2E35A

The minimized average structure of l11 with rg refinement
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
publication title The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2e35A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2e35A01
5GAEJ 2JQ7A 3PIPF 1HC8A 5JVGF 3CJRB 1YJNI 2E34A 1VQ8I 3G6EI 2ZJQF 3CCSI 3I56I 1ACIA 1VQLI 3I55I 2QA4I 3CCLI 1YJWI 1MMSA 1YIJI 3CC7I 1VQPI 1S72I 1WIBA 4IOAF 3J7ZI 3CC4I 2FOWA 1VQ7I 1VQ9I 2ZJPF 1YHQI 3CCEI 3CJTB 2QEXI 2OTLI 1VQ6I 1VQOI 1YI2I 1Y39A 1VQNI 1VQKI 5GAGJ 1FOYA 3CMEI 2E35A 5GAHJ 3CCUI 1QA6A 5GADJ 4UY8I 3CCQI 3CC2I 2K3FA 3G4SI 3CJQB 1FOXA 3PIOF 3CCJI 3CD6I 2H8WA 2ZJRF 3CF5F 1VQ4I 3J7YJ 1YJ9I 1VQMI 2NXNB 3CJSB 3DLLF 5DM6F 4IO9F 2E36A 4V19K 5DM7F 3CCMI 1FOWA 4IOCF 2OTJI 3G71I 3CCVI 3EGVB 1YITI 3CMAI 1VQ5I 3CCRI
chains in the Genus database with same CATH superfamily
1WZ2A 4XRFA 2FNAA 4HNUA 5HOOA 4BQQA 3IUOA 1D3YA 1Y8RB 2Z2SB 2MABA 3HJEA 1RETA 2Z99A 1KQ0A 3W2WA 1E3HA 1T0FA 2IA1A 1K6OA 1WJ5A 2TRTA 4KT6A 1T98A 5HLGA 1JT0A 1HCRA 1ACIA 5D5VB 4BQNA 4XONA 4CO8A 2O61A 2W48A 5C3EJ 2LFBA 3V4GA 3HIFA 3JRIA 1ETYA 4HLYA 1T6SA 1V5GA 2RV8A 3GLXA 1FLIA 1QHHD 1QGPA 5FKOA 1OLTA 1HQCA 3K70C 3B73A 2L7MP 3L00A 2TDXA 2OAZA 2CG4A 4X0GA 3H1CA 1Z7LA 1UMQA 2HQRA 4CDGA 1ONVA 1SAUA 4CCMA 3BTJA 2EFOA 2JUCA 5CVIA 4F91B 1I5ZA 1RR8C 2M4KA 1D0YA 2DJIA 4BACA 1YFHA 1STZA 5IP9J 2JWTA 2DDBA 3MEXA 2YR2A 2E35A 4M72A 4I0BA 2OF7A 2HQNA 5TISC 5K5RA 1BI2A 2WWYA 1N77A 1JTYA 1QPMA 5J4VA 4I6ZA 4OIRF 2XC7A 4D7MA 1L3LA 2YUSA 3SJMA 2DK8A 3H35A 2DFEA 1X2NA 1ETXA 2I10A 3BJAA 1S3JA 3VB2A 5J40A 2HOEA 1GLNA 2L01A 4HX7A 4D1QA 2QSGX 1IN7A 2ELKA 4I98B 3I4NJ 5CVRA 2YU9J 3CCYA 2MC3A 3S32A 1N75A 1MW7A 2M4GA 2HXIA 2DJNA 3TMOA 3ZMUA 2NVXJ 4I01A 2DTRA 3PL8A 3DV8A 1LEBA 1MNEA 2JN6A 2CQ7A 4I7HA 4KIBA 1R5ID 4ZJZA 2Y75A 3I71A 3K4CA 3A2KA 4RM2A 3BTIA 1VI0A 3VDXA 3SXYA 2LH9A 3PFIA 4FCYA 1D1BA 3MWMA 2R7VA 2EFWA 1OYIA 4RGXA 5M3FJ 4EM2A 4RB0A 2FXAA 3HM5A 2K86A 2P5LC 5LRSA 2E71A 3CLQA 1G3SA 2HTJA 1ON1A 2Y69H 1KZHA 1QNTA 3RZDJ 5HDGA 5FLVA 4DIQA 1IAWA 4LG3A 1KYZA 3OYAA 1ZKGA 1C0WA 5FRMA 1FX7A 2R3SA 4B44A 2ZJ2A 3DQVC 1VQ8I 4A3DJ 3AL0C 4DGWB 1DPUA 3TOAA 1OJLA 2HPIA 1JI8A 1P92A 1TWCJ 3TW6A 4CH7A 4M6VA 3FF5A 4NQWA 3OWTA 1R36A 2K4JA 1MNDA 3WTSC 5F0CA 2FOKA 1PJRA 1H0MA 2F5VA 5KHDA 3ZQQA 4C9YA 4B09A 4EEFG 1I3QJ 1PDNC 2F5EA 4MGRA 3TGNA 1Z77A 3GYHX 2QF7A 3FMQA 4K2EA 2IJLA 1W0UA 1KA8A 3PNTA 3S1RJ 3GFIA 1TQMA 2RDPA 1NTCA 2M3AA 3M8JA 2HXOA 3G1LA 4D5CA 4RAYA 1OCTC 1GHCA 1RUOA 1ZR2A 2EQRA 3CCUI 1O3QA 5DYMA 1BIBA 4GGGA 1APLC 4W97A 2YSRA 3GFLA 3S2HJ 4ZZDA 3TEDA 4XN0A 2ZB9A 1T33A 1IUFA 3RKWA 5FLMJ 2R7TA 1Z6RA 2LLKA 3BR3A 2VOOA 1JJ6C 4XL9A 3PJRA 2DI3A 3DF8A 3EQLF 4BQAA 1JGSA 4E7SA 3ECHA 4BDYA 3JAMZ 4NC6A 2VJ5A 4Y17A 2AXTC 3CLOA 2DTZA 3MCZA 2DOFA 4FE4A 1Y1VJ 1OISA 5E1ZB 1VNDA 2VKDA 4PFPA 2ZJRF 2NVUB 3GTGJ 3SYTA 3RZOJ 5FFXA 3OIQA 3SFZA 3IRQA 1X3ZB 1SEUA 3S14J 1RC9A 2VBXA 4BKXA 3F8FA 3CF2A 9ANTA 2LBFB 2OJED 2EPFA 3E3VA 1ZG3A 3WTWC 4M71A 1IXCA 1J7KA 5EEGA 3V8LA 1H88C 3BJOA 2BW3B 2VT2A 4AM3A 2HEOA 5J1YA 1XCVA 2CU7A 2RGVA 3BR6A 5FO5A 4IQ4A 4HAMA 4MFEA 5AONA 3MFKA 5E3MA 3IRRA 2FMLA 3V7CA 2QQAA 1VQ5I 2NNNA 4Y4RA 4HZFA 1ZRDA 4E7ZA 1JKPC 2JA2A 5D4RA 3GZ6A 2PX9A 1JTXA 5EEHA 5LEKA 4F92B 3RPUA 1Q1VA 1UELB 2L7KA 2P6SA 5IYBJ 4BXXJ 2R93J 2E1MB 3ZCOA 3CJRB 1OKRA 3BR5A 5HS8A 4NC7A 1Y8QB 4KT5C 3OYHA 1E3OC 2TCTA 4RA2A 3WG7H 1AU7A 4U0YA 5B66C 3BTLA 4KMFA 5IP6A 3I56I 4I2OA 5A2QZ 4MEXF 1A36A 1R1TA 4L5EA 1MZBA 2K9LA 3SEQA 1ZLKA 3BPVA 2FSWA 5M5XJ 3CCLI 1DDNA 1WSUA 3W2VA 3VEPA 4PJ0C 2ACJA 1LB2A 4IRIA 2DYRH 3QOPA 4IOAF 2K7LA 1UHSA 5EDNA 4KJZA 1M1EB 3E6CC 1TT5B 5EZGA 3OYBA 1P9QC 1XX5A 3RCOA 4EM1A 2VQGA 4G94A 2ZXIA 1XG1A 5FKNA 3KE2A 2DT6A 5B1BH 4A3EJ 1B8IB 2GA2A 2BEOA 4GCVA 3HEFA 5D6FA 4XLPF 3RSNA 3ROUA 4AIDA 2FQ3A 4YIIA 2N8GA 1EF4A 2OC6A 4L9NA 2QWWA 2DMQA 3K69A 1D0XA 1MIJA 2M2EA 4BDZA 1S7EA 2AO9A 4XBFA 2CS3A 4BU2A 3P5JA 3MAJA 2E7WA 3C1DA 4L0YB 1X4OA 3QU3A 2FU4A 2XRNA 1FOXA 3L2WA 2BHZA 1FYKA 2VASA 1S7AA 4QWQA 4BHBA 4BEHA 2STWA 4IHTA 3V8JA 5BNGA 2GOXB 3C3WA 1R5HA 3WTVC 2MBFA 4CUGA 2MLKA 1SVMA 5EYRA 2MYSA 4FISA 1LVAA 3I3LA 3CDHA 4LFUA 3P9KA 4GFBA 1P6RA 4XLFA 2I5UA 3SFIA 1U9NA 2MGQA 3LMMA 2QVOA 4BE2A 4R1HA 1ZLJA 4EJVA 1NG6A 3WTTC 5BQTA 2ISYA 2QZ8A 2CO5A 3OMYA 3CCVI 2CUEA 2XF7A 4MQ9F 2XAHA 1UG0A 1OCOH 2OUMA 5IYCJ 1KQ9A 1OYWA 4II3A 5L3GA 1X1PA 1WJFA 2P5VA 2F48A 4I76A 2GAUA 3QODA 3VWBA 1UJ8A 3KZZA 4A3MJ 2R7UA 4HW0A 4BGDA 3K4KA 3WGHA 1YIOA 3EDPA 4RGUA 2BY0A 1Z21A 2DN0A 3GLLA 2E2IJ 3BG5A 4B3XA 1OYYA 2L9VA 2V1XA 5EGOB 1MSFC 3J7AY 1LDJA 1P7JA 5FKMA 1GV5A 5EF6A 4PK4A 2V6CA 3LQQA 3S93A 4EGYA 1UCRA 3S1QJ 3G1OA 4IHXA 1FT9A 4ZDPA 2OA4A 2HDDA 1PYVA 2LMDA 1IF1A 2WY7Q 2FRHA 2LKXA 4A0ZA 1U6GA 1ZELA 3D1NI 3JAMK 1J0RA 2P7CB 3KFWX 1QU3A 5BOXA 4JP0A 1RPWA 5CKTA 1Y6IA 2R7QA 4HA8A 1BA5A 2AQFA 2DMTA 3RKYA 4U88A 4DBQA 1BL0A 2VB6A 2CUJA 3TBIA 3QPSA 3S17J 1YLFA 4L9VA 4IZZA 5K5OA 1YX3A 3WGIA 1GUUA 1NHAA 4NQWB 2XRLA 1KYWA 5GPCA 1YW7A 4M9SA 2W4SA 5C44J 3Q5FA 2H6BA 4L0ZB 3W3CA 4JYKA 2VE9A 1S7OA 1A35A 3T1BA 3H5NA 4KITB 1POGA 2IW5A 4ENMA 1ZH5A 3TL4X 2DA4A 3PQKA 4BXFA 5F1RA 2DOAA 4D7NA 3FM3A 5ICEA 1KU3A 1RNLA 5GP9A 3F22A 2VONA 1IDYA 5L3BA 1D8KA 1TW3A 3BDDA 2NS0A 4FASD 2HOTA 2HKXA 3TQNA 1RI7A 5F27A 4CCKA 1VQ4I 4ESFA 4LJZF 2KRHA 5LBQA 1LE8A 3IAM2 2DT7B 2QQ8A 3OIPA 3DLLF 5A2QK 3WTYC 1R9TJ 1MJ9A 2KL4A 3ONQA 3CESA 2XAQA 3OY9A 3ZOBA 2CGPA 5JR3A 2VJJA 1I1SA 3KEYA 2WAQN 2ZMEA 1FWZA 2K9NA 2LOOA 3FXOA 2ZC2A 5J47A 5JI6A 3JTGA 2L7ZA 3KYCB 1Z0XA 1XB4A 1BC7C 2MLGA 1X1AA 4OWRB 1KQ8A 2HVQA 1JGGA 2UXNA 2J5PA 1DQUA 3FWEA 2EB7A 3FK6A 1P4WA 2YX4A 4LOCA 4HNTA 5J1UA 5JVGF 2LF7A 5DCMA 2Z3YA 4YFNF 4A6EA 4MLOA 3GW2A 3AAFA 2V1NA 1F9NA 1XC5A 3EUKL 4EM0B 4OIOF 5K7ZA 2P4WA 2OU2A 3VYTB 3A03A 1UZCA 4Y7NJ 5J8FA 1W36C 4ZZLA 1JHFA 4N9HA 2DAOA 2EK5A 2E19A 2Z33A 1JUSA 3DBHB 2MG4A 1X2MA 4YFXF 3QU6A 3MKYB 3VOEA 4LIVA 3F6VA 2LF8A 3IH2A 4UUSA 1VQ7I 1ZK8A 3N97A 3ASOH 2K40A 2E1NA 1DUXC 2E5NA 2HYFA 1O7LA 4PCQA 5DV5A 5B3SH 5HNHA 4ENJA 1U5TA 1VQOI 2KP6A 2GIZA 5GAGJ 1W5CC 3DBLB 1R7JA 1EH7A 1S8NA 4XRSA 1YRNA 3K1NA 4OINF 2A6EF 1QA6A 2JPBA 2Y2ZA 4G8XA 3OR2C 4XORA 3JRFA 4UY8I 3Q3SA 1MDMA 3TO9A 1HXDA 3E6DA 2IRFG 2HZDA 5J1RA 4UVBA 4G9YA 3JTHA 4CYCB 3ZRGA 1W0TA 3DPUA 1WH7A 3CJQB 3U1DA 3KIOA 1IRFA 4HF2A 3OR1C 2M9HA 5TGTA 4AIHA 4B1RA 3ABTA 2IAIA 1HSTA 4RAFA 4IF4A 2WC2A 3KZIC 3DFGA 3CO6C 1WH5A 2F4MB 2G0EA 3CCJI 2L9RA 1YG2A 1BR2A 1YJ9I 1WJEA 2NXNB 2BXYA 4KA4A 4HEA2 2WY8Q 4IO9F 1SMYF 2GLOA 1XDUA 3I9V2 2VBYA 3KP6A 3LSJA 3M3YJ 1DGWY 3WHCA 5KAIC 2P5KA 3ERMA 4V19K 2EINH 2LYCA 2CQNA 2VC0A 2W1OA 3ZMZA 2WBMA 2KKOA 3O8GA 3VODA 1TQIA 3DKYA 5LHHA 3A02A 3R4KA 2IGMA 3ECOA 2XGXA 4BEHB 3K10A 1FC3A 1FIPA 3R0JA 2R7ZJ 4FTHA 2YPRA 2K9MA 1ETVA 4PJMA 3RJPA 4R79A 3MKZA 3MN2A 2NOJB 3HHGA 4M74A 1TC3C 2K9SA 2XSDC 4NC8A 1WVRA 4OMZA 3ZP5A 1XMKA 3KP2A 2PJPA 2WV0A 4AYBN 3PO2J 3GEZA 3F8CA 5E8IA 1WQ2A 2VXZA 1WI3A 1SFEA 5KAFC 2CWEA 5EEAA 4HX4A 2A6HF 4GYIA 4YG2F 3BY6A 1S72I 4S05A 3OYIA 3TO6A 2DDAA 4KDPA 2Y30A 2ZSHB 3C7JA 4HG2A 2O03A 1AOYA 1PUFB 2FOWA 2M34A 2QGUA 4R8HA 2EZHA 1V3FA 3CJTB 3F8MA 3OSGA 2OTLI 2QLZA 3HKZN 3I0TA 3WGGA 1B8IA 2DA5A 4P1WA 4L9JA 2UV1A 5KVRA 3MKWB 2ADUA 3M4OJ 5IY5H 1P7IA 2VQLA 3X2QH 1BI0A 2IA0A 4C2TA 1ZGWA 3BCBA 5GAHJ 3K2AA 1FNNA 1T2KA 4IPAA 4XLHA 5M3MJ 1EA3A 5KNLA 2PI0A 3VSKA 2O0YA 4LB6B 2BY2A 4G6TB 5DD4A 1USTA 1FJLA 4PSWA 1U8BA 3G3ZA 4AVZA 4RAGA 3BP8A 3F8BA 1XSDA 1QZZA 2MH9A 1BI1A 2KZVA 2VPRA 2V1DA 4KISA 5L3CA 2LVSA 2ISZA 2B7EA 1V55H 1ENHA 2A5YB 2IGOA 2M7AA 2RC4A 4NB5A 4IHSA 3HSEA 1WJBA 3P7NA 4CHUA 4CZCA 3E6MA 1DU0A 3GTPJ 1FTTA 1SVOA 2BYVE 3FMRA 3OYGA 3DP7A 3LA7A 1E0EA 1PUEE 1EH8A 1X3WB 4OAZA 1BOBA 3KP4A 1BC8C 2QYOA 4MNUA 3J7YJ 3FM5A 4KN7X 4XOPA 2PN6A 4MO7A 3Q0VA 1HDPA 1YTYA 5E17F 2CH0A 4J01A 5FKKA 2IA2A 1FYMA 1A6QA 3BROA 2BHYA 1ZGJA 1Z7UA 2UZKA 3LSPA 3SDBA 2LKPA 4L5IA 4EQQA 4O3MA 2DW4A 4RGSA 3JSPA 2O7OA 2H1KA 1HW1A 1WKMA 3G71I 1G3WA 3OSFA 1O3SA 4II2A 2VQHA 2FE3A 1Z05A 2WAEA 3KP5A 4L18B 2WB1N 2W25A 1MMNA 3HRSA 1LE8B 2KPMA 4C2MJ 4HDUA 2OZUA 3BG9A 1UHWA 2G7HA 1IC8A 5E3LA 2L02A 4EGZA 1ZTRA 4KFCA 3D5SC 1O3RA 3DPLC 3NQOA 1JKQC 3GTOJ 2ID6A 1BR1A 4JX5A 1SFUA 3O2PE 2EIJH 3H9QA 2H94A 5D4SA 4ZYEA 3FZVA 3D5RC 2DA6A 5IOYA 1MJAA 5EGOA 2ZMEB 2XB5A 4N0BA 1VQLI 1BR4A 3COAC 2AQEA 5D5UB 1PVEA 3ULQB 1YJWI 1MJBA 1R6RA 3HRMA 4CGZA 2FBHA 1IN5A 3GWZA 1HLVA 3BQYA 1G3TA 4XK4A 1VF9A 1FZPB 4UB6C 1K61A 1CGPA 1X1CA 3E97A 3BTCA 2DMPA 3BQZA 5DCMB 2NYXA 2NS7A 1VQ9I 4E7LA 5CJ9A 2DFFA 1IN8A 2WADA 3V7RA 1G8XA 2EIMH 4EJOA 1G3YA 2IS2A 3P9IA 2F2EA 3FHZA 3K4LA 2F5FA 4PJJA 4BBRJ 2XASA 1GT0C 1XGNA 2XGCA 3F9KA 2KIUA 3BT9A 4AYBA 4MIMA 4FETA 1XMXA 2OPTA 3S2WA 1CQTA 3ZMVA 3CP2A 2HQ5A 4RMNA 3KZYA 2VOPA 3QPHA 2BGCA 3PQJA 3ERED 2MSYA 2PEXA 1Z91A 2K3FA 3F8NA 4Y13A 4UUSB 3FXUA 3ABMH 2O6GE 2M30A 1I6XA 2KJBA 1DGRM 3F23A 3MZHA 4E7IA 1U5TB 2DMNA 1S5LC 1TWAJ 2VKHA 2LK2A 4IQJA 5E18F 2VKVA 5K7FA 2KRFA 2JRMA 2Y9ZA 3HSRA 3GTMJ 4JOMA 2WTEA 1YRNB 2KQRA 2LSOA 1ORKA 2HDWA 3HKZA 5LGNA 3WU0A 3FXQA 1FBUA 4L9TA 2P0WA 2ZXWH 3CO7C 2DPDA 3LSTA 2QBYB 1MDMB 4AVPA 5FKLA 5B5EC 1ERDA 1QVTA 5FROA 3ZQCA 2BXZA 2EBIA 5BS6A 3F72A 3UR3C 3WODF 3WU1B 1MMDA 1WFXA 2F5CA 2GZWA 4DZPA 2QM3A 1L0OC 3SZTA 2VJIA 1TWFJ 3EYYA 2OTJI 4DQ2A 3VYSB 2ZFWA 3H3UA 3LA2A 1YITI 4M6YA 2P81A 4KNYA 5J8CA 4BJTA 5ILUA 1V4RA 4HBLA 3QYEA 3HHHA 2KT0A 1HKTA 3ZQGA 3U1KA 2E7XA 2JZYA 5IP7J 4AU7A 1D1CA 1XTAA 3HOYJ 1J59A 1FYLA 2L9SA 4BY1J 4DBRA 2LC2A 3EUHC 4EJTA 1KU7A 2VKEA 1D0ZA 1SD4A 2X48A 4B4CA 3TOBA 3U9GA 3H9GA 1OCPA 4XSZF 2NNYA 1XDSA 1YYVA 3B6CA 1TQPA 1EJ9A 1RIOH 2W82A 5K7HA 4RS8A 4P55A 2GXAA 1P4XA 2DQRA 2P6TA 2W85A 2JVGA 2R7RA 3HUGB 4I09A 2NVQJ 4EVIA 3OS2A 3L2RA 2JSPA 1K83J 3KX2A 1ZAOA 3I53A 3H3VK 4P9UA 2WB1A 2V9PA 3FBNB 5FJ8J 1LVKA 5JLWA 3BG6A 3LSIA 5D8LB 2CW8A 3DKWA 1IZ1A 2RREA 2LRDA 4N4NB 2AHQA 1ZREA 3SHFA 2Q2EA 4UV9A 2HVSA 1G4DA 2A68F 2OBPA 3M9AA 1MSEC 4YIRX 2Y31A 4W1UA 3D5LA 3RQ4A 4UB8C 4HQEA 4H4KC 2XAFA 3CCQI 5E8GA 5H2FC 2ZBKA 4C3JJ 2G7UA 1T56A 1UG2A 3BR2A 1SD5A 4CYCA 3LAPA 3T8TA 2R0QC 5IT9Z 2XAUA 3R6SA 2E60A 2ETHA 3I5UA 3HOVJ 4I02A 1WHUA 2KLOA 3R60A 4ESBA 3C2HA 3MZ8A 5BMZA 1ULYA 1CF7B 5BPIA 3CJSB 3FXLA 2MA3A 1JUPA 1BI3A 3B6AA 1D1AA 4KIFA 3QYBA 4F3QA 4U87A 2R92J 4IL6C 5FRNA 3O6BB 1IN4A 4EMSA 5DM7F 2Z5UA 3ASNH 3LWFA 5D6EA 5DCFA 1IXSB 2R5ZA 3MKLA 5HODA 3BZ6A 2BZTA 3BWGA 4IKFA 2CJJA 4QLCU 4TV7A 1BOAA 4E6KG 2EV5A 4HSRA 1E17A 3FXKA 3RKXA 2V1UA 1HW2A 4WXDA 3WU2C 4A12A 1O7FA 2XKOA 5HDKA 3L2CA 1QPIA 3CCRI 2BVLA 1W7PA 3JCUC 1YX5A 4F93B 2LP0A 5LGTA 5LGUA 1Y1WJ 3LSKA 2RAEA 3FIWA 3HOUJ 4HX8A 1TBXA 2M8EA 2KZGA 4YELA 4DZJA 3OYNA 1TWGJ 1TWHJ 1SFKA 5M5WJ 4RLFA 1RKWA 2Z1DA 3HYIA 1O4XA 5FGMA 2V6EA 4BHPA 1H9TA 4G6QA 1LDKB 4WXCA 5DDGA 2F4OB 4ETSA 3LAJA 1IRXA 3L7WA 4CYDA 2VODA 3CC7I 2CRGA 2O9LA 1R4MB 1FPQA 3JW4A 4A3CJ 4PJNA 5AIPA 5H6QA 1SANA 2GM4A 1QHGA 1B6AA 3BLYA 1PP7U 5LEJA 4E70A 4LLGF 3T5XA 2KHMA 3K4NA 4LK1F 1PUFA 4BUPA 2DFHA 1MBKA 5HVQC 3NRVA 3RTRA 4XRMA 4DYRA 2KDZA 1TL8A 1LKXA 2EV0A 3BPXA 3O8HA 4ZYGA 1K4TA 4I0AA 4XQFA 1G2HA 4A3KJ 1IRZA 3HC7A 4BQOA 2CQXA 3QP5A 4CICA 3J81Z 1ZN2A 3S1MJ 1WJAA 2X9DA 3E6BA 5JVTA 3WHBA 2Y9YA 4U7BA 2PFBA 4XLNF 3DEUA 3BJ6A 1ETOA 2L3DA 2O3FA 3TKYA 1ZR4A 2K5CA 3ZMTA 1R1UA 2WA0A 3OYJA 1ETQA 2JJ7A 2ICWG 3KP3A 3MZYA 3PIOF 2PMUA 1LEAA 2X0LA 2XAJA 2K4BA 1JT6A 3IKVA 3S2DJ 3PSFA 3HXLA 1LDDA 4A69C 5ERIA 4EJUA 1FSHA 5GPAA 4AWXB 3FMSA 3CDIA 4CSWA 4HQMA 2F4IA 3PNYA 1OR7C 4PJLA 5DM6F 2GWRA 3OYDA 1I1GA 3GO5A 3L9FA 3ABKH 2DPUA 4PZJA 1F5TA 4Z2YA 2VLAA 3CCMI 2IXSA 2DMUA 4MEYF 3OYFA 1IGNA 3E5QA 4CCOA 2VBZA 1MBEA 2R7XA 4CCNA 1QO0D 2ZKZA 3H0GJ 5E1WA 4M3BA 4LITA 4HOBA 3IV5A 1W5TA 2VE8A 1QVUA 1OPCA 1RZ4A 2C6YA 2HFHA 4UV8A 1BBYA 3GFJA 1WGXA 4Y52J 1HF0A 5ILSA 4JX4A 2A5WA 3KLOA 3EETA 5FD6A 5CVVA 3K4MA 2CUZA 2R7OA 3GTLJ 4XMYA 3ZGKA 2Z16A 4YEJA 5LLQA 2A05A 3LFUA 4HF1A 2JUGA 4S0HB 3IL2A 5H20A 1U78A 1AKHA 5HS7A 1IN6A 1WIBA 1R1VA 4RB2C 3A1YA 3S3NA 2E1MC 4BNCA 5IT9K 1XN7A 3F3XA 3OS0A 3DTKA 4C3HJ 2LD5A 2DA2A 3AG3H 4GO1A 2CV0A 1YHQI 2XSJC 2CSOA 1LNWA 5LFAA 3HTSB 3S16J 3FK7A 2R7SA 1MKMA 3CUQC 3M7GA 1VQ6I 1FIAA 2HYGD 2H6CA 5CYVA 2EZIA 1X1BA 2LKSA 3IWFA 5L3EA 3C2BA 2CV2A 3AFHA 1JHHA 2LY1A 1OCRH 4P96A 3JREA 4PGHA 4E7KA 4IXAA 2W24A 2IEKA 1IJWC 1KU9A 2EILH 3LOCA 2KFDA 4A0XA 4Q4ZF 1T0FC 2ME0A 2HGCA 2IPQX 1BIAA 2OCEA 2QKMB 4ON0A 4ITVA 3SZPA 3KETA 1JE8A 1ZRCA 5F0FA 4OMYA 5DTDA 2QUFA 2MH2A 4RAZA 1HKQA 5GTHC 3HOSA 4LLLA 4HV5A 3TO7A 3OYCA 3G2BA 5JLXA 2Q2EB 1TT0A 2FBKA 3LSGA 2LR8A 3HPGA 2ME6A 3I58A 1SMTA 3VYRB 1XS9A 1IUYA 3FKIJ 3RPUD 3CJNA 1UHMA 2F6CA 2ZCWA 2QBYA 3HOXJ 1KU2A 4GYGA 5DUIA 2D2WA 1WWXA 2GOMA 2M8GX 1BW5A 3A01A 1XD7A 4FX0A 3JRGA 4RM3A 3BCAA 2ZO4A 5EG0A 5K1YA 4D5FA 3AL0B 5E79C 4AD9A 3S15J 4BJ6C 4OOIA 5FFZA 1K4SA 4C3IJ 2X6XA 2DOEA 5JHUA 3F21A 1SAXA 4BE1A 4G7ZF 3FXRA 3RI4A 1FEXA 1LUJB 2QCOA 2DLLA 2R5ZB 3MMYB 3RQIA 3N4MA 2KISA 2STTA 3K0LA 2QQBA 4ZYHA 1REPC 3LFKA 4UUTA 1FBQA 3QWLA 2HPMA 2NVYJ 3JSOA 4PGGA 2L2OA 3J81K 2DA7A 4MFDA 2HQAA 2NAZA 4WXHA 4O6JA 1YIJI 5DUKA 1YQAA 5H6RA 2K85A 1W7PB 1J9IA 2WAFA 4Y15A 3HUGA 2NS8A 2M1BA 3H5AA 4BS9A 4XN3A 5CLSA 3CC4I 1XCBA 1Z67A 4C30A 2X51A 5CPRB 3OYMA 2ZJPF 4A3BJ 4KICA 2RKHA 3DCFA 4XOTA 4FT8A 4G7HF 1I39A 4DNCA 2R7FA 3CUOA 3GVAA 1Z1DA 2LDUA 3DBRB 2QKLB 1AWCA 4LLNA 4A5MA 4UNOA 1LPQA 3BOQA 4UXNA 1VQKI 1OCZH 1BJZA 4WK8F 2DA1A 6PAXA 2M0MA 3H5RA 4HYEA 3VPRA 3CMEI 1T08B 5AIQA 3G1MA 1GXPA 4BY7J 4BXUA 1U3EM 3H36A 1B4AA 1Q1HA 3M1CA 1O57A 2DYSH 2WAQA 2JA6J 3A0BC 3R61A 4RB1A 5F0HA 4XR6A 2ECCA 1WRJA 4XKCA 2IGNA 4BAYA 3JRAA 3JR9A 5DEQA 2JK3A 3FKJA 3BG7A 3S1NJ 5HNFA 2L7FP 1R71A 5J6XA 1QBJA 2M5WA 5CVJA 4B8XA 3DTIA 2X6YA 1X58A 1IDZA 2XB0X 2BY1A 3HG9A 3QQAA 3DWLE 4XKBA 3V7SA 1W4MA 2EFPA 1ITYA 2W57A 3TDUC 1TLHB 3M8FA 4A3LJ 2EA4A 1VQMI 3DEEA 1LJ9A 2JPCA 1YO5C 1CF7A 2M7BA 1I50J 1USSA 2DT5A 2FX0A 1XGMA 2E36A 4Z6YA 4C2UA 2DCEA 1JUMA 2DODA 2OQRA 1FOWA 3NAUA 3R0AA 4E7JA 4A3GJ 2O5RA 2VN2A 4HPQA 3IHUA 4BYYA 4IOCF 2DK5A 2XPUA 3FBIB 2CW7A 4P9FA 4AIJA 3IH4A 3SQNA 2X1EA 2CFXA 3CMAI 4HF0A 1BN5A 5IT3A 4A3JJ 4NUBA 2PBIA 2L0KA 5GAEJ 2L54A 2B63J 1D5VA 3VYUB 5CQGA 1F4KA 2JA7J 1HC8A 1IV6A 1SD6A 2EIKH 2OQGA 1P2FA 1YE9A 3HDDA 5IYDJ 3K9TA 1XPXA 2VBWA 3KEQA 3OYEA 2OCCH 3K1MA 3HL2A 1ZRFA 1FTZA 3E0JB 5JFRA 4QSHA 2A07F 2HR3A 4UVAA 2MW8A 2A69F 1R23A 1QQIA 3U21A 3H0DA 3ZQHA 3QPLA 1WJDA 2LY9A 4CCJA 2CFOA 3IH3A 2CW0F 4XIDA 4IHYA 4IRGA 3FXMA 3JRCA 1ETWA 3IAS2 4A93J 2XGDA 3QP6A 2BVMA 5J4YA 4MQVA 4S04A 3BR1A 3K6GA 4LIUA 2J5OA 2H8RA 4M3EA 3V8KA 1ODDA 2ZXHA 3WE2A 1U2WA 4B48A 1LQ1A 3CDLA 1H9GA 2XIGA 1OCCH 1WPKA 2JA5J 2EFQA 3S3MA 1AKHB 4MHGA 1W1WE 3RYPA 1QZYA 3MVPA 1NK3P 3NWSA 1OQYA 3BG3A 4AC0A 4FX4A 2JTVA 2XHKA 3I59A 5J3LA 1BM9A 2COMA 2KIQA 2VJ4A 2X6WA 2P8TA 2HTSA 5M5YJ 1B9NA 1G59A 4DYQA 2EFNA 3KYLA 5F04A 1Z3XA 3HOWJ 1V54H 2OD5A 2VUMJ 1WCMJ 3IC7A 1IV8A 2YU3A 2IBDA 3CMYA 1D5YA 1HKSA 4B43A 1NG7A 3CF5F 2R4GA 3HGYA 2FNPA 3ZN1A 3J80Z 1X4PA 1QZEA 4PDKA 2VQCA 3GTKJ 3TDZC 4RBOA 1G6NA 1K79A 3ZQIA 1T95A 4HDVA 3ML6A 5TRDA 4ABZA 2PJRA 5ICCA 2B0LA 2DBBA 4B47A 2MC4A 3I4MJ 3F6OA 2L9NA 3HB9A 1EKEA 3E5XA 1LFBA 3I4PA 4KMUX 1ZG5A 1R49A 3T0YA 3OYKA 1B72A 2DQLA 1SFXA 3GCMA 4JQFA 2ELJA 4CZZA 1VFCA 3OOUA 4DW6A 2V9KA 5CVUA 1F43A 1RRJA 5C4XJ 3LQRA 1GDTA 4XLEA 3HOTA 3JRHA 3Q0UA 1LFUP 4Q48A 4WX9A 4BHCA 2HNHA 2JQ7A 4BH9A 1HDDC 4D0PA 2AXLA 3L09A 3SDGA 3A01B 3W2AA 2EZLA 1V5FA 2BOLA 1O3TA 5EG0B 5EZHA 5L3FA 5ICFA 3HRUA 5HS9A 2HWVA 2QA4I 4GRIA 3ZR8X 3M07A 2Q8KA 4G6DA 2VXDA 2ESHA 1MD0A 4AIKA 1OFCX 3FDYA 2P7VB 4L5JA 2L4AA 3E5UA 4OAYA 3REOA 3GTQJ 2BBYA 2QSHX 3AG1H 5E1XA 1A04A 4HNVA 3EUAA 1PP8F 2K3PA 3LSMA 4LG0A 2QEXI 2VPLA 2RQPA 1UFMA 2FQ4A 4RGRA 1YI2I 1Y39A 1EV7A 1MH3A 3ABLH 4XSXF 3QYFA 4G7OF 3FXJA 4O5VA 4BBSJ 2R7WA 4ENKA 1ZG1A 3CMMA 4ZH4F 3LL7A 3OOPA 3LA3A 1T8IA 3LSHA 3I64A 1J75A 3WG9A 1Y0NA 4Y3OA 1T39A 4LK0F 4IHWA 1X1DA 1H89C 1GVDA 3UKGA 4LB5A 5HLHA 1Y0UA 2JRTA 3GX4X 1I6HJ 3HSFA 3A4CA 3LSRA 3WTXC 2FEZA 2IVMA 1ZQ3P 5D8KB 1B1BA 3AG2H 3CQZJ 3NEUA 4IHVA 3VFZA 4FE7A 1S29A 2EJRA 3Q0WA 3ESWB 1KGSA 2PLYA 3T8RA 3ISPA 4M3FA 2D5VA 4JBAA 4M9XA 2V4JC 4ESJA 2ESNA 5F6FA 3RPQA 3ZQ7A 4XKVA 2LY2A 1FMVA 1HSJA 4XNFA 1HA8A 3RYRA 2XROA 1ETKA 1R58A 4M9ZA 4XM3A 3IKTA 1ZGAA 1U0JA 2CMPA 3C18A 3EPZA 4EJWA 2R5YB 2E2HJ 4QPQA 2V9VA 2O8KA 4P5OA 4XLAA 3TP3A 1MBHA 4I99C 3SEZA 4LGWA 2MD0A 5ED4A 3PO3J 2DU9A 1X3UA 2VI6A 1XGOA 4U7DA 3S8PA 5D5WB 3QAHA 2X4HA 3CUQB 1A6IA 4LD5A 4QPOA 4N4OB 2X1CA 4E7HA 3H9JA 1TP4A 3K2ZA 4OU0A 1MMGA 2NVTJ 4Y33A 3L2UA 2VC1A 3WTUC 2D45A 3GBGA 4A3FJ 2QSFX 3GF2A 5IOZA 4DJAA 4XKWA 1B9MA 1FBSA 4JK1X 1YJNI 2CUFA 1AA7A 2CYYA 2E34A 2GXGA 5DD8A 1JJ8C 1RUNA 2XUBA 3KEOA 3G6EI 1K78A 3OYLA 2GQQA 2PG4A 4U0VA 2O8XA 3I55I 3O3KA 2A3SA 4ZYDA 3PUBA 3CTAA 3NARA 1UAAA 4NDLA 2K27A 2MD5A 2XPVA 3K4JA 2Y0SN 4RLQA 4MTEA 4RDUA 1MMSA 1W36D 1F1ZA 1VQPI 2H09A 1R5GA 1I3AA 3DTEA 5E3NA 1VZ0A 3J7ZI 3PNVA 1N25A 2BE5F 2W7NA 4BJ5C 3HTUA 1B59A 2Q1ZB 3CCEI 3M1EA 1DPRA 2DO7A 2ZMEC 1A31A 1MH4A 2KJCA 4WF2A 4ZDLA 3GZNB 3J80K 1FSEA 2XF5A 3ABUA 4ZTFA 1VQNI 3ZQFA 2E1OA 2KMUA 2PMHA 2D1HA 2RNJA 3AG4H 2IS4A 3W6KB 5E3OA 4LMYA 5FB2A 4H0EA 1XMAA 2BY3A 4DYCA 5FD5A 4YIFA 2DFIA 2XAGA 3BC8A 4EV0A 3DKXA 4PFOA 3Q9VA 4XICA 3HGGA 2JSCA 3CC2I 3DEWA 2UWMA 3FISA 2CQQA 3DLAA 3D0SA 5KCMA 1Z6TA 1HBXG 3KP7A 2V79A 3V42A 2LG4A 2UXXA 4ZDOA 3EUHA 4YRVA 3C2GA 2M87A 1QRYA 2VT3A 2ZFUA 2H8WA 2HI3A 2JT1A 5DS9A 2ELHA 2JMWA 3NWTA 4M6XA 1LFPA 2VIXA 3W6JB 2XKPA 3CZ6A 3I59B 2HOSA 2V26A 2FBIA 5IPAA 1U5TC 1JXSA 5CQEA 2YS9A 2A61A 3Q9SA 2OZ6A 4NHJA 1MBGA 3H92A 3UNGC 3GFMA 3BZKA 1TW2A 3IP4B 3B02A 1K7AA 4A6DA 2L4MA 3P9CA 3GUDA 2EV6A 3K1PA 3TW7A 2FA5A 5EJCA 2EZKA 1ZYRF 2Q0OA 1T38A 4ANJA 4M3DA 2HVRA 1MBJA 2ZXJA 3G73A 1BJAA 1X19A 4B3AA 1XSVA 4KYWA 2DXIA 1J2XA 1Y56A 3S3OA 3H3ZA 3ELKA 2PJRB 2V7FA 1YOVB 4M73A 3ZMDA 5F1JA 5F64A 4JX6A 2RQQA 1S6LA 4OIQF 2K9QA 4WWCA 1TZLA 5KK1A 2W84A 1E2XA 4KUMA 3TP0A 2ZJQF 3CCSI 2X1DA 1B72B 2OV7A 3AKZA 3JRBA 4IJAA 1JKRC 3F0CA 2HDCA 4HSTA 3ZXSA 4UHTA 1YW8A 5HLTA 1I27A 1RKTA 1GVJA 2XV4S 3ZMSA 2G9WA 3PM1A 4G12A 1AHDP 2X6OA 5LD2C 4WCGA 2Y0MA 2WV1A 1EH6A 5FLXZ 2IS1A 4KIGA 2YX7A 2FJ1A 2IGKA 2QENA 3HRTA 4XRSG 5HDNA 2GXBA 1N78A 1ZARA 4ENNA 2NRAC 3WE3A 3DU5A 2DA3A 1E3PA 2Y48A 4A3IJ 3KYDB 4UVCA 1FOYA 1TNTA 3J7AO 2K02A 3IWZA 4HV6A 4NNJA 1D8JA 3GXOA 1K6YA 2EWNA 1FP1D 3ZQLA 5GADJ 1MMAA 4IRHA 3RKQA 1R4NB 1RR7A 1YS6A 5LRRA 4RB3C 4NBQA 2Y0SA 2E5ZA 2LREA 3K70D 2FF4A 3VSLA 1BW6A 4LG0B 3G4SI 4QIWN 1IW7F 2PMZN 1P4AA 5HLIA 4EATA 2RVCA 1JKOC 1RESA 3ZPLA 4Q47A 3M8EA 4DOZA 1ON2A 4CXFA 2KRCA 3GMEA 3OL4A 4J19A 3K4BA 4OIPF 3I54A 1SC7A 2IT0A 5L3DA 3L2QA 2HU9A 3QRFF 1MGTA 2XGEA 2BV6A 3E7LA 2I8DA 2W00A 2HS5A 1IG7A 4BL0B 1J5YA 4E4HA 2JVHA 1FY7A 4FHTA 3W6VA 4D9JA 1SFOJ 1NH3A 4J00A 4FQGA 2LNBA 1H8AC 2CV1A 3HPHA 5C4JJ 3L1PA 4YFKF 2X85A 4HLXA 1U9OA 1HW5A 3OV8A 3U2RA 1S9HA 2XVCA 2FUG2 1GV2A 3EGVB 1SVLA 4IEJA 2ZNYA 2L5QA 2EH3A 2GBYA 1KONA 3EYIA 2PQ8A 2GIVA 4ZYAA 4M3GA 2XF6A 2XPWA 5ILVA 2KDOA 2VL8A 2A6TA 3ZN0A 3PIPF 2M0CA 4Q5SF 2D1VA 1MBFA 2XDVA 2ZSIB 4XLCA 1IXRC 5F08A 5D5XB 4QTRA 2HKOA 2R7DA 3A0HC 4V2FA 4KN4X 4UUVA 2RNGA 3E1SA 4A0YA 5K5QA 4CCLA 3L2VA 2UUZA 4F7ZA 4GXOA 2M45A 3MQ0A 1IO2A 2CQKA 3CP8A 3RIRA 3KPHA 5B1AH 3OIOA 1V5EA 1GXQA 2H27A 4X6AJ 1FOKA 2ECBA 2QQ9A 4AUXA 3DPTA 4PSXA 4V2GA 1VTNC 5BPDA 1DP7P 2COBA 2F5DA 1XGSA 1U8RA 2FMYA 2Z9OA 4F52A 3FHNA 2E2JJ 1OR7A 1K78B 3OS1A 1R00A 1HOMA 1DU6A 1W5SA 4F55A 4ASNA 2JA8J 3WTZA 1YS7A 2KIFA 1OMIA 2RN7A 4U0WA 1UB9A 3HBLA 2E1CA 3FX3A 3DU6A 3DXJF 4ZC3A 4A2UA 5GTIC 1J09A 5E20A 2H1LA 3GZ5A 4GDFA 3K7AJ 1YW9A 3SZGA 3KLNA 2EA2A 2LBFA 3QOEA 2FD5A 4IX7A 2HYJA 2ZNZA 4CA0A 1F36A 4A5NA 4PUSA 1FP2A 2IP2A 2BW3A 2HOAA 1TTYA 1Z9CA 1DP3A 3HOZJ 2MFZA 3BR0A 2NOGA 3KCCA 5JHFA 3GTJJ 1NK2P 3N05A 1FMWA 3PFYA 1WJCA 1R22A 3CD6I 1XSXA 5TJJA 1W7PD 1WI9A 2KIMA 4BE0A 1Z3YA 2B9SA 4ZTJA 3JRDA 3MD2A 4X1EA 2ID3A 2R5YA 1ZHFA 3HZJA 1A5JA 2GA1A 3PSIA 1TNSA 2LTPA 3BZCA 3PUFA 4IVNA 3OL3A 4MTDA 2AS5F 1SD7A 3LNQA 3RDIA 5ICGA 3CUQA 2PMZA 5LHIA 2HZTA 4N9IA 5FLXK 3QPTA 5LHGA 1MNMC 4HRIA 1IRGA 2IS6A
chains in the Genus database with same CATH topology
5GAEJ 2JQ7A 3PIPF 1HC8A 5JVGF 3CJRB 1YJNI 2E34A 1VQ8I 3G6EI 2ZJQF 3CCSI 3I56I 1ACIA 1VQLI 3I55I 2QA4I 3CCLI 1YJWI 1MMSA 1YIJI 3CC7I 1VQPI 1S72I 1WIBA 4IOAF 3J7ZI 3CC4I 2FOWA 1VQ7I 1VQ9I 2ZJPF 1YHQI 3CCEI 3CJTB 2QEXI 2OTLI 1VQ6I 1VQOI 1YI2I 1Y39A 1VQNI 1VQKI 5GAGJ 1FOYA 3CMEI 2E35A 5GAHJ 3CCUI 1QA6A 5GADJ 4UY8I 3CCQI 3CC2I 2K3FA 3G4SI 3CJQB 1FOXA 3PIOF 3CCJI 3CD6I 2H8WA 2ZJRF 3CF5F 1VQ4I 3J7YJ 1YJ9I 1VQMI 2NXNB 3CJSB 3DLLF 5DM6F 4IO9F 2E36A 4V19K 5DM7F 3CCMI 1FOWA 4IOCF 2OTJI 3G71I 3CCVI 3EGVB 1YITI 3CMAI 1VQ5I 3CCRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE J;  2JQ7 A;  3PIP F;  1HC8 A;  5JVG F;  3CJR B;  1YJN I;  2E34 A;  1VQ8 I;  3G6E I;  2ZJQ F;  3CCS I;  3I56 I;  1ACI A;  1VQL I;  3I55 I;  2QA4 I;  3CCL I;  1YJW I;  1MMS A;  1YIJ I;  3CC7 I;  1VQP I;  1S72 I;  1WIB A;  4IOA F;  3J7Z I;  3CC4 I;  2FOW A;  1VQ7 I;  1VQ9 I;  2ZJP F;  1YHQ I;  3CCE I;  3CJT B;  2QEX I;  2OTL I;  1VQ6 I;  1VQO I;  1YI2 I;  1Y39 A;  1VQN I;  1VQK I;  5GAG J;  1FOY A;  3CME I;  2E35 A;  5GAH J;  3CCU I;  1QA6 A;  5GAD J;  4UY8 I;  3CCQ I;  3CC2 I;  2K3F A;  3G4S I;  3CJQ B;  1FOX A;  3PIO F;  3CCJ I;  3CD6 I;  2H8W A;  2ZJR F;  3CF5 F;  1VQ4 I;  3J7Y J;  1YJ9 I;  1VQM I;  2NXN B;  3CJS B;  3DLL F;  5DM6 F;  4IO9 F;  2E36 A;  4V19 K;  5DM7 F;  3CCM I;  1FOW A;  4IOC F;  2OTJ I;  3G71 I;  3CCV I;  3EGV B;  1YIT I;  3CMA I;  1VQ5 I;  3CCR I; 
#chains in the Genus database with same CATH topology
 1WZ2 A;  4XRF A;  2FNA A;  4HNU A;  5HOO A;  4BQQ A;  3IUO A;  1D3Y A;  1Y8R B;  2Z2S B;  2MAB A;  3HJE A;  1RET A;  2Z99 A;  1KQ0 A;  3W2W A;  1E3H A;  1T0F A;  2IA1 A;  1K6O A;  1WJ5 A;  2TRT A;  4KT6 A;  1T98 A;  5HLG A;  1JT0 A;  1HCR A;  1ACI A;  5D5V B;  4BQN A;  4XON A;  4CO8 A;  2O61 A;  2W48 A;  5C3E J;  2LFB A;  3V4G A;  3HIF A;  3JRI A;  1ETY A;  4HLY A;  1T6S A;  1V5G A;  2RV8 A;  3GLX A;  1FLI A;  1QHH D;  1QGP A;  5FKO A;  1OLT A;  1HQC A;  3K70 C;  3B73 A;  2L7M P;  3L00 A;  2TDX A;  2OAZ A;  2CG4 A;  4X0G A;  3H1C A;  1Z7L A;  1UMQ A;  2HQR A;  4CDG A;  1ONV A;  1SAU A;  4CCM A;  3BTJ A;  2EFO A;  2JUC A;  5CVI A;  4F91 B;  1I5Z A;  1RR8 C;  2M4K A;  1D0Y A;  2DJI A;  4BAC A;  1YFH A;  1STZ A;  5IP9 J;  2JWT A;  2DDB A;  3MEX A;  2YR2 A;  2E35 A;  4M72 A;  4I0B A;  2OF7 A;  2HQN A;  5TIS C;  5K5R A;  1BI2 A;  2WWY A;  1N77 A;  1JTY A;  1QPM A;  5J4V A;  4I6Z A;  4OIR F;  2XC7 A;  4D7M A;  1L3L A;  2YUS A;  3SJM A;  2DK8 A;  3H35 A;  2DFE A;  1X2N A;  1ETX A;  2I10 A;  3BJA A;  1S3J A;  3VB2 A;  5J40 A;  2HOE A;  1GLN A;  2L01 A;  4HX7 A;  4D1Q A;  2QSG X;  1IN7 A;  2ELK A;  4I98 B;  3I4N J;  5CVR A;  2YU9 J;  3CCY A;  2MC3 A;  3S32 A;  1N75 A;  1MW7 A;  2M4G A;  2HXI A;  2DJN A;  3TMO A;  3ZMU A;  2NVX J;  4I01 A;  2DTR A;  3PL8 A;  3DV8 A;  1LEB A;  1MNE A;  2JN6 A;  2CQ7 A;  4I7H A;  4KIB A;  1R5I D;  4ZJZ A;  2Y75 A;  3I71 A;  3K4C A;  3A2K A;  4RM2 A;  3BTI A;  1VI0 A;  3VDX A;  3SXY A;  2LH9 A;  3PFI A;  4FCY A;  1D1B A;  3MWM A;  2R7V A;  2EFW A;  1OYI A;  4RGX A;  5M3F J;  4EM2 A;  4RB0 A;  2FXA A;  3HM5 A;  2K86 A;  2P5L C;  5LRS A;  2E71 A;  3CLQ A;  1G3S A;  2HTJ A;  1ON1 A;  2Y69 H;  1KZH A;  1QNT A;  3RZD J;  5HDG A;  5FLV A;  4DIQ A;  1IAW A;  4LG3 A;  1KYZ A;  3OYA A;  1ZKG A;  1C0W A;  5FRM A;  1FX7 A;  2R3S A;  4B44 A;  2ZJ2 A;  3DQV C;  1VQ8 I;  4A3D J;  3AL0 C;  4DGW B;  1DPU A;  3TOA A;  1OJL A;  2HPI A;  1JI8 A;  1P92 A;  1TWC J;  3TW6 A;  4CH7 A;  4M6V A;  3FF5 A;  4NQW A;  3OWT A;  1R36 A;  2K4J A;  1MND A;  3WTS C;  5F0C A;  2FOK A;  1PJR A;  1H0M A;  2F5V A;  5KHD A;  3ZQQ A;  4C9Y A;  4B09 A;  4EEF G;  1I3Q J;  1PDN C;  2F5E A;  4MGR A;  3TGN A;  1Z77 A;  3GYH X;  2QF7 A;  3FMQ A;  4K2E A;  2IJL A;  1W0U A;  1KA8 A;  3PNT A;  3S1R J;  3GFI A;  1TQM A;  2RDP A;  1NTC A;  2M3A A;  3M8J A;  2HXO A;  3G1L A;  4D5C A;  4RAY A;  1OCT C;  1GHC A;  1RUO A;  1ZR2 A;  2EQR A;  3CCU I;  1O3Q A;  5DYM A;  1BIB A;  4GGG A;  1APL C;  4W97 A;  2YSR A;  3GFL A;  3S2H J;  4ZZD A;  3TED A;  4XN0 A;  2ZB9 A;  1T33 A;  1IUF A;  3RKW A;  5FLM J;  2R7T A;  1Z6R A;  2LLK A;  3BR3 A;  2VOO A;  1JJ6 C;  4XL9 A;  3PJR A;  2DI3 A;  3DF8 A;  3EQL F;  4BQA A;  1JGS A;  4E7S A;  3ECH A;  4BDY A;  3JAM Z;  4NC6 A;  2VJ5 A;  4Y17 A;  2AXT C;  3CLO A;  2DTZ A;  3MCZ A;  2DOF A;  4FE4 A;  1Y1V J;  1OIS A;  5E1Z B;  1VND A;  2VKD A;  4PFP A;  2ZJR F;  2NVU B;  3GTG J;  3SYT A;  3RZO J;  5FFX A;  3OIQ A;  3SFZ A;  3IRQ A;  1X3Z B;  1SEU A;  3S14 J;  1RC9 A;  2VBX A;  4BKX A;  3F8F A;  3CF2 A;  9ANT A;  2LBF B;  2OJE D;  2EPF A;  3E3V A;  1ZG3 A;  3WTW C;  4M71 A;  1IXC A;  1J7K A;  5EEG A;  3V8L A;  1H88 C;  3BJO A;  2BW3 B;  2VT2 A;  4AM3 A;  2HEO A;  5J1Y A;  1XCV A;  2CU7 A;  2RGV A;  3BR6 A;  5FO5 A;  4IQ4 A;  4HAM A;  4MFE A;  5AON A;  3MFK A;  5E3M A;  3IRR A;  2FML A;  3V7C A;  2QQA A;  1VQ5 I;  2NNN A;  4Y4R A;  4HZF A;  1ZRD A;  4E7Z A;  1JKP C;  2JA2 A;  5D4R A;  3GZ6 A;  2PX9 A;  1JTX A;  5EEH A;  5LEK A;  4F92 B;  3RPU A;  1Q1V A;  1UEL B;  2L7K A;  2P6S A;  5IYB J;  4BXX J;  2R93 J;  2E1M B;  3ZCO A;  3CJR B;  1OKR A;  3BR5 A;  5HS8 A;  4NC7 A;  1Y8Q B;  4KT5 C;  3OYH A;  1E3O C;  2TCT A;  4RA2 A;  3WG7 H;  1AU7 A;  4U0Y A;  5B66 C;  3BTL A;  4KMF A;  5IP6 A;  3I56 I;  4I2O A;  5A2Q Z;  4MEX F;  1A36 A;  1R1T A;  4L5E A;  1MZB A;  2K9L A;  3SEQ A;  1ZLK A;  3BPV A;  2FSW A;  5M5X J;  3CCL I;  1DDN A;  1WSU A;  3W2V A;  3VEP A;  4PJ0 C;  2ACJ A;  1LB2 A;  4IRI A;  2DYR H;  3QOP A;  4IOA F;  2K7L A;  1UHS A;  5EDN A;  4KJZ A;  1M1E B;  3E6C C;  1TT5 B;  5EZG A;  3OYB A;  1P9Q C;  1XX5 A;  3RCO A;  4EM1 A;  2VQG A;  4G94 A;  2ZXI A;  1XG1 A;  5FKN A;  3KE2 A;  2DT6 A;  5B1B H;  4A3E J;  1B8I B;  2GA2 A;  2BEO A;  4GCV A;  3HEF A;  5D6F A;  4XLP F;  3RSN A;  3ROU A;  4AID A;  2FQ3 A;  4YII A;  2N8G A;  1EF4 A;  2OC6 A;  4L9N A;  2QWW A;  2DMQ A;  3K69 A;  1D0X A;  1MIJ A;  2M2E A;  4BDZ A;  1S7E A;  2AO9 A;  4XBF A;  2CS3 A;  4BU2 A;  3P5J A;  3MAJ A;  2E7W A;  3C1D A;  4L0Y B;  1X4O A;  3QU3 A;  2FU4 A;  2XRN A;  1FOX A;  3L2W A;  2BHZ A;  1FYK A;  2VAS A;  1S7A A;  4QWQ A;  4BHB A;  4BEH A;  2STW A;  4IHT A;  3V8J A;  5BNG A;  2GOX B;  3C3W A;  1R5H A;  3WTV C;  2MBF A;  4CUG A;  2MLK A;  1SVM A;  5EYR A;  2MYS A;  4FIS A;  1LVA A;  3I3L A;  3CDH A;  4LFU A;  3P9K A;  4GFB A;  1P6R A;  4XLF A;  2I5U A;  3SFI A;  1U9N A;  2MGQ A;  3LMM A;  2QVO A;  4BE2 A;  4R1H A;  1ZLJ A;  4EJV A;  1NG6 A;  3WTT C;  5BQT A;  2ISY A;  2QZ8 A;  2CO5 A;  3OMY A;  3CCV I;  2CUE A;  2XF7 A;  4MQ9 F;  2XAH A;  1UG0 A;  1OCO H;  2OUM A;  5IYC J;  1KQ9 A;  1OYW A;  4II3 A;  5L3G A;  1X1P A;  1WJF A;  2P5V A;  2F48 A;  4I76 A;  2GAU A;  3QOD A;  3VWB A;  1UJ8 A;  3KZZ A;  4A3M J;  2R7U A;  4HW0 A;  4BGD A;  3K4K A;  3WGH A;  1YIO A;  3EDP A;  4RGU A;  2BY0 A;  1Z21 A;  2DN0 A;  3GLL A;  2E2I J;  3BG5 A;  4B3X A;  1OYY A;  2L9V A;  2V1X A;  5EGO B;  1MSF C;  3J7A Y;  1LDJ A;  1P7J A;  5FKM A;  1GV5 A;  5EF6 A;  4PK4 A;  2V6C A;  3LQQ A;  3S93 A;  4EGY A;  1UCR A;  3S1Q J;  3G1O A;  4IHX A;  1FT9 A;  4ZDP A;  2OA4 A;  2HDD A;  1PYV A;  2LMD A;  1IF1 A;  2WY7 Q;  2FRH A;  2LKX A;  4A0Z A;  1U6G A;  1ZEL A;  3D1N I;  3JAM K;  1J0R A;  2P7C B;  3KFW X;  1QU3 A;  5BOX A;  4JP0 A;  1RPW A;  5CKT A;  1Y6I A;  2R7Q A;  4HA8 A;  1BA5 A;  2AQF A;  2DMT A;  3RKY A;  4U88 A;  4DBQ A;  1BL0 A;  2VB6 A;  2CUJ A;  3TBI A;  3QPS A;  3S17 J;  1YLF A;  4L9V A;  4IZZ A;  5K5O A;  1YX3 A;  3WGI A;  1GUU A;  1NHA A;  4NQW B;  2XRL A;  1KYW A;  5GPC A;  1YW7 A;  4M9S A;  2W4S A;  5C44 J;  3Q5F A;  2H6B A;  4L0Z B;  3W3C A;  4JYK A;  2VE9 A;  1S7O A;  1A35 A;  3T1B A;  3H5N A;  4KIT B;  1POG A;  2IW5 A;  4ENM A;  1ZH5 A;  3TL4 X;  2DA4 A;  3PQK A;  4BXF A;  5F1R A;  2DOA A;  4D7N A;  3FM3 A;  5ICE A;  1KU3 A;  1RNL A;  5GP9 A;  3F22 A;  2VON A;  1IDY A;  5L3B A;  1D8K A;  1TW3 A;  3BDD A;  2NS0 A;  4FAS D;  2HOT A;  2HKX A;  3TQN A;  1RI7 A;  5F27 A;  4CCK A;  1VQ4 I;  4ESF A;  4LJZ F;  2KRH A;  5LBQ A;  1LE8 A;  3IAM 2;  2DT7 B;  2QQ8 A;  3OIP A;  3DLL F;  5A2Q K;  3WTY C;  1R9T J;  1MJ9 A;  2KL4 A;  3ONQ A;  3CES A;  2XAQ A;  3OY9 A;  3ZOB A;  2CGP A;  5JR3 A;  2VJJ A;  1I1S A;  3KEY A;  2WAQ N;  2ZME A;  1FWZ A;  2K9N A;  2LOO A;  3FXO A;  2ZC2 A;  5J47 A;  5JI6 A;  3JTG A;  2L7Z A;  3KYC B;  1Z0X A;  1XB4 A;  1BC7 C;  2MLG A;  1X1A A;  4OWR B;  1KQ8 A;  2HVQ A;  1JGG A;  2UXN A;  2J5P A;  1DQU A;  3FWE A;  2EB7 A;  3FK6 A;  1P4W A;  2YX4 A;  4LOC A;  4HNT A;  5J1U A;  5JVG F;  2LF7 A;  5DCM A;  2Z3Y A;  4YFN F;  4A6E A;  4MLO A;  3GW2 A;  3AAF A;  2V1N A;  1F9N A;  1XC5 A;  3EUK L;  4EM0 B;  4OIO F;  5K7Z A;  2P4W A;  2OU2 A;  3VYT B;  3A03 A;  1UZC A;  4Y7N J;  5J8F A;  1W36 C;  4ZZL A;  1JHF A;  4N9H A;  2DAO A;  2EK5 A;  2E19 A;  2Z33 A;  1JUS A;  3DBH B;  2MG4 A;  1X2M A;  4YFX F;  3QU6 A;  3MKY B;  3VOE A;  4LIV A;  3F6V A;  2LF8 A;  3IH2 A;  4UUS A;  1VQ7 I;  1ZK8 A;  3N97 A;  3ASO H;  2K40 A;  2E1N A;  1DUX C;  2E5N A;  2HYF A;  1O7L A;  4PCQ A;  5DV5 A;  5B3S H;  5HNH A;  4ENJ A;  1U5T A;  1VQO I;  2KP6 A;  2GIZ A;  5GAG J;  1W5C C;  3DBL B;  1R7J A;  1EH7 A;  1S8N A;  4XRS A;  1YRN A;  3K1N A;  4OIN F;  2A6E F;  1QA6 A;  2JPB A;  2Y2Z A;  4G8X A;  3OR2 C;  4XOR A;  3JRF A;  4UY8 I;  3Q3S A;  1MDM A;  3TO9 A;  1HXD A;  3E6D A;  2IRF G;  2HZD A;  5J1R A;  4UVB A;  4G9Y A;  3JTH A;  4CYC B;  3ZRG A;  1W0T A;  3DPU A;  1WH7 A;  3CJQ B;  3U1D A;  3KIO A;  1IRF A;  4HF2 A;  3OR1 C;  2M9H A;  5TGT A;  4AIH A;  4B1R A;  3ABT A;  2IAI A;  1HST A;  4RAF A;  4IF4 A;  2WC2 A;  3KZI C;  3DFG A;  3CO6 C;  1WH5 A;  2F4M B;  2G0E A;  3CCJ I;  2L9R A;  1YG2 A;  1BR2 A;  1YJ9 I;  1WJE A;  2NXN B;  2BXY A;  4KA4 A;  4HEA 2;  2WY8 Q;  4IO9 F;  1SMY F;  2GLO A;  1XDU A;  3I9V 2;  2VBY A;  3KP6 A;  3LSJ A;  3M3Y J;  1DGW Y;  3WHC A;  5KAI C;  2P5K A;  3ERM A;  4V19 K;  2EIN H;  2LYC A;  2CQN A;  2VC0 A;  2W1O A;  3ZMZ A;  2WBM A;  2KKO A;  3O8G A;  3VOD A;  1TQI A;  3DKY A;  5LHH A;  3A02 A;  3R4K A;  2IGM A;  3ECO A;  2XGX A;  4BEH B;  3K10 A;  1FC3 A;  1FIP A;  3R0J A;  2R7Z J;  4FTH A;  2YPR A;  2K9M A;  1ETV A;  4PJM A;  3RJP A;  4R79 A;  3MKZ A;  3MN2 A;  2NOJ B;  3HHG A;  4M74 A;  1TC3 C;  2K9S A;  2XSD C;  4NC8 A;  1WVR A;  4OMZ A;  3ZP5 A;  1XMK A;  3KP2 A;  2PJP A;  2WV0 A;  4AYB N;  3PO2 J;  3GEZ A;  3F8C A;  5E8I A;  1WQ2 A;  2VXZ A;  1WI3 A;  1SFE A;  5KAF C;  2CWE A;  5EEA A;  4HX4 A;  2A6H F;  4GYI A;  4YG2 F;  3BY6 A;  1S72 I;  4S05 A;  3OYI A;  3TO6 A;  2DDA A;  4KDP A;  2Y30 A;  2ZSH B;  3C7J A;  4HG2 A;  2O03 A;  1AOY A;  1PUF B;  2FOW A;  2M34 A;  2QGU A;  4R8H A;  2EZH A;  1V3F A;  3CJT B;  3F8M A;  3OSG A;  2OTL I;  2QLZ A;  3HKZ N;  3I0T A;  3WGG A;  1B8I A;  2DA5 A;  4P1W A;  4L9J A;  2UV1 A;  5KVR A;  3MKW B;  2ADU A;  3M4O J;  5IY5 H;  1P7I A;  2VQL A;  3X2Q H;  1BI0 A;  2IA0 A;  4C2T A;  1ZGW A;  3BCB A;  5GAH J;  3K2A A;  1FNN A;  1T2K A;  4IPA A;  4XLH A;  5M3M J;  1EA3 A;  5KNL A;  2PI0 A;  3VSK A;  2O0Y A;  4LB6 B;  2BY2 A;  4G6T B;  5DD4 A;  1UST A;  1FJL A;  4PSW A;  1U8B A;  3G3Z A;  4AVZ A;  4RAG A;  3BP8 A;  3F8B A;  1XSD A;  1QZZ A;  2MH9 A;  1BI1 A;  2KZV A;  2VPR A;  2V1D A;  4KIS A;  5L3C A;  2LVS A;  2ISZ A;  2B7E A;  1V55 H;  1ENH A;  2A5Y B;  2IGO A;  2M7A A;  2RC4 A;  4NB5 A;  4IHS A;  3HSE A;  1WJB A;  3P7N A;  4CHU A;  4CZC A;  3E6M A;  1DU0 A;  3GTP J;  1FTT A;  1SVO A;  2BYV E;  3FMR A;  3OYG A;  3DP7 A;  3LA7 A;  1E0E A;  1PUE E;  1EH8 A;  1X3W B;  4OAZ A;  1BOB A;  3KP4 A;  1BC8 C;  2QYO A;  4MNU A;  3J7Y J;  3FM5 A;  4KN7 X;  4XOP A;  2PN6 A;  4MO7 A;  3Q0V A;  1HDP A;  1YTY A;  5E17 F;  2CH0 A;  4J01 A;  5FKK A;  2IA2 A;  1FYM A;  1A6Q A;  3BRO A;  2BHY A;  1ZGJ A;  1Z7U A;  2UZK A;  3LSP A;  3SDB A;  2LKP A;  4L5I A;  4EQQ A;  4O3M A;  2DW4 A;  4RGS A;  3JSP A;  2O7O A;  2H1K A;  1HW1 A;  1WKM A;  3G71 I;  1G3W A;  3OSF A;  1O3S A;  4II2 A;  2VQH A;  2FE3 A;  1Z05 A;  2WAE A;  3KP5 A;  4L18 B;  2WB1 N;  2W25 A;  1MMN A;  3HRS A;  1LE8 B;  2KPM A;  4C2M J;  4HDU A;  2OZU A;  3BG9 A;  1UHW A;  2G7H A;  1IC8 A;  5E3L A;  2L02 A;  4EGZ A;  1ZTR A;  4KFC A;  3D5S C;  1O3R A;  3DPL C;  3NQO A;  1JKQ C;  3GTO J;  2ID6 A;  1BR1 A;  4JX5 A;  1SFU A;  3O2P E;  2EIJ H;  3H9Q A;  2H94 A;  5D4S A;  4ZYE A;  3FZV A;  3D5R C;  2DA6 A;  5IOY A;  1MJA A;  5EGO A;  2ZME B;  2XB5 A;  4N0B A;  1VQL I;  1BR4 A;  3COA C;  2AQE A;  5D5U B;  1PVE A;  3ULQ B;  1YJW I;  1MJB A;  1R6R A;  3HRM A;  4CGZ A;  2FBH A;  1IN5 A;  3GWZ A;  1HLV A;  3BQY A;  1G3T A;  4XK4 A;  1VF9 A;  1FZP B;  4UB6 C;  1K61 A;  1CGP A;  1X1C A;  3E97 A;  3BTC A;  2DMP A;  3BQZ A;  5DCM B;  2NYX A;  2NS7 A;  1VQ9 I;  4E7L A;  5CJ9 A;  2DFF A;  1IN8 A;  2WAD A;  3V7R A;  1G8X A;  2EIM H;  4EJO A;  1G3Y A;  2IS2 A;  3P9I A;  2F2E A;  3FHZ A;  3K4L A;  2F5F A;  4PJJ A;  4BBR J;  2XAS A;  1GT0 C;  1XGN A;  2XGC A;  3F9K A;  2KIU A;  3BT9 A;  4AYB A;  4MIM A;  4FET A;  1XMX A;  2OPT A;  3S2W A;  1CQT A;  3ZMV A;  3CP2 A;  2HQ5 A;  4RMN A;  3KZY A;  2VOP A;  3QPH A;  2BGC A;  3PQJ A;  3ERE D;  2MSY A;  2PEX A;  1Z91 A;  2K3F A;  3F8N A;  4Y13 A;  4UUS B;  3FXU A;  3ABM H;  2O6G E;  2M30 A;  1I6X A;  2KJB A;  1DGR M;  3F23 A;  3MZH A;  4E7I A;  1U5T B;  2DMN A;  1S5L C;  1TWA J;  2VKH A;  2LK2 A;  4IQJ A;  5E18 F;  2VKV A;  5K7F A;  2KRF A;  2JRM A;  2Y9Z A;  3HSR A;  3GTM J;  4JOM A;  2WTE A;  1YRN B;  2KQR A;  2LSO A;  1ORK A;  2HDW A;  3HKZ A;  5LGN A;  3WU0 A;  3FXQ A;  1FBU A;  4L9T A;  2P0W A;  2ZXW H;  3CO7 C;  2DPD A;  3LST A;  2QBY B;  1MDM B;  4AVP A;  5FKL A;  5B5E C;  1ERD A;  1QVT A;  5FRO A;  3ZQC A;  2BXZ A;  2EBI A;  5BS6 A;  3F72 A;  3UR3 C;  3WOD F;  3WU1 B;  1MMD A;  1WFX A;  2F5C A;  2GZW A;  4DZP A;  2QM3 A;  1L0O C;  3SZT A;  2VJI A;  1TWF J;  3EYY A;  2OTJ I;  4DQ2 A;  3VYS B;  2ZFW A;  3H3U A;  3LA2 A;  1YIT I;  4M6Y A;  2P81 A;  4KNY A;  5J8C A;  4BJT A;  5ILU A;  1V4R A;  4HBL A;  3QYE A;  3HHH A;  2KT0 A;  1HKT A;  3ZQG A;  3U1K A;  2E7X A;  2JZY A;  5IP7 J;  4AU7 A;  1D1C A;  1XTA A;  3HOY J;  1J59 A;  1FYL A;  2L9S A;  4BY1 J;  4DBR A;  2LC2 A;  3EUH C;  4EJT A;  1KU7 A;  2VKE A;  1D0Z A;  1SD4 A;  2X48 A;  4B4C A;  3TOB A;  3U9G A;  3H9G A;  1OCP A;  4XSZ F;  2NNY A;  1XDS A;  1YYV A;  3B6C A;  1TQP A;  1EJ9 A;  1RIO H;  2W82 A;  5K7H A;  4RS8 A;  4P55 A;  2GXA A;  1P4X A;  2DQR A;  2P6T A;  2W85 A;  2JVG A;  2R7R A;  3HUG B;  4I09 A;  2NVQ J;  4EVI A;  3OS2 A;  3L2R A;  2JSP A;  1K83 J;  3KX2 A;  1ZAO A;  3I53 A;  3H3V K;  4P9U A;  2WB1 A;  2V9P A;  3FBN B;  5FJ8 J;  1LVK A;  5JLW A;  3BG6 A;  3LSI A;  5D8L B;  2CW8 A;  3DKW A;  1IZ1 A;  2RRE A;  2LRD A;  4N4N B;  2AHQ A;  1ZRE A;  3SHF A;  2Q2E A;  4UV9 A;  2HVS A;  1G4D A;  2A68 F;  2OBP A;  3M9A A;  1MSE C;  4YIR X;  2Y31 A;  4W1U A;  3D5L A;  3RQ4 A;  4UB8 C;  4HQE A;  4H4K C;  2XAF A;  3CCQ I;  5E8G A;  5H2F C;  2ZBK A;  4C3J J;  2G7U A;  1T56 A;  1UG2 A;  3BR2 A;  1SD5 A;  4CYC A;  3LAP A;  3T8T A;  2R0Q C;  5IT9 Z;  2XAU A;  3R6S A;  2E60 A;  2ETH A;  3I5U A;  3HOV J;  4I02 A;  1WHU A;  2KLO A;  3R60 A;  4ESB A;  3C2H A;  3MZ8 A;  5BMZ A;  1ULY A;  1CF7 B;  5BPI A;  3CJS B;  3FXL A;  2MA3 A;  1JUP A;  1BI3 A;  3B6A A;  1D1A A;  4KIF A;  3QYB A;  4F3Q A;  4U87 A;  2R92 J;  4IL6 C;  5FRN A;  3O6B B;  1IN4 A;  4EMS A;  5DM7 F;  2Z5U A;  3ASN H;  3LWF A;  5D6E A;  5DCF A;  1IXS B;  2R5Z A;  3MKL A;  5HOD A;  3BZ6 A;  2BZT A;  3BWG A;  4IKF A;  2CJJ A;  4QLC U;  4TV7 A;  1BOA A;  4E6K G;  2EV5 A;  4HSR A;  1E17 A;  3FXK A;  3RKX A;  2V1U A;  1HW2 A;  4WXD A;  3WU2 C;  4A12 A;  1O7F A;  2XKO A;  5HDK A;  3L2C A;  1QPI A;  3CCR I;  2BVL A;  1W7P A;  3JCU C;  1YX5 A;  4F93 B;  2LP0 A;  5LGT A;  5LGU A;  1Y1W J;  3LSK A;  2RAE A;  3FIW A;  3HOU J;  4HX8 A;  1TBX A;  2M8E A;  2KZG A;  4YEL A;  4DZJ A;  3OYN A;  1TWG J;  1TWH J;  1SFK A;  5M5W J;  4RLF A;  1RKW A;  2Z1D A;  3HYI A;  1O4X A;  5FGM A;  2V6E A;  4BHP A;  1H9T A;  4G6Q A;  1LDK B;  4WXC A;  5DDG A;  2F4O B;  4ETS A;  3LAJ A;  1IRX A;  3L7W A;  4CYD A;  2VOD A;  3CC7 I;  2CRG A;  2O9L A;  1R4M B;  1FPQ A;  3JW4 A;  4A3C J;  4PJN A;  5AIP A;  5H6Q A;  1SAN A;  2GM4 A;  1QHG A;  1B6A A;  3BLY A;  1PP7 U;  5LEJ A;  4E70 A;  4LLG F;  3T5X A;  2KHM A;  3K4N A;  4LK1 F;  1PUF A;  4BUP A;  2DFH A;  1MBK A;  5HVQ C;  3NRV A;  3RTR A;  4XRM A;  4DYR A;  2KDZ A;  1TL8 A;  1LKX A;  2EV0 A;  3BPX A;  3O8H A;  4ZYG A;  1K4T A;  4I0A A;  4XQF A;  1G2H A;  4A3K J;  1IRZ A;  3HC7 A;  4BQO A;  2CQX A;  3QP5 A;  4CIC A;  3J81 Z;  1ZN2 A;  3S1M J;  1WJA A;  2X9D A;  3E6B A;  5JVT A;  3WHB A;  2Y9Y A;  4U7B A;  2PFB A;  4XLN F;  3DEU A;  3BJ6 A;  1ETO A;  2L3D A;  2O3F A;  3TKY A;  1ZR4 A;  2K5C A;  3ZMT A;  1R1U A;  2WA0 A;  3OYJ A;  1ETQ A;  2JJ7 A;  2ICW G;  3KP3 A;  3MZY A;  3PIO F;  2PMU A;  1LEA A;  2X0L A;  2XAJ A;  2K4B A;  1JT6 A;  3IKV A;  3S2D J;  3PSF A;  3HXL A;  1LDD A;  4A69 C;  5ERI A;  4EJU A;  1FSH A;  5GPA A;  4AWX B;  3FMS A;  3CDI A;  4CSW A;  4HQM A;  2F4I A;  3PNY A;  1OR7 C;  4PJL A;  5DM6 F;  2GWR A;  3OYD A;  1I1G A;  3GO5 A;  3L9F A;  3ABK H;  2DPU A;  4PZJ A;  1F5T A;  4Z2Y A;  2VLA A;  3CCM I;  2IXS A;  2DMU A;  4MEY F;  3OYF A;  1IGN A;  3E5Q A;  4CCO A;  2VBZ A;  1MBE A;  2R7X A;  4CCN A;  1QO0 D;  2ZKZ A;  3H0G J;  5E1W A;  4M3B A;  4LIT A;  4HOB A;  3IV5 A;  1W5T A;  2VE8 A;  1QVU A;  1OPC A;  1RZ4 A;  2C6Y A;  2HFH A;  4UV8 A;  1BBY A;  3GFJ A;  1WGX A;  4Y52 J;  1HF0 A;  5ILS A;  4JX4 A;  2A5W A;  3KLO A;  3EET A;  5FD6 A;  5CVV A;  3K4M A;  2CUZ A;  2R7O A;  3GTL J;  4XMY A;  3ZGK A;  2Z16 A;  4YEJ A;  5LLQ A;  2A05 A;  3LFU A;  4HF1 A;  2JUG A;  4S0H B;  3IL2 A;  5H20 A;  1U78 A;  1AKH A;  5HS7 A;  1IN6 A;  1WIB A;  1R1V A;  4RB2 C;  3A1Y A;  3S3N A;  2E1M C;  4BNC A;  5IT9 K;  1XN7 A;  3F3X A;  3OS0 A;  3DTK A;  4C3H J;  2LD5 A;  2DA2 A;  3AG3 H;  4GO1 A;  2CV0 A;  1YHQ I;  2XSJ C;  2CSO A;  1LNW A;  5LFA A;  3HTS B;  3S16 J;  3FK7 A;  2R7S A;  1MKM A;  3CUQ C;  3M7G A;  1VQ6 I;  1FIA A;  2HYG D;  2H6C A;  5CYV A;  2EZI A;  1X1B A;  2LKS A;  3IWF A;  5L3E A;  3C2B A;  2CV2 A;  3AFH A;  1JHH A;  2LY1 A;  1OCR H;  4P96 A;  3JRE A;  4PGH A;  4E7K A;  4IXA A;  2W24 A;  2IEK A;  1IJW C;  1KU9 A;  2EIL H;  3LOC A;  2KFD A;  4A0X A;  4Q4Z F;  1T0F C;  2ME0 A;  2HGC A;  2IPQ X;  1BIA A;  2OCE A;  2QKM B;  4ON0 A;  4ITV A;  3SZP A;  3KET A;  1JE8 A;  1ZRC A;  5F0F A;  4OMY A;  5DTD A;  2QUF A;  2MH2 A;  4RAZ A;  1HKQ A;  5GTH C;  3HOS A;  4LLL A;  4HV5 A;  3TO7 A;  3OYC A;  3G2B A;  5JLX A;  2Q2E B;  1TT0 A;  2FBK A;  3LSG A;  2LR8 A;  3HPG A;  2ME6 A;  3I58 A;  1SMT A;  3VYR B;  1XS9 A;  1IUY A;  3FKI J;  3RPU D;  3CJN A;  1UHM A;  2F6C A;  2ZCW A;  2QBY A;  3HOX J;  1KU2 A;  4GYG A;  5DUI A;  2D2W A;  1WWX A;  2GOM A;  2M8G X;  1BW5 A;  3A01 A;  1XD7 A;  4FX0 A;  3JRG A;  4RM3 A;  3BCA A;  2ZO4 A;  5EG0 A;  5K1Y A;  4D5F A;  3AL0 B;  5E79 C;  4AD9 A;  3S15 J;  4BJ6 C;  4OOI A;  5FFZ A;  1K4S A;  4C3I J;  2X6X A;  2DOE A;  5JHU A;  3F21 A;  1SAX A;  4BE1 A;  4G7Z F;  3FXR A;  3RI4 A;  1FEX A;  1LUJ B;  2QCO A;  2DLL A;  2R5Z B;  3MMY B;  3RQI A;  3N4M A;  2KIS A;  2STT A;  3K0L A;  2QQB A;  4ZYH A;  1REP C;  3LFK A;  4UUT A;  1FBQ A;  3QWL A;  2HPM A;  2NVY J;  3JSO A;  4PGG A;  2L2O A;  3J81 K;  2DA7 A;  4MFD A;  2HQA A;  2NAZ A;  4WXH A;  4O6J A;  1YIJ I;  5DUK A;  1YQA A;  5H6R A;  2K85 A;  1W7P B;  1J9I A;  2WAF A;  4Y15 A;  3HUG A;  2NS8 A;  2M1B A;  3H5A A;  4BS9 A;  4XN3 A;  5CLS A;  3CC4 I;  1XCB A;  1Z67 A;  4C30 A;  2X51 A;  5CPR B;  3OYM A;  2ZJP F;  4A3B J;  4KIC A;  2RKH A;  3DCF A;  4XOT A;  4FT8 A;  4G7H F;  1I39 A;  4DNC A;  2R7F A;  3CUO A;  3GVA A;  1Z1D A;  2LDU A;  3DBR B;  2QKL B;  1AWC A;  4LLN A;  4A5M A;  4UNO A;  1LPQ A;  3BOQ A;  4UXN A;  1VQK I;  1OCZ H;  1BJZ A;  4WK8 F;  2DA1 A;  6PAX A;  2M0M A;  3H5R A;  4HYE A;  3VPR A;  3CME I;  1T08 B;  5AIQ A;  3G1M A;  1GXP A;  4BY7 J;  4BXU A;  1U3E M;  3H36 A;  1B4A A;  1Q1H A;  3M1C A;  1O57 A;  2DYS H;  2WAQ A;  2JA6 J;  3A0B C;  3R61 A;  4RB1 A;  5F0H A;  4XR6 A;  2ECC A;  1WRJ A;  4XKC A;  2IGN A;  4BAY A;  3JRA A;  3JR9 A;  5DEQ A;  2JK3 A;  3FKJ A;  3BG7 A;  3S1N J;  5HNF A;  2L7F P;  1R71 A;  5J6X A;  1QBJ A;  2M5W A;  5CVJ A;  4B8X A;  3DTI A;  2X6Y A;  1X58 A;  1IDZ A;  2XB0 X;  2BY1 A;  3HG9 A;  3QQA A;  3DWL E;  4XKB A;  3V7S A;  1W4M A;  2EFP A;  1ITY A;  2W57 A;  3TDU C;  1TLH B;  3M8F A;  4A3L J;  2EA4 A;  1VQM I;  3DEE A;  1LJ9 A;  2JPC A;  1YO5 C;  1CF7 A;  2M7B A;  1I50 J;  1USS A;  2DT5 A;  2FX0 A;  1XGM A;  2E36 A;  4Z6Y A;  4C2U A;  2DCE A;  1JUM A;  2DOD A;  2OQR A;  1FOW A;  3NAU A;  3R0A A;  4E7J A;  4A3G J;  2O5R A;  2VN2 A;  4HPQ A;  3IHU A;  4BYY A;  4IOC F;  2DK5 A;  2XPU A;  3FBI B;  2CW7 A;  4P9F A;  4AIJ A;  3IH4 A;  3SQN A;  2X1E A;  2CFX A;  3CMA I;  4HF0 A;  1BN5 A;  5IT3 A;  4A3J J;  4NUB A;  2PBI A;  2L0K A;  5GAE J;  2L54 A;  2B63 J;  1D5V A;  3VYU B;  5CQG A;  1F4K A;  2JA7 J;  1HC8 A;  1IV6 A;  1SD6 A;  2EIK H;  2OQG A;  1P2F A;  1YE9 A;  3HDD A;  5IYD J;  3K9T A;  1XPX A;  2VBW A;  3KEQ A;  3OYE A;  2OCC H;  3K1M A;  3HL2 A;  1ZRF A;  1FTZ A;  3E0J B;  5JFR A;  4QSH A;  2A07 F;  2HR3 A;  4UVA A;  2MW8 A;  2A69 F;  1R23 A;  1QQI A;  3U21 A;  3H0D A;  3ZQH A;  3QPL A;  1WJD A;  2LY9 A;  4CCJ A;  2CFO A;  3IH3 A;  2CW0 F;  4XID A;  4IHY A;  4IRG A;  3FXM A;  3JRC A;  1ETW A;  3IAS 2;  4A93 J;  2XGD A;  3QP6 A;  2BVM A;  5J4Y A;  4MQV A;  4S04 A;  3BR1 A;  3K6G A;  4LIU A;  2J5O A;  2H8R A;  4M3E A;  3V8K A;  1ODD A;  2ZXH A;  3WE2 A;  1U2W A;  4B48 A;  1LQ1 A;  3CDL A;  1H9G A;  2XIG A;  1OCC H;  1WPK A;  2JA5 J;  2EFQ A;  3S3M A;  1AKH B;  4MHG A;  1W1W E;  3RYP A;  1QZY A;  3MVP A;  1NK3 P;  3NWS A;  1OQY A;  3BG3 A;  4AC0 A;  4FX4 A;  2JTV A;  2XHK A;  3I59 A;  5J3L A;  1BM9 A;  2COM A;  2KIQ A;  2VJ4 A;  2X6W A;  2P8T A;  2HTS A;  5M5Y J;  1B9N A;  1G59 A;  4DYQ A;  2EFN A;  3KYL A;  5F04 A;  1Z3X A;  3HOW J;  1V54 H;  2OD5 A;  2VUM J;  1WCM J;  3IC7 A;  1IV8 A;  2YU3 A;  2IBD A;  3CMY A;  1D5Y A;  1HKS A;  4B43 A;  1NG7 A;  3CF5 F;  2R4G A;  3HGY A;  2FNP A;  3ZN1 A;  3J80 Z;  1X4P A;  1QZE A;  4PDK A;  2VQC A;  3GTK J;  3TDZ C;  4RBO A;  1G6N A;  1K79 A;  3ZQI A;  1T95 A;  4HDV A;  3ML6 A;  5TRD A;  4ABZ A;  2PJR A;  5ICC A;  2B0L A;  2DBB A;  4B47 A;  2MC4 A;  3I4M J;  3F6O A;  2L9N A;  3HB9 A;  1EKE A;  3E5X A;  1LFB A;  3I4P A;  4KMU X;  1ZG5 A;  1R49 A;  3T0Y A;  3OYK A;  1B72 A;  2DQL A;  1SFX A;  3GCM A;  4JQF A;  2ELJ A;  4CZZ A;  1VFC A;  3OOU A;  4DW6 A;  2V9K A;  5CVU A;  1F43 A;  1RRJ A;  5C4X J;  3LQR A;  1GDT A;  4XLE A;  3HOT A;  3JRH A;  3Q0U A;  1LFU P;  4Q48 A;  4WX9 A;  4BHC A;  2HNH A;  2JQ7 A;  4BH9 A;  1HDD C;  4D0P A;  2AXL A;  3L09 A;  3SDG A;  3A01 B;  3W2A A;  2EZL A;  1V5F A;  2BOL A;  1O3T A;  5EG0 B;  5EZH A;  5L3F A;  5ICF A;  3HRU A;  5HS9 A;  2HWV A;  2QA4 I;  4GRI A;  3ZR8 X;  3M07 A;  2Q8K A;  4G6D A;  2VXD A;  2ESH A;  1MD0 A;  4AIK A;  1OFC X;  3FDY A;  2P7V B;  4L5J A;  2L4A A;  3E5U A;  4OAY A;  3REO A;  3GTQ J;  2BBY A;  2QSH X;  3AG1 H;  5E1X A;  1A04 A;  4HNV A;  3EUA A;  1PP8 F;  2K3P A;  3LSM A;  4LG0 A;  2QEX I;  2VPL A;  2RQP A;  1UFM A;  2FQ4 A;  4RGR A;  1YI2 I;  1Y39 A;  1EV7 A;  1MH3 A;  3ABL H;  4XSX F;  3QYF A;  4G7O F;  3FXJ A;  4O5V A;  4BBS J;  2R7W A;  4ENK A;  1ZG1 A;  3CMM A;  4ZH4 F;  3LL7 A;  3OOP A;  3LA3 A;  1T8I A;  3LSH A;  3I64 A;  1J75 A;  3WG9 A;  1Y0N A;  4Y3O A;  1T39 A;  4LK0 F;  4IHW A;  1X1D A;  1H89 C;  1GVD A;  3UKG A;  4LB5 A;  5HLH A;  1Y0U A;  2JRT A;  3GX4 X;  1I6H J;  3HSF A;  3A4C A;  3LSR A;  3WTX C;  2FEZ A;  2IVM A;  1ZQ3 P;  5D8K B;  1B1B A;  3AG2 H;  3CQZ J;  3NEU A;  4IHV A;  3VFZ A;  4FE7 A;  1S29 A;  2EJR A;  3Q0W A;  3ESW B;  1KGS A;  2PLY A;  3T8R A;  3ISP A;  4M3F A;  2D5V A;  4JBA A;  4M9X A;  2V4J C;  4ESJ A;  2ESN A;  5F6F A;  3RPQ A;  3ZQ7 A;  4XKV A;  2LY2 A;  1FMV A;  1HSJ A;  4XNF A;  1HA8 A;  3RYR A;  2XRO A;  1ETK A;  1R58 A;  4M9Z A;  4XM3 A;  3IKT A;  1ZGA A;  1U0J A;  2CMP A;  3C18 A;  3EPZ A;  4EJW A;  2R5Y B;  2E2H J;  4QPQ A;  2V9V A;  2O8K A;  4P5O A;  4XLA A;  3TP3 A;  1MBH A;  4I99 C;  3SEZ A;  4LGW A;  2MD0 A;  5ED4 A;  3PO3 J;  2DU9 A;  1X3U A;  2VI6 A;  1XGO A;  4U7D A;  3S8P A;  5D5W B;  3QAH A;  2X4H A;  3CUQ B;  1A6I A;  4LD5 A;  4QPO A;  4N4O B;  2X1C A;  4E7H A;  3H9J A;  1TP4 A;  3K2Z A;  4OU0 A;  1MMG A;  2NVT J;  4Y33 A;  3L2U A;  2VC1 A;  3WTU C;  2D45 A;  3GBG A;  4A3F J;  2QSF X;  3GF2 A;  5IOZ A;  4DJA A;  4XKW A;  1B9M A;  1FBS A;  4JK1 X;  1YJN I;  2CUF A;  1AA7 A;  2CYY A;  2E34 A;  2GXG A;  5DD8 A;  1JJ8 C;  1RUN A;  2XUB A;  3KEO A;  3G6E I;  1K78 A;  3OYL A;  2GQQ A;  2PG4 A;  4U0V A;  2O8X A;  3I55 I;  3O3K A;  2A3S A;  4ZYD A;  3PUB A;  3CTA A;  3NAR A;  1UAA A;  4NDL A;  2K27 A;  2MD5 A;  2XPV A;  3K4J A;  2Y0S N;  4RLQ A;  4MTE A;  4RDU A;  1MMS A;  1W36 D;  1F1Z A;  1VQP I;  2H09 A;  1R5G A;  1I3A A;  3DTE A;  5E3N A;  1VZ0 A;  3J7Z I;  3PNV A;  1N25 A;  2BE5 F;  2W7N A;  4BJ5 C;  3HTU A;  1B59 A;  2Q1Z B;  3CCE I;  3M1E A;  1DPR A;  2DO7 A;  2ZME C;  1A31 A;  1MH4 A;  2KJC A;  4WF2 A;  4ZDL A;  3GZN B;  3J80 K;  1FSE A;  2XF5 A;  3ABU A;  4ZTF A;  1VQN I;  3ZQF A;  2E1O A;  2KMU A;  2PMH A;  2D1H A;  2RNJ A;  3AG4 H;  2IS4 A;  3W6K B;  5E3O A;  4LMY A;  5FB2 A;  4H0E A;  1XMA A;  2BY3 A;  4DYC A;  5FD5 A;  4YIF A;  2DFI A;  2XAG A;  3BC8 A;  4EV0 A;  3DKX A;  4PFO A;  3Q9V A;  4XIC A;  3HGG A;  2JSC A;  3CC2 I;  3DEW A;  2UWM A;  3FIS A;  2CQQ A;  3DLA A;  3D0S A;  5KCM A;  1Z6T A;  1HBX G;  3KP7 A;  2V79 A;  3V42 A;  2LG4 A;  2UXX A;  4ZDO A;  3EUH A;  4YRV A;  3C2G A;  2M87 A;  1QRY A;  2VT3 A;  2ZFU A;  2H8W A;  2HI3 A;  2JT1 A;  5DS9 A;  2ELH A;  2JMW A;  3NWT A;  4M6X A;  1LFP A;  2VIX A;  3W6J B;  2XKP A;  3CZ6 A;  3I59 B;  2HOS A;  2V26 A;  2FBI A;  5IPA A;  1U5T C;  1JXS A;  5CQE A;  2YS9 A;  2A61 A;  3Q9S A;  2OZ6 A;  4NHJ A;  1MBG A;  3H92 A;  3UNG C;  3GFM A;  3BZK A;  1TW2 A;  3IP4 B;  3B02 A;  1K7A A;  4A6D A;  2L4M A;  3P9C A;  3GUD A;  2EV6 A;  3K1P A;  3TW7 A;  2FA5 A;  5EJC A;  2EZK A;  1ZYR F;  2Q0O A;  1T38 A;  4ANJ A;  4M3D A;  2HVR A;  1MBJ A;  2ZXJ A;  3G73 A;  1BJA A;  1X19 A;  4B3A A;  1XSV A;  4KYW A;  2DXI A;  1J2X A;  1Y56 A;  3S3O A;  3H3Z A;  3ELK A;  2PJR B;  2V7F A;  1YOV B;  4M73 A;  3ZMD A;  5F1J A;  5F64 A;  4JX6 A;  2RQQ A;  1S6L A;  4OIQ F;  2K9Q A;  4WWC A;  1TZL A;  5KK1 A;  2W84 A;  1E2X A;  4KUM A;  3TP0 A;  2ZJQ F;  3CCS I;  2X1D A;  1B72 B;  2OV7 A;  3AKZ A;  3JRB A;  4IJA A;  1JKR C;  3F0C A;  2HDC A;  4HST A;  3ZXS A;  4UHT A;  1YW8 A;  5HLT A;  1I27 A;  1RKT A;  1GVJ A;  2XV4 S;  3ZMS A;  2G9W A;  3PM1 A;  4G12 A;  1AHD P;  2X6O A;  5LD2 C;  4WCG A;  2Y0M A;  2WV1 A;  1EH6 A;  5FLX Z;  2IS1 A;  4KIG A;  2YX7 A;  2FJ1 A;  2IGK A;  2QEN A;  3HRT A;  4XRS G;  5HDN A;  2GXB A;  1N78 A;  1ZAR A;  4ENN A;  2NRA C;  3WE3 A;  3DU5 A;  2DA3 A;  1E3P A;  2Y48 A;  4A3I J;  3KYD B;  4UVC A;  1FOY A;  1TNT A;  3J7A O;  2K02 A;  3IWZ A;  4HV6 A;  4NNJ A;  1D8J A;  3GXO A;  1K6Y A;  2EWN A;  1FP1 D;  3ZQL A;  5GAD J;  1MMA A;  4IRH A;  3RKQ A;  1R4N B;  1RR7 A;  1YS6 A;  5LRR A;  4RB3 C;  4NBQ A;  2Y0S A;  2E5Z A;  2LRE A;  3K70 D;  2FF4 A;  3VSL A;  1BW6 A;  4LG0 B;  3G4S I;  4QIW N;  1IW7 F;  2PMZ N;  1P4A A;  5HLI A;  4EAT A;  2RVC A;  1JKO C;  1RES A;  3ZPL A;  4Q47 A;  3M8E A;  4DOZ A;  1ON2 A;  4CXF A;  2KRC A;  3GME A;  3OL4 A;  4J19 A;  3K4B A;  4OIP F;  3I54 A;  1SC7 A;  2IT0 A;  5L3D A;  3L2Q A;  2HU9 A;  3QRF F;  1MGT A;  2XGE A;  2BV6 A;  3E7L A;  2I8D A;  2W00 A;  2HS5 A;  1IG7 A;  4BL0 B;  1J5Y A;  4E4H A;  2JVH A;  1FY7 A;  4FHT A;  3W6V A;  4D9J A;  1SFO J;  1NH3 A;  4J00 A;  4FQG A;  2LNB A;  1H8A C;  2CV1 A;  3HPH A;  5C4J J;  3L1P A;  4YFK F;  2X85 A;  4HLX A;  1U9O A;  1HW5 A;  3OV8 A;  3U2R A;  1S9H A;  2XVC A;  2FUG 2;  1GV2 A;  3EGV B;  1SVL A;  4IEJ A;  2ZNY A;  2L5Q A;  2EH3 A;  2GBY A;  1KON A;  3EYI A;  2PQ8 A;  2GIV A;  4ZYA A;  4M3G A;  2XF6 A;  2XPW A;  5ILV A;  2KDO A;  2VL8 A;  2A6T A;  3ZN0 A;  3PIP F;  2M0C A;  4Q5S F;  2D1V A;  1MBF A;  2XDV A;  2ZSI B;  4XLC A;  1IXR C;  5F08 A;  5D5X B;  4QTR A;  2HKO A;  2R7D A;  3A0H C;  4V2F A;  4KN4 X;  4UUV A;  2RNG A;  3E1S A;  4A0Y A;  5K5Q A;  4CCL A;  3L2V A;  2UUZ A;  4F7Z A;  4GXO A;  2M45 A;  3MQ0 A;  1IO2 A;  2CQK A;  3CP8 A;  3RIR A;  3KPH A;  5B1A H;  3OIO A;  1V5E A;  1GXQ A;  2H27 A;  4X6A J;  1FOK A;  2ECB A;  2QQ9 A;  4AUX A;  3DPT A;  4PSX A;  4V2G A;  1VTN C;  5BPD A;  1DP7 P;  2COB A;  2F5D A;  1XGS A;  1U8R A;  2FMY A;  2Z9O A;  4F52 A;  3FHN A;  2E2J J;  1OR7 A;  1K78 B;  3OS1 A;  1R00 A;  1HOM A;  1DU6 A;  1W5S A;  4F55 A;  4ASN A;  2JA8 J;  3WTZ A;  1YS7 A;  2KIF A;  1OMI A;  2RN7 A;  4U0W A;  1UB9 A;  3HBL A;  2E1C A;  3FX3 A;  3DU6 A;  3DXJ F;  4ZC3 A;  4A2U A;  5GTI C;  1J09 A;  5E20 A;  2H1L A;  3GZ5 A;  4GDF A;  3K7A J;  1YW9 A;  3SZG A;  3KLN A;  2EA2 A;  2LBF A;  3QOE A;  2FD5 A;  4IX7 A;  2HYJ A;  2ZNZ A;  4CA0 A;  1F36 A;  4A5N A;  4PUS A;  1FP2 A;  2IP2 A;  2BW3 A;  2HOA A;  1TTY A;  1Z9C A;  1DP3 A;  3HOZ J;  2MFZ A;  3BR0 A;  2NOG A;  3KCC A;  5JHF A;  3GTJ J;  1NK2 P;  3N05 A;  1FMW A;  3PFY A;  1WJC A;  1R22 A;  3CD6 I;  1XSX A;  5TJJ A;  1W7P D;  1WI9 A;  2KIM A;  4BE0 A;  1Z3Y A;  2B9S A;  4ZTJ A;  3JRD A;  3MD2 A;  4X1E A;  2ID3 A;  2R5Y A;  1ZHF A;  3HZJ A;  1A5J A;  2GA1 A;  3PSI A;  1TNS A;  2LTP A;  3BZC A;  3PUF A;  4IVN A;  3OL3 A;  4MTD A;  2AS5 F;  1SD7 A;  3LNQ A;  3RDI A;  5ICG A;  3CUQ A;  2PMZ A;  5LHI A;  2HZT A;  4N9I A;  5FLX K;  3QPT A;  5LHG A;  1MNM C;  4HRI A;  1IRG A;  2IS6 A; 
#chains in the Genus database with same CATH homology
 5GAE J;  2JQ7 A;  3PIP F;  1HC8 A;  5JVG F;  3CJR B;  1YJN I;  2E34 A;  1VQ8 I;  3G6E I;  2ZJQ F;  3CCS I;  3I56 I;  1ACI A;  1VQL I;  3I55 I;  2QA4 I;  3CCL I;  1YJW I;  1MMS A;  1YIJ I;  3CC7 I;  1VQP I;  1S72 I;  1WIB A;  4IOA F;  3J7Z I;  3CC4 I;  2FOW A;  1VQ7 I;  1VQ9 I;  2ZJP F;  1YHQ I;  3CCE I;  3CJT B;  2QEX I;  2OTL I;  1VQ6 I;  1VQO I;  1YI2 I;  1Y39 A;  1VQN I;  1VQK I;  5GAG J;  1FOY A;  3CME I;  2E35 A;  5GAH J;  3CCU I;  1QA6 A;  5GAD J;  4UY8 I;  3CCQ I;  3CC2 I;  2K3F A;  3G4S I;  3CJQ B;  1FOX A;  3PIO F;  3CCJ I;  3CD6 I;  2H8W A;  2ZJR F;  3CF5 F;  1VQ4 I;  3J7Y J;  1YJ9 I;  1VQM I;  2NXN B;  3CJS B;  3DLL F;  5DM6 F;  4IO9 F;  2E36 A;  4V19 K;  5DM7 F;  3CCM I;  1FOW A;  4IOC F;  2OTJ I;  3G71 I;  3CCV I;  3EGV B;  1YIT I;  3CMA I;  1VQ5 I;  3CCR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...