3ECOA

Crystal structure of mepr, a transcription regulator of the staphylococcus aureus multidrug efflux pump mepa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
137
structure length
135
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MepR
publication title Structural and biochemical characterization of MepR, a multidrug binding transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 51
structure length 135
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ecoA00
5D5VB 2X4HA 2HKOA 5ERIA 3N4MA 3FZVA 2Z99A 3HTUA 2EFOA 3K1MA 4WXDA 2YPRA 1MDMB 3BZ6A 3CUQA 4HF2A 1TW2A 3U9GA 1H9GA 1YIOA 2FRHA 2PMHA 1EH6A 1JHHA 5BPIA 1CGPA 4HF1A 2YSRA 5EEGA 4IPAA 2VODA 1BI1A 4AWXB 2FBIA 2PJPA 4XLPF 4IXAA 3RJPA 2M45A 4L18B 2QQBA 2CFXA 1STZA 4KA4A 2PEXA 4LG0A 5ILVA 1HQCA 2K86A 1FT9A 2C6YA 3SHFA 4NHJA 1R23A 4Q5SF 2V6CA 5JI6A 2HGCA 2HYFA 2KIUA 2D2WA 4L5JA 3TKYA 5HS8A 2VXZA 4L0ZB 1EH7A 3PQKA 4WWCA 1XCVA 3RKWA 3CJNA 1IN4A 3OOPA 5E8IA 1YW7A 3GFMA 5CVVA 3ERED 1FBSA 1R5HA 2D1VA 3RIRA 2RGVA 2L54A 3E3VA 2QBYB 1USTA 1TW3A 3DF8A 5CYVA 2XKPA 4LMYA 4RAZA 1R1TA 4ZZLA 2IA1A 3TO6A 2KJBA 4LB6B 3ZMDA 1I1GA 5HS9A 2ISZA 1O3RA 5LHHA 1XDSA 3EYIA 3FHZA 3E6CC 1IXRC 3O2PE 4EGZA 4LLNA 4UVAA 2FU4A 3OV8A 2IA0A 3QRFF 3F8NA 5TJJA 2M5WA 2OZUA 3HRSA 1RIOH 3FXQA 1LDJA 4Q47A 4XRFA 5J6XA 3ECOA 1CF7A 2CWEA 5FLXZ 4CYDA 1BI2A 2XROA 1O3TA 2ELHA 1A04A 3M8FA 4WCGA 2BGCA 3M7GA 3QP6A 4HYEA 1YS6A 3DXJF 4HA8A 4GGGA 2HOEA 2FA5A 1F5TA 4EV0A 4EM1A 5ICGA 2DPDA 4M9SA 1BN5A 3T8RA 4TV7A 2K27A 1IZ1A 4UVBA 2L4MA 2XHKA 3HRUA 4K2EA 1S6LA 2OD5A 3V4GA 1D3YA 3T0YA 4KN4X 3P9CA 2TDXA 5FB2A 2P8TA 3H92A 1BM9A 2ZXJA 2PMUA 3WTYC 2PG4A 3FMRA 3GUDA 5DCMA 3REOA 4ESBA 2VC1A 3ZMTA 4RGUA 3L09A 4IVNA 3ZN1A 1SAXA 3KP7A 1YS7A 1Z9CA 5LGUA 4I0AA 2JT1A 1K6OA 2MC3A 5CLSA 4U7BA 1F9NA 2KJCA 4R8HA 2P7CB 1FOKA 2H09A 2VC0A 2E7WA 4BHCA 4HW0A 1Z6RA 4M6XA 3WE3A 2QM3A 1E2XA 1IRGA 3ABTA 5AIQA 2K4BA 3ZN0A 1W7PB 5ICCA 1Z05A 5L3BA 5DDGA 2W24A 2EV5A 2HZTA 3BROA 1FSHA 1FNNA 1LNWA 4L9NA 2DU9A 2RC4A 1KU9A 2BV6A 1IUYA 2IP2A 4KMUX 2W25A 1J0RA 4PZJA 4P55A 1BBYA 3P9KA 3CUQC 3JSPA 4KIGA 3V8LA 2VT3A 2CSOA 4XSXF 5HLGA 4AIHA 4HQMA 3HSEA 1YG2A 4ZZDA 1ZHFA 3GVAA 3IHUA 3KE2A 1TTYA 2FSWA 2RQPA 4Y15A 2UZKA 3V8JA 2V1UA 2XAHA 1TQIA 4WX9A 2W84A 1YW9A 2JPBA 3DV8A 3ZQ7A 2Z5UA 4N9IA 5DUIA 4L9TA 4L5IA 3IRRA 2XIGA 4I02A 2V1DA 1WI9A 5E1WA 3F22A 1HKTA 2KKOA 4M9ZA 4MEYF 1G3YA 2DFIA 1IXSB 3QAHA 1OYWA 3FM3A 3M1EA 4P96A 2DLLA 1K78B 4D0PA 4U0WA 2BEOA 3DFGA 3EQLF 4L9VA 5K5QA 2M8EA 4IRHA 1PDNC 1OYYA 1NHAA 3MZHA 1P4WA 4KYWA 2LKPA 5AIPA 3WG9A 2ZJ2A 3O6BB 3GWZA 4YFXF 4OOIA 2AS5F 2M87A 1KYZA 5K5OA 3ISPA 1FYLA 2YX7A 1XSDA 2BE5F 3VEPA 1P2FA 5HLIA 3CO6C 1FYKA 1WRJA 1L0OC 1LEAA 4E70A 2HR3A 2XASA 1QZYA 1ZN2A 2P6SA 2JSCA 5ILSA 2IW5A 5DV5A 4CO8A 1FC3A 3VFZA 3KLNA 3KETA 1U2WA 3E5QA 4G6QA 4U7DA 3F8MA 3LSTA 1R5GA 2AXLA 5JFRA 2F2EA 1K7AA 5E17F 4M9XA 3Q5FA 4KUMA 2HKXA 3C18A 1HKSA 1G3TA 4JBAA 4P5OA 5BMZA 2GQQA 5ED4A 2ISYA 2ACJA 1PP8F 1LVAA 1FP2A 3JW4A 1P4AA 2F5FA 1DPRA 3FMQA 4LFUA 2XAQA 2DI3A 1J9IA 4NB5A 3BOQA 5LGNA 5A2QZ 3COAC 1S8NA 3TOBA 3F6VA 3GEZA 2EFWA 3I5UA 5E8GA 1EH8A 4KT5C 4G6DA 3KP4A 3LQQA 4CXFA 2XVCA 4A5NA 1JXSA 3GXOA 2IJLA 1J59A 3MZYA 2V79A 5CVIA 2MA3A 4I09A 2EWNA 2A61A 2MLGA 3BJ6A 1ULYA 2HQRA 1DDNA 1Z1DA 4IF4A 1RUNA 2OBPA 2MBFA 2P4WA 5FD5A 2DPUA 2PN6A 4JK1X 4LK0F 2Z9OA 2GZWA 3VOEA 1FP1D 3KEOA 2IA2A 3RI4A 1HW1A 3VODA 1R1VA 3JSOA 1Q1HA 3I54A 1XGOA 2D1HA 1YLFA 4KN7X 1C0WA 5DCFA 1XSXA 3ML6A 4Y17A 2F5CA 1H9TA 4CICA 4QLCU 3RKXA 5D4SA 3C1DA 3RKYA 4ETSA 1MGTA 3ELKA 2G7HA 2LF8A 2QLZA 2HDCA 2K7LA 3B02A 1LEBA 5L3FA 3J81Z 5D6FA 3QPHA 5FFXA 4OIPF 5AONA 1BC8C 2L3DA 3FWEA 5LLQA 5KK1A 3GFJA 3F8FA 4MGRA 1JHFA 3MAJA 2YR2A 2Y48A 5LEKA 2W57A 1MDMA 2JZYA 3AAFA 3KP2A 4JQFA 4U88A 3M8EA 2MD5A 3V8KA 1KQ8A 4MTEA 3IL2A 4A6EA 3E6MA 2FXAA 3LWFA 4N0BA 3TQNA 3MCZA 1GVJA 3KEQA 4OU0A 2ZCWA 3R6SA 3K9TA 1QQIA 4G94A 4Q48A 1MKMA 1FY7A 1QBJA 3HIFA 5JHUA 4QWQA 3KP6A 5EEHA 1MD0A 5L3EA 2HWVA 2A3SA 4AD9A 4PGHA 5H6RA 2ZKZA 3IRQA 2EJRA 1F1ZA 2KIMA 2LDUA 3QU6A 1LJ9A 1U8RA 1F4KA 1OYIA 1B9MA 3JAMK 4HLYA 3LFKA 3W6JB 1UCRA 2UXNA 5HVQC 3WTWC 4MNUA 1WSUA 4R79A 5D6EA 5LRSA 4IHTA 1ZARA 3BP8A 4Y13A 3D5LA 5JVTA 2L02A 2HYGD 2H94A 2VOPA 1IN8A 2YX4A 3R4KA 1HSTA 3H3UA 4KICA 2ZNZA 3C3WA 3GFLA 1XN7A 3FMSA 2QBYA 4WXHA 2LSOA 3K1NA 4MQVA 1I5ZA 5HDGA 5KVRA 1YO5C 3KFWX 3I59B 1XGNA 1AOYA 3PQJA 1MZBA 3TDUC 4ON0A 2VN2A 2L01A 3GYHX 4A6DA 4FX4A 5DD8A 2ZO4A 3J80K 1SMTA 5L3DA 2VBZA 1XSVA 3R0AA 1B59A 2OAZA 4KIFA 3TDZC 1R7JA 1G6NA 2XAFA 4UNOA 2EA2A 1ZH5A 3NRVA 3B73A 4MQ9F 3R0JA 2CO5A 1KU2A 4ENNA 5LEJA 5ILUA 1W5SA 1FZPB 4O3MA 1OPCA 4ZYEA 2XAJA 4P9FA 2VONA 1MJ9A 4LJZF 1J7KA 1YFHA 4GO1A 5D5WB 1TQMA 5D5XB 1B1BA 1OKRA 2A6HF 4A0ZA 2RN7A 1U3EM 1I27A 2HFHA 4M74A 1IN6A 1G3SA 3HYIA 1O3QA 4EMSA 1SFEA 3GZ5A 4EJVA 2FBHA 2GIVA 2ZNYA 3R60A 2DQLA 3JTGA 1GHCA 4HLXA 3GF2A 1R58A 1XGMA 5IT9Z 3ZPLA 1IXCA 3HTSB 1P92A 1ZG3A 4LGWA 4FX0A 2FOKA 3IC7A 1YTYA 4HX4A 4HQEA 1BIBA 4RB3C 1OR7A 3C7JA 5HDKA 4MTDA 5BS6A 1QGPA 3IKVA 2Y75A 2P5VA 1TNTA 2NS0A 2HQNA 5F1RA 4OMYA 3G73A 2A69F 5E1XA 4MEXF 1ONVA 1RI7A 3E5XA 3CDHA 2WV0A 3TO9A 3VB2A 1RUOA 2B0LA 1W7PA 3EETA 2XGXA 4XBFA 5CVUA 1QPMA 1BOAA 3KP3A 5BPDA 2NNNA 3N97A 2PQ8A 4HOBA 1W7PD 3BPVA 5HOOA 5H6QA 3IKTA 2OA4A 3KP5A 2DO7A 1T6SA 4BHPA 4CZZA 1LQ1A 1RZ4A 3MEXA 1JE8A 1GXQA 2QENA 1IAWA 3L7WA 4RB2C 1R36A 4M73A 2UXXA 2EV0A 1FLIA 3CTAA 5D4RA 1X3UA 1YW8A 1W5TA 2L4AA 1ZLJA 1D8KA 4RB0A 3F3XA 1P4XA 5FLXK 2ZMEB 3KLOA 3RPQA 4H0EA 4L9JA 2A68F 2GXGA 2A5YB 2CW0F 1ZYRF 2RDPA 3RYPA 3SZPA 3F23A 2J5PA 4HX8A 5LBQA 3BWGA 4UV9A 3SZTA 3BPXA 5IT3A 1S7OA 2HTSA 3MFKA 5CVJA 3WTVC 1T0FA 1S7AA 3P7NA 2QYOA 1XGSA 1S3JA 2HS5A 4RGRA 2QZ8A 4M71A 4OIQF 3BDDA 1QO0D 2P6TA 1K78A 4UUVA 5FO5A 1ZAOA 1D8JA 1R22A 2OZ6A 2RVCA 1ZLKA 1TNSA 2FE3A 3QU3A 4BHBA 4ZH4F 4PGGA 1XD7A 3WE2A 3E5UA 3PFIA 2OQRA 4A12A 4A5MA 3F72A 1U78A 1H0MA 2OU2A 2ETHA 2EB7A 2RV8A 2X0LA 3QPTA 2Z33A 4ENMA 3TO7A 2XRNA 1KQ0A 1R00A 3K69A 3KZZA 1HXDA 1LB2A 2P5LC 2H6BA 4XLNF 2E7XA 2Y0MA 3EUHA 3I58A 1I6XA 2EFQA 4A2UA 1E17A 1SD6A 2DW4A 3LAJA 4RAYA 1V4RA 1U5TB 3LA7A 1QZZA 1P6RA 5D8LB 1J75A 1Y0UA 4NQWA 5BQTA 1WQ2A 1DP7P 2OQGA 5E1ZB 3CUQB 4ENKA 3QOPA 4KDPA 2O3FA 1IW7F 1Z91A 2XUBA 3CO7C 2IVMA 3TOAA 4CDGA 3FXUA 1ZREA 2EV6A 1IF1A 4PCQA 1IN7A 3L9FA 2RKHA 3R61A 1KU7A 2Q0OA 4I0BA 1IN5A 1OMIA 2JPCA 4OINF 4S04A 3ECHA 2NAZA 2XKOA 2GA1A 3JTHA 4LG0B 2QVOA 3RDIA 1BC7C 2WC2A 3D0SA 1U5TA 3T8TA 3I4PA 4AIKA 3WU0A 2MLKA 4S05A 3LA2A 4B8XA 4KNYA 2CGPA 1R1UA 2YU3A 3FM5A 1MJBA 2P5KA 4FT8A 5LRRA 2ZBKA 2E1CA 5CVRA 4LLLA 2DK5A 1USSA 4HF0A 3ZP5A 3BY6A 5L3CA 3LA3A 4ESJA 2QUFA 2H27A 2PI0A 4U0VA 4ESFA 4RGXA 1UFMA 6PAXA 4FHTA 1ZGAA 1FWZA 2VT2A 5DYMA 3O3KA 1S29A 3G3ZA 4F7ZA 1SD7A 4ZYDA 2FMYA 2V9VA 3SFZA 2GA2A 2STWA 4I01A 3ZMZA 3RPUA 1HW5A 4G9YA 1LDKB 1XMAA 5E20A 4WXCA 4HBLA 1VTNC 2MH2A 1ON1A 3DEUA 4M6YA 3HHGA 3GZ6A 2R7DA 4EVIA 3TGNA 3E97A 3LQRA 4GYIA 3HRTA 3H3ZA 1KGSA 2V1XA 1BIAA 1CF7B 1MJAA 2PBIA 3FX3A 1T38A 2UWMA 3WTXC 3NQOA 1FBQA 3BJAA 4OMZA 4AIJA 3GW2A 1B6AA 3SXYA 1O3SA 1WKMA 4WF2A 4KMFA 1HBXG 3RYRA 3BJOA 1U6GA 5DEQA 1ZRCA 5LHGA 1KQ9A 1TBXA 2MH9A 1ZRDA 1ZGJA 2ADUA 1ZRFA 3I71A 5DUKA 2VE9A 3WU1B 4YFKF 2HEOA 4DNCA 3HHHA 4Q4ZF 1BI0A 3Q9VA 3V7CA 3DPTA 4GCVA 4WK8F 2NNYA 3L2CA 3L00A 4IRIA 4M72A 2Z3YA 4KFCA 4G7HF 3GX4X 5JR3A 4EJTA 5A2QK 5HS7A 1T98A 5DCMB 3T5XA 2FMLA 3WODF 1SD4A 4LB5A 3HUGA 3K1PA 4HX7A 3HOSA 5LGTA 4ENJA 1JGSA 4HDUA 1KA8A 1B9NA 4ASNA 3MQ0A 4IJAA 1FBUA 3NEUA 2K4JA 2D45A 4GYGA 4EJOA 4ZYHA 4BNCA 2IT0A 4A0YA 1HW2A 3WTZA 4RB1A 3HOTA 4Z2YA 5K5RA 3W6KB 1ZG5A 2FQ3A 4EM0B 4EM2A 4EJUA 3Q9SA 5L3GA 2J5OA 4B09A 2QWWA 3CLOA 5DD4A 4UV8A 2Q2EA 2COMA 4A0XA 4PDKA 4KIBA 4G7OF 2CG4A 2W85A 4ZYGA 3E6BA 4YG2F 2A6EF 3DP7A 1SFXA 2DTRA 1YQAA 2A07F 4BYYA 3I59A 4HV6A 2JTVA 3EDPA 3DKWA 3P9IA 2ZFWA 2R7FA 1HKQA 2IPQX 1FYMA 4LLGF 1YYVA 1ON2A 2VBYA 2O8XA 3DPLC 2STTA 2F5DA 1XB4A 4I2OA 2VE8A 3T1BA 1D5VA 3J81K 2BBYA 3WGHA 5D8KB 3K0LA 1PP7U 4UHTA 4OIRF 2FF4A 4I98B 3ABUA 1BJAA 3QP5A 2O03A 4L0YB 3U2RA 5LHIA 3HSRA 4XSZF 3I0TA 1DPUA 2G9WA 3HSFA 2E1NA 1G3WA 3V7RA 4HV5A 3I64A 2K02A 3V7SA 4YFNF 3F6OA 4LK1F 2FBKA 1I1SA 2ESHA 3MWMA 2GXBA 1U5TC 2R3SA 4IRGA 3ROUA 4IHSA 5K1YA 2DAOA 1RNLA 2WTEA 3DQVC 4DQ2A 2KRFA 4EQQA 4UXNA 2FNPA 2H6CA 4G8XA 2PLYA 5HLHA 5E18F 1XDUA 3GLXA 2QQ9A 3E6DA 1O7LA 1KU3A 2DT5A 1SMYF 2Q8KA 2GAUA 2JRTA 5D5UB 5ICFA 1LDDA 2O0YA 2NYXA 3RTRA 1GXPA 1QNTA 2DQRA 3F8BA 1FX7A 4EGYA 3EYYA 4HDVA 2M30A 2PFBA 4OIOF 1UHMA 3FXRA 2CYYA 4BH9A 2G7UA 5J8FA 3J7AO 2VBWA 1REPC 1FSEA 2BYVE 3FF5A 4MHGA 4U0YA 3HRMA 4YIFA 2M1BA 1Z7UA 4P9UA 3ZMUA 3GFIA 4O6JA 3M9AA 2CQKA 4I7HA 4BAYA 2F5EA 4EJWA 3K2ZA 2XV4S 3CUOA 4YIIA 2VBXA 2EFNA 3F8CA 1IRFA 1DUXC 2XAGA 3SQNA 5ICEA 2EA4A 1HSJA 1ODDA 3S2WA 3ZMSA 4UVCA 3WGGA 3KZYA 5F64A 4BXUA 2P7VB 1T2KA 1J2XA 1WWXA 1UB9A 1O7FA 4G7ZF 5FD6A 3IWFA 1K79A 2ZMEA 5J8CA 1Z6TA 5TRDA 2ESNA 5BOXA 2EFPA 1UHWA 1V3FA 3I53A 1PUEE 2NRAC 2O61A 1L3LA 3JAMZ 1TLHB 4LD5A 3U1DA 2FNAA 4BQAA 1TQPA 5F6FA 3WTUC 4HZFA 2KIFA 3GO5A 4CHUA 2QQAA 1G4DA 3WGIA 4HAMA 1XCBA 3ZMVA 1SFUA 2DBBA 1KYWA 2RNJA 2EK5A 3KCCA 2O6GE 5H20A 4N9HA 3WTTC 5FGMA 4R1HA 3ULQB 5IT9K 3LAPA 4GXOA 5HDNA 2FEZA 2IRFG 2HTJA 1AWCA 2DK8A 1XMKA 2WWYA 3F21A 4RGSA 2LNBA 5FFZA 2VOOA 1T39A 1O57A 4O5VA 4RS8A 4CGZA 1FPQA 1B4AA 1BI3A 1ZG1A 1EV7A 1W4MA 2LF7A 3J80Z 1SD5A 1J5YA 4AVPA 5CJ9A 2GWRA 3WTSC 3IWZA
chains in the Genus database with same CATH superfamily
5D5VB 5FJ8J 2X4HA 2HKOA 2JUGA 2LY2A 5FLVA 2DXIA 3D1NI 5ERIA 3OSFA 4UB6C 3N4MA 1FMVA 3FZVA 5H2FC 3E7LA 2Z99A 3W2WA 3HTUA 2EFOA 1LE8B 3KPHA 3K1MA 4WXDA 2YPRA 1MMAA 1MDMB 1WJDA 1E3PA 3OS1A 3CCSI 3BZ6A 5B1AH 1I50J 1K4TA 1W0TA 3CUQA 4XKWA 4HF2A 2WAQA 4X6AJ 1A31A 2KP6A 2WBMA 1TW2A 3U9GA 1Y39A 2IGNA 1H9GA 1YIOA 1VI0A 3GMEA 2XSDC 2BY0A 2FRHA 2LY9A 3BR1A 2WY8Q 2KT0A 3MKYB 2PMHA 1EH6A 1JHHA 4RLQA 1DU0A 5BPIA 1CGPA 4HF1A 4C2MJ 2JWTA 5EDNA 4A3MJ 2YSRA 5EEGA 2RREA 2Y2ZA 4XORA 4IPAA 4F93B 1JJ8C 2K3FA 2IS1A 5EJCA 2KISA 2VODA 3HPHA 2DT6A 1W36C 1BI1A 4AWXB 1OCTC 2FBIA 2PJPA 3ONQA 4XLPF 4IXAA 3RJPA 2M45A 5FLMJ 1BOBA 2QQBA 4L18B 2CFXA 3Q3SA 2K9MA 1STZA 2X1DA 5IOZA 4KA4A 4ANJA 3LSGA 2PEXA 2X6OA 4A3KJ 4LG0A 2LVSA 5ILVA 1IGNA 1HQCA 4II2A 3OYDA 4XOTA 1ZKGA 2K86A 1ETXA 1FT9A 5GPCA 4BQQA 2C6YA 2AQFA 1LE8A 3SHFA 4NHJA 1NG7A 3AG1H 4QSHA 4YRVA 1R23A 3CF2A 5JLWA 4Q5SF 2V6CA 5JI6A 3HOYJ 2HGCA 1U9NA 1OCRH 1XC5A 2HYFA 2D2WA 1Z3XA 2KIUA 4L5JA 5KAIC 2MABA 1XTAA 3TKYA 4QPOA 5HS8A 2VXZA 4IL6C 4B43A 2CUFA 1QVTA 2LFBA 3RPUD 3X2QH 4L0ZB 1EH7A 3PQKA 2HZDA 2CV1A 4C2TA 4XNFA 4HRIA 2K85A 4WWCA 1XCVA 3RKWA 3CJNA 1RC9A 1IN4A 3OOPA 5E8IA 1YW7A 3GFMA 5CVVA 1TT0A 4LIVA 3ESWB 3ERED 3LSPA 1FBSA 3BG5A 1R5HA 2D1VA 1YE9A 3RIRA 2RGVA 2DMTA 3EUKL 1XPXA 3K4BA 2L54A 3E3VA 2QBYB 1USTA 1TW3A 4IKFA 2NOJB 3DF8A 5CYVA 2XKPA 3DEEA 4LMYA 4RAZA 4IO9F 1R1TA 4ZZLA 4A93J 2IA1A 4F55A 3TO6A 2KJBA 4LB6B 3CZ6A 3ZMDA 1I1GA 3HKZN 5HS9A 4AYBA 2ISZA 4BU2A 1O3RA 1E3OC 5LHHA 1VF9A 1XDSA 3FHZA 3EYIA 3CCJI 3E6CC 1IXRC 3OR2C 2Y9ZA 3O2PE 4EGZA 2ME0A 4LLNA 2Y0SA 4UVAA 2FU4A 2CQNA 2L9SA 3OV8A 2IA0A 1JI8A 3QRFF 1WJCA 3FBNB 3CCEI 3CCMI 3F8NA 5TJJA 3G6EI 5JHFA 2CW7A 1U9OA 2M5WA 2VKVA 2YUSA 2E60A 2OZUA 3S32A 2NVQJ 3HRSA 3TP3A 4BJTA 3OYMA 1RIOH 3FXQA 1LDJA 4Q47A 1VQ7I 4XRFA 5J6XA 2XPUA 3ECOA 4RM3A 1CF7A 2CWEA 5FLXZ 1AHDP 4CYDA 2ELKA 3C2HA 4JOMA 3HEFA 2E19A 1BI2A 2K9QA 4XRSG 2XROA 1O3TA 2ELHA 1A04A 3M8FA 4WCGA 4YEJA 1BW6A 3S3OA 2BGCA 1X3WB 3M7GA 1YHQI 3QP6A 4HYEA 2OTJI 1YS6A 2VQHA 3DXJF 2BVMA 4HA8A 4GGGA 2HOEA 3PFYA 5IP9J 2FA5A 1F5TA 1KONA 2M8GX 2E1MB 4I76A 4EV0A 4BEHA 4EM1A 5ICGA 2DPDA 3GTOJ 4M9SA 3G71I 1BN5A 2BW3A 3T8RA 1JTXA 2DFEA 4TV7A 3LSKA 2K27A 1P9QC 2K40A 1R9TJ 1IZ1A 1V5EA 3W2AA 1HC8A 4LITA 4UVBA 5FKLA 2L4MA 3U21A 4JX6A 2XHKA 3HRUA 4K2EA 5CPRB 3AG4H 1S6LA 2CH0A 4B3XA 2OD5A 3V4GA 3HOWJ 1D3YA 3FK6A 3HBLA 4NUBA 3H9JA 3T0YA 2BOLA 4FASD 3ABLH 4KN4X 3P9CA 2KIQA 3BTCA 1SEUA 2TDXA 4F91B 2L0KA 3BZKA 3HC7A 3B6AA 3MMYB 5FB2A 2XRLA 2P8TA 3H92A 1LUJB 1ENHA 2DMUA 2PMZN 1BM9A 4JP0A 2ZXJA 2PMUA 3FMRA 2PG4A 3WTYC 3GUDA 5DCMA 2HDDA 2GOXB 3REOA 4ESBA 2VC1A 3ZMTA 4RGUA 3L09A 4IVNA 3ZN1A 1SAXA 1MSEC 3KP7A 1YS7A 1Z9CA 5LGUA 3KX2A 4I0AA 2JT1A 4XLHA 1K6OA 2MC3A 2GM4A 5CLSA 3HG9A 4U7BA 1F9NA 2V6EA 3H3VK 5DTDA 2KJCA 4R8HA 2EIJH 4HEA2 2P7CB 4I6ZA 3ZQGA 1FOKA 1UJ8A 2H09A 2VC0A 2E7WA 4BHCA 3QPSA 2HOTA 4UUSA 2H8RA 3G2BA 4HW0A 1Z6RA 4M6XA 2F5VA 2M2EA 3WE3A 2QM3A 3A0HC 3DBRB 1E2XA 5CQEA 1IRGA 3A03A 3ABTA 2ZXIA 1JGGA 5AIQA 1GVDA 4NNJA 3S2DJ 3S1RJ 2K4BA 4DZJA 3FXOA 3ZN0A 1W7PB 3C2GA 3A2KA 5ICCA 1Z05A 5L3BA 5DDGA 2WB1N 2W24A 2K9NA 1W5CC 2EV5A 2F48A 2HZTA 4AM3A 3BROA 1VQOI 1FSHA 4JYKA 1FNNA 1GV2A 1LNWA 4L9NA 2CFOA 2DU9A 1WJAA 1MMGA 2RC4A 2W48A 1KU9A 2BV6A 4PJJA 1IUYA 2IP2A 4KMUX 3OYEA 2W25A 1J0RA 4PZJA 3WHBA 4BKXA 4P55A 4P1WA 4AU7A 3ZQIA 2HVQA 4RM2A 3NAUA 4Z6YA 1BBYA 3P9KA 3CUQC 4OAYA 2IS4A 1JT0A 3JSPA 4KIGA 1ETWA 3V8LA 1ZGWA 2VT3A 3QYEA 2CSOA 4XSXF 4JX5A 4A3DJ 5HLGA 3PUFA 2OPTA 2X6WA 4HQMA 4AIHA 3Q0WA 3HSEA 1AKHA 1YG2A 1W36D 4ZZDA 3A02A 1ZHFA 3GVAA 2O8KA 2VL8A 1FEXA 3A01A 3OYBA 3IHUA 4C3JJ 3KE2A 4PSWA 5B5EC 1TTYA 5M5XJ 4A3GJ 3DWLE 3VYTB 2FSWA 1BJZA 2DMPA 2VQLA 2AO9A 2CQXA 2RQPA 5M5YJ 4Y15A 4IHVA 2E1OA 2UZKA 3V8JA 2V1UA 1ACIA 3ABKH 3OWTA 2IAIA 2XAHA 3M8JA 5J1YA 4IQ4A 1TQIA 1WJFA 2LMDA 3WG7H 4WX9A 2W84A 1YW9A 2JPBA 3DV8A 3ZQ7A 2Z5UA 4EATA 2R7VA 3K4NA 4N9IA 1A5JA 2L7MP 5DUIA 4L9TA 4L5IA 3IRRA 3S1NJ 2XIGA 4I02A 3OL4A 5KHDA 2V1DA 1WI9A 2COBA 2I8DA 5E1WA 3F22A 1HKTA 2KRHA 1GT0C 2NVYJ 1VQ6I 2KKOA 4M9ZA 2HNHA 4C2UA 3GTQJ 4MEYF 1G3YA 2DFIA 1IXSB 2QCOA 3QAHA 1OYWA 1LFPA 2P81A 3CMAI 3FM3A 1Y8RB 4PJNA 3I4MJ 3M1EA 1FTZA 2MC4A 4P96A 4A69C 2BY2A 2DLLA 1K78B 1ZTRA 4D0PA 4U0WA 2BEOA 4QIWN 1N25A 1S9HA 3DFGA 3EQLF 4L9VA 5K5QA 3LL7A 3KEYA 2GIZA 5GAGJ 2M8EA 1FTTA 4IRHA 1PDNC 1OYYA 1NHAA 2Z2SB 3MZHA 4ITVA 1P4WA 4KYWA 1UG2A 3QYBA 3H0DA 4ABZA 3CCVI 2LKPA 5AIPA 3WG9A 2DFFA 2ZJ2A 3O6BB 1ORKA 2HU9A 3S3MA 1RKWA 2DJIA 3GWZA 1H89C 4BE1A 4IQJA 4YFXF 4OOIA 5HODA 2AS5F 3G1MA 2PMZA 1ZR4A 2M87A 1BA5A 1KYZA 3LMMA 2PJRB 4BJ5C 1V5FA 5K5OA 2KDOA 3FK7A 3DPUA 3ISPA 1VQ5I 1DGWY 3M07A 1FYLA 3K7AJ 4ZJZA 2YX7A 1SFOJ 1XSDA 2BE5F 3VEPA 1P2FA 5TISC 3K4LA 5HLIA 3CO6C 1FYKA 1JKOC 2JSPA 1WPKA 2R7QA 4ZDPA 1P7JA 3ZRGA 1WRJA 2UUZA 3BC8A 1L0OC 1LEAA 1R4MB 4E70A 2HR3A 2XASA 3DKXA 2KFDA 1WFXA 1OISA 1QZYA 1ZN2A 2P6SA 2HDWA 2JSCA 5ILSA 2R5ZB 2DYSH 3GTMJ 2IW5A 3FXKA 3QYFA 5DV5A 4CO8A 1FC3A 3VFZA 3KLNA 3KETA 1U2WA 1W1WE 3AL0B 3E5QA 2M4KA 1MNDA 4NQWB 2EILH 2DODA 4G6QA 2E5ZA 2JVHA 4U7DA 4BBSJ 3F8MA 2JMWA 3LSTA 1R5GA 2AXLA 5JFRA 2OF7A 2F2EA 3VDXA 2V1NA 1FIPA 1K7AA 2WAEA 5E17F 4M9XA 2OCCH 3Q5FA 1A36A 4XMYA 1G2HA 1RKTA 1MBGA 2WB1A 4E7ZA 1NK2P 4KUMA 2MSYA 2HKXA 3C18A 1FIAA 2L7KA 1HKSA 1G3TA 3S1QJ 5F0FA 2JN6A 3HOVJ 4JBAA 4P5OA 3H5NA 4CYCB 4A3BJ 1J09A 3BQYA 5BMZA 2GQQA 5ED4A 4Y7NJ 1QPIA 2CV0A 3H35A 3CP2A 1SVLA 2ISYA 2ACJA 1PP8F 1BR2A 2HOAA 1V54H 1LVAA 1YIJI 1FP2A 2H1KA 1GV5A 3JW4A 1P4AA 2F5FA 1JKRC 3ABMH 1DPRA 4HPQA 3FMQA 3S1MJ 4LFUA 2CUZA 2X1CA 2XAQA 3ZR8X 2DI3A 4XLEA 1TP4A 3OMYA 1K61A 1J9IA 2KRCA 4NB5A 3BOQA 5LGNA 5A2QZ 3COAC 1S8NA 2ZB9A 3TOBA 1D5YA 3F6VA 3GEZA 2R7TA 2EFWA 3I5UA 5B1BH 1S7EA 1EH8A 5E8GA 4KT5C 1RR8C 4XR6A 4G6DA 3KP4A 2Y0SN 3LQQA 2BXYA 4CXFA 2XVCA 4A5NA 4DZPA 3GXOA 1H88C 1F43A 1JXSA 2IJLA 1J59A 3MZYA 2ECCA 2V79A 5CVIA 2MA3A 3GBGA 4I09A 2EWNA 4CCMA 2A61A 2MLGA 3BJ6A 1ULYA 2HQRA 1TL8A 2DFHA 3OIQA 1DDNA 1Z1DA 4IF4A 1RUNA 5E3MA 2OBPA 2MBFA 2P4WA 3W6VA 5FD5A 1GUUA 2PN6A 2DPUA 4JK1X 4LK0F 1WJ5A 2Z9OA 3RQ4A 2GZWA 3VOEA 1FP1D 2JRMA 3LSIA 4BBRJ 3KEOA 1VQKI 1TZLA 1HA8A 2E1MC 2HXIA 1FOXA 2IA2A 2GBYA 3RI4A 1MBEA 3OYAA 2VJ5A 1HW1A 4X1EA 3VODA 4U87A 2FUG2 1R1VA 2VASA 4CCLA 2Y30A 3OSGA 3JSOA 1Q1HA 2LTPA 5KNLA 1Z21A 3I54A 1XGOA 2L9RA 2D1HA 2UV1A 4E7HA 3L2QA 2HVSA 1YLFA 4KN7X 1C0WA 5DCFA 2JA7J 1I3QJ 1XSXA 5IP6A 3ML6A 4Y17A 9ANTA 2MW8A 4HSRA 2R7SA 2KLOA 2F5CA 1H9TA 4N4OB 4CICA 4QLCU 3BT9A 3RKXA 5D4SA 2ZJQF 3C1DA 3RKYA 2CU7A 2DT7B 4ETSA 1MGTA 3ELKA 2G7HA 2LF8A 2QLZA 2HDCA 2FD5A 2K7LA 5F04A 3B02A 2XF7A 1LEBA 5L3FA 1TC3C 3J81Z 3CD6I 3CMYA 4M3DA 5EZGA 5D6FA 5IP7J 2K9LA 1S72I 2NXNB 3QPHA 3SFIA 1MNMC 3FKJA 2QSGX 4Y4RA 5FRMA 2V9PA 3MN2A 4KITB 1CQTA 5FFXA 2DOAA 2VQCA 4YIRX 4KT6A 4OIPF 5AONA 1BC8C 2L3DA 3FWEA 5LLQA 3FHNA 5KK1A 3HDDA 3GFJA 2OC6A 3F8FA 3U1KA 4MGRA 5GTHC 1JHFA 3S93A 3MAJA 2W7NA 2YR2A 3FISA 4MO7A 2Y48A 1OCZH 5LEKA 1QU3A 2W57A 1MDMA 2JZYA 4F3QA 3AAFA 2L9VA 3KP2A 4JQFA 4U88A 2EBIA 2ZFUA 3M8EA 3MVPA 1D0YA 4FQGA 2VJIA 2CV2A 2MD5A 3V8KA 1KQ8A 2EH3A 4MTEA 3IL2A 3H0GJ 4CUGA 4A6EA 3NWSA 2XF5A 3CESA 5GP9A 3E6MA 2FXAA 3LWFA 4LOCA 4N0BA 3TQNA 1N75A 3MCZA 1GVJA 3KEQA 2QSHX 4OU0A 4BY1J 3G1LA 5HLTA 4E4HA 2ZCWA 2LH9A 3JRGA 2AQEA 3R6SA 3RCOA 3JRDA 1U8BA 3PNVA 5M3MJ 1GLNA 2EIKH 3S17J 4A3IJ 3K9TA 1TWAJ 2M9HA 4DBQA 1MIJA 1JUPA 2OV7A 1WCMJ 1VZ0A 3OYCA 1QQIA 4G94A 4Q48A 1MKMA 3ASOH 1FY7A 1Z77A 2LKXA 1QBJA 3VSKA 4XRSA 2HXOA 4XLAA 3FDYA 3HIFA 2LBFB 1X3ZB 3ZQHA 3BLYA 1R49A 4IHXA 3OYGA 5JHUA 4QWQA 2ID3A 3KP6A 5GADJ 2R7UA 5EEHA 4N4NB 1Z3YA 1MD0A 3HUGB 4HNTA 5L3EA 2HWVA 2A3SA 4AD9A 4PGHA 5H6RA 4AIDA 4D1QA 2ZKZA 3IRQA 3TL4X 2EJRA 1F1ZA 3CDLA 2KIMA 2LDUA 1XMXA 3QU6A 1Y1WJ 1LJ9A 1U8RA 1F4KA 2I5UA 1JUSA 1V5GA 2CUEA 2P0WA 1OYIA 2VIXA 1B9MA 4BDYA 2DDBA 2JA2A 3JAMK 5E3NA 4HLYA 1T56A 1WI3A 2XPWA 3MD2A 3LFKA 3W6JB 1UCRA 2UXNA 1BL0A 3KYCB 5HVQC 3WTWC 4MNUA 1WSUA 1YJNI 4R79A 3OY9A 4D5CA 5D6EA 5LRSA 4IHTA 1ZARA 2QF7A 4L5EA 3KIOA 2DA3A 2GXAA 3BP8A 4Y13A 2V9KA 5IYBJ 1ERDA 4MIMA 3D5LA 5JVTA 2L02A 2HYGD 1LVKA 3CLQA 1VNDA 3IH4A 2H94A 2VOPA 1IN8A 2VUMJ 2Q2EB 2YX4A 3R4KA 1RR7A 1T0FC 1HSTA 3H3UA 2EZHA 4KICA 3ZOBA 2ZNZA 3NARA 3GZNB 3C3WA 3GFLA 2Q1ZB 1XN7A 3FMSA 2QBYA 4WXHA 2LSOA 3K1NA 4MQVA 5K7ZA 1I5ZA 1VQNI 5HDGA 5KVRA 1YO5C 3KFWX 2LBFA 4B4CA 1YX3A 1PYVA 3I59B 1R4NB 1XGNA 1Y6IA 3WU2C 2Z1DA 4BQOA 1AOYA 2LD5A 2QQ8A 2KL4A 3PQJA 1JKQC 3QPLA 3BCAA 3SDGA 1MZBA 3TDUC 4ON0A 1G8XA 2VN2A 2L01A 5EYRA 3JRAA 1X2NA 3GYHX 3P5JA 3NWTA 1HF0A 4A6DA 4FX4A 3GTLJ 5DD8A 1IRZA 2ZO4A 3J80K 2R0QC 1SMTA 3DLAA 2VBZA 5L3DA 1ZELA 1XSVA 3R0AA 3OR1C 1B59A 2OAZA 3K4CA 3TP0A 4KIFA 3I56I 3TEDA 3TDZC 1R7JA 1BR1A 2XAFA 1G6NA 5J4YA 4UNOA 5E79C 2EA2A 2F4MB 1ZH5A 1LFBA 3NRVA 3B73A 4MQ9F 3R0JA 3DTKA 3PIOF 3BG9A 2HQAA 5DM6F 3EUHC 1I3AA 2CO5A 1KU2A 4ENNA 3E1SA 5LEJA 5ILUA 1W5SA 2NVXJ 1FZPB 4XN3A 1D1CA 1EKEA 3PSIA 4O3MA 3ZQQA 1EJ9A 1OPCA 3L2RA 4ZYEA 5K7FA 2XAJA 4P9FA 2VONA 1MJ9A 4XN0A 4LJZF 3DTEA 1J7KA 4V19K 1YFHA 4FTHA 1OCPA 4GO1A 5D5WB 1TQMA 1B1BA 1OKRA 5GPAA 2A6HF 3K2AA 5D5XB 4A0ZA 2RN7A 1U3EM 2XDVA 4D5FA 1I27A 3HM5A 2HFHA 4HSTA 1ETVA 4M74A 5GAHJ 2CMPA 1IN6A 2F6CA 1G3SA 4RAGA 3HYIA 1O3QA 4EMSA 3IH3A 5HNHA 1SFEA 2M4GA 4ZC3A 3GZ5A 4EJVA 5GTIC 2FBHA 2GIVA 2ZNYA 3N05A 3R60A 5F27A 3SZGA 2DQLA 3AKZA 3JTGA 4BE2A 1A35A 1EA3A 4XONA 1GHCA 4HLXA 3GF2A 2ELJA 1R58A 1XGMA 2KMUA 3ERMA 3H5RA 5IT9Z 3ZPLA 2V26A 1IXCA 2DCEA 3L2VA 2R5YB 3HTSB 4XL9A 1P92A 1ZG3A 4LGWA 4FX0A 3E0JB 2FOKA 1X19A 4UUTA 3IC7A 4W97A 1U0JA 2EQRA 1YTYA 2RQQA 3SJMA 2LREA 4HX4A 4HQEA 1BIBA 3TBIA 4RB3C 1OR7A 3C7JA 5HDKA 4MTDA 5BS6A 1QGPA 3IKVA 4ZDLA 1IRXA 4ZTFA 2KDZA 2Y75A 4RMNA 2P5VA 1MMSA 1TNTA 2NS0A 4DYQA 1WH7A 2VI6A 3JR9A 2HQNA 5F1RA 4OMYA 3HOZJ 3G73A 2A69F 5E1XA 3OYNA 4MEXF 1ONVA 1RI7A 3E5XA 1ETKA 5EG0B 3CDHA 4OWRB 2WV0A 3TO9A 3VB2A 1RUOA 1OCCH 2B0LA 1W7PA 3EETA 2XGXA 1FOWA 4XBFA 4C3IJ 4XICA 2JA5J 5CVUA 1QPMA 3RKQA 1BOAA 1K4SA 1B72B 1T33A 4BS9A 3KP3A 1I39A 5BPDA 3D5SC 3IUOA 4RDUA 3GTKJ 2NNNA 3N97A 2PQ8A 2E2HJ 1E0EA 4HOBA 2JK3A 2QA4I 1MBHA 1W7PD 4MFEA 3H36A 3BPVA 5HOOA 5H6QA 3IKTA 2OA4A 4AVZA 3KP5A 2DO7A 1T6SA 3A1YA 3HGYA 1M1EB 4BHPA 4CZZA 1UZCA 1LQ1A 1RZ4A 3MEXA 1JE8A 3HZJA 3A4CA 1GXQA 2ZC2A 3J7ZI 2QENA 1IAWA 3L7WA 4RB2C 1R36A 3CCUI 3CDIA 5J47A 1RESA 2LP0A 4M73A 2JJ7A 2UXXA 1P7IA 3PIPF 2EV0A 1FLIA 5JLXA 5C4XJ 3CTAA 3BQZA 5D4RA 1PUFB 1X3UA 1YW8A 2K9SA 1Y0NA 1W5TA 2L4AA 1ZLJA 1D8KA 5EZHA 4M3GA 2H8WA 4RB0A 3F3XA 1P4XA 5FLXK 2ZMEB 3KLOA 4PJMA 3RPQA 4E6KG 1SVOA 3ZGKA 4H0EA 3CF5F 2IBDA 3LSRA 1UELB 3O8GA 1IJWC 4G6TB 4HG2A 4L9JA 4KJZA 4C3HJ 3L2UA 2A68F 2GXGA 4DW6A 1VQLI 2A5YB 2CW0F 2R7RA 1ZYRF 3L2WA 2RDPA 3RYPA 3SEZA 1SVMA 3SZPA 4MFDA 5LFAA 3F23A 1G59A 2J5PA 1LPQA 1QRYA 4FE4A 4HX8A 5LBQA 2KHMA 2X85A 2M0MA 4V2GA 2RAEA 2R4GA 2X51A 3BWGA 2DA4A 2E34A 1BW5A 3UNGC 4UV9A 3SZTA 3BPXA 5IT3A 1YITI 3VYSB 3PSFA 3G4SI 1A6IA 1O4XA 3KYLA 1S7OA 2HTSA 3MFKA 2LOOA 4HNUA 5CVJA 3WTVC 1T0FA 4F92B 3HGGA 2DOFA 2DDAA 2HQ5A 1S7AA 3P7NA 3OYHA 1T95A 2QYOA 1XGSA 1S3JA 4BACA 2HS5A 4RGRA 1X1CA 2QZ8A 4M71A 4OIQF 4NDLA 3BDDA 3VYUB 1QO0D 2M0CA 2P6TA 2QKMB 3LFUA 1K78A 4UUVA 5FO5A 1ZAOA 1D8JA 1R22A 2OZ6A 2RVCA 2YU9J 3CMEI 3DBHB 2Z16A 2TCTA 2XGCA 2OTLI 1R6RA 3BG6A 1TNSA 2FE3A 1ZLKA 3QU3A 2EPFA 1YRNB 4BHBA 1X1DA 2VB6A 3PNYA 1BR4A 4DBRA 4A3EJ 4M3BA 4ZH4F 4PGGA 2DJNA 1XD7A 3VPRA 1MH3A 3H9QA 4CCNA 3WE2A 3E5UA 3PFIA 1IDZA 1JTYA 2XGDA 2OQRA 3BTJA 3OYIA 4A12A 4A5MA 3F72A 2PJRA 3LSJA 3QQAA 4GFBA 1U78A 2LYCA 5FKNA 1H0MA 2W1OA 2M7BA 2OU2A 2M34A 2ETHA 2X0LA 2RV8A 2EB7A 2DOEA 3QPTA 3JREA 2Z33A 4ENMA 3TO7A 2H1LA 2XRNA 1KQ0A 4DJAA 2XPVA 1R00A 3K69A 2LRDA 3KZZA 1HXDA 2VLAA 1VFCA 2M3AA 1VQ8I 1LB2A 2LY1A 2AHQA 3DLLF 2P5LC 2H6BA 4XLNF 2AXTC 2E7XA 2Y0MA 2X1EA 3EUHA 3I58A 1Z7LA 2VKEA 2HPIA 2PX9A 3TW6A 1I6XA 2EFQA 3OYFA 4A2UA 1E17A 1SD6A 2DW4A 3LAJA 4RAYA 4CZCA 1V4RA 3DTIA 4M3FA 1ITYA 2R5ZA 3V42A 1U5TB 3LA7A 2WAFA 2ZXWH 1QZZA 2I10A 1P6RA 4RBOA 1HDDC 1I6HJ 1DGRM 5D8LB 2VPLA 1NTCA 1J75A 1Y0UA 4NQWA 5BQTA 2ZSIB 1WQ2A 1DP7P 2BHYA 3OIPA 2OQGA 5E1ZB 2O7OA 1YJ9I 3RSNA 3H1CA 1MBKA 3CUQB 3W2VA 4ENKA 3AG2H 3LSMA 3QOPA 4ZTJA 4KDPA 1WJBA 4E7IA 2OCEA 3DEWA 2O3FA 2XB5A 2DA2A 1IW7F 2IXSA 1Z91A 2XUBA 4XLFA 3CO7C 2IVMA 2JUCA 2HOSA 3AG3H 3TOAA 2ZJRF 4CDGA 3FXUA 1ZREA 2E35A 5IY5H 2EV6A 3RZOJ 1IF1A 4PCQA 1IN7A 5J1RA 2F4OB 3CCLI 1QHHD 2K5CA 4CYCA 3L9FA 2RKHA 3R61A 5IPAA 5EF6A 1XG1A 1KU7A 2Q0OA 3OOUA 1IN5A 1OMIA 2JPCA 3IP4B 4I0BA 1NK3P 3MKWB 3CCQI 2EZIA 4OINF 2VXDA 4D7MA 3LSHA 4CSWA 4S04A 1KZHA 3ECHA 1FOYA 2NAZA 1K83J 4XIDA 2XKOA 2GA1A 3QOEA 4HNVA 3JTHA 4LG0B 4UB8C 3SYTA 2QVOA 3FXLA 4CCJA 2W4SA 2JA6J 2Y9YA 3HL2A 4A3LJ 2LG4A 3RDIA 1BC7C 2WC2A 3D0SA 1U5TA 3T8TA 3I4PA 2B9SA 1T8IA 1VQMI 4AIKA 1XS9A 5C3EJ 3WU0A 2MLKA 3ZCOA 4S05A 3LA2A 4B8XA 4KNYA 2EINH 1R1UA 2CGPA 3VWBA 2YU3A 3PL8A 3C2BA 3FM5A 4PJ0C 1MJBA 2P5KA 5F08A 4FT8A 1WGXA 5LRRA 2ZBKA 1WZ2A 1ETOA 2E1CA 5CVRA 1MBFA 4LLLA 2DK5A 4NBQA 1USSA 2ID6A 3S8PA 2E5NA 4HF0A 1OR7C 3UR3C 5K7HA 3ZP5A 3BY6A 2V7FA 2CUJA 3BCBA 5L3CA 2O9LA 5CKTA 5FRNA 4G12A 3CCRI 3LA3A 4B48A 1XX5A 4ESJA 5J3LA 1X58A 2QUFA 2H27A 2BVLA 2PI0A 4U0VA 4ESFA 2VKHA 4RGXA 3OYLA 4E7LA 1UFMA 3O8HA 4FETA 2IGOA 2NVTJ 4IZZA 6PAXA 4FHTA 3KYDB 3K4MA 2DTZA 1ZGAA 4B1RA 2HVRA 1FWZA 2O5RA 2VT2A 5FROA 3CJQB 5DYMA 2LKSA 4F52A 3O3KA 2ZJPF 3M1CA 3JRBA 1S29A 3VYRB 2Y69H 3G3ZA 4F7ZA 1SD7A 4ZYDA 2FMYA 2X6YA 2V9VA 3SFZA 1E3HA 2GA2A 2STWA 4I01A 5J1UA 3ZMZA 4C9YA 3DU6A 2W82A 3RPUA 1HW5A 4G9YA 3J7AY 1LDKB 1XMAA 5E20A 1R71A 2WV1A 1HDPA 3IAM2 3F9KA 1K6YA 4WXCA 4HBLA 3OS2A 3A0BC 3K70C 2CS3A 1VTNC 1TWFJ 2MH2A 2DMQA 1ON1A 3DEUA 4JX4A 5B3SH 4M6YA 3I55I 1SC7A 2R93J 2VJ4A 3HHGA 2L9NA 3GZ6A 2R7XA 5EGOB 2R7DA 4EVIA 3TGNA 3E97A 3LQRA 4GYIA 3HRTA 3H3ZA 1KGSA 2V1XA 1T08B 2DA7A 2RNGA 3S2HJ 3G1OA 1BIAA 1CF7B 3ZQLA 2B63J 1IUFA 1MJAA 2B7EA 3K10A 2Y31A 3EPZA 2G0EA 2MYSA 2PBIA 3FX3A 4FE7A 1T38A 2UWMA 5DS9A 3WTXC 3NQOA 1FBQA 3BJAA 4OMZA 4AIJA 3GW2A 1B6AA 1SAUA 3SXYA 1O3SA 1WKMA 4WF2A 4KMFA 1HBXG 3RYRA 4B47A 3BJOA 2IGMA 3HOXJ 2R7OA 3BTIA 1U6GA 2NS8A 5DEQA 1ZRCA 5LHGA 1KQ9A 1TBXA 2MH9A 2GWRA 3H9GA 1ZRDA 1ZGJA 2ADUA 4BEHB 2KPMA 4J19A 4PUSA 1ZRFA 2DA6A 3I71A 5DUKA 2BW3B 2JVGA 3WU1B 2VE9A 5IYCJ 2BY3A 4YFKF 2HEOA 3CC7I 4DNCA 3HHHA 2A5WA 4Q4ZF 5TGTA 1BI0A 3BR3A 3BR6A 3Q9VA 4DYCA 1MBJA 2WA0A 3PNTA 3V7CA 3DPTA 4XKVA 4GCVA 5B66C 4WK8F 1LFUP 3CQZJ 3CP8A 3BG3A 2NNYA 2E71A 3FXMA 5KAFC 3L00A 3L2CA 1MSFC 4M72A 4IRIA 1OQYA 5EGOA 5E3LA 2Z3YA 4KFCA 4G7HF 3GX4X 5JR3A 4FCYA 4EJTA 1IO2A 2VKDA 1MMNA 2LR8A 5A2QK 1N78A 3BR5A 3D5RC 4M3EA 2DA5A 4DOZA 5HS7A 1T98A 5DCMB 2MD0A 4X0GA 1OLTA 3T5XA 5M3FJ 4M6VA 2FMLA 1ETYA 1WJEA 2X9DA 3WODF 4QTRA 2WADA 1SD4A 2CRGA 4LB5A 3ZQCA 5HNFA 1ETQA 1HOMA 3HUGA 3ZXSA 3K1PA 4HX7A 3HOSA 3L1PA 2BZTA 3BR0A 5LGTA 4XK4A 3LNQA 5F1JA 3GTPJ 4ENJA 3GCMA 3PO3J 2ZMEC 3HXLA 1PJRA 2QKLB 1JGSA 4YELA 1JJ6C 4HDUA 4IEJA 1KA8A 1B9NA 4ASNA 3IV5A 2MFZA 3MQ0A 1A6QA 4IJAA 1FBUA 3NEUA 2K4JA 2D45A 4GYGA 4EJOA 4UUSB 1VQPI 2A05A 4ZYHA 4BNCA 2IT0A 2YS9A 4A0YA 1HW2A 1Y56A 3WTZA 3HB9A 4RB1A 3HOTA 4Z2YA 4NC8A 5JVGF 3K4JA 5K5RA 3BZCA 3W6KB 1JKPC 1ZG5A 3WHCA 4ZDOA 2FQ3A 4EM0B 4EM2A 1OCOH 4EJUA 3Q9SA 5L3GA 2J5OA 3MKLA 4B09A 2XC7A 1QHGA 1DP3A 2QWWA 3CLOA 5DD4A 2OUMA 4UV8A 4RLFA 4CCOA 2GLOA 4FISA 2Q2EA 2COMA 2QGUA 2XF6A 4A0XA 3J7YJ 4PDKA 1QA6A 2ZXHA 5DM7F 4KIBA 4G7OF 4RA2A 1TWGJ 2CG4A 2DMNA 3MZ8A 4E7JA 2W85A 3BG7A 1VQ9I 4ZYGA 3E6BA 4YG2F 1TWHJ 2A6EF 2GOMA 2ZSHB 1SFXA 1YX5A 3DP7A 1YOVB 1GDTA 2DTRA 1YQAA 3LOCA 2A07F 4BQNA 2BHZA 4BYYA 3AL0C 3I59A 1D1AA 4UY8I 4HV6A 2JTVA 2L7FP 2IS2A 1YJWI 1WVRA 3DKWA 3EDPA 3P9IA 3GTJJ 2ZFWA 2R7FA 1HKQA 4XOPA 2IPQX 1FYMA 4LLGF 3DKYA 4XKCA 1YYVA 1MMDA 1ON2A 2DA1A 2VBYA 2O8XA 3DPLC 5FKMA 3K4KA 3JCUC 2STTA 2F5DA 1XB4A 5IYDJ 5LD2C 4I2OA 2VE8A 3T1BA 1D5VA 3IH2A 3J81K 2BBYA 3WGHA 3CC2I 5D8KB 3K0LA 1DQUA 1PP7U 2HYJA 4UHTA 4J01A 1AKHB 4OIRF 3DBLB 1ZQ3P 4CH7A 1WH5A 4C30A 2DYRH 2VQGA 3A01B 2FF4A 5CQGA 4I98B 3Q0UA 3ABUA 4BXXJ 1BJAA 3QP5A 3OS0A 2O03A 4L0YB 4PSXA 3U2RA 1DU6A 5LHIA 3HSRA 4XSZF 3PO2J 3I0TA 1Y8QB 1DPUA 2G9WA 1Y1VJ 1MW7A 1SFKA 2XB0X 4BL0B 3JRHA 3HSFA 2E1NA 1G3WA 1SANA 3V7RA 4HV5A 3I64A 2K02A 2TRTA 4XLCA 3F6OA 1IDYA 4Y3OA 3V7SA 4YFNF 1FJLA 4IHWA 2EZKA 4LK1F 4IOAF 1OFCX 4LG3A 2NOGA 2FBKA 1QZEA 3CC4I 1I1SA 2K3PA 2ESHA 4II3A 3CCYA 3MWMA 2GXBA 1U5TC 4B3AA 1H8AC 2R3SA 4IRGA 3ROUA 4IHSA 5K1YA 2DAOA 4IX7A 2EIMH 2HI3A 5F0HA 1HLVA 1RNLA 4E7KA 2WTEA 5J40A 3DQVC 4DQ2A 2KRFA 4EQQA 4UXNA 2QEXI 2FNPA 2H6CA 4AUXA 4G8XA 2FOWA 2PLYA 3HKZA 5HLHA 1B8IB 5E18F 3BR2A 1HCRA 1XDUA 3CJTB 3GLXA 4NC7A 3S14J 3IAS2 2QQ9A 2XGEA 1N77A 2FJ1A 3E6DA 4B44A 3S3NA 3RQIA 1RRJA 2MG4A 4BY7J 1O7LA 2WY7Q 4A3CJ 3SEQA 1KU3A 1ZR2A 4XRMA 2DT5A 1Q1VA 1TWCJ 1SMYF 2Q8KA 2GAUA 2JRTA 3I9V2 5D5UB 2LLKA 3M4OJ 3F0CA 5ICFA 4XQFA 1LDDA 2ICWG 2NYXA 2O0YA 3RTRA 2R5YA 1GXPA 2L5QA 1QNTA 2DQRA 2N8GA 1FX7A 3ASNH 3F8BA 4PFOA 4EGYA 3EYYA 1X1AA 2IEKA 4AC0A 4HDVA 2M30A 2PFBA 4OIOF 4D7NA 3TMOA 3K70D 3JRCA 3S15J 1UHMA 3FXRA 2CYYA 4BH9A 2FX0A 2G7UA 5J8FA 3J7AO 2VBWA 1REPC 2BY1A 1FSEA 1D0XA 2BYVE 3FF5A 4MHGA 1MH4A 3HRMA 4YIFA 2A6TA 4U0YA 2M1BA 3UKGA 1Z7UA 4P9UA 4MLOA 2LC2A 2HPMA 1R5ID 4V2FA 3ZMUA 2CQQA 1W0UA 1X1PA 3GFIA 4O6JA 3BTLA 2EZLA 3M9AA 2CQKA 4QPQA 4I7HA 2KZVA 4BAYA 4BXFA 4DGWB 2F5EA 4XM3A 4EJWA 3OYJA 3RZDJ 5EG0A 3K2ZA 1B8IA 4NC6A 4I99C 1X1BA 2XV4S 4GRIA 3CUOA 1LKXA 4YIIA 4A3FJ 2VBXA 1RETA 2WAQN 2EFNA 2QSFX 3OIOA 4H4KC 5E3OA 3F8CA 3QODA 4PJLA 3HOUJ 1IRFA 4D9JA 4DYRA 2M7AA 1B72A 1DUXC 1D0ZA 2XAGA 5C4JJ 4S0HB 3SQNA 5ICEA 2EA4A 2XAUA 3PUBA 2E2JJ 1HSJA 1ODDA 1TT5B 5IOYA 3S2WA 1MNEA 5BNGA 4PK4A 3ZMSA 2R7WA 3W3CA 1NH3A 2KZGA 3B6CA 2CW8A 1IC8A 1UAAA 4UVCA 3I4NJ 3DCFA 3WGGA 4A3JJ 1UHSA 3PM1A 5M5WJ 3ZQFA 3KZYA 5KCMA 5F64A 4BXUA 4Y52J 1POGA 5EEAA 4RAFA 4KISA 2P7VB 4PFPA 1WHUA 4DIQA 3K6GA 2KQRA 1X2MA 3CMMA 1T2KA 2V4JC 2VJJA 1J2XA 1WWXA 1JT6A 1UB9A 1PUFA 4LIUA 1O7FA 4ZYAA 4BDZA 4BGDA 3HJEA 3FIWA 4G7ZF 3H5AA 5F0CA 5FD6A 3AFHA 3IWFA 1K79A 2ZMEA 1OJLA 2VPRA 5J8CA 2L7ZA 4BUPA 1Z6TA 5TRDA 4GDFA 4EEFG 2ESNA 2BXZA 5BOXA 2EFPA 2NS7A 1UHWA 1V3FA 3I53A 1QVUA 1PUEE 2NVUB 2NRAC 5J4VA 1S5LC 4CCKA 2O61A 3FXJA 1IV8A 4W1UA 2MGQA 1L3LA 1Z67A 3JAMZ 1TLHB 2W00A 4LD5A 3U1DA 2E2IJ 2CQ7A 2FNAA 3Q0VA 3GTGJ 4BQAA 3KZIC 1VQ4I 1TQPA 5F6FA 2D5VA 2X6XA 3WTUC 4Y33A 4HZFA 1AA7A 2KIFA 3GO5A 3JRIA 1IV6A 4CHUA 2QQAA 2ME6A 4IHYA 1G4DA 3WGIA 3SDBA 4HAMA 1XCBA 2XSJC 3ZMVA 1SFUA 2DBBA 1KYWA 4BE0A 5FKKA 4J00A 1JUMA 5GAEJ 2ECBA 2RNJA 3FKIJ 2EK5A 3KCCA 3VSLA 1EF4A 3I3LA 2IS6A 2O6GE 3FBIB 1X4PA 5C44J 2R7ZJ 5H20A 1PVEA 1UMQA 4N9HA 3WTTC 1IG7A 5FGMA 4R1HA 4AYBN 3ULQB 5IT9K 4OAZA 4GXOA 3LAPA 3MKZA 4BJ6C 5HDNA 1YRNA 2FEZA 2IGKA 1YI2I 2IRFG 2R92J 1UG0A 4IOCF 1NG6A 3HPGA 2HTJA 4E7SA 2OJED 1Z0XA 1AWCA 2DK8A 3PJRA 4XKBA 3JRFA 1F36A 1APLC 2E36A 3EUAA 2JQ7A 2JA8J 2X48A 1XMKA 2F4IA 2WWYA 2CJJA 3F21A 2LK2A 3OYKA 3TW7A 4RGSA 1AU7A 3M3YJ 2LNBA 5FFZA 2VOOA 3DU5A 1T39A 1FMWA 1O57A 1V55H 3QWLA 4O5VA 5FKOA 3GLLA 4RS8A 4CGZA 1RPWA 2FQ4A 1FPQA 1X4OA 1ZK8A 1B4AA 1BI3A 4CA0A 1ZG1A 1EV7A 1W4MA 2LF7A 3J80Z 1SD5A 3S16J 2L2OA 1J5YA 1D1BA 2DN0A 4AVPA 3OL3A 5CJ9A 3CJRB 3WTSC 3IWZA
chains in the Genus database with same CATH topology
5D5VB 2X4HA 2HKOA 5ERIA 3N4MA 3FZVA 2Z99A 3HTUA 2EFOA 3K1MA 4WXDA 2YPRA 1MDMB 3BZ6A 3CUQA 4HF2A 1TW2A 3U9GA 1H9GA 1YIOA 2FRHA 2PMHA 1EH6A 1JHHA 5BPIA 1CGPA 4HF1A 2YSRA 5EEGA 4IPAA 2VODA 1BI1A 4AWXB 2FBIA 2PJPA 4XLPF 4IXAA 3RJPA 2M45A 4L18B 2QQBA 2CFXA 1STZA 4KA4A 2PEXA 4LG0A 5ILVA 1HQCA 2K86A 1FT9A 2C6YA 3SHFA 4NHJA 1R23A 4Q5SF 2V6CA 5JI6A 2HGCA 2HYFA 2KIUA 2D2WA 4L5JA 3TKYA 5HS8A 2VXZA 4L0ZB 1EH7A 3PQKA 4WWCA 1XCVA 3RKWA 3CJNA 1IN4A 3OOPA 5E8IA 1YW7A 3GFMA 5CVVA 3ERED 1FBSA 1R5HA 2D1VA 3RIRA 2RGVA 2L54A 3E3VA 2QBYB 1USTA 1TW3A 3DF8A 5CYVA 2XKPA 4LMYA 4RAZA 1R1TA 4ZZLA 2IA1A 3TO6A 2KJBA 4LB6B 3ZMDA 1I1GA 5HS9A 2ISZA 1O3RA 5LHHA 1XDSA 3EYIA 3FHZA 3E6CC 1IXRC 3O2PE 4EGZA 4LLNA 4UVAA 2FU4A 3OV8A 2IA0A 3QRFF 3F8NA 5TJJA 2M5WA 2OZUA 3HRSA 1RIOH 3FXQA 1LDJA 4Q47A 4XRFA 5J6XA 3ECOA 1CF7A 2CWEA 5FLXZ 4CYDA 1BI2A 2XROA 1O3TA 2ELHA 1A04A 3M8FA 4WCGA 2BGCA 3M7GA 3QP6A 4HYEA 1YS6A 3DXJF 4HA8A 4GGGA 2HOEA 2FA5A 1F5TA 4EV0A 4EM1A 5ICGA 2DPDA 4M9SA 1BN5A 3T8RA 4TV7A 2K27A 1IZ1A 4UVBA 2L4MA 2XHKA 3HRUA 4K2EA 1S6LA 2OD5A 3V4GA 1D3YA 3T0YA 4KN4X 3P9CA 2TDXA 5FB2A 2P8TA 3H92A 1BM9A 2ZXJA 2PMUA 3WTYC 2PG4A 3FMRA 3GUDA 5DCMA 3REOA 4ESBA 2VC1A 3ZMTA 4RGUA 3L09A 4IVNA 3ZN1A 1SAXA 3KP7A 1YS7A 1Z9CA 5LGUA 4I0AA 2JT1A 1K6OA 2MC3A 5CLSA 4U7BA 1F9NA 2KJCA 4R8HA 2P7CB 1FOKA 2H09A 2VC0A 2E7WA 4BHCA 4HW0A 1Z6RA 4M6XA 3WE3A 2QM3A 1E2XA 1IRGA 3ABTA 5AIQA 2K4BA 3ZN0A 1W7PB 5ICCA 1Z05A 5L3BA 5DDGA 2W24A 2EV5A 2HZTA 3BROA 1FSHA 1FNNA 1LNWA 4L9NA 2DU9A 2RC4A 1KU9A 2BV6A 1IUYA 2IP2A 4KMUX 2W25A 1J0RA 4PZJA 4P55A 1BBYA 3P9KA 3CUQC 3JSPA 4KIGA 3V8LA 2VT3A 2CSOA 4XSXF 5HLGA 4AIHA 4HQMA 3HSEA 1YG2A 4ZZDA 1ZHFA 3GVAA 3IHUA 3KE2A 1TTYA 2FSWA 2RQPA 4Y15A 2UZKA 3V8JA 2V1UA 2XAHA 1TQIA 4WX9A 2W84A 1YW9A 2JPBA 3DV8A 3ZQ7A 2Z5UA 4N9IA 5DUIA 4L9TA 4L5IA 3IRRA 2XIGA 4I02A 2V1DA 1WI9A 5E1WA 3F22A 1HKTA 2KKOA 4M9ZA 4MEYF 1G3YA 2DFIA 1IXSB 3QAHA 1OYWA 3FM3A 3M1EA 4P96A 2DLLA 1K78B 4D0PA 4U0WA 2BEOA 3DFGA 3EQLF 4L9VA 5K5QA 2M8EA 4IRHA 1PDNC 1OYYA 1NHAA 3MZHA 1P4WA 4KYWA 2LKPA 5AIPA 3WG9A 2ZJ2A 3O6BB 3GWZA 4YFXF 4OOIA 2AS5F 2M87A 1KYZA 5K5OA 3ISPA 1FYLA 2YX7A 1XSDA 2BE5F 3VEPA 1P2FA 5HLIA 3CO6C 1FYKA 1WRJA 1L0OC 1LEAA 4E70A 2HR3A 2XASA 1QZYA 1ZN2A 2P6SA 2JSCA 5ILSA 2IW5A 5DV5A 4CO8A 1FC3A 3VFZA 3KLNA 3KETA 1U2WA 3E5QA 4G6QA 4U7DA 3F8MA 3LSTA 1R5GA 2AXLA 5JFRA 2F2EA 1K7AA 5E17F 4M9XA 3Q5FA 4KUMA 2HKXA 3C18A 1HKSA 1G3TA 4JBAA 4P5OA 5BMZA 2GQQA 5ED4A 2ISYA 2ACJA 1PP8F 1LVAA 1FP2A 3JW4A 1P4AA 2F5FA 1DPRA 3FMQA 4LFUA 2XAQA 2DI3A 1J9IA 4NB5A 3BOQA 5LGNA 5A2QZ 3COAC 1S8NA 3TOBA 3F6VA 3GEZA 2EFWA 3I5UA 5E8GA 1EH8A 4KT5C 4G6DA 3KP4A 3LQQA 4CXFA 2XVCA 4A5NA 1JXSA 3GXOA 2IJLA 1J59A 3MZYA 2V79A 5CVIA 2MA3A 4I09A 2EWNA 2A61A 2MLGA 3BJ6A 1ULYA 2HQRA 1DDNA 1Z1DA 4IF4A 1RUNA 2OBPA 2MBFA 2P4WA 5FD5A 2DPUA 2PN6A 4JK1X 4LK0F 2Z9OA 2GZWA 3VOEA 1FP1D 3KEOA 2IA2A 3RI4A 1HW1A 3VODA 1R1VA 3JSOA 1Q1HA 3I54A 1XGOA 2D1HA 1YLFA 4KN7X 1C0WA 5DCFA 1XSXA 3ML6A 4Y17A 2F5CA 1H9TA 4CICA 4QLCU 3RKXA 5D4SA 3C1DA 3RKYA 4ETSA 1MGTA 3ELKA 2G7HA 2LF8A 2QLZA 2HDCA 2K7LA 3B02A 1LEBA 5L3FA 3J81Z 5D6FA 3QPHA 5FFXA 4OIPF 5AONA 1BC8C 2L3DA 3FWEA 5LLQA 5KK1A 3GFJA 3F8FA 4MGRA 1JHFA 3MAJA 2YR2A 2Y48A 5LEKA 2W57A 1MDMA 2JZYA 3AAFA 3KP2A 4JQFA 4U88A 3M8EA 2MD5A 3V8KA 1KQ8A 4MTEA 3IL2A 4A6EA 3E6MA 2FXAA 3LWFA 4N0BA 3TQNA 3MCZA 1GVJA 3KEQA 4OU0A 2ZCWA 3R6SA 3K9TA 1QQIA 4G94A 4Q48A 1MKMA 1FY7A 1QBJA 3HIFA 5JHUA 4QWQA 3KP6A 5EEHA 1MD0A 5L3EA 2HWVA 2A3SA 4AD9A 4PGHA 5H6RA 2ZKZA 3IRQA 2EJRA 1F1ZA 2KIMA 2LDUA 3QU6A 1LJ9A 1U8RA 1F4KA 1OYIA 1B9MA 3JAMK 4HLYA 3LFKA 3W6JB 1UCRA 2UXNA 5HVQC 3WTWC 4MNUA 1WSUA 4R79A 5D6EA 5LRSA 4IHTA 1ZARA 3BP8A 4Y13A 3D5LA 5JVTA 2L02A 2HYGD 2H94A 2VOPA 1IN8A 2YX4A 3R4KA 1HSTA 3H3UA 4KICA 2ZNZA 3C3WA 3GFLA 1XN7A 3FMSA 2QBYA 4WXHA 2LSOA 3K1NA 4MQVA 1I5ZA 5HDGA 5KVRA 1YO5C 3KFWX 3I59B 1XGNA 1AOYA 3PQJA 1MZBA 3TDUC 4ON0A 2VN2A 2L01A 3GYHX 4A6DA 4FX4A 5DD8A 2ZO4A 3J80K 1SMTA 5L3DA 2VBZA 1XSVA 3R0AA 1B59A 2OAZA 4KIFA 3TDZC 1R7JA 1G6NA 2XAFA 4UNOA 2EA2A 1ZH5A 3NRVA 3B73A 4MQ9F 3R0JA 2CO5A 1KU2A 4ENNA 5LEJA 5ILUA 1W5SA 1FZPB 4O3MA 1OPCA 4ZYEA 2XAJA 4P9FA 2VONA 1MJ9A 4LJZF 1J7KA 1YFHA 4GO1A 5D5WB 1TQMA 5D5XB 1B1BA 1OKRA 2A6HF 4A0ZA 2RN7A 1U3EM 1I27A 2HFHA 4M74A 1IN6A 1G3SA 3HYIA 1O3QA 4EMSA 1SFEA 3GZ5A 4EJVA 2FBHA 2GIVA 2ZNYA 3R60A 2DQLA 3JTGA 1GHCA 4HLXA 3GF2A 1R58A 1XGMA 5IT9Z 3ZPLA 1IXCA 3HTSB 1P92A 1ZG3A 4LGWA 4FX0A 2FOKA 3IC7A 1YTYA 4HX4A 4HQEA 1BIBA 4RB3C 1OR7A 3C7JA 5HDKA 4MTDA 5BS6A 1QGPA 3IKVA 2Y75A 2P5VA 1TNTA 2NS0A 2HQNA 5F1RA 4OMYA 3G73A 2A69F 5E1XA 4MEXF 1ONVA 1RI7A 3E5XA 3CDHA 2WV0A 3TO9A 3VB2A 1RUOA 2B0LA 1W7PA 3EETA 2XGXA 4XBFA 5CVUA 1QPMA 1BOAA 3KP3A 5BPDA 2NNNA 3N97A 2PQ8A 4HOBA 1W7PD 3BPVA 5HOOA 5H6QA 3IKTA 2OA4A 3KP5A 2DO7A 1T6SA 4BHPA 4CZZA 1LQ1A 1RZ4A 3MEXA 1JE8A 1GXQA 2QENA 1IAWA 3L7WA 4RB2C 1R36A 4M73A 2UXXA 2EV0A 1FLIA 3CTAA 5D4RA 1X3UA 1YW8A 1W5TA 2L4AA 1ZLJA 1D8KA 4RB0A 3F3XA 1P4XA 5FLXK 2ZMEB 3KLOA 3RPQA 4H0EA 4L9JA 2A68F 2GXGA 2A5YB 2CW0F 1ZYRF 2RDPA 3RYPA 3SZPA 3F23A 2J5PA 4HX8A 5LBQA 3BWGA 4UV9A 3SZTA 3BPXA 5IT3A 1S7OA 2HTSA 3MFKA 5CVJA 3WTVC 1T0FA 1S7AA 3P7NA 2QYOA 1XGSA 1S3JA 2HS5A 4RGRA 2QZ8A 4M71A 4OIQF 3BDDA 1QO0D 2P6TA 1K78A 4UUVA 5FO5A 1ZAOA 1D8JA 1R22A 2OZ6A 2RVCA 1ZLKA 1TNSA 2FE3A 3QU3A 4BHBA 4ZH4F 4PGGA 1XD7A 3WE2A 3E5UA 3PFIA 2OQRA 4A12A 4A5MA 3F72A 1U78A 1H0MA 2OU2A 2ETHA 2EB7A 2RV8A 2X0LA 3QPTA 2Z33A 4ENMA 3TO7A 2XRNA 1KQ0A 1R00A 3K69A 3KZZA 1HXDA 1LB2A 2P5LC 2H6BA 4XLNF 2E7XA 2Y0MA 3EUHA 3I58A 1I6XA 2EFQA 4A2UA 1E17A 1SD6A 2DW4A 3LAJA 4RAYA 1V4RA 1U5TB 3LA7A 1QZZA 1P6RA 5D8LB 1J75A 1Y0UA 4NQWA 5BQTA 1WQ2A 1DP7P 2OQGA 5E1ZB 3CUQB 4ENKA 3QOPA 4KDPA 2O3FA 1IW7F 1Z91A 2XUBA 3CO7C 2IVMA 3TOAA 4CDGA 3FXUA 1ZREA 2EV6A 1IF1A 4PCQA 1IN7A 3L9FA 2RKHA 3R61A 1KU7A 2Q0OA 4I0BA 1IN5A 1OMIA 2JPCA 4OINF 4S04A 3ECHA 2NAZA 2XKOA 2GA1A 3JTHA 4LG0B 2QVOA 3RDIA 1BC7C 2WC2A 3D0SA 1U5TA 3T8TA 3I4PA 4AIKA 3WU0A 2MLKA 4S05A 3LA2A 4B8XA 4KNYA 2CGPA 1R1UA 2YU3A 3FM5A 1MJBA 2P5KA 4FT8A 5LRRA 2ZBKA 2E1CA 5CVRA 4LLLA 2DK5A 1USSA 4HF0A 3ZP5A 3BY6A 5L3CA 3LA3A 4ESJA 2QUFA 2H27A 2PI0A 4U0VA 4ESFA 4RGXA 1UFMA 6PAXA 4FHTA 1ZGAA 1FWZA 2VT2A 5DYMA 3O3KA 1S29A 3G3ZA 4F7ZA 1SD7A 4ZYDA 2FMYA 2V9VA 3SFZA 2GA2A 2STWA 4I01A 3ZMZA 3RPUA 1HW5A 4G9YA 1LDKB 1XMAA 5E20A 4WXCA 4HBLA 1VTNC 2MH2A 1ON1A 3DEUA 4M6YA 3HHGA 3GZ6A 2R7DA 4EVIA 3TGNA 3E97A 3LQRA 4GYIA 3HRTA 3H3ZA 1KGSA 2V1XA 1BIAA 1CF7B 1MJAA 2PBIA 3FX3A 1T38A 2UWMA 3WTXC 3NQOA 1FBQA 3BJAA 4OMZA 4AIJA 3GW2A 1B6AA 3SXYA 1O3SA 1WKMA 4WF2A 4KMFA 1HBXG 3RYRA 3BJOA 1U6GA 5DEQA 1ZRCA 5LHGA 1KQ9A 1TBXA 2MH9A 1ZRDA 1ZGJA 2ADUA 1ZRFA 3I71A 5DUKA 2VE9A 3WU1B 4YFKF 2HEOA 4DNCA 3HHHA 4Q4ZF 1BI0A 3Q9VA 3V7CA 3DPTA 4GCVA 4WK8F 2NNYA 3L2CA 3L00A 4IRIA 4M72A 2Z3YA 4KFCA 4G7HF 3GX4X 5JR3A 4EJTA 5A2QK 5HS7A 1T98A 5DCMB 3T5XA 2FMLA 3WODF 1SD4A 4LB5A 3HUGA 3K1PA 4HX7A 3HOSA 5LGTA 4ENJA 1JGSA 4HDUA 1KA8A 1B9NA 4ASNA 3MQ0A 4IJAA 1FBUA 3NEUA 2K4JA 2D45A 4GYGA 4EJOA 4ZYHA 4BNCA 2IT0A 4A0YA 1HW2A 3WTZA 4RB1A 3HOTA 4Z2YA 5K5RA 3W6KB 1ZG5A 2FQ3A 4EM0B 4EM2A 4EJUA 3Q9SA 5L3GA 2J5OA 4B09A 2QWWA 3CLOA 5DD4A 4UV8A 2Q2EA 2COMA 4A0XA 4PDKA 4KIBA 4G7OF 2CG4A 2W85A 4ZYGA 3E6BA 4YG2F 2A6EF 3DP7A 1SFXA 2DTRA 1YQAA 2A07F 4BYYA 3I59A 4HV6A 2JTVA 3EDPA 3DKWA 3P9IA 2ZFWA 2R7FA 1HKQA 2IPQX 1FYMA 4LLGF 1YYVA 1ON2A 2VBYA 2O8XA 3DPLC 2STTA 2F5DA 1XB4A 4I2OA 2VE8A 3T1BA 1D5VA 3J81K 2BBYA 3WGHA 5D8KB 3K0LA 1PP7U 4UHTA 4OIRF 2FF4A 4I98B 3ABUA 1BJAA 3QP5A 2O03A 4L0YB 3U2RA 5LHIA 3HSRA 4XSZF 3I0TA 1DPUA 2G9WA 3HSFA 2E1NA 1G3WA 3V7RA 4HV5A 3I64A 2K02A 3V7SA 4YFNF 3F6OA 4LK1F 2FBKA 1I1SA 2ESHA 3MWMA 2GXBA 1U5TC 2R3SA 4IRGA 3ROUA 4IHSA 5K1YA 2DAOA 1RNLA 2WTEA 3DQVC 4DQ2A 2KRFA 4EQQA 4UXNA 2FNPA 2H6CA 4G8XA 2PLYA 5HLHA 5E18F 1XDUA 3GLXA 2QQ9A 3E6DA 1O7LA 1KU3A 2DT5A 1SMYF 2Q8KA 2GAUA 2JRTA 5D5UB 5ICFA 1LDDA 2O0YA 2NYXA 3RTRA 1GXPA 1QNTA 2DQRA 3F8BA 1FX7A 4EGYA 3EYYA 4HDVA 2M30A 2PFBA 4OIOF 1UHMA 3FXRA 2CYYA 4BH9A 2G7UA 5J8FA 3J7AO 2VBWA 1REPC 1FSEA 2BYVE 3FF5A 4MHGA 4U0YA 3HRMA 4YIFA 2M1BA 1Z7UA 4P9UA 3ZMUA 3GFIA 4O6JA 3M9AA 2CQKA 4I7HA 4BAYA 2F5EA 4EJWA 3K2ZA 2XV4S 3CUOA 4YIIA 2VBXA 2EFNA 3F8CA 1IRFA 1DUXC 2XAGA 3SQNA 5ICEA 2EA4A 1HSJA 1ODDA 3S2WA 3ZMSA 4UVCA 3WGGA 3KZYA 5F64A 4BXUA 2P7VB 1T2KA 1J2XA 1WWXA 1UB9A 1O7FA 4G7ZF 5FD6A 3IWFA 1K79A 2ZMEA 5J8CA 1Z6TA 5TRDA 2ESNA 5BOXA 2EFPA 1UHWA 1V3FA 3I53A 1PUEE 2NRAC 2O61A 1L3LA 3JAMZ 1TLHB 4LD5A 3U1DA 2FNAA 4BQAA 1TQPA 5F6FA 3WTUC 4HZFA 2KIFA 3GO5A 4CHUA 2QQAA 1G4DA 3WGIA 4HAMA 1XCBA 3ZMVA 1SFUA 2DBBA 1KYWA 2RNJA 2EK5A 3KCCA 2O6GE 5H20A 4N9HA 3WTTC 5FGMA 4R1HA 3ULQB 5IT9K 3LAPA 4GXOA 5HDNA 2FEZA 2IRFG 2HTJA 1AWCA 2DK8A 1XMKA 2WWYA 3F21A 4RGSA 2LNBA 5FFZA 2VOOA 1T39A 1O57A 4O5VA 4RS8A 4CGZA 1FPQA 1B4AA 1BI3A 1ZG1A 1EV7A 1W4MA 2LF7A 3J80Z 1SD5A 1J5YA 4AVPA 5CJ9A 2GWRA 3WTSC 3IWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5V B;  2X4H A;  2HKO A;  5ERI A;  3N4M A;  3FZV A;  2Z99 A;  3HTU A;  2EFO A;  3K1M A;  4WXD A;  2YPR A;  1MDM B;  3BZ6 A;  3CUQ A;  4HF2 A;  1TW2 A;  3U9G A;  1H9G A;  1YIO A;  2FRH A;  2PMH A;  1EH6 A;  1JHH A;  5BPI A;  1CGP A;  4HF1 A;  2YSR A;  5EEG A;  4IPA A;  2VOD A;  1BI1 A;  4AWX B;  2FBI A;  2PJP A;  4XLP F;  4IXA A;  3RJP A;  2M45 A;  4L18 B;  2QQB A;  2CFX A;  1STZ A;  4KA4 A;  2PEX A;  4LG0 A;  5ILV A;  1HQC A;  2K86 A;  1FT9 A;  2C6Y A;  3SHF A;  4NHJ A;  1R23 A;  4Q5S F;  2V6C A;  5JI6 A;  2HGC A;  2HYF A;  2KIU A;  2D2W A;  4L5J A;  3TKY A;  5HS8 A;  2VXZ A;  4L0Z B;  1EH7 A;  3PQK A;  4WWC A;  1XCV A;  3RKW A;  3CJN A;  1IN4 A;  3OOP A;  5E8I A;  1YW7 A;  3GFM A;  5CVV A;  3ERE D;  1FBS A;  1R5H A;  2D1V A;  3RIR A;  2RGV A;  2L54 A;  3E3V A;  2QBY B;  1UST A;  1TW3 A;  3DF8 A;  5CYV A;  2XKP A;  4LMY A;  4RAZ A;  1R1T A;  4ZZL A;  2IA1 A;  3TO6 A;  2KJB A;  4LB6 B;  3ZMD A;  1I1G A;  5HS9 A;  2ISZ A;  1O3R A;  5LHH A;  1XDS A;  3EYI A;  3FHZ A;  3E6C C;  1IXR C;  3O2P E;  4EGZ A;  4LLN A;  4UVA A;  2FU4 A;  3OV8 A;  2IA0 A;  3QRF F;  3F8N A;  5TJJ A;  2M5W A;  2OZU A;  3HRS A;  1RIO H;  3FXQ A;  1LDJ A;  4Q47 A;  4XRF A;  5J6X A;  3ECO A;  1CF7 A;  2CWE A;  5FLX Z;  4CYD A;  1BI2 A;  2XRO A;  1O3T A;  2ELH A;  1A04 A;  3M8F A;  4WCG A;  2BGC A;  3M7G A;  3QP6 A;  4HYE A;  1YS6 A;  3DXJ F;  4HA8 A;  4GGG A;  2HOE A;  2FA5 A;  1F5T A;  4EV0 A;  4EM1 A;  5ICG A;  2DPD A;  4M9S A;  1BN5 A;  3T8R A;  4TV7 A;  2K27 A;  1IZ1 A;  4UVB A;  2L4M A;  2XHK A;  3HRU A;  4K2E A;  1S6L A;  2OD5 A;  3V4G A;  1D3Y A;  3T0Y A;  4KN4 X;  3P9C A;  2TDX A;  5FB2 A;  2P8T A;  3H92 A;  1BM9 A;  2ZXJ A;  2PMU A;  3WTY C;  2PG4 A;  3FMR A;  3GUD A;  5DCM A;  3REO A;  4ESB A;  2VC1 A;  3ZMT A;  4RGU A;  3L09 A;  4IVN A;  3ZN1 A;  1SAX A;  3KP7 A;  1YS7 A;  1Z9C A;  5LGU A;  4I0A A;  2JT1 A;  1K6O A;  2MC3 A;  5CLS A;  4U7B A;  1F9N A;  2KJC A;  4R8H A;  2P7C B;  1FOK A;  2H09 A;  2VC0 A;  2E7W A;  4BHC A;  4HW0 A;  1Z6R A;  4M6X A;  3WE3 A;  2QM3 A;  1E2X A;  1IRG A;  3ABT A;  5AIQ A;  2K4B A;  3ZN0 A;  1W7P B;  5ICC A;  1Z05 A;  5L3B A;  5DDG A;  2W24 A;  2EV5 A;  2HZT A;  3BRO A;  1FSH A;  1FNN A;  1LNW A;  4L9N A;  2DU9 A;  2RC4 A;  1KU9 A;  2BV6 A;  1IUY A;  2IP2 A;  4KMU X;  2W25 A;  1J0R A;  4PZJ A;  4P55 A;  1BBY A;  3P9K A;  3CUQ C;  3JSP A;  4KIG A;  3V8L A;  2VT3 A;  2CSO A;  4XSX F;  5HLG A;  4AIH A;  4HQM A;  3HSE A;  1YG2 A;  4ZZD A;  1ZHF A;  3GVA A;  3IHU A;  3KE2 A;  1TTY A;  2FSW A;  2RQP A;  4Y15 A;  2UZK A;  3V8J A;  2V1U A;  2XAH A;  1TQI A;  4WX9 A;  2W84 A;  1YW9 A;  2JPB A;  3DV8 A;  3ZQ7 A;  2Z5U A;  4N9I A;  5DUI A;  4L9T A;  4L5I A;  3IRR A;  2XIG A;  4I02 A;  2V1D A;  1WI9 A;  5E1W A;  3F22 A;  1HKT A;  2KKO A;  4M9Z A;  4MEY F;  1G3Y A;  2DFI A;  1IXS B;  3QAH A;  1OYW A;  3FM3 A;  3M1E A;  4P96 A;  2DLL A;  1K78 B;  4D0P A;  4U0W A;  2BEO A;  3DFG A;  3EQL F;  4L9V A;  5K5Q A;  2M8E A;  4IRH A;  1PDN C;  1OYY A;  1NHA A;  3MZH A;  1P4W A;  4KYW A;  2LKP A;  5AIP A;  3WG9 A;  2ZJ2 A;  3O6B B;  3GWZ A;  4YFX F;  4OOI A;  2AS5 F;  2M87 A;  1KYZ A;  5K5O A;  3ISP A;  1FYL A;  2YX7 A;  1XSD A;  2BE5 F;  3VEP A;  1P2F A;  5HLI A;  3CO6 C;  1FYK A;  1WRJ A;  1L0O C;  1LEA A;  4E70 A;  2HR3 A;  2XAS A;  1QZY A;  1ZN2 A;  2P6S A;  2JSC A;  5ILS A;  2IW5 A;  5DV5 A;  4CO8 A;  1FC3 A;  3VFZ A;  3KLN A;  3KET A;  1U2W A;  3E5Q A;  4G6Q A;  4U7D A;  3F8M A;  3LST A;  1R5G A;  2AXL A;  5JFR A;  2F2E A;  1K7A A;  5E17 F;  4M9X A;  3Q5F A;  4KUM A;  2HKX A;  3C18 A;  1HKS A;  1G3T A;  4JBA A;  4P5O A;  5BMZ A;  2GQQ A;  5ED4 A;  2ISY A;  2ACJ A;  1PP8 F;  1LVA A;  1FP2 A;  3JW4 A;  1P4A A;  2F5F A;  1DPR A;  3FMQ A;  4LFU A;  2XAQ A;  2DI3 A;  1J9I A;  4NB5 A;  3BOQ A;  5LGN A;  5A2Q Z;  3COA C;  1S8N A;  3TOB A;  3F6V A;  3GEZ A;  2EFW A;  3I5U A;  5E8G A;  1EH8 A;  4KT5 C;  4G6D A;  3KP4 A;  3LQQ A;  4CXF A;  2XVC A;  4A5N A;  1JXS A;  3GXO A;  2IJL A;  1J59 A;  3MZY A;  2V79 A;  5CVI A;  2MA3 A;  4I09 A;  2EWN A;  2A61 A;  2MLG A;  3BJ6 A;  1ULY A;  2HQR A;  1DDN A;  1Z1D A;  4IF4 A;  1RUN A;  2OBP A;  2MBF A;  2P4W A;  5FD5 A;  2DPU A;  2PN6 A;  4JK1 X;  4LK0 F;  2Z9O A;  2GZW A;  3VOE A;  1FP1 D;  3KEO A;  2IA2 A;  3RI4 A;  1HW1 A;  3VOD A;  1R1V A;  3JSO A;  1Q1H A;  3I54 A;  1XGO A;  2D1H A;  1YLF A;  4KN7 X;  1C0W A;  5DCF A;  1XSX A;  3ML6 A;  4Y17 A;  2F5C A;  1H9T A;  4CIC A;  4QLC U;  3RKX A;  5D4S A;  3C1D A;  3RKY A;  4ETS A;  1MGT A;  3ELK A;  2G7H A;  2LF8 A;  2QLZ A;  2HDC A;  2K7L A;  3B02 A;  1LEB A;  5L3F A;  3J81 Z;  5D6F A;  3QPH A;  5FFX A;  4OIP F;  5AON A;  1BC8 C;  2L3D A;  3FWE A;  5LLQ A;  5KK1 A;  3GFJ A;  3F8F A;  4MGR A;  1JHF A;  3MAJ A;  2YR2 A;  2Y48 A;  5LEK A;  2W57 A;  1MDM A;  2JZY A;  3AAF A;  3KP2 A;  4JQF A;  4U88 A;  3M8E A;  2MD5 A;  3V8K A;  1KQ8 A;  4MTE A;  3IL2 A;  4A6E A;  3E6M A;  2FXA A;  3LWF A;  4N0B A;  3TQN A;  3MCZ A;  1GVJ A;  3KEQ A;  4OU0 A;  2ZCW A;  3R6S A;  3K9T A;  1QQI A;  4G94 A;  4Q48 A;  1MKM A;  1FY7 A;  1QBJ A;  3HIF A;  5JHU A;  4QWQ A;  3KP6 A;  5EEH A;  1MD0 A;  5L3E A;  2HWV A;  2A3S A;  4AD9 A;  4PGH A;  5H6R A;  2ZKZ A;  3IRQ A;  2EJR A;  1F1Z A;  2KIM A;  2LDU A;  3QU6 A;  1LJ9 A;  1U8R A;  1F4K A;  1OYI A;  1B9M A;  3JAM K;  4HLY A;  3LFK A;  3W6J B;  1UCR A;  2UXN A;  5HVQ C;  3WTW C;  4MNU A;  1WSU A;  4R79 A;  5D6E A;  5LRS A;  4IHT A;  1ZAR A;  3BP8 A;  4Y13 A;  3D5L A;  5JVT A;  2L02 A;  2HYG D;  2H94 A;  2VOP A;  1IN8 A;  2YX4 A;  3R4K A;  1HST A;  3H3U A;  4KIC A;  2ZNZ A;  3C3W A;  3GFL A;  1XN7 A;  3FMS A;  2QBY A;  4WXH A;  2LSO A;  3K1N A;  4MQV A;  1I5Z A;  5HDG A;  5KVR A;  1YO5 C;  3KFW X;  3I59 B;  1XGN A;  1AOY A;  3PQJ A;  1MZB A;  3TDU C;  4ON0 A;  2VN2 A;  2L01 A;  3GYH X;  4A6D A;  4FX4 A;  5DD8 A;  2ZO4 A;  3J80 K;  1SMT A;  5L3D A;  2VBZ A;  1XSV A;  3R0A A;  1B59 A;  2OAZ A;  4KIF A;  3TDZ C;  1R7J A;  1G6N A;  2XAF A;  4UNO A;  2EA2 A;  1ZH5 A;  3NRV A;  3B73 A;  4MQ9 F;  3R0J A;  2CO5 A;  1KU2 A;  4ENN A;  5LEJ A;  5ILU A;  1W5S A;  1FZP B;  4O3M A;  1OPC A;  4ZYE A;  2XAJ A;  4P9F A;  2VON A;  1MJ9 A;  4LJZ F;  1J7K A;  1YFH A;  4GO1 A;  5D5W B;  1TQM A;  5D5X B;  1B1B A;  1OKR A;  2A6H F;  4A0Z A;  2RN7 A;  1U3E M;  1I27 A;  2HFH A;  4M74 A;  1IN6 A;  1G3S A;  3HYI A;  1O3Q A;  4EMS A;  1SFE A;  3GZ5 A;  4EJV A;  2FBH A;  2GIV A;  2ZNY A;  3R60 A;  2DQL A;  3JTG A;  1GHC A;  4HLX A;  3GF2 A;  1R58 A;  1XGM A;  5IT9 Z;  3ZPL A;  1IXC A;  3HTS B;  1P92 A;  1ZG3 A;  4LGW A;  4FX0 A;  2FOK A;  3IC7 A;  1YTY A;  4HX4 A;  4HQE A;  1BIB A;  4RB3 C;  1OR7 A;  3C7J A;  5HDK A;  4MTD A;  5BS6 A;  1QGP A;  3IKV A;  2Y75 A;  2P5V A;  1TNT A;  2NS0 A;  2HQN A;  5F1R A;  4OMY A;  3G73 A;  2A69 F;  5E1X A;  4MEX F;  1ONV A;  1RI7 A;  3E5X A;  3CDH A;  2WV0 A;  3TO9 A;  3VB2 A;  1RUO A;  2B0L A;  1W7P A;  3EET A;  2XGX A;  4XBF A;  5CVU A;  1QPM A;  1BOA A;  3KP3 A;  5BPD A;  2NNN A;  3N97 A;  2PQ8 A;  4HOB A;  1W7P D;  3BPV A;  5HOO A;  5H6Q A;  3IKT A;  2OA4 A;  3KP5 A;  2DO7 A;  1T6S A;  4BHP A;  4CZZ A;  1LQ1 A;  1RZ4 A;  3MEX A;  1JE8 A;  1GXQ A;  2QEN A;  1IAW A;  3L7W A;  4RB2 C;  1R36 A;  4M73 A;  2UXX A;  2EV0 A;  1FLI A;  3CTA A;  5D4R A;  1X3U A;  1YW8 A;  1W5T A;  2L4A A;  1ZLJ A;  1D8K A;  4RB0 A;  3F3X A;  1P4X A;  5FLX K;  2ZME B;  3KLO A;  3RPQ A;  4H0E A;  4L9J A;  2A68 F;  2GXG A;  2A5Y B;  2CW0 F;  1ZYR F;  2RDP A;  3RYP A;  3SZP A;  3F23 A;  2J5P A;  4HX8 A;  5LBQ A;  3BWG A;  4UV9 A;  3SZT A;  3BPX A;  5IT3 A;  1S7O A;  2HTS A;  3MFK A;  5CVJ A;  3WTV C;  1T0F A;  1S7A A;  3P7N A;  2QYO A;  1XGS A;  1S3J A;  2HS5 A;  4RGR A;  2QZ8 A;  4M71 A;  4OIQ F;  3BDD A;  1QO0 D;  2P6T A;  1K78 A;  4UUV A;  5FO5 A;  1ZAO A;  1D8J A;  1R22 A;  2OZ6 A;  2RVC A;  1ZLK A;  1TNS A;  2FE3 A;  3QU3 A;  4BHB A;  4ZH4 F;  4PGG A;  1XD7 A;  3WE2 A;  3E5U A;  3PFI A;  2OQR A;  4A12 A;  4A5M A;  3F72 A;  1U78 A;  1H0M A;  2OU2 A;  2ETH A;  2EB7 A;  2RV8 A;  2X0L A;  3QPT A;  2Z33 A;  4ENM A;  3TO7 A;  2XRN A;  1KQ0 A;  1R00 A;  3K69 A;  3KZZ A;  1HXD A;  1LB2 A;  2P5L C;  2H6B A;  4XLN F;  2E7X A;  2Y0M A;  3EUH A;  3I58 A;  1I6X A;  2EFQ A;  4A2U A;  1E17 A;  1SD6 A;  2DW4 A;  3LAJ A;  4RAY A;  1V4R A;  1U5T B;  3LA7 A;  1QZZ A;  1P6R A;  5D8L B;  1J75 A;  1Y0U A;  4NQW A;  5BQT A;  1WQ2 A;  1DP7 P;  2OQG A;  5E1Z B;  3CUQ B;  4ENK A;  3QOP A;  4KDP A;  2O3F A;  1IW7 F;  1Z91 A;  2XUB A;  3CO7 C;  2IVM A;  3TOA A;  4CDG A;  3FXU A;  1ZRE A;  2EV6 A;  1IF1 A;  4PCQ A;  1IN7 A;  3L9F A;  2RKH A;  3R61 A;  1KU7 A;  2Q0O A;  4I0B A;  1IN5 A;  1OMI A;  2JPC A;  4OIN F;  4S04 A;  3ECH A;  2NAZ A;  2XKO A;  2GA1 A;  3JTH A;  4LG0 B;  2QVO A;  3RDI A;  1BC7 C;  2WC2 A;  3D0S A;  1U5T A;  3T8T A;  3I4P A;  4AIK A;  3WU0 A;  2MLK A;  4S05 A;  3LA2 A;  4B8X A;  4KNY A;  2CGP A;  1R1U A;  2YU3 A;  3FM5 A;  1MJB A;  2P5K A;  4FT8 A;  5LRR A;  2ZBK A;  2E1C A;  5CVR A;  4LLL A;  2DK5 A;  1USS A;  4HF0 A;  3ZP5 A;  3BY6 A;  5L3C A;  3LA3 A;  4ESJ A;  2QUF A;  2H27 A;  2PI0 A;  4U0V A;  4ESF A;  4RGX A;  1UFM A;  6PAX A;  4FHT A;  1ZGA A;  1FWZ A;  2VT2 A;  5DYM A;  3O3K A;  1S29 A;  3G3Z A;  4F7Z A;  1SD7 A;  4ZYD A;  2FMY A;  2V9V A;  3SFZ A;  2GA2 A;  2STW A;  4I01 A;  3ZMZ A;  3RPU A;  1HW5 A;  4G9Y A;  1LDK B;  1XMA A;  5E20 A;  4WXC A;  4HBL A;  1VTN C;  2MH2 A;  1ON1 A;  3DEU A;  4M6Y A;  3HHG A;  3GZ6 A;  2R7D A;  4EVI A;  3TGN A;  3E97 A;  3LQR A;  4GYI A;  3HRT A;  3H3Z A;  1KGS A;  2V1X A;  1BIA A;  1CF7 B;  1MJA A;  2PBI A;  3FX3 A;  1T38 A;  2UWM A;  3WTX C;  3NQO A;  1FBQ A;  3BJA A;  4OMZ A;  4AIJ A;  3GW2 A;  1B6A A;  3SXY A;  1O3S A;  1WKM A;  4WF2 A;  4KMF A;  1HBX G;  3RYR A;  3BJO A;  1U6G A;  5DEQ A;  1ZRC A;  5LHG A;  1KQ9 A;  1TBX A;  2MH9 A;  1ZRD A;  1ZGJ A;  2ADU A;  1ZRF A;  3I71 A;  5DUK A;  2VE9 A;  3WU1 B;  4YFK F;  2HEO A;  4DNC A;  3HHH A;  4Q4Z F;  1BI0 A;  3Q9V A;  3V7C A;  3DPT A;  4GCV A;  4WK8 F;  2NNY A;  3L2C A;  3L00 A;  4IRI A;  4M72 A;  2Z3Y A;  4KFC A;  4G7H F;  3GX4 X;  5JR3 A;  4EJT A;  5A2Q K;  5HS7 A;  1T98 A;  5DCM B;  3T5X A;  2FML A;  3WOD F;  1SD4 A;  4LB5 A;  3HUG A;  3K1P A;  4HX7 A;  3HOS A;  5LGT A;  4ENJ A;  1JGS A;  4HDU A;  1KA8 A;  1B9N A;  4ASN A;  3MQ0 A;  4IJA A;  1FBU A;  3NEU A;  2K4J A;  2D45 A;  4GYG A;  4EJO A;  4ZYH A;  4BNC A;  2IT0 A;  4A0Y A;  1HW2 A;  3WTZ A;  4RB1 A;  3HOT A;  4Z2Y A;  5K5R A;  3W6K B;  1ZG5 A;  2FQ3 A;  4EM0 B;  4EM2 A;  4EJU A;  3Q9S A;  5L3G A;  2J5O A;  4B09 A;  2QWW A;  3CLO A;  5DD4 A;  4UV8 A;  2Q2E A;  2COM A;  4A0X A;  4PDK A;  4KIB A;  4G7O F;  2CG4 A;  2W85 A;  4ZYG A;  3E6B A;  4YG2 F;  2A6E F;  3DP7 A;  1SFX A;  2DTR A;  1YQA A;  2A07 F;  4BYY A;  3I59 A;  4HV6 A;  2JTV A;  3EDP A;  3DKW A;  3P9I A;  2ZFW A;  2R7F A;  1HKQ A;  2IPQ X;  1FYM A;  4LLG F;  1YYV A;  1ON2 A;  2VBY A;  2O8X A;  3DPL C;  2STT A;  2F5D A;  1XB4 A;  4I2O A;  2VE8 A;  3T1B A;  1D5V A;  3J81 K;  2BBY A;  3WGH A;  5D8K B;  3K0L A;  1PP7 U;  4UHT A;  4OIR F;  2FF4 A;  4I98 B;  3ABU A;  1BJA A;  3QP5 A;  2O03 A;  4L0Y B;  3U2R A;  5LHI A;  3HSR A;  4XSZ F;  3I0T A;  1DPU A;  2G9W A;  3HSF A;  2E1N A;  1G3W A;  3V7R A;  4HV5 A;  3I64 A;  2K02 A;  3V7S A;  4YFN F;  3F6O A;  4LK1 F;  2FBK A;  1I1S A;  2ESH A;  3MWM A;  2GXB A;  1U5T C;  2R3S A;  4IRG A;  3ROU A;  4IHS A;  5K1Y A;  2DAO A;  1RNL A;  2WTE A;  3DQV C;  4DQ2 A;  2KRF A;  4EQQ A;  4UXN A;  2FNP A;  2H6C A;  4G8X A;  2PLY A;  5HLH A;  5E18 F;  1XDU A;  3GLX A;  2QQ9 A;  3E6D A;  1O7L A;  1KU3 A;  2DT5 A;  1SMY F;  2Q8K A;  2GAU A;  2JRT A;  5D5U B;  5ICF A;  1LDD A;  2O0Y A;  2NYX A;  3RTR A;  1GXP A;  1QNT A;  2DQR A;  3F8B A;  1FX7 A;  4EGY A;  3EYY A;  4HDV A;  2M30 A;  2PFB A;  4OIO F;  1UHM A;  3FXR A;  2CYY A;  4BH9 A;  2G7U A;  5J8F A;  3J7A O;  2VBW A;  1REP C;  1FSE A;  2BYV E;  3FF5 A;  4MHG A;  4U0Y A;  3HRM A;  4YIF A;  2M1B A;  1Z7U A;  4P9U A;  3ZMU A;  3GFI A;  4O6J A;  3M9A A;  2CQK A;  4I7H A;  4BAY A;  2F5E A;  4EJW A;  3K2Z A;  2XV4 S;  3CUO A;  4YII A;  2VBX A;  2EFN A;  3F8C A;  1IRF A;  1DUX C;  2XAG A;  3SQN A;  5ICE A;  2EA4 A;  1HSJ A;  1ODD A;  3S2W A;  3ZMS A;  4UVC A;  3WGG A;  3KZY A;  5F64 A;  4BXU A;  2P7V B;  1T2K A;  1J2X A;  1WWX A;  1UB9 A;  1O7F A;  4G7Z F;  5FD6 A;  3IWF A;  1K79 A;  2ZME A;  5J8C A;  1Z6T A;  5TRD A;  2ESN A;  5BOX A;  2EFP A;  1UHW A;  1V3F A;  3I53 A;  1PUE E;  2NRA C;  2O61 A;  1L3L A;  3JAM Z;  1TLH B;  4LD5 A;  3U1D A;  2FNA A;  4BQA A;  1TQP A;  5F6F A;  3WTU C;  4HZF A;  2KIF A;  3GO5 A;  4CHU A;  2QQA A;  1G4D A;  3WGI A;  4HAM A;  1XCB A;  3ZMV A;  1SFU A;  2DBB A;  1KYW A;  2RNJ A;  2EK5 A;  3KCC A;  2O6G E;  5H20 A;  4N9H A;  3WTT C;  5FGM A;  4R1H A;  3ULQ B;  5IT9 K;  3LAP A;  4GXO A;  5HDN A;  2FEZ A;  2IRF G;  2HTJ A;  1AWC A;  2DK8 A;  1XMK A;  2WWY A;  3F21 A;  4RGS A;  2LNB A;  5FFZ A;  2VOO A;  1T39 A;  1O57 A;  4O5V A;  4RS8 A;  4CGZ A;  1FPQ A;  1B4A A;  1BI3 A;  1ZG1 A;  1EV7 A;  1W4M A;  2LF7 A;  3J80 Z;  1SD5 A;  1J5Y A;  4AVP A;  5CJ9 A;  2GWR A;  3WTS C;  3IWZ A; 
#chains in the Genus database with same CATH topology
 5D5V B;  5FJ8 J;  2X4H A;  2HKO A;  2JUG A;  2LY2 A;  5FLV A;  2DXI A;  3D1N I;  5ERI A;  3OSF A;  4UB6 C;  3N4M A;  1FMV A;  3FZV A;  5H2F C;  3E7L A;  2Z99 A;  3W2W A;  3HTU A;  2EFO A;  1LE8 B;  3KPH A;  3K1M A;  4WXD A;  2YPR A;  1MMA A;  1MDM B;  1WJD A;  1E3P A;  3OS1 A;  3CCS I;  3BZ6 A;  5B1A H;  1I50 J;  1K4T A;  1W0T A;  3CUQ A;  4XKW A;  4HF2 A;  2WAQ A;  4X6A J;  1A31 A;  2KP6 A;  2WBM A;  1TW2 A;  3U9G A;  1Y39 A;  2IGN A;  1H9G A;  1YIO A;  1VI0 A;  3GME A;  2XSD C;  2BY0 A;  2FRH A;  2LY9 A;  3BR1 A;  2WY8 Q;  2KT0 A;  3MKY B;  2PMH A;  1EH6 A;  1JHH A;  4RLQ A;  1DU0 A;  5BPI A;  1CGP A;  4HF1 A;  4C2M J;  2JWT A;  5EDN A;  4A3M J;  2YSR A;  5EEG A;  2RRE A;  2Y2Z A;  4XOR A;  4IPA A;  4F93 B;  1JJ8 C;  2K3F A;  2IS1 A;  5EJC A;  2KIS A;  2VOD A;  3HPH A;  2DT6 A;  1W36 C;  1BI1 A;  4AWX B;  1OCT C;  2FBI A;  2PJP A;  3ONQ A;  4XLP F;  4IXA A;  3RJP A;  2M45 A;  5FLM J;  1BOB A;  2QQB A;  4L18 B;  2CFX A;  3Q3S A;  2K9M A;  1STZ A;  2X1D A;  5IOZ A;  4KA4 A;  4ANJ A;  3LSG A;  2PEX A;  2X6O A;  4A3K J;  4LG0 A;  2LVS A;  5ILV A;  1IGN A;  1HQC A;  4II2 A;  3OYD A;  4XOT A;  1ZKG A;  2K86 A;  1ETX A;  1FT9 A;  5GPC A;  4BQQ A;  2C6Y A;  2AQF A;  1LE8 A;  3SHF A;  4NHJ A;  1NG7 A;  3AG1 H;  4QSH A;  4YRV A;  1R23 A;  3CF2 A;  5JLW A;  4Q5S F;  2V6C A;  5JI6 A;  3HOY J;  2HGC A;  1U9N A;  1OCR H;  1XC5 A;  2HYF A;  2D2W A;  1Z3X A;  2KIU A;  4L5J A;  5KAI C;  2MAB A;  1XTA A;  3TKY A;  4QPO A;  5HS8 A;  2VXZ A;  4IL6 C;  4B43 A;  2CUF A;  1QVT A;  2LFB A;  3RPU D;  3X2Q H;  4L0Z B;  1EH7 A;  3PQK A;  2HZD A;  2CV1 A;  4C2T A;  4XNF A;  4HRI A;  2K85 A;  4WWC A;  1XCV A;  3RKW A;  3CJN A;  1RC9 A;  1IN4 A;  3OOP A;  5E8I A;  1YW7 A;  3GFM A;  5CVV A;  1TT0 A;  4LIV A;  3ESW B;  3ERE D;  3LSP A;  1FBS A;  3BG5 A;  1R5H A;  2D1V A;  1YE9 A;  3RIR A;  2RGV A;  2DMT A;  3EUK L;  1XPX A;  3K4B A;  2L54 A;  3E3V A;  2QBY B;  1UST A;  1TW3 A;  4IKF A;  2NOJ B;  3DF8 A;  5CYV A;  2XKP A;  3DEE A;  4LMY A;  4RAZ A;  4IO9 F;  1R1T A;  4ZZL A;  4A93 J;  2IA1 A;  4F55 A;  3TO6 A;  2KJB A;  4LB6 B;  3CZ6 A;  3ZMD A;  1I1G A;  3HKZ N;  5HS9 A;  4AYB A;  2ISZ A;  4BU2 A;  1O3R A;  1E3O C;  5LHH A;  1VF9 A;  1XDS A;  3FHZ A;  3EYI A;  3CCJ I;  3E6C C;  1IXR C;  3OR2 C;  2Y9Z A;  3O2P E;  4EGZ A;  2ME0 A;  4LLN A;  2Y0S A;  4UVA A;  2FU4 A;  2CQN A;  2L9S A;  3OV8 A;  2IA0 A;  1JI8 A;  3QRF F;  1WJC A;  3FBN B;  3CCE I;  3CCM I;  3F8N A;  5TJJ A;  3G6E I;  5JHF A;  2CW7 A;  1U9O A;  2M5W A;  2VKV A;  2YUS A;  2E60 A;  2OZU A;  3S32 A;  2NVQ J;  3HRS A;  3TP3 A;  4BJT A;  3OYM A;  1RIO H;  3FXQ A;  1LDJ A;  4Q47 A;  1VQ7 I;  4XRF A;  5J6X A;  2XPU A;  3ECO A;  4RM3 A;  1CF7 A;  2CWE A;  5FLX Z;  1AHD P;  4CYD A;  2ELK A;  3C2H A;  4JOM A;  3HEF A;  2E19 A;  1BI2 A;  2K9Q A;  4XRS G;  2XRO A;  1O3T A;  2ELH A;  1A04 A;  3M8F A;  4WCG A;  4YEJ A;  1BW6 A;  3S3O A;  2BGC A;  1X3W B;  3M7G A;  1YHQ I;  3QP6 A;  4HYE A;  2OTJ I;  1YS6 A;  2VQH A;  3DXJ F;  2BVM A;  4HA8 A;  4GGG A;  2HOE A;  3PFY A;  5IP9 J;  2FA5 A;  1F5T A;  1KON A;  2M8G X;  2E1M B;  4I76 A;  4EV0 A;  4BEH A;  4EM1 A;  5ICG A;  2DPD A;  3GTO J;  4M9S A;  3G71 I;  1BN5 A;  2BW3 A;  3T8R A;  1JTX A;  2DFE A;  4TV7 A;  3LSK A;  2K27 A;  1P9Q C;  2K40 A;  1R9T J;  1IZ1 A;  1V5E A;  3W2A A;  1HC8 A;  4LIT A;  4UVB A;  5FKL A;  2L4M A;  3U21 A;  4JX6 A;  2XHK A;  3HRU A;  4K2E A;  5CPR B;  3AG4 H;  1S6L A;  2CH0 A;  4B3X A;  2OD5 A;  3V4G A;  3HOW J;  1D3Y A;  3FK6 A;  3HBL A;  4NUB A;  3H9J A;  3T0Y A;  2BOL A;  4FAS D;  3ABL H;  4KN4 X;  3P9C A;  2KIQ A;  3BTC A;  1SEU A;  2TDX A;  4F91 B;  2L0K A;  3BZK A;  3HC7 A;  3B6A A;  3MMY B;  5FB2 A;  2XRL A;  2P8T A;  3H92 A;  1LUJ B;  1ENH A;  2DMU A;  2PMZ N;  1BM9 A;  4JP0 A;  2ZXJ A;  2PMU A;  3FMR A;  2PG4 A;  3WTY C;  3GUD A;  5DCM A;  2HDD A;  2GOX B;  3REO A;  4ESB A;  2VC1 A;  3ZMT A;  4RGU A;  3L09 A;  4IVN A;  3ZN1 A;  1SAX A;  1MSE C;  3KP7 A;  1YS7 A;  1Z9C A;  5LGU A;  3KX2 A;  4I0A A;  2JT1 A;  4XLH A;  1K6O A;  2MC3 A;  2GM4 A;  5CLS A;  3HG9 A;  4U7B A;  1F9N A;  2V6E A;  3H3V K;  5DTD A;  2KJC A;  4R8H A;  2EIJ H;  4HEA 2;  2P7C B;  4I6Z A;  3ZQG A;  1FOK A;  1UJ8 A;  2H09 A;  2VC0 A;  2E7W A;  4BHC A;  3QPS A;  2HOT A;  4UUS A;  2H8R A;  3G2B A;  4HW0 A;  1Z6R A;  4M6X A;  2F5V A;  2M2E A;  3WE3 A;  2QM3 A;  3A0H C;  3DBR B;  1E2X A;  5CQE A;  1IRG A;  3A03 A;  3ABT A;  2ZXI A;  1JGG A;  5AIQ A;  1GVD A;  4NNJ A;  3S2D J;  3S1R J;  2K4B A;  4DZJ A;  3FXO A;  3ZN0 A;  1W7P B;  3C2G A;  3A2K A;  5ICC A;  1Z05 A;  5L3B A;  5DDG A;  2WB1 N;  2W24 A;  2K9N A;  1W5C C;  2EV5 A;  2F48 A;  2HZT A;  4AM3 A;  3BRO A;  1VQO I;  1FSH A;  4JYK A;  1FNN A;  1GV2 A;  1LNW A;  4L9N A;  2CFO A;  2DU9 A;  1WJA A;  1MMG A;  2RC4 A;  2W48 A;  1KU9 A;  2BV6 A;  4PJJ A;  1IUY A;  2IP2 A;  4KMU X;  3OYE A;  2W25 A;  1J0R A;  4PZJ A;  3WHB A;  4BKX A;  4P55 A;  4P1W A;  4AU7 A;  3ZQI A;  2HVQ A;  4RM2 A;  3NAU A;  4Z6Y A;  1BBY A;  3P9K A;  3CUQ C;  4OAY A;  2IS4 A;  1JT0 A;  3JSP A;  4KIG A;  1ETW A;  3V8L A;  1ZGW A;  2VT3 A;  3QYE A;  2CSO A;  4XSX F;  4JX5 A;  4A3D J;  5HLG A;  3PUF A;  2OPT A;  2X6W A;  4HQM A;  4AIH A;  3Q0W A;  3HSE A;  1AKH A;  1YG2 A;  1W36 D;  4ZZD A;  3A02 A;  1ZHF A;  3GVA A;  2O8K A;  2VL8 A;  1FEX A;  3A01 A;  3OYB A;  3IHU A;  4C3J J;  3KE2 A;  4PSW A;  5B5E C;  1TTY A;  5M5X J;  4A3G J;  3DWL E;  3VYT B;  2FSW A;  1BJZ A;  2DMP A;  2VQL A;  2AO9 A;  2CQX A;  2RQP A;  5M5Y J;  4Y15 A;  4IHV A;  2E1O A;  2UZK A;  3V8J A;  2V1U A;  1ACI A;  3ABK H;  3OWT A;  2IAI A;  2XAH A;  3M8J A;  5J1Y A;  4IQ4 A;  1TQI A;  1WJF A;  2LMD A;  3WG7 H;  4WX9 A;  2W84 A;  1YW9 A;  2JPB A;  3DV8 A;  3ZQ7 A;  2Z5U A;  4EAT A;  2R7V A;  3K4N A;  4N9I A;  1A5J A;  2L7M P;  5DUI A;  4L9T A;  4L5I A;  3IRR A;  3S1N J;  2XIG A;  4I02 A;  3OL4 A;  5KHD A;  2V1D A;  1WI9 A;  2COB A;  2I8D A;  5E1W A;  3F22 A;  1HKT A;  2KRH A;  1GT0 C;  2NVY J;  1VQ6 I;  2KKO A;  4M9Z A;  2HNH A;  4C2U A;  3GTQ J;  4MEY F;  1G3Y A;  2DFI A;  1IXS B;  2QCO A;  3QAH A;  1OYW A;  1LFP A;  2P81 A;  3CMA I;  3FM3 A;  1Y8R B;  4PJN A;  3I4M J;  3M1E A;  1FTZ A;  2MC4 A;  4P96 A;  4A69 C;  2BY2 A;  2DLL A;  1K78 B;  1ZTR A;  4D0P A;  4U0W A;  2BEO A;  4QIW N;  1N25 A;  1S9H A;  3DFG A;  3EQL F;  4L9V A;  5K5Q A;  3LL7 A;  3KEY A;  2GIZ A;  5GAG J;  2M8E A;  1FTT A;  4IRH A;  1PDN C;  1OYY A;  1NHA A;  2Z2S B;  3MZH A;  4ITV A;  1P4W A;  4KYW A;  1UG2 A;  3QYB A;  3H0D A;  4ABZ A;  3CCV I;  2LKP A;  5AIP A;  3WG9 A;  2DFF A;  2ZJ2 A;  3O6B B;  1ORK A;  2HU9 A;  3S3M A;  1RKW A;  2DJI A;  3GWZ A;  1H89 C;  4BE1 A;  4IQJ A;  4YFX F;  4OOI A;  5HOD A;  2AS5 F;  3G1M A;  2PMZ A;  1ZR4 A;  2M87 A;  1BA5 A;  1KYZ A;  3LMM A;  2PJR B;  4BJ5 C;  1V5F A;  5K5O A;  2KDO A;  3FK7 A;  3DPU A;  3ISP A;  1VQ5 I;  1DGW Y;  3M07 A;  1FYL A;  3K7A J;  4ZJZ A;  2YX7 A;  1SFO J;  1XSD A;  2BE5 F;  3VEP A;  1P2F A;  5TIS C;  3K4L A;  5HLI A;  3CO6 C;  1FYK A;  1JKO C;  2JSP A;  1WPK A;  2R7Q A;  4ZDP A;  1P7J A;  3ZRG A;  1WRJ A;  2UUZ A;  3BC8 A;  1L0O C;  1LEA A;  1R4M B;  4E70 A;  2HR3 A;  2XAS A;  3DKX A;  2KFD A;  1WFX A;  1OIS A;  1QZY A;  1ZN2 A;  2P6S A;  2HDW A;  2JSC A;  5ILS A;  2R5Z B;  2DYS H;  3GTM J;  2IW5 A;  3FXK A;  3QYF A;  5DV5 A;  4CO8 A;  1FC3 A;  3VFZ A;  3KLN A;  3KET A;  1U2W A;  1W1W E;  3AL0 B;  3E5Q A;  2M4K A;  1MND A;  4NQW B;  2EIL H;  2DOD A;  4G6Q A;  2E5Z A;  2JVH A;  4U7D A;  4BBS J;  3F8M A;  2JMW A;  3LST A;  1R5G A;  2AXL A;  5JFR A;  2OF7 A;  2F2E A;  3VDX A;  2V1N A;  1FIP A;  1K7A A;  2WAE A;  5E17 F;  4M9X A;  2OCC H;  3Q5F A;  1A36 A;  4XMY A;  1G2H A;  1RKT A;  1MBG A;  2WB1 A;  4E7Z A;  1NK2 P;  4KUM A;  2MSY A;  2HKX A;  3C18 A;  1FIA A;  2L7K A;  1HKS A;  1G3T A;  3S1Q J;  5F0F A;  2JN6 A;  3HOV J;  4JBA A;  4P5O A;  3H5N A;  4CYC B;  4A3B J;  1J09 A;  3BQY A;  5BMZ A;  2GQQ A;  5ED4 A;  4Y7N J;  1QPI A;  2CV0 A;  3H35 A;  3CP2 A;  1SVL A;  2ISY A;  2ACJ A;  1PP8 F;  1BR2 A;  2HOA A;  1V54 H;  1LVA A;  1YIJ I;  1FP2 A;  2H1K A;  1GV5 A;  3JW4 A;  1P4A A;  2F5F A;  1JKR C;  3ABM H;  1DPR A;  4HPQ A;  3FMQ A;  3S1M J;  4LFU A;  2CUZ A;  2X1C A;  2XAQ A;  3ZR8 X;  2DI3 A;  4XLE A;  1TP4 A;  3OMY A;  1K61 A;  1J9I A;  2KRC A;  4NB5 A;  3BOQ A;  5LGN A;  5A2Q Z;  3COA C;  1S8N A;  2ZB9 A;  3TOB A;  1D5Y A;  3F6V A;  3GEZ A;  2R7T A;  2EFW A;  3I5U A;  5B1B H;  1S7E A;  1EH8 A;  5E8G A;  4KT5 C;  1RR8 C;  4XR6 A;  4G6D A;  3KP4 A;  2Y0S N;  3LQQ A;  2BXY A;  4CXF A;  2XVC A;  4A5N A;  4DZP A;  3GXO A;  1H88 C;  1F43 A;  1JXS A;  2IJL A;  1J59 A;  3MZY A;  2ECC A;  2V79 A;  5CVI A;  2MA3 A;  3GBG A;  4I09 A;  2EWN A;  4CCM A;  2A61 A;  2MLG A;  3BJ6 A;  1ULY A;  2HQR A;  1TL8 A;  2DFH A;  3OIQ A;  1DDN A;  1Z1D A;  4IF4 A;  1RUN A;  5E3M A;  2OBP A;  2MBF A;  2P4W A;  3W6V A;  5FD5 A;  1GUU A;  2PN6 A;  2DPU A;  4JK1 X;  4LK0 F;  1WJ5 A;  2Z9O A;  3RQ4 A;  2GZW A;  3VOE A;  1FP1 D;  2JRM A;  3LSI A;  4BBR J;  3KEO A;  1VQK I;  1TZL A;  1HA8 A;  2E1M C;  2HXI A;  1FOX A;  2IA2 A;  2GBY A;  3RI4 A;  1MBE A;  3OYA A;  2VJ5 A;  1HW1 A;  4X1E A;  3VOD A;  4U87 A;  2FUG 2;  1R1V A;  2VAS A;  4CCL A;  2Y30 A;  3OSG A;  3JSO A;  1Q1H A;  2LTP A;  5KNL A;  1Z21 A;  3I54 A;  1XGO A;  2L9R A;  2D1H A;  2UV1 A;  4E7H A;  3L2Q A;  2HVS A;  1YLF A;  4KN7 X;  1C0W A;  5DCF A;  2JA7 J;  1I3Q J;  1XSX A;  5IP6 A;  3ML6 A;  4Y17 A;  9ANT A;  2MW8 A;  4HSR A;  2R7S A;  2KLO A;  2F5C A;  1H9T A;  4N4O B;  4CIC A;  4QLC U;  3BT9 A;  3RKX A;  5D4S A;  2ZJQ F;  3C1D A;  3RKY A;  2CU7 A;  2DT7 B;  4ETS A;  1MGT A;  3ELK A;  2G7H A;  2LF8 A;  2QLZ A;  2HDC A;  2FD5 A;  2K7L A;  5F04 A;  3B02 A;  2XF7 A;  1LEB A;  5L3F A;  1TC3 C;  3J81 Z;  3CD6 I;  3CMY A;  4M3D A;  5EZG A;  5D6F A;  5IP7 J;  2K9L A;  1S72 I;  2NXN B;  3QPH A;  3SFI A;  1MNM C;  3FKJ A;  2QSG X;  4Y4R A;  5FRM A;  2V9P A;  3MN2 A;  4KIT B;  1CQT A;  5FFX A;  2DOA A;  2VQC A;  4YIR X;  4KT6 A;  4OIP F;  5AON A;  1BC8 C;  2L3D A;  3FWE A;  5LLQ A;  3FHN A;  5KK1 A;  3HDD A;  3GFJ A;  2OC6 A;  3F8F A;  3U1K A;  4MGR A;  5GTH C;  1JHF A;  3S93 A;  3MAJ A;  2W7N A;  2YR2 A;  3FIS A;  4MO7 A;  2Y48 A;  1OCZ H;  5LEK A;  1QU3 A;  2W57 A;  1MDM A;  2JZY A;  4F3Q A;  3AAF A;  2L9V A;  3KP2 A;  4JQF A;  4U88 A;  2EBI A;  2ZFU A;  3M8E A;  3MVP A;  1D0Y A;  4FQG A;  2VJI A;  2CV2 A;  2MD5 A;  3V8K A;  1KQ8 A;  2EH3 A;  4MTE A;  3IL2 A;  3H0G J;  4CUG A;  4A6E A;  3NWS A;  2XF5 A;  3CES A;  5GP9 A;  3E6M A;  2FXA A;  3LWF A;  4LOC A;  4N0B A;  3TQN A;  1N75 A;  3MCZ A;  1GVJ A;  3KEQ A;  2QSH X;  4OU0 A;  4BY1 J;  3G1L A;  5HLT A;  4E4H A;  2ZCW A;  2LH9 A;  3JRG A;  2AQE A;  3R6S A;  3RCO A;  3JRD A;  1U8B A;  3PNV A;  5M3M J;  1GLN A;  2EIK H;  3S17 J;  4A3I J;  3K9T A;  1TWA J;  2M9H A;  4DBQ A;  1MIJ A;  1JUP A;  2OV7 A;  1WCM J;  1VZ0 A;  3OYC A;  1QQI A;  4G94 A;  4Q48 A;  1MKM A;  3ASO H;  1FY7 A;  1Z77 A;  2LKX A;  1QBJ A;  3VSK A;  4XRS A;  2HXO A;  4XLA A;  3FDY A;  3HIF A;  2LBF B;  1X3Z B;  3ZQH A;  3BLY A;  1R49 A;  4IHX A;  3OYG A;  5JHU A;  4QWQ A;  2ID3 A;  3KP6 A;  5GAD J;  2R7U A;  5EEH A;  4N4N B;  1Z3Y A;  1MD0 A;  3HUG B;  4HNT A;  5L3E A;  2HWV A;  2A3S A;  4AD9 A;  4PGH A;  5H6R A;  4AID A;  4D1Q A;  2ZKZ A;  3IRQ A;  3TL4 X;  2EJR A;  1F1Z A;  3CDL A;  2KIM A;  2LDU A;  1XMX A;  3QU6 A;  1Y1W J;  1LJ9 A;  1U8R A;  1F4K A;  2I5U A;  1JUS A;  1V5G A;  2CUE A;  2P0W A;  1OYI A;  2VIX A;  1B9M A;  4BDY A;  2DDB A;  2JA2 A;  3JAM K;  5E3N A;  4HLY A;  1T56 A;  1WI3 A;  2XPW A;  3MD2 A;  3LFK A;  3W6J B;  1UCR A;  2UXN A;  1BL0 A;  3KYC B;  5HVQ C;  3WTW C;  4MNU A;  1WSU A;  1YJN I;  4R79 A;  3OY9 A;  4D5C A;  5D6E A;  5LRS A;  4IHT A;  1ZAR A;  2QF7 A;  4L5E A;  3KIO A;  2DA3 A;  2GXA A;  3BP8 A;  4Y13 A;  2V9K A;  5IYB J;  1ERD A;  4MIM A;  3D5L A;  5JVT A;  2L02 A;  2HYG D;  1LVK A;  3CLQ A;  1VND A;  3IH4 A;  2H94 A;  2VOP A;  1IN8 A;  2VUM J;  2Q2E B;  2YX4 A;  3R4K A;  1RR7 A;  1T0F C;  1HST A;  3H3U A;  2EZH A;  4KIC A;  3ZOB A;  2ZNZ A;  3NAR A;  3GZN B;  3C3W A;  3GFL A;  2Q1Z B;  1XN7 A;  3FMS A;  2QBY A;  4WXH A;  2LSO A;  3K1N A;  4MQV A;  5K7Z A;  1I5Z A;  1VQN I;  5HDG A;  5KVR A;  1YO5 C;  3KFW X;  2LBF A;  4B4C A;  1YX3 A;  1PYV A;  3I59 B;  1R4N B;  1XGN A;  1Y6I A;  3WU2 C;  2Z1D A;  4BQO A;  1AOY A;  2LD5 A;  2QQ8 A;  2KL4 A;  3PQJ A;  1JKQ C;  3QPL A;  3BCA A;  3SDG A;  1MZB A;  3TDU C;  4ON0 A;  1G8X A;  2VN2 A;  2L01 A;  5EYR A;  3JRA A;  1X2N A;  3GYH X;  3P5J A;  3NWT A;  1HF0 A;  4A6D A;  4FX4 A;  3GTL J;  5DD8 A;  1IRZ A;  2ZO4 A;  3J80 K;  2R0Q C;  1SMT A;  3DLA A;  2VBZ A;  5L3D A;  1ZEL A;  1XSV A;  3R0A A;  3OR1 C;  1B59 A;  2OAZ A;  3K4C A;  3TP0 A;  4KIF A;  3I56 I;  3TED A;  3TDZ C;  1R7J A;  1BR1 A;  2XAF A;  1G6N A;  5J4Y A;  4UNO A;  5E79 C;  2EA2 A;  2F4M B;  1ZH5 A;  1LFB A;  3NRV A;  3B73 A;  4MQ9 F;  3R0J A;  3DTK A;  3PIO F;  3BG9 A;  2HQA A;  5DM6 F;  3EUH C;  1I3A A;  2CO5 A;  1KU2 A;  4ENN A;  3E1S A;  5LEJ A;  5ILU A;  1W5S A;  2NVX J;  1FZP B;  4XN3 A;  1D1C A;  1EKE A;  3PSI A;  4O3M A;  3ZQQ A;  1EJ9 A;  1OPC A;  3L2R A;  4ZYE A;  5K7F A;  2XAJ A;  4P9F A;  2VON A;  1MJ9 A;  4XN0 A;  4LJZ F;  3DTE A;  1J7K A;  4V19 K;  1YFH A;  4FTH A;  1OCP A;  4GO1 A;  5D5W B;  1TQM A;  1B1B A;  1OKR A;  5GPA A;  2A6H F;  3K2A A;  5D5X B;  4A0Z A;  2RN7 A;  1U3E M;  2XDV A;  4D5F A;  1I27 A;  3HM5 A;  2HFH A;  4HST A;  1ETV A;  4M74 A;  5GAH J;  2CMP A;  1IN6 A;  2F6C A;  1G3S A;  4RAG A;  3HYI A;  1O3Q A;  4EMS A;  3IH3 A;  5HNH A;  1SFE A;  2M4G A;  4ZC3 A;  3GZ5 A;  4EJV A;  5GTI C;  2FBH A;  2GIV A;  2ZNY A;  3N05 A;  3R60 A;  5F27 A;  3SZG A;  2DQL A;  3AKZ A;  3JTG A;  4BE2 A;  1A35 A;  1EA3 A;  4XON A;  1GHC A;  4HLX A;  3GF2 A;  2ELJ A;  1R58 A;  1XGM A;  2KMU A;  3ERM A;  3H5R A;  5IT9 Z;  3ZPL A;  2V26 A;  1IXC A;  2DCE A;  3L2V A;  2R5Y B;  3HTS B;  4XL9 A;  1P92 A;  1ZG3 A;  4LGW A;  4FX0 A;  3E0J B;  2FOK A;  1X19 A;  4UUT A;  3IC7 A;  4W97 A;  1U0J A;  2EQR A;  1YTY A;  2RQQ A;  3SJM A;  2LRE A;  4HX4 A;  4HQE A;  1BIB A;  3TBI A;  4RB3 C;  1OR7 A;  3C7J A;  5HDK A;  4MTD A;  5BS6 A;  1QGP A;  3IKV A;  4ZDL A;  1IRX A;  4ZTF A;  2KDZ A;  2Y75 A;  4RMN A;  2P5V A;  1MMS A;  1TNT A;  2NS0 A;  4DYQ A;  1WH7 A;  2VI6 A;  3JR9 A;  2HQN A;  5F1R A;  4OMY A;  3HOZ J;  3G73 A;  2A69 F;  5E1X A;  3OYN A;  4MEX F;  1ONV A;  1RI7 A;  3E5X A;  1ETK A;  5EG0 B;  3CDH A;  4OWR B;  2WV0 A;  3TO9 A;  3VB2 A;  1RUO A;  1OCC H;  2B0L A;  1W7P A;  3EET A;  2XGX A;  1FOW A;  4XBF A;  4C3I J;  4XIC A;  2JA5 J;  5CVU A;  1QPM A;  3RKQ A;  1BOA A;  1K4S A;  1B72 B;  1T33 A;  4BS9 A;  3KP3 A;  1I39 A;  5BPD A;  3D5S C;  3IUO A;  4RDU A;  3GTK J;  2NNN A;  3N97 A;  2PQ8 A;  2E2H J;  1E0E A;  4HOB A;  2JK3 A;  2QA4 I;  1MBH A;  1W7P D;  4MFE A;  3H36 A;  3BPV A;  5HOO A;  5H6Q A;  3IKT A;  2OA4 A;  4AVZ A;  3KP5 A;  2DO7 A;  1T6S A;  3A1Y A;  3HGY A;  1M1E B;  4BHP A;  4CZZ A;  1UZC A;  1LQ1 A;  1RZ4 A;  3MEX A;  1JE8 A;  3HZJ A;  3A4C A;  1GXQ A;  2ZC2 A;  3J7Z I;  2QEN A;  1IAW A;  3L7W A;  4RB2 C;  1R36 A;  3CCU I;  3CDI A;  5J47 A;  1RES A;  2LP0 A;  4M73 A;  2JJ7 A;  2UXX A;  1P7I A;  3PIP F;  2EV0 A;  1FLI A;  5JLX A;  5C4X J;  3CTA A;  3BQZ A;  5D4R A;  1PUF B;  1X3U A;  1YW8 A;  2K9S A;  1Y0N A;  1W5T A;  2L4A A;  1ZLJ A;  1D8K A;  5EZH A;  4M3G A;  2H8W A;  4RB0 A;  3F3X A;  1P4X A;  5FLX K;  2ZME B;  3KLO A;  4PJM A;  3RPQ A;  4E6K G;  1SVO A;  3ZGK A;  4H0E A;  3CF5 F;  2IBD A;  3LSR A;  1UEL B;  3O8G A;  1IJW C;  4G6T B;  4HG2 A;  4L9J A;  4KJZ A;  4C3H J;  3L2U A;  2A68 F;  2GXG A;  4DW6 A;  1VQL I;  2A5Y B;  2CW0 F;  2R7R A;  1ZYR F;  3L2W A;  2RDP A;  3RYP A;  3SEZ A;  1SVM A;  3SZP A;  4MFD A;  5LFA A;  3F23 A;  1G59 A;  2J5P A;  1LPQ A;  1QRY A;  4FE4 A;  4HX8 A;  5LBQ A;  2KHM A;  2X85 A;  2M0M A;  4V2G A;  2RAE A;  2R4G A;  2X51 A;  3BWG A;  2DA4 A;  2E34 A;  1BW5 A;  3UNG C;  4UV9 A;  3SZT A;  3BPX A;  5IT3 A;  1YIT I;  3VYS B;  3PSF A;  3G4S I;  1A6I A;  1O4X A;  3KYL A;  1S7O A;  2HTS A;  3MFK A;  2LOO A;  4HNU A;  5CVJ A;  3WTV C;  1T0F A;  4F92 B;  3HGG A;  2DOF A;  2DDA A;  2HQ5 A;  1S7A A;  3P7N A;  3OYH A;  1T95 A;  2QYO A;  1XGS A;  1S3J A;  4BAC A;  2HS5 A;  4RGR A;  1X1C A;  2QZ8 A;  4M71 A;  4OIQ F;  4NDL A;  3BDD A;  3VYU B;  1QO0 D;  2M0C A;  2P6T A;  2QKM B;  3LFU A;  1K78 A;  4UUV A;  5FO5 A;  1ZAO A;  1D8J A;  1R22 A;  2OZ6 A;  2RVC A;  2YU9 J;  3CME I;  3DBH B;  2Z16 A;  2TCT A;  2XGC A;  2OTL I;  1R6R A;  3BG6 A;  1TNS A;  2FE3 A;  1ZLK A;  3QU3 A;  2EPF A;  1YRN B;  4BHB A;  1X1D A;  2VB6 A;  3PNY A;  1BR4 A;  4DBR A;  4A3E J;  4M3B A;  4ZH4 F;  4PGG A;  2DJN A;  1XD7 A;  3VPR A;  1MH3 A;  3H9Q A;  4CCN A;  3WE2 A;  3E5U A;  3PFI A;  1IDZ A;  1JTY A;  2XGD A;  2OQR A;  3BTJ A;  3OYI A;  4A12 A;  4A5M A;  3F72 A;  2PJR A;  3LSJ A;  3QQA A;  4GFB A;  1U78 A;  2LYC A;  5FKN A;  1H0M A;  2W1O A;  2M7B A;  2OU2 A;  2M34 A;  2ETH A;  2X0L A;  2RV8 A;  2EB7 A;  2DOE A;  3QPT A;  3JRE A;  2Z33 A;  4ENM A;  3TO7 A;  2H1L A;  2XRN A;  1KQ0 A;  4DJA A;  2XPV A;  1R00 A;  3K69 A;  2LRD A;  3KZZ A;  1HXD A;  2VLA A;  1VFC A;  2M3A A;  1VQ8 I;  1LB2 A;  2LY1 A;  2AHQ A;  3DLL F;  2P5L C;  2H6B A;  4XLN F;  2AXT C;  2E7X A;  2Y0M A;  2X1E A;  3EUH A;  3I58 A;  1Z7L A;  2VKE A;  2HPI A;  2PX9 A;  3TW6 A;  1I6X A;  2EFQ A;  3OYF A;  4A2U A;  1E17 A;  1SD6 A;  2DW4 A;  3LAJ A;  4RAY A;  4CZC A;  1V4R A;  3DTI A;  4M3F A;  1ITY A;  2R5Z A;  3V42 A;  1U5T B;  3LA7 A;  2WAF A;  2ZXW H;  1QZZ A;  2I10 A;  1P6R A;  4RBO A;  1HDD C;  1I6H J;  1DGR M;  5D8L B;  2VPL A;  1NTC A;  1J75 A;  1Y0U A;  4NQW A;  5BQT A;  2ZSI B;  1WQ2 A;  1DP7 P;  2BHY A;  3OIP A;  2OQG A;  5E1Z B;  2O7O A;  1YJ9 I;  3RSN A;  3H1C A;  1MBK A;  3CUQ B;  3W2V A;  4ENK A;  3AG2 H;  3LSM A;  3QOP A;  4ZTJ A;  4KDP A;  1WJB A;  4E7I A;  2OCE A;  3DEW A;  2O3F A;  2XB5 A;  2DA2 A;  1IW7 F;  2IXS A;  1Z91 A;  2XUB A;  4XLF A;  3CO7 C;  2IVM A;  2JUC A;  2HOS A;  3AG3 H;  3TOA A;  2ZJR F;  4CDG A;  3FXU A;  1ZRE A;  2E35 A;  5IY5 H;  2EV6 A;  3RZO J;  1IF1 A;  4PCQ A;  1IN7 A;  5J1R A;  2F4O B;  3CCL I;  1QHH D;  2K5C A;  4CYC A;  3L9F A;  2RKH A;  3R61 A;  5IPA A;  5EF6 A;  1XG1 A;  1KU7 A;  2Q0O A;  3OOU A;  1IN5 A;  1OMI A;  2JPC A;  3IP4 B;  4I0B A;  1NK3 P;  3MKW B;  3CCQ I;  2EZI A;  4OIN F;  2VXD A;  4D7M A;  3LSH A;  4CSW A;  4S04 A;  1KZH A;  3ECH A;  1FOY A;  2NAZ A;  1K83 J;  4XID A;  2XKO A;  2GA1 A;  3QOE A;  4HNV A;  3JTH A;  4LG0 B;  4UB8 C;  3SYT A;  2QVO A;  3FXL A;  4CCJ A;  2W4S A;  2JA6 J;  2Y9Y A;  3HL2 A;  4A3L J;  2LG4 A;  3RDI A;  1BC7 C;  2WC2 A;  3D0S A;  1U5T A;  3T8T A;  3I4P A;  2B9S A;  1T8I A;  1VQM I;  4AIK A;  1XS9 A;  5C3E J;  3WU0 A;  2MLK A;  3ZCO A;  4S05 A;  3LA2 A;  4B8X A;  4KNY A;  2EIN H;  1R1U A;  2CGP A;  3VWB A;  2YU3 A;  3PL8 A;  3C2B A;  3FM5 A;  4PJ0 C;  1MJB A;  2P5K A;  5F08 A;  4FT8 A;  1WGX A;  5LRR A;  2ZBK A;  1WZ2 A;  1ETO A;  2E1C A;  5CVR A;  1MBF A;  4LLL A;  2DK5 A;  4NBQ A;  1USS A;  2ID6 A;  3S8P A;  2E5N A;  4HF0 A;  1OR7 C;  3UR3 C;  5K7H A;  3ZP5 A;  3BY6 A;  2V7F A;  2CUJ A;  3BCB A;  5L3C A;  2O9L A;  5CKT A;  5FRN A;  4G12 A;  3CCR I;  3LA3 A;  4B48 A;  1XX5 A;  4ESJ A;  5J3L A;  1X58 A;  2QUF A;  2H27 A;  2BVL A;  2PI0 A;  4U0V A;  4ESF A;  2VKH A;  4RGX A;  3OYL A;  4E7L A;  1UFM A;  3O8H A;  4FET A;  2IGO A;  2NVT J;  4IZZ A;  6PAX A;  4FHT A;  3KYD B;  3K4M A;  2DTZ A;  1ZGA A;  4B1R A;  2HVR A;  1FWZ A;  2O5R A;  2VT2 A;  5FRO A;  3CJQ B;  5DYM A;  2LKS A;  4F52 A;  3O3K A;  2ZJP F;  3M1C A;  3JRB A;  1S29 A;  3VYR B;  2Y69 H;  3G3Z A;  4F7Z A;  1SD7 A;  4ZYD A;  2FMY A;  2X6Y A;  2V9V A;  3SFZ A;  1E3H A;  2GA2 A;  2STW A;  4I01 A;  5J1U A;  3ZMZ A;  4C9Y A;  3DU6 A;  2W82 A;  3RPU A;  1HW5 A;  4G9Y A;  3J7A Y;  1LDK B;  1XMA A;  5E20 A;  1R71 A;  2WV1 A;  1HDP A;  3IAM 2;  3F9K A;  1K6Y A;  4WXC A;  4HBL A;  3OS2 A;  3A0B C;  3K70 C;  2CS3 A;  1VTN C;  1TWF J;  2MH2 A;  2DMQ A;  1ON1 A;  3DEU A;  4JX4 A;  5B3S H;  4M6Y A;  3I55 I;  1SC7 A;  2R93 J;  2VJ4 A;  3HHG A;  2L9N A;  3GZ6 A;  2R7X A;  5EGO B;  2R7D A;  4EVI A;  3TGN A;  3E97 A;  3LQR A;  4GYI A;  3HRT A;  3H3Z A;  1KGS A;  2V1X A;  1T08 B;  2DA7 A;  2RNG A;  3S2H J;  3G1O A;  1BIA A;  1CF7 B;  3ZQL A;  2B63 J;  1IUF A;  1MJA A;  2B7E A;  3K10 A;  2Y31 A;  3EPZ A;  2G0E A;  2MYS A;  2PBI A;  3FX3 A;  4FE7 A;  1T38 A;  2UWM A;  5DS9 A;  3WTX C;  3NQO A;  1FBQ A;  3BJA A;  4OMZ A;  4AIJ A;  3GW2 A;  1B6A A;  1SAU A;  3SXY A;  1O3S A;  1WKM A;  4WF2 A;  4KMF A;  1HBX G;  3RYR A;  4B47 A;  3BJO A;  2IGM A;  3HOX J;  2R7O A;  3BTI A;  1U6G A;  2NS8 A;  5DEQ A;  1ZRC A;  5LHG A;  1KQ9 A;  1TBX A;  2MH9 A;  2GWR A;  3H9G A;  1ZRD A;  1ZGJ A;  2ADU A;  4BEH B;  2KPM A;  4J19 A;  4PUS A;  1ZRF A;  2DA6 A;  3I71 A;  5DUK A;  2BW3 B;  2JVG A;  3WU1 B;  2VE9 A;  5IYC J;  2BY3 A;  4YFK F;  2HEO A;  3CC7 I;  4DNC A;  3HHH A;  2A5W A;  4Q4Z F;  5TGT A;  1BI0 A;  3BR3 A;  3BR6 A;  3Q9V A;  4DYC A;  1MBJ A;  2WA0 A;  3PNT A;  3V7C A;  3DPT A;  4XKV A;  4GCV A;  5B66 C;  4WK8 F;  1LFU P;  3CQZ J;  3CP8 A;  3BG3 A;  2NNY A;  2E71 A;  3FXM A;  5KAF C;  3L00 A;  3L2C A;  1MSF C;  4M72 A;  4IRI A;  1OQY A;  5EGO A;  5E3L A;  2Z3Y A;  4KFC A;  4G7H F;  3GX4 X;  5JR3 A;  4FCY A;  4EJT A;  1IO2 A;  2VKD A;  1MMN A;  2LR8 A;  5A2Q K;  1N78 A;  3BR5 A;  3D5R C;  4M3E A;  2DA5 A;  4DOZ A;  5HS7 A;  1T98 A;  5DCM B;  2MD0 A;  4X0G A;  1OLT A;  3T5X A;  5M3F J;  4M6V A;  2FML A;  1ETY A;  1WJE A;  2X9D A;  3WOD F;  4QTR A;  2WAD A;  1SD4 A;  2CRG A;  4LB5 A;  3ZQC A;  5HNF A;  1ETQ A;  1HOM A;  3HUG A;  3ZXS A;  3K1P A;  4HX7 A;  3HOS A;  3L1P A;  2BZT A;  3BR0 A;  5LGT A;  4XK4 A;  3LNQ A;  5F1J A;  3GTP J;  4ENJ A;  3GCM A;  3PO3 J;  2ZME C;  3HXL A;  1PJR A;  2QKL B;  1JGS A;  4YEL A;  1JJ6 C;  4HDU A;  4IEJ A;  1KA8 A;  1B9N A;  4ASN A;  3IV5 A;  2MFZ A;  3MQ0 A;  1A6Q A;  4IJA A;  1FBU A;  3NEU A;  2K4J A;  2D45 A;  4GYG A;  4EJO A;  4UUS B;  1VQP I;  2A05 A;  4ZYH A;  4BNC A;  2IT0 A;  2YS9 A;  4A0Y A;  1HW2 A;  1Y56 A;  3WTZ A;  3HB9 A;  4RB1 A;  3HOT A;  4Z2Y A;  4NC8 A;  5JVG F;  3K4J A;  5K5R A;  3BZC A;  3W6K B;  1JKP C;  1ZG5 A;  3WHC A;  4ZDO A;  2FQ3 A;  4EM0 B;  4EM2 A;  1OCO H;  4EJU A;  3Q9S A;  5L3G A;  2J5O A;  3MKL A;  4B09 A;  2XC7 A;  1QHG A;  1DP3 A;  2QWW A;  3CLO A;  5DD4 A;  2OUM A;  4UV8 A;  4RLF A;  4CCO A;  2GLO A;  4FIS A;  2Q2E A;  2COM A;  2QGU A;  2XF6 A;  4A0X A;  3J7Y J;  4PDK A;  1QA6 A;  2ZXH A;  5DM7 F;  4KIB A;  4G7O F;  4RA2 A;  1TWG J;  2CG4 A;  2DMN A;  3MZ8 A;  4E7J A;  2W85 A;  3BG7 A;  1VQ9 I;  4ZYG A;  3E6B A;  4YG2 F;  1TWH J;  2A6E F;  2GOM A;  2ZSH B;  1SFX A;  1YX5 A;  3DP7 A;  1YOV B;  1GDT A;  2DTR A;  1YQA A;  3LOC A;  2A07 F;  4BQN A;  2BHZ A;  4BYY A;  3AL0 C;  3I59 A;  1D1A A;  4UY8 I;  4HV6 A;  2JTV A;  2L7F P;  2IS2 A;  1YJW I;  1WVR A;  3DKW A;  3EDP A;  3P9I A;  3GTJ J;  2ZFW A;  2R7F A;  1HKQ A;  4XOP A;  2IPQ X;  1FYM A;  4LLG F;  3DKY A;  4XKC A;  1YYV A;  1MMD A;  1ON2 A;  2DA1 A;  2VBY A;  2O8X A;  3DPL C;  5FKM A;  3K4K A;  3JCU C;  2STT A;  2F5D A;  1XB4 A;  5IYD J;  5LD2 C;  4I2O A;  2VE8 A;  3T1B A;  1D5V A;  3IH2 A;  3J81 K;  2BBY A;  3WGH A;  3CC2 I;  5D8K B;  3K0L A;  1DQU A;  1PP7 U;  2HYJ A;  4UHT A;  4J01 A;  1AKH B;  4OIR F;  3DBL B;  1ZQ3 P;  4CH7 A;  1WH5 A;  4C30 A;  2DYR H;  2VQG A;  3A01 B;  2FF4 A;  5CQG A;  4I98 B;  3Q0U A;  3ABU A;  4BXX J;  1BJA A;  3QP5 A;  3OS0 A;  2O03 A;  4L0Y B;  4PSX A;  3U2R A;  1DU6 A;  5LHI A;  3HSR A;  4XSZ F;  3PO2 J;  3I0T A;  1Y8Q B;  1DPU A;  2G9W A;  1Y1V J;  1MW7 A;  1SFK A;  2XB0 X;  4BL0 B;  3JRH A;  3HSF A;  2E1N A;  1G3W A;  1SAN A;  3V7R A;  4HV5 A;  3I64 A;  2K02 A;  2TRT A;  4XLC A;  3F6O A;  1IDY A;  4Y3O A;  3V7S A;  4YFN F;  1FJL A;  4IHW A;  2EZK A;  4LK1 F;  4IOA F;  1OFC X;  4LG3 A;  2NOG A;  2FBK A;  1QZE A;  3CC4 I;  1I1S A;  2K3P A;  2ESH A;  4II3 A;  3CCY A;  3MWM A;  2GXB A;  1U5T C;  4B3A A;  1H8A C;  2R3S A;  4IRG A;  3ROU A;  4IHS A;  5K1Y A;  2DAO A;  4IX7 A;  2EIM H;  2HI3 A;  5F0H A;  1HLV A;  1RNL A;  4E7K A;  2WTE A;  5J40 A;  3DQV C;  4DQ2 A;  2KRF A;  4EQQ A;  4UXN A;  2QEX I;  2FNP A;  2H6C A;  4AUX A;  4G8X A;  2FOW A;  2PLY A;  3HKZ A;  5HLH A;  1B8I B;  5E18 F;  3BR2 A;  1HCR A;  1XDU A;  3CJT B;  3GLX A;  4NC7 A;  3S14 J;  3IAS 2;  2QQ9 A;  2XGE A;  1N77 A;  2FJ1 A;  3E6D A;  4B44 A;  3S3N A;  3RQI A;  1RRJ A;  2MG4 A;  4BY7 J;  1O7L A;  2WY7 Q;  4A3C J;  3SEQ A;  1KU3 A;  1ZR2 A;  4XRM A;  2DT5 A;  1Q1V A;  1TWC J;  1SMY F;  2Q8K A;  2GAU A;  2JRT A;  3I9V 2;  5D5U B;  2LLK A;  3M4O J;  3F0C A;  5ICF A;  4XQF A;  1LDD A;  2ICW G;  2NYX A;  2O0Y A;  3RTR A;  2R5Y A;  1GXP A;  2L5Q A;  1QNT A;  2DQR A;  2N8G A;  1FX7 A;  3ASN H;  3F8B A;  4PFO A;  4EGY A;  3EYY A;  1X1A A;  2IEK A;  4AC0 A;  4HDV A;  2M30 A;  2PFB A;  4OIO F;  4D7N A;  3TMO A;  3K70 D;  3JRC A;  3S15 J;  1UHM A;  3FXR A;  2CYY A;  4BH9 A;  2FX0 A;  2G7U A;  5J8F A;  3J7A O;  2VBW A;  1REP C;  2BY1 A;  1FSE A;  1D0X A;  2BYV E;  3FF5 A;  4MHG A;  1MH4 A;  3HRM A;  4YIF A;  2A6T A;  4U0Y A;  2M1B A;  3UKG A;  1Z7U A;  4P9U A;  4MLO A;  2LC2 A;  2HPM A;  1R5I D;  4V2F A;  3ZMU A;  2CQQ A;  1W0U A;  1X1P A;  3GFI A;  4O6J A;  3BTL A;  2EZL A;  3M9A A;  2CQK A;  4QPQ A;  4I7H A;  2KZV A;  4BAY A;  4BXF A;  4DGW B;  2F5E A;  4XM3 A;  4EJW A;  3OYJ A;  3RZD J;  5EG0 A;  3K2Z A;  1B8I A;  4NC6 A;  4I99 C;  1X1B A;  2XV4 S;  4GRI A;  3CUO A;  1LKX A;  4YII A;  4A3F J;  2VBX A;  1RET A;  2WAQ N;  2EFN A;  2QSF X;  3OIO A;  4H4K C;  5E3O A;  3F8C A;  3QOD A;  4PJL A;  3HOU J;  1IRF A;  4D9J A;  4DYR A;  2M7A A;  1B72 A;  1DUX C;  1D0Z A;  2XAG A;  5C4J J;  4S0H B;  3SQN A;  5ICE A;  2EA4 A;  2XAU A;  3PUB A;  2E2J J;  1HSJ A;  1ODD A;  1TT5 B;  5IOY A;  3S2W A;  1MNE A;  5BNG A;  4PK4 A;  3ZMS A;  2R7W A;  3W3C A;  1NH3 A;  2KZG A;  3B6C A;  2CW8 A;  1IC8 A;  1UAA A;  4UVC A;  3I4N J;  3DCF A;  3WGG A;  4A3J J;  1UHS A;  3PM1 A;  5M5W J;  3ZQF A;  3KZY A;  5KCM A;  5F64 A;  4BXU A;  4Y52 J;  1POG A;  5EEA A;  4RAF A;  4KIS A;  2P7V B;  4PFP A;  1WHU A;  4DIQ A;  3K6G A;  2KQR A;  1X2M A;  3CMM A;  1T2K A;  2V4J C;  2VJJ A;  1J2X A;  1WWX A;  1JT6 A;  1UB9 A;  1PUF A;  4LIU A;  1O7F A;  4ZYA A;  4BDZ A;  4BGD A;  3HJE A;  3FIW A;  4G7Z F;  3H5A A;  5F0C A;  5FD6 A;  3AFH A;  3IWF A;  1K79 A;  2ZME A;  1OJL A;  2VPR A;  5J8C A;  2L7Z A;  4BUP A;  1Z6T A;  5TRD A;  4GDF A;  4EEF G;  2ESN A;  2BXZ A;  5BOX A;  2EFP A;  2NS7 A;  1UHW A;  1V3F A;  3I53 A;  1QVU A;  1PUE E;  2NVU B;  2NRA C;  5J4V A;  1S5L C;  4CCK A;  2O61 A;  3FXJ A;  1IV8 A;  4W1U A;  2MGQ A;  1L3L A;  1Z67 A;  3JAM Z;  1TLH B;  2W00 A;  4LD5 A;  3U1D A;  2E2I J;  2CQ7 A;  2FNA A;  3Q0V A;  3GTG J;  4BQA A;  3KZI C;  1VQ4 I;  1TQP A;  5F6F A;  2D5V A;  2X6X A;  3WTU C;  4Y33 A;  4HZF A;  1AA7 A;  2KIF A;  3GO5 A;  3JRI A;  1IV6 A;  4CHU A;  2QQA A;  2ME6 A;  4IHY A;  1G4D A;  3WGI A;  3SDB A;  4HAM A;  1XCB A;  2XSJ C;  3ZMV A;  1SFU A;  2DBB A;  1KYW A;  4BE0 A;  5FKK A;  4J00 A;  1JUM A;  5GAE J;  2ECB A;  2RNJ A;  3FKI J;  2EK5 A;  3KCC A;  3VSL A;  1EF4 A;  3I3L A;  2IS6 A;  2O6G E;  3FBI B;  1X4P A;  5C44 J;  2R7Z J;  5H20 A;  1PVE A;  1UMQ A;  4N9H A;  3WTT C;  1IG7 A;  5FGM A;  4R1H A;  4AYB N;  3ULQ B;  5IT9 K;  4OAZ A;  4GXO A;  3LAP A;  3MKZ A;  4BJ6 C;  5HDN A;  1YRN A;  2FEZ A;  2IGK A;  1YI2 I;  2IRF G;  2R92 J;  1UG0 A;  4IOC F;  1NG6 A;  3HPG A;  2HTJ A;  4E7S A;  2OJE D;  1Z0X A;  1AWC A;  2DK8 A;  3PJR A;  4XKB A;  3JRF A;  1F36 A;  1APL C;  2E36 A;  3EUA A;  2JQ7 A;  2JA8 J;  2X48 A;  1XMK A;  2F4I A;  2WWY A;  2CJJ A;  3F21 A;  2LK2 A;  3OYK A;  3TW7 A;  4RGS A;  1AU7 A;  3M3Y J;  2LNB A;  5FFZ A;  2VOO A;  3DU5 A;  1T39 A;  1FMW A;  1O57 A;  1V55 H;  3QWL A;  4O5V A;  5FKO A;  3GLL A;  4RS8 A;  4CGZ A;  1RPW A;  2FQ4 A;  1FPQ A;  1X4O A;  1ZK8 A;  1B4A A;  1BI3 A;  4CA0 A;  1ZG1 A;  1EV7 A;  1W4M A;  2LF7 A;  3J80 Z;  1SD5 A;  3S16 J;  2L2O A;  1J5Y A;  1D1B A;  2DN0 A;  4AVP A;  3OL3 A;  5CJ9 A;  3CJR B;  3WTS C;  3IWZ A; 
#chains in the Genus database with same CATH homology
 5D5V B;  2X4H A;  2HKO A;  5ERI A;  3N4M A;  3FZV A;  2Z99 A;  3HTU A;  2EFO A;  3K1M A;  4WXD A;  2YPR A;  1MDM B;  3BZ6 A;  3CUQ A;  4HF2 A;  1TW2 A;  3U9G A;  1H9G A;  1YIO A;  2FRH A;  2PMH A;  1EH6 A;  1JHH A;  5BPI A;  1CGP A;  4HF1 A;  2YSR A;  5EEG A;  4IPA A;  2VOD A;  1BI1 A;  4AWX B;  2FBI A;  2PJP A;  4XLP F;  4IXA A;  3RJP A;  2M45 A;  4L18 B;  2QQB A;  2CFX A;  1STZ A;  4KA4 A;  2PEX A;  4LG0 A;  5ILV A;  1HQC A;  2K86 A;  1FT9 A;  2C6Y A;  3SHF A;  4NHJ A;  1R23 A;  4Q5S F;  2V6C A;  5JI6 A;  2HGC A;  2HYF A;  2KIU A;  2D2W A;  4L5J A;  3TKY A;  5HS8 A;  2VXZ A;  4L0Z B;  1EH7 A;  3PQK A;  4WWC A;  1XCV A;  3RKW A;  3CJN A;  1IN4 A;  3OOP A;  5E8I A;  1YW7 A;  3GFM A;  5CVV A;  3ERE D;  1FBS A;  1R5H A;  2D1V A;  3RIR A;  2RGV A;  2L54 A;  3E3V A;  2QBY B;  1UST A;  1TW3 A;  3DF8 A;  5CYV A;  2XKP A;  4LMY A;  4RAZ A;  1R1T A;  4ZZL A;  2IA1 A;  3TO6 A;  2KJB A;  4LB6 B;  3ZMD A;  1I1G A;  5HS9 A;  2ISZ A;  1O3R A;  5LHH A;  1XDS A;  3EYI A;  3FHZ A;  3E6C C;  1IXR C;  3O2P E;  4EGZ A;  4LLN A;  4UVA A;  2FU4 A;  3OV8 A;  2IA0 A;  3QRF F;  3F8N A;  5TJJ A;  2M5W A;  2OZU A;  3HRS A;  1RIO H;  3FXQ A;  1LDJ A;  4Q47 A;  4XRF A;  5J6X A;  3ECO A;  1CF7 A;  2CWE A;  5FLX Z;  4CYD A;  1BI2 A;  2XRO A;  1O3T A;  2ELH A;  1A04 A;  3M8F A;  4WCG A;  2BGC A;  3M7G A;  3QP6 A;  4HYE A;  1YS6 A;  3DXJ F;  4HA8 A;  4GGG A;  2HOE A;  2FA5 A;  1F5T A;  4EV0 A;  4EM1 A;  5ICG A;  2DPD A;  4M9S A;  1BN5 A;  3T8R A;  4TV7 A;  2K27 A;  1IZ1 A;  4UVB A;  2L4M A;  2XHK A;  3HRU A;  4K2E A;  1S6L A;  2OD5 A;  3V4G A;  1D3Y A;  3T0Y A;  4KN4 X;  3P9C A;  2TDX A;  5FB2 A;  2P8T A;  3H92 A;  1BM9 A;  2ZXJ A;  2PMU A;  3WTY C;  2PG4 A;  3FMR A;  3GUD A;  5DCM A;  3REO A;  4ESB A;  2VC1 A;  3ZMT A;  4RGU A;  3L09 A;  4IVN A;  3ZN1 A;  1SAX A;  3KP7 A;  1YS7 A;  1Z9C A;  5LGU A;  4I0A A;  2JT1 A;  1K6O A;  2MC3 A;  5CLS A;  4U7B A;  1F9N A;  2KJC A;  4R8H A;  2P7C B;  1FOK A;  2H09 A;  2VC0 A;  2E7W A;  4BHC A;  4HW0 A;  1Z6R A;  4M6X A;  3WE3 A;  2QM3 A;  1E2X A;  1IRG A;  3ABT A;  5AIQ A;  2K4B A;  3ZN0 A;  1W7P B;  5ICC A;  1Z05 A;  5L3B A;  5DDG A;  2W24 A;  2EV5 A;  2HZT A;  3BRO A;  1FSH A;  1FNN A;  1LNW A;  4L9N A;  2DU9 A;  2RC4 A;  1KU9 A;  2BV6 A;  1IUY A;  2IP2 A;  4KMU X;  2W25 A;  1J0R A;  4PZJ A;  4P55 A;  1BBY A;  3P9K A;  3CUQ C;  3JSP A;  4KIG A;  3V8L A;  2VT3 A;  2CSO A;  4XSX F;  5HLG A;  4AIH A;  4HQM A;  3HSE A;  1YG2 A;  4ZZD A;  1ZHF A;  3GVA A;  3IHU A;  3KE2 A;  1TTY A;  2FSW A;  2RQP A;  4Y15 A;  2UZK A;  3V8J A;  2V1U A;  2XAH A;  1TQI A;  4WX9 A;  2W84 A;  1YW9 A;  2JPB A;  3DV8 A;  3ZQ7 A;  2Z5U A;  4N9I A;  5DUI A;  4L9T A;  4L5I A;  3IRR A;  2XIG A;  4I02 A;  2V1D A;  1WI9 A;  5E1W A;  3F22 A;  1HKT A;  2KKO A;  4M9Z A;  4MEY F;  1G3Y A;  2DFI A;  1IXS B;  3QAH A;  1OYW A;  3FM3 A;  3M1E A;  4P96 A;  2DLL A;  1K78 B;  4D0P A;  4U0W A;  2BEO A;  3DFG A;  3EQL F;  4L9V A;  5K5Q A;  2M8E A;  4IRH A;  1PDN C;  1OYY A;  1NHA A;  3MZH A;  1P4W A;  4KYW A;  2LKP A;  5AIP A;  3WG9 A;  2ZJ2 A;  3O6B B;  3GWZ A;  4YFX F;  4OOI A;  2AS5 F;  2M87 A;  1KYZ A;  5K5O A;  3ISP A;  1FYL A;  2YX7 A;  1XSD A;  2BE5 F;  3VEP A;  1P2F A;  5HLI A;  3CO6 C;  1FYK A;  1WRJ A;  1L0O C;  1LEA A;  4E70 A;  2HR3 A;  2XAS A;  1QZY A;  1ZN2 A;  2P6S A;  2JSC A;  5ILS A;  2IW5 A;  5DV5 A;  4CO8 A;  1FC3 A;  3VFZ A;  3KLN A;  3KET A;  1U2W A;  3E5Q A;  4G6Q A;  4U7D A;  3F8M A;  3LST A;  1R5G A;  2AXL A;  5JFR A;  2F2E A;  1K7A A;  5E17 F;  4M9X A;  3Q5F A;  4KUM A;  2HKX A;  3C18 A;  1HKS A;  1G3T A;  4JBA A;  4P5O A;  5BMZ A;  2GQQ A;  5ED4 A;  2ISY A;  2ACJ A;  1PP8 F;  1LVA A;  1FP2 A;  3JW4 A;  1P4A A;  2F5F A;  1DPR A;  3FMQ A;  4LFU A;  2XAQ A;  2DI3 A;  1J9I A;  4NB5 A;  3BOQ A;  5LGN A;  5A2Q Z;  3COA C;  1S8N A;  3TOB A;  3F6V A;  3GEZ A;  2EFW A;  3I5U A;  5E8G A;  1EH8 A;  4KT5 C;  4G6D A;  3KP4 A;  3LQQ A;  4CXF A;  2XVC A;  4A5N A;  1JXS A;  3GXO A;  2IJL A;  1J59 A;  3MZY A;  2V79 A;  5CVI A;  2MA3 A;  4I09 A;  2EWN A;  2A61 A;  2MLG A;  3BJ6 A;  1ULY A;  2HQR A;  1DDN A;  1Z1D A;  4IF4 A;  1RUN A;  2OBP A;  2MBF A;  2P4W A;  5FD5 A;  2DPU A;  2PN6 A;  4JK1 X;  4LK0 F;  2Z9O A;  2GZW A;  3VOE A;  1FP1 D;  3KEO A;  2IA2 A;  3RI4 A;  1HW1 A;  3VOD A;  1R1V A;  3JSO A;  1Q1H A;  3I54 A;  1XGO A;  2D1H A;  1YLF A;  4KN7 X;  1C0W A;  5DCF A;  1XSX A;  3ML6 A;  4Y17 A;  2F5C A;  1H9T A;  4CIC A;  4QLC U;  3RKX A;  5D4S A;  3C1D A;  3RKY A;  4ETS A;  1MGT A;  3ELK A;  2G7H A;  2LF8 A;  2QLZ A;  2HDC A;  2K7L A;  3B02 A;  1LEB A;  5L3F A;  3J81 Z;  5D6F A;  3QPH A;  5FFX A;  4OIP F;  5AON A;  1BC8 C;  2L3D A;  3FWE A;  5LLQ A;  5KK1 A;  3GFJ A;  3F8F A;  4MGR A;  1JHF A;  3MAJ A;  2YR2 A;  2Y48 A;  5LEK A;  2W57 A;  1MDM A;  2JZY A;  3AAF A;  3KP2 A;  4JQF A;  4U88 A;  3M8E A;  2MD5 A;  3V8K A;  1KQ8 A;  4MTE A;  3IL2 A;  4A6E A;  3E6M A;  2FXA A;  3LWF A;  4N0B A;  3TQN A;  3MCZ A;  1GVJ A;  3KEQ A;  4OU0 A;  2ZCW A;  3R6S A;  3K9T A;  1QQI A;  4G94 A;  4Q48 A;  1MKM A;  1FY7 A;  1QBJ A;  3HIF A;  5JHU A;  4QWQ A;  3KP6 A;  5EEH A;  1MD0 A;  5L3E A;  2HWV A;  2A3S A;  4AD9 A;  4PGH A;  5H6R A;  2ZKZ A;  3IRQ A;  2EJR A;  1F1Z A;  2KIM A;  2LDU A;  3QU6 A;  1LJ9 A;  1U8R A;  1F4K A;  1OYI A;  1B9M A;  3JAM K;  4HLY A;  3LFK A;  3W6J B;  1UCR A;  2UXN A;  5HVQ C;  3WTW C;  4MNU A;  1WSU A;  4R79 A;  5D6E A;  5LRS A;  4IHT A;  1ZAR A;  3BP8 A;  4Y13 A;  3D5L A;  5JVT A;  2L02 A;  2HYG D;  2H94 A;  2VOP A;  1IN8 A;  2YX4 A;  3R4K A;  1HST A;  3H3U A;  4KIC A;  2ZNZ A;  3C3W A;  3GFL A;  1XN7 A;  3FMS A;  2QBY A;  4WXH A;  2LSO A;  3K1N A;  4MQV A;  1I5Z A;  5HDG A;  5KVR A;  1YO5 C;  3KFW X;  3I59 B;  1XGN A;  1AOY A;  3PQJ A;  1MZB A;  3TDU C;  4ON0 A;  2VN2 A;  2L01 A;  3GYH X;  4A6D A;  4FX4 A;  5DD8 A;  2ZO4 A;  3J80 K;  1SMT A;  5L3D A;  2VBZ A;  1XSV A;  3R0A A;  1B59 A;  2OAZ A;  4KIF A;  3TDZ C;  1R7J A;  1G6N A;  2XAF A;  4UNO A;  2EA2 A;  1ZH5 A;  3NRV A;  3B73 A;  4MQ9 F;  3R0J A;  2CO5 A;  1KU2 A;  4ENN A;  5LEJ A;  5ILU A;  1W5S A;  1FZP B;  4O3M A;  1OPC A;  4ZYE A;  2XAJ A;  4P9F A;  2VON A;  1MJ9 A;  4LJZ F;  1J7K A;  1YFH A;  4GO1 A;  5D5W B;  1TQM A;  5D5X B;  1B1B A;  1OKR A;  2A6H F;  4A0Z A;  2RN7 A;  1U3E M;  1I27 A;  2HFH A;  4M74 A;  1IN6 A;  1G3S A;  3HYI A;  1O3Q A;  4EMS A;  1SFE A;  3GZ5 A;  4EJV A;  2FBH A;  2GIV A;  2ZNY A;  3R60 A;  2DQL A;  3JTG A;  1GHC A;  4HLX A;  3GF2 A;  1R58 A;  1XGM A;  5IT9 Z;  3ZPL A;  1IXC A;  3HTS B;  1P92 A;  1ZG3 A;  4LGW A;  4FX0 A;  2FOK A;  3IC7 A;  1YTY A;  4HX4 A;  4HQE A;  1BIB A;  4RB3 C;  1OR7 A;  3C7J A;  5HDK A;  4MTD A;  5BS6 A;  1QGP A;  3IKV A;  2Y75 A;  2P5V A;  1TNT A;  2NS0 A;  2HQN A;  5F1R A;  4OMY A;  3G73 A;  2A69 F;  5E1X A;  4MEX F;  1ONV A;  1RI7 A;  3E5X A;  3CDH A;  2WV0 A;  3TO9 A;  3VB2 A;  1RUO A;  2B0L A;  1W7P A;  3EET A;  2XGX A;  4XBF A;  5CVU A;  1QPM A;  1BOA A;  3KP3 A;  5BPD A;  2NNN A;  3N97 A;  2PQ8 A;  4HOB A;  1W7P D;  3BPV A;  5HOO A;  5H6Q A;  3IKT A;  2OA4 A;  3KP5 A;  2DO7 A;  1T6S A;  4BHP A;  4CZZ A;  1LQ1 A;  1RZ4 A;  3MEX A;  1JE8 A;  1GXQ A;  2QEN A;  1IAW A;  3L7W A;  4RB2 C;  1R36 A;  4M73 A;  2UXX A;  2EV0 A;  1FLI A;  3CTA A;  5D4R A;  1X3U A;  1YW8 A;  1W5T A;  2L4A A;  1ZLJ A;  1D8K A;  4RB0 A;  3F3X A;  1P4X A;  5FLX K;  2ZME B;  3KLO A;  3RPQ A;  4H0E A;  4L9J A;  2A68 F;  2GXG A;  2A5Y B;  2CW0 F;  1ZYR F;  2RDP A;  3RYP A;  3SZP A;  3F23 A;  2J5P A;  4HX8 A;  5LBQ A;  3BWG A;  4UV9 A;  3SZT A;  3BPX A;  5IT3 A;  1S7O A;  2HTS A;  3MFK A;  5CVJ A;  3WTV C;  1T0F A;  1S7A A;  3P7N A;  2QYO A;  1XGS A;  1S3J A;  2HS5 A;  4RGR A;  2QZ8 A;  4M71 A;  4OIQ F;  3BDD A;  1QO0 D;  2P6T A;  1K78 A;  4UUV A;  5FO5 A;  1ZAO A;  1D8J A;  1R22 A;  2OZ6 A;  2RVC A;  1ZLK A;  1TNS A;  2FE3 A;  3QU3 A;  4BHB A;  4ZH4 F;  4PGG A;  1XD7 A;  3WE2 A;  3E5U A;  3PFI A;  2OQR A;  4A12 A;  4A5M A;  3F72 A;  1U78 A;  1H0M A;  2OU2 A;  2ETH A;  2EB7 A;  2RV8 A;  2X0L A;  3QPT A;  2Z33 A;  4ENM A;  3TO7 A;  2XRN A;  1KQ0 A;  1R00 A;  3K69 A;  3KZZ A;  1HXD A;  1LB2 A;  2P5L C;  2H6B A;  4XLN F;  2E7X A;  2Y0M A;  3EUH A;  3I58 A;  1I6X A;  2EFQ A;  4A2U A;  1E17 A;  1SD6 A;  2DW4 A;  3LAJ A;  4RAY A;  1V4R A;  1U5T B;  3LA7 A;  1QZZ A;  1P6R A;  5D8L B;  1J75 A;  1Y0U A;  4NQW A;  5BQT A;  1WQ2 A;  1DP7 P;  2OQG A;  5E1Z B;  3CUQ B;  4ENK A;  3QOP A;  4KDP A;  2O3F A;  1IW7 F;  1Z91 A;  2XUB A;  3CO7 C;  2IVM A;  3TOA A;  4CDG A;  3FXU A;  1ZRE A;  2EV6 A;  1IF1 A;  4PCQ A;  1IN7 A;  3L9F A;  2RKH A;  3R61 A;  1KU7 A;  2Q0O A;  4I0B A;  1IN5 A;  1OMI A;  2JPC A;  4OIN F;  4S04 A;  3ECH A;  2NAZ A;  2XKO A;  2GA1 A;  3JTH A;  4LG0 B;  2QVO A;  3RDI A;  1BC7 C;  2WC2 A;  3D0S A;  1U5T A;  3T8T A;  3I4P A;  4AIK A;  3WU0 A;  2MLK A;  4S05 A;  3LA2 A;  4B8X A;  4KNY A;  2CGP A;  1R1U A;  2YU3 A;  3FM5 A;  1MJB A;  2P5K A;  4FT8 A;  5LRR A;  2ZBK A;  2E1C A;  5CVR A;  4LLL A;  2DK5 A;  1USS A;  4HF0 A;  3ZP5 A;  3BY6 A;  5L3C A;  3LA3 A;  4ESJ A;  2QUF A;  2H27 A;  2PI0 A;  4U0V A;  4ESF A;  4RGX A;  1UFM A;  6PAX A;  4FHT A;  1ZGA A;  1FWZ A;  2VT2 A;  5DYM A;  3O3K A;  1S29 A;  3G3Z A;  4F7Z A;  1SD7 A;  4ZYD A;  2FMY A;  2V9V A;  3SFZ A;  2GA2 A;  2STW A;  4I01 A;  3ZMZ A;  3RPU A;  1HW5 A;  4G9Y A;  1LDK B;  1XMA A;  5E20 A;  4WXC A;  4HBL A;  1VTN C;  2MH2 A;  1ON1 A;  3DEU A;  4M6Y A;  3HHG A;  3GZ6 A;  2R7D A;  4EVI A;  3TGN A;  3E97 A;  3LQR A;  4GYI A;  3HRT A;  3H3Z A;  1KGS A;  2V1X A;  1BIA A;  1CF7 B;  1MJA A;  2PBI A;  3FX3 A;  1T38 A;  2UWM A;  3WTX C;  3NQO A;  1FBQ A;  3BJA A;  4OMZ A;  4AIJ A;  3GW2 A;  1B6A A;  3SXY A;  1O3S A;  1WKM A;  4WF2 A;  4KMF A;  1HBX G;  3RYR A;  3BJO A;  1U6G A;  5DEQ A;  1ZRC A;  5LHG A;  1KQ9 A;  1TBX A;  2MH9 A;  1ZRD A;  1ZGJ A;  2ADU A;  1ZRF A;  3I71 A;  5DUK A;  2VE9 A;  3WU1 B;  4YFK F;  2HEO A;  4DNC A;  3HHH A;  4Q4Z F;  1BI0 A;  3Q9V A;  3V7C A;  3DPT A;  4GCV A;  4WK8 F;  2NNY A;  3L2C A;  3L00 A;  4IRI A;  4M72 A;  2Z3Y A;  4KFC A;  4G7H F;  3GX4 X;  5JR3 A;  4EJT A;  5A2Q K;  5HS7 A;  1T98 A;  5DCM B;  3T5X A;  2FML A;  3WOD F;  1SD4 A;  4LB5 A;  3HUG A;  3K1P A;  4HX7 A;  3HOS A;  5LGT A;  4ENJ A;  1JGS A;  4HDU A;  1KA8 A;  1B9N A;  4ASN A;  3MQ0 A;  4IJA A;  1FBU A;  3NEU A;  2K4J A;  2D45 A;  4GYG A;  4EJO A;  4ZYH A;  4BNC A;  2IT0 A;  4A0Y A;  1HW2 A;  3WTZ A;  4RB1 A;  3HOT A;  4Z2Y A;  5K5R A;  3W6K B;  1ZG5 A;  2FQ3 A;  4EM0 B;  4EM2 A;  4EJU A;  3Q9S A;  5L3G A;  2J5O A;  4B09 A;  2QWW A;  3CLO A;  5DD4 A;  4UV8 A;  2Q2E A;  2COM A;  4A0X A;  4PDK A;  4KIB A;  4G7O F;  2CG4 A;  2W85 A;  4ZYG A;  3E6B A;  4YG2 F;  2A6E F;  3DP7 A;  1SFX A;  2DTR A;  1YQA A;  2A07 F;  4BYY A;  3I59 A;  4HV6 A;  2JTV A;  3EDP A;  3DKW A;  3P9I A;  2ZFW A;  2R7F A;  1HKQ A;  2IPQ X;  1FYM A;  4LLG F;  1YYV A;  1ON2 A;  2VBY A;  2O8X A;  3DPL C;  2STT A;  2F5D A;  1XB4 A;  4I2O A;  2VE8 A;  3T1B A;  1D5V A;  3J81 K;  2BBY A;  3WGH A;  5D8K B;  3K0L A;  1PP7 U;  4UHT A;  4OIR F;  2FF4 A;  4I98 B;  3ABU A;  1BJA A;  3QP5 A;  2O03 A;  4L0Y B;  3U2R A;  5LHI A;  3HSR A;  4XSZ F;  3I0T A;  1DPU A;  2G9W A;  3HSF A;  2E1N A;  1G3W A;  3V7R A;  4HV5 A;  3I64 A;  2K02 A;  3V7S A;  4YFN F;  3F6O A;  4LK1 F;  2FBK A;  1I1S A;  2ESH A;  3MWM A;  2GXB A;  1U5T C;  2R3S A;  4IRG A;  3ROU A;  4IHS A;  5K1Y A;  2DAO A;  1RNL A;  2WTE A;  3DQV C;  4DQ2 A;  2KRF A;  4EQQ A;  4UXN A;  2FNP A;  2H6C A;  4G8X A;  2PLY A;  5HLH A;  5E18 F;  1XDU A;  3GLX A;  2QQ9 A;  3E6D A;  1O7L A;  1KU3 A;  2DT5 A;  1SMY F;  2Q8K A;  2GAU A;  2JRT A;  5D5U B;  5ICF A;  1LDD A;  2O0Y A;  2NYX A;  3RTR A;  1GXP A;  1QNT A;  2DQR A;  3F8B A;  1FX7 A;  4EGY A;  3EYY A;  4HDV A;  2M30 A;  2PFB A;  4OIO F;  1UHM A;  3FXR A;  2CYY A;  4BH9 A;  2G7U A;  5J8F A;  3J7A O;  2VBW A;  1REP C;  1FSE A;  2BYV E;  3FF5 A;  4MHG A;  4U0Y A;  3HRM A;  4YIF A;  2M1B A;  1Z7U A;  4P9U A;  3ZMU A;  3GFI A;  4O6J A;  3M9A A;  2CQK A;  4I7H A;  4BAY A;  2F5E A;  4EJW A;  3K2Z A;  2XV4 S;  3CUO A;  4YII A;  2VBX A;  2EFN A;  3F8C A;  1IRF A;  1DUX C;  2XAG A;  3SQN A;  5ICE A;  2EA4 A;  1HSJ A;  1ODD A;  3S2W A;  3ZMS A;  4UVC A;  3WGG A;  3KZY A;  5F64 A;  4BXU A;  2P7V B;  1T2K A;  1J2X A;  1WWX A;  1UB9 A;  1O7F A;  4G7Z F;  5FD6 A;  3IWF A;  1K79 A;  2ZME A;  5J8C A;  1Z6T A;  5TRD A;  2ESN A;  5BOX A;  2EFP A;  1UHW A;  1V3F A;  3I53 A;  1PUE E;  2NRA C;  2O61 A;  1L3L A;  3JAM Z;  1TLH B;  4LD5 A;  3U1D A;  2FNA A;  4BQA A;  1TQP A;  5F6F A;  3WTU C;  4HZF A;  2KIF A;  3GO5 A;  4CHU A;  2QQA A;  1G4D A;  3WGI A;  4HAM A;  1XCB A;  3ZMV A;  1SFU A;  2DBB A;  1KYW A;  2RNJ A;  2EK5 A;  3KCC A;  2O6G E;  5H20 A;  4N9H A;  3WTT C;  5FGM A;  4R1H A;  3ULQ B;  5IT9 K;  3LAP A;  4GXO A;  5HDN A;  2FEZ A;  2IRF G;  2HTJ A;  1AWC A;  2DK8 A;  1XMK A;  2WWY A;  3F21 A;  4RGS A;  2LNB A;  5FFZ A;  2VOO A;  1T39 A;  1O57 A;  4O5V A;  4RS8 A;  4CGZ A;  1FPQ A;  1B4A A;  1BI3 A;  1ZG1 A;  1EV7 A;  1W4M A;  2LF7 A;  3J80 Z;  1SD5 A;  1J5Y A;  4AVP A;  5CJ9 A;  2GWR A;  3WTS C;  3IWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...