2Z33A

Solution structure of the dna complex of phob dna-binding/transactivation domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*TP*GP*TP*CP*AP*TP*AP*AP*AP*TP*CP*TP*GP*T)-3'
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2z33A00
5FD6A 6PAXA 5FFZA 3FHZA 3LAJA 4N0BA 4L18B 4A12A 3GLXA 4OIRF 1L3LA 2ZKZA 1ZLJA 4JBAA 1O57A 2CGPA 4A2UA 1U8RA 3EQLF 4WWCA 1I6XA 1QPMA 1SFEA 2PLYA 3JSPA 4IRGA 2XAFA 1KQ8A 4I98B 3IL2A 2IVMA 2H09A 2ISZA 2V9VA 1J59A 1R00A 1XMAA 3KZZA 5CJ9A 5L3EA 3KP6A 5HLHA 2STTA 3F21A 3WODF 2DW4A 4LMYA 2MD5A 4L0YB 2QM3A 1B1BA 3B73A 4IRHA 2Q2EA 3G3ZA 4U0YA 2GA2A 1LEAA 1LDDA 3MZYA 2EJRA 3KP2A 2CW0F 5DD8A 1USSA 5LHIA 2A6EF 5E17F 1L0OC 2KIUA 4YFNF 2F5FA 2O0YA 3W6JB 3Q5FA 2MLKA 1FPQA 1B59A 1Y0UA 4A6DA 1VTNC 3ZP5A 4HX7A 3JTGA 4L9VA 4XLNF 3BDDA 2ESNA 3M9AA 5E1ZB 2YX7A 1W7PD 3H3UA 4ESFA 4CZZA 2CSOA 2QLZA 2JPCA 2LNBA 1H9TA 4BHCA 1SMTA 1OYIA 1BIAA 1S3JA 3D5LA 3F23A 4L9TA 4BHBA 3LA3A 4Q47A 2P8TA 3WE2A 5BPIA 3E6MA 1O3RA 1MGTA 3RKYA 3HRTA 1FT9A 2PQ8A 3MFKA 1P6RA 4KN7X 1F9NA 4QLCU 3KLNA 3GFIA 3KEQA 2A61A 4G7ZF 5ILUA 2K4JA 2VC1A 1STZA 1TNTA 1BI3A 4AIKA 1CF7A 4GYIA 1LEBA 2BEOA 5IT9Z 4BH9A 3QRFF 3FM5A 2FU4A 1BBYA 2M45A 2NAZA 1MKMA 4GYGA 3L00A 3P9KA 4ETSA 3ML6A 1H9GA 1GXPA 2Z5UA 1FLIA 2GIVA 1AOYA 1UFMA 1HW1A 2VE8A 4E70A 4UNOA 2VN2A 1MDMB 3CUQA 3O6BB 1BI0A 1FOKA 2QQ9A 2QWWA 3C3WA 3GFLA 4A0ZA 1I1GA 3HRSA 1LDKB 3BPXA 3CUOA 1EH6A 5LLQA 3R0AA 1HKQA 5ED4A 2IA2A 4L9JA 4EM2A 4KICA 4MHGA 5LGNA 2JZYA 5FB2A 1D5VA 2OQGA 2BE5F 5J8CA 4LB5A 2L3DA 3LWFA 2XV4S 1MJAA 4DNCA 4MTEA 3VEPA 2PG4A 1XGSA 1D8KA 2V1UA 3DQVC 5ILSA 1WI9A 1DUXC 1ZREA 5FO5A 3SXYA 1J7KA 4JQFA 1IXRC 3OOPA 1OKRA 1XB4A 1LB2A 2HYFA 1R36A 2LDUA 3LAPA 2XGXA 4MTDA 2W57A 2LKPA 3WGGA 5AIQA 1J2XA 3F8BA 3QPHA 3I0TA 3DPTA 2PMHA 3ZMDA 1GVJA 1R7JA 2UXXA 2WTEA 2BGCA 3M1EA 5A2QZ 3WTTC 1R58A 1YG2A 2D45A 1FP2A 2G7HA 3ISPA 4AVPA 4O3MA 3PFIA 5ERIA 3COAC 1TQMA 3R60A 3V8LA 1USTA 3FMQA 4S05A 2OZ6A 3TDUC 4U0WA 3K2ZA 4HQMA 1W7PA 4MQVA 2PN6A 3GEZA 4XSZF 4Z2YA 1H0MA 2DBBA 3CO7C 3ECHA 1Q1HA 3I59A 2L01A 2KIFA 2CG4A 2HEOA 2F5CA 2DPUA 4K2EA 1W4MA 3HYIA 1OR7A 3RDIA 1S8NA 2KIMA 2J5PA 1YW8A 1CF7B 3IRRA 1XDUA 4M74A 2V1DA 1FYLA 3SHFA 1IRGA 2LF7A 3QU6A 2HWVA 2R7DA 5IT3A 1XMKA 2P6TA 4GO1A 2NYXA 4ZZLA 2NNYA 4L0ZB 1U5TA 2H6CA 1E17A 2Q0OA 1J0RA 1TQPA 2PJPA 4Y15A 1YFHA 2OU2A 3HOTA 2O3FA 4I0BA 3WU1B 3F6VA 4XSXF 2GQQA 5HDKA 5LEKA 1ON1A 3HRUA 3BJAA 2EB7A 1QBJA 2HKOA 1Z05A 1HBXG 2X0LA 4F7ZA 2YPRA 1IUYA 1TQIA 4HF2A 2CO5A 2M8EA 5D5VB 3FMSA 1WWXA 4MNUA 1DDNA 2LF8A 2GZWA 5HS7A 3FXRA 2GWRA 1KQ0A 4HOBA 3NQOA 1RNLA 3PQJA 4UUVA 1KA8A 3CUQC 3K1NA 3K9TA 3BJOA 3F3XA 3WGIA 3EDPA 5DEQA 3DXJF 4IJAA 1X3UA 1HSJA 2QQBA 1IN7A 4P5OA 4M9XA 3AAFA 4HX8A 1ZLKA 2NRAC 1K7AA 1G3SA 5DCMA 4CICA 2CQKA 2FMLA 2NNNA 1U5TC 1WSUA 1FNNA 2CFXA 1SFUA 5TJJA 3RKWA 1QZYA 2EK5A 3WG9A 2PFBA 1XDSA 1YIOA 3EYYA 4LJZF 4M71A 2IW5A 1FYMA 5EEGA 2VOPA 3E5QA 4R8HA 1UHWA 5JVTA 4MEYF 3F8MA 1G3WA 4BQAA 3KE2A 1ULYA 2Z33A 1HXDA 4BNCA 4KT5C 2Y75A 1FBSA 3U2RA 2H94A 3ZN0A 2K27A 4LK1F 1T98A 1T0FA 2COMA 2Q8KA 4EGYA 2RQPA 1B9MA 5D5UB 1OYYA 2GXBA 3L7WA 3O3KA 5LBQA 4OMZA 2EA2A 2K02A 3GZ5A 2Z99A 1DP7P 4IHTA 2ZJ2A 5HS9A 3E3VA 1O7FA 1O3QA 1P4WA 4WK8F 4CDGA 1YS6A 3HTUA 4HV6A 2AXLA 2D2WA 1R5HA 2VT2A 1ZYRF 5F6FA 1Z6TA 2XHKA 3J80K 1BM9A 2HS5A 5A2QK 2IPQX 1UB9A 2JPBA 2FNPA 2V1XA 2E7WA 2CWEA 1WKMA 3MEXA 1R1UA 3WTXC 2DQRA 2ZMEA 2DTRA 1D8JA 3W6KB 1QNTA 1KU2A 3M8EA 5DUKA 2ZNYA 1K6OA 3HRMA 3TQNA 1YQAA 2HQNA 1TNSA 4LLGF 4NHJA 2R3SA 4I7HA 2NS0A 1OPCA 4BYYA 3JTHA 3KCCA 5KVRA 2XAJA 4PDKA 5CYVA 2EV0A 2B0LA 4LK0F 4JK1X 4YIIA 2GAUA 4EQQA 4U88A 5K1YA 3U1DA 1ZG3A 1BC7C 1HSTA 5L3BA 1G6NA 1KQ9A 1KGSA 5E8IA 3KEOA 1Z9CA 3HHHA 2DK8A 1J9IA 3Q9SA 1C0WA 1R1VA 3LA2A 1MJBA 5D8KB 3ZN1A 5LGTA 1EV7A 1MDMA 1OYWA 3EUHA 2RVCA 3GWZA 2O6GE 4HLYA 3S2WA 3TO9A 4ESBA 2FSWA 1ODDA 4U7DA 1K79A 3JAMZ 3ELKA 1W7PB 2OQRA 2VBWA 5E20A 4RS8A 1PDNC 3I58A 2PEXA 2QENA 1Z7UA 5D6EA 1P92A 4XLPF 3F72A 4A6EA 3GO5A 4D0PA 1YW7A 2ZNZA 4A0XA 3K1PA 1UHMA 3CUQB 1Z6RA 2M30A 4EJWA 3MZHA 5FFXA 5K5RA 4EV0A 3GF2A 5E18F 1EH7A 2M1BA 3ZMZA 5ICCA 2A6HF 2YX4A 3HHGA 1SD6A 1R23A 2M87A 3SQNA 4A5NA 3ZMVA 1KU7A 1WRJA 2DQLA 1RUNA 3GZ6A 3CTAA 3ZMSA 4YFXF 4AD9A 4P55A 4BHPA 4LG0B 3B02A 5DDGA 2MC3A 3FWEA 3RKXA 2D1VA 2XKPA 3MAJA 1IF1A 2RGVA 3R6SA 4RAZA 4WXCA 4KYWA 1ZGJA 2W25A 3L09A 4MEXF 1KU9A 5LHHA 5HS8A 1BOAA 3V7CA 2L02A 2EFWA 1TBXA 3LA7A 4HLXA 2OA4A 1I27A 3RI4A 3RTRA 3C1DA 1T2KA 3DFGA 4OIPF 3BOQA 2WWYA 2HZTA 3DP7A 2QBYB 4B8XA 3LQQA 4R1HA 2IJLA 3T1BA 2RN7A 4L5JA 5DYMA 4WF2A 4LD5A 4KMUX 2YU3A 4WXDA 3V8KA 1MZBA 3CJNA 1IN8A 1V4RA 2W84A 2DU9A 2EV6A 2MH2A 2EWNA 1RZ4A 4IVNA 2ZFWA 2QYOA 1DPUA 4EMSA 3IRQA 5FLXZ 2QQAA 2O03A 3E97A 2F5EA 1IXCA 2DPDA 3F8CA 4ESJA 3QPTA 1YTYA 1ZRFA 4TV7A 5D5XB 2DO7A 1HKSA 3BJ6A 4CYDA 3GFJA 2YR2A 2ISYA 4OU0A 2HQRA 1S7AA 2A68F 5F64A 5DV5A 3FF5A 4H0EA 1E2XA 2JSCA 3WTWC 4G7HF 5JI6A 3SZPA 2F5DA 4HF0A 3T8RA 2FF4A 3RYRA 4A0YA 1XCVA 5D4SA 5CVIA 2FE3A 2QZ8A 5JR3A 1ZHFA 4HAMA 4UXNA 1OMIA 3QOPA 1BN5A 2EFQA 3RPQA 4Q4ZF 2QVOA 4MQ9F 3HSFA 5LEJA 1ONVA 2ETHA 4DQ2A 2TDXA 4NB5A 2Z9OA 2IT0A 4WX9A 1U5TB 1T39A 4RGXA 3GUDA 3RIRA 1ZRDA 3VB2A 1FX7A 4A5MA 1XSDA 2EV5A 2RV8A 4LLNA 5LRSA 1J75A 2P5VA 4G8XA 3JSOA 3E6BA 5F1RA 4G9YA 1P4AA 2VE9A 5FLXK 5L3CA 3DEUA 5L3DA 5FGMA 3DKWA 5BS6A 2RNJA 2FBHA 4I09A 1LDJA 3ZMTA 3F8NA 2ACJA 2MH9A 2P4WA 4OINF 1F5TA 3QU3A 1FYKA 2V6CA 3GYHX 2HGCA 2J5OA 2GA1A 3IKVA 2XASA 5DCMB 3N97A 2L54A 1O7LA 2L4AA 4IF4A 3I5UA 3WTSC 1FBUA 3P9IA 1KU3A 4EGZA 5HDGA 1ZRCA 3K69A 4L5IA 3F8FA 4CHUA 3ABUA 5K5OA 1DPRA 1RIOH 1KYZA 4P96A 4HDUA 3CDHA 1P4XA 3ROUA 2HFHA 2MA3A 4MGRA 3BY6A 3PQKA 1HKTA 2IRFG 3K1MA 4UVBA 1JHFA 4OIOF 1QO0D 1F1ZA 1F4KA 2PMUA 4I02A 4BXUA 3TDZC 4LB6B 4G6DA 1FZPB 3QAHA 2UZKA 1U78A 2HKXA 2OD5A 3P7NA 2OAZA 2O8XA 2KJBA 2FNAA 3M8FA 4G7OF 3GW2A 4HX4A 3V7SA 5H6RA 4PGHA 1A04A 2UWMA 2G9WA 4KMFA 3H3ZA 1LQ1A 1EH8A 4P9UA 3GXOA 3KP4A 4OIQF 3QP6A 3IC7A 2ZO4A 5AONA 2A3SA 4ZYEA 3MWMA 3E6DA 3IWFA 1IN6A 3TO6A 1W5SA 2EA4A 3HSEA 2CYYA 3BROA 4O6JA 2EFOA 2DAOA 4G6QA 5D5WB 4KDPA 3REOA 3C7JA 4RGSA 1P2FA 1XCBA 3NEUA 2XVCA 3IHUA 3HUGA 4KIGA 2RKHA 2HYGD 1U6GA 2ZMEB 4ASNA 2HTJA 2BYVE 3L2CA 4EVIA 5H20A 4UHTA 1RUOA 1B6AA 2FA5A 4GCVA 4O5VA 4N9HA 2E1NA 2VC0A 3N4MA 1ZH5A 1PUEE 1FBQA 1UCRA 4BAYA 2XUBA 2XROA 1NHAA 3BP8A 4LG0A 5HLIA 4ZH4F 2KKOA 1R22A 2BV6A 3P9CA 2FQ3A 3HIFA 3T5XA 2XAHA 4AWXB 3KLOA 4YFKF 4LLLA 1IZ1A 3DPLC 4ZYHA 3ZPLA 1LNWA 1FSHA 1QQIA 4WCGA 3R61A 1XSVA 4KN4X 3I54A 3WTVC 3CO6C 2FOKA 3LSTA 2P6SA 1S6LA 5IT9K 3E5XA 1V3FA 4AIJA 1TW3A 4GXOA 2W24A 1FY7A 5TRDA 1I5ZA 4P9FA 3C18A 3IWZA 3KETA 4KNYA 4YG2F 3V8JA 1Z91A 5HLGA 2MLGA 3V7RA 1XGMA 3FXQA 3RJPA 3WTZA 1SD4A 1GHCA 4ZYDA 4KFCA 1JHHA 4LGWA 4UVAA 3IKTA 5E1WA 1PP7U 5ICEA 5LHGA 5DCFA 3ECOA 4PGGA 4L9NA 1IN5A 3LFKA 3ABTA 4RGUA 2Y48A 1YS7A 2DI3A 3K0LA 2W85A 3J80Z 4EM1A 1XGNA 4FT8A 4HF1A 3VODA 4XBFA 1B4AA 1IN4A 5ILVA 2HOEA 4RAYA 2ADUA 2X4HA 2FBKA 3ZQ7A 3BPVA 5J6XA 2Z3YA 4IRIA 2P5LC 1MJ9A 3I59B 2RDPA 1BJAA 2MBFA 3SFZA 4OMYA 2PI0A 3F22A 1FWZA 4EJVA 2EFPA 3FX3A 1SAXA 4I0AA 2F2EA 5JHUA 4HW0A 5E8GA 2ZBKA 1XN7A 1I1SA 5J8FA 1HW5A 3HOSA 1PP8F 2L4MA 4LFUA 3SZTA 3E5UA 3ERED 3DV8A 5CVVA 1FC3A 5D6FA 2XIGA 4HDVA 5LGUA 2K4BA 3KP5A 4I2OA 3H92A 2A07F 2KJCA 4M9ZA 2JTVA 4EJUA 2OZUA 3WE3A 2VBXA 4CO8A 4IPAA 3QP5A 3VOEA 5CVJA 5DD4A 1G4DA 1CGPA 4KA4A 4B09A 1WQ2A 4RB2C 5JFRA 3KZYA 3NRVA 2FBIA 1XGOA 5LRRA 2K86A 2HTSA 4YIFA 3F6OA 4WXHA 3GFMA 2ELHA 3KP3A 2Y0MA 1T38A 3MQ0A 4OOIA 3GVAA 3TOBA 5L3FA 3BWGA 1Z1DA 5HOOA 3J81Z 2EFNA 1B9NA 1LVAA 5HVQC 3VFZA 4PZJA 1ZG5A 2GXGA 1U2WA 2VBYA 3CLOA 2P7VB 4Y13A 2H6BA 4M6XA 2IA1A 3T0YA 4UV9A 1TTYA 3M7GA 2XRNA 2C6YA 1D3YA 2WV0A 3T8TA 4I01A 3FM3A 4EJTA 1J5YA 1XD7A 3I71A 4HQEA 1ZG1A 1R5GA 2G7UA 2VXZA 3I53A 5D4RA 2UXNA 2IP2A 5CVUA 1O3TA 3R0JA 1SFXA 5BMZA 4FX4A 3WU0A 2WC2A 4RB3C 5BOXA 1SD7A 1S7OA 1JXSA 3LQRA 1QZZA 3OV8A 2JT1A 2QUFA 3GX4X 1BIBA 3JAMK 3D0SA 2P7CB 4QWQA 4KIFA 4M6YA 2ZCWA 2VBZA 3L9FA 1ZARA 2AS5F 4UV8A 3HTSB 3WGHA 2IA0A 4NQWA 2DT5A 4ENKA 3EYIA 1O3SA 5L3GA 4U7BA 2V79A 3U9GA 1JE8A 4ZZDA 3BZ6A 4RB0A 2YSRA 2RC4A 5D8LB 3ULQB 4EJOA 3Q9VA 4HBLA 2VOOA 3DF8A 2ZXJA 3TGNA 1W5TA 1HQCA 1JGSA 1SMYF 2ESHA 1ZN2A 1IW7F 3MCZA 3TOAA 2VODA 1TW2A 4HZFA 4Q5SF 4M73A 1G3YA 4IXAA 3TKYA 1BI1A 1T6SA 2K7LA 1K78B 2HDCA 2M5WA 2FEZA 1G3TA 1SD5A 3I64A 3O2PE 2XKOA 5K5QA 2QBYA 1K78A 1IXSB 1YW9A 4HV5A 2E1CA 1IRFA 3FMRA 5CVRA 3RYPA 2R7FA 4U0VA 4GGGA 4ON0A 1YLFA 4FX0A 5H6QA 4ENNA 2A69F 1MD0A 3FXUA 2D1HA 1RI7A 4XRFA 2FXAA 4PCQA 1QGPA 3I4PA 2FRHA 4Q48A 4M72A 5KK1A 5BPDA 4HA8A 5EEHA 3G73A 5AIPA 2XAGA 5CLSA 4EM0B 5BQTA 2HR3A 5ICGA 1BC8C 4KUMA 4HYEA 4AIHA 2E7XA 3R4KA 1GXQA 3WTYC 2P5KA 2VT3A 1U3EM 1HW2A 2BBYA 4ENMA 4RGRA 5HDNA 1ON2A 3ZMUA 2H27A 2KRFA 1BI2A 2DK5A 2VONA 4CXFA 3JW4A 1ZAOA 4G94A 5E1XA 4Y17A 3FZVA 1AWCA 3J81K 1KYWA 2STWA 1YYVA 4FHTA 3WTUC 4M9SA 1YO5C 4KIBA 1FP1D 4R79A 1LJ9A 1ZGAA 3V4GA 2OBPA 3EETA 2O61A 2JRTA 3RPUA 4ENJA 2LSOA 4RB1A 1REPC 4S04A 2XAQA 1TLHB 4ZYGA 5DUIA 4N9IA 3J7AO 1FSEA 1IAWA 1XSXA 2A5YB 2FMYA 5ICFA 3KP7A 1S29A 4IHSA 4CGZA 1R1TA 3KFWX 4UVCA 3E6CC 2DLLA 2DFIA 2PBIA 5FD5A 3TO7A 3HSRA
chains in the Genus database with same CATH superfamily
5FD6A 4OAYA 6PAXA 2WY7Q 4XRMA 2IS1A 5FFZA 3FHZA 3LAJA 4N0BA 4L18B 2KZVA 1W1WE 3GLXA 4A12A 4OIRF 3P5JA 4DYQA 1D5YA 1L3LA 2ZSHB 2ZKZA 1ZLJA 3L2WA 2HXOA 2OV7A 3DKYA 4JBAA 3BR2A 1O57A 3K4KA 2CGPA 2V9KA 1NG7A 4A2UA 2KMUA 1U8RA 1EKEA 3EQLF 2GOXB 4WWCA 4YEJA 1VF9A 2X1CA 1TC3C 1I6XA 3K2AA 1QPMA 1SFEA 3H0GJ 2PLYA 3JSPA 4IRGA 2XAFA 1KQ8A 1ETQA 2KPMA 3CJRB 4I98B 2CH0A 4CH7A 4NC8A 1Y0NA 3IL2A 4F52A 2IVMA 4Y7NJ 2H09A 2ISZA 2V9VA 1J59A 1VQ4I 4A3KJ 1R00A 3OY9A 2W48A 3MN2A 1QRYA 1XMAA 3KZZA 4ZDOA 2ZSIB 3CP8A 5CJ9A 3H3VK 1F43A 5L3EA 3KP6A 4BJTA 5HLHA 4X6AJ 3HGGA 1FOXA 1VQKI 2STTA 3F21A 3WODF 3M8JA 4UY8I 2DW4A 4LMYA 1LUJB 2L5QA 2MD5A 5BNGA 1AA7A 3S2HJ 1LVKA 2QM3A 4L0YB 1B1BA 3EUAA 1V54H 1V5GA 3B73A 4IRHA 4E4HA 4HPQA 2Q2EA 3G3ZA 4RDUA 1VQ9I 1I3AA 4U0YA 5E3NA 2GA2A 1IRZA 1HOMA 1E0EA 1LEAA 1LDDA 1HA8A 3WG7H 2HVRA 3MZYA 3HBLA 2HXIA 2R7SA 2MABA 2EJRA 3KP2A 1IUFA 1LKXA 2CW0F 4CYCB 5DD8A 1USSA 3BTLA 4XN0A 5LHIA 3OYIA 4E7IA 1LFBA 2A6EF 3S2DJ 5E17F 1L0OC 2KIUA 3LSMA 4E7ZA 4YFNF 3GCMA 3ZQQA 4PFPA 2F5FA 3DLLF 2O0YA 3W6JB 3Q5FA 2MLKA 1FPQA 1B59A 2LFBA 1Y0UA 3GLLA 1X4OA 4A6DA 1VTNC 1HDDC 1POGA 3ZP5A 2PX9A 4HX7A 4IHXA 3JTGA 2ZJRF 4L9VA 4XLNF 3BDDA 1B72A 2IS2A 2ESNA 3M9AA 5E1ZB 2YX7A 1W7PD 1U0JA 2OPTA 3H3UA 4ESFA 4CZZA 2CSOA 1RETA 2QLZA 2X6OA 1VFCA 2JPCA 2LNBA 1H9TA 4NDLA 4BHCA 1SMTA 1OYIA 1D1BA 3LMMA 2WBMA 1Z67A 2MW8A 1BIAA 4RBOA 1S3JA 2JJ7A 3D5LA 4E7SA 3ERMA 2DFHA 3F23A 2LKSA 1IGNA 2KIQA 4L9TA 4BHBA 2CQ7A 3LA3A 4Q47A 2P8TA 3WE2A 4XRSG 5BPIA 4ZJZA 1MIJA 1T8IA 3E6MA 2AO9A 5J4YA 4E7KA 1M1EB 1JI8A 3FXJA 2E34A 3JRGA 1O3RA 3GTLJ 1MGTA 2DA3A 4IO9F 3RKYA 3HRTA 1FT9A 4FISA 2PQ8A 2X9DA 3SJMA 2CFOA 2DMTA 1BR1A 4AIDA 3QOEA 5EG0B 2EILH 2P81A 1IG7A 3MFKA 1S72I 5GADJ 5K7ZA 1P6RA 4KN7X 1A5JA 1F9NA 4QLCU 1IJWC 3PNTA 4BUPA 3KLNA 3GFIA 3KEQA 2H1KA 2A61A 4G7ZF 4W1UA 5F08A 3VYTB 1I39A 5ILUA 2K4JA 2ID6A 2ME0A 2EIKH 2VIXA 5F0CA 5FKKA 2VC1A 4D7MA 2H8RA 1NTCA 3CF2A 1STZA 1TNTA 1TP4A 3A1YA 3CZ6A 1BI3A 4AIKA 4Y3OA 1CF7A 1AU7A 1DU0A 4GYIA 1TWHJ 1LEBA 2LLKA 2BEOA 5GAEJ 5IT9Z 1WPKA 4BH9A 1WHUA 4F91B 3QRFF 2BHYA 3FM5A 3GTMJ 2FU4A 1BBYA 2M45A 2NAZA 4UUSA 3Q0WA 1FEXA 1MKMA 3DTKA 4BY7J 4GYGA 3K70D 2R7OA 3L00A 3P9KA 4ETSA 1Z77A 3ML6A 1H9GA 5GP9A 1GXPA 3DBRB 2KFDA 2Z5UA 5K7FA 2G0EA 2XF6A 1FLIA 2GIVA 1AOYA 1UFMA 1HW1A 2JRMA 2EH3A 3MMYB 5F27A 3CMYA 2VE8A 4E70A 4PFOA 4UNOA 1FOWA 2VN2A 5E3MA 1W0TA 1MDMB 3IAS2 4UUTA 3CUQA 3O6BB 1BI0A 1TL8A 1IV6A 2NVQJ 2Y9ZA 4AM3A 4RAGA 1FOKA 2QQ9A 2QWWA 2UV1A 4NBQA 4D9JA 3C3WA 3GFLA 3K6GA 1VQ7I 4A0ZA 1I1GA 3HRSA 1LDKB 2M8GX 3VYRB 2GXAA 3BPXA 3CUOA 1EH6A 2YS9A 5CQEA 5LLQA 3R0AA 3C2GA 1HKQA 1Y56A 2CV1A 5ED4A 2IA2A 3DLAA 2IBDA 2CU7A 4L9JA 4IL6C 2HOAA 4EM2A 3VSKA 2VKEA 4BXFA 2LYCA 4KICA 4MHGA 3S3NA 4QIWN 2EBIA 2Y9YA 5LGNA 2JZYA 5FB2A 1D5VA 2OQGA 2KT0A 2BE5F 4CCLA 3ASNH 5J8CA 4GDFA 3OYEA 4LB5A 2YU9J 3W2VA 2L3DA 4M6VA 3LWFA 2XV4S 1MJAA 2XPWA 3HOUJ 3UNGC 2Z2SB 5JHFA 4DNCA 3A01B 4MTEA 4PJJA 3VEPA 2ELJA 3L2VA 2PG4A 5GTHC 2DJIA 1XGSA 5HNFA 4QPQA 3RPUD 3DEEA 1D8KA 3DQVC 5ILSA 3TW7A 2V1UA 4A93J 1WI9A 1DUXC 2XGDA 2R0QC 1ZREA 4EEFG 5FO5A 1ETWA 3SXYA 2K5CA 1AKHB 2QGUA 4A3LJ 2Y0SN 1J7KA 1R4NB 4A3BJ 4JQFA 1IXRC 2I5UA 3OOPA 1OKRA 2M7AA 3VWBA 1NG6A 5IPAA 4C3IJ 1VQLI 1XB4A 4C3HJ 1LB2A 3FXKA 2HYFA 1JUSA 5TGTA 1MW7A 4CCNA 3OYMA 1JT6A 1R36A 2LDUA 3CCSI 1A6QA 3LAPA 4XICA 2NVYJ 1YJWI 1Z21A 2W7NA 2FD5A 1MMAA 3UKGA 4MFEA 3BT9A 3MD2A 2XGXA 4BL0B 4MTDA 2W57A 4XKVA 2LKPA 3S3MA 1TWCJ 3WGGA 3JRCA 1K83J 1TZLA 5AIQA 1SANA 1J2XA 1MNDA 2JK3A 3F8BA 3F0CA 3QPHA 3L2RA 3I0TA 4A3CJ 1ENHA 2BXZA 3DPTA 1T08B 4G6TB 2PMHA 1P7IA 3ZMDA 1GVJA 2X1EA 1MBHA 1R7JA 2UXXA 2WTEA 3C2HA 2BGCA 3M1EA 4C30A 5A2QZ 1N77A 3WTTC 3HOVJ 2IAIA 1R58A 3CESA 3KIOA 1YG2A 2D45A 1OQYA 2MSYA 5CKTA 1FP2A 1TWGJ 4IOAF 2G7HA 1RKWA 3ISPA 4AVPA 3RKQA 4O3MA 3PFIA 5ERIA 4BY1J 4HNVA 3BCBA 3HJEA 5FKLA 4MLOA 3COAC 2FOWA 1TQMA 3G1LA 3AKZA 3R60A 3V8LA 1USTA 2BY0A 1N78A 3FMQA 3FISA 4S05A 2R7RA 4YRVA 2OZ6A 3TDUC 4J19A 1SFKA 4U87A 4U0WA 3K2ZA 4HQMA 3D1NI 1AHDP 1MMGA 3QPSA 2Z16A 1W7PA 4MQVA 3VSLA 3NARA 1FTTA 2PN6A 1X3ZB 3GEZA 2XAUA 3SYTA 4XSZF 4Z2YA 1H0MA 4C3JJ 3FHNA 2DBBA 3J7AY 3CO7C 3ECHA 1Q1HA 3I59A 3BR6A 3IP4B 3CF5F 2L01A 2ID3A 2KIFA 1B8IB 2CG4A 1JKQC 2HEOA 2F5CA 4B44A 4K2EA 2DPUA 3NWSA 1W4MA 2M0MA 2HPIA 3HYIA 1OR7A 3RDIA 4ZDLA 1S8NA 2KIMA 4GRIA 3ZQLA 2J5PA 2WY8Q 1YW8A 1CF7B 3IRRA 1XDUA 1MNEA 4M74A 2V1DA 2Q2EB 1FYLA 1DQUA 3SHFA 2X6XA 1YIJI 4PSWA 1IRGA 1BR2A 2E1MC 2LF7A 3QU6A 2HWVA 3H36A 2R7DA 1D0XA 5IT3A 1XMKA 4V2FA 2R5YB 3FBIB 2P6TA 2AHQA 4E7JA 2DJNA 4GO1A 1ACIA 2NYXA 4ZZLA 2NNYA 4L0ZB 1U5TA 3ZXSA 2H6CA 4D7NA 4IQ4A 4CCKA 1E17A 4BE0A 1FIAA 2JUGA 2Q0OA 2DCEA 1J0RA 3GTJJ 1EF4A 4ZDPA 1TQPA 3CCVI 2PJPA 4Y15A 1YFHA 2WAEA 2CUEA 2BZTA 2OU2A 4BS9A 3LSIA 3HOTA 2O3FA 4I0BA 3WU1B 3F6VA 2JWTA 4DYRA 4XSXF 2VQLA 2GQQA 4N4OB 2O8KA 5HDKA 1QPIA 2UUZA 3HDDA 5LEKA 3RQ4A 1ON1A 4F55A 3HRUA 4BKXA 3BJAA 2EB7A 1QBJA 2IS6A 5B66C 2HKOA 1Z05A 1HBXG 4PSXA 4DBRA 2XF5A 3CDIA 1EJ9A 3ABLH 4C2MJ 2M3AA 2X0LA 4F7ZA 5EGOB 2NXNB 4AUXA 3M3YJ 2YPRA 1IUYA 1TQIA 3HZJA 3U1KA 4HF2A 2CO5A 3D5RC 2M8EA 5D5VB 1B8IA 4CSWA 3FMSA 4I99C 3PIPF 5E79C 1WWXA 3TL4X 4MNUA 1DDNA 3CCLI 3H5RA 4FTHA 2VL8A 2LF8A 3LSKA 2GZWA 5HS7A 3OIPA 3HC7A 3FXRA 4BEHB 4FQGA 2GWRA 5GPCA 3BZKA 1KQ0A 4HOBA 3NQOA 1RNLA 3ZQFA 1OCOH 3MKYB 3OMYA 3PQJA 1ZKGA 2MD0A 5FROA 4UUVA 1KA8A 3CUQC 4RLQA 2LC2A 3K1NA 1KZHA 1RESA 3K9TA 3BJOA 3F3XA 3WGIA 3EDPA 3W3CA 5DEQA 5KCMA 3DXJF 4IJAA 1X3UA 3U21A 2JVGA 1HSJA 2QQBA 1YRNA 2VXDA 1X4PA 1IN7A 4P5OA 2HPMA 4M9XA 3AAFA 1ZQ3P 1JUPA 3QQAA 2M2EA 1VQMI 2E5ZA 5FKOA 4HX8A 2EQRA 1OCTC 4XN3A 1YX5A 3CCQI 1ZLKA 3SDBA 3CJTB 2NRAC 1K7AA 1G3SA 5DCMA 1VQPI 5LFAA 4CICA 4A3FJ 1P7JA 2CQKA 2KRHA 2LMDA 1KONA 2VQGA 5E3OA 2FMLA 2NNNA 1U5TC 1WSUA 1FNNA 2CFXA 3HUGB 1SFUA 2VKVA 5TJJA 1Z3XA 3M07A 3RKWA 1QZYA 1X2NA 2EK5A 2HOTA 4F3QA 2VPRA 3WG9A 5DS9A 2PFBA 4GFBA 1XDSA 1YIOA 3EYYA 4LJZF 3PIOF 3JRIA 1BW5A 4M71A 2WAQA 4XIDA 1WJCA 2IW5A 1FYMA 1SFOJ 5EEGA 1WZ2A 2VOPA 3E5QA 2LK2A 1UHWA 4R8HA 5JVTA 5EYRA 3ZGKA 4MEYF 3F8MA 5JLWA 3I9V2 1G3WA 5J1RA 3KE2A 4BQAA 1ULYA 2Z33A 3HXLA 1HXDA 3PO3J 4BNCA 4KT5C 2Y75A 2CQQA 1FBSA 5J47A 3U2RA 2H94A 3OL4A 3L1PA 1IRXA 3ZN0A 2K27A 4LK1F 1T98A 1T0FA 2DN0A 3OYKA 2ZXIA 4IEJA 2COMA 1DP3A 4LITA 2BVMA 2Q8KA 3CMAI 2OTLI 2R7ZJ 4EGYA 2RQPA 1B9MA 3CC4I 2KDZA 2L2OA 1MBGA 5D5UB 2WAQN 1OYYA 5CQGA 2GXBA 2MFZA 5EJCA 3I56I 3L7WA 3O3KA 1W36D 5LBQA 1MH4A 1RPWA 2EA2A 4OMZA 2LKXA 2K02A 3GZ5A 4M3GA 2Z99A 2VPLA 1DP7P 4ZTJA 4IHTA 2IGMA 1LPQA 1WJAA 1RR7A 2ZJ2A 5HS9A 3E3VA 3K4JA 1O7FA 2AQEA 1O3QA 1P4WA 4WK8F 1SAUA 4CDGA 1YS6A 3HTUA 4HV6A 3OYFA 1GUUA 2LBFB 2AXLA 5H2FC 4YELA 2D2WA 1R5HA 5IYCJ 2VT2A 2WA0A 1ZYRF 2E5NA 5F6FA 1SVMA 2AXTC 1Z6TA 2XHKA 3J80K 1BM9A 4N4NB 2HS5A 1X58A 4BXXJ 3CCJI 5A2QK 2IPQX 3WU2C 1UB9A 4B47A 2JPBA 2FNPA 1LE8B 3ZQHA 2V1XA 3DBLB 2CWEA 2E7WA 4DJAA 1WKMA 3MEXA 3I55I 3MZ8A 2CJJA 2L9RA 1R1UA 5FLVA 5IOZA 3WTXC 2NVUB 3X2QH 1E3PA 2DQRA 2BY3A 4A3IJ 4XLEA 2ZMEA 2DTRA 3FKIJ 3H35A 2EIJH 3NWTA 4I76A 2LRDA 1D8JA 4S0HB 2F6CA 3AFHA 1XS9A 3W6KB 1QNTA 1KU2A 3M8EA 5DUKA 4IZZA 2ZNYA 1Y1VJ 1K6OA 3HRMA 3TQNA 1YQAA 2EIMH 2HQNA 1TNSA 3K7AJ 4LLGF 1PUFB 4NHJA 4BJ5C 2R3SA 3QYEA 2NS0A 4I7HA 1OPCA 4BYYA 3H5AA 3HOWJ 3JTHA 4J00A 3ZCOA 3KCCA 5KVRA 2XAJA 4P1WA 4PDKA 5CYVA 2EV0A 1I3QJ 2EZKA 2B0LA 2AQFA 3IAM2 4LK0F 4JK1X 3PNYA 2FUG2 2F4OB 1TT0A 5EGOA 4YIIA 3CLQA 4MIMA 2GAUA 4EQQA 5B1AH 3TP3A 4U88A 4X0GA 5K1YA 3U1DA 1NH3A 1X1PA 1ZG3A 2VJIA 4CUGA 3OYDA 1BC7C 2XRLA 1HSTA 1N75A 4IQJA 2K9SA 4RM2A 2O7OA 4IX7A 5L3BA 1UG0A 1X2MA 2RREA 4B4CA 1G6NA 1KQ9A 1KGSA 2LR8A 2F48A 2Y30A 3KEOA 3QWLA 3G2BA 3HHHA 2DK8A 5E8IA 3HL2A 1Z9CA 1YJNI 1J9IA 3Q9SA 1C0WA 2IEKA 5EF6A 2MGQA 1R1VA 3LA2A 3BR1A 1MJBA 4W97A 5D8KB 2KDOA 5FRNA 3ZN1A 5LGTA 1EV7A 3EUHC 1MDMA 2A05A 3LSJA 1OYWA 3EUHA 2RVCA 3GWZA 2O6GE 3QYBA 4HLYA 3S2WA 1SVLA 3TO9A 4ANJA 4ESBA 2OJED 2FSWA 1ODDA 4U7DA 2Z1DA 3CCYA 1K79A 1V5EA 1Z7LA 2VASA 3JAMZ 3ELKA 1W7PB 2BVLA 1YHQI 2OQRA 2VBWA 5E20A 4XRSA 1OCZH 1ORKA 4RS8A 1TT5B 3GZNB 1PDNC 1ETYA 3I58A 2PEXA 4F93B 2NOGA 3GMEA 5M5WJ 2QENA 1Z7UA 5D6EA 1P92A 4XLPF 3F72A 4A6EA 2K3PA 3GO5A 3S1QJ 2X6WA 2EINH 3B6CA 2E60A 4D0PA 1YW7A 2ZNZA 4A0XA 1YE9A 3K1PA 1UHMA 4XOTA 3CUQB 1Z6RA 2M30A 4XKCA 4EJWA 3MZHA 5FFXA 3HKZN 3AL0B 5K5RA 4EV0A 1LE8A 3GF2A 5E18F 1F36A 2VB6A 2RNGA 1EH7A 2M1BA 1T56A 3G1OA 3ZMZA 5ICCA 2A6HF 2R7UA 2YX4A 2A5WA 3HHGA 3V42A 3VYSB 1SD6A 1R23A 1I6HJ 2M87A 4NUBA 3SQNA 4A5NA 3H9JA 3ZMVA 3MKWB 1KU7A 1WRJA 2DQLA 3OS1A 1RUNA 3GZ6A 3CTAA 3DU5A 3ZMSA 2Y31A 3OR1C 4AD9A 4YFXF 4P55A 4BDYA 4BHPA 4LG0B 4Z6YA 3B02A 2R7WA 2PMZA 5DDGA 2MC3A 3J7YJ 3FWEA 1WH7A 3RKXA 2D1VA 5M3MJ 2ZJQF 2XKPA 3S3OA 4XR6A 3MAJA 1IF1A 2RGVA 3R6SA 4RAZA 4WXCA 1UMQA 4KYWA 1ZGJA 2R7TA 2W25A 3L09A 2XGCA 2X1DA 4MEXF 3I4MJ 1KU9A 3HGYA 5LHHA 5HS8A 1BOAA 5F0FA 3V7CA 3NAUA 2CQNA 2L02A 4DZJA 2EFWA 1TBXA 3LA7A 1WH5A 2LTPA 4HLXA 2OA4A 1I27A 5EEAA 4HG2A 3RI4A 2IS4A 3RTRA 3C1DA 1T2KA 3DFGA 4OIPF 3BOQA 2JMWA 2KZGA 2WWYA 2QQ8A 2HZTA 1ZR4A 1FIPA 2JQ7A 3DP7A 3LSRA 2QBYB 4B8XA 3LQQA 2KHMA 4R1HA 3JRDA 2IJLA 2DT7B 3T1BA 2RN7A 4L5JA 4X1EA 3TW6A 2ELKA 5DYMA 5J1UA 4WF2A 3CJQB 4LD5A 1UG2A 3Q0UA 3OIOA 4KMUX 1WCMJ 2YU3A 4WXDA 3AG2H 1MZBA 3V8KA 4BJ6C 3CJNA 2QSHX 2CRGA 3KX2A 1IN8A 3DKXA 2MYSA 3SEQA 4JYKA 1V4RA 2PJRA 2HQAA 4I6ZA 2W84A 2DU9A 2EV6A 2MH2A 2EWNA 1RZ4A 4PJNA 4IVNA 2ZFWA 2QYOA 2DOEA 2R93J 1OLTA 1DPUA 4EMSA 2K40A 3IRQA 5FLXZ 2QQAA 2M4GA 2O03A 3G4SI 5KAFC 1JJ8C 2ZC2A 4NC7A 2W82A 3E97A 2F5EA 3K10A 1IXCA 3JR9A 1K4TA 2DPDA 5CPRB 2COBA 3F8CA 4J01A 4ESJA 3QPTA 1YTYA 1UHSA 3BZCA 3RZOJ 1ZRFA 4TV7A 5D5XB 2DO7A 1O4XA 1HKSA 3BJ6A 3RCOA 4CYDA 3GFJA 3GTOJ 2YR2A 3QYFA 2HQ5A 2ISYA 5IYDJ 4OU0A 2HQRA 1WGXA 3S93A 1S7AA 2A68F 1R6RA 5F64A 3VPRA 5DV5A 2VKHA 2DYSH 3FF5A 4PK4A 4H0EA 1E2XA 3RZDJ 2JSCA 3WTWC 4G7HF 5JI6A 3SZPA 2F5DA 4C2TA 4HF0A 3T8RA 2FF4A 3FK7A 4CZCA 3RYRA 4A0YA 2WV1A 3OYLA 1XCVA 5D4SA 5CVIA 2FE3A 5FKNA 1JTYA 2QEXI 2QZ8A 5M5YJ 5JR3A 3VYUB 1ZHFA 4HAMA 2B9SA 1G8XA 1S5LC 3HKZA 2DT6A 2X85A 1VQNI 4UXNA 3L2UA 1VQ6I 4BDZA 1GV2A 1OMIA 3O8HA 1OJLA 3QOPA 1BN5A 2EFQA 3BG3A 3RPQA 4Q4ZF 2E2JJ 1U8BA 1MH3A 2FQ4A 4F92B 2QVOA 4MQ9F 2CMPA 3FKJA 3HSFA 5LEJA 3BR3A 2Y69H 4E6KG 1ZR2A 1ONVA 2ETHA 2HOSA 4AVZA 4DQ2A 2NS7A 2TDXA 2OCEA 1OR7C 4NNJA 2E19A 4NB5A 1XG1A 1K6YA 2Z9OA 2IT0A 4WX9A 5IP7J 2DA6A 4MFDA 1U5TB 2DYRH 1T39A 2HU9A 4RGXA 2O5RA 2QSGX 3GUDA 3RIRA 1GDTA 1ZRDA 3VB2A 1FX7A 2HDWA 4A5MA 1XSDA 3IV5A 5EDNA 2H8WA 1WJ5A 2Y2ZA 2EV5A 2RV8A 2BY2A 4LLNA 5LRSA 1S7EA 1J75A 3RQIA 2L9VA 2DMQA 4XONA 2LP0A 2LVSA 3AL0C 4AU7A 2K9MA 2E1OA 3GTPJ 2P5VA 4G8XA 3JSOA 4E7LA 3E6BA 5F1RA 4HSRA 3KPHA 4G9YA 5B5EC 2V1NA 4G12A 2GM4A 1P4AA 9ANTA 2VE9A 1XPXA 5L3CA 3A02A 5FLXK 3K4CA 4KISA 3DEUA 5L3DA 1V5FA 3DKWA 4FE4A 1E3HA 4LG3A 5FGMA 5BS6A 1SEUA 2RNJA 2L7FP 1Q1VA 2FBHA 2XB0X 1UELB 4XL9A 2NVXJ 4ITVA 4I09A 3OYNA 1LDJA 3ZMTA 2MC4A 4UB6C 3F8NA 1MMNA 2MH9A 2P4WA 4OINF 2ACJA 3OYCA 2M0CA 1F5TA 2D5VA 3IUOA 4BQQA 4DZPA 3QU3A 1FYKA 2V6CA 3GYHX 3D5SC 2HGCA 1QHGA 2J5OA 2GA1A 3IKVA 3CCMI 1R9TJ 3A0BC 1QVTA 2XASA 5F0HA 1WVRA 3EPZA 1H88C 5DCMB 3N97A 1MBEA 1W0UA 2CS3A 3A2KA 2L54A 1O7LA 4BQOA 3MKZA 2L4AA 4IF4A 2VKDA 3I5UA 4B48A 1YI2I 3WTSC 1FBUA 3P9IA 1KU3A 4EGZA 4XLCA 5HDGA 4KITB 1FMWA 1ZRCA 3K69A 1OISA 4L5IA 3F8FA 3JREA 4CHUA 2PMZN 3ABUA 1DPRA 5K5OA 1RIOH 1KYZA 4P96A 1B72B 1VQOI 4HDUA 3HOXJ 3HPGA 3ZQIA 3CDHA 1P4XA 2M34A 5GPAA 1WI3A 2QA4I 4XLFA 4BBSJ 3ROUA 1JKOC 4D1QA 2HFHA 3A0HC 1FTZA 2MA3A 4AYBA 2W1OA 4FETA 1ETVA 3ZOBA 2CUZA 4II2A 4MGRA 1HCRA 3QPLA 3BY6A 3PQKA 1HKTA 2IRFG 2DA4A 3K1MA 4UVBA 1JHFA 2GLOA 4PJMA 2V7FA 3JRAA 1U9OA 4OIOF 1QO0D 1F1ZA 1F4KA 2OF7A 2PMUA 4I02A 4BXUA 3TDZC 4OAZA 1P9QC 4LB6B 4G6DA 5TISC 1FZPB 3QAHA 2UZKA 1I50J 1U78A 2E71A 2HKXA 2LBFA 3LSHA 2OD5A 3P7NA 4JP0A 2OAZA 5GTIC 2O8XA 2KJBA 4DYCA 2FNAA 3M8FA 2KRCA 1Y8QB 4QTRA 5C4JJ 4G7OF 1ZELA 3GW2A 4HX4A 3TP0A 3V7SA 5EZHA 4FCYA 1HDPA 1J09A 2R5ZB 3TEDA 5H6RA 1BW6A 4PGHA 2F5VA 5JLXA 4AC0A 1A04A 2ME6A 1K61A 1RKTA 3BLYA 2UWMA 2G9WA 4KMFA 2PJRB 3HEFA 3H3ZA 3K4BA 1EH8A 4P9UA 1LQ1A 3OL3A 3GXOA 3OSFA 4A3JJ 4RAFA 3KP4A 4OIQF 3IH2A 3QP6A 1EA3A 2V26A 3IC7A 4PUSA 4IHVA 2K9NA 2ZO4A 1RRJA 1BR4A 1OFCX 3H1CA 5AONA 1YX3A 1DGWY 2A3SA 2DMUA 3MWMA 4ZYEA 2HI3A 3E6DA 3IWFA 1IN6A 3TO6A 1W5SA 2EA4A 3HSEA 2CYYA 4BU2A 2Y0SA 3BROA 4O6JA 2EFOA 2DAOA 2I8DA 4G6QA 5D5WB 3FXLA 2JN6A 4KDPA 3REOA 3C7JA 3A4CA 2A6TA 4H4KC 4RGSA 1QHHD 3TMOA 1P2FA 2V4JC 4A3GJ 1XCBA 4A69C 5IP9J 3NEUA 2XVCA 2CUFA 3IHUA 2VI6A 1GV5A 4UUSB 3OWTA 3K70C 2R7QA 3Q0VA 3VDXA 3HUGA 3LOCA 4KIGA 2RKHA 5F1JA 4XLAA 2HYGD 4CA0A 1XTAA 3GTGJ 4B43A 2CV2A 1U6GA 4BE2A 1R71A 2ZMEB 3EUKL 1YOVB 3N05A 4ASNA 2HTJA 2BYVE 1A6IA 3LFUA 3L2CA 4EVIA 3PL8A 5H20A 4UHTA 3MKLA 3GTQJ 2DMNA 1RUOA 2E1MB 5HLTA 1WJEA 1B6AA 4BACA 2FA5A 2K3FA 4GCVA 4LIUA 4O5VA 4N9HA 2XSDC 1YITI 2E1NA 2VC0A 3N4MA 4YIRX 1ZH5A 5J1YA 1PUEE 5M3FJ 1FBQA 3S32A 1UCRA 4BAYA 3SEZA 2XUBA 2XROA 1NHAA 3BP8A 4LG0A 5EG0A 5HLIA 4DGWB 4ZH4F 2KKOA 1R22A 2JSPA 4JOMA 2BV6A 4IHYA 3S1NJ 3C2BA 3P9CA 2FQ3A 3HIFA 3T5XA 1GT0C 2XAHA 1R4MB 4AWXB 2K85A 4XKWA 2I10A 3KLOA 4YFKF 2GOMA 3AG1H 4LLLA 1CQTA 1IZ1A 1N25A 3AG4H 3DPLC 4ZYHA 3ZPLA 3BR5A 1LNWA 4KJZA 3G6EI 3ZQCA 1FSHA 1QQIA 2DA7A 4WCGA 3R61A 4CCOA 1XSVA 3CQZJ 3K4MA 4KN4X 3I54A 3WTVC 3DU6A 3CO6C 2FOKA 2IGNA 2BW3B 3LSTA 1W5CC 1VNDA 5KHDA 1QVUA 3BG9A 3O8GA 3S15J 2P6SA 3HM5A 3PM1A 1S6LA 5IT9K 5B1BH 3E5XA 1V3FA 1X19A 4AIJA 2QCOA 1TW3A 4GXOA 2RQQA 1PJRA 4QPOA 4IKFA 2W24A 1FY7A 2DXIA 1IO2A 5TRDA 1I5ZA 2DA1A 4P9FA 3C18A 3IWZA 4Y4RA 3KETA 4FE7A 1TWAJ 4KNYA 4YG2F 3JCUC 1U9NA 3V8JA 1Z91A 4NQWB 5HLGA 2XB5A 1HC8A 3S14J 2MLGA 3V7RA 1X1DA 1XGMA 3FXQA 3RJPA 3WTZA 1SD4A 1GHCA 1NK2P 4ZYDA 4KFCA 2EZHA 1JHHA 4LGWA 2DMPA 4UVAA 4CCMA 3OS2A 3IKTA 2L9NA 3BTJA 5E1WA 1BOBA 4XORA 1PP7U 1RR8C 2FJ1A 5ICEA 4RMNA 3CDLA 4C2UA 5C3EJ 5LHGA 1UZCA 2HDDA 2XPVA 1TWFJ 5DCFA 1Y1WJ 2F4IA 3ECOA 4L9NA 1IN5A 2VQCA 3LFKA 4PGGA 2KISA 2VLAA 3ABTA 4RGUA 2Y48A 3IH4A 3CCUI 1YS7A 2DI3A 5B3SH 3K0LA 2W85A 3J80Z 2O9LA 4EM1A 1XGNA 4FT8A 3KZIC 4HF1A 3VODA 1T0FC 4XBFA 2X51A 3BC8A 1B4AA 1IN4A 5ILVA 2HOEA 4RM3A 4RAYA 5E3LA 2ADUA 2X4HA 2FBKA 3ZQ7A 3BPVA 5J6XA 2Z3YA 3OYJA 2V9PA 5IYBJ 4IRIA 2P5LC 1MJ9A 3CMMA 3OSGA 3I59B 3M4OJ 2DFFA 2VJJA 2E2HJ 2R7VA 2RDPA 1BJAA 1GLNA 3F9KA 2MBFA 2XF7A 4V2GA 1IC8A 2F4MB 3S17J 3SFZA 4OMYA 2PI0A 3F22A 1FWZA 1VZ0A 4EJVA 2EFPA 4BEHA 1MSEC 3ZQGA 3FX3A 3W2AA 1SAXA 4I0AA 2F2EA 4M3EA 4BBRJ 5JHUA 4HW0A 2B7EA 5E8GA 1APLC 2JUCA 2ZBKA 1XN7A 1I1SA 2ICWG 4XQFA 3GBGA 2ZXHA 3BQYA 5J8FA 2R92J 1HW5A 3HOSA 1PP8F 2L4MA 4IHWA 3DTIA 3W6VA 4LFUA 3SZTA 3E5UA 2E35A 3ERED 4HNUA 4LOCA 3KYCB 3S1RJ 1E3OC 2HYJA 3DV8A 2KQRA 2XGEA 5CVVA 1FC3A 2CQXA 1ETKA 5D6FA 5FLMJ 2XIGA 1FOYA 4HDVA 5LGUA 1YRNB 2E2IJ 4RA2A 1WJFA 2ZMEC 2VUMJ 2K4BA 3KP5A 1VI0A 4I2OA 3H92A 2A07F 1A36A 2EZIA 2KJCA 4M9ZA 2JTVA 4EJUA 2OZUA 3WE3A 1D0YA 1UAAA 2R4GA 2VBXA 3ASOH 4CO8A 4IPAA 3QP5A 3VOEA 4V19K 5CVJA 5DD4A 1G4DA 1CGPA 4KA4A 4B09A 1WQ2A 3DEWA 4RB2C 5JFRA 1X3WB 3KZYA 3UR3C 3OYGA 3NRVA 3H5NA 2FBIA 1XGOA 3H9GA 2R5YA 3OYBA 2QF7A 5LRRA 1Y39A 3J7ZI 5C44J 3S16J 2K86A 4IOCF 2HTSA 4YIFA 2XDVA 2LOOA 3F6OA 4WXHA 1DU6A 4JX5A 3GFMA 2ELHA 3AG3H 3KP3A 1JGGA 5EZGA 2Y0MA 2L7KA 2NVTJ 1S9HA 2L9SA 2VJ5A 4Y33A 1T38A 5FKMA 3B6AA 2X48A 3MQ0A 5HODA 3ABKH 4OOIA 1ERDA 3GVAA 4A3EJ 1Y6IA 3TOBA 5L3FA 3GTKJ 1MMSA 2TRTA 3PJRA 3W2WA 3BWGA 1Z1DA 5HOOA 3TBIA 1QZEA 3J81Z 2LY9A 2EFNA 2DA5A 1YJ9I 2IGKA 1B9NA 1LVAA 1PYVA 1XMXA 5HVQC 3VFZA 2W00A 2H1LA 4PZJA 4B1RA 4AYBN 2L0KA 4XOPA 1ZG5A 2GXGA 2BOLA 2M9HA 1U2WA 2VBYA 3CLOA 1R49A 2JA6J 2P7VB 2LG4A 3MVPA 4Y13A 2KP6A 2H6BA 1XC5A 4M6XA 2CW8A 1X1AA 4C9YA 2IA1A 3ONQA 4UV9A 3T0YA 3L2QA 2WB1N 1TTYA 3M7GA 2LREA 2XRNA 1A35A 2C6YA 5LD2C 1D3YA 2WV0A 3ESWB 3T8TA 4I01A 3FM3A 1MBJA 4EJTA 1J5YA 1XD7A 3ABMH 3I71A 4HQEA 3KYDB 4HNTA 1ZG1A 1R5GA 2G7UA 2VXZA 3I53A 1X1CA 2R5ZA 5D4RA 2UXNA 2IP2A 2TCTA 3JRHA 1ITYA 5CVUA 2LY1A 3PUBA 1FJLA 1O3TA 2M7BA 3R0JA 1SFXA 5BMZA 4FX4A 3WU0A 2WC2A 4RB3C 3LL7A 5BOXA 1ZTRA 2VJ4A 3LSPA 1SD7A 1S7OA 2BY1A 3E1SA 1JXSA 4OWRB 3LQRA 2ZFUA 1QZZA 2NOJB 3WHBA 3OV8A 2JT1A 2QUFA 5J40A 3GX4X 2JA8J 1BIBA 2QKLB 2EZLA 3SZGA 4JX6A 3HB9A 3JAMK 1OCPA 1IDZA 2WB1A 3D0SA 2P7CB 2P0WA 5F04A 5IY5H 3CP2A 4QWQA 4KIFA 4L5EA 4M6YA 4QSHA 3E7LA 2ZCWA 2VBZA 3L9FA 1MMDA 3HOZJ 1ZARA 2AS5F 2DDAA 3LNQA 2HVSA 3PSFA 3OIQA 4UV8A 1AKHA 3ZRGA 3HTSB 3G71I 4LIVA 3IH3A 3WGHA 4DOZA 1OCCH 1LFPA 2BXYA 4NC6A 1JUMA 1X1BA 1MBFA 2IA0A 4NQWA 2DT5A 1D0ZA 2KLOA 1K4SA 3QODA 3I3LA 4ENKA 3G1MA 3EYIA 2IGOA 2K9LA 4DBQA 2XC7A 1O3SA 1MBKA 5L3GA 1HF0A 4U7BA 2MG4A 4ZTFA 2V79A 3U9GA 2Q1ZB 1JE8A 4ZZDA 2WADA 4A3DJ 3BZ6A 4RB0A 2YSRA 2RC4A 2DOAA 5KAIC 5D8LB 3FK6A 1FMVA 3ULQB 4EJOA 5KNLA 3Q9VA 5GAHJ 2YUSA 4HBLA 2VOOA 3DF8A 4B3AA 4XK4A 2ZXJA 3TGNA 1W5TA 3CC7I 2BW3A 1ETXA 3PFYA 1MSFC 2QSFX 1HQCA 1JGSA 3I4NJ 1SMYF 2IXSA 2XSJC 1PUFA 2ESHA 1BL0A 1ZN2A 1IW7F 4DW6A 1A31A 4XKBA 2FX0A 3MCZA 1JT0A 1T95A 4CCJA 2JVHA 1Z0XA 3OOUA 3TOAA 3ZR8X 2VODA 5DM6F 1TW2A 4HZFA 4Q5SF 5J4VA 4M73A 3CMEI 1HLVA 1G3YA 4IXAA 3TKYA 1BI1A 3CCEI 4ABZA 1T6SA 3BR0A 3FXOA 2K7LA 1K78B 2HDCA 2V6EA 2M5WA 2BHZA 2OC6A 4II3A 1G3TA 2FEZA 1SD5A 1ETOA 3DPUA 3I64A 2XKOA 3O2PE 5K5QA 4HSTA 1VQ8I 2QBYA 4Y52J 1K78A 5K7HA 1IXSB 1YW9A 2X6YA 4M3DA 2B63J 4HV5A 4PJ0C 1H8AC 2E1CA 1IRFA 3FMRA 5CVRA 3RYPA 2R7FA 4U0VA 2DTZA 2WAFA 5C4XJ 3DWLE 5FJ8J 2HNHA 4GGGA 2OTJI 4ON0A 1G2HA 1YLFA 3CC2I 2R7XA 4FX0A 3KYLA 5H6QA 1XX5A 3FXMA 5J3LA 4A3MJ 1WJBA 4ENNA 2A69F 1MD0A 1PVEA 2D1HA 3FXUA 1BA5A 1RI7A 1Z3YA 4XRFA 3BQZA 2FXAA 4PCQA 1QGPA 3I4PA 3PO2J 2FRHA 2VQHA 2ZB9A 2DODA 2LD5A 4Q48A 4M72A 1H89C 5KK1A 4JX4A 1WFXA 5BPDA 4HA8A 3PUFA 4HEA2 4KT6A 2DFEA 5EEHA 4FASD 2N8GA 3G73A 5AIPA 3KEYA 2XAGA 4EATA 5CLSA 2GBYA 4EM0B 1ZGWA 4BGDA 4MO7A 5BQTA 2NS8A 2HR3A 3WHCA 1NK3P 2DDBA 4D5CA 1SC7A 1QA6A 3LSGA 3HG9A 1Y8RB 3BTCA 4ZYAA 5ICGA 2LH9A 4M3FA 1BC8C 2CUJA 2OUMA 4KUMA 1ZK8A 2JA2A 3PSIA 4HYEA 4RLFA 1OCRH 3BG6A 4AIHA 2E7XA 1V55H 3R4KA 1D1AA 1GXQA 3DCFA 3WTYC 3SDGA 2ZXWH 2E36A 1G59A 3BG7A 1DGRM 1GVDA 2L7MP 2P5KA 4XM3A 5GAGJ 2VT3A 1U3EM 4BE1A 2JA5J 2CV0A 2KL4A 4XMYA 3K4LA 3HOYJ 3OS0A 1HW2A 2BBYA 4ENMA 2RAEA 4RGRA 5HDNA 5DM7F 1ON2A 3ZMUA 2H27A 2KRFA 2DA2A 3JRBA 1MNMC 1BI2A 2DK5A 3DTEA 4B3XA 2VONA 1JJ6C 1R5ID 3DBHB 1IDYA 4CXFA 3JW4A 1ZAOA 2XPUA 1JKRC 4G94A 2CW7A 5E1XA 4Y17A 3OYAA 2GIZA 3M1CA 2JA7J 2ECBA 3FZVA 1AWCA 1BJZA 3J81K 1KYWA 2STWA 1YYVA 3A01A 3BCAA 3HPHA 3OYHA 4FHTA 1D1CA 4D5FA 4XLHA 3WTUC 2ZJPF 3FDYA 4DIQA 4PJLA 4ZC3A 4M9SA 1YO5C 1LFUP 4KIBA 4M3BA 1FP1D 4R79A 1LJ9A 5IOYA 1ZGAA 3V4GA 3SFIA 2OBPA 3BG5A 1UJ8A 2OCCH 3PNVA 3H0DA 2K9QA 3EETA 2O61A 4CYCA 5FRMA 3RSNA 3FBNB 4BQNA 2JRTA 1QU3A 1IV8A 2W4SA 3OR2C 3RPUA 4ENJA 2EPFA 2LSOA 4RB1A 1REPC 4S04A 2XAQA 3H9QA 3A03A 1SVOA 3E0JB 1TLHB 4E7HA 5DTDA 4ZYGA 5DUIA 2LY2A 3S1MJ 4N9IA 3J7AO 1FSEA 3Q3SA 1IAWA 2QKMB 5M5XJ 5JVGF 3JRFA 2M4KA 1WJDA 3FIWA 1XSXA 1JTXA 2A5YB 3S8PA 1W36C 2FMYA 5ICFA 4UB8C 1RC9A 3KP7A 1S29A 4IHSA 4CGZA 3CCRI 3CD6I 4XNFA 5IP6A 1R1TA 2ECCA 2HVQA 2DOFA 2L7ZA 3KFWX 1JKPC 4UVCA 3E6CC 3K4NA 2DLLA 2DFIA 2HZDA 2PBIA 3BTIA 5FD5A 4HRIA 3TO7A 1T33A 1VQ5I 3HSRA 5HNHA
chains in the Genus database with same CATH topology
5FD6A 6PAXA 5FFZA 3FHZA 3LAJA 4N0BA 4L18B 4A12A 3GLXA 4OIRF 1L3LA 2ZKZA 1ZLJA 4JBAA 1O57A 2CGPA 4A2UA 1U8RA 3EQLF 4WWCA 1I6XA 1QPMA 1SFEA 2PLYA 3JSPA 4IRGA 2XAFA 1KQ8A 4I98B 3IL2A 2IVMA 2H09A 2ISZA 2V9VA 1J59A 1R00A 1XMAA 3KZZA 5CJ9A 5L3EA 3KP6A 5HLHA 2STTA 3F21A 3WODF 2DW4A 4LMYA 2MD5A 4L0YB 2QM3A 1B1BA 3B73A 4IRHA 2Q2EA 3G3ZA 4U0YA 2GA2A 1LEAA 1LDDA 3MZYA 2EJRA 3KP2A 2CW0F 5DD8A 1USSA 5LHIA 2A6EF 5E17F 1L0OC 2KIUA 4YFNF 2F5FA 2O0YA 3W6JB 3Q5FA 2MLKA 1FPQA 1B59A 1Y0UA 4A6DA 1VTNC 3ZP5A 4HX7A 3JTGA 4L9VA 4XLNF 3BDDA 2ESNA 3M9AA 5E1ZB 2YX7A 1W7PD 3H3UA 4ESFA 4CZZA 2CSOA 2QLZA 2JPCA 2LNBA 1H9TA 4BHCA 1SMTA 1OYIA 1BIAA 1S3JA 3D5LA 3F23A 4L9TA 4BHBA 3LA3A 4Q47A 2P8TA 3WE2A 5BPIA 3E6MA 1O3RA 1MGTA 3RKYA 3HRTA 1FT9A 2PQ8A 3MFKA 1P6RA 4KN7X 1F9NA 4QLCU 3KLNA 3GFIA 3KEQA 2A61A 4G7ZF 5ILUA 2K4JA 2VC1A 1STZA 1TNTA 1BI3A 4AIKA 1CF7A 4GYIA 1LEBA 2BEOA 5IT9Z 4BH9A 3QRFF 3FM5A 2FU4A 1BBYA 2M45A 2NAZA 1MKMA 4GYGA 3L00A 3P9KA 4ETSA 3ML6A 1H9GA 1GXPA 2Z5UA 1FLIA 2GIVA 1AOYA 1UFMA 1HW1A 2VE8A 4E70A 4UNOA 2VN2A 1MDMB 3CUQA 3O6BB 1BI0A 1FOKA 2QQ9A 2QWWA 3C3WA 3GFLA 4A0ZA 1I1GA 3HRSA 1LDKB 3BPXA 3CUOA 1EH6A 5LLQA 3R0AA 1HKQA 5ED4A 2IA2A 4L9JA 4EM2A 4KICA 4MHGA 5LGNA 2JZYA 5FB2A 1D5VA 2OQGA 2BE5F 5J8CA 4LB5A 2L3DA 3LWFA 2XV4S 1MJAA 4DNCA 4MTEA 3VEPA 2PG4A 1XGSA 1D8KA 2V1UA 3DQVC 5ILSA 1WI9A 1DUXC 1ZREA 5FO5A 3SXYA 1J7KA 4JQFA 1IXRC 3OOPA 1OKRA 1XB4A 1LB2A 2HYFA 1R36A 2LDUA 3LAPA 2XGXA 4MTDA 2W57A 2LKPA 3WGGA 5AIQA 1J2XA 3F8BA 3QPHA 3I0TA 3DPTA 2PMHA 3ZMDA 1GVJA 1R7JA 2UXXA 2WTEA 2BGCA 3M1EA 5A2QZ 3WTTC 1R58A 1YG2A 2D45A 1FP2A 2G7HA 3ISPA 4AVPA 4O3MA 3PFIA 5ERIA 3COAC 1TQMA 3R60A 3V8LA 1USTA 3FMQA 4S05A 2OZ6A 3TDUC 4U0WA 3K2ZA 4HQMA 1W7PA 4MQVA 2PN6A 3GEZA 4XSZF 4Z2YA 1H0MA 2DBBA 3CO7C 3ECHA 1Q1HA 3I59A 2L01A 2KIFA 2CG4A 2HEOA 2F5CA 2DPUA 4K2EA 1W4MA 3HYIA 1OR7A 3RDIA 1S8NA 2KIMA 2J5PA 1YW8A 1CF7B 3IRRA 1XDUA 4M74A 2V1DA 1FYLA 3SHFA 1IRGA 2LF7A 3QU6A 2HWVA 2R7DA 5IT3A 1XMKA 2P6TA 4GO1A 2NYXA 4ZZLA 2NNYA 4L0ZB 1U5TA 2H6CA 1E17A 2Q0OA 1J0RA 1TQPA 2PJPA 4Y15A 1YFHA 2OU2A 3HOTA 2O3FA 4I0BA 3WU1B 3F6VA 4XSXF 2GQQA 5HDKA 5LEKA 1ON1A 3HRUA 3BJAA 2EB7A 1QBJA 2HKOA 1Z05A 1HBXG 2X0LA 4F7ZA 2YPRA 1IUYA 1TQIA 4HF2A 2CO5A 2M8EA 5D5VB 3FMSA 1WWXA 4MNUA 1DDNA 2LF8A 2GZWA 5HS7A 3FXRA 2GWRA 1KQ0A 4HOBA 3NQOA 1RNLA 3PQJA 4UUVA 1KA8A 3CUQC 3K1NA 3K9TA 3BJOA 3F3XA 3WGIA 3EDPA 5DEQA 3DXJF 4IJAA 1X3UA 1HSJA 2QQBA 1IN7A 4P5OA 4M9XA 3AAFA 4HX8A 1ZLKA 2NRAC 1K7AA 1G3SA 5DCMA 4CICA 2CQKA 2FMLA 2NNNA 1U5TC 1WSUA 1FNNA 2CFXA 1SFUA 5TJJA 3RKWA 1QZYA 2EK5A 3WG9A 2PFBA 1XDSA 1YIOA 3EYYA 4LJZF 4M71A 2IW5A 1FYMA 5EEGA 2VOPA 3E5QA 4R8HA 1UHWA 5JVTA 4MEYF 3F8MA 1G3WA 4BQAA 3KE2A 1ULYA 2Z33A 1HXDA 4BNCA 4KT5C 2Y75A 1FBSA 3U2RA 2H94A 3ZN0A 2K27A 4LK1F 1T98A 1T0FA 2COMA 2Q8KA 4EGYA 2RQPA 1B9MA 5D5UB 1OYYA 2GXBA 3L7WA 3O3KA 5LBQA 4OMZA 2EA2A 2K02A 3GZ5A 2Z99A 1DP7P 4IHTA 2ZJ2A 5HS9A 3E3VA 1O7FA 1O3QA 1P4WA 4WK8F 4CDGA 1YS6A 3HTUA 4HV6A 2AXLA 2D2WA 1R5HA 2VT2A 1ZYRF 5F6FA 1Z6TA 2XHKA 3J80K 1BM9A 2HS5A 5A2QK 2IPQX 1UB9A 2JPBA 2FNPA 2V1XA 2E7WA 2CWEA 1WKMA 3MEXA 1R1UA 3WTXC 2DQRA 2ZMEA 2DTRA 1D8JA 3W6KB 1QNTA 1KU2A 3M8EA 5DUKA 2ZNYA 1K6OA 3HRMA 3TQNA 1YQAA 2HQNA 1TNSA 4LLGF 4NHJA 2R3SA 4I7HA 2NS0A 1OPCA 4BYYA 3JTHA 3KCCA 5KVRA 2XAJA 4PDKA 5CYVA 2EV0A 2B0LA 4LK0F 4JK1X 4YIIA 2GAUA 4EQQA 4U88A 5K1YA 3U1DA 1ZG3A 1BC7C 1HSTA 5L3BA 1G6NA 1KQ9A 1KGSA 5E8IA 3KEOA 1Z9CA 3HHHA 2DK8A 1J9IA 3Q9SA 1C0WA 1R1VA 3LA2A 1MJBA 5D8KB 3ZN1A 5LGTA 1EV7A 1MDMA 1OYWA 3EUHA 2RVCA 3GWZA 2O6GE 4HLYA 3S2WA 3TO9A 4ESBA 2FSWA 1ODDA 4U7DA 1K79A 3JAMZ 3ELKA 1W7PB 2OQRA 2VBWA 5E20A 4RS8A 1PDNC 3I58A 2PEXA 2QENA 1Z7UA 5D6EA 1P92A 4XLPF 3F72A 4A6EA 3GO5A 4D0PA 1YW7A 2ZNZA 4A0XA 3K1PA 1UHMA 3CUQB 1Z6RA 2M30A 4EJWA 3MZHA 5FFXA 5K5RA 4EV0A 3GF2A 5E18F 1EH7A 2M1BA 3ZMZA 5ICCA 2A6HF 2YX4A 3HHGA 1SD6A 1R23A 2M87A 3SQNA 4A5NA 3ZMVA 1KU7A 1WRJA 2DQLA 1RUNA 3GZ6A 3CTAA 3ZMSA 4YFXF 4AD9A 4P55A 4BHPA 4LG0B 3B02A 5DDGA 2MC3A 3FWEA 3RKXA 2D1VA 2XKPA 3MAJA 1IF1A 2RGVA 3R6SA 4RAZA 4WXCA 4KYWA 1ZGJA 2W25A 3L09A 4MEXF 1KU9A 5LHHA 5HS8A 1BOAA 3V7CA 2L02A 2EFWA 1TBXA 3LA7A 4HLXA 2OA4A 1I27A 3RI4A 3RTRA 3C1DA 1T2KA 3DFGA 4OIPF 3BOQA 2WWYA 2HZTA 3DP7A 2QBYB 4B8XA 3LQQA 4R1HA 2IJLA 3T1BA 2RN7A 4L5JA 5DYMA 4WF2A 4LD5A 4KMUX 2YU3A 4WXDA 3V8KA 1MZBA 3CJNA 1IN8A 1V4RA 2W84A 2DU9A 2EV6A 2MH2A 2EWNA 1RZ4A 4IVNA 2ZFWA 2QYOA 1DPUA 4EMSA 3IRQA 5FLXZ 2QQAA 2O03A 3E97A 2F5EA 1IXCA 2DPDA 3F8CA 4ESJA 3QPTA 1YTYA 1ZRFA 4TV7A 5D5XB 2DO7A 1HKSA 3BJ6A 4CYDA 3GFJA 2YR2A 2ISYA 4OU0A 2HQRA 1S7AA 2A68F 5F64A 5DV5A 3FF5A 4H0EA 1E2XA 2JSCA 3WTWC 4G7HF 5JI6A 3SZPA 2F5DA 4HF0A 3T8RA 2FF4A 3RYRA 4A0YA 1XCVA 5D4SA 5CVIA 2FE3A 2QZ8A 5JR3A 1ZHFA 4HAMA 4UXNA 1OMIA 3QOPA 1BN5A 2EFQA 3RPQA 4Q4ZF 2QVOA 4MQ9F 3HSFA 5LEJA 1ONVA 2ETHA 4DQ2A 2TDXA 4NB5A 2Z9OA 2IT0A 4WX9A 1U5TB 1T39A 4RGXA 3GUDA 3RIRA 1ZRDA 3VB2A 1FX7A 4A5MA 1XSDA 2EV5A 2RV8A 4LLNA 5LRSA 1J75A 2P5VA 4G8XA 3JSOA 3E6BA 5F1RA 4G9YA 1P4AA 2VE9A 5FLXK 5L3CA 3DEUA 5L3DA 5FGMA 3DKWA 5BS6A 2RNJA 2FBHA 4I09A 1LDJA 3ZMTA 3F8NA 2ACJA 2MH9A 2P4WA 4OINF 1F5TA 3QU3A 1FYKA 2V6CA 3GYHX 2HGCA 2J5OA 2GA1A 3IKVA 2XASA 5DCMB 3N97A 2L54A 1O7LA 2L4AA 4IF4A 3I5UA 3WTSC 1FBUA 3P9IA 1KU3A 4EGZA 5HDGA 1ZRCA 3K69A 4L5IA 3F8FA 4CHUA 3ABUA 5K5OA 1DPRA 1RIOH 1KYZA 4P96A 4HDUA 3CDHA 1P4XA 3ROUA 2HFHA 2MA3A 4MGRA 3BY6A 3PQKA 1HKTA 2IRFG 3K1MA 4UVBA 1JHFA 4OIOF 1QO0D 1F1ZA 1F4KA 2PMUA 4I02A 4BXUA 3TDZC 4LB6B 4G6DA 1FZPB 3QAHA 2UZKA 1U78A 2HKXA 2OD5A 3P7NA 2OAZA 2O8XA 2KJBA 2FNAA 3M8FA 4G7OF 3GW2A 4HX4A 3V7SA 5H6RA 4PGHA 1A04A 2UWMA 2G9WA 4KMFA 3H3ZA 1LQ1A 1EH8A 4P9UA 3GXOA 3KP4A 4OIQF 3QP6A 3IC7A 2ZO4A 5AONA 2A3SA 4ZYEA 3MWMA 3E6DA 3IWFA 1IN6A 3TO6A 1W5SA 2EA4A 3HSEA 2CYYA 3BROA 4O6JA 2EFOA 2DAOA 4G6QA 5D5WB 4KDPA 3REOA 3C7JA 4RGSA 1P2FA 1XCBA 3NEUA 2XVCA 3IHUA 3HUGA 4KIGA 2RKHA 2HYGD 1U6GA 2ZMEB 4ASNA 2HTJA 2BYVE 3L2CA 4EVIA 5H20A 4UHTA 1RUOA 1B6AA 2FA5A 4GCVA 4O5VA 4N9HA 2E1NA 2VC0A 3N4MA 1ZH5A 1PUEE 1FBQA 1UCRA 4BAYA 2XUBA 2XROA 1NHAA 3BP8A 4LG0A 5HLIA 4ZH4F 2KKOA 1R22A 2BV6A 3P9CA 2FQ3A 3HIFA 3T5XA 2XAHA 4AWXB 3KLOA 4YFKF 4LLLA 1IZ1A 3DPLC 4ZYHA 3ZPLA 1LNWA 1FSHA 1QQIA 4WCGA 3R61A 1XSVA 4KN4X 3I54A 3WTVC 3CO6C 2FOKA 3LSTA 2P6SA 1S6LA 5IT9K 3E5XA 1V3FA 4AIJA 1TW3A 4GXOA 2W24A 1FY7A 5TRDA 1I5ZA 4P9FA 3C18A 3IWZA 3KETA 4KNYA 4YG2F 3V8JA 1Z91A 5HLGA 2MLGA 3V7RA 1XGMA 3FXQA 3RJPA 3WTZA 1SD4A 1GHCA 4ZYDA 4KFCA 1JHHA 4LGWA 4UVAA 3IKTA 5E1WA 1PP7U 5ICEA 5LHGA 5DCFA 3ECOA 4PGGA 4L9NA 1IN5A 3LFKA 3ABTA 4RGUA 2Y48A 1YS7A 2DI3A 3K0LA 2W85A 3J80Z 4EM1A 1XGNA 4FT8A 4HF1A 3VODA 4XBFA 1B4AA 1IN4A 5ILVA 2HOEA 4RAYA 2ADUA 2X4HA 2FBKA 3ZQ7A 3BPVA 5J6XA 2Z3YA 4IRIA 2P5LC 1MJ9A 3I59B 2RDPA 1BJAA 2MBFA 3SFZA 4OMYA 2PI0A 3F22A 1FWZA 4EJVA 2EFPA 3FX3A 1SAXA 4I0AA 2F2EA 5JHUA 4HW0A 5E8GA 2ZBKA 1XN7A 1I1SA 5J8FA 1HW5A 3HOSA 1PP8F 2L4MA 4LFUA 3SZTA 3E5UA 3ERED 3DV8A 5CVVA 1FC3A 5D6FA 2XIGA 4HDVA 5LGUA 2K4BA 3KP5A 4I2OA 3H92A 2A07F 2KJCA 4M9ZA 2JTVA 4EJUA 2OZUA 3WE3A 2VBXA 4CO8A 4IPAA 3QP5A 3VOEA 5CVJA 5DD4A 1G4DA 1CGPA 4KA4A 4B09A 1WQ2A 4RB2C 5JFRA 3KZYA 3NRVA 2FBIA 1XGOA 5LRRA 2K86A 2HTSA 4YIFA 3F6OA 4WXHA 3GFMA 2ELHA 3KP3A 2Y0MA 1T38A 3MQ0A 4OOIA 3GVAA 3TOBA 5L3FA 3BWGA 1Z1DA 5HOOA 3J81Z 2EFNA 1B9NA 1LVAA 5HVQC 3VFZA 4PZJA 1ZG5A 2GXGA 1U2WA 2VBYA 3CLOA 2P7VB 4Y13A 2H6BA 4M6XA 2IA1A 3T0YA 4UV9A 1TTYA 3M7GA 2XRNA 2C6YA 1D3YA 2WV0A 3T8TA 4I01A 3FM3A 4EJTA 1J5YA 1XD7A 3I71A 4HQEA 1ZG1A 1R5GA 2G7UA 2VXZA 3I53A 5D4RA 2UXNA 2IP2A 5CVUA 1O3TA 3R0JA 1SFXA 5BMZA 4FX4A 3WU0A 2WC2A 4RB3C 5BOXA 1SD7A 1S7OA 1JXSA 3LQRA 1QZZA 3OV8A 2JT1A 2QUFA 3GX4X 1BIBA 3JAMK 3D0SA 2P7CB 4QWQA 4KIFA 4M6YA 2ZCWA 2VBZA 3L9FA 1ZARA 2AS5F 4UV8A 3HTSB 3WGHA 2IA0A 4NQWA 2DT5A 4ENKA 3EYIA 1O3SA 5L3GA 4U7BA 2V79A 3U9GA 1JE8A 4ZZDA 3BZ6A 4RB0A 2YSRA 2RC4A 5D8LB 3ULQB 4EJOA 3Q9VA 4HBLA 2VOOA 3DF8A 2ZXJA 3TGNA 1W5TA 1HQCA 1JGSA 1SMYF 2ESHA 1ZN2A 1IW7F 3MCZA 3TOAA 2VODA 1TW2A 4HZFA 4Q5SF 4M73A 1G3YA 4IXAA 3TKYA 1BI1A 1T6SA 2K7LA 1K78B 2HDCA 2M5WA 2FEZA 1G3TA 1SD5A 3I64A 3O2PE 2XKOA 5K5QA 2QBYA 1K78A 1IXSB 1YW9A 4HV5A 2E1CA 1IRFA 3FMRA 5CVRA 3RYPA 2R7FA 4U0VA 4GGGA 4ON0A 1YLFA 4FX0A 5H6QA 4ENNA 2A69F 1MD0A 3FXUA 2D1HA 1RI7A 4XRFA 2FXAA 4PCQA 1QGPA 3I4PA 2FRHA 4Q48A 4M72A 5KK1A 5BPDA 4HA8A 5EEHA 3G73A 5AIPA 2XAGA 5CLSA 4EM0B 5BQTA 2HR3A 5ICGA 1BC8C 4KUMA 4HYEA 4AIHA 2E7XA 3R4KA 1GXQA 3WTYC 2P5KA 2VT3A 1U3EM 1HW2A 2BBYA 4ENMA 4RGRA 5HDNA 1ON2A 3ZMUA 2H27A 2KRFA 1BI2A 2DK5A 2VONA 4CXFA 3JW4A 1ZAOA 4G94A 5E1XA 4Y17A 3FZVA 1AWCA 3J81K 1KYWA 2STWA 1YYVA 4FHTA 3WTUC 4M9SA 1YO5C 4KIBA 1FP1D 4R79A 1LJ9A 1ZGAA 3V4GA 2OBPA 3EETA 2O61A 2JRTA 3RPUA 4ENJA 2LSOA 4RB1A 1REPC 4S04A 2XAQA 1TLHB 4ZYGA 5DUIA 4N9IA 3J7AO 1FSEA 1IAWA 1XSXA 2A5YB 2FMYA 5ICFA 3KP7A 1S29A 4IHSA 4CGZA 1R1TA 3KFWX 4UVCA 3E6CC 2DLLA 2DFIA 2PBIA 5FD5A 3TO7A 3HSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FD6 A;  6PAX A;  5FFZ A;  3FHZ A;  3LAJ A;  4N0B A;  4L18 B;  4A12 A;  3GLX A;  4OIR F;  1L3L A;  2ZKZ A;  1ZLJ A;  4JBA A;  1O57 A;  2CGP A;  4A2U A;  1U8R A;  3EQL F;  4WWC A;  1I6X A;  1QPM A;  1SFE A;  2PLY A;  3JSP A;  4IRG A;  2XAF A;  1KQ8 A;  4I98 B;  3IL2 A;  2IVM A;  2H09 A;  2ISZ A;  2V9V A;  1J59 A;  1R00 A;  1XMA A;  3KZZ A;  5CJ9 A;  5L3E A;  3KP6 A;  5HLH A;  2STT A;  3F21 A;  3WOD F;  2DW4 A;  4LMY A;  2MD5 A;  4L0Y B;  2QM3 A;  1B1B A;  3B73 A;  4IRH A;  2Q2E A;  3G3Z A;  4U0Y A;  2GA2 A;  1LEA A;  1LDD A;  3MZY A;  2EJR A;  3KP2 A;  2CW0 F;  5DD8 A;  1USS A;  5LHI A;  2A6E F;  5E17 F;  1L0O C;  2KIU A;  4YFN F;  2F5F A;  2O0Y A;  3W6J B;  3Q5F A;  2MLK A;  1FPQ A;  1B59 A;  1Y0U A;  4A6D A;  1VTN C;  3ZP5 A;  4HX7 A;  3JTG A;  4L9V A;  4XLN F;  3BDD A;  2ESN A;  3M9A A;  5E1Z B;  2YX7 A;  1W7P D;  3H3U A;  4ESF A;  4CZZ A;  2CSO A;  2QLZ A;  2JPC A;  2LNB A;  1H9T A;  4BHC A;  1SMT A;  1OYI A;  1BIA A;  1S3J A;  3D5L A;  3F23 A;  4L9T A;  4BHB A;  3LA3 A;  4Q47 A;  2P8T A;  3WE2 A;  5BPI A;  3E6M A;  1O3R A;  1MGT A;  3RKY A;  3HRT A;  1FT9 A;  2PQ8 A;  3MFK A;  1P6R A;  4KN7 X;  1F9N A;  4QLC U;  3KLN A;  3GFI A;  3KEQ A;  2A61 A;  4G7Z F;  5ILU A;  2K4J A;  2VC1 A;  1STZ A;  1TNT A;  1BI3 A;  4AIK A;  1CF7 A;  4GYI A;  1LEB A;  2BEO A;  5IT9 Z;  4BH9 A;  3QRF F;  3FM5 A;  2FU4 A;  1BBY A;  2M45 A;  2NAZ A;  1MKM A;  4GYG A;  3L00 A;  3P9K A;  4ETS A;  3ML6 A;  1H9G A;  1GXP A;  2Z5U A;  1FLI A;  2GIV A;  1AOY A;  1UFM A;  1HW1 A;  2VE8 A;  4E70 A;  4UNO A;  2VN2 A;  1MDM B;  3CUQ A;  3O6B B;  1BI0 A;  1FOK A;  2QQ9 A;  2QWW A;  3C3W A;  3GFL A;  4A0Z A;  1I1G A;  3HRS A;  1LDK B;  3BPX A;  3CUO A;  1EH6 A;  5LLQ A;  3R0A A;  1HKQ A;  5ED4 A;  2IA2 A;  4L9J A;  4EM2 A;  4KIC A;  4MHG A;  5LGN A;  2JZY A;  5FB2 A;  1D5V A;  2OQG A;  2BE5 F;  5J8C A;  4LB5 A;  2L3D A;  3LWF A;  2XV4 S;  1MJA A;  4DNC A;  4MTE A;  3VEP A;  2PG4 A;  1XGS A;  1D8K A;  2V1U A;  3DQV C;  5ILS A;  1WI9 A;  1DUX C;  1ZRE A;  5FO5 A;  3SXY A;  1J7K A;  4JQF A;  1IXR C;  3OOP A;  1OKR A;  1XB4 A;  1LB2 A;  2HYF A;  1R36 A;  2LDU A;  3LAP A;  2XGX A;  4MTD A;  2W57 A;  2LKP A;  3WGG A;  5AIQ A;  1J2X A;  3F8B A;  3QPH A;  3I0T A;  3DPT A;  2PMH A;  3ZMD A;  1GVJ A;  1R7J A;  2UXX A;  2WTE A;  2BGC A;  3M1E A;  5A2Q Z;  3WTT C;  1R58 A;  1YG2 A;  2D45 A;  1FP2 A;  2G7H A;  3ISP A;  4AVP A;  4O3M A;  3PFI A;  5ERI A;  3COA C;  1TQM A;  3R60 A;  3V8L A;  1UST A;  3FMQ A;  4S05 A;  2OZ6 A;  3TDU C;  4U0W A;  3K2Z A;  4HQM A;  1W7P A;  4MQV A;  2PN6 A;  3GEZ A;  4XSZ F;  4Z2Y A;  1H0M A;  2DBB A;  3CO7 C;  3ECH A;  1Q1H A;  3I59 A;  2L01 A;  2KIF A;  2CG4 A;  2HEO A;  2F5C A;  2DPU A;  4K2E A;  1W4M A;  3HYI A;  1OR7 A;  3RDI A;  1S8N A;  2KIM A;  2J5P A;  1YW8 A;  1CF7 B;  3IRR A;  1XDU A;  4M74 A;  2V1D A;  1FYL A;  3SHF A;  1IRG A;  2LF7 A;  3QU6 A;  2HWV A;  2R7D A;  5IT3 A;  1XMK A;  2P6T A;  4GO1 A;  2NYX A;  4ZZL A;  2NNY A;  4L0Z B;  1U5T A;  2H6C A;  1E17 A;  2Q0O A;  1J0R A;  1TQP A;  2PJP A;  4Y15 A;  1YFH A;  2OU2 A;  3HOT A;  2O3F A;  4I0B A;  3WU1 B;  3F6V A;  4XSX F;  2GQQ A;  5HDK A;  5LEK A;  1ON1 A;  3HRU A;  3BJA A;  2EB7 A;  1QBJ A;  2HKO A;  1Z05 A;  1HBX G;  2X0L A;  4F7Z A;  2YPR A;  1IUY A;  1TQI A;  4HF2 A;  2CO5 A;  2M8E A;  5D5V B;  3FMS A;  1WWX A;  4MNU A;  1DDN A;  2LF8 A;  2GZW A;  5HS7 A;  3FXR A;  2GWR A;  1KQ0 A;  4HOB A;  3NQO A;  1RNL A;  3PQJ A;  4UUV A;  1KA8 A;  3CUQ C;  3K1N A;  3K9T A;  3BJO A;  3F3X A;  3WGI A;  3EDP A;  5DEQ A;  3DXJ F;  4IJA A;  1X3U A;  1HSJ A;  2QQB A;  1IN7 A;  4P5O A;  4M9X A;  3AAF A;  4HX8 A;  1ZLK A;  2NRA C;  1K7A A;  1G3S A;  5DCM A;  4CIC A;  2CQK A;  2FML A;  2NNN A;  1U5T C;  1WSU A;  1FNN A;  2CFX A;  1SFU A;  5TJJ A;  3RKW A;  1QZY A;  2EK5 A;  3WG9 A;  2PFB A;  1XDS A;  1YIO A;  3EYY A;  4LJZ F;  4M71 A;  2IW5 A;  1FYM A;  5EEG A;  2VOP A;  3E5Q A;  4R8H A;  1UHW A;  5JVT A;  4MEY F;  3F8M A;  1G3W A;  4BQA A;  3KE2 A;  1ULY A;  2Z33 A;  1HXD A;  4BNC A;  4KT5 C;  2Y75 A;  1FBS A;  3U2R A;  2H94 A;  3ZN0 A;  2K27 A;  4LK1 F;  1T98 A;  1T0F A;  2COM A;  2Q8K A;  4EGY A;  2RQP A;  1B9M A;  5D5U B;  1OYY A;  2GXB A;  3L7W A;  3O3K A;  5LBQ A;  4OMZ A;  2EA2 A;  2K02 A;  3GZ5 A;  2Z99 A;  1DP7 P;  4IHT A;  2ZJ2 A;  5HS9 A;  3E3V A;  1O7F A;  1O3Q A;  1P4W A;  4WK8 F;  4CDG A;  1YS6 A;  3HTU A;  4HV6 A;  2AXL A;  2D2W A;  1R5H A;  2VT2 A;  1ZYR F;  5F6F A;  1Z6T A;  2XHK A;  3J80 K;  1BM9 A;  2HS5 A;  5A2Q K;  2IPQ X;  1UB9 A;  2JPB A;  2FNP A;  2V1X A;  2E7W A;  2CWE A;  1WKM A;  3MEX A;  1R1U A;  3WTX C;  2DQR A;  2ZME A;  2DTR A;  1D8J A;  3W6K B;  1QNT A;  1KU2 A;  3M8E A;  5DUK A;  2ZNY A;  1K6O A;  3HRM A;  3TQN A;  1YQA A;  2HQN A;  1TNS A;  4LLG F;  4NHJ A;  2R3S A;  4I7H A;  2NS0 A;  1OPC A;  4BYY A;  3JTH A;  3KCC A;  5KVR A;  2XAJ A;  4PDK A;  5CYV A;  2EV0 A;  2B0L A;  4LK0 F;  4JK1 X;  4YII A;  2GAU A;  4EQQ A;  4U88 A;  5K1Y A;  3U1D A;  1ZG3 A;  1BC7 C;  1HST A;  5L3B A;  1G6N A;  1KQ9 A;  1KGS A;  5E8I A;  3KEO A;  1Z9C A;  3HHH A;  2DK8 A;  1J9I A;  3Q9S A;  1C0W A;  1R1V A;  3LA2 A;  1MJB A;  5D8K B;  3ZN1 A;  5LGT A;  1EV7 A;  1MDM A;  1OYW A;  3EUH A;  2RVC A;  3GWZ A;  2O6G E;  4HLY A;  3S2W A;  3TO9 A;  4ESB A;  2FSW A;  1ODD A;  4U7D A;  1K79 A;  3JAM Z;  3ELK A;  1W7P B;  2OQR A;  2VBW A;  5E20 A;  4RS8 A;  1PDN C;  3I58 A;  2PEX A;  2QEN A;  1Z7U A;  5D6E A;  1P92 A;  4XLP F;  3F72 A;  4A6E A;  3GO5 A;  4D0P A;  1YW7 A;  2ZNZ A;  4A0X A;  3K1P A;  1UHM A;  3CUQ B;  1Z6R A;  2M30 A;  4EJW A;  3MZH A;  5FFX A;  5K5R A;  4EV0 A;  3GF2 A;  5E18 F;  1EH7 A;  2M1B A;  3ZMZ A;  5ICC A;  2A6H F;  2YX4 A;  3HHG A;  1SD6 A;  1R23 A;  2M87 A;  3SQN A;  4A5N A;  3ZMV A;  1KU7 A;  1WRJ A;  2DQL A;  1RUN A;  3GZ6 A;  3CTA A;  3ZMS A;  4YFX F;  4AD9 A;  4P55 A;  4BHP A;  4LG0 B;  3B02 A;  5DDG A;  2MC3 A;  3FWE A;  3RKX A;  2D1V A;  2XKP A;  3MAJ A;  1IF1 A;  2RGV A;  3R6S A;  4RAZ A;  4WXC A;  4KYW A;  1ZGJ A;  2W25 A;  3L09 A;  4MEX F;  1KU9 A;  5LHH A;  5HS8 A;  1BOA A;  3V7C A;  2L02 A;  2EFW A;  1TBX A;  3LA7 A;  4HLX A;  2OA4 A;  1I27 A;  3RI4 A;  3RTR A;  3C1D A;  1T2K A;  3DFG A;  4OIP F;  3BOQ A;  2WWY A;  2HZT A;  3DP7 A;  2QBY B;  4B8X A;  3LQQ A;  4R1H A;  2IJL A;  3T1B A;  2RN7 A;  4L5J A;  5DYM A;  4WF2 A;  4LD5 A;  4KMU X;  2YU3 A;  4WXD A;  3V8K A;  1MZB A;  3CJN A;  1IN8 A;  1V4R A;  2W84 A;  2DU9 A;  2EV6 A;  2MH2 A;  2EWN A;  1RZ4 A;  4IVN A;  2ZFW A;  2QYO A;  1DPU A;  4EMS A;  3IRQ A;  5FLX Z;  2QQA A;  2O03 A;  3E97 A;  2F5E A;  1IXC A;  2DPD A;  3F8C A;  4ESJ A;  3QPT A;  1YTY A;  1ZRF A;  4TV7 A;  5D5X B;  2DO7 A;  1HKS A;  3BJ6 A;  4CYD A;  3GFJ A;  2YR2 A;  2ISY A;  4OU0 A;  2HQR A;  1S7A A;  2A68 F;  5F64 A;  5DV5 A;  3FF5 A;  4H0E A;  1E2X A;  2JSC A;  3WTW C;  4G7H F;  5JI6 A;  3SZP A;  2F5D A;  4HF0 A;  3T8R A;  2FF4 A;  3RYR A;  4A0Y A;  1XCV A;  5D4S A;  5CVI A;  2FE3 A;  2QZ8 A;  5JR3 A;  1ZHF A;  4HAM A;  4UXN A;  1OMI A;  3QOP A;  1BN5 A;  2EFQ A;  3RPQ A;  4Q4Z F;  2QVO A;  4MQ9 F;  3HSF A;  5LEJ A;  1ONV A;  2ETH A;  4DQ2 A;  2TDX A;  4NB5 A;  2Z9O A;  2IT0 A;  4WX9 A;  1U5T B;  1T39 A;  4RGX A;  3GUD A;  3RIR A;  1ZRD A;  3VB2 A;  1FX7 A;  4A5M A;  1XSD A;  2EV5 A;  2RV8 A;  4LLN A;  5LRS A;  1J75 A;  2P5V A;  4G8X A;  3JSO A;  3E6B A;  5F1R A;  4G9Y A;  1P4A A;  2VE9 A;  5FLX K;  5L3C A;  3DEU A;  5L3D A;  5FGM A;  3DKW A;  5BS6 A;  2RNJ A;  2FBH A;  4I09 A;  1LDJ A;  3ZMT A;  3F8N A;  2ACJ A;  2MH9 A;  2P4W A;  4OIN F;  1F5T A;  3QU3 A;  1FYK A;  2V6C A;  3GYH X;  2HGC A;  2J5O A;  2GA1 A;  3IKV A;  2XAS A;  5DCM B;  3N97 A;  2L54 A;  1O7L A;  2L4A A;  4IF4 A;  3I5U A;  3WTS C;  1FBU A;  3P9I A;  1KU3 A;  4EGZ A;  5HDG A;  1ZRC A;  3K69 A;  4L5I A;  3F8F A;  4CHU A;  3ABU A;  5K5O A;  1DPR A;  1RIO H;  1KYZ A;  4P96 A;  4HDU A;  3CDH A;  1P4X A;  3ROU A;  2HFH A;  2MA3 A;  4MGR A;  3BY6 A;  3PQK A;  1HKT A;  2IRF G;  3K1M A;  4UVB A;  1JHF A;  4OIO F;  1QO0 D;  1F1Z A;  1F4K A;  2PMU A;  4I02 A;  4BXU A;  3TDZ C;  4LB6 B;  4G6D A;  1FZP B;  3QAH A;  2UZK A;  1U78 A;  2HKX A;  2OD5 A;  3P7N A;  2OAZ A;  2O8X A;  2KJB A;  2FNA A;  3M8F A;  4G7O F;  3GW2 A;  4HX4 A;  3V7S A;  5H6R A;  4PGH A;  1A04 A;  2UWM A;  2G9W A;  4KMF A;  3H3Z A;  1LQ1 A;  1EH8 A;  4P9U A;  3GXO A;  3KP4 A;  4OIQ F;  3QP6 A;  3IC7 A;  2ZO4 A;  5AON A;  2A3S A;  4ZYE A;  3MWM A;  3E6D A;  3IWF A;  1IN6 A;  3TO6 A;  1W5S A;  2EA4 A;  3HSE A;  2CYY A;  3BRO A;  4O6J A;  2EFO A;  2DAO A;  4G6Q A;  5D5W B;  4KDP A;  3REO A;  3C7J A;  4RGS A;  1P2F A;  1XCB A;  3NEU A;  2XVC A;  3IHU A;  3HUG A;  4KIG A;  2RKH A;  2HYG D;  1U6G A;  2ZME B;  4ASN A;  2HTJ A;  2BYV E;  3L2C A;  4EVI A;  5H20 A;  4UHT A;  1RUO A;  1B6A A;  2FA5 A;  4GCV A;  4O5V A;  4N9H A;  2E1N A;  2VC0 A;  3N4M A;  1ZH5 A;  1PUE E;  1FBQ A;  1UCR A;  4BAY A;  2XUB A;  2XRO A;  1NHA A;  3BP8 A;  4LG0 A;  5HLI A;  4ZH4 F;  2KKO A;  1R22 A;  2BV6 A;  3P9C A;  2FQ3 A;  3HIF A;  3T5X A;  2XAH A;  4AWX B;  3KLO A;  4YFK F;  4LLL A;  1IZ1 A;  3DPL C;  4ZYH A;  3ZPL A;  1LNW A;  1FSH A;  1QQI A;  4WCG A;  3R61 A;  1XSV A;  4KN4 X;  3I54 A;  3WTV C;  3CO6 C;  2FOK A;  3LST A;  2P6S A;  1S6L A;  5IT9 K;  3E5X A;  1V3F A;  4AIJ A;  1TW3 A;  4GXO A;  2W24 A;  1FY7 A;  5TRD A;  1I5Z A;  4P9F A;  3C18 A;  3IWZ A;  3KET A;  4KNY A;  4YG2 F;  3V8J A;  1Z91 A;  5HLG A;  2MLG A;  3V7R A;  1XGM A;  3FXQ A;  3RJP A;  3WTZ A;  1SD4 A;  1GHC A;  4ZYD A;  4KFC A;  1JHH A;  4LGW A;  4UVA A;  3IKT A;  5E1W A;  1PP7 U;  5ICE A;  5LHG A;  5DCF A;  3ECO A;  4PGG A;  4L9N A;  1IN5 A;  3LFK A;  3ABT A;  4RGU A;  2Y48 A;  1YS7 A;  2DI3 A;  3K0L A;  2W85 A;  3J80 Z;  4EM1 A;  1XGN A;  4FT8 A;  4HF1 A;  3VOD A;  4XBF A;  1B4A A;  1IN4 A;  5ILV A;  2HOE A;  4RAY A;  2ADU A;  2X4H A;  2FBK A;  3ZQ7 A;  3BPV A;  5J6X A;  2Z3Y A;  4IRI A;  2P5L C;  1MJ9 A;  3I59 B;  2RDP A;  1BJA A;  2MBF A;  3SFZ A;  4OMY A;  2PI0 A;  3F22 A;  1FWZ A;  4EJV A;  2EFP A;  3FX3 A;  1SAX A;  4I0A A;  2F2E A;  5JHU A;  4HW0 A;  5E8G A;  2ZBK A;  1XN7 A;  1I1S A;  5J8F A;  1HW5 A;  3HOS A;  1PP8 F;  2L4M A;  4LFU A;  3SZT A;  3E5U A;  3ERE D;  3DV8 A;  5CVV A;  1FC3 A;  5D6F A;  2XIG A;  4HDV A;  5LGU A;  2K4B A;  3KP5 A;  4I2O A;  3H92 A;  2A07 F;  2KJC A;  4M9Z A;  2JTV A;  4EJU A;  2OZU A;  3WE3 A;  2VBX A;  4CO8 A;  4IPA A;  3QP5 A;  3VOE A;  5CVJ A;  5DD4 A;  1G4D A;  1CGP A;  4KA4 A;  4B09 A;  1WQ2 A;  4RB2 C;  5JFR A;  3KZY A;  3NRV A;  2FBI A;  1XGO A;  5LRR A;  2K86 A;  2HTS A;  4YIF A;  3F6O A;  4WXH A;  3GFM A;  2ELH A;  3KP3 A;  2Y0M A;  1T38 A;  3MQ0 A;  4OOI A;  3GVA A;  3TOB A;  5L3F A;  3BWG A;  1Z1D A;  5HOO A;  3J81 Z;  2EFN A;  1B9N A;  1LVA A;  5HVQ C;  3VFZ A;  4PZJ A;  1ZG5 A;  2GXG A;  1U2W A;  2VBY A;  3CLO A;  2P7V B;  4Y13 A;  2H6B A;  4M6X A;  2IA1 A;  3T0Y A;  4UV9 A;  1TTY A;  3M7G A;  2XRN A;  2C6Y A;  1D3Y A;  2WV0 A;  3T8T A;  4I01 A;  3FM3 A;  4EJT A;  1J5Y A;  1XD7 A;  3I71 A;  4HQE A;  1ZG1 A;  1R5G A;  2G7U A;  2VXZ A;  3I53 A;  5D4R A;  2UXN A;  2IP2 A;  5CVU A;  1O3T A;  3R0J A;  1SFX A;  5BMZ A;  4FX4 A;  3WU0 A;  2WC2 A;  4RB3 C;  5BOX A;  1SD7 A;  1S7O A;  1JXS A;  3LQR A;  1QZZ A;  3OV8 A;  2JT1 A;  2QUF A;  3GX4 X;  1BIB A;  3JAM K;  3D0S A;  2P7C B;  4QWQ A;  4KIF A;  4M6Y A;  2ZCW A;  2VBZ A;  3L9F A;  1ZAR A;  2AS5 F;  4UV8 A;  3HTS B;  3WGH A;  2IA0 A;  4NQW A;  2DT5 A;  4ENK A;  3EYI A;  1O3S A;  5L3G A;  4U7B A;  2V79 A;  3U9G A;  1JE8 A;  4ZZD A;  3BZ6 A;  4RB0 A;  2YSR A;  2RC4 A;  5D8L B;  3ULQ B;  4EJO A;  3Q9V A;  4HBL A;  2VOO A;  3DF8 A;  2ZXJ A;  3TGN A;  1W5T A;  1HQC A;  1JGS A;  1SMY F;  2ESH A;  1ZN2 A;  1IW7 F;  3MCZ A;  3TOA A;  2VOD A;  1TW2 A;  4HZF A;  4Q5S F;  4M73 A;  1G3Y A;  4IXA A;  3TKY A;  1BI1 A;  1T6S A;  2K7L A;  1K78 B;  2HDC A;  2M5W A;  2FEZ A;  1G3T A;  1SD5 A;  3I64 A;  3O2P E;  2XKO A;  5K5Q A;  2QBY A;  1K78 A;  1IXS B;  1YW9 A;  4HV5 A;  2E1C A;  1IRF A;  3FMR A;  5CVR A;  3RYP A;  2R7F A;  4U0V A;  4GGG A;  4ON0 A;  1YLF A;  4FX0 A;  5H6Q A;  4ENN A;  2A69 F;  1MD0 A;  3FXU A;  2D1H A;  1RI7 A;  4XRF A;  2FXA A;  4PCQ A;  1QGP A;  3I4P A;  2FRH A;  4Q48 A;  4M72 A;  5KK1 A;  5BPD A;  4HA8 A;  5EEH A;  3G73 A;  5AIP A;  2XAG A;  5CLS A;  4EM0 B;  5BQT A;  2HR3 A;  5ICG A;  1BC8 C;  4KUM A;  4HYE A;  4AIH A;  2E7X A;  3R4K A;  1GXQ A;  3WTY C;  2P5K A;  2VT3 A;  1U3E M;  1HW2 A;  2BBY A;  4ENM A;  4RGR A;  5HDN A;  1ON2 A;  3ZMU A;  2H27 A;  2KRF A;  1BI2 A;  2DK5 A;  2VON A;  4CXF A;  3JW4 A;  1ZAO A;  4G94 A;  5E1X A;  4Y17 A;  3FZV A;  1AWC A;  3J81 K;  1KYW A;  2STW A;  1YYV A;  4FHT A;  3WTU C;  4M9S A;  1YO5 C;  4KIB A;  1FP1 D;  4R79 A;  1LJ9 A;  1ZGA A;  3V4G A;  2OBP A;  3EET A;  2O61 A;  2JRT A;  3RPU A;  4ENJ A;  2LSO A;  4RB1 A;  1REP C;  4S04 A;  2XAQ A;  1TLH B;  4ZYG A;  5DUI A;  4N9I A;  3J7A O;  1FSE A;  1IAW A;  1XSX A;  2A5Y B;  2FMY A;  5ICF A;  3KP7 A;  1S29 A;  4IHS A;  4CGZ A;  1R1T A;  3KFW X;  4UVC A;  3E6C C;  2DLL A;  2DFI A;  2PBI A;  5FD5 A;  3TO7 A;  3HSR A; 
#chains in the Genus database with same CATH topology
 5FD6 A;  4OAY A;  6PAX A;  2WY7 Q;  4XRM A;  2IS1 A;  5FFZ A;  3FHZ A;  3LAJ A;  4N0B A;  4L18 B;  2KZV A;  1W1W E;  3GLX A;  4A12 A;  4OIR F;  3P5J A;  4DYQ A;  1D5Y A;  1L3L A;  2ZSH B;  2ZKZ A;  1ZLJ A;  3L2W A;  2HXO A;  2OV7 A;  3DKY A;  4JBA A;  3BR2 A;  1O57 A;  3K4K A;  2CGP A;  2V9K A;  1NG7 A;  4A2U A;  2KMU A;  1U8R A;  1EKE A;  3EQL F;  2GOX B;  4WWC A;  4YEJ A;  1VF9 A;  2X1C A;  1TC3 C;  1I6X A;  3K2A A;  1QPM A;  1SFE A;  3H0G J;  2PLY A;  3JSP A;  4IRG A;  2XAF A;  1KQ8 A;  1ETQ A;  2KPM A;  3CJR B;  4I98 B;  2CH0 A;  4CH7 A;  4NC8 A;  1Y0N A;  3IL2 A;  4F52 A;  2IVM A;  4Y7N J;  2H09 A;  2ISZ A;  2V9V A;  1J59 A;  1VQ4 I;  4A3K J;  1R00 A;  3OY9 A;  2W48 A;  3MN2 A;  1QRY A;  1XMA A;  3KZZ A;  4ZDO A;  2ZSI B;  3CP8 A;  5CJ9 A;  3H3V K;  1F43 A;  5L3E A;  3KP6 A;  4BJT A;  5HLH A;  4X6A J;  3HGG A;  1FOX A;  1VQK I;  2STT A;  3F21 A;  3WOD F;  3M8J A;  4UY8 I;  2DW4 A;  4LMY A;  1LUJ B;  2L5Q A;  2MD5 A;  5BNG A;  1AA7 A;  3S2H J;  1LVK A;  2QM3 A;  4L0Y B;  1B1B A;  3EUA A;  1V54 H;  1V5G A;  3B73 A;  4IRH A;  4E4H A;  4HPQ A;  2Q2E A;  3G3Z A;  4RDU A;  1VQ9 I;  1I3A A;  4U0Y A;  5E3N A;  2GA2 A;  1IRZ A;  1HOM A;  1E0E A;  1LEA A;  1LDD A;  1HA8 A;  3WG7 H;  2HVR A;  3MZY A;  3HBL A;  2HXI A;  2R7S A;  2MAB A;  2EJR A;  3KP2 A;  1IUF A;  1LKX A;  2CW0 F;  4CYC B;  5DD8 A;  1USS A;  3BTL A;  4XN0 A;  5LHI A;  3OYI A;  4E7I A;  1LFB A;  2A6E F;  3S2D J;  5E17 F;  1L0O C;  2KIU A;  3LSM A;  4E7Z A;  4YFN F;  3GCM A;  3ZQQ A;  4PFP A;  2F5F A;  3DLL F;  2O0Y A;  3W6J B;  3Q5F A;  2MLK A;  1FPQ A;  1B59 A;  2LFB A;  1Y0U A;  3GLL A;  1X4O A;  4A6D A;  1VTN C;  1HDD C;  1POG A;  3ZP5 A;  2PX9 A;  4HX7 A;  4IHX A;  3JTG A;  2ZJR F;  4L9V A;  4XLN F;  3BDD A;  1B72 A;  2IS2 A;  2ESN A;  3M9A A;  5E1Z B;  2YX7 A;  1W7P D;  1U0J A;  2OPT A;  3H3U A;  4ESF A;  4CZZ A;  2CSO A;  1RET A;  2QLZ A;  2X6O A;  1VFC A;  2JPC A;  2LNB A;  1H9T A;  4NDL A;  4BHC A;  1SMT A;  1OYI A;  1D1B A;  3LMM A;  2WBM A;  1Z67 A;  2MW8 A;  1BIA A;  4RBO A;  1S3J A;  2JJ7 A;  3D5L A;  4E7S A;  3ERM A;  2DFH A;  3F23 A;  2LKS A;  1IGN A;  2KIQ A;  4L9T A;  4BHB A;  2CQ7 A;  3LA3 A;  4Q47 A;  2P8T A;  3WE2 A;  4XRS G;  5BPI A;  4ZJZ A;  1MIJ A;  1T8I A;  3E6M A;  2AO9 A;  5J4Y A;  4E7K A;  1M1E B;  1JI8 A;  3FXJ A;  2E34 A;  3JRG A;  1O3R A;  3GTL J;  1MGT A;  2DA3 A;  4IO9 F;  3RKY A;  3HRT A;  1FT9 A;  4FIS A;  2PQ8 A;  2X9D A;  3SJM A;  2CFO A;  2DMT A;  1BR1 A;  4AID A;  3QOE A;  5EG0 B;  2EIL H;  2P81 A;  1IG7 A;  3MFK A;  1S72 I;  5GAD J;  5K7Z A;  1P6R A;  4KN7 X;  1A5J A;  1F9N A;  4QLC U;  1IJW C;  3PNT A;  4BUP A;  3KLN A;  3GFI A;  3KEQ A;  2H1K A;  2A61 A;  4G7Z F;  4W1U A;  5F08 A;  3VYT B;  1I39 A;  5ILU A;  2K4J A;  2ID6 A;  2ME0 A;  2EIK H;  2VIX A;  5F0C A;  5FKK A;  2VC1 A;  4D7M A;  2H8R A;  1NTC A;  3CF2 A;  1STZ A;  1TNT A;  1TP4 A;  3A1Y A;  3CZ6 A;  1BI3 A;  4AIK A;  4Y3O A;  1CF7 A;  1AU7 A;  1DU0 A;  4GYI A;  1TWH J;  1LEB A;  2LLK A;  2BEO A;  5GAE J;  5IT9 Z;  1WPK A;  4BH9 A;  1WHU A;  4F91 B;  3QRF F;  2BHY A;  3FM5 A;  3GTM J;  2FU4 A;  1BBY A;  2M45 A;  2NAZ A;  4UUS A;  3Q0W A;  1FEX A;  1MKM A;  3DTK A;  4BY7 J;  4GYG A;  3K70 D;  2R7O A;  3L00 A;  3P9K A;  4ETS A;  1Z77 A;  3ML6 A;  1H9G A;  5GP9 A;  1GXP A;  3DBR B;  2KFD A;  2Z5U A;  5K7F A;  2G0E A;  2XF6 A;  1FLI A;  2GIV A;  1AOY A;  1UFM A;  1HW1 A;  2JRM A;  2EH3 A;  3MMY B;  5F27 A;  3CMY A;  2VE8 A;  4E70 A;  4PFO A;  4UNO A;  1FOW A;  2VN2 A;  5E3M A;  1W0T A;  1MDM B;  3IAS 2;  4UUT A;  3CUQ A;  3O6B B;  1BI0 A;  1TL8 A;  1IV6 A;  2NVQ J;  2Y9Z A;  4AM3 A;  4RAG A;  1FOK A;  2QQ9 A;  2QWW A;  2UV1 A;  4NBQ A;  4D9J A;  3C3W A;  3GFL A;  3K6G A;  1VQ7 I;  4A0Z A;  1I1G A;  3HRS A;  1LDK B;  2M8G X;  3VYR B;  2GXA A;  3BPX A;  3CUO A;  1EH6 A;  2YS9 A;  5CQE A;  5LLQ A;  3R0A A;  3C2G A;  1HKQ A;  1Y56 A;  2CV1 A;  5ED4 A;  2IA2 A;  3DLA A;  2IBD A;  2CU7 A;  4L9J A;  4IL6 C;  2HOA A;  4EM2 A;  3VSK A;  2VKE A;  4BXF A;  2LYC A;  4KIC A;  4MHG A;  3S3N A;  4QIW N;  2EBI A;  2Y9Y A;  5LGN A;  2JZY A;  5FB2 A;  1D5V A;  2OQG A;  2KT0 A;  2BE5 F;  4CCL A;  3ASN H;  5J8C A;  4GDF A;  3OYE A;  4LB5 A;  2YU9 J;  3W2V A;  2L3D A;  4M6V A;  3LWF A;  2XV4 S;  1MJA A;  2XPW A;  3HOU J;  3UNG C;  2Z2S B;  5JHF A;  4DNC A;  3A01 B;  4MTE A;  4PJJ A;  3VEP A;  2ELJ A;  3L2V A;  2PG4 A;  5GTH C;  2DJI A;  1XGS A;  5HNF A;  4QPQ A;  3RPU D;  3DEE A;  1D8K A;  3DQV C;  5ILS A;  3TW7 A;  2V1U A;  4A93 J;  1WI9 A;  1DUX C;  2XGD A;  2R0Q C;  1ZRE A;  4EEF G;  5FO5 A;  1ETW A;  3SXY A;  2K5C A;  1AKH B;  2QGU A;  4A3L J;  2Y0S N;  1J7K A;  1R4N B;  4A3B J;  4JQF A;  1IXR C;  2I5U A;  3OOP A;  1OKR A;  2M7A A;  3VWB A;  1NG6 A;  5IPA A;  4C3I J;  1VQL I;  1XB4 A;  4C3H J;  1LB2 A;  3FXK A;  2HYF A;  1JUS A;  5TGT A;  1MW7 A;  4CCN A;  3OYM A;  1JT6 A;  1R36 A;  2LDU A;  3CCS I;  1A6Q A;  3LAP A;  4XIC A;  2NVY J;  1YJW I;  1Z21 A;  2W7N A;  2FD5 A;  1MMA A;  3UKG A;  4MFE A;  3BT9 A;  3MD2 A;  2XGX A;  4BL0 B;  4MTD A;  2W57 A;  4XKV A;  2LKP A;  3S3M A;  1TWC J;  3WGG A;  3JRC A;  1K83 J;  1TZL A;  5AIQ A;  1SAN A;  1J2X A;  1MND A;  2JK3 A;  3F8B A;  3F0C A;  3QPH A;  3L2R A;  3I0T A;  4A3C J;  1ENH A;  2BXZ A;  3DPT A;  1T08 B;  4G6T B;  2PMH A;  1P7I A;  3ZMD A;  1GVJ A;  2X1E A;  1MBH A;  1R7J A;  2UXX A;  2WTE A;  3C2H A;  2BGC A;  3M1E A;  4C30 A;  5A2Q Z;  1N77 A;  3WTT C;  3HOV J;  2IAI A;  1R58 A;  3CES A;  3KIO A;  1YG2 A;  2D45 A;  1OQY A;  2MSY A;  5CKT A;  1FP2 A;  1TWG J;  4IOA F;  2G7H A;  1RKW A;  3ISP A;  4AVP A;  3RKQ A;  4O3M A;  3PFI A;  5ERI A;  4BY1 J;  4HNV A;  3BCB A;  3HJE A;  5FKL A;  4MLO A;  3COA C;  2FOW A;  1TQM A;  3G1L A;  3AKZ A;  3R60 A;  3V8L A;  1UST A;  2BY0 A;  1N78 A;  3FMQ A;  3FIS A;  4S05 A;  2R7R A;  4YRV A;  2OZ6 A;  3TDU C;  4J19 A;  1SFK A;  4U87 A;  4U0W A;  3K2Z A;  4HQM A;  3D1N I;  1AHD P;  1MMG A;  3QPS A;  2Z16 A;  1W7P A;  4MQV A;  3VSL A;  3NAR A;  1FTT A;  2PN6 A;  1X3Z B;  3GEZ A;  2XAU A;  3SYT A;  4XSZ F;  4Z2Y A;  1H0M A;  4C3J J;  3FHN A;  2DBB A;  3J7A Y;  3CO7 C;  3ECH A;  1Q1H A;  3I59 A;  3BR6 A;  3IP4 B;  3CF5 F;  2L01 A;  2ID3 A;  2KIF A;  1B8I B;  2CG4 A;  1JKQ C;  2HEO A;  2F5C A;  4B44 A;  4K2E A;  2DPU A;  3NWS A;  1W4M A;  2M0M A;  2HPI A;  3HYI A;  1OR7 A;  3RDI A;  4ZDL A;  1S8N A;  2KIM A;  4GRI A;  3ZQL A;  2J5P A;  2WY8 Q;  1YW8 A;  1CF7 B;  3IRR A;  1XDU A;  1MNE A;  4M74 A;  2V1D A;  2Q2E B;  1FYL A;  1DQU A;  3SHF A;  2X6X A;  1YIJ I;  4PSW A;  1IRG A;  1BR2 A;  2E1M C;  2LF7 A;  3QU6 A;  2HWV A;  3H36 A;  2R7D A;  1D0X A;  5IT3 A;  1XMK A;  4V2F A;  2R5Y B;  3FBI B;  2P6T A;  2AHQ A;  4E7J A;  2DJN A;  4GO1 A;  1ACI A;  2NYX A;  4ZZL A;  2NNY A;  4L0Z B;  1U5T A;  3ZXS A;  2H6C A;  4D7N A;  4IQ4 A;  4CCK A;  1E17 A;  4BE0 A;  1FIA A;  2JUG A;  2Q0O A;  2DCE A;  1J0R A;  3GTJ J;  1EF4 A;  4ZDP A;  1TQP A;  3CCV I;  2PJP A;  4Y15 A;  1YFH A;  2WAE A;  2CUE A;  2BZT A;  2OU2 A;  4BS9 A;  3LSI A;  3HOT A;  2O3F A;  4I0B A;  3WU1 B;  3F6V A;  2JWT A;  4DYR A;  4XSX F;  2VQL A;  2GQQ A;  4N4O B;  2O8K A;  5HDK A;  1QPI A;  2UUZ A;  3HDD A;  5LEK A;  3RQ4 A;  1ON1 A;  4F55 A;  3HRU A;  4BKX A;  3BJA A;  2EB7 A;  1QBJ A;  2IS6 A;  5B66 C;  2HKO A;  1Z05 A;  1HBX G;  4PSX A;  4DBR A;  2XF5 A;  3CDI A;  1EJ9 A;  3ABL H;  4C2M J;  2M3A A;  2X0L A;  4F7Z A;  5EGO B;  2NXN B;  4AUX A;  3M3Y J;  2YPR A;  1IUY A;  1TQI A;  3HZJ A;  3U1K A;  4HF2 A;  2CO5 A;  3D5R C;  2M8E A;  5D5V B;  1B8I A;  4CSW A;  3FMS A;  4I99 C;  3PIP F;  5E79 C;  1WWX A;  3TL4 X;  4MNU A;  1DDN A;  3CCL I;  3H5R A;  4FTH A;  2VL8 A;  2LF8 A;  3LSK A;  2GZW A;  5HS7 A;  3OIP A;  3HC7 A;  3FXR A;  4BEH B;  4FQG A;  2GWR A;  5GPC A;  3BZK A;  1KQ0 A;  4HOB A;  3NQO A;  1RNL A;  3ZQF A;  1OCO H;  3MKY B;  3OMY A;  3PQJ A;  1ZKG A;  2MD0 A;  5FRO A;  4UUV A;  1KA8 A;  3CUQ C;  4RLQ A;  2LC2 A;  3K1N A;  1KZH A;  1RES A;  3K9T A;  3BJO A;  3F3X A;  3WGI A;  3EDP A;  3W3C A;  5DEQ A;  5KCM A;  3DXJ F;  4IJA A;  1X3U A;  3U21 A;  2JVG A;  1HSJ A;  2QQB A;  1YRN A;  2VXD A;  1X4P A;  1IN7 A;  4P5O A;  2HPM A;  4M9X A;  3AAF A;  1ZQ3 P;  1JUP A;  3QQA A;  2M2E A;  1VQM I;  2E5Z A;  5FKO A;  4HX8 A;  2EQR A;  1OCT C;  4XN3 A;  1YX5 A;  3CCQ I;  1ZLK A;  3SDB A;  3CJT B;  2NRA C;  1K7A A;  1G3S A;  5DCM A;  1VQP I;  5LFA A;  4CIC A;  4A3F J;  1P7J A;  2CQK A;  2KRH A;  2LMD A;  1KON A;  2VQG A;  5E3O A;  2FML A;  2NNN A;  1U5T C;  1WSU A;  1FNN A;  2CFX A;  3HUG B;  1SFU A;  2VKV A;  5TJJ A;  1Z3X A;  3M07 A;  3RKW A;  1QZY A;  1X2N A;  2EK5 A;  2HOT A;  4F3Q A;  2VPR A;  3WG9 A;  5DS9 A;  2PFB A;  4GFB A;  1XDS A;  1YIO A;  3EYY A;  4LJZ F;  3PIO F;  3JRI A;  1BW5 A;  4M71 A;  2WAQ A;  4XID A;  1WJC A;  2IW5 A;  1FYM A;  1SFO J;  5EEG A;  1WZ2 A;  2VOP A;  3E5Q A;  2LK2 A;  1UHW A;  4R8H A;  5JVT A;  5EYR A;  3ZGK A;  4MEY F;  3F8M A;  5JLW A;  3I9V 2;  1G3W A;  5J1R A;  3KE2 A;  4BQA A;  1ULY A;  2Z33 A;  3HXL A;  1HXD A;  3PO3 J;  4BNC A;  4KT5 C;  2Y75 A;  2CQQ A;  1FBS A;  5J47 A;  3U2R A;  2H94 A;  3OL4 A;  3L1P A;  1IRX A;  3ZN0 A;  2K27 A;  4LK1 F;  1T98 A;  1T0F A;  2DN0 A;  3OYK A;  2ZXI A;  4IEJ A;  2COM A;  1DP3 A;  4LIT A;  2BVM A;  2Q8K A;  3CMA I;  2OTL I;  2R7Z J;  4EGY A;  2RQP A;  1B9M A;  3CC4 I;  2KDZ A;  2L2O A;  1MBG A;  5D5U B;  2WAQ N;  1OYY A;  5CQG A;  2GXB A;  2MFZ A;  5EJC A;  3I56 I;  3L7W A;  3O3K A;  1W36 D;  5LBQ A;  1MH4 A;  1RPW A;  2EA2 A;  4OMZ A;  2LKX A;  2K02 A;  3GZ5 A;  4M3G A;  2Z99 A;  2VPL A;  1DP7 P;  4ZTJ A;  4IHT A;  2IGM A;  1LPQ A;  1WJA A;  1RR7 A;  2ZJ2 A;  5HS9 A;  3E3V A;  3K4J A;  1O7F A;  2AQE A;  1O3Q A;  1P4W A;  4WK8 F;  1SAU A;  4CDG A;  1YS6 A;  3HTU A;  4HV6 A;  3OYF A;  1GUU A;  2LBF B;  2AXL A;  5H2F C;  4YEL A;  2D2W A;  1R5H A;  5IYC J;  2VT2 A;  2WA0 A;  1ZYR F;  2E5N A;  5F6F A;  1SVM A;  2AXT C;  1Z6T A;  2XHK A;  3J80 K;  1BM9 A;  4N4N B;  2HS5 A;  1X58 A;  4BXX J;  3CCJ I;  5A2Q K;  2IPQ X;  3WU2 C;  1UB9 A;  4B47 A;  2JPB A;  2FNP A;  1LE8 B;  3ZQH A;  2V1X A;  3DBL B;  2CWE A;  2E7W A;  4DJA A;  1WKM A;  3MEX A;  3I55 I;  3MZ8 A;  2CJJ A;  2L9R A;  1R1U A;  5FLV A;  5IOZ A;  3WTX C;  2NVU B;  3X2Q H;  1E3P A;  2DQR A;  2BY3 A;  4A3I J;  4XLE A;  2ZME A;  2DTR A;  3FKI J;  3H35 A;  2EIJ H;  3NWT A;  4I76 A;  2LRD A;  1D8J A;  4S0H B;  2F6C A;  3AFH A;  1XS9 A;  3W6K B;  1QNT A;  1KU2 A;  3M8E A;  5DUK A;  4IZZ A;  2ZNY A;  1Y1V J;  1K6O A;  3HRM A;  3TQN A;  1YQA A;  2EIM H;  2HQN A;  1TNS A;  3K7A J;  4LLG F;  1PUF B;  4NHJ A;  4BJ5 C;  2R3S A;  3QYE A;  2NS0 A;  4I7H A;  1OPC A;  4BYY A;  3H5A A;  3HOW J;  3JTH A;  4J00 A;  3ZCO A;  3KCC A;  5KVR A;  2XAJ A;  4P1W A;  4PDK A;  5CYV A;  2EV0 A;  1I3Q J;  2EZK A;  2B0L A;  2AQF A;  3IAM 2;  4LK0 F;  4JK1 X;  3PNY A;  2FUG 2;  2F4O B;  1TT0 A;  5EGO A;  4YII A;  3CLQ A;  4MIM A;  2GAU A;  4EQQ A;  5B1A H;  3TP3 A;  4U88 A;  4X0G A;  5K1Y A;  3U1D A;  1NH3 A;  1X1P A;  1ZG3 A;  2VJI A;  4CUG A;  3OYD A;  1BC7 C;  2XRL A;  1HST A;  1N75 A;  4IQJ A;  2K9S A;  4RM2 A;  2O7O A;  4IX7 A;  5L3B A;  1UG0 A;  1X2M A;  2RRE A;  4B4C A;  1G6N A;  1KQ9 A;  1KGS A;  2LR8 A;  2F48 A;  2Y30 A;  3KEO A;  3QWL A;  3G2B A;  3HHH A;  2DK8 A;  5E8I A;  3HL2 A;  1Z9C A;  1YJN I;  1J9I A;  3Q9S A;  1C0W A;  2IEK A;  5EF6 A;  2MGQ A;  1R1V A;  3LA2 A;  3BR1 A;  1MJB A;  4W97 A;  5D8K B;  2KDO A;  5FRN A;  3ZN1 A;  5LGT A;  1EV7 A;  3EUH C;  1MDM A;  2A05 A;  3LSJ A;  1OYW A;  3EUH A;  2RVC A;  3GWZ A;  2O6G E;  3QYB A;  4HLY A;  3S2W A;  1SVL A;  3TO9 A;  4ANJ A;  4ESB A;  2OJE D;  2FSW A;  1ODD A;  4U7D A;  2Z1D A;  3CCY A;  1K79 A;  1V5E A;  1Z7L A;  2VAS A;  3JAM Z;  3ELK A;  1W7P B;  2BVL A;  1YHQ I;  2OQR A;  2VBW A;  5E20 A;  4XRS A;  1OCZ H;  1ORK A;  4RS8 A;  1TT5 B;  3GZN B;  1PDN C;  1ETY A;  3I58 A;  2PEX A;  4F93 B;  2NOG A;  3GME A;  5M5W J;  2QEN A;  1Z7U A;  5D6E A;  1P92 A;  4XLP F;  3F72 A;  4A6E A;  2K3P A;  3GO5 A;  3S1Q J;  2X6W A;  2EIN H;  3B6C A;  2E60 A;  4D0P A;  1YW7 A;  2ZNZ A;  4A0X A;  1YE9 A;  3K1P A;  1UHM A;  4XOT A;  3CUQ B;  1Z6R A;  2M30 A;  4XKC A;  4EJW A;  3MZH A;  5FFX A;  3HKZ N;  3AL0 B;  5K5R A;  4EV0 A;  1LE8 A;  3GF2 A;  5E18 F;  1F36 A;  2VB6 A;  2RNG A;  1EH7 A;  2M1B A;  1T56 A;  3G1O A;  3ZMZ A;  5ICC A;  2A6H F;  2R7U A;  2YX4 A;  2A5W A;  3HHG A;  3V42 A;  3VYS B;  1SD6 A;  1R23 A;  1I6H J;  2M87 A;  4NUB A;  3SQN A;  4A5N A;  3H9J A;  3ZMV A;  3MKW B;  1KU7 A;  1WRJ A;  2DQL A;  3OS1 A;  1RUN A;  3GZ6 A;  3CTA A;  3DU5 A;  3ZMS A;  2Y31 A;  3OR1 C;  4AD9 A;  4YFX F;  4P55 A;  4BDY A;  4BHP A;  4LG0 B;  4Z6Y A;  3B02 A;  2R7W A;  2PMZ A;  5DDG A;  2MC3 A;  3J7Y J;  3FWE A;  1WH7 A;  3RKX A;  2D1V A;  5M3M J;  2ZJQ F;  2XKP A;  3S3O A;  4XR6 A;  3MAJ A;  1IF1 A;  2RGV A;  3R6S A;  4RAZ A;  4WXC A;  1UMQ A;  4KYW A;  1ZGJ A;  2R7T A;  2W25 A;  3L09 A;  2XGC A;  2X1D A;  4MEX F;  3I4M J;  1KU9 A;  3HGY A;  5LHH A;  5HS8 A;  1BOA A;  5F0F A;  3V7C A;  3NAU A;  2CQN A;  2L02 A;  4DZJ A;  2EFW A;  1TBX A;  3LA7 A;  1WH5 A;  2LTP A;  4HLX A;  2OA4 A;  1I27 A;  5EEA A;  4HG2 A;  3RI4 A;  2IS4 A;  3RTR A;  3C1D A;  1T2K A;  3DFG A;  4OIP F;  3BOQ A;  2JMW A;  2KZG A;  2WWY A;  2QQ8 A;  2HZT A;  1ZR4 A;  1FIP A;  2JQ7 A;  3DP7 A;  3LSR A;  2QBY B;  4B8X A;  3LQQ A;  2KHM A;  4R1H A;  3JRD A;  2IJL A;  2DT7 B;  3T1B A;  2RN7 A;  4L5J A;  4X1E A;  3TW6 A;  2ELK A;  5DYM A;  5J1U A;  4WF2 A;  3CJQ B;  4LD5 A;  1UG2 A;  3Q0U A;  3OIO A;  4KMU X;  1WCM J;  2YU3 A;  4WXD A;  3AG2 H;  1MZB A;  3V8K A;  4BJ6 C;  3CJN A;  2QSH X;  2CRG A;  3KX2 A;  1IN8 A;  3DKX A;  2MYS A;  3SEQ A;  4JYK A;  1V4R A;  2PJR A;  2HQA A;  4I6Z A;  2W84 A;  2DU9 A;  2EV6 A;  2MH2 A;  2EWN A;  1RZ4 A;  4PJN A;  4IVN A;  2ZFW A;  2QYO A;  2DOE A;  2R93 J;  1OLT A;  1DPU A;  4EMS A;  2K40 A;  3IRQ A;  5FLX Z;  2QQA A;  2M4G A;  2O03 A;  3G4S I;  5KAF C;  1JJ8 C;  2ZC2 A;  4NC7 A;  2W82 A;  3E97 A;  2F5E A;  3K10 A;  1IXC A;  3JR9 A;  1K4T A;  2DPD A;  5CPR B;  2COB A;  3F8C A;  4J01 A;  4ESJ A;  3QPT A;  1YTY A;  1UHS A;  3BZC A;  3RZO J;  1ZRF A;  4TV7 A;  5D5X B;  2DO7 A;  1O4X A;  1HKS A;  3BJ6 A;  3RCO A;  4CYD A;  3GFJ A;  3GTO J;  2YR2 A;  3QYF A;  2HQ5 A;  2ISY A;  5IYD J;  4OU0 A;  2HQR A;  1WGX A;  3S93 A;  1S7A A;  2A68 F;  1R6R A;  5F64 A;  3VPR A;  5DV5 A;  2VKH A;  2DYS H;  3FF5 A;  4PK4 A;  4H0E A;  1E2X A;  3RZD J;  2JSC A;  3WTW C;  4G7H F;  5JI6 A;  3SZP A;  2F5D A;  4C2T A;  4HF0 A;  3T8R A;  2FF4 A;  3FK7 A;  4CZC A;  3RYR A;  4A0Y A;  2WV1 A;  3OYL A;  1XCV A;  5D4S A;  5CVI A;  2FE3 A;  5FKN A;  1JTY A;  2QEX I;  2QZ8 A;  5M5Y J;  5JR3 A;  3VYU B;  1ZHF A;  4HAM A;  2B9S A;  1G8X A;  1S5L C;  3HKZ A;  2DT6 A;  2X85 A;  1VQN I;  4UXN A;  3L2U A;  1VQ6 I;  4BDZ A;  1GV2 A;  1OMI A;  3O8H A;  1OJL A;  3QOP A;  1BN5 A;  2EFQ A;  3BG3 A;  3RPQ A;  4Q4Z F;  2E2J J;  1U8B A;  1MH3 A;  2FQ4 A;  4F92 B;  2QVO A;  4MQ9 F;  2CMP A;  3FKJ A;  3HSF A;  5LEJ A;  3BR3 A;  2Y69 H;  4E6K G;  1ZR2 A;  1ONV A;  2ETH A;  2HOS A;  4AVZ A;  4DQ2 A;  2NS7 A;  2TDX A;  2OCE A;  1OR7 C;  4NNJ A;  2E19 A;  4NB5 A;  1XG1 A;  1K6Y A;  2Z9O A;  2IT0 A;  4WX9 A;  5IP7 J;  2DA6 A;  4MFD A;  1U5T B;  2DYR H;  1T39 A;  2HU9 A;  4RGX A;  2O5R A;  2QSG X;  3GUD A;  3RIR A;  1GDT A;  1ZRD A;  3VB2 A;  1FX7 A;  2HDW A;  4A5M A;  1XSD A;  3IV5 A;  5EDN A;  2H8W A;  1WJ5 A;  2Y2Z A;  2EV5 A;  2RV8 A;  2BY2 A;  4LLN A;  5LRS A;  1S7E A;  1J75 A;  3RQI A;  2L9V A;  2DMQ A;  4XON A;  2LP0 A;  2LVS A;  3AL0 C;  4AU7 A;  2K9M A;  2E1O A;  3GTP J;  2P5V A;  4G8X A;  3JSO A;  4E7L A;  3E6B A;  5F1R A;  4HSR A;  3KPH A;  4G9Y A;  5B5E C;  2V1N A;  4G12 A;  2GM4 A;  1P4A A;  9ANT A;  2VE9 A;  1XPX A;  5L3C A;  3A02 A;  5FLX K;  3K4C A;  4KIS A;  3DEU A;  5L3D A;  1V5F A;  3DKW A;  4FE4 A;  1E3H A;  4LG3 A;  5FGM A;  5BS6 A;  1SEU A;  2RNJ A;  2L7F P;  1Q1V A;  2FBH A;  2XB0 X;  1UEL B;  4XL9 A;  2NVX J;  4ITV A;  4I09 A;  3OYN A;  1LDJ A;  3ZMT A;  2MC4 A;  4UB6 C;  3F8N A;  1MMN A;  2MH9 A;  2P4W A;  4OIN F;  2ACJ A;  3OYC A;  2M0C A;  1F5T A;  2D5V A;  3IUO A;  4BQQ A;  4DZP A;  3QU3 A;  1FYK A;  2V6C A;  3GYH X;  3D5S C;  2HGC A;  1QHG A;  2J5O A;  2GA1 A;  3IKV A;  3CCM I;  1R9T J;  3A0B C;  1QVT A;  2XAS A;  5F0H A;  1WVR A;  3EPZ A;  1H88 C;  5DCM B;  3N97 A;  1MBE A;  1W0U A;  2CS3 A;  3A2K A;  2L54 A;  1O7L A;  4BQO A;  3MKZ A;  2L4A A;  4IF4 A;  2VKD A;  3I5U A;  4B48 A;  1YI2 I;  3WTS C;  1FBU A;  3P9I A;  1KU3 A;  4EGZ A;  4XLC A;  5HDG A;  4KIT B;  1FMW A;  1ZRC A;  3K69 A;  1OIS A;  4L5I A;  3F8F A;  3JRE A;  4CHU A;  2PMZ N;  3ABU A;  1DPR A;  5K5O A;  1RIO H;  1KYZ A;  4P96 A;  1B72 B;  1VQO I;  4HDU A;  3HOX J;  3HPG A;  3ZQI A;  3CDH A;  1P4X A;  2M34 A;  5GPA A;  1WI3 A;  2QA4 I;  4XLF A;  4BBS J;  3ROU A;  1JKO C;  4D1Q A;  2HFH A;  3A0H C;  1FTZ A;  2MA3 A;  4AYB A;  2W1O A;  4FET A;  1ETV A;  3ZOB A;  2CUZ A;  4II2 A;  4MGR A;  1HCR A;  3QPL A;  3BY6 A;  3PQK A;  1HKT A;  2IRF G;  2DA4 A;  3K1M A;  4UVB A;  1JHF A;  2GLO A;  4PJM A;  2V7F A;  3JRA A;  1U9O A;  4OIO F;  1QO0 D;  1F1Z A;  1F4K A;  2OF7 A;  2PMU A;  4I02 A;  4BXU A;  3TDZ C;  4OAZ A;  1P9Q C;  4LB6 B;  4G6D A;  5TIS C;  1FZP B;  3QAH A;  2UZK A;  1I50 J;  1U78 A;  2E71 A;  2HKX A;  2LBF A;  3LSH A;  2OD5 A;  3P7N A;  4JP0 A;  2OAZ A;  5GTI C;  2O8X A;  2KJB A;  4DYC A;  2FNA A;  3M8F A;  2KRC A;  1Y8Q B;  4QTR A;  5C4J J;  4G7O F;  1ZEL A;  3GW2 A;  4HX4 A;  3TP0 A;  3V7S A;  5EZH A;  4FCY A;  1HDP A;  1J09 A;  2R5Z B;  3TED A;  5H6R A;  1BW6 A;  4PGH A;  2F5V A;  5JLX A;  4AC0 A;  1A04 A;  2ME6 A;  1K61 A;  1RKT A;  3BLY A;  2UWM A;  2G9W A;  4KMF A;  2PJR B;  3HEF A;  3H3Z A;  3K4B A;  1EH8 A;  4P9U A;  1LQ1 A;  3OL3 A;  3GXO A;  3OSF A;  4A3J J;  4RAF A;  3KP4 A;  4OIQ F;  3IH2 A;  3QP6 A;  1EA3 A;  2V26 A;  3IC7 A;  4PUS A;  4IHV A;  2K9N A;  2ZO4 A;  1RRJ A;  1BR4 A;  1OFC X;  3H1C A;  5AON A;  1YX3 A;  1DGW Y;  2A3S A;  2DMU A;  3MWM A;  4ZYE A;  2HI3 A;  3E6D A;  3IWF A;  1IN6 A;  3TO6 A;  1W5S A;  2EA4 A;  3HSE A;  2CYY A;  4BU2 A;  2Y0S A;  3BRO A;  4O6J A;  2EFO A;  2DAO A;  2I8D A;  4G6Q A;  5D5W B;  3FXL A;  2JN6 A;  4KDP A;  3REO A;  3C7J A;  3A4C A;  2A6T A;  4H4K C;  4RGS A;  1QHH D;  3TMO A;  1P2F A;  2V4J C;  4A3G J;  1XCB A;  4A69 C;  5IP9 J;  3NEU A;  2XVC A;  2CUF A;  3IHU A;  2VI6 A;  1GV5 A;  4UUS B;  3OWT A;  3K70 C;  2R7Q A;  3Q0V A;  3VDX A;  3HUG A;  3LOC A;  4KIG A;  2RKH A;  5F1J A;  4XLA A;  2HYG D;  4CA0 A;  1XTA A;  3GTG J;  4B43 A;  2CV2 A;  1U6G A;  4BE2 A;  1R71 A;  2ZME B;  3EUK L;  1YOV B;  3N05 A;  4ASN A;  2HTJ A;  2BYV E;  1A6I A;  3LFU A;  3L2C A;  4EVI A;  3PL8 A;  5H20 A;  4UHT A;  3MKL A;  3GTQ J;  2DMN A;  1RUO A;  2E1M B;  5HLT A;  1WJE A;  1B6A A;  4BAC A;  2FA5 A;  2K3F A;  4GCV A;  4LIU A;  4O5V A;  4N9H A;  2XSD C;  1YIT I;  2E1N A;  2VC0 A;  3N4M A;  4YIR X;  1ZH5 A;  5J1Y A;  1PUE E;  5M3F J;  1FBQ A;  3S32 A;  1UCR A;  4BAY A;  3SEZ A;  2XUB A;  2XRO A;  1NHA A;  3BP8 A;  4LG0 A;  5EG0 A;  5HLI A;  4DGW B;  4ZH4 F;  2KKO A;  1R22 A;  2JSP A;  4JOM A;  2BV6 A;  4IHY A;  3S1N J;  3C2B A;  3P9C A;  2FQ3 A;  3HIF A;  3T5X A;  1GT0 C;  2XAH A;  1R4M B;  4AWX B;  2K85 A;  4XKW A;  2I10 A;  3KLO A;  4YFK F;  2GOM A;  3AG1 H;  4LLL A;  1CQT A;  1IZ1 A;  1N25 A;  3AG4 H;  3DPL C;  4ZYH A;  3ZPL A;  3BR5 A;  1LNW A;  4KJZ A;  3G6E I;  3ZQC A;  1FSH A;  1QQI A;  2DA7 A;  4WCG A;  3R61 A;  4CCO A;  1XSV A;  3CQZ J;  3K4M A;  4KN4 X;  3I54 A;  3WTV C;  3DU6 A;  3CO6 C;  2FOK A;  2IGN A;  2BW3 B;  3LST A;  1W5C C;  1VND A;  5KHD A;  1QVU A;  3BG9 A;  3O8G A;  3S15 J;  2P6S A;  3HM5 A;  3PM1 A;  1S6L A;  5IT9 K;  5B1B H;  3E5X A;  1V3F A;  1X19 A;  4AIJ A;  2QCO A;  1TW3 A;  4GXO A;  2RQQ A;  1PJR A;  4QPO A;  4IKF A;  2W24 A;  1FY7 A;  2DXI A;  1IO2 A;  5TRD A;  1I5Z A;  2DA1 A;  4P9F A;  3C18 A;  3IWZ A;  4Y4R A;  3KET A;  4FE7 A;  1TWA J;  4KNY A;  4YG2 F;  3JCU C;  1U9N A;  3V8J A;  1Z91 A;  4NQW B;  5HLG A;  2XB5 A;  1HC8 A;  3S14 J;  2MLG A;  3V7R A;  1X1D A;  1XGM A;  3FXQ A;  3RJP A;  3WTZ A;  1SD4 A;  1GHC A;  1NK2 P;  4ZYD A;  4KFC A;  2EZH A;  1JHH A;  4LGW A;  2DMP A;  4UVA A;  4CCM A;  3OS2 A;  3IKT A;  2L9N A;  3BTJ A;  5E1W A;  1BOB A;  4XOR A;  1PP7 U;  1RR8 C;  2FJ1 A;  5ICE A;  4RMN A;  3CDL A;  4C2U A;  5C3E J;  5LHG A;  1UZC A;  2HDD A;  2XPV A;  1TWF J;  5DCF A;  1Y1W J;  2F4I A;  3ECO A;  4L9N A;  1IN5 A;  2VQC A;  3LFK A;  4PGG A;  2KIS A;  2VLA A;  3ABT A;  4RGU A;  2Y48 A;  3IH4 A;  3CCU I;  1YS7 A;  2DI3 A;  5B3S H;  3K0L A;  2W85 A;  3J80 Z;  2O9L A;  4EM1 A;  1XGN A;  4FT8 A;  3KZI C;  4HF1 A;  3VOD A;  1T0F C;  4XBF A;  2X51 A;  3BC8 A;  1B4A A;  1IN4 A;  5ILV A;  2HOE A;  4RM3 A;  4RAY A;  5E3L A;  2ADU A;  2X4H A;  2FBK A;  3ZQ7 A;  3BPV A;  5J6X A;  2Z3Y A;  3OYJ A;  2V9P A;  5IYB J;  4IRI A;  2P5L C;  1MJ9 A;  3CMM A;  3OSG A;  3I59 B;  3M4O J;  2DFF A;  2VJJ A;  2E2H J;  2R7V A;  2RDP A;  1BJA A;  1GLN A;  3F9K A;  2MBF A;  2XF7 A;  4V2G A;  1IC8 A;  2F4M B;  3S17 J;  3SFZ A;  4OMY A;  2PI0 A;  3F22 A;  1FWZ A;  1VZ0 A;  4EJV A;  2EFP A;  4BEH A;  1MSE C;  3ZQG A;  3FX3 A;  3W2A A;  1SAX A;  4I0A A;  2F2E A;  4M3E A;  4BBR J;  5JHU A;  4HW0 A;  2B7E A;  5E8G A;  1APL C;  2JUC A;  2ZBK A;  1XN7 A;  1I1S A;  2ICW G;  4XQF A;  3GBG A;  2ZXH A;  3BQY A;  5J8F A;  2R92 J;  1HW5 A;  3HOS A;  1PP8 F;  2L4M A;  4IHW A;  3DTI A;  3W6V A;  4LFU A;  3SZT A;  3E5U A;  2E35 A;  3ERE D;  4HNU A;  4LOC A;  3KYC B;  3S1R J;  1E3O C;  2HYJ A;  3DV8 A;  2KQR A;  2XGE A;  5CVV A;  1FC3 A;  2CQX A;  1ETK A;  5D6F A;  5FLM J;  2XIG A;  1FOY A;  4HDV A;  5LGU A;  1YRN B;  2E2I J;  4RA2 A;  1WJF A;  2ZME C;  2VUM J;  2K4B A;  3KP5 A;  1VI0 A;  4I2O A;  3H92 A;  2A07 F;  1A36 A;  2EZI A;  2KJC A;  4M9Z A;  2JTV A;  4EJU A;  2OZU A;  3WE3 A;  1D0Y A;  1UAA A;  2R4G A;  2VBX A;  3ASO H;  4CO8 A;  4IPA A;  3QP5 A;  3VOE A;  4V19 K;  5CVJ A;  5DD4 A;  1G4D A;  1CGP A;  4KA4 A;  4B09 A;  1WQ2 A;  3DEW A;  4RB2 C;  5JFR A;  1X3W B;  3KZY A;  3UR3 C;  3OYG A;  3NRV A;  3H5N A;  2FBI A;  1XGO A;  3H9G A;  2R5Y A;  3OYB A;  2QF7 A;  5LRR A;  1Y39 A;  3J7Z I;  5C44 J;  3S16 J;  2K86 A;  4IOC F;  2HTS A;  4YIF A;  2XDV A;  2LOO A;  3F6O A;  4WXH A;  1DU6 A;  4JX5 A;  3GFM A;  2ELH A;  3AG3 H;  3KP3 A;  1JGG A;  5EZG A;  2Y0M A;  2L7K A;  2NVT J;  1S9H A;  2L9S A;  2VJ5 A;  4Y33 A;  1T38 A;  5FKM A;  3B6A A;  2X48 A;  3MQ0 A;  5HOD A;  3ABK H;  4OOI A;  1ERD A;  3GVA A;  4A3E J;  1Y6I A;  3TOB A;  5L3F A;  3GTK J;  1MMS A;  2TRT A;  3PJR A;  3W2W A;  3BWG A;  1Z1D A;  5HOO A;  3TBI A;  1QZE A;  3J81 Z;  2LY9 A;  2EFN A;  2DA5 A;  1YJ9 I;  2IGK A;  1B9N A;  1LVA A;  1PYV A;  1XMX A;  5HVQ C;  3VFZ A;  2W00 A;  2H1L A;  4PZJ A;  4B1R A;  4AYB N;  2L0K A;  4XOP A;  1ZG5 A;  2GXG A;  2BOL A;  2M9H A;  1U2W A;  2VBY A;  3CLO A;  1R49 A;  2JA6 J;  2P7V B;  2LG4 A;  3MVP A;  4Y13 A;  2KP6 A;  2H6B A;  1XC5 A;  4M6X A;  2CW8 A;  1X1A A;  4C9Y A;  2IA1 A;  3ONQ A;  4UV9 A;  3T0Y A;  3L2Q A;  2WB1 N;  1TTY A;  3M7G A;  2LRE A;  2XRN A;  1A35 A;  2C6Y A;  5LD2 C;  1D3Y A;  2WV0 A;  3ESW B;  3T8T A;  4I01 A;  3FM3 A;  1MBJ A;  4EJT A;  1J5Y A;  1XD7 A;  3ABM H;  3I71 A;  4HQE A;  3KYD B;  4HNT A;  1ZG1 A;  1R5G A;  2G7U A;  2VXZ A;  3I53 A;  1X1C A;  2R5Z A;  5D4R A;  2UXN A;  2IP2 A;  2TCT A;  3JRH A;  1ITY A;  5CVU A;  2LY1 A;  3PUB A;  1FJL A;  1O3T A;  2M7B A;  3R0J A;  1SFX A;  5BMZ A;  4FX4 A;  3WU0 A;  2WC2 A;  4RB3 C;  3LL7 A;  5BOX A;  1ZTR A;  2VJ4 A;  3LSP A;  1SD7 A;  1S7O A;  2BY1 A;  3E1S A;  1JXS A;  4OWR B;  3LQR A;  2ZFU A;  1QZZ A;  2NOJ B;  3WHB A;  3OV8 A;  2JT1 A;  2QUF A;  5J40 A;  3GX4 X;  2JA8 J;  1BIB A;  2QKL B;  2EZL A;  3SZG A;  4JX6 A;  3HB9 A;  3JAM K;  1OCP A;  1IDZ A;  2WB1 A;  3D0S A;  2P7C B;  2P0W A;  5F04 A;  5IY5 H;  3CP2 A;  4QWQ A;  4KIF A;  4L5E A;  4M6Y A;  4QSH A;  3E7L A;  2ZCW A;  2VBZ A;  3L9F A;  1MMD A;  3HOZ J;  1ZAR A;  2AS5 F;  2DDA A;  3LNQ A;  2HVS A;  3PSF A;  3OIQ A;  4UV8 A;  1AKH A;  3ZRG A;  3HTS B;  3G71 I;  4LIV A;  3IH3 A;  3WGH A;  4DOZ A;  1OCC H;  1LFP A;  2BXY A;  4NC6 A;  1JUM A;  1X1B A;  1MBF A;  2IA0 A;  4NQW A;  2DT5 A;  1D0Z A;  2KLO A;  1K4S A;  3QOD A;  3I3L A;  4ENK A;  3G1M A;  3EYI A;  2IGO A;  2K9L A;  4DBQ A;  2XC7 A;  1O3S A;  1MBK A;  5L3G A;  1HF0 A;  4U7B A;  2MG4 A;  4ZTF A;  2V79 A;  3U9G A;  2Q1Z B;  1JE8 A;  4ZZD A;  2WAD A;  4A3D J;  3BZ6 A;  4RB0 A;  2YSR A;  2RC4 A;  2DOA A;  5KAI C;  5D8L B;  3FK6 A;  1FMV A;  3ULQ B;  4EJO A;  5KNL A;  3Q9V A;  5GAH J;  2YUS A;  4HBL A;  2VOO A;  3DF8 A;  4B3A A;  4XK4 A;  2ZXJ A;  3TGN A;  1W5T A;  3CC7 I;  2BW3 A;  1ETX A;  3PFY A;  1MSF C;  2QSF X;  1HQC A;  1JGS A;  3I4N J;  1SMY F;  2IXS A;  2XSJ C;  1PUF A;  2ESH A;  1BL0 A;  1ZN2 A;  1IW7 F;  4DW6 A;  1A31 A;  4XKB A;  2FX0 A;  3MCZ A;  1JT0 A;  1T95 A;  4CCJ A;  2JVH A;  1Z0X A;  3OOU A;  3TOA A;  3ZR8 X;  2VOD A;  5DM6 F;  1TW2 A;  4HZF A;  4Q5S F;  5J4V A;  4M73 A;  3CME I;  1HLV A;  1G3Y A;  4IXA A;  3TKY A;  1BI1 A;  3CCE I;  4ABZ A;  1T6S A;  3BR0 A;  3FXO A;  2K7L A;  1K78 B;  2HDC A;  2V6E A;  2M5W A;  2BHZ A;  2OC6 A;  4II3 A;  1G3T A;  2FEZ A;  1SD5 A;  1ETO A;  3DPU A;  3I64 A;  2XKO A;  3O2P E;  5K5Q A;  4HST A;  1VQ8 I;  2QBY A;  4Y52 J;  1K78 A;  5K7H A;  1IXS B;  1YW9 A;  2X6Y A;  4M3D A;  2B63 J;  4HV5 A;  4PJ0 C;  1H8A C;  2E1C A;  1IRF A;  3FMR A;  5CVR A;  3RYP A;  2R7F A;  4U0V A;  2DTZ A;  2WAF A;  5C4X J;  3DWL E;  5FJ8 J;  2HNH A;  4GGG A;  2OTJ I;  4ON0 A;  1G2H A;  1YLF A;  3CC2 I;  2R7X A;  4FX0 A;  3KYL A;  5H6Q A;  1XX5 A;  3FXM A;  5J3L A;  4A3M J;  1WJB A;  4ENN A;  2A69 F;  1MD0 A;  1PVE A;  2D1H A;  3FXU A;  1BA5 A;  1RI7 A;  1Z3Y A;  4XRF A;  3BQZ A;  2FXA A;  4PCQ A;  1QGP A;  3I4P A;  3PO2 J;  2FRH A;  2VQH A;  2ZB9 A;  2DOD A;  2LD5 A;  4Q48 A;  4M72 A;  1H89 C;  5KK1 A;  4JX4 A;  1WFX A;  5BPD A;  4HA8 A;  3PUF A;  4HEA 2;  4KT6 A;  2DFE A;  5EEH A;  4FAS D;  2N8G A;  3G73 A;  5AIP A;  3KEY A;  2XAG A;  4EAT A;  5CLS A;  2GBY A;  4EM0 B;  1ZGW A;  4BGD A;  4MO7 A;  5BQT A;  2NS8 A;  2HR3 A;  3WHC A;  1NK3 P;  2DDB A;  4D5C A;  1SC7 A;  1QA6 A;  3LSG A;  3HG9 A;  1Y8R B;  3BTC A;  4ZYA A;  5ICG A;  2LH9 A;  4M3F A;  1BC8 C;  2CUJ A;  2OUM A;  4KUM A;  1ZK8 A;  2JA2 A;  3PSI A;  4HYE A;  4RLF A;  1OCR H;  3BG6 A;  4AIH A;  2E7X A;  1V55 H;  3R4K A;  1D1A A;  1GXQ A;  3DCF A;  3WTY C;  3SDG A;  2ZXW H;  2E36 A;  1G59 A;  3BG7 A;  1DGR M;  1GVD A;  2L7M P;  2P5K A;  4XM3 A;  5GAG J;  2VT3 A;  1U3E M;  4BE1 A;  2JA5 J;  2CV0 A;  2KL4 A;  4XMY A;  3K4L A;  3HOY J;  3OS0 A;  1HW2 A;  2BBY A;  4ENM A;  2RAE A;  4RGR A;  5HDN A;  5DM7 F;  1ON2 A;  3ZMU A;  2H27 A;  2KRF A;  2DA2 A;  3JRB A;  1MNM C;  1BI2 A;  2DK5 A;  3DTE A;  4B3X A;  2VON A;  1JJ6 C;  1R5I D;  3DBH B;  1IDY A;  4CXF A;  3JW4 A;  1ZAO A;  2XPU A;  1JKR C;  4G94 A;  2CW7 A;  5E1X A;  4Y17 A;  3OYA A;  2GIZ A;  3M1C A;  2JA7 J;  2ECB A;  3FZV A;  1AWC A;  1BJZ A;  3J81 K;  1KYW A;  2STW A;  1YYV A;  3A01 A;  3BCA A;  3HPH A;  3OYH A;  4FHT A;  1D1C A;  4D5F A;  4XLH A;  3WTU C;  2ZJP F;  3FDY A;  4DIQ A;  4PJL A;  4ZC3 A;  4M9S A;  1YO5 C;  1LFU P;  4KIB A;  4M3B A;  1FP1 D;  4R79 A;  1LJ9 A;  5IOY A;  1ZGA A;  3V4G A;  3SFI A;  2OBP A;  3BG5 A;  1UJ8 A;  2OCC H;  3PNV A;  3H0D A;  2K9Q A;  3EET A;  2O61 A;  4CYC A;  5FRM A;  3RSN A;  3FBN B;  4BQN A;  2JRT A;  1QU3 A;  1IV8 A;  2W4S A;  3OR2 C;  3RPU A;  4ENJ A;  2EPF A;  2LSO A;  4RB1 A;  1REP C;  4S04 A;  2XAQ A;  3H9Q A;  3A03 A;  1SVO A;  3E0J B;  1TLH B;  4E7H A;  5DTD A;  4ZYG A;  5DUI A;  2LY2 A;  3S1M J;  4N9I A;  3J7A O;  1FSE A;  3Q3S A;  1IAW A;  2QKM B;  5M5X J;  5JVG F;  3JRF A;  2M4K A;  1WJD A;  3FIW A;  1XSX A;  1JTX A;  2A5Y B;  3S8P A;  1W36 C;  2FMY A;  5ICF A;  4UB8 C;  1RC9 A;  3KP7 A;  1S29 A;  4IHS A;  4CGZ A;  3CCR I;  3CD6 I;  4XNF A;  5IP6 A;  1R1T A;  2ECC A;  2HVQ A;  2DOF A;  2L7Z A;  3KFW X;  1JKP C;  4UVC A;  3E6C C;  3K4N A;  2DLL A;  2DFI A;  2HZD A;  2PBI A;  3BTI A;  5FD5 A;  4HRI A;  3TO7 A;  1T33 A;  1VQ5 I;  3HSR A;  5HNH A; 
#chains in the Genus database with same CATH homology
 5FD6 A;  6PAX A;  5FFZ A;  3FHZ A;  3LAJ A;  4N0B A;  4L18 B;  4A12 A;  3GLX A;  4OIR F;  1L3L A;  2ZKZ A;  1ZLJ A;  4JBA A;  1O57 A;  2CGP A;  4A2U A;  1U8R A;  3EQL F;  4WWC A;  1I6X A;  1QPM A;  1SFE A;  2PLY A;  3JSP A;  4IRG A;  2XAF A;  1KQ8 A;  4I98 B;  3IL2 A;  2IVM A;  2H09 A;  2ISZ A;  2V9V A;  1J59 A;  1R00 A;  1XMA A;  3KZZ A;  5CJ9 A;  5L3E A;  3KP6 A;  5HLH A;  2STT A;  3F21 A;  3WOD F;  2DW4 A;  4LMY A;  2MD5 A;  4L0Y B;  2QM3 A;  1B1B A;  3B73 A;  4IRH A;  2Q2E A;  3G3Z A;  4U0Y A;  2GA2 A;  1LEA A;  1LDD A;  3MZY A;  2EJR A;  3KP2 A;  2CW0 F;  5DD8 A;  1USS A;  5LHI A;  2A6E F;  5E17 F;  1L0O C;  2KIU A;  4YFN F;  2F5F A;  2O0Y A;  3W6J B;  3Q5F A;  2MLK A;  1FPQ A;  1B59 A;  1Y0U A;  4A6D A;  1VTN C;  3ZP5 A;  4HX7 A;  3JTG A;  4L9V A;  4XLN F;  3BDD A;  2ESN A;  3M9A A;  5E1Z B;  2YX7 A;  1W7P D;  3H3U A;  4ESF A;  4CZZ A;  2CSO A;  2QLZ A;  2JPC A;  2LNB A;  1H9T A;  4BHC A;  1SMT A;  1OYI A;  1BIA A;  1S3J A;  3D5L A;  3F23 A;  4L9T A;  4BHB A;  3LA3 A;  4Q47 A;  2P8T A;  3WE2 A;  5BPI A;  3E6M A;  1O3R A;  1MGT A;  3RKY A;  3HRT A;  1FT9 A;  2PQ8 A;  3MFK A;  1P6R A;  4KN7 X;  1F9N A;  4QLC U;  3KLN A;  3GFI A;  3KEQ A;  2A61 A;  4G7Z F;  5ILU A;  2K4J A;  2VC1 A;  1STZ A;  1TNT A;  1BI3 A;  4AIK A;  1CF7 A;  4GYI A;  1LEB A;  2BEO A;  5IT9 Z;  4BH9 A;  3QRF F;  3FM5 A;  2FU4 A;  1BBY A;  2M45 A;  2NAZ A;  1MKM A;  4GYG A;  3L00 A;  3P9K A;  4ETS A;  3ML6 A;  1H9G A;  1GXP A;  2Z5U A;  1FLI A;  2GIV A;  1AOY A;  1UFM A;  1HW1 A;  2VE8 A;  4E70 A;  4UNO A;  2VN2 A;  1MDM B;  3CUQ A;  3O6B B;  1BI0 A;  1FOK A;  2QQ9 A;  2QWW A;  3C3W A;  3GFL A;  4A0Z A;  1I1G A;  3HRS A;  1LDK B;  3BPX A;  3CUO A;  1EH6 A;  5LLQ A;  3R0A A;  1HKQ A;  5ED4 A;  2IA2 A;  4L9J A;  4EM2 A;  4KIC A;  4MHG A;  5LGN A;  2JZY A;  5FB2 A;  1D5V A;  2OQG A;  2BE5 F;  5J8C A;  4LB5 A;  2L3D A;  3LWF A;  2XV4 S;  1MJA A;  4DNC A;  4MTE A;  3VEP A;  2PG4 A;  1XGS A;  1D8K A;  2V1U A;  3DQV C;  5ILS A;  1WI9 A;  1DUX C;  1ZRE A;  5FO5 A;  3SXY A;  1J7K A;  4JQF A;  1IXR C;  3OOP A;  1OKR A;  1XB4 A;  1LB2 A;  2HYF A;  1R36 A;  2LDU A;  3LAP A;  2XGX A;  4MTD A;  2W57 A;  2LKP A;  3WGG A;  5AIQ A;  1J2X A;  3F8B A;  3QPH A;  3I0T A;  3DPT A;  2PMH A;  3ZMD A;  1GVJ A;  1R7J A;  2UXX A;  2WTE A;  2BGC A;  3M1E A;  5A2Q Z;  3WTT C;  1R58 A;  1YG2 A;  2D45 A;  1FP2 A;  2G7H A;  3ISP A;  4AVP A;  4O3M A;  3PFI A;  5ERI A;  3COA C;  1TQM A;  3R60 A;  3V8L A;  1UST A;  3FMQ A;  4S05 A;  2OZ6 A;  3TDU C;  4U0W A;  3K2Z A;  4HQM A;  1W7P A;  4MQV A;  2PN6 A;  3GEZ A;  4XSZ F;  4Z2Y A;  1H0M A;  2DBB A;  3CO7 C;  3ECH A;  1Q1H A;  3I59 A;  2L01 A;  2KIF A;  2CG4 A;  2HEO A;  2F5C A;  2DPU A;  4K2E A;  1W4M A;  3HYI A;  1OR7 A;  3RDI A;  1S8N A;  2KIM A;  2J5P A;  1YW8 A;  1CF7 B;  3IRR A;  1XDU A;  4M74 A;  2V1D A;  1FYL A;  3SHF A;  1IRG A;  2LF7 A;  3QU6 A;  2HWV A;  2R7D A;  5IT3 A;  1XMK A;  2P6T A;  4GO1 A;  2NYX A;  4ZZL A;  2NNY A;  4L0Z B;  1U5T A;  2H6C A;  1E17 A;  2Q0O A;  1J0R A;  1TQP A;  2PJP A;  4Y15 A;  1YFH A;  2OU2 A;  3HOT A;  2O3F A;  4I0B A;  3WU1 B;  3F6V A;  4XSX F;  2GQQ A;  5HDK A;  5LEK A;  1ON1 A;  3HRU A;  3BJA A;  2EB7 A;  1QBJ A;  2HKO A;  1Z05 A;  1HBX G;  2X0L A;  4F7Z A;  2YPR A;  1IUY A;  1TQI A;  4HF2 A;  2CO5 A;  2M8E A;  5D5V B;  3FMS A;  1WWX A;  4MNU A;  1DDN A;  2LF8 A;  2GZW A;  5HS7 A;  3FXR A;  2GWR A;  1KQ0 A;  4HOB A;  3NQO A;  1RNL A;  3PQJ A;  4UUV A;  1KA8 A;  3CUQ C;  3K1N A;  3K9T A;  3BJO A;  3F3X A;  3WGI A;  3EDP A;  5DEQ A;  3DXJ F;  4IJA A;  1X3U A;  1HSJ A;  2QQB A;  1IN7 A;  4P5O A;  4M9X A;  3AAF A;  4HX8 A;  1ZLK A;  2NRA C;  1K7A A;  1G3S A;  5DCM A;  4CIC A;  2CQK A;  2FML A;  2NNN A;  1U5T C;  1WSU A;  1FNN A;  2CFX A;  1SFU A;  5TJJ A;  3RKW A;  1QZY A;  2EK5 A;  3WG9 A;  2PFB A;  1XDS A;  1YIO A;  3EYY A;  4LJZ F;  4M71 A;  2IW5 A;  1FYM A;  5EEG A;  2VOP A;  3E5Q A;  4R8H A;  1UHW A;  5JVT A;  4MEY F;  3F8M A;  1G3W A;  4BQA A;  3KE2 A;  1ULY A;  2Z33 A;  1HXD A;  4BNC A;  4KT5 C;  2Y75 A;  1FBS A;  3U2R A;  2H94 A;  3ZN0 A;  2K27 A;  4LK1 F;  1T98 A;  1T0F A;  2COM A;  2Q8K A;  4EGY A;  2RQP A;  1B9M A;  5D5U B;  1OYY A;  2GXB A;  3L7W A;  3O3K A;  5LBQ A;  4OMZ A;  2EA2 A;  2K02 A;  3GZ5 A;  2Z99 A;  1DP7 P;  4IHT A;  2ZJ2 A;  5HS9 A;  3E3V A;  1O7F A;  1O3Q A;  1P4W A;  4WK8 F;  4CDG A;  1YS6 A;  3HTU A;  4HV6 A;  2AXL A;  2D2W A;  1R5H A;  2VT2 A;  1ZYR F;  5F6F A;  1Z6T A;  2XHK A;  3J80 K;  1BM9 A;  2HS5 A;  5A2Q K;  2IPQ X;  1UB9 A;  2JPB A;  2FNP A;  2V1X A;  2E7W A;  2CWE A;  1WKM A;  3MEX A;  1R1U A;  3WTX C;  2DQR A;  2ZME A;  2DTR A;  1D8J A;  3W6K B;  1QNT A;  1KU2 A;  3M8E A;  5DUK A;  2ZNY A;  1K6O A;  3HRM A;  3TQN A;  1YQA A;  2HQN A;  1TNS A;  4LLG F;  4NHJ A;  2R3S A;  4I7H A;  2NS0 A;  1OPC A;  4BYY A;  3JTH A;  3KCC A;  5KVR A;  2XAJ A;  4PDK A;  5CYV A;  2EV0 A;  2B0L A;  4LK0 F;  4JK1 X;  4YII A;  2GAU A;  4EQQ A;  4U88 A;  5K1Y A;  3U1D A;  1ZG3 A;  1BC7 C;  1HST A;  5L3B A;  1G6N A;  1KQ9 A;  1KGS A;  5E8I A;  3KEO A;  1Z9C A;  3HHH A;  2DK8 A;  1J9I A;  3Q9S A;  1C0W A;  1R1V A;  3LA2 A;  1MJB A;  5D8K B;  3ZN1 A;  5LGT A;  1EV7 A;  1MDM A;  1OYW A;  3EUH A;  2RVC A;  3GWZ A;  2O6G E;  4HLY A;  3S2W A;  3TO9 A;  4ESB A;  2FSW A;  1ODD A;  4U7D A;  1K79 A;  3JAM Z;  3ELK A;  1W7P B;  2OQR A;  2VBW A;  5E20 A;  4RS8 A;  1PDN C;  3I58 A;  2PEX A;  2QEN A;  1Z7U A;  5D6E A;  1P92 A;  4XLP F;  3F72 A;  4A6E A;  3GO5 A;  4D0P A;  1YW7 A;  2ZNZ A;  4A0X A;  3K1P A;  1UHM A;  3CUQ B;  1Z6R A;  2M30 A;  4EJW A;  3MZH A;  5FFX A;  5K5R A;  4EV0 A;  3GF2 A;  5E18 F;  1EH7 A;  2M1B A;  3ZMZ A;  5ICC A;  2A6H F;  2YX4 A;  3HHG A;  1SD6 A;  1R23 A;  2M87 A;  3SQN A;  4A5N A;  3ZMV A;  1KU7 A;  1WRJ A;  2DQL A;  1RUN A;  3GZ6 A;  3CTA A;  3ZMS A;  4YFX F;  4AD9 A;  4P55 A;  4BHP A;  4LG0 B;  3B02 A;  5DDG A;  2MC3 A;  3FWE A;  3RKX A;  2D1V A;  2XKP A;  3MAJ A;  1IF1 A;  2RGV A;  3R6S A;  4RAZ A;  4WXC A;  4KYW A;  1ZGJ A;  2W25 A;  3L09 A;  4MEX F;  1KU9 A;  5LHH A;  5HS8 A;  1BOA A;  3V7C A;  2L02 A;  2EFW A;  1TBX A;  3LA7 A;  4HLX A;  2OA4 A;  1I27 A;  3RI4 A;  3RTR A;  3C1D A;  1T2K A;  3DFG A;  4OIP F;  3BOQ A;  2WWY A;  2HZT A;  3DP7 A;  2QBY B;  4B8X A;  3LQQ A;  4R1H A;  2IJL A;  3T1B A;  2RN7 A;  4L5J A;  5DYM A;  4WF2 A;  4LD5 A;  4KMU X;  2YU3 A;  4WXD A;  3V8K A;  1MZB A;  3CJN A;  1IN8 A;  1V4R A;  2W84 A;  2DU9 A;  2EV6 A;  2MH2 A;  2EWN A;  1RZ4 A;  4IVN A;  2ZFW A;  2QYO A;  1DPU A;  4EMS A;  3IRQ A;  5FLX Z;  2QQA A;  2O03 A;  3E97 A;  2F5E A;  1IXC A;  2DPD A;  3F8C A;  4ESJ A;  3QPT A;  1YTY A;  1ZRF A;  4TV7 A;  5D5X B;  2DO7 A;  1HKS A;  3BJ6 A;  4CYD A;  3GFJ A;  2YR2 A;  2ISY A;  4OU0 A;  2HQR A;  1S7A A;  2A68 F;  5F64 A;  5DV5 A;  3FF5 A;  4H0E A;  1E2X A;  2JSC A;  3WTW C;  4G7H F;  5JI6 A;  3SZP A;  2F5D A;  4HF0 A;  3T8R A;  2FF4 A;  3RYR A;  4A0Y A;  1XCV A;  5D4S A;  5CVI A;  2FE3 A;  2QZ8 A;  5JR3 A;  1ZHF A;  4HAM A;  4UXN A;  1OMI A;  3QOP A;  1BN5 A;  2EFQ A;  3RPQ A;  4Q4Z F;  2QVO A;  4MQ9 F;  3HSF A;  5LEJ A;  1ONV A;  2ETH A;  4DQ2 A;  2TDX A;  4NB5 A;  2Z9O A;  2IT0 A;  4WX9 A;  1U5T B;  1T39 A;  4RGX A;  3GUD A;  3RIR A;  1ZRD A;  3VB2 A;  1FX7 A;  4A5M A;  1XSD A;  2EV5 A;  2RV8 A;  4LLN A;  5LRS A;  1J75 A;  2P5V A;  4G8X A;  3JSO A;  3E6B A;  5F1R A;  4G9Y A;  1P4A A;  2VE9 A;  5FLX K;  5L3C A;  3DEU A;  5L3D A;  5FGM A;  3DKW A;  5BS6 A;  2RNJ A;  2FBH A;  4I09 A;  1LDJ A;  3ZMT A;  3F8N A;  2ACJ A;  2MH9 A;  2P4W A;  4OIN F;  1F5T A;  3QU3 A;  1FYK A;  2V6C A;  3GYH X;  2HGC A;  2J5O A;  2GA1 A;  3IKV A;  2XAS A;  5DCM B;  3N97 A;  2L54 A;  1O7L A;  2L4A A;  4IF4 A;  3I5U A;  3WTS C;  1FBU A;  3P9I A;  1KU3 A;  4EGZ A;  5HDG A;  1ZRC A;  3K69 A;  4L5I A;  3F8F A;  4CHU A;  3ABU A;  5K5O A;  1DPR A;  1RIO H;  1KYZ A;  4P96 A;  4HDU A;  3CDH A;  1P4X A;  3ROU A;  2HFH A;  2MA3 A;  4MGR A;  3BY6 A;  3PQK A;  1HKT A;  2IRF G;  3K1M A;  4UVB A;  1JHF A;  4OIO F;  1QO0 D;  1F1Z A;  1F4K A;  2PMU A;  4I02 A;  4BXU A;  3TDZ C;  4LB6 B;  4G6D A;  1FZP B;  3QAH A;  2UZK A;  1U78 A;  2HKX A;  2OD5 A;  3P7N A;  2OAZ A;  2O8X A;  2KJB A;  2FNA A;  3M8F A;  4G7O F;  3GW2 A;  4HX4 A;  3V7S A;  5H6R A;  4PGH A;  1A04 A;  2UWM A;  2G9W A;  4KMF A;  3H3Z A;  1LQ1 A;  1EH8 A;  4P9U A;  3GXO A;  3KP4 A;  4OIQ F;  3QP6 A;  3IC7 A;  2ZO4 A;  5AON A;  2A3S A;  4ZYE A;  3MWM A;  3E6D A;  3IWF A;  1IN6 A;  3TO6 A;  1W5S A;  2EA4 A;  3HSE A;  2CYY A;  3BRO A;  4O6J A;  2EFO A;  2DAO A;  4G6Q A;  5D5W B;  4KDP A;  3REO A;  3C7J A;  4RGS A;  1P2F A;  1XCB A;  3NEU A;  2XVC A;  3IHU A;  3HUG A;  4KIG A;  2RKH A;  2HYG D;  1U6G A;  2ZME B;  4ASN A;  2HTJ A;  2BYV E;  3L2C A;  4EVI A;  5H20 A;  4UHT A;  1RUO A;  1B6A A;  2FA5 A;  4GCV A;  4O5V A;  4N9H A;  2E1N A;  2VC0 A;  3N4M A;  1ZH5 A;  1PUE E;  1FBQ A;  1UCR A;  4BAY A;  2XUB A;  2XRO A;  1NHA A;  3BP8 A;  4LG0 A;  5HLI A;  4ZH4 F;  2KKO A;  1R22 A;  2BV6 A;  3P9C A;  2FQ3 A;  3HIF A;  3T5X A;  2XAH A;  4AWX B;  3KLO A;  4YFK F;  4LLL A;  1IZ1 A;  3DPL C;  4ZYH A;  3ZPL A;  1LNW A;  1FSH A;  1QQI A;  4WCG A;  3R61 A;  1XSV A;  4KN4 X;  3I54 A;  3WTV C;  3CO6 C;  2FOK A;  3LST A;  2P6S A;  1S6L A;  5IT9 K;  3E5X A;  1V3F A;  4AIJ A;  1TW3 A;  4GXO A;  2W24 A;  1FY7 A;  5TRD A;  1I5Z A;  4P9F A;  3C18 A;  3IWZ A;  3KET A;  4KNY A;  4YG2 F;  3V8J A;  1Z91 A;  5HLG A;  2MLG A;  3V7R A;  1XGM A;  3FXQ A;  3RJP A;  3WTZ A;  1SD4 A;  1GHC A;  4ZYD A;  4KFC A;  1JHH A;  4LGW A;  4UVA A;  3IKT A;  5E1W A;  1PP7 U;  5ICE A;  5LHG A;  5DCF A;  3ECO A;  4PGG A;  4L9N A;  1IN5 A;  3LFK A;  3ABT A;  4RGU A;  2Y48 A;  1YS7 A;  2DI3 A;  3K0L A;  2W85 A;  3J80 Z;  4EM1 A;  1XGN A;  4FT8 A;  4HF1 A;  3VOD A;  4XBF A;  1B4A A;  1IN4 A;  5ILV A;  2HOE A;  4RAY A;  2ADU A;  2X4H A;  2FBK A;  3ZQ7 A;  3BPV A;  5J6X A;  2Z3Y A;  4IRI A;  2P5L C;  1MJ9 A;  3I59 B;  2RDP A;  1BJA A;  2MBF A;  3SFZ A;  4OMY A;  2PI0 A;  3F22 A;  1FWZ A;  4EJV A;  2EFP A;  3FX3 A;  1SAX A;  4I0A A;  2F2E A;  5JHU A;  4HW0 A;  5E8G A;  2ZBK A;  1XN7 A;  1I1S A;  5J8F A;  1HW5 A;  3HOS A;  1PP8 F;  2L4M A;  4LFU A;  3SZT A;  3E5U A;  3ERE D;  3DV8 A;  5CVV A;  1FC3 A;  5D6F A;  2XIG A;  4HDV A;  5LGU A;  2K4B A;  3KP5 A;  4I2O A;  3H92 A;  2A07 F;  2KJC A;  4M9Z A;  2JTV A;  4EJU A;  2OZU A;  3WE3 A;  2VBX A;  4CO8 A;  4IPA A;  3QP5 A;  3VOE A;  5CVJ A;  5DD4 A;  1G4D A;  1CGP A;  4KA4 A;  4B09 A;  1WQ2 A;  4RB2 C;  5JFR A;  3KZY A;  3NRV A;  2FBI A;  1XGO A;  5LRR A;  2K86 A;  2HTS A;  4YIF A;  3F6O A;  4WXH A;  3GFM A;  2ELH A;  3KP3 A;  2Y0M A;  1T38 A;  3MQ0 A;  4OOI A;  3GVA A;  3TOB A;  5L3F A;  3BWG A;  1Z1D A;  5HOO A;  3J81 Z;  2EFN A;  1B9N A;  1LVA A;  5HVQ C;  3VFZ A;  4PZJ A;  1ZG5 A;  2GXG A;  1U2W A;  2VBY A;  3CLO A;  2P7V B;  4Y13 A;  2H6B A;  4M6X A;  2IA1 A;  3T0Y A;  4UV9 A;  1TTY A;  3M7G A;  2XRN A;  2C6Y A;  1D3Y A;  2WV0 A;  3T8T A;  4I01 A;  3FM3 A;  4EJT A;  1J5Y A;  1XD7 A;  3I71 A;  4HQE A;  1ZG1 A;  1R5G A;  2G7U A;  2VXZ A;  3I53 A;  5D4R A;  2UXN A;  2IP2 A;  5CVU A;  1O3T A;  3R0J A;  1SFX A;  5BMZ A;  4FX4 A;  3WU0 A;  2WC2 A;  4RB3 C;  5BOX A;  1SD7 A;  1S7O A;  1JXS A;  3LQR A;  1QZZ A;  3OV8 A;  2JT1 A;  2QUF A;  3GX4 X;  1BIB A;  3JAM K;  3D0S A;  2P7C B;  4QWQ A;  4KIF A;  4M6Y A;  2ZCW A;  2VBZ A;  3L9F A;  1ZAR A;  2AS5 F;  4UV8 A;  3HTS B;  3WGH A;  2IA0 A;  4NQW A;  2DT5 A;  4ENK A;  3EYI A;  1O3S A;  5L3G A;  4U7B A;  2V79 A;  3U9G A;  1JE8 A;  4ZZD A;  3BZ6 A;  4RB0 A;  2YSR A;  2RC4 A;  5D8L B;  3ULQ B;  4EJO A;  3Q9V A;  4HBL A;  2VOO A;  3DF8 A;  2ZXJ A;  3TGN A;  1W5T A;  1HQC A;  1JGS A;  1SMY F;  2ESH A;  1ZN2 A;  1IW7 F;  3MCZ A;  3TOA A;  2VOD A;  1TW2 A;  4HZF A;  4Q5S F;  4M73 A;  1G3Y A;  4IXA A;  3TKY A;  1BI1 A;  1T6S A;  2K7L A;  1K78 B;  2HDC A;  2M5W A;  2FEZ A;  1G3T A;  1SD5 A;  3I64 A;  3O2P E;  2XKO A;  5K5Q A;  2QBY A;  1K78 A;  1IXS B;  1YW9 A;  4HV5 A;  2E1C A;  1IRF A;  3FMR A;  5CVR A;  3RYP A;  2R7F A;  4U0V A;  4GGG A;  4ON0 A;  1YLF A;  4FX0 A;  5H6Q A;  4ENN A;  2A69 F;  1MD0 A;  3FXU A;  2D1H A;  1RI7 A;  4XRF A;  2FXA A;  4PCQ A;  1QGP A;  3I4P A;  2FRH A;  4Q48 A;  4M72 A;  5KK1 A;  5BPD A;  4HA8 A;  5EEH A;  3G73 A;  5AIP A;  2XAG A;  5CLS A;  4EM0 B;  5BQT A;  2HR3 A;  5ICG A;  1BC8 C;  4KUM A;  4HYE A;  4AIH A;  2E7X A;  3R4K A;  1GXQ A;  3WTY C;  2P5K A;  2VT3 A;  1U3E M;  1HW2 A;  2BBY A;  4ENM A;  4RGR A;  5HDN A;  1ON2 A;  3ZMU A;  2H27 A;  2KRF A;  1BI2 A;  2DK5 A;  2VON A;  4CXF A;  3JW4 A;  1ZAO A;  4G94 A;  5E1X A;  4Y17 A;  3FZV A;  1AWC A;  3J81 K;  1KYW A;  2STW A;  1YYV A;  4FHT A;  3WTU C;  4M9S A;  1YO5 C;  4KIB A;  1FP1 D;  4R79 A;  1LJ9 A;  1ZGA A;  3V4G A;  2OBP A;  3EET A;  2O61 A;  2JRT A;  3RPU A;  4ENJ A;  2LSO A;  4RB1 A;  1REP C;  4S04 A;  2XAQ A;  1TLH B;  4ZYG A;  5DUI A;  4N9I A;  3J7A O;  1FSE A;  1IAW A;  1XSX A;  2A5Y B;  2FMY A;  5ICF A;  3KP7 A;  1S29 A;  4IHS A;  4CGZ A;  1R1T A;  3KFW X;  4UVC A;  3E6C C;  2DLL A;  2DFI A;  2PBI A;  5FD5 A;  3TO7 A;  3HSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...