3ECOA

Crystal structure of mepr, a transcription regulator of the staphylococcus aureus multidrug efflux pump mepa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
137
structure length
135
Chain Sequence
FTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title Structural and biochemical characterization of MepR, a multidrug binding transcription regulator of the Staphylococcus aureus multidrug efflux pump MepA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 51
structure length 135
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ecoA00
3K1MA 2HTJA 2GA1A 1PUEE 4LGWA 1ZRFA 1R1UA 5LBQA 4HLXA 1CF7B 2STWA 3H3UA 4EM1A 1UHMA 3VEPA 4BHBA 2OA4A 3HUGA 4EJTA 4OMZA 4EGZA 3LA7A 2PBIA 3BOQA 2VBYA 1BI3A 4G94A 3B02A 4M9SA 2CQKA 3IRRA 4AWXB 4ZYHA 3WE2A 2YU3A 1XGSA 2KJCA 2EFWA 3KCCA 3GX4X 1TTYA 2QWWA 4HX4A 2R7FA 1ZARA 5FGMA 4WF2A 3ZQ7A 1XDUA 2GXBA 2Z3YA 3I53A 3HSRA 3CO6C 2YX7A 4CHUA 1SFUA 1SD4A 1KQ8A 4KIFA 4IF4A 2LSOA 3L9FA 3E97A 3QRFF 1YIOA 1TQMA 1V4RA 4N9HA 3VB2A 2FEZA 2Q0OA 5CVJA 4HQEA 4JK1X 1G3WA 2DFIA 4MGRA 4L9JA 1QNTA 2P5KA 4B09A 3LA3A 4KICA 2QVOA 2H27A 4M73A 1FYMA 3ISPA 3MFKA 2Y75A 1U6GA 3BZ6A 1ZH5A 2DI3A 1TNTA 1I1SA 1H9TA 2FNAA 1W7PA 4RB2C 1O7FA 3PQJA 3KP7A 5E8IA 2FBIA 4YFXF 3I59A 1JXSA 4FX0A 1A04A 3MWMA 2P5VA 5D5VB 3LAJA 2XGXA 3F23A 4MQ9F 1FYKA 1P6RA 2VT3A 3WTYC 5E8GA 5ILVA 1KU2A 4BAYA 3MZHA 2MC3A 4WWCA 4IJAA 5TRDA 2HS5A 3V7SA 3VODA 3CUQA 4HX8A 2AXLA 3P9KA 2HOEA 2RVCA 3FXRA 4MTEA 4WX9A 5HVQC 5L3EA 1GHCA 2VC1A 5HS9A 4L9VA 2AS5F 1ODDA 3T8TA 4S05A 4ZZLA 3RIRA 3BDDA 3J80Z 2MLGA 2DQLA 1WQ2A 1IN7A 2O8XA 3K0LA 3IL2A 1AWCA 4KYWA 2HKOA 3C3WA 4LMYA 4HBLA 2V1DA 3ZP5A 2OQGA 5DCMA 1HKQA 2X0LA 2O03A 3TOAA 3ZMDA 1R1TA 2DO7A 3F6OA 2DBBA 3HRUA 5J6XA 3ECHA 5D5UB 3FHZA 4GYGA 3QAHA 3CO7C 4CICA 2J5OA 3KLNA 1R00A 3V4GA 1ZLJA 5E18F 4P9UA 3V8LA 3WGHA 1P92A 2X4HA 4OIQF 4NQWA 3WTSC 2XASA 3DV8A 3GFLA 1STZA 1J75A 1B4AA 3K2ZA 1DPRA 1U5TC 4KNYA 1KYZA 3GVAA 1FP1D 3RTRA 5DUKA 4YIIA 1S7AA 1QQIA 2GIVA 1MJ9A 2VBZA 2A6HF 1R1VA 3E6MA 2HKXA 3FX3A 2K4BA 2W57A 3I58A 1JGSA 2F2EA 1ZHFA 2XV4S 3SZPA 5BQTA 5D5WB 1JHHA 5L3FA 2F5EA 2FE3A 1H9GA 4UVAA 4GCVA 4WXDA 4I0BA 1BBYA 3BROA 1X3UA 3HHHA 1E2XA 3BPVA 3GZ6A 4ENJA 2VBWA 2XAHA 4LK0F 3RPUA 3H3ZA 5BPDA 2W25A 3ROUA 1JE8A 4UNOA 1IAWA 3NRVA 2NS0A 3RKXA 4OIOF 3C1DA 3LQQA 4HF1A 4UV8A 5LGUA 2WTEA 2M45A 1S7OA 1O57A 4XLNF 3TKYA 2PN6A 1DP7P 4HDUA 1BC8C 3I0TA 1W5TA 1LNWA 2QYOA 5LRRA 2P6TA 1TLHB 2ZJ2A 3JTGA 4LB6B 1S3JA 4EJOA 4L5JA 4EJVA 2LDUA 3P7NA 3MCZA 2EFPA 3F8NA 1T39A 1LDKB 2H09A 2OQRA 3F6VA 3J81K 4GYIA 3WTWC 4RS8A 3L2CA 3S2WA 5DEQA 1HXDA 2STTA 4R79A 4MQVA 1G3YA 5ICFA 3GF2A 4MEYF 4U88A 5CYVA 3COAC 2P4WA 2V6CA 3JAMK 1FBSA 2XAJA 3EUHA 3ULQB 1KYWA 2A5YB 3E5QA 4EJWA 5ILUA 3TO9A 5K5RA 4GO1A 3BY6A 4HOBA 4HV6A 3KEOA 5FO5A 3SZTA 1FP2A 4H0EA 1O3QA 2XIGA 2MA3A 4L9TA 1B9NA 2QM3A 5FD6A 4GGGA 1J59A 2E7XA 4BNCA 2HEOA 4RGRA 4CGZA 4Q48A 2V1UA 1OYYA 1KQ0A 3M8FA 1GXPA 4IVNA 3KLOA 1MDMB 1T0FA 4G6DA 1Z7UA 4AIKA 2XAQA 4LK1F 2Z33A 1I5ZA 2GZWA 2P7CB 5A2QK 4CO8A 2DK8A 2A68F 2DW4A 2ZNZA 3QU3A 4D0PA 2NYXA 1ZN2A 4JBAA 4M9ZA 4ESJA 3KFWX 5LLQA 5AIQA 1SMYF 1F5TA 2ZMEA 2L3DA 4L9NA 2EA2A 5BS6A 1CF7A 4BHCA 3W6JB 2ELHA 1Z9CA 1HSJA 1D8JA 5CVUA 3JW4A 2HR3A 2Q2EA 3FMQA 1YW8A 4IPAA 1EH6A 2FF4A 2BYVE 2EA4A 3F8CA 4U7DA 1XGMA 3HTSB 2E1NA 3GZ5A 1QGPA 3TDZC 3DPTA 1U2WA 5LGTA 2M1BA 1GXQA 4RAYA 4UUVA 1B6AA 2K27A 4ESBA 4G7HF 2G9WA 4IHTA 3ZN1A 3BJOA 3DQVC 4RB3C 3JSPA 4BQAA 3IC7A 3O2PE 3FMSA 3OV8A 1SFXA 1K78B 1IF1A 4K2EA 4MHGA 3GLXA 2O0YA 2XUBA 4Q5SF 2FXAA 5D5XB 3C18A 1G3TA 2ISYA 4LLLA 2HGCA 2KKOA 5CLSA 1Q1HA 1YW9A 3Q5FA 3HOTA 1S29A 2RC4A 3O3KA 1FSHA 2DK5A 1IUYA 2PG4A 4KUMA 5D4SA 4GXOA 3REOA 3ZMUA 2L4MA 1V3FA 2DTRA 4G9YA 2V79A 4ZZDA 3HIFA 3GW2A 1UFMA 2IT0A 4EQQA 1LVAA 4Z2YA 4ENMA 1ZLKA 3GFJA 2JPCA 2L54A 1ULYA 2JT1A 4AIHA 2PMUA 1SD6A 2F5FA 2PLYA 1FYLA 1TQPA 3HOSA 2LNBA 2CGPA 5H6QA 1MKMA 1PP7U 3CTAA 4ON0A 2GWRA 2A3SA 1MD0A 4RGUA 2W85A 1XGOA 3JTHA 5JI6A 1FY7A 2XAGA 3KZZA 2VE9A 1G4DA 4YIFA 2YX4A 5DD4A 1PDNC 4Q4ZF 6PAXA 4ESFA 3IRQA 5ILSA 1EV7A 4MEXF 3RI4A 1EH8A 3E6CC 2CYYA 5TJJA 4RB0A 3FXUA 3RKWA 3V8KA 1D8KA 1ZGJA 4ENNA 1XD7A 2FMLA 2GXGA 1EH7A 3M7GA 2EK5A 3CDHA 4HQMA 2FBKA 2NNYA 2FOKA 4N9IA 5IT3A 1HW5A 3P9IA 2KRFA 5JVTA 1IRGA 1XSXA 5LHHA 1IZ1A 1YO5C 1K79A 3BPXA 2G7HA 5E1WA 3ZMVA 4M6XA 2V1XA 3K1NA 2RNJA 3VFZA 4OMYA 3TOBA 4ETSA 1XGNA 3J7AO 1H0MA 5CJ9A 4XLPF 4P5OA 2O61A 4EJUA 2FMYA 3ABUA 2M30A 1SD5A 5D8LB 2XVCA 5LEKA 1W5SA 2WC2A 3KETA 3BJ6A 3SFZA 5BOXA 3BP8A 2D2WA 3HSEA 1RI7A 2UWMA 4I02A 1C0WA 1U3EM 2JPBA 2NNNA 2OAZA 4RGXA 2JTVA 3K1PA 1OYIA 3Q9SA 1FT9A 3I59B 4LFUA 1YS6A 3WTUC 1IN4A 5DDGA 1P2FA 1ZG3A 3ELKA 3E3VA 4AD9A 4XSZF 4LG0A 2J5PA 3K69A 1F9NA 3MEXA 5BPIA 2MD5A 4WXCA 3CUQB 5IT9Z 1HW1A 4LLNA 4Q47A 2EWNA 1REPC 2Y0MA 2IP2A 2VOPA 2EFNA 2A6EF 1BM9A 4KIGA 3QP5A 4YFKF 1RIOH 1O3SA 3IKTA 2IA2A 1Y0UA 5ICCA 3HRSA 4ZH4F 2TDXA 2GA2A 4JQFA 4KN4X 1HSTA 4PGHA 3TO6A 4QLCU 1LEBA 2VODA 3TGNA 5E1XA 1UB9A 3W6KB 4PZJA 1HQCA 4UVBA 5DV5A 5DCMB 3N97A 5DCFA 4R8HA 2BE5F 3O6BB 4Y13A 1R58A 4CDGA 1FWZA 2ZXJA 5FLXZ 2XHKA 1BIBA 2FA5A 3BJAA 3KP4A 2FRHA 1HBXG 3TDUC 4HAMA 4N0BA 3KZYA 5JHUA 2ZFWA 1I27A 1R22A 5H6RA 2HQNA 5L3GA 5HS8A 3FM3A 3AAFA 2K4JA 3VOEA 1XMAA 5K5QA 3ZMSA 1RUNA 2IVMA 1WSUA 4OIRF 1MZBA 4HA8A 5F1RA 4HF2A 5HLIA 1LDDA 1XN7A 1T2KA 1Z6RA 2IW5A 4HLYA 2P6SA 5E1ZB 2CWEA 2HZTA 1SD7A 4R1HA 4KIBA 3L7WA 3R4KA 1S6LA 4M71A 4L5IA 2LF7A 3KP3A 2QLZA 2XROA 2YR2A 2NRAC 1IXSB 2VT2A 2HTSA 3BWGA 3I64A 1RNLA 2LF8A 2QQAA 1Z91A 4E70A 4PDKA 5H20A 1FBQA 3KE2A 2Q8KA 4U7BA 2IPQX 2YSRA 1ZYRF 3E5XA 4PCQA 2W84A 4TV7A 2IRFG 3MZYA 4NB5A 1F1ZA 2OZ6A 3E6DA 3J80K 2EFOA 2JSCA 3GXOA 2L02A 1P4XA 2W24A 1IRFA 1QZYA 3T8RA 3K9TA 2RQPA 2A69F 3WTVC 4XBFA 2HWVA 3NEUA 4A6DA 2FBHA 2O3FA 2QQBA 1B9MA 1BI0A 4WK8F 1WKMA 1W4MA 4I09A 4PGGA 1BOAA 1U5TA 1OMIA 2K86A 2QUFA 1ZG5A 2RV8A 5CVVA 1BI2A 3SHFA 4LJZF 4IHSA 1WRJA 4U0VA 1YYVA 1MJAA 1NHAA 2C6YA 5HDKA 2Z99A 3V7CA 2RN7A 3F8BA 4LLGF 1XCBA 3Q9VA 4MTDA 1HKTA 4HX7A 1B1BA 2KJBA 1O7LA 1XSDA 1IW7F 2K02A 3TQNA 3C7JA 4UV9A 3QP6A 5ICEA 3JSOA 4KT5C 5K5OA 1W7PD 4M72A 3FXQA 1YTYA 5EEHA 5ERIA 4KA4A 2ZNYA 1TW3A 3WGIA 1J5YA 1FX7A 1YQAA 3M8EA 2OD5A 1ZRDA 3V7RA 2QBYA 3IWFA 2H6BA 1MGTA 3OOPA 3I71A 5J8FA 2KIFA 4P9FA 4A0XA 1BC7C 4LD5A 1MJBA 1OYWA 2ESHA 2VC0A 3F21A 2HFHA 2MH9A 1ON1A 1YG2A 2ZO4A 5EEGA 4WXHA 2GQQA 1XSVA 3KEQA 4EM2A 2PJPA 1BIAA 2P7VB 4I7HA 2BBYA 5LEJA 2R7DA 4EV0A 1DUXC 2P5LC 2UXXA 3R0JA 1FBUA 1FC3A 1ZAOA 2L01A 3SQNA 1USTA 1TW2A 1G6NA 4ZYEA 2M87A 5FFZA 2DPUA 4FHTA 1S8NA 1G3SA 2M8EA 4KFCA 2ACJA 4B8XA 5LHGA 2DLLA 4RAZA 3RKYA 4A0YA 4CXFA 2G7UA 3FM5A 5JR3A 2ZBKA 5HLHA 1ONVA 1FOKA 3FF5A 1FLIA 1I6XA 2ZMEB 4AIJA 3RYRA 1FSEA 3GEZA 3DEUA 5DYMA 5F6FA 3IKVA 3HHGA 2K7LA 3HTUA 4XRFA 2QZ8A 1YFHA 2Y48A 2PMHA 3D0SA 2COMA 1R36A 1K6OA 4OIPF 3B73A 5BMZA 4Y17A 1LB2A 3T5XA 4ZYGA 2IA0A 1XCVA 4Y15A 4FT8A 2BV6A 3N4MA 2XRNA 3R60A 1IXRC 1R23A 2E7WA 4G8XA 1OPCA 5K1YA 1CGPA 2CW0F 2EV5A 4L0YB 3G73A 5D6FA 1LJ9A 4HF0A 1R5GA 1L0OC 1Z05A 2RKHA 1SFEA 1WI9A 4G7OF 1PP8F 2JRTA 1KU9A 5D6EA 3HRTA 1XB4A 4HV5A 1D5VA 5L3DA 2ZCWA 4ENKA 2CFXA 2ESNA 1ZGAA 2EV0A 2A07F 2EV6A 1KU3A 2KIMA 3EQLF 3DPLC 3F8FA 1D3YA 4YFNF 3I5UA 1ZG1A 2B0LA 2ETHA 2VN2A 2Z5UA 4EMSA 1HKSA 2H6CA 5FFXA 3I54A 3WU1B 1P4AA 3RJPA 1KA8A 3QPTA 1RUOA 2EFQA 4BYYA 3FZVA 1SMTA 3CUOA 2RDPA 1K7AA 4BH9A 3NQOA 4L18B 3F22A 3GUDA 1Z1DA 2A61A 2HYGD 4NHJA 5HOOA 3EETA 2CG4A 1YLFA 1W7PB 5E17F 4A2UA 3CJNA 2R3SA 2PQ8A 4UXNA 3E5UA 4M9XA 4HYEA 2E1CA 1OKRA 4IRHA 2DAOA 2UXNA 1J9IA 1AOYA 1QBJA 1WWXA 2XKPA 2F5CA 4RB1A 3J81Z 1T38A 4ZYDA 2VONA 4BHPA 4A0ZA 3U1DA 3EDPA 3JAMZ 3HYIA 4O3MA 4HZFA 2H94A 1QZZA 1LEAA 2WWYA 1BN5A 5F64A 2OBPA 1O3TA 1FNNA 4OOIA 4UHTA 1R7JA 4EM0B 2FSWA 3QU6A 3WTZA 3GYHX 3M9AA 5L3BA 4WCGA 2YPRA 1YS7A 1GVJA 4DQ2A 1XMKA 3IWZA 5D8KB 4U0WA 4CZZA 4YG2F 2CSOA 3ML6A 3G3ZA 5D4RA 2Z9OA 2OZUA 2IA1A 4MNUA 4LG0B 1P4WA 2PFBA 5CVRA 3ECOA 4U0YA 1IN5A 3SXYA 3LFKA 2EB7A 4A12A 2FU4A 1ZREA 1LQ1A 5A2QZ 1JHFA 2D45A 3CLOA 4FX4A 3MAJA 4G6QA 4AVPA 5AONA 3GO5A 4I01A 5HDGA 2BGCA 2NAZA 2ZKZA 2DT5A 5DUIA 4RGSA 1L3LA 2ISZA 3LWFA 4HW0A 4HDVA 2RGVA 3ZN0A 3PQKA 1YW7A 2WV0A 3TO7A 1TQIA 3L09A 1F4KA 3RPQA 1UHWA 3GFIA 2MLKA 3RDIA 2O6GE 4DNCA 2LKPA 3QOPA 3V8JA 3ERED 1HW2A 3F8MA 2L4AA 4O6JA 3WTTC 5E20A 3GFMA 3WU0A 3QPHA 2BEOA 4KMFA 2FQ3A 3KP2A 5ED4A 1O3RA 1ON2A 2OU2A 2XKOA 3R6SA 3IHUA 3LA2A 1IN8A 2CO5A 4A5MA 1IXCA 3DFGA 5DD8A 5HLGA 3I4PA 4F7ZA 2DPDA 2VXZA 1J0RA 4M6YA 3LQRA 3D5LA 3M1EA 3U2RA 5LRSA 1DDNA 4OU0A 3WTXC 1MDMA 5CVIA 4KDPA 3P9CA 4I98B 3ABTA 4O5VA 4A5NA 2GAUA 4UVCA 4A6EA 5KK1A 1U8RA 1BJAA 3F3XA 1XDSA 2V9VA 5IT9K 5L3CA 5J8CA 4M74A 3DKWA 1T98A 2PI0A 4P96A 4L0ZB 1BI1A 4BXUA 3EYIA 4KN7X 4EGYA 1TNSA 1I1GA 4I2OA 3DF8A 3HSFA 2VE8A 4OINF 1E17A 2PEXA 2HQRA 1RZ4A 1DPUA 2D1HA 2FNPA 3F72A 5LGNA 5HDNA 3H92A 2MH2A 4QWQA 2P8TA 1TBXA 3FMRA 1ZRCA 2EJRA 5FLXK 3KP5A 3WGGA 3ZPLA 3LAPA 5HS7A 2IJLA 5ICGA 2JZYA 1SAXA 4IXAA 5LHIA 1J2XA 3ZMZA 1FZPB 1OR7A 3PFIA 5AIPA 1B59A 4S04A 1U5TB 3KP6A 2VBXA 5FD5A 2D1VA 3WODF 3RYPA 1KGSA 3EYYA 1USSA 3DP7A 2VOOA 2F5DA 3T0YA 3ZMTA 1KU7A 2MBFA 4EVIA 1VTNC 1J7KA 3L00A 2HDCA 5JFRA 5KVRA 4P55A 1K78A 1UCRA 3GWZA 3MQ0A 3WG9A 1KQ9A 3HRMA 2DU9A 3U9GA 2HYFA 3R61A 2KIUA 4G7ZF 4LB5A 4IRIA 3LSTA 2QENA 1QO0D 2QQ9A 2UZKA 4XSXF 3E6BA 4ASNA 1IN6A 4I0AA 1U78A 1FPQA 3DXJF 3R0AA 2M5WA 2ADUA 2DQRA 1T6SA 2XAFA 1QPMA 4KMUX 2QBYB 4IRGA 3CUQC 1LDJA 1Z6TA 1R5HA 5FB2A 3FWEA 3T1BA 3WE3A 4CYDA
chains in the Genus database with same CATH superfamily
2ELKA 3K1MA 2HTJA 2LP0A 5B5EC 1UZCA 2GA1A 1PUEE 4LGWA 3CF2A 1ZRFA 1R1UA 5LBQA 4X0GA 4HLXA 2VLAA 1CF7B 2HOSA 4C3IJ 2STWA 3OOUA 5JLWA 3H3UA 2CW8A 4EM1A 1UHMA 2H8WA 3VEPA 4BHBA 1AHDP 2OA4A 3HUGA 3S1QJ 3VYSB 4EJTA 4OMZA 2V6EA 4EGZA 3OSFA 1RRJA 2VUMJ 5C4JJ 3EUAA 3LA7A 3HM5A 4PSWA 1OQYA 3K4MA 2PBIA 3BOQA 2VBYA 1BI3A 1TWCJ 4G94A 3B02A 4M9SA 2CQKA 3IRRA 4AWXB 3G1MA 4RM2A 4ZYHA 3KX2A 3WE2A 3ZOBA 2DDAA 2M7BA 2YU3A 1B72A 2JA2A 1MBFA 1XGSA 2KJCA 4PJ0C 1QRYA 2HYJA 2EFWA 4BDZA 3KCCA 3GX4X 1IGNA 2H1KA 3GBGA 1QPIA 1TTYA 5HODA 2QWWA 3SDGA 4HX4A 3A01A 2Z2SB 3HOZJ 4F55A 1GV5A 2R7FA 2DMQA 4CCJA 3BT9A 1U9OA 1ZARA 1HA8A 2W4SA 5FGMA 3MKZA 4XKCA 4WF2A 3Q0UA 3ZQ7A 2CH0A 2X51A 1XDUA 2GXBA 4F91B 2Z3YA 3I53A 3H0GJ 5EG0B 3N05A 3HSRA 4XMYA 3CO6C 2YX7A 4CHUA 3ZXSA 1SFUA 1SD4A 1VQPI 2NVQJ 1KQ8A 4KIFA 4IF4A 1UMQA 2LSOA 5E3LA 4D7MA 3L9FA 1EA3A 1NK2P 3E97A 3K7AJ 1YIOA 3QRFF 4XN3A 1TQMA 1V4RA 4N9HA 3VB2A 2XB5A 4C2UA 2FEZA 3BZCA 2A5WA 2Q0OA 5CVJA 4HQEA 2GM4A 2NVXJ 4JK1X 1G3WA 2DFIA 4MGRA 3S1MJ 3LSKA 4L9JA 1QNTA 2P5KA 4B09A 2WAQA 3LA3A 2X6WA 4KICA 2QVOA 1EKEA 2H27A 2HVQA 4M73A 1QA6A 1FYMA 3ISPA 3O8HA 3MFKA 2UV1A 2DDBA 1E3PA 2Y75A 5IP6A 1X1DA 4BKXA 1TWFJ 1U6GA 3BZ6A 1ZH5A 3E0JB 2DI3A 2DOFA 1TNTA 1I1SA 1H9TA 2AHQA 4BJ5C 2FNAA 2DCEA 5GADJ 4DYCA 1W7PA 4RB2C 1O7FA 3PQJA 3KP7A 5E8IA 3CMMA 2X6YA 2FBIA 4YFXF 3HBLA 5IP9J 3I59A 1JXSA 3S3MA 4ZC3A 1Y1VJ 4XR6A 4FX0A 1A04A 2VASA 2Z1DA 2K9LA 3MWMA 4XRSA 2P5VA 5D5VB 3LAJA 3ZQFA 2XGXA 4Y7NJ 3F23A 2DYRH 4MQ9F 4A69C 1FTZA 1FYKA 1P6RA 2AXTC 3S3OA 2VT3A 3G71I 1VQLI 1JTYA 2VXDA 3WTYC 1Y39A 1R49A 4XORA 1ACIA 5E8GA 5ILVA 1KU2A 1PVEA 3MD2A 4BAYA 3MZHA 3S17J 2MC3A 4WWCA 4IJAA 5TRDA 2O8KA 5F0CA 2R0QC 3BG5A 2HS5A 2HXIA 2JRMA 2QF7A 3V7SA 3VODA 3CUQA 3BR6A 4HX8A 2AXLA 3P9KA 2HOEA 2RVCA 1OCTC 3FXRA 4MTEA 3U1KA 4AYBA 1TT5B 1WJDA 1MIJA 5HVQC 4WX9A 3GTJJ 5L3EA 1GHCA 3OYCA 5EGOB 2VC1A 4ZTJA 1MMSA 1ETXA 3TW7A 1FJLA 2MGQA 3SDBA 4W97A 5HS9A 3TEDA 5FLVA 3W2VA 4L9VA 1P9QC 2AS5F 1ODDA 3T8TA 4S05A 4GRIA 4ZZLA 3RIRA 1LFUP 2XGEA 1Z3XA 1XPXA 4BQOA 3BDDA 5GAEJ 3J80Z 2MLGA 3DCFA 1WJAA 2DQLA 1WQ2A 3BR0A 1IN7A 3OIQA 2O8XA 3OYEA 3G1OA 1ETQA 3GCMA 3K0LA 1DQUA 3IL2A 1AWCA 4KYWA 2HKOA 3DKYA 3C3WA 4LMYA 4HBLA 2V1DA 3ZP5A 2OQGA 1GVDA 5DCMA 1ORKA 1HKQA 2X0LA 4DIQA 5E3OA 3AG3H 3ERMA 2DA5A 2O03A 1JGGA 3TOAA 3ZMDA 1R1TA 2CJJA 2DO7A 3QYEA 2WAQN 3F6OA 2JJ7A 2DBBA 1YRNB 1OCCH 1Z7LA 2XB0X 3HRUA 5J6XA 5M3FJ 4LIUA 3ECHA 1FOXA 5D5UB 3FHZA 3HL2A 4GYGA 3QAHA 1MH4A 5EJCA 3CO7C 1B8IA 1PYVA 3CMYA 4CICA 3BTJA 3IUOA 2J5OA 3KLNA 3JRHA 1R00A 1UAAA 3V4GA 3PSFA 1RKWA 1ZLJA 5E18F 5EDNA 3PJRA 4F3QA 5DM6F 3I4MJ 4P9UA 3V8LA 3LSIA 3OY9A 3WGHA 1P92A 2K3PA 2R4GA 2X4HA 1QVUA 3PIOF 1YE9A 1ZR2A 2JVGA 3OYBA 4OIQF 4NQWA 3WTSC 2XASA 5EZGA 3CP2A 3OS2A 3DV8A 3GFLA 2HOAA 3EUHC 4A3CJ 2E2HJ 1VQ8I 3A0HC 1STZA 1LVKA 1J75A 1B4AA 1X1PA 2CFOA 1CQTA 3K2ZA 1DPRA 1U5TC 4KNYA 1IJWC 1QZEA 1KYZA 2M0CA 1FP1D 3GVAA 3RTRA 4AM3A 5DUKA 4YIIA 3CF5F 1S7AA 1QQIA 4XRSG 3GZNB 2GIVA 1AKHB 1MJ9A 2VBZA 2A6HF 1R1VA 3BCAA 3E6MA 4V2FA 4BQNA 2HKXA 4ABZA 4M3GA 5CQGA 3TL4X 5M5XJ 3FX3A 1NG7A 2K4BA 2WY8Q 2W57A 5M5YJ 3IH4A 3I58A 1JGSA 3OR2C 5IP7J 3HZJA 2LBFB 2F2EA 1ZHFA 2XV4S 3DU6A 3SZPA 4BDYA 5BQTA 3LSPA 5IYDJ 3TW6A 5D5WB 1JHHA 4NC8A 3L2VA 5L3FA 2BVLA 2F5EA 2FE3A 5H2FC 1UG2A 3RCOA 1H9GA 4UVAA 2WB1N 2V9KA 2VI6A 4GCVA 2CUZA 3PNVA 4MO7A 4WXDA 4I0BA 3LSRA 1F43A 2I10A 1MNEA 3IH2A 1T0FC 2ZC2A 3EPZA 1BBYA 2M8GX 3DTIA 3BROA 1X3UA 3HHHA 1E2XA 3BPVA 2ZJRF 3GZ6A 2ECCA 5GAHJ 4BXXJ 4ENJA 2HZDA 3FBIB 2VBWA 5IY5H 2XAHA 2FQ4A 4LK0F 3RPUA 3H3ZA 5BPDA 2W25A 3ROUA 3CD6I 1JE8A 3BR2A 4XRMA 4UNOA 2QEXI 1IAWA 2X9DA 3NRVA 2NS0A 3DBLB 4UUSA 2HU9A 3WU2C 3ZQIA 2OC6A 3RKXA 4OIOF 3C1DA 3LQQA 4B3AA 4HF1A 4UV8A 1N77A 5LGUA 2WTEA 2M45A 1YI2I 1LFBA 1MMAA 1S7OA 2DTZA 1O57A 3H36A 2ZMEC 2CMPA 3JRGA 2JA6J 2DYSH 4XLNF 4ZDPA 4E7KA 2E1MB 1EJ9A 3TKYA 2PN6A 3M4OJ 1DP7P 4BY7J 4HDUA 1BC8C 1BW5A 4QIWN 3I0TA 2JUCA 2OF7A 1W5TA 1LNWA 2X1CA 1Y8RB 2QYOA 2TCTA 5LRRA 3FKIJ 2P6TA 3AG4H 1XMXA 1SFOJ 1TLHB 2XGDA 1MW7A 2ZJ2A 3JTGA 4LB6B 1S3JA 2OV7A 4EJOA 1X4PA 2R7UA 2BXYA 1JUMA 2ME0A 4L5JA 4EJVA 2LDUA 2WBMA 4IZZA 3P7NA 3MCZA 1YJNI 3HXLA 3A4CA 3CC2I 2EFPA 2L9NA 1VQ6I 2LR8A 3F8NA 3NARA 2E71A 3QODA 3D1NI 1BOBA 1T39A 1LDKB 1BA5A 2H09A 2OQRA 3F6VA 2E1OA 3J81K 3CDLA 4GYIA 3KYLA 3K4KA 3WTWC 3K4LA 1IG7A 4RS8A 3L2CA 3S2WA 5DEQA 1HXDA 2STTA 4R79A 4MQVA 1G3YA 3L2QA 5ICFA 3GF2A 4MEYF 4U88A 5CYVA 1MBGA 2EILH 3COAC 2P4WA 2V6CA 4PUSA 2LKXA 1G2HA 2YS9A 1FBSA 1X2NA 3JAMK 2XAJA 1ITYA 3EUHA 2R5YB 3ULQB 1KYWA 2A5YB 2LREA 1JTXA 4E7LA 1V5GA 3E5QA 4ITVA 4EJWA 5ILUA 2CQXA 3TO9A 5K5RA 1FIPA 1X2MA 1Y0NA 2MABA 4GO1A 3BY6A 1NH3A 2IS4A 5IPAA 4HOBA 4HV6A 3KEOA 2R7ZJ 1MNDA 5FO5A 3SZTA 4HNVA 1FP2A 4H0EA 2LVSA 1O3QA 1T95A 2XIGA 3H9JA 4N4OB 1AA7A 2MA3A 4L9TA 2GOMA 4BBRJ 5TISC 1B9NA 2R7WA 2QSGX 4J01A 2QM3A 2DJIA 5FD6A 5GPAA 4XNFA 4BQQA 2CV2A 4GGGA 5F08A 1G59A 3MVPA 1J59A 1JKQC 2A6TA 2VQGA 1A6QA 3C2HA 2VQCA 4M3DA 2E7XA 4BNCA 2OUMA 5GAGJ 2HEOA 4RGRA 1YITI 4OAYA 1WJ5A 3KIOA 4CA0A 4CGZA 4Q48A 1T56A 1RC9A 3RSNA 2V1UA 3KPHA 3BTCA 1OYYA 2R5ZA 1KQ0A 1ETVA 3M8FA 2VL8A 3BR5A 1GXPA 4IVNA 3KLOA 2F4IA 1MDMB 2ZB9A 5KAFC 3AKZA 1T0FA 4G6DA 3HGYA 3GTKJ 1Z7UA 4AIKA 2XAQA 1JT0A 4LK1F 2Z33A 1HDDC 1I5ZA 2GZWA 2P7CB 3K4JA 5J47A 5A2QK 4CO8A 2MG4A 2BW3B 4BUPA 2DK8A 3OYJA 3J7ZI 2A68F 2DW4A 2ZNZA 1YHQI 3QU3A 4YELA 3SEZA 4D0PA 2NYXA 1ZN2A 1ZQ3P 3Q0VA 4JBAA 1OJLA 2OCEA 4XLFA 2FD5A 4M9ZA 4KITB 4ESJA 2JK3A 3KFWX 5LLQA 5AIQA 1X1AA 4E6KG 1SMYF 1F5TA 2RNGA 2ZMEA 1Z0XA 2L3DA 4L9NA 3V42A 1PJRA 2QA4I 3HOXJ 5J4VA 2EA2A 5BS6A 1CF7A 4BHCA 2HOTA 2KPMA 3W6JB 2ELHA 1Z9CA 1HSJA 2A05A 1D8JA 1Z21A 2XDVA 2KISA 5CVUA 3JW4A 2HR3A 5J1RA 2Q2EA 2CQ7A 3VWBA 3FMQA 4BJ6C 1I3QJ 1YW8A 4IPAA 1FEXA 1EH6A 2FF4A 4F93B 2BYVE 4G12A 1WJBA 1VFCA 2EA4A 3F8CA 4U7DA 1XGMA 3HTSB 2HI3A 5B1AH 1R71A 5JHFA 2E1NA 2WAEA 1GV2A 2MW8A 3GZ5A 4C30A 4NC6A 1QGPA 4FE7A 3KEYA 3TDZC 3HOUJ 3DPTA 1BR4A 1U2WA 2LG4A 3B6CA 4IOAF 4ZYAA 5LGTA 3NWSA 3JCUC 2M1BA 3WG7H 4Z6YA 1GXQA 1BR2A 1ENHA 4XICA 2KZGA 3ESWB 3S2HJ 4IHWA 3DPUA 4RAYA 4UUVA 1B6AA 2K27A 4ESBA 4G7HF 3A0BC 4BY1J 2G9WA 2KHMA 3HC7A 4IHTA 3ZN1A 3BJOA 3DQVC 2KDZA 4RB3C 3ZRGA 3JSPA 2KQRA 4BQAA 3S32A 3BG3A 3IC7A 3O2PE 2VPLA 3FMSA 3OR1C 1UG0A 3OV8A 1SFXA 4MLOA 1K78B 1OCOH 1IF1A 1R4MB 4E7JA 2L7FP 1JJ6C 4K2EA 2DN0A 3CJTB 3GLXA 4MHGA 4BU2A 2O0YA 3BTLA 2PMZN 2XUBA 4Q5SF 2FXAA 4L5EA 5J40A 5D5XB 4IHYA 1JUSA 3C18A 3ABKH 1G3TA 2ISYA 2HGCA 2KKOA 5CLSA 4LLLA 1Q1HA 1YW9A 1JUPA 3Q5FA 1FMWA 3HOTA 3ZGKA 1WHUA 3FXJA 1S29A 2RC4A 3O3KA 4XKWA 1AU7A 1FSHA 2DK5A 3AL0B 1IUYA 2IAIA 2EPFA 2PG4A 4Y4RA 2W7NA 4KUMA 1RESA 2Y0SA 2LFBA 1XG1A 5D4SA 4J00A 4GXOA 3REOA 3ZMUA 2DJNA 3S1RJ 2L4MA 1V3FA 4ZJZA 3IV5A 1T8IA 1K4TA 3AFHA 2DTRA 4G9YA 2V79A 1J09A 1A5JA 4ZZDA 3HIFA 3GW2A 1SAUA 1UFMA 2IT0A 4YRVA 4EQQA 1I50J 1LVAA 3TP3A 5HLTA 4Z2YA 4ENMA 4A3LJ 4A3BJ 5JVGF 2ZFUA 1ZLKA 3GFJA 2NOGA 2JPCA 2L54A 1ULYA 2JT1A 4M3BA 3QOEA 3C2GA 4AIHA 2PMUA 1SD6A 2F5FA 4BBSJ 3HDDA 4D5CA 2PLYA 1A31A 1FYLA 4BL0B 4LOCA 1TQPA 1OCZH 2LNBA 3HOSA 5B66C 1ZR4A 2CGPA 1IV8A 2IGKA 3FK7A 1MBEA 3ASNH 4P1WA 1MKMA 5H6QA 5BNGA 3CTAA 3OMYA 4ON0A 2LD5A 2GWRA 3QQAA 1PP7U 2A3SA 1VQKI 1MD0A 4DZPA 4RGUA 2W85A 1XGOA 3IH3A 3JTHA 4PJNA 1FY7A 1XTAA 5JI6A 4S0HB 2XAGA 3KZZA 2HQAA 2VE9A 1G4DA 5CQEA 2QKLB 4YIFA 3I55I 2YX4A 3HUGB 3DWLE 4NNJA 5CKTA 5DD4A 4RLFA 1PDNC 4Q4ZF 6PAXA 4ESFA 2D5VA 4XK4A 3ZCOA 3IRQA 1K4SA 5ILSA 1EV7A 4MEXF 5F27A 3RI4A 1EH8A 3E6CC 2CYYA 3HOYJ 3RPUD 5TJJA 5FROA 1HDPA 3JREA 3OWTA 1B72B 1ETKA 3OYLA 4RB0A 5F04A 3FXUA 5EEAA 2VKEA 3RKWA 3V8KA 2IBDA 1D8KA 1ZGJA 3HB9A 3FXLA 4CSWA 1DU0A 1VQ4I 2E1MC 4ENNA 1XD7A 1D0ZA 1IRZA 2FMLA 1LPQA 2GXGA 3MKLA 1W1WE 3A01B 1EH7A 3M7GA 3HG9A 2EK5A 1T08B 3CDHA 4HQMA 2FBKA 2NNYA 2FOKA 1WJEA 2KRCA 4N9IA 4D1QA 5IT3A 1KONA 1HW5A 2E35A 3P9IA 2KRFA 5JVTA 2K85A 1IRGA 1XSXA 5LHHA 1IZ1A 3JRFA 1YO5C 3DBRB 1K79A 3IAS2 5C4XJ 3BPXA 4HRIA 2G7HA 4RA2A 4CH7A 4CCLA 2Y0SN 5E1WA 3ZMVA 4M6XA 2V1XA 3K1NA 2Y9YA 1KZHA 2RNJA 2KT0A 3VFZA 2V1NA 3SJMA 3OYHA 3RQ4A 2DA3A 1WFXA 3ASOH 4EATA 1QU3A 3OL3A 1VZ0A 4OMYA 3TOBA 4ETSA 1XGNA 3J7AO 3OYGA 1H0MA 5CJ9A 1ETWA 3JRBA 4XQFA 2AQEA 4XLPF 4MFEA 4P5OA 2O61A 4EJUA 1EF4A 2EH3A 2FMYA 2O9LA 4G6TB 4E7SA 3ABUA 2M30A 2IS6A 1SD5A 2E34A 2ELJA 5D8LB 3MKWB 1TWHJ 4JYKA 2XVCA 5LEKA 1W5SA 4GDFA 2FUG2 2WC2A 3KETA 3BJ6A 3SFZA 4GFBA 5BOXA 3BP8A 2HDDA 5K7ZA 1XS9A 4A3FJ 2D2WA 2BZTA 1RI7A 3HSEA 2UWMA 4F92B 4I02A 2VJ5A 1C0WA 1U3EM 2JPBA 2WB1A 2W00A 4BXFA 2NNNA 2OAZA 4RGXA 2JTVA 1D1CA 3K1PA 4KJZA 4QPOA 4I6ZA 3OYIA 2NXNB 3GTPJ 1OYIA 3FK6A 4NDLA 3Q9SA 1FT9A 3I59B 4LFUA 3CZ6A 1YS6A 3WTUC 1IN4A 1GT0C 5E3NA 5IYCJ 2EIMH 2JWTA 1RR7A 5DDGA 3J7AY 1P2FA 2EZIA 1I3AA 4A3MJ 1ZG3A 1PUFA 3ELKA 4XL9A 1IUFA 2CS3A 3E3VA 4ZTFA 4AD9A 4XSZF 4DBQA 3CJQB 2ID3A 2KLOA 4LG0A 1QVTA 2J5PA 2BOLA 1TP4A 3K69A 5KAIC 4C3HJ 2B63J 2L9VA 1F9NA 3MEXA 5BPIA 2MD5A 4WXCA 2PX9A 2X1DA 3CUQB 2LBFA 3MN2A 5IT9Z 1HW1A 3HJEA 4LLNA 4Q47A 2EWNA 2K9NA 4CCKA 3MKYB 2Y0MA 1REPC 4M3EA 2IP2A 3G1LA 2VOPA 2EFNA 1X3ZB 4PJLA 2A6EF 3FBNB 1BM9A 4KIGA 3QP5A 4YFKF 1RIOH 2NVYJ 3I9V2 2GIZA 1O3SA 2DT6A 4XN0A 2EIJH 3IKTA 1F36A 2XF5A 5EZHA 2IA2A 3HOWJ 2L7KA 1Y0UA 5ICCA 3HRSA 5DTDA 1YIJI 4N4NB 1MSFC 4ZH4F 2TDXA 2GA2A 2XRLA 4JQFA 4KN4X 1HSTA 2GLOA 3H5RA 3FIWA 4PGHA 1TT0A 3TO6A 4QLCU 1LEBA 2VODA 3TGNA 5E1XA 1UB9A 3W6KB 4PZJA 1HQCA 2EIKH 4UVBA 5DV5A 5DCMB 1WCMJ 1RR8C 1FOWA 3N97A 5DCFA 5F1JA 2BE5F 4R8HA 3O6BB 2ECBA 3HEFA 4Y13A 4B48A 3GTQJ 1R58A 2CRGA 1V54H 1FWZA 2ZXJA 4CCOA 4CDGA 5FLXZ 1IDYA 2XHKA 2OPTA 4AU7A 1BIBA 2FA5A 3BJAA 3KP4A 2LY2A 5J3LA 2FRHA 1HBXG 2H1LA 1RKTA 3TDUC 1VNDA 4HAMA 3S16J 4N0BA 5HNFA 4A3JJ 3KZYA 5JHUA 1B8IB 1TWGJ 4IQ4A 2ZFWA 1I27A 1R22A 5H6RA 2HQNA 4LG3A 5L3GA 5HS8A 2OCCH 2X6OA 3FM3A 3AAFA 1SEUA 2K4JA 4IL6C 3VOEA 1XMAA 5K5QA 2E19A 2VKHA 2KP6A 3ZMSA 1RUNA 2IVMA 1D0YA 5EF6A 2F6CA 4EEFG 1N75A 4OIRF 1WSUA 1MZBA 2PJRB 4HA8A 5F1RA 5FKOA 2E2JJ 4RLQA 3CMEI 2JA8J 1P7IA 1SVOA 5C3EJ 4HF2A 4UUTA 5HLIA 3CCJI 4I76A 4FCYA 1LDDA 3IAM2 4NQWB 3HPGA 2JN6A 2L7ZA 1LKXA 2R7RA 1FOYA 1XN7A 2E36A 1T2KA 1Z6RA 3ZQHA 1A6IA 2IW5A 4HLYA 2P6SA 3OIOA 2CWEA 5E1ZB 2K9SA 2HZTA 1SD7A 4R1HA 3OYKA 4KIBA 3L7WA 3R4KA 3BZKA 1S6LA 4M71A 1N78A 4BE2A 4L5IA 3KZIC 2LF7A 3KP3A 2BHYA 2QLZA 5J1YA 2YR2A 2XROA 1BL0A 2FOWA 2NRAC 1HC8A 2EQRA 2GOXB 1HOMA 1IXSB 5M5WJ 2VT2A 4JP0A 2X1EA 3NAUA 5K7HA 2WV1A 2DOAA 2HTSA 2LMDA 3BWGA 3I64A 1RNLA 2LF8A 2QQAA 2HVRA 1Z91A 2OJED 4E70A 4PDKA 5H20A 2QSHX 4BEHA 2F48A 1ZTRA 3ONQA 5FJ8J 1GLNA 1FBQA 1U9NA 1IV6A 3KE2A 3G4SI 5KHDA 2R7QA 2Q8KA 4U7BA 2IPQX 3CESA 2YSRA 1ZYRF 3WHCA 3E5XA 4PCQA 5IOYA 3JRCA 2W84A 2IGMA 3PNYA 2VQHA 3QWLA 1IRXA 4TV7A 1MNMC 2IRFG 3LMMA 3ZQCA 3AL0C 4DJAA 3MZYA 1X3WB 4NB5A 1F1ZA 1SVMA 2OZ6A 3E6DA 3J80K 2EFOA 2IGOA 4D7NA 2JSCA 5KNLA 3GXOA 2L02A 4Y3OA 1P4XA 2W24A 3CP8A 3LSJA 1IRFA 1QZYA 3K2AA 2WA0A 3T8RA 4BS9A 3K9TA 2LRDA 3L2WA 1LE8A 2RQPA 2IGNA 2L7MP 2QQ8A 3W2WA 2A69F 3WTVC 4YEJA 4XBFA 2NS7A 2OTJI 2F5VA 5J1UA 4UUSB 3SZGA 2HWVA 2ZXHA 3NEUA 4A6DA 1WJFA 2R7VA 4U87A 2FBHA 2DFHA 2I8DA 3HPHA 2O3FA 4RDUA 2QQBA 1B9MA 1BI0A 4M3FA 4WK8F 1WKMA 1W4MA 4I09A 4PGGA 1BOAA 5LFAA 1Y6IA 3PO3J 3PFYA 1U5TA 4HNUA 1JJ8C 1OMIA 2K86A 2QUFA 1ZG5A 2RV8A 4XLEA 5CVVA 1BI2A 3VYRB 3SHFA 4C3JJ 1BJZA 4LJZF 4IHSA 1ETYA 1MMNA 3SFIA 1WRJA 4U0VA 4PJMA 3LOCA 2M4KA 4XIDA 3CC7I 4A93J 3UR3C 1YYVA 4C2MJ 5FLMJ 1ZKGA 4B1RA 1MJAA 1NHAA 5E3MA 2C6YA 5HDKA 1FTTA 2Z99A 3V7CA 2KMUA 1ZK8A 1W36D 2RN7A 3F8BA 4LLGF 3PL8A 3ZQLA 4FASD 2LYCA 1X58A 2V7FA 3S8PA 2GXAA 1XCBA 2K9MA 3Q9VA 4MTDA 1I6HJ 1HKTA 3ZR8X 1W5CC 4HX7A 1NK3P 1B1BA 3FKJA 2KJBA 3VPRA 1O7LA 3SEQA 4DYQA 3CCRI 1XSDA 3GTMJ 1K83J 5HNHA 1IW7F 2K02A 4UB8C 3C7JA 3TQNA 4UV9A 3QP6A 1WGXA 2MSYA 3SYTA 5ICEA 4II3A 3JSOA 3HGGA 4KT5C 5K5OA 1V5FA 1W7PD 4M72A 3FXQA 2PMZA 1YTYA 4JOMA 1IO2A 4NUBA 5EEHA 5ERIA 4KA4A 2ZNYA 1TW3A 3WGIA 2NOJB 1J5YA 1FX7A 2VPRA 3E1SA 3GMEA 2JMWA 2VJJA 1YQAA 3K6GA 3PM1A 3M8EA 2JQ7A 3FXOA 1HLVA 2OD5A 1ZRDA 1Q1VA 3V7RA 2QBYA 4CYCA 3IWFA 2H6BA 5CPRB 1MGTA 2BY3A 2E5NA 3WHBA 3H1CA 3QPLA 3QYBA 3OOPA 1WJCA 3I71A 5J8FA 1MBHA 2X48A 2KIFA 2XF7A 2XGCA 1W0UA 2O5RA 3H5NA 2JA5J 1X1CA 4P9FA 4A0XA 1XX5A 4LD5A 1BC7C 1M1EB 1MJBA 1OYWA 1FMVA 2AO9A 2ESHA 2VC0A 4RM3A 3A02A 3F21A 2HFHA 1OFCX 3J7YJ 2MH9A 2QKMB 1ON1A 1YG2A 2AQFA 2LLKA 2ZO4A 5EEGA 2ICWG 1QHHD 3TP0A 2GQQA 3AG2H 1XSVA 2YUSA 3KEQA 4WXHA 5F0FA 4EM2A 2PJPA 3CCLI 3M3YJ 1BIAA 2P7VB 4I7HA 4RAGA 2BBYA 5LEJA 1D5YA 3O8GA 4KT6A 2R7DA 4EV0A 2R92J 4BGDA 1DUXC 2HQ5A 3H5AA 2P5LC 3OS0A 3DU5A 4HSTA 2UXXA 3R0JA 1E3OC 2BY1A 4DOZA 1FBUA 1FC3A 2Y30A 1ZAOA 4XLCA 2L01A 2R5ZB 3SQNA 1USTA 3P5JA 2VIXA 2X85A 1TW2A 2KFDA 1G6NA 1X4OA 1RETA 3BG9A 4ZYEA 2HDWA 2M87A 1MSEC 5FFZA 1MMGA 2DPUA 3CC4I 1SVLA 4FHTA 1S8NA 3F9KA 1G3SA 2M8EA 2K9QA 4KFCA 2ACJA 2LH9A 4B8XA 5LHGA 5EYRA 2DLLA 4KISA 2RQQA 4FETA 3LNQA 4RAZA 2CU7A 2XPVA 3RKYA 1XC5A 4A0YA 4CXFA 2CUEA 3F0CA 4IO9F 2G7UA 1DGWY 3FM5A 4E7ZA 1U0JA 5JR3A 4Y52J 2RREA 3OIPA 4DGWB 5EG0A 2ZBKA 2ZXIA 5GTIC 3ABLH 5HLHA 4IX7A 1ONVA 4IHXA 1Y56A 1A35A 2K40A 1FOKA 4IKFA 3D5RC 3FF5A 2DA7A 1FLIA 1I6XA 2ZMEB 4E7IA 2L2OA 4AIJA 4LIVA 3RYRA 2IS2A 2Q1ZB 3S93A 5DS9A 2CUFA 1FSEA 2TRTA 3GEZA 1VF9A 3DEUA 2R7XA 4CCMA 4HG2A 4AUXA 1Y1WJ 2M4GA 3HKZN 5DYMA 1YJWI 2CQQA 5F6FA 5B3SH 3IKVA 3HHGA 2K7LA 2Q2EB 1APLC 1WVRA 4M6VA 3K70C 3CDIA 3HTUA 4XRFA 2B9SA 4D5FA 2QZ8A 3I56I 4DYRA 1GUUA 1YFHA 2Y48A 2PMHA 3H9GA 3ZQQA 3W3CA 3D0SA 5FKNA 2COMA 2MFZA 1HF0A 1R36A 1S72I 3DEWA 5FKLA 1K6OA 3A03A 4OIPF 1D1AA 3B73A 4HSRA 3GTGJ 5BMZA 2R7OA 3H35A 3NWTA 4Y17A 5FKMA 1LB2A 4PFOA 3T5XA 3ZQGA 4ZYGA 2IA0A 3CJRB 3RQIA 4ANJA 1XCVA 4Y15A 2LKSA 3TMOA 4OWRB 2JA7J 4FT8A 1S7EA 1WH7A 2BV6A 2XRNA 3L2RA 3N4MA 3R60A 1IXRC 1R23A 1E3HA 2E7WA 2VB6A 1OPCA 4G8XA 4A3DJ 1R5ID 1JKRC 5K1YA 1CGPA 3S14J 2BY0A 2CW0F 1ERDA 2EV5A 1BR1A 4L0YB 3G73A 2LK2A 5D6FA 4HEA2 3FISA 1LJ9A 2BY2A 1IDZA 1ZGWA 4HF0A 1R5GA 1L0OC 1Z05A 2RKHA 1SFEA 3JRAA 1G8XA 2DMPA 2BVMA 4D9JA 1WI9A 4G7OF 4AC0A 1PP8F 3JR9A 4CCNA 2JRTA 3PSIA 4J19A 1KU9A 2MD0A 2QCOA 5D6EA 4FISA 1R9TJ 3HRTA 1XB4A 4HV5A 3W2AA 3ABMH 2NVTJ 1D5VA 5L3DA 2OTLI 3KYCB 5EGOA 3S1NJ 2ZCWA 3RZOJ 2F4OB 4ENKA 2CFXA 1OCPA 1U8BA 3GLLA 2DODA 2ESNA 1ZGAA 4II2A 4A3IJ 2HVSA 2EV0A 2A07F 3BG6A 1TZLA 2EV6A 1KU3A 1QHGA 2KIMA 2XC7A 3EQLF 1RPWA 3CLQA 3DPLC 3F8FA 3QPSA 1NG6A 1BW6A 1D3YA 4YFNF 2Y9ZA 3M07A 3I5UA 4JX5A 1ZG1A 1VI0A 1Y8QB 2B0LA 5IYBJ 1E0EA 3OYMA 2ETHA 2VN2A 2Z5UA 4B4CA 4EMSA 1HKSA 2H6CA 4C9YA 1YRNA 3I54A 5FFXA 5GTHC 2R7SA 5GP9A 1X19A 3WU1B 3LSHA 1P4AA 4V19K 3RJPA 5K7FA 1KA8A 3DLAA 3QPTA 4I99C 1RUOA 2EFQA 2ZSIB 4BYYA 5GPCA 2Y2ZA 3FZVA 3K4NA 2R93J 4BE1A 5FKKA 1SMTA 4XOTA 1JKPC 3CCEI 3CUOA 2RDPA 1K7AA 4BH9A 3NQOA 4L18B 2E5ZA 1WI3A 3PNTA 2UUZA 2F4MB 3L2UA 2HXOA 3F22A 3K4BA 1JT6A 3GUDA 3BTIA 3OYNA 1Z1DA 4YIRX 5F0HA 2A61A 2HYGD 4NHJA 1W0TA 5HOOA 4IOCF 3EETA 2CG4A 1YLFA 2LY1A 1W7PB 5E17F 4A2UA 3CJNA 2P81A 2R3SA 2VKVA 3DLLF 2W1OA 3I3LA 2PQ8A 4LITA 4UXNA 3E5UA 4M9XA 4UB6C 3L1PA 4HYEA 2E1CA 1OKRA 1H8AC 1GDTA 2VQLA 3CCVI 2R7TA 1T33A 4IRHA 2DA4A 4NBQA 2DAOA 2UXNA 2VJ4A 1UHSA 5J4YA 4C2TA 1J9IA 1AOYA 3PIPF 1QBJA 4H4KC 1AKHA 1WWXA 2XKPA 1Z67A 2F5CA 3PUFA 1TWAJ 4RB1A 3BCBA 3J81Z 2HPMA 1UELB 3H3VK 1A36A 3K4CA 1T38A 9ANTA 3E7LA 4ZYDA 1P7JA 3MZ8A 2VONA 2Z16A 4BHPA 2JSPA 2BHZA 2XF6A 4A0ZA 3U1DA 5M3MJ 3EDPA 1YX3A 2MYSA 3JAMZ 3A2KA 4Y33A 2I5UA 3X2QH 3HYIA 4O3MA 4HZFA 3K10A 3BR1A 4BACA 2H94A 1QZZA 1TL8A 1LEAA 2WWYA 1BN5A 5F64A 1MBJA 3U21A 4JX6A 2OBPA 1VQOI 1MMDA 1O3TA 2H8RA 3DKXA 3VSKA 3CCQI 1FNNA 4OOIA 4B47A 3CCYA 4UHTA 2LTPA 4UY8I 1POGA 3CCSI 2KDOA 1R7JA 4EM0B 2PJRA 4DW6A 1DGRM 3LSGA 4BJTA 1K6YA 3IP4B 2FSWA 3QU6A 2DA1A 3WTZA 2W48A 2EZLA 3GYHX 3RKQA 2WADA 2E60A 1NTCA 2RAEA 2MC4A 4IQJA 3M9AA 5L3BA 1TC3C 4WCGA 2O7OA 2YPRA 1YS7A 2K3FA 1GVJA 4DQ2A 1XMKA 3VYTB 3FXMA 3IWZA 5D8KB 4ZDLA 4U0WA 4CZZA 5KCMA 4YG2F 1H89C 3M1CA 4QPQA 2DMUA 2CSOA 2QGUA 3ML6A 1SC7A 4PSXA 3G3ZA 5D4RA 1PUFB 2ZJPF 2OZUA 2Z9OA 4PK4A 2IA1A 2XSDC 4MNUA 4AYBN 3OYAA 4LG0B 1P4WA 2PFBA 5CVRA 3ECOA 4U0YA 1IN5A 3CCMI 2EINH 3SXYA 2IEKA 3LFKA 4PJJA 2COBA 1ZELA 2K5CA 2EB7A 1VQ5I 2LC2A 4A12A 2FU4A 1OISA 1ZREA 2DMTA 1LQ1A 5A2QZ 3JRDA 1JHFA 2GBYA 2D45A 4DBRA 4XKVA 3CLOA 1LUJB 4FX4A 3MAJA 4G6QA 4AVPA 2XPUA 3I4NJ 5AONA 3OSGA 3GO5A 4I01A 5HDGA 3S3NA 2BGCA 2DMNA 4IEJA 2NAZA 2ZKZA 1MH3A 4X1EA 2DT5A 5DUIA 2DFEA 2XPWA 4RGSA 3UNGC 4A3EJ 1V5EA 1OR7C 2X6XA 1L3LA 2L5QA 4MFDA 2ISZA 3Q0WA 2FJ1A 2LY9A 3QYFA 1K61A 3G2BA 3LWFA 2NVUB 3DEEA 4HW0A 3VSLA 4HDVA 3D5SC 3FXKA 5C44J 5LD2C 2RGVA 1YJ9I 3M8JA 3ZN0A 3C2BA 2Y69H 4BE0A 1YX5A 3PQKA 2FX0A 3S15J 1OCRH 1YW7A 2WV0A 2M7AA 2IXSA 5JLXA 3TO7A 3EUKL 3FHNA 2L9RA 1TQIA 4RBOA 3L09A 1H88C 2M3AA 1F4KA 2R5YA 2JUGA 4E4HA 5E79C 3RPQA 1UHWA 2ME6A 1LFPA 4FQGA 2MLKA 3RDIA 4AVZA 3GFIA 2O6GE 4DNCA 2LKPA 3QOPA 3V8JA 3ERED 1SFKA 1HW2A 3F8MA 2L4AA 4O6JA 4FE4A 3WTTC 5E20A 3GFMA 3DTEA 3WU0A 2CQNA 3QPHA 4RAFA 2BEOA 2VJIA 4KMFA 1R4NB 2FQ3A 3KP2A 2XAUA 5ED4A 3Q3SA 1O3RA 1ON2A 2OU2A 2XKOA 3R6SA 3IHUA 1ETOA 1DP3A 4XM3A 4QTRA 3LA2A 3BLYA 1IN8A 2CO5A 4A3KJ 2DOEA 4A5MA 1IC8A 1IXCA 2EZHA 2CW7A 3DFGA 5DD8A 2G0EA 2ZSHB 5HLGA 3UKGA 4HPQA 1UJ8A 3I4PA 4F7ZA 2DPDA 2VXZA 4NC7A 1X1BA 1J0RA 2KIQA 4W1UA 4M6YA 2M2EA 3FDYA 3LQRA 2EBIA 3D5LA 3M1EA 3U2RA 5LRSA 1DDNA 4OU0A 2KL4A 3WTXC 1MDMA 5CVIA 4KDPA 3P9CA 4I98B 4RMNA 1WZ2A 3ABTA 4O5VA 4A5NA 2GAUA 4UVCA 4A6EA 4DZJA 4CZCA 5KK1A 3DBHB 2V9PA 4HNTA 1U8RA 3MMYB 3TBIA 1BJAA 3F3XA 2BW3A 3GTLJ 1XDSA 2V9VA 5IT9K 5L3CA 2W82A 2V4JC 4BEHB 4E7HA 1O4XA 4A3GJ 2VKDA 2QSFX 3HOVJ 1HCRA 5J8CA 3LFUA 4M74A 1VQNI 3DKWA 1T98A 2KRHA 2PI0A 4P96A 4L0ZB 4XKBA 1BI1A 1Z77A 2V26A 4BXUA 3EYIA 2L0KA 4KN7X 2Y31A 3DTKA 4EGYA 1TNSA 3VDXA 2DA2A 4AIDA 1I1GA 4I2OA 3DF8A 2M34A 3HSFA 1V55H 2VE8A 4OINF 3VYUB 1E17A 2PEXA 2M9HA 4MIMA 4B44A 2HQRA 4XOPA 1OLTA 5FRMA 1RZ4A 3BG7A 1DPUA 2D1HA 3OS1A 2FNPA 1I39A 3AG1H 3F72A 4X6AJ 5LGNA 5HDNA 4QSHA 2WY7Q 1LE8B 3A1YA 3H92A 4F52A 2MH2A 4QWQA 2KZVA 1VQMI 2P8TA 1TBXA 3FMRA 1ZRCA 2EJRA 5FLXK 1D0XA 3H9QA 3KP5A 3WGGA 3ZPLA 3LAPA 5HS7A 2IJLA 3BQYA 5ICGA 2JZYA 3H0DA 1SAXA 1S9HA 4IXAA 3W6VA 5LHIA 3HKZA 1Z3YA 3PUBA 1SANA 1J2XA 2WAFA 3ZMZA 1FZPB 4XONA 3GTOJ 1OR7A 3PFIA 5AIPA 1B59A 4S04A 2N8GA 1U5TB 3JRIA 1D1BA 3G6EI 3KP6A 2VBXA 5FD5A 2D1VA 4XLHA 3WODF 4CUGA 2IS1A 5TGTA 1KGSA 3RYPA 3PO2J 4FTHA 1W36C 4JX4A 2DFFA 3EYYA 2BXZA 2P0WA 1R6RA 3BC8A 1DU6A 1USSA 1VQ9I 3DP7A 3LL7A 2VOOA 2F5DA 3T0YA 3ZMTA 1KU7A 2MBFA 1YOVB 3RZDJ 4EVIA 1VTNC 4B43A 1J7KA 4IHVA 3L00A 3KYDB 2EZKA 2HDCA 5JFRA 5KVRA 4P55A 1K78A 1UCRA 3CQZJ 3GWZA 2CUJA 3MQ0A 3WG9A 5FRNA 1FIAA 1MBKA 1WH5A 1KQ9A 2M0MA 3HRMA 2ID6A 4PFPA 3OYDA 2DU9A 3U9GA 2B7EA 2HYFA 2DXIA 3R61A 2HNHA 3S2DJ 2HPIA 2KIUA 2XSJC 4OAZA 4G7ZF 4LB5A 2NS8A 3OL4A 3LSMA 2JVHA 3CMAI 4IRIA 3LSTA 2CV1A 2QENA 1JI8A 1QO0D 2QQ9A 2UZKA 4V2GA 4XSXF 2CV0A 5DM7F 3BR3A 1WPKA 3CCUI 5B1BH 3E6BA 4ASNA 1IN6A 3B6AA 1JKOC 4I0AA 3BQZA 1U78A 2LOOA 4B3XA 1FPQA 3DXJF 3R0AA 2M5WA 4ZDOA 2ADUA 3K70D 2DQRA 1T6SA 2XAFA 1QPMA 4KMUX 3OYFA 1S5LC 2QBYB 4CYCB 4IRGA 3CUQC 1LDJA 4XLAA 2ZXWH 5IOZA 1Z6TA 2DA6A 1R5HA 2E2IJ 1VQ7I 5FB2A 3FWEA 3T1BA 3WE3A 2ZJQF 2L9SA 2DT7B 2YU9J 4CYDA 1N25A
chains in the Genus database with same CATH topology
3K1MA 2HTJA 2GA1A 1PUEE 4LGWA 1ZRFA 1R1UA 5LBQA 4HLXA 1CF7B 2STWA 3H3UA 4EM1A 1UHMA 3VEPA 4BHBA 2OA4A 3HUGA 4EJTA 4OMZA 4EGZA 3LA7A 2PBIA 3BOQA 2VBYA 1BI3A 4G94A 3B02A 4M9SA 2CQKA 3IRRA 4AWXB 4ZYHA 3WE2A 2YU3A 1XGSA 2KJCA 2EFWA 3KCCA 3GX4X 1TTYA 2QWWA 4HX4A 2R7FA 1ZARA 5FGMA 4WF2A 3ZQ7A 1XDUA 2GXBA 2Z3YA 3I53A 3HSRA 3CO6C 2YX7A 4CHUA 1SFUA 1SD4A 1KQ8A 4KIFA 4IF4A 2LSOA 3L9FA 3E97A 3QRFF 1YIOA 1TQMA 1V4RA 4N9HA 3VB2A 2FEZA 2Q0OA 5CVJA 4HQEA 4JK1X 1G3WA 2DFIA 4MGRA 4L9JA 1QNTA 2P5KA 4B09A 3LA3A 4KICA 2QVOA 2H27A 4M73A 1FYMA 3ISPA 3MFKA 2Y75A 1U6GA 3BZ6A 1ZH5A 2DI3A 1TNTA 1I1SA 1H9TA 2FNAA 1W7PA 4RB2C 1O7FA 3PQJA 3KP7A 5E8IA 2FBIA 4YFXF 3I59A 1JXSA 4FX0A 1A04A 3MWMA 2P5VA 5D5VB 3LAJA 2XGXA 3F23A 4MQ9F 1FYKA 1P6RA 2VT3A 3WTYC 5E8GA 5ILVA 1KU2A 4BAYA 3MZHA 2MC3A 4WWCA 4IJAA 5TRDA 2HS5A 3V7SA 3VODA 3CUQA 4HX8A 2AXLA 3P9KA 2HOEA 2RVCA 3FXRA 4MTEA 4WX9A 5HVQC 5L3EA 1GHCA 2VC1A 5HS9A 4L9VA 2AS5F 1ODDA 3T8TA 4S05A 4ZZLA 3RIRA 3BDDA 3J80Z 2MLGA 2DQLA 1WQ2A 1IN7A 2O8XA 3K0LA 3IL2A 1AWCA 4KYWA 2HKOA 3C3WA 4LMYA 4HBLA 2V1DA 3ZP5A 2OQGA 5DCMA 1HKQA 2X0LA 2O03A 3TOAA 3ZMDA 1R1TA 2DO7A 3F6OA 2DBBA 3HRUA 5J6XA 3ECHA 5D5UB 3FHZA 4GYGA 3QAHA 3CO7C 4CICA 2J5OA 3KLNA 1R00A 3V4GA 1ZLJA 5E18F 4P9UA 3V8LA 3WGHA 1P92A 2X4HA 4OIQF 4NQWA 3WTSC 2XASA 3DV8A 3GFLA 1STZA 1J75A 1B4AA 3K2ZA 1DPRA 1U5TC 4KNYA 1KYZA 3GVAA 1FP1D 3RTRA 5DUKA 4YIIA 1S7AA 1QQIA 2GIVA 1MJ9A 2VBZA 2A6HF 1R1VA 3E6MA 2HKXA 3FX3A 2K4BA 2W57A 3I58A 1JGSA 2F2EA 1ZHFA 2XV4S 3SZPA 5BQTA 5D5WB 1JHHA 5L3FA 2F5EA 2FE3A 1H9GA 4UVAA 4GCVA 4WXDA 4I0BA 1BBYA 3BROA 1X3UA 3HHHA 1E2XA 3BPVA 3GZ6A 4ENJA 2VBWA 2XAHA 4LK0F 3RPUA 3H3ZA 5BPDA 2W25A 3ROUA 1JE8A 4UNOA 1IAWA 3NRVA 2NS0A 3RKXA 4OIOF 3C1DA 3LQQA 4HF1A 4UV8A 5LGUA 2WTEA 2M45A 1S7OA 1O57A 4XLNF 3TKYA 2PN6A 1DP7P 4HDUA 1BC8C 3I0TA 1W5TA 1LNWA 2QYOA 5LRRA 2P6TA 1TLHB 2ZJ2A 3JTGA 4LB6B 1S3JA 4EJOA 4L5JA 4EJVA 2LDUA 3P7NA 3MCZA 2EFPA 3F8NA 1T39A 1LDKB 2H09A 2OQRA 3F6VA 3J81K 4GYIA 3WTWC 4RS8A 3L2CA 3S2WA 5DEQA 1HXDA 2STTA 4R79A 4MQVA 1G3YA 5ICFA 3GF2A 4MEYF 4U88A 5CYVA 3COAC 2P4WA 2V6CA 3JAMK 1FBSA 2XAJA 3EUHA 3ULQB 1KYWA 2A5YB 3E5QA 4EJWA 5ILUA 3TO9A 5K5RA 4GO1A 3BY6A 4HOBA 4HV6A 3KEOA 5FO5A 3SZTA 1FP2A 4H0EA 1O3QA 2XIGA 2MA3A 4L9TA 1B9NA 2QM3A 5FD6A 4GGGA 1J59A 2E7XA 4BNCA 2HEOA 4RGRA 4CGZA 4Q48A 2V1UA 1OYYA 1KQ0A 3M8FA 1GXPA 4IVNA 3KLOA 1MDMB 1T0FA 4G6DA 1Z7UA 4AIKA 2XAQA 4LK1F 2Z33A 1I5ZA 2GZWA 2P7CB 5A2QK 4CO8A 2DK8A 2A68F 2DW4A 2ZNZA 3QU3A 4D0PA 2NYXA 1ZN2A 4JBAA 4M9ZA 4ESJA 3KFWX 5LLQA 5AIQA 1SMYF 1F5TA 2ZMEA 2L3DA 4L9NA 2EA2A 5BS6A 1CF7A 4BHCA 3W6JB 2ELHA 1Z9CA 1HSJA 1D8JA 5CVUA 3JW4A 2HR3A 2Q2EA 3FMQA 1YW8A 4IPAA 1EH6A 2FF4A 2BYVE 2EA4A 3F8CA 4U7DA 1XGMA 3HTSB 2E1NA 3GZ5A 1QGPA 3TDZC 3DPTA 1U2WA 5LGTA 2M1BA 1GXQA 4RAYA 4UUVA 1B6AA 2K27A 4ESBA 4G7HF 2G9WA 4IHTA 3ZN1A 3BJOA 3DQVC 4RB3C 3JSPA 4BQAA 3IC7A 3O2PE 3FMSA 3OV8A 1SFXA 1K78B 1IF1A 4K2EA 4MHGA 3GLXA 2O0YA 2XUBA 4Q5SF 2FXAA 5D5XB 3C18A 1G3TA 2ISYA 4LLLA 2HGCA 2KKOA 5CLSA 1Q1HA 1YW9A 3Q5FA 3HOTA 1S29A 2RC4A 3O3KA 1FSHA 2DK5A 1IUYA 2PG4A 4KUMA 5D4SA 4GXOA 3REOA 3ZMUA 2L4MA 1V3FA 2DTRA 4G9YA 2V79A 4ZZDA 3HIFA 3GW2A 1UFMA 2IT0A 4EQQA 1LVAA 4Z2YA 4ENMA 1ZLKA 3GFJA 2JPCA 2L54A 1ULYA 2JT1A 4AIHA 2PMUA 1SD6A 2F5FA 2PLYA 1FYLA 1TQPA 3HOSA 2LNBA 2CGPA 5H6QA 1MKMA 1PP7U 3CTAA 4ON0A 2GWRA 2A3SA 1MD0A 4RGUA 2W85A 1XGOA 3JTHA 5JI6A 1FY7A 2XAGA 3KZZA 2VE9A 1G4DA 4YIFA 2YX4A 5DD4A 1PDNC 4Q4ZF 6PAXA 4ESFA 3IRQA 5ILSA 1EV7A 4MEXF 3RI4A 1EH8A 3E6CC 2CYYA 5TJJA 4RB0A 3FXUA 3RKWA 3V8KA 1D8KA 1ZGJA 4ENNA 1XD7A 2FMLA 2GXGA 1EH7A 3M7GA 2EK5A 3CDHA 4HQMA 2FBKA 2NNYA 2FOKA 4N9IA 5IT3A 1HW5A 3P9IA 2KRFA 5JVTA 1IRGA 1XSXA 5LHHA 1IZ1A 1YO5C 1K79A 3BPXA 2G7HA 5E1WA 3ZMVA 4M6XA 2V1XA 3K1NA 2RNJA 3VFZA 4OMYA 3TOBA 4ETSA 1XGNA 3J7AO 1H0MA 5CJ9A 4XLPF 4P5OA 2O61A 4EJUA 2FMYA 3ABUA 2M30A 1SD5A 5D8LB 2XVCA 5LEKA 1W5SA 2WC2A 3KETA 3BJ6A 3SFZA 5BOXA 3BP8A 2D2WA 3HSEA 1RI7A 2UWMA 4I02A 1C0WA 1U3EM 2JPBA 2NNNA 2OAZA 4RGXA 2JTVA 3K1PA 1OYIA 3Q9SA 1FT9A 3I59B 4LFUA 1YS6A 3WTUC 1IN4A 5DDGA 1P2FA 1ZG3A 3ELKA 3E3VA 4AD9A 4XSZF 4LG0A 2J5PA 3K69A 1F9NA 3MEXA 5BPIA 2MD5A 4WXCA 3CUQB 5IT9Z 1HW1A 4LLNA 4Q47A 2EWNA 1REPC 2Y0MA 2IP2A 2VOPA 2EFNA 2A6EF 1BM9A 4KIGA 3QP5A 4YFKF 1RIOH 1O3SA 3IKTA 2IA2A 1Y0UA 5ICCA 3HRSA 4ZH4F 2TDXA 2GA2A 4JQFA 4KN4X 1HSTA 4PGHA 3TO6A 4QLCU 1LEBA 2VODA 3TGNA 5E1XA 1UB9A 3W6KB 4PZJA 1HQCA 4UVBA 5DV5A 5DCMB 3N97A 5DCFA 4R8HA 2BE5F 3O6BB 4Y13A 1R58A 4CDGA 1FWZA 2ZXJA 5FLXZ 2XHKA 1BIBA 2FA5A 3BJAA 3KP4A 2FRHA 1HBXG 3TDUC 4HAMA 4N0BA 3KZYA 5JHUA 2ZFWA 1I27A 1R22A 5H6RA 2HQNA 5L3GA 5HS8A 3FM3A 3AAFA 2K4JA 3VOEA 1XMAA 5K5QA 3ZMSA 1RUNA 2IVMA 1WSUA 4OIRF 1MZBA 4HA8A 5F1RA 4HF2A 5HLIA 1LDDA 1XN7A 1T2KA 1Z6RA 2IW5A 4HLYA 2P6SA 5E1ZB 2CWEA 2HZTA 1SD7A 4R1HA 4KIBA 3L7WA 3R4KA 1S6LA 4M71A 4L5IA 2LF7A 3KP3A 2QLZA 2XROA 2YR2A 2NRAC 1IXSB 2VT2A 2HTSA 3BWGA 3I64A 1RNLA 2LF8A 2QQAA 1Z91A 4E70A 4PDKA 5H20A 1FBQA 3KE2A 2Q8KA 4U7BA 2IPQX 2YSRA 1ZYRF 3E5XA 4PCQA 2W84A 4TV7A 2IRFG 3MZYA 4NB5A 1F1ZA 2OZ6A 3E6DA 3J80K 2EFOA 2JSCA 3GXOA 2L02A 1P4XA 2W24A 1IRFA 1QZYA 3T8RA 3K9TA 2RQPA 2A69F 3WTVC 4XBFA 2HWVA 3NEUA 4A6DA 2FBHA 2O3FA 2QQBA 1B9MA 1BI0A 4WK8F 1WKMA 1W4MA 4I09A 4PGGA 1BOAA 1U5TA 1OMIA 2K86A 2QUFA 1ZG5A 2RV8A 5CVVA 1BI2A 3SHFA 4LJZF 4IHSA 1WRJA 4U0VA 1YYVA 1MJAA 1NHAA 2C6YA 5HDKA 2Z99A 3V7CA 2RN7A 3F8BA 4LLGF 1XCBA 3Q9VA 4MTDA 1HKTA 4HX7A 1B1BA 2KJBA 1O7LA 1XSDA 1IW7F 2K02A 3TQNA 3C7JA 4UV9A 3QP6A 5ICEA 3JSOA 4KT5C 5K5OA 1W7PD 4M72A 3FXQA 1YTYA 5EEHA 5ERIA 4KA4A 2ZNYA 1TW3A 3WGIA 1J5YA 1FX7A 1YQAA 3M8EA 2OD5A 1ZRDA 3V7RA 2QBYA 3IWFA 2H6BA 1MGTA 3OOPA 3I71A 5J8FA 2KIFA 4P9FA 4A0XA 1BC7C 4LD5A 1MJBA 1OYWA 2ESHA 2VC0A 3F21A 2HFHA 2MH9A 1ON1A 1YG2A 2ZO4A 5EEGA 4WXHA 2GQQA 1XSVA 3KEQA 4EM2A 2PJPA 1BIAA 2P7VB 4I7HA 2BBYA 5LEJA 2R7DA 4EV0A 1DUXC 2P5LC 2UXXA 3R0JA 1FBUA 1FC3A 1ZAOA 2L01A 3SQNA 1USTA 1TW2A 1G6NA 4ZYEA 2M87A 5FFZA 2DPUA 4FHTA 1S8NA 1G3SA 2M8EA 4KFCA 2ACJA 4B8XA 5LHGA 2DLLA 4RAZA 3RKYA 4A0YA 4CXFA 2G7UA 3FM5A 5JR3A 2ZBKA 5HLHA 1ONVA 1FOKA 3FF5A 1FLIA 1I6XA 2ZMEB 4AIJA 3RYRA 1FSEA 3GEZA 3DEUA 5DYMA 5F6FA 3IKVA 3HHGA 2K7LA 3HTUA 4XRFA 2QZ8A 1YFHA 2Y48A 2PMHA 3D0SA 2COMA 1R36A 1K6OA 4OIPF 3B73A 5BMZA 4Y17A 1LB2A 3T5XA 4ZYGA 2IA0A 1XCVA 4Y15A 4FT8A 2BV6A 3N4MA 2XRNA 3R60A 1IXRC 1R23A 2E7WA 4G8XA 1OPCA 5K1YA 1CGPA 2CW0F 2EV5A 4L0YB 3G73A 5D6FA 1LJ9A 4HF0A 1R5GA 1L0OC 1Z05A 2RKHA 1SFEA 1WI9A 4G7OF 1PP8F 2JRTA 1KU9A 5D6EA 3HRTA 1XB4A 4HV5A 1D5VA 5L3DA 2ZCWA 4ENKA 2CFXA 2ESNA 1ZGAA 2EV0A 2A07F 2EV6A 1KU3A 2KIMA 3EQLF 3DPLC 3F8FA 1D3YA 4YFNF 3I5UA 1ZG1A 2B0LA 2ETHA 2VN2A 2Z5UA 4EMSA 1HKSA 2H6CA 5FFXA 3I54A 3WU1B 1P4AA 3RJPA 1KA8A 3QPTA 1RUOA 2EFQA 4BYYA 3FZVA 1SMTA 3CUOA 2RDPA 1K7AA 4BH9A 3NQOA 4L18B 3F22A 3GUDA 1Z1DA 2A61A 2HYGD 4NHJA 5HOOA 3EETA 2CG4A 1YLFA 1W7PB 5E17F 4A2UA 3CJNA 2R3SA 2PQ8A 4UXNA 3E5UA 4M9XA 4HYEA 2E1CA 1OKRA 4IRHA 2DAOA 2UXNA 1J9IA 1AOYA 1QBJA 1WWXA 2XKPA 2F5CA 4RB1A 3J81Z 1T38A 4ZYDA 2VONA 4BHPA 4A0ZA 3U1DA 3EDPA 3JAMZ 3HYIA 4O3MA 4HZFA 2H94A 1QZZA 1LEAA 2WWYA 1BN5A 5F64A 2OBPA 1O3TA 1FNNA 4OOIA 4UHTA 1R7JA 4EM0B 2FSWA 3QU6A 3WTZA 3GYHX 3M9AA 5L3BA 4WCGA 2YPRA 1YS7A 1GVJA 4DQ2A 1XMKA 3IWZA 5D8KB 4U0WA 4CZZA 4YG2F 2CSOA 3ML6A 3G3ZA 5D4RA 2Z9OA 2OZUA 2IA1A 4MNUA 4LG0B 1P4WA 2PFBA 5CVRA 3ECOA 4U0YA 1IN5A 3SXYA 3LFKA 2EB7A 4A12A 2FU4A 1ZREA 1LQ1A 5A2QZ 1JHFA 2D45A 3CLOA 4FX4A 3MAJA 4G6QA 4AVPA 5AONA 3GO5A 4I01A 5HDGA 2BGCA 2NAZA 2ZKZA 2DT5A 5DUIA 4RGSA 1L3LA 2ISZA 3LWFA 4HW0A 4HDVA 2RGVA 3ZN0A 3PQKA 1YW7A 2WV0A 3TO7A 1TQIA 3L09A 1F4KA 3RPQA 1UHWA 3GFIA 2MLKA 3RDIA 2O6GE 4DNCA 2LKPA 3QOPA 3V8JA 3ERED 1HW2A 3F8MA 2L4AA 4O6JA 3WTTC 5E20A 3GFMA 3WU0A 3QPHA 2BEOA 4KMFA 2FQ3A 3KP2A 5ED4A 1O3RA 1ON2A 2OU2A 2XKOA 3R6SA 3IHUA 3LA2A 1IN8A 2CO5A 4A5MA 1IXCA 3DFGA 5DD8A 5HLGA 3I4PA 4F7ZA 2DPDA 2VXZA 1J0RA 4M6YA 3LQRA 3D5LA 3M1EA 3U2RA 5LRSA 1DDNA 4OU0A 3WTXC 1MDMA 5CVIA 4KDPA 3P9CA 4I98B 3ABTA 4O5VA 4A5NA 2GAUA 4UVCA 4A6EA 5KK1A 1U8RA 1BJAA 3F3XA 1XDSA 2V9VA 5IT9K 5L3CA 5J8CA 4M74A 3DKWA 1T98A 2PI0A 4P96A 4L0ZB 1BI1A 4BXUA 3EYIA 4KN7X 4EGYA 1TNSA 1I1GA 4I2OA 3DF8A 3HSFA 2VE8A 4OINF 1E17A 2PEXA 2HQRA 1RZ4A 1DPUA 2D1HA 2FNPA 3F72A 5LGNA 5HDNA 3H92A 2MH2A 4QWQA 2P8TA 1TBXA 3FMRA 1ZRCA 2EJRA 5FLXK 3KP5A 3WGGA 3ZPLA 3LAPA 5HS7A 2IJLA 5ICGA 2JZYA 1SAXA 4IXAA 5LHIA 1J2XA 3ZMZA 1FZPB 1OR7A 3PFIA 5AIPA 1B59A 4S04A 1U5TB 3KP6A 2VBXA 5FD5A 2D1VA 3WODF 3RYPA 1KGSA 3EYYA 1USSA 3DP7A 2VOOA 2F5DA 3T0YA 3ZMTA 1KU7A 2MBFA 4EVIA 1VTNC 1J7KA 3L00A 2HDCA 5JFRA 5KVRA 4P55A 1K78A 1UCRA 3GWZA 3MQ0A 3WG9A 1KQ9A 3HRMA 2DU9A 3U9GA 2HYFA 3R61A 2KIUA 4G7ZF 4LB5A 4IRIA 3LSTA 2QENA 1QO0D 2QQ9A 2UZKA 4XSXF 3E6BA 4ASNA 1IN6A 4I0AA 1U78A 1FPQA 3DXJF 3R0AA 2M5WA 2ADUA 2DQRA 1T6SA 2XAFA 1QPMA 4KMUX 2QBYB 4IRGA 3CUQC 1LDJA 1Z6TA 1R5HA 5FB2A 3FWEA 3T1BA 3WE3A 4CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1M A;  2HTJ A;  2GA1 A;  1PUE E;  4LGW A;  1ZRF A;  1R1U A;  5LBQ A;  4HLX A;  1CF7 B;  2STW A;  3H3U A;  4EM1 A;  1UHM A;  3VEP A;  4BHB A;  2OA4 A;  3HUG A;  4EJT A;  4OMZ A;  4EGZ A;  3LA7 A;  2PBI A;  3BOQ A;  2VBY A;  1BI3 A;  4G94 A;  3B02 A;  4M9S A;  2CQK A;  3IRR A;  4AWX B;  4ZYH A;  3WE2 A;  2YU3 A;  1XGS A;  2KJC A;  2EFW A;  3KCC A;  3GX4 X;  1TTY A;  2QWW A;  4HX4 A;  2R7F A;  1ZAR A;  5FGM A;  4WF2 A;  3ZQ7 A;  1XDU A;  2GXB A;  2Z3Y A;  3I53 A;  3HSR A;  3CO6 C;  2YX7 A;  4CHU A;  1SFU A;  1SD4 A;  1KQ8 A;  4KIF A;  4IF4 A;  2LSO A;  3L9F A;  3E97 A;  3QRF F;  1YIO A;  1TQM A;  1V4R A;  4N9H A;  3VB2 A;  2FEZ A;  2Q0O A;  5CVJ A;  4HQE A;  4JK1 X;  1G3W A;  2DFI A;  4MGR A;  4L9J A;  1QNT A;  2P5K A;  4B09 A;  3LA3 A;  4KIC A;  2QVO A;  2H27 A;  4M73 A;  1FYM A;  3ISP A;  3MFK A;  2Y75 A;  1U6G A;  3BZ6 A;  1ZH5 A;  2DI3 A;  1TNT A;  1I1S A;  1H9T A;  2FNA A;  1W7P A;  4RB2 C;  1O7F A;  3PQJ A;  3KP7 A;  5E8I A;  2FBI A;  4YFX F;  3I59 A;  1JXS A;  4FX0 A;  1A04 A;  3MWM A;  2P5V A;  5D5V B;  3LAJ A;  2XGX A;  3F23 A;  4MQ9 F;  1FYK A;  1P6R A;  2VT3 A;  3WTY C;  5E8G A;  5ILV A;  1KU2 A;  4BAY A;  3MZH A;  2MC3 A;  4WWC A;  4IJA A;  5TRD A;  2HS5 A;  3V7S A;  3VOD A;  3CUQ A;  4HX8 A;  2AXL A;  3P9K A;  2HOE A;  2RVC A;  3FXR A;  4MTE A;  4WX9 A;  5HVQ C;  5L3E A;  1GHC A;  2VC1 A;  5HS9 A;  4L9V A;  2AS5 F;  1ODD A;  3T8T A;  4S05 A;  4ZZL A;  3RIR A;  3BDD A;  3J80 Z;  2MLG A;  2DQL A;  1WQ2 A;  1IN7 A;  2O8X A;  3K0L A;  3IL2 A;  1AWC A;  4KYW A;  2HKO A;  3C3W A;  4LMY A;  4HBL A;  2V1D A;  3ZP5 A;  2OQG A;  5DCM A;  1HKQ A;  2X0L A;  2O03 A;  3TOA A;  3ZMD A;  1R1T A;  2DO7 A;  3F6O A;  2DBB A;  3HRU A;  5J6X A;  3ECH A;  5D5U B;  3FHZ A;  4GYG A;  3QAH A;  3CO7 C;  4CIC A;  2J5O A;  3KLN A;  1R00 A;  3V4G A;  1ZLJ A;  5E18 F;  4P9U A;  3V8L A;  3WGH A;  1P92 A;  2X4H A;  4OIQ F;  4NQW A;  3WTS C;  2XAS A;  3DV8 A;  3GFL A;  1STZ A;  1J75 A;  1B4A A;  3K2Z A;  1DPR A;  1U5T C;  4KNY A;  1KYZ A;  3GVA A;  1FP1 D;  3RTR A;  5DUK A;  4YII A;  1S7A A;  1QQI A;  2GIV A;  1MJ9 A;  2VBZ A;  2A6H F;  1R1V A;  3E6M A;  2HKX A;  3FX3 A;  2K4B A;  2W57 A;  3I58 A;  1JGS A;  2F2E A;  1ZHF A;  2XV4 S;  3SZP A;  5BQT A;  5D5W B;  1JHH A;  5L3F A;  2F5E A;  2FE3 A;  1H9G A;  4UVA A;  4GCV A;  4WXD A;  4I0B A;  1BBY A;  3BRO A;  1X3U A;  3HHH A;  1E2X A;  3BPV A;  3GZ6 A;  4ENJ A;  2VBW A;  2XAH A;  4LK0 F;  3RPU A;  3H3Z A;  5BPD A;  2W25 A;  3ROU A;  1JE8 A;  4UNO A;  1IAW A;  3NRV A;  2NS0 A;  3RKX A;  4OIO F;  3C1D A;  3LQQ A;  4HF1 A;  4UV8 A;  5LGU A;  2WTE A;  2M45 A;  1S7O A;  1O57 A;  4XLN F;  3TKY A;  2PN6 A;  1DP7 P;  4HDU A;  1BC8 C;  3I0T A;  1W5T A;  1LNW A;  2QYO A;  5LRR A;  2P6T A;  1TLH B;  2ZJ2 A;  3JTG A;  4LB6 B;  1S3J A;  4EJO A;  4L5J A;  4EJV A;  2LDU A;  3P7N A;  3MCZ A;  2EFP A;  3F8N A;  1T39 A;  1LDK B;  2H09 A;  2OQR A;  3F6V A;  3J81 K;  4GYI A;  3WTW C;  4RS8 A;  3L2C A;  3S2W A;  5DEQ A;  1HXD A;  2STT A;  4R79 A;  4MQV A;  1G3Y A;  5ICF A;  3GF2 A;  4MEY F;  4U88 A;  5CYV A;  3COA C;  2P4W A;  2V6C A;  3JAM K;  1FBS A;  2XAJ A;  3EUH A;  3ULQ B;  1KYW A;  2A5Y B;  3E5Q A;  4EJW A;  5ILU A;  3TO9 A;  5K5R A;  4GO1 A;  3BY6 A;  4HOB A;  4HV6 A;  3KEO A;  5FO5 A;  3SZT A;  1FP2 A;  4H0E A;  1O3Q A;  2XIG A;  2MA3 A;  4L9T A;  1B9N A;  2QM3 A;  5FD6 A;  4GGG A;  1J59 A;  2E7X A;  4BNC A;  2HEO A;  4RGR A;  4CGZ A;  4Q48 A;  2V1U A;  1OYY A;  1KQ0 A;  3M8F A;  1GXP A;  4IVN A;  3KLO A;  1MDM B;  1T0F A;  4G6D A;  1Z7U A;  4AIK A;  2XAQ A;  4LK1 F;  2Z33 A;  1I5Z A;  2GZW A;  2P7C B;  5A2Q K;  4CO8 A;  2DK8 A;  2A68 F;  2DW4 A;  2ZNZ A;  3QU3 A;  4D0P A;  2NYX A;  1ZN2 A;  4JBA A;  4M9Z A;  4ESJ A;  3KFW X;  5LLQ A;  5AIQ A;  1SMY F;  1F5T A;  2ZME A;  2L3D A;  4L9N A;  2EA2 A;  5BS6 A;  1CF7 A;  4BHC A;  3W6J B;  2ELH A;  1Z9C A;  1HSJ A;  1D8J A;  5CVU A;  3JW4 A;  2HR3 A;  2Q2E A;  3FMQ A;  1YW8 A;  4IPA A;  1EH6 A;  2FF4 A;  2BYV E;  2EA4 A;  3F8C A;  4U7D A;  1XGM A;  3HTS B;  2E1N A;  3GZ5 A;  1QGP A;  3TDZ C;  3DPT A;  1U2W A;  5LGT A;  2M1B A;  1GXQ A;  4RAY A;  4UUV A;  1B6A A;  2K27 A;  4ESB A;  4G7H F;  2G9W A;  4IHT A;  3ZN1 A;  3BJO A;  3DQV C;  4RB3 C;  3JSP A;  4BQA A;  3IC7 A;  3O2P E;  3FMS A;  3OV8 A;  1SFX A;  1K78 B;  1IF1 A;  4K2E A;  4MHG A;  3GLX A;  2O0Y A;  2XUB A;  4Q5S F;  2FXA A;  5D5X B;  3C18 A;  1G3T A;  2ISY A;  4LLL A;  2HGC A;  2KKO A;  5CLS A;  1Q1H A;  1YW9 A;  3Q5F A;  3HOT A;  1S29 A;  2RC4 A;  3O3K A;  1FSH A;  2DK5 A;  1IUY A;  2PG4 A;  4KUM A;  5D4S A;  4GXO A;  3REO A;  3ZMU A;  2L4M A;  1V3F A;  2DTR A;  4G9Y A;  2V79 A;  4ZZD A;  3HIF A;  3GW2 A;  1UFM A;  2IT0 A;  4EQQ A;  1LVA A;  4Z2Y A;  4ENM A;  1ZLK A;  3GFJ A;  2JPC A;  2L54 A;  1ULY A;  2JT1 A;  4AIH A;  2PMU A;  1SD6 A;  2F5F A;  2PLY A;  1FYL A;  1TQP A;  3HOS A;  2LNB A;  2CGP A;  5H6Q A;  1MKM A;  1PP7 U;  3CTA A;  4ON0 A;  2GWR A;  2A3S A;  1MD0 A;  4RGU A;  2W85 A;  1XGO A;  3JTH A;  5JI6 A;  1FY7 A;  2XAG A;  3KZZ A;  2VE9 A;  1G4D A;  4YIF A;  2YX4 A;  5DD4 A;  1PDN C;  4Q4Z F;  6PAX A;  4ESF A;  3IRQ A;  5ILS A;  1EV7 A;  4MEX F;  3RI4 A;  1EH8 A;  3E6C C;  2CYY A;  5TJJ A;  4RB0 A;  3FXU A;  3RKW A;  3V8K A;  1D8K A;  1ZGJ A;  4ENN A;  1XD7 A;  2FML A;  2GXG A;  1EH7 A;  3M7G A;  2EK5 A;  3CDH A;  4HQM A;  2FBK A;  2NNY A;  2FOK A;  4N9I A;  5IT3 A;  1HW5 A;  3P9I A;  2KRF A;  5JVT A;  1IRG A;  1XSX A;  5LHH A;  1IZ1 A;  1YO5 C;  1K79 A;  3BPX A;  2G7H A;  5E1W A;  3ZMV A;  4M6X A;  2V1X A;  3K1N A;  2RNJ A;  3VFZ A;  4OMY A;  3TOB A;  4ETS A;  1XGN A;  3J7A O;  1H0M A;  5CJ9 A;  4XLP F;  4P5O A;  2O61 A;  4EJU A;  2FMY A;  3ABU A;  2M30 A;  1SD5 A;  5D8L B;  2XVC A;  5LEK A;  1W5S A;  2WC2 A;  3KET A;  3BJ6 A;  3SFZ A;  5BOX A;  3BP8 A;  2D2W A;  3HSE A;  1RI7 A;  2UWM A;  4I02 A;  1C0W A;  1U3E M;  2JPB A;  2NNN A;  2OAZ A;  4RGX A;  2JTV A;  3K1P A;  1OYI A;  3Q9S A;  1FT9 A;  3I59 B;  4LFU A;  1YS6 A;  3WTU C;  1IN4 A;  5DDG A;  1P2F A;  1ZG3 A;  3ELK A;  3E3V A;  4AD9 A;  4XSZ F;  4LG0 A;  2J5P A;  3K69 A;  1F9N A;  3MEX A;  5BPI A;  2MD5 A;  4WXC A;  3CUQ B;  5IT9 Z;  1HW1 A;  4LLN A;  4Q47 A;  2EWN A;  1REP C;  2Y0M A;  2IP2 A;  2VOP A;  2EFN A;  2A6E F;  1BM9 A;  4KIG A;  3QP5 A;  4YFK F;  1RIO H;  1O3S A;  3IKT A;  2IA2 A;  1Y0U A;  5ICC A;  3HRS A;  4ZH4 F;  2TDX A;  2GA2 A;  4JQF A;  4KN4 X;  1HST A;  4PGH A;  3TO6 A;  4QLC U;  1LEB A;  2VOD A;  3TGN A;  5E1X A;  1UB9 A;  3W6K B;  4PZJ A;  1HQC A;  4UVB A;  5DV5 A;  5DCM B;  3N97 A;  5DCF A;  4R8H A;  2BE5 F;  3O6B B;  4Y13 A;  1R58 A;  4CDG A;  1FWZ A;  2ZXJ A;  5FLX Z;  2XHK A;  1BIB A;  2FA5 A;  3BJA A;  3KP4 A;  2FRH A;  1HBX G;  3TDU C;  4HAM A;  4N0B A;  3KZY A;  5JHU A;  2ZFW A;  1I27 A;  1R22 A;  5H6R A;  2HQN A;  5L3G A;  5HS8 A;  3FM3 A;  3AAF A;  2K4J A;  3VOE A;  1XMA A;  5K5Q A;  3ZMS A;  1RUN A;  2IVM A;  1WSU A;  4OIR F;  1MZB A;  4HA8 A;  5F1R A;  4HF2 A;  5HLI A;  1LDD A;  1XN7 A;  1T2K A;  1Z6R A;  2IW5 A;  4HLY A;  2P6S A;  5E1Z B;  2CWE A;  2HZT A;  1SD7 A;  4R1H A;  4KIB A;  3L7W A;  3R4K A;  1S6L A;  4M71 A;  4L5I A;  2LF7 A;  3KP3 A;  2QLZ A;  2XRO A;  2YR2 A;  2NRA C;  1IXS B;  2VT2 A;  2HTS A;  3BWG A;  3I64 A;  1RNL A;  2LF8 A;  2QQA A;  1Z91 A;  4E70 A;  4PDK A;  5H20 A;  1FBQ A;  3KE2 A;  2Q8K A;  4U7B A;  2IPQ X;  2YSR A;  1ZYR F;  3E5X A;  4PCQ A;  2W84 A;  4TV7 A;  2IRF G;  3MZY A;  4NB5 A;  1F1Z A;  2OZ6 A;  3E6D A;  3J80 K;  2EFO A;  2JSC A;  3GXO A;  2L02 A;  1P4X A;  2W24 A;  1IRF A;  1QZY A;  3T8R A;  3K9T A;  2RQP A;  2A69 F;  3WTV C;  4XBF A;  2HWV A;  3NEU A;  4A6D A;  2FBH A;  2O3F A;  2QQB A;  1B9M A;  1BI0 A;  4WK8 F;  1WKM A;  1W4M A;  4I09 A;  4PGG A;  1BOA A;  1U5T A;  1OMI A;  2K86 A;  2QUF A;  1ZG5 A;  2RV8 A;  5CVV A;  1BI2 A;  3SHF A;  4LJZ F;  4IHS A;  1WRJ A;  4U0V A;  1YYV A;  1MJA A;  1NHA A;  2C6Y A;  5HDK A;  2Z99 A;  3V7C A;  2RN7 A;  3F8B A;  4LLG F;  1XCB A;  3Q9V A;  4MTD A;  1HKT A;  4HX7 A;  1B1B A;  2KJB A;  1O7L A;  1XSD A;  1IW7 F;  2K02 A;  3TQN A;  3C7J A;  4UV9 A;  3QP6 A;  5ICE A;  3JSO A;  4KT5 C;  5K5O A;  1W7P D;  4M72 A;  3FXQ A;  1YTY A;  5EEH A;  5ERI A;  4KA4 A;  2ZNY A;  1TW3 A;  3WGI A;  1J5Y A;  1FX7 A;  1YQA A;  3M8E A;  2OD5 A;  1ZRD A;  3V7R A;  2QBY A;  3IWF A;  2H6B A;  1MGT A;  3OOP A;  3I71 A;  5J8F A;  2KIF A;  4P9F A;  4A0X A;  1BC7 C;  4LD5 A;  1MJB A;  1OYW A;  2ESH A;  2VC0 A;  3F21 A;  2HFH A;  2MH9 A;  1ON1 A;  1YG2 A;  2ZO4 A;  5EEG A;  4WXH A;  2GQQ A;  1XSV A;  3KEQ A;  4EM2 A;  2PJP A;  1BIA A;  2P7V B;  4I7H A;  2BBY A;  5LEJ A;  2R7D A;  4EV0 A;  1DUX C;  2P5L C;  2UXX A;  3R0J A;  1FBU A;  1FC3 A;  1ZAO A;  2L01 A;  3SQN A;  1UST A;  1TW2 A;  1G6N A;  4ZYE A;  2M87 A;  5FFZ A;  2DPU A;  4FHT A;  1S8N A;  1G3S A;  2M8E A;  4KFC A;  2ACJ A;  4B8X A;  5LHG A;  2DLL A;  4RAZ A;  3RKY A;  4A0Y A;  4CXF A;  2G7U A;  3FM5 A;  5JR3 A;  2ZBK A;  5HLH A;  1ONV A;  1FOK A;  3FF5 A;  1FLI A;  1I6X A;  2ZME B;  4AIJ A;  3RYR A;  1FSE A;  3GEZ A;  3DEU A;  5DYM A;  5F6F A;  3IKV A;  3HHG A;  2K7L A;  3HTU A;  4XRF A;  2QZ8 A;  1YFH A;  2Y48 A;  2PMH A;  3D0S A;  2COM A;  1R36 A;  1K6O A;  4OIP F;  3B73 A;  5BMZ A;  4Y17 A;  1LB2 A;  3T5X A;  4ZYG A;  2IA0 A;  1XCV A;  4Y15 A;  4FT8 A;  2BV6 A;  3N4M A;  2XRN A;  3R60 A;  1IXR C;  1R23 A;  2E7W A;  4G8X A;  1OPC A;  5K1Y A;  1CGP A;  2CW0 F;  2EV5 A;  4L0Y B;  3G73 A;  5D6F A;  1LJ9 A;  4HF0 A;  1R5G A;  1L0O C;  1Z05 A;  2RKH A;  1SFE A;  1WI9 A;  4G7O F;  1PP8 F;  2JRT A;  1KU9 A;  5D6E A;  3HRT A;  1XB4 A;  4HV5 A;  1D5V A;  5L3D A;  2ZCW A;  4ENK A;  2CFX A;  2ESN A;  1ZGA A;  2EV0 A;  2A07 F;  2EV6 A;  1KU3 A;  2KIM A;  3EQL F;  3DPL C;  3F8F A;  1D3Y A;  4YFN F;  3I5U A;  1ZG1 A;  2B0L A;  2ETH A;  2VN2 A;  2Z5U A;  4EMS A;  1HKS A;  2H6C A;  5FFX A;  3I54 A;  3WU1 B;  1P4A A;  3RJP A;  1KA8 A;  3QPT A;  1RUO A;  2EFQ A;  4BYY A;  3FZV A;  1SMT A;  3CUO A;  2RDP A;  1K7A A;  4BH9 A;  3NQO A;  4L18 B;  3F22 A;  3GUD A;  1Z1D A;  2A61 A;  2HYG D;  4NHJ A;  5HOO A;  3EET A;  2CG4 A;  1YLF A;  1W7P B;  5E17 F;  4A2U A;  3CJN A;  2R3S A;  2PQ8 A;  4UXN A;  3E5U A;  4M9X A;  4HYE A;  2E1C A;  1OKR A;  4IRH A;  2DAO A;  2UXN A;  1J9I A;  1AOY A;  1QBJ A;  1WWX A;  2XKP A;  2F5C A;  4RB1 A;  3J81 Z;  1T38 A;  4ZYD A;  2VON A;  4BHP A;  4A0Z A;  3U1D A;  3EDP A;  3JAM Z;  3HYI A;  4O3M A;  4HZF A;  2H94 A;  1QZZ A;  1LEA A;  2WWY A;  1BN5 A;  5F64 A;  2OBP A;  1O3T A;  1FNN A;  4OOI A;  4UHT A;  1R7J A;  4EM0 B;  2FSW A;  3QU6 A;  3WTZ A;  3GYH X;  3M9A A;  5L3B A;  4WCG A;  2YPR A;  1YS7 A;  1GVJ A;  4DQ2 A;  1XMK A;  3IWZ A;  5D8K B;  4U0W A;  4CZZ A;  4YG2 F;  2CSO A;  3ML6 A;  3G3Z A;  5D4R A;  2Z9O A;  2OZU A;  2IA1 A;  4MNU A;  4LG0 B;  1P4W A;  2PFB A;  5CVR A;  3ECO A;  4U0Y A;  1IN5 A;  3SXY A;  3LFK A;  2EB7 A;  4A12 A;  2FU4 A;  1ZRE A;  1LQ1 A;  5A2Q Z;  1JHF A;  2D45 A;  3CLO A;  4FX4 A;  3MAJ A;  4G6Q A;  4AVP A;  5AON A;  3GO5 A;  4I01 A;  5HDG A;  2BGC A;  2NAZ A;  2ZKZ A;  2DT5 A;  5DUI A;  4RGS A;  1L3L A;  2ISZ A;  3LWF A;  4HW0 A;  4HDV A;  2RGV A;  3ZN0 A;  3PQK A;  1YW7 A;  2WV0 A;  3TO7 A;  1TQI A;  3L09 A;  1F4K A;  3RPQ A;  1UHW A;  3GFI A;  2MLK A;  3RDI A;  2O6G E;  4DNC A;  2LKP A;  3QOP A;  3V8J A;  3ERE D;  1HW2 A;  3F8M A;  2L4A A;  4O6J A;  3WTT C;  5E20 A;  3GFM A;  3WU0 A;  3QPH A;  2BEO A;  4KMF A;  2FQ3 A;  3KP2 A;  5ED4 A;  1O3R A;  1ON2 A;  2OU2 A;  2XKO A;  3R6S A;  3IHU A;  3LA2 A;  1IN8 A;  2CO5 A;  4A5M A;  1IXC A;  3DFG A;  5DD8 A;  5HLG A;  3I4P A;  4F7Z A;  2DPD A;  2VXZ A;  1J0R A;  4M6Y A;  3LQR A;  3D5L A;  3M1E A;  3U2R A;  5LRS A;  1DDN A;  4OU0 A;  3WTX C;  1MDM A;  5CVI A;  4KDP A;  3P9C A;  4I98 B;  3ABT A;  4O5V A;  4A5N A;  2GAU A;  4UVC A;  4A6E A;  5KK1 A;  1U8R A;  1BJA A;  3F3X A;  1XDS A;  2V9V A;  5IT9 K;  5L3C A;  5J8C A;  4M74 A;  3DKW A;  1T98 A;  2PI0 A;  4P96 A;  4L0Z B;  1BI1 A;  4BXU A;  3EYI A;  4KN7 X;  4EGY A;  1TNS A;  1I1G A;  4I2O A;  3DF8 A;  3HSF A;  2VE8 A;  4OIN F;  1E17 A;  2PEX A;  2HQR A;  1RZ4 A;  1DPU A;  2D1H A;  2FNP A;  3F72 A;  5LGN A;  5HDN A;  3H92 A;  2MH2 A;  4QWQ A;  2P8T A;  1TBX A;  3FMR A;  1ZRC A;  2EJR A;  5FLX K;  3KP5 A;  3WGG A;  3ZPL A;  3LAP A;  5HS7 A;  2IJL A;  5ICG A;  2JZY A;  1SAX A;  4IXA A;  5LHI A;  1J2X A;  3ZMZ A;  1FZP B;  1OR7 A;  3PFI A;  5AIP A;  1B59 A;  4S04 A;  1U5T B;  3KP6 A;  2VBX A;  5FD5 A;  2D1V A;  3WOD F;  3RYP A;  1KGS A;  3EYY A;  1USS A;  3DP7 A;  2VOO A;  2F5D A;  3T0Y A;  3ZMT A;  1KU7 A;  2MBF A;  4EVI A;  1VTN C;  1J7K A;  3L00 A;  2HDC A;  5JFR A;  5KVR A;  4P55 A;  1K78 A;  1UCR A;  3GWZ A;  3MQ0 A;  3WG9 A;  1KQ9 A;  3HRM A;  2DU9 A;  3U9G A;  2HYF A;  3R61 A;  2KIU A;  4G7Z F;  4LB5 A;  4IRI A;  3LST A;  2QEN A;  1QO0 D;  2QQ9 A;  2UZK A;  4XSX F;  3E6B A;  4ASN A;  1IN6 A;  4I0A A;  1U78 A;  1FPQ A;  3DXJ F;  3R0A A;  2M5W A;  2ADU A;  2DQR A;  1T6S A;  2XAF A;  1QPM A;  4KMU X;  2QBY B;  4IRG A;  3CUQ C;  1LDJ A;  1Z6T A;  1R5H A;  5FB2 A;  3FWE A;  3T1B A;  3WE3 A;  4CYD A; 
#chains in the Genus database with same CATH topology
 2ELK A;  3K1M A;  2HTJ A;  2LP0 A;  5B5E C;  1UZC A;  2GA1 A;  1PUE E;  4LGW A;  3CF2 A;  1ZRF A;  1R1U A;  5LBQ A;  4X0G A;  4HLX A;  2VLA A;  1CF7 B;  2HOS A;  4C3I J;  2STW A;  3OOU A;  5JLW A;  3H3U A;  2CW8 A;  4EM1 A;  1UHM A;  2H8W A;  3VEP A;  4BHB A;  1AHD P;  2OA4 A;  3HUG A;  3S1Q J;  3VYS B;  4EJT A;  4OMZ A;  2V6E A;  4EGZ A;  3OSF A;  1RRJ A;  2VUM J;  5C4J J;  3EUA A;  3LA7 A;  3HM5 A;  4PSW A;  1OQY A;  3K4M A;  2PBI A;  3BOQ A;  2VBY A;  1BI3 A;  1TWC J;  4G94 A;  3B02 A;  4M9S A;  2CQK A;  3IRR A;  4AWX B;  3G1M A;  4RM2 A;  4ZYH A;  3KX2 A;  3WE2 A;  3ZOB A;  2DDA A;  2M7B A;  2YU3 A;  1B72 A;  2JA2 A;  1MBF A;  1XGS A;  2KJC A;  4PJ0 C;  1QRY A;  2HYJ A;  2EFW A;  4BDZ A;  3KCC A;  3GX4 X;  1IGN A;  2H1K A;  3GBG A;  1QPI A;  1TTY A;  5HOD A;  2QWW A;  3SDG A;  4HX4 A;  3A01 A;  2Z2S B;  3HOZ J;  4F55 A;  1GV5 A;  2R7F A;  2DMQ A;  4CCJ A;  3BT9 A;  1U9O A;  1ZAR A;  1HA8 A;  2W4S A;  5FGM A;  3MKZ A;  4XKC A;  4WF2 A;  3Q0U A;  3ZQ7 A;  2CH0 A;  2X51 A;  1XDU A;  2GXB A;  4F91 B;  2Z3Y A;  3I53 A;  3H0G J;  5EG0 B;  3N05 A;  3HSR A;  4XMY A;  3CO6 C;  2YX7 A;  4CHU A;  3ZXS A;  1SFU A;  1SD4 A;  1VQP I;  2NVQ J;  1KQ8 A;  4KIF A;  4IF4 A;  1UMQ A;  2LSO A;  5E3L A;  4D7M A;  3L9F A;  1EA3 A;  1NK2 P;  3E97 A;  3K7A J;  1YIO A;  3QRF F;  4XN3 A;  1TQM A;  1V4R A;  4N9H A;  3VB2 A;  2XB5 A;  4C2U A;  2FEZ A;  3BZC A;  2A5W A;  2Q0O A;  5CVJ A;  4HQE A;  2GM4 A;  2NVX J;  4JK1 X;  1G3W A;  2DFI A;  4MGR A;  3S1M J;  3LSK A;  4L9J A;  1QNT A;  2P5K A;  4B09 A;  2WAQ A;  3LA3 A;  2X6W A;  4KIC A;  2QVO A;  1EKE A;  2H27 A;  2HVQ A;  4M73 A;  1QA6 A;  1FYM A;  3ISP A;  3O8H A;  3MFK A;  2UV1 A;  2DDB A;  1E3P A;  2Y75 A;  5IP6 A;  1X1D A;  4BKX A;  1TWF J;  1U6G A;  3BZ6 A;  1ZH5 A;  3E0J B;  2DI3 A;  2DOF A;  1TNT A;  1I1S A;  1H9T A;  2AHQ A;  4BJ5 C;  2FNA A;  2DCE A;  5GAD J;  4DYC A;  1W7P A;  4RB2 C;  1O7F A;  3PQJ A;  3KP7 A;  5E8I A;  3CMM A;  2X6Y A;  2FBI A;  4YFX F;  3HBL A;  5IP9 J;  3I59 A;  1JXS A;  3S3M A;  4ZC3 A;  1Y1V J;  4XR6 A;  4FX0 A;  1A04 A;  2VAS A;  2Z1D A;  2K9L A;  3MWM A;  4XRS A;  2P5V A;  5D5V B;  3LAJ A;  3ZQF A;  2XGX A;  4Y7N J;  3F23 A;  2DYR H;  4MQ9 F;  4A69 C;  1FTZ A;  1FYK A;  1P6R A;  2AXT C;  3S3O A;  2VT3 A;  3G71 I;  1VQL I;  1JTY A;  2VXD A;  3WTY C;  1Y39 A;  1R49 A;  4XOR A;  1ACI A;  5E8G A;  5ILV A;  1KU2 A;  1PVE A;  3MD2 A;  4BAY A;  3MZH A;  3S17 J;  2MC3 A;  4WWC A;  4IJA A;  5TRD A;  2O8K A;  5F0C A;  2R0Q C;  3BG5 A;  2HS5 A;  2HXI A;  2JRM A;  2QF7 A;  3V7S A;  3VOD A;  3CUQ A;  3BR6 A;  4HX8 A;  2AXL A;  3P9K A;  2HOE A;  2RVC A;  1OCT C;  3FXR A;  4MTE A;  3U1K A;  4AYB A;  1TT5 B;  1WJD A;  1MIJ A;  5HVQ C;  4WX9 A;  3GTJ J;  5L3E A;  1GHC A;  3OYC A;  5EGO B;  2VC1 A;  4ZTJ A;  1MMS A;  1ETX A;  3TW7 A;  1FJL A;  2MGQ A;  3SDB A;  4W97 A;  5HS9 A;  3TED A;  5FLV A;  3W2V A;  4L9V A;  1P9Q C;  2AS5 F;  1ODD A;  3T8T A;  4S05 A;  4GRI A;  4ZZL A;  3RIR A;  1LFU P;  2XGE A;  1Z3X A;  1XPX A;  4BQO A;  3BDD A;  5GAE J;  3J80 Z;  2MLG A;  3DCF A;  1WJA A;  2DQL A;  1WQ2 A;  3BR0 A;  1IN7 A;  3OIQ A;  2O8X A;  3OYE A;  3G1O A;  1ETQ A;  3GCM A;  3K0L A;  1DQU A;  3IL2 A;  1AWC A;  4KYW A;  2HKO A;  3DKY A;  3C3W A;  4LMY A;  4HBL A;  2V1D A;  3ZP5 A;  2OQG A;  1GVD A;  5DCM A;  1ORK A;  1HKQ A;  2X0L A;  4DIQ A;  5E3O A;  3AG3 H;  3ERM A;  2DA5 A;  2O03 A;  1JGG A;  3TOA A;  3ZMD A;  1R1T A;  2CJJ A;  2DO7 A;  3QYE A;  2WAQ N;  3F6O A;  2JJ7 A;  2DBB A;  1YRN B;  1OCC H;  1Z7L A;  2XB0 X;  3HRU A;  5J6X A;  5M3F J;  4LIU A;  3ECH A;  1FOX A;  5D5U B;  3FHZ A;  3HL2 A;  4GYG A;  3QAH A;  1MH4 A;  5EJC A;  3CO7 C;  1B8I A;  1PYV A;  3CMY A;  4CIC A;  3BTJ A;  3IUO A;  2J5O A;  3KLN A;  3JRH A;  1R00 A;  1UAA A;  3V4G A;  3PSF A;  1RKW A;  1ZLJ A;  5E18 F;  5EDN A;  3PJR A;  4F3Q A;  5DM6 F;  3I4M J;  4P9U A;  3V8L A;  3LSI A;  3OY9 A;  3WGH A;  1P92 A;  2K3P A;  2R4G A;  2X4H A;  1QVU A;  3PIO F;  1YE9 A;  1ZR2 A;  2JVG A;  3OYB A;  4OIQ F;  4NQW A;  3WTS C;  2XAS A;  5EZG A;  3CP2 A;  3OS2 A;  3DV8 A;  3GFL A;  2HOA A;  3EUH C;  4A3C J;  2E2H J;  1VQ8 I;  3A0H C;  1STZ A;  1LVK A;  1J75 A;  1B4A A;  1X1P A;  2CFO A;  1CQT A;  3K2Z A;  1DPR A;  1U5T C;  4KNY A;  1IJW C;  1QZE A;  1KYZ A;  2M0C A;  1FP1 D;  3GVA A;  3RTR A;  4AM3 A;  5DUK A;  4YII A;  3CF5 F;  1S7A A;  1QQI A;  4XRS G;  3GZN B;  2GIV A;  1AKH B;  1MJ9 A;  2VBZ A;  2A6H F;  1R1V A;  3BCA A;  3E6M A;  4V2F A;  4BQN A;  2HKX A;  4ABZ A;  4M3G A;  5CQG A;  3TL4 X;  5M5X J;  3FX3 A;  1NG7 A;  2K4B A;  2WY8 Q;  2W57 A;  5M5Y J;  3IH4 A;  3I58 A;  1JGS A;  3OR2 C;  5IP7 J;  3HZJ A;  2LBF B;  2F2E A;  1ZHF A;  2XV4 S;  3DU6 A;  3SZP A;  4BDY A;  5BQT A;  3LSP A;  5IYD J;  3TW6 A;  5D5W B;  1JHH A;  4NC8 A;  3L2V A;  5L3F A;  2BVL A;  2F5E A;  2FE3 A;  5H2F C;  1UG2 A;  3RCO A;  1H9G A;  4UVA A;  2WB1 N;  2V9K A;  2VI6 A;  4GCV A;  2CUZ A;  3PNV A;  4MO7 A;  4WXD A;  4I0B A;  3LSR A;  1F43 A;  2I10 A;  1MNE A;  3IH2 A;  1T0F C;  2ZC2 A;  3EPZ A;  1BBY A;  2M8G X;  3DTI A;  3BRO A;  1X3U A;  3HHH A;  1E2X A;  3BPV A;  2ZJR F;  3GZ6 A;  2ECC A;  5GAH J;  4BXX J;  4ENJ A;  2HZD A;  3FBI B;  2VBW A;  5IY5 H;  2XAH A;  2FQ4 A;  4LK0 F;  3RPU A;  3H3Z A;  5BPD A;  2W25 A;  3ROU A;  3CD6 I;  1JE8 A;  3BR2 A;  4XRM A;  4UNO A;  2QEX I;  1IAW A;  2X9D A;  3NRV A;  2NS0 A;  3DBL B;  4UUS A;  2HU9 A;  3WU2 C;  3ZQI A;  2OC6 A;  3RKX A;  4OIO F;  3C1D A;  3LQQ A;  4B3A A;  4HF1 A;  4UV8 A;  1N77 A;  5LGU A;  2WTE A;  2M45 A;  1YI2 I;  1LFB A;  1MMA A;  1S7O A;  2DTZ A;  1O57 A;  3H36 A;  2ZME C;  2CMP A;  3JRG A;  2JA6 J;  2DYS H;  4XLN F;  4ZDP A;  4E7K A;  2E1M B;  1EJ9 A;  3TKY A;  2PN6 A;  3M4O J;  1DP7 P;  4BY7 J;  4HDU A;  1BC8 C;  1BW5 A;  4QIW N;  3I0T A;  2JUC A;  2OF7 A;  1W5T A;  1LNW A;  2X1C A;  1Y8R B;  2QYO A;  2TCT A;  5LRR A;  3FKI J;  2P6T A;  3AG4 H;  1XMX A;  1SFO J;  1TLH B;  2XGD A;  1MW7 A;  2ZJ2 A;  3JTG A;  4LB6 B;  1S3J A;  2OV7 A;  4EJO A;  1X4P A;  2R7U A;  2BXY A;  1JUM A;  2ME0 A;  4L5J A;  4EJV A;  2LDU A;  2WBM A;  4IZZ A;  3P7N A;  3MCZ A;  1YJN I;  3HXL A;  3A4C A;  3CC2 I;  2EFP A;  2L9N A;  1VQ6 I;  2LR8 A;  3F8N A;  3NAR A;  2E71 A;  3QOD A;  3D1N I;  1BOB A;  1T39 A;  1LDK B;  1BA5 A;  2H09 A;  2OQR A;  3F6V A;  2E1O A;  3J81 K;  3CDL A;  4GYI A;  3KYL A;  3K4K A;  3WTW C;  3K4L A;  1IG7 A;  4RS8 A;  3L2C A;  3S2W A;  5DEQ A;  1HXD A;  2STT A;  4R79 A;  4MQV A;  1G3Y A;  3L2Q A;  5ICF A;  3GF2 A;  4MEY F;  4U88 A;  5CYV A;  1MBG A;  2EIL H;  3COA C;  2P4W A;  2V6C A;  4PUS A;  2LKX A;  1G2H A;  2YS9 A;  1FBS A;  1X2N A;  3JAM K;  2XAJ A;  1ITY A;  3EUH A;  2R5Y B;  3ULQ B;  1KYW A;  2A5Y B;  2LRE A;  1JTX A;  4E7L A;  1V5G A;  3E5Q A;  4ITV A;  4EJW A;  5ILU A;  2CQX A;  3TO9 A;  5K5R A;  1FIP A;  1X2M A;  1Y0N A;  2MAB A;  4GO1 A;  3BY6 A;  1NH3 A;  2IS4 A;  5IPA A;  4HOB A;  4HV6 A;  3KEO A;  2R7Z J;  1MND A;  5FO5 A;  3SZT A;  4HNV A;  1FP2 A;  4H0E A;  2LVS A;  1O3Q A;  1T95 A;  2XIG A;  3H9J A;  4N4O B;  1AA7 A;  2MA3 A;  4L9T A;  2GOM A;  4BBR J;  5TIS C;  1B9N A;  2R7W A;  2QSG X;  4J01 A;  2QM3 A;  2DJI A;  5FD6 A;  5GPA A;  4XNF A;  4BQQ A;  2CV2 A;  4GGG A;  5F08 A;  1G59 A;  3MVP A;  1J59 A;  1JKQ C;  2A6T A;  2VQG A;  1A6Q A;  3C2H A;  2VQC A;  4M3D A;  2E7X A;  4BNC A;  2OUM A;  5GAG J;  2HEO A;  4RGR A;  1YIT I;  4OAY A;  1WJ5 A;  3KIO A;  4CA0 A;  4CGZ A;  4Q48 A;  1T56 A;  1RC9 A;  3RSN A;  2V1U A;  3KPH A;  3BTC A;  1OYY A;  2R5Z A;  1KQ0 A;  1ETV A;  3M8F A;  2VL8 A;  3BR5 A;  1GXP A;  4IVN A;  3KLO A;  2F4I A;  1MDM B;  2ZB9 A;  5KAF C;  3AKZ A;  1T0F A;  4G6D A;  3HGY A;  3GTK J;  1Z7U A;  4AIK A;  2XAQ A;  1JT0 A;  4LK1 F;  2Z33 A;  1HDD C;  1I5Z A;  2GZW A;  2P7C B;  3K4J A;  5J47 A;  5A2Q K;  4CO8 A;  2MG4 A;  2BW3 B;  4BUP A;  2DK8 A;  3OYJ A;  3J7Z I;  2A68 F;  2DW4 A;  2ZNZ A;  1YHQ I;  3QU3 A;  4YEL A;  3SEZ A;  4D0P A;  2NYX A;  1ZN2 A;  1ZQ3 P;  3Q0V A;  4JBA A;  1OJL A;  2OCE A;  4XLF A;  2FD5 A;  4M9Z A;  4KIT B;  4ESJ A;  2JK3 A;  3KFW X;  5LLQ A;  5AIQ A;  1X1A A;  4E6K G;  1SMY F;  1F5T A;  2RNG A;  2ZME A;  1Z0X A;  2L3D A;  4L9N A;  3V42 A;  1PJR A;  2QA4 I;  3HOX J;  5J4V A;  2EA2 A;  5BS6 A;  1CF7 A;  4BHC A;  2HOT A;  2KPM A;  3W6J B;  2ELH A;  1Z9C A;  1HSJ A;  2A05 A;  1D8J A;  1Z21 A;  2XDV A;  2KIS A;  5CVU A;  3JW4 A;  2HR3 A;  5J1R A;  2Q2E A;  2CQ7 A;  3VWB A;  3FMQ A;  4BJ6 C;  1I3Q J;  1YW8 A;  4IPA A;  1FEX A;  1EH6 A;  2FF4 A;  4F93 B;  2BYV E;  4G12 A;  1WJB A;  1VFC A;  2EA4 A;  3F8C A;  4U7D A;  1XGM A;  3HTS B;  2HI3 A;  5B1A H;  1R71 A;  5JHF A;  2E1N A;  2WAE A;  1GV2 A;  2MW8 A;  3GZ5 A;  4C30 A;  4NC6 A;  1QGP A;  4FE7 A;  3KEY A;  3TDZ C;  3HOU J;  3DPT A;  1BR4 A;  1U2W A;  2LG4 A;  3B6C A;  4IOA F;  4ZYA A;  5LGT A;  3NWS A;  3JCU C;  2M1B A;  3WG7 H;  4Z6Y A;  1GXQ A;  1BR2 A;  1ENH A;  4XIC A;  2KZG A;  3ESW B;  3S2H J;  4IHW A;  3DPU A;  4RAY A;  4UUV A;  1B6A A;  2K27 A;  4ESB A;  4G7H F;  3A0B C;  4BY1 J;  2G9W A;  2KHM A;  3HC7 A;  4IHT A;  3ZN1 A;  3BJO A;  3DQV C;  2KDZ A;  4RB3 C;  3ZRG A;  3JSP A;  2KQR A;  4BQA A;  3S32 A;  3BG3 A;  3IC7 A;  3O2P E;  2VPL A;  3FMS A;  3OR1 C;  1UG0 A;  3OV8 A;  1SFX A;  4MLO A;  1K78 B;  1OCO H;  1IF1 A;  1R4M B;  4E7J A;  2L7F P;  1JJ6 C;  4K2E A;  2DN0 A;  3CJT B;  3GLX A;  4MHG A;  4BU2 A;  2O0Y A;  3BTL A;  2PMZ N;  2XUB A;  4Q5S F;  2FXA A;  4L5E A;  5J40 A;  5D5X B;  4IHY A;  1JUS A;  3C18 A;  3ABK H;  1G3T A;  2ISY A;  2HGC A;  2KKO A;  5CLS A;  4LLL A;  1Q1H A;  1YW9 A;  1JUP A;  3Q5F A;  1FMW A;  3HOT A;  3ZGK A;  1WHU A;  3FXJ A;  1S29 A;  2RC4 A;  3O3K A;  4XKW A;  1AU7 A;  1FSH A;  2DK5 A;  3AL0 B;  1IUY A;  2IAI A;  2EPF A;  2PG4 A;  4Y4R A;  2W7N A;  4KUM A;  1RES A;  2Y0S A;  2LFB A;  1XG1 A;  5D4S A;  4J00 A;  4GXO A;  3REO A;  3ZMU A;  2DJN A;  3S1R J;  2L4M A;  1V3F A;  4ZJZ A;  3IV5 A;  1T8I A;  1K4T A;  3AFH A;  2DTR A;  4G9Y A;  2V79 A;  1J09 A;  1A5J A;  4ZZD A;  3HIF A;  3GW2 A;  1SAU A;  1UFM A;  2IT0 A;  4YRV A;  4EQQ A;  1I50 J;  1LVA A;  3TP3 A;  5HLT A;  4Z2Y A;  4ENM A;  4A3L J;  4A3B J;  5JVG F;  2ZFU A;  1ZLK A;  3GFJ A;  2NOG A;  2JPC A;  2L54 A;  1ULY A;  2JT1 A;  4M3B A;  3QOE A;  3C2G A;  4AIH A;  2PMU A;  1SD6 A;  2F5F A;  4BBS J;  3HDD A;  4D5C A;  2PLY A;  1A31 A;  1FYL A;  4BL0 B;  4LOC A;  1TQP A;  1OCZ H;  2LNB A;  3HOS A;  5B66 C;  1ZR4 A;  2CGP A;  1IV8 A;  2IGK A;  3FK7 A;  1MBE A;  3ASN H;  4P1W A;  1MKM A;  5H6Q A;  5BNG A;  3CTA A;  3OMY A;  4ON0 A;  2LD5 A;  2GWR A;  3QQA A;  1PP7 U;  2A3S A;  1VQK I;  1MD0 A;  4DZP A;  4RGU A;  2W85 A;  1XGO A;  3IH3 A;  3JTH A;  4PJN A;  1FY7 A;  1XTA A;  5JI6 A;  4S0H B;  2XAG A;  3KZZ A;  2HQA A;  2VE9 A;  1G4D A;  5CQE A;  2QKL B;  4YIF A;  3I55 I;  2YX4 A;  3HUG B;  3DWL E;  4NNJ A;  5CKT A;  5DD4 A;  4RLF A;  1PDN C;  4Q4Z F;  6PAX A;  4ESF A;  2D5V A;  4XK4 A;  3ZCO A;  3IRQ A;  1K4S A;  5ILS A;  1EV7 A;  4MEX F;  5F27 A;  3RI4 A;  1EH8 A;  3E6C C;  2CYY A;  3HOY J;  3RPU D;  5TJJ A;  5FRO A;  1HDP A;  3JRE A;  3OWT A;  1B72 B;  1ETK A;  3OYL A;  4RB0 A;  5F04 A;  3FXU A;  5EEA A;  2VKE A;  3RKW A;  3V8K A;  2IBD A;  1D8K A;  1ZGJ A;  3HB9 A;  3FXL A;  4CSW A;  1DU0 A;  1VQ4 I;  2E1M C;  4ENN A;  1XD7 A;  1D0Z A;  1IRZ A;  2FML A;  1LPQ A;  2GXG A;  3MKL A;  1W1W E;  3A01 B;  1EH7 A;  3M7G A;  3HG9 A;  2EK5 A;  1T08 B;  3CDH A;  4HQM A;  2FBK A;  2NNY A;  2FOK A;  1WJE A;  2KRC A;  4N9I A;  4D1Q A;  5IT3 A;  1KON A;  1HW5 A;  2E35 A;  3P9I A;  2KRF A;  5JVT A;  2K85 A;  1IRG A;  1XSX A;  5LHH A;  1IZ1 A;  3JRF A;  1YO5 C;  3DBR B;  1K79 A;  3IAS 2;  5C4X J;  3BPX A;  4HRI A;  2G7H A;  4RA2 A;  4CH7 A;  4CCL A;  2Y0S N;  5E1W A;  3ZMV A;  4M6X A;  2V1X A;  3K1N A;  2Y9Y A;  1KZH A;  2RNJ A;  2KT0 A;  3VFZ A;  2V1N A;  3SJM A;  3OYH A;  3RQ4 A;  2DA3 A;  1WFX A;  3ASO H;  4EAT A;  1QU3 A;  3OL3 A;  1VZ0 A;  4OMY A;  3TOB A;  4ETS A;  1XGN A;  3J7A O;  3OYG A;  1H0M A;  5CJ9 A;  1ETW A;  3JRB A;  4XQF A;  2AQE A;  4XLP F;  4MFE A;  4P5O A;  2O61 A;  4EJU A;  1EF4 A;  2EH3 A;  2FMY A;  2O9L A;  4G6T B;  4E7S A;  3ABU A;  2M30 A;  2IS6 A;  1SD5 A;  2E34 A;  2ELJ A;  5D8L B;  3MKW B;  1TWH J;  4JYK A;  2XVC A;  5LEK A;  1W5S A;  4GDF A;  2FUG 2;  2WC2 A;  3KET A;  3BJ6 A;  3SFZ A;  4GFB A;  5BOX A;  3BP8 A;  2HDD A;  5K7Z A;  1XS9 A;  4A3F J;  2D2W A;  2BZT A;  1RI7 A;  3HSE A;  2UWM A;  4F92 B;  4I02 A;  2VJ5 A;  1C0W A;  1U3E M;  2JPB A;  2WB1 A;  2W00 A;  4BXF A;  2NNN A;  2OAZ A;  4RGX A;  2JTV A;  1D1C A;  3K1P A;  4KJZ A;  4QPO A;  4I6Z A;  3OYI A;  2NXN B;  3GTP J;  1OYI A;  3FK6 A;  4NDL A;  3Q9S A;  1FT9 A;  3I59 B;  4LFU A;  3CZ6 A;  1YS6 A;  3WTU C;  1IN4 A;  1GT0 C;  5E3N A;  5IYC J;  2EIM H;  2JWT A;  1RR7 A;  5DDG A;  3J7A Y;  1P2F A;  2EZI A;  1I3A A;  4A3M J;  1ZG3 A;  1PUF A;  3ELK A;  4XL9 A;  1IUF A;  2CS3 A;  3E3V A;  4ZTF A;  4AD9 A;  4XSZ F;  4DBQ A;  3CJQ B;  2ID3 A;  2KLO A;  4LG0 A;  1QVT A;  2J5P A;  2BOL A;  1TP4 A;  3K69 A;  5KAI C;  4C3H J;  2B63 J;  2L9V A;  1F9N A;  3MEX A;  5BPI A;  2MD5 A;  4WXC A;  2PX9 A;  2X1D A;  3CUQ B;  2LBF A;  3MN2 A;  5IT9 Z;  1HW1 A;  3HJE A;  4LLN A;  4Q47 A;  2EWN A;  2K9N A;  4CCK A;  3MKY B;  2Y0M A;  1REP C;  4M3E A;  2IP2 A;  3G1L A;  2VOP A;  2EFN A;  1X3Z B;  4PJL A;  2A6E F;  3FBN B;  1BM9 A;  4KIG A;  3QP5 A;  4YFK F;  1RIO H;  2NVY J;  3I9V 2;  2GIZ A;  1O3S A;  2DT6 A;  4XN0 A;  2EIJ H;  3IKT A;  1F36 A;  2XF5 A;  5EZH A;  2IA2 A;  3HOW J;  2L7K A;  1Y0U A;  5ICC A;  3HRS A;  5DTD A;  1YIJ I;  4N4N B;  1MSF C;  4ZH4 F;  2TDX A;  2GA2 A;  2XRL A;  4JQF A;  4KN4 X;  1HST A;  2GLO A;  3H5R A;  3FIW A;  4PGH A;  1TT0 A;  3TO6 A;  4QLC U;  1LEB A;  2VOD A;  3TGN A;  5E1X A;  1UB9 A;  3W6K B;  4PZJ A;  1HQC A;  2EIK H;  4UVB A;  5DV5 A;  5DCM B;  1WCM J;  1RR8 C;  1FOW A;  3N97 A;  5DCF A;  5F1J A;  2BE5 F;  4R8H A;  3O6B B;  2ECB A;  3HEF A;  4Y13 A;  4B48 A;  3GTQ J;  1R58 A;  2CRG A;  1V54 H;  1FWZ A;  2ZXJ A;  4CCO A;  4CDG A;  5FLX Z;  1IDY A;  2XHK A;  2OPT A;  4AU7 A;  1BIB A;  2FA5 A;  3BJA A;  3KP4 A;  2LY2 A;  5J3L A;  2FRH A;  1HBX G;  2H1L A;  1RKT A;  3TDU C;  1VND A;  4HAM A;  3S16 J;  4N0B A;  5HNF A;  4A3J J;  3KZY A;  5JHU A;  1B8I B;  1TWG J;  4IQ4 A;  2ZFW A;  1I27 A;  1R22 A;  5H6R A;  2HQN A;  4LG3 A;  5L3G A;  5HS8 A;  2OCC H;  2X6O A;  3FM3 A;  3AAF A;  1SEU A;  2K4J A;  4IL6 C;  3VOE A;  1XMA A;  5K5Q A;  2E19 A;  2VKH A;  2KP6 A;  3ZMS A;  1RUN A;  2IVM A;  1D0Y A;  5EF6 A;  2F6C A;  4EEF G;  1N75 A;  4OIR F;  1WSU A;  1MZB A;  2PJR B;  4HA8 A;  5F1R A;  5FKO A;  2E2J J;  4RLQ A;  3CME I;  2JA8 J;  1P7I A;  1SVO A;  5C3E J;  4HF2 A;  4UUT A;  5HLI A;  3CCJ I;  4I76 A;  4FCY A;  1LDD A;  3IAM 2;  4NQW B;  3HPG A;  2JN6 A;  2L7Z A;  1LKX A;  2R7R A;  1FOY A;  1XN7 A;  2E36 A;  1T2K A;  1Z6R A;  3ZQH A;  1A6I A;  2IW5 A;  4HLY A;  2P6S A;  3OIO A;  2CWE A;  5E1Z B;  2K9S A;  2HZT A;  1SD7 A;  4R1H A;  3OYK A;  4KIB A;  3L7W A;  3R4K A;  3BZK A;  1S6L A;  4M71 A;  1N78 A;  4BE2 A;  4L5I A;  3KZI C;  2LF7 A;  3KP3 A;  2BHY A;  2QLZ A;  5J1Y A;  2YR2 A;  2XRO A;  1BL0 A;  2FOW A;  2NRA C;  1HC8 A;  2EQR A;  2GOX B;  1HOM A;  1IXS B;  5M5W J;  2VT2 A;  4JP0 A;  2X1E A;  3NAU A;  5K7H A;  2WV1 A;  2DOA A;  2HTS A;  2LMD A;  3BWG A;  3I64 A;  1RNL A;  2LF8 A;  2QQA A;  2HVR A;  1Z91 A;  2OJE D;  4E70 A;  4PDK A;  5H20 A;  2QSH X;  4BEH A;  2F48 A;  1ZTR A;  3ONQ A;  5FJ8 J;  1GLN A;  1FBQ A;  1U9N A;  1IV6 A;  3KE2 A;  3G4S I;  5KHD A;  2R7Q A;  2Q8K A;  4U7B A;  2IPQ X;  3CES A;  2YSR A;  1ZYR F;  3WHC A;  3E5X A;  4PCQ A;  5IOY A;  3JRC A;  2W84 A;  2IGM A;  3PNY A;  2VQH A;  3QWL A;  1IRX A;  4TV7 A;  1MNM C;  2IRF G;  3LMM A;  3ZQC A;  3AL0 C;  4DJA A;  3MZY A;  1X3W B;  4NB5 A;  1F1Z A;  1SVM A;  2OZ6 A;  3E6D A;  3J80 K;  2EFO A;  2IGO A;  4D7N A;  2JSC A;  5KNL A;  3GXO A;  2L02 A;  4Y3O A;  1P4X A;  2W24 A;  3CP8 A;  3LSJ A;  1IRF A;  1QZY A;  3K2A A;  2WA0 A;  3T8R A;  4BS9 A;  3K9T A;  2LRD A;  3L2W A;  1LE8 A;  2RQP A;  2IGN A;  2L7M P;  2QQ8 A;  3W2W A;  2A69 F;  3WTV C;  4YEJ A;  4XBF A;  2NS7 A;  2OTJ I;  2F5V A;  5J1U A;  4UUS B;  3SZG A;  2HWV A;  2ZXH A;  3NEU A;  4A6D A;  1WJF A;  2R7V A;  4U87 A;  2FBH A;  2DFH A;  2I8D A;  3HPH A;  2O3F A;  4RDU A;  2QQB A;  1B9M A;  1BI0 A;  4M3F A;  4WK8 F;  1WKM A;  1W4M A;  4I09 A;  4PGG A;  1BOA A;  5LFA A;  1Y6I A;  3PO3 J;  3PFY A;  1U5T A;  4HNU A;  1JJ8 C;  1OMI A;  2K86 A;  2QUF A;  1ZG5 A;  2RV8 A;  4XLE A;  5CVV A;  1BI2 A;  3VYR B;  3SHF A;  4C3J J;  1BJZ A;  4LJZ F;  4IHS A;  1ETY A;  1MMN A;  3SFI A;  1WRJ A;  4U0V A;  4PJM A;  3LOC A;  2M4K A;  4XID A;  3CC7 I;  4A93 J;  3UR3 C;  1YYV A;  4C2M J;  5FLM J;  1ZKG A;  4B1R A;  1MJA A;  1NHA A;  5E3M A;  2C6Y A;  5HDK A;  1FTT A;  2Z99 A;  3V7C A;  2KMU A;  1ZK8 A;  1W36 D;  2RN7 A;  3F8B A;  4LLG F;  3PL8 A;  3ZQL A;  4FAS D;  2LYC A;  1X58 A;  2V7F A;  3S8P A;  2GXA A;  1XCB A;  2K9M A;  3Q9V A;  4MTD A;  1I6H J;  1HKT A;  3ZR8 X;  1W5C C;  4HX7 A;  1NK3 P;  1B1B A;  3FKJ A;  2KJB A;  3VPR A;  1O7L A;  3SEQ A;  4DYQ A;  3CCR I;  1XSD A;  3GTM J;  1K83 J;  5HNH A;  1IW7 F;  2K02 A;  4UB8 C;  3C7J A;  3TQN A;  4UV9 A;  3QP6 A;  1WGX A;  2MSY A;  3SYT A;  5ICE A;  4II3 A;  3JSO A;  3HGG A;  4KT5 C;  5K5O A;  1V5F A;  1W7P D;  4M72 A;  3FXQ A;  2PMZ A;  1YTY A;  4JOM A;  1IO2 A;  4NUB A;  5EEH A;  5ERI A;  4KA4 A;  2ZNY A;  1TW3 A;  3WGI A;  2NOJ B;  1J5Y A;  1FX7 A;  2VPR A;  3E1S A;  3GME A;  2JMW A;  2VJJ A;  1YQA A;  3K6G A;  3PM1 A;  3M8E A;  2JQ7 A;  3FXO A;  1HLV A;  2OD5 A;  1ZRD A;  1Q1V A;  3V7R A;  2QBY A;  4CYC A;  3IWF A;  2H6B A;  5CPR B;  1MGT A;  2BY3 A;  2E5N A;  3WHB A;  3H1C A;  3QPL A;  3QYB A;  3OOP A;  1WJC A;  3I71 A;  5J8F A;  1MBH A;  2X48 A;  2KIF A;  2XF7 A;  2XGC A;  1W0U A;  2O5R A;  3H5N A;  2JA5 J;  1X1C A;  4P9F A;  4A0X A;  1XX5 A;  4LD5 A;  1BC7 C;  1M1E B;  1MJB A;  1OYW A;  1FMV A;  2AO9 A;  2ESH A;  2VC0 A;  4RM3 A;  3A02 A;  3F21 A;  2HFH A;  1OFC X;  3J7Y J;  2MH9 A;  2QKM B;  1ON1 A;  1YG2 A;  2AQF A;  2LLK A;  2ZO4 A;  5EEG A;  2ICW G;  1QHH D;  3TP0 A;  2GQQ A;  3AG2 H;  1XSV A;  2YUS A;  3KEQ A;  4WXH A;  5F0F A;  4EM2 A;  2PJP A;  3CCL I;  3M3Y J;  1BIA A;  2P7V B;  4I7H A;  4RAG A;  2BBY A;  5LEJ A;  1D5Y A;  3O8G A;  4KT6 A;  2R7D A;  4EV0 A;  2R92 J;  4BGD A;  1DUX C;  2HQ5 A;  3H5A A;  2P5L C;  3OS0 A;  3DU5 A;  4HST A;  2UXX A;  3R0J A;  1E3O C;  2BY1 A;  4DOZ A;  1FBU A;  1FC3 A;  2Y30 A;  1ZAO A;  4XLC A;  2L01 A;  2R5Z B;  3SQN A;  1UST A;  3P5J A;  2VIX A;  2X85 A;  1TW2 A;  2KFD A;  1G6N A;  1X4O A;  1RET A;  3BG9 A;  4ZYE A;  2HDW A;  2M87 A;  1MSE C;  5FFZ A;  1MMG A;  2DPU A;  3CC4 I;  1SVL A;  4FHT A;  1S8N A;  3F9K A;  1G3S A;  2M8E A;  2K9Q A;  4KFC A;  2ACJ A;  2LH9 A;  4B8X A;  5LHG A;  5EYR A;  2DLL A;  4KIS A;  2RQQ A;  4FET A;  3LNQ A;  4RAZ A;  2CU7 A;  2XPV A;  3RKY A;  1XC5 A;  4A0Y A;  4CXF A;  2CUE A;  3F0C A;  4IO9 F;  2G7U A;  1DGW Y;  3FM5 A;  4E7Z A;  1U0J A;  5JR3 A;  4Y52 J;  2RRE A;  3OIP A;  4DGW B;  5EG0 A;  2ZBK A;  2ZXI A;  5GTI C;  3ABL H;  5HLH A;  4IX7 A;  1ONV A;  4IHX A;  1Y56 A;  1A35 A;  2K40 A;  1FOK A;  4IKF A;  3D5R C;  3FF5 A;  2DA7 A;  1FLI A;  1I6X A;  2ZME B;  4E7I A;  2L2O A;  4AIJ A;  4LIV A;  3RYR A;  2IS2 A;  2Q1Z B;  3S93 A;  5DS9 A;  2CUF A;  1FSE A;  2TRT A;  3GEZ A;  1VF9 A;  3DEU A;  2R7X A;  4CCM A;  4HG2 A;  4AUX A;  1Y1W J;  2M4G A;  3HKZ N;  5DYM A;  1YJW I;  2CQQ A;  5F6F A;  5B3S H;  3IKV A;  3HHG A;  2K7L A;  2Q2E B;  1APL C;  1WVR A;  4M6V A;  3K70 C;  3CDI A;  3HTU A;  4XRF A;  2B9S A;  4D5F A;  2QZ8 A;  3I56 I;  4DYR A;  1GUU A;  1YFH A;  2Y48 A;  2PMH A;  3H9G A;  3ZQQ A;  3W3C A;  3D0S A;  5FKN A;  2COM A;  2MFZ A;  1HF0 A;  1R36 A;  1S72 I;  3DEW A;  5FKL A;  1K6O A;  3A03 A;  4OIP F;  1D1A A;  3B73 A;  4HSR A;  3GTG J;  5BMZ A;  2R7O A;  3H35 A;  3NWT A;  4Y17 A;  5FKM A;  1LB2 A;  4PFO A;  3T5X A;  3ZQG A;  4ZYG A;  2IA0 A;  3CJR B;  3RQI A;  4ANJ A;  1XCV A;  4Y15 A;  2LKS A;  3TMO A;  4OWR B;  2JA7 J;  4FT8 A;  1S7E A;  1WH7 A;  2BV6 A;  2XRN A;  3L2R A;  3N4M A;  3R60 A;  1IXR C;  1R23 A;  1E3H A;  2E7W A;  2VB6 A;  1OPC A;  4G8X A;  4A3D J;  1R5I D;  1JKR C;  5K1Y A;  1CGP A;  3S14 J;  2BY0 A;  2CW0 F;  1ERD A;  2EV5 A;  1BR1 A;  4L0Y B;  3G73 A;  2LK2 A;  5D6F A;  4HEA 2;  3FIS A;  1LJ9 A;  2BY2 A;  1IDZ A;  1ZGW A;  4HF0 A;  1R5G A;  1L0O C;  1Z05 A;  2RKH A;  1SFE A;  3JRA A;  1G8X A;  2DMP A;  2BVM A;  4D9J A;  1WI9 A;  4G7O F;  4AC0 A;  1PP8 F;  3JR9 A;  4CCN A;  2JRT A;  3PSI A;  4J19 A;  1KU9 A;  2MD0 A;  2QCO A;  5D6E A;  4FIS A;  1R9T J;  3HRT A;  1XB4 A;  4HV5 A;  3W2A A;  3ABM H;  2NVT J;  1D5V A;  5L3D A;  2OTL I;  3KYC B;  5EGO A;  3S1N J;  2ZCW A;  3RZO J;  2F4O B;  4ENK A;  2CFX A;  1OCP A;  1U8B A;  3GLL A;  2DOD A;  2ESN A;  1ZGA A;  4II2 A;  4A3I J;  2HVS A;  2EV0 A;  2A07 F;  3BG6 A;  1TZL A;  2EV6 A;  1KU3 A;  1QHG A;  2KIM A;  2XC7 A;  3EQL F;  1RPW A;  3CLQ A;  3DPL C;  3F8F A;  3QPS A;  1NG6 A;  1BW6 A;  1D3Y A;  4YFN F;  2Y9Z A;  3M07 A;  3I5U A;  4JX5 A;  1ZG1 A;  1VI0 A;  1Y8Q B;  2B0L A;  5IYB J;  1E0E A;  3OYM A;  2ETH A;  2VN2 A;  2Z5U A;  4B4C A;  4EMS A;  1HKS A;  2H6C A;  4C9Y A;  1YRN A;  3I54 A;  5FFX A;  5GTH C;  2R7S A;  5GP9 A;  1X19 A;  3WU1 B;  3LSH A;  1P4A A;  4V19 K;  3RJP A;  5K7F A;  1KA8 A;  3DLA A;  3QPT A;  4I99 C;  1RUO A;  2EFQ A;  2ZSI B;  4BYY A;  5GPC A;  2Y2Z A;  3FZV A;  3K4N A;  2R93 J;  4BE1 A;  5FKK A;  1SMT A;  4XOT A;  1JKP C;  3CCE I;  3CUO A;  2RDP A;  1K7A A;  4BH9 A;  3NQO A;  4L18 B;  2E5Z A;  1WI3 A;  3PNT A;  2UUZ A;  2F4M B;  3L2U A;  2HXO A;  3F22 A;  3K4B A;  1JT6 A;  3GUD A;  3BTI A;  3OYN A;  1Z1D A;  4YIR X;  5F0H A;  2A61 A;  2HYG D;  4NHJ A;  1W0T A;  5HOO A;  4IOC F;  3EET A;  2CG4 A;  1YLF A;  2LY1 A;  1W7P B;  5E17 F;  4A2U A;  3CJN A;  2P81 A;  2R3S A;  2VKV A;  3DLL F;  2W1O A;  3I3L A;  2PQ8 A;  4LIT A;  4UXN A;  3E5U A;  4M9X A;  4UB6 C;  3L1P A;  4HYE A;  2E1C A;  1OKR A;  1H8A C;  1GDT A;  2VQL A;  3CCV I;  2R7T A;  1T33 A;  4IRH A;  2DA4 A;  4NBQ A;  2DAO A;  2UXN A;  2VJ4 A;  1UHS A;  5J4Y A;  4C2T A;  1J9I A;  1AOY A;  3PIP F;  1QBJ A;  4H4K C;  1AKH A;  1WWX A;  2XKP A;  1Z67 A;  2F5C A;  3PUF A;  1TWA J;  4RB1 A;  3BCB A;  3J81 Z;  2HPM A;  1UEL B;  3H3V K;  1A36 A;  3K4C A;  1T38 A;  9ANT A;  3E7L A;  4ZYD A;  1P7J A;  3MZ8 A;  2VON A;  2Z16 A;  4BHP A;  2JSP A;  2BHZ A;  2XF6 A;  4A0Z A;  3U1D A;  5M3M J;  3EDP A;  1YX3 A;  2MYS A;  3JAM Z;  3A2K A;  4Y33 A;  2I5U A;  3X2Q H;  3HYI A;  4O3M A;  4HZF A;  3K10 A;  3BR1 A;  4BAC A;  2H94 A;  1QZZ A;  1TL8 A;  1LEA A;  2WWY A;  1BN5 A;  5F64 A;  1MBJ A;  3U21 A;  4JX6 A;  2OBP A;  1VQO I;  1MMD A;  1O3T A;  2H8R A;  3DKX A;  3VSK A;  3CCQ I;  1FNN A;  4OOI A;  4B47 A;  3CCY A;  4UHT A;  2LTP A;  4UY8 I;  1POG A;  3CCS I;  2KDO A;  1R7J A;  4EM0 B;  2PJR A;  4DW6 A;  1DGR M;  3LSG A;  4BJT A;  1K6Y A;  3IP4 B;  2FSW A;  3QU6 A;  2DA1 A;  3WTZ A;  2W48 A;  2EZL A;  3GYH X;  3RKQ A;  2WAD A;  2E60 A;  1NTC A;  2RAE A;  2MC4 A;  4IQJ A;  3M9A A;  5L3B A;  1TC3 C;  4WCG A;  2O7O A;  2YPR A;  1YS7 A;  2K3F A;  1GVJ A;  4DQ2 A;  1XMK A;  3VYT B;  3FXM A;  3IWZ A;  5D8K B;  4ZDL A;  4U0W A;  4CZZ A;  5KCM A;  4YG2 F;  1H89 C;  3M1C A;  4QPQ A;  2DMU A;  2CSO A;  2QGU A;  3ML6 A;  1SC7 A;  4PSX A;  3G3Z A;  5D4R A;  1PUF B;  2ZJP F;  2OZU A;  2Z9O A;  4PK4 A;  2IA1 A;  2XSD C;  4MNU A;  4AYB N;  3OYA A;  4LG0 B;  1P4W A;  2PFB A;  5CVR A;  3ECO A;  4U0Y A;  1IN5 A;  3CCM I;  2EIN H;  3SXY A;  2IEK A;  3LFK A;  4PJJ A;  2COB A;  1ZEL A;  2K5C A;  2EB7 A;  1VQ5 I;  2LC2 A;  4A12 A;  2FU4 A;  1OIS A;  1ZRE A;  2DMT A;  1LQ1 A;  5A2Q Z;  3JRD A;  1JHF A;  2GBY A;  2D45 A;  4DBR A;  4XKV A;  3CLO A;  1LUJ B;  4FX4 A;  3MAJ A;  4G6Q A;  4AVP A;  2XPU A;  3I4N J;  5AON A;  3OSG A;  3GO5 A;  4I01 A;  5HDG A;  3S3N A;  2BGC A;  2DMN A;  4IEJ A;  2NAZ A;  2ZKZ A;  1MH3 A;  4X1E A;  2DT5 A;  5DUI A;  2DFE A;  2XPW A;  4RGS A;  3UNG C;  4A3E J;  1V5E A;  1OR7 C;  2X6X A;  1L3L A;  2L5Q A;  4MFD A;  2ISZ A;  3Q0W A;  2FJ1 A;  2LY9 A;  3QYF A;  1K61 A;  3G2B A;  3LWF A;  2NVU B;  3DEE A;  4HW0 A;  3VSL A;  4HDV A;  3D5S C;  3FXK A;  5C44 J;  5LD2 C;  2RGV A;  1YJ9 I;  3M8J A;  3ZN0 A;  3C2B A;  2Y69 H;  4BE0 A;  1YX5 A;  3PQK A;  2FX0 A;  3S15 J;  1OCR H;  1YW7 A;  2WV0 A;  2M7A A;  2IXS A;  5JLX A;  3TO7 A;  3EUK L;  3FHN A;  2L9R A;  1TQI A;  4RBO A;  3L09 A;  1H88 C;  2M3A A;  1F4K A;  2R5Y A;  2JUG A;  4E4H A;  5E79 C;  3RPQ A;  1UHW A;  2ME6 A;  1LFP A;  4FQG A;  2MLK A;  3RDI A;  4AVZ A;  3GFI A;  2O6G E;  4DNC A;  2LKP A;  3QOP A;  3V8J A;  3ERE D;  1SFK A;  1HW2 A;  3F8M A;  2L4A A;  4O6J A;  4FE4 A;  3WTT C;  5E20 A;  3GFM A;  3DTE A;  3WU0 A;  2CQN A;  3QPH A;  4RAF A;  2BEO A;  2VJI A;  4KMF A;  1R4N B;  2FQ3 A;  3KP2 A;  2XAU A;  5ED4 A;  3Q3S A;  1O3R A;  1ON2 A;  2OU2 A;  2XKO A;  3R6S A;  3IHU A;  1ETO A;  1DP3 A;  4XM3 A;  4QTR A;  3LA2 A;  3BLY A;  1IN8 A;  2CO5 A;  4A3K J;  2DOE A;  4A5M A;  1IC8 A;  1IXC A;  2EZH A;  2CW7 A;  3DFG A;  5DD8 A;  2G0E A;  2ZSH B;  5HLG A;  3UKG A;  4HPQ A;  1UJ8 A;  3I4P A;  4F7Z A;  2DPD A;  2VXZ A;  4NC7 A;  1X1B A;  1J0R A;  2KIQ A;  4W1U A;  4M6Y A;  2M2E A;  3FDY A;  3LQR A;  2EBI A;  3D5L A;  3M1E A;  3U2R A;  5LRS A;  1DDN A;  4OU0 A;  2KL4 A;  3WTX C;  1MDM A;  5CVI A;  4KDP A;  3P9C A;  4I98 B;  4RMN A;  1WZ2 A;  3ABT A;  4O5V A;  4A5N A;  2GAU A;  4UVC A;  4A6E A;  4DZJ A;  4CZC A;  5KK1 A;  3DBH B;  2V9P A;  4HNT A;  1U8R A;  3MMY B;  3TBI A;  1BJA A;  3F3X A;  2BW3 A;  3GTL J;  1XDS A;  2V9V A;  5IT9 K;  5L3C A;  2W82 A;  2V4J C;  4BEH B;  4E7H A;  1O4X A;  4A3G J;  2VKD A;  2QSF X;  3HOV J;  1HCR A;  5J8C A;  3LFU A;  4M74 A;  1VQN I;  3DKW A;  1T98 A;  2KRH A;  2PI0 A;  4P96 A;  4L0Z B;  4XKB A;  1BI1 A;  1Z77 A;  2V26 A;  4BXU A;  3EYI A;  2L0K A;  4KN7 X;  2Y31 A;  3DTK A;  4EGY A;  1TNS A;  3VDX A;  2DA2 A;  4AID A;  1I1G A;  4I2O A;  3DF8 A;  2M34 A;  3HSF A;  1V55 H;  2VE8 A;  4OIN F;  3VYU B;  1E17 A;  2PEX A;  2M9H A;  4MIM A;  4B44 A;  2HQR A;  4XOP A;  1OLT A;  5FRM A;  1RZ4 A;  3BG7 A;  1DPU A;  2D1H A;  3OS1 A;  2FNP A;  1I39 A;  3AG1 H;  3F72 A;  4X6A J;  5LGN A;  5HDN A;  4QSH A;  2WY7 Q;  1LE8 B;  3A1Y A;  3H92 A;  4F52 A;  2MH2 A;  4QWQ A;  2KZV A;  1VQM I;  2P8T A;  1TBX A;  3FMR A;  1ZRC A;  2EJR A;  5FLX K;  1D0X A;  3H9Q A;  3KP5 A;  3WGG A;  3ZPL A;  3LAP A;  5HS7 A;  2IJL A;  3BQY A;  5ICG A;  2JZY A;  3H0D A;  1SAX A;  1S9H A;  4IXA A;  3W6V A;  5LHI A;  3HKZ A;  1Z3Y A;  3PUB A;  1SAN A;  1J2X A;  2WAF A;  3ZMZ A;  1FZP B;  4XON A;  3GTO J;  1OR7 A;  3PFI A;  5AIP A;  1B59 A;  4S04 A;  2N8G A;  1U5T B;  3JRI A;  1D1B A;  3G6E I;  3KP6 A;  2VBX A;  5FD5 A;  2D1V A;  4XLH A;  3WOD F;  4CUG A;  2IS1 A;  5TGT A;  1KGS A;  3RYP A;  3PO2 J;  4FTH A;  1W36 C;  4JX4 A;  2DFF A;  3EYY A;  2BXZ A;  2P0W A;  1R6R A;  3BC8 A;  1DU6 A;  1USS A;  1VQ9 I;  3DP7 A;  3LL7 A;  2VOO A;  2F5D A;  3T0Y A;  3ZMT A;  1KU7 A;  2MBF A;  1YOV B;  3RZD J;  4EVI A;  1VTN C;  4B43 A;  1J7K A;  4IHV A;  3L00 A;  3KYD B;  2EZK A;  2HDC A;  5JFR A;  5KVR A;  4P55 A;  1K78 A;  1UCR A;  3CQZ J;  3GWZ A;  2CUJ A;  3MQ0 A;  3WG9 A;  5FRN A;  1FIA A;  1MBK A;  1WH5 A;  1KQ9 A;  2M0M A;  3HRM A;  2ID6 A;  4PFP A;  3OYD A;  2DU9 A;  3U9G A;  2B7E A;  2HYF A;  2DXI A;  3R61 A;  2HNH A;  3S2D J;  2HPI A;  2KIU A;  2XSJ C;  4OAZ A;  4G7Z F;  4LB5 A;  2NS8 A;  3OL4 A;  3LSM A;  2JVH A;  3CMA I;  4IRI A;  3LST A;  2CV1 A;  2QEN A;  1JI8 A;  1QO0 D;  2QQ9 A;  2UZK A;  4V2G A;  4XSX F;  2CV0 A;  5DM7 F;  3BR3 A;  1WPK A;  3CCU I;  5B1B H;  3E6B A;  4ASN A;  1IN6 A;  3B6A A;  1JKO C;  4I0A A;  3BQZ A;  1U78 A;  2LOO A;  4B3X A;  1FPQ A;  3DXJ F;  3R0A A;  2M5W A;  4ZDO A;  2ADU A;  3K70 D;  2DQR A;  1T6S A;  2XAF A;  1QPM A;  4KMU X;  3OYF A;  1S5L C;  2QBY B;  4CYC B;  4IRG A;  3CUQ C;  1LDJ A;  4XLA A;  2ZXW H;  5IOZ A;  1Z6T A;  2DA6 A;  1R5H A;  2E2I J;  1VQ7 I;  5FB2 A;  3FWE A;  3T1B A;  3WE3 A;  2ZJQ F;  2L9S A;  2DT7 B;  2YU9 J;  4CYD A;  1N25 A; 
#chains in the Genus database with same CATH homology
 3K1M A;  2HTJ A;  2GA1 A;  1PUE E;  4LGW A;  1ZRF A;  1R1U A;  5LBQ A;  4HLX A;  1CF7 B;  2STW A;  3H3U A;  4EM1 A;  1UHM A;  3VEP A;  4BHB A;  2OA4 A;  3HUG A;  4EJT A;  4OMZ A;  4EGZ A;  3LA7 A;  2PBI A;  3BOQ A;  2VBY A;  1BI3 A;  4G94 A;  3B02 A;  4M9S A;  2CQK A;  3IRR A;  4AWX B;  4ZYH A;  3WE2 A;  2YU3 A;  1XGS A;  2KJC A;  2EFW A;  3KCC A;  3GX4 X;  1TTY A;  2QWW A;  4HX4 A;  2R7F A;  1ZAR A;  5FGM A;  4WF2 A;  3ZQ7 A;  1XDU A;  2GXB A;  2Z3Y A;  3I53 A;  3HSR A;  3CO6 C;  2YX7 A;  4CHU A;  1SFU A;  1SD4 A;  1KQ8 A;  4KIF A;  4IF4 A;  2LSO A;  3L9F A;  3E97 A;  3QRF F;  1YIO A;  1TQM A;  1V4R A;  4N9H A;  3VB2 A;  2FEZ A;  2Q0O A;  5CVJ A;  4HQE A;  4JK1 X;  1G3W A;  2DFI A;  4MGR A;  4L9J A;  1QNT A;  2P5K A;  4B09 A;  3LA3 A;  4KIC A;  2QVO A;  2H27 A;  4M73 A;  1FYM A;  3ISP A;  3MFK A;  2Y75 A;  1U6G A;  3BZ6 A;  1ZH5 A;  2DI3 A;  1TNT A;  1I1S A;  1H9T A;  2FNA A;  1W7P A;  4RB2 C;  1O7F A;  3PQJ A;  3KP7 A;  5E8I A;  2FBI A;  4YFX F;  3I59 A;  1JXS A;  4FX0 A;  1A04 A;  3MWM A;  2P5V A;  5D5V B;  3LAJ A;  2XGX A;  3F23 A;  4MQ9 F;  1FYK A;  1P6R A;  2VT3 A;  3WTY C;  5E8G A;  5ILV A;  1KU2 A;  4BAY A;  3MZH A;  2MC3 A;  4WWC A;  4IJA A;  5TRD A;  2HS5 A;  3V7S A;  3VOD A;  3CUQ A;  4HX8 A;  2AXL A;  3P9K A;  2HOE A;  2RVC A;  3FXR A;  4MTE A;  4WX9 A;  5HVQ C;  5L3E A;  1GHC A;  2VC1 A;  5HS9 A;  4L9V A;  2AS5 F;  1ODD A;  3T8T A;  4S05 A;  4ZZL A;  3RIR A;  3BDD A;  3J80 Z;  2MLG A;  2DQL A;  1WQ2 A;  1IN7 A;  2O8X A;  3K0L A;  3IL2 A;  1AWC A;  4KYW A;  2HKO A;  3C3W A;  4LMY A;  4HBL A;  2V1D A;  3ZP5 A;  2OQG A;  5DCM A;  1HKQ A;  2X0L A;  2O03 A;  3TOA A;  3ZMD A;  1R1T A;  2DO7 A;  3F6O A;  2DBB A;  3HRU A;  5J6X A;  3ECH A;  5D5U B;  3FHZ A;  4GYG A;  3QAH A;  3CO7 C;  4CIC A;  2J5O A;  3KLN A;  1R00 A;  3V4G A;  1ZLJ A;  5E18 F;  4P9U A;  3V8L A;  3WGH A;  1P92 A;  2X4H A;  4OIQ F;  4NQW A;  3WTS C;  2XAS A;  3DV8 A;  3GFL A;  1STZ A;  1J75 A;  1B4A A;  3K2Z A;  1DPR A;  1U5T C;  4KNY A;  1KYZ A;  3GVA A;  1FP1 D;  3RTR A;  5DUK A;  4YII A;  1S7A A;  1QQI A;  2GIV A;  1MJ9 A;  2VBZ A;  2A6H F;  1R1V A;  3E6M A;  2HKX A;  3FX3 A;  2K4B A;  2W57 A;  3I58 A;  1JGS A;  2F2E A;  1ZHF A;  2XV4 S;  3SZP A;  5BQT A;  5D5W B;  1JHH A;  5L3F A;  2F5E A;  2FE3 A;  1H9G A;  4UVA A;  4GCV A;  4WXD A;  4I0B A;  1BBY A;  3BRO A;  1X3U A;  3HHH A;  1E2X A;  3BPV A;  3GZ6 A;  4ENJ A;  2VBW A;  2XAH A;  4LK0 F;  3RPU A;  3H3Z A;  5BPD A;  2W25 A;  3ROU A;  1JE8 A;  4UNO A;  1IAW A;  3NRV A;  2NS0 A;  3RKX A;  4OIO F;  3C1D A;  3LQQ A;  4HF1 A;  4UV8 A;  5LGU A;  2WTE A;  2M45 A;  1S7O A;  1O57 A;  4XLN F;  3TKY A;  2PN6 A;  1DP7 P;  4HDU A;  1BC8 C;  3I0T A;  1W5T A;  1LNW A;  2QYO A;  5LRR A;  2P6T A;  1TLH B;  2ZJ2 A;  3JTG A;  4LB6 B;  1S3J A;  4EJO A;  4L5J A;  4EJV A;  2LDU A;  3P7N A;  3MCZ A;  2EFP A;  3F8N A;  1T39 A;  1LDK B;  2H09 A;  2OQR A;  3F6V A;  3J81 K;  4GYI A;  3WTW C;  4RS8 A;  3L2C A;  3S2W A;  5DEQ A;  1HXD A;  2STT A;  4R79 A;  4MQV A;  1G3Y A;  5ICF A;  3GF2 A;  4MEY F;  4U88 A;  5CYV A;  3COA C;  2P4W A;  2V6C A;  3JAM K;  1FBS A;  2XAJ A;  3EUH A;  3ULQ B;  1KYW A;  2A5Y B;  3E5Q A;  4EJW A;  5ILU A;  3TO9 A;  5K5R A;  4GO1 A;  3BY6 A;  4HOB A;  4HV6 A;  3KEO A;  5FO5 A;  3SZT A;  1FP2 A;  4H0E A;  1O3Q A;  2XIG A;  2MA3 A;  4L9T A;  1B9N A;  2QM3 A;  5FD6 A;  4GGG A;  1J59 A;  2E7X A;  4BNC A;  2HEO A;  4RGR A;  4CGZ A;  4Q48 A;  2V1U A;  1OYY A;  1KQ0 A;  3M8F A;  1GXP A;  4IVN A;  3KLO A;  1MDM B;  1T0F A;  4G6D A;  1Z7U A;  4AIK A;  2XAQ A;  4LK1 F;  2Z33 A;  1I5Z A;  2GZW A;  2P7C B;  5A2Q K;  4CO8 A;  2DK8 A;  2A68 F;  2DW4 A;  2ZNZ A;  3QU3 A;  4D0P A;  2NYX A;  1ZN2 A;  4JBA A;  4M9Z A;  4ESJ A;  3KFW X;  5LLQ A;  5AIQ A;  1SMY F;  1F5T A;  2ZME A;  2L3D A;  4L9N A;  2EA2 A;  5BS6 A;  1CF7 A;  4BHC A;  3W6J B;  2ELH A;  1Z9C A;  1HSJ A;  1D8J A;  5CVU A;  3JW4 A;  2HR3 A;  2Q2E A;  3FMQ A;  1YW8 A;  4IPA A;  1EH6 A;  2FF4 A;  2BYV E;  2EA4 A;  3F8C A;  4U7D A;  1XGM A;  3HTS B;  2E1N A;  3GZ5 A;  1QGP A;  3TDZ C;  3DPT A;  1U2W A;  5LGT A;  2M1B A;  1GXQ A;  4RAY A;  4UUV A;  1B6A A;  2K27 A;  4ESB A;  4G7H F;  2G9W A;  4IHT A;  3ZN1 A;  3BJO A;  3DQV C;  4RB3 C;  3JSP A;  4BQA A;  3IC7 A;  3O2P E;  3FMS A;  3OV8 A;  1SFX A;  1K78 B;  1IF1 A;  4K2E A;  4MHG A;  3GLX A;  2O0Y A;  2XUB A;  4Q5S F;  2FXA A;  5D5X B;  3C18 A;  1G3T A;  2ISY A;  4LLL A;  2HGC A;  2KKO A;  5CLS A;  1Q1H A;  1YW9 A;  3Q5F A;  3HOT A;  1S29 A;  2RC4 A;  3O3K A;  1FSH A;  2DK5 A;  1IUY A;  2PG4 A;  4KUM A;  5D4S A;  4GXO A;  3REO A;  3ZMU A;  2L4M A;  1V3F A;  2DTR A;  4G9Y A;  2V79 A;  4ZZD A;  3HIF A;  3GW2 A;  1UFM A;  2IT0 A;  4EQQ A;  1LVA A;  4Z2Y A;  4ENM A;  1ZLK A;  3GFJ A;  2JPC A;  2L54 A;  1ULY A;  2JT1 A;  4AIH A;  2PMU A;  1SD6 A;  2F5F A;  2PLY A;  1FYL A;  1TQP A;  3HOS A;  2LNB A;  2CGP A;  5H6Q A;  1MKM A;  1PP7 U;  3CTA A;  4ON0 A;  2GWR A;  2A3S A;  1MD0 A;  4RGU A;  2W85 A;  1XGO A;  3JTH A;  5JI6 A;  1FY7 A;  2XAG A;  3KZZ A;  2VE9 A;  1G4D A;  4YIF A;  2YX4 A;  5DD4 A;  1PDN C;  4Q4Z F;  6PAX A;  4ESF A;  3IRQ A;  5ILS A;  1EV7 A;  4MEX F;  3RI4 A;  1EH8 A;  3E6C C;  2CYY A;  5TJJ A;  4RB0 A;  3FXU A;  3RKW A;  3V8K A;  1D8K A;  1ZGJ A;  4ENN A;  1XD7 A;  2FML A;  2GXG A;  1EH7 A;  3M7G A;  2EK5 A;  3CDH A;  4HQM A;  2FBK A;  2NNY A;  2FOK A;  4N9I A;  5IT3 A;  1HW5 A;  3P9I A;  2KRF A;  5JVT A;  1IRG A;  1XSX A;  5LHH A;  1IZ1 A;  1YO5 C;  1K79 A;  3BPX A;  2G7H A;  5E1W A;  3ZMV A;  4M6X A;  2V1X A;  3K1N A;  2RNJ A;  3VFZ A;  4OMY A;  3TOB A;  4ETS A;  1XGN A;  3J7A O;  1H0M A;  5CJ9 A;  4XLP F;  4P5O A;  2O61 A;  4EJU A;  2FMY A;  3ABU A;  2M30 A;  1SD5 A;  5D8L B;  2XVC A;  5LEK A;  1W5S A;  2WC2 A;  3KET A;  3BJ6 A;  3SFZ A;  5BOX A;  3BP8 A;  2D2W A;  3HSE A;  1RI7 A;  2UWM A;  4I02 A;  1C0W A;  1U3E M;  2JPB A;  2NNN A;  2OAZ A;  4RGX A;  2JTV A;  3K1P A;  1OYI A;  3Q9S A;  1FT9 A;  3I59 B;  4LFU A;  1YS6 A;  3WTU C;  1IN4 A;  5DDG A;  1P2F A;  1ZG3 A;  3ELK A;  3E3V A;  4AD9 A;  4XSZ F;  4LG0 A;  2J5P A;  3K69 A;  1F9N A;  3MEX A;  5BPI A;  2MD5 A;  4WXC A;  3CUQ B;  5IT9 Z;  1HW1 A;  4LLN A;  4Q47 A;  2EWN A;  1REP C;  2Y0M A;  2IP2 A;  2VOP A;  2EFN A;  2A6E F;  1BM9 A;  4KIG A;  3QP5 A;  4YFK F;  1RIO H;  1O3S A;  3IKT A;  2IA2 A;  1Y0U A;  5ICC A;  3HRS A;  4ZH4 F;  2TDX A;  2GA2 A;  4JQF A;  4KN4 X;  1HST A;  4PGH A;  3TO6 A;  4QLC U;  1LEB A;  2VOD A;  3TGN A;  5E1X A;  1UB9 A;  3W6K B;  4PZJ A;  1HQC A;  4UVB A;  5DV5 A;  5DCM B;  3N97 A;  5DCF A;  4R8H A;  2BE5 F;  3O6B B;  4Y13 A;  1R58 A;  4CDG A;  1FWZ A;  2ZXJ A;  5FLX Z;  2XHK A;  1BIB A;  2FA5 A;  3BJA A;  3KP4 A;  2FRH A;  1HBX G;  3TDU C;  4HAM A;  4N0B A;  3KZY A;  5JHU A;  2ZFW A;  1I27 A;  1R22 A;  5H6R A;  2HQN A;  5L3G A;  5HS8 A;  3FM3 A;  3AAF A;  2K4J A;  3VOE A;  1XMA A;  5K5Q A;  3ZMS A;  1RUN A;  2IVM A;  1WSU A;  4OIR F;  1MZB A;  4HA8 A;  5F1R A;  4HF2 A;  5HLI A;  1LDD A;  1XN7 A;  1T2K A;  1Z6R A;  2IW5 A;  4HLY A;  2P6S A;  5E1Z B;  2CWE A;  2HZT A;  1SD7 A;  4R1H A;  4KIB A;  3L7W A;  3R4K A;  1S6L A;  4M71 A;  4L5I A;  2LF7 A;  3KP3 A;  2QLZ A;  2XRO A;  2YR2 A;  2NRA C;  1IXS B;  2VT2 A;  2HTS A;  3BWG A;  3I64 A;  1RNL A;  2LF8 A;  2QQA A;  1Z91 A;  4E70 A;  4PDK A;  5H20 A;  1FBQ A;  3KE2 A;  2Q8K A;  4U7B A;  2IPQ X;  2YSR A;  1ZYR F;  3E5X A;  4PCQ A;  2W84 A;  4TV7 A;  2IRF G;  3MZY A;  4NB5 A;  1F1Z A;  2OZ6 A;  3E6D A;  3J80 K;  2EFO A;  2JSC A;  3GXO A;  2L02 A;  1P4X A;  2W24 A;  1IRF A;  1QZY A;  3T8R A;  3K9T A;  2RQP A;  2A69 F;  3WTV C;  4XBF A;  2HWV A;  3NEU A;  4A6D A;  2FBH A;  2O3F A;  2QQB A;  1B9M A;  1BI0 A;  4WK8 F;  1WKM A;  1W4M A;  4I09 A;  4PGG A;  1BOA A;  1U5T A;  1OMI A;  2K86 A;  2QUF A;  1ZG5 A;  2RV8 A;  5CVV A;  1BI2 A;  3SHF A;  4LJZ F;  4IHS A;  1WRJ A;  4U0V A;  1YYV A;  1MJA A;  1NHA A;  2C6Y A;  5HDK A;  2Z99 A;  3V7C A;  2RN7 A;  3F8B A;  4LLG F;  1XCB A;  3Q9V A;  4MTD A;  1HKT A;  4HX7 A;  1B1B A;  2KJB A;  1O7L A;  1XSD A;  1IW7 F;  2K02 A;  3TQN A;  3C7J A;  4UV9 A;  3QP6 A;  5ICE A;  3JSO A;  4KT5 C;  5K5O A;  1W7P D;  4M72 A;  3FXQ A;  1YTY A;  5EEH A;  5ERI A;  4KA4 A;  2ZNY A;  1TW3 A;  3WGI A;  1J5Y A;  1FX7 A;  1YQA A;  3M8E A;  2OD5 A;  1ZRD A;  3V7R A;  2QBY A;  3IWF A;  2H6B A;  1MGT A;  3OOP A;  3I71 A;  5J8F A;  2KIF A;  4P9F A;  4A0X A;  1BC7 C;  4LD5 A;  1MJB A;  1OYW A;  2ESH A;  2VC0 A;  3F21 A;  2HFH A;  2MH9 A;  1ON1 A;  1YG2 A;  2ZO4 A;  5EEG A;  4WXH A;  2GQQ A;  1XSV A;  3KEQ A;  4EM2 A;  2PJP A;  1BIA A;  2P7V B;  4I7H A;  2BBY A;  5LEJ A;  2R7D A;  4EV0 A;  1DUX C;  2P5L C;  2UXX A;  3R0J A;  1FBU A;  1FC3 A;  1ZAO A;  2L01 A;  3SQN A;  1UST A;  1TW2 A;  1G6N A;  4ZYE A;  2M87 A;  5FFZ A;  2DPU A;  4FHT A;  1S8N A;  1G3S A;  2M8E A;  4KFC A;  2ACJ A;  4B8X A;  5LHG A;  2DLL A;  4RAZ A;  3RKY A;  4A0Y A;  4CXF A;  2G7U A;  3FM5 A;  5JR3 A;  2ZBK A;  5HLH A;  1ONV A;  1FOK A;  3FF5 A;  1FLI A;  1I6X A;  2ZME B;  4AIJ A;  3RYR A;  1FSE A;  3GEZ A;  3DEU A;  5DYM A;  5F6F A;  3IKV A;  3HHG A;  2K7L A;  3HTU A;  4XRF A;  2QZ8 A;  1YFH A;  2Y48 A;  2PMH A;  3D0S A;  2COM A;  1R36 A;  1K6O A;  4OIP F;  3B73 A;  5BMZ A;  4Y17 A;  1LB2 A;  3T5X A;  4ZYG A;  2IA0 A;  1XCV A;  4Y15 A;  4FT8 A;  2BV6 A;  3N4M A;  2XRN A;  3R60 A;  1IXR C;  1R23 A;  2E7W A;  4G8X A;  1OPC A;  5K1Y A;  1CGP A;  2CW0 F;  2EV5 A;  4L0Y B;  3G73 A;  5D6F A;  1LJ9 A;  4HF0 A;  1R5G A;  1L0O C;  1Z05 A;  2RKH A;  1SFE A;  1WI9 A;  4G7O F;  1PP8 F;  2JRT A;  1KU9 A;  5D6E A;  3HRT A;  1XB4 A;  4HV5 A;  1D5V A;  5L3D A;  2ZCW A;  4ENK A;  2CFX A;  2ESN A;  1ZGA A;  2EV0 A;  2A07 F;  2EV6 A;  1KU3 A;  2KIM A;  3EQL F;  3DPL C;  3F8F A;  1D3Y A;  4YFN F;  3I5U A;  1ZG1 A;  2B0L A;  2ETH A;  2VN2 A;  2Z5U A;  4EMS A;  1HKS A;  2H6C A;  5FFX A;  3I54 A;  3WU1 B;  1P4A A;  3RJP A;  1KA8 A;  3QPT A;  1RUO A;  2EFQ A;  4BYY A;  3FZV A;  1SMT A;  3CUO A;  2RDP A;  1K7A A;  4BH9 A;  3NQO A;  4L18 B;  3F22 A;  3GUD A;  1Z1D A;  2A61 A;  2HYG D;  4NHJ A;  5HOO A;  3EET A;  2CG4 A;  1YLF A;  1W7P B;  5E17 F;  4A2U A;  3CJN A;  2R3S A;  2PQ8 A;  4UXN A;  3E5U A;  4M9X A;  4HYE A;  2E1C A;  1OKR A;  4IRH A;  2DAO A;  2UXN A;  1J9I A;  1AOY A;  1QBJ A;  1WWX A;  2XKP A;  2F5C A;  4RB1 A;  3J81 Z;  1T38 A;  4ZYD A;  2VON A;  4BHP A;  4A0Z A;  3U1D A;  3EDP A;  3JAM Z;  3HYI A;  4O3M A;  4HZF A;  2H94 A;  1QZZ A;  1LEA A;  2WWY A;  1BN5 A;  5F64 A;  2OBP A;  1O3T A;  1FNN A;  4OOI A;  4UHT A;  1R7J A;  4EM0 B;  2FSW A;  3QU6 A;  3WTZ A;  3GYH X;  3M9A A;  5L3B A;  4WCG A;  2YPR A;  1YS7 A;  1GVJ A;  4DQ2 A;  1XMK A;  3IWZ A;  5D8K B;  4U0W A;  4CZZ A;  4YG2 F;  2CSO A;  3ML6 A;  3G3Z A;  5D4R A;  2Z9O A;  2OZU A;  2IA1 A;  4MNU A;  4LG0 B;  1P4W A;  2PFB A;  5CVR A;  3ECO A;  4U0Y A;  1IN5 A;  3SXY A;  3LFK A;  2EB7 A;  4A12 A;  2FU4 A;  1ZRE A;  1LQ1 A;  5A2Q Z;  1JHF A;  2D45 A;  3CLO A;  4FX4 A;  3MAJ A;  4G6Q A;  4AVP A;  5AON A;  3GO5 A;  4I01 A;  5HDG A;  2BGC A;  2NAZ A;  2ZKZ A;  2DT5 A;  5DUI A;  4RGS A;  1L3L A;  2ISZ A;  3LWF A;  4HW0 A;  4HDV A;  2RGV A;  3ZN0 A;  3PQK A;  1YW7 A;  2WV0 A;  3TO7 A;  1TQI A;  3L09 A;  1F4K A;  3RPQ A;  1UHW A;  3GFI A;  2MLK A;  3RDI A;  2O6G E;  4DNC A;  2LKP A;  3QOP A;  3V8J A;  3ERE D;  1HW2 A;  3F8M A;  2L4A A;  4O6J A;  3WTT C;  5E20 A;  3GFM A;  3WU0 A;  3QPH A;  2BEO A;  4KMF A;  2FQ3 A;  3KP2 A;  5ED4 A;  1O3R A;  1ON2 A;  2OU2 A;  2XKO A;  3R6S A;  3IHU A;  3LA2 A;  1IN8 A;  2CO5 A;  4A5M A;  1IXC A;  3DFG A;  5DD8 A;  5HLG A;  3I4P A;  4F7Z A;  2DPD A;  2VXZ A;  1J0R A;  4M6Y A;  3LQR A;  3D5L A;  3M1E A;  3U2R A;  5LRS A;  1DDN A;  4OU0 A;  3WTX C;  1MDM A;  5CVI A;  4KDP A;  3P9C A;  4I98 B;  3ABT A;  4O5V A;  4A5N A;  2GAU A;  4UVC A;  4A6E A;  5KK1 A;  1U8R A;  1BJA A;  3F3X A;  1XDS A;  2V9V A;  5IT9 K;  5L3C A;  5J8C A;  4M74 A;  3DKW A;  1T98 A;  2PI0 A;  4P96 A;  4L0Z B;  1BI1 A;  4BXU A;  3EYI A;  4KN7 X;  4EGY A;  1TNS A;  1I1G A;  4I2O A;  3DF8 A;  3HSF A;  2VE8 A;  4OIN F;  1E17 A;  2PEX A;  2HQR A;  1RZ4 A;  1DPU A;  2D1H A;  2FNP A;  3F72 A;  5LGN A;  5HDN A;  3H92 A;  2MH2 A;  4QWQ A;  2P8T A;  1TBX A;  3FMR A;  1ZRC A;  2EJR A;  5FLX K;  3KP5 A;  3WGG A;  3ZPL A;  3LAP A;  5HS7 A;  2IJL A;  5ICG A;  2JZY A;  1SAX A;  4IXA A;  5LHI A;  1J2X A;  3ZMZ A;  1FZP B;  1OR7 A;  3PFI A;  5AIP A;  1B59 A;  4S04 A;  1U5T B;  3KP6 A;  2VBX A;  5FD5 A;  2D1V A;  3WOD F;  3RYP A;  1KGS A;  3EYY A;  1USS A;  3DP7 A;  2VOO A;  2F5D A;  3T0Y A;  3ZMT A;  1KU7 A;  2MBF A;  4EVI A;  1VTN C;  1J7K A;  3L00 A;  2HDC A;  5JFR A;  5KVR A;  4P55 A;  1K78 A;  1UCR A;  3GWZ A;  3MQ0 A;  3WG9 A;  1KQ9 A;  3HRM A;  2DU9 A;  3U9G A;  2HYF A;  3R61 A;  2KIU A;  4G7Z F;  4LB5 A;  4IRI A;  3LST A;  2QEN A;  1QO0 D;  2QQ9 A;  2UZK A;  4XSX F;  3E6B A;  4ASN A;  1IN6 A;  4I0A A;  1U78 A;  1FPQ A;  3DXJ F;  3R0A A;  2M5W A;  2ADU A;  2DQR A;  1T6S A;  2XAF A;  1QPM A;  4KMU X;  2QBY B;  4IRG A;  3CUQ C;  1LDJ A;  1Z6T A;  1R5H A;  5FB2 A;  3FWE A;  3T1B A;  3WE3 A;  4CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...