3ECOA

Crystal structure of mepr, a transcription regulator of the staphylococcus aureus multidrug efflux pump mepa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
137
structure length
135
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title Structural and biochemical characterization of MepR, a multidrug binding transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 51
structure length 135
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ecoA00
2MH9A 3WGGA 3HOSA 2A07F 2VONA 3QPTA 4MNUA 2KJBA 2DI3A 4BH9A 3M8EA 3RJPA 2M87A 3R0JA 5L3FA 1R58A 3C18A 5IT3A 1KQ0A 1TQMA 3SFZA 4EJOA 3VB2A 1I5ZA 2VBXA 5DCMA 4Q4ZF 5BS6A 2W24A 2P5VA 2D1VA 2UWMA 3ZMSA 2P7CB 3BOQA 4KICA 4HX7A 1HW1A 5LGUA 2F2EA 3MCZA 4JK1X 1PDNC 2A69F 1OPCA 1F1ZA 3CLOA 4PDKA 5ILUA 2IA1A 1QPMA 1REPC 3U2RA 3I5UA 1BOAA 2G7HA 4AVPA 1MJBA 5D5VB 2VE8A 4MHGA 4H0EA 1FX7A 4LFUA 3I0TA 4LLNA 1UHMA 1USTA 4K2EA 4N9IA 1ZG1A 3Q9VA 4ENNA 4RGRA 4HF1A 3MWMA 1ZHFA 1U6GA 3F22A 3P7NA 1B4AA 3O6BB 4WXHA 4A5NA 5JI6A 5HDGA 1MDMB 4OMZA 5K5RA 5L3BA 3HUGA 4BXUA 4EJVA 1JHFA 3C1DA 1O3RA 3ULQB 2JZYA 1TQPA 1LEBA 3DF8A 1KYWA 4EGZA 2CGPA 3B73A 1L0OC 3K69A 1K79A 4I01A 3VODA 3ZMDA 2VT2A 4ZYHA 4U7BA 1W5SA 2Q2EA 1P4WA 1T0FA 3H3UA 3CUQA 1W7PB 1MKMA 4RAYA 4LK0F 5FO5A 3F8CA 3DQVC 3F8BA 3KP6A 1UCRA 5K1YA 5AIQA 3CJNA 4HX4A 2HKXA 4AWXB 4ZH4F 1IF1A 3GO5A 2QQAA 3GVAA 2XV4S 1J2XA 4P9UA 1ZGAA 2EA4A 2FNPA 2A61A 2XHKA 3RYPA 1B59A 1B9NA 1IN8A 3ML6A 4KN7X 1DPUA 2GA1A 4N9HA 4I09A 3Q5FA 5E17F 4XLNF 5E1XA 2Y48A 3U1DA 3SHFA 2VT3A 1IAWA 5J8CA 5E18F 4E70A 3I58A 3ZMTA 1YS7A 2E7XA 1G4DA 1YIOA 4D0PA 1A04A 1KU3A 2OD5A 1O3QA 4IPAA 3T1BA 1KGSA 3F8MA 1MJAA 4IVNA 1FSHA 3FMQA 4UUVA 1LVAA 4BHPA 3KZZA 2VC1A 2PEXA 5FFZA 2L4AA 3CUOA 4IHTA 4UHTA 1U5TC 1ZH5A 1XGSA 1IXCA 4Q47A 3L2CA 2DU9A 2LF7A 1K78A 5LRRA 5KVRA 5DD4A 2ZCWA 3ZN1A 2VBZA 2ACJA 2BEOA 1FYLA 5A2QZ 2QLZA 2LDUA 4CICA 1SMTA 2KIUA 3C7JA 4A5MA 4BNCA 4HZFA 3DFGA 1KU2A 2F5DA 3GX4X 1YG2A 1ZLKA 1XB4A 5EEHA 3P9CA 4HAMA 4WK8F 4P5OA 1SD5A 2CG4A 4GGGA 1ZG5A 3KZYA 5D6EA 5TRDA 1T39A 1FLIA 4AIJA 4IRHA 2K86A 3G3ZA 4L0YB 2W57A 3RYRA 3QP6A 3RKWA 1YFHA 4LD5A 2YX7A 1F9NA 3O2PE 2K4JA 1HW2A 3I71A 1OYIA 1HKSA 2HZTA 1FZPB 4S05A 5FD6A 1PP7U 3LWFA 4BAYA 1S7OA 2IPQX 2VOPA 5F6FA 2E1CA 4KIFA 4HV6A 4DQ2A 1BI1A 1K7AA 1XGMA 4FHTA 4HYEA 1AOYA 1ZAOA 5BMZA 4KIGA 3BROA 1EH7A 3JAMK 2XRNA 2OU2A 2D2WA 3LA2A 4KNYA 2JRTA 5D6FA 4KIBA 5DCFA 4M71A 1FBQA 4M72A 2P6SA 4G7ZF 2QM3A 3F3XA 4GO1A 1DP7P 4KT5C 1RI7A 3KP4A 3BY6A 1ZRFA 2MLKA 1QO0D 3R0AA 4ESBA 3RPQA 3PQKA 1SFXA 3TDZC 1IW7F 1UB9A 4F7ZA 2XROA 2XAJA 3FXUA 2QQBA 3WTVC 1G6NA 5ILVA 5CYVA 1XSDA 2HKOA 1U2WA 1R22A 2ZMEB 4B09A 2O0YA 2KIFA 1J9IA 2EB7A 2MC3A 3NEUA 3DXJF 2RC4A 3IL2A 1Y0UA 2D45A 2X0LA 2ZBKA 3QRFF 4OOIA 2RGVA 1D8JA 1HW5A 2LKPA 2IJLA 1R23A 4O5VA 2KKOA 4ENKA 2OZ6A 2M45A 2HQNA 4ZZDA 1IUYA 3MEXA 3Q9SA 1YW7A 3LAJA 1RIOH 3BJ6A 4EVIA 3V8LA 5TJJA 2PLYA 1T6SA 1HQCA 2GIVA 4KYWA 4HOBA 2Y75A 3F8NA 3HIFA 4NQWA 5ICCA 2EV6A 4ETSA 3K9TA 2EFWA 2QBYB 2HQRA 1JE8A 5DUKA 3I59A 2HYGD 4P55A 5LGNA 4G8XA 4MTDA 1FSEA 5D5WB 3WE3A 1P2FA 1IRGA 3BPXA 2AS5F 2EK5A 1XMAA 3JTHA 1Z05A 2YU3A 5HS8A 3GZ6A 2PMHA 5BOXA 4LG0A 2HDCA 4LLLA 2RNJA 2WC2A 4EM1A 3ELKA 1KQ8A 2PMUA 2VE9A 4Q48A 1RZ4A 4RB3C 2VODA 1DUXC 2HFHA 3DV8A 5E1WA 3NRVA 3J80K 3E6DA 2GXGA 4HF2A 3RKXA 2DK5A 3IHUA 3MZHA 1OYWA 4RB0A 3WTYC 4I0BA 4S04A 1UFMA 4EJUA 5ICFA 3T0YA 3JTGA 1F4KA 4LK1F 1OMIA 1R36A 1XMKA 2CQKA 1U78A 1E17A 1Z6RA 1TW2A 2XASA 3BWGA 2R3SA 2VC0A 2LSOA 3FX3A 2KIMA 5DUIA 4FX0A 1KU9A 2IT0A 2P7VB 5ED4A 5LGTA 4XSZF 3M7GA 2QENA 1S29A 5JHUA 1I6XA 2XVCA 2IVMA 4RGSA 1ODDA 2EFPA 1D8KA 3BJAA 4G94A 3ZMVA 3ABTA 1P4XA 3IRQA 4EM2A 2C6YA 4LB5A 4ESFA 2LF8A 3VFZA 4YFNF 5ICGA 2FXAA 3E6MA 1FP2A 1R7JA 4A0ZA 4NB5A 4BHBA 4JBAA 4R1HA 3E5QA 1XCBA 1S6LA 3RPUA 2XAFA 3B02A 3SZTA 3WTUC 1R1UA 1KU7A 3EUHA 3W6KB 3GFIA 1XN7A 3V7CA 1PUEE 1XGOA 2G7UA 2A68F 4Z2YA 4Q5SF 3E6CC 1Q1HA 3GZ5A 3OV8A 2KRFA 2HS5A 2H6CA 2JPCA 3TOBA 2D1HA 2GQQA 2FBIA 3RTRA 5LRSA 3E6BA 2BV6A 2QVOA 4BQAA 1XDSA 1TLHB 4JQFA 2A3SA 5D4SA 5DEQA 4ZYDA 2JT1A 3IWZA 4G6DA 2R7FA 4U0YA 1WWXA 4L9JA 2MA3A 5LEJA 2FQ3A 2ZJ2A 1R1TA 5CVVA 2A6EF 4G7OF 3DPLC 1WI9A 3T8RA 3P9IA 2FNAA 1FY7A 4WX9A 1WRJA 2P5KA 5FB2A 1ZRCA 4R8HA 4M9ZA 3ZMZA 1PP8F 5HDKA 1P4AA 2FEZA 4AIKA 1U5TB 5AONA 5IT9Z 1CF7A 3ROUA 1IRFA 1Z1DA 3CO7C 2HOEA 4UXNA 2ETHA 2BGCA 4I02A 4R79A 2STTA 5LBQA 4UV8A 2A6HF 4QWQA 5D8KB 1XD7A 5LEKA 3E3VA 1FNNA 3CUQC 3ECOA 1F5TA 4KUMA 4CYDA 4M9XA 2V1DA 4XBFA 2HTSA 3F6VA 2FF4A 4MEYF 4OIOF 2MH2A 2IRFG 4A6EA 3HRUA 2CWEA 4PGHA 2W25A 2O3FA 4YIFA 1DDNA 2O61A 4EJTA 1STZA 5ERIA 5L3CA 3KLOA 4HX8A 5CLSA 2EWNA 3GYHX 2CW0F 5L3GA 2STWA 1I1SA 2JPBA 2QQ9A 4IJAA 2ESHA 2PG4A 2Q8KA 3L9FA 5F1RA 5HDNA 2FMLA 2M8EA 1Z91A 1G3WA 4I0AA 1K78B 1YW8A 3I54A 3F6OA 4YG2F 5LHIA 1YYVA 3F8FA 1CGPA 1SMYF 2X4HA 2DO7A 2J5OA 3FXRA 4FT8A 1MZBA 4RGXA 3GW2A 4MQ9F 2QUFA 1J59A 1Z7UA 2R7DA 3ZPLA 3REOA 3K1NA 3HSFA 2K4BA 5HLIA 1ON2A 5HLGA 4GYGA 1V4RA 3BZ6A 4YFXF 4AIHA 2Z99A 4OU0A 1IZ1A 1FWZA 2NYXA 2ZNYA 4HW0A 2PI0A 4M9SA 3ISPA 2ISYA 4Y17A 3WU0A 4YIIA 3GWZA 1D5VA 3J80Z 1ON1A 5E8IA 4HDVA 3CTAA 3KP2A 3FM5A 3HOTA 3I4PA 2NNNA 4ON0A 5D4RA 5L3EA 1L3LA 1FC3A 3QU3A 2QYOA 2ISZA 4I98B 3U9GA 4CHUA 3QAHA 3WTZA 4P96A 2ESNA 2H09A 3LFKA 4G6QA 3S2WA 2RQPA 2Y0MA 5HLHA 1HKTA 2HGCA 3R60A 5D5UB 1BJAA 3NQOA 1T98A 1HSTA 3TKYA 2IW5A 1BIAA 4HV5A 2AXLA 3ECHA 4A0YA 2LNBA 5H6QA 4HLXA 3ZN0A 3VOEA 5LHGA 3FXQA 4EQQA 2HTJA 4OIQF 4I2OA 1KA8A 1MGTA 4LB6B 1YO5C 3F72A 4KA4A 1ZARA 2B0LA 3TOAA 4PGGA 4EMSA 1IN4A 2IA2A 3V8JA 2ZMEA 2XAGA 2HYFA 2NS0A 1XDUA 1J75A 1OYYA 2P8TA 1FYKA 5FGMA 3TO9A 2FBHA 1FT9A 3L09A 2WWYA 4QLCU 2IA0A 4M6YA 2EV5A 4CZZA 1MJ9A 2OZUA 5K5QA 1BBYA 2Q0OA 2HEOA 1OR7A 1R5GA 2E1NA 1R5HA 2K27A 4U88A 2F5EA 5DDGA 2P4WA 4FX4A 4A6DA 4G7HF 5E20A 1QQIA 1U8RA 5HVQC 2YSRA 1HBXG 3FWEA 5E1ZB 4IF4A 3RKYA 4WCGA 1GHCA 4L9TA 2PQ8A 1J0RA 5AIPA 2EJRA 4NHJA 4IRGA 2OA4A 3WGHA 5EEGA 3GFMA 3ZQ7A 2PN6A 3HHGA 3WTXC 1W7PD 2EA2A 4OMYA 1X3UA 1BI2A 4U0VA 5A2QK 3FF5A 1O3TA 1IN7A 2OQGA 3N4MA 1J7KA 3PQJA 5CVUA 1ZGJA 3T5XA 2VBYA 5DV5A 4AD9A 3QPHA 2GZWA 5HS9A 3IKTA 3WODF 3V4GA 4UNOA 4RB1A 4WXDA 3N97A 2DPDA 1FOKA 4HDUA 3GEZA 3GLXA 2FBKA 2L02A 5FD5A 1E2XA 2DAOA 2J5PA 1I27A 4RS8A 1I1GA 2ZNZA 2ZO4A 4L18B 2L4MA 2RDPA 2O8XA 3DP7A 1O7FA 3GFJA 3WE2A 4GCVA 3ZP5A 3LQRA 2XAQA 4PZJA 2W85A 2NRAC 2P5LC 1QGPA 2JSCA 4IHSA 3WG9A 3GUDA 3O3KA 3IC7A 5JR3A 3KP7A 6PAXA 2L54A 3QP5A 3JSPA 3JW4A 1SD6A 3EQLF 4HA8A 4P9FA 3FHZA 2DBBA 1LQ1A 1J5YA 1B9MA 3EETA 4HQEA 1TNTA 2RVCA 1IXSB 3GFLA 3TGNA 2FMYA 2VBWA 2P6TA 5HOOA 4OINF 3HRMA 3WTSC 2PJPA 2RV8A 3TQNA 1TBXA 2DTRA 3DEUA 1LJ9A 4WXCA 2RN7A 4B8XA 4Y13A 5DCMB 1BM9A 1K6OA 2K02A 2H94A 1BC8C 4M6XA 4L0ZB 3EYYA 2NNYA 1MD0A 1HXDA 5DYMA 4RB2C 1GXQA 4EV0A 1UHWA 2OQRA 1SD4A 4LJZF 1BI0A 3EDPA 3V7RA 2Z3YA 2QZ8A 3WGIA 4O6JA 3K0LA 1C0WA 2WV0A 1B1BA 3C3WA 1BIBA 1WKMA 3SQNA 2ZXJA 1HKQA 2DQRA 4KMFA 1TTYA 3IKVA 1U3EM 1MDMA 2DK8A 1IN6A 1FBSA 2H27A 1S3JA 2OBPA 1FBUA 2UZKA 5DD8A 2O03A 3KCCA 3TO6A 5H20A 3BPVA 3R6SA 1GXPA 2H6BA 1VTNC 3RIRA 1XSXA 3D5LA 4LMYA 3BP8A 2EFQA 2V79A 5CVJA 3HSEA 4LLGF 1O7LA 4UVAA 3V7SA 4A12A 3F23A 1JGSA 1RUNA 1LB2A 1W7PA 1FP1D 5LHHA 3GF2A 2XGXA 2A5YB 3LA7A 3JAMZ 3KLNA 3J81K 4M74A 1YW9A 2MBFA 4L9VA 4UV9A 2V9VA 4LGWA 5FLXK 3QU6A 1RNLA 2FSWA 4U7DA 1ZN2A 5KK1A 2NAZA 1D3YA 2DQLA 1W4MA 4O3MA 2L01A 2XUBA 3CUQB 3IRRA 2IP2A 4L9NA 4PCQA 3CO6C 2XIGA 3FMRA 1U5TA 3DPTA 4CDGA 1ZYRF 4MTEA 1BC7C 3WTWC 2E7WA 4KN4X 2JTVA 4M73A 3J7AO 3F21A 2FOKA 5D5XB 5BQTA 3FMSA 2MD5A 5ILSA 1YTYA 1BN5A 1H9GA 4GXOA 1FYMA 4ENJA 3TDUC 2KJCA 3BJOA 3EYIA 3M8FA 4ESJA 4YFKF 1TQIA 2Z33A 4ENMA 2FU4A 1SD7A 4N0BA 1CF7B 1LDJA 1JXSA 2HR3A 1KQ9A 1BI3A 1HSJA 4HLYA 1EV7A 4MGRA 2M5WA 2PFBA 4ASNA 2ZKZA 3KP5A 3RDIA 3T8TA 3ERED 3MZYA 4MQVA 4KDPA 5E8GA 1ONVA 2EFNA 3MAJA 1NHAA 2UXNA 3HTSB 4HF0A 4OIRF 1YS6A 4RGUA 2YPRA 3I64A 3BDDA 3TO7A 3RI4A 1Z6TA 4DNCA 1LEAA 5J8FA 2GXBA 4EJWA 3DKWA 3L00A 4UVCA 1IN5A 1TNSA 3K1PA 1ZG3A 3LAPA 2TDXA 1EH6A 2DT5A 5CVRA 1WQ2A 4XRFA 2V6CA 2DW4A 2W84A 1H0MA 4UVBA 2V1UA 2OAZA 3PFIA 1H9TA 2V1XA 2DPUA 4Y15A 2FRHA 4L5JA 3HRTA 2UXXA 3HSRA 2K7LA 1S7AA 4HQMA 2YX4A 2BE5F 4G9YA 4EM0B 1XCVA 5K5OA 3E97A 1ZREA 2GAUA 4U0WA 1IXRC 2F5CA 2COMA 4ZYEA 5JFRA 2HWVA 3FM3A 4A0XA 3LQQA 3QOPA 2VXZA 1SFEA 2CYYA 2VN2A 1YLFA 2XKPA 1R1VA 2CSOA 5ICEA 1FPQA 3KETA 3WU1B 2Z9OA 3M1EA 1P6RA 3K1MA 2GWRA 2DLLA 3SZPA 4A2UA 2GA2A 1G3SA 1W5TA 1P92A 1XSVA 3HRSA 4L5IA 1T2KA 3R4KA 2FE3A 1LNWA 3OOPA 4KMUX 3ABUA 1QNTA 2FA5A 3KFWX 3HHHA 2QWWA 2Z5UA 3H3ZA 4CO8A 4RAZA 5JVTA 1Z9CA 1G3TA 1ZLJA 3KP3A 3JSOA 1S8NA 3MQ0A 3IWFA 2PBIA 2XKOA 2DFIA 3KEQA 3KEOA 1SFUA 2RKHA 1QZZA 5IT9K 1G3YA 1OKRA 2L3DA 5CJ9A 3E5XA 4IRIA 3SXYA 3D0SA 3R61A 4XSXF 4CXFA 3VEPA 3MFKA 2WTEA 1USSA 1GVJA 5L3DA 3WTTC 3E5UA 1DPRA 2M1BA 1O57A 3LSTA 3M9AA 1TW3A 2F5FA 4ZYGA 1LDKB 1O3SA 5F64A 3G73A 2ADUA 1AWCA 4IXAA 3L7WA 4EGYA 5J6XA 5FFXA 5D8LB 2G9WA 4XLPF 1V3FA 4BYYA 1SAXA 5LLQA 2QBYA 4KFCA 1YQAA 2VOOA 3J81Z 2EV0A 4GYIA 4MEXF 1RUOA 2BYVE 3AAFA 5FLXZ 3V8KA 5BPIA 4WF2A 2O6GE 3K2ZA 4ZZLA 5HS7A 3FZVA 3HYIA 2M30A 2EFOA 1T38A 1ULYA 4HBLA 4CGZA 2ZFWA 4I7HA 1QZYA 1B6AA 2XAHA 3ZMUA 1LDDA 1R00A 2ELHA 3W6JB 1XGNA 1QBJA 3P9KA 4TV7A 5BPDA 1JHHA 3CDHA 2YR2A 3I59B 3HTUA 2CFXA 1EH8A 2MLGA 3COAC 3I53A 2BBYA 4WWCA 3H92A 4BHCA 4OIPF 1KYZA 3LA3A 3KE2A 1WSUA 4LG0B 5H6RA 5CVIA 1ZRDA 2CO5A 3GXOA
chains in the Genus database with same CATH superfamily
2MH9A 3WGGA 2MD0A 3HOSA 2A07F 2IAIA 4V19K 1A6QA 2VONA 3QPTA 4MNUA 1TWFJ 2KJBA 3BT9A 4QPOA 3HOXJ 2DI3A 4BH9A 3M8EA 5F1JA 4B3XA 2KP6A 1D5YA 3RJPA 4C2MJ 3L2VA 2FUG2 2M87A 1OQYA 2LKSA 3R0JA 5L3FA 3HKZN 5HNHA 2LVSA 3S3OA 2F4OB 1R58A 1WJFA 3C18A 1KQ0A 3WHBA 5IT3A 1AA7A 1TQMA 3SFZA 4EJOA 3QYFA 3PL8A 3VB2A 4E7HA 1I5ZA 2VBXA 2DA6A 5DCMA 3BR1A 1BR2A 4Q4ZF 5BS6A 2AXTC 1HF0A 4RAFA 1VFCA 2IGOA 1ETOA 2B63J 2W24A 2P5VA 4C3JJ 4BBRJ 2D1VA 5J1YA 2UWMA 3ZMSA 2P7CB 3BOQA 2EIMH 4HX7A 4KICA 1HW1A 5B1AH 5LGUA 1LVKA 2ZB9A 2BY0A 2F2EA 3MCZA 2KPMA 1TT0A 4JK1X 4B4CA 1WH7A 1PDNC 4B43A 2A69F 4IX7A 3K6GA 1OPCA 4DIQA 2FX0A 1F1ZA 1JUMA 1W0UA 1ZK8A 1DP3A 3CLOA 4H4KC 2XF7A 4PDKA 5ILUA 4DGWB 2IA1A 1QPMA 3PUFA 1REPC 3U2RA 2W4SA 3MKYB 3OYGA 2COBA 3I5UA 1BOAA 3S17J 2E34A 2G7HA 4AVPA 1MJBA 5D5VB 2EZKA 2VE8A 4MHGA 4H0EA 1CQTA 3LSRA 1OCTC 1FX7A 4LFUA 4BKXA 2JQ7A 3I0TA 4LLNA 1FJLA 3SEZA 1UHMA 4LOCA 1USTA 4K2EA 1JUSA 4N9IA 3NAUA 1WJDA 2HXOA 1ZG1A 3Q9VA 4CUGA 4XORA 4ENNA 3GTOJ 1UG2A 4RGRA 2MW8A 1RR7A 1ERDA 4HF1A 2DMPA 3MWMA 1ZHFA 4F55A 1U6GA 2M0CA 2DFEA 2P0WA 1YRNB 1MW7A 3F22A 2BZTA 3P7NA 1B4AA 2RREA 3O6BB 2M7AA 4WXHA 4A5NA 5JI6A 2HYJA 3BG5A 3ZQHA 3FK6A 5HDGA 3VDXA 1MDMB 4E7IA 4OMZA 5K5RA 4BJ5C 5M5YJ 5L3BA 3HUGA 4UB6C 2DOEA 4BXUA 3OL3A 1S72I 3LL7A 1Y39A 3HDDA 2JWTA 1ORKA 2XPVA 4EJVA 5M5XJ 1JHFA 2HQ5A 2E35A 3C1DA 1O3RA 2M4GA 3ULQB 2GXAA 2JZYA 4BQQA 1TQPA 1U9NA 1LEBA 3DF8A 4NC8A 1KYWA 1V5GA 4EGZA 2CGPA 3B73A 1L0OC 2ZSHB 3OIPA 3GZNB 4B48A 5J4VA 3K69A 2UV1A 3AG2H 5DS9A 3VSLA 1TL8A 1PUFB 4I01A 3VODA 3ZMDA 1K79A 2K9LA 2VT2A 1BW6A 1D0XA 4MO7A 1X19A 4ZYHA 4U7BA 4P1WA 1W5SA 2YS9A 2Q2EA 1P4WA 1OISA 4BQNA 1T0FA 3H3UA 3CUQA 4XRSG 3G1LA 1W7PB 1Z3XA 1MNMC 1XS9A 1MKMA 3QODA 3OYFA 4RAYA 2MGQA 1PVEA 4UB8C 2CJJA 1Z21A 2Y9YA 1PJRA 3MKLA 3DPUA 2LD5A 4LK0F 5FO5A 3F8CA 3DQVC 3LSIA 3Q0UA 1VI0A 1E3OC 4BY7J 1AKHA 3F8BA 1IV6A 1P7IA 3KP6A 1UCRA 2VUMJ 4MFDA 1ENHA 5K1YA 1Q1VA 3BR3A 4PK4A 5AIQA 3CP8A 3CJNA 4HX4A 4NC6A 2HKXA 4AWXB 4ZH4F 3LOCA 1IF1A 3GO5A 2L9NA 2QQAA 1FOWA 1UELB 1OFCX 2Y31A 3GVAA 5IPAA 3IUOA 2XV4S 3I55I 1MMSA 5H2FC 1J2XA 1BOBA 1Z7LA 3HOYJ 4P9UA 1ZGAA 2EA4A 2HQAA 2LR8A 2FNPA 2A61A 2XHKA 4DJAA 4B44A 2DXIA 3RYPA 1B59A 3J7AY 1B9NA 1IN8A 3BZCA 3ML6A 4KN7X 1VQOI 1DPUA 1ZR2A 1QVUA 2GA1A 4GDFA 4N9HA 4CYCB 4I09A 2R7ZJ 3Q5FA 5E17F 2VKEA 4XLNF 5E1XA 4QSHA 2Y48A 2HDWA 3U1DA 2AQFA 3SHFA 2VT3A 2E5ZA 1IAWA 5J8CA 2JN6A 2RQQA 5E18F 4E70A 2R7WA 1UG0A 3HZJA 3I58A 2NVUB 3ZMTA 4D1QA 1YS7A 3AL0C 3WG7H 1H88C 3KIOA 2E7XA 1G4DA 2OF7A 1YIOA 2W00A 3CMYA 4D0PA 1A04A 3ABMH 1KU3A 2OD5A 5CPRB 4ZTJA 4IPAA 3T1BA 1KGSA 3F8MA 1MJAA 4IVNA 4D9JA 3FMQA 1O3QA 4UUVA 1FSHA 3AG3H 4M3BA 1LVAA 4LITA 4BHPA 3KZZA 2VC1A 5F0FA 3HG9A 5EEAA 2PEXA 3BR0A 4JYKA 2R7RA 5FFZA 2L4AA 3CUOA 4IHTA 4UHTA 1U5TC 2CRGA 3I56I 1ZH5A 5EYRA 1XGSA 1VQ9I 3L2RA 5TISC 3CCQI 3ABKH 1IXCA 3H0GJ 3NARA 4Q47A 1JKRC 3L2CA 2DU9A 2LY1A 2JA8J 2LF7A 1K78A 4BXXJ 5LRRA 4F92B 5KVRA 4G12A 5DD4A 1VQ8I 2ZCWA 3ZN1A 2VBZA 2ACJA 3K4CA 2BEOA 1FYLA 4CZCA 1JT0A 5A2QZ 4ITVA 2QLZA 2LDUA 3G1MA 4CICA 5C4JJ 1SMTA 2KIUA 3RCOA 3C7JA 2NVXJ 4IHWA 5K7FA 2QQ8A 2YUSA 2CUFA 4AYBA 4A5MA 3CCRI 4BDZA 4BNCA 4HZFA 3FXOA 3DFGA 1KU2A 3FBIB 2F5DA 3GX4X 1YG2A 1F43A 1ETKA 2JA2A 1ZLKA 1XB4A 2MSYA 2KIQA 3L2UA 5EEHA 3FKIJ 4XKVA 4IZZA 3P9CA 3GTGJ 4HAMA 4WK8F 4P5OA 1SD5A 2CG4A 3MN2A 4GGGA 2NVQJ 3OYLA 1V5FA 1Y1WJ 2KQRA 3KZYA 1ZG5A 5D6EA 4BBSJ 3CJQB 5TRDA 1T39A 1FLIA 3ESWB 4IOCF 4AIJA 4XLCA 2X85A 3WU2C 2E5NA 3PSFA 1QU3A 4XLEA 4IRHA 2K86A 3G3ZA 4L0YB 3S16J 2IS1A 2W57A 4W97A 2ZFUA 3QP6A 3RYRA 4AYBN 4QPQA 3RKWA 5GAHJ 1YFHA 3RQ4A 3CCYA 4LD5A 2YX7A 2L7MP 1F9NA 3O2PE 3LSHA 3JRDA 2K4JA 3DLAA 2V6EA 3CCMI 4X0GA 1SC7A 3BTCA 1HW2A 4QIWN 4HPQA 2CFOA 3I71A 5F04A 3UNGC 1OYIA 1HKSA 2LYCA 5IY5H 4YRVA 3J7ZI 3H5AA 5M3MJ 5C4XJ 2HZTA 1FZPB 1VQLI 4S05A 2ZC2A 1I50J 5FD6A 4XOPA 2BW3B 3LNQA 2W7NA 1JKOC 1PP7U 3LWFA 4BQOA 4BAYA 1S7OA 1R4NB 1Y6IA 2IPQX 2VOPA 1OJLA 2HPMA 5F6FA 3SZGA 2E1CA 5C44J 4IO9F 4KIFA 4C2UA 2NS7A 4HV6A 4DQ2A 1BI1A 4A69C 1QZEA 4CCMA 1K7AA 1XGMA 4FCYA 4FHTA 4HYEA 1WI3A 1AOYA 1ZAOA 5E3OA 1GV5A 5BMZA 1IG7A 4KIGA 5M5WJ 2WY7Q 2A05A 1MBJA 3BROA 2CV2A 3QWLA 1B8IB 1EH7A 3JAMK 2XRNA 2OU2A 2D2WA 3LA2A 5DM6F 4KNYA 3GLLA 2JRTA 1KZHA 5D6FA 4KIBA 1T8IA 1GT0C 2ZXHA 2VKDA 4RLFA 5DCFA 3ZQCA 2LKXA 4M71A 1FBQA 2VQGA 4M72A 2PX9A 2Q1ZB 2P6SA 5KAIC 1MMDA 3C2BA 5C3EJ 3GTKJ 1WJ5A 1T95A 3H3VK 2WY8Q 1R5ID 2EINH 4G7ZF 1IJWC 5IYCJ 1MNDA 1W5CC 4FASD 2QM3A 3F3XA 4GO1A 1DP7P 2LBFB 3M07A 3MKWB 2I5UA 1MBFA 4KT5C 2CMPA 3BZKA 1RI7A 1OCRH 2QSFX 4KITB 3KP4A 3BY6A 1ZRFA 1PYVA 3H36A 1FMVA 2MLKA 2ICWG 3OYCA 2XPWA 1QO0D 3GCMA 3HC7A 2F4IA 3R0AA 1UZCA 2ME6A 4ESBA 2OCEA 2F4MB 4GFBA 3RPQA 2VLAA 3CDIA 1D0ZA 3D5RC 3PQKA 1SFXA 3TDZC 4QTRA 1IW7F 1UB9A 4F7ZA 3S93A 2XROA 1QPIA 2XAJA 4HSTA 3FXUA 2QQBA 3WTVC 1XG1A 1G6NA 2WV1A 2XSJC 5ILVA 5CYVA 3NWSA 1XSDA 1Z3YA 1U2WA 2DMTA 2HKOA 1R22A 2VPLA 1ACIA 2ZMEB 4B09A 2PJRA 4CH7A 2KFDA 2O0YA 3S32A 2KIFA 1NG7A 1J9IA 2EB7A 4XLHA 2MC3A 3NEUA 4DZPA 4D7NA 2P81A 4JX4A 2EILH 3DXJF 2E1OA 2RC4A 4CCKA 3IL2A 3ZQLA 1Y0UA 2D45A 2HU9A 4AVZA 2X0LA 2ZBKA 3QRFF 1LKXA 4OOIA 2LOOA 1K4SA 2EH3A 1G8XA 2HNHA 2RGVA 3HOWJ 1HW5A 1D8JA 2LKPA 3RPUD 5E3NA 2IJLA 2R5YA 1R23A 4O5VA 1A36A 3TBIA 3TP3A 2KKOA 4ENKA 2OZ6A 2M45A 1ZELA 1SFKA 2EIJH 3J7YJ 2BHYA 3FXJA 2HQNA 4ZZDA 1IUYA 3MEXA 3Q9SA 1YW7A 1YJNI 1HCRA 3LAJA 1RIOH 3BJ6A 4HRIA 4EVIA 4IHYA 5JHFA 3V8LA 5TJJA 2PLYA 5JVGF 1T6SA 1HQCA 1B72A 4IOAF 4AU7A 2GIVA 1JUPA 2M4KA 4XM3A 2XB5A 4KYWA 2HPIA 4ZC3A 5F0HA 2VQHA 4HOBA 2LTPA 2Y75A 3F8NA 3MMYB 5J3LA 4HSRA 3HIFA 1ZR4A 2L9RA 4GRIA 2W82A 2DYSH 4NQWA 1VQMI 5ICCA 2EV6A 1VZ0A 3HPHA 4ETSA 3K9TA 2EFWA 2QBYB 2IEKA 4CA0A 3VYTB 2QGUA 2HQRA 1JE8A 4PSXA 3OYBA 4J01A 5DUKA 3I59A 2HYGD 3ZQQA 4P55A 5LGNA 1GUUA 4G8XA 4X6AJ 4MTDA 1FSEA 5D5WB 3H9JA 3WE3A 3AG4H 1P2FA 3DEWA 1KONA 1IRGA 4XLFA 3BPXA 3PIPF 2KT0A 1HLVA 2AS5F 3K4MA 2EK5A 1XMAA 4HNTA 3JTHA 1Z05A 5EG0A 2YU3A 5HS8A 3GZ6A 3L2WA 1LFPA 3JCUC 2PMHA 1RRJA 5BOXA 3KZIC 4LG0A 2HDCA 5B1BH 4BEHB 2JK3A 4MIMA 2MC4A 1LE8B 4LLLA 2RNJA 2WC2A 4EM1A 3BR6A 3TEDA 1JJ8C 3IAM2 1D1BA 2VXDA 3ELKA 1KQ8A 2PMUA 2VE9A 4Q48A 4XN0A 1RZ4A 1VQPI 3X2QH 4RB3C 2VODA 1DUXC 2HI3A 2HFHA 1R4MB 3DV8A 4BDYA 2GOMA 3SYTA 2VL8A 3OY9A 5E1WA 3NRVA 3J80K 3E6DA 2GXGA 2BHZA 4RAGA 2K9NA 2V26A 4I99C 4HF2A 1E3PA 2L9SA 1X3ZB 4FE4A 3RKXA 2DK5A 1O4XA 2LY9A 1GV2A 3IHUA 3MZHA 3M4OJ 1OYWA 4RB0A 3WTYC 5IP6A 4IHXA 4I0BA 4S04A 3GMEA 3LSMA 1UFMA 3U21A 1RKTA 3G4SI 4EJUA 2IGMA 5ICFA 3T0YA 2VIXA 3JTGA 1F4KA 3H5RA 2QA4I 1X1PA 1SVOA 1OMIA 1R36A 1XMKA 4LK1F 1WVRA 3KPHA 2CQKA 4E7KA 1NG6A 1U78A 1FOYA 2ZSIB 1E17A 1I3QJ 1Z6RA 2BY1A 1Y56A 2K40A 2X51A 1TW2A 3DWLE 2R7SA 2XASA 3BWGA 2R3SA 3ZQFA 1H89C 2VC0A 2LSOA 2VJ4A 4C9YA 3AFHA 3FX3A 2KIMA 4PJMA 5DUIA 2JVHA 2JA5J 1X1DA 4FX0A 1KU9A 2IT0A 3CP2A 2P7VB 2L0KA 2UUZA 2JMWA 1U9OA 5ED4A 5LGTA 4XSZF 3OYEA 1SEUA 5CQGA 3M7GA 4IQJA 2QENA 1S29A 3F9KA 1T08B 1WJEA 1BR4A 5JHUA 1DU6A 1FTZA 3CQZJ 1I6XA 2FQ4A 2XVCA 1UAAA 2IVMA 1E3HA 4RGSA 3PNVA 1ODDA 2EFPA 1D8KA 3BJAA 4G94A 2BOLA 4NBQA 2X6YA 3IH2A 2OUMA 3ZMVA 1JI8A 3ABTA 1P4XA 3LSGA 1R71A 3BR5A 2CW7A 3IRQA 5IOZA 1TWAJ 2E71A 4EM2A 2C6YA 4PJ0C 2K3PA 4LB5A 4ESFA 4BACA 3HEFA 2LF8A 1YRNA 3VFZA 2CH0A 4YFNF 2QKMB 5ICGA 2FXAA 3SDBA 3E6MA 1TWHJ 1NK3P 1FP2A 3EPZA 2LLKA 1R7JA 3UR3C 4A0ZA 1HA8A 3UKGA 2O7OA 1P9QC 3LSJA 2KISA 4NB5A 2MYSA 4BHBA 3K70D 4JBAA 4R1HA 3G6EI 2WBMA 3E5QA 2CV1A 1MIJA 1HDDC 1XCBA 1S6LA 3RPUA 2XAFA 2Y9ZA 5EGOB 3KYCB 3B02A 3SZTA 3FIWA 3WTUC 2L2OA 1R1UA 3QPSA 2HOSA 2JA7J 1KU7A 3EUHA 3CF2A 5B5EC 1WPKA 3GTPJ 3CZ6A 1LUJB 3W6KB 2V9PA 2A6TA 1XN7A 3GFIA 5KNLA 3V7CA 1X2MA 1PUEE 1XGOA 2G7UA 3A01B 2A68F 2ID3A 2JRMA 1GDTA 1SVMA 4Z2YA 4ZTFA 4Q5SF 3E6CC 5GPAA 2M8GX 1Q1HA 3GZ5A 2K85A 3OV8A 1G2HA 2KRFA 4ZDOA 4PJJA 2HS5A 2H6CA 2JPCA 2X1CA 3TOBA 2OCCH 3CMAI 2L7KA 2F48A 3RQIA 4OAYA 2D1HA 1UHSA 3OSGA 1D1AA 2GQQA 2FBIA 3W6VA 3OOUA 3RTRA 3ZRGA 5LRSA 3CESA 3E6BA 2Z16A 2Z2SB 1ETQA 3BLYA 2QKLB 4Z6YA 2HXIA 2ZXWH 4FE7A 2LMDA 2BV6A 2QVOA 4BQAA 2KRHA 3BCBA 1XDSA 4E7ZA 1TLHB 1UJ8A 2NXNB 4JQFA 2A3SA 5D4SA 5DEQA 2ZXIA 4ZYDA 2JT1A 3IWZA 4G6DA 2R7FA 4U0YA 1K6YA 1X1AA 1WWXA 3D5SC 4L9JA 4KT6A 2ZJRF 2MA3A 5LEJA 2E36A 1LFBA 1ZQ3P 2FQ3A 3AL0B 4AC0A 2ZJ2A 1R1TA 5CVVA 4OAZA 2A6EF 2Q2EB 3OWTA 4G7OF 3DPLC 1WI9A 2JSPA 3BR2A 3T8RA 4IHVA 3P9IA 2FNAA 3W3CA 4JP0A 3JREA 1FOXA 1FY7A 4WX9A 1WRJA 4ZJZA 1TWGJ 2P5KA 4N4OB 3OMYA 5FB2A 2MFZA 1YX5A 1ZRCA 3HXLA 4R8HA 2TCTA 3JRCA 4M9ZA 3ZMZA 1PP8F 4IQ4A 5HDKA 9ANTA 1P4AA 2FEZA 1FIPA 4AIKA 1U5TB 1VQ4I 1AKHB 5AONA 1ETXA 3VWBA 5IT9Z 1CF7A 3ROUA 1IRFA 1Z1DA 3EUKL 3CO7C 2HOEA 3G2BA 2ETHA 4UXNA 3OS2A 3FK7A 4PUSA 2BGCA 4I02A 4R79A 2STTA 5LBQA 4XRMA 4UV8A 2A6HF 2I10A 4QWQA 1G59A 4M6VA 1T56A 2LREA 2Y69H 5EZHA 2LY2A 4UUTA 5D8KB 3ABLH 1XD7A 5LEKA 1T0FC 2TRTA 1FNNA 3CUQC 3E3VA 5K7HA 4W1UA 1IV8A 3QPLA 1IRXA 4XN3A 3CC2I 1FEXA 3ECOA 4AUXA 2L7ZA 2WA0A 1S5LC 1Y1VJ 2A5WA 1U0JA 1F5TA 4KUMA 3CLQA 4EEFG 2V7FA 4CYDA 1MMNA 1DQUA 5FJ8J 3OIQA 1ZTRA 4M9XA 2V1DA 4XBFA 2HTSA 3F6VA 2FF4A 4MEYF 1VQ7I 2MH2A 2VKHA 1OCZH 4OIOF 1TT5B 2IRFG 4MFEA 2FJ1A 4A6EA 3HRUA 2CWEA 2OC6A 1A31A 4PGHA 1X1BA 4XICA 2W25A 2DA5A 2O3FA 4YIFA 1DDNA 3S1RJ 1OCOH 2K9QA 3W2WA 2F5VA 2O61A 4EJTA 1STZA 5ERIA 1JKQC 5L3CA 2DOAA 2QSHX 4Y52J 3KLOA 4HX8A 2R4GA 4XR6A 5CLSA 3Q0WA 2EWNA 3TP0A 5B66C 3GYHX 2CW0F 5L3GA 2STWA 3S2HJ 1BW5A 1I1SA 1GLNA 2JPBA 2QQ9A 4NUBA 4IJAA 2BY3A 1Z0XA 2ESHA 4JX6A 1MBEA 1DGWY 3PNYA 2PG4A 2Q8KA 3F0CA 3L9FA 4HNVA 5F1RA 5HDNA 2DT7B 2FMLA 2M8EA 2WADA 1Z91A 1G3WA 4I0AA 3KYDB 5IYBJ 1K78B 1YW8A 2CQNA 3I54A 3F6OA 2JVGA 4PJNA 3SDGA 2L7FP 4YG2F 5LHIA 1VQ5I 3KYLA 1YYVA 1JTXA 3F8FA 1SMYF 3OS1A 3OYNA 1CGPA 2X4HA 3CDLA 1GVDA 2DO7A 2H1LA 4E4HA 1XTAA 2J5OA 2IS6A 1AU7A 3FXRA 5FRMA 2OPTA 4DYCA 4FT8A 1MZBA 4RGXA 3GW2A 5FLVA 4MQ9F 2QUFA 4BUPA 4CCLA 1J59A 1Z7UA 1W1WE 2IGKA 2R7DA 1R49A 3ZPLA 3REOA 3K1NA 2XRLA 3HSFA 2NOJB 2K4BA 5HLIA 1ON2A 3BG6A 3DCFA 5HLGA 4GYGA 1V4RA 4ZDLA 4F52A 3S1QJ 3BZ6A 4YFXF 3BCAA 4AIHA 2VQLA 1MNEA 1RESA 2Z99A 4OU0A 3PO2J 1IZ1A 1FWZA 2NYXA 2ZNYA 4HW0A 2XSDC 2PI0A 1BA5A 4M9SA 3ISPA 4CCNA 2R7XA 2ISYA 5FRNA 4Y17A 3KX2A 3WU0A 3JRGA 3FXMA 3QYBA 4YIIA 3GWZA 1D5VA 3J80Z 2E2IJ 1ON1A 5E8IA 4HDVA 3ZOBA 1YE9A 3CTAA 3KP2A 3FM5A 4C30A 3HOTA 3I4PA 2NNNA 4ON0A 5D4RA 1F36A 2R5ZB 5J1UA 5L3EA 1MBHA 1L3LA 1P7JA 4U87A 5JLWA 1FC3A 3QU3A 3B6AA 2QYOA 2ISZA 4I98B 3U9GA 4CHUA 4A93J 2QSGX 3QAHA 1B8IA 5IP9J 3WTZA 4P96A 3FISA 4BE2A 3W2VA 2ESNA 2X48A 2H09A 3LFKA 3H0DA 3HPGA 1SAUA 3DU6A 4G6QA 3S2WA 2B9SA 2RQPA 2Y0MA 5HLHA 3DBHB 1BL0A 1EA3A 5BNGA 3E1SA 1HKTA 2HGCA 3R60A 4LIUA 3H35A 3VPRA 4JOMA 5D5UB 4DW6A 2QEXI 1BJAA 1V54H 3NQOA 1TC3C 1DU0A 5CKTA 1T98A 1HSTA 3RKQA 3JRIA 3TKYA 4PFPA 3DLLF 4RLQA 5HODA 2IW5A 1MMGA 1BIAA 1RPWA 4HV5A 3A02A 2AXLA 4BS9A 3ECHA 1VQ6I 4A0YA 2LNBA 3S1NJ 2LBFA 3PSIA 3A0HC 5H6QA 4D5FA 4HLXA 3ZN0A 3DEEA 3OYKA 2X1DA 3VOEA 2DDBA 5LHGA 3FXQA 4EQQA 4DBRA 2HTJA 3HM5A 4OIQF 5GAGJ 2HDDA 4EATA 4I2OA 2WAEA 3MD2A 2R93J 1KA8A 1MGTA 2WB1A 1IUFA 4LB6B 2IS4A 1YO5C 2KHMA 3F72A 1Y0NA 4KA4A 1ZARA 1NTCA 2B0LA 3TOAA 4PGGA 4HEA2 4EMSA 2L9VA 4A3IJ 1IN4A 2VJIA 1EJ9A 2IA2A 3V8JA 3Q0VA 3QQAA 2ZMEA 4NNJA 3A0BC 5E3LA 2XAGA 3S1MJ 2HYFA 2NS0A 1XDUA 1J75A 1OYYA 5FKNA 2KDOA 2P8TA 1SVLA 1FYKA 2M34A 5FGMA 5EDNA 2XF5A 5GTIC 3TO9A 2FBHA 1FT9A 3L09A 2WWYA 1EKEA 4QLCU 2WB1N 4LIVA 2IA0A 4M6YA 2EV5A 5B3SH 4CZZA 3BQZA 1MJ9A 1Z67A 2OZUA 1BBYA 5K5QA 3A4CA 5GAEJ 1XMXA 2Q0OA 1R9TJ 2HEOA 1OR7A 1R5GA 4ZDPA 2O9LA 2E1NA 5GPCA 4BU2A 1R5HA 2K27A 2RAEA 4U88A 2F5EA 5DDGA 1FTTA 2P4WA 4FX4A 4BL0B 1QHGA 4A6DA 2OTLI 5F08A 4G7HF 2OV7A 4XK4A 5E20A 1QQIA 1U8RA 5HVQC 2YSRA 1HBXG 3FWEA 4LG3A 2PJRB 5E1ZB 4IF4A 3RKYA 4WCGA 1X3WB 1GHCA 4L9TA 2PQ8A 3L1PA 3OL4A 1J0RA 4RA2A 4Y7NJ 5AIPA 2EJRA 4NHJA 1ZGWA 4IRGA 2OA4A 5KAFC 1ZKGA 4HG2A 2BXZA 4UUSB 3SEQA 3WGHA 2OTJI 5EEGA 4DBQA 3PJRA 3GFMA 3ZQ7A 2VB6A 2PN6A 3HHGA 3WTXC 1W7PD 2EA2A 3K4LA 4OMYA 1X3UA 1A6IA 3DBLB 1BI2A 4U0VA 1QHHD 5A2QK 3PO3J 2GLOA 4NC7A 2DTZA 2HZDA 3FF5A 1O3TA 1IN7A 2OQGA 1E0EA 3N4MA 1J7KA 2XC7A 1V5EA 5FKMA 2PMZN 3PQJA 5CVUA 1VQKI 1JJ6C 4PFOA 5J1RA 1ZGJA 3T5XA 2OJED 5F27A 2VBYA 1SFOJ 3AG1H 5DV5A 4AD9A 3QPHA 2EBIA 2GZWA 5HS9A 3I3LA 2FOWA 3IKTA 3WODF 3V4GA 4UNOA 2ZJPF 3I4NJ 4RB1A 4WXDA 2O5RA 1POGA 2JUCA 3N97A 2F6CA 2CS3A 1YJWI 4BEHA 2DPDA 1FOKA 3OYDA 1WFXA 2DN0A 3G1OA 4NQWB 4HDUA 5DM7F 3IP4B 3GEZA 3GLXA 2FBKA 2L02A 5FD5A 1E2XA 1YJ9I 2KL4A 2DAOA 2J5PA 1I27A 3DKXA 3I4MJ 2DFHA 4RS8A 1I1GA 4ZYAA 4FETA 2ZNZA 2ZO4A 3O8GA 5CQEA 5GTHC 1WJCA 3TW6A 3H9GA 3TW7A 4L18B 2L4MA 2RDPA 4A3KJ 3OYIA 2O8XA 3DP7A 1O7FA 3GFJA 3OYHA 2EZIA 3WE2A 4GCVA 3ZP5A 3LQRA 2XAQA 4II3A 5EG0B 1I6HJ 1N77A 4PZJA 2KMUA 2KDZA 3FKJA 2W85A 3LSKA 2NRAC 2P5LC 1QGPA 2JSCA 2YU9J 4IHSA 4A3BJ 3H5NA 3WG9A 3GUDA 3S3MA 3O3KA 4XQFA 3IC7A 2JUGA 5JR3A 2Y0SA 4A3CJ 3KP7A 6PAXA 2AQEA 3HOVJ 2IGNA 1IGNA 2K5CA 2VI6A 5J47A 1FMWA 2L54A 1MSEC 3QP5A 3JSPA 3JW4A 3K4NA 4CSWA 1SD6A 3EQLF 1RETA 4HA8A 4P9FA 4PSWA 2HOTA 3FHZA 2DBBA 2JA6J 1VQNI 1LQ1A 2L5QA 1J5YA 1B9MA 3EETA 4HQEA 1MBKA 1HDPA 1TNTA 2RVCA 1IXSB 1IC8A 2DJNA 2N8GA 1X4PA 1IDYA 3M3YJ 3GFLA 2R7QA 3C2GA 3TGNA 3K10A 1D0YA 1YOVB 4HNUA 3TL4X 3DU5A 2FMYA 2VBWA 3IH3A 2P6TA 5HOOA 4OINF 1N78A 3HRMA 3WTSC 2PJPA 1YHQI 2RV8A 2LFBA 3TQNA 2VASA 2Y0SN 1TBXA 2DTRA 3CJRB 3DEUA 1LJ9A 4E7JA 4WXCA 2RN7A 4B8XA 1MBGA 5DCMB 1BM9A 4Y13A 1K6OA 2K02A 2H94A 3MKZA 2H8WA 1BJZA 3N05A 1BC8C 3P5JA 4V2FA 4M6XA 5EF6A 1I3AA 3EYYA 3CCSI 4L0ZB 2X6OA 2NNYA 4A3LJ 3CMEI 1W36C 2DOFA 1MD0A 4IKFA 5KCMA 1HXDA 4XKBA 2DA1A 5DYMA 4RB2C 1A5JA 1GXQA 2Y30A 4EV0A 4BE1A 2FD5A 1UHWA 2GOXB 2OQRA 1SD4A 4M3GA 2QCOA 2ELKA 4LJZF 1BI0A 3EDPA 3V7RA 2Z3YA 1M1EB 2QZ8A 3WGIA 3CCLI 4O6JA 4N4NB 4F91B 3K0LA 1C0WA 2WV0A 1K83J 3IAS2 1B1BA 2EIKH 3C3WA 2Z1DA 2LC2A 1RKWA 1BIBA 1WKMA 3SQNA 1VNDA 2ZXJA 1HKQA 2DQRA 3TMOA 4KMFA 3ASOH 4YIRX 1TTYA 3IKVA 1U3EM 4A3DJ 1MDMA 2DK8A 1IN6A 1ETYA 2WAQA 1FBSA 3HOZJ 2R7OA 2H27A 4ABZA 1RC9A 2E19A 1K61A 1S3JA 2OBPA 3ZGKA 1FBUA 4NDLA 5EGOA 4L5EA 2UZKA 1N25A 5DD8A 2O03A 2W48A 3KCCA 3TO6A 5J4YA 1IDZA 1DGRM 2EZLA 4E7LA 3ERMA 5H20A 3BPVA 3R6SA 1GXPA 2H6BA 1VTNC 4F93B 3A01A 3B6CA 3RIRA 1IRZA 1XSXA 3D5LA 2LRDA 3GTQJ 4LMYA 3EUAA 1MH3A 2GIZA 3BP8A 3K7AJ 2EFQA 1PUFA 3CMMA 2HOAA 2V79A 4CCJA 5CVJA 5EZGA 5FKLA 5KHDA 3HSEA 5M3FJ 4LLGF 1O7LA 1XX5A 4UVAA 3V7SA 4A12A 3F23A 5LD2C 2MABA 2WAQN 3CCVI 1JGSA 1RUNA 1LB2A 1W7PA 1FP1D 3HUGB 4A3JJ 4E7SA 1W0TA 5LHHA 3GF2A 4FTHA 3QYEA 2XGXA 1APLC 1RR8C 2A5YB 3LA7A 3JAMZ 3D1NI 3OR2C 3KLNA 3J81K 4M74A 1YW9A 3RZOJ 2MBFA 4L9VA 2XDVA 5J40A 2HVSA 4UV9A 2V9VA 4LGWA 1OCPA 5FLXK 3QU6A 1RNLA 2FSWA 1I39A 2ZJQF 1YX3A 4U7DA 1ZN2A 5KK1A 2HVRA 2NAZA 2XGEA 1D3YA 2R7VA 5FROA 4J19A 3OYAA 3ZR8X 4I6ZA 2DQLA 3M1CA 2D5VA 1WGXA 1W4MA 4O3MA 2L01A 2XUBA 3CUQB 4XLAA 3IRRA 2IP2A 3CD6I 4L9NA 4PCQA 3CCJI 2M2EA 4E6KG 2XIGA 5LFAA 3CO6C 3FMRA 1U5TA 4RM2A 3DPTA 4CDGA 4CYCA 1ZYRF 2CUZA 3EUHC 4MTEA 1BC7C 1R6RA 3WTWC 2E7WA 1EF4A 4A3EJ 1AHDP 4KN4X 2JTVA 4M73A 2KRCA 3J7AO 3F21A 2FOKA 5D5XB 2XB0X 5FKOA 2XAUA 5BQTA 1UMQA 3FMSA 3CJTB 2BY2A 2CW8A 2MD5A 2VPRA 2RNGA 5ILSA 1YTYA 1BN5A 1H9GA 4GXOA 1FYMA 4ENJA 4C2TA 3TDUC 2VKVA 2KJCA 3BJOA 3SJMA 1JT6A 3EYIA 3M8FA 4ESJA 4YFKF 4RMNA 1FIAA 3SFIA 1TQIA 4XOTA 2Z33A 4ENMA 2B7EA 2FU4A 4DYRA 2KZGA 3OYMA 1Y8QB 3LMMA 3HB9A 1SD7A 5TGTA 3ZXSA 4N0BA 1MH4A 1CF7B 3LSPA 1LDJA 1JXSA 2R92J 1JKPC 2HR3A 1KQ9A 2CQQA 3PM1A 1BI3A 3FXLA 2DMUA 3E7LA 5FKKA 2X6WA 1WH5A 3ONQA 2ECCA 3BQYA 1HSJA 3JRBA 4HLYA 1SANA 5FLMJ 2DDAA 2DA7A 2X6XA 1VF9A 3JRHA 4IEJA 1EV7A 5JLXA 4MGRA 3ZQIA 2M5WA 2DA2A 2PFBA 2NS8A 3PNTA 4ASNA 3OR1C 4CCOA 1Y8RB 2EZHA 3E0JB 2ZKZA 3PIOF 3KP5A 3RDIA 3T8TA 3BG3A 3ERED 4B3AA 3MZYA 4XKCA 2LK2A 4MQVA 4KDPA 5E8GA 1ONVA 2EFNA 2H8RA 3MAJA 1NHAA 1HOMA 1WHUA 3FHNA 2UXNA 3HTSB 4HF0A 4OIRF 2CQ7A 1YS6A 1NH3A 3OS0A 3OYJA 4XL9A 4RGUA 4C3IJ 2LH9A 2VJ5A 2YPRA 3CC7I 3HGGA 3I64A 3BDDA 3TO7A 4ANJA 1MMAA 1Z6TA 5DTDA 4DNCA 1LEAA 3RI4A 3JR9A 3JRFA 5J8FA 2GXBA 2NVYJ 4EJWA 1U8BA 2CQXA 1TWCJ 2X1EA 3DKWA 3L00A 3GTJJ 4BJTA 4UVCA 1IN5A 1TNSA 3K1PA 1ZG3A 4FQGA 3LAPA 4RM3A 4I76A 4A3GJ 2TDXA 1EH6A 1T33A 2DT5A 1YIJI 5E3MA 4A3FJ 2KLOA 2DA3A 1BR1A 2XPUA 1WQ2A 4XRFA 3K4KA 5CVRA 4BE0A 2M3AA 2E1MB 2V6CA 4OWRB 1WZ2A 2DW4A 2W84A 3MVPA 1H0MA 2XF6A 2K9MA 4G6TB 4UVBA 2V1UA 1HC8A 2OAZA 3PFIA 3S3NA 2V1XA 1H9TA 2DPUA 1S9HA 2EPFA 4Y15A 1ETVA 2FRHA 4L5JA 3S8PA 4XIDA 3LFUA 3HRTA 2UXXA 3HSRA 4X1EA 4Y33A 2K7LA 2E2JJ 2H1KA 1S7AA 1QA6A 4HQMA 2YX4A 2BE5F 2HVQA 3H9QA 3VYRB 2BW3A 5EJCA 1N75A 3BG9A 4G9YA 4EM0B 1XCVA 3V42A 2XGCA 1Z77A 4XKWA 2ELJA 2DJIA 5K5OA 3E97A 1TZLA 3K4BA 3BC8A 2CU7A 2V4JC 1ZREA 2R5ZA 2GAUA 4IL6C 4U0WA 1S7EA 1IXRC 2O8KA 2F5CA 2COMA 5E79C 5IP7J 4ZYEA 2E1MC 3S15J 5JFRA 2HWVA 3FM3A 5GP9A 4D7MA 3O8HA 2LP0A 4A0XA 3LQQA 2BXYA 4Y3OA 3QOPA 1X2NA 2VXZA 2DT6A 2XGDA 1SFEA 2CYYA 2IS2A 2ECBA 3CF5F 4YEJA 4M3DA 2VN2A 4D5CA 1ETWA 3DTEA 4A3MJ 1YLFA 1QRYA 2XKPA 1R1VA 2CSOA 1W36D 1A35A 4DYQA 1TP4A 5ICEA 1FPQA 3KETA 2DMQA 3U1KA 3WU1B 2Z9OA 3S2DJ 3M1EA 1WCMJ 1P6RA 3K1MA 2GWRA 3K70C 2DLLA 3SZPA 4A2UA 2GA2A 1G3SA 3C2HA 1W5TA 3IH4A 4M3EA 1P92A 1XSVA 4XNFA 2IBDA 3CCEI 2V1NA 3AKZA 3HRSA 3RZDJ 4L5IA 1T2KA 2E60A 3R4KA 2FE3A 1LNWA 2M7BA 3OOPA 3ABUA 4KMUX 1QNTA 5IOYA 2FA5A 3KFWX 4PJLA 3HHHA 2QWWA 3GTLJ 4C3HJ 2Z5UA 3H3ZA 4BGDA 3A1YA 4CO8A 4BJ6C 3FDYA 4RAZA 3HBLA 2W1OA 5JVTA 1Z9CA 1G3TA 2AHQA 2CUEA 1ZLJA 2JJ7A 3JRAA 3GBGA 3DTIA 3KP3A 3ASNH 3JSOA 2DCEA 1S8NA 3MQ0A 3HGYA 2GM4A 3IWFA 3K2AA 3PFYA 1H8AC 2PBIA 2E2HJ 1J09A 2G0EA 2DFIA 2XKOA 3HJEA 3KEOA 3KEQA 3GTMJ 1SFUA 2BVMA 2RKHA 3I9V2 1QZZA 1V55H 5IT9K 3S14J 1G3YA 1OKRA 2L3DA 5CJ9A 3E5XA 3IV5A 4IRIA 3SXYA 2DODA 3D0SA 3R61A 4MLOA 2R7TA 2WAFA 2M0MA 2MG4A 1XC5A 4J00A 4XSXF 1JTYA 2KZVA 2ME0A 4V2GA 4CXFA 4UY8I 5K7ZA 3VEPA 3MFKA 2WTEA 1USSA 1GVJA 1QVTA 2NOGA 4JX5A 5L3DA 1JGGA 3WHCA 3WTTC 3PUBA 3E5UA 2PMZA 3QOEA 1DPRA 3NWTA 4DOZA 1X4OA 1O57A 2M1BA 3LSTA 3M9AA 4M3FA 1WJBA 1TW3A 2F5FA 4ZYGA 4B47A 1LDKB 2Y2ZA 1O3SA 3HL2A 2CUJA 5F64A 3G73A 2ADUA 2R0QC 4UUSA 4KISA 1X1CA 1ITYA 4XMYA 2I8DA 1AWCA 4AM3A 3BTJA 2ID6A 4IXAA 3DKYA 3L7WA 4EGYA 2V9KA 5J6XA 3BTLA 5FFXA 5D8LB 4F3QA 2R7UA 2G9WA 2X9DA 2K3FA 1V3FA 4B1RA 4XLPF 4BYYA 2NVTJ 5IYDJ 1SAXA 2DFFA 5LLQA 2QBYA 2R5YB 2QF7A 4KFCA 2DA4A 1YQAA 2VOOA 1K4TA 4KJZA 3J81Z 2EV0A 4GYIA 4XRSA 4S0HB 4MEXF 1MSFC 3VYUB 3HOUJ 1RUOA 2BYVE 2ZMEC 3KEYA 3AAFA 1YI2I 5FLXZ 3V8KA 2BVLA 4WF2A 5BPIA 2O6GE 3K2ZA 4ZZLA 5HS7A 3W2AA 3FZVA 3HYIA 5F0CA 3DTKA 2M30A 2EFOA 4RBOA 1T38A 2IXSA 1LFUP 1ULYA 4HBLA 3A03A 1B72B 3MZ8A 3RSNA 3Q3SA 4CGZA 2ZFWA 4I7HA 1QZYA 1B6AA 5GADJ 3K4JA 2XAHA 3ZMUA 1LDDA 2AO9A 4XONA 3L2QA 4BY1J 1R00A 3FBNB 2ELHA 1IO2A 3W6JB 1X58A 1LE8A 1XGNA 1QBJA 2CV0A 3ZQGA 3P9KA 2M9HA 4RDUA 3DBRB 3CCUI 4TV7A 5BPDA 1OR7C 3OIOA 1JHHA 4Y4RA 4FISA 5HNFA 3CDHA 1OLTA 2GBYA 1WJAA 4BXFA 2YR2A 3I59B 3HTUA 4AIDA 5HLTA 3ZCOA 2CFXA 1EH8A 3H1CA 1LPQA 4II2A 2DMNA 2MLGA 3COAC 3I53A 2BBYA 4WWCA 3FXKA 2K9SA 2VJJA 3H92A 3A2KA 4BHCA 1XPXA 4OIPF 4DZJA 3HKZA 1KYZA 3M8JA 2EQRA 3LA3A 3G71I 2LG4A 1OCCH 3OSFA 1D1CA 3KE2A 3BG7A 4YELA 1WSUA 3BTIA 3VSKA 4LG0B 3CC4I 2DYRH 5H6RA 1NK2P 5CVIA 1ZRDA 2CO5A 3GXOA 3VYSB 1YITI 2VQCA
chains in the Genus database with same CATH topology
2MH9A 3WGGA 3HOSA 2A07F 2VONA 3QPTA 4MNUA 2KJBA 2DI3A 4BH9A 3M8EA 3RJPA 2M87A 3R0JA 5L3FA 1R58A 3C18A 5IT3A 1KQ0A 1TQMA 3SFZA 4EJOA 3VB2A 1I5ZA 2VBXA 5DCMA 4Q4ZF 5BS6A 2W24A 2P5VA 2D1VA 2UWMA 3ZMSA 2P7CB 3BOQA 4KICA 4HX7A 1HW1A 5LGUA 2F2EA 3MCZA 4JK1X 1PDNC 2A69F 1OPCA 1F1ZA 3CLOA 4PDKA 5ILUA 2IA1A 1QPMA 1REPC 3U2RA 3I5UA 1BOAA 2G7HA 4AVPA 1MJBA 5D5VB 2VE8A 4MHGA 4H0EA 1FX7A 4LFUA 3I0TA 4LLNA 1UHMA 1USTA 4K2EA 4N9IA 1ZG1A 3Q9VA 4ENNA 4RGRA 4HF1A 3MWMA 1ZHFA 1U6GA 3F22A 3P7NA 1B4AA 3O6BB 4WXHA 4A5NA 5JI6A 5HDGA 1MDMB 4OMZA 5K5RA 5L3BA 3HUGA 4BXUA 4EJVA 1JHFA 3C1DA 1O3RA 3ULQB 2JZYA 1TQPA 1LEBA 3DF8A 1KYWA 4EGZA 2CGPA 3B73A 1L0OC 3K69A 1K79A 4I01A 3VODA 3ZMDA 2VT2A 4ZYHA 4U7BA 1W5SA 2Q2EA 1P4WA 1T0FA 3H3UA 3CUQA 1W7PB 1MKMA 4RAYA 4LK0F 5FO5A 3F8CA 3DQVC 3F8BA 3KP6A 1UCRA 5K1YA 5AIQA 3CJNA 4HX4A 2HKXA 4AWXB 4ZH4F 1IF1A 3GO5A 2QQAA 3GVAA 2XV4S 1J2XA 4P9UA 1ZGAA 2EA4A 2FNPA 2A61A 2XHKA 3RYPA 1B59A 1B9NA 1IN8A 3ML6A 4KN7X 1DPUA 2GA1A 4N9HA 4I09A 3Q5FA 5E17F 4XLNF 5E1XA 2Y48A 3U1DA 3SHFA 2VT3A 1IAWA 5J8CA 5E18F 4E70A 3I58A 3ZMTA 1YS7A 2E7XA 1G4DA 1YIOA 4D0PA 1A04A 1KU3A 2OD5A 1O3QA 4IPAA 3T1BA 1KGSA 3F8MA 1MJAA 4IVNA 1FSHA 3FMQA 4UUVA 1LVAA 4BHPA 3KZZA 2VC1A 2PEXA 5FFZA 2L4AA 3CUOA 4IHTA 4UHTA 1U5TC 1ZH5A 1XGSA 1IXCA 4Q47A 3L2CA 2DU9A 2LF7A 1K78A 5LRRA 5KVRA 5DD4A 2ZCWA 3ZN1A 2VBZA 2ACJA 2BEOA 1FYLA 5A2QZ 2QLZA 2LDUA 4CICA 1SMTA 2KIUA 3C7JA 4A5MA 4BNCA 4HZFA 3DFGA 1KU2A 2F5DA 3GX4X 1YG2A 1ZLKA 1XB4A 5EEHA 3P9CA 4HAMA 4WK8F 4P5OA 1SD5A 2CG4A 4GGGA 1ZG5A 3KZYA 5D6EA 5TRDA 1T39A 1FLIA 4AIJA 4IRHA 2K86A 3G3ZA 4L0YB 2W57A 3RYRA 3QP6A 3RKWA 1YFHA 4LD5A 2YX7A 1F9NA 3O2PE 2K4JA 1HW2A 3I71A 1OYIA 1HKSA 2HZTA 1FZPB 4S05A 5FD6A 1PP7U 3LWFA 4BAYA 1S7OA 2IPQX 2VOPA 5F6FA 2E1CA 4KIFA 4HV6A 4DQ2A 1BI1A 1K7AA 1XGMA 4FHTA 4HYEA 1AOYA 1ZAOA 5BMZA 4KIGA 3BROA 1EH7A 3JAMK 2XRNA 2OU2A 2D2WA 3LA2A 4KNYA 2JRTA 5D6FA 4KIBA 5DCFA 4M71A 1FBQA 4M72A 2P6SA 4G7ZF 2QM3A 3F3XA 4GO1A 1DP7P 4KT5C 1RI7A 3KP4A 3BY6A 1ZRFA 2MLKA 1QO0D 3R0AA 4ESBA 3RPQA 3PQKA 1SFXA 3TDZC 1IW7F 1UB9A 4F7ZA 2XROA 2XAJA 3FXUA 2QQBA 3WTVC 1G6NA 5ILVA 5CYVA 1XSDA 2HKOA 1U2WA 1R22A 2ZMEB 4B09A 2O0YA 2KIFA 1J9IA 2EB7A 2MC3A 3NEUA 3DXJF 2RC4A 3IL2A 1Y0UA 2D45A 2X0LA 2ZBKA 3QRFF 4OOIA 2RGVA 1D8JA 1HW5A 2LKPA 2IJLA 1R23A 4O5VA 2KKOA 4ENKA 2OZ6A 2M45A 2HQNA 4ZZDA 1IUYA 3MEXA 3Q9SA 1YW7A 3LAJA 1RIOH 3BJ6A 4EVIA 3V8LA 5TJJA 2PLYA 1T6SA 1HQCA 2GIVA 4KYWA 4HOBA 2Y75A 3F8NA 3HIFA 4NQWA 5ICCA 2EV6A 4ETSA 3K9TA 2EFWA 2QBYB 2HQRA 1JE8A 5DUKA 3I59A 2HYGD 4P55A 5LGNA 4G8XA 4MTDA 1FSEA 5D5WB 3WE3A 1P2FA 1IRGA 3BPXA 2AS5F 2EK5A 1XMAA 3JTHA 1Z05A 2YU3A 5HS8A 3GZ6A 2PMHA 5BOXA 4LG0A 2HDCA 4LLLA 2RNJA 2WC2A 4EM1A 3ELKA 1KQ8A 2PMUA 2VE9A 4Q48A 1RZ4A 4RB3C 2VODA 1DUXC 2HFHA 3DV8A 5E1WA 3NRVA 3J80K 3E6DA 2GXGA 4HF2A 3RKXA 2DK5A 3IHUA 3MZHA 1OYWA 4RB0A 3WTYC 4I0BA 4S04A 1UFMA 4EJUA 5ICFA 3T0YA 3JTGA 1F4KA 4LK1F 1OMIA 1R36A 1XMKA 2CQKA 1U78A 1E17A 1Z6RA 1TW2A 2XASA 3BWGA 2R3SA 2VC0A 2LSOA 3FX3A 2KIMA 5DUIA 4FX0A 1KU9A 2IT0A 2P7VB 5ED4A 5LGTA 4XSZF 3M7GA 2QENA 1S29A 5JHUA 1I6XA 2XVCA 2IVMA 4RGSA 1ODDA 2EFPA 1D8KA 3BJAA 4G94A 3ZMVA 3ABTA 1P4XA 3IRQA 4EM2A 2C6YA 4LB5A 4ESFA 2LF8A 3VFZA 4YFNF 5ICGA 2FXAA 3E6MA 1FP2A 1R7JA 4A0ZA 4NB5A 4BHBA 4JBAA 4R1HA 3E5QA 1XCBA 1S6LA 3RPUA 2XAFA 3B02A 3SZTA 3WTUC 1R1UA 1KU7A 3EUHA 3W6KB 3GFIA 1XN7A 3V7CA 1PUEE 1XGOA 2G7UA 2A68F 4Z2YA 4Q5SF 3E6CC 1Q1HA 3GZ5A 3OV8A 2KRFA 2HS5A 2H6CA 2JPCA 3TOBA 2D1HA 2GQQA 2FBIA 3RTRA 5LRSA 3E6BA 2BV6A 2QVOA 4BQAA 1XDSA 1TLHB 4JQFA 2A3SA 5D4SA 5DEQA 4ZYDA 2JT1A 3IWZA 4G6DA 2R7FA 4U0YA 1WWXA 4L9JA 2MA3A 5LEJA 2FQ3A 2ZJ2A 1R1TA 5CVVA 2A6EF 4G7OF 3DPLC 1WI9A 3T8RA 3P9IA 2FNAA 1FY7A 4WX9A 1WRJA 2P5KA 5FB2A 1ZRCA 4R8HA 4M9ZA 3ZMZA 1PP8F 5HDKA 1P4AA 2FEZA 4AIKA 1U5TB 5AONA 5IT9Z 1CF7A 3ROUA 1IRFA 1Z1DA 3CO7C 2HOEA 4UXNA 2ETHA 2BGCA 4I02A 4R79A 2STTA 5LBQA 4UV8A 2A6HF 4QWQA 5D8KB 1XD7A 5LEKA 3E3VA 1FNNA 3CUQC 3ECOA 1F5TA 4KUMA 4CYDA 4M9XA 2V1DA 4XBFA 2HTSA 3F6VA 2FF4A 4MEYF 4OIOF 2MH2A 2IRFG 4A6EA 3HRUA 2CWEA 4PGHA 2W25A 2O3FA 4YIFA 1DDNA 2O61A 4EJTA 1STZA 5ERIA 5L3CA 3KLOA 4HX8A 5CLSA 2EWNA 3GYHX 2CW0F 5L3GA 2STWA 1I1SA 2JPBA 2QQ9A 4IJAA 2ESHA 2PG4A 2Q8KA 3L9FA 5F1RA 5HDNA 2FMLA 2M8EA 1Z91A 1G3WA 4I0AA 1K78B 1YW8A 3I54A 3F6OA 4YG2F 5LHIA 1YYVA 3F8FA 1CGPA 1SMYF 2X4HA 2DO7A 2J5OA 3FXRA 4FT8A 1MZBA 4RGXA 3GW2A 4MQ9F 2QUFA 1J59A 1Z7UA 2R7DA 3ZPLA 3REOA 3K1NA 3HSFA 2K4BA 5HLIA 1ON2A 5HLGA 4GYGA 1V4RA 3BZ6A 4YFXF 4AIHA 2Z99A 4OU0A 1IZ1A 1FWZA 2NYXA 2ZNYA 4HW0A 2PI0A 4M9SA 3ISPA 2ISYA 4Y17A 3WU0A 4YIIA 3GWZA 1D5VA 3J80Z 1ON1A 5E8IA 4HDVA 3CTAA 3KP2A 3FM5A 3HOTA 3I4PA 2NNNA 4ON0A 5D4RA 5L3EA 1L3LA 1FC3A 3QU3A 2QYOA 2ISZA 4I98B 3U9GA 4CHUA 3QAHA 3WTZA 4P96A 2ESNA 2H09A 3LFKA 4G6QA 3S2WA 2RQPA 2Y0MA 5HLHA 1HKTA 2HGCA 3R60A 5D5UB 1BJAA 3NQOA 1T98A 1HSTA 3TKYA 2IW5A 1BIAA 4HV5A 2AXLA 3ECHA 4A0YA 2LNBA 5H6QA 4HLXA 3ZN0A 3VOEA 5LHGA 3FXQA 4EQQA 2HTJA 4OIQF 4I2OA 1KA8A 1MGTA 4LB6B 1YO5C 3F72A 4KA4A 1ZARA 2B0LA 3TOAA 4PGGA 4EMSA 1IN4A 2IA2A 3V8JA 2ZMEA 2XAGA 2HYFA 2NS0A 1XDUA 1J75A 1OYYA 2P8TA 1FYKA 5FGMA 3TO9A 2FBHA 1FT9A 3L09A 2WWYA 4QLCU 2IA0A 4M6YA 2EV5A 4CZZA 1MJ9A 2OZUA 5K5QA 1BBYA 2Q0OA 2HEOA 1OR7A 1R5GA 2E1NA 1R5HA 2K27A 4U88A 2F5EA 5DDGA 2P4WA 4FX4A 4A6DA 4G7HF 5E20A 1QQIA 1U8RA 5HVQC 2YSRA 1HBXG 3FWEA 5E1ZB 4IF4A 3RKYA 4WCGA 1GHCA 4L9TA 2PQ8A 1J0RA 5AIPA 2EJRA 4NHJA 4IRGA 2OA4A 3WGHA 5EEGA 3GFMA 3ZQ7A 2PN6A 3HHGA 3WTXC 1W7PD 2EA2A 4OMYA 1X3UA 1BI2A 4U0VA 5A2QK 3FF5A 1O3TA 1IN7A 2OQGA 3N4MA 1J7KA 3PQJA 5CVUA 1ZGJA 3T5XA 2VBYA 5DV5A 4AD9A 3QPHA 2GZWA 5HS9A 3IKTA 3WODF 3V4GA 4UNOA 4RB1A 4WXDA 3N97A 2DPDA 1FOKA 4HDUA 3GEZA 3GLXA 2FBKA 2L02A 5FD5A 1E2XA 2DAOA 2J5PA 1I27A 4RS8A 1I1GA 2ZNZA 2ZO4A 4L18B 2L4MA 2RDPA 2O8XA 3DP7A 1O7FA 3GFJA 3WE2A 4GCVA 3ZP5A 3LQRA 2XAQA 4PZJA 2W85A 2NRAC 2P5LC 1QGPA 2JSCA 4IHSA 3WG9A 3GUDA 3O3KA 3IC7A 5JR3A 3KP7A 6PAXA 2L54A 3QP5A 3JSPA 3JW4A 1SD6A 3EQLF 4HA8A 4P9FA 3FHZA 2DBBA 1LQ1A 1J5YA 1B9MA 3EETA 4HQEA 1TNTA 2RVCA 1IXSB 3GFLA 3TGNA 2FMYA 2VBWA 2P6TA 5HOOA 4OINF 3HRMA 3WTSC 2PJPA 2RV8A 3TQNA 1TBXA 2DTRA 3DEUA 1LJ9A 4WXCA 2RN7A 4B8XA 4Y13A 5DCMB 1BM9A 1K6OA 2K02A 2H94A 1BC8C 4M6XA 4L0ZB 3EYYA 2NNYA 1MD0A 1HXDA 5DYMA 4RB2C 1GXQA 4EV0A 1UHWA 2OQRA 1SD4A 4LJZF 1BI0A 3EDPA 3V7RA 2Z3YA 2QZ8A 3WGIA 4O6JA 3K0LA 1C0WA 2WV0A 1B1BA 3C3WA 1BIBA 1WKMA 3SQNA 2ZXJA 1HKQA 2DQRA 4KMFA 1TTYA 3IKVA 1U3EM 1MDMA 2DK8A 1IN6A 1FBSA 2H27A 1S3JA 2OBPA 1FBUA 2UZKA 5DD8A 2O03A 3KCCA 3TO6A 5H20A 3BPVA 3R6SA 1GXPA 2H6BA 1VTNC 3RIRA 1XSXA 3D5LA 4LMYA 3BP8A 2EFQA 2V79A 5CVJA 3HSEA 4LLGF 1O7LA 4UVAA 3V7SA 4A12A 3F23A 1JGSA 1RUNA 1LB2A 1W7PA 1FP1D 5LHHA 3GF2A 2XGXA 2A5YB 3LA7A 3JAMZ 3KLNA 3J81K 4M74A 1YW9A 2MBFA 4L9VA 4UV9A 2V9VA 4LGWA 5FLXK 3QU6A 1RNLA 2FSWA 4U7DA 1ZN2A 5KK1A 2NAZA 1D3YA 2DQLA 1W4MA 4O3MA 2L01A 2XUBA 3CUQB 3IRRA 2IP2A 4L9NA 4PCQA 3CO6C 2XIGA 3FMRA 1U5TA 3DPTA 4CDGA 1ZYRF 4MTEA 1BC7C 3WTWC 2E7WA 4KN4X 2JTVA 4M73A 3J7AO 3F21A 2FOKA 5D5XB 5BQTA 3FMSA 2MD5A 5ILSA 1YTYA 1BN5A 1H9GA 4GXOA 1FYMA 4ENJA 3TDUC 2KJCA 3BJOA 3EYIA 3M8FA 4ESJA 4YFKF 1TQIA 2Z33A 4ENMA 2FU4A 1SD7A 4N0BA 1CF7B 1LDJA 1JXSA 2HR3A 1KQ9A 1BI3A 1HSJA 4HLYA 1EV7A 4MGRA 2M5WA 2PFBA 4ASNA 2ZKZA 3KP5A 3RDIA 3T8TA 3ERED 3MZYA 4MQVA 4KDPA 5E8GA 1ONVA 2EFNA 3MAJA 1NHAA 2UXNA 3HTSB 4HF0A 4OIRF 1YS6A 4RGUA 2YPRA 3I64A 3BDDA 3TO7A 3RI4A 1Z6TA 4DNCA 1LEAA 5J8FA 2GXBA 4EJWA 3DKWA 3L00A 4UVCA 1IN5A 1TNSA 3K1PA 1ZG3A 3LAPA 2TDXA 1EH6A 2DT5A 5CVRA 1WQ2A 4XRFA 2V6CA 2DW4A 2W84A 1H0MA 4UVBA 2V1UA 2OAZA 3PFIA 1H9TA 2V1XA 2DPUA 4Y15A 2FRHA 4L5JA 3HRTA 2UXXA 3HSRA 2K7LA 1S7AA 4HQMA 2YX4A 2BE5F 4G9YA 4EM0B 1XCVA 5K5OA 3E97A 1ZREA 2GAUA 4U0WA 1IXRC 2F5CA 2COMA 4ZYEA 5JFRA 2HWVA 3FM3A 4A0XA 3LQQA 3QOPA 2VXZA 1SFEA 2CYYA 2VN2A 1YLFA 2XKPA 1R1VA 2CSOA 5ICEA 1FPQA 3KETA 3WU1B 2Z9OA 3M1EA 1P6RA 3K1MA 2GWRA 2DLLA 3SZPA 4A2UA 2GA2A 1G3SA 1W5TA 1P92A 1XSVA 3HRSA 4L5IA 1T2KA 3R4KA 2FE3A 1LNWA 3OOPA 4KMUX 3ABUA 1QNTA 2FA5A 3KFWX 3HHHA 2QWWA 2Z5UA 3H3ZA 4CO8A 4RAZA 5JVTA 1Z9CA 1G3TA 1ZLJA 3KP3A 3JSOA 1S8NA 3MQ0A 3IWFA 2PBIA 2XKOA 2DFIA 3KEQA 3KEOA 1SFUA 2RKHA 1QZZA 5IT9K 1G3YA 1OKRA 2L3DA 5CJ9A 3E5XA 4IRIA 3SXYA 3D0SA 3R61A 4XSXF 4CXFA 3VEPA 3MFKA 2WTEA 1USSA 1GVJA 5L3DA 3WTTC 3E5UA 1DPRA 2M1BA 1O57A 3LSTA 3M9AA 1TW3A 2F5FA 4ZYGA 1LDKB 1O3SA 5F64A 3G73A 2ADUA 1AWCA 4IXAA 3L7WA 4EGYA 5J6XA 5FFXA 5D8LB 2G9WA 4XLPF 1V3FA 4BYYA 1SAXA 5LLQA 2QBYA 4KFCA 1YQAA 2VOOA 3J81Z 2EV0A 4GYIA 4MEXF 1RUOA 2BYVE 3AAFA 5FLXZ 3V8KA 5BPIA 4WF2A 2O6GE 3K2ZA 4ZZLA 5HS7A 3FZVA 3HYIA 2M30A 2EFOA 1T38A 1ULYA 4HBLA 4CGZA 2ZFWA 4I7HA 1QZYA 1B6AA 2XAHA 3ZMUA 1LDDA 1R00A 2ELHA 3W6JB 1XGNA 1QBJA 3P9KA 4TV7A 5BPDA 1JHHA 3CDHA 2YR2A 3I59B 3HTUA 2CFXA 1EH8A 2MLGA 3COAC 3I53A 2BBYA 4WWCA 3H92A 4BHCA 4OIPF 1KYZA 3LA3A 3KE2A 1WSUA 4LG0B 5H6RA 5CVIA 1ZRDA 2CO5A 3GXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH9 A;  3WGG A;  3HOS A;  2A07 F;  2VON A;  3QPT A;  4MNU A;  2KJB A;  2DI3 A;  4BH9 A;  3M8E A;  3RJP A;  2M87 A;  3R0J A;  5L3F A;  1R58 A;  3C18 A;  5IT3 A;  1KQ0 A;  1TQM A;  3SFZ A;  4EJO A;  3VB2 A;  1I5Z A;  2VBX A;  5DCM A;  4Q4Z F;  5BS6 A;  2W24 A;  2P5V A;  2D1V A;  2UWM A;  3ZMS A;  2P7C B;  3BOQ A;  4KIC A;  4HX7 A;  1HW1 A;  5LGU A;  2F2E A;  3MCZ A;  4JK1 X;  1PDN C;  2A69 F;  1OPC A;  1F1Z A;  3CLO A;  4PDK A;  5ILU A;  2IA1 A;  1QPM A;  1REP C;  3U2R A;  3I5U A;  1BOA A;  2G7H A;  4AVP A;  1MJB A;  5D5V B;  2VE8 A;  4MHG A;  4H0E A;  1FX7 A;  4LFU A;  3I0T A;  4LLN A;  1UHM A;  1UST A;  4K2E A;  4N9I A;  1ZG1 A;  3Q9V A;  4ENN A;  4RGR A;  4HF1 A;  3MWM A;  1ZHF A;  1U6G A;  3F22 A;  3P7N A;  1B4A A;  3O6B B;  4WXH A;  4A5N A;  5JI6 A;  5HDG A;  1MDM B;  4OMZ A;  5K5R A;  5L3B A;  3HUG A;  4BXU A;  4EJV A;  1JHF A;  3C1D A;  1O3R A;  3ULQ B;  2JZY A;  1TQP A;  1LEB A;  3DF8 A;  1KYW A;  4EGZ A;  2CGP A;  3B73 A;  1L0O C;  3K69 A;  1K79 A;  4I01 A;  3VOD A;  3ZMD A;  2VT2 A;  4ZYH A;  4U7B A;  1W5S A;  2Q2E A;  1P4W A;  1T0F A;  3H3U A;  3CUQ A;  1W7P B;  1MKM A;  4RAY A;  4LK0 F;  5FO5 A;  3F8C A;  3DQV C;  3F8B A;  3KP6 A;  1UCR A;  5K1Y A;  5AIQ A;  3CJN A;  4HX4 A;  2HKX A;  4AWX B;  4ZH4 F;  1IF1 A;  3GO5 A;  2QQA A;  3GVA A;  2XV4 S;  1J2X A;  4P9U A;  1ZGA A;  2EA4 A;  2FNP A;  2A61 A;  2XHK A;  3RYP A;  1B59 A;  1B9N A;  1IN8 A;  3ML6 A;  4KN7 X;  1DPU A;  2GA1 A;  4N9H A;  4I09 A;  3Q5F A;  5E17 F;  4XLN F;  5E1X A;  2Y48 A;  3U1D A;  3SHF A;  2VT3 A;  1IAW A;  5J8C A;  5E18 F;  4E70 A;  3I58 A;  3ZMT A;  1YS7 A;  2E7X A;  1G4D A;  1YIO A;  4D0P A;  1A04 A;  1KU3 A;  2OD5 A;  1O3Q A;  4IPA A;  3T1B A;  1KGS A;  3F8M A;  1MJA A;  4IVN A;  1FSH A;  3FMQ A;  4UUV A;  1LVA A;  4BHP A;  3KZZ A;  2VC1 A;  2PEX A;  5FFZ A;  2L4A A;  3CUO A;  4IHT A;  4UHT A;  1U5T C;  1ZH5 A;  1XGS A;  1IXC A;  4Q47 A;  3L2C A;  2DU9 A;  2LF7 A;  1K78 A;  5LRR A;  5KVR A;  5DD4 A;  2ZCW A;  3ZN1 A;  2VBZ A;  2ACJ A;  2BEO A;  1FYL A;  5A2Q Z;  2QLZ A;  2LDU A;  4CIC A;  1SMT A;  2KIU A;  3C7J A;  4A5M A;  4BNC A;  4HZF A;  3DFG A;  1KU2 A;  2F5D A;  3GX4 X;  1YG2 A;  1ZLK A;  1XB4 A;  5EEH A;  3P9C A;  4HAM A;  4WK8 F;  4P5O A;  1SD5 A;  2CG4 A;  4GGG A;  1ZG5 A;  3KZY A;  5D6E A;  5TRD A;  1T39 A;  1FLI A;  4AIJ A;  4IRH A;  2K86 A;  3G3Z A;  4L0Y B;  2W57 A;  3RYR A;  3QP6 A;  3RKW A;  1YFH A;  4LD5 A;  2YX7 A;  1F9N A;  3O2P E;  2K4J A;  1HW2 A;  3I71 A;  1OYI A;  1HKS A;  2HZT A;  1FZP B;  4S05 A;  5FD6 A;  1PP7 U;  3LWF A;  4BAY A;  1S7O A;  2IPQ X;  2VOP A;  5F6F A;  2E1C A;  4KIF A;  4HV6 A;  4DQ2 A;  1BI1 A;  1K7A A;  1XGM A;  4FHT A;  4HYE A;  1AOY A;  1ZAO A;  5BMZ A;  4KIG A;  3BRO A;  1EH7 A;  3JAM K;  2XRN A;  2OU2 A;  2D2W A;  3LA2 A;  4KNY A;  2JRT A;  5D6F A;  4KIB A;  5DCF A;  4M71 A;  1FBQ A;  4M72 A;  2P6S A;  4G7Z F;  2QM3 A;  3F3X A;  4GO1 A;  1DP7 P;  4KT5 C;  1RI7 A;  3KP4 A;  3BY6 A;  1ZRF A;  2MLK A;  1QO0 D;  3R0A A;  4ESB A;  3RPQ A;  3PQK A;  1SFX A;  3TDZ C;  1IW7 F;  1UB9 A;  4F7Z A;  2XRO A;  2XAJ A;  3FXU A;  2QQB A;  3WTV C;  1G6N A;  5ILV A;  5CYV A;  1XSD A;  2HKO A;  1U2W A;  1R22 A;  2ZME B;  4B09 A;  2O0Y A;  2KIF A;  1J9I A;  2EB7 A;  2MC3 A;  3NEU A;  3DXJ F;  2RC4 A;  3IL2 A;  1Y0U A;  2D45 A;  2X0L A;  2ZBK A;  3QRF F;  4OOI A;  2RGV A;  1D8J A;  1HW5 A;  2LKP A;  2IJL A;  1R23 A;  4O5V A;  2KKO A;  4ENK A;  2OZ6 A;  2M45 A;  2HQN A;  4ZZD A;  1IUY A;  3MEX A;  3Q9S A;  1YW7 A;  3LAJ A;  1RIO H;  3BJ6 A;  4EVI A;  3V8L A;  5TJJ A;  2PLY A;  1T6S A;  1HQC A;  2GIV A;  4KYW A;  4HOB A;  2Y75 A;  3F8N A;  3HIF A;  4NQW A;  5ICC A;  2EV6 A;  4ETS A;  3K9T A;  2EFW A;  2QBY B;  2HQR A;  1JE8 A;  5DUK A;  3I59 A;  2HYG D;  4P55 A;  5LGN A;  4G8X A;  4MTD A;  1FSE A;  5D5W B;  3WE3 A;  1P2F A;  1IRG A;  3BPX A;  2AS5 F;  2EK5 A;  1XMA A;  3JTH A;  1Z05 A;  2YU3 A;  5HS8 A;  3GZ6 A;  2PMH A;  5BOX A;  4LG0 A;  2HDC A;  4LLL A;  2RNJ A;  2WC2 A;  4EM1 A;  3ELK A;  1KQ8 A;  2PMU A;  2VE9 A;  4Q48 A;  1RZ4 A;  4RB3 C;  2VOD A;  1DUX C;  2HFH A;  3DV8 A;  5E1W A;  3NRV A;  3J80 K;  3E6D A;  2GXG A;  4HF2 A;  3RKX A;  2DK5 A;  3IHU A;  3MZH A;  1OYW A;  4RB0 A;  3WTY C;  4I0B A;  4S04 A;  1UFM A;  4EJU A;  5ICF A;  3T0Y A;  3JTG A;  1F4K A;  4LK1 F;  1OMI A;  1R36 A;  1XMK A;  2CQK A;  1U78 A;  1E17 A;  1Z6R A;  1TW2 A;  2XAS A;  3BWG A;  2R3S A;  2VC0 A;  2LSO A;  3FX3 A;  2KIM A;  5DUI A;  4FX0 A;  1KU9 A;  2IT0 A;  2P7V B;  5ED4 A;  5LGT A;  4XSZ F;  3M7G A;  2QEN A;  1S29 A;  5JHU A;  1I6X A;  2XVC A;  2IVM A;  4RGS A;  1ODD A;  2EFP A;  1D8K A;  3BJA A;  4G94 A;  3ZMV A;  3ABT A;  1P4X A;  3IRQ A;  4EM2 A;  2C6Y A;  4LB5 A;  4ESF A;  2LF8 A;  3VFZ A;  4YFN F;  5ICG A;  2FXA A;  3E6M A;  1FP2 A;  1R7J A;  4A0Z A;  4NB5 A;  4BHB A;  4JBA A;  4R1H A;  3E5Q A;  1XCB A;  1S6L A;  3RPU A;  2XAF A;  3B02 A;  3SZT A;  3WTU C;  1R1U A;  1KU7 A;  3EUH A;  3W6K B;  3GFI A;  1XN7 A;  3V7C A;  1PUE E;  1XGO A;  2G7U A;  2A68 F;  4Z2Y A;  4Q5S F;  3E6C C;  1Q1H A;  3GZ5 A;  3OV8 A;  2KRF A;  2HS5 A;  2H6C A;  2JPC A;  3TOB A;  2D1H A;  2GQQ A;  2FBI A;  3RTR A;  5LRS A;  3E6B A;  2BV6 A;  2QVO A;  4BQA A;  1XDS A;  1TLH B;  4JQF A;  2A3S A;  5D4S A;  5DEQ A;  4ZYD A;  2JT1 A;  3IWZ A;  4G6D A;  2R7F A;  4U0Y A;  1WWX A;  4L9J A;  2MA3 A;  5LEJ A;  2FQ3 A;  2ZJ2 A;  1R1T A;  5CVV A;  2A6E F;  4G7O F;  3DPL C;  1WI9 A;  3T8R A;  3P9I A;  2FNA A;  1FY7 A;  4WX9 A;  1WRJ A;  2P5K A;  5FB2 A;  1ZRC A;  4R8H A;  4M9Z A;  3ZMZ A;  1PP8 F;  5HDK A;  1P4A A;  2FEZ A;  4AIK A;  1U5T B;  5AON A;  5IT9 Z;  1CF7 A;  3ROU A;  1IRF A;  1Z1D A;  3CO7 C;  2HOE A;  4UXN A;  2ETH A;  2BGC A;  4I02 A;  4R79 A;  2STT A;  5LBQ A;  4UV8 A;  2A6H F;  4QWQ A;  5D8K B;  1XD7 A;  5LEK A;  3E3V A;  1FNN A;  3CUQ C;  3ECO A;  1F5T A;  4KUM A;  4CYD A;  4M9X A;  2V1D A;  4XBF A;  2HTS A;  3F6V A;  2FF4 A;  4MEY F;  4OIO F;  2MH2 A;  2IRF G;  4A6E A;  3HRU A;  2CWE A;  4PGH A;  2W25 A;  2O3F A;  4YIF A;  1DDN A;  2O61 A;  4EJT A;  1STZ A;  5ERI A;  5L3C A;  3KLO A;  4HX8 A;  5CLS A;  2EWN A;  3GYH X;  2CW0 F;  5L3G A;  2STW A;  1I1S A;  2JPB A;  2QQ9 A;  4IJA A;  2ESH A;  2PG4 A;  2Q8K A;  3L9F A;  5F1R A;  5HDN A;  2FML A;  2M8E A;  1Z91 A;  1G3W A;  4I0A A;  1K78 B;  1YW8 A;  3I54 A;  3F6O A;  4YG2 F;  5LHI A;  1YYV A;  3F8F A;  1CGP A;  1SMY F;  2X4H A;  2DO7 A;  2J5O A;  3FXR A;  4FT8 A;  1MZB A;  4RGX A;  3GW2 A;  4MQ9 F;  2QUF A;  1J59 A;  1Z7U A;  2R7D A;  3ZPL A;  3REO A;  3K1N A;  3HSF A;  2K4B A;  5HLI A;  1ON2 A;  5HLG A;  4GYG A;  1V4R A;  3BZ6 A;  4YFX F;  4AIH A;  2Z99 A;  4OU0 A;  1IZ1 A;  1FWZ A;  2NYX A;  2ZNY A;  4HW0 A;  2PI0 A;  4M9S A;  3ISP A;  2ISY A;  4Y17 A;  3WU0 A;  4YII A;  3GWZ A;  1D5V A;  3J80 Z;  1ON1 A;  5E8I A;  4HDV A;  3CTA A;  3KP2 A;  3FM5 A;  3HOT A;  3I4P A;  2NNN A;  4ON0 A;  5D4R A;  5L3E A;  1L3L A;  1FC3 A;  3QU3 A;  2QYO A;  2ISZ A;  4I98 B;  3U9G A;  4CHU A;  3QAH A;  3WTZ A;  4P96 A;  2ESN A;  2H09 A;  3LFK A;  4G6Q A;  3S2W A;  2RQP A;  2Y0M A;  5HLH A;  1HKT A;  2HGC A;  3R60 A;  5D5U B;  1BJA A;  3NQO A;  1T98 A;  1HST A;  3TKY A;  2IW5 A;  1BIA A;  4HV5 A;  2AXL A;  3ECH A;  4A0Y A;  2LNB A;  5H6Q A;  4HLX A;  3ZN0 A;  3VOE A;  5LHG A;  3FXQ A;  4EQQ A;  2HTJ A;  4OIQ F;  4I2O A;  1KA8 A;  1MGT A;  4LB6 B;  1YO5 C;  3F72 A;  4KA4 A;  1ZAR A;  2B0L A;  3TOA A;  4PGG A;  4EMS A;  1IN4 A;  2IA2 A;  3V8J A;  2ZME A;  2XAG A;  2HYF A;  2NS0 A;  1XDU A;  1J75 A;  1OYY A;  2P8T A;  1FYK A;  5FGM A;  3TO9 A;  2FBH A;  1FT9 A;  3L09 A;  2WWY A;  4QLC U;  2IA0 A;  4M6Y A;  2EV5 A;  4CZZ A;  1MJ9 A;  2OZU A;  5K5Q A;  1BBY A;  2Q0O A;  2HEO A;  1OR7 A;  1R5G A;  2E1N A;  1R5H A;  2K27 A;  4U88 A;  2F5E A;  5DDG A;  2P4W A;  4FX4 A;  4A6D A;  4G7H F;  5E20 A;  1QQI A;  1U8R A;  5HVQ C;  2YSR A;  1HBX G;  3FWE A;  5E1Z B;  4IF4 A;  3RKY A;  4WCG A;  1GHC A;  4L9T A;  2PQ8 A;  1J0R A;  5AIP A;  2EJR A;  4NHJ A;  4IRG A;  2OA4 A;  3WGH A;  5EEG A;  3GFM A;  3ZQ7 A;  2PN6 A;  3HHG A;  3WTX C;  1W7P D;  2EA2 A;  4OMY A;  1X3U A;  1BI2 A;  4U0V A;  5A2Q K;  3FF5 A;  1O3T A;  1IN7 A;  2OQG A;  3N4M A;  1J7K A;  3PQJ A;  5CVU A;  1ZGJ A;  3T5X A;  2VBY A;  5DV5 A;  4AD9 A;  3QPH A;  2GZW A;  5HS9 A;  3IKT A;  3WOD F;  3V4G A;  4UNO A;  4RB1 A;  4WXD A;  3N97 A;  2DPD A;  1FOK A;  4HDU A;  3GEZ A;  3GLX A;  2FBK A;  2L02 A;  5FD5 A;  1E2X A;  2DAO A;  2J5P A;  1I27 A;  4RS8 A;  1I1G A;  2ZNZ A;  2ZO4 A;  4L18 B;  2L4M A;  2RDP A;  2O8X A;  3DP7 A;  1O7F A;  3GFJ A;  3WE2 A;  4GCV A;  3ZP5 A;  3LQR A;  2XAQ A;  4PZJ A;  2W85 A;  2NRA C;  2P5L C;  1QGP A;  2JSC A;  4IHS A;  3WG9 A;  3GUD A;  3O3K A;  3IC7 A;  5JR3 A;  3KP7 A;  6PAX A;  2L54 A;  3QP5 A;  3JSP A;  3JW4 A;  1SD6 A;  3EQL F;  4HA8 A;  4P9F A;  3FHZ A;  2DBB A;  1LQ1 A;  1J5Y A;  1B9M A;  3EET A;  4HQE A;  1TNT A;  2RVC A;  1IXS B;  3GFL A;  3TGN A;  2FMY A;  2VBW A;  2P6T A;  5HOO A;  4OIN F;  3HRM A;  3WTS C;  2PJP A;  2RV8 A;  3TQN A;  1TBX A;  2DTR A;  3DEU A;  1LJ9 A;  4WXC A;  2RN7 A;  4B8X A;  4Y13 A;  5DCM B;  1BM9 A;  1K6O A;  2K02 A;  2H94 A;  1BC8 C;  4M6X A;  4L0Z B;  3EYY A;  2NNY A;  1MD0 A;  1HXD A;  5DYM A;  4RB2 C;  1GXQ A;  4EV0 A;  1UHW A;  2OQR A;  1SD4 A;  4LJZ F;  1BI0 A;  3EDP A;  3V7R A;  2Z3Y A;  2QZ8 A;  3WGI A;  4O6J A;  3K0L A;  1C0W A;  2WV0 A;  1B1B A;  3C3W A;  1BIB A;  1WKM A;  3SQN A;  2ZXJ A;  1HKQ A;  2DQR A;  4KMF A;  1TTY A;  3IKV A;  1U3E M;  1MDM A;  2DK8 A;  1IN6 A;  1FBS A;  2H27 A;  1S3J A;  2OBP A;  1FBU A;  2UZK A;  5DD8 A;  2O03 A;  3KCC A;  3TO6 A;  5H20 A;  3BPV A;  3R6S A;  1GXP A;  2H6B A;  1VTN C;  3RIR A;  1XSX A;  3D5L A;  4LMY A;  3BP8 A;  2EFQ A;  2V79 A;  5CVJ A;  3HSE A;  4LLG F;  1O7L A;  4UVA A;  3V7S A;  4A12 A;  3F23 A;  1JGS A;  1RUN A;  1LB2 A;  1W7P A;  1FP1 D;  5LHH A;  3GF2 A;  2XGX A;  2A5Y B;  3LA7 A;  3JAM Z;  3KLN A;  3J81 K;  4M74 A;  1YW9 A;  2MBF A;  4L9V A;  4UV9 A;  2V9V A;  4LGW A;  5FLX K;  3QU6 A;  1RNL A;  2FSW A;  4U7D A;  1ZN2 A;  5KK1 A;  2NAZ A;  1D3Y A;  2DQL A;  1W4M A;  4O3M A;  2L01 A;  2XUB A;  3CUQ B;  3IRR A;  2IP2 A;  4L9N A;  4PCQ A;  3CO6 C;  2XIG A;  3FMR A;  1U5T A;  3DPT A;  4CDG A;  1ZYR F;  4MTE A;  1BC7 C;  3WTW C;  2E7W A;  4KN4 X;  2JTV A;  4M73 A;  3J7A O;  3F21 A;  2FOK A;  5D5X B;  5BQT A;  3FMS A;  2MD5 A;  5ILS A;  1YTY A;  1BN5 A;  1H9G A;  4GXO A;  1FYM A;  4ENJ A;  3TDU C;  2KJC A;  3BJO A;  3EYI A;  3M8F A;  4ESJ A;  4YFK F;  1TQI A;  2Z33 A;  4ENM A;  2FU4 A;  1SD7 A;  4N0B A;  1CF7 B;  1LDJ A;  1JXS A;  2HR3 A;  1KQ9 A;  1BI3 A;  1HSJ A;  4HLY A;  1EV7 A;  4MGR A;  2M5W A;  2PFB A;  4ASN A;  2ZKZ A;  3KP5 A;  3RDI A;  3T8T A;  3ERE D;  3MZY A;  4MQV A;  4KDP A;  5E8G A;  1ONV A;  2EFN A;  3MAJ A;  1NHA A;  2UXN A;  3HTS B;  4HF0 A;  4OIR F;  1YS6 A;  4RGU A;  2YPR A;  3I64 A;  3BDD A;  3TO7 A;  3RI4 A;  1Z6T A;  4DNC A;  1LEA A;  5J8F A;  2GXB A;  4EJW A;  3DKW A;  3L00 A;  4UVC A;  1IN5 A;  1TNS A;  3K1P A;  1ZG3 A;  3LAP A;  2TDX A;  1EH6 A;  2DT5 A;  5CVR A;  1WQ2 A;  4XRF A;  2V6C A;  2DW4 A;  2W84 A;  1H0M A;  4UVB A;  2V1U A;  2OAZ A;  3PFI A;  1H9T A;  2V1X A;  2DPU A;  4Y15 A;  2FRH A;  4L5J A;  3HRT A;  2UXX A;  3HSR A;  2K7L A;  1S7A A;  4HQM A;  2YX4 A;  2BE5 F;  4G9Y A;  4EM0 B;  1XCV A;  5K5O A;  3E97 A;  1ZRE A;  2GAU A;  4U0W A;  1IXR C;  2F5C A;  2COM A;  4ZYE A;  5JFR A;  2HWV A;  3FM3 A;  4A0X A;  3LQQ A;  3QOP A;  2VXZ A;  1SFE A;  2CYY A;  2VN2 A;  1YLF A;  2XKP A;  1R1V A;  2CSO A;  5ICE A;  1FPQ A;  3KET A;  3WU1 B;  2Z9O A;  3M1E A;  1P6R A;  3K1M A;  2GWR A;  2DLL A;  3SZP A;  4A2U A;  2GA2 A;  1G3S A;  1W5T A;  1P92 A;  1XSV A;  3HRS A;  4L5I A;  1T2K A;  3R4K A;  2FE3 A;  1LNW A;  3OOP A;  4KMU X;  3ABU A;  1QNT A;  2FA5 A;  3KFW X;  3HHH A;  2QWW A;  2Z5U A;  3H3Z A;  4CO8 A;  4RAZ A;  5JVT A;  1Z9C A;  1G3T A;  1ZLJ A;  3KP3 A;  3JSO A;  1S8N A;  3MQ0 A;  3IWF A;  2PBI A;  2XKO A;  2DFI A;  3KEQ A;  3KEO A;  1SFU A;  2RKH A;  1QZZ A;  5IT9 K;  1G3Y A;  1OKR A;  2L3D A;  5CJ9 A;  3E5X A;  4IRI A;  3SXY A;  3D0S A;  3R61 A;  4XSX F;  4CXF A;  3VEP A;  3MFK A;  2WTE A;  1USS A;  1GVJ A;  5L3D A;  3WTT C;  3E5U A;  1DPR A;  2M1B A;  1O57 A;  3LST A;  3M9A A;  1TW3 A;  2F5F A;  4ZYG A;  1LDK B;  1O3S A;  5F64 A;  3G73 A;  2ADU A;  1AWC A;  4IXA A;  3L7W A;  4EGY A;  5J6X A;  5FFX A;  5D8L B;  2G9W A;  4XLP F;  1V3F A;  4BYY A;  1SAX A;  5LLQ A;  2QBY A;  4KFC A;  1YQA A;  2VOO A;  3J81 Z;  2EV0 A;  4GYI A;  4MEX F;  1RUO A;  2BYV E;  3AAF A;  5FLX Z;  3V8K A;  5BPI A;  4WF2 A;  2O6G E;  3K2Z A;  4ZZL A;  5HS7 A;  3FZV A;  3HYI A;  2M30 A;  2EFO A;  1T38 A;  1ULY A;  4HBL A;  4CGZ A;  2ZFW A;  4I7H A;  1QZY A;  1B6A A;  2XAH A;  3ZMU A;  1LDD A;  1R00 A;  2ELH A;  3W6J B;  1XGN A;  1QBJ A;  3P9K A;  4TV7 A;  5BPD A;  1JHH A;  3CDH A;  2YR2 A;  3I59 B;  3HTU A;  2CFX A;  1EH8 A;  2MLG A;  3COA C;  3I53 A;  2BBY A;  4WWC A;  3H92 A;  4BHC A;  4OIP F;  1KYZ A;  3LA3 A;  3KE2 A;  1WSU A;  4LG0 B;  5H6R A;  5CVI A;  1ZRD A;  2CO5 A;  3GXO A; 
#chains in the Genus database with same CATH topology
 2MH9 A;  3WGG A;  2MD0 A;  3HOS A;  2A07 F;  2IAI A;  4V19 K;  1A6Q A;  2VON A;  3QPT A;  4MNU A;  1TWF J;  2KJB A;  3BT9 A;  4QPO A;  3HOX J;  2DI3 A;  4BH9 A;  3M8E A;  5F1J A;  4B3X A;  2KP6 A;  1D5Y A;  3RJP A;  4C2M J;  3L2V A;  2FUG 2;  2M87 A;  1OQY A;  2LKS A;  3R0J A;  5L3F A;  3HKZ N;  5HNH A;  2LVS A;  3S3O A;  2F4O B;  1R58 A;  1WJF A;  3C18 A;  1KQ0 A;  3WHB A;  5IT3 A;  1AA7 A;  1TQM A;  3SFZ A;  4EJO A;  3QYF A;  3PL8 A;  3VB2 A;  4E7H A;  1I5Z A;  2VBX A;  2DA6 A;  5DCM A;  3BR1 A;  1BR2 A;  4Q4Z F;  5BS6 A;  2AXT C;  1HF0 A;  4RAF A;  1VFC A;  2IGO A;  1ETO A;  2B63 J;  2W24 A;  2P5V A;  4C3J J;  4BBR J;  2D1V A;  5J1Y A;  2UWM A;  3ZMS A;  2P7C B;  3BOQ A;  2EIM H;  4HX7 A;  4KIC A;  1HW1 A;  5B1A H;  5LGU A;  1LVK A;  2ZB9 A;  2BY0 A;  2F2E A;  3MCZ A;  2KPM A;  1TT0 A;  4JK1 X;  4B4C A;  1WH7 A;  1PDN C;  4B43 A;  2A69 F;  4IX7 A;  3K6G A;  1OPC A;  4DIQ A;  2FX0 A;  1F1Z A;  1JUM A;  1W0U A;  1ZK8 A;  1DP3 A;  3CLO A;  4H4K C;  2XF7 A;  4PDK A;  5ILU A;  4DGW B;  2IA1 A;  1QPM A;  3PUF A;  1REP C;  3U2R A;  2W4S A;  3MKY B;  3OYG A;  2COB A;  3I5U A;  1BOA A;  3S17 J;  2E34 A;  2G7H A;  4AVP A;  1MJB A;  5D5V B;  2EZK A;  2VE8 A;  4MHG A;  4H0E A;  1CQT A;  3LSR A;  1OCT C;  1FX7 A;  4LFU A;  4BKX A;  2JQ7 A;  3I0T A;  4LLN A;  1FJL A;  3SEZ A;  1UHM A;  4LOC A;  1UST A;  4K2E A;  1JUS A;  4N9I A;  3NAU A;  1WJD A;  2HXO A;  1ZG1 A;  3Q9V A;  4CUG A;  4XOR A;  4ENN A;  3GTO J;  1UG2 A;  4RGR A;  2MW8 A;  1RR7 A;  1ERD A;  4HF1 A;  2DMP A;  3MWM A;  1ZHF A;  4F55 A;  1U6G A;  2M0C A;  2DFE A;  2P0W A;  1YRN B;  1MW7 A;  3F22 A;  2BZT A;  3P7N A;  1B4A A;  2RRE A;  3O6B B;  2M7A A;  4WXH A;  4A5N A;  5JI6 A;  2HYJ A;  3BG5 A;  3ZQH A;  3FK6 A;  5HDG A;  3VDX A;  1MDM B;  4E7I A;  4OMZ A;  5K5R A;  4BJ5 C;  5M5Y J;  5L3B A;  3HUG A;  4UB6 C;  2DOE A;  4BXU A;  3OL3 A;  1S72 I;  3LL7 A;  1Y39 A;  3HDD A;  2JWT A;  1ORK A;  2XPV A;  4EJV A;  5M5X J;  1JHF A;  2HQ5 A;  2E35 A;  3C1D A;  1O3R A;  2M4G A;  3ULQ B;  2GXA A;  2JZY A;  4BQQ A;  1TQP A;  1U9N A;  1LEB A;  3DF8 A;  4NC8 A;  1KYW A;  1V5G A;  4EGZ A;  2CGP A;  3B73 A;  1L0O C;  2ZSH B;  3OIP A;  3GZN B;  4B48 A;  5J4V A;  3K69 A;  2UV1 A;  3AG2 H;  5DS9 A;  3VSL A;  1TL8 A;  1PUF B;  4I01 A;  3VOD A;  3ZMD A;  1K79 A;  2K9L A;  2VT2 A;  1BW6 A;  1D0X A;  4MO7 A;  1X19 A;  4ZYH A;  4U7B A;  4P1W A;  1W5S A;  2YS9 A;  2Q2E A;  1P4W A;  1OIS A;  4BQN A;  1T0F A;  3H3U A;  3CUQ A;  4XRS G;  3G1L A;  1W7P B;  1Z3X A;  1MNM C;  1XS9 A;  1MKM A;  3QOD A;  3OYF A;  4RAY A;  2MGQ A;  1PVE A;  4UB8 C;  2CJJ A;  1Z21 A;  2Y9Y A;  1PJR A;  3MKL A;  3DPU A;  2LD5 A;  4LK0 F;  5FO5 A;  3F8C A;  3DQV C;  3LSI A;  3Q0U A;  1VI0 A;  1E3O C;  4BY7 J;  1AKH A;  3F8B A;  1IV6 A;  1P7I A;  3KP6 A;  1UCR A;  2VUM J;  4MFD A;  1ENH A;  5K1Y A;  1Q1V A;  3BR3 A;  4PK4 A;  5AIQ A;  3CP8 A;  3CJN A;  4HX4 A;  4NC6 A;  2HKX A;  4AWX B;  4ZH4 F;  3LOC A;  1IF1 A;  3GO5 A;  2L9N A;  2QQA A;  1FOW A;  1UEL B;  1OFC X;  2Y31 A;  3GVA A;  5IPA A;  3IUO A;  2XV4 S;  3I55 I;  1MMS A;  5H2F C;  1J2X A;  1BOB A;  1Z7L A;  3HOY J;  4P9U A;  1ZGA A;  2EA4 A;  2HQA A;  2LR8 A;  2FNP A;  2A61 A;  2XHK A;  4DJA A;  4B44 A;  2DXI A;  3RYP A;  1B59 A;  3J7A Y;  1B9N A;  1IN8 A;  3BZC A;  3ML6 A;  4KN7 X;  1VQO I;  1DPU A;  1ZR2 A;  1QVU A;  2GA1 A;  4GDF A;  4N9H A;  4CYC B;  4I09 A;  2R7Z J;  3Q5F A;  5E17 F;  2VKE A;  4XLN F;  5E1X A;  4QSH A;  2Y48 A;  2HDW A;  3U1D A;  2AQF A;  3SHF A;  2VT3 A;  2E5Z A;  1IAW A;  5J8C A;  2JN6 A;  2RQQ A;  5E18 F;  4E70 A;  2R7W A;  1UG0 A;  3HZJ A;  3I58 A;  2NVU B;  3ZMT A;  4D1Q A;  1YS7 A;  3AL0 C;  3WG7 H;  1H88 C;  3KIO A;  2E7X A;  1G4D A;  2OF7 A;  1YIO A;  2W00 A;  3CMY A;  4D0P A;  1A04 A;  3ABM H;  1KU3 A;  2OD5 A;  5CPR B;  4ZTJ A;  4IPA A;  3T1B A;  1KGS A;  3F8M A;  1MJA A;  4IVN A;  4D9J A;  3FMQ A;  1O3Q A;  4UUV A;  1FSH A;  3AG3 H;  4M3B A;  1LVA A;  4LIT A;  4BHP A;  3KZZ A;  2VC1 A;  5F0F A;  3HG9 A;  5EEA A;  2PEX A;  3BR0 A;  4JYK A;  2R7R A;  5FFZ A;  2L4A A;  3CUO A;  4IHT A;  4UHT A;  1U5T C;  2CRG A;  3I56 I;  1ZH5 A;  5EYR A;  1XGS A;  1VQ9 I;  3L2R A;  5TIS C;  3CCQ I;  3ABK H;  1IXC A;  3H0G J;  3NAR A;  4Q47 A;  1JKR C;  3L2C A;  2DU9 A;  2LY1 A;  2JA8 J;  2LF7 A;  1K78 A;  4BXX J;  5LRR A;  4F92 B;  5KVR A;  4G12 A;  5DD4 A;  1VQ8 I;  2ZCW A;  3ZN1 A;  2VBZ A;  2ACJ A;  3K4C A;  2BEO A;  1FYL A;  4CZC A;  1JT0 A;  5A2Q Z;  4ITV A;  2QLZ A;  2LDU A;  3G1M A;  4CIC A;  5C4J J;  1SMT A;  2KIU A;  3RCO A;  3C7J A;  2NVX J;  4IHW A;  5K7F A;  2QQ8 A;  2YUS A;  2CUF A;  4AYB A;  4A5M A;  3CCR I;  4BDZ A;  4BNC A;  4HZF A;  3FXO A;  3DFG A;  1KU2 A;  3FBI B;  2F5D A;  3GX4 X;  1YG2 A;  1F43 A;  1ETK A;  2JA2 A;  1ZLK A;  1XB4 A;  2MSY A;  2KIQ A;  3L2U A;  5EEH A;  3FKI J;  4XKV A;  4IZZ A;  3P9C A;  3GTG J;  4HAM A;  4WK8 F;  4P5O A;  1SD5 A;  2CG4 A;  3MN2 A;  4GGG A;  2NVQ J;  3OYL A;  1V5F A;  1Y1W J;  2KQR A;  3KZY A;  1ZG5 A;  5D6E A;  4BBS J;  3CJQ B;  5TRD A;  1T39 A;  1FLI A;  3ESW B;  4IOC F;  4AIJ A;  4XLC A;  2X85 A;  3WU2 C;  2E5N A;  3PSF A;  1QU3 A;  4XLE A;  4IRH A;  2K86 A;  3G3Z A;  4L0Y B;  3S16 J;  2IS1 A;  2W57 A;  4W97 A;  2ZFU A;  3QP6 A;  3RYR A;  4AYB N;  4QPQ A;  3RKW A;  5GAH J;  1YFH A;  3RQ4 A;  3CCY A;  4LD5 A;  2YX7 A;  2L7M P;  1F9N A;  3O2P E;  3LSH A;  3JRD A;  2K4J A;  3DLA A;  2V6E A;  3CCM I;  4X0G A;  1SC7 A;  3BTC A;  1HW2 A;  4QIW N;  4HPQ A;  2CFO A;  3I71 A;  5F04 A;  3UNG C;  1OYI A;  1HKS A;  2LYC A;  5IY5 H;  4YRV A;  3J7Z I;  3H5A A;  5M3M J;  5C4X J;  2HZT A;  1FZP B;  1VQL I;  4S05 A;  2ZC2 A;  1I50 J;  5FD6 A;  4XOP A;  2BW3 B;  3LNQ A;  2W7N A;  1JKO C;  1PP7 U;  3LWF A;  4BQO A;  4BAY A;  1S7O A;  1R4N B;  1Y6I A;  2IPQ X;  2VOP A;  1OJL A;  2HPM A;  5F6F A;  3SZG A;  2E1C A;  5C44 J;  4IO9 F;  4KIF A;  4C2U A;  2NS7 A;  4HV6 A;  4DQ2 A;  1BI1 A;  4A69 C;  1QZE A;  4CCM A;  1K7A A;  1XGM A;  4FCY A;  4FHT A;  4HYE A;  1WI3 A;  1AOY A;  1ZAO A;  5E3O A;  1GV5 A;  5BMZ A;  1IG7 A;  4KIG A;  5M5W J;  2WY7 Q;  2A05 A;  1MBJ A;  3BRO A;  2CV2 A;  3QWL A;  1B8I B;  1EH7 A;  3JAM K;  2XRN A;  2OU2 A;  2D2W A;  3LA2 A;  5DM6 F;  4KNY A;  3GLL A;  2JRT A;  1KZH A;  5D6F A;  4KIB A;  1T8I A;  1GT0 C;  2ZXH A;  2VKD A;  4RLF A;  5DCF A;  3ZQC A;  2LKX A;  4M71 A;  1FBQ A;  2VQG A;  4M72 A;  2PX9 A;  2Q1Z B;  2P6S A;  5KAI C;  1MMD A;  3C2B A;  5C3E J;  3GTK J;  1WJ5 A;  1T95 A;  3H3V K;  2WY8 Q;  1R5I D;  2EIN H;  4G7Z F;  1IJW C;  5IYC J;  1MND A;  1W5C C;  4FAS D;  2QM3 A;  3F3X A;  4GO1 A;  1DP7 P;  2LBF B;  3M07 A;  3MKW B;  2I5U A;  1MBF A;  4KT5 C;  2CMP A;  3BZK A;  1RI7 A;  1OCR H;  2QSF X;  4KIT B;  3KP4 A;  3BY6 A;  1ZRF A;  1PYV A;  3H36 A;  1FMV A;  2MLK A;  2ICW G;  3OYC A;  2XPW A;  1QO0 D;  3GCM A;  3HC7 A;  2F4I A;  3R0A A;  1UZC A;  2ME6 A;  4ESB A;  2OCE A;  2F4M B;  4GFB A;  3RPQ A;  2VLA A;  3CDI A;  1D0Z A;  3D5R C;  3PQK A;  1SFX A;  3TDZ C;  4QTR A;  1IW7 F;  1UB9 A;  4F7Z A;  3S93 A;  2XRO A;  1QPI A;  2XAJ A;  4HST A;  3FXU A;  2QQB A;  3WTV C;  1XG1 A;  1G6N A;  2WV1 A;  2XSJ C;  5ILV A;  5CYV A;  3NWS A;  1XSD A;  1Z3Y A;  1U2W A;  2DMT A;  2HKO A;  1R22 A;  2VPL A;  1ACI A;  2ZME B;  4B09 A;  2PJR A;  4CH7 A;  2KFD A;  2O0Y A;  3S32 A;  2KIF A;  1NG7 A;  1J9I A;  2EB7 A;  4XLH A;  2MC3 A;  3NEU A;  4DZP A;  4D7N A;  2P81 A;  4JX4 A;  2EIL H;  3DXJ F;  2E1O A;  2RC4 A;  4CCK A;  3IL2 A;  3ZQL A;  1Y0U A;  2D45 A;  2HU9 A;  4AVZ A;  2X0L A;  2ZBK A;  3QRF F;  1LKX A;  4OOI A;  2LOO A;  1K4S A;  2EH3 A;  1G8X A;  2HNH A;  2RGV A;  3HOW J;  1HW5 A;  1D8J A;  2LKP A;  3RPU D;  5E3N A;  2IJL A;  2R5Y A;  1R23 A;  4O5V A;  1A36 A;  3TBI A;  3TP3 A;  2KKO A;  4ENK A;  2OZ6 A;  2M45 A;  1ZEL A;  1SFK A;  2EIJ H;  3J7Y J;  2BHY A;  3FXJ A;  2HQN A;  4ZZD A;  1IUY A;  3MEX A;  3Q9S A;  1YW7 A;  1YJN I;  1HCR A;  3LAJ A;  1RIO H;  3BJ6 A;  4HRI A;  4EVI A;  4IHY A;  5JHF A;  3V8L A;  5TJJ A;  2PLY A;  5JVG F;  1T6S A;  1HQC A;  1B72 A;  4IOA F;  4AU7 A;  2GIV A;  1JUP A;  2M4K A;  4XM3 A;  2XB5 A;  4KYW A;  2HPI A;  4ZC3 A;  5F0H A;  2VQH A;  4HOB A;  2LTP A;  2Y75 A;  3F8N A;  3MMY B;  5J3L A;  4HSR A;  3HIF A;  1ZR4 A;  2L9R A;  4GRI A;  2W82 A;  2DYS H;  4NQW A;  1VQM I;  5ICC A;  2EV6 A;  1VZ0 A;  3HPH A;  4ETS A;  3K9T A;  2EFW A;  2QBY B;  2IEK A;  4CA0 A;  3VYT B;  2QGU A;  2HQR A;  1JE8 A;  4PSX A;  3OYB A;  4J01 A;  5DUK A;  3I59 A;  2HYG D;  3ZQQ A;  4P55 A;  5LGN A;  1GUU A;  4G8X A;  4X6A J;  4MTD A;  1FSE A;  5D5W B;  3H9J A;  3WE3 A;  3AG4 H;  1P2F A;  3DEW A;  1KON A;  1IRG A;  4XLF A;  3BPX A;  3PIP F;  2KT0 A;  1HLV A;  2AS5 F;  3K4M A;  2EK5 A;  1XMA A;  4HNT A;  3JTH A;  1Z05 A;  5EG0 A;  2YU3 A;  5HS8 A;  3GZ6 A;  3L2W A;  1LFP A;  3JCU C;  2PMH A;  1RRJ A;  5BOX A;  3KZI C;  4LG0 A;  2HDC A;  5B1B H;  4BEH B;  2JK3 A;  4MIM A;  2MC4 A;  1LE8 B;  4LLL A;  2RNJ A;  2WC2 A;  4EM1 A;  3BR6 A;  3TED A;  1JJ8 C;  3IAM 2;  1D1B A;  2VXD A;  3ELK A;  1KQ8 A;  2PMU A;  2VE9 A;  4Q48 A;  4XN0 A;  1RZ4 A;  1VQP I;  3X2Q H;  4RB3 C;  2VOD A;  1DUX C;  2HI3 A;  2HFH A;  1R4M B;  3DV8 A;  4BDY A;  2GOM A;  3SYT A;  2VL8 A;  3OY9 A;  5E1W A;  3NRV A;  3J80 K;  3E6D A;  2GXG A;  2BHZ A;  4RAG A;  2K9N A;  2V26 A;  4I99 C;  4HF2 A;  1E3P A;  2L9S A;  1X3Z B;  4FE4 A;  3RKX A;  2DK5 A;  1O4X A;  2LY9 A;  1GV2 A;  3IHU A;  3MZH A;  3M4O J;  1OYW A;  4RB0 A;  3WTY C;  5IP6 A;  4IHX A;  4I0B A;  4S04 A;  3GME A;  3LSM A;  1UFM A;  3U21 A;  1RKT A;  3G4S I;  4EJU A;  2IGM A;  5ICF A;  3T0Y A;  2VIX A;  3JTG A;  1F4K A;  3H5R A;  2QA4 I;  1X1P A;  1SVO A;  1OMI A;  1R36 A;  1XMK A;  4LK1 F;  1WVR A;  3KPH A;  2CQK A;  4E7K A;  1NG6 A;  1U78 A;  1FOY A;  2ZSI B;  1E17 A;  1I3Q J;  1Z6R A;  2BY1 A;  1Y56 A;  2K40 A;  2X51 A;  1TW2 A;  3DWL E;  2R7S A;  2XAS A;  3BWG A;  2R3S A;  3ZQF A;  1H89 C;  2VC0 A;  2LSO A;  2VJ4 A;  4C9Y A;  3AFH A;  3FX3 A;  2KIM A;  4PJM A;  5DUI A;  2JVH A;  2JA5 J;  1X1D A;  4FX0 A;  1KU9 A;  2IT0 A;  3CP2 A;  2P7V B;  2L0K A;  2UUZ A;  2JMW A;  1U9O A;  5ED4 A;  5LGT A;  4XSZ F;  3OYE A;  1SEU A;  5CQG A;  3M7G A;  4IQJ A;  2QEN A;  1S29 A;  3F9K A;  1T08 B;  1WJE A;  1BR4 A;  5JHU A;  1DU6 A;  1FTZ A;  3CQZ J;  1I6X A;  2FQ4 A;  2XVC A;  1UAA A;  2IVM A;  1E3H A;  4RGS A;  3PNV A;  1ODD A;  2EFP A;  1D8K A;  3BJA A;  4G94 A;  2BOL A;  4NBQ A;  2X6Y A;  3IH2 A;  2OUM A;  3ZMV A;  1JI8 A;  3ABT A;  1P4X A;  3LSG A;  1R71 A;  3BR5 A;  2CW7 A;  3IRQ A;  5IOZ A;  1TWA J;  2E71 A;  4EM2 A;  2C6Y A;  4PJ0 C;  2K3P A;  4LB5 A;  4ESF A;  4BAC A;  3HEF A;  2LF8 A;  1YRN A;  3VFZ A;  2CH0 A;  4YFN F;  2QKM B;  5ICG A;  2FXA A;  3SDB A;  3E6M A;  1TWH J;  1NK3 P;  1FP2 A;  3EPZ A;  2LLK A;  1R7J A;  3UR3 C;  4A0Z A;  1HA8 A;  3UKG A;  2O7O A;  1P9Q C;  3LSJ A;  2KIS A;  4NB5 A;  2MYS A;  4BHB A;  3K70 D;  4JBA A;  4R1H A;  3G6E I;  2WBM A;  3E5Q A;  2CV1 A;  1MIJ A;  1HDD C;  1XCB A;  1S6L A;  3RPU A;  2XAF A;  2Y9Z A;  5EGO B;  3KYC B;  3B02 A;  3SZT A;  3FIW A;  3WTU C;  2L2O A;  1R1U A;  3QPS A;  2HOS A;  2JA7 J;  1KU7 A;  3EUH A;  3CF2 A;  5B5E C;  1WPK A;  3GTP J;  3CZ6 A;  1LUJ B;  3W6K B;  2V9P A;  2A6T A;  1XN7 A;  3GFI A;  5KNL A;  3V7C A;  1X2M A;  1PUE E;  1XGO A;  2G7U A;  3A01 B;  2A68 F;  2ID3 A;  2JRM A;  1GDT A;  1SVM A;  4Z2Y A;  4ZTF A;  4Q5S F;  3E6C C;  5GPA A;  2M8G X;  1Q1H A;  3GZ5 A;  2K85 A;  3OV8 A;  1G2H A;  2KRF A;  4ZDO A;  4PJJ A;  2HS5 A;  2H6C A;  2JPC A;  2X1C A;  3TOB A;  2OCC H;  3CMA I;  2L7K A;  2F48 A;  3RQI A;  4OAY A;  2D1H A;  1UHS A;  3OSG A;  1D1A A;  2GQQ A;  2FBI A;  3W6V A;  3OOU A;  3RTR A;  3ZRG A;  5LRS A;  3CES A;  3E6B A;  2Z16 A;  2Z2S B;  1ETQ A;  3BLY A;  2QKL B;  4Z6Y A;  2HXI A;  2ZXW H;  4FE7 A;  2LMD A;  2BV6 A;  2QVO A;  4BQA A;  2KRH A;  3BCB A;  1XDS A;  4E7Z A;  1TLH B;  1UJ8 A;  2NXN B;  4JQF A;  2A3S A;  5D4S A;  5DEQ A;  2ZXI A;  4ZYD A;  2JT1 A;  3IWZ A;  4G6D A;  2R7F A;  4U0Y A;  1K6Y A;  1X1A A;  1WWX A;  3D5S C;  4L9J A;  4KT6 A;  2ZJR F;  2MA3 A;  5LEJ A;  2E36 A;  1LFB A;  1ZQ3 P;  2FQ3 A;  3AL0 B;  4AC0 A;  2ZJ2 A;  1R1T A;  5CVV A;  4OAZ A;  2A6E F;  2Q2E B;  3OWT A;  4G7O F;  3DPL C;  1WI9 A;  2JSP A;  3BR2 A;  3T8R A;  4IHV A;  3P9I A;  2FNA A;  3W3C A;  4JP0 A;  3JRE A;  1FOX A;  1FY7 A;  4WX9 A;  1WRJ A;  4ZJZ A;  1TWG J;  2P5K A;  4N4O B;  3OMY A;  5FB2 A;  2MFZ A;  1YX5 A;  1ZRC A;  3HXL A;  4R8H A;  2TCT A;  3JRC A;  4M9Z A;  3ZMZ A;  1PP8 F;  4IQ4 A;  5HDK A;  9ANT A;  1P4A A;  2FEZ A;  1FIP A;  4AIK A;  1U5T B;  1VQ4 I;  1AKH B;  5AON A;  1ETX A;  3VWB A;  5IT9 Z;  1CF7 A;  3ROU A;  1IRF A;  1Z1D A;  3EUK L;  3CO7 C;  2HOE A;  3G2B A;  2ETH A;  4UXN A;  3OS2 A;  3FK7 A;  4PUS A;  2BGC A;  4I02 A;  4R79 A;  2STT A;  5LBQ A;  4XRM A;  4UV8 A;  2A6H F;  2I10 A;  4QWQ A;  1G59 A;  4M6V A;  1T56 A;  2LRE A;  2Y69 H;  5EZH A;  2LY2 A;  4UUT A;  5D8K B;  3ABL H;  1XD7 A;  5LEK A;  1T0F C;  2TRT A;  1FNN A;  3CUQ C;  3E3V A;  5K7H A;  4W1U A;  1IV8 A;  3QPL A;  1IRX A;  4XN3 A;  3CC2 I;  1FEX A;  3ECO A;  4AUX A;  2L7Z A;  2WA0 A;  1S5L C;  1Y1V J;  2A5W A;  1U0J A;  1F5T A;  4KUM A;  3CLQ A;  4EEF G;  2V7F A;  4CYD A;  1MMN A;  1DQU A;  5FJ8 J;  3OIQ A;  1ZTR A;  4M9X A;  2V1D A;  4XBF A;  2HTS A;  3F6V A;  2FF4 A;  4MEY F;  1VQ7 I;  2MH2 A;  2VKH A;  1OCZ H;  4OIO F;  1TT5 B;  2IRF G;  4MFE A;  2FJ1 A;  4A6E A;  3HRU A;  2CWE A;  2OC6 A;  1A31 A;  4PGH A;  1X1B A;  4XIC A;  2W25 A;  2DA5 A;  2O3F A;  4YIF A;  1DDN A;  3S1R J;  1OCO H;  2K9Q A;  3W2W A;  2F5V A;  2O61 A;  4EJT A;  1STZ A;  5ERI A;  1JKQ C;  5L3C A;  2DOA A;  2QSH X;  4Y52 J;  3KLO A;  4HX8 A;  2R4G A;  4XR6 A;  5CLS A;  3Q0W A;  2EWN A;  3TP0 A;  5B66 C;  3GYH X;  2CW0 F;  5L3G A;  2STW A;  3S2H J;  1BW5 A;  1I1S A;  1GLN A;  2JPB A;  2QQ9 A;  4NUB A;  4IJA A;  2BY3 A;  1Z0X A;  2ESH A;  4JX6 A;  1MBE A;  1DGW Y;  3PNY A;  2PG4 A;  2Q8K A;  3F0C A;  3L9F A;  4HNV A;  5F1R A;  5HDN A;  2DT7 B;  2FML A;  2M8E A;  2WAD A;  1Z91 A;  1G3W A;  4I0A A;  3KYD B;  5IYB J;  1K78 B;  1YW8 A;  2CQN A;  3I54 A;  3F6O A;  2JVG A;  4PJN A;  3SDG A;  2L7F P;  4YG2 F;  5LHI A;  1VQ5 I;  3KYL A;  1YYV A;  1JTX A;  3F8F A;  1SMY F;  3OS1 A;  3OYN A;  1CGP A;  2X4H A;  3CDL A;  1GVD A;  2DO7 A;  2H1L A;  4E4H A;  1XTA A;  2J5O A;  2IS6 A;  1AU7 A;  3FXR A;  5FRM A;  2OPT A;  4DYC A;  4FT8 A;  1MZB A;  4RGX A;  3GW2 A;  5FLV A;  4MQ9 F;  2QUF A;  4BUP A;  4CCL A;  1J59 A;  1Z7U A;  1W1W E;  2IGK A;  2R7D A;  1R49 A;  3ZPL A;  3REO A;  3K1N A;  2XRL A;  3HSF A;  2NOJ B;  2K4B A;  5HLI A;  1ON2 A;  3BG6 A;  3DCF A;  5HLG A;  4GYG A;  1V4R A;  4ZDL A;  4F52 A;  3S1Q J;  3BZ6 A;  4YFX F;  3BCA A;  4AIH A;  2VQL A;  1MNE A;  1RES A;  2Z99 A;  4OU0 A;  3PO2 J;  1IZ1 A;  1FWZ A;  2NYX A;  2ZNY A;  4HW0 A;  2XSD C;  2PI0 A;  1BA5 A;  4M9S A;  3ISP A;  4CCN A;  2R7X A;  2ISY A;  5FRN A;  4Y17 A;  3KX2 A;  3WU0 A;  3JRG A;  3FXM A;  3QYB A;  4YII A;  3GWZ A;  1D5V A;  3J80 Z;  2E2I J;  1ON1 A;  5E8I A;  4HDV A;  3ZOB A;  1YE9 A;  3CTA A;  3KP2 A;  3FM5 A;  4C30 A;  3HOT A;  3I4P A;  2NNN A;  4ON0 A;  5D4R A;  1F36 A;  2R5Z B;  5J1U A;  5L3E A;  1MBH A;  1L3L A;  1P7J A;  4U87 A;  5JLW A;  1FC3 A;  3QU3 A;  3B6A A;  2QYO A;  2ISZ A;  4I98 B;  3U9G A;  4CHU A;  4A93 J;  2QSG X;  3QAH A;  1B8I A;  5IP9 J;  3WTZ A;  4P96 A;  3FIS A;  4BE2 A;  3W2V A;  2ESN A;  2X48 A;  2H09 A;  3LFK A;  3H0D A;  3HPG A;  1SAU A;  3DU6 A;  4G6Q A;  3S2W A;  2B9S A;  2RQP A;  2Y0M A;  5HLH A;  3DBH B;  1BL0 A;  1EA3 A;  5BNG A;  3E1S A;  1HKT A;  2HGC A;  3R60 A;  4LIU A;  3H35 A;  3VPR A;  4JOM A;  5D5U B;  4DW6 A;  2QEX I;  1BJA A;  1V54 H;  3NQO A;  1TC3 C;  1DU0 A;  5CKT A;  1T98 A;  1HST A;  3RKQ A;  3JRI A;  3TKY A;  4PFP A;  3DLL F;  4RLQ A;  5HOD A;  2IW5 A;  1MMG A;  1BIA A;  1RPW A;  4HV5 A;  3A02 A;  2AXL A;  4BS9 A;  3ECH A;  1VQ6 I;  4A0Y A;  2LNB A;  3S1N J;  2LBF A;  3PSI A;  3A0H C;  5H6Q A;  4D5F A;  4HLX A;  3ZN0 A;  3DEE A;  3OYK A;  2X1D A;  3VOE A;  2DDB A;  5LHG A;  3FXQ A;  4EQQ A;  4DBR A;  2HTJ A;  3HM5 A;  4OIQ F;  5GAG J;  2HDD A;  4EAT A;  4I2O A;  2WAE A;  3MD2 A;  2R93 J;  1KA8 A;  1MGT A;  2WB1 A;  1IUF A;  4LB6 B;  2IS4 A;  1YO5 C;  2KHM A;  3F72 A;  1Y0N A;  4KA4 A;  1ZAR A;  1NTC A;  2B0L A;  3TOA A;  4PGG A;  4HEA 2;  4EMS A;  2L9V A;  4A3I J;  1IN4 A;  2VJI A;  1EJ9 A;  2IA2 A;  3V8J A;  3Q0V A;  3QQA A;  2ZME A;  4NNJ A;  3A0B C;  5E3L A;  2XAG A;  3S1M J;  2HYF A;  2NS0 A;  1XDU A;  1J75 A;  1OYY A;  5FKN A;  2KDO A;  2P8T A;  1SVL A;  1FYK A;  2M34 A;  5FGM A;  5EDN A;  2XF5 A;  5GTI C;  3TO9 A;  2FBH A;  1FT9 A;  3L09 A;  2WWY A;  1EKE A;  4QLC U;  2WB1 N;  4LIV A;  2IA0 A;  4M6Y A;  2EV5 A;  5B3S H;  4CZZ A;  3BQZ A;  1MJ9 A;  1Z67 A;  2OZU A;  1BBY A;  5K5Q A;  3A4C A;  5GAE J;  1XMX A;  2Q0O A;  1R9T J;  2HEO A;  1OR7 A;  1R5G A;  4ZDP A;  2O9L A;  2E1N A;  5GPC A;  4BU2 A;  1R5H A;  2K27 A;  2RAE A;  4U88 A;  2F5E A;  5DDG A;  1FTT A;  2P4W A;  4FX4 A;  4BL0 B;  1QHG A;  4A6D A;  2OTL I;  5F08 A;  4G7H F;  2OV7 A;  4XK4 A;  5E20 A;  1QQI A;  1U8R A;  5HVQ C;  2YSR A;  1HBX G;  3FWE A;  4LG3 A;  2PJR B;  5E1Z B;  4IF4 A;  3RKY A;  4WCG A;  1X3W B;  1GHC A;  4L9T A;  2PQ8 A;  3L1P A;  3OL4 A;  1J0R A;  4RA2 A;  4Y7N J;  5AIP A;  2EJR A;  4NHJ A;  1ZGW A;  4IRG A;  2OA4 A;  5KAF C;  1ZKG A;  4HG2 A;  2BXZ A;  4UUS B;  3SEQ A;  3WGH A;  2OTJ I;  5EEG A;  4DBQ A;  3PJR A;  3GFM A;  3ZQ7 A;  2VB6 A;  2PN6 A;  3HHG A;  3WTX C;  1W7P D;  2EA2 A;  3K4L A;  4OMY A;  1X3U A;  1A6I A;  3DBL B;  1BI2 A;  4U0V A;  1QHH D;  5A2Q K;  3PO3 J;  2GLO A;  4NC7 A;  2DTZ A;  2HZD A;  3FF5 A;  1O3T A;  1IN7 A;  2OQG A;  1E0E A;  3N4M A;  1J7K A;  2XC7 A;  1V5E A;  5FKM A;  2PMZ N;  3PQJ A;  5CVU A;  1VQK I;  1JJ6 C;  4PFO A;  5J1R A;  1ZGJ A;  3T5X A;  2OJE D;  5F27 A;  2VBY A;  1SFO J;  3AG1 H;  5DV5 A;  4AD9 A;  3QPH A;  2EBI A;  2GZW A;  5HS9 A;  3I3L A;  2FOW A;  3IKT A;  3WOD F;  3V4G A;  4UNO A;  2ZJP F;  3I4N J;  4RB1 A;  4WXD A;  2O5R A;  1POG A;  2JUC A;  3N97 A;  2F6C A;  2CS3 A;  1YJW I;  4BEH A;  2DPD A;  1FOK A;  3OYD A;  1WFX A;  2DN0 A;  3G1O A;  4NQW B;  4HDU A;  5DM7 F;  3IP4 B;  3GEZ A;  3GLX A;  2FBK A;  2L02 A;  5FD5 A;  1E2X A;  1YJ9 I;  2KL4 A;  2DAO A;  2J5P A;  1I27 A;  3DKX A;  3I4M J;  2DFH A;  4RS8 A;  1I1G A;  4ZYA A;  4FET A;  2ZNZ A;  2ZO4 A;  3O8G A;  5CQE A;  5GTH C;  1WJC A;  3TW6 A;  3H9G A;  3TW7 A;  4L18 B;  2L4M A;  2RDP A;  4A3K J;  3OYI A;  2O8X A;  3DP7 A;  1O7F A;  3GFJ A;  3OYH A;  2EZI A;  3WE2 A;  4GCV A;  3ZP5 A;  3LQR A;  2XAQ A;  4II3 A;  5EG0 B;  1I6H J;  1N77 A;  4PZJ A;  2KMU A;  2KDZ A;  3FKJ A;  2W85 A;  3LSK A;  2NRA C;  2P5L C;  1QGP A;  2JSC A;  2YU9 J;  4IHS A;  4A3B J;  3H5N A;  3WG9 A;  3GUD A;  3S3M A;  3O3K A;  4XQF A;  3IC7 A;  2JUG A;  5JR3 A;  2Y0S A;  4A3C J;  3KP7 A;  6PAX A;  2AQE A;  3HOV J;  2IGN A;  1IGN A;  2K5C A;  2VI6 A;  5J47 A;  1FMW A;  2L54 A;  1MSE C;  3QP5 A;  3JSP A;  3JW4 A;  3K4N A;  4CSW A;  1SD6 A;  3EQL F;  1RET A;  4HA8 A;  4P9F A;  4PSW A;  2HOT A;  3FHZ A;  2DBB A;  2JA6 J;  1VQN I;  1LQ1 A;  2L5Q A;  1J5Y A;  1B9M A;  3EET A;  4HQE A;  1MBK A;  1HDP A;  1TNT A;  2RVC A;  1IXS B;  1IC8 A;  2DJN A;  2N8G A;  1X4P A;  1IDY A;  3M3Y J;  3GFL A;  2R7Q A;  3C2G A;  3TGN A;  3K10 A;  1D0Y A;  1YOV B;  4HNU A;  3TL4 X;  3DU5 A;  2FMY A;  2VBW A;  3IH3 A;  2P6T A;  5HOO A;  4OIN F;  1N78 A;  3HRM A;  3WTS C;  2PJP A;  1YHQ I;  2RV8 A;  2LFB A;  3TQN A;  2VAS A;  2Y0S N;  1TBX A;  2DTR A;  3CJR B;  3DEU A;  1LJ9 A;  4E7J A;  4WXC A;  2RN7 A;  4B8X A;  1MBG A;  5DCM B;  1BM9 A;  4Y13 A;  1K6O A;  2K02 A;  2H94 A;  3MKZ A;  2H8W A;  1BJZ A;  3N05 A;  1BC8 C;  3P5J A;  4V2F A;  4M6X A;  5EF6 A;  1I3A A;  3EYY A;  3CCS I;  4L0Z B;  2X6O A;  2NNY A;  4A3L J;  3CME I;  1W36 C;  2DOF A;  1MD0 A;  4IKF A;  5KCM A;  1HXD A;  4XKB A;  2DA1 A;  5DYM A;  4RB2 C;  1A5J A;  1GXQ A;  2Y30 A;  4EV0 A;  4BE1 A;  2FD5 A;  1UHW A;  2GOX B;  2OQR A;  1SD4 A;  4M3G A;  2QCO A;  2ELK A;  4LJZ F;  1BI0 A;  3EDP A;  3V7R A;  2Z3Y A;  1M1E B;  2QZ8 A;  3WGI A;  3CCL I;  4O6J A;  4N4N B;  4F91 B;  3K0L A;  1C0W A;  2WV0 A;  1K83 J;  3IAS 2;  1B1B A;  2EIK H;  3C3W A;  2Z1D A;  2LC2 A;  1RKW A;  1BIB A;  1WKM A;  3SQN A;  1VND A;  2ZXJ A;  1HKQ A;  2DQR A;  3TMO A;  4KMF A;  3ASO H;  4YIR X;  1TTY A;  3IKV A;  1U3E M;  4A3D J;  1MDM A;  2DK8 A;  1IN6 A;  1ETY A;  2WAQ A;  1FBS A;  3HOZ J;  2R7O A;  2H27 A;  4ABZ A;  1RC9 A;  2E19 A;  1K61 A;  1S3J A;  2OBP A;  3ZGK A;  1FBU A;  4NDL A;  5EGO A;  4L5E A;  2UZK A;  1N25 A;  5DD8 A;  2O03 A;  2W48 A;  3KCC A;  3TO6 A;  5J4Y A;  1IDZ A;  1DGR M;  2EZL A;  4E7L A;  3ERM A;  5H20 A;  3BPV A;  3R6S A;  1GXP A;  2H6B A;  1VTN C;  4F93 B;  3A01 A;  3B6C A;  3RIR A;  1IRZ A;  1XSX A;  3D5L A;  2LRD A;  3GTQ J;  4LMY A;  3EUA A;  1MH3 A;  2GIZ A;  3BP8 A;  3K7A J;  2EFQ A;  1PUF A;  3CMM A;  2HOA A;  2V79 A;  4CCJ A;  5CVJ A;  5EZG A;  5FKL A;  5KHD A;  3HSE A;  5M3F J;  4LLG F;  1O7L A;  1XX5 A;  4UVA A;  3V7S A;  4A12 A;  3F23 A;  5LD2 C;  2MAB A;  2WAQ N;  3CCV I;  1JGS A;  1RUN A;  1LB2 A;  1W7P A;  1FP1 D;  3HUG B;  4A3J J;  4E7S A;  1W0T A;  5LHH A;  3GF2 A;  4FTH A;  3QYE A;  2XGX A;  1APL C;  1RR8 C;  2A5Y B;  3LA7 A;  3JAM Z;  3D1N I;  3OR2 C;  3KLN A;  3J81 K;  4M74 A;  1YW9 A;  3RZO J;  2MBF A;  4L9V A;  2XDV A;  5J40 A;  2HVS A;  4UV9 A;  2V9V A;  4LGW A;  1OCP A;  5FLX K;  3QU6 A;  1RNL A;  2FSW A;  1I39 A;  2ZJQ F;  1YX3 A;  4U7D A;  1ZN2 A;  5KK1 A;  2HVR A;  2NAZ A;  2XGE A;  1D3Y A;  2R7V A;  5FRO A;  4J19 A;  3OYA A;  3ZR8 X;  4I6Z A;  2DQL A;  3M1C A;  2D5V A;  1WGX A;  1W4M A;  4O3M A;  2L01 A;  2XUB A;  3CUQ B;  4XLA A;  3IRR A;  2IP2 A;  3CD6 I;  4L9N A;  4PCQ A;  3CCJ I;  2M2E A;  4E6K G;  2XIG A;  5LFA A;  3CO6 C;  3FMR A;  1U5T A;  4RM2 A;  3DPT A;  4CDG A;  4CYC A;  1ZYR F;  2CUZ A;  3EUH C;  4MTE A;  1BC7 C;  1R6R A;  3WTW C;  2E7W A;  1EF4 A;  4A3E J;  1AHD P;  4KN4 X;  2JTV A;  4M73 A;  2KRC A;  3J7A O;  3F21 A;  2FOK A;  5D5X B;  2XB0 X;  5FKO A;  2XAU A;  5BQT A;  1UMQ A;  3FMS A;  3CJT B;  2BY2 A;  2CW8 A;  2MD5 A;  2VPR A;  2RNG A;  5ILS A;  1YTY A;  1BN5 A;  1H9G A;  4GXO A;  1FYM A;  4ENJ A;  4C2T A;  3TDU C;  2VKV A;  2KJC A;  3BJO A;  3SJM A;  1JT6 A;  3EYI A;  3M8F A;  4ESJ A;  4YFK F;  4RMN A;  1FIA A;  3SFI A;  1TQI A;  4XOT A;  2Z33 A;  4ENM A;  2B7E A;  2FU4 A;  4DYR A;  2KZG A;  3OYM A;  1Y8Q B;  3LMM A;  3HB9 A;  1SD7 A;  5TGT A;  3ZXS A;  4N0B A;  1MH4 A;  1CF7 B;  3LSP A;  1LDJ A;  1JXS A;  2R92 J;  1JKP C;  2HR3 A;  1KQ9 A;  2CQQ A;  3PM1 A;  1BI3 A;  3FXL A;  2DMU A;  3E7L A;  5FKK A;  2X6W A;  1WH5 A;  3ONQ A;  2ECC A;  3BQY A;  1HSJ A;  3JRB A;  4HLY A;  1SAN A;  5FLM J;  2DDA A;  2DA7 A;  2X6X A;  1VF9 A;  3JRH A;  4IEJ A;  1EV7 A;  5JLX A;  4MGR A;  3ZQI A;  2M5W A;  2DA2 A;  2PFB A;  2NS8 A;  3PNT A;  4ASN A;  3OR1 C;  4CCO A;  1Y8R B;  2EZH A;  3E0J B;  2ZKZ A;  3PIO F;  3KP5 A;  3RDI A;  3T8T A;  3BG3 A;  3ERE D;  4B3A A;  3MZY A;  4XKC A;  2LK2 A;  4MQV A;  4KDP A;  5E8G A;  1ONV A;  2EFN A;  2H8R A;  3MAJ A;  1NHA A;  1HOM A;  1WHU A;  3FHN A;  2UXN A;  3HTS B;  4HF0 A;  4OIR F;  2CQ7 A;  1YS6 A;  1NH3 A;  3OS0 A;  3OYJ A;  4XL9 A;  4RGU A;  4C3I J;  2LH9 A;  2VJ5 A;  2YPR A;  3CC7 I;  3HGG A;  3I64 A;  3BDD A;  3TO7 A;  4ANJ A;  1MMA A;  1Z6T A;  5DTD A;  4DNC A;  1LEA A;  3RI4 A;  3JR9 A;  3JRF A;  5J8F A;  2GXB A;  2NVY J;  4EJW A;  1U8B A;  2CQX A;  1TWC J;  2X1E A;  3DKW A;  3L00 A;  3GTJ J;  4BJT A;  4UVC A;  1IN5 A;  1TNS A;  3K1P A;  1ZG3 A;  4FQG A;  3LAP A;  4RM3 A;  4I76 A;  4A3G J;  2TDX A;  1EH6 A;  1T33 A;  2DT5 A;  1YIJ I;  5E3M A;  4A3F J;  2KLO A;  2DA3 A;  1BR1 A;  2XPU A;  1WQ2 A;  4XRF A;  3K4K A;  5CVR A;  4BE0 A;  2M3A A;  2E1M B;  2V6C A;  4OWR B;  1WZ2 A;  2DW4 A;  2W84 A;  3MVP A;  1H0M A;  2XF6 A;  2K9M A;  4G6T B;  4UVB A;  2V1U A;  1HC8 A;  2OAZ A;  3PFI A;  3S3N A;  2V1X A;  1H9T A;  2DPU A;  1S9H A;  2EPF A;  4Y15 A;  1ETV A;  2FRH A;  4L5J A;  3S8P A;  4XID A;  3LFU A;  3HRT A;  2UXX A;  3HSR A;  4X1E A;  4Y33 A;  2K7L A;  2E2J J;  2H1K A;  1S7A A;  1QA6 A;  4HQM A;  2YX4 A;  2BE5 F;  2HVQ A;  3H9Q A;  3VYR B;  2BW3 A;  5EJC A;  1N75 A;  3BG9 A;  4G9Y A;  4EM0 B;  1XCV A;  3V42 A;  2XGC A;  1Z77 A;  4XKW A;  2ELJ A;  2DJI A;  5K5O A;  3E97 A;  1TZL A;  3K4B A;  3BC8 A;  2CU7 A;  2V4J C;  1ZRE A;  2R5Z A;  2GAU A;  4IL6 C;  4U0W A;  1S7E A;  1IXR C;  2O8K A;  2F5C A;  2COM A;  5E79 C;  5IP7 J;  4ZYE A;  2E1M C;  3S15 J;  5JFR A;  2HWV A;  3FM3 A;  5GP9 A;  4D7M A;  3O8H A;  2LP0 A;  4A0X A;  3LQQ A;  2BXY A;  4Y3O A;  3QOP A;  1X2N A;  2VXZ A;  2DT6 A;  2XGD A;  1SFE A;  2CYY A;  2IS2 A;  2ECB A;  3CF5 F;  4YEJ A;  4M3D A;  2VN2 A;  4D5C A;  1ETW A;  3DTE A;  4A3M J;  1YLF A;  1QRY A;  2XKP A;  1R1V A;  2CSO A;  1W36 D;  1A35 A;  4DYQ A;  1TP4 A;  5ICE A;  1FPQ A;  3KET A;  2DMQ A;  3U1K A;  3WU1 B;  2Z9O A;  3S2D J;  3M1E A;  1WCM J;  1P6R A;  3K1M A;  2GWR A;  3K70 C;  2DLL A;  3SZP A;  4A2U A;  2GA2 A;  1G3S A;  3C2H A;  1W5T A;  3IH4 A;  4M3E A;  1P92 A;  1XSV A;  4XNF A;  2IBD A;  3CCE I;  2V1N A;  3AKZ A;  3HRS A;  3RZD J;  4L5I A;  1T2K A;  2E60 A;  3R4K A;  2FE3 A;  1LNW A;  2M7B A;  3OOP A;  3ABU A;  4KMU X;  1QNT A;  5IOY A;  2FA5 A;  3KFW X;  4PJL A;  3HHH A;  2QWW A;  3GTL J;  4C3H J;  2Z5U A;  3H3Z A;  4BGD A;  3A1Y A;  4CO8 A;  4BJ6 C;  3FDY A;  4RAZ A;  3HBL A;  2W1O A;  5JVT A;  1Z9C A;  1G3T A;  2AHQ A;  2CUE A;  1ZLJ A;  2JJ7 A;  3JRA A;  3GBG A;  3DTI A;  3KP3 A;  3ASN H;  3JSO A;  2DCE A;  1S8N A;  3MQ0 A;  3HGY A;  2GM4 A;  3IWF A;  3K2A A;  3PFY A;  1H8A C;  2PBI A;  2E2H J;  1J09 A;  2G0E A;  2DFI A;  2XKO A;  3HJE A;  3KEO A;  3KEQ A;  3GTM J;  1SFU A;  2BVM A;  2RKH A;  3I9V 2;  1QZZ A;  1V55 H;  5IT9 K;  3S14 J;  1G3Y A;  1OKR A;  2L3D A;  5CJ9 A;  3E5X A;  3IV5 A;  4IRI A;  3SXY A;  2DOD A;  3D0S A;  3R61 A;  4MLO A;  2R7T A;  2WAF A;  2M0M A;  2MG4 A;  1XC5 A;  4J00 A;  4XSX F;  1JTY A;  2KZV A;  2ME0 A;  4V2G A;  4CXF A;  4UY8 I;  5K7Z A;  3VEP A;  3MFK A;  2WTE A;  1USS A;  1GVJ A;  1QVT A;  2NOG A;  4JX5 A;  5L3D A;  1JGG A;  3WHC A;  3WTT C;  3PUB A;  3E5U A;  2PMZ A;  3QOE A;  1DPR A;  3NWT A;  4DOZ A;  1X4O A;  1O57 A;  2M1B A;  3LST A;  3M9A A;  4M3F A;  1WJB A;  1TW3 A;  2F5F A;  4ZYG A;  4B47 A;  1LDK B;  2Y2Z A;  1O3S A;  3HL2 A;  2CUJ A;  5F64 A;  3G73 A;  2ADU A;  2R0Q C;  4UUS A;  4KIS A;  1X1C A;  1ITY A;  4XMY A;  2I8D A;  1AWC A;  4AM3 A;  3BTJ A;  2ID6 A;  4IXA A;  3DKY A;  3L7W A;  4EGY A;  2V9K A;  5J6X A;  3BTL A;  5FFX A;  5D8L B;  4F3Q A;  2R7U A;  2G9W A;  2X9D A;  2K3F A;  1V3F A;  4B1R A;  4XLP F;  4BYY A;  2NVT J;  5IYD J;  1SAX A;  2DFF A;  5LLQ A;  2QBY A;  2R5Y B;  2QF7 A;  4KFC A;  2DA4 A;  1YQA A;  2VOO A;  1K4T A;  4KJZ A;  3J81 Z;  2EV0 A;  4GYI A;  4XRS A;  4S0H B;  4MEX F;  1MSF C;  3VYU B;  3HOU J;  1RUO A;  2BYV E;  2ZME C;  3KEY A;  3AAF A;  1YI2 I;  5FLX Z;  3V8K A;  2BVL A;  4WF2 A;  5BPI A;  2O6G E;  3K2Z A;  4ZZL A;  5HS7 A;  3W2A A;  3FZV A;  3HYI A;  5F0C A;  3DTK A;  2M30 A;  2EFO A;  4RBO A;  1T38 A;  2IXS A;  1LFU P;  1ULY A;  4HBL A;  3A03 A;  1B72 B;  3MZ8 A;  3RSN A;  3Q3S A;  4CGZ A;  2ZFW A;  4I7H A;  1QZY A;  1B6A A;  5GAD J;  3K4J A;  2XAH A;  3ZMU A;  1LDD A;  2AO9 A;  4XON A;  3L2Q A;  4BY1 J;  1R00 A;  3FBN B;  2ELH A;  1IO2 A;  3W6J B;  1X58 A;  1LE8 A;  1XGN A;  1QBJ A;  2CV0 A;  3ZQG A;  3P9K A;  2M9H A;  4RDU A;  3DBR B;  3CCU I;  4TV7 A;  5BPD A;  1OR7 C;  3OIO A;  1JHH A;  4Y4R A;  4FIS A;  5HNF A;  3CDH A;  1OLT A;  2GBY A;  1WJA A;  4BXF A;  2YR2 A;  3I59 B;  3HTU A;  4AID A;  5HLT A;  3ZCO A;  2CFX A;  1EH8 A;  3H1C A;  1LPQ A;  4II2 A;  2DMN A;  2MLG A;  3COA C;  3I53 A;  2BBY A;  4WWC A;  3FXK A;  2K9S A;  2VJJ A;  3H92 A;  3A2K A;  4BHC A;  1XPX A;  4OIP F;  4DZJ A;  3HKZ A;  1KYZ A;  3M8J A;  2EQR A;  3LA3 A;  3G71 I;  2LG4 A;  1OCC H;  3OSF A;  1D1C A;  3KE2 A;  3BG7 A;  4YEL A;  1WSU A;  3BTI A;  3VSK A;  4LG0 B;  3CC4 I;  2DYR H;  5H6R A;  1NK2 P;  5CVI A;  1ZRD A;  2CO5 A;  3GXO A;  3VYS B;  1YIT I;  2VQC A; 
#chains in the Genus database with same CATH homology
 2MH9 A;  3WGG A;  3HOS A;  2A07 F;  2VON A;  3QPT A;  4MNU A;  2KJB A;  2DI3 A;  4BH9 A;  3M8E A;  3RJP A;  2M87 A;  3R0J A;  5L3F A;  1R58 A;  3C18 A;  5IT3 A;  1KQ0 A;  1TQM A;  3SFZ A;  4EJO A;  3VB2 A;  1I5Z A;  2VBX A;  5DCM A;  4Q4Z F;  5BS6 A;  2W24 A;  2P5V A;  2D1V A;  2UWM A;  3ZMS A;  2P7C B;  3BOQ A;  4KIC A;  4HX7 A;  1HW1 A;  5LGU A;  2F2E A;  3MCZ A;  4JK1 X;  1PDN C;  2A69 F;  1OPC A;  1F1Z A;  3CLO A;  4PDK A;  5ILU A;  2IA1 A;  1QPM A;  1REP C;  3U2R A;  3I5U A;  1BOA A;  2G7H A;  4AVP A;  1MJB A;  5D5V B;  2VE8 A;  4MHG A;  4H0E A;  1FX7 A;  4LFU A;  3I0T A;  4LLN A;  1UHM A;  1UST A;  4K2E A;  4N9I A;  1ZG1 A;  3Q9V A;  4ENN A;  4RGR A;  4HF1 A;  3MWM A;  1ZHF A;  1U6G A;  3F22 A;  3P7N A;  1B4A A;  3O6B B;  4WXH A;  4A5N A;  5JI6 A;  5HDG A;  1MDM B;  4OMZ A;  5K5R A;  5L3B A;  3HUG A;  4BXU A;  4EJV A;  1JHF A;  3C1D A;  1O3R A;  3ULQ B;  2JZY A;  1TQP A;  1LEB A;  3DF8 A;  1KYW A;  4EGZ A;  2CGP A;  3B73 A;  1L0O C;  3K69 A;  1K79 A;  4I01 A;  3VOD A;  3ZMD A;  2VT2 A;  4ZYH A;  4U7B A;  1W5S A;  2Q2E A;  1P4W A;  1T0F A;  3H3U A;  3CUQ A;  1W7P B;  1MKM A;  4RAY A;  4LK0 F;  5FO5 A;  3F8C A;  3DQV C;  3F8B A;  3KP6 A;  1UCR A;  5K1Y A;  5AIQ A;  3CJN A;  4HX4 A;  2HKX A;  4AWX B;  4ZH4 F;  1IF1 A;  3GO5 A;  2QQA A;  3GVA A;  2XV4 S;  1J2X A;  4P9U A;  1ZGA A;  2EA4 A;  2FNP A;  2A61 A;  2XHK A;  3RYP A;  1B59 A;  1B9N A;  1IN8 A;  3ML6 A;  4KN7 X;  1DPU A;  2GA1 A;  4N9H A;  4I09 A;  3Q5F A;  5E17 F;  4XLN F;  5E1X A;  2Y48 A;  3U1D A;  3SHF A;  2VT3 A;  1IAW A;  5J8C A;  5E18 F;  4E70 A;  3I58 A;  3ZMT A;  1YS7 A;  2E7X A;  1G4D A;  1YIO A;  4D0P A;  1A04 A;  1KU3 A;  2OD5 A;  1O3Q A;  4IPA A;  3T1B A;  1KGS A;  3F8M A;  1MJA A;  4IVN A;  1FSH A;  3FMQ A;  4UUV A;  1LVA A;  4BHP A;  3KZZ A;  2VC1 A;  2PEX A;  5FFZ A;  2L4A A;  3CUO A;  4IHT A;  4UHT A;  1U5T C;  1ZH5 A;  1XGS A;  1IXC A;  4Q47 A;  3L2C A;  2DU9 A;  2LF7 A;  1K78 A;  5LRR A;  5KVR A;  5DD4 A;  2ZCW A;  3ZN1 A;  2VBZ A;  2ACJ A;  2BEO A;  1FYL A;  5A2Q Z;  2QLZ A;  2LDU A;  4CIC A;  1SMT A;  2KIU A;  3C7J A;  4A5M A;  4BNC A;  4HZF A;  3DFG A;  1KU2 A;  2F5D A;  3GX4 X;  1YG2 A;  1ZLK A;  1XB4 A;  5EEH A;  3P9C A;  4HAM A;  4WK8 F;  4P5O A;  1SD5 A;  2CG4 A;  4GGG A;  1ZG5 A;  3KZY A;  5D6E A;  5TRD A;  1T39 A;  1FLI A;  4AIJ A;  4IRH A;  2K86 A;  3G3Z A;  4L0Y B;  2W57 A;  3RYR A;  3QP6 A;  3RKW A;  1YFH A;  4LD5 A;  2YX7 A;  1F9N A;  3O2P E;  2K4J A;  1HW2 A;  3I71 A;  1OYI A;  1HKS A;  2HZT A;  1FZP B;  4S05 A;  5FD6 A;  1PP7 U;  3LWF A;  4BAY A;  1S7O A;  2IPQ X;  2VOP A;  5F6F A;  2E1C A;  4KIF A;  4HV6 A;  4DQ2 A;  1BI1 A;  1K7A A;  1XGM A;  4FHT A;  4HYE A;  1AOY A;  1ZAO A;  5BMZ A;  4KIG A;  3BRO A;  1EH7 A;  3JAM K;  2XRN A;  2OU2 A;  2D2W A;  3LA2 A;  4KNY A;  2JRT A;  5D6F A;  4KIB A;  5DCF A;  4M71 A;  1FBQ A;  4M72 A;  2P6S A;  4G7Z F;  2QM3 A;  3F3X A;  4GO1 A;  1DP7 P;  4KT5 C;  1RI7 A;  3KP4 A;  3BY6 A;  1ZRF A;  2MLK A;  1QO0 D;  3R0A A;  4ESB A;  3RPQ A;  3PQK A;  1SFX A;  3TDZ C;  1IW7 F;  1UB9 A;  4F7Z A;  2XRO A;  2XAJ A;  3FXU A;  2QQB A;  3WTV C;  1G6N A;  5ILV A;  5CYV A;  1XSD A;  2HKO A;  1U2W A;  1R22 A;  2ZME B;  4B09 A;  2O0Y A;  2KIF A;  1J9I A;  2EB7 A;  2MC3 A;  3NEU A;  3DXJ F;  2RC4 A;  3IL2 A;  1Y0U A;  2D45 A;  2X0L A;  2ZBK A;  3QRF F;  4OOI A;  2RGV A;  1D8J A;  1HW5 A;  2LKP A;  2IJL A;  1R23 A;  4O5V A;  2KKO A;  4ENK A;  2OZ6 A;  2M45 A;  2HQN A;  4ZZD A;  1IUY A;  3MEX A;  3Q9S A;  1YW7 A;  3LAJ A;  1RIO H;  3BJ6 A;  4EVI A;  3V8L A;  5TJJ A;  2PLY A;  1T6S A;  1HQC A;  2GIV A;  4KYW A;  4HOB A;  2Y75 A;  3F8N A;  3HIF A;  4NQW A;  5ICC A;  2EV6 A;  4ETS A;  3K9T A;  2EFW A;  2QBY B;  2HQR A;  1JE8 A;  5DUK A;  3I59 A;  2HYG D;  4P55 A;  5LGN A;  4G8X A;  4MTD A;  1FSE A;  5D5W B;  3WE3 A;  1P2F A;  1IRG A;  3BPX A;  2AS5 F;  2EK5 A;  1XMA A;  3JTH A;  1Z05 A;  2YU3 A;  5HS8 A;  3GZ6 A;  2PMH A;  5BOX A;  4LG0 A;  2HDC A;  4LLL A;  2RNJ A;  2WC2 A;  4EM1 A;  3ELK A;  1KQ8 A;  2PMU A;  2VE9 A;  4Q48 A;  1RZ4 A;  4RB3 C;  2VOD A;  1DUX C;  2HFH A;  3DV8 A;  5E1W A;  3NRV A;  3J80 K;  3E6D A;  2GXG A;  4HF2 A;  3RKX A;  2DK5 A;  3IHU A;  3MZH A;  1OYW A;  4RB0 A;  3WTY C;  4I0B A;  4S04 A;  1UFM A;  4EJU A;  5ICF A;  3T0Y A;  3JTG A;  1F4K A;  4LK1 F;  1OMI A;  1R36 A;  1XMK A;  2CQK A;  1U78 A;  1E17 A;  1Z6R A;  1TW2 A;  2XAS A;  3BWG A;  2R3S A;  2VC0 A;  2LSO A;  3FX3 A;  2KIM A;  5DUI A;  4FX0 A;  1KU9 A;  2IT0 A;  2P7V B;  5ED4 A;  5LGT A;  4XSZ F;  3M7G A;  2QEN A;  1S29 A;  5JHU A;  1I6X A;  2XVC A;  2IVM A;  4RGS A;  1ODD A;  2EFP A;  1D8K A;  3BJA A;  4G94 A;  3ZMV A;  3ABT A;  1P4X A;  3IRQ A;  4EM2 A;  2C6Y A;  4LB5 A;  4ESF A;  2LF8 A;  3VFZ A;  4YFN F;  5ICG A;  2FXA A;  3E6M A;  1FP2 A;  1R7J A;  4A0Z A;  4NB5 A;  4BHB A;  4JBA A;  4R1H A;  3E5Q A;  1XCB A;  1S6L A;  3RPU A;  2XAF A;  3B02 A;  3SZT A;  3WTU C;  1R1U A;  1KU7 A;  3EUH A;  3W6K B;  3GFI A;  1XN7 A;  3V7C A;  1PUE E;  1XGO A;  2G7U A;  2A68 F;  4Z2Y A;  4Q5S F;  3E6C C;  1Q1H A;  3GZ5 A;  3OV8 A;  2KRF A;  2HS5 A;  2H6C A;  2JPC A;  3TOB A;  2D1H A;  2GQQ A;  2FBI A;  3RTR A;  5LRS A;  3E6B A;  2BV6 A;  2QVO A;  4BQA A;  1XDS A;  1TLH B;  4JQF A;  2A3S A;  5D4S A;  5DEQ A;  4ZYD A;  2JT1 A;  3IWZ A;  4G6D A;  2R7F A;  4U0Y A;  1WWX A;  4L9J A;  2MA3 A;  5LEJ A;  2FQ3 A;  2ZJ2 A;  1R1T A;  5CVV A;  2A6E F;  4G7O F;  3DPL C;  1WI9 A;  3T8R A;  3P9I A;  2FNA A;  1FY7 A;  4WX9 A;  1WRJ A;  2P5K A;  5FB2 A;  1ZRC A;  4R8H A;  4M9Z A;  3ZMZ A;  1PP8 F;  5HDK A;  1P4A A;  2FEZ A;  4AIK A;  1U5T B;  5AON A;  5IT9 Z;  1CF7 A;  3ROU A;  1IRF A;  1Z1D A;  3CO7 C;  2HOE A;  4UXN A;  2ETH A;  2BGC A;  4I02 A;  4R79 A;  2STT A;  5LBQ A;  4UV8 A;  2A6H F;  4QWQ A;  5D8K B;  1XD7 A;  5LEK A;  3E3V A;  1FNN A;  3CUQ C;  3ECO A;  1F5T A;  4KUM A;  4CYD A;  4M9X A;  2V1D A;  4XBF A;  2HTS A;  3F6V A;  2FF4 A;  4MEY F;  4OIO F;  2MH2 A;  2IRF G;  4A6E A;  3HRU A;  2CWE A;  4PGH A;  2W25 A;  2O3F A;  4YIF A;  1DDN A;  2O61 A;  4EJT A;  1STZ A;  5ERI A;  5L3C A;  3KLO A;  4HX8 A;  5CLS A;  2EWN A;  3GYH X;  2CW0 F;  5L3G A;  2STW A;  1I1S A;  2JPB A;  2QQ9 A;  4IJA A;  2ESH A;  2PG4 A;  2Q8K A;  3L9F A;  5F1R A;  5HDN A;  2FML A;  2M8E A;  1Z91 A;  1G3W A;  4I0A A;  1K78 B;  1YW8 A;  3I54 A;  3F6O A;  4YG2 F;  5LHI A;  1YYV A;  3F8F A;  1CGP A;  1SMY F;  2X4H A;  2DO7 A;  2J5O A;  3FXR A;  4FT8 A;  1MZB A;  4RGX A;  3GW2 A;  4MQ9 F;  2QUF A;  1J59 A;  1Z7U A;  2R7D A;  3ZPL A;  3REO A;  3K1N A;  3HSF A;  2K4B A;  5HLI A;  1ON2 A;  5HLG A;  4GYG A;  1V4R A;  3BZ6 A;  4YFX F;  4AIH A;  2Z99 A;  4OU0 A;  1IZ1 A;  1FWZ A;  2NYX A;  2ZNY A;  4HW0 A;  2PI0 A;  4M9S A;  3ISP A;  2ISY A;  4Y17 A;  3WU0 A;  4YII A;  3GWZ A;  1D5V A;  3J80 Z;  1ON1 A;  5E8I A;  4HDV A;  3CTA A;  3KP2 A;  3FM5 A;  3HOT A;  3I4P A;  2NNN A;  4ON0 A;  5D4R A;  5L3E A;  1L3L A;  1FC3 A;  3QU3 A;  2QYO A;  2ISZ A;  4I98 B;  3U9G A;  4CHU A;  3QAH A;  3WTZ A;  4P96 A;  2ESN A;  2H09 A;  3LFK A;  4G6Q A;  3S2W A;  2RQP A;  2Y0M A;  5HLH A;  1HKT A;  2HGC A;  3R60 A;  5D5U B;  1BJA A;  3NQO A;  1T98 A;  1HST A;  3TKY A;  2IW5 A;  1BIA A;  4HV5 A;  2AXL A;  3ECH A;  4A0Y A;  2LNB A;  5H6Q A;  4HLX A;  3ZN0 A;  3VOE A;  5LHG A;  3FXQ A;  4EQQ A;  2HTJ A;  4OIQ F;  4I2O A;  1KA8 A;  1MGT A;  4LB6 B;  1YO5 C;  3F72 A;  4KA4 A;  1ZAR A;  2B0L A;  3TOA A;  4PGG A;  4EMS A;  1IN4 A;  2IA2 A;  3V8J A;  2ZME A;  2XAG A;  2HYF A;  2NS0 A;  1XDU A;  1J75 A;  1OYY A;  2P8T A;  1FYK A;  5FGM A;  3TO9 A;  2FBH A;  1FT9 A;  3L09 A;  2WWY A;  4QLC U;  2IA0 A;  4M6Y A;  2EV5 A;  4CZZ A;  1MJ9 A;  2OZU A;  5K5Q A;  1BBY A;  2Q0O A;  2HEO A;  1OR7 A;  1R5G A;  2E1N A;  1R5H A;  2K27 A;  4U88 A;  2F5E A;  5DDG A;  2P4W A;  4FX4 A;  4A6D A;  4G7H F;  5E20 A;  1QQI A;  1U8R A;  5HVQ C;  2YSR A;  1HBX G;  3FWE A;  5E1Z B;  4IF4 A;  3RKY A;  4WCG A;  1GHC A;  4L9T A;  2PQ8 A;  1J0R A;  5AIP A;  2EJR A;  4NHJ A;  4IRG A;  2OA4 A;  3WGH A;  5EEG A;  3GFM A;  3ZQ7 A;  2PN6 A;  3HHG A;  3WTX C;  1W7P D;  2EA2 A;  4OMY A;  1X3U A;  1BI2 A;  4U0V A;  5A2Q K;  3FF5 A;  1O3T A;  1IN7 A;  2OQG A;  3N4M A;  1J7K A;  3PQJ A;  5CVU A;  1ZGJ A;  3T5X A;  2VBY A;  5DV5 A;  4AD9 A;  3QPH A;  2GZW A;  5HS9 A;  3IKT A;  3WOD F;  3V4G A;  4UNO A;  4RB1 A;  4WXD A;  3N97 A;  2DPD A;  1FOK A;  4HDU A;  3GEZ A;  3GLX A;  2FBK A;  2L02 A;  5FD5 A;  1E2X A;  2DAO A;  2J5P A;  1I27 A;  4RS8 A;  1I1G A;  2ZNZ A;  2ZO4 A;  4L18 B;  2L4M A;  2RDP A;  2O8X A;  3DP7 A;  1O7F A;  3GFJ A;  3WE2 A;  4GCV A;  3ZP5 A;  3LQR A;  2XAQ A;  4PZJ A;  2W85 A;  2NRA C;  2P5L C;  1QGP A;  2JSC A;  4IHS A;  3WG9 A;  3GUD A;  3O3K A;  3IC7 A;  5JR3 A;  3KP7 A;  6PAX A;  2L54 A;  3QP5 A;  3JSP A;  3JW4 A;  1SD6 A;  3EQL F;  4HA8 A;  4P9F A;  3FHZ A;  2DBB A;  1LQ1 A;  1J5Y A;  1B9M A;  3EET A;  4HQE A;  1TNT A;  2RVC A;  1IXS B;  3GFL A;  3TGN A;  2FMY A;  2VBW A;  2P6T A;  5HOO A;  4OIN F;  3HRM A;  3WTS C;  2PJP A;  2RV8 A;  3TQN A;  1TBX A;  2DTR A;  3DEU A;  1LJ9 A;  4WXC A;  2RN7 A;  4B8X A;  4Y13 A;  5DCM B;  1BM9 A;  1K6O A;  2K02 A;  2H94 A;  1BC8 C;  4M6X A;  4L0Z B;  3EYY A;  2NNY A;  1MD0 A;  1HXD A;  5DYM A;  4RB2 C;  1GXQ A;  4EV0 A;  1UHW A;  2OQR A;  1SD4 A;  4LJZ F;  1BI0 A;  3EDP A;  3V7R A;  2Z3Y A;  2QZ8 A;  3WGI A;  4O6J A;  3K0L A;  1C0W A;  2WV0 A;  1B1B A;  3C3W A;  1BIB A;  1WKM A;  3SQN A;  2ZXJ A;  1HKQ A;  2DQR A;  4KMF A;  1TTY A;  3IKV A;  1U3E M;  1MDM A;  2DK8 A;  1IN6 A;  1FBS A;  2H27 A;  1S3J A;  2OBP A;  1FBU A;  2UZK A;  5DD8 A;  2O03 A;  3KCC A;  3TO6 A;  5H20 A;  3BPV A;  3R6S A;  1GXP A;  2H6B A;  1VTN C;  3RIR A;  1XSX A;  3D5L A;  4LMY A;  3BP8 A;  2EFQ A;  2V79 A;  5CVJ A;  3HSE A;  4LLG F;  1O7L A;  4UVA A;  3V7S A;  4A12 A;  3F23 A;  1JGS A;  1RUN A;  1LB2 A;  1W7P A;  1FP1 D;  5LHH A;  3GF2 A;  2XGX A;  2A5Y B;  3LA7 A;  3JAM Z;  3KLN A;  3J81 K;  4M74 A;  1YW9 A;  2MBF A;  4L9V A;  4UV9 A;  2V9V A;  4LGW A;  5FLX K;  3QU6 A;  1RNL A;  2FSW A;  4U7D A;  1ZN2 A;  5KK1 A;  2NAZ A;  1D3Y A;  2DQL A;  1W4M A;  4O3M A;  2L01 A;  2XUB A;  3CUQ B;  3IRR A;  2IP2 A;  4L9N A;  4PCQ A;  3CO6 C;  2XIG A;  3FMR A;  1U5T A;  3DPT A;  4CDG A;  1ZYR F;  4MTE A;  1BC7 C;  3WTW C;  2E7W A;  4KN4 X;  2JTV A;  4M73 A;  3J7A O;  3F21 A;  2FOK A;  5D5X B;  5BQT A;  3FMS A;  2MD5 A;  5ILS A;  1YTY A;  1BN5 A;  1H9G A;  4GXO A;  1FYM A;  4ENJ A;  3TDU C;  2KJC A;  3BJO A;  3EYI A;  3M8F A;  4ESJ A;  4YFK F;  1TQI A;  2Z33 A;  4ENM A;  2FU4 A;  1SD7 A;  4N0B A;  1CF7 B;  1LDJ A;  1JXS A;  2HR3 A;  1KQ9 A;  1BI3 A;  1HSJ A;  4HLY A;  1EV7 A;  4MGR A;  2M5W A;  2PFB A;  4ASN A;  2ZKZ A;  3KP5 A;  3RDI A;  3T8T A;  3ERE D;  3MZY A;  4MQV A;  4KDP A;  5E8G A;  1ONV A;  2EFN A;  3MAJ A;  1NHA A;  2UXN A;  3HTS B;  4HF0 A;  4OIR F;  1YS6 A;  4RGU A;  2YPR A;  3I64 A;  3BDD A;  3TO7 A;  3RI4 A;  1Z6T A;  4DNC A;  1LEA A;  5J8F A;  2GXB A;  4EJW A;  3DKW A;  3L00 A;  4UVC A;  1IN5 A;  1TNS A;  3K1P A;  1ZG3 A;  3LAP A;  2TDX A;  1EH6 A;  2DT5 A;  5CVR A;  1WQ2 A;  4XRF A;  2V6C A;  2DW4 A;  2W84 A;  1H0M A;  4UVB A;  2V1U A;  2OAZ A;  3PFI A;  1H9T A;  2V1X A;  2DPU A;  4Y15 A;  2FRH A;  4L5J A;  3HRT A;  2UXX A;  3HSR A;  2K7L A;  1S7A A;  4HQM A;  2YX4 A;  2BE5 F;  4G9Y A;  4EM0 B;  1XCV A;  5K5O A;  3E97 A;  1ZRE A;  2GAU A;  4U0W A;  1IXR C;  2F5C A;  2COM A;  4ZYE A;  5JFR A;  2HWV A;  3FM3 A;  4A0X A;  3LQQ A;  3QOP A;  2VXZ A;  1SFE A;  2CYY A;  2VN2 A;  1YLF A;  2XKP A;  1R1V A;  2CSO A;  5ICE A;  1FPQ A;  3KET A;  3WU1 B;  2Z9O A;  3M1E A;  1P6R A;  3K1M A;  2GWR A;  2DLL A;  3SZP A;  4A2U A;  2GA2 A;  1G3S A;  1W5T A;  1P92 A;  1XSV A;  3HRS A;  4L5I A;  1T2K A;  3R4K A;  2FE3 A;  1LNW A;  3OOP A;  4KMU X;  3ABU A;  1QNT A;  2FA5 A;  3KFW X;  3HHH A;  2QWW A;  2Z5U A;  3H3Z A;  4CO8 A;  4RAZ A;  5JVT A;  1Z9C A;  1G3T A;  1ZLJ A;  3KP3 A;  3JSO A;  1S8N A;  3MQ0 A;  3IWF A;  2PBI A;  2XKO A;  2DFI A;  3KEQ A;  3KEO A;  1SFU A;  2RKH A;  1QZZ A;  5IT9 K;  1G3Y A;  1OKR A;  2L3D A;  5CJ9 A;  3E5X A;  4IRI A;  3SXY A;  3D0S A;  3R61 A;  4XSX F;  4CXF A;  3VEP A;  3MFK A;  2WTE A;  1USS A;  1GVJ A;  5L3D A;  3WTT C;  3E5U A;  1DPR A;  2M1B A;  1O57 A;  3LST A;  3M9A A;  1TW3 A;  2F5F A;  4ZYG A;  1LDK B;  1O3S A;  5F64 A;  3G73 A;  2ADU A;  1AWC A;  4IXA A;  3L7W A;  4EGY A;  5J6X A;  5FFX A;  5D8L B;  2G9W A;  4XLP F;  1V3F A;  4BYY A;  1SAX A;  5LLQ A;  2QBY A;  4KFC A;  1YQA A;  2VOO A;  3J81 Z;  2EV0 A;  4GYI A;  4MEX F;  1RUO A;  2BYV E;  3AAF A;  5FLX Z;  3V8K A;  5BPI A;  4WF2 A;  2O6G E;  3K2Z A;  4ZZL A;  5HS7 A;  3FZV A;  3HYI A;  2M30 A;  2EFO A;  1T38 A;  1ULY A;  4HBL A;  4CGZ A;  2ZFW A;  4I7H A;  1QZY A;  1B6A A;  2XAH A;  3ZMU A;  1LDD A;  1R00 A;  2ELH A;  3W6J B;  1XGN A;  1QBJ A;  3P9K A;  4TV7 A;  5BPD A;  1JHH A;  3CDH A;  2YR2 A;  3I59 B;  3HTU A;  2CFX A;  1EH8 A;  2MLG A;  3COA C;  3I53 A;  2BBY A;  4WWC A;  3H92 A;  4BHC A;  4OIP F;  1KYZ A;  3LA3 A;  3KE2 A;  1WSU A;  4LG0 B;  5H6R A;  5CVI A;  1ZRD A;  2CO5 A;  3GXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...