2EIKH

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eikH00
3AG4H 2EIKH 2OCCH 2EINH 5B1BH 1OCRH 1OCCH 1V55H 2EIMH 3AG2H 3ABLH 3ABMH 3WG7H 2EIJH 3ABKH 3ASOH 1OCZH 2ZXWH 5IY5H 2DYRH 3AG1H 2EILH 3AG3H 1V54H 2Y69H 1OCOH 2DYSH 5B1AH 5B3SH 3ASNH 3X2QH
chains in the Genus database with same CATH superfamily
4DNCA 2V79A 1XG1A 4GFBA 1LUJB 1Z21A 4PUSA 5KCMA 1GDTA 2V6EA 2AQFA 4HDVA 3T1BA 1MMDA 2UZKA 3HRTA 1W4MA 3PQJA 3HOVJ 2X6XA 3CP2A 4W1UA 3N97A 3E5QA 2DN0A 2BEOA 1I50J 5F08A 1QHHD 1OKRA 2ZJRF 3S3MA 4H4KC 2KLOA 1R22A 1WJ5A 5LD2C 2Y0MA 3U1KA 3GTKJ 4IQ4A 1JGGA 2CQNA 2JUCA 2N8GA 4M6XA 4MIMA 2XKPA 1ZAOA 1AKHB 3FBIB 5F1RA 3S1MJ 3GZ5A 4UHTA 2V6CA 3KEOA 2AHQA 4Q48A 4BKXA 2QKMB 3PM1A 2HDCA 5EYRA 2FBIA 2HTSA 5KAFC 1MBEA 2OV7A 1VZ0A 1TNSA 1O3QA 2VKHA 5IY5H 3OR2C 3TDUC 2MFZA 5HS9A 2EILH 1G3SA 1VFCA 3E5XA 1I3AA 3GTQJ 2EJRA 4ENKA 1IO2A 5H6QA 3ZMUA 2AQEA 3M9AA 1LEAA 1UHSA 1QNTA 1MNDA 4L18B 3M8FA 1YX5A 2X4HA 2FSWA 4AVZA 4MQ9F 2EFNA 3WG9A 4E4HA 1R49A 1DU6A 4KT6A 2F5VA 4CCJA 4ON0A 3OIQA 3LSMA 5H2FC 2R7WA 1FC3A 3RPQA 4CCNA 2LD5A 3KP6A 2IW5A 3JRAA 2ZMEC 1Y56A 2DYRH 2J5OA 1MJAA 3F21A 3NEUA 3HTSB 2DK8A 3MCZA 3QP6A 3BPXA 3WODF 5ILVA 1VQ9I 1ONVA 1VTNC 1P4WA 4HSRA 1J59A 1F1ZA 2W57A 3G1OA 3I64A 4IL6C 2E1OA 2QZ8A 5EG0B 3WTZA 1A6QA 1JUSA 4PJLA 3I0TA 1BW5A 3RJPA 3K7AJ 4M71A 5DCMA 5CVJA 3K1PA 2VT2A 5EZHA 4RM2A 3CCRI 3RTRA 1WH7A 3ZN1A 3Q9VA 1O57A 2DQLA 2DA4A 2ZXWH 3BQZA 3I53A 3UNGC 4A0YA 4RGXA 2CRGA 2IJLA 3LFKA 5FFZA 2QM3A 2ZMEA 3I5UA 4OU0A 2EPFA 3V8JA 3VYSB 4B47A 1FBUA 5LLQA 1WRJA 1JKPC 1JJ8C 2X1EA 2W82A 5HDNA 3JRFA 2VT3A 1ZG5A 2EIMH 4U0WA 4E7ZA 3CCQI 4BJTA 3HDDA 1MNMC 1G2HA 1SVMA 4YIIA 1SFOJ 2WV1A 2QQ9A 2P5VA 2XAHA 2JTVA 3G3ZA 3T8RA 4NC8A 2HQ5A 2EZIA 3RKWA 5LGTA 4IZZA 1XMKA 3M1EA 1P2FA 3EUHC 4LLLA 4XLPF 1U0JA 2ZJPF 1APLC 3E97A 1ZK8A 3S15J 3RKXA 1NK3P 5BOXA 2V1UA 1IXRC 3K4KA 4BQAA 1LE8A 1O4XA 2Y48A 3QU6A 1Y1VJ 2WAQN 4LMYA 1LDKB 2EZLA 4P96A 4F3QA 4UUTA 2JQ7A 1YW9A 3TBIA 3FXMA 4O3MA 3S32A 1K79A 3FXKA 2BXZA 3BCBA 1OCZH 3A01B 3SXYA 4KNYA 2ELKA 3U2RA 2DOFA 2Y0SN 4C2MJ 1UHMA 2KIUA 1QRYA 2K27A 3BJAA 2VN2A 4DZPA 2ZNZA 4Q5SF 2A5YB 4PJJA 2LNBA 1VI0A 3WTUC 1ZLKA 4BHPA 3DPTA 2HU9A 5FKMA 3IUOA 1IZ1A 4BQOA 4ABZA 3JR9A 2EBIA 2VJ4A 1OR7A 3L2WA 3HXLA 2X1CA 4KN4X 5L3EA 2BW3B 4YG2F 3WG7H 4D1QA 1F36A 5J4YA 4IHVA 4XSZF 3SJMA 1LKXA 1KZHA 3HSRA 2OQGA 3ESWB 1U8RA 1Z7LA 2K40A 1K6OA 2PBIA 2LY1A 2EV0A 3C2BA 1ODDA 1T0FA 2L7MP 4P1WA 2FBHA 1ZYRF 2HNHA 4HSTA 2VJIA 2YUSA 2YS9A 3N4MA 5J6XA 1H89C 1R1UA 5E3LA 3WU1B 5GTHC 3KYLA 2W48A 4I2OA 4ZDOA 1T56A 2MH2A 3BR2A 3E6CC 1TWGJ 4B1RA 2XKOA 2JPBA 4A3FJ 4CSWA 4M74A 3R0AA 4D9JA 4AU7A 4MO7A 1EA3A 1L3LA 3MKWB 2P5LC 1W5CC 5ED4A 4R1HA 2PJRA 2XC7A 1LJ9A 3LAPA 2XV4S 4G94A 3OYFA 3CJQB 2Y31A 3GTJJ 5D5UB 2EWNA 1Y1WJ 3M1CA 3ULQB 2TDXA 3HSFA 3CC2I 2ZKZA 1YG2A 4L9VA 4EGYA 3K4BA 3CUQC 4D7MA 5GAHJ 1YJNI 1D8KA 1OQYA 1T08B 5FKLA 1USSA 2NVUB 2AXLA 4CO8A 5D8KB 3MKYB 2XPVA 4HF2A 4NQWB 4UB8C 3J7AY 1OYYA 2L3DA 4ZC3A 1TT0A 2FUG2 2NYXA 2FJ1A 4NNJA 1P6RA 4ZDLA 1YFHA 2HQAA 1Y8QB 3K4NA 3OWTA 3LSJA 4RMNA 2H1LA 2X51A 1UELB 4LG0B 2L0KA 1QZYA 4B09A 4CCOA 1B6AA 4ZJZA 2STTA 2UV1A 3KX2A 5LHIA 4ZZDA 2PMZN 2Q2EA 5BS6A 3BROA 4JX5A 2GQQA 2JVGA 2V9KA 3LSGA 3H92A 4DJAA 1P7IA 1WJCA 2P7VB 3DLLF 2MC4A 4NHJA 2M7AA 2K4JA 4UNOA 2FX0A 1IN8A 4YIRX 1NTCA 1SD7A 2JZYA 1IUFA 3L7WA 3X2QH 2KDZA 4YIFA 4X0GA 3QYFA 2P81A 2Z16A 2LTPA 4XRMA 3C3WA 1XGOA 1OCCH 1XGMA 4UUSA 2CQKA 2NS8A 1SFEA 3DU6A 4OIQF 1IUYA 3SZGA 1BI1A 1YYVA 4BNCA 2VBZA 3CDHA 4DQ2A 3TOBA 3LMMA 4AIDA 3S2HJ 2LK2A 2L02A 2KIFA 3C18A 1J09A 3PSFA 1SAUA 1HKQA 2HOTA 2Z2SB 4LGWA 2B0LA 3KFWX 1HW5A 2CJJA 4N4NB 3LA7A 4RB0A 3CCEI 2LF7A 1KQ9A 1LVKA 3P5JA 2MLGA 3BQYA 3HSEA 3ABKH 3ASOH 3BZCA 3CLQA 3JSOA 1IN5A 2KHMA 1WJEA 2KDOA 1D8JA 1TWHJ 4PDKA 2GWRA 3TO9A 4Z2YA 4CUGA 3QWLA 2DPDA 3PNYA 3RQ4A 4TV7A 4YRVA 3OYNA 3DQVC 2AS5F 3FKJA 3HRMA 1W0TA 4IF4A 2IAIA 2OCCH 2V9VA 2CFXA 3ISPA 4DYCA 2DMQA 2Y30A 3OS0A 1T33A 2FXAA 2VBXA 3K1NA 4L9TA 2KP6A 5JHFA 3GUDA 2HR3A 3DF8A 3MQ0A 1YIJI 1RUOA 3L1PA 1FBSA 1Z77A 1QPMA 4B43A 3P9IA 2R3SA 4WK8F 2R5YA 2FF4A 1ZTRA 4PJ0C 1YITI 3B6CA 3BWGA 1FEXA 2ID6A 2HVQA 2LFBA 4IRGA 1R00A 5F0CA 1BOBA 1P7JA 3FBNB 2IS1A 3TO7A 2JK3A 4XKVA 3CZ6A 5C4JJ 5IYCJ 1Q1VA 1FY7A 1A04A 2OAZA 1MIJA 1SEUA 2OBPA 3B6AA 1D3YA 3ERED 3CCLI 3MAJA 5J1YA 3IRRA 4L9JA 3WU2C 1IJWC 1HW2A 5HS7A 5F27A 3DU5A 2F48A 4F52A 1PVEA 3ZR8X 5B1BH 4G7OF 3VPRA 2VKEA 2VB6A 2JWTA 2XAFA 4G6DA 3RZDJ 4BUPA 5FLMJ 3LFUA 5DCFA 3GWZA 1ZH5A 5CLSA 2FOKA 3FXOA 1WVRA 1X3WB 3TP3A 1U5TB 4GO1A 5J8FA 2M1BA 1EKEA 1RKTA 4OMYA 3GW2A 4EJVA 2VPRA 4IX7A 2DA2A 5LRRA 3TOAA 3DXJF 1NG6A 3DEWA 1GXPA 2VJJA 2Y69H 6PAXA 3WGGA 3RPUA 3OYKA 2LC2A 2BHYA 3ONQA 3WTSC 2XF5A 2ICWG 3CTAA 2IT0A 2JSCA 4KA4A 2V1DA 3FM5A 2EA2A 4JX6A 4AUXA 4Z6YA 1UFMA 2WBMA 3DV8A 1FT9A 3JRDA 5JI6A 1R23A 4M9XA 5DD4A 3DPLC 4E7SA 2P6SA 4LD5A 4A0ZA 1IN6A 3VODA 2LY2A 1D1AA 4FISA 4KICA 3OR1C 4LG3A 3CP8A 2DT5A 1H0MA 5GP9A 2E1MB 3IH3A 3E3VA 1LFBA 2K9MA 4CZCA 2YU3A 4X6AJ 3HUGA 3QPHA 1LB2A 5L3CA 3IP4B 4IHXA 3TKYA 1IXSB 4C30A 4MNUA 1N78A 3GFJA 3I59A 4ANJA 1ETVA 1RPWA 1T2KA 2IS2A 1DQUA 3GMEA 1IF1A 2PQ8A 2R7QA 4XOTA 3LAJA 4KUMA 2QLZA 2G0EA 3GLXA 2DFFA 3BR5A 5FKNA 1GXQA 4KT5C 2VQLA 5EEGA 2CYYA 1LVAA 5LRSA 3JRBA 3Q0WA 4ENMA 4ZYGA 3K4MA 2FQ4A 2L2OA 3BLYA 1W7PD 5D5VB 1YO5C 1P9QC 3HRUA 3LQRA 2CW7A 4JBAA 3BT9A 3FK6A 3HOSA 5LHGA 3V42A 4AYBA 1UJ8A 3HGYA 1DDNA 5M5WJ 1IV6A 1B9MA 3LSHA 5A2QK 2D1VA 4F55A 3CO6C 1FMWA 4HV6A 1FOWA 4BXXJ 1FYKA 3I4MJ 1S7EA 5F6FA 3TL4X 5JVGF 3I4PA 1DP3A 3A03A 3C7JA 3MVPA 1I6HJ 3IWZA 3M8EA 2OTLI 2GM4A 5E18F 1HBXG 1Q1HA 5GAEJ 5K7FA 2FNAA 2Q0OA 1KYWA 1UHWA 3NQOA 4F92B 2GA2A 4QIWN 1TC3C 2A6EF 2RDPA 2DXIA 2K86A 4UVCA 1YOVB 3MEXA 1X58A 1IAWA 3HL2A 2DFHA 3VB2A 2UXNA 4U0YA 1OCOH 4F93B 1B8IB 4Y52J 5LEKA 4A5NA 2XIGA 1OMIA 4AVPA 3V4GA 3AG4H 3NARA 4L5IA 2IS6A 3JREA 1SVLA 4M9SA 1KONA 4PFPA 3F72A 4WXHA 4OIRF 5IT3A 5HVQC 1RNLA 3MZ8A 3GF2A 1UZCA 1ZQ3P 3QQAA 4KIBA 4WCGA 2R5ZA 1HA8A 3K4CA 2JRMA 2LBFA 2J5PA 3MWMA 5CVUA 1IV8A 2V26A 1ENHA 2H94A 2Q1ZB 2K9SA 4I01A 1WWXA 1Z05A 2JSPA 4YEJA 4QPQA 4U87A 1RC9A 2NVYJ 2HVRA 1BBYA 3DLAA 2M2EA 3ZGKA 1MMNA 2QYOA 2O6GE 3PO2J 3KLOA 1X1PA 2NNNA 2IVMA 2XB5A 3KP4A 3QRFF 2VE8A 1ON1A 3ZMSA 5CJ9A 2R7ZJ 5HNFA 1T98A 4B3XA 1BR2A 5LGUA 2E5ZA 5F0HA 2F6CA 4FX4A 5E20A 4HDUA 3AKZA 1I27A 4YELA 3HG9A 2KIMA 5IOYA 4V2FA 4V19K 1ON2A 4MHGA 3PO3J 2X1DA 2M45A 1O7FA 4GXOA 2HYFA 2HTJA 2QCOA 3M3YJ 5D4RA 1VQLI 1WJAA 1AKHA 1KQ8A 4XLFA 2H8RA 2QWWA 1WJBA 2EIJH 3CCYA 3ZMTA 2LSOA 4A3MJ 2PN6A 5A2QZ 4HF1A 1AHDP 4II2A 3RCOA 2DYSH 1Z0XA 3L2VA 3IKTA 3B02A 4L0ZB 4N9IA 5GADJ 1FTTA 1BIAA 2D1HA 3PL8A 3OYAA 4MEXF 1ZRFA 2JRTA 2NNYA 1UMQA 1A31A 3HTUA 3ZCOA 1X4OA 1X1CA 4XRFA 2BGCA 1Z9CA 3K4JA 4FE7A 5HLGA 3HPHA 4IRHA 3FDYA 1F4KA 3HIFA 1YRNB 3LA3A 2ZCWA 1OYWA 1V5GA 3ABLH 5ICFA 1LFUP 1H9GA 5CYVA 3I58A 3TGNA 3HZJA 2VQCA 2ZC2A 1Z3YA 3JAMK 4A12A 3JTGA 1K78B 2ID3A 2ZSIB 5JHUA 5CVRA 4EM2A 4HQMA 3WHCA 5IPAA 2VIXA 1WH5A 2VL8A 1MW7A 2IRFG 3CUOA 4XICA 4ZTFA 5TGTA 3ML6A 1MZBA 2IGKA 2MW8A 4B8XA 5DTDA 1G59A 2MABA 2NAZA 3HYIA 3RSNA 5EG0A 2STWA 2XASA 3VSKA 1B59A 4M9ZA 2HZDA 4BU2A 3ZQHA 3DBHB 3GXOA 1XMAA 1QZZA 2XAUA 1R9TJ 1K61A 4JYKA 5K5QA 3J7AO 2JVHA 3B73A 4HW0A 3E7LA 1QVTA 5L3DA 4GCVA 4A69C 4LFUA 3U21A 1YIOA 2RKHA 5E79C 2L7KA 2M4KA 2GXAA 2GZWA 3OYIA 4C9YA 2L01A 4B4CA 2RREA 5AONA 2Y9YA 2L4MA 1LNWA 3E0JB 3S2DJ 2O3FA 4XN0A 2UUZA 4A6DA 1STZA 3BJ6A 4RAZA 2MLKA 1I3QJ 4IHWA 3F8MA 3GTLJ 2IA1A 2QENA 4R79A 2UWMA 5FRNA 2R0QC 4HOBA 3C2GA 2HZTA 1K83J 3HPGA 3RYPA 4A93J 3I3LA 4HAMA 1N25A 1ZRCA 5IT9K 4RAFA 1PUFA 2FU4A 4BEHB 1JT0A 2GXGA 4HX7A 5E1WA 4BAYA 9ANTA 4R8HA 1YW7A 2ME0A 3H5NA 1QHGA 2H09A 4MEYF 1BOAA 2IXSA 2XPUA 3CLOA 4ENNA 2X9DA 2VBYA 3TEDA 5LBQA 3LNQA 3IH2A 1MBJA 2HXOA 1DUXC 1JT6A 2OQRA 4KMUX 3DKXA 3CCSI 1X1AA 3S8PA 4BS9A 2ESNA 5D4SA 2DPUA 1B9NA 1T6SA 2OJED 3PNTA 4EV0A 1CF7B 3QAHA 1OR7C 2CUJA 3R60A 5FLXK 4WX9A 2FD5A 2EV5A 2L9VA 4G9YA 2M8EA 2P5KA 3ZMDA 5DDGA 2VUMJ 3PQKA 3F9KA 3PNVA 1U8BA 1XPXA 5AIPA 3ZQGA 5F04A 2HDDA 3FZVA 2G7HA 2ZXHA 2QSHX 2RAEA 1WPKA 4M3GA 3JAMZ 1YW8A 1T0FC 3SEQA 2EFQA 4RDUA 4ZYDA 2AXTC 2ZMEB 2DODA 2M0CA 3RYRA 4IKFA 1HC8A 1ETQA 4DBQA 3ASNH 4B3AA 2A05A 1F5TA 3OYBA 3PFIA 1N75A 1UB9A 4BXUA 1AU7A 5LHHA 1J2XA 1Z3XA 3CC4I 3R0JA 2WC2A 2L5QA 4YFNF 1VF9A 3L2CA 2K9LA 3OYHA 1BM9A 1RZ4A 2MA3A 4M73A 3K70C 4XKBA 3V7CA 4GRIA 2OZ6A 3DTEA 4FTHA 2DK5A 3QPSA 2KRHA 4NDLA 5ILUA 3WTTC 1KU3A 3BOQA 4XMYA 4A3KJ 2COBA 4A5MA 2JA5J 4J01A 2CS3A 2Z5UA 1MMSA 3QOEA 1BR1A 5FFXA 1PJRA 3MZHA 1LE8B 1BC7C 4OWRB 3PJRA 1HF0A 2OF7A 4C3IJ 2WTEA 5HOOA 2RC4A 3OL4A 5F0FA 3W2VA 3WTVC 1H8AC 3ZN0A 4XBFA 2A07F 2MG4A 1KGSA 5KVRA 2DU9A 3A0HC 1SFXA 3IAM2 4NQWA 2OCEA 2XF7A 5E8IA 1N77A 3HGGA 2XUBA 4LITA 2JUGA 2RN7A 2E1CA 5B1AH 2DMNA 5IT9Z 3L9FA 4LG0A 2VPLA 5M5YJ 1JXSA 3O8GA 4ESFA 4FE4A 2HOAA 1S6LA 1FP1D 4G6QA 2KL4A 4MTEA 5HLHA 2E2JJ 1ZG1A 4GYIA 2KRCA 2XDVA 2L9NA 4HF0A 4ITVA 2ZNYA 2DMTA 3K69A 2W84A 4I09A 2QKLB 5FLXZ 1V5FA 1YTYA 1IG7A 3OSFA 3HEFA 5DV5A 4LK1F 3W6KB 3VOEA 5JLWA 3DCFA 1J75A 1BW6A 4PCQA 5BQTA 4OINF 4B48A 2HVSA 4RM3A 2HQNA 2JA8J 4BY1J 4G7ZF 4HV5A 4HQEA 3AL0C 3FKIJ 1VQMI 2NRAC 3MZYA 4HX8A 1W7PB 1R36A 1Z6RA 3I56I 2K3FA 1V4RA 1U6GA 2DMUA 3GBGA 2CGPA 3AG1H 1JGSA 2HWVA 1ETYA 3FXQA 2VBWA 3GLLA 5B3SH 5DM7F 5EGOB 3CJTB 1IRZA 1O7LA 4RB2C 5DYMA 1XB4A 2BVLA 4BJ5C 3FXUA 3U9GA 2DCEA 3IC7A 2NXNB 4PSWA 2L54A 3K0LA 4Y17A 1JUPA 1MMGA 1VQ7I 2KJCA 1E3HA 4JOMA 4EQQA 2PJPA 2OZUA 3GO5A 1RR8C 5K1YA 3W3CA 2NS0A 1IDYA 1SANA 2DA1A 1WJDA 1BJZA 2DA5A 2OD5A 2HYJA 4A3DJ 3H5AA 2NVTJ 3FXRA 4IOCF 2CG4A 5H6RA 5IOZA 4N9HA 2LDUA 2DFEA 4UV9A 1MH4A 2W25A 3BDDA 2BY3A 2HFHA 3HKZA 3TMOA 3CUQB 3JRGA 4C2TA 4MLOA 1V55H 1SD5A 2FEZA 3DWLE 2V9PA 4HLXA 3GYHX 1R4NB 5FROA 3CDIA 2PLYA 3H3UA 4J00A 4C2UA 4FHTA 1IDZA 2CV1A 1OFCX 2P8TA 3SDBA 2O0YA 2F4IA 3LOCA 4HNTA 3RZOJ 4BGDA 2K02A 2L9RA 2K4BA 5LEJA 3AAFA 2QSGX 4ZTJA 2Y2ZA 3WGHA 5EF6A 4DYQA 4PK4A 2CW0F 1ZHFA 3FXLA 3QYEA 4XLEA 1RETA 2G7UA 3DTIA 2XVCA 3ZQFA 2E35A 2FA5A 1HSTA 2KT0A 4U7DA 3RQIA 5M5XJ 4A3IJ 2A68F 2GOMA 3FMQA 4UB6C 3PFYA 3ROUA 1ULYA 5D5WB 1H88C 5TJJA 2YX4A 2A3SA 3NAUA 3FK7A 2XROA 3CMMA 3T8TA 2ZFUA 5J40A 2QQ8A 1TW3A 2I5UA 2UXXA 2DW4A 3BR0A 3DFGA 2K3PA 2YU9J 4IRIA 1XN7A 1ZGAA 2XAQA 4I0AA 1E2XA 1DU0A 1OYIA 4WXDA 1BA5A 3PUFA 2EQRA 4UXNA 1BJAA 1MMAA 1RESA 2E60A 2EA4A 3ABTA 4S05A 5BPIA 1MBKA 3SFIA 2X0LA 4BE2A 2NOGA 1PUEE 3G4SI 3G1MA 5KK1A 3JTHA 4XONA 4EJOA 4FX0A 1XCVA 3M8JA 2NVQJ 1U5TA 1V5EA 3CC7I 1HLVA 2CQQA 2A6HF 4LIUA 4D0PA 2E7XA 1E3PA 4EMSA 2JA6J 2HOSA 2KZVA 3IWFA 1TZLA 3FF5A 1A6IA 5GPAA 2XB0X 3GTPJ 1ORKA 3BTIA 3BG9A 3BZKA 1HKTA 2P7CB 2QQAA 3ERMA 3BR1A 1FP2A 1TQIA 2BHZA 3VYUB 1SC7A 1FYLA 2LKSA 4KN7X 5CVIA 2EFOA 1T38A 4E7LA 1G3YA 2VXDA 1U9NA 3SQNA 2RGVA 2LY9A 2HPMA 2LRDA 3ABUA 3HHHA 3J7YJ 2VODA 2EFWA 3GTGJ 1GLNA 3F22A 1P92A 2GBYA 2O61A 2COMA 2IEKA 2ZXJA 5KAIC 1QGPA 4G12A 2NVXJ 3I4NJ 1DPUA 4QLCU 1JJ6C 3A02A 4DZJA 2VC1A 3GZNB 3D5SC 4IO9F 1D0YA 1FIPA 1WQ2A 1BI0A 1Y39A 2QEXI 3HOWJ 5E3OA 3S2WA 3FMRA 4RLFA 4C3JJ 4I98B 1B1BA 2W00A 1E0EA 1T39A 2BBYA 1QA6A 3BR3A 2KZGA 4JP0A 1GHCA 1QO0D 3GFIA 1X1DA 1MGTA 1MSFC 3QODA 1U2WA 4HNUA 1KU7A 3V8LA 5E8GA 1A5JA 1YX3A 2IA0A 4IHTA 4XN3A 4QWQA 1R5GA 1E17A 2WAFA 2HDWA 4UVAA 3C1DA 3RI4A 3SZPA 1OLTA 4CYDA 3TO6A 2R7RA 4ESJA 2E36A 3H3ZA 1XSDA 3L2UA 1T8IA 2IGMA 4Q4ZF 1R58A 3MKZA 3JCUC 3LSKA 2K7LA 1FMVA 4G7HF 2K9NA 5F1JA 2YR2A 3F23A 2K9QA 3OMYA 2Z9OA 1JI8A 2G9WA 3S14J 4P9UA 1MJBA 2MGQA 4CCLA 3KZZA 2LREA 5FKKA 3V7SA 1XGNA 2DJNA 3L2RA 3KZIC 3K70D 4RBOA 3H3VK 1AWCA 2HQRA 1F9NA 5K5RA 3GZ6A 3RKQA 3BY6A 5M3FJ 1VQKI 1Y0NA 1LEBA 3PIPF 2CWEA 2RV8A 4JQFA 1USTA 4M6VA 2ACJA 2Z99A 5D6FA 3QYBA 1EH7A 2GOXB 2DTRA 3KPHA 4I7HA 4PSXA 3WGIA 3HOTA 4E7KA 1MDMB 4A3GJ 4U7BA 3SHFA 2ECBA 3Q0VA 4O6JA 1XGSA 1D0XA 1XSVA 5LFAA 1B8IA 4Q47A 1K4SA 3WU0A 2V4JC 4A6EA 5JR3A 1B4AA 1NK2P 1ITYA 4RGSA 3K4LA 1Z7UA 4CICA 4BACA 1X2NA 3SZTA 2V1NA 1YS6A 2VC0A 2XGCA 3LSIA 3AFHA 4RB1A 1WFXA 2X6WA 5GTIC 4BE1A 2DOEA 4FQGA 2XGXA 3EPZA 5K7HA 4YFKF 1C0WA 4D5FA 3QPTA 2CSOA 2IGOA 3JRIA 3WHBA 3KYDB 2MD5A 4V2GA 2JPCA 3F6VA 3HOUJ 2MYSA 1JTYA 3EYYA 3O2PE 4LJZF 4CA0A 4XRSA 1D5YA 2BXYA 3KETA 1OJLA 4J19A 3FM3A 2LH9A 2R7VA 2LOOA 1YS7A 5IP9J 3FXJA 3HC7A 3E6MA 3G73A 4AWXB 2ISYA 3WTWC 2ISZA 2CW8A 1FLIA 3EYIA 4AYBN 3OOPA 2WB1A 4BXFA 2CH0A 2HYGD 2QBYA 1DGRM 2DBBA 2F4OB 2TRTA 1AA7A 5TRDA 2MD0A 5HLTA 1VQ8I 2EV6A 1G6NA 1SMTA 4ETSA 2DLLA 4EM1A 1TL8A 5E3MA 5AIQA 3OS1A 3F8NA 4IQJA 3O3KA 4HPQA 2E1NA 2NOJB 2O5RA 4IOAF 1MNEA 2HPIA 3LWFA 5J8CA 4XLHA 2RNGA 2XRLA 1W0UA 4D5CA 4RAGA 1B72B 2X6YA 5HS8A 5CPRB 3OYLA 4IJAA 2DMPA 4PJNA 1JHHA 2B9SA 3LL7A 1YQAA 3OV8A 3BPVA 4KITB 4AM3A 1X19A 2XHKA 3HJEA 1I6XA 1XDUA 2KPMA 1X1BA 1MH3A 3CJNA 4S04A 2IP2A 1J5YA 3EQLF 2WV0A 3H36A 4Y3OA 2GIVA 4OOIA 4CYCB 1IRXA 1FX7A 2XGEA 2KRFA 2X6OA 4NC6A 3VYTB 2R5ZB 2D45A 3T5XA 2DO7A 2OC6A 1HDPA 1OCPA 4DBRA 4HRIA 4M6YA 1YRNA 5KHDA 3MFKA 2ETHA 3J80K 4P9FA 5BPDA 3SFZA 1ETOA 4HZFA 5IP7J 4C3HJ 4EVIA 1JKQC 3BG7A 4XLCA 4II3A 5J1RA 1SAXA 3ZP5A 1PDNC 2GAUA 4A3BJ 2Z33A 3QU3A 1KA8A 3UR3C 2PX9A 2KQRA 3VDXA 2CV2A 4QPOA 2E7WA 4A2UA 4MGRA 1SFKA 4BHCA 3CCMI 5D5XB 4AIKA 4BJ6C 1YJWI 4JK1X 4I6ZA 5HDKA 5L3FA 2R7FA 3LSTA 3W6VA 1BL0A 2XAJA 4G6TB 4LLGF 1FSHA 3NWSA 1MBFA 2Z3YA 3G71I 1CQTA 1OCTC 1REPC 4BQNA 3EETA 2W7NA 2FQ3A 5DM6F 2XGDA 1QU3A 1G8XA 4OIPF 2DDBA 2EB7A 2VXZA 4RS8A 5C3EJ 2R7DA 2QUFA 1VQPI 2D5VA 5FLVA 1NG7A 2B63J 1WZ2A 1ETWA 3H9QA 1O3TA 4EJUA 5DEQA 5LGNA 3J7ZI 2WADA 1IW7F 3CD6I 1KQ0A 3BG6A 2LLKA 1GT0C 1U3EM 3A2KA 2DDAA 1KYZA 1XMXA 2XAGA 4M3BA 1I1GA 2A69F 3IHUA 2IGNA 3ZQ7A 2BZTA 3Q3SA 1Y8RB 1A35A 1VQNI 2RNJA 1Z67A 2H8WA 1HCRA 3HOZJ 3IRQA 1Y0UA 3NRVA 2VJ5A 1S72I 2WAEA 4E7IA 5CQEA 2L7ZA 2P6TA 4ZH4F 3H0DA 4BE0A 4M72A 3OYMA 4BEHA 3ZQQA 4IPAA 2V1XA 3RPUD 2KMUA 3Q9SA 2P4WA 1UG2A 2EK5A 2TCTA 4LIVA 2DTZA 4I02A 3CF5F 1S29A 3V7RA 2E5NA 2WY7Q 2JT1A 2O8XA 2I8DA 1YI2I 3K1MA 2LKXA 1M1EB 4HEA2 1MD0A 1IXCA 1A36A 3F0CA 1PYVA 2R93J 3OIPA 1T95A 4BL0B 3GEZA 3S17J 3A1YA 2ZSHB 3CCJI 2R7SA 1TTYA 1CF7A 1ZRDA 4E70A 2WAQA 1R5ID 5CKTA 3G1LA 2W85A 2VE9A 3MD2A 1Y6IA 3BR6A 4A3LJ 2FE3A 3KEYA 1ZELA 3R6SA 3AG2H 4Y15A 4AIHA 2GLOA 4UVBA 2EZKA 3VSLA 2ELHA 2FMLA 2M5WA 2HXIA 1RIOH 2XPWA 2Y0SA 3SEZA 2CU7A 3ZXSA 4L9NA 3LSRA 3TW6A 3J80Z 3J81K 3DKWA 3T0YA 4H0EA 2Y9ZA 4ZYAA 3CDLA 4W97A 3ZMZA 1K7AA 1GV5A 4A0XA 1ZG3A 3A01A 1S7AA 5F64A 2O03A 3DPUA 5DCMB 1R1VA 3OYDA 4OMZA 2FBKA 5ERIA 2R92J 1SMYF 2IPQX 4EJTA 3VYRB 3GX4X 4BQQA 2ME6A 4IEJA 3ZOBA 2QGUA 1H9TA 4OAZA 2RQQA 2LG4A 2BE5F 2DT7B 3I9V2 2BW3A 1V3FA 1ZKGA 5K5OA 1RKWA 1PUFB 1GUUA 3SDGA 5JVTA 2XF6A 3GFLA 3D0SA 5IYDJ 2PMUA 2CQ7A 2VKVA 3DEUA 4LK0F 3WTYC 4EEFG 5D6EA 2FRHA 1DPRA 3Q5FA 2BOLA 4Y4RA 5EZGA 4PGGA 2D2WA 1TBXA 1UG0A 1FYMA 5HLIA 4EATA 4OAYA 1FPQA 4E7HA 3ZQCA 1BI3A 4PGHA 5ICCA 3LSPA 2BYVE 4Y13A 3P7NA 1EJ9A 2OU2A 3H9JA 3LA2A 1MBGA 4XNFA 4BY7J 4XK4A 2LKPA 1V54H 2VQHA 2B7EA 4IHSA 3HHGA 3VFZA 1FBQA 1W36C 4KMFA 4XRSG 4HG2A 3PSIA 2MBFA 2PFBA 1QBJA 2YX7A 1K4TA 4GGGA 1PP8F 3EUHA 1TQPA 4XSXF 1G3WA 1P4AA 4M3FA 3OYJA 3CMEI 1QVUA 2ZFWA 1HKSA 5C44J 3HM5A 3JRHA 4WF2A 1ZR4A 4RAYA 2AO9A 3DP7A 4JX4A 3WE2A 3BG3A 5JLXA 3EUAA 4I0BA 3H9GA 1LDDA 2C6YA 2O7OA 3K2AA 1RRJA 3G2BA 5C4XJ 1BR4A 5L3GA 2PMZA 3K9TA 1VQOI 1TP4A 3E6BA 2F5CA 4ZDPA 2K85A 2VASA 1LPQA 1QPIA 4BBRJ 1FTZA 4FT8A 2I10A 3ABMH 3CMYA 1EV7A 3NWTA 4UY8I 2QSFX 4DOZA 3J81Z 3GCMA 2RVCA 2H1KA 4OIOF 1W7PA 3IV5A 2VQGA 3CCUI 1EF4A 3R4KA 3HOYJ 5DUIA 2CFOA 4M3DA 5L3BA 5B5EC 4CH7A 5FO5A 2HS5A 2E34A 5BNGA 4BYYA 4AC0A 5EGOA 4NUBA 2EIKH 4KIGA 2M4GA 4HNVA 4NBQA 1G4DA 1XS9A 3MMYB 2Q8KA 5E17F 3MKLA 2PJRB 1DGWY 1Z91A 3DBLB 3F6OA 3S3OA 4KISA 3FISA 1FOXA 1YE9A 3S93A 3RDIA 1W1WE 1K6YA 1BI2A 4MTDA 2HEOA 4QTRA 1BIBA 4A3JJ 3JW4A 1I39A 4HBLA 3HOXJ 2YSRA 2L4AA 1MJ9A 4L5EA 2GIZA 5JFRA 2CV0A 2EZHA 4QSHA 4ESBA 1DP7P 1MBHA 2DI3A 4XKWA 2E71A 3KP2A 3OYCA 3PUBA 5FD5A 2LMDA 2W4SA 5J47A 4LLNA 2W1OA 1HDDC 1D1CA 2KISA 4DYRA 3OYEA 3HRSA 2QQBA 3CUQA 1RI7A 1R6RA 1ETKA 3ZQLA 1NHAA 1SVOA 4AIJA 1E3OC 1RR7A 1VQ6I 1J0RA 4I99C 2M87A 4F7ZA 1TNTA 1RUNA 2VONA 3RKYA 3AG3H 4HA8A 5E1XA 3KEQA 1FJLA 3S1RJ 4N0BA 1HQCA 4E7JA 2Q2EB 3PIOF 3VEPA 5KNLA 1S9HA 1JUMA 5H20A 4LB6B 2H27A 2JMWA 2KKOA 2M0MA 1D5VA 3F8BA 4FASD 1XCBA 2KJBA 1I1SA 2PG4A 2H6BA 4HX4A 2VOPA 3F3XA 3IAS2 2KFDA 2ZB9A 4KIFA 2ZBKA 2MH9A 1GVDA 1S7OA 5HNHA 1R1TA 3L2QA 4UV8A 4F91B 1GV2A 1TQMA 4A3EJ 3FIWA 5B66C 4BDZA 2CUZA 3ZQIA 4ENJA 1F43A 3E5UA 5FJ8J 4LOCA 4HYEA 2JA7J 1LQ1A 2LVSA 2QA4I 4KYWA 3M7GA 2XSJC 1FIAA 1TWFJ 2HI3A 3KP7A 4XM3A 2JA2A 4DGWB 1YHQI 1J9IA 4UUSB 1AOYA 3TDZC 2BY0A 2PMHA 1R71A 2M8GX 4XIDA 3UKGA 1HSJA 1Z6TA 5FB2A 3JSPA 1IGNA 2VLAA 2CQXA 1U5TC 3AL0B 4CZZA 2XSDC 2R7UA 4U88A 3EUKL 4CCKA 4RA2A 3GFMA 1OISA 2E2HJ 3DKYA 3ECHA 1U78A 3G6EI 2OPTA 2E2IJ 4FETA 1VQ4I 5DUKA 4WWCA 3OIOA 5FD6A 4YFXF 5HDGA 3D5RC 4BDYA 2A5WA 2HKOA 3HKZN 1OCRH 1KU2A 3FMSA 3IKVA 1S8NA 2DA6A 2OUMA 4ZYHA 1ZLJA 1CGPA 3EDPA 1LFPA 4ASNA 2A61A 1ZR2A 4IHYA 1R7JA 2R4GA 1QQIA 1X3UA 4BH9A 3IL2A 1SFUA 3A4CA 4Y33A 2F5FA 2FMYA 3KIOA 2DA3A 2E1MC 3I54A 1WHUA 3E1SA 2JN6A 4XL9A 1GVJA 4I76A 4EGZA 1XDSA 1FSEA 3F8FA 5TISC 2HKXA 5DD8A 1O3SA 1WCMJ 3HBLA 3QOPA 2P0WA 1WGXA 1MKMA 3RIRA 2O9LA 5FGMA 3VWBA 2CUEA 2JJ7A 4G8XA 5EEAA 1WSUA 1WI9A 2DAOA 2W24A 1TT5B 3REOA 3BTJA 4K2EA 5ICEA 1YJ9I 4L5JA 1U9OA 3WTXC 5J4VA 3JRCA 1XTAA 1NH3A 2WY8Q 3BTCA 1OPCA 2WWYA 2R5YB 3WE3A 2YPRA 3BZ6A 2M30A 3CF2A 3FWEA 2MSYA 3IH4A 4GYGA 2EFPA 3OSGA 2Y75A 2QF7A 4X1EA 1EH6A 4M3EA 2DQRA 3H0GJ 3S1NJ 3F8CA 1TWAJ 3BTLA 3KP3A 2ESHA 1FZPB 4LB5A 3BC8A 3GVAA 4HLYA 1WJFA 3P9KA 5EEHA 2ZXIA 1L0OC 3W2WA 3CQZJ 4MQVA 4XQFA 1XD7A 5M3MJ 2H6CA 1VNDA 3ELKA 1FWZA 3TW7A 1S3JA 1IC8A 4L0YB 2PEXA 3SYTA 4O5VA 2VI6A 1IRFA 3KP5A 5K7ZA 4UUVA 2EH3A 4U0VA 4CGZA 2GA1A 2X85A 5J3LA 3E6DA 4MFDA 2O8KA 2QVOA 1W5TA 5GAGJ 2CUFA 5FKOA 1BC8C 1JKOC 2Z1DA 3W6JB 3K10A 1TW2A 1D0ZA 4PFOA 5EDNA 4XOPA 1X2MA 1SD6A 3MN2A 2A6TA 2ZJ2A 5D8LB 3I55I 3H35A 4XLAA 1ACIA 3DBRB 1EH8A 3KYCB 2M7BA 5ICGA 2R7TA 2F5DA 4KFCA 4XORA 4RB3C 1KU9A 5GPCA 3P9CA 1WKMA 2LF8A 3O6BB 2DFIA 1XSXA 2FOWA 3U1DA 1MDMA 1ZREA 3DEEA 1FNNA 1FOKA 4RGRA 3M07A 2V7FA 3BP8A 1ZARA 1X4PA 2DT6A 2LR8A 4KDPA 2M9HA 4FCYA 1QZEA 2VKDA 4ZYEA 4MFEA 3OL3A 5ILSA 4RGUA 3ZPLA 3GTMJ 1POGA 2IS4A 1IN7A 3ZMVA 2BVMA 2F4MB 1W36D 1VQ5I 2IA2A 3KCCA 2M3AA 4IVNA 4DIQA 3DTKA 3S16J 4BHBA 3CJRB 3KE2A 4B44A 3HUGB 1W5SA 3TP0A 4D7NA 3CESA 1JHFA 2DOAA 2K5CA 1MSEC 1R5HA 2EINH 3HB9A 1JKRC 1UAAA 1PP7U 2VOOA 3I59B 4GDFA 1ZGWA 1G3TA 5E3NA 1I5ZA 1Z1DA 2GXBA 1R4MB 2CMPA 3K6GA 5HODA 2F2EA 1ZGJA 4A3CJ 2R7XA 1ERDA 5FRMA 2LYCA 4RLQA 4XR6A 4XLNF 1BN5A 3D5LA 1X3ZB 4P55A 1IRGA 3C2HA 3CO7C 5EJCA 1HXDA 5CVVA 1J7KA 1UCRA 1D1BA 3OY9A 2M34A 3L00A 2PI0A 1XX5A 3A0BC 3QP5A 3R61A 4NC7A 5J1UA 5BMZA 3OS2A 2FNPA 1S5LC 4BBSJ 1B72A 2ELJA 3N05A 4XKCA 2BY1A 2R7OA 1ZN2A 2KIQA 3OYGA 2X48A 3FHNA 3S3NA 4KJZA 2ZO4A 1WI3A 2ZJQF 4NB5A 1O3RA 3COAC 4CHUA 3LQQA 4AD9A 1IN4A 4CXFA 1HOMA 1SD4A 4CYCA 3S1QJ 3BCAA 5IP6A 2DJIA 4PJMA 3O8HA 2XRNA 4N4OB 2F5EA 2BV6A 3OOUA 1YLFA 1TWCJ 2NS7A 4E6KG 2L9SA 3V8KA 3KZYA 4IXAA 3ECOA 3D1NI 1FOYA 2OA4A 2ECCA 5IYBJ 1P4XA 2BY2A 3FHZA 4EM0B 4P5OA 2HOEA 2MC3A 3CMAI 1HW1A 4WXCA 3L09A 4PZJA 2DA7A 1JE8A 3GTOJ 1XC5A 1ETXA 2RQPA 5E1ZB 3ZRGA 2IBDA 4CDGA 3BG5A 4ZZLA 5DS9A 3QPLA 2QBYB 4S0HB 1LDJA 2LBFB 4DW6A 2HGCA 4Y7NJ 3FX3A 5CQGA 4EJWA 1TLHB 3TQNA 4CCMA 2WA0A 3CCVI 3Q0UA 3K2ZA 3H1CA 3BJOA 2E19A 1JTXA 2CO5A 2LP0A 2ADUA 3H5RA 2WB1N 3KLNA 3I71A 3W2AA 2OTJI 1K78A 2L7FP 3M4OJ
chains in the Genus database with same CATH topology
3AG4H 2EIKH 2OCCH 2EINH 5B1BH 1OCRH 1OCCH 1V55H 2EIMH 3AG2H 3ABLH 3ABMH 3WG7H 2EIJH 3ABKH 3ASOH 1OCZH 2ZXWH 5IY5H 2DYRH 3AG1H 2EILH 3AG3H 1V54H 2Y69H 1OCOH 2DYSH 5B1AH 5B3SH 3ASNH 3X2QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 H;  2EIK H;  2OCC H;  2EIN H;  5B1B H;  1OCR H;  1OCC H;  1V55 H;  2EIM H;  3AG2 H;  3ABL H;  3ABM H;  3WG7 H;  2EIJ H;  3ABK H;  3ASO H;  1OCZ H;  2ZXW H;  5IY5 H;  2DYR H;  3AG1 H;  2EIL H;  3AG3 H;  1V54 H;  2Y69 H;  1OCO H;  2DYS H;  5B1A H;  5B3S H;  3ASN H;  3X2Q H; 
#chains in the Genus database with same CATH topology
 4DNC A;  2V79 A;  1XG1 A;  4GFB A;  1LUJ B;  1Z21 A;  4PUS A;  5KCM A;  1GDT A;  2V6E A;  2AQF A;  4HDV A;  3T1B A;  1MMD A;  2UZK A;  3HRT A;  1W4M A;  3PQJ A;  3HOV J;  2X6X A;  3CP2 A;  4W1U A;  3N97 A;  3E5Q A;  2DN0 A;  2BEO A;  1I50 J;  5F08 A;  1QHH D;  1OKR A;  2ZJR F;  3S3M A;  4H4K C;  2KLO A;  1R22 A;  1WJ5 A;  5LD2 C;  2Y0M A;  3U1K A;  3GTK J;  4IQ4 A;  1JGG A;  2CQN A;  2JUC A;  2N8G A;  4M6X A;  4MIM A;  2XKP A;  1ZAO A;  1AKH B;  3FBI B;  5F1R A;  3S1M J;  3GZ5 A;  4UHT A;  2V6C A;  3KEO A;  2AHQ A;  4Q48 A;  4BKX A;  2QKM B;  3PM1 A;  2HDC A;  5EYR A;  2FBI A;  2HTS A;  5KAF C;  1MBE A;  2OV7 A;  1VZ0 A;  1TNS A;  1O3Q A;  2VKH A;  5IY5 H;  3OR2 C;  3TDU C;  2MFZ A;  5HS9 A;  2EIL H;  1G3S A;  1VFC A;  3E5X A;  1I3A A;  3GTQ J;  2EJR A;  4ENK A;  1IO2 A;  5H6Q A;  3ZMU A;  2AQE A;  3M9A A;  1LEA A;  1UHS A;  1QNT A;  1MND A;  4L18 B;  3M8F A;  1YX5 A;  2X4H A;  2FSW A;  4AVZ A;  4MQ9 F;  2EFN A;  3WG9 A;  4E4H A;  1R49 A;  1DU6 A;  4KT6 A;  2F5V A;  4CCJ A;  4ON0 A;  3OIQ A;  3LSM A;  5H2F C;  2R7W A;  1FC3 A;  3RPQ A;  4CCN A;  2LD5 A;  3KP6 A;  2IW5 A;  3JRA A;  2ZME C;  1Y56 A;  2DYR H;  2J5O A;  1MJA A;  3F21 A;  3NEU A;  3HTS B;  2DK8 A;  3MCZ A;  3QP6 A;  3BPX A;  3WOD F;  5ILV A;  1VQ9 I;  1ONV A;  1VTN C;  1P4W A;  4HSR A;  1J59 A;  1F1Z A;  2W57 A;  3G1O A;  3I64 A;  4IL6 C;  2E1O A;  2QZ8 A;  5EG0 B;  3WTZ A;  1A6Q A;  1JUS A;  4PJL A;  3I0T A;  1BW5 A;  3RJP A;  3K7A J;  4M71 A;  5DCM A;  5CVJ A;  3K1P A;  2VT2 A;  5EZH A;  4RM2 A;  3CCR I;  3RTR A;  1WH7 A;  3ZN1 A;  3Q9V A;  1O57 A;  2DQL A;  2DA4 A;  2ZXW H;  3BQZ A;  3I53 A;  3UNG C;  4A0Y A;  4RGX A;  2CRG A;  2IJL A;  3LFK A;  5FFZ A;  2QM3 A;  2ZME A;  3I5U A;  4OU0 A;  2EPF A;  3V8J A;  3VYS B;  4B47 A;  1FBU A;  5LLQ A;  1WRJ A;  1JKP C;  1JJ8 C;  2X1E A;  2W82 A;  5HDN A;  3JRF A;  2VT3 A;  1ZG5 A;  2EIM H;  4U0W A;  4E7Z A;  3CCQ I;  4BJT A;  3HDD A;  1MNM C;  1G2H A;  1SVM A;  4YII A;  1SFO J;  2WV1 A;  2QQ9 A;  2P5V A;  2XAH A;  2JTV A;  3G3Z A;  3T8R A;  4NC8 A;  2HQ5 A;  2EZI A;  3RKW A;  5LGT A;  4IZZ A;  1XMK A;  3M1E A;  1P2F A;  3EUH C;  4LLL A;  4XLP F;  1U0J A;  2ZJP F;  1APL C;  3E97 A;  1ZK8 A;  3S15 J;  3RKX A;  1NK3 P;  5BOX A;  2V1U A;  1IXR C;  3K4K A;  4BQA A;  1LE8 A;  1O4X A;  2Y48 A;  3QU6 A;  1Y1V J;  2WAQ N;  4LMY A;  1LDK B;  2EZL A;  4P96 A;  4F3Q A;  4UUT A;  2JQ7 A;  1YW9 A;  3TBI A;  3FXM A;  4O3M A;  3S32 A;  1K79 A;  3FXK A;  2BXZ A;  3BCB A;  1OCZ H;  3A01 B;  3SXY A;  4KNY A;  2ELK A;  3U2R A;  2DOF A;  2Y0S N;  4C2M J;  1UHM A;  2KIU A;  1QRY A;  2K27 A;  3BJA A;  2VN2 A;  4DZP A;  2ZNZ A;  4Q5S F;  2A5Y B;  4PJJ A;  2LNB A;  1VI0 A;  3WTU C;  1ZLK A;  4BHP A;  3DPT A;  2HU9 A;  5FKM A;  3IUO A;  1IZ1 A;  4BQO A;  4ABZ A;  3JR9 A;  2EBI A;  2VJ4 A;  1OR7 A;  3L2W A;  3HXL A;  2X1C A;  4KN4 X;  5L3E A;  2BW3 B;  4YG2 F;  3WG7 H;  4D1Q A;  1F36 A;  5J4Y A;  4IHV A;  4XSZ F;  3SJM A;  1LKX A;  1KZH A;  3HSR A;  2OQG A;  3ESW B;  1U8R A;  1Z7L A;  2K40 A;  1K6O A;  2PBI A;  2LY1 A;  2EV0 A;  3C2B A;  1ODD A;  1T0F A;  2L7M P;  4P1W A;  2FBH A;  1ZYR F;  2HNH A;  4HST A;  2VJI A;  2YUS A;  2YS9 A;  3N4M A;  5J6X A;  1H89 C;  1R1U A;  5E3L A;  3WU1 B;  5GTH C;  3KYL A;  2W48 A;  4I2O A;  4ZDO A;  1T56 A;  2MH2 A;  3BR2 A;  3E6C C;  1TWG J;  4B1R A;  2XKO A;  2JPB A;  4A3F J;  4CSW A;  4M74 A;  3R0A A;  4D9J A;  4AU7 A;  4MO7 A;  1EA3 A;  1L3L A;  3MKW B;  2P5L C;  1W5C C;  5ED4 A;  4R1H A;  2PJR A;  2XC7 A;  1LJ9 A;  3LAP A;  2XV4 S;  4G94 A;  3OYF A;  3CJQ B;  2Y31 A;  3GTJ J;  5D5U B;  2EWN A;  1Y1W J;  3M1C A;  3ULQ B;  2TDX A;  3HSF A;  3CC2 I;  2ZKZ A;  1YG2 A;  4L9V A;  4EGY A;  3K4B A;  3CUQ C;  4D7M A;  5GAH J;  1YJN I;  1D8K A;  1OQY A;  1T08 B;  5FKL A;  1USS A;  2NVU B;  2AXL A;  4CO8 A;  5D8K B;  3MKY B;  2XPV A;  4HF2 A;  4NQW B;  4UB8 C;  3J7A Y;  1OYY A;  2L3D A;  4ZC3 A;  1TT0 A;  2FUG 2;  2NYX A;  2FJ1 A;  4NNJ A;  1P6R A;  4ZDL A;  1YFH A;  2HQA A;  1Y8Q B;  3K4N A;  3OWT A;  3LSJ A;  4RMN A;  2H1L A;  2X51 A;  1UEL B;  4LG0 B;  2L0K A;  1QZY A;  4B09 A;  4CCO A;  1B6A A;  4ZJZ A;  2STT A;  2UV1 A;  3KX2 A;  5LHI A;  4ZZD A;  2PMZ N;  2Q2E A;  5BS6 A;  3BRO A;  4JX5 A;  2GQQ A;  2JVG A;  2V9K A;  3LSG A;  3H92 A;  4DJA A;  1P7I A;  1WJC A;  2P7V B;  3DLL F;  2MC4 A;  4NHJ A;  2M7A A;  2K4J A;  4UNO A;  2FX0 A;  1IN8 A;  4YIR X;  1NTC A;  1SD7 A;  2JZY A;  1IUF A;  3L7W A;  3X2Q H;  2KDZ A;  4YIF A;  4X0G A;  3QYF A;  2P81 A;  2Z16 A;  2LTP A;  4XRM A;  3C3W A;  1XGO A;  1OCC H;  1XGM A;  4UUS A;  2CQK A;  2NS8 A;  1SFE A;  3DU6 A;  4OIQ F;  1IUY A;  3SZG A;  1BI1 A;  1YYV A;  4BNC A;  2VBZ A;  3CDH A;  4DQ2 A;  3TOB A;  3LMM A;  4AID A;  3S2H J;  2LK2 A;  2L02 A;  2KIF A;  3C18 A;  1J09 A;  3PSF A;  1SAU A;  1HKQ A;  2HOT A;  2Z2S B;  4LGW A;  2B0L A;  3KFW X;  1HW5 A;  2CJJ A;  4N4N B;  3LA7 A;  4RB0 A;  3CCE I;  2LF7 A;  1KQ9 A;  1LVK A;  3P5J A;  2MLG A;  3BQY A;  3HSE A;  3ABK H;  3ASO H;  3BZC A;  3CLQ A;  3JSO A;  1IN5 A;  2KHM A;  1WJE A;  2KDO A;  1D8J A;  1TWH J;  4PDK A;  2GWR A;  3TO9 A;  4Z2Y A;  4CUG A;  3QWL A;  2DPD A;  3PNY A;  3RQ4 A;  4TV7 A;  4YRV A;  3OYN A;  3DQV C;  2AS5 F;  3FKJ A;  3HRM A;  1W0T A;  4IF4 A;  2IAI A;  2OCC H;  2V9V A;  2CFX A;  3ISP A;  4DYC A;  2DMQ A;  2Y30 A;  3OS0 A;  1T33 A;  2FXA A;  2VBX A;  3K1N A;  4L9T A;  2KP6 A;  5JHF A;  3GUD A;  2HR3 A;  3DF8 A;  3MQ0 A;  1YIJ I;  1RUO A;  3L1P A;  1FBS A;  1Z77 A;  1QPM A;  4B43 A;  3P9I A;  2R3S A;  4WK8 F;  2R5Y A;  2FF4 A;  1ZTR A;  4PJ0 C;  1YIT I;  3B6C A;  3BWG A;  1FEX A;  2ID6 A;  2HVQ A;  2LFB A;  4IRG A;  1R00 A;  5F0C A;  1BOB A;  1P7J A;  3FBN B;  2IS1 A;  3TO7 A;  2JK3 A;  4XKV A;  3CZ6 A;  5C4J J;  5IYC J;  1Q1V A;  1FY7 A;  1A04 A;  2OAZ A;  1MIJ A;  1SEU A;  2OBP A;  3B6A A;  1D3Y A;  3ERE D;  3CCL I;  3MAJ A;  5J1Y A;  3IRR A;  4L9J A;  3WU2 C;  1IJW C;  1HW2 A;  5HS7 A;  5F27 A;  3DU5 A;  2F48 A;  4F52 A;  1PVE A;  3ZR8 X;  5B1B H;  4G7O F;  3VPR A;  2VKE A;  2VB6 A;  2JWT A;  2XAF A;  4G6D A;  3RZD J;  4BUP A;  5FLM J;  3LFU A;  5DCF A;  3GWZ A;  1ZH5 A;  5CLS A;  2FOK A;  3FXO A;  1WVR A;  1X3W B;  3TP3 A;  1U5T B;  4GO1 A;  5J8F A;  2M1B A;  1EKE A;  1RKT A;  4OMY A;  3GW2 A;  4EJV A;  2VPR A;  4IX7 A;  2DA2 A;  5LRR A;  3TOA A;  3DXJ F;  1NG6 A;  3DEW A;  1GXP A;  2VJJ A;  2Y69 H;  6PAX A;  3WGG A;  3RPU A;  3OYK A;  2LC2 A;  2BHY A;  3ONQ A;  3WTS C;  2XF5 A;  2ICW G;  3CTA A;  2IT0 A;  2JSC A;  4KA4 A;  2V1D A;  3FM5 A;  2EA2 A;  4JX6 A;  4AUX A;  4Z6Y A;  1UFM A;  2WBM A;  3DV8 A;  1FT9 A;  3JRD A;  5JI6 A;  1R23 A;  4M9X A;  5DD4 A;  3DPL C;  4E7S A;  2P6S A;  4LD5 A;  4A0Z A;  1IN6 A;  3VOD A;  2LY2 A;  1D1A A;  4FIS A;  4KIC A;  3OR1 C;  4LG3 A;  3CP8 A;  2DT5 A;  1H0M A;  5GP9 A;  2E1M B;  3IH3 A;  3E3V A;  1LFB A;  2K9M A;  4CZC A;  2YU3 A;  4X6A J;  3HUG A;  3QPH A;  1LB2 A;  5L3C A;  3IP4 B;  4IHX A;  3TKY A;  1IXS B;  4C30 A;  4MNU A;  1N78 A;  3GFJ A;  3I59 A;  4ANJ A;  1ETV A;  1RPW A;  1T2K A;  2IS2 A;  1DQU A;  3GME A;  1IF1 A;  2PQ8 A;  2R7Q A;  4XOT A;  3LAJ A;  4KUM A;  2QLZ A;  2G0E A;  3GLX A;  2DFF A;  3BR5 A;  5FKN A;  1GXQ A;  4KT5 C;  2VQL A;  5EEG A;  2CYY A;  1LVA A;  5LRS A;  3JRB A;  3Q0W A;  4ENM A;  4ZYG A;  3K4M A;  2FQ4 A;  2L2O A;  3BLY A;  1W7P D;  5D5V B;  1YO5 C;  1P9Q C;  3HRU A;  3LQR A;  2CW7 A;  4JBA A;  3BT9 A;  3FK6 A;  3HOS A;  5LHG A;  3V42 A;  4AYB A;  1UJ8 A;  3HGY A;  1DDN A;  5M5W J;  1IV6 A;  1B9M A;  3LSH A;  5A2Q K;  2D1V A;  4F55 A;  3CO6 C;  1FMW A;  4HV6 A;  1FOW A;  4BXX J;  1FYK A;  3I4M J;  1S7E A;  5F6F A;  3TL4 X;  5JVG F;  3I4P A;  1DP3 A;  3A03 A;  3C7J A;  3MVP A;  1I6H J;  3IWZ A;  3M8E A;  2OTL I;  2GM4 A;  5E18 F;  1HBX G;  1Q1H A;  5GAE J;  5K7F A;  2FNA A;  2Q0O A;  1KYW A;  1UHW A;  3NQO A;  4F92 B;  2GA2 A;  4QIW N;  1TC3 C;  2A6E F;  2RDP A;  2DXI A;  2K86 A;  4UVC A;  1YOV B;  3MEX A;  1X58 A;  1IAW A;  3HL2 A;  2DFH A;  3VB2 A;  2UXN A;  4U0Y A;  1OCO H;  4F93 B;  1B8I B;  4Y52 J;  5LEK A;  4A5N A;  2XIG A;  1OMI A;  4AVP A;  3V4G A;  3AG4 H;  3NAR A;  4L5I A;  2IS6 A;  3JRE A;  1SVL A;  4M9S A;  1KON A;  4PFP A;  3F72 A;  4WXH A;  4OIR F;  5IT3 A;  5HVQ C;  1RNL A;  3MZ8 A;  3GF2 A;  1UZC A;  1ZQ3 P;  3QQA A;  4KIB A;  4WCG A;  2R5Z A;  1HA8 A;  3K4C A;  2JRM A;  2LBF A;  2J5P A;  3MWM A;  5CVU A;  1IV8 A;  2V26 A;  1ENH A;  2H94 A;  2Q1Z B;  2K9S A;  4I01 A;  1WWX A;  1Z05 A;  2JSP A;  4YEJ A;  4QPQ A;  4U87 A;  1RC9 A;  2NVY J;  2HVR A;  1BBY A;  3DLA A;  2M2E A;  3ZGK A;  1MMN A;  2QYO A;  2O6G E;  3PO2 J;  3KLO A;  1X1P A;  2NNN A;  2IVM A;  2XB5 A;  3KP4 A;  3QRF F;  2VE8 A;  1ON1 A;  3ZMS A;  5CJ9 A;  2R7Z J;  5HNF A;  1T98 A;  4B3X A;  1BR2 A;  5LGU A;  2E5Z A;  5F0H A;  2F6C A;  4FX4 A;  5E20 A;  4HDU A;  3AKZ A;  1I27 A;  4YEL A;  3HG9 A;  2KIM A;  5IOY A;  4V2F A;  4V19 K;  1ON2 A;  4MHG A;  3PO3 J;  2X1D A;  2M45 A;  1O7F A;  4GXO A;  2HYF A;  2HTJ A;  2QCO A;  3M3Y J;  5D4R A;  1VQL I;  1WJA A;  1AKH A;  1KQ8 A;  4XLF A;  2H8R A;  2QWW A;  1WJB A;  2EIJ H;  3CCY A;  3ZMT A;  2LSO A;  4A3M J;  2PN6 A;  5A2Q Z;  4HF1 A;  1AHD P;  4II2 A;  3RCO A;  2DYS H;  1Z0X A;  3L2V A;  3IKT A;  3B02 A;  4L0Z B;  4N9I A;  5GAD J;  1FTT A;  1BIA A;  2D1H A;  3PL8 A;  3OYA A;  4MEX F;  1ZRF A;  2JRT A;  2NNY A;  1UMQ A;  1A31 A;  3HTU A;  3ZCO A;  1X4O A;  1X1C A;  4XRF A;  2BGC A;  1Z9C A;  3K4J A;  4FE7 A;  5HLG A;  3HPH A;  4IRH A;  3FDY A;  1F4K A;  3HIF A;  1YRN B;  3LA3 A;  2ZCW A;  1OYW A;  1V5G A;  3ABL H;  5ICF A;  1LFU P;  1H9G A;  5CYV A;  3I58 A;  3TGN A;  3HZJ A;  2VQC A;  2ZC2 A;  1Z3Y A;  3JAM K;  4A12 A;  3JTG A;  1K78 B;  2ID3 A;  2ZSI B;  5JHU A;  5CVR A;  4EM2 A;  4HQM A;  3WHC A;  5IPA A;  2VIX A;  1WH5 A;  2VL8 A;  1MW7 A;  2IRF G;  3CUO A;  4XIC A;  4ZTF A;  5TGT A;  3ML6 A;  1MZB A;  2IGK A;  2MW8 A;  4B8X A;  5DTD A;  1G59 A;  2MAB A;  2NAZ A;  3HYI A;  3RSN A;  5EG0 A;  2STW A;  2XAS A;  3VSK A;  1B59 A;  4M9Z A;  2HZD A;  4BU2 A;  3ZQH A;  3DBH B;  3GXO A;  1XMA A;  1QZZ A;  2XAU A;  1R9T J;  1K61 A;  4JYK A;  5K5Q A;  3J7A O;  2JVH A;  3B73 A;  4HW0 A;  3E7L A;  1QVT A;  5L3D A;  4GCV A;  4A69 C;  4LFU A;  3U21 A;  1YIO A;  2RKH A;  5E79 C;  2L7K A;  2M4K A;  2GXA A;  2GZW A;  3OYI A;  4C9Y A;  2L01 A;  4B4C A;  2RRE A;  5AON A;  2Y9Y A;  2L4M A;  1LNW A;  3E0J B;  3S2D J;  2O3F A;  4XN0 A;  2UUZ A;  4A6D A;  1STZ A;  3BJ6 A;  4RAZ A;  2MLK A;  1I3Q J;  4IHW A;  3F8M A;  3GTL J;  2IA1 A;  2QEN A;  4R79 A;  2UWM A;  5FRN A;  2R0Q C;  4HOB A;  3C2G A;  2HZT A;  1K83 J;  3HPG A;  3RYP A;  4A93 J;  3I3L A;  4HAM A;  1N25 A;  1ZRC A;  5IT9 K;  4RAF A;  1PUF A;  2FU4 A;  4BEH B;  1JT0 A;  2GXG A;  4HX7 A;  5E1W A;  4BAY A;  9ANT A;  4R8H A;  1YW7 A;  2ME0 A;  3H5N A;  1QHG A;  2H09 A;  4MEY F;  1BOA A;  2IXS A;  2XPU A;  3CLO A;  4ENN A;  2X9D A;  2VBY A;  3TED A;  5LBQ A;  3LNQ A;  3IH2 A;  1MBJ A;  2HXO A;  1DUX C;  1JT6 A;  2OQR A;  4KMU X;  3DKX A;  3CCS I;  1X1A A;  3S8P A;  4BS9 A;  2ESN A;  5D4S A;  2DPU A;  1B9N A;  1T6S A;  2OJE D;  3PNT A;  4EV0 A;  1CF7 B;  3QAH A;  1OR7 C;  2CUJ A;  3R60 A;  5FLX K;  4WX9 A;  2FD5 A;  2EV5 A;  2L9V A;  4G9Y A;  2M8E A;  2P5K A;  3ZMD A;  5DDG A;  2VUM J;  3PQK A;  3F9K A;  3PNV A;  1U8B A;  1XPX A;  5AIP A;  3ZQG A;  5F04 A;  2HDD A;  3FZV A;  2G7H A;  2ZXH A;  2QSH X;  2RAE A;  1WPK A;  4M3G A;  3JAM Z;  1YW8 A;  1T0F C;  3SEQ A;  2EFQ A;  4RDU A;  4ZYD A;  2AXT C;  2ZME B;  2DOD A;  2M0C A;  3RYR A;  4IKF A;  1HC8 A;  1ETQ A;  4DBQ A;  3ASN H;  4B3A A;  2A05 A;  1F5T A;  3OYB A;  3PFI A;  1N75 A;  1UB9 A;  4BXU A;  1AU7 A;  5LHH A;  1J2X A;  1Z3X A;  3CC4 I;  3R0J A;  2WC2 A;  2L5Q A;  4YFN F;  1VF9 A;  3L2C A;  2K9L A;  3OYH A;  1BM9 A;  1RZ4 A;  2MA3 A;  4M73 A;  3K70 C;  4XKB A;  3V7C A;  4GRI A;  2OZ6 A;  3DTE A;  4FTH A;  2DK5 A;  3QPS A;  2KRH A;  4NDL A;  5ILU A;  3WTT C;  1KU3 A;  3BOQ A;  4XMY A;  4A3K J;  2COB A;  4A5M A;  2JA5 J;  4J01 A;  2CS3 A;  2Z5U A;  1MMS A;  3QOE A;  1BR1 A;  5FFX A;  1PJR A;  3MZH A;  1LE8 B;  1BC7 C;  4OWR B;  3PJR A;  1HF0 A;  2OF7 A;  4C3I J;  2WTE A;  5HOO A;  2RC4 A;  3OL4 A;  5F0F A;  3W2V A;  3WTV C;  1H8A C;  3ZN0 A;  4XBF A;  2A07 F;  2MG4 A;  1KGS A;  5KVR A;  2DU9 A;  3A0H C;  1SFX A;  3IAM 2;  4NQW A;  2OCE A;  2XF7 A;  5E8I A;  1N77 A;  3HGG A;  2XUB A;  4LIT A;  2JUG A;  2RN7 A;  2E1C A;  5B1A H;  2DMN A;  5IT9 Z;  3L9F A;  4LG0 A;  2VPL A;  5M5Y J;  1JXS A;  3O8G A;  4ESF A;  4FE4 A;  2HOA A;  1S6L A;  1FP1 D;  4G6Q A;  2KL4 A;  4MTE A;  5HLH A;  2E2J J;  1ZG1 A;  4GYI A;  2KRC A;  2XDV A;  2L9N A;  4HF0 A;  4ITV A;  2ZNY A;  2DMT A;  3K69 A;  2W84 A;  4I09 A;  2QKL B;  5FLX Z;  1V5F A;  1YTY A;  1IG7 A;  3OSF A;  3HEF A;  5DV5 A;  4LK1 F;  3W6K B;  3VOE A;  5JLW A;  3DCF A;  1J75 A;  1BW6 A;  4PCQ A;  5BQT A;  4OIN F;  4B48 A;  2HVS A;  4RM3 A;  2HQN A;  2JA8 J;  4BY1 J;  4G7Z F;  4HV5 A;  4HQE A;  3AL0 C;  3FKI J;  1VQM I;  2NRA C;  3MZY A;  4HX8 A;  1W7P B;  1R36 A;  1Z6R A;  3I56 I;  2K3F A;  1V4R A;  1U6G A;  2DMU A;  3GBG A;  2CGP A;  3AG1 H;  1JGS A;  2HWV A;  1ETY A;  3FXQ A;  2VBW A;  3GLL A;  5B3S H;  5DM7 F;  5EGO B;  3CJT B;  1IRZ A;  1O7L A;  4RB2 C;  5DYM A;  1XB4 A;  2BVL A;  4BJ5 C;  3FXU A;  3U9G A;  2DCE A;  3IC7 A;  2NXN B;  4PSW A;  2L54 A;  3K0L A;  4Y17 A;  1JUP A;  1MMG A;  1VQ7 I;  2KJC A;  1E3H A;  4JOM A;  4EQQ A;  2PJP A;  2OZU A;  3GO5 A;  1RR8 C;  5K1Y A;  3W3C A;  2NS0 A;  1IDY A;  1SAN A;  2DA1 A;  1WJD A;  1BJZ A;  2DA5 A;  2OD5 A;  2HYJ A;  4A3D J;  3H5A A;  2NVT J;  3FXR A;  4IOC F;  2CG4 A;  5H6R A;  5IOZ A;  4N9H A;  2LDU A;  2DFE A;  4UV9 A;  1MH4 A;  2W25 A;  3BDD A;  2BY3 A;  2HFH A;  3HKZ A;  3TMO A;  3CUQ B;  3JRG A;  4C2T A;  4MLO A;  1V55 H;  1SD5 A;  2FEZ A;  3DWL E;  2V9P A;  4HLX A;  3GYH X;  1R4N B;  5FRO A;  3CDI A;  2PLY A;  3H3U A;  4J00 A;  4C2U A;  4FHT A;  1IDZ A;  2CV1 A;  1OFC X;  2P8T A;  3SDB A;  2O0Y A;  2F4I A;  3LOC A;  4HNT A;  3RZO J;  4BGD A;  2K02 A;  2L9R A;  2K4B A;  5LEJ A;  3AAF A;  2QSG X;  4ZTJ A;  2Y2Z A;  3WGH A;  5EF6 A;  4DYQ A;  4PK4 A;  2CW0 F;  1ZHF A;  3FXL A;  3QYE A;  4XLE A;  1RET A;  2G7U A;  3DTI A;  2XVC A;  3ZQF A;  2E35 A;  2FA5 A;  1HST A;  2KT0 A;  4U7D A;  3RQI A;  5M5X J;  4A3I J;  2A68 F;  2GOM A;  3FMQ A;  4UB6 C;  3PFY A;  3ROU A;  1ULY A;  5D5W B;  1H88 C;  5TJJ A;  2YX4 A;  2A3S A;  3NAU A;  3FK7 A;  2XRO A;  3CMM A;  3T8T A;  2ZFU A;  5J40 A;  2QQ8 A;  1TW3 A;  2I5U A;  2UXX A;  2DW4 A;  3BR0 A;  3DFG A;  2K3P A;  2YU9 J;  4IRI A;  1XN7 A;  1ZGA A;  2XAQ A;  4I0A A;  1E2X A;  1DU0 A;  1OYI A;  4WXD A;  1BA5 A;  3PUF A;  2EQR A;  4UXN A;  1BJA A;  1MMA A;  1RES A;  2E60 A;  2EA4 A;  3ABT A;  4S05 A;  5BPI A;  1MBK A;  3SFI A;  2X0L A;  4BE2 A;  2NOG A;  1PUE E;  3G4S I;  3G1M A;  5KK1 A;  3JTH A;  4XON A;  4EJO A;  4FX0 A;  1XCV A;  3M8J A;  2NVQ J;  1U5T A;  1V5E A;  3CC7 I;  1HLV A;  2CQQ A;  2A6H F;  4LIU A;  4D0P A;  2E7X A;  1E3P A;  4EMS A;  2JA6 J;  2HOS A;  2KZV A;  3IWF A;  1TZL A;  3FF5 A;  1A6I A;  5GPA A;  2XB0 X;  3GTP J;  1ORK A;  3BTI A;  3BG9 A;  3BZK A;  1HKT A;  2P7C B;  2QQA A;  3ERM A;  3BR1 A;  1FP2 A;  1TQI A;  2BHZ A;  3VYU B;  1SC7 A;  1FYL A;  2LKS A;  4KN7 X;  5CVI A;  2EFO A;  1T38 A;  4E7L A;  1G3Y A;  2VXD A;  1U9N A;  3SQN A;  2RGV A;  2LY9 A;  2HPM A;  2LRD A;  3ABU A;  3HHH A;  3J7Y J;  2VOD A;  2EFW A;  3GTG J;  1GLN A;  3F22 A;  1P92 A;  2GBY A;  2O61 A;  2COM A;  2IEK A;  2ZXJ A;  5KAI C;  1QGP A;  4G12 A;  2NVX J;  3I4N J;  1DPU A;  4QLC U;  1JJ6 C;  3A02 A;  4DZJ A;  2VC1 A;  3GZN B;  3D5S C;  4IO9 F;  1D0Y A;  1FIP A;  1WQ2 A;  1BI0 A;  1Y39 A;  2QEX I;  3HOW J;  5E3O A;  3S2W A;  3FMR A;  4RLF A;  4C3J J;  4I98 B;  1B1B A;  2W00 A;  1E0E A;  1T39 A;  2BBY A;  1QA6 A;  3BR3 A;  2KZG A;  4JP0 A;  1GHC A;  1QO0 D;  3GFI A;  1X1D A;  1MGT A;  1MSF C;  3QOD A;  1U2W A;  4HNU A;  1KU7 A;  3V8L A;  5E8G A;  1A5J A;  1YX3 A;  2IA0 A;  4IHT A;  4XN3 A;  4QWQ A;  1R5G A;  1E17 A;  2WAF A;  2HDW A;  4UVA A;  3C1D A;  3RI4 A;  3SZP A;  1OLT A;  4CYD A;  3TO6 A;  2R7R A;  4ESJ A;  2E36 A;  3H3Z A;  1XSD A;  3L2U A;  1T8I A;  2IGM A;  4Q4Z F;  1R58 A;  3MKZ A;  3JCU C;  3LSK A;  2K7L A;  1FMV A;  4G7H F;  2K9N A;  5F1J A;  2YR2 A;  3F23 A;  2K9Q A;  3OMY A;  2Z9O A;  1JI8 A;  2G9W A;  3S14 J;  4P9U A;  1MJB A;  2MGQ A;  4CCL A;  3KZZ A;  2LRE A;  5FKK A;  3V7S A;  1XGN A;  2DJN A;  3L2R A;  3KZI C;  3K70 D;  4RBO A;  3H3V K;  1AWC A;  2HQR A;  1F9N A;  5K5R A;  3GZ6 A;  3RKQ A;  3BY6 A;  5M3F J;  1VQK I;  1Y0N A;  1LEB A;  3PIP F;  2CWE A;  2RV8 A;  4JQF A;  1UST A;  4M6V A;  2ACJ A;  2Z99 A;  5D6F A;  3QYB A;  1EH7 A;  2GOX B;  2DTR A;  3KPH A;  4I7H A;  4PSX A;  3WGI A;  3HOT A;  4E7K A;  1MDM B;  4A3G J;  4U7B A;  3SHF A;  2ECB A;  3Q0V A;  4O6J A;  1XGS A;  1D0X A;  1XSV A;  5LFA A;  1B8I A;  4Q47 A;  1K4S A;  3WU0 A;  2V4J C;  4A6E A;  5JR3 A;  1B4A A;  1NK2 P;  1ITY A;  4RGS A;  3K4L A;  1Z7U A;  4CIC A;  4BAC A;  1X2N A;  3SZT A;  2V1N A;  1YS6 A;  2VC0 A;  2XGC A;  3LSI A;  3AFH A;  4RB1 A;  1WFX A;  2X6W A;  5GTI C;  4BE1 A;  2DOE A;  4FQG A;  2XGX A;  3EPZ A;  5K7H A;  4YFK F;  1C0W A;  4D5F A;  3QPT A;  2CSO A;  2IGO A;  3JRI A;  3WHB A;  3KYD B;  2MD5 A;  4V2G A;  2JPC A;  3F6V A;  3HOU J;  2MYS A;  1JTY A;  3EYY A;  3O2P E;  4LJZ F;  4CA0 A;  4XRS A;  1D5Y A;  2BXY A;  3KET A;  1OJL A;  4J19 A;  3FM3 A;  2LH9 A;  2R7V A;  2LOO A;  1YS7 A;  5IP9 J;  3FXJ A;  3HC7 A;  3E6M A;  3G73 A;  4AWX B;  2ISY A;  3WTW C;  2ISZ A;  2CW8 A;  1FLI A;  3EYI A;  4AYB N;  3OOP A;  2WB1 A;  4BXF A;  2CH0 A;  2HYG D;  2QBY A;  1DGR M;  2DBB A;  2F4O B;  2TRT A;  1AA7 A;  5TRD A;  2MD0 A;  5HLT A;  1VQ8 I;  2EV6 A;  1G6N A;  1SMT A;  4ETS A;  2DLL A;  4EM1 A;  1TL8 A;  5E3M A;  5AIQ A;  3OS1 A;  3F8N A;  4IQJ A;  3O3K A;  4HPQ A;  2E1N A;  2NOJ B;  2O5R A;  4IOA F;  1MNE A;  2HPI A;  3LWF A;  5J8C A;  4XLH A;  2RNG A;  2XRL A;  1W0U A;  4D5C A;  4RAG A;  1B72 B;  2X6Y A;  5HS8 A;  5CPR B;  3OYL A;  4IJA A;  2DMP A;  4PJN A;  1JHH A;  2B9S A;  3LL7 A;  1YQA A;  3OV8 A;  3BPV A;  4KIT B;  4AM3 A;  1X19 A;  2XHK A;  3HJE A;  1I6X A;  1XDU A;  2KPM A;  1X1B A;  1MH3 A;  3CJN A;  4S04 A;  2IP2 A;  1J5Y A;  3EQL F;  2WV0 A;  3H36 A;  4Y3O A;  2GIV A;  4OOI A;  4CYC B;  1IRX A;  1FX7 A;  2XGE A;  2KRF A;  2X6O A;  4NC6 A;  3VYT B;  2R5Z B;  2D45 A;  3T5X A;  2DO7 A;  2OC6 A;  1HDP A;  1OCP A;  4DBR A;  4HRI A;  4M6Y A;  1YRN A;  5KHD A;  3MFK A;  2ETH A;  3J80 K;  4P9F A;  5BPD A;  3SFZ A;  1ETO A;  4HZF A;  5IP7 J;  4C3H J;  4EVI A;  1JKQ C;  3BG7 A;  4XLC A;  4II3 A;  5J1R A;  1SAX A;  3ZP5 A;  1PDN C;  2GAU A;  4A3B J;  2Z33 A;  3QU3 A;  1KA8 A;  3UR3 C;  2PX9 A;  2KQR A;  3VDX A;  2CV2 A;  4QPO A;  2E7W A;  4A2U A;  4MGR A;  1SFK A;  4BHC A;  3CCM I;  5D5X B;  4AIK A;  4BJ6 C;  1YJW I;  4JK1 X;  4I6Z A;  5HDK A;  5L3F A;  2R7F A;  3LST A;  3W6V A;  1BL0 A;  2XAJ A;  4G6T B;  4LLG F;  1FSH A;  3NWS A;  1MBF A;  2Z3Y A;  3G71 I;  1CQT A;  1OCT C;  1REP C;  4BQN A;  3EET A;  2W7N A;  2FQ3 A;  5DM6 F;  2XGD A;  1QU3 A;  1G8X A;  4OIP F;  2DDB A;  2EB7 A;  2VXZ A;  4RS8 A;  5C3E J;  2R7D A;  2QUF A;  1VQP I;  2D5V A;  5FLV A;  1NG7 A;  2B63 J;  1WZ2 A;  1ETW A;  3H9Q A;  1O3T A;  4EJU A;  5DEQ A;  5LGN A;  3J7Z I;  2WAD A;  1IW7 F;  3CD6 I;  1KQ0 A;  3BG6 A;  2LLK A;  1GT0 C;  1U3E M;  3A2K A;  2DDA A;  1KYZ A;  1XMX A;  2XAG A;  4M3B A;  1I1G A;  2A69 F;  3IHU A;  2IGN A;  3ZQ7 A;  2BZT A;  3Q3S A;  1Y8R B;  1A35 A;  1VQN I;  2RNJ A;  1Z67 A;  2H8W A;  1HCR A;  3HOZ J;  3IRQ A;  1Y0U A;  3NRV A;  2VJ5 A;  1S72 I;  2WAE A;  4E7I A;  5CQE A;  2L7Z A;  2P6T A;  4ZH4 F;  3H0D A;  4BE0 A;  4M72 A;  3OYM A;  4BEH A;  3ZQQ A;  4IPA A;  2V1X A;  3RPU D;  2KMU A;  3Q9S A;  2P4W A;  1UG2 A;  2EK5 A;  2TCT A;  4LIV A;  2DTZ A;  4I02 A;  3CF5 F;  1S29 A;  3V7R A;  2E5N A;  2WY7 Q;  2JT1 A;  2O8X A;  2I8D A;  1YI2 I;  3K1M A;  2LKX A;  1M1E B;  4HEA 2;  1MD0 A;  1IXC A;  1A36 A;  3F0C A;  1PYV A;  2R93 J;  3OIP A;  1T95 A;  4BL0 B;  3GEZ A;  3S17 J;  3A1Y A;  2ZSH B;  3CCJ I;  2R7S A;  1TTY A;  1CF7 A;  1ZRD A;  4E70 A;  2WAQ A;  1R5I D;  5CKT A;  3G1L A;  2W85 A;  2VE9 A;  3MD2 A;  1Y6I A;  3BR6 A;  4A3L J;  2FE3 A;  3KEY A;  1ZEL A;  3R6S A;  3AG2 H;  4Y15 A;  4AIH A;  2GLO A;  4UVB A;  2EZK A;  3VSL A;  2ELH A;  2FML A;  2M5W A;  2HXI A;  1RIO H;  2XPW A;  2Y0S A;  3SEZ A;  2CU7 A;  3ZXS A;  4L9N A;  3LSR A;  3TW6 A;  3J80 Z;  3J81 K;  3DKW A;  3T0Y A;  4H0E A;  2Y9Z A;  4ZYA A;  3CDL A;  4W97 A;  3ZMZ A;  1K7A A;  1GV5 A;  4A0X A;  1ZG3 A;  3A01 A;  1S7A A;  5F64 A;  2O03 A;  3DPU A;  5DCM B;  1R1V A;  3OYD A;  4OMZ A;  2FBK A;  5ERI A;  2R92 J;  1SMY F;  2IPQ X;  4EJT A;  3VYR B;  3GX4 X;  4BQQ A;  2ME6 A;  4IEJ A;  3ZOB A;  2QGU A;  1H9T A;  4OAZ A;  2RQQ A;  2LG4 A;  2BE5 F;  2DT7 B;  3I9V 2;  2BW3 A;  1V3F A;  1ZKG A;  5K5O A;  1RKW A;  1PUF B;  1GUU A;  3SDG A;  5JVT A;  2XF6 A;  3GFL A;  3D0S A;  5IYD J;  2PMU A;  2CQ7 A;  2VKV A;  3DEU A;  4LK0 F;  3WTY C;  4EEF G;  5D6E A;  2FRH A;  1DPR A;  3Q5F A;  2BOL A;  4Y4R A;  5EZG A;  4PGG A;  2D2W A;  1TBX A;  1UG0 A;  1FYM A;  5HLI A;  4EAT A;  4OAY A;  1FPQ A;  4E7H A;  3ZQC A;  1BI3 A;  4PGH A;  5ICC A;  3LSP A;  2BYV E;  4Y13 A;  3P7N A;  1EJ9 A;  2OU2 A;  3H9J A;  3LA2 A;  1MBG A;  4XNF A;  4BY7 J;  4XK4 A;  2LKP A;  1V54 H;  2VQH A;  2B7E A;  4IHS A;  3HHG A;  3VFZ A;  1FBQ A;  1W36 C;  4KMF A;  4XRS G;  4HG2 A;  3PSI A;  2MBF A;  2PFB A;  1QBJ A;  2YX7 A;  1K4T A;  4GGG A;  1PP8 F;  3EUH A;  1TQP A;  4XSX F;  1G3W A;  1P4A A;  4M3F A;  3OYJ A;  3CME I;  1QVU A;  2ZFW A;  1HKS A;  5C44 J;  3HM5 A;  3JRH A;  4WF2 A;  1ZR4 A;  4RAY A;  2AO9 A;  3DP7 A;  4JX4 A;  3WE2 A;  3BG3 A;  5JLX A;  3EUA A;  4I0B A;  3H9G A;  1LDD A;  2C6Y A;  2O7O A;  3K2A A;  1RRJ A;  3G2B A;  5C4X J;  1BR4 A;  5L3G A;  2PMZ A;  3K9T A;  1VQO I;  1TP4 A;  3E6B A;  2F5C A;  4ZDP A;  2K85 A;  2VAS A;  1LPQ A;  1QPI A;  4BBR J;  1FTZ A;  4FT8 A;  2I10 A;  3ABM H;  3CMY A;  1EV7 A;  3NWT A;  4UY8 I;  2QSF X;  4DOZ A;  3J81 Z;  3GCM A;  2RVC A;  2H1K A;  4OIO F;  1W7P A;  3IV5 A;  2VQG A;  3CCU I;  1EF4 A;  3R4K A;  3HOY J;  5DUI A;  2CFO A;  4M3D A;  5L3B A;  5B5E C;  4CH7 A;  5FO5 A;  2HS5 A;  2E34 A;  5BNG A;  4BYY A;  4AC0 A;  5EGO A;  4NUB A;  2EIK H;  4KIG A;  2M4G A;  4HNV A;  4NBQ A;  1G4D A;  1XS9 A;  3MMY B;  2Q8K A;  5E17 F;  3MKL A;  2PJR B;  1DGW Y;  1Z91 A;  3DBL B;  3F6O A;  3S3O A;  4KIS A;  3FIS A;  1FOX A;  1YE9 A;  3S93 A;  3RDI A;  1W1W E;  1K6Y A;  1BI2 A;  4MTD A;  2HEO A;  4QTR A;  1BIB A;  4A3J J;  3JW4 A;  1I39 A;  4HBL A;  3HOX J;  2YSR A;  2L4A A;  1MJ9 A;  4L5E A;  2GIZ A;  5JFR A;  2CV0 A;  2EZH A;  4QSH A;  4ESB A;  1DP7 P;  1MBH A;  2DI3 A;  4XKW A;  2E71 A;  3KP2 A;  3OYC A;  3PUB A;  5FD5 A;  2LMD A;  2W4S A;  5J47 A;  4LLN A;  2W1O A;  1HDD C;  1D1C A;  2KIS A;  4DYR A;  3OYE A;  3HRS A;  2QQB A;  3CUQ A;  1RI7 A;  1R6R A;  1ETK A;  3ZQL A;  1NHA A;  1SVO A;  4AIJ A;  1E3O C;  1RR7 A;  1VQ6 I;  1J0R A;  4I99 C;  2M87 A;  4F7Z A;  1TNT A;  1RUN A;  2VON A;  3RKY A;  3AG3 H;  4HA8 A;  5E1X A;  3KEQ A;  1FJL A;  3S1R J;  4N0B A;  1HQC A;  4E7J A;  2Q2E B;  3PIO F;  3VEP A;  5KNL A;  1S9H A;  1JUM A;  5H20 A;  4LB6 B;  2H27 A;  2JMW A;  2KKO A;  2M0M A;  1D5V A;  3F8B A;  4FAS D;  1XCB A;  2KJB A;  1I1S A;  2PG4 A;  2H6B A;  4HX4 A;  2VOP A;  3F3X A;  3IAS 2;  2KFD A;  2ZB9 A;  4KIF A;  2ZBK A;  2MH9 A;  1GVD A;  1S7O A;  5HNH A;  1R1T A;  3L2Q A;  4UV8 A;  4F91 B;  1GV2 A;  1TQM A;  4A3E J;  3FIW A;  5B66 C;  4BDZ A;  2CUZ A;  3ZQI A;  4ENJ A;  1F43 A;  3E5U A;  5FJ8 J;  4LOC A;  4HYE A;  2JA7 J;  1LQ1 A;  2LVS A;  2QA4 I;  4KYW A;  3M7G A;  2XSJ C;  1FIA A;  1TWF J;  2HI3 A;  3KP7 A;  4XM3 A;  2JA2 A;  4DGW B;  1YHQ I;  1J9I A;  4UUS B;  1AOY A;  3TDZ C;  2BY0 A;  2PMH A;  1R71 A;  2M8G X;  4XID A;  3UKG A;  1HSJ A;  1Z6T A;  5FB2 A;  3JSP A;  1IGN A;  2VLA A;  2CQX A;  1U5T C;  3AL0 B;  4CZZ A;  2XSD C;  2R7U A;  4U88 A;  3EUK L;  4CCK A;  4RA2 A;  3GFM A;  1OIS A;  2E2H J;  3DKY A;  3ECH A;  1U78 A;  3G6E I;  2OPT A;  2E2I J;  4FET A;  1VQ4 I;  5DUK A;  4WWC A;  3OIO A;  5FD6 A;  4YFX F;  5HDG A;  3D5R C;  4BDY A;  2A5W A;  2HKO A;  3HKZ N;  1OCR H;  1KU2 A;  3FMS A;  3IKV A;  1S8N A;  2DA6 A;  2OUM A;  4ZYH A;  1ZLJ A;  1CGP A;  3EDP A;  1LFP A;  4ASN A;  2A61 A;  1ZR2 A;  4IHY A;  1R7J A;  2R4G A;  1QQI A;  1X3U A;  4BH9 A;  3IL2 A;  1SFU A;  3A4C A;  4Y33 A;  2F5F A;  2FMY A;  3KIO A;  2DA3 A;  2E1M C;  3I54 A;  1WHU A;  3E1S A;  2JN6 A;  4XL9 A;  1GVJ A;  4I76 A;  4EGZ A;  1XDS A;  1FSE A;  3F8F A;  5TIS C;  2HKX A;  5DD8 A;  1O3S A;  1WCM J;  3HBL A;  3QOP A;  2P0W A;  1WGX A;  1MKM A;  3RIR A;  2O9L A;  5FGM A;  3VWB A;  2CUE A;  2JJ7 A;  4G8X A;  5EEA A;  1WSU A;  1WI9 A;  2DAO A;  2W24 A;  1TT5 B;  3REO A;  3BTJ A;  4K2E A;  5ICE A;  1YJ9 I;  4L5J A;  1U9O A;  3WTX C;  5J4V A;  3JRC A;  1XTA A;  1NH3 A;  2WY8 Q;  3BTC A;  1OPC A;  2WWY A;  2R5Y B;  3WE3 A;  2YPR A;  3BZ6 A;  2M30 A;  3CF2 A;  3FWE A;  2MSY A;  3IH4 A;  4GYG A;  2EFP A;  3OSG A;  2Y75 A;  2QF7 A;  4X1E A;  1EH6 A;  4M3E A;  2DQR A;  3H0G J;  3S1N J;  3F8C A;  1TWA J;  3BTL A;  3KP3 A;  2ESH A;  1FZP B;  4LB5 A;  3BC8 A;  3GVA A;  4HLY A;  1WJF A;  3P9K A;  5EEH A;  2ZXI A;  1L0O C;  3W2W A;  3CQZ J;  4MQV A;  4XQF A;  1XD7 A;  5M3M J;  2H6C A;  1VND A;  3ELK A;  1FWZ A;  3TW7 A;  1S3J A;  1IC8 A;  4L0Y B;  2PEX A;  3SYT A;  4O5V A;  2VI6 A;  1IRF A;  3KP5 A;  5K7Z A;  4UUV A;  2EH3 A;  4U0V A;  4CGZ A;  2GA1 A;  2X85 A;  5J3L A;  3E6D A;  4MFD A;  2O8K A;  2QVO A;  1W5T A;  5GAG J;  2CUF A;  5FKO A;  1BC8 C;  1JKO C;  2Z1D A;  3W6J B;  3K10 A;  1TW2 A;  1D0Z A;  4PFO A;  5EDN A;  4XOP A;  1X2M A;  1SD6 A;  3MN2 A;  2A6T A;  2ZJ2 A;  5D8L B;  3I55 I;  3H35 A;  4XLA A;  1ACI A;  3DBR B;  1EH8 A;  3KYC B;  2M7B A;  5ICG A;  2R7T A;  2F5D A;  4KFC A;  4XOR A;  4RB3 C;  1KU9 A;  5GPC A;  3P9C A;  1WKM A;  2LF8 A;  3O6B B;  2DFI A;  1XSX A;  2FOW A;  3U1D A;  1MDM A;  1ZRE A;  3DEE A;  1FNN A;  1FOK A;  4RGR A;  3M07 A;  2V7F A;  3BP8 A;  1ZAR A;  1X4P A;  2DT6 A;  2LR8 A;  4KDP A;  2M9H A;  4FCY A;  1QZE A;  2VKD A;  4ZYE A;  4MFE A;  3OL3 A;  5ILS A;  4RGU A;  3ZPL A;  3GTM J;  1POG A;  2IS4 A;  1IN7 A;  3ZMV A;  2BVM A;  2F4M B;  1W36 D;  1VQ5 I;  2IA2 A;  3KCC A;  2M3A A;  4IVN A;  4DIQ A;  3DTK A;  3S16 J;  4BHB A;  3CJR B;  3KE2 A;  4B44 A;  3HUG B;  1W5S A;  3TP0 A;  4D7N A;  3CES A;  1JHF A;  2DOA A;  2K5C A;  1MSE C;  1R5H A;  2EIN H;  3HB9 A;  1JKR C;  1UAA A;  1PP7 U;  2VOO A;  3I59 B;  4GDF A;  1ZGW A;  1G3T A;  5E3N A;  1I5Z A;  1Z1D A;  2GXB A;  1R4M B;  2CMP A;  3K6G A;  5HOD A;  2F2E A;  1ZGJ A;  4A3C J;  2R7X A;  1ERD A;  5FRM A;  2LYC A;  4RLQ A;  4XR6 A;  4XLN F;  1BN5 A;  3D5L A;  1X3Z B;  4P55 A;  1IRG A;  3C2H A;  3CO7 C;  5EJC A;  1HXD A;  5CVV A;  1J7K A;  1UCR A;  1D1B A;  3OY9 A;  2M34 A;  3L00 A;  2PI0 A;  1XX5 A;  3A0B C;  3QP5 A;  3R61 A;  4NC7 A;  5J1U A;  5BMZ A;  3OS2 A;  2FNP A;  1S5L C;  4BBS J;  1B72 A;  2ELJ A;  3N05 A;  4XKC A;  2BY1 A;  2R7O A;  1ZN2 A;  2KIQ A;  3OYG A;  2X48 A;  3FHN A;  3S3N A;  4KJZ A;  2ZO4 A;  1WI3 A;  2ZJQ F;  4NB5 A;  1O3R A;  3COA C;  4CHU A;  3LQQ A;  4AD9 A;  1IN4 A;  4CXF A;  1HOM A;  1SD4 A;  4CYC A;  3S1Q J;  3BCA A;  5IP6 A;  2DJI A;  4PJM A;  3O8H A;  2XRN A;  4N4O B;  2F5E A;  2BV6 A;  3OOU A;  1YLF A;  1TWC J;  2NS7 A;  4E6K G;  2L9S A;  3V8K A;  3KZY A;  4IXA A;  3ECO A;  3D1N I;  1FOY A;  2OA4 A;  2ECC A;  5IYB J;  1P4X A;  2BY2 A;  3FHZ A;  4EM0 B;  4P5O A;  2HOE A;  2MC3 A;  3CMA I;  1HW1 A;  4WXC A;  3L09 A;  4PZJ A;  2DA7 A;  1JE8 A;  3GTO J;  1XC5 A;  1ETX A;  2RQP A;  5E1Z B;  3ZRG A;  2IBD A;  4CDG A;  3BG5 A;  4ZZL A;  5DS9 A;  3QPL A;  2QBY B;  4S0H B;  1LDJ A;  2LBF B;  4DW6 A;  2HGC A;  4Y7N J;  3FX3 A;  5CQG A;  4EJW A;  1TLH B;  3TQN A;  4CCM A;  2WA0 A;  3CCV I;  3Q0U A;  3K2Z A;  3H1C A;  3BJO A;  2E19 A;  1JTX A;  2CO5 A;  2LP0 A;  2ADU A;  3H5R A;  2WB1 N;  3KLN A;  3I71 A;  3W2A A;  2OTJ I;  1K78 A;  2L7F P;  3M4O J; 
#chains in the Genus database with same CATH homology
 3AG4 H;  2EIK H;  2OCC H;  2EIN H;  5B1B H;  1OCR H;  1OCC H;  1V55 H;  2EIM H;  3AG2 H;  3ABL H;  3ABM H;  3WG7 H;  2EIJ H;  3ABK H;  3ASO H;  1OCZ H;  2ZXW H;  5IY5 H;  2DYR H;  3AG1 H;  2EIL H;  3AG3 H;  1V54 H;  2Y69 H;  1OCO H;  2DYS H;  5B1A H;  5B3S H;  3ASN H;  3X2Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...