2Z33A

Solution structure of the dna complex of phob dna-binding/transactivation domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
b'MAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*CP*TP*GP*TP*CP*AP*TP*AP*AP*AP*TP*CP*TP*GP*T)-3'
publication title Water-mediated interactions between DNA and PhoB DNA-binding/transactivation domain: NMR-restrained molecular dynamics in explicit water environment.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 25
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2z33A00
4OMZA 5ILVA 3N97A 4RAZA 2DQRA 4L9TA 4M71A 3GZ6A 5E17F 3I59B 3R6SA 5HDKA 3GYHX 1G3TA 2ELHA 3F23A 3KZZA 1F4KA 2Z99A 5LEKA 1XD7A 2G7HA 5F64A 5LHHA 2YPRA 4IRGA 5H6QA 4HDUA 3SZTA 2HKOA 1EH6A 1SAXA 4CXFA 4MQ9F 4I0BA 2YSRA 4N0BA 3ECOA 3NEUA 3R0JA 5K5OA 2ADUA 3RYPA 2J5PA 3DV8A 3GFIA 2F5FA 3E5XA 1Z7UA 1RI7A 2EFQA 2QBYB 1KQ0A 1J5YA 2BE5F 2H6BA 5EEGA 4R8HA 2M87A 1USSA 3MWMA 1KA8A 2R3SA 2PQ8A 1HSTA 3GUDA 5E1WA 2P6SA 3GFMA 3F72A 1ZRDA 3D0SA 5HOOA 5LBQA 4S05A 1T38A 1KQ8A 3MEXA 1VTNC 1YW9A 4WX9A 5DD4A 4ZZDA 1S7OA 4BH9A 1ZG1A 1S3JA 1D5VA 3FF5A 2O6GE 4CHUA 2QQAA 2OZ6A 4HZFA 3HTSB 4AIJA 4A5MA 4LG0A 1FYMA 3KZYA 3M7GA 2GXGA 4UVBA 3KEOA 4ENKA 4E70A 5HDNA 2Q0OA 3EYYA 2FBIA 2HYFA 4EVIA 3EETA 5CVUA 1XN7A 2NNNA 4FX4A 1SFUA 5CVRA 4I09A 2IA2A 2V79A 2BEOA 3REOA 2FEZA 2CFXA 4WXCA 2RQPA 1H0MA 1W5TA 2W24A 5L3BA 3BPVA 3U1DA 1ZRCA 4BQAA 2O61A 1HKSA 4EGZA 1FP2A 1W4MA 2NS0A 2D45A 2F5CA 1O3SA 4CICA 1XB4A 2E7WA 3CO6C 2A07F 5FO5A 4XSZF 2DK8A 1S7AA 3E6BA 1F5TA 1FYLA 2ESNA 3IL2A 1XDUA 5K5QA 3OV8A 4NB5A 3D5LA 1KU9A 2EFWA 1V4RA 2NAZA 3HHGA 3WTYC 4U7DA 2WC2A 1W5SA 2ETHA 3VODA 4A0YA 1YQAA 5FD6A 1S29A 2K4BA 1FT9A 1U2WA 2LF8A 4K2EA 2KKOA 2WV0A 5CJ9A 4M6YA 3WTVC 3JTHA 5LLQA 1DPUA 1YLFA 4WCGA 3TGNA 2ZKZA 3LQQA 3BOQA 2V1XA 1K79A 2MLKA 3FM3A 1OYIA 5D6EA 4H0EA 5JHUA 1IN6A 2X4HA 5E8IA 3F8BA 4D0PA 3Q9VA 3M9AA 5TRDA 5D4SA 3RI4A 2EV6A 1FPQA 4A6DA 3DXJF 1T6SA 2FBHA 4WK8F 4EJVA 3BY6A 4WF2A 3T8RA 4PGHA 4RB0A 1RZ4A 4XLNF 3F8MA 1IN8A 3QP6A 2XAGA 4YFKF 1AWCA 4LLGF 4PGGA 3F8NA 2NYXA 1STZA 2KRFA 2M8EA 4AIKA 3CUOA 1ZH5A 3BZ6A 4M74A 5TJJA 2KIUA 2ZNZA 3FMRA 4MEYF 1KU2A 5AIPA 1SFEA 2FRHA 3I59A 5HDGA 3R60A 4BYYA 1E17A 1TQIA 1XGNA 2K7LA 5DEQA 1B9NA 1G3SA 4BAYA 2Y0MA 3RKYA 3CTAA 2DQLA 2TDXA 2EFOA 2J5OA 2A68F 1TLHB 2HR3A 1XDSA 4RGUA 3P9KA 4U7BA 2BBYA 2ZJ2A 2EV5A 2OAZA 3MCZA 1HKTA 2FU4A 5L3DA 3L00A 1C0WA 1JHHA 2YU3A 3WGIA 4BHCA 5FB2A 2QBYA 1WSUA 4Y15A 1U3EM 1UHWA 5J8CA 1UHMA 1P4XA 5DUIA 2VT3A 5LEJA 3JAMK 1EV7A 4MHGA 2DW4A 3GFJA 1SMYF 3I54A 1MKMA 4LG0B 2VN2A 1GHCA 2ESHA 2F5EA 1LEAA 1XSXA 3QP5A 2B0LA 2UWMA 1K7AA 5CVVA 2PJPA 1B9MA 4BNCA 1P2FA 4HV5A 2OA4A 3BPXA 4AWXB 3LSTA 1L3LA 1R58A 5JR3A 1BI3A 2NNYA 4IRIA 3SXYA 1FSHA 1KYZA 1R23A 1TQPA 4LK1F 4KA4A 3E6MA 1CF7B 1MZBA 4UXNA 3CUQB 1J7KA 3IRQA 2VOOA 3HRSA 3GO5A 2EFNA 5ICGA 2XAQA 2DI3A 4L0ZB 4IHSA 1IN7A 3MZHA 4Q5SF 3HSEA 1YW7A 3EQLF 3WE3A 3J81K 5ICFA 2STWA 4LB5A 3RKWA 4HA8A 2IA1A 3FXQA 4GGGA 2A61A 4ZH4F 4G7OF 4O5VA 3K9TA 2PFBA 2RC4A 4L5IA 2HGCA 2VONA 5BMZA 5AONA 1J75A 3L9FA 3NRVA 4CO8A 2IPQX 3TOBA 4L0YB 1DPRA 3I58A 2JTVA 1FYKA 4RGSA 3CUQC 3VEPA 2ZBKA 1LB2A 3LWFA 2QWWA 3TDUC 3ZMUA 3RDIA 1T0FA 4PCQA 1Q1HA 4FT8A 2W84A 3GWZA 1L0OC 1W7PB 4G6DA 3TOAA 1OPCA 2EK5A 1MD0A 3KFWX 2W85A 2LDUA 2PLYA 3E5QA 3RPQA 2GA2A 3F3XA 3ECHA 2A6HF 3ROUA 2P7VB 1PUEE 1ULYA 2O3FA 3HYIA 5HS9A 2GAUA 1BN5A 1QNTA 5DCFA 1ZARA 3HTUA 5E1ZB 3PQKA 4LK0F 1U6GA 3M1EA 1IUYA 2ZFWA 3WU1B 3DF8A 3K2ZA 3DEUA 2CW0F 1REPC 3KE2A 2H6CA 5D5XB 4HW0A 4IPAA 3QRFF 2ACJA 4ZZLA 3PQJA 2L3DA 1KGSA 2YX4A 2UXXA 4HF0A 2OBPA 3V4GA 4LB6B 1R1UA 4P96A 3SZPA 1P6RA 1GXQA 2EFPA 2CGPA 1ZLJA 2FOKA 4G94A 3E3VA 2R7DA 2XHKA 1FLIA 3LQRA 2AS5F 3SFZA 3GFLA 4KNYA 2Q2EA 5ILSA 1ON2A 3GW2A 3JAMZ 3L2CA 2G9WA 4CZZA 2EB7A 4Z2YA 3IKTA 2Z9OA 3WTWC 4HX4A 1BC8C 2K27A 4EM1A 3RYRA 1ZN2A 2L02A 4XRFA 4RB2C 4U0YA 4OIOF 2YR2A 3EDPA 2ZXJA 5E8GA 1G6NA 5FFXA 1HW1A 5DV5A 5H6RA 1F1ZA 5D5VB 3ELKA 1T98A 5LGNA 2E7XA 4WXDA 3CLOA 1BM9A 3V7CA 4XLPF 5F1RA 2PN6A 3R61A 4HF2A 4RS8A 5E20A 1FBSA 2UXNA 1YYVA 3K1MA 1J2XA 3P7NA 2XROA 2RKHA 5D5WB 1R00A 2VBZA 4HOBA 4I2OA 1LDJA 1I5ZA 2GA1A 2EJRA 3IKVA 3J80K 1MJAA 1OYYA 1A04A 4ESJA 1UB9A 1ZYRF 1XSVA 2XUBA 2VE9A 5LHGA 2MD5A 3IC7A 4F7ZA 2Z33A 4QWQA 1RUOA 4HLYA 1XGMA 4U0VA 3SQNA 5IT9K 1P4WA 5HS7A 3H3UA 5FD5A 1OR7A 2OU2A 4MQVA 2XAHA 2HQNA 2DK5A 3JSOA 3B02A 3ZN0A 2IA0A 3RKXA 3QOPA 2COMA 4OU0A 4EJOA 1FP1D 3TQNA 3EYIA 1CF7A 5BOXA 3CUQA 2LKPA 2E1CA 5HLIA 2Q8KA 3KP3A 4YFNF 4EQQA 2M45A 2XKOA 2QQBA 2A6EF 1LDDA 3OOPA 2QUFA 1D3YA 5ED4A 2CYYA 3KLOA 3GX4X 1ZREA 2V1UA 3LAJA 3F22A 2XIGA 3ZMVA 2FXAA 4HQMA 4Q4ZF 1ZAOA 2P7CB 1K78A 2JPCA 3JW4A 2STTA 5JI6A 4P9FA 2MH2A 2FMYA 3PFIA 3V7SA 2GXBA 5ILUA 4XBFA 5FGMA 2F5DA 3U9GA 2D1VA 1ZHFA 2Z3YA 1SD7A 2K02A 1PP7U 1I1GA 3COAC 1I6XA 3HUGA 3KP2A 4R1HA 1KU7A 4M9SA 1FBUA 4I01A 1LEBA 4HQEA 1JHFA 3F6VA 4ZYGA 4L9NA 5HS8A 2MA3A 4IF4A 3BWGA 1W7PA 1X3UA 3WTTC 3QAHA 1Z05A 3FZVA 3GF2A 4IJAA 4UVAA 2KIMA 2HTJA 5J8FA 5D6FA 4BHPA 3ZN1A 2BV6A 3E6CC 4B8XA 3FWEA 2F2EA 5FFZA 3ZP5A 4UVCA 5ICEA 3SHFA 2DT5A 2FE3A 4KICA 2O0YA 1WWXA 1TQMA 2O8XA 4RAYA 1U8RA 2DBBA 1XCVA 4GYGA 1IXRC 2IW5A 5LGUA 3LFKA 1JGSA 2DLLA 4GXOA 3TDZC 2A69F 3I5UA 1SD5A 3G73A 4Y13A 3RTRA 4L18B 1ZRFA 2L4MA 2FMLA 4EJWA 1WI9A 1Z1DA 5E18F 3HHHA 1H9TA 3MFKA 1U78A 4ENNA 3KP7A 1Z9CA 4B09A 4YFXF 2A5YB 3KETA 2OQRA 2MLGA 2VBWA 1FSEA 2GWRA 1IRFA 2YX7A 1KU3A 3JSPA 1GXPA 2QYOA 2ZCWA 1FC3A 5A2QK 4EJUA 1MJBA 2CQKA 5D8KB 2WTEA 5E1XA 3T0YA 4ENJA 3GEZA 3T1BA 3LAPA 3P9IA 2G7UA 2OD5A 5BPIA 2HYGD 2JRTA 5ICCA 4LMYA 1AOYA 3C3WA 1YTYA 2C6YA 4A0XA 4UHTA 1XGOA 1XMAA 2EWNA 4RB3C 2IT0A 5IT9Z 4EJTA 4HAMA 4KT5C 1TTYA 1Y0UA 1ON1A 5K1YA 3T5XA 4ON0A 5IT3A 4S04A 3F8CA 5CVIA 5KK1A 1HBXG 2BYVE 1I1SA 1I27A 2ISZA 1FNNA 4PDKA 2W57A 1PP8F 1BI1A 2ISYA 1H9GA 4ESFA 4DNCA 3BJOA 2IRFG 3M8FA 4A6EA 2VXZA 1J9IA 3C18A 3BJ6A 3IRRA 4YIFA 1SD4A 4LD5A 1CGPA 1D8KA 1G3YA 1O3RA 4JK1X 1R1VA 4KIFA 3ZMTA 1QPMA 4LFUA 3I53A 3ML6A 5DUKA 4L9JA 4KMUX 2H94A 1BI0A 3ZQ7A 1O3QA 1KQ9A 3WGHA 1K78B 3DP7A 4N9HA 3W6JB 5FLXK 3P9CA 2JZYA 1B4AA 3Q9SA 2HFHA 3H92A 4G7HF 2GIVA 4Q48A 4G8XA 3I71A 4BXUA 4KDPA 1FOKA 3L7WA 1BBYA 1GVJA 2VT2A 4EMSA 1DUXC 3L09A 4Q47A 1R36A 2HZTA 2RGVA 1BJAA 4YIIA 1WKMA 4OIPF 3HSRA 4RGRA 2CO5A 2L54A 3KLNA 2VC1A 3N4MA 5EEHA 3WGGA 4KN7X 4KN4X 1YW8A 5DYMA 4JBAA 4EV0A 5DCMB 5L3EA 1IAWA 2ZNYA 1J0RA 5D5UB 1RNLA 3K69A 1V3FA 1B6AA 2HQRA 3WTXC 4CYDA 2KJBA 5BS6A 4UV9A 4M9ZA 3BROA 2IVMA 1R22A 2VBYA 3KP6A 4I7HA 4JQFA 3DQVC 2DO7A 1S6LA 4WXHA 4KFCA 4O6JA 2EV0A 3J7AO 2UZKA 5BQTA 2Y75A 2PMUA 1SFXA 4ASNA 1F9NA 5H20A 4OIQF 4KUMA 2X0LA 3F6OA 4M73A 1WRJA 2DAOA 1JXSA 2V1DA 2HDCA 4HBLA 1YO5C 2AXLA 2DPUA 1XGSA 3S2WA 1QBJA 2V9VA 1IN4A 4AD9A 1YFHA 4ZYEA 3U2RA 5ERIA 1DP7P 2A3SA 2XAFA 2HOEA 5K5RA 4KIBA 1USTA 3C1DA 4P5OA 3E6DA 1Z6RA 4GYIA 1TW2A 3R0AA 4OOIA 5LRSA 3WU0A 2CWEA 3LA3A 4HV6A 2FF4A 2CSOA 3GXOA 3O3KA 1U5TB 3QU3A 2MC3A 1QQIA 1XSDA 3O6BB 2QENA 1B1BA 2P5LC 3DKWA 1B59A 1FBQA 3IHUA 3Q5FA 1TNSA 2D2WA 1JE8A 3CJNA 4NHJA 1LNWA 2FA5A 3TKYA 1HSJA 1HW2A 4OIRF 2LNBA 2DU9A 2FQ3A 2XVCA 4HDVA 2BGCA 1OYWA 3BJAA 2EA2A 3TO7A 4LLLA 3LA2A 5J6XA 1D8JA 3MZYA 2QQ9A 5CLSA 1O7LA 1U5TC 3FXRA 3ABTA 3HIFA 4UNOA 2R7FA 1UFMA 4EGYA 3V8KA 3J81Z 2PBIA 4P55A 4KIGA 3I64A 1MJ9A 2W25A 1O3TA 2FSWA 1NHAA 4KMFA 1QGPA 3BP8A 3G3ZA 1TW3A 5FLXZ 4G9YA 4OMYA 3GLXA 2Z5UA 3T8TA 1EH8A 3IWFA 4MEXF 3VFZA 3FMQA 1IF1A 1G4DA 2XKPA 4MTDA 3HOSA 3FMSA 1YIOA 3K1NA 2DFIA 4HYEA 4EM0B 4M6XA 3E97A 4Y17A 2H09A 3ZMZA 2PI0A 3HRUA 2LF7A 2P6TA 2DTRA 4HLXA 2MBFA 1OMIA 4MGRA 3FHZA 3KCCA 5LHIA 3WTSC 4A0ZA 3C7JA 1G3WA 1FZPB 3V8JA 1XCBA 1PDNC 1R5HA 4EM2A 1MDMB 1ODDA 3DPTA 1YG2A 3IWZA 1IXSB 3I4PA 3TO9A 3WTUC 3F21A 1IXCA 3ERED 1SD6A 1HQCA 5HLHA 4A5NA 3K0LA 4CGZA 2OQGA 3BDDA 4U0WA 2H27A 2M5WA 1MGTA 2KIFA 3HSFA 2Y48A 2ZMEB 1J59A 2HTSA 1Z6TA 4I02A 4LLNA 4GO1A 4OINF 3QU6A 5DCMA 1RIOH 4DQ2A 2NRAC 4BHBA 1HW5A 3MAJA 1DDNA 1S8NA 1LDKB 1IW7F 2FNPA 3MQ0A 5HVQC 1YS6A 2IP2A 2RN7A 3FXUA 1SMTA 5JFRA 1BIAA 5L3FA 2DPDA 3E5UA 2P4WA 3GZ5A 3JTGA 1QZZA 2XGXA 5JVTA 1WQ2A 2RV8A 2ZO4A 1E2XA 3I0TA 4UV8A 1ZGJA 4AIHA 4P9UA 3EUHA 4CDGA 1O57A 1OKRA 4AVPA 3GVAA 2MH9A 3ABUA 4G6QA 4NQWA 2XRNA 2EA4A 4A12A 5LGTA 3ZMDA 4O3MA 2M30A 1FWZA 2RDPA 2VOPA 4FX0A 4N9IA 5DD8A 1U5TA 2HEOA 1FY7A 3J80Z 4LJZF 2VE8A 4IRHA 3WODF 4ZYHA 2QLZA 3HRMA 1R5GA 2PEXA 4QLCU 1ZGAA 4U88A 1YS7A 1ZLKA 2M1BA 4RGXA 5BPDA 2L01A 3VOEA 3LA7A 1R1TA 3KP4A 4IXAA 5AIQA 3RIRA 3QPTA 4RB1A 3H3ZA 1IN5A 4GCVA 3WTZA 4HX7A 3W6KB 5DDGA 3RPUA 5KVRA 5L3CA 4G7ZF 2HKXA 2LSOA 1QO0D 3B73A 1BC7C 3DPLC 3ISPA 2V6CA 1BI2A 2D1HA 3TO6A 4ESBA 3FX3A 2K4JA 2P5KA 4I0AA 2QVOA 2FNAA 4WWCA 3HOTA 1KYWA 3K1PA 2L4AA 1ONVA 4TV7A 4IHTA 3WG9A 1Z91A 1P92A 3F8FA 4R79A 1ZG3A 2XV4S 1LVAA 4M72A 1O7FA 3AAFA 2JT1A 2K86A 1LQ1A 3CO7C 3O2PE 1RUNA 2OZUA 2RNJA 3ZMSA 2XASA 2E1NA 3QPHA 4XSXF 2O03A 2QZ8A 4L9VA 6PAXA 3ULQB 5CYVA 2VC0A 2P5VA 3RJPA 4YG2F 2PG4A 2WWYA 2GQQA 3CDHA 4ETSA 3DFGA 4PZJA 1ZG5A 3HRTA 5D8LB 1P4AA 5LRRA 4M9XA 3NQOA 1XMKA 4MNUA 2JSCA 1FX7A 5CVJA 1IRGA 3V8LA 1HXDA 3M8EA 3V7RA 4HX8A 3KP5A 2XAJA 2P8TA 2PMHA 1W7PD 2GZWA 1MDMA 2HWVA 1IZ1A 4HF1A 1UCRA 4UUVA 2IJLA 4KYWA 4A2UA 1TBXA 4I98B 1TNTA 1EH7A 1QZYA 2VBXA 1K6OA 1BIBA 2VODA 4MTEA 5L3GA 2KJCA 5HLGA 2JPBA 2QM3A 3VB2A 1LJ9A 2ZMEA 2FBKA 3R4KA 4IVNA 3WE2A 1R7JA 4ENMA 1BOAA 2CG4A 2RVCA 5A2QZ 4LGWA 3ZPLA 4ZYDA 4L5JA 4FHTA 3KEQA 2HS5A 1HKQA 1T2KA 5F6FA 5D4RA 1T39A 3FM5A
chains in the Genus database with same CATH superfamily
4OMZA 3SEZA 3J7ZI 5ILVA 4A3FJ 3HG9A 4RAZA 3N97A 2R5YB 2DQRA 4L9TA 1U8BA 2M7BA 2M2EA 1JUPA 3HKZN 3OR1C 4M71A 3GZ6A 2R7XA 2EBIA 4NQWB 4DJAA 1MNEA 5E17F 3I59B 4LITA 3R6SA 4B4CA 5HDKA 3GYHX 1G3TA 2ELHA 3S93A 3F23A 3KZZA 1F4KA 2Z99A 3H5RA 5LEKA 4I6ZA 1XD7A 2G7HA 5F64A 3G71I 3BTLA 5LHHA 3B6CA 2YPRA 4IRGA 5H6QA 2PMZA 4HDUA 3SZTA 2HKOA 1EH6A 1SAXA 3KEYA 1Z0XA 4CXFA 3BLYA 4MQ9F 4I0BA 5FROA 1K4SA 2CUEA 2K40A 1T95A 2YSRA 4N0BA 3ECOA 5J1RA 3NEUA 3R0JA 5K5OA 2ADUA 5KAIC 3PNTA 3RYPA 1UELB 2K9NA 2J5PA 4BBSJ 3DV8A 3OYEA 3GFIA 2ZJQF 2M0CA 2F5FA 3E5XA 1Z7UA 1D1AA 2HI3A 1RI7A 2EFQA 2DMNA 2NOGA 1QHHD 2RAEA 2R5ZB 2QBYB 1ENHA 1VQKI 4XM3A 3FK7A 4DZPA 1WVRA 1KQ0A 1J5YA 1Z7LA 2BE5F 2H6BA 1N75A 5EEGA 4R8HA 2M87A 2COBA 4IQ4A 2N8GA 1USSA 3DBHB 1FIAA 2K9LA 1A35A 4M3FA 4IOCF 3MWMA 1KA8A 4Y33A 2R3SA 3NAUA 2PQ8A 1HSTA 2DFEA 1ZGWA 2OCCH 3GUDA 5E1WA 1RRJA 3S3OA 2FJ1A 2P6SA 3GFMA 1LUJB 3F72A 3OYLA 2IGKA 2LK2A 3RKQA 2VJJA 3D0SA 5HOOA 1ZRDA 5LBQA 4S05A 1T38A 1KQ8A 1J09A 3MEXA 1VTNC 3HOZJ 1S5LC 1Y0NA 1YW9A 3OSFA 3D5RC 4WX9A 1MBKA 2DCEA 5DD4A 4ZZDA 1XS9A 1S7OA 1K61A 4BH9A 1ZG1A 1S3JA 4BL0B 5B66C 1D5VA 1VQ7I 5M5YJ 1V5GA 1I39A 2XSJC 3FF5A 2O6GE 3CDIA 5EDNA 2KRCA 4CHUA 3BR5A 5FKOA 2QQAA 2W00A 3HBLA 2HOAA 1ETQA 2OZ6A 4HZFA 3HTSB 2LBFB 3FISA 4AIJA 3ZR8X 4A5MA 5J4YA 4LG0A 1FYMA 1OQYA 3KZYA 3M7GA 2GXGA 3BG6A 4UVBA 3OYNA 4YIRX 4CZCA 3KEOA 2MYSA 4MFEA 2L7ZA 4NBQA 3HL2A 2HVSA 4ENKA 4E70A 3L2UA 4XKBA 3S1MJ 2ZXHA 1X19A 5BNGA 2KT0A 5HDNA 2Q0OA 3EYYA 1FOWA 2FBIA 2HYFA 4EVIA 3EETA 2LP0A 3H9QA 3AG1H 4RM2A 5CVUA 1IDZA 3CCQI 1H88C 1XN7A 2NNNA 4FX4A 3LFUA 1SFUA 5CVRA 4I09A 2IA2A 2V79A 1SC7A 2BEOA 3REOA 2FEZA 2CFXA 4WXCA 1FJLA 4XKCA 2RQPA 1H0MA 3M4OJ 1W5TA 2W24A 3EPZA 5L3BA 3BPVA 5EZGA 5GADJ 4OAYA 3U1DA 4XKVA 1ZRCA 4BQAA 2O61A 1HKSA 4EGZA 1FP2A 3WHCA 1W4MA 2NS0A 4LIVA 2D45A 1IRXA 2F5CA 1O3SA 3CC4I 2XC7A 4CICA 1XB4A 2E7WA 3CO6C 2A07F 5FO5A 1VI0A 2LOOA 4XSZF 5FRMA 1AHDP 1F43A 2DK8A 1S7AA 3E6BA 3K70D 3CESA 1F5TA 1FYLA 5LD2C 2ESNA 3IL2A 5GPAA 2HPMA 1XDUA 5K5QA 3OV8A 4NB5A 4CH7A 3D5LA 4ZTFA 1KU9A 5EG0A 3HXLA 3S16J 3ZGKA 2EFWA 1V4RA 2NAZA 2HDDA 3HHGA 1T08B 2NVUB 3OYGA 2L9VA 5EZHA 5F0FA 3TEDA 3WTYC 1WJAA 3Q0UA 4U7DA 1MSFC 3H9GA 2P0WA 2WC2A 2CQXA 1BR4A 1W5SA 2TRTA 2ETHA 3VODA 4BXFA 4A0YA 2GM4A 4RBOA 1YQAA 5FD6A 1S29A 2K4BA 1FT9A 1U2WA 2LF8A 4K2EA 2R4GA 2KKOA 4NDLA 2WV0A 4XOTA 5CJ9A 4M6YA 3BT9A 3W2AA 3WTVC 3JTHA 5LLQA 1DPUA 1YLFA 1X3ZB 4QIWN 3RCOA 4WCGA 3TGNA 2ZKZA 3LQQA 5DTDA 4CCOA 3BOQA 2V1XA 4CUGA 1IJWC 1K79A 3HOWJ 3FBNB 1ETOA 2DA3A 1JT6A 2MLKA 3FM3A 1OYIA 5D6EA 1VQPI 4H0EA 5JHUA 1IN6A 2X4HA 5E8IA 3F8BA 3BR2A 4D0PA 3Q9VA 4CSWA 1NG6A 3M9AA 2KDOA 5TRDA 2Z1DA 5D4SA 3RI4A 2EV6A 3K4JA 2B63J 4AIDA 3OS1A 1FPQA 4A6DA 2VQHA 3DXJF 4MFDA 4RLFA 2DODA 4XRSG 1T6SA 2FBHA 2O9LA 3CF5F 4WK8F 4EJVA 3BY6A 4WF2A 2K5CA 1SEUA 2ZXWH 3T8RA 4BQQA 4PGHA 2CQQA 2JUGA 5J4VA 4A3CJ 1T0FC 1ORKA 3GZNB 4DW6A 4RB0A 2M4KA 1VQLI 1RZ4A 4IEJA 3NWSA 1A31A 4XLNF 2Y69H 3F8MA 2XB5A 1IN8A 5EEAA 3QP6A 3LSIA 2XAGA 2LRDA 3TP3A 2LREA 1IG7A 4BACA 4YFKF 1DP3A 1AWCA 4LLGF 2K3PA 5DS9A 4X1EA 3IH3A 4PGGA 3F8NA 2NYXA 1STZA 2KRFA 2M8EA 4AIKA 3CUOA 3S1RJ 1ZH5A 3BZ6A 2JK3A 2HZDA 4M74A 5TJJA 5K7ZA 1JT0A 2R5YA 2KIUA 2ZNZA 3FMRA 4MEYF 1WJCA 4JX4A 2VKVA 1KU2A 2XGCA 3F9KA 5AIPA 3CCUI 1SFEA 2FRHA 5C44J 1D0XA 2YUSA 3I59A 1IC8A 5HDGA 2X1EA 2Q2EB 3R60A 3MKYB 4C2UA 4BYYA 3K6GA 3C2BA 2I10A 1E17A 1TQIA 2XGEA 1MIJA 5CKTA 1XGNA 2K7LA 5DEQA 4E7SA 3PSFA 4F91B 1B9NA 1G3SA 4BAYA 3S2HJ 1QZEA 2Y0MA 5GAGJ 2DDBA 3RKYA 2ECBA 3CTAA 2DQLA 1YE9A 2EFOA 2TDXA 2J5OA 3S8PA 2A68F 2DJIA 1TLHB 2HR3A 1XDSA 4RGUA 3K4KA 3P9KA 4U7BA 2BBYA 2ZJ2A 4UB8C 4V19K 1UG2A 3MKLA 1AKHB 3ESWB 2EV5A 2OAZA 3MCZA 3OIOA 3ZQHA 3MKWB 1HKTA 5TISC 2FU4A 4B3XA 1PJRA 1X1CA 2LY2A 5L3DA 2W7NA 3L00A 1C0WA 1JHHA 2YU3A 3WGIA 3BC8A 3S32A 3BG9A 4BHCA 3RQIA 2R5ZA 3S1NJ 5FB2A 2QBYA 3SEQA 1WSUA 4Y15A 2DA7A 1U3EM 3CDLA 1UHWA 2FD5A 3E1SA 5J8CA 2XRLA 2K3FA 2V9PA 1UHMA 1P4XA 5DUIA 2VT3A 3GTGJ 5LEJA 3JAMK 3JRCA 3OSGA 3CC7I 1EV7A 2WAQN 4MHGA 1BL0A 2DW4A 3U1KA 1D1BA 2CFOA 3GFJA 4A3BJ 4CCKA 1SMYF 2DMPA 3VYUB 3I54A 1MKMA 1NH3A 2Y9ZA 4BJ6C 4LG0B 2VN2A 4E4HA 1GHCA 2ESHA 2F5EA 2E60A 2I8DA 1LEAA 1XSXA 3QP5A 2DT6A 2B0LA 5JVGF 2UWMA 2XPUA 3LSHA 1K7AA 5CVVA 2PJPA 1B9MA 4BNCA 2XGDA 3DTKA 3VYTB 1P2FA 1WHUA 4HV5A 2OA4A 3BPXA 3ZQFA 4BU2A 3I9V2 1AA7A 4IOAF 4QTRA 4DBRA 2HVRA 4AWXB 5GTHC 2WY8Q 3LSTA 2LBFA 4ZYAA 1S9HA 1L3LA 1R58A 2E5ZA 1VNDA 5JR3A 1BI3A 1LFBA 2NNYA 4IRIA 2LC2A 2QSHX 3SXYA 1FSHA 1KYZA 1R23A 1TQPA 2BW3B 4LK1F 4KA4A 3E6MA 1CF7B 1MZBA 4UXNA 3CUQB 1J7KA 3IRQA 2VOOA 3H36A 1TT5B 3HRSA 4HSRA 3GO5A 2BY2A 2IEKA 2EFNA 1JKQC 1SVLA 5LFAA 3JRFA 5ICGA 1VQ5I 3G6EI 2XAQA 2IXSA 2DI3A 4L0ZB 4IHSA 2VLAA 1IN7A 3WU2C 3MZHA 4Q5SF 3OYFA 4DGWB 3SFIA 2NVQJ 3HSEA 1YW7A 3EQLF 3WE3A 3J81K 3CCMI 1HA8A 5ICFA 2STWA 4LB5A 2JJ7A 4Y52J 5IP7J 1SFKA 3RKWA 4HA8A 2IA1A 3FXQA 4GGGA 2XSDC 2BY0A 5B1AH 2A61A 3GMEA 4ZH4F 1OR7C 3VSKA 4BQOA 4QSHA 4BBRJ 5JHFA 2LR8A 4G7OF 4O5VA 3K9TA 2R7ZJ 2PFBA 4CA0A 2E1MB 2RC4A 4A3GJ 4L5IA 2HGCA 3B6AA 4PK4A 2VONA 5BMZA 5AONA 1J75A 5F0CA 3L9FA 3NRVA 4CO8A 1U9NA 2IPQX 5IY5H 3GBGA 3A02A 2R93J 3TOBA 4L0YB 1WJFA 1DPRA 3I58A 4PJJA 2JTVA 3OYDA 1FYKA 1FTZA 2IGNA 5IPAA 4RGSA 3CUQC 3VEPA 2ZBKA 3HUGB 1LB2A 3LWFA 2QWWA 2X6OA 3TDUC 1OCOH 3ZMUA 3RDIA 2CU7A 1T0FA 3NARA 3QYFA 4PCQA 2E36A 1Q1HA 2CW8A 4FT8A 3Q0VA 2W84A 2PX9A 2ELJA 1DGWY 3GWZA 1L0OC 1ERDA 4BGDA 1HCRA 1W7PB 2Z2SB 4G6DA 3TOAA 3J7YJ 1OPCA 2EK5A 1MD0A 3KFWX 1I3AA 2PJRB 2W85A 2LDUA 3MN2A 1X1AA 2Q1ZB 2PLYA 2JWTA 3E5QA 3RPQA 2GA2A 3F3XA 3ECHA 3PUFA 2A6HF 1GUUA 3ROUA 2P7VB 2ZSIB 4MLOA 4E6KG 1PUEE 1ULYA 2OUMA 3TBIA 2O3FA 3HYIA 1MH4A 2ZXIA 3HDDA 2E5NA 2DT7B 3IH2A 5HS9A 3SZGA 2GAUA 3I4MJ 1BN5A 2HXOA 1KONA 1QNTA 5DCFA 2E1MC 1HDPA 4RAFA 1MNMC 4OWRB 1ZARA 3W6VA 1B8IB 3I55I 4BUPA 2PMZN 3OYCA 5K7HA 3JR9A 3HTUA 3K4CA 5E1ZB 3K4BA 2BXZA 3PQKA 4LK0F 1U6GA 2M8GX 3A4CA 2XF5A 3M1EA 1IUYA 2ZFWA 4NUBA 3WU1B 3DF8A 1WJ5A 4A3LJ 3CD6I 2Y2ZA 4A3JJ 1N78A 3K2ZA 1DU6A 4XLCA 5GTIC 2DJNA 3DEUA 2CW0F 1HF0A 2JSPA 1REPC 4BEHB 3KE2A 3EUKL 2H6CA 2BHYA 5D5XB 5J3LA 4HW0A 4IPAA 2OTJI 3GTMJ 3QRFF 4J19A 2ACJA 4ZZLA 1X1PA 3OYMA 3PQJA 2L3DA 3S3MA 1KGSA 2EILH 4IHVA 2NS7A 5GPCA 4Z6YA 3DU5A 2JQ7A 2YX4A 2UXXA 3GTQJ 4HF0A 2OBPA 2DA5A 2MGQA 4LB6B 3V4GA 1R1UA 3PNYA 4P96A 3SZPA 1ZR4A 1WH7A 1P6RA 1GXQA 3KPHA 2EFPA 2VKHA 2ICWG 1R49A 4D1QA 2VQLA 1G59A 2CGPA 4NNJA 1ZLJA 3Q3SA 2BY3A 2FOKA 2KFDA 2FOWA 3E3VA 4G94A 5F27A 2R7DA 4GFBA 3SDBA 4XN0A 2XHKA 1FLIA 3LQRA 2AS5F 1APLC 3SFZA 1VF9A 3GFLA 3CJRB 4KNYA 2Q2EA 5ILSA 1ON2A 4BJ5C 3GW2A 3L2WA 2AQFA 3JAMZ 3LL7A 3L2CA 1QU3A 4DZJA 4G6TB 1WJDA 1X2NA 1HLVA 4MO7A 4DYCA 2WBMA 2G9WA 4CZZA 2EB7A 4Z2YA 4XLEA 4XK4A 3IKTA 2Z9OA 3WTWC 4HX4A 1JJ8C 1BC8C 3DEEA 2K27A 4EM1A 4FISA 2WV1A 3RYRA 2ZFUA 1ZN2A 2L02A 4XRFA 4RB2C 4U0YA 4OIOF 2YR2A 3EDPA 2NXNB 3MD2A 4W1UA 2LMDA 1AKHA 2ZXJA 5FRNA 5E8GA 1T39A 2E1OA 1G6NA 3CC2I 2VJ4A 1HW1A 5FFXA 3GTJJ 5DV5A 5H6RA 3RPUD 1F1ZA 5D5VB 3ELKA 1T98A 5LGNA 2E7XA 1BA5A 1XX5A 2X1CA 4F3QA 4WXDA 3VYRB 3ASNH 3EUHC 3I4NJ 3CLOA 1BM9A 2ELKA 4PJLA 3V7CA 1UAAA 2VKEA 4XLPF 1HC8A 3CQZJ 5F1RA 2PN6A 1Y8QB 2F4OB 3R61A 4HF2A 4RS8A 2V9KA 4AC0A 5E20A 1FBSA 1BJZA 2UXNA 1YYVA 4IZZA 3ZQGA 3K1MA 1J2XA 2DDAA 3P7NA 2XROA 2RKHA 3HM5A 5HODA 3PNVA 5D5WB 1R00A 2K9QA 2VBZA 3BQZA 4HOBA 2Y31A 4F92B 1WJEA 2O7OA 4IHXA 3KX2A 4D9JA 4I2OA 4RDUA 1LDJA 1I5ZA 2GA1A 1V54H 2EJRA 3M07A 3IKVA 2EPFA 2BOLA 3OYBA 1RR8C 2L7KA 3J80K 1Z21A 1QVUA 1MJAA 4ZJZA 2EH3A 1OYYA 2E71A 1A04A 4ESJA 1MNDA 1UB9A 1ZYRF 1XSVA 3W2VA 2XUBA 2VE9A 5LHGA 1D1CA 2MD5A 3DBLB 3FIWA 3IC7A 4GDFA 4FTHA 3C2GA 4F7ZA 2Z33A 4HSTA 4QWQA 1ITYA 2V1NA 1WI3A 2K9MA 4JP0A 2L7MP 2QEXI 1RUOA 2X6WA 4HLYA 1XGMA 4U0VA 4C30A 3SQNA 3MMYB 5IT9K 1P4WA 5HS7A 3H3UA 4D5FA 5FD5A 1GDTA 1OR7A 2ID6A 2OU2A 3DCFA 4MQVA 2LVSA 2XAHA 3LNQA 2HOTA 2HQNA 1WPKA 2DK5A 3JSOA 5M3FJ 1EA3A 4EATA 3B02A 3ZN0A 2F4IA 2IA0A 3RKXA 3QOPA 2COMA 4OU0A 4PUSA 4E7IA 1S72I 4UY8I 4EJOA 1FP1D 3KYLA 3TQNA 3D5SC 3AKZA 2BW3A 3EYIA 1CF7A 3HOXJ 5BOXA 3CUQA 2DA2A 4RLQA 4I76A 1RPWA 2LKPA 3W2WA 2UUZA 1DGRM 2V26A 2E1CA 3OYIA 5HLIA 4HNUA 2Q8KA 3KP3A 3CMAI 3OS0A 4YFNF 4EQQA 2M45A 2DYRH 2XKOA 1PVEA 3HGGA 4C9YA 2QQBA 1EJ9A 4LOCA 4XOPA 2A6EF 4AYBA 4W97A 1LDDA 3FHNA 3FM5A 3OOPA 2QUFA 1D3YA 5ED4A 2CYYA 3KLOA 3GX4X 2L9NA 1ZREA 2V1UA 5HLTA 2WY7Q 3LAJA 3F22A 2XIGA 3BCAA 2FXAA 3ZMVA 4HQMA 4Q4ZF 1ZAOA 2P7CB 4I99C 1K78A 2JPCA 3JW4A 4B43A 2STTA 3ABLH 1TT0A 5JI6A 4P9FA 2MH2A 1MBFA 2FMYA 3PFIA 3V7SA 2LG4A 1VFCA 5ILUA 4XBFA 3L2QA 2GXBA 1FOXA 5FGMA 2F5DA 5KCMA 3U9GA 3BTIA 2D1VA 3H0DA 1ZHFA 2X48A 4JX6A 2Z3YA 2NVXJ 1SD7A 3CCVI 2K02A 2R7SA 5IOYA 1PP7U 1SANA 2VPRA 1I1GA 4HEA2 1OLTA 3BTJA 1EKEA 2Y30A 3COAC 1I6XA 2BVLA 1LKXA 4AU7A 3HUGA 2QSGX 3KP2A 5IYCJ 1H89C 4R1HA 1MBHA 1KU7A 4M9SA 1FBUA 4I01A 1LEBA 4HQEA 2JMWA 1JHFA 3H35A 4NC7A 4XMYA 3F6VA 5C4JJ 3LSPA 4ZYGA 3VPRA 4L9NA 2RQQA 5HS8A 1LE8B 3I56I 3ASOH 2MA3A 2EINH 3HZJA 2MC4A 2LY1A 4IF4A 3BWGA 1W7PA 5FLVA 2A6TA 1X3UA 3WTTC 2CQ7A 3QAHA 1WGXA 1IUFA 1Z05A 3K70C 2PJRA 3FZVA 3GF2A 3FKJA 4IJAA 4UVAA 2KIMA 3PIOF 2HTJA 5J8FA 1MH3A 5D6FA 3FXJA 1LPQA 3JRDA 4BHPA 3ZN1A 2BV6A 2IS4A 4JX5A 2VB6A 3E6CC 4B8XA 3FWEA 3CCRI 2F2EA 2XAUA 2VASA 1PUFB 2X85A 4UUTA 5FFZA 3OYAA 3ZP5A 4UVCA 2KZGA 2B7EA 3S3NA 1B8IA 2KIQA 2X9DA 5ICEA 2L9RA 2DT5A 2FE3A 4KICA 3SHFA 2O0YA 1WWXA 4HG2A 3VYSB 3KYCB 1RESA 2DOFA 1TQMA 1K6YA 2R7OA 4C2MJ 2O8XA 4RAYA 1U8RA 1G2HA 2R7WA 2DBBA 1TWHJ 5EF6A 1XCVA 4GYGA 3GTKJ 1IXRC 2IW5A 2R7UA 5LGUA 3LFKA 1JGSA 4V2FA 2DLLA 1R5ID 3IAM2 1T56A 2KZVA 4N4NB 4GXOA 3TDZC 1NTCA 2A69F 3I5UA 1SD5A 4BEHA 3G73A 2ID3A 4Y13A 3RTRA 3ZQCA 4L18B 4XL9A 1ZRFA 2L4MA 4DOZA 2FMLA 4QPQA 3HOYJ 4EJWA 1WI9A 3CMYA 2MSYA 1Z1DA 5E18F 3HHHA 2CV1A 3H9JA 1H9TA 3MFKA 3OY9A 1U78A 1ZR2A 2KHMA 2OC6A 1T33A 4ENNA 3KP7A 1ETWA 1Z9CA 4B09A 2ZMEC 4YFXF 2CQNA 2A5YB 3KETA 2OQRA 2MLGA 2VBWA 1FSEA 2EZKA 2F4MB 2GWRA 4PFPA 2GXAA 2JA6J 1IRFA 2IAIA 2YX7A 1KU3A 1BOBA 3C2HA 4H4KC 4F52A 1QA6A 3JSPA 1GXPA 2QYOA 3DTEA 4NC8A 1IV8A 2ZCWA 1FC3A 2DFFA 5A2QK 4B1RA 3MKZA 3H5NA 4EJUA 1MJBA 2HYJA 4IL6C 3JCUC 2CQKA 5D8KB 1LVKA 2WTEA 4F93B 3PM1A 5E1XA 3T0YA 5IOZA 4ENJA 3GEZA 4A3DJ 3CMEI 3Q0WA 3T1BA 3LAPA 3OMYA 3GTOJ 3BG5A 3P9IA 1ACIA 2WB1A 1R4MB 1TP4A 4XNFA 2G7UA 2OD5A 3HOUJ 2E19A 4PJNA 4BE0A 3FXKA 2VIXA 3A0BC 3DLLF 5BPIA 3AG3H 1GT0C 2DMQA 1WJBA 2HYGD 5C3EJ 2HDWA 2JRTA 1R6RA 5ICCA 4LMYA 1AOYA 3C3WA 3K4NA 1YTYA 3CCJI 3TL4X 2C6YA 4A0XA 4UHTA 2VJ5A 1XGOA 1XMAA 2EWNA 2GIZA 4LG3A 5KNLA 4FE7A 3JREA 2M4GA 2CRGA 4RB3C 2IT0A 5IT9Z 3K4LA 2R7TA 1D0ZA 4EJTA 4HAMA 1FOYA 1E3HA 1TWGJ 4KT5C 3ZQIA 2VUMJ 2GLOA 1YJNI 1TTYA 2VKDA 1Y0UA 1UMQA 5JLWA 5EGOA 1ON1A 2A5WA 5K1YA 3L2VA 3OYJA 3T5XA 2A05A 4ON0A 1Z3XA 3BR1A 5IT3A 4S04A 4XQFA 3F8CA 4UUSB 5CVIA 2GBYA 2MABA 3H5AA 5KK1A 1HBXG 3BCBA 1ZKGA 2BYVE 1P9QC 4BKXA 1I1SA 1I27A 2ISZA 1FNNA 4L5EA 1T8IA 2OTLI 1JGGA 4PDKA 2KP6A 2W57A 3A01B 1QRYA 1PP8F 4QPOA 1OCCH 1BI1A 4PJ0C 4A3EJ 2KQRA 2ISYA 2KDZA 3DKYA 3FK6A 1H9GA 4ESFA 4DNCA 1AU7A 3BJOA 2IRFG 5M5WJ 2LKXA 2W1OA 3M8FA 3HGYA 2DN0A 4A6EA 4B44A 2VXZA 5B1BH 4DBQA 1J9IA 2KISA 3C18A 3BJ6A 3IRRA 4YIFA 1SD4A 1ZTRA 4LD5A 2OF7A 3D1NI 1CGPA 1D8KA 4FETA 1MBEA 1G3YA 1O3RA 3LOCA 4JK1X 1R1VA 4KIFA 3ZMTA 3JRGA 1JKPC 2CW7A 1QPMA 4LFUA 5DM7F 4BE1A 3GCMA 2HOSA 3I53A 2DTZA 2DOEA 3ML6A 2EIKH 3OYHA 1ZQ3P 3DBRB 2WADA 1ETKA 2DA6A 3KYDB 1MMDA 3ABMH 3RSNA 5DUKA 4L9JA 2EIMH 1D0YA 3DKXA 2AO9A 3AL0C 4KMUX 2H94A 1JKOC 1BI0A 3CZ6A 2HQAA 5FJ8J 1M1EB 2X6YA 3TW6A 3ZQ7A 1KQ9A 3K2AA 2OPTA 3WGHA 1O3QA 1K78B 3DTIA 4XRMA 4F55A 4IQJA 3DP7A 5M5XJ 4N9HA 3W6JB 5FLXK 3P9CA 5K7FA 2JRMA 2JZYA 1B4AA 3Q9SA 1F36A 2HFHA 3H92A 3BTCA 4G7HF 3AG4H 4BJTA 4RA2A 1LFPA 2GIVA 4CCLA 4G12A 4G8XA 4Q48A 3I71A 1X4PA 4BXUA 4KDPA 1FOKA 3A1YA 3L7WA 1BBYA 1GVJA 2VT2A 4DIQA 1YJ9I 4EMSA 3L2RA 2QQ8A 1DUXC 2ZB9A 3L09A 4Q47A 1R36A 3FXOA 2HZTA 2IS6A 2RGVA 1BJAA 3QYEA 4S0HB 4YIIA 2R7RA 1UJ8A 1WKMA 4DYRA 4OIPF 3HSRA 4RGRA 1X1BA 2CO5A 3QQAA 2L54A 1VQOI 2BVMA 3KLNA 5JLXA 4DYQA 2M0MA 1TC3C 2UV1A 2VC1A 3CLQA 4ZDPA 4D7NA 3DLAA 3N4MA 2X6XA 2M7AA 5EEHA 3WGGA 1RR7A 4KN7X 2ME0A 4KN4X 1YW8A 5EYRA 1JI8A 5DYMA 1W0TA 4JBAA 3WHBA 5IYDJ 4EV0A 1XTAA 5DCMB 5L3EA 1IAWA 2ZNYA 3VWBA 1J0RA 5D5UB 3TP0A 4BY7J 1RNLA 4Y3OA 3BZCA 2DYSH 1RC9A 3K69A 1LE8A 1V3FA 3OWTA 2R0QC 1JJ6C 1Y1WJ 1B6AA 2HQRA 3WTXC 3CMMA 1MBGA 1I6HJ 3HOVJ 4CYDA 2KJBA 5BS6A 4UV9A 1E0EA 3UKGA 4OAZA 2KLOA 2EQRA 4M9ZA 3BROA 2DMTA 1R22A 2IVMA 3P5JA 2VBYA 3KP6A 4I7HA 4JQFA 3DQVC 1RKTA 2DO7A 4XKWA 2QSFX 1S6LA 4IX7A 3RZDJ 3S15J 4WXHA 4KFCA 4O6JA 2EV0A 3PO3J 3J7AO 2UZKA 2ME6A 5BQTA 2P81A 2Y75A 2K9SA 2JA5J 1PUFA 1IV6A 2PMUA 3IV5A 1SFXA 3DU6A 4ASNA 3A03A 2MD0A 3CCLI 1F9NA 5H20A 4OIQF 4KUMA 2X0LA 3F6OA 4M73A 1YHQI 1WRJA 5GAHJ 1HOMA 2DAOA 2ZC2A 1JXSA 2V1DA 2HDCA 3JRBA 2LTPA 2LKSA 3CP8A 4HBLA 1YO5C 1Q1VA 2AXLA 2DPUA 1XGSA 3S2WA 1CQTA 1QBJA 2BZTA 2V9VA 1IN4A 1P7JA 1JUMA 4AD9A 5IP6A 3BR3A 3CJTB 3BG3A 3LSGA 3I3LA 5E3MA 1YFHA 4ZYEA 1Y8RB 1G8XA 5J1UA 3U2RA 5ERIA 4A3KJ 1DP7P 1YRNB 2A3SA 2CMPA 2XAFA 2HOEA 5K5RA 3OIPA 4KIBA 2KMUA 2O5RA 1USTA 1YX5A 3C1DA 3RZOJ 1OJLA 4P5OA 5EJCA 3E6DA 1TWFJ 1Z6RA 4GYIA 1TW2A 3R0AA 4OOIA 3VDXA 5LRSA 3WU0A 2CWEA 4XLAA 3LA3A 4HV6A 2FF4A 3CF2A 4E7JA 4U87A 1WZ2A 2CSOA 3GXOA 3O3KA 3S2DJ 3M1CA 2E2JJ 3OL3A 2K85A 2X1DA 2QCOA 1U5TB 3E0JB 5FKKA 3SDGA 2H1KA 1R71A 1E3OC 4B48A 3QU3A 2MC3A 3S14J 3H1CA 1QQIA 5HNHA 1XSDA 3G1LA 3ZQLA 2WA0A 4JOMA 4ZC3A 3O6BB 4ABZA 1OCPA 3NWTA 3PSIA 2VPLA 2QKMB 3OL4A 2CS3A 1B1BA 2QENA 5KHDA 2R7QA 2P5LC 3DKWA 2EZIA 1B59A 1FBQA 5E3OA 3H0GJ 1WFXA 2XPWA 4PFOA 3IHUA 3Q5FA 2F5VA 4II3A 1TNSA 2D2WA 2XF6A 1JE8A 1Y6IA 4GRIA 3CJNA 4NHJA 1LNWA 2FA5A 5EGOB 3TKYA 3HKZA 1HSJA 1HW2A 2L7FP 3OS2A 1GV2A 2VQGA 3HC7A 4OIRF 2LNBA 2DU9A 4IKFA 2B9SA 1U0JA 2FQ3A 2XVCA 4HDVA 2BGCA 1OYWA 3IP4B 2H8RA 3BJAA 4RM3A 2EA2A 3TO7A 2DXIA 4HRIA 4XONA 4LLLA 1DU0A 2XPVA 3U21A 3LA2A 5J6XA 4BDZA 4CYCB 1D8JA 1ETVA 3MZYA 5IP9J 2QQ9A 5CLSA 3ZCOA 2X51A 1OCZH 3FXMA 3BR6A 1O7LA 1U5TC 1UHSA 3FXRA 2JN6A 3ABTA 2WAEA 3HIFA 4AUXA 4BDYA 4UNOA 1W1WE 2R7FA 1UFMA 4EGYA 1WH5A 1VQMI 1S7EA 3V42A 3V8KA 4UUSA 2OJED 2NS8A 2E2HJ 5F08A 3HPGA 3J81Z 2PBIA 4P55A 3UNGC 1XMXA 4KIGA 4AYBN 4C3HJ 1PYVA 3I64A 3S17J 2MFZA 1MMNA 1MJ9A 4ANJA 5F04A 2BY1A 2IBDA 2W25A 3K10A 4E7ZA 1YIJI 4KISA 2YU9J 1B72B 1O3TA 9ANTA 2FSWA 4CCJA 4BQNA 1NHAA 3G4SI 2QA4I 4KMFA 1QGPA 3A01A 3BP8A 3G3ZA 1QPIA 1TW3A 3HEFA 3QPLA 3ERMA 5FLXZ 4G9YA 1VZ0A 3L1PA 4OMYA 4XRSA 3GLXA 2Z5UA 2LFBA 2WAFA 1D5YA 5J47A 3T8TA 1EH8A 5F1JA 3IWFA 3UR3C 4RAGA 4MEXF 3VFZA 2DFHA 3FMQA 1IF1A 3KZIC 1G4DA 2XKPA 1NG7A 3O8GA 1ETYA 1SFOJ 4MTDA 3HOSA 3DPUA 1I50J 4KT6A 3FMSA 4M6VA 4E7KA 1OFCX 2MG4A 4LIUA 3MVPA 3DEWA 3TW7A 1YIOA 3K1NA 1R4NB 2DFIA 4HYEA 4EM0B 2VI6A 4M6XA 4X0GA 1MSEC 1EF4A 3E97A 4Y17A 1W36D 4BS9A 2VQCA 1NK3P 2H09A 3ZMZA 2PI0A 3HRUA 2LF7A 2R92J 2P6TA 2DTRA 4HLXA 3W3CA 2MBFA 3FKIJ 1OMIA 4MGRA 4KJZA 5GAEJ 2EIJH 2JA2A 2E34A 3FHZA 3KCCA 3PO2J 3K7AJ 3HJEA 2HU9A 5LHIA 4B3AA 3WTSC 2E35A 3ZRGA 3WG7H 1YI2I 4HNTA 2HVQA 4A0ZA 3GTPJ 3C7JA 1G3WA 1FZPB 1FTTA 3V8JA 1XCBA 1PDNC 1R5HA 4EM2A 1MDMB 3M3YJ 1ODDA 3DPTA 2R7VA 3AG2H 1YG2A 3IWZA 4AM3A 1IXSB 3SJMA 2IS1A 3CCSI 3I4PA 3TO9A 1SVMA 3WTUC 3F21A 1IXCA 3ERED 1SD6A 1HQCA 5HLHA 4A5NA 2DMUA 3K0LA 3MZ8A 5C4XJ 2LLKA 1SAUA 3ZOBA 2MW8A 4CGZA 2OQGA 2G0EA 3BDDA 2LD5A 4U0WA 1W0UA 3A2KA 3E7LA 4YELA 2H27A 2M5WA 3LSRA 2Y9YA 1MGTA 2JVHA 1XG1A 1Z3YA 2KIFA 3HSFA 2Y48A 2ZMEB 5FKLA 1J59A 2HQ5A 1ZK8A 2HTSA 1Z6TA 4I02A 4LLNA 2IS2A 4GO1A 4OINF 3QU6A 5J1YA 1MMSA 2QGUA 5DCMA 1RIOH 4DQ2A 2M34A 1VQ9I 2FX0A 3GLLA 3PL8A 5E3LA 2NRAC 4YRVA 4BHBA 4A3MJ 2QF7A 4ZDLA 1W36C 1HW5A 3FDYA 3MAJA 1JTXA 1DDNA 1S8NA 1LDKB 1OCRH 2L0KA 5B5EC 1IW7F 3OYKA 2FNPA 4J01A 3BQYA 1UZCA 2EZLA 4PSWA 1MW7A 2AHQA 3MQ0A 4D5CA 3ONQA 1OCTC 5HVQC 1YS6A 2WB1N 1Y39A 4D7MA 1Y56A 2IP2A 2D5VA 2RN7A 3FXUA 1FMVA 1SMTA 5JFRA 4Y4RA 1VQ6I 1E3PA 1BIAA 3QODA 5L3FA 1MMAA 2L5QA 2DPDA 4PJMA 3E5UA 3SYTA 3HPHA 1A5JA 2QKLB 2P4WA 3GZ5A 1TWAJ 3JTGA 2IGOA 1HDDC 1QZZA 2XGXA 1Z77A 2JUCA 1X58A 5JVTA 4V2GA 2RNGA 1WQ2A 1JUSA 1X3WB 1X4OA 2RV8A 2ZO4A 1E2XA 3I0TA 2OCEA 4UV8A 2V4JC 5FKMA 1ZGJA 2VL8A 4AIHA 1LFUP 4P9UA 1N77A 1YJWI 1XPXA 2BHZA 3EUHA 1ETXA 4CDGA 3ABKH 1O57A 1OKRA 4AVPA 2NVYJ 1BW6A 1W5CC 3GVAA 5TGTA 3ZQQA 1TZLA 2V6EA 1YRNA 2MH9A 2LYCA 2HPIA 3ABUA 1P7IA 3HB9A 4G6QA 4NQWA 2XRNA 2ZJPF 2CV0A 3H3VK 2EA4A 4A12A 3CCEI 5LGTA 1IGNA 3LSMA 3PFYA 4RMNA 3ZMDA 3CP2A 4O3MA 2M30A 1FWZA 2CUJA 2RDPA 1A6QA 2VOPA 2XB0X 2CJJA 2Y0SN 1FIPA 4A3IJ 2BXYA 4FX0A 4N9IA 5DD8A 1U5TA 3VSLA 4J00A 2HEOA 4IHWA 2YS9A 2JA8J 1FY7A 2Z16A 3J80Z 4LJZF 2KRHA 2VE8A 5FKNA 4IRHA 2GOXB 3WODF 3X2QH 4FASD 4ZYHA 2QLZA 1YX3A 5M3MJ 2FUG2 2L2OA 1R5GA 3HRMA 4XR6A 2PEXA 4P1WA 2NOJB 3IUOA 2I5UA 4QLCU 1ZGAA 4BXXJ 1N25A 4U88A 1YS7A 1ZLKA 3QPSA 1POGA 5CPRB 2M1BA 4RGXA 3OR2C 5BPDA 3QYBA 2L01A 2F6CA 3F0CA 3VOEA 3LA7A 3GTLJ 1R1TA 1VQ8I 3KP4A 3LSJA 2HNHA 4IXAA 1I3QJ 5AIQA 3RIRA 3CJQB 3QPTA 4RB1A 3H3ZA 4XLHA 1IN5A 4GCVA 4C2TA 3WTZA 4HX7A 1ZELA 2DA1A 3J7AY 3W6KB 5DDGA 3RPUA 5FLMJ 5KVRA 5E3NA 5L3CA 4G7ZF 3AL0B 1R9TJ 2JA7J 2Y0SA 4BE2A 1V5FA 1GLNA 4CYCA 2HKXA 2LSOA 1V5EA 2LH9A 3JRAA 3A0HC 3G1OA 1QO0D 2DA4A 2OV7A 3B73A 1BC7C 3DPLC 2F48A 3ISPA 2ECCA 2V6CA 1BI2A 1GVDA 3DWLE 4XIDA 2D1HA 1OISA 3TO6A 1VQNI 3LMMA 4ESBA 3FX3A 2K4JA 2P5KA 4M3DA 4I0AA 2QVOA 3JRIA 2TCTA 2KPMA 2FNAA 4WWCA 3HOTA 4XN3A 1KYWA 3K1PA 2L4AA 1ONVA 1IO2A 2V7FA 4JYKA 4TV7A 1MMGA 3M8JA 4IHTA 1B72A 4FE4A 3WG9A 2GOMA 1Z91A 1P92A 4XORA 3F8FA 4R79A 1ZG3A 2H1LA 4KITB 5CQEA 2M3AA 2L9SA 2AQEA 5DM6F 2XV4S 3CCYA 1LVAA 4M72A 1TL8A 1O7FA 4FCYA 2H8WA 1QVTA 3AAFA 1RETA 3G1MA 4MIMA 1NK2P 3BZKA 2JT1A 2K86A 1LQ1A 3CO7C 1V55H 3O2PE 2WAQA 4YEJA 1RUNA 2OZUA 2RNJA 2CUFA 3ZMSA 4II2A 2XASA 1A36A 2E1NA 3QPHA 1UG0A 1K4TA 1TWCJ 4XSXF 3N05A 4A69C 2O03A 2QZ8A 4PSXA 4L9VA 6PAXA 4XICA 3ULQB 5CYVA 1FMWA 3IH4A 4X6AJ 1H8AC 2VC0A 5EG0B 2P5VA 3RJPA 4YG2F 2PG4A 5F0HA 2GQQA 2WWYA 3QOEA 3CDHA 1X2MA 4UB6C 4ETSA 3DFGA 4CCMA 4PZJA 2CV2A 3ZXSA 4FQGA 1ZG5A 3PJRA 2VJIA 2W48A 3KIOA 3HRTA 5D8LB 1WCMJ 1P4AA 1JKRC 5LRRA 2IGMA 4M9XA 3NQOA 1IDYA 1XMKA 4XLFA 1QHGA 4HNVA 5HNFA 4MNUA 2JSCA 1FX7A 5CVJA 1IRGA 2CUZA 3V8LA 1BR1A 4E7HA 3K4MA 1HXDA 2NVTJ 3M8EA 3V7RA 4HX8A 2FQ4A 5KAFC 4C3JJ 1MBJA 5E79C 3KP5A 2E2IJ 2XAJA 2P8TA 3LSKA 2PMHA 1W7PD 4IO9F 2GZWA 2EZHA 1MDMA 1K83J 4M3BA 2HWVA 4IHYA 1IZ1A 4HF1A 1GV5A 1UCRA 3S1QJ 1XC5A 4UUVA 2IJLA 4KYWA 1YOVB 4A2UA 2CH0A 1TBXA 1BW5A 1BR2A 1DQUA 4HPQA 3BR0A 4I98B 3TMOA 1TNTA 4A93J 4ZDOA 1EH7A 3AFHA 5B3SH 1RKWA 1QZYA 2VBXA 4CCNA 1K6OA 1BIBA 1Y1VJ 2W82A 2VODA 5CQGA 3EUAA 2XDVA 4MTEA 5L3GA 2DOAA 2LY9A 2ZJRF 1O4XA 2KJCA 1VQ4I 5HLGA 5H2FC 2JPBA 4E7LA 1A6IA 2QM3A 2W4SA 3VB2A 1LJ9A 2ZMEA 2FBKA 3R4KA 4IVNA 3WE2A 4BY1J 4Y7NJ 1X1DA 4ZTJA 4M3EA 1R7JA 3FBIB 4ENMA 1BOAA 2ZSHB 3G2BA 3QWLA 4ITVA 5J40A 2CG4A 2RVCA 5A2QZ 4C3IJ 5IYBJ 4B47A 4LGWA 3PIPF 3ZPLA 4M3GA 4ZYDA 4L5JA 4FHTA 3PUBA 3O8HA 3KEQA 2VXDA 2AXTC 1KZHA 2RREA 3OIQA 2XF7A 4N4OB 1FEXA 4NC6A 4AVZA 3JRHA 3BG7A 1HKQA 2HS5A 2M9HA 4EEFG 2O8KA 1T2KA 3FXLA 3OOUA 1Z67A 1U9OA 5F6FA 2JVGA 3IAS2 2KL4A 3RQ4A 1SVOA 5D4RA 5GP9A 1YITI 1IRZA 1JTYA 2HXIA
chains in the Genus database with same CATH topology
4OMZA 5ILVA 3N97A 4RAZA 2DQRA 4L9TA 4M71A 3GZ6A 5E17F 3I59B 3R6SA 5HDKA 3GYHX 1G3TA 2ELHA 3F23A 3KZZA 1F4KA 2Z99A 5LEKA 1XD7A 2G7HA 5F64A 5LHHA 2YPRA 4IRGA 5H6QA 4HDUA 3SZTA 2HKOA 1EH6A 1SAXA 4CXFA 4MQ9F 4I0BA 2YSRA 4N0BA 3ECOA 3NEUA 3R0JA 5K5OA 2ADUA 3RYPA 2J5PA 3DV8A 3GFIA 2F5FA 3E5XA 1Z7UA 1RI7A 2EFQA 2QBYB 1KQ0A 1J5YA 2BE5F 2H6BA 5EEGA 4R8HA 2M87A 1USSA 3MWMA 1KA8A 2R3SA 2PQ8A 1HSTA 3GUDA 5E1WA 2P6SA 3GFMA 3F72A 1ZRDA 3D0SA 5HOOA 5LBQA 4S05A 1T38A 1KQ8A 3MEXA 1VTNC 1YW9A 4WX9A 5DD4A 4ZZDA 1S7OA 4BH9A 1ZG1A 1S3JA 1D5VA 3FF5A 2O6GE 4CHUA 2QQAA 2OZ6A 4HZFA 3HTSB 4AIJA 4A5MA 4LG0A 1FYMA 3KZYA 3M7GA 2GXGA 4UVBA 3KEOA 4ENKA 4E70A 5HDNA 2Q0OA 3EYYA 2FBIA 2HYFA 4EVIA 3EETA 5CVUA 1XN7A 2NNNA 4FX4A 1SFUA 5CVRA 4I09A 2IA2A 2V79A 2BEOA 3REOA 2FEZA 2CFXA 4WXCA 2RQPA 1H0MA 1W5TA 2W24A 5L3BA 3BPVA 3U1DA 1ZRCA 4BQAA 2O61A 1HKSA 4EGZA 1FP2A 1W4MA 2NS0A 2D45A 2F5CA 1O3SA 4CICA 1XB4A 2E7WA 3CO6C 2A07F 5FO5A 4XSZF 2DK8A 1S7AA 3E6BA 1F5TA 1FYLA 2ESNA 3IL2A 1XDUA 5K5QA 3OV8A 4NB5A 3D5LA 1KU9A 2EFWA 1V4RA 2NAZA 3HHGA 3WTYC 4U7DA 2WC2A 1W5SA 2ETHA 3VODA 4A0YA 1YQAA 5FD6A 1S29A 2K4BA 1FT9A 1U2WA 2LF8A 4K2EA 2KKOA 2WV0A 5CJ9A 4M6YA 3WTVC 3JTHA 5LLQA 1DPUA 1YLFA 4WCGA 3TGNA 2ZKZA 3LQQA 3BOQA 2V1XA 1K79A 2MLKA 3FM3A 1OYIA 5D6EA 4H0EA 5JHUA 1IN6A 2X4HA 5E8IA 3F8BA 4D0PA 3Q9VA 3M9AA 5TRDA 5D4SA 3RI4A 2EV6A 1FPQA 4A6DA 3DXJF 1T6SA 2FBHA 4WK8F 4EJVA 3BY6A 4WF2A 3T8RA 4PGHA 4RB0A 1RZ4A 4XLNF 3F8MA 1IN8A 3QP6A 2XAGA 4YFKF 1AWCA 4LLGF 4PGGA 3F8NA 2NYXA 1STZA 2KRFA 2M8EA 4AIKA 3CUOA 1ZH5A 3BZ6A 4M74A 5TJJA 2KIUA 2ZNZA 3FMRA 4MEYF 1KU2A 5AIPA 1SFEA 2FRHA 3I59A 5HDGA 3R60A 4BYYA 1E17A 1TQIA 1XGNA 2K7LA 5DEQA 1B9NA 1G3SA 4BAYA 2Y0MA 3RKYA 3CTAA 2DQLA 2TDXA 2EFOA 2J5OA 2A68F 1TLHB 2HR3A 1XDSA 4RGUA 3P9KA 4U7BA 2BBYA 2ZJ2A 2EV5A 2OAZA 3MCZA 1HKTA 2FU4A 5L3DA 3L00A 1C0WA 1JHHA 2YU3A 3WGIA 4BHCA 5FB2A 2QBYA 1WSUA 4Y15A 1U3EM 1UHWA 5J8CA 1UHMA 1P4XA 5DUIA 2VT3A 5LEJA 3JAMK 1EV7A 4MHGA 2DW4A 3GFJA 1SMYF 3I54A 1MKMA 4LG0B 2VN2A 1GHCA 2ESHA 2F5EA 1LEAA 1XSXA 3QP5A 2B0LA 2UWMA 1K7AA 5CVVA 2PJPA 1B9MA 4BNCA 1P2FA 4HV5A 2OA4A 3BPXA 4AWXB 3LSTA 1L3LA 1R58A 5JR3A 1BI3A 2NNYA 4IRIA 3SXYA 1FSHA 1KYZA 1R23A 1TQPA 4LK1F 4KA4A 3E6MA 1CF7B 1MZBA 4UXNA 3CUQB 1J7KA 3IRQA 2VOOA 3HRSA 3GO5A 2EFNA 5ICGA 2XAQA 2DI3A 4L0ZB 4IHSA 1IN7A 3MZHA 4Q5SF 3HSEA 1YW7A 3EQLF 3WE3A 3J81K 5ICFA 2STWA 4LB5A 3RKWA 4HA8A 2IA1A 3FXQA 4GGGA 2A61A 4ZH4F 4G7OF 4O5VA 3K9TA 2PFBA 2RC4A 4L5IA 2HGCA 2VONA 5BMZA 5AONA 1J75A 3L9FA 3NRVA 4CO8A 2IPQX 3TOBA 4L0YB 1DPRA 3I58A 2JTVA 1FYKA 4RGSA 3CUQC 3VEPA 2ZBKA 1LB2A 3LWFA 2QWWA 3TDUC 3ZMUA 3RDIA 1T0FA 4PCQA 1Q1HA 4FT8A 2W84A 3GWZA 1L0OC 1W7PB 4G6DA 3TOAA 1OPCA 2EK5A 1MD0A 3KFWX 2W85A 2LDUA 2PLYA 3E5QA 3RPQA 2GA2A 3F3XA 3ECHA 2A6HF 3ROUA 2P7VB 1PUEE 1ULYA 2O3FA 3HYIA 5HS9A 2GAUA 1BN5A 1QNTA 5DCFA 1ZARA 3HTUA 5E1ZB 3PQKA 4LK0F 1U6GA 3M1EA 1IUYA 2ZFWA 3WU1B 3DF8A 3K2ZA 3DEUA 2CW0F 1REPC 3KE2A 2H6CA 5D5XB 4HW0A 4IPAA 3QRFF 2ACJA 4ZZLA 3PQJA 2L3DA 1KGSA 2YX4A 2UXXA 4HF0A 2OBPA 3V4GA 4LB6B 1R1UA 4P96A 3SZPA 1P6RA 1GXQA 2EFPA 2CGPA 1ZLJA 2FOKA 4G94A 3E3VA 2R7DA 2XHKA 1FLIA 3LQRA 2AS5F 3SFZA 3GFLA 4KNYA 2Q2EA 5ILSA 1ON2A 3GW2A 3JAMZ 3L2CA 2G9WA 4CZZA 2EB7A 4Z2YA 3IKTA 2Z9OA 3WTWC 4HX4A 1BC8C 2K27A 4EM1A 3RYRA 1ZN2A 2L02A 4XRFA 4RB2C 4U0YA 4OIOF 2YR2A 3EDPA 2ZXJA 5E8GA 1G6NA 5FFXA 1HW1A 5DV5A 5H6RA 1F1ZA 5D5VB 3ELKA 1T98A 5LGNA 2E7XA 4WXDA 3CLOA 1BM9A 3V7CA 4XLPF 5F1RA 2PN6A 3R61A 4HF2A 4RS8A 5E20A 1FBSA 2UXNA 1YYVA 3K1MA 1J2XA 3P7NA 2XROA 2RKHA 5D5WB 1R00A 2VBZA 4HOBA 4I2OA 1LDJA 1I5ZA 2GA1A 2EJRA 3IKVA 3J80K 1MJAA 1OYYA 1A04A 4ESJA 1UB9A 1ZYRF 1XSVA 2XUBA 2VE9A 5LHGA 2MD5A 3IC7A 4F7ZA 2Z33A 4QWQA 1RUOA 4HLYA 1XGMA 4U0VA 3SQNA 5IT9K 1P4WA 5HS7A 3H3UA 5FD5A 1OR7A 2OU2A 4MQVA 2XAHA 2HQNA 2DK5A 3JSOA 3B02A 3ZN0A 2IA0A 3RKXA 3QOPA 2COMA 4OU0A 4EJOA 1FP1D 3TQNA 3EYIA 1CF7A 5BOXA 3CUQA 2LKPA 2E1CA 5HLIA 2Q8KA 3KP3A 4YFNF 4EQQA 2M45A 2XKOA 2QQBA 2A6EF 1LDDA 3OOPA 2QUFA 1D3YA 5ED4A 2CYYA 3KLOA 3GX4X 1ZREA 2V1UA 3LAJA 3F22A 2XIGA 3ZMVA 2FXAA 4HQMA 4Q4ZF 1ZAOA 2P7CB 1K78A 2JPCA 3JW4A 2STTA 5JI6A 4P9FA 2MH2A 2FMYA 3PFIA 3V7SA 2GXBA 5ILUA 4XBFA 5FGMA 2F5DA 3U9GA 2D1VA 1ZHFA 2Z3YA 1SD7A 2K02A 1PP7U 1I1GA 3COAC 1I6XA 3HUGA 3KP2A 4R1HA 1KU7A 4M9SA 1FBUA 4I01A 1LEBA 4HQEA 1JHFA 3F6VA 4ZYGA 4L9NA 5HS8A 2MA3A 4IF4A 3BWGA 1W7PA 1X3UA 3WTTC 3QAHA 1Z05A 3FZVA 3GF2A 4IJAA 4UVAA 2KIMA 2HTJA 5J8FA 5D6FA 4BHPA 3ZN1A 2BV6A 3E6CC 4B8XA 3FWEA 2F2EA 5FFZA 3ZP5A 4UVCA 5ICEA 3SHFA 2DT5A 2FE3A 4KICA 2O0YA 1WWXA 1TQMA 2O8XA 4RAYA 1U8RA 2DBBA 1XCVA 4GYGA 1IXRC 2IW5A 5LGUA 3LFKA 1JGSA 2DLLA 4GXOA 3TDZC 2A69F 3I5UA 1SD5A 3G73A 4Y13A 3RTRA 4L18B 1ZRFA 2L4MA 2FMLA 4EJWA 1WI9A 1Z1DA 5E18F 3HHHA 1H9TA 3MFKA 1U78A 4ENNA 3KP7A 1Z9CA 4B09A 4YFXF 2A5YB 3KETA 2OQRA 2MLGA 2VBWA 1FSEA 2GWRA 1IRFA 2YX7A 1KU3A 3JSPA 1GXPA 2QYOA 2ZCWA 1FC3A 5A2QK 4EJUA 1MJBA 2CQKA 5D8KB 2WTEA 5E1XA 3T0YA 4ENJA 3GEZA 3T1BA 3LAPA 3P9IA 2G7UA 2OD5A 5BPIA 2HYGD 2JRTA 5ICCA 4LMYA 1AOYA 3C3WA 1YTYA 2C6YA 4A0XA 4UHTA 1XGOA 1XMAA 2EWNA 4RB3C 2IT0A 5IT9Z 4EJTA 4HAMA 4KT5C 1TTYA 1Y0UA 1ON1A 5K1YA 3T5XA 4ON0A 5IT3A 4S04A 3F8CA 5CVIA 5KK1A 1HBXG 2BYVE 1I1SA 1I27A 2ISZA 1FNNA 4PDKA 2W57A 1PP8F 1BI1A 2ISYA 1H9GA 4ESFA 4DNCA 3BJOA 2IRFG 3M8FA 4A6EA 2VXZA 1J9IA 3C18A 3BJ6A 3IRRA 4YIFA 1SD4A 4LD5A 1CGPA 1D8KA 1G3YA 1O3RA 4JK1X 1R1VA 4KIFA 3ZMTA 1QPMA 4LFUA 3I53A 3ML6A 5DUKA 4L9JA 4KMUX 2H94A 1BI0A 3ZQ7A 1O3QA 1KQ9A 3WGHA 1K78B 3DP7A 4N9HA 3W6JB 5FLXK 3P9CA 2JZYA 1B4AA 3Q9SA 2HFHA 3H92A 4G7HF 2GIVA 4Q48A 4G8XA 3I71A 4BXUA 4KDPA 1FOKA 3L7WA 1BBYA 1GVJA 2VT2A 4EMSA 1DUXC 3L09A 4Q47A 1R36A 2HZTA 2RGVA 1BJAA 4YIIA 1WKMA 4OIPF 3HSRA 4RGRA 2CO5A 2L54A 3KLNA 2VC1A 3N4MA 5EEHA 3WGGA 4KN7X 4KN4X 1YW8A 5DYMA 4JBAA 4EV0A 5DCMB 5L3EA 1IAWA 2ZNYA 1J0RA 5D5UB 1RNLA 3K69A 1V3FA 1B6AA 2HQRA 3WTXC 4CYDA 2KJBA 5BS6A 4UV9A 4M9ZA 3BROA 2IVMA 1R22A 2VBYA 3KP6A 4I7HA 4JQFA 3DQVC 2DO7A 1S6LA 4WXHA 4KFCA 4O6JA 2EV0A 3J7AO 2UZKA 5BQTA 2Y75A 2PMUA 1SFXA 4ASNA 1F9NA 5H20A 4OIQF 4KUMA 2X0LA 3F6OA 4M73A 1WRJA 2DAOA 1JXSA 2V1DA 2HDCA 4HBLA 1YO5C 2AXLA 2DPUA 1XGSA 3S2WA 1QBJA 2V9VA 1IN4A 4AD9A 1YFHA 4ZYEA 3U2RA 5ERIA 1DP7P 2A3SA 2XAFA 2HOEA 5K5RA 4KIBA 1USTA 3C1DA 4P5OA 3E6DA 1Z6RA 4GYIA 1TW2A 3R0AA 4OOIA 5LRSA 3WU0A 2CWEA 3LA3A 4HV6A 2FF4A 2CSOA 3GXOA 3O3KA 1U5TB 3QU3A 2MC3A 1QQIA 1XSDA 3O6BB 2QENA 1B1BA 2P5LC 3DKWA 1B59A 1FBQA 3IHUA 3Q5FA 1TNSA 2D2WA 1JE8A 3CJNA 4NHJA 1LNWA 2FA5A 3TKYA 1HSJA 1HW2A 4OIRF 2LNBA 2DU9A 2FQ3A 2XVCA 4HDVA 2BGCA 1OYWA 3BJAA 2EA2A 3TO7A 4LLLA 3LA2A 5J6XA 1D8JA 3MZYA 2QQ9A 5CLSA 1O7LA 1U5TC 3FXRA 3ABTA 3HIFA 4UNOA 2R7FA 1UFMA 4EGYA 3V8KA 3J81Z 2PBIA 4P55A 4KIGA 3I64A 1MJ9A 2W25A 1O3TA 2FSWA 1NHAA 4KMFA 1QGPA 3BP8A 3G3ZA 1TW3A 5FLXZ 4G9YA 4OMYA 3GLXA 2Z5UA 3T8TA 1EH8A 3IWFA 4MEXF 3VFZA 3FMQA 1IF1A 1G4DA 2XKPA 4MTDA 3HOSA 3FMSA 1YIOA 3K1NA 2DFIA 4HYEA 4EM0B 4M6XA 3E97A 4Y17A 2H09A 3ZMZA 2PI0A 3HRUA 2LF7A 2P6TA 2DTRA 4HLXA 2MBFA 1OMIA 4MGRA 3FHZA 3KCCA 5LHIA 3WTSC 4A0ZA 3C7JA 1G3WA 1FZPB 3V8JA 1XCBA 1PDNC 1R5HA 4EM2A 1MDMB 1ODDA 3DPTA 1YG2A 3IWZA 1IXSB 3I4PA 3TO9A 3WTUC 3F21A 1IXCA 3ERED 1SD6A 1HQCA 5HLHA 4A5NA 3K0LA 4CGZA 2OQGA 3BDDA 4U0WA 2H27A 2M5WA 1MGTA 2KIFA 3HSFA 2Y48A 2ZMEB 1J59A 2HTSA 1Z6TA 4I02A 4LLNA 4GO1A 4OINF 3QU6A 5DCMA 1RIOH 4DQ2A 2NRAC 4BHBA 1HW5A 3MAJA 1DDNA 1S8NA 1LDKB 1IW7F 2FNPA 3MQ0A 5HVQC 1YS6A 2IP2A 2RN7A 3FXUA 1SMTA 5JFRA 1BIAA 5L3FA 2DPDA 3E5UA 2P4WA 3GZ5A 3JTGA 1QZZA 2XGXA 5JVTA 1WQ2A 2RV8A 2ZO4A 1E2XA 3I0TA 4UV8A 1ZGJA 4AIHA 4P9UA 3EUHA 4CDGA 1O57A 1OKRA 4AVPA 3GVAA 2MH9A 3ABUA 4G6QA 4NQWA 2XRNA 2EA4A 4A12A 5LGTA 3ZMDA 4O3MA 2M30A 1FWZA 2RDPA 2VOPA 4FX0A 4N9IA 5DD8A 1U5TA 2HEOA 1FY7A 3J80Z 4LJZF 2VE8A 4IRHA 3WODF 4ZYHA 2QLZA 3HRMA 1R5GA 2PEXA 4QLCU 1ZGAA 4U88A 1YS7A 1ZLKA 2M1BA 4RGXA 5BPDA 2L01A 3VOEA 3LA7A 1R1TA 3KP4A 4IXAA 5AIQA 3RIRA 3QPTA 4RB1A 3H3ZA 1IN5A 4GCVA 3WTZA 4HX7A 3W6KB 5DDGA 3RPUA 5KVRA 5L3CA 4G7ZF 2HKXA 2LSOA 1QO0D 3B73A 1BC7C 3DPLC 3ISPA 2V6CA 1BI2A 2D1HA 3TO6A 4ESBA 3FX3A 2K4JA 2P5KA 4I0AA 2QVOA 2FNAA 4WWCA 3HOTA 1KYWA 3K1PA 2L4AA 1ONVA 4TV7A 4IHTA 3WG9A 1Z91A 1P92A 3F8FA 4R79A 1ZG3A 2XV4S 1LVAA 4M72A 1O7FA 3AAFA 2JT1A 2K86A 1LQ1A 3CO7C 3O2PE 1RUNA 2OZUA 2RNJA 3ZMSA 2XASA 2E1NA 3QPHA 4XSXF 2O03A 2QZ8A 4L9VA 6PAXA 3ULQB 5CYVA 2VC0A 2P5VA 3RJPA 4YG2F 2PG4A 2WWYA 2GQQA 3CDHA 4ETSA 3DFGA 4PZJA 1ZG5A 3HRTA 5D8LB 1P4AA 5LRRA 4M9XA 3NQOA 1XMKA 4MNUA 2JSCA 1FX7A 5CVJA 1IRGA 3V8LA 1HXDA 3M8EA 3V7RA 4HX8A 3KP5A 2XAJA 2P8TA 2PMHA 1W7PD 2GZWA 1MDMA 2HWVA 1IZ1A 4HF1A 1UCRA 4UUVA 2IJLA 4KYWA 4A2UA 1TBXA 4I98B 1TNTA 1EH7A 1QZYA 2VBXA 1K6OA 1BIBA 2VODA 4MTEA 5L3GA 2KJCA 5HLGA 2JPBA 2QM3A 3VB2A 1LJ9A 2ZMEA 2FBKA 3R4KA 4IVNA 3WE2A 1R7JA 4ENMA 1BOAA 2CG4A 2RVCA 5A2QZ 4LGWA 3ZPLA 4ZYDA 4L5JA 4FHTA 3KEQA 2HS5A 1HKQA 1T2KA 5F6FA 5D4RA 1T39A 3FM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMZ A;  5ILV A;  3N97 A;  4RAZ A;  2DQR A;  4L9T A;  4M71 A;  3GZ6 A;  5E17 F;  3I59 B;  3R6S A;  5HDK A;  3GYH X;  1G3T A;  2ELH A;  3F23 A;  3KZZ A;  1F4K A;  2Z99 A;  5LEK A;  1XD7 A;  2G7H A;  5F64 A;  5LHH A;  2YPR A;  4IRG A;  5H6Q A;  4HDU A;  3SZT A;  2HKO A;  1EH6 A;  1SAX A;  4CXF A;  4MQ9 F;  4I0B A;  2YSR A;  4N0B A;  3ECO A;  3NEU A;  3R0J A;  5K5O A;  2ADU A;  3RYP A;  2J5P A;  3DV8 A;  3GFI A;  2F5F A;  3E5X A;  1Z7U A;  1RI7 A;  2EFQ A;  2QBY B;  1KQ0 A;  1J5Y A;  2BE5 F;  2H6B A;  5EEG A;  4R8H A;  2M87 A;  1USS A;  3MWM A;  1KA8 A;  2R3S A;  2PQ8 A;  1HST A;  3GUD A;  5E1W A;  2P6S A;  3GFM A;  3F72 A;  1ZRD A;  3D0S A;  5HOO A;  5LBQ A;  4S05 A;  1T38 A;  1KQ8 A;  3MEX A;  1VTN C;  1YW9 A;  4WX9 A;  5DD4 A;  4ZZD A;  1S7O A;  4BH9 A;  1ZG1 A;  1S3J A;  1D5V A;  3FF5 A;  2O6G E;  4CHU A;  2QQA A;  2OZ6 A;  4HZF A;  3HTS B;  4AIJ A;  4A5M A;  4LG0 A;  1FYM A;  3KZY A;  3M7G A;  2GXG A;  4UVB A;  3KEO A;  4ENK A;  4E70 A;  5HDN A;  2Q0O A;  3EYY A;  2FBI A;  2HYF A;  4EVI A;  3EET A;  5CVU A;  1XN7 A;  2NNN A;  4FX4 A;  1SFU A;  5CVR A;  4I09 A;  2IA2 A;  2V79 A;  2BEO A;  3REO A;  2FEZ A;  2CFX A;  4WXC A;  2RQP A;  1H0M A;  1W5T A;  2W24 A;  5L3B A;  3BPV A;  3U1D A;  1ZRC A;  4BQA A;  2O61 A;  1HKS A;  4EGZ A;  1FP2 A;  1W4M A;  2NS0 A;  2D45 A;  2F5C A;  1O3S A;  4CIC A;  1XB4 A;  2E7W A;  3CO6 C;  2A07 F;  5FO5 A;  4XSZ F;  2DK8 A;  1S7A A;  3E6B A;  1F5T A;  1FYL A;  2ESN A;  3IL2 A;  1XDU A;  5K5Q A;  3OV8 A;  4NB5 A;  3D5L A;  1KU9 A;  2EFW A;  1V4R A;  2NAZ A;  3HHG A;  3WTY C;  4U7D A;  2WC2 A;  1W5S A;  2ETH A;  3VOD A;  4A0Y A;  1YQA A;  5FD6 A;  1S29 A;  2K4B A;  1FT9 A;  1U2W A;  2LF8 A;  4K2E A;  2KKO A;  2WV0 A;  5CJ9 A;  4M6Y A;  3WTV C;  3JTH A;  5LLQ A;  1DPU A;  1YLF A;  4WCG A;  3TGN A;  2ZKZ A;  3LQQ A;  3BOQ A;  2V1X A;  1K79 A;  2MLK A;  3FM3 A;  1OYI A;  5D6E A;  4H0E A;  5JHU A;  1IN6 A;  2X4H A;  5E8I A;  3F8B A;  4D0P A;  3Q9V A;  3M9A A;  5TRD A;  5D4S A;  3RI4 A;  2EV6 A;  1FPQ A;  4A6D A;  3DXJ F;  1T6S A;  2FBH A;  4WK8 F;  4EJV A;  3BY6 A;  4WF2 A;  3T8R A;  4PGH A;  4RB0 A;  1RZ4 A;  4XLN F;  3F8M A;  1IN8 A;  3QP6 A;  2XAG A;  4YFK F;  1AWC A;  4LLG F;  4PGG A;  3F8N A;  2NYX A;  1STZ A;  2KRF A;  2M8E A;  4AIK A;  3CUO A;  1ZH5 A;  3BZ6 A;  4M74 A;  5TJJ A;  2KIU A;  2ZNZ A;  3FMR A;  4MEY F;  1KU2 A;  5AIP A;  1SFE A;  2FRH A;  3I59 A;  5HDG A;  3R60 A;  4BYY A;  1E17 A;  1TQI A;  1XGN A;  2K7L A;  5DEQ A;  1B9N A;  1G3S A;  4BAY A;  2Y0M A;  3RKY A;  3CTA A;  2DQL A;  2TDX A;  2EFO A;  2J5O A;  2A68 F;  1TLH B;  2HR3 A;  1XDS A;  4RGU A;  3P9K A;  4U7B A;  2BBY A;  2ZJ2 A;  2EV5 A;  2OAZ A;  3MCZ A;  1HKT A;  2FU4 A;  5L3D A;  3L00 A;  1C0W A;  1JHH A;  2YU3 A;  3WGI A;  4BHC A;  5FB2 A;  2QBY A;  1WSU A;  4Y15 A;  1U3E M;  1UHW A;  5J8C A;  1UHM A;  1P4X A;  5DUI A;  2VT3 A;  5LEJ A;  3JAM K;  1EV7 A;  4MHG A;  2DW4 A;  3GFJ A;  1SMY F;  3I54 A;  1MKM A;  4LG0 B;  2VN2 A;  1GHC A;  2ESH A;  2F5E A;  1LEA A;  1XSX A;  3QP5 A;  2B0L A;  2UWM A;  1K7A A;  5CVV A;  2PJP A;  1B9M A;  4BNC A;  1P2F A;  4HV5 A;  2OA4 A;  3BPX A;  4AWX B;  3LST A;  1L3L A;  1R58 A;  5JR3 A;  1BI3 A;  2NNY A;  4IRI A;  3SXY A;  1FSH A;  1KYZ A;  1R23 A;  1TQP A;  4LK1 F;  4KA4 A;  3E6M A;  1CF7 B;  1MZB A;  4UXN A;  3CUQ B;  1J7K A;  3IRQ A;  2VOO A;  3HRS A;  3GO5 A;  2EFN A;  5ICG A;  2XAQ A;  2DI3 A;  4L0Z B;  4IHS A;  1IN7 A;  3MZH A;  4Q5S F;  3HSE A;  1YW7 A;  3EQL F;  3WE3 A;  3J81 K;  5ICF A;  2STW A;  4LB5 A;  3RKW A;  4HA8 A;  2IA1 A;  3FXQ A;  4GGG A;  2A61 A;  4ZH4 F;  4G7O F;  4O5V A;  3K9T A;  2PFB A;  2RC4 A;  4L5I A;  2HGC A;  2VON A;  5BMZ A;  5AON A;  1J75 A;  3L9F A;  3NRV A;  4CO8 A;  2IPQ X;  3TOB A;  4L0Y B;  1DPR A;  3I58 A;  2JTV A;  1FYK A;  4RGS A;  3CUQ C;  3VEP A;  2ZBK A;  1LB2 A;  3LWF A;  2QWW A;  3TDU C;  3ZMU A;  3RDI A;  1T0F A;  4PCQ A;  1Q1H A;  4FT8 A;  2W84 A;  3GWZ A;  1L0O C;  1W7P B;  4G6D A;  3TOA A;  1OPC A;  2EK5 A;  1MD0 A;  3KFW X;  2W85 A;  2LDU A;  2PLY A;  3E5Q A;  3RPQ A;  2GA2 A;  3F3X A;  3ECH A;  2A6H F;  3ROU A;  2P7V B;  1PUE E;  1ULY A;  2O3F A;  3HYI A;  5HS9 A;  2GAU A;  1BN5 A;  1QNT A;  5DCF A;  1ZAR A;  3HTU A;  5E1Z B;  3PQK A;  4LK0 F;  1U6G A;  3M1E A;  1IUY A;  2ZFW A;  3WU1 B;  3DF8 A;  3K2Z A;  3DEU A;  2CW0 F;  1REP C;  3KE2 A;  2H6C A;  5D5X B;  4HW0 A;  4IPA A;  3QRF F;  2ACJ A;  4ZZL A;  3PQJ A;  2L3D A;  1KGS A;  2YX4 A;  2UXX A;  4HF0 A;  2OBP A;  3V4G A;  4LB6 B;  1R1U A;  4P96 A;  3SZP A;  1P6R A;  1GXQ A;  2EFP A;  2CGP A;  1ZLJ A;  2FOK A;  4G94 A;  3E3V A;  2R7D A;  2XHK A;  1FLI A;  3LQR A;  2AS5 F;  3SFZ A;  3GFL A;  4KNY A;  2Q2E A;  5ILS A;  1ON2 A;  3GW2 A;  3JAM Z;  3L2C A;  2G9W A;  4CZZ A;  2EB7 A;  4Z2Y A;  3IKT A;  2Z9O A;  3WTW C;  4HX4 A;  1BC8 C;  2K27 A;  4EM1 A;  3RYR A;  1ZN2 A;  2L02 A;  4XRF A;  4RB2 C;  4U0Y A;  4OIO F;  2YR2 A;  3EDP A;  2ZXJ A;  5E8G A;  1G6N A;  5FFX A;  1HW1 A;  5DV5 A;  5H6R A;  1F1Z A;  5D5V B;  3ELK A;  1T98 A;  5LGN A;  2E7X A;  4WXD A;  3CLO A;  1BM9 A;  3V7C A;  4XLP F;  5F1R A;  2PN6 A;  3R61 A;  4HF2 A;  4RS8 A;  5E20 A;  1FBS A;  2UXN A;  1YYV A;  3K1M A;  1J2X A;  3P7N A;  2XRO A;  2RKH A;  5D5W B;  1R00 A;  2VBZ A;  4HOB A;  4I2O A;  1LDJ A;  1I5Z A;  2GA1 A;  2EJR A;  3IKV A;  3J80 K;  1MJA A;  1OYY A;  1A04 A;  4ESJ A;  1UB9 A;  1ZYR F;  1XSV A;  2XUB A;  2VE9 A;  5LHG A;  2MD5 A;  3IC7 A;  4F7Z A;  2Z33 A;  4QWQ A;  1RUO A;  4HLY A;  1XGM A;  4U0V A;  3SQN A;  5IT9 K;  1P4W A;  5HS7 A;  3H3U A;  5FD5 A;  1OR7 A;  2OU2 A;  4MQV A;  2XAH A;  2HQN A;  2DK5 A;  3JSO A;  3B02 A;  3ZN0 A;  2IA0 A;  3RKX A;  3QOP A;  2COM A;  4OU0 A;  4EJO A;  1FP1 D;  3TQN A;  3EYI A;  1CF7 A;  5BOX A;  3CUQ A;  2LKP A;  2E1C A;  5HLI A;  2Q8K A;  3KP3 A;  4YFN F;  4EQQ A;  2M45 A;  2XKO A;  2QQB A;  2A6E F;  1LDD A;  3OOP A;  2QUF A;  1D3Y A;  5ED4 A;  2CYY A;  3KLO A;  3GX4 X;  1ZRE A;  2V1U A;  3LAJ A;  3F22 A;  2XIG A;  3ZMV A;  2FXA A;  4HQM A;  4Q4Z F;  1ZAO A;  2P7C B;  1K78 A;  2JPC A;  3JW4 A;  2STT A;  5JI6 A;  4P9F A;  2MH2 A;  2FMY A;  3PFI A;  3V7S A;  2GXB A;  5ILU A;  4XBF A;  5FGM A;  2F5D A;  3U9G A;  2D1V A;  1ZHF A;  2Z3Y A;  1SD7 A;  2K02 A;  1PP7 U;  1I1G A;  3COA C;  1I6X A;  3HUG A;  3KP2 A;  4R1H A;  1KU7 A;  4M9S A;  1FBU A;  4I01 A;  1LEB A;  4HQE A;  1JHF A;  3F6V A;  4ZYG A;  4L9N A;  5HS8 A;  2MA3 A;  4IF4 A;  3BWG A;  1W7P A;  1X3U A;  3WTT C;  3QAH A;  1Z05 A;  3FZV A;  3GF2 A;  4IJA A;  4UVA A;  2KIM A;  2HTJ A;  5J8F A;  5D6F A;  4BHP A;  3ZN1 A;  2BV6 A;  3E6C C;  4B8X A;  3FWE A;  2F2E A;  5FFZ A;  3ZP5 A;  4UVC A;  5ICE A;  3SHF A;  2DT5 A;  2FE3 A;  4KIC A;  2O0Y A;  1WWX A;  1TQM A;  2O8X A;  4RAY A;  1U8R A;  2DBB A;  1XCV A;  4GYG A;  1IXR C;  2IW5 A;  5LGU A;  3LFK A;  1JGS A;  2DLL A;  4GXO A;  3TDZ C;  2A69 F;  3I5U A;  1SD5 A;  3G73 A;  4Y13 A;  3RTR A;  4L18 B;  1ZRF A;  2L4M A;  2FML A;  4EJW A;  1WI9 A;  1Z1D A;  5E18 F;  3HHH A;  1H9T A;  3MFK A;  1U78 A;  4ENN A;  3KP7 A;  1Z9C A;  4B09 A;  4YFX F;  2A5Y B;  3KET A;  2OQR A;  2MLG A;  2VBW A;  1FSE A;  2GWR A;  1IRF A;  2YX7 A;  1KU3 A;  3JSP A;  1GXP A;  2QYO A;  2ZCW A;  1FC3 A;  5A2Q K;  4EJU A;  1MJB A;  2CQK A;  5D8K B;  2WTE A;  5E1X A;  3T0Y A;  4ENJ A;  3GEZ A;  3T1B A;  3LAP A;  3P9I A;  2G7U A;  2OD5 A;  5BPI A;  2HYG D;  2JRT A;  5ICC A;  4LMY A;  1AOY A;  3C3W A;  1YTY A;  2C6Y A;  4A0X A;  4UHT A;  1XGO A;  1XMA A;  2EWN A;  4RB3 C;  2IT0 A;  5IT9 Z;  4EJT A;  4HAM A;  4KT5 C;  1TTY A;  1Y0U A;  1ON1 A;  5K1Y A;  3T5X A;  4ON0 A;  5IT3 A;  4S04 A;  3F8C A;  5CVI A;  5KK1 A;  1HBX G;  2BYV E;  1I1S A;  1I27 A;  2ISZ A;  1FNN A;  4PDK A;  2W57 A;  1PP8 F;  1BI1 A;  2ISY A;  1H9G A;  4ESF A;  4DNC A;  3BJO A;  2IRF G;  3M8F A;  4A6E A;  2VXZ A;  1J9I A;  3C18 A;  3BJ6 A;  3IRR A;  4YIF A;  1SD4 A;  4LD5 A;  1CGP A;  1D8K A;  1G3Y A;  1O3R A;  4JK1 X;  1R1V A;  4KIF A;  3ZMT A;  1QPM A;  4LFU A;  3I53 A;  3ML6 A;  5DUK A;  4L9J A;  4KMU X;  2H94 A;  1BI0 A;  3ZQ7 A;  1O3Q A;  1KQ9 A;  3WGH A;  1K78 B;  3DP7 A;  4N9H A;  3W6J B;  5FLX K;  3P9C A;  2JZY A;  1B4A A;  3Q9S A;  2HFH A;  3H92 A;  4G7H F;  2GIV A;  4Q48 A;  4G8X A;  3I71 A;  4BXU A;  4KDP A;  1FOK A;  3L7W A;  1BBY A;  1GVJ A;  2VT2 A;  4EMS A;  1DUX C;  3L09 A;  4Q47 A;  1R36 A;  2HZT A;  2RGV A;  1BJA A;  4YII A;  1WKM A;  4OIP F;  3HSR A;  4RGR A;  2CO5 A;  2L54 A;  3KLN A;  2VC1 A;  3N4M A;  5EEH A;  3WGG A;  4KN7 X;  4KN4 X;  1YW8 A;  5DYM A;  4JBA A;  4EV0 A;  5DCM B;  5L3E A;  1IAW A;  2ZNY A;  1J0R A;  5D5U B;  1RNL A;  3K69 A;  1V3F A;  1B6A A;  2HQR A;  3WTX C;  4CYD A;  2KJB A;  5BS6 A;  4UV9 A;  4M9Z A;  3BRO A;  2IVM A;  1R22 A;  2VBY A;  3KP6 A;  4I7H A;  4JQF A;  3DQV C;  2DO7 A;  1S6L A;  4WXH A;  4KFC A;  4O6J A;  2EV0 A;  3J7A O;  2UZK A;  5BQT A;  2Y75 A;  2PMU A;  1SFX A;  4ASN A;  1F9N A;  5H20 A;  4OIQ F;  4KUM A;  2X0L A;  3F6O A;  4M73 A;  1WRJ A;  2DAO A;  1JXS A;  2V1D A;  2HDC A;  4HBL A;  1YO5 C;  2AXL A;  2DPU A;  1XGS A;  3S2W A;  1QBJ A;  2V9V A;  1IN4 A;  4AD9 A;  1YFH A;  4ZYE A;  3U2R A;  5ERI A;  1DP7 P;  2A3S A;  2XAF A;  2HOE A;  5K5R A;  4KIB A;  1UST A;  3C1D A;  4P5O A;  3E6D A;  1Z6R A;  4GYI A;  1TW2 A;  3R0A A;  4OOI A;  5LRS A;  3WU0 A;  2CWE A;  3LA3 A;  4HV6 A;  2FF4 A;  2CSO A;  3GXO A;  3O3K A;  1U5T B;  3QU3 A;  2MC3 A;  1QQI A;  1XSD A;  3O6B B;  2QEN A;  1B1B A;  2P5L C;  3DKW A;  1B59 A;  1FBQ A;  3IHU A;  3Q5F A;  1TNS A;  2D2W A;  1JE8 A;  3CJN A;  4NHJ A;  1LNW A;  2FA5 A;  3TKY A;  1HSJ A;  1HW2 A;  4OIR F;  2LNB A;  2DU9 A;  2FQ3 A;  2XVC A;  4HDV A;  2BGC A;  1OYW A;  3BJA A;  2EA2 A;  3TO7 A;  4LLL A;  3LA2 A;  5J6X A;  1D8J A;  3MZY A;  2QQ9 A;  5CLS A;  1O7L A;  1U5T C;  3FXR A;  3ABT A;  3HIF A;  4UNO A;  2R7F A;  1UFM A;  4EGY A;  3V8K A;  3J81 Z;  2PBI A;  4P55 A;  4KIG A;  3I64 A;  1MJ9 A;  2W25 A;  1O3T A;  2FSW A;  1NHA A;  4KMF A;  1QGP A;  3BP8 A;  3G3Z A;  1TW3 A;  5FLX Z;  4G9Y A;  4OMY A;  3GLX A;  2Z5U A;  3T8T A;  1EH8 A;  3IWF A;  4MEX F;  3VFZ A;  3FMQ A;  1IF1 A;  1G4D A;  2XKP A;  4MTD A;  3HOS A;  3FMS A;  1YIO A;  3K1N A;  2DFI A;  4HYE A;  4EM0 B;  4M6X A;  3E97 A;  4Y17 A;  2H09 A;  3ZMZ A;  2PI0 A;  3HRU A;  2LF7 A;  2P6T A;  2DTR A;  4HLX A;  2MBF A;  1OMI A;  4MGR A;  3FHZ A;  3KCC A;  5LHI A;  3WTS C;  4A0Z A;  3C7J A;  1G3W A;  1FZP B;  3V8J A;  1XCB A;  1PDN C;  1R5H A;  4EM2 A;  1MDM B;  1ODD A;  3DPT A;  1YG2 A;  3IWZ A;  1IXS B;  3I4P A;  3TO9 A;  3WTU C;  3F21 A;  1IXC A;  3ERE D;  1SD6 A;  1HQC A;  5HLH A;  4A5N A;  3K0L A;  4CGZ A;  2OQG A;  3BDD A;  4U0W A;  2H27 A;  2M5W A;  1MGT A;  2KIF A;  3HSF A;  2Y48 A;  2ZME B;  1J59 A;  2HTS A;  1Z6T A;  4I02 A;  4LLN A;  4GO1 A;  4OIN F;  3QU6 A;  5DCM A;  1RIO H;  4DQ2 A;  2NRA C;  4BHB A;  1HW5 A;  3MAJ A;  1DDN A;  1S8N A;  1LDK B;  1IW7 F;  2FNP A;  3MQ0 A;  5HVQ C;  1YS6 A;  2IP2 A;  2RN7 A;  3FXU A;  1SMT A;  5JFR A;  1BIA A;  5L3F A;  2DPD A;  3E5U A;  2P4W A;  3GZ5 A;  3JTG A;  1QZZ A;  2XGX A;  5JVT A;  1WQ2 A;  2RV8 A;  2ZO4 A;  1E2X A;  3I0T A;  4UV8 A;  1ZGJ A;  4AIH A;  4P9U A;  3EUH A;  4CDG A;  1O57 A;  1OKR A;  4AVP A;  3GVA A;  2MH9 A;  3ABU A;  4G6Q A;  4NQW A;  2XRN A;  2EA4 A;  4A12 A;  5LGT A;  3ZMD A;  4O3M A;  2M30 A;  1FWZ A;  2RDP A;  2VOP A;  4FX0 A;  4N9I A;  5DD8 A;  1U5T A;  2HEO A;  1FY7 A;  3J80 Z;  4LJZ F;  2VE8 A;  4IRH A;  3WOD F;  4ZYH A;  2QLZ A;  3HRM A;  1R5G A;  2PEX A;  4QLC U;  1ZGA A;  4U88 A;  1YS7 A;  1ZLK A;  2M1B A;  4RGX A;  5BPD A;  2L01 A;  3VOE A;  3LA7 A;  1R1T A;  3KP4 A;  4IXA A;  5AIQ A;  3RIR A;  3QPT A;  4RB1 A;  3H3Z A;  1IN5 A;  4GCV A;  3WTZ A;  4HX7 A;  3W6K B;  5DDG A;  3RPU A;  5KVR A;  5L3C A;  4G7Z F;  2HKX A;  2LSO A;  1QO0 D;  3B73 A;  1BC7 C;  3DPL C;  3ISP A;  2V6C A;  1BI2 A;  2D1H A;  3TO6 A;  4ESB A;  3FX3 A;  2K4J A;  2P5K A;  4I0A A;  2QVO A;  2FNA A;  4WWC A;  3HOT A;  1KYW A;  3K1P A;  2L4A A;  1ONV A;  4TV7 A;  4IHT A;  3WG9 A;  1Z91 A;  1P92 A;  3F8F A;  4R79 A;  1ZG3 A;  2XV4 S;  1LVA A;  4M72 A;  1O7F A;  3AAF A;  2JT1 A;  2K86 A;  1LQ1 A;  3CO7 C;  3O2P E;  1RUN A;  2OZU A;  2RNJ A;  3ZMS A;  2XAS A;  2E1N A;  3QPH A;  4XSX F;  2O03 A;  2QZ8 A;  4L9V A;  6PAX A;  3ULQ B;  5CYV A;  2VC0 A;  2P5V A;  3RJP A;  4YG2 F;  2PG4 A;  2WWY A;  2GQQ A;  3CDH A;  4ETS A;  3DFG A;  4PZJ A;  1ZG5 A;  3HRT A;  5D8L B;  1P4A A;  5LRR A;  4M9X A;  3NQO A;  1XMK A;  4MNU A;  2JSC A;  1FX7 A;  5CVJ A;  1IRG A;  3V8L A;  1HXD A;  3M8E A;  3V7R A;  4HX8 A;  3KP5 A;  2XAJ A;  2P8T A;  2PMH A;  1W7P D;  2GZW A;  1MDM A;  2HWV A;  1IZ1 A;  4HF1 A;  1UCR A;  4UUV A;  2IJL A;  4KYW A;  4A2U A;  1TBX A;  4I98 B;  1TNT A;  1EH7 A;  1QZY A;  2VBX A;  1K6O A;  1BIB A;  2VOD A;  4MTE A;  5L3G A;  2KJC A;  5HLG A;  2JPB A;  2QM3 A;  3VB2 A;  1LJ9 A;  2ZME A;  2FBK A;  3R4K A;  4IVN A;  3WE2 A;  1R7J A;  4ENM A;  1BOA A;  2CG4 A;  2RVC A;  5A2Q Z;  4LGW A;  3ZPL A;  4ZYD A;  4L5J A;  4FHT A;  3KEQ A;  2HS5 A;  1HKQ A;  1T2K A;  5F6F A;  5D4R A;  1T39 A;  3FM5 A; 
#chains in the Genus database with same CATH topology
 4OMZ A;  3SEZ A;  3J7Z I;  5ILV A;  4A3F J;  3HG9 A;  4RAZ A;  3N97 A;  2R5Y B;  2DQR A;  4L9T A;  1U8B A;  2M7B A;  2M2E A;  1JUP A;  3HKZ N;  3OR1 C;  4M71 A;  3GZ6 A;  2R7X A;  2EBI A;  4NQW B;  4DJA A;  1MNE A;  5E17 F;  3I59 B;  4LIT A;  3R6S A;  4B4C A;  5HDK A;  3GYH X;  1G3T A;  2ELH A;  3S93 A;  3F23 A;  3KZZ A;  1F4K A;  2Z99 A;  3H5R A;  5LEK A;  4I6Z A;  1XD7 A;  2G7H A;  5F64 A;  3G71 I;  3BTL A;  5LHH A;  3B6C A;  2YPR A;  4IRG A;  5H6Q A;  2PMZ A;  4HDU A;  3SZT A;  2HKO A;  1EH6 A;  1SAX A;  3KEY A;  1Z0X A;  4CXF A;  3BLY A;  4MQ9 F;  4I0B A;  5FRO A;  1K4S A;  2CUE A;  2K40 A;  1T95 A;  2YSR A;  4N0B A;  3ECO A;  5J1R A;  3NEU A;  3R0J A;  5K5O A;  2ADU A;  5KAI C;  3PNT A;  3RYP A;  1UEL B;  2K9N A;  2J5P A;  4BBS J;  3DV8 A;  3OYE A;  3GFI A;  2ZJQ F;  2M0C A;  2F5F A;  3E5X A;  1Z7U A;  1D1A A;  2HI3 A;  1RI7 A;  2EFQ A;  2DMN A;  2NOG A;  1QHH D;  2RAE A;  2R5Z B;  2QBY B;  1ENH A;  1VQK I;  4XM3 A;  3FK7 A;  4DZP A;  1WVR A;  1KQ0 A;  1J5Y A;  1Z7L A;  2BE5 F;  2H6B A;  1N75 A;  5EEG A;  4R8H A;  2M87 A;  2COB A;  4IQ4 A;  2N8G A;  1USS A;  3DBH B;  1FIA A;  2K9L A;  1A35 A;  4M3F A;  4IOC F;  3MWM A;  1KA8 A;  4Y33 A;  2R3S A;  3NAU A;  2PQ8 A;  1HST A;  2DFE A;  1ZGW A;  2OCC H;  3GUD A;  5E1W A;  1RRJ A;  3S3O A;  2FJ1 A;  2P6S A;  3GFM A;  1LUJ B;  3F72 A;  3OYL A;  2IGK A;  2LK2 A;  3RKQ A;  2VJJ A;  3D0S A;  5HOO A;  1ZRD A;  5LBQ A;  4S05 A;  1T38 A;  1KQ8 A;  1J09 A;  3MEX A;  1VTN C;  3HOZ J;  1S5L C;  1Y0N A;  1YW9 A;  3OSF A;  3D5R C;  4WX9 A;  1MBK A;  2DCE A;  5DD4 A;  4ZZD A;  1XS9 A;  1S7O A;  1K61 A;  4BH9 A;  1ZG1 A;  1S3J A;  4BL0 B;  5B66 C;  1D5V A;  1VQ7 I;  5M5Y J;  1V5G A;  1I39 A;  2XSJ C;  3FF5 A;  2O6G E;  3CDI A;  5EDN A;  2KRC A;  4CHU A;  3BR5 A;  5FKO A;  2QQA A;  2W00 A;  3HBL A;  2HOA A;  1ETQ A;  2OZ6 A;  4HZF A;  3HTS B;  2LBF B;  3FIS A;  4AIJ A;  3ZR8 X;  4A5M A;  5J4Y A;  4LG0 A;  1FYM A;  1OQY A;  3KZY A;  3M7G A;  2GXG A;  3BG6 A;  4UVB A;  3OYN A;  4YIR X;  4CZC A;  3KEO A;  2MYS A;  4MFE A;  2L7Z A;  4NBQ A;  3HL2 A;  2HVS A;  4ENK A;  4E70 A;  3L2U A;  4XKB A;  3S1M J;  2ZXH A;  1X19 A;  5BNG A;  2KT0 A;  5HDN A;  2Q0O A;  3EYY A;  1FOW A;  2FBI A;  2HYF A;  4EVI A;  3EET A;  2LP0 A;  3H9Q A;  3AG1 H;  4RM2 A;  5CVU A;  1IDZ A;  3CCQ I;  1H88 C;  1XN7 A;  2NNN A;  4FX4 A;  3LFU A;  1SFU A;  5CVR A;  4I09 A;  2IA2 A;  2V79 A;  1SC7 A;  2BEO A;  3REO A;  2FEZ A;  2CFX A;  4WXC A;  1FJL A;  4XKC A;  2RQP A;  1H0M A;  3M4O J;  1W5T A;  2W24 A;  3EPZ A;  5L3B A;  3BPV A;  5EZG A;  5GAD J;  4OAY A;  3U1D A;  4XKV A;  1ZRC A;  4BQA A;  2O61 A;  1HKS A;  4EGZ A;  1FP2 A;  3WHC A;  1W4M A;  2NS0 A;  4LIV A;  2D45 A;  1IRX A;  2F5C A;  1O3S A;  3CC4 I;  2XC7 A;  4CIC A;  1XB4 A;  2E7W A;  3CO6 C;  2A07 F;  5FO5 A;  1VI0 A;  2LOO A;  4XSZ F;  5FRM A;  1AHD P;  1F43 A;  2DK8 A;  1S7A A;  3E6B A;  3K70 D;  3CES A;  1F5T A;  1FYL A;  5LD2 C;  2ESN A;  3IL2 A;  5GPA A;  2HPM A;  1XDU A;  5K5Q A;  3OV8 A;  4NB5 A;  4CH7 A;  3D5L A;  4ZTF A;  1KU9 A;  5EG0 A;  3HXL A;  3S16 J;  3ZGK A;  2EFW A;  1V4R A;  2NAZ A;  2HDD A;  3HHG A;  1T08 B;  2NVU B;  3OYG A;  2L9V A;  5EZH A;  5F0F A;  3TED A;  3WTY C;  1WJA A;  3Q0U A;  4U7D A;  1MSF C;  3H9G A;  2P0W A;  2WC2 A;  2CQX A;  1BR4 A;  1W5S A;  2TRT A;  2ETH A;  3VOD A;  4BXF A;  4A0Y A;  2GM4 A;  4RBO A;  1YQA A;  5FD6 A;  1S29 A;  2K4B A;  1FT9 A;  1U2W A;  2LF8 A;  4K2E A;  2R4G A;  2KKO A;  4NDL A;  2WV0 A;  4XOT A;  5CJ9 A;  4M6Y A;  3BT9 A;  3W2A A;  3WTV C;  3JTH A;  5LLQ A;  1DPU A;  1YLF A;  1X3Z B;  4QIW N;  3RCO A;  4WCG A;  3TGN A;  2ZKZ A;  3LQQ A;  5DTD A;  4CCO A;  3BOQ A;  2V1X A;  4CUG A;  1IJW C;  1K79 A;  3HOW J;  3FBN B;  1ETO A;  2DA3 A;  1JT6 A;  2MLK A;  3FM3 A;  1OYI A;  5D6E A;  1VQP I;  4H0E A;  5JHU A;  1IN6 A;  2X4H A;  5E8I A;  3F8B A;  3BR2 A;  4D0P A;  3Q9V A;  4CSW A;  1NG6 A;  3M9A A;  2KDO A;  5TRD A;  2Z1D A;  5D4S A;  3RI4 A;  2EV6 A;  3K4J A;  2B63 J;  4AID A;  3OS1 A;  1FPQ A;  4A6D A;  2VQH A;  3DXJ F;  4MFD A;  4RLF A;  2DOD A;  4XRS G;  1T6S A;  2FBH A;  2O9L A;  3CF5 F;  4WK8 F;  4EJV A;  3BY6 A;  4WF2 A;  2K5C A;  1SEU A;  2ZXW H;  3T8R A;  4BQQ A;  4PGH A;  2CQQ A;  2JUG A;  5J4V A;  4A3C J;  1T0F C;  1ORK A;  3GZN B;  4DW6 A;  4RB0 A;  2M4K A;  1VQL I;  1RZ4 A;  4IEJ A;  3NWS A;  1A31 A;  4XLN F;  2Y69 H;  3F8M A;  2XB5 A;  1IN8 A;  5EEA A;  3QP6 A;  3LSI A;  2XAG A;  2LRD A;  3TP3 A;  2LRE A;  1IG7 A;  4BAC A;  4YFK F;  1DP3 A;  1AWC A;  4LLG F;  2K3P A;  5DS9 A;  4X1E A;  3IH3 A;  4PGG A;  3F8N A;  2NYX A;  1STZ A;  2KRF A;  2M8E A;  4AIK A;  3CUO A;  3S1R J;  1ZH5 A;  3BZ6 A;  2JK3 A;  2HZD A;  4M74 A;  5TJJ A;  5K7Z A;  1JT0 A;  2R5Y A;  2KIU A;  2ZNZ A;  3FMR A;  4MEY F;  1WJC A;  4JX4 A;  2VKV A;  1KU2 A;  2XGC A;  3F9K A;  5AIP A;  3CCU I;  1SFE A;  2FRH A;  5C44 J;  1D0X A;  2YUS A;  3I59 A;  1IC8 A;  5HDG A;  2X1E A;  2Q2E B;  3R60 A;  3MKY B;  4C2U A;  4BYY A;  3K6G A;  3C2B A;  2I10 A;  1E17 A;  1TQI A;  2XGE A;  1MIJ A;  5CKT A;  1XGN A;  2K7L A;  5DEQ A;  4E7S A;  3PSF A;  4F91 B;  1B9N A;  1G3S A;  4BAY A;  3S2H J;  1QZE A;  2Y0M A;  5GAG J;  2DDB A;  3RKY A;  2ECB A;  3CTA A;  2DQL A;  1YE9 A;  2EFO A;  2TDX A;  2J5O A;  3S8P A;  2A68 F;  2DJI A;  1TLH B;  2HR3 A;  1XDS A;  4RGU A;  3K4K A;  3P9K A;  4U7B A;  2BBY A;  2ZJ2 A;  4UB8 C;  4V19 K;  1UG2 A;  3MKL A;  1AKH B;  3ESW B;  2EV5 A;  2OAZ A;  3MCZ A;  3OIO A;  3ZQH A;  3MKW B;  1HKT A;  5TIS C;  2FU4 A;  4B3X A;  1PJR A;  1X1C A;  2LY2 A;  5L3D A;  2W7N A;  3L00 A;  1C0W A;  1JHH A;  2YU3 A;  3WGI A;  3BC8 A;  3S32 A;  3BG9 A;  4BHC A;  3RQI A;  2R5Z A;  3S1N J;  5FB2 A;  2QBY A;  3SEQ A;  1WSU A;  4Y15 A;  2DA7 A;  1U3E M;  3CDL A;  1UHW A;  2FD5 A;  3E1S A;  5J8C A;  2XRL A;  2K3F A;  2V9P A;  1UHM A;  1P4X A;  5DUI A;  2VT3 A;  3GTG J;  5LEJ A;  3JAM K;  3JRC A;  3OSG A;  3CC7 I;  1EV7 A;  2WAQ N;  4MHG A;  1BL0 A;  2DW4 A;  3U1K A;  1D1B A;  2CFO A;  3GFJ A;  4A3B J;  4CCK A;  1SMY F;  2DMP A;  3VYU B;  3I54 A;  1MKM A;  1NH3 A;  2Y9Z A;  4BJ6 C;  4LG0 B;  2VN2 A;  4E4H A;  1GHC A;  2ESH A;  2F5E A;  2E60 A;  2I8D A;  1LEA A;  1XSX A;  3QP5 A;  2DT6 A;  2B0L A;  5JVG F;  2UWM A;  2XPU A;  3LSH A;  1K7A A;  5CVV A;  2PJP A;  1B9M A;  4BNC A;  2XGD A;  3DTK A;  3VYT B;  1P2F A;  1WHU A;  4HV5 A;  2OA4 A;  3BPX A;  3ZQF A;  4BU2 A;  3I9V 2;  1AA7 A;  4IOA F;  4QTR A;  4DBR A;  2HVR A;  4AWX B;  5GTH C;  2WY8 Q;  3LST A;  2LBF A;  4ZYA A;  1S9H A;  1L3L A;  1R58 A;  2E5Z A;  1VND A;  5JR3 A;  1BI3 A;  1LFB A;  2NNY A;  4IRI A;  2LC2 A;  2QSH X;  3SXY A;  1FSH A;  1KYZ A;  1R23 A;  1TQP A;  2BW3 B;  4LK1 F;  4KA4 A;  3E6M A;  1CF7 B;  1MZB A;  4UXN A;  3CUQ B;  1J7K A;  3IRQ A;  2VOO A;  3H36 A;  1TT5 B;  3HRS A;  4HSR A;  3GO5 A;  2BY2 A;  2IEK A;  2EFN A;  1JKQ C;  1SVL A;  5LFA A;  3JRF A;  5ICG A;  1VQ5 I;  3G6E I;  2XAQ A;  2IXS A;  2DI3 A;  4L0Z B;  4IHS A;  2VLA A;  1IN7 A;  3WU2 C;  3MZH A;  4Q5S F;  3OYF A;  4DGW B;  3SFI A;  2NVQ J;  3HSE A;  1YW7 A;  3EQL F;  3WE3 A;  3J81 K;  3CCM I;  1HA8 A;  5ICF A;  2STW A;  4LB5 A;  2JJ7 A;  4Y52 J;  5IP7 J;  1SFK A;  3RKW A;  4HA8 A;  2IA1 A;  3FXQ A;  4GGG A;  2XSD C;  2BY0 A;  5B1A H;  2A61 A;  3GME A;  4ZH4 F;  1OR7 C;  3VSK A;  4BQO A;  4QSH A;  4BBR J;  5JHF A;  2LR8 A;  4G7O F;  4O5V A;  3K9T A;  2R7Z J;  2PFB A;  4CA0 A;  2E1M B;  2RC4 A;  4A3G J;  4L5I A;  2HGC A;  3B6A A;  4PK4 A;  2VON A;  5BMZ A;  5AON A;  1J75 A;  5F0C A;  3L9F A;  3NRV A;  4CO8 A;  1U9N A;  2IPQ X;  5IY5 H;  3GBG A;  3A02 A;  2R93 J;  3TOB A;  4L0Y B;  1WJF A;  1DPR A;  3I58 A;  4PJJ A;  2JTV A;  3OYD A;  1FYK A;  1FTZ A;  2IGN A;  5IPA A;  4RGS A;  3CUQ C;  3VEP A;  2ZBK A;  3HUG B;  1LB2 A;  3LWF A;  2QWW A;  2X6O A;  3TDU C;  1OCO H;  3ZMU A;  3RDI A;  2CU7 A;  1T0F A;  3NAR A;  3QYF A;  4PCQ A;  2E36 A;  1Q1H A;  2CW8 A;  4FT8 A;  3Q0V A;  2W84 A;  2PX9 A;  2ELJ A;  1DGW Y;  3GWZ A;  1L0O C;  1ERD A;  4BGD A;  1HCR A;  1W7P B;  2Z2S B;  4G6D A;  3TOA A;  3J7Y J;  1OPC A;  2EK5 A;  1MD0 A;  3KFW X;  1I3A A;  2PJR B;  2W85 A;  2LDU A;  3MN2 A;  1X1A A;  2Q1Z B;  2PLY A;  2JWT A;  3E5Q A;  3RPQ A;  2GA2 A;  3F3X A;  3ECH A;  3PUF A;  2A6H F;  1GUU A;  3ROU A;  2P7V B;  2ZSI B;  4MLO A;  4E6K G;  1PUE E;  1ULY A;  2OUM A;  3TBI A;  2O3F A;  3HYI A;  1MH4 A;  2ZXI A;  3HDD A;  2E5N A;  2DT7 B;  3IH2 A;  5HS9 A;  3SZG A;  2GAU A;  3I4M J;  1BN5 A;  2HXO A;  1KON A;  1QNT A;  5DCF A;  2E1M C;  1HDP A;  4RAF A;  1MNM C;  4OWR B;  1ZAR A;  3W6V A;  1B8I B;  3I55 I;  4BUP A;  2PMZ N;  3OYC A;  5K7H A;  3JR9 A;  3HTU A;  3K4C A;  5E1Z B;  3K4B A;  2BXZ A;  3PQK A;  4LK0 F;  1U6G A;  2M8G X;  3A4C A;  2XF5 A;  3M1E A;  1IUY A;  2ZFW A;  4NUB A;  3WU1 B;  3DF8 A;  1WJ5 A;  4A3L J;  3CD6 I;  2Y2Z A;  4A3J J;  1N78 A;  3K2Z A;  1DU6 A;  4XLC A;  5GTI C;  2DJN A;  3DEU A;  2CW0 F;  1HF0 A;  2JSP A;  1REP C;  4BEH B;  3KE2 A;  3EUK L;  2H6C A;  2BHY A;  5D5X B;  5J3L A;  4HW0 A;  4IPA A;  2OTJ I;  3GTM J;  3QRF F;  4J19 A;  2ACJ A;  4ZZL A;  1X1P A;  3OYM A;  3PQJ A;  2L3D A;  3S3M A;  1KGS A;  2EIL H;  4IHV A;  2NS7 A;  5GPC A;  4Z6Y A;  3DU5 A;  2JQ7 A;  2YX4 A;  2UXX A;  3GTQ J;  4HF0 A;  2OBP A;  2DA5 A;  2MGQ A;  4LB6 B;  3V4G A;  1R1U A;  3PNY A;  4P96 A;  3SZP A;  1ZR4 A;  1WH7 A;  1P6R A;  1GXQ A;  3KPH A;  2EFP A;  2VKH A;  2ICW G;  1R49 A;  4D1Q A;  2VQL A;  1G59 A;  2CGP A;  4NNJ A;  1ZLJ A;  3Q3S A;  2BY3 A;  2FOK A;  2KFD A;  2FOW A;  3E3V A;  4G94 A;  5F27 A;  2R7D A;  4GFB A;  3SDB A;  4XN0 A;  2XHK A;  1FLI A;  3LQR A;  2AS5 F;  1APL C;  3SFZ A;  1VF9 A;  3GFL A;  3CJR B;  4KNY A;  2Q2E A;  5ILS A;  1ON2 A;  4BJ5 C;  3GW2 A;  3L2W A;  2AQF A;  3JAM Z;  3LL7 A;  3L2C A;  1QU3 A;  4DZJ A;  4G6T B;  1WJD A;  1X2N A;  1HLV A;  4MO7 A;  4DYC A;  2WBM A;  2G9W A;  4CZZ A;  2EB7 A;  4Z2Y A;  4XLE A;  4XK4 A;  3IKT A;  2Z9O A;  3WTW C;  4HX4 A;  1JJ8 C;  1BC8 C;  3DEE A;  2K27 A;  4EM1 A;  4FIS A;  2WV1 A;  3RYR A;  2ZFU A;  1ZN2 A;  2L02 A;  4XRF A;  4RB2 C;  4U0Y A;  4OIO F;  2YR2 A;  3EDP A;  2NXN B;  3MD2 A;  4W1U A;  2LMD A;  1AKH A;  2ZXJ A;  5FRN A;  5E8G A;  1T39 A;  2E1O A;  1G6N A;  3CC2 I;  2VJ4 A;  1HW1 A;  5FFX A;  3GTJ J;  5DV5 A;  5H6R A;  3RPU D;  1F1Z A;  5D5V B;  3ELK A;  1T98 A;  5LGN A;  2E7X A;  1BA5 A;  1XX5 A;  2X1C A;  4F3Q A;  4WXD A;  3VYR B;  3ASN H;  3EUH C;  3I4N J;  3CLO A;  1BM9 A;  2ELK A;  4PJL A;  3V7C A;  1UAA A;  2VKE A;  4XLP F;  1HC8 A;  3CQZ J;  5F1R A;  2PN6 A;  1Y8Q B;  2F4O B;  3R61 A;  4HF2 A;  4RS8 A;  2V9K A;  4AC0 A;  5E20 A;  1FBS A;  1BJZ A;  2UXN A;  1YYV A;  4IZZ A;  3ZQG A;  3K1M A;  1J2X A;  2DDA A;  3P7N A;  2XRO A;  2RKH A;  3HM5 A;  5HOD A;  3PNV A;  5D5W B;  1R00 A;  2K9Q A;  2VBZ A;  3BQZ A;  4HOB A;  2Y31 A;  4F92 B;  1WJE A;  2O7O A;  4IHX A;  3KX2 A;  4D9J A;  4I2O A;  4RDU A;  1LDJ A;  1I5Z A;  2GA1 A;  1V54 H;  2EJR A;  3M07 A;  3IKV A;  2EPF A;  2BOL A;  3OYB A;  1RR8 C;  2L7K A;  3J80 K;  1Z21 A;  1QVU A;  1MJA A;  4ZJZ A;  2EH3 A;  1OYY A;  2E71 A;  1A04 A;  4ESJ A;  1MND A;  1UB9 A;  1ZYR F;  1XSV A;  3W2V A;  2XUB A;  2VE9 A;  5LHG A;  1D1C A;  2MD5 A;  3DBL B;  3FIW A;  3IC7 A;  4GDF A;  4FTH A;  3C2G A;  4F7Z A;  2Z33 A;  4HST A;  4QWQ A;  1ITY A;  2V1N A;  1WI3 A;  2K9M A;  4JP0 A;  2L7M P;  2QEX I;  1RUO A;  2X6W A;  4HLY A;  1XGM A;  4U0V A;  4C30 A;  3SQN A;  3MMY B;  5IT9 K;  1P4W A;  5HS7 A;  3H3U A;  4D5F A;  5FD5 A;  1GDT A;  1OR7 A;  2ID6 A;  2OU2 A;  3DCF A;  4MQV A;  2LVS A;  2XAH A;  3LNQ A;  2HOT A;  2HQN A;  1WPK A;  2DK5 A;  3JSO A;  5M3F J;  1EA3 A;  4EAT A;  3B02 A;  3ZN0 A;  2F4I A;  2IA0 A;  3RKX A;  3QOP A;  2COM A;  4OU0 A;  4PUS A;  4E7I A;  1S72 I;  4UY8 I;  4EJO A;  1FP1 D;  3KYL A;  3TQN A;  3D5S C;  3AKZ A;  2BW3 A;  3EYI A;  1CF7 A;  3HOX J;  5BOX A;  3CUQ A;  2DA2 A;  4RLQ A;  4I76 A;  1RPW A;  2LKP A;  3W2W A;  2UUZ A;  1DGR M;  2V26 A;  2E1C A;  3OYI A;  5HLI A;  4HNU A;  2Q8K A;  3KP3 A;  3CMA I;  3OS0 A;  4YFN F;  4EQQ A;  2M45 A;  2DYR H;  2XKO A;  1PVE A;  3HGG A;  4C9Y A;  2QQB A;  1EJ9 A;  4LOC A;  4XOP A;  2A6E F;  4AYB A;  4W97 A;  1LDD A;  3FHN A;  3FM5 A;  3OOP A;  2QUF A;  1D3Y A;  5ED4 A;  2CYY A;  3KLO A;  3GX4 X;  2L9N A;  1ZRE A;  2V1U A;  5HLT A;  2WY7 Q;  3LAJ A;  3F22 A;  2XIG A;  3BCA A;  2FXA A;  3ZMV A;  4HQM A;  4Q4Z F;  1ZAO A;  2P7C B;  4I99 C;  1K78 A;  2JPC A;  3JW4 A;  4B43 A;  2STT A;  3ABL H;  1TT0 A;  5JI6 A;  4P9F A;  2MH2 A;  1MBF A;  2FMY A;  3PFI A;  3V7S A;  2LG4 A;  1VFC A;  5ILU A;  4XBF A;  3L2Q A;  2GXB A;  1FOX A;  5FGM A;  2F5D A;  5KCM A;  3U9G A;  3BTI A;  2D1V A;  3H0D A;  1ZHF A;  2X48 A;  4JX6 A;  2Z3Y A;  2NVX J;  1SD7 A;  3CCV I;  2K02 A;  2R7S A;  5IOY A;  1PP7 U;  1SAN A;  2VPR A;  1I1G A;  4HEA 2;  1OLT A;  3BTJ A;  1EKE A;  2Y30 A;  3COA C;  1I6X A;  2BVL A;  1LKX A;  4AU7 A;  3HUG A;  2QSG X;  3KP2 A;  5IYC J;  1H89 C;  4R1H A;  1MBH A;  1KU7 A;  4M9S A;  1FBU A;  4I01 A;  1LEB A;  4HQE A;  2JMW A;  1JHF A;  3H35 A;  4NC7 A;  4XMY A;  3F6V A;  5C4J J;  3LSP A;  4ZYG A;  3VPR A;  4L9N A;  2RQQ A;  5HS8 A;  1LE8 B;  3I56 I;  3ASO H;  2MA3 A;  2EIN H;  3HZJ A;  2MC4 A;  2LY1 A;  4IF4 A;  3BWG A;  1W7P A;  5FLV A;  2A6T A;  1X3U A;  3WTT C;  2CQ7 A;  3QAH A;  1WGX A;  1IUF A;  1Z05 A;  3K70 C;  2PJR A;  3FZV A;  3GF2 A;  3FKJ A;  4IJA A;  4UVA A;  2KIM A;  3PIO F;  2HTJ A;  5J8F A;  1MH3 A;  5D6F A;  3FXJ A;  1LPQ A;  3JRD A;  4BHP A;  3ZN1 A;  2BV6 A;  2IS4 A;  4JX5 A;  2VB6 A;  3E6C C;  4B8X A;  3FWE A;  3CCR I;  2F2E A;  2XAU A;  2VAS A;  1PUF B;  2X85 A;  4UUT A;  5FFZ A;  3OYA A;  3ZP5 A;  4UVC A;  2KZG A;  2B7E A;  3S3N A;  1B8I A;  2KIQ A;  2X9D A;  5ICE A;  2L9R A;  2DT5 A;  2FE3 A;  4KIC A;  3SHF A;  2O0Y A;  1WWX A;  4HG2 A;  3VYS B;  3KYC B;  1RES A;  2DOF A;  1TQM A;  1K6Y A;  2R7O A;  4C2M J;  2O8X A;  4RAY A;  1U8R A;  1G2H A;  2R7W A;  2DBB A;  1TWH J;  5EF6 A;  1XCV A;  4GYG A;  3GTK J;  1IXR C;  2IW5 A;  2R7U A;  5LGU A;  3LFK A;  1JGS A;  4V2F A;  2DLL A;  1R5I D;  3IAM 2;  1T56 A;  2KZV A;  4N4N B;  4GXO A;  3TDZ C;  1NTC A;  2A69 F;  3I5U A;  1SD5 A;  4BEH A;  3G73 A;  2ID3 A;  4Y13 A;  3RTR A;  3ZQC A;  4L18 B;  4XL9 A;  1ZRF A;  2L4M A;  4DOZ A;  2FML A;  4QPQ A;  3HOY J;  4EJW A;  1WI9 A;  3CMY A;  2MSY A;  1Z1D A;  5E18 F;  3HHH A;  2CV1 A;  3H9J A;  1H9T A;  3MFK A;  3OY9 A;  1U78 A;  1ZR2 A;  2KHM A;  2OC6 A;  1T33 A;  4ENN A;  3KP7 A;  1ETW A;  1Z9C A;  4B09 A;  2ZME C;  4YFX F;  2CQN A;  2A5Y B;  3KET A;  2OQR A;  2MLG A;  2VBW A;  1FSE A;  2EZK A;  2F4M B;  2GWR A;  4PFP A;  2GXA A;  2JA6 J;  1IRF A;  2IAI A;  2YX7 A;  1KU3 A;  1BOB A;  3C2H A;  4H4K C;  4F52 A;  1QA6 A;  3JSP A;  1GXP A;  2QYO A;  3DTE A;  4NC8 A;  1IV8 A;  2ZCW A;  1FC3 A;  2DFF A;  5A2Q K;  4B1R A;  3MKZ A;  3H5N A;  4EJU A;  1MJB A;  2HYJ A;  4IL6 C;  3JCU C;  2CQK A;  5D8K B;  1LVK A;  2WTE A;  4F93 B;  3PM1 A;  5E1X A;  3T0Y A;  5IOZ A;  4ENJ A;  3GEZ A;  4A3D J;  3CME I;  3Q0W A;  3T1B A;  3LAP A;  3OMY A;  3GTO J;  3BG5 A;  3P9I A;  1ACI A;  2WB1 A;  1R4M B;  1TP4 A;  4XNF A;  2G7U A;  2OD5 A;  3HOU J;  2E19 A;  4PJN A;  4BE0 A;  3FXK A;  2VIX A;  3A0B C;  3DLL F;  5BPI A;  3AG3 H;  1GT0 C;  2DMQ A;  1WJB A;  2HYG D;  5C3E J;  2HDW A;  2JRT A;  1R6R A;  5ICC A;  4LMY A;  1AOY A;  3C3W A;  3K4N A;  1YTY A;  3CCJ I;  3TL4 X;  2C6Y A;  4A0X A;  4UHT A;  2VJ5 A;  1XGO A;  1XMA A;  2EWN A;  2GIZ A;  4LG3 A;  5KNL A;  4FE7 A;  3JRE A;  2M4G A;  2CRG A;  4RB3 C;  2IT0 A;  5IT9 Z;  3K4L A;  2R7T A;  1D0Z A;  4EJT A;  4HAM A;  1FOY A;  1E3H A;  1TWG J;  4KT5 C;  3ZQI A;  2VUM J;  2GLO A;  1YJN I;  1TTY A;  2VKD A;  1Y0U A;  1UMQ A;  5JLW A;  5EGO A;  1ON1 A;  2A5W A;  5K1Y A;  3L2V A;  3OYJ A;  3T5X A;  2A05 A;  4ON0 A;  1Z3X A;  3BR1 A;  5IT3 A;  4S04 A;  4XQF A;  3F8C A;  4UUS B;  5CVI A;  2GBY A;  2MAB A;  3H5A A;  5KK1 A;  1HBX G;  3BCB A;  1ZKG A;  2BYV E;  1P9Q C;  4BKX A;  1I1S A;  1I27 A;  2ISZ A;  1FNN A;  4L5E A;  1T8I A;  2OTL I;  1JGG A;  4PDK A;  2KP6 A;  2W57 A;  3A01 B;  1QRY A;  1PP8 F;  4QPO A;  1OCC H;  1BI1 A;  4PJ0 C;  4A3E J;  2KQR A;  2ISY A;  2KDZ A;  3DKY A;  3FK6 A;  1H9G A;  4ESF A;  4DNC A;  1AU7 A;  3BJO A;  2IRF G;  5M5W J;  2LKX A;  2W1O A;  3M8F A;  3HGY A;  2DN0 A;  4A6E A;  4B44 A;  2VXZ A;  5B1B H;  4DBQ A;  1J9I A;  2KIS A;  3C18 A;  3BJ6 A;  3IRR A;  4YIF A;  1SD4 A;  1ZTR A;  4LD5 A;  2OF7 A;  3D1N I;  1CGP A;  1D8K A;  4FET A;  1MBE A;  1G3Y A;  1O3R A;  3LOC A;  4JK1 X;  1R1V A;  4KIF A;  3ZMT A;  3JRG A;  1JKP C;  2CW7 A;  1QPM A;  4LFU A;  5DM7 F;  4BE1 A;  3GCM A;  2HOS A;  3I53 A;  2DTZ A;  2DOE A;  3ML6 A;  2EIK H;  3OYH A;  1ZQ3 P;  3DBR B;  2WAD A;  1ETK A;  2DA6 A;  3KYD B;  1MMD A;  3ABM H;  3RSN A;  5DUK A;  4L9J A;  2EIM H;  1D0Y A;  3DKX A;  2AO9 A;  3AL0 C;  4KMU X;  2H94 A;  1JKO C;  1BI0 A;  3CZ6 A;  2HQA A;  5FJ8 J;  1M1E B;  2X6Y A;  3TW6 A;  3ZQ7 A;  1KQ9 A;  3K2A A;  2OPT A;  3WGH A;  1O3Q A;  1K78 B;  3DTI A;  4XRM A;  4F55 A;  4IQJ A;  3DP7 A;  5M5X J;  4N9H A;  3W6J B;  5FLX K;  3P9C A;  5K7F A;  2JRM A;  2JZY A;  1B4A A;  3Q9S A;  1F36 A;  2HFH A;  3H92 A;  3BTC A;  4G7H F;  3AG4 H;  4BJT A;  4RA2 A;  1LFP A;  2GIV A;  4CCL A;  4G12 A;  4G8X A;  4Q48 A;  3I71 A;  1X4P A;  4BXU A;  4KDP A;  1FOK A;  3A1Y A;  3L7W A;  1BBY A;  1GVJ A;  2VT2 A;  4DIQ A;  1YJ9 I;  4EMS A;  3L2R A;  2QQ8 A;  1DUX C;  2ZB9 A;  3L09 A;  4Q47 A;  1R36 A;  3FXO A;  2HZT A;  2IS6 A;  2RGV A;  1BJA A;  3QYE A;  4S0H B;  4YII A;  2R7R A;  1UJ8 A;  1WKM A;  4DYR A;  4OIP F;  3HSR A;  4RGR A;  1X1B A;  2CO5 A;  3QQA A;  2L54 A;  1VQO I;  2BVM A;  3KLN A;  5JLX A;  4DYQ A;  2M0M A;  1TC3 C;  2UV1 A;  2VC1 A;  3CLQ A;  4ZDP A;  4D7N A;  3DLA A;  3N4M A;  2X6X A;  2M7A A;  5EEH A;  3WGG A;  1RR7 A;  4KN7 X;  2ME0 A;  4KN4 X;  1YW8 A;  5EYR A;  1JI8 A;  5DYM A;  1W0T A;  4JBA A;  3WHB A;  5IYD J;  4EV0 A;  1XTA A;  5DCM B;  5L3E A;  1IAW A;  2ZNY A;  3VWB A;  1J0R A;  5D5U B;  3TP0 A;  4BY7 J;  1RNL A;  4Y3O A;  3BZC A;  2DYS H;  1RC9 A;  3K69 A;  1LE8 A;  1V3F A;  3OWT A;  2R0Q C;  1JJ6 C;  1Y1W J;  1B6A A;  2HQR A;  3WTX C;  3CMM A;  1MBG A;  1I6H J;  3HOV J;  4CYD A;  2KJB A;  5BS6 A;  4UV9 A;  1E0E A;  3UKG A;  4OAZ A;  2KLO A;  2EQR A;  4M9Z A;  3BRO A;  2DMT A;  1R22 A;  2IVM A;  3P5J A;  2VBY A;  3KP6 A;  4I7H A;  4JQF A;  3DQV C;  1RKT A;  2DO7 A;  4XKW A;  2QSF X;  1S6L A;  4IX7 A;  3RZD J;  3S15 J;  4WXH A;  4KFC A;  4O6J A;  2EV0 A;  3PO3 J;  3J7A O;  2UZK A;  2ME6 A;  5BQT A;  2P81 A;  2Y75 A;  2K9S A;  2JA5 J;  1PUF A;  1IV6 A;  2PMU A;  3IV5 A;  1SFX A;  3DU6 A;  4ASN A;  3A03 A;  2MD0 A;  3CCL I;  1F9N A;  5H20 A;  4OIQ F;  4KUM A;  2X0L A;  3F6O A;  4M73 A;  1YHQ I;  1WRJ A;  5GAH J;  1HOM A;  2DAO A;  2ZC2 A;  1JXS A;  2V1D A;  2HDC A;  3JRB A;  2LTP A;  2LKS A;  3CP8 A;  4HBL A;  1YO5 C;  1Q1V A;  2AXL A;  2DPU A;  1XGS A;  3S2W A;  1CQT A;  1QBJ A;  2BZT A;  2V9V A;  1IN4 A;  1P7J A;  1JUM A;  4AD9 A;  5IP6 A;  3BR3 A;  3CJT B;  3BG3 A;  3LSG A;  3I3L A;  5E3M A;  1YFH A;  4ZYE A;  1Y8R B;  1G8X A;  5J1U A;  3U2R A;  5ERI A;  4A3K J;  1DP7 P;  1YRN B;  2A3S A;  2CMP A;  2XAF A;  2HOE A;  5K5R A;  3OIP A;  4KIB A;  2KMU A;  2O5R A;  1UST A;  1YX5 A;  3C1D A;  3RZO J;  1OJL A;  4P5O A;  5EJC A;  3E6D A;  1TWF J;  1Z6R A;  4GYI A;  1TW2 A;  3R0A A;  4OOI A;  3VDX A;  5LRS A;  3WU0 A;  2CWE A;  4XLA A;  3LA3 A;  4HV6 A;  2FF4 A;  3CF2 A;  4E7J A;  4U87 A;  1WZ2 A;  2CSO A;  3GXO A;  3O3K A;  3S2D J;  3M1C A;  2E2J J;  3OL3 A;  2K85 A;  2X1D A;  2QCO A;  1U5T B;  3E0J B;  5FKK A;  3SDG A;  2H1K A;  1R71 A;  1E3O C;  4B48 A;  3QU3 A;  2MC3 A;  3S14 J;  3H1C A;  1QQI A;  5HNH A;  1XSD A;  3G1L A;  3ZQL A;  2WA0 A;  4JOM A;  4ZC3 A;  3O6B B;  4ABZ A;  1OCP A;  3NWT A;  3PSI A;  2VPL A;  2QKM B;  3OL4 A;  2CS3 A;  1B1B A;  2QEN A;  5KHD A;  2R7Q A;  2P5L C;  3DKW A;  2EZI A;  1B59 A;  1FBQ A;  5E3O A;  3H0G J;  1WFX A;  2XPW A;  4PFO A;  3IHU A;  3Q5F A;  2F5V A;  4II3 A;  1TNS A;  2D2W A;  2XF6 A;  1JE8 A;  1Y6I A;  4GRI A;  3CJN A;  4NHJ A;  1LNW A;  2FA5 A;  5EGO B;  3TKY A;  3HKZ A;  1HSJ A;  1HW2 A;  2L7F P;  3OS2 A;  1GV2 A;  2VQG A;  3HC7 A;  4OIR F;  2LNB A;  2DU9 A;  4IKF A;  2B9S A;  1U0J A;  2FQ3 A;  2XVC A;  4HDV A;  2BGC A;  1OYW A;  3IP4 B;  2H8R A;  3BJA A;  4RM3 A;  2EA2 A;  3TO7 A;  2DXI A;  4HRI A;  4XON A;  4LLL A;  1DU0 A;  2XPV A;  3U21 A;  3LA2 A;  5J6X A;  4BDZ A;  4CYC B;  1D8J A;  1ETV A;  3MZY A;  5IP9 J;  2QQ9 A;  5CLS A;  3ZCO A;  2X51 A;  1OCZ H;  3FXM A;  3BR6 A;  1O7L A;  1U5T C;  1UHS A;  3FXR A;  2JN6 A;  3ABT A;  2WAE A;  3HIF A;  4AUX A;  4BDY A;  4UNO A;  1W1W E;  2R7F A;  1UFM A;  4EGY A;  1WH5 A;  1VQM I;  1S7E A;  3V42 A;  3V8K A;  4UUS A;  2OJE D;  2NS8 A;  2E2H J;  5F08 A;  3HPG A;  3J81 Z;  2PBI A;  4P55 A;  3UNG C;  1XMX A;  4KIG A;  4AYB N;  4C3H J;  1PYV A;  3I64 A;  3S17 J;  2MFZ A;  1MMN A;  1MJ9 A;  4ANJ A;  5F04 A;  2BY1 A;  2IBD A;  2W25 A;  3K10 A;  4E7Z A;  1YIJ I;  4KIS A;  2YU9 J;  1B72 B;  1O3T A;  9ANT A;  2FSW A;  4CCJ A;  4BQN A;  1NHA A;  3G4S I;  2QA4 I;  4KMF A;  1QGP A;  3A01 A;  3BP8 A;  3G3Z A;  1QPI A;  1TW3 A;  3HEF A;  3QPL A;  3ERM A;  5FLX Z;  4G9Y A;  1VZ0 A;  3L1P A;  4OMY A;  4XRS A;  3GLX A;  2Z5U A;  2LFB A;  2WAF A;  1D5Y A;  5J47 A;  3T8T A;  1EH8 A;  5F1J A;  3IWF A;  3UR3 C;  4RAG A;  4MEX F;  3VFZ A;  2DFH A;  3FMQ A;  1IF1 A;  3KZI C;  1G4D A;  2XKP A;  1NG7 A;  3O8G A;  1ETY A;  1SFO J;  4MTD A;  3HOS A;  3DPU A;  1I50 J;  4KT6 A;  3FMS A;  4M6V A;  4E7K A;  1OFC X;  2MG4 A;  4LIU A;  3MVP A;  3DEW A;  3TW7 A;  1YIO A;  3K1N A;  1R4N B;  2DFI A;  4HYE A;  4EM0 B;  2VI6 A;  4M6X A;  4X0G A;  1MSE C;  1EF4 A;  3E97 A;  4Y17 A;  1W36 D;  4BS9 A;  2VQC A;  1NK3 P;  2H09 A;  3ZMZ A;  2PI0 A;  3HRU A;  2LF7 A;  2R92 J;  2P6T A;  2DTR A;  4HLX A;  3W3C A;  2MBF A;  3FKI J;  1OMI A;  4MGR A;  4KJZ A;  5GAE J;  2EIJ H;  2JA2 A;  2E34 A;  3FHZ A;  3KCC A;  3PO2 J;  3K7A J;  3HJE A;  2HU9 A;  5LHI A;  4B3A A;  3WTS C;  2E35 A;  3ZRG A;  3WG7 H;  1YI2 I;  4HNT A;  2HVQ A;  4A0Z A;  3GTP J;  3C7J A;  1G3W A;  1FZP B;  1FTT A;  3V8J A;  1XCB A;  1PDN C;  1R5H A;  4EM2 A;  1MDM B;  3M3Y J;  1ODD A;  3DPT A;  2R7V A;  3AG2 H;  1YG2 A;  3IWZ A;  4AM3 A;  1IXS B;  3SJM A;  2IS1 A;  3CCS I;  3I4P A;  3TO9 A;  1SVM A;  3WTU C;  3F21 A;  1IXC A;  3ERE D;  1SD6 A;  1HQC A;  5HLH A;  4A5N A;  2DMU A;  3K0L A;  3MZ8 A;  5C4X J;  2LLK A;  1SAU A;  3ZOB A;  2MW8 A;  4CGZ A;  2OQG A;  2G0E A;  3BDD A;  2LD5 A;  4U0W A;  1W0U A;  3A2K A;  3E7L A;  4YEL A;  2H27 A;  2M5W A;  3LSR A;  2Y9Y A;  1MGT A;  2JVH A;  1XG1 A;  1Z3Y A;  2KIF A;  3HSF A;  2Y48 A;  2ZME B;  5FKL A;  1J59 A;  2HQ5 A;  1ZK8 A;  2HTS A;  1Z6T A;  4I02 A;  4LLN A;  2IS2 A;  4GO1 A;  4OIN F;  3QU6 A;  5J1Y A;  1MMS A;  2QGU A;  5DCM A;  1RIO H;  4DQ2 A;  2M34 A;  1VQ9 I;  2FX0 A;  3GLL A;  3PL8 A;  5E3L A;  2NRA C;  4YRV A;  4BHB A;  4A3M J;  2QF7 A;  4ZDL A;  1W36 C;  1HW5 A;  3FDY A;  3MAJ A;  1JTX A;  1DDN A;  1S8N A;  1LDK B;  1OCR H;  2L0K A;  5B5E C;  1IW7 F;  3OYK A;  2FNP A;  4J01 A;  3BQY A;  1UZC A;  2EZL A;  4PSW A;  1MW7 A;  2AHQ A;  3MQ0 A;  4D5C A;  3ONQ A;  1OCT C;  5HVQ C;  1YS6 A;  2WB1 N;  1Y39 A;  4D7M A;  1Y56 A;  2IP2 A;  2D5V A;  2RN7 A;  3FXU A;  1FMV A;  1SMT A;  5JFR A;  4Y4R A;  1VQ6 I;  1E3P A;  1BIA A;  3QOD A;  5L3F A;  1MMA A;  2L5Q A;  2DPD A;  4PJM A;  3E5U A;  3SYT A;  3HPH A;  1A5J A;  2QKL B;  2P4W A;  3GZ5 A;  1TWA J;  3JTG A;  2IGO A;  1HDD C;  1QZZ A;  2XGX A;  1Z77 A;  2JUC A;  1X58 A;  5JVT A;  4V2G A;  2RNG A;  1WQ2 A;  1JUS A;  1X3W B;  1X4O A;  2RV8 A;  2ZO4 A;  1E2X A;  3I0T A;  2OCE A;  4UV8 A;  2V4J C;  5FKM A;  1ZGJ A;  2VL8 A;  4AIH A;  1LFU P;  4P9U A;  1N77 A;  1YJW I;  1XPX A;  2BHZ A;  3EUH A;  1ETX A;  4CDG A;  3ABK H;  1O57 A;  1OKR A;  4AVP A;  2NVY J;  1BW6 A;  1W5C C;  3GVA A;  5TGT A;  3ZQQ A;  1TZL A;  2V6E A;  1YRN A;  2MH9 A;  2LYC A;  2HPI A;  3ABU A;  1P7I A;  3HB9 A;  4G6Q A;  4NQW A;  2XRN A;  2ZJP F;  2CV0 A;  3H3V K;  2EA4 A;  4A12 A;  3CCE I;  5LGT A;  1IGN A;  3LSM A;  3PFY A;  4RMN A;  3ZMD A;  3CP2 A;  4O3M A;  2M30 A;  1FWZ A;  2CUJ A;  2RDP A;  1A6Q A;  2VOP A;  2XB0 X;  2CJJ A;  2Y0S N;  1FIP A;  4A3I J;  2BXY A;  4FX0 A;  4N9I A;  5DD8 A;  1U5T A;  3VSL A;  4J00 A;  2HEO A;  4IHW A;  2YS9 A;  2JA8 J;  1FY7 A;  2Z16 A;  3J80 Z;  4LJZ F;  2KRH A;  2VE8 A;  5FKN A;  4IRH A;  2GOX B;  3WOD F;  3X2Q H;  4FAS D;  4ZYH A;  2QLZ A;  1YX3 A;  5M3M J;  2FUG 2;  2L2O A;  1R5G A;  3HRM A;  4XR6 A;  2PEX A;  4P1W A;  2NOJ B;  3IUO A;  2I5U A;  4QLC U;  1ZGA A;  4BXX J;  1N25 A;  4U88 A;  1YS7 A;  1ZLK A;  3QPS A;  1POG A;  5CPR B;  2M1B A;  4RGX A;  3OR2 C;  5BPD A;  3QYB A;  2L01 A;  2F6C A;  3F0C A;  3VOE A;  3LA7 A;  3GTL J;  1R1T A;  1VQ8 I;  3KP4 A;  3LSJ A;  2HNH A;  4IXA A;  1I3Q J;  5AIQ A;  3RIR A;  3CJQ B;  3QPT A;  4RB1 A;  3H3Z A;  4XLH A;  1IN5 A;  4GCV A;  4C2T A;  3WTZ A;  4HX7 A;  1ZEL A;  2DA1 A;  3J7A Y;  3W6K B;  5DDG A;  3RPU A;  5FLM J;  5KVR A;  5E3N A;  5L3C A;  4G7Z F;  3AL0 B;  1R9T J;  2JA7 J;  2Y0S A;  4BE2 A;  1V5F A;  1GLN A;  4CYC A;  2HKX A;  2LSO A;  1V5E A;  2LH9 A;  3JRA A;  3A0H C;  3G1O A;  1QO0 D;  2DA4 A;  2OV7 A;  3B73 A;  1BC7 C;  3DPL C;  2F48 A;  3ISP A;  2ECC A;  2V6C A;  1BI2 A;  1GVD A;  3DWL E;  4XID A;  2D1H A;  1OIS A;  3TO6 A;  1VQN I;  3LMM A;  4ESB A;  3FX3 A;  2K4J A;  2P5K A;  4M3D A;  4I0A A;  2QVO A;  3JRI A;  2TCT A;  2KPM A;  2FNA A;  4WWC A;  3HOT A;  4XN3 A;  1KYW A;  3K1P A;  2L4A A;  1ONV A;  1IO2 A;  2V7F A;  4JYK A;  4TV7 A;  1MMG A;  3M8J A;  4IHT A;  1B72 A;  4FE4 A;  3WG9 A;  2GOM A;  1Z91 A;  1P92 A;  4XOR A;  3F8F A;  4R79 A;  1ZG3 A;  2H1L A;  4KIT B;  5CQE A;  2M3A A;  2L9S A;  2AQE A;  5DM6 F;  2XV4 S;  3CCY A;  1LVA A;  4M72 A;  1TL8 A;  1O7F A;  4FCY A;  2H8W A;  1QVT A;  3AAF A;  1RET A;  3G1M A;  4MIM A;  1NK2 P;  3BZK A;  2JT1 A;  2K86 A;  1LQ1 A;  3CO7 C;  1V55 H;  3O2P E;  2WAQ A;  4YEJ A;  1RUN A;  2OZU A;  2RNJ A;  2CUF A;  3ZMS A;  4II2 A;  2XAS A;  1A36 A;  2E1N A;  3QPH A;  1UG0 A;  1K4T A;  1TWC J;  4XSX F;  3N05 A;  4A69 C;  2O03 A;  2QZ8 A;  4PSX A;  4L9V A;  6PAX A;  4XIC A;  3ULQ B;  5CYV A;  1FMW A;  3IH4 A;  4X6A J;  1H8A C;  2VC0 A;  5EG0 B;  2P5V A;  3RJP A;  4YG2 F;  2PG4 A;  5F0H A;  2GQQ A;  2WWY A;  3QOE A;  3CDH A;  1X2M A;  4UB6 C;  4ETS A;  3DFG A;  4CCM A;  4PZJ A;  2CV2 A;  3ZXS A;  4FQG A;  1ZG5 A;  3PJR A;  2VJI A;  2W48 A;  3KIO A;  3HRT A;  5D8L B;  1WCM J;  1P4A A;  1JKR C;  5LRR A;  2IGM A;  4M9X A;  3NQO A;  1IDY A;  1XMK A;  4XLF A;  1QHG A;  4HNV A;  5HNF A;  4MNU A;  2JSC A;  1FX7 A;  5CVJ A;  1IRG A;  2CUZ A;  3V8L A;  1BR1 A;  4E7H A;  3K4M A;  1HXD A;  2NVT J;  3M8E A;  3V7R A;  4HX8 A;  2FQ4 A;  5KAF C;  4C3J J;  1MBJ A;  5E79 C;  3KP5 A;  2E2I J;  2XAJ A;  2P8T A;  3LSK A;  2PMH A;  1W7P D;  4IO9 F;  2GZW A;  2EZH A;  1MDM A;  1K83 J;  4M3B A;  2HWV A;  4IHY A;  1IZ1 A;  4HF1 A;  1GV5 A;  1UCR A;  3S1Q J;  1XC5 A;  4UUV A;  2IJL A;  4KYW A;  1YOV B;  4A2U A;  2CH0 A;  1TBX A;  1BW5 A;  1BR2 A;  1DQU A;  4HPQ A;  3BR0 A;  4I98 B;  3TMO A;  1TNT A;  4A93 J;  4ZDO A;  1EH7 A;  3AFH A;  5B3S H;  1RKW A;  1QZY A;  2VBX A;  4CCN A;  1K6O A;  1BIB A;  1Y1V J;  2W82 A;  2VOD A;  5CQG A;  3EUA A;  2XDV A;  4MTE A;  5L3G A;  2DOA A;  2LY9 A;  2ZJR F;  1O4X A;  2KJC A;  1VQ4 I;  5HLG A;  5H2F C;  2JPB A;  4E7L A;  1A6I A;  2QM3 A;  2W4S A;  3VB2 A;  1LJ9 A;  2ZME A;  2FBK A;  3R4K A;  4IVN A;  3WE2 A;  4BY1 J;  4Y7N J;  1X1D A;  4ZTJ A;  4M3E A;  1R7J A;  3FBI B;  4ENM A;  1BOA A;  2ZSH B;  3G2B A;  3QWL A;  4ITV A;  5J40 A;  2CG4 A;  2RVC A;  5A2Q Z;  4C3I J;  5IYB J;  4B47 A;  4LGW A;  3PIP F;  3ZPL A;  4M3G A;  4ZYD A;  4L5J A;  4FHT A;  3PUB A;  3O8H A;  3KEQ A;  2VXD A;  2AXT C;  1KZH A;  2RRE A;  3OIQ A;  2XF7 A;  4N4O B;  1FEX A;  4NC6 A;  4AVZ A;  3JRH A;  3BG7 A;  1HKQ A;  2HS5 A;  2M9H A;  4EEF G;  2O8K A;  1T2K A;  3FXL A;  3OOU A;  1Z67 A;  1U9O A;  5F6F A;  2JVG A;  3IAS 2;  2KL4 A;  3RQ4 A;  1SVO A;  5D4R A;  5GP9 A;  1YIT I;  1IRZ A;  1JTY A;  2HXI A; 
#chains in the Genus database with same CATH homology
 4OMZ A;  5ILV A;  3N97 A;  4RAZ A;  2DQR A;  4L9T A;  4M71 A;  3GZ6 A;  5E17 F;  3I59 B;  3R6S A;  5HDK A;  3GYH X;  1G3T A;  2ELH A;  3F23 A;  3KZZ A;  1F4K A;  2Z99 A;  5LEK A;  1XD7 A;  2G7H A;  5F64 A;  5LHH A;  2YPR A;  4IRG A;  5H6Q A;  4HDU A;  3SZT A;  2HKO A;  1EH6 A;  1SAX A;  4CXF A;  4MQ9 F;  4I0B A;  2YSR A;  4N0B A;  3ECO A;  3NEU A;  3R0J A;  5K5O A;  2ADU A;  3RYP A;  2J5P A;  3DV8 A;  3GFI A;  2F5F A;  3E5X A;  1Z7U A;  1RI7 A;  2EFQ A;  2QBY B;  1KQ0 A;  1J5Y A;  2BE5 F;  2H6B A;  5EEG A;  4R8H A;  2M87 A;  1USS A;  3MWM A;  1KA8 A;  2R3S A;  2PQ8 A;  1HST A;  3GUD A;  5E1W A;  2P6S A;  3GFM A;  3F72 A;  1ZRD A;  3D0S A;  5HOO A;  5LBQ A;  4S05 A;  1T38 A;  1KQ8 A;  3MEX A;  1VTN C;  1YW9 A;  4WX9 A;  5DD4 A;  4ZZD A;  1S7O A;  4BH9 A;  1ZG1 A;  1S3J A;  1D5V A;  3FF5 A;  2O6G E;  4CHU A;  2QQA A;  2OZ6 A;  4HZF A;  3HTS B;  4AIJ A;  4A5M A;  4LG0 A;  1FYM A;  3KZY A;  3M7G A;  2GXG A;  4UVB A;  3KEO A;  4ENK A;  4E70 A;  5HDN A;  2Q0O A;  3EYY A;  2FBI A;  2HYF A;  4EVI A;  3EET A;  5CVU A;  1XN7 A;  2NNN A;  4FX4 A;  1SFU A;  5CVR A;  4I09 A;  2IA2 A;  2V79 A;  2BEO A;  3REO A;  2FEZ A;  2CFX A;  4WXC A;  2RQP A;  1H0M A;  1W5T A;  2W24 A;  5L3B A;  3BPV A;  3U1D A;  1ZRC A;  4BQA A;  2O61 A;  1HKS A;  4EGZ A;  1FP2 A;  1W4M A;  2NS0 A;  2D45 A;  2F5C A;  1O3S A;  4CIC A;  1XB4 A;  2E7W A;  3CO6 C;  2A07 F;  5FO5 A;  4XSZ F;  2DK8 A;  1S7A A;  3E6B A;  1F5T A;  1FYL A;  2ESN A;  3IL2 A;  1XDU A;  5K5Q A;  3OV8 A;  4NB5 A;  3D5L A;  1KU9 A;  2EFW A;  1V4R A;  2NAZ A;  3HHG A;  3WTY C;  4U7D A;  2WC2 A;  1W5S A;  2ETH A;  3VOD A;  4A0Y A;  1YQA A;  5FD6 A;  1S29 A;  2K4B A;  1FT9 A;  1U2W A;  2LF8 A;  4K2E A;  2KKO A;  2WV0 A;  5CJ9 A;  4M6Y A;  3WTV C;  3JTH A;  5LLQ A;  1DPU A;  1YLF A;  4WCG A;  3TGN A;  2ZKZ A;  3LQQ A;  3BOQ A;  2V1X A;  1K79 A;  2MLK A;  3FM3 A;  1OYI A;  5D6E A;  4H0E A;  5JHU A;  1IN6 A;  2X4H A;  5E8I A;  3F8B A;  4D0P A;  3Q9V A;  3M9A A;  5TRD A;  5D4S A;  3RI4 A;  2EV6 A;  1FPQ A;  4A6D A;  3DXJ F;  1T6S A;  2FBH A;  4WK8 F;  4EJV A;  3BY6 A;  4WF2 A;  3T8R A;  4PGH A;  4RB0 A;  1RZ4 A;  4XLN F;  3F8M A;  1IN8 A;  3QP6 A;  2XAG A;  4YFK F;  1AWC A;  4LLG F;  4PGG A;  3F8N A;  2NYX A;  1STZ A;  2KRF A;  2M8E A;  4AIK A;  3CUO A;  1ZH5 A;  3BZ6 A;  4M74 A;  5TJJ A;  2KIU A;  2ZNZ A;  3FMR A;  4MEY F;  1KU2 A;  5AIP A;  1SFE A;  2FRH A;  3I59 A;  5HDG A;  3R60 A;  4BYY A;  1E17 A;  1TQI A;  1XGN A;  2K7L A;  5DEQ A;  1B9N A;  1G3S A;  4BAY A;  2Y0M A;  3RKY A;  3CTA A;  2DQL A;  2TDX A;  2EFO A;  2J5O A;  2A68 F;  1TLH B;  2HR3 A;  1XDS A;  4RGU A;  3P9K A;  4U7B A;  2BBY A;  2ZJ2 A;  2EV5 A;  2OAZ A;  3MCZ A;  1HKT A;  2FU4 A;  5L3D A;  3L00 A;  1C0W A;  1JHH A;  2YU3 A;  3WGI A;  4BHC A;  5FB2 A;  2QBY A;  1WSU A;  4Y15 A;  1U3E M;  1UHW A;  5J8C A;  1UHM A;  1P4X A;  5DUI A;  2VT3 A;  5LEJ A;  3JAM K;  1EV7 A;  4MHG A;  2DW4 A;  3GFJ A;  1SMY F;  3I54 A;  1MKM A;  4LG0 B;  2VN2 A;  1GHC A;  2ESH A;  2F5E A;  1LEA A;  1XSX A;  3QP5 A;  2B0L A;  2UWM A;  1K7A A;  5CVV A;  2PJP A;  1B9M A;  4BNC A;  1P2F A;  4HV5 A;  2OA4 A;  3BPX A;  4AWX B;  3LST A;  1L3L A;  1R58 A;  5JR3 A;  1BI3 A;  2NNY A;  4IRI A;  3SXY A;  1FSH A;  1KYZ A;  1R23 A;  1TQP A;  4LK1 F;  4KA4 A;  3E6M A;  1CF7 B;  1MZB A;  4UXN A;  3CUQ B;  1J7K A;  3IRQ A;  2VOO A;  3HRS A;  3GO5 A;  2EFN A;  5ICG A;  2XAQ A;  2DI3 A;  4L0Z B;  4IHS A;  1IN7 A;  3MZH A;  4Q5S F;  3HSE A;  1YW7 A;  3EQL F;  3WE3 A;  3J81 K;  5ICF A;  2STW A;  4LB5 A;  3RKW A;  4HA8 A;  2IA1 A;  3FXQ A;  4GGG A;  2A61 A;  4ZH4 F;  4G7O F;  4O5V A;  3K9T A;  2PFB A;  2RC4 A;  4L5I A;  2HGC A;  2VON A;  5BMZ A;  5AON A;  1J75 A;  3L9F A;  3NRV A;  4CO8 A;  2IPQ X;  3TOB A;  4L0Y B;  1DPR A;  3I58 A;  2JTV A;  1FYK A;  4RGS A;  3CUQ C;  3VEP A;  2ZBK A;  1LB2 A;  3LWF A;  2QWW A;  3TDU C;  3ZMU A;  3RDI A;  1T0F A;  4PCQ A;  1Q1H A;  4FT8 A;  2W84 A;  3GWZ A;  1L0O C;  1W7P B;  4G6D A;  3TOA A;  1OPC A;  2EK5 A;  1MD0 A;  3KFW X;  2W85 A;  2LDU A;  2PLY A;  3E5Q A;  3RPQ A;  2GA2 A;  3F3X A;  3ECH A;  2A6H F;  3ROU A;  2P7V B;  1PUE E;  1ULY A;  2O3F A;  3HYI A;  5HS9 A;  2GAU A;  1BN5 A;  1QNT A;  5DCF A;  1ZAR A;  3HTU A;  5E1Z B;  3PQK A;  4LK0 F;  1U6G A;  3M1E A;  1IUY A;  2ZFW A;  3WU1 B;  3DF8 A;  3K2Z A;  3DEU A;  2CW0 F;  1REP C;  3KE2 A;  2H6C A;  5D5X B;  4HW0 A;  4IPA A;  3QRF F;  2ACJ A;  4ZZL A;  3PQJ A;  2L3D A;  1KGS A;  2YX4 A;  2UXX A;  4HF0 A;  2OBP A;  3V4G A;  4LB6 B;  1R1U A;  4P96 A;  3SZP A;  1P6R A;  1GXQ A;  2EFP A;  2CGP A;  1ZLJ A;  2FOK A;  4G94 A;  3E3V A;  2R7D A;  2XHK A;  1FLI A;  3LQR A;  2AS5 F;  3SFZ A;  3GFL A;  4KNY A;  2Q2E A;  5ILS A;  1ON2 A;  3GW2 A;  3JAM Z;  3L2C A;  2G9W A;  4CZZ A;  2EB7 A;  4Z2Y A;  3IKT A;  2Z9O A;  3WTW C;  4HX4 A;  1BC8 C;  2K27 A;  4EM1 A;  3RYR A;  1ZN2 A;  2L02 A;  4XRF A;  4RB2 C;  4U0Y A;  4OIO F;  2YR2 A;  3EDP A;  2ZXJ A;  5E8G A;  1G6N A;  5FFX A;  1HW1 A;  5DV5 A;  5H6R A;  1F1Z A;  5D5V B;  3ELK A;  1T98 A;  5LGN A;  2E7X A;  4WXD A;  3CLO A;  1BM9 A;  3V7C A;  4XLP F;  5F1R A;  2PN6 A;  3R61 A;  4HF2 A;  4RS8 A;  5E20 A;  1FBS A;  2UXN A;  1YYV A;  3K1M A;  1J2X A;  3P7N A;  2XRO A;  2RKH A;  5D5W B;  1R00 A;  2VBZ A;  4HOB A;  4I2O A;  1LDJ A;  1I5Z A;  2GA1 A;  2EJR A;  3IKV A;  3J80 K;  1MJA A;  1OYY A;  1A04 A;  4ESJ A;  1UB9 A;  1ZYR F;  1XSV A;  2XUB A;  2VE9 A;  5LHG A;  2MD5 A;  3IC7 A;  4F7Z A;  2Z33 A;  4QWQ A;  1RUO A;  4HLY A;  1XGM A;  4U0V A;  3SQN A;  5IT9 K;  1P4W A;  5HS7 A;  3H3U A;  5FD5 A;  1OR7 A;  2OU2 A;  4MQV A;  2XAH A;  2HQN A;  2DK5 A;  3JSO A;  3B02 A;  3ZN0 A;  2IA0 A;  3RKX A;  3QOP A;  2COM A;  4OU0 A;  4EJO A;  1FP1 D;  3TQN A;  3EYI A;  1CF7 A;  5BOX A;  3CUQ A;  2LKP A;  2E1C A;  5HLI A;  2Q8K A;  3KP3 A;  4YFN F;  4EQQ A;  2M45 A;  2XKO A;  2QQB A;  2A6E F;  1LDD A;  3OOP A;  2QUF A;  1D3Y A;  5ED4 A;  2CYY A;  3KLO A;  3GX4 X;  1ZRE A;  2V1U A;  3LAJ A;  3F22 A;  2XIG A;  3ZMV A;  2FXA A;  4HQM A;  4Q4Z F;  1ZAO A;  2P7C B;  1K78 A;  2JPC A;  3JW4 A;  2STT A;  5JI6 A;  4P9F A;  2MH2 A;  2FMY A;  3PFI A;  3V7S A;  2GXB A;  5ILU A;  4XBF A;  5FGM A;  2F5D A;  3U9G A;  2D1V A;  1ZHF A;  2Z3Y A;  1SD7 A;  2K02 A;  1PP7 U;  1I1G A;  3COA C;  1I6X A;  3HUG A;  3KP2 A;  4R1H A;  1KU7 A;  4M9S A;  1FBU A;  4I01 A;  1LEB A;  4HQE A;  1JHF A;  3F6V A;  4ZYG A;  4L9N A;  5HS8 A;  2MA3 A;  4IF4 A;  3BWG A;  1W7P A;  1X3U A;  3WTT C;  3QAH A;  1Z05 A;  3FZV A;  3GF2 A;  4IJA A;  4UVA A;  2KIM A;  2HTJ A;  5J8F A;  5D6F A;  4BHP A;  3ZN1 A;  2BV6 A;  3E6C C;  4B8X A;  3FWE A;  2F2E A;  5FFZ A;  3ZP5 A;  4UVC A;  5ICE A;  3SHF A;  2DT5 A;  2FE3 A;  4KIC A;  2O0Y A;  1WWX A;  1TQM A;  2O8X A;  4RAY A;  1U8R A;  2DBB A;  1XCV A;  4GYG A;  1IXR C;  2IW5 A;  5LGU A;  3LFK A;  1JGS A;  2DLL A;  4GXO A;  3TDZ C;  2A69 F;  3I5U A;  1SD5 A;  3G73 A;  4Y13 A;  3RTR A;  4L18 B;  1ZRF A;  2L4M A;  2FML A;  4EJW A;  1WI9 A;  1Z1D A;  5E18 F;  3HHH A;  1H9T A;  3MFK A;  1U78 A;  4ENN A;  3KP7 A;  1Z9C A;  4B09 A;  4YFX F;  2A5Y B;  3KET A;  2OQR A;  2MLG A;  2VBW A;  1FSE A;  2GWR A;  1IRF A;  2YX7 A;  1KU3 A;  3JSP A;  1GXP A;  2QYO A;  2ZCW A;  1FC3 A;  5A2Q K;  4EJU A;  1MJB A;  2CQK A;  5D8K B;  2WTE A;  5E1X A;  3T0Y A;  4ENJ A;  3GEZ A;  3T1B A;  3LAP A;  3P9I A;  2G7U A;  2OD5 A;  5BPI A;  2HYG D;  2JRT A;  5ICC A;  4LMY A;  1AOY A;  3C3W A;  1YTY A;  2C6Y A;  4A0X A;  4UHT A;  1XGO A;  1XMA A;  2EWN A;  4RB3 C;  2IT0 A;  5IT9 Z;  4EJT A;  4HAM A;  4KT5 C;  1TTY A;  1Y0U A;  1ON1 A;  5K1Y A;  3T5X A;  4ON0 A;  5IT3 A;  4S04 A;  3F8C A;  5CVI A;  5KK1 A;  1HBX G;  2BYV E;  1I1S A;  1I27 A;  2ISZ A;  1FNN A;  4PDK A;  2W57 A;  1PP8 F;  1BI1 A;  2ISY A;  1H9G A;  4ESF A;  4DNC A;  3BJO A;  2IRF G;  3M8F A;  4A6E A;  2VXZ A;  1J9I A;  3C18 A;  3BJ6 A;  3IRR A;  4YIF A;  1SD4 A;  4LD5 A;  1CGP A;  1D8K A;  1G3Y A;  1O3R A;  4JK1 X;  1R1V A;  4KIF A;  3ZMT A;  1QPM A;  4LFU A;  3I53 A;  3ML6 A;  5DUK A;  4L9J A;  4KMU X;  2H94 A;  1BI0 A;  3ZQ7 A;  1O3Q A;  1KQ9 A;  3WGH A;  1K78 B;  3DP7 A;  4N9H A;  3W6J B;  5FLX K;  3P9C A;  2JZY A;  1B4A A;  3Q9S A;  2HFH A;  3H92 A;  4G7H F;  2GIV A;  4Q48 A;  4G8X A;  3I71 A;  4BXU A;  4KDP A;  1FOK A;  3L7W A;  1BBY A;  1GVJ A;  2VT2 A;  4EMS A;  1DUX C;  3L09 A;  4Q47 A;  1R36 A;  2HZT A;  2RGV A;  1BJA A;  4YII A;  1WKM A;  4OIP F;  3HSR A;  4RGR A;  2CO5 A;  2L54 A;  3KLN A;  2VC1 A;  3N4M A;  5EEH A;  3WGG A;  4KN7 X;  4KN4 X;  1YW8 A;  5DYM A;  4JBA A;  4EV0 A;  5DCM B;  5L3E A;  1IAW A;  2ZNY A;  1J0R A;  5D5U B;  1RNL A;  3K69 A;  1V3F A;  1B6A A;  2HQR A;  3WTX C;  4CYD A;  2KJB A;  5BS6 A;  4UV9 A;  4M9Z A;  3BRO A;  2IVM A;  1R22 A;  2VBY A;  3KP6 A;  4I7H A;  4JQF A;  3DQV C;  2DO7 A;  1S6L A;  4WXH A;  4KFC A;  4O6J A;  2EV0 A;  3J7A O;  2UZK A;  5BQT A;  2Y75 A;  2PMU A;  1SFX A;  4ASN A;  1F9N A;  5H20 A;  4OIQ F;  4KUM A;  2X0L A;  3F6O A;  4M73 A;  1WRJ A;  2DAO A;  1JXS A;  2V1D A;  2HDC A;  4HBL A;  1YO5 C;  2AXL A;  2DPU A;  1XGS A;  3S2W A;  1QBJ A;  2V9V A;  1IN4 A;  4AD9 A;  1YFH A;  4ZYE A;  3U2R A;  5ERI A;  1DP7 P;  2A3S A;  2XAF A;  2HOE A;  5K5R A;  4KIB A;  1UST A;  3C1D A;  4P5O A;  3E6D A;  1Z6R A;  4GYI A;  1TW2 A;  3R0A A;  4OOI A;  5LRS A;  3WU0 A;  2CWE A;  3LA3 A;  4HV6 A;  2FF4 A;  2CSO A;  3GXO A;  3O3K A;  1U5T B;  3QU3 A;  2MC3 A;  1QQI A;  1XSD A;  3O6B B;  2QEN A;  1B1B A;  2P5L C;  3DKW A;  1B59 A;  1FBQ A;  3IHU A;  3Q5F A;  1TNS A;  2D2W A;  1JE8 A;  3CJN A;  4NHJ A;  1LNW A;  2FA5 A;  3TKY A;  1HSJ A;  1HW2 A;  4OIR F;  2LNB A;  2DU9 A;  2FQ3 A;  2XVC A;  4HDV A;  2BGC A;  1OYW A;  3BJA A;  2EA2 A;  3TO7 A;  4LLL A;  3LA2 A;  5J6X A;  1D8J A;  3MZY A;  2QQ9 A;  5CLS A;  1O7L A;  1U5T C;  3FXR A;  3ABT A;  3HIF A;  4UNO A;  2R7F A;  1UFM A;  4EGY A;  3V8K A;  3J81 Z;  2PBI A;  4P55 A;  4KIG A;  3I64 A;  1MJ9 A;  2W25 A;  1O3T A;  2FSW A;  1NHA A;  4KMF A;  1QGP A;  3BP8 A;  3G3Z A;  1TW3 A;  5FLX Z;  4G9Y A;  4OMY A;  3GLX A;  2Z5U A;  3T8T A;  1EH8 A;  3IWF A;  4MEX F;  3VFZ A;  3FMQ A;  1IF1 A;  1G4D A;  2XKP A;  4MTD A;  3HOS A;  3FMS A;  1YIO A;  3K1N A;  2DFI A;  4HYE A;  4EM0 B;  4M6X A;  3E97 A;  4Y17 A;  2H09 A;  3ZMZ A;  2PI0 A;  3HRU A;  2LF7 A;  2P6T A;  2DTR A;  4HLX A;  2MBF A;  1OMI A;  4MGR A;  3FHZ A;  3KCC A;  5LHI A;  3WTS C;  4A0Z A;  3C7J A;  1G3W A;  1FZP B;  3V8J A;  1XCB A;  1PDN C;  1R5H A;  4EM2 A;  1MDM B;  1ODD A;  3DPT A;  1YG2 A;  3IWZ A;  1IXS B;  3I4P A;  3TO9 A;  3WTU C;  3F21 A;  1IXC A;  3ERE D;  1SD6 A;  1HQC A;  5HLH A;  4A5N A;  3K0L A;  4CGZ A;  2OQG A;  3BDD A;  4U0W A;  2H27 A;  2M5W A;  1MGT A;  2KIF A;  3HSF A;  2Y48 A;  2ZME B;  1J59 A;  2HTS A;  1Z6T A;  4I02 A;  4LLN A;  4GO1 A;  4OIN F;  3QU6 A;  5DCM A;  1RIO H;  4DQ2 A;  2NRA C;  4BHB A;  1HW5 A;  3MAJ A;  1DDN A;  1S8N A;  1LDK B;  1IW7 F;  2FNP A;  3MQ0 A;  5HVQ C;  1YS6 A;  2IP2 A;  2RN7 A;  3FXU A;  1SMT A;  5JFR A;  1BIA A;  5L3F A;  2DPD A;  3E5U A;  2P4W A;  3GZ5 A;  3JTG A;  1QZZ A;  2XGX A;  5JVT A;  1WQ2 A;  2RV8 A;  2ZO4 A;  1E2X A;  3I0T A;  4UV8 A;  1ZGJ A;  4AIH A;  4P9U A;  3EUH A;  4CDG A;  1O57 A;  1OKR A;  4AVP A;  3GVA A;  2MH9 A;  3ABU A;  4G6Q A;  4NQW A;  2XRN A;  2EA4 A;  4A12 A;  5LGT A;  3ZMD A;  4O3M A;  2M30 A;  1FWZ A;  2RDP A;  2VOP A;  4FX0 A;  4N9I A;  5DD8 A;  1U5T A;  2HEO A;  1FY7 A;  3J80 Z;  4LJZ F;  2VE8 A;  4IRH A;  3WOD F;  4ZYH A;  2QLZ A;  3HRM A;  1R5G A;  2PEX A;  4QLC U;  1ZGA A;  4U88 A;  1YS7 A;  1ZLK A;  2M1B A;  4RGX A;  5BPD A;  2L01 A;  3VOE A;  3LA7 A;  1R1T A;  3KP4 A;  4IXA A;  5AIQ A;  3RIR A;  3QPT A;  4RB1 A;  3H3Z A;  1IN5 A;  4GCV A;  3WTZ A;  4HX7 A;  3W6K B;  5DDG A;  3RPU A;  5KVR A;  5L3C A;  4G7Z F;  2HKX A;  2LSO A;  1QO0 D;  3B73 A;  1BC7 C;  3DPL C;  3ISP A;  2V6C A;  1BI2 A;  2D1H A;  3TO6 A;  4ESB A;  3FX3 A;  2K4J A;  2P5K A;  4I0A A;  2QVO A;  2FNA A;  4WWC A;  3HOT A;  1KYW A;  3K1P A;  2L4A A;  1ONV A;  4TV7 A;  4IHT A;  3WG9 A;  1Z91 A;  1P92 A;  3F8F A;  4R79 A;  1ZG3 A;  2XV4 S;  1LVA A;  4M72 A;  1O7F A;  3AAF A;  2JT1 A;  2K86 A;  1LQ1 A;  3CO7 C;  3O2P E;  1RUN A;  2OZU A;  2RNJ A;  3ZMS A;  2XAS A;  2E1N A;  3QPH A;  4XSX F;  2O03 A;  2QZ8 A;  4L9V A;  6PAX A;  3ULQ B;  5CYV A;  2VC0 A;  2P5V A;  3RJP A;  4YG2 F;  2PG4 A;  2WWY A;  2GQQ A;  3CDH A;  4ETS A;  3DFG A;  4PZJ A;  1ZG5 A;  3HRT A;  5D8L B;  1P4A A;  5LRR A;  4M9X A;  3NQO A;  1XMK A;  4MNU A;  2JSC A;  1FX7 A;  5CVJ A;  1IRG A;  3V8L A;  1HXD A;  3M8E A;  3V7R A;  4HX8 A;  3KP5 A;  2XAJ A;  2P8T A;  2PMH A;  1W7P D;  2GZW A;  1MDM A;  2HWV A;  1IZ1 A;  4HF1 A;  1UCR A;  4UUV A;  2IJL A;  4KYW A;  4A2U A;  1TBX A;  4I98 B;  1TNT A;  1EH7 A;  1QZY A;  2VBX A;  1K6O A;  1BIB A;  2VOD A;  4MTE A;  5L3G A;  2KJC A;  5HLG A;  2JPB A;  2QM3 A;  3VB2 A;  1LJ9 A;  2ZME A;  2FBK A;  3R4K A;  4IVN A;  3WE2 A;  1R7J A;  4ENM A;  1BOA A;  2CG4 A;  2RVC A;  5A2Q Z;  4LGW A;  3ZPL A;  4ZYD A;  4L5J A;  4FHT A;  3KEQ A;  2HS5 A;  1HKQ A;  1T2K A;  5F6F A;  5D4R A;  1T39 A;  3FM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...