3ECOA

Crystal structure of mepr, a transcription regulator of the staphylococcus aureus multidrug efflux pump mepa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
137
structure length
135
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of MepR, a multidrug binding transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords MepR
total genus 51
structure length 135
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ecoA00
2EFNA 1AWCA 4KMFA 3IWFA 3QU6A 5DCFA 1KU2A 2MC3A 4U88A 1XSVA 2MA3A 3HRUA 3ZMVA 1I1GA 4RGUA 3DXJF 3G3ZA 4ZYEA 1FBQA 4HA8A 1KYWA 5D4RA 2L4AA 3L7WA 1IN8A 3VEPA 4FX4A 3EYIA 4AD9A 4L5JA 4OIOF 4G7HF 1EH7A 5DDGA 2VE9A 2XV4S 1S29A 4S05A 1LB2A 1TQPA 2VN2A 1XB4A 3C1DA 4KN4X 1KYZA 1KQ9A 3GFLA 5FD5A 2QVOA 2HEOA 1YLFA 4BQAA 2F5DA 3Q9SA 3CTAA 1ZREA 3F3XA 2WTEA 2LDUA 1WSUA 4JBAA 5KK1A 1PDNC 3BROA 4HDVA 1NHAA 3IWZA 2HTSA 4MEYF 2HWVA 3LA7A 1UCRA 5LGUA 2ZJ2A 3F8MA 4GXOA 4NQWA 3HTSB 2HQRA 3CUQA 3ABTA 2XUBA 1P92A 4HOBA 3CO6C 1LDDA 3F21A 4UHTA 2DBBA 5BPIA 2IA0A 2ESHA 1XCVA 2Z3YA 4A6DA 4RB2C 1LDJA 2WV0A 4IHTA 4EMSA 5ERIA 2C6YA 4EM2A 2VOPA 4RGXA 1IRFA 4HYEA 2VONA 2V1UA 5LEJA 4F7ZA 2DAOA 5LGNA 2Y48A 5ILSA 2CWEA 3KCCA 4OIRF 3B02A 2TDXA 3R60A 3TOAA 1E17A 3WODF 3BWGA 3IRQA 1HKQA 1YQAA 1BJAA 3MCZA 5FFXA 1JE8A 2W24A 4WXDA 1BC8C 4O5VA 5LRSA 1WI9A 1I1SA 4YIFA 3CUQC 3HRMA 1LVAA 4LK0F 3KE2A 5IT9K 1AOYA 2L54A 3C7JA 4JK1X 2V1XA 1QZZA 3WU1B 3F8CA 4I0AA 4BYYA 2V9VA 2VC0A 1O3TA 2ISZA 4L9TA 1K78B 2A3SA 1F4KA 2K86A 2HGCA 5D8KB 5ILUA 1F9NA 2K02A 3DQVC 2XAHA 4M9ZA 3V8LA 1HKSA 1WWXA 2XGXA 5J6XA 5ICGA 5DD8A 4HF0A 1V4RA 1BIBA 2NS0A 4LD5A 3LA3A 4RAYA 4UV8A 2W57A 4HDUA 2DTRA 3TQNA 1IXSB 4YIIA 4ZYHA 4PZJA 3RDIA 1RNLA 2GZWA 1RUNA 4LLNA 2XVCA 2O0YA 1P2FA 3RIRA 3QOPA 3HOSA 2OD5A 2NYXA 1QQIA 4PGHA 5JVTA 1U5TC 1R5GA 3MAJA 3SZPA 1SAXA 5HLIA 5BS6A 5LHGA 1U5TB 3JSPA 1ULYA 2X4HA 1J0RA 2MLKA 2JPCA 3U1DA 4U0VA 4L0YB 5LBQA 2YU3A 2Y75A 1J2XA 3U2RA 1A04A 1IN7A 3MFKA 5A2QK 2RNJA 5KVRA 2YSRA 4GYIA 5DEQA 2QYOA 2VT3A 1ZYRF 4L9VA 3ECHA 3IL2A 2CQKA 3LQQA 3F6VA 3O3KA 3E6MA 1HXDA 4CGZA 1LEBA 1OKRA 1XSXA 3K1MA 3F8BA 4OMYA 4I2OA 4PCQA 4MTDA 2CGPA 1YS6A 1SFUA 2HYFA 3GEZA 3TGNA 4L5IA 1Z7UA 1PP7U 5L3DA 4XSZF 5HLHA 4G9YA 5EEHA 2XAGA 5HDGA 1OPCA 4KA4A 1UHWA 1W7PB 1P4XA 4KMUX 2OQRA 3WE3A 3KETA 2K4JA 2VBXA 2GA1A 1HW2A 2W25A 4OOIA 2X0LA 4K2EA 2E1NA 1RIOH 2FEZA 6PAXA 3R6SA 2PMHA 3QU3A 1PP8F 3J7AO 4IHSA 5CVRA 3GFJA 1BI3A 3EDPA 1KGSA 1XDSA 4LG0A 3HRSA 1D5VA 1IUYA 5E18F 3WGHA 3WTYC 2EA4A 3GF2A 3RPUA 1MJ9A 1BI0A 3O6BB 3FZVA 1RZ4A 1R36A 3J81K 1XMAA 4KN7X 4CO8A 3ZMDA 4EM0B 4CYDA 4G8XA 2VODA 3CUQB 4UV9A 5D6FA 2M45A 5CVUA 3I59A 1STZA 3DKWA 2PFBA 2FE3A 3QPHA 3T5XA 5HDNA 2K27A 1KU9A 2MH9A 4B8XA 3ECOA 3OOPA 4EJTA 1JXSA 5LHIA 3MWMA 5AONA 4I02A 4U7DA 3RYRA 3EETA 3JAMK 3HUGA 2ISYA 3B73A 2A68F 3RYPA 1DUXC 4MEXF 5E1XA 1R7JA 2LSOA 1OR7A 4UUVA 1TNTA 4MTEA 1PUEE 1BIAA 5J8CA 3V8KA 3MEXA 3WGIA 5LRRA 2QWWA 3ABUA 4KYWA 5DCMB 4AIJA 2EJRA 4KIBA 1XCBA 1ODDA 2R7FA 3I53A 4JQFA 4O3MA 4UVBA 3I0TA 4A6EA 2Z99A 1ZGJA 2AXLA 2XIGA 2H94A 1WQ2A 3FM3A 1HBXG 3V7CA 3F8NA 3E6DA 4DQ2A 5L3GA 1XDUA 1ZG5A 1SD4A 4Y17A 2JT1A 1J9IA 4GCVA 1FOKA 4P9UA 2EFWA 2FF4A 3VFZA 2OBPA 3M8EA 3FWEA 2R7DA 2MD5A 1OYYA 1B6AA 1FWZA 2G7UA 5DD4A 1QPMA 1B9NA 3F8FA 2QQAA 3HSFA 5LGTA 4M9XA 1YW7A 2CO5A 2XROA 4RAZA 3C18A 4ENKA 2CW0F 3L00A 1USSA 4MNUA 3LWFA 4QLCU 1UFMA 4ON0A 2DT5A 2BE5F 5HVQC 4A12A 3K0LA 3HHHA 1J7KA 4U7BA 1ON1A 1O3RA 2LNBA 3DPLC 2H09A 2AS5F 1Z91A 4KUMA 4AVPA 1GXQA 5J8FA 4TV7A 2XRNA 4CHUA 2FSWA 2M87A 5LHHA 3RPQA 1XGSA 5IT3A 2P7VB 1U8RA 4M9SA 1FBSA 1XGOA 2DQRA 4EQQA 2ZMEB 4E70A 1S7OA 2OZUA 4BXUA 1UHMA 4CDGA 1T98A 1ZGAA 4LMYA 3I59B 1B4AA 4OU0A 4AIHA 2GAUA 2O6GE 2RQPA 2PI0A 2GXBA 1KQ8A 1XD7A 3E97A 3EUHA 2ETHA 5CVVA 2PBIA 2D45A 4Q4ZF 3NEUA 1MDMB 3WTTC 2Z33A 5ED4A 4YG2F 5E1WA 3FMSA 3V4GA 3GXOA 5L3BA 2DI3A 4IRIA 3HIFA 2O03A 3D5LA 2DPDA 5TRDA 2ZNYA 3RI4A 4CXFA 3CDHA 4EM1A 2QUFA 3WTUC 2EV5A 3BJ6A 3TKYA 2GA2A 1QGPA 4XLPF 3MZHA 4ZYDA 3KP4A 4KIFA 4WXHA 1IZ1A 4A2UA 1KU3A 2GIVA 3ZMSA 1CF7B 2F5CA 5D5VB 1JHFA 1DPRA 1K78A 2DFIA 5A2QZ 2RN7A 1ZARA 4XBFA 5L3FA 1ZRCA 1YG2A 4KT5C 3WTSC 3GWZA 2YX4A 2IVMA 2XAQA 2FBIA 1ZH5A 2H6BA 4P55A 3ML6A 1HW1A 3GW2A 1XGMA 2QQ9A 4LFUA 1IF1A 4EGZA 1TTYA 4U0WA 1LEAA 4ETSA 5BOXA 1Y0UA 2PEXA 2HQNA 2A07F 4Y13A 5FLXK 2BYVE 4FX0A 3HSEA 2FNAA 3TDZC 2KJBA 2ADUA 5H6QA 1FYKA 2F5FA 4A5MA 2HS5A 1I5ZA 2XKOA 3I54A 4OMZA 1D3YA 1QZYA 1YYVA 2QZ8A 1EH8A 2OQGA 3CO7C 5HDKA 4IVNA 1IRGA 2B0LA 3ZMZA 3AAFA 5CVIA 4LB6B 1U78A 3IRRA 1G4DA 5FO5A 1MGTA 3ZN1A 3N4MA 4RGSA 2DU9A 2XKPA 3F72A 3VODA 5CYVA 2A69F 3NQOA 2K7LA 1D8KA 2RDPA 3H3ZA 2FA5A 2WWYA 1WKMA 4HV5A 3DF8A 3VOEA 3KEOA 4ENMA 2M1BA 3QP5A 2VOOA 2VBWA 4EJOA 2JSCA 3LQRA 3DV8A 1HKTA 4M71A 2IW5A 1SMYF 3F6OA 1Z6RA 2ZCWA 1S8NA 1T6SA 1VTNC 4EJWA 1EH6A 4GO1A 4I98B 3KFWX 1HQCA 3BJAA 2PMUA 3F22A 5BMZA 1U5TA 1TQIA 5AIQA 5ICEA 2DO7A 5HS8A 4MHGA 3OV8A 3JTGA 2Y0MA 1FLIA 3RKWA 3J80K 5HS9A 1HW5A 3KEQA 2CYYA 3JAMZ 2HYGD 3R0AA 2GXGA 3L09A 1B59A 1YTYA 1ZHFA 2D1VA 3M7GA 3EYYA 3H92A 1OYWA 4KDPA 2LF7A 1BI2A 2FMYA 1W7PA 3H3UA 4XSXF 2E7WA 1CGPA 1YFHA 3Q9VA 2VBYA 3ULQB 3GFIA 3C3WA 4EJUA 3REOA 2G9WA 5AIPA 2RV8A 3S2WA 2EV0A 4ZH4F 4DNCA 2P7CB 2IRFG 1T38A 2JPBA 1T0FA 1I6XA 1MD0A 1IXRC 3HYIA 3F23A 1F1ZA 2FOKA 2GQQA 2VXZA 3NRVA 4HBLA 4HLYA 4A5NA 2YR2A 1ONVA 5DUKA 2K4BA 1O7LA 3V8JA 3G73A 2QBYA 4HX4A 2FRHA 4HV6A 1GVJA 4KICA 4HLXA 3ZPLA 4RB1A 3QP6A 5DUIA 1TBXA 1Z05A 4BHPA 4ESFA 1O3QA 4NB5A 2P5VA 2NRAC 1ZLJA 5JHUA 1H9GA 2UZKA 3KZYA 4OIQF 2IA1A 4N9IA 2KKOA 5DCMA 3ISPA 2EFQA 3J81Z 1C0WA 5K5QA 1P4WA 2D2WA 1FT9A 2HZTA 2O3FA 2ZO4A 2P8TA 1FP1D 3FXRA 2UXXA 2DW4A 3QPTA 4B09A 1S7AA 2ZXJA 3WG9A 5EEGA 3TO6A 2HTJA 4NHJA 4Z2YA 1B1BA 2H27A 4CICA 3KP2A 2L02A 2XHKA 2BBYA 4R8HA 1SD5A 1EV7A 5FGMA 1HSJA 1G3WA 2P5LC 2M5WA 2OU2A 4CZZA 3IC7A 2A6EF 3I71A 2E7XA 3CUOA 4UNOA 3KP7A 4WXCA 1G3SA 1UB9A 2V1DA 3TO9A 2OA4A 4M74A 1R58A 4IXAA 4KFCA 1S6LA 2CG4A 1IN6A 1U2WA 1T2KA 4EGYA 2P5KA 4P5OA 4IRHA 1HSTA 2WC2A 3SHFA 3WTWC 3FMQA 5D5WB 1J75A 2Q2EA 1GHCA 4BAYA 2IPQX 4RB0A 1FZPB 3GLXA 1L0OC 1Z1DA 5HS7A 2JZYA 4M72A 4N9HA 3W6KB 5K5OA 1TQMA 3T0YA 1ZN2A 1FYMA 4M6XA 5HOOA 1TLHB 1QBJA 4WK8F 1SD6A 3RKXA 3V7SA 3L9FA 1KU7A 2HDCA 5F64A 1O57A 5JR3A 3HRTA 1R1TA 3BPVA 2HFHA 5F1RA 2FNPA 3IKVA 1XMKA 3T8RA 1R1VA 4L9JA 2ZMEA 3K9TA 4HAMA 5HLGA 2FQ3A 1USTA 2ESNA 3KLNA 5FLXZ 1SFEA 5BQTA 5FFZA 1W5TA 2IA2A 2RGVA 4ZZDA 2STTA 3JTHA 3KZZA 5ILVA 3R61A 4KIGA 1SFXA 4L0ZB 3ERED 1KA8A 1KQ0A 4G6QA 4EVIA 2RC4A 2KIMA 3E6BA 1OYIA 2A61A 5JFRA 1G3YA 2EWNA 1B9MA 4ENJA 3LAJA 1H0MA 1FX7A 2FMLA 5L3CA 1DPUA 3IKTA 3CJNA 2RVCA 4P96A 4O6JA 2IJLA 2MLGA 3M9AA 3WTXC 3FXUA 2HOEA 1FY7A 1ZRDA 3R4KA 1TW2A 4BNCA 4EJVA 2HKXA 1O3SA 4S04A 1FPQA 2VT2A 1XN7A 4PGGA 3ZP5A 1IAWA 2ACJA 1ZRFA 3P9IA 3COAC 1BI1A 2FBKA 3DPTA 1LDKB 5H6RA 1IW7F 2CSOA 4OIPF 2E1CA 4HF2A 2DK8A 4FHTA 1K6OA 1R1UA 1W4MA 3GO5A 3DFGA 5K1YA 1U3EM 3LFKA 4GGGA 3WTZA 5D8LB 1YIOA 2Z9OA 3U9GA 5LLQA 1LQ1A 4RB3C 2HKOA 2ZNZA 4MGRA 3FM5A 4HZFA 4ESBA 3E5XA 1J59A 5DYMA 4AWXB 3DP7A 2Z5UA 4G94A 3FF5A 4IF4A 5ICFA 2W84A 3TO7A 1W7PD 5K5RA 3BP8A 1H9TA 4WF2A 1Z6TA 4ZZLA 1S3JA 2KIUA 4AIKA 2IT0A 3JW4A 3CLOA 1ZLKA 2H6CA 2XAFA 4XRFA 3E6CC 2IP2A 4L18B 3RKYA 4R79A 5LEKA 3O2PE 4LJZF 1FSHA 3K1PA 3GYHX 3R0JA 1BOAA 2A5YB 3WU0A 1YW8A 2NAZA 2NNYA 1DP7P 4M6YA 4G6DA 5E17F 5D5XB 3PQJA 4WX9A 2OAZA 3JSOA 2M30A 4HX7A 3ZQ7A 2ZKZA 3DEUA 2LKPA 3ELKA 3P9KA 2PQ8A 3K1NA 2EFOA 3ROUA 1K79A 4H0EA 3RTRA 3LAPA 4FT8A 4A0XA 5BPDA 2YPRA 2JTVA 5D4SA 5CVJA 4LG0B 4P9FA 3FHZA 1YW9A 1FBUA 4LGWA 4M73A 3BPXA 1P4AA 4Q48A 3N97A 2GWRA 2VBZA 1F5TA 4HQMA 4YFXF 2KJCA 5CJ9A 2DLLA 2M8EA 2G7HA 4RS8A 1MJAA 4YFNF 3T8TA 2A6HF 1R22A 4Q47A 5H20A 4PDKA 1D8JA 4ZYGA 2OZ6A 3GVAA 1TNSA 5E1ZB 3L2CA 4XLNF 2EFPA 3SQNA 3TOBA 4ESJA 4YFKF 2LF8A 5TJJA 3SXYA 5D5UB 1LJ9A 3WGGA 2QM3A 3LA2A 5E20A 1R00A 1RI7A 4ENNA 2JRTA 3P9CA 3FMRA 1ZG1A 1RUOA 1CF7A 3GFMA 2UWMA 2CFXA 3T1BA 2NNNA 2PG4A 1XGNA 1G3TA 5L3EA 1G6NA 1DDNA 1IN5A 2D1HA 4LLLA 2ELHA 2J5OA 4BHCA 1FP2A 5D6EA 4BHBA 4UVAA 4MQVA 4IPAA 4L9NA 3MZYA 2RKHA 4KNYA 1ON2A 1BM9A 1P6RA 2BGCA 4HX8A 2KRFA 1LNWA 3E5QA 2L4MA 2L3DA 3GUDA 1QNTA 2HR3A 2MBFA 2UXNA 2QBYB 4QWQA 4N0BA 3Q5FA 2BV6A 1I27A 1FSEA 1K7AA 2VE8A 2W85A 2VC1A 3J80Z 4UVCA 1JHHA 3PQKA 3HSRA 4U0YA 4LK1F 5E8IA 1IXCA 2DK5A 2O61A 1Q1HA 2PN6A 2KIFA 2STWA 1OMIA 3P7NA 4OINF 2XAJA 2V79A 4LB5A 3E5UA 1BBYA 2P6SA 1Z9CA 4I7HA 2DQLA 4A0ZA 4I01A 1V3FA 2ZBKA 3HHGA 3QAHA 4WCGA 3IHUA 1MKMA 2FU4A 4UXNA 3I58A 2V6CA 4BH9A 2QLZA 3QRFF 2EB7A 1O7FA 1TW3A 3M8FA 1GXPA 3WTVC 3I64A 3TDUC 3GX4X 2DPUA 1SMTA 2QENA 3K2ZA 3BOQA 1L3LA 5DV5A 3ZMUA 2Q8KA 1REPC 2Q0OA 2ZFWA 2R3SA 1YO5C 2L01A 4ASNA 1FC3A 1U6GA 2F2EA 4HQEA 3MQ0A 3ZMTA 4RGRA 2XASA 4IRGA 3HOTA 3BJOA 4LLGF 3BZ6A 1E2XA 1SD7A 3M1EA 1BN5A 5FB2A 1WRJA 3FX3A 4HF1A 2EK5A 3SFZA 3E3VA 4R1HA 2PLYA 2PJPA 1X3UA 4Y15A 1T39A 2O8XA 1JGSA 3I4PA 3KP6A 4D0PA 1ZAOA 1YS7A 4I09A 2EA2A 3GZ6A 1ZG3A 4I0BA 4MQ9F 4A0YA 5IT9Z 4WWCA 2FXAA 3PFIA 3BDDA 3RJPA 3HTUA 3VB2A 1FYLA 1MDMA 3KP5A 2FBHA 3W6JB 4HW0A 5E8GA 1W5SA 2P6TA 1R5HA 4G7ZF 5FD6A 4G7OF 5JI6A 2YX7A 1QO0D 2MH2A 4IJAA 2P4WA 1XSDA 3I5UA 1FNNA 1R23A 2QQBA 3LSTA 2F5EA 3V7RA 3SZTA 1J5YA 3BY6A 4EV0A 1IN4A 5ICCA 4GYGA 3K69A 3EQLF 2BEOA 3D0SA 2J5PA 3FXQA 2COMA 1MZBA 1BC7C 5F6FA 3KLOA 4Q5SF 3GZ5A 3KP3A 3ZN0A 3WE2A 2EV6A 5CLSA 1MJBA
chains in the Genus database with same CATH superfamily
2EFNA 2LVSA 1AWCA 4KMFA 2PMZA 3IWFA 3QU6A 5DCFA 2L7KA 3ONQA 1KU2A 2MC3A 4XLHA 2KIQA 4U88A 1XSVA 4RDUA 2MA3A 1VQPI 4BEHA 1WJCA 3H1CA 3HRUA 5C4XJ 1FMWA 1I1GA 2W00A 2DA7A 3BG5A 3K6GA 3ZMVA 1JI8A 4RGUA 2DOEA 2ECBA 3DXJF 3G3ZA 1RKWA 4ZYEA 2DA1A 2HXOA 1FBQA 2K9NA 3HM5A 3HB9A 5EDNA 4HA8A 4UUTA 1P7JA 3AG2H 1KYWA 2KZVA 4AVZA 3CCUI 1VQLI 1QVUA 5D4RA 2L4AA 3L7WA 2VPLA 1IN8A 3VEPA 4FX4A 3EYIA 4AD9A 1MNMC 4L5JA 4OIOF 1D0YA 2IGNA 4G7HF 1EH7A 1AKHB 2ZB9A 5DDGA 2W7NA 2XV4S 2VE9A 3H0GJ 1S29A 4S05A 1R9TJ 5IP6A 1LB2A 1TQPA 2VN2A 5B66C 4E7IA 1XB4A 2DA2A 3C1DA 2ZXWH 4KN4X 2CV0A 1R71A 1KYZA 4ABZA 1KQ9A 3PUFA 3GFLA 5FD5A 2F4OB 2QVOA 1X58A 2HEOA 1YLFA 1JUPA 2ZJPF 4BQAA 2F5DA 3BTIA 3S2HJ 3Q9SA 2WB1N 2IS2A 3CTAA 2CS3A 1ZREA 3F3XA 2EINH 2WTEA 2LDUA 5CQEA 5FKLA 1WJDA 1WSUA 3MKLA 4JBAA 3FDYA 5KK1A 1PDNC 3BROA 2QSFX 4HDVA 1NHAA 3IWZA 1FTTA 2HTSA 3L1PA 3KIOA 2IXSA 4MEYF 2R5ZA 3GTQJ 2X6YA 2HWVA 3LA7A 2N8GA 3HUGB 1UCRA 5LGUA 1JKOC 3A01B 3D1NI 2NVTJ 2HQAA 2ZJ2A 3F8MA 2OF7A 2OCEA 1MMGA 3N05A 3PNTA 4GXOA 3H0DA 4NQWA 4GFBA 2R7TA 1ETQA 1PJRA 3HTSB 2HQRA 3CUQA 1TP4A 3ZQGA 3ABTA 2XUBA 5GPCA 1LE8A 4V19K 1P92A 3AG1H 4HOBA 3CJRB 2Y2ZA 2QF7A 3MKWB 3CO6C 1LDDA 2E2IJ 4BXFA 1BR2A 2Q1ZB 2EBIA 2VLAA 3F21A 4UHTA 2GLOA 3CP2A 2DBBA 4XOTA 3W3CA 3MMYB 5BPIA 2IA0A 2ESHA 1XCVA 2VKHA 2Z3YA 4A6DA 4RB2C 4JX5A 2EILH 2NOGA 4BQNA 5F0HA 1LDJA 2WV0A 2XPUA 2D5VA 4IHTA 4EMSA 2JRMA 2K5CA 2P0WA 4JX4A 5ERIA 1MSEC 1RETA 2C6YA 4EM2A 2NOJB 3S1RJ 2VOPA 4RGXA 1IRFA 4HYEA 2VONA 4G12A 2NS7A 2V1UA 1LKXA 5LEJA 2KDOA 4Y33A 2DYSH 4F7ZA 2DAOA 1FOXA 5LGNA 4CCJA 2Y48A 3K70D 3CCMI 5ILSA 2CWEA 2EZKA 3KCCA 4E7LA 4OIRF 2ZJQF 3B02A 2TDXA 3R60A 3K7AJ 1V54H 3CJTB 3MN2A 5TGTA 3DKXA 1W0UA 3TOAA 1E17A 1X4PA 2JA5J 4JOMA 3WODF 4BU2A 3BWGA 1B72B 3IRQA 5F04A 1DU6A 1HKQA 3Q0WA 1YQAA 4HNUA 1D5YA 4BQOA 5FROA 1BJAA 3MCZA 5FFXA 1JE8A 2W24A 4IX7A 4WXDA 2KLOA 2JA7J 2HOTA 1BC8C 4O5VA 5LRSA 1DGWY 1WI9A 1I1SA 4YIFA 3SJMA 3CUQC 2LD5A 1SEUA 3SZGA 3HRMA 2MFZA 1LVAA 2Y9YA 4LK0F 3KE2A 1LFBA 4D5CA 5IT9K 1AOYA 5EF6A 1LE8B 2L54A 3LFUA 3C7JA 3AFHA 2GOMA 3Q0UA 2DN0A 1HDDC 3HKZN 1ETWA 5CQGA 4JK1X 4CZCA 4DZJA 2V1XA 1YX3A 1QZZA 3AG4H 3WU1B 3F8CA 4I0AA 4RAFA 3QQAA 4S0HB 4BYYA 2V9VA 2VC0A 2KL4A 1O3TA 1R4MB 2VKVA 2ZXIA 4RLQA 4L9TA 2ISZA 1K78B 2EH3A 1AKHA 2A3SA 1F4KA 2K86A 1Z67A 3QPLA 5F0FA 5DS9A 1AHDP 2HGCA 3OOUA 5D8KB 5ILUA 1F9NA 2K02A 3DQVC 2XAHA 3PL8A 4M9ZA 4DYRA 1LUJB 3V8LA 1HKSA 5H2FC 1Z3XA 1WWXA 2XGXA 4X6AJ 5J6XA 5ICGA 9ANTA 5DD8A 1A5JA 3S1QJ 3MKYB 3LSPA 1JT0A 3BCAA 2HXIA 1MBJA 1YIJI 4HF0A 1V4RA 1BIBA 4RLFA 1H88C 1TC3C 1OCPA 1OCRH 2NS0A 4LD5A 3LA3A 3M3YJ 4RAYA 3UNGC 4UV8A 1KZHA 4CH7A 2W57A 4HDUA 2DTRA 4AYBN 3TQNA 3BR1A 3P5JA 2CUZA 1IXSB 4YIIA 4XN0A 4ZYHA 4PZJA 3RDIA 1RNLA 2GZWA 1RUNA 2R5ZB 2XVCA 4LLNA 2O0YA 1DGRM 1P2FA 4BGDA 1ZELA 3RIRA 4IKFA 3QOPA 3Q3SA 3HOSA 2OD5A 2L7FP 2NYXA 1QQIA 3OR1C 4PGHA 5JVTA 1U5TC 3BTLA 4NNJA 2OJED 1R5GA 1X3WB 2L7ZA 2HYJA 3LOCA 1E0EA 4N4NB 3MAJA 3SZPA 1SAXA 4NBQA 5HLIA 1WPKA 5BS6A 5LHGA 1U5TB 3F0CA 3JSPA 1ULYA 4LG3A 2X4HA 1J0RA 4CCKA 5JLXA 2MLKA 4YIRX 1A36A 1TWCJ 2JPCA 2ZC2A 3FXLA 3U1DA 4FISA 4U0VA 4PK4A 2V1NA 5GPAA 5TISC 1YHQI 2WAFA 4L0YB 5LBQA 2YU3A 2V4JC 2Y75A 1J2XA 3U2RA 1A04A 1IN7A 3MFKA 3JRIA 5A2QK 1K4SA 2A5WA 2RNJA 5KVRA 2YSRA 5FRNA 2LH9A 4GYIA 3CF2A 4QPOA 5DEQA 2QYOA 1LFUP 2DXIA 2VT3A 1ZYRF 1MBGA 4L9VA 3ECHA 3IL2A 2CQKA 3LQQA 3F6VA 3CCEI 2DDBA 3RKQA 2JQ7A 4FTHA 2FX0A 1GLNA 3HKZA 5J47A 3O3KA 3E6MA 1HXDA 4CGZA 1GVDA 3AKZA 2GM4A 1LEBA 1OKRA 1XSXA 3K1MA 3F8BA 4OMYA 4I2OA 4PCQA 4MTDA 1QU3A 3OYFA 2CGPA 1YS6A 1SFUA 2HYFA 2DA3A 3GEZA 3TGNA 4L5IA 5EGOB 1Z7UA 1PP7U 2X9DA 5L3DA 4XSZF 4B47A 1BA5A 2AQEA 1FMVA 2X48A 3CLQA 1ETKA 5HLHA 4G9YA 3OYBA 5EEHA 2XAGA 5HDGA 4G6TB 1OPCA 3MKZA 4XLAA 4KA4A 2WADA 1UHWA 1W7PB 1P4XA 4KMUX 1XMXA 2OQRA 3A02A 3WE3A 3KETA 2CW8A 2K4JA 4M3BA 2VBXA 2X1DA 3HZJA 2GA1A 1HW2A 2W25A 1ETOA 4F52A 4OOIA 2X0LA 4OAZA 4K2EA 1MMNA 2E1NA 1XC5A 3LSKA 3EUAA 1RIOH 2FEZA 1U0JA 3HG9A 4F93B 6PAXA 2IS1A 4LITA 2AQFA 4B48A 5KCMA 3R6SA 4IQJA 2PMHA 3QU3A 2JVHA 4C2TA 1PP8F 3J7AO 2K9LA 4IHSA 5CVRA 3GFJA 1BI3A 3NARA 3TP0A 1QVTA 4XK4A 3EDPA 1KGSA 1XDSA 2F48A 3HRSA 4LG0A 1D5VA 1IUYA 1Y8RB 5E18F 3WGHA 2BY3A 4C9YA 2CFOA 1YRNA 3WTYC 2DJIA 2EA4A 3BG9A 3GF2A 2R7OA 3RPUA 1MJ9A 3PM1A 2XRLA 5HLTA 3QOEA 1BI0A 1LVKA 3BR5A 3CDLA 3O6BB 3RPUD 3FZVA 3RSNA 3DCFA 1ZK8A 3ASOH 2DODA 2MW8A 1RZ4A 3ABLH 1R36A 3OSFA 1A6QA 3HGYA 3LSIA 5J4VA 3J81K 1XMAA 4KN7X 1WZ2A 4CO8A 1APLC 3ZMDA 4EM0B 4CYDA 4G8XA 2CV2A 2VODA 3KZIC 3CUQB 4UV9A 5D6FA 2M45A 4B1RA 5CVUA 1IGNA 3HPHA 3I59A 4XRSA 2DA5A 1STZA 3DTEA 2HOSA 3A0BC 3S2DJ 3DKWA 2CQQA 2HPIA 1RRJA 2E35A 2PFBA 1GV5A 2FE3A 3QPHA 5HNFA 1Y39A 1ETXA 3T5XA 3VDXA 5HDNA 2IS4A 2K27A 1KU9A 2MH9A 1BW6A 4B8XA 1TT5B 3ECOA 3GBGA 3FHNA 3FXOA 3GZNB 3OOPA 4XIDA 4A69C 2AHQA 4EJTA 1JXSA 5LHIA 3MWMA 1I3QJ 5AONA 3S3MA 4I02A 4U7DA 3RYRA 3OS1A 1VQKI 4XKBA 3EETA 2AXTC 3JAMK 3HUGA 3L2RA 2R0QC 1K6YA 2R7ZJ 2ISYA 3B73A 2A68F 3OWTA 2LY9A 4B44A 3CCRI 3RYPA 3KPHA 3CCQI 1DUXC 1DQUA 4MEXF 2LKSA 5E1XA 3PUBA 1RR8C 1R7JA 1HC8A 4IL6C 2LSOA 1IC8A 3Q0VA 1TT0A 1OR7A 3ERMA 3H9JA 3S3OA 4UUVA 1TNTA 1XS9A 4MTEA 4KJZA 2QGUA 2VJ5A 1PUEE 1BIAA 3ZQHA 5F27A 5J8CA 3VYRB 3LNQA 3V8KA 5IOYA 4D1QA 4XRSG 5E3NA 3MEXA 5K7ZA 3WGIA 3BR2A 2V9KA 3IH4A 5LRRA 2QWWA 2XGEA 3ABUA 4KYWA 5DCMB 4AIJA 3CJQB 2EJRA 1D1CA 3OYAA 4KIBA 1XCBA 1ODDA 2R7FA 3I53A 4JQFA 4O3MA 4UVBA 4A3IJ 3L2WA 3I0TA 4A6EA 2Z99A 1ZGJA 2AXLA 1B8IA 1ENHA 1YJ9I 2XIGA 2H94A 2VI6A 1WQ2A 1T56A 2QCOA 3FM3A 2ZFUA 1HBXG 1OCTC 3V7CA 3F8NA 3E6DA 4DQ2A 5L3GA 1XDUA 5GAEJ 2L9SA 3CMAI 1TWHJ 1R5ID 3C2GA 1ZG5A 1SD4A 4Y17A 2JT1A 5EEAA 3NAUA 4GRIA 1J9IA 2NS8A 3E7LA 4W1UA 3UKGA 4GCVA 1FOKA 4P9UA 2EFWA 3M8JA 2FF4A 2CQXA 1QRYA 1OR7C 2OBPA 3VFZA 2GIZA 4BXXJ 5B1AH 3M8EA 1R6RA 2NVYJ 3S3NA 4BDYA 3FWEA 2R7DA 5C4JJ 1IDYA 2MD5A 5J4YA 2HU9A 1OYYA 1B6AA 3O8GA 2GXAA 2X1CA 1FWZA 2XSJC 1W1WE 2G7UA 3TBIA 4BE2A 4XLFA 5DD4A 3DWLE 1ETYA 1QPMA 1B9NA 2VJ4A 3F8FA 2QQAA 3HSFA 2M4KA 1T0FC 3HGGA 2LLKA 3HEFA 4M3FA 5LGTA 4M9XA 1YW7A 2CO5A 1YE9A 2XROA 2W1OA 4RAZA 1DP3A 2VIXA 3C18A 4ZDPA 4ENKA 2CW0F 3L00A 1VQMI 3HL2A 2DT7B 1RPWA 3RQIA 1USSA 1EF4A 4BEHB 4MNUA 2DFHA 3LWFA 1SVOA 4QLCU 1UFMA 4ON0A 2E1MC 3H36A 2DT5A 2BE5F 1VNDA 1X1CA 5HVQC 1B8IB 4A12A 3TEDA 3K0LA 3HHHA 1J7KA 3K4MA 1IG7A 2DMTA 4U7BA 3DTKA 5GADJ 1ON1A 2KPMA 1O3RA 1JKRC 2LNBA 4MFDA 4XNFA 2L5QA 2K9MA 3DPLC 5JVGF 2H09A 2AS5F 1Z91A 4KUMA 3BZKA 2BHZA 4AVPA 1GXQA 4FCYA 2M7BA 5J8FA 3JRFA 4BY1J 3ZQIA 4TV7A 2XRNA 2KRCA 1N25A 1XG1A 2FSWA 2M87A 3K4KA 4I76A 3V42A 4D7NA 5LHHA 3RPQA 1XGSA 5IT3A 5FKKA 5GP9A 2P7VB 2RREA 1F43A 3FXJA 1U8RA 4M9SA 3OS2A 4C3JJ 2OTJI 3I4NJ 1FBSA 2R5YA 1XGOA 2IGOA 2V6EA 3I4MJ 2DQRA 4B4CA 4EQQA 3LMMA 2ZMEB 4E70A 4BJTA 1S7OA 2OZUA 4BXUA 4IOAF 1UHMA 2MSYA 3ESWB 3OIQA 4CDGA 1SAUA 1UELB 3KYLA 4FE4A 1T98A 2BY0A 1ZGAA 4LMYA 5IPAA 3BT9A 3I59B 4MO7A 3WHCA 1B4AA 4OU0A 3CC4I 4AIHA 3IAM2 1JKPC 4BBSJ 1OCZH 2GAUA 2W4SA 4NUBA 2O6GE 2RQPA 3OYLA 2KRHA 2V9PA 3OL4A 4XKCA 5HODA 2PI0A 2GXBA 2E71A 3VWBA 4XLCA 1KQ8A 1XD7A 2COBA 1AA7A 2LKXA 2R7SA 4XMYA 3EUHA 2R7QA 3E97A 4QSHA 2ETHA 5CVVA 3JCUC 4A93J 2PBIA 2D45A 4Q4ZF 4FQGA 3NEUA 1MDMB 2JMWA 2MYSA 3WTTC 2Z33A 2HNHA 3ABMH 5ED4A 2XF5A 3KX2A 4XICA 3BR3A 4YG2F 5E1WA 3FMSA 4XOPA 3V4GA 3GXOA 5L3BA 4OWRB 2DI3A 4IRIA 1I3AA 2EQRA 2VB6A 3HIFA 1WI3A 5FLMJ 2O03A 3D5LA 5LFAA 5TRDA 2DPDA 2ZNYA 4IEJA 3RI4A 1VQ5I 4A3BJ 4CXFA 3S1NJ 3CDHA 4JX6A 4EM1A 1M1EB 2O7OA 2QUFA 3K4LA 2BVLA 3WTUC 2EV5A 3BJ6A 5K7HA 3TKYA 2JUGA 2GA2A 5HNHA 1QGPA 4XLPF 3MZHA 4RA2A 4ZYDA 3OYIA 3KP4A 4KIFA 4WXHA 1IZ1A 4A2UA 3UR3C 1KU3A 2GIVA 3ZMSA 1ERDA 1CF7B 2F5CA 1I39A 3S15J 1HLVA 2IBDA 3ZQQA 2TCTA 3HOYJ 2HDWA 4BL0B 5D5VB 1JHFA 2K40A 4BE1A 1DPRA 3G2BA 2VJIA 4PJMA 1K78A 4KISA 2DFIA 2R7UA 3SFIA 2CUJA 5A2QZ 2DA6A 2RN7A 4RBOA 2LBFA 1IV8A 1ZARA 2CRGA 4XBFA 5L3FA 3D5RC 1ZRCA 1YG2A 1X2MA 4KT5C 3WTSC 3GWZA 3QODA 4H4KC 2YX4A 3OYHA 4JP0A 2IVMA 2XAQA 3L2UA 5F08A 2FBIA 1ZH5A 4YELA 2H6BA 4P55A 4UB6C 3PJRA 3DLAA 3ML6A 1HW1A 1N75A 2WBMA 2JA8J 3GW2A 1XGMA 4LOCA 2QQ9A 4LFUA 1IF1A 3FBIB 2HVRA 3PO2J 4EGZA 1Y6IA 1TTYA 5KAIC 2M3AA 3A03A 4U0WA 3BTCA 1LEAA 3IV5A 4ETSA 5BOXA 1Y0UA 3GTPJ 3ABKH 3CC7I 4PJ0C 2PEXA 2HQNA 2A07F 4Y13A 4XN3A 3I9V2 5FLXK 2BYVE 3BG3A 3W6VA 4FX0A 2DTZA 3HSEA 4DJAA 2L9RA 2FNAA 3TDZC 4DGWB 2KJBA 2ADUA 4J00A 5H6QA 1FYKA 2F5FA 4J19A 4A5MA 2HS5A 5IYDJ 1I5ZA 2XKOA 3I54A 4OMZA 1D3YA 1QZYA 1MMAA 1YYVA 2QZ8A 3HXLA 4DW6A 1BOBA 2KHMA 2R93J 3LSGA 5E79C 1EH8A 4J01A 4XORA 2OQGA 3CO7C 2Y9ZA 5HDKA 4IVNA 2DMUA 1IRGA 4A3JJ 2B0LA 3ZMZA 1SFOJ 3AAFA 4HPQA 5CVIA 4LB6B 1U78A 3IRRA 1G4DA 4A3MJ 4A3EJ 5FO5A 1MGTA 3ZN1A 4GDFA 3N4MA 4RGSA 3CMEI 2VJJA 3GMEA 2DU9A 1OLTA 2XKPA 3PSIA 4RM2A 2R5YB 3F72A 3VODA 2E36A 2ELKA 5CYVA 1UG0A 2A69F 1QHGA 2E1OA 3JRHA 3S8PA 3NQOA 2WAEA 2K7LA 1D8KA 2RDPA 3H3ZA 2FA5A 1JKQC 5J1RA 3RCOA 2WWYA 4XL9A 2F4IA 1FJLA 1WKMA 4I6ZA 1OCCH 4HV5A 1JGGA 1Z3YA 1NG7A 3DF8A 3VOEA 3KEOA 4ENMA 2M1BA 3QP5A 2VOOA 2DDAA 1G59A 2MGQA 2VBWA 3S32A 4EJOA 3OYEA 3JRBA 2JSCA 2KQRA 3LQRA 3DV8A 1NK3P 1HKTA 1YJNI 3K4NA 4M71A 2IW5A 4ANJA 2V26A 1SMYF 4C30A 3OSGA 3F6OA 1Z6RA 2ZCWA 2F4MB 1PUFA 1S8NA 1T6SA 5EJCA 1X19A 1ZTRA 1VTNC 4EJWA 1EH6A 4GO1A 4I98B 3KFWX 1HQCA 3BJAA 2W82A 2PMUA 5GTIC 3F22A 5BMZA 4ZYAA 2PX9A 1U5TA 2YS9A 1TQIA 2QEXI 4XONA 5AIQA 2MABA 2PJRA 5ICEA 2DO7A 5HS8A 4MHGA 3SEZA 2M9HA 3OV8A 4NC8A 2Y0MA 3JTGA 3BQYA 1FLIA 1JUSA 5HS9A 1HW5A 3RKWA 3J80K 2ID6A 2I10A 3KEQA 3HOWJ 1XTAA 2CYYA 2XAUA 3JAMZ 2HYGD 4DBRA 2H8WA 2EPFA 2JA2A 3R0AA 2GXGA 1HA8A 3L09A 1YITI 1W5CC 4E7ZA 2ME0A 1JJ6C 5EYRA 1B59A 3H5AA 3J7ZI 2ICWG 2XF7A 3CCSI 1YTYA 1ZHFA 2D1VA 3M7GA 3ZRGA 3EYYA 1SVMA 3H92A 1OYWA 4KDPA 2LF7A 1S5LC 1BI2A 2KZGA 2XB0X 1Q1VA 3U21A 2DJNA 2FMYA 1W7PA 2DOAA 3H3UA 3IH2A 3NWSA 4D5FA 2IGMA 1MBEA 4XSXF 2E7WA 4CUGA 3JR9A 2MC4A 1CGPA 1YFHA 3OR2C 3Q9VA 2VBYA 1JTYA 3ULQB 3GFIA 3C3WA 4EJUA 3HOZJ 3W2WA 2M7AA 3CCJI 3REOA 2G9WA 5AIPA 2RV8A 3S2WA 4NDLA 2EV0A 3FKJA 2B7EA 2Z2SB 4ZH4F 1V5EA 4DNCA 2P7CB 2BY1A 4L5EA 2IRFG 1T38A 2KP6A 1D1BA 3LSRA 2JPBA 1T0FA 1I6XA 1MD0A 1IXRC 3HYIA 2VASA 4Z6YA 3F23A 1F1ZA 2Z1DA 2FOKA 2GQQA 4KITB 4CCNA 2DYRH 1WCMJ 4FASD 2VXZA 1WVRA 2R4GA 3NRVA 4HBLA 4HLYA 4A5NA 2YR2A 4UY8I 1ONVA 2E19A 4BUPA 1D1AA 5DUKA 2E60A 2K4BA 1FOYA 1O7LA 3V8JA 1MH3A 3G73A 4X1EA 5FJ8J 2K9QA 2QBYA 5IYBJ 4IHVA 3MVPA 3ZQCA 2RNGA 4HX4A 2XSDC 1Z21A 1WJEA 2FRHA 3EUHC 4HV6A 4XQFA 1GVJA 4KICA 2WV1A 4HLXA 2PMZN 1OCOH 1T08B 2I8DA 2NVUB 4W97A 2VQHA 5KAFC 2QA4I 2VL8A 3ZPLA 4RB1A 3QP6A 5DUIA 1TBXA 1Z05A 2WA0A 4BHPA 4UUSB 4MFEA 4ESFA 3H5RA 3WG7H 1O3QA 4ZDOA 4EEFG 3CF5F 3RZOJ 4NB5A 2P5VA 2NRAC 3BQZA 4CCLA 2DOFA 1ZLJA 3OMYA 1UMQA 4PJNA 5JHUA 1H9GA 2UZKA 3KZYA 4ZTJA 3PNYA 4DIQA 2IA1A 4N9IA 4OIQF 4IOCF 2KKOA 5DCMA 5DM7F 2BY2A 2EFQA 3ISPA 3LSJA 3TL4X 3J81Z 1C0WA 1VQ9I 5K5QA 1ZR2A 5EZGA 1P4WA 1X1BA 3OYJA 2D2WA 1FT9A 3ZR8X 2HZTA 3FXMA 4U87A 4XKWA 2WY7Q 2BZTA 2O3FA 2B9SA 2X51A 2CQNA 1GUUA 2ZO4A 2P8TA 5M5WJ 3VSKA 2DMNA 1FP1D 3FXRA 5LD2C 3KEYA 2UXXA 3OY9A 3LSMA 3VYSB 4DYQA 2DW4A 3QPTA 4B09A 1S7AA 2ZXJA 3WG9A 5EEGA 3K70C 3TO6A 2HTJA 3PNVA 1BL0A 2VQCA 1S9HA 1ORKA 2CUEA 4BACA 4NHJA 2JA6J 4Z2YA 1B1BA 1WJ5A 1A31A 2LC2A 1JJ8C 2VQLA 1E3HA 3D5SC 4IQ4A 2H27A 2LG4A 4CICA 3KP2A 4CYCB 2L02A 4II3A 4HG2A 2XHKA 4E6KG 2BBYA 1SANA 4Y4RA 2EIJH 4R8HA 3DLLF 1SD5A 1EV7A 3DBLB 5FGMA 1HSJA 4BJ6C 3RZDJ 1G3WA 2P5LC 4A3KJ 2IS6A 2M5WA 3ZQLA 2OU2A 4CZZA 3IC7A 2A6EF 4EATA 3H5NA 3I71A 3M1CA 1TWAJ 2E7XA 3CUOA 4UNOA 2OPTA 3KP7A 1UJ8A 1NG6A 1VQ6I 4WXCA 3PO3J 4QTRA 1G3SA 1UB9A 2V1DA 3MZ8A 3TO9A 2LRDA 2OA4A 3BTJA 4M74A 1R58A 4IXAA 4MIMA 4KFCA 1S6LA 2CG4A 3GCMA 1IN6A 1U2WA 3TW6A 4IHXA 1T2KA 3FIWA 4UB8C 4EGYA 1MIJA 1MNDA 2P5KA 1OQYA 2M4GA 4IRHA 4P5OA 1HSTA 2WC2A 3JRDA 1UZCA 3QYBA 2LY1A 3SHFA 3WTWC 3FMQA 5CKTA 1E3OC 3HBLA 5D5WB 1W36C 1J75A 1O4XA 1N77A 2Q2EA 2XPWA 3F9KA 4BAYA 1GHCA 2IPQX 4RB0A 1I50J 1FZPB 3GLXA 1L0OC 1WH5A 1TZLA 1Z1DA 4RMNA 3M07A 2H1KA 3SEQA 3CQZJ 5HS7A 3ZOBA 3K10A 1A35A 4F92B 2JZYA 4M72A 4N9HA 3W6KB 5K5OA 1TQMA 3T0YA 3A01A 1ZN2A 1FYMA 1MNEA 2M34A 3DBRB 2R7WA 4M6XA 2BXYA 1XPXA 5HOOA 1TLHB 1QBJA 1X4OA 4WK8F 3U1KA 1SD6A 3RKXA 3V7SA 3L9FA 2KDZA 3BZCA 2KFDA 1KU7A 2HDCA 5F64A 4M3GA 1V5FA 3HOXJ 1O57A 4A3GJ 2VKDA 4IO9F 5JR3A 3HRTA 3E0JB 2NVXJ 1R1TA 3BPVA 3GLLA 1JT6A 2HFHA 2YU9J 5F1RA 1GT0C 2FNPA 3OYKA 3HPGA 1RESA 2H1LA 3IKVA 1XMKA 2FD5A 3JRCA 3T8RA 2HQ5A 1X1AA 3FBNB 1R1VA 2ZXHA 4L9JA 2ZMEA 3OYMA 3K9TA 3BG6A 1WJAA 2JVGA 4HAMA 3GTJJ 2HPMA 5HLGA 2FQ3A 2AO9A 2CQ7A 1USTA 2ESNA 3KLNA 2YUSA 3G1OA 1SFEA 2DFFA 5FLXZ 1ETVA 4M3EA 5BQTA 5FFZA 2M2EA 2E5NA 3CCVI 1W5TA 1MMDA 2IA2A 2RGVA 4ZZDA 2STTA 3JTHA 4BBRJ 3KZZA 2DT6A 2M8GX 5ILVA 1ACIA 2NXNB 1Y8QB 1HOMA 3R61A 2M0MA 4KIGA 2WB1A 4HSRA 1SFXA 4L0ZB 3ERED 1KA8A 2BW3A 2O5RA 1KQ0A 4PFPA 4BDZA 4G6QA 4EVIA 2VUMJ 1K61A 1LFPA 2RC4A 2WAQN 2KIMA 3E6BA 1OYIA 2A61A 5JFRA 1I6HJ 2LFBA 1G3YA 2EWNA 5E3OA 1JUMA 1B9MA 4F3QA 4ENJA 3LAJA 1H0MA 1FX7A 2FMLA 5J3LA 5K7FA 5L3CA 1UHSA 1DPUA 3PFYA 2QQ8A 3CMMA 4V2GA 3IKTA 3SYTA 3OIOA 1RC9A 2DA4A 3CJNA 1ZGWA 3H9GA 2RVCA 4DOZA 3FK7A 3G1LA 5EG0A 4P96A 4QIWN 2F5VA 3I3LA 4NC7A 1IO2A 3EUKL 3A2KA 4O6JA 1SVLA 2ZJRF 2IJLA 5IP7J 1IJWC 1T95A 2FOWA 2MLGA 3M9AA 5BNGA 2BOLA 3FXUA 3WTXC 2Y69H 3JREA 2K3PA 2HOEA 1FY7A 2LP0A 1ZRDA 3AL0B 5J1UA 2BHYA 3R4KA 4FETA 1D0XA 5B5EC 3I56I 1MW7A 1TW2A 4EJVA 4C3IJ 4BNCA 1ITYA 2HKXA 1O3SA 4S04A 1FPQA 2VT2A 2EIKH 2IGKA 1XN7A 2X6XA 3W2AA 1Y56A 4PGGA 3ZP5A 1IAWA 2ACJA 1ZRFA 3GTGJ 3FISA 3SDGA 3P9IA 3COAC 1BI1A 2NVQJ 2FBKA 3DPTA 2H8RA 2Z16A 1LDKB 1AU7A 2QSGX 5H6RA 1IRZA 1SFKA 4A3FJ 4IHYA 1IW7F 1MH4A 1YI2I 2CSOA 3LL7A 3DBHB 4N4OB 2A6TA 1VQ7I 4OIPF 2E1CA 4HF2A 2DK8A 4FHTA 3ASNH 1K6OA 4CA0A 1R1UA 1W4MA 2EZLA 3GO5A 1VF9A 3WU2C 3DFGA 5K1YA 2LY2A 1EKEA 1U3EM 2IAIA 1QA6A 3LFKA 4GGGA 4XM3A 3WTZA 2UUZA 1VQ8I 2HDDA 2K3FA 5D8LB 2M0CA 4ZC3A 2JN6A 5GTHC 1YIOA 4AYBA 1PYVA 2Z9OA 3CP8A 3U9GA 2E5ZA 5LLQA 1LQ1A 4PSWA 4RB3C 5FLVA 2HKOA 2ZNZA 4MGRA 2VKEA 2HI3A 3FM5A 4HZFA 1TWFJ 4ESBA 2R7XA 1W0TA 1Z77A 5B1BH 3E5XA 4HRIA 1J59A 5DYMA 1VQOI 4AWXB 3DP7A 3C2BA 2Z5UA 3MD2A 3FF5A 4G94A 4IF4A 5ICFA 2W84A 3TO7A 1POGA 4MLOA 1W7PD 5DM6F 1B72A 4B3AA 5K5RA 1YOVB 3BP8A 3FK6A 1H9TA 1XX5A 4WF2A 1Z6TA 4ZZLA 4BJ5C 1S3JA 2CW7A 2KIUA 3HOUJ 3H35A 4AIKA 2G0EA 2IT0A 3JW4A 3HC7A 3CLOA 2K85A 5KNLA 2JJ7A 1ZLKA 1Z7LA 3DEEA 2H6CA 2XAFA 4XRFA 2DMQA 1QPIA 3E6CC 4A3LJ 2IP2A 4CYCA 4L18B 2HOAA 3RKYA 3W2VA 4R79A 5LEKA 3S16J 3O2PE 3CD6I 4C2MJ 4LJZF 2EZIA 1FSHA 3K1PA 3GYHX 1MBHA 3R0JA 1BOAA 2A5YB 3WU0A 1YW8A 5M5XJ 2NAZA 2NNYA 1DP7P 1P9QC 2LOOA 1U8BA 4M6YA 4HEA2 4QPQA 2QKLB 2E1MB 1R4NB 4G6DA 4B3XA 4UUSA 5E17F 4BQQA 5D5XB 3PQJA 4WX9A 2ZSHB 2OAZA 3JSOA 1YJWI 2OV7A 2Y0SN 2M30A 4HX7A 3ZQ7A 3AL0C 2ZKZA 3DEUA 2R7RA 2LKPA 3ELKA 3P9KA 2PQ8A 2LMDA 5F1JA 2LREA 1EJ9A 1WJFA 4E4HA 3IP4B 3K1NA 2EFOA 3ROUA 1K79A 1ZKGA 4H0EA 2OUMA 1N78A 2FJ1A 2OCCH 4XKVA 3RTRA 3LAPA 1VQNI 4FT8A 5E3MA 4A0XA 5BPDA 2YPRA 4X0GA 2JTVA 1G2HA 5D4SA 2JSPA 1Y1WJ 5CVJA 2UV1A 4LG0B 4P9FA 2QSHX 3FHZA 1R49A 1YW9A 1MBKA 1FBUA 1U9OA 4LGWA 4M73A 3J7YJ 2R92J 1OJLA 2Q2EB 3BPXA 1P4AA 3H3VK 3O8HA 5GAGJ 4Q48A 2E2JJ 2CU7A 3N97A 3B6CA 1FIAA 3CCLI 2GWRA 2VBZA 3M4OJ 1UAAA 2ZMEC 3KYDB 1V55H 4HQMA 4YFXF 1F5TA 2KJCA 5IOZA 5CJ9A 2DLLA 3EPZA 2ME6A 2M8EA 2G7HA 1W36D 4F91B 4RS8A 1MJAA 5E3LA 1QHHD 4YFNF 4HNVA 3T8TA 2A6HF 3CZ6A 1NK2P 4PJLA 4A3DJ 1R22A 3K2AA 4Q47A 2JWTA 5H20A 1YX5A 4PDKA 5C3EJ 4CCMA 4M3DA 1D8JA 1FEXA 3VYTB 2CUFA 5FKOA 4ZYGA 2OZ6A 2OC6A 3GVAA 1S7EA 3ZQFA 1TNSA 3JRGA 4BS9A 2E2HJ 5E1ZB 3L2CA 1KONA 3QWLA 2L0KA 4XLNF 2EFPA 3SQNA 5IYCJ 1WGXA 3TOBA 4ESJA 2E34A 5DTDA 3BR0A 2W48A 4YFKF 1HDPA 2VPRA 2LF8A 5TJJA 3BR6A 1PUFB 5EZHA 3SXYA 5D5UB 1LJ9A 3WGGA 1G8XA 2QM3A 3LA2A 2FQ4A 5E20A 1NH3A 1R00A 1RI7A 4PUSA 2JRTA 4ENNA 5FKMA 3P9CA 3FMRA 3IUOA 3DU6A 2LYCA 2L7MP 1ZG1A 5M5YJ 1RUOA 1CF7A 3GFMA 2UWMA 2CFXA 1QZEA 1U9NA 3T1BA 2NNNA 2PG4A 1XGNA 1G3TA 5L3EA 2DFEA 3DU5A 1G6NA 3S93A 1EA3A 1DDNA 1TWGJ 1X3ZB 1DU0A 3LSHA 4AUXA 3KYCB 4JYKA 4ZDLA 1IN5A 2D1HA 2LBFB 4LLLA 2ELHA 2J5OA 4E7KA 4BHCA 1FP2A 5D6EA 4BHBA 4UVAA 4MQVA 2JUCA 5KHDA 4IPAA 1ZQ3P 3QYFA 4L9NA 2BXZA 3MZYA 5CPRB 2RKHA 5IP9J 4KNYA 3GTOJ 3HOVJ 2RAEA 1ON2A 3PIPF 4F55A 3OYGA 1BM9A 2HVQA 1A6IA 2XGCA 3BLYA 1X2NA 5EGOA 4D9JA 2O9LA 1P6RA 2BGCA 4HX8A 3BCBA 3TP3A 2KRFA 1LNWA 3G6EI 2XB5A 3S14J 1GV2A 2KISA 3E5QA 2L4MA 2L3DA 1WHUA 3GUDA 1QNTA 2HR3A 2MBFA 3L2QA 3I55I 5JHFA 3CC2I 2UXNA 2QBYB 4QWQA 1P7IA 3A0HC 3G1MA 4N0BA 3Q5FA 2BV6A 3CESA 1I27A 2F6CA 1FSEA 4XRMA 1K7AA 2VE8A 2W85A 2VC1A 3J80Z 3SDBA 5B3SH 4PJJA 4UVCA 2GBYA 1JHHA 4BE0A 3PQKA 1Y1VJ 3HSRA 4U0YA 2B63J 3FXKA 4LK1F 1IDZA 4E7HA 1OFCX 1Y0NA 5E8IA 1IXCA 4DZPA 2DK5A 2O61A 1Q1HA 3ZCOA 2PN6A 2Y31A 2X6WA 3IAS2 2KIFA 2PJRB 1E3PA 3K4BA 3PSFA 1GDTA 2STWA 5J40A 4PFOA 2QKMB 3TW7A 3GTKJ 1HF0A 3L2VA 4AC0A 1OMIA 3P7NA 4OINF 2XPVA 1D0ZA 2HZDA 2XAJA 2V79A 3G71I 5EG0B 4LB5A 4LIVA 3E5UA 1BBYA 1OISA 2P6SA 1Z9CA 5F0CA 4I7HA 3OYCA 2DQLA 4A0ZA 4I01A 3C2HA 1VZ0A 4C3HJ 1V3FA 3CMYA 4ITVA 4IZZA 2ZBKA 2CJJA 3HHGA 5J1YA 3QAHA 3DEWA 1MBFA 4WCGA 3A1YA 2CMPA 3K4CA 2X85A 3IHUA 4ZJZA 2O8KA 3B6AA 5IY5H 1MKMA 3DTIA 2FU4A 4UXNA 2XF6A 3I58A 4Y52J 2V6CA 2CH0A 3JRAA 3WHBA 2K9SA 4AM3A 4BH9A 4PSXA 2QLZA 3OYDA 4M6VA 3QRFF 4CHUA 1TL8A 1RKTA 2ID3A 1YRNB 2EB7A 1O7FA 1TW3A 3M8FA 2V7FA 1H8AC 1GXPA 3WTVC 3I64A 3FKIJ 3CCYA 3TDUC 1S72I 3GX4X 1BJZA 2DPUA 3VYUB 1SMTA 3X2QH 2QENA 3K2ZA 3BOQA 3CDIA 1L3LA 1VFCA 5DV5A 2LK2A 3ZMUA 1IUFA 1X1DA 2VXDA 1Z0XA 1FOWA 2Q8KA 2LTPA 3NWTA 4Y7NJ 1REPC 2I5UA 2Q0OA 2ZFWA 2R3SA 1YO5C 3AG3H 2MD0A 5C44J 3OYNA 3QYEA 2L01A 3K4JA 3OS0A 4YRVA 4ASNA 3GTMJ 2ZSIB 1FC3A 1U6GA 2EIMH 2BVMA 3GTLJ 2F2EA 1F36A 4HQEA 1UG2A 5M3MJ 3MQ0A 4RM3A 3ZMTA 4RGRA 4ZTFA 2EZHA 3S1MJ 1ZR4A 4I99C 4CCOA 2XASA 4IRGA 1WJBA 4OAYA 4XLEA 1RR7A 3HOTA 3BJOA 3A4CA 4LLGF 1J09A 1X1PA 3BZ6A 1E2XA 1SD7A 3M1EA 3E1SA 1BN5A 4B43A 1WFXA 5FB2A 2Y30A 4NC6A 5GAHJ 4HNTA 1WRJA 3FX3A 4HF1A 2EK5A 1PVEA 4V2FA 2TRTA 5FRMA 5M3FJ 1V5GA 3SFZA 3E3VA 4RAGA 5JLWA 4R1HA 1H89C 2PLYA 2PJPA 1X3UA 2VQGA 2Y0SA 3BC8A 4Y15A 1T39A 2O8XA 4LIUA 1JGSA 2LR8A 3I4PA 3KP6A 3G4SI 1FIPA 2WAQA 4D0PA 1ZAOA 1YS7A 4YEJA 4I09A 3HDDA 2EA2A 3GZ6A 1ZG3A 2A05A 4I0BA 2XDVA 3PIOF 2FUG2 4HSTA 4MQ9F 4A0YA 5IT9Z 3VPRA 4Y3OA 2X6OA 4WWCA 2FXAA 2R7VA 1NTCA 3PFIA 1MMSA 3BDDA 3OL3A 1IV6A 3RJPA 3HTUA 1MSFC 3HJEA 4E7JA 3QPSA 3VB2A 1SC7A 3KP5A 3W6JB 2FBHA 1MDMA 2DCEA 1FYLA 4HW0A 5E8GA 2OTLI 1W5SA 2P6TA 3DKYA 1R5HA 4G7ZF 2KT0A 1BW5A 1T33A 5FD6A 1BR1A 5JI6A 2P81A 2XC7A 1CQTA 4G7OF 2WY8Q 2L2OA 4BKXA 2YX7A 1QO0D 3IH3A 4NQWB 1HCRA 2MG4A 2RQQA 2MH2A 2IEKA 2DMPA 3OIPA 4IJAA 2L9NA 2P4WA 3TMOA 5FKNA 1XSDA 3I5UA 1JTXA 1FNNA 1R23A 4CSWA 2ECCA 2JK3A 3S17J 2BW3B 2QQBA 1VI0A 3LSTA 4DBQA 2F5EA 3V7RA 3SZTA 4D7MA 1J5YA 3BY6A 4EV0A 1FTZA 1IN4A 5ICCA 1LPQA 4C2UA 4GYGA 2X1EA 2HVSA 1T8IA 3K69A 3EQLF 2BEOA 3ZXSA 3D0SA 3BG7A 2GOXB 4AU7A 2J5PA 1WH7A 2CV1A 4KT6A 4XR6A 3FXQA 1K83J 4E7SA 2XGDA 3VSLA 2COMA 3ZGKA 1VQ4I 4AIDA 2KMUA 1MZBA 1BC7C 5F6FA 2L9VA 4DYCA 3KLOA 4Q5SF 3GZ5A 3KP3A 3ZN0A 1K4TA 3WE2A 2EV6A 5CLSA 1IRXA 2ELJA 4P1WA 4A3CJ 4IHWA 3J7AY 3RQ4A 3H9QA 3DPUA 1MJBA 4BY7J 1BR4A 4FE7A 4II2A
chains in the Genus database with same CATH topology
2EFNA 1AWCA 4KMFA 3IWFA 3QU6A 5DCFA 1KU2A 2MC3A 4U88A 1XSVA 2MA3A 3HRUA 3ZMVA 1I1GA 4RGUA 3DXJF 3G3ZA 4ZYEA 1FBQA 4HA8A 1KYWA 5D4RA 2L4AA 3L7WA 1IN8A 3VEPA 4FX4A 3EYIA 4AD9A 4L5JA 4OIOF 4G7HF 1EH7A 5DDGA 2VE9A 2XV4S 1S29A 4S05A 1LB2A 1TQPA 2VN2A 1XB4A 3C1DA 4KN4X 1KYZA 1KQ9A 3GFLA 5FD5A 2QVOA 2HEOA 1YLFA 4BQAA 2F5DA 3Q9SA 3CTAA 1ZREA 3F3XA 2WTEA 2LDUA 1WSUA 4JBAA 5KK1A 1PDNC 3BROA 4HDVA 1NHAA 3IWZA 2HTSA 4MEYF 2HWVA 3LA7A 1UCRA 5LGUA 2ZJ2A 3F8MA 4GXOA 4NQWA 3HTSB 2HQRA 3CUQA 3ABTA 2XUBA 1P92A 4HOBA 3CO6C 1LDDA 3F21A 4UHTA 2DBBA 5BPIA 2IA0A 2ESHA 1XCVA 2Z3YA 4A6DA 4RB2C 1LDJA 2WV0A 4IHTA 4EMSA 5ERIA 2C6YA 4EM2A 2VOPA 4RGXA 1IRFA 4HYEA 2VONA 2V1UA 5LEJA 4F7ZA 2DAOA 5LGNA 2Y48A 5ILSA 2CWEA 3KCCA 4OIRF 3B02A 2TDXA 3R60A 3TOAA 1E17A 3WODF 3BWGA 3IRQA 1HKQA 1YQAA 1BJAA 3MCZA 5FFXA 1JE8A 2W24A 4WXDA 1BC8C 4O5VA 5LRSA 1WI9A 1I1SA 4YIFA 3CUQC 3HRMA 1LVAA 4LK0F 3KE2A 5IT9K 1AOYA 2L54A 3C7JA 4JK1X 2V1XA 1QZZA 3WU1B 3F8CA 4I0AA 4BYYA 2V9VA 2VC0A 1O3TA 2ISZA 4L9TA 1K78B 2A3SA 1F4KA 2K86A 2HGCA 5D8KB 5ILUA 1F9NA 2K02A 3DQVC 2XAHA 4M9ZA 3V8LA 1HKSA 1WWXA 2XGXA 5J6XA 5ICGA 5DD8A 4HF0A 1V4RA 1BIBA 2NS0A 4LD5A 3LA3A 4RAYA 4UV8A 2W57A 4HDUA 2DTRA 3TQNA 1IXSB 4YIIA 4ZYHA 4PZJA 3RDIA 1RNLA 2GZWA 1RUNA 4LLNA 2XVCA 2O0YA 1P2FA 3RIRA 3QOPA 3HOSA 2OD5A 2NYXA 1QQIA 4PGHA 5JVTA 1U5TC 1R5GA 3MAJA 3SZPA 1SAXA 5HLIA 5BS6A 5LHGA 1U5TB 3JSPA 1ULYA 2X4HA 1J0RA 2MLKA 2JPCA 3U1DA 4U0VA 4L0YB 5LBQA 2YU3A 2Y75A 1J2XA 3U2RA 1A04A 1IN7A 3MFKA 5A2QK 2RNJA 5KVRA 2YSRA 4GYIA 5DEQA 2QYOA 2VT3A 1ZYRF 4L9VA 3ECHA 3IL2A 2CQKA 3LQQA 3F6VA 3O3KA 3E6MA 1HXDA 4CGZA 1LEBA 1OKRA 1XSXA 3K1MA 3F8BA 4OMYA 4I2OA 4PCQA 4MTDA 2CGPA 1YS6A 1SFUA 2HYFA 3GEZA 3TGNA 4L5IA 1Z7UA 1PP7U 5L3DA 4XSZF 5HLHA 4G9YA 5EEHA 2XAGA 5HDGA 1OPCA 4KA4A 1UHWA 1W7PB 1P4XA 4KMUX 2OQRA 3WE3A 3KETA 2K4JA 2VBXA 2GA1A 1HW2A 2W25A 4OOIA 2X0LA 4K2EA 2E1NA 1RIOH 2FEZA 6PAXA 3R6SA 2PMHA 3QU3A 1PP8F 3J7AO 4IHSA 5CVRA 3GFJA 1BI3A 3EDPA 1KGSA 1XDSA 4LG0A 3HRSA 1D5VA 1IUYA 5E18F 3WGHA 3WTYC 2EA4A 3GF2A 3RPUA 1MJ9A 1BI0A 3O6BB 3FZVA 1RZ4A 1R36A 3J81K 1XMAA 4KN7X 4CO8A 3ZMDA 4EM0B 4CYDA 4G8XA 2VODA 3CUQB 4UV9A 5D6FA 2M45A 5CVUA 3I59A 1STZA 3DKWA 2PFBA 2FE3A 3QPHA 3T5XA 5HDNA 2K27A 1KU9A 2MH9A 4B8XA 3ECOA 3OOPA 4EJTA 1JXSA 5LHIA 3MWMA 5AONA 4I02A 4U7DA 3RYRA 3EETA 3JAMK 3HUGA 2ISYA 3B73A 2A68F 3RYPA 1DUXC 4MEXF 5E1XA 1R7JA 2LSOA 1OR7A 4UUVA 1TNTA 4MTEA 1PUEE 1BIAA 5J8CA 3V8KA 3MEXA 3WGIA 5LRRA 2QWWA 3ABUA 4KYWA 5DCMB 4AIJA 2EJRA 4KIBA 1XCBA 1ODDA 2R7FA 3I53A 4JQFA 4O3MA 4UVBA 3I0TA 4A6EA 2Z99A 1ZGJA 2AXLA 2XIGA 2H94A 1WQ2A 3FM3A 1HBXG 3V7CA 3F8NA 3E6DA 4DQ2A 5L3GA 1XDUA 1ZG5A 1SD4A 4Y17A 2JT1A 1J9IA 4GCVA 1FOKA 4P9UA 2EFWA 2FF4A 3VFZA 2OBPA 3M8EA 3FWEA 2R7DA 2MD5A 1OYYA 1B6AA 1FWZA 2G7UA 5DD4A 1QPMA 1B9NA 3F8FA 2QQAA 3HSFA 5LGTA 4M9XA 1YW7A 2CO5A 2XROA 4RAZA 3C18A 4ENKA 2CW0F 3L00A 1USSA 4MNUA 3LWFA 4QLCU 1UFMA 4ON0A 2DT5A 2BE5F 5HVQC 4A12A 3K0LA 3HHHA 1J7KA 4U7BA 1ON1A 1O3RA 2LNBA 3DPLC 2H09A 2AS5F 1Z91A 4KUMA 4AVPA 1GXQA 5J8FA 4TV7A 2XRNA 4CHUA 2FSWA 2M87A 5LHHA 3RPQA 1XGSA 5IT3A 2P7VB 1U8RA 4M9SA 1FBSA 1XGOA 2DQRA 4EQQA 2ZMEB 4E70A 1S7OA 2OZUA 4BXUA 1UHMA 4CDGA 1T98A 1ZGAA 4LMYA 3I59B 1B4AA 4OU0A 4AIHA 2GAUA 2O6GE 2RQPA 2PI0A 2GXBA 1KQ8A 1XD7A 3E97A 3EUHA 2ETHA 5CVVA 2PBIA 2D45A 4Q4ZF 3NEUA 1MDMB 3WTTC 2Z33A 5ED4A 4YG2F 5E1WA 3FMSA 3V4GA 3GXOA 5L3BA 2DI3A 4IRIA 3HIFA 2O03A 3D5LA 2DPDA 5TRDA 2ZNYA 3RI4A 4CXFA 3CDHA 4EM1A 2QUFA 3WTUC 2EV5A 3BJ6A 3TKYA 2GA2A 1QGPA 4XLPF 3MZHA 4ZYDA 3KP4A 4KIFA 4WXHA 1IZ1A 4A2UA 1KU3A 2GIVA 3ZMSA 1CF7B 2F5CA 5D5VB 1JHFA 1DPRA 1K78A 2DFIA 5A2QZ 2RN7A 1ZARA 4XBFA 5L3FA 1ZRCA 1YG2A 4KT5C 3WTSC 3GWZA 2YX4A 2IVMA 2XAQA 2FBIA 1ZH5A 2H6BA 4P55A 3ML6A 1HW1A 3GW2A 1XGMA 2QQ9A 4LFUA 1IF1A 4EGZA 1TTYA 4U0WA 1LEAA 4ETSA 5BOXA 1Y0UA 2PEXA 2HQNA 2A07F 4Y13A 5FLXK 2BYVE 4FX0A 3HSEA 2FNAA 3TDZC 2KJBA 2ADUA 5H6QA 1FYKA 2F5FA 4A5MA 2HS5A 1I5ZA 2XKOA 3I54A 4OMZA 1D3YA 1QZYA 1YYVA 2QZ8A 1EH8A 2OQGA 3CO7C 5HDKA 4IVNA 1IRGA 2B0LA 3ZMZA 3AAFA 5CVIA 4LB6B 1U78A 3IRRA 1G4DA 5FO5A 1MGTA 3ZN1A 3N4MA 4RGSA 2DU9A 2XKPA 3F72A 3VODA 5CYVA 2A69F 3NQOA 2K7LA 1D8KA 2RDPA 3H3ZA 2FA5A 2WWYA 1WKMA 4HV5A 3DF8A 3VOEA 3KEOA 4ENMA 2M1BA 3QP5A 2VOOA 2VBWA 4EJOA 2JSCA 3LQRA 3DV8A 1HKTA 4M71A 2IW5A 1SMYF 3F6OA 1Z6RA 2ZCWA 1S8NA 1T6SA 1VTNC 4EJWA 1EH6A 4GO1A 4I98B 3KFWX 1HQCA 3BJAA 2PMUA 3F22A 5BMZA 1U5TA 1TQIA 5AIQA 5ICEA 2DO7A 5HS8A 4MHGA 3OV8A 3JTGA 2Y0MA 1FLIA 3RKWA 3J80K 5HS9A 1HW5A 3KEQA 2CYYA 3JAMZ 2HYGD 3R0AA 2GXGA 3L09A 1B59A 1YTYA 1ZHFA 2D1VA 3M7GA 3EYYA 3H92A 1OYWA 4KDPA 2LF7A 1BI2A 2FMYA 1W7PA 3H3UA 4XSXF 2E7WA 1CGPA 1YFHA 3Q9VA 2VBYA 3ULQB 3GFIA 3C3WA 4EJUA 3REOA 2G9WA 5AIPA 2RV8A 3S2WA 2EV0A 4ZH4F 4DNCA 2P7CB 2IRFG 1T38A 2JPBA 1T0FA 1I6XA 1MD0A 1IXRC 3HYIA 3F23A 1F1ZA 2FOKA 2GQQA 2VXZA 3NRVA 4HBLA 4HLYA 4A5NA 2YR2A 1ONVA 5DUKA 2K4BA 1O7LA 3V8JA 3G73A 2QBYA 4HX4A 2FRHA 4HV6A 1GVJA 4KICA 4HLXA 3ZPLA 4RB1A 3QP6A 5DUIA 1TBXA 1Z05A 4BHPA 4ESFA 1O3QA 4NB5A 2P5VA 2NRAC 1ZLJA 5JHUA 1H9GA 2UZKA 3KZYA 4OIQF 2IA1A 4N9IA 2KKOA 5DCMA 3ISPA 2EFQA 3J81Z 1C0WA 5K5QA 1P4WA 2D2WA 1FT9A 2HZTA 2O3FA 2ZO4A 2P8TA 1FP1D 3FXRA 2UXXA 2DW4A 3QPTA 4B09A 1S7AA 2ZXJA 3WG9A 5EEGA 3TO6A 2HTJA 4NHJA 4Z2YA 1B1BA 2H27A 4CICA 3KP2A 2L02A 2XHKA 2BBYA 4R8HA 1SD5A 1EV7A 5FGMA 1HSJA 1G3WA 2P5LC 2M5WA 2OU2A 4CZZA 3IC7A 2A6EF 3I71A 2E7XA 3CUOA 4UNOA 3KP7A 4WXCA 1G3SA 1UB9A 2V1DA 3TO9A 2OA4A 4M74A 1R58A 4IXAA 4KFCA 1S6LA 2CG4A 1IN6A 1U2WA 1T2KA 4EGYA 2P5KA 4P5OA 4IRHA 1HSTA 2WC2A 3SHFA 3WTWC 3FMQA 5D5WB 1J75A 2Q2EA 1GHCA 4BAYA 2IPQX 4RB0A 1FZPB 3GLXA 1L0OC 1Z1DA 5HS7A 2JZYA 4M72A 4N9HA 3W6KB 5K5OA 1TQMA 3T0YA 1ZN2A 1FYMA 4M6XA 5HOOA 1TLHB 1QBJA 4WK8F 1SD6A 3RKXA 3V7SA 3L9FA 1KU7A 2HDCA 5F64A 1O57A 5JR3A 3HRTA 1R1TA 3BPVA 2HFHA 5F1RA 2FNPA 3IKVA 1XMKA 3T8RA 1R1VA 4L9JA 2ZMEA 3K9TA 4HAMA 5HLGA 2FQ3A 1USTA 2ESNA 3KLNA 5FLXZ 1SFEA 5BQTA 5FFZA 1W5TA 2IA2A 2RGVA 4ZZDA 2STTA 3JTHA 3KZZA 5ILVA 3R61A 4KIGA 1SFXA 4L0ZB 3ERED 1KA8A 1KQ0A 4G6QA 4EVIA 2RC4A 2KIMA 3E6BA 1OYIA 2A61A 5JFRA 1G3YA 2EWNA 1B9MA 4ENJA 3LAJA 1H0MA 1FX7A 2FMLA 5L3CA 1DPUA 3IKTA 3CJNA 2RVCA 4P96A 4O6JA 2IJLA 2MLGA 3M9AA 3WTXC 3FXUA 2HOEA 1FY7A 1ZRDA 3R4KA 1TW2A 4BNCA 4EJVA 2HKXA 1O3SA 4S04A 1FPQA 2VT2A 1XN7A 4PGGA 3ZP5A 1IAWA 2ACJA 1ZRFA 3P9IA 3COAC 1BI1A 2FBKA 3DPTA 1LDKB 5H6RA 1IW7F 2CSOA 4OIPF 2E1CA 4HF2A 2DK8A 4FHTA 1K6OA 1R1UA 1W4MA 3GO5A 3DFGA 5K1YA 1U3EM 3LFKA 4GGGA 3WTZA 5D8LB 1YIOA 2Z9OA 3U9GA 5LLQA 1LQ1A 4RB3C 2HKOA 2ZNZA 4MGRA 3FM5A 4HZFA 4ESBA 3E5XA 1J59A 5DYMA 4AWXB 3DP7A 2Z5UA 4G94A 3FF5A 4IF4A 5ICFA 2W84A 3TO7A 1W7PD 5K5RA 3BP8A 1H9TA 4WF2A 1Z6TA 4ZZLA 1S3JA 2KIUA 4AIKA 2IT0A 3JW4A 3CLOA 1ZLKA 2H6CA 2XAFA 4XRFA 3E6CC 2IP2A 4L18B 3RKYA 4R79A 5LEKA 3O2PE 4LJZF 1FSHA 3K1PA 3GYHX 3R0JA 1BOAA 2A5YB 3WU0A 1YW8A 2NAZA 2NNYA 1DP7P 4M6YA 4G6DA 5E17F 5D5XB 3PQJA 4WX9A 2OAZA 3JSOA 2M30A 4HX7A 3ZQ7A 2ZKZA 3DEUA 2LKPA 3ELKA 3P9KA 2PQ8A 3K1NA 2EFOA 3ROUA 1K79A 4H0EA 3RTRA 3LAPA 4FT8A 4A0XA 5BPDA 2YPRA 2JTVA 5D4SA 5CVJA 4LG0B 4P9FA 3FHZA 1YW9A 1FBUA 4LGWA 4M73A 3BPXA 1P4AA 4Q48A 3N97A 2GWRA 2VBZA 1F5TA 4HQMA 4YFXF 2KJCA 5CJ9A 2DLLA 2M8EA 2G7HA 4RS8A 1MJAA 4YFNF 3T8TA 2A6HF 1R22A 4Q47A 5H20A 4PDKA 1D8JA 4ZYGA 2OZ6A 3GVAA 1TNSA 5E1ZB 3L2CA 4XLNF 2EFPA 3SQNA 3TOBA 4ESJA 4YFKF 2LF8A 5TJJA 3SXYA 5D5UB 1LJ9A 3WGGA 2QM3A 3LA2A 5E20A 1R00A 1RI7A 4ENNA 2JRTA 3P9CA 3FMRA 1ZG1A 1RUOA 1CF7A 3GFMA 2UWMA 2CFXA 3T1BA 2NNNA 2PG4A 1XGNA 1G3TA 5L3EA 1G6NA 1DDNA 1IN5A 2D1HA 4LLLA 2ELHA 2J5OA 4BHCA 1FP2A 5D6EA 4BHBA 4UVAA 4MQVA 4IPAA 4L9NA 3MZYA 2RKHA 4KNYA 1ON2A 1BM9A 1P6RA 2BGCA 4HX8A 2KRFA 1LNWA 3E5QA 2L4MA 2L3DA 3GUDA 1QNTA 2HR3A 2MBFA 2UXNA 2QBYB 4QWQA 4N0BA 3Q5FA 2BV6A 1I27A 1FSEA 1K7AA 2VE8A 2W85A 2VC1A 3J80Z 4UVCA 1JHHA 3PQKA 3HSRA 4U0YA 4LK1F 5E8IA 1IXCA 2DK5A 2O61A 1Q1HA 2PN6A 2KIFA 2STWA 1OMIA 3P7NA 4OINF 2XAJA 2V79A 4LB5A 3E5UA 1BBYA 2P6SA 1Z9CA 4I7HA 2DQLA 4A0ZA 4I01A 1V3FA 2ZBKA 3HHGA 3QAHA 4WCGA 3IHUA 1MKMA 2FU4A 4UXNA 3I58A 2V6CA 4BH9A 2QLZA 3QRFF 2EB7A 1O7FA 1TW3A 3M8FA 1GXPA 3WTVC 3I64A 3TDUC 3GX4X 2DPUA 1SMTA 2QENA 3K2ZA 3BOQA 1L3LA 5DV5A 3ZMUA 2Q8KA 1REPC 2Q0OA 2ZFWA 2R3SA 1YO5C 2L01A 4ASNA 1FC3A 1U6GA 2F2EA 4HQEA 3MQ0A 3ZMTA 4RGRA 2XASA 4IRGA 3HOTA 3BJOA 4LLGF 3BZ6A 1E2XA 1SD7A 3M1EA 1BN5A 5FB2A 1WRJA 3FX3A 4HF1A 2EK5A 3SFZA 3E3VA 4R1HA 2PLYA 2PJPA 1X3UA 4Y15A 1T39A 2O8XA 1JGSA 3I4PA 3KP6A 4D0PA 1ZAOA 1YS7A 4I09A 2EA2A 3GZ6A 1ZG3A 4I0BA 4MQ9F 4A0YA 5IT9Z 4WWCA 2FXAA 3PFIA 3BDDA 3RJPA 3HTUA 3VB2A 1FYLA 1MDMA 3KP5A 2FBHA 3W6JB 4HW0A 5E8GA 1W5SA 2P6TA 1R5HA 4G7ZF 5FD6A 4G7OF 5JI6A 2YX7A 1QO0D 2MH2A 4IJAA 2P4WA 1XSDA 3I5UA 1FNNA 1R23A 2QQBA 3LSTA 2F5EA 3V7RA 3SZTA 1J5YA 3BY6A 4EV0A 1IN4A 5ICCA 4GYGA 3K69A 3EQLF 2BEOA 3D0SA 2J5PA 3FXQA 2COMA 1MZBA 1BC7C 5F6FA 3KLOA 4Q5SF 3GZ5A 3KP3A 3ZN0A 3WE2A 2EV6A 5CLSA 1MJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFN A;  1AWC A;  4KMF A;  3IWF A;  3QU6 A;  5DCF A;  1KU2 A;  2MC3 A;  4U88 A;  1XSV A;  2MA3 A;  3HRU A;  3ZMV A;  1I1G A;  4RGU A;  3DXJ F;  3G3Z A;  4ZYE A;  1FBQ A;  4HA8 A;  1KYW A;  5D4R A;  2L4A A;  3L7W A;  1IN8 A;  3VEP A;  4FX4 A;  3EYI A;  4AD9 A;  4L5J A;  4OIO F;  4G7H F;  1EH7 A;  5DDG A;  2VE9 A;  2XV4 S;  1S29 A;  4S05 A;  1LB2 A;  1TQP A;  2VN2 A;  1XB4 A;  3C1D A;  4KN4 X;  1KYZ A;  1KQ9 A;  3GFL A;  5FD5 A;  2QVO A;  2HEO A;  1YLF A;  4BQA A;  2F5D A;  3Q9S A;  3CTA A;  1ZRE A;  3F3X A;  2WTE A;  2LDU A;  1WSU A;  4JBA A;  5KK1 A;  1PDN C;  3BRO A;  4HDV A;  1NHA A;  3IWZ A;  2HTS A;  4MEY F;  2HWV A;  3LA7 A;  1UCR A;  5LGU A;  2ZJ2 A;  3F8M A;  4GXO A;  4NQW A;  3HTS B;  2HQR A;  3CUQ A;  3ABT A;  2XUB A;  1P92 A;  4HOB A;  3CO6 C;  1LDD A;  3F21 A;  4UHT A;  2DBB A;  5BPI A;  2IA0 A;  2ESH A;  1XCV A;  2Z3Y A;  4A6D A;  4RB2 C;  1LDJ A;  2WV0 A;  4IHT A;  4EMS A;  5ERI A;  2C6Y A;  4EM2 A;  2VOP A;  4RGX A;  1IRF A;  4HYE A;  2VON A;  2V1U A;  5LEJ A;  4F7Z A;  2DAO A;  5LGN A;  2Y48 A;  5ILS A;  2CWE A;  3KCC A;  4OIR F;  3B02 A;  2TDX A;  3R60 A;  3TOA A;  1E17 A;  3WOD F;  3BWG A;  3IRQ A;  1HKQ A;  1YQA A;  1BJA A;  3MCZ A;  5FFX A;  1JE8 A;  2W24 A;  4WXD A;  1BC8 C;  4O5V A;  5LRS A;  1WI9 A;  1I1S A;  4YIF A;  3CUQ C;  3HRM A;  1LVA A;  4LK0 F;  3KE2 A;  5IT9 K;  1AOY A;  2L54 A;  3C7J A;  4JK1 X;  2V1X A;  1QZZ A;  3WU1 B;  3F8C A;  4I0A A;  4BYY A;  2V9V A;  2VC0 A;  1O3T A;  2ISZ A;  4L9T A;  1K78 B;  2A3S A;  1F4K A;  2K86 A;  2HGC A;  5D8K B;  5ILU A;  1F9N A;  2K02 A;  3DQV C;  2XAH A;  4M9Z A;  3V8L A;  1HKS A;  1WWX A;  2XGX A;  5J6X A;  5ICG A;  5DD8 A;  4HF0 A;  1V4R A;  1BIB A;  2NS0 A;  4LD5 A;  3LA3 A;  4RAY A;  4UV8 A;  2W57 A;  4HDU A;  2DTR A;  3TQN A;  1IXS B;  4YII A;  4ZYH A;  4PZJ A;  3RDI A;  1RNL A;  2GZW A;  1RUN A;  4LLN A;  2XVC A;  2O0Y A;  1P2F A;  3RIR A;  3QOP A;  3HOS A;  2OD5 A;  2NYX A;  1QQI A;  4PGH A;  5JVT A;  1U5T C;  1R5G A;  3MAJ A;  3SZP A;  1SAX A;  5HLI A;  5BS6 A;  5LHG A;  1U5T B;  3JSP A;  1ULY A;  2X4H A;  1J0R A;  2MLK A;  2JPC A;  3U1D A;  4U0V A;  4L0Y B;  5LBQ A;  2YU3 A;  2Y75 A;  1J2X A;  3U2R A;  1A04 A;  1IN7 A;  3MFK A;  5A2Q K;  2RNJ A;  5KVR A;  2YSR A;  4GYI A;  5DEQ A;  2QYO A;  2VT3 A;  1ZYR F;  4L9V A;  3ECH A;  3IL2 A;  2CQK A;  3LQQ A;  3F6V A;  3O3K A;  3E6M A;  1HXD A;  4CGZ A;  1LEB A;  1OKR A;  1XSX A;  3K1M A;  3F8B A;  4OMY A;  4I2O A;  4PCQ A;  4MTD A;  2CGP A;  1YS6 A;  1SFU A;  2HYF A;  3GEZ A;  3TGN A;  4L5I A;  1Z7U A;  1PP7 U;  5L3D A;  4XSZ F;  5HLH A;  4G9Y A;  5EEH A;  2XAG A;  5HDG A;  1OPC A;  4KA4 A;  1UHW A;  1W7P B;  1P4X A;  4KMU X;  2OQR A;  3WE3 A;  3KET A;  2K4J A;  2VBX A;  2GA1 A;  1HW2 A;  2W25 A;  4OOI A;  2X0L A;  4K2E A;  2E1N A;  1RIO H;  2FEZ A;  6PAX A;  3R6S A;  2PMH A;  3QU3 A;  1PP8 F;  3J7A O;  4IHS A;  5CVR A;  3GFJ A;  1BI3 A;  3EDP A;  1KGS A;  1XDS A;  4LG0 A;  3HRS A;  1D5V A;  1IUY A;  5E18 F;  3WGH A;  3WTY C;  2EA4 A;  3GF2 A;  3RPU A;  1MJ9 A;  1BI0 A;  3O6B B;  3FZV A;  1RZ4 A;  1R36 A;  3J81 K;  1XMA A;  4KN7 X;  4CO8 A;  3ZMD A;  4EM0 B;  4CYD A;  4G8X A;  2VOD A;  3CUQ B;  4UV9 A;  5D6F A;  2M45 A;  5CVU A;  3I59 A;  1STZ A;  3DKW A;  2PFB A;  2FE3 A;  3QPH A;  3T5X A;  5HDN A;  2K27 A;  1KU9 A;  2MH9 A;  4B8X A;  3ECO A;  3OOP A;  4EJT A;  1JXS A;  5LHI A;  3MWM A;  5AON A;  4I02 A;  4U7D A;  3RYR A;  3EET A;  3JAM K;  3HUG A;  2ISY A;  3B73 A;  2A68 F;  3RYP A;  1DUX C;  4MEX F;  5E1X A;  1R7J A;  2LSO A;  1OR7 A;  4UUV A;  1TNT A;  4MTE A;  1PUE E;  1BIA A;  5J8C A;  3V8K A;  3MEX A;  3WGI A;  5LRR A;  2QWW A;  3ABU A;  4KYW A;  5DCM B;  4AIJ A;  2EJR A;  4KIB A;  1XCB A;  1ODD A;  2R7F A;  3I53 A;  4JQF A;  4O3M A;  4UVB A;  3I0T A;  4A6E A;  2Z99 A;  1ZGJ A;  2AXL A;  2XIG A;  2H94 A;  1WQ2 A;  3FM3 A;  1HBX G;  3V7C A;  3F8N A;  3E6D A;  4DQ2 A;  5L3G A;  1XDU A;  1ZG5 A;  1SD4 A;  4Y17 A;  2JT1 A;  1J9I A;  4GCV A;  1FOK A;  4P9U A;  2EFW A;  2FF4 A;  3VFZ A;  2OBP A;  3M8E A;  3FWE A;  2R7D A;  2MD5 A;  1OYY A;  1B6A A;  1FWZ A;  2G7U A;  5DD4 A;  1QPM A;  1B9N A;  3F8F A;  2QQA A;  3HSF A;  5LGT A;  4M9X A;  1YW7 A;  2CO5 A;  2XRO A;  4RAZ A;  3C18 A;  4ENK A;  2CW0 F;  3L00 A;  1USS A;  4MNU A;  3LWF A;  4QLC U;  1UFM A;  4ON0 A;  2DT5 A;  2BE5 F;  5HVQ C;  4A12 A;  3K0L A;  3HHH A;  1J7K A;  4U7B A;  1ON1 A;  1O3R A;  2LNB A;  3DPL C;  2H09 A;  2AS5 F;  1Z91 A;  4KUM A;  4AVP A;  1GXQ A;  5J8F A;  4TV7 A;  2XRN A;  4CHU A;  2FSW A;  2M87 A;  5LHH A;  3RPQ A;  1XGS A;  5IT3 A;  2P7V B;  1U8R A;  4M9S A;  1FBS A;  1XGO A;  2DQR A;  4EQQ A;  2ZME B;  4E70 A;  1S7O A;  2OZU A;  4BXU A;  1UHM A;  4CDG A;  1T98 A;  1ZGA A;  4LMY A;  3I59 B;  1B4A A;  4OU0 A;  4AIH A;  2GAU A;  2O6G E;  2RQP A;  2PI0 A;  2GXB A;  1KQ8 A;  1XD7 A;  3E97 A;  3EUH A;  2ETH A;  5CVV A;  2PBI A;  2D45 A;  4Q4Z F;  3NEU A;  1MDM B;  3WTT C;  2Z33 A;  5ED4 A;  4YG2 F;  5E1W A;  3FMS A;  3V4G A;  3GXO A;  5L3B A;  2DI3 A;  4IRI A;  3HIF A;  2O03 A;  3D5L A;  2DPD A;  5TRD A;  2ZNY A;  3RI4 A;  4CXF A;  3CDH A;  4EM1 A;  2QUF A;  3WTU C;  2EV5 A;  3BJ6 A;  3TKY A;  2GA2 A;  1QGP A;  4XLP F;  3MZH A;  4ZYD A;  3KP4 A;  4KIF A;  4WXH A;  1IZ1 A;  4A2U A;  1KU3 A;  2GIV A;  3ZMS A;  1CF7 B;  2F5C A;  5D5V B;  1JHF A;  1DPR A;  1K78 A;  2DFI A;  5A2Q Z;  2RN7 A;  1ZAR A;  4XBF A;  5L3F A;  1ZRC A;  1YG2 A;  4KT5 C;  3WTS C;  3GWZ A;  2YX4 A;  2IVM A;  2XAQ A;  2FBI A;  1ZH5 A;  2H6B A;  4P55 A;  3ML6 A;  1HW1 A;  3GW2 A;  1XGM A;  2QQ9 A;  4LFU A;  1IF1 A;  4EGZ A;  1TTY A;  4U0W A;  1LEA A;  4ETS A;  5BOX A;  1Y0U A;  2PEX A;  2HQN A;  2A07 F;  4Y13 A;  5FLX K;  2BYV E;  4FX0 A;  3HSE A;  2FNA A;  3TDZ C;  2KJB A;  2ADU A;  5H6Q A;  1FYK A;  2F5F A;  4A5M A;  2HS5 A;  1I5Z A;  2XKO A;  3I54 A;  4OMZ A;  1D3Y A;  1QZY A;  1YYV A;  2QZ8 A;  1EH8 A;  2OQG A;  3CO7 C;  5HDK A;  4IVN A;  1IRG A;  2B0L A;  3ZMZ A;  3AAF A;  5CVI A;  4LB6 B;  1U78 A;  3IRR A;  1G4D A;  5FO5 A;  1MGT A;  3ZN1 A;  3N4M A;  4RGS A;  2DU9 A;  2XKP A;  3F72 A;  3VOD A;  5CYV A;  2A69 F;  3NQO A;  2K7L A;  1D8K A;  2RDP A;  3H3Z A;  2FA5 A;  2WWY A;  1WKM A;  4HV5 A;  3DF8 A;  3VOE A;  3KEO A;  4ENM A;  2M1B A;  3QP5 A;  2VOO A;  2VBW A;  4EJO A;  2JSC A;  3LQR A;  3DV8 A;  1HKT A;  4M71 A;  2IW5 A;  1SMY F;  3F6O A;  1Z6R A;  2ZCW A;  1S8N A;  1T6S A;  1VTN C;  4EJW A;  1EH6 A;  4GO1 A;  4I98 B;  3KFW X;  1HQC A;  3BJA A;  2PMU A;  3F22 A;  5BMZ A;  1U5T A;  1TQI A;  5AIQ A;  5ICE A;  2DO7 A;  5HS8 A;  4MHG A;  3OV8 A;  3JTG A;  2Y0M A;  1FLI A;  3RKW A;  3J80 K;  5HS9 A;  1HW5 A;  3KEQ A;  2CYY A;  3JAM Z;  2HYG D;  3R0A A;  2GXG A;  3L09 A;  1B59 A;  1YTY A;  1ZHF A;  2D1V A;  3M7G A;  3EYY A;  3H92 A;  1OYW A;  4KDP A;  2LF7 A;  1BI2 A;  2FMY A;  1W7P A;  3H3U A;  4XSX F;  2E7W A;  1CGP A;  1YFH A;  3Q9V A;  2VBY A;  3ULQ B;  3GFI A;  3C3W A;  4EJU A;  3REO A;  2G9W A;  5AIP A;  2RV8 A;  3S2W A;  2EV0 A;  4ZH4 F;  4DNC A;  2P7C B;  2IRF G;  1T38 A;  2JPB A;  1T0F A;  1I6X A;  1MD0 A;  1IXR C;  3HYI A;  3F23 A;  1F1Z A;  2FOK A;  2GQQ A;  2VXZ A;  3NRV A;  4HBL A;  4HLY A;  4A5N A;  2YR2 A;  1ONV A;  5DUK A;  2K4B A;  1O7L A;  3V8J A;  3G73 A;  2QBY A;  4HX4 A;  2FRH A;  4HV6 A;  1GVJ A;  4KIC A;  4HLX A;  3ZPL A;  4RB1 A;  3QP6 A;  5DUI A;  1TBX A;  1Z05 A;  4BHP A;  4ESF A;  1O3Q A;  4NB5 A;  2P5V A;  2NRA C;  1ZLJ A;  5JHU A;  1H9G A;  2UZK A;  3KZY A;  4OIQ F;  2IA1 A;  4N9I A;  2KKO A;  5DCM A;  3ISP A;  2EFQ A;  3J81 Z;  1C0W A;  5K5Q A;  1P4W A;  2D2W A;  1FT9 A;  2HZT A;  2O3F A;  2ZO4 A;  2P8T A;  1FP1 D;  3FXR A;  2UXX A;  2DW4 A;  3QPT A;  4B09 A;  1S7A A;  2ZXJ A;  3WG9 A;  5EEG A;  3TO6 A;  2HTJ A;  4NHJ A;  4Z2Y A;  1B1B A;  2H27 A;  4CIC A;  3KP2 A;  2L02 A;  2XHK A;  2BBY A;  4R8H A;  1SD5 A;  1EV7 A;  5FGM A;  1HSJ A;  1G3W A;  2P5L C;  2M5W A;  2OU2 A;  4CZZ A;  3IC7 A;  2A6E F;  3I71 A;  2E7X A;  3CUO A;  4UNO A;  3KP7 A;  4WXC A;  1G3S A;  1UB9 A;  2V1D A;  3TO9 A;  2OA4 A;  4M74 A;  1R58 A;  4IXA A;  4KFC A;  1S6L A;  2CG4 A;  1IN6 A;  1U2W A;  1T2K A;  4EGY A;  2P5K A;  4P5O A;  4IRH A;  1HST A;  2WC2 A;  3SHF A;  3WTW C;  3FMQ A;  5D5W B;  1J75 A;  2Q2E A;  1GHC A;  4BAY A;  2IPQ X;  4RB0 A;  1FZP B;  3GLX A;  1L0O C;  1Z1D A;  5HS7 A;  2JZY A;  4M72 A;  4N9H A;  3W6K B;  5K5O A;  1TQM A;  3T0Y A;  1ZN2 A;  1FYM A;  4M6X A;  5HOO A;  1TLH B;  1QBJ A;  4WK8 F;  1SD6 A;  3RKX A;  3V7S A;  3L9F A;  1KU7 A;  2HDC A;  5F64 A;  1O57 A;  5JR3 A;  3HRT A;  1R1T A;  3BPV A;  2HFH A;  5F1R A;  2FNP A;  3IKV A;  1XMK A;  3T8R A;  1R1V A;  4L9J A;  2ZME A;  3K9T A;  4HAM A;  5HLG A;  2FQ3 A;  1UST A;  2ESN A;  3KLN A;  5FLX Z;  1SFE A;  5BQT A;  5FFZ A;  1W5T A;  2IA2 A;  2RGV A;  4ZZD A;  2STT A;  3JTH A;  3KZZ A;  5ILV A;  3R61 A;  4KIG A;  1SFX A;  4L0Z B;  3ERE D;  1KA8 A;  1KQ0 A;  4G6Q A;  4EVI A;  2RC4 A;  2KIM A;  3E6B A;  1OYI A;  2A61 A;  5JFR A;  1G3Y A;  2EWN A;  1B9M A;  4ENJ A;  3LAJ A;  1H0M A;  1FX7 A;  2FML A;  5L3C A;  1DPU A;  3IKT A;  3CJN A;  2RVC A;  4P96 A;  4O6J A;  2IJL A;  2MLG A;  3M9A A;  3WTX C;  3FXU A;  2HOE A;  1FY7 A;  1ZRD A;  3R4K A;  1TW2 A;  4BNC A;  4EJV A;  2HKX A;  1O3S A;  4S04 A;  1FPQ A;  2VT2 A;  1XN7 A;  4PGG A;  3ZP5 A;  1IAW A;  2ACJ A;  1ZRF A;  3P9I A;  3COA C;  1BI1 A;  2FBK A;  3DPT A;  1LDK B;  5H6R A;  1IW7 F;  2CSO A;  4OIP F;  2E1C A;  4HF2 A;  2DK8 A;  4FHT A;  1K6O A;  1R1U A;  1W4M A;  3GO5 A;  3DFG A;  5K1Y A;  1U3E M;  3LFK A;  4GGG A;  3WTZ A;  5D8L B;  1YIO A;  2Z9O A;  3U9G A;  5LLQ A;  1LQ1 A;  4RB3 C;  2HKO A;  2ZNZ A;  4MGR A;  3FM5 A;  4HZF A;  4ESB A;  3E5X A;  1J59 A;  5DYM A;  4AWX B;  3DP7 A;  2Z5U A;  4G94 A;  3FF5 A;  4IF4 A;  5ICF A;  2W84 A;  3TO7 A;  1W7P D;  5K5R A;  3BP8 A;  1H9T A;  4WF2 A;  1Z6T A;  4ZZL A;  1S3J A;  2KIU A;  4AIK A;  2IT0 A;  3JW4 A;  3CLO A;  1ZLK A;  2H6C A;  2XAF A;  4XRF A;  3E6C C;  2IP2 A;  4L18 B;  3RKY A;  4R79 A;  5LEK A;  3O2P E;  4LJZ F;  1FSH A;  3K1P A;  3GYH X;  3R0J A;  1BOA A;  2A5Y B;  3WU0 A;  1YW8 A;  2NAZ A;  2NNY A;  1DP7 P;  4M6Y A;  4G6D A;  5E17 F;  5D5X B;  3PQJ A;  4WX9 A;  2OAZ A;  3JSO A;  2M30 A;  4HX7 A;  3ZQ7 A;  2ZKZ A;  3DEU A;  2LKP A;  3ELK A;  3P9K A;  2PQ8 A;  3K1N A;  2EFO A;  3ROU A;  1K79 A;  4H0E A;  3RTR A;  3LAP A;  4FT8 A;  4A0X A;  5BPD A;  2YPR A;  2JTV A;  5D4S A;  5CVJ A;  4LG0 B;  4P9F A;  3FHZ A;  1YW9 A;  1FBU A;  4LGW A;  4M73 A;  3BPX A;  1P4A A;  4Q48 A;  3N97 A;  2GWR A;  2VBZ A;  1F5T A;  4HQM A;  4YFX F;  2KJC A;  5CJ9 A;  2DLL A;  2M8E A;  2G7H A;  4RS8 A;  1MJA A;  4YFN F;  3T8T A;  2A6H F;  1R22 A;  4Q47 A;  5H20 A;  4PDK A;  1D8J A;  4ZYG A;  2OZ6 A;  3GVA A;  1TNS A;  5E1Z B;  3L2C A;  4XLN F;  2EFP A;  3SQN A;  3TOB A;  4ESJ A;  4YFK F;  2LF8 A;  5TJJ A;  3SXY A;  5D5U B;  1LJ9 A;  3WGG A;  2QM3 A;  3LA2 A;  5E20 A;  1R00 A;  1RI7 A;  4ENN A;  2JRT A;  3P9C A;  3FMR A;  1ZG1 A;  1RUO A;  1CF7 A;  3GFM A;  2UWM A;  2CFX A;  3T1B A;  2NNN A;  2PG4 A;  1XGN A;  1G3T A;  5L3E A;  1G6N A;  1DDN A;  1IN5 A;  2D1H A;  4LLL A;  2ELH A;  2J5O A;  4BHC A;  1FP2 A;  5D6E A;  4BHB A;  4UVA A;  4MQV A;  4IPA A;  4L9N A;  3MZY A;  2RKH A;  4KNY A;  1ON2 A;  1BM9 A;  1P6R A;  2BGC A;  4HX8 A;  2KRF A;  1LNW A;  3E5Q A;  2L4M A;  2L3D A;  3GUD A;  1QNT A;  2HR3 A;  2MBF A;  2UXN A;  2QBY B;  4QWQ A;  4N0B A;  3Q5F A;  2BV6 A;  1I27 A;  1FSE A;  1K7A A;  2VE8 A;  2W85 A;  2VC1 A;  3J80 Z;  4UVC A;  1JHH A;  3PQK A;  3HSR A;  4U0Y A;  4LK1 F;  5E8I A;  1IXC A;  2DK5 A;  2O61 A;  1Q1H A;  2PN6 A;  2KIF A;  2STW A;  1OMI A;  3P7N A;  4OIN F;  2XAJ A;  2V79 A;  4LB5 A;  3E5U A;  1BBY A;  2P6S A;  1Z9C A;  4I7H A;  2DQL A;  4A0Z A;  4I01 A;  1V3F A;  2ZBK A;  3HHG A;  3QAH A;  4WCG A;  3IHU A;  1MKM A;  2FU4 A;  4UXN A;  3I58 A;  2V6C A;  4BH9 A;  2QLZ A;  3QRF F;  2EB7 A;  1O7F A;  1TW3 A;  3M8F A;  1GXP A;  3WTV C;  3I64 A;  3TDU C;  3GX4 X;  2DPU A;  1SMT A;  2QEN A;  3K2Z A;  3BOQ A;  1L3L A;  5DV5 A;  3ZMU A;  2Q8K A;  1REP C;  2Q0O A;  2ZFW A;  2R3S A;  1YO5 C;  2L01 A;  4ASN A;  1FC3 A;  1U6G A;  2F2E A;  4HQE A;  3MQ0 A;  3ZMT A;  4RGR A;  2XAS A;  4IRG A;  3HOT A;  3BJO A;  4LLG F;  3BZ6 A;  1E2X A;  1SD7 A;  3M1E A;  1BN5 A;  5FB2 A;  1WRJ A;  3FX3 A;  4HF1 A;  2EK5 A;  3SFZ A;  3E3V A;  4R1H A;  2PLY A;  2PJP A;  1X3U A;  4Y15 A;  1T39 A;  2O8X A;  1JGS A;  3I4P A;  3KP6 A;  4D0P A;  1ZAO A;  1YS7 A;  4I09 A;  2EA2 A;  3GZ6 A;  1ZG3 A;  4I0B A;  4MQ9 F;  4A0Y A;  5IT9 Z;  4WWC A;  2FXA A;  3PFI A;  3BDD A;  3RJP A;  3HTU A;  3VB2 A;  1FYL A;  1MDM A;  3KP5 A;  2FBH A;  3W6J B;  4HW0 A;  5E8G A;  1W5S A;  2P6T A;  1R5H A;  4G7Z F;  5FD6 A;  4G7O F;  5JI6 A;  2YX7 A;  1QO0 D;  2MH2 A;  4IJA A;  2P4W A;  1XSD A;  3I5U A;  1FNN A;  1R23 A;  2QQB A;  3LST A;  2F5E A;  3V7R A;  3SZT A;  1J5Y A;  3BY6 A;  4EV0 A;  1IN4 A;  5ICC A;  4GYG A;  3K69 A;  3EQL F;  2BEO A;  3D0S A;  2J5P A;  3FXQ A;  2COM A;  1MZB A;  1BC7 C;  5F6F A;  3KLO A;  4Q5S F;  3GZ5 A;  3KP3 A;  3ZN0 A;  3WE2 A;  2EV6 A;  5CLS A;  1MJB A; 
#chains in the Genus database with same CATH topology
 2EFN A;  2LVS A;  1AWC A;  4KMF A;  2PMZ A;  3IWF A;  3QU6 A;  5DCF A;  2L7K A;  3ONQ A;  1KU2 A;  2MC3 A;  4XLH A;  2KIQ A;  4U88 A;  1XSV A;  4RDU A;  2MA3 A;  1VQP I;  4BEH A;  1WJC A;  3H1C A;  3HRU A;  5C4X J;  1FMW A;  1I1G A;  2W00 A;  2DA7 A;  3BG5 A;  3K6G A;  3ZMV A;  1JI8 A;  4RGU A;  2DOE A;  2ECB A;  3DXJ F;  3G3Z A;  1RKW A;  4ZYE A;  2DA1 A;  2HXO A;  1FBQ A;  2K9N A;  3HM5 A;  3HB9 A;  5EDN A;  4HA8 A;  4UUT A;  1P7J A;  3AG2 H;  1KYW A;  2KZV A;  4AVZ A;  3CCU I;  1VQL I;  1QVU A;  5D4R A;  2L4A A;  3L7W A;  2VPL A;  1IN8 A;  3VEP A;  4FX4 A;  3EYI A;  4AD9 A;  1MNM C;  4L5J A;  4OIO F;  1D0Y A;  2IGN A;  4G7H F;  1EH7 A;  1AKH B;  2ZB9 A;  5DDG A;  2W7N A;  2XV4 S;  2VE9 A;  3H0G J;  1S29 A;  4S05 A;  1R9T J;  5IP6 A;  1LB2 A;  1TQP A;  2VN2 A;  5B66 C;  4E7I A;  1XB4 A;  2DA2 A;  3C1D A;  2ZXW H;  4KN4 X;  2CV0 A;  1R71 A;  1KYZ A;  4ABZ A;  1KQ9 A;  3PUF A;  3GFL A;  5FD5 A;  2F4O B;  2QVO A;  1X58 A;  2HEO A;  1YLF A;  1JUP A;  2ZJP F;  4BQA A;  2F5D A;  3BTI A;  3S2H J;  3Q9S A;  2WB1 N;  2IS2 A;  3CTA A;  2CS3 A;  1ZRE A;  3F3X A;  2EIN H;  2WTE A;  2LDU A;  5CQE A;  5FKL A;  1WJD A;  1WSU A;  3MKL A;  4JBA A;  3FDY A;  5KK1 A;  1PDN C;  3BRO A;  2QSF X;  4HDV A;  1NHA A;  3IWZ A;  1FTT A;  2HTS A;  3L1P A;  3KIO A;  2IXS A;  4MEY F;  2R5Z A;  3GTQ J;  2X6Y A;  2HWV A;  3LA7 A;  2N8G A;  3HUG B;  1UCR A;  5LGU A;  1JKO C;  3A01 B;  3D1N I;  2NVT J;  2HQA A;  2ZJ2 A;  3F8M A;  2OF7 A;  2OCE A;  1MMG A;  3N05 A;  3PNT A;  4GXO A;  3H0D A;  4NQW A;  4GFB A;  2R7T A;  1ETQ A;  1PJR A;  3HTS B;  2HQR A;  3CUQ A;  1TP4 A;  3ZQG A;  3ABT A;  2XUB A;  5GPC A;  1LE8 A;  4V19 K;  1P92 A;  3AG1 H;  4HOB A;  3CJR B;  2Y2Z A;  2QF7 A;  3MKW B;  3CO6 C;  1LDD A;  2E2I J;  4BXF A;  1BR2 A;  2Q1Z B;  2EBI A;  2VLA A;  3F21 A;  4UHT A;  2GLO A;  3CP2 A;  2DBB A;  4XOT A;  3W3C A;  3MMY B;  5BPI A;  2IA0 A;  2ESH A;  1XCV A;  2VKH A;  2Z3Y A;  4A6D A;  4RB2 C;  4JX5 A;  2EIL H;  2NOG A;  4BQN A;  5F0H A;  1LDJ A;  2WV0 A;  2XPU A;  2D5V A;  4IHT A;  4EMS A;  2JRM A;  2K5C A;  2P0W A;  4JX4 A;  5ERI A;  1MSE C;  1RET A;  2C6Y A;  4EM2 A;  2NOJ B;  3S1R J;  2VOP A;  4RGX A;  1IRF A;  4HYE A;  2VON A;  4G12 A;  2NS7 A;  2V1U A;  1LKX A;  5LEJ A;  2KDO A;  4Y33 A;  2DYS H;  4F7Z A;  2DAO A;  1FOX A;  5LGN A;  4CCJ A;  2Y48 A;  3K70 D;  3CCM I;  5ILS A;  2CWE A;  2EZK A;  3KCC A;  4E7L A;  4OIR F;  2ZJQ F;  3B02 A;  2TDX A;  3R60 A;  3K7A J;  1V54 H;  3CJT B;  3MN2 A;  5TGT A;  3DKX A;  1W0U A;  3TOA A;  1E17 A;  1X4P A;  2JA5 J;  4JOM A;  3WOD F;  4BU2 A;  3BWG A;  1B72 B;  3IRQ A;  5F04 A;  1DU6 A;  1HKQ A;  3Q0W A;  1YQA A;  4HNU A;  1D5Y A;  4BQO A;  5FRO A;  1BJA A;  3MCZ A;  5FFX A;  1JE8 A;  2W24 A;  4IX7 A;  4WXD A;  2KLO A;  2JA7 J;  2HOT A;  1BC8 C;  4O5V A;  5LRS A;  1DGW Y;  1WI9 A;  1I1S A;  4YIF A;  3SJM A;  3CUQ C;  2LD5 A;  1SEU A;  3SZG A;  3HRM A;  2MFZ A;  1LVA A;  2Y9Y A;  4LK0 F;  3KE2 A;  1LFB A;  4D5C A;  5IT9 K;  1AOY A;  5EF6 A;  1LE8 B;  2L54 A;  3LFU A;  3C7J A;  3AFH A;  2GOM A;  3Q0U A;  2DN0 A;  1HDD C;  3HKZ N;  1ETW A;  5CQG A;  4JK1 X;  4CZC A;  4DZJ A;  2V1X A;  1YX3 A;  1QZZ A;  3AG4 H;  3WU1 B;  3F8C A;  4I0A A;  4RAF A;  3QQA A;  4S0H B;  4BYY A;  2V9V A;  2VC0 A;  2KL4 A;  1O3T A;  1R4M B;  2VKV A;  2ZXI A;  4RLQ A;  4L9T A;  2ISZ A;  1K78 B;  2EH3 A;  1AKH A;  2A3S A;  1F4K A;  2K86 A;  1Z67 A;  3QPL A;  5F0F A;  5DS9 A;  1AHD P;  2HGC A;  3OOU A;  5D8K B;  5ILU A;  1F9N A;  2K02 A;  3DQV C;  2XAH A;  3PL8 A;  4M9Z A;  4DYR A;  1LUJ B;  3V8L A;  1HKS A;  5H2F C;  1Z3X A;  1WWX A;  2XGX A;  4X6A J;  5J6X A;  5ICG A;  9ANT A;  5DD8 A;  1A5J A;  3S1Q J;  3MKY B;  3LSP A;  1JT0 A;  3BCA A;  2HXI A;  1MBJ A;  1YIJ I;  4HF0 A;  1V4R A;  1BIB A;  4RLF A;  1H88 C;  1TC3 C;  1OCP A;  1OCR H;  2NS0 A;  4LD5 A;  3LA3 A;  3M3Y J;  4RAY A;  3UNG C;  4UV8 A;  1KZH A;  4CH7 A;  2W57 A;  4HDU A;  2DTR A;  4AYB N;  3TQN A;  3BR1 A;  3P5J A;  2CUZ A;  1IXS B;  4YII A;  4XN0 A;  4ZYH A;  4PZJ A;  3RDI A;  1RNL A;  2GZW A;  1RUN A;  2R5Z B;  2XVC A;  4LLN A;  2O0Y A;  1DGR M;  1P2F A;  4BGD A;  1ZEL A;  3RIR A;  4IKF A;  3QOP A;  3Q3S A;  3HOS A;  2OD5 A;  2L7F P;  2NYX A;  1QQI A;  3OR1 C;  4PGH A;  5JVT A;  1U5T C;  3BTL A;  4NNJ A;  2OJE D;  1R5G A;  1X3W B;  2L7Z A;  2HYJ A;  3LOC A;  1E0E A;  4N4N B;  3MAJ A;  3SZP A;  1SAX A;  4NBQ A;  5HLI A;  1WPK A;  5BS6 A;  5LHG A;  1U5T B;  3F0C A;  3JSP A;  1ULY A;  4LG3 A;  2X4H A;  1J0R A;  4CCK A;  5JLX A;  2MLK A;  4YIR X;  1A36 A;  1TWC J;  2JPC A;  2ZC2 A;  3FXL A;  3U1D A;  4FIS A;  4U0V A;  4PK4 A;  2V1N A;  5GPA A;  5TIS C;  1YHQ I;  2WAF A;  4L0Y B;  5LBQ A;  2YU3 A;  2V4J C;  2Y75 A;  1J2X A;  3U2R A;  1A04 A;  1IN7 A;  3MFK A;  3JRI A;  5A2Q K;  1K4S A;  2A5W A;  2RNJ A;  5KVR A;  2YSR A;  5FRN A;  2LH9 A;  4GYI A;  3CF2 A;  4QPO A;  5DEQ A;  2QYO A;  1LFU P;  2DXI A;  2VT3 A;  1ZYR F;  1MBG A;  4L9V A;  3ECH A;  3IL2 A;  2CQK A;  3LQQ A;  3F6V A;  3CCE I;  2DDB A;  3RKQ A;  2JQ7 A;  4FTH A;  2FX0 A;  1GLN A;  3HKZ A;  5J47 A;  3O3K A;  3E6M A;  1HXD A;  4CGZ A;  1GVD A;  3AKZ A;  2GM4 A;  1LEB A;  1OKR A;  1XSX A;  3K1M A;  3F8B A;  4OMY A;  4I2O A;  4PCQ A;  4MTD A;  1QU3 A;  3OYF A;  2CGP A;  1YS6 A;  1SFU A;  2HYF A;  2DA3 A;  3GEZ A;  3TGN A;  4L5I A;  5EGO B;  1Z7U A;  1PP7 U;  2X9D A;  5L3D A;  4XSZ F;  4B47 A;  1BA5 A;  2AQE A;  1FMV A;  2X48 A;  3CLQ A;  1ETK A;  5HLH A;  4G9Y A;  3OYB A;  5EEH A;  2XAG A;  5HDG A;  4G6T B;  1OPC A;  3MKZ A;  4XLA A;  4KA4 A;  2WAD A;  1UHW A;  1W7P B;  1P4X A;  4KMU X;  1XMX A;  2OQR A;  3A02 A;  3WE3 A;  3KET A;  2CW8 A;  2K4J A;  4M3B A;  2VBX A;  2X1D A;  3HZJ A;  2GA1 A;  1HW2 A;  2W25 A;  1ETO A;  4F52 A;  4OOI A;  2X0L A;  4OAZ A;  4K2E A;  1MMN A;  2E1N A;  1XC5 A;  3LSK A;  3EUA A;  1RIO H;  2FEZ A;  1U0J A;  3HG9 A;  4F93 B;  6PAX A;  2IS1 A;  4LIT A;  2AQF A;  4B48 A;  5KCM A;  3R6S A;  4IQJ A;  2PMH A;  3QU3 A;  2JVH A;  4C2T A;  1PP8 F;  3J7A O;  2K9L A;  4IHS A;  5CVR A;  3GFJ A;  1BI3 A;  3NAR A;  3TP0 A;  1QVT A;  4XK4 A;  3EDP A;  1KGS A;  1XDS A;  2F48 A;  3HRS A;  4LG0 A;  1D5V A;  1IUY A;  1Y8R B;  5E18 F;  3WGH A;  2BY3 A;  4C9Y A;  2CFO A;  1YRN A;  3WTY C;  2DJI A;  2EA4 A;  3BG9 A;  3GF2 A;  2R7O A;  3RPU A;  1MJ9 A;  3PM1 A;  2XRL A;  5HLT A;  3QOE A;  1BI0 A;  1LVK A;  3BR5 A;  3CDL A;  3O6B B;  3RPU D;  3FZV A;  3RSN A;  3DCF A;  1ZK8 A;  3ASO H;  2DOD A;  2MW8 A;  1RZ4 A;  3ABL H;  1R36 A;  3OSF A;  1A6Q A;  3HGY A;  3LSI A;  5J4V A;  3J81 K;  1XMA A;  4KN7 X;  1WZ2 A;  4CO8 A;  1APL C;  3ZMD A;  4EM0 B;  4CYD A;  4G8X A;  2CV2 A;  2VOD A;  3KZI C;  3CUQ B;  4UV9 A;  5D6F A;  2M45 A;  4B1R A;  5CVU A;  1IGN A;  3HPH A;  3I59 A;  4XRS A;  2DA5 A;  1STZ A;  3DTE A;  2HOS A;  3A0B C;  3S2D J;  3DKW A;  2CQQ A;  2HPI A;  1RRJ A;  2E35 A;  2PFB A;  1GV5 A;  2FE3 A;  3QPH A;  5HNF A;  1Y39 A;  1ETX A;  3T5X A;  3VDX A;  5HDN A;  2IS4 A;  2K27 A;  1KU9 A;  2MH9 A;  1BW6 A;  4B8X A;  1TT5 B;  3ECO A;  3GBG A;  3FHN A;  3FXO A;  3GZN B;  3OOP A;  4XID A;  4A69 C;  2AHQ A;  4EJT A;  1JXS A;  5LHI A;  3MWM A;  1I3Q J;  5AON A;  3S3M A;  4I02 A;  4U7D A;  3RYR A;  3OS1 A;  1VQK I;  4XKB A;  3EET A;  2AXT C;  3JAM K;  3HUG A;  3L2R A;  2R0Q C;  1K6Y A;  2R7Z J;  2ISY A;  3B73 A;  2A68 F;  3OWT A;  2LY9 A;  4B44 A;  3CCR I;  3RYP A;  3KPH A;  3CCQ I;  1DUX C;  1DQU A;  4MEX F;  2LKS A;  5E1X A;  3PUB A;  1RR8 C;  1R7J A;  1HC8 A;  4IL6 C;  2LSO A;  1IC8 A;  3Q0V A;  1TT0 A;  1OR7 A;  3ERM A;  3H9J A;  3S3O A;  4UUV A;  1TNT A;  1XS9 A;  4MTE A;  4KJZ A;  2QGU A;  2VJ5 A;  1PUE E;  1BIA A;  3ZQH A;  5F27 A;  5J8C A;  3VYR B;  3LNQ A;  3V8K A;  5IOY A;  4D1Q A;  4XRS G;  5E3N A;  3MEX A;  5K7Z A;  3WGI A;  3BR2 A;  2V9K A;  3IH4 A;  5LRR A;  2QWW A;  2XGE A;  3ABU A;  4KYW A;  5DCM B;  4AIJ A;  3CJQ B;  2EJR A;  1D1C A;  3OYA A;  4KIB A;  1XCB A;  1ODD A;  2R7F A;  3I53 A;  4JQF A;  4O3M A;  4UVB A;  4A3I J;  3L2W A;  3I0T A;  4A6E A;  2Z99 A;  1ZGJ A;  2AXL A;  1B8I A;  1ENH A;  1YJ9 I;  2XIG A;  2H94 A;  2VI6 A;  1WQ2 A;  1T56 A;  2QCO A;  3FM3 A;  2ZFU A;  1HBX G;  1OCT C;  3V7C A;  3F8N A;  3E6D A;  4DQ2 A;  5L3G A;  1XDU A;  5GAE J;  2L9S A;  3CMA I;  1TWH J;  1R5I D;  3C2G A;  1ZG5 A;  1SD4 A;  4Y17 A;  2JT1 A;  5EEA A;  3NAU A;  4GRI A;  1J9I A;  2NS8 A;  3E7L A;  4W1U A;  3UKG A;  4GCV A;  1FOK A;  4P9U A;  2EFW A;  3M8J A;  2FF4 A;  2CQX A;  1QRY A;  1OR7 C;  2OBP A;  3VFZ A;  2GIZ A;  4BXX J;  5B1A H;  3M8E A;  1R6R A;  2NVY J;  3S3N A;  4BDY A;  3FWE A;  2R7D A;  5C4J J;  1IDY A;  2MD5 A;  5J4Y A;  2HU9 A;  1OYY A;  1B6A A;  3O8G A;  2GXA A;  2X1C A;  1FWZ A;  2XSJ C;  1W1W E;  2G7U A;  3TBI A;  4BE2 A;  4XLF A;  5DD4 A;  3DWL E;  1ETY A;  1QPM A;  1B9N A;  2VJ4 A;  3F8F A;  2QQA A;  3HSF A;  2M4K A;  1T0F C;  3HGG A;  2LLK A;  3HEF A;  4M3F A;  5LGT A;  4M9X A;  1YW7 A;  2CO5 A;  1YE9 A;  2XRO A;  2W1O A;  4RAZ A;  1DP3 A;  2VIX A;  3C18 A;  4ZDP A;  4ENK A;  2CW0 F;  3L00 A;  1VQM I;  3HL2 A;  2DT7 B;  1RPW A;  3RQI A;  1USS A;  1EF4 A;  4BEH B;  4MNU A;  2DFH A;  3LWF A;  1SVO A;  4QLC U;  1UFM A;  4ON0 A;  2E1M C;  3H36 A;  2DT5 A;  2BE5 F;  1VND A;  1X1C A;  5HVQ C;  1B8I B;  4A12 A;  3TED A;  3K0L A;  3HHH A;  1J7K A;  3K4M A;  1IG7 A;  2DMT A;  4U7B A;  3DTK A;  5GAD J;  1ON1 A;  2KPM A;  1O3R A;  1JKR C;  2LNB A;  4MFD A;  4XNF A;  2L5Q A;  2K9M A;  3DPL C;  5JVG F;  2H09 A;  2AS5 F;  1Z91 A;  4KUM A;  3BZK A;  2BHZ A;  4AVP A;  1GXQ A;  4FCY A;  2M7B A;  5J8F A;  3JRF A;  4BY1 J;  3ZQI A;  4TV7 A;  2XRN A;  2KRC A;  1N25 A;  1XG1 A;  2FSW A;  2M87 A;  3K4K A;  4I76 A;  3V42 A;  4D7N A;  5LHH A;  3RPQ A;  1XGS A;  5IT3 A;  5FKK A;  5GP9 A;  2P7V B;  2RRE A;  1F43 A;  3FXJ A;  1U8R A;  4M9S A;  3OS2 A;  4C3J J;  2OTJ I;  3I4N J;  1FBS A;  2R5Y A;  1XGO A;  2IGO A;  2V6E A;  3I4M J;  2DQR A;  4B4C A;  4EQQ A;  3LMM A;  2ZME B;  4E70 A;  4BJT A;  1S7O A;  2OZU A;  4BXU A;  4IOA F;  1UHM A;  2MSY A;  3ESW B;  3OIQ A;  4CDG A;  1SAU A;  1UEL B;  3KYL A;  4FE4 A;  1T98 A;  2BY0 A;  1ZGA A;  4LMY A;  5IPA A;  3BT9 A;  3I59 B;  4MO7 A;  3WHC A;  1B4A A;  4OU0 A;  3CC4 I;  4AIH A;  3IAM 2;  1JKP C;  4BBS J;  1OCZ H;  2GAU A;  2W4S A;  4NUB A;  2O6G E;  2RQP A;  3OYL A;  2KRH A;  2V9P A;  3OL4 A;  4XKC A;  5HOD A;  2PI0 A;  2GXB A;  2E71 A;  3VWB A;  4XLC A;  1KQ8 A;  1XD7 A;  2COB A;  1AA7 A;  2LKX A;  2R7S A;  4XMY A;  3EUH A;  2R7Q A;  3E97 A;  4QSH A;  2ETH A;  5CVV A;  3JCU C;  4A93 J;  2PBI A;  2D45 A;  4Q4Z F;  4FQG A;  3NEU A;  1MDM B;  2JMW A;  2MYS A;  3WTT C;  2Z33 A;  2HNH A;  3ABM H;  5ED4 A;  2XF5 A;  3KX2 A;  4XIC A;  3BR3 A;  4YG2 F;  5E1W A;  3FMS A;  4XOP A;  3V4G A;  3GXO A;  5L3B A;  4OWR B;  2DI3 A;  4IRI A;  1I3A A;  2EQR A;  2VB6 A;  3HIF A;  1WI3 A;  5FLM J;  2O03 A;  3D5L A;  5LFA A;  5TRD A;  2DPD A;  2ZNY A;  4IEJ A;  3RI4 A;  1VQ5 I;  4A3B J;  4CXF A;  3S1N J;  3CDH A;  4JX6 A;  4EM1 A;  1M1E B;  2O7O A;  2QUF A;  3K4L A;  2BVL A;  3WTU C;  2EV5 A;  3BJ6 A;  5K7H A;  3TKY A;  2JUG A;  2GA2 A;  5HNH A;  1QGP A;  4XLP F;  3MZH A;  4RA2 A;  4ZYD A;  3OYI A;  3KP4 A;  4KIF A;  4WXH A;  1IZ1 A;  4A2U A;  3UR3 C;  1KU3 A;  2GIV A;  3ZMS A;  1ERD A;  1CF7 B;  2F5C A;  1I39 A;  3S15 J;  1HLV A;  2IBD A;  3ZQQ A;  2TCT A;  3HOY J;  2HDW A;  4BL0 B;  5D5V B;  1JHF A;  2K40 A;  4BE1 A;  1DPR A;  3G2B A;  2VJI A;  4PJM A;  1K78 A;  4KIS A;  2DFI A;  2R7U A;  3SFI A;  2CUJ A;  5A2Q Z;  2DA6 A;  2RN7 A;  4RBO A;  2LBF A;  1IV8 A;  1ZAR A;  2CRG A;  4XBF A;  5L3F A;  3D5R C;  1ZRC A;  1YG2 A;  1X2M A;  4KT5 C;  3WTS C;  3GWZ A;  3QOD A;  4H4K C;  2YX4 A;  3OYH A;  4JP0 A;  2IVM A;  2XAQ A;  3L2U A;  5F08 A;  2FBI A;  1ZH5 A;  4YEL A;  2H6B A;  4P55 A;  4UB6 C;  3PJR A;  3DLA A;  3ML6 A;  1HW1 A;  1N75 A;  2WBM A;  2JA8 J;  3GW2 A;  1XGM A;  4LOC A;  2QQ9 A;  4LFU A;  1IF1 A;  3FBI B;  2HVR A;  3PO2 J;  4EGZ A;  1Y6I A;  1TTY A;  5KAI C;  2M3A A;  3A03 A;  4U0W A;  3BTC A;  1LEA A;  3IV5 A;  4ETS A;  5BOX A;  1Y0U A;  3GTP J;  3ABK H;  3CC7 I;  4PJ0 C;  2PEX A;  2HQN A;  2A07 F;  4Y13 A;  4XN3 A;  3I9V 2;  5FLX K;  2BYV E;  3BG3 A;  3W6V A;  4FX0 A;  2DTZ A;  3HSE A;  4DJA A;  2L9R A;  2FNA A;  3TDZ C;  4DGW B;  2KJB A;  2ADU A;  4J00 A;  5H6Q A;  1FYK A;  2F5F A;  4J19 A;  4A5M A;  2HS5 A;  5IYD J;  1I5Z A;  2XKO A;  3I54 A;  4OMZ A;  1D3Y A;  1QZY A;  1MMA A;  1YYV A;  2QZ8 A;  3HXL A;  4DW6 A;  1BOB A;  2KHM A;  2R93 J;  3LSG A;  5E79 C;  1EH8 A;  4J01 A;  4XOR A;  2OQG A;  3CO7 C;  2Y9Z A;  5HDK A;  4IVN A;  2DMU A;  1IRG A;  4A3J J;  2B0L A;  3ZMZ A;  1SFO J;  3AAF A;  4HPQ A;  5CVI A;  4LB6 B;  1U78 A;  3IRR A;  1G4D A;  4A3M J;  4A3E J;  5FO5 A;  1MGT A;  3ZN1 A;  4GDF A;  3N4M A;  4RGS A;  3CME I;  2VJJ A;  3GME A;  2DU9 A;  1OLT A;  2XKP A;  3PSI A;  4RM2 A;  2R5Y B;  3F72 A;  3VOD A;  2E36 A;  2ELK A;  5CYV A;  1UG0 A;  2A69 F;  1QHG A;  2E1O A;  3JRH A;  3S8P A;  3NQO A;  2WAE A;  2K7L A;  1D8K A;  2RDP A;  3H3Z A;  2FA5 A;  1JKQ C;  5J1R A;  3RCO A;  2WWY A;  4XL9 A;  2F4I A;  1FJL A;  1WKM A;  4I6Z A;  1OCC H;  4HV5 A;  1JGG A;  1Z3Y A;  1NG7 A;  3DF8 A;  3VOE A;  3KEO A;  4ENM A;  2M1B A;  3QP5 A;  2VOO A;  2DDA A;  1G59 A;  2MGQ A;  2VBW A;  3S32 A;  4EJO A;  3OYE A;  3JRB A;  2JSC A;  2KQR A;  3LQR A;  3DV8 A;  1NK3 P;  1HKT A;  1YJN I;  3K4N A;  4M71 A;  2IW5 A;  4ANJ A;  2V26 A;  1SMY F;  4C30 A;  3OSG A;  3F6O A;  1Z6R A;  2ZCW A;  2F4M B;  1PUF A;  1S8N A;  1T6S A;  5EJC A;  1X19 A;  1ZTR A;  1VTN C;  4EJW A;  1EH6 A;  4GO1 A;  4I98 B;  3KFW X;  1HQC A;  3BJA A;  2W82 A;  2PMU A;  5GTI C;  3F22 A;  5BMZ A;  4ZYA A;  2PX9 A;  1U5T A;  2YS9 A;  1TQI A;  2QEX I;  4XON A;  5AIQ A;  2MAB A;  2PJR A;  5ICE A;  2DO7 A;  5HS8 A;  4MHG A;  3SEZ A;  2M9H A;  3OV8 A;  4NC8 A;  2Y0M A;  3JTG A;  3BQY A;  1FLI A;  1JUS A;  5HS9 A;  1HW5 A;  3RKW A;  3J80 K;  2ID6 A;  2I10 A;  3KEQ A;  3HOW J;  1XTA A;  2CYY A;  2XAU A;  3JAM Z;  2HYG D;  4DBR A;  2H8W A;  2EPF A;  2JA2 A;  3R0A A;  2GXG A;  1HA8 A;  3L09 A;  1YIT I;  1W5C C;  4E7Z A;  2ME0 A;  1JJ6 C;  5EYR A;  1B59 A;  3H5A A;  3J7Z I;  2ICW G;  2XF7 A;  3CCS I;  1YTY A;  1ZHF A;  2D1V A;  3M7G A;  3ZRG A;  3EYY A;  1SVM A;  3H92 A;  1OYW A;  4KDP A;  2LF7 A;  1S5L C;  1BI2 A;  2KZG A;  2XB0 X;  1Q1V A;  3U21 A;  2DJN A;  2FMY A;  1W7P A;  2DOA A;  3H3U A;  3IH2 A;  3NWS A;  4D5F A;  2IGM A;  1MBE A;  4XSX F;  2E7W A;  4CUG A;  3JR9 A;  2MC4 A;  1CGP A;  1YFH A;  3OR2 C;  3Q9V A;  2VBY A;  1JTY A;  3ULQ B;  3GFI A;  3C3W A;  4EJU A;  3HOZ J;  3W2W A;  2M7A A;  3CCJ I;  3REO A;  2G9W A;  5AIP A;  2RV8 A;  3S2W A;  4NDL A;  2EV0 A;  3FKJ A;  2B7E A;  2Z2S B;  4ZH4 F;  1V5E A;  4DNC A;  2P7C B;  2BY1 A;  4L5E A;  2IRF G;  1T38 A;  2KP6 A;  1D1B A;  3LSR A;  2JPB A;  1T0F A;  1I6X A;  1MD0 A;  1IXR C;  3HYI A;  2VAS A;  4Z6Y A;  3F23 A;  1F1Z A;  2Z1D A;  2FOK A;  2GQQ A;  4KIT B;  4CCN A;  2DYR H;  1WCM J;  4FAS D;  2VXZ A;  1WVR A;  2R4G A;  3NRV A;  4HBL A;  4HLY A;  4A5N A;  2YR2 A;  4UY8 I;  1ONV A;  2E19 A;  4BUP A;  1D1A A;  5DUK A;  2E60 A;  2K4B A;  1FOY A;  1O7L A;  3V8J A;  1MH3 A;  3G73 A;  4X1E A;  5FJ8 J;  2K9Q A;  2QBY A;  5IYB J;  4IHV A;  3MVP A;  3ZQC A;  2RNG A;  4HX4 A;  2XSD C;  1Z21 A;  1WJE A;  2FRH A;  3EUH C;  4HV6 A;  4XQF A;  1GVJ A;  4KIC A;  2WV1 A;  4HLX A;  2PMZ N;  1OCO H;  1T08 B;  2I8D A;  2NVU B;  4W97 A;  2VQH A;  5KAF C;  2QA4 I;  2VL8 A;  3ZPL A;  4RB1 A;  3QP6 A;  5DUI A;  1TBX A;  1Z05 A;  2WA0 A;  4BHP A;  4UUS B;  4MFE A;  4ESF A;  3H5R A;  3WG7 H;  1O3Q A;  4ZDO A;  4EEF G;  3CF5 F;  3RZO J;  4NB5 A;  2P5V A;  2NRA C;  3BQZ A;  4CCL A;  2DOF A;  1ZLJ A;  3OMY A;  1UMQ A;  4PJN A;  5JHU A;  1H9G A;  2UZK A;  3KZY A;  4ZTJ A;  3PNY A;  4DIQ A;  2IA1 A;  4N9I A;  4OIQ F;  4IOC F;  2KKO A;  5DCM A;  5DM7 F;  2BY2 A;  2EFQ A;  3ISP A;  3LSJ A;  3TL4 X;  3J81 Z;  1C0W A;  1VQ9 I;  5K5Q A;  1ZR2 A;  5EZG A;  1P4W A;  1X1B A;  3OYJ A;  2D2W A;  1FT9 A;  3ZR8 X;  2HZT A;  3FXM A;  4U87 A;  4XKW A;  2WY7 Q;  2BZT A;  2O3F A;  2B9S A;  2X51 A;  2CQN A;  1GUU A;  2ZO4 A;  2P8T A;  5M5W J;  3VSK A;  2DMN A;  1FP1 D;  3FXR A;  5LD2 C;  3KEY A;  2UXX A;  3OY9 A;  3LSM A;  3VYS B;  4DYQ A;  2DW4 A;  3QPT A;  4B09 A;  1S7A A;  2ZXJ A;  3WG9 A;  5EEG A;  3K70 C;  3TO6 A;  2HTJ A;  3PNV A;  1BL0 A;  2VQC A;  1S9H A;  1ORK A;  2CUE A;  4BAC A;  4NHJ A;  2JA6 J;  4Z2Y A;  1B1B A;  1WJ5 A;  1A31 A;  2LC2 A;  1JJ8 C;  2VQL A;  1E3H A;  3D5S C;  4IQ4 A;  2H27 A;  2LG4 A;  4CIC A;  3KP2 A;  4CYC B;  2L02 A;  4II3 A;  4HG2 A;  2XHK A;  4E6K G;  2BBY A;  1SAN A;  4Y4R A;  2EIJ H;  4R8H A;  3DLL F;  1SD5 A;  1EV7 A;  3DBL B;  5FGM A;  1HSJ A;  4BJ6 C;  3RZD J;  1G3W A;  2P5L C;  4A3K J;  2IS6 A;  2M5W A;  3ZQL A;  2OU2 A;  4CZZ A;  3IC7 A;  2A6E F;  4EAT A;  3H5N A;  3I71 A;  3M1C A;  1TWA J;  2E7X A;  3CUO A;  4UNO A;  2OPT A;  3KP7 A;  1UJ8 A;  1NG6 A;  1VQ6 I;  4WXC A;  3PO3 J;  4QTR A;  1G3S A;  1UB9 A;  2V1D A;  3MZ8 A;  3TO9 A;  2LRD A;  2OA4 A;  3BTJ A;  4M74 A;  1R58 A;  4IXA A;  4MIM A;  4KFC A;  1S6L A;  2CG4 A;  3GCM A;  1IN6 A;  1U2W A;  3TW6 A;  4IHX A;  1T2K A;  3FIW A;  4UB8 C;  4EGY A;  1MIJ A;  1MND A;  2P5K A;  1OQY A;  2M4G A;  4IRH A;  4P5O A;  1HST A;  2WC2 A;  3JRD A;  1UZC A;  3QYB A;  2LY1 A;  3SHF A;  3WTW C;  3FMQ A;  5CKT A;  1E3O C;  3HBL A;  5D5W B;  1W36 C;  1J75 A;  1O4X A;  1N77 A;  2Q2E A;  2XPW A;  3F9K A;  4BAY A;  1GHC A;  2IPQ X;  4RB0 A;  1I50 J;  1FZP B;  3GLX A;  1L0O C;  1WH5 A;  1TZL A;  1Z1D A;  4RMN A;  3M07 A;  2H1K A;  3SEQ A;  3CQZ J;  5HS7 A;  3ZOB A;  3K10 A;  1A35 A;  4F92 B;  2JZY A;  4M72 A;  4N9H A;  3W6K B;  5K5O A;  1TQM A;  3T0Y A;  3A01 A;  1ZN2 A;  1FYM A;  1MNE A;  2M34 A;  3DBR B;  2R7W A;  4M6X A;  2BXY A;  1XPX A;  5HOO A;  1TLH B;  1QBJ A;  1X4O A;  4WK8 F;  3U1K A;  1SD6 A;  3RKX A;  3V7S A;  3L9F A;  2KDZ A;  3BZC A;  2KFD A;  1KU7 A;  2HDC A;  5F64 A;  4M3G A;  1V5F A;  3HOX J;  1O57 A;  4A3G J;  2VKD A;  4IO9 F;  5JR3 A;  3HRT A;  3E0J B;  2NVX J;  1R1T A;  3BPV A;  3GLL A;  1JT6 A;  2HFH A;  2YU9 J;  5F1R A;  1GT0 C;  2FNP A;  3OYK A;  3HPG A;  1RES A;  2H1L A;  3IKV A;  1XMK A;  2FD5 A;  3JRC A;  3T8R A;  2HQ5 A;  1X1A A;  3FBN B;  1R1V A;  2ZXH A;  4L9J A;  2ZME A;  3OYM A;  3K9T A;  3BG6 A;  1WJA A;  2JVG A;  4HAM A;  3GTJ J;  2HPM A;  5HLG A;  2FQ3 A;  2AO9 A;  2CQ7 A;  1UST A;  2ESN A;  3KLN A;  2YUS A;  3G1O A;  1SFE A;  2DFF A;  5FLX Z;  1ETV A;  4M3E A;  5BQT A;  5FFZ A;  2M2E A;  2E5N A;  3CCV I;  1W5T A;  1MMD A;  2IA2 A;  2RGV A;  4ZZD A;  2STT A;  3JTH A;  4BBR J;  3KZZ A;  2DT6 A;  2M8G X;  5ILV A;  1ACI A;  2NXN B;  1Y8Q B;  1HOM A;  3R61 A;  2M0M A;  4KIG A;  2WB1 A;  4HSR A;  1SFX A;  4L0Z B;  3ERE D;  1KA8 A;  2BW3 A;  2O5R A;  1KQ0 A;  4PFP A;  4BDZ A;  4G6Q A;  4EVI A;  2VUM J;  1K61 A;  1LFP A;  2RC4 A;  2WAQ N;  2KIM A;  3E6B A;  1OYI A;  2A61 A;  5JFR A;  1I6H J;  2LFB A;  1G3Y A;  2EWN A;  5E3O A;  1JUM A;  1B9M A;  4F3Q A;  4ENJ A;  3LAJ A;  1H0M A;  1FX7 A;  2FML A;  5J3L A;  5K7F A;  5L3C A;  1UHS A;  1DPU A;  3PFY A;  2QQ8 A;  3CMM A;  4V2G A;  3IKT A;  3SYT A;  3OIO A;  1RC9 A;  2DA4 A;  3CJN A;  1ZGW A;  3H9G A;  2RVC A;  4DOZ A;  3FK7 A;  3G1L A;  5EG0 A;  4P96 A;  4QIW N;  2F5V A;  3I3L A;  4NC7 A;  1IO2 A;  3EUK L;  3A2K A;  4O6J A;  1SVL A;  2ZJR F;  2IJL A;  5IP7 J;  1IJW C;  1T95 A;  2FOW A;  2MLG A;  3M9A A;  5BNG A;  2BOL A;  3FXU A;  3WTX C;  2Y69 H;  3JRE A;  2K3P A;  2HOE A;  1FY7 A;  2LP0 A;  1ZRD A;  3AL0 B;  5J1U A;  2BHY A;  3R4K A;  4FET A;  1D0X A;  5B5E C;  3I56 I;  1MW7 A;  1TW2 A;  4EJV A;  4C3I J;  4BNC A;  1ITY A;  2HKX A;  1O3S A;  4S04 A;  1FPQ A;  2VT2 A;  2EIK H;  2IGK A;  1XN7 A;  2X6X A;  3W2A A;  1Y56 A;  4PGG A;  3ZP5 A;  1IAW A;  2ACJ A;  1ZRF A;  3GTG J;  3FIS A;  3SDG A;  3P9I A;  3COA C;  1BI1 A;  2NVQ J;  2FBK A;  3DPT A;  2H8R A;  2Z16 A;  1LDK B;  1AU7 A;  2QSG X;  5H6R A;  1IRZ A;  1SFK A;  4A3F J;  4IHY A;  1IW7 F;  1MH4 A;  1YI2 I;  2CSO A;  3LL7 A;  3DBH B;  4N4O B;  2A6T A;  1VQ7 I;  4OIP F;  2E1C A;  4HF2 A;  2DK8 A;  4FHT A;  3ASN H;  1K6O A;  4CA0 A;  1R1U A;  1W4M A;  2EZL A;  3GO5 A;  1VF9 A;  3WU2 C;  3DFG A;  5K1Y A;  2LY2 A;  1EKE A;  1U3E M;  2IAI A;  1QA6 A;  3LFK A;  4GGG A;  4XM3 A;  3WTZ A;  2UUZ A;  1VQ8 I;  2HDD A;  2K3F A;  5D8L B;  2M0C A;  4ZC3 A;  2JN6 A;  5GTH C;  1YIO A;  4AYB A;  1PYV A;  2Z9O A;  3CP8 A;  3U9G A;  2E5Z A;  5LLQ A;  1LQ1 A;  4PSW A;  4RB3 C;  5FLV A;  2HKO A;  2ZNZ A;  4MGR A;  2VKE A;  2HI3 A;  3FM5 A;  4HZF A;  1TWF J;  4ESB A;  2R7X A;  1W0T A;  1Z77 A;  5B1B H;  3E5X A;  4HRI A;  1J59 A;  5DYM A;  1VQO I;  4AWX B;  3DP7 A;  3C2B A;  2Z5U A;  3MD2 A;  3FF5 A;  4G94 A;  4IF4 A;  5ICF A;  2W84 A;  3TO7 A;  1POG A;  4MLO A;  1W7P D;  5DM6 F;  1B72 A;  4B3A A;  5K5R A;  1YOV B;  3BP8 A;  3FK6 A;  1H9T A;  1XX5 A;  4WF2 A;  1Z6T A;  4ZZL A;  4BJ5 C;  1S3J A;  2CW7 A;  2KIU A;  3HOU J;  3H35 A;  4AIK A;  2G0E A;  2IT0 A;  3JW4 A;  3HC7 A;  3CLO A;  2K85 A;  5KNL A;  2JJ7 A;  1ZLK A;  1Z7L A;  3DEE A;  2H6C A;  2XAF A;  4XRF A;  2DMQ A;  1QPI A;  3E6C C;  4A3L J;  2IP2 A;  4CYC A;  4L18 B;  2HOA A;  3RKY A;  3W2V A;  4R79 A;  5LEK A;  3S16 J;  3O2P E;  3CD6 I;  4C2M J;  4LJZ F;  2EZI A;  1FSH A;  3K1P A;  3GYH X;  1MBH A;  3R0J A;  1BOA A;  2A5Y B;  3WU0 A;  1YW8 A;  5M5X J;  2NAZ A;  2NNY A;  1DP7 P;  1P9Q C;  2LOO A;  1U8B A;  4M6Y A;  4HEA 2;  4QPQ A;  2QKL B;  2E1M B;  1R4N B;  4G6D A;  4B3X A;  4UUS A;  5E17 F;  4BQQ A;  5D5X B;  3PQJ A;  4WX9 A;  2ZSH B;  2OAZ A;  3JSO A;  1YJW I;  2OV7 A;  2Y0S N;  2M30 A;  4HX7 A;  3ZQ7 A;  3AL0 C;  2ZKZ A;  3DEU A;  2R7R A;  2LKP A;  3ELK A;  3P9K A;  2PQ8 A;  2LMD A;  5F1J A;  2LRE A;  1EJ9 A;  1WJF A;  4E4H A;  3IP4 B;  3K1N A;  2EFO A;  3ROU A;  1K79 A;  1ZKG A;  4H0E A;  2OUM A;  1N78 A;  2FJ1 A;  2OCC H;  4XKV A;  3RTR A;  3LAP A;  1VQN I;  4FT8 A;  5E3M A;  4A0X A;  5BPD A;  2YPR A;  4X0G A;  2JTV A;  1G2H A;  5D4S A;  2JSP A;  1Y1W J;  5CVJ A;  2UV1 A;  4LG0 B;  4P9F A;  2QSH X;  3FHZ A;  1R49 A;  1YW9 A;  1MBK A;  1FBU A;  1U9O A;  4LGW A;  4M73 A;  3J7Y J;  2R92 J;  1OJL A;  2Q2E B;  3BPX A;  1P4A A;  3H3V K;  3O8H A;  5GAG J;  4Q48 A;  2E2J J;  2CU7 A;  3N97 A;  3B6C A;  1FIA A;  3CCL I;  2GWR A;  2VBZ A;  3M4O J;  1UAA A;  2ZME C;  3KYD B;  1V55 H;  4HQM A;  4YFX F;  1F5T A;  2KJC A;  5IOZ A;  5CJ9 A;  2DLL A;  3EPZ A;  2ME6 A;  2M8E A;  2G7H A;  1W36 D;  4F91 B;  4RS8 A;  1MJA A;  5E3L A;  1QHH D;  4YFN F;  4HNV A;  3T8T A;  2A6H F;  3CZ6 A;  1NK2 P;  4PJL A;  4A3D J;  1R22 A;  3K2A A;  4Q47 A;  2JWT A;  5H20 A;  1YX5 A;  4PDK A;  5C3E J;  4CCM A;  4M3D A;  1D8J A;  1FEX A;  3VYT B;  2CUF A;  5FKO A;  4ZYG A;  2OZ6 A;  2OC6 A;  3GVA A;  1S7E A;  3ZQF A;  1TNS A;  3JRG A;  4BS9 A;  2E2H J;  5E1Z B;  3L2C A;  1KON A;  3QWL A;  2L0K A;  4XLN F;  2EFP A;  3SQN A;  5IYC J;  1WGX A;  3TOB A;  4ESJ A;  2E34 A;  5DTD A;  3BR0 A;  2W48 A;  4YFK F;  1HDP A;  2VPR A;  2LF8 A;  5TJJ A;  3BR6 A;  1PUF B;  5EZH A;  3SXY A;  5D5U B;  1LJ9 A;  3WGG A;  1G8X A;  2QM3 A;  3LA2 A;  2FQ4 A;  5E20 A;  1NH3 A;  1R00 A;  1RI7 A;  4PUS A;  2JRT A;  4ENN A;  5FKM A;  3P9C A;  3FMR A;  3IUO A;  3DU6 A;  2LYC A;  2L7M P;  1ZG1 A;  5M5Y J;  1RUO A;  1CF7 A;  3GFM A;  2UWM A;  2CFX A;  1QZE A;  1U9N A;  3T1B A;  2NNN A;  2PG4 A;  1XGN A;  1G3T A;  5L3E A;  2DFE A;  3DU5 A;  1G6N A;  3S93 A;  1EA3 A;  1DDN A;  1TWG J;  1X3Z B;  1DU0 A;  3LSH A;  4AUX A;  3KYC B;  4JYK A;  4ZDL A;  1IN5 A;  2D1H A;  2LBF B;  4LLL A;  2ELH A;  2J5O A;  4E7K A;  4BHC A;  1FP2 A;  5D6E A;  4BHB A;  4UVA A;  4MQV A;  2JUC A;  5KHD A;  4IPA A;  1ZQ3 P;  3QYF A;  4L9N A;  2BXZ A;  3MZY A;  5CPR B;  2RKH A;  5IP9 J;  4KNY A;  3GTO J;  3HOV J;  2RAE A;  1ON2 A;  3PIP F;  4F55 A;  3OYG A;  1BM9 A;  2HVQ A;  1A6I A;  2XGC A;  3BLY A;  1X2N A;  5EGO A;  4D9J A;  2O9L A;  1P6R A;  2BGC A;  4HX8 A;  3BCB A;  3TP3 A;  2KRF A;  1LNW A;  3G6E I;  2XB5 A;  3S14 J;  1GV2 A;  2KIS A;  3E5Q A;  2L4M A;  2L3D A;  1WHU A;  3GUD A;  1QNT A;  2HR3 A;  2MBF A;  3L2Q A;  3I55 I;  5JHF A;  3CC2 I;  2UXN A;  2QBY B;  4QWQ A;  1P7I A;  3A0H C;  3G1M A;  4N0B A;  3Q5F A;  2BV6 A;  3CES A;  1I27 A;  2F6C A;  1FSE A;  4XRM A;  1K7A A;  2VE8 A;  2W85 A;  2VC1 A;  3J80 Z;  3SDB A;  5B3S H;  4PJJ A;  4UVC A;  2GBY A;  1JHH A;  4BE0 A;  3PQK A;  1Y1V J;  3HSR A;  4U0Y A;  2B63 J;  3FXK A;  4LK1 F;  1IDZ A;  4E7H A;  1OFC X;  1Y0N A;  5E8I A;  1IXC A;  4DZP A;  2DK5 A;  2O61 A;  1Q1H A;  3ZCO A;  2PN6 A;  2Y31 A;  2X6W A;  3IAS 2;  2KIF A;  2PJR B;  1E3P A;  3K4B A;  3PSF A;  1GDT A;  2STW A;  5J40 A;  4PFO A;  2QKM B;  3TW7 A;  3GTK J;  1HF0 A;  3L2V A;  4AC0 A;  1OMI A;  3P7N A;  4OIN F;  2XPV A;  1D0Z A;  2HZD A;  2XAJ A;  2V79 A;  3G71 I;  5EG0 B;  4LB5 A;  4LIV A;  3E5U A;  1BBY A;  1OIS A;  2P6S A;  1Z9C A;  5F0C A;  4I7H A;  3OYC A;  2DQL A;  4A0Z A;  4I01 A;  3C2H A;  1VZ0 A;  4C3H J;  1V3F A;  3CMY A;  4ITV A;  4IZZ A;  2ZBK A;  2CJJ A;  3HHG A;  5J1Y A;  3QAH A;  3DEW A;  1MBF A;  4WCG A;  3A1Y A;  2CMP A;  3K4C A;  2X85 A;  3IHU A;  4ZJZ A;  2O8K A;  3B6A A;  5IY5 H;  1MKM A;  3DTI A;  2FU4 A;  4UXN A;  2XF6 A;  3I58 A;  4Y52 J;  2V6C A;  2CH0 A;  3JRA A;  3WHB A;  2K9S A;  4AM3 A;  4BH9 A;  4PSX A;  2QLZ A;  3OYD A;  4M6V A;  3QRF F;  4CHU A;  1TL8 A;  1RKT A;  2ID3 A;  1YRN B;  2EB7 A;  1O7F A;  1TW3 A;  3M8F A;  2V7F A;  1H8A C;  1GXP A;  3WTV C;  3I64 A;  3FKI J;  3CCY A;  3TDU C;  1S72 I;  3GX4 X;  1BJZ A;  2DPU A;  3VYU B;  1SMT A;  3X2Q H;  2QEN A;  3K2Z A;  3BOQ A;  3CDI A;  1L3L A;  1VFC A;  5DV5 A;  2LK2 A;  3ZMU A;  1IUF A;  1X1D A;  2VXD A;  1Z0X A;  1FOW A;  2Q8K A;  2LTP A;  3NWT A;  4Y7N J;  1REP C;  2I5U A;  2Q0O A;  2ZFW A;  2R3S A;  1YO5 C;  3AG3 H;  2MD0 A;  5C44 J;  3OYN A;  3QYE A;  2L01 A;  3K4J A;  3OS0 A;  4YRV A;  4ASN A;  3GTM J;  2ZSI B;  1FC3 A;  1U6G A;  2EIM H;  2BVM A;  3GTL J;  2F2E A;  1F36 A;  4HQE A;  1UG2 A;  5M3M J;  3MQ0 A;  4RM3 A;  3ZMT A;  4RGR A;  4ZTF A;  2EZH A;  3S1M J;  1ZR4 A;  4I99 C;  4CCO A;  2XAS A;  4IRG A;  1WJB A;  4OAY A;  4XLE A;  1RR7 A;  3HOT A;  3BJO A;  3A4C A;  4LLG F;  1J09 A;  1X1P A;  3BZ6 A;  1E2X A;  1SD7 A;  3M1E A;  3E1S A;  1BN5 A;  4B43 A;  1WFX A;  5FB2 A;  2Y30 A;  4NC6 A;  5GAH J;  4HNT A;  1WRJ A;  3FX3 A;  4HF1 A;  2EK5 A;  1PVE A;  4V2F A;  2TRT A;  5FRM A;  5M3F J;  1V5G A;  3SFZ A;  3E3V A;  4RAG A;  5JLW A;  4R1H A;  1H89 C;  2PLY A;  2PJP A;  1X3U A;  2VQG A;  2Y0S A;  3BC8 A;  4Y15 A;  1T39 A;  2O8X A;  4LIU A;  1JGS A;  2LR8 A;  3I4P A;  3KP6 A;  3G4S I;  1FIP A;  2WAQ A;  4D0P A;  1ZAO A;  1YS7 A;  4YEJ A;  4I09 A;  3HDD A;  2EA2 A;  3GZ6 A;  1ZG3 A;  2A05 A;  4I0B A;  2XDV A;  3PIO F;  2FUG 2;  4HST A;  4MQ9 F;  4A0Y A;  5IT9 Z;  3VPR A;  4Y3O A;  2X6O A;  4WWC A;  2FXA A;  2R7V A;  1NTC A;  3PFI A;  1MMS A;  3BDD A;  3OL3 A;  1IV6 A;  3RJP A;  3HTU A;  1MSF C;  3HJE A;  4E7J A;  3QPS A;  3VB2 A;  1SC7 A;  3KP5 A;  3W6J B;  2FBH A;  1MDM A;  2DCE A;  1FYL A;  4HW0 A;  5E8G A;  2OTL I;  1W5S A;  2P6T A;  3DKY A;  1R5H A;  4G7Z F;  2KT0 A;  1BW5 A;  1T33 A;  5FD6 A;  1BR1 A;  5JI6 A;  2P81 A;  2XC7 A;  1CQT A;  4G7O F;  2WY8 Q;  2L2O A;  4BKX A;  2YX7 A;  1QO0 D;  3IH3 A;  4NQW B;  1HCR A;  2MG4 A;  2RQQ A;  2MH2 A;  2IEK A;  2DMP A;  3OIP A;  4IJA A;  2L9N A;  2P4W A;  3TMO A;  5FKN A;  1XSD A;  3I5U A;  1JTX A;  1FNN A;  1R23 A;  4CSW A;  2ECC A;  2JK3 A;  3S17 J;  2BW3 B;  2QQB A;  1VI0 A;  3LST A;  4DBQ A;  2F5E A;  3V7R A;  3SZT A;  4D7M A;  1J5Y A;  3BY6 A;  4EV0 A;  1FTZ A;  1IN4 A;  5ICC A;  1LPQ A;  4C2U A;  4GYG A;  2X1E A;  2HVS A;  1T8I A;  3K69 A;  3EQL F;  2BEO A;  3ZXS A;  3D0S A;  3BG7 A;  2GOX B;  4AU7 A;  2J5P A;  1WH7 A;  2CV1 A;  4KT6 A;  4XR6 A;  3FXQ A;  1K83 J;  4E7S A;  2XGD A;  3VSL A;  2COM A;  3ZGK A;  1VQ4 I;  4AID A;  2KMU A;  1MZB A;  1BC7 C;  5F6F A;  2L9V A;  4DYC A;  3KLO A;  4Q5S F;  3GZ5 A;  3KP3 A;  3ZN0 A;  1K4T A;  3WE2 A;  2EV6 A;  5CLS A;  1IRX A;  2ELJ A;  4P1W A;  4A3C J;  4IHW A;  3J7A Y;  3RQ4 A;  3H9Q A;  3DPU A;  1MJB A;  4BY7 J;  1BR4 A;  4FE7 A;  4II2 A; 
#chains in the Genus database with same CATH homology
 2EFN A;  1AWC A;  4KMF A;  3IWF A;  3QU6 A;  5DCF A;  1KU2 A;  2MC3 A;  4U88 A;  1XSV A;  2MA3 A;  3HRU A;  3ZMV A;  1I1G A;  4RGU A;  3DXJ F;  3G3Z A;  4ZYE A;  1FBQ A;  4HA8 A;  1KYW A;  5D4R A;  2L4A A;  3L7W A;  1IN8 A;  3VEP A;  4FX4 A;  3EYI A;  4AD9 A;  4L5J A;  4OIO F;  4G7H F;  1EH7 A;  5DDG A;  2VE9 A;  2XV4 S;  1S29 A;  4S05 A;  1LB2 A;  1TQP A;  2VN2 A;  1XB4 A;  3C1D A;  4KN4 X;  1KYZ A;  1KQ9 A;  3GFL A;  5FD5 A;  2QVO A;  2HEO A;  1YLF A;  4BQA A;  2F5D A;  3Q9S A;  3CTA A;  1ZRE A;  3F3X A;  2WTE A;  2LDU A;  1WSU A;  4JBA A;  5KK1 A;  1PDN C;  3BRO A;  4HDV A;  1NHA A;  3IWZ A;  2HTS A;  4MEY F;  2HWV A;  3LA7 A;  1UCR A;  5LGU A;  2ZJ2 A;  3F8M A;  4GXO A;  4NQW A;  3HTS B;  2HQR A;  3CUQ A;  3ABT A;  2XUB A;  1P92 A;  4HOB A;  3CO6 C;  1LDD A;  3F21 A;  4UHT A;  2DBB A;  5BPI A;  2IA0 A;  2ESH A;  1XCV A;  2Z3Y A;  4A6D A;  4RB2 C;  1LDJ A;  2WV0 A;  4IHT A;  4EMS A;  5ERI A;  2C6Y A;  4EM2 A;  2VOP A;  4RGX A;  1IRF A;  4HYE A;  2VON A;  2V1U A;  5LEJ A;  4F7Z A;  2DAO A;  5LGN A;  2Y48 A;  5ILS A;  2CWE A;  3KCC A;  4OIR F;  3B02 A;  2TDX A;  3R60 A;  3TOA A;  1E17 A;  3WOD F;  3BWG A;  3IRQ A;  1HKQ A;  1YQA A;  1BJA A;  3MCZ A;  5FFX A;  1JE8 A;  2W24 A;  4WXD A;  1BC8 C;  4O5V A;  5LRS A;  1WI9 A;  1I1S A;  4YIF A;  3CUQ C;  3HRM A;  1LVA A;  4LK0 F;  3KE2 A;  5IT9 K;  1AOY A;  2L54 A;  3C7J A;  4JK1 X;  2V1X A;  1QZZ A;  3WU1 B;  3F8C A;  4I0A A;  4BYY A;  2V9V A;  2VC0 A;  1O3T A;  2ISZ A;  4L9T A;  1K78 B;  2A3S A;  1F4K A;  2K86 A;  2HGC A;  5D8K B;  5ILU A;  1F9N A;  2K02 A;  3DQV C;  2XAH A;  4M9Z A;  3V8L A;  1HKS A;  1WWX A;  2XGX A;  5J6X A;  5ICG A;  5DD8 A;  4HF0 A;  1V4R A;  1BIB A;  2NS0 A;  4LD5 A;  3LA3 A;  4RAY A;  4UV8 A;  2W57 A;  4HDU A;  2DTR A;  3TQN A;  1IXS B;  4YII A;  4ZYH A;  4PZJ A;  3RDI A;  1RNL A;  2GZW A;  1RUN A;  4LLN A;  2XVC A;  2O0Y A;  1P2F A;  3RIR A;  3QOP A;  3HOS A;  2OD5 A;  2NYX A;  1QQI A;  4PGH A;  5JVT A;  1U5T C;  1R5G A;  3MAJ A;  3SZP A;  1SAX A;  5HLI A;  5BS6 A;  5LHG A;  1U5T B;  3JSP A;  1ULY A;  2X4H A;  1J0R A;  2MLK A;  2JPC A;  3U1D A;  4U0V A;  4L0Y B;  5LBQ A;  2YU3 A;  2Y75 A;  1J2X A;  3U2R A;  1A04 A;  1IN7 A;  3MFK A;  5A2Q K;  2RNJ A;  5KVR A;  2YSR A;  4GYI A;  5DEQ A;  2QYO A;  2VT3 A;  1ZYR F;  4L9V A;  3ECH A;  3IL2 A;  2CQK A;  3LQQ A;  3F6V A;  3O3K A;  3E6M A;  1HXD A;  4CGZ A;  1LEB A;  1OKR A;  1XSX A;  3K1M A;  3F8B A;  4OMY A;  4I2O A;  4PCQ A;  4MTD A;  2CGP A;  1YS6 A;  1SFU A;  2HYF A;  3GEZ A;  3TGN A;  4L5I A;  1Z7U A;  1PP7 U;  5L3D A;  4XSZ F;  5HLH A;  4G9Y A;  5EEH A;  2XAG A;  5HDG A;  1OPC A;  4KA4 A;  1UHW A;  1W7P B;  1P4X A;  4KMU X;  2OQR A;  3WE3 A;  3KET A;  2K4J A;  2VBX A;  2GA1 A;  1HW2 A;  2W25 A;  4OOI A;  2X0L A;  4K2E A;  2E1N A;  1RIO H;  2FEZ A;  6PAX A;  3R6S A;  2PMH A;  3QU3 A;  1PP8 F;  3J7A O;  4IHS A;  5CVR A;  3GFJ A;  1BI3 A;  3EDP A;  1KGS A;  1XDS A;  4LG0 A;  3HRS A;  1D5V A;  1IUY A;  5E18 F;  3WGH A;  3WTY C;  2EA4 A;  3GF2 A;  3RPU A;  1MJ9 A;  1BI0 A;  3O6B B;  3FZV A;  1RZ4 A;  1R36 A;  3J81 K;  1XMA A;  4KN7 X;  4CO8 A;  3ZMD A;  4EM0 B;  4CYD A;  4G8X A;  2VOD A;  3CUQ B;  4UV9 A;  5D6F A;  2M45 A;  5CVU A;  3I59 A;  1STZ A;  3DKW A;  2PFB A;  2FE3 A;  3QPH A;  3T5X A;  5HDN A;  2K27 A;  1KU9 A;  2MH9 A;  4B8X A;  3ECO A;  3OOP A;  4EJT A;  1JXS A;  5LHI A;  3MWM A;  5AON A;  4I02 A;  4U7D A;  3RYR A;  3EET A;  3JAM K;  3HUG A;  2ISY A;  3B73 A;  2A68 F;  3RYP A;  1DUX C;  4MEX F;  5E1X A;  1R7J A;  2LSO A;  1OR7 A;  4UUV A;  1TNT A;  4MTE A;  1PUE E;  1BIA A;  5J8C A;  3V8K A;  3MEX A;  3WGI A;  5LRR A;  2QWW A;  3ABU A;  4KYW A;  5DCM B;  4AIJ A;  2EJR A;  4KIB A;  1XCB A;  1ODD A;  2R7F A;  3I53 A;  4JQF A;  4O3M A;  4UVB A;  3I0T A;  4A6E A;  2Z99 A;  1ZGJ A;  2AXL A;  2XIG A;  2H94 A;  1WQ2 A;  3FM3 A;  1HBX G;  3V7C A;  3F8N A;  3E6D A;  4DQ2 A;  5L3G A;  1XDU A;  1ZG5 A;  1SD4 A;  4Y17 A;  2JT1 A;  1J9I A;  4GCV A;  1FOK A;  4P9U A;  2EFW A;  2FF4 A;  3VFZ A;  2OBP A;  3M8E A;  3FWE A;  2R7D A;  2MD5 A;  1OYY A;  1B6A A;  1FWZ A;  2G7U A;  5DD4 A;  1QPM A;  1B9N A;  3F8F A;  2QQA A;  3HSF A;  5LGT A;  4M9X A;  1YW7 A;  2CO5 A;  2XRO A;  4RAZ A;  3C18 A;  4ENK A;  2CW0 F;  3L00 A;  1USS A;  4MNU A;  3LWF A;  4QLC U;  1UFM A;  4ON0 A;  2DT5 A;  2BE5 F;  5HVQ C;  4A12 A;  3K0L A;  3HHH A;  1J7K A;  4U7B A;  1ON1 A;  1O3R A;  2LNB A;  3DPL C;  2H09 A;  2AS5 F;  1Z91 A;  4KUM A;  4AVP A;  1GXQ A;  5J8F A;  4TV7 A;  2XRN A;  4CHU A;  2FSW A;  2M87 A;  5LHH A;  3RPQ A;  1XGS A;  5IT3 A;  2P7V B;  1U8R A;  4M9S A;  1FBS A;  1XGO A;  2DQR A;  4EQQ A;  2ZME B;  4E70 A;  1S7O A;  2OZU A;  4BXU A;  1UHM A;  4CDG A;  1T98 A;  1ZGA A;  4LMY A;  3I59 B;  1B4A A;  4OU0 A;  4AIH A;  2GAU A;  2O6G E;  2RQP A;  2PI0 A;  2GXB A;  1KQ8 A;  1XD7 A;  3E97 A;  3EUH A;  2ETH A;  5CVV A;  2PBI A;  2D45 A;  4Q4Z F;  3NEU A;  1MDM B;  3WTT C;  2Z33 A;  5ED4 A;  4YG2 F;  5E1W A;  3FMS A;  3V4G A;  3GXO A;  5L3B A;  2DI3 A;  4IRI A;  3HIF A;  2O03 A;  3D5L A;  2DPD A;  5TRD A;  2ZNY A;  3RI4 A;  4CXF A;  3CDH A;  4EM1 A;  2QUF A;  3WTU C;  2EV5 A;  3BJ6 A;  3TKY A;  2GA2 A;  1QGP A;  4XLP F;  3MZH A;  4ZYD A;  3KP4 A;  4KIF A;  4WXH A;  1IZ1 A;  4A2U A;  1KU3 A;  2GIV A;  3ZMS A;  1CF7 B;  2F5C A;  5D5V B;  1JHF A;  1DPR A;  1K78 A;  2DFI A;  5A2Q Z;  2RN7 A;  1ZAR A;  4XBF A;  5L3F A;  1ZRC A;  1YG2 A;  4KT5 C;  3WTS C;  3GWZ A;  2YX4 A;  2IVM A;  2XAQ A;  2FBI A;  1ZH5 A;  2H6B A;  4P55 A;  3ML6 A;  1HW1 A;  3GW2 A;  1XGM A;  2QQ9 A;  4LFU A;  1IF1 A;  4EGZ A;  1TTY A;  4U0W A;  1LEA A;  4ETS A;  5BOX A;  1Y0U A;  2PEX A;  2HQN A;  2A07 F;  4Y13 A;  5FLX K;  2BYV E;  4FX0 A;  3HSE A;  2FNA A;  3TDZ C;  2KJB A;  2ADU A;  5H6Q A;  1FYK A;  2F5F A;  4A5M A;  2HS5 A;  1I5Z A;  2XKO A;  3I54 A;  4OMZ A;  1D3Y A;  1QZY A;  1YYV A;  2QZ8 A;  1EH8 A;  2OQG A;  3CO7 C;  5HDK A;  4IVN A;  1IRG A;  2B0L A;  3ZMZ A;  3AAF A;  5CVI A;  4LB6 B;  1U78 A;  3IRR A;  1G4D A;  5FO5 A;  1MGT A;  3ZN1 A;  3N4M A;  4RGS A;  2DU9 A;  2XKP A;  3F72 A;  3VOD A;  5CYV A;  2A69 F;  3NQO A;  2K7L A;  1D8K A;  2RDP A;  3H3Z A;  2FA5 A;  2WWY A;  1WKM A;  4HV5 A;  3DF8 A;  3VOE A;  3KEO A;  4ENM A;  2M1B A;  3QP5 A;  2VOO A;  2VBW A;  4EJO A;  2JSC A;  3LQR A;  3DV8 A;  1HKT A;  4M71 A;  2IW5 A;  1SMY F;  3F6O A;  1Z6R A;  2ZCW A;  1S8N A;  1T6S A;  1VTN C;  4EJW A;  1EH6 A;  4GO1 A;  4I98 B;  3KFW X;  1HQC A;  3BJA A;  2PMU A;  3F22 A;  5BMZ A;  1U5T A;  1TQI A;  5AIQ A;  5ICE A;  2DO7 A;  5HS8 A;  4MHG A;  3OV8 A;  3JTG A;  2Y0M A;  1FLI A;  3RKW A;  3J80 K;  5HS9 A;  1HW5 A;  3KEQ A;  2CYY A;  3JAM Z;  2HYG D;  3R0A A;  2GXG A;  3L09 A;  1B59 A;  1YTY A;  1ZHF A;  2D1V A;  3M7G A;  3EYY A;  3H92 A;  1OYW A;  4KDP A;  2LF7 A;  1BI2 A;  2FMY A;  1W7P A;  3H3U A;  4XSX F;  2E7W A;  1CGP A;  1YFH A;  3Q9V A;  2VBY A;  3ULQ B;  3GFI A;  3C3W A;  4EJU A;  3REO A;  2G9W A;  5AIP A;  2RV8 A;  3S2W A;  2EV0 A;  4ZH4 F;  4DNC A;  2P7C B;  2IRF G;  1T38 A;  2JPB A;  1T0F A;  1I6X A;  1MD0 A;  1IXR C;  3HYI A;  3F23 A;  1F1Z A;  2FOK A;  2GQQ A;  2VXZ A;  3NRV A;  4HBL A;  4HLY A;  4A5N A;  2YR2 A;  1ONV A;  5DUK A;  2K4B A;  1O7L A;  3V8J A;  3G73 A;  2QBY A;  4HX4 A;  2FRH A;  4HV6 A;  1GVJ A;  4KIC A;  4HLX A;  3ZPL A;  4RB1 A;  3QP6 A;  5DUI A;  1TBX A;  1Z05 A;  4BHP A;  4ESF A;  1O3Q A;  4NB5 A;  2P5V A;  2NRA C;  1ZLJ A;  5JHU A;  1H9G A;  2UZK A;  3KZY A;  4OIQ F;  2IA1 A;  4N9I A;  2KKO A;  5DCM A;  3ISP A;  2EFQ A;  3J81 Z;  1C0W A;  5K5Q A;  1P4W A;  2D2W A;  1FT9 A;  2HZT A;  2O3F A;  2ZO4 A;  2P8T A;  1FP1 D;  3FXR A;  2UXX A;  2DW4 A;  3QPT A;  4B09 A;  1S7A A;  2ZXJ A;  3WG9 A;  5EEG A;  3TO6 A;  2HTJ A;  4NHJ A;  4Z2Y A;  1B1B A;  2H27 A;  4CIC A;  3KP2 A;  2L02 A;  2XHK A;  2BBY A;  4R8H A;  1SD5 A;  1EV7 A;  5FGM A;  1HSJ A;  1G3W A;  2P5L C;  2M5W A;  2OU2 A;  4CZZ A;  3IC7 A;  2A6E F;  3I71 A;  2E7X A;  3CUO A;  4UNO A;  3KP7 A;  4WXC A;  1G3S A;  1UB9 A;  2V1D A;  3TO9 A;  2OA4 A;  4M74 A;  1R58 A;  4IXA A;  4KFC A;  1S6L A;  2CG4 A;  1IN6 A;  1U2W A;  1T2K A;  4EGY A;  2P5K A;  4P5O A;  4IRH A;  1HST A;  2WC2 A;  3SHF A;  3WTW C;  3FMQ A;  5D5W B;  1J75 A;  2Q2E A;  1GHC A;  4BAY A;  2IPQ X;  4RB0 A;  1FZP B;  3GLX A;  1L0O C;  1Z1D A;  5HS7 A;  2JZY A;  4M72 A;  4N9H A;  3W6K B;  5K5O A;  1TQM A;  3T0Y A;  1ZN2 A;  1FYM A;  4M6X A;  5HOO A;  1TLH B;  1QBJ A;  4WK8 F;  1SD6 A;  3RKX A;  3V7S A;  3L9F A;  1KU7 A;  2HDC A;  5F64 A;  1O57 A;  5JR3 A;  3HRT A;  1R1T A;  3BPV A;  2HFH A;  5F1R A;  2FNP A;  3IKV A;  1XMK A;  3T8R A;  1R1V A;  4L9J A;  2ZME A;  3K9T A;  4HAM A;  5HLG A;  2FQ3 A;  1UST A;  2ESN A;  3KLN A;  5FLX Z;  1SFE A;  5BQT A;  5FFZ A;  1W5T A;  2IA2 A;  2RGV A;  4ZZD A;  2STT A;  3JTH A;  3KZZ A;  5ILV A;  3R61 A;  4KIG A;  1SFX A;  4L0Z B;  3ERE D;  1KA8 A;  1KQ0 A;  4G6Q A;  4EVI A;  2RC4 A;  2KIM A;  3E6B A;  1OYI A;  2A61 A;  5JFR A;  1G3Y A;  2EWN A;  1B9M A;  4ENJ A;  3LAJ A;  1H0M A;  1FX7 A;  2FML A;  5L3C A;  1DPU A;  3IKT A;  3CJN A;  2RVC A;  4P96 A;  4O6J A;  2IJL A;  2MLG A;  3M9A A;  3WTX C;  3FXU A;  2HOE A;  1FY7 A;  1ZRD A;  3R4K A;  1TW2 A;  4BNC A;  4EJV A;  2HKX A;  1O3S A;  4S04 A;  1FPQ A;  2VT2 A;  1XN7 A;  4PGG A;  3ZP5 A;  1IAW A;  2ACJ A;  1ZRF A;  3P9I A;  3COA C;  1BI1 A;  2FBK A;  3DPT A;  1LDK B;  5H6R A;  1IW7 F;  2CSO A;  4OIP F;  2E1C A;  4HF2 A;  2DK8 A;  4FHT A;  1K6O A;  1R1U A;  1W4M A;  3GO5 A;  3DFG A;  5K1Y A;  1U3E M;  3LFK A;  4GGG A;  3WTZ A;  5D8L B;  1YIO A;  2Z9O A;  3U9G A;  5LLQ A;  1LQ1 A;  4RB3 C;  2HKO A;  2ZNZ A;  4MGR A;  3FM5 A;  4HZF A;  4ESB A;  3E5X A;  1J59 A;  5DYM A;  4AWX B;  3DP7 A;  2Z5U A;  4G94 A;  3FF5 A;  4IF4 A;  5ICF A;  2W84 A;  3TO7 A;  1W7P D;  5K5R A;  3BP8 A;  1H9T A;  4WF2 A;  1Z6T A;  4ZZL A;  1S3J A;  2KIU A;  4AIK A;  2IT0 A;  3JW4 A;  3CLO A;  1ZLK A;  2H6C A;  2XAF A;  4XRF A;  3E6C C;  2IP2 A;  4L18 B;  3RKY A;  4R79 A;  5LEK A;  3O2P E;  4LJZ F;  1FSH A;  3K1P A;  3GYH X;  3R0J A;  1BOA A;  2A5Y B;  3WU0 A;  1YW8 A;  2NAZ A;  2NNY A;  1DP7 P;  4M6Y A;  4G6D A;  5E17 F;  5D5X B;  3PQJ A;  4WX9 A;  2OAZ A;  3JSO A;  2M30 A;  4HX7 A;  3ZQ7 A;  2ZKZ A;  3DEU A;  2LKP A;  3ELK A;  3P9K A;  2PQ8 A;  3K1N A;  2EFO A;  3ROU A;  1K79 A;  4H0E A;  3RTR A;  3LAP A;  4FT8 A;  4A0X A;  5BPD A;  2YPR A;  2JTV A;  5D4S A;  5CVJ A;  4LG0 B;  4P9F A;  3FHZ A;  1YW9 A;  1FBU A;  4LGW A;  4M73 A;  3BPX A;  1P4A A;  4Q48 A;  3N97 A;  2GWR A;  2VBZ A;  1F5T A;  4HQM A;  4YFX F;  2KJC A;  5CJ9 A;  2DLL A;  2M8E A;  2G7H A;  4RS8 A;  1MJA A;  4YFN F;  3T8T A;  2A6H F;  1R22 A;  4Q47 A;  5H20 A;  4PDK A;  1D8J A;  4ZYG A;  2OZ6 A;  3GVA A;  1TNS A;  5E1Z B;  3L2C A;  4XLN F;  2EFP A;  3SQN A;  3TOB A;  4ESJ A;  4YFK F;  2LF8 A;  5TJJ A;  3SXY A;  5D5U B;  1LJ9 A;  3WGG A;  2QM3 A;  3LA2 A;  5E20 A;  1R00 A;  1RI7 A;  4ENN A;  2JRT A;  3P9C A;  3FMR A;  1ZG1 A;  1RUO A;  1CF7 A;  3GFM A;  2UWM A;  2CFX A;  3T1B A;  2NNN A;  2PG4 A;  1XGN A;  1G3T A;  5L3E A;  1G6N A;  1DDN A;  1IN5 A;  2D1H A;  4LLL A;  2ELH A;  2J5O A;  4BHC A;  1FP2 A;  5D6E A;  4BHB A;  4UVA A;  4MQV A;  4IPA A;  4L9N A;  3MZY A;  2RKH A;  4KNY A;  1ON2 A;  1BM9 A;  1P6R A;  2BGC A;  4HX8 A;  2KRF A;  1LNW A;  3E5Q A;  2L4M A;  2L3D A;  3GUD A;  1QNT A;  2HR3 A;  2MBF A;  2UXN A;  2QBY B;  4QWQ A;  4N0B A;  3Q5F A;  2BV6 A;  1I27 A;  1FSE A;  1K7A A;  2VE8 A;  2W85 A;  2VC1 A;  3J80 Z;  4UVC A;  1JHH A;  3PQK A;  3HSR A;  4U0Y A;  4LK1 F;  5E8I A;  1IXC A;  2DK5 A;  2O61 A;  1Q1H A;  2PN6 A;  2KIF A;  2STW A;  1OMI A;  3P7N A;  4OIN F;  2XAJ A;  2V79 A;  4LB5 A;  3E5U A;  1BBY A;  2P6S A;  1Z9C A;  4I7H A;  2DQL A;  4A0Z A;  4I01 A;  1V3F A;  2ZBK A;  3HHG A;  3QAH A;  4WCG A;  3IHU A;  1MKM A;  2FU4 A;  4UXN A;  3I58 A;  2V6C A;  4BH9 A;  2QLZ A;  3QRF F;  2EB7 A;  1O7F A;  1TW3 A;  3M8F A;  1GXP A;  3WTV C;  3I64 A;  3TDU C;  3GX4 X;  2DPU A;  1SMT A;  2QEN A;  3K2Z A;  3BOQ A;  1L3L A;  5DV5 A;  3ZMU A;  2Q8K A;  1REP C;  2Q0O A;  2ZFW A;  2R3S A;  1YO5 C;  2L01 A;  4ASN A;  1FC3 A;  1U6G A;  2F2E A;  4HQE A;  3MQ0 A;  3ZMT A;  4RGR A;  2XAS A;  4IRG A;  3HOT A;  3BJO A;  4LLG F;  3BZ6 A;  1E2X A;  1SD7 A;  3M1E A;  1BN5 A;  5FB2 A;  1WRJ A;  3FX3 A;  4HF1 A;  2EK5 A;  3SFZ A;  3E3V A;  4R1H A;  2PLY A;  2PJP A;  1X3U A;  4Y15 A;  1T39 A;  2O8X A;  1JGS A;  3I4P A;  3KP6 A;  4D0P A;  1ZAO A;  1YS7 A;  4I09 A;  2EA2 A;  3GZ6 A;  1ZG3 A;  4I0B A;  4MQ9 F;  4A0Y A;  5IT9 Z;  4WWC A;  2FXA A;  3PFI A;  3BDD A;  3RJP A;  3HTU A;  3VB2 A;  1FYL A;  1MDM A;  3KP5 A;  2FBH A;  3W6J B;  4HW0 A;  5E8G A;  1W5S A;  2P6T A;  1R5H A;  4G7Z F;  5FD6 A;  4G7O F;  5JI6 A;  2YX7 A;  1QO0 D;  2MH2 A;  4IJA A;  2P4W A;  1XSD A;  3I5U A;  1FNN A;  1R23 A;  2QQB A;  3LST A;  2F5E A;  3V7R A;  3SZT A;  1J5Y A;  3BY6 A;  4EV0 A;  1IN4 A;  5ICC A;  4GYG A;  3K69 A;  3EQL F;  2BEO A;  3D0S A;  2J5P A;  3FXQ A;  2COM A;  1MZB A;  1BC7 C;  5F6F A;  3KLO A;  4Q5S F;  3GZ5 A;  3KP3 A;  3ZN0 A;  3WE2 A;  2EV6 A;  5CLS A;  1MJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...