2Z33A

Solution structure of the dna complex of phob dna-binding/transactivation domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*GP*TP*CP*AP*TP*AP*AP*AP*TP*CP*TP*GP*T)-3'
publication title Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2z33A00
3O2PE 1FWZA 3EQLF 4M74A 3FMRA 1R22A 5HDNA 3RI4A 5DCMA 3KP3A 5LEJA 1XSVA 4XSXF 2D2WA 2DQRA 3ABTA 4MEYF 4KFCA 1BM9A 4YG2F 4KMUX 1FYMA 2O61A 1R36A 3K1NA 4G6DA 3ZMZA 4QWQA 1B9NA 3WE3A 1YW8A 1QO0D 4L5JA 1S6LA 4RB3C 1YFHA 3WU1B 1BC7C 2VE8A 1UHWA 3P9IA 2UXNA 3BY6A 1EV7A 3SZPA 3JTHA 3MFKA 3WTXC 5D5UB 1HW2A 1E17A 3COAC 4KNYA 3F8FA 3WTYC 2BBYA 3TO9A 1TQIA 2M45A 4BXUA 4U88A 3WG9A 4UUVA 5ICFA 3WTUC 1IW7F 3MZYA 1J5YA 3DP7A 4KIBA 3NRVA 1XGOA 1XSXA 1T38A 3F8CA 3D5LA 2W24A 3I58A 2BGCA 1SMYF 4M9XA 2D45A 2FSWA 5CVVA 1IXSB 1T98A 4M6YA 4HF0A 2VXZA 3VEPA 4CXFA 5L3CA 5CYVA 5J8CA 4LLLA 4KDPA 1FT9A 2XAFA 4WWCA 4ENNA 1G3TA 3F6OA 4ESJA 3ZMDA 3DEUA 2MLGA 1U8RA 1ZGJA 5DCFA 2J5PA 3RYRA 4HF1A 4I0AA 1XMKA 1B1BA 5A2QZ 2V1UA 3LFKA 1SD4A 2ISYA 2J5OA 5D8LB 1LVAA 1B59A 2CFXA 1TBXA 3E6MA 1TNTA 2XIGA 2FQ3A 2P5VA 2P6TA 3W6KB 3WODF 5HLHA 4HA8A 2CG4A 2EK5A 1U5TC 4KUMA 4AD9A 2OD5A 2VOOA 1KU3A 1NHAA 5LRRA 3HIFA 2P7VB 1Z9CA 3P7NA 3KLOA 1XGSA 2GZWA 2HYFA 1G4DA 2IVMA 3RJPA 1W5SA 5ICCA 3EUHA 3OOPA 2RVCA 4Y15A 4UVBA 3ULQB 1KU9A 2DFIA 2HQRA 1XMAA 5LLQA 3P9CA 2P7CB 3MEXA 2DO7A 2DK8A 1LDDA 1C0WA 3TOBA 1D3YA 1FC3A 3EYYA 4FHTA 3ZMUA 4EJTA 3SFZA 3ZPLA 2HFHA 2Z99A 1T39A 1FBQA 1FOKA 4EM0B 5BS6A 4OU0A 2FMLA 2BE5F 2R7FA 2M30A 1H9GA 4Y17A 3ECOA 3T0YA 1SFEA 2B0LA 1IN6A 4LG0B 2LNBA 1PUEE 4EM1A 1RNLA 4HOBA 3FXUA 1K6OA 4IHSA 4FT8A 1BI3A 1P4AA 5CLSA 5D5WB 2H94A 2E1CA 3GLXA 1BIAA 3E6BA 4EM2A 4QLCU 2F5DA 1KQ0A 1OYYA 1QGPA 3MQ0A 4ZYGA 4U7DA 2RGVA 2ZCWA 5E1XA 3HSRA 3WE2A 2V1DA 2VC0A 1B9MA 1KGSA 3J81Z 1F1ZA 2XKOA 1ZRDA 3E6CC 3BPXA 4RB0A 1LQ1A 2ACJA 3VFZA 2QQAA 3IC7A 3KFWX 5D6FA 2K4BA 2ZKZA 5A2QK 3K2ZA 2EA2A 1FBUA 1ZG5A 1QBJA 4EJOA 2FF4A 5JVTA 1HSTA 1GXQA 4YIFA 2L4MA 4KIFA 3HHHA 2EA4A 2STTA 3M8EA 3Q9VA 4OOIA 1QNTA 2HDCA 4E70A 3CUOA 2RKHA 5CVUA 3R60A 2OZ6A 2YU3A 2MLKA 1MD0A 1J7KA 2F5EA 2FNAA 3BOQA 1XGMA 3ZMVA 3F3XA 2P4WA 4HQEA 4HAMA 3HOSA 4RS8A 1PDNC 1B6AA 2ETHA 1R1TA 4Q4ZF 1KU7A 3FM5A 2OQGA 2EJRA 3WTTC 5CVIA 2P5KA 4ENJA 3I71A 2K27A 1YW7A 4P96A 1FX7A 2GAUA 1R00A 3T8RA 2Z5UA 4MGRA 4L0ZB 1BI1A 2A68F 4UXNA 5FD5A 4Q48A 3H3UA 5AONA 2A6EF 5HLIA 3P9KA 4KYWA 5K5QA 2DT5A 2FBIA 1Z91A 2ZMEA 3FWEA 2R3SA 3GFMA 5BQTA 5FO5A 2KKOA 2XV4S 4BH9A 2O0YA 3LWFA 2OU2A 4LK0F 1I6XA 1U78A 2NAZA 2RC4A 5H6QA 3RKYA 2XRNA 1DUXC 4P9FA 4AVPA 4YFXF 3IRRA 4MQVA 3FF5A 1R23A 2C6YA 2PJPA 3KCCA 3M1EA 5E1WA 2HQNA 5CJ9A 1XCBA 2Z33A 5LHIA 3S2WA 1S8NA 2O03A 2MH2A 1YS7A 5F64A 1P4XA 5DV5A 2EFPA 4RAZA 4CYDA 3GXOA 2A07F 3N97A 1BBYA 1JHHA 1P4WA 3R4KA 5LEKA 2ISZA 1PP7U 3L00A 3ZN0A 3BP8A 2M1BA 3V7CA 4M9SA 2PI0A 2FXAA 3F8MA 5ILSA 2IA0A 3DQVC 3KE2A 1ZRCA 1EH8A 3HSFA 3E5UA 1DDNA 1IXRC 1TTYA 4R1HA 1LEAA 2O8XA 1H0MA 3U9GA 3I59B 2IW5A 2NNYA 1W7PB 3PQJA 1FZPB 2RN7A 3TO7A 4MQ9F 1IZ1A 4S04A 5IT9Z 3BWGA 2M8EA 1HKQA 2HR3A 4HX7A 5HS7A 2YX4A 1Z6TA 4M6XA 1F4KA 2GXBA 4HV5A 2Y0MA 1BI0A 1JE8A 4HLYA 2XKPA 1P2FA 5L3GA 3ELKA 1MDMA 1GHCA 3FXRA 2PMHA 1SMTA 4EJUA 2PN6A 1ZHFA 4PDKA 2E7WA 4BHCA 4RB1A 5FD6A 1U6GA 1EH6A 4G7ZF 1ODDA 1O57A 2O3FA 2XGXA 3HTSB 2L02A 4G7OF 2HKOA 5L3DA 4A6EA 5JHUA 1IXCA 1JXSA 4A0XA 5D5XB 4CICA 3VB2A 5E17F 1Y0UA 1Q1HA 4NHJA 3V8JA 2GXGA 2EB7A 4Q5SF 1SD5A 3O3KA 5LGUA 3N4MA 5DD8A 1LNWA 3WTSC 1K78A 2L01A 3F8NA 4GYGA 3K69A 3M9AA 4RGXA 3NEUA 3IWFA 5FFXA 4RGUA 1HBXG 2OAZA 3E5XA 3ROUA 3MZHA 3ISPA 5TJJA 2NNNA 5LGNA 1ONVA 1YQAA 3G73A 4YFNF 1J59A 4PGGA 1YYVA 2XAHA 3ZMTA 1BN5A 2W84A 4S05A 1MJAA 3KP4A 1BC8C 2UWMA 3LA7A 3KZZA 4HBLA 3GWZA 2HS5A 2PMUA 2GWRA 4OMYA 2FNPA 3K1MA 1XN7A 3SHFA 4HV6A 3I54A 3D0SA 3CO6C 1O7FA 4XRFA 2COMA 2YX7A 1O3TA 2UXXA 2FRHA 5HS9A 2Y75A 2VC1A 1FP1D 5IT9K 1WQ2A 2H6BA 5F6FA 4YIIA 5BOXA 1MJ9A 4ZH4F 1AWCA 3KEQA 4IJAA 2HTSA 3HRSA 3IRQA 2HOEA 1KYWA 3B73A 3GFLA 2R7DA 1KYZA 4ZZLA 1MZBA 4GXOA 3I59A 4GGGA 1W7PA 3TKYA 3O6BB 2FOKA 4M71A 3BJ6A 2GA1A 2KRFA 4UVCA 1QZZA 3TQNA 1J2XA 1E2XA 2H27A 3F72A 3FMSA 2YSRA 3QU6A 1ON1A 2QENA 4M73A 4LB5A 3JSPA 2XVCA 4RB2C 4ASNA 4L0YB 2EFOA 3Q9SA 3G3ZA 1XDUA 3TDUC 1FYKA 1OPCA 1SD7A 4BAYA 2QLZA 4A0ZA 1J0RA 2QZ8A 4ZYDA 2DK5A 2RDPA 2VBZA 2A6HF 1REPC 3OV8A 5L3BA 1L3LA 4IRIA 1FNNA 4KT5C 3CUQA 1STZA 4U0VA 3JW4A 4MEXF 1RUOA 1TQPA 1T0FA 1USSA 2ZMEB 2EFNA 5DYMA 3BJOA 4GCVA 1I1GA 2VT2A 1BOAA 4G6QA 1LDJA 4EJVA 1VTNC 2IP2A 5JR3A 3ZP5A 5F1RA 3JAMZ 4XSZF 2GA2A 1IN8A 2Q2EA 5J8FA 1HQCA 2H09A 5K5OA 5D5VB 4IPAA 2JZYA 4EQQA 1L0OC 4P5OA 1SFXA 4WK8F 1QZYA 3KZYA 2HTJA 1S7AA 3HOTA 2EWNA 5DDGA 2CWEA 1CGPA 1B4AA 5K1YA 1G3SA 2CGPA 5ILVA 3HUGA 3L9FA 1FYLA 3J80Z 4OIPF 3I0TA 3TO6A 2DPUA 1FLIA 2F5FA 1IUYA 4HX4A 2JT1A 1I1SA 1KQ8A 1U3EM 1BJAA 2ESNA 4U7BA 2A3SA 1ZAOA 4WX9A 2CW0F 2JRTA 5HDKA 4I01A 3FM3A 2V79A 2MA3A 3QRFF 5KK1A 2G7HA 5ILUA 2PBIA 3VODA 5DEQA 2Q8KA 1R1VA 1Z1DA 3IKVA 1LEBA 2EFQA 4ZYHA 2ELHA 2Y48A 2MH9A 1CF7A 1FP2A 5K5RA 4ZZDA 2VBYA 2IA1A 1K79A 1USTA 5L3EA 3ZMSA 3F21A 2OZUA 4WXDA 1MDMB 1ZREA 2STWA 4EVIA 3CTAA 2VE9A 1DPRA 1F5TA 3DV8A 4P9UA 4N9HA 4KN4X 4A5MA 4WF2A 4EV0A 2DQLA 1TLHB 4OIQF 1ZN2A 5HDGA 5JI6A 4U0WA 1WWXA 2WC2A 1UB9A 4H0EA 3DKWA 2YR2A 1FSHA 3LA3A 3DF8A 2KJCA 2L3DA 5H20A 4I7HA 4ESBA 3GF2A 1FPQA 3WGGA 1W4MA 1YS6A 3AAFA 4AIKA 4ZYEA 1K78B 4TV7A 5LRSA 1BIBA 5E1ZB 4MTEA 4IVNA 3LQQA 2MC3A 2VBXA 2VT3A 2V1XA 4O5VA 1FY7A 4CZZA 3LA2A 4PCQA 4B8XA 3QPTA 4KMFA 2PG4A 2ZNYA 2IA2A 1XDSA 4HW0A 2YPRA 2BV6A 3M8FA 3J80K 3QAHA 4WXCA 4RAYA 4I2OA 3J81K 2EV0A 2W57A 1V4RA 1O3SA 4LJZF 5FGMA 2EV5A 1OYIA 4UVAA 1R5HA 1OYWA 2VBWA 4A12A 5LGTA 3ABUA 2NS0A 1ZG1A 3Q5FA 4L9NA 2IPQX 3LAJA 3F22A 2HEOA 2ADUA 5IT3A 3GUDA 3TDZC 4CDGA 5LHGA 3DFGA 3PFIA 2FU4A 2OQRA 4HZFA 3RPQA 3T1BA 3LSTA 3I5UA 3MCZA 4MNUA 2BEOA 5D4SA 4LMYA 1OMIA 3HRMA 5H6RA 1JHFA 4M72A 1Z05A 2F5CA 1MGTA 2KJBA 1MJBA 2K4JA 2H6CA 2K7LA 4LFUA 2VN2A 5KVRA 3R61A 1BI2A 3J7AO 3IL2A 1P6RA 1I27A 4BNCA 2DBBA 5DD4A 3FMQA 2ZFWA 3EDPA 2CSOA 4HQMA 4WXHA 1IN4A 4G7HF 2NRAC 5E18F 3U2RA 2PFBA 2JPBA 5TRDA 1YIOA 3I53A 4UHTA 2LF7A 5E8GA 3LAPA 5AIPA 3MWMA 5BPIA 5BMZA 1OKRA 3QOPA 2XHKA 2ZXJA 1UHMA 4L9TA 1YO5C 5E8IA 2ZJ2A 3TGNA 1D8KA 2DLLA 3DXJF 3E97A 3HRUA 3CUQB 2DPDA 3CJNA 1AOYA 2QYOA 2JPCA 2V9VA 4KA4A 1RIOH 5DUIA 1FBSA 1F9NA 3V8LA 2K86A 4O3MA 3EYIA 4AIHA 3ML6A 5L3FA 4LLNA 1YG2A 4IRGA 4KICA 3C18A 5ICEA 4IHTA 2IT0A 4I98B 3PQKA 4HDUA 4L5IA 4N0BA 2GQQA 1LDKB 1SAXA 1J9IA 5HLGA 2JTVA 3FHZA 1W5TA 3IWZA 2LF8A 3I64A 2IJLA 3RKXA 3L7WA 1KU2A 1G3WA 3E6DA 3FX3A 1Z6RA 5BPDA 4ESFA 1ZARA 2D1HA 3IKTA 1S3JA 4EGZA 1O3RA 2QUFA 4YFKF 1IRGA 2VOPA 2RV8A 4BHPA 3CUQC 5ICGA 2E7XA 3K0LA 3QU3A 3F6VA 2XAJA 2QWWA 5JFRA 2VODA 5J6XA 2OA4A 4U0YA 2FMYA 4A2UA 1WI9A 3CLOA 1X3UA 2BYVE 1ZG3A 4UNOA 1R1UA 3KP7A 3T8TA 1JGSA 4KN7X 3E5QA 2P8TA 1IRFA 1U5TB 3GFJA 3JSOA 4OIRF 1KQ9A 4DQ2A 1RI7A 3VOEA 1HSJA 1V3FA 2E1NA 4A0YA 3KP2A 4G8XA 5HS8A 1SFUA 2XROA 3QP6A 4HLXA 1ZRFA 1CF7B 1ZGAA 5CVJA 1RZ4A 2Z9OA 3MAJA 1K7AA 1XD7A 2KIFA 2WWYA 2RQPA 1ON2A 1UFMA 3KLNA 3IHUA 2O6GE 2F2EA 2KIMA 1ZH5A 1HW5A 3JTGA 1RUNA 5ERIA 4PZJA 4ETSA 5ED4A 1R5GA 2A69F 2WTEA 4XLPF 2QBYA 3GZ6A 3I4PA 2DTRA 3WTZA 4FX4A 1G3YA 2CYYA 1LB2A 4EJWA 2W85A 6PAXA 4CO8A 4BYYA 1J75A 2DW4A 2LSOA 1ZLJA 2ZO4A 4GYIA 5HOOA 4BHBA 2LKPA 2ZNZA 4ON0A 4OMZA 2GIVA 2V6CA 2DU9A 4IXAA 1ULYA 3QPHA 3WGIA 3FXQA 4UV8A 1P92A 2M87A 2L4AA 3SXYA 4NQWA 2FBKA 4K2EA 2LDUA 3DPLC 3H92A 1OR7A 3NQOA 1WKMA 4MTDA 2CO5A 2UZKA 3DPTA 3SQNA 1XCVA 2OBPA 3EETA 4JBAA 1T6SA 4OINF 2QVOA 1IN5A 2FBHA 2JSCA 3C3WA 3R0JA 3V8KA 5E20A 3ZQ7A 5FLXZ 5EEHA 2ZBKA 4EMSA 4BQAA 5FB2A 4HDVA 2FA5A 2QQBA 5CVRA 3T5XA 4R79A 3WGHA 1D8JA 4R8HA 2CQKA 1S29A 2XASA 1PP8F 3ECHA 4WCGA 3QP5A 4PGHA 1G6NA 3GO5A 2FEZA 3RTRA 4L9JA 1GXPA 3F8BA 2IRFG 2KIUA 3KP6A 4IRHA 2P6SA 3C1DA 1DP7P 4EGYA 1U5TA 1R7JA 3WU0A 4LLGF 4P55A 3M7GA 4UV9A 1YW9A 1TW3A 2XUBA 3GVAA 3V7SA 2XAGA 4GO1A 4L18B 5FFZA 4LK1F 3K9TA 3GZ5A 4MHGA 1TQMA 4Q47A 2HYGD 3HYIA 3RIRA 4LD5A 1Z7UA 1XGNA 4CGZA 4JQFA 1TW2A 4G9YA 3LQRA 2RNJA 1IN7A 3RPUA 4F7ZA 4A5NA 2X4HA 5D8KB 3GYHX 1HW1A 3REOA 1GVJA 1W7PD 2NYXA 2HGCA 2TDXA 5HVQC 2K02A 1HKSA 3L2CA 3HRTA 1LJ9A 3E3VA 2EV6A 4M9ZA 4ENMA 4OIOF 4Y13A 4HF2A 1R58A 3BROA 3TOAA 5DCMB 3JAMK 3RYPA 1FSEA 5DUKA 1T2KA 1IAWA 1IF1A 2W25A 1D5VA 4RGSA 3W6JB 3GEZA 1QQIA 2XAQA 3WTVC 3L09A 2EFWA 4G94A 3F23A 4Z2YA 3U1DA 3ERED 3FZVA 4HYEA 3H3ZA 2VONA 1DPUA 4HX8A 2PEXA 5FLXK 4ENKA 3C7JA 2Z3YA 3V7RA 4XBFA 4D0PA 4N9IA 4DNCA 1HXDA 3CDHA 1XB4A 3WTWC 1EH7A 3HSEA 1A04A 5D4RA 2Q0OA 3KP5A 2G9WA 2PQ8A 1SD6A 1HKTA 1KA8A 4NB5A 2WV0A 2P5LC 4LG0A 2MBFA 4L9VA 2AS5F 3KEOA 2HKXA 3BJAA 2HWVA 2ESHA 3HTUA 2QM3A 4RGRA 3KETA 1O3QA 2QQ9A 3RKWA 3V4GA 1QPMA 4I0BA 3SZTA 4LB6B 1TNSA 3R6SA 2X0LA 2M5WA 2L54A 5D6EA 2DI3A 1YTYA 1ZLKA 4AIJA 1WRJA 2D1VA 2DAOA 5AIQA 1XSDA 1S7OA 1U2WA 3B02A 1H9TA 1O7LA 5LBQA 4XLNF 2G7UA 1WSUA 1UCRA 1YLFA 4B09A 2HZTA 4A6DA 2PLYA 3RDIA 3CO7C 4I09A 2A5YB 3ZN1A 5LHHA 1I5ZA 3GW2A 4JK1X 2FE3A 4FX0A 4KIGA 3BDDA 3R0AA 3BPVA 3K1PA 3GX4X 4AWXB 4CHUA 2AXLA 4O6JA 4IF4A 2QBYB 3GFIA 3BZ6A 1MKMA 3HHGA 4I02A 5EEGA 4LGWA 1ZYRF 2MD5A 2A61A
chains in the Genus database with same CATH superfamily
1D1AA 3O2PE 4A3MJ 1NH3A 1FWZA 1SC7A 3EQLF 4M74A 3FMRA 1R22A 5F27A 4PK4A 1OCOH 5HDNA 3RI4A 5DCMA 3KP3A 5LEJA 3NWTA 1XSVA 3RCOA 4XSXF 2D2WA 4UB8C 4PJMA 1GV5A 3BR5A 2KRCA 1E3OC 2UUZA 2DQRA 3TW7A 2IGKA 2VIXA 1MIJA 3K4BA 3PIOF 3ABTA 4MEYF 4KFCA 1BM9A 4NQWB 4YG2F 2H8WA 4KMUX 1FYMA 4A3LJ 2CUEA 2O61A 1R36A 2OF7A 4XKBA 3K1NA 3W2VA 5F0CA 4G6DA 5CKTA 3ZMZA 2XGEA 2W7NA 1FIAA 1R4NB 2HVRA 3U21A 3GTPJ 1WJCA 4QWQA 1IO2A 3BR6A 1MH3A 3CC4I 1B9NA 3IP4B 4P1WA 5IP6A 1LFUP 4RA2A 3WE3A 2IS6A 3DEEA 1YW8A 1ZQ3P 5C4XJ 4DYQA 1QO0D 2X6WA 1S6LA 4L5JA 4RB3C 5C4JJ 3IH3A 3WU1B 2K5CA 1YFHA 1BC7C 2QSGX 3HOWJ 2VKVA 3DCFA 5HNHA 2FUG2 4IKFA 2L7ZA 2VE8A 1P7IA 1UHWA 2UXNA 3P9IA 4A93J 2ELKA 3BY6A 3OR1C 1EV7A 3K7AJ 3SZPA 4UUSA 5J40A 3JTHA 3MFKA 3QYFA 3JCUC 3WHCA 3WTXC 3PM1A 5D5UB 4X1EA 2LBFA 1HW2A 1E17A 4B4CA 3COAC 3BTIA 1TP4A 2OTLI 4KNYA 3F8FA 1N75A 4D5CA 3WTYC 2BBYA 3TO9A 1TQIA 2M45A 3A4CA 3CMYA 4BXUA 4U88A 3WG9A 3OS1A 4UUVA 2ECCA 1BOBA 3DU6A 4XL9A 1PJRA 5ICFA 3WTUC 1IW7F 3MZYA 1E3PA 2JA5J 1J5YA 3DP7A 2ME6A 3H1CA 4BBRJ 1QZEA 5FKLA 2CQNA 3FXKA 5FKMA 2BZTA 2R7OA 2VKEA 1YJ9I 3LSJA 2CFOA 4KIBA 1YOVB 1ZR2A 4PSWA 4CCNA 1LE8A 3IH2A 3NRVA 3OIOA 1XGOA 3RQIA 4ZC3A 1XSXA 1OQYA 1T38A 3F8CA 1TZLA 3H5RA 3D5LA 1OR7C 4JP0A 4A3CJ 2W24A 5FKKA 4J19A 2LLKA 2HQAA 1PVEA 1OCRH 2VI6A 3FKJA 2X6YA 4BL0B 3I58A 2BGCA 5CPRB 3S14J 4XOPA 1XC5A 2ME0A 1SMYF 1UG2A 4M9XA 3HJEA 3GTLJ 2D45A 3OYLA 2FSWA 5CVVA 4BJTA 1IXSB 1X3WB 1SFKA 1T98A 4M6YA 3KEYA 4HF0A 2VXZA 3VEPA 4CXFA 1X3ZB 5L3CA 3KIOA 1V55H 5CYVA 4LLLA 5J8CA 4KDPA 2HXOA 2JWTA 3M8JA 1QA6A 2HOSA 4Y3OA 4C2TA 4IHYA 1GVDA 3OYMA 3K4JA 5F0HA 1FT9A 3L2WA 2XAFA 4WWCA 4FCYA 4ENNA 1G3TA 2L9NA 4I6ZA 3F6OA 4ESJA 4RDUA 1RC9A 3DEUA 3ZMDA 1LVKA 2MLGA 2WAFA 4PJLA 3K4CA 1TWFJ 4C2UA 1U8RA 1ZGJA 3AG2H 3Q3SA 5DCFA 2R7XA 2J5PA 3RYRA 4HF1A 4I0AA 4DJAA 1XMKA 4B1RA 1B1BA 3U1KA 5A2QZ 2V1UA 1T33A 3LFKA 1SD4A 3S1QJ 2ISYA 2J5OA 5D8LB 1LVAA 1BR4A 2VPLA 1B59A 2CFXA 1TBXA 3E6MA 1TNTA 2XIGA 2LY2A 2FQ3A 3OYAA 4E7LA 1VF9A 1X1DA 2HPMA 3PL8A 4PJ0C 2P5VA 2DA1A 2P6TA 4E7SA 1N78A 3W6KB 3TL4X 3WODF 4CSWA 2Z1DA 4HA8A 2CG4A 5HLHA 2EK5A 1U5TC 1MSEC 4KUMA 4AD9A 2OD5A 3VYSB 2VOOA 1G8XA 1KU3A 1NHAA 2RQQA 5LRRA 3HIFA 1JTYA 2CH0A 2LYCA 3G71I 2EPFA 2A05A 2P7VB 2P0WA 1Z9CA 3AG1H 3P7NA 3KLOA 1D0YA 1XGSA 2XF5A 2GZWA 3ERMA 2NS8A 3PUBA 4XOTA 2HYFA 1G4DA 2IVMA 2BXYA 3RJPA 1W5SA 4CA0A 5ICCA 3EUHA 5J47A 5FLVA 3OOPA 2RVCA 2GOMA 3FDYA 4Y15A 2BY2A 4UVBA 3ULQB 3CJRB 1N25A 1KU9A 1W1WE 2DFIA 2HQRA 2QF7A 3BG3A 1XMAA 1I39A 5LLQA 1IRXA 3P9CA 2P7CB 4QPOA 3MEXA 1B72B 2DO7A 2DK8A 3HOUJ 1LDDA 1A6IA 2GOXB 5M5WJ 2DXIA 1C0WA 2ZSIB 3TOBA 1A31A 1D3YA 1FC3A 3EYYA 3LL7A 4FHTA 3L2VA 5B5EC 3ZMUA 4EJTA 5J4YA 3SFZA 1A36A 3ZPLA 2HFHA 1AKHB 2R7SA 2Z99A 1T39A 4HSTA 3HDDA 1FBQA 4DGWB 1FOKA 2VJIA 4EM0B 5BS6A 4OU0A 2FMLA 4F3QA 2BE5F 2R7FA 5IYBJ 2M30A 2ZFUA 1H9GA 1TC3C 4Y17A 5B3SH 1EF4A 4CUGA 3ECOA 1LKXA 3T0YA 2ZXIA 1SFEA 1QRYA 2B0LA 4BS9A 3OS2A 2XC7A 1IN6A 4BXXJ 4LG0B 2LNBA 1PUEE 2E1MB 1RESA 4AIDA 4EM1A 1RNLA 4HOBA 3FXUA 4FE4A 3BG6A 4M3BA 5E3MA 1K6OA 3CCVI 2BY0A 4IHSA 4FT8A 2L9RA 1Z77A 1BI3A 1P4AA 1W5CC 5CLSA 5D5WB 1M1EB 1QU3A 1R71A 5EGOB 2H94A 2E1CA 3GLXA 1BIAA 2BY3A 1XMXA 3E6BA 4EM2A 4QLCU 3BTLA 2QEXI 2F5DA 1KQ0A 3CP8A 1OYYA 5IPAA 1QGPA 1KONA 3MQ0A 4ZYGA 4U7DA 2RGVA 2ZCWA 2HDWA 2FX0A 5E1XA 3L2UA 5TISC 3HSRA 3CLQA 4ZJZA 5EZGA 4UUTA 3BG7A 3WE2A 2V1DA 2BVLA 2VC0A 1PYVA 1B9MA 1RRJA 5BNGA 1QVUA 1KGSA 4BJ6C 4DZJA 3PFYA 3J81Z 4B43A 1F1ZA 2XKOA 3OS0A 3PIPF 3H9GA 3S2DJ 3P5JA 1ZRDA 3E6CC 3BPXA 4CCMA 4RB0A 5M3FJ 1R6RA 2K9LA 1YI2I 1LQ1A 2ACJA 1QVTA 3CMMA 1WFXA 2DOEA 2EILH 2QQAA 3IC7A 3KFWX 5D6FA 3VFZA 2LY9A 1SVMA 1QPIA 2K4BA 2ZKZA 2KFDA 2HDDA 5A2QK 3K2ZA 1W36D 2JK3A 3MKYB 4E7HA 2EA2A 1JT0A 4B48A 1UHSA 2DFEA 1FBUA 1ZG5A 2EQRA 1QBJA 2LP0A 4EJOA 2FF4A 5JVTA 3Q0WA 3ZQQA 2CJJA 1HSTA 1GXQA 4YIFA 2L4MA 4KIFA 2KQRA 1I3AA 3HHHA 2EA4A 4I99C 5KHDA 2STTA 3I4MJ 3M8EA 3Q9VA 1VQPI 1G59A 4OOIA 1QNTA 4KITB 2HDCA 4JX6A 4E70A 3CUOA 2DYSH 2LTPA 2RKHA 3K4MA 5CVUA 1GDTA 3FXOA 3R60A 4N4OB 4J00A 2OZ6A 2YU3A 2MLKA 2LKSA 4I76A 1S72I 1UELB 5B66C 1MD0A 2MFZA 1J7KA 1JKQC 2HZDA 3J7AY 2F5EA 2FNAA 4DBQA 3BOQA 1XGMA 4LG3A 3ZMVA 3F3XA 2P4WA 4HQEA 4HAMA 2EIMH 3G1OA 3HOSA 3CZ6A 4RS8A 1PDNC 1B6AA 2ETHA 1Z7LA 2M4KA 4A3EJ 1R1TA 4IOAF 4Q4ZF 2Y30A 4PJNA 4QIWN 4MIMA 2IGOA 4XLHA 3LFUA 1X4PA 1KU7A 3FM5A 2OQGA 2EJRA 3WTTC 5CVIA 2P5KA 4ENJA 2WBMA 5E3NA 4ZDOA 1U9OA 3I71A 2K27A 1A35A 1YW7A 4P96A 1FX7A 2GAUA 1R00A 2LH9A 3T8RA 2Z5UA 4MGRA 4L0ZB 1BI1A 2A68F 3CJQB 4UXNA 5FD5A 1NG6A 1NG7A 3BQZA 3H3UA 4Q48A 3ZQGA 5AONA 2A6EF 4C2MJ 2JVGA 3P9KA 5HLIA 1EJ9A 4NC7A 4KYWA 5K5QA 3SEQA 2DT5A 3BR3A 2FBIA 1Z91A 2ZMEA 3FWEA 2R3SA 1JJ6C 1B72A 3GFMA 3OL3A 2EZIA 4DZPA 3CC7I 2Y0SN 2E19A 1MBGA 5BQTA 1Z3XA 1V5GA 5FO5A 2DA3A 4AC0A 4BJ5C 3OYIA 5KAIC 4ZDPA 1JT6A 2XAUA 2KKOA 2XV4S 3OYKA 4A3FJ 4BH9A 1JKRC 2O0YA 1MBKA 3LWFA 1AA7A 2VPRA 2OU2A 4LK0F 1I6XA 1DGRM 1U78A 2NAZA 2RC4A 1HLVA 3BC8A 4XLCA 5H6QA 3RKYA 4GDFA 2LBFB 4RBOA 2XRNA 1DUXC 2RAEA 3O8HA 4P9FA 4AVPA 4YFXF 2K3PA 3IRRA 4MQVA 2M34A 1R23A 3FF5A 2FJ1A 2L9SA 1QHHD 3BCAA 2C6YA 2PJPA 4AYBN 3KCCA 3M1EA 2JSPA 4QPQA 5E1WA 2F4MB 2HQNA 5CJ9A 3JRDA 1XCBA 1AHDP 4BY1J 2Z33A 2WADA 1GV2A 1TWAJ 5LHIA 1MMNA 3FXMA 3S2WA 1S8NA 2O03A 2MH2A 1EA3A 2QKMB 1NTCA 1YS7A 5F64A 2ID6A 1P4XA 5DV5A 3SJMA 4JYKA 2EFPA 4RAZA 4CYDA 2KL4A 3GXOA 3OR2C 2CW7A 3N97A 2A07F 1GLNA 2O9LA 4XM3A 4JOMA 2DA5A 2R5YA 2WA0A 1BBYA 1JHHA 5K7ZA 1P4WA 3R4KA 5LEKA 5KNLA 2ISZA 1PP7U 3L00A 3ZN0A 1I3QJ 3BP8A 2A5WA 1ETWA 2M1BA 3V7CA 4M9SA 2PI0A 3S15J 3S1NJ 1WH5A 2FXAA 1JKOC 3F8MA 4BDYA 5ILSA 5FRNA 3RQ4A 4BQOA 2Y69H 3CP2A 4L5EA 3TBIA 3MN2A 3ZR8X 2IA0A 3H3VK 1K83J 3DQVC 2PX9A 3KE2A 1ZRCA 1EH8A 1YJNI 1F43A 4RAGA 3KZIC 3RSNA 3HSFA 3E5UA 4XMYA 1DDNA 5J1YA 1IXRC 3EUKL 1TTYA 2HPIA 4R1HA 1LEAA 4ANJA 2O8XA 1H0MA 1OLTA 1LFPA 3U9GA 3I59B 2IW5A 3DBRB 1RKTA 2NNYA 1W7PB 3PQJA 2EZHA 1FZPB 2RN7A 3TO7A 1T95A 4MQ9F 2JJ7A 5IYDJ 1IZ1A 2W48A 2AHQA 2E2HJ 4C3JJ 2HVQA 4S04A 3GMEA 5IT9Z 3BWGA 2M8EA 1Y0NA 1HKQA 2HR3A 4HX7A 2DA2A 3OYGA 1ETKA 2HQ5A 4GRIA 2ICWG 5HS7A 3SYTA 2YX4A 1Z6TA 2VJJA 3GLLA 4M6XA 1F4KA 1ETQA 2GXBA 4HV5A 3KYDB 1BR2A 2Y0MA 1BI0A 1JE8A 3ASOH 3HM5A 4HLYA 1V5FA 1VQ4I 2XKPA 1P2FA 2F4IA 2IS1A 1DQUA 5L3GA 3ELKA 1MDMA 1GHCA 2VLAA 3FXRA 2PMHA 1SMTA 4EJUA 2XSDC 2PN6A 1ZHFA 3HB9A 4ZTJA 1RETA 3GTJJ 3RPUD 4PDKA 5M3MJ 2E7WA 4ZTFA 2VQGA 3HC7A 4BHCA 3LSPA 3AL0B 4RB1A 1Z67A 3HBLA 2M8GX 5FD6A 1U6GA 1EH6A 4Y33A 4G7ZF 2DFHA 1ODDA 1O57A 2O8KA 1SANA 2O3FA 2XB5A 4CCKA 2XGXA 3HOXJ 2L02A 2E34A 3HTSB 4G7OF 2ZSHB 2HKOA 5L3DA 2OC6A 3PSIA 4A6EA 5JHUA 1IXCA 1JXSA 4A0XA 1BR1A 5CQGA 5D5XB 4CICA 2UV1A 5TGTA 3VB2A 3RZOJ 3DLAA 5E3LA 5E17F 3ASNH 1Y0UA 2GXAA 2VL8A 1Q1HA 4NHJA 3V8JA 2GXGA 2EB7A 4Q5SF 1SD5A 1TWCJ 2W00A 3O3KA 5LGUA 3M1CA 4Y7NJ 3JRCA 5DD8A 3N4MA 1VZ0A 3K6GA 1LNWA 3WTSC 4NBQA 1K78A 2OCCH 1POGA 2DCEA 2DT7B 1VNDA 2L01A 3F8NA 5FLMJ 4GYGA 3K69A 3M9AA 4RGXA 3NEUA 3IWFA 5FFXA 4RGUA 3A03A 1HBXG 4DYCA 3ZRGA 3HGYA 2OAZA 2YS9A 3E5XA 2LKXA 3ROUA 3MZHA 3ISPA 5TJJA 2VQCA 1OJLA 2NNNA 3DBLB 2JN6A 5LGNA 1ONVA 1YQAA 3G73A 4XNFA 1X58A 4YFNF 2DODA 2COBA 1J59A 4PFOA 4PGGA 2HVSA 1G2HA 4BEHB 1FMWA 1YYVA 3EUHC 2XAHA 3ZMTA 1BN5A 2W84A 4S05A 1MJAA 3KP4A 1BC8C 2UWMA 2LG4A 5KAFC 3LA7A 3I55I 2EINH 3KZZA 4B3XA 1ETYA 4HBLA 1VQNI 5J3LA 2EBIA 3HUGB 3JR9A 3GWZA 2HS5A 2PMUA 2DJNA 1RR8C 2I5UA 3LOCA 2GWRA 2D5VA 3KX2A 4OMYA 2DMQA 2FNPA 1K6YA 1R4MB 1XN7A 3K1MA 4U87A 3SHFA 2MD0A 3PSFA 3MMYB 4HV6A 1DU6A 3I54A 1X1AA 3D0SA 3CO6C 1WI3A 2B63J 1WJ5A 1O7FA 2XGCA 4RAFA 4XRFA 2COMA 2DMPA 2YX7A 1O3TA 2UXXA 2FRHA 5HS9A 4V2GA 3PJRA 2Y75A 2VC1A 1FP1D 5IT9K 1WQ2A 2H6BA 2PMZA 3LSHA 1Q1VA 5F6FA 1T8IA 4YIIA 5BOXA 2QA4I 1IG7A 3ZQFA 3DKXA 1MJ9A 4ZH4F 1AWCA 1YJWI 1Y6IA 3KEQA 4YEJA 4IJAA 2HTSA 3HRSA 4XLFA 3IRQA 2R7RA 1ENHA 1Z0XA 5K7FA 2HOEA 1VQOI 3BZKA 1ZELA 2JUGA 1UZCA 4IOCF 1KYWA 2XF7A 3B73A 3GFLA 2R7DA 5B1AH 1KYZA 4ZZLA 3CCEI 2WY7Q 1MZBA 4GXOA 3I59A 2O7OA 4GGGA 1W7PA 3L2RA 1VI0A 4LIUA 2E2JJ 2FOWA 5EJCA 3TKYA 3O6BB 2FOKA 3UR3C 4M71A 2Q1ZB 2BHYA 5K7HA 1BW6A 1Y39A 3BJ6A 2GA1A 2KRFA 3SEZA 4UVCA 1QZZA 5FJ8J 1WJBA 4G12A 3TQNA 2E1OA 3GTQJ 1J2XA 3G6EI 5JLWA 1E2XA 2H27A 2X9DA 2M7BA 4ABZA 2W1OA 3H0DA 3F72A 5IY5H 3FMSA 1O4XA 1AU7A 2LC2A 2YSRA 3QU6A 2PMZN 1ON1A 2QENA 1T56A 1IRZA 4M73A 4LB5A 2AQFA 3JSPA 2XVCA 4RB2C 4ASNA 4BU2A 4L0YB 1YITI 2EFOA 3CCMI 2M0CA 3Q9SA 3G3ZA 1XDUA 4BACA 2JMWA 1BW5A 3S93A 3TDUC 2LOOA 1FYKA 1OPCA 3G2BA 1SD7A 3QYBA 4BAYA 2QLZA 4A0ZA 3PNTA 1J0RA 2QZ8A 4F92B 1JUMA 3G1LA 4ZYDA 2EZLA 2DK5A 2RDPA 2VBZA 2CV2A 3F0CA 4D7MA 1RPWA 2A6HF 1REPC 5JVGF 3OV8A 5L3BA 1L3LA 2NVYJ 2AO9A 4E7ZA 4X0GA 1FNNA 4IRIA 3K4LA 4KT5C 3KYCB 1LFBA 3CUQA 3JRHA 4EEFG 1STZA 3TW6A 3WG7H 2JQ7A 4U0VA 2Y9YA 5IOYA 3JW4A 4MEXF 1YRNA 1RUOA 1TQPA 1T0FA 1USSA 2QSHX 4F52A 2ZMEB 2JA7J 2O5RA 3A1YA 2EFNA 2X6XA 2R5ZA 3MVPA 5DYMA 3BJOA 4GCVA 1I1GA 2CQQA 2VT2A 3O8GA 1BOAA 3RZDJ 1HA8A 3BLYA 1LDJA 4G6QA 4EJVA 1IDYA 4XLEA 1VTNC 4NUBA 2IP2A 1SVLA 2KDZA 4BBSJ 3CQZJ 3HGGA 1IUFA 4D1QA 3I3LA 5JR3A 3ZP5A 1OCPA 1XS9A 5F1RA 2LRDA 4XSZF 2HYJA 2GA2A 3JAMZ 1IN8A 1WH7A 3HOVJ 2Q2EA 1FOXA 2X48A 1ZK8A 3BZCA 5J8FA 5EEAA 1HQCA 1Y1WJ 2H09A 1W0UA 5K5OA 2DYRH 5GTIC 3BG5A 1F36A 2VXDA 4XORA 5D5VB 1MW7A 3PNVA 2ELJA 2YU9J 4IPAA 5IOZA 2KIQA 2JZYA 4EQQA 1L0OC 2QSFX 4P5OA 3DKYA 1FEXA 1SFXA 1JTXA 1TWHJ 4C9YA 2F48A 1PUFA 4WK8F 1QZYA 3B6CA 3KZYA 4BEHA 2ECBA 4LOCA 2HTJA 1WGXA 3SDBA 1S7AA 3HOTA 2R5YB 1HDPA 3F9KA 2EWNA 3G1MA 5DDGA 2DN0A 2CWEA 1CGPA 3H35A 5J1UA 1B4AA 5K1YA 1G3SA 1X2MA 2TCTA 2CGPA 5IYCJ 2M7AA 3S1MJ 4IQ4A 2OPTA 2R7QA 5ILVA 2HOAA 4HG2A 2ZMEC 3HUGA 3L9FA 4DOZA 3D1NI 1H8AC 1FYLA 4FTHA 3VDXA 3JRGA 3J80Z 2R93J 4OIPF 3I0TA 3TO6A 3OYCA 2DPUA 1FLIA 1DU0A 2F5FA 1IUYA 4HX4A 3W2WA 2BVMA 2JT1A 2LMDA 1I1SA 2AXTC 1KQ8A 1U3EM 2WAEA 2ZB9A 3H0GJ 2VB6A 1BJAA 1WCMJ 2ESNA 3HKZN 3H9JA 4U7BA 2A3SA 1ZAOA 4A3KJ 4WX9A 3ABLH 2CW0F 2JRTA 2W82A 5HDKA 4I01A 4ZYAA 1E3HA 3FM3A 2V79A 2MA3A 3QRFF 1IV6A 5KK1A 2B7EA 2Y2ZA 1ETXA 2G7HA 4IHVA 4UB6C 1WJAA 5ILUA 4E4HA 2E1MC 4J01A 2PBIA 3VODA 5DEQA 4C3HJ 2Q8KA 2ZXHA 1R1VA 1MBHA 1Z1DA 3IKVA 4BDZA 1SEUA 1N77A 1LEBA 4M3EA 2EFQA 4ZYHA 1LPQA 2ELHA 2K9NA 3RKQA 3BQYA 1H89C 2Y48A 5B1BH 4QTRA 2MH9A 1CF7A 4DBRA 1FP2A 2R7TA 5K5RA 2V4JC 2V26A 1NK3P 4ZZDA 2V9PA 1XG1A 2VBYA 2IA1A 1K79A 1USTA 4BGDA 5L3EA 4A3DJ 3OYJA 2E60A 3ABKH 3ZMSA 1FTZA 3F21A 3PUFA 2OZUA 4WXDA 1MDMB 3OYBA 1ZREA 3BR2A 4EVIA 2STWA 3CTAA 2VE9A 2Y9ZA 1DPRA 2IBDA 1F5TA 3DV8A 4P9UA 2BHZA 2Y0SA 4N9HA 3OMYA 1WJDA 4KN4X 4A5MA 4WF2A 4EV0A 1R9TJ 2PJRB 2DQLA 1TLHB 4M3FA 4OIQF 1ZN2A 1Z3YA 5HDGA 4KT6A 2G0EA 5JI6A 1VQ7I 4U0WA 1WWXA 2DT6A 1YX5A 2WC2A 4OAYA 1UB9A 1X4OA 3HZJA 2I10A 2MGQA 2DMTA 4H0EA 2NOJB 3S16J 1WJEA 2CU7A 3DKWA 3FISA 1FIPA 2KT0A 1YE9A 2K9QA 3DBHB 2YR2A 1FSHA 3LA3A 2LFBA 3DF8A 2KJCA 4DW6A 2L3DA 2DMNA 5H20A 3TP0A 4AYBA 4I7HA 4ESBA 4A3GJ 3GF2A 1FPQA 3FIWA 3I9V2 1E0EA 1HOMA 5F04A 2X6OA 3WGGA 1W4MA 3BTJA 1YS6A 3AAFA 4QSHA 4AIKA 4ZYEA 2GLOA 4Y4RA 1K78B 4TV7A 2MYSA 5LRSA 1BIBA 3EUAA 3HG9A 4FETA 3CCQI 3BCBA 5E1ZB 1LUJB 2OCEA 4MTEA 3E1SA 4IVNA 3ESWB 3LQQA 1R5ID 2MC3A 4A3IJ 2VBXA 2OUMA 2WAQN 2VT3A 2V1XA 4O5VA 1FY7A 4CZZA 3LA2A 4PCQA 4E7KA 1ZKGA 3H9QA 3ABMH 4B8XA 1Y1VJ 3QPTA 1X1PA 2V1NA 1K4SA 3CCRI 2XPUA 4KMFA 3BT9A 2N8GA 3AKZA 2F4OB 5JHFA 2WY8Q 2PG4A 4HPQA 1V5EA 3HOYJ 2ZNYA 2RNGA 2IA2A 2ZXWH 2R0QC 1XDSA 4HW0A 2YPRA 2BV6A 4RM2A 1OCCH 3ZCOA 4FISA 3M8FA 4CCJA 5GTHC 3J80K 3QAHA 4WXCA 3DTKA 4NNJA 4RAYA 4I2OA 1MBFA 4XKCA 4JX5A 3J81K 2EV0A 2W57A 3D5RC 5GADJ 4BQNA 1J09A 2V7FA 1V4RA 4DYRA 1O3SA 1U0JA 4LJZF 5FGMA 2EV5A 2EH3A 1OYIA 4UVAA 1R5HA 1OYWA 2VBWA 3K70C 4A12A 5EDNA 3OSFA 5LGTA 3ABUA 2NS0A 1OCZH 4ZDLA 1ZG1A 1YIJI 3Q5FA 4L9NA 2IPQX 3LAJA 2CV1A 3VYUB 3GTMJ 3F22A 2HEOA 1VQKI 2HU9A 2ADUA 5IT3A 3FK6A 3GUDA 3TDZC 4CDGA 4XKWA 5FKNA 2DA7A 3OIPA 1MNDA 4B47A 5LHGA 3DFGA 3PFIA 4F93B 2FU4A 2OQRA 4HZFA 2R7VA 3CMAI 1FTTA 2XPVA 3MD2A 3RPQA 3S3NA 3T1BA 1D0XA 3LSTA 3I5UA 5GPAA 3MCZA 2R7ZJ 1MNMC 3KPHA 3ZXSA 4MNUA 1KZHA 3FBNB 5KCMA 2BEOA 4PFPA 5D4SA 1D5YA 4W97A 4LMYA 3FBIB 1OMIA 2KLOA 3LSGA 3HRMA 3GTKJ 5H6RA 1JHFA 2KMUA 4IQJA 3BR0A 4A69C 4M72A 1Z05A 2F5CA 2IXSA 1MGTA 1VQMI 2KJBA 1MJBA 2K4JA 2H6CA 2K7LA 3QQAA 2KISA 4LFUA 2VN2A 5FKOA 5KVRA 3R61A 2VUMJ 5M5XJ 1BI2A 3J7AO 3OYHA 3IL2A 4CH7A 1P6RA 1I27A 2X1DA 4XLAA 4A3BJ 4BNCA 5J1RA 2DBBA 3HEFA 3FMQA 5DD4A 2ZFWA 3EDPA 2CSOA 4HQMA 4WXHA 1IN4A 4G7HF 2NRAC 3DPUA 3CDIA 1TT0A 5E18F 3U2RA 2A6TA 2PFBA 2JPBA 5M5YJ 2MABA 5TRDA 3J7YJ 3GZNB 4N4NB 1YIOA 3I53A 4UHTA 3QPSA 2LF7A 1WPKA 5E8GA 4E7JA 3LAPA 3WHBA 4PSXA 5AIPA 5CQEA 3HOZJ 3MWMA 2ZJRF 4E7IA 5BPIA 2JRMA 5BMZA 3DEWA 1OKRA 3OYDA 3QOPA 2XHKA 2PJRA 3LSRA 2VKHA 1ETOA 4RMNA 1UJ8A 2ZXJA 2CS3A 3ZQCA 2XF6A 1UHMA 3MKLA 5GP9A 4IL6C 4L9TA 3TEDA 1YO5C 5E8IA 2ZJ2A 2F6CA 1D8KA 3TGNA 1I6HJ 2DLLA 1JUPA 2WB1N 3DWLE 1MMDA 3DXJF 3E97A 3HRUA 3OIQA 3CUQB 2DPDA 4KISA 3CJNA 1AOYA 2QYOA 2JPCA 2V9VA 2GIZA 4KA4A 1YRNB 1RIOH 2IGMA 1FBSA 5DUIA 4IEJA 3VYRB 1F9NA 3V8LA 2K86A 2OV7A 3MZ8A 4O3MA 2R5ZB 3EYIA 1MNEA 3ONQA 4AIHA 5IP9J 2CQXA 3ML6A 4IO9F 2R92J 5L3FA 2X1CA 2KRHA 4LLNA 1BL0A 4GFBA 4II3A 5H2FC 2BY1A 1YG2A 2LK2A 4IRGA 2BOLA 4KICA 2ZJQF 3C18A 2X85A 5ICEA 4IHTA 2LVSA 1U9NA 2IT0A 3L1PA 4I98B 2JA6J 3PQKA 2CQ7A 4HDUA 3QYEA 4L5IA 4N0BA 2NXNB 2GQQA 1LDKB 2Q2EB 3IAM2 2FD5A 1SAXA 2QQ8A 1J9IA 2OTJI 4FQGA 5HLGA 2JTVA 3FHZA 1JUSA 2GBYA 2K85A 1W5TA 2K9MA 3IWZA 5LFAA 2LF8A 3I64A 3CCSI 2LREA 2IJLA 3RKXA 3L7WA 1KU2A 3L2QA 1FMVA 3AL0C 1G3WA 3E6DA 2B9SA 1PUFB 1ERDA 1V54H 3OYEA 3FX3A 1Z6RA 5BPDA 4ESFA 1ZARA 2R4GA 2D1HA 4HSRA 3IKTA 1S3JA 4NC8A 2QKLB 3CF5F 4EGZA 1O3RA 2QUFA 4YFKF 1IRGA 3CD6I 2VOPA 1CQTA 2RV8A 3CDLA 4PJJA 4BHPA 3CUQC 2VASA 5ICGA 2E7XA 3K0LA 3QU3A 3S2HJ 2ZJPF 2X51A 1K61A 1T0FC 2L9VA 3F6VA 2JVHA 2XAJA 3QODA 3K2AA 2QWWA 5JFRA 5GAHJ 3X2QH 5GAEJ 2VODA 3SDGA 5J6XA 2QCOA 2OA4A 5DS9A 3QWLA 2M2EA 4U0YA 2FMYA 4A2UA 3W2AA 1YHQI 1HDDC 1WI9A 3CLOA 3BR1A 1X3UA 1MMAA 1A6QA 2BYVE 1ZG3A 4UNOA 1R1UA 3DTIA 3KP7A 1XPXA 3GTGJ 1JGSA 3T8TA 3C2HA 4KN7X 3E5QA 2P8TA 4BQQA 1IRFA 1HCRA 1U5TB 4XQFA 1GUUA 1ITYA 3GFJA 3JSOA 4F55A 4OIRF 5FROA 1KQ9A 1RI7A 3VOEA 4DQ2A 1HSJA 1P7JA 1V3FA 1DP3A 1VFCA 3ZQLA 1IDZA 2E1NA 2IAIA 4A0YA 3AG4H 3GCMA 3BG9A 4UY8I 3C2GA 3NWSA 3KP2A 4G8XA 5HS8A 1Z21A 3JREA 4AM3A 1SFUA 1ACIA 2QGUA 4V19K 2XROA 3QP6A 1R49A 3QOEA 2EIKH 4MFDA 4AUXA 4XN3A 3JRBA 4HLXA 3DU5A 2MW8A 3FHNA 3LSMA 3HL2A 3AG3H 3LNQA 1HC8A 5E3OA 1ZRFA 4MLOA 1ZGAA 1CF7B 3LSKA 5CVJA 1RZ4A 2Z9OA 3MAJA 3I56I 1K7AA 1BJZA 1XD7A 2KIFA 2WWYA 2AQEA 1ON2A 2RQPA 1UFMA 3IH4A 3KLNA 4D7NA 3A01B 3IHUA 1JJ8C 2O6GE 1DGWY 3M07A 2F2EA 1ZTRA 2KIMA 2H1KA 2VQHA 3TMOA 1ZH5A 4NDLA 3Q0UA 4OAZA 3C2BA 1HW5A 3OL4A 5C44J 1RR7A 3JTGA 1RUNA 5ERIA 4PZJA 4ETSA 2JUCA 2E2IJ 3K10A 2K3FA 5ED4A 4Y52J 4XRMA 1R5GA 2A69F 2WTEA 2DA4A 4A3JJ 4XLPF 2QBYA 1WHUA 1QHGA 3GZ6A 3I4PA 2DTRA 4XK4A 2E71A 3CCUI 2NVXJ 3WTZA 4FX4A 1G3YA 2CYYA 1LB2A 4EJWA 2W85A 6PAXA 4CO8A 4BYYA 4OWRB 1J75A 2DW4A 2LSOA 1Y8QB 1ZLJA 2ZO4A 2X1EA 3OWTA 4GYIA 1WVRA 2LR8A 5HOOA 2RREA 5EZHA 4BHBA 2LKPA 5HNFA 2ZNZA 4ON0A 1S7EA 2JA8J 2TRTA 4OMZA 2MG4A 2GIVA 2V6CA 4II2A 2DU9A 4IXAA 4G6TB 2HNHA 1VQ8I 1ULYA 3QPHA 3WGIA 4FASD 3FXQA 4UV8A 2HXIA 5EG0B 1VQ6I 4YRVA 3AFHA 2L0KA 4XRSA 4CYCB 4BKXA 1P92A 1S9HA 2M87A 2L4AA 1X19A 2JA2A 3SXYA 1UG0A 4NQWA 3I4NJ 2FBKA 4K2EA 2LDUA 3DPLC 4HEA2 4RLFA 3H92A 1OR7A 1Y56A 3NQOA 3A02A 1WKMA 2KHMA 4MTDA 4YELA 2L5QA 2XPWA 1OCTC 2CO5A 2UZKA 3DPTA 3SQNA 2R7UA 1XCVA 2OBPA 3K70D 2VKDA 3K4KA 3EETA 2E36A 5FRMA 4JBAA 1T6SA 4OINF 5DTDA 3CMEI 3HPGA 3VPRA 3HKZA 2QVOA 4D9JA 2IS4A 1IN5A 2FBHA 2JSCA 2LY1A 3C3WA 2P81A 3DLLF 2HOTA 3R0JA 3V8KA 2MC4A 5E20A 4IHWA 3PO3J 5JLXA 3ZQ7A 1SAUA 5FLXZ 4DIQA 5EEHA 2L7MP 5LD2C 2ZBKA 4XKVA 4EMSA 4BQAA 1MBEA 5FB2A 4BE2A 4HDVA 2FA5A 1W0TA 2QQBA 5CVRA 2CRGA 3T5XA 4R79A 3WGHA 1D8JA 4R8HA 2CQKA 2NVTJ 1S29A 2XASA 1PP8F 2XB0X 3OY9A 3ECHA 1D1BA 3S8PA 4WCGA 3QP5A 4PGHA 1WJFA 3NARA 4CCOA 1G6NA 1XX5A 3GO5A 2GM4A 2L2OA 3IAS2 2FEZA 3VSKA 3RTRA 4L9JA 1GXPA 1FOYA 3F8BA 2IRFG 3N05A 4XONA 5GAGJ 3DTEA 2KIUA 3KP6A 4IRHA 2P6SA 4CZCA 2BXZA 2W4SA 2K9SA 1MSFC 3C1DA 2CUJA 2WV1A 3ZGKA 4XICA 1DP7P 4RLQA 2Y31A 4EGYA 1U5TA 1JGGA 1R7JA 3WU0A 4LLGF 4P55A 5F08A 3M7GA 3OYFA 4UV9A 1YW9A 1TW3A 2XUBA 3GVAA 1B8IB 3V7SA 2XAGA 4PUSA 2YUSA 1X1BA 1FJLA 1VQ5I 4GO1A 5DM7F 4L18B 5FFZA 4B3AA 4LK1F 3K9TA 3GZ5A 4BE0A 1IJWC 4MHGA 4M3GA 1TQMA 3CCLI 3SFIA 1TL8A 3UKGA 2NOGA 5GPCA 1FOWA 4Q47A 5F1JA 2HYGD 4KJZA 3PNYA 3HYIA 4MO7A 3RIRA 2R7WA 4LD5A 2DJIA 1YX3A 1Z7UA 3FXLA 4C30A 4BXFA 5J4VA 1XGNA 2DFFA 4Z6YA 4CGZA 3TP3A 2FQ4A 4HRIA 4JQFA 2M0MA 5C3EJ 1OFCX 1TW2A 3UNGC 4G9YA 3LQRA 2ZC2A 2RNJA 1IN7A 3RPUA 1U8BA 4F7ZA 2M3AA 3A01A 4A5NA 3MKWB 3S1RJ 1RKWA 2X4HA 3A2KA 5D8KB 1SFOJ 3GYHX 3H5AA 1HW1A 3REOA 1GVJA 2NVUB 1W7PD 2NYXA 2HGCA 2TDXA 3EPZA 5HVQC 5F0FA 2K02A 1HKSA 3L2CA 3HRTA 4HNUA 2WAQA 1BA5A 1LJ9A 2CUFA 3E3VA 2BW3B 1MH4A 2EV6A 3D5SC 2DMUA 4M9ZA 5IP7J 4ENMA 4OIOF 4Y13A 4HF2A 2CUZA 1R58A 4NC6A 1MMGA 2IS2A 2XGDA 4CCLA 1D1CA 3K4NA 3LSIA 2F5VA 2CV0A 3BROA 3TOAA 5DCMB 3JAMK 4D5FA 3JRFA 1IGNA 3RYPA 3BTCA 1FSEA 2L7KA 3A0HC 5DUKA 1T2KA 1IAWA 1IF1A 2W25A 1NK2P 1D5VA 4RGSA 4M3DA 3W6JB 2DDAA 3GEZA 1QQIA 2XAQA 4FE7A 3OYNA 1VQLI 5EYRA 3WTVC 2H8RA 2V6EA 3L09A 3KYLA 2EFWA 4G94A 2H1LA 3F23A 4X6AJ 1H88C 4Z2YA 2DA6A 3U1DA 3ERED 3CC2I 3FZVA 4HYEA 3H3ZA 5EG0A 2VONA 4H4KC 4CYCA 1DPUA 4IHXA 3SZGA 2NS7A 2KZGA 2PEXA 2L7FP 4HX8A 1I50J 2CMPA 5FLXK 2XDVA 2IGNA 3E7LA 3FKIJ 4ENKA 3C7JA 2DOAA 2IEKA 2Z3YA 4XBFA 3V7RA 4D0PA 1ETVA 4N9IA 4DNCA 1HXDA 1HF0A 3CDHA 1MBJA 4C3IJ 1XB4A 3WTWC 1EH7A 3H36A 3HSEA 3CCYA 3OOUA 1AKHA 3B6AA 1APLC 1SVOA 1VQ9I 1MMSA 1A04A 5D4RA 1XTAA 2KDOA 3E0JB 4UUSB 2Q0OA 3NAUA 1UAAA 2NVQJ 3S32A 1IV8A 1ORKA 3VSLA 3VWBA 3KP5A 2G9WA 3HPHA 2PQ8A 1SD6A 1HKTA 1TT5B 1S5LC 4JX4A 1OISA 1KA8A 3MKZA 2OJED 4NB5A 1ZR4A 3H5NA 2WV0A 1EKEA 5HODA 2P5LC 4LG0A 9ANTA 2MSYA 4MFEA 2MBFA 4L9VA 2AS5F 1P9QC 3KEOA 4RM3A 2HKXA 3W3CA 3BJAA 3IV5A 2HWVA 2ESHA 1ZGWA 3G4SI 3HTUA 2EIJH 1T08B 3FK7A 5E79C 1UMQA 4LITA 2QM3A 1LE8B 4RGRA 1Y8RB 3CESA 3QPLA 4XR6A 3KETA 4BE1A 1O3QA 5EGOA 4YIRX 3JRAA 2QQ9A 3RKWA 3V4GA 1QPMA 4I0BA 3SZTA 3GTOJ 2HI3A 4LB6B 1GT0C 3CCJI 1TNSA 2VJ5A 3R6SA 2X0LA 3WU2C 3ZOBA 1X1CA 4S0HB 2M5WA 2L54A 2DTZA 5D6EA 2Z2SB 4W1UA 2DI3A 1JI8A 1X2NA 1YTYA 1ZLKA 4XN0A 4AIJA 3HXLA 2VQLA 3PO2J 3V42A 3VYTB 3JRIA 4B44A 3S3OA 1WRJA 1B8IA 2D1VA 3ZQIA 2DAOA 4XIDA 5AIQA 4IZZA 4LIVA 1XSDA 2CW8A 2KP6A 3OSGA 1S7OA 1U2WA 3B02A 3GBGA 1H9TA 2WB1A 1O7LA 5LBQA 2Z16A 4XLNF 4BUPA 2G7UA 4ITVA 4E6KG 1UCRA 1WSUA 1YLFA 1JKPC 4B09A 2HZTA 3ZQHA 1IC8A 4A6DA 2PLYA 2I8DA 3RDIA 4I09A 3CO7C 2A5YB 2EZKA 3ZN1A 3S3MA 5LHHA 3W6VA 4BY7J 1I5ZA 4HNVA 3GW2A 2E5NA 4JK1X 2FE3A 4FX0A 3LMMA 3A0BC 1K4TA 4V2FA 4AVZA 1WZ2A 4XRSG 1A5JA 4KIGA 3BDDA 3R0AA 2V9KA 3BPVA 3K1PA 3GX4X 2KPMA 4AWXB 1W36C 4CHUA 2AXLA 3M4OJ 4IX7A 4O6JA 4IF4A 2ID3A 2KZVA 3Q0VA 4HNTA 4EATA 2QBYB 3GFIA 3BZ6A 5EF6A 1TWGJ 4F91B 1MKMA 3HHGA 3CJTB 3FXJA 5HLTA 1D0ZA 3M3YJ 2LD5A 2K40A 4I02A 5EEGA 2DDBA 2M9HA 2E5ZA 2DOFA 2XSJC 2M4GA 4LGWA 1ZYRF 4M6VA 2E35A 5DM6F 2VJ4A 2MD5A 2XRLA 4AU7A 3S17J 2BW3A 3CF2A 3IUOA 3J7ZI 2A61A
chains in the Genus database with same CATH topology
3O2PE 1FWZA 3EQLF 4M74A 3FMRA 1R22A 5HDNA 3RI4A 5DCMA 3KP3A 5LEJA 1XSVA 4XSXF 2D2WA 2DQRA 3ABTA 4MEYF 4KFCA 1BM9A 4YG2F 4KMUX 1FYMA 2O61A 1R36A 3K1NA 4G6DA 3ZMZA 4QWQA 1B9NA 3WE3A 1YW8A 1QO0D 4L5JA 1S6LA 4RB3C 1YFHA 3WU1B 1BC7C 2VE8A 1UHWA 3P9IA 2UXNA 3BY6A 1EV7A 3SZPA 3JTHA 3MFKA 3WTXC 5D5UB 1HW2A 1E17A 3COAC 4KNYA 3F8FA 3WTYC 2BBYA 3TO9A 1TQIA 2M45A 4BXUA 4U88A 3WG9A 4UUVA 5ICFA 3WTUC 1IW7F 3MZYA 1J5YA 3DP7A 4KIBA 3NRVA 1XGOA 1XSXA 1T38A 3F8CA 3D5LA 2W24A 3I58A 2BGCA 1SMYF 4M9XA 2D45A 2FSWA 5CVVA 1IXSB 1T98A 4M6YA 4HF0A 2VXZA 3VEPA 4CXFA 5L3CA 5CYVA 5J8CA 4LLLA 4KDPA 1FT9A 2XAFA 4WWCA 4ENNA 1G3TA 3F6OA 4ESJA 3ZMDA 3DEUA 2MLGA 1U8RA 1ZGJA 5DCFA 2J5PA 3RYRA 4HF1A 4I0AA 1XMKA 1B1BA 5A2QZ 2V1UA 3LFKA 1SD4A 2ISYA 2J5OA 5D8LB 1LVAA 1B59A 2CFXA 1TBXA 3E6MA 1TNTA 2XIGA 2FQ3A 2P5VA 2P6TA 3W6KB 3WODF 5HLHA 4HA8A 2CG4A 2EK5A 1U5TC 4KUMA 4AD9A 2OD5A 2VOOA 1KU3A 1NHAA 5LRRA 3HIFA 2P7VB 1Z9CA 3P7NA 3KLOA 1XGSA 2GZWA 2HYFA 1G4DA 2IVMA 3RJPA 1W5SA 5ICCA 3EUHA 3OOPA 2RVCA 4Y15A 4UVBA 3ULQB 1KU9A 2DFIA 2HQRA 1XMAA 5LLQA 3P9CA 2P7CB 3MEXA 2DO7A 2DK8A 1LDDA 1C0WA 3TOBA 1D3YA 1FC3A 3EYYA 4FHTA 3ZMUA 4EJTA 3SFZA 3ZPLA 2HFHA 2Z99A 1T39A 1FBQA 1FOKA 4EM0B 5BS6A 4OU0A 2FMLA 2BE5F 2R7FA 2M30A 1H9GA 4Y17A 3ECOA 3T0YA 1SFEA 2B0LA 1IN6A 4LG0B 2LNBA 1PUEE 4EM1A 1RNLA 4HOBA 3FXUA 1K6OA 4IHSA 4FT8A 1BI3A 1P4AA 5CLSA 5D5WB 2H94A 2E1CA 3GLXA 1BIAA 3E6BA 4EM2A 4QLCU 2F5DA 1KQ0A 1OYYA 1QGPA 3MQ0A 4ZYGA 4U7DA 2RGVA 2ZCWA 5E1XA 3HSRA 3WE2A 2V1DA 2VC0A 1B9MA 1KGSA 3J81Z 1F1ZA 2XKOA 1ZRDA 3E6CC 3BPXA 4RB0A 1LQ1A 2ACJA 3VFZA 2QQAA 3IC7A 3KFWX 5D6FA 2K4BA 2ZKZA 5A2QK 3K2ZA 2EA2A 1FBUA 1ZG5A 1QBJA 4EJOA 2FF4A 5JVTA 1HSTA 1GXQA 4YIFA 2L4MA 4KIFA 3HHHA 2EA4A 2STTA 3M8EA 3Q9VA 4OOIA 1QNTA 2HDCA 4E70A 3CUOA 2RKHA 5CVUA 3R60A 2OZ6A 2YU3A 2MLKA 1MD0A 1J7KA 2F5EA 2FNAA 3BOQA 1XGMA 3ZMVA 3F3XA 2P4WA 4HQEA 4HAMA 3HOSA 4RS8A 1PDNC 1B6AA 2ETHA 1R1TA 4Q4ZF 1KU7A 3FM5A 2OQGA 2EJRA 3WTTC 5CVIA 2P5KA 4ENJA 3I71A 2K27A 1YW7A 4P96A 1FX7A 2GAUA 1R00A 3T8RA 2Z5UA 4MGRA 4L0ZB 1BI1A 2A68F 4UXNA 5FD5A 4Q48A 3H3UA 5AONA 2A6EF 5HLIA 3P9KA 4KYWA 5K5QA 2DT5A 2FBIA 1Z91A 2ZMEA 3FWEA 2R3SA 3GFMA 5BQTA 5FO5A 2KKOA 2XV4S 4BH9A 2O0YA 3LWFA 2OU2A 4LK0F 1I6XA 1U78A 2NAZA 2RC4A 5H6QA 3RKYA 2XRNA 1DUXC 4P9FA 4AVPA 4YFXF 3IRRA 4MQVA 3FF5A 1R23A 2C6YA 2PJPA 3KCCA 3M1EA 5E1WA 2HQNA 5CJ9A 1XCBA 2Z33A 5LHIA 3S2WA 1S8NA 2O03A 2MH2A 1YS7A 5F64A 1P4XA 5DV5A 2EFPA 4RAZA 4CYDA 3GXOA 2A07F 3N97A 1BBYA 1JHHA 1P4WA 3R4KA 5LEKA 2ISZA 1PP7U 3L00A 3ZN0A 3BP8A 2M1BA 3V7CA 4M9SA 2PI0A 2FXAA 3F8MA 5ILSA 2IA0A 3DQVC 3KE2A 1ZRCA 1EH8A 3HSFA 3E5UA 1DDNA 1IXRC 1TTYA 4R1HA 1LEAA 2O8XA 1H0MA 3U9GA 3I59B 2IW5A 2NNYA 1W7PB 3PQJA 1FZPB 2RN7A 3TO7A 4MQ9F 1IZ1A 4S04A 5IT9Z 3BWGA 2M8EA 1HKQA 2HR3A 4HX7A 5HS7A 2YX4A 1Z6TA 4M6XA 1F4KA 2GXBA 4HV5A 2Y0MA 1BI0A 1JE8A 4HLYA 2XKPA 1P2FA 5L3GA 3ELKA 1MDMA 1GHCA 3FXRA 2PMHA 1SMTA 4EJUA 2PN6A 1ZHFA 4PDKA 2E7WA 4BHCA 4RB1A 5FD6A 1U6GA 1EH6A 4G7ZF 1ODDA 1O57A 2O3FA 2XGXA 3HTSB 2L02A 4G7OF 2HKOA 5L3DA 4A6EA 5JHUA 1IXCA 1JXSA 4A0XA 5D5XB 4CICA 3VB2A 5E17F 1Y0UA 1Q1HA 4NHJA 3V8JA 2GXGA 2EB7A 4Q5SF 1SD5A 3O3KA 5LGUA 3N4MA 5DD8A 1LNWA 3WTSC 1K78A 2L01A 3F8NA 4GYGA 3K69A 3M9AA 4RGXA 3NEUA 3IWFA 5FFXA 4RGUA 1HBXG 2OAZA 3E5XA 3ROUA 3MZHA 3ISPA 5TJJA 2NNNA 5LGNA 1ONVA 1YQAA 3G73A 4YFNF 1J59A 4PGGA 1YYVA 2XAHA 3ZMTA 1BN5A 2W84A 4S05A 1MJAA 3KP4A 1BC8C 2UWMA 3LA7A 3KZZA 4HBLA 3GWZA 2HS5A 2PMUA 2GWRA 4OMYA 2FNPA 3K1MA 1XN7A 3SHFA 4HV6A 3I54A 3D0SA 3CO6C 1O7FA 4XRFA 2COMA 2YX7A 1O3TA 2UXXA 2FRHA 5HS9A 2Y75A 2VC1A 1FP1D 5IT9K 1WQ2A 2H6BA 5F6FA 4YIIA 5BOXA 1MJ9A 4ZH4F 1AWCA 3KEQA 4IJAA 2HTSA 3HRSA 3IRQA 2HOEA 1KYWA 3B73A 3GFLA 2R7DA 1KYZA 4ZZLA 1MZBA 4GXOA 3I59A 4GGGA 1W7PA 3TKYA 3O6BB 2FOKA 4M71A 3BJ6A 2GA1A 2KRFA 4UVCA 1QZZA 3TQNA 1J2XA 1E2XA 2H27A 3F72A 3FMSA 2YSRA 3QU6A 1ON1A 2QENA 4M73A 4LB5A 3JSPA 2XVCA 4RB2C 4ASNA 4L0YB 2EFOA 3Q9SA 3G3ZA 1XDUA 3TDUC 1FYKA 1OPCA 1SD7A 4BAYA 2QLZA 4A0ZA 1J0RA 2QZ8A 4ZYDA 2DK5A 2RDPA 2VBZA 2A6HF 1REPC 3OV8A 5L3BA 1L3LA 4IRIA 1FNNA 4KT5C 3CUQA 1STZA 4U0VA 3JW4A 4MEXF 1RUOA 1TQPA 1T0FA 1USSA 2ZMEB 2EFNA 5DYMA 3BJOA 4GCVA 1I1GA 2VT2A 1BOAA 4G6QA 1LDJA 4EJVA 1VTNC 2IP2A 5JR3A 3ZP5A 5F1RA 3JAMZ 4XSZF 2GA2A 1IN8A 2Q2EA 5J8FA 1HQCA 2H09A 5K5OA 5D5VB 4IPAA 2JZYA 4EQQA 1L0OC 4P5OA 1SFXA 4WK8F 1QZYA 3KZYA 2HTJA 1S7AA 3HOTA 2EWNA 5DDGA 2CWEA 1CGPA 1B4AA 5K1YA 1G3SA 2CGPA 5ILVA 3HUGA 3L9FA 1FYLA 3J80Z 4OIPF 3I0TA 3TO6A 2DPUA 1FLIA 2F5FA 1IUYA 4HX4A 2JT1A 1I1SA 1KQ8A 1U3EM 1BJAA 2ESNA 4U7BA 2A3SA 1ZAOA 4WX9A 2CW0F 2JRTA 5HDKA 4I01A 3FM3A 2V79A 2MA3A 3QRFF 5KK1A 2G7HA 5ILUA 2PBIA 3VODA 5DEQA 2Q8KA 1R1VA 1Z1DA 3IKVA 1LEBA 2EFQA 4ZYHA 2ELHA 2Y48A 2MH9A 1CF7A 1FP2A 5K5RA 4ZZDA 2VBYA 2IA1A 1K79A 1USTA 5L3EA 3ZMSA 3F21A 2OZUA 4WXDA 1MDMB 1ZREA 2STWA 4EVIA 3CTAA 2VE9A 1DPRA 1F5TA 3DV8A 4P9UA 4N9HA 4KN4X 4A5MA 4WF2A 4EV0A 2DQLA 1TLHB 4OIQF 1ZN2A 5HDGA 5JI6A 4U0WA 1WWXA 2WC2A 1UB9A 4H0EA 3DKWA 2YR2A 1FSHA 3LA3A 3DF8A 2KJCA 2L3DA 5H20A 4I7HA 4ESBA 3GF2A 1FPQA 3WGGA 1W4MA 1YS6A 3AAFA 4AIKA 4ZYEA 1K78B 4TV7A 5LRSA 1BIBA 5E1ZB 4MTEA 4IVNA 3LQQA 2MC3A 2VBXA 2VT3A 2V1XA 4O5VA 1FY7A 4CZZA 3LA2A 4PCQA 4B8XA 3QPTA 4KMFA 2PG4A 2ZNYA 2IA2A 1XDSA 4HW0A 2YPRA 2BV6A 3M8FA 3J80K 3QAHA 4WXCA 4RAYA 4I2OA 3J81K 2EV0A 2W57A 1V4RA 1O3SA 4LJZF 5FGMA 2EV5A 1OYIA 4UVAA 1R5HA 1OYWA 2VBWA 4A12A 5LGTA 3ABUA 2NS0A 1ZG1A 3Q5FA 4L9NA 2IPQX 3LAJA 3F22A 2HEOA 2ADUA 5IT3A 3GUDA 3TDZC 4CDGA 5LHGA 3DFGA 3PFIA 2FU4A 2OQRA 4HZFA 3RPQA 3T1BA 3LSTA 3I5UA 3MCZA 4MNUA 2BEOA 5D4SA 4LMYA 1OMIA 3HRMA 5H6RA 1JHFA 4M72A 1Z05A 2F5CA 1MGTA 2KJBA 1MJBA 2K4JA 2H6CA 2K7LA 4LFUA 2VN2A 5KVRA 3R61A 1BI2A 3J7AO 3IL2A 1P6RA 1I27A 4BNCA 2DBBA 5DD4A 3FMQA 2ZFWA 3EDPA 2CSOA 4HQMA 4WXHA 1IN4A 4G7HF 2NRAC 5E18F 3U2RA 2PFBA 2JPBA 5TRDA 1YIOA 3I53A 4UHTA 2LF7A 5E8GA 3LAPA 5AIPA 3MWMA 5BPIA 5BMZA 1OKRA 3QOPA 2XHKA 2ZXJA 1UHMA 4L9TA 1YO5C 5E8IA 2ZJ2A 3TGNA 1D8KA 2DLLA 3DXJF 3E97A 3HRUA 3CUQB 2DPDA 3CJNA 1AOYA 2QYOA 2JPCA 2V9VA 4KA4A 1RIOH 5DUIA 1FBSA 1F9NA 3V8LA 2K86A 4O3MA 3EYIA 4AIHA 3ML6A 5L3FA 4LLNA 1YG2A 4IRGA 4KICA 3C18A 5ICEA 4IHTA 2IT0A 4I98B 3PQKA 4HDUA 4L5IA 4N0BA 2GQQA 1LDKB 1SAXA 1J9IA 5HLGA 2JTVA 3FHZA 1W5TA 3IWZA 2LF8A 3I64A 2IJLA 3RKXA 3L7WA 1KU2A 1G3WA 3E6DA 3FX3A 1Z6RA 5BPDA 4ESFA 1ZARA 2D1HA 3IKTA 1S3JA 4EGZA 1O3RA 2QUFA 4YFKF 1IRGA 2VOPA 2RV8A 4BHPA 3CUQC 5ICGA 2E7XA 3K0LA 3QU3A 3F6VA 2XAJA 2QWWA 5JFRA 2VODA 5J6XA 2OA4A 4U0YA 2FMYA 4A2UA 1WI9A 3CLOA 1X3UA 2BYVE 1ZG3A 4UNOA 1R1UA 3KP7A 3T8TA 1JGSA 4KN7X 3E5QA 2P8TA 1IRFA 1U5TB 3GFJA 3JSOA 4OIRF 1KQ9A 4DQ2A 1RI7A 3VOEA 1HSJA 1V3FA 2E1NA 4A0YA 3KP2A 4G8XA 5HS8A 1SFUA 2XROA 3QP6A 4HLXA 1ZRFA 1CF7B 1ZGAA 5CVJA 1RZ4A 2Z9OA 3MAJA 1K7AA 1XD7A 2KIFA 2WWYA 2RQPA 1ON2A 1UFMA 3KLNA 3IHUA 2O6GE 2F2EA 2KIMA 1ZH5A 1HW5A 3JTGA 1RUNA 5ERIA 4PZJA 4ETSA 5ED4A 1R5GA 2A69F 2WTEA 4XLPF 2QBYA 3GZ6A 3I4PA 2DTRA 3WTZA 4FX4A 1G3YA 2CYYA 1LB2A 4EJWA 2W85A 6PAXA 4CO8A 4BYYA 1J75A 2DW4A 2LSOA 1ZLJA 2ZO4A 4GYIA 5HOOA 4BHBA 2LKPA 2ZNZA 4ON0A 4OMZA 2GIVA 2V6CA 2DU9A 4IXAA 1ULYA 3QPHA 3WGIA 3FXQA 4UV8A 1P92A 2M87A 2L4AA 3SXYA 4NQWA 2FBKA 4K2EA 2LDUA 3DPLC 3H92A 1OR7A 3NQOA 1WKMA 4MTDA 2CO5A 2UZKA 3DPTA 3SQNA 1XCVA 2OBPA 3EETA 4JBAA 1T6SA 4OINF 2QVOA 1IN5A 2FBHA 2JSCA 3C3WA 3R0JA 3V8KA 5E20A 3ZQ7A 5FLXZ 5EEHA 2ZBKA 4EMSA 4BQAA 5FB2A 4HDVA 2FA5A 2QQBA 5CVRA 3T5XA 4R79A 3WGHA 1D8JA 4R8HA 2CQKA 1S29A 2XASA 1PP8F 3ECHA 4WCGA 3QP5A 4PGHA 1G6NA 3GO5A 2FEZA 3RTRA 4L9JA 1GXPA 3F8BA 2IRFG 2KIUA 3KP6A 4IRHA 2P6SA 3C1DA 1DP7P 4EGYA 1U5TA 1R7JA 3WU0A 4LLGF 4P55A 3M7GA 4UV9A 1YW9A 1TW3A 2XUBA 3GVAA 3V7SA 2XAGA 4GO1A 4L18B 5FFZA 4LK1F 3K9TA 3GZ5A 4MHGA 1TQMA 4Q47A 2HYGD 3HYIA 3RIRA 4LD5A 1Z7UA 1XGNA 4CGZA 4JQFA 1TW2A 4G9YA 3LQRA 2RNJA 1IN7A 3RPUA 4F7ZA 4A5NA 2X4HA 5D8KB 3GYHX 1HW1A 3REOA 1GVJA 1W7PD 2NYXA 2HGCA 2TDXA 5HVQC 2K02A 1HKSA 3L2CA 3HRTA 1LJ9A 3E3VA 2EV6A 4M9ZA 4ENMA 4OIOF 4Y13A 4HF2A 1R58A 3BROA 3TOAA 5DCMB 3JAMK 3RYPA 1FSEA 5DUKA 1T2KA 1IAWA 1IF1A 2W25A 1D5VA 4RGSA 3W6JB 3GEZA 1QQIA 2XAQA 3WTVC 3L09A 2EFWA 4G94A 3F23A 4Z2YA 3U1DA 3ERED 3FZVA 4HYEA 3H3ZA 2VONA 1DPUA 4HX8A 2PEXA 5FLXK 4ENKA 3C7JA 2Z3YA 3V7RA 4XBFA 4D0PA 4N9IA 4DNCA 1HXDA 3CDHA 1XB4A 3WTWC 1EH7A 3HSEA 1A04A 5D4RA 2Q0OA 3KP5A 2G9WA 2PQ8A 1SD6A 1HKTA 1KA8A 4NB5A 2WV0A 2P5LC 4LG0A 2MBFA 4L9VA 2AS5F 3KEOA 2HKXA 3BJAA 2HWVA 2ESHA 3HTUA 2QM3A 4RGRA 3KETA 1O3QA 2QQ9A 3RKWA 3V4GA 1QPMA 4I0BA 3SZTA 4LB6B 1TNSA 3R6SA 2X0LA 2M5WA 2L54A 5D6EA 2DI3A 1YTYA 1ZLKA 4AIJA 1WRJA 2D1VA 2DAOA 5AIQA 1XSDA 1S7OA 1U2WA 3B02A 1H9TA 1O7LA 5LBQA 4XLNF 2G7UA 1WSUA 1UCRA 1YLFA 4B09A 2HZTA 4A6DA 2PLYA 3RDIA 3CO7C 4I09A 2A5YB 3ZN1A 5LHHA 1I5ZA 3GW2A 4JK1X 2FE3A 4FX0A 4KIGA 3BDDA 3R0AA 3BPVA 3K1PA 3GX4X 4AWXB 4CHUA 2AXLA 4O6JA 4IF4A 2QBYB 3GFIA 3BZ6A 1MKMA 3HHGA 4I02A 5EEGA 4LGWA 1ZYRF 2MD5A 2A61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2P E;  1FWZ A;  3EQL F;  4M74 A;  3FMR A;  1R22 A;  5HDN A;  3RI4 A;  5DCM A;  3KP3 A;  5LEJ A;  1XSV A;  4XSX F;  2D2W A;  2DQR A;  3ABT A;  4MEY F;  4KFC A;  1BM9 A;  4YG2 F;  4KMU X;  1FYM A;  2O61 A;  1R36 A;  3K1N A;  4G6D A;  3ZMZ A;  4QWQ A;  1B9N A;  3WE3 A;  1YW8 A;  1QO0 D;  4L5J A;  1S6L A;  4RB3 C;  1YFH A;  3WU1 B;  1BC7 C;  2VE8 A;  1UHW A;  3P9I A;  2UXN A;  3BY6 A;  1EV7 A;  3SZP A;  3JTH A;  3MFK A;  3WTX C;  5D5U B;  1HW2 A;  1E17 A;  3COA C;  4KNY A;  3F8F A;  3WTY C;  2BBY A;  3TO9 A;  1TQI A;  2M45 A;  4BXU A;  4U88 A;  3WG9 A;  4UUV A;  5ICF A;  3WTU C;  1IW7 F;  3MZY A;  1J5Y A;  3DP7 A;  4KIB A;  3NRV A;  1XGO A;  1XSX A;  1T38 A;  3F8C A;  3D5L A;  2W24 A;  3I58 A;  2BGC A;  1SMY F;  4M9X A;  2D45 A;  2FSW A;  5CVV A;  1IXS B;  1T98 A;  4M6Y A;  4HF0 A;  2VXZ A;  3VEP A;  4CXF A;  5L3C A;  5CYV A;  5J8C A;  4LLL A;  4KDP A;  1FT9 A;  2XAF A;  4WWC A;  4ENN A;  1G3T A;  3F6O A;  4ESJ A;  3ZMD A;  3DEU A;  2MLG A;  1U8R A;  1ZGJ A;  5DCF A;  2J5P A;  3RYR A;  4HF1 A;  4I0A A;  1XMK A;  1B1B A;  5A2Q Z;  2V1U A;  3LFK A;  1SD4 A;  2ISY A;  2J5O A;  5D8L B;  1LVA A;  1B59 A;  2CFX A;  1TBX A;  3E6M A;  1TNT A;  2XIG A;  2FQ3 A;  2P5V A;  2P6T A;  3W6K B;  3WOD F;  5HLH A;  4HA8 A;  2CG4 A;  2EK5 A;  1U5T C;  4KUM A;  4AD9 A;  2OD5 A;  2VOO A;  1KU3 A;  1NHA A;  5LRR A;  3HIF A;  2P7V B;  1Z9C A;  3P7N A;  3KLO A;  1XGS A;  2GZW A;  2HYF A;  1G4D A;  2IVM A;  3RJP A;  1W5S A;  5ICC A;  3EUH A;  3OOP A;  2RVC A;  4Y15 A;  4UVB A;  3ULQ B;  1KU9 A;  2DFI A;  2HQR A;  1XMA A;  5LLQ A;  3P9C A;  2P7C B;  3MEX A;  2DO7 A;  2DK8 A;  1LDD A;  1C0W A;  3TOB A;  1D3Y A;  1FC3 A;  3EYY A;  4FHT A;  3ZMU A;  4EJT A;  3SFZ A;  3ZPL A;  2HFH A;  2Z99 A;  1T39 A;  1FBQ A;  1FOK A;  4EM0 B;  5BS6 A;  4OU0 A;  2FML A;  2BE5 F;  2R7F A;  2M30 A;  1H9G A;  4Y17 A;  3ECO A;  3T0Y A;  1SFE A;  2B0L A;  1IN6 A;  4LG0 B;  2LNB A;  1PUE E;  4EM1 A;  1RNL A;  4HOB A;  3FXU A;  1K6O A;  4IHS A;  4FT8 A;  1BI3 A;  1P4A A;  5CLS A;  5D5W B;  2H94 A;  2E1C A;  3GLX A;  1BIA A;  3E6B A;  4EM2 A;  4QLC U;  2F5D A;  1KQ0 A;  1OYY A;  1QGP A;  3MQ0 A;  4ZYG A;  4U7D A;  2RGV A;  2ZCW A;  5E1X A;  3HSR A;  3WE2 A;  2V1D A;  2VC0 A;  1B9M A;  1KGS A;  3J81 Z;  1F1Z A;  2XKO A;  1ZRD A;  3E6C C;  3BPX A;  4RB0 A;  1LQ1 A;  2ACJ A;  3VFZ A;  2QQA A;  3IC7 A;  3KFW X;  5D6F A;  2K4B A;  2ZKZ A;  5A2Q K;  3K2Z A;  2EA2 A;  1FBU A;  1ZG5 A;  1QBJ A;  4EJO A;  2FF4 A;  5JVT A;  1HST A;  1GXQ A;  4YIF A;  2L4M A;  4KIF A;  3HHH A;  2EA4 A;  2STT A;  3M8E A;  3Q9V A;  4OOI A;  1QNT A;  2HDC A;  4E70 A;  3CUO A;  2RKH A;  5CVU A;  3R60 A;  2OZ6 A;  2YU3 A;  2MLK A;  1MD0 A;  1J7K A;  2F5E A;  2FNA A;  3BOQ A;  1XGM A;  3ZMV A;  3F3X A;  2P4W A;  4HQE A;  4HAM A;  3HOS A;  4RS8 A;  1PDN C;  1B6A A;  2ETH A;  1R1T A;  4Q4Z F;  1KU7 A;  3FM5 A;  2OQG A;  2EJR A;  3WTT C;  5CVI A;  2P5K A;  4ENJ A;  3I71 A;  2K27 A;  1YW7 A;  4P96 A;  1FX7 A;  2GAU A;  1R00 A;  3T8R A;  2Z5U A;  4MGR A;  4L0Z B;  1BI1 A;  2A68 F;  4UXN A;  5FD5 A;  4Q48 A;  3H3U A;  5AON A;  2A6E F;  5HLI A;  3P9K A;  4KYW A;  5K5Q A;  2DT5 A;  2FBI A;  1Z91 A;  2ZME A;  3FWE A;  2R3S A;  3GFM A;  5BQT A;  5FO5 A;  2KKO A;  2XV4 S;  4BH9 A;  2O0Y A;  3LWF A;  2OU2 A;  4LK0 F;  1I6X A;  1U78 A;  2NAZ A;  2RC4 A;  5H6Q A;  3RKY A;  2XRN A;  1DUX C;  4P9F A;  4AVP A;  4YFX F;  3IRR A;  4MQV A;  3FF5 A;  1R23 A;  2C6Y A;  2PJP A;  3KCC A;  3M1E A;  5E1W A;  2HQN A;  5CJ9 A;  1XCB A;  2Z33 A;  5LHI A;  3S2W A;  1S8N A;  2O03 A;  2MH2 A;  1YS7 A;  5F64 A;  1P4X A;  5DV5 A;  2EFP A;  4RAZ A;  4CYD A;  3GXO A;  2A07 F;  3N97 A;  1BBY A;  1JHH A;  1P4W A;  3R4K A;  5LEK A;  2ISZ A;  1PP7 U;  3L00 A;  3ZN0 A;  3BP8 A;  2M1B A;  3V7C A;  4M9S A;  2PI0 A;  2FXA A;  3F8M A;  5ILS A;  2IA0 A;  3DQV C;  3KE2 A;  1ZRC A;  1EH8 A;  3HSF A;  3E5U A;  1DDN A;  1IXR C;  1TTY A;  4R1H A;  1LEA A;  2O8X A;  1H0M A;  3U9G A;  3I59 B;  2IW5 A;  2NNY A;  1W7P B;  3PQJ A;  1FZP B;  2RN7 A;  3TO7 A;  4MQ9 F;  1IZ1 A;  4S04 A;  5IT9 Z;  3BWG A;  2M8E A;  1HKQ A;  2HR3 A;  4HX7 A;  5HS7 A;  2YX4 A;  1Z6T A;  4M6X A;  1F4K A;  2GXB A;  4HV5 A;  2Y0M A;  1BI0 A;  1JE8 A;  4HLY A;  2XKP A;  1P2F A;  5L3G A;  3ELK A;  1MDM A;  1GHC A;  3FXR A;  2PMH A;  1SMT A;  4EJU A;  2PN6 A;  1ZHF A;  4PDK A;  2E7W A;  4BHC A;  4RB1 A;  5FD6 A;  1U6G A;  1EH6 A;  4G7Z F;  1ODD A;  1O57 A;  2O3F A;  2XGX A;  3HTS B;  2L02 A;  4G7O F;  2HKO A;  5L3D A;  4A6E A;  5JHU A;  1IXC A;  1JXS A;  4A0X A;  5D5X B;  4CIC A;  3VB2 A;  5E17 F;  1Y0U A;  1Q1H A;  4NHJ A;  3V8J A;  2GXG A;  2EB7 A;  4Q5S F;  1SD5 A;  3O3K A;  5LGU A;  3N4M A;  5DD8 A;  1LNW A;  3WTS C;  1K78 A;  2L01 A;  3F8N A;  4GYG A;  3K69 A;  3M9A A;  4RGX A;  3NEU A;  3IWF A;  5FFX A;  4RGU A;  1HBX G;  2OAZ A;  3E5X A;  3ROU A;  3MZH A;  3ISP A;  5TJJ A;  2NNN A;  5LGN A;  1ONV A;  1YQA A;  3G73 A;  4YFN F;  1J59 A;  4PGG A;  1YYV A;  2XAH A;  3ZMT A;  1BN5 A;  2W84 A;  4S05 A;  1MJA A;  3KP4 A;  1BC8 C;  2UWM A;  3LA7 A;  3KZZ A;  4HBL A;  3GWZ A;  2HS5 A;  2PMU A;  2GWR A;  4OMY A;  2FNP A;  3K1M A;  1XN7 A;  3SHF A;  4HV6 A;  3I54 A;  3D0S A;  3CO6 C;  1O7F A;  4XRF A;  2COM A;  2YX7 A;  1O3T A;  2UXX A;  2FRH A;  5HS9 A;  2Y75 A;  2VC1 A;  1FP1 D;  5IT9 K;  1WQ2 A;  2H6B A;  5F6F A;  4YII A;  5BOX A;  1MJ9 A;  4ZH4 F;  1AWC A;  3KEQ A;  4IJA A;  2HTS A;  3HRS A;  3IRQ A;  2HOE A;  1KYW A;  3B73 A;  3GFL A;  2R7D A;  1KYZ A;  4ZZL A;  1MZB A;  4GXO A;  3I59 A;  4GGG A;  1W7P A;  3TKY A;  3O6B B;  2FOK A;  4M71 A;  3BJ6 A;  2GA1 A;  2KRF A;  4UVC A;  1QZZ A;  3TQN A;  1J2X A;  1E2X A;  2H27 A;  3F72 A;  3FMS A;  2YSR A;  3QU6 A;  1ON1 A;  2QEN A;  4M73 A;  4LB5 A;  3JSP A;  2XVC A;  4RB2 C;  4ASN A;  4L0Y B;  2EFO A;  3Q9S A;  3G3Z A;  1XDU A;  3TDU C;  1FYK A;  1OPC A;  1SD7 A;  4BAY A;  2QLZ A;  4A0Z A;  1J0R A;  2QZ8 A;  4ZYD A;  2DK5 A;  2RDP A;  2VBZ A;  2A6H F;  1REP C;  3OV8 A;  5L3B A;  1L3L A;  4IRI A;  1FNN A;  4KT5 C;  3CUQ A;  1STZ A;  4U0V A;  3JW4 A;  4MEX F;  1RUO A;  1TQP A;  1T0F A;  1USS A;  2ZME B;  2EFN A;  5DYM A;  3BJO A;  4GCV A;  1I1G A;  2VT2 A;  1BOA A;  4G6Q A;  1LDJ A;  4EJV A;  1VTN C;  2IP2 A;  5JR3 A;  3ZP5 A;  5F1R A;  3JAM Z;  4XSZ F;  2GA2 A;  1IN8 A;  2Q2E A;  5J8F A;  1HQC A;  2H09 A;  5K5O A;  5D5V B;  4IPA A;  2JZY A;  4EQQ A;  1L0O C;  4P5O A;  1SFX A;  4WK8 F;  1QZY A;  3KZY A;  2HTJ A;  1S7A A;  3HOT A;  2EWN A;  5DDG A;  2CWE A;  1CGP A;  1B4A A;  5K1Y A;  1G3S A;  2CGP A;  5ILV A;  3HUG A;  3L9F A;  1FYL A;  3J80 Z;  4OIP F;  3I0T A;  3TO6 A;  2DPU A;  1FLI A;  2F5F A;  1IUY A;  4HX4 A;  2JT1 A;  1I1S A;  1KQ8 A;  1U3E M;  1BJA A;  2ESN A;  4U7B A;  2A3S A;  1ZAO A;  4WX9 A;  2CW0 F;  2JRT A;  5HDK A;  4I01 A;  3FM3 A;  2V79 A;  2MA3 A;  3QRF F;  5KK1 A;  2G7H A;  5ILU A;  2PBI A;  3VOD A;  5DEQ A;  2Q8K A;  1R1V A;  1Z1D A;  3IKV A;  1LEB A;  2EFQ A;  4ZYH A;  2ELH A;  2Y48 A;  2MH9 A;  1CF7 A;  1FP2 A;  5K5R A;  4ZZD A;  2VBY A;  2IA1 A;  1K79 A;  1UST A;  5L3E A;  3ZMS A;  3F21 A;  2OZU A;  4WXD A;  1MDM B;  1ZRE A;  2STW A;  4EVI A;  3CTA A;  2VE9 A;  1DPR A;  1F5T A;  3DV8 A;  4P9U A;  4N9H A;  4KN4 X;  4A5M A;  4WF2 A;  4EV0 A;  2DQL A;  1TLH B;  4OIQ F;  1ZN2 A;  5HDG A;  5JI6 A;  4U0W A;  1WWX A;  2WC2 A;  1UB9 A;  4H0E A;  3DKW A;  2YR2 A;  1FSH A;  3LA3 A;  3DF8 A;  2KJC A;  2L3D A;  5H20 A;  4I7H A;  4ESB A;  3GF2 A;  1FPQ A;  3WGG A;  1W4M A;  1YS6 A;  3AAF A;  4AIK A;  4ZYE A;  1K78 B;  4TV7 A;  5LRS A;  1BIB A;  5E1Z B;  4MTE A;  4IVN A;  3LQQ A;  2MC3 A;  2VBX A;  2VT3 A;  2V1X A;  4O5V A;  1FY7 A;  4CZZ A;  3LA2 A;  4PCQ A;  4B8X A;  3QPT A;  4KMF A;  2PG4 A;  2ZNY A;  2IA2 A;  1XDS A;  4HW0 A;  2YPR A;  2BV6 A;  3M8F A;  3J80 K;  3QAH A;  4WXC A;  4RAY A;  4I2O A;  3J81 K;  2EV0 A;  2W57 A;  1V4R A;  1O3S A;  4LJZ F;  5FGM A;  2EV5 A;  1OYI A;  4UVA A;  1R5H A;  1OYW A;  2VBW A;  4A12 A;  5LGT A;  3ABU A;  2NS0 A;  1ZG1 A;  3Q5F A;  4L9N A;  2IPQ X;  3LAJ A;  3F22 A;  2HEO A;  2ADU A;  5IT3 A;  3GUD A;  3TDZ C;  4CDG A;  5LHG A;  3DFG A;  3PFI A;  2FU4 A;  2OQR A;  4HZF A;  3RPQ A;  3T1B A;  3LST A;  3I5U A;  3MCZ A;  4MNU A;  2BEO A;  5D4S A;  4LMY A;  1OMI A;  3HRM A;  5H6R A;  1JHF A;  4M72 A;  1Z05 A;  2F5C A;  1MGT A;  2KJB A;  1MJB A;  2K4J A;  2H6C A;  2K7L A;  4LFU A;  2VN2 A;  5KVR A;  3R61 A;  1BI2 A;  3J7A O;  3IL2 A;  1P6R A;  1I27 A;  4BNC A;  2DBB A;  5DD4 A;  3FMQ A;  2ZFW A;  3EDP A;  2CSO A;  4HQM A;  4WXH A;  1IN4 A;  4G7H F;  2NRA C;  5E18 F;  3U2R A;  2PFB A;  2JPB A;  5TRD A;  1YIO A;  3I53 A;  4UHT A;  2LF7 A;  5E8G A;  3LAP A;  5AIP A;  3MWM A;  5BPI A;  5BMZ A;  1OKR A;  3QOP A;  2XHK A;  2ZXJ A;  1UHM A;  4L9T A;  1YO5 C;  5E8I A;  2ZJ2 A;  3TGN A;  1D8K A;  2DLL A;  3DXJ F;  3E97 A;  3HRU A;  3CUQ B;  2DPD A;  3CJN A;  1AOY A;  2QYO A;  2JPC A;  2V9V A;  4KA4 A;  1RIO H;  5DUI A;  1FBS A;  1F9N A;  3V8L A;  2K86 A;  4O3M A;  3EYI A;  4AIH A;  3ML6 A;  5L3F A;  4LLN A;  1YG2 A;  4IRG A;  4KIC A;  3C18 A;  5ICE A;  4IHT A;  2IT0 A;  4I98 B;  3PQK A;  4HDU A;  4L5I A;  4N0B A;  2GQQ A;  1LDK B;  1SAX A;  1J9I A;  5HLG A;  2JTV A;  3FHZ A;  1W5T A;  3IWZ A;  2LF8 A;  3I64 A;  2IJL A;  3RKX A;  3L7W A;  1KU2 A;  1G3W A;  3E6D A;  3FX3 A;  1Z6R A;  5BPD A;  4ESF A;  1ZAR A;  2D1H A;  3IKT A;  1S3J A;  4EGZ A;  1O3R A;  2QUF A;  4YFK F;  1IRG A;  2VOP A;  2RV8 A;  4BHP A;  3CUQ C;  5ICG A;  2E7X A;  3K0L A;  3QU3 A;  3F6V A;  2XAJ A;  2QWW A;  5JFR A;  2VOD A;  5J6X A;  2OA4 A;  4U0Y A;  2FMY A;  4A2U A;  1WI9 A;  3CLO A;  1X3U A;  2BYV E;  1ZG3 A;  4UNO A;  1R1U A;  3KP7 A;  3T8T A;  1JGS A;  4KN7 X;  3E5Q A;  2P8T A;  1IRF A;  1U5T B;  3GFJ A;  3JSO A;  4OIR F;  1KQ9 A;  4DQ2 A;  1RI7 A;  3VOE A;  1HSJ A;  1V3F A;  2E1N A;  4A0Y A;  3KP2 A;  4G8X A;  5HS8 A;  1SFU A;  2XRO A;  3QP6 A;  4HLX A;  1ZRF A;  1CF7 B;  1ZGA A;  5CVJ A;  1RZ4 A;  2Z9O A;  3MAJ A;  1K7A A;  1XD7 A;  2KIF A;  2WWY A;  2RQP A;  1ON2 A;  1UFM A;  3KLN A;  3IHU A;  2O6G E;  2F2E A;  2KIM A;  1ZH5 A;  1HW5 A;  3JTG A;  1RUN A;  5ERI A;  4PZJ A;  4ETS A;  5ED4 A;  1R5G A;  2A69 F;  2WTE A;  4XLP F;  2QBY A;  3GZ6 A;  3I4P A;  2DTR A;  3WTZ A;  4FX4 A;  1G3Y A;  2CYY A;  1LB2 A;  4EJW A;  2W85 A;  6PAX A;  4CO8 A;  4BYY A;  1J75 A;  2DW4 A;  2LSO A;  1ZLJ A;  2ZO4 A;  4GYI A;  5HOO A;  4BHB A;  2LKP A;  2ZNZ A;  4ON0 A;  4OMZ A;  2GIV A;  2V6C A;  2DU9 A;  4IXA A;  1ULY A;  3QPH A;  3WGI A;  3FXQ A;  4UV8 A;  1P92 A;  2M87 A;  2L4A A;  3SXY A;  4NQW A;  2FBK A;  4K2E A;  2LDU A;  3DPL C;  3H92 A;  1OR7 A;  3NQO A;  1WKM A;  4MTD A;  2CO5 A;  2UZK A;  3DPT A;  3SQN A;  1XCV A;  2OBP A;  3EET A;  4JBA A;  1T6S A;  4OIN F;  2QVO A;  1IN5 A;  2FBH A;  2JSC A;  3C3W A;  3R0J A;  3V8K A;  5E20 A;  3ZQ7 A;  5FLX Z;  5EEH A;  2ZBK A;  4EMS A;  4BQA A;  5FB2 A;  4HDV A;  2FA5 A;  2QQB A;  5CVR A;  3T5X A;  4R79 A;  3WGH A;  1D8J A;  4R8H A;  2CQK A;  1S29 A;  2XAS A;  1PP8 F;  3ECH A;  4WCG A;  3QP5 A;  4PGH A;  1G6N A;  3GO5 A;  2FEZ A;  3RTR A;  4L9J A;  1GXP A;  3F8B A;  2IRF G;  2KIU A;  3KP6 A;  4IRH A;  2P6S A;  3C1D A;  1DP7 P;  4EGY A;  1U5T A;  1R7J A;  3WU0 A;  4LLG F;  4P55 A;  3M7G A;  4UV9 A;  1YW9 A;  1TW3 A;  2XUB A;  3GVA A;  3V7S A;  2XAG A;  4GO1 A;  4L18 B;  5FFZ A;  4LK1 F;  3K9T A;  3GZ5 A;  4MHG A;  1TQM A;  4Q47 A;  2HYG D;  3HYI A;  3RIR A;  4LD5 A;  1Z7U A;  1XGN A;  4CGZ A;  4JQF A;  1TW2 A;  4G9Y A;  3LQR A;  2RNJ A;  1IN7 A;  3RPU A;  4F7Z A;  4A5N A;  2X4H A;  5D8K B;  3GYH X;  1HW1 A;  3REO A;  1GVJ A;  1W7P D;  2NYX A;  2HGC A;  2TDX A;  5HVQ C;  2K02 A;  1HKS A;  3L2C A;  3HRT A;  1LJ9 A;  3E3V A;  2EV6 A;  4M9Z A;  4ENM A;  4OIO F;  4Y13 A;  4HF2 A;  1R58 A;  3BRO A;  3TOA A;  5DCM B;  3JAM K;  3RYP A;  1FSE A;  5DUK A;  1T2K A;  1IAW A;  1IF1 A;  2W25 A;  1D5V A;  4RGS A;  3W6J B;  3GEZ A;  1QQI A;  2XAQ A;  3WTV C;  3L09 A;  2EFW A;  4G94 A;  3F23 A;  4Z2Y A;  3U1D A;  3ERE D;  3FZV A;  4HYE A;  3H3Z A;  2VON A;  1DPU A;  4HX8 A;  2PEX A;  5FLX K;  4ENK A;  3C7J A;  2Z3Y A;  3V7R A;  4XBF A;  4D0P A;  4N9I A;  4DNC A;  1HXD A;  3CDH A;  1XB4 A;  3WTW C;  1EH7 A;  3HSE A;  1A04 A;  5D4R A;  2Q0O A;  3KP5 A;  2G9W A;  2PQ8 A;  1SD6 A;  1HKT A;  1KA8 A;  4NB5 A;  2WV0 A;  2P5L C;  4LG0 A;  2MBF A;  4L9V A;  2AS5 F;  3KEO A;  2HKX A;  3BJA A;  2HWV A;  2ESH A;  3HTU A;  2QM3 A;  4RGR A;  3KET A;  1O3Q A;  2QQ9 A;  3RKW A;  3V4G A;  1QPM A;  4I0B A;  3SZT A;  4LB6 B;  1TNS A;  3R6S A;  2X0L A;  2M5W A;  2L54 A;  5D6E A;  2DI3 A;  1YTY A;  1ZLK A;  4AIJ A;  1WRJ A;  2D1V A;  2DAO A;  5AIQ A;  1XSD A;  1S7O A;  1U2W A;  3B02 A;  1H9T A;  1O7L A;  5LBQ A;  4XLN F;  2G7U A;  1WSU A;  1UCR A;  1YLF A;  4B09 A;  2HZT A;  4A6D A;  2PLY A;  3RDI A;  3CO7 C;  4I09 A;  2A5Y B;  3ZN1 A;  5LHH A;  1I5Z A;  3GW2 A;  4JK1 X;  2FE3 A;  4FX0 A;  4KIG A;  3BDD A;  3R0A A;  3BPV A;  3K1P A;  3GX4 X;  4AWX B;  4CHU A;  2AXL A;  4O6J A;  4IF4 A;  2QBY B;  3GFI A;  3BZ6 A;  1MKM A;  3HHG A;  4I02 A;  5EEG A;  4LGW A;  1ZYR F;  2MD5 A;  2A61 A; 
#chains in the Genus database with same CATH topology
 1D1A A;  3O2P E;  4A3M J;  1NH3 A;  1FWZ A;  1SC7 A;  3EQL F;  4M74 A;  3FMR A;  1R22 A;  5F27 A;  4PK4 A;  1OCO H;  5HDN A;  3RI4 A;  5DCM A;  3KP3 A;  5LEJ A;  3NWT A;  1XSV A;  3RCO A;  4XSX F;  2D2W A;  4UB8 C;  4PJM A;  1GV5 A;  3BR5 A;  2KRC A;  1E3O C;  2UUZ A;  2DQR A;  3TW7 A;  2IGK A;  2VIX A;  1MIJ A;  3K4B A;  3PIO F;  3ABT A;  4MEY F;  4KFC A;  1BM9 A;  4NQW B;  4YG2 F;  2H8W A;  4KMU X;  1FYM A;  4A3L J;  2CUE A;  2O61 A;  1R36 A;  2OF7 A;  4XKB A;  3K1N A;  3W2V A;  5F0C A;  4G6D A;  5CKT A;  3ZMZ A;  2XGE A;  2W7N A;  1FIA A;  1R4N B;  2HVR A;  3U21 A;  3GTP J;  1WJC A;  4QWQ A;  1IO2 A;  3BR6 A;  1MH3 A;  3CC4 I;  1B9N A;  3IP4 B;  4P1W A;  5IP6 A;  1LFU P;  4RA2 A;  3WE3 A;  2IS6 A;  3DEE A;  1YW8 A;  1ZQ3 P;  5C4X J;  4DYQ A;  1QO0 D;  2X6W A;  1S6L A;  4L5J A;  4RB3 C;  5C4J J;  3IH3 A;  3WU1 B;  2K5C A;  1YFH A;  1BC7 C;  2QSG X;  3HOW J;  2VKV A;  3DCF A;  5HNH A;  2FUG 2;  4IKF A;  2L7Z A;  2VE8 A;  1P7I A;  1UHW A;  2UXN A;  3P9I A;  4A93 J;  2ELK A;  3BY6 A;  3OR1 C;  1EV7 A;  3K7A J;  3SZP A;  4UUS A;  5J40 A;  3JTH A;  3MFK A;  3QYF A;  3JCU C;  3WHC A;  3WTX C;  3PM1 A;  5D5U B;  4X1E A;  2LBF A;  1HW2 A;  1E17 A;  4B4C A;  3COA C;  3BTI A;  1TP4 A;  2OTL I;  4KNY A;  3F8F A;  1N75 A;  4D5C A;  3WTY C;  2BBY A;  3TO9 A;  1TQI A;  2M45 A;  3A4C A;  3CMY A;  4BXU A;  4U88 A;  3WG9 A;  3OS1 A;  4UUV A;  2ECC A;  1BOB A;  3DU6 A;  4XL9 A;  1PJR A;  5ICF A;  3WTU C;  1IW7 F;  3MZY A;  1E3P A;  2JA5 J;  1J5Y A;  3DP7 A;  2ME6 A;  3H1C A;  4BBR J;  1QZE A;  5FKL A;  2CQN A;  3FXK A;  5FKM A;  2BZT A;  2R7O A;  2VKE A;  1YJ9 I;  3LSJ A;  2CFO A;  4KIB A;  1YOV B;  1ZR2 A;  4PSW A;  4CCN A;  1LE8 A;  3IH2 A;  3NRV A;  3OIO A;  1XGO A;  3RQI A;  4ZC3 A;  1XSX A;  1OQY A;  1T38 A;  3F8C A;  1TZL A;  3H5R A;  3D5L A;  1OR7 C;  4JP0 A;  4A3C J;  2W24 A;  5FKK A;  4J19 A;  2LLK A;  2HQA A;  1PVE A;  1OCR H;  2VI6 A;  3FKJ A;  2X6Y A;  4BL0 B;  3I58 A;  2BGC A;  5CPR B;  3S14 J;  4XOP A;  1XC5 A;  2ME0 A;  1SMY F;  1UG2 A;  4M9X A;  3HJE A;  3GTL J;  2D45 A;  3OYL A;  2FSW A;  5CVV A;  4BJT A;  1IXS B;  1X3W B;  1SFK A;  1T98 A;  4M6Y A;  3KEY A;  4HF0 A;  2VXZ A;  3VEP A;  4CXF A;  1X3Z B;  5L3C A;  3KIO A;  1V55 H;  5CYV A;  4LLL A;  5J8C A;  4KDP A;  2HXO A;  2JWT A;  3M8J A;  1QA6 A;  2HOS A;  4Y3O A;  4C2T A;  4IHY A;  1GVD A;  3OYM A;  3K4J A;  5F0H A;  1FT9 A;  3L2W A;  2XAF A;  4WWC A;  4FCY A;  4ENN A;  1G3T A;  2L9N A;  4I6Z A;  3F6O A;  4ESJ A;  4RDU A;  1RC9 A;  3DEU A;  3ZMD A;  1LVK A;  2MLG A;  2WAF A;  4PJL A;  3K4C A;  1TWF J;  4C2U A;  1U8R A;  1ZGJ A;  3AG2 H;  3Q3S A;  5DCF A;  2R7X A;  2J5P A;  3RYR A;  4HF1 A;  4I0A A;  4DJA A;  1XMK A;  4B1R A;  1B1B A;  3U1K A;  5A2Q Z;  2V1U A;  1T33 A;  3LFK A;  1SD4 A;  3S1Q J;  2ISY A;  2J5O A;  5D8L B;  1LVA A;  1BR4 A;  2VPL A;  1B59 A;  2CFX A;  1TBX A;  3E6M A;  1TNT A;  2XIG A;  2LY2 A;  2FQ3 A;  3OYA A;  4E7L A;  1VF9 A;  1X1D A;  2HPM A;  3PL8 A;  4PJ0 C;  2P5V A;  2DA1 A;  2P6T A;  4E7S A;  1N78 A;  3W6K B;  3TL4 X;  3WOD F;  4CSW A;  2Z1D A;  4HA8 A;  2CG4 A;  5HLH A;  2EK5 A;  1U5T C;  1MSE C;  4KUM A;  4AD9 A;  2OD5 A;  3VYS B;  2VOO A;  1G8X A;  1KU3 A;  1NHA A;  2RQQ A;  5LRR A;  3HIF A;  1JTY A;  2CH0 A;  2LYC A;  3G71 I;  2EPF A;  2A05 A;  2P7V B;  2P0W A;  1Z9C A;  3AG1 H;  3P7N A;  3KLO A;  1D0Y A;  1XGS A;  2XF5 A;  2GZW A;  3ERM A;  2NS8 A;  3PUB A;  4XOT A;  2HYF A;  1G4D A;  2IVM A;  2BXY A;  3RJP A;  1W5S A;  4CA0 A;  5ICC A;  3EUH A;  5J47 A;  5FLV A;  3OOP A;  2RVC A;  2GOM A;  3FDY A;  4Y15 A;  2BY2 A;  4UVB A;  3ULQ B;  3CJR B;  1N25 A;  1KU9 A;  1W1W E;  2DFI A;  2HQR A;  2QF7 A;  3BG3 A;  1XMA A;  1I39 A;  5LLQ A;  1IRX A;  3P9C A;  2P7C B;  4QPO A;  3MEX A;  1B72 B;  2DO7 A;  2DK8 A;  3HOU J;  1LDD A;  1A6I A;  2GOX B;  5M5W J;  2DXI A;  1C0W A;  2ZSI B;  3TOB A;  1A31 A;  1D3Y A;  1FC3 A;  3EYY A;  3LL7 A;  4FHT A;  3L2V A;  5B5E C;  3ZMU A;  4EJT A;  5J4Y A;  3SFZ A;  1A36 A;  3ZPL A;  2HFH A;  1AKH B;  2R7S A;  2Z99 A;  1T39 A;  4HST A;  3HDD A;  1FBQ A;  4DGW B;  1FOK A;  2VJI A;  4EM0 B;  5BS6 A;  4OU0 A;  2FML A;  4F3Q A;  2BE5 F;  2R7F A;  5IYB J;  2M30 A;  2ZFU A;  1H9G A;  1TC3 C;  4Y17 A;  5B3S H;  1EF4 A;  4CUG A;  3ECO A;  1LKX A;  3T0Y A;  2ZXI A;  1SFE A;  1QRY A;  2B0L A;  4BS9 A;  3OS2 A;  2XC7 A;  1IN6 A;  4BXX J;  4LG0 B;  2LNB A;  1PUE E;  2E1M B;  1RES A;  4AID A;  4EM1 A;  1RNL A;  4HOB A;  3FXU A;  4FE4 A;  3BG6 A;  4M3B A;  5E3M A;  1K6O A;  3CCV I;  2BY0 A;  4IHS A;  4FT8 A;  2L9R A;  1Z77 A;  1BI3 A;  1P4A A;  1W5C C;  5CLS A;  5D5W B;  1M1E B;  1QU3 A;  1R71 A;  5EGO B;  2H94 A;  2E1C A;  3GLX A;  1BIA A;  2BY3 A;  1XMX A;  3E6B A;  4EM2 A;  4QLC U;  3BTL A;  2QEX I;  2F5D A;  1KQ0 A;  3CP8 A;  1OYY A;  5IPA A;  1QGP A;  1KON A;  3MQ0 A;  4ZYG A;  4U7D A;  2RGV A;  2ZCW A;  2HDW A;  2FX0 A;  5E1X A;  3L2U A;  5TIS C;  3HSR A;  3CLQ A;  4ZJZ A;  5EZG A;  4UUT A;  3BG7 A;  3WE2 A;  2V1D A;  2BVL A;  2VC0 A;  1PYV A;  1B9M A;  1RRJ A;  5BNG A;  1QVU A;  1KGS A;  4BJ6 C;  4DZJ A;  3PFY A;  3J81 Z;  4B43 A;  1F1Z A;  2XKO A;  3OS0 A;  3PIP F;  3H9G A;  3S2D J;  3P5J A;  1ZRD A;  3E6C C;  3BPX A;  4CCM A;  4RB0 A;  5M3F J;  1R6R A;  2K9L A;  1YI2 I;  1LQ1 A;  2ACJ A;  1QVT A;  3CMM A;  1WFX A;  2DOE A;  2EIL H;  2QQA A;  3IC7 A;  3KFW X;  5D6F A;  3VFZ A;  2LY9 A;  1SVM A;  1QPI A;  2K4B A;  2ZKZ A;  2KFD A;  2HDD A;  5A2Q K;  3K2Z A;  1W36 D;  2JK3 A;  3MKY B;  4E7H A;  2EA2 A;  1JT0 A;  4B48 A;  1UHS A;  2DFE A;  1FBU A;  1ZG5 A;  2EQR A;  1QBJ A;  2LP0 A;  4EJO A;  2FF4 A;  5JVT A;  3Q0W A;  3ZQQ A;  2CJJ A;  1HST A;  1GXQ A;  4YIF A;  2L4M A;  4KIF A;  2KQR A;  1I3A A;  3HHH A;  2EA4 A;  4I99 C;  5KHD A;  2STT A;  3I4M J;  3M8E A;  3Q9V A;  1VQP I;  1G59 A;  4OOI A;  1QNT A;  4KIT B;  2HDC A;  4JX6 A;  4E70 A;  3CUO A;  2DYS H;  2LTP A;  2RKH A;  3K4M A;  5CVU A;  1GDT A;  3FXO A;  3R60 A;  4N4O B;  4J00 A;  2OZ6 A;  2YU3 A;  2MLK A;  2LKS A;  4I76 A;  1S72 I;  1UEL B;  5B66 C;  1MD0 A;  2MFZ A;  1J7K A;  1JKQ C;  2HZD A;  3J7A Y;  2F5E A;  2FNA A;  4DBQ A;  3BOQ A;  1XGM A;  4LG3 A;  3ZMV A;  3F3X A;  2P4W A;  4HQE A;  4HAM A;  2EIM H;  3G1O A;  3HOS A;  3CZ6 A;  4RS8 A;  1PDN C;  1B6A A;  2ETH A;  1Z7L A;  2M4K A;  4A3E J;  1R1T A;  4IOA F;  4Q4Z F;  2Y30 A;  4PJN A;  4QIW N;  4MIM A;  2IGO A;  4XLH A;  3LFU A;  1X4P A;  1KU7 A;  3FM5 A;  2OQG A;  2EJR A;  3WTT C;  5CVI A;  2P5K A;  4ENJ A;  2WBM A;  5E3N A;  4ZDO A;  1U9O A;  3I71 A;  2K27 A;  1A35 A;  1YW7 A;  4P96 A;  1FX7 A;  2GAU A;  1R00 A;  2LH9 A;  3T8R A;  2Z5U A;  4MGR A;  4L0Z B;  1BI1 A;  2A68 F;  3CJQ B;  4UXN A;  5FD5 A;  1NG6 A;  1NG7 A;  3BQZ A;  3H3U A;  4Q48 A;  3ZQG A;  5AON A;  2A6E F;  4C2M J;  2JVG A;  3P9K A;  5HLI A;  1EJ9 A;  4NC7 A;  4KYW A;  5K5Q A;  3SEQ A;  2DT5 A;  3BR3 A;  2FBI A;  1Z91 A;  2ZME A;  3FWE A;  2R3S A;  1JJ6 C;  1B72 A;  3GFM A;  3OL3 A;  2EZI A;  4DZP A;  3CC7 I;  2Y0S N;  2E19 A;  1MBG A;  5BQT A;  1Z3X A;  1V5G A;  5FO5 A;  2DA3 A;  4AC0 A;  4BJ5 C;  3OYI A;  5KAI C;  4ZDP A;  1JT6 A;  2XAU A;  2KKO A;  2XV4 S;  3OYK A;  4A3F J;  4BH9 A;  1JKR C;  2O0Y A;  1MBK A;  3LWF A;  1AA7 A;  2VPR A;  2OU2 A;  4LK0 F;  1I6X A;  1DGR M;  1U78 A;  2NAZ A;  2RC4 A;  1HLV A;  3BC8 A;  4XLC A;  5H6Q A;  3RKY A;  4GDF A;  2LBF B;  4RBO A;  2XRN A;  1DUX C;  2RAE A;  3O8H A;  4P9F A;  4AVP A;  4YFX F;  2K3P A;  3IRR A;  4MQV A;  2M34 A;  1R23 A;  3FF5 A;  2FJ1 A;  2L9S A;  1QHH D;  3BCA A;  2C6Y A;  2PJP A;  4AYB N;  3KCC A;  3M1E A;  2JSP A;  4QPQ A;  5E1W A;  2F4M B;  2HQN A;  5CJ9 A;  3JRD A;  1XCB A;  1AHD P;  4BY1 J;  2Z33 A;  2WAD A;  1GV2 A;  1TWA J;  5LHI A;  1MMN A;  3FXM A;  3S2W A;  1S8N A;  2O03 A;  2MH2 A;  1EA3 A;  2QKM B;  1NTC A;  1YS7 A;  5F64 A;  2ID6 A;  1P4X A;  5DV5 A;  3SJM A;  4JYK A;  2EFP A;  4RAZ A;  4CYD A;  2KL4 A;  3GXO A;  3OR2 C;  2CW7 A;  3N97 A;  2A07 F;  1GLN A;  2O9L A;  4XM3 A;  4JOM A;  2DA5 A;  2R5Y A;  2WA0 A;  1BBY A;  1JHH A;  5K7Z A;  1P4W A;  3R4K A;  5LEK A;  5KNL A;  2ISZ A;  1PP7 U;  3L00 A;  3ZN0 A;  1I3Q J;  3BP8 A;  2A5W A;  1ETW A;  2M1B A;  3V7C A;  4M9S A;  2PI0 A;  3S15 J;  3S1N J;  1WH5 A;  2FXA A;  1JKO C;  3F8M A;  4BDY A;  5ILS A;  5FRN A;  3RQ4 A;  4BQO A;  2Y69 H;  3CP2 A;  4L5E A;  3TBI A;  3MN2 A;  3ZR8 X;  2IA0 A;  3H3V K;  1K83 J;  3DQV C;  2PX9 A;  3KE2 A;  1ZRC A;  1EH8 A;  1YJN I;  1F43 A;  4RAG A;  3KZI C;  3RSN A;  3HSF A;  3E5U A;  4XMY A;  1DDN A;  5J1Y A;  1IXR C;  3EUK L;  1TTY A;  2HPI A;  4R1H A;  1LEA A;  4ANJ A;  2O8X A;  1H0M A;  1OLT A;  1LFP A;  3U9G A;  3I59 B;  2IW5 A;  3DBR B;  1RKT A;  2NNY A;  1W7P B;  3PQJ A;  2EZH A;  1FZP B;  2RN7 A;  3TO7 A;  1T95 A;  4MQ9 F;  2JJ7 A;  5IYD J;  1IZ1 A;  2W48 A;  2AHQ A;  2E2H J;  4C3J J;  2HVQ A;  4S04 A;  3GME A;  5IT9 Z;  3BWG A;  2M8E A;  1Y0N A;  1HKQ A;  2HR3 A;  4HX7 A;  2DA2 A;  3OYG A;  1ETK A;  2HQ5 A;  4GRI A;  2ICW G;  5HS7 A;  3SYT A;  2YX4 A;  1Z6T A;  2VJJ A;  3GLL A;  4M6X A;  1F4K A;  1ETQ A;  2GXB A;  4HV5 A;  3KYD B;  1BR2 A;  2Y0M A;  1BI0 A;  1JE8 A;  3ASO H;  3HM5 A;  4HLY A;  1V5F A;  1VQ4 I;  2XKP A;  1P2F A;  2F4I A;  2IS1 A;  1DQU A;  5L3G A;  3ELK A;  1MDM A;  1GHC A;  2VLA A;  3FXR A;  2PMH A;  1SMT A;  4EJU A;  2XSD C;  2PN6 A;  1ZHF A;  3HB9 A;  4ZTJ A;  1RET A;  3GTJ J;  3RPU D;  4PDK A;  5M3M J;  2E7W A;  4ZTF A;  2VQG A;  3HC7 A;  4BHC A;  3LSP A;  3AL0 B;  4RB1 A;  1Z67 A;  3HBL A;  2M8G X;  5FD6 A;  1U6G A;  1EH6 A;  4Y33 A;  4G7Z F;  2DFH A;  1ODD A;  1O57 A;  2O8K A;  1SAN A;  2O3F A;  2XB5 A;  4CCK A;  2XGX A;  3HOX J;  2L02 A;  2E34 A;  3HTS B;  4G7O F;  2ZSH B;  2HKO A;  5L3D A;  2OC6 A;  3PSI A;  4A6E A;  5JHU A;  1IXC A;  1JXS A;  4A0X A;  1BR1 A;  5CQG A;  5D5X B;  4CIC A;  2UV1 A;  5TGT A;  3VB2 A;  3RZO J;  3DLA A;  5E3L A;  5E17 F;  3ASN H;  1Y0U A;  2GXA A;  2VL8 A;  1Q1H A;  4NHJ A;  3V8J A;  2GXG A;  2EB7 A;  4Q5S F;  1SD5 A;  1TWC J;  2W00 A;  3O3K A;  5LGU A;  3M1C A;  4Y7N J;  3JRC A;  5DD8 A;  3N4M A;  1VZ0 A;  3K6G A;  1LNW A;  3WTS C;  4NBQ A;  1K78 A;  2OCC H;  1POG A;  2DCE A;  2DT7 B;  1VND A;  2L01 A;  3F8N A;  5FLM J;  4GYG A;  3K69 A;  3M9A A;  4RGX A;  3NEU A;  3IWF A;  5FFX A;  4RGU A;  3A03 A;  1HBX G;  4DYC A;  3ZRG A;  3HGY A;  2OAZ A;  2YS9 A;  3E5X A;  2LKX A;  3ROU A;  3MZH A;  3ISP A;  5TJJ A;  2VQC A;  1OJL A;  2NNN A;  3DBL B;  2JN6 A;  5LGN A;  1ONV A;  1YQA A;  3G73 A;  4XNF A;  1X58 A;  4YFN F;  2DOD A;  2COB A;  1J59 A;  4PFO A;  4PGG A;  2HVS A;  1G2H A;  4BEH B;  1FMW A;  1YYV A;  3EUH C;  2XAH A;  3ZMT A;  1BN5 A;  2W84 A;  4S05 A;  1MJA A;  3KP4 A;  1BC8 C;  2UWM A;  2LG4 A;  5KAF C;  3LA7 A;  3I55 I;  2EIN H;  3KZZ A;  4B3X A;  1ETY A;  4HBL A;  1VQN I;  5J3L A;  2EBI A;  3HUG B;  3JR9 A;  3GWZ A;  2HS5 A;  2PMU A;  2DJN A;  1RR8 C;  2I5U A;  3LOC A;  2GWR A;  2D5V A;  3KX2 A;  4OMY A;  2DMQ A;  2FNP A;  1K6Y A;  1R4M B;  1XN7 A;  3K1M A;  4U87 A;  3SHF A;  2MD0 A;  3PSF A;  3MMY B;  4HV6 A;  1DU6 A;  3I54 A;  1X1A A;  3D0S A;  3CO6 C;  1WI3 A;  2B63 J;  1WJ5 A;  1O7F A;  2XGC A;  4RAF A;  4XRF A;  2COM A;  2DMP A;  2YX7 A;  1O3T A;  2UXX A;  2FRH A;  5HS9 A;  4V2G A;  3PJR A;  2Y75 A;  2VC1 A;  1FP1 D;  5IT9 K;  1WQ2 A;  2H6B A;  2PMZ A;  3LSH A;  1Q1V A;  5F6F A;  1T8I A;  4YII A;  5BOX A;  2QA4 I;  1IG7 A;  3ZQF A;  3DKX A;  1MJ9 A;  4ZH4 F;  1AWC A;  1YJW I;  1Y6I A;  3KEQ A;  4YEJ A;  4IJA A;  2HTS A;  3HRS A;  4XLF A;  3IRQ A;  2R7R A;  1ENH A;  1Z0X A;  5K7F A;  2HOE A;  1VQO I;  3BZK A;  1ZEL A;  2JUG A;  1UZC A;  4IOC F;  1KYW A;  2XF7 A;  3B73 A;  3GFL A;  2R7D A;  5B1A H;  1KYZ A;  4ZZL A;  3CCE I;  2WY7 Q;  1MZB A;  4GXO A;  3I59 A;  2O7O A;  4GGG A;  1W7P A;  3L2R A;  1VI0 A;  4LIU A;  2E2J J;  2FOW A;  5EJC A;  3TKY A;  3O6B B;  2FOK A;  3UR3 C;  4M71 A;  2Q1Z B;  2BHY A;  5K7H A;  1BW6 A;  1Y39 A;  3BJ6 A;  2GA1 A;  2KRF A;  3SEZ A;  4UVC A;  1QZZ A;  5FJ8 J;  1WJB A;  4G12 A;  3TQN A;  2E1O A;  3GTQ J;  1J2X A;  3G6E I;  5JLW A;  1E2X A;  2H27 A;  2X9D A;  2M7B A;  4ABZ A;  2W1O A;  3H0D A;  3F72 A;  5IY5 H;  3FMS A;  1O4X A;  1AU7 A;  2LC2 A;  2YSR A;  3QU6 A;  2PMZ N;  1ON1 A;  2QEN A;  1T56 A;  1IRZ A;  4M73 A;  4LB5 A;  2AQF A;  3JSP A;  2XVC A;  4RB2 C;  4ASN A;  4BU2 A;  4L0Y B;  1YIT I;  2EFO A;  3CCM I;  2M0C A;  3Q9S A;  3G3Z A;  1XDU A;  4BAC A;  2JMW A;  1BW5 A;  3S93 A;  3TDU C;  2LOO A;  1FYK A;  1OPC A;  3G2B A;  1SD7 A;  3QYB A;  4BAY A;  2QLZ A;  4A0Z A;  3PNT A;  1J0R A;  2QZ8 A;  4F92 B;  1JUM A;  3G1L A;  4ZYD A;  2EZL A;  2DK5 A;  2RDP A;  2VBZ A;  2CV2 A;  3F0C A;  4D7M A;  1RPW A;  2A6H F;  1REP C;  5JVG F;  3OV8 A;  5L3B A;  1L3L A;  2NVY J;  2AO9 A;  4E7Z A;  4X0G A;  1FNN A;  4IRI A;  3K4L A;  4KT5 C;  3KYC B;  1LFB A;  3CUQ A;  3JRH A;  4EEF G;  1STZ A;  3TW6 A;  3WG7 H;  2JQ7 A;  4U0V A;  2Y9Y A;  5IOY A;  3JW4 A;  4MEX F;  1YRN A;  1RUO A;  1TQP A;  1T0F A;  1USS A;  2QSH X;  4F52 A;  2ZME B;  2JA7 J;  2O5R A;  3A1Y A;  2EFN A;  2X6X A;  2R5Z A;  3MVP A;  5DYM A;  3BJO A;  4GCV A;  1I1G A;  2CQQ A;  2VT2 A;  3O8G A;  1BOA A;  3RZD J;  1HA8 A;  3BLY A;  1LDJ A;  4G6Q A;  4EJV A;  1IDY A;  4XLE A;  1VTN C;  4NUB A;  2IP2 A;  1SVL A;  2KDZ A;  4BBS J;  3CQZ J;  3HGG A;  1IUF A;  4D1Q A;  3I3L A;  5JR3 A;  3ZP5 A;  1OCP A;  1XS9 A;  5F1R A;  2LRD A;  4XSZ F;  2HYJ A;  2GA2 A;  3JAM Z;  1IN8 A;  1WH7 A;  3HOV J;  2Q2E A;  1FOX A;  2X48 A;  1ZK8 A;  3BZC A;  5J8F A;  5EEA A;  1HQC A;  1Y1W J;  2H09 A;  1W0U A;  5K5O A;  2DYR H;  5GTI C;  3BG5 A;  1F36 A;  2VXD A;  4XOR A;  5D5V B;  1MW7 A;  3PNV A;  2ELJ A;  2YU9 J;  4IPA A;  5IOZ A;  2KIQ A;  2JZY A;  4EQQ A;  1L0O C;  2QSF X;  4P5O A;  3DKY A;  1FEX A;  1SFX A;  1JTX A;  1TWH J;  4C9Y A;  2F48 A;  1PUF A;  4WK8 F;  1QZY A;  3B6C A;  3KZY A;  4BEH A;  2ECB A;  4LOC A;  2HTJ A;  1WGX A;  3SDB A;  1S7A A;  3HOT A;  2R5Y B;  1HDP A;  3F9K A;  2EWN A;  3G1M A;  5DDG A;  2DN0 A;  2CWE A;  1CGP A;  3H35 A;  5J1U A;  1B4A A;  5K1Y A;  1G3S A;  1X2M A;  2TCT A;  2CGP A;  5IYC J;  2M7A A;  3S1M J;  4IQ4 A;  2OPT A;  2R7Q A;  5ILV A;  2HOA A;  4HG2 A;  2ZME C;  3HUG A;  3L9F A;  4DOZ A;  3D1N I;  1H8A C;  1FYL A;  4FTH A;  3VDX A;  3JRG A;  3J80 Z;  2R93 J;  4OIP F;  3I0T A;  3TO6 A;  3OYC A;  2DPU A;  1FLI A;  1DU0 A;  2F5F A;  1IUY A;  4HX4 A;  3W2W A;  2BVM A;  2JT1 A;  2LMD A;  1I1S A;  2AXT C;  1KQ8 A;  1U3E M;  2WAE A;  2ZB9 A;  3H0G J;  2VB6 A;  1BJA A;  1WCM J;  2ESN A;  3HKZ N;  3H9J A;  4U7B A;  2A3S A;  1ZAO A;  4A3K J;  4WX9 A;  3ABL H;  2CW0 F;  2JRT A;  2W82 A;  5HDK A;  4I01 A;  4ZYA A;  1E3H A;  3FM3 A;  2V79 A;  2MA3 A;  3QRF F;  1IV6 A;  5KK1 A;  2B7E A;  2Y2Z A;  1ETX A;  2G7H A;  4IHV A;  4UB6 C;  1WJA A;  5ILU A;  4E4H A;  2E1M C;  4J01 A;  2PBI A;  3VOD A;  5DEQ A;  4C3H J;  2Q8K A;  2ZXH A;  1R1V A;  1MBH A;  1Z1D A;  3IKV A;  4BDZ A;  1SEU A;  1N77 A;  1LEB A;  4M3E A;  2EFQ A;  4ZYH A;  1LPQ A;  2ELH A;  2K9N A;  3RKQ A;  3BQY A;  1H89 C;  2Y48 A;  5B1B H;  4QTR A;  2MH9 A;  1CF7 A;  4DBR A;  1FP2 A;  2R7T A;  5K5R A;  2V4J C;  2V26 A;  1NK3 P;  4ZZD A;  2V9P A;  1XG1 A;  2VBY A;  2IA1 A;  1K79 A;  1UST A;  4BGD A;  5L3E A;  4A3D J;  3OYJ A;  2E60 A;  3ABK H;  3ZMS A;  1FTZ A;  3F21 A;  3PUF A;  2OZU A;  4WXD A;  1MDM B;  3OYB A;  1ZRE A;  3BR2 A;  4EVI A;  2STW A;  3CTA A;  2VE9 A;  2Y9Z A;  1DPR A;  2IBD A;  1F5T A;  3DV8 A;  4P9U A;  2BHZ A;  2Y0S A;  4N9H A;  3OMY A;  1WJD A;  4KN4 X;  4A5M A;  4WF2 A;  4EV0 A;  1R9T J;  2PJR B;  2DQL A;  1TLH B;  4M3F A;  4OIQ F;  1ZN2 A;  1Z3Y A;  5HDG A;  4KT6 A;  2G0E A;  5JI6 A;  1VQ7 I;  4U0W A;  1WWX A;  2DT6 A;  1YX5 A;  2WC2 A;  4OAY A;  1UB9 A;  1X4O A;  3HZJ A;  2I10 A;  2MGQ A;  2DMT A;  4H0E A;  2NOJ B;  3S16 J;  1WJE A;  2CU7 A;  3DKW A;  3FIS A;  1FIP A;  2KT0 A;  1YE9 A;  2K9Q A;  3DBH B;  2YR2 A;  1FSH A;  3LA3 A;  2LFB A;  3DF8 A;  2KJC A;  4DW6 A;  2L3D A;  2DMN A;  5H20 A;  3TP0 A;  4AYB A;  4I7H A;  4ESB A;  4A3G J;  3GF2 A;  1FPQ A;  3FIW A;  3I9V 2;  1E0E A;  1HOM A;  5F04 A;  2X6O A;  3WGG A;  1W4M A;  3BTJ A;  1YS6 A;  3AAF A;  4QSH A;  4AIK A;  4ZYE A;  2GLO A;  4Y4R A;  1K78 B;  4TV7 A;  2MYS A;  5LRS A;  1BIB A;  3EUA A;  3HG9 A;  4FET A;  3CCQ I;  3BCB A;  5E1Z B;  1LUJ B;  2OCE A;  4MTE A;  3E1S A;  4IVN A;  3ESW B;  3LQQ A;  1R5I D;  2MC3 A;  4A3I J;  2VBX A;  2OUM A;  2WAQ N;  2VT3 A;  2V1X A;  4O5V A;  1FY7 A;  4CZZ A;  3LA2 A;  4PCQ A;  4E7K A;  1ZKG A;  3H9Q A;  3ABM H;  4B8X A;  1Y1V J;  3QPT A;  1X1P A;  2V1N A;  1K4S A;  3CCR I;  2XPU A;  4KMF A;  3BT9 A;  2N8G A;  3AKZ A;  2F4O B;  5JHF A;  2WY8 Q;  2PG4 A;  4HPQ A;  1V5E A;  3HOY J;  2ZNY A;  2RNG A;  2IA2 A;  2ZXW H;  2R0Q C;  1XDS A;  4HW0 A;  2YPR A;  2BV6 A;  4RM2 A;  1OCC H;  3ZCO A;  4FIS A;  3M8F A;  4CCJ A;  5GTH C;  3J80 K;  3QAH A;  4WXC A;  3DTK A;  4NNJ A;  4RAY A;  4I2O A;  1MBF A;  4XKC A;  4JX5 A;  3J81 K;  2EV0 A;  2W57 A;  3D5R C;  5GAD J;  4BQN A;  1J09 A;  2V7F A;  1V4R A;  4DYR A;  1O3S A;  1U0J A;  4LJZ F;  5FGM A;  2EV5 A;  2EH3 A;  1OYI A;  4UVA A;  1R5H A;  1OYW A;  2VBW A;  3K70 C;  4A12 A;  5EDN A;  3OSF A;  5LGT A;  3ABU A;  2NS0 A;  1OCZ H;  4ZDL A;  1ZG1 A;  1YIJ I;  3Q5F A;  4L9N A;  2IPQ X;  3LAJ A;  2CV1 A;  3VYU B;  3GTM J;  3F22 A;  2HEO A;  1VQK I;  2HU9 A;  2ADU A;  5IT3 A;  3FK6 A;  3GUD A;  3TDZ C;  4CDG A;  4XKW A;  5FKN A;  2DA7 A;  3OIP A;  1MND A;  4B47 A;  5LHG A;  3DFG A;  3PFI A;  4F93 B;  2FU4 A;  2OQR A;  4HZF A;  2R7V A;  3CMA I;  1FTT A;  2XPV A;  3MD2 A;  3RPQ A;  3S3N A;  3T1B A;  1D0X A;  3LST A;  3I5U A;  5GPA A;  3MCZ A;  2R7Z J;  1MNM C;  3KPH A;  3ZXS A;  4MNU A;  1KZH A;  3FBN B;  5KCM A;  2BEO A;  4PFP A;  5D4S A;  1D5Y A;  4W97 A;  4LMY A;  3FBI B;  1OMI A;  2KLO A;  3LSG A;  3HRM A;  3GTK J;  5H6R A;  1JHF A;  2KMU A;  4IQJ A;  3BR0 A;  4A69 C;  4M72 A;  1Z05 A;  2F5C A;  2IXS A;  1MGT A;  1VQM I;  2KJB A;  1MJB A;  2K4J A;  2H6C A;  2K7L A;  3QQA A;  2KIS A;  4LFU A;  2VN2 A;  5FKO A;  5KVR A;  3R61 A;  2VUM J;  5M5X J;  1BI2 A;  3J7A O;  3OYH A;  3IL2 A;  4CH7 A;  1P6R A;  1I27 A;  2X1D A;  4XLA A;  4A3B J;  4BNC A;  5J1R A;  2DBB A;  3HEF A;  3FMQ A;  5DD4 A;  2ZFW A;  3EDP A;  2CSO A;  4HQM A;  4WXH A;  1IN4 A;  4G7H F;  2NRA C;  3DPU A;  3CDI A;  1TT0 A;  5E18 F;  3U2R A;  2A6T A;  2PFB A;  2JPB A;  5M5Y J;  2MAB A;  5TRD A;  3J7Y J;  3GZN B;  4N4N B;  1YIO A;  3I53 A;  4UHT A;  3QPS A;  2LF7 A;  1WPK A;  5E8G A;  4E7J A;  3LAP A;  3WHB A;  4PSX A;  5AIP A;  5CQE A;  3HOZ J;  3MWM A;  2ZJR F;  4E7I A;  5BPI A;  2JRM A;  5BMZ A;  3DEW A;  1OKR A;  3OYD A;  3QOP A;  2XHK A;  2PJR A;  3LSR A;  2VKH A;  1ETO A;  4RMN A;  1UJ8 A;  2ZXJ A;  2CS3 A;  3ZQC A;  2XF6 A;  1UHM A;  3MKL A;  5GP9 A;  4IL6 C;  4L9T A;  3TED A;  1YO5 C;  5E8I A;  2ZJ2 A;  2F6C A;  1D8K A;  3TGN A;  1I6H J;  2DLL A;  1JUP A;  2WB1 N;  3DWL E;  1MMD A;  3DXJ F;  3E97 A;  3HRU A;  3OIQ A;  3CUQ B;  2DPD A;  4KIS A;  3CJN A;  1AOY A;  2QYO A;  2JPC A;  2V9V A;  2GIZ A;  4KA4 A;  1YRN B;  1RIO H;  2IGM A;  1FBS A;  5DUI A;  4IEJ A;  3VYR B;  1F9N A;  3V8L A;  2K86 A;  2OV7 A;  3MZ8 A;  4O3M A;  2R5Z B;  3EYI A;  1MNE A;  3ONQ A;  4AIH A;  5IP9 J;  2CQX A;  3ML6 A;  4IO9 F;  2R92 J;  5L3F A;  2X1C A;  2KRH A;  4LLN A;  1BL0 A;  4GFB A;  4II3 A;  5H2F C;  2BY1 A;  1YG2 A;  2LK2 A;  4IRG A;  2BOL A;  4KIC A;  2ZJQ F;  3C18 A;  2X85 A;  5ICE A;  4IHT A;  2LVS A;  1U9N A;  2IT0 A;  3L1P A;  4I98 B;  2JA6 J;  3PQK A;  2CQ7 A;  4HDU A;  3QYE A;  4L5I A;  4N0B A;  2NXN B;  2GQQ A;  1LDK B;  2Q2E B;  3IAM 2;  2FD5 A;  1SAX A;  2QQ8 A;  1J9I A;  2OTJ I;  4FQG A;  5HLG A;  2JTV A;  3FHZ A;  1JUS A;  2GBY A;  2K85 A;  1W5T A;  2K9M A;  3IWZ A;  5LFA A;  2LF8 A;  3I64 A;  3CCS I;  2LRE A;  2IJL A;  3RKX A;  3L7W A;  1KU2 A;  3L2Q A;  1FMV A;  3AL0 C;  1G3W A;  3E6D A;  2B9S A;  1PUF B;  1ERD A;  1V54 H;  3OYE A;  3FX3 A;  1Z6R A;  5BPD A;  4ESF A;  1ZAR A;  2R4G A;  2D1H A;  4HSR A;  3IKT A;  1S3J A;  4NC8 A;  2QKL B;  3CF5 F;  4EGZ A;  1O3R A;  2QUF A;  4YFK F;  1IRG A;  3CD6 I;  2VOP A;  1CQT A;  2RV8 A;  3CDL A;  4PJJ A;  4BHP A;  3CUQ C;  2VAS A;  5ICG A;  2E7X A;  3K0L A;  3QU3 A;  3S2H J;  2ZJP F;  2X51 A;  1K61 A;  1T0F C;  2L9V A;  3F6V A;  2JVH A;  2XAJ A;  3QOD A;  3K2A A;  2QWW A;  5JFR A;  5GAH J;  3X2Q H;  5GAE J;  2VOD A;  3SDG A;  5J6X A;  2QCO A;  2OA4 A;  5DS9 A;  3QWL A;  2M2E A;  4U0Y A;  2FMY A;  4A2U A;  3W2A A;  1YHQ I;  1HDD C;  1WI9 A;  3CLO A;  3BR1 A;  1X3U A;  1MMA A;  1A6Q A;  2BYV E;  1ZG3 A;  4UNO A;  1R1U A;  3DTI A;  3KP7 A;  1XPX A;  3GTG J;  1JGS A;  3T8T A;  3C2H A;  4KN7 X;  3E5Q A;  2P8T A;  4BQQ A;  1IRF A;  1HCR A;  1U5T B;  4XQF A;  1GUU A;  1ITY A;  3GFJ A;  3JSO A;  4F55 A;  4OIR F;  5FRO A;  1KQ9 A;  1RI7 A;  3VOE A;  4DQ2 A;  1HSJ A;  1P7J A;  1V3F A;  1DP3 A;  1VFC A;  3ZQL A;  1IDZ A;  2E1N A;  2IAI A;  4A0Y A;  3AG4 H;  3GCM A;  3BG9 A;  4UY8 I;  3C2G A;  3NWS A;  3KP2 A;  4G8X A;  5HS8 A;  1Z21 A;  3JRE A;  4AM3 A;  1SFU A;  1ACI A;  2QGU A;  4V19 K;  2XRO A;  3QP6 A;  1R49 A;  3QOE A;  2EIK H;  4MFD A;  4AUX A;  4XN3 A;  3JRB A;  4HLX A;  3DU5 A;  2MW8 A;  3FHN A;  3LSM A;  3HL2 A;  3AG3 H;  3LNQ A;  1HC8 A;  5E3O A;  1ZRF A;  4MLO A;  1ZGA A;  1CF7 B;  3LSK A;  5CVJ A;  1RZ4 A;  2Z9O A;  3MAJ A;  3I56 I;  1K7A A;  1BJZ A;  1XD7 A;  2KIF A;  2WWY A;  2AQE A;  1ON2 A;  2RQP A;  1UFM A;  3IH4 A;  3KLN A;  4D7N A;  3A01 B;  3IHU A;  1JJ8 C;  2O6G E;  1DGW Y;  3M07 A;  2F2E A;  1ZTR A;  2KIM A;  2H1K A;  2VQH A;  3TMO A;  1ZH5 A;  4NDL A;  3Q0U A;  4OAZ A;  3C2B A;  1HW5 A;  3OL4 A;  5C44 J;  1RR7 A;  3JTG A;  1RUN A;  5ERI A;  4PZJ A;  4ETS A;  2JUC A;  2E2I J;  3K10 A;  2K3F A;  5ED4 A;  4Y52 J;  4XRM A;  1R5G A;  2A69 F;  2WTE A;  2DA4 A;  4A3J J;  4XLP F;  2QBY A;  1WHU A;  1QHG A;  3GZ6 A;  3I4P A;  2DTR A;  4XK4 A;  2E71 A;  3CCU I;  2NVX J;  3WTZ A;  4FX4 A;  1G3Y A;  2CYY A;  1LB2 A;  4EJW A;  2W85 A;  6PAX A;  4CO8 A;  4BYY A;  4OWR B;  1J75 A;  2DW4 A;  2LSO A;  1Y8Q B;  1ZLJ A;  2ZO4 A;  2X1E A;  3OWT A;  4GYI A;  1WVR A;  2LR8 A;  5HOO A;  2RRE A;  5EZH A;  4BHB A;  2LKP A;  5HNF A;  2ZNZ A;  4ON0 A;  1S7E A;  2JA8 J;  2TRT A;  4OMZ A;  2MG4 A;  2GIV A;  2V6C A;  4II2 A;  2DU9 A;  4IXA A;  4G6T B;  2HNH A;  1VQ8 I;  1ULY A;  3QPH A;  3WGI A;  4FAS D;  3FXQ A;  4UV8 A;  2HXI A;  5EG0 B;  1VQ6 I;  4YRV A;  3AFH A;  2L0K A;  4XRS A;  4CYC B;  4BKX A;  1P92 A;  1S9H A;  2M87 A;  2L4A A;  1X19 A;  2JA2 A;  3SXY A;  1UG0 A;  4NQW A;  3I4N J;  2FBK A;  4K2E A;  2LDU A;  3DPL C;  4HEA 2;  4RLF A;  3H92 A;  1OR7 A;  1Y56 A;  3NQO A;  3A02 A;  1WKM A;  2KHM A;  4MTD A;  4YEL A;  2L5Q A;  2XPW A;  1OCT C;  2CO5 A;  2UZK A;  3DPT A;  3SQN A;  2R7U A;  1XCV A;  2OBP A;  3K70 D;  2VKD A;  3K4K A;  3EET A;  2E36 A;  5FRM A;  4JBA A;  1T6S A;  4OIN F;  5DTD A;  3CME I;  3HPG A;  3VPR A;  3HKZ A;  2QVO A;  4D9J A;  2IS4 A;  1IN5 A;  2FBH A;  2JSC A;  2LY1 A;  3C3W A;  2P81 A;  3DLL F;  2HOT A;  3R0J A;  3V8K A;  2MC4 A;  5E20 A;  4IHW A;  3PO3 J;  5JLX A;  3ZQ7 A;  1SAU A;  5FLX Z;  4DIQ A;  5EEH A;  2L7M P;  5LD2 C;  2ZBK A;  4XKV A;  4EMS A;  4BQA A;  1MBE A;  5FB2 A;  4BE2 A;  4HDV A;  2FA5 A;  1W0T A;  2QQB A;  5CVR A;  2CRG A;  3T5X A;  4R79 A;  3WGH A;  1D8J A;  4R8H A;  2CQK A;  2NVT J;  1S29 A;  2XAS A;  1PP8 F;  2XB0 X;  3OY9 A;  3ECH A;  1D1B A;  3S8P A;  4WCG A;  3QP5 A;  4PGH A;  1WJF A;  3NAR A;  4CCO A;  1G6N A;  1XX5 A;  3GO5 A;  2GM4 A;  2L2O A;  3IAS 2;  2FEZ A;  3VSK A;  3RTR A;  4L9J A;  1GXP A;  1FOY A;  3F8B A;  2IRF G;  3N05 A;  4XON A;  5GAG J;  3DTE A;  2KIU A;  3KP6 A;  4IRH A;  2P6S A;  4CZC A;  2BXZ A;  2W4S A;  2K9S A;  1MSF C;  3C1D A;  2CUJ A;  2WV1 A;  3ZGK A;  4XIC A;  1DP7 P;  4RLQ A;  2Y31 A;  4EGY A;  1U5T A;  1JGG A;  1R7J A;  3WU0 A;  4LLG F;  4P55 A;  5F08 A;  3M7G A;  3OYF A;  4UV9 A;  1YW9 A;  1TW3 A;  2XUB A;  3GVA A;  1B8I B;  3V7S A;  2XAG A;  4PUS A;  2YUS A;  1X1B A;  1FJL A;  1VQ5 I;  4GO1 A;  5DM7 F;  4L18 B;  5FFZ A;  4B3A A;  4LK1 F;  3K9T A;  3GZ5 A;  4BE0 A;  1IJW C;  4MHG A;  4M3G A;  1TQM A;  3CCL I;  3SFI A;  1TL8 A;  3UKG A;  2NOG A;  5GPC A;  1FOW A;  4Q47 A;  5F1J A;  2HYG D;  4KJZ A;  3PNY A;  3HYI A;  4MO7 A;  3RIR A;  2R7W A;  4LD5 A;  2DJI A;  1YX3 A;  1Z7U A;  3FXL A;  4C30 A;  4BXF A;  5J4V A;  1XGN A;  2DFF A;  4Z6Y A;  4CGZ A;  3TP3 A;  2FQ4 A;  4HRI A;  4JQF A;  2M0M A;  5C3E J;  1OFC X;  1TW2 A;  3UNG C;  4G9Y A;  3LQR A;  2ZC2 A;  2RNJ A;  1IN7 A;  3RPU A;  1U8B A;  4F7Z A;  2M3A A;  3A01 A;  4A5N A;  3MKW B;  3S1R J;  1RKW A;  2X4H A;  3A2K A;  5D8K B;  1SFO J;  3GYH X;  3H5A A;  1HW1 A;  3REO A;  1GVJ A;  2NVU B;  1W7P D;  2NYX A;  2HGC A;  2TDX A;  3EPZ A;  5HVQ C;  5F0F A;  2K02 A;  1HKS A;  3L2C A;  3HRT A;  4HNU A;  2WAQ A;  1BA5 A;  1LJ9 A;  2CUF A;  3E3V A;  2BW3 B;  1MH4 A;  2EV6 A;  3D5S C;  2DMU A;  4M9Z A;  5IP7 J;  4ENM A;  4OIO F;  4Y13 A;  4HF2 A;  2CUZ A;  1R58 A;  4NC6 A;  1MMG A;  2IS2 A;  2XGD A;  4CCL A;  1D1C A;  3K4N A;  3LSI A;  2F5V A;  2CV0 A;  3BRO A;  3TOA A;  5DCM B;  3JAM K;  4D5F A;  3JRF A;  1IGN A;  3RYP A;  3BTC A;  1FSE A;  2L7K A;  3A0H C;  5DUK A;  1T2K A;  1IAW A;  1IF1 A;  2W25 A;  1NK2 P;  1D5V A;  4RGS A;  4M3D A;  3W6J B;  2DDA A;  3GEZ A;  1QQI A;  2XAQ A;  4FE7 A;  3OYN A;  1VQL I;  5EYR A;  3WTV C;  2H8R A;  2V6E A;  3L09 A;  3KYL A;  2EFW A;  4G94 A;  2H1L A;  3F23 A;  4X6A J;  1H88 C;  4Z2Y A;  2DA6 A;  3U1D A;  3ERE D;  3CC2 I;  3FZV A;  4HYE A;  3H3Z A;  5EG0 A;  2VON A;  4H4K C;  4CYC A;  1DPU A;  4IHX A;  3SZG A;  2NS7 A;  2KZG A;  2PEX A;  2L7F P;  4HX8 A;  1I50 J;  2CMP A;  5FLX K;  2XDV A;  2IGN A;  3E7L A;  3FKI J;  4ENK A;  3C7J A;  2DOA A;  2IEK A;  2Z3Y A;  4XBF A;  3V7R A;  4D0P A;  1ETV A;  4N9I A;  4DNC A;  1HXD A;  1HF0 A;  3CDH A;  1MBJ A;  4C3I J;  1XB4 A;  3WTW C;  1EH7 A;  3H36 A;  3HSE A;  3CCY A;  3OOU A;  1AKH A;  3B6A A;  1APL C;  1SVO A;  1VQ9 I;  1MMS A;  1A04 A;  5D4R A;  1XTA A;  2KDO A;  3E0J B;  4UUS B;  2Q0O A;  3NAU A;  1UAA A;  2NVQ J;  3S32 A;  1IV8 A;  1ORK A;  3VSL A;  3VWB A;  3KP5 A;  2G9W A;  3HPH A;  2PQ8 A;  1SD6 A;  1HKT A;  1TT5 B;  1S5L C;  4JX4 A;  1OIS A;  1KA8 A;  3MKZ A;  2OJE D;  4NB5 A;  1ZR4 A;  3H5N A;  2WV0 A;  1EKE A;  5HOD A;  2P5L C;  4LG0 A;  9ANT A;  2MSY A;  4MFE A;  2MBF A;  4L9V A;  2AS5 F;  1P9Q C;  3KEO A;  4RM3 A;  2HKX A;  3W3C A;  3BJA A;  3IV5 A;  2HWV A;  2ESH A;  1ZGW A;  3G4S I;  3HTU A;  2EIJ H;  1T08 B;  3FK7 A;  5E79 C;  1UMQ A;  4LIT A;  2QM3 A;  1LE8 B;  4RGR A;  1Y8R B;  3CES A;  3QPL A;  4XR6 A;  3KET A;  4BE1 A;  1O3Q A;  5EGO A;  4YIR X;  3JRA A;  2QQ9 A;  3RKW A;  3V4G A;  1QPM A;  4I0B A;  3SZT A;  3GTO J;  2HI3 A;  4LB6 B;  1GT0 C;  3CCJ I;  1TNS A;  2VJ5 A;  3R6S A;  2X0L A;  3WU2 C;  3ZOB A;  1X1C A;  4S0H B;  2M5W A;  2L54 A;  2DTZ A;  5D6E A;  2Z2S B;  4W1U A;  2DI3 A;  1JI8 A;  1X2N A;  1YTY A;  1ZLK A;  4XN0 A;  4AIJ A;  3HXL A;  2VQL A;  3PO2 J;  3V42 A;  3VYT B;  3JRI A;  4B44 A;  3S3O A;  1WRJ A;  1B8I A;  2D1V A;  3ZQI A;  2DAO A;  4XID A;  5AIQ A;  4IZZ A;  4LIV A;  1XSD A;  2CW8 A;  2KP6 A;  3OSG A;  1S7O A;  1U2W A;  3B02 A;  3GBG A;  1H9T A;  2WB1 A;  1O7L A;  5LBQ A;  2Z16 A;  4XLN F;  4BUP A;  2G7U A;  4ITV A;  4E6K G;  1UCR A;  1WSU A;  1YLF A;  1JKP C;  4B09 A;  2HZT A;  3ZQH A;  1IC8 A;  4A6D A;  2PLY A;  2I8D A;  3RDI A;  4I09 A;  3CO7 C;  2A5Y B;  2EZK A;  3ZN1 A;  3S3M A;  5LHH A;  3W6V A;  4BY7 J;  1I5Z A;  4HNV A;  3GW2 A;  2E5N A;  4JK1 X;  2FE3 A;  4FX0 A;  3LMM A;  3A0B C;  1K4T A;  4V2F A;  4AVZ A;  1WZ2 A;  4XRS G;  1A5J A;  4KIG A;  3BDD A;  3R0A A;  2V9K A;  3BPV A;  3K1P A;  3GX4 X;  2KPM A;  4AWX B;  1W36 C;  4CHU A;  2AXL A;  3M4O J;  4IX7 A;  4O6J A;  4IF4 A;  2ID3 A;  2KZV A;  3Q0V A;  4HNT A;  4EAT A;  2QBY B;  3GFI A;  3BZ6 A;  5EF6 A;  1TWG J;  4F91 B;  1MKM A;  3HHG A;  3CJT B;  3FXJ A;  5HLT A;  1D0Z A;  3M3Y J;  2LD5 A;  2K40 A;  4I02 A;  5EEG A;  2DDB A;  2M9H A;  2E5Z A;  2DOF A;  2XSJ C;  2M4G A;  4LGW A;  1ZYR F;  4M6V A;  2E35 A;  5DM6 F;  2VJ4 A;  2MD5 A;  2XRL A;  4AU7 A;  3S17 J;  2BW3 A;  3CF2 A;  3IUO A;  3J7Z I;  2A61 A; 
#chains in the Genus database with same CATH homology
 3O2P E;  1FWZ A;  3EQL F;  4M74 A;  3FMR A;  1R22 A;  5HDN A;  3RI4 A;  5DCM A;  3KP3 A;  5LEJ A;  1XSV A;  4XSX F;  2D2W A;  2DQR A;  3ABT A;  4MEY F;  4KFC A;  1BM9 A;  4YG2 F;  4KMU X;  1FYM A;  2O61 A;  1R36 A;  3K1N A;  4G6D A;  3ZMZ A;  4QWQ A;  1B9N A;  3WE3 A;  1YW8 A;  1QO0 D;  4L5J A;  1S6L A;  4RB3 C;  1YFH A;  3WU1 B;  1BC7 C;  2VE8 A;  1UHW A;  3P9I A;  2UXN A;  3BY6 A;  1EV7 A;  3SZP A;  3JTH A;  3MFK A;  3WTX C;  5D5U B;  1HW2 A;  1E17 A;  3COA C;  4KNY A;  3F8F A;  3WTY C;  2BBY A;  3TO9 A;  1TQI A;  2M45 A;  4BXU A;  4U88 A;  3WG9 A;  4UUV A;  5ICF A;  3WTU C;  1IW7 F;  3MZY A;  1J5Y A;  3DP7 A;  4KIB A;  3NRV A;  1XGO A;  1XSX A;  1T38 A;  3F8C A;  3D5L A;  2W24 A;  3I58 A;  2BGC A;  1SMY F;  4M9X A;  2D45 A;  2FSW A;  5CVV A;  1IXS B;  1T98 A;  4M6Y A;  4HF0 A;  2VXZ A;  3VEP A;  4CXF A;  5L3C A;  5CYV A;  5J8C A;  4LLL A;  4KDP A;  1FT9 A;  2XAF A;  4WWC A;  4ENN A;  1G3T A;  3F6O A;  4ESJ A;  3ZMD A;  3DEU A;  2MLG A;  1U8R A;  1ZGJ A;  5DCF A;  2J5P A;  3RYR A;  4HF1 A;  4I0A A;  1XMK A;  1B1B A;  5A2Q Z;  2V1U A;  3LFK A;  1SD4 A;  2ISY A;  2J5O A;  5D8L B;  1LVA A;  1B59 A;  2CFX A;  1TBX A;  3E6M A;  1TNT A;  2XIG A;  2FQ3 A;  2P5V A;  2P6T A;  3W6K B;  3WOD F;  5HLH A;  4HA8 A;  2CG4 A;  2EK5 A;  1U5T C;  4KUM A;  4AD9 A;  2OD5 A;  2VOO A;  1KU3 A;  1NHA A;  5LRR A;  3HIF A;  2P7V B;  1Z9C A;  3P7N A;  3KLO A;  1XGS A;  2GZW A;  2HYF A;  1G4D A;  2IVM A;  3RJP A;  1W5S A;  5ICC A;  3EUH A;  3OOP A;  2RVC A;  4Y15 A;  4UVB A;  3ULQ B;  1KU9 A;  2DFI A;  2HQR A;  1XMA A;  5LLQ A;  3P9C A;  2P7C B;  3MEX A;  2DO7 A;  2DK8 A;  1LDD A;  1C0W A;  3TOB A;  1D3Y A;  1FC3 A;  3EYY A;  4FHT A;  3ZMU A;  4EJT A;  3SFZ A;  3ZPL A;  2HFH A;  2Z99 A;  1T39 A;  1FBQ A;  1FOK A;  4EM0 B;  5BS6 A;  4OU0 A;  2FML A;  2BE5 F;  2R7F A;  2M30 A;  1H9G A;  4Y17 A;  3ECO A;  3T0Y A;  1SFE A;  2B0L A;  1IN6 A;  4LG0 B;  2LNB A;  1PUE E;  4EM1 A;  1RNL A;  4HOB A;  3FXU A;  1K6O A;  4IHS A;  4FT8 A;  1BI3 A;  1P4A A;  5CLS A;  5D5W B;  2H94 A;  2E1C A;  3GLX A;  1BIA A;  3E6B A;  4EM2 A;  4QLC U;  2F5D A;  1KQ0 A;  1OYY A;  1QGP A;  3MQ0 A;  4ZYG A;  4U7D A;  2RGV A;  2ZCW A;  5E1X A;  3HSR A;  3WE2 A;  2V1D A;  2VC0 A;  1B9M A;  1KGS A;  3J81 Z;  1F1Z A;  2XKO A;  1ZRD A;  3E6C C;  3BPX A;  4RB0 A;  1LQ1 A;  2ACJ A;  3VFZ A;  2QQA A;  3IC7 A;  3KFW X;  5D6F A;  2K4B A;  2ZKZ A;  5A2Q K;  3K2Z A;  2EA2 A;  1FBU A;  1ZG5 A;  1QBJ A;  4EJO A;  2FF4 A;  5JVT A;  1HST A;  1GXQ A;  4YIF A;  2L4M A;  4KIF A;  3HHH A;  2EA4 A;  2STT A;  3M8E A;  3Q9V A;  4OOI A;  1QNT A;  2HDC A;  4E70 A;  3CUO A;  2RKH A;  5CVU A;  3R60 A;  2OZ6 A;  2YU3 A;  2MLK A;  1MD0 A;  1J7K A;  2F5E A;  2FNA A;  3BOQ A;  1XGM A;  3ZMV A;  3F3X A;  2P4W A;  4HQE A;  4HAM A;  3HOS A;  4RS8 A;  1PDN C;  1B6A A;  2ETH A;  1R1T A;  4Q4Z F;  1KU7 A;  3FM5 A;  2OQG A;  2EJR A;  3WTT C;  5CVI A;  2P5K A;  4ENJ A;  3I71 A;  2K27 A;  1YW7 A;  4P96 A;  1FX7 A;  2GAU A;  1R00 A;  3T8R A;  2Z5U A;  4MGR A;  4L0Z B;  1BI1 A;  2A68 F;  4UXN A;  5FD5 A;  4Q48 A;  3H3U A;  5AON A;  2A6E F;  5HLI A;  3P9K A;  4KYW A;  5K5Q A;  2DT5 A;  2FBI A;  1Z91 A;  2ZME A;  3FWE A;  2R3S A;  3GFM A;  5BQT A;  5FO5 A;  2KKO A;  2XV4 S;  4BH9 A;  2O0Y A;  3LWF A;  2OU2 A;  4LK0 F;  1I6X A;  1U78 A;  2NAZ A;  2RC4 A;  5H6Q A;  3RKY A;  2XRN A;  1DUX C;  4P9F A;  4AVP A;  4YFX F;  3IRR A;  4MQV A;  3FF5 A;  1R23 A;  2C6Y A;  2PJP A;  3KCC A;  3M1E A;  5E1W A;  2HQN A;  5CJ9 A;  1XCB A;  2Z33 A;  5LHI A;  3S2W A;  1S8N A;  2O03 A;  2MH2 A;  1YS7 A;  5F64 A;  1P4X A;  5DV5 A;  2EFP A;  4RAZ A;  4CYD A;  3GXO A;  2A07 F;  3N97 A;  1BBY A;  1JHH A;  1P4W A;  3R4K A;  5LEK A;  2ISZ A;  1PP7 U;  3L00 A;  3ZN0 A;  3BP8 A;  2M1B A;  3V7C A;  4M9S A;  2PI0 A;  2FXA A;  3F8M A;  5ILS A;  2IA0 A;  3DQV C;  3KE2 A;  1ZRC A;  1EH8 A;  3HSF A;  3E5U A;  1DDN A;  1IXR C;  1TTY A;  4R1H A;  1LEA A;  2O8X A;  1H0M A;  3U9G A;  3I59 B;  2IW5 A;  2NNY A;  1W7P B;  3PQJ A;  1FZP B;  2RN7 A;  3TO7 A;  4MQ9 F;  1IZ1 A;  4S04 A;  5IT9 Z;  3BWG A;  2M8E A;  1HKQ A;  2HR3 A;  4HX7 A;  5HS7 A;  2YX4 A;  1Z6T A;  4M6X A;  1F4K A;  2GXB A;  4HV5 A;  2Y0M A;  1BI0 A;  1JE8 A;  4HLY A;  2XKP A;  1P2F A;  5L3G A;  3ELK A;  1MDM A;  1GHC A;  3FXR A;  2PMH A;  1SMT A;  4EJU A;  2PN6 A;  1ZHF A;  4PDK A;  2E7W A;  4BHC A;  4RB1 A;  5FD6 A;  1U6G A;  1EH6 A;  4G7Z F;  1ODD A;  1O57 A;  2O3F A;  2XGX A;  3HTS B;  2L02 A;  4G7O F;  2HKO A;  5L3D A;  4A6E A;  5JHU A;  1IXC A;  1JXS A;  4A0X A;  5D5X B;  4CIC A;  3VB2 A;  5E17 F;  1Y0U A;  1Q1H A;  4NHJ A;  3V8J A;  2GXG A;  2EB7 A;  4Q5S F;  1SD5 A;  3O3K A;  5LGU A;  3N4M A;  5DD8 A;  1LNW A;  3WTS C;  1K78 A;  2L01 A;  3F8N A;  4GYG A;  3K69 A;  3M9A A;  4RGX A;  3NEU A;  3IWF A;  5FFX A;  4RGU A;  1HBX G;  2OAZ A;  3E5X A;  3ROU A;  3MZH A;  3ISP A;  5TJJ A;  2NNN A;  5LGN A;  1ONV A;  1YQA A;  3G73 A;  4YFN F;  1J59 A;  4PGG A;  1YYV A;  2XAH A;  3ZMT A;  1BN5 A;  2W84 A;  4S05 A;  1MJA A;  3KP4 A;  1BC8 C;  2UWM A;  3LA7 A;  3KZZ A;  4HBL A;  3GWZ A;  2HS5 A;  2PMU A;  2GWR A;  4OMY A;  2FNP A;  3K1M A;  1XN7 A;  3SHF A;  4HV6 A;  3I54 A;  3D0S A;  3CO6 C;  1O7F A;  4XRF A;  2COM A;  2YX7 A;  1O3T A;  2UXX A;  2FRH A;  5HS9 A;  2Y75 A;  2VC1 A;  1FP1 D;  5IT9 K;  1WQ2 A;  2H6B A;  5F6F A;  4YII A;  5BOX A;  1MJ9 A;  4ZH4 F;  1AWC A;  3KEQ A;  4IJA A;  2HTS A;  3HRS A;  3IRQ A;  2HOE A;  1KYW A;  3B73 A;  3GFL A;  2R7D A;  1KYZ A;  4ZZL A;  1MZB A;  4GXO A;  3I59 A;  4GGG A;  1W7P A;  3TKY A;  3O6B B;  2FOK A;  4M71 A;  3BJ6 A;  2GA1 A;  2KRF A;  4UVC A;  1QZZ A;  3TQN A;  1J2X A;  1E2X A;  2H27 A;  3F72 A;  3FMS A;  2YSR A;  3QU6 A;  1ON1 A;  2QEN A;  4M73 A;  4LB5 A;  3JSP A;  2XVC A;  4RB2 C;  4ASN A;  4L0Y B;  2EFO A;  3Q9S A;  3G3Z A;  1XDU A;  3TDU C;  1FYK A;  1OPC A;  1SD7 A;  4BAY A;  2QLZ A;  4A0Z A;  1J0R A;  2QZ8 A;  4ZYD A;  2DK5 A;  2RDP A;  2VBZ A;  2A6H F;  1REP C;  3OV8 A;  5L3B A;  1L3L A;  4IRI A;  1FNN A;  4KT5 C;  3CUQ A;  1STZ A;  4U0V A;  3JW4 A;  4MEX F;  1RUO A;  1TQP A;  1T0F A;  1USS A;  2ZME B;  2EFN A;  5DYM A;  3BJO A;  4GCV A;  1I1G A;  2VT2 A;  1BOA A;  4G6Q A;  1LDJ A;  4EJV A;  1VTN C;  2IP2 A;  5JR3 A;  3ZP5 A;  5F1R A;  3JAM Z;  4XSZ F;  2GA2 A;  1IN8 A;  2Q2E A;  5J8F A;  1HQC A;  2H09 A;  5K5O A;  5D5V B;  4IPA A;  2JZY A;  4EQQ A;  1L0O C;  4P5O A;  1SFX A;  4WK8 F;  1QZY A;  3KZY A;  2HTJ A;  1S7A A;  3HOT A;  2EWN A;  5DDG A;  2CWE A;  1CGP A;  1B4A A;  5K1Y A;  1G3S A;  2CGP A;  5ILV A;  3HUG A;  3L9F A;  1FYL A;  3J80 Z;  4OIP F;  3I0T A;  3TO6 A;  2DPU A;  1FLI A;  2F5F A;  1IUY A;  4HX4 A;  2JT1 A;  1I1S A;  1KQ8 A;  1U3E M;  1BJA A;  2ESN A;  4U7B A;  2A3S A;  1ZAO A;  4WX9 A;  2CW0 F;  2JRT A;  5HDK A;  4I01 A;  3FM3 A;  2V79 A;  2MA3 A;  3QRF F;  5KK1 A;  2G7H A;  5ILU A;  2PBI A;  3VOD A;  5DEQ A;  2Q8K A;  1R1V A;  1Z1D A;  3IKV A;  1LEB A;  2EFQ A;  4ZYH A;  2ELH A;  2Y48 A;  2MH9 A;  1CF7 A;  1FP2 A;  5K5R A;  4ZZD A;  2VBY A;  2IA1 A;  1K79 A;  1UST A;  5L3E A;  3ZMS A;  3F21 A;  2OZU A;  4WXD A;  1MDM B;  1ZRE A;  2STW A;  4EVI A;  3CTA A;  2VE9 A;  1DPR A;  1F5T A;  3DV8 A;  4P9U A;  4N9H A;  4KN4 X;  4A5M A;  4WF2 A;  4EV0 A;  2DQL A;  1TLH B;  4OIQ F;  1ZN2 A;  5HDG A;  5JI6 A;  4U0W A;  1WWX A;  2WC2 A;  1UB9 A;  4H0E A;  3DKW A;  2YR2 A;  1FSH A;  3LA3 A;  3DF8 A;  2KJC A;  2L3D A;  5H20 A;  4I7H A;  4ESB A;  3GF2 A;  1FPQ A;  3WGG A;  1W4M A;  1YS6 A;  3AAF A;  4AIK A;  4ZYE A;  1K78 B;  4TV7 A;  5LRS A;  1BIB A;  5E1Z B;  4MTE A;  4IVN A;  3LQQ A;  2MC3 A;  2VBX A;  2VT3 A;  2V1X A;  4O5V A;  1FY7 A;  4CZZ A;  3LA2 A;  4PCQ A;  4B8X A;  3QPT A;  4KMF A;  2PG4 A;  2ZNY A;  2IA2 A;  1XDS A;  4HW0 A;  2YPR A;  2BV6 A;  3M8F A;  3J80 K;  3QAH A;  4WXC A;  4RAY A;  4I2O A;  3J81 K;  2EV0 A;  2W57 A;  1V4R A;  1O3S A;  4LJZ F;  5FGM A;  2EV5 A;  1OYI A;  4UVA A;  1R5H A;  1OYW A;  2VBW A;  4A12 A;  5LGT A;  3ABU A;  2NS0 A;  1ZG1 A;  3Q5F A;  4L9N A;  2IPQ X;  3LAJ A;  3F22 A;  2HEO A;  2ADU A;  5IT3 A;  3GUD A;  3TDZ C;  4CDG A;  5LHG A;  3DFG A;  3PFI A;  2FU4 A;  2OQR A;  4HZF A;  3RPQ A;  3T1B A;  3LST A;  3I5U A;  3MCZ A;  4MNU A;  2BEO A;  5D4S A;  4LMY A;  1OMI A;  3HRM A;  5H6R A;  1JHF A;  4M72 A;  1Z05 A;  2F5C A;  1MGT A;  2KJB A;  1MJB A;  2K4J A;  2H6C A;  2K7L A;  4LFU A;  2VN2 A;  5KVR A;  3R61 A;  1BI2 A;  3J7A O;  3IL2 A;  1P6R A;  1I27 A;  4BNC A;  2DBB A;  5DD4 A;  3FMQ A;  2ZFW A;  3EDP A;  2CSO A;  4HQM A;  4WXH A;  1IN4 A;  4G7H F;  2NRA C;  5E18 F;  3U2R A;  2PFB A;  2JPB A;  5TRD A;  1YIO A;  3I53 A;  4UHT A;  2LF7 A;  5E8G A;  3LAP A;  5AIP A;  3MWM A;  5BPI A;  5BMZ A;  1OKR A;  3QOP A;  2XHK A;  2ZXJ A;  1UHM A;  4L9T A;  1YO5 C;  5E8I A;  2ZJ2 A;  3TGN A;  1D8K A;  2DLL A;  3DXJ F;  3E97 A;  3HRU A;  3CUQ B;  2DPD A;  3CJN A;  1AOY A;  2QYO A;  2JPC A;  2V9V A;  4KA4 A;  1RIO H;  5DUI A;  1FBS A;  1F9N A;  3V8L A;  2K86 A;  4O3M A;  3EYI A;  4AIH A;  3ML6 A;  5L3F A;  4LLN A;  1YG2 A;  4IRG A;  4KIC A;  3C18 A;  5ICE A;  4IHT A;  2IT0 A;  4I98 B;  3PQK A;  4HDU A;  4L5I A;  4N0B A;  2GQQ A;  1LDK B;  1SAX A;  1J9I A;  5HLG A;  2JTV A;  3FHZ A;  1W5T A;  3IWZ A;  2LF8 A;  3I64 A;  2IJL A;  3RKX A;  3L7W A;  1KU2 A;  1G3W A;  3E6D A;  3FX3 A;  1Z6R A;  5BPD A;  4ESF A;  1ZAR A;  2D1H A;  3IKT A;  1S3J A;  4EGZ A;  1O3R A;  2QUF A;  4YFK F;  1IRG A;  2VOP A;  2RV8 A;  4BHP A;  3CUQ C;  5ICG A;  2E7X A;  3K0L A;  3QU3 A;  3F6V A;  2XAJ A;  2QWW A;  5JFR A;  2VOD A;  5J6X A;  2OA4 A;  4U0Y A;  2FMY A;  4A2U A;  1WI9 A;  3CLO A;  1X3U A;  2BYV E;  1ZG3 A;  4UNO A;  1R1U A;  3KP7 A;  3T8T A;  1JGS A;  4KN7 X;  3E5Q A;  2P8T A;  1IRF A;  1U5T B;  3GFJ A;  3JSO A;  4OIR F;  1KQ9 A;  4DQ2 A;  1RI7 A;  3VOE A;  1HSJ A;  1V3F A;  2E1N A;  4A0Y A;  3KP2 A;  4G8X A;  5HS8 A;  1SFU A;  2XRO A;  3QP6 A;  4HLX A;  1ZRF A;  1CF7 B;  1ZGA A;  5CVJ A;  1RZ4 A;  2Z9O A;  3MAJ A;  1K7A A;  1XD7 A;  2KIF A;  2WWY A;  2RQP A;  1ON2 A;  1UFM A;  3KLN A;  3IHU A;  2O6G E;  2F2E A;  2KIM A;  1ZH5 A;  1HW5 A;  3JTG A;  1RUN A;  5ERI A;  4PZJ A;  4ETS A;  5ED4 A;  1R5G A;  2A69 F;  2WTE A;  4XLP F;  2QBY A;  3GZ6 A;  3I4P A;  2DTR A;  3WTZ A;  4FX4 A;  1G3Y A;  2CYY A;  1LB2 A;  4EJW A;  2W85 A;  6PAX A;  4CO8 A;  4BYY A;  1J75 A;  2DW4 A;  2LSO A;  1ZLJ A;  2ZO4 A;  4GYI A;  5HOO A;  4BHB A;  2LKP A;  2ZNZ A;  4ON0 A;  4OMZ A;  2GIV A;  2V6C A;  2DU9 A;  4IXA A;  1ULY A;  3QPH A;  3WGI A;  3FXQ A;  4UV8 A;  1P92 A;  2M87 A;  2L4A A;  3SXY A;  4NQW A;  2FBK A;  4K2E A;  2LDU A;  3DPL C;  3H92 A;  1OR7 A;  3NQO A;  1WKM A;  4MTD A;  2CO5 A;  2UZK A;  3DPT A;  3SQN A;  1XCV A;  2OBP A;  3EET A;  4JBA A;  1T6S A;  4OIN F;  2QVO A;  1IN5 A;  2FBH A;  2JSC A;  3C3W A;  3R0J A;  3V8K A;  5E20 A;  3ZQ7 A;  5FLX Z;  5EEH A;  2ZBK A;  4EMS A;  4BQA A;  5FB2 A;  4HDV A;  2FA5 A;  2QQB A;  5CVR A;  3T5X A;  4R79 A;  3WGH A;  1D8J A;  4R8H A;  2CQK A;  1S29 A;  2XAS A;  1PP8 F;  3ECH A;  4WCG A;  3QP5 A;  4PGH A;  1G6N A;  3GO5 A;  2FEZ A;  3RTR A;  4L9J A;  1GXP A;  3F8B A;  2IRF G;  2KIU A;  3KP6 A;  4IRH A;  2P6S A;  3C1D A;  1DP7 P;  4EGY A;  1U5T A;  1R7J A;  3WU0 A;  4LLG F;  4P55 A;  3M7G A;  4UV9 A;  1YW9 A;  1TW3 A;  2XUB A;  3GVA A;  3V7S A;  2XAG A;  4GO1 A;  4L18 B;  5FFZ A;  4LK1 F;  3K9T A;  3GZ5 A;  4MHG A;  1TQM A;  4Q47 A;  2HYG D;  3HYI A;  3RIR A;  4LD5 A;  1Z7U A;  1XGN A;  4CGZ A;  4JQF A;  1TW2 A;  4G9Y A;  3LQR A;  2RNJ A;  1IN7 A;  3RPU A;  4F7Z A;  4A5N A;  2X4H A;  5D8K B;  3GYH X;  1HW1 A;  3REO A;  1GVJ A;  1W7P D;  2NYX A;  2HGC A;  2TDX A;  5HVQ C;  2K02 A;  1HKS A;  3L2C A;  3HRT A;  1LJ9 A;  3E3V A;  2EV6 A;  4M9Z A;  4ENM A;  4OIO F;  4Y13 A;  4HF2 A;  1R58 A;  3BRO A;  3TOA A;  5DCM B;  3JAM K;  3RYP A;  1FSE A;  5DUK A;  1T2K A;  1IAW A;  1IF1 A;  2W25 A;  1D5V A;  4RGS A;  3W6J B;  3GEZ A;  1QQI A;  2XAQ A;  3WTV C;  3L09 A;  2EFW A;  4G94 A;  3F23 A;  4Z2Y A;  3U1D A;  3ERE D;  3FZV A;  4HYE A;  3H3Z A;  2VON A;  1DPU A;  4HX8 A;  2PEX A;  5FLX K;  4ENK A;  3C7J A;  2Z3Y A;  3V7R A;  4XBF A;  4D0P A;  4N9I A;  4DNC A;  1HXD A;  3CDH A;  1XB4 A;  3WTW C;  1EH7 A;  3HSE A;  1A04 A;  5D4R A;  2Q0O A;  3KP5 A;  2G9W A;  2PQ8 A;  1SD6 A;  1HKT A;  1KA8 A;  4NB5 A;  2WV0 A;  2P5L C;  4LG0 A;  2MBF A;  4L9V A;  2AS5 F;  3KEO A;  2HKX A;  3BJA A;  2HWV A;  2ESH A;  3HTU A;  2QM3 A;  4RGR A;  3KET A;  1O3Q A;  2QQ9 A;  3RKW A;  3V4G A;  1QPM A;  4I0B A;  3SZT A;  4LB6 B;  1TNS A;  3R6S A;  2X0L A;  2M5W A;  2L54 A;  5D6E A;  2DI3 A;  1YTY A;  1ZLK A;  4AIJ A;  1WRJ A;  2D1V A;  2DAO A;  5AIQ A;  1XSD A;  1S7O A;  1U2W A;  3B02 A;  1H9T A;  1O7L A;  5LBQ A;  4XLN F;  2G7U A;  1WSU A;  1UCR A;  1YLF A;  4B09 A;  2HZT A;  4A6D A;  2PLY A;  3RDI A;  3CO7 C;  4I09 A;  2A5Y B;  3ZN1 A;  5LHH A;  1I5Z A;  3GW2 A;  4JK1 X;  2FE3 A;  4FX0 A;  4KIG A;  3BDD A;  3R0A A;  3BPV A;  3K1P A;  3GX4 X;  4AWX B;  4CHU A;  2AXL A;  4O6J A;  4IF4 A;  2QBY B;  3GFI A;  3BZ6 A;  1MKM A;  3HHG A;  4I02 A;  5EEG A;  4LGW A;  1ZYR F;  2MD5 A;  2A61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...