3NEUA

The crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
NPTFHADKPIYSQISDWMKKQMITGEWKGEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMGSFVTSDKALFDQLKKELADAITERFLEEAKSIGLDDQTAIELLIKRSRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin1836 protein
publication title The crystal structure of a functionally-unknown protein lin1836 from Listeria innocua Clip11262
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 41
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3neuA01
5D5UB 3KP6A 4RGRA 3BPXA 5LBQA 5LHGA 2F5FA 3PQKA 2F5CA 2M45A 2CG4A 3ZPLA 5E20A 2EV6A 2R7DA 3K1MA 4LLNA 1XSVA 4ZYHA 2GXBA 2JPCA 4GO1A 4G7ZF 4WF2A 3GXOA 1EH8A 1ZARA 2RKHA 4MGRA 4ESBA 2KIUA 5K1YA 3H3ZA 2LF8A 5EEGA 2M1BA 4BQAA 2OD5A 2HS5A 3EUHA 1P4XA 2CSOA 2RVCA 4BYYA 2EB7A 2P7VB 2HTSA 1LVAA 3T8TA 4M71A 1WQ2A 2BEOA 3J81Z 3J80K 4IHTA 4P5OA 1TNSA 2RV8A 2ADUA 4CXFA 5LEKA 1I27A 2XIGA 3DXJF 2IA2A 3M1EA 1U8RA 4U7DA 2K4JA 1H9GA 1DDNA 4AVPA 4EV0A 3OOPA 1KU3A 3C18A 1PP7U 2XKOA 5LGUA 2HKXA 1Z1DA 3F8MA 4GYIA 1XMAA 2PEXA 1XGOA 1REPC 3HIFA 4Q48A 1MJ9A 3RIRA 4Q5SF 5DYMA 4G6QA 1S7AA 3KLNA 2LNBA 1B59A 2XV4S 1J9IA 1P4WA 4ENKA 2NAZA 4U0YA 5HS9A 3HRSA 2FEZA 1U2WA 3HSEA 2HYGD 1IN7A 2E1CA 4P96A 3LFKA 2M5WA 1E2XA 3I4PA 3ZQ7A 1E17A 2DI3A 1DPRA 4IRIA 5LRRA 1LQ1A 3L00A 5L3FA 2KIFA 3WODF 5D8KB 3WTSC 4L9VA 4UXNA 1R00A 1T2KA 4WWCA 5DCMB 1R7JA 2D2WA 2YR2A 4HV6A 2G9WA 2IW5A 3V4GA 1C0WA 1TQMA 2BE5F 5D5VB 2FE3A 3HRUA 5FFXA 1OYWA 5CJ9A 1BI0A 5E17F 3SXYA 3F22A 1YW8A 2D1VA 3M7GA 1CF7A 5AIQA 2A6HF 3SFZA 3J81K 2WTEA 1EV7A 2EFOA 3IKTA 2GIVA 2CGPA 1T98A 3KP3A 4EQQA 2K86A 4N0BA 4RGUA 1G3YA 4HLYA 2HZTA 1R1VA 1Z9CA 1R36A 4WXHA 4WX9A 1J59A 1RUNA 2L3DA 1V4RA 1LJ9A 1P4AA 1JE8A 3T1BA 3I5UA 2FBKA 2IJLA 1YTYA 4N9IA 1MDMA 1XN7A 1ZN2A 3R4KA 5E8IA 2VOOA 1K79A 1O7FA 4OINF 2G7UA 2MC3A 4HF1A 3GFMA 1F9NA 2L01A 4BNCA 2L54A 4HQEA 5DUKA 3QU3A 2CW0F 2GWRA 4EM0B 2VT3A 2L4AA 1DPUA 2PJPA 5HLGA 5TJJA 3VEPA 4GCVA 3TO7A 1IAWA 5JVTA 4NQWA 3BOQA 3CUQB 4IRGA 4EGYA 2ZBKA 1FP1D 1XSDA 4Y17A 3TDZC 1O57A 1SFUA 1FYKA 4RGSA 3WG9A 4QLCU 1YYVA 2XHKA 1TQIA 1GHCA 1FYLA 1J75A 2EA2A 3CJNA 1ZRCA 3WTTC 4NHJA 2OA4A 1W7PA 1SD6A 4Z2YA 3K69A 1R1TA 3R60A 2Z33A 2W84A 3BP8A 5D8LB 2OQRA 3DF8A 4YG2F 1XDUA 3GX4X 2HQNA 2NYXA 1XGSA 2D45A 3K0LA 5CVIA 2DPUA 2GQQA 1W7PD 1USSA 2O03A 3CUQC 3BZ6A 4L0YB 2FQ3A 3GFIA 1SD4A 5ILSA 3I64A 3LAJA 1H9TA 3IRRA 4EJTA 4FHTA 4I01A 4IXAA 1HXDA 3WTUC 1I5ZA 4KT5C 1J5YA 4U88A 3GFLA 4YFKF 2PBIA 1QGPA 1WSUA 5DCFA 1MJAA 3IL2A 1MGTA 4G9YA 3RYRA 3BJAA 3RI4A 1ODDA 3DFGA 5BS6A 5HLHA 4WXCA 2HOEA 2OBPA 3QP6A 4DQ2A 1D3YA 3I58A 1R23A 2EV0A 5L3BA 3R0AA 3NEUA 2FU4A 2FNPA 1R5GA 3F6VA 1Z7UA 3SZPA 3LSTA 2XAQA 4JQFA 2VBZA 1TBXA 1HBXG 1ZLKA 2K4BA 5D5XB 1G6NA 4ASNA 2QYOA 1OKRA 4KFCA 2XAFA 3VB2A 1R5HA 4HYEA 5ICFA 5H20A 2V6CA 1YLFA 3B02A 3JAMK 3K1NA 5E1ZB 3H92A 4S04A 4E70A 1O3RA 1PP8F 3WE2A 3E6DA 1K6OA 2ISYA 2W85A 5CVJA 2Q2EA 3EYIA 2MD5A 3ROUA 4YIIA 3J7AO 4ENJA 3WTWC 3J80Z 1EH6A 2IVMA 4RB1A 3QP5A 4A5MA 2DQLA 2NNNA 3L9FA 1HKQA 2K27A 4CZZA 3E6BA 3BWGA 3GW2A 2NS0A 1IRGA 1XGNA 4F7ZA 1I1SA 3C1DA 5ICCA 3CO6C 3WTVC 2O61A 3JSOA 1XSXA 2K02A 4U0WA 5K5QA 1TLHB 2J5PA 2R3SA 3V7CA 2RN7A 2ZCWA 2ZJ2A 2HTJA 3FMQA 4AWXB 4LGWA 4MNUA 4RAYA 1CF7B 4CHUA 2HKOA 3E5QA 4BHPA 2VOPA 3FMRA 5LLQA 2E7WA 4LMYA 2M8EA 4OIOF 3ZMUA 4EVIA 1FYMA 2XAGA 4I09A 4YFNF 1ZLJA 1FPQA 3QOPA 2ELHA 4LLLA 1IXCA 3FM3A 1MDMB 3F3XA 3KCCA 2FBIA 3BDDA 1GVJA 1LDKB 5E1WA 2HGCA 2MH9A 2JTVA 3V8LA 4UV8A 1IRFA 3ZMDA 4OIPF 2GXGA 1ZRFA 1JHFA 2CQKA 3TO9A 1OR7A 4BHCA 3V7SA 2C6YA 3FM5A 2PG4A 1F5TA 4NB5A 3VFZA 2G7HA 3DPTA 3ZN1A 1TQPA 5FD5A 1W5TA 2PMHA 2ZFWA 3RTRA 1ZG3A 1FY7A 3RPQA 1UCRA 3FX3A 4O3MA 3K9TA 2LKPA 3GZ6A 2HEOA 2L02A 1AOYA 3CLOA 2QM3A 5HS7A 5L3DA 1T39A 2CFXA 5ILUA 1TW3A 2PQ8A 2FMLA 4PCQA 4Y13A 5LEJA 4XLPF 1FWZA 1J2XA 1SD5A 4IRHA 4UV9A 4OIRF 1W7PB 2A68F 2MLGA 3BJOA 3FWEA 1IUYA 1QZYA 3MZHA 2EV5A 2H27A 3O2PE 3JTGA 2FXAA 2IT0A 1R58A 2UWMA 2RDPA 5BQTA 1TTYA 3LWFA 5HDGA 4EJWA 3LQQA 3QAHA 3BY6A 2FRHA 1J7KA 3E3VA 3ZMTA 2H6CA 3MWMA 4M73A 3P9IA 1ZG5A 2ESHA 1UFMA 3D5LA 3HHHA 2W57A 3IHUA 4RB0A 1FBQA 1SMTA 2L4MA 3KP5A 4KYWA 3GWZA 4KUMA 4BAYA 1OYIA 3I59B 2FSWA 3Q9VA 1EH7A 2V1UA 2PI0A 1P6RA 2IA0A 3FXRA 2DBBA 1LNWA 4LB6B 2HFHA 5AONA 2P6SA 4JK1X 3WTYC 1FSHA 2A69F 3CO7C 1J0RA 4YIFA 3MCZA 2WC2A 3LAPA 4HX7A 3QPHA 5DDGA 4UVCA 3EDPA 2F2EA 4L5JA 3I0TA 4KN7X 5H6RA 5K5RA 4YFXF 4ON0A 3TGNA 2A5YB 4MHGA 3KP7A 5J8FA 4B09A 1BN5A 2VXZA 5F1RA 2B0LA 2XROA 4BXUA 3RYPA 5LRSA 3IC7A 2WV0A 5FO5A 2O0YA 1ZGAA 3WTXC 3JSPA 5KVRA 3F8FA 3MFKA 4A6EA 3ECOA 1Z6RA 3W6JB 4HDVA 1BC8C 3HSRA 3WTZA 3IKVA 5JFRA 3L2CA 2RQPA 4M9ZA 2YU3A 4O6JA 1HW5A 4EMSA 3RJPA 1ON1A 1YW9A 3KLOA 1I1GA 3QRFF 2Y48A 3KEOA 4CGZA 1K7AA 1ZH5A 4S05A 2DK8A 4ZH4F 1WKMA 4HX4A 4G8XA 3REOA 3HUGA 2MLKA 1UHWA 2VONA 2KJBA 1IXRC 3DEUA 4XLNF 3JAMZ 3KZZA 3M8FA 5HDKA 1QPMA 1KQ9A 4MTEA 1MJBA 4P9UA 1BM9A 2COMA 2VBYA 2A61A 2ZO4A 5KK1A 3H3UA 2QVOA 1S7OA 4RGXA 2PN6A 3F23A 3GVAA 4CYDA 1HKSA 2RC4A 3ECHA 2BV6A 1YFHA 2ZNZA 3F21A 5JR3A 4HV5A 4HLXA 2P5KA 4M74A 1S6LA 1HW1A 4A6DA 2YX4A 3FF5A 4KIGA 1OYYA 2JPBA 2A07F 5J6XA 2YSRA 3KP2A 3T5XA 1RZ4A 3I54A 4I02A 4ZZLA 5H6QA 3HHGA 3LA7A 5LHIA 4M6YA 3ZN0A 4OIQF 2OQGA 5BPDA 2KKOA 3G3ZA 5CVRA 4XRFA 2KIMA 3ABUA 2VC1A 2Y75A 3IWZA 4L9NA 2M87A 4XSZF 4KMFA 3MEXA 3I59A 2UXNA 5JHUA 5A2QK 3DQVC 1H0MA 3FZVA 4FT8A 1G3TA 3V8JA 2EFQA 2IPQX 1O3QA 2EFPA 3F6OA 3WU0A 4LK1F 5AIPA 3BPVA 3BJ6A 3ELKA 1HKTA 1B1BA 4HF0A 2P5VA 3CUOA 1F4KA 4KA4A 2A3SA 5HLIA 2D1HA 2DFIA 3OV8A 4XSXF 1S29A 3GFJA 1LDJA 2VE8A 2P5LC 2DPDA 2LF7A 4D0PA 4I98B 4IPAA 4OU0A 5EEHA 1GXPA 3WGHA 3W6KB 3ERED 1R22A 4I2OA 4IJAA 5BOXA 5F6FA 4IVNA 4ZYEA 1FC3A 2LSOA 1XMKA 4B8XA 3EYYA 2ZXJA 2DLLA 1KU9A 2XGXA 5DV5A 4EM1A 3BROA 5HOOA 1ONVA 4OOIA 2QQBA 2K7LA 2LDUA 1SFXA 3N97A 1VTNC 3AAFA 4RB2C 1YO5C 5BPIA 3R0JA 3F8NA 2CYYA 3HTSB 3TOBA 2V79A 3M9AA 1XGMA 1BOAA 3RPUA 2ZNYA 1UHMA 2ESNA 5IT9K 4HZFA 4PDKA 1HSJA 1Q1HA 3PFIA 3T8RA 1TW2A 5ERIA 2EFWA 4WXDA 1U5TA 2HR3A 4A0YA 2V1DA 1KGSA 3HYIA 1YS6A 1L0OC 4HX8A 2FOKA 4WCGA 1XCVA 4L9TA 2V1XA 2H94A 5F64A 2QUFA 3P9CA 1MZBA 4DNCA 1B9MA 1WI9A 1U78A 1B9NA 3F72A 1T6SA 4WK8F 2AXLA 1QO0D 1W5SA 1ZG1A 3HOTA 1DUXC 2Z3YA 1JGSA 2R7FA 4G7HF 3ULQB 4UVAA 1IXSB 3JTHA 3RKWA 2QQAA 5JI6A 4GGGA 2BBYA 1NHAA 4HBLA 1ZAOA 2VBWA 1OPCA 4M9XA 1RUOA 1XDSA 2XUBA 2ISZA 4EGZA 2Y0MA 4N9HA 2QBYA 1FNNA 1WWXA 4HA8A 3ZMVA 1KYZA 5LGTA 4Q47A 4QWQA 3L7WA 2J5OA 4H0EA 3QU6A 1MKMA 2DW4A 5FFZA 4MQVA 5FLXK 2WWYA 3HRTA 1IF1A 4A12A 4L9JA 1SFEA 2HYFA 1BC7C 4L18B 1U3EM 1FSEA 3L09A 3QPTA 3R61A 3SHFA 1IN5A 1BJAA 2ZMEA 5D6EA 4U0VA 2OAZA 1I6XA 1RI7A 1KU2A 3JW4A 5HVQC 5L3GA 3NRVA 5K5OA 4I7HA 1JXSA 3WGIA 4UVBA 2ACJA 5D4RA 1HSTA 4G6DA 2VE9A 2QLZA 3E5UA 3MAJA 4KN4X 3V8KA 4LK0F 3VODA 2PLYA 2RNJA 3TDUC 4ENMA 2DO7A 1LB2A 4U7BA 4LB5A 2UXXA 2PFBA 5E1XA 2KRFA 3FXQA 3LA2A 2GAUA 1L3LA 1KQ8A 4KNYA 4Q4ZF 3N4MA 3VOEA 3DPLC 4G7OF 3F8BA 4MTDA 1FLIA 5LGNA 2DU9A 4CICA 2GA2A 4I0AA 2VC0A 2XRNA 2AS5F 3ABTA 3K1PA 1K78A 2JSCA 2MH2A 4GYGA 3U9GA 1IZ1A 2CO5A 3O3KA 1XD7A 2FMYA 4HAMA 5DEQA 3Q9SA 2FNAA 3PQJA 4ZZDA 2VBXA 5ICGA 1FZPB 4P9FA 5CYVA 4LG0A 3E97A 1A04A 2XKPA 3KP4A 3IWFA 4UNOA 3ML6A 2VT2A 1P92A 2FBHA 2DTRA 4G94A 5E18F 2OU2A 2P4WA 3RKYA 1SAXA 1LEAA 6PAXA 3K2ZA 3EQLF 5FB2A 5TRDA 4RS8A 1Z05A 1B4AA 5LHHA 4LFUA 4MEYF 1V3FA 2KJCA 1IW7F 3U1DA 2EWNA 4CO8A 3KE2A 3P9KA 4LLGF 5L3EA 2HQRA 4HW0A 2M30A 1GXQA 1LEBA 1FT9A 4KMUX 3KZYA 4LD5A 1HQCA 4A5NA 1KA8A 3GZ5A 2FA5A 1D5VA 1YW7A 2Z99A 3TOAA 3CDHA 4IHSA 2QQ9A 3SZTA 3ZMSA 4ZYDA 3GYHX 1G3SA 5E8GA 1D8KA 2E7XA 2Q8KA 1USTA 4ESFA 1BI1A 5CLSA 1HW2A 4I0BA 2STWA 1S3JA 4HF2A 1STZA 1YQAA 2BGCA 4TV7A 1JHHA 3LQRA 2W24A 5A2QZ 4R79A 1F1ZA 2H09A 5ICEA 4L5IA 2GA1A 2H6BA 3B73A 4PGGA 1BIBA 3I71A 2VN2A 3G73A 1RNLA 4PGHA 2P6TA 4BHBA 1ZRDA 1QZZA 2Z5UA 3LA3A 1U5TB 2A6EF 1XB4A 1CGPA 4JBAA 1FBUA 4L0ZB 2PMUA 3TQNA 4M6XA 5L3CA 3GF2A 4XBFA 2FF4A 1FOKA 3NQOA 2O3FA 5FGMA 1O7LA 4AD9A 3E6CC 3GO5A 2TDXA 2RGVA 3CTAA 2UZKA 1Z91A 4FX0A 5BMZA 4FX4A 3I53A 3DV8A 4HOBA 4OMZA 4LJZF 4R8HA 1XCBA 1PUEE 1KQ0A 4EJOA 1S8NA 3Q5FA 2IA1A 1MD0A 2BYVE 1P2FA 1UB9A 1U5TC 5FD6A 3F8CA 1G4DA 2HWVA 2DK5A 4A2UA 3KETA 2QBYB 2VODA 4ETSA 2MA3A 5IT9Z 3IRQA 2NNYA 4KICA 2JRTA 3ISPA 5DUIA 2QWWA 2DT5A 1D8JA 2QZ8A 4ENNA 1LDDA 4OMYA 5D4SA 1KU7A 3ZMZA 4RAZA 2E1NA 1QQIA 1ZYRF 3DP7A 4ZYGA 4MEXF 3C3WA 3GUDA 3HRMA 2JT1A 2QENA 2EA4A 2ZKZA 1BIAA 5HS8A 5HDNA 2V9VA 3R6SA 3GLXA 5CVVA 3D0SA 2ZMEB 1YIOA 3FHZA 4CDGA 4Y15A 2IRFG 2MBFA 5CVUA 5J8CA 2HDCA 3S2WA 1ULYA 5ILVA 1BBYA 1YS7A 4RB3C 2XASA 4BH9A 5DD8A 2DAOA 1ZHFA 5DCMA 1Z6TA 1DP7P 4EJUA 2W25A 4EJVA 5ED4A 2O6GE 4MQ9F 3O6BB 4HQMA 2CWEA 1FP2A 3M8EA 3C7JA 4AIKA 4UUVA 3HTUA 2EJRA 4IF4A 1W4MA 2EK5A 1FBSA 4O5VA 4AIJA 1PDNC 2YPRA 4HDUA 2IP2A 1G3WA 2OZ6A 3E6MA 4GXOA 1KYWA 1FX7A 1SD7A 5FLXZ 5D5WB 4A0ZA 2OZUA 1K78B 1OMIA 1TNTA 3TKYA 1X3UA 3E5XA 3MQ0A 1YG2A 2EFNA 1ON2A 2XVCA 3TO6A 3ZP5A 2DQRA 1B6AA 1RIOH 3V7RA 2P8TA 2NRAC 3EETA 1ZREA 4LG0B 1QNTA 1IN6A 4A0XA 3P7NA 4PZJA 2P7CB 4K2EA 3T0YA 2XAHA 4ESJA 1WRJA 4M9SA 2STTA 3FXUA 1ZGJA 3WE3A 4KIFA 2X0LA 3RKXA 4EM2A 3U2RA 1R1UA 4M72A 1T0FA 3COAC 3SQNA 3DKWA 3FMSA 3MZYA 2YX7A 3KEQA 1IN4A 1Y0UA 2JZYA 4KIBA 1AWCA 3HSFA 2F5EA 1BI3A 2Q0OA 4P55A 3CUQA 2XAJA 1U6GA 3WU1B 1BI2A 2ETHA 1QBJA 2O8XA 3KFWX 1T38A 4UHTA 1IN8A 1O3TA 2Z9OA 2X4HA 2GZWA 3WGGA 3HOSA 1SMYF 3GEZA 4AIHA 2F5DA 3RDIA 1O3SA 5D6FA 5IT3A 4KDPA 4R1HA 5DD4A
chains in the Genus database with same CATH superfamily
5D5UB 3KP6A 3SDBA 4C3JJ 4RGRA 1YRNB 3BPXA 5LBQA 1I6HJ 5LHGA 4IO9F 2F5FA 3IUOA 1LFPA 3ABKH 4GDFA 3PQKA 3SJMA 3I3LA 2F5CA 2M45A 2CG4A 1A31A 2GLOA 3ZPLA 5E20A 2EV6A 2R7DA 3K1MA 1ETXA 4LLNA 1XSVA 1NTCA 3VPRA 4ZYHA 5E3MA 5EG0B 2GXBA 5JVGF 2JPCA 4GO1A 4G7ZF 1TT5B 1DP3A 4WF2A 3FIWA 3GXOA 3OS0A 1EH8A 3ZGKA 1ZARA 2RKHA 3DU5A 3BQYA 2V9PA 4MGRA 4ESBA 2KIUA 5K1YA 3H3ZA 2LF8A 5EEGA 2M1BA 5EDNA 5FJ8J 4BQAA 3AG4H 1TWCJ 4PK4A 2DJIA 2RREA 2Y0SA 2OD5A 2LBFB 5IY5H 2HS5A 2MSYA 3G1MA 3EUHA 3IH4A 1P4XA 2OC6A 2CSOA 2RVCA 2DA1A 2CQNA 4BYYA 2EB7A 2CV0A 2P7VB 1RR8C 2HTSA 1TWGJ 1LVAA 4CH7A 4YIRX 1WJCA 5FKNA 2L7MP 3T8TA 4M71A 1WQ2A 3FHNA 2BEOA 3J81Z 3J80K 5F1JA 1N77A 4IHTA 3ZQHA 1LFBA 1TNSA 2RV8A 4P5OA 4MFEA 2ADUA 5LFAA 3J7AY 1QHGA 4CXFA 3OR2C 2EZLA 1MBHA 5LEKA 2VLAA 1I27A 4RAGA 2XIGA 3HGYA 4XRMA 3DXJF 4JP0A 4GRIA 3OYCA 2IA2A 3BR1A 4A3EJ 2ZFUA 3M1EA 1YJNI 4U7DA 1U8RA 2OJED 1Y39A 4NNJA 2VI6A 2YS9A 1H8AC 2K4JA 1H9GA 1RESA 2HQ5A 1DDNA 4F52A 2HNHA 4AVPA 3OYGA 4EV0A 3PSIA 3OOPA 4FE4A 4F92B 3KIOA 1KU3A 1JJ8C 3A2KA 2E2IJ 3C18A 3TEDA 2XF6A 1PP7U 1IGNA 2XKOA 5LGUA 2HKXA 1Y8RB 4D5CA 1Z1DA 3OYJA 2X6WA 3QYEA 4C3HJ 2X51A 3OIPA 4N4NB 2LLKA 2JVGA 2ZJPF 1BR2A 1X1CA 3F8MA 4GYIA 1XMAA 3CMYA 2PEXA 1XGOA 1X4OA 3GZNB 1REPC 3MN2A 4ZTFA 3HIFA 4Q48A 2L7ZA 1WCMJ 1MJ9A 3RIRA 4Q5SF 1TWHJ 5DYMA 3PFYA 4G6QA 1S7AA 4C2TA 3QOEA 1N25A 3KLNA 1DGRM 2LNBA 1IRXA 3O8HA 3LSRA 1W36C 1B59A 4A3GJ 5FRMA 3HM5A 1S5LC 2XV4S 4BU2A 1J9IA 1Y56A 4LITA 1P4WA 2W82A 4ENKA 2NAZA 4U0YA 5HS9A 3HRSA 3CCMI 3H5AA 1ETYA 1HOMA 4XORA 2PJRB 2FEZA 2KP6A 2LMDA 3LL7A 1U2WA 3M8JA 3W3CA 2ZSHB 3HSEA 4E4HA 2HYGD 1IN7A 2M4KA 2E1CA 2Y9YA 4P96A 3LFKA 3FKJA 1PJRA 2M5WA 3VYTB 3HB9A 2M7AA 4DIQA 1E2XA 3I4PA 3ZQ7A 3FK7A 1E17A 2JA5J 2VB6A 2DI3A 4ZTJA 1IDYA 1DPRA 1YOVB 4IRIA 5LRRA 1AKHA 2VKHA 1LQ1A 1WH7A 2ME0A 4UUSB 3L00A 3G71I 5L3FA 2KIFA 3WODF 5D8KB 2R5ZA 3WTSC 2A05A 4D7MA 3JRGA 3L2VA 2BXYA 4L9VA 4UXNA 1R00A 1T2KA 4WWCA 5IOYA 3OYIA 2NVTJ 3BG7A 5DCMB 3MZ8A 3QWLA 5GAHJ 1B72A 1Z77A 2VJ5A 1YE9A 3S1NJ 1R7JA 4A3KJ 2D2WA 2BXZA 5J1YA 1MMAA 2YR2A 1TL8A 2WAQN 1MIJA 4HV6A 2G9WA 3JRFA 2IW5A 3ZQLA 3V4GA 1VQOI 1C0WA 3OS2A 2EIJH 3QODA 1TQMA 3NAUA 2BE5F 5D5VB 1Q1VA 4D9JA 1Z21A 2FE3A 1VQMI 3CDLA 4MIMA 2BY1A 3HRUA 5FFXA 1ZTRA 1OYWA 5CJ9A 1BI0A 3FBNB 5E17F 3SXYA 3F22A 1YW8A 2D1VA 3M7GA 5FKLA 1CF7A 5AIQA 2A6HF 1ETOA 3SFZA 1MH3A 3J81K 2WTEA 2HPMA 1EV7A 2GXAA 2EFOA 1VQNI 3IKTA 2FX0A 5KCMA 2GIVA 5LD2C 4XOPA 4DYQA 2HU9A 2OUMA 4E7HA 4XL9A 1T98A 2CGPA 3PNYA 1SANA 5M5XJ 3KP3A 3CESA 4EQQA 3AG1H 2K86A 4N0BA 4RGUA 4RM2A 1D0YA 1G3YA 4HLYA 1X19A 2VJ4A 2Y2ZA 3OL4A 3LSGA 2HZTA 1R49A 4H4KC 2KLOA 2IBDA 4V2FA 1R1VA 1D1CA 3BG5A 1Z9CA 1R36A 2BHZA 4WXHA 4WX9A 5EGOA 1J59A 1RUNA 2L3DA 1V4RA 1TT0A 1LJ9A 1P4AA 1JE8A 3T1BA 2FQ4A 4IKFA 3I5UA 2LKSA 4LIVA 3G1OA 3PJRA 2M4GA 2FBKA 3HG9A 2IJLA 1YTYA 1A5JA 3N05A 4N9IA 1IV8A 4XN3A 1MDMA 4FE7A 1XN7A 1ZN2A 3R4KA 3E7LA 5E8IA 2VOOA 1K79A 3S2HJ 2UUZA 1O7FA 4OINF 2LFBA 2IGNA 5KAFC 2G7UA 2MC3A 1N75A 2VKVA 3KYCB 3CCSI 4HF1A 1UG2A 5B66C 3GFMA 2EILH 4M3GA 5C44J 3DBRB 3A02A 1MSFC 2WADA 3BR3A 1F9NA 2WB1A 1R4NB 2L01A 4BNCA 2L54A 4HQEA 2VJJA 2EPFA 2E71A 5DUKA 3QU3A 2CW0F 2GWRA 4EM0B 1CQTA 2VT3A 2ELJA 2L4AA 1DPUA 2R5YB 4MLOA 2PJPA 2CUEA 5HLGA 3S1QJ 2M34A 5TJJA 5F27A 3VEPA 4DW6A 3KYLA 1MMSA 4GCVA 3TO7A 1IAWA 5JVTA 4NQWA 3BOQA 3CUQB 4IRGA 4EGYA 2E1MB 3GTMJ 2ZBKA 1FP1D 3CCEI 1XSDA 1LE8A 4Y17A 3TDZC 2RNGA 1O57A 4RMNA 1SFUA 1I3AA 2NVQJ 3RCOA 1FYKA 3HZJA 4RGSA 3WG9A 1OCZH 4QLCU 1YYVA 1P7JA 2I8DA 2XHKA 1TQIA 1GHCA 4AVZA 1FYLA 3G1LA 3QYFA 2GOXB 3HL2A 1J75A 3LSJA 2EA2A 4A3BJ 2QQ8A 3CJNA 3W6VA 1ZRCA 3WTTC 4NHJA 2OA4A 4A3LJ 3BLYA 1W7PA 1P7IA 1SD6A 4Z2YA 2XC7A 2DMUA 3FXOA 3K69A 1R1TA 1T95A 3R60A 2RAEA 4N4OB 1TC3C 2EINH 3FBIB 1W36D 4J19A 2Z33A 1T0FC 2CQQA 2OV7A 2W84A 3BR5A 3BP8A 2KRHA 5D8LB 4QTRA 4C2MJ 2OQRA 1WFXA 3DF8A 3CP2A 3I56I 2OCCH 4YG2F 3L2QA 1XDUA 4QSHA 4KISA 3GX4X 1PYVA 1UHSA 2QA4I 1X1PA 2HQNA 2LREA 2NYXA 3E0JB 1XGSA 4IEJA 3UR3C 4EATA 2XSJC 3G2BA 2D45A 3TMOA 3K0LA 5CVIA 2DPUA 2A5WA 4XIDA 3PSFA 2H8RA 2K3FA 2GQQA 1W7PD 1USSA 3OYFA 2O03A 4J00A 3NARA 4CCNA 3KZIC 3CUQC 3JRDA 2L2OA 3BZ6A 3ZOBA 4L0YB 2FQ3A 1JUMA 4BY7J 2RQQA 3ABMH 3GFIA 1SD4A 5ILSA 4E7IA 2FOWA 3I64A 2OF7A 2WAFA 3BZKA 3LAJA 1FJLA 2DDBA 1H9TA 2QSHX 1FIAA 3IRRA 4EJTA 2GM4A 4FTHA 4FHTA 4I01A 4AYBA 4IXAA 1HXDA 4XRSA 3WTUC 1I5ZA 4KT5C 1J5YA 5E79C 1H89C 3S17J 2K5CA 4U88A 3GFLA 3P5JA 3AL0B 4YFKF 1U9NA 2PBIA 1QGPA 2WB1N 1WSUA 5B1AH 5DCFA 5J1UA 1MJAA 3IL2A 1MGTA 4G9YA 1KZHA 5IYBJ 3RYRA 2HDDA 1MMGA 3CP8A 3BJAA 3OOUA 2XF7A 4Y52J 3RI4A 1ODDA 3DFGA 3TW6A 2CH0A 1I50J 4DZJA 5BS6A 5HLHA 4WXCA 2HOEA 2OBPA 2DA2A 3QP6A 3GTQJ 4DQ2A 1E3PA 5F08A 1D3YA 1D1AA 2BY2A 3M07A 1POGA 1R23A 2EV0A 3I58A 3R0AA 5L3BA 4A3IJ 3NEUA 2FU4A 1Z67A 2FNPA 1R5GA 3F6VA 1Z7UA 3SZPA 1SFKA 2KDOA 4II3A 2E19A 3LSTA 2DJNA 2JA2A 2XAQA 4B4CA 4JQFA 2VBZA 2K3PA 1D5YA 1TBXA 1MSEC 3OR1C 1HBXG 1ZLKA 2IXSA 2K4BA 5TGTA 1G6NA 5D5XB 2QYOA 4ASNA 2D5VA 2TRTA 1OKRA 3EUHC 4KFCA 2XAFA 3VB2A 1A6QA 4YRVA 3Q0UA 1MNMC 1R5HA 4HYEA 5ICFA 4RM3A 4FETA 5H20A 2V6CA 5FROA 3MVPA 4BACA 1F36A 2LK2A 1YLFA 3B02A 2M3AA 5IOZA 3JAMK 3ESWB 2XF5A 2F6CA 3JRAA 1FEXA 2E35A 1K4SA 3K1NA 2R0QC 5E1ZB 4HRIA 3DPUA 3H92A 2A6TA 2W00A 5EZGA 4S04A 5FKOA 4M3DA 1JTYA 2IGMA 5DS9A 4E70A 3QPSA 1VQKI 1O3RA 3GTPJ 2LYCA 1JTXA 1PP8F 2UV1A 3WE2A 3E6DA 1K6OA 2ISYA 1Z0XA 2W85A 5CVJA 4DJAA 2W4SA 3FDYA 5C3EJ 2Q2EA 1VZ0A 2VL8A 3EYIA 4I6ZA 2DXIA 2MD5A 3ROUA 4YIIA 3J7AO 4ENJA 3OWTA 3G6EI 3H5RA 3WTWC 2W48A 3BR0A 3J80Z 1EH6A 2IVMA 3IP4B 4RB1A 4IOAF 3QP5A 4A5MA 2Z1DA 2DQLA 3H5NA 3QYBA 2NNNA 1I3QJ 3L9FA 4PJ0C 4S0HB 1HKQA 2K27A 1WVRA 3F0CA 4CZZA 4D1QA 3E6BA 4NC6A 1G59A 3W2WA 1AKHB 3BWGA 3GW2A 1ETVA 2NS0A 3GLLA 1RKWA 1IRGA 3MKWB 2R5ZB 3ZXSA 3CCUI 2Y69H 1XGNA 3VDXA 4DOZA 3VWBA 1SC7A 4F7ZA 1I1SA 3C1DA 5K7ZA 2BZTA 3GBGA 5ICCA 3CO6C 3WTVC 2X9DA 1B72B 4BQQA 2LC2A 4AYBN 1ZELA 4XR6A 2O61A 3JSOA 3LSHA 1XSXA 2K02A 4U0WA 5K5QA 2DMPA 3CMEI 1TLHB 1JT0A 3VYUB 4M3FA 1YI2I 2J5PA 1P9QC 2R3SA 3IAS2 3V7CA 2RN7A 2ZCWA 4PJNA 2ZJ2A 2HTJA 3FMQA 4AWXB 4LGWA 1K4TA 4B43A 5IPAA 1ENHA 4MNUA 4RAYA 1XS9A 1CF7B 4ZDOA 3ERMA 3K4MA 3LMMA 1ORKA 4CHUA 3W2AA 2HKOA 3E5QA 4ABZA 2CV2A 3A0BC 4BHPA 2VOPA 3FMRA 5LLQA 1DU0A 1SVLA 2E7WA 4LMYA 2M8EA 4OIOF 3LFUA 1FTTA 2KPMA 1ZR2A 3SEZA 2YUSA 3ZMUA 3OSGA 2QF7A 2CV1A 4EVIA 2XPVA 1FYMA 3RZOJ 2EZKA 4BGDA 2XAGA 4I09A 5EZHA 1U8BA 3I9V2 1X2MA 1EKEA 2DA7A 4YFNF 5EGOB 3CJQB 1QPIA 1V55H 1ZLJA 4Y33A 1DU6A 1ERDA 1FPQA 3A01A 3KX2A 3QOPA 3H3VK 2ELHA 2CS3A 4LLLA 1IXCA 5E3OA 3M3YJ 3FM3A 3S8PA 1MDMB 3F3XA 3KCCA 2V9KA 3VYSB 4AU7A 2FBIA 3BDDA 1GVJA 1WGXA 3DCFA 4KT6A 1LDKB 2V7FA 2HGCA 5E1WA 2MH9A 3JREA 2JTVA 2ZC2A 3V8LA 2X1CA 4UV8A 3I4MJ 1IRFA 3ZMDA 3PIPF 3JR9A 4OIPF 1O4XA 4XOTA 5KNLA 2DFFA 2GXGA 2R4GA 2H1KA 1ZRFA 2V6EA 1JHFA 4LIUA 1EJ9A 2CQKA 2HDWA 3TO9A 1OR7A 1GDTA 4BQNA 4BHCA 4BKXA 1WZ2A 3V7SA 2C6YA 3FM5A 1WJBA 2PG4A 4NB5A 1F5TA 9ANTA 3VFZA 2G7HA 3DPTA 4E7LA 3ZN1A 1TQPA 1BR1A 5FD5A 4V19K 1W5TA 4ZC3A 2PMHA 2ZFWA 3BZCA 3RTRA 2HQAA 3FXLA 4E7KA 2E60A 2K9MA 1ZG3A 1FY7A 3RPQA 1UCRA 3FX3A 4O3MA 3K9TA 2LKPA 3GZ6A 2WAQA 2HEOA 4NQWB 2L02A 1AOYA 4XM3A 3CLOA 2BY0A 2IGKA 2QM3A 3BTIA 1HA8A 1LE8B 2MW8A 5HS7A 2WAEA 2XPWA 3OMYA 2Y30A 4HG2A 5L3DA 1T39A 5CKTA 4RBOA 2CFXA 5ILUA 1LKXA 1TW3A 2PQ8A 4YELA 2NVUB 4QPOA 1J09A 2FMLA 2H1LA 2KMUA 3OYMA 2CJJA 2FUG2 4PCQA 4Y13A 2DFHA 2DMTA 2AO9A 5TISC 5LEJA 1FWZA 1K6YA 4XLPF 2BW3A 1J2XA 1SD5A 2DYSH 4IRHA 4UV9A 5J4YA 4OIRF 1W7PB 2F4MB 5JHFA 1XG1A 2LTPA 3S93A 2A68F 4BJTA 4IHVA 4BY1J 2MLGA 3BJOA 2L7KA 4G6TB 3FWEA 1IUYA 1QZYA 1ETKA 2G0EA 3MZHA 2ELKA 3BTCA 2EV5A 2E34A 2H27A 2AXTC 1ACIA 3O2PE 3JTGA 2IAIA 4F93B 2FXAA 2IT0A 2CUZA 1TP4A 3MKZA 1R58A 2AQEA 4F91B 2UWMA 1OCPA 2ID3A 2RDPA 5BQTA 1TTYA 3LWFA 3AKZA 3I55I 5E3NA 2XGCA 4XLFA 5HDGA 4EJWA 1OCCH 2KQRA 1VQ5I 3LQQA 3QAHA 3BY6A 2FRHA 3CMAI 1J7KA 3E3VA 3ZMTA 2H6CA 3MWMA 2JJ7A 3DTEA 4IX7A 4M73A 4QIWN 3P9IA 1ZG5A 1IC8A 2B63J 2ESHA 1UFMA 4JYKA 3VSLA 3D5LA 3HHHA 2F4OB 2IGOA 2COBA 3GTKJ 2CU7A 5M5WJ 4C9YA 2W57A 3BCBA 3IHUA 4RB0A 1E3HA 1FBQA 4A69C 2JA8J 1SMTA 2DMQA 5E3LA 2WA0A 2L4MA 3KP5A 4MFDA 4KYWA 3GWZA 2NOGA 4KUMA 3Q0WA 3OSFA 4BAYA 1OYIA 3DBLB 3AG3H 3I59B 1YIJI 2VUMJ 1JKPC 2FSWA 2GIZA 1I39A 3Q9VA 1EH7A 2XGDA 3WHBA 3L2WA 3CC4I 2V1UA 2PI0A 1QHHD 1P6RA 3DU6A 2IA0A 3FXRA 3A4CA 3H9JA 1ETQA 2DBBA 2ZB9A 3I4NJ 1LNWA 4LB6B 2LKXA 4FCYA 3HEFA 2HFHA 3LOCA 5AONA 2P6SA 3H36A 4JK1X 3WTYC 2KIQA 2DTZA 1FSHA 3BTLA 2A69F 3CJTB 3J7ZI 3CO7C 1J0RA 2DCEA 3MCZA 2M2EA 2NVYJ 3OIOA 4YIFA 2DA6A 3K4LA 3FK6A 3IV5A 2WC2A 1X58A 3LAPA 4HX7A 3QPHA 5DDGA 5J4VA 2MYSA 4UVCA 3EDPA 4V2GA 2F2EA 4L5JA 3I0TA 4KN7X 4HSTA 1YJ9I 5H6RA 5K5RA 3DLLF 3DKYA 3WU2C 1N78A 4YFXF 4ON0A 3OYNA 2OPTA 2MG4A 3TGNA 3AG2H 2ZXIA 4NBQA 4JX6A 3K70C 2A5YB 5F0FA 4ANJA 1V5FA 2LOOA 1B8IA 4MHGA 3KP7A 2DODA 2M0CA 3PUBA 5J8FA 4B09A 3OS1A 3B6CA 4LG3A 1BN5A 2VXZA 3FXMA 5F1RA 4BJ5C 1TZLA 5EJCA 1X3ZB 2N8GA 2NS7A 4JX5A 5DTDA 3HBLA 2B0LA 1W1WE 2XROA 4A93J 4B3AA 3IH2A 3SDGA 4BXUA 2WY7Q 3RYPA 2Q2EB 3BG9A 3BTJA 2VQGA 5LRSA 4IQJA 3FXKA 3ZQGA 3IC7A 2WV0A 3JRHA 5FO5A 1VQPI 1JKOC 2O0YA 1VI0A 1ZGAA 4X0GA 3OYAA 4X6AJ 1VNDA 3H0DA 1AU7A 3CCLI 3WTXC 3JSPA 1QRYA 1S72I 5KVRA 2XB0X 3F8FA 5B3SH 3BT9A 3MFKA 4A6EA 3ECOA 1MBEA 3RSNA 1Z6RA 3W6JB 4HDVA 1ZK8A 4PSXA 3U1KA 1BC8C 2YU9J 2IS2A 1DQUA 1RPWA 3HSRA 3WTZA 3IKVA 5JFRA 3L2CA 2DOAA 2NS8A 2RQPA 4CCKA 1ZR4A 4M9ZA 1PUFA 2HOTA 2YU3A 4XONA 1FMWA 4L5EA 4O6JA 1HW5A 2B7EA 4RLQA 1T33A 2E2JJ 4EMSA 4BEHA 3EUKL 3RJPA 1ON1A 2E5ZA 2LR8A 2LP0A 2HOAA 3CCVI 1YW9A 2LG4A 3FXJA 5B5EC 3GTJJ 3KLOA 1I1GA 4B44A 3QRFF 2Y48A 5F04A 3KEOA 2Z16A 1RKTA 4CGZA 4BE1A 1K7AA 2F4IA 3OIQA 1ZH5A 4S05A 2DK8A 2X6YA 4ZH4F 1WKMA 2M7BA 4HX4A 4G8XA 3REOA 2W7NA 3HUGA 2MLKA 1UHWA 2VONA 2ECBA 3UNGC 1UELB 3M4OJ 2KJBA 1IXRC 3DEUA 1GVDA 4XLNF 3JAMZ 3KZZA 3M8FA 3HOVJ 5HDKA 1G2HA 1OFCX 1QPMA 1Y6IA 4AM3A 1KQ9A 4MTEA 4XLEA 1MJBA 5HODA 4PFPA 4P9UA 1BM9A 2COMA 2VBYA 1R4MB 2A61A 1GLNA 2ZO4A 5KK1A 5CQEA 4HNUA 3DEWA 3H3UA 1MBGA 2QVOA 1S7OA 2M0MA 4RGXA 2K85A 2PN6A 3L2RA 3F23A 3FKIJ 3GVAA 4E7SA 2QSGX 4CYDA 1MNEA 2LD5A 5F0HA 2I5UA 5GPCA 1V5EA 1HKSA 2X1EA 2RC4A 3ECHA 2BV6A 3CJRB 1YFHA 3NWSA 2ZNZA 3A01B 1JJ6C 3K4NA 4FQGA 3F21A 5JR3A 4HV5A 4HLXA 2P5KA 2MD0A 2ZXHA 4M74A 1S6LA 1HW1A 3PM1A 4A6DA 2YX4A 4KJZA 3FF5A 2EIMH 3HOZJ 4KIGA 1OYYA 2JPBA 2A07F 1LUJB 2ECCA 3H1CA 5J6XA 5EF6A 1MH4A 2YSRA 3KP2A 3T5XA 1RZ4A 3TL4X 3OY9A 3I54A 4CCJA 4I02A 1DGWY 3BR2A 3DTKA 1QVUA 4ZZLA 4IHYA 4Z6YA 1RC9A 5H6QA 1NK2P 3HHGA 1HCRA 2GOMA 3CD6I 3LA7A 5LHIA 4DYCA 4M6YA 3ZN0A 4OIQF 3WG7H 2BHYA 2OQGA 4I76A 5BPDA 4U87A 4CUGA 1A35A 2KKOA 3G3ZA 5CVRA 2K9SA 4XRFA 1GV5A 2KIMA 3ABUA 2VC1A 1V5GA 2Y75A 3H9GA 3IWZA 4L9NA 1WH5A 4UB8C 2M87A 4XSZF 1OLTA 1K61A 4KMFA 4XKWA 3MEXA 5DM7F 3I59A 2UXNA 5JHUA 2NOJB 3DQVC 5A2QK 1H0MA 5J47A 2IS6A 2R7XA 3FZVA 4FT8A 1G3TA 3MKLA 4RDUA 3GTOJ 3V8JA 2EFQA 2XAUA 4NC8A 2IPQX 4ZDLA 2AHQA 1O3QA 2EFPA 5IP6A 4JOMA 1VF9A 3F6OA 3WU0A 3VYRB 2E2HJ 2JSPA 1JUPA 4LK1F 5AIPA 3SEQA 4C3IJ 1SVMA 3BPVA 3BJ6A 1MMDA 3ELKA 2BW3B 1HKTA 3K70D 3HXLA 1B1BA 4BJ6C 3K10A 3SFIA 3ONQA 4HF0A 1MNDA 2P5VA 3CUOA 1BL0A 1F4KA 3CMMA 2KFDA 3HPHA 3OYHA 2WBMA 4KA4A 1X1BA 2A3SA 1OR7C 5HLIA 2D1HA 5EEAA 3PNTA 2DFIA 1QA6A 3PUFA 5J40A 3PIOF 3OV8A 3S1RJ 2DDAA 4RAFA 1W0UA 4D7NA 5KHDA 4XSXF 4B47A 4JX4A 1S29A 3J7YJ 3GFJA 1LDJA 3CCQI 2VE8A 2P5LC 4Y7NJ 1ITYA 2DPDA 3CDIA 1GV2A 1JKRC 2JN6A 2LF7A 3VSKA 4D0PA 4I98B 5C4JJ 4IPAA 4OU0A 1VQ9I 3Q3SA 2MABA 5EEHA 1FOYA 2F5VA 1NG7A 1GXPA 3WGHA 4A3FJ 4XN0A 2EZHA 3W6KB 3ERED 2ZMEC 3K4JA 3BG3A 4BQOA 1TWAJ 1R22A 1R71A 1IRZA 1BW5A 3ZQQA 4I2OA 5C4XJ 2X1DA 4IJAA 5BOXA 5F6FA 4IVNA 1GT0C 3BR6A 5FLMJ 2FJ1A 4E6KG 2VKEA 4BBSJ 4ZYEA 1FC3A 3NWTA 2LSOA 1XMKA 4B8XA 2HXOA 3EYYA 2ZXJA 1UMQA 3RQ4A 1Z3XA 1WJAA 2DLLA 1KU9A 2XGXA 5DV5A 4EM1A 3BROA 3GCMA 5HOOA 2QGUA 3ZR8X 1ONVA 4OOIA 2L9NA 2QQBA 2CW8A 2K7LA 2LDUA 1SFXA 3DLAA 3N97A 1VTNC 3AAFA 4RB2C 1W0TA 1YO5C 5BPIA 2ME6A 2JUCA 3R0JA 2L0KA 3F8NA 4XNFA 2CYYA 3HTSB 3HOUJ 4HSRA 1X1DA 2XRLA 3A03A 3TOBA 1HF0A 2V79A 3M9AA 1RR7A 1XGMA 1OJLA 1BOAA 1WJEA 1W5CC 4C2UA 3RPUA 1BA5A 3IH3A 2ZNYA 1UHMA 1JT6A 2ESNA 1R9TJ 1IG7A 5IT9K 4HZFA 4PDKA 1HSJA 2R93J 2QKLB 1Q1HA 3PFIA 1XC5A 3T8RA 1TW2A 3S15J 5ERIA 2EFWA 2VQHA 4WXDA 4EEFG 1U5TA 2HR3A 3K4BA 4A0YA 4PJMA 2V1DA 3GTGJ 1KGSA 3HYIA 1YS6A 2OTLI 1L0OC 1F43A 4HX8A 2FOKA 4WCGA 1B8IB 1XCVA 2K40A 4YEJA 3PNVA 4L9TA 2V1XA 2F48A 2H94A 1SAUA 3RPUD 3V42A 3ABLH 5F64A 2KL4A 1JGGA 2QUFA 3P9CA 1MZBA 4DNCA 1NH3A 1B9MA 4FISA 1WI9A 2XGEA 1EF4A 2R7QA 1U78A 3OYKA 1B9NA 4DZPA 3F72A 1T6SA 4WK8F 2AXLA 2JRMA 3TBIA 1VQ6I 3PO2J 2CRGA 1QO0D 4ZYAA 3F9KA 1W5SA 1ZG1A 1FIPA 3HOTA 2Z3YA 1DUXC 5CQGA 2BOLA 3MMYB 2EH3A 5FKMA 1JI8A 2QEXI 2R7SA 1JGSA 1YX5A 2W1OA 2R7FA 4G7HF 3WHCA 3QPLA 2VQLA 3ULQB 2JK3A 4XKCA 4UVAA 1IXSB 3JRCA 3JTHA 1S9HA 3G4SI 3RKWA 1V54H 2QQAA 5JI6A 2ICWG 4BDYA 4GGGA 4F3QA 2BBYA 1NHAA 1PUFB 4HBLA 2K9NA 1ZAOA 1D0ZA 1U9OA 2VBWA 1OPCA 4M9XA 1YHQI 5HLTA 3S3MA 1RUOA 1XDSA 4BEHB 2XUBA 2ZSIB 4CYCA 2ISZA 1QVTA 1RETA 2BY3A 4PUSA 4EGZA 2Y0MA 1S7EA 4N9HA 2QBYA 1M1EB 1FNNA 1QU3A 1WWXA 4HA8A 3ZMVA 3HDDA 4BXXJ 1KYZA 3CF2A 5LGTA 3O8GA 1Y0NA 2O7OA 4Q47A 2KZGA 3CCYA 3ASOH 3L7WA 2J5OA 4HEA2 4NUBA 4QWQA 4H0EA 3QU6A 4M3EA 5JLXA 3GMEA 3KYDB 1MKMA 2DW4A 4II2A 5FFZA 2LRDA 2E36A 4MQVA 5FLXK 3HUGB 4XKBA 3HRTA 2WWYA 4UY8I 2ZXWH 3RQIA 1IF1A 4A12A 4L9JA 1SFEA 4KITB 1EA3A 1OCTC 2HYFA 5K7HA 3S1MJ 5M5YJ 1BC7C 2LY1A 4L18B 2LVSA 2E5NA 2O9LA 1U3EM 1FSEA 3L09A 3QPTA 3R61A 3SHFA 1IN5A 1X4PA 1BJAA 2ZMEA 2Y31A 5D6EA 4U0VA 2OAZA 1I6XA 1RI7A 1KU2A 4HPQA 3JW4A 5HVQC 5L3GA 2WV1A 3NRVA 5K5OA 1A6IA 2DN0A 3HOYJ 4I7HA 1JXSA 3WGIA 4UVBA 4BXFA 2ACJA 3OYLA 5D4RA 1FOWA 1HSTA 2X48A 4G6DA 2VE9A 1Z3YA 2B9SA 2QLZA 3E5UA 3MAJA 4KN4X 2V26A 3LSPA 3K4KA 3V8KA 4LK0F 3ZQIA 3VODA 2PLYA 2QSFX 2PMZA 3D5SC 5IP7J 1E0EA 2RNJA 3TDUC 4ENMA 2DO7A 5JLWA 4QPQA 1LB2A 4U7BA 4LB5A 2UXXA 2PFBA 5E1XA 2KRFA 4BDZA 3FXQA 3LA2A 1D1BA 2GAUA 1L3LA 3KEYA 1KQ8A 2Q1ZB 3ZCOA 4KNYA 4Q4ZF 3DKXA 3N4MA 3VOEA 3DPLC 4G7OF 3F8BA 3S14J 1BW6A 2DT7B 4M6VA 4MTDA 1FLIA 5LGNA 2DU9A 3HKZA 3B6AA 2CFOA 3HGGA 1BR4A 4CICA 2GA2A 4ZJZA 4I0AA 5GTHC 3CLQA 1WJFA 3EPZA 4XICA 2VC0A 2XRNA 4OWRB 2X85A 3X2QH 3D5RC 3CQZJ 2AS5F 3ABTA 3K1PA 3BQZA 1K78A 5FKKA 2JSCA 1WJDA 2MH2A 4GYGA 3U9GA 4A3JJ 1IZ1A 2CO5A 2DA5A 3O3KA 1XD7A 2FMYA 2MGQA 4HAMA 2DOFA 5DEQA 4AIDA 3Q9SA 5BNGA 2FNAA 3PQJA 4Y4RA 2BVMA 1G8XA 4ZZDA 5H2FC 3HOXJ 4XLHA 3CC7I 2VBXA 5ICGA 4A3CJ 1FZPB 4P9FA 5KAIC 1X3WB 5CYVA 4LG0A 2M8GX 3E97A 4ZDPA 1MW7A 3KPHA 1A04A 2XKPA 3KP4A 3IWFA 4UNOA 3ML6A 2VT2A 1P92A 1UZCA 2FBHA 2DTRA 4DYRA 4G94A 5EYRA 5E18F 5IYCJ 4BE0A 2OU2A 2P4WA 3RKYA 1SAXA 1LEAA 3OYDA 1VQ4I 4BUPA 6PAXA 3K2ZA 3EQLF 5FB2A 5TRDA 2Y0SN 4RS8A 1OQYA 2R7VA 2XB5A 5GAEJ 2CUFA 1Z05A 3FISA 1B4AA 2P0WA 5LHHA 4LFUA 4MEYF 1V3FA 2KJCA 1IW7F 5B1BH 3U1DA 2EWNA 1R6RA 2MC4A 4CO8A 3KE2A 3P9KA 4LLGF 4IHXA 3DEEA 5L3EA 4G12A 2HYJA 2HQRA 2JWTA 4HW0A 2ZJRF 3OYEA 4XKVA 2M30A 1GXQA 4D5FA 2R7WA 2AQFA 1LEBA 1FT9A 1HLVA 4KMUX 3KZYA 4LD5A 2K9LA 1HQCA 4A5NA 2KDZA 1KA8A 1FTZA 3L2UA 3GZ5A 2FA5A 1D5VA 4OAYA 1YW7A 2Z99A 2PMZN 3TOAA 3CDHA 4IHSA 4PFOA 1UAAA 4I99C 2QQ9A 4RLFA 3SZTA 2ID6A 3ZMSA 4ZYDA 3OYBA 2IS4A 3GYHX 1G3SA 2NXNB 5E8GA 3MD2A 1D8KA 2E7XA 2Q8KA 5DM6F 1USTA 4ESFA 1BI1A 5CLSA 5GAGJ 4IQ4A 1HW2A 1WI3A 4I0BA 2STWA 2JVHA 2VASA 1S3JA 4XLCA 4HF2A 4DBRA 1STZA 1YQAA 2BGCA 1Z7LA 2DA4A 4TV7A 1JHHA 3LQRA 3TP0A 3S2DJ 5K7FA 2CQ7A 1HDDC 2LH9A 2W24A 2CW7A 5A2QZ 4R79A 4PJLA 1X1AA 1F1ZA 1K83J 2R7RA 2EZIA 2H09A 2L9VA 1WJ5A 5ICEA 4L5IA 2GA1A 2X6OA 3HKZN 2H6BA 1IJWC 3B73A 4IZZA 5M3FJ 3GTLJ 1LFUP 4PGGA 4ITVA 1BIBA 3I71A 2VN2A 3G73A 2PX9A 3CCRI 1RNLA 4PGHA 1YRNA 1T08B 4CZCA 2DFEA 2M9HA 4AUXA 3S16J 2L5QA 4MO7A 2P6TA 3IAM2 4C30A 2ZJQF 1ZQ3P 2VQCA 2BVLA 4DBQA 2E1OA 2GBYA 4BHBA 5EG0A 1T8IA 1OCOH 3K7AJ 3A0HC 3CZ6A 1XTAA 1ZRDA 1QZZA 5GADJ 2Z5UA 4CCMA 3LA3A 4A3DJ 1QZEA 4B48A 1U5TB 4XMYA 4NDLA 2A6EF 1IV6A 1XB4A 1FMVA 2HXIA 4JBAA 1CGPA 2VXDA 4CCOA 1FBUA 4L0ZB 2LBFA 2L7FP 1LPQA 2PMUA 3TQNA 3S32A 4M6XA 4GFBA 3H9QA 1IDZA 2R92J 5L3CA 1AHDP 3GF2A 4XBFA 4CA0A 2XPUA 2IS1A 2FF4A 1FOKA 3BC8A 3NQOA 2O3FA 2LY2A 5FGMA 5FRNA 1O7LA 4PSWA 3DWLE 5J3LA 4PJJA 4W1UA 4AD9A 3E6CC 3GO5A 2TDXA 2RGVA 3JCUC 3CTAA 2UZKA 1HDPA 2VJIA 1Z91A 4FX0A 3S3NA 2R7ZJ 5BMZA 4AC0A 3LSIA 1ZGWA 4FX4A 1U0JA 3I53A 3DV8A 4HOBA 4OMZA 2L9SA 4A3MJ 4LJZF 4R8HA 2FD5A 1XCBA 1PUEE 1KQ0A 4EJOA 1S8NA 2R7UA 5GTIC 3Q5FA 2IA1A 3LSKA 1MD0A 1Y1VJ 2BYVE 3BCAA 3RZDJ 1P2FA 2HVSA 1UB9A 1OISA 1U5TC 5CPRB 5FD6A 4CYCB 4OAZA 3F8CA 3Q0VA 1G4DA 5M3MJ 2HWVA 2DK5A 4A2UA 2XDVA 4XRSG 3KETA 2JUGA 2XSDC 2QBYB 3HOWJ 2VODA 3K4CA 3LNQA 4ETSA 4BS9A 3OL3A 1IUFA 4B3XA 2JA7J 2R7TA 2MA3A 1VFCA 2WY8Q 5IT9Z 5F0CA 3S3OA 3QQAA 3IRQA 2NNYA 4XLAA 5HNHA 4KICA 2EQRA 2JRTA 2IEKA 3ISPA 5DUIA 1SFOJ 2QWWA 2DT5A 4XK4A 2QZ8A 5GPAA 3D1NI 4ENNA 1YJWI 2O8KA 1D8JA 1LDDA 4OMYA 5D4SA 1KU7A 2VIXA 3HJEA 4CCLA 1UJ8A 3ZMZA 4RAZA 2K9QA 2E1NA 1QQIA 2E1MC 2LY9A 1ZYRF 3DP7A 4ZYGA 2OTJI 3DBHB 1WPKA 4MEXF 2Y9ZA 1XX5A 3C3WA 3GUDA 3HRMA 2JT1A 2QENA 2EA4A 2ZKZA 1BIAA 2H8WA 5HS8A 5HDNA 1BOBA 2V9VA 3R6SA 2MFZA 3GLXA 2DT6A 2V4JC 1MBFA 4M3BA 5CVVA 3D0SA 3LSMA 2PJRA 2ZMEB 1YIOA 3FHZA 4CDGA 1T56A 4RA2A 4Y15A 1ZKGA 2IRFG 5FLVA 3W2VA 4NC7A 3L1PA 2MBFA 5CVUA 2L9RA 3ASNH 2CUJA 1OCRH 1GUUA 5J8CA 1SVOA 3DTIA 2TCTA 2HDCA 3S2WA 1VQ7I 4CSWA 1Y8QB 1ULYA 4UUSA 3ZQFA 5ILVA 2KRCA 1BBYA 1YS7A 4RB3C 2XASA 4BH9A 1YX3A 3RKQA 1BJZA 2DAOA 5DD8A 4HNTA 1VQ8I 1ZHFA 5DCMA 1Z6TA 1DP7P 2X6XA 4EJUA 2W25A 4EJVA 2KISA 4UUTA 5ED4A 2O6GE 3CCJI 1UG0A 4MQ9F 3O6BB 4FASD 1IO2A 4HQMA 2KT0A 2CWEA 1FP2A 4F55A 3M8EA 3HPGA 5HNFA 1XMXA 3C7JA 4AIKA 4UUVA 3HTUA 4XQFA 2EIKH 3E1SA 2EJRA 4IF4A 1W4MA 2EK5A 1FBSA 4O5VA 4AIJA 1PDNC 2YPRA 4HDUA 2IP2A 1G3WA 3C2GA 4E7ZA 2OZ6A 5IP9J 1TWFJ 3UKGA 1MBJA 4W97A 3E6MA 1NG6A 4GXOA 1KYWA 1FX7A 2OCEA 2HVRA 1SD7A 3H35A 5FLXZ 5D5WB 4A0ZA 3AL0C 2OZUA 1K78B 2JA6J 1OMIA 1TNTA 3TKYA 1X3UA 3E5XA 3MQ0A 1KONA 2O5RA 3AFHA 2NVXJ 1H88C 1HC8A 4BE2A 1XPXA 2JQ7A 1YG2A 1APLC 4BL0B 2EFNA 1ON2A 2XVCA 3EUAA 3TO6A 3ZP5A 2CQXA 1JKQC 3BG6A 2DQRA 1B6AA 3H0GJ 3V7RA 1RIOH 3CF5F 2P8TA 4IL6C 1E3OC 2VPLA 2NRAC 3EETA 1ZREA 4LG0B 1MBKA 2DYRH 1YITI 2DA3A 1WHUA 1QNTA 4P1WA 1IN6A 4A0XA 1FOXA 3P7NA 4PZJA 1VQLI 2P7CB 1D0XA 4K2EA 2R7OA 3PO3J 4UB6C 2EBIA 3C2HA 3SYTA 2CMPA 3T0YA 2XAHA 4ESJA 2QKMB 1MMNA 2HZDA 1WRJA 4M9SA 2HI3A 2STTA 2V1NA 3FXUA 1ZGJA 3WE3A 4KIFA 1A36A 1JUSA 2X0LA 3C2BA 5IYDJ 3RKXA 4X1EA 1R5ID 1RRJA 4EM2A 3U2RA 1R1UA 4M72A 1T0FA 5GP9A 3COAC 3SZGA 3K6GA 1LVKA 3SQNA 4DGWB 3DKWA 4J01A 3FMSA 4E7JA 3K2AA 3TP3A 4IHWA 3MZYA 3MKYB 2R5YA 3U21A 3JRBA 2YX7A 1Y1WJ 1AA7A 3HC7A 2DMNA 2DOEA 3ZQCA 3KEQA 2VKDA 3JRIA 2HPIA 1IN4A 1PVEA 2P81A 1NK3P 1Y0UA 2JZYA 4KIBA 1AWCA 2KZVA 3HSFA 2F5EA 1BI3A 2Q0OA 4P55A 3M1CA 1SEUA 3A1YA 5J1RA 3CUQA 3ZRGA 2XAJA 1U6GA 2HOSA 3WU1B 1BI2A 2ETHA 1QBJA 2O8XA 3KFWX 2JMWA 4UHTA 2Z2SB 1T38A 1IN8A 1O3TA 3CC2I 2KHMA 2I10A 4IOCF 2Z9OA 2X4HA 2GZWA 1X2NA 3WGGA 3HOSA 2HVQA 1ETWA 3PL8A 1SMYF 4HNVA 4LOCA 3GEZA 3TW7A 4Y3OA 4BBRJ 2F5DA 3RDIA 4AIHA 1O3SA 5D6FA 5IT3A 4KDPA 4B1RA 2QCOA 2VPRA 4R1HA 5DD4A
chains in the Genus database with same CATH topology
5D5UB 3KP6A 4RGRA 3BPXA 5LBQA 5LHGA 2F5FA 3PQKA 2F5CA 2M45A 2CG4A 3ZPLA 5E20A 2EV6A 2R7DA 3K1MA 4LLNA 1XSVA 4ZYHA 2GXBA 2JPCA 4GO1A 4G7ZF 4WF2A 3GXOA 1EH8A 1ZARA 2RKHA 4MGRA 4ESBA 2KIUA 5K1YA 3H3ZA 2LF8A 5EEGA 2M1BA 4BQAA 2OD5A 2HS5A 3EUHA 1P4XA 2CSOA 2RVCA 4BYYA 2EB7A 2P7VB 2HTSA 1LVAA 3T8TA 4M71A 1WQ2A 2BEOA 3J81Z 3J80K 4IHTA 4P5OA 1TNSA 2RV8A 2ADUA 4CXFA 5LEKA 1I27A 2XIGA 3DXJF 2IA2A 3M1EA 1U8RA 4U7DA 2K4JA 1H9GA 1DDNA 4AVPA 4EV0A 3OOPA 1KU3A 3C18A 1PP7U 2XKOA 5LGUA 2HKXA 1Z1DA 3F8MA 4GYIA 1XMAA 2PEXA 1XGOA 1REPC 3HIFA 4Q48A 1MJ9A 3RIRA 4Q5SF 5DYMA 4G6QA 1S7AA 3KLNA 2LNBA 1B59A 2XV4S 1J9IA 1P4WA 4ENKA 2NAZA 4U0YA 5HS9A 3HRSA 2FEZA 1U2WA 3HSEA 2HYGD 1IN7A 2E1CA 4P96A 3LFKA 2M5WA 1E2XA 3I4PA 3ZQ7A 1E17A 2DI3A 1DPRA 4IRIA 5LRRA 1LQ1A 3L00A 5L3FA 2KIFA 3WODF 5D8KB 3WTSC 4L9VA 4UXNA 1R00A 1T2KA 4WWCA 5DCMB 1R7JA 2D2WA 2YR2A 4HV6A 2G9WA 2IW5A 3V4GA 1C0WA 1TQMA 2BE5F 5D5VB 2FE3A 3HRUA 5FFXA 1OYWA 5CJ9A 1BI0A 5E17F 3SXYA 3F22A 1YW8A 2D1VA 3M7GA 1CF7A 5AIQA 2A6HF 3SFZA 3J81K 2WTEA 1EV7A 2EFOA 3IKTA 2GIVA 2CGPA 1T98A 3KP3A 4EQQA 2K86A 4N0BA 4RGUA 1G3YA 4HLYA 2HZTA 1R1VA 1Z9CA 1R36A 4WXHA 4WX9A 1J59A 1RUNA 2L3DA 1V4RA 1LJ9A 1P4AA 1JE8A 3T1BA 3I5UA 2FBKA 2IJLA 1YTYA 4N9IA 1MDMA 1XN7A 1ZN2A 3R4KA 5E8IA 2VOOA 1K79A 1O7FA 4OINF 2G7UA 2MC3A 4HF1A 3GFMA 1F9NA 2L01A 4BNCA 2L54A 4HQEA 5DUKA 3QU3A 2CW0F 2GWRA 4EM0B 2VT3A 2L4AA 1DPUA 2PJPA 5HLGA 5TJJA 3VEPA 4GCVA 3TO7A 1IAWA 5JVTA 4NQWA 3BOQA 3CUQB 4IRGA 4EGYA 2ZBKA 1FP1D 1XSDA 4Y17A 3TDZC 1O57A 1SFUA 1FYKA 4RGSA 3WG9A 4QLCU 1YYVA 2XHKA 1TQIA 1GHCA 1FYLA 1J75A 2EA2A 3CJNA 1ZRCA 3WTTC 4NHJA 2OA4A 1W7PA 1SD6A 4Z2YA 3K69A 1R1TA 3R60A 2Z33A 2W84A 3BP8A 5D8LB 2OQRA 3DF8A 4YG2F 1XDUA 3GX4X 2HQNA 2NYXA 1XGSA 2D45A 3K0LA 5CVIA 2DPUA 2GQQA 1W7PD 1USSA 2O03A 3CUQC 3BZ6A 4L0YB 2FQ3A 3GFIA 1SD4A 5ILSA 3I64A 3LAJA 1H9TA 3IRRA 4EJTA 4FHTA 4I01A 4IXAA 1HXDA 3WTUC 1I5ZA 4KT5C 1J5YA 4U88A 3GFLA 4YFKF 2PBIA 1QGPA 1WSUA 5DCFA 1MJAA 3IL2A 1MGTA 4G9YA 3RYRA 3BJAA 3RI4A 1ODDA 3DFGA 5BS6A 5HLHA 4WXCA 2HOEA 2OBPA 3QP6A 4DQ2A 1D3YA 3I58A 1R23A 2EV0A 5L3BA 3R0AA 3NEUA 2FU4A 2FNPA 1R5GA 3F6VA 1Z7UA 3SZPA 3LSTA 2XAQA 4JQFA 2VBZA 1TBXA 1HBXG 1ZLKA 2K4BA 5D5XB 1G6NA 4ASNA 2QYOA 1OKRA 4KFCA 2XAFA 3VB2A 1R5HA 4HYEA 5ICFA 5H20A 2V6CA 1YLFA 3B02A 3JAMK 3K1NA 5E1ZB 3H92A 4S04A 4E70A 1O3RA 1PP8F 3WE2A 3E6DA 1K6OA 2ISYA 2W85A 5CVJA 2Q2EA 3EYIA 2MD5A 3ROUA 4YIIA 3J7AO 4ENJA 3WTWC 3J80Z 1EH6A 2IVMA 4RB1A 3QP5A 4A5MA 2DQLA 2NNNA 3L9FA 1HKQA 2K27A 4CZZA 3E6BA 3BWGA 3GW2A 2NS0A 1IRGA 1XGNA 4F7ZA 1I1SA 3C1DA 5ICCA 3CO6C 3WTVC 2O61A 3JSOA 1XSXA 2K02A 4U0WA 5K5QA 1TLHB 2J5PA 2R3SA 3V7CA 2RN7A 2ZCWA 2ZJ2A 2HTJA 3FMQA 4AWXB 4LGWA 4MNUA 4RAYA 1CF7B 4CHUA 2HKOA 3E5QA 4BHPA 2VOPA 3FMRA 5LLQA 2E7WA 4LMYA 2M8EA 4OIOF 3ZMUA 4EVIA 1FYMA 2XAGA 4I09A 4YFNF 1ZLJA 1FPQA 3QOPA 2ELHA 4LLLA 1IXCA 3FM3A 1MDMB 3F3XA 3KCCA 2FBIA 3BDDA 1GVJA 1LDKB 5E1WA 2HGCA 2MH9A 2JTVA 3V8LA 4UV8A 1IRFA 3ZMDA 4OIPF 2GXGA 1ZRFA 1JHFA 2CQKA 3TO9A 1OR7A 4BHCA 3V7SA 2C6YA 3FM5A 2PG4A 1F5TA 4NB5A 3VFZA 2G7HA 3DPTA 3ZN1A 1TQPA 5FD5A 1W5TA 2PMHA 2ZFWA 3RTRA 1ZG3A 1FY7A 3RPQA 1UCRA 3FX3A 4O3MA 3K9TA 2LKPA 3GZ6A 2HEOA 2L02A 1AOYA 3CLOA 2QM3A 5HS7A 5L3DA 1T39A 2CFXA 5ILUA 1TW3A 2PQ8A 2FMLA 4PCQA 4Y13A 5LEJA 4XLPF 1FWZA 1J2XA 1SD5A 4IRHA 4UV9A 4OIRF 1W7PB 2A68F 2MLGA 3BJOA 3FWEA 1IUYA 1QZYA 3MZHA 2EV5A 2H27A 3O2PE 3JTGA 2FXAA 2IT0A 1R58A 2UWMA 2RDPA 5BQTA 1TTYA 3LWFA 5HDGA 4EJWA 3LQQA 3QAHA 3BY6A 2FRHA 1J7KA 3E3VA 3ZMTA 2H6CA 3MWMA 4M73A 3P9IA 1ZG5A 2ESHA 1UFMA 3D5LA 3HHHA 2W57A 3IHUA 4RB0A 1FBQA 1SMTA 2L4MA 3KP5A 4KYWA 3GWZA 4KUMA 4BAYA 1OYIA 3I59B 2FSWA 3Q9VA 1EH7A 2V1UA 2PI0A 1P6RA 2IA0A 3FXRA 2DBBA 1LNWA 4LB6B 2HFHA 5AONA 2P6SA 4JK1X 3WTYC 1FSHA 2A69F 3CO7C 1J0RA 4YIFA 3MCZA 2WC2A 3LAPA 4HX7A 3QPHA 5DDGA 4UVCA 3EDPA 2F2EA 4L5JA 3I0TA 4KN7X 5H6RA 5K5RA 4YFXF 4ON0A 3TGNA 2A5YB 4MHGA 3KP7A 5J8FA 4B09A 1BN5A 2VXZA 5F1RA 2B0LA 2XROA 4BXUA 3RYPA 5LRSA 3IC7A 2WV0A 5FO5A 2O0YA 1ZGAA 3WTXC 3JSPA 5KVRA 3F8FA 3MFKA 4A6EA 3ECOA 1Z6RA 3W6JB 4HDVA 1BC8C 3HSRA 3WTZA 3IKVA 5JFRA 3L2CA 2RQPA 4M9ZA 2YU3A 4O6JA 1HW5A 4EMSA 3RJPA 1ON1A 1YW9A 3KLOA 1I1GA 3QRFF 2Y48A 3KEOA 4CGZA 1K7AA 1ZH5A 4S05A 2DK8A 4ZH4F 1WKMA 4HX4A 4G8XA 3REOA 3HUGA 2MLKA 1UHWA 2VONA 2KJBA 1IXRC 3DEUA 4XLNF 3JAMZ 3KZZA 3M8FA 5HDKA 1QPMA 1KQ9A 4MTEA 1MJBA 4P9UA 1BM9A 2COMA 2VBYA 2A61A 2ZO4A 5KK1A 3H3UA 2QVOA 1S7OA 4RGXA 2PN6A 3F23A 3GVAA 4CYDA 1HKSA 2RC4A 3ECHA 2BV6A 1YFHA 2ZNZA 3F21A 5JR3A 4HV5A 4HLXA 2P5KA 4M74A 1S6LA 1HW1A 4A6DA 2YX4A 3FF5A 4KIGA 1OYYA 2JPBA 2A07F 5J6XA 2YSRA 3KP2A 3T5XA 1RZ4A 3I54A 4I02A 4ZZLA 5H6QA 3HHGA 3LA7A 5LHIA 4M6YA 3ZN0A 4OIQF 2OQGA 5BPDA 2KKOA 3G3ZA 5CVRA 4XRFA 2KIMA 3ABUA 2VC1A 2Y75A 3IWZA 4L9NA 2M87A 4XSZF 4KMFA 3MEXA 3I59A 2UXNA 5JHUA 5A2QK 3DQVC 1H0MA 3FZVA 4FT8A 1G3TA 3V8JA 2EFQA 2IPQX 1O3QA 2EFPA 3F6OA 3WU0A 4LK1F 5AIPA 3BPVA 3BJ6A 3ELKA 1HKTA 1B1BA 4HF0A 2P5VA 3CUOA 1F4KA 4KA4A 2A3SA 5HLIA 2D1HA 2DFIA 3OV8A 4XSXF 1S29A 3GFJA 1LDJA 2VE8A 2P5LC 2DPDA 2LF7A 4D0PA 4I98B 4IPAA 4OU0A 5EEHA 1GXPA 3WGHA 3W6KB 3ERED 1R22A 4I2OA 4IJAA 5BOXA 5F6FA 4IVNA 4ZYEA 1FC3A 2LSOA 1XMKA 4B8XA 3EYYA 2ZXJA 2DLLA 1KU9A 2XGXA 5DV5A 4EM1A 3BROA 5HOOA 1ONVA 4OOIA 2QQBA 2K7LA 2LDUA 1SFXA 3N97A 1VTNC 3AAFA 4RB2C 1YO5C 5BPIA 3R0JA 3F8NA 2CYYA 3HTSB 3TOBA 2V79A 3M9AA 1XGMA 1BOAA 3RPUA 2ZNYA 1UHMA 2ESNA 5IT9K 4HZFA 4PDKA 1HSJA 1Q1HA 3PFIA 3T8RA 1TW2A 5ERIA 2EFWA 4WXDA 1U5TA 2HR3A 4A0YA 2V1DA 1KGSA 3HYIA 1YS6A 1L0OC 4HX8A 2FOKA 4WCGA 1XCVA 4L9TA 2V1XA 2H94A 5F64A 2QUFA 3P9CA 1MZBA 4DNCA 1B9MA 1WI9A 1U78A 1B9NA 3F72A 1T6SA 4WK8F 2AXLA 1QO0D 1W5SA 1ZG1A 3HOTA 1DUXC 2Z3YA 1JGSA 2R7FA 4G7HF 3ULQB 4UVAA 1IXSB 3JTHA 3RKWA 2QQAA 5JI6A 4GGGA 2BBYA 1NHAA 4HBLA 1ZAOA 2VBWA 1OPCA 4M9XA 1RUOA 1XDSA 2XUBA 2ISZA 4EGZA 2Y0MA 4N9HA 2QBYA 1FNNA 1WWXA 4HA8A 3ZMVA 1KYZA 5LGTA 4Q47A 4QWQA 3L7WA 2J5OA 4H0EA 3QU6A 1MKMA 2DW4A 5FFZA 4MQVA 5FLXK 2WWYA 3HRTA 1IF1A 4A12A 4L9JA 1SFEA 2HYFA 1BC7C 4L18B 1U3EM 1FSEA 3L09A 3QPTA 3R61A 3SHFA 1IN5A 1BJAA 2ZMEA 5D6EA 4U0VA 2OAZA 1I6XA 1RI7A 1KU2A 3JW4A 5HVQC 5L3GA 3NRVA 5K5OA 4I7HA 1JXSA 3WGIA 4UVBA 2ACJA 5D4RA 1HSTA 4G6DA 2VE9A 2QLZA 3E5UA 3MAJA 4KN4X 3V8KA 4LK0F 3VODA 2PLYA 2RNJA 3TDUC 4ENMA 2DO7A 1LB2A 4U7BA 4LB5A 2UXXA 2PFBA 5E1XA 2KRFA 3FXQA 3LA2A 2GAUA 1L3LA 1KQ8A 4KNYA 4Q4ZF 3N4MA 3VOEA 3DPLC 4G7OF 3F8BA 4MTDA 1FLIA 5LGNA 2DU9A 4CICA 2GA2A 4I0AA 2VC0A 2XRNA 2AS5F 3ABTA 3K1PA 1K78A 2JSCA 2MH2A 4GYGA 3U9GA 1IZ1A 2CO5A 3O3KA 1XD7A 2FMYA 4HAMA 5DEQA 3Q9SA 2FNAA 3PQJA 4ZZDA 2VBXA 5ICGA 1FZPB 4P9FA 5CYVA 4LG0A 3E97A 1A04A 2XKPA 3KP4A 3IWFA 4UNOA 3ML6A 2VT2A 1P92A 2FBHA 2DTRA 4G94A 5E18F 2OU2A 2P4WA 3RKYA 1SAXA 1LEAA 6PAXA 3K2ZA 3EQLF 5FB2A 5TRDA 4RS8A 1Z05A 1B4AA 5LHHA 4LFUA 4MEYF 1V3FA 2KJCA 1IW7F 3U1DA 2EWNA 4CO8A 3KE2A 3P9KA 4LLGF 5L3EA 2HQRA 4HW0A 2M30A 1GXQA 1LEBA 1FT9A 4KMUX 3KZYA 4LD5A 1HQCA 4A5NA 1KA8A 3GZ5A 2FA5A 1D5VA 1YW7A 2Z99A 3TOAA 3CDHA 4IHSA 2QQ9A 3SZTA 3ZMSA 4ZYDA 3GYHX 1G3SA 5E8GA 1D8KA 2E7XA 2Q8KA 1USTA 4ESFA 1BI1A 5CLSA 1HW2A 4I0BA 2STWA 1S3JA 4HF2A 1STZA 1YQAA 2BGCA 4TV7A 1JHHA 3LQRA 2W24A 5A2QZ 4R79A 1F1ZA 2H09A 5ICEA 4L5IA 2GA1A 2H6BA 3B73A 4PGGA 1BIBA 3I71A 2VN2A 3G73A 1RNLA 4PGHA 2P6TA 4BHBA 1ZRDA 1QZZA 2Z5UA 3LA3A 1U5TB 2A6EF 1XB4A 1CGPA 4JBAA 1FBUA 4L0ZB 2PMUA 3TQNA 4M6XA 5L3CA 3GF2A 4XBFA 2FF4A 1FOKA 3NQOA 2O3FA 5FGMA 1O7LA 4AD9A 3E6CC 3GO5A 2TDXA 2RGVA 3CTAA 2UZKA 1Z91A 4FX0A 5BMZA 4FX4A 3I53A 3DV8A 4HOBA 4OMZA 4LJZF 4R8HA 1XCBA 1PUEE 1KQ0A 4EJOA 1S8NA 3Q5FA 2IA1A 1MD0A 2BYVE 1P2FA 1UB9A 1U5TC 5FD6A 3F8CA 1G4DA 2HWVA 2DK5A 4A2UA 3KETA 2QBYB 2VODA 4ETSA 2MA3A 5IT9Z 3IRQA 2NNYA 4KICA 2JRTA 3ISPA 5DUIA 2QWWA 2DT5A 1D8JA 2QZ8A 4ENNA 1LDDA 4OMYA 5D4SA 1KU7A 3ZMZA 4RAZA 2E1NA 1QQIA 1ZYRF 3DP7A 4ZYGA 4MEXF 3C3WA 3GUDA 3HRMA 2JT1A 2QENA 2EA4A 2ZKZA 1BIAA 5HS8A 5HDNA 2V9VA 3R6SA 3GLXA 5CVVA 3D0SA 2ZMEB 1YIOA 3FHZA 4CDGA 4Y15A 2IRFG 2MBFA 5CVUA 5J8CA 2HDCA 3S2WA 1ULYA 5ILVA 1BBYA 1YS7A 4RB3C 2XASA 4BH9A 5DD8A 2DAOA 1ZHFA 5DCMA 1Z6TA 1DP7P 4EJUA 2W25A 4EJVA 5ED4A 2O6GE 4MQ9F 3O6BB 4HQMA 2CWEA 1FP2A 3M8EA 3C7JA 4AIKA 4UUVA 3HTUA 2EJRA 4IF4A 1W4MA 2EK5A 1FBSA 4O5VA 4AIJA 1PDNC 2YPRA 4HDUA 2IP2A 1G3WA 2OZ6A 3E6MA 4GXOA 1KYWA 1FX7A 1SD7A 5FLXZ 5D5WB 4A0ZA 2OZUA 1K78B 1OMIA 1TNTA 3TKYA 1X3UA 3E5XA 3MQ0A 1YG2A 2EFNA 1ON2A 2XVCA 3TO6A 3ZP5A 2DQRA 1B6AA 1RIOH 3V7RA 2P8TA 2NRAC 3EETA 1ZREA 4LG0B 1QNTA 1IN6A 4A0XA 3P7NA 4PZJA 2P7CB 4K2EA 3T0YA 2XAHA 4ESJA 1WRJA 4M9SA 2STTA 3FXUA 1ZGJA 3WE3A 4KIFA 2X0LA 3RKXA 4EM2A 3U2RA 1R1UA 4M72A 1T0FA 3COAC 3SQNA 3DKWA 3FMSA 3MZYA 2YX7A 3KEQA 1IN4A 1Y0UA 2JZYA 4KIBA 1AWCA 3HSFA 2F5EA 1BI3A 2Q0OA 4P55A 3CUQA 2XAJA 1U6GA 3WU1B 1BI2A 2ETHA 1QBJA 2O8XA 3KFWX 1T38A 4UHTA 1IN8A 1O3TA 2Z9OA 2X4HA 2GZWA 3WGGA 3HOSA 1SMYF 3GEZA 4AIHA 2F5DA 3RDIA 1O3SA 5D6FA 5IT3A 4KDPA 4R1HA 5DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5U B;  3KP6 A;  4RGR A;  3BPX A;  5LBQ A;  5LHG A;  2F5F A;  3PQK A;  2F5C A;  2M45 A;  2CG4 A;  3ZPL A;  5E20 A;  2EV6 A;  2R7D A;  3K1M A;  4LLN A;  1XSV A;  4ZYH A;  2GXB A;  2JPC A;  4GO1 A;  4G7Z F;  4WF2 A;  3GXO A;  1EH8 A;  1ZAR A;  2RKH A;  4MGR A;  4ESB A;  2KIU A;  5K1Y A;  3H3Z A;  2LF8 A;  5EEG A;  2M1B A;  4BQA A;  2OD5 A;  2HS5 A;  3EUH A;  1P4X A;  2CSO A;  2RVC A;  4BYY A;  2EB7 A;  2P7V B;  2HTS A;  1LVA A;  3T8T A;  4M71 A;  1WQ2 A;  2BEO A;  3J81 Z;  3J80 K;  4IHT A;  4P5O A;  1TNS A;  2RV8 A;  2ADU A;  4CXF A;  5LEK A;  1I27 A;  2XIG A;  3DXJ F;  2IA2 A;  3M1E A;  1U8R A;  4U7D A;  2K4J A;  1H9G A;  1DDN A;  4AVP A;  4EV0 A;  3OOP A;  1KU3 A;  3C18 A;  1PP7 U;  2XKO A;  5LGU A;  2HKX A;  1Z1D A;  3F8M A;  4GYI A;  1XMA A;  2PEX A;  1XGO A;  1REP C;  3HIF A;  4Q48 A;  1MJ9 A;  3RIR A;  4Q5S F;  5DYM A;  4G6Q A;  1S7A A;  3KLN A;  2LNB A;  1B59 A;  2XV4 S;  1J9I A;  1P4W A;  4ENK A;  2NAZ A;  4U0Y A;  5HS9 A;  3HRS A;  2FEZ A;  1U2W A;  3HSE A;  2HYG D;  1IN7 A;  2E1C A;  4P96 A;  3LFK A;  2M5W A;  1E2X A;  3I4P A;  3ZQ7 A;  1E17 A;  2DI3 A;  1DPR A;  4IRI A;  5LRR A;  1LQ1 A;  3L00 A;  5L3F A;  2KIF A;  3WOD F;  5D8K B;  3WTS C;  4L9V A;  4UXN A;  1R00 A;  1T2K A;  4WWC A;  5DCM B;  1R7J A;  2D2W A;  2YR2 A;  4HV6 A;  2G9W A;  2IW5 A;  3V4G A;  1C0W A;  1TQM A;  2BE5 F;  5D5V B;  2FE3 A;  3HRU A;  5FFX A;  1OYW A;  5CJ9 A;  1BI0 A;  5E17 F;  3SXY A;  3F22 A;  1YW8 A;  2D1V A;  3M7G A;  1CF7 A;  5AIQ A;  2A6H F;  3SFZ A;  3J81 K;  2WTE A;  1EV7 A;  2EFO A;  3IKT A;  2GIV A;  2CGP A;  1T98 A;  3KP3 A;  4EQQ A;  2K86 A;  4N0B A;  4RGU A;  1G3Y A;  4HLY A;  2HZT A;  1R1V A;  1Z9C A;  1R36 A;  4WXH A;  4WX9 A;  1J59 A;  1RUN A;  2L3D A;  1V4R A;  1LJ9 A;  1P4A A;  1JE8 A;  3T1B A;  3I5U A;  2FBK A;  2IJL A;  1YTY A;  4N9I A;  1MDM A;  1XN7 A;  1ZN2 A;  3R4K A;  5E8I A;  2VOO A;  1K79 A;  1O7F A;  4OIN F;  2G7U A;  2MC3 A;  4HF1 A;  3GFM A;  1F9N A;  2L01 A;  4BNC A;  2L54 A;  4HQE A;  5DUK A;  3QU3 A;  2CW0 F;  2GWR A;  4EM0 B;  2VT3 A;  2L4A A;  1DPU A;  2PJP A;  5HLG A;  5TJJ A;  3VEP A;  4GCV A;  3TO7 A;  1IAW A;  5JVT A;  4NQW A;  3BOQ A;  3CUQ B;  4IRG A;  4EGY A;  2ZBK A;  1FP1 D;  1XSD A;  4Y17 A;  3TDZ C;  1O57 A;  1SFU A;  1FYK A;  4RGS A;  3WG9 A;  4QLC U;  1YYV A;  2XHK A;  1TQI A;  1GHC A;  1FYL A;  1J75 A;  2EA2 A;  3CJN A;  1ZRC A;  3WTT C;  4NHJ A;  2OA4 A;  1W7P A;  1SD6 A;  4Z2Y A;  3K69 A;  1R1T A;  3R60 A;  2Z33 A;  2W84 A;  3BP8 A;  5D8L B;  2OQR A;  3DF8 A;  4YG2 F;  1XDU A;  3GX4 X;  2HQN A;  2NYX A;  1XGS A;  2D45 A;  3K0L A;  5CVI A;  2DPU A;  2GQQ A;  1W7P D;  1USS A;  2O03 A;  3CUQ C;  3BZ6 A;  4L0Y B;  2FQ3 A;  3GFI A;  1SD4 A;  5ILS A;  3I64 A;  3LAJ A;  1H9T A;  3IRR A;  4EJT A;  4FHT A;  4I01 A;  4IXA A;  1HXD A;  3WTU C;  1I5Z A;  4KT5 C;  1J5Y A;  4U88 A;  3GFL A;  4YFK F;  2PBI A;  1QGP A;  1WSU A;  5DCF A;  1MJA A;  3IL2 A;  1MGT A;  4G9Y A;  3RYR A;  3BJA A;  3RI4 A;  1ODD A;  3DFG A;  5BS6 A;  5HLH A;  4WXC A;  2HOE A;  2OBP A;  3QP6 A;  4DQ2 A;  1D3Y A;  3I58 A;  1R23 A;  2EV0 A;  5L3B A;  3R0A A;  3NEU A;  2FU4 A;  2FNP A;  1R5G A;  3F6V A;  1Z7U A;  3SZP A;  3LST A;  2XAQ A;  4JQF A;  2VBZ A;  1TBX A;  1HBX G;  1ZLK A;  2K4B A;  5D5X B;  1G6N A;  4ASN A;  2QYO A;  1OKR A;  4KFC A;  2XAF A;  3VB2 A;  1R5H A;  4HYE A;  5ICF A;  5H20 A;  2V6C A;  1YLF A;  3B02 A;  3JAM K;  3K1N A;  5E1Z B;  3H92 A;  4S04 A;  4E70 A;  1O3R A;  1PP8 F;  3WE2 A;  3E6D A;  1K6O A;  2ISY A;  2W85 A;  5CVJ A;  2Q2E A;  3EYI A;  2MD5 A;  3ROU A;  4YII A;  3J7A O;  4ENJ A;  3WTW C;  3J80 Z;  1EH6 A;  2IVM A;  4RB1 A;  3QP5 A;  4A5M A;  2DQL A;  2NNN A;  3L9F A;  1HKQ A;  2K27 A;  4CZZ A;  3E6B A;  3BWG A;  3GW2 A;  2NS0 A;  1IRG A;  1XGN A;  4F7Z A;  1I1S A;  3C1D A;  5ICC A;  3CO6 C;  3WTV C;  2O61 A;  3JSO A;  1XSX A;  2K02 A;  4U0W A;  5K5Q A;  1TLH B;  2J5P A;  2R3S A;  3V7C A;  2RN7 A;  2ZCW A;  2ZJ2 A;  2HTJ A;  3FMQ A;  4AWX B;  4LGW A;  4MNU A;  4RAY A;  1CF7 B;  4CHU A;  2HKO A;  3E5Q A;  4BHP A;  2VOP A;  3FMR A;  5LLQ A;  2E7W A;  4LMY A;  2M8E A;  4OIO F;  3ZMU A;  4EVI A;  1FYM A;  2XAG A;  4I09 A;  4YFN F;  1ZLJ A;  1FPQ A;  3QOP A;  2ELH A;  4LLL A;  1IXC A;  3FM3 A;  1MDM B;  3F3X A;  3KCC A;  2FBI A;  3BDD A;  1GVJ A;  1LDK B;  5E1W A;  2HGC A;  2MH9 A;  2JTV A;  3V8L A;  4UV8 A;  1IRF A;  3ZMD A;  4OIP F;  2GXG A;  1ZRF A;  1JHF A;  2CQK A;  3TO9 A;  1OR7 A;  4BHC A;  3V7S A;  2C6Y A;  3FM5 A;  2PG4 A;  1F5T A;  4NB5 A;  3VFZ A;  2G7H A;  3DPT A;  3ZN1 A;  1TQP A;  5FD5 A;  1W5T A;  2PMH A;  2ZFW A;  3RTR A;  1ZG3 A;  1FY7 A;  3RPQ A;  1UCR A;  3FX3 A;  4O3M A;  3K9T A;  2LKP A;  3GZ6 A;  2HEO A;  2L02 A;  1AOY A;  3CLO A;  2QM3 A;  5HS7 A;  5L3D A;  1T39 A;  2CFX A;  5ILU A;  1TW3 A;  2PQ8 A;  2FML A;  4PCQ A;  4Y13 A;  5LEJ A;  4XLP F;  1FWZ A;  1J2X A;  1SD5 A;  4IRH A;  4UV9 A;  4OIR F;  1W7P B;  2A68 F;  2MLG A;  3BJO A;  3FWE A;  1IUY A;  1QZY A;  3MZH A;  2EV5 A;  2H27 A;  3O2P E;  3JTG A;  2FXA A;  2IT0 A;  1R58 A;  2UWM A;  2RDP A;  5BQT A;  1TTY A;  3LWF A;  5HDG A;  4EJW A;  3LQQ A;  3QAH A;  3BY6 A;  2FRH A;  1J7K A;  3E3V A;  3ZMT A;  2H6C A;  3MWM A;  4M73 A;  3P9I A;  1ZG5 A;  2ESH A;  1UFM A;  3D5L A;  3HHH A;  2W57 A;  3IHU A;  4RB0 A;  1FBQ A;  1SMT A;  2L4M A;  3KP5 A;  4KYW A;  3GWZ A;  4KUM A;  4BAY A;  1OYI A;  3I59 B;  2FSW A;  3Q9V A;  1EH7 A;  2V1U A;  2PI0 A;  1P6R A;  2IA0 A;  3FXR A;  2DBB A;  1LNW A;  4LB6 B;  2HFH A;  5AON A;  2P6S A;  4JK1 X;  3WTY C;  1FSH A;  2A69 F;  3CO7 C;  1J0R A;  4YIF A;  3MCZ A;  2WC2 A;  3LAP A;  4HX7 A;  3QPH A;  5DDG A;  4UVC A;  3EDP A;  2F2E A;  4L5J A;  3I0T A;  4KN7 X;  5H6R A;  5K5R A;  4YFX F;  4ON0 A;  3TGN A;  2A5Y B;  4MHG A;  3KP7 A;  5J8F A;  4B09 A;  1BN5 A;  2VXZ A;  5F1R A;  2B0L A;  2XRO A;  4BXU A;  3RYP A;  5LRS A;  3IC7 A;  2WV0 A;  5FO5 A;  2O0Y A;  1ZGA A;  3WTX C;  3JSP A;  5KVR A;  3F8F A;  3MFK A;  4A6E A;  3ECO A;  1Z6R A;  3W6J B;  4HDV A;  1BC8 C;  3HSR A;  3WTZ A;  3IKV A;  5JFR A;  3L2C A;  2RQP A;  4M9Z A;  2YU3 A;  4O6J A;  1HW5 A;  4EMS A;  3RJP A;  1ON1 A;  1YW9 A;  3KLO A;  1I1G A;  3QRF F;  2Y48 A;  3KEO A;  4CGZ A;  1K7A A;  1ZH5 A;  4S05 A;  2DK8 A;  4ZH4 F;  1WKM A;  4HX4 A;  4G8X A;  3REO A;  3HUG A;  2MLK A;  1UHW A;  2VON A;  2KJB A;  1IXR C;  3DEU A;  4XLN F;  3JAM Z;  3KZZ A;  3M8F A;  5HDK A;  1QPM A;  1KQ9 A;  4MTE A;  1MJB A;  4P9U A;  1BM9 A;  2COM A;  2VBY A;  2A61 A;  2ZO4 A;  5KK1 A;  3H3U A;  2QVO A;  1S7O A;  4RGX A;  2PN6 A;  3F23 A;  3GVA A;  4CYD A;  1HKS A;  2RC4 A;  3ECH A;  2BV6 A;  1YFH A;  2ZNZ A;  3F21 A;  5JR3 A;  4HV5 A;  4HLX A;  2P5K A;  4M74 A;  1S6L A;  1HW1 A;  4A6D A;  2YX4 A;  3FF5 A;  4KIG A;  1OYY A;  2JPB A;  2A07 F;  5J6X A;  2YSR A;  3KP2 A;  3T5X A;  1RZ4 A;  3I54 A;  4I02 A;  4ZZL A;  5H6Q A;  3HHG A;  3LA7 A;  5LHI A;  4M6Y A;  3ZN0 A;  4OIQ F;  2OQG A;  5BPD A;  2KKO A;  3G3Z A;  5CVR A;  4XRF A;  2KIM A;  3ABU A;  2VC1 A;  2Y75 A;  3IWZ A;  4L9N A;  2M87 A;  4XSZ F;  4KMF A;  3MEX A;  3I59 A;  2UXN A;  5JHU A;  5A2Q K;  3DQV C;  1H0M A;  3FZV A;  4FT8 A;  1G3T A;  3V8J A;  2EFQ A;  2IPQ X;  1O3Q A;  2EFP A;  3F6O A;  3WU0 A;  4LK1 F;  5AIP A;  3BPV A;  3BJ6 A;  3ELK A;  1HKT A;  1B1B A;  4HF0 A;  2P5V A;  3CUO A;  1F4K A;  4KA4 A;  2A3S A;  5HLI A;  2D1H A;  2DFI A;  3OV8 A;  4XSX F;  1S29 A;  3GFJ A;  1LDJ A;  2VE8 A;  2P5L C;  2DPD A;  2LF7 A;  4D0P A;  4I98 B;  4IPA A;  4OU0 A;  5EEH A;  1GXP A;  3WGH A;  3W6K B;  3ERE D;  1R22 A;  4I2O A;  4IJA A;  5BOX A;  5F6F A;  4IVN A;  4ZYE A;  1FC3 A;  2LSO A;  1XMK A;  4B8X A;  3EYY A;  2ZXJ A;  2DLL A;  1KU9 A;  2XGX A;  5DV5 A;  4EM1 A;  3BRO A;  5HOO A;  1ONV A;  4OOI A;  2QQB A;  2K7L A;  2LDU A;  1SFX A;  3N97 A;  1VTN C;  3AAF A;  4RB2 C;  1YO5 C;  5BPI A;  3R0J A;  3F8N A;  2CYY A;  3HTS B;  3TOB A;  2V79 A;  3M9A A;  1XGM A;  1BOA A;  3RPU A;  2ZNY A;  1UHM A;  2ESN A;  5IT9 K;  4HZF A;  4PDK A;  1HSJ A;  1Q1H A;  3PFI A;  3T8R A;  1TW2 A;  5ERI A;  2EFW A;  4WXD A;  1U5T A;  2HR3 A;  4A0Y A;  2V1D A;  1KGS A;  3HYI A;  1YS6 A;  1L0O C;  4HX8 A;  2FOK A;  4WCG A;  1XCV A;  4L9T A;  2V1X A;  2H94 A;  5F64 A;  2QUF A;  3P9C A;  1MZB A;  4DNC A;  1B9M A;  1WI9 A;  1U78 A;  1B9N A;  3F72 A;  1T6S A;  4WK8 F;  2AXL A;  1QO0 D;  1W5S A;  1ZG1 A;  3HOT A;  1DUX C;  2Z3Y A;  1JGS A;  2R7F A;  4G7H F;  3ULQ B;  4UVA A;  1IXS B;  3JTH A;  3RKW A;  2QQA A;  5JI6 A;  4GGG A;  2BBY A;  1NHA A;  4HBL A;  1ZAO A;  2VBW A;  1OPC A;  4M9X A;  1RUO A;  1XDS A;  2XUB A;  2ISZ A;  4EGZ A;  2Y0M A;  4N9H A;  2QBY A;  1FNN A;  1WWX A;  4HA8 A;  3ZMV A;  1KYZ A;  5LGT A;  4Q47 A;  4QWQ A;  3L7W A;  2J5O A;  4H0E A;  3QU6 A;  1MKM A;  2DW4 A;  5FFZ A;  4MQV A;  5FLX K;  2WWY A;  3HRT A;  1IF1 A;  4A12 A;  4L9J A;  1SFE A;  2HYF A;  1BC7 C;  4L18 B;  1U3E M;  1FSE A;  3L09 A;  3QPT A;  3R61 A;  3SHF A;  1IN5 A;  1BJA A;  2ZME A;  5D6E A;  4U0V A;  2OAZ A;  1I6X A;  1RI7 A;  1KU2 A;  3JW4 A;  5HVQ C;  5L3G A;  3NRV A;  5K5O A;  4I7H A;  1JXS A;  3WGI A;  4UVB A;  2ACJ A;  5D4R A;  1HST A;  4G6D A;  2VE9 A;  2QLZ A;  3E5U A;  3MAJ A;  4KN4 X;  3V8K A;  4LK0 F;  3VOD A;  2PLY A;  2RNJ A;  3TDU C;  4ENM A;  2DO7 A;  1LB2 A;  4U7B A;  4LB5 A;  2UXX A;  2PFB A;  5E1X A;  2KRF A;  3FXQ A;  3LA2 A;  2GAU A;  1L3L A;  1KQ8 A;  4KNY A;  4Q4Z F;  3N4M A;  3VOE A;  3DPL C;  4G7O F;  3F8B A;  4MTD A;  1FLI A;  5LGN A;  2DU9 A;  4CIC A;  2GA2 A;  4I0A A;  2VC0 A;  2XRN A;  2AS5 F;  3ABT A;  3K1P A;  1K78 A;  2JSC A;  2MH2 A;  4GYG A;  3U9G A;  1IZ1 A;  2CO5 A;  3O3K A;  1XD7 A;  2FMY A;  4HAM A;  5DEQ A;  3Q9S A;  2FNA A;  3PQJ A;  4ZZD A;  2VBX A;  5ICG A;  1FZP B;  4P9F A;  5CYV A;  4LG0 A;  3E97 A;  1A04 A;  2XKP A;  3KP4 A;  3IWF A;  4UNO A;  3ML6 A;  2VT2 A;  1P92 A;  2FBH A;  2DTR A;  4G94 A;  5E18 F;  2OU2 A;  2P4W A;  3RKY A;  1SAX A;  1LEA A;  6PAX A;  3K2Z A;  3EQL F;  5FB2 A;  5TRD A;  4RS8 A;  1Z05 A;  1B4A A;  5LHH A;  4LFU A;  4MEY F;  1V3F A;  2KJC A;  1IW7 F;  3U1D A;  2EWN A;  4CO8 A;  3KE2 A;  3P9K A;  4LLG F;  5L3E A;  2HQR A;  4HW0 A;  2M30 A;  1GXQ A;  1LEB A;  1FT9 A;  4KMU X;  3KZY A;  4LD5 A;  1HQC A;  4A5N A;  1KA8 A;  3GZ5 A;  2FA5 A;  1D5V A;  1YW7 A;  2Z99 A;  3TOA A;  3CDH A;  4IHS A;  2QQ9 A;  3SZT A;  3ZMS A;  4ZYD A;  3GYH X;  1G3S A;  5E8G A;  1D8K A;  2E7X A;  2Q8K A;  1UST A;  4ESF A;  1BI1 A;  5CLS A;  1HW2 A;  4I0B A;  2STW A;  1S3J A;  4HF2 A;  1STZ A;  1YQA A;  2BGC A;  4TV7 A;  1JHH A;  3LQR A;  2W24 A;  5A2Q Z;  4R79 A;  1F1Z A;  2H09 A;  5ICE A;  4L5I A;  2GA1 A;  2H6B A;  3B73 A;  4PGG A;  1BIB A;  3I71 A;  2VN2 A;  3G73 A;  1RNL A;  4PGH A;  2P6T A;  4BHB A;  1ZRD A;  1QZZ A;  2Z5U A;  3LA3 A;  1U5T B;  2A6E F;  1XB4 A;  1CGP A;  4JBA A;  1FBU A;  4L0Z B;  2PMU A;  3TQN A;  4M6X A;  5L3C A;  3GF2 A;  4XBF A;  2FF4 A;  1FOK A;  3NQO A;  2O3F A;  5FGM A;  1O7L A;  4AD9 A;  3E6C C;  3GO5 A;  2TDX A;  2RGV A;  3CTA A;  2UZK A;  1Z91 A;  4FX0 A;  5BMZ A;  4FX4 A;  3I53 A;  3DV8 A;  4HOB A;  4OMZ A;  4LJZ F;  4R8H A;  1XCB A;  1PUE E;  1KQ0 A;  4EJO A;  1S8N A;  3Q5F A;  2IA1 A;  1MD0 A;  2BYV E;  1P2F A;  1UB9 A;  1U5T C;  5FD6 A;  3F8C A;  1G4D A;  2HWV A;  2DK5 A;  4A2U A;  3KET A;  2QBY B;  2VOD A;  4ETS A;  2MA3 A;  5IT9 Z;  3IRQ A;  2NNY A;  4KIC A;  2JRT A;  3ISP A;  5DUI A;  2QWW A;  2DT5 A;  1D8J A;  2QZ8 A;  4ENN A;  1LDD A;  4OMY A;  5D4S A;  1KU7 A;  3ZMZ A;  4RAZ A;  2E1N A;  1QQI A;  1ZYR F;  3DP7 A;  4ZYG A;  4MEX F;  3C3W A;  3GUD A;  3HRM A;  2JT1 A;  2QEN A;  2EA4 A;  2ZKZ A;  1BIA A;  5HS8 A;  5HDN A;  2V9V A;  3R6S A;  3GLX A;  5CVV A;  3D0S A;  2ZME B;  1YIO A;  3FHZ A;  4CDG A;  4Y15 A;  2IRF G;  2MBF A;  5CVU A;  5J8C A;  2HDC A;  3S2W A;  1ULY A;  5ILV A;  1BBY A;  1YS7 A;  4RB3 C;  2XAS A;  4BH9 A;  5DD8 A;  2DAO A;  1ZHF A;  5DCM A;  1Z6T A;  1DP7 P;  4EJU A;  2W25 A;  4EJV A;  5ED4 A;  2O6G E;  4MQ9 F;  3O6B B;  4HQM A;  2CWE A;  1FP2 A;  3M8E A;  3C7J A;  4AIK A;  4UUV A;  3HTU A;  2EJR A;  4IF4 A;  1W4M A;  2EK5 A;  1FBS A;  4O5V A;  4AIJ A;  1PDN C;  2YPR A;  4HDU A;  2IP2 A;  1G3W A;  2OZ6 A;  3E6M A;  4GXO A;  1KYW A;  1FX7 A;  1SD7 A;  5FLX Z;  5D5W B;  4A0Z A;  2OZU A;  1K78 B;  1OMI A;  1TNT A;  3TKY A;  1X3U A;  3E5X A;  3MQ0 A;  1YG2 A;  2EFN A;  1ON2 A;  2XVC A;  3TO6 A;  3ZP5 A;  2DQR A;  1B6A A;  1RIO H;  3V7R A;  2P8T A;  2NRA C;  3EET A;  1ZRE A;  4LG0 B;  1QNT A;  1IN6 A;  4A0X A;  3P7N A;  4PZJ A;  2P7C B;  4K2E A;  3T0Y A;  2XAH A;  4ESJ A;  1WRJ A;  4M9S A;  2STT A;  3FXU A;  1ZGJ A;  3WE3 A;  4KIF A;  2X0L A;  3RKX A;  4EM2 A;  3U2R A;  1R1U A;  4M72 A;  1T0F A;  3COA C;  3SQN A;  3DKW A;  3FMS A;  3MZY A;  2YX7 A;  3KEQ A;  1IN4 A;  1Y0U A;  2JZY A;  4KIB A;  1AWC A;  3HSF A;  2F5E A;  1BI3 A;  2Q0O A;  4P55 A;  3CUQ A;  2XAJ A;  1U6G A;  3WU1 B;  1BI2 A;  2ETH A;  1QBJ A;  2O8X A;  3KFW X;  1T38 A;  4UHT A;  1IN8 A;  1O3T A;  2Z9O A;  2X4H A;  2GZW A;  3WGG A;  3HOS A;  1SMY F;  3GEZ A;  4AIH A;  2F5D A;  3RDI A;  1O3S A;  5D6F A;  5IT3 A;  4KDP A;  4R1H A;  5DD4 A; 
#chains in the Genus database with same CATH topology
 5D5U B;  3KP6 A;  3SDB A;  4C3J J;  4RGR A;  1YRN B;  3BPX A;  5LBQ A;  1I6H J;  5LHG A;  4IO9 F;  2F5F A;  3IUO A;  1LFP A;  3ABK H;  4GDF A;  3PQK A;  3SJM A;  3I3L A;  2F5C A;  2M45 A;  2CG4 A;  1A31 A;  2GLO A;  3ZPL A;  5E20 A;  2EV6 A;  2R7D A;  3K1M A;  1ETX A;  4LLN A;  1XSV A;  1NTC A;  3VPR A;  4ZYH A;  5E3M A;  5EG0 B;  2GXB A;  5JVG F;  2JPC A;  4GO1 A;  4G7Z F;  1TT5 B;  1DP3 A;  4WF2 A;  3FIW A;  3GXO A;  3OS0 A;  1EH8 A;  3ZGK A;  1ZAR A;  2RKH A;  3DU5 A;  3BQY A;  2V9P A;  4MGR A;  4ESB A;  2KIU A;  5K1Y A;  3H3Z A;  2LF8 A;  5EEG A;  2M1B A;  5EDN A;  5FJ8 J;  4BQA A;  3AG4 H;  1TWC J;  4PK4 A;  2DJI A;  2RRE A;  2Y0S A;  2OD5 A;  2LBF B;  5IY5 H;  2HS5 A;  2MSY A;  3G1M A;  3EUH A;  3IH4 A;  1P4X A;  2OC6 A;  2CSO A;  2RVC A;  2DA1 A;  2CQN A;  4BYY A;  2EB7 A;  2CV0 A;  2P7V B;  1RR8 C;  2HTS A;  1TWG J;  1LVA A;  4CH7 A;  4YIR X;  1WJC A;  5FKN A;  2L7M P;  3T8T A;  4M71 A;  1WQ2 A;  3FHN A;  2BEO A;  3J81 Z;  3J80 K;  5F1J A;  1N77 A;  4IHT A;  3ZQH A;  1LFB A;  1TNS A;  2RV8 A;  4P5O A;  4MFE A;  2ADU A;  5LFA A;  3J7A Y;  1QHG A;  4CXF A;  3OR2 C;  2EZL A;  1MBH A;  5LEK A;  2VLA A;  1I27 A;  4RAG A;  2XIG A;  3HGY A;  4XRM A;  3DXJ F;  4JP0 A;  4GRI A;  3OYC A;  2IA2 A;  3BR1 A;  4A3E J;  2ZFU A;  3M1E A;  1YJN I;  4U7D A;  1U8R A;  2OJE D;  1Y39 A;  4NNJ A;  2VI6 A;  2YS9 A;  1H8A C;  2K4J A;  1H9G A;  1RES A;  2HQ5 A;  1DDN A;  4F52 A;  2HNH A;  4AVP A;  3OYG A;  4EV0 A;  3PSI A;  3OOP A;  4FE4 A;  4F92 B;  3KIO A;  1KU3 A;  1JJ8 C;  3A2K A;  2E2I J;  3C18 A;  3TED A;  2XF6 A;  1PP7 U;  1IGN A;  2XKO A;  5LGU A;  2HKX A;  1Y8R B;  4D5C A;  1Z1D A;  3OYJ A;  2X6W A;  3QYE A;  4C3H J;  2X51 A;  3OIP A;  4N4N B;  2LLK A;  2JVG A;  2ZJP F;  1BR2 A;  1X1C A;  3F8M A;  4GYI A;  1XMA A;  3CMY A;  2PEX A;  1XGO A;  1X4O A;  3GZN B;  1REP C;  3MN2 A;  4ZTF A;  3HIF A;  4Q48 A;  2L7Z A;  1WCM J;  1MJ9 A;  3RIR A;  4Q5S F;  1TWH J;  5DYM A;  3PFY A;  4G6Q A;  1S7A A;  4C2T A;  3QOE A;  1N25 A;  3KLN A;  1DGR M;  2LNB A;  1IRX A;  3O8H A;  3LSR A;  1W36 C;  1B59 A;  4A3G J;  5FRM A;  3HM5 A;  1S5L C;  2XV4 S;  4BU2 A;  1J9I A;  1Y56 A;  4LIT A;  1P4W A;  2W82 A;  4ENK A;  2NAZ A;  4U0Y A;  5HS9 A;  3HRS A;  3CCM I;  3H5A A;  1ETY A;  1HOM A;  4XOR A;  2PJR B;  2FEZ A;  2KP6 A;  2LMD A;  3LL7 A;  1U2W A;  3M8J A;  3W3C A;  2ZSH B;  3HSE A;  4E4H A;  2HYG D;  1IN7 A;  2M4K A;  2E1C A;  2Y9Y A;  4P96 A;  3LFK A;  3FKJ A;  1PJR A;  2M5W A;  3VYT B;  3HB9 A;  2M7A A;  4DIQ A;  1E2X A;  3I4P A;  3ZQ7 A;  3FK7 A;  1E17 A;  2JA5 J;  2VB6 A;  2DI3 A;  4ZTJ A;  1IDY A;  1DPR A;  1YOV B;  4IRI A;  5LRR A;  1AKH A;  2VKH A;  1LQ1 A;  1WH7 A;  2ME0 A;  4UUS B;  3L00 A;  3G71 I;  5L3F A;  2KIF A;  3WOD F;  5D8K B;  2R5Z A;  3WTS C;  2A05 A;  4D7M A;  3JRG A;  3L2V A;  2BXY A;  4L9V A;  4UXN A;  1R00 A;  1T2K A;  4WWC A;  5IOY A;  3OYI A;  2NVT J;  3BG7 A;  5DCM B;  3MZ8 A;  3QWL A;  5GAH J;  1B72 A;  1Z77 A;  2VJ5 A;  1YE9 A;  3S1N J;  1R7J A;  4A3K J;  2D2W A;  2BXZ A;  5J1Y A;  1MMA A;  2YR2 A;  1TL8 A;  2WAQ N;  1MIJ A;  4HV6 A;  2G9W A;  3JRF A;  2IW5 A;  3ZQL A;  3V4G A;  1VQO I;  1C0W A;  3OS2 A;  2EIJ H;  3QOD A;  1TQM A;  3NAU A;  2BE5 F;  5D5V B;  1Q1V A;  4D9J A;  1Z21 A;  2FE3 A;  1VQM I;  3CDL A;  4MIM A;  2BY1 A;  3HRU A;  5FFX A;  1ZTR A;  1OYW A;  5CJ9 A;  1BI0 A;  3FBN B;  5E17 F;  3SXY A;  3F22 A;  1YW8 A;  2D1V A;  3M7G A;  5FKL A;  1CF7 A;  5AIQ A;  2A6H F;  1ETO A;  3SFZ A;  1MH3 A;  3J81 K;  2WTE A;  2HPM A;  1EV7 A;  2GXA A;  2EFO A;  1VQN I;  3IKT A;  2FX0 A;  5KCM A;  2GIV A;  5LD2 C;  4XOP A;  4DYQ A;  2HU9 A;  2OUM A;  4E7H A;  4XL9 A;  1T98 A;  2CGP A;  3PNY A;  1SAN A;  5M5X J;  3KP3 A;  3CES A;  4EQQ A;  3AG1 H;  2K86 A;  4N0B A;  4RGU A;  4RM2 A;  1D0Y A;  1G3Y A;  4HLY A;  1X19 A;  2VJ4 A;  2Y2Z A;  3OL4 A;  3LSG A;  2HZT A;  1R49 A;  4H4K C;  2KLO A;  2IBD A;  4V2F A;  1R1V A;  1D1C A;  3BG5 A;  1Z9C A;  1R36 A;  2BHZ A;  4WXH A;  4WX9 A;  5EGO A;  1J59 A;  1RUN A;  2L3D A;  1V4R A;  1TT0 A;  1LJ9 A;  1P4A A;  1JE8 A;  3T1B A;  2FQ4 A;  4IKF A;  3I5U A;  2LKS A;  4LIV A;  3G1O A;  3PJR A;  2M4G A;  2FBK A;  3HG9 A;  2IJL A;  1YTY A;  1A5J A;  3N05 A;  4N9I A;  1IV8 A;  4XN3 A;  1MDM A;  4FE7 A;  1XN7 A;  1ZN2 A;  3R4K A;  3E7L A;  5E8I A;  2VOO A;  1K79 A;  3S2H J;  2UUZ A;  1O7F A;  4OIN F;  2LFB A;  2IGN A;  5KAF C;  2G7U A;  2MC3 A;  1N75 A;  2VKV A;  3KYC B;  3CCS I;  4HF1 A;  1UG2 A;  5B66 C;  3GFM A;  2EIL H;  4M3G A;  5C44 J;  3DBR B;  3A02 A;  1MSF C;  2WAD A;  3BR3 A;  1F9N A;  2WB1 A;  1R4N B;  2L01 A;  4BNC A;  2L54 A;  4HQE A;  2VJJ A;  2EPF A;  2E71 A;  5DUK A;  3QU3 A;  2CW0 F;  2GWR A;  4EM0 B;  1CQT A;  2VT3 A;  2ELJ A;  2L4A A;  1DPU A;  2R5Y B;  4MLO A;  2PJP A;  2CUE A;  5HLG A;  3S1Q J;  2M34 A;  5TJJ A;  5F27 A;  3VEP A;  4DW6 A;  3KYL A;  1MMS A;  4GCV A;  3TO7 A;  1IAW A;  5JVT A;  4NQW A;  3BOQ A;  3CUQ B;  4IRG A;  4EGY A;  2E1M B;  3GTM J;  2ZBK A;  1FP1 D;  3CCE I;  1XSD A;  1LE8 A;  4Y17 A;  3TDZ C;  2RNG A;  1O57 A;  4RMN A;  1SFU A;  1I3A A;  2NVQ J;  3RCO A;  1FYK A;  3HZJ A;  4RGS A;  3WG9 A;  1OCZ H;  4QLC U;  1YYV A;  1P7J A;  2I8D A;  2XHK A;  1TQI A;  1GHC A;  4AVZ A;  1FYL A;  3G1L A;  3QYF A;  2GOX B;  3HL2 A;  1J75 A;  3LSJ A;  2EA2 A;  4A3B J;  2QQ8 A;  3CJN A;  3W6V A;  1ZRC A;  3WTT C;  4NHJ A;  2OA4 A;  4A3L J;  3BLY A;  1W7P A;  1P7I A;  1SD6 A;  4Z2Y A;  2XC7 A;  2DMU A;  3FXO A;  3K69 A;  1R1T A;  1T95 A;  3R60 A;  2RAE A;  4N4O B;  1TC3 C;  2EIN H;  3FBI B;  1W36 D;  4J19 A;  2Z33 A;  1T0F C;  2CQQ A;  2OV7 A;  2W84 A;  3BR5 A;  3BP8 A;  2KRH A;  5D8L B;  4QTR A;  4C2M J;  2OQR A;  1WFX A;  3DF8 A;  3CP2 A;  3I56 I;  2OCC H;  4YG2 F;  3L2Q A;  1XDU A;  4QSH A;  4KIS A;  3GX4 X;  1PYV A;  1UHS A;  2QA4 I;  1X1P A;  2HQN A;  2LRE A;  2NYX A;  3E0J B;  1XGS A;  4IEJ A;  3UR3 C;  4EAT A;  2XSJ C;  3G2B A;  2D45 A;  3TMO A;  3K0L A;  5CVI A;  2DPU A;  2A5W A;  4XID A;  3PSF A;  2H8R A;  2K3F A;  2GQQ A;  1W7P D;  1USS A;  3OYF A;  2O03 A;  4J00 A;  3NAR A;  4CCN A;  3KZI C;  3CUQ C;  3JRD A;  2L2O A;  3BZ6 A;  3ZOB A;  4L0Y B;  2FQ3 A;  1JUM A;  4BY7 J;  2RQQ A;  3ABM H;  3GFI A;  1SD4 A;  5ILS A;  4E7I A;  2FOW A;  3I64 A;  2OF7 A;  2WAF A;  3BZK A;  3LAJ A;  1FJL A;  2DDB A;  1H9T A;  2QSH X;  1FIA A;  3IRR A;  4EJT A;  2GM4 A;  4FTH A;  4FHT A;  4I01 A;  4AYB A;  4IXA A;  1HXD A;  4XRS A;  3WTU C;  1I5Z A;  4KT5 C;  1J5Y A;  5E79 C;  1H89 C;  3S17 J;  2K5C A;  4U88 A;  3GFL A;  3P5J A;  3AL0 B;  4YFK F;  1U9N A;  2PBI A;  1QGP A;  2WB1 N;  1WSU A;  5B1A H;  5DCF A;  5J1U A;  1MJA A;  3IL2 A;  1MGT A;  4G9Y A;  1KZH A;  5IYB J;  3RYR A;  2HDD A;  1MMG A;  3CP8 A;  3BJA A;  3OOU A;  2XF7 A;  4Y52 J;  3RI4 A;  1ODD A;  3DFG A;  3TW6 A;  2CH0 A;  1I50 J;  4DZJ A;  5BS6 A;  5HLH A;  4WXC A;  2HOE A;  2OBP A;  2DA2 A;  3QP6 A;  3GTQ J;  4DQ2 A;  1E3P A;  5F08 A;  1D3Y A;  1D1A A;  2BY2 A;  3M07 A;  1POG A;  1R23 A;  2EV0 A;  3I58 A;  3R0A A;  5L3B A;  4A3I J;  3NEU A;  2FU4 A;  1Z67 A;  2FNP A;  1R5G A;  3F6V A;  1Z7U A;  3SZP A;  1SFK A;  2KDO A;  4II3 A;  2E19 A;  3LST A;  2DJN A;  2JA2 A;  2XAQ A;  4B4C A;  4JQF A;  2VBZ A;  2K3P A;  1D5Y A;  1TBX A;  1MSE C;  3OR1 C;  1HBX G;  1ZLK A;  2IXS A;  2K4B A;  5TGT A;  1G6N A;  5D5X B;  2QYO A;  4ASN A;  2D5V A;  2TRT A;  1OKR A;  3EUH C;  4KFC A;  2XAF A;  3VB2 A;  1A6Q A;  4YRV A;  3Q0U A;  1MNM C;  1R5H A;  4HYE A;  5ICF A;  4RM3 A;  4FET A;  5H20 A;  2V6C A;  5FRO A;  3MVP A;  4BAC A;  1F36 A;  2LK2 A;  1YLF A;  3B02 A;  2M3A A;  5IOZ A;  3JAM K;  3ESW B;  2XF5 A;  2F6C A;  3JRA A;  1FEX A;  2E35 A;  1K4S A;  3K1N A;  2R0Q C;  5E1Z B;  4HRI A;  3DPU A;  3H92 A;  2A6T A;  2W00 A;  5EZG A;  4S04 A;  5FKO A;  4M3D A;  1JTY A;  2IGM A;  5DS9 A;  4E70 A;  3QPS A;  1VQK I;  1O3R A;  3GTP J;  2LYC A;  1JTX A;  1PP8 F;  2UV1 A;  3WE2 A;  3E6D A;  1K6O A;  2ISY A;  1Z0X A;  2W85 A;  5CVJ A;  4DJA A;  2W4S A;  3FDY A;  5C3E J;  2Q2E A;  1VZ0 A;  2VL8 A;  3EYI A;  4I6Z A;  2DXI A;  2MD5 A;  3ROU A;  4YII A;  3J7A O;  4ENJ A;  3OWT A;  3G6E I;  3H5R A;  3WTW C;  2W48 A;  3BR0 A;  3J80 Z;  1EH6 A;  2IVM A;  3IP4 B;  4RB1 A;  4IOA F;  3QP5 A;  4A5M A;  2Z1D A;  2DQL A;  3H5N A;  3QYB A;  2NNN A;  1I3Q J;  3L9F A;  4PJ0 C;  4S0H B;  1HKQ A;  2K27 A;  1WVR A;  3F0C A;  4CZZ A;  4D1Q A;  3E6B A;  4NC6 A;  1G59 A;  3W2W A;  1AKH B;  3BWG A;  3GW2 A;  1ETV A;  2NS0 A;  3GLL A;  1RKW A;  1IRG A;  3MKW B;  2R5Z B;  3ZXS A;  3CCU I;  2Y69 H;  1XGN A;  3VDX A;  4DOZ A;  3VWB A;  1SC7 A;  4F7Z A;  1I1S A;  3C1D A;  5K7Z A;  2BZT A;  3GBG A;  5ICC A;  3CO6 C;  3WTV C;  2X9D A;  1B72 B;  4BQQ A;  2LC2 A;  4AYB N;  1ZEL A;  4XR6 A;  2O61 A;  3JSO A;  3LSH A;  1XSX A;  2K02 A;  4U0W A;  5K5Q A;  2DMP A;  3CME I;  1TLH B;  1JT0 A;  3VYU B;  4M3F A;  1YI2 I;  2J5P A;  1P9Q C;  2R3S A;  3IAS 2;  3V7C A;  2RN7 A;  2ZCW A;  4PJN A;  2ZJ2 A;  2HTJ A;  3FMQ A;  4AWX B;  4LGW A;  1K4T A;  4B43 A;  5IPA A;  1ENH A;  4MNU A;  4RAY A;  1XS9 A;  1CF7 B;  4ZDO A;  3ERM A;  3K4M A;  3LMM A;  1ORK A;  4CHU A;  3W2A A;  2HKO A;  3E5Q A;  4ABZ A;  2CV2 A;  3A0B C;  4BHP A;  2VOP A;  3FMR A;  5LLQ A;  1DU0 A;  1SVL A;  2E7W A;  4LMY A;  2M8E A;  4OIO F;  3LFU A;  1FTT A;  2KPM A;  1ZR2 A;  3SEZ A;  2YUS A;  3ZMU A;  3OSG A;  2QF7 A;  2CV1 A;  4EVI A;  2XPV A;  1FYM A;  3RZO J;  2EZK A;  4BGD A;  2XAG A;  4I09 A;  5EZH A;  1U8B A;  3I9V 2;  1X2M A;  1EKE A;  2DA7 A;  4YFN F;  5EGO B;  3CJQ B;  1QPI A;  1V55 H;  1ZLJ A;  4Y33 A;  1DU6 A;  1ERD A;  1FPQ A;  3A01 A;  3KX2 A;  3QOP A;  3H3V K;  2ELH A;  2CS3 A;  4LLL A;  1IXC A;  5E3O A;  3M3Y J;  3FM3 A;  3S8P A;  1MDM B;  3F3X A;  3KCC A;  2V9K A;  3VYS B;  4AU7 A;  2FBI A;  3BDD A;  1GVJ A;  1WGX A;  3DCF A;  4KT6 A;  1LDK B;  2V7F A;  2HGC A;  5E1W A;  2MH9 A;  3JRE A;  2JTV A;  2ZC2 A;  3V8L A;  2X1C A;  4UV8 A;  3I4M J;  1IRF A;  3ZMD A;  3PIP F;  3JR9 A;  4OIP F;  1O4X A;  4XOT A;  5KNL A;  2DFF A;  2GXG A;  2R4G A;  2H1K A;  1ZRF A;  2V6E A;  1JHF A;  4LIU A;  1EJ9 A;  2CQK A;  2HDW A;  3TO9 A;  1OR7 A;  1GDT A;  4BQN A;  4BHC A;  4BKX A;  1WZ2 A;  3V7S A;  2C6Y A;  3FM5 A;  1WJB A;  2PG4 A;  4NB5 A;  1F5T A;  9ANT A;  3VFZ A;  2G7H A;  3DPT A;  4E7L A;  3ZN1 A;  1TQP A;  1BR1 A;  5FD5 A;  4V19 K;  1W5T A;  4ZC3 A;  2PMH A;  2ZFW A;  3BZC A;  3RTR A;  2HQA A;  3FXL A;  4E7K A;  2E60 A;  2K9M A;  1ZG3 A;  1FY7 A;  3RPQ A;  1UCR A;  3FX3 A;  4O3M A;  3K9T A;  2LKP A;  3GZ6 A;  2WAQ A;  2HEO A;  4NQW B;  2L02 A;  1AOY A;  4XM3 A;  3CLO A;  2BY0 A;  2IGK A;  2QM3 A;  3BTI A;  1HA8 A;  1LE8 B;  2MW8 A;  5HS7 A;  2WAE A;  2XPW A;  3OMY A;  2Y30 A;  4HG2 A;  5L3D A;  1T39 A;  5CKT A;  4RBO A;  2CFX A;  5ILU A;  1LKX A;  1TW3 A;  2PQ8 A;  4YEL A;  2NVU B;  4QPO A;  1J09 A;  2FML A;  2H1L A;  2KMU A;  3OYM A;  2CJJ A;  2FUG 2;  4PCQ A;  4Y13 A;  2DFH A;  2DMT A;  2AO9 A;  5TIS C;  5LEJ A;  1FWZ A;  1K6Y A;  4XLP F;  2BW3 A;  1J2X A;  1SD5 A;  2DYS H;  4IRH A;  4UV9 A;  5J4Y A;  4OIR F;  1W7P B;  2F4M B;  5JHF A;  1XG1 A;  2LTP A;  3S93 A;  2A68 F;  4BJT A;  4IHV A;  4BY1 J;  2MLG A;  3BJO A;  2L7K A;  4G6T B;  3FWE A;  1IUY A;  1QZY A;  1ETK A;  2G0E A;  3MZH A;  2ELK A;  3BTC A;  2EV5 A;  2E34 A;  2H27 A;  2AXT C;  1ACI A;  3O2P E;  3JTG A;  2IAI A;  4F93 B;  2FXA A;  2IT0 A;  2CUZ A;  1TP4 A;  3MKZ A;  1R58 A;  2AQE A;  4F91 B;  2UWM A;  1OCP A;  2ID3 A;  2RDP A;  5BQT A;  1TTY A;  3LWF A;  3AKZ A;  3I55 I;  5E3N A;  2XGC A;  4XLF A;  5HDG A;  4EJW A;  1OCC H;  2KQR A;  1VQ5 I;  3LQQ A;  3QAH A;  3BY6 A;  2FRH A;  3CMA I;  1J7K A;  3E3V A;  3ZMT A;  2H6C A;  3MWM A;  2JJ7 A;  3DTE A;  4IX7 A;  4M73 A;  4QIW N;  3P9I A;  1ZG5 A;  1IC8 A;  2B63 J;  2ESH A;  1UFM A;  4JYK A;  3VSL A;  3D5L A;  3HHH A;  2F4O B;  2IGO A;  2COB A;  3GTK J;  2CU7 A;  5M5W J;  4C9Y A;  2W57 A;  3BCB A;  3IHU A;  4RB0 A;  1E3H A;  1FBQ A;  4A69 C;  2JA8 J;  1SMT A;  2DMQ A;  5E3L A;  2WA0 A;  2L4M A;  3KP5 A;  4MFD A;  4KYW A;  3GWZ A;  2NOG A;  4KUM A;  3Q0W A;  3OSF A;  4BAY A;  1OYI A;  3DBL B;  3AG3 H;  3I59 B;  1YIJ I;  2VUM J;  1JKP C;  2FSW A;  2GIZ A;  1I39 A;  3Q9V A;  1EH7 A;  2XGD A;  3WHB A;  3L2W A;  3CC4 I;  2V1U A;  2PI0 A;  1QHH D;  1P6R A;  3DU6 A;  2IA0 A;  3FXR A;  3A4C A;  3H9J A;  1ETQ A;  2DBB A;  2ZB9 A;  3I4N J;  1LNW A;  4LB6 B;  2LKX A;  4FCY A;  3HEF A;  2HFH A;  3LOC A;  5AON A;  2P6S A;  3H36 A;  4JK1 X;  3WTY C;  2KIQ A;  2DTZ A;  1FSH A;  3BTL A;  2A69 F;  3CJT B;  3J7Z I;  3CO7 C;  1J0R A;  2DCE A;  3MCZ A;  2M2E A;  2NVY J;  3OIO A;  4YIF A;  2DA6 A;  3K4L A;  3FK6 A;  3IV5 A;  2WC2 A;  1X58 A;  3LAP A;  4HX7 A;  3QPH A;  5DDG A;  5J4V A;  2MYS A;  4UVC A;  3EDP A;  4V2G A;  2F2E A;  4L5J A;  3I0T A;  4KN7 X;  4HST A;  1YJ9 I;  5H6R A;  5K5R A;  3DLL F;  3DKY A;  3WU2 C;  1N78 A;  4YFX F;  4ON0 A;  3OYN A;  2OPT A;  2MG4 A;  3TGN A;  3AG2 H;  2ZXI A;  4NBQ A;  4JX6 A;  3K70 C;  2A5Y B;  5F0F A;  4ANJ A;  1V5F A;  2LOO A;  1B8I A;  4MHG A;  3KP7 A;  2DOD A;  2M0C A;  3PUB A;  5J8F A;  4B09 A;  3OS1 A;  3B6C A;  4LG3 A;  1BN5 A;  2VXZ A;  3FXM A;  5F1R A;  4BJ5 C;  1TZL A;  5EJC A;  1X3Z B;  2N8G A;  2NS7 A;  4JX5 A;  5DTD A;  3HBL A;  2B0L A;  1W1W E;  2XRO A;  4A93 J;  4B3A A;  3IH2 A;  3SDG A;  4BXU A;  2WY7 Q;  3RYP A;  2Q2E B;  3BG9 A;  3BTJ A;  2VQG A;  5LRS A;  4IQJ A;  3FXK A;  3ZQG A;  3IC7 A;  2WV0 A;  3JRH A;  5FO5 A;  1VQP I;  1JKO C;  2O0Y A;  1VI0 A;  1ZGA A;  4X0G A;  3OYA A;  4X6A J;  1VND A;  3H0D A;  1AU7 A;  3CCL I;  3WTX C;  3JSP A;  1QRY A;  1S72 I;  5KVR A;  2XB0 X;  3F8F A;  5B3S H;  3BT9 A;  3MFK A;  4A6E A;  3ECO A;  1MBE A;  3RSN A;  1Z6R A;  3W6J B;  4HDV A;  1ZK8 A;  4PSX A;  3U1K A;  1BC8 C;  2YU9 J;  2IS2 A;  1DQU A;  1RPW A;  3HSR A;  3WTZ A;  3IKV A;  5JFR A;  3L2C A;  2DOA A;  2NS8 A;  2RQP A;  4CCK A;  1ZR4 A;  4M9Z A;  1PUF A;  2HOT A;  2YU3 A;  4XON A;  1FMW A;  4L5E A;  4O6J A;  1HW5 A;  2B7E A;  4RLQ A;  1T33 A;  2E2J J;  4EMS A;  4BEH A;  3EUK L;  3RJP A;  1ON1 A;  2E5Z A;  2LR8 A;  2LP0 A;  2HOA A;  3CCV I;  1YW9 A;  2LG4 A;  3FXJ A;  5B5E C;  3GTJ J;  3KLO A;  1I1G A;  4B44 A;  3QRF F;  2Y48 A;  5F04 A;  3KEO A;  2Z16 A;  1RKT A;  4CGZ A;  4BE1 A;  1K7A A;  2F4I A;  3OIQ A;  1ZH5 A;  4S05 A;  2DK8 A;  2X6Y A;  4ZH4 F;  1WKM A;  2M7B A;  4HX4 A;  4G8X A;  3REO A;  2W7N A;  3HUG A;  2MLK A;  1UHW A;  2VON A;  2ECB A;  3UNG C;  1UEL B;  3M4O J;  2KJB A;  1IXR C;  3DEU A;  1GVD A;  4XLN F;  3JAM Z;  3KZZ A;  3M8F A;  3HOV J;  5HDK A;  1G2H A;  1OFC X;  1QPM A;  1Y6I A;  4AM3 A;  1KQ9 A;  4MTE A;  4XLE A;  1MJB A;  5HOD A;  4PFP A;  4P9U A;  1BM9 A;  2COM A;  2VBY A;  1R4M B;  2A61 A;  1GLN A;  2ZO4 A;  5KK1 A;  5CQE A;  4HNU A;  3DEW A;  3H3U A;  1MBG A;  2QVO A;  1S7O A;  2M0M A;  4RGX A;  2K85 A;  2PN6 A;  3L2R A;  3F23 A;  3FKI J;  3GVA A;  4E7S A;  2QSG X;  4CYD A;  1MNE A;  2LD5 A;  5F0H A;  2I5U A;  5GPC A;  1V5E A;  1HKS A;  2X1E A;  2RC4 A;  3ECH A;  2BV6 A;  3CJR B;  1YFH A;  3NWS A;  2ZNZ A;  3A01 B;  1JJ6 C;  3K4N A;  4FQG A;  3F21 A;  5JR3 A;  4HV5 A;  4HLX A;  2P5K A;  2MD0 A;  2ZXH A;  4M74 A;  1S6L A;  1HW1 A;  3PM1 A;  4A6D A;  2YX4 A;  4KJZ A;  3FF5 A;  2EIM H;  3HOZ J;  4KIG A;  1OYY A;  2JPB A;  2A07 F;  1LUJ B;  2ECC A;  3H1C A;  5J6X A;  5EF6 A;  1MH4 A;  2YSR A;  3KP2 A;  3T5X A;  1RZ4 A;  3TL4 X;  3OY9 A;  3I54 A;  4CCJ A;  4I02 A;  1DGW Y;  3BR2 A;  3DTK A;  1QVU A;  4ZZL A;  4IHY A;  4Z6Y A;  1RC9 A;  5H6Q A;  1NK2 P;  3HHG A;  1HCR A;  2GOM A;  3CD6 I;  3LA7 A;  5LHI A;  4DYC A;  4M6Y A;  3ZN0 A;  4OIQ F;  3WG7 H;  2BHY A;  2OQG A;  4I76 A;  5BPD A;  4U87 A;  4CUG A;  1A35 A;  2KKO A;  3G3Z A;  5CVR A;  2K9S A;  4XRF A;  1GV5 A;  2KIM A;  3ABU A;  2VC1 A;  1V5G A;  2Y75 A;  3H9G A;  3IWZ A;  4L9N A;  1WH5 A;  4UB8 C;  2M87 A;  4XSZ F;  1OLT A;  1K61 A;  4KMF A;  4XKW A;  3MEX A;  5DM7 F;  3I59 A;  2UXN A;  5JHU A;  2NOJ B;  3DQV C;  5A2Q K;  1H0M A;  5J47 A;  2IS6 A;  2R7X A;  3FZV A;  4FT8 A;  1G3T A;  3MKL A;  4RDU A;  3GTO J;  3V8J A;  2EFQ A;  2XAU A;  4NC8 A;  2IPQ X;  4ZDL A;  2AHQ A;  1O3Q A;  2EFP A;  5IP6 A;  4JOM A;  1VF9 A;  3F6O A;  3WU0 A;  3VYR B;  2E2H J;  2JSP A;  1JUP A;  4LK1 F;  5AIP A;  3SEQ A;  4C3I J;  1SVM A;  3BPV A;  3BJ6 A;  1MMD A;  3ELK A;  2BW3 B;  1HKT A;  3K70 D;  3HXL A;  1B1B A;  4BJ6 C;  3K10 A;  3SFI A;  3ONQ A;  4HF0 A;  1MND A;  2P5V A;  3CUO A;  1BL0 A;  1F4K A;  3CMM A;  2KFD A;  3HPH A;  3OYH A;  2WBM A;  4KA4 A;  1X1B A;  2A3S A;  1OR7 C;  5HLI A;  2D1H A;  5EEA A;  3PNT A;  2DFI A;  1QA6 A;  3PUF A;  5J40 A;  3PIO F;  3OV8 A;  3S1R J;  2DDA A;  4RAF A;  1W0U A;  4D7N A;  5KHD A;  4XSX F;  4B47 A;  4JX4 A;  1S29 A;  3J7Y J;  3GFJ A;  1LDJ A;  3CCQ I;  2VE8 A;  2P5L C;  4Y7N J;  1ITY A;  2DPD A;  3CDI A;  1GV2 A;  1JKR C;  2JN6 A;  2LF7 A;  3VSK A;  4D0P A;  4I98 B;  5C4J J;  4IPA A;  4OU0 A;  1VQ9 I;  3Q3S A;  2MAB A;  5EEH A;  1FOY A;  2F5V A;  1NG7 A;  1GXP A;  3WGH A;  4A3F J;  4XN0 A;  2EZH A;  3W6K B;  3ERE D;  2ZME C;  3K4J A;  3BG3 A;  4BQO A;  1TWA J;  1R22 A;  1R71 A;  1IRZ A;  1BW5 A;  3ZQQ A;  4I2O A;  5C4X J;  2X1D A;  4IJA A;  5BOX A;  5F6F A;  4IVN A;  1GT0 C;  3BR6 A;  5FLM J;  2FJ1 A;  4E6K G;  2VKE A;  4BBS J;  4ZYE A;  1FC3 A;  3NWT A;  2LSO A;  1XMK A;  4B8X A;  2HXO A;  3EYY A;  2ZXJ A;  1UMQ A;  3RQ4 A;  1Z3X A;  1WJA A;  2DLL A;  1KU9 A;  2XGX A;  5DV5 A;  4EM1 A;  3BRO A;  3GCM A;  5HOO A;  2QGU A;  3ZR8 X;  1ONV A;  4OOI A;  2L9N A;  2QQB A;  2CW8 A;  2K7L A;  2LDU A;  1SFX A;  3DLA A;  3N97 A;  1VTN C;  3AAF A;  4RB2 C;  1W0T A;  1YO5 C;  5BPI A;  2ME6 A;  2JUC A;  3R0J A;  2L0K A;  3F8N A;  4XNF A;  2CYY A;  3HTS B;  3HOU J;  4HSR A;  1X1D A;  2XRL A;  3A03 A;  3TOB A;  1HF0 A;  2V79 A;  3M9A A;  1RR7 A;  1XGM A;  1OJL A;  1BOA A;  1WJE A;  1W5C C;  4C2U A;  3RPU A;  1BA5 A;  3IH3 A;  2ZNY A;  1UHM A;  1JT6 A;  2ESN A;  1R9T J;  1IG7 A;  5IT9 K;  4HZF A;  4PDK A;  1HSJ A;  2R93 J;  2QKL B;  1Q1H A;  3PFI A;  1XC5 A;  3T8R A;  1TW2 A;  3S15 J;  5ERI A;  2EFW A;  2VQH A;  4WXD A;  4EEF G;  1U5T A;  2HR3 A;  3K4B A;  4A0Y A;  4PJM A;  2V1D A;  3GTG J;  1KGS A;  3HYI A;  1YS6 A;  2OTL I;  1L0O C;  1F43 A;  4HX8 A;  2FOK A;  4WCG A;  1B8I B;  1XCV A;  2K40 A;  4YEJ A;  3PNV A;  4L9T A;  2V1X A;  2F48 A;  2H94 A;  1SAU A;  3RPU D;  3V42 A;  3ABL H;  5F64 A;  2KL4 A;  1JGG A;  2QUF A;  3P9C A;  1MZB A;  4DNC A;  1NH3 A;  1B9M A;  4FIS A;  1WI9 A;  2XGE A;  1EF4 A;  2R7Q A;  1U78 A;  3OYK A;  1B9N A;  4DZP A;  3F72 A;  1T6S A;  4WK8 F;  2AXL A;  2JRM A;  3TBI A;  1VQ6 I;  3PO2 J;  2CRG A;  1QO0 D;  4ZYA A;  3F9K A;  1W5S A;  1ZG1 A;  1FIP A;  3HOT A;  2Z3Y A;  1DUX C;  5CQG A;  2BOL A;  3MMY B;  2EH3 A;  5FKM A;  1JI8 A;  2QEX I;  2R7S A;  1JGS A;  1YX5 A;  2W1O A;  2R7F A;  4G7H F;  3WHC A;  3QPL A;  2VQL A;  3ULQ B;  2JK3 A;  4XKC A;  4UVA A;  1IXS B;  3JRC A;  3JTH A;  1S9H A;  3G4S I;  3RKW A;  1V54 H;  2QQA A;  5JI6 A;  2ICW G;  4BDY A;  4GGG A;  4F3Q A;  2BBY A;  1NHA A;  1PUF B;  4HBL A;  2K9N A;  1ZAO A;  1D0Z A;  1U9O A;  2VBW A;  1OPC A;  4M9X A;  1YHQ I;  5HLT A;  3S3M A;  1RUO A;  1XDS A;  4BEH B;  2XUB A;  2ZSI B;  4CYC A;  2ISZ A;  1QVT A;  1RET A;  2BY3 A;  4PUS A;  4EGZ A;  2Y0M A;  1S7E A;  4N9H A;  2QBY A;  1M1E B;  1FNN A;  1QU3 A;  1WWX A;  4HA8 A;  3ZMV A;  3HDD A;  4BXX J;  1KYZ A;  3CF2 A;  5LGT A;  3O8G A;  1Y0N A;  2O7O A;  4Q47 A;  2KZG A;  3CCY A;  3ASO H;  3L7W A;  2J5O A;  4HEA 2;  4NUB A;  4QWQ A;  4H0E A;  3QU6 A;  4M3E A;  5JLX A;  3GME A;  3KYD B;  1MKM A;  2DW4 A;  4II2 A;  5FFZ A;  2LRD A;  2E36 A;  4MQV A;  5FLX K;  3HUG B;  4XKB A;  3HRT A;  2WWY A;  4UY8 I;  2ZXW H;  3RQI A;  1IF1 A;  4A12 A;  4L9J A;  1SFE A;  4KIT B;  1EA3 A;  1OCT C;  2HYF A;  5K7H A;  3S1M J;  5M5Y J;  1BC7 C;  2LY1 A;  4L18 B;  2LVS A;  2E5N A;  2O9L A;  1U3E M;  1FSE A;  3L09 A;  3QPT A;  3R61 A;  3SHF A;  1IN5 A;  1X4P A;  1BJA A;  2ZME A;  2Y31 A;  5D6E A;  4U0V A;  2OAZ A;  1I6X A;  1RI7 A;  1KU2 A;  4HPQ A;  3JW4 A;  5HVQ C;  5L3G A;  2WV1 A;  3NRV A;  5K5O A;  1A6I A;  2DN0 A;  3HOY J;  4I7H A;  1JXS A;  3WGI A;  4UVB A;  4BXF A;  2ACJ A;  3OYL A;  5D4R A;  1FOW A;  1HST A;  2X48 A;  4G6D A;  2VE9 A;  1Z3Y A;  2B9S A;  2QLZ A;  3E5U A;  3MAJ A;  4KN4 X;  2V26 A;  3LSP A;  3K4K A;  3V8K A;  4LK0 F;  3ZQI A;  3VOD A;  2PLY A;  2QSF X;  2PMZ A;  3D5S C;  5IP7 J;  1E0E A;  2RNJ A;  3TDU C;  4ENM A;  2DO7 A;  5JLW A;  4QPQ A;  1LB2 A;  4U7B A;  4LB5 A;  2UXX A;  2PFB A;  5E1X A;  2KRF A;  4BDZ A;  3FXQ A;  3LA2 A;  1D1B A;  2GAU A;  1L3L A;  3KEY A;  1KQ8 A;  2Q1Z B;  3ZCO A;  4KNY A;  4Q4Z F;  3DKX A;  3N4M A;  3VOE A;  3DPL C;  4G7O F;  3F8B A;  3S14 J;  1BW6 A;  2DT7 B;  4M6V A;  4MTD A;  1FLI A;  5LGN A;  2DU9 A;  3HKZ A;  3B6A A;  2CFO A;  3HGG A;  1BR4 A;  4CIC A;  2GA2 A;  4ZJZ A;  4I0A A;  5GTH C;  3CLQ A;  1WJF A;  3EPZ A;  4XIC A;  2VC0 A;  2XRN A;  4OWR B;  2X85 A;  3X2Q H;  3D5R C;  3CQZ J;  2AS5 F;  3ABT A;  3K1P A;  3BQZ A;  1K78 A;  5FKK A;  2JSC A;  1WJD A;  2MH2 A;  4GYG A;  3U9G A;  4A3J J;  1IZ1 A;  2CO5 A;  2DA5 A;  3O3K A;  1XD7 A;  2FMY A;  2MGQ A;  4HAM A;  2DOF A;  5DEQ A;  4AID A;  3Q9S A;  5BNG A;  2FNA A;  3PQJ A;  4Y4R A;  2BVM A;  1G8X A;  4ZZD A;  5H2F C;  3HOX J;  4XLH A;  3CC7 I;  2VBX A;  5ICG A;  4A3C J;  1FZP B;  4P9F A;  5KAI C;  1X3W B;  5CYV A;  4LG0 A;  2M8G X;  3E97 A;  4ZDP A;  1MW7 A;  3KPH A;  1A04 A;  2XKP A;  3KP4 A;  3IWF A;  4UNO A;  3ML6 A;  2VT2 A;  1P92 A;  1UZC A;  2FBH A;  2DTR A;  4DYR A;  4G94 A;  5EYR A;  5E18 F;  5IYC J;  4BE0 A;  2OU2 A;  2P4W A;  3RKY A;  1SAX A;  1LEA A;  3OYD A;  1VQ4 I;  4BUP A;  6PAX A;  3K2Z A;  3EQL F;  5FB2 A;  5TRD A;  2Y0S N;  4RS8 A;  1OQY A;  2R7V A;  2XB5 A;  5GAE J;  2CUF A;  1Z05 A;  3FIS A;  1B4A A;  2P0W A;  5LHH A;  4LFU A;  4MEY F;  1V3F A;  2KJC A;  1IW7 F;  5B1B H;  3U1D A;  2EWN A;  1R6R A;  2MC4 A;  4CO8 A;  3KE2 A;  3P9K A;  4LLG F;  4IHX A;  3DEE A;  5L3E A;  4G12 A;  2HYJ A;  2HQR A;  2JWT A;  4HW0 A;  2ZJR F;  3OYE A;  4XKV A;  2M30 A;  1GXQ A;  4D5F A;  2R7W A;  2AQF A;  1LEB A;  1FT9 A;  1HLV A;  4KMU X;  3KZY A;  4LD5 A;  2K9L A;  1HQC A;  4A5N A;  2KDZ A;  1KA8 A;  1FTZ A;  3L2U A;  3GZ5 A;  2FA5 A;  1D5V A;  4OAY A;  1YW7 A;  2Z99 A;  2PMZ N;  3TOA A;  3CDH A;  4IHS A;  4PFO A;  1UAA A;  4I99 C;  2QQ9 A;  4RLF A;  3SZT A;  2ID6 A;  3ZMS A;  4ZYD A;  3OYB A;  2IS4 A;  3GYH X;  1G3S A;  2NXN B;  5E8G A;  3MD2 A;  1D8K A;  2E7X A;  2Q8K A;  5DM6 F;  1UST A;  4ESF A;  1BI1 A;  5CLS A;  5GAG J;  4IQ4 A;  1HW2 A;  1WI3 A;  4I0B A;  2STW A;  2JVH A;  2VAS A;  1S3J A;  4XLC A;  4HF2 A;  4DBR A;  1STZ A;  1YQA A;  2BGC A;  1Z7L A;  2DA4 A;  4TV7 A;  1JHH A;  3LQR A;  3TP0 A;  3S2D J;  5K7F A;  2CQ7 A;  1HDD C;  2LH9 A;  2W24 A;  2CW7 A;  5A2Q Z;  4R79 A;  4PJL A;  1X1A A;  1F1Z A;  1K83 J;  2R7R A;  2EZI A;  2H09 A;  2L9V A;  1WJ5 A;  5ICE A;  4L5I A;  2GA1 A;  2X6O A;  3HKZ N;  2H6B A;  1IJW C;  3B73 A;  4IZZ A;  5M3F J;  3GTL J;  1LFU P;  4PGG A;  4ITV A;  1BIB A;  3I71 A;  2VN2 A;  3G73 A;  2PX9 A;  3CCR I;  1RNL A;  4PGH A;  1YRN A;  1T08 B;  4CZC A;  2DFE A;  2M9H A;  4AUX A;  3S16 J;  2L5Q A;  4MO7 A;  2P6T A;  3IAM 2;  4C30 A;  2ZJQ F;  1ZQ3 P;  2VQC A;  2BVL A;  4DBQ A;  2E1O A;  2GBY A;  4BHB A;  5EG0 A;  1T8I A;  1OCO H;  3K7A J;  3A0H C;  3CZ6 A;  1XTA A;  1ZRD A;  1QZZ A;  5GAD J;  2Z5U A;  4CCM A;  3LA3 A;  4A3D J;  1QZE A;  4B48 A;  1U5T B;  4XMY A;  4NDL A;  2A6E F;  1IV6 A;  1XB4 A;  1FMV A;  2HXI A;  4JBA A;  1CGP A;  2VXD A;  4CCO A;  1FBU A;  4L0Z B;  2LBF A;  2L7F P;  1LPQ A;  2PMU A;  3TQN A;  3S32 A;  4M6X A;  4GFB A;  3H9Q A;  1IDZ A;  2R92 J;  5L3C A;  1AHD P;  3GF2 A;  4XBF A;  4CA0 A;  2XPU A;  2IS1 A;  2FF4 A;  1FOK A;  3BC8 A;  3NQO A;  2O3F A;  2LY2 A;  5FGM A;  5FRN A;  1O7L A;  4PSW A;  3DWL E;  5J3L A;  4PJJ A;  4W1U A;  4AD9 A;  3E6C C;  3GO5 A;  2TDX A;  2RGV A;  3JCU C;  3CTA A;  2UZK A;  1HDP A;  2VJI A;  1Z91 A;  4FX0 A;  3S3N A;  2R7Z J;  5BMZ A;  4AC0 A;  3LSI A;  1ZGW A;  4FX4 A;  1U0J A;  3I53 A;  3DV8 A;  4HOB A;  4OMZ A;  2L9S A;  4A3M J;  4LJZ F;  4R8H A;  2FD5 A;  1XCB A;  1PUE E;  1KQ0 A;  4EJO A;  1S8N A;  2R7U A;  5GTI C;  3Q5F A;  2IA1 A;  3LSK A;  1MD0 A;  1Y1V J;  2BYV E;  3BCA A;  3RZD J;  1P2F A;  2HVS A;  1UB9 A;  1OIS A;  1U5T C;  5CPR B;  5FD6 A;  4CYC B;  4OAZ A;  3F8C A;  3Q0V A;  1G4D A;  5M3M J;  2HWV A;  2DK5 A;  4A2U A;  2XDV A;  4XRS G;  3KET A;  2JUG A;  2XSD C;  2QBY B;  3HOW J;  2VOD A;  3K4C A;  3LNQ A;  4ETS A;  4BS9 A;  3OL3 A;  1IUF A;  4B3X A;  2JA7 J;  2R7T A;  2MA3 A;  1VFC A;  2WY8 Q;  5IT9 Z;  5F0C A;  3S3O A;  3QQA A;  3IRQ A;  2NNY A;  4XLA A;  5HNH A;  4KIC A;  2EQR A;  2JRT A;  2IEK A;  3ISP A;  5DUI A;  1SFO J;  2QWW A;  2DT5 A;  4XK4 A;  2QZ8 A;  5GPA A;  3D1N I;  4ENN A;  1YJW I;  2O8K A;  1D8J A;  1LDD A;  4OMY A;  5D4S A;  1KU7 A;  2VIX A;  3HJE A;  4CCL A;  1UJ8 A;  3ZMZ A;  4RAZ A;  2K9Q A;  2E1N A;  1QQI A;  2E1M C;  2LY9 A;  1ZYR F;  3DP7 A;  4ZYG A;  2OTJ I;  3DBH B;  1WPK A;  4MEX F;  2Y9Z A;  1XX5 A;  3C3W A;  3GUD A;  3HRM A;  2JT1 A;  2QEN A;  2EA4 A;  2ZKZ A;  1BIA A;  2H8W A;  5HS8 A;  5HDN A;  1BOB A;  2V9V A;  3R6S A;  2MFZ A;  3GLX A;  2DT6 A;  2V4J C;  1MBF A;  4M3B A;  5CVV A;  3D0S A;  3LSM A;  2PJR A;  2ZME B;  1YIO A;  3FHZ A;  4CDG A;  1T56 A;  4RA2 A;  4Y15 A;  1ZKG A;  2IRF G;  5FLV A;  3W2V A;  4NC7 A;  3L1P A;  2MBF A;  5CVU A;  2L9R A;  3ASN H;  2CUJ A;  1OCR H;  1GUU A;  5J8C A;  1SVO A;  3DTI A;  2TCT A;  2HDC A;  3S2W A;  1VQ7 I;  4CSW A;  1Y8Q B;  1ULY A;  4UUS A;  3ZQF A;  5ILV A;  2KRC A;  1BBY A;  1YS7 A;  4RB3 C;  2XAS A;  4BH9 A;  1YX3 A;  3RKQ A;  1BJZ A;  2DAO A;  5DD8 A;  4HNT A;  1VQ8 I;  1ZHF A;  5DCM A;  1Z6T A;  1DP7 P;  2X6X A;  4EJU A;  2W25 A;  4EJV A;  2KIS A;  4UUT A;  5ED4 A;  2O6G E;  3CCJ I;  1UG0 A;  4MQ9 F;  3O6B B;  4FAS D;  1IO2 A;  4HQM A;  2KT0 A;  2CWE A;  1FP2 A;  4F55 A;  3M8E A;  3HPG A;  5HNF A;  1XMX A;  3C7J A;  4AIK A;  4UUV A;  3HTU A;  4XQF A;  2EIK H;  3E1S A;  2EJR A;  4IF4 A;  1W4M A;  2EK5 A;  1FBS A;  4O5V A;  4AIJ A;  1PDN C;  2YPR A;  4HDU A;  2IP2 A;  1G3W A;  3C2G A;  4E7Z A;  2OZ6 A;  5IP9 J;  1TWF J;  3UKG A;  1MBJ A;  4W97 A;  3E6M A;  1NG6 A;  4GXO A;  1KYW A;  1FX7 A;  2OCE A;  2HVR A;  1SD7 A;  3H35 A;  5FLX Z;  5D5W B;  4A0Z A;  3AL0 C;  2OZU A;  1K78 B;  2JA6 J;  1OMI A;  1TNT A;  3TKY A;  1X3U A;  3E5X A;  3MQ0 A;  1KON A;  2O5R A;  3AFH A;  2NVX J;  1H88 C;  1HC8 A;  4BE2 A;  1XPX A;  2JQ7 A;  1YG2 A;  1APL C;  4BL0 B;  2EFN A;  1ON2 A;  2XVC A;  3EUA A;  3TO6 A;  3ZP5 A;  2CQX A;  1JKQ C;  3BG6 A;  2DQR A;  1B6A A;  3H0G J;  3V7R A;  1RIO H;  3CF5 F;  2P8T A;  4IL6 C;  1E3O C;  2VPL A;  2NRA C;  3EET A;  1ZRE A;  4LG0 B;  1MBK A;  2DYR H;  1YIT I;  2DA3 A;  1WHU A;  1QNT A;  4P1W A;  1IN6 A;  4A0X A;  1FOX A;  3P7N A;  4PZJ A;  1VQL I;  2P7C B;  1D0X A;  4K2E A;  2R7O A;  3PO3 J;  4UB6 C;  2EBI A;  3C2H A;  3SYT A;  2CMP A;  3T0Y A;  2XAH A;  4ESJ A;  2QKM B;  1MMN A;  2HZD A;  1WRJ A;  4M9S A;  2HI3 A;  2STT A;  2V1N A;  3FXU A;  1ZGJ A;  3WE3 A;  4KIF A;  1A36 A;  1JUS A;  2X0L A;  3C2B A;  5IYD J;  3RKX A;  4X1E A;  1R5I D;  1RRJ A;  4EM2 A;  3U2R A;  1R1U A;  4M72 A;  1T0F A;  5GP9 A;  3COA C;  3SZG A;  3K6G A;  1LVK A;  3SQN A;  4DGW B;  3DKW A;  4J01 A;  3FMS A;  4E7J A;  3K2A A;  3TP3 A;  4IHW A;  3MZY A;  3MKY B;  2R5Y A;  3U21 A;  3JRB A;  2YX7 A;  1Y1W J;  1AA7 A;  3HC7 A;  2DMN A;  2DOE A;  3ZQC A;  3KEQ A;  2VKD A;  3JRI A;  2HPI A;  1IN4 A;  1PVE A;  2P81 A;  1NK3 P;  1Y0U A;  2JZY A;  4KIB A;  1AWC A;  2KZV A;  3HSF A;  2F5E A;  1BI3 A;  2Q0O A;  4P55 A;  3M1C A;  1SEU A;  3A1Y A;  5J1R A;  3CUQ A;  3ZRG A;  2XAJ A;  1U6G A;  2HOS A;  3WU1 B;  1BI2 A;  2ETH A;  1QBJ A;  2O8X A;  3KFW X;  2JMW A;  4UHT A;  2Z2S B;  1T38 A;  1IN8 A;  1O3T A;  3CC2 I;  2KHM A;  2I10 A;  4IOC F;  2Z9O A;  2X4H A;  2GZW A;  1X2N A;  3WGG A;  3HOS A;  2HVQ A;  1ETW A;  3PL8 A;  1SMY F;  4HNV A;  4LOC A;  3GEZ A;  3TW7 A;  4Y3O A;  4BBR J;  2F5D A;  3RDI A;  4AIH A;  1O3S A;  5D6F A;  5IT3 A;  4KDP A;  4B1R A;  2QCO A;  2VPR A;  4R1H A;  5DD4 A; 
#chains in the Genus database with same CATH homology
 5D5U B;  3KP6 A;  4RGR A;  3BPX A;  5LBQ A;  5LHG A;  2F5F A;  3PQK A;  2F5C A;  2M45 A;  2CG4 A;  3ZPL A;  5E20 A;  2EV6 A;  2R7D A;  3K1M A;  4LLN A;  1XSV A;  4ZYH A;  2GXB A;  2JPC A;  4GO1 A;  4G7Z F;  4WF2 A;  3GXO A;  1EH8 A;  1ZAR A;  2RKH A;  4MGR A;  4ESB A;  2KIU A;  5K1Y A;  3H3Z A;  2LF8 A;  5EEG A;  2M1B A;  4BQA A;  2OD5 A;  2HS5 A;  3EUH A;  1P4X A;  2CSO A;  2RVC A;  4BYY A;  2EB7 A;  2P7V B;  2HTS A;  1LVA A;  3T8T A;  4M71 A;  1WQ2 A;  2BEO A;  3J81 Z;  3J80 K;  4IHT A;  4P5O A;  1TNS A;  2RV8 A;  2ADU A;  4CXF A;  5LEK A;  1I27 A;  2XIG A;  3DXJ F;  2IA2 A;  3M1E A;  1U8R A;  4U7D A;  2K4J A;  1H9G A;  1DDN A;  4AVP A;  4EV0 A;  3OOP A;  1KU3 A;  3C18 A;  1PP7 U;  2XKO A;  5LGU A;  2HKX A;  1Z1D A;  3F8M A;  4GYI A;  1XMA A;  2PEX A;  1XGO A;  1REP C;  3HIF A;  4Q48 A;  1MJ9 A;  3RIR A;  4Q5S F;  5DYM A;  4G6Q A;  1S7A A;  3KLN A;  2LNB A;  1B59 A;  2XV4 S;  1J9I A;  1P4W A;  4ENK A;  2NAZ A;  4U0Y A;  5HS9 A;  3HRS A;  2FEZ A;  1U2W A;  3HSE A;  2HYG D;  1IN7 A;  2E1C A;  4P96 A;  3LFK A;  2M5W A;  1E2X A;  3I4P A;  3ZQ7 A;  1E17 A;  2DI3 A;  1DPR A;  4IRI A;  5LRR A;  1LQ1 A;  3L00 A;  5L3F A;  2KIF A;  3WOD F;  5D8K B;  3WTS C;  4L9V A;  4UXN A;  1R00 A;  1T2K A;  4WWC A;  5DCM B;  1R7J A;  2D2W A;  2YR2 A;  4HV6 A;  2G9W A;  2IW5 A;  3V4G A;  1C0W A;  1TQM A;  2BE5 F;  5D5V B;  2FE3 A;  3HRU A;  5FFX A;  1OYW A;  5CJ9 A;  1BI0 A;  5E17 F;  3SXY A;  3F22 A;  1YW8 A;  2D1V A;  3M7G A;  1CF7 A;  5AIQ A;  2A6H F;  3SFZ A;  3J81 K;  2WTE A;  1EV7 A;  2EFO A;  3IKT A;  2GIV A;  2CGP A;  1T98 A;  3KP3 A;  4EQQ A;  2K86 A;  4N0B A;  4RGU A;  1G3Y A;  4HLY A;  2HZT A;  1R1V A;  1Z9C A;  1R36 A;  4WXH A;  4WX9 A;  1J59 A;  1RUN A;  2L3D A;  1V4R A;  1LJ9 A;  1P4A A;  1JE8 A;  3T1B A;  3I5U A;  2FBK A;  2IJL A;  1YTY A;  4N9I A;  1MDM A;  1XN7 A;  1ZN2 A;  3R4K A;  5E8I A;  2VOO A;  1K79 A;  1O7F A;  4OIN F;  2G7U A;  2MC3 A;  4HF1 A;  3GFM A;  1F9N A;  2L01 A;  4BNC A;  2L54 A;  4HQE A;  5DUK A;  3QU3 A;  2CW0 F;  2GWR A;  4EM0 B;  2VT3 A;  2L4A A;  1DPU A;  2PJP A;  5HLG A;  5TJJ A;  3VEP A;  4GCV A;  3TO7 A;  1IAW A;  5JVT A;  4NQW A;  3BOQ A;  3CUQ B;  4IRG A;  4EGY A;  2ZBK A;  1FP1 D;  1XSD A;  4Y17 A;  3TDZ C;  1O57 A;  1SFU A;  1FYK A;  4RGS A;  3WG9 A;  4QLC U;  1YYV A;  2XHK A;  1TQI A;  1GHC A;  1FYL A;  1J75 A;  2EA2 A;  3CJN A;  1ZRC A;  3WTT C;  4NHJ A;  2OA4 A;  1W7P A;  1SD6 A;  4Z2Y A;  3K69 A;  1R1T A;  3R60 A;  2Z33 A;  2W84 A;  3BP8 A;  5D8L B;  2OQR A;  3DF8 A;  4YG2 F;  1XDU A;  3GX4 X;  2HQN A;  2NYX A;  1XGS A;  2D45 A;  3K0L A;  5CVI A;  2DPU A;  2GQQ A;  1W7P D;  1USS A;  2O03 A;  3CUQ C;  3BZ6 A;  4L0Y B;  2FQ3 A;  3GFI A;  1SD4 A;  5ILS A;  3I64 A;  3LAJ A;  1H9T A;  3IRR A;  4EJT A;  4FHT A;  4I01 A;  4IXA A;  1HXD A;  3WTU C;  1I5Z A;  4KT5 C;  1J5Y A;  4U88 A;  3GFL A;  4YFK F;  2PBI A;  1QGP A;  1WSU A;  5DCF A;  1MJA A;  3IL2 A;  1MGT A;  4G9Y A;  3RYR A;  3BJA A;  3RI4 A;  1ODD A;  3DFG A;  5BS6 A;  5HLH A;  4WXC A;  2HOE A;  2OBP A;  3QP6 A;  4DQ2 A;  1D3Y A;  3I58 A;  1R23 A;  2EV0 A;  5L3B A;  3R0A A;  3NEU A;  2FU4 A;  2FNP A;  1R5G A;  3F6V A;  1Z7U A;  3SZP A;  3LST A;  2XAQ A;  4JQF A;  2VBZ A;  1TBX A;  1HBX G;  1ZLK A;  2K4B A;  5D5X B;  1G6N A;  4ASN A;  2QYO A;  1OKR A;  4KFC A;  2XAF A;  3VB2 A;  1R5H A;  4HYE A;  5ICF A;  5H20 A;  2V6C A;  1YLF A;  3B02 A;  3JAM K;  3K1N A;  5E1Z B;  3H92 A;  4S04 A;  4E70 A;  1O3R A;  1PP8 F;  3WE2 A;  3E6D A;  1K6O A;  2ISY A;  2W85 A;  5CVJ A;  2Q2E A;  3EYI A;  2MD5 A;  3ROU A;  4YII A;  3J7A O;  4ENJ A;  3WTW C;  3J80 Z;  1EH6 A;  2IVM A;  4RB1 A;  3QP5 A;  4A5M A;  2DQL A;  2NNN A;  3L9F A;  1HKQ A;  2K27 A;  4CZZ A;  3E6B A;  3BWG A;  3GW2 A;  2NS0 A;  1IRG A;  1XGN A;  4F7Z A;  1I1S A;  3C1D A;  5ICC A;  3CO6 C;  3WTV C;  2O61 A;  3JSO A;  1XSX A;  2K02 A;  4U0W A;  5K5Q A;  1TLH B;  2J5P A;  2R3S A;  3V7C A;  2RN7 A;  2ZCW A;  2ZJ2 A;  2HTJ A;  3FMQ A;  4AWX B;  4LGW A;  4MNU A;  4RAY A;  1CF7 B;  4CHU A;  2HKO A;  3E5Q A;  4BHP A;  2VOP A;  3FMR A;  5LLQ A;  2E7W A;  4LMY A;  2M8E A;  4OIO F;  3ZMU A;  4EVI A;  1FYM A;  2XAG A;  4I09 A;  4YFN F;  1ZLJ A;  1FPQ A;  3QOP A;  2ELH A;  4LLL A;  1IXC A;  3FM3 A;  1MDM B;  3F3X A;  3KCC A;  2FBI A;  3BDD A;  1GVJ A;  1LDK B;  5E1W A;  2HGC A;  2MH9 A;  2JTV A;  3V8L A;  4UV8 A;  1IRF A;  3ZMD A;  4OIP F;  2GXG A;  1ZRF A;  1JHF A;  2CQK A;  3TO9 A;  1OR7 A;  4BHC A;  3V7S A;  2C6Y A;  3FM5 A;  2PG4 A;  1F5T A;  4NB5 A;  3VFZ A;  2G7H A;  3DPT A;  3ZN1 A;  1TQP A;  5FD5 A;  1W5T A;  2PMH A;  2ZFW A;  3RTR A;  1ZG3 A;  1FY7 A;  3RPQ A;  1UCR A;  3FX3 A;  4O3M A;  3K9T A;  2LKP A;  3GZ6 A;  2HEO A;  2L02 A;  1AOY A;  3CLO A;  2QM3 A;  5HS7 A;  5L3D A;  1T39 A;  2CFX A;  5ILU A;  1TW3 A;  2PQ8 A;  2FML A;  4PCQ A;  4Y13 A;  5LEJ A;  4XLP F;  1FWZ A;  1J2X A;  1SD5 A;  4IRH A;  4UV9 A;  4OIR F;  1W7P B;  2A68 F;  2MLG A;  3BJO A;  3FWE A;  1IUY A;  1QZY A;  3MZH A;  2EV5 A;  2H27 A;  3O2P E;  3JTG A;  2FXA A;  2IT0 A;  1R58 A;  2UWM A;  2RDP A;  5BQT A;  1TTY A;  3LWF A;  5HDG A;  4EJW A;  3LQQ A;  3QAH A;  3BY6 A;  2FRH A;  1J7K A;  3E3V A;  3ZMT A;  2H6C A;  3MWM A;  4M73 A;  3P9I A;  1ZG5 A;  2ESH A;  1UFM A;  3D5L A;  3HHH A;  2W57 A;  3IHU A;  4RB0 A;  1FBQ A;  1SMT A;  2L4M A;  3KP5 A;  4KYW A;  3GWZ A;  4KUM A;  4BAY A;  1OYI A;  3I59 B;  2FSW A;  3Q9V A;  1EH7 A;  2V1U A;  2PI0 A;  1P6R A;  2IA0 A;  3FXR A;  2DBB A;  1LNW A;  4LB6 B;  2HFH A;  5AON A;  2P6S A;  4JK1 X;  3WTY C;  1FSH A;  2A69 F;  3CO7 C;  1J0R A;  4YIF A;  3MCZ A;  2WC2 A;  3LAP A;  4HX7 A;  3QPH A;  5DDG A;  4UVC A;  3EDP A;  2F2E A;  4L5J A;  3I0T A;  4KN7 X;  5H6R A;  5K5R A;  4YFX F;  4ON0 A;  3TGN A;  2A5Y B;  4MHG A;  3KP7 A;  5J8F A;  4B09 A;  1BN5 A;  2VXZ A;  5F1R A;  2B0L A;  2XRO A;  4BXU A;  3RYP A;  5LRS A;  3IC7 A;  2WV0 A;  5FO5 A;  2O0Y A;  1ZGA A;  3WTX C;  3JSP A;  5KVR A;  3F8F A;  3MFK A;  4A6E A;  3ECO A;  1Z6R A;  3W6J B;  4HDV A;  1BC8 C;  3HSR A;  3WTZ A;  3IKV A;  5JFR A;  3L2C A;  2RQP A;  4M9Z A;  2YU3 A;  4O6J A;  1HW5 A;  4EMS A;  3RJP A;  1ON1 A;  1YW9 A;  3KLO A;  1I1G A;  3QRF F;  2Y48 A;  3KEO A;  4CGZ A;  1K7A A;  1ZH5 A;  4S05 A;  2DK8 A;  4ZH4 F;  1WKM A;  4HX4 A;  4G8X A;  3REO A;  3HUG A;  2MLK A;  1UHW A;  2VON A;  2KJB A;  1IXR C;  3DEU A;  4XLN F;  3JAM Z;  3KZZ A;  3M8F A;  5HDK A;  1QPM A;  1KQ9 A;  4MTE A;  1MJB A;  4P9U A;  1BM9 A;  2COM A;  2VBY A;  2A61 A;  2ZO4 A;  5KK1 A;  3H3U A;  2QVO A;  1S7O A;  4RGX A;  2PN6 A;  3F23 A;  3GVA A;  4CYD A;  1HKS A;  2RC4 A;  3ECH A;  2BV6 A;  1YFH A;  2ZNZ A;  3F21 A;  5JR3 A;  4HV5 A;  4HLX A;  2P5K A;  4M74 A;  1S6L A;  1HW1 A;  4A6D A;  2YX4 A;  3FF5 A;  4KIG A;  1OYY A;  2JPB A;  2A07 F;  5J6X A;  2YSR A;  3KP2 A;  3T5X A;  1RZ4 A;  3I54 A;  4I02 A;  4ZZL A;  5H6Q A;  3HHG A;  3LA7 A;  5LHI A;  4M6Y A;  3ZN0 A;  4OIQ F;  2OQG A;  5BPD A;  2KKO A;  3G3Z A;  5CVR A;  4XRF A;  2KIM A;  3ABU A;  2VC1 A;  2Y75 A;  3IWZ A;  4L9N A;  2M87 A;  4XSZ F;  4KMF A;  3MEX A;  3I59 A;  2UXN A;  5JHU A;  5A2Q K;  3DQV C;  1H0M A;  3FZV A;  4FT8 A;  1G3T A;  3V8J A;  2EFQ A;  2IPQ X;  1O3Q A;  2EFP A;  3F6O A;  3WU0 A;  4LK1 F;  5AIP A;  3BPV A;  3BJ6 A;  3ELK A;  1HKT A;  1B1B A;  4HF0 A;  2P5V A;  3CUO A;  1F4K A;  4KA4 A;  2A3S A;  5HLI A;  2D1H A;  2DFI A;  3OV8 A;  4XSX F;  1S29 A;  3GFJ A;  1LDJ A;  2VE8 A;  2P5L C;  2DPD A;  2LF7 A;  4D0P A;  4I98 B;  4IPA A;  4OU0 A;  5EEH A;  1GXP A;  3WGH A;  3W6K B;  3ERE D;  1R22 A;  4I2O A;  4IJA A;  5BOX A;  5F6F A;  4IVN A;  4ZYE A;  1FC3 A;  2LSO A;  1XMK A;  4B8X A;  3EYY A;  2ZXJ A;  2DLL A;  1KU9 A;  2XGX A;  5DV5 A;  4EM1 A;  3BRO A;  5HOO A;  1ONV A;  4OOI A;  2QQB A;  2K7L A;  2LDU A;  1SFX A;  3N97 A;  1VTN C;  3AAF A;  4RB2 C;  1YO5 C;  5BPI A;  3R0J A;  3F8N A;  2CYY A;  3HTS B;  3TOB A;  2V79 A;  3M9A A;  1XGM A;  1BOA A;  3RPU A;  2ZNY A;  1UHM A;  2ESN A;  5IT9 K;  4HZF A;  4PDK A;  1HSJ A;  1Q1H A;  3PFI A;  3T8R A;  1TW2 A;  5ERI A;  2EFW A;  4WXD A;  1U5T A;  2HR3 A;  4A0Y A;  2V1D A;  1KGS A;  3HYI A;  1YS6 A;  1L0O C;  4HX8 A;  2FOK A;  4WCG A;  1XCV A;  4L9T A;  2V1X A;  2H94 A;  5F64 A;  2QUF A;  3P9C A;  1MZB A;  4DNC A;  1B9M A;  1WI9 A;  1U78 A;  1B9N A;  3F72 A;  1T6S A;  4WK8 F;  2AXL A;  1QO0 D;  1W5S A;  1ZG1 A;  3HOT A;  1DUX C;  2Z3Y A;  1JGS A;  2R7F A;  4G7H F;  3ULQ B;  4UVA A;  1IXS B;  3JTH A;  3RKW A;  2QQA A;  5JI6 A;  4GGG A;  2BBY A;  1NHA A;  4HBL A;  1ZAO A;  2VBW A;  1OPC A;  4M9X A;  1RUO A;  1XDS A;  2XUB A;  2ISZ A;  4EGZ A;  2Y0M A;  4N9H A;  2QBY A;  1FNN A;  1WWX A;  4HA8 A;  3ZMV A;  1KYZ A;  5LGT A;  4Q47 A;  4QWQ A;  3L7W A;  2J5O A;  4H0E A;  3QU6 A;  1MKM A;  2DW4 A;  5FFZ A;  4MQV A;  5FLX K;  2WWY A;  3HRT A;  1IF1 A;  4A12 A;  4L9J A;  1SFE A;  2HYF A;  1BC7 C;  4L18 B;  1U3E M;  1FSE A;  3L09 A;  3QPT A;  3R61 A;  3SHF A;  1IN5 A;  1BJA A;  2ZME A;  5D6E A;  4U0V A;  2OAZ A;  1I6X A;  1RI7 A;  1KU2 A;  3JW4 A;  5HVQ C;  5L3G A;  3NRV A;  5K5O A;  4I7H A;  1JXS A;  3WGI A;  4UVB A;  2ACJ A;  5D4R A;  1HST A;  4G6D A;  2VE9 A;  2QLZ A;  3E5U A;  3MAJ A;  4KN4 X;  3V8K A;  4LK0 F;  3VOD A;  2PLY A;  2RNJ A;  3TDU C;  4ENM A;  2DO7 A;  1LB2 A;  4U7B A;  4LB5 A;  2UXX A;  2PFB A;  5E1X A;  2KRF A;  3FXQ A;  3LA2 A;  2GAU A;  1L3L A;  1KQ8 A;  4KNY A;  4Q4Z F;  3N4M A;  3VOE A;  3DPL C;  4G7O F;  3F8B A;  4MTD A;  1FLI A;  5LGN A;  2DU9 A;  4CIC A;  2GA2 A;  4I0A A;  2VC0 A;  2XRN A;  2AS5 F;  3ABT A;  3K1P A;  1K78 A;  2JSC A;  2MH2 A;  4GYG A;  3U9G A;  1IZ1 A;  2CO5 A;  3O3K A;  1XD7 A;  2FMY A;  4HAM A;  5DEQ A;  3Q9S A;  2FNA A;  3PQJ A;  4ZZD A;  2VBX A;  5ICG A;  1FZP B;  4P9F A;  5CYV A;  4LG0 A;  3E97 A;  1A04 A;  2XKP A;  3KP4 A;  3IWF A;  4UNO A;  3ML6 A;  2VT2 A;  1P92 A;  2FBH A;  2DTR A;  4G94 A;  5E18 F;  2OU2 A;  2P4W A;  3RKY A;  1SAX A;  1LEA A;  6PAX A;  3K2Z A;  3EQL F;  5FB2 A;  5TRD A;  4RS8 A;  1Z05 A;  1B4A A;  5LHH A;  4LFU A;  4MEY F;  1V3F A;  2KJC A;  1IW7 F;  3U1D A;  2EWN A;  4CO8 A;  3KE2 A;  3P9K A;  4LLG F;  5L3E A;  2HQR A;  4HW0 A;  2M30 A;  1GXQ A;  1LEB A;  1FT9 A;  4KMU X;  3KZY A;  4LD5 A;  1HQC A;  4A5N A;  1KA8 A;  3GZ5 A;  2FA5 A;  1D5V A;  1YW7 A;  2Z99 A;  3TOA A;  3CDH A;  4IHS A;  2QQ9 A;  3SZT A;  3ZMS A;  4ZYD A;  3GYH X;  1G3S A;  5E8G A;  1D8K A;  2E7X A;  2Q8K A;  1UST A;  4ESF A;  1BI1 A;  5CLS A;  1HW2 A;  4I0B A;  2STW A;  1S3J A;  4HF2 A;  1STZ A;  1YQA A;  2BGC A;  4TV7 A;  1JHH A;  3LQR A;  2W24 A;  5A2Q Z;  4R79 A;  1F1Z A;  2H09 A;  5ICE A;  4L5I A;  2GA1 A;  2H6B A;  3B73 A;  4PGG A;  1BIB A;  3I71 A;  2VN2 A;  3G73 A;  1RNL A;  4PGH A;  2P6T A;  4BHB A;  1ZRD A;  1QZZ A;  2Z5U A;  3LA3 A;  1U5T B;  2A6E F;  1XB4 A;  1CGP A;  4JBA A;  1FBU A;  4L0Z B;  2PMU A;  3TQN A;  4M6X A;  5L3C A;  3GF2 A;  4XBF A;  2FF4 A;  1FOK A;  3NQO A;  2O3F A;  5FGM A;  1O7L A;  4AD9 A;  3E6C C;  3GO5 A;  2TDX A;  2RGV A;  3CTA A;  2UZK A;  1Z91 A;  4FX0 A;  5BMZ A;  4FX4 A;  3I53 A;  3DV8 A;  4HOB A;  4OMZ A;  4LJZ F;  4R8H A;  1XCB A;  1PUE E;  1KQ0 A;  4EJO A;  1S8N A;  3Q5F A;  2IA1 A;  1MD0 A;  2BYV E;  1P2F A;  1UB9 A;  1U5T C;  5FD6 A;  3F8C A;  1G4D A;  2HWV A;  2DK5 A;  4A2U A;  3KET A;  2QBY B;  2VOD A;  4ETS A;  2MA3 A;  5IT9 Z;  3IRQ A;  2NNY A;  4KIC A;  2JRT A;  3ISP A;  5DUI A;  2QWW A;  2DT5 A;  1D8J A;  2QZ8 A;  4ENN A;  1LDD A;  4OMY A;  5D4S A;  1KU7 A;  3ZMZ A;  4RAZ A;  2E1N A;  1QQI A;  1ZYR F;  3DP7 A;  4ZYG A;  4MEX F;  3C3W A;  3GUD A;  3HRM A;  2JT1 A;  2QEN A;  2EA4 A;  2ZKZ A;  1BIA A;  5HS8 A;  5HDN A;  2V9V A;  3R6S A;  3GLX A;  5CVV A;  3D0S A;  2ZME B;  1YIO A;  3FHZ A;  4CDG A;  4Y15 A;  2IRF G;  2MBF A;  5CVU A;  5J8C A;  2HDC A;  3S2W A;  1ULY A;  5ILV A;  1BBY A;  1YS7 A;  4RB3 C;  2XAS A;  4BH9 A;  5DD8 A;  2DAO A;  1ZHF A;  5DCM A;  1Z6T A;  1DP7 P;  4EJU A;  2W25 A;  4EJV A;  5ED4 A;  2O6G E;  4MQ9 F;  3O6B B;  4HQM A;  2CWE A;  1FP2 A;  3M8E A;  3C7J A;  4AIK A;  4UUV A;  3HTU A;  2EJR A;  4IF4 A;  1W4M A;  2EK5 A;  1FBS A;  4O5V A;  4AIJ A;  1PDN C;  2YPR A;  4HDU A;  2IP2 A;  1G3W A;  2OZ6 A;  3E6M A;  4GXO A;  1KYW A;  1FX7 A;  1SD7 A;  5FLX Z;  5D5W B;  4A0Z A;  2OZU A;  1K78 B;  1OMI A;  1TNT A;  3TKY A;  1X3U A;  3E5X A;  3MQ0 A;  1YG2 A;  2EFN A;  1ON2 A;  2XVC A;  3TO6 A;  3ZP5 A;  2DQR A;  1B6A A;  1RIO H;  3V7R A;  2P8T A;  2NRA C;  3EET A;  1ZRE A;  4LG0 B;  1QNT A;  1IN6 A;  4A0X A;  3P7N A;  4PZJ A;  2P7C B;  4K2E A;  3T0Y A;  2XAH A;  4ESJ A;  1WRJ A;  4M9S A;  2STT A;  3FXU A;  1ZGJ A;  3WE3 A;  4KIF A;  2X0L A;  3RKX A;  4EM2 A;  3U2R A;  1R1U A;  4M72 A;  1T0F A;  3COA C;  3SQN A;  3DKW A;  3FMS A;  3MZY A;  2YX7 A;  3KEQ A;  1IN4 A;  1Y0U A;  2JZY A;  4KIB A;  1AWC A;  3HSF A;  2F5E A;  1BI3 A;  2Q0O A;  4P55 A;  3CUQ A;  2XAJ A;  1U6G A;  3WU1 B;  1BI2 A;  2ETH A;  1QBJ A;  2O8X A;  3KFW X;  1T38 A;  4UHT A;  1IN8 A;  1O3T A;  2Z9O A;  2X4H A;  2GZW A;  3WGG A;  3HOS A;  1SMY F;  3GEZ A;  4AIH A;  2F5D A;  3RDI A;  1O3S A;  5D6F A;  5IT3 A;  4KDP A;  4R1H A;  5DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...