2EIKH

Cadmium ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 26
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 2eikH00
3WG7H 2EINH 3ASNH 3X2QH 2EIKH 1V55H 1OCZH 2EILH 2ZXWH 1OCCH 3AG4H 5B1AH 2OCCH 2DYRH 2EIMH 1V54H 2DYSH 3AG1H 3ABLH 3AG2H 2EIJH 5B1BH 3ASOH 5B3SH 1OCRH 3ABMH 3AG3H 5IY5H 1OCOH 2Y69H 3ABKH
chains in the Genus database with same CATH superfamily
4HF1A 5E17F 1IN6A 3I55I 3K7AJ 4CYDA 3ASNH 5GADJ 2YU9J 3JAMK 1BJAA 1TLHB 4EMSA 5M3FJ 4CH7A 4Y13A 2H6BA 3DKYA 2EIMH 1VQ8I 4Y4RA 1QO0D 3WTYC 1DP7P 1EH6A 3IHUA 1NG7A 2A68F 4BJ6C 2CO5A 4XLPF 4I99C 4RB2C 2IA0A 1SD7A 4QPQA 3BOQA 4BUPA 3PNVA 3DLLF 1CQTA 5B3SH 4GGGA 2CV0A 2BOLA 3CLOA 1U78A 1J0RA 2LBFA 2V9PA 4LOCA 1XPXA 2VE9A 1V5GA 4HSTA 2KJBA 1Y6IA 4BBSJ 2V6CA 2Y0SA 1ZREA 3CCYA 1VQOI 1RRJA 2D1HA 4M73A 1B9NA 3KYCB 1STZA 3TW7A 1QBJA 1EV7A 2GAUA 3MCZA 1J5YA 2IA1A 3KP5A 3E5QA 4RLQA 3IWFA 2RV8A 2LH9A 1JKPC 2COBA 2Z1DA 4XLCA 3GEZA 2AQFA 3R0JA 3M3YJ 4XBFA 1QHGA 4RAZA 3JSOA 3LSMA 1BN5A 2E1CA 3ZMVA 4WF2A 2O61A 2Y9YA 2STWA 2LYCA 2NYXA 1UHMA 4NHJA 5K5QA 2XRNA 2R0QC 5E20A 5JLWA 3OOUA 2QKMB 1MBJA 4IOCF 3H5RA 2VLAA 3CCMI 3J7AO 4M71A 2CRGA 3HC7A 2F5FA 1OQYA 3HUGB 5CQEA 4YG2F 3GO5A 5LHHA 2EQRA 2VN2A 2JA5J 2JA6J 2MSYA 2Z5UA 1VI0A 1XGOA 2K5CA 5E8GA 4OIPF 3NRVA 2DMPA 1BC8C 5DD8A 2X85A 2PBIA 4EJUA 4AIJA 4ZJZA 4LG3A 3J80K 3M1CA 3QPLA 5EEGA 3OS2A 2COMA 1JE8A 3K4BA 4XRFA 2FD5A 1W7PA 1R1VA 2L9SA 3A0HC 4N4NB 5DV5A 3WTXC 4HF2A 2ZCWA 3IKTA 3I59B 1ZELA 1L3LA 3MKYB 1REPC 5C4XJ 4IRHA 2K9NA 2O7OA 5LFAA 1U5TA 2TDXA 3F22A 3BT9A 5KVRA 1FOKA 5FLVA 2DJIA 5DCMA 3SDBA 1BI3A 2WY7Q 5EZHA 3ABMH 4UB8C 2E71A 3M7GA 4M6XA 1OCOH 3AG3H 3FXUA 5HS7A 1B4AA 1MMGA 4EVIA 3VFZA 4Q4ZF 1H8AC 1ZRCA 1P2FA 2BV6A 2HQ5A 3JRFA 4IEJA 3GXOA 2V1XA 2XPVA 4AIHA 5A2QK 1FX7A 2FBHA 3SZGA 3ABUA 1O3RA 1ETWA 1BR2A 4ZH4F 1OKRA 3ZQFA 1WJEA 3FM3A 1VZ0A 1FP2A 5FFXA 1RR7A 2MH9A 4N9HA 5L3FA 1VQKI 2O8KA 1Y1VJ 2LKPA 4BS9A 5B5EC 3KIOA 2I5UA 4GYGA 3F8MA 3OIQA 5L3CA 3QU3A 2DT7B 2K40A 1OISA 1YS7A 5HDNA 3H9GA 4AYBN 3AFHA 3J7ZI 4BL0B 2NNNA 2XHKA 3C18A 1Z7LA 4KIBA 2EFOA 1VNDA 1A04A 3DBRB 2E1MB 1ZRFA 3DV8A 3R60A 4RAYA 4S04A 3BJAA 3F8FA 2V1UA 3AAFA 3SHFA 2E1MC 1OCRH 2R7SA 3F8NA 1BI2A 4UB6C 3SZTA 2QSHX 2LY9A 4E4HA 4UVAA 2LTPA 3BWGA 4BJ5C 5L3GA 2ACJA 2A5WA 3LSPA 1J09A 3MKLA 1LDJA 2AXLA 3K4JA 1O7LA 2DA7A 5B1AH 1T08B 2L0KA 1FSHA 1KQ9A 2K9SA 2JUCA 2PJRB 4WXCA 1D0ZA 1HLVA 1TBXA 2H6CA 3HKZN 4BXXJ 1I1SA 1QVTA 1ZR2A 1WI3A 4YFXF 1BW5A 1MJBA 1B8IA 2QBYA 2L3DA 1KZHA 1UG2A 3FBNB 5E3NA 4YFKF 3FKIJ 5ICEA 3S8PA 1S7EA 5DUIA 2ELKA 3CCQI 1JUSA 2VC0A 1ON1A 1TT0A 3C7JA 3TBIA 1ZRDA 1UFMA 4ASNA 3ZCOA 2VI6A 2TRTA 1R9TJ 5J4YA 1HW2A 2CYYA 2W1OA 4M3DA 3S2HJ 4A12A 2XPWA 2ZB9A 3RPQA 1UELB 2DN0A 2VBZA 3HSFA 4LG0B 2L02A 2DMNA 5F1JA 4GDFA 2PQ8A 4BDZA 2W48A 2OZ6A 1IUYA 1XMAA 5ILUA 4FX0A 2K9MA 2VIXA 1A6QA 1U0JA 2ZFUA 2Q1ZB 2X0LA 5D8KB 1D8JA 4PGGA 1WPKA 2K7LA 1H89C 2P6SA 2ZKZA 3GLLA 3VEPA 3WTSC 1AOYA 2VXDA 5M5XJ 3CMAI 3FXMA 3CCVI 3FIWA 1ORKA 1GV2A 3IV5A 4MNUA 2QQAA 2XVCA 4A0YA 3CF2A 5EG0A 1UHWA 2X1EA 3K9TA 5F0FA 2P5KA 3MD2A 2EFQA 4MTDA 5F27A 4UUSB 3T8TA 3CCJI 2XPUA 4EJWA 2FU4A 4C3JJ 2F5DA 3G4SI 1K4TA 2ISYA 3DQVC 4KYWA 3HRSA 3C2HA 2FX0A 5KHDA 4ESBA 4BE0A 2FQ4A 1R58A 2IEKA 3V8LA 5J8CA 4OWRB 3HRUA 2WB1A 1B72A 3JRIA 2ZMEB 4K2EA 1DUXC 3OOPA 3SXYA 1ZTRA 4X0GA 2BW3A 2O6GE 1XG1A 4ETSA 3S14J 2NVUB 2KIUA 2ZMEC 5B1BH 4RS8A 5IT9Z 1Z3YA 3RZDJ 2I10A 2DQRA 4FX4A 1S3JA 3VB2A 1BM9A 2A3SA 2WBMA 4BHBA 2R7XA 3BJOA 2QEXI 3DTKA 2F48A 2OTLI 3I9V2 2X6OA 3QOPA 2F4OB 2DXIA 2VKDA 2L2OA 1R1UA 2EFPA 4LGWA 2RQPA 4NB5A 1XDUA 4E6KG 3LWFA 3ONQA 2MC4A 3OYLA 3Q9VA 4M6VA 1YJ9I 2BBYA 3QAHA 3L7WA 3ABLH 1H9TA 3Q3SA 2EFWA 3OSGA 3SFIA 2WAFA 3EDPA 2Y0SN 5LHGA 4CHUA 2OF7A 1V3FA 2NS7A 3K4NA 4QTRA 3CTAA 1TW3A 2G9WA 3CCLI 4A0XA 2JSPA 1JKRC 1A31A 1K83J 4A3IJ 3JRHA 2R7QA 1W0UA 4ZC3A 2VUMJ 4OAYA 2B7EA 2GWRA 2UXNA 4FHTA 3LFUA 4E7ZA 2W00A 3L2WA 2NVQJ 5AIPA 1WI9A 2DA1A 3E6DA 4B44A 5E18F 3W2AA 1MMDA 1TQPA 1YW8A 2DT6A 3OL3A 3QP5A 4M6YA 4J19A 4HA8A 4B3XA 2FMYA 3KYLA 3AG1H 3J81Z 5CVRA 1MIJA 1HSTA 2CUEA 2V1DA 5IYCJ 2Z99A 1GXPA 2ELHA 3LA2A 4PFPA 4CDGA 3OYFA 2FA5A 1Y8QB 1Z0XA 1OCTC 1QZYA 2HTSA 1GHCA 4I0BA 3CUQB 1I3AA 2M30A 4UXNA 4RAGA 5ERIA 3X2QH 5FLMJ 3DPUA 4ZZLA 1ZGAA 4A5MA 3KP2A 4HLYA 3CUQC 1XC5A 3B02A 1ZGWA 2QVOA 2KDOA 2GA2A 4DW6A 4LB6B 4HPQA 3F72A 2VQLA 4QWQA 4L5JA 4ABZA 3OYNA 3CMMA 2FNAA 4NNJA 4I6ZA 3CC7I 4GYIA 5JHFA 4KA4A 2Y30A 3RJPA 2O3FA 5D4RA 1ZGJA 2ZXJA 2G7HA 1RR8C 1JUMA 4PJMA 3Q0UA 3OV8A 1TWCJ 1FOWA 3SJMA 1YJNI 1K4SA 1CF7B 2CV2A 1R5HA 2DYRH 2G7UA 3HOVJ 3FMSA 2JVHA 3CCRI 3H3ZA 4HSRA 3HEFA 4ZYDA 3NARA 1H0MA 2EZKA 3OL4A 3QOEA 3HHGA 1D1AA 3JW4A 2R5YB 4E7LA 2KZVA 2V26A 1JUPA 5FKKA 4KMUX 2K9LA 3ZXSA 3RI4A 2MD0A 3WU1B 1TNTA 5EEHA 3W2WA 3O8HA 4I0AA 2FOKA 1PP8F 1Y0UA 3E3VA 5H6QA 4D5CA 5ICGA 2P7CB 3WTZA 4EV0A 2AHQA 1WJ5A 5KK1A 3HYIA 4BHCA 4UUVA 2XROA 4OIQF 3WHCA 3KX2A 1FNNA 1VQ6I 3HOWJ 4E7SA 4E7KA 4IHWA 1BJZA 4PDKA 2KISA 3VSKA 1PVEA 4XKCA 3S17J 1IUFA 2E19A 3BLYA 2IS2A 1GUUA 2GXGA 1FY7A 3FXQA 3B73A 1Y0NA 2LVSA 2VKHA 4B09A 4L9NA 2Q8KA 2LRDA 1FOXA 2LF8A 1NTCA 2XIGA 1UB9A 2OQGA 2QF7A 3C3WA 2XF7A 3U1DA 1V5FA 4II2A 3WE3A 4HDUA 3DPLC 2DLLA 2M2EA 5EDNA 2VQCA 1HKTA 2HDDA 4LLGF 2NS0A 3ZPLA 2KZGA 3PO3J 1KU9A 2L9RA 2HDWA 2CQQA 4NDLA 5B66C 3VYRB 3UNGC 3IC7A 4ESJA 3HOUJ 1IXSB 3U9GA 1QVUA 4BGDA 1AA7A 1FOYA 5IP9J 1DDNA 3HUGA 2CMPA 2X4HA 3B6AA 1MMNA 2IW5A 2QZ8A 3HPHA 4RGRA 2NOGA 2FNPA 2AS5F 1TW2A 4V19K 1M1EB 4IJAA 4M9XA 2PJPA 3EUAA 2KJCA 2DPDA 3QU6A 3M1EA 2KIQA 2P8TA 2R5ZB 2IS4A 4DYQA 4IX7A 1JJ8C 5EZGA 3G3ZA 1I6HJ 1W4MA 1VQ5I 4BKXA 1IXCA 5EJCA 3P9CA 4CCJA 5ED4A 5HDGA 4B47A 1BOAA 2IS6A 2KKOA 3KP6A 2HI3A 1IRGA 2WV1A 2OTJI 1OYWA 1UMQA 2H94A 3EUHC 4F93B 2WWYA 3G1MA 4YRVA 1Y39A 2GIVA 1YE9A 1GLNA 2BEOA 1U2WA 2EIJH 1XCBA 4XRSA 3PIPF 2JWTA 3HM5A 2BXZA 2PMHA 1G59A 4Y52J 5EF6A 2VE8A 5BMZA 3TQNA 3HB9A 5J40A 2TCTA 3FMQA 4B43A 2CV1A 4HZFA 3ABKH 5FKNA 5D5XB 5J8FA 2H27A 1N78A 2VJ4A 4LK0F 3S3MA 1MBFA 5GP9A 1ZG1A 4XSZF 1HKQA 1OR7C 2DA5A 1FLIA 3LSIA 1SC7A 5CKTA 1R71A 2E2IJ 3BG5A 2JN6A 5DYMA 1JXSA 4Z6YA 1PUFB 2IGMA 4KUMA 4EM0B 3VWBA 2IA2A 4YIRX 1O57A 3WE2A 2WB1N 6PAXA 2HQNA 2IGOA 2Y48A 1MNMC 1YI2I 4WK8F 3FXRA 1SD5A 2PMUA 5GPAA 4A3LJ 4PSWA 4ENKA 1VQPI 3DEUA 3L2RA 1V55H 1SVLA 1IW7F 2VT2A 3EUKL 2GA1A 4I76A 2M8EA 4XN0A 3GWZA 2IGNA 2GBYA 2RQQA 4IRIA 2Z33A 1LFPA 5M3MJ 1WH7A 4PK4A 3ZN0A 5DDGA 1MBKA 3L2UA 3QPSA 2PJRA 4QIWN 1D0YA 4HNTA 3K1PA 2PLYA 5FRNA 2L7KA 2CUFA 2P81A 3ZMZA 1KYZA 4W1UA 2CQNA 2DA6A 3HRMA 3IKVA 3H3VK 2R7UA 4DBRA 2KIFA 2P6TA 4ITVA 2P4WA 1BOBA 4NQWB 4AVZA 4IHYA 4A3JJ 1XDSA 1L0OC 1YW9A 3E5UA 3FMRA 3F8BA 2VB6A 1FYMA 2HXIA 4A69C 1HDDC 3CP8A 2LDUA 4D5FA 4M9SA 3K0LA 4MQ9F 2PMZA 2IVMA 5J3LA 3DU6A 3HZJA 2ZO4A 1Z77A 3BR2A 4IHSA 4A3FJ 4E7JA 3ROUA 3JRAA 3PSIA 1X2NA 1AHDP 1EJ9A 2GM4A 2N8GA 3VYTB 2BY1A 3WTVC 3ZQGA 2EINH 2KMUA 4ENMA 2Q2EA 3EQLF 1SAXA 5DEQA 4S05A 3RZOJ 2ZNYA 3GCMA 3AKZA 3CDHA 4EATA 2JPBA 2VPRA 1SD6A 3HL2A 1BI1A 2FUG2 4IQJA 1IV8A 5BPIA 1JGSA 4FQGA 4Y3OA 2DDBA 2R93J 2L7FP 3JSPA 4KNYA 3HSEA 3LSKA 3OYCA 1BL0A 4N0BA 1FP1D 3SEQA 2OAZA 4UUSA 3HOTA 2E2HJ 3TEDA 3VPRA 1ZG3A 3IWZA 4XOPA 4D7NA 2IXSA 2L01A 1IN8A 3FM5A 2AQEA 3FWEA 2X51A 1YFHA 2RC4A 3K10A 2X48A 1IN7A 4AD9A 2EH3A 2ZMEA 4EGYA 4OMYA 1R4NB 1V4RA 4RGXA 1N77A 2YU3A 3L2QA 3BR0A 2KDZA 4CZCA 3EYIA 2VL8A 4PJ0C 2HS5A 1FWZA 4BBRJ 4XLNF 1X3WB 5CPRB 4A3KJ 3NWSA 4RGUA 1BIBA 1XGSA 1FT9A 4RBOA 2DMTA 4Z2YA 3J7AY 3D5LA 3HJEA 3DKWA 3CD6I 1S29A 1ULYA 1S8NA 2CQ7A 2LFBA 4HDVA 5E1WA 2VKEA 1GDTA 4LIVA 1BBYA 1BC7C 2IP2A 2A05A 3DKXA 2VODA 1WJFA 4AVPA 4KFCA 4KT5C 1IXRC 2EFNA 1YQAA 3OYHA 1D1BA 1LKXA 2HOAA 1HF0A 3K1NA 2FF4A 3TO7A 4EEFG 1NK3P 4BNCA 3AL0B 2W84A 3BR3A 2ISZA 3RKQA 3GW2A 2BHZA 2L7MP 4LLNA 1MBHA 4AU7A 2X1CA 4FE7A 2WC2A 2EA4A 4A3EJ 2X1DA 3AL0C 4BQOA 5F0HA 1G3TA 3WTTC 1U9OA 3JRGA 3HOSA 3E97A 1JKOC 1TNSA 4BY1J 1I1GA 2M34A 1W5SA 4HQMA 3V8JA 2R7VA 4I7HA 1WHUA 2B63J 3MQ0A 5H2FC 1E3PA 2MLGA 2JK3A 3K2AA 3BZCA 2E35A 1XD7A 2R4GA 2DQLA 1J7KA 3FHZA 4KDPA 4N9IA 2NAZA 2OUMA 1F5TA 2MLKA 4UVBA 1ZN2A 3ML6A 2DOEA 3CZ6A 2EB7A 3R0AA 4IPAA 1WGXA 4BE2A 5DD4A 3IRQA 3CUQA 3BTLA 1QQIA 2PEXA 2OCEA 5HLGA 3S3NA 4KMFA 5FKLA 1XSDA 4M72A 1JTYA 2MH2A 4I09A 2VBWA 2JMWA 3S1NJ 2EA2A 1O7FA 4L5IA 1ETYA 4HRIA 1G3YA 1U6GA 2XGCA 1X19A 1VFCA 1R1TA 2QCOA 3KZIC 5EEAA 3MKZA 1MMSA 5GAHJ 4IZZA 3RCOA 4BQAA 2WY8Q 1MSEC 1BW6A 3GMEA 1SFEA 3OYEA 3HGYA 3ZQ7A 5LGUA 1SANA 3DPTA 2DFHA 3B6CA 3WU0A 5LEJA 3IAS2 5C4JJ 3PIOF 4BH9A 3JTGA 5IOZA 3PJRA 5J6XA 2B9SA 1MGTA 1Z05A 4OMZA 2R5YA 3FXOA 4WX9A 1JT6A 2PN6A 2W7NA 2CU7A 1XN7A 2JPCA 4AM3A 2L7ZA 3QPTA 1FIAA 2LREA 1UHSA 2VQGA 1MSFC 3FKJA 2X9DA 1WCMJ 3Q5FA 2K3PA 1VQ4I 1IDYA 5FKMA 3C2GA 2E60A 1N75A 5ICCA 1WJDA 2VJ5A 1VQ7I 2V79A 2IBDA 5C44J 3GVAA 2ICWG 1K78B 3ZQLA 1QZZA 1LPQA 2LK2A 1VF9A 3C1DA 3QYEA 2F5EA 3W6JB 1NHAA 1MDMB 4A3GJ 2E7WA 2E2JJ 3O6BB 3A0BC 1YG2A 2O0YA 3MFKA 2DFFA 3BTIA 5HS8A 3QQAA 3PFIA 2BYVE 2IJLA 4RM3A 2QYOA 2Y31A 1P9QC 4LK1F 5L3DA 2H09A 1IG7A 2Z3YA 3A01B 2A61A 5EGOB 5LGNA 5DS9A 3DXJF 1X1CA 2FRHA 4JP0A 1B59A 5DM7F 1FMWA 4B8XA 3GTKJ 3BR5A 2CQXA 5J1UA 4D9JA 4JBAA 4BU2A 5K7FA 4A5NA 2Y2ZA 2HU9A 2XAHA 2ZJQF 1FBSA 4I98B 1O3SA 1SAUA 2F6CA 2MFZA 1I50J 2MC3A 4HV5A 4F91B 4ENJA 3G1LA 1OCCH 2LSOA 2F4MB 5E1XA 3WG9A 4G7ZF 5DTDA 2MABA 3L2CA 3KFWX 2FSWA 4KITB 4I01A 2ETHA 4PUSA 3G71I 3S1RJ 2NS8A 2PG4A 1T39A 1UCRA 2R5ZA 4ZDOA 1T0FA 3R61A 3WTWC 1TP4A 5IY5H 1LE8B 2FOWA 3KEQA 3BG7A 5D5WB 2FQ3A 2M4GA 4LD5A 3G73A 2OA4A 4PJJA 2VT3A 4JK1X 1HCRA 3WHBA 3HIFA 4HX4A 2PMZN 4UHTA 3EUHA 4Y15A 2HOEA 2P0WA 2EBIA 2WV0A 1O3TA 5JVTA 4ZTFA 1ZARA 2NVTJ 2RNGA 4L5EA 4BEHA 4DOZA 3CCUI 4A3DJ 1RI7A 2Y9ZA 3M9AA 2XSDC 4Q5SF 1P4AA 5FGMA 4FT8A 3VYUB 2VBXA 3BR6A 3PL8A 1IN4A 4LFUA 2JTVA 5FFZA 1IRXA 3HOYJ 3ZQQA 5C3EJ 2VOOA 5LEKA 2LP0A 2CUJA 5FB2A 2JSCA 3GTPJ 1IDZA 3NEUA 3RIRA 3GLXA 4E70A 1YITI 1X58A 2LC2A 1RC9A 4XRMA 3ZMSA 4OAZA 4XIDA 1S7AA 2DODA 5FO5A 4W97A 3TL4X 5LD2C 4II3A 1WVRA 4DZPA 3EPZA 4XNFA 1R23A 3V7RA 2Q0OA 2DOAA 1I5ZA 4CSWA 5J1YA 2Z2SB 3V4GA 1KA8A 1GV5A 2WTEA 1BIAA 3PUFA 3I4MJ 1ERDA 4HOBA 1LJ9A 2MBFA 4AIKA 4R1HA 3CMYA 4A3MJ 3HG9A 3CQZJ 2XAJA 3REOA 3QP6A 3ISPA 1I39A 5LRSA 1ZLKA 4IL6C 5AIQA 1X1DA 1PUEE 2V9VA 2ID3A 2DYSH 3L09A 2XRLA 1XGNA 1XSVA 2Y0MA 4HV6A 3TKYA 1GT0C 1W5TA 1WZ2A 5KNLA 5D5UB 3QYBA 4A2UA 4CCMA 2EK5A 3HOXJ 1FZPB 3Q0WA 4XM3A 2O5RA 2OQRA 3LNQA 4S0HB 3DTIA 4L0YB 2QQ9A 4KJZA 5K7ZA 3UR3C 3T5XA 1LNWA 2IPQX 2XV4S 4NC7A 1SMTA 4XN3A 1S9HA 5TRDA 1MBEA 3IL2A 2QGUA 2PX9A 2O9LA 4MIMA 1FSEA 1U5TB 3BY6A 4YIFA 4NQWA 1U3EM 2FBKA 3E7LA 4EGZA 3S1MJ 4L9JA 4FTHA 2UXXA 2XB5A 4EM1A 5LBQA 1IO2A 3U21A 2HWVA 3IAM2 2VBYA 3MKWB 2XAUA 1U5TC 4U7BA 4U0WA 3KCCA 3R4KA 1YRNB 2STTA 3I3LA 3LQRA 2BY2A 2KPMA 3OYBA 1E3HA 1OMIA 1R6RA 2ESNA 4XKVA 2ELJA 5KAFC 4C30A 1DU0A 2HQRA 3RKXA 4O5VA 5FROA 1B9MA 1I27A 3FXJA 5IYBJ 2CFOA 3GTLJ 2MW8A 1F43A 5L3BA 2IRFG 1OYYA 2V6EA 2DMUA 1S5LC 3ECOA 1TWGJ 4I2OA 2ADUA 3LSTA 3GX4X 3K1MA 1DGRM 5IT9K 1G4DA 5GAEJ 5H6RA 3K4MA 3TW6A 1JTXA 4RM2A 5ILVA 2DI3A 2CFXA 3J7YJ 3F8CA 1RPWA 1UG0A 3P9KA 4F3QA 3K6GA 2VJJA 5K5OA 1TL8A 2HVRA 2ID6A 3KPHA 1FTTA 4DYRA 3FX3A 2JRTA 1FC3A 2WAQA 4HAMA 3DWLE 2JA7J 1B6AA 1SVMA 2KLOA 1T8IA 2CH0A 2DA4A 5BNGA 1ONVA 4IKFA 5E79C 4RB3C 1RETA 1ZQ3P 2MYSA 3ZMDA 1R36A 3OYDA 2NVYJ 3H1CA 2FE3A 3ERMA 1RKTA 3DEWA 3T0YA 5M5YJ 3QWLA 3GTGJ 5IP6A 2Z16A 1G6NA 1IRFA 2HPIA 4NBQA 3TGNA 4IHXA 1HA8A 3RSNA 1T33A 3H3UA 5KCMA 4BYYA 2A6HF 2EV6A 2M1BA 3CDIA 3FK6A 4X1EA 3R6SA 1W0TA 3RKYA 2L5QA 2UV1A 3CO6C 1IAWA 2GLOA 1ZKGA 4XQFA 5L3EA 3LA3A 2OJED 3J81K 4X6AJ 2G0EA 3CCEI 3ZQIA 3EYYA 3A02A 2M87A 3TO6A 9ANTA 2DAOA 3S93A 2NRAC 4CYCB 4UNOA 1OFCX 4RB0A 3L2VA 1HDPA 1JKQC 4XICA 3OY9A 1KYWA 4M3BA 4BXFA 1P4XA 1V54H 2V4JC 1WRJA 1Z9CA 3BPVA 1XTAA 5JVGF 3N4MA 5F0CA 3I59A 5FKOA 4CZZA 2HVQA 3BJ6A 1FBQA 5HLIA 2E5ZA 4XOTA 2W25A 2LOOA 2R7ZJ 2X6XA 3E6CC 3W3CA 1KONA 3WODF 4LLLA 4R79A 1Y8RB 3F9KA 4QLCU 4G6DA 1DQUA 5F1RA 3FF5A 4WWCA 3CMEI 4E7IA 3D5SC 3H35A 1LVKA 2O03A 1LEAA 4U0VA 4XLFA 2PFBA 4J00A 2CSOA 5JFRA 5FLXZ 3CESA 3OR1C 1ZAOA 2ME0A 1D5YA 1YW7A 2NOJB 2BY0A 3F21A 3CLQA 5HVQC 2CW8A 1B72B 1JI8A 5EYRA 2OD5A 3K2ZA 2CW0F 3E6BA 2E1NA 4GO1A 3JAMZ 1G2HA 2YX7A 3ZGKA 1BI0A 1S7OA 2BE5F 3BR1A 4P96A 2M4KA 4ANJA 2HTJA 2KHMA 2BZTA 3BTCA 4M3GA 2D2WA 4WXDA 2HEOA 2P5VA 4NUBA 4DJAA 4U0YA 4AUXA 1POGA 1EKEA 3QODA 3KP7A 4JX4A 3QYFA 3ZQHA 1KQ8A 4XLHA 5IOYA 5CVUA 2P7VB 1T2KA 3H9JA 2JRMA 3CF5F 4PGHA 1P92A 3S3OA 5GPCA 5FRMA 3F6VA 1HBXG 1IGNA 1QZEA 1D1CA 3E1SA 3MN2A 1IV6A 2HPMA 1EA3A 2NXNB 2ZXWH 2VPLA 4IQ4A 1I3QJ 2KP6A 1X4PA 3I4PA 2ZC2A 1TC3C 1TWFJ 3RPUD 3WU2C 1ETOA 1TWHJ 4G94A 1LFBA 2XF6A 5IYDJ 2JVGA 1A36A 4QPOA 3LSJA 2D5VA 4XKBA 1RZ4A 3CJQB 4V2GA 1XB4A 2E5NA 2ZFWA 3WGGA 4EJTA 2M45A 3CO7C 2QKLB 1YS6A 4MFEA 2QA4I 2XAFA 3P5JA 1EF4A 2QQ8A 3RYPA 1HQCA 1SMYF 3ZMTA 3PQKA 2HQAA 3BCBA 4DGWB 2X6WA 3ZN1A 3OWTA 1F1ZA 1UZCA 3IUOA 1XMKA 3KZZA 2RN7A 2QLZA 4RLFA 2J5PA 2EV5A 2F5VA 5HLHA 3A01A 1WH5A 2XSJC 5EGOA 3IH4A 2ZJRF 3G2BA 3ZR8X 3O3KA 1SD4A 1GVDA 3J80Z 2O8XA 4LG0A 3HGGA 3DBLB 2HR3A 1ZLJA 2LR8A 1HC8A 1X4OA 2BXYA 3S32A 4YFNF 3I4NJ 3PUBA 2L4AA 4FCYA 2XB0X 5TGTA 4KICA 4NC8A 3DEEA 1W36D 1MNDA 1HSJA 2XC7A 2DFEA 2FXAA 2K27A 3GYHX 4L9TA 3S2DJ 3TOAA 1TQIA 4HBLA 1YIOA 2XGEA 4FE4A 1PYVA 5E1ZB 4OU0A 3OMYA 3W2VA 1YIJI 3BC8A 3BQZA 1F9NA 1N25A 2M5WA 4RMNA 4HLXA 4HNUA 1DU6A 1XGMA 3IH3A 3WGHA 2H8RA 2BVLA 3SYTA 5A2QZ 3GTJJ 1LE8A 1Z21A 2K9QA 1U9NA 3DU5A 3BQYA 4N4OB 4IHVA 1ON2A 1QPIA 2R7TA 2R7RA 3KEYA 1MNEA 3KP3A 3PQJA 4DNCA 2VOPA 2M0CA 2QSGX 4DBQA 1W7PD 5J47A 1MKMA 3PFYA 2RGVA 5JR3A 1K6OA 3BG3A 1WJBA 4Y7NJ 1O3QA 3E6MA 4DIQA 4C2TA 3OYAA 4XKWA 4G6QA 1P7JA 1WWXA 1YYVA 2DDAA 3BPXA 4PJNA 3KETA 4J01A 3HBLA 1TQMA 2KRHA 2XGDA 5TJJA 1J75A 2OCCH 5BPDA 2JA8J 3S16J 3HTUA 3I53A 2KRFA 2LD5A 1LB2A 3DF8A 3CJTB 1QNTA 1Z91A 3LAPA 4G12A 1RUOA 3OR2C 2HNHA 4YELA 5K5RA 3H0GJ 1SEUA 1X1AA 5DCFA 2WAQN 2ZSHB 2W57A 4ZDPA 5F08A 1IC8A 2EWNA 5DUKA 4FASD 3A03A 1USTA 1LDDA 1XS9A 3M8JA 2EZIA 3ZQCA 4ZZDA 3KE2A 5ICFA 2JA2A 4H4KC 4ENNA 1IJWC 3AG4H 2PI0A 3I0TA 3T8RA 2M3AA 3SFZA 5CVJA 2IGKA 4RDUA 3FXKA 1R4MB 3K4LA 4UY8I 5F04A 5CYVA 3IH2A 4DYCA 3VDXA 2DW4A 2D45A 2W82A 2RDPA 1RUNA 4LB5A 4A6DA 3F23A 1J9IA 1MW7A 3U1KA 5E3MA 3MMYB 1Q1HA 1E3OC 1X3UA 3CUOA 2EJRA 3GZNB 4LITA 4BE1A 2VC1A 2JT1A 3MZ8A 3OYGA 5D6EA 1ZYRF 4CGZA 2J5OA 3K70D 5LHIA 1YTYA 3JRDA 2QSFX 4CCNA 3HTSB 3Q9SA 4P1WA 3TP3A 2GOXB 2ZBKA 1HW1A 4ON0A 3S2WA 2DPUA 4RB1A 4P5OA 2OV7A 3P7NA 4BAYA 1YRNA 1T95A 1ZHFA 4M3FA 1KU3A 3HOZJ 2HFHA 4M9ZA 5BS6A 1JHFA 2CGPA 1DPRA 3E5XA 4ZYHA 2YS9A 4AWXB 1QGPA 2KFDA 3H0DA 3NQOA 4U7DA 2I8DA 3JRBA 2E36A 1EH8A 2V9KA 2B0LA 4WXHA 4MFDA 2IT0A 1CF7A 1MH4A 4MQVA 2CG4A 1FIPA 3G6EI 5E3LA 2M0MA 1FMVA 2A07F 1D3YA 1H9GA 1LFUP 3I54A 1QRYA 4EM2A 2W85A 4L9VA 2CQKA 4JX5A 3H9QA 1FEXA 1K79A 4R8HA 1PDNC 3ABTA 4C3HJ 4OIRF 4IXAA 2OPTA 2R7DA 4DZJA 3D5RC 1OJLA 3DTEA 3VOEA 2EPFA 4RAFA 5CVVA 3K69A 2HVSA 3KLOA 3RYRA 2OU2A 2UZKA 1F4KA 1OYIA 2Y75A 4ZTJA 3RDIA 3H5NA 2RNJA 3PSFA 1W5CC 1CGPA 3M8FA 4LMYA 1XCVA 2RREA 2AXTC 5BOXA 1B1BA 2QENA 3RTRA 4A3CJ 2HKOA 3KZYA 3MAJA 2E1OA 3VSLA 2C6YA 2DTZA 3MZHA 4MGRA 5LGTA 1Z7UA 2ECCA 3RQ4A 1YX5A 2ZXIA 4L18B 1SFXA 3OSFA 1TTYA 3BDDA 4IF4A 4FETA 1HW5A 2HYGD 2KRCA 4EJOA 2R3SA 1R7JA 4M74A 5CVIA 2HOSA 4UUTA 2DTRA 1ENHA 3H5AA 3ZOBA 4D7MA 2ECBA 3HSRA 4XMYA 4XORA 4HG2A 3SZPA 4CYCA 3M8EA 1SFOJ 1IZ1A 2X6YA 1G3WA 2DCEA 4B48A 4A6EA 4F7ZA 1K7AA 1K61A 1GVJA 1AKHB 2XGXA 1FYKA 1PP7U 1KU2A 4HNVA 5AONA 2HXOA 2XAQA 3Q0VA 1WKMA 1NH3A 3C2BA 1R5GA 5CJ9A 2HGCA 3L1PA 3N97A 4Y33A 1YO5C 1P4WA 2Q2EB 2VASA 1Z6TA 3DFGA 3A1YA 4UV8A 3OS0A 1WJAA 1RKWA 4Y17A 1K6YA 1ETVA 4BQNA 4MHGA 2KIMA 3CDLA 2R7FA 2MG4A 1UJ8A 1QA6A 2WAEA 3CJNA 5J1RA 5JI6A 4JX6A 3D1NI 5HLTA 1ODDA 1Z1DA 3BCAA 1XSXA 3CCSI 4RGSA 1LQ1A 2XASA 1FBUA 3F0CA 2LBFB 3NWTA 1G8XA 2GZWA 1FJLA 3LSRA 2CJJA 2E34A 5F6FA 4B3AA 3RPUA 2XF5A 2LY1A 2JQ7A 3M4OJ 3TP0A 1SVOA 5JLXA 1KGSA 2LKSA 4RA2A 4DQ2A 5D8LB 4PFOA 5M5WJ 2K86A 2V7FA 2HOTA 3S1QJ 1G3SA 1OCZH 3GUDA 1OR7A 2YR2A 1ETQA 2LF7A 3O2PE 5ILSA 3W6VA 4G8XA 1QHHD 1R00A 1F36A 4Q47A 4BJTA 4NC6A 1MJAA 3ZRGA 2DT5A 4CCOA 1FYLA 1GXQA 2LY2A 3O8GA 2BY3A 2WADA 3E0JB 3JR9A 1LUJB 5FJ8J 2CW7A 2GOMA 3KYDB 1UAAA 4HQEA 3GTOJ 2K02A 1LEBA 5HS9A 1E0EA 2CS3A 3HPGA 1PUFA 4IRGA 4V2FA 3KP4A 5JHUA 1W36C 3PO2J 2A69F 3MVPA 3MEXA 4HEA2 5IP7J 1W1WE 3JRCA 2HYJA 5GTIC 3D0SA 4MTEA 3DLAA 3I56I 4ZYEA 3VYSB 2KQRA 1V5EA 5CLSA 4P9FA 1D5VA 1Z3XA 3SDGA 3WGIA 3GTMJ 1D8KA 1EH7A 1OLTA 2OBPA 3FBIB 1C0WA 5KAIC 1HKSA 4MEXF 5H20A 4E7HA 1DP3A 2A6EF 3GZ6A 1T38A 5LLQA 3KLNA 4BY7J 2HDCA 4CUGA 2H1KA 1RIOH 2W4SA 1KU7A 1YOVB 2RVCA 3VODA 1W7PB 3GFIA 3TO9A 3W6KB 3A4CA 1SFKA 4ESFA 4OOIA 3T1BA 4BXUA 4IVNA 3FISA 4EJVA 1NK2P 4A3BJ 3ZMUA 2DBBA 5HNHA 4C2UA 4BHPA 1Z6RA 1T6SA 2QM3A 3H92A 5DCMB 3MWMA 4BQQA 2F5CA 1E2XA 3TMOA 2NVXJ 5TISC 4F92B 2XUBA 2ZSIB 1R49A 2GXBA 1I6XA 1JJ6C 4PSXA 1VQNI 2P5LC 4B4CA 1MZBA 1MBGA 3LL7A 4BDYA 3COAC 1Q1VA 2WA0A 4XRSG 5CQGA 3BP8A 1TZLA 1RESA 3A2KA 3PNTA 5F64A 4CICA 1OCPA 2QQBA 5GTHC 3DBHB 4IHTA 2KT0A 2JUGA 4U88A 4D1QA 5D5VB 3EETA 3QPHA 1PJRA 5E3OA 4IO9F 2DK5A 3LSGA 3LQQA 2GQQA 1MD0A 1TT5B 2GIZA 3BTJA 4G9YA 4ZYGA 1P6RA 1BR1A 1A6IA 1T98A 2UWMA 2A6TA 4KIFA 1H88C 4Q48A 3WTUC 2IS1A 1S72I 1LDKB 3ASOH 3G1OA 3I58A 2LLKA 3WG7H 1OPCA 4KT6A 4QSHA 4CCKA 1RNLA 3CP2A 2H8WA 2ZJ2A 2YSRA 3FDYA 1JGGA 4XK4A 2BVMA 4L0ZB 4AC0A 2LKXA 1WJCA 3L00A 1J2XA 1FTZA 2CUZA 1J59A 3BZ6A 1R22A 1U8BA 4PCQA 3RKWA 5FD5A 4LJZF 4G6TB 3UKGA 2K85A 3GFJA 1ZH5A 4HW0A 2DFIA 3CC4I 1ZG5A 3M07A 2ZNZA 2JZYA 3FXLA 3H36A 3K70C 3OIPA 3F6OA 3I71A 3F3XA 3JCUC 4HX7A 5K1YA 1AU7A 5HDKA 2LMDA 2D1VA 4OINF 4P9UA 4OIOF 4A0ZA 4JOMA 2LNBA 4C3IJ 1YX3A 3OS1A 2MD5A 1HXDA 3I64A 1BR4A 2ZJPF 3BROA 2QBYB 1B8IB 3LAJA 2DJNA 1VTNC 3JREA 2FBIA 4A93J 3BG6A 4MO7A 1A5JA 4CO8A 2RAEA 1QPMA 1FPQA 2MGQA 4UV9A 5K7HA 3LA7A 4PZJA 2M7BA 2BGCA 4XONA 2UUZA 2A5YB 2DK8A 4O3MA 1R5ID 2M8GX 1E17A 1Y1WJ 2EIKH 3GFMA 4PJLA 2ZXHA 4HF0A 3OYKA 3BZKA 3MZYA 3HRTA 2XDVA 2YPRA 3V7CA 2DU9A 3GBGA 2K4BA 1JHHA 3RQIA 1ETXA 2DA2A 1HOMA 2K4JA 2VJIA 5FD6A 3TDZC 3OYMA 3U2RA 3BG9A 2L54A 1BA5A 1VQMI 5IPAA 3GTQJ 2R92J 3ELKA 4GXOA 1AWCA 4U87A 2DOFA 1IF1A 1Z67A 2L4MA 4ZDLA 4XLEA 4M3EA 2M7AA 1MMAA 4CCLA 5EG0B 1IN5A 1VQLI 1ACIA 3HHHA 3CJRB 1ZK8A 3ZP5A 1KQ0A 4ZYAA 5DM6F 3TDUC 2JJ7A 3AG2H 1DGWY 2AO9A 3LSHA 4P55A 2E7XA 2HZTA 3PM1A 4AYBA 4D0PA 2HKXA 4F52A 1WSUA 1USSA 2F4IA 1YJWI 2L9NA 2EV0A 3IRRA 1APLC 1TWAJ 2CWEA 3NAUA 5IT3A 1T0FC 3OYIA 4GFBA 1D0XA 1YLFA 2EZLA 5E8IA 5BQTA 5LRRA 1ITYA 3OYJA 2VQHA 4BEHB 2BW3B 1X1BA 1LVAA 2LG4A 3SEZA 5D6FA 1WFXA 2F2EA 3HDDA 2MA3A 3KEOA 3N05A 3HXLA 2QUFA 1X1PA 3CC2I 3V8KA 4I02A 3ULQB 4EQQA 4B1RA 1O4XA 1DPUA 2VONA 1T56A 1MJ9A 1JT0A 3HKZA 4XSXF 2KL4A 2ME6A 4C2MJ 4MEYF 3SQNA 2HZDA 5GAGJ 2Z9OA 3DCFA 4FISA 4KIGA 3IP4B 2DA3A 1MH3A 1P7IA 2QWWA 1ETKA 3K4KA 5D4SA 2H1LA 4HX8A 2OC6A 3TOBA 3S15J 1K78A 2DMQA 4H0EA 3QRFF 2K3FA 4KN7X 4KN4X 4F55A 4BACA 1MDMA 2ESHA 3ECHA 4XLAA 2FEZA 2NNYA 4UVCA 2OZUA 1YHQI 2RKHA 3L9FA 2EILH 4CA0A 1IRZA 3FK7A 2YX4A 3OIOA 5HOOA 3V7SA 3LFKA 4TV7A 5HODA 3GF2A 1U8RA 3K4CA 4CXFA 1X2MA 2XKOA 1SFUA 4JYKA 4JQFA 2FJ1A 2HYFA 2VKVA 1ZR4A 3ERED 3GZ5A 3ESWB 3PNYA 2GXAA 4G7HF 2VXZA 5J4VA 2FMLA 2R7WA 2W24A 4MLOA 3LOCA 4GRIA 2Y69H 1A35A 3JTHA 2V1NA 1X3ZB 3I5UA 3P9IA 3FZVA 4G7OF 1QU3A 2DO7A 4YEJA 1WQ2A 5HNFA 2IAIA 1VQ9I 4IOAF 2YUSA 1Y56A 4O6JA 3LMMA 4WCGA 4KISA 1S6LA 3V42A 3GFLA 2R7OA 4XL9A 3DP7A 1AKHA 4GCVA 1XMXA 2BHYA 1XX5A 3FHNA 5FLXK 4XR6A 4LIUA 2EZHA 4C9YA 4YIIA 4AIDA 2XKPA 1NG6A 4HYEA 2XAGA 2M9HA 2L9VA
chains in the Genus database with same CATH topology
3WG7H 2EINH 3ASNH 3X2QH 2EIKH 1V55H 1OCZH 2EILH 2ZXWH 1OCCH 3AG4H 5B1AH 2OCCH 2DYRH 2EIMH 1V54H 2DYSH 3AG1H 3ABLH 3AG2H 2EIJH 5B1BH 3ASOH 5B3SH 1OCRH 3ABMH 3AG3H 5IY5H 1OCOH 2Y69H 3ABKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG7 H;  2EIN H;  3ASN H;  3X2Q H;  2EIK H;  1V55 H;  1OCZ H;  2EIL H;  2ZXW H;  1OCC H;  3AG4 H;  5B1A H;  2OCC H;  2DYR H;  2EIM H;  1V54 H;  2DYS H;  3AG1 H;  3ABL H;  3AG2 H;  2EIJ H;  5B1B H;  3ASO H;  5B3S H;  1OCR H;  3ABM H;  3AG3 H;  5IY5 H;  1OCO H;  2Y69 H;  3ABK H; 
#chains in the Genus database with same CATH topology
 4HF1 A;  5E17 F;  1IN6 A;  3I55 I;  3K7A J;  4CYD A;  3ASN H;  5GAD J;  2YU9 J;  3JAM K;  1BJA A;  1TLH B;  4EMS A;  5M3F J;  4CH7 A;  4Y13 A;  2H6B A;  3DKY A;  2EIM H;  1VQ8 I;  4Y4R A;  1QO0 D;  3WTY C;  1DP7 P;  1EH6 A;  3IHU A;  1NG7 A;  2A68 F;  4BJ6 C;  2CO5 A;  4XLP F;  4I99 C;  4RB2 C;  2IA0 A;  1SD7 A;  4QPQ A;  3BOQ A;  4BUP A;  3PNV A;  3DLL F;  1CQT A;  5B3S H;  4GGG A;  2CV0 A;  2BOL A;  3CLO A;  1U78 A;  1J0R A;  2LBF A;  2V9P A;  4LOC A;  1XPX A;  2VE9 A;  1V5G A;  4HST A;  2KJB A;  1Y6I A;  4BBS J;  2V6C A;  2Y0S A;  1ZRE A;  3CCY A;  1VQO I;  1RRJ A;  2D1H A;  4M73 A;  1B9N A;  3KYC B;  1STZ A;  3TW7 A;  1QBJ A;  1EV7 A;  2GAU A;  3MCZ A;  1J5Y A;  2IA1 A;  3KP5 A;  3E5Q A;  4RLQ A;  3IWF A;  2RV8 A;  2LH9 A;  1JKP C;  2COB A;  2Z1D A;  4XLC A;  3GEZ A;  2AQF A;  3R0J A;  3M3Y J;  4XBF A;  1QHG A;  4RAZ A;  3JSO A;  3LSM A;  1BN5 A;  2E1C A;  3ZMV A;  4WF2 A;  2O61 A;  2Y9Y A;  2STW A;  2LYC A;  2NYX A;  1UHM A;  4NHJ A;  5K5Q A;  2XRN A;  2R0Q C;  5E20 A;  5JLW A;  3OOU A;  2QKM B;  1MBJ A;  4IOC F;  3H5R A;  2VLA A;  3CCM I;  3J7A O;  4M71 A;  2CRG A;  3HC7 A;  2F5F A;  1OQY A;  3HUG B;  5CQE A;  4YG2 F;  3GO5 A;  5LHH A;  2EQR A;  2VN2 A;  2JA5 J;  2JA6 J;  2MSY A;  2Z5U A;  1VI0 A;  1XGO A;  2K5C A;  5E8G A;  4OIP F;  3NRV A;  2DMP A;  1BC8 C;  5DD8 A;  2X85 A;  2PBI A;  4EJU A;  4AIJ A;  4ZJZ A;  4LG3 A;  3J80 K;  3M1C A;  3QPL A;  5EEG A;  3OS2 A;  2COM A;  1JE8 A;  3K4B A;  4XRF A;  2FD5 A;  1W7P A;  1R1V A;  2L9S A;  3A0H C;  4N4N B;  5DV5 A;  3WTX C;  4HF2 A;  2ZCW A;  3IKT A;  3I59 B;  1ZEL A;  1L3L A;  3MKY B;  1REP C;  5C4X J;  4IRH A;  2K9N A;  2O7O A;  5LFA A;  1U5T A;  2TDX A;  3F22 A;  3BT9 A;  5KVR A;  1FOK A;  5FLV A;  2DJI A;  5DCM A;  3SDB A;  1BI3 A;  2WY7 Q;  5EZH A;  3ABM H;  4UB8 C;  2E71 A;  3M7G A;  4M6X A;  1OCO H;  3AG3 H;  3FXU A;  5HS7 A;  1B4A A;  1MMG A;  4EVI A;  3VFZ A;  4Q4Z F;  1H8A C;  1ZRC A;  1P2F A;  2BV6 A;  2HQ5 A;  3JRF A;  4IEJ A;  3GXO A;  2V1X A;  2XPV A;  4AIH A;  5A2Q K;  1FX7 A;  2FBH A;  3SZG A;  3ABU A;  1O3R A;  1ETW A;  1BR2 A;  4ZH4 F;  1OKR A;  3ZQF A;  1WJE A;  3FM3 A;  1VZ0 A;  1FP2 A;  5FFX A;  1RR7 A;  2MH9 A;  4N9H A;  5L3F A;  1VQK I;  2O8K A;  1Y1V J;  2LKP A;  4BS9 A;  5B5E C;  3KIO A;  2I5U A;  4GYG A;  3F8M A;  3OIQ A;  5L3C A;  3QU3 A;  2DT7 B;  2K40 A;  1OIS A;  1YS7 A;  5HDN A;  3H9G A;  4AYB N;  3AFH A;  3J7Z I;  4BL0 B;  2NNN A;  2XHK A;  3C18 A;  1Z7L A;  4KIB A;  2EFO A;  1VND A;  1A04 A;  3DBR B;  2E1M B;  1ZRF A;  3DV8 A;  3R60 A;  4RAY A;  4S04 A;  3BJA A;  3F8F A;  2V1U A;  3AAF A;  3SHF A;  2E1M C;  1OCR H;  2R7S A;  3F8N A;  1BI2 A;  4UB6 C;  3SZT A;  2QSH X;  2LY9 A;  4E4H A;  4UVA A;  2LTP A;  3BWG A;  4BJ5 C;  5L3G A;  2ACJ A;  2A5W A;  3LSP A;  1J09 A;  3MKL A;  1LDJ A;  2AXL A;  3K4J A;  1O7L A;  2DA7 A;  5B1A H;  1T08 B;  2L0K A;  1FSH A;  1KQ9 A;  2K9S A;  2JUC A;  2PJR B;  4WXC A;  1D0Z A;  1HLV A;  1TBX A;  2H6C A;  3HKZ N;  4BXX J;  1I1S A;  1QVT A;  1ZR2 A;  1WI3 A;  4YFX F;  1BW5 A;  1MJB A;  1B8I A;  2QBY A;  2L3D A;  1KZH A;  1UG2 A;  3FBN B;  5E3N A;  4YFK F;  3FKI J;  5ICE A;  3S8P A;  1S7E A;  5DUI A;  2ELK A;  3CCQ I;  1JUS A;  2VC0 A;  1ON1 A;  1TT0 A;  3C7J A;  3TBI A;  1ZRD A;  1UFM A;  4ASN A;  3ZCO A;  2VI6 A;  2TRT A;  1R9T J;  5J4Y A;  1HW2 A;  2CYY A;  2W1O A;  4M3D A;  3S2H J;  4A12 A;  2XPW A;  2ZB9 A;  3RPQ A;  1UEL B;  2DN0 A;  2VBZ A;  3HSF A;  4LG0 B;  2L02 A;  2DMN A;  5F1J A;  4GDF A;  2PQ8 A;  4BDZ A;  2W48 A;  2OZ6 A;  1IUY A;  1XMA A;  5ILU A;  4FX0 A;  2K9M A;  2VIX A;  1A6Q A;  1U0J A;  2ZFU A;  2Q1Z B;  2X0L A;  5D8K B;  1D8J A;  4PGG A;  1WPK A;  2K7L A;  1H89 C;  2P6S A;  2ZKZ A;  3GLL A;  3VEP A;  3WTS C;  1AOY A;  2VXD A;  5M5X J;  3CMA I;  3FXM A;  3CCV I;  3FIW A;  1ORK A;  1GV2 A;  3IV5 A;  4MNU A;  2QQA A;  2XVC A;  4A0Y A;  3CF2 A;  5EG0 A;  1UHW A;  2X1E A;  3K9T A;  5F0F A;  2P5K A;  3MD2 A;  2EFQ A;  4MTD A;  5F27 A;  4UUS B;  3T8T A;  3CCJ I;  2XPU A;  4EJW A;  2FU4 A;  4C3J J;  2F5D A;  3G4S I;  1K4T A;  2ISY A;  3DQV C;  4KYW A;  3HRS A;  3C2H A;  2FX0 A;  5KHD A;  4ESB A;  4BE0 A;  2FQ4 A;  1R58 A;  2IEK A;  3V8L A;  5J8C A;  4OWR B;  3HRU A;  2WB1 A;  1B72 A;  3JRI A;  2ZME B;  4K2E A;  1DUX C;  3OOP A;  3SXY A;  1ZTR A;  4X0G A;  2BW3 A;  2O6G E;  1XG1 A;  4ETS A;  3S14 J;  2NVU B;  2KIU A;  2ZME C;  5B1B H;  4RS8 A;  5IT9 Z;  1Z3Y A;  3RZD J;  2I10 A;  2DQR A;  4FX4 A;  1S3J A;  3VB2 A;  1BM9 A;  2A3S A;  2WBM A;  4BHB A;  2R7X A;  3BJO A;  2QEX I;  3DTK A;  2F48 A;  2OTL I;  3I9V 2;  2X6O A;  3QOP A;  2F4O B;  2DXI A;  2VKD A;  2L2O A;  1R1U A;  2EFP A;  4LGW A;  2RQP A;  4NB5 A;  1XDU A;  4E6K G;  3LWF A;  3ONQ A;  2MC4 A;  3OYL A;  3Q9V A;  4M6V A;  1YJ9 I;  2BBY A;  3QAH A;  3L7W A;  3ABL H;  1H9T A;  3Q3S A;  2EFW A;  3OSG A;  3SFI A;  2WAF A;  3EDP A;  2Y0S N;  5LHG A;  4CHU A;  2OF7 A;  1V3F A;  2NS7 A;  3K4N A;  4QTR A;  3CTA A;  1TW3 A;  2G9W A;  3CCL I;  4A0X A;  2JSP A;  1JKR C;  1A31 A;  1K83 J;  4A3I J;  3JRH A;  2R7Q A;  1W0U A;  4ZC3 A;  2VUM J;  4OAY A;  2B7E A;  2GWR A;  2UXN A;  4FHT A;  3LFU A;  4E7Z A;  2W00 A;  3L2W A;  2NVQ J;  5AIP A;  1WI9 A;  2DA1 A;  3E6D A;  4B44 A;  5E18 F;  3W2A A;  1MMD A;  1TQP A;  1YW8 A;  2DT6 A;  3OL3 A;  3QP5 A;  4M6Y A;  4J19 A;  4HA8 A;  4B3X A;  2FMY A;  3KYL A;  3AG1 H;  3J81 Z;  5CVR A;  1MIJ A;  1HST A;  2CUE A;  2V1D A;  5IYC J;  2Z99 A;  1GXP A;  2ELH A;  3LA2 A;  4PFP A;  4CDG A;  3OYF A;  2FA5 A;  1Y8Q B;  1Z0X A;  1OCT C;  1QZY A;  2HTS A;  1GHC A;  4I0B A;  3CUQ B;  1I3A A;  2M30 A;  4UXN A;  4RAG A;  5ERI A;  3X2Q H;  5FLM J;  3DPU A;  4ZZL A;  1ZGA A;  4A5M A;  3KP2 A;  4HLY A;  3CUQ C;  1XC5 A;  3B02 A;  1ZGW A;  2QVO A;  2KDO A;  2GA2 A;  4DW6 A;  4LB6 B;  4HPQ A;  3F72 A;  2VQL A;  4QWQ A;  4L5J A;  4ABZ A;  3OYN A;  3CMM A;  2FNA A;  4NNJ A;  4I6Z A;  3CC7 I;  4GYI A;  5JHF A;  4KA4 A;  2Y30 A;  3RJP A;  2O3F A;  5D4R A;  1ZGJ A;  2ZXJ A;  2G7H A;  1RR8 C;  1JUM A;  4PJM A;  3Q0U A;  3OV8 A;  1TWC J;  1FOW A;  3SJM A;  1YJN I;  1K4S A;  1CF7 B;  2CV2 A;  1R5H A;  2DYR H;  2G7U A;  3HOV J;  3FMS A;  2JVH A;  3CCR I;  3H3Z A;  4HSR A;  3HEF A;  4ZYD A;  3NAR A;  1H0M A;  2EZK A;  3OL4 A;  3QOE A;  3HHG A;  1D1A A;  3JW4 A;  2R5Y B;  4E7L A;  2KZV A;  2V26 A;  1JUP A;  5FKK A;  4KMU X;  2K9L A;  3ZXS A;  3RI4 A;  2MD0 A;  3WU1 B;  1TNT A;  5EEH A;  3W2W A;  3O8H A;  4I0A A;  2FOK A;  1PP8 F;  1Y0U A;  3E3V A;  5H6Q A;  4D5C A;  5ICG A;  2P7C B;  3WTZ A;  4EV0 A;  2AHQ A;  1WJ5 A;  5KK1 A;  3HYI A;  4BHC A;  4UUV A;  2XRO A;  4OIQ F;  3WHC A;  3KX2 A;  1FNN A;  1VQ6 I;  3HOW J;  4E7S A;  4E7K A;  4IHW A;  1BJZ A;  4PDK A;  2KIS A;  3VSK A;  1PVE A;  4XKC A;  3S17 J;  1IUF A;  2E19 A;  3BLY A;  2IS2 A;  1GUU A;  2GXG A;  1FY7 A;  3FXQ A;  3B73 A;  1Y0N A;  2LVS A;  2VKH A;  4B09 A;  4L9N A;  2Q8K A;  2LRD A;  1FOX A;  2LF8 A;  1NTC A;  2XIG A;  1UB9 A;  2OQG A;  2QF7 A;  3C3W A;  2XF7 A;  3U1D A;  1V5F A;  4II2 A;  3WE3 A;  4HDU A;  3DPL C;  2DLL A;  2M2E A;  5EDN A;  2VQC A;  1HKT A;  2HDD A;  4LLG F;  2NS0 A;  3ZPL A;  2KZG A;  3PO3 J;  1KU9 A;  2L9R A;  2HDW A;  2CQQ A;  4NDL A;  5B66 C;  3VYR B;  3UNG C;  3IC7 A;  4ESJ A;  3HOU J;  1IXS B;  3U9G A;  1QVU A;  4BGD A;  1AA7 A;  1FOY A;  5IP9 J;  1DDN A;  3HUG A;  2CMP A;  2X4H A;  3B6A A;  1MMN A;  2IW5 A;  2QZ8 A;  3HPH A;  4RGR A;  2NOG A;  2FNP A;  2AS5 F;  1TW2 A;  4V19 K;  1M1E B;  4IJA A;  4M9X A;  2PJP A;  3EUA A;  2KJC A;  2DPD A;  3QU6 A;  3M1E A;  2KIQ A;  2P8T A;  2R5Z B;  2IS4 A;  4DYQ A;  4IX7 A;  1JJ8 C;  5EZG A;  3G3Z A;  1I6H J;  1W4M A;  1VQ5 I;  4BKX A;  1IXC A;  5EJC A;  3P9C A;  4CCJ A;  5ED4 A;  5HDG A;  4B47 A;  1BOA A;  2IS6 A;  2KKO A;  3KP6 A;  2HI3 A;  1IRG A;  2WV1 A;  2OTJ I;  1OYW A;  1UMQ A;  2H94 A;  3EUH C;  4F93 B;  2WWY A;  3G1M A;  4YRV A;  1Y39 A;  2GIV A;  1YE9 A;  1GLN A;  2BEO A;  1U2W A;  2EIJ H;  1XCB A;  4XRS A;  3PIP F;  2JWT A;  3HM5 A;  2BXZ A;  2PMH A;  1G59 A;  4Y52 J;  5EF6 A;  2VE8 A;  5BMZ A;  3TQN A;  3HB9 A;  5J40 A;  2TCT A;  3FMQ A;  4B43 A;  2CV1 A;  4HZF A;  3ABK H;  5FKN A;  5D5X B;  5J8F A;  2H27 A;  1N78 A;  2VJ4 A;  4LK0 F;  3S3M A;  1MBF A;  5GP9 A;  1ZG1 A;  4XSZ F;  1HKQ A;  1OR7 C;  2DA5 A;  1FLI A;  3LSI A;  1SC7 A;  5CKT A;  1R71 A;  2E2I J;  3BG5 A;  2JN6 A;  5DYM A;  1JXS A;  4Z6Y A;  1PUF B;  2IGM A;  4KUM A;  4EM0 B;  3VWB A;  2IA2 A;  4YIR X;  1O57 A;  3WE2 A;  2WB1 N;  6PAX A;  2HQN A;  2IGO A;  2Y48 A;  1MNM C;  1YI2 I;  4WK8 F;  3FXR A;  1SD5 A;  2PMU A;  5GPA A;  4A3L J;  4PSW A;  4ENK A;  1VQP I;  3DEU A;  3L2R A;  1V55 H;  1SVL A;  1IW7 F;  2VT2 A;  3EUK L;  2GA1 A;  4I76 A;  2M8E A;  4XN0 A;  3GWZ A;  2IGN A;  2GBY A;  2RQQ A;  4IRI A;  2Z33 A;  1LFP A;  5M3M J;  1WH7 A;  4PK4 A;  3ZN0 A;  5DDG A;  1MBK A;  3L2U A;  3QPS A;  2PJR A;  4QIW N;  1D0Y A;  4HNT A;  3K1P A;  2PLY A;  5FRN A;  2L7K A;  2CUF A;  2P81 A;  3ZMZ A;  1KYZ A;  4W1U A;  2CQN A;  2DA6 A;  3HRM A;  3IKV A;  3H3V K;  2R7U A;  4DBR A;  2KIF A;  2P6T A;  4ITV A;  2P4W A;  1BOB A;  4NQW B;  4AVZ A;  4IHY A;  4A3J J;  1XDS A;  1L0O C;  1YW9 A;  3E5U A;  3FMR A;  3F8B A;  2VB6 A;  1FYM A;  2HXI A;  4A69 C;  1HDD C;  3CP8 A;  2LDU A;  4D5F A;  4M9S A;  3K0L A;  4MQ9 F;  2PMZ A;  2IVM A;  5J3L A;  3DU6 A;  3HZJ A;  2ZO4 A;  1Z77 A;  3BR2 A;  4IHS A;  4A3F J;  4E7J A;  3ROU A;  3JRA A;  3PSI A;  1X2N A;  1AHD P;  1EJ9 A;  2GM4 A;  2N8G A;  3VYT B;  2BY1 A;  3WTV C;  3ZQG A;  2EIN H;  2KMU A;  4ENM A;  2Q2E A;  3EQL F;  1SAX A;  5DEQ A;  4S05 A;  3RZO J;  2ZNY A;  3GCM A;  3AKZ A;  3CDH A;  4EAT A;  2JPB A;  2VPR A;  1SD6 A;  3HL2 A;  1BI1 A;  2FUG 2;  4IQJ A;  1IV8 A;  5BPI A;  1JGS A;  4FQG A;  4Y3O A;  2DDB A;  2R93 J;  2L7F P;  3JSP A;  4KNY A;  3HSE A;  3LSK A;  3OYC A;  1BL0 A;  4N0B A;  1FP1 D;  3SEQ A;  2OAZ A;  4UUS A;  3HOT A;  2E2H J;  3TED A;  3VPR A;  1ZG3 A;  3IWZ A;  4XOP A;  4D7N A;  2IXS A;  2L01 A;  1IN8 A;  3FM5 A;  2AQE A;  3FWE A;  2X51 A;  1YFH A;  2RC4 A;  3K10 A;  2X48 A;  1IN7 A;  4AD9 A;  2EH3 A;  2ZME A;  4EGY A;  4OMY A;  1R4N B;  1V4R A;  4RGX A;  1N77 A;  2YU3 A;  3L2Q A;  3BR0 A;  2KDZ A;  4CZC A;  3EYI A;  2VL8 A;  4PJ0 C;  2HS5 A;  1FWZ A;  4BBR J;  4XLN F;  1X3W B;  5CPR B;  4A3K J;  3NWS A;  4RGU A;  1BIB A;  1XGS A;  1FT9 A;  4RBO A;  2DMT A;  4Z2Y A;  3J7A Y;  3D5L A;  3HJE A;  3DKW A;  3CD6 I;  1S29 A;  1ULY A;  1S8N A;  2CQ7 A;  2LFB A;  4HDV A;  5E1W A;  2VKE A;  1GDT A;  4LIV A;  1BBY A;  1BC7 C;  2IP2 A;  2A05 A;  3DKX A;  2VOD A;  1WJF A;  4AVP A;  4KFC A;  4KT5 C;  1IXR C;  2EFN A;  1YQA A;  3OYH A;  1D1B A;  1LKX A;  2HOA A;  1HF0 A;  3K1N A;  2FF4 A;  3TO7 A;  4EEF G;  1NK3 P;  4BNC A;  3AL0 B;  2W84 A;  3BR3 A;  2ISZ A;  3RKQ A;  3GW2 A;  2BHZ A;  2L7M P;  4LLN A;  1MBH A;  4AU7 A;  2X1C A;  4FE7 A;  2WC2 A;  2EA4 A;  4A3E J;  2X1D A;  3AL0 C;  4BQO A;  5F0H A;  1G3T A;  3WTT C;  1U9O A;  3JRG A;  3HOS A;  3E97 A;  1JKO C;  1TNS A;  4BY1 J;  1I1G A;  2M34 A;  1W5S A;  4HQM A;  3V8J A;  2R7V A;  4I7H A;  1WHU A;  2B63 J;  3MQ0 A;  5H2F C;  1E3P A;  2MLG A;  2JK3 A;  3K2A A;  3BZC A;  2E35 A;  1XD7 A;  2R4G A;  2DQL A;  1J7K A;  3FHZ A;  4KDP A;  4N9I A;  2NAZ A;  2OUM A;  1F5T A;  2MLK A;  4UVB A;  1ZN2 A;  3ML6 A;  2DOE A;  3CZ6 A;  2EB7 A;  3R0A A;  4IPA A;  1WGX A;  4BE2 A;  5DD4 A;  3IRQ A;  3CUQ A;  3BTL A;  1QQI A;  2PEX A;  2OCE A;  5HLG A;  3S3N A;  4KMF A;  5FKL A;  1XSD A;  4M72 A;  1JTY A;  2MH2 A;  4I09 A;  2VBW A;  2JMW A;  3S1N J;  2EA2 A;  1O7F A;  4L5I A;  1ETY A;  4HRI A;  1G3Y A;  1U6G A;  2XGC A;  1X19 A;  1VFC A;  1R1T A;  2QCO A;  3KZI C;  5EEA A;  3MKZ A;  1MMS A;  5GAH J;  4IZZ A;  3RCO A;  4BQA A;  2WY8 Q;  1MSE C;  1BW6 A;  3GME A;  1SFE A;  3OYE A;  3HGY A;  3ZQ7 A;  5LGU A;  1SAN A;  3DPT A;  2DFH A;  3B6C A;  3WU0 A;  5LEJ A;  3IAS 2;  5C4J J;  3PIO F;  4BH9 A;  3JTG A;  5IOZ A;  3PJR A;  5J6X A;  2B9S A;  1MGT A;  1Z05 A;  4OMZ A;  2R5Y A;  3FXO A;  4WX9 A;  1JT6 A;  2PN6 A;  2W7N A;  2CU7 A;  1XN7 A;  2JPC A;  4AM3 A;  2L7Z A;  3QPT A;  1FIA A;  2LRE A;  1UHS A;  2VQG A;  1MSF C;  3FKJ A;  2X9D A;  1WCM J;  3Q5F A;  2K3P A;  1VQ4 I;  1IDY A;  5FKM A;  3C2G A;  2E60 A;  1N75 A;  5ICC A;  1WJD A;  2VJ5 A;  1VQ7 I;  2V79 A;  2IBD A;  5C44 J;  3GVA A;  2ICW G;  1K78 B;  3ZQL A;  1QZZ A;  1LPQ A;  2LK2 A;  1VF9 A;  3C1D A;  3QYE A;  2F5E A;  3W6J B;  1NHA A;  1MDM B;  4A3G J;  2E7W A;  2E2J J;  3O6B B;  3A0B C;  1YG2 A;  2O0Y A;  3MFK A;  2DFF A;  3BTI A;  5HS8 A;  3QQA A;  3PFI A;  2BYV E;  2IJL A;  4RM3 A;  2QYO A;  2Y31 A;  1P9Q C;  4LK1 F;  5L3D A;  2H09 A;  1IG7 A;  2Z3Y A;  3A01 B;  2A61 A;  5EGO B;  5LGN A;  5DS9 A;  3DXJ F;  1X1C A;  2FRH A;  4JP0 A;  1B59 A;  5DM7 F;  1FMW A;  4B8X A;  3GTK J;  3BR5 A;  2CQX A;  5J1U A;  4D9J A;  4JBA A;  4BU2 A;  5K7F A;  4A5N A;  2Y2Z A;  2HU9 A;  2XAH A;  2ZJQ F;  1FBS A;  4I98 B;  1O3S A;  1SAU A;  2F6C A;  2MFZ A;  1I50 J;  2MC3 A;  4HV5 A;  4F91 B;  4ENJ A;  3G1L A;  1OCC H;  2LSO A;  2F4M B;  5E1X A;  3WG9 A;  4G7Z F;  5DTD A;  2MAB A;  3L2C A;  3KFW X;  2FSW A;  4KIT B;  4I01 A;  2ETH A;  4PUS A;  3G71 I;  3S1R J;  2NS8 A;  2PG4 A;  1T39 A;  1UCR A;  2R5Z A;  4ZDO A;  1T0F A;  3R61 A;  3WTW C;  1TP4 A;  5IY5 H;  1LE8 B;  2FOW A;  3KEQ A;  3BG7 A;  5D5W B;  2FQ3 A;  2M4G A;  4LD5 A;  3G73 A;  2OA4 A;  4PJJ A;  2VT3 A;  4JK1 X;  1HCR A;  3WHB A;  3HIF A;  4HX4 A;  2PMZ N;  4UHT A;  3EUH A;  4Y15 A;  2HOE A;  2P0W A;  2EBI A;  2WV0 A;  1O3T A;  5JVT A;  4ZTF A;  1ZAR A;  2NVT J;  2RNG A;  4L5E A;  4BEH A;  4DOZ A;  3CCU I;  4A3D J;  1RI7 A;  2Y9Z A;  3M9A A;  2XSD C;  4Q5S F;  1P4A A;  5FGM A;  4FT8 A;  3VYU B;  2VBX A;  3BR6 A;  3PL8 A;  1IN4 A;  4LFU A;  2JTV A;  5FFZ A;  1IRX A;  3HOY J;  3ZQQ A;  5C3E J;  2VOO A;  5LEK A;  2LP0 A;  2CUJ A;  5FB2 A;  2JSC A;  3GTP J;  1IDZ A;  3NEU A;  3RIR A;  3GLX A;  4E70 A;  1YIT I;  1X58 A;  2LC2 A;  1RC9 A;  4XRM A;  3ZMS A;  4OAZ A;  4XID A;  1S7A A;  2DOD A;  5FO5 A;  4W97 A;  3TL4 X;  5LD2 C;  4II3 A;  1WVR A;  4DZP A;  3EPZ A;  4XNF A;  1R23 A;  3V7R A;  2Q0O A;  2DOA A;  1I5Z A;  4CSW A;  5J1Y A;  2Z2S B;  3V4G A;  1KA8 A;  1GV5 A;  2WTE A;  1BIA A;  3PUF A;  3I4M J;  1ERD A;  4HOB A;  1LJ9 A;  2MBF A;  4AIK A;  4R1H A;  3CMY A;  4A3M J;  3HG9 A;  3CQZ J;  2XAJ A;  3REO A;  3QP6 A;  3ISP A;  1I39 A;  5LRS A;  1ZLK A;  4IL6 C;  5AIQ A;  1X1D A;  1PUE E;  2V9V A;  2ID3 A;  2DYS H;  3L09 A;  2XRL A;  1XGN A;  1XSV A;  2Y0M A;  4HV6 A;  3TKY A;  1GT0 C;  1W5T A;  1WZ2 A;  5KNL A;  5D5U B;  3QYB A;  4A2U A;  4CCM A;  2EK5 A;  3HOX J;  1FZP B;  3Q0W A;  4XM3 A;  2O5R A;  2OQR A;  3LNQ A;  4S0H B;  3DTI A;  4L0Y B;  2QQ9 A;  4KJZ A;  5K7Z A;  3UR3 C;  3T5X A;  1LNW A;  2IPQ X;  2XV4 S;  4NC7 A;  1SMT A;  4XN3 A;  1S9H A;  5TRD A;  1MBE A;  3IL2 A;  2QGU A;  2PX9 A;  2O9L A;  4MIM A;  1FSE A;  1U5T B;  3BY6 A;  4YIF A;  4NQW A;  1U3E M;  2FBK A;  3E7L A;  4EGZ A;  3S1M J;  4L9J A;  4FTH A;  2UXX A;  2XB5 A;  4EM1 A;  5LBQ A;  1IO2 A;  3U21 A;  2HWV A;  3IAM 2;  2VBY A;  3MKW B;  2XAU A;  1U5T C;  4U7B A;  4U0W A;  3KCC A;  3R4K A;  1YRN B;  2STT A;  3I3L A;  3LQR A;  2BY2 A;  2KPM A;  3OYB A;  1E3H A;  1OMI A;  1R6R A;  2ESN A;  4XKV A;  2ELJ A;  5KAF C;  4C30 A;  1DU0 A;  2HQR A;  3RKX A;  4O5V A;  5FRO A;  1B9M A;  1I27 A;  3FXJ A;  5IYB J;  2CFO A;  3GTL J;  2MW8 A;  1F43 A;  5L3B A;  2IRF G;  1OYY A;  2V6E A;  2DMU A;  1S5L C;  3ECO A;  1TWG J;  4I2O A;  2ADU A;  3LST A;  3GX4 X;  3K1M A;  1DGR M;  5IT9 K;  1G4D A;  5GAE J;  5H6R A;  3K4M A;  3TW6 A;  1JTX A;  4RM2 A;  5ILV A;  2DI3 A;  2CFX A;  3J7Y J;  3F8C A;  1RPW A;  1UG0 A;  3P9K A;  4F3Q A;  3K6G A;  2VJJ A;  5K5O A;  1TL8 A;  2HVR A;  2ID6 A;  3KPH A;  1FTT A;  4DYR A;  3FX3 A;  2JRT A;  1FC3 A;  2WAQ A;  4HAM A;  3DWL E;  2JA7 J;  1B6A A;  1SVM A;  2KLO A;  1T8I A;  2CH0 A;  2DA4 A;  5BNG A;  1ONV A;  4IKF A;  5E79 C;  4RB3 C;  1RET A;  1ZQ3 P;  2MYS A;  3ZMD A;  1R36 A;  3OYD A;  2NVY J;  3H1C A;  2FE3 A;  3ERM A;  1RKT A;  3DEW A;  3T0Y A;  5M5Y J;  3QWL A;  3GTG J;  5IP6 A;  2Z16 A;  1G6N A;  1IRF A;  2HPI A;  4NBQ A;  3TGN A;  4IHX A;  1HA8 A;  3RSN A;  1T33 A;  3H3U A;  5KCM A;  4BYY A;  2A6H F;  2EV6 A;  2M1B A;  3CDI A;  3FK6 A;  4X1E A;  3R6S A;  1W0T A;  3RKY A;  2L5Q A;  2UV1 A;  3CO6 C;  1IAW A;  2GLO A;  1ZKG A;  4XQF A;  5L3E A;  3LA3 A;  2OJE D;  3J81 K;  4X6A J;  2G0E A;  3CCE I;  3ZQI A;  3EYY A;  3A02 A;  2M87 A;  3TO6 A;  9ANT A;  2DAO A;  3S93 A;  2NRA C;  4CYC B;  4UNO A;  1OFC X;  4RB0 A;  3L2V A;  1HDP A;  1JKQ C;  4XIC A;  3OY9 A;  1KYW A;  4M3B A;  4BXF A;  1P4X A;  1V54 H;  2V4J C;  1WRJ A;  1Z9C A;  3BPV A;  1XTA A;  5JVG F;  3N4M A;  5F0C A;  3I59 A;  5FKO A;  4CZZ A;  2HVQ A;  3BJ6 A;  1FBQ A;  5HLI A;  2E5Z A;  4XOT A;  2W25 A;  2LOO A;  2R7Z J;  2X6X A;  3E6C C;  3W3C A;  1KON A;  3WOD F;  4LLL A;  4R79 A;  1Y8R B;  3F9K A;  4QLC U;  4G6D A;  1DQU A;  5F1R A;  3FF5 A;  4WWC A;  3CME I;  4E7I A;  3D5S C;  3H35 A;  1LVK A;  2O03 A;  1LEA A;  4U0V A;  4XLF A;  2PFB A;  4J00 A;  2CSO A;  5JFR A;  5FLX Z;  3CES A;  3OR1 C;  1ZAO A;  2ME0 A;  1D5Y A;  1YW7 A;  2NOJ B;  2BY0 A;  3F21 A;  3CLQ A;  5HVQ C;  2CW8 A;  1B72 B;  1JI8 A;  5EYR A;  2OD5 A;  3K2Z A;  2CW0 F;  3E6B A;  2E1N A;  4GO1 A;  3JAM Z;  1G2H A;  2YX7 A;  3ZGK A;  1BI0 A;  1S7O A;  2BE5 F;  3BR1 A;  4P96 A;  2M4K A;  4ANJ A;  2HTJ A;  2KHM A;  2BZT A;  3BTC A;  4M3G A;  2D2W A;  4WXD A;  2HEO A;  2P5V A;  4NUB A;  4DJA A;  4U0Y A;  4AUX A;  1POG A;  1EKE A;  3QOD A;  3KP7 A;  4JX4 A;  3QYF A;  3ZQH A;  1KQ8 A;  4XLH A;  5IOY A;  5CVU A;  2P7V B;  1T2K A;  3H9J A;  2JRM A;  3CF5 F;  4PGH A;  1P92 A;  3S3O A;  5GPC A;  5FRM A;  3F6V A;  1HBX G;  1IGN A;  1QZE A;  1D1C A;  3E1S A;  3MN2 A;  1IV6 A;  2HPM A;  1EA3 A;  2NXN B;  2ZXW H;  2VPL A;  4IQ4 A;  1I3Q J;  2KP6 A;  1X4P A;  3I4P A;  2ZC2 A;  1TC3 C;  1TWF J;  3RPU D;  3WU2 C;  1ETO A;  1TWH J;  4G94 A;  1LFB A;  2XF6 A;  5IYD J;  2JVG A;  1A36 A;  4QPO A;  3LSJ A;  2D5V A;  4XKB A;  1RZ4 A;  3CJQ B;  4V2G A;  1XB4 A;  2E5N A;  2ZFW A;  3WGG A;  4EJT A;  2M45 A;  3CO7 C;  2QKL B;  1YS6 A;  4MFE A;  2QA4 I;  2XAF A;  3P5J A;  1EF4 A;  2QQ8 A;  3RYP A;  1HQC A;  1SMY F;  3ZMT A;  3PQK A;  2HQA A;  3BCB A;  4DGW B;  2X6W A;  3ZN1 A;  3OWT A;  1F1Z A;  1UZC A;  3IUO A;  1XMK A;  3KZZ A;  2RN7 A;  2QLZ A;  4RLF A;  2J5P A;  2EV5 A;  2F5V A;  5HLH A;  3A01 A;  1WH5 A;  2XSJ C;  5EGO A;  3IH4 A;  2ZJR F;  3G2B A;  3ZR8 X;  3O3K A;  1SD4 A;  1GVD A;  3J80 Z;  2O8X A;  4LG0 A;  3HGG A;  3DBL B;  2HR3 A;  1ZLJ A;  2LR8 A;  1HC8 A;  1X4O A;  2BXY A;  3S32 A;  4YFN F;  3I4N J;  3PUB A;  2L4A A;  4FCY A;  2XB0 X;  5TGT A;  4KIC A;  4NC8 A;  3DEE A;  1W36 D;  1MND A;  1HSJ A;  2XC7 A;  2DFE A;  2FXA A;  2K27 A;  3GYH X;  4L9T A;  3S2D J;  3TOA A;  1TQI A;  4HBL A;  1YIO A;  2XGE A;  4FE4 A;  1PYV A;  5E1Z B;  4OU0 A;  3OMY A;  3W2V A;  1YIJ I;  3BC8 A;  3BQZ A;  1F9N A;  1N25 A;  2M5W A;  4RMN A;  4HLX A;  4HNU A;  1DU6 A;  1XGM A;  3IH3 A;  3WGH A;  2H8R A;  2BVL A;  3SYT A;  5A2Q Z;  3GTJ J;  1LE8 A;  1Z21 A;  2K9Q A;  1U9N A;  3DU5 A;  3BQY A;  4N4O B;  4IHV A;  1ON2 A;  1QPI A;  2R7T A;  2R7R A;  3KEY A;  1MNE A;  3KP3 A;  3PQJ A;  4DNC A;  2VOP A;  2M0C A;  2QSG X;  4DBQ A;  1W7P D;  5J47 A;  1MKM A;  3PFY A;  2RGV A;  5JR3 A;  1K6O A;  3BG3 A;  1WJB A;  4Y7N J;  1O3Q A;  3E6M A;  4DIQ A;  4C2T A;  3OYA A;  4XKW A;  4G6Q A;  1P7J A;  1WWX A;  1YYV A;  2DDA A;  3BPX A;  4PJN A;  3KET A;  4J01 A;  3HBL A;  1TQM A;  2KRH A;  2XGD A;  5TJJ A;  1J75 A;  2OCC H;  5BPD A;  2JA8 J;  3S16 J;  3HTU A;  3I53 A;  2KRF A;  2LD5 A;  1LB2 A;  3DF8 A;  3CJT B;  1QNT A;  1Z91 A;  3LAP A;  4G12 A;  1RUO A;  3OR2 C;  2HNH A;  4YEL A;  5K5R A;  3H0G J;  1SEU A;  1X1A A;  5DCF A;  2WAQ N;  2ZSH B;  2W57 A;  4ZDP A;  5F08 A;  1IC8 A;  2EWN A;  5DUK A;  4FAS D;  3A03 A;  1UST A;  1LDD A;  1XS9 A;  3M8J A;  2EZI A;  3ZQC A;  4ZZD A;  3KE2 A;  5ICF A;  2JA2 A;  4H4K C;  4ENN A;  1IJW C;  3AG4 H;  2PI0 A;  3I0T A;  3T8R A;  2M3A A;  3SFZ A;  5CVJ A;  2IGK A;  4RDU A;  3FXK A;  1R4M B;  3K4L A;  4UY8 I;  5F04 A;  5CYV A;  3IH2 A;  4DYC A;  3VDX A;  2DW4 A;  2D45 A;  2W82 A;  2RDP A;  1RUN A;  4LB5 A;  4A6D A;  3F23 A;  1J9I A;  1MW7 A;  3U1K A;  5E3M A;  3MMY B;  1Q1H A;  1E3O C;  1X3U A;  3CUO A;  2EJR A;  3GZN B;  4LIT A;  4BE1 A;  2VC1 A;  2JT1 A;  3MZ8 A;  3OYG A;  5D6E A;  1ZYR F;  4CGZ A;  2J5O A;  3K70 D;  5LHI A;  1YTY A;  3JRD A;  2QSF X;  4CCN A;  3HTS B;  3Q9S A;  4P1W A;  3TP3 A;  2GOX B;  2ZBK A;  1HW1 A;  4ON0 A;  3S2W A;  2DPU A;  4RB1 A;  4P5O A;  2OV7 A;  3P7N A;  4BAY A;  1YRN A;  1T95 A;  1ZHF A;  4M3F A;  1KU3 A;  3HOZ J;  2HFH A;  4M9Z A;  5BS6 A;  1JHF A;  2CGP A;  1DPR A;  3E5X A;  4ZYH A;  2YS9 A;  4AWX B;  1QGP A;  2KFD A;  3H0D A;  3NQO A;  4U7D A;  2I8D A;  3JRB A;  2E36 A;  1EH8 A;  2V9K A;  2B0L A;  4WXH A;  4MFD A;  2IT0 A;  1CF7 A;  1MH4 A;  4MQV A;  2CG4 A;  1FIP A;  3G6E I;  5E3L A;  2M0M A;  1FMV A;  2A07 F;  1D3Y A;  1H9G A;  1LFU P;  3I54 A;  1QRY A;  4EM2 A;  2W85 A;  4L9V A;  2CQK A;  4JX5 A;  3H9Q A;  1FEX A;  1K79 A;  4R8H A;  1PDN C;  3ABT A;  4C3H J;  4OIR F;  4IXA A;  2OPT A;  2R7D A;  4DZJ A;  3D5R C;  1OJL A;  3DTE A;  3VOE A;  2EPF A;  4RAF A;  5CVV A;  3K69 A;  2HVS A;  3KLO A;  3RYR A;  2OU2 A;  2UZK A;  1F4K A;  1OYI A;  2Y75 A;  4ZTJ A;  3RDI A;  3H5N A;  2RNJ A;  3PSF A;  1W5C C;  1CGP A;  3M8F A;  4LMY A;  1XCV A;  2RRE A;  2AXT C;  5BOX A;  1B1B A;  2QEN A;  3RTR A;  4A3C J;  2HKO A;  3KZY A;  3MAJ A;  2E1O A;  3VSL A;  2C6Y A;  2DTZ A;  3MZH A;  4MGR A;  5LGT A;  1Z7U A;  2ECC A;  3RQ4 A;  1YX5 A;  2ZXI A;  4L18 B;  1SFX A;  3OSF A;  1TTY A;  3BDD A;  4IF4 A;  4FET A;  1HW5 A;  2HYG D;  2KRC A;  4EJO A;  2R3S A;  1R7J A;  4M74 A;  5CVI A;  2HOS A;  4UUT A;  2DTR A;  1ENH A;  3H5A A;  3ZOB A;  4D7M A;  2ECB A;  3HSR A;  4XMY A;  4XOR A;  4HG2 A;  3SZP A;  4CYC A;  3M8E A;  1SFO J;  1IZ1 A;  2X6Y A;  1G3W A;  2DCE A;  4B48 A;  4A6E A;  4F7Z A;  1K7A A;  1K61 A;  1GVJ A;  1AKH B;  2XGX A;  1FYK A;  1PP7 U;  1KU2 A;  4HNV A;  5AON A;  2HXO A;  2XAQ A;  3Q0V A;  1WKM A;  1NH3 A;  3C2B A;  1R5G A;  5CJ9 A;  2HGC A;  3L1P A;  3N97 A;  4Y33 A;  1YO5 C;  1P4W A;  2Q2E B;  2VAS A;  1Z6T A;  3DFG A;  3A1Y A;  4UV8 A;  3OS0 A;  1WJA A;  1RKW A;  4Y17 A;  1K6Y A;  1ETV A;  4BQN A;  4MHG A;  2KIM A;  3CDL A;  2R7F A;  2MG4 A;  1UJ8 A;  1QA6 A;  2WAE A;  3CJN A;  5J1R A;  5JI6 A;  4JX6 A;  3D1N I;  5HLT A;  1ODD A;  1Z1D A;  3BCA A;  1XSX A;  3CCS I;  4RGS A;  1LQ1 A;  2XAS A;  1FBU A;  3F0C A;  2LBF B;  3NWT A;  1G8X A;  2GZW A;  1FJL A;  3LSR A;  2CJJ A;  2E34 A;  5F6F A;  4B3A A;  3RPU A;  2XF5 A;  2LY1 A;  2JQ7 A;  3M4O J;  3TP0 A;  1SVO A;  5JLX A;  1KGS A;  2LKS A;  4RA2 A;  4DQ2 A;  5D8L B;  4PFO A;  5M5W J;  2K86 A;  2V7F A;  2HOT A;  3S1Q J;  1G3S A;  1OCZ H;  3GUD A;  1OR7 A;  2YR2 A;  1ETQ A;  2LF7 A;  3O2P E;  5ILS A;  3W6V A;  4G8X A;  1QHH D;  1R00 A;  1F36 A;  4Q47 A;  4BJT A;  4NC6 A;  1MJA A;  3ZRG A;  2DT5 A;  4CCO A;  1FYL A;  1GXQ A;  2LY2 A;  3O8G A;  2BY3 A;  2WAD A;  3E0J B;  3JR9 A;  1LUJ B;  5FJ8 J;  2CW7 A;  2GOM A;  3KYD B;  1UAA A;  4HQE A;  3GTO J;  2K02 A;  1LEB A;  5HS9 A;  1E0E A;  2CS3 A;  3HPG A;  1PUF A;  4IRG A;  4V2F A;  3KP4 A;  5JHU A;  1W36 C;  3PO2 J;  2A69 F;  3MVP A;  3MEX A;  4HEA 2;  5IP7 J;  1W1W E;  3JRC A;  2HYJ A;  5GTI C;  3D0S A;  4MTE A;  3DLA A;  3I56 I;  4ZYE A;  3VYS B;  2KQR A;  1V5E A;  5CLS A;  4P9F A;  1D5V A;  1Z3X A;  3SDG A;  3WGI A;  3GTM J;  1D8K A;  1EH7 A;  1OLT A;  2OBP A;  3FBI B;  1C0W A;  5KAI C;  1HKS A;  4MEX F;  5H20 A;  4E7H A;  1DP3 A;  2A6E F;  3GZ6 A;  1T38 A;  5LLQ A;  3KLN A;  4BY7 J;  2HDC A;  4CUG A;  2H1K A;  1RIO H;  2W4S A;  1KU7 A;  1YOV B;  2RVC A;  3VOD A;  1W7P B;  3GFI A;  3TO9 A;  3W6K B;  3A4C A;  1SFK A;  4ESF A;  4OOI A;  3T1B A;  4BXU A;  4IVN A;  3FIS A;  4EJV A;  1NK2 P;  4A3B J;  3ZMU A;  2DBB A;  5HNH A;  4C2U A;  4BHP A;  1Z6R A;  1T6S A;  2QM3 A;  3H92 A;  5DCM B;  3MWM A;  4BQQ A;  2F5C A;  1E2X A;  3TMO A;  2NVX J;  5TIS C;  4F92 B;  2XUB A;  2ZSI B;  1R49 A;  2GXB A;  1I6X A;  1JJ6 C;  4PSX A;  1VQN I;  2P5L C;  4B4C A;  1MZB A;  1MBG A;  3LL7 A;  4BDY A;  3COA C;  1Q1V A;  2WA0 A;  4XRS G;  5CQG A;  3BP8 A;  1TZL A;  1RES A;  3A2K A;  3PNT A;  5F64 A;  4CIC A;  1OCP A;  2QQB A;  5GTH C;  3DBH B;  4IHT A;  2KT0 A;  2JUG A;  4U88 A;  4D1Q A;  5D5V B;  3EET A;  3QPH A;  1PJR A;  5E3O A;  4IO9 F;  2DK5 A;  3LSG A;  3LQQ A;  2GQQ A;  1MD0 A;  1TT5 B;  2GIZ A;  3BTJ A;  4G9Y A;  4ZYG A;  1P6R A;  1BR1 A;  1A6I A;  1T98 A;  2UWM A;  2A6T A;  4KIF A;  1H88 C;  4Q48 A;  3WTU C;  2IS1 A;  1S72 I;  1LDK B;  3ASO H;  3G1O A;  3I58 A;  2LLK A;  3WG7 H;  1OPC A;  4KT6 A;  4QSH A;  4CCK A;  1RNL A;  3CP2 A;  2H8W A;  2ZJ2 A;  2YSR A;  3FDY A;  1JGG A;  4XK4 A;  2BVM A;  4L0Z B;  4AC0 A;  2LKX A;  1WJC A;  3L00 A;  1J2X A;  1FTZ A;  2CUZ A;  1J59 A;  3BZ6 A;  1R22 A;  1U8B A;  4PCQ A;  3RKW A;  5FD5 A;  4LJZ F;  4G6T B;  3UKG A;  2K85 A;  3GFJ A;  1ZH5 A;  4HW0 A;  2DFI A;  3CC4 I;  1ZG5 A;  3M07 A;  2ZNZ A;  2JZY A;  3FXL A;  3H36 A;  3K70 C;  3OIP A;  3F6O A;  3I71 A;  3F3X A;  3JCU C;  4HX7 A;  5K1Y A;  1AU7 A;  5HDK A;  2LMD A;  2D1V A;  4OIN F;  4P9U A;  4OIO F;  4A0Z A;  4JOM A;  2LNB A;  4C3I J;  1YX3 A;  3OS1 A;  2MD5 A;  1HXD A;  3I64 A;  1BR4 A;  2ZJP F;  3BRO A;  2QBY B;  1B8I B;  3LAJ A;  2DJN A;  1VTN C;  3JRE A;  2FBI A;  4A93 J;  3BG6 A;  4MO7 A;  1A5J A;  4CO8 A;  2RAE A;  1QPM A;  1FPQ A;  2MGQ A;  4UV9 A;  5K7H A;  3LA7 A;  4PZJ A;  2M7B A;  2BGC A;  4XON A;  2UUZ A;  2A5Y B;  2DK8 A;  4O3M A;  1R5I D;  2M8G X;  1E17 A;  1Y1W J;  2EIK H;  3GFM A;  4PJL A;  2ZXH A;  4HF0 A;  3OYK A;  3BZK A;  3MZY A;  3HRT A;  2XDV A;  2YPR A;  3V7C A;  2DU9 A;  3GBG A;  2K4B A;  1JHH A;  3RQI A;  1ETX A;  2DA2 A;  1HOM A;  2K4J A;  2VJI A;  5FD6 A;  3TDZ C;  3OYM A;  3U2R A;  3BG9 A;  2L54 A;  1BA5 A;  1VQM I;  5IPA A;  3GTQ J;  2R92 J;  3ELK A;  4GXO A;  1AWC A;  4U87 A;  2DOF A;  1IF1 A;  1Z67 A;  2L4M A;  4ZDL A;  4XLE A;  4M3E A;  2M7A A;  1MMA A;  4CCL A;  5EG0 B;  1IN5 A;  1VQL I;  1ACI A;  3HHH A;  3CJR B;  1ZK8 A;  3ZP5 A;  1KQ0 A;  4ZYA A;  5DM6 F;  3TDU C;  2JJ7 A;  3AG2 H;  1DGW Y;  2AO9 A;  3LSH A;  4P55 A;  2E7X A;  2HZT A;  3PM1 A;  4AYB A;  4D0P A;  2HKX A;  4F52 A;  1WSU A;  1USS A;  2F4I A;  1YJW I;  2L9N A;  2EV0 A;  3IRR A;  1APL C;  1TWA J;  2CWE A;  3NAU A;  5IT3 A;  1T0F C;  3OYI A;  4GFB A;  1D0X A;  1YLF A;  2EZL A;  5E8I A;  5BQT A;  5LRR A;  1ITY A;  3OYJ A;  2VQH A;  4BEH B;  2BW3 B;  1X1B A;  1LVA A;  2LG4 A;  3SEZ A;  5D6F A;  1WFX A;  2F2E A;  3HDD A;  2MA3 A;  3KEO A;  3N05 A;  3HXL A;  2QUF A;  1X1P A;  3CC2 I;  3V8K A;  4I02 A;  3ULQ B;  4EQQ A;  4B1R A;  1O4X A;  1DPU A;  2VON A;  1T56 A;  1MJ9 A;  1JT0 A;  3HKZ A;  4XSX F;  2KL4 A;  2ME6 A;  4C2M J;  4MEY F;  3SQN A;  2HZD A;  5GAG J;  2Z9O A;  3DCF A;  4FIS A;  4KIG A;  3IP4 B;  2DA3 A;  1MH3 A;  1P7I A;  2QWW A;  1ETK A;  3K4K A;  5D4S A;  2H1L A;  4HX8 A;  2OC6 A;  3TOB A;  3S15 J;  1K78 A;  2DMQ A;  4H0E A;  3QRF F;  2K3F A;  4KN7 X;  4KN4 X;  4F55 A;  4BAC A;  1MDM A;  2ESH A;  3ECH A;  4XLA A;  2FEZ A;  2NNY A;  4UVC A;  2OZU A;  1YHQ I;  2RKH A;  3L9F A;  2EIL H;  4CA0 A;  1IRZ A;  3FK7 A;  2YX4 A;  3OIO A;  5HOO A;  3V7S A;  3LFK A;  4TV7 A;  5HOD A;  3GF2 A;  1U8R A;  3K4C A;  4CXF A;  1X2M A;  2XKO A;  1SFU A;  4JYK A;  4JQF A;  2FJ1 A;  2HYF A;  2VKV A;  1ZR4 A;  3ERE D;  3GZ5 A;  3ESW B;  3PNY A;  2GXA A;  4G7H F;  2VXZ A;  5J4V A;  2FML A;  2R7W A;  2W24 A;  4MLO A;  3LOC A;  4GRI A;  2Y69 H;  1A35 A;  3JTH A;  2V1N A;  1X3Z B;  3I5U A;  3P9I A;  3FZV A;  4G7O F;  1QU3 A;  2DO7 A;  4YEJ A;  1WQ2 A;  5HNF A;  2IAI A;  1VQ9 I;  4IOA F;  2YUS A;  1Y56 A;  4O6J A;  3LMM A;  4WCG A;  4KIS A;  1S6L A;  3V42 A;  3GFL A;  2R7O A;  4XL9 A;  3DP7 A;  1AKH A;  4GCV A;  1XMX A;  2BHY A;  1XX5 A;  3FHN A;  5FLX K;  4XR6 A;  4LIU A;  2EZH A;  4C9Y A;  4YII A;  4AID A;  2XKP A;  1NG6 A;  4HYE A;  2XAG A;  2M9H A;  2L9V A; 
#chains in the Genus database with same CATH homology
 3WG7 H;  2EIN H;  3ASN H;  3X2Q H;  2EIK H;  1V55 H;  1OCZ H;  2EIL H;  2ZXW H;  1OCC H;  3AG4 H;  5B1A H;  2OCC H;  2DYR H;  2EIM H;  1V54 H;  2DYS H;  3AG1 H;  3ABL H;  3AG2 H;  2EIJ H;  5B1B H;  3ASO H;  5B3S H;  1OCR H;  3ABM H;  3AG3 H;  5IY5 H;  1OCO H;  2Y69 H;  3ABK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...