4BXXJ

Arrested rna polymerase ii-bye1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bxxJ00
1ZR2A 5GP9A 2FJ1A 2NS7A 4BY7J 1IC8A 4D5CA 2K9NA 3B6CA 2NVXJ 4M6VA 1Q1VA 1MBHA 2Y9YA 1LE8A 4DW6A 3OSFA 1ZKGA 4MIMA 2X9DA 4MO7A 4V2GA 1SANA 4IHYA 2LKXA 1B8IA 1ETYA 2DMNA 3HGYA 4EEFG 1U9NA 1RKTA 5K7FA 4W1UA 2RAEA 3HKZN 3BQZA 1MBKA 5EF6A 3NAUA 3OOUA 1JJ8C 1ETWA 3JRGA 2QCOA 1A6IA 2E1OA 1ZK8A 4QSHA 3GTPJ 1HLVA 3LSGA 3HOWJ 2YUSA 1MBJA 3IV5A 3NARA 2LFBA 3JRBA 1TWCJ 2D5VA 4DZJA 4M3BA 4V2FA 4A3JJ 3HOXJ 2YU9J 2MW8A 1UHSA 4BBRJ 1CQTA 3FIWA 3JRFA 3IH4A 2IAIA 5F08A 3GTOJ 2LTPA 1ZQ3P 2K9QA 5E3NA 1Y1WJ 1POGA 3QPSA 1ITYA 2XRLA 1T56A 3BTJA 3H3VK 1VFCA 1AU7A 3GTGJ 1FIAA 5EG0A 1JKOC 3S16J 1HDDC 1FEXA 3LSPA 3ZOBA 1IGNA 1JKRC 5M5YJ 5M3FJ 3BR1A 4M3GA 2L0KA 2DJNA 1TWHJ 3IH2A 1PUFA 4A3BJ 3JRDA 5FJ8J 1Z0XA 2GM4A 1NTCA 2O8KA 4B1RA 5IOYA 1BW5A 3G1OA 5FLVA 2HOTA 3BR6A 4RDUA 1TC3C 3BTIA 2LLKA 1K83J 4S0HB 2KT0A 1B72A 4C3IJ 5GPAA 1IJWC 2EZHA 1IDYA 4D7NA 1MBGA 3RKQA 1H8AC 5FKMA 1JT6A 1FJLA 4RBOA 1X2MA 4FCYA 1IV6A 2QF7A 1YRNB 2MG4A 2LVSA 3W6VA 3WHBA 5M3MJ 2CUFA 2NVTJ 3GTJJ 2HXOA 1RKWA 2CUEA 4XICA 1GUUA 3CQZJ 5IOZA 4AYBN 5GPCA 3MVPA 1AKHA 2NVYJ 3BQYA 3O8GA 5J1RA 2H1KA 4X6AJ 4ABZA 3RQIA 3O8HA 2O7OA 4A3DJ 1K61A 3S1QJ 3Q0WA 3HB9A 1HOMA 2EZIA 1JT0A 2L7ZA 2COBA 2JK3A 2EQRA 3FISA 5F0HA 5EGOB 4M3EA 4A3EJ 4BY1J 2VI6A 1ZR4A 3QQAA 5M5WJ 2NOGA 2L7MP 3BT9A 5C4XJ 1XG1A 2LY9A 4A3FJ 2W48A 1R9TJ 3TEDA 2E19A 3I4MJ 1E3OC 2EH3A 2WV1A 5F27A 5J1YA 4A93J 1F43A 2CRGA 3VPRA 2R5YB 2XB5A 1WPKA 4IHWA 5C4JJ 1TWFJ 4A3GJ 4Y52J 3K7AJ 5E3OA 3HOZJ 1JJ6C 1VNDA 4FE4A 2R93J 1GDTA 1OFCX 1U9OA 3SJMA 5IPAA 2WAQN 1DU0A 2DMTA 1TWGJ 5EGOA 1WH7A 2B63J 1UG2A 2YS9A 1LFBA 3S14J 2GBYA 2EZLA 3Q3SA 1BJZA 2FD5A 4XK4A 3BR5A 2ELKA 4J19A 4NDLA 3SFIA 4B4CA 1G2HA 1X2NA 4M3DA 4I6ZA 2R5ZB 5JLWA 1GV5A 2X48A 3A01B 3BG5A 2CU7A 1NK3P 4I76A 2DMQA 3L1PA 3BG3A 1U78A 3OSGA 1HF0A 2XPWA 3LSJA 4W97A 5EG0B 2CJJA 2Y0SN 2JA5J 1ORKA 1QVUA 2MSYA 3S1MJ 5FKOA 1FTTA 1RETA 2DA1A 2Y9ZA 4FISA 5F0FA 5DS9A 3CDLA 1JUMA 5BNGA 1LE8B 2G0EA 2HDDA 2OPTA 3TW7A 2ID6A 5F1JA 1NK2P 4IHXA 3HEFA 5E3LA 1WCMJ 4XRMA 1BL0A 5M5XJ 5IYBJ 3TW6A 4C3JJ 3DEWA 2HOAA 3JR9A 2M0CA 1IG7A 1GVDA 2R5ZA 3K2AA 1OCTC 1UMQA 2HOSA 1QPIA 4XRSA 5FKNA 4HNVA 9ANTA 5EDNA 3ZQCA 1MH4A 1P7JA 1S7EA 2L9RA 2IEKA 2XPUA 1FIPA 2Y2ZA 4A3LJ 1SFOJ 3ZQGA 5EEAA 5IP6A 2JA6J 2P81A 1PUFB 3HOVJ 1JUPA 4G12A 1QVTA 2X6OA 3M3YJ 2VUMJ 2DA7A 4QIWN 1TWAJ 2JN6A 1D5YA 2VKEA 3I4NJ 5IP9J 2LD5A 1OCPA 3ZQIA 2DA6A 2XGCA 3HGGA 2CQXA 3A01A 1VI0A 1FTZA 2H8RA 1WGXA 4Y7NJ 2XB0X 3G1MA 4X1EA 1B72B 2KDZA 3S1RJ 1WH5A 5E3MA 2ECBA 2ME0A 1RESA 1XS9A 2E2JJ 2M9HA 1ENHA 2DA2A 5FKKA 3HOYJ 1QRYA 1IUFA 1GV2A 3G1LA 1I3QJ 2R0QC 3GTKJ 3PO2J 1JTYA 1U8BA 3HDDA 1ETKA 4BBSJ 1T33A 3CCYA 2NVQJ 3Q0VA 3JRAA 1B8IB 3OIOA 2GLOA 4M3FA 4D7MA 1BW6A 1ETXA 2JWTA 1F36A 2VKVA 2Y31A 4C2MJ 3RZDJ 3HOUJ 3UKGA 2DA5A 4JP0A 1A5JA 4DZPA 4XIDA 4JX5A 3S1NJ 1H88C 3ZQLA 4GFBA 3S2DJ 1MNMC 2ZB9A 3M4OJ 1BA5A 1JTXA 1MBEA 3FKIJ 2XPVA 3GBGA 3FK7A 5EZGA 1W0TA 2DTZA 1W0UA 3B6AA 1MBFA 2HQ5A 4JYKA 3RZOJ 1EF4A 3HM5A 1HCRA 3LOCA 5FKLA 5J1UA 2XGDA 1JKQC 4A69C 1ETOA 2HXIA 3ZQHA 5JLXA 4D5FA 4FTHA 3H0GJ 1YRNA 1JUSA 5C44J 3S15J 5K7ZA 2I10A 1Z77A 1OJLA 3DCFA 5IP7J 1MSFC 1I6HJ 4BXXJ 1O4XA 3BG9A 3IH3A 2LP0A 2XGEA 3BR3A 3S2HJ 3CMYA 2E2HJ 2DMUA 4JX6A 1Y1VJ 2ME6A 5F04A 1APLC 3PO3J 3F0CA 4UUSB 1MH3A 3MN2A 4CYCB 4UUSA 2O9LA 5IYCJ 1RR7A 2DA3A 3JRIA 5F0CA 3JRHA 3TP0A 1IDZA 2OF7A 3MKLA 4A3KJ 1P7IA 2JJ7A 4DYQA 3WHCA 1WI3A 3JRCA 2R7ZJ 3SDGA 2MGQA 3FK6A 4FE7A 2FQ4A 2K40A 1MSEC 2M34A 4JX4A 4AC0A 5C3EJ 4A3CJ 1JGGA 3GTLJ 4XRSG 1DU6A 3PM1A 3LSRA 2XSDC 2M8GX 5IYDJ 4IHVA 2LR8A 5DTDA 4QTRA 2ID3A 2ECCA 3JREA 4IEJA 1VF9A 2Y30A 4L5EA 2R5YA 3C2BA 1X58A 2JA7J 1AKHB 4BKXA 2E2IJ 3HBLA 2JA8J 3GTMJ 4CYCA 2FX0A 3A02A 1XC5A 2EBIA 2HI3A 3LNQA 2WB1N 5HODA 2K9SA 3E7LA 2JMWA 2R92J 4DYCA 1H89C 1ZGWA 3S17J 2N8GA 2LK2A 2DMPA 4MLOA 2IBDA 2DN0A 3GTQJ 3TP3A 2AO9A 1HDPA 4C3HJ 2M2EA 2TCTA 5FLMJ 5J3LA 4UUTA 4DYRA 1ETQA 1ZTRA 3BR2A 3QPLA 1ETVA 1AHDP 4A3MJ 3D1NI 1LFUP 4A3IJ 2HYJA 2EZKA 4LOCA 3ZQFA 4B3AA 3BTCA 2CQQA 4AUXA 1GT0C 2PMZN 3BTLA 4MFEA 2AHQA 3Q0UA 2VPRA 5EYRA 3BR0A 2NS8A 3A03A 1IRZA 2TRTA 2L7FP 1JKPC 4MFDA 5K7HA 1I50J 5EZHA 2DA4A 1RPWA
chains in the Genus database with same CATH superfamily
2EJRA 1YE9A 3UNGC 3HHHA 1BIBA 2FJ1A 2NS7A 2GZWA 4D5CA 4UVBA 5D6EA 2ELHA 2OTLI 1D8KA 4M6VA 1ZRDA 3RIRA 2X1EA 4EVIA 5EJCA 1VQKI 2Y9YA 4TV7A 4E6KG 1LE8A 2Z99A 4LLGF 4MIMA 5IY5H 4IHYA 2LKXA 1MMAA 1ETYA 3ZQQA 3HGYA 3ZCOA 2F2EA 5CVRA 4L9JA 1WVRA 5K7FA 2BHYA 4YFNF 3HKZN 1N77A 1LEAA 3CUOA 3GF2A 4XNFA 5HDGA 2GQQA 1JJ8C 1WJAA 3JRGA 2QCOA 1ONVA 4EQQA 1ZK8A 2IVMA 3GTPJ 3F8FA 5CQGA 3LSGA 2V26A 4ZYHA 1U0JA 3IV5A 3NARA 1BBYA 1OISA 5JI6A 3JRBA 3CCMI 4ASNA 4MNUA 1P2FA 1TWCJ 2RV8A 2FQ3A 1NHAA 3K1MA 1FYKA 4BHPA 2FOKA 3KFWX 1QHGA 3PNVA 2HU9A 2MW8A 3BJOA 3FKJA 4QWQA 4NQWB 2VE9A 2FBKA 3AL0C 1B4AA 3JRFA 3IH4A 1MMNA 4OMZA 1ERDA 5DCFA 5F08A 4A0XA 2LTPA 3WGIA 2BV6A 2JSPA 2VBWA 2MH9A 3KZYA 3QPSA 4RB2C 4PGHA 4HDVA 3DTIA 2P7CB 1QHHD 3PIOF 3N05A 1DGRM 2Z2SB 2P5LC 3H3VK 4Q4ZF 4U88A 4O5VA 1IN8A 1JKOC 2LC2A 2R3SA 1HDDC 3LSPA 1V5EA 3CCVI 2CFOA 2EFWA 3N4MA 1J2XA 3REOA 1JKRC 3FXLA 3GO5A 2RDPA 1FP2A 3BR1A 3H9QA 1SEUA 2E1MB 4HLXA 2HQAA 4BQOA 4DOZA 3M8JA 2A68F 2L0KA 4H0EA 1G3TA 2HS5A 4A3BJ 4XL9A 3G4SI 5FJ8J 1OR7A 4HLYA 2KL4A 1NTCA 2ACJA 2ZFUA 2WV0A 1BW5A 1SVLA 4MTDA 3TL4X 1X1AA 4RGSA 2LLKA 5DD8A 3FMRA 4S0HB 4E7SA 1FWZA 2M4GA 3A4CA 3HPGA 1XTAA 3GWZA 2RREA 3G6EI 3BDDA 2YSRA 1SFKA 1XPXA 3CMEI 4YIFA 2MC3A 1PDNC 4LG0A 4ZYGA 5FKMA 4NC8A 3HJEA 3U9GA 2XF5A 5EEHA 3IUOA 2BY2A 5FGMA 1FJLA 3R60A 1KA8A 1IN7A 3FXMA 1BR4A 4RBOA 2MBFA 3HC7A 2Y48A 3JSOA 3F21A 5L3FA 2MG4A 1ZYRF 5ERIA 3CZ6A 4ZDLA 1K78A 4BGDA 5LD2C 2NVTJ 2LSOA 1A36A 3LQRA 3QYEA 3OV8A 1R7JA 3CQZJ 3H0DA 4GGGA 5IOZA 5BPIA 1PP7U 1UAAA 1BC7C 2KJCA 3DPUA 3M1CA 3O8GA 5D8LB 5J1RA 2M1BA 3Q5FA 1B59A 1BR2A 1NG6A 3O8HA 3VYSB 5E18F 3BROA 2PI0A 4MTEA 1YQAA 2LRDA 3J7AO 3L2RA 4KN4X 4KMFA 4N0BA 3OS1A 1ZELA 2EIJH 2L7ZA 5H6QA 1TL8A 2COBA 1W5TA 3LA2A 3V7RA 4LG0B 1E3PA 5TRDA 4A3EJ 2MLKA 1RZ4A 5FB2A 2QLZA 2BY1A 4B09A 2CQ7A 3OYHA 5E8IA 3EUAA 1R4MB 4HX4A 4NQWA 1BN5A 5E1ZB 2UV1A 5L3BA 2E19A 3I4MJ 3LFUA 4DGWB 2LYCA 2HFHA 5HOOA 2WV1A 2HEOA 1U5TC 4U0YA 3DXJF 4E7IA 2XB5A 2JVHA 1ZG5A 5HS9A 3RKXA 1U2WA 2NNNA 5LGUA 4R8HA 5D5VB 3K7AJ 2HVRA 3OYMA 2AQFA 3P7NA 4A5NA 5HDNA 1QZYA 4MGRA 5K5OA 1GDTA 2IGKA 2R7DA 3SJMA 4C30A 5IPAA 1N78A 2JT1A 2DMTA 1TWGJ 4G6DA 3HPHA 1R1UA 2R7OA 1WH7A 5DV5A 2VODA 1LFBA 5IT9K 3S14J 2GBYA 4ITVA 3Q3SA 3EDPA 2L9VA 4J19A 2K9MA 4HPQA 4AIKA 2DT5A 5KK1A 1X2NA 2HDCA 4IPAA 4I6ZA 2X48A 1G6NA 3E5XA 1V3FA 2IA0A 2A6EF 1LPQA 4XBFA 4KFCA 2GWRA 3BG3A 3DPLC 3QU6A 3R61A 1D0ZA 2AXTC 1ZH5A 3DU5A 5LEKA 4F52A 4BNCA 4W97A 5FFZA 2X6YA 2H09A 3LSIA 2CJJA 4KN7X 2JA5J 4IHSA 1ORKA 2VJIA 2ZMEC 2ZJ2A 4IL6C 4IVNA 3OIPA 5FD6A 3L2WA 2O8XA 2Y9ZA 4HOBA 3K4KA 4E7KA 1TNSA 2V79A 5DS9A 1JI8A 4PGGA 1YX5A 5BNGA 2M45A 4HX8A 5E3LA 1HKTA 1MJAA 1WCMJ 5M5XJ 5IYBJ 3U2RA 3OYKA 4C2UA 4Y17A 5KNLA 3CESA 1J09A 1I1GA 3DEWA 3ZN1A 2I5UA 5HLIA 3MZHA 4OINF 4RAZA 3S2WA 2DW4A 3FHZA 3MEXA 4YIIA 3ZMVA 4XRSA 1W1WE 5F1RA 5EDNA 1MH4A 1CGPA 1REPC 2J5OA 5EEGA 1SFOJ 5EEAA 2UXXA 2JA6J 1O3TA 1PUFB 2DFHA 1N75A 3M07A 3FM3A 4E70A 1RUNA 2VUMJ 3QYFA 1TWAJ 3S32A 3CMMA 1UZCA 1D5YA 2VKEA 1R36A 2XKOA 2H8WA 2HOEA 2LD5A 1VQNI 3E97A 1G4DA 3PIPF 2M4KA 2Y75A 4I99C 1TLHB 1BI0A 2AXLA 2CV2A 3LFKA 3RDIA 1Z7UA 1S6LA 2PX9A 2KDZA 3S3OA 4OOIA 1UB9A 1WH5A 4QPOA 3QOEA 1I6XA 3FXJA 4UY8I 1KYWA 4P5OA 2ETHA 4CYDA 1ENHA 2KFDA 4AWXB 3HOYJ 1R1TA 4Q47A 1QRYA 3S93A 1IUFA 1GV2A 1X1PA 3K69A 3Q9VA 4ZZLA 1TTYA 5A2QK 2R0QC 5DDGA 1SC7A 4BJ6C 5LGNA 3PO2J 3BP8A 1T33A 5J6XA 3AG4H 1WJ5A 3CCYA 4EJWA 2NVQJ 2CW0F 3NQOA 5DM6F 1B8IB 2GLOA 4N4NB 4O6JA 2V1DA 4P9FA 3OR1C 2FMLA 4XR6A 4EV0A 3RZDJ 3UKGA 3OR2C 2DA5A 4U0VA 3OL3A 5A2QZ 4IQJA 4XIDA 3CP8A 4A0ZA 1YLFA 4EM2A 1RIOH 2IS6A 1X1BA 1H88C 5E17F 1ZG3A 1DDNA 1G3YA 2FF4A 4P9UA 2FU4A 4Z2YA 3ZQ7A 4BS9A 4PJ0C 2EV6A 1IRGA 3M4OJ 4P55A 1XMXA 1VQ7I 1HSTA 4FQGA 5EZGA 1W0TA 2IGMA 3DFGA 2CV1A 1J9IA 2DYRH 2BVMA 2B0LA 3B6AA 2STWA 1W4MA 1TZLA 3VB2A 1VQMI 1EKEA 3OIQA 3F3XA 3K1NA 1XB4A 5FKLA 3KEYA 2XGDA 3CUQA 3TDZC 4G6QA 3K2ZA 1BOAA 5JLXA 1YRNA 2OBPA 2RC4A 3I71A 1R4NB 3DCFA 3DBRB 1I6HJ 1OMIA 4BXXJ 4NUBA 2L5QA 1W5CC 2P7VB 1IXRC 1YW9A 2E2HJ 4JX6A 2UXNA 4YG2F 5LHHA 2V6EA 1APLC 1TP4A 2CMPA 4UUSA 5KVRA 3J80Z 2DA3A 5HNHA 2OZ6A 2KJBA 3JRIA 1SFXA 4IHTA 1LKXA 5BS6A 4A3KJ 4LG3A 3OYDA 4DYQA 3WHCA 1KU9A 2JSCA 1LDDA 4EM1A 5J47A 1IO2A 3JRCA 3AG2H 1X3ZB 1P4XA 1SD7A 4FE7A 4L9TA 2K40A 2NNYA 2M34A 4AC0A 5C3EJ 1IRFA 2IA1A 2PG4A 2VOPA 2IT0A 2K5CA 1WJDA 4B43A 3FXKA 4XLEA 2HQNA 1EV7A 3LSRA 2JQ7A 2M8GX 4IHVA 3T0YA 1S29A 1S7AA 1EH7A 1HKSA 4O3MA 3QRFF 3GFMA 2E1CA 4KNYA 3WGHA 3JREA 3FXRA 4IEJA 3SEQA 1VF9A 2R7FA 2CUZA 1R5ID 3CF2A 3GTMJ 1ZARA 2KRHA 3ERMA 5JFRA 1WHUA 3CCLI 1E3HA 4PFPA 2R7VA 4ZYAA 5HODA 1H0MA 1VQ5I 1PUEE 4UB6C 4ETSA 3KP6A 4ENNA 4P96A 1YO5C 1E2XA 2BVLA 3CC7I 4RAGA 1YHQI 1D8JA 2VBXA 2VQHA 2AO9A 3TO9A 4CCJA 2M2EA 1U3EM 4ESJA 3H3ZA 1T6SA 4HNTA 4E7HA 5TISC 3GFJA 5ILSA 4DYRA 3OWTA 4HNUA 4BL0B 1ETVA 1AHDP 2P6TA 2CSOA 2L9NA 3TBIA 2R7UA 2QYOA 4WXCA 1GT0C 4Y33A 1V55H 2B9SA 1S5LC 3VOEA 3BZKA 3RSNA 4XRFA 2VPRA 1HBXG 2L7FP 1JKPC 5K7HA 1FLIA 2LBFB 3ZMTA 4PUSA 4LITA 5GP9A 1ACIA 1HQCA 1IC8A 1MMDA 3ABLH 1YW7A 1MBHA 2JRTA 5B1AH 4IRIA 2HKXA 3NWSA 1ZKGA 4MO7A 1YS7A 4V2GA 1Z7LA 1HXDA 1SANA 3I54A 1EH6A 1W7PB 3V7SA 3J7ZI 3S3NA 1B8IA 1BC8C 4EEFG 1U9NA 2KIQA 2DK5A 4W1UA 3BQZA 1LEBA 1XDUA 1YJWI 2V6CA 2K3PA 4CH7A 2M87A 3NAUA 1NG7A 3OOUA 5L3GA 1ETWA 1FOYA 3K4MA 2ZO4A 4DBRA 4UVAA 2MYSA 3DKWA 2R7XA 4HEA2 2KP6A 2PLYA 3HOWJ 2YUSA 4BACA 1YIOA 2QUFA 1IUYA 5JHUA 4I2OA 3S3MA 3FMSA 3F8NA 3F8BA 2D5VA 3CD6I 1KYZA 4G94A 2ADUA 4DZJA 4A3JJ 2OU2A 3HOXJ 4HDUA 1QQIA 1XCVA 3R0JA 4M74A 4A2UA 5ED4A 2YU9J 4HRIA 4B47A 1CQTA 5L3EA 4LD5A 2V9VA 2IAIA 3GTOJ 3WTWC 1ULYA 2M7AA 3P5JA 3DKYA 1ITYA 1SMYF 1GHCA 1LDKB 2HTJA 2XRLA 4XOTA 4RLFA 1V5FA 1KZHA 3K0LA 1VFCA 1R00A 3FXUA 4BE1A 2NRAC 5EG0A 5J4VA 4KICA 3S16J 2DCEA 3HHGA 4RLQA 5KAFC 1X4OA 2ZXHA 5CLSA 3FXOA 5H6RA 5M3FJ 2HPIA 1G3SA 3GMEA 3VDXA 5GAEJ 1VQOI 2V1UA 1TWHJ 2VLAA 5DUKA 2O8KA 1YS6A 1WJCA 4B1RA 4RAYA 3EETA 2VQLA 3MZ8A 5FLVA 2DOAA 1VZ0A 2OZUA 3WU0A 4XLHA 3RKYA 3IAS2 1B9NA 4RDUA 1VQ9I 2VBZA 1QPMA 4M72A 1ZGAA 2KT0A 2WB1A 4AIJA 1B72A 3PJRA 1W5SA 4C3IJ 5GPAA 3DV8A 3MFKA 2CO5A 2EZHA 2EFQA 1SMTA 1IDYA 5FROA 4D7NA 3O2PE 4BQNA 2VXZA 3ECOA 4IRHA 3GYHX 4U7DA 2JPBA 1ZRCA 1KONA 3KE2A 2CH0A 1H8AC 2QBYB 2M0MA 2FNAA 1SD4A 3PUFA 3OYIA 1D0XA 2CFXA 4UV9A 2F5CA 1MJ9A 2ZMEB 4ESBA 5LLQA 4FCYA 1K4SA 4XKCA 4HQMA 3W6VA 5LFAA 2V9PA 1YITI 2YPRA 2CUFA 2V4JC 3HRSA 4GRIA 5ICEA 2FSWA 3BPVA 2R4GA 3ZR8X 1QZZA 1RKWA 2HXOA 1T08B 2HKOA 4XN0A 3H5AA 4KIFA 4AYBN 5GPCA 1RUOA 4HSRA 3DLLF 3MVPA 3PFIA 2NVYJ 3BQYA 4XKVA 2DJIA 5J40A 3O6BB 4E7LA 4CSWA 2L4MA 2L9SA 2O7OA 3HYIA 3WE3A 1XGSA 3G3ZA 1WQ2A 3HB9A 3Q0WA 2DPDA 5B3SH 4UNOA 4F7ZA 1OKRA 1GXQA 1W36C 4HG2A 2JK3A 1ON1A 2MD5A 2IP2A 3FISA 5EGOB 3MKZA 5BOXA 3FF5A 3VODA 3GZNB 4NNJA 1M1EB 3X2QH 3JCUC 3K70C 3CC4I 1PP8F 1XG1A 4XKWA 3COAC 2XHKA 1R9TJ 5HLTA 1YJNI 4KYWA 2JTVA 2ZKZA 2EH3A 2WWYA 4CCLA 2D1VA 2OCEA 5F27A 3CO7C 1F43A 1QNTA 3L7WA 1R1VA 3E5QA 3TMOA 2CQKA 4IHWA 4EGYA 3BCBA 4OMYA 3MWMA 2BW3B 3RI4A 1R22A 3GXOA 4BYYA 1WKMA 1T38A 4F55A 2QBYA 1ZAOA 3CCQI 3WTXC 1FPQA 3CJNA 4FE4A 4UB8C 2EFPA 2BBYA 4UHTA 1U9OA 2F5DA 1DU0A 3F9KA 1WSUA 5EGOA 2A6HF 4CICA 3CC2I 2B63J 1UG2A 2FD5A 4F92B 3PQJA 4XK4A 1OR7C 2F48A 3SFIA 4B4CA 1G2HA 2VPLA 2R5ZB 5JLWA 3IWFA 2GXBA 1HW5A 2CU7A 1ON2A 4OAYA 2FBHA 5DCMB 3F72A 3TDUC 3JSPA 3T1BA 4OIPF 1W7PD 3L1PA 2VOOA 4DIQA 3WG7H 3OSGA 2L4AA 1XSXA 1A04A 5CJ9A 2LDUA 3S8PA 1HF0A 1K4TA 2BW3A 2O3FA 3TO6A 2Y0SN 2W25A 1PVEA 2EFNA 4B48A 1MMSA 3ZN0A 1FTTA 1RETA 2DA1A 2DOEA 4L5IA 4D9JA 4NC6A 3I56I 1JHHA 2ZMEA 3DU6A 3KP2A 1JUMA 1LNWA 1PYVA 2EB7A 4M71A 2HDDA 2NVUB 2ID6A 3M9AA 1NK2P 3J7YJ 4E4HA 2OUMA 1K78B 1BL0A 3TW6A 1RNLA 3K9TA 3D5LA 4E7JA 1JHFA 5D4RA 1XCBA 2Z16A 1HA8A 4WF2A 2R5ZA 2E5ZA 4HF2A 1SFEA 4QLCU 3FXQA 3HSEA 1QPIA 4HNVA 2RKHA 2E1MC 4D0PA 3L2VA 1DPRA 2PJRA 2VE8A 3RJPA 2L9RA 2NXNB 1WFXA 4XQFA 2IGOA 3P9CA 2GAUA 4ESFA 2P81A 1IXCA 1QVTA 4RMNA 5ICCA 1XDSA 3DBHB 2JN6A 3CO6C 2DK8A 3I4NJ 5IP9J 2HYGD 1OCPA 5CVUA 1V4RA 3ABUA 4AYBA 2FOWA 1AWCA 2H8RA 1WGXA 3I0TA 3G1MA 2IS4A 3BWGA 5FLXK 4X1EA 3ZMZA 1Z6RA 2G9WA 2MD0A 2FEZA 3BOQA 1S7OA 2P6SA 1VQ4I 2ME0A 3KP4A 4X0GA 2LY2A 1XS9A 2KLOA 2E2JJ 2M9HA 2FXAA 2DA2A 2ZC2A 5FKKA 1TNTA 3U1KA 2GA1A 4L5JA 2FRHA 3W6JB 1J59A 4KISA 2X6XA 3H35A 1U8BA 1TQIA 1ZLKA 3SZGA 5LRSA 3R4KA 3JRAA 1FBUA 3LAJA 2K27A 1ETXA 3IHUA 2JWTA 2Y31A 1IN4A 2Z5UA 4JP0A 4BE2A 3SZPA 3B73A 3S1NJ 4OAZA 2XAUA 1FC3A 2D45A 4GFBA 1OCRH 5HNFA 4I0AA 3JTGA 1FBSA 1MNMC 5FRMA 4RB3C 2FUG2 1BA5A 2XKPA 4I01A 3ZMUA 2E1NA 2DTZA 5FFXA 1W0UA 2D2WA 3U1DA 2EINH 3ESWB 4S04A 3UR3C 4JYKA 3SEZA 3WTVC 2K02A 3CCEI 1EF4A 4HX7A 2E34A 3DLAA 4M9XA 1JKQC 2QENA 1IRXA 1ETOA 2HXIA 4A69C 5ILUA 1O3RA 4FTHA 4WXDA 4CCNA 1E0EA 1S8NA 5K7ZA 4EJVA 4Q5SF 2HNHA 1O4XA 3BG9A 4ENKA 3IH3A 1BI1A 2PBIA 4HBLA 5H20A 4II2A 2DMUA 4ZDOA 3H92A 3HIFA 2ME6A 4BDZA 3K6GA 1MDMA 1UHMA 5LHGA 2A69F 4UV8A 4KUMA 1VTNC 3F0CA 3E6CC 2XAHA 4CYCB 2VT2A 2WBMA 1T8IA 5IYCJ 2ZJRF 3RYRA 3GLLA 4IOCF 2DDAA 1IDZA 1JGSA 3VWBA 2JJ7A 1HSJA 3QWLA 3HRTA 2GXAA 1WI3A 3HUGA 3QYBA 2R7ZJ 5LRRA 2MGQA 2LKSA 1MSEC 1MD0A 3I64A 4KIBA 1JGGA 1ZRFA 1FSEA 3FHNA 3PM1A 4XM3A 1DU6A 2XSDC 5IYDJ 1R58A 2LR8A 4QTRA 3E3VA 1Z91A 2KMUA 4L0YB 4S05A 1XD7A 2ECCA 1R5HA 2QKMB 4A5MA 4L5EA 3A0BC 4CGZA 3LQQA 3C2BA 1IW7F 3LA7A 1O7LA 1HKQA 2PQ8A 1Z6TA 4LIVA 2GIZA 2JA8J 1IN5A 3A02A 4IJAA 5KCMA 4KT6A 3E7LA 3DKXA 2R92J 2DXIA 4CUGA 2IA2A 2N8GA 2DMPA 3QPHA 2FE3A 2VL8A 3TP3A 3RQ4A 1Z05A 4BU2A 3OS0A 1HDPA 3FMQA 5FLMJ 5J3LA 1FNNA 5CVIA 2XAFA 3L2UA 1LDJA 2XAJA 4XORA 1ETQA 2XRNA 3QPLA 4C2TA 3GCMA 2IJLA 3D1NI 2WAFA 1LFUP 1UHWA 3QPTA 2CV0A 4LOCA 3ZQFA 4JOMA 5D4SA 1KGSA 4AU7A 1DUXC 2HVSA 3EPZA 4XLPF 5GTIC 4MFEA 2QQAA 3F6OA 4MQ9F 3OYCA 1LQ1A 2V9KA 3A03A 3FX3A 3VYUB 4XN3A 5GAHJ 2XROA 5CPRB 1DGWY 3N97A 3Q9SA 3WGGA 2DA4A 3HSRA 4IOAF 1ZHFA 4BY7J 5K5RA 2NVXJ 2KIMA 3B6CA 2W00A 3AG1H 4A12A 3BJ6A 1O3QA 4XLFA 4DW6A 4XLAA 3OMYA 2F5VA 3B02A 4IQ4A 2LMDA 3CCRI 1YFHA 5AONA 2X0LA 2ZNYA 2DMNA 1FOXA 3FBIB 1Z9CA 1RKTA 3ZXSA 4C9YA 1ZREA 1XGNA 2RAEA 2X1CA 4BHBA 3ONQA 4BE0A 1D3YA 4FT8A 2DQLA 5CVJA 4V19K 1R5GA 1USTA 5KAIC 3C7JA 3A2KA 3C2HA 3ZRGA 1A6IA 5DCMA 1Y0NA 3WTZA 3F22A 2XC7A 5K5QA 1HLVA 4HF1A 1MBJA 1YJ9I 2OAZA 3QP6A 2IS1A 2LFBA 2HR3A 4YRVA 3CCSI 2PMUA 2AS5F 5AIQA 3F6VA 1J75A 4YELA 4OIQF 4I02A 4WCGA 3LAPA 1ZLJA 2RQQA 2DODA 2M8EA 2LKPA 1Y8RB 1B9MA 1MMGA 2W4SA 4JK1X 3ISPA 1W7PA 3PL8A 1POGA 2V7FA 1ODDA 4G9YA 5AIPA 2WAEA 1T56A 3OYGA 2DT6A 2DQRA 1OCOH 3BTJA 4OU0A 4Y13A 3H9GA 1FEXA 2IGNA 3OY9A 3IL2A 1QA6A 3H36A 4GYIA 1Z21A 3ZOBA 1IGNA 1P92A 3FM5A 4IXAA 2K4BA 5F6FA 1WJFA 5HVQC 2W84A 5M5YJ 2IPQX 3LSMA 4U87A 3EYYA 3IRRA 1CF7A 3TOBA 3IH2A 2VKHA 2CWEA 3PQKA 3JRDA 1BR1A 2H1LA 1Z0XA 2O03A 2GM4A 1TT5B 4XSZF 4ENMA 1MNDA 4D1QA 4ON0A 3G1OA 1S3JA 3C18A 4HYEA 2HOTA 3HSFA 3BR6A 2STTA 2OQGA 3K70D 1WWXA 5DUIA 2JUGA 2L2OA 2KIFA 3L09A 3SDBA 4AM3A 3WODF 4EM0B 1MKMA 2RVCA 4N9IA 4MHGA 2CW7A 3OYJA 3SHFA 3MKYB 4ZTFA 3K4JA 1JT6A 1I5ZA 4AVZA 4EJTA 2DLLA 1H9GA 2RGVA 3K10A 4ZH4F 1IV6A 2QF7A 1YRNB 2LVSA 4II3A 4Y4RA 5M3MJ 1KU2A 2K9LA 1Y8QB 3EUKL 2FNPA 2E60A 4XICA 4G7OF 3PSFA 3E6DA 1AKHA 2DBBA 2JA2A 4WWCA 4L0ZB 1J5YA 1TT0A 3VYRB 2K86A 3H5RA 5D5XB 5LHIA 1K61A 4GO1A 3HOTA 2EZIA 3OYLA 1JT0A 5E1WA 3DP7A 2QQ9A 2XGXA 2KRCA 4RM3A 5E1XA 1XX5A 2ZSHB 4PSWA 5BPDA 2A3SA 5F0HA 4EJUA 4M3EA 2GOXB 1IF1A 1R71A 2VASA 4BY1J 1SAUA 3L2CA 1ZR4A 3ULQB 2A5YB 3QQAA 1UJ8A 3HL2A 5CYVA 2NOJB 2NOGA 2X6WA 1K6OA 3F8CA 5B5EC 4A3FJ 1WRJA 3TEDA 1TQMA 2V1XA 2Q8KA 1E3OC 4B8XA 2OQRA 2BEOA 2DI3A 1U6GA 4A93J 2CRGA 2ELJA 2E7WA 1QBJA 4CDGA 2E35A 1WPKA 2ZXIA 4IF4A 5LEJA 4CO8A 5C4JJ 4EGZA 4A3GJ 2CQNA 4RA2A 5DYMA 5E3OA 1JJ6C 1A31A 4NHJA 4PJNA 1VNDA 3DWLE 2R93J 3KLNA 2KRFA 2RQPA 2DAOA 2AQEA 3ABTA 3GEZA 1W36D 5JR3A 4IO9F 1IZ1A 2L7KA 2W85A 1BI3A 1DP3A 3BR5A 3GZ5A 4DJAA 4NDLA 2L01A 4YFXF 2QSHX 1GV5A 3D0SA 5E8GA 3A01B 1FOWA 3SYTA 3BG5A 1JE8A 3KIOA 4LMYA 2R7QA 3W2AA 4I76A 2DMQA 3NWTA 2F5FA 3R0AA 1U78A 2DYSH 1FT9A 3J81K 3CP2A 4PZJA 4HA8A 4XKBA 4KA4A 3RPQA 1FOKA 4KIGA 1TW3A 1QVUA 4LLNA 3S1MJ 5FKOA 4XOPA 1SVMA 2CGPA 1N25A 2TDXA 3WTYC 2IS2A 2H94A 1J0RA 1S9HA 5CVVA 1L0OC 1YI2I 4LIUA 1T2KA 2JRMA 1G3WA 2HGCA 4GXOA 4Y15A 1LE8B 4ANJA 5HS8A 1J7KA 1AA7A 5F1JA 2I8DA 2PMHA 2VQGA 3SXYA 3AKZA 2VJ4A 2HVQA 4KT5C 2HZTA 4IRGA 2HOAA 2M0CA 1GVDA 4PJLA 2DOFA 3K2AA 3DTEA 5K1YA 4G7HF 1OCTC 2EIKH 2HOSA 3P9IA 9ANTA 2Y0SA 2KISA 1X19A 3CUQC 3ZQCA 2EILH 1S72I 1P7JA 1S7EA 3IKVA 3A0HC 1OYIA 3QU3A 3G73A 2COMA 2Y2ZA 1D1CA 1QO0D 4PJMA 4XMYA 4KJZA 3A1YA 3MKWB 4G12A 2ESHA 3I53A 3W3CA 4QIWN 2ISYA 2F6CA 2K7LA 2Q2EB 3NEUA 4BH9A 3ZQIA 2DA6A 2MC4A 3HGGA 2CQXA 4HZFA 5D8KB 2XB0X 2OA4A 1GVJA 1LUJB 2O0YA 5E3MA 2ECBA 2VC1A 1RESA 1Y0UA 3LSHA 3PUBA 4FHTA 4BHCA 1MZBA 3GUDA 2VB6A 2PN6A 1FBQA 3G1LA 5E20A 1D0YA 1I3QJ 5HS7A 3VEPA 3LWFA 5IT3A 4OIRF 1DPUA 4OWRB 2L02A 1JTYA 3W2VA 2BZTA 4BBSJ 5GADJ 1FYLA 2VJ5A 2VC0A 3GFIA 3TGNA 5H2FC 3Q0VA 1RC9A 3OIOA 4CCKA 1BW6A 2W82A 1F36A 2VKVA 4C2MJ 3KX2A 3HOUJ 2ZCWA 2XASA 2E7XA 3CLOA 2G7HA 4HSTA 5DD4A 4AIDA 2YU3A 1C0WA 5HDKA 4DZPA 1XN7A 2FMYA 4JX5A 1XGMA 3CTAA 1P9QC 4RS8A 3ZQLA 1T39A 3BLYA 1Y39A 3E6MA 3DEUA 3P9KA 3S2DJ 1QU3A 2ZB9A 1I27A 3W2WA 4HV6A 4NB5A 1LJ9A 2KQRA 2XF6A 3KEQA 4EJOA 3WU2C 3M8EA 3MD2A 4F93B 3L9FA 3RZOJ 2YR2A 3HM5A 3LOCA 3OYEA 2KZVA 4I09A 1K7AA 4F91B 4D5FA 3ZQHA 1U8RA 3DEEA 3H0GJ 3OYNA 2VN2A 3K4LA 3U21A 4WX9A 2I10A 1Z77A 1OJLA 1FX7A 4QPQA 1FZPB 5IP7J 1XMAA 3CDHA 2Z33A 3CMYA 1IV8A 3L2QA 1V5GA 3H1CA 1OLTA 2VJJA 1X3UA 3FWEA 4BJ5C 3PO3J 2VBYA 1QZEA 2XUBA 1MH3A 4UUSB 2LF7A 1A35A 2WAQA 3EUHA 3RPUA 4ZYDA 1KU3A 4AVPA 2O9LA 1RR7A 3EUHC 2B7EA 4RB1A 3V7CA 3JRHA 3TP0A 1FMVA 1T98A 2OF7A 2XF7A 3BC8A 4BQQA 1D5VA 3I59B 2OCCH 3KETA 2EFOA 3I3LA 3FK6A 2EV0A 4Q48A 4L9NA 2P5KA 2FQ4A 4JX4A 2BYVE 2Q2EA 3V8KA 2KDOA 2BGCA 4XRSG 2F5EA 4ENJA 3LSKA 3BZ6A 5DTDA 2R7SA 2ID3A 4N9HA 2QKLB 4LB5A 2QQBA 2Y30A 2R5YA 1T0FC 3F8MA 1QGPA 1X58A 2X1DA 4DNCA 1AKHB 3OL4A 2E2IJ 4U0WA 4BUPA 3HBLA 2R7TA 3MAJA 4CZZA 2EK5A 2Q1ZB 2GIVA 5JHFA 2UZKA 2IW5A 3LNQA 2WB1N 2WA0A 2MLGA 2JMWA 3ELKA 4DYCA 2QZ8A 2PFBA 4LLLA 1ZGWA 3S17J 1MJBA 3FDYA 1KU7A 4PCQA 2WTEA 2LK2A 4MLOA 2X51A 2LG4A 3L00A 4XLCA 4RB0A 4C3HJ 2TCTA 2XAGA 4PFOA 1U5TA 3WU1B 5JVGF 3PNYA 3AFHA 4UXNA 1ZTRA 4BDYA 3BR2A 3LL7A 2OD5A 3ZMDA 1R49A 2EZKA 4MQVA 3BTCA 4ZDPA 1O57A 3HKZA 3GVAA 2PMZN 3BTLA 3DBLB 2A61A 3IC7A 2AHQA 1USSA 2CW8A 2CUJA 1FMWA 1YOVB 5F64A 1X1CA 1IRZA 2TRTA 4ZZDA 3K4CA 3I4PA 2ZBKA 1ZR2A 3GLXA 5FO5A 3ERED 6PAXA 4RGXA 4XSXF 2K9NA 1K6YA 2W24A 1Z3XA 1G8XA 1P4AA 1Q1VA 1EA3A 1OPCA 2ZXJA 1X4PA 5L3CA 3OSFA 1UG0A 2X9DA 2RNJA 2JUCA 3K4NA 4BAYA 2MA3A 2CG4A 4DQ2A 1Y56A 1I3AA 4CHUA 4BXUA 2KHMA 2G7UA 1MBKA 5EF6A 1OCCH 3KZZA 2A07F 3ASNH 2OV7A 2OTJI 2HYFA 4Z6YA 3E1SA 3WTUC 3AL0B 3RCOA 3EYIA 2E1OA 4QSHA 3V42A 5ILVA 2PJRB 5B66C 1NH3A 3M1EA 5DM7F 4NC7A 1CF7B 4A6DA 2LOOA 4K2EA 4KDPA 2HTSA 4M73A 3I59A 1WJEA 2LBFA 2DPUA 4M3BA 5BMZA 4V2FA 2DFEA 3IRQA 2DDBA 4R1HA 1LVAA 3SQNA 2YX7A 1UHSA 1Z1DA 4YFKF 4BBRJ 3GW2A 1TW2A 3BG6A 2C6YA 2E71A 1KQ0A 3FIWA 3IP4B 3M7GA 3RYPA 3WE2A 1IXSB 1YG2A 3CJRB 3CJQB 3J7AY 2Z3YA 1ZQ3P 1T0FA 1I1SA 2K9QA 5E3NA 4IX7A 1BJAA 1Y1WJ 3BJAA 5FLXZ 4M6XA 1RR8C 4YIRX 1LVKA 2D1HA 1OQYA 3HTSB 4RGUA 1AU7A 3VYTB 1LB2A 4GDFA 1FIAA 2DU9A 4HV5A 3GTGJ 2VONA 2KKOA 2PJPA 2NS0A 2V1NA 4WK8F 2ZXWH 1D1BA 1Y6IA 3KLOA 3MZYA 5GAGJ 4M3GA 4YEJA 1A6QA 3I55I 2KZGA 3SFZA 4ZTJA 1FYMA 1ZGJA 3KYDB 2DJNA 2M3AA 5TGTA 1PUFA 3KZIC 3QP5A 3I5UA 4L18B 4PK4A 4M6YA 2W7NA 5IOYA 5J8CA 1VQLI 3GZ6A 3ECHA 1HW1A 2WY8Q 4J01A 3DQVC 1O7FA 2H6CA 1TC3C 3BTIA 3JTHA 3KEOA 1K83J 2P4WA 3WTSC 1P4WA 4Y3OA 3NRVA 2QEXI 2WY7Q 3V8JA 1STZA 4PJJA 4ZC3A 1IJWC 2CYYA 1Z3YA 3MCZA 1MNEA 5LGTA 1MBGA 4CCOA 3RKQA 1UELB 2FBIA 2PEXA 3ABKH 4RAFA 3TKYA 2MH2A 4FX0A 2XSJC 1ZN2A 1HC8A 1X2MA 4HAMA 3FZVA 5B1BH 4H4KC 3WHBA 4FASD 2XAQA 3LSTA 3GTJJ 1H9TA 3HG9A 3M8FA 1G59A 1F9NA 2CUEA 1EJ9A 1GUUA 4ZJZA 1KQ9A 2WC2A 2LF8A 4KMUX 3WTTC 5ICGA 2H1KA 4X6AJ 2LREA 4I7HA 4ABZA 2L54A 2EA2A 3RQIA 4BJTA 4FETA 2A6TA 2Y0MA 4A3DJ 5LBQA 3S1QJ 1X1DA 2DFIA 2ZNZA 2K4JA 1OYWA 1HOMA 2A5WA 5CQEA 5FD5A 2XDVA 1YYVA 3ASOH 2R7RA 1MW7A 1VQPI 2EQRA 4JQFA 5DEQA 2VI6A 5L3DA 3I9V2 2RN7A 5M5WJ 3AG3H 3CUQB 4OIOF 2L7MP 3BT9A 5C4XJ 2MABA 3CDIA 2DT7B 2LY9A 3IWZA 2VQCA 2W48A 5GTHC 4BEHB 2GA2A 1AOYA 1P6RA 3ML6A 1SAXA 1XSVA 4G6TB 3ZPLA 4HQEA 5J1YA 4PDKA 3OYFA 3WG9A 3VPRA 2R5YB 2BOLA 2E5NA 2W1OA 1TWFJ 4Y52J 3OS2A 1O3SA 2K85A 3FBNB 2IRFG 3HOZJ 2F4OB 1E17A 1WJBA 3EQLF 3H3UA 4DBQA 1OFCX 1OYYA 2J5PA 4MEYF 3HRUA 3CCUI 3W6KB 1GLNA 2WAQN 1SFUA 2UWMA 1SD6A 3V4GA 4G8XA 1GXPA 4R79A 2YS9A 3RKWA 1YW8A 2EZLA 3KP7A 1BJZA 3C1DA 2ELKA 4UVCA 3E0JB 1MDMB 4M3DA 2ESNA 4RGRA 1BI2A 1WI9A 5J4YA 2VXDA 1NK3P 5J8FA 3RTRA 1PJRA 3ABMH 2DO7A 1IN6A 2ZSIB 4B3XA 1VQ8I 1V54H 2XPWA 5D5WB 2MFZA 3LSJA 1XMKA 5EG0B 2RNGA 3VSKA 5JVTA 3E6BA 3PFYA 3HUGB 2MSYA 1SD5A 1Q1HA 3CCJI 3JW4A 1I39A 2QM3A 5ICFA 3R6SA 1TBXA 2UUZA 4FISA 5F0FA 2LY1A 5BQTA 3CDLA 4B44A 3VSLA 2G0EA 4CZCA 4BEHA 2OPTA 3TW7A 4IHXA 3HEFA 4XRMA 5IT9Z 1BOBA 1HW2A 4C3JJ 3DPTA 4HF0A 5D6FA 1IG7A 2XIGA 3JR9A 4ZYEA 4LB6B 3OOPA 3H9JA 2JPCA 3BG7A 2VIXA 3D5RC 1UMQA 3E5UA 2F4MB 3TOAA 2HPMA 5FKNA 4LK1F 2LNBA 2K3FA 4KITB 3TQNA 3F23A 3QAHA 2BXYA 2IEKA 2XPUA 3BY6A 1UFMA 1FIPA 4A3LJ 4CCMA 3ZQGA 1B6AA 5IP6A 2PMZA 3I58A 5TJJA 3HOVJ 1JUPA 3ZGKA 1TQPA 2X6OA 3M3YJ 2CS3A 2DA7A 3D5SC 3G71I 1B1BA 5HLGA 4FX4A 3CMAI 5FRNA 2XGCA 1FTZA 3A01A 1VI0A 2KPMA 4MEXF 4Y7NJ 5D5UB 2R7WA 4N4OB 4AD9A 3JAMK 2DTRA 1B72B 3H5NA 4WXHA 1LFPA 3PNTA 3S1RJ 2JVGA 2OC6A 4CA0A 5KHDA 4I98B 4CXFA 3KYCB 3LMMA 1K79A 4LJZF 4EATA 3IKTA 3OYBA 2P8TA 3ZP5A 2WADA 2QSGX 2EPFA 2HWVA 2BHZA 3CLQA 3QODA 3GTKJ 2Z1DA 3KP3A 3ROUA 3T5XA 3HDDA 1ETKA 2FA5A 3C3WA 1FP1D 5E79C 4M3FA 4D7MA 1JXSA 3GX4X 1R6RA 2OJED 1YIJI 2ISZA 2M5WA 1OCZH 2ICWG 1A5JA 2EWNA 2X85A 1ZG1A 4G7ZF 2QQ8A 4HW0A 1FSHA 3V8LA 1X3WB 2E36A 2P5VA 3O3KA 1YX3A 3PSIA 3CJTB 4IKFA 1JTXA 1MBEA 2XV4S 2XPVA 3FKIJ 2GOMA 3FK7A 3GBGA 4XLNF 3HOSA 1DP7P 3BZCA 1RRJA 1MIJA 3C2GA 1MBFA 2HQ5A 1F5TA 3SZTA 2HDWA 3T8RA 3VFZA 3AAFA 1HCRA 1WZ2A 5J1UA 2DFFA 4LFUA 2EIMH 1RI7A 3J80K 1JUSA 5C44J 3S15J 2W57A 1SVOA 3HTUA 2F4IA 1MSFC 4RM2A 3S2HJ 2LP0A 2XGEA 3BR3A 3BCAA 3BPXA 2M30A 1Y1VJ 3HXLA 3J81Z 2GXGA 2Y69H 5F04A 4UUVA 1FY7A 4F3QA 3JAMZ 1D1AA 3IAM2 3MN2A 3OYAA 4IZZA 4E7ZA 2H27A 3MQ0A 3K1PA 3K4BA 2VT3A 2L3DA 5F0CA 1VQ6I 2QVOA 3ZMSA 2JZYA 2KIUA 2LH9A 3MKLA 1P7IA 3QOPA 3DTKA 4NBQA 3HZJA 2IXSA 1UCRA 3GFLA 3LA3A 3SDGA 4A6EA 3HRMA 2NYXA 4GCVA 4GYGA 1T95A 4A3CJ 2ZJQF 3MMYB 4M9SA 2BXZA 4P1WA 2BY0A 3GTLJ 2M7BA 1IAWA 3T8TA 2ZFWA 2X4HA 2YX4A 1DQUA 3DF8A 4EMSA 2A05A 1R23A 3G2BA 3TO7A 4J00A 3KPHA 1BIAA 1F1ZA 1KQ8A 2JA7J 2HQRA 4BKXA 4I0BA 2O6GE 3KYLA 1F4KA 1L3LA 4CYCA 2FX0A 2Z9OA 2HZDA 1XC5A 5HLHA 2EBIA 2HI3A 2QGUA 1XSDA 2K9SA 2XVCA 1H89C 4LK0F 2H6BA 1EH8A 4BXFA 1Z67A 4U7BA 1YTYA 2IBDA 2DN0A 2NAZA 2QWWA 3GTQJ 3CF5F 3KP5A 2QA4I 1U5TB 4BQAA 4UUTA 4L9VA 2VKDA 2P0WA 1BM9A 2EA4A 4A3MJ 2O61A 4A3IJ 2HYJA 4PSXA 4B3AA 2CQQA 1MGTA 4AUXA 2Q0OA 2QSFX 3RPUD 4A0YA 2ZJPF 1XGOA 4LGWA 5CKTA 4AIHA 3Q0UA 5EYRA 3BR0A 3KCCA 2BE5F 4M9ZA 2EV5A 2NS8A 4JBAA 2O5RA 4MFDA 4XONA 2BY3A 1I50J 5EZHA 1RPWA
chains in the Genus database with same CATH topology
1ZR2A 5GP9A 2FJ1A 2NS7A 4BY7J 1IC8A 4D5CA 2K9NA 3B6CA 2NVXJ 4M6VA 1Q1VA 1MBHA 2Y9YA 1LE8A 4DW6A 3OSFA 1ZKGA 4MIMA 2X9DA 4MO7A 4V2GA 1SANA 4IHYA 2LKXA 1B8IA 1ETYA 2DMNA 3HGYA 4EEFG 1U9NA 1RKTA 5K7FA 4W1UA 2RAEA 3HKZN 3BQZA 1MBKA 5EF6A 3NAUA 3OOUA 1JJ8C 1ETWA 3JRGA 2QCOA 1A6IA 2E1OA 1ZK8A 4QSHA 3GTPJ 1HLVA 3LSGA 3HOWJ 2YUSA 1MBJA 3IV5A 3NARA 2LFBA 3JRBA 1TWCJ 2D5VA 4DZJA 4M3BA 4V2FA 4A3JJ 3HOXJ 2YU9J 2MW8A 1UHSA 4BBRJ 1CQTA 3FIWA 3JRFA 3IH4A 2IAIA 5F08A 3GTOJ 2LTPA 1ZQ3P 2K9QA 5E3NA 1Y1WJ 1POGA 3QPSA 1ITYA 2XRLA 1T56A 3BTJA 3H3VK 1VFCA 1AU7A 3GTGJ 1FIAA 5EG0A 1JKOC 3S16J 1HDDC 1FEXA 3LSPA 3ZOBA 1IGNA 1JKRC 5M5YJ 5M3FJ 3BR1A 4M3GA 2L0KA 2DJNA 1TWHJ 3IH2A 1PUFA 4A3BJ 3JRDA 5FJ8J 1Z0XA 2GM4A 1NTCA 2O8KA 4B1RA 5IOYA 1BW5A 3G1OA 5FLVA 2HOTA 3BR6A 4RDUA 1TC3C 3BTIA 2LLKA 1K83J 4S0HB 2KT0A 1B72A 4C3IJ 5GPAA 1IJWC 2EZHA 1IDYA 4D7NA 1MBGA 3RKQA 1H8AC 5FKMA 1JT6A 1FJLA 4RBOA 1X2MA 4FCYA 1IV6A 2QF7A 1YRNB 2MG4A 2LVSA 3W6VA 3WHBA 5M3MJ 2CUFA 2NVTJ 3GTJJ 2HXOA 1RKWA 2CUEA 4XICA 1GUUA 3CQZJ 5IOZA 4AYBN 5GPCA 3MVPA 1AKHA 2NVYJ 3BQYA 3O8GA 5J1RA 2H1KA 4X6AJ 4ABZA 3RQIA 3O8HA 2O7OA 4A3DJ 1K61A 3S1QJ 3Q0WA 3HB9A 1HOMA 2EZIA 1JT0A 2L7ZA 2COBA 2JK3A 2EQRA 3FISA 5F0HA 5EGOB 4M3EA 4A3EJ 4BY1J 2VI6A 1ZR4A 3QQAA 5M5WJ 2NOGA 2L7MP 3BT9A 5C4XJ 1XG1A 2LY9A 4A3FJ 2W48A 1R9TJ 3TEDA 2E19A 3I4MJ 1E3OC 2EH3A 2WV1A 5F27A 5J1YA 4A93J 1F43A 2CRGA 3VPRA 2R5YB 2XB5A 1WPKA 4IHWA 5C4JJ 1TWFJ 4A3GJ 4Y52J 3K7AJ 5E3OA 3HOZJ 1JJ6C 1VNDA 4FE4A 2R93J 1GDTA 1OFCX 1U9OA 3SJMA 5IPAA 2WAQN 1DU0A 2DMTA 1TWGJ 5EGOA 1WH7A 2B63J 1UG2A 2YS9A 1LFBA 3S14J 2GBYA 2EZLA 3Q3SA 1BJZA 2FD5A 4XK4A 3BR5A 2ELKA 4J19A 4NDLA 3SFIA 4B4CA 1G2HA 1X2NA 4M3DA 4I6ZA 2R5ZB 5JLWA 1GV5A 2X48A 3A01B 3BG5A 2CU7A 1NK3P 4I76A 2DMQA 3L1PA 3BG3A 1U78A 3OSGA 1HF0A 2XPWA 3LSJA 4W97A 5EG0B 2CJJA 2Y0SN 2JA5J 1ORKA 1QVUA 2MSYA 3S1MJ 5FKOA 1FTTA 1RETA 2DA1A 2Y9ZA 4FISA 5F0FA 5DS9A 3CDLA 1JUMA 5BNGA 1LE8B 2G0EA 2HDDA 2OPTA 3TW7A 2ID6A 5F1JA 1NK2P 4IHXA 3HEFA 5E3LA 1WCMJ 4XRMA 1BL0A 5M5XJ 5IYBJ 3TW6A 4C3JJ 3DEWA 2HOAA 3JR9A 2M0CA 1IG7A 1GVDA 2R5ZA 3K2AA 1OCTC 1UMQA 2HOSA 1QPIA 4XRSA 5FKNA 4HNVA 9ANTA 5EDNA 3ZQCA 1MH4A 1P7JA 1S7EA 2L9RA 2IEKA 2XPUA 1FIPA 2Y2ZA 4A3LJ 1SFOJ 3ZQGA 5EEAA 5IP6A 2JA6J 2P81A 1PUFB 3HOVJ 1JUPA 4G12A 1QVTA 2X6OA 3M3YJ 2VUMJ 2DA7A 4QIWN 1TWAJ 2JN6A 1D5YA 2VKEA 3I4NJ 5IP9J 2LD5A 1OCPA 3ZQIA 2DA6A 2XGCA 3HGGA 2CQXA 3A01A 1VI0A 1FTZA 2H8RA 1WGXA 4Y7NJ 2XB0X 3G1MA 4X1EA 1B72B 2KDZA 3S1RJ 1WH5A 5E3MA 2ECBA 2ME0A 1RESA 1XS9A 2E2JJ 2M9HA 1ENHA 2DA2A 5FKKA 3HOYJ 1QRYA 1IUFA 1GV2A 3G1LA 1I3QJ 2R0QC 3GTKJ 3PO2J 1JTYA 1U8BA 3HDDA 1ETKA 4BBSJ 1T33A 3CCYA 2NVQJ 3Q0VA 3JRAA 1B8IB 3OIOA 2GLOA 4M3FA 4D7MA 1BW6A 1ETXA 2JWTA 1F36A 2VKVA 2Y31A 4C2MJ 3RZDJ 3HOUJ 3UKGA 2DA5A 4JP0A 1A5JA 4DZPA 4XIDA 4JX5A 3S1NJ 1H88C 3ZQLA 4GFBA 3S2DJ 1MNMC 2ZB9A 3M4OJ 1BA5A 1JTXA 1MBEA 3FKIJ 2XPVA 3GBGA 3FK7A 5EZGA 1W0TA 2DTZA 1W0UA 3B6AA 1MBFA 2HQ5A 4JYKA 3RZOJ 1EF4A 3HM5A 1HCRA 3LOCA 5FKLA 5J1UA 2XGDA 1JKQC 4A69C 1ETOA 2HXIA 3ZQHA 5JLXA 4D5FA 4FTHA 3H0GJ 1YRNA 1JUSA 5C44J 3S15J 5K7ZA 2I10A 1Z77A 1OJLA 3DCFA 5IP7J 1MSFC 1I6HJ 4BXXJ 1O4XA 3BG9A 3IH3A 2LP0A 2XGEA 3BR3A 3S2HJ 3CMYA 2E2HJ 2DMUA 4JX6A 1Y1VJ 2ME6A 5F04A 1APLC 3PO3J 3F0CA 4UUSB 1MH3A 3MN2A 4CYCB 4UUSA 2O9LA 5IYCJ 1RR7A 2DA3A 3JRIA 5F0CA 3JRHA 3TP0A 1IDZA 2OF7A 3MKLA 4A3KJ 1P7IA 2JJ7A 4DYQA 3WHCA 1WI3A 3JRCA 2R7ZJ 3SDGA 2MGQA 3FK6A 4FE7A 2FQ4A 2K40A 1MSEC 2M34A 4JX4A 4AC0A 5C3EJ 4A3CJ 1JGGA 3GTLJ 4XRSG 1DU6A 3PM1A 3LSRA 2XSDC 2M8GX 5IYDJ 4IHVA 2LR8A 5DTDA 4QTRA 2ID3A 2ECCA 3JREA 4IEJA 1VF9A 2Y30A 4L5EA 2R5YA 3C2BA 1X58A 2JA7J 1AKHB 4BKXA 2E2IJ 3HBLA 2JA8J 3GTMJ 4CYCA 2FX0A 3A02A 1XC5A 2EBIA 2HI3A 3LNQA 2WB1N 5HODA 2K9SA 3E7LA 2JMWA 2R92J 4DYCA 1H89C 1ZGWA 3S17J 2N8GA 2LK2A 2DMPA 4MLOA 2IBDA 2DN0A 3GTQJ 3TP3A 2AO9A 1HDPA 4C3HJ 2M2EA 2TCTA 5FLMJ 5J3LA 4UUTA 4DYRA 1ETQA 1ZTRA 3BR2A 3QPLA 1ETVA 1AHDP 4A3MJ 3D1NI 1LFUP 4A3IJ 2HYJA 2EZKA 4LOCA 3ZQFA 4B3AA 3BTCA 2CQQA 4AUXA 1GT0C 2PMZN 3BTLA 4MFEA 2AHQA 3Q0UA 2VPRA 5EYRA 3BR0A 2NS8A 3A03A 1IRZA 2TRTA 2L7FP 1JKPC 4MFDA 5K7HA 1I50J 5EZHA 2DA4A 1RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR2 A;  5GP9 A;  2FJ1 A;  2NS7 A;  4BY7 J;  1IC8 A;  4D5C A;  2K9N A;  3B6C A;  2NVX J;  4M6V A;  1Q1V A;  1MBH A;  2Y9Y A;  1LE8 A;  4DW6 A;  3OSF A;  1ZKG A;  4MIM A;  2X9D A;  4MO7 A;  4V2G A;  1SAN A;  4IHY A;  2LKX A;  1B8I A;  1ETY A;  2DMN A;  3HGY A;  4EEF G;  1U9N A;  1RKT A;  5K7F A;  4W1U A;  2RAE A;  3HKZ N;  3BQZ A;  1MBK A;  5EF6 A;  3NAU A;  3OOU A;  1JJ8 C;  1ETW A;  3JRG A;  2QCO A;  1A6I A;  2E1O A;  1ZK8 A;  4QSH A;  3GTP J;  1HLV A;  3LSG A;  3HOW J;  2YUS A;  1MBJ A;  3IV5 A;  3NAR A;  2LFB A;  3JRB A;  1TWC J;  2D5V A;  4DZJ A;  4M3B A;  4V2F A;  4A3J J;  3HOX J;  2YU9 J;  2MW8 A;  1UHS A;  4BBR J;  1CQT A;  3FIW A;  3JRF A;  3IH4 A;  2IAI A;  5F08 A;  3GTO J;  2LTP A;  1ZQ3 P;  2K9Q A;  5E3N A;  1Y1W J;  1POG A;  3QPS A;  1ITY A;  2XRL A;  1T56 A;  3BTJ A;  3H3V K;  1VFC A;  1AU7 A;  3GTG J;  1FIA A;  5EG0 A;  1JKO C;  3S16 J;  1HDD C;  1FEX A;  3LSP A;  3ZOB A;  1IGN A;  1JKR C;  5M5Y J;  5M3F J;  3BR1 A;  4M3G A;  2L0K A;  2DJN A;  1TWH J;  3IH2 A;  1PUF A;  4A3B J;  3JRD A;  5FJ8 J;  1Z0X A;  2GM4 A;  1NTC A;  2O8K A;  4B1R A;  5IOY A;  1BW5 A;  3G1O A;  5FLV A;  2HOT A;  3BR6 A;  4RDU A;  1TC3 C;  3BTI A;  2LLK A;  1K83 J;  4S0H B;  2KT0 A;  1B72 A;  4C3I J;  5GPA A;  1IJW C;  2EZH A;  1IDY A;  4D7N A;  1MBG A;  3RKQ A;  1H8A C;  5FKM A;  1JT6 A;  1FJL A;  4RBO A;  1X2M A;  4FCY A;  1IV6 A;  2QF7 A;  1YRN B;  2MG4 A;  2LVS A;  3W6V A;  3WHB A;  5M3M J;  2CUF A;  2NVT J;  3GTJ J;  2HXO A;  1RKW A;  2CUE A;  4XIC A;  1GUU A;  3CQZ J;  5IOZ A;  4AYB N;  5GPC A;  3MVP A;  1AKH A;  2NVY J;  3BQY A;  3O8G A;  5J1R A;  2H1K A;  4X6A J;  4ABZ A;  3RQI A;  3O8H A;  2O7O A;  4A3D J;  1K61 A;  3S1Q J;  3Q0W A;  3HB9 A;  1HOM A;  2EZI A;  1JT0 A;  2L7Z A;  2COB A;  2JK3 A;  2EQR A;  3FIS A;  5F0H A;  5EGO B;  4M3E A;  4A3E J;  4BY1 J;  2VI6 A;  1ZR4 A;  3QQA A;  5M5W J;  2NOG A;  2L7M P;  3BT9 A;  5C4X J;  1XG1 A;  2LY9 A;  4A3F J;  2W48 A;  1R9T J;  3TED A;  2E19 A;  3I4M J;  1E3O C;  2EH3 A;  2WV1 A;  5F27 A;  5J1Y A;  4A93 J;  1F43 A;  2CRG A;  3VPR A;  2R5Y B;  2XB5 A;  1WPK A;  4IHW A;  5C4J J;  1TWF J;  4A3G J;  4Y52 J;  3K7A J;  5E3O A;  3HOZ J;  1JJ6 C;  1VND A;  4FE4 A;  2R93 J;  1GDT A;  1OFC X;  1U9O A;  3SJM A;  5IPA A;  2WAQ N;  1DU0 A;  2DMT A;  1TWG J;  5EGO A;  1WH7 A;  2B63 J;  1UG2 A;  2YS9 A;  1LFB A;  3S14 J;  2GBY A;  2EZL A;  3Q3S A;  1BJZ A;  2FD5 A;  4XK4 A;  3BR5 A;  2ELK A;  4J19 A;  4NDL A;  3SFI A;  4B4C A;  1G2H A;  1X2N A;  4M3D A;  4I6Z A;  2R5Z B;  5JLW A;  1GV5 A;  2X48 A;  3A01 B;  3BG5 A;  2CU7 A;  1NK3 P;  4I76 A;  2DMQ A;  3L1P A;  3BG3 A;  1U78 A;  3OSG A;  1HF0 A;  2XPW A;  3LSJ A;  4W97 A;  5EG0 B;  2CJJ A;  2Y0S N;  2JA5 J;  1ORK A;  1QVU A;  2MSY A;  3S1M J;  5FKO A;  1FTT A;  1RET A;  2DA1 A;  2Y9Z A;  4FIS A;  5F0F A;  5DS9 A;  3CDL A;  1JUM A;  5BNG A;  1LE8 B;  2G0E A;  2HDD A;  2OPT A;  3TW7 A;  2ID6 A;  5F1J A;  1NK2 P;  4IHX A;  3HEF A;  5E3L A;  1WCM J;  4XRM A;  1BL0 A;  5M5X J;  5IYB J;  3TW6 A;  4C3J J;  3DEW A;  2HOA A;  3JR9 A;  2M0C A;  1IG7 A;  1GVD A;  2R5Z A;  3K2A A;  1OCT C;  1UMQ A;  2HOS A;  1QPI A;  4XRS A;  5FKN A;  4HNV A;  9ANT A;  5EDN A;  3ZQC A;  1MH4 A;  1P7J A;  1S7E A;  2L9R A;  2IEK A;  2XPU A;  1FIP A;  2Y2Z A;  4A3L J;  1SFO J;  3ZQG A;  5EEA A;  5IP6 A;  2JA6 J;  2P81 A;  1PUF B;  3HOV J;  1JUP A;  4G12 A;  1QVT A;  2X6O A;  3M3Y J;  2VUM J;  2DA7 A;  4QIW N;  1TWA J;  2JN6 A;  1D5Y A;  2VKE A;  3I4N J;  5IP9 J;  2LD5 A;  1OCP A;  3ZQI A;  2DA6 A;  2XGC A;  3HGG A;  2CQX A;  3A01 A;  1VI0 A;  1FTZ A;  2H8R A;  1WGX A;  4Y7N J;  2XB0 X;  3G1M A;  4X1E A;  1B72 B;  2KDZ A;  3S1R J;  1WH5 A;  5E3M A;  2ECB A;  2ME0 A;  1RES A;  1XS9 A;  2E2J J;  2M9H A;  1ENH A;  2DA2 A;  5FKK A;  3HOY J;  1QRY A;  1IUF A;  1GV2 A;  3G1L A;  1I3Q J;  2R0Q C;  3GTK J;  3PO2 J;  1JTY A;  1U8B A;  3HDD A;  1ETK A;  4BBS J;  1T33 A;  3CCY A;  2NVQ J;  3Q0V A;  3JRA A;  1B8I B;  3OIO A;  2GLO A;  4M3F A;  4D7M A;  1BW6 A;  1ETX A;  2JWT A;  1F36 A;  2VKV A;  2Y31 A;  4C2M J;  3RZD J;  3HOU J;  3UKG A;  2DA5 A;  4JP0 A;  1A5J A;  4DZP A;  4XID A;  4JX5 A;  3S1N J;  1H88 C;  3ZQL A;  4GFB A;  3S2D J;  1MNM C;  2ZB9 A;  3M4O J;  1BA5 A;  1JTX A;  1MBE A;  3FKI J;  2XPV A;  3GBG A;  3FK7 A;  5EZG A;  1W0T A;  2DTZ A;  1W0U A;  3B6A A;  1MBF A;  2HQ5 A;  4JYK A;  3RZO J;  1EF4 A;  3HM5 A;  1HCR A;  3LOC A;  5FKL A;  5J1U A;  2XGD A;  1JKQ C;  4A69 C;  1ETO A;  2HXI A;  3ZQH A;  5JLX A;  4D5F A;  4FTH A;  3H0G J;  1YRN A;  1JUS A;  5C44 J;  3S15 J;  5K7Z A;  2I10 A;  1Z77 A;  1OJL A;  3DCF A;  5IP7 J;  1MSF C;  1I6H J;  4BXX J;  1O4X A;  3BG9 A;  3IH3 A;  2LP0 A;  2XGE A;  3BR3 A;  3S2H J;  3CMY A;  2E2H J;  2DMU A;  4JX6 A;  1Y1V J;  2ME6 A;  5F04 A;  1APL C;  3PO3 J;  3F0C A;  4UUS B;  1MH3 A;  3MN2 A;  4CYC B;  4UUS A;  2O9L A;  5IYC J;  1RR7 A;  2DA3 A;  3JRI A;  5F0C A;  3JRH A;  3TP0 A;  1IDZ A;  2OF7 A;  3MKL A;  4A3K J;  1P7I A;  2JJ7 A;  4DYQ A;  3WHC A;  1WI3 A;  3JRC A;  2R7Z J;  3SDG A;  2MGQ A;  3FK6 A;  4FE7 A;  2FQ4 A;  2K40 A;  1MSE C;  2M34 A;  4JX4 A;  4AC0 A;  5C3E J;  4A3C J;  1JGG A;  3GTL J;  4XRS G;  1DU6 A;  3PM1 A;  3LSR A;  2XSD C;  2M8G X;  5IYD J;  4IHV A;  2LR8 A;  5DTD A;  4QTR A;  2ID3 A;  2ECC A;  3JRE A;  4IEJ A;  1VF9 A;  2Y30 A;  4L5E A;  2R5Y A;  3C2B A;  1X58 A;  2JA7 J;  1AKH B;  4BKX A;  2E2I J;  3HBL A;  2JA8 J;  3GTM J;  4CYC A;  2FX0 A;  3A02 A;  1XC5 A;  2EBI A;  2HI3 A;  3LNQ A;  2WB1 N;  5HOD A;  2K9S A;  3E7L A;  2JMW A;  2R92 J;  4DYC A;  1H89 C;  1ZGW A;  3S17 J;  2N8G A;  2LK2 A;  2DMP A;  4MLO A;  2IBD A;  2DN0 A;  3GTQ J;  3TP3 A;  2AO9 A;  1HDP A;  4C3H J;  2M2E A;  2TCT A;  5FLM J;  5J3L A;  4UUT A;  4DYR A;  1ETQ A;  1ZTR A;  3BR2 A;  3QPL A;  1ETV A;  1AHD P;  4A3M J;  3D1N I;  1LFU P;  4A3I J;  2HYJ A;  2EZK A;  4LOC A;  3ZQF A;  4B3A A;  3BTC A;  2CQQ A;  4AUX A;  1GT0 C;  2PMZ N;  3BTL A;  4MFE A;  2AHQ A;  3Q0U A;  2VPR A;  5EYR A;  3BR0 A;  2NS8 A;  3A03 A;  1IRZ A;  2TRT A;  2L7F P;  1JKP C;  4MFD A;  5K7H A;  1I50 J;  5EZH A;  2DA4 A;  1RPW A; 
#chains in the Genus database with same CATH topology
 2EJR A;  1YE9 A;  3UNG C;  3HHH A;  1BIB A;  2FJ1 A;  2NS7 A;  2GZW A;  4D5C A;  4UVB A;  5D6E A;  2ELH A;  2OTL I;  1D8K A;  4M6V A;  1ZRD A;  3RIR A;  2X1E A;  4EVI A;  5EJC A;  1VQK I;  2Y9Y A;  4TV7 A;  4E6K G;  1LE8 A;  2Z99 A;  4LLG F;  4MIM A;  5IY5 H;  4IHY A;  2LKX A;  1MMA A;  1ETY A;  3ZQQ A;  3HGY A;  3ZCO A;  2F2E A;  5CVR A;  4L9J A;  1WVR A;  5K7F A;  2BHY A;  4YFN F;  3HKZ N;  1N77 A;  1LEA A;  3CUO A;  3GF2 A;  4XNF A;  5HDG A;  2GQQ A;  1JJ8 C;  1WJA A;  3JRG A;  2QCO A;  1ONV A;  4EQQ A;  1ZK8 A;  2IVM A;  3GTP J;  3F8F A;  5CQG A;  3LSG A;  2V26 A;  4ZYH A;  1U0J A;  3IV5 A;  3NAR A;  1BBY A;  1OIS A;  5JI6 A;  3JRB A;  3CCM I;  4ASN A;  4MNU A;  1P2F A;  1TWC J;  2RV8 A;  2FQ3 A;  1NHA A;  3K1M A;  1FYK A;  4BHP A;  2FOK A;  3KFW X;  1QHG A;  3PNV A;  2HU9 A;  2MW8 A;  3BJO A;  3FKJ A;  4QWQ A;  4NQW B;  2VE9 A;  2FBK A;  3AL0 C;  1B4A A;  3JRF A;  3IH4 A;  1MMN A;  4OMZ A;  1ERD A;  5DCF A;  5F08 A;  4A0X A;  2LTP A;  3WGI A;  2BV6 A;  2JSP A;  2VBW A;  2MH9 A;  3KZY A;  3QPS A;  4RB2 C;  4PGH A;  4HDV A;  3DTI A;  2P7C B;  1QHH D;  3PIO F;  3N05 A;  1DGR M;  2Z2S B;  2P5L C;  3H3V K;  4Q4Z F;  4U88 A;  4O5V A;  1IN8 A;  1JKO C;  2LC2 A;  2R3S A;  1HDD C;  3LSP A;  1V5E A;  3CCV I;  2CFO A;  2EFW A;  3N4M A;  1J2X A;  3REO A;  1JKR C;  3FXL A;  3GO5 A;  2RDP A;  1FP2 A;  3BR1 A;  3H9Q A;  1SEU A;  2E1M B;  4HLX A;  2HQA A;  4BQO A;  4DOZ A;  3M8J A;  2A68 F;  2L0K A;  4H0E A;  1G3T A;  2HS5 A;  4A3B J;  4XL9 A;  3G4S I;  5FJ8 J;  1OR7 A;  4HLY A;  2KL4 A;  1NTC A;  2ACJ A;  2ZFU A;  2WV0 A;  1BW5 A;  1SVL A;  4MTD A;  3TL4 X;  1X1A A;  4RGS A;  2LLK A;  5DD8 A;  3FMR A;  4S0H B;  4E7S A;  1FWZ A;  2M4G A;  3A4C A;  3HPG A;  1XTA A;  3GWZ A;  2RRE A;  3G6E I;  3BDD A;  2YSR A;  1SFK A;  1XPX A;  3CME I;  4YIF A;  2MC3 A;  1PDN C;  4LG0 A;  4ZYG A;  5FKM A;  4NC8 A;  3HJE A;  3U9G A;  2XF5 A;  5EEH A;  3IUO A;  2BY2 A;  5FGM A;  1FJL A;  3R60 A;  1KA8 A;  1IN7 A;  3FXM A;  1BR4 A;  4RBO A;  2MBF A;  3HC7 A;  2Y48 A;  3JSO A;  3F21 A;  5L3F A;  2MG4 A;  1ZYR F;  5ERI A;  3CZ6 A;  4ZDL A;  1K78 A;  4BGD A;  5LD2 C;  2NVT J;  2LSO A;  1A36 A;  3LQR A;  3QYE A;  3OV8 A;  1R7J A;  3CQZ J;  3H0D A;  4GGG A;  5IOZ A;  5BPI A;  1PP7 U;  1UAA A;  1BC7 C;  2KJC A;  3DPU A;  3M1C A;  3O8G A;  5D8L B;  5J1R A;  2M1B A;  3Q5F A;  1B59 A;  1BR2 A;  1NG6 A;  3O8H A;  3VYS B;  5E18 F;  3BRO A;  2PI0 A;  4MTE A;  1YQA A;  2LRD A;  3J7A O;  3L2R A;  4KN4 X;  4KMF A;  4N0B A;  3OS1 A;  1ZEL A;  2EIJ H;  2L7Z A;  5H6Q A;  1TL8 A;  2COB A;  1W5T A;  3LA2 A;  3V7R A;  4LG0 B;  1E3P A;  5TRD A;  4A3E J;  2MLK A;  1RZ4 A;  5FB2 A;  2QLZ A;  2BY1 A;  4B09 A;  2CQ7 A;  3OYH A;  5E8I A;  3EUA A;  1R4M B;  4HX4 A;  4NQW A;  1BN5 A;  5E1Z B;  2UV1 A;  5L3B A;  2E19 A;  3I4M J;  3LFU A;  4DGW B;  2LYC A;  2HFH A;  5HOO A;  2WV1 A;  2HEO A;  1U5T C;  4U0Y A;  3DXJ F;  4E7I A;  2XB5 A;  2JVH A;  1ZG5 A;  5HS9 A;  3RKX A;  1U2W A;  2NNN A;  5LGU A;  4R8H A;  5D5V B;  3K7A J;  2HVR A;  3OYM A;  2AQF A;  3P7N A;  4A5N A;  5HDN A;  1QZY A;  4MGR A;  5K5O A;  1GDT A;  2IGK A;  2R7D A;  3SJM A;  4C30 A;  5IPA A;  1N78 A;  2JT1 A;  2DMT A;  1TWG J;  4G6D A;  3HPH A;  1R1U A;  2R7O A;  1WH7 A;  5DV5 A;  2VOD A;  1LFB A;  5IT9 K;  3S14 J;  2GBY A;  4ITV A;  3Q3S A;  3EDP A;  2L9V A;  4J19 A;  2K9M A;  4HPQ A;  4AIK A;  2DT5 A;  5KK1 A;  1X2N A;  2HDC A;  4IPA A;  4I6Z A;  2X48 A;  1G6N A;  3E5X A;  1V3F A;  2IA0 A;  2A6E F;  1LPQ A;  4XBF A;  4KFC A;  2GWR A;  3BG3 A;  3DPL C;  3QU6 A;  3R61 A;  1D0Z A;  2AXT C;  1ZH5 A;  3DU5 A;  5LEK A;  4F52 A;  4BNC A;  4W97 A;  5FFZ A;  2X6Y A;  2H09 A;  3LSI A;  2CJJ A;  4KN7 X;  2JA5 J;  4IHS A;  1ORK A;  2VJI A;  2ZME C;  2ZJ2 A;  4IL6 C;  4IVN A;  3OIP A;  5FD6 A;  3L2W A;  2O8X A;  2Y9Z A;  4HOB A;  3K4K A;  4E7K A;  1TNS A;  2V79 A;  5DS9 A;  1JI8 A;  4PGG A;  1YX5 A;  5BNG A;  2M45 A;  4HX8 A;  5E3L A;  1HKT A;  1MJA A;  1WCM J;  5M5X J;  5IYB J;  3U2R A;  3OYK A;  4C2U A;  4Y17 A;  5KNL A;  3CES A;  1J09 A;  1I1G A;  3DEW A;  3ZN1 A;  2I5U A;  5HLI A;  3MZH A;  4OIN F;  4RAZ A;  3S2W A;  2DW4 A;  3FHZ A;  3MEX A;  4YII A;  3ZMV A;  4XRS A;  1W1W E;  5F1R A;  5EDN A;  1MH4 A;  1CGP A;  1REP C;  2J5O A;  5EEG A;  1SFO J;  5EEA A;  2UXX A;  2JA6 J;  1O3T A;  1PUF B;  2DFH A;  1N75 A;  3M07 A;  3FM3 A;  4E70 A;  1RUN A;  2VUM J;  3QYF A;  1TWA J;  3S32 A;  3CMM A;  1UZC A;  1D5Y A;  2VKE A;  1R36 A;  2XKO A;  2H8W A;  2HOE A;  2LD5 A;  1VQN I;  3E97 A;  1G4D A;  3PIP F;  2M4K A;  2Y75 A;  4I99 C;  1TLH B;  1BI0 A;  2AXL A;  2CV2 A;  3LFK A;  3RDI A;  1Z7U A;  1S6L A;  2PX9 A;  2KDZ A;  3S3O A;  4OOI A;  1UB9 A;  1WH5 A;  4QPO A;  3QOE A;  1I6X A;  3FXJ A;  4UY8 I;  1KYW A;  4P5O A;  2ETH A;  4CYD A;  1ENH A;  2KFD A;  4AWX B;  3HOY J;  1R1T A;  4Q47 A;  1QRY A;  3S93 A;  1IUF A;  1GV2 A;  1X1P A;  3K69 A;  3Q9V A;  4ZZL A;  1TTY A;  5A2Q K;  2R0Q C;  5DDG A;  1SC7 A;  4BJ6 C;  5LGN A;  3PO2 J;  3BP8 A;  1T33 A;  5J6X A;  3AG4 H;  1WJ5 A;  3CCY A;  4EJW A;  2NVQ J;  2CW0 F;  3NQO A;  5DM6 F;  1B8I B;  2GLO A;  4N4N B;  4O6J A;  2V1D A;  4P9F A;  3OR1 C;  2FML A;  4XR6 A;  4EV0 A;  3RZD J;  3UKG A;  3OR2 C;  2DA5 A;  4U0V A;  3OL3 A;  5A2Q Z;  4IQJ A;  4XID A;  3CP8 A;  4A0Z A;  1YLF A;  4EM2 A;  1RIO H;  2IS6 A;  1X1B A;  1H88 C;  5E17 F;  1ZG3 A;  1DDN A;  1G3Y A;  2FF4 A;  4P9U A;  2FU4 A;  4Z2Y A;  3ZQ7 A;  4BS9 A;  4PJ0 C;  2EV6 A;  1IRG A;  3M4O J;  4P55 A;  1XMX A;  1VQ7 I;  1HST A;  4FQG A;  5EZG A;  1W0T A;  2IGM A;  3DFG A;  2CV1 A;  1J9I A;  2DYR H;  2BVM A;  2B0L A;  3B6A A;  2STW A;  1W4M A;  1TZL A;  3VB2 A;  1VQM I;  1EKE A;  3OIQ A;  3F3X A;  3K1N A;  1XB4 A;  5FKL A;  3KEY A;  2XGD A;  3CUQ A;  3TDZ C;  4G6Q A;  3K2Z A;  1BOA A;  5JLX A;  1YRN A;  2OBP A;  2RC4 A;  3I71 A;  1R4N B;  3DCF A;  3DBR B;  1I6H J;  1OMI A;  4BXX J;  4NUB A;  2L5Q A;  1W5C C;  2P7V B;  1IXR C;  1YW9 A;  2E2H J;  4JX6 A;  2UXN A;  4YG2 F;  5LHH A;  2V6E A;  1APL C;  1TP4 A;  2CMP A;  4UUS A;  5KVR A;  3J80 Z;  2DA3 A;  5HNH A;  2OZ6 A;  2KJB A;  3JRI A;  1SFX A;  4IHT A;  1LKX A;  5BS6 A;  4A3K J;  4LG3 A;  3OYD A;  4DYQ A;  3WHC A;  1KU9 A;  2JSC A;  1LDD A;  4EM1 A;  5J47 A;  1IO2 A;  3JRC A;  3AG2 H;  1X3Z B;  1P4X A;  1SD7 A;  4FE7 A;  4L9T A;  2K40 A;  2NNY A;  2M34 A;  4AC0 A;  5C3E J;  1IRF A;  2IA1 A;  2PG4 A;  2VOP A;  2IT0 A;  2K5C A;  1WJD A;  4B43 A;  3FXK A;  4XLE A;  2HQN A;  1EV7 A;  3LSR A;  2JQ7 A;  2M8G X;  4IHV A;  3T0Y A;  1S29 A;  1S7A A;  1EH7 A;  1HKS A;  4O3M A;  3QRF F;  3GFM A;  2E1C A;  4KNY A;  3WGH A;  3JRE A;  3FXR A;  4IEJ A;  3SEQ A;  1VF9 A;  2R7F A;  2CUZ A;  1R5I D;  3CF2 A;  3GTM J;  1ZAR A;  2KRH A;  3ERM A;  5JFR A;  1WHU A;  3CCL I;  1E3H A;  4PFP A;  2R7V A;  4ZYA A;  5HOD A;  1H0M A;  1VQ5 I;  1PUE E;  4UB6 C;  4ETS A;  3KP6 A;  4ENN A;  4P96 A;  1YO5 C;  1E2X A;  2BVL A;  3CC7 I;  4RAG A;  1YHQ I;  1D8J A;  2VBX A;  2VQH A;  2AO9 A;  3TO9 A;  4CCJ A;  2M2E A;  1U3E M;  4ESJ A;  3H3Z A;  1T6S A;  4HNT A;  4E7H A;  5TIS C;  3GFJ A;  5ILS A;  4DYR A;  3OWT A;  4HNU A;  4BL0 B;  1ETV A;  1AHD P;  2P6T A;  2CSO A;  2L9N A;  3TBI A;  2R7U A;  2QYO A;  4WXC A;  1GT0 C;  4Y33 A;  1V55 H;  2B9S A;  1S5L C;  3VOE A;  3BZK A;  3RSN A;  4XRF A;  2VPR A;  1HBX G;  2L7F P;  1JKP C;  5K7H A;  1FLI A;  2LBF B;  3ZMT A;  4PUS A;  4LIT A;  5GP9 A;  1ACI A;  1HQC A;  1IC8 A;  1MMD A;  3ABL H;  1YW7 A;  1MBH A;  2JRT A;  5B1A H;  4IRI A;  2HKX A;  3NWS A;  1ZKG A;  4MO7 A;  1YS7 A;  4V2G A;  1Z7L A;  1HXD A;  1SAN A;  3I54 A;  1EH6 A;  1W7P B;  3V7S A;  3J7Z I;  3S3N A;  1B8I A;  1BC8 C;  4EEF G;  1U9N A;  2KIQ A;  2DK5 A;  4W1U A;  3BQZ A;  1LEB A;  1XDU A;  1YJW I;  2V6C A;  2K3P A;  4CH7 A;  2M87 A;  3NAU A;  1NG7 A;  3OOU A;  5L3G A;  1ETW A;  1FOY A;  3K4M A;  2ZO4 A;  4DBR A;  4UVA A;  2MYS A;  3DKW A;  2R7X A;  4HEA 2;  2KP6 A;  2PLY A;  3HOW J;  2YUS A;  4BAC A;  1YIO A;  2QUF A;  1IUY A;  5JHU A;  4I2O A;  3S3M A;  3FMS A;  3F8N A;  3F8B A;  2D5V A;  3CD6 I;  1KYZ A;  4G94 A;  2ADU A;  4DZJ A;  4A3J J;  2OU2 A;  3HOX J;  4HDU A;  1QQI A;  1XCV A;  3R0J A;  4M74 A;  4A2U A;  5ED4 A;  2YU9 J;  4HRI A;  4B47 A;  1CQT A;  5L3E A;  4LD5 A;  2V9V A;  2IAI A;  3GTO J;  3WTW C;  1ULY A;  2M7A A;  3P5J A;  3DKY A;  1ITY A;  1SMY F;  1GHC A;  1LDK B;  2HTJ A;  2XRL A;  4XOT A;  4RLF A;  1V5F A;  1KZH A;  3K0L A;  1VFC A;  1R00 A;  3FXU A;  4BE1 A;  2NRA C;  5EG0 A;  5J4V A;  4KIC A;  3S16 J;  2DCE A;  3HHG A;  4RLQ A;  5KAF C;  1X4O A;  2ZXH A;  5CLS A;  3FXO A;  5H6R A;  5M3F J;  2HPI A;  1G3S A;  3GME A;  3VDX A;  5GAE J;  1VQO I;  2V1U A;  1TWH J;  2VLA A;  5DUK A;  2O8K A;  1YS6 A;  1WJC A;  4B1R A;  4RAY A;  3EET A;  2VQL A;  3MZ8 A;  5FLV A;  2DOA A;  1VZ0 A;  2OZU A;  3WU0 A;  4XLH A;  3RKY A;  3IAS 2;  1B9N A;  4RDU A;  1VQ9 I;  2VBZ A;  1QPM A;  4M72 A;  1ZGA A;  2KT0 A;  2WB1 A;  4AIJ A;  1B72 A;  3PJR A;  1W5S A;  4C3I J;  5GPA A;  3DV8 A;  3MFK A;  2CO5 A;  2EZH A;  2EFQ A;  1SMT A;  1IDY A;  5FRO A;  4D7N A;  3O2P E;  4BQN A;  2VXZ A;  3ECO A;  4IRH A;  3GYH X;  4U7D A;  2JPB A;  1ZRC A;  1KON A;  3KE2 A;  2CH0 A;  1H8A C;  2QBY B;  2M0M A;  2FNA A;  1SD4 A;  3PUF A;  3OYI A;  1D0X A;  2CFX A;  4UV9 A;  2F5C A;  1MJ9 A;  2ZME B;  4ESB A;  5LLQ A;  4FCY A;  1K4S A;  4XKC A;  4HQM A;  3W6V A;  5LFA A;  2V9P A;  1YIT I;  2YPR A;  2CUF A;  2V4J C;  3HRS A;  4GRI A;  5ICE A;  2FSW A;  3BPV A;  2R4G A;  3ZR8 X;  1QZZ A;  1RKW A;  2HXO A;  1T08 B;  2HKO A;  4XN0 A;  3H5A A;  4KIF A;  4AYB N;  5GPC A;  1RUO A;  4HSR A;  3DLL F;  3MVP A;  3PFI A;  2NVY J;  3BQY A;  4XKV A;  2DJI A;  5J40 A;  3O6B B;  4E7L A;  4CSW A;  2L4M A;  2L9S A;  2O7O A;  3HYI A;  3WE3 A;  1XGS A;  3G3Z A;  1WQ2 A;  3HB9 A;  3Q0W A;  2DPD A;  5B3S H;  4UNO A;  4F7Z A;  1OKR A;  1GXQ A;  1W36 C;  4HG2 A;  2JK3 A;  1ON1 A;  2MD5 A;  2IP2 A;  3FIS A;  5EGO B;  3MKZ A;  5BOX A;  3FF5 A;  3VOD A;  3GZN B;  4NNJ A;  1M1E B;  3X2Q H;  3JCU C;  3K70 C;  3CC4 I;  1PP8 F;  1XG1 A;  4XKW A;  3COA C;  2XHK A;  1R9T J;  5HLT A;  1YJN I;  4KYW A;  2JTV A;  2ZKZ A;  2EH3 A;  2WWY A;  4CCL A;  2D1V A;  2OCE A;  5F27 A;  3CO7 C;  1F43 A;  1QNT A;  3L7W A;  1R1V A;  3E5Q A;  3TMO A;  2CQK A;  4IHW A;  4EGY A;  3BCB A;  4OMY A;  3MWM A;  2BW3 B;  3RI4 A;  1R22 A;  3GXO A;  4BYY A;  1WKM A;  1T38 A;  4F55 A;  2QBY A;  1ZAO A;  3CCQ I;  3WTX C;  1FPQ A;  3CJN A;  4FE4 A;  4UB8 C;  2EFP A;  2BBY A;  4UHT A;  1U9O A;  2F5D A;  1DU0 A;  3F9K A;  1WSU A;  5EGO A;  2A6H F;  4CIC A;  3CC2 I;  2B63 J;  1UG2 A;  2FD5 A;  4F92 B;  3PQJ A;  4XK4 A;  1OR7 C;  2F48 A;  3SFI A;  4B4C A;  1G2H A;  2VPL A;  2R5Z B;  5JLW A;  3IWF A;  2GXB A;  1HW5 A;  2CU7 A;  1ON2 A;  4OAY A;  2FBH A;  5DCM B;  3F72 A;  3TDU C;  3JSP A;  3T1B A;  4OIP F;  1W7P D;  3L1P A;  2VOO A;  4DIQ A;  3WG7 H;  3OSG A;  2L4A A;  1XSX A;  1A04 A;  5CJ9 A;  2LDU A;  3S8P A;  1HF0 A;  1K4T A;  2BW3 A;  2O3F A;  3TO6 A;  2Y0S N;  2W25 A;  1PVE A;  2EFN A;  4B48 A;  1MMS A;  3ZN0 A;  1FTT A;  1RET A;  2DA1 A;  2DOE A;  4L5I A;  4D9J A;  4NC6 A;  3I56 I;  1JHH A;  2ZME A;  3DU6 A;  3KP2 A;  1JUM A;  1LNW A;  1PYV A;  2EB7 A;  4M71 A;  2HDD A;  2NVU B;  2ID6 A;  3M9A A;  1NK2 P;  3J7Y J;  4E4H A;  2OUM A;  1K78 B;  1BL0 A;  3TW6 A;  1RNL A;  3K9T A;  3D5L A;  4E7J A;  1JHF A;  5D4R A;  1XCB A;  2Z16 A;  1HA8 A;  4WF2 A;  2R5Z A;  2E5Z A;  4HF2 A;  1SFE A;  4QLC U;  3FXQ A;  3HSE A;  1QPI A;  4HNV A;  2RKH A;  2E1M C;  4D0P A;  3L2V A;  1DPR A;  2PJR A;  2VE8 A;  3RJP A;  2L9R A;  2NXN B;  1WFX A;  4XQF A;  2IGO A;  3P9C A;  2GAU A;  4ESF A;  2P81 A;  1IXC A;  1QVT A;  4RMN A;  5ICC A;  1XDS A;  3DBH B;  2JN6 A;  3CO6 C;  2DK8 A;  3I4N J;  5IP9 J;  2HYG D;  1OCP A;  5CVU A;  1V4R A;  3ABU A;  4AYB A;  2FOW A;  1AWC A;  2H8R A;  1WGX A;  3I0T A;  3G1M A;  2IS4 A;  3BWG A;  5FLX K;  4X1E A;  3ZMZ A;  1Z6R A;  2G9W A;  2MD0 A;  2FEZ A;  3BOQ A;  1S7O A;  2P6S A;  1VQ4 I;  2ME0 A;  3KP4 A;  4X0G A;  2LY2 A;  1XS9 A;  2KLO A;  2E2J J;  2M9H A;  2FXA A;  2DA2 A;  2ZC2 A;  5FKK A;  1TNT A;  3U1K A;  2GA1 A;  4L5J A;  2FRH A;  3W6J B;  1J59 A;  4KIS A;  2X6X A;  3H35 A;  1U8B A;  1TQI A;  1ZLK A;  3SZG A;  5LRS A;  3R4K A;  3JRA A;  1FBU A;  3LAJ A;  2K27 A;  1ETX A;  3IHU A;  2JWT A;  2Y31 A;  1IN4 A;  2Z5U A;  4JP0 A;  4BE2 A;  3SZP A;  3B73 A;  3S1N J;  4OAZ A;  2XAU A;  1FC3 A;  2D45 A;  4GFB A;  1OCR H;  5HNF A;  4I0A A;  3JTG A;  1FBS A;  1MNM C;  5FRM A;  4RB3 C;  2FUG 2;  1BA5 A;  2XKP A;  4I01 A;  3ZMU A;  2E1N A;  2DTZ A;  5FFX A;  1W0U A;  2D2W A;  3U1D A;  2EIN H;  3ESW B;  4S04 A;  3UR3 C;  4JYK A;  3SEZ A;  3WTV C;  2K02 A;  3CCE I;  1EF4 A;  4HX7 A;  2E34 A;  3DLA A;  4M9X A;  1JKQ C;  2QEN A;  1IRX A;  1ETO A;  2HXI A;  4A69 C;  5ILU A;  1O3R A;  4FTH A;  4WXD A;  4CCN A;  1E0E A;  1S8N A;  5K7Z A;  4EJV A;  4Q5S F;  2HNH A;  1O4X A;  3BG9 A;  4ENK A;  3IH3 A;  1BI1 A;  2PBI A;  4HBL A;  5H20 A;  4II2 A;  2DMU A;  4ZDO A;  3H92 A;  3HIF A;  2ME6 A;  4BDZ A;  3K6G A;  1MDM A;  1UHM A;  5LHG A;  2A69 F;  4UV8 A;  4KUM A;  1VTN C;  3F0C A;  3E6C C;  2XAH A;  4CYC B;  2VT2 A;  2WBM A;  1T8I A;  5IYC J;  2ZJR F;  3RYR A;  3GLL A;  4IOC F;  2DDA A;  1IDZ A;  1JGS A;  3VWB A;  2JJ7 A;  1HSJ A;  3QWL A;  3HRT A;  2GXA A;  1WI3 A;  3HUG A;  3QYB A;  2R7Z J;  5LRR A;  2MGQ A;  2LKS A;  1MSE C;  1MD0 A;  3I64 A;  4KIB A;  1JGG A;  1ZRF A;  1FSE A;  3FHN A;  3PM1 A;  4XM3 A;  1DU6 A;  2XSD C;  5IYD J;  1R58 A;  2LR8 A;  4QTR A;  3E3V A;  1Z91 A;  2KMU A;  4L0Y B;  4S05 A;  1XD7 A;  2ECC A;  1R5H A;  2QKM B;  4A5M A;  4L5E A;  3A0B C;  4CGZ A;  3LQQ A;  3C2B A;  1IW7 F;  3LA7 A;  1O7L A;  1HKQ A;  2PQ8 A;  1Z6T A;  4LIV A;  2GIZ A;  2JA8 J;  1IN5 A;  3A02 A;  4IJA A;  5KCM A;  4KT6 A;  3E7L A;  3DKX A;  2R92 J;  2DXI A;  4CUG A;  2IA2 A;  2N8G A;  2DMP A;  3QPH A;  2FE3 A;  2VL8 A;  3TP3 A;  3RQ4 A;  1Z05 A;  4BU2 A;  3OS0 A;  1HDP A;  3FMQ A;  5FLM J;  5J3L A;  1FNN A;  5CVI A;  2XAF A;  3L2U A;  1LDJ A;  2XAJ A;  4XOR A;  1ETQ A;  2XRN A;  3QPL A;  4C2T A;  3GCM A;  2IJL A;  3D1N I;  2WAF A;  1LFU P;  1UHW A;  3QPT A;  2CV0 A;  4LOC A;  3ZQF A;  4JOM A;  5D4S A;  1KGS A;  4AU7 A;  1DUX C;  2HVS A;  3EPZ A;  4XLP F;  5GTI C;  4MFE A;  2QQA A;  3F6O A;  4MQ9 F;  3OYC A;  1LQ1 A;  2V9K A;  3A03 A;  3FX3 A;  3VYU B;  4XN3 A;  5GAH J;  2XRO A;  5CPR B;  1DGW Y;  3N97 A;  3Q9S A;  3WGG A;  2DA4 A;  3HSR A;  4IOA F;  1ZHF A;  4BY7 J;  5K5R A;  2NVX J;  2KIM A;  3B6C A;  2W00 A;  3AG1 H;  4A12 A;  3BJ6 A;  1O3Q A;  4XLF A;  4DW6 A;  4XLA A;  3OMY A;  2F5V A;  3B02 A;  4IQ4 A;  2LMD A;  3CCR I;  1YFH A;  5AON A;  2X0L A;  2ZNY A;  2DMN A;  1FOX A;  3FBI B;  1Z9C A;  1RKT A;  3ZXS A;  4C9Y A;  1ZRE A;  1XGN A;  2RAE A;  2X1C A;  4BHB A;  3ONQ A;  4BE0 A;  1D3Y A;  4FT8 A;  2DQL A;  5CVJ A;  4V19 K;  1R5G A;  1UST A;  5KAI C;  3C7J A;  3A2K A;  3C2H A;  3ZRG A;  1A6I A;  5DCM A;  1Y0N A;  3WTZ A;  3F22 A;  2XC7 A;  5K5Q A;  1HLV A;  4HF1 A;  1MBJ A;  1YJ9 I;  2OAZ A;  3QP6 A;  2IS1 A;  2LFB A;  2HR3 A;  4YRV A;  3CCS I;  2PMU A;  2AS5 F;  5AIQ A;  3F6V A;  1J75 A;  4YEL A;  4OIQ F;  4I02 A;  4WCG A;  3LAP A;  1ZLJ A;  2RQQ A;  2DOD A;  2M8E A;  2LKP A;  1Y8R B;  1B9M A;  1MMG A;  2W4S A;  4JK1 X;  3ISP A;  1W7P A;  3PL8 A;  1POG A;  2V7F A;  1ODD A;  4G9Y A;  5AIP A;  2WAE A;  1T56 A;  3OYG A;  2DT6 A;  2DQR A;  1OCO H;  3BTJ A;  4OU0 A;  4Y13 A;  3H9G A;  1FEX A;  2IGN A;  3OY9 A;  3IL2 A;  1QA6 A;  3H36 A;  4GYI A;  1Z21 A;  3ZOB A;  1IGN A;  1P92 A;  3FM5 A;  4IXA A;  2K4B A;  5F6F A;  1WJF A;  5HVQ C;  2W84 A;  5M5Y J;  2IPQ X;  3LSM A;  4U87 A;  3EYY A;  3IRR A;  1CF7 A;  3TOB A;  3IH2 A;  2VKH A;  2CWE A;  3PQK A;  3JRD A;  1BR1 A;  2H1L A;  1Z0X A;  2O03 A;  2GM4 A;  1TT5 B;  4XSZ F;  4ENM A;  1MND A;  4D1Q A;  4ON0 A;  3G1O A;  1S3J A;  3C18 A;  4HYE A;  2HOT A;  3HSF A;  3BR6 A;  2STT A;  2OQG A;  3K70 D;  1WWX A;  5DUI A;  2JUG A;  2L2O A;  2KIF A;  3L09 A;  3SDB A;  4AM3 A;  3WOD F;  4EM0 B;  1MKM A;  2RVC A;  4N9I A;  4MHG A;  2CW7 A;  3OYJ A;  3SHF A;  3MKY B;  4ZTF A;  3K4J A;  1JT6 A;  1I5Z A;  4AVZ A;  4EJT A;  2DLL A;  1H9G A;  2RGV A;  3K10 A;  4ZH4 F;  1IV6 A;  2QF7 A;  1YRN B;  2LVS A;  4II3 A;  4Y4R A;  5M3M J;  1KU2 A;  2K9L A;  1Y8Q B;  3EUK L;  2FNP A;  2E60 A;  4XIC A;  4G7O F;  3PSF A;  3E6D A;  1AKH A;  2DBB A;  2JA2 A;  4WWC A;  4L0Z B;  1J5Y A;  1TT0 A;  3VYR B;  2K86 A;  3H5R A;  5D5X B;  5LHI A;  1K61 A;  4GO1 A;  3HOT A;  2EZI A;  3OYL A;  1JT0 A;  5E1W A;  3DP7 A;  2QQ9 A;  2XGX A;  2KRC A;  4RM3 A;  5E1X A;  1XX5 A;  2ZSH B;  4PSW A;  5BPD A;  2A3S A;  5F0H A;  4EJU A;  4M3E A;  2GOX B;  1IF1 A;  1R71 A;  2VAS A;  4BY1 J;  1SAU A;  3L2C A;  1ZR4 A;  3ULQ B;  2A5Y B;  3QQA A;  1UJ8 A;  3HL2 A;  5CYV A;  2NOJ B;  2NOG A;  2X6W A;  1K6O A;  3F8C A;  5B5E C;  4A3F J;  1WRJ A;  3TED A;  1TQM A;  2V1X A;  2Q8K A;  1E3O C;  4B8X A;  2OQR A;  2BEO A;  2DI3 A;  1U6G A;  4A93 J;  2CRG A;  2ELJ A;  2E7W A;  1QBJ A;  4CDG A;  2E35 A;  1WPK A;  2ZXI A;  4IF4 A;  5LEJ A;  4CO8 A;  5C4J J;  4EGZ A;  4A3G J;  2CQN A;  4RA2 A;  5DYM A;  5E3O A;  1JJ6 C;  1A31 A;  4NHJ A;  4PJN A;  1VND A;  3DWL E;  2R93 J;  3KLN A;  2KRF A;  2RQP A;  2DAO A;  2AQE A;  3ABT A;  3GEZ A;  1W36 D;  5JR3 A;  4IO9 F;  1IZ1 A;  2L7K A;  2W85 A;  1BI3 A;  1DP3 A;  3BR5 A;  3GZ5 A;  4DJA A;  4NDL A;  2L01 A;  4YFX F;  2QSH X;  1GV5 A;  3D0S A;  5E8G A;  3A01 B;  1FOW A;  3SYT A;  3BG5 A;  1JE8 A;  3KIO A;  4LMY A;  2R7Q A;  3W2A A;  4I76 A;  2DMQ A;  3NWT A;  2F5F A;  3R0A A;  1U78 A;  2DYS H;  1FT9 A;  3J81 K;  3CP2 A;  4PZJ A;  4HA8 A;  4XKB A;  4KA4 A;  3RPQ A;  1FOK A;  4KIG A;  1TW3 A;  1QVU A;  4LLN A;  3S1M J;  5FKO A;  4XOP A;  1SVM A;  2CGP A;  1N25 A;  2TDX A;  3WTY C;  2IS2 A;  2H94 A;  1J0R A;  1S9H A;  5CVV A;  1L0O C;  1YI2 I;  4LIU A;  1T2K A;  2JRM A;  1G3W A;  2HGC A;  4GXO A;  4Y15 A;  1LE8 B;  4ANJ A;  5HS8 A;  1J7K A;  1AA7 A;  5F1J A;  2I8D A;  2PMH A;  2VQG A;  3SXY A;  3AKZ A;  2VJ4 A;  2HVQ A;  4KT5 C;  2HZT A;  4IRG A;  2HOA A;  2M0C A;  1GVD A;  4PJL A;  2DOF A;  3K2A A;  3DTE A;  5K1Y A;  4G7H F;  1OCT C;  2EIK H;  2HOS A;  3P9I A;  9ANT A;  2Y0S A;  2KIS A;  1X19 A;  3CUQ C;  3ZQC A;  2EIL H;  1S72 I;  1P7J A;  1S7E A;  3IKV A;  3A0H C;  1OYI A;  3QU3 A;  3G73 A;  2COM A;  2Y2Z A;  1D1C A;  1QO0 D;  4PJM A;  4XMY A;  4KJZ A;  3A1Y A;  3MKW B;  4G12 A;  2ESH A;  3I53 A;  3W3C A;  4QIW N;  2ISY A;  2F6C A;  2K7L A;  2Q2E B;  3NEU A;  4BH9 A;  3ZQI A;  2DA6 A;  2MC4 A;  3HGG A;  2CQX A;  4HZF A;  5D8K B;  2XB0 X;  2OA4 A;  1GVJ A;  1LUJ B;  2O0Y A;  5E3M A;  2ECB A;  2VC1 A;  1RES A;  1Y0U A;  3LSH A;  3PUB A;  4FHT A;  4BHC A;  1MZB A;  3GUD A;  2VB6 A;  2PN6 A;  1FBQ A;  3G1L A;  5E20 A;  1D0Y A;  1I3Q J;  5HS7 A;  3VEP A;  3LWF A;  5IT3 A;  4OIR F;  1DPU A;  4OWR B;  2L02 A;  1JTY A;  3W2V A;  2BZT A;  4BBS J;  5GAD J;  1FYL A;  2VJ5 A;  2VC0 A;  3GFI A;  3TGN A;  5H2F C;  3Q0V A;  1RC9 A;  3OIO A;  4CCK A;  1BW6 A;  2W82 A;  1F36 A;  2VKV A;  4C2M J;  3KX2 A;  3HOU J;  2ZCW A;  2XAS A;  2E7X A;  3CLO A;  2G7H A;  4HST A;  5DD4 A;  4AID A;  2YU3 A;  1C0W A;  5HDK A;  4DZP A;  1XN7 A;  2FMY A;  4JX5 A;  1XGM A;  3CTA A;  1P9Q C;  4RS8 A;  3ZQL A;  1T39 A;  3BLY A;  1Y39 A;  3E6M A;  3DEU A;  3P9K A;  3S2D J;  1QU3 A;  2ZB9 A;  1I27 A;  3W2W A;  4HV6 A;  4NB5 A;  1LJ9 A;  2KQR A;  2XF6 A;  3KEQ A;  4EJO A;  3WU2 C;  3M8E A;  3MD2 A;  4F93 B;  3L9F A;  3RZO J;  2YR2 A;  3HM5 A;  3LOC A;  3OYE A;  2KZV A;  4I09 A;  1K7A A;  4F91 B;  4D5F A;  3ZQH A;  1U8R A;  3DEE A;  3H0G J;  3OYN A;  2VN2 A;  3K4L A;  3U21 A;  4WX9 A;  2I10 A;  1Z77 A;  1OJL A;  1FX7 A;  4QPQ A;  1FZP B;  5IP7 J;  1XMA A;  3CDH A;  2Z33 A;  3CMY A;  1IV8 A;  3L2Q A;  1V5G A;  3H1C A;  1OLT A;  2VJJ A;  1X3U A;  3FWE A;  4BJ5 C;  3PO3 J;  2VBY A;  1QZE A;  2XUB A;  1MH3 A;  4UUS B;  2LF7 A;  1A35 A;  2WAQ A;  3EUH A;  3RPU A;  4ZYD A;  1KU3 A;  4AVP A;  2O9L A;  1RR7 A;  3EUH C;  2B7E A;  4RB1 A;  3V7C A;  3JRH A;  3TP0 A;  1FMV A;  1T98 A;  2OF7 A;  2XF7 A;  3BC8 A;  4BQQ A;  1D5V A;  3I59 B;  2OCC H;  3KET A;  2EFO A;  3I3L A;  3FK6 A;  2EV0 A;  4Q48 A;  4L9N A;  2P5K A;  2FQ4 A;  4JX4 A;  2BYV E;  2Q2E A;  3V8K A;  2KDO A;  2BGC A;  4XRS G;  2F5E A;  4ENJ A;  3LSK A;  3BZ6 A;  5DTD A;  2R7S A;  2ID3 A;  4N9H A;  2QKL B;  4LB5 A;  2QQB A;  2Y30 A;  2R5Y A;  1T0F C;  3F8M A;  1QGP A;  1X58 A;  2X1D A;  4DNC A;  1AKH B;  3OL4 A;  2E2I J;  4U0W A;  4BUP A;  3HBL A;  2R7T A;  3MAJ A;  4CZZ A;  2EK5 A;  2Q1Z B;  2GIV A;  5JHF A;  2UZK A;  2IW5 A;  3LNQ A;  2WB1 N;  2WA0 A;  2MLG A;  2JMW A;  3ELK A;  4DYC A;  2QZ8 A;  2PFB A;  4LLL A;  1ZGW A;  3S17 J;  1MJB A;  3FDY A;  1KU7 A;  4PCQ A;  2WTE A;  2LK2 A;  4MLO A;  2X51 A;  2LG4 A;  3L00 A;  4XLC A;  4RB0 A;  4C3H J;  2TCT A;  2XAG A;  4PFO A;  1U5T A;  3WU1 B;  5JVG F;  3PNY A;  3AFH A;  4UXN A;  1ZTR A;  4BDY A;  3BR2 A;  3LL7 A;  2OD5 A;  3ZMD A;  1R49 A;  2EZK A;  4MQV A;  3BTC A;  4ZDP A;  1O57 A;  3HKZ A;  3GVA A;  2PMZ N;  3BTL A;  3DBL B;  2A61 A;  3IC7 A;  2AHQ A;  1USS A;  2CW8 A;  2CUJ A;  1FMW A;  1YOV B;  5F64 A;  1X1C A;  1IRZ A;  2TRT A;  4ZZD A;  3K4C A;  3I4P A;  2ZBK A;  1ZR2 A;  3GLX A;  5FO5 A;  3ERE D;  6PAX A;  4RGX A;  4XSX F;  2K9N A;  1K6Y A;  2W24 A;  1Z3X A;  1G8X A;  1P4A A;  1Q1V A;  1EA3 A;  1OPC A;  2ZXJ A;  1X4P A;  5L3C A;  3OSF A;  1UG0 A;  2X9D A;  2RNJ A;  2JUC A;  3K4N A;  4BAY A;  2MA3 A;  2CG4 A;  4DQ2 A;  1Y56 A;  1I3A A;  4CHU A;  4BXU A;  2KHM A;  2G7U A;  1MBK A;  5EF6 A;  1OCC H;  3KZZ A;  2A07 F;  3ASN H;  2OV7 A;  2OTJ I;  2HYF A;  4Z6Y A;  3E1S A;  3WTU C;  3AL0 B;  3RCO A;  3EYI A;  2E1O A;  4QSH A;  3V42 A;  5ILV A;  2PJR B;  5B66 C;  1NH3 A;  3M1E A;  5DM7 F;  4NC7 A;  1CF7 B;  4A6D A;  2LOO A;  4K2E A;  4KDP A;  2HTS A;  4M73 A;  3I59 A;  1WJE A;  2LBF A;  2DPU A;  4M3B A;  5BMZ A;  4V2F A;  2DFE A;  3IRQ A;  2DDB A;  4R1H A;  1LVA A;  3SQN A;  2YX7 A;  1UHS A;  1Z1D A;  4YFK F;  4BBR J;  3GW2 A;  1TW2 A;  3BG6 A;  2C6Y A;  2E71 A;  1KQ0 A;  3FIW A;  3IP4 B;  3M7G A;  3RYP A;  3WE2 A;  1IXS B;  1YG2 A;  3CJR B;  3CJQ B;  3J7A Y;  2Z3Y A;  1ZQ3 P;  1T0F A;  1I1S A;  2K9Q A;  5E3N A;  4IX7 A;  1BJA A;  1Y1W J;  3BJA A;  5FLX Z;  4M6X A;  1RR8 C;  4YIR X;  1LVK A;  2D1H A;  1OQY A;  3HTS B;  4RGU A;  1AU7 A;  3VYT B;  1LB2 A;  4GDF A;  1FIA A;  2DU9 A;  4HV5 A;  3GTG J;  2VON A;  2KKO A;  2PJP A;  2NS0 A;  2V1N A;  4WK8 F;  2ZXW H;  1D1B A;  1Y6I A;  3KLO A;  3MZY A;  5GAG J;  4M3G A;  4YEJ A;  1A6Q A;  3I55 I;  2KZG A;  3SFZ A;  4ZTJ A;  1FYM A;  1ZGJ A;  3KYD B;  2DJN A;  2M3A A;  5TGT A;  1PUF A;  3KZI C;  3QP5 A;  3I5U A;  4L18 B;  4PK4 A;  4M6Y A;  2W7N A;  5IOY A;  5J8C A;  1VQL I;  3GZ6 A;  3ECH A;  1HW1 A;  2WY8 Q;  4J01 A;  3DQV C;  1O7F A;  2H6C A;  1TC3 C;  3BTI A;  3JTH A;  3KEO A;  1K83 J;  2P4W A;  3WTS C;  1P4W A;  4Y3O A;  3NRV A;  2QEX I;  2WY7 Q;  3V8J A;  1STZ A;  4PJJ A;  4ZC3 A;  1IJW C;  2CYY A;  1Z3Y A;  3MCZ A;  1MNE A;  5LGT A;  1MBG A;  4CCO A;  3RKQ A;  1UEL B;  2FBI A;  2PEX A;  3ABK H;  4RAF A;  3TKY A;  2MH2 A;  4FX0 A;  2XSJ C;  1ZN2 A;  1HC8 A;  1X2M A;  4HAM A;  3FZV A;  5B1B H;  4H4K C;  3WHB A;  4FAS D;  2XAQ A;  3LST A;  3GTJ J;  1H9T A;  3HG9 A;  3M8F A;  1G59 A;  1F9N A;  2CUE A;  1EJ9 A;  1GUU A;  4ZJZ A;  1KQ9 A;  2WC2 A;  2LF8 A;  4KMU X;  3WTT C;  5ICG A;  2H1K A;  4X6A J;  2LRE A;  4I7H A;  4ABZ A;  2L54 A;  2EA2 A;  3RQI A;  4BJT A;  4FET A;  2A6T A;  2Y0M A;  4A3D J;  5LBQ A;  3S1Q J;  1X1D A;  2DFI A;  2ZNZ A;  2K4J A;  1OYW A;  1HOM A;  2A5W A;  5CQE A;  5FD5 A;  2XDV A;  1YYV A;  3ASO H;  2R7R A;  1MW7 A;  1VQP I;  2EQR A;  4JQF A;  5DEQ A;  2VI6 A;  5L3D A;  3I9V 2;  2RN7 A;  5M5W J;  3AG3 H;  3CUQ B;  4OIO F;  2L7M P;  3BT9 A;  5C4X J;  2MAB A;  3CDI A;  2DT7 B;  2LY9 A;  3IWZ A;  2VQC A;  2W48 A;  5GTH C;  4BEH B;  2GA2 A;  1AOY A;  1P6R A;  3ML6 A;  1SAX A;  1XSV A;  4G6T B;  3ZPL A;  4HQE A;  5J1Y A;  4PDK A;  3OYF A;  3WG9 A;  3VPR A;  2R5Y B;  2BOL A;  2E5N A;  2W1O A;  1TWF J;  4Y52 J;  3OS2 A;  1O3S A;  2K85 A;  3FBN B;  2IRF G;  3HOZ J;  2F4O B;  1E17 A;  1WJB A;  3EQL F;  3H3U A;  4DBQ A;  1OFC X;  1OYY A;  2J5P A;  4MEY F;  3HRU A;  3CCU I;  3W6K B;  1GLN A;  2WAQ N;  1SFU A;  2UWM A;  1SD6 A;  3V4G A;  4G8X A;  1GXP A;  4R79 A;  2YS9 A;  3RKW A;  1YW8 A;  2EZL A;  3KP7 A;  1BJZ A;  3C1D A;  2ELK A;  4UVC A;  3E0J B;  1MDM B;  4M3D A;  2ESN A;  4RGR A;  1BI2 A;  1WI9 A;  5J4Y A;  2VXD A;  1NK3 P;  5J8F A;  3RTR A;  1PJR A;  3ABM H;  2DO7 A;  1IN6 A;  2ZSI B;  4B3X A;  1VQ8 I;  1V54 H;  2XPW A;  5D5W B;  2MFZ A;  3LSJ A;  1XMK A;  5EG0 B;  2RNG A;  3VSK A;  5JVT A;  3E6B A;  3PFY A;  3HUG B;  2MSY A;  1SD5 A;  1Q1H A;  3CCJ I;  3JW4 A;  1I39 A;  2QM3 A;  5ICF A;  3R6S A;  1TBX A;  2UUZ A;  4FIS A;  5F0F A;  2LY1 A;  5BQT A;  3CDL A;  4B44 A;  3VSL A;  2G0E A;  4CZC A;  4BEH A;  2OPT A;  3TW7 A;  4IHX A;  3HEF A;  4XRM A;  5IT9 Z;  1BOB A;  1HW2 A;  4C3J J;  3DPT A;  4HF0 A;  5D6F A;  1IG7 A;  2XIG A;  3JR9 A;  4ZYE A;  4LB6 B;  3OOP A;  3H9J A;  2JPC A;  3BG7 A;  2VIX A;  3D5R C;  1UMQ A;  3E5U A;  2F4M B;  3TOA A;  2HPM A;  5FKN A;  4LK1 F;  2LNB A;  2K3F A;  4KIT B;  3TQN A;  3F23 A;  3QAH A;  2BXY A;  2IEK A;  2XPU A;  3BY6 A;  1UFM A;  1FIP A;  4A3L J;  4CCM A;  3ZQG A;  1B6A A;  5IP6 A;  2PMZ A;  3I58 A;  5TJJ A;  3HOV J;  1JUP A;  3ZGK A;  1TQP A;  2X6O A;  3M3Y J;  2CS3 A;  2DA7 A;  3D5S C;  3G71 I;  1B1B A;  5HLG A;  4FX4 A;  3CMA I;  5FRN A;  2XGC A;  1FTZ A;  3A01 A;  1VI0 A;  2KPM A;  4MEX F;  4Y7N J;  5D5U B;  2R7W A;  4N4O B;  4AD9 A;  3JAM K;  2DTR A;  1B72 B;  3H5N A;  4WXH A;  1LFP A;  3PNT A;  3S1R J;  2JVG A;  2OC6 A;  4CA0 A;  5KHD A;  4I98 B;  4CXF A;  3KYC B;  3LMM A;  1K79 A;  4LJZ F;  4EAT A;  3IKT A;  3OYB A;  2P8T A;  3ZP5 A;  2WAD A;  2QSG X;  2EPF A;  2HWV A;  2BHZ A;  3CLQ A;  3QOD A;  3GTK J;  2Z1D A;  3KP3 A;  3ROU A;  3T5X A;  3HDD A;  1ETK A;  2FA5 A;  3C3W A;  1FP1 D;  5E79 C;  4M3F A;  4D7M A;  1JXS A;  3GX4 X;  1R6R A;  2OJE D;  1YIJ I;  2ISZ A;  2M5W A;  1OCZ H;  2ICW G;  1A5J A;  2EWN A;  2X85 A;  1ZG1 A;  4G7Z F;  2QQ8 A;  4HW0 A;  1FSH A;  3V8L A;  1X3W B;  2E36 A;  2P5V A;  3O3K A;  1YX3 A;  3PSI A;  3CJT B;  4IKF A;  1JTX A;  1MBE A;  2XV4 S;  2XPV A;  3FKI J;  2GOM A;  3FK7 A;  3GBG A;  4XLN F;  3HOS A;  1DP7 P;  3BZC A;  1RRJ A;  1MIJ A;  3C2G A;  1MBF A;  2HQ5 A;  1F5T A;  3SZT A;  2HDW A;  3T8R A;  3VFZ A;  3AAF A;  1HCR A;  1WZ2 A;  5J1U A;  2DFF A;  4LFU A;  2EIM H;  1RI7 A;  3J80 K;  1JUS A;  5C44 J;  3S15 J;  2W57 A;  1SVO A;  3HTU A;  2F4I A;  1MSF C;  4RM2 A;  3S2H J;  2LP0 A;  2XGE A;  3BR3 A;  3BCA A;  3BPX A;  2M30 A;  1Y1V J;  3HXL A;  3J81 Z;  2GXG A;  2Y69 H;  5F04 A;  4UUV A;  1FY7 A;  4F3Q A;  3JAM Z;  1D1A A;  3IAM 2;  3MN2 A;  3OYA A;  4IZZ A;  4E7Z A;  2H27 A;  3MQ0 A;  3K1P A;  3K4B A;  2VT3 A;  2L3D A;  5F0C A;  1VQ6 I;  2QVO A;  3ZMS A;  2JZY A;  2KIU A;  2LH9 A;  3MKL A;  1P7I A;  3QOP A;  3DTK A;  4NBQ A;  3HZJ A;  2IXS A;  1UCR A;  3GFL A;  3LA3 A;  3SDG A;  4A6E A;  3HRM A;  2NYX A;  4GCV A;  4GYG A;  1T95 A;  4A3C J;  2ZJQ F;  3MMY B;  4M9S A;  2BXZ A;  4P1W A;  2BY0 A;  3GTL J;  2M7B A;  1IAW A;  3T8T A;  2ZFW A;  2X4H A;  2YX4 A;  1DQU A;  3DF8 A;  4EMS A;  2A05 A;  1R23 A;  3G2B A;  3TO7 A;  4J00 A;  3KPH A;  1BIA A;  1F1Z A;  1KQ8 A;  2JA7 J;  2HQR A;  4BKX A;  4I0B A;  2O6G E;  3KYL A;  1F4K A;  1L3L A;  4CYC A;  2FX0 A;  2Z9O A;  2HZD A;  1XC5 A;  5HLH A;  2EBI A;  2HI3 A;  2QGU A;  1XSD A;  2K9S A;  2XVC A;  1H89 C;  4LK0 F;  2H6B A;  1EH8 A;  4BXF A;  1Z67 A;  4U7B A;  1YTY A;  2IBD A;  2DN0 A;  2NAZ A;  2QWW A;  3GTQ J;  3CF5 F;  3KP5 A;  2QA4 I;  1U5T B;  4BQA A;  4UUT A;  4L9V A;  2VKD A;  2P0W A;  1BM9 A;  2EA4 A;  4A3M J;  2O61 A;  4A3I J;  2HYJ A;  4PSX A;  4B3A A;  2CQQ A;  1MGT A;  4AUX A;  2Q0O A;  2QSF X;  3RPU D;  4A0Y A;  2ZJP F;  1XGO A;  4LGW A;  5CKT A;  4AIH A;  3Q0U A;  5EYR A;  3BR0 A;  3KCC A;  2BE5 F;  4M9Z A;  2EV5 A;  2NS8 A;  4JBA A;  2O5R A;  4MFD A;  4XON A;  2BY3 A;  1I50 J;  5EZH A;  1RPW A; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  5GP9 A;  2FJ1 A;  2NS7 A;  4BY7 J;  1IC8 A;  4D5C A;  2K9N A;  3B6C A;  2NVX J;  4M6V A;  1Q1V A;  1MBH A;  2Y9Y A;  1LE8 A;  4DW6 A;  3OSF A;  1ZKG A;  4MIM A;  2X9D A;  4MO7 A;  4V2G A;  1SAN A;  4IHY A;  2LKX A;  1B8I A;  1ETY A;  2DMN A;  3HGY A;  4EEF G;  1U9N A;  1RKT A;  5K7F A;  4W1U A;  2RAE A;  3HKZ N;  3BQZ A;  1MBK A;  5EF6 A;  3NAU A;  3OOU A;  1JJ8 C;  1ETW A;  3JRG A;  2QCO A;  1A6I A;  2E1O A;  1ZK8 A;  4QSH A;  3GTP J;  1HLV A;  3LSG A;  3HOW J;  2YUS A;  1MBJ A;  3IV5 A;  3NAR A;  2LFB A;  3JRB A;  1TWC J;  2D5V A;  4DZJ A;  4M3B A;  4V2F A;  4A3J J;  3HOX J;  2YU9 J;  2MW8 A;  1UHS A;  4BBR J;  1CQT A;  3FIW A;  3JRF A;  3IH4 A;  2IAI A;  5F08 A;  3GTO J;  2LTP A;  1ZQ3 P;  2K9Q A;  5E3N A;  1Y1W J;  1POG A;  3QPS A;  1ITY A;  2XRL A;  1T56 A;  3BTJ A;  3H3V K;  1VFC A;  1AU7 A;  3GTG J;  1FIA A;  5EG0 A;  1JKO C;  3S16 J;  1HDD C;  1FEX A;  3LSP A;  3ZOB A;  1IGN A;  1JKR C;  5M5Y J;  5M3F J;  3BR1 A;  4M3G A;  2L0K A;  2DJN A;  1TWH J;  3IH2 A;  1PUF A;  4A3B J;  3JRD A;  5FJ8 J;  1Z0X A;  2GM4 A;  1NTC A;  2O8K A;  4B1R A;  5IOY A;  1BW5 A;  3G1O A;  5FLV A;  2HOT A;  3BR6 A;  4RDU A;  1TC3 C;  3BTI A;  2LLK A;  1K83 J;  4S0H B;  2KT0 A;  1B72 A;  4C3I J;  5GPA A;  1IJW C;  2EZH A;  1IDY A;  4D7N A;  1MBG A;  3RKQ A;  1H8A C;  5FKM A;  1JT6 A;  1FJL A;  4RBO A;  1X2M A;  4FCY A;  1IV6 A;  2QF7 A;  1YRN B;  2MG4 A;  2LVS A;  3W6V A;  3WHB A;  5M3M J;  2CUF A;  2NVT J;  3GTJ J;  2HXO A;  1RKW A;  2CUE A;  4XIC A;  1GUU A;  3CQZ J;  5IOZ A;  4AYB N;  5GPC A;  3MVP A;  1AKH A;  2NVY J;  3BQY A;  3O8G A;  5J1R A;  2H1K A;  4X6A J;  4ABZ A;  3RQI A;  3O8H A;  2O7O A;  4A3D J;  1K61 A;  3S1Q J;  3Q0W A;  3HB9 A;  1HOM A;  2EZI A;  1JT0 A;  2L7Z A;  2COB A;  2JK3 A;  2EQR A;  3FIS A;  5F0H A;  5EGO B;  4M3E A;  4A3E J;  4BY1 J;  2VI6 A;  1ZR4 A;  3QQA A;  5M5W J;  2NOG A;  2L7M P;  3BT9 A;  5C4X J;  1XG1 A;  2LY9 A;  4A3F J;  2W48 A;  1R9T J;  3TED A;  2E19 A;  3I4M J;  1E3O C;  2EH3 A;  2WV1 A;  5F27 A;  5J1Y A;  4A93 J;  1F43 A;  2CRG A;  3VPR A;  2R5Y B;  2XB5 A;  1WPK A;  4IHW A;  5C4J J;  1TWF J;  4A3G J;  4Y52 J;  3K7A J;  5E3O A;  3HOZ J;  1JJ6 C;  1VND A;  4FE4 A;  2R93 J;  1GDT A;  1OFC X;  1U9O A;  3SJM A;  5IPA A;  2WAQ N;  1DU0 A;  2DMT A;  1TWG J;  5EGO A;  1WH7 A;  2B63 J;  1UG2 A;  2YS9 A;  1LFB A;  3S14 J;  2GBY A;  2EZL A;  3Q3S A;  1BJZ A;  2FD5 A;  4XK4 A;  3BR5 A;  2ELK A;  4J19 A;  4NDL A;  3SFI A;  4B4C A;  1G2H A;  1X2N A;  4M3D A;  4I6Z A;  2R5Z B;  5JLW A;  1GV5 A;  2X48 A;  3A01 B;  3BG5 A;  2CU7 A;  1NK3 P;  4I76 A;  2DMQ A;  3L1P A;  3BG3 A;  1U78 A;  3OSG A;  1HF0 A;  2XPW A;  3LSJ A;  4W97 A;  5EG0 B;  2CJJ A;  2Y0S N;  2JA5 J;  1ORK A;  1QVU A;  2MSY A;  3S1M J;  5FKO A;  1FTT A;  1RET A;  2DA1 A;  2Y9Z A;  4FIS A;  5F0F A;  5DS9 A;  3CDL A;  1JUM A;  5BNG A;  1LE8 B;  2G0E A;  2HDD A;  2OPT A;  3TW7 A;  2ID6 A;  5F1J A;  1NK2 P;  4IHX A;  3HEF A;  5E3L A;  1WCM J;  4XRM A;  1BL0 A;  5M5X J;  5IYB J;  3TW6 A;  4C3J J;  3DEW A;  2HOA A;  3JR9 A;  2M0C A;  1IG7 A;  1GVD A;  2R5Z A;  3K2A A;  1OCT C;  1UMQ A;  2HOS A;  1QPI A;  4XRS A;  5FKN A;  4HNV A;  9ANT A;  5EDN A;  3ZQC A;  1MH4 A;  1P7J A;  1S7E A;  2L9R A;  2IEK A;  2XPU A;  1FIP A;  2Y2Z A;  4A3L J;  1SFO J;  3ZQG A;  5EEA A;  5IP6 A;  2JA6 J;  2P81 A;  1PUF B;  3HOV J;  1JUP A;  4G12 A;  1QVT A;  2X6O A;  3M3Y J;  2VUM J;  2DA7 A;  4QIW N;  1TWA J;  2JN6 A;  1D5Y A;  2VKE A;  3I4N J;  5IP9 J;  2LD5 A;  1OCP A;  3ZQI A;  2DA6 A;  2XGC A;  3HGG A;  2CQX A;  3A01 A;  1VI0 A;  1FTZ A;  2H8R A;  1WGX A;  4Y7N J;  2XB0 X;  3G1M A;  4X1E A;  1B72 B;  2KDZ A;  3S1R J;  1WH5 A;  5E3M A;  2ECB A;  2ME0 A;  1RES A;  1XS9 A;  2E2J J;  2M9H A;  1ENH A;  2DA2 A;  5FKK A;  3HOY J;  1QRY A;  1IUF A;  1GV2 A;  3G1L A;  1I3Q J;  2R0Q C;  3GTK J;  3PO2 J;  1JTY A;  1U8B A;  3HDD A;  1ETK A;  4BBS J;  1T33 A;  3CCY A;  2NVQ J;  3Q0V A;  3JRA A;  1B8I B;  3OIO A;  2GLO A;  4M3F A;  4D7M A;  1BW6 A;  1ETX A;  2JWT A;  1F36 A;  2VKV A;  2Y31 A;  4C2M J;  3RZD J;  3HOU J;  3UKG A;  2DA5 A;  4JP0 A;  1A5J A;  4DZP A;  4XID A;  4JX5 A;  3S1N J;  1H88 C;  3ZQL A;  4GFB A;  3S2D J;  1MNM C;  2ZB9 A;  3M4O J;  1BA5 A;  1JTX A;  1MBE A;  3FKI J;  2XPV A;  3GBG A;  3FK7 A;  5EZG A;  1W0T A;  2DTZ A;  1W0U A;  3B6A A;  1MBF A;  2HQ5 A;  4JYK A;  3RZO J;  1EF4 A;  3HM5 A;  1HCR A;  3LOC A;  5FKL A;  5J1U A;  2XGD A;  1JKQ C;  4A69 C;  1ETO A;  2HXI A;  3ZQH A;  5JLX A;  4D5F A;  4FTH A;  3H0G J;  1YRN A;  1JUS A;  5C44 J;  3S15 J;  5K7Z A;  2I10 A;  1Z77 A;  1OJL A;  3DCF A;  5IP7 J;  1MSF C;  1I6H J;  4BXX J;  1O4X A;  3BG9 A;  3IH3 A;  2LP0 A;  2XGE A;  3BR3 A;  3S2H J;  3CMY A;  2E2H J;  2DMU A;  4JX6 A;  1Y1V J;  2ME6 A;  5F04 A;  1APL C;  3PO3 J;  3F0C A;  4UUS B;  1MH3 A;  3MN2 A;  4CYC B;  4UUS A;  2O9L A;  5IYC J;  1RR7 A;  2DA3 A;  3JRI A;  5F0C A;  3JRH A;  3TP0 A;  1IDZ A;  2OF7 A;  3MKL A;  4A3K J;  1P7I A;  2JJ7 A;  4DYQ A;  3WHC A;  1WI3 A;  3JRC A;  2R7Z J;  3SDG A;  2MGQ A;  3FK6 A;  4FE7 A;  2FQ4 A;  2K40 A;  1MSE C;  2M34 A;  4JX4 A;  4AC0 A;  5C3E J;  4A3C J;  1JGG A;  3GTL J;  4XRS G;  1DU6 A;  3PM1 A;  3LSR A;  2XSD C;  2M8G X;  5IYD J;  4IHV A;  2LR8 A;  5DTD A;  4QTR A;  2ID3 A;  2ECC A;  3JRE A;  4IEJ A;  1VF9 A;  2Y30 A;  4L5E A;  2R5Y A;  3C2B A;  1X58 A;  2JA7 J;  1AKH B;  4BKX A;  2E2I J;  3HBL A;  2JA8 J;  3GTM J;  4CYC A;  2FX0 A;  3A02 A;  1XC5 A;  2EBI A;  2HI3 A;  3LNQ A;  2WB1 N;  5HOD A;  2K9S A;  3E7L A;  2JMW A;  2R92 J;  4DYC A;  1H89 C;  1ZGW A;  3S17 J;  2N8G A;  2LK2 A;  2DMP A;  4MLO A;  2IBD A;  2DN0 A;  3GTQ J;  3TP3 A;  2AO9 A;  1HDP A;  4C3H J;  2M2E A;  2TCT A;  5FLM J;  5J3L A;  4UUT A;  4DYR A;  1ETQ A;  1ZTR A;  3BR2 A;  3QPL A;  1ETV A;  1AHD P;  4A3M J;  3D1N I;  1LFU P;  4A3I J;  2HYJ A;  2EZK A;  4LOC A;  3ZQF A;  4B3A A;  3BTC A;  2CQQ A;  4AUX A;  1GT0 C;  2PMZ N;  3BTL A;  4MFE A;  2AHQ A;  3Q0U A;  2VPR A;  5EYR A;  3BR0 A;  2NS8 A;  3A03 A;  1IRZ A;  2TRT A;  2L7F P;  1JKP C;  4MFD A;  5K7H A;  1I50 J;  5EZH A;  2DA4 A;  1RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...