2Z33A

Solution structure of the dna complex of phob dna-binding/transactivation domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*GP*TP*CP*AP*TP*AP*AP*AP*TP*CP*TP*GP*T)-3'
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2z33A00
4GYGA 3KLOA 4MHGA 5FB2A 3I59A 2Z33A 1LDDA 1IF1A 1U2WA 4OMZA 5J8FA 3WTWC 2M45A 4HQEA 1Z05A 3WGGA 1YG2A 4RB0A 2YPRA 1A04A 4EM1A 4WXDA 1G3WA 2M1BA 2MLKA 1XDUA 1KYWA 3SXYA 1PDNC 1DP7P 3HSEA 3CUQC 3KZZA 2XKPA 3V8KA 2UWMA 3OV8A 1R22A 4FT8A 3GVAA 2V1UA 3GZ5A 4EV0A 3IRRA 3KP5A 1XSDA 3TDZC 3JSPA 5FGMA 4LLLA 2VBXA 2GQQA 2CFXA 1HXDA 2VE9A 3ZPLA 3BPVA 1U8RA 2G9WA 3O2PE 5K5OA 3FMRA 3GZ6A 3BP8A 2A6EF 4I7HA 2VOPA 3SQNA 2O3FA 3QP6A 4XBFA 2FNAA 4HF0A 1S7AA 4G6DA 4HF1A 1ZRDA 2YX7A 3EDPA 5DCMB 2WWYA 1DPUA 1R1UA 1CF7A 3F8BA 2IPQX 1XCVA 3V7RA 1WQ2A 3HIFA 4YFKF 3ZMTA 1BBYA 1OYWA 4RB1A 2LNBA 4WXHA 5D5VB 1YQAA 4EJUA 2K7LA 3KZYA 5CYVA 2E7XA 3LA7A 4NQWA 5KK1A 1ZGAA 3REOA 1VTNC 2E7WA 5HLIA 2P8TA 2DT5A 3HUGA 1FZPB 5L3FA 3E6BA 5CVIA 2OBPA 5LBQA 5DUIA 5CVJA 1E17A 4IRHA 3ECOA 3U1DA 2QUFA 1IN6A 3GFIA 3ZMVA 1LEAA 2A6HF 3BWGA 1TNSA 2F5FA 1R1VA 2D2WA 3DV8A 1ZHFA 5E18F 3D0SA 4I98B 1IN8A 4KMUX 4H0EA 2HDCA 1J5YA 2HKXA 3C18A 1W4MA 4OU0A 4MQ9F 3ABUA 3BPXA 1P6RA 4UV9A 5TRDA 4EM0B 3WE3A 3SZTA 2IJLA 2ZMEA 5E8IA 3JAMK 4E70A 3I53A 1X3UA 2LDUA 3BDDA 3ZMDA 1SFUA 1ZLKA 4MNUA 2L01A 3QP5A 3I71A 1XDSA 3W6JB 4JQFA 2HWVA 2ESNA 2ZXJA 1H9TA 2EV5A 3I58A 4L5IA 4U7DA 3WG9A 4CICA 1YLFA 2QZ8A 2XIGA 2MD5A 2OQGA 5HLGA 2EB7A 4UUVA 3B02A 2E1NA 1U6GA 4KN7X 2ZBKA 2FEZA 1KQ8A 3AAFA 1W7PB 4Q5SF 2GXGA 4KN4X 2EFQA 4MGRA 1ONVA 5D4RA 2KIMA 3GX4X 1FLIA 4M6YA 4BH9A 3NRVA 4KA4A 4GGGA 2L3DA 3M7GA 1TQIA 3BY6A 5L3EA 4G6QA 2C6YA 3F72A 1LDKB 2PMHA 5DDGA 5HLHA 5LGTA 3M9AA 3V7CA 1J59A 3M1EA 3RDIA 3W6KB 2L4AA 3D5LA 3ULQB 5LEJA 5LEKA 2A61A 4LD5A 3JW4A 3KCCA 1Z1DA 1AWCA 5K5RA 4YFNF 4I0AA 3L09A 5CJ9A 2VE8A 3HSRA 5FD5A 1HQCA 4ENKA 2XRNA 2PG4A 1T2KA 2ZNZA 4U88A 2QM3A 2ZMEB 3V8LA 1WWXA 4PGHA 4UVBA 3IWZA 2V1XA 4M73A 4GCVA 4LK1F 2JTVA 2QWWA 1UHMA 1YFHA 4MTEA 1REPC 2VC1A 1IUYA 5FFZA 1UFMA 2BEOA 4RGUA 1XB4A 5F1RA 2HZTA 2EV0A 3GLXA 3KFWX 5DEQA 4N9HA 3TQNA 1EH8A 4IRIA 5DYMA 4RGXA 1RUOA 3SHFA 4RGSA 4WXCA 4OIRF 4HF2A 1O3RA 4I02A 1ULYA 3K1PA 1BN5A 3KEQA 3J80Z 4RB3C 4R1HA 2ISZA 2ETHA 4ZZDA 2XAHA 5CVUA 2K4JA 2ZJ2A 2A07F 1AOYA 3HRUA 4AIHA 2FSWA 2G7UA 2LKPA 5HDNA 4BHCA 2EA4A 1SD5A 3WTSC 1UCRA 1RI7A 5A2QK 1RNLA 1I27A 3H3ZA 4HX8A 1V4RA 2H94A 5L3CA 1FT9A 1BJAA 1W5TA 3COAC 1ZREA 4LLNA 3B73A 1P4XA 4XSXF 4UXNA 1R1TA 3FXQA 3GXOA 3R0JA 1FX7A 4HDVA 3V4GA 4EM2A 5BOXA 3TOBA 3ZMZA 3DXJF 2CW0F 1BI0A 2NNYA 3OOPA 4OINF 3GFMA 2DAOA 3HHHA 4UVCA 3GEZA 1DPRA 3BJOA 2VBZA 4P9UA 3K69A 1SFXA 3I0TA 1S3JA 3TO6A 4EMSA 4BXUA 1XGMA 2VODA 4PCQA 3J81K 1XGNA 3ZP5A 5LHHA 4IVNA 2XASA 3HOTA 1YIOA 3MZHA 3N4MA 1FYMA 3WTYC 3RIRA 2X0LA 5AIQA 5ICCA 3CUOA 3WTXC 1H9GA 2H09A 1Z9CA 1MJBA 3ROUA 3O3KA 2OD5A 5FO5A 1FBSA 4NHJA 4UVAA 3RI4A 1I1GA 1WRJA 1Z91A 2NS0A 1KU7A 3HTUA 5E1WA 4U0YA 1YS6A 4KUMA 1OYIA 2NYXA 1TQPA 4WF2A 4EVIA 4G7HF 3EQLF 4L9JA 2QQ9A 4N9IA 4CXFA 4ASNA 1LEBA 4YFXF 5LRSA 5E17F 2HTSA 1O57A 3DP7A 4P55A 4A6DA 1HKSA 5TJJA 4HLXA 1JHFA 5AONA 3HRMA 1T0FA 4KNYA 1O3TA 1CGPA 2Y48A 2STWA 2F5EA 3QU3A 5JI6A 3F6OA 4G8XA 5ILUA 2ZO4A 3RPQA 2V6CA 3NEUA 3NQOA 2OAZA 2YSRA 3FXRA 2M5WA 1J9IA 2P6SA 5D6EA 2XUBA 4O6JA 4L18B 1U5TC 2VT2A 2W57A 2GWRA 3EYYA 3Q9SA 3R6SA 2DPUA 1S6LA 4Y13A 4M71A 4A2UA 3LAPA 2MA3A 2MH2A 1P4WA 2Q2EA 5HS7A 4M74A 1SD7A 4HA8A 3T5XA 4ZYEA 4OMYA 2IA1A 3LQQA 1HSJA 2KIUA 4OOIA 1K78B 3FF5A 3TDUC 1SMYF 1IXRC 1YYVA 3K9TA 2D45A 2IT0A 2R7FA 2K86A 2EFNA 1C0WA 4EJWA 5HS8A 1F1ZA 3M8FA 4L9NA 2P7VB 1B9NA 1ZAOA 2ZKZA 4MEYF 3F3XA 5D5UB 2GAUA 3FHZA 1HKQA 4F7ZA 1OR7A 3CO6C 1B9MA 1FWZA 2JT1A 3KEOA 4ENNA 2IP2A 4QLCU 4YG2F 3QOPA 1TW3A 3R0AA 2RGVA 2XAGA 2DW4A 1L3LA 3U2RA 3VEPA 2VOOA 3I5UA 4L0YB 5BPIA 1SAXA 2JPBA 4P5OA 3P9IA 1HW5A 1I5ZA 2HGCA 4L9TA 1BC8C 1K6OA 5LHGA 4HAMA 1MDMA 4HX4A 1MZBA 2WC2A 3DFGA 2EJRA 4HBLA 4EJTA 2EFOA 4AIKA 4PZJA 3V8JA 2GA2A 4CO8A 4Y17A 3FXUA 4B8XA 1FYLA 2F2EA 4CDGA 4UHTA 5BMZA 1TTYA 5LRRA 3HHGA 3Q9VA 2HTJA 2L4MA 1B4AA 1MKMA 2HYGD 4BNCA 1LB2A 3WTZA 2XAFA 2HQNA 2MBFA 2PMUA 2VC0A 3MZYA 4M9ZA 3F8MA 2DU9A 2CO5A 3WTVC 4M9XA 1R00A 3CLOA 2UZKA 4BYYA 1I1SA 4GXOA 5LGNA 3ABTA 1R36A 3KP7A 1R23A 1K7AA 4AIJA 2QQBA 5ED4A 1DDNA 2PI0A 1IN5A 1EV7A 3FMSA 4EGZA 5L3BA 2KJBA 3IKVA 4U7BA 4U0WA 1OYYA 2OQRA 4L9VA 1J0RA 2TDXA 1MJAA 1IW7F 1PUEE 3FZVA 1SD6A 1FC3A 3R60A 4BHBA 1WI9A 1HW2A 4IPAA 4ZYDA 4DNCA 2ZFWA 2HQRA 1BC7C 4KDPA 2VBWA 2P7CB 2D1VA 2QQAA 3M8EA 4KICA 4XRFA 1B6AA 3CUQA 4TV7A 5D5WB 1STZA 5HS9A 2CG4A 2STTA 3JSOA 4A6EA 4QWQA 1Z6TA 1NHAA 5J6XA 3V7SA 3DF8A 3ZN1A 4R79A 2W84A 4A12A 2UXXA 1FSHA 2KJCA 3N97A 4L5JA 4HX7A 5A2QZ 4ZZLA 4MTDA 1SMTA 2EFWA 1Z6RA 3C1DA 1ZH5A 1D8JA 4LG0A 4MEXF 4K2EA 1MD0A 2ESHA 3CTAA 3GFJA 1S29A 2DQRA 3GFLA 2P4WA 5D6FA 5K1YA 4WX9A 4Y15A 2FE3A 3E3VA 1D8KA 4EQQA 3FWEA 5LHIA 1ZG1A 2NAZA 1Z7UA 1G6NA 4G7ZF 2RKHA 1GHCA 4NB5A 2DLLA 2QLZA 4WK8F 1BI3A 2L54A 4IRGA 4KFCA 1GXQA 2H6BA 2FF4A 1KQ9A 2ACJA 2M87A 1MJ9A 2O0YA 5DV5A 4G7OF 1RUNA 3RYRA 1EH6A 2H6CA 4A0YA 2XKOA 3RPUA 1Q1HA 2F5CA 4IHSA 3L00A 3WGIA 2BYVE 2P5VA 3T0YA 4JK1X 3I59B 1F4KA 4U0VA 5F64A 3JTHA 3P9CA 2GXBA 3ZN0A 4OIQF 2GA1A 5IT3A 2Z99A 4A5NA 2IA2A 3WU0A 1O7FA 5CLSA 4IJAA 1MGTA 1WSUA 2R3SA 3CUQB 2P5LC 3E97A 2O61A 2QYOA 2NNNA 3BZ6A 2A68F 3E6MA 3I4PA 3FM5A 2P5KA 1O7LA 2W24A 1HSTA 5BS6A 4O3MA 1KU9A 2ELHA 1PP7U 2HYFA 1B59A 4I0BA 2K4BA 1OPCA 2V79A 3L7WA 1KGSA 1S8NA 4Z2YA 1FBUA 4LG0B 1ZRCA 4FX4A 2CSOA 4KYWA 4LK0F 1KU2A 4HYEA 2DI3A 5JHUA 2J5OA 4LGWA 5BQTA 1W7PA 3KE2A 3ISPA 4HZFA 5DCMA 3WU1B 1L0OC 3HSFA 1I6XA 4I01A 2LSOA 5IT9K 1IRGA 2Z5UA 2DQLA 2HKOA 1JXSA 3J7AO 2J5PA 4CZZA 1ZYRF 2FBKA 1T38A 3WTTC 2DTRA 2O8XA 4A0XA 2P6TA 2E1CA 1TNTA 3ZMUA 3L2CA 4HW0A 3J81Z 4YIIA 3SFZA 3T8RA 3ZQ7A 3K1MA 3KETA 2K02A 2FBHA 1F9NA 2JZYA 4A0ZA 2DO7A 4AVPA 3GUDA 2F5DA 2Y0MA 3E6CC 1BI1A 3MQ0A 1IZ1A 1QO0D 5HVQC 3IRQA 3L9FA 4KIGA 2BE5F 1JE8A 1KU3A 2EK5A 3K0LA 4AWXB 4DQ2A 1IAWA 4BAYA 4S05A 4RS8A 3DQVC 3QPTA 4ESBA 4HOBA 3RJPA 5D4SA 2Q0OA 2PJPA 1TBXA 5F6FA 4ZH4F 1XGOA 1IXCA 2H27A 3LQRA 1OMIA 1IN4A 2FOKA 2EA2A 2CQKA 3EETA 1LVAA 2WV0A 1XN7A 1K79A 1D3YA 4ENMA 1T6SA 1ZRFA 2L02A 2EWNA 2Z3YA 1IXSB 2EV6A 3MAJA 1TQMA 4KT5C 4UV8A 3MCZA 5CVVA 4BHPA 3WE2A 2MC3A 2JPCA 1YTYA 1FY7A 2KRFA 5LGUA 1KQ0A 1YW7A 3LWFA 3J80K 5HDKA 4YIFA 3QPHA 2HOEA 2FA5A 3O6BB 1UHWA 5FLXK 1BOAA 4L0ZB 3FX3A 1QZYA 4UNOA 2QVOA 4LMYA 1FSEA 2MH9A 4P96A 6PAXA 3TO9A 5E1XA 1MDMB 2GIVA 1U5TA 5EEGA 1OKRA 3RKXA 4I09A 1JHHA 4CYDA 4R8HA 3U9GA 4XLNF 4D0PA 3QRFF 4M6XA 1USSA 3R4KA 5CVRA 1GXPA 3HRSA 4BQAA 2FBIA 1P2FA 3LSTA 3TO7A 2AS5F 1ODDA 1SFEA 3FM3A 1FBQA 4GO1A 3Q5FA 2CGPA 2QBYA 1XMKA 3EUHA 2FMYA 2QBYB 1YS7A 2CYYA 4CHUA 1Y0UA 3C3WA 3KP6A 5DD4A 1XMAA 4RAYA 3ZMSA 5ILVA 1G4DA 3KP2A 4IHTA 1R58A 2Y75A 3KP3A 1G3TA 5DUKA 3PQJA 1FYKA 1P92A 2XV4S 2A69F 1IN7A 2W25A 1WKMA 1PP8F 4ENJA 3VODA 3I54A 2JSCA 3LA2A 1ZG3A 5EEHA 5E1ZB 3GWZA 4EJOA 3H92A 3E5UA 2YX4A 4ESFA 5DD8A 3F8NA 3C7JA 2IW5A 1U5TB 2RDPA 2DFIA 2PEXA 1U3EM 2HR3A 2AXLA 2O6GE 2M8EA 3WTUC 3BJAA 3F6VA 2W85A 3IWFA 5DCFA 2BV6A 2PFBA 1O3QA 5D8KB 1ZLJA 2FMLA 3SZPA 4S04A 2PN6A 2VN2A 3F22A 4OIOF 2XAJA 4PGGA 4RGRA 4ESJA 2M30A 3H3UA 3QAHA 4EJVA 2A5YB 2VT3A 4M72A 4WWCA 3CJNA 4KIBA 4G94A 3ECHA 3GO5A 4XLPF 2VONA 4FHTA 1ON1A 3GYHX 4Q47A 1FNNA 4CGZA 3HRTA 2PQ8A 2PLYA 3F21A 1ZGJA 4N0BA 1EH7A 3JAMZ 3DPTA 3BJ6A 2V9VA 2BBYA 2OU2A 1P4AA 1O3SA 4A5MA 3LFKA 4O5VA 3TGNA 1LDJA 1K78A 3DPLC 3TKYA 3BOQA 1W5SA 1FP2A 2PBIA 4IF4A 3TOAA 4G9YA 1QGPA 1RZ4A 3HOSA 3PQKA 3BROA 3F8FA 2WTEA 3F8CA 2FRHA 2RNJA 5ILSA 2R7DA 5IT9Z 2DK8A 4HQMA 2RC4A 3F23A 1S7OA 2K27A 4HLYA 3CO7C 3RTRA 1XCBA 4WCGA 2CWEA 2JRTA 2COMA 3KP4A 3R61A 2XGXA 5H6QA 2Q8KA 1DUXC 3I64A 1KYZA 4KIFA 4JBAA 3PFIA 4Q4ZF 4GYIA 3RYPA 4M9SA 4IXAA 1QBJA 5JR3A 2RN7A 5H6RA 3P7NA 2EFPA 1R7JA 2XHKA 3IKTA 4LFUA 2OZUA 3ML6A 4LJZF 5D8LB 4I2OA 4B09A 1W7PD 1HKTA 5E8GA 1UB9A 3LAJA 4PDKA 4LB5A 1B1BA 1FP1D 2ADUA 3RKYA 3EYIA 1SD4A 1J75A 1J2XA 2FXAA 3T8TA 3K2ZA 2RVCA 3WODF 1ZN2A 1XSXA 3IHUA 1G3YA 1KA8A 1RIOH 5L3DA 3IL2A 2V1DA 2XVCA 1D5VA 3E6DA 5JFRA 1BIAA 3E5QA 3T1BA 2B0LA 1BI2A 5BPDA 1XGSA 3G73A 3G3ZA 1G3SA 4EGYA 2MLGA 4LB6B 3MFKA 1HW1A 2OA4A 1IRFA 5KVRA 2HFHA 5FD6A 2LF8A 3K1NA 3WGHA 2VBYA 3DKWA 1BIBA 2IVMA 1YW8A 3LA3A 2DBBA 2XROA 3GW2A 1E2XA 1J7KA 3QU6A 5FFXA 2LF7A 3S2WA 1T98A 4HV5A 4LLGF 1V3FA 5AIPA 2FNPA 5D5XB 4XSZF 5H20A 1GVJA 1TLHB 3ELKA 5HOOA 4Q48A 5L3GA 3HTSB 1JGSA 1YW9A 2KIFA 1LNWA 4HV6A 3DEUA 3JTGA 2O03A 2G7HA 3GF2A 4RAZA 4ZYHA 3VFZA 5LLQA 2GZWA 1R5GA 4OIPF 4MQVA 1R5HA 2VXZA 5HDGA 5E20A 1QZZA 3FMQA 1FOKA 2Z9OA 1ZG5A 1T39A 2DPDA 4P9FA 1TW2A 5ICFA 4ZYGA 5FLXZ 1ON2A 2D1HA 5ICGA 1FPQA 3MWMA 3IC7A 4HDUA 5JVTA 2HS5A 2BGCA 2HEOA 2KKOA 2YR2A 2YU3A 3CDHA 2ZCWA 1H0MA 1XSVA 2RV8A 3HYIA 5ICEA 3VOEA 2NRAC 4AD9A 2IRFG 2ISYA 1USTA 3VB2A 2ZNYA 3KLNA 2A3SA 2RQPA 1XD7A 1QNTA 3P9KA 4RB2C 4FX0A 1LQ1A 1ZARA 4KMFA 4ETSA 1U78A 2FQ3A 1YO5C 2OZ6A 1LJ9A 3E5XA 2IA0A 4ON0A 2QENA 1HBXG 2FU4A 3RKWA 5J8CA 2XAQA 1QQIA 2X4HA 2UXNA 1BM9A 1CF7B 2DK5A 5ERIA 3MEXA 1QPMA 1F5TA 3ERED 5K5QA
chains in the Genus database with same CATH superfamily
4GYGA 3KLOA 4MHGA 5FB2A 3I59A 1D1BA 3RZOJ 1BW6A 3EUKL 1SANA 2ZFUA 2VXDA 1HF0A 1MBFA 2QSGX 3FXKA 2Z33A 2G0EA 3CCEI 1LDDA 1IF1A 1U2WA 4OMZA 5J8FA 2ELJA 3WTWC 2M45A 1MMNA 3PUBA 4HQEA 1Z05A 3WGGA 1YG2A 3OYKA 1TZLA 4RB0A 2DTZA 4OWRB 2YPRA 1A04A 3W2VA 2VKHA 3ZXSA 4EM1A 3OOUA 4WXDA 4C9YA 5C4JJ 1G3WA 2M1BA 2MLKA 1XS9A 2HDWA 1XDUA 1VQMI 1KYWA 1VQ9I 4BJ5C 3QYEA 3SXYA 1PDNC 3HUGB 1DP7P 3FKIJ 1ETXA 4ZDLA 2ID3A 3HSEA 3CUQC 3KZZA 2XKPA 4D5FA 2EZLA 2K9SA 3V8KA 3L2QA 2UWMA 4NC6A 2KHMA 3OV8A 1R22A 4FT8A 2E34A 3GVAA 2HVSA 2V1UA 3SJMA 2E71A 3GZ5A 3FDYA 1VQ6I 4EV0A 3IRRA 3KP5A 1XSDA 4X0GA 1P9QC 4MFEA 3TDZC 3JSPA 2GOXB 5FGMA 4LLLA 3CCUI 2VBXA 1BW5A 2GQQA 4CZCA 2CFXA 4AC0A 1HXDA 2VE9A 3ZPLA 4B3AA 2DFEA 3BPVA 1F43A 3DBHB 1U8RA 2G9WA 3O2PE 3LSGA 3HC7A 5K5OA 3FMRA 3GZ6A 1V5GA 1CQTA 3BP8A 1ZR2A 2A6EF 1POGA 1X3ZB 4I7HA 2VOPA 3SQNA 2O3FA 3QP6A 2LD5A 4XBFA 2FNAA 4HF0A 2HYJA 1S7AA 4X1EA 1WGXA 2EINH 2XB5A 3FXLA 2QGUA 1X2NA 4G6DA 1D0ZA 4ABZA 4AVZA 4YRVA 4HF1A 3DKYA 1ZRDA 2LKXA 2JN6A 1KZHA 2LBFA 1QVUA 1WJCA 2YX7A 3EDPA 5DCMB 1X1AA 2R5ZA 1DU6A 2WWYA 1DPUA 2L7FP 1R1UA 4DIQA 1CF7A 3F8BA 1PJRA 3I56I 1D1AA 2IPQX 4B47A 1Q1VA 1OCZH 1XCVA 2DA3A 2M9HA 3JR9A 1JJ8C 1QHHD 1WQ2A 2IGMA 3HIFA 3V7RA 4YFKF 3ZMTA 1OCOH 2ECBA 1Z0XA 5F0FA 1BBYA 4C2UA 1OYWA 2DODA 4RB1A 2LNBA 4WXHA 5D5VB 4BDZA 1QA6A 1YQAA 1A35A 4EJUA 2A05A 9ANTA 4D5CA 2K7LA 3CC4I 3KZYA 2LMDA 5CYVA 2E7XA 1ZK8A 3LA7A 4NQWA 1Z3XA 5KK1A 4XRSA 1ZGAA 5LFAA 3REOA 1VTNC 2E7WA 5HLIA 3LSRA 2P8TA 3PFYA 2AXTC 2DT5A 3HUGA 3OYDA 3BR1A 2JA5J 2E2IJ 4IKFA 3S2DJ 1FZPB 5L3FA 1BR1A 3P5JA 4A3FJ 1T56A 3E6BA 5CVIA 2OBPA 4HPQA 3H9QA 5LBQA 5DUIA 5CVJA 3PNYA 1A31A 3ASNH 4IRHA 1GV2A 1E17A 3BLYA 2O9LA 3ECOA 3U1DA 4HNTA 1PUFB 2QUFA 1IN6A 4PK4A 1E3HA 3GFIA 3ZMVA 1LEAA 3G1OA 1YX5A 2A6HF 3BWGA 1TNSA 2F5FA 2LC2A 2Y30A 4XMYA 4A3EJ 1IDYA 1R1VA 4PFPA 2D2WA 3DV8A 1EF4A 3W3CA 1ZHFA 1R9TJ 4L5EA 2IS2A 2GM4A 5E18F 2BVMA 3D0SA 2BZTA 3GTOJ 4I98B 1IN8A 2MW8A 3BR0A 4KMUX 2Y0SA 5J1YA 1YHQI 4H0EA 1TT5B 2ELKA 1LUJB 2N8GA 2HDCA 3FXMA 4FTHA 1J5YA 2HKXA 4HNUA 2WY7Q 5FKMA 3Q0UA 3C18A 4RDUA 4ZJZA 1W4MA 4OU0A 4MQ9F 3ABUA 3BPXA 2E1MC 3IAM2 2PMZN 1P6RA 1YITI 4UV9A 5TRDA 4EM0B 3GCMA 2DFHA 3WE3A 3SZTA 2RREA 2IJLA 2ZMEA 5E8IA 2CUFA 3JAMK 2QCOA 4DGWB 4E70A 5FKKA 3I53A 2WBMA 3RSNA 1X3UA 2LDUA 1W0TA 3VSLA 3BDDA 4XIDA 3ZMDA 1SFUA 2KFDA 1ZLKA 4MNUA 2WV1A 3PL8A 2L01A 3QP5A 3HOYJ 3I71A 2Y31A 1XDSA 3W6JB 3ZGKA 4JQFA 3LSJA 2HWVA 3S93A 2KMUA 2ESNA 2ZXJA 3A03A 4QPOA 1H8AC 1H9TA 2EV5A 3GTLJ 3I58A 4L5IA 3OSFA 4F92B 3WG9A 4U7DA 3K70D 3PNVA 5E3LA 4CICA 1YLFA 4QIWN 2QZ8A 2XIGA 2MD5A 3H0GJ 3PJRA 2OQGA 4CCOA 4GRIA 5HLGA 2EB7A 4UUVA 3B02A 2E1NA 2K9MA 1EA3A 2XC7A 4HRIA 1MBGA 1U6GA 3OIQA 3A01A 2MFZA 4KN7X 1XC5A 2ZBKA 2FEZA 1KQ8A 2EQRA 2RAEA 3AAFA 1W7PB 4Q5SF 2MGQA 2GXGA 4KN4X 3QQAA 2EFQA 4MGRA 1OCPA 3J7YJ 1HLVA 4XLCA 1ONVA 5D4RA 2KIMA 3GX4X 4FISA 1FLIA 2E5NA 4M6YA 4BH9A 3NRVA 5FROA 1V55H 4KA4A 4GGGA 2L3DA 3M7GA 1TQIA 1ZQ3P 3BY6A 5L3EA 4CYCA 1Y0NA 4G6QA 3G1LA 2C6YA 3F72A 2X51A 1LDKB 4CCJA 2PMHA 1S9HA 4CYCB 5DDGA 5HLHA 2FD5A 2LK2A 5LGTA 2BHZA 3M9AA 3V7CA 4ZTJA 3VYTB 3DBRB 2IS1A 1J59A 3M1EA 1LKXA 2JA6J 1NH3A 3RDIA 3W6KB 2L4AA 2CV0A 3CDIA 3D5LA 1S7EA 4NQWB 3DTEA 2VPRA 3ULQB 5CPRB 3ZOBA 2A61A 4LD5A 5LEJA 5LEKA 3JW4A 3KCCA 1A6IA 1Z1DA 1AWCA 5K5RA 2CW8A 3OMYA 4YFNF 4I0AA 3L09A 5CJ9A 2H8RA 3HOXJ 3KEYA 3IUOA 3LSHA 4PJNA 2X6YA 4XN0A 4BQQA 2X6XA 2VE8A 3UNGC 3HSRA 1VQOI 5FD5A 1IRZA 1HQCA 1DGRM 4ENKA 2XGEA 1SEUA 1FOWA 2CJJA 2XRNA 1JUPA 2PG4A 4LG3A 2XRLA 1T2KA 4DZPA 2ZSHB 2ZNZA 1AU7A 1G8XA 4U88A 2QM3A 2ZMEB 1R4NB 3V8LA 3JRDA 3PO3J 1ZELA 1WWXA 2NXNB 2LR8A 4PGHA 2DXIA 1UG0A 2Z2SB 1MW7A 1K61A 2CUJA 4UVBA 2KZGA 3IWZA 1X1BA 2V1XA 4M73A 4GCVA 2MG4A 2QSHX 4LK1F 2F4IA 2FOWA 2JTVA 2QWWA 1UHMA 1YFHA 2DA5A 4MTEA 1OISA 1XMXA 1T08B 3S1NJ 1REPC 2F4MB 2EIMH 1ETVA 2VC1A 4RAFA 5F08A 5KHDA 2W7NA 2R5YB 5E79C 1IUYA 2V9KA 5FFZA 1UFMA 2BEOA 4RGUA 1WZ2A 1G2HA 1MIJA 1XB4A 2KRHA 5F1RA 2HZTA 3C2HA 2EV0A 1YI2I 3GLXA 4B44A 3KFWX 5DEQA 4IX7A 4N9HA 3RPUD 2R7XA 3TQNA 5EF6A 1MMSA 1EH8A 2LFBA 3AG4H 4IRIA 5EJCA 5DYMA 4RGXA 1RUOA 3SHFA 4RGSA 1IV6A 4WXCA 1RPWA 4OIRF 1IUFA 1K4SA 4HF2A 1O3RA 3RZDJ 4I02A 1ULYA 3K1PA 2WAQN 2VI6A 3BTIA 1MNEA 3Q0WA 3KIOA 5TISC 3D5RC 1BN5A 3KEQA 3J80Z 4RB3C 4R1HA 2EZHA 2ETHA 2ISZA 4ZZDA 3K2AA 1WFXA 1T33A 2XAHA 3S8PA 4XK4A 3FBIB 5CVUA 2GXAA 1ZR4A 2DJIA 2K4JA 2ZJ2A 3GTPJ 2A07F 1AOYA 2CS3A 3HRUA 3K6GA 4I76A 1NG6A 2FSWA 2G7UA 3K10A 3LSIA 3K4MA 4AIHA 2LKPA 3GTJJ 1W36D 1SFOJ 3OYGA 5HDNA 4UB6C 3D1NI 3CCLI 1X19A 3AFHA 4ZDPA 3L1PA 4BHCA 2V6EA 3MKWB 2EA4A 1SD5A 4PJJA 3A0HC 2M7AA 3TP0A 3WTSC 4A3MJ 1WCMJ 1T0FC 1UCRA 1RI7A 5A2QK 1RNLA 1I27A 3H3ZA 2IEKA 4HX8A 1V4RA 2DA4A 3DU5A 2H94A 5L3CA 1FT9A 2KDOA 1BJAA 1W5TA 3COAC 1SAUA 5C44J 1FTZA 1ZREA 2NS7A 4LLNA 3B73A 1P4XA 1P7IA 2K5CA 2XF7A 4XSXF 5FRNA 3ESWB 4UXNA 3JCUC 1R1TA 3FXQA 3GXOA 1Y6IA 1FX7A 3MZ8A 3R0JA 4HDVA 3V4GA 3FIWA 2CRGA 2XGCA 3NWTA 2BW3A 4EM2A 5BOXA 1YJ9I 2BY1A 4IL6C 3TOBA 3ZMZA 2M8GX 1MSFC 2LYCA 3DXJF 2CW0F 1BI0A 2DJNA 2NNYA 3OOPA 4F91B 3WU2C 4OINF 3S16J 3GFMA 4DJAA 2DAOA 2W4SA 3HHHA 5M3FJ 4UUSB 4UVCA 3GEZA 5K7ZA 1DPRA 1HDDC 4II2A 4IHYA 1I39A 3H9GA 1VQ8I 3BJOA 1QVTA 2LP0A 2VBZA 2TRTA 3FXOA 5TGTA 4P9UA 3K69A 1SFXA 3K4CA 1IG7A 3I0TA 2WAQA 1S3JA 3TO6A 1Z77A 4EMSA 3GTKJ 3UR3C 4BXUA 1PYVA 1XGMA 5CQGA 2NVXJ 2VODA 4PCQA 3ABMH 5J4YA 3J81K 1XGNA 3ZP5A 2XGDA 4YELA 3PIOF 1TWAJ 3QYFA 2HU9A 5LHHA 4F52A 4NDLA 4IOAF 4IVNA 1DP3A 1BR4A 1FMWA 2XASA 3BQZA 3HOTA 1YIOA 3MZHA 1JT6A 2HNHA 1TT0A 2ZJQF 3N4MA 2UV1A 1YIJI 1FYMA 4I99C 1VQ5I 4Y3OA 4C3JJ 2JK3A 3WTYC 4J19A 1ORKA 1V54H 3RIRA 1ETWA 2X0LA 1R4MB 5AIQA 1UJ8A 5ICCA 3CUOA 3WTXC 1H9GA 1OLTA 3BZCA 2H09A 1Z9CA 1MJBA 3ROUA 2X48A 3TW7A 3S1RJ 3CP2A 3O3KA 2OD5A 5FO5A 1FBSA 4JX6A 4NHJA 4UVAA 3CLQA 1B8IB 2HXOA 3RI4A 1M1EB 1I1GA 1WI3A 1WRJA 3TW6A 1Z91A 2NS0A 1KU7A 3VWBA 3HG9A 1I6HJ 3HTUA 5E1WA 4V2GA 4U0YA 1YS6A 3VPRA 1V5EA 3S32A 4KUMA 1OYIA 2NYXA 1TQPA 4WF2A 4EVIA 5J1RA 4G7HF 3EQLF 3L2VA 4V19K 3BG3A 4HSRA 4L9JA 2AO9A 2E2HJ 2QQ9A 4N9IA 4CXFA 3OS2A 4ASNA 5J47A 1LEBA 4YFXF 5LRSA 4AYBN 5E17F 2HTSA 1O57A 3DP7A 2KISA 4P55A 4A6DA 4HNVA 2M4GA 1HKSA 5TJJA 3ZR8X 4XKVA 1TWCJ 4HLXA 1JHFA 5AONA 4C3IJ 3CESA 3HRMA 1I50J 1T0FA 4KNYA 1O3TA 2K3PA 1CGPA 2Y48A 3I3LA 2F5EA 2HI3A 2STWA 3QU3A 5JI6A 3F6OA 4G8XA 5ILUA 2ZO4A 3RPQA 2V6CA 1FJLA 3NEUA 3NQOA 2OAZA 2VKDA 3S1QJ 2YSRA 1XPXA 3OIPA 2DN0A 2E36A 3FXRA 2JQ7A 3FK7A 3ZQCA 2M5WA 1J9IA 2W48A 2P6SA 5D6EA 4BUPA 3HOWJ 2XUBA 2DMUA 3FBNB 4DYQA 4O6JA 4L18B 1U5TC 4BXXJ 2ZXWH 3DLLF 3OSGA 1K4TA 2VQGA 2LREA 2VT2A 2W57A 2OTLI 2GWRA 3EYYA 5IPAA 3LSPA 1MMAA 1GV5A 4MLOA 5J3LA 2X6OA 3Q9SA 3R6SA 1FTTA 2DFFA 4NC8A 2DPUA 1S6LA 4F93B 2E2JJ 4Y13A 2OPTA 4M71A 4A2UA 2OUMA 3I9V2 2M4KA 3LAPA 1Y1WJ 4XKCA 2MA3A 4M3DA 1E3OC 2MH2A 1P4WA 2Q2EA 3UKGA 1MNMC 5HS7A 3W6VA 4M74A 1SD7A 4HA8A 3T5XA 1FIAA 4ZYEA 4OMYA 4C2TA 2IA1A 4NC7A 3PO2J 2DYSH 3LQQA 3ERMA 3S17J 1HSJA 2KIUA 4OOIA 4Y33A 1K78B 3FF5A 1VFCA 2VPLA 3TDUC 1SMYF 1VNDA 2NOJB 2R5ZB 4AUXA 1IXRC 1YYVA 4PJMA 3K9TA 3HB9A 2D45A 2E60A 2IT0A 2L7KA 3G4SI 2R7FA 2K86A 2EFNA 3QPLA 1C0WA 2ZJPF 4CCKA 5CKTA 4EJWA 4J01A 3QODA 4IHVA 5HS8A 1F1ZA 2EH3A 3BTCA 3QYBA 3M8FA 4L9NA 5E3NA 4A3GJ 2P7VB 1B9NA 3TEDA 1ZAOA 1K6YA 2ZKZA 3G71I 4MEYF 1LFBA 3KYCB 4PSWA 4CCMA 2OCEA 5M5YJ 3F3XA 3AKZA 1N77A 5D5UB 2GAUA 3JRFA 3FHZA 1HKQA 1A5JA 3W2WA 4F7ZA 3OYJA 3JREA 2R7TA 2F6CA 4CSWA 2HOSA 4XORA 1OR7A 4A3DJ 3CO6C 1B9MA 1FWZA 2JT1A 1RR7A 3KEOA 3QOEA 1X3WB 2VUMJ 3M4OJ 4ENNA 2IP2A 4QLCU 4YG2F 3CCRI 3S3MA 3QOPA 1TW3A 2R4GA 2RGVA 3R0AA 4RLFA 2KP6A 2DW4A 2XAGA 1LFPA 4D7MA 1L3LA 3U2RA 3VEPA 5IOYA 2VOOA 3I5UA 2OTJI 4L0YB 3MKZA 5BPIA 1SAXA 4D1QA 3H5AA 2LKSA 2JPBA 3E1SA 4P5OA 3P9IA 1HW5A 2VJ4A 1I5ZA 2HGCA 4L9TA 5EEAA 1BC8C 3CCYA 1K6OA 5LHGA 4P1WA 4HAMA 4CCNA 4M3GA 1MDMA 4XKBA 4HX4A 3K4BA 2K40A 4X6AJ 1JJ6C 1MZBA 2WC2A 3DFGA 2BY0A 2EJRA 4HBLA 1YX3A 4XLHA 4EJTA 3VSKA 4PFOA 1TC3C 2HVRA 4IO9F 2EFOA 4AIKA 2LRDA 4PZJA 2HDDA 2ME0A 2VQHA 3MD2A 4RM3A 1HDPA 2GA2A 3V8JA 4CO8A 4II3A 4Y17A 2JVHA 3FXUA 4B8XA 4G12A 1FYLA 2F2EA 2QF7A 2UUZA 4CDGA 4UHTA 5BMZA 1WJBA 4C2MJ 1TTYA 5GP9A 1MMDA 5LRRA 3HHGA 3Q9VA 3HXLA 2HTJA 2L4MA 1B4AA 1MKMA 2HYGD 3OYCA 1MNDA 4M3BA 3CCSI 4BNCA 1LB2A 3WTZA 4DYRA 4DBQA 3H1CA 2IS4A 4DBRA 3PUFA 4FCYA 1ETKA 1D1CA 2XAFA 3DCFA 2E1OA 5B66C 2HQNA 2V1NA 2VC0A 2PMUA 2MBFA 3MZYA 4M9ZA 3RQIA 1GVDA 3BG9A 5GPCA 1H89C 3CD6I 3F8MA 1H88C 2DU9A 2CO5A 3ZCOA 3WTVC 4M9XA 1R00A 3CLOA 3WHBA 2UZKA 2WB1A 2XF5A 4BYYA 3DTIA 1I1SA 4GXOA 5LGNA 2CW7A 3I4NJ 3ABTA 1R36A 5E3MA 2BHYA 3KP7A 1R23A 1SVMA 3CCMI 3H0DA 4RA2A 1K7AA 2P0WA 3EPZA 4AIJA 2HPMA 2QQBA 5ED4A 1MBHA 4KJZA 2KDZA 2L9SA 5GAEJ 3OYEA 1DDNA 1RESA 3F9KA 2PI0A 3H5NA 1IN5A 1EV7A 3FMSA 4EGZA 2CQXA 5HLTA 5L3BA 2KJBA 3IKVA 4U7BA 4U0WA 1OYYA 2BY3A 4W1UA 3OYLA 3JRCA 2OQRA 4L9VA 2IGNA 1J0RA 2TDXA 1MJAA 3HM5A 1IW7F 3ZQQA 1PUEE 3BG6A 3FZVA 5GTHC 3KYLA 1SD6A 1N78A 2Y9YA 1FC3A 2M34A 2BOLA 3R60A 4BHBA 1RETA 3ABKH 1E3PA 1F36A 1WI9A 2M3AA 4MIMA 1HW2A 1X4OA 4BEHA 4IPAA 4ZYDA 4DNCA 2ZJRF 5K7HA 2ZFWA 1VQKI 2HQRA 2ZMEC 1UHSA 1BR2A 1J09A 1BC7C 4OAYA 1V5FA 4KDPA 2VBWA 3SEQA 3N05A 2P7CB 5J40A 1IC8A 2D1VA 4IHXA 2QQAA 3M8EA 2XPVA 4KICA 3SDBA 1Z21A 4XRFA 1B6AA 2R7QA 3CUQA 4TV7A 2DDAA 3I55I 5D5WB 1STZA 5HS9A 3O8HA 4XLFA 2CG4A 3CJTB 2STTA 1ACIA 3JSOA 1U9OA 4A6EA 1ZGWA 4QWQA 4CUGA 4YIRX 1Z6TA 2O7OA 1VQ7I 1NHAA 2ME6A 4XRSG 1I3AA 2COBA 2CU7A 5J6XA 3V7SA 3DF8A 3ZN1A 4R79A 2IGKA 2W84A 4A12A 3LSKA 2UXXA 1HCRA 2L9VA 3HZJA 1FSHA 2KJCA 2QQ8A 1QZEA 3N97A 4L5JA 4HX7A 5A2QZ 2R93J 4ZZLA 4MTDA 1SMTA 3HOUJ 2EFWA 1Z6RA 3AL0C 1AKHA 3IH2A 2CFOA 3C1DA 1ZH5A 1D8JA 1WHUA 1HA8A 4V2FA 4LG0A 3CMAI 4MEXF 4KT6A 1QHGA 1IDZA 4K2EA 5IP7J 3CMYA 1MD0A 2ESHA 2TCTA 2WAEA 3CTAA 3GFJA 1S29A 2DQRA 2WAFA 3K70C 2LBFB 5DM7F 3S3OA 1MH3A 4JX4A 2BVLA 2NVUB 2QSFX 3B6AA 3GFLA 2P4WA 5D6FA 2L7MP 5K1YA 4WX9A 4Y15A 3DEEA 2JMWA 4B43A 2X6WA 2FE3A 2DMPA 3E3VA 4E6KG 2K9NA 4MFDA 4BXFA 1D8KA 4EQQA 3FWEA 5LHIA 1ZG1A 2XDVA 2NAZA 1Z7UA 1G6NA 4G7ZF 2RKHA 1GHCA 4FASD 4NB5A 1YJWI 2F4OB 2DLLA 2QLZA 4E7IA 4ZTFA 3H36A 1BI3A 2L54A 4WK8F 2MYSA 3GLLA 4IRGA 2VJ5A 4KFCA 1GXQA 3AL0B 1TP4A 3VYSB 1ENHA 1X2MA 1LFUP 1OCCH 4FQGA 2H6BA 1WPKA 2FF4A 2HOAA 1JUSA 1KQ9A 2ACJA 2M87A 1MJ9A 5HODA 2O0YA 4A69C 5DV5A 4G7OF 1Y39A 2Z16A 3BQYA 1RUNA 3RYRA 3HPHA 3TL4X 2VASA 1EH6A 2H6CA 2NOGA 2IBDA 3BCAA 4A0YA 2XKOA 3KX2A 3L2UA 3TBIA 3I4MJ 3RPUA 5IY5H 4BJTA 1Q1HA 2F5CA 3KYDB 2HPIA 1W1WE 4IHSA 3L00A 2LVSA 1BOBA 4EEFG 3WGIA 2BYVE 2P5VA 3T0YA 1NK2P 4JK1X 4D7NA 3I59B 1F4KA 4U0VA 5F64A 3JTHA 3P9CA 4A3KJ 2GXBA 3ZN0A 4OIQF 2GA1A 3L2WA 1A36A 2E19A 2I5UA 5GADJ 3CMEI 5IT3A 4AM3A 2OCCH 3WG7H 2HXIA 3ZRGA 2Z99A 4A5NA 3V42A 2IA2A 4BU2A 1AKHB 1U0JA 2R92J 1VZ0A 1U8BA 3WU0A 1O7FA 3RCOA 2XPUA 3K4KA 5CLSA 1S72I 2EZKA 4IJAA 1T8IA 4RMNA 4FE7A 1MGTA 1WSUA 2R3SA 2CQ7A 3CDLA 2ECCA 3CZ6A 3CUQB 1Z3YA 1W5CC 4FE4A 2P5LC 3A1YA 3E97A 3QPSA 2DOFA 3BR5A 2O61A 2QYOA 2NNNA 4RM2A 2LY9A 5B5EC 3BZ6A 3CF5F 2A68F 3E6MA 3I4PA 4IQ4A 3FM5A 4AIDA 2P5KA 1O7LA 2W24A 1HSTA 5BS6A 4O3MA 1KU9A 2ELHA 1MSEC 1PP7U 3ZQIA 1RRJA 2HYFA 1FIPA 1B59A 4M6VA 4I0BA 2K4BA 3BR3A 1OPCA 2CH0A 2V79A 3L7WA 4B48A 2JRMA 3C2BA 1KGSA 1S8NA 2R7OA 4Z2YA 1FBUA 2DDBA 4LG0B 1ZRCA 4FX4A 2CSOA 4HG2A 4XONA 3W2AA 4KYWA 4LK0F 3CJRB 1B72B 1KU2A 4HYEA 2DI3A 1TWFJ 5JHUA 2J5OA 4LGWA 4QTRA 5BQTA 1W7PA 2F48A 4BGDA 2WADA 2GIZA 3G2BA 1WJDA 3KE2A 3ISPA 4HZFA 1BA5A 5DCMA 3WU1B 3GMEA 3VYUB 4E4HA 1WJAA 1L0OC 3HSFA 1W36C 1WJFA 1I6XA 4I01A 5DTDA 2LSOA 5IT9K 4MO7A 1IRGA 2B9SA 3MN2A 2YU9J 3SEZA 2Z5UA 2DQLA 1IV8A 3JRIA 4IZZA 2HKOA 2NS8A 1JXSA 3J7AO 2FX0A 2J5PA 4CZZA 1ZYRF 4UUTA 2VJJA 2LLKA 3OWTA 3PSIA 1JGGA 4E7JA 2XAUA 2FBKA 1T38A 5C3EJ 3WTTC 2DTRA 2O8XA 4A0XA 2P6TA 4RAGA 2E1CA 5BNGA 2VB6A 1TNTA 3ZMUA 2LG4A 3JRBA 3L2CA 3PM1A 4HW0A 2QKMB 3J81Z 4LIUA 4YIIA 1VQ4I 4S0HB 3SFZA 3T8RA 3ZQ7A 3K1MA 3KETA 3GTQJ 2K02A 2FBHA 1F9NA 2JZYA 4A0ZA 4C3HJ 2R7ZJ 1OCTC 2DO7A 1X58A 4AVPA 3GUDA 2F5DA 2Y0MA 4Z6YA 1UELB 1BI1A 3E6CC 2LTPA 3MQ0A 3IV5A 1IZ1A 1AA7A 4ZDOA 2ZXHA 4XQFA 1QO0D 2DA2A 5DM6F 2KLOA 4C30A 5HVQC 3IRQA 1N25A 3L9FA 4BE2A 4KIGA 4FETA 2Q1ZB 5IYBJ 2XB0X 3A0BC 3KPHA 2HOTA 1AHDP 2BE5F 1JE8A 2R0QC 1KU3A 2K3FA 2EK5A 2X1CA 3K0LA 1GDTA 4AWXB 4DQ2A 1IAWA 2VQCA 1Y8QB 2HQ5A 3IH3A 2V4JC 1YE9A 4BAYA 4S05A 3S2HJ 4RS8A 1ITYA 3DQVC 3QPTA 1GUUA 3OS1A 4ESBA 2KQRA 4HOBA 3RJPA 4Y4RA 5D4SA 2Q0OA 2JA7J 3Q3SA 4IHWA 2PJPA 1TBXA 2X1EA 1WH7A 5F6FA 1BL0A 2B63J 4ZH4F 4HEA2 1U9NA 1RR8C 1XGOA 1IXCA 2AQEA 4RLQA 3LQRA 1OMIA 4BJ6C 2H27A 4Y52J 3A02A 3OR2C 1IN4A 5IYDJ 3K4JA 2L0KA 2FOKA 2EA2A 5K7FA 2CQKA 3EETA 1JKPC 1LVAA 2JWTA 4E7KA 2WV0A 1JI8A 1XN7A 5EYRA 3JRAA 1KONA 1K79A 1D3YA 3ZQGA 4ENMA 1T6SA 3IH4A 1ZRFA 2L02A 2EWNA 2H1KA 2Z3YA 5GPAA 3E7LA 1IXSB 4N4NB 5M5XJ 2EV6A 1MBEA 1R5ID 1FMVA 3BC8A 3MAJA 2LY2A 1R49A 4N4OB 5B1BH 1TQMA 4KT5C 3LMMA 4UV8A 4BY7J 3S14J 3MCZA 4M3FA 1YRNA 2FUG2 3GTGJ 5CVVA 4BHPA 3SDGA 3G1MA 1G59A 3WE2A 2MC3A 2JPCA 2QEXI 1YTYA 1NK3P 1JTYA 2OF7A 1FY7A 2KRFA 5LGUA 1KQ0A 1YW7A 4D9JA 1ZTRA 1JKQC 3LWFA 3J80K 1DQUA 2R7RA 4YIFA 5HDKA 3QPHA 2HOEA 2FA5A 3O6BB 1SC7A 3OY9A 2MC4A 1XG1A 4U87A 1UHWA 4BBSJ 5FLXK 4BKXA 1BOAA 1R6RA 5M5WJ 4L0ZB 3FX3A 1QZYA 1SVOA 1ZKGA 2YUSA 3BCBA 1LPQA 4UNOA 2QVOA 3OYAA 3DLAA 3A01B 3C2GA 3CCJI 2JA8J 4F55A 4LMYA 3J7ZI 3HDDA 5E3OA 1FSEA 2MH9A 4P96A 6PAXA 2EZIA 3TO9A 3HL2A 5KAFC 5E1XA 5FKNA 1MDMB 2GIVA 1U5TA 5EEGA 1OKRA 3RKXA 2GOMA 2IS6A 4I09A 1JHHA 4QPQA 3H3VK 3BZKA 4CYDA 3OYIA 4R8HA 3U9GA 4CA0A 4XLNF 4D0PA 3QRFF 4LIVA 5JHFA 4M6XA 1I3QJ 1USSA 5GAHJ 3HGGA 5DS9A 3HGYA 2MD0A 2EILH 3SZGA 3R4KA 3U21A 2JUCA 5CVRA 2BW3B 3KZIC 1FOXA 1PUFA 3K4NA 1GXPA 3HRSA 4QSHA 4BQAA 2FBIA 1S5LC 2AQFA 3DBLB 1P2FA 4JX5A 2CMPA 3LSTA 4JYKA 5FLVA 1OR7C 3TO7A 4PJ0C 2AS5F 1ODDA 4UUSA 1SFEA 3FM3A 1FBQA 4A93J 2H8WA 2KZVA 5EG0A 1O4XA 4GO1A 3FISA 3Q5FA 2ZB9A 2CGPA 2A6TA 2YS9A 2W82A 2QBYA 5EG0B 1XMKA 4E7ZA 3LSMA 3EUHA 2FMYA 1VI0A 2QBYB 1YS7A 2CYYA 4CHUA 1Y0UA 3C3WA 3DKXA 1NG7A 3KP6A 4A3CJ 2QKLB 1JKRC 1APLC 5DD4A 1XMAA 4RAYA 3SYTA 3ZMSA 5ILVA 3OYBA 1G4DA 3OR1C 2M0CA 4Y7NJ 3CP8A 5F0CA 2LOOA 3KP2A 2Y75A 1R58A 3KP3A 4IHTA 1G3TA 3OYMA 2R7UA 2O5RA 3IP4B 2E5ZA 5KNLA 1OFCX 2DA7A 5DUKA 1R71A 3PQJA 1FYKA 1D5YA 2KIQA 2V9PA 5EZHA 3GZNB 3GTMJ 4DW6A 1P92A 2R5YA 2XV4S 2A69F 3LNQA 1IN7A 2W25A 1WKMA 4XR6A 3EUAA 1UMQA 1PP8F 2X85A 4ENJA 1UZCA 1WJ5A 1VQPI 3VODA 3I54A 4B3XA 1MBJA 2JSCA 2MABA 3LA2A 1Y56A 1ZG3A 5EEHA 1LE8B 5E1ZB 4IQJA 3GWZA 4DZJA 4EJOA 5FRMA 3H92A 3E5UA 2YX4A 2KPMA 2ZXIA 4ESFA 3D5SC 1SFKA 5HNFA 5DD8A 5GAGJ 3F8NA 1B72A 4KISA 5FKOA 3ZQHA 4BBRJ 1NTCA 4RBOA 3C7JA 2IW5A 4AYBA 1U5TB 2RDPA 3VDXA 1JUMA 1TWHJ 2CUEA 3CJQB 2QA4I 2DYRH 1IRXA 2HQAA 2DFIA 2ICWG 2PEXA 1U3EM 2Y0SN 3X2QH 2HR3A 4IOCF 3DWLE 4KITB 4BE0A 2CQQA 1ETOA 2AXLA 4DOZA 5F0HA 2O6GE 2M8EA 3WTUC 3BJAA 3FHNA 4XLEA 2VQLA 3F6VA 2V7FA 4BY1J 3F0CA 2W85A 3IWFA 5DCFA 2PJRA 2BV6A 3AG2H 2PFBA 3SFIA 3OL4A 1O3QA 5D8KB 2VJIA 1OCRH 1ZLJA 2PJRB 2FMLA 3SZPA 2P81A 4GDFA 4S04A 4ANJA 5HNHA 2PN6A 3HKZA 2VN2A 1RKTA 3F22A 4OIOF 2XAJA 4PGGA 4RGRA 4ESJA 2M30A 3H3UA 3OL3A 3QAHA 4EJVA 2A5YB 2VT3A 1XTAA 2DOEA 4M72A 4WWCA 3OYNA 2VKVA 3J7AY 3CJNA 4KIBA 4XNFA 4PJLA 1MMGA 4G94A 3ECHA 2OV7A 2Y2ZA 3GO5A 3CC7I 4XLPF 3HJEA 3A2KA 2CUZA 3O8GA 1VQLI 3PSFA 2DMQA 2VONA 4FHTA 1D0XA 1ON1A 4Q47A 1FNNA 3GYHX 4CGZA 3HRTA 2PQ8A 2PLYA 2A5WA 2WB1N 1ETYA 5EGOB 3F21A 2Z1DA 1FEXA 3FXJA 2DCEA 1ZGJA 4N0BA 1EH7A 3JAMZ 2L2OA 1QU3A 3DPTA 3H35A 3BJ6A 4UB8C 5C4XJ 2V9VA 2BBYA 4E7LA 2OU2A 1P4AA 4A3BJ 2RQQA 3TP3A 1O3SA 4A5MA 3LFKA 4O5VA 3TGNA 5EDNA 1UAAA 1LDJA 2NVYJ 1K78A 1VF9A 1LE8A 3DPLC 3TKYA 3BOQA 1W5SA 1N75A 1FP2A 1ETQA 2PBIA 5F1JA 2B7EA 4IF4A 3TOAA 2FJ1A 3U1KA 4G9YA 1QGPA 2E35A 1RZ4A 3HOSA 3PQKA 3BROA 2EPFA 3F8FA 4HSTA 2IGOA 3DEWA 2WTEA 2DT6A 3F8CA 2FRHA 2RNJA 5ILSA 3OYFA 2R7DA 5IT9Z 2XSDC 3LOCA 2XPWA 1UG2A 1X4PA 2DK8A 3ABLH 2RC4A 3BTLA 4HQMA 3M1CA 3F23A 1S7OA 2K27A 2DOAA 2VLAA 4HLYA 5EZGA 4PSXA 3CO7C 2E1MB 3RTRA 1XCBA 4WCGA 2CWEA 2R7WA 2BXZA 2JRTA 1QRYA 2COMA 3KP4A 3DU6A 3R61A 3BTJA 3BG5A 2XGXA 3DPUA 3EUHC 5H6QA 4DYCA 1EJ9A 2Q8KA 2VL8A 4H4KC 4NBQA 2JSPA 3K7AJ 3I64A 1FOYA 1DUXC 1KYZA 3BR2A 4KIFA 3BG7A 3CCQI 4JBAA 4CCLA 2ZC2A 3PFIA 2L9NA 2JVGA 4GYIA 4Q4ZF 5IP9J 4ITVA 1TWGJ 2H1LA 3PNTA 3RYPA 4BE1A 2RNGA 4M9SA 1EKEA 4A3IJ 1RKWA 2NVQJ 3HOZJ 4IXAA 4JP0A 1K83J 2KL4A 1QBJA 2Y9ZA 5JR3A 5K5QA 2L7ZA 3K4LA 5FKLA 4B4CA 1B8IA 2RN7A 5H6RA 2M0MA 3P7NA 2EFPA 3CF2A 1R7JA 2XHKA 3IKTA 4LFUA 3FKJA 2OZUA 2IXSA 3ML6A 4LJZF 5D8LB 3E0JB 3CQZJ 5H2FC 4I2OA 3BR6A 4B09A 3ZQLA 1W7PD 1HKTA 5E8GA 1UB9A 1DGWY 3L2RA 4BQOA 5EGOA 3LAJA 4PDKA 4LB5A 1B1BA 3A4CA 1FP1D 2DMTA 2ADUA 1RC9A 4LOCA 2X9DA 4XOTA 1ERDA 3RKYA 3RQ4A 4CH7A 4F3QA 3EYIA 1IGNA 1SD4A 1WVRA 4XN3A 2LY1A 1J75A 1J2XA 2FXAA 3T8TA 3K2ZA 4BS9A 2FQ4A 2CQNA 2RVCA 3AG1H 3WODF 3CC2I 2M2EA 4E7SA 2V26A 1ZN2A 3NARA 5F27A 3H9JA 1XSXA 3IHUA 1KA8A 1G3YA 2ZSIB 3JRHA 4IEJA 1RIOH 3ONQA 1YOVB 5L3DA 3IL2A 2DT7B 4JOMA 4XL9A 2V1DA 2XVCA 3QWLA 4XM3A 4AU7A 4XICA 1D5VA 3Q0VA 3E6DA 1PVEA 5JFRA 2L9RA 5IYCJ 2VIXA 1BIAA 3E5QA 2NVTJ 1WH5A 2PX9A 5IP6A 3T1BA 2B0LA 1WJEA 1BI2A 3G6EI 1XGSA 2EIKH 5BPDA 3G73A 3G3ZA 2VKEA 2W1OA 1OJLA 5JLXA 4XRMA 2DMNA 2Q2EB 1X1PA 3OYHA 1G3SA 1X1DA 2MLGA 5CQEA 4EGYA 4LB6B 3MFKA 1HW1A 4ZYAA 2OA4A 1IRFA 5KVRA 1OQYA 1QPIA 4EATA 1Z7LA 2HFHA 5FD6A 2LF8A 3K1NA 4UY8I 3WGHA 2VBYA 4G6TB 4XKWA 3DKWA 5KAIC 5FLMJ 1BIBA 2IVMA 3OIOA 1XX5A 1YW8A 3LA3A 2DBBA 1LVKA 2XROA 5JVGF 3M07A 3GW2A 3NAUA 1E2XA 3AG3H 1J7KA 2EBIA 3ASOH 3DTKA 3QU6A 5FFXA 2LF7A 3S2WA 3CMMA 1T98A 4GFBA 4HV5A 4LLGF 1V3FA 5AIPA 5LD2C 2FNPA 5D5XB 3LL7A 4XSZF 5H20A 1Y8RB 3IAS2 1GVJA 1TLHB 2JA2A 1JT0A 1E0EA 3WHCA 3MMYB 3B6CA 3ELKA 3MKLA 4A3LJ 2GBYA 5HOOA 4Q48A 2O8KA 5L3GA 3HTSB 1JGSA 1YW9A 5M3MJ 2KIFA 4M3EA 1LNWA 5B3SH 2XSJC 4BEHB 3OS0A 4HV6A 4I6ZA 3M3YJ 4BACA 1IO2A 3DEUA 3JTGA 2O03A 5KCMA 4PUSA 5J4VA 2IAIA 1DU0A 2G7HA 3GF2A 4RAZA 1IJWC 5J1UA 4ZYHA 3VFZA 2EIJH 4A3JJ 3MKYB 3JRGA 5LLQA 2GZWA 4J00A 1R5GA 3GBGA 4OIPF 1T95A 4MQVA 1R5HA 1P7JA 2I10A 3HPGA 2KRCA 2VXZA 5HDGA 3RKQA 5E20A 1QZZA 3NWSA 2WA0A 1TL8A 3FMQA 1FOKA 2Z9OA 1ZG5A 3M8JA 2BY2A 3S1MJ 4OAZA 4BQNA 1T39A 2DPDA 4P9FA 1TW2A 2OJED 5GTIC 5ICFA 2F5VA 4ZYGA 5FLXZ 3BT9A 1ON2A 2D1HA 4XLAA 5ICGA 4BDYA 1D0YA 1FPQA 1GLNA 3IC7A 3MWMA 4HDUA 5JVTA 3S3NA 3VYRB 2HS5A 1SVLA 2BGCA 2BXYA 2HEOA 2KKOA 3ZQFA 3LFUA 1MBKA 3PIPF 2YR2A 1Y1VJ 2YU3A 1VQNI 3H5RA 4B1RA 3CDHA 2ZCWA 2X1DA 2M7BA 2L5QA 2CV1A 1Z67A 1H0MA 5FJ8J 1XSVA 4XOPA 2RV8A 2MSYA 3FK6A 3HYIA 2HVQA 3VOEA 5ICEA 2AHQA 4BL0B 3S15J 4NNJA 1YRNB 2NRAC 1HC8A 4AD9A 2IRFG 2ISYA 1USTA 3VB2A 2ZNYA 2D5VA 3KLNA 1A6QA 3HBLA 3CCVI 2A3SA 2RQPA 3HEFA 2R7SA 2CV2A 3HOVJ 2R7VA 5F04A 1XD7A 2HZDA 2ID6A 1QNTA 2K85A 3P9KA 4RB2C 2K9LA 4FX0A 1LQ1A 2WY8Q 2LH9A 2DA6A 1ZARA 2KT0A 4YEJA 2W00A 2K9QA 4KMFA 4ETSA 1MH4A 2Y69H 4E7HA 1U78A 2FQ3A 1YO5C 1JTXA 5JLWA 1W0UA 1HOMA 2GLOA 2OC6A 2OZ6A 1X1CA 1LJ9A 3E5XA 2IA0A 4ON0A 2QENA 1HBXG 3TMOA 2FU4A 3RKWA 5B1AH 1GT0C 4LITA 5J8CA 1BJZA 3MVPA 1YJNI 2JJ7A 2XF6A 2XAQA 1QQIA 2X4HA 2UXNA 1JKOC 1BM9A 4W97A 2JUGA 1CF7B 2DK5A 5ERIA 4NUBA 3MEXA 3HKZN 1QPMA 2I8DA 2DA1A 1F5TA 2PMZA 3ERED 4ZC3A 5IOZA
chains in the Genus database with same CATH topology
4GYGA 3KLOA 4MHGA 5FB2A 3I59A 2Z33A 1LDDA 1IF1A 1U2WA 4OMZA 5J8FA 3WTWC 2M45A 4HQEA 1Z05A 3WGGA 1YG2A 4RB0A 2YPRA 1A04A 4EM1A 4WXDA 1G3WA 2M1BA 2MLKA 1XDUA 1KYWA 3SXYA 1PDNC 1DP7P 3HSEA 3CUQC 3KZZA 2XKPA 3V8KA 2UWMA 3OV8A 1R22A 4FT8A 3GVAA 2V1UA 3GZ5A 4EV0A 3IRRA 3KP5A 1XSDA 3TDZC 3JSPA 5FGMA 4LLLA 2VBXA 2GQQA 2CFXA 1HXDA 2VE9A 3ZPLA 3BPVA 1U8RA 2G9WA 3O2PE 5K5OA 3FMRA 3GZ6A 3BP8A 2A6EF 4I7HA 2VOPA 3SQNA 2O3FA 3QP6A 4XBFA 2FNAA 4HF0A 1S7AA 4G6DA 4HF1A 1ZRDA 2YX7A 3EDPA 5DCMB 2WWYA 1DPUA 1R1UA 1CF7A 3F8BA 2IPQX 1XCVA 3V7RA 1WQ2A 3HIFA 4YFKF 3ZMTA 1BBYA 1OYWA 4RB1A 2LNBA 4WXHA 5D5VB 1YQAA 4EJUA 2K7LA 3KZYA 5CYVA 2E7XA 3LA7A 4NQWA 5KK1A 1ZGAA 3REOA 1VTNC 2E7WA 5HLIA 2P8TA 2DT5A 3HUGA 1FZPB 5L3FA 3E6BA 5CVIA 2OBPA 5LBQA 5DUIA 5CVJA 1E17A 4IRHA 3ECOA 3U1DA 2QUFA 1IN6A 3GFIA 3ZMVA 1LEAA 2A6HF 3BWGA 1TNSA 2F5FA 1R1VA 2D2WA 3DV8A 1ZHFA 5E18F 3D0SA 4I98B 1IN8A 4KMUX 4H0EA 2HDCA 1J5YA 2HKXA 3C18A 1W4MA 4OU0A 4MQ9F 3ABUA 3BPXA 1P6RA 4UV9A 5TRDA 4EM0B 3WE3A 3SZTA 2IJLA 2ZMEA 5E8IA 3JAMK 4E70A 3I53A 1X3UA 2LDUA 3BDDA 3ZMDA 1SFUA 1ZLKA 4MNUA 2L01A 3QP5A 3I71A 1XDSA 3W6JB 4JQFA 2HWVA 2ESNA 2ZXJA 1H9TA 2EV5A 3I58A 4L5IA 4U7DA 3WG9A 4CICA 1YLFA 2QZ8A 2XIGA 2MD5A 2OQGA 5HLGA 2EB7A 4UUVA 3B02A 2E1NA 1U6GA 4KN7X 2ZBKA 2FEZA 1KQ8A 3AAFA 1W7PB 4Q5SF 2GXGA 4KN4X 2EFQA 4MGRA 1ONVA 5D4RA 2KIMA 3GX4X 1FLIA 4M6YA 4BH9A 3NRVA 4KA4A 4GGGA 2L3DA 3M7GA 1TQIA 3BY6A 5L3EA 4G6QA 2C6YA 3F72A 1LDKB 2PMHA 5DDGA 5HLHA 5LGTA 3M9AA 3V7CA 1J59A 3M1EA 3RDIA 3W6KB 2L4AA 3D5LA 3ULQB 5LEJA 5LEKA 2A61A 4LD5A 3JW4A 3KCCA 1Z1DA 1AWCA 5K5RA 4YFNF 4I0AA 3L09A 5CJ9A 2VE8A 3HSRA 5FD5A 1HQCA 4ENKA 2XRNA 2PG4A 1T2KA 2ZNZA 4U88A 2QM3A 2ZMEB 3V8LA 1WWXA 4PGHA 4UVBA 3IWZA 2V1XA 4M73A 4GCVA 4LK1F 2JTVA 2QWWA 1UHMA 1YFHA 4MTEA 1REPC 2VC1A 1IUYA 5FFZA 1UFMA 2BEOA 4RGUA 1XB4A 5F1RA 2HZTA 2EV0A 3GLXA 3KFWX 5DEQA 4N9HA 3TQNA 1EH8A 4IRIA 5DYMA 4RGXA 1RUOA 3SHFA 4RGSA 4WXCA 4OIRF 4HF2A 1O3RA 4I02A 1ULYA 3K1PA 1BN5A 3KEQA 3J80Z 4RB3C 4R1HA 2ISZA 2ETHA 4ZZDA 2XAHA 5CVUA 2K4JA 2ZJ2A 2A07F 1AOYA 3HRUA 4AIHA 2FSWA 2G7UA 2LKPA 5HDNA 4BHCA 2EA4A 1SD5A 3WTSC 1UCRA 1RI7A 5A2QK 1RNLA 1I27A 3H3ZA 4HX8A 1V4RA 2H94A 5L3CA 1FT9A 1BJAA 1W5TA 3COAC 1ZREA 4LLNA 3B73A 1P4XA 4XSXF 4UXNA 1R1TA 3FXQA 3GXOA 3R0JA 1FX7A 4HDVA 3V4GA 4EM2A 5BOXA 3TOBA 3ZMZA 3DXJF 2CW0F 1BI0A 2NNYA 3OOPA 4OINF 3GFMA 2DAOA 3HHHA 4UVCA 3GEZA 1DPRA 3BJOA 2VBZA 4P9UA 3K69A 1SFXA 3I0TA 1S3JA 3TO6A 4EMSA 4BXUA 1XGMA 2VODA 4PCQA 3J81K 1XGNA 3ZP5A 5LHHA 4IVNA 2XASA 3HOTA 1YIOA 3MZHA 3N4MA 1FYMA 3WTYC 3RIRA 2X0LA 5AIQA 5ICCA 3CUOA 3WTXC 1H9GA 2H09A 1Z9CA 1MJBA 3ROUA 3O3KA 2OD5A 5FO5A 1FBSA 4NHJA 4UVAA 3RI4A 1I1GA 1WRJA 1Z91A 2NS0A 1KU7A 3HTUA 5E1WA 4U0YA 1YS6A 4KUMA 1OYIA 2NYXA 1TQPA 4WF2A 4EVIA 4G7HF 3EQLF 4L9JA 2QQ9A 4N9IA 4CXFA 4ASNA 1LEBA 4YFXF 5LRSA 5E17F 2HTSA 1O57A 3DP7A 4P55A 4A6DA 1HKSA 5TJJA 4HLXA 1JHFA 5AONA 3HRMA 1T0FA 4KNYA 1O3TA 1CGPA 2Y48A 2STWA 2F5EA 3QU3A 5JI6A 3F6OA 4G8XA 5ILUA 2ZO4A 3RPQA 2V6CA 3NEUA 3NQOA 2OAZA 2YSRA 3FXRA 2M5WA 1J9IA 2P6SA 5D6EA 2XUBA 4O6JA 4L18B 1U5TC 2VT2A 2W57A 2GWRA 3EYYA 3Q9SA 3R6SA 2DPUA 1S6LA 4Y13A 4M71A 4A2UA 3LAPA 2MA3A 2MH2A 1P4WA 2Q2EA 5HS7A 4M74A 1SD7A 4HA8A 3T5XA 4ZYEA 4OMYA 2IA1A 3LQQA 1HSJA 2KIUA 4OOIA 1K78B 3FF5A 3TDUC 1SMYF 1IXRC 1YYVA 3K9TA 2D45A 2IT0A 2R7FA 2K86A 2EFNA 1C0WA 4EJWA 5HS8A 1F1ZA 3M8FA 4L9NA 2P7VB 1B9NA 1ZAOA 2ZKZA 4MEYF 3F3XA 5D5UB 2GAUA 3FHZA 1HKQA 4F7ZA 1OR7A 3CO6C 1B9MA 1FWZA 2JT1A 3KEOA 4ENNA 2IP2A 4QLCU 4YG2F 3QOPA 1TW3A 3R0AA 2RGVA 2XAGA 2DW4A 1L3LA 3U2RA 3VEPA 2VOOA 3I5UA 4L0YB 5BPIA 1SAXA 2JPBA 4P5OA 3P9IA 1HW5A 1I5ZA 2HGCA 4L9TA 1BC8C 1K6OA 5LHGA 4HAMA 1MDMA 4HX4A 1MZBA 2WC2A 3DFGA 2EJRA 4HBLA 4EJTA 2EFOA 4AIKA 4PZJA 3V8JA 2GA2A 4CO8A 4Y17A 3FXUA 4B8XA 1FYLA 2F2EA 4CDGA 4UHTA 5BMZA 1TTYA 5LRRA 3HHGA 3Q9VA 2HTJA 2L4MA 1B4AA 1MKMA 2HYGD 4BNCA 1LB2A 3WTZA 2XAFA 2HQNA 2MBFA 2PMUA 2VC0A 3MZYA 4M9ZA 3F8MA 2DU9A 2CO5A 3WTVC 4M9XA 1R00A 3CLOA 2UZKA 4BYYA 1I1SA 4GXOA 5LGNA 3ABTA 1R36A 3KP7A 1R23A 1K7AA 4AIJA 2QQBA 5ED4A 1DDNA 2PI0A 1IN5A 1EV7A 3FMSA 4EGZA 5L3BA 2KJBA 3IKVA 4U7BA 4U0WA 1OYYA 2OQRA 4L9VA 1J0RA 2TDXA 1MJAA 1IW7F 1PUEE 3FZVA 1SD6A 1FC3A 3R60A 4BHBA 1WI9A 1HW2A 4IPAA 4ZYDA 4DNCA 2ZFWA 2HQRA 1BC7C 4KDPA 2VBWA 2P7CB 2D1VA 2QQAA 3M8EA 4KICA 4XRFA 1B6AA 3CUQA 4TV7A 5D5WB 1STZA 5HS9A 2CG4A 2STTA 3JSOA 4A6EA 4QWQA 1Z6TA 1NHAA 5J6XA 3V7SA 3DF8A 3ZN1A 4R79A 2W84A 4A12A 2UXXA 1FSHA 2KJCA 3N97A 4L5JA 4HX7A 5A2QZ 4ZZLA 4MTDA 1SMTA 2EFWA 1Z6RA 3C1DA 1ZH5A 1D8JA 4LG0A 4MEXF 4K2EA 1MD0A 2ESHA 3CTAA 3GFJA 1S29A 2DQRA 3GFLA 2P4WA 5D6FA 5K1YA 4WX9A 4Y15A 2FE3A 3E3VA 1D8KA 4EQQA 3FWEA 5LHIA 1ZG1A 2NAZA 1Z7UA 1G6NA 4G7ZF 2RKHA 1GHCA 4NB5A 2DLLA 2QLZA 4WK8F 1BI3A 2L54A 4IRGA 4KFCA 1GXQA 2H6BA 2FF4A 1KQ9A 2ACJA 2M87A 1MJ9A 2O0YA 5DV5A 4G7OF 1RUNA 3RYRA 1EH6A 2H6CA 4A0YA 2XKOA 3RPUA 1Q1HA 2F5CA 4IHSA 3L00A 3WGIA 2BYVE 2P5VA 3T0YA 4JK1X 3I59B 1F4KA 4U0VA 5F64A 3JTHA 3P9CA 2GXBA 3ZN0A 4OIQF 2GA1A 5IT3A 2Z99A 4A5NA 2IA2A 3WU0A 1O7FA 5CLSA 4IJAA 1MGTA 1WSUA 2R3SA 3CUQB 2P5LC 3E97A 2O61A 2QYOA 2NNNA 3BZ6A 2A68F 3E6MA 3I4PA 3FM5A 2P5KA 1O7LA 2W24A 1HSTA 5BS6A 4O3MA 1KU9A 2ELHA 1PP7U 2HYFA 1B59A 4I0BA 2K4BA 1OPCA 2V79A 3L7WA 1KGSA 1S8NA 4Z2YA 1FBUA 4LG0B 1ZRCA 4FX4A 2CSOA 4KYWA 4LK0F 1KU2A 4HYEA 2DI3A 5JHUA 2J5OA 4LGWA 5BQTA 1W7PA 3KE2A 3ISPA 4HZFA 5DCMA 3WU1B 1L0OC 3HSFA 1I6XA 4I01A 2LSOA 5IT9K 1IRGA 2Z5UA 2DQLA 2HKOA 1JXSA 3J7AO 2J5PA 4CZZA 1ZYRF 2FBKA 1T38A 3WTTC 2DTRA 2O8XA 4A0XA 2P6TA 2E1CA 1TNTA 3ZMUA 3L2CA 4HW0A 3J81Z 4YIIA 3SFZA 3T8RA 3ZQ7A 3K1MA 3KETA 2K02A 2FBHA 1F9NA 2JZYA 4A0ZA 2DO7A 4AVPA 3GUDA 2F5DA 2Y0MA 3E6CC 1BI1A 3MQ0A 1IZ1A 1QO0D 5HVQC 3IRQA 3L9FA 4KIGA 2BE5F 1JE8A 1KU3A 2EK5A 3K0LA 4AWXB 4DQ2A 1IAWA 4BAYA 4S05A 4RS8A 3DQVC 3QPTA 4ESBA 4HOBA 3RJPA 5D4SA 2Q0OA 2PJPA 1TBXA 5F6FA 4ZH4F 1XGOA 1IXCA 2H27A 3LQRA 1OMIA 1IN4A 2FOKA 2EA2A 2CQKA 3EETA 1LVAA 2WV0A 1XN7A 1K79A 1D3YA 4ENMA 1T6SA 1ZRFA 2L02A 2EWNA 2Z3YA 1IXSB 2EV6A 3MAJA 1TQMA 4KT5C 4UV8A 3MCZA 5CVVA 4BHPA 3WE2A 2MC3A 2JPCA 1YTYA 1FY7A 2KRFA 5LGUA 1KQ0A 1YW7A 3LWFA 3J80K 5HDKA 4YIFA 3QPHA 2HOEA 2FA5A 3O6BB 1UHWA 5FLXK 1BOAA 4L0ZB 3FX3A 1QZYA 4UNOA 2QVOA 4LMYA 1FSEA 2MH9A 4P96A 6PAXA 3TO9A 5E1XA 1MDMB 2GIVA 1U5TA 5EEGA 1OKRA 3RKXA 4I09A 1JHHA 4CYDA 4R8HA 3U9GA 4XLNF 4D0PA 3QRFF 4M6XA 1USSA 3R4KA 5CVRA 1GXPA 3HRSA 4BQAA 2FBIA 1P2FA 3LSTA 3TO7A 2AS5F 1ODDA 1SFEA 3FM3A 1FBQA 4GO1A 3Q5FA 2CGPA 2QBYA 1XMKA 3EUHA 2FMYA 2QBYB 1YS7A 2CYYA 4CHUA 1Y0UA 3C3WA 3KP6A 5DD4A 1XMAA 4RAYA 3ZMSA 5ILVA 1G4DA 3KP2A 4IHTA 1R58A 2Y75A 3KP3A 1G3TA 5DUKA 3PQJA 1FYKA 1P92A 2XV4S 2A69F 1IN7A 2W25A 1WKMA 1PP8F 4ENJA 3VODA 3I54A 2JSCA 3LA2A 1ZG3A 5EEHA 5E1ZB 3GWZA 4EJOA 3H92A 3E5UA 2YX4A 4ESFA 5DD8A 3F8NA 3C7JA 2IW5A 1U5TB 2RDPA 2DFIA 2PEXA 1U3EM 2HR3A 2AXLA 2O6GE 2M8EA 3WTUC 3BJAA 3F6VA 2W85A 3IWFA 5DCFA 2BV6A 2PFBA 1O3QA 5D8KB 1ZLJA 2FMLA 3SZPA 4S04A 2PN6A 2VN2A 3F22A 4OIOF 2XAJA 4PGGA 4RGRA 4ESJA 2M30A 3H3UA 3QAHA 4EJVA 2A5YB 2VT3A 4M72A 4WWCA 3CJNA 4KIBA 4G94A 3ECHA 3GO5A 4XLPF 2VONA 4FHTA 1ON1A 3GYHX 4Q47A 1FNNA 4CGZA 3HRTA 2PQ8A 2PLYA 3F21A 1ZGJA 4N0BA 1EH7A 3JAMZ 3DPTA 3BJ6A 2V9VA 2BBYA 2OU2A 1P4AA 1O3SA 4A5MA 3LFKA 4O5VA 3TGNA 1LDJA 1K78A 3DPLC 3TKYA 3BOQA 1W5SA 1FP2A 2PBIA 4IF4A 3TOAA 4G9YA 1QGPA 1RZ4A 3HOSA 3PQKA 3BROA 3F8FA 2WTEA 3F8CA 2FRHA 2RNJA 5ILSA 2R7DA 5IT9Z 2DK8A 4HQMA 2RC4A 3F23A 1S7OA 2K27A 4HLYA 3CO7C 3RTRA 1XCBA 4WCGA 2CWEA 2JRTA 2COMA 3KP4A 3R61A 2XGXA 5H6QA 2Q8KA 1DUXC 3I64A 1KYZA 4KIFA 4JBAA 3PFIA 4Q4ZF 4GYIA 3RYPA 4M9SA 4IXAA 1QBJA 5JR3A 2RN7A 5H6RA 3P7NA 2EFPA 1R7JA 2XHKA 3IKTA 4LFUA 2OZUA 3ML6A 4LJZF 5D8LB 4I2OA 4B09A 1W7PD 1HKTA 5E8GA 1UB9A 3LAJA 4PDKA 4LB5A 1B1BA 1FP1D 2ADUA 3RKYA 3EYIA 1SD4A 1J75A 1J2XA 2FXAA 3T8TA 3K2ZA 2RVCA 3WODF 1ZN2A 1XSXA 3IHUA 1G3YA 1KA8A 1RIOH 5L3DA 3IL2A 2V1DA 2XVCA 1D5VA 3E6DA 5JFRA 1BIAA 3E5QA 3T1BA 2B0LA 1BI2A 5BPDA 1XGSA 3G73A 3G3ZA 1G3SA 4EGYA 2MLGA 4LB6B 3MFKA 1HW1A 2OA4A 1IRFA 5KVRA 2HFHA 5FD6A 2LF8A 3K1NA 3WGHA 2VBYA 3DKWA 1BIBA 2IVMA 1YW8A 3LA3A 2DBBA 2XROA 3GW2A 1E2XA 1J7KA 3QU6A 5FFXA 2LF7A 3S2WA 1T98A 4HV5A 4LLGF 1V3FA 5AIPA 2FNPA 5D5XB 4XSZF 5H20A 1GVJA 1TLHB 3ELKA 5HOOA 4Q48A 5L3GA 3HTSB 1JGSA 1YW9A 2KIFA 1LNWA 4HV6A 3DEUA 3JTGA 2O03A 2G7HA 3GF2A 4RAZA 4ZYHA 3VFZA 5LLQA 2GZWA 1R5GA 4OIPF 4MQVA 1R5HA 2VXZA 5HDGA 5E20A 1QZZA 3FMQA 1FOKA 2Z9OA 1ZG5A 1T39A 2DPDA 4P9FA 1TW2A 5ICFA 4ZYGA 5FLXZ 1ON2A 2D1HA 5ICGA 1FPQA 3MWMA 3IC7A 4HDUA 5JVTA 2HS5A 2BGCA 2HEOA 2KKOA 2YR2A 2YU3A 3CDHA 2ZCWA 1H0MA 1XSVA 2RV8A 3HYIA 5ICEA 3VOEA 2NRAC 4AD9A 2IRFG 2ISYA 1USTA 3VB2A 2ZNYA 3KLNA 2A3SA 2RQPA 1XD7A 1QNTA 3P9KA 4RB2C 4FX0A 1LQ1A 1ZARA 4KMFA 4ETSA 1U78A 2FQ3A 1YO5C 2OZ6A 1LJ9A 3E5XA 2IA0A 4ON0A 2QENA 1HBXG 2FU4A 3RKWA 5J8CA 2XAQA 1QQIA 2X4HA 2UXNA 1BM9A 1CF7B 2DK5A 5ERIA 3MEXA 1QPMA 1F5TA 3ERED 5K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYG A;  3KLO A;  4MHG A;  5FB2 A;  3I59 A;  2Z33 A;  1LDD A;  1IF1 A;  1U2W A;  4OMZ A;  5J8F A;  3WTW C;  2M45 A;  4HQE A;  1Z05 A;  3WGG A;  1YG2 A;  4RB0 A;  2YPR A;  1A04 A;  4EM1 A;  4WXD A;  1G3W A;  2M1B A;  2MLK A;  1XDU A;  1KYW A;  3SXY A;  1PDN C;  1DP7 P;  3HSE A;  3CUQ C;  3KZZ A;  2XKP A;  3V8K A;  2UWM A;  3OV8 A;  1R22 A;  4FT8 A;  3GVA A;  2V1U A;  3GZ5 A;  4EV0 A;  3IRR A;  3KP5 A;  1XSD A;  3TDZ C;  3JSP A;  5FGM A;  4LLL A;  2VBX A;  2GQQ A;  2CFX A;  1HXD A;  2VE9 A;  3ZPL A;  3BPV A;  1U8R A;  2G9W A;  3O2P E;  5K5O A;  3FMR A;  3GZ6 A;  3BP8 A;  2A6E F;  4I7H A;  2VOP A;  3SQN A;  2O3F A;  3QP6 A;  4XBF A;  2FNA A;  4HF0 A;  1S7A A;  4G6D A;  4HF1 A;  1ZRD A;  2YX7 A;  3EDP A;  5DCM B;  2WWY A;  1DPU A;  1R1U A;  1CF7 A;  3F8B A;  2IPQ X;  1XCV A;  3V7R A;  1WQ2 A;  3HIF A;  4YFK F;  3ZMT A;  1BBY A;  1OYW A;  4RB1 A;  2LNB A;  4WXH A;  5D5V B;  1YQA A;  4EJU A;  2K7L A;  3KZY A;  5CYV A;  2E7X A;  3LA7 A;  4NQW A;  5KK1 A;  1ZGA A;  3REO A;  1VTN C;  2E7W A;  5HLI A;  2P8T A;  2DT5 A;  3HUG A;  1FZP B;  5L3F A;  3E6B A;  5CVI A;  2OBP A;  5LBQ A;  5DUI A;  5CVJ A;  1E17 A;  4IRH A;  3ECO A;  3U1D A;  2QUF A;  1IN6 A;  3GFI A;  3ZMV A;  1LEA A;  2A6H F;  3BWG A;  1TNS A;  2F5F A;  1R1V A;  2D2W A;  3DV8 A;  1ZHF A;  5E18 F;  3D0S A;  4I98 B;  1IN8 A;  4KMU X;  4H0E A;  2HDC A;  1J5Y A;  2HKX A;  3C18 A;  1W4M A;  4OU0 A;  4MQ9 F;  3ABU A;  3BPX A;  1P6R A;  4UV9 A;  5TRD A;  4EM0 B;  3WE3 A;  3SZT A;  2IJL A;  2ZME A;  5E8I A;  3JAM K;  4E70 A;  3I53 A;  1X3U A;  2LDU A;  3BDD A;  3ZMD A;  1SFU A;  1ZLK A;  4MNU A;  2L01 A;  3QP5 A;  3I71 A;  1XDS A;  3W6J B;  4JQF A;  2HWV A;  2ESN A;  2ZXJ A;  1H9T A;  2EV5 A;  3I58 A;  4L5I A;  4U7D A;  3WG9 A;  4CIC A;  1YLF A;  2QZ8 A;  2XIG A;  2MD5 A;  2OQG A;  5HLG A;  2EB7 A;  4UUV A;  3B02 A;  2E1N A;  1U6G A;  4KN7 X;  2ZBK A;  2FEZ A;  1KQ8 A;  3AAF A;  1W7P B;  4Q5S F;  2GXG A;  4KN4 X;  2EFQ A;  4MGR A;  1ONV A;  5D4R A;  2KIM A;  3GX4 X;  1FLI A;  4M6Y A;  4BH9 A;  3NRV A;  4KA4 A;  4GGG A;  2L3D A;  3M7G A;  1TQI A;  3BY6 A;  5L3E A;  4G6Q A;  2C6Y A;  3F72 A;  1LDK B;  2PMH A;  5DDG A;  5HLH A;  5LGT A;  3M9A A;  3V7C A;  1J59 A;  3M1E A;  3RDI A;  3W6K B;  2L4A A;  3D5L A;  3ULQ B;  5LEJ A;  5LEK A;  2A61 A;  4LD5 A;  3JW4 A;  3KCC A;  1Z1D A;  1AWC A;  5K5R A;  4YFN F;  4I0A A;  3L09 A;  5CJ9 A;  2VE8 A;  3HSR A;  5FD5 A;  1HQC A;  4ENK A;  2XRN A;  2PG4 A;  1T2K A;  2ZNZ A;  4U88 A;  2QM3 A;  2ZME B;  3V8L A;  1WWX A;  4PGH A;  4UVB A;  3IWZ A;  2V1X A;  4M73 A;  4GCV A;  4LK1 F;  2JTV A;  2QWW A;  1UHM A;  1YFH A;  4MTE A;  1REP C;  2VC1 A;  1IUY A;  5FFZ A;  1UFM A;  2BEO A;  4RGU A;  1XB4 A;  5F1R A;  2HZT A;  2EV0 A;  3GLX A;  3KFW X;  5DEQ A;  4N9H A;  3TQN A;  1EH8 A;  4IRI A;  5DYM A;  4RGX A;  1RUO A;  3SHF A;  4RGS A;  4WXC A;  4OIR F;  4HF2 A;  1O3R A;  4I02 A;  1ULY A;  3K1P A;  1BN5 A;  3KEQ A;  3J80 Z;  4RB3 C;  4R1H A;  2ISZ A;  2ETH A;  4ZZD A;  2XAH A;  5CVU A;  2K4J A;  2ZJ2 A;  2A07 F;  1AOY A;  3HRU A;  4AIH A;  2FSW A;  2G7U A;  2LKP A;  5HDN A;  4BHC A;  2EA4 A;  1SD5 A;  3WTS C;  1UCR A;  1RI7 A;  5A2Q K;  1RNL A;  1I27 A;  3H3Z A;  4HX8 A;  1V4R A;  2H94 A;  5L3C A;  1FT9 A;  1BJA A;  1W5T A;  3COA C;  1ZRE A;  4LLN A;  3B73 A;  1P4X A;  4XSX F;  4UXN A;  1R1T A;  3FXQ A;  3GXO A;  3R0J A;  1FX7 A;  4HDV A;  3V4G A;  4EM2 A;  5BOX A;  3TOB A;  3ZMZ A;  3DXJ F;  2CW0 F;  1BI0 A;  2NNY A;  3OOP A;  4OIN F;  3GFM A;  2DAO A;  3HHH A;  4UVC A;  3GEZ A;  1DPR A;  3BJO A;  2VBZ A;  4P9U A;  3K69 A;  1SFX A;  3I0T A;  1S3J A;  3TO6 A;  4EMS A;  4BXU A;  1XGM A;  2VOD A;  4PCQ A;  3J81 K;  1XGN A;  3ZP5 A;  5LHH A;  4IVN A;  2XAS A;  3HOT A;  1YIO A;  3MZH A;  3N4M A;  1FYM A;  3WTY C;  3RIR A;  2X0L A;  5AIQ A;  5ICC A;  3CUO A;  3WTX C;  1H9G A;  2H09 A;  1Z9C A;  1MJB A;  3ROU A;  3O3K A;  2OD5 A;  5FO5 A;  1FBS A;  4NHJ A;  4UVA A;  3RI4 A;  1I1G A;  1WRJ A;  1Z91 A;  2NS0 A;  1KU7 A;  3HTU A;  5E1W A;  4U0Y A;  1YS6 A;  4KUM A;  1OYI A;  2NYX A;  1TQP A;  4WF2 A;  4EVI A;  4G7H F;  3EQL F;  4L9J A;  2QQ9 A;  4N9I A;  4CXF A;  4ASN A;  1LEB A;  4YFX F;  5LRS A;  5E17 F;  2HTS A;  1O57 A;  3DP7 A;  4P55 A;  4A6D A;  1HKS A;  5TJJ A;  4HLX A;  1JHF A;  5AON A;  3HRM A;  1T0F A;  4KNY A;  1O3T A;  1CGP A;  2Y48 A;  2STW A;  2F5E A;  3QU3 A;  5JI6 A;  3F6O A;  4G8X A;  5ILU A;  2ZO4 A;  3RPQ A;  2V6C A;  3NEU A;  3NQO A;  2OAZ A;  2YSR A;  3FXR A;  2M5W A;  1J9I A;  2P6S A;  5D6E A;  2XUB A;  4O6J A;  4L18 B;  1U5T C;  2VT2 A;  2W57 A;  2GWR A;  3EYY A;  3Q9S A;  3R6S A;  2DPU A;  1S6L A;  4Y13 A;  4M71 A;  4A2U A;  3LAP A;  2MA3 A;  2MH2 A;  1P4W A;  2Q2E A;  5HS7 A;  4M74 A;  1SD7 A;  4HA8 A;  3T5X A;  4ZYE A;  4OMY A;  2IA1 A;  3LQQ A;  1HSJ A;  2KIU A;  4OOI A;  1K78 B;  3FF5 A;  3TDU C;  1SMY F;  1IXR C;  1YYV A;  3K9T A;  2D45 A;  2IT0 A;  2R7F A;  2K86 A;  2EFN A;  1C0W A;  4EJW A;  5HS8 A;  1F1Z A;  3M8F A;  4L9N A;  2P7V B;  1B9N A;  1ZAO A;  2ZKZ A;  4MEY F;  3F3X A;  5D5U B;  2GAU A;  3FHZ A;  1HKQ A;  4F7Z A;  1OR7 A;  3CO6 C;  1B9M A;  1FWZ A;  2JT1 A;  3KEO A;  4ENN A;  2IP2 A;  4QLC U;  4YG2 F;  3QOP A;  1TW3 A;  3R0A A;  2RGV A;  2XAG A;  2DW4 A;  1L3L A;  3U2R A;  3VEP A;  2VOO A;  3I5U A;  4L0Y B;  5BPI A;  1SAX A;  2JPB A;  4P5O A;  3P9I A;  1HW5 A;  1I5Z A;  2HGC A;  4L9T A;  1BC8 C;  1K6O A;  5LHG A;  4HAM A;  1MDM A;  4HX4 A;  1MZB A;  2WC2 A;  3DFG A;  2EJR A;  4HBL A;  4EJT A;  2EFO A;  4AIK A;  4PZJ A;  3V8J A;  2GA2 A;  4CO8 A;  4Y17 A;  3FXU A;  4B8X A;  1FYL A;  2F2E A;  4CDG A;  4UHT A;  5BMZ A;  1TTY A;  5LRR A;  3HHG A;  3Q9V A;  2HTJ A;  2L4M A;  1B4A A;  1MKM A;  2HYG D;  4BNC A;  1LB2 A;  3WTZ A;  2XAF A;  2HQN A;  2MBF A;  2PMU A;  2VC0 A;  3MZY A;  4M9Z A;  3F8M A;  2DU9 A;  2CO5 A;  3WTV C;  4M9X A;  1R00 A;  3CLO A;  2UZK A;  4BYY A;  1I1S A;  4GXO A;  5LGN A;  3ABT A;  1R36 A;  3KP7 A;  1R23 A;  1K7A A;  4AIJ A;  2QQB A;  5ED4 A;  1DDN A;  2PI0 A;  1IN5 A;  1EV7 A;  3FMS A;  4EGZ A;  5L3B A;  2KJB A;  3IKV A;  4U7B A;  4U0W A;  1OYY A;  2OQR A;  4L9V A;  1J0R A;  2TDX A;  1MJA A;  1IW7 F;  1PUE E;  3FZV A;  1SD6 A;  1FC3 A;  3R60 A;  4BHB A;  1WI9 A;  1HW2 A;  4IPA A;  4ZYD A;  4DNC A;  2ZFW A;  2HQR A;  1BC7 C;  4KDP A;  2VBW A;  2P7C B;  2D1V A;  2QQA A;  3M8E A;  4KIC A;  4XRF A;  1B6A A;  3CUQ A;  4TV7 A;  5D5W B;  1STZ A;  5HS9 A;  2CG4 A;  2STT A;  3JSO A;  4A6E A;  4QWQ A;  1Z6T A;  1NHA A;  5J6X A;  3V7S A;  3DF8 A;  3ZN1 A;  4R79 A;  2W84 A;  4A12 A;  2UXX A;  1FSH A;  2KJC A;  3N97 A;  4L5J A;  4HX7 A;  5A2Q Z;  4ZZL A;  4MTD A;  1SMT A;  2EFW A;  1Z6R A;  3C1D A;  1ZH5 A;  1D8J A;  4LG0 A;  4MEX F;  4K2E A;  1MD0 A;  2ESH A;  3CTA A;  3GFJ A;  1S29 A;  2DQR A;  3GFL A;  2P4W A;  5D6F A;  5K1Y A;  4WX9 A;  4Y15 A;  2FE3 A;  3E3V A;  1D8K A;  4EQQ A;  3FWE A;  5LHI A;  1ZG1 A;  2NAZ A;  1Z7U A;  1G6N A;  4G7Z F;  2RKH A;  1GHC A;  4NB5 A;  2DLL A;  2QLZ A;  4WK8 F;  1BI3 A;  2L54 A;  4IRG A;  4KFC A;  1GXQ A;  2H6B A;  2FF4 A;  1KQ9 A;  2ACJ A;  2M87 A;  1MJ9 A;  2O0Y A;  5DV5 A;  4G7O F;  1RUN A;  3RYR A;  1EH6 A;  2H6C A;  4A0Y A;  2XKO A;  3RPU A;  1Q1H A;  2F5C A;  4IHS A;  3L00 A;  3WGI A;  2BYV E;  2P5V A;  3T0Y A;  4JK1 X;  3I59 B;  1F4K A;  4U0V A;  5F64 A;  3JTH A;  3P9C A;  2GXB A;  3ZN0 A;  4OIQ F;  2GA1 A;  5IT3 A;  2Z99 A;  4A5N A;  2IA2 A;  3WU0 A;  1O7F A;  5CLS A;  4IJA A;  1MGT A;  1WSU A;  2R3S A;  3CUQ B;  2P5L C;  3E97 A;  2O61 A;  2QYO A;  2NNN A;  3BZ6 A;  2A68 F;  3E6M A;  3I4P A;  3FM5 A;  2P5K A;  1O7L A;  2W24 A;  1HST A;  5BS6 A;  4O3M A;  1KU9 A;  2ELH A;  1PP7 U;  2HYF A;  1B59 A;  4I0B A;  2K4B A;  1OPC A;  2V79 A;  3L7W A;  1KGS A;  1S8N A;  4Z2Y A;  1FBU A;  4LG0 B;  1ZRC A;  4FX4 A;  2CSO A;  4KYW A;  4LK0 F;  1KU2 A;  4HYE A;  2DI3 A;  5JHU A;  2J5O A;  4LGW A;  5BQT A;  1W7P A;  3KE2 A;  3ISP A;  4HZF A;  5DCM A;  3WU1 B;  1L0O C;  3HSF A;  1I6X A;  4I01 A;  2LSO A;  5IT9 K;  1IRG A;  2Z5U A;  2DQL A;  2HKO A;  1JXS A;  3J7A O;  2J5P A;  4CZZ A;  1ZYR F;  2FBK A;  1T38 A;  3WTT C;  2DTR A;  2O8X A;  4A0X A;  2P6T A;  2E1C A;  1TNT A;  3ZMU A;  3L2C A;  4HW0 A;  3J81 Z;  4YII A;  3SFZ A;  3T8R A;  3ZQ7 A;  3K1M A;  3KET A;  2K02 A;  2FBH A;  1F9N A;  2JZY A;  4A0Z A;  2DO7 A;  4AVP A;  3GUD A;  2F5D A;  2Y0M A;  3E6C C;  1BI1 A;  3MQ0 A;  1IZ1 A;  1QO0 D;  5HVQ C;  3IRQ A;  3L9F A;  4KIG A;  2BE5 F;  1JE8 A;  1KU3 A;  2EK5 A;  3K0L A;  4AWX B;  4DQ2 A;  1IAW A;  4BAY A;  4S05 A;  4RS8 A;  3DQV C;  3QPT A;  4ESB A;  4HOB A;  3RJP A;  5D4S A;  2Q0O A;  2PJP A;  1TBX A;  5F6F A;  4ZH4 F;  1XGO A;  1IXC A;  2H27 A;  3LQR A;  1OMI A;  1IN4 A;  2FOK A;  2EA2 A;  2CQK A;  3EET A;  1LVA A;  2WV0 A;  1XN7 A;  1K79 A;  1D3Y A;  4ENM A;  1T6S A;  1ZRF A;  2L02 A;  2EWN A;  2Z3Y A;  1IXS B;  2EV6 A;  3MAJ A;  1TQM A;  4KT5 C;  4UV8 A;  3MCZ A;  5CVV A;  4BHP A;  3WE2 A;  2MC3 A;  2JPC A;  1YTY A;  1FY7 A;  2KRF A;  5LGU A;  1KQ0 A;  1YW7 A;  3LWF A;  3J80 K;  5HDK A;  4YIF A;  3QPH A;  2HOE A;  2FA5 A;  3O6B B;  1UHW A;  5FLX K;  1BOA A;  4L0Z B;  3FX3 A;  1QZY A;  4UNO A;  2QVO A;  4LMY A;  1FSE A;  2MH9 A;  4P96 A;  6PAX A;  3TO9 A;  5E1X A;  1MDM B;  2GIV A;  1U5T A;  5EEG A;  1OKR A;  3RKX A;  4I09 A;  1JHH A;  4CYD A;  4R8H A;  3U9G A;  4XLN F;  4D0P A;  3QRF F;  4M6X A;  1USS A;  3R4K A;  5CVR A;  1GXP A;  3HRS A;  4BQA A;  2FBI A;  1P2F A;  3LST A;  3TO7 A;  2AS5 F;  1ODD A;  1SFE A;  3FM3 A;  1FBQ A;  4GO1 A;  3Q5F A;  2CGP A;  2QBY A;  1XMK A;  3EUH A;  2FMY A;  2QBY B;  1YS7 A;  2CYY A;  4CHU A;  1Y0U A;  3C3W A;  3KP6 A;  5DD4 A;  1XMA A;  4RAY A;  3ZMS A;  5ILV A;  1G4D A;  3KP2 A;  4IHT A;  1R58 A;  2Y75 A;  3KP3 A;  1G3T A;  5DUK A;  3PQJ A;  1FYK A;  1P92 A;  2XV4 S;  2A69 F;  1IN7 A;  2W25 A;  1WKM A;  1PP8 F;  4ENJ A;  3VOD A;  3I54 A;  2JSC A;  3LA2 A;  1ZG3 A;  5EEH A;  5E1Z B;  3GWZ A;  4EJO A;  3H92 A;  3E5U A;  2YX4 A;  4ESF A;  5DD8 A;  3F8N A;  3C7J A;  2IW5 A;  1U5T B;  2RDP A;  2DFI A;  2PEX A;  1U3E M;  2HR3 A;  2AXL A;  2O6G E;  2M8E A;  3WTU C;  3BJA A;  3F6V A;  2W85 A;  3IWF A;  5DCF A;  2BV6 A;  2PFB A;  1O3Q A;  5D8K B;  1ZLJ A;  2FML A;  3SZP A;  4S04 A;  2PN6 A;  2VN2 A;  3F22 A;  4OIO F;  2XAJ A;  4PGG A;  4RGR A;  4ESJ A;  2M30 A;  3H3U A;  3QAH A;  4EJV A;  2A5Y B;  2VT3 A;  4M72 A;  4WWC A;  3CJN A;  4KIB A;  4G94 A;  3ECH A;  3GO5 A;  4XLP F;  2VON A;  4FHT A;  1ON1 A;  3GYH X;  4Q47 A;  1FNN A;  4CGZ A;  3HRT A;  2PQ8 A;  2PLY A;  3F21 A;  1ZGJ A;  4N0B A;  1EH7 A;  3JAM Z;  3DPT A;  3BJ6 A;  2V9V A;  2BBY A;  2OU2 A;  1P4A A;  1O3S A;  4A5M A;  3LFK A;  4O5V A;  3TGN A;  1LDJ A;  1K78 A;  3DPL C;  3TKY A;  3BOQ A;  1W5S A;  1FP2 A;  2PBI A;  4IF4 A;  3TOA A;  4G9Y A;  1QGP A;  1RZ4 A;  3HOS A;  3PQK A;  3BRO A;  3F8F A;  2WTE A;  3F8C A;  2FRH A;  2RNJ A;  5ILS A;  2R7D A;  5IT9 Z;  2DK8 A;  4HQM A;  2RC4 A;  3F23 A;  1S7O A;  2K27 A;  4HLY A;  3CO7 C;  3RTR A;  1XCB A;  4WCG A;  2CWE A;  2JRT A;  2COM A;  3KP4 A;  3R61 A;  2XGX A;  5H6Q A;  2Q8K A;  1DUX C;  3I64 A;  1KYZ A;  4KIF A;  4JBA A;  3PFI A;  4Q4Z F;  4GYI A;  3RYP A;  4M9S A;  4IXA A;  1QBJ A;  5JR3 A;  2RN7 A;  5H6R A;  3P7N A;  2EFP A;  1R7J A;  2XHK A;  3IKT A;  4LFU A;  2OZU A;  3ML6 A;  4LJZ F;  5D8L B;  4I2O A;  4B09 A;  1W7P D;  1HKT A;  5E8G A;  1UB9 A;  3LAJ A;  4PDK A;  4LB5 A;  1B1B A;  1FP1 D;  2ADU A;  3RKY A;  3EYI A;  1SD4 A;  1J75 A;  1J2X A;  2FXA A;  3T8T A;  3K2Z A;  2RVC A;  3WOD F;  1ZN2 A;  1XSX A;  3IHU A;  1G3Y A;  1KA8 A;  1RIO H;  5L3D A;  3IL2 A;  2V1D A;  2XVC A;  1D5V A;  3E6D A;  5JFR A;  1BIA A;  3E5Q A;  3T1B A;  2B0L A;  1BI2 A;  5BPD A;  1XGS A;  3G73 A;  3G3Z A;  1G3S A;  4EGY A;  2MLG A;  4LB6 B;  3MFK A;  1HW1 A;  2OA4 A;  1IRF A;  5KVR A;  2HFH A;  5FD6 A;  2LF8 A;  3K1N A;  3WGH A;  2VBY A;  3DKW A;  1BIB A;  2IVM A;  1YW8 A;  3LA3 A;  2DBB A;  2XRO A;  3GW2 A;  1E2X A;  1J7K A;  3QU6 A;  5FFX A;  2LF7 A;  3S2W A;  1T98 A;  4HV5 A;  4LLG F;  1V3F A;  5AIP A;  2FNP A;  5D5X B;  4XSZ F;  5H20 A;  1GVJ A;  1TLH B;  3ELK A;  5HOO A;  4Q48 A;  5L3G A;  3HTS B;  1JGS A;  1YW9 A;  2KIF A;  1LNW A;  4HV6 A;  3DEU A;  3JTG A;  2O03 A;  2G7H A;  3GF2 A;  4RAZ A;  4ZYH A;  3VFZ A;  5LLQ A;  2GZW A;  1R5G A;  4OIP F;  4MQV A;  1R5H A;  2VXZ A;  5HDG A;  5E20 A;  1QZZ A;  3FMQ A;  1FOK A;  2Z9O A;  1ZG5 A;  1T39 A;  2DPD A;  4P9F A;  1TW2 A;  5ICF A;  4ZYG A;  5FLX Z;  1ON2 A;  2D1H A;  5ICG A;  1FPQ A;  3MWM A;  3IC7 A;  4HDU A;  5JVT A;  2HS5 A;  2BGC A;  2HEO A;  2KKO A;  2YR2 A;  2YU3 A;  3CDH A;  2ZCW A;  1H0M A;  1XSV A;  2RV8 A;  3HYI A;  5ICE A;  3VOE A;  2NRA C;  4AD9 A;  2IRF G;  2ISY A;  1UST A;  3VB2 A;  2ZNY A;  3KLN A;  2A3S A;  2RQP A;  1XD7 A;  1QNT A;  3P9K A;  4RB2 C;  4FX0 A;  1LQ1 A;  1ZAR A;  4KMF A;  4ETS A;  1U78 A;  2FQ3 A;  1YO5 C;  2OZ6 A;  1LJ9 A;  3E5X A;  2IA0 A;  4ON0 A;  2QEN A;  1HBX G;  2FU4 A;  3RKW A;  5J8C A;  2XAQ A;  1QQI A;  2X4H A;  2UXN A;  1BM9 A;  1CF7 B;  2DK5 A;  5ERI A;  3MEX A;  1QPM A;  1F5T A;  3ERE D;  5K5Q A; 
#chains in the Genus database with same CATH topology
 4GYG A;  3KLO A;  4MHG A;  5FB2 A;  3I59 A;  1D1B A;  3RZO J;  1BW6 A;  3EUK L;  1SAN A;  2ZFU A;  2VXD A;  1HF0 A;  1MBF A;  2QSG X;  3FXK A;  2Z33 A;  2G0E A;  3CCE I;  1LDD A;  1IF1 A;  1U2W A;  4OMZ A;  5J8F A;  2ELJ A;  3WTW C;  2M45 A;  1MMN A;  3PUB A;  4HQE A;  1Z05 A;  3WGG A;  1YG2 A;  3OYK A;  1TZL A;  4RB0 A;  2DTZ A;  4OWR B;  2YPR A;  1A04 A;  3W2V A;  2VKH A;  3ZXS A;  4EM1 A;  3OOU A;  4WXD A;  4C9Y A;  5C4J J;  1G3W A;  2M1B A;  2MLK A;  1XS9 A;  2HDW A;  1XDU A;  1VQM I;  1KYW A;  1VQ9 I;  4BJ5 C;  3QYE A;  3SXY A;  1PDN C;  3HUG B;  1DP7 P;  3FKI J;  1ETX A;  4ZDL A;  2ID3 A;  3HSE A;  3CUQ C;  3KZZ A;  2XKP A;  4D5F A;  2EZL A;  2K9S A;  3V8K A;  3L2Q A;  2UWM A;  4NC6 A;  2KHM A;  3OV8 A;  1R22 A;  4FT8 A;  2E34 A;  3GVA A;  2HVS A;  2V1U A;  3SJM A;  2E71 A;  3GZ5 A;  3FDY A;  1VQ6 I;  4EV0 A;  3IRR A;  3KP5 A;  1XSD A;  4X0G A;  1P9Q C;  4MFE A;  3TDZ C;  3JSP A;  2GOX B;  5FGM A;  4LLL A;  3CCU I;  2VBX A;  1BW5 A;  2GQQ A;  4CZC A;  2CFX A;  4AC0 A;  1HXD A;  2VE9 A;  3ZPL A;  4B3A A;  2DFE A;  3BPV A;  1F43 A;  3DBH B;  1U8R A;  2G9W A;  3O2P E;  3LSG A;  3HC7 A;  5K5O A;  3FMR A;  3GZ6 A;  1V5G A;  1CQT A;  3BP8 A;  1ZR2 A;  2A6E F;  1POG A;  1X3Z B;  4I7H A;  2VOP A;  3SQN A;  2O3F A;  3QP6 A;  2LD5 A;  4XBF A;  2FNA A;  4HF0 A;  2HYJ A;  1S7A A;  4X1E A;  1WGX A;  2EIN H;  2XB5 A;  3FXL A;  2QGU A;  1X2N A;  4G6D A;  1D0Z A;  4ABZ A;  4AVZ A;  4YRV A;  4HF1 A;  3DKY A;  1ZRD A;  2LKX A;  2JN6 A;  1KZH A;  2LBF A;  1QVU A;  1WJC A;  2YX7 A;  3EDP A;  5DCM B;  1X1A A;  2R5Z A;  1DU6 A;  2WWY A;  1DPU A;  2L7F P;  1R1U A;  4DIQ A;  1CF7 A;  3F8B A;  1PJR A;  3I56 I;  1D1A A;  2IPQ X;  4B47 A;  1Q1V A;  1OCZ H;  1XCV A;  2DA3 A;  2M9H A;  3JR9 A;  1JJ8 C;  1QHH D;  1WQ2 A;  2IGM A;  3HIF A;  3V7R A;  4YFK F;  3ZMT A;  1OCO H;  2ECB A;  1Z0X A;  5F0F A;  1BBY A;  4C2U A;  1OYW A;  2DOD A;  4RB1 A;  2LNB A;  4WXH A;  5D5V B;  4BDZ A;  1QA6 A;  1YQA A;  1A35 A;  4EJU A;  2A05 A;  9ANT A;  4D5C A;  2K7L A;  3CC4 I;  3KZY A;  2LMD A;  5CYV A;  2E7X A;  1ZK8 A;  3LA7 A;  4NQW A;  1Z3X A;  5KK1 A;  4XRS A;  1ZGA A;  5LFA A;  3REO A;  1VTN C;  2E7W A;  5HLI A;  3LSR A;  2P8T A;  3PFY A;  2AXT C;  2DT5 A;  3HUG A;  3OYD A;  3BR1 A;  2JA5 J;  2E2I J;  4IKF A;  3S2D J;  1FZP B;  5L3F A;  1BR1 A;  3P5J A;  4A3F J;  1T56 A;  3E6B A;  5CVI A;  2OBP A;  4HPQ A;  3H9Q A;  5LBQ A;  5DUI A;  5CVJ A;  3PNY A;  1A31 A;  3ASN H;  4IRH A;  1GV2 A;  1E17 A;  3BLY A;  2O9L A;  3ECO A;  3U1D A;  4HNT A;  1PUF B;  2QUF A;  1IN6 A;  4PK4 A;  1E3H A;  3GFI A;  3ZMV A;  1LEA A;  3G1O A;  1YX5 A;  2A6H F;  3BWG A;  1TNS A;  2F5F A;  2LC2 A;  2Y30 A;  4XMY A;  4A3E J;  1IDY A;  1R1V A;  4PFP A;  2D2W A;  3DV8 A;  1EF4 A;  3W3C A;  1ZHF A;  1R9T J;  4L5E A;  2IS2 A;  2GM4 A;  5E18 F;  2BVM A;  3D0S A;  2BZT A;  3GTO J;  4I98 B;  1IN8 A;  2MW8 A;  3BR0 A;  4KMU X;  2Y0S A;  5J1Y A;  1YHQ I;  4H0E A;  1TT5 B;  2ELK A;  1LUJ B;  2N8G A;  2HDC A;  3FXM A;  4FTH A;  1J5Y A;  2HKX A;  4HNU A;  2WY7 Q;  5FKM A;  3Q0U A;  3C18 A;  4RDU A;  4ZJZ A;  1W4M A;  4OU0 A;  4MQ9 F;  3ABU A;  3BPX A;  2E1M C;  3IAM 2;  2PMZ N;  1P6R A;  1YIT I;  4UV9 A;  5TRD A;  4EM0 B;  3GCM A;  2DFH A;  3WE3 A;  3SZT A;  2RRE A;  2IJL A;  2ZME A;  5E8I A;  2CUF A;  3JAM K;  2QCO A;  4DGW B;  4E70 A;  5FKK A;  3I53 A;  2WBM A;  3RSN A;  1X3U A;  2LDU A;  1W0T A;  3VSL A;  3BDD A;  4XID A;  3ZMD A;  1SFU A;  2KFD A;  1ZLK A;  4MNU A;  2WV1 A;  3PL8 A;  2L01 A;  3QP5 A;  3HOY J;  3I71 A;  2Y31 A;  1XDS A;  3W6J B;  3ZGK A;  4JQF A;  3LSJ A;  2HWV A;  3S93 A;  2KMU A;  2ESN A;  2ZXJ A;  3A03 A;  4QPO A;  1H8A C;  1H9T A;  2EV5 A;  3GTL J;  3I58 A;  4L5I A;  3OSF A;  4F92 B;  3WG9 A;  4U7D A;  3K70 D;  3PNV A;  5E3L A;  4CIC A;  1YLF A;  4QIW N;  2QZ8 A;  2XIG A;  2MD5 A;  3H0G J;  3PJR A;  2OQG A;  4CCO A;  4GRI A;  5HLG A;  2EB7 A;  4UUV A;  3B02 A;  2E1N A;  2K9M A;  1EA3 A;  2XC7 A;  4HRI A;  1MBG A;  1U6G A;  3OIQ A;  3A01 A;  2MFZ A;  4KN7 X;  1XC5 A;  2ZBK A;  2FEZ A;  1KQ8 A;  2EQR A;  2RAE A;  3AAF A;  1W7P B;  4Q5S F;  2MGQ A;  2GXG A;  4KN4 X;  3QQA A;  2EFQ A;  4MGR A;  1OCP A;  3J7Y J;  1HLV A;  4XLC A;  1ONV A;  5D4R A;  2KIM A;  3GX4 X;  4FIS A;  1FLI A;  2E5N A;  4M6Y A;  4BH9 A;  3NRV A;  5FRO A;  1V55 H;  4KA4 A;  4GGG A;  2L3D A;  3M7G A;  1TQI A;  1ZQ3 P;  3BY6 A;  5L3E A;  4CYC A;  1Y0N A;  4G6Q A;  3G1L A;  2C6Y A;  3F72 A;  2X51 A;  1LDK B;  4CCJ A;  2PMH A;  1S9H A;  4CYC B;  5DDG A;  5HLH A;  2FD5 A;  2LK2 A;  5LGT A;  2BHZ A;  3M9A A;  3V7C A;  4ZTJ A;  3VYT B;  3DBR B;  2IS1 A;  1J59 A;  3M1E A;  1LKX A;  2JA6 J;  1NH3 A;  3RDI A;  3W6K B;  2L4A A;  2CV0 A;  3CDI A;  3D5L A;  1S7E A;  4NQW B;  3DTE A;  2VPR A;  3ULQ B;  5CPR B;  3ZOB A;  2A61 A;  4LD5 A;  5LEJ A;  5LEK A;  3JW4 A;  3KCC A;  1A6I A;  1Z1D A;  1AWC A;  5K5R A;  2CW8 A;  3OMY A;  4YFN F;  4I0A A;  3L09 A;  5CJ9 A;  2H8R A;  3HOX J;  3KEY A;  3IUO A;  3LSH A;  4PJN A;  2X6Y A;  4XN0 A;  4BQQ A;  2X6X A;  2VE8 A;  3UNG C;  3HSR A;  1VQO I;  5FD5 A;  1IRZ A;  1HQC A;  1DGR M;  4ENK A;  2XGE A;  1SEU A;  1FOW A;  2CJJ A;  2XRN A;  1JUP A;  2PG4 A;  4LG3 A;  2XRL A;  1T2K A;  4DZP A;  2ZSH B;  2ZNZ A;  1AU7 A;  1G8X A;  4U88 A;  2QM3 A;  2ZME B;  1R4N B;  3V8L A;  3JRD A;  3PO3 J;  1ZEL A;  1WWX A;  2NXN B;  2LR8 A;  4PGH A;  2DXI A;  1UG0 A;  2Z2S B;  1MW7 A;  1K61 A;  2CUJ A;  4UVB A;  2KZG A;  3IWZ A;  1X1B A;  2V1X A;  4M73 A;  4GCV A;  2MG4 A;  2QSH X;  4LK1 F;  2F4I A;  2FOW A;  2JTV A;  2QWW A;  1UHM A;  1YFH A;  2DA5 A;  4MTE A;  1OIS A;  1XMX A;  1T08 B;  3S1N J;  1REP C;  2F4M B;  2EIM H;  1ETV A;  2VC1 A;  4RAF A;  5F08 A;  5KHD A;  2W7N A;  2R5Y B;  5E79 C;  1IUY A;  2V9K A;  5FFZ A;  1UFM A;  2BEO A;  4RGU A;  1WZ2 A;  1G2H A;  1MIJ A;  1XB4 A;  2KRH A;  5F1R A;  2HZT A;  3C2H A;  2EV0 A;  1YI2 I;  3GLX A;  4B44 A;  3KFW X;  5DEQ A;  4IX7 A;  4N9H A;  3RPU D;  2R7X A;  3TQN A;  5EF6 A;  1MMS A;  1EH8 A;  2LFB A;  3AG4 H;  4IRI A;  5EJC A;  5DYM A;  4RGX A;  1RUO A;  3SHF A;  4RGS A;  1IV6 A;  4WXC A;  1RPW A;  4OIR F;  1IUF A;  1K4S A;  4HF2 A;  1O3R A;  3RZD J;  4I02 A;  1ULY A;  3K1P A;  2WAQ N;  2VI6 A;  3BTI A;  1MNE A;  3Q0W A;  3KIO A;  5TIS C;  3D5R C;  1BN5 A;  3KEQ A;  3J80 Z;  4RB3 C;  4R1H A;  2EZH A;  2ETH A;  2ISZ A;  4ZZD A;  3K2A A;  1WFX A;  1T33 A;  2XAH A;  3S8P A;  4XK4 A;  3FBI B;  5CVU A;  2GXA A;  1ZR4 A;  2DJI A;  2K4J A;  2ZJ2 A;  3GTP J;  2A07 F;  1AOY A;  2CS3 A;  3HRU A;  3K6G A;  4I76 A;  1NG6 A;  2FSW A;  2G7U A;  3K10 A;  3LSI A;  3K4M A;  4AIH A;  2LKP A;  3GTJ J;  1W36 D;  1SFO J;  3OYG A;  5HDN A;  4UB6 C;  3D1N I;  3CCL I;  1X19 A;  3AFH A;  4ZDP A;  3L1P A;  4BHC A;  2V6E A;  3MKW B;  2EA4 A;  1SD5 A;  4PJJ A;  3A0H C;  2M7A A;  3TP0 A;  3WTS C;  4A3M J;  1WCM J;  1T0F C;  1UCR A;  1RI7 A;  5A2Q K;  1RNL A;  1I27 A;  3H3Z A;  2IEK A;  4HX8 A;  1V4R A;  2DA4 A;  3DU5 A;  2H94 A;  5L3C A;  1FT9 A;  2KDO A;  1BJA A;  1W5T A;  3COA C;  1SAU A;  5C44 J;  1FTZ A;  1ZRE A;  2NS7 A;  4LLN A;  3B73 A;  1P4X A;  1P7I A;  2K5C A;  2XF7 A;  4XSX F;  5FRN A;  3ESW B;  4UXN A;  3JCU C;  1R1T A;  3FXQ A;  3GXO A;  1Y6I A;  1FX7 A;  3MZ8 A;  3R0J A;  4HDV A;  3V4G A;  3FIW A;  2CRG A;  2XGC A;  3NWT A;  2BW3 A;  4EM2 A;  5BOX A;  1YJ9 I;  2BY1 A;  4IL6 C;  3TOB A;  3ZMZ A;  2M8G X;  1MSF C;  2LYC A;  3DXJ F;  2CW0 F;  1BI0 A;  2DJN A;  2NNY A;  3OOP A;  4F91 B;  3WU2 C;  4OIN F;  3S16 J;  3GFM A;  4DJA A;  2DAO A;  2W4S A;  3HHH A;  5M3F J;  4UUS B;  4UVC A;  3GEZ A;  5K7Z A;  1DPR A;  1HDD C;  4II2 A;  4IHY A;  1I39 A;  3H9G A;  1VQ8 I;  3BJO A;  1QVT A;  2LP0 A;  2VBZ A;  2TRT A;  3FXO A;  5TGT A;  4P9U A;  3K69 A;  1SFX A;  3K4C A;  1IG7 A;  3I0T A;  2WAQ A;  1S3J A;  3TO6 A;  1Z77 A;  4EMS A;  3GTK J;  3UR3 C;  4BXU A;  1PYV A;  1XGM A;  5CQG A;  2NVX J;  2VOD A;  4PCQ A;  3ABM H;  5J4Y A;  3J81 K;  1XGN A;  3ZP5 A;  2XGD A;  4YEL A;  3PIO F;  1TWA J;  3QYF A;  2HU9 A;  5LHH A;  4F52 A;  4NDL A;  4IOA F;  4IVN A;  1DP3 A;  1BR4 A;  1FMW A;  2XAS A;  3BQZ A;  3HOT A;  1YIO A;  3MZH A;  1JT6 A;  2HNH A;  1TT0 A;  2ZJQ F;  3N4M A;  2UV1 A;  1YIJ I;  1FYM A;  4I99 C;  1VQ5 I;  4Y3O A;  4C3J J;  2JK3 A;  3WTY C;  4J19 A;  1ORK A;  1V54 H;  3RIR A;  1ETW A;  2X0L A;  1R4M B;  5AIQ A;  1UJ8 A;  5ICC A;  3CUO A;  3WTX C;  1H9G A;  1OLT A;  3BZC A;  2H09 A;  1Z9C A;  1MJB A;  3ROU A;  2X48 A;  3TW7 A;  3S1R J;  3CP2 A;  3O3K A;  2OD5 A;  5FO5 A;  1FBS A;  4JX6 A;  4NHJ A;  4UVA A;  3CLQ A;  1B8I B;  2HXO A;  3RI4 A;  1M1E B;  1I1G A;  1WI3 A;  1WRJ A;  3TW6 A;  1Z91 A;  2NS0 A;  1KU7 A;  3VWB A;  3HG9 A;  1I6H J;  3HTU A;  5E1W A;  4V2G A;  4U0Y A;  1YS6 A;  3VPR A;  1V5E A;  3S32 A;  4KUM A;  1OYI A;  2NYX A;  1TQP A;  4WF2 A;  4EVI A;  5J1R A;  4G7H F;  3EQL F;  3L2V A;  4V19 K;  3BG3 A;  4HSR A;  4L9J A;  2AO9 A;  2E2H J;  2QQ9 A;  4N9I A;  4CXF A;  3OS2 A;  4ASN A;  5J47 A;  1LEB A;  4YFX F;  5LRS A;  4AYB N;  5E17 F;  2HTS A;  1O57 A;  3DP7 A;  2KIS A;  4P55 A;  4A6D A;  4HNV A;  2M4G A;  1HKS A;  5TJJ A;  3ZR8 X;  4XKV A;  1TWC J;  4HLX A;  1JHF A;  5AON A;  4C3I J;  3CES A;  3HRM A;  1I50 J;  1T0F A;  4KNY A;  1O3T A;  2K3P A;  1CGP A;  2Y48 A;  3I3L A;  2F5E A;  2HI3 A;  2STW A;  3QU3 A;  5JI6 A;  3F6O A;  4G8X A;  5ILU A;  2ZO4 A;  3RPQ A;  2V6C A;  1FJL A;  3NEU A;  3NQO A;  2OAZ A;  2VKD A;  3S1Q J;  2YSR A;  1XPX A;  3OIP A;  2DN0 A;  2E36 A;  3FXR A;  2JQ7 A;  3FK7 A;  3ZQC A;  2M5W A;  1J9I A;  2W48 A;  2P6S A;  5D6E A;  4BUP A;  3HOW J;  2XUB A;  2DMU A;  3FBN B;  4DYQ A;  4O6J A;  4L18 B;  1U5T C;  4BXX J;  2ZXW H;  3DLL F;  3OSG A;  1K4T A;  2VQG A;  2LRE A;  2VT2 A;  2W57 A;  2OTL I;  2GWR A;  3EYY A;  5IPA A;  3LSP A;  1MMA A;  1GV5 A;  4MLO A;  5J3L A;  2X6O A;  3Q9S A;  3R6S A;  1FTT A;  2DFF A;  4NC8 A;  2DPU A;  1S6L A;  4F93 B;  2E2J J;  4Y13 A;  2OPT A;  4M71 A;  4A2U A;  2OUM A;  3I9V 2;  2M4K A;  3LAP A;  1Y1W J;  4XKC A;  2MA3 A;  4M3D A;  1E3O C;  2MH2 A;  1P4W A;  2Q2E A;  3UKG A;  1MNM C;  5HS7 A;  3W6V A;  4M74 A;  1SD7 A;  4HA8 A;  3T5X A;  1FIA A;  4ZYE A;  4OMY A;  4C2T A;  2IA1 A;  4NC7 A;  3PO2 J;  2DYS H;  3LQQ A;  3ERM A;  3S17 J;  1HSJ A;  2KIU A;  4OOI A;  4Y33 A;  1K78 B;  3FF5 A;  1VFC A;  2VPL A;  3TDU C;  1SMY F;  1VND A;  2NOJ B;  2R5Z B;  4AUX A;  1IXR C;  1YYV A;  4PJM A;  3K9T A;  3HB9 A;  2D45 A;  2E60 A;  2IT0 A;  2L7K A;  3G4S I;  2R7F A;  2K86 A;  2EFN A;  3QPL A;  1C0W A;  2ZJP F;  4CCK A;  5CKT A;  4EJW A;  4J01 A;  3QOD A;  4IHV A;  5HS8 A;  1F1Z A;  2EH3 A;  3BTC A;  3QYB A;  3M8F A;  4L9N A;  5E3N A;  4A3G J;  2P7V B;  1B9N A;  3TED A;  1ZAO A;  1K6Y A;  2ZKZ A;  3G71 I;  4MEY F;  1LFB A;  3KYC B;  4PSW A;  4CCM A;  2OCE A;  5M5Y J;  3F3X A;  3AKZ A;  1N77 A;  5D5U B;  2GAU A;  3JRF A;  3FHZ A;  1HKQ A;  1A5J A;  3W2W A;  4F7Z A;  3OYJ A;  3JRE A;  2R7T A;  2F6C A;  4CSW A;  2HOS A;  4XOR A;  1OR7 A;  4A3D J;  3CO6 C;  1B9M A;  1FWZ A;  2JT1 A;  1RR7 A;  3KEO A;  3QOE A;  1X3W B;  2VUM J;  3M4O J;  4ENN A;  2IP2 A;  4QLC U;  4YG2 F;  3CCR I;  3S3M A;  3QOP A;  1TW3 A;  2R4G A;  2RGV A;  3R0A A;  4RLF A;  2KP6 A;  2DW4 A;  2XAG A;  1LFP A;  4D7M A;  1L3L A;  3U2R A;  3VEP A;  5IOY A;  2VOO A;  3I5U A;  2OTJ I;  4L0Y B;  3MKZ A;  5BPI A;  1SAX A;  4D1Q A;  3H5A A;  2LKS A;  2JPB A;  3E1S A;  4P5O A;  3P9I A;  1HW5 A;  2VJ4 A;  1I5Z A;  2HGC A;  4L9T A;  5EEA A;  1BC8 C;  3CCY A;  1K6O A;  5LHG A;  4P1W A;  4HAM A;  4CCN A;  4M3G A;  1MDM A;  4XKB A;  4HX4 A;  3K4B A;  2K40 A;  4X6A J;  1JJ6 C;  1MZB A;  2WC2 A;  3DFG A;  2BY0 A;  2EJR A;  4HBL A;  1YX3 A;  4XLH A;  4EJT A;  3VSK A;  4PFO A;  1TC3 C;  2HVR A;  4IO9 F;  2EFO A;  4AIK A;  2LRD A;  4PZJ A;  2HDD A;  2ME0 A;  2VQH A;  3MD2 A;  4RM3 A;  1HDP A;  2GA2 A;  3V8J A;  4CO8 A;  4II3 A;  4Y17 A;  2JVH A;  3FXU A;  4B8X A;  4G12 A;  1FYL A;  2F2E A;  2QF7 A;  2UUZ A;  4CDG A;  4UHT A;  5BMZ A;  1WJB A;  4C2M J;  1TTY A;  5GP9 A;  1MMD A;  5LRR A;  3HHG A;  3Q9V A;  3HXL A;  2HTJ A;  2L4M A;  1B4A A;  1MKM A;  2HYG D;  3OYC A;  1MND A;  4M3B A;  3CCS I;  4BNC A;  1LB2 A;  3WTZ A;  4DYR A;  4DBQ A;  3H1C A;  2IS4 A;  4DBR A;  3PUF A;  4FCY A;  1ETK A;  1D1C A;  2XAF A;  3DCF A;  2E1O A;  5B66 C;  2HQN A;  2V1N A;  2VC0 A;  2PMU A;  2MBF A;  3MZY A;  4M9Z A;  3RQI A;  1GVD A;  3BG9 A;  5GPC A;  1H89 C;  3CD6 I;  3F8M A;  1H88 C;  2DU9 A;  2CO5 A;  3ZCO A;  3WTV C;  4M9X A;  1R00 A;  3CLO A;  3WHB A;  2UZK A;  2WB1 A;  2XF5 A;  4BYY A;  3DTI A;  1I1S A;  4GXO A;  5LGN A;  2CW7 A;  3I4N J;  3ABT A;  1R36 A;  5E3M A;  2BHY A;  3KP7 A;  1R23 A;  1SVM A;  3CCM I;  3H0D A;  4RA2 A;  1K7A A;  2P0W A;  3EPZ A;  4AIJ A;  2HPM A;  2QQB A;  5ED4 A;  1MBH A;  4KJZ A;  2KDZ A;  2L9S A;  5GAE J;  3OYE A;  1DDN A;  1RES A;  3F9K A;  2PI0 A;  3H5N A;  1IN5 A;  1EV7 A;  3FMS A;  4EGZ A;  2CQX A;  5HLT A;  5L3B A;  2KJB A;  3IKV A;  4U7B A;  4U0W A;  1OYY A;  2BY3 A;  4W1U A;  3OYL A;  3JRC A;  2OQR A;  4L9V A;  2IGN A;  1J0R A;  2TDX A;  1MJA A;  3HM5 A;  1IW7 F;  3ZQQ A;  1PUE E;  3BG6 A;  3FZV A;  5GTH C;  3KYL A;  1SD6 A;  1N78 A;  2Y9Y A;  1FC3 A;  2M34 A;  2BOL A;  3R60 A;  4BHB A;  1RET A;  3ABK H;  1E3P A;  1F36 A;  1WI9 A;  2M3A A;  4MIM A;  1HW2 A;  1X4O A;  4BEH A;  4IPA A;  4ZYD A;  4DNC A;  2ZJR F;  5K7H A;  2ZFW A;  1VQK I;  2HQR A;  2ZME C;  1UHS A;  1BR2 A;  1J09 A;  1BC7 C;  4OAY A;  1V5F A;  4KDP A;  2VBW A;  3SEQ A;  3N05 A;  2P7C B;  5J40 A;  1IC8 A;  2D1V A;  4IHX A;  2QQA A;  3M8E A;  2XPV A;  4KIC A;  3SDB A;  1Z21 A;  4XRF A;  1B6A A;  2R7Q A;  3CUQ A;  4TV7 A;  2DDA A;  3I55 I;  5D5W B;  1STZ A;  5HS9 A;  3O8H A;  4XLF A;  2CG4 A;  3CJT B;  2STT A;  1ACI A;  3JSO A;  1U9O A;  4A6E A;  1ZGW A;  4QWQ A;  4CUG A;  4YIR X;  1Z6T A;  2O7O A;  1VQ7 I;  1NHA A;  2ME6 A;  4XRS G;  1I3A A;  2COB A;  2CU7 A;  5J6X A;  3V7S A;  3DF8 A;  3ZN1 A;  4R79 A;  2IGK A;  2W84 A;  4A12 A;  3LSK A;  2UXX A;  1HCR A;  2L9V A;  3HZJ A;  1FSH A;  2KJC A;  2QQ8 A;  1QZE A;  3N97 A;  4L5J A;  4HX7 A;  5A2Q Z;  2R93 J;  4ZZL A;  4MTD A;  1SMT A;  3HOU J;  2EFW A;  1Z6R A;  3AL0 C;  1AKH A;  3IH2 A;  2CFO A;  3C1D A;  1ZH5 A;  1D8J A;  1WHU A;  1HA8 A;  4V2F A;  4LG0 A;  3CMA I;  4MEX F;  4KT6 A;  1QHG A;  1IDZ A;  4K2E A;  5IP7 J;  3CMY A;  1MD0 A;  2ESH A;  2TCT A;  2WAE A;  3CTA A;  3GFJ A;  1S29 A;  2DQR A;  2WAF A;  3K70 C;  2LBF B;  5DM7 F;  3S3O A;  1MH3 A;  4JX4 A;  2BVL A;  2NVU B;  2QSF X;  3B6A A;  3GFL A;  2P4W A;  5D6F A;  2L7M P;  5K1Y A;  4WX9 A;  4Y15 A;  3DEE A;  2JMW A;  4B43 A;  2X6W A;  2FE3 A;  2DMP A;  3E3V A;  4E6K G;  2K9N A;  4MFD A;  4BXF A;  1D8K A;  4EQQ A;  3FWE A;  5LHI A;  1ZG1 A;  2XDV A;  2NAZ A;  1Z7U A;  1G6N A;  4G7Z F;  2RKH A;  1GHC A;  4FAS D;  4NB5 A;  1YJW I;  2F4O B;  2DLL A;  2QLZ A;  4E7I A;  4ZTF A;  3H36 A;  1BI3 A;  2L54 A;  4WK8 F;  2MYS A;  3GLL A;  4IRG A;  2VJ5 A;  4KFC A;  1GXQ A;  3AL0 B;  1TP4 A;  3VYS B;  1ENH A;  1X2M A;  1LFU P;  1OCC H;  4FQG A;  2H6B A;  1WPK A;  2FF4 A;  2HOA A;  1JUS A;  1KQ9 A;  2ACJ A;  2M87 A;  1MJ9 A;  5HOD A;  2O0Y A;  4A69 C;  5DV5 A;  4G7O F;  1Y39 A;  2Z16 A;  3BQY A;  1RUN A;  3RYR A;  3HPH A;  3TL4 X;  2VAS A;  1EH6 A;  2H6C A;  2NOG A;  2IBD A;  3BCA A;  4A0Y A;  2XKO A;  3KX2 A;  3L2U A;  3TBI A;  3I4M J;  3RPU A;  5IY5 H;  4BJT A;  1Q1H A;  2F5C A;  3KYD B;  2HPI A;  1W1W E;  4IHS A;  3L00 A;  2LVS A;  1BOB A;  4EEF G;  3WGI A;  2BYV E;  2P5V A;  3T0Y A;  1NK2 P;  4JK1 X;  4D7N A;  3I59 B;  1F4K A;  4U0V A;  5F64 A;  3JTH A;  3P9C A;  4A3K J;  2GXB A;  3ZN0 A;  4OIQ F;  2GA1 A;  3L2W A;  1A36 A;  2E19 A;  2I5U A;  5GAD J;  3CME I;  5IT3 A;  4AM3 A;  2OCC H;  3WG7 H;  2HXI A;  3ZRG A;  2Z99 A;  4A5N A;  3V42 A;  2IA2 A;  4BU2 A;  1AKH B;  1U0J A;  2R92 J;  1VZ0 A;  1U8B A;  3WU0 A;  1O7F A;  3RCO A;  2XPU A;  3K4K A;  5CLS A;  1S72 I;  2EZK A;  4IJA A;  1T8I A;  4RMN A;  4FE7 A;  1MGT A;  1WSU A;  2R3S A;  2CQ7 A;  3CDL A;  2ECC A;  3CZ6 A;  3CUQ B;  1Z3Y A;  1W5C C;  4FE4 A;  2P5L C;  3A1Y A;  3E97 A;  3QPS A;  2DOF A;  3BR5 A;  2O61 A;  2QYO A;  2NNN A;  4RM2 A;  2LY9 A;  5B5E C;  3BZ6 A;  3CF5 F;  2A68 F;  3E6M A;  3I4P A;  4IQ4 A;  3FM5 A;  4AID A;  2P5K A;  1O7L A;  2W24 A;  1HST A;  5BS6 A;  4O3M A;  1KU9 A;  2ELH A;  1MSE C;  1PP7 U;  3ZQI A;  1RRJ A;  2HYF A;  1FIP A;  1B59 A;  4M6V A;  4I0B A;  2K4B A;  3BR3 A;  1OPC A;  2CH0 A;  2V79 A;  3L7W A;  4B48 A;  2JRM A;  3C2B A;  1KGS A;  1S8N A;  2R7O A;  4Z2Y A;  1FBU A;  2DDB A;  4LG0 B;  1ZRC A;  4FX4 A;  2CSO A;  4HG2 A;  4XON A;  3W2A A;  4KYW A;  4LK0 F;  3CJR B;  1B72 B;  1KU2 A;  4HYE A;  2DI3 A;  1TWF J;  5JHU A;  2J5O A;  4LGW A;  4QTR A;  5BQT A;  1W7P A;  2F48 A;  4BGD A;  2WAD A;  2GIZ A;  3G2B A;  1WJD A;  3KE2 A;  3ISP A;  4HZF A;  1BA5 A;  5DCM A;  3WU1 B;  3GME A;  3VYU B;  4E4H A;  1WJA A;  1L0O C;  3HSF A;  1W36 C;  1WJF A;  1I6X A;  4I01 A;  5DTD A;  2LSO A;  5IT9 K;  4MO7 A;  1IRG A;  2B9S A;  3MN2 A;  2YU9 J;  3SEZ A;  2Z5U A;  2DQL A;  1IV8 A;  3JRI A;  4IZZ A;  2HKO A;  2NS8 A;  1JXS A;  3J7A O;  2FX0 A;  2J5P A;  4CZZ A;  1ZYR F;  4UUT A;  2VJJ A;  2LLK A;  3OWT A;  3PSI A;  1JGG A;  4E7J A;  2XAU A;  2FBK A;  1T38 A;  5C3E J;  3WTT C;  2DTR A;  2O8X A;  4A0X A;  2P6T A;  4RAG A;  2E1C A;  5BNG A;  2VB6 A;  1TNT A;  3ZMU A;  2LG4 A;  3JRB A;  3L2C A;  3PM1 A;  4HW0 A;  2QKM B;  3J81 Z;  4LIU A;  4YII A;  1VQ4 I;  4S0H B;  3SFZ A;  3T8R A;  3ZQ7 A;  3K1M A;  3KET A;  3GTQ J;  2K02 A;  2FBH A;  1F9N A;  2JZY A;  4A0Z A;  4C3H J;  2R7Z J;  1OCT C;  2DO7 A;  1X58 A;  4AVP A;  3GUD A;  2F5D A;  2Y0M A;  4Z6Y A;  1UEL B;  1BI1 A;  3E6C C;  2LTP A;  3MQ0 A;  3IV5 A;  1IZ1 A;  1AA7 A;  4ZDO A;  2ZXH A;  4XQF A;  1QO0 D;  2DA2 A;  5DM6 F;  2KLO A;  4C30 A;  5HVQ C;  3IRQ A;  1N25 A;  3L9F A;  4BE2 A;  4KIG A;  4FET A;  2Q1Z B;  5IYB J;  2XB0 X;  3A0B C;  3KPH A;  2HOT A;  1AHD P;  2BE5 F;  1JE8 A;  2R0Q C;  1KU3 A;  2K3F A;  2EK5 A;  2X1C A;  3K0L A;  1GDT A;  4AWX B;  4DQ2 A;  1IAW A;  2VQC A;  1Y8Q B;  2HQ5 A;  3IH3 A;  2V4J C;  1YE9 A;  4BAY A;  4S05 A;  3S2H J;  4RS8 A;  1ITY A;  3DQV C;  3QPT A;  1GUU A;  3OS1 A;  4ESB A;  2KQR A;  4HOB A;  3RJP A;  4Y4R A;  5D4S A;  2Q0O A;  2JA7 J;  3Q3S A;  4IHW A;  2PJP A;  1TBX A;  2X1E A;  1WH7 A;  5F6F A;  1BL0 A;  2B63 J;  4ZH4 F;  4HEA 2;  1U9N A;  1RR8 C;  1XGO A;  1IXC A;  2AQE A;  4RLQ A;  3LQR A;  1OMI A;  4BJ6 C;  2H27 A;  4Y52 J;  3A02 A;  3OR2 C;  1IN4 A;  5IYD J;  3K4J A;  2L0K A;  2FOK A;  2EA2 A;  5K7F A;  2CQK A;  3EET A;  1JKP C;  1LVA A;  2JWT A;  4E7K A;  2WV0 A;  1JI8 A;  1XN7 A;  5EYR A;  3JRA A;  1KON A;  1K79 A;  1D3Y A;  3ZQG A;  4ENM A;  1T6S A;  3IH4 A;  1ZRF A;  2L02 A;  2EWN A;  2H1K A;  2Z3Y A;  5GPA A;  3E7L A;  1IXS B;  4N4N B;  5M5X J;  2EV6 A;  1MBE A;  1R5I D;  1FMV A;  3BC8 A;  3MAJ A;  2LY2 A;  1R49 A;  4N4O B;  5B1B H;  1TQM A;  4KT5 C;  3LMM A;  4UV8 A;  4BY7 J;  3S14 J;  3MCZ A;  4M3F A;  1YRN A;  2FUG 2;  3GTG J;  5CVV A;  4BHP A;  3SDG A;  3G1M A;  1G59 A;  3WE2 A;  2MC3 A;  2JPC A;  2QEX I;  1YTY A;  1NK3 P;  1JTY A;  2OF7 A;  1FY7 A;  2KRF A;  5LGU A;  1KQ0 A;  1YW7 A;  4D9J A;  1ZTR A;  1JKQ C;  3LWF A;  3J80 K;  1DQU A;  2R7R A;  4YIF A;  5HDK A;  3QPH A;  2HOE A;  2FA5 A;  3O6B B;  1SC7 A;  3OY9 A;  2MC4 A;  1XG1 A;  4U87 A;  1UHW A;  4BBS J;  5FLX K;  4BKX A;  1BOA A;  1R6R A;  5M5W J;  4L0Z B;  3FX3 A;  1QZY A;  1SVO A;  1ZKG A;  2YUS A;  3BCB A;  1LPQ A;  4UNO A;  2QVO A;  3OYA A;  3DLA A;  3A01 B;  3C2G A;  3CCJ I;  2JA8 J;  4F55 A;  4LMY A;  3J7Z I;  3HDD A;  5E3O A;  1FSE A;  2MH9 A;  4P96 A;  6PAX A;  2EZI A;  3TO9 A;  3HL2 A;  5KAF C;  5E1X A;  5FKN A;  1MDM B;  2GIV A;  1U5T A;  5EEG A;  1OKR A;  3RKX A;  2GOM A;  2IS6 A;  4I09 A;  1JHH A;  4QPQ A;  3H3V K;  3BZK A;  4CYD A;  3OYI A;  4R8H A;  3U9G A;  4CA0 A;  4XLN F;  4D0P A;  3QRF F;  4LIV A;  5JHF A;  4M6X A;  1I3Q J;  1USS A;  5GAH J;  3HGG A;  5DS9 A;  3HGY A;  2MD0 A;  2EIL H;  3SZG A;  3R4K A;  3U21 A;  2JUC A;  5CVR A;  2BW3 B;  3KZI C;  1FOX A;  1PUF A;  3K4N A;  1GXP A;  3HRS A;  4QSH A;  4BQA A;  2FBI A;  1S5L C;  2AQF A;  3DBL B;  1P2F A;  4JX5 A;  2CMP A;  3LST A;  4JYK A;  5FLV A;  1OR7 C;  3TO7 A;  4PJ0 C;  2AS5 F;  1ODD A;  4UUS A;  1SFE A;  3FM3 A;  1FBQ A;  4A93 J;  2H8W A;  2KZV A;  5EG0 A;  1O4X A;  4GO1 A;  3FIS A;  3Q5F A;  2ZB9 A;  2CGP A;  2A6T A;  2YS9 A;  2W82 A;  2QBY A;  5EG0 B;  1XMK A;  4E7Z A;  3LSM A;  3EUH A;  2FMY A;  1VI0 A;  2QBY B;  1YS7 A;  2CYY A;  4CHU A;  1Y0U A;  3C3W A;  3DKX A;  1NG7 A;  3KP6 A;  4A3C J;  2QKL B;  1JKR C;  1APL C;  5DD4 A;  1XMA A;  4RAY A;  3SYT A;  3ZMS A;  5ILV A;  3OYB A;  1G4D A;  3OR1 C;  2M0C A;  4Y7N J;  3CP8 A;  5F0C A;  2LOO A;  3KP2 A;  2Y75 A;  1R58 A;  3KP3 A;  4IHT A;  1G3T A;  3OYM A;  2R7U A;  2O5R A;  3IP4 B;  2E5Z A;  5KNL A;  1OFC X;  2DA7 A;  5DUK A;  1R71 A;  3PQJ A;  1FYK A;  1D5Y A;  2KIQ A;  2V9P A;  5EZH A;  3GZN B;  3GTM J;  4DW6 A;  1P92 A;  2R5Y A;  2XV4 S;  2A69 F;  3LNQ A;  1IN7 A;  2W25 A;  1WKM A;  4XR6 A;  3EUA A;  1UMQ A;  1PP8 F;  2X85 A;  4ENJ A;  1UZC A;  1WJ5 A;  1VQP I;  3VOD A;  3I54 A;  4B3X A;  1MBJ A;  2JSC A;  2MAB A;  3LA2 A;  1Y56 A;  1ZG3 A;  5EEH A;  1LE8 B;  5E1Z B;  4IQJ A;  3GWZ A;  4DZJ A;  4EJO A;  5FRM A;  3H92 A;  3E5U A;  2YX4 A;  2KPM A;  2ZXI A;  4ESF A;  3D5S C;  1SFK A;  5HNF A;  5DD8 A;  5GAG J;  3F8N A;  1B72 A;  4KIS A;  5FKO A;  3ZQH A;  4BBR J;  1NTC A;  4RBO A;  3C7J A;  2IW5 A;  4AYB A;  1U5T B;  2RDP A;  3VDX A;  1JUM A;  1TWH J;  2CUE A;  3CJQ B;  2QA4 I;  2DYR H;  1IRX A;  2HQA A;  2DFI A;  2ICW G;  2PEX A;  1U3E M;  2Y0S N;  3X2Q H;  2HR3 A;  4IOC F;  3DWL E;  4KIT B;  4BE0 A;  2CQQ A;  1ETO A;  2AXL A;  4DOZ A;  5F0H A;  2O6G E;  2M8E A;  3WTU C;  3BJA A;  3FHN A;  4XLE A;  2VQL A;  3F6V A;  2V7F A;  4BY1 J;  3F0C A;  2W85 A;  3IWF A;  5DCF A;  2PJR A;  2BV6 A;  3AG2 H;  2PFB A;  3SFI A;  3OL4 A;  1O3Q A;  5D8K B;  2VJI A;  1OCR H;  1ZLJ A;  2PJR B;  2FML A;  3SZP A;  2P81 A;  4GDF A;  4S04 A;  4ANJ A;  5HNH A;  2PN6 A;  3HKZ A;  2VN2 A;  1RKT A;  3F22 A;  4OIO F;  2XAJ A;  4PGG A;  4RGR A;  4ESJ A;  2M30 A;  3H3U A;  3OL3 A;  3QAH A;  4EJV A;  2A5Y B;  2VT3 A;  1XTA A;  2DOE A;  4M72 A;  4WWC A;  3OYN A;  2VKV A;  3J7A Y;  3CJN A;  4KIB A;  4XNF A;  4PJL A;  1MMG A;  4G94 A;  3ECH A;  2OV7 A;  2Y2Z A;  3GO5 A;  3CC7 I;  4XLP F;  3HJE A;  3A2K A;  2CUZ A;  3O8G A;  1VQL I;  3PSF A;  2DMQ A;  2VON A;  4FHT A;  1D0X A;  1ON1 A;  4Q47 A;  1FNN A;  3GYH X;  4CGZ A;  3HRT A;  2PQ8 A;  2PLY A;  2A5W A;  2WB1 N;  1ETY A;  5EGO B;  3F21 A;  2Z1D A;  1FEX A;  3FXJ A;  2DCE A;  1ZGJ A;  4N0B A;  1EH7 A;  3JAM Z;  2L2O A;  1QU3 A;  3DPT A;  3H35 A;  3BJ6 A;  4UB8 C;  5C4X J;  2V9V A;  2BBY A;  4E7L A;  2OU2 A;  1P4A A;  4A3B J;  2RQQ A;  3TP3 A;  1O3S A;  4A5M A;  3LFK A;  4O5V A;  3TGN A;  5EDN A;  1UAA A;  1LDJ A;  2NVY J;  1K78 A;  1VF9 A;  1LE8 A;  3DPL C;  3TKY A;  3BOQ A;  1W5S A;  1N75 A;  1FP2 A;  1ETQ A;  2PBI A;  5F1J A;  2B7E A;  4IF4 A;  3TOA A;  2FJ1 A;  3U1K A;  4G9Y A;  1QGP A;  2E35 A;  1RZ4 A;  3HOS A;  3PQK A;  3BRO A;  2EPF A;  3F8F A;  4HST A;  2IGO A;  3DEW A;  2WTE A;  2DT6 A;  3F8C A;  2FRH A;  2RNJ A;  5ILS A;  3OYF A;  2R7D A;  5IT9 Z;  2XSD C;  3LOC A;  2XPW A;  1UG2 A;  1X4P A;  2DK8 A;  3ABL H;  2RC4 A;  3BTL A;  4HQM A;  3M1C A;  3F23 A;  1S7O A;  2K27 A;  2DOA A;  2VLA A;  4HLY A;  5EZG A;  4PSX A;  3CO7 C;  2E1M B;  3RTR A;  1XCB A;  4WCG A;  2CWE A;  2R7W A;  2BXZ A;  2JRT A;  1QRY A;  2COM A;  3KP4 A;  3DU6 A;  3R61 A;  3BTJ A;  3BG5 A;  2XGX A;  3DPU A;  3EUH C;  5H6Q A;  4DYC A;  1EJ9 A;  2Q8K A;  2VL8 A;  4H4K C;  4NBQ A;  2JSP A;  3K7A J;  3I64 A;  1FOY A;  1DUX C;  1KYZ A;  3BR2 A;  4KIF A;  3BG7 A;  3CCQ I;  4JBA A;  4CCL A;  2ZC2 A;  3PFI A;  2L9N A;  2JVG A;  4GYI A;  4Q4Z F;  5IP9 J;  4ITV A;  1TWG J;  2H1L A;  3PNT A;  3RYP A;  4BE1 A;  2RNG A;  4M9S A;  1EKE A;  4A3I J;  1RKW A;  2NVQ J;  3HOZ J;  4IXA A;  4JP0 A;  1K83 J;  2KL4 A;  1QBJ A;  2Y9Z A;  5JR3 A;  5K5Q A;  2L7Z A;  3K4L A;  5FKL A;  4B4C A;  1B8I A;  2RN7 A;  5H6R A;  2M0M A;  3P7N A;  2EFP A;  3CF2 A;  1R7J A;  2XHK A;  3IKT A;  4LFU A;  3FKJ A;  2OZU A;  2IXS A;  3ML6 A;  4LJZ F;  5D8L B;  3E0J B;  3CQZ J;  5H2F C;  4I2O A;  3BR6 A;  4B09 A;  3ZQL A;  1W7P D;  1HKT A;  5E8G A;  1UB9 A;  1DGW Y;  3L2R A;  4BQO A;  5EGO A;  3LAJ A;  4PDK A;  4LB5 A;  1B1B A;  3A4C A;  1FP1 D;  2DMT A;  2ADU A;  1RC9 A;  4LOC A;  2X9D A;  4XOT A;  1ERD A;  3RKY A;  3RQ4 A;  4CH7 A;  4F3Q A;  3EYI A;  1IGN A;  1SD4 A;  1WVR A;  4XN3 A;  2LY1 A;  1J75 A;  1J2X A;  2FXA A;  3T8T A;  3K2Z A;  4BS9 A;  2FQ4 A;  2CQN A;  2RVC A;  3AG1 H;  3WOD F;  3CC2 I;  2M2E A;  4E7S A;  2V26 A;  1ZN2 A;  3NAR A;  5F27 A;  3H9J A;  1XSX A;  3IHU A;  1KA8 A;  1G3Y A;  2ZSI B;  3JRH A;  4IEJ A;  1RIO H;  3ONQ A;  1YOV B;  5L3D A;  3IL2 A;  2DT7 B;  4JOM A;  4XL9 A;  2V1D A;  2XVC A;  3QWL A;  4XM3 A;  4AU7 A;  4XIC A;  1D5V A;  3Q0V A;  3E6D A;  1PVE A;  5JFR A;  2L9R A;  5IYC J;  2VIX A;  1BIA A;  3E5Q A;  2NVT J;  1WH5 A;  2PX9 A;  5IP6 A;  3T1B A;  2B0L A;  1WJE A;  1BI2 A;  3G6E I;  1XGS A;  2EIK H;  5BPD A;  3G73 A;  3G3Z A;  2VKE A;  2W1O A;  1OJL A;  5JLX A;  4XRM A;  2DMN A;  2Q2E B;  1X1P A;  3OYH A;  1G3S A;  1X1D A;  2MLG A;  5CQE A;  4EGY A;  4LB6 B;  3MFK A;  1HW1 A;  4ZYA A;  2OA4 A;  1IRF A;  5KVR A;  1OQY A;  1QPI A;  4EAT A;  1Z7L A;  2HFH A;  5FD6 A;  2LF8 A;  3K1N A;  4UY8 I;  3WGH A;  2VBY A;  4G6T B;  4XKW A;  3DKW A;  5KAI C;  5FLM J;  1BIB A;  2IVM A;  3OIO A;  1XX5 A;  1YW8 A;  3LA3 A;  2DBB A;  1LVK A;  2XRO A;  5JVG F;  3M07 A;  3GW2 A;  3NAU A;  1E2X A;  3AG3 H;  1J7K A;  2EBI A;  3ASO H;  3DTK A;  3QU6 A;  5FFX A;  2LF7 A;  3S2W A;  3CMM A;  1T98 A;  4GFB A;  4HV5 A;  4LLG F;  1V3F A;  5AIP A;  5LD2 C;  2FNP A;  5D5X B;  3LL7 A;  4XSZ F;  5H20 A;  1Y8R B;  3IAS 2;  1GVJ A;  1TLH B;  2JA2 A;  1JT0 A;  1E0E A;  3WHC A;  3MMY B;  3B6C A;  3ELK A;  3MKL A;  4A3L J;  2GBY A;  5HOO A;  4Q48 A;  2O8K A;  5L3G A;  3HTS B;  1JGS A;  1YW9 A;  5M3M J;  2KIF A;  4M3E A;  1LNW A;  5B3S H;  2XSJ C;  4BEH B;  3OS0 A;  4HV6 A;  4I6Z A;  3M3Y J;  4BAC A;  1IO2 A;  3DEU A;  3JTG A;  2O03 A;  5KCM A;  4PUS A;  5J4V A;  2IAI A;  1DU0 A;  2G7H A;  3GF2 A;  4RAZ A;  1IJW C;  5J1U A;  4ZYH A;  3VFZ A;  2EIJ H;  4A3J J;  3MKY B;  3JRG A;  5LLQ A;  2GZW A;  4J00 A;  1R5G A;  3GBG A;  4OIP F;  1T95 A;  4MQV A;  1R5H A;  1P7J A;  2I10 A;  3HPG A;  2KRC A;  2VXZ A;  5HDG A;  3RKQ A;  5E20 A;  1QZZ A;  3NWS A;  2WA0 A;  1TL8 A;  3FMQ A;  1FOK A;  2Z9O A;  1ZG5 A;  3M8J A;  2BY2 A;  3S1M J;  4OAZ A;  4BQN A;  1T39 A;  2DPD A;  4P9F A;  1TW2 A;  2OJE D;  5GTI C;  5ICF A;  2F5V A;  4ZYG A;  5FLX Z;  3BT9 A;  1ON2 A;  2D1H A;  4XLA A;  5ICG A;  4BDY A;  1D0Y A;  1FPQ A;  1GLN A;  3IC7 A;  3MWM A;  4HDU A;  5JVT A;  3S3N A;  3VYR B;  2HS5 A;  1SVL A;  2BGC A;  2BXY A;  2HEO A;  2KKO A;  3ZQF A;  3LFU A;  1MBK A;  3PIP F;  2YR2 A;  1Y1V J;  2YU3 A;  1VQN I;  3H5R A;  4B1R A;  3CDH A;  2ZCW A;  2X1D A;  2M7B A;  2L5Q A;  2CV1 A;  1Z67 A;  1H0M A;  5FJ8 J;  1XSV A;  4XOP A;  2RV8 A;  2MSY A;  3FK6 A;  3HYI A;  2HVQ A;  3VOE A;  5ICE A;  2AHQ A;  4BL0 B;  3S15 J;  4NNJ A;  1YRN B;  2NRA C;  1HC8 A;  4AD9 A;  2IRF G;  2ISY A;  1UST A;  3VB2 A;  2ZNY A;  2D5V A;  3KLN A;  1A6Q A;  3HBL A;  3CCV I;  2A3S A;  2RQP A;  3HEF A;  2R7S A;  2CV2 A;  3HOV J;  2R7V A;  5F04 A;  1XD7 A;  2HZD A;  2ID6 A;  1QNT A;  2K85 A;  3P9K A;  4RB2 C;  2K9L A;  4FX0 A;  1LQ1 A;  2WY8 Q;  2LH9 A;  2DA6 A;  1ZAR A;  2KT0 A;  4YEJ A;  2W00 A;  2K9Q A;  4KMF A;  4ETS A;  1MH4 A;  2Y69 H;  4E7H A;  1U78 A;  2FQ3 A;  1YO5 C;  1JTX A;  5JLW A;  1W0U A;  1HOM A;  2GLO A;  2OC6 A;  2OZ6 A;  1X1C A;  1LJ9 A;  3E5X A;  2IA0 A;  4ON0 A;  2QEN A;  1HBX G;  3TMO A;  2FU4 A;  3RKW A;  5B1A H;  1GT0 C;  4LIT A;  5J8C A;  1BJZ A;  3MVP A;  1YJN I;  2JJ7 A;  2XF6 A;  2XAQ A;  1QQI A;  2X4H A;  2UXN A;  1JKO C;  1BM9 A;  4W97 A;  2JUG A;  1CF7 B;  2DK5 A;  5ERI A;  4NUB A;  3MEX A;  3HKZ N;  1QPM A;  2I8D A;  2DA1 A;  1F5T A;  2PMZ A;  3ERE D;  4ZC3 A;  5IOZ A; 
#chains in the Genus database with same CATH homology
 4GYG A;  3KLO A;  4MHG A;  5FB2 A;  3I59 A;  2Z33 A;  1LDD A;  1IF1 A;  1U2W A;  4OMZ A;  5J8F A;  3WTW C;  2M45 A;  4HQE A;  1Z05 A;  3WGG A;  1YG2 A;  4RB0 A;  2YPR A;  1A04 A;  4EM1 A;  4WXD A;  1G3W A;  2M1B A;  2MLK A;  1XDU A;  1KYW A;  3SXY A;  1PDN C;  1DP7 P;  3HSE A;  3CUQ C;  3KZZ A;  2XKP A;  3V8K A;  2UWM A;  3OV8 A;  1R22 A;  4FT8 A;  3GVA A;  2V1U A;  3GZ5 A;  4EV0 A;  3IRR A;  3KP5 A;  1XSD A;  3TDZ C;  3JSP A;  5FGM A;  4LLL A;  2VBX A;  2GQQ A;  2CFX A;  1HXD A;  2VE9 A;  3ZPL A;  3BPV A;  1U8R A;  2G9W A;  3O2P E;  5K5O A;  3FMR A;  3GZ6 A;  3BP8 A;  2A6E F;  4I7H A;  2VOP A;  3SQN A;  2O3F A;  3QP6 A;  4XBF A;  2FNA A;  4HF0 A;  1S7A A;  4G6D A;  4HF1 A;  1ZRD A;  2YX7 A;  3EDP A;  5DCM B;  2WWY A;  1DPU A;  1R1U A;  1CF7 A;  3F8B A;  2IPQ X;  1XCV A;  3V7R A;  1WQ2 A;  3HIF A;  4YFK F;  3ZMT A;  1BBY A;  1OYW A;  4RB1 A;  2LNB A;  4WXH A;  5D5V B;  1YQA A;  4EJU A;  2K7L A;  3KZY A;  5CYV A;  2E7X A;  3LA7 A;  4NQW A;  5KK1 A;  1ZGA A;  3REO A;  1VTN C;  2E7W A;  5HLI A;  2P8T A;  2DT5 A;  3HUG A;  1FZP B;  5L3F A;  3E6B A;  5CVI A;  2OBP A;  5LBQ A;  5DUI A;  5CVJ A;  1E17 A;  4IRH A;  3ECO A;  3U1D A;  2QUF A;  1IN6 A;  3GFI A;  3ZMV A;  1LEA A;  2A6H F;  3BWG A;  1TNS A;  2F5F A;  1R1V A;  2D2W A;  3DV8 A;  1ZHF A;  5E18 F;  3D0S A;  4I98 B;  1IN8 A;  4KMU X;  4H0E A;  2HDC A;  1J5Y A;  2HKX A;  3C18 A;  1W4M A;  4OU0 A;  4MQ9 F;  3ABU A;  3BPX A;  1P6R A;  4UV9 A;  5TRD A;  4EM0 B;  3WE3 A;  3SZT A;  2IJL A;  2ZME A;  5E8I A;  3JAM K;  4E70 A;  3I53 A;  1X3U A;  2LDU A;  3BDD A;  3ZMD A;  1SFU A;  1ZLK A;  4MNU A;  2L01 A;  3QP5 A;  3I71 A;  1XDS A;  3W6J B;  4JQF A;  2HWV A;  2ESN A;  2ZXJ A;  1H9T A;  2EV5 A;  3I58 A;  4L5I A;  4U7D A;  3WG9 A;  4CIC A;  1YLF A;  2QZ8 A;  2XIG A;  2MD5 A;  2OQG A;  5HLG A;  2EB7 A;  4UUV A;  3B02 A;  2E1N A;  1U6G A;  4KN7 X;  2ZBK A;  2FEZ A;  1KQ8 A;  3AAF A;  1W7P B;  4Q5S F;  2GXG A;  4KN4 X;  2EFQ A;  4MGR A;  1ONV A;  5D4R A;  2KIM A;  3GX4 X;  1FLI A;  4M6Y A;  4BH9 A;  3NRV A;  4KA4 A;  4GGG A;  2L3D A;  3M7G A;  1TQI A;  3BY6 A;  5L3E A;  4G6Q A;  2C6Y A;  3F72 A;  1LDK B;  2PMH A;  5DDG A;  5HLH A;  5LGT A;  3M9A A;  3V7C A;  1J59 A;  3M1E A;  3RDI A;  3W6K B;  2L4A A;  3D5L A;  3ULQ B;  5LEJ A;  5LEK A;  2A61 A;  4LD5 A;  3JW4 A;  3KCC A;  1Z1D A;  1AWC A;  5K5R A;  4YFN F;  4I0A A;  3L09 A;  5CJ9 A;  2VE8 A;  3HSR A;  5FD5 A;  1HQC A;  4ENK A;  2XRN A;  2PG4 A;  1T2K A;  2ZNZ A;  4U88 A;  2QM3 A;  2ZME B;  3V8L A;  1WWX A;  4PGH A;  4UVB A;  3IWZ A;  2V1X A;  4M73 A;  4GCV A;  4LK1 F;  2JTV A;  2QWW A;  1UHM A;  1YFH A;  4MTE A;  1REP C;  2VC1 A;  1IUY A;  5FFZ A;  1UFM A;  2BEO A;  4RGU A;  1XB4 A;  5F1R A;  2HZT A;  2EV0 A;  3GLX A;  3KFW X;  5DEQ A;  4N9H A;  3TQN A;  1EH8 A;  4IRI A;  5DYM A;  4RGX A;  1RUO A;  3SHF A;  4RGS A;  4WXC A;  4OIR F;  4HF2 A;  1O3R A;  4I02 A;  1ULY A;  3K1P A;  1BN5 A;  3KEQ A;  3J80 Z;  4RB3 C;  4R1H A;  2ISZ A;  2ETH A;  4ZZD A;  2XAH A;  5CVU A;  2K4J A;  2ZJ2 A;  2A07 F;  1AOY A;  3HRU A;  4AIH A;  2FSW A;  2G7U A;  2LKP A;  5HDN A;  4BHC A;  2EA4 A;  1SD5 A;  3WTS C;  1UCR A;  1RI7 A;  5A2Q K;  1RNL A;  1I27 A;  3H3Z A;  4HX8 A;  1V4R A;  2H94 A;  5L3C A;  1FT9 A;  1BJA A;  1W5T A;  3COA C;  1ZRE A;  4LLN A;  3B73 A;  1P4X A;  4XSX F;  4UXN A;  1R1T A;  3FXQ A;  3GXO A;  3R0J A;  1FX7 A;  4HDV A;  3V4G A;  4EM2 A;  5BOX A;  3TOB A;  3ZMZ A;  3DXJ F;  2CW0 F;  1BI0 A;  2NNY A;  3OOP A;  4OIN F;  3GFM A;  2DAO A;  3HHH A;  4UVC A;  3GEZ A;  1DPR A;  3BJO A;  2VBZ A;  4P9U A;  3K69 A;  1SFX A;  3I0T A;  1S3J A;  3TO6 A;  4EMS A;  4BXU A;  1XGM A;  2VOD A;  4PCQ A;  3J81 K;  1XGN A;  3ZP5 A;  5LHH A;  4IVN A;  2XAS A;  3HOT A;  1YIO A;  3MZH A;  3N4M A;  1FYM A;  3WTY C;  3RIR A;  2X0L A;  5AIQ A;  5ICC A;  3CUO A;  3WTX C;  1H9G A;  2H09 A;  1Z9C A;  1MJB A;  3ROU A;  3O3K A;  2OD5 A;  5FO5 A;  1FBS A;  4NHJ A;  4UVA A;  3RI4 A;  1I1G A;  1WRJ A;  1Z91 A;  2NS0 A;  1KU7 A;  3HTU A;  5E1W A;  4U0Y A;  1YS6 A;  4KUM A;  1OYI A;  2NYX A;  1TQP A;  4WF2 A;  4EVI A;  4G7H F;  3EQL F;  4L9J A;  2QQ9 A;  4N9I A;  4CXF A;  4ASN A;  1LEB A;  4YFX F;  5LRS A;  5E17 F;  2HTS A;  1O57 A;  3DP7 A;  4P55 A;  4A6D A;  1HKS A;  5TJJ A;  4HLX A;  1JHF A;  5AON A;  3HRM A;  1T0F A;  4KNY A;  1O3T A;  1CGP A;  2Y48 A;  2STW A;  2F5E A;  3QU3 A;  5JI6 A;  3F6O A;  4G8X A;  5ILU A;  2ZO4 A;  3RPQ A;  2V6C A;  3NEU A;  3NQO A;  2OAZ A;  2YSR A;  3FXR A;  2M5W A;  1J9I A;  2P6S A;  5D6E A;  2XUB A;  4O6J A;  4L18 B;  1U5T C;  2VT2 A;  2W57 A;  2GWR A;  3EYY A;  3Q9S A;  3R6S A;  2DPU A;  1S6L A;  4Y13 A;  4M71 A;  4A2U A;  3LAP A;  2MA3 A;  2MH2 A;  1P4W A;  2Q2E A;  5HS7 A;  4M74 A;  1SD7 A;  4HA8 A;  3T5X A;  4ZYE A;  4OMY A;  2IA1 A;  3LQQ A;  1HSJ A;  2KIU A;  4OOI A;  1K78 B;  3FF5 A;  3TDU C;  1SMY F;  1IXR C;  1YYV A;  3K9T A;  2D45 A;  2IT0 A;  2R7F A;  2K86 A;  2EFN A;  1C0W A;  4EJW A;  5HS8 A;  1F1Z A;  3M8F A;  4L9N A;  2P7V B;  1B9N A;  1ZAO A;  2ZKZ A;  4MEY F;  3F3X A;  5D5U B;  2GAU A;  3FHZ A;  1HKQ A;  4F7Z A;  1OR7 A;  3CO6 C;  1B9M A;  1FWZ A;  2JT1 A;  3KEO A;  4ENN A;  2IP2 A;  4QLC U;  4YG2 F;  3QOP A;  1TW3 A;  3R0A A;  2RGV A;  2XAG A;  2DW4 A;  1L3L A;  3U2R A;  3VEP A;  2VOO A;  3I5U A;  4L0Y B;  5BPI A;  1SAX A;  2JPB A;  4P5O A;  3P9I A;  1HW5 A;  1I5Z A;  2HGC A;  4L9T A;  1BC8 C;  1K6O A;  5LHG A;  4HAM A;  1MDM A;  4HX4 A;  1MZB A;  2WC2 A;  3DFG A;  2EJR A;  4HBL A;  4EJT A;  2EFO A;  4AIK A;  4PZJ A;  3V8J A;  2GA2 A;  4CO8 A;  4Y17 A;  3FXU A;  4B8X A;  1FYL A;  2F2E A;  4CDG A;  4UHT A;  5BMZ A;  1TTY A;  5LRR A;  3HHG A;  3Q9V A;  2HTJ A;  2L4M A;  1B4A A;  1MKM A;  2HYG D;  4BNC A;  1LB2 A;  3WTZ A;  2XAF A;  2HQN A;  2MBF A;  2PMU A;  2VC0 A;  3MZY A;  4M9Z A;  3F8M A;  2DU9 A;  2CO5 A;  3WTV C;  4M9X A;  1R00 A;  3CLO A;  2UZK A;  4BYY A;  1I1S A;  4GXO A;  5LGN A;  3ABT A;  1R36 A;  3KP7 A;  1R23 A;  1K7A A;  4AIJ A;  2QQB A;  5ED4 A;  1DDN A;  2PI0 A;  1IN5 A;  1EV7 A;  3FMS A;  4EGZ A;  5L3B A;  2KJB A;  3IKV A;  4U7B A;  4U0W A;  1OYY A;  2OQR A;  4L9V A;  1J0R A;  2TDX A;  1MJA A;  1IW7 F;  1PUE E;  3FZV A;  1SD6 A;  1FC3 A;  3R60 A;  4BHB A;  1WI9 A;  1HW2 A;  4IPA A;  4ZYD A;  4DNC A;  2ZFW A;  2HQR A;  1BC7 C;  4KDP A;  2VBW A;  2P7C B;  2D1V A;  2QQA A;  3M8E A;  4KIC A;  4XRF A;  1B6A A;  3CUQ A;  4TV7 A;  5D5W B;  1STZ A;  5HS9 A;  2CG4 A;  2STT A;  3JSO A;  4A6E A;  4QWQ A;  1Z6T A;  1NHA A;  5J6X A;  3V7S A;  3DF8 A;  3ZN1 A;  4R79 A;  2W84 A;  4A12 A;  2UXX A;  1FSH A;  2KJC A;  3N97 A;  4L5J A;  4HX7 A;  5A2Q Z;  4ZZL A;  4MTD A;  1SMT A;  2EFW A;  1Z6R A;  3C1D A;  1ZH5 A;  1D8J A;  4LG0 A;  4MEX F;  4K2E A;  1MD0 A;  2ESH A;  3CTA A;  3GFJ A;  1S29 A;  2DQR A;  3GFL A;  2P4W A;  5D6F A;  5K1Y A;  4WX9 A;  4Y15 A;  2FE3 A;  3E3V A;  1D8K A;  4EQQ A;  3FWE A;  5LHI A;  1ZG1 A;  2NAZ A;  1Z7U A;  1G6N A;  4G7Z F;  2RKH A;  1GHC A;  4NB5 A;  2DLL A;  2QLZ A;  4WK8 F;  1BI3 A;  2L54 A;  4IRG A;  4KFC A;  1GXQ A;  2H6B A;  2FF4 A;  1KQ9 A;  2ACJ A;  2M87 A;  1MJ9 A;  2O0Y A;  5DV5 A;  4G7O F;  1RUN A;  3RYR A;  1EH6 A;  2H6C A;  4A0Y A;  2XKO A;  3RPU A;  1Q1H A;  2F5C A;  4IHS A;  3L00 A;  3WGI A;  2BYV E;  2P5V A;  3T0Y A;  4JK1 X;  3I59 B;  1F4K A;  4U0V A;  5F64 A;  3JTH A;  3P9C A;  2GXB A;  3ZN0 A;  4OIQ F;  2GA1 A;  5IT3 A;  2Z99 A;  4A5N A;  2IA2 A;  3WU0 A;  1O7F A;  5CLS A;  4IJA A;  1MGT A;  1WSU A;  2R3S A;  3CUQ B;  2P5L C;  3E97 A;  2O61 A;  2QYO A;  2NNN A;  3BZ6 A;  2A68 F;  3E6M A;  3I4P A;  3FM5 A;  2P5K A;  1O7L A;  2W24 A;  1HST A;  5BS6 A;  4O3M A;  1KU9 A;  2ELH A;  1PP7 U;  2HYF A;  1B59 A;  4I0B A;  2K4B A;  1OPC A;  2V79 A;  3L7W A;  1KGS A;  1S8N A;  4Z2Y A;  1FBU A;  4LG0 B;  1ZRC A;  4FX4 A;  2CSO A;  4KYW A;  4LK0 F;  1KU2 A;  4HYE A;  2DI3 A;  5JHU A;  2J5O A;  4LGW A;  5BQT A;  1W7P A;  3KE2 A;  3ISP A;  4HZF A;  5DCM A;  3WU1 B;  1L0O C;  3HSF A;  1I6X A;  4I01 A;  2LSO A;  5IT9 K;  1IRG A;  2Z5U A;  2DQL A;  2HKO A;  1JXS A;  3J7A O;  2J5P A;  4CZZ A;  1ZYR F;  2FBK A;  1T38 A;  3WTT C;  2DTR A;  2O8X A;  4A0X A;  2P6T A;  2E1C A;  1TNT A;  3ZMU A;  3L2C A;  4HW0 A;  3J81 Z;  4YII A;  3SFZ A;  3T8R A;  3ZQ7 A;  3K1M A;  3KET A;  2K02 A;  2FBH A;  1F9N A;  2JZY A;  4A0Z A;  2DO7 A;  4AVP A;  3GUD A;  2F5D A;  2Y0M A;  3E6C C;  1BI1 A;  3MQ0 A;  1IZ1 A;  1QO0 D;  5HVQ C;  3IRQ A;  3L9F A;  4KIG A;  2BE5 F;  1JE8 A;  1KU3 A;  2EK5 A;  3K0L A;  4AWX B;  4DQ2 A;  1IAW A;  4BAY A;  4S05 A;  4RS8 A;  3DQV C;  3QPT A;  4ESB A;  4HOB A;  3RJP A;  5D4S A;  2Q0O A;  2PJP A;  1TBX A;  5F6F A;  4ZH4 F;  1XGO A;  1IXC A;  2H27 A;  3LQR A;  1OMI A;  1IN4 A;  2FOK A;  2EA2 A;  2CQK A;  3EET A;  1LVA A;  2WV0 A;  1XN7 A;  1K79 A;  1D3Y A;  4ENM A;  1T6S A;  1ZRF A;  2L02 A;  2EWN A;  2Z3Y A;  1IXS B;  2EV6 A;  3MAJ A;  1TQM A;  4KT5 C;  4UV8 A;  3MCZ A;  5CVV A;  4BHP A;  3WE2 A;  2MC3 A;  2JPC A;  1YTY A;  1FY7 A;  2KRF A;  5LGU A;  1KQ0 A;  1YW7 A;  3LWF A;  3J80 K;  5HDK A;  4YIF A;  3QPH A;  2HOE A;  2FA5 A;  3O6B B;  1UHW A;  5FLX K;  1BOA A;  4L0Z B;  3FX3 A;  1QZY A;  4UNO A;  2QVO A;  4LMY A;  1FSE A;  2MH9 A;  4P96 A;  6PAX A;  3TO9 A;  5E1X A;  1MDM B;  2GIV A;  1U5T A;  5EEG A;  1OKR A;  3RKX A;  4I09 A;  1JHH A;  4CYD A;  4R8H A;  3U9G A;  4XLN F;  4D0P A;  3QRF F;  4M6X A;  1USS A;  3R4K A;  5CVR A;  1GXP A;  3HRS A;  4BQA A;  2FBI A;  1P2F A;  3LST A;  3TO7 A;  2AS5 F;  1ODD A;  1SFE A;  3FM3 A;  1FBQ A;  4GO1 A;  3Q5F A;  2CGP A;  2QBY A;  1XMK A;  3EUH A;  2FMY A;  2QBY B;  1YS7 A;  2CYY A;  4CHU A;  1Y0U A;  3C3W A;  3KP6 A;  5DD4 A;  1XMA A;  4RAY A;  3ZMS A;  5ILV A;  1G4D A;  3KP2 A;  4IHT A;  1R58 A;  2Y75 A;  3KP3 A;  1G3T A;  5DUK A;  3PQJ A;  1FYK A;  1P92 A;  2XV4 S;  2A69 F;  1IN7 A;  2W25 A;  1WKM A;  1PP8 F;  4ENJ A;  3VOD A;  3I54 A;  2JSC A;  3LA2 A;  1ZG3 A;  5EEH A;  5E1Z B;  3GWZ A;  4EJO A;  3H92 A;  3E5U A;  2YX4 A;  4ESF A;  5DD8 A;  3F8N A;  3C7J A;  2IW5 A;  1U5T B;  2RDP A;  2DFI A;  2PEX A;  1U3E M;  2HR3 A;  2AXL A;  2O6G E;  2M8E A;  3WTU C;  3BJA A;  3F6V A;  2W85 A;  3IWF A;  5DCF A;  2BV6 A;  2PFB A;  1O3Q A;  5D8K B;  1ZLJ A;  2FML A;  3SZP A;  4S04 A;  2PN6 A;  2VN2 A;  3F22 A;  4OIO F;  2XAJ A;  4PGG A;  4RGR A;  4ESJ A;  2M30 A;  3H3U A;  3QAH A;  4EJV A;  2A5Y B;  2VT3 A;  4M72 A;  4WWC A;  3CJN A;  4KIB A;  4G94 A;  3ECH A;  3GO5 A;  4XLP F;  2VON A;  4FHT A;  1ON1 A;  3GYH X;  4Q47 A;  1FNN A;  4CGZ A;  3HRT A;  2PQ8 A;  2PLY A;  3F21 A;  1ZGJ A;  4N0B A;  1EH7 A;  3JAM Z;  3DPT A;  3BJ6 A;  2V9V A;  2BBY A;  2OU2 A;  1P4A A;  1O3S A;  4A5M A;  3LFK A;  4O5V A;  3TGN A;  1LDJ A;  1K78 A;  3DPL C;  3TKY A;  3BOQ A;  1W5S A;  1FP2 A;  2PBI A;  4IF4 A;  3TOA A;  4G9Y A;  1QGP A;  1RZ4 A;  3HOS A;  3PQK A;  3BRO A;  3F8F A;  2WTE A;  3F8C A;  2FRH A;  2RNJ A;  5ILS A;  2R7D A;  5IT9 Z;  2DK8 A;  4HQM A;  2RC4 A;  3F23 A;  1S7O A;  2K27 A;  4HLY A;  3CO7 C;  3RTR A;  1XCB A;  4WCG A;  2CWE A;  2JRT A;  2COM A;  3KP4 A;  3R61 A;  2XGX A;  5H6Q A;  2Q8K A;  1DUX C;  3I64 A;  1KYZ A;  4KIF A;  4JBA A;  3PFI A;  4Q4Z F;  4GYI A;  3RYP A;  4M9S A;  4IXA A;  1QBJ A;  5JR3 A;  2RN7 A;  5H6R A;  3P7N A;  2EFP A;  1R7J A;  2XHK A;  3IKT A;  4LFU A;  2OZU A;  3ML6 A;  4LJZ F;  5D8L B;  4I2O A;  4B09 A;  1W7P D;  1HKT A;  5E8G A;  1UB9 A;  3LAJ A;  4PDK A;  4LB5 A;  1B1B A;  1FP1 D;  2ADU A;  3RKY A;  3EYI A;  1SD4 A;  1J75 A;  1J2X A;  2FXA A;  3T8T A;  3K2Z A;  2RVC A;  3WOD F;  1ZN2 A;  1XSX A;  3IHU A;  1G3Y A;  1KA8 A;  1RIO H;  5L3D A;  3IL2 A;  2V1D A;  2XVC A;  1D5V A;  3E6D A;  5JFR A;  1BIA A;  3E5Q A;  3T1B A;  2B0L A;  1BI2 A;  5BPD A;  1XGS A;  3G73 A;  3G3Z A;  1G3S A;  4EGY A;  2MLG A;  4LB6 B;  3MFK A;  1HW1 A;  2OA4 A;  1IRF A;  5KVR A;  2HFH A;  5FD6 A;  2LF8 A;  3K1N A;  3WGH A;  2VBY A;  3DKW A;  1BIB A;  2IVM A;  1YW8 A;  3LA3 A;  2DBB A;  2XRO A;  3GW2 A;  1E2X A;  1J7K A;  3QU6 A;  5FFX A;  2LF7 A;  3S2W A;  1T98 A;  4HV5 A;  4LLG F;  1V3F A;  5AIP A;  2FNP A;  5D5X B;  4XSZ F;  5H20 A;  1GVJ A;  1TLH B;  3ELK A;  5HOO A;  4Q48 A;  5L3G A;  3HTS B;  1JGS A;  1YW9 A;  2KIF A;  1LNW A;  4HV6 A;  3DEU A;  3JTG A;  2O03 A;  2G7H A;  3GF2 A;  4RAZ A;  4ZYH A;  3VFZ A;  5LLQ A;  2GZW A;  1R5G A;  4OIP F;  4MQV A;  1R5H A;  2VXZ A;  5HDG A;  5E20 A;  1QZZ A;  3FMQ A;  1FOK A;  2Z9O A;  1ZG5 A;  1T39 A;  2DPD A;  4P9F A;  1TW2 A;  5ICF A;  4ZYG A;  5FLX Z;  1ON2 A;  2D1H A;  5ICG A;  1FPQ A;  3MWM A;  3IC7 A;  4HDU A;  5JVT A;  2HS5 A;  2BGC A;  2HEO A;  2KKO A;  2YR2 A;  2YU3 A;  3CDH A;  2ZCW A;  1H0M A;  1XSV A;  2RV8 A;  3HYI A;  5ICE A;  3VOE A;  2NRA C;  4AD9 A;  2IRF G;  2ISY A;  1UST A;  3VB2 A;  2ZNY A;  3KLN A;  2A3S A;  2RQP A;  1XD7 A;  1QNT A;  3P9K A;  4RB2 C;  4FX0 A;  1LQ1 A;  1ZAR A;  4KMF A;  4ETS A;  1U78 A;  2FQ3 A;  1YO5 C;  2OZ6 A;  1LJ9 A;  3E5X A;  2IA0 A;  4ON0 A;  2QEN A;  1HBX G;  2FU4 A;  3RKW A;  5J8C A;  2XAQ A;  1QQI A;  2X4H A;  2UXN A;  1BM9 A;  1CF7 B;  2DK5 A;  5ERI A;  3MEX A;  1QPM A;  1F5T A;  3ERE D;  5K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...