B A;  4U0W A;  1ZYR F;  4P9U A;  4ZZL A;  5L3G A;  3EYI A;  4M9X A;  3O2P E;  1YTY A;  2LKP A;  5F6F A;  3WG9 A; 
#chains in the Genus database with same CATH topology
 3S3N A;  1QGP A;  5L3D A;  3L9F A;  1RIO H;  3QPH A;  3HSR A;  5D6F A;  3HKZ A;  3CME I;  1HW1 A;  1K7A A;  2KZG A;  2K3P A;  1YX3 A;  1KU9 A;  1UMQ A;  2OF7 A;  2I10 A;  1UEL B;  2IBD A;  1OCC H;  3S8P A;  2DMQ A;  2NS7 A;  1R5G A;  1EJ9 A;  1XG1 A;  1R7J A;  4OMY A;  2NVQ J;  4LG0 B;  2A6T A;  3F21 A;  1R71 A;  4CYC B;  2IS4 A;  2W7N A;  5DEQ A;  1A35 A;  4IHX A;  4UVC A;  3HSE A;  2H6B A;  1FP2 A;  1XS9 A;  2H94 A;  1UJ8 A;  3TKY A;  3T8R A;  2Y2Z A;  5E18 F;  2VKV A;  4AVP A;  2M0M A;  4FTH A;  4NNJ A;  2LY9 A;  2JRM A;  1GV5 A;  4RMN A;  5HDN A;  3S2D J;  2KFD A;  2M0C A;  1VQK I;  3M7G A;  3JAM Z;  1JHH A;  1S6L A;  3U9G A;  3ERM A;  2ETH A;  2KKO A;  1G2H A;  1J5Y A;  4U87 A;  1QVU A;  1ZG5 A;  4MEX F;  1XGS A;  3X2Q H;  2K7L A;  2BEO A;  2FD5 A;  3ABK H;  2QQ8 A;  2VI6 A;  4E7L A;  4A3L J;  1XSV A;  1NHA A;  2HQR A;  2MA3 A;  2VE9 A;  1VQP I;  2ZNY A;  2P5V A;  4XN0 A;  1B9M A;  4U0Y A;  3K6G A;  2XGX A;  3FMR A;  4NC7 A;  5LGN A;  2R7O A;  3R0J A;  3GTJ J;  1I6X A;  1PDN C;  4Z2Y A;  2DFI A;  1JJ6 C;  2L7M P;  3G1L A;  5EGO A;  3GZN B;  2LLK A;  2YU3 A;  2LBF A;  2K9N A;  2OU2 A;  3K4K A;  2M4G A;  1GVJ A;  3BZK A;  1K6Y A;  2HVQ A;  1J09 A;  1TWC J;  2CW0 F;  4PFP A;  1A04 A;  4HNV A;  2FMY A;  1IN7 A;  4A3D J;  3H9J A;  1QU3 A;  2XHK A;  2OAZ A;  2YR2 A;  3WTU C;  1FOX A;  2HQ5 A;  2ZBK A;  2CUF A;  2IEK A;  2R7F A;  2CO5 A;  2ZSI B;  1WVR A;  3DLL F;  2MFZ A;  4FIS A;  3DKY A;  2ADU A;  1M1E B;  4XKV A;  2M4K A;  5D8L B;  3WHC A;  1APL C;  4IRH A;  3Q9V A;  5HLG A;  1H0M A;  4ZDP A;  2R92 J;  3ZQI A;  4LIU A;  1BIA A;  3S1R J;  5EYR A;  4DYQ A;  3BR3 A;  4EJW A;  1DDN A;  2A6E F;  2FX0 A;  1IUF A;  2W00 A;  2GZW A;  1NG7 A;  3T8T A;  3WTY C;  2ZJ2 A;  3L2C A;  2RKH A;  4U0V A;  4BQO A;  1XGN A;  5K5Q A;  3I4P A;  4XID A;  3TGN A;  1EA3 A;  2Y0S N;  1TT0 A;  2GXG A;  3OYI A;  1ZG3 A;  2HWV A;  4FX4 A;  3FDY A;  2L7Z A;  2OBP A;  4A6E A;  5J8F A;  3EUA A;  2O03 A;  1RR8 C;  4M3G A;  2M7B A;  3QOE A;  1ULY A;  4C2M J;  1IRF A;  1Z7U A;  3S17 J;  3JTG A;  1V5F A;  1YO5 C;  4A2U A;  2H8R A;  2X6O A;  1LE8 B;  2Y48 A;  1QHH D;  4GO1 A;  1USS A;  4KMF A;  5FD6 A;  3DBR B;  4EJU A;  3OS2 A;  3CCR I;  4KIC A;  3PQK A;  1FOY A;  1RKT A;  3PIP F;  3J7Z I;  3L7W A;  5J4Y A;  2GAU A;  1FOW A;  2JPB A;  1YLF A;  1E2X A;  2E2H J;  1MMD A;  2F5F A;  2VKH A;  3EPZ A;  4AVZ A;  4EEF G;  4EGZ A;  2VT3 A;  2EA2 A;  2A07 F;  3BCB A;  3ZMS A;  1I1G A;  3FIW A;  2XUB A;  4DYC A;  5F27 A;  5C44 J;  2R7U A;  3LSJ A;  1QA6 A;  3JSO A;  5J6X A;  1HST A;  1X1P A;  1IXS B;  2W24 A;  3Q0W A;  4WCG A;  1POG A;  2VXZ A;  4MTE A;  3ERE D;  1D5Y A;  1C0W A;  4XM3 A;  1U2W A;  3EYY A;  3ZMD A;  2V9K A;  3DBL B;  3JW4 A;  4RA2 A;  2V4J C;  3A2K A;  3W2V A;  1VFC A;  3R0A A;  1G3Y A;  2OZU A;  2WWY A;  2L2O A;  3L2Q A;  5B5E C;  2HS5 A;  3S16 J;  2PQ8 A;  3NWT A;  5FJ8 J;  2EWN A;  1YX5 A;  1ZRC A;  3ZPL A;  4G94 A;  1N25 A;  3BJ6 A;  5LLQ A;  1KA8 A;  3A01 A;  4OAZ A;  1TNS A;  1D1C A;  2NNN A;  3FMQ A;  4B43 A;  1RES A;  2E1M C;  3BCA A;  2YUS A;  3SEQ A;  3KZZ A;  2LR8 A;  4Y13 A;  2QBY A;  3A0H C;  3RCO A;  3ZQH A;  3I4N J;  3KYL A;  3F22 A;  2XKO A;  4A0Y A;  1J2X A;  2DI3 A;  3J7Y J;  5LEJ A;  4E7K A;  2KJB A;  4EVI A;  3RJP A;  1E3P A;  2HVR A;  4BHB A;  3JRH A;  1X3U A;  2Q2E B;  2O9L A;  5FRN A;  2LMD A;  2VJI A;  3K4C A;  4OMZ A;  2JVG A;  3BJO A;  3VFZ A;  1F5T A;  2DT7 B;  2FBI A;  2HZT A;  1OLT A;  3CLO A;  4RAY A;  1FYM A;  4OU0 A;  4BH9 A;  1QRY A;  3D0S A;  2DYS H;  4M73 A;  5KAI C;  1MBF A;  4HAM A;  4RM3 A;  2OD5 A;  1BR1 A;  4XKB A;  3DPT A;  2V26 A;  1KON A;  1MIJ A;  2LSO A;  2P81 A;  3HZJ A;  1RUO A;  2COM A;  3DEU A;  2CJJ A;  1UHM A;  2OQG A;  2W48 A;  2VPL A;  3LAP A;  2ECB A;  3O8G A;  5JHU A;  3HOT A;  4WXD A;  4G6T B;  1ZGW A;  2ZSH B;  2N8G A;  5BMZ A;  2M45 A;  2O7O A;  1PUF A;  3E1S A;  4WX9 A;  3CC2 I;  5EG0 A;  2MD0 A;  3OYD A;  1XB4 A;  3G1M A;  3JCU C;  4RS8 A;  3ZOB A;  4W97 A;  4F3Q A;  1HA8 A;  1SC7 A;  1N75 A;  3DTI A;  3ONQ A;  4B3A A;  3I55 I;  2DW4 A;  1BN5 A;  3D5L A;  1B72 A;  5HNF A;  4GCV A;  1YOV B;  2KIU A;  2UXX A;  2L02 A;  1XCV A;  2VJ5 A;  1Y8Q B;  2PG4 A;  2XDV A;  3P9K A;  2CYY A;  3K7A J;  4NBQ A;  3VOD A;  1KYW A;  1R1T A;  1LB2 A;  3RQI A;  5F64 A;  4F92 B;  4JX6 A;  5HS8 A;  1EH7 A;  4C3H J;  2BY3 A;  4E7H A;  2R4G A;  3HXL A;  2VB6 A;  5D8K B;  4PJL A;  2R7S A;  3DU6 A;  2FOK A;  1T56 A;  3E7L A;  2AHQ A;  3GLL A;  1SAN A;  4KN7 X;  5ICF A;  1A6I A;  2AXL A;  3DPL C;  3L00 A;  5JHF A;  2DOA A;  2RVC A;  2DMP A;  5EEH A;  1R4N B;  1R1V A;  1Y39 A;  4LLN A;  2TRT A;  2BY2 A;  2HZD A;  1VQO I;  3PSF A;  4AM3 A;  1U8R A;  2ZFU A;  3SEZ A;  3WE3 A;  1PVE A;  3TW6 A;  2RC4 A;  5ILS A;  2DBB A;  1YIJ I;  1JT0 A;  1A36 A;  4R1H A;  4KNY A;  2BOL A;  4N9H A;  5FLM J;  3K4N A;  3DLA A;  2GOX B;  1G3T A;  2CWE A;  2AS5 F;  3OIO A;  1ZKG A;  1X1C A;  5H2F C;  3QU3 A;  3BWG A;  1SFK A;  4R79 A;  2AXT C;  1ZAO A;  2R5Z B;  1YI2 I;  3IKT A;  3ZP5 A;  1YRN A;  1XD7 A;  1R9T J;  2F2E A;  3JRB A;  2BV6 A;  4PGG A;  2HPM A;  1HW2 A;  2EK5 A;  3CQZ J;  3W6J B;  3CJQ B;  5FRO A;  5M5Y J;  3HRS A;  2M87 A;  3F8C A;  4E7I A;  2R7D A;  1V54 H;  1IN4 A;  2HQN A;  1H8A C;  1X4O A;  4RB1 A;  1WJF A;  5FKN A;  2MG4 A;  4M3E A;  3AKZ A;  1R4M B;  2EIM H;  1RI7 A;  4II3 A;  4FHT A;  3J81 K;  1GDT A;  1YHQ I;  5F1J A;  2WB1 A;  2CQK A;  4RB2 C;  4IVN A;  2XSJ C;  1BOA A;  4BHC A;  3FXQ A;  4MHG A;  2QQB A;  4IHY A;  3A02 A;  2VKE A;  4RGS A;  1FPQ A;  4A3B J;  3DTE A;  2DA2 A;  3F8B A;  1I1S A;  1FBS A;  4JX5 A;  1OYI A;  4Q48 A;  3OY9 A;  2V9P A;  2EA4 A;  3IC7 A;  2DJN A;  2IS2 A;  3OR2 C;  4O5V A;  1B4A A;  2XC7 A;  3HL2 A;  1JUP A;  2FRH A;  1LEA A;  5FB2 A;  4LMY A;  5IY5 H;  1J7K A;  4G7Z F;  1V55 H;  1TQM A;  4E70 A;  2IGN A;  2NAZ A;  3DKW A;  3KCC A;  4EGY A;  3QRF F;  3H1C A;  2YPR A;  5B1A H;  2OTL I;  2HOT A;  2GWR A;  4AYB A;  1FMV A;  4B09 A;  3U2R A;  2Z33 A;  1LFB A;  2ZB9 A;  2MH9 A;  2K3F A;  2PLY A;  1NK3 P;  3TOA A;  3GTP J;  2XRO A;  2HKO A;  2XV4 S;  3MZH A;  4QTR A;  4GYI A;  1BL0 A;  2DDB A;  3IAS 2;  1AKH A;  1FP1 D;  1SFE A;  3DXJ F;  1VQM I;  2E2J J;  4QLC U;  4UV9 A;  2KIM A;  3FXO A;  3RIR A;  1MDM A;  1YIO A;  1JTY A;  2MBF A;  1OCR H;  2IVM A;  4IX7 A;  5J1R A;  3GTK J;  3ZCO A;  2PJP A;  3RPU A;  2CFX A;  1XTA A;  2BGC A;  3JTH A;  4XMY A;  4KA4 A;  3MFK A;  3ULQ B;  3FXU A;  4KIT B;  5B3S H;  2F5D A;  2CUZ A;  1ETK A;  3IKV A;  1TL8 A;  4AD9 A;  1BM9 A;  3ZMU A;  3ESW B;  3OYN A;  4JP0 A;  3OS1 A;  1SFO J;  4HBL A;  3MKL A;  4X1E A;  2E1M B;  2Z2S B;  1MBH A;  1EV7 A;  2F48 A;  3I5U A;  4NC8 A;  1SMT A;  4C3J J;  2L0K A;  3RI4 A;  4BXF A;  4E7S A;  1D0Y A;  1U5T A;  3I71 A;  4BL0 B;  4BDZ A;  4OIN F;  4HSR A;  4BS9 A;  5IT9 K;  3MWM A;  2Y9Z A;  1OYY A;  1FTZ A;  2DK8 A;  2FXA A;  2FSW A;  1MMG A;  2GA1 A;  3RZO J;  5DM7 F;  4BYY A;  1HQC A;  4BQA A;  5DCM A;  3LSG A;  4XN3 A;  2VIX A;  1Z0X A;  5FKL A;  4JOM A;  4OIR F;  2PJR A;  5FKO A;  3FHN A;  4IHS A;  3TO7 A;  3O3K A;  3GTO J;  3J81 Z;  5FFX A;  4F52 A;  3CUQ A;  1RC9 A;  1KYZ A;  2E7W A;  3K9T A;  1I50 J;  5K5O A;  1SEU A;  2LG4 A;  2KMU A;  1CF7 B;  3GLX A;  4N4N B;  1R36 A;  4XLE A;  5AON A;  1O3R A;  2DMU A;  2E1O A;  4CCM A;  2QF7 A;  1JUM A;  4PUS A;  5GPC A;  1NH3 A;  2M8G X;  2YSR A;  3CUO A;  3BDD A;  3S3O A;  2ISZ A;  3E6C C;  2KDO A;  1ETX A;  4A3F J;  2JA6 J;  1P9Q C;  2LVS A;  5LFA A;  5ILU A;  1N77 A;  5CQE A;  2OV7 A;  2BBY A;  1KGS A;  2NRA C;  4N0B A;  3JRD A;  3ZQL A;  3VWB A;  2HVS A;  2CQQ A;  5AIQ A;  2M1B A;  4U88 A;  3FIS A;  1A5J A;  3HIF A;  2CG4 A;  5E1Z B;  2CGP A;  4L0Z B;  1ETW A;  2A61 A;  3NWS A;  3TW7 A;  4LFU A;  2JVH A;  2BY0 A;  2EV6 A;  1BA5 A;  1MGT A;  1Z05 A;  4D7N A;  4BBR J;  1OCZ H;  2CV0 A;  1X3Z B;  2X85 A;  4YIR X;  1MD0 A;  2EIK H;  3MQ0 A;  4I01 A;  2B7E A;  3GTL J;  1NG6 A;  3IH4 A;  4PGH A;  1P4A A;  1T33 A;  3WTV C;  2B63 J;  4HPQ A;  2IS1 A;  2Z9O A;  1H9T A;  1X2N A;  3T5X A;  3VDX A;  3ASN H;  2ME6 A;  1S72 I;  1ZRE A;  5FLV A;  1K78 B;  4CZC A;  3K69 A;  1DP7 P;  2EIL H;  2JSP A;  1KQ8 A;  1SD5 A;  1LPQ A;  4IF4 A;  3BPX A;  2NS8 A;  3IHU A;  5DYM A;  3A01 B;  3UKG A;  2G7U A;  1G59 A;  3I4M J;  2DA1 A;  3OL4 A;  2OA4 A;  2Y0M A;  2MLK A;  4XSX F;  4HF1 A;  2LOO A;  2EB7 A;  1X58 A;  3BG7 A;  5K7F A;  4G7H F;  4IKF A;  3IV5 A;  3Q3S A;  1D1B A;  3WTX C;  2P4W A;  3WTZ A;  1V4R A;  2OC6 A;  1HSJ A;  4XK4 A;  4UB8 C;  1U5T C;  2ZNZ A;  4QPQ A;  2VN2 A;  3T1B A;  2NOJ B;  1ETY A;  1F36 A;  5JFR A;  2LF8 A;  4IPA A;  1ITY A;  4PSW A;  1OR7 C;  2E60 A;  2I8D A;  2VBZ A;  2DU9 A;  2X6Y A;  5BNG A;  1SVM A;  1X3W B;  4H4K C;  5ED4 A;  5D5W B;  1A31 A;  1W5C C;  1T6S A;  4AYB N;  2DT6 A;  3EDP A;  5IT9 Z;  1JKR C;  1ZK8 A;  3AL0 C;  3CDI A;  3BRO A;  3GTG J;  3A4C A;  3QOD A;  2L9V A;  4IL6 C;  4ZJZ A;  3Q5F A;  3CUQ C;  3KX2 A;  2VBW A;  2NVY J;  3KLO A;  3E97 A;  3HHG A;  2Q1Z B;  1LNW A;  4GFB A;  2ZFW A;  4CHU A;  2QLZ A;  4DJA A;  5E79 C;  4YFK F;  1TNT A;  5D5U B;  2EJR A;  2H6C A;  5D4S A;  2P5L C;  2E5Z A;  2JN6 A;  2MGQ A;  4QWQ A;  4UVB A;  2KJC A;  3NRV A;  4H0E A;  3F8F A;  2ZJR F;  4G6Q A;  3D5S C;  2QM3 A;  1I3A A;  5EG0 B;  4CUG A;  5LRR A;  4MFD A;  3CMA I;  2X1D A;  2ACJ A;  4ETS A;  4M9S A;  4FE7 A;  3FHZ A;  3GZ5 A;  1B8I B;  3S1N J;  3O8H A;  4PK4 A;  5ERI A;  3JRG A;  2YX4 A;  1MJA A;  1TW2 A;  2W4S A;  4HW0 A;  3VB2 A;  3UR3 C;  4ZYD A;  5LHH A;  2JA7 J;  2KHM A;  4CCJ A;  3PIO F;  4M71 A;  3OSF A;  2Z99 A;  1TP4 A;  1X2M A;  4YII A;  4CA0 A;  4DNC A;  4KJZ A;  2O8X A;  4ESB A;  4I2O A;  3PNV A;  5LGU A;  4UY8 I;  2JRT A;  2LDU A;  3D1N I;  1GVD A;  1SVO A;  1SD7 A;  2F5V A;  1IRG A;  2Z16 A;  3F6V A;  3W2W A;  3BZ6 A;  5CVR A;  3QAH A;  4HNT A;  1UFM A;  2G0E A;  4B44 A;  2KIF A;  3E6B A;  4P55 A;  1FEX A;  5M5X J;  1QO0 D;  1MBG A;  3LST A;  5C4J J;  3BZC A;  1HC8 A;  2DQR A;  1BJA A;  3BG3 A;  4Q47 A;  4BXU A;  1P92 A;  2CU7 A;  2O6G E;  3PO2 J;  3W3C A;  5IPA A;  2PBI A;  2X0L A;  3I54 A;  1F4K A;  4LIV A;  5GAD J;  1PP7 U;  3F0C A;  2LP0 A;  4XRS G;  2QWW A;  2X51 A;  4AC0 A;  5E8G A;  3CC4 I;  3DBH B;  5E1X A;  4BHP A;  3FXJ A;  1OKR A;  3D5R C;  3ROU A;  3F9K A;  2CRG A;  1XN7 A;  5DD4 A;  2FUG 2;  3BR0 A;  1DU0 A;  2M2E A;  1D1A A;  1ON2 A;  4R8H A;  4S04 A;  3ABL H;  2ZME C;  3VSK A;  2PI0 A;  3HUG B;  3OYC A;  4A3K J;  4MO7 A;  5HVQ C;  4M9Z A;  3FK6 A;  2RRE A;  3HRU A;  2KIQ A;  1K4S A;  3MVP A;  3H3U A;  3KET A;  3GVA A;  2MH2 A;  2EPF A;  2ZXI A;  3ELK A;  3N05 A;  2ZXH A;  1VI0 A;  3CCV I;  2KLO A;  4MQV A;  1WPK A;  3FX3 A;  1XX5 A;  4LK1 F;  3RPU D;  2RDP A;  2LK2 A;  2JSC A;  4BJT A;  3SZT A;  4LLL A;  3HRM A;  2JPC A;  4JK1 X;  2LKX A;  1B9N A;  1REP C;  4AID A;  2BXY A;  3GFM A;  3OYJ A;  2FA5 A;  5CQG A;  3GF2 A;  3MKY B;  2JQ7 A;  2KRF A;  2V79 A;  4UHT A;  2HTS A;  2LKS A;  3DV8 A;  3W6K B;  1Z77 A;  2FBK A;  2VQH A;  2EV0 A;  2DA4 A;  2XGD A;  3M1E A;  1HF0 A;  3I59 B;  3H92 A;  3LL7 A;  1VQN I;  4XNF A;  5CYV A;  2A6H F;  2O0Y A;  5GAE J;  1GXQ A;  2R7V A;  3CF2 A;  4RBO A;  4IXA A;  1FJL A;  1MJ9 A;  4D0P A;  1SAU A;  4JX4 A;  3BY6 A;  5IYB J;  3W2A A;  4L9T A;  2QYO A;  2XAF A;  3CTA A;  1ZR2 A;  3KZI C;  2VON A;  4HEA 2;  4CCK A;  1LDK B;  3L1P A;  1S7O A;  1ZTR A;  2HTJ A;  4Y3O A;  4IQ4 A;  5HDG A;  4WWC A;  1LFP A;  2BVL A;  3MD2 A;  3IAM 2;  2STT A;  3AAF A;  4XR6 A;  3DP7 A;  3QOP A;  3RKX A;  4IEJ A;  2DXI A;  1ODD A;  3G3Z A;  3WE2 A;  2JA2 A;  3S1Q J;  2ZXW H;  2M34 A;  2HGC A;  2UXN A;  3CCY A;  2K4J A;  3WOD F;  3VEP A;  3PL8 A;  3OL3 A;  1FBQ A;  1LFU P;  1MSF C;  4O3M A;  4WXH A;  3AG4 H;  3K1P A;  5C3E J;  1P2F A;  4NQW B;  1GUU A;  3TED A;  2ID3 A;  3WHB A;  1WJD A;  2ID6 A;  2HYF A;  1QPM A;  3V8K A;  4M6V A;  1UST A;  2QEN A;  4BAY A;  1WJA A;  4A3G J;  4MIM A;  5J1U A;  4ESJ A;  3H0G J;  4DZJ A;  1TTY A;  4V2F A;  1ZG1 A;  3I58 A;  3BT9 A;  2A69 F;  4HLY A;  3IRQ A;  5JR3 A;  4EJT A;  2D1V A;  3HKZ N;  4Y17 A;  4I09 A;  2IXS A;  3WU2 C;  1D3Y A;  2FF4 A;  3PSI A;  3BP8 A;  4P5O A;  1FSE A;  3SQN A;  2CW8 A;  4C30 A;  3LFK A;  1ENH A;  3FM3 A;  3FXL A;  3IH3 A;  5ICC A;  3P9I A;  1XDS A;  3BC8 A;  4PCQ A;  5DCM B;  1R00 A;  4ASN A;  2R7X A;  1SD6 A;  5E3M A;  2MW8 A;  3GZ6 A;  1W7P A;  1O7L A;  2BYV E;  3DCF A;  2R93 J;  2B0L A;  1MND A;  3L2W A;  2IP2 A;  5H6R A;  2L9R A;  2L5Q A;  3KP6 A;  3K4B A;  4B4C A;  1UG2 A;  5FD5 A;  2ZC2 A;  1TWG J;  4XKW A;  1FTT A;  2DOE A;  2DOD A;  5E17 F;  5IP7 J;  4F91 B;  1MBJ A;  3KEQ A;  3IL2 A;  3BJA A;  3KFW X;  4PZJ A;  2K5C A;  3AG2 H;  4RAF A;  3PUB A;  2ZJQ F;  1I27 A;  3C2B A;  4EM1 A;  3OWT A;  3QYF A;  1DQU A;  4LIT A;  4WXC A;  1SAX A;  1R1U A;  3KEY A;  3E5X A;  4A6D A;  5M3M J;  1IDY A;  2BW3 A;  4KIS A;  3KE2 A;  2R5Y A;  4JYK A;  4B48 A;  5FLX K;  4IRG A;  2O5R A;  3RTR A;  5CKT A;  2JA5 J;  4YFN F;  2K9S A;  5CLS A;  4Z6Y A;  3B02 A;  3JRI A;  3GTM J;  1X4P A;  2F4M B;  2RQQ A;  1EH6 A;  1MJB A;  3SYT A;  4V2G A;  2GIZ A;  1TQI A;  1VZ0 A;  1Y8R B;  2E19 A;  3M8J A;  1BBY A;  3A1Y A;  3LA2 A;  3NAU A;  4XOP A;  2DTR A;  4HNU A;  5H20 A;  2DOF A;  4I02 A;  3U1K A;  4A3C J;  3LA7 A;  3BG5 A;  4UNO A;  2HYJ A;  4P1W A;  2NVU B;  1RKW A;  3OYA A;  3S3M A;  2L7K A;  2DMN A;  3OOP A;  3GWZ A;  2R0Q C;  4CXF A;  2FML A;  2XSD C;  1WGX A;  2K85 A;  2VOP A;  1DGW Y;  5K7H A;  4L0Y B;  2DFE A;  4OWR B;  3WTS C;  1D5V A;  5DUK A;  3HJE A;  1ZQ3 P;  1WRJ A;  2BHY A;  2F4O B;  3L2U A;  1CQT A;  2JUG A;  2RQP A;  3TBI A;  4S0H B;  1S29 A;  3QPS A;  4MLO A;  2D5V A;  1XC5 A;  2RV8 A;  1MSE C;  1FYL A;  1R23 A;  2RN7 A;  5F0F A;  3ZRG A;  2VLA A;  1V3F A;  3H5R A;  1X1D A;  1W0U A;  4LG0 A;  2IA1 A;  1ONV A;  4CYC A;  4AIJ A;  3K4L A;  1WH7 A;  2IGM A;  4LB5 A;  2DO7 A;  1Q1V A;  1OCO H;  1IO2 A;  5LRS A;  3CZ6 A;  3DWL E;  2R3S A;  4XSZ F;  2GXA A;  5D4R A;  1P7I A;  4KMU X;  3TO9 A;  2ZME B;  2L9N A;  4L5E A;  2XF7 A;  2XGE A;  3GW2 A;  1UAA A;  1YQA A;  2VQC A;  3WTT C;  1SD4 A;  3LFU A;  4UXN A;  3PNT A;  4HF2 A;  1YJ9 I;  4HG2 A;  2XGC A;  5IYC J;  1MMS A;  3CC7 I;  3OYE A;  3G1O A;  2LRE A;  3ZN1 A;  2M9H A;  4BBS J;  2GBY A;  3MEX A;  1JI8 A;  1FNN A;  1FMW A;  3NEU A;  1O4X A;  3OYK A;  2DYR H;  2ELH A;  1RPW A;  1UHW A;  1KQ0 A;  1IN6 A;  3OV8 A;  4C9Y A;  1YS6 A;  3U21 A;  4KIG A;  3ZMZ A;  5M3F J;  1ZR4 A;  1IV6 A;  2EQR A;  2E7X A;  2EZI A;  3SFZ A;  1VQL I;  2CW7 A;  3PFY A;  3QPT A;  2VAS A;  4FX0 A;  1LVK A;  4LD5 A;  2L3D A;  4PSX A;  1OIS A;  3LSH A;  4XLH A;  4UV8 A;  5E20 A;  3LQR A;  4ZTF A;  4A12 A;  4CCL A;  3O6B B;  5EDN A;  2KT0 A;  2MC4 A;  3SHF A;  3IRR A;  3I3L A;  1WJ5 A;  3PQJ A;  3CD6 I;  3CP2 A;  4IOC F;  4D5F A;  2AQF A;  2VPR A;  1S3J A;  3GTQ J;  2JTV A;  5FLX Z;  2A68 F;  1ORK A;  2XF6 A;  3HG9 A;  3L09 A;  3S14 J;  4I0A A;  5B1B H;  3REO A;  3OIP A;  4N4O B;  5EZG A;  3I56 I;  1Z21 A;  1CGP A;  2CQN A;  5EEG A;  3WG7 H;  5TRD A;  1Y1V J;  4ZYH A;  2EIJ H;  4PJ0 C;  2XAG A;  2NS0 A;  1GXP A;  2HEO A;  3ZQF A;  2IA0 A;  5DUI A;  4P9F A;  2M7A A;  4M3F A;  2MYS A;  3CO6 C;  2CS3 A;  3DQV C;  2FQ3 A;  1JT6 A;  3COA C;  1O3Q A;  4A69 C;  1MMN A;  4WK8 F;  3CMY A;  5J8C A;  2DDA A;  1OYW A;  5L3E A;  2H1K A;  1V5G A;  1O57 A;  1Y0U A;  2FNA A;  3I53 A;  1R5H A;  3BLY A;  2GOM A;  3KP3 A;  2V1N A;  4EQQ A;  1F43 A;  4FAS D;  1FOK A;  4KYW A;  5DTD A;  2GXB A;  4P96 A;  5TJJ A;  2KRH A;  3OYH A;  3JRC A;  1IZ1 A;  2F5E A;  1Z6T A;  5FGM A;  3OS0 A;  2V1D A;  5CPR B;  2IPQ X;  2P6T A;  2X1E A;  5EGO B;  1BOB A;  3G73 A;  2C6Y A;  3CJT B;  1HDP A;  4XOR A;  4YIF A;  1W36 C;  2LBF B;  2EZK A;  1HXD A;  3GXO A;  3H3Z A;  4A0Z A;  4KFC A;  2D45 A;  2IA2 A;  1BR4 A;  5IT3 A;  1IN5 A;  2W84 A;  5KAF C;  4BJ5 C;  5FRM A;  3KEO A;  4CH7 A;  2R7Q A;  5E8I A;  2WAE A;  4AIH A;  4IQJ A;  2Z5U A;  4F7Z A;  3NAR A;  5DS9 A;  1LE8 A;  4NC6 A;  1ETQ A;  2VBX A;  2NOG A;  5HS9 A;  4M3D A;  3FWE A;  4QPO A;  3ZMT A;  2E71 A;  2DN0 A;  2R7Z J;  2NNY A;  1WJE A;  4DBQ A;  1K6O A;  2B9S A;  3V7S A;  2LRD A;  4A3J J;  3VOE A;  3RQ4 A;  2L54 A;  2WC2 A;  1K79 A;  1QZZ A;  4HV6 A;  1Y0N A;  1WHU A;  1PJR A;  5F0C A;  2ME0 A;  3E5U A;  1FYK A;  1QPI A;  3BTI A;  3LAJ A;  4ZYE A;  5DM6 F;  3NQO A;  3EUH A;  1L0O C;  3CO7 C;  3CJR B;  3ZR8 X;  3UNG C;  4BE0 A;  1GHC A;  2WBM A;  1KQ9 A;  2O3F A;  5TGT A;  4EJO A;  3DKX A;  3GO5 A;  1I3Q J;  3CCJ I;  2Q8K A;  4GRI A;  3GUD A;  3EUK L;  2IS6 A;  1DUX C;  2HKX A;  2JK3 A;  2VJJ A;  5FKK A;  1E3H A;  1ZHF A;  3IH2 A;  2HI3 A;  5CVV A;  4HX8 A;  1T95 A;  2WV1 A;  5L3F A;  2X4H A;  1D8K A;  1S7E A;  3PNY A;  4ENK A;  4BE2 A;  3N4M A;  4BY1 J;  4YFX F;  2XRN A;  4DOZ A;  1W7P D;  1T2K A;  4BQQ A;  2PMU A;  5HLH A;  4GXO A;  1IN8 A;  1MBK A;  1ZEL A;  4KDP A;  4L9N A;  2A3S A;  4IHV A;  4L5J A;  1E0E A;  1O3T A;  4UUV A;  2XAU A;  4KT5 C;  3CJN A;  4RB3 C;  1PYV A;  3S1M J;  5EF6 A;  3RYR A;  2XB5 A;  4V19 K;  2Q2E A;  5DCF A;  2Y9Y A;  3BG9 A;  3GME A;  3KP2 A;  3LSM A;  3WU0 A;  1XMX A;  2DTZ A;  1DU6 A;  4L18 B;  3SZG A;  2JMW A;  3VYS B;  4J01 A;  3ML6 A;  4YEL A;  1TWF J;  3JRA A;  1Z91 A;  4HA8 A;  2YU9 J;  1DP3 A;  3VYT B;  4M6Y A;  4Y33 A;  3LSK A;  1VTN C;  2LNB A;  3LA3 A;  4BGD A;  2PN6 A;  2QQA A;  2KL4 A;  1D0Z A;  5C4X J;  2WB1 N;  3E3V A;  3CCU I;  2W1O A;  1F9N A;  1QZE A;  2UZK A;  4A3E J;  2YS9 A;  4XLN F;  1HCR A;  2EIN H;  2VE8 A;  3PM1 A;  4RGR A;  1IGN A;  4MFE A;  4A5N A;  2QZ8 A;  5LBQ A;  2MD5 A;  1W7P B;  3DEE A;  2Y30 A;  4IRI A;  4LK0 F;  2W85 A;  1R58 A;  3WTW C;  2QBY B;  1WJB A;  4G6D A;  2F6C A;  2Y69 H;  4BAC A;  4ZTJ A;  9ANT A;  4RLF A;  3QWL A;  4D1Q A;  2ZXJ A;  1BW6 A;  4I6Z A;  3EUH C;  4IHW A;  2IGK A;  2L4M A;  2QKM B;  5IP9 J;  5ILV A;  1UZC A;  2IJL A;  2NYX A;  3F3X A;  4HOB A;  2K9M A;  2FNP A;  2XAH A;  4E6K G;  4CCO A;  1BIB A;  2XPV A;  5J1Y A;  3E0J B;  4LB6 B;  4OIQ F;  2ESN A;  1YYV A;  5HLI A;  4JBA A;  1ZN2 A;  5F08 A;  1J75 A;  3J80 K;  1IUY A;  5BPD A;  3H0D A;  1T8I A;  3E6D A;  1VQ8 I;  4XRS A;  2IRF G;  2VXD A;  2OUM A;  4ENN A;  2BW3 B;  3GYH X;  4L9J A;  1SMY F;  1LJ9 A;  3KPH A;  1XGM A;  2XAQ A;  3LSI A;  1W36 D;  5B66 C;  1BC7 C;  1YJW I;  4BEH A;  2XRL A;  3Q9S A;  2MSY A;  4XQF A;  2KIS A;  4FT8 A;  1XPX A;  1IRZ A;  2DK5 A;  1PUF B;  4XRM A;  2LC2 A;  1P4X A;  2KQR A;  3OR1 C;  1Z9C A;  3C2G A;  2H8W A;  1UB9 A;  3EQL F;  3U1D A;  1I6H J;  2H27 A;  3AG1 H;  1MKM A;  3I64 A;  3K2Z A;  3ZMV A;  5EEA A;  1JTX A;  3V4G A;  4XLA A;  1VQ5 I;  3KLN A;  4ZH4 F;  1B72 B;  1ON1 A;  2L9S A;  1Y6I A;  4ENJ A;  2UV1 A;  4ZDL A;  4I76 A;  2ESH A;  4ZYG A;  2E1N A;  4AUX A;  4NHJ A;  1ZGJ A;  1MH3 A;  2WA0 A;  3BQY A;  3FKJ A;  5CVU A;  1EH8 A;  4IJA A;  2RNJ A;  1XMK A;  2H1L A;  2FE3 A;  3C7J A;  1D0X A;  1HOM A;  5GTI C;  1X19 A;  1VQ9 I;  2ISY A;  2ZO4 A;  3GEZ A;  3L2R A;  2DT5 A;  4MEY F;  2P7C B;  1DPR A;  3MMY B;  1YW7 A;  2CV2 A;  4IOA F;  5M5W J;  3TDU C;  1XMA A;  1OQY A;  1ERD A;  1IV8 A;  1X1B A;  3DEW A;  3HTU A;  4DZP A;  4YG2 F;  1AU7 A;  1MBE A;  4DQ2 A;  3L2V A;  3HC7 A;  4HF0 A;  1T08 B;  1WKM A;  2JUC A;  4ABZ A;  4FET A;  3ASO H;  4IHT A;  1W0T A;  3HTS B;  1NTC A;  5KHD A;  1K4T A;  2MC3 A;  1W5S A;  3MN2 A;  1RR7 A;  3ECO A;  2XF5 A;  3R60 A;  2QSF X;  5ICG A;  1UCR A;  5F1R A;  1VQ4 I;  2CV1 A;  3CDH A;  4BXX J;  1YRN B;  4PFO A;  1ZH5 A;  2NVT J;  5GTH C;  3RSN A;  2QKL B;  4KIB A;  1VQ7 I;  3F8M A;  2LY1 A;  4BJ6 C;  3PJR A;  2YX7 A;  4L5I A;  3KP5 A;  2CMP A;  3G71 I;  2EFW A;  4S05 A;  2VC0 A;  2P0W A;  3FZV A;  3OYB A;  2GLO A;  4LJZ F;  2EZH A;  5A2Q K;  1XDU A;  3P7N A;  3MAJ A;  1R5I D;  4XON A;  1XSX A;  4I99 C;  3PO3 J;  4E7J A;  3M3Y J;  1ACI A;  2E36 A;  4F55 A;  2JJ7 A;  3A03 A;  4B3X A;  3G6E I;  3J80 Z;  3CLQ A;  3QP5 A;  4M3B A;  3HEF A;  4I98 B;  2TCT A;  2W25 A;  3SZP A;  1S5L C;  2PX9 A;  2Z3Y A;  3LSR A;  1IDZ A;  2M5W A;  3LSP A;  2V6E A;  2EV5 A;  2J5O A;  2O8K A;  4J19 A;  1P6R A;  2RAE A;  6PAX A;  3HGY A;  3HPH A;  3LQQ A;  2HXO A;  4N9I A;  1IRX A;  4XL9 A;  5L3B A;  2BZT A;  2XVC A;  1IXR C;  3LOC A;  5KVR A;  5AIP A;  3TOB A;  3DTK A;  3F6O A;  2DJI A;  1FLI A;  3RYP A;  2CFO A;  3F23 A;  1OMI A;  4RGU A;  3C18 A;  2A5Y B;  2HDW A;  3TP3 A;  1ZAR A;  4A0X A;  3K4M A;  3AG3 H;  3S93 A;  1GLN A;  3HOV J;  5LGT A;  2BY1 A;  2V7F A;  2DQL A;  3K1M A;  3KZY A;  5FO5 A;  1G6N A;  3BPV A;  4XRF A;  4LGW A;  4E7Z A;  2E1C A;  2X6W A;  1MNM C;  1G3S A;  4U7B A;  4AU7 A;  4EMS A;  3CF5 F;  3MKW B;  1GT0 C;  1IJW C;  1VQ6 I;  1R49 A;  5CVJ A;  3MZY A;  5D5X B;  2OJE D;  5H6Q A;  1ZGA A;  3K4J A;  4UVA A;  4RAG A;  2EZL A;  2QSG X;  1AKH B;  3TQN A;  1FT9 A;  2UWM A;  3I9V 2;  4IO9 F;  2EFQ A;  4M72 A;  5HNH A;  2Z1D A;  2UUZ A;  1D8J A;  3WGH A;  1MDM B;  1YG2 A;  3BR5 A;  3QYE A;  1CF7 A;  2QUF A;  3K70 C;  4HX7 A;  4NDL A;  2QGU A;  3QYB A;  1FSH A;  2WV0 A;  3JSP A;  2R7R A;  4G9Y A;  4Y4R A;  4DYR A;  3QU6 A;  5HLT A;  2DPD A;  4UUS A;  1Z7L A;  4CSW A;  2QQ9 A;  4HDV A;  4HLX A;  2CUE A;  2GIV A;  2HOS A;  1IXC A;  2ZJP F;  2Y31 A;  4AIK A;  2JWT A;  1WI9 A;  4OOI A;  1HLV A;  2JT1 A;  2KRC A;  1YS7 A;  2CQ7 A;  5DDG A;  3OYG A;  3M9A A;  1SFU A;  1BI0 A;  1FBU A;  2LTP A;  1XCB A;  2BE5 F;  5JLX A;  1GV2 A;  1MW7 A;  1QHG A;  2D2W A;  3ABT A;  3M1C A;  4YRV A;  3R6S A;  5LHI A;  3H36 A;  1U5T B;  3B6C A;  1OCP A;  2XAJ A;  3ISP A;  1EF4 A;  1YW9 A;  3WU1 B;  2L4A A;  1FC3 A;  2AQE A;  2OQR A;  3BG6 A;  4JQF A;  1JKP C;  1W5T A;  1OPC A;  3S32 A;  3VYU B;  2EFN A;  2QEX I;  2XIG A;  2OPT A;  5GAG J;  2VKD A;  3AFH A;  4ANJ A;  4CYD A;  3C2H A;  5A2Q Z;  2PJR B;  2VT2 A;  3AL0 B;  1QQI A;  2XKP A;  3H3V K;  4Y7N J;  3LWF A;  2HDD A;  2WY7 Q;  1JJ8 C;  2V9V A;  4ZZD A;  3CUQ B;  1X1A A;  4I7H A;  3BOQ A;  1XGO A;  4FCY A;  1EKE A;  3K2A A;  3ABU A;  1Z67 A;  3ZN0 A;  1WWX A;  4BQN A;  3DU5 A;  1QVT A;  1BI3 A;  3R4K A;  4B8X A;  1HW5 A;  4DW6 A;  1K78 A;  3B6A A;  3RKY A;  3QQA A;  4DBR A;  2VBY A;  3HB9 A;  1OCT C;  1VF9 A;  4CDG A;  3MCZ A;  1NK2 P;  3LMM A;  2AO9 A;  2NVX J;  2M3A A;  3S15 J;  2EH3 A;  1HKS A;  1R22 A;  4FE4 A;  4PJM A;  3DPU A;  1U6G A;  2O61 A;  1S7A A;  1W1W E;  1I5Z A;  4MTD A;  3RKQ A;  4A3I J;  1JKO C;  2OTJ I;  3RPQ A;  5JI6 A;  3J7A O;  4HDU A;  4XIC A;  2W82 A;  1PP8 F;  3FK7 A;  3GBG A;  2ZKZ A;  3RKW A;  5LD2 C;  5F0H A;  5HOO A;  1ZRD A;  2DPU A;  2QVO A;  1I39 A;  5HOD A;  1T0F A;  1LQ1 A;  4UUT A;  1FZP B;  3C3W A;  1U0J A;  1K61 A;  3RDI A;  2FU4 A;  3P5J A;  4QIW N;  2PFB A;  4UB6 C;  5DV5 A;  5GP9 A;  1RNL A;  2A05 A;  3CCM I;  4KUM A;  5KK1 A;  4O6J A;  2M30 A;  1B6A A;  1YIT I;  2IT0 A;  1WQ2 A;  1BI1 A;  1R6R A;  1Y56 A;  3FXR A;  1WCM J;  4RGX A;  2PMH A;  1H89 C;  2DA6 A;  4ZYA A;  1N78 A;  3ZQG A;  4ESF A;  1Z6R A;  1BW5 A;  3H5A A;  4RAZ A;  1RET A;  2K4B A;  3VPR A;  2WTE A;  2MAB A;  3SDG A;  5KNL A;  1A6Q A;  3Q0U A;  3A0B C;  5EZH A;  5D5V B;  1KZH A;  3V8J A;  2VJ4 A;  5K7Z A;  2IW5 A;  4D9J A;  2WAQ A;  1S8N A;  1LDJ A;  2CQX A;  2VUM J;  1JHF A;  3M8F A;  4NUB A;  1U3E M;  3TDZ C;  1TWH J;  1JXS A;  3F72 A;  4XLF A;  1B8I A;  2R7W A;  3G4S I;  1YE9 A;  1Z3X A;  2DLL A;  2Q0O A;  4B1R A;  5BQT A;  1MZB A;  4AWX B;  1B59 A;  4BNC A;  2BHZ A;  3CCE I;  1WFX A;  2CUJ A;  3K0L A;  1PUE E;  5J4V A;  4IZZ A;  2F5C A;  4G8X A;  3ABM H;  3FBN B;  1T98 A;  4B47 A;  3HGG A;  2F4I A;  3CMM A;  3MZ8 A;  1TT5 B;  4M6X A;  3HSF A;  1DGR M;  2TDX A;  3R61 A;  4XLC A;  1G3W A;  1JKQ C;  1T39 A;  3JRE A;  3GX4 X;  1JE8 A;  3HOZ J;  2V6C A;  3FF5 A;  3HHH A;  4DIQ A;  4ZDO A;  3GCM A;  4C2U A;  3BR6 A;  4A93 J;  1WZ2 A;  2EFP A;  5E1W A;  2P7V B;  2HOA A;  4CIC A;  3K70 D;  4BEH B;  4LLG F;  2QCO A;  4XKC A;  1E17 A;  3FM5 A;  1Z1D A;  3KYC B;  2OCE A;  2JZY A;  1AHD P;  3CDL A;  4DGW B;  1O7F A;  2CSO A;  2H09 A;  3KP4 A;  2WY8 Q;  3Q0V A;  4GDF A;  5GPA A;  2IGO A;  5J47 A;  3HOX J;  3GFI A;  3CCS I;  2ELJ A;  2DFF A;  2V1U A;  2MLG A;  3TO6 A;  2PMZ A;  3OMY A;  4KN4 X;  3V7C A;  1L3L A;  2X9D A;  1KU2 A;  1ETO A;  2X6X A;  3CP8 A;  2KDZ A;  2LD5 A;  4YEJ A;  1AWC A;  1T0F C;  3S2W A;  3IP4 B;  3V42 A;  1G4D A;  4RB0 A;  3M4O J;  3OOU A;  3HUG A;  3P9C A;  3HOW J;  4XBF A;  2DA7 A;  1G8X A;  2OZ6 A;  1SVL A;  1IC8 A;  3PUF A;  3H9G A;  4ITV A;  4EJV A;  3HM5 A;  4PJN A;  4Y15 A;  2VQL A;  3KIO A;  4FQG A;  3BTJ A;  2K9L A;  3HPG A;  3TP0 A;  5E3O A;  2G7H A;  1MMA A;  4BU2 A;  1KU7 A;  3HYI A;  1HDD C;  2HR3 A;  1IG7 A;  2FJ1 A;  5E3N A;  1U78 A;  1H9G A;  5BOX A;  1U8B A;  3G2B A;  4EM0 B;  1V5E A;  1HKQ A;  4G7O F;  2V1X A;  5IOZ A;  4X0G A;  2VC1 A;  4BKX A;  1BJZ A;  5K5R A;  1ZRF A;  5J3L A;  1S9H A;  3GFJ A;  4K2E A;  3OYM A;  3I59 A;  3GFL A;  4W1U A;  2ICW G;  3KP7 A;  4CZZ A;  4KT6 A;  1LKX A;  1HBX G;  1UHS A;  2E35 A;  4Y52 J;  2X48 A;  3E5Q A;  1P4W A;  4U7D A;  4EV0 A;  3H35 A;  1TZL A;  3BTC A;  3ZGK A;  5EJC A;  1XSD A;  3RZD J;  5FKM A;  2WAD A;  1T38 A;  2GA2 A;  5TIS C;  4HST A;  2EBI A;  3ZQQ A;  4CO8 A;  5JVT A;  3JRF A;  3BQZ A;  1FIA A;  5LHG A;  2STW A;  3WGI A;  4OIP F;  4X6A J;  1QZY A;  2DA3 A;  1ETV A;  3BR1 A;  4XLP F;  3H5N A;  3TL4 X;  4F93 B;  3ECH A;  4HRI A;  4ENM A;  4HYE A;  1ZLJ A;  2WAF A;  3PFI A;  1Q1H A;  2DCE A;  3DFG A;  1JUS A;  2FBH A;  1SFX A;  2VOO A;  1TQP A;  4D7M A;  2Y75 A;  4A5M A;  1JGG A;  3HDD A;  5F04 A;  4ON0 A;  5L3C A;  2M8E A;  3TMO A;  4TV7 A;  1WSU A;  4MQ9 F;  1Z3Y A;  4KIF A;  3OYL A;  2OCC H;  4NQW A;  2L7F P;  3IUO A;  4QSH A;  3KYD B;  5J40 A;  2J5P A;  4BUP A;  2VQG A;  1YW8 A;  1LEB A;  1TBX A;  4CCN A;  2K9Q A;  2RNG A;  1MH4 A;  1UG0 A;  3OYF A;  1TLH B;  5D6E A;  2WAQ N;  1TW3 A;  2IAI A;  3BR2 A;  3IWZ A;  2QSH X;  1F1Z A;  5IYD J;  3B73 A;  4M74 A;  5FFZ A;  3EET A;  4Q4Z F;  4HQE A;  3QP6 A;  1YFH A;  2ELK A;  4HX4 A;  5JLW A;  3FXM A;  1KU3 A;  1DPU A;  1OR7 A;  4PJJ A;  2P8T A;  3VYR B;  2HXI A;  4BY7 J;  5BS6 A;  2HDC A;  2FOW A;  4I0B A;  1RUN A;  3CES A;  4XOT A;  1Y1W J;  3SDB A;  4RDU A;  2E5N A;  4EM2 A;  2JA8 J;  1LDD A;  3ZXS A;  2ZCW A;  2DFH A;  3VSL A;  2HQA A;  2LFB A;  2VL8 A;  3QPL A;  4II2 A;  4HQM A;  3BTL A;  4GGG A;  1RZ4 A;  2VOD A;  2XAS A;  1BI2 A;  4GYG A;  1FWZ A;  2EFO A;  4Q5S F;  5LEK A;  2K02 A;  1IF1 A;  2HOE A;  2COB A;  1ZLK A;  4UUS B;  1J59 A;  2HYG D;  4RLQ A;  3S2H J;  3M07 A;  4BE1 A;  4OAY A;  3HRT A;  3OSG A;  1QBJ A;  2K86 A;  1OJL A;  2P5K A;  2RGV A;  5IP6 A;  4ZC3 A;  2BVM A;  2XPW A;  4MNU A;  3I0T A;  4LOC A;  2PMZ N;  1AA7 A;  4PDK A;  3ZQC A;  2A5W A;  2D1H A;  4BDY A;  3C1D A;  5BPI A;  1H88 C;  3M8E A;  3ZQ7 A;  1BC8 C;  2LYC A;  3MKZ A;  3CCQ I;  4J00 A;  2R7T A;  3SFI A;  3OIQ A;  3JR9 A;  1U9N A;  3F8N A;  3JAM K;  2KP6 A;  2L01 A;  5CJ9 A;  2LH9 A;  4CGZ A;  5GAH J;  2DAO A;  3HOY J;  2PEX A;  1YJN I;  2BXZ A;  3SJM A;  1WH5 A;  1K83 J;  2DA5 A;  1IW7 F;  3IWF A;  1MNE A;  5HS7 A;  4HZF A;  1AOY A;  1QNT A;  3HBL A;  3V8L A;  5HDK A;  1OFC X;  1FX7 A;  4OIO F;  2FQ4 A;  2ECC A;  5CVI A;  4L9V A;  2DMT A;  2XPU A;  1J0R A;  3K10 A;  5K1Y A;  1LUJ B;  1JGS A;  5DD8 A;  2G9W A;  3N97 A;  1RRJ A;  1FY7 A;  2LF7 A;  1J9I A;  1O3S A;  2KPM A;  2KZV A;  2FEZ A;  1STZ A;  3E6M A;  4WF2 A;  4E4H A;  4EAT A;  3WGG A;  4RM2 A;  5E3L A;  2K40 A;  2Y0S A;  1W4M A;  2W57 A;  4C3I J;  2E34 A;  3V7R A;  2GM4 A;  1BR2 A;  2NXN B;  2HNH A;  3FMS A;  1TWA J;  1IAW A;  3H9Q A;  2K27 A;  4G12 A;  4HV5 A;  2R5Y B;  4A3M J;  3T0Y A;  5IOY A;  3DF8 A;  3SXY A;  1U9O A;  5KCM A;  3CCL I;  1E3O C;  3HOU J;  4MGR A;  1VND A;  2P6S A;  1LVA A;  2ZME A;  2X1C A;  3K1N A;  3HOS A;  2I5U A;  3J7A Y;  2LY2 A;  1HKT A;  2GQQ A;  1TC3 C;  4NB5 A;  3W6V A;  2HFH A;  2HPI A;  1FIP A;  1WJC A;  5ICE A;  2E2I J;  1P7J A;  1B1B A;  4U0W A;  1WI3 A;  3FBI B;  1ZYR F;  4P9U A;  4ZZL A;  5L3G A;  3EYI A;  4M9X A;  2QA4 I;  3O2P E;  1YTY A;  3FKI J;  2R5Z A;  2LKP A;  3LNQ A;  4LG3 A;  5JVG F;  4D5C A;  2XB0 X;  4C2T A;  5F6F A;  3FXK A;  2CH0 A;  3WG9 A;  2HU9 A; 
#chains in the Genus database with same CATH homology
 1QGP A;  5L3D A;  3L9F A;  1RIO H;  3QPH A;  3HSR A;  5D6F A;  1HW1 A;  1K7A A;  1KU9 A;  1R5G A;  1R7J A;  4OMY A;  4LG0 B;  3F21 A;  5DEQ A;  4UVC A;  3HSE A;  2H6B A;  1FP2 A;  2H94 A;  3TKY A;  3T8R A;  5E18 F;  4AVP A;  5HDN A;  3M7G A;  3JAM Z;  1JHH A;  1S6L A;  3U9G A;  2ETH A;  2KKO A;  1J5Y A;  1ZG5 A;  4MEX F;  1XGS A;  2K7L A;  2BEO A;  1XSV A;  1NHA A;  2HQR A;  2MA3 A;  2VE9 A;  2ZNY A;  2P5V A;  1B9M A;  4U0Y A;  2XGX A;  3FMR A;  5LGN A;  3R0J A;  1PDN C;  1I6X A;  4Z2Y A;  2DFI A;  2YU3 A;  2OU2 A;  1GVJ A;  2CW0 F;  1A04 A;  2FMY A;  1IN7 A;  2XHK A;  2OAZ A;  2YR2 A;  3WTU C;  2ZBK A;  2R7F A;  2CO5 A;  2ADU A;  5D8L B;  4IRH A;  3Q9V A;  5HLG A;  1H0M A;  1BIA A;  4EJW A;  1DDN A;  2A6E F;  2GZW A;  3T8T A;  3WTY C;  2ZJ2 A;  3L2C A;  2RKH A;  4U0V A;  1XGN A;  5K5Q A;  3I4P A;  3TGN A;  2GXG A;  1ZG3 A;  2HWV A;  4FX4 A;  4A6E A;  2OBP A;  5J8F A;  2O03 A;  1ULY A;  1IRF A;  1Z7U A;  3JTG A;  1YO5 C;  4A2U A;  2Y48 A;  4KMF A;  4GO1 A;  1USS A;  5FD6 A;  4EJU A;  4KIC A;  3PQK A;  3L7W A;  2GAU A;  2JPB A;  1YLF A;  1E2X A;  2F5F A;  4EGZ A;  2VT3 A;  2EA2 A;  2A07 F;  3ZMS A;  1I1G A;  2XUB A;  3JSO A;  5J6X A;  1HST A;  1IXS B;  2W24 A;  4WCG A;  2VXZ A;  4MTE A;  3ERE D;  1C0W A;  1U2W A;  3EYY A;  3ZMD A;  3JW4 A;  3R0A A;  1G3Y A;  2OZU A;  2WWY A;  2HS5 A;  2PQ8 A;  2EWN A;  1ZRC A;  3ZPL A;  4G94 A;  3BJ6 A;  5LLQ A;  1KA8 A;  1TNS A;  2NNN A;  3FMQ A;  3KZZ A;  4Y13 A;  2QBY A;  3F22 A;  2XKO A;  4A0Y A;  1J2X A;  2DI3 A;  5LEJ A;  2KJB A;  4EVI A;  3RJP A;  4BHB A;  1X3U A;  4OMZ A;  3BJO A;  3VFZ A;  1F5T A;  2FBI A;  2HZT A;  3CLO A;  4RAY A;  1FYM A;  4OU0 A;  4BH9 A;  3D0S A;  4M73 A;  4HAM A;  2OD5 A;  3DPT A;  2LSO A;  1RUO A;  2COM A;  3DEU A;  2OQG A;  1UHM A;  3LAP A;  5JHU A;  3HOT A;  4WXD A;  5BMZ A;  2M45 A;  4WX9 A;  1XB4 A;  4RS8 A;  2DW4 A;  1BN5 A;  3D5L A;  4GCV A;  2KIU A;  2UXX A;  2L02 A;  1XCV A;  2PG4 A;  3P9K A;  2CYY A;  3VOD A;  1KYW A;  1R1T A;  1LB2 A;  5F64 A;  5HS8 A;  1EH7 A;  5D8K B;  2FOK A;  4KN7 X;  5ICF A;  2AXL A;  3DPL C;  3L00 A;  2RVC A;  5EEH A;  4LLN A;  1R1V A;  1U8R A;  3WE3 A;  2RC4 A;  5ILS A;  2DBB A;  4R1H A;  4KNY A;  4N9H A;  1G3T A;  2CWE A;  2AS5 F;  3QU3 A;  3BWG A;  4R79 A;  1ZAO A;  3IKT A;  3ZP5 A;  1XD7 A;  2F2E A;  2BV6 A;  4PGG A;  1HW2 A;  2EK5 A;  3W6J B;  3HRS A;  2M87 A;  3F8C A;  2R7D A;  1IN4 A;  2HQN A;  4RB1 A;  1RI7 A;  4FHT A;  3J81 K;  4RB2 C;  2CQK A;  4IVN A;  1BOA A;  4BHC A;  3FXQ A;  4MHG A;  2QQB A;  4RGS A;  1FPQ A;  3F8B A;  1I1S A;  1FBS A;  4Q48 A;  1OYI A;  2EA4 A;  3IC7 A;  4O5V A;  1B4A A;  2FRH A;  1LEA A;  5FB2 A;  4LMY A;  1J7K A;  4G7Z F;  1TQM A;  4E70 A;  2NAZ A;  3DKW A;  3KCC A;  4EGY A;  3QRF F;  2YPR A;  2GWR A;  4B09 A;  3U2R A;  2Z33 A;  2MH9 A;  2PLY A;  3TOA A;  2XRO A;  2HKO A;  2XV4 S;  3MZH A;  4GYI A;  1FP1 D;  1SFE A;  3DXJ F;  4QLC U;  4UV9 A;  2KIM A;  3RIR A;  1MDM A;  1YIO A;  2MBF A;  2IVM A;  2PJP A;  3RPU A;  2CFX A;  2BGC A;  3JTH A;  4KA4 A;  3MFK A;  3ULQ B;  3FXU A;  2F5D A;  3IKV A;  4AD9 A;  1BM9 A;  3ZMU A;  4HBL A;  1EV7 A;  3I5U A;  1SMT A;  3RI4 A;  1U5T A;  3I71 A;  4OIN F;  5IT9 K;  3MWM A;  1OYY A;  2DK8 A;  2FXA A;  2FSW A;  2GA1 A;  4BYY A;  1HQC A;  4BQA A;  5DCM A;  4OIR F;  4IHS A;  3TO7 A;  3O3K A;  3J81 Z;  5FFX A;  3CUQ A;  1KYZ A;  2E7W A;  3K9T A;  5K5O A;  1CF7 B;  3GLX A;  1R36 A;  5AON A;  1O3R A;  2YSR A;  3CUO A;  3BDD A;  2ISZ A;  3E6C C;  5ILU A;  2BBY A;  1KGS A;  2NRA C;  4N0B A;  5AIQ A;  2M1B A;  4U88 A;  3HIF A;  2CG4 A;  5E1Z B;  2CGP A;  4L0Z B;  2A61 A;  4LFU A;  2EV6 A;  1MGT A;  1Z05 A;  1MD0 A;  4I01 A;  3MQ0 A;  4PGH A;  1P4A A;  3WTV C;  2Z9O A;  1H9T A;  3T5X A;  1K78 B;  3K69 A;  1DP7 P;  1KQ8 A;  1SD5 A;  4IF4 A;  3BPX A;  3IHU A;  5DYM A;  2G7U A;  2OA4 A;  2Y0M A;  2MLK A;  4XSX F;  4HF1 A;  2EB7 A;  4G7H F;  3WTX C;  2P4W A;  3WTZ A;  1V4R A;  1HSJ A;  1U5T C;  2ZNZ A;  2VN2 A;  3T1B A;  5JFR A;  2LF8 A;  4IPA A;  2VBZ A;  2DU9 A;  5ED4 A;  5D5W B;  1T6S A;  3EDP A;  5IT9 Z;  3BRO A;  3Q5F A;  3CUQ C;  2VBW A;  3KLO A;  3E97 A;  3HHG A;  1LNW A;  2ZFW A;  4CHU A;  2QLZ A;  4YFK F;  1TNT A;  5D5U B;  2EJR A;  2H6C A;  5D4S A;  2P5L C;  4QWQ A;  4UVB A;  2KJC A;  3NRV A;  4H0E A;  3F8F A;  4G6Q A;  2QM3 A;  5LRR A;  2ACJ A;  4ETS A;  4M9S A;  3FHZ A;  3GZ5 A;  5ERI A;  2YX4 A;  1MJA A;  1TW2 A;  4HW0 A;  3VB2 A;  4ZYD A;  5LHH A;  4M71 A;  2Z99 A;  4YII A;  4DNC A;  2O8X A;  4ESB A;  4I2O A;  5LGU A;  2JRT A;  2LDU A;  1IRG A;  1SD7 A;  3F6V A;  3BZ6 A;  5CVR A;  3QAH A;  1UFM A;  2KIF A;  3E6B A;  4P55 A;  1QO0 D;  3LST A;  2DQR A;  1BJA A;  4Q47 A;  4BXU A;  1P92 A;  2O6G E;  2PBI A;  2X0L A;  3I54 A;  1F4K A;  1PP7 U;  2QWW A;  5E8G A;  5E1X A;  4BHP A;  1OKR A;  3ROU A;  1XN7 A;  5DD4 A;  1ON2 A;  4R8H A;  4S04 A;  2PI0 A;  5HVQ C;  4M9Z A;  3HRU A;  3H3U A;  3KET A;  3GVA A;  2MH2 A;  3ELK A;  4MQV A;  3FX3 A;  4LK1 F;  2RDP A;  2JSC A;  3SZT A;  4LLL A;  3HRM A;  2JPC A;  4JK1 X;  1B9N A;  1REP C;  3GFM A;  2FA5 A;  3GF2 A;  2KRF A;  2V79 A;  4UHT A;  2HTS A;  3DV8 A;  3W6K B;  2FBK A;  2EV0 A;  3M1E A;  3I59 B;  3H92 A;  5CYV A;  2A6H F;  2O0Y A;  1GXQ A;  4IXA A;  1MJ9 A;  4D0P A;  3BY6 A;  4L9T A;  2QYO A;  2XAF A;  3CTA A;  2VON A;  1LDK B;  1S7O A;  2HTJ A;  5HDG A;  4WWC A;  2STT A;  3AAF A;  3DP7 A;  3QOP A;  3RKX A;  1ODD A;  3G3Z A;  3WE2 A;  2HGC A;  2UXN A;  3WOD F;  2K4J A;  3VEP A;  1FBQ A;  4O3M A;  4WXH A;  3K1P A;  1P2F A;  3V8K A;  2HYF A;  1QPM A;  1UST A;  2QEN A;  4BAY A;  4ESJ A;  1TTY A;  1ZG1 A;  3I58 A;  4HLY A;  2A69 F;  3IRQ A;  5JR3 A;  4EJT A;  2D1V A;  4Y17 A;  4I09 A;  1D3Y A;  2FF4 A;  3BP8 A;  4P5O A;  1FSE A;  3SQN A;  3LFK A;  3FM3 A;  5ICC A;  3P9I A;  1XDS A;  4PCQ A;  5DCM B;  1R00 A;  4ASN A;  1SD6 A;  3GZ6 A;  1W7P A;  1O7L A;  2BYV E;  2B0L A;  2IP2 A;  5H6R A;  3KP6 A;  5FD5 A;  5E17 F;  3KEQ A;  3IL2 A;  3BJA A;  3KFW X;  4PZJ A;  1I27 A;  4EM1 A;  1SAX A;  4WXC A;  1R1U A;  3E5X A;  4A6D A;  3KE2 A;  5FLX K;  4IRG A;  3RTR A;  4YFN F;  5CLS A;  3B02 A;  1EH6 A;  1MJB A;  1TQI A;  1BBY A;  3LA2 A;  2DTR A;  5H20 A;  4I02 A;  3LA7 A;  4UNO A;  3OOP A;  3GWZ A;  4CXF A;  2FML A;  2VOP A;  4L0Y B;  1D5V A;  3WTS C;  5DUK A;  1WRJ A;  2RQP A;  1S29 A;  2RV8 A;  1FYL A;  1R23 A;  2RN7 A;  1V3F A;  4LG0 A;  2IA1 A;  1ONV A;  4AIJ A;  4LB5 A;  2DO7 A;  5LRS A;  2R3S A;  4XSZ F;  5D4R A;  4KMU X;  3TO9 A;  2ZME B;  3GW2 A;  1YQA A;  3WTT C;  1SD4 A;  4UXN A;  4HF2 A;  3ZN1 A;  3MEX A;  1FNN A;  3NEU A;  2ELH A;  1UHW A;  3OV8 A;  1KQ0 A;  1IN6 A;  1YS6 A;  4KIG A;  3ZMZ A;  2E7X A;  3SFZ A;  3QPT A;  4FX0 A;  4LD5 A;  2L3D A;  4UV8 A;  5E20 A;  3LQR A;  4A12 A;  3O6B B;  3SHF A;  3IRR A;  3PQJ A;  1S3J A;  2JTV A;  5FLX Z;  2A68 F;  3L09 A;  4I0A A;  3REO A;  1ZRE A;  1CGP A;  5EEG A;  5TRD A;  4ZYH A;  2XAG A;  2NS0 A;  1GXP A;  2HEO A;  5DUI A;  2IA0 A;  4P9F A;  3CO6 C;  3DQV C;  2FQ3 A;  3COA C;  1O3Q A;  4WK8 F;  5J8C A;  1OYW A;  5L3E A;  1O57 A;  1Y0U A;  2FNA A;  3I53 A;  1R5H A;  3KP3 A;  4EQQ A;  4KYW A;  1FOK A;  2GXB A;  4P96 A;  5TJJ A;  1IZ1 A;  2F5E A;  1Z6T A;  5FGM A;  2V1D A;  2IPQ X;  2P6T A;  3G73 A;  2C6Y A;  4YIF A;  3H3Z A;  1HXD A;  3GXO A;  4KFC A;  4A0Z A;  2D45 A;  2IA2 A;  5IT3 A;  1IN5 A;  2W84 A;  3KEO A;  5E8I A;  4AIH A;  2Z5U A;  4F7Z A;  2VBX A;  5HS9 A;  3FWE A;  3ZMT A;  2NNY A;  1K6O A;  3V7S A;  3VOE A;  2L54 A;  2WC2 A;  1K79 A;  1QZZ A;  4HV6 A;  3E5U A;  1FYK A;  3LAJ A;  4ZYE A;  3NQO A;  3EUH A;  1L0O C;  3CO7 C;  1GHC A;  1KQ9 A;  2O3F A;  4EJO A;  3GO5 A;  2Q8K A;  3GUD A;  1DUX C;  2HKX A;  1ZHF A;  5CVV A;  4HX8 A;  5L3F A;  2X4H A;  1D8K A;  4ENK A;  3N4M A;  4YFX F;  2XRN A;  1W7P D;  1T2K A;  2PMU A;  5HLH A;  4GXO A;  1IN8 A;  4KDP A;  4L9N A;  2A3S A;  4L5J A;  1O3T A;  4UUV A;  4KT5 C;  3CJN A;  4RB3 C;  3RYR A;  2Q2E A;  5DCF A;  3KP2 A;  3WU0 A;  4L18 B;  3ML6 A;  1Z91 A;  4HA8 A;  4M6Y A;  1VTN C;  2LNB A;  3LA3 A;  2PN6 A;  2QQA A;  3E3V A;  2UZK A;  1F9N A;  4XLN F;  2VE8 A;  4RGR A;  4A5N A;  2QZ8 A;  5LBQ A;  2MD5 A;  1W7P B;  4IRI A;  4LK0 F;  2W85 A;  1R58 A;  3WTW C;  2QBY B;  4G6D A;  2ZXJ A;  2L4M A;  5ILV A;  2IJL A;  2NYX A;  3F3X A;  4HOB A;  2FNP A;  2XAH A;  1BIB A;  4LB6 B;  4OIQ F;  2ESN A;  1YYV A;  5HLI A;  4JBA A;  1ZN2 A;  1J75 A;  3J80 K;  1IUY A;  5BPD A;  3E6D A;  2IRF G;  4ENN A;  3GYH X;  4L9J A;  1SMY F;  1LJ9 A;  1XGM A;  2XAQ A;  1BC7 C;  3Q9S A;  4FT8 A;  2DK5 A;  1P4X A;  1Z9C A;  1UB9 A;  3EQL F;  3U1D A;  2H27 A;  1MKM A;  3I64 A;  3K2Z A;  3ZMV A;  3V4G A;  3KLN A;  4ZH4 F;  1ON1 A;  4ENJ A;  2ESH A;  4ZYG A;  2E1N A;  4NHJ A;  1ZGJ A;  5CVU A;  1EH8 A;  4IJA A;  2RNJ A;  1XMK A;  2FE3 A;  3C7J A;  2ISY A;  2ZO4 A;  3GEZ A;  2DT5 A;  4MEY F;  2P7C B;  1DPR A;  1YW7 A;  3TDU C;  1XMA A;  4YG2 F;  3HTU A;  4DQ2 A;  4HF0 A;  1WKM A;  4IHT A;  3HTS B;  2MC3 A;  1W5S A;  3ECO A;  3R60 A;  5ICG A;  1UCR A;  5F1R A;  3CDH A;  1ZH5 A;  4KIB A;  3F8M A;  2YX7 A;  4L5I A;  3KP5 A;  2EFW A;  4S05 A;  2VC0 A;  3FZV A;  4LJZ F;  5A2Q K;  1XDU A;  3P7N A;  3MAJ A;  1XSX A;  3J80 Z;  3QP5 A;  4I98 B;  2W25 A;  3SZP A;  2Z3Y A;  2M5W A;  2EV5 A;  2J5O A;  1P6R A;  6PAX A;  3LQQ A;  4N9I A;  5L3B A;  2XVC A;  1IXR C;  5KVR A;  5AIP A;  3TOB A;  3F6O A;  1FLI A;  3RYP A;  3F23 A;  1OMI A;  4RGU A;  3C18 A;  2A5Y B;  1ZAR A;  4A0X A;  5LGT A;  2DQL A;  3K1M A;  3KZY A;  5FO5 A;  1G6N A;  3BPV A;  4XRF A;  4LGW A;  2E1C A;  1G3S A;  4U7B A;  4EMS A;  5CVJ A;  3MZY A;  5D5X B;  5H6Q A;  1ZGA A;  4UVA A;  3TQN A;  1FT9 A;  2UWM A;  2EFQ A;  4M72 A;  1D8J A;  3WGH A;  1MDM B;  1YG2 A;  1CF7 A;  2QUF A;  4HX7 A;  1FSH A;  2WV0 A;  3JSP A;  4G9Y A;  3QU6 A;  2DPD A;  4HDV A;  2QQ9 A;  4HLX A;  2GIV A;  1IXC A;  4AIK A;  1WI9 A;  4OOI A;  2JT1 A;  1YS7 A;  5DDG A;  1SFU A;  3M9A A;  1BI0 A;  1FBU A;  1XCB A;  2BE5 F;  3ABT A;  2D2W A;  3R6S A;  5LHI A;  1U5T B;  2XAJ A;  3ISP A;  1YW9 A;  3WU1 B;  2L4A A;  1FC3 A;  4JQF A;  2OQR A;  1W5T A;  1OPC A;  2EFN A;  2XIG A;  4CYD A;  5A2Q Z;  2VT2 A;  1QQI A;  2XKP A;  3LWF A;  2V9V A;  4ZZD A;  3CUQ B;  4I7H A;  3BOQ A;  1XGO A;  3ABU A;  3ZN0 A;  1WWX A;  1BI3 A;  3R4K A;  4B8X A;  1HW5 A;  1K78 A;  3RKY A;  2VBY A;  4CDG A;  3MCZ A;  1HKS A;  1R22 A;  2O61 A;  1U6G A;  1S7A A;  1I5Z A;  4MTD A;  3RPQ A;  5JI6 A;  3J7A O;  4HDU A;  1PP8 F;  2ZKZ A;  3RKW A;  5HOO A;  1ZRD A;  2DPU A;  2QVO A;  1T0F A;  1LQ1 A;  1FZP B;  3C3W A;  3RDI A;  2FU4 A;  2PFB A;  5DV5 A;  1RNL A;  4KUM A;  5KK1 A;  4O6J A;  2M30 A;  1B6A A;  2IT0 A;  1WQ2 A;  1BI1 A;  3FXR A;  4RGX A;  2PMH A;  4ESF A;  1Z6R A;  4RAZ A;  2K4B A;  2WTE A;  5D5V B;  3V8J A;  2IW5 A;  1S8N A;  1LDJ A;  1JHF A;  3M8F A;  1JXS A;  1U3E M;  3TDZ C;  3F72 A;  2Q0O A;  5BQT A;  2DLL A;  1MZB A;  4AWX B;  1B59 A;  4BNC A;  3K0L A;  1PUE E;  2F5C A;  4G8X A;  1T98 A;  4M6X A;  3HSF A;  2TDX A;  3R61 A;  1G3W A;  1T39 A;  3GX4 X;  1JE8 A;  2V6C A;  3FF5 A;  3HHH A;  2EFP A;  5E1W A;  2P7V B;  4CIC A;  4LLG F;  1E17 A;  3FM5 A;  1Z1D A;  2JZY A;  1O7F A;  2CSO A;  2H09 A;  3KP4 A;  3GFI A;  2V1U A;  2MLG A;  3TO6 A;  3V7C A;  1L3L A;  4KN4 X;  1KU2 A;  1AWC A;  3S2W A;  1G4D A;  4RB0 A;  3HUG A;  3P9C A;  4XBF A;  2OZ6 A;  4EJV A;  4Y15 A;  2G7H A;  1KU7 A;  3HYI A;  2HR3 A;  1U78 A;  1H9G A;  5BOX A;  4EM0 B;  4G7O F;  1HKQ A;  2V1X A;  2VC1 A;  5K5R A;  1ZRF A;  3GFJ A;  4K2E A;  3I59 A;  3GFL A;  3KP7 A;  4CZZ A;  1HBX G;  3E5Q A;  1P4W A;  4U7D A;  4EV0 A;  1XSD A;  1T38 A;  2GA2 A;  5JVT A;  4CO8 A;  5LHG A;  2STW A;  3WGI A;  4OIP F;  1QZY A;  4XLP F;  3ECH A;  4ENM A;  4HYE A;  1ZLJ A;  3PFI A;  1Q1H A;  3DFG A;  2FBH A;  1SFX A;  2VOO A;  1TQP A;  2Y75 A;  4A5M A;  4ON0 A;  5L3C A;  2M8E A;  4TV7 A;  1WSU A;  4MQ9 F;  4KIF A;  4NQW A;  2J5P A;  1YW8 A;  1LEB A;  1TBX A;  1TLH B;  5D6E A;  1TW3 A;  3IWZ A;  1F1Z A;  3B73 A;  4M74 A;  5FFZ A;  3EET A;  4Q4Z F;  4HQE A;  3QP6 A;  1YFH A;  4HX4 A;  1KU3 A;  1DPU A;  1OR7 A;  5BS6 A;  2P8T A;  2HDC A;  4I0B A;  1RUN A;  4EM2 A;  1LDD A;  2ZCW A;  4HQM A;  4GGG A;  1RZ4 A;  2VOD A;  2XAS A;  1BI2 A;  4GYG A;  1FWZ A;  2EFO A;  4Q5S F;  5LEK A;  2K02 A;  1IF1 A;  2HOE A;  1ZLK A;  1J59 A;  2HYG D;  3HRT A;  1QBJ A;  2K86 A;  2P5K A;  2RGV A;  4MNU A;  3I0T A;  4PDK A;  2D1H A;  3C1D A;  5BPI A;  3M8E A;  3ZQ7 A;  1BC8 C;  3F8N A;  3JAM K;  2L01 A;  5CJ9 A;  4CGZ A;  2DAO A;  2PEX A;  3IWF A;  1IW7 F;  5HS7 A;  4HZF A;  1AOY A;  1QNT A;  3V8L A;  5HDK A;  1FX7 A;  4OIO F;  5CVI A;  4L9V A;  5K1Y A;  1J0R A;  1JGS A;  5DD8 A;  2G9W A;  3N97 A;  1FY7 A;  2LF7 A;  1J9I A;  1O3S A;  4WF2 A;  2FEZ A;  1STZ A;  3E6M A;  3WGG A;  1W4M A;  2W57 A;  3V7R A;  3FMS A;  1IAW A;  2K27 A;  4HV5 A;  3T0Y A;  3DF8 A;  3SXY A;  4MGR A;  2P6S A;  1LVA A;  2ZME A;  3K1N A;  3HOS A;  1HKT A;  2GQQ A;  4NB5 A;  2HFH A;  5ICE A;  1B1B A;  4U0W A;  1ZYR F;  4P9U A;  4ZZL A;  5L3G A;  3EYI A;  4M9X A;  3O2P E;  1YTY A;  2LKP A;  5F6F A;  3WG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...