2EIKH

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eikH00
2EIMH 1OCOH 1OCZH 2ZXWH 3AG1H 2Y69H 2EIJH 2OCCH 3AG4H 5B1BH 3ABKH 1OCCH 3AG3H 3ABMH 5B3SH 1V54H 2DYSH 1V55H 2EILH 5IY5H 2EIKH 3ASNH 3WG7H 3AG2H 2EINH 1OCRH 5B1AH 3ASOH 3ABLH 2DYRH 3X2QH
chains in the Genus database with same CATH superfamily
2VQHA 4J00A 1DPUA 5ICCA 2V1UA 3BR2A 4DGWB 2FSWA 1IF1A 4WK8F 5IP7J 3CMEI 1IN8A 4I0AA 3EPZA 1D1CA 4DYCA 2BVLA 4D5FA 1MBFA 5ICGA 4FHTA 4Y17A 3GFMA 3OYJA 1W0TA 3CCLI 1ETOA 5EZGA 3FMQA 4HAMA 4AYBA 5TISC 4F3QA 4ZH4F 2RVCA 4MEXF 2DOFA 3FM3A 2XF7A 3G4SI 1VNDA 3WTUC 3I64A 3GYHX 3SDGA 4F91B 2X6OA 1REPC 2KZGA 1DUXC 4EM2A 4UUVA 3IWZA 4YIFA 1VFCA 2VKDA 4KDPA 4CYDA 2K9NA 4D1QA 5HDGA 4MIMA 1APLC 4N9IA 5GTHC 1HF0A 3H3VK 4O5VA 2OQRA 3GF2A 1B6AA 3DEUA 2VI6A 2L4MA 5ILVA 2NVTJ 3CP2A 4A3DJ 4E7LA 2EFNA 2PG4A 3PQKA 3ZQFA 1W1WE 3NRVA 2OUMA 3LSMA 2JWTA 3V42A 4YFNF 4U87A 2D5VA 4XICA 5IT9Z 4Y3OA 2VJ4A 1TQIA 1JUMA 2NS0A 5ICEA 2G0EA 1JGGA 1T56A 2E35A 1IN5A 2CW0F 4XSXF 3K6GA 5ED4A 2QBYB 3IH4A 4QWQA 2G7HA 3SFIA 4ASNA 2L7KA 3BZCA 3A1YA 2A5YB 4EMSA 3LQQA 1WSUA 3AG3H 3SJMA 1UZCA 1MDMB 5J4YA 3KE2A 5EF6A 1V55H 1Z21A 4MLOA 1F5TA 1RPWA 1U5TA 5ILUA 1YFHA 1DP7P 1K79A 4ZC3A 3H5AA 5LEKA 1YQAA 2ZXJA 2MC3A 3QRFF 2ZB9A 1G6NA 1WH5A 4G12A 4NUBA 3ECHA 1SD4A 4BNCA 2K9QA 5FROA 4AC0A 5IOYA 1D1BA 2QQBA 1T08B 3H3UA 5DM6F 3J80Z 1RNLA 3LA2A 4RAGA 4U0WA 1OJLA 2MLKA 2BXYA 2K02A 4GGGA 5BS6A 2CG4A 2MG4A 3HOSA 2VKEA 1J59A 5LEJA 2VOOA 5LHHA 1NG7A 3CCVI 5BOXA 1HW2A 1EJ9A 1MNDA 2LBFA 3K1MA 2CGPA 3OMYA 3ZMUA 2GM4A 3FISA 2XF5A 4I99C 2L01A 4A3JJ 2E5NA 1WJCA 2XF6A 1I39A 3QU3A 1P2FA 2P7VB 1MNEA 3HBLA 4ITVA 4A3BJ 1DU6A 4XKBA 2X6XA 5EJCA 3PIPF 1TT5B 1RR8C 2IBDA 4P9UA 1J9IA 2ELHA 2L9NA 5CVVA 4D7NA 1ZG5A 2PFBA 4ZZLA 2LR8A 4K2EA 1N78A 4DZPA 2LF8A 2O9LA 2W7NA 4CH7A 2H94A 1IUYA 3JR9A 3T8TA 3HKZA 5FFXA 1HSTA 5B66C 5DV5A 4ESFA 6PAXA 2IA0A 1ETVA 2HXIA 1OYYA 2RQQA 1LFPA 3M3YJ 2KJCA 2L4AA 2OCCH 2ZXIA 4YRVA 1H8AC 2STTA 4A3LJ 2EA2A 3EUHA 1MBGA 1PUEE 2VLAA 1HOMA 4N4OB 4XKCA 1SVOA 2VQCA 3RQIA 2NXNB 4BQAA 1ERDA 2NAZA 1XSVA 4G8XA 2FA5A 2RGVA 1OYWA 2D1VA 1N25A 4Y13A 1T2KA 4CCOA 3M4OJ 4EM0B 2X48A 3E6BA 1DQUA 1TC3C 4A2UA 2A3SA 4I76A 5E1XA 2LKXA 1ZLJA 5K7FA 3AG1H 5HNFA 2MLGA 2E60A 2QGUA 2R93J 3MQ0A 4IHXA 3CDIA 2OZ6A 2MH2A 5FLMJ 1S7OA 3FZVA 4II2A 1OR7C 1A36A 3FM5A 5EZHA 2HQRA 3F8MA 2QBYA 3HOTA 2H27A 4EJUA 1LE8B 4HSRA 2L0KA 3AG2H 1I6XA 5FLXK 2PMZA 3LOCA 1LPQA 1MDMA 3J81Z 1H88C 2R7FA 3WTXC 1MJ9A 1DPRA 4KT6A 3DBLB 2NRAC 2BHYA 3HDDA 2HOEA 1IUFA 2IGKA 3BJ6A 4I98B 2L02A 2ZXWH 4PJLA 3OYNA 3IL2A 2IJLA 3KZZA 3BTJA 4BUPA 5DUKA 3P5JA 2K3PA 1HC8A 1D0XA 1IJWC 2H1KA 1BOAA 1ETXA 1Y0UA 1EH7A 1SMTA 1XGOA 1XMKA 1SANA 1IN4A 2EV0A 2ZSHB 2WBMA 3MZHA 3NAUA 1OPCA 1ON2A 3S17J 3KP5A 3HB9A 3QPSA 3G1MA 2PBIA 1PP8F 4ZYEA 4KJZA 2HOAA 3K70C 1V5EA 1LNWA 2NVQJ 4HOBA 2HU9A 3DPLC 2DDBA 5H6RA 2HTJA 2F5DA 2G9WA 1R71A 3BCBA 5F64A 3ZMTA 2X1DA 1AHDP 5JI6A 5LHIA 3CTAA 3DKYA 2NOJB 3FMRA 3OIOA 4JOMA 3L2UA 4NQWB 1NG6A 1OCPA 3M1EA 4BE0A 3HOWJ 1PJRA 3ZPLA 1U9NA 4EVIA 1JE8A 5EDNA 4IF4A 3GUDA 4XRSA 1JKQC 4U7DA 3K4MA 5CQGA 5KHDA 3COAC 3PQJA 3RCOA 3I4MJ 3DQVC 1IDZA 1HKQA 2BYVE 4E6KG 3BG6A 4XBFA 3GEZA 4G94A 1S7AA 3TMOA 1P4XA 3TP0A 2NVUB 4IX7A 1OISA 3CJRB 2LY9A 4MQ9F 1ZG1A 1JHHA 5F0CA 1ACIA 3NWTA 3S32A 3CP8A 3SZTA 4A3MJ 1RRJA 2XAUA 2P5VA 1OCRH 4CCLA 3ASOH 2DMQA 4D0PA 3BC8A 2DTZA 4FT8A 3GFJA 1ENHA 3S8PA 2HVQA 3AAFA 5D8LB 2EIMH 2QLZA 1B9NA 3K10A 2PJRA 3OYHA 2DODA 5GPAA 1SFOJ 1O3SA 2XC7A 1XTAA 4A12A 2QA4I 4B09A 3I54A 3KPHA 1QO0D 4B47A 2X1CA 5IPAA 5L3BA 1VZ0A 3FMSA 1UCRA 3FKJA 2E7XA 1W5CC 2P8TA 2VKVA 3EQLF 4C2MJ 5M3FJ 3JSOA 1POGA 1O3TA 3WHCA 2V9VA 2HR3A 4RMNA 1DGWY 3IP4B 3VOEA 2PLYA 3U1DA 2NOGA 4MGRA 5EEAA 1HQCA 2X4HA 1HBXG 2VJIA 5DEQA 3CQZJ 4E4HA 4XN0A 3KIOA 5LGNA 1KQ9A 4AD9A 2X51A 2LY1A 1YS7A 2CFXA 3C3WA 1V54H 3ABTA 3E5XA 4GYIA 5CYVA 5AIQA 1WFXA 1VQ8I 4OMZA 4V19K 3HYIA 3ZQHA 2V1XA 1G3WA 4NC7A 2F6CA 5E8GA 4KFCA 1RETA 3ABLH 5FKKA 3VPRA 1SAUA 3ESWB 2F5FA 2JA6J 1E3PA 2K4BA 3GZNB 4BBRJ 2BY2A 3W6KB 1ZG3A 2FJ1A 4BEHA 1MBEA 4Q4ZF 3LSJA 1SFUA 3W2VA 1SFEA 2GQQA 1X2MA 4UNOA 4C9YA 1U6GA 2HPIA 3OYKA 5FD5A 2I5UA 4KN4X 1O3RA 2HKOA 2JSCA 3H0DA 1BOBA 3T5XA 4OWRB 1MMNA 1RZ4A 5HDNA 2HOTA 1FIAA 3IH2A 5J6XA 2CJJA 4UVAA 5E18F 3C18A 4PDKA 4HZFA 3M1CA 1YITI 2L9VA 4B4CA 2HOSA 3I59B 4N9HA 4QPQA 4U0VA 2OZUA 4MHGA 3WGGA 3VYUB 3N4MA 2HNHA 3AG4H 4A3CJ 3BQZA 3VDXA 3W6VA 4MFEA 2QENA 4YIIA 3CCJI 1B1BA 2OTJI 5DS9A 1NK2P 2PQ8A 4BJTA 4R79A 2ELKA 3LWFA 5EG0B 3AKZA 2HQ5A 5J8FA 4DYQA 3LL7A 3CC4I 2GBYA 3L7WA 5LD2C 3GLXA 1I6HJ 1YJ9I 3A02A 2XUBA 3BG7A 2H8RA 2XHKA 3E5QA 1NH3A 3UR3C 1J5YA 2NVYJ 2BVMA 3OL3A 4QTRA 4BDYA 2P6SA 5CLSA 1MMDA 3ZQGA 2E2IJ 2O8XA 1WHUA 3CJNA 1YTYA 5LGTA 2OBPA 1FLIA 2DO7A 3FXLA 3C1DA 1ON1A 4BXUA 4CZZA 3JRIA 5HOOA 3J7AO 2XGEA 4RGRA 4IOAF 2NNNA 2HZTA 1IXRC 2ME0A 1KU2A 5K7HA 4IVNA 3K7AJ 2XASA 4HPQA 5F1RA 2Y0MA 4RGSA 4KNYA 1XGNA 2JVGA 1IW7F 5GP9A 4DQ2A 3UKGA 4BHBA 3N97A 3H35A 3B6CA 5GAHJ 1WPKA 1KA8A 4F55A 2JPCA 1VQ6I 1WJFA 1ZELA 2WC2A 3IAS2 5J40A 4M6XA 4BJ6C 1LQ1A 2JA2A 3F23A 5M5WJ 3OOPA 3ZOBA 3MZ8A 4A5MA 4Y52J 2BW3B 3A0BC 2NYXA 3MZYA 3ZQCA 3BR3A 3SYTA 5FLXZ 5DD4A 5L3CA 5IY5H 3OYIA 4ZJZA 1IV8A 4M3DA 2Y2ZA 2IRFG 2H1LA 1S3JA 4PCQA 4G7HF 3FXRA 3TBIA 2DFIA 1LUJB 2VC1A 1JJ6C 5D4SA 2OD5A 2KKOA 3JCUC 1SC7A 5F1JA 4XLPF 3I56I 4M9XA 1X1PA 1LDKB 3KEOA 3MWMA 3KP4A 4XLAA 4KICA 1IN6A 3BPVA 2DK5A 1HW5A 1ZAOA 1FX7A 3PO2J 4R8HA 1U8BA 2E7WA 1KZHA 3ZGKA 1IC8A 3QOPA 2AQFA 2UXXA 1KQ0A 2EILH 1J09A 4HQEA 1W7PB 3I59A 3E6CC 2WAFA 3BR5A 3OR2C 4ESBA 3DBHB 2DFHA 5ERIA 2MW8A 4PUSA 2ESNA 1OFCX 4LK1F 2M7AA 3G1LA 1FOYA 4B8XA 1TWAJ 3GCMA 3B73A 3KP3A 3RSNA 2E1MB 4JQFA 3TW6A 5EG0A 4L9TA 2GIZA 5CKTA 5D6EA 4HA8A 4ETSA 2DQLA 2GXGA 1EV7A 1O7LA 1OCCH 1ZGJA 1IRZA 2Z2SB 5TRDA 4IOCF 1OLTA 4OINF 2CQKA 3VB2A 2XAFA 2Q1ZB 3CZ6A 3S3OA 3CMAI 3GX4X 4NB5A 2F4MB 2LMDA 5CQEA 3QYBA 2XB5A 3BWGA 4TV7A 1IG7A 2CV1A 2K5CA 4WXDA 1BR1A 3LSKA 2DPUA 1GHCA 3PIOF 1U5TB 2PEXA 3OS1A 4XSZF 3CCEI 3FBNB 2AO9A 3HTUA 2Y48A 4M6VA 2M0MA 1UMQA 3M8EA 2DA3A 3H9QA 2R4GA 3HGGA 2VT3A 2A5WA 2L7FP 2XRNA 5E3NA 3OSGA 2QCOA 3M9AA 2ZJPF 4IXAA 2LYCA 2L54A 3OYCA 1P7JA 3V8LA 5JFRA 2EK5A 4E7KA 1D5YA 3DEWA 1WCMJ 2BXZA 1J2XA 2DOEA 4G6QA 3SHFA 3RPUD 1YIOA 3ZQIA 1JUPA 1BJZA 4B1RA 5L3GA 1LVKA 3HGYA 3B6AA 3K4CA 3EYYA 2JZYA 4RAZA 3BR1A 4N0BA 3GTOJ 3PFYA 2WAEA 5CPRB 4FTHA 1YW7A 1G8XA 1FBQA 2EWNA 1S8NA 3QOEA 1R00A 4XLNF 4RAYA 5E17F 3ZXSA 4IPAA 1UG2A 5F27A 1K78A 1IO2A 3DU5A 5FRMA 1Y1WJ 2IS1A 1XSDA 2DXIA 1Z1DA 1FOKA 2R7OA 4FX0A 4R1HA 4GYGA 3RKWA 2EV6A 4KA4A 2R7WA 5JVTA 4AM3A 2K3FA 1AU7A 2KHMA 3LQRA 3SQNA 3JRBA 5FLVA 3P9CA 3MCZA 4RM2A 4D9JA 1GT0C 1EA3A 3VYTB 1PYVA 5TJJA 5FJ8J 2EFOA 2EH3A 3W2AA 2Y31A 1CF7B 5FKOA 2CUZA 3HTSB 1W7PA 2HYGD 5HLHA 2E2HJ 2O03A 1D8KA 4MTEA 2VOPA 1TWFJ 3K1NA 4ZYHA 4HX4A 1S29A 3FX3A 1FMWA 2OPTA 3R60A 2OJED 4DOZA 1ORKA 1OYIA 1CQTA 2O5RA 3LSHA 4AUXA 3FWEA 5J4VA 1UELB 4HRIA 2QQ8A 4EJWA 4EGYA 3DEEA 5L3FA 1S7EA 2K9SA 1I27A 1Q1VA 2WV0A 1W5SA 1WQ2A 2OA4A 1U9OA 1K6OA 3K2ZA 3H0GJ 2JUGA 3ZCOA 4ZYDA 3DTEA 4XKVA 1LJ9A 3HC7A 1S5LC 5HLGA 4UHTA 2VB6A 4WXHA 5HLTA 1K61A 3M7GA 3F21A 2Z1DA 3KP2A 4WWCA 2ZMEC 1BI1A 1IV6A 2KIUA 3QP5A 3H1CA 5HS9A 2IGOA 4I02A 2O61A 4DZJA 1HCRA 5DCMB 1YLFA 4P9FA 2HPMA 4XONA 1XN7A 2MFZA 3I9V2 2PJPA 3L00A 5HNHA 3E5UA 3OYMA 2CFOA 3HOVJ 2M4KA 3ZQLA 2HI3A 3O2PE 3HJEA 2HDDA 3S2WA 1U3EM 1U8RA 3IC7A 5IP9J 3LSPA 4II3A 2DBBA 4JP0A 4C2UA 2D2WA 3F6VA 3GMEA 1FP1D 1RR7A 3KYCB 1RI7A 4GDFA 2VONA 3WGHA 2P5KA 4IRIA 2E1NA 3S1NJ 3TKYA 3O8HA 3KX2A 1H9TA 2P7CB 2CUJA 1TWCJ 2WA0A 4BJ5C 3ML6A 3P9KA 1O4XA 1TWGJ 1B59A 4I6ZA 4A0ZA 1ETQA 3LSIA 2XKPA 1Z05A 3CUQC 3IRQA 3CCQI 2MA3A 4OOIA 4HNVA 1OR7A 2DN0A 3GTJJ 2LNBA 3HXLA 2V4JC 3KP7A 5LLQA 3OWTA 4NC6A 1GDTA 5FRNA 3WTSC 2F5EA 2O0YA 4ZZDA 1ETYA 5IT3A 4PJ0C 2Y30A 3D5LA 3TO6A 4QLCU 2XSDC 4FX4A 2LG4A 2A6TA 2X6YA 4Q48A 3WHBA 3EETA 5E3MA 1FZPB 4M74A 4S05A 2OCEA 2GWRA 3H3ZA 2GOXB 3GBGA 2QWWA 5LFAA 5TGTA 4YIRX 4KUMA 3DWLE 1R5HA 1Y56A 1MMGA 3LSRA 5F04A 3K4KA 4QPOA 3WTYC 2R7XA 3W2WA 3KETA 1ZRDA 1BW6A 1CF7A 4D5CA 4LMYA 2BGCA 3ZQQA 2QYOA 2M4GA 2FEZA 1Y39A 3C2HA 4UY8I 1NK3P 2PJRB 4LB6B 2JJ7A 2JK3A 2VKHA 4LITA 3KEYA 1HA8A 2HZDA 3E97A 3IAM2 3F3XA 1G3TA 3E6MA 5FGMA 3A01B 2DPDA 3AL0C 4I0BA 3X2QH 2BHZA 4RA2A 3TL4X 3DU6A 4EEFG 1UHMA 5J1YA 2O6GE 3OV8A 3NARA 2Z3YA 1XS9A 4RGXA 2BOLA 3VSKA 3HL2A 5C4XJ 5D5WB 3K4NA 1X1DA 1TBXA 3E3VA 3MVPA 3CCSI 2IA1A 3HOXJ 2GIVA 1Z7UA 5AIPA 2B63J 3FDYA 5E3LA 1Y1VJ 2COBA 1KQ8A 2HYFA 5EEHA 1FYKA 3T0YA 1KYZA 5DM7F 1FOXA 4AIHA 2TRTA 1FTZA 3GLLA 3M07A 2QQAA 4HQMA 4XOPA 5KNLA 1QA6A 3AFHA 1KU7A 1ZKGA 2VL8A 1OCTC 2FMLA 2STWA 2A6EF 2KJBA 2DTRA 5DCMA 4CCMA 1VQNI 4BGDA 1N77A 1VQ9I 4M3GA 3A0HC 1A6IA 1VQMI 1VQ4I 3DLLF 1V5GA 2F4OB 5FKLA 1YOVB 2DYSH 3BP8A 3G2BA 5JVGF 4XM3A 4BEHB 4FASD 4XMYA 1ZLKA 2AS5F 3QODA 2OC6A 4XLFA 5J1RA 5KCMA 1QVUA 1H0MA 3VODA 2KISA 3OYLA 3CF5F 2K7LA 2GOMA 2ADUA 2LRDA 3LAPA 4KN7X 2JMWA 3Q0WA 2MSYA 2WADA 3G3ZA 3FK7A 3L9FA 1U2WA 3OL4A 3SDBA 4BL0B 2UV1A 5A2QZ 1UFMA 1FC3A 2L9SA 3LA7A 4B43A 4CXFA 4FCYA 5E8IA 1Y0NA 1BIBA 1YJNI 1OMIA 3GTQJ 2OV7A 3Q9SA 3PNVA 1W4MA 1FWZA 2HVRA 2MABA 1UB9A 3WU2C 1ODDA 2OF7A 2ZJ2A 2IPQX 4A0YA 3BG3A 1J7KA 1TQMA 3MKWB 4J19A 2KP6A 3HG9A 3QYFA 3DLAA 4MQVA 1KYWA 3V7CA 5K5OA 1TLHB 2ZJQF 4EJVA 4OIQF 1W0UA 2DA6A 4HYEA 1YJWI 2Y69H 3I71A 2FE3A 3CJTB 3I0TA 5B1BH 2R7SA 2QQ9A 4L9VA 5IOZA 1HSJA 3K4BA 1Z6RA 1QZEA 4D7MA 1E2XA 1K4SA 4EQQA 4HV6A 2YSRA 3K2AA 2G7UA 4BKXA 3GTGJ 5F0FA 1TW3A 3Q0UA 4AIJA 1IN7A 1MBJA 1IRXA 2Y0SN 1STZA 3UNGC 3DCFA 3Q3SA 4L5EA 2ZBKA 2O8KA 5D5VB 3ONQA 1AA7A 3EYIA 3V7RA 2WAQN 4L18B 3A01A 1FNNA 2OAZA 4M73A 3W6JB 3GW2A 1BM9A 3RZDJ 3WTTC 4XN3A 3Q9VA 3H36A 2LH9A 3WTWC 1X2NA 1NHAA 3TDZC 4IRGA 1Z91A 1R1UA 2DT7B 2AXTC 3QP6A 4OIOF 2PX9A 2ZC2A 1XGMA 3CCUI 1Z77A 1R7JA 3ZN1A 3CESA 2JUCA 2A07F 1YE9A 3HM5A 5CJ9A 1PP7U 5KAFC 3LNQA 1NTCA 2RKHA 2CO5A 1YG2A 3H9GA 1WJEA 3V4GA 2F5VA 2VPRA 4IZZA 1FSEA 1UG0A 3DTKA 1FY7A 3RZOJ 2Q0OA 2K4JA 1XGSA 4XOTA 3CO6C 1Q1HA 3O6BB 2LC2A 3TO9A 4BHCA 3Q5FA 3JRAA 4CUGA 2W82A 2BY3A 3REOA 5C4JJ 3TDUC 1BL0A 3O3KA 2VE8A 3ZMVA 4RGUA 3FXUA 3S2HJ 4HF1A 2ZCWA 3FBIB 2XRLA 2ZKZA 2ISYA 4QIWN 1FJLA 2ELJA 1QGPA 2B9SA 2RREA 1ZN2A 2EIKH 4F92B 4IJAA 1FBSA 2XGCA 4LGWA 1UJ8A 3JW4A 1EF4A 1PDNC 2NVXJ 2RNJA 3CC2I 1ITYA 1X1BA 1FP2A 3SFZA 1LVAA 3WE2A 4JX4A 2DA2A 4DYRA 4W1UA 1YHQI 3QYEA 1PVEA 5GADJ 4G6TB 2IS2A 2KIMA 2H6BA 2FXAA 4JYKA 2OU2A 3IHUA 2AQEA 3GWZA 3WU0A 5K1YA 3HOUJ 2JA7J 1X3UA 3OS0A 1KU3A 4WF2A 5FKNA 1WVRA 2KMUA 2W24A 3KFWX 1PUFB 2XPUA 3U2RA 1QU3A 5DUIA 4BACA 3ROUA 4IHTA 1YRNB 2DW4A 3F0CA 4M3EA 2KIQA 4Z6YA 2EZKA 2M30A 3PUBA 4AIKA 5IT9K 3PSFA 4RB3C 4E7IA 4A3EJ 1R6RA 4M3FA 1QQIA 2DMTA 2E36A 1AKHB 1FOWA 1MSEC 4ENJA 2EA4A 4CO8A 3RKYA 4HNUA 3BOQA 3ABMH 5FO5A 2FRHA 3TOBA 2WY7Q 1MZBA 1WH7A 5D4RA 2L7MP 4Q5SF 4E7ZA 4DNCA 4GFBA 4IQ4A 2YU9J 5B1AH 5IP6A 2KRHA 4FE4A 2DYRH 1MBKA 5AONA 2RQPA 3LFUA 2E1OA 1JTYA 1SAXA 2LKPA 3H9JA 1QNTA 2V1NA 1SD6A 4NHJA 2NS7A 3JTHA 3F8NA 3U9GA 3BG9A 1MH4A 3DV8A 3GVAA 2PMHA 4P1WA 4M9ZA 2DAOA 5K7ZA 1F36A 1TT0A 3I55I 1BJAA 2QF7A 1YS6A 3WODF 4IL6C 2CSOA 2KDOA 2H09A 3PNTA 3WG9A 1WJ5A 3C2BA 1USSA 4BAYA 1WJDA 1LB2A 3RYRA 3EDPA 4IHSA 3K69A 3OR1C 4BS9A 1X19A 2R7ZJ 5JLWA 1T95A 3QQAA 1TWHJ 1K7AA 4L9JA 1BI3A 3SEZA 4KISA 5CVRA 3S3MA 4JX5A 4Y33A 3MKZA 2FBIA 5JR3A 4IRHA 2TCTA 1YW8A 1BR4A 3QU6A 1R1TA 1A35A 4DBRA 2HQNA 3JTGA 1MNMC 1K78B 1A31A 5D5UB 3OIPA 3DBRB 3HSEA 3VEPA 1G3YA 1VI0A 4LFUA 2V6CA 1WKMA 2EQRA 3ZRGA 5LHGA 2L7ZA 1MMSA 3SZPA 5IYCJ 4PFOA 2XGXA 1TNSA 4IO9F 1LDJA 3FIWA 2M1BA 2CYYA 3CJQB 3GFIA 1HW1A 2XIGA 2ZFWA 3VWBA 3HKZN 2X9DA 1F4KA 2J5OA 4UUSB 3HRSA 2LY2A 1Z67A 2IA2A 2JVHA 1JKPC 1I5ZA 5IYDJ 1JXSA 4HLXA 5CVUA 1MSFC 1R23A 4H0EA 4XRMA 2WB1N 3R4KA 2BY1A 1YX3A 4I09A 2P5LC 1IRGA 2M7BA 3KLOA 2BEOA 4RM3A 3CUQB 3HRTA 5JLXA 1OCZH 2DA7A 3L2VA 4G6DA 4G7ZF 4S04A 1FTTA 4BXFA 4YG2F 5EGOB 1PUFA 3HRUA 1JGSA 2FU4A 5E1WA 1YRNA 3BCAA 5JHFA 3WE3A 2EBIA 3I58A 4G7OF 4KIFA 1P9QC 4JBAA 3IH3A 1R1VA 2D1HA 2DI3A 3GZ5A 4RAFA 4XL9A 3KYLA 1AKHA 2VIXA 3DP7A 1HLVA 1JHFA 2FQ3A 2A6HF 2LTPA 3V7SA 1JT0A 2M34A 5KVRA 3ZQ7A 4PGGA 2LLKA 3BTIA 1QHHD 3RPQA 3PNYA 1VQ5I 1G2HA 2IW5A 3P9IA 2DA4A 4M3BA 1DU0A 4BQQA 1QRYA 1RC9A 3J7YJ 4AVPA 3OSFA 1O3QA 2X6WA 4ENMA 1R36A 1SVLA 3BQYA 4CICA 1N75A 3IRRA 4A3KJ 3HUGB 1JJ8C 2A69F 1XSXA 2XKOA 2EINH 4NNJA 5DYMA 1TW2A 1R49A 1Z3XA 1ZK8A 3IWFA 2DJNA 2ME6A 3HZJA 5F0HA 3AL0B 1LKXA 4E7JA 4RDUA 2QKMB 3HOYJ 2IT0A 1ZRFA 3RIRA 3BJAA 3KZYA 2DLLA 1R22A 3R6SA 1BIAA 2HTSA 3A4CA 1V3FA 2XPWA 2V9KA 3ECOA 2M45A 1XPXA 2L3DA 4JK1X 4A6DA 3G6EI 2P0WA 3DF8A 3OIQA 2FOWA 2IP2A 2BZTA 4MO7A 1G4DA 2VUMJ 2RAEA 4C3IJ 1Z3YA 3B02A 1RIOH 2ZMEA 2R92J 5F6FA 3EUAA 3L2WA 2EJRA 4AIDA 5FKMA 3K9TA 1T0FC 1L3LA 5GPCA 2J5PA 4MNUA 3FXJA 2CV0A 2F4IA 1Z0XA 1ZGAA 1RKTA 3GTMJ 1JKOC 2XB0X 2KLOA 2F5CA 2UWMA 1VQOI 3CCRI 1RUNA 3F72A 3S2DJ 1MKMA 1Z9CA 2R7TA 4I2OA 2FNAA 2NS8A 5LBQA 2FUG2 3NEUA 4UUSA 5GTIC 2ZXHA 5HS7A 1QBJA 3NWSA 3QPLA 2IS4A 1OCOH 3HHHA 1X3WB 1WWXA 2FQ4A 3IUOA 3J7AY 4AU7A 3CC7I 3ZP5A 1S72I 4V2FA 4CCJA 2FBHA 4LK0F 1SD5A 3FXQA 2HKXA 1GV5A 1IZ1A 3CUQA 4LG3A 1FIPA 2KRCA 2KQRA 2XROA 4EATA 5C44J 2CUEA 2FBKA 3BZKA 3KCCA 5EGOA 3JSPA 1X4OA 4RS8A 2ECBA 4E7SA 2L5QA 2W48A 4IHVA 1I1SA 1FMVA 1XMXA 2ID3A 2VQLA 3FF5A 3TP3A 4QSHA 5HLIA 1OQYA 3KEQA 5H6QA 4HDVA 2KZVA 2V7FA 2R0QC 1X58A 3L2RA 2V9PA 3FKIJ 3BZ6A 4HV5A 3TOAA 2LOOA 1D1AA 3MMYB 2VXDA 2Y75A 3A2KA 2R5ZB 1BI2A 4LG0A 4L0ZB 3Q0VA 4ANJA 1SFXA 3VSLA 4EM1A 4KIGA 1T38A 2GXBA 3HUGA 2A68F 2L2OA 1W7PD 3DTIA 1T39A 2DT6A 3TW7A 2EV5A 3E0JB 2DJIA 2LSOA 2DFEA 3EUKL 1J0RA 2V79A 2HEOA 3GTLJ 2R7VA 4XORA 3M8FA 5IYBJ 1HDPA 3HPHA 2VJ5A 5E20A 1ZH5A 2CW8A 5EEGA 1AOYA 4CYCA 1P7IA 5M5XJ 1E3OC 2HDWA 4ABZA 5HODA 2ZO4A 1XDSA 2EFPA 4UUTA 2R7UA 1G59A 2EZLA 4XLCA 4G9YA 2XAGA 2E1CA 3PO3J 3R0AA 2R7QA 5K5QA 4YEJA 3ELKA 3HPGA 3QWLA 3CDHA 1A6QA 2WWYA 5BNGA 1QHGA 2DFFA 1U0JA 1XCVA 2DDAA 2LREA 4LLGF 3IKTA 1JI8A 4B44A 4BU2A 1A04A 3WG7H 3ZMDA 3DXJF 2QSHX 9ANTA 2KT0A 3C2GA 2W00A 1B8IB 4A69C 3MKYB 3BJOA 2LP0A 3DKWA 2E1MC 2F2EA 1FSHA 1E3HA 4DBQA 4WXCA 4RLFA 3F22A 1BN5A 1JTXA 1IDYA 1OKRA 2HWVA 2P4WA 2XPVA 2Z9OA 5D6FA 1WRJA 1FT9A 2VJJA 1MD0A 3H5NA 2HFHA 2HVSA 2QSGX 4JX6A 5CVIA 2GXAA 3FK6A 4UB6C 1E0EA 2JPBA 4XR6A 3KLNA 2K85A 2FD5A 2M3AA 2VXZA 4BXXJ 2WY8Q 3QAHA 4HDUA 3RI4A 1LEAA 4I01A 4MEYF 3F8BA 4C30A 2MH9A 2E2JJ 4LB5A 4HX8A 1U5TC 2CV2A 5BQTA 4KYWA 3G1OA 1K4TA 4LOCA 2DMPA 3E7LA 2ZJRF 2LD5A 2GA2A 5KK1A 1P4WA 2FNPA 4C3JJ 3HSFA 2VPLA 1F43A 1DP3A 4KMUX 2ACJA 2JQ7A 3H5RA 2QM3A 2CUFA 2WB1A 2WTEA 4J01A 2P81A 4HNTA 1V5FA 5FD6A 3RTRA 3OYEA 2P6TA 1MJAA 1TZLA 2JN6A 4BY7J 3ULQB 2CH0A 2KRFA 4N4NB 1MBHA 5LRSA 4F52A 3WU1B 2ESHA 2RDPA 1SFKA 2LFBA 1R4MB 1SD7A 2M5WA 3QPHA 2KIFA 4EGZA 1IAWA 4L5IA 5FFZA 2R5ZA 1BA5A 5BPDA 4ESJA 2VN2A 1YI2I 1JKRC 1YW9A 5E3OA 2ZSIB 1TP4A 1D8JA 2E71A 4Y4RA 4OIRF 2Z33A 1Y6IA 1ZR2A 2CQQA 1K83J 3K70D 1T6SA 2ZNZA 1R5ID 3JRFA 2KL4A 3DPTA 2X1EA 4X6AJ 2VBWA 4M71A 1D0ZA 1GXQA 2W84A 4WCGA 2AXLA 5D5XB 2LF7A 3LSTA 5E79C 3ISPA 4A0XA 2WV1A 4B3AA 2R5YB 3F8CA 2B7EA 1HXDA 4X1EA 3PSIA 3T8RA 2MGQA 2CRGA 3OYGA 5J47A 2EIJH 4FETA 1GVJA 1BC8C 2R7DA 1SVMA 5L3DA 5K5RA 3N05A 1F1ZA 2YR2A 3GZ6A 2W1OA 3BDDA 2YUSA 1KONA 1R5GA 3PFIA 4FE7A 4Z2YA 3OYBA 1DDNA 1QVTA 1R9TJ 3EUHC 1ZTRA 4NC8A 1R4NB 1XMAA 4FISA 3C7JA 4PJMA 3KP6A 4WX9A 3K1PA 3RYPA 3F9KA 1UAAA 4EV0A 3K4JA 4RB2C 2KDZA 5M5YJ 3F6OA 3D5SC 3RKQA 2JA8J 2VBZA 4XIDA 4A6EA 2CQ7A 1B8IA 2LK2A 2Q8KA 1YIJI 4DW6A 4BYYA 2F48A 2FOKA 1GVDA 1XX5A 4RBOA 4ZTFA 3ASNH 5C3EJ 4C2TA 2TDXA 1VQPI 2OTLI 1FEXA 1UHSA 2LKSA 2MYSA 1BR2A 4IEJA 4PZJA 1SEUA 1I1GA 2B0LA 4P96A 2PN6A 2RV8A 3P7NA 1ETWA 4OAZA 2HYJA 1GV2A 3S14J 2Z16A 4KITB 2BE5F 3CCMI 2EFWA 5CVJA 1DGRM 2JRMA 2GLOA 1ULYA 2CW7A 5J1UA 3CMYA 1MIJA 4Y7NJ 1EH6A 1XCBA 1MGTA 4ZDLA 4XLHA 2IGNA 4L5JA 3DFGA 1GLNA 4XQFA 2DA1A 2W85A 2EB7A 4XNFA 1VQKI 4IHWA 1GUUA 1M1EB 3BR0A 2CQXA 1X4PA 1X1AA 2DMUA 4FQGA 2MD5A 2NNYA 4CA0A 2O3FA 1WI9A 1IGNA 1VTNC 1SMYF 4IHYA 2M8EA 3S3NA 3VYSB 5LRRA 1XD7A 2COMA 3CDLA 3D0SA 4BH9A 3S1MJ 4C3HJ 4BQNA 1TL8A 1ZHFA 2AHQA 2ID6A 2XAJA 4V2GA 2IXSA 3D5RC 3TEDA 2N8GA 1J75A 5HS8A 3J7ZI 3F8FA 3FHNA 4GXOA 2MC4A 2IVMA 3ABUA 2KFDA 3I4PA 1C0WA 2GZWA 3IV5A 4P5OA 3I4NJ 1P4AA 3V8KA 3VFZA 4A3IJ 3GTKJ 3JAMK 1LE8A 1YX5A 4U88A 2XGDA 2Z5UA 3CO7C 2JTVA 4L9NA 3ERED 2VE9A 3OY9A 2RNGA 1XDUA 3OYAA 2VBXA 4Q47A 4KT5C 3FHZA 1W5TA 5DCFA 2R5YA 4HF2A 2YX4A 4F7ZA 4HG2A 1G3SA 1JT6A 2DK8A 4RB0A 4EJOA 2RN7A 1XG1A 1HKTA 2LVSA 1VF9A 2E34A 4BBSJ 4I7HA 5BMZA 3HHGA 3PM1A 5DDGA 4AYBN 4MTDA 3TO7A 4PJJA 4A3FJ 2FF4A 2QZ8A 1D3YA 3GFLA 3O8GA 3L09A 4PJNA 3CUOA 1FBUA 3S93A 2HQAA 1W36D 2XV4S 1FYMA 2DU9A 3ZMZA 3E1SA 4CSWA 5LGUA 1ONVA 1IXCA 3CLOA 3CLQA 3BT9A 1A5JA 2Y9YA 1JUSA 2QEXI 3WTVC 1RKWA 3L2CA 2M2EA 3U1KA 3GXOA 2XAHA 4LIUA 4KMFA 3TQNA 2EZHA 1MW7A 3CD6I 2MD0A 1B4AA 5J8CA 4XRFA 1V4RA 3ZR8X 1TNTA 3JRCA 4NQWA 4OU0A 2GA1A 1TTYA 4LLLA 2M0CA 2M8GX 2EZIA 4PFPA 3HOZJ 1VQ7I 2M9HA 3HIFA 4GRIA 4H4KC 2Y9ZA 2HDCA 2IAIA 3BTCA 3ZN0A 2C6YA 3SEQA 3GTPJ 2ECCA 1T33A 3BTLA 1O57A 4LLNA 4W97A 3TGNA 1W36C 2UUZA 2V6EA 4CDGA 1ZR4A 1WZ2A 3G71I 1GXPA 2EPFA 1RESA 3BPXA 2KPMA 3FXMA 3RJPA 1F9NA 2VQGA 1QPIA 5DTDA 4ZTJA 2EFQA 3JREA 2QUFA 4BDZA 2QKLB 3W3CA 2UZKA 3CMMA 5B5EC 2ETHA 2UXNA 2ZFUA 4LIVA 5DD8A 2OQGA 2E5ZA 2PI0A 1UHWA 3J80K 3BY6A 3LA3A 4M9SA 4IQJA 4HW0A 4ZDPA 2CMPA 4XRSG 1U78A 1MH3A 4LJZF 1H9GA 1ZARA 2A61A 3V8JA 1ZYRF 3L1PA 1BW5A 3S1RJ 1QPMA 1X1CA 2QVOA 3BLYA 3MKLA 5F08A 1YYVA 3PL8A 2V1DA 4UVCA 1I3AA 1FPQA 4B48A 4U0YA 2XDVA 1O7FA 5E1ZB 3LSGA 4NDLA 5ILSA 4UB8C 5M3MJ 2H8WA 2ISZA 2CU7A 1P92A 4KIBA 4PK4A 4XK4A 3JRHA 1T8IA 4HEA2 4M6YA 2YPRA 4XLEA 2ZMEB 5FB2A 1QZZA 2IEKA 4RB1A 1MJBA 1B72B 4P55A 3SXYA 2Q2EB 3E6DA 2XAQA 3MN2A 3K4LA 5D8KB 3FXKA 1ETKA 4CGZA 2X0LA 3SZGA 1FYLA 3MD2A 4DIQA 4DJAA 2FX0A 3KYDB 4UXNA 1Z7LA 2CQNA 3M8JA 4O3MA 4LD5A 1IXSB 3I3LA 3H92A 4A93J 1QZYA 4GO1A 4CHUA 2K9LA 3MEXA 1HKSA 3R0JA 4UV8A 4ENKA 1BC7C 2H6CA 3LFKA 1Z6TA 4UV9A 1I50J 3BG5A 2K9MA 3HSRA 4UVBA 1WJBA 1LDDA 4NBQA 3ZMSA 4ZYAA 2VT2A 2VASA 4A3GJ 2JT1A 3RDIA 2YX7A 4IKFA 1VQLI 4ZDOA 2PMUA 4U7BA 3LMMA 3OOUA 1ZRCA 3I53A 1B9MA 1Y8RB 5KAIC 3QPTA 1WI3A 1L0OC 3BROA 1EKEA 2VC0A 5GAEJ 1USTA 2YU3A 3IKVA 4GCVA 1LEBA 1YO5C 4OAYA 2IGMA 1ZREA 5B3SH 2HS5A 1RUOA 1X3ZB 3MAJA 4HF0A 4B3XA 3PJRA 2VBYA 2CWEA 2I8DA 1T0FA 2E19A 2CS3A 2W25A 2DCEA 4PGHA 3PUFA 3WGIA 1EH8A 2XSJC 3G73A 4BE2A 1WJAA 2DQRA 4BY1J 1P6RA 3FXOA 2PMZN 4HBLA 4XKWA 5H20A 5GAGJ 5ICFA 3J81K 4LG0B 1WGXA 4OMYA 3ABKH 4YFXF 1E17A 2IS6A 3RPUA 4HX7A 4Y15A 3RQ4A 2MBFA 2K86A 4E70A 2ICWG 1ZGWA 2K40A 2ZNYA 3L2QA 4E7HA 3OYFA 1R58A 4YELA 2BY0A 3BR6A 2K27A 4S0HB 5JHUA 5L3EA 2Y0SA 5H2FC 2Z99A 3T1BA 4A5NA 4BHPA 3JRDA 3JRGA 4RLQA 3S16J 2DT5A 3MFKA 4HLYA 4F93B 2FMYA 3OYDA 3K0LA 2O7OA 2V26A 2W57A 1BI0A 2D45A 1ZQ3P 1LFBA 3RKXA 2WAQA 4M72A 3DKXA 3R61A 1HDDC 4CYCB 1D0YA 4EJTA 1MMAA 4CCKA 2QSFX 3ERMA 2JSPA 1Y8QB 4ZYGA 3S1QJ 4O6JA 3U21A 4AVZA 1KGSA 2JA5J 1S6LA 5EYRA 2HXOA 2XVCA 1AWCA 5A2QK 4X0GA 4AWXB 2BV6A 3D1NI 2I10A 3S15J 1S9HA 2RC4A 3CCYA 1T98A 1KU9A 1XB4A 4PSXA 4BE1A 1XC5A 3I5UA 3HRMA 2L9RA 2DA5A 5HDKA 1H89C 2DMNA 2LDUA 3KZIC 1B72A 1D5VA 1K6YA 4HSTA 1BBYA 4BQOA 4OIPF 2Q2EA 5BPIA 3DPUA 2R3SA 2LBFB 2GAUA 5J3LA 3CF2A 2JRTA 3HEFA 4PSWA 5HVQC 3A03A 4ENNA 4YFKF 2VODA 3NQOA 3WTZA 4CZCA 1CGPA 3VYRB 2BBYA 1I3QJ 2M87A 4L0YB 3GO5A 4CCNA 1LFUP 2A05A 3JAMZ 2X85A 3LAJA 2W4SA 4ON0A 4MFDA 2BW3A 2HGCA 2DOAA 2YS9A 2R7RA 1IRFA 3OS2A 1TQPA
chains in the Genus database with same CATH topology
2EIMH 1OCOH 1OCZH 2ZXWH 3AG1H 2Y69H 2EIJH 2OCCH 3AG4H 5B1BH 3ABKH 1OCCH 3AG3H 3ABMH 5B3SH 1V54H 2DYSH 1V55H 2EILH 5IY5H 2EIKH 3ASNH 3WG7H 3AG2H 2EINH 1OCRH 5B1AH 3ASOH 3ABLH 2DYRH 3X2QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM H;  1OCO H;  1OCZ H;  2ZXW H;  3AG1 H;  2Y69 H;  2EIJ H;  2OCC H;  3AG4 H;  5B1B H;  3ABK H;  1OCC H;  3AG3 H;  3ABM H;  5B3S H;  1V54 H;  2DYS H;  1V55 H;  2EIL H;  5IY5 H;  2EIK H;  3ASN H;  3WG7 H;  3AG2 H;  2EIN H;  1OCR H;  5B1A H;  3ASO H;  3ABL H;  2DYR H;  3X2Q H; 
#chains in the Genus database with same CATH topology
 2VQH A;  4J00 A;  1DPU A;  5ICC A;  2V1U A;  3BR2 A;  4DGW B;  2FSW A;  1IF1 A;  4WK8 F;  5IP7 J;  3CME I;  1IN8 A;  4I0A A;  3EPZ A;  1D1C A;  4DYC A;  2BVL A;  4D5F A;  1MBF A;  5ICG A;  4FHT A;  4Y17 A;  3GFM A;  3OYJ A;  1W0T A;  3CCL I;  1ETO A;  5EZG A;  3FMQ A;  4HAM A;  4AYB A;  5TIS C;  4F3Q A;  4ZH4 F;  2RVC A;  4MEX F;  2DOF A;  3FM3 A;  2XF7 A;  3G4S I;  1VND A;  3WTU C;  3I64 A;  3GYH X;  3SDG A;  4F91 B;  2X6O A;  1REP C;  2KZG A;  1DUX C;  4EM2 A;  4UUV A;  3IWZ A;  4YIF A;  1VFC A;  2VKD A;  4KDP A;  4CYD A;  2K9N A;  4D1Q A;  5HDG A;  4MIM A;  1APL C;  4N9I A;  5GTH C;  1HF0 A;  3H3V K;  4O5V A;  2OQR A;  3GF2 A;  1B6A A;  3DEU A;  2VI6 A;  2L4M A;  5ILV A;  2NVT J;  3CP2 A;  4A3D J;  4E7L A;  2EFN A;  2PG4 A;  3PQK A;  3ZQF A;  1W1W E;  3NRV A;  2OUM A;  3LSM A;  2JWT A;  3V42 A;  4YFN F;  4U87 A;  2D5V A;  4XIC A;  5IT9 Z;  4Y3O A;  2VJ4 A;  1TQI A;  1JUM A;  2NS0 A;  5ICE A;  2G0E A;  1JGG A;  1T56 A;  2E35 A;  1IN5 A;  2CW0 F;  4XSX F;  3K6G A;  5ED4 A;  2QBY B;  3IH4 A;  4QWQ A;  2G7H A;  3SFI A;  4ASN A;  2L7K A;  3BZC A;  3A1Y A;  2A5Y B;  4EMS A;  3LQQ A;  1WSU A;  3AG3 H;  3SJM A;  1UZC A;  1MDM B;  5J4Y A;  3KE2 A;  5EF6 A;  1V55 H;  1Z21 A;  4MLO A;  1F5T A;  1RPW A;  1U5T A;  5ILU A;  1YFH A;  1DP7 P;  1K79 A;  4ZC3 A;  3H5A A;  5LEK A;  1YQA A;  2ZXJ A;  2MC3 A;  3QRF F;  2ZB9 A;  1G6N A;  1WH5 A;  4G12 A;  4NUB A;  3ECH A;  1SD4 A;  4BNC A;  2K9Q A;  5FRO A;  4AC0 A;  5IOY A;  1D1B A;  2QQB A;  1T08 B;  3H3U A;  5DM6 F;  3J80 Z;  1RNL A;  3LA2 A;  4RAG A;  4U0W A;  1OJL A;  2MLK A;  2BXY A;  2K02 A;  4GGG A;  5BS6 A;  2CG4 A;  2MG4 A;  3HOS A;  2VKE A;  1J59 A;  5LEJ A;  2VOO A;  5LHH A;  1NG7 A;  3CCV I;  5BOX A;  1HW2 A;  1EJ9 A;  1MND A;  2LBF A;  3K1M A;  2CGP A;  3OMY A;  3ZMU A;  2GM4 A;  3FIS A;  2XF5 A;  4I99 C;  2L01 A;  4A3J J;  2E5N A;  1WJC A;  2XF6 A;  1I39 A;  3QU3 A;  1P2F A;  2P7V B;  1MNE A;  3HBL A;  4ITV A;  4A3B J;  1DU6 A;  4XKB A;  2X6X A;  5EJC A;  3PIP F;  1TT5 B;  1RR8 C;  2IBD A;  4P9U A;  1J9I A;  2ELH A;  2L9N A;  5CVV A;  4D7N A;  1ZG5 A;  2PFB A;  4ZZL A;  2LR8 A;  4K2E A;  1N78 A;  4DZP A;  2LF8 A;  2O9L A;  2W7N A;  4CH7 A;  2H94 A;  1IUY A;  3JR9 A;  3T8T A;  3HKZ A;  5FFX A;  1HST A;  5B66 C;  5DV5 A;  4ESF A;  6PAX A;  2IA0 A;  1ETV A;  2HXI A;  1OYY A;  2RQQ A;  1LFP A;  3M3Y J;  2KJC A;  2L4A A;  2OCC H;  2ZXI A;  4YRV A;  1H8A C;  2STT A;  4A3L J;  2EA2 A;  3EUH A;  1MBG A;  1PUE E;  2VLA A;  1HOM A;  4N4O B;  4XKC A;  1SVO A;  2VQC A;  3RQI A;  2NXN B;  4BQA A;  1ERD A;  2NAZ A;  1XSV A;  4G8X A;  2FA5 A;  2RGV A;  1OYW A;  2D1V A;  1N25 A;  4Y13 A;  1T2K A;  4CCO A;  3M4O J;  4EM0 B;  2X48 A;  3E6B A;  1DQU A;  1TC3 C;  4A2U A;  2A3S A;  4I76 A;  5E1X A;  2LKX A;  1ZLJ A;  5K7F A;  3AG1 H;  5HNF A;  2MLG A;  2E60 A;  2QGU A;  2R93 J;  3MQ0 A;  4IHX A;  3CDI A;  2OZ6 A;  2MH2 A;  5FLM J;  1S7O A;  3FZV A;  4II2 A;  1OR7 C;  1A36 A;  3FM5 A;  5EZH A;  2HQR A;  3F8M A;  2QBY A;  3HOT A;  2H27 A;  4EJU A;  1LE8 B;  4HSR A;  2L0K A;  3AG2 H;  1I6X A;  5FLX K;  2PMZ A;  3LOC A;  1LPQ A;  1MDM A;  3J81 Z;  1H88 C;  2R7F A;  3WTX C;  1MJ9 A;  1DPR A;  4KT6 A;  3DBL B;  2NRA C;  2BHY A;  3HDD A;  2HOE A;  1IUF A;  2IGK A;  3BJ6 A;  4I98 B;  2L02 A;  2ZXW H;  4PJL A;  3OYN A;  3IL2 A;  2IJL A;  3KZZ A;  3BTJ A;  4BUP A;  5DUK A;  3P5J A;  2K3P A;  1HC8 A;  1D0X A;  1IJW C;  2H1K A;  1BOA A;  1ETX A;  1Y0U A;  1EH7 A;  1SMT A;  1XGO A;  1XMK A;  1SAN A;  1IN4 A;  2EV0 A;  2ZSH B;  2WBM A;  3MZH A;  3NAU A;  1OPC A;  1ON2 A;  3S17 J;  3KP5 A;  3HB9 A;  3QPS A;  3G1M A;  2PBI A;  1PP8 F;  4ZYE A;  4KJZ A;  2HOA A;  3K70 C;  1V5E A;  1LNW A;  2NVQ J;  4HOB A;  2HU9 A;  3DPL C;  2DDB A;  5H6R A;  2HTJ A;  2F5D A;  2G9W A;  1R71 A;  3BCB A;  5F64 A;  3ZMT A;  2X1D A;  1AHD P;  5JI6 A;  5LHI A;  3CTA A;  3DKY A;  2NOJ B;  3FMR A;  3OIO A;  4JOM A;  3L2U A;  4NQW B;  1NG6 A;  1OCP A;  3M1E A;  4BE0 A;  3HOW J;  1PJR A;  3ZPL A;  1U9N A;  4EVI A;  1JE8 A;  5EDN A;  4IF4 A;  3GUD A;  4XRS A;  1JKQ C;  4U7D A;  3K4M A;  5CQG A;  5KHD A;  3COA C;  3PQJ A;  3RCO A;  3I4M J;  3DQV C;  1IDZ A;  1HKQ A;  2BYV E;  4E6K G;  3BG6 A;  4XBF A;  3GEZ A;  4G94 A;  1S7A A;  3TMO A;  1P4X A;  3TP0 A;  2NVU B;  4IX7 A;  1OIS A;  3CJR B;  2LY9 A;  4MQ9 F;  1ZG1 A;  1JHH A;  5F0C A;  1ACI A;  3NWT A;  3S32 A;  3CP8 A;  3SZT A;  4A3M J;  1RRJ A;  2XAU A;  2P5V A;  1OCR H;  4CCL A;  3ASO H;  2DMQ A;  4D0P A;  3BC8 A;  2DTZ A;  4FT8 A;  3GFJ A;  1ENH A;  3S8P A;  2HVQ A;  3AAF A;  5D8L B;  2EIM H;  2QLZ A;  1B9N A;  3K10 A;  2PJR A;  3OYH A;  2DOD A;  5GPA A;  1SFO J;  1O3S A;  2XC7 A;  1XTA A;  4A12 A;  2QA4 I;  4B09 A;  3I54 A;  3KPH A;  1QO0 D;  4B47 A;  2X1C A;  5IPA A;  5L3B A;  1VZ0 A;  3FMS A;  1UCR A;  3FKJ A;  2E7X A;  1W5C C;  2P8T A;  2VKV A;  3EQL F;  4C2M J;  5M3F J;  3JSO A;  1POG A;  1O3T A;  3WHC A;  2V9V A;  2HR3 A;  4RMN A;  1DGW Y;  3IP4 B;  3VOE A;  2PLY A;  3U1D A;  2NOG A;  4MGR A;  5EEA A;  1HQC A;  2X4H A;  1HBX G;  2VJI A;  5DEQ A;  3CQZ J;  4E4H A;  4XN0 A;  3KIO A;  5LGN A;  1KQ9 A;  4AD9 A;  2X51 A;  2LY1 A;  1YS7 A;  2CFX A;  3C3W A;  1V54 H;  3ABT A;  3E5X A;  4GYI A;  5CYV A;  5AIQ A;  1WFX A;  1VQ8 I;  4OMZ A;  4V19 K;  3HYI A;  3ZQH A;  2V1X A;  1G3W A;  4NC7 A;  2F6C A;  5E8G A;  4KFC A;  1RET A;  3ABL H;  5FKK A;  3VPR A;  1SAU A;  3ESW B;  2F5F A;  2JA6 J;  1E3P A;  2K4B A;  3GZN B;  4BBR J;  2BY2 A;  3W6K B;  1ZG3 A;  2FJ1 A;  4BEH A;  1MBE A;  4Q4Z F;  3LSJ A;  1SFU A;  3W2V A;  1SFE A;  2GQQ A;  1X2M A;  4UNO A;  4C9Y A;  1U6G A;  2HPI A;  3OYK A;  5FD5 A;  2I5U A;  4KN4 X;  1O3R A;  2HKO A;  2JSC A;  3H0D A;  1BOB A;  3T5X A;  4OWR B;  1MMN A;  1RZ4 A;  5HDN A;  2HOT A;  1FIA A;  3IH2 A;  5J6X A;  2CJJ A;  4UVA A;  5E18 F;  3C18 A;  4PDK A;  4HZF A;  3M1C A;  1YIT I;  2L9V A;  4B4C A;  2HOS A;  3I59 B;  4N9H A;  4QPQ A;  4U0V A;  2OZU A;  4MHG A;  3WGG A;  3VYU B;  3N4M A;  2HNH A;  3AG4 H;  4A3C J;  3BQZ A;  3VDX A;  3W6V A;  4MFE A;  2QEN A;  4YII A;  3CCJ I;  1B1B A;  2OTJ I;  5DS9 A;  1NK2 P;  2PQ8 A;  4BJT A;  4R79 A;  2ELK A;  3LWF A;  5EG0 B;  3AKZ A;  2HQ5 A;  5J8F A;  4DYQ A;  3LL7 A;  3CC4 I;  2GBY A;  3L7W A;  5LD2 C;  3GLX A;  1I6H J;  1YJ9 I;  3A02 A;  2XUB A;  3BG7 A;  2H8R A;  2XHK A;  3E5Q A;  1NH3 A;  3UR3 C;  1J5Y A;  2NVY J;  2BVM A;  3OL3 A;  4QTR A;  4BDY A;  2P6S A;  5CLS A;  1MMD A;  3ZQG A;  2E2I J;  2O8X A;  1WHU A;  3CJN A;  1YTY A;  5LGT A;  2OBP A;  1FLI A;  2DO7 A;  3FXL A;  3C1D A;  1ON1 A;  4BXU A;  4CZZ A;  3JRI A;  5HOO A;  3J7A O;  2XGE A;  4RGR A;  4IOA F;  2NNN A;  2HZT A;  1IXR C;  2ME0 A;  1KU2 A;  5K7H A;  4IVN A;  3K7A J;  2XAS A;  4HPQ A;  5F1R A;  2Y0M A;  4RGS A;  4KNY A;  1XGN A;  2JVG A;  1IW7 F;  5GP9 A;  4DQ2 A;  3UKG A;  4BHB A;  3N97 A;  3H35 A;  3B6C A;  5GAH J;  1WPK A;  1KA8 A;  4F55 A;  2JPC A;  1VQ6 I;  1WJF A;  1ZEL A;  2WC2 A;  3IAS 2;  5J40 A;  4M6X A;  4BJ6 C;  1LQ1 A;  2JA2 A;  3F23 A;  5M5W J;  3OOP A;  3ZOB A;  3MZ8 A;  4A5M A;  4Y52 J;  2BW3 B;  3A0B C;  2NYX A;  3MZY A;  3ZQC A;  3BR3 A;  3SYT A;  5FLX Z;  5DD4 A;  5L3C A;  5IY5 H;  3OYI A;  4ZJZ A;  1IV8 A;  4M3D A;  2Y2Z A;  2IRF G;  2H1L A;  1S3J A;  4PCQ A;  4G7H F;  3FXR A;  3TBI A;  2DFI A;  1LUJ B;  2VC1 A;  1JJ6 C;  5D4S A;  2OD5 A;  2KKO A;  3JCU C;  1SC7 A;  5F1J A;  4XLP F;  3I56 I;  4M9X A;  1X1P A;  1LDK B;  3KEO A;  3MWM A;  3KP4 A;  4XLA A;  4KIC A;  1IN6 A;  3BPV A;  2DK5 A;  1HW5 A;  1ZAO A;  1FX7 A;  3PO2 J;  4R8H A;  1U8B A;  2E7W A;  1KZH A;  3ZGK A;  1IC8 A;  3QOP A;  2AQF A;  2UXX A;  1KQ0 A;  2EIL H;  1J09 A;  4HQE A;  1W7P B;  3I59 A;  3E6C C;  2WAF A;  3BR5 A;  3OR2 C;  4ESB A;  3DBH B;  2DFH A;  5ERI A;  2MW8 A;  4PUS A;  2ESN A;  1OFC X;  4LK1 F;  2M7A A;  3G1L A;  1FOY A;  4B8X A;  1TWA J;  3GCM A;  3B73 A;  3KP3 A;  3RSN A;  2E1M B;  4JQF A;  3TW6 A;  5EG0 A;  4L9T A;  2GIZ A;  5CKT A;  5D6E A;  4HA8 A;  4ETS A;  2DQL A;  2GXG A;  1EV7 A;  1O7L A;  1OCC H;  1ZGJ A;  1IRZ A;  2Z2S B;  5TRD A;  4IOC F;  1OLT A;  4OIN F;  2CQK A;  3VB2 A;  2XAF A;  2Q1Z B;  3CZ6 A;  3S3O A;  3CMA I;  3GX4 X;  4NB5 A;  2F4M B;  2LMD A;  5CQE A;  3QYB A;  2XB5 A;  3BWG A;  4TV7 A;  1IG7 A;  2CV1 A;  2K5C A;  4WXD A;  1BR1 A;  3LSK A;  2DPU A;  1GHC A;  3PIO F;  1U5T B;  2PEX A;  3OS1 A;  4XSZ F;  3CCE I;  3FBN B;  2AO9 A;  3HTU A;  2Y48 A;  4M6V A;  2M0M A;  1UMQ A;  3M8E A;  2DA3 A;  3H9Q A;  2R4G A;  3HGG A;  2VT3 A;  2A5W A;  2L7F P;  2XRN A;  5E3N A;  3OSG A;  2QCO A;  3M9A A;  2ZJP F;  4IXA A;  2LYC A;  2L54 A;  3OYC A;  1P7J A;  3V8L A;  5JFR A;  2EK5 A;  4E7K A;  1D5Y A;  3DEW A;  1WCM J;  2BXZ A;  1J2X A;  2DOE A;  4G6Q A;  3SHF A;  3RPU D;  1YIO A;  3ZQI A;  1JUP A;  1BJZ A;  4B1R A;  5L3G A;  1LVK A;  3HGY A;  3B6A A;  3K4C A;  3EYY A;  2JZY A;  4RAZ A;  3BR1 A;  4N0B A;  3GTO J;  3PFY A;  2WAE A;  5CPR B;  4FTH A;  1YW7 A;  1G8X A;  1FBQ A;  2EWN A;  1S8N A;  3QOE A;  1R00 A;  4XLN F;  4RAY A;  5E17 F;  3ZXS A;  4IPA A;  1UG2 A;  5F27 A;  1K78 A;  1IO2 A;  3DU5 A;  5FRM A;  1Y1W J;  2IS1 A;  1XSD A;  2DXI A;  1Z1D A;  1FOK A;  2R7O A;  4FX0 A;  4R1H A;  4GYG A;  3RKW A;  2EV6 A;  4KA4 A;  2R7W A;  5JVT A;  4AM3 A;  2K3F A;  1AU7 A;  2KHM A;  3LQR A;  3SQN A;  3JRB A;  5FLV A;  3P9C A;  3MCZ A;  4RM2 A;  4D9J A;  1GT0 C;  1EA3 A;  3VYT B;  1PYV A;  5TJJ A;  5FJ8 J;  2EFO A;  2EH3 A;  3W2A A;  2Y31 A;  1CF7 B;  5FKO A;  2CUZ A;  3HTS B;  1W7P A;  2HYG D;  5HLH A;  2E2H J;  2O03 A;  1D8K A;  4MTE A;  2VOP A;  1TWF J;  3K1N A;  4ZYH A;  4HX4 A;  1S29 A;  3FX3 A;  1FMW A;  2OPT A;  3R60 A;  2OJE D;  4DOZ A;  1ORK A;  1OYI A;  1CQT A;  2O5R A;  3LSH A;  4AUX A;  3FWE A;  5J4V A;  1UEL B;  4HRI A;  2QQ8 A;  4EJW A;  4EGY A;  3DEE A;  5L3F A;  1S7E A;  2K9S A;  1I27 A;  1Q1V A;  2WV0 A;  1W5S A;  1WQ2 A;  2OA4 A;  1U9O A;  1K6O A;  3K2Z A;  3H0G J;  2JUG A;  3ZCO A;  4ZYD A;  3DTE A;  4XKV A;  1LJ9 A;  3HC7 A;  1S5L C;  5HLG A;  4UHT A;  2VB6 A;  4WXH A;  5HLT A;  1K61 A;  3M7G A;  3F21 A;  2Z1D A;  3KP2 A;  4WWC A;  2ZME C;  1BI1 A;  1IV6 A;  2KIU A;  3QP5 A;  3H1C A;  5HS9 A;  2IGO A;  4I02 A;  2O61 A;  4DZJ A;  1HCR A;  5DCM B;  1YLF A;  4P9F A;  2HPM A;  4XON A;  1XN7 A;  2MFZ A;  3I9V 2;  2PJP A;  3L00 A;  5HNH A;  3E5U A;  3OYM A;  2CFO A;  3HOV J;  2M4K A;  3ZQL A;  2HI3 A;  3O2P E;  3HJE A;  2HDD A;  3S2W A;  1U3E M;  1U8R A;  3IC7 A;  5IP9 J;  3LSP A;  4II3 A;  2DBB A;  4JP0 A;  4C2U A;  2D2W A;  3F6V A;  3GME A;  1FP1 D;  1RR7 A;  3KYC B;  1RI7 A;  4GDF A;  2VON A;  3WGH A;  2P5K A;  4IRI A;  2E1N A;  3S1N J;  3TKY A;  3O8H A;  3KX2 A;  1H9T A;  2P7C B;  2CUJ A;  1TWC J;  2WA0 A;  4BJ5 C;  3ML6 A;  3P9K A;  1O4X A;  1TWG J;  1B59 A;  4I6Z A;  4A0Z A;  1ETQ A;  3LSI A;  2XKP A;  1Z05 A;  3CUQ C;  3IRQ A;  3CCQ I;  2MA3 A;  4OOI A;  4HNV A;  1OR7 A;  2DN0 A;  3GTJ J;  2LNB A;  3HXL A;  2V4J C;  3KP7 A;  5LLQ A;  3OWT A;  4NC6 A;  1GDT A;  5FRN A;  3WTS C;  2F5E A;  2O0Y A;  4ZZD A;  1ETY A;  5IT3 A;  4PJ0 C;  2Y30 A;  3D5L A;  3TO6 A;  4QLC U;  2XSD C;  4FX4 A;  2LG4 A;  2A6T A;  2X6Y A;  4Q48 A;  3WHB A;  3EET A;  5E3M A;  1FZP B;  4M74 A;  4S05 A;  2OCE A;  2GWR A;  3H3Z A;  2GOX B;  3GBG A;  2QWW A;  5LFA A;  5TGT A;  4YIR X;  4KUM A;  3DWL E;  1R5H A;  1Y56 A;  1MMG A;  3LSR A;  5F04 A;  3K4K A;  4QPO A;  3WTY C;  2R7X A;  3W2W A;  3KET A;  1ZRD A;  1BW6 A;  1CF7 A;  4D5C A;  4LMY A;  2BGC A;  3ZQQ A;  2QYO A;  2M4G A;  2FEZ A;  1Y39 A;  3C2H A;  4UY8 I;  1NK3 P;  2PJR B;  4LB6 B;  2JJ7 A;  2JK3 A;  2VKH A;  4LIT A;  3KEY A;  1HA8 A;  2HZD A;  3E97 A;  3IAM 2;  3F3X A;  1G3T A;  3E6M A;  5FGM A;  3A01 B;  2DPD A;  3AL0 C;  4I0B A;  3X2Q H;  2BHZ A;  4RA2 A;  3TL4 X;  3DU6 A;  4EEF G;  1UHM A;  5J1Y A;  2O6G E;  3OV8 A;  3NAR A;  2Z3Y A;  1XS9 A;  4RGX A;  2BOL A;  3VSK A;  3HL2 A;  5C4X J;  5D5W B;  3K4N A;  1X1D A;  1TBX A;  3E3V A;  3MVP A;  3CCS I;  2IA1 A;  3HOX J;  2GIV A;  1Z7U A;  5AIP A;  2B63 J;  3FDY A;  5E3L A;  1Y1V J;  2COB A;  1KQ8 A;  2HYF A;  5EEH A;  1FYK A;  3T0Y A;  1KYZ A;  5DM7 F;  1FOX A;  4AIH A;  2TRT A;  1FTZ A;  3GLL A;  3M07 A;  2QQA A;  4HQM A;  4XOP A;  5KNL A;  1QA6 A;  3AFH A;  1KU7 A;  1ZKG A;  2VL8 A;  1OCT C;  2FML A;  2STW A;  2A6E F;  2KJB A;  2DTR A;  5DCM A;  4CCM A;  1VQN I;  4BGD A;  1N77 A;  1VQ9 I;  4M3G A;  3A0H C;  1A6I A;  1VQM I;  1VQ4 I;  3DLL F;  1V5G A;  2F4O B;  5FKL A;  1YOV B;  2DYS H;  3BP8 A;  3G2B A;  5JVG F;  4XM3 A;  4BEH B;  4FAS D;  4XMY A;  1ZLK A;  2AS5 F;  3QOD A;  2OC6 A;  4XLF A;  5J1R A;  5KCM A;  1QVU A;  1H0M A;  3VOD A;  2KIS A;  3OYL A;  3CF5 F;  2K7L A;  2GOM A;  2ADU A;  2LRD A;  3LAP A;  4KN7 X;  2JMW A;  3Q0W A;  2MSY A;  2WAD A;  3G3Z A;  3FK7 A;  3L9F A;  1U2W A;  3OL4 A;  3SDB A;  4BL0 B;  2UV1 A;  5A2Q Z;  1UFM A;  1FC3 A;  2L9S A;  3LA7 A;  4B43 A;  4CXF A;  4FCY A;  5E8I A;  1Y0N A;  1BIB A;  1YJN I;  1OMI A;  3GTQ J;  2OV7 A;  3Q9S A;  3PNV A;  1W4M A;  1FWZ A;  2HVR A;  2MAB A;  1UB9 A;  3WU2 C;  1ODD A;  2OF7 A;  2ZJ2 A;  2IPQ X;  4A0Y A;  3BG3 A;  1J7K A;  1TQM A;  3MKW B;  4J19 A;  2KP6 A;  3HG9 A;  3QYF A;  3DLA A;  4MQV A;  1KYW A;  3V7C A;  5K5O A;  1TLH B;  2ZJQ F;  4EJV A;  4OIQ F;  1W0U A;  2DA6 A;  4HYE A;  1YJW I;  2Y69 H;  3I71 A;  2FE3 A;  3CJT B;  3I0T A;  5B1B H;  2R7S A;  2QQ9 A;  4L9V A;  5IOZ A;  1HSJ A;  3K4B A;  1Z6R A;  1QZE A;  4D7M A;  1E2X A;  1K4S A;  4EQQ A;  4HV6 A;  2YSR A;  3K2A A;  2G7U A;  4BKX A;  3GTG J;  5F0F A;  1TW3 A;  3Q0U A;  4AIJ A;  1IN7 A;  1MBJ A;  1IRX A;  2Y0S N;  1STZ A;  3UNG C;  3DCF A;  3Q3S A;  4L5E A;  2ZBK A;  2O8K A;  5D5V B;  3ONQ A;  1AA7 A;  3EYI A;  3V7R A;  2WAQ N;  4L18 B;  3A01 A;  1FNN A;  2OAZ A;  4M73 A;  3W6J B;  3GW2 A;  1BM9 A;  3RZD J;  3WTT C;  4XN3 A;  3Q9V A;  3H36 A;  2LH9 A;  3WTW C;  1X2N A;  1NHA A;  3TDZ C;  4IRG A;  1Z91 A;  1R1U A;  2DT7 B;  2AXT C;  3QP6 A;  4OIO F;  2PX9 A;  2ZC2 A;  1XGM A;  3CCU I;  1Z77 A;  1R7J A;  3ZN1 A;  3CES A;  2JUC A;  2A07 F;  1YE9 A;  3HM5 A;  5CJ9 A;  1PP7 U;  5KAF C;  3LNQ A;  1NTC A;  2RKH A;  2CO5 A;  1YG2 A;  3H9G A;  1WJE A;  3V4G A;  2F5V A;  2VPR A;  4IZZ A;  1FSE A;  1UG0 A;  3DTK A;  1FY7 A;  3RZO J;  2Q0O A;  2K4J A;  1XGS A;  4XOT A;  3CO6 C;  1Q1H A;  3O6B B;  2LC2 A;  3TO9 A;  4BHC A;  3Q5F A;  3JRA A;  4CUG A;  2W82 A;  2BY3 A;  3REO A;  5C4J J;  3TDU C;  1BL0 A;  3O3K A;  2VE8 A;  3ZMV A;  4RGU A;  3FXU A;  3S2H J;  4HF1 A;  2ZCW A;  3FBI B;  2XRL A;  2ZKZ A;  2ISY A;  4QIW N;  1FJL A;  2ELJ A;  1QGP A;  2B9S A;  2RRE A;  1ZN2 A;  2EIK H;  4F92 B;  4IJA A;  1FBS A;  2XGC A;  4LGW A;  1UJ8 A;  3JW4 A;  1EF4 A;  1PDN C;  2NVX J;  2RNJ A;  3CC2 I;  1ITY A;  1X1B A;  1FP2 A;  3SFZ A;  1LVA A;  3WE2 A;  4JX4 A;  2DA2 A;  4DYR A;  4W1U A;  1YHQ I;  3QYE A;  1PVE A;  5GAD J;  4G6T B;  2IS2 A;  2KIM A;  2H6B A;  2FXA A;  4JYK A;  2OU2 A;  3IHU A;  2AQE A;  3GWZ A;  3WU0 A;  5K1Y A;  3HOU J;  2JA7 J;  1X3U A;  3OS0 A;  1KU3 A;  4WF2 A;  5FKN A;  1WVR A;  2KMU A;  2W24 A;  3KFW X;  1PUF B;  2XPU A;  3U2R A;  1QU3 A;  5DUI A;  4BAC A;  3ROU A;  4IHT A;  1YRN B;  2DW4 A;  3F0C A;  4M3E A;  2KIQ A;  4Z6Y A;  2EZK A;  2M30 A;  3PUB A;  4AIK A;  5IT9 K;  3PSF A;  4RB3 C;  4E7I A;  4A3E J;  1R6R A;  4M3F A;  1QQI A;  2DMT A;  2E36 A;  1AKH B;  1FOW A;  1MSE C;  4ENJ A;  2EA4 A;  4CO8 A;  3RKY A;  4HNU A;  3BOQ A;  3ABM H;  5FO5 A;  2FRH A;  3TOB A;  2WY7 Q;  1MZB A;  1WH7 A;  5D4R A;  2L7M P;  4Q5S F;  4E7Z A;  4DNC A;  4GFB A;  4IQ4 A;  2YU9 J;  5B1A H;  5IP6 A;  2KRH A;  4FE4 A;  2DYR H;  1MBK A;  5AON A;  2RQP A;  3LFU A;  2E1O A;  1JTY A;  1SAX A;  2LKP A;  3H9J A;  1QNT A;  2V1N A;  1SD6 A;  4NHJ A;  2NS7 A;  3JTH A;  3F8N A;  3U9G A;  3BG9 A;  1MH4 A;  3DV8 A;  3GVA A;  2PMH A;  4P1W A;  4M9Z A;  2DAO A;  5K7Z A;  1F36 A;  1TT0 A;  3I55 I;  1BJA A;  2QF7 A;  1YS6 A;  3WOD F;  4IL6 C;  2CSO A;  2KDO A;  2H09 A;  3PNT A;  3WG9 A;  1WJ5 A;  3C2B A;  1USS A;  4BAY A;  1WJD A;  1LB2 A;  3RYR A;  3EDP A;  4IHS A;  3K69 A;  3OR1 C;  4BS9 A;  1X19 A;  2R7Z J;  5JLW A;  1T95 A;  3QQA A;  1TWH J;  1K7A A;  4L9J A;  1BI3 A;  3SEZ A;  4KIS A;  5CVR A;  3S3M A;  4JX5 A;  4Y33 A;  3MKZ A;  2FBI A;  5JR3 A;  4IRH A;  2TCT A;  1YW8 A;  1BR4 A;  3QU6 A;  1R1T A;  1A35 A;  4DBR A;  2HQN A;  3JTG A;  1MNM C;  1K78 B;  1A31 A;  5D5U B;  3OIP A;  3DBR B;  3HSE A;  3VEP A;  1G3Y A;  1VI0 A;  4LFU A;  2V6C A;  1WKM A;  2EQR A;  3ZRG A;  5LHG A;  2L7Z A;  1MMS A;  3SZP A;  5IYC J;  4PFO A;  2XGX A;  1TNS A;  4IO9 F;  1LDJ A;  3FIW A;  2M1B A;  2CYY A;  3CJQ B;  3GFI A;  1HW1 A;  2XIG A;  2ZFW A;  3VWB A;  3HKZ N;  2X9D A;  1F4K A;  2J5O A;  4UUS B;  3HRS A;  2LY2 A;  1Z67 A;  2IA2 A;  2JVH A;  1JKP C;  1I5Z A;  5IYD J;  1JXS A;  4HLX A;  5CVU A;  1MSF C;  1R23 A;  4H0E A;  4XRM A;  2WB1 N;  3R4K A;  2BY1 A;  1YX3 A;  4I09 A;  2P5L C;  1IRG A;  2M7B A;  3KLO A;  2BEO A;  4RM3 A;  3CUQ B;  3HRT A;  5JLX A;  1OCZ H;  2DA7 A;  3L2V A;  4G6D A;  4G7Z F;  4S04 A;  1FTT A;  4BXF A;  4YG2 F;  5EGO B;  1PUF A;  3HRU A;  1JGS A;  2FU4 A;  5E1W A;  1YRN A;  3BCA A;  5JHF A;  3WE3 A;  2EBI A;  3I58 A;  4G7O F;  4KIF A;  1P9Q C;  4JBA A;  3IH3 A;  1R1V A;  2D1H A;  2DI3 A;  3GZ5 A;  4RAF A;  4XL9 A;  3KYL A;  1AKH A;  2VIX A;  3DP7 A;  1HLV A;  1JHF A;  2FQ3 A;  2A6H F;  2LTP A;  3V7S A;  1JT0 A;  2M34 A;  5KVR A;  3ZQ7 A;  4PGG A;  2LLK A;  3BTI A;  1QHH D;  3RPQ A;  3PNY A;  1VQ5 I;  1G2H A;  2IW5 A;  3P9I A;  2DA4 A;  4M3B A;  1DU0 A;  4BQQ A;  1QRY A;  1RC9 A;  3J7Y J;  4AVP A;  3OSF A;  1O3Q A;  2X6W A;  4ENM A;  1R36 A;  1SVL A;  3BQY A;  4CIC A;  1N75 A;  3IRR A;  4A3K J;  3HUG B;  1JJ8 C;  2A69 F;  1XSX A;  2XKO A;  2EIN H;  4NNJ A;  5DYM A;  1TW2 A;  1R49 A;  1Z3X A;  1ZK8 A;  3IWF A;  2DJN A;  2ME6 A;  3HZJ A;  5F0H A;  3AL0 B;  1LKX A;  4E7J A;  4RDU A;  2QKM B;  3HOY J;  2IT0 A;  1ZRF A;  3RIR A;  3BJA A;  3KZY A;  2DLL A;  1R22 A;  3R6S A;  1BIA A;  2HTS A;  3A4C A;  1V3F A;  2XPW A;  2V9K A;  3ECO A;  2M45 A;  1XPX A;  2L3D A;  4JK1 X;  4A6D A;  3G6E I;  2P0W A;  3DF8 A;  3OIQ A;  2FOW A;  2IP2 A;  2BZT A;  4MO7 A;  1G4D A;  2VUM J;  2RAE A;  4C3I J;  1Z3Y A;  3B02 A;  1RIO H;  2ZME A;  2R92 J;  5F6F A;  3EUA A;  3L2W A;  2EJR A;  4AID A;  5FKM A;  3K9T A;  1T0F C;  1L3L A;  5GPC A;  2J5P A;  4MNU A;  3FXJ A;  2CV0 A;  2F4I A;  1Z0X A;  1ZGA A;  1RKT A;  3GTM J;  1JKO C;  2XB0 X;  2KLO A;  2F5C A;  2UWM A;  1VQO I;  3CCR I;  1RUN A;  3F72 A;  3S2D J;  1MKM A;  1Z9C A;  2R7T A;  4I2O A;  2FNA A;  2NS8 A;  5LBQ A;  2FUG 2;  3NEU A;  4UUS A;  5GTI C;  2ZXH A;  5HS7 A;  1QBJ A;  3NWS A;  3QPL A;  2IS4 A;  1OCO H;  3HHH A;  1X3W B;  1WWX A;  2FQ4 A;  3IUO A;  3J7A Y;  4AU7 A;  3CC7 I;  3ZP5 A;  1S72 I;  4V2F A;  4CCJ A;  2FBH A;  4LK0 F;  1SD5 A;  3FXQ A;  2HKX A;  1GV5 A;  1IZ1 A;  3CUQ A;  4LG3 A;  1FIP A;  2KRC A;  2KQR A;  2XRO A;  4EAT A;  5C44 J;  2CUE A;  2FBK A;  3BZK A;  3KCC A;  5EGO A;  3JSP A;  1X4O A;  4RS8 A;  2ECB A;  4E7S A;  2L5Q A;  2W48 A;  4IHV A;  1I1S A;  1FMV A;  1XMX A;  2ID3 A;  2VQL A;  3FF5 A;  3TP3 A;  4QSH A;  5HLI A;  1OQY A;  3KEQ A;  5H6Q A;  4HDV A;  2KZV A;  2V7F A;  2R0Q C;  1X58 A;  3L2R A;  2V9P A;  3FKI J;  3BZ6 A;  4HV5 A;  3TOA A;  2LOO A;  1D1A A;  3MMY B;  2VXD A;  2Y75 A;  3A2K A;  2R5Z B;  1BI2 A;  4LG0 A;  4L0Z B;  3Q0V A;  4ANJ A;  1SFX A;  3VSL A;  4EM1 A;  4KIG A;  1T38 A;  2GXB A;  3HUG A;  2A68 F;  2L2O A;  1W7P D;  3DTI A;  1T39 A;  2DT6 A;  3TW7 A;  2EV5 A;  3E0J B;  2DJI A;  2LSO A;  2DFE A;  3EUK L;  1J0R A;  2V79 A;  2HEO A;  3GTL J;  2R7V A;  4XOR A;  3M8F A;  5IYB J;  1HDP A;  3HPH A;  2VJ5 A;  5E20 A;  1ZH5 A;  2CW8 A;  5EEG A;  1AOY A;  4CYC A;  1P7I A;  5M5X J;  1E3O C;  2HDW A;  4ABZ A;  5HOD A;  2ZO4 A;  1XDS A;  2EFP A;  4UUT A;  2R7U A;  1G59 A;  2EZL A;  4XLC A;  4G9Y A;  2XAG A;  2E1C A;  3PO3 J;  3R0A A;  2R7Q A;  5K5Q A;  4YEJ A;  3ELK A;  3HPG A;  3QWL A;  3CDH A;  1A6Q A;  2WWY A;  5BNG A;  1QHG A;  2DFF A;  1U0J A;  1XCV A;  2DDA A;  2LRE A;  4LLG F;  3IKT A;  1JI8 A;  4B44 A;  4BU2 A;  1A04 A;  3WG7 H;  3ZMD A;  3DXJ F;  2QSH X;  9ANT A;  2KT0 A;  3C2G A;  2W00 A;  1B8I B;  4A69 C;  3MKY B;  3BJO A;  2LP0 A;  3DKW A;  2E1M C;  2F2E A;  1FSH A;  1E3H A;  4DBQ A;  4WXC A;  4RLF A;  3F22 A;  1BN5 A;  1JTX A;  1IDY A;  1OKR A;  2HWV A;  2P4W A;  2XPV A;  2Z9O A;  5D6F A;  1WRJ A;  1FT9 A;  2VJJ A;  1MD0 A;  3H5N A;  2HFH A;  2HVS A;  2QSG X;  4JX6 A;  5CVI A;  2GXA A;  3FK6 A;  4UB6 C;  1E0E A;  2JPB A;  4XR6 A;  3KLN A;  2K85 A;  2FD5 A;  2M3A A;  2VXZ A;  4BXX J;  2WY8 Q;  3QAH A;  4HDU A;  3RI4 A;  1LEA A;  4I01 A;  4MEY F;  3F8B A;  4C30 A;  2MH9 A;  2E2J J;  4LB5 A;  4HX8 A;  1U5T C;  2CV2 A;  5BQT A;  4KYW A;  3G1O A;  1K4T A;  4LOC A;  2DMP A;  3E7L A;  2ZJR F;  2LD5 A;  2GA2 A;  5KK1 A;  1P4W A;  2FNP A;  4C3J J;  3HSF A;  2VPL A;  1F43 A;  1DP3 A;  4KMU X;  2ACJ A;  2JQ7 A;  3H5R A;  2QM3 A;  2CUF A;  2WB1 A;  2WTE A;  4J01 A;  2P81 A;  4HNT A;  1V5F A;  5FD6 A;  3RTR A;  3OYE A;  2P6T A;  1MJA A;  1TZL A;  2JN6 A;  4BY7 J;  3ULQ B;  2CH0 A;  2KRF A;  4N4N B;  1MBH A;  5LRS A;  4F52 A;  3WU1 B;  2ESH A;  2RDP A;  1SFK A;  2LFB A;  1R4M B;  1SD7 A;  2M5W A;  3QPH A;  2KIF A;  4EGZ A;  1IAW A;  4L5I A;  5FFZ A;  2R5Z A;  1BA5 A;  5BPD A;  4ESJ A;  2VN2 A;  1YI2 I;  1JKR C;  1YW9 A;  5E3O A;  2ZSI B;  1TP4 A;  1D8J A;  2E71 A;  4Y4R A;  4OIR F;  2Z33 A;  1Y6I A;  1ZR2 A;  2CQQ A;  1K83 J;  3K70 D;  1T6S A;  2ZNZ A;  1R5I D;  3JRF A;  2KL4 A;  3DPT A;  2X1E A;  4X6A J;  2VBW A;  4M71 A;  1D0Z A;  1GXQ A;  2W84 A;  4WCG A;  2AXL A;  5D5X B;  2LF7 A;  3LST A;  5E79 C;  3ISP A;  4A0X A;  2WV1 A;  4B3A A;  2R5Y B;  3F8C A;  2B7E A;  1HXD A;  4X1E A;  3PSI A;  3T8R A;  2MGQ A;  2CRG A;  3OYG A;  5J47 A;  2EIJ H;  4FET A;  1GVJ A;  1BC8 C;  2R7D A;  1SVM A;  5L3D A;  5K5R A;  3N05 A;  1F1Z A;  2YR2 A;  3GZ6 A;  2W1O A;  3BDD A;  2YUS A;  1KON A;  1R5G A;  3PFI A;  4FE7 A;  4Z2Y A;  3OYB A;  1DDN A;  1QVT A;  1R9T J;  3EUH C;  1ZTR A;  4NC8 A;  1R4N B;  1XMA A;  4FIS A;  3C7J A;  4PJM A;  3KP6 A;  4WX9 A;  3K1P A;  3RYP A;  3F9K A;  1UAA A;  4EV0 A;  3K4J A;  4RB2 C;  2KDZ A;  5M5Y J;  3F6O A;  3D5S C;  3RKQ A;  2JA8 J;  2VBZ A;  4XID A;  4A6E A;  2CQ7 A;  1B8I A;  2LK2 A;  2Q8K A;  1YIJ I;  4DW6 A;  4BYY A;  2F48 A;  2FOK A;  1GVD A;  1XX5 A;  4RBO A;  4ZTF A;  3ASN H;  5C3E J;  4C2T A;  2TDX A;  1VQP I;  2OTL I;  1FEX A;  1UHS A;  2LKS A;  2MYS A;  1BR2 A;  4IEJ A;  4PZJ A;  1SEU A;  1I1G A;  2B0L A;  4P96 A;  2PN6 A;  2RV8 A;  3P7N A;  1ETW A;  4OAZ A;  2HYJ A;  1GV2 A;  3S14 J;  2Z16 A;  4KIT B;  2BE5 F;  3CCM I;  2EFW A;  5CVJ A;  1DGR M;  2JRM A;  2GLO A;  1ULY A;  2CW7 A;  5J1U A;  3CMY A;  1MIJ A;  4Y7N J;  1EH6 A;  1XCB A;  1MGT A;  4ZDL A;  4XLH A;  2IGN A;  4L5J A;  3DFG A;  1GLN A;  4XQF A;  2DA1 A;  2W85 A;  2EB7 A;  4XNF A;  1VQK I;  4IHW A;  1GUU A;  1M1E B;  3BR0 A;  2CQX A;  1X4P A;  1X1A A;  2DMU A;  4FQG A;  2MD5 A;  2NNY A;  4CA0 A;  2O3F A;  1WI9 A;  1IGN A;  1VTN C;  1SMY F;  4IHY A;  2M8E A;  3S3N A;  3VYS B;  5LRR A;  1XD7 A;  2COM A;  3CDL A;  3D0S A;  4BH9 A;  3S1M J;  4C3H J;  4BQN A;  1TL8 A;  1ZHF A;  2AHQ A;  2ID6 A;  2XAJ A;  4V2G A;  2IXS A;  3D5R C;  3TED A;  2N8G A;  1J75 A;  5HS8 A;  3J7Z I;  3F8F A;  3FHN A;  4GXO A;  2MC4 A;  2IVM A;  3ABU A;  2KFD A;  3I4P A;  1C0W A;  2GZW A;  3IV5 A;  4P5O A;  3I4N J;  1P4A A;  3V8K A;  3VFZ A;  4A3I J;  3GTK J;  3JAM K;  1LE8 A;  1YX5 A;  4U88 A;  2XGD A;  2Z5U A;  3CO7 C;  2JTV A;  4L9N A;  3ERE D;  2VE9 A;  3OY9 A;  2RNG A;  1XDU A;  3OYA A;  2VBX A;  4Q47 A;  4KT5 C;  3FHZ A;  1W5T A;  5DCF A;  2R5Y A;  4HF2 A;  2YX4 A;  4F7Z A;  4HG2 A;  1G3S A;  1JT6 A;  2DK8 A;  4RB0 A;  4EJO A;  2RN7 A;  1XG1 A;  1HKT A;  2LVS A;  1VF9 A;  2E34 A;  4BBS J;  4I7H A;  5BMZ A;  3HHG A;  3PM1 A;  5DDG A;  4AYB N;  4MTD A;  3TO7 A;  4PJJ A;  4A3F J;  2FF4 A;  2QZ8 A;  1D3Y A;  3GFL A;  3O8G A;  3L09 A;  4PJN A;  3CUO A;  1FBU A;  3S93 A;  2HQA A;  1W36 D;  2XV4 S;  1FYM A;  2DU9 A;  3ZMZ A;  3E1S A;  4CSW A;  5LGU A;  1ONV A;  1IXC A;  3CLO A;  3CLQ A;  3BT9 A;  1A5J A;  2Y9Y A;  1JUS A;  2QEX I;  3WTV C;  1RKW A;  3L2C A;  2M2E A;  3U1K A;  3GXO A;  2XAH A;  4LIU A;  4KMF A;  3TQN A;  2EZH A;  1MW7 A;  3CD6 I;  2MD0 A;  1B4A A;  5J8C A;  4XRF A;  1V4R A;  3ZR8 X;  1TNT A;  3JRC A;  4NQW A;  4OU0 A;  2GA1 A;  1TTY A;  4LLL A;  2M0C A;  2M8G X;  2EZI A;  4PFP A;  3HOZ J;  1VQ7 I;  2M9H A;  3HIF A;  4GRI A;  4H4K C;  2Y9Z A;  2HDC A;  2IAI A;  3BTC A;  3ZN0 A;  2C6Y A;  3SEQ A;  3GTP J;  2ECC A;  1T33 A;  3BTL A;  1O57 A;  4LLN A;  4W97 A;  3TGN A;  1W36 C;  2UUZ A;  2V6E A;  4CDG A;  1ZR4 A;  1WZ2 A;  3G71 I;  1GXP A;  2EPF A;  1RES A;  3BPX A;  2KPM A;  3FXM A;  3RJP A;  1F9N A;  2VQG A;  1QPI A;  5DTD A;  4ZTJ A;  2EFQ A;  3JRE A;  2QUF A;  4BDZ A;  2QKL B;  3W3C A;  2UZK A;  3CMM A;  5B5E C;  2ETH A;  2UXN A;  2ZFU A;  4LIV A;  5DD8 A;  2OQG A;  2E5Z A;  2PI0 A;  1UHW A;  3J80 K;  3BY6 A;  3LA3 A;  4M9S A;  4IQJ A;  4HW0 A;  4ZDP A;  2CMP A;  4XRS G;  1U78 A;  1MH3 A;  4LJZ F;  1H9G A;  1ZAR A;  2A61 A;  3V8J A;  1ZYR F;  3L1P A;  1BW5 A;  3S1R J;  1QPM A;  1X1C A;  2QVO A;  3BLY A;  3MKL A;  5F08 A;  1YYV A;  3PL8 A;  2V1D A;  4UVC A;  1I3A A;  1FPQ A;  4B48 A;  4U0Y A;  2XDV A;  1O7F A;  5E1Z B;  3LSG A;  4NDL A;  5ILS A;  4UB8 C;  5M3M J;  2H8W A;  2ISZ A;  2CU7 A;  1P92 A;  4KIB A;  4PK4 A;  4XK4 A;  3JRH A;  1T8I A;  4HEA 2;  4M6Y A;  2YPR A;  4XLE A;  2ZME B;  5FB2 A;  1QZZ A;  2IEK A;  4RB1 A;  1MJB A;  1B72 B;  4P55 A;  3SXY A;  2Q2E B;  3E6D A;  2XAQ A;  3MN2 A;  3K4L A;  5D8K B;  3FXK A;  1ETK A;  4CGZ A;  2X0L A;  3SZG A;  1FYL A;  3MD2 A;  4DIQ A;  4DJA A;  2FX0 A;  3KYD B;  4UXN A;  1Z7L A;  2CQN A;  3M8J A;  4O3M A;  4LD5 A;  1IXS B;  3I3L A;  3H92 A;  4A93 J;  1QZY A;  4GO1 A;  4CHU A;  2K9L A;  3MEX A;  1HKS A;  3R0J A;  4UV8 A;  4ENK A;  1BC7 C;  2H6C A;  3LFK A;  1Z6T A;  4UV9 A;  1I50 J;  3BG5 A;  2K9M A;  3HSR A;  4UVB A;  1WJB A;  1LDD A;  4NBQ A;  3ZMS A;  4ZYA A;  2VT2 A;  2VAS A;  4A3G J;  2JT1 A;  3RDI A;  2YX7 A;  4IKF A;  1VQL I;  4ZDO A;  2PMU A;  4U7B A;  3LMM A;  3OOU A;  1ZRC A;  3I53 A;  1B9M A;  1Y8R B;  5KAI C;  3QPT A;  1WI3 A;  1L0O C;  3BRO A;  1EKE A;  2VC0 A;  5GAE J;  1UST A;  2YU3 A;  3IKV A;  4GCV A;  1LEB A;  1YO5 C;  4OAY A;  2IGM A;  1ZRE A;  5B3S H;  2HS5 A;  1RUO A;  1X3Z B;  3MAJ A;  4HF0 A;  4B3X A;  3PJR A;  2VBY A;  2CWE A;  2I8D A;  1T0F A;  2E19 A;  2CS3 A;  2W25 A;  2DCE A;  4PGH A;  3PUF A;  3WGI A;  1EH8 A;  2XSJ C;  3G73 A;  4BE2 A;  1WJA A;  2DQR A;  4BY1 J;  1P6R A;  3FXO A;  2PMZ N;  4HBL A;  4XKW A;  5H20 A;  5GAG J;  5ICF A;  3J81 K;  4LG0 B;  1WGX A;  4OMY A;  3ABK H;  4YFX F;  1E17 A;  2IS6 A;  3RPU A;  4HX7 A;  4Y15 A;  3RQ4 A;  2MBF A;  2K86 A;  4E70 A;  2ICW G;  1ZGW A;  2K40 A;  2ZNY A;  3L2Q A;  4E7H A;  3OYF A;  1R58 A;  4YEL A;  2BY0 A;  3BR6 A;  2K27 A;  4S0H B;  5JHU A;  5L3E A;  2Y0S A;  5H2F C;  2Z99 A;  3T1B A;  4A5N A;  4BHP A;  3JRD A;  3JRG A;  4RLQ A;  3S16 J;  2DT5 A;  3MFK A;  4HLY A;  4F93 B;  2FMY A;  3OYD A;  3K0L A;  2O7O A;  2V26 A;  2W57 A;  1BI0 A;  2D45 A;  1ZQ3 P;  1LFB A;  3RKX A;  2WAQ A;  4M72 A;  3DKX A;  3R61 A;  1HDD C;  4CYC B;  1D0Y A;  4EJT A;  1MMA A;  4CCK A;  2QSF X;  3ERM A;  2JSP A;  1Y8Q B;  4ZYG A;  3S1Q J;  4O6J A;  3U21 A;  4AVZ A;  1KGS A;  2JA5 J;  1S6L A;  5EYR A;  2HXO A;  2XVC A;  1AWC A;  5A2Q K;  4X0G A;  4AWX B;  2BV6 A;  3D1N I;  2I10 A;  3S15 J;  1S9H A;  2RC4 A;  3CCY A;  1T98 A;  1KU9 A;  1XB4 A;  4PSX A;  4BE1 A;  1XC5 A;  3I5U A;  3HRM A;  2L9R A;  2DA5 A;  5HDK A;  1H89 C;  2DMN A;  2LDU A;  3KZI C;  1B72 A;  1D5V A;  1K6Y A;  4HST A;  1BBY A;  4BQO A;  4OIP F;  2Q2E A;  5BPI A;  3DPU A;  2R3S A;  2LBF B;  2GAU A;  5J3L A;  3CF2 A;  2JRT A;  3HEF A;  4PSW A;  5HVQ C;  3A03 A;  4ENN A;  4YFK F;  2VOD A;  3NQO A;  3WTZ A;  4CZC A;  1CGP A;  3VYR B;  2BBY A;  1I3Q J;  2M87 A;  4L0Y B;  3GO5 A;  4CCN A;  1LFU P;  2A05 A;  3JAM Z;  2X85 A;  3LAJ A;  2W4S A;  4ON0 A;  4MFD A;  2BW3 A;  2HGC A;  2DOA A;  2YS9 A;  2R7R A;  1IRF A;  3OS2 A;  1TQP A; 
#chains in the Genus database with same CATH homology
 2EIM H;  1OCO H;  1OCZ H;  2ZXW H;  3AG1 H;  2Y69 H;  2EIJ H;  2OCC H;  3AG4 H;  5B1B H;  3ABK H;  1OCC H;  3AG3 H;  3ABM H;  5B3S H;  1V54 H;  2DYS H;  1V55 H;  2EIL H;  5IY5 H;  2EIK H;  3ASN H;  3WG7 H;  3AG2 H;  2EIN H;  1OCR H;  5B1A H;  3ASO H;  3ABL H;  2DYR H;  3X2Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...