2E35A

The minimized average structure of l11 with rg refinement
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
b'MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L11
publication title The structure of free L11 and functional dynamics of L11 in free, L11-rRNA(58 nt) binary and L11-rRNA(58 nt)-thiostrepton ternary complexes
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
A PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2e35A02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 2e35A01
3J7YJ 3G71I 2K3FA 3CJTB 3PIOF 1VQ8I 5GADJ 2ZJPF 2JQ7A 3CD6I 2E34A 4IOCF 1QA6A 1VQOI 1VQ5I 1S72I 1FOXA 5GAEJ 5DM7F 3G4SI 1ACIA 1YJNI 5GAHJ 3I56I 3CCLI 3CC4I 3CJSB 5GAGJ 1FOYA 3J7ZI 5JVGF 1VQ4I 3CCEI 4V19K 1MMSA 3CCMI 1YIJI 1VQNI 3CCRI 1YJWI 3G6EI 3CCJI 2E35A 3CCQI 1VQMI 4IOAF 1HC8A 2NXNB 3CMAI 1Y39A 1WIBA 1VQKI 2FOWA 2H8WA 2ZJQF 2ZJRF 2QEXI 2OTLI 3PIPF 3I55I 1YITI 3DLLF 3CJRB 1YI2I 2OTJI 3CF5F 4IO9F 3CJQB 1YHQI 4UY8I 2QA4I 1YJ9I 1VQLI 1VQ7I 1VQ9I 3CC7I 3CMEI 3EGVB 3CC2I 2E36A 3CCVI 1FOWA 1VQPI 5DM6F 1VQ6I 3CCUI 3CCSI
chains in the Genus database with same CATH superfamily
4IKFA 1EA3A 3DKWA 1USTA 1YS7A 1P6RA 1U5TB 4F7ZA 2R5YB 3CJTB 4OWRB 3HGGA 5BNGA 4KMFA 3F6VA 2NS8A 1J09A 2OZ6A 3CP8A 2NNNA 3HGYA 4UNOA 2HTJA 1RETA 4S05A 5ILVA 2BV6A 1OISA 2EH3A 2E34A 3QU3A 2YS9A 3V8LA 1QA6A 2JRMA 4AVPA 5IPAA 2QQAA 1VQ5I 3BG9A 1W36D 4I0BA 1KONA 5GAEJ 3SHFA 1TTYA 1B1BA 2O6GE 1G3YA 2X9DA 5GAHJ 1T98A 3CC4I 4G12A 3A0HC 2JZYA 1OCCH 1E3OC 3DLAA 3PUBA 4RLFA 3HDDA 2WB1N 2ZKZA 2CYYA 2LFBA 2M0CA 4IEJA 3S93A 4MNUA 3J7ZI 1T39A 5CQGA 3CCEI 5FROA 3FMRA 2VIXA 3DBRB 3CJNA 2BVMA 4EM1A 5HNFA 3BLYA 4Z6YA 2HS5A 5DUKA 3U2RA 1VTNC 1H8AC 2RDPA 4Y15A 3VYTB 2DOEA 4E7ZA 1MMGA 4AM3A 1SD4A 4HDVA 2PMZA 3LMMA 2KIFA 3QAHA 3KFWX 3Q0WA 1IRGA 3P5JA 3KP7A 1T0FC 1HC8A 2QCOA 3GBGA 2PN6A 4HDUA 1IZ1A 1NH3A 2XRLA 4PJ0C 4NC8A 2ZMEC 4CZCA 2JMWA 3K0LA 1HF0A 2H8WA 3KLNA 3WU2C 5FRMA 4LLNA 4KA4A 1GUUA 2MGQA 2P7VB 5DYMA 4S0HB 3U1DA 1QO0D 1DP7P 2DMPA 1REPC 3LQRA 4E7IA 4RB0A 2MW8A 3ZMZA 1BR1A 3LA3A 1LNWA 5D6EA 2Y9ZA 5FKMA 3OSGA 4JQFA 1CGPA 1E2XA 3DWLE 4PK4A 2Y30A 2QA4I 2ZBKA 1HSJA 3LA7A 4HQMA 1K4TA 1MBEA 2IP2A 5K5OA 2VXDA 1DDNA 1D8JA 2VODA 4L5EA 2PMZN 1AA7A 1JUMA 5E8GA 4A3FJ 2CU7A 1G3TA 2B9SA 3CCVI 1D5VA 2P5KA 3V8KA 4XLPF 1VNDA 3BR0A 3ZMDA 1FP1D 2UXNA 1ITYA 1A31A 2X4HA 3LSJA 3T8TA 4E7JA 4DOZA 2VOOA 1F5TA 3HOSA 3HXLA 5LGUA 5M5WJ 4QPQA 1EJ9A 2GLOA 2UUZA 1YRNA 3E1SA 1JKQC 1VQ8I 5LBQA 1G8XA 1X1CA 4DJAA 2LF7A 4IVNA 2ICWG 1I6XA 3MKYB 3M07A 3HOXJ 1IN4A 1D1CA 3F8MA 3HBLA 4JBAA 3WU1B 1UHWA 2ID3A 5IY5H 1D1BA 5KCMA 4ZDLA 4CA0A 2W84A 3S32A 3HHHA 3M1CA 2ETHA 3JRDA 5DUIA 3KEOA 3DPTA 1A36A 1QVTA 4JK1X 3OYEA 2IS6A 2FBIA 3H9QA 2F5VA 1YO5C 3CQZJ 1WJAA 2OCEA 4AUXA 3I59B 4XLEA 2M5WA 3VFZA 4XSXF 4LIUA 5J40A 1B59A 5B1BH 1PUFB 3IUOA 3BR5A 1S8NA 2KKOA 2OU2A 1MKMA 4P5OA 5LD2C 1IDZA 3LA2A 3KEQA 2OUMA 1RUOA 2X6OA 2HOTA 1UG2A 1FP2A 2PEXA 1W7PA 3RYRA 4W1UA 3BZ6A 1WI3A 3IC7A 3JTHA 3VYSB 4Q5SF 4XIDA 2NYXA 2D2WA 2LRDA 3QPLA 3EUHC 4F3QA 4BE1A 5HLHA 5K1YA 3W6VA 1EF4A 4X1EA 5FGMA 4IPAA 2R3SA 4ABZA 5D8KB 2MG4A 1WZ2A 2ZJQF 3CUOA 3QP6A 2QZ8A 3MFKA 2BYVE 2VBZA 1GV5A 2HOEA 1K78B 4RAGA 1IRFA 3F22A 2P4WA 3OMYA 3GW2A 4UV9A 5B3SH 2L01A 4FISA 2JA2A 4BUPA 3K10A 4UUVA 1WVRA 3I9V2 2HDDA 3P9KA 3VSLA 3EUKL 3H36A 3N4MA 3KEYA 2VJIA 4IQ4A 3F72A 3DQVC 2O0YA 1DUXC 2M9HA 3OYLA 4GGGA 3HKZA 3NEUA 2DT5A 2ZXIA 4ZDOA 4PGHA 2EA2A 3F21A 2P5LC 2GM4A 2PMHA 4ITVA 1NTCA 1MSEC 4M74A 2I8DA 5D4SA 2PG4A 1ZAOA 3GFMA 3RPUA 3WGIA 3OYJA 3IH3A 5F0FA 2Y0SN 4ZJZA 1X1DA 2V7FA 2VI6A 5M5XJ 4U0YA 1A6IA 1EV7A 1W1WE 2FQ3A 3K6GA 2CJJA 5K5RA 1O3RA 3RIRA 1ETXA 3S17J 2EBIA 1ZLJA 2KRHA 1T6SA 3VDXA 2FNAA 3T0YA 3KE2A 2V6CA 1VF9A 2FX0A 5IYDJ 4PSXA 3E6CC 3RKXA 3PO2J 4HYEA 5CYVA 5IOYA 2L9NA 4H0EA 4KIFA 2JUCA 1FOKA 2F5FA 3ERMA 3G1OA 2DN0A 2CFXA 2CV2A 1XGMA 5LGTA 5ICCA 1T2KA 3AL0C 1YW7A 1ETOA 3HKZN 1ZGJA 2GOXB 3Q3SA 2DFIA 1KQ8A 1HXDA 2XF5A 3TKYA 4M9SA 2HQNA 1Y1WJ 4J19A 4OOIA 3GWZA 4G7HF 2ESNA 2KMUA 3FBNB 1ETVA 3UKGA 2OC6A 3ABMH 3QPHA 3VSKA 1VQNI 1LJ9A 3BTIA 2FBKA 2H6CA 3H5RA 1ZR2A 3IHUA 3CESA 2IS1A 2IS4A 3HRUA 4L9JA 3HL2A 1ORKA 1OLTA 2JRTA 3S3MA 2LDUA 1FWZA 2HDWA 3H5AA 2WWYA 3GTPJ 3I58A 2DA2A 4CYCB 3OV8A 2CO5A 1LKXA 2WADA 3CTAA 1ZG3A 1ZELA 2GAUA 1K61A 2RGVA 5DV5A 1P4WA 3FKIJ 3OYIA 2KP6A 3OYKA 3M8EA 3FHZA 3GTGJ 2JA6J 3CMYA 3I53A 3PNTA 4RGXA 1L3LA 2HOAA 2M34A 4L5JA 4NBQA 4BQOA 4DBRA 5IP6A 4CICA 3GZNB 4CCNA 3CF5F 3GXOA 2RV8A 1P9QC 2EQRA 3PQKA 1E0EA 4XRSG 1Z21A 3FM3A 1K6OA 2EFPA 1OR7A 3IL2A 5LEJA 1XN7A 4XKWA 3P7NA 1P4AA 4JX6A 4AC0A 3CUQA 2F6CA 3MN2A 1Z0XA 2E71A 2ELJA 4WWCA 4CHUA 1OCRH 2LR8A 2VC1A 2IRFG 3KP4A 5E3LA 4D5CA 4YFKF 3JSOA 3D1NI 1ZLKA 4J00A 1WKMA 2KZGA 2KT0A 3MZHA 4G6QA 1SAUA 3V7SA 4KITB 2NRAC 2EINH 2PX9A 2ECCA 2M7BA 2KQRA 3PSFA 1YRNB 2QUFA 2L7KA 4ENKA 4ETSA 2AS5F 1MNEA 1B9MA 2CSOA 2V79A 4BEHB 3BY6A 3TP3A 1D0XA 3BTCA 4AVZA 3C2BA 2V1XA 2ESHA 4Q47A 3BR2A 3NWSA 2M45A 1WJEA 3D5RC 4WX9A 1JGSA 3V42A 4RGRA 1PJRA 3R60A 4AIJA 1OYIA 2ELKA 1LDDA 3IRQA 3I56I 3TDZC 3JRGA 2Y2ZA 3F8CA 4XRSA 4IQJA 2ZXJA 1Z6TA 3ZQGA 3MVPA 4XBFA 3T5XA 2R7WA 4V2GA 3CJSB 4PJNA 2VBYA 4WF2A 4CO8A 3K4JA 3GCMA 3H9GA 4E7HA 4EJUA 4I7HA 1U5TA 3FIWA 3I0TA 4LMYA 1Z9CA 1BI2A 3RZDJ 2KISA 1N25A 3J80Z 3BQYA 2KFDA 3FISA 1OCOH 2ELHA 4BXUA 4F93B 2DPDA 5FLVA 1ZARA 2FQ4A 3ZQHA 1W4MA 2E2HJ 2HEOA 2BHYA 4HG2A 1JHFA 4OMZA 1W7PB 2E7XA 4II2A 3LSRA 4BDZA 4M6XA 3S3NA 1SFEA 2DBBA 2Y9YA 1SVMA 2VQGA 2RQPA 1SD5A 3Q9VA 2E5NA 3CZ6A 4N0BA 2DAOA 5CKTA 4M72A 5J8FA 5EF6A 3K1NA 1A5JA 3BJOA 4HBLA 3GFJA 1FPQA 3HOVJ 2W4SA 2L0KA 4PJJA 2DMNA 2MYSA 3FBIB 2YX7A 3GO5A 2OTLI 3KP2A 2FUG2 2OJED 1RUNA 4XM3A 1YITI 1MD0A 4KN4X 1G4DA 3VB2A 4LJZF 2XGCA 2YR2A 4XONA 4EJVA 3BPXA 3SZPA 1YJ9I 2PBIA 3JCUC 5FKKA 2D45A 3A01B 3J80K 4A0ZA 3QYEA 4LITA 3RPQA 3VOEA 3LAJA 2ZNYA 1MBGA 2V1UA 3VEPA 3GLXA 5J47A 2CQQA 2Z9OA 3A02A 1FOWA 2HKXA 3BG5A 4KN7X 5JR3A 5K7HA 4Y3OA 2O8KA 4EJWA 1I5ZA 3E6MA 1T08B 2W57A 2ZNZA 5H6RA 3CCUI 2L9VA 2E1MC 2XV4S 5HDNA 3LAPA 2BXZA 3IH2A 3KX2A 2V1NA 4BH9A 2C6YA 1B72B 1ZKGA 4NC6A 3SZTA 3W3CA 2YX4A 2LG4A 4NNJA 1A35A 5H20A 4BHCA 2OPTA 4A3BJ 1RI7A 4XORA 1Y1VJ 4BY7J 2F4OB 1WJBA 3FXMA 3ZQFA 4Y52J 1FT9A 4B47A 2EB7A 3VYUB 3TBIA 2BW3A 4M3DA 1B9NA 2V1DA 2VN2A 1RR8C 5GTHC 1BC8C 1XCVA 1QZZA 1KU3A 4JYKA 2K4JA 3TW7A 1RNLA 2WV0A 2J5OA 3C2GA 2ZSHB 5FKOA 2VBWA 2A69F 1X3UA 2OQGA 4EVIA 1Y0UA 2JJ7A 2QM3A 5E1ZB 4Y4RA 4QSHA 2H27A 2COMA 1BIAA 3QWLA 4A5MA 2UZKA 1JE8A 1UFMA 3EYYA 1B8IB 3LWFA 1S7OA 1Y6IA 5JVTA 1BW6A 3G2BA 3A4CA 3E7LA 3LOCA 4EJOA 2DMUA 5KHDA 2N8GA 3G6EI 2DA1A 3U21A 2MABA 1V5FA 5ERIA 3KYCB 2P0WA 3SEZA 3BJAA 1G6NA 3G1LA 3UNGC 4BYYA 3IWZA 4UB6C 1V54H 1UCRA 2L9RA 3JAMZ 4CXFA 2YU3A 2JA8J 2BZTA 2EZKA 1WJDA 1Z91A 5FFXA 3ZMTA 2NXNB 2NS0A 2NVQJ 3ONQA 2XGEA 5FLMJ 3S2WA 2GQQA 1W5TA 2ZJ2A 3LL7A 4ESBA 2DW4A 3BOQA 2HPIA 1R1UA 4M73A 4I98B 2XKOA 3CDHA 2O8XA 2A68F 1PUFA 2LC2A 4XOPA 1I3QJ 1POGA 3QPSA 2RN7A 4RMNA 4XRMA 4A3LJ 3B02A 2QYOA 2I5UA 5TISC 4F92B 5EG0B 1G3SA 4D1QA 2WAQA 3FXLA 1KYZA 1V4RA 3R4KA 4YIIA 4LOCA 2OA4A 3CUQB 1YTYA 5BS6A 5E8IA 1I39A 5EDNA 4RAZA 5BPDA 2E36A 2MD0A 2Y31A 4IXAA 3ML6A 1O7FA 1LEAA 4G7ZF 4F52A 1BOBA 4GCVA 4DYCA 3TL4X 3ZQ7A 2K40A 1F1ZA 2XHKA 1R22A 1RPWA 4A0YA 4BDYA 2OZUA 4A3JJ 1P7JA 2R7DA 3EUAA 1WJFA 3JAMK 2M30A 1MBHA 1Y8QB 3J7YJ 3GEZA 1ULYA 1E17A 1U9OA 2O5RA 4A69C 5E79C 4U87A 2DA5A 3GFLA 3RYPA 1FSEA 3E0JB 1R36A 2LD5A 4NC7A 2R92J 1D0ZA 3S14J 3H9JA 1WI9A 1XMKA 2JA7J 1LFUP 4IOCF 1UB9A 2K9NA 5F08A 3GTKJ 2DPUA 2WB1A 2GZWA 2HZTA 3L1PA 2Z99A 3R6SA 4HEA2 1RR7A 2VJ5A 1TQIA 3FM5A 4Q48A 4CCJA 3D5LA 2VQLA 5EJCA 1J5YA 1IV8A 1PYVA 1HW1A 4GO1A 3LSMA 4OMYA 3BR3A 5M3FJ 2FE3A 4RAFA 2XF7A 1G59A 1ZR4A 3OYCA 3WGHA 3MAJA 2DTRA 1BIBA 2QSFX 3H0GJ 2KDZA 3BZKA 4O3MA 2IBDA 5E20A 1LE8B 1MJBA 1Q1VA 1OMIA 3FX3A 3OR1C 3SYTA 4HF0A 2XAUA 4ZDPA 4G8XA 3K70D 4A0XA 2ZXWH 2G0EA 1MMNA 3L00A 4IOAF 3ZMSA 5JLXA 3BR1A 3MWMA 1U0JA 2A61A 1ZH5A 1B6AA 2HQRA 4U7DA 1XSXA 3HZJA 1O7LA 2L5QA 4LD5A 2E60A 1YQAA 3AL0B 1MDMB 1AOYA 4R1HA 3PFIA 4UV8A 2E1OA 2H8RA 3J81Z 3RDIA 4C2UA 3QYFA 2JPCA 3KYDB 5IT3A 1BA5A 3PIPF 2JUGA 1SEUA 1R49A 4XQFA 2YU9J 2JSPA 3DF8A 1LFBA 2DDBA 2M7AA 3AG2H 2NOJB 2M87A 2HXIA 2LKSA 1YI2I 2L4AA 4KDPA 2E2IJ 3V7CA 5F1RA 1DU6A 2DU9A 1QQIA 2R7VA 3QODA 1U8RA 2ME6A 5DDGA 1VQ9I 4HNVA 5LHIA 2GXGA 5M5YJ 1SD7A 3ABLH 5F6FA 3HTSB 5DD4A 1BL0A 3HPGA 4CYCA 1GT0C 5DD8A 1HDPA 3HIFA 4BS9A 2CV1A 2R5ZB 4E4HA 2F5CA 1BJAA 1RKWA 2R7SA 5H6QA 4FASD 4JOMA 3HOUJ 2K9LA 1IUYA 4Y33A 1I6HJ 1Z1DA 3G1MA 2Y69H 4E7KA 2NNYA 4Z2YA 1R71A 1BR2A 2CG4A 4BL0B 2KJBA 2XGXA 2GA2A 3P9CA 1S5LC 3WTWC 1JGGA 1KQ9A 3S1RJ 4KUMA 3PUFA 4EEFG 5CPRB 1W5SA 3JRBA 2BW3B 2FOKA 4AIDA 1GVJA 2EZLA 2LBFB 1JJ8C 3IWFA 3LFKA 1TWFJ 2BBYA 3RZOJ 3RKWA 2V6EA 5E3OA 2QWWA 3C2HA 3WTTC 3SFZA 5CVJA 4B09A 4BHBA 2HNHA 5TGTA 3CCYA 3WHCA 2E1NA 3HSEA 3ASNH 3V4GA 4HX7A 4BEHA 2ZFWA 4NDLA 4WXDA 4ZH4F 4EM2A 1I27A 3FXRA 4DYRA 3E5UA 3CCJI 2E7WA 2XPVA 4OAYA 1W36C 3S1QJ 4G94A 5CJ9A 2K9MA 2WV1A 4L5IA 1JKPC 3E5XA 3OWTA 4MEYF 3ISPA 2STWA 3MMYB 2K9SA 3T8RA 1MBKA 2BVLA 2QBYB 1V55H 2FA5A 2HGCA 1TBXA 3DBHB 4HOBA 1ZRDA 4MGRA 2LKXA 2P6TA 1MH4A 5J8CA 2Z33A 4I02A 1IXSB 5LRSA 1ZRCA 1X2NA 1OCTC 3VODA 2MC4A 2XAQA 1EH7A 1YX3A 3ZQQA 1Z77A 2FEZA 2GBYA 3QOEA 1ZG1A 2M8EA 4KIGA 4G7OF 3C1DA 4OU0A 2ADUA 2MLGA 2ID6A 1J0RA 2P8TA 5AIPA 5L3FA 2K85A 2Q1ZB 1WJ5A 1ZYRF 3LFUA 2KRFA 3JW4A 1JT0A 2X85A 3BZCA 3ECHA 4XK4A 4BQAA 4IO9F 2NVUB 2NVXJ 3DPLC 4WK8F 2HTSA 5KAFC 2AXLA 3QU6A 1DQUA 1VFCA 2DTZA 2H1LA 4N4NB 3CC7I 2Y0SA 3JR9A 1IRZA 2MD5A 2QVOA 3EGVB 2UWMA 1UHSA 3OYBA 4FQGA 5KNLA 2KL4A 3E97A 1WH5A 5CVUA 3ULQB 2D5VA 1LPQA 4F91B 4ZC3A 3I71A 4PCQA 4IRIA 2FD5A 2VT3A 2TRTA 1DP3A 2XSJC 4A3KJ 1PP8F 2QSHX 3MCZA 4KICA 2RC4A 2XUBA 3ZRGA 4ON0A 4IZZA 1X1AA 2ZJPF 3GTJJ 1HW5A 4XLHA 5ILSA 3GUDA 1CF7B 2KZVA 3A01A 1QPIA 4C2MJ 1X1BA 4HPQA 1T0FA 3S2DJ 3TP0A 4P9FA 1H88C 3HRMA 3CLQA 1FMVA 1SVLA 3OR2C 3P9IA 4JX5A 3DKXA 2XRNA 3MZ8A 5GTIC 1D8KA 1Q1HA 2PI0A 4HF2A 4I76A 4FE7A 4UUTA 2ZMEA 3DBLB 3S16J 1HQCA 1HSTA 2IA0A 5D8LB 2H1KA 4M9XA 4DZPA 4UVCA 4HA8A 1J2XA 4Q4ZF 1NHAA 3AG1H 5GAGJ 4G9YA 1MSFC 1B72A 4NB5A 2E1MB 5HDGA 4EQQA 4ZYDA 1VQ4I 1FY7A 3RQ4A 2YSRA 1U9NA 2K02A 1SAXA 4IHXA 2VKHA 3BROA 2XPWA 1YJWI 1T56A 2PJPA 2EZIA 1TQMA 5K7ZA 1IW7F 2EV6A 4XKBA 1EH8A 2YUSA 1X19A 2E35A 4XNFA 5JHUA 1SVOA 2DQRA 2OBPA 4P1WA 3OYFA 3HOZJ 1MJAA 4L9VA 4CZZA 3HRTA 3AKZA 1APLC 1UMQA 4FTHA 4NQWA 4KNYA 4ZYHA 2G7HA 3OYAA 2R93J 3F0CA 2DK8A 3M3YJ 4M3FA 1P92A 2JT1A 4FE4A 4RM3A 1Y39A 2VOPA 1HKQA 2BEOA 4MIMA 2DA7A 4A93J 2MSYA 1WIBA 5ICFA 2LF8A 4AIHA 2QEXI 2A6HF 1X3ZB 2BXYA 4A12A 1B8IA 1MGTA 1R4NB 5EEGA 5FO5A 9ANTA 2PJRB 2A6EF 3DU6A 3IP4B 4WXCA 4IRGA 4EM0B 2W7NA 5LFAA 2WA0A 2IA2A 5CVVA 1SFKA 2CUJA 1U6GA 1RESA 1AU7A 4PJLA 2V9KA 3BWGA 3RI4A 1IXRC 3G3ZA 3K4KA 2KDOA 3K9TA 2XAHA 4A2UA 4A6DA 5C4JJ 1AKHB 2IS2A 3U1KA 3I64A 2GWRA 4FX4A 2PLYA 5HDKA 1XMXA 1XTAA 2IW5A 2YPRA 4HRIA 3HUGA 2J5PA 3FMQA 4II3A 3LSTA 2F48A 2Z2SB 2XROA 3BTLA 3OIQA 1VQ6I 2EIMH 4MHGA 2VQCA 4U88A 4GYGA 4ZTJA 3A1YA 3CO6C 4PGGA 1SMYF 2DOAA 3H3UA 3ZGKA 2R7TA 3AFHA 2VE9A 4HLYA 3DXJF 3PSIA 1YFHA 3HC7A 2DFEA 5EG0A 4XN0A 4Y7NJ 4A6EA 2LTPA 4ZZLA 3QYBA 1W0TA 3M4OJ 1YG2A 1ERDA 3O2PE 4M6VA 3A0BC 1VQOI 1S72I 4M6YA 1FTZA 1TNSA 1FOXA 3ROUA 3B6AA 1XG1A 3BJ6A 1ACIA 1YJNI 3U9GA 2O3FA 5EYRA 4I99C 1G3WA 3EUHA 3JRCA 1Z05A 2M1BA 2IT0A 4DNCA 2P81A 2W85A 2LY2A 3IH4A 3F6OA 2DYSH 2KRCA 4U0VA 4MEXF 5B1AH 1XPXA 1A04A 2ISZA 4GRIA 3JRIA 2OCCH 2LP0A 3IKTA 3KPHA 3KIOA 2VE8A 3DEEA 4AD9A 4X0GA 2LVSA 3CCMI 1LEBA 4RBOA 2GXAA 3QOPA 2DA4A 3FWEA 3F8FA 3W2VA 1XD7A 2KHMA 1VQMI 2RNJA 3PNVA 3Q9SA 4IF4A 2VT2A 3MKZA 3EYIA 3JREA 3H0DA 1FNNA 1H0MA 1D5YA 2BY3A 3ELKA 2KLOA 3KZIC 2CUZA 3CMAI 2BGCA 3S1MJ 5ILUA 4EV0A 1D0YA 2FU4A 3GZ5A 2HQAA 1FTTA 4E7SA 1TC3C 5DEQA 4A3CJ 4QLCU 2MA3A 3NWTA 1ETYA 5EEAA 3H92A 2DT6A 2HYJA 1LE8A 1Z7LA 1FIAA 3ZQIA 1H9TA 1RIOH 2HVSA 4QWQA 4L0YB 1YLFA 2QQ8A 2EILH 4XKVA 2JSCA 4PSWA 2VJ4A 4HLXA 4RB3C 2WY7Q 3T1BA 1FSHA 2XAJA 4BXFA 2R7FA 2HFHA 3W6KB 5DTDA 2VKVA 3B73A 5IP7J 1MDMA 4S04A 2EZHA 2LLKA 3LQQA 3FK7A 1NK2P 4LLLA 3FXUA 3CO7C 4R79A 3IRRA 1K4SA 3C7JA 2A07F 1K7AA 1SC7A 3EDPA 3OL4A 4N9IA 4XOTA 2W1OA 2XB0X 2B63J 1KQ0A 1LB2A 3L7WA 2DFFA 1ZK8A 3H3ZA 5GADJ 2X0LA 4BE0A 2CRGA 1OCZH 2E2JJ 1RKTA 1GVDA 4M71A 3I3LA 1NK3P 4NUBA 3KETA 5HVQC 4O6JA 1S29A 1GLNA 3D0SA 1T38A 3COAC 5FB2A 3S8PA 2R5ZA 4C2TA 4ZYAA 2DJNA 3IV5A 2NVYJ 4UVAA 5J3LA 2ZMEB 2CFOA 1P4XA 1FC3A 4OIOF 4XKCA 5E1XA 3F8NA 5EZHA 1DU0A 1J59A 1N77A 4H4KC 1L0OC 4CYDA 5IT9Z 5C44J 2FRHA 1IUFA 1H9GA 1FX7A 2DXIA 2DO7A 3WTYC 3QQAA 2DFHA 4M3EA 3VPRA 1TZLA 2EK5A 2X6YA 4IL6C 2XB5A 1WPKA 1QHGA 2LK2A 2X1CA 2M8GX 1F36A 2CUFA 2NOGA 1ON2A 5ICEA 2JTVA 2LBFA 3GTOJ 5EGOB 1NG6A 2A6TA 3C3WA 2BY0A 2JN6A 1OKRA 2R0QC 1H89C 1GDTA 2CV0A 1QBJA 3V7RA 4A3MJ 4OIPF 3JRFA 1FBUA 2EIJH 2LOOA 4NQWB 3TDUC 5GPCA 1CQTA 4L9NA 4PFPA 3K7AJ 3DV8A 2HYGD 2FNPA 1KU9A 2QLZA 1ETKA 4HNTA 4FHTA 3SDGA 4RM2A 2NAZA 3WTUC 2HVQA 4Y13A 1JJ6C 3BG3A 5HODA 2MLKA 3KZZA 3N05A 2RAEA 5D5VB 3WG7H 5DS9A 1I3AA 1GHCA 4MQ9F 1T8IA 5IP9J 1YIOA 3M1EA 4C3IJ 5IT9K 2H6BA 1UELB 2IGKA 1YHQI 4L9TA 4UY8I 1F43A 2QBYA 4I0AA 3DTKA 3E6BA 2IPQX 3X2QH 1IN7A 1Z7UA 1W7PD 3AG4H 3HM5A 3GVAA 3HUGB 4UXNA 3OY9A 1M1EB 3FDYA 5D5UB 5LGNA 2LY1A 2CW8A 2HDCA 1S7AA 1VQPI 5BQTA 1T95A 3L9FA 2EFWA 2EPFA 2Z16A 2M2EA 2HYFA 1KYWA 4BY1J 3BR6A 2K3FA 4OINF 1HKSA 2RQQA 4IHSA 4IHTA 4IHVA 2B7EA 2V26A 4YRVA 4FCYA 5D5XB 5FD5A 1XCBA 4RB1A 3I54A 2P6SA 2MFZA 3G4SI 1MNDA 3DFGA 3SDBA 3EPZA 4D7MA 4HNUA 1QGPA 3ZMUA 1S3JA 3F8BA 3Q0UA 4BKXA 4M3GA 1LFPA 3DTIA 5JHFA 3O8HA 1STZA 3BCAA 1O57A 3RPUD 2QQBA 1XS9A 1U2WA 1PP7U 4XICA 3MD2A 5JVGF 1U78A 3CF2A 2DMTA 3TO6A 3TO9A 4V19K 5DCFA 4KT5C 2H94A 4MFEA 2M0MA 1R5ID 4IX7A 1YIJI 2B0LA 2UXXA 1CF7A 1R23A 3LSPA 1TW2A 2Q2EB 3HEFA 2HXOA 3IAS2 1YW8A 2L7FP 3R61A 3REOA 4YFNF 4WXHA 5CLSA 4BNCA 3BG6A 2HPMA 3SXYA 5KAIC 5J4VA 2CQ7A 4BQNA 1WCMJ 3GTLJ 3TOAA 1MNMC 2ZFUA 2L9SA 4AYBN 2K86A 1UJ8A 5C3EJ 2K9QA 3O8GA 1VQKI 3ABTA 2WY8Q 5EZGA 2DCEA 1R9TJ 5IYCJ 3FZVA 5C4XJ 3L2QA 2K7LA 2L4MA 4M3BA 4CCLA 2L3DA 4V2FA 1W5CC 2ZXHA 4LB5A 3TOBA 1UG0A 4CH7A 5HLTA 1JKRC 1VQLI 1VQ7I 1RC9A 3LSIA 4MLOA 4U0WA 5GP9A 4QPOA 3HOWJ 4BXXJ 1TWGJ 3DKYA 4YIRX 1R00A 2DDAA 5FKLA 5LRRA 2JK3A 4ASNA 1ZREA 4ESFA 3CC2I 2GOMA 1FZPB 3N97A 2JWTA 1WJCA 3QRFF 3K2AA 3KZYA 5E3NA 4EGZA 1IG7A 3GLLA 1TLHB 3WGGA 4XMYA 2PJRA 2JPBA 5B66C 2HQ5A 2FMYA 2MH9A 5J1UA 1MBJA 2CS3A 3S2HJ 2BHZA 4N9HA 2DT7B 3TEDA 1ZTRA 1SD6A 1JI8A 2WAEA 2ME0A 2DQLA 2E19A 1AKHA 2MH2A 2X6XA 1HBXG 3GMEA 1TWHJ 3M8JA 2IGMA 2O03A 2AO9A 1IC8A 4LG0B 5J1RA 3RKQA 5DM7F 3O3KA 3ZMVA 3PFYA 2IGOA 2IGNA 4KYWA 3PO3J 1PVEA 1QU3A 1MMAA 2GA1A 4FX0A 1IN5A 1TW3A 5M3MJ 2DYRH 2XASA 5L3BA 4GYIA 1SFOJ 3I4PA 5IOZA 2AHQA 4G6DA 1HCRA 4B4CA 3ZP5A 2W25A 1KZHA 2NVTJ 5F64A 3S1NJ 1J75A 4A3IJ 3SZGA 3S3OA 1MMSA 3FXKA 4HAMA 1BN5A 1J9IA 3J81K 4I6ZA 3LNQA 2CQKA 3I4NJ 2VXZA 3TW6A 1XDSA 3UR3C 4HQEA 1IN6A 4AWXB 1BW5A 4B8XA 1MIJA 3WODF 2A5WA 1FYMA 1JTXA 3OIOA 2ZCWA 2DK5A 3RCOA 2CGPA 1GV2A 1HA8A 3BTJA 3WE3A 2ZSIB 2G7UA 2R7ZJ 4RLQA 1QZEA 3HG9A 3GTQJ 2RKHA 2IA1A 4PFOA 4WCGA 4EATA 3MKLA 1OCPA 3WHBA 1JXSA 3ZQCA 2KJCA 4XLFA 5KK1A 2L54A 4KIBA 5F04A 2STTA 1K6YA 4AU7A 1HDDC 3W2WA 3DPUA 4E70A 5F1JA 1OFCX 4LB6B 4PDKA 2FF4A 1X4OA 2ZC2A 4LLGF 3FKJA 2K5CA 3ZN0A 4IJAA 2VKDA 4RA2A 3K70C 2P7CB 4HF1A 1FEXA 1BC7C 4YEJA 3K1MA 1R1VA 1KU2A 1JTYA 1BM9A 4YFXF 2CMPA 4RS8A 2X51A 5FRNA 3OL3A 5E1WA 1Y56A 3BT9A 2LMDA 4DGWB 2XAFA 2VPLA 3WG9A 2I10A 2EFQA 1WSUA 4U7BA 3DU5A 3OS1A 2F4IA 5FLXZ 1A6QA 4CCMA 3GX4X 3EQLF 3L09A 4DW6A 2IVMA 3CCSI 1X4PA 1JUPA 2Y75A 3Q5FA 1ETWA 1QNTA 2PFBA 1IJWC 2FBHA 1TQPA 3PIOF 1IF1A 1BJZA 4IHYA 3HYIA 2K4BA 3EETA 5J6XA 4YG2F 1PDNC 4UUSB 5LHHA 1IXCA 3G73A 4BGDA 1GXPA 4CCOA 3TQNA 1R5HA 4CGZA 1I1SA 2X1DA 4K2EA 4UVBA 1BI3A 1QRYA 1ZGAA 3ESWB 1OR7C 2F5DA 3CCLI 3WTSC 3WTVC 4B43A 4EGYA 4GDFA 2VPRA 2QENA 2QF7A 3CUQC 3WE2A 5HLGA 3OS0A 1FYLA 1F4KA 2LY9A 3A03A 3BPVA 2D1VA 4LK1F 1N78A 3L2CA 1R6RA 3GTMJ 5H2FC 3OIPA 4D7NA 4XSZF 1R1TA 1YX5A 3OOUA 3FHNA 2X6WA 1X1PA 3A2KA 2X48A 2E5ZA 3PL8A 1V5GA 3K4BA 3MKWB 3OYHA 3K2ZA 6PAXA 3TO7A 5L3EA 4FETA 4HZFA 4BJ6C 3IKVA 5CVRA 4DQ2A 4MQVA 5FLXK 1Z67A 5E3MA 3GF2A 2HU9A 5JFRA 3CCQI 1JHHA 1O3SA 5F27A 3BG7A 2BE5F 1D1AA 3ZQLA 4DYQA 2HWVA 2HKOA 4FT8A 5J4YA 2NS7A 1R7JA 1SFXA 3WTXC 1SMTA 3L2WA 2VC0A 4LFUA 2OAZA 3DCFA 2ECBA 1FLIA 4P55A 3ZCOA 1XSVA 1P2FA 3K4CA 2FOWA 4IRHA 2HOSA 1NG7A 3RKYA 4TV7A 2OQRA 2LNBA 1U5TC 4IHWA 3I55I 2EV0A 5EGOA 1RZ4A 1XX5A 3DLLF 3RJPA 4XLNF 1IGNA 1OQYA 1BI1A 2Q0OA 2X1EA 2Z5UA 3JSPA 2JA5J 3JRHA 1WH7A 2DA3A 4A3GJ 1WHUA 2LSOA 1V5EA 2IEKA 3FF5A 4BQQA 3J7AO 4CSWA 5DCMA 1U8BA 1Y0NA 3O6BB 4I01A 5D6FA 2PQ8A 2M4GA 1HKTA 1LVKA 2DOFA 2O7OA 4ZYGA 3CP2A 1X58A 1YW9A 3I5UA 3OYGA 4OAZA 3BDDA 3M8FA 3K4MA 4D5FA 1OYYA 3DP7A 4LIVA 4KISA 2ZO4A 1I1GA 2EFNA 5L3DA 3G71I 1S6LA 4HV5A 1ZG5A 1FBQA 2VUMJ 3CDLA 2CH0A 2JQ7A 3KP5A 4I2OA 1N75A 2TCTA 1FYKA 5D5WB 3DEUA 1UZCA 4ZYEA 1IAWA 5A2QZ 4L18B 4PUSA 2H09A 4LK0F 2HI3A 3RQIA 4LGWA 4XRFA 2EFOA 4A3DJ 1WQ2A 2FSWA 2CW0F 4DIQA 2AQEA 1RRJA 1ONVA 4MO7A 3L2RA 1ZHFA 2L7MP 2W82A 4X6AJ 1WRJA 2COBA 1WGXA 1R58A 1BR4A 3R0JA 2WTEA 3W6JB 3IAM2 1XB4A 2V9VA 1KU7A 3CCRI 2DI3A 3LSKA 1XGOA 3NRVA 2VJJA 2VBXA 4Y17A 3W2AA 4UHTA 3F23A 2FXAA 3FK6A 2V4JC 4BHPA 1DPUA 2VQHA 1Z3YA 4P9UA 2WAFA 4BJTA 4J01A 2XSDC 1ZGWA 2OF7A 4XL9A 1DGRM 2R7OA 4N4OB 5HS8A 1C0WA 2O9LA 1EH6A 2HVRA 2L02A 1OJLA 1EKEA 1DPRA 2A05A 1AHDP 2DMQA 2OD5A 1HW2A 3ZXSA 2V9PA 1E3HA 1JUSA 3MZYA 4HV6A 5A2QK 4ZTFA 4KJZA 3KP3A 3E6DA 2XVCA 4PZJA 3D5SC 2Q2EA 1TNTA 3OYMA 3HTUA 4OIRF 2W48A 2TDXA 2UV1A 5FFZA 2R7XA 3CJRB 3SFIA 1K83J 4PJMA 1XGSA 4F55A 2OTJI 2O61A 5K7FA 3GFIA 1IN8A 2K27A 2EV5A 4GFBA 1MH3A 1VI0A 5JI6A 2IAIA 4GXOA 4RGUA 3PNYA 5L3GA 2A3SA 2WBMA 2VKEA 3BP8A 2HR3A 2EWNA 2GIZA 2HZDA 1ZN2A 4ENNA 5TRDA 2W24A 3KCCA 4C3JJ 4D0PA 5IYBJ 1HLVA 2K3PA 3M7GA 5EEHA 1ODDA 4B3XA 1G2HA 1OYWA 1O3TA 1ZQ3P 5CVIA 1DGWY 2OV7A 2CQXA 3QPTA 4M9ZA 1UAAA 1GXQA 4L0ZB 4EMSA 4C9YA 3HB9A 2GXBA 3JRAA 2QKMB 3BC8A 4ENJA 5D4RA 5J1YA 1QPMA 1KA8A 2DLLA 5FD6A 3F9KA 3HPHA 5HLIA 2VL8A 3R0AA 4CDGA 1XC5A 1TL8A 4MTEA 4QIWN 4XN3A 2R5YA 3LSGA 1TWAJ 3CD6I 2L2OA 3LSHA 1O3QA 1R4MB 1FMWA 4HX4A 4A5NA 2VLAA 1FJLA 2XDVA 1YE9A 4JX4A 4DBQA 2CQNA 3C18A 4UB8C 4BJ5C 4BU2A 1WWXA 4YIFA 1SFUA 4QTRA 2LKPA 5B5EC 3ERED 5F0CA 2FJ1A 2CW7A 2BY1A 3V8JA 4RB2C 3RTRA 3BQZA 2W00A 3ZR8X 4E6KG 2IJLA 5HS9A 3H35A 1Y8RB 1MJ9A 5ICGA 3NAUA 2MC3A 3I4MJ 5E17F 3HSFA 1HOMA 3E3VA 1S7EA 4XLCA 4LG0A 3SQNA 1QZYA 2EIKH 3AAFA 3FXOA 2DJIA 4HW0A 4CUGA 4I09A 2RREA 1ZRFA 3L2UA 5HOOA 3HRSA 3WTZA 2Y0MA 3ZPLA 2Y48A 2KIUA 4HX8A 3ZOBA 4C30A 2VASA 3B6CA 5KVRA 3FXQA 4B3AA 3VYRB 5LLQA 2R7RA 2AXTC 3TMOA 2ISYA 2KIQA 2F4MB 4B48A 5AIQA 5LHGA 3OS2A 1MBFA 3AG3H 1SANA 3NQOA 2DODA 4HSTA 3QP5A 2Z1DA 3DEWA 4KFCA 3OOPA 3E5QA 1Z6RA 1P7IA 2VONA 1S9HA 3M9AA 1USSA 3TGNA 4RGSA 2KPMA 4RAYA 5DCMB 2GIVA 1JT6A 2ZB9A 1W0UA 3L2VA 1O4XA 2Q8KA 4W97A 2RNGA 2MBFA 2EJRA 2XKPA 4YELA 2WC2A 3ABKH 3GYHX 4KT6A 3CLOA 3K4LA 2D1HA 1WFXA 4O5VA 5LEKA 2AQFA 3KLOA 2R4GA 1I50J 5HS7A 2QKLB 5GPAA 4ENMA 3H1CA 5BMZA 1XDUA 1TT0A 5HNHA 4BAYA 5F0HA 4BACA 2CUEA 2JVGA 1ETQA 1FIPA 3FMSA 2G9WA 4C3HJ 3FXJA 3GZ6A 3ECOA 2LH9A 2PMUA 4HSRA 2R7QA 3DTEA 3HJEA 4MFDA 5TJJA 3KYLA 1MMDA 4XLAA 1QVUA 2RVCA 5L3CA 1OPCA 1X3WB 2XPUA 3S15J 1Z3XA 4BE2A 2F5EA 2ACJA 3H3VK 1R5GA 2LYCA 1BI0A 3Q0VA 1IDYA 3ZN1A 1K79A 4ESJA 1TT5B 3K69A 2P5VA 3PJRA 3PQJA 2XIGA 2LREA 1FOYA 2EA4A 2BOLA 3SJMA 1YS6A 3I59A 5BOXA 2IXSA 2M3AA 3F3XA 2QSGX 1D3YA 3HHGA 4UUSA 1PUEE 1V3FA 3OYNA 2XC7A 4EJTA 1BBYA 1E3PA 3BCBA 1T33A 1LDJA 4KMUX 4A3EJ 4B1RA 3CDIA 1VZ0A 3ASOH 1X2MA 4ANJA 2M4KA 3KP6A 4AYBA 2QQ9A 2QGUA 2XAGA 3H5NA 1XGNA 3ABUA 5CQEA 1TP4A 3PM1A 5BPIA 1IV6A 4JP0A 1B4AA 3NARA 1F9NA 3MQ0A 1LUJB 1LDKB 4E7LA 2L7ZA 1FBSA 3K4NA 4NHJA 2FMLA 1J7KA 4ZZDA 3OYDA 2R7UA 2ZJRF 2CWEA 2F2EA 2JVHA 4G6TB 4RDUA 3J7AY 2XF6A 1AWCA 4BBRJ 5K5QA 1XSDA 1UHMA 1K78A 1QHHD 1MZBA 3JTGA 1YOVB 3K1PA 2Z3YA 4P96A 5FKNA 4D9JA 3CJQB 2XGDA 2VB6A 1XMAA 2DA6A 5AONA 1MW7A 1IRXA 4R8HA 3VWBA 1IO2A 3HSRA 3RSNA 1LVAA 4MTDA 4AIKA 2KIMA 1U3EM 4DZJA 2BY2A 3CMEI 1TWCJ 3CMMA 4LG3A 1YYVA 3OSFA 4XR6A 4CCKA 1BOAA 5JLWA 3HOTA 1KGSA 3WU0A 4OIQF 4BBSJ 3SEQA 2WAQN 1JKOC 2A5YB 3MEXA 5E18F 1ENHA 5DM6F 1LQ1A 2E1CA 5ED4A 5FJ8J 3HOYJ 4B44A 1ON1A
chains in the Genus database with same CATH topology
3J7YJ 3G71I 2K3FA 3CJTB 3PIOF 1VQ8I 5GADJ 2ZJPF 2JQ7A 3CD6I 2E34A 4IOCF 1QA6A 1VQOI 1VQ5I 1S72I 1FOXA 5GAEJ 5DM7F 3G4SI 1ACIA 1YJNI 5GAHJ 3I56I 3CCLI 3CC4I 3CJSB 5GAGJ 1FOYA 3J7ZI 5JVGF 1VQ4I 3CCEI 4V19K 1MMSA 3CCMI 1YIJI 1VQNI 3CCRI 1YJWI 3G6EI 3CCJI 2E35A 3CCQI 1VQMI 4IOAF 1HC8A 2NXNB 3CMAI 1Y39A 1WIBA 1VQKI 2FOWA 2H8WA 2ZJQF 2ZJRF 2QEXI 2OTLI 3PIPF 3I55I 1YITI 3DLLF 3CJRB 1YI2I 2OTJI 3CF5F 4IO9F 3CJQB 1YHQI 4UY8I 2QA4I 1YJ9I 1VQLI 1VQ7I 1VQ9I 3CC7I 3CMEI 3EGVB 3CC2I 2E36A 3CCVI 1FOWA 1VQPI 5DM6F 1VQ6I 3CCUI 3CCSI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y J;  3G71 I;  2K3F A;  3CJT B;  3PIO F;  1VQ8 I;  5GAD J;  2ZJP F;  2JQ7 A;  3CD6 I;  2E34 A;  4IOC F;  1QA6 A;  1VQO I;  1VQ5 I;  1S72 I;  1FOX A;  5GAE J;  5DM7 F;  3G4S I;  1ACI A;  1YJN I;  5GAH J;  3I56 I;  3CCL I;  3CC4 I;  3CJS B;  5GAG J;  1FOY A;  3J7Z I;  5JVG F;  1VQ4 I;  3CCE I;  4V19 K;  1MMS A;  3CCM I;  1YIJ I;  1VQN I;  3CCR I;  1YJW I;  3G6E I;  3CCJ I;  2E35 A;  3CCQ I;  1VQM I;  4IOA F;  1HC8 A;  2NXN B;  3CMA I;  1Y39 A;  1WIB A;  1VQK I;  2FOW A;  2H8W A;  2ZJQ F;  2ZJR F;  2QEX I;  2OTL I;  3PIP F;  3I55 I;  1YIT I;  3DLL F;  3CJR B;  1YI2 I;  2OTJ I;  3CF5 F;  4IO9 F;  3CJQ B;  1YHQ I;  4UY8 I;  2QA4 I;  1YJ9 I;  1VQL I;  1VQ7 I;  1VQ9 I;  3CC7 I;  3CME I;  3EGV B;  3CC2 I;  2E36 A;  3CCV I;  1FOW A;  1VQP I;  5DM6 F;  1VQ6 I;  3CCU I;  3CCS I; 
#chains in the Genus database with same CATH topology
 4IKF A;  1EA3 A;  3DKW A;  1UST A;  1YS7 A;  1P6R A;  1U5T B;  4F7Z A;  2R5Y B;  3CJT B;  4OWR B;  3HGG A;  5BNG A;  4KMF A;  3F6V A;  2NS8 A;  1J09 A;  2OZ6 A;  3CP8 A;  2NNN A;  3HGY A;  4UNO A;  2HTJ A;  1RET A;  4S05 A;  5ILV A;  2BV6 A;  1OIS A;  2EH3 A;  2E34 A;  3QU3 A;  2YS9 A;  3V8L A;  1QA6 A;  2JRM A;  4AVP A;  5IPA A;  2QQA A;  1VQ5 I;  3BG9 A;  1W36 D;  4I0B A;  1KON A;  5GAE J;  3SHF A;  1TTY A;  1B1B A;  2O6G E;  1G3Y A;  2X9D A;  5GAH J;  1T98 A;  3CC4 I;  4G12 A;  3A0H C;  2JZY A;  1OCC H;  1E3O C;  3DLA A;  3PUB A;  4RLF A;  3HDD A;  2WB1 N;  2ZKZ A;  2CYY A;  2LFB A;  2M0C A;  4IEJ A;  3S93 A;  4MNU A;  3J7Z I;  1T39 A;  5CQG A;  3CCE I;  5FRO A;  3FMR A;  2VIX A;  3DBR B;  3CJN A;  2BVM A;  4EM1 A;  5HNF A;  3BLY A;  4Z6Y A;  2HS5 A;  5DUK A;  3U2R A;  1VTN C;  1H8A C;  2RDP A;  4Y15 A;  3VYT B;  2DOE A;  4E7Z A;  1MMG A;  4AM3 A;  1SD4 A;  4HDV A;  2PMZ A;  3LMM A;  2KIF A;  3QAH A;  3KFW X;  3Q0W A;  1IRG A;  3P5J A;  3KP7 A;  1T0F C;  1HC8 A;  2QCO A;  3GBG A;  2PN6 A;  4HDU A;  1IZ1 A;  1NH3 A;  2XRL A;  4PJ0 C;  4NC8 A;  2ZME C;  4CZC A;  2JMW A;  3K0L A;  1HF0 A;  2H8W A;  3KLN A;  3WU2 C;  5FRM A;  4LLN A;  4KA4 A;  1GUU A;  2MGQ A;  2P7V B;  5DYM A;  4S0H B;  3U1D A;  1QO0 D;  1DP7 P;  2DMP A;  1REP C;  3LQR A;  4E7I A;  4RB0 A;  2MW8 A;  3ZMZ A;  1BR1 A;  3LA3 A;  1LNW A;  5D6E A;  2Y9Z A;  5FKM A;  3OSG A;  4JQF A;  1CGP A;  1E2X A;  3DWL E;  4PK4 A;  2Y30 A;  2QA4 I;  2ZBK A;  1HSJ A;  3LA7 A;  4HQM A;  1K4T A;  1MBE A;  2IP2 A;  5K5O A;  2VXD A;  1DDN A;  1D8J A;  2VOD A;  4L5E A;  2PMZ N;  1AA7 A;  1JUM A;  5E8G A;  4A3F J;  2CU7 A;  1G3T A;  2B9S A;  3CCV I;  1D5V A;  2P5K A;  3V8K A;  4XLP F;  1VND A;  3BR0 A;  3ZMD A;  1FP1 D;  2UXN A;  1ITY A;  1A31 A;  2X4H A;  3LSJ A;  3T8T A;  4E7J A;  4DOZ A;  2VOO A;  1F5T A;  3HOS A;  3HXL A;  5LGU A;  5M5W J;  4QPQ A;  1EJ9 A;  2GLO A;  2UUZ A;  1YRN A;  3E1S A;  1JKQ C;  1VQ8 I;  5LBQ A;  1G8X A;  1X1C A;  4DJA A;  2LF7 A;  4IVN A;  2ICW G;  1I6X A;  3MKY B;  3M07 A;  3HOX J;  1IN4 A;  1D1C A;  3F8M A;  3HBL A;  4JBA A;  3WU1 B;  1UHW A;  2ID3 A;  5IY5 H;  1D1B A;  5KCM A;  4ZDL A;  4CA0 A;  2W84 A;  3S32 A;  3HHH A;  3M1C A;  2ETH A;  3JRD A;  5DUI A;  3KEO A;  3DPT A;  1A36 A;  1QVT A;  4JK1 X;  3OYE A;  2IS6 A;  2FBI A;  3H9Q A;  2F5V A;  1YO5 C;  3CQZ J;  1WJA A;  2OCE A;  4AUX A;  3I59 B;  4XLE A;  2M5W A;  3VFZ A;  4XSX F;  4LIU A;  5J40 A;  1B59 A;  5B1B H;  1PUF B;  3IUO A;  3BR5 A;  1S8N A;  2KKO A;  2OU2 A;  1MKM A;  4P5O A;  5LD2 C;  1IDZ A;  3LA2 A;  3KEQ A;  2OUM A;  1RUO A;  2X6O A;  2HOT A;  1UG2 A;  1FP2 A;  2PEX A;  1W7P A;  3RYR A;  4W1U A;  3BZ6 A;  1WI3 A;  3IC7 A;  3JTH A;  3VYS B;  4Q5S F;  4XID A;  2NYX A;  2D2W A;  2LRD A;  3QPL A;  3EUH C;  4F3Q A;  4BE1 A;  5HLH A;  5K1Y A;  3W6V A;  1EF4 A;  4X1E A;  5FGM A;  4IPA A;  2R3S A;  4ABZ A;  5D8K B;  2MG4 A;  1WZ2 A;  2ZJQ F;  3CUO A;  3QP6 A;  2QZ8 A;  3MFK A;  2BYV E;  2VBZ A;  1GV5 A;  2HOE A;  1K78 B;  4RAG A;  1IRF A;  3F22 A;  2P4W A;  3OMY A;  3GW2 A;  4UV9 A;  5B3S H;  2L01 A;  4FIS A;  2JA2 A;  4BUP A;  3K10 A;  4UUV A;  1WVR A;  3I9V 2;  2HDD A;  3P9K A;  3VSL A;  3EUK L;  3H36 A;  3N4M A;  3KEY A;  2VJI A;  4IQ4 A;  3F72 A;  3DQV C;  2O0Y A;  1DUX C;  2M9H A;  3OYL A;  4GGG A;  3HKZ A;  3NEU A;  2DT5 A;  2ZXI A;  4ZDO A;  4PGH A;  2EA2 A;  3F21 A;  2P5L C;  2GM4 A;  2PMH A;  4ITV A;  1NTC A;  1MSE C;  4M74 A;  2I8D A;  5D4S A;  2PG4 A;  1ZAO A;  3GFM A;  3RPU A;  3WGI A;  3OYJ A;  3IH3 A;  5F0F A;  2Y0S N;  4ZJZ A;  1X1D A;  2V7F A;  2VI6 A;  5M5X J;  4U0Y A;  1A6I A;  1EV7 A;  1W1W E;  2FQ3 A;  3K6G A;  2CJJ A;  5K5R A;  1O3R A;  3RIR A;  1ETX A;  3S17 J;  2EBI A;  1ZLJ A;  2KRH A;  1T6S A;  3VDX A;  2FNA A;  3T0Y A;  3KE2 A;  2V6C A;  1VF9 A;  2FX0 A;  5IYD J;  4PSX A;  3E6C C;  3RKX A;  3PO2 J;  4HYE A;  5CYV A;  5IOY A;  2L9N A;  4H0E A;  4KIF A;  2JUC A;  1FOK A;  2F5F A;  3ERM A;  3G1O A;  2DN0 A;  2CFX A;  2CV2 A;  1XGM A;  5LGT A;  5ICC A;  1T2K A;  3AL0 C;  1YW7 A;  1ETO A;  3HKZ N;  1ZGJ A;  2GOX B;  3Q3S A;  2DFI A;  1KQ8 A;  1HXD A;  2XF5 A;  3TKY A;  4M9S A;  2HQN A;  1Y1W J;  4J19 A;  4OOI A;  3GWZ A;  4G7H F;  2ESN A;  2KMU A;  3FBN B;  1ETV A;  3UKG A;  2OC6 A;  3ABM H;  3QPH A;  3VSK A;  1VQN I;  1LJ9 A;  3BTI A;  2FBK A;  2H6C A;  3H5R A;  1ZR2 A;  3IHU A;  3CES A;  2IS1 A;  2IS4 A;  3HRU A;  4L9J A;  3HL2 A;  1ORK A;  1OLT A;  2JRT A;  3S3M A;  2LDU A;  1FWZ A;  2HDW A;  3H5A A;  2WWY A;  3GTP J;  3I58 A;  2DA2 A;  4CYC B;  3OV8 A;  2CO5 A;  1LKX A;  2WAD A;  3CTA A;  1ZG3 A;  1ZEL A;  2GAU A;  1K61 A;  2RGV A;  5DV5 A;  1P4W A;  3FKI J;  3OYI A;  2KP6 A;  3OYK A;  3M8E A;  3FHZ A;  3GTG J;  2JA6 J;  3CMY A;  3I53 A;  3PNT A;  4RGX A;  1L3L A;  2HOA A;  2M34 A;  4L5J A;  4NBQ A;  4BQO A;  4DBR A;  5IP6 A;  4CIC A;  3GZN B;  4CCN A;  3CF5 F;  3GXO A;  2RV8 A;  1P9Q C;  2EQR A;  3PQK A;  1E0E A;  4XRS G;  1Z21 A;  3FM3 A;  1K6O A;  2EFP A;  1OR7 A;  3IL2 A;  5LEJ A;  1XN7 A;  4XKW A;  3P7N A;  1P4A A;  4JX6 A;  4AC0 A;  3CUQ A;  2F6C A;  3MN2 A;  1Z0X A;  2E71 A;  2ELJ A;  4WWC A;  4CHU A;  1OCR H;  2LR8 A;  2VC1 A;  2IRF G;  3KP4 A;  5E3L A;  4D5C A;  4YFK F;  3JSO A;  3D1N I;  1ZLK A;  4J00 A;  1WKM A;  2KZG A;  2KT0 A;  3MZH A;  4G6Q A;  1SAU A;  3V7S A;  4KIT B;  2NRA C;  2EIN H;  2PX9 A;  2ECC A;  2M7B A;  2KQR A;  3PSF A;  1YRN B;  2QUF A;  2L7K A;  4ENK A;  4ETS A;  2AS5 F;  1MNE A;  1B9M A;  2CSO A;  2V79 A;  4BEH B;  3BY6 A;  3TP3 A;  1D0X A;  3BTC A;  4AVZ A;  3C2B A;  2V1X A;  2ESH A;  4Q47 A;  3BR2 A;  3NWS A;  2M45 A;  1WJE A;  3D5R C;  4WX9 A;  1JGS A;  3V42 A;  4RGR A;  1PJR A;  3R60 A;  4AIJ A;  1OYI A;  2ELK A;  1LDD A;  3IRQ A;  3I56 I;  3TDZ C;  3JRG A;  2Y2Z A;  3F8C A;  4XRS A;  4IQJ A;  2ZXJ A;  1Z6T A;  3ZQG A;  3MVP A;  4XBF A;  3T5X A;  2R7W A;  4V2G A;  3CJS B;  4PJN A;  2VBY A;  4WF2 A;  4CO8 A;  3K4J A;  3GCM A;  3H9G A;  4E7H A;  4EJU A;  4I7H A;  1U5T A;  3FIW A;  3I0T A;  4LMY A;  1Z9C A;  1BI2 A;  3RZD J;  2KIS A;  1N25 A;  3J80 Z;  3BQY A;  2KFD A;  3FIS A;  1OCO H;  2ELH A;  4BXU A;  4F93 B;  2DPD A;  5FLV A;  1ZAR A;  2FQ4 A;  3ZQH A;  1W4M A;  2E2H J;  2HEO A;  2BHY A;  4HG2 A;  1JHF A;  4OMZ A;  1W7P B;  2E7X A;  4II2 A;  3LSR A;  4BDZ A;  4M6X A;  3S3N A;  1SFE A;  2DBB A;  2Y9Y A;  1SVM A;  2VQG A;  2RQP A;  1SD5 A;  3Q9V A;  2E5N A;  3CZ6 A;  4N0B A;  2DAO A;  5CKT A;  4M72 A;  5J8F A;  5EF6 A;  3K1N A;  1A5J A;  3BJO A;  4HBL A;  3GFJ A;  1FPQ A;  3HOV J;  2W4S A;  2L0K A;  4PJJ A;  2DMN A;  2MYS A;  3FBI B;  2YX7 A;  3GO5 A;  2OTL I;  3KP2 A;  2FUG 2;  2OJE D;  1RUN A;  4XM3 A;  1YIT I;  1MD0 A;  4KN4 X;  1G4D A;  3VB2 A;  4LJZ F;  2XGC A;  2YR2 A;  4XON A;  4EJV A;  3BPX A;  3SZP A;  1YJ9 I;  2PBI A;  3JCU C;  5FKK A;  2D45 A;  3A01 B;  3J80 K;  4A0Z A;  3QYE A;  4LIT A;  3RPQ A;  3VOE A;  3LAJ A;  2ZNY A;  1MBG A;  2V1U A;  3VEP A;  3GLX A;  5J47 A;  2CQQ A;  2Z9O A;  3A02 A;  1FOW A;  2HKX A;  3BG5 A;  4KN7 X;  5JR3 A;  5K7H A;  4Y3O A;  2O8K A;  4EJW A;  1I5Z A;  3E6M A;  1T08 B;  2W57 A;  2ZNZ A;  5H6R A;  3CCU I;  2L9V A;  2E1M C;  2XV4 S;  5HDN A;  3LAP A;  2BXZ A;  3IH2 A;  3KX2 A;  2V1N A;  4BH9 A;  2C6Y A;  1B72 B;  1ZKG A;  4NC6 A;  3SZT A;  3W3C A;  2YX4 A;  2LG4 A;  4NNJ A;  1A35 A;  5H20 A;  4BHC A;  2OPT A;  4A3B J;  1RI7 A;  4XOR A;  1Y1V J;  4BY7 J;  2F4O B;  1WJB A;  3FXM A;  3ZQF A;  4Y52 J;  1FT9 A;  4B47 A;  2EB7 A;  3VYU B;  3TBI A;  2BW3 A;  4M3D A;  1B9N A;  2V1D A;  2VN2 A;  1RR8 C;  5GTH C;  1BC8 C;  1XCV A;  1QZZ A;  1KU3 A;  4JYK A;  2K4J A;  3TW7 A;  1RNL A;  2WV0 A;  2J5O A;  3C2G A;  2ZSH B;  5FKO A;  2VBW A;  2A69 F;  1X3U A;  2OQG A;  4EVI A;  1Y0U A;  2JJ7 A;  2QM3 A;  5E1Z B;  4Y4R A;  4QSH A;  2H27 A;  2COM A;  1BIA A;  3QWL A;  4A5M A;  2UZK A;  1JE8 A;  1UFM A;  3EYY A;  1B8I B;  3LWF A;  1S7O A;  1Y6I A;  5JVT A;  1BW6 A;  3G2B A;  3A4C A;  3E7L A;  3LOC A;  4EJO A;  2DMU A;  5KHD A;  2N8G A;  3G6E I;  2DA1 A;  3U21 A;  2MAB A;  1V5F A;  5ERI A;  3KYC B;  2P0W A;  3SEZ A;  3BJA A;  1G6N A;  3G1L A;  3UNG C;  4BYY A;  3IWZ A;  4UB6 C;  1V54 H;  1UCR A;  2L9R A;  3JAM Z;  4CXF A;  2YU3 A;  2JA8 J;  2BZT A;  2EZK A;  1WJD A;  1Z91 A;  5FFX A;  3ZMT A;  2NXN B;  2NS0 A;  2NVQ J;  3ONQ A;  2XGE A;  5FLM J;  3S2W A;  2GQQ A;  1W5T A;  2ZJ2 A;  3LL7 A;  4ESB A;  2DW4 A;  3BOQ A;  2HPI A;  1R1U A;  4M73 A;  4I98 B;  2XKO A;  3CDH A;  2O8X A;  2A68 F;  1PUF A;  2LC2 A;  4XOP A;  1I3Q J;  1POG A;  3QPS A;  2RN7 A;  4RMN A;  4XRM A;  4A3L J;  3B02 A;  2QYO A;  2I5U A;  5TIS C;  4F92 B;  5EG0 B;  1G3S A;  4D1Q A;  2WAQ A;  3FXL A;  1KYZ A;  1V4R A;  3R4K A;  4YII A;  4LOC A;  2OA4 A;  3CUQ B;  1YTY A;  5BS6 A;  5E8I A;  1I39 A;  5EDN A;  4RAZ A;  5BPD A;  2E36 A;  2MD0 A;  2Y31 A;  4IXA A;  3ML6 A;  1O7F A;  1LEA A;  4G7Z F;  4F52 A;  1BOB A;  4GCV A;  4DYC A;  3TL4 X;  3ZQ7 A;  2K40 A;  1F1Z A;  2XHK A;  1R22 A;  1RPW A;  4A0Y A;  4BDY A;  2OZU A;  4A3J J;  1P7J A;  2R7D A;  3EUA A;  1WJF A;  3JAM K;  2M30 A;  1MBH A;  1Y8Q B;  3J7Y J;  3GEZ A;  1ULY A;  1E17 A;  1U9O A;  2O5R A;  4A69 C;  5E79 C;  4U87 A;  2DA5 A;  3GFL A;  3RYP A;  1FSE A;  3E0J B;  1R36 A;  2LD5 A;  4NC7 A;  2R92 J;  1D0Z A;  3S14 J;  3H9J A;  1WI9 A;  1XMK A;  2JA7 J;  1LFU P;  4IOC F;  1UB9 A;  2K9N A;  5F08 A;  3GTK J;  2DPU A;  2WB1 A;  2GZW A;  2HZT A;  3L1P A;  2Z99 A;  3R6S A;  4HEA 2;  1RR7 A;  2VJ5 A;  1TQI A;  3FM5 A;  4Q48 A;  4CCJ A;  3D5L A;  2VQL A;  5EJC A;  1J5Y A;  1IV8 A;  1PYV A;  1HW1 A;  4GO1 A;  3LSM A;  4OMY A;  3BR3 A;  5M3F J;  2FE3 A;  4RAF A;  2XF7 A;  1G59 A;  1ZR4 A;  3OYC A;  3WGH A;  3MAJ A;  2DTR A;  1BIB A;  2QSF X;  3H0G J;  2KDZ A;  3BZK A;  4O3M A;  2IBD A;  5E20 A;  1LE8 B;  1MJB A;  1Q1V A;  1OMI A;  3FX3 A;  3OR1 C;  3SYT A;  4HF0 A;  2XAU A;  4ZDP A;  4G8X A;  3K70 D;  4A0X A;  2ZXW H;  2G0E A;  1MMN A;  3L00 A;  4IOA F;  3ZMS A;  5JLX A;  3BR1 A;  3MWM A;  1U0J A;  2A61 A;  1ZH5 A;  1B6A A;  2HQR A;  4U7D A;  1XSX A;  3HZJ A;  1O7L A;  2L5Q A;  4LD5 A;  2E60 A;  1YQA A;  3AL0 B;  1MDM B;  1AOY A;  4R1H A;  3PFI A;  4UV8 A;  2E1O A;  2H8R A;  3J81 Z;  3RDI A;  4C2U A;  3QYF A;  2JPC A;  3KYD B;  5IT3 A;  1BA5 A;  3PIP F;  2JUG A;  1SEU A;  1R49 A;  4XQF A;  2YU9 J;  2JSP A;  3DF8 A;  1LFB A;  2DDB A;  2M7A A;  3AG2 H;  2NOJ B;  2M87 A;  2HXI A;  2LKS A;  1YI2 I;  2L4A A;  4KDP A;  2E2I J;  3V7C A;  5F1R A;  1DU6 A;  2DU9 A;  1QQI A;  2R7V A;  3QOD A;  1U8R A;  2ME6 A;  5DDG A;  1VQ9 I;  4HNV A;  5LHI A;  2GXG A;  5M5Y J;  1SD7 A;  3ABL H;  5F6F A;  3HTS B;  5DD4 A;  1BL0 A;  3HPG A;  4CYC A;  1GT0 C;  5DD8 A;  1HDP A;  3HIF A;  4BS9 A;  2CV1 A;  2R5Z B;  4E4H A;  2F5C A;  1BJA A;  1RKW A;  2R7S A;  5H6Q A;  4FAS D;  4JOM A;  3HOU J;  2K9L A;  1IUY A;  4Y33 A;  1I6H J;  1Z1D A;  3G1M A;  2Y69 H;  4E7K A;  2NNY A;  4Z2Y A;  1R71 A;  1BR2 A;  2CG4 A;  4BL0 B;  2KJB A;  2XGX A;  2GA2 A;  3P9C A;  1S5L C;  3WTW C;  1JGG A;  1KQ9 A;  3S1R J;  4KUM A;  3PUF A;  4EEF G;  5CPR B;  1W5S A;  3JRB A;  2BW3 B;  2FOK A;  4AID A;  1GVJ A;  2EZL A;  2LBF B;  1JJ8 C;  3IWF A;  3LFK A;  1TWF J;  2BBY A;  3RZO J;  3RKW A;  2V6E A;  5E3O A;  2QWW A;  3C2H A;  3WTT C;  3SFZ A;  5CVJ A;  4B09 A;  4BHB A;  2HNH A;  5TGT A;  3CCY A;  3WHC A;  2E1N A;  3HSE A;  3ASN H;  3V4G A;  4HX7 A;  4BEH A;  2ZFW A;  4NDL A;  4WXD A;  4ZH4 F;  4EM2 A;  1I27 A;  3FXR A;  4DYR A;  3E5U A;  3CCJ I;  2E7W A;  2XPV A;  4OAY A;  1W36 C;  3S1Q J;  4G94 A;  5CJ9 A;  2K9M A;  2WV1 A;  4L5I A;  1JKP C;  3E5X A;  3OWT A;  4MEY F;  3ISP A;  2STW A;  3MMY B;  2K9S A;  3T8R A;  1MBK A;  2BVL A;  2QBY B;  1V55 H;  2FA5 A;  2HGC A;  1TBX A;  3DBH B;  4HOB A;  1ZRD A;  4MGR A;  2LKX A;  2P6T A;  1MH4 A;  5J8C A;  2Z33 A;  4I02 A;  1IXS B;  5LRS A;  1ZRC A;  1X2N A;  1OCT C;  3VOD A;  2MC4 A;  2XAQ A;  1EH7 A;  1YX3 A;  3ZQQ A;  1Z77 A;  2FEZ A;  2GBY A;  3QOE A;  1ZG1 A;  2M8E A;  4KIG A;  4G7O F;  3C1D A;  4OU0 A;  2ADU A;  2MLG A;  2ID6 A;  1J0R A;  2P8T A;  5AIP A;  5L3F A;  2K85 A;  2Q1Z B;  1WJ5 A;  1ZYR F;  3LFU A;  2KRF A;  3JW4 A;  1JT0 A;  2X85 A;  3BZC A;  3ECH A;  4XK4 A;  4BQA A;  4IO9 F;  2NVU B;  2NVX J;  3DPL C;  4WK8 F;  2HTS A;  5KAF C;  2AXL A;  3QU6 A;  1DQU A;  1VFC A;  2DTZ A;  2H1L A;  4N4N B;  3CC7 I;  2Y0S A;  3JR9 A;  1IRZ A;  2MD5 A;  2QVO A;  3EGV B;  2UWM A;  1UHS A;  3OYB A;  4FQG A;  5KNL A;  2KL4 A;  3E97 A;  1WH5 A;  5CVU A;  3ULQ B;  2D5V A;  1LPQ A;  4F91 B;  4ZC3 A;  3I71 A;  4PCQ A;  4IRI A;  2FD5 A;  2VT3 A;  2TRT A;  1DP3 A;  2XSJ C;  4A3K J;  1PP8 F;  2QSH X;  3MCZ A;  4KIC A;  2RC4 A;  2XUB A;  3ZRG A;  4ON0 A;  4IZZ A;  1X1A A;  2ZJP F;  3GTJ J;  1HW5 A;  4XLH A;  5ILS A;  3GUD A;  1CF7 B;  2KZV A;  3A01 A;  1QPI A;  4C2M J;  1X1B A;  4HPQ A;  1T0F A;  3S2D J;  3TP0 A;  4P9F A;  1H88 C;  3HRM A;  3CLQ A;  1FMV A;  1SVL A;  3OR2 C;  3P9I A;  4JX5 A;  3DKX A;  2XRN A;  3MZ8 A;  5GTI C;  1D8K A;  1Q1H A;  2PI0 A;  4HF2 A;  4I76 A;  4FE7 A;  4UUT A;  2ZME A;  3DBL B;  3S16 J;  1HQC A;  1HST A;  2IA0 A;  5D8L B;  2H1K A;  4M9X A;  4DZP A;  4UVC A;  4HA8 A;  1J2X A;  4Q4Z F;  1NHA A;  3AG1 H;  5GAG J;  4G9Y A;  1MSF C;  1B72 A;  4NB5 A;  2E1M B;  5HDG A;  4EQQ A;  4ZYD A;  1VQ4 I;  1FY7 A;  3RQ4 A;  2YSR A;  1U9N A;  2K02 A;  1SAX A;  4IHX A;  2VKH A;  3BRO A;  2XPW A;  1YJW I;  1T56 A;  2PJP A;  2EZI A;  1TQM A;  5K7Z A;  1IW7 F;  2EV6 A;  4XKB A;  1EH8 A;  2YUS A;  1X19 A;  2E35 A;  4XNF A;  5JHU A;  1SVO A;  2DQR A;  2OBP A;  4P1W A;  3OYF A;  3HOZ J;  1MJA A;  4L9V A;  4CZZ A;  3HRT A;  3AKZ A;  1APL C;  1UMQ A;  4FTH A;  4NQW A;  4KNY A;  4ZYH A;  2G7H A;  3OYA A;  2R93 J;  3F0C A;  2DK8 A;  3M3Y J;  4M3F A;  1P92 A;  2JT1 A;  4FE4 A;  4RM3 A;  1Y39 A;  2VOP A;  1HKQ A;  2BEO A;  4MIM A;  2DA7 A;  4A93 J;  2MSY A;  1WIB A;  5ICF A;  2LF8 A;  4AIH A;  2QEX I;  2A6H F;  1X3Z B;  2BXY A;  4A12 A;  1B8I A;  1MGT A;  1R4N B;  5EEG A;  5FO5 A;  9ANT A;  2PJR B;  2A6E F;  3DU6 A;  3IP4 B;  4WXC A;  4IRG A;  4EM0 B;  2W7N A;  5LFA A;  2WA0 A;  2IA2 A;  5CVV A;  1SFK A;  2CUJ A;  1U6G A;  1RES A;  1AU7 A;  4PJL A;  2V9K A;  3BWG A;  3RI4 A;  1IXR C;  3G3Z A;  3K4K A;  2KDO A;  3K9T A;  2XAH A;  4A2U A;  4A6D A;  5C4J J;  1AKH B;  2IS2 A;  3U1K A;  3I64 A;  2GWR A;  4FX4 A;  2PLY A;  5HDK A;  1XMX A;  1XTA A;  2IW5 A;  2YPR A;  4HRI A;  3HUG A;  2J5P A;  3FMQ A;  4II3 A;  3LST A;  2F48 A;  2Z2S B;  2XRO A;  3BTL A;  3OIQ A;  1VQ6 I;  2EIM H;  4MHG A;  2VQC A;  4U88 A;  4GYG A;  4ZTJ A;  3A1Y A;  3CO6 C;  4PGG A;  1SMY F;  2DOA A;  3H3U A;  3ZGK A;  2R7T A;  3AFH A;  2VE9 A;  4HLY A;  3DXJ F;  3PSI A;  1YFH A;  3HC7 A;  2DFE A;  5EG0 A;  4XN0 A;  4Y7N J;  4A6E A;  2LTP A;  4ZZL A;  3QYB A;  1W0T A;  3M4O J;  1YG2 A;  1ERD A;  3O2P E;  4M6V A;  3A0B C;  1VQO I;  1S72 I;  4M6Y A;  1FTZ A;  1TNS A;  1FOX A;  3ROU A;  3B6A A;  1XG1 A;  3BJ6 A;  1ACI A;  1YJN I;  3U9G A;  2O3F A;  5EYR A;  4I99 C;  1G3W A;  3EUH A;  3JRC A;  1Z05 A;  2M1B A;  2IT0 A;  4DNC A;  2P81 A;  2W85 A;  2LY2 A;  3IH4 A;  3F6O A;  2DYS H;  2KRC A;  4U0V A;  4MEX F;  5B1A H;  1XPX A;  1A04 A;  2ISZ A;  4GRI A;  3JRI A;  2OCC H;  2LP0 A;  3IKT A;  3KPH A;  3KIO A;  2VE8 A;  3DEE A;  4AD9 A;  4X0G A;  2LVS A;  3CCM I;  1LEB A;  4RBO A;  2GXA A;  3QOP A;  2DA4 A;  3FWE A;  3F8F A;  3W2V A;  1XD7 A;  2KHM A;  1VQM I;  2RNJ A;  3PNV A;  3Q9S A;  4IF4 A;  2VT2 A;  3MKZ A;  3EYI A;  3JRE A;  3H0D A;  1FNN A;  1H0M A;  1D5Y A;  2BY3 A;  3ELK A;  2KLO A;  3KZI C;  2CUZ A;  3CMA I;  2BGC A;  3S1M J;  5ILU A;  4EV0 A;  1D0Y A;  2FU4 A;  3GZ5 A;  2HQA A;  1FTT A;  4E7S A;  1TC3 C;  5DEQ A;  4A3C J;  4QLC U;  2MA3 A;  3NWT A;  1ETY A;  5EEA A;  3H92 A;  2DT6 A;  2HYJ A;  1LE8 A;  1Z7L A;  1FIA A;  3ZQI A;  1H9T A;  1RIO H;  2HVS A;  4QWQ A;  4L0Y B;  1YLF A;  2QQ8 A;  2EIL H;  4XKV A;  2JSC A;  4PSW A;  2VJ4 A;  4HLX A;  4RB3 C;  2WY7 Q;  3T1B A;  1FSH A;  2XAJ A;  4BXF A;  2R7F A;  2HFH A;  3W6K B;  5DTD A;  2VKV A;  3B73 A;  5IP7 J;  1MDM A;  4S04 A;  2EZH A;  2LLK A;  3LQQ A;  3FK7 A;  1NK2 P;  4LLL A;  3FXU A;  3CO7 C;  4R79 A;  3IRR A;  1K4S A;  3C7J A;  2A07 F;  1K7A A;  1SC7 A;  3EDP A;  3OL4 A;  4N9I A;  4XOT A;  2W1O A;  2XB0 X;  2B63 J;  1KQ0 A;  1LB2 A;  3L7W A;  2DFF A;  1ZK8 A;  3H3Z A;  5GAD J;  2X0L A;  4BE0 A;  2CRG A;  1OCZ H;  2E2J J;  1RKT A;  1GVD A;  4M71 A;  3I3L A;  1NK3 P;  4NUB A;  3KET A;  5HVQ C;  4O6J A;  1S29 A;  1GLN A;  3D0S A;  1T38 A;  3COA C;  5FB2 A;  3S8P A;  2R5Z A;  4C2T A;  4ZYA A;  2DJN A;  3IV5 A;  2NVY J;  4UVA A;  5J3L A;  2ZME B;  2CFO A;  1P4X A;  1FC3 A;  4OIO F;  4XKC A;  5E1X A;  3F8N A;  5EZH A;  1DU0 A;  1J59 A;  1N77 A;  4H4K C;  1L0O C;  4CYD A;  5IT9 Z;  5C44 J;  2FRH A;  1IUF A;  1H9G A;  1FX7 A;  2DXI A;  2DO7 A;  3WTY C;  3QQA A;  2DFH A;  4M3E A;  3VPR A;  1TZL A;  2EK5 A;  2X6Y A;  4IL6 C;  2XB5 A;  1WPK A;  1QHG A;  2LK2 A;  2X1C A;  2M8G X;  1F36 A;  2CUF A;  2NOG A;  1ON2 A;  5ICE A;  2JTV A;  2LBF A;  3GTO J;  5EGO B;  1NG6 A;  2A6T A;  3C3W A;  2BY0 A;  2JN6 A;  1OKR A;  2R0Q C;  1H89 C;  1GDT A;  2CV0 A;  1QBJ A;  3V7R A;  4A3M J;  4OIP F;  3JRF A;  1FBU A;  2EIJ H;  2LOO A;  4NQW B;  3TDU C;  5GPC A;  1CQT A;  4L9N A;  4PFP A;  3K7A J;  3DV8 A;  2HYG D;  2FNP A;  1KU9 A;  2QLZ A;  1ETK A;  4HNT A;  4FHT A;  3SDG A;  4RM2 A;  2NAZ A;  3WTU C;  2HVQ A;  4Y13 A;  1JJ6 C;  3BG3 A;  5HOD A;  2MLK A;  3KZZ A;  3N05 A;  2RAE A;  5D5V B;  3WG7 H;  5DS9 A;  1I3A A;  1GHC A;  4MQ9 F;  1T8I A;  5IP9 J;  1YIO A;  3M1E A;  4C3I J;  5IT9 K;  2H6B A;  1UEL B;  2IGK A;  1YHQ I;  4L9T A;  4UY8 I;  1F43 A;  2QBY A;  4I0A A;  3DTK A;  3E6B A;  2IPQ X;  3X2Q H;  1IN7 A;  1Z7U A;  1W7P D;  3AG4 H;  3HM5 A;  3GVA A;  3HUG B;  4UXN A;  3OY9 A;  1M1E B;  3FDY A;  5D5U B;  5LGN A;  2LY1 A;  2CW8 A;  2HDC A;  1S7A A;  1VQP I;  5BQT A;  1T95 A;  3L9F A;  2EFW A;  2EPF A;  2Z16 A;  2M2E A;  2HYF A;  1KYW A;  4BY1 J;  3BR6 A;  2K3F A;  4OIN F;  1HKS A;  2RQQ A;  4IHS A;  4IHT A;  4IHV A;  2B7E A;  2V26 A;  4YRV A;  4FCY A;  5D5X B;  5FD5 A;  1XCB A;  4RB1 A;  3I54 A;  2P6S A;  2MFZ A;  3G4S I;  1MND A;  3DFG A;  3SDB A;  3EPZ A;  4D7M A;  4HNU A;  1QGP A;  3ZMU A;  1S3J A;  3F8B A;  3Q0U A;  4BKX A;  4M3G A;  1LFP A;  3DTI A;  5JHF A;  3O8H A;  1STZ A;  3BCA A;  1O57 A;  3RPU D;  2QQB A;  1XS9 A;  1U2W A;  1PP7 U;  4XIC A;  3MD2 A;  5JVG F;  1U78 A;  3CF2 A;  2DMT A;  3TO6 A;  3TO9 A;  4V19 K;  5DCF A;  4KT5 C;  2H94 A;  4MFE A;  2M0M A;  1R5I D;  4IX7 A;  1YIJ I;  2B0L A;  2UXX A;  1CF7 A;  1R23 A;  3LSP A;  1TW2 A;  2Q2E B;  3HEF A;  2HXO A;  3IAS 2;  1YW8 A;  2L7F P;  3R61 A;  3REO A;  4YFN F;  4WXH A;  5CLS A;  4BNC A;  3BG6 A;  2HPM A;  3SXY A;  5KAI C;  5J4V A;  2CQ7 A;  4BQN A;  1WCM J;  3GTL J;  3TOA A;  1MNM C;  2ZFU A;  2L9S A;  4AYB N;  2K86 A;  1UJ8 A;  5C3E J;  2K9Q A;  3O8G A;  1VQK I;  3ABT A;  2WY8 Q;  5EZG A;  2DCE A;  1R9T J;  5IYC J;  3FZV A;  5C4X J;  3L2Q A;  2K7L A;  2L4M A;  4M3B A;  4CCL A;  2L3D A;  4V2F A;  1W5C C;  2ZXH A;  4LB5 A;  3TOB A;  1UG0 A;  4CH7 A;  5HLT A;  1JKR C;  1VQL I;  1VQ7 I;  1RC9 A;  3LSI A;  4MLO A;  4U0W A;  5GP9 A;  4QPO A;  3HOW J;  4BXX J;  1TWG J;  3DKY A;  4YIR X;  1R00 A;  2DDA A;  5FKL A;  5LRR A;  2JK3 A;  4ASN A;  1ZRE A;  4ESF A;  3CC2 I;  2GOM A;  1FZP B;  3N97 A;  2JWT A;  1WJC A;  3QRF F;  3K2A A;  3KZY A;  5E3N A;  4EGZ A;  1IG7 A;  3GLL A;  1TLH B;  3WGG A;  4XMY A;  2PJR A;  2JPB A;  5B66 C;  2HQ5 A;  2FMY A;  2MH9 A;  5J1U A;  1MBJ A;  2CS3 A;  3S2H J;  2BHZ A;  4N9H A;  2DT7 B;  3TED A;  1ZTR A;  1SD6 A;  1JI8 A;  2WAE A;  2ME0 A;  2DQL A;  2E19 A;  1AKH A;  2MH2 A;  2X6X A;  1HBX G;  3GME A;  1TWH J;  3M8J A;  2IGM A;  2O03 A;  2AO9 A;  1IC8 A;  4LG0 B;  5J1R A;  3RKQ A;  5DM7 F;  3O3K A;  3ZMV A;  3PFY A;  2IGO A;  2IGN A;  4KYW A;  3PO3 J;  1PVE A;  1QU3 A;  1MMA A;  2GA1 A;  4FX0 A;  1IN5 A;  1TW3 A;  5M3M J;  2DYR H;  2XAS A;  5L3B A;  4GYI A;  1SFO J;  3I4P A;  5IOZ A;  2AHQ A;  4G6D A;  1HCR A;  4B4C A;  3ZP5 A;  2W25 A;  1KZH A;  2NVT J;  5F64 A;  3S1N J;  1J75 A;  4A3I J;  3SZG A;  3S3O A;  1MMS A;  3FXK A;  4HAM A;  1BN5 A;  1J9I A;  3J81 K;  4I6Z A;  3LNQ A;  2CQK A;  3I4N J;  2VXZ A;  3TW6 A;  1XDS A;  3UR3 C;  4HQE A;  1IN6 A;  4AWX B;  1BW5 A;  4B8X A;  1MIJ A;  3WOD F;  2A5W A;  1FYM A;  1JTX A;  3OIO A;  2ZCW A;  2DK5 A;  3RCO A;  2CGP A;  1GV2 A;  1HA8 A;  3BTJ A;  3WE3 A;  2ZSI B;  2G7U A;  2R7Z J;  4RLQ A;  1QZE A;  3HG9 A;  3GTQ J;  2RKH A;  2IA1 A;  4PFO A;  4WCG A;  4EAT A;  3MKL A;  1OCP A;  3WHB A;  1JXS A;  3ZQC A;  2KJC A;  4XLF A;  5KK1 A;  2L54 A;  4KIB A;  5F04 A;  2STT A;  1K6Y A;  4AU7 A;  1HDD C;  3W2W A;  3DPU A;  4E70 A;  5F1J A;  1OFC X;  4LB6 B;  4PDK A;  2FF4 A;  1X4O A;  2ZC2 A;  4LLG F;  3FKJ A;  2K5C A;  3ZN0 A;  4IJA A;  2VKD A;  4RA2 A;  3K70 C;  2P7C B;  4HF1 A;  1FEX A;  1BC7 C;  4YEJ A;  3K1M A;  1R1V A;  1KU2 A;  1JTY A;  1BM9 A;  4YFX F;  2CMP A;  4RS8 A;  2X51 A;  5FRN A;  3OL3 A;  5E1W A;  1Y56 A;  3BT9 A;  2LMD A;  4DGW B;  2XAF A;  2VPL A;  3WG9 A;  2I10 A;  2EFQ A;  1WSU A;  4U7B A;  3DU5 A;  3OS1 A;  2F4I A;  5FLX Z;  1A6Q A;  4CCM A;  3GX4 X;  3EQL F;  3L09 A;  4DW6 A;  2IVM A;  3CCS I;  1X4P A;  1JUP A;  2Y75 A;  3Q5F A;  1ETW A;  1QNT A;  2PFB A;  1IJW C;  2FBH A;  1TQP A;  3PIO F;  1IF1 A;  1BJZ A;  4IHY A;  3HYI A;  2K4B A;  3EET A;  5J6X A;  4YG2 F;  1PDN C;  4UUS B;  5LHH A;  1IXC A;  3G73 A;  4BGD A;  1GXP A;  4CCO A;  3TQN A;  1R5H A;  4CGZ A;  1I1S A;  2X1D A;  4K2E A;  4UVB A;  1BI3 A;  1QRY A;  1ZGA A;  3ESW B;  1OR7 C;  2F5D A;  3CCL I;  3WTS C;  3WTV C;  4B43 A;  4EGY A;  4GDF A;  2VPR A;  2QEN A;  2QF7 A;  3CUQ C;  3WE2 A;  5HLG A;  3OS0 A;  1FYL A;  1F4K A;  2LY9 A;  3A03 A;  3BPV A;  2D1V A;  4LK1 F;  1N78 A;  3L2C A;  1R6R A;  3GTM J;  5H2F C;  3OIP A;  4D7N A;  4XSZ F;  1R1T A;  1YX5 A;  3OOU A;  3FHN A;  2X6W A;  1X1P A;  3A2K A;  2X48 A;  2E5Z A;  3PL8 A;  1V5G A;  3K4B A;  3MKW B;  3OYH A;  3K2Z A;  6PAX A;  3TO7 A;  5L3E A;  4FET A;  4HZF A;  4BJ6 C;  3IKV A;  5CVR A;  4DQ2 A;  4MQV A;  5FLX K;  1Z67 A;  5E3M A;  3GF2 A;  2HU9 A;  5JFR A;  3CCQ I;  1JHH A;  1O3S A;  5F27 A;  3BG7 A;  2BE5 F;  1D1A A;  3ZQL A;  4DYQ A;  2HWV A;  2HKO A;  4FT8 A;  5J4Y A;  2NS7 A;  1R7J A;  1SFX A;  3WTX C;  1SMT A;  3L2W A;  2VC0 A;  4LFU A;  2OAZ A;  3DCF A;  2ECB A;  1FLI A;  4P55 A;  3ZCO A;  1XSV A;  1P2F A;  3K4C A;  2FOW A;  4IRH A;  2HOS A;  1NG7 A;  3RKY A;  4TV7 A;  2OQR A;  2LNB A;  1U5T C;  4IHW A;  3I55 I;  2EV0 A;  5EGO A;  1RZ4 A;  1XX5 A;  3DLL F;  3RJP A;  4XLN F;  1IGN A;  1OQY A;  1BI1 A;  2Q0O A;  2X1E A;  2Z5U A;  3JSP A;  2JA5 J;  3JRH A;  1WH7 A;  2DA3 A;  4A3G J;  1WHU A;  2LSO A;  1V5E A;  2IEK A;  3FF5 A;  4BQQ A;  3J7A O;  4CSW A;  5DCM A;  1U8B A;  1Y0N A;  3O6B B;  4I01 A;  5D6F A;  2PQ8 A;  2M4G A;  1HKT A;  1LVK A;  2DOF A;  2O7O A;  4ZYG A;  3CP2 A;  1X58 A;  1YW9 A;  3I5U A;  3OYG A;  4OAZ A;  3BDD A;  3M8F A;  3K4M A;  4D5F A;  1OYY A;  3DP7 A;  4LIV A;  4KIS A;  2ZO4 A;  1I1G A;  2EFN A;  5L3D A;  3G71 I;  1S6L A;  4HV5 A;  1ZG5 A;  1FBQ A;  2VUM J;  3CDL A;  2CH0 A;  2JQ7 A;  3KP5 A;  4I2O A;  1N75 A;  2TCT A;  1FYK A;  5D5W B;  3DEU A;  1UZC A;  4ZYE A;  1IAW A;  5A2Q Z;  4L18 B;  4PUS A;  2H09 A;  4LK0 F;  2HI3 A;  3RQI A;  4LGW A;  4XRF A;  2EFO A;  4A3D J;  1WQ2 A;  2FSW A;  2CW0 F;  4DIQ A;  2AQE A;  1RRJ A;  1ONV A;  4MO7 A;  3L2R A;  1ZHF A;  2L7M P;  2W82 A;  4X6A J;  1WRJ A;  2COB A;  1WGX A;  1R58 A;  1BR4 A;  3R0J A;  2WTE A;  3W6J B;  3IAM 2;  1XB4 A;  2V9V A;  1KU7 A;  3CCR I;  2DI3 A;  3LSK A;  1XGO A;  3NRV A;  2VJJ A;  2VBX A;  4Y17 A;  3W2A A;  4UHT A;  3F23 A;  2FXA A;  3FK6 A;  2V4J C;  4BHP A;  1DPU A;  2VQH A;  1Z3Y A;  4P9U A;  2WAF A;  4BJT A;  4J01 A;  2XSD C;  1ZGW A;  2OF7 A;  4XL9 A;  1DGR M;  2R7O A;  4N4O B;  5HS8 A;  1C0W A;  2O9L A;  1EH6 A;  2HVR A;  2L02 A;  1OJL A;  1EKE A;  1DPR A;  2A05 A;  1AHD P;  2DMQ A;  2OD5 A;  1HW2 A;  3ZXS A;  2V9P A;  1E3H A;  1JUS A;  3MZY A;  4HV6 A;  5A2Q K;  4ZTF A;  4KJZ A;  3KP3 A;  3E6D A;  2XVC A;  4PZJ A;  3D5S C;  2Q2E A;  1TNT A;  3OYM A;  3HTU A;  4OIR F;  2W48 A;  2TDX A;  2UV1 A;  5FFZ A;  2R7X A;  3CJR B;  3SFI A;  1K83 J;  4PJM A;  1XGS A;  4F55 A;  2OTJ I;  2O61 A;  5K7F A;  3GFI A;  1IN8 A;  2K27 A;  2EV5 A;  4GFB A;  1MH3 A;  1VI0 A;  5JI6 A;  2IAI A;  4GXO A;  4RGU A;  3PNY A;  5L3G A;  2A3S A;  2WBM A;  2VKE A;  3BP8 A;  2HR3 A;  2EWN A;  2GIZ A;  2HZD A;  1ZN2 A;  4ENN A;  5TRD A;  2W24 A;  3KCC A;  4C3J J;  4D0P A;  5IYB J;  1HLV A;  2K3P A;  3M7G A;  5EEH A;  1ODD A;  4B3X A;  1G2H A;  1OYW A;  1O3T A;  1ZQ3 P;  5CVI A;  1DGW Y;  2OV7 A;  2CQX A;  3QPT A;  4M9Z A;  1UAA A;  1GXQ A;  4L0Z B;  4EMS A;  4C9Y A;  3HB9 A;  2GXB A;  3JRA A;  2QKM B;  3BC8 A;  4ENJ A;  5D4R A;  5J1Y A;  1QPM A;  1KA8 A;  2DLL A;  5FD6 A;  3F9K A;  3HPH A;  5HLI A;  2VL8 A;  3R0A A;  4CDG A;  1XC5 A;  1TL8 A;  4MTE A;  4QIW N;  4XN3 A;  2R5Y A;  3LSG A;  1TWA J;  3CD6 I;  2L2O A;  3LSH A;  1O3Q A;  1R4M B;  1FMW A;  4HX4 A;  4A5N A;  2VLA A;  1FJL A;  2XDV A;  1YE9 A;  4JX4 A;  4DBQ A;  2CQN A;  3C18 A;  4UB8 C;  4BJ5 C;  4BU2 A;  1WWX A;  4YIF A;  1SFU A;  4QTR A;  2LKP A;  5B5E C;  3ERE D;  5F0C A;  2FJ1 A;  2CW7 A;  2BY1 A;  3V8J A;  4RB2 C;  3RTR A;  3BQZ A;  2W00 A;  3ZR8 X;  4E6K G;  2IJL A;  5HS9 A;  3H35 A;  1Y8R B;  1MJ9 A;  5ICG A;  3NAU A;  2MC3 A;  3I4M J;  5E17 F;  3HSF A;  1HOM A;  3E3V A;  1S7E A;  4XLC A;  4LG0 A;  3SQN A;  1QZY A;  2EIK H;  3AAF A;  3FXO A;  2DJI A;  4HW0 A;  4CUG A;  4I09 A;  2RRE A;  1ZRF A;  3L2U A;  5HOO A;  3HRS A;  3WTZ A;  2Y0M A;  3ZPL A;  2Y48 A;  2KIU A;  4HX8 A;  3ZOB A;  4C30 A;  2VAS A;  3B6C A;  5KVR A;  3FXQ A;  4B3A A;  3VYR B;  5LLQ A;  2R7R A;  2AXT C;  3TMO A;  2ISY A;  2KIQ A;  2F4M B;  4B48 A;  5AIQ A;  5LHG A;  3OS2 A;  1MBF A;  3AG3 H;  1SAN A;  3NQO A;  2DOD A;  4HST A;  3QP5 A;  2Z1D A;  3DEW A;  4KFC A;  3OOP A;  3E5Q A;  1Z6R A;  1P7I A;  2VON A;  1S9H A;  3M9A A;  1USS A;  3TGN A;  4RGS A;  2KPM A;  4RAY A;  5DCM B;  2GIV A;  1JT6 A;  2ZB9 A;  1W0U A;  3L2V A;  1O4X A;  2Q8K A;  4W97 A;  2RNG A;  2MBF A;  2EJR A;  2XKP A;  4YEL A;  2WC2 A;  3ABK H;  3GYH X;  4KT6 A;  3CLO A;  3K4L A;  2D1H A;  1WFX A;  4O5V A;  5LEK A;  2AQF A;  3KLO A;  2R4G A;  1I50 J;  5HS7 A;  2QKL B;  5GPA A;  4ENM A;  3H1C A;  5BMZ A;  1XDU A;  1TT0 A;  5HNH A;  4BAY A;  5F0H A;  4BAC A;  2CUE A;  2JVG A;  1ETQ A;  1FIP A;  3FMS A;  2G9W A;  4C3H J;  3FXJ A;  3GZ6 A;  3ECO A;  2LH9 A;  2PMU A;  4HSR A;  2R7Q A;  3DTE A;  3HJE A;  4MFD A;  5TJJ A;  3KYL A;  1MMD A;  4XLA A;  1QVU A;  2RVC A;  5L3C A;  1OPC A;  1X3W B;  2XPU A;  3S15 J;  1Z3X A;  4BE2 A;  2F5E A;  2ACJ A;  3H3V K;  1R5G A;  2LYC A;  1BI0 A;  3Q0V A;  1IDY A;  3ZN1 A;  1K79 A;  4ESJ A;  1TT5 B;  3K69 A;  2P5V A;  3PJR A;  3PQJ A;  2XIG A;  2LRE A;  1FOY A;  2EA4 A;  2BOL A;  3SJM A;  1YS6 A;  3I59 A;  5BOX A;  2IXS A;  2M3A A;  3F3X A;  2QSG X;  1D3Y A;  3HHG A;  4UUS A;  1PUE E;  1V3F A;  3OYN A;  2XC7 A;  4EJT A;  1BBY A;  1E3P A;  3BCB A;  1T33 A;  1LDJ A;  4KMU X;  4A3E J;  4B1R A;  3CDI A;  1VZ0 A;  3ASO H;  1X2M A;  4ANJ A;  2M4K A;  3KP6 A;  4AYB A;  2QQ9 A;  2QGU A;  2XAG A;  3H5N A;  1XGN A;  3ABU A;  5CQE A;  1TP4 A;  3PM1 A;  5BPI A;  1IV6 A;  4JP0 A;  1B4A A;  3NAR A;  1F9N A;  3MQ0 A;  1LUJ B;  1LDK B;  4E7L A;  2L7Z A;  1FBS A;  3K4N A;  4NHJ A;  2FML A;  1J7K A;  4ZZD A;  3OYD A;  2R7U A;  2ZJR F;  2CWE A;  2F2E A;  2JVH A;  4G6T B;  4RDU A;  3J7A Y;  2XF6 A;  1AWC A;  4BBR J;  5K5Q A;  1XSD A;  1UHM A;  1K78 A;  1QHH D;  1MZB A;  3JTG A;  1YOV B;  3K1P A;  2Z3Y A;  4P96 A;  5FKN A;  4D9J A;  3CJQ B;  2XGD A;  2VB6 A;  1XMA A;  2DA6 A;  5AON A;  1MW7 A;  1IRX A;  4R8H A;  3VWB A;  1IO2 A;  3HSR A;  3RSN A;  1LVA A;  4MTD A;  4AIK A;  2KIM A;  1U3E M;  4DZJ A;  2BY2 A;  3CME I;  1TWC J;  3CMM A;  4LG3 A;  1YYV A;  3OSF A;  4XR6 A;  4CCK A;  1BOA A;  5JLW A;  3HOT A;  1KGS A;  3WU0 A;  4OIQ F;  4BBS J;  3SEQ A;  2WAQ N;  1JKO C;  2A5Y B;  3MEX A;  5E18 F;  1ENH A;  5DM6 F;  1LQ1 A;  2E1C A;  5ED4 A;  5FJ8 J;  3HOY J;  4B44 A;  1ON1 A; 
#chains in the Genus database with same CATH homology
 3J7Y J;  3G71 I;  2K3F A;  3CJT B;  3PIO F;  1VQ8 I;  5GAD J;  2ZJP F;  2JQ7 A;  3CD6 I;  2E34 A;  4IOC F;  1QA6 A;  1VQO I;  1VQ5 I;  1S72 I;  1FOX A;  5GAE J;  5DM7 F;  3G4S I;  1ACI A;  1YJN I;  5GAH J;  3I56 I;  3CCL I;  3CC4 I;  3CJS B;  5GAG J;  1FOY A;  3J7Z I;  5JVG F;  1VQ4 I;  3CCE I;  4V19 K;  1MMS A;  3CCM I;  1YIJ I;  1VQN I;  3CCR I;  1YJW I;  3G6E I;  3CCJ I;  2E35 A;  3CCQ I;  1VQM I;  4IOA F;  1HC8 A;  2NXN B;  3CMA I;  1Y39 A;  1WIB A;  1VQK I;  2FOW A;  2H8W A;  2ZJQ F;  2ZJR F;  2QEX I;  2OTL I;  3PIP F;  3I55 I;  1YIT I;  3DLL F;  3CJR B;  1YI2 I;  2OTJ I;  3CF5 F;  4IO9 F;  3CJQ B;  1YHQ I;  4UY8 I;  2QA4 I;  1YJ9 I;  1VQL I;  1VQ7 I;  1VQ9 I;  3CC7 I;  3CME I;  3EGV B;  3CC2 I;  2E36 A;  3CCV I;  1FOW A;  1VQP I;  5DM6 F;  1VQ6 I;  3CCU I;  3CCS I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...