4BXXJ

Arrested rna polymerase ii-bye1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bxxJ00
3BR0A 4L5EA 4IHWA 4XK4A 4C2MJ 5IPAA 3QPSA 3FK6A 2JWTA 2FJ1A 3MKLA 2HOTA 2DMTA 2L7MP 4BBSJ 1ZR4A 2EH3A 5GP9A 5E3NA 2NOGA 2E2IJ 2K9QA 1POGA 2O9LA 2XB5A 3D1NI 2L7ZA 2RAEA 4IHYA 4GFBA 5J3LA 1VF9A 1MBGA 4A3DJ 4C3JJ 2NVYJ 3ZOBA 4RDUA 1ETQA 4V2FA 1WCMJ 5IYCJ 4DYRA 1PUFB 3BR6A 1IDYA 3JRCA 2ECCA 2JA8J 4CYCB 3S1MJ 1X2MA 1WH7A 5J1UA 4UUSA 1GVDA 2E2JJ 2L9RA 4D5CA 3HDDA 5EF6A 1ETVA 2OF7A 3HB9A 1QRYA 2KT0A 5M5WJ 3ZQGA 5E3LA 5EDNA 2DTZA 5K7HA 3Q0UA 1WH5A 3CDLA 1HF0A 2Y9YA 3RQIA 3BR5A 1MSFC 1JT6A 2MG4A 1JKPC 1OCPA 1QPIA 1FTZA 2HOSA 3G1MA 1LE8A 3FKIJ 1D5YA 4A93J 4IHXA 1I6HJ 3H0GJ 3BG9A 2KDZA 4I76A 1FEXA 4DYCA 3JRIA 4M3FA 3K2AA 3GTOJ 1RPWA 4A3IJ 1AKHA 2XSDC 2X6OA 5FKLA 1OCTC 3DCFA 3IH2A 1Z77A 3HOZJ 1ETKA 3ZQCA 2XPUA 3O8HA 2EZHA 1IG7A 4ABZA 5M3MJ 1GUUA 2I10A 4A3CJ 2K9NA 1JUPA 2HDDA 4BBRJ 4W1UA 3JRAA 1U9NA 2M34A 1A6IA 2FQ4A 1UMQA 2AO9A 5E3OA 5EG0B 2HOAA 2HYJA 3S17J 3IH4A 4NDLA 5IOYA 3JRBA 1GDTA 1JT0A 3GTGJ 3O8GA 3BTLA 2CQXA 2R92J 4FTHA 2R93J 4Y52J 1JKOC 3BTCA 2ID6A 1IRZA 2XB0X 3JRGA 4A69C 1VFCA 4D5FA 4A3GJ 3L1PA 2H8RA 9ANTA 3BQZA 3C2BA 1JGGA 1AKHB 4A3JJ 2DMPA 5F0HA 2E1OA 2VKEA 3A02A 5FJ8J 3PO2J 5FLMJ 4X6AJ 3OSGA 5K7ZA 4V2GA 3WHBA 3S1NJ 2TRTA 4MFDA 1IC8A 1GV5A 1B8IB 1BW6A 2WB1N 1ETYA 3CCYA 2K9SA 2VI6A 1BW5A 3BQYA 1H8AC 1HDPA 4XRSG 3S15J 1GT0C 3I4MJ 1UG2A 5F27A 3ZQHA 3B6AA 1SANA 1JKQC 2Y0SN 4A3EJ 3CQZJ 1B8IA 1HDDC 3S2DJ 3QQAA 2GBYA 2ME0A 2R5YB 5IP7J 1IUFA 1YRNA 1F36A 1MH4A 1P7IA 4XRSA 3K7AJ 2IBDA 1MBEA 2MGQA 3FIWA 3FK7A 2LLKA 2P81A 5M5XJ 3RZOJ 3QPLA 3IV5A 5C4XJ 2YUSA 2XRLA 2Y31A 4BY7J 1I3QJ 2TCTA 1TWCJ 5K7FA 4A3FJ 4B4CA 1YRNB 1QVTA 4JX5A 2K40A 2M2EA 1GV2A 4M6VA 2VPRA 4S0HB 3S1QJ 3BT9A 4QIWN 2L0KA 4M3BA 4W97A 3SDGA 3JREA 4DYQA 3S16J 1MBJA 2VUMJ 3HOUJ 5C3EJ 3H3VK 1JTYA 1RESA 3TP0A 2LD5A 1W0UA 1IDZA 1RETA 5IP9J 3OOUA 4IHVA 2XGDA 1DU0A 5J1RA 1FTTA 2DMQA 4UUTA 4UUSB 1BJZA 2PMZN 5FKOA 3HM5A 4D7MA 2M8GX 3BG3A 5M3FJ 2E19A 3LSRA 3NAUA 2CUFA 5FLVA 3PO3J 3TP3A 3JRFA 1XC5A 3LNQA 3WHCA 1U78A 2ECBA 1RKTA 5F08A 2NS8A 3BR1A 5DTDA 4DZJA 1FIPA 4MFEA 2XPVA 1Y1WJ 5JLXA 5IYBJ 4XICA 4QSHA 3GTMJ 2X9DA 2DA3A 4JX6A 1JKRC 1B72A 2DA2A 4AYBN 5JLWA 1HLVA 3HOYJ 1FIAA 1LE8B 3JRHA 3PM1A 3HOVJ 4LOCA 2FX0A 3W6VA 1ITYA 3HEFA 4EEFG 4G12A 2LY9A 4A3LJ 2CQQA 2R5YA 5IYDJ 2AHQA 3Q0VA 1ZK8A 3BR2A 2EZKA 5C4JJ 3TW7A 1O4XA 3DEWA 4A3MJ 1ZR2A 3A03A 4M3DA 2E2HJ 2JA5J 5EEAA 1WI3A 1W0TA 1JTXA 1I50J 5EZGA 5HODA 3NARA 2LKXA 2HXIA 1TWAJ 2D5VA 2DA6A 1FJLA 4A3KJ 2HXOA 2EBIA 1MH3A 3B6CA 2JJ7A 5E3MA 4MO7A 1VI0A 2WV1A 5M5YJ 1APLC 2Y2ZA 4I6ZA 3E7LA 3HGGA 4JX4A 5IP6A 1ZQ3P 4MIMA 2JA6J 5EGOA 3SFIA 3OSFA 3GBGA 1IJWC 2R7ZJ 1K83J 4M3GA 1H88C 1NK3P 2DA5A 2R0QC 3RKQA 1PUFA 1E3OC 2M9HA 4JYKA 3MN2A 4M3EA 1QVUA 1ZGWA 1TWFJ 1JJ6C 1UHSA 2FD5A 3OIOA 4QTRA 1RR7A 2WAQN 2MW8A 1IV6A 3ZQLA 5GPCA 1BL0A 4A3BJ 3S2HJ 3LSJA 5EGOB 2JN6A 4J19A 1TWHJ 1WPKA 2JA7J 1RKWA 1LFUP 4JP0A 1TWGJ 2DA1A 5EG0A 1F43A 5BNGA 1EF4A 5FKMA 4XRMA 2G0EA 5C44J 1IGNA 2CUEA 1MBHA 3G1LA 5GPAA 3HBLA 4FCYA 2COBA 4AUXA 3FISA 2R5ZB 2ME6A 4X1EA 2JMWA 4B1RA 2W48A 1AU7A 2IEKA 2XGEA 3GTQJ 2CU7A 1R9TJ 1G2HA 3S14J 2DN0A 2B63J 3BTIA 1X58A 2NVQJ 1A5JA 1S7EA 2N8GA 1DU6A 2LP0A 1H89C 3GTKJ 3JR9A 5FKNA 1MBKA 4D7NA 2EQRA 4BKXA 3I4NJ 1X2NA 4IEJA 2DMUA 1VNDA 1U9OA 1MBFA 4RBOA 2LFBA 3RZDJ 1Q1VA 3F0CA 3S1RJ 3GTLJ 2M0CA 1JUMA 1Z0XA 1CQTA 1MNMC 2HI3A 1NTCA 4FE4A 1ETOA 3ZQFA 4AC0A 4DW6A 3Q3SA 1SFOJ 1ZKGA 2JK3A 3BG5A 3LSGA 3A01A 4HNVA 1WGXA 1T33A 1MSEC 3JRDA 3MVPA 2X48A 5F0FA 2DMNA 5EYRA 1ENHA 2IAIA 3BR3A 2YS9A 2R5ZA 2EZLA 1U8BA 2VKVA 3GTPJ 2NS7A 2GLOA 2ELKA 4FE7A 5FKKA 4Y7NJ 4BXXJ 4MLOA 5EZHA 4FISA 2LK2A 3LSPA 2YU9J 1ETWA 1XS9A 1K61A 3A01B 2Y9ZA 2EZIA 2NVXJ 3ZQIA 3G1OA 3CMYA 2O8KA 4BY1J 2LR8A 2HQ5A 2O7OA 3HKZN 3VPRA 1ZTRA 2LVSA 2MSYA 2XPWA 3HGYA 1NK2P 3TEDA 5IOZA 1LFBA 3TW6A 3HOWJ 2DA4A 2L7FP 2QCOA 3BTJA 1P7JA 2OPTA 2XGCA 1OFCX 3HOXJ 2CRGA 2LTPA 1OJLA 1B72B 1ORKA 1T56A 4C3HJ 4B3AA 4C3IJ 3GTJJ 2QF7A 2DA7A 2NVTJ 1BA5A 5F1JA 2ID3A 1JUSA 4CYCA 1XG1A 3M4OJ 2GM4A 1HOMA 1HCRA 2ZB9A 3UKGA 1AHDP 5F04A 2CJJA 1JJ8C 5DS9A 3LOCA 5J1YA 5F0CA 4DZPA 4XIDA 3M3YJ 2H1KA 1TC3C 1ETXA 2Y30A 3Q0WA 3IH3A 2DJNA 1Y1VJ 3SJMA
chains in the Genus database with same CATH superfamily
4L5EA 4IHWA 4C2MJ 4PGGA 2JWTA 1T8IA 1M1EB 3DLAA 2IGMA 2NOJB 2ZSHB 4I02A 2HOTA 2ACJA 2DMTA 1TQMA 2OTJI 4KA4A 1BBYA 5JHFA 2ZBKA 5GP9A 5E3NA 1LDJA 2GA2A 1K6OA 3CCUI 1W1WE 3LMMA 2XB5A 4PZJA 4GFBA 3PSFA 3EETA 4UY8I 5HDNA 2IXSA 4C3JJ 2X4HA 2H8WA 1BC8C 1C0WA 1ETQA 4OMYA 3HTUA 1PUFB 3I59B 3IP4B 1MMNA 2PJRA 1NH3A 3CJRB 2JA8J 1IRGA 2PMHA 2VQGA 4XBFA 1GVDA 1YX3A 2E2JJ 3ZQ7A 1TQIA 3MQ0A 1ETVA 5J47A 2DLLA 2XKOA 3QPHA 1ONVA 2EB7A 2FOKA 4CCMA 1QRYA 2KT0A 5M5WJ 3WTXC 1DQUA 5E8IA 5TRDA 4NBQA 2R7SA 2P8TA 3QAHA 1KA8A 4CO8A 3CDLA 1R6RA 4HG2A 3KE2A 1G6NA 1QZEA 3BR5A 5ICFA 3GLXA 2R7QA 2MG4A 4ESJA 1PUEE 5CJ9A 2HOSA 1LE8A 4EGZA 1HBXG 1QBJA 1OLTA 2G9WA 1H9GA 3PUFA 1K78B 3AKZA 3K4CA 2QA4I 2Z1DA 4I76A 2J5OA 3HC7A 3K2AA 3OIQA 2XROA 4A3IJ 1D1BA 4HX7A 1U3EM 2D2WA 3F8CA 3VSLA 3IH2A 5CVVA 1I1GA 3VYSB 3DLLF 4AWXB 2EZHA 5BS6A 2YU3A 1G3YA 2R7FA 3FMRA 3S3NA 3QRFF 1HW5A 1JUPA 2FBKA 3HL2A 2HDDA 3K70D 3G71I 3JRAA 2HEOA 2VJIA 1UB9A 5BQTA 1ZG1A 3F72A 5FRNA 4I99C 3W2WA 1PP8F 2M34A 1A6IA 2UXNA 2FQ4A 4RLQA 1L0OC 5EG0B 1TBXA 1OCCH 3HTSB 2AQFA 3NQOA 2Z9OA 3JRBA 1YIOA 1ZGAA 1GDTA 1JT0A 1VQ7I 2F2EA 3TO9A 2VXZA 4BXFA 3FZVA 3BTLA 1FY7A 2Y69H 3P9IA 1XDUA 4FTHA 4H4KC 4EV0A 2R93J 1JKOC 4RM2A 1LVAA 1JHFA 3A4CA 3BTCA 1U2WA 2XB0X 2ZMEB 4A69C 4HLXA 3WODF 4DBQA 2KZVA 2H8RA 1TP4A 3C2BA 1IN5A 5ED4A 2BW3A 2JUCA 3V8JA 4XN3A 2E1OA 2VKEA 2L54A 2GIZA 3IHUA 2MD0A 4XKWA 3J7YJ 5K7ZA 3OSGA 3BZCA 3WHBA 5FGMA 2DFHA 3PUBA 4MFDA 3RTRA 4II2A 1Z7UA 2KFDA 3EUHA 1ZG3A 2VC0A 3K4LA 1R36A 3ZQQA 1ETYA 4JK1X 1IAWA 4Q48A 4BEHA 4LLNA 1FP1D 1CF7A 4L18B 2OD5A 2BW3B 2HQAA 3VYUB 5LRSA 4HYEA 1BW5A 2OZUA 1R5GA 3F8NA 4OOIA 2LF8A 5HLGA 1GT0C 1S7OA 3PL8A 1VQKI 5LGNA 5HNHA 3I3LA 2WTEA 3E5XA 1BR4A 4IRIA 4FETA 2M8EA 3WTZA 4N4NB 2ME0A 2VE8A 2F5DA 3OYGA 5B1AH 1P7IA 2PFBA 3OOPA 4BJ6C 2VBWA 2MGQA 4RAGA 4Y4RA 4LK1F 2LY1A 3H5RA 3KEYA 4CH7A 4UXNA 3AL0C 4BY7J 1I3QJ 1OPCA 1TWCJ 3QODA 4WXCA 3H9JA 5K5RA 4A3FJ 4B4CA 2XGXA 4FQGA 2VJJA 2PN6A 2IS2A 3H5NA 5K1YA 3ZP5A 3V8KA 3ZGKA 4MQVA 2ISYA 3LA7A 1MMDA 1SD4A 2QQ9A 4M6VA 2R7WA 3S1QJ 2JVGA 3JREA 3IWFA 4QPQA 2GOMA 1MBJA 1DPRA 3K70C 4Q4ZF 3RCOA 4RGRA 2R7VA 1JTYA 3TP0A 4LITA 1IDZA 5IP9J 3WTSC 3CJTB 4RA2A 3FHNA 5CPRB 1BJZA 2DW4A 1WVRA 1BIBA 1FOWA 2GOXB 3LSRA 4YEJA 3WHCA 3DU6A 1U78A 4AIDA 2NS8A 5DTDA 2HKXA 4DZJA 3NEUA 2XKPA 1LVKA 2QENA 3J80K 2IW5A 2ZJRF 2OJED 1F1ZA 4B09A 2VC1A 5JLXA 1SC7A 4XICA 3GWZA 2M0MA 4IVNA 5KAFC 4WXDA 4HF1A 4AYBN 2K3FA 1HLVA 2XC7A 3HSEA 2WAFA 4GO1A 3WE3A 1R22A 4BNCA 3W6VA 3W2AA 1QA6A 3Q9SA 4BE2A 2AHQA 3K1MA 1VQLI 3BG7A 3U9GA 1STZA 5LEJA 2P5LC 2HGCA 4BQAA 1ZGJA 2ZC2A 3ABLH 3TW7A 3ZRGA 5H20A 1DP3A 4PDKA 2P6SA 2DO7A 3A03A 3E5QA 3GW2A 2E2HJ 4CHUA 3ISPA 3RDIA 4CCLA 1J5YA 5EJCA 1JTXA 5HODA 3LSIA 3PSIA 1KYZA 1TWAJ 2MYSA 2O5RA 2VONA 3A0HC 1FJLA 2FUG2 2OC6A 4GRIA 4NC6A 2EBIA 3B6CA 3N4MA 1SEUA 3DEEA 4MTDA 4YIFA 1OQYA 2WV1A 5M5YJ 2E7XA 3E7LA 4KJZA 3T1BA 4ZTFA 5DCMA 1OYYA 3QP6A 2JA6J 3HHGA 5EGOA 3SFIA 2DODA 3K4NA 4U0WA 3VB2A 2R0QC 4IO9F 2FMLA 1PUFA 4II3A 5GTIC 4M3EA 1ZGWA 3IC7A 1TWFJ 3JCUC 5ERIA 3OIOA 1FOKA 2F5EA 2WAQN 3WG9A 2XDVA 4ESBA 1J7KA 3S8PA 2E71A 5L3DA 1R49A 1BL0A 3S2HJ 2X1EA 2YR2A 2DT7B 4G94A 5EGOB 3FMSA 4ENNA 4I0AA 4XOPA 1OCOH 5DD4A 1WPKA 1YW8A 3H36A 2STTA 2DA1A 1EF4A 3N05A 2K4JA 5B3SH 3PQKA 4A5MA 2V4JC 2VXDA 2O61A 4BE1A 4YELA 3G1LA 3UNGC 3O2PE 3HBLA 4FCYA 3DBRB 4IHSA 4XLAA 2MC3A 2IA0A 4F3QA 2KIFA 1D5VA 3HYIA 3JAMZ 1AU7A 2IEKA 3P9KA 4IZZA 2CU7A 2CW7A 1G2HA 3DPUA 1T95A 3S14J 2XF6A 2B63J 1X58A 1YJ9I 3S3OA 6PAXA 1F4KA 3J81K 5HS8A 2Y48A 4Y15A 3H9GA 1R1VA 4G6DA 3OYKA 1FYMA 4ZTJA 1OYWA 1W5SA 2ZNYA 3ESWB 1S6LA 3M8FA 3N97A 1VNDA 3CUQA 5HLIA 3CMEI 1WZ2A 1K79A 1S7AA 2LFBA 1PP7U 1R4NB 3ROUA 5ICGA 2M30A 1YS7A 3DPTA 3T0YA 3SZPA 3DEUA 1JUMA 1MNMC 2DT5A 1ZRFA 3OYNA 1NTCA 2A6EF 4FE4A 3ZQFA 4DW6A 1O7LA 3RPUD 1DGRM 1SFOJ 1GVJA 4X0GA 2MLKA 2JK3A 2CQKA 4V19K 3ECOA 3SQNA 4HNVA 5A2QK 1TL8A 2GWRA 2UV1A 3JRDA 3MVPA 5JVGF 2X48A 1MSEC 2W57A 5KCMA 3ABMH 5LLQA 3BR3A 2YS9A 4UHTA 2VKVA 5AONA 5DM7F 3CCEI 3GTPJ 2GLOA 1R1TA 3FKJA 4CDGA 4BXXJ 5EZHA 1ZELA 1MGTA 2EA2A 2I8DA 1HXDA 2M87A 1X1PA 3LSPA 2W4SA 1ETWA 1SMTA 4QLCU 1K61A 3I0TA 4TV7A 2XAFA 2EZIA 4OINF 2Q1ZB 2X6WA 4PJJA 3ZQIA 4BY1J 3LSTA 1XPXA 2HU9A 2HQ5A 3VOEA 3X2QH 1WJDA 1LB2A 3C1DA 2XPWA 3HGYA 4CZZA 2HZTA 1ZRCA 3M9AA 2L7FP 5FD6A 4CCKA 1R23A 2L9VA 2DU9A 2IGNA 2OPTA 4FT8A 3AG2H 4XKBA 2XRNA 3BZKA 5L3GA 3GZ6A 1MDMB 3J7ZI 1A35A 4L9JA 2LTPA 3CMAI 1W7PD 2A6HF 2VIXA 1E2XA 4ASNA 1ZRDA 2QF7A 4KNYA 4F92B 2DA7A 4A6EA 1LQ1A 1MNEA 3TDUC 3O6BB 1BA5A 2ID3A 1MD0A 3OIPA 1Q1HA 2W1OA 5GAHJ 4CYCA 1KZHA 3CP8A 2KQRA 1XSDA 1HOMA 1E0EA 1QHGA 3RYPA 4KMUX 1OCZH 1AHDP 2MH9A 2K3PA 2CJJA 4P1WA 3FM3A 4XIDA 4ZJZA 2E34A 5J40A 3DF8A 2LG4A 1TC3C 2RQPA 2EJRA 3KEOA 3K1NA 3QPSA 3FK6A 1FYKA 2FJ1A 2WAEA 3TDZC 3K4MA 3L2RA 3G3ZA 3DKYA 3ZMTA 4BBSJ 4ZH4F 3RPQA 4PGHA 2E2IJ 1POGA 2JUGA 4P9FA 2L7ZA 4PFPA 1FBQA 4IHYA 1TZLA 5D6EA 2KRFA 1HC8A 3LQRA 4FHTA 2X1CA 4EVIA 1YW7A 1KQ8A 1X4PA 1S5LC 4LLGF 2YX7A 3LSMA 1VQNI 1IDYA 4ZYEA 2BY3A 5D5VB 4L5JA 4QPOA 3OV8A 3S1MJ 4AD9A 3HPGA 1BIAA 2FNAA 4LD5A 1Z67A 3GZNB 3HZJA 5EF6A 4N9HA 2FBHA 2VL8A 3E0JB 3FXKA 3KYLA 3KFWX 2JQ7A 4NC7A 2L5QA 4A12A 2JPBA 5EDNA 2DTZA 4BXUA 5K7HA 3OWTA 1WH5A 3W2VA 3KP3A 1MW7A 4NUBA 1W36C 1PJRA 3GO5A 1Y0NA 3G2BA 3CJNA 3H3UA 1MSFC 5F1RA 3ABTA 1JKPC 2VB6A 3KZZA 5IY5H 1QO0D 4A2UA 2QLZA 3FKIJ 4ZYHA 3BLYA 4BJ5C 2DOFA 1K6YA 4O6JA 3BG9A 1W5TA 3JRIA 4Z6YA 5HOOA 4N9IA 3GTOJ 1RPWA 3SZGA 2HS5A 4XLPF 2XSDC 2X6OA 1OR7C 1FNNA 3HRSA 4I0BA 3BZ6A 3HOZJ 3TOAA 3ASNH 1LJ9A 3DV8A 1RRJA 2FF4A 4RLFA 5DUKA 4ABZA 1TTYA 3E1SA 3MKYB 3VEPA 5DEQA 2K9NA 1XGMA 4BBRJ 2V26A 4ENKA 1U9NA 3F8BA 1XN7A 3DU5A 2EFWA 5DCMB 3IH4A 2IJLA 4A5NA 4XN0A 2ELJA 4NDLA 1D1CA 4RB3C 1FSHA 3O8GA 2FSWA 2CQXA 1RUNA 2L4MA 3LWFA 2HFHA 1HSJA 2HTSA 2ID6A 4XSZF 1IRZA 3LFKA 3JRGA 4ANJA 1ULYA 4RGUA 3ABKH 3ZPLA 1AKHB 1JGGA 1REPC 4BEHB 5FRMA 5GAEJ 1CF7B 3JTHA 4BACA 2DBBA 2NAZA 3HPHA 5FJ8J 5FLMJ 3I5UA 4HA8A 2V1UA 4A0ZA 3CO6C 1G3SA 1IC8A 4EGYA 3HJEA 5CLSA 3K69A 2Q8KA 5LFAA 1B9NA 1SMYF 3PNYA 2Z99A 3L2UA 2Q0OA 1DPUA 2Y0MA 3KP4A 2Y75A 2QM3A 1Z3XA 2K9SA 1V5GA 4LJZF 3T5XA 3OYIA 2PMUA 3GMEA 3V4GA 5ICCA 4CSWA 2D1HA 4LLLA 1YQAA 2VJ5A 1HDPA 4XRSG 2P5VA 3I4MJ 5F27A 3EUHC 1SANA 1JKQC 4PSXA 1B6AA 3BC8A 1HDDC 4WX9A 2OBPA 2MC4A 5TISC 3S2DJ 3PJRA 3DTKA 2CMPA 3K4BA 3TMOA 1IUFA 1F36A 2W82A 1PDNC 4XRSA 4GYGA 2IBDA 3FK7A 3K10A 5DCFA 1A04A 2P7VB 1N77A 5M5XJ 3RZOJ 2K27A 3GFMA 3QWLA 3IV5A 2FNPA 2CV0A 2CUJA 1W5CC 2EILH 2IS1A 4RMNA 5JVTA 1T0FA 2DYSH 3D5RC 3M8JA 1HQCA 5K7FA 2ZO4A 5FLXZ 2IRFG 1K4TA 5TJJA 2KKOA 4LIVA 4LK0F 4Y13A 3I64A 3P9CA 5CVUA 4L9TA 5HLHA 3E5UA 2LY2A 1IZ1A 5AIQA 4QIWN 1GHCA 5ILSA 2VBYA 1V3FA 3QU3A 4ZDOA 3OS0A 3HOUJ 3B73A 3C2GA 5C3EJ 1O57A 1WJCA 2ZMEA 1QZZA 3ERED 1RESA 2MABA 1ZAOA 3F23A 1YS6A 4IHVA 5E8GA 4S04A 2JRMA 2XGDA 2H6BA 1YO5C 4UUTA 2FXAA 4UUSB 2L7KA 3H3ZA 3TOBA 4ON0A 3HM5A 4ETSA 3BG3A 5M3FJ 3M07A 2E19A 5J4YA 3NAUA 2CUFA 2BY1A 2CQ7A 3QYBA 4HQMA 5K5OA 5FLVA 3PO3J 3TP3A 5LGUA 3JRFA 1HKSA 2YX4A 2ECBA 5F08A 5ICEA 3G4SI 1AOYA 4XOTA 2A68F 1FIPA 2VOPA 2XAHA 2PLYA 2L2OA 2XPVA 1Y1WJ 3GFIA 4QSHA 1O7FA 5CQGA 1LKXA 3WU2C 1JKRC 1XMKA 2H09A 1X3ZB 2DCEA 5FB2A 5EEGA 2BVLA 5B5EC 1ON1A 1FIAA 1N25A 3ZN1A 3JRHA 1S29A 2MFZA 3HOVJ 4BE0A 1ITYA 4EEFG 4O5VA 2KRHA 3ONQA 2LY9A 3ELKA 3OMYA 4F91B 1J0RA 2CQQA 3HHHA 1R5ID 3Q0VA 2W7NA 4LGWA 2L3DA 3JSPA 3FX3A 2DK5A 1TT5B 5C4JJ 3K0LA 3CF5F 4A3MJ 1ZR2A 3L9FA 2VPLA 5E1XA 2WC2A 3WU0A 1D3YA 5EEAA 2QGUA 3V7SA 3NRVA 1XTAA 1W0TA 1FOXA 1IV8A 2E35A 4ZYDA 3QU6A 3MKWB 1WSUA 5E3MA 4MO7A 3CCMI 3NWTA 4P96A 4LG0B 2DOAA 3C7JA 1S3JA 4I6ZA 3WU1B 3HGGA 1P2FA 3KZYA 2BY0A 1IXCA 2M4GA 1UCRA 1K78A 4CXFA 1SFKA 4MIMA 2Z33A 4AU7A 3J7AY 2R7ZJ 1TNTA 4E7SA 1H88C 5E1ZB 2IGKA 2VODA 1LFPA 2LH9A 3MZ8A 4I2OA 3MFKA 3QOPA 1JJ6C 1UHSA 4LIUA 4QTRA 1X3UA 1RR7A 4LG0A 4OIOF 3SEZA 3HG9A 5E20A 4XLCA 5GPCA 5H6RA 2KLOA 2ZJPF 4B3XA 4IQJA 2E1CA 4J19A 1EH6A 1K4SA 2LOOA 2JA7J 3OYMA 4XQFA 2CFOA 1TWGJ 5EG0A 2DFIA 1UELB 5FKMA 4XRMA 3D5SC 3BCAA 3BROA 2CUEA 1IXRC 2KHMA 3PIOF 3CCJI 4ZYAA 4EJTA 5GPAA 3LSHA 3KEQA 1KU9A 1U8RA 3E6CC 1Z6RA 3KP6A 5KVRA 5L3EA 3COAC 1JGSA 1E3HA 2R5ZB 1OISA 3FISA 2MH2A 3KZIC 3FXQA 4OAYA 3LA3A 2Z16A 4K2EA 3HSRA 2KJBA 2EIMH 5FROA 2NVQJ 3BTIA 1A5JA 1P4WA 5E1WA 1S7EA 4F52A 4BJTA 1DU6A 1WI9A 3ULQB 3GTKJ 1WJFA 4YG2F 3GVAA 4D7NA 1A6QA 2EQRA 2UUZA 1IW7F 1X2NA 4IL6C 1DDNA 3KX2A 4U87A 3V7CA 4B48A 3RZDJ 4JBAA 4L5IA 4CCJA 4RAZA 3S1RJ 2L9NA 3CC2I 4AC0A 4YFKF 2ZJ2A 2AXLA 3E6BA 3L2WA 2CYYA 2QQAA 3OYBA 3BG5A 5LD2C 1XSXA 3ZMUA 5EYRA 1ENHA 1OMIA 1IO2A 3BOQA 4NB5A 4PUSA 2NS7A 3GUDA 2A3SA 2KZGA 4MLOA 4FISA 4CCOA 4OIRF 4G7OF 2YU9J 2ZXHA 4UV9A 4MGRA 1AWCA 3H35A 4C2TA 1N75A 1EJ9A 2NVXJ 2L9SA 2EK5A 2O7OA 5CVRA 3SYTA 2CUZA 4ZZDA 2LVSA 2M5WA 4UB8C 2ZFWA 1EV7A 5IOZA 3R60A 3VFZA 2E1MC 2RN7A 4F7ZA 3DKXA 1LNWA 1OFCX 4CUGA 2BV6A 4M71A 5DM6F 2CRGA 2NXNB 5HS7A 4GDFA 1I1SA 4HBLA 5BOXA 3GFLA 1NHAA 1Z9CA 1G59A 1B72B 1XGOA 1ORKA 2P0WA 4XNFA 2F4IA 1Z7LA 4C3IJ 4HQEA 5LRRA 1BOAA 1D8KA 4OWRB 3FHZA 2NVTJ 3FXMA 2RGVA 3FDYA 5F1JA 1XG1A 1FT9A 2RKHA 4MTEA 3M4OJ 3BJ6A 3REOA 1Y56A 2K9MA 2GXAA 5DD8A 2WBMA 2ZB9A 2PEXA 3UKGA 5F04A 3Q5FA 3O3KA 5E18F 2E36A 3LOCA 1YHQI 5J1YA 3CJQB 3IKVA 3M3YJ 1MJBA 3JTGA 1QZYA 2GZWA 2M45A 2KIUA 1ETXA 2Y30A 3Q0WA 4AIJA 3NWSA 4C2UA 1Y1VJ 2LC2A 4A6DA 3SJMA 3S2WA 5IPAA 3CUQB 2XIGA 4RB2C 1HKTA 2PI0A 4Q47A 2DFFA 4UVCA 2COMA 2L7MP 3M1EA 1VQ8I 4CYDA 2XF5A 2EH3A 2IA1A 4KUMA 2K9QA 2VASA 2Z3YA 3BP8A 4PJ0C 3EYYA 2DXIA 2O9LA 3D1NI 1AA7A 3KLOA 3MZHA 1DGWY 1UFMA 2RAEA 3K4KA 4YIRX 2WWYA 3QYFA 4R79A 4MEYF 2MBFA 1Z1DA 2X51A 3W6JB 3G73A 1MBGA 2DQRA 3OY9A 2XAGA 2JPCA 3ZOBA 4HF2A 4RDUA 3P7NA 4V2FA 1WCMJ 2R7OA 4DYRA 5IYCJ 2V7FA 2PG4A 3A2KA 3JRCA 2ETHA 1FMWA 2ECCA 3E97A 1X2MA 2LNBA 5J1UA 4UUSA 5B1BH 3F22A 2DPDA 3CC4I 2PJPA 3HDDA 4XR6A 4IOCF 1SD7A 3BY6A 3HSFA 1FOYA 3HB9A 1XX5A 3ZQGA 5E3LA 3T8RA 1FBUA 1VZ0A 3Q0UA 3CTAA 4HDUA 2LMDA 4DOZA 3ASOH 1P9QC 2LRDA 3MMYB 4BHPA 3I55I 3GX4X 3EQLF 2Q2EB 2O8XA 1MDMA 2F4OB 1FP2A 2JSCA 3A1YA 3GXOA 3G1MA 2FBIA 1W36D 2QWWA 1TT0A 4U0VA 4A93J 3IUOA 4DJAA 4F93B 1WKMA 4IHXA 1I6HJ 2V79A 3U2RA 2KDZA 1SD5A 2PQ8A 1Y8RB 3DPLC 1P92A 3PIPF 4M3FA 2H1LA 4RB0A 1J75A 1U5TA 1X1CA 2DAOA 4LMYA 5FKLA 2W25A 2EWNA 3SHFA 4D0PA 1KU3A 4LG3A 3ZQCA 1BJAA 2EV6A 4KITB 3HKZA 1GUUA 2OZ6A 1MMGA 2L4AA 3RI4A 2GXBA 1SFEA 4M9XA 4P5OA 4E4HA 4HSRA 4W1UA 4KISA 4B43A 3L2VA 1U5TB 2ZXJA 1BI0A 4I98B 3I53A 2AO9A 5E3OA 2EFOA 3SDBA 2HOAA 2HYJA 1SVLA 5D6FA 4QWQA 4KFCA 3RKYA 4WK8F 2E60A 3I4PA 3GTGJ 2RQQA 3F6OA 3ZN0A 1ZH5A 2LREA 1VQOI 2AXTC 1D8JA 4Y52J 3V7RA 3AG1H 5FO5A 2Z5UA 3WE2A 4ENJA 2ZSIB 9ANTA 1YJWI 1YE9A 3BQZA 1ZARA 4HRIA 2CS3A 2DMPA 5F0HA 1WJAA 3PO2J 2EIKH 3OR1C 3FM5A 2WV0A 4V2GA 3KPHA 2NVUB 2BXYA 3WGGA 3DTIA 1X4OA 3JW4A 4E70A 3EPZA 1FMVA 3DQVC 3WTWC 3WTYC 1IF1A 1BW6A 3VODA 1FBSA 2WB1N 3SFZA 2ESNA 3CCYA 2LSOA 2GA1A 1UAAA 2A61A 3GF2A 2WY8Q 2DDAA 5LHGA 1ZREA 4BYYA 4E6KG 3EDPA 5TGTA 1SFXA 1ZLKA 1Y0UA 3BQYA 2XAUA 1XMXA 4RS8A 1UG2A 3W6KB 3L00A 2CV1A 4U7DA 2Y0SN 4A3EJ 3CQZJ 3HRTA 4KT5C 3AL0B 3QQAA 5DV5A 2GBYA 1HSTA 2CW8A 2KISA 5DDGA 2R5YB 3KYDB 5IP7J 2M3AA 2YSRA 4PCQA 5HDGA 1MH4A 1Z91A 3CP2A 1MBEA 3FIWA 2AS5F 2LLKA 2P81A 4EJOA 3QPLA 2VBXA 5HNFA 1EH8A 3CESA 4UVAA 5C4XJ 2QZ8A 2YUSA 3FXOA 2XRLA 3F6VA 3BDDA 3IRRA 2Y31A 3LFUA 3R0JA 4GGGA 3MZYA 2HPIA 3SEQA 4OU0A 3IWZA 1FSEA 1WRJA 2WAQA 1YRNB 3I58A 1QVTA 2VBZA 3B02A 1I3AA 5GTHC 1T08B 4IX7A 2EINH 2QYOA 4R8HA 3CLOA 1GV2A 1NG6A 2DI3A 4KDPA 2VN2A 2VPRA 4S0HB 4HSTA 2QQBA 2VKDA 2L0KA 1RR8C 1WHUA 1Z6TA 3MKZA 3SDGA 2W84A 4HNTA 2NS0A 3RIRA 3S16J 2VUMJ 1XGNA 3H92A 4KIBA 3FF5A 2FU4A 4XSXF 3QYEA 3QP5A 5CYVA 4YRVA 1F5TA 3H1CA 4MHGA 3RSNA 2QVOA 5IT9K 3P5JA 3OOUA 2XUBA 2VT2A 4BUPA 3M1CA 1BI2A 1DU0A 1FTTA 2DMQA 2K4BA 2ISZA 1MMAA 2PMZN 5FKOA 4D7MA 3OYFA 4ESFA 4L9VA 2CW0F 1BR1A 5D4SA 1G3TA 1XC5A 4PJNA 3LNQA 3DKWA 3MWMA 5GADJ 2K9LA 4XL9A 3BR1A 1B4AA 4OMZA 1FYLA 2DT6A 4E7JA 2OV7A 2DFEA 1V5EA 4MFEA 3RKWA 2M7BA 1PYVA 3GTMJ 2JVHA 2DA3A 2X9DA 3HXLA 4JX6A 3WGHA 1B72A 4P9UA 1D0XA 2FA5A 4RGSA 2A5YB 3ERMA 1E3PA 3R4KA 2X0LA 4BQNA 1ZN2A 4NC8A 2F4MB 5IT9Z 2CH0A 3PM1A 4AYBA 4HLYA 3GZ5A 1Y39A 3MCZA 2CV2A 3FXRA 4G12A 2FRHA 3CZ6A 4A3LJ 1N78A 2FQ3A 1U6GA 1ZK8A 5F64A 5FFZA 2EZKA 4HPQA 1KU2A 2ZXIA 1O4XA 3DEWA 2BOLA 2IA2A 4S05A 3S3MA 4M3DA 2JA5J 1WI3A 4E7ZA 3KP5A 4B47A 1I50J 1RZ4A 1TW3A 2ZXWH 2LKXA 2HXIA 4HF0A 2D5VA 2JT1A 2BZTA 2HXOA 4GXOA 1TLHB 3HRUA 3OS2A 1VI0A 2G7UA 2DPUA 1B9MA 3RQ4A 2O0YA 2WA0A 4Y17A 1JHHA 1YLFA 4DBRA 1T38A 4KIGA 5IP6A 1ZQ3P 1T98A 3E6MA 3LAPA 5AIPA 4Z2YA 3OSFA 3GBGA 1IJWC 1K83J 1VQ4I 2CGPA 4M3GA 4ZC3A 1NK3P 2DA5A 4BDZA 1FZPB 1E3OC 2M9HA 4JYKA 3MN2A 1GXQA 2RV8A 3QPTA 1BN5A 2FD5A 1I6XA 1S8NA 4BQOA 4MQ9F 3ZMSA 5EEHA 2NYXA 2A07F 2G7HA 1IN7A 4M73A 1H0MA 3ZQLA 2UZKA 2VQCA 1CGPA 3MEXA 3M8EA 3LSJA 1LEBA 1IN6A 3TO7A 3GLLA 5CVJA 4BHBA 4RGXA 1OCRH 2W85A 4JP0A 2H6CA 4WWCA 1UJ8A 2QUFA 3PFYA 2Q2EA 4AVPA 4XLFA 2HDWA 4HV5A 1P4XA 3ZR8X 3PQJA 2HKOA 2HDCA 1YJNI 4IKFA 1P6RA 1QQIA 5D5WB 3LQQA 2E7WA 5HVQC 2COBA 1R58A 1HKQA 2P6TA 4EQQA 3OS1A 1JI8A 4AUXA 2ME6A 4X1EA 4BGDA 2W48A 2V6CA 2XGEA 1R9TJ 2KRCA 2DN0A 3LAJA 3S93A 2IPQX 2M4KA 5L3CA 2W24A 1O3QA 2DJIA 2K85A 2EV5A 4XLNF 4DGWB 2NNYA 2LP0A 2DDBA 1H89C 2H94A 2QBYB 4E7HA 2WB1A 3R0AA 4G7HF 1ODDA 4IXAA 5E17F 4EM0B 4M6YA 3WTTC 3FBIB 3M7GA 1G3WA 2BBYA 5H6QA 1V54H 2XAQA 2DMUA 1UZCA 1U9OA 3OYEA 1KGSA 4RAFA 4RBOA 3HOTA 5LHHA 1KONA 1Q1VA 3GCMA 4PJLA 1EH7A 3LA2A 2M0CA 1CQTA 4JQFA 4M9ZA 4DNCA 2BEOA 2LKSA 1V4RA 1ETOA 5CVIA 1VQ6I 3Q3SA 4G8XA 3FXLA 2JRTA 4PJMA 1DP7P 1ZKGA 2CFXA 3BG6A 2CWEA 4WXHA 2EFNA 1K7AA 1T33A 2K5CA 5LGTA 2ZNZA 3I56I 5F0FA 4AVZA 2R7RA 3I71A 4FE7A 5FKKA 4Y7NJ 4YFNF 2XV4S 3C18A 1ZG5A 2LK2A 2V9PA 1LEAA 4Y33A 1QPMA 2A69F 1XS9A 2OCCH 3A01B 3CC7I 4MEXF 2XSJC 2JZYA 1MMSA 2DQLA 2LF7A 2LR8A 2ESHA 3ABUA 3HKZN 5BPIA 3DBHB 2D45A 2VQLA 1ZTRA 4HEA2 3CCRI 1U0JA 1ACIA 3CCQI 4HNUA 3TW6A 2DA4A 1U5TC 3WTVC 2QCOA 3EYIA 3BTJA 4I7HA 4PSWA 1O3RA 2XGCA 1TQPA 1OJLA 2LBFB 2MA3A 3TBIA 3ML6A 4C3HJ 3KETA 1LPQA 4E7IA 1VQ9I 2FE3A 2RVCA 3DWLE 3K2ZA 3OYHA 3G6EI 2KP6A 1WJ5A 2R7TA 3U1KA 2V1XA 1R7JA 4KN4X 2XVCA 3TQNA 4U7BA 4IRHA 3EUAA 2CQNA 2VJ4A 1ERDA 5F0CA 1YX5A 3S32A 4DZPA 1FPQA 3OL3A 1QU3A 1XCBA 3IH3A 3IL2A 4E7KA 2DJNA 5DYMA 3BR0A 4XK4A 3DBLB 1USTA 1OR7A 1IRFA 2R4GA 3MKLA 4KT6A 5KK1A 1J9IA 4WCGA 4D9JA 4NHJA 5KHDA 5ILVA 4U88A 4AIHA 1ZR4A 1X1DA 2OTLI 4ZDLA 2NOGA 2R3SA 1B59A 3OL4A 2EA4A 2UXXA 2JA2A 4EJWA 1TW2A 4G7ZF 3CCLI 5J3LA 2EFPA 1VF9A 2XAJA 3ECHA 3F9KA 4BHCA 5ILUA 5KNLA 2JSPA 1YTYA 1WFXA 5J6XA 1BOBA 4A3DJ 1E17A 4EM2A 4C30A 5D5XB 2NVYJ 3AFHA 3TGNA 2B9SA 3IAS2 5L3FA 1LDKB 3BR6A 4CYCB 1WH7A 2E5NA 3K4JA 2L9RA 2MD5A 3T8TA 4D5CA 1GXPA 1SVOA 2QEXI 1W7PA 2OUMA 2R7XA 3QOEA 4H0EA 3BPXA 2OF7A 2X85A 2A6TA 3OR2C 4LB5A 1HW1A 3AG4H 1X1BA 3PNVA 5D5UB 2K7LA 2IGOA 2ADUA 2FMYA 1G4DA 4NNJA 3BJAA 2HVSA 4G9YA 3LL7A 3CMMA 3I59A 4KMFA 4GCVA 1WJEA 2FOWA 1WQ2A 2Y9YA 3RQIA 1HF0A 2PJRB 2GIVA 1JT6A 3SXYA 3CUQC 1BR2A 2DOEA 2B0LA 1OCPA 4HW0A 1QPIA 1FTZA 2HNHA 1D5YA 1W7PB 3PFIA 4U0YA 1JE8A 1X1AA 2NRAC 2K02A 4L0YB 2O03A 2OU2A 3H0GJ 1XSVA 2MLGA 3KLNA 1O3SA 2W00A 1FEXA 2TDXA 4DYCA 4M72A 4L9NA 4M74A 4MNUA 2HQNA 2XASA 2F5FA 5CKTA 1AKHA 1TNSA 1OCTC 1XDSA 3DCFA 1Z77A 4N4OB 5IT3A 2WADA 2BYVE 2STWA 1ETKA 5JFRA 2XPUA 3O8HA 5D8KB 3GEZA 1XCVA 1IG7A 1I5ZA 3OYDA 3H0DA 4KYWA 1LDDA 1SAUA 5M3MJ 1VQMI 2I10A 4A3CJ 4E7LA 3OYLA 4XKCA 1QGPA 2HVQA 1NG7A 4FX0A 1PVEA 2BHYA 1R1UA 2R7DA 2OQGA 4KN7X 3CUOA 4XLEA 3UR3C 5BMZA 2F5VA 4B8XA 3CD6I 1UMQA 3S17J 5D4RA 1UHMA 5DUIA 3FWEA 3SZTA 5D8LB 4CZCA 3TO6A 3KCCA 2M7AA 1L3LA 5IOYA 4IRGA 1H9TA 1SAXA 3HUGA 3V42A 1KQ9A 1F9NA 2QKLB 2RNGA 2R92J 2BGCA 3FXJA 1W4MA 4OIQF 1A36A 2HTJA 4UUVA 1YFHA 2EV0A 1VFCA 4A3GJ 4D5FA 5CQEA 3L1PA 4FX4A 2VT3A 1ZLJA 5KAIC 2ZJQF 3F3XA 4A3JJ 2X1DA 3DTEA 4HOBA 3A02A 2OAZA 1SD6A 4X6AJ 4BQQA 2LKPA 3S1NJ 2DTRA 1I39A 2TRTA 1R5HA 3F8FA 3CDHA 1GV5A 3WG7H 2VLAA 2KJCA 3K6GA 4R1HA 1B8IB 1EA3A 2O6GE 2P4WA 5A2QZ 3CCSI 5J8FA 2VI6A 5HS9A 3A0BC 2HVRA 2BY2A 4RB1A 2A5WA 1XGSA 3C3WA 3TKYA 3U1DA 4PFOA 1H8AC 5K5QA 2QSHX 4ZYGA 3KP7A 3AAFA 3S15J 3IRQA 3ZQHA 1WJBA 3IKTA 3B6AA 2HYFA 2QSGX 2F48A 2XHKA 3ZMZA 4B44A 5J4VA 1B8IA 3EUKL 3HOSA 2VE9A 5JI6A 2BVMA 4EM1A 1B1BA 3ZMVA 3WGIA 3FBNB 3D0SA 3GYHX 1FC3A 1YRNA 2X6YA 4IPAA 1RNLA 2QBYA 1R00A 3K7AJ 1YOVB 2RDPA 4XONA 3DFGA 4D1QA 4DIQA 1OYIA 4YIIA 4I01A 4LFUA 4BH9A 2TCTA 2KPMA 4G6QA 4IJAA 2HYGD 4DQ2A 1S9HA 2H27A 4O3MA 4JX5A 4UVBA 1D0YA 2K40A 2L01A 3F21A 4Y3OA 4RM3A 2M2EA 4KICA 5B66C 1VTNC 3FXUA 2HPMA 3J80Z 3BT9A 5E79C 4OIPF 4M3BA 4W97A 2ICWG 1A31A 4XKVA 4DYQA 2DK8A 4BDYA 4UV8A 4A0YA 4BAYA 3CO7C 2EIJH 1YG2A 3H3VK 4BU2A 2Z2SB 2KDOA 2LD5A 1W0UA 1RETA 1MIJA 2KL4A 2QQ8A 5LBQA 1IN4A 3BPVA 2QSFX 5J1RA 2PBIA 3ZCOA 1J59A 3K9TA 2M8GX 2YPRA 2OA4A 1RI7A 4ZZLA 1V55H 2O3FA 2VOOA 2LBFA 2RC4A 3I9V2 1KYWA 2HWVA 1RKTA 3WTUC 4N0BA 2CSOA 2M1BA 4HX8A 1GLNA 4EJUA 2OCEA 4G6TB 4ZDPA 2KMUA 5IYBJ 3F8MA 1J09A 2DYRH 4I09A 2LDUA 3K1PA 2DA2A 2E5ZA 3L2CA 4HAMA 2R7UA 3VSKA 5JLWA 3HOYJ 4HZFA 1QNTA 3D5LA 1LE8B 3HRMA 4IHTA 3V8LA 4LOCA 2FX0A 4EJVA 1WWXA 1EKEA 3HEFA 2WY7Q 1R71A 2IVMA 1KQ0A 3VYTB 3MD2A 2PX9A 2R5YA 5IYDJ 2V1NA 3RKXA 4CA0A 4UNOA 1FLIA 3BR2A 4PK4A 2AQEA 3TL4X 2NNNA 4XM3A 2E1NA 2A05A 1IN8A 4M9SA 3OYJA 2Y0SA 1DUXC 3J7AO 1FWZA 2X6XA 5EZGA 3JSOA 1S72I 3NARA 3OYCA 3L7WA 3MAJA 5LEKA 2DA6A 2VQHA 5FD5A 3CF2A 4A3KJ 2FEZA 1MH3A 2JJ7A 1T6SA 1BC7C 4FASD 2BXZA 2EFQA 1MNDA 3KYCB 1APLC 2C6YA 2Y2ZA 2RREA 4JX4A 2P7CB 1SFUA 2BHZA 1ZYRF 5LHIA 2P5KA 1IUYA 1ON2A 3RKQA 3RYRA 3CLQA 5H2FC 1T2KA 1QVUA 3AG3H 1YYVA 1VQ5I 1SVMA 2GAUA 1T0FC 5HLTA 2MW8A 1IV6A 1YITI 1O3TA 4BL0B 4IQ4A 3BJOA 1MJ9A 4IOAF 4A3BJ 1P4AA 3VYRB 3R6SA 2JN6A 2KIQA 3VDXA 3J81Z 2F6CA 2V9KA 2IS6A 2I5UA 1TWHJ 4F55A 1RKWA 1Z21A 1LFUP 2ZKZA 2V1DA 1F43A 5BNGA 4WF2A 4CCNA 1XMAA 3GFJA 1Y6IA 2G0EA 4IF4A 5C44J 1IGNA 1X19A 1MKMA 3BCBA 1MBHA 4EMSA 2B7EA 1VQPI 1JXSA 2ELHA 1J2XA 5F6FA 4KIFA 4BS9A 4ENMA 4B1RA 2JMWA 1ZHFA 2PMZA 3GTQJ 1XB4A 3DP7A 4A0XA 4AIKA 3E3VA 4OAZA 2GQQA 4JOMA 1Z05A 4NQWA 3LSKA 2J5PA 2N8GA 1XD7A 2VKHA 4Q5SF 3CCVI 3HIFA 3JR9A 2L02A 5FKNA 4P55A 3E6DA 1MBKA 1BI3A 3Q9VA 4BKXA 3I4NJ 2KIMA 3L09A 4EATA 4IEJA 3HUGB 2V6EA 1YIJI 1MZBA 2EPFA 5JHUA 4RAYA 1MBFA 4XLHA 2BE5F 3F0CA 3GTLJ 2XF7A 5JR3A 1RIOH 1Z0XA 1QHHD 2HI3A 4NQWB 4HDVA 2UWMA 2E1MB 3RPUA 4M6XA 1T39A 1R4MB 3C2HA 1HA8A 3FMQA 1UG0A 4UB6C 4XORA 3VWBA 1IRXA 3I54A 2V9VA 3LSGA 3A01A 1WGXA 2IP2A 3H5AA 3RJPA 2DMNA 2QKMB 5L3BA 5GAGJ 2IAIA 2IT0A 2R5ZA 1U8BA 2EZLA 1D0ZA 4YFXF 1USSA 2ELKA 5FLXK 3U21A 1HW2A 4XRFA 1V5FA 1FX7A 4ITVA 3OYAA 1Y8QB 4AM3A 2Y9ZA 4GYIA 2O8KA 3G1OA 3CMYA 2HZDA 3ZXSA 2K86A 4C9YA 2LYCA 2RNJA 2ZFUA 1LUJB 1RUOA 3VPRA 2MSYA 3ZMDA 1NK2P 3TEDA 1I27A 4HV6A 1LFBA 2CG4A 3HOWJ 5FFXA 1YW9A 2HQRA 3CDIA 1P7JA 4XMYA 2HOEA 2D1VA 3HOXJ 2IS4A 3KP2A 4HX4A 1MJAA 3IAM2 4CGZA 2F5CA 3L2QA 1T56A 1RC9A 4B3AA 3GTJJ 2ZCWA 3PNTA 2ZMEC 3W3CA 2OQRA 3DXJF 3H9QA 1IXSB 1G8XA 4CICA 1UHWA 4J01A 1JUSA 3KIOA 2HR3A 4L0ZB 2GM4A 4LB6B 3BWGA 1HCRA 1D1AA 4J00A 5HDKA 2CO5A 1X3WB 1JJ8C 5DS9A 3R61A 3JAMK 1KU7A 5J8CA 2GXGA 1YI2I 5BPDA 2H1KA 1BI1A 1OKRA 2JTVA 1Z3YA 1BM9A
chains in the Genus database with same CATH topology
3BR0A 4L5EA 4IHWA 4XK4A 4C2MJ 5IPAA 3QPSA 3FK6A 2JWTA 2FJ1A 3MKLA 2HOTA 2DMTA 2L7MP 4BBSJ 1ZR4A 2EH3A 5GP9A 5E3NA 2NOGA 2E2IJ 2K9QA 1POGA 2O9LA 2XB5A 3D1NI 2L7ZA 2RAEA 4IHYA 4GFBA 5J3LA 1VF9A 1MBGA 4A3DJ 4C3JJ 2NVYJ 3ZOBA 4RDUA 1ETQA 4V2FA 1WCMJ 5IYCJ 4DYRA 1PUFB 3BR6A 1IDYA 3JRCA 2ECCA 2JA8J 4CYCB 3S1MJ 1X2MA 1WH7A 5J1UA 4UUSA 1GVDA 2E2JJ 2L9RA 4D5CA 3HDDA 5EF6A 1ETVA 2OF7A 3HB9A 1QRYA 2KT0A 5M5WJ 3ZQGA 5E3LA 5EDNA 2DTZA 5K7HA 3Q0UA 1WH5A 3CDLA 1HF0A 2Y9YA 3RQIA 3BR5A 1MSFC 1JT6A 2MG4A 1JKPC 1OCPA 1QPIA 1FTZA 2HOSA 3G1MA 1LE8A 3FKIJ 1D5YA 4A93J 4IHXA 1I6HJ 3H0GJ 3BG9A 2KDZA 4I76A 1FEXA 4DYCA 3JRIA 4M3FA 3K2AA 3GTOJ 1RPWA 4A3IJ 1AKHA 2XSDC 2X6OA 5FKLA 1OCTC 3DCFA 3IH2A 1Z77A 3HOZJ 1ETKA 3ZQCA 2XPUA 3O8HA 2EZHA 1IG7A 4ABZA 5M3MJ 1GUUA 2I10A 4A3CJ 2K9NA 1JUPA 2HDDA 4BBRJ 4W1UA 3JRAA 1U9NA 2M34A 1A6IA 2FQ4A 1UMQA 2AO9A 5E3OA 5EG0B 2HOAA 2HYJA 3S17J 3IH4A 4NDLA 5IOYA 3JRBA 1GDTA 1JT0A 3GTGJ 3O8GA 3BTLA 2CQXA 2R92J 4FTHA 2R93J 4Y52J 1JKOC 3BTCA 2ID6A 1IRZA 2XB0X 3JRGA 4A69C 1VFCA 4D5FA 4A3GJ 3L1PA 2H8RA 9ANTA 3BQZA 3C2BA 1JGGA 1AKHB 4A3JJ 2DMPA 5F0HA 2E1OA 2VKEA 3A02A 5FJ8J 3PO2J 5FLMJ 4X6AJ 3OSGA 5K7ZA 4V2GA 3WHBA 3S1NJ 2TRTA 4MFDA 1IC8A 1GV5A 1B8IB 1BW6A 2WB1N 1ETYA 3CCYA 2K9SA 2VI6A 1BW5A 3BQYA 1H8AC 1HDPA 4XRSG 3S15J 1GT0C 3I4MJ 1UG2A 5F27A 3ZQHA 3B6AA 1SANA 1JKQC 2Y0SN 4A3EJ 3CQZJ 1B8IA 1HDDC 3S2DJ 3QQAA 2GBYA 2ME0A 2R5YB 5IP7J 1IUFA 1YRNA 1F36A 1MH4A 1P7IA 4XRSA 3K7AJ 2IBDA 1MBEA 2MGQA 3FIWA 3FK7A 2LLKA 2P81A 5M5XJ 3RZOJ 3QPLA 3IV5A 5C4XJ 2YUSA 2XRLA 2Y31A 4BY7J 1I3QJ 2TCTA 1TWCJ 5K7FA 4A3FJ 4B4CA 1YRNB 1QVTA 4JX5A 2K40A 2M2EA 1GV2A 4M6VA 2VPRA 4S0HB 3S1QJ 3BT9A 4QIWN 2L0KA 4M3BA 4W97A 3SDGA 3JREA 4DYQA 3S16J 1MBJA 2VUMJ 3HOUJ 5C3EJ 3H3VK 1JTYA 1RESA 3TP0A 2LD5A 1W0UA 1IDZA 1RETA 5IP9J 3OOUA 4IHVA 2XGDA 1DU0A 5J1RA 1FTTA 2DMQA 4UUTA 4UUSB 1BJZA 2PMZN 5FKOA 3HM5A 4D7MA 2M8GX 3BG3A 5M3FJ 2E19A 3LSRA 3NAUA 2CUFA 5FLVA 3PO3J 3TP3A 3JRFA 1XC5A 3LNQA 3WHCA 1U78A 2ECBA 1RKTA 5F08A 2NS8A 3BR1A 5DTDA 4DZJA 1FIPA 4MFEA 2XPVA 1Y1WJ 5JLXA 5IYBJ 4XICA 4QSHA 3GTMJ 2X9DA 2DA3A 4JX6A 1JKRC 1B72A 2DA2A 4AYBN 5JLWA 1HLVA 3HOYJ 1FIAA 1LE8B 3JRHA 3PM1A 3HOVJ 4LOCA 2FX0A 3W6VA 1ITYA 3HEFA 4EEFG 4G12A 2LY9A 4A3LJ 2CQQA 2R5YA 5IYDJ 2AHQA 3Q0VA 1ZK8A 3BR2A 2EZKA 5C4JJ 3TW7A 1O4XA 3DEWA 4A3MJ 1ZR2A 3A03A 4M3DA 2E2HJ 2JA5J 5EEAA 1WI3A 1W0TA 1JTXA 1I50J 5EZGA 5HODA 3NARA 2LKXA 2HXIA 1TWAJ 2D5VA 2DA6A 1FJLA 4A3KJ 2HXOA 2EBIA 1MH3A 3B6CA 2JJ7A 5E3MA 4MO7A 1VI0A 2WV1A 5M5YJ 1APLC 2Y2ZA 4I6ZA 3E7LA 3HGGA 4JX4A 5IP6A 1ZQ3P 4MIMA 2JA6J 5EGOA 3SFIA 3OSFA 3GBGA 1IJWC 2R7ZJ 1K83J 4M3GA 1H88C 1NK3P 2DA5A 2R0QC 3RKQA 1PUFA 1E3OC 2M9HA 4JYKA 3MN2A 4M3EA 1QVUA 1ZGWA 1TWFJ 1JJ6C 1UHSA 2FD5A 3OIOA 4QTRA 1RR7A 2WAQN 2MW8A 1IV6A 3ZQLA 5GPCA 1BL0A 4A3BJ 3S2HJ 3LSJA 5EGOB 2JN6A 4J19A 1TWHJ 1WPKA 2JA7J 1RKWA 1LFUP 4JP0A 1TWGJ 2DA1A 5EG0A 1F43A 5BNGA 1EF4A 5FKMA 4XRMA 2G0EA 5C44J 1IGNA 2CUEA 1MBHA 3G1LA 5GPAA 3HBLA 4FCYA 2COBA 4AUXA 3FISA 2R5ZB 2ME6A 4X1EA 2JMWA 4B1RA 2W48A 1AU7A 2IEKA 2XGEA 3GTQJ 2CU7A 1R9TJ 1G2HA 3S14J 2DN0A 2B63J 3BTIA 1X58A 2NVQJ 1A5JA 1S7EA 2N8GA 1DU6A 2LP0A 1H89C 3GTKJ 3JR9A 5FKNA 1MBKA 4D7NA 2EQRA 4BKXA 3I4NJ 1X2NA 4IEJA 2DMUA 1VNDA 1U9OA 1MBFA 4RBOA 2LFBA 3RZDJ 1Q1VA 3F0CA 3S1RJ 3GTLJ 2M0CA 1JUMA 1Z0XA 1CQTA 1MNMC 2HI3A 1NTCA 4FE4A 1ETOA 3ZQFA 4AC0A 4DW6A 3Q3SA 1SFOJ 1ZKGA 2JK3A 3BG5A 3LSGA 3A01A 4HNVA 1WGXA 1T33A 1MSEC 3JRDA 3MVPA 2X48A 5F0FA 2DMNA 5EYRA 1ENHA 2IAIA 3BR3A 2YS9A 2R5ZA 2EZLA 1U8BA 2VKVA 3GTPJ 2NS7A 2GLOA 2ELKA 4FE7A 5FKKA 4Y7NJ 4BXXJ 4MLOA 5EZHA 4FISA 2LK2A 3LSPA 2YU9J 1ETWA 1XS9A 1K61A 3A01B 2Y9ZA 2EZIA 2NVXJ 3ZQIA 3G1OA 3CMYA 2O8KA 4BY1J 2LR8A 2HQ5A 2O7OA 3HKZN 3VPRA 1ZTRA 2LVSA 2MSYA 2XPWA 3HGYA 1NK2P 3TEDA 5IOZA 1LFBA 3TW6A 3HOWJ 2DA4A 2L7FP 2QCOA 3BTJA 1P7JA 2OPTA 2XGCA 1OFCX 3HOXJ 2CRGA 2LTPA 1OJLA 1B72B 1ORKA 1T56A 4C3HJ 4B3AA 4C3IJ 3GTJJ 2QF7A 2DA7A 2NVTJ 1BA5A 5F1JA 2ID3A 1JUSA 4CYCA 1XG1A 3M4OJ 2GM4A 1HOMA 1HCRA 2ZB9A 3UKGA 1AHDP 5F04A 2CJJA 1JJ8C 5DS9A 3LOCA 5J1YA 5F0CA 4DZPA 4XIDA 3M3YJ 2H1KA 1TC3C 1ETXA 2Y30A 3Q0WA 3IH3A 2DJNA 1Y1VJ 3SJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR0 A;  4L5E A;  4IHW A;  4XK4 A;  4C2M J;  5IPA A;  3QPS A;  3FK6 A;  2JWT A;  2FJ1 A;  3MKL A;  2HOT A;  2DMT A;  2L7M P;  4BBS J;  1ZR4 A;  2EH3 A;  5GP9 A;  5E3N A;  2NOG A;  2E2I J;  2K9Q A;  1POG A;  2O9L A;  2XB5 A;  3D1N I;  2L7Z A;  2RAE A;  4IHY A;  4GFB A;  5J3L A;  1VF9 A;  1MBG A;  4A3D J;  4C3J J;  2NVY J;  3ZOB A;  4RDU A;  1ETQ A;  4V2F A;  1WCM J;  5IYC J;  4DYR A;  1PUF B;  3BR6 A;  1IDY A;  3JRC A;  2ECC A;  2JA8 J;  4CYC B;  3S1M J;  1X2M A;  1WH7 A;  5J1U A;  4UUS A;  1GVD A;  2E2J J;  2L9R A;  4D5C A;  3HDD A;  5EF6 A;  1ETV A;  2OF7 A;  3HB9 A;  1QRY A;  2KT0 A;  5M5W J;  3ZQG A;  5E3L A;  5EDN A;  2DTZ A;  5K7H A;  3Q0U A;  1WH5 A;  3CDL A;  1HF0 A;  2Y9Y A;  3RQI A;  3BR5 A;  1MSF C;  1JT6 A;  2MG4 A;  1JKP C;  1OCP A;  1QPI A;  1FTZ A;  2HOS A;  3G1M A;  1LE8 A;  3FKI J;  1D5Y A;  4A93 J;  4IHX A;  1I6H J;  3H0G J;  3BG9 A;  2KDZ A;  4I76 A;  1FEX A;  4DYC A;  3JRI A;  4M3F A;  3K2A A;  3GTO J;  1RPW A;  4A3I J;  1AKH A;  2XSD C;  2X6O A;  5FKL A;  1OCT C;  3DCF A;  3IH2 A;  1Z77 A;  3HOZ J;  1ETK A;  3ZQC A;  2XPU A;  3O8H A;  2EZH A;  1IG7 A;  4ABZ A;  5M3M J;  1GUU A;  2I10 A;  4A3C J;  2K9N A;  1JUP A;  2HDD A;  4BBR J;  4W1U A;  3JRA A;  1U9N A;  2M34 A;  1A6I A;  2FQ4 A;  1UMQ A;  2AO9 A;  5E3O A;  5EG0 B;  2HOA A;  2HYJ A;  3S17 J;  3IH4 A;  4NDL A;  5IOY A;  3JRB A;  1GDT A;  1JT0 A;  3GTG J;  3O8G A;  3BTL A;  2CQX A;  2R92 J;  4FTH A;  2R93 J;  4Y52 J;  1JKO C;  3BTC A;  2ID6 A;  1IRZ A;  2XB0 X;  3JRG A;  4A69 C;  1VFC A;  4D5F A;  4A3G J;  3L1P A;  2H8R A;  9ANT A;  3BQZ A;  3C2B A;  1JGG A;  1AKH B;  4A3J J;  2DMP A;  5F0H A;  2E1O A;  2VKE A;  3A02 A;  5FJ8 J;  3PO2 J;  5FLM J;  4X6A J;  3OSG A;  5K7Z A;  4V2G A;  3WHB A;  3S1N J;  2TRT A;  4MFD A;  1IC8 A;  1GV5 A;  1B8I B;  1BW6 A;  2WB1 N;  1ETY A;  3CCY A;  2K9S A;  2VI6 A;  1BW5 A;  3BQY A;  1H8A C;  1HDP A;  4XRS G;  3S15 J;  1GT0 C;  3I4M J;  1UG2 A;  5F27 A;  3ZQH A;  3B6A A;  1SAN A;  1JKQ C;  2Y0S N;  4A3E J;  3CQZ J;  1B8I A;  1HDD C;  3S2D J;  3QQA A;  2GBY A;  2ME0 A;  2R5Y B;  5IP7 J;  1IUF A;  1YRN A;  1F36 A;  1MH4 A;  1P7I A;  4XRS A;  3K7A J;  2IBD A;  1MBE A;  2MGQ A;  3FIW A;  3FK7 A;  2LLK A;  2P81 A;  5M5X J;  3RZO J;  3QPL A;  3IV5 A;  5C4X J;  2YUS A;  2XRL A;  2Y31 A;  4BY7 J;  1I3Q J;  2TCT A;  1TWC J;  5K7F A;  4A3F J;  4B4C A;  1YRN B;  1QVT A;  4JX5 A;  2K40 A;  2M2E A;  1GV2 A;  4M6V A;  2VPR A;  4S0H B;  3S1Q J;  3BT9 A;  4QIW N;  2L0K A;  4M3B A;  4W97 A;  3SDG A;  3JRE A;  4DYQ A;  3S16 J;  1MBJ A;  2VUM J;  3HOU J;  5C3E J;  3H3V K;  1JTY A;  1RES A;  3TP0 A;  2LD5 A;  1W0U A;  1IDZ A;  1RET A;  5IP9 J;  3OOU A;  4IHV A;  2XGD A;  1DU0 A;  5J1R A;  1FTT A;  2DMQ A;  4UUT A;  4UUS B;  1BJZ A;  2PMZ N;  5FKO A;  3HM5 A;  4D7M A;  2M8G X;  3BG3 A;  5M3F J;  2E19 A;  3LSR A;  3NAU A;  2CUF A;  5FLV A;  3PO3 J;  3TP3 A;  3JRF A;  1XC5 A;  3LNQ A;  3WHC A;  1U78 A;  2ECB A;  1RKT A;  5F08 A;  2NS8 A;  3BR1 A;  5DTD A;  4DZJ A;  1FIP A;  4MFE A;  2XPV A;  1Y1W J;  5JLX A;  5IYB J;  4XIC A;  4QSH A;  3GTM J;  2X9D A;  2DA3 A;  4JX6 A;  1JKR C;  1B72 A;  2DA2 A;  4AYB N;  5JLW A;  1HLV A;  3HOY J;  1FIA A;  1LE8 B;  3JRH A;  3PM1 A;  3HOV J;  4LOC A;  2FX0 A;  3W6V A;  1ITY A;  3HEF A;  4EEF G;  4G12 A;  2LY9 A;  4A3L J;  2CQQ A;  2R5Y A;  5IYD J;  2AHQ A;  3Q0V A;  1ZK8 A;  3BR2 A;  2EZK A;  5C4J J;  3TW7 A;  1O4X A;  3DEW A;  4A3M J;  1ZR2 A;  3A03 A;  4M3D A;  2E2H J;  2JA5 J;  5EEA A;  1WI3 A;  1W0T A;  1JTX A;  1I50 J;  5EZG A;  5HOD A;  3NAR A;  2LKX A;  2HXI A;  1TWA J;  2D5V A;  2DA6 A;  1FJL A;  4A3K J;  2HXO A;  2EBI A;  1MH3 A;  3B6C A;  2JJ7 A;  5E3M A;  4MO7 A;  1VI0 A;  2WV1 A;  5M5Y J;  1APL C;  2Y2Z A;  4I6Z A;  3E7L A;  3HGG A;  4JX4 A;  5IP6 A;  1ZQ3 P;  4MIM A;  2JA6 J;  5EGO A;  3SFI A;  3OSF A;  3GBG A;  1IJW C;  2R7Z J;  1K83 J;  4M3G A;  1H88 C;  1NK3 P;  2DA5 A;  2R0Q C;  3RKQ A;  1PUF A;  1E3O C;  2M9H A;  4JYK A;  3MN2 A;  4M3E A;  1QVU A;  1ZGW A;  1TWF J;  1JJ6 C;  1UHS A;  2FD5 A;  3OIO A;  4QTR A;  1RR7 A;  2WAQ N;  2MW8 A;  1IV6 A;  3ZQL A;  5GPC A;  1BL0 A;  4A3B J;  3S2H J;  3LSJ A;  5EGO B;  2JN6 A;  4J19 A;  1TWH J;  1WPK A;  2JA7 J;  1RKW A;  1LFU P;  4JP0 A;  1TWG J;  2DA1 A;  5EG0 A;  1F43 A;  5BNG A;  1EF4 A;  5FKM A;  4XRM A;  2G0E A;  5C44 J;  1IGN A;  2CUE A;  1MBH A;  3G1L A;  5GPA A;  3HBL A;  4FCY A;  2COB A;  4AUX A;  3FIS A;  2R5Z B;  2ME6 A;  4X1E A;  2JMW A;  4B1R A;  2W48 A;  1AU7 A;  2IEK A;  2XGE A;  3GTQ J;  2CU7 A;  1R9T J;  1G2H A;  3S14 J;  2DN0 A;  2B63 J;  3BTI A;  1X58 A;  2NVQ J;  1A5J A;  1S7E A;  2N8G A;  1DU6 A;  2LP0 A;  1H89 C;  3GTK J;  3JR9 A;  5FKN A;  1MBK A;  4D7N A;  2EQR A;  4BKX A;  3I4N J;  1X2N A;  4IEJ A;  2DMU A;  1VND A;  1U9O A;  1MBF A;  4RBO A;  2LFB A;  3RZD J;  1Q1V A;  3F0C A;  3S1R J;  3GTL J;  2M0C A;  1JUM A;  1Z0X A;  1CQT A;  1MNM C;  2HI3 A;  1NTC A;  4FE4 A;  1ETO A;  3ZQF A;  4AC0 A;  4DW6 A;  3Q3S A;  1SFO J;  1ZKG A;  2JK3 A;  3BG5 A;  3LSG A;  3A01 A;  4HNV A;  1WGX A;  1T33 A;  1MSE C;  3JRD A;  3MVP A;  2X48 A;  5F0F A;  2DMN A;  5EYR A;  1ENH A;  2IAI A;  3BR3 A;  2YS9 A;  2R5Z A;  2EZL A;  1U8B A;  2VKV A;  3GTP J;  2NS7 A;  2GLO A;  2ELK A;  4FE7 A;  5FKK A;  4Y7N J;  4BXX J;  4MLO A;  5EZH A;  4FIS A;  2LK2 A;  3LSP A;  2YU9 J;  1ETW A;  1XS9 A;  1K61 A;  3A01 B;  2Y9Z A;  2EZI A;  2NVX J;  3ZQI A;  3G1O A;  3CMY A;  2O8K A;  4BY1 J;  2LR8 A;  2HQ5 A;  2O7O A;  3HKZ N;  3VPR A;  1ZTR A;  2LVS A;  2MSY A;  2XPW A;  3HGY A;  1NK2 P;  3TED A;  5IOZ A;  1LFB A;  3TW6 A;  3HOW J;  2DA4 A;  2L7F P;  2QCO A;  3BTJ A;  1P7J A;  2OPT A;  2XGC A;  1OFC X;  3HOX J;  2CRG A;  2LTP A;  1OJL A;  1B72 B;  1ORK A;  1T56 A;  4C3H J;  4B3A A;  4C3I J;  3GTJ J;  2QF7 A;  2DA7 A;  2NVT J;  1BA5 A;  5F1J A;  2ID3 A;  1JUS A;  4CYC A;  1XG1 A;  3M4O J;  2GM4 A;  1HOM A;  1HCR A;  2ZB9 A;  3UKG A;  1AHD P;  5F04 A;  2CJJ A;  1JJ8 C;  5DS9 A;  3LOC A;  5J1Y A;  5F0C A;  4DZP A;  4XID A;  3M3Y J;  2H1K A;  1TC3 C;  1ETX A;  2Y30 A;  3Q0W A;  3IH3 A;  2DJN A;  1Y1V J;  3SJM A; 
#chains in the Genus database with same CATH topology
 4L5E A;  4IHW A;  4C2M J;  4PGG A;  2JWT A;  1T8I A;  1M1E B;  3DLA A;  2IGM A;  2NOJ B;  2ZSH B;  4I02 A;  2HOT A;  2ACJ A;  2DMT A;  1TQM A;  2OTJ I;  4KA4 A;  1BBY A;  5JHF A;  2ZBK A;  5GP9 A;  5E3N A;  1LDJ A;  2GA2 A;  1K6O A;  3CCU I;  1W1W E;  3LMM A;  2XB5 A;  4PZJ A;  4GFB A;  3PSF A;  3EET A;  4UY8 I;  5HDN A;  2IXS A;  4C3J J;  2X4H A;  2H8W A;  1BC8 C;  1C0W A;  1ETQ A;  4OMY A;  3HTU A;  1PUF B;  3I59 B;  3IP4 B;  1MMN A;  2PJR A;  1NH3 A;  3CJR B;  2JA8 J;  1IRG A;  2PMH A;  2VQG A;  4XBF A;  1GVD A;  1YX3 A;  2E2J J;  3ZQ7 A;  1TQI A;  3MQ0 A;  1ETV A;  5J47 A;  2DLL A;  2XKO A;  3QPH A;  1ONV A;  2EB7 A;  2FOK A;  4CCM A;  1QRY A;  2KT0 A;  5M5W J;  3WTX C;  1DQU A;  5E8I A;  5TRD A;  4NBQ A;  2R7S A;  2P8T A;  3QAH A;  1KA8 A;  4CO8 A;  3CDL A;  1R6R A;  4HG2 A;  3KE2 A;  1G6N A;  1QZE A;  3BR5 A;  5ICF A;  3GLX A;  2R7Q A;  2MG4 A;  4ESJ A;  1PUE E;  5CJ9 A;  2HOS A;  1LE8 A;  4EGZ A;  1HBX G;  1QBJ A;  1OLT A;  2G9W A;  1H9G A;  3PUF A;  1K78 B;  3AKZ A;  3K4C A;  2QA4 I;  2Z1D A;  4I76 A;  2J5O A;  3HC7 A;  3K2A A;  3OIQ A;  2XRO A;  4A3I J;  1D1B A;  4HX7 A;  1U3E M;  2D2W A;  3F8C A;  3VSL A;  3IH2 A;  5CVV A;  1I1G A;  3VYS B;  3DLL F;  4AWX B;  2EZH A;  5BS6 A;  2YU3 A;  1G3Y A;  2R7F A;  3FMR A;  3S3N A;  3QRF F;  1HW5 A;  1JUP A;  2FBK A;  3HL2 A;  2HDD A;  3K70 D;  3G71 I;  3JRA A;  2HEO A;  2VJI A;  1UB9 A;  5BQT A;  1ZG1 A;  3F72 A;  5FRN A;  4I99 C;  3W2W A;  1PP8 F;  2M34 A;  1A6I A;  2UXN A;  2FQ4 A;  4RLQ A;  1L0O C;  5EG0 B;  1TBX A;  1OCC H;  3HTS B;  2AQF A;  3NQO A;  2Z9O A;  3JRB A;  1YIO A;  1ZGA A;  1GDT A;  1JT0 A;  1VQ7 I;  2F2E A;  3TO9 A;  2VXZ A;  4BXF A;  3FZV A;  3BTL A;  1FY7 A;  2Y69 H;  3P9I A;  1XDU A;  4FTH A;  4H4K C;  4EV0 A;  2R93 J;  1JKO C;  4RM2 A;  1LVA A;  1JHF A;  3A4C A;  3BTC A;  1U2W A;  2XB0 X;  2ZME B;  4A69 C;  4HLX A;  3WOD F;  4DBQ A;  2KZV A;  2H8R A;  1TP4 A;  3C2B A;  1IN5 A;  5ED4 A;  2BW3 A;  2JUC A;  3V8J A;  4XN3 A;  2E1O A;  2VKE A;  2L54 A;  2GIZ A;  3IHU A;  2MD0 A;  4XKW A;  3J7Y J;  5K7Z A;  3OSG A;  3BZC A;  3WHB A;  5FGM A;  2DFH A;  3PUB A;  4MFD A;  3RTR A;  4II2 A;  1Z7U A;  2KFD A;  3EUH A;  1ZG3 A;  2VC0 A;  3K4L A;  1R36 A;  3ZQQ A;  1ETY A;  4JK1 X;  1IAW A;  4Q48 A;  4BEH A;  4LLN A;  1FP1 D;  1CF7 A;  4L18 B;  2OD5 A;  2BW3 B;  2HQA A;  3VYU B;  5LRS A;  4HYE A;  1BW5 A;  2OZU A;  1R5G A;  3F8N A;  4OOI A;  2LF8 A;  5HLG A;  1GT0 C;  1S7O A;  3PL8 A;  1VQK I;  5LGN A;  5HNH A;  3I3L A;  2WTE A;  3E5X A;  1BR4 A;  4IRI A;  4FET A;  2M8E A;  3WTZ A;  4N4N B;  2ME0 A;  2VE8 A;  2F5D A;  3OYG A;  5B1A H;  1P7I A;  2PFB A;  3OOP A;  4BJ6 C;  2VBW A;  2MGQ A;  4RAG A;  4Y4R A;  4LK1 F;  2LY1 A;  3H5R A;  3KEY A;  4CH7 A;  4UXN A;  3AL0 C;  4BY7 J;  1I3Q J;  1OPC A;  1TWC J;  3QOD A;  4WXC A;  3H9J A;  5K5R A;  4A3F J;  4B4C A;  2XGX A;  4FQG A;  2VJJ A;  2PN6 A;  2IS2 A;  3H5N A;  5K1Y A;  3ZP5 A;  3V8K A;  3ZGK A;  4MQV A;  2ISY A;  3LA7 A;  1MMD A;  1SD4 A;  2QQ9 A;  4M6V A;  2R7W A;  3S1Q J;  2JVG A;  3JRE A;  3IWF A;  4QPQ A;  2GOM A;  1MBJ A;  1DPR A;  3K70 C;  4Q4Z F;  3RCO A;  4RGR A;  2R7V A;  1JTY A;  3TP0 A;  4LIT A;  1IDZ A;  5IP9 J;  3WTS C;  3CJT B;  4RA2 A;  3FHN A;  5CPR B;  1BJZ A;  2DW4 A;  1WVR A;  1BIB A;  1FOW A;  2GOX B;  3LSR A;  4YEJ A;  3WHC A;  3DU6 A;  1U78 A;  4AID A;  2NS8 A;  5DTD A;  2HKX A;  4DZJ A;  3NEU A;  2XKP A;  1LVK A;  2QEN A;  3J80 K;  2IW5 A;  2ZJR F;  2OJE D;  1F1Z A;  4B09 A;  2VC1 A;  5JLX A;  1SC7 A;  4XIC A;  3GWZ A;  2M0M A;  4IVN A;  5KAF C;  4WXD A;  4HF1 A;  4AYB N;  2K3F A;  1HLV A;  2XC7 A;  3HSE A;  2WAF A;  4GO1 A;  3WE3 A;  1R22 A;  4BNC A;  3W6V A;  3W2A A;  1QA6 A;  3Q9S A;  4BE2 A;  2AHQ A;  3K1M A;  1VQL I;  3BG7 A;  3U9G A;  1STZ A;  5LEJ A;  2P5L C;  2HGC A;  4BQA A;  1ZGJ A;  2ZC2 A;  3ABL H;  3TW7 A;  3ZRG A;  5H20 A;  1DP3 A;  4PDK A;  2P6S A;  2DO7 A;  3A03 A;  3E5Q A;  3GW2 A;  2E2H J;  4CHU A;  3ISP A;  3RDI A;  4CCL A;  1J5Y A;  5EJC A;  1JTX A;  5HOD A;  3LSI A;  3PSI A;  1KYZ A;  1TWA J;  2MYS A;  2O5R A;  2VON A;  3A0H C;  1FJL A;  2FUG 2;  2OC6 A;  4GRI A;  4NC6 A;  2EBI A;  3B6C A;  3N4M A;  1SEU A;  3DEE A;  4MTD A;  4YIF A;  1OQY A;  2WV1 A;  5M5Y J;  2E7X A;  3E7L A;  4KJZ A;  3T1B A;  4ZTF A;  5DCM A;  1OYY A;  3QP6 A;  2JA6 J;  3HHG A;  5EGO A;  3SFI A;  2DOD A;  3K4N A;  4U0W A;  3VB2 A;  2R0Q C;  4IO9 F;  2FML A;  1PUF A;  4II3 A;  5GTI C;  4M3E A;  1ZGW A;  3IC7 A;  1TWF J;  3JCU C;  5ERI A;  3OIO A;  1FOK A;  2F5E A;  2WAQ N;  3WG9 A;  2XDV A;  4ESB A;  1J7K A;  3S8P A;  2E71 A;  5L3D A;  1R49 A;  1BL0 A;  3S2H J;  2X1E A;  2YR2 A;  2DT7 B;  4G94 A;  5EGO B;  3FMS A;  4ENN A;  4I0A A;  4XOP A;  1OCO H;  5DD4 A;  1WPK A;  1YW8 A;  3H36 A;  2STT A;  2DA1 A;  1EF4 A;  3N05 A;  2K4J A;  5B3S H;  3PQK A;  4A5M A;  2V4J C;  2VXD A;  2O61 A;  4BE1 A;  4YEL A;  3G1L A;  3UNG C;  3O2P E;  3HBL A;  4FCY A;  3DBR B;  4IHS A;  4XLA A;  2MC3 A;  2IA0 A;  4F3Q A;  2KIF A;  1D5V A;  3HYI A;  3JAM Z;  1AU7 A;  2IEK A;  3P9K A;  4IZZ A;  2CU7 A;  2CW7 A;  1G2H A;  3DPU A;  1T95 A;  3S14 J;  2XF6 A;  2B63 J;  1X58 A;  1YJ9 I;  3S3O A;  6PAX A;  1F4K A;  3J81 K;  5HS8 A;  2Y48 A;  4Y15 A;  3H9G A;  1R1V A;  4G6D A;  3OYK A;  1FYM A;  4ZTJ A;  1OYW A;  1W5S A;  2ZNY A;  3ESW B;  1S6L A;  3M8F A;  3N97 A;  1VND A;  3CUQ A;  5HLI A;  3CME I;  1WZ2 A;  1K79 A;  1S7A A;  2LFB A;  1PP7 U;  1R4N B;  3ROU A;  5ICG A;  2M30 A;  1YS7 A;  3DPT A;  3T0Y A;  3SZP A;  3DEU A;  1JUM A;  1MNM C;  2DT5 A;  1ZRF A;  3OYN A;  1NTC A;  2A6E F;  4FE4 A;  3ZQF A;  4DW6 A;  1O7L A;  3RPU D;  1DGR M;  1SFO J;  1GVJ A;  4X0G A;  2MLK A;  2JK3 A;  2CQK A;  4V19 K;  3ECO A;  3SQN A;  4HNV A;  5A2Q K;  1TL8 A;  2GWR A;  2UV1 A;  3JRD A;  3MVP A;  5JVG F;  2X48 A;  1MSE C;  2W57 A;  5KCM A;  3ABM H;  5LLQ A;  3BR3 A;  2YS9 A;  4UHT A;  2VKV A;  5AON A;  5DM7 F;  3CCE I;  3GTP J;  2GLO A;  1R1T A;  3FKJ A;  4CDG A;  4BXX J;  5EZH A;  1ZEL A;  1MGT A;  2EA2 A;  2I8D A;  1HXD A;  2M87 A;  1X1P A;  3LSP A;  2W4S A;  1ETW A;  1SMT A;  4QLC U;  1K61 A;  3I0T A;  4TV7 A;  2XAF A;  2EZI A;  4OIN F;  2Q1Z B;  2X6W A;  4PJJ A;  3ZQI A;  4BY1 J;  3LST A;  1XPX A;  2HU9 A;  2HQ5 A;  3VOE A;  3X2Q H;  1WJD A;  1LB2 A;  3C1D A;  2XPW A;  3HGY A;  4CZZ A;  2HZT A;  1ZRC A;  3M9A A;  2L7F P;  5FD6 A;  4CCK A;  1R23 A;  2L9V A;  2DU9 A;  2IGN A;  2OPT A;  4FT8 A;  3AG2 H;  4XKB A;  2XRN A;  3BZK A;  5L3G A;  3GZ6 A;  1MDM B;  3J7Z I;  1A35 A;  4L9J A;  2LTP A;  3CMA I;  1W7P D;  2A6H F;  2VIX A;  1E2X A;  4ASN A;  1ZRD A;  2QF7 A;  4KNY A;  4F92 B;  2DA7 A;  4A6E A;  1LQ1 A;  1MNE A;  3TDU C;  3O6B B;  1BA5 A;  2ID3 A;  1MD0 A;  3OIP A;  1Q1H A;  2W1O A;  5GAH J;  4CYC A;  1KZH A;  3CP8 A;  2KQR A;  1XSD A;  1HOM A;  1E0E A;  1QHG A;  3RYP A;  4KMU X;  1OCZ H;  1AHD P;  2MH9 A;  2K3P A;  2CJJ A;  4P1W A;  3FM3 A;  4XID A;  4ZJZ A;  2E34 A;  5J40 A;  3DF8 A;  2LG4 A;  1TC3 C;  2RQP A;  2EJR A;  3KEO A;  3K1N A;  3QPS A;  3FK6 A;  1FYK A;  2FJ1 A;  2WAE A;  3TDZ C;  3K4M A;  3L2R A;  3G3Z A;  3DKY A;  3ZMT A;  4BBS J;  4ZH4 F;  3RPQ A;  4PGH A;  2E2I J;  1POG A;  2JUG A;  4P9F A;  2L7Z A;  4PFP A;  1FBQ A;  4IHY A;  1TZL A;  5D6E A;  2KRF A;  1HC8 A;  3LQR A;  4FHT A;  2X1C A;  4EVI A;  1YW7 A;  1KQ8 A;  1X4P A;  1S5L C;  4LLG F;  2YX7 A;  3LSM A;  1VQN I;  1IDY A;  4ZYE A;  2BY3 A;  5D5V B;  4L5J A;  4QPO A;  3OV8 A;  3S1M J;  4AD9 A;  3HPG A;  1BIA A;  2FNA A;  4LD5 A;  1Z67 A;  3GZN B;  3HZJ A;  5EF6 A;  4N9H A;  2FBH A;  2VL8 A;  3E0J B;  3FXK A;  3KYL A;  3KFW X;  2JQ7 A;  4NC7 A;  2L5Q A;  4A12 A;  2JPB A;  5EDN A;  2DTZ A;  4BXU A;  5K7H A;  3OWT A;  1WH5 A;  3W2V A;  3KP3 A;  1MW7 A;  4NUB A;  1W36 C;  1PJR A;  3GO5 A;  1Y0N A;  3G2B A;  3CJN A;  3H3U A;  1MSF C;  5F1R A;  3ABT A;  1JKP C;  2VB6 A;  3KZZ A;  5IY5 H;  1QO0 D;  4A2U A;  2QLZ A;  3FKI J;  4ZYH A;  3BLY A;  4BJ5 C;  2DOF A;  1K6Y A;  4O6J A;  3BG9 A;  1W5T A;  3JRI A;  4Z6Y A;  5HOO A;  4N9I A;  3GTO J;  1RPW A;  3SZG A;  2HS5 A;  4XLP F;  2XSD C;  2X6O A;  1OR7 C;  1FNN A;  3HRS A;  4I0B A;  3BZ6 A;  3HOZ J;  3TOA A;  3ASN H;  1LJ9 A;  3DV8 A;  1RRJ A;  2FF4 A;  4RLF A;  5DUK A;  4ABZ A;  1TTY A;  3E1S A;  3MKY B;  3VEP A;  5DEQ A;  2K9N A;  1XGM A;  4BBR J;  2V26 A;  4ENK A;  1U9N A;  3F8B A;  1XN7 A;  3DU5 A;  2EFW A;  5DCM B;  3IH4 A;  2IJL A;  4A5N A;  4XN0 A;  2ELJ A;  4NDL A;  1D1C A;  4RB3 C;  1FSH A;  3O8G A;  2FSW A;  2CQX A;  1RUN A;  2L4M A;  3LWF A;  2HFH A;  1HSJ A;  2HTS A;  2ID6 A;  4XSZ F;  1IRZ A;  3LFK A;  3JRG A;  4ANJ A;  1ULY A;  4RGU A;  3ABK H;  3ZPL A;  1AKH B;  1JGG A;  1REP C;  4BEH B;  5FRM A;  5GAE J;  1CF7 B;  3JTH A;  4BAC A;  2DBB A;  2NAZ A;  3HPH A;  5FJ8 J;  5FLM J;  3I5U A;  4HA8 A;  2V1U A;  4A0Z A;  3CO6 C;  1G3S A;  1IC8 A;  4EGY A;  3HJE A;  5CLS A;  3K69 A;  2Q8K A;  5LFA A;  1B9N A;  1SMY F;  3PNY A;  2Z99 A;  3L2U A;  2Q0O A;  1DPU A;  2Y0M A;  3KP4 A;  2Y75 A;  2QM3 A;  1Z3X A;  2K9S A;  1V5G A;  4LJZ F;  3T5X A;  3OYI A;  2PMU A;  3GME A;  3V4G A;  5ICC A;  4CSW A;  2D1H A;  4LLL A;  1YQA A;  2VJ5 A;  1HDP A;  4XRS G;  2P5V A;  3I4M J;  5F27 A;  3EUH C;  1SAN A;  1JKQ C;  4PSX A;  1B6A A;  3BC8 A;  1HDD C;  4WX9 A;  2OBP A;  2MC4 A;  5TIS C;  3S2D J;  3PJR A;  3DTK A;  2CMP A;  3K4B A;  3TMO A;  1IUF A;  1F36 A;  2W82 A;  1PDN C;  4XRS A;  4GYG A;  2IBD A;  3FK7 A;  3K10 A;  5DCF A;  1A04 A;  2P7V B;  1N77 A;  5M5X J;  3RZO J;  2K27 A;  3GFM A;  3QWL A;  3IV5 A;  2FNP A;  2CV0 A;  2CUJ A;  1W5C C;  2EIL H;  2IS1 A;  4RMN A;  5JVT A;  1T0F A;  2DYS H;  3D5R C;  3M8J A;  1HQC A;  5K7F A;  2ZO4 A;  5FLX Z;  2IRF G;  1K4T A;  5TJJ A;  2KKO A;  4LIV A;  4LK0 F;  4Y13 A;  3I64 A;  3P9C A;  5CVU A;  4L9T A;  5HLH A;  3E5U A;  2LY2 A;  1IZ1 A;  5AIQ A;  4QIW N;  1GHC A;  5ILS A;  2VBY A;  1V3F A;  3QU3 A;  4ZDO A;  3OS0 A;  3HOU J;  3B73 A;  3C2G A;  5C3E J;  1O57 A;  1WJC A;  2ZME A;  1QZZ A;  3ERE D;  1RES A;  2MAB A;  1ZAO A;  3F23 A;  1YS6 A;  4IHV A;  5E8G A;  4S04 A;  2JRM A;  2XGD A;  2H6B A;  1YO5 C;  4UUT A;  2FXA A;  4UUS B;  2L7K A;  3H3Z A;  3TOB A;  4ON0 A;  3HM5 A;  4ETS A;  3BG3 A;  5M3F J;  3M07 A;  2E19 A;  5J4Y A;  3NAU A;  2CUF A;  2BY1 A;  2CQ7 A;  3QYB A;  4HQM A;  5K5O A;  5FLV A;  3PO3 J;  3TP3 A;  5LGU A;  3JRF A;  1HKS A;  2YX4 A;  2ECB A;  5F08 A;  5ICE A;  3G4S I;  1AOY A;  4XOT A;  2A68 F;  1FIP A;  2VOP A;  2XAH A;  2PLY A;  2L2O A;  2XPV A;  1Y1W J;  3GFI A;  4QSH A;  1O7F A;  5CQG A;  1LKX A;  3WU2 C;  1JKR C;  1XMK A;  2H09 A;  1X3Z B;  2DCE A;  5FB2 A;  5EEG A;  2BVL A;  5B5E C;  1ON1 A;  1FIA A;  1N25 A;  3ZN1 A;  3JRH A;  1S29 A;  2MFZ A;  3HOV J;  4BE0 A;  1ITY A;  4EEF G;  4O5V A;  2KRH A;  3ONQ A;  2LY9 A;  3ELK A;  3OMY A;  4F91 B;  1J0R A;  2CQQ A;  3HHH A;  1R5I D;  3Q0V A;  2W7N A;  4LGW A;  2L3D A;  3JSP A;  3FX3 A;  2DK5 A;  1TT5 B;  5C4J J;  3K0L A;  3CF5 F;  4A3M J;  1ZR2 A;  3L9F A;  2VPL A;  5E1X A;  2WC2 A;  3WU0 A;  1D3Y A;  5EEA A;  2QGU A;  3V7S A;  3NRV A;  1XTA A;  1W0T A;  1FOX A;  1IV8 A;  2E35 A;  4ZYD A;  3QU6 A;  3MKW B;  1WSU A;  5E3M A;  4MO7 A;  3CCM I;  3NWT A;  4P96 A;  4LG0 B;  2DOA A;  3C7J A;  1S3J A;  4I6Z A;  3WU1 B;  3HGG A;  1P2F A;  3KZY A;  2BY0 A;  1IXC A;  2M4G A;  1UCR A;  1K78 A;  4CXF A;  1SFK A;  4MIM A;  2Z33 A;  4AU7 A;  3J7A Y;  2R7Z J;  1TNT A;  4E7S A;  1H88 C;  5E1Z B;  2IGK A;  2VOD A;  1LFP A;  2LH9 A;  3MZ8 A;  4I2O A;  3MFK A;  3QOP A;  1JJ6 C;  1UHS A;  4LIU A;  4QTR A;  1X3U A;  1RR7 A;  4LG0 A;  4OIO F;  3SEZ A;  3HG9 A;  5E20 A;  4XLC A;  5GPC A;  5H6R A;  2KLO A;  2ZJP F;  4B3X A;  4IQJ A;  2E1C A;  4J19 A;  1EH6 A;  1K4S A;  2LOO A;  2JA7 J;  3OYM A;  4XQF A;  2CFO A;  1TWG J;  5EG0 A;  2DFI A;  1UEL B;  5FKM A;  4XRM A;  3D5S C;  3BCA A;  3BRO A;  2CUE A;  1IXR C;  2KHM A;  3PIO F;  3CCJ I;  4ZYA A;  4EJT A;  5GPA A;  3LSH A;  3KEQ A;  1KU9 A;  1U8R A;  3E6C C;  1Z6R A;  3KP6 A;  5KVR A;  5L3E A;  3COA C;  1JGS A;  1E3H A;  2R5Z B;  1OIS A;  3FIS A;  2MH2 A;  3KZI C;  3FXQ A;  4OAY A;  3LA3 A;  2Z16 A;  4K2E A;  3HSR A;  2KJB A;  2EIM H;  5FRO A;  2NVQ J;  3BTI A;  1A5J A;  1P4W A;  5E1W A;  1S7E A;  4F52 A;  4BJT A;  1DU6 A;  1WI9 A;  3ULQ B;  3GTK J;  1WJF A;  4YG2 F;  3GVA A;  4D7N A;  1A6Q A;  2EQR A;  2UUZ A;  1IW7 F;  1X2N A;  4IL6 C;  1DDN A;  3KX2 A;  4U87 A;  3V7C A;  4B48 A;  3RZD J;  4JBA A;  4L5I A;  4CCJ A;  4RAZ A;  3S1R J;  2L9N A;  3CC2 I;  4AC0 A;  4YFK F;  2ZJ2 A;  2AXL A;  3E6B A;  3L2W A;  2CYY A;  2QQA A;  3OYB A;  3BG5 A;  5LD2 C;  1XSX A;  3ZMU A;  5EYR A;  1ENH A;  1OMI A;  1IO2 A;  3BOQ A;  4NB5 A;  4PUS A;  2NS7 A;  3GUD A;  2A3S A;  2KZG A;  4MLO A;  4FIS A;  4CCO A;  4OIR F;  4G7O F;  2YU9 J;  2ZXH A;  4UV9 A;  4MGR A;  1AWC A;  3H35 A;  4C2T A;  1N75 A;  1EJ9 A;  2NVX J;  2L9S A;  2EK5 A;  2O7O A;  5CVR A;  3SYT A;  2CUZ A;  4ZZD A;  2LVS A;  2M5W A;  4UB8 C;  2ZFW A;  1EV7 A;  5IOZ A;  3R60 A;  3VFZ A;  2E1M C;  2RN7 A;  4F7Z A;  3DKX A;  1LNW A;  1OFC X;  4CUG A;  2BV6 A;  4M71 A;  5DM6 F;  2CRG A;  2NXN B;  5HS7 A;  4GDF A;  1I1S A;  4HBL A;  5BOX A;  3GFL A;  1NHA A;  1Z9C A;  1G59 A;  1B72 B;  1XGO A;  1ORK A;  2P0W A;  4XNF A;  2F4I A;  1Z7L A;  4C3I J;  4HQE A;  5LRR A;  1BOA A;  1D8K A;  4OWR B;  3FHZ A;  2NVT J;  3FXM A;  2RGV A;  3FDY A;  5F1J A;  1XG1 A;  1FT9 A;  2RKH A;  4MTE A;  3M4O J;  3BJ6 A;  3REO A;  1Y56 A;  2K9M A;  2GXA A;  5DD8 A;  2WBM A;  2ZB9 A;  2PEX A;  3UKG A;  5F04 A;  3Q5F A;  3O3K A;  5E18 F;  2E36 A;  3LOC A;  1YHQ I;  5J1Y A;  3CJQ B;  3IKV A;  3M3Y J;  1MJB A;  3JTG A;  1QZY A;  2GZW A;  2M45 A;  2KIU A;  1ETX A;  2Y30 A;  3Q0W A;  4AIJ A;  3NWS A;  4C2U A;  1Y1V J;  2LC2 A;  4A6D A;  3SJM A;  3S2W A;  5IPA A;  3CUQ B;  2XIG A;  4RB2 C;  1HKT A;  2PI0 A;  4Q47 A;  2DFF A;  4UVC A;  2COM A;  2L7M P;  3M1E A;  1VQ8 I;  4CYD A;  2XF5 A;  2EH3 A;  2IA1 A;  4KUM A;  2K9Q A;  2VAS A;  2Z3Y A;  3BP8 A;  4PJ0 C;  3EYY A;  2DXI A;  2O9L A;  3D1N I;  1AA7 A;  3KLO A;  3MZH A;  1DGW Y;  1UFM A;  2RAE A;  3K4K A;  4YIR X;  2WWY A;  3QYF A;  4R79 A;  4MEY F;  2MBF A;  1Z1D A;  2X51 A;  3W6J B;  3G73 A;  1MBG A;  2DQR A;  3OY9 A;  2XAG A;  2JPC A;  3ZOB A;  4HF2 A;  4RDU A;  3P7N A;  4V2F A;  1WCM J;  2R7O A;  4DYR A;  5IYC J;  2V7F A;  2PG4 A;  3A2K A;  3JRC A;  2ETH A;  1FMW A;  2ECC A;  3E97 A;  1X2M A;  2LNB A;  5J1U A;  4UUS A;  5B1B H;  3F22 A;  2DPD A;  3CC4 I;  2PJP A;  3HDD A;  4XR6 A;  4IOC F;  1SD7 A;  3BY6 A;  3HSF A;  1FOY A;  3HB9 A;  1XX5 A;  3ZQG A;  5E3L A;  3T8R A;  1FBU A;  1VZ0 A;  3Q0U A;  3CTA A;  4HDU A;  2LMD A;  4DOZ A;  3ASO H;  1P9Q C;  2LRD A;  3MMY B;  4BHP A;  3I55 I;  3GX4 X;  3EQL F;  2Q2E B;  2O8X A;  1MDM A;  2F4O B;  1FP2 A;  2JSC A;  3A1Y A;  3GXO A;  3G1M A;  2FBI A;  1W36 D;  2QWW A;  1TT0 A;  4U0V A;  4A93 J;  3IUO A;  4DJA A;  4F93 B;  1WKM A;  4IHX A;  1I6H J;  2V79 A;  3U2R A;  2KDZ A;  1SD5 A;  2PQ8 A;  1Y8R B;  3DPL C;  1P92 A;  3PIP F;  4M3F A;  2H1L A;  4RB0 A;  1J75 A;  1U5T A;  1X1C A;  2DAO A;  4LMY A;  5FKL A;  2W25 A;  2EWN A;  3SHF A;  4D0P A;  1KU3 A;  4LG3 A;  3ZQC A;  1BJA A;  2EV6 A;  4KIT B;  3HKZ A;  1GUU A;  2OZ6 A;  1MMG A;  2L4A A;  3RI4 A;  2GXB A;  1SFE A;  4M9X A;  4P5O A;  4E4H A;  4HSR A;  4W1U A;  4KIS A;  4B43 A;  3L2V A;  1U5T B;  2ZXJ A;  1BI0 A;  4I98 B;  3I53 A;  2AO9 A;  5E3O A;  2EFO A;  3SDB A;  2HOA A;  2HYJ A;  1SVL A;  5D6F A;  4QWQ A;  4KFC A;  3RKY A;  4WK8 F;  2E60 A;  3I4P A;  3GTG J;  2RQQ A;  3F6O A;  3ZN0 A;  1ZH5 A;  2LRE A;  1VQO I;  2AXT C;  1D8J A;  4Y52 J;  3V7R A;  3AG1 H;  5FO5 A;  2Z5U A;  3WE2 A;  4ENJ A;  2ZSI B;  9ANT A;  1YJW I;  1YE9 A;  3BQZ A;  1ZAR A;  4HRI A;  2CS3 A;  2DMP A;  5F0H A;  1WJA A;  3PO2 J;  2EIK H;  3OR1 C;  3FM5 A;  2WV0 A;  4V2G A;  3KPH A;  2NVU B;  2BXY A;  3WGG A;  3DTI A;  1X4O A;  3JW4 A;  4E70 A;  3EPZ A;  1FMV A;  3DQV C;  3WTW C;  3WTY C;  1IF1 A;  1BW6 A;  3VOD A;  1FBS A;  2WB1 N;  3SFZ A;  2ESN A;  3CCY A;  2LSO A;  2GA1 A;  1UAA A;  2A61 A;  3GF2 A;  2WY8 Q;  2DDA A;  5LHG A;  1ZRE A;  4BYY A;  4E6K G;  3EDP A;  5TGT A;  1SFX A;  1ZLK A;  1Y0U A;  3BQY A;  2XAU A;  1XMX A;  4RS8 A;  1UG2 A;  3W6K B;  3L00 A;  2CV1 A;  4U7D A;  2Y0S N;  4A3E J;  3CQZ J;  3HRT A;  4KT5 C;  3AL0 B;  3QQA A;  5DV5 A;  2GBY A;  1HST A;  2CW8 A;  2KIS A;  5DDG A;  2R5Y B;  3KYD B;  5IP7 J;  2M3A A;  2YSR A;  4PCQ A;  5HDG A;  1MH4 A;  1Z91 A;  3CP2 A;  1MBE A;  3FIW A;  2AS5 F;  2LLK A;  2P81 A;  4EJO A;  3QPL A;  2VBX A;  5HNF A;  1EH8 A;  3CES A;  4UVA A;  5C4X J;  2QZ8 A;  2YUS A;  3FXO A;  2XRL A;  3F6V A;  3BDD A;  3IRR A;  2Y31 A;  3LFU A;  3R0J A;  4GGG A;  3MZY A;  2HPI A;  3SEQ A;  4OU0 A;  3IWZ A;  1FSE A;  1WRJ A;  2WAQ A;  1YRN B;  3I58 A;  1QVT A;  2VBZ A;  3B02 A;  1I3A A;  5GTH C;  1T08 B;  4IX7 A;  2EIN H;  2QYO A;  4R8H A;  3CLO A;  1GV2 A;  1NG6 A;  2DI3 A;  4KDP A;  2VN2 A;  2VPR A;  4S0H B;  4HST A;  2QQB A;  2VKD A;  2L0K A;  1RR8 C;  1WHU A;  1Z6T A;  3MKZ A;  3SDG A;  2W84 A;  4HNT A;  2NS0 A;  3RIR A;  3S16 J;  2VUM J;  1XGN A;  3H92 A;  4KIB A;  3FF5 A;  2FU4 A;  4XSX F;  3QYE A;  3QP5 A;  5CYV A;  4YRV A;  1F5T A;  3H1C A;  4MHG A;  3RSN A;  2QVO A;  5IT9 K;  3P5J A;  3OOU A;  2XUB A;  2VT2 A;  4BUP A;  3M1C A;  1BI2 A;  1DU0 A;  1FTT A;  2DMQ A;  2K4B A;  2ISZ A;  1MMA A;  2PMZ N;  5FKO A;  4D7M A;  3OYF A;  4ESF A;  4L9V A;  2CW0 F;  1BR1 A;  5D4S A;  1G3T A;  1XC5 A;  4PJN A;  3LNQ A;  3DKW A;  3MWM A;  5GAD J;  2K9L A;  4XL9 A;  3BR1 A;  1B4A A;  4OMZ A;  1FYL A;  2DT6 A;  4E7J A;  2OV7 A;  2DFE A;  1V5E A;  4MFE A;  3RKW A;  2M7B A;  1PYV A;  3GTM J;  2JVH A;  2DA3 A;  2X9D A;  3HXL A;  4JX6 A;  3WGH A;  1B72 A;  4P9U A;  1D0X A;  2FA5 A;  4RGS A;  2A5Y B;  3ERM A;  1E3P A;  3R4K A;  2X0L A;  4BQN A;  1ZN2 A;  4NC8 A;  2F4M B;  5IT9 Z;  2CH0 A;  3PM1 A;  4AYB A;  4HLY A;  3GZ5 A;  1Y39 A;  3MCZ A;  2CV2 A;  3FXR A;  4G12 A;  2FRH A;  3CZ6 A;  4A3L J;  1N78 A;  2FQ3 A;  1U6G A;  1ZK8 A;  5F64 A;  5FFZ A;  2EZK A;  4HPQ A;  1KU2 A;  2ZXI A;  1O4X A;  3DEW A;  2BOL A;  2IA2 A;  4S05 A;  3S3M A;  4M3D A;  2JA5 J;  1WI3 A;  4E7Z A;  3KP5 A;  4B47 A;  1I50 J;  1RZ4 A;  1TW3 A;  2ZXW H;  2LKX A;  2HXI A;  4HF0 A;  2D5V A;  2JT1 A;  2BZT A;  2HXO A;  4GXO A;  1TLH B;  3HRU A;  3OS2 A;  1VI0 A;  2G7U A;  2DPU A;  1B9M A;  3RQ4 A;  2O0Y A;  2WA0 A;  4Y17 A;  1JHH A;  1YLF A;  4DBR A;  1T38 A;  4KIG A;  5IP6 A;  1ZQ3 P;  1T98 A;  3E6M A;  3LAP A;  5AIP A;  4Z2Y A;  3OSF A;  3GBG A;  1IJW C;  1K83 J;  1VQ4 I;  2CGP A;  4M3G A;  4ZC3 A;  1NK3 P;  2DA5 A;  4BDZ A;  1FZP B;  1E3O C;  2M9H A;  4JYK A;  3MN2 A;  1GXQ A;  2RV8 A;  3QPT A;  1BN5 A;  2FD5 A;  1I6X A;  1S8N A;  4BQO A;  4MQ9 F;  3ZMS A;  5EEH A;  2NYX A;  2A07 F;  2G7H A;  1IN7 A;  4M73 A;  1H0M A;  3ZQL A;  2UZK A;  2VQC A;  1CGP A;  3MEX A;  3M8E A;  3LSJ A;  1LEB A;  1IN6 A;  3TO7 A;  3GLL A;  5CVJ A;  4BHB A;  4RGX A;  1OCR H;  2W85 A;  4JP0 A;  2H6C A;  4WWC A;  1UJ8 A;  2QUF A;  3PFY A;  2Q2E A;  4AVP A;  4XLF A;  2HDW A;  4HV5 A;  1P4X A;  3ZR8 X;  3PQJ A;  2HKO A;  2HDC A;  1YJN I;  4IKF A;  1P6R A;  1QQI A;  5D5W B;  3LQQ A;  2E7W A;  5HVQ C;  2COB A;  1R58 A;  1HKQ A;  2P6T A;  4EQQ A;  3OS1 A;  1JI8 A;  4AUX A;  2ME6 A;  4X1E A;  4BGD A;  2W48 A;  2V6C A;  2XGE A;  1R9T J;  2KRC A;  2DN0 A;  3LAJ A;  3S93 A;  2IPQ X;  2M4K A;  5L3C A;  2W24 A;  1O3Q A;  2DJI A;  2K85 A;  2EV5 A;  4XLN F;  4DGW B;  2NNY A;  2LP0 A;  2DDB A;  1H89 C;  2H94 A;  2QBY B;  4E7H A;  2WB1 A;  3R0A A;  4G7H F;  1ODD A;  4IXA A;  5E17 F;  4EM0 B;  4M6Y A;  3WTT C;  3FBI B;  3M7G A;  1G3W A;  2BBY A;  5H6Q A;  1V54 H;  2XAQ A;  2DMU A;  1UZC A;  1U9O A;  3OYE A;  1KGS A;  4RAF A;  4RBO A;  3HOT A;  5LHH A;  1KON A;  1Q1V A;  3GCM A;  4PJL A;  1EH7 A;  3LA2 A;  2M0C A;  1CQT A;  4JQF A;  4M9Z A;  4DNC A;  2BEO A;  2LKS A;  1V4R A;  1ETO A;  5CVI A;  1VQ6 I;  3Q3S A;  4G8X A;  3FXL A;  2JRT A;  4PJM A;  1DP7 P;  1ZKG A;  2CFX A;  3BG6 A;  2CWE A;  4WXH A;  2EFN A;  1K7A A;  1T33 A;  2K5C A;  5LGT A;  2ZNZ A;  3I56 I;  5F0F A;  4AVZ A;  2R7R A;  3I71 A;  4FE7 A;  5FKK A;  4Y7N J;  4YFN F;  2XV4 S;  3C18 A;  1ZG5 A;  2LK2 A;  2V9P A;  1LEA A;  4Y33 A;  1QPM A;  2A69 F;  1XS9 A;  2OCC H;  3A01 B;  3CC7 I;  4MEX F;  2XSJ C;  2JZY A;  1MMS A;  2DQL A;  2LF7 A;  2LR8 A;  2ESH A;  3ABU A;  3HKZ N;  5BPI A;  3DBH B;  2D45 A;  2VQL A;  1ZTR A;  4HEA 2;  3CCR I;  1U0J A;  1ACI A;  3CCQ I;  4HNU A;  3TW6 A;  2DA4 A;  1U5T C;  3WTV C;  2QCO A;  3EYI A;  3BTJ A;  4I7H A;  4PSW A;  1O3R A;  2XGC A;  1TQP A;  1OJL A;  2LBF B;  2MA3 A;  3TBI A;  3ML6 A;  4C3H J;  3KET A;  1LPQ A;  4E7I A;  1VQ9 I;  2FE3 A;  2RVC A;  3DWL E;  3K2Z A;  3OYH A;  3G6E I;  2KP6 A;  1WJ5 A;  2R7T A;  3U1K A;  2V1X A;  1R7J A;  4KN4 X;  2XVC A;  3TQN A;  4U7B A;  4IRH A;  3EUA A;  2CQN A;  2VJ4 A;  1ERD A;  5F0C A;  1YX5 A;  3S32 A;  4DZP A;  1FPQ A;  3OL3 A;  1QU3 A;  1XCB A;  3IH3 A;  3IL2 A;  4E7K A;  2DJN A;  5DYM A;  3BR0 A;  4XK4 A;  3DBL B;  1UST A;  1OR7 A;  1IRF A;  2R4G A;  3MKL A;  4KT6 A;  5KK1 A;  1J9I A;  4WCG A;  4D9J A;  4NHJ A;  5KHD A;  5ILV A;  4U88 A;  4AIH A;  1ZR4 A;  1X1D A;  2OTL I;  4ZDL A;  2NOG A;  2R3S A;  1B59 A;  3OL4 A;  2EA4 A;  2UXX A;  2JA2 A;  4EJW A;  1TW2 A;  4G7Z F;  3CCL I;  5J3L A;  2EFP A;  1VF9 A;  2XAJ A;  3ECH A;  3F9K A;  4BHC A;  5ILU A;  5KNL A;  2JSP A;  1YTY A;  1WFX A;  5J6X A;  1BOB A;  4A3D J;  1E17 A;  4EM2 A;  4C30 A;  5D5X B;  2NVY J;  3AFH A;  3TGN A;  2B9S A;  3IAS 2;  5L3F A;  1LDK B;  3BR6 A;  4CYC B;  1WH7 A;  2E5N A;  3K4J A;  2L9R A;  2MD5 A;  3T8T A;  4D5C A;  1GXP A;  1SVO A;  2QEX I;  1W7P A;  2OUM A;  2R7X A;  3QOE A;  4H0E A;  3BPX A;  2OF7 A;  2X85 A;  2A6T A;  3OR2 C;  4LB5 A;  1HW1 A;  3AG4 H;  1X1B A;  3PNV A;  5D5U B;  2K7L A;  2IGO A;  2ADU A;  2FMY A;  1G4D A;  4NNJ A;  3BJA A;  2HVS A;  4G9Y A;  3LL7 A;  3CMM A;  3I59 A;  4KMF A;  4GCV A;  1WJE A;  2FOW A;  1WQ2 A;  2Y9Y A;  3RQI A;  1HF0 A;  2PJR B;  2GIV A;  1JT6 A;  3SXY A;  3CUQ C;  1BR2 A;  2DOE A;  2B0L A;  1OCP A;  4HW0 A;  1QPI A;  1FTZ A;  2HNH A;  1D5Y A;  1W7P B;  3PFI A;  4U0Y A;  1JE8 A;  1X1A A;  2NRA C;  2K02 A;  4L0Y B;  2O03 A;  2OU2 A;  3H0G J;  1XSV A;  2MLG A;  3KLN A;  1O3S A;  2W00 A;  1FEX A;  2TDX A;  4DYC A;  4M72 A;  4L9N A;  4M74 A;  4MNU A;  2HQN A;  2XAS A;  2F5F A;  5CKT A;  1AKH A;  1TNS A;  1OCT C;  1XDS A;  3DCF A;  1Z77 A;  4N4O B;  5IT3 A;  2WAD A;  2BYV E;  2STW A;  1ETK A;  5JFR A;  2XPU A;  3O8H A;  5D8K B;  3GEZ A;  1XCV A;  1IG7 A;  1I5Z A;  3OYD A;  3H0D A;  4KYW A;  1LDD A;  1SAU A;  5M3M J;  1VQM I;  2I10 A;  4A3C J;  4E7L A;  3OYL A;  4XKC A;  1QGP A;  2HVQ A;  1NG7 A;  4FX0 A;  1PVE A;  2BHY A;  1R1U A;  2R7D A;  2OQG A;  4KN7 X;  3CUO A;  4XLE A;  3UR3 C;  5BMZ A;  2F5V A;  4B8X A;  3CD6 I;  1UMQ A;  3S17 J;  5D4R A;  1UHM A;  5DUI A;  3FWE A;  3SZT A;  5D8L B;  4CZC A;  3TO6 A;  3KCC A;  2M7A A;  1L3L A;  5IOY A;  4IRG A;  1H9T A;  1SAX A;  3HUG A;  3V42 A;  1KQ9 A;  1F9N A;  2QKL B;  2RNG A;  2R92 J;  2BGC A;  3FXJ A;  1W4M A;  4OIQ F;  1A36 A;  2HTJ A;  4UUV A;  1YFH A;  2EV0 A;  1VFC A;  4A3G J;  4D5F A;  5CQE A;  3L1P A;  4FX4 A;  2VT3 A;  1ZLJ A;  5KAI C;  2ZJQ F;  3F3X A;  4A3J J;  2X1D A;  3DTE A;  4HOB A;  3A02 A;  2OAZ A;  1SD6 A;  4X6A J;  4BQQ A;  2LKP A;  3S1N J;  2DTR A;  1I39 A;  2TRT A;  1R5H A;  3F8F A;  3CDH A;  1GV5 A;  3WG7 H;  2VLA A;  2KJC A;  3K6G A;  4R1H A;  1B8I B;  1EA3 A;  2O6G E;  2P4W A;  5A2Q Z;  3CCS I;  5J8F A;  2VI6 A;  5HS9 A;  3A0B C;  2HVR A;  2BY2 A;  4RB1 A;  2A5W A;  1XGS A;  3C3W A;  3TKY A;  3U1D A;  4PFO A;  1H8A C;  5K5Q A;  2QSH X;  4ZYG A;  3KP7 A;  3AAF A;  3S15 J;  3IRQ A;  3ZQH A;  1WJB A;  3IKT A;  3B6A A;  2HYF A;  2QSG X;  2F48 A;  2XHK A;  3ZMZ A;  4B44 A;  5J4V A;  1B8I A;  3EUK L;  3HOS A;  2VE9 A;  5JI6 A;  2BVM A;  4EM1 A;  1B1B A;  3ZMV A;  3WGI A;  3FBN B;  3D0S A;  3GYH X;  1FC3 A;  1YRN A;  2X6Y A;  4IPA A;  1RNL A;  2QBY A;  1R00 A;  3K7A J;  1YOV B;  2RDP A;  4XON A;  3DFG A;  4D1Q A;  4DIQ A;  1OYI A;  4YII A;  4I01 A;  4LFU A;  4BH9 A;  2TCT A;  2KPM A;  4G6Q A;  4IJA A;  2HYG D;  4DQ2 A;  1S9H A;  2H27 A;  4O3M A;  4JX5 A;  4UVB A;  1D0Y A;  2K40 A;  2L01 A;  3F21 A;  4Y3O A;  4RM3 A;  2M2E A;  4KIC A;  5B66 C;  1VTN C;  3FXU A;  2HPM A;  3J80 Z;  3BT9 A;  5E79 C;  4OIP F;  4M3B A;  4W97 A;  2ICW G;  1A31 A;  4XKV A;  4DYQ A;  2DK8 A;  4BDY A;  4UV8 A;  4A0Y A;  4BAY A;  3CO7 C;  2EIJ H;  1YG2 A;  3H3V K;  4BU2 A;  2Z2S B;  2KDO A;  2LD5 A;  1W0U A;  1RET A;  1MIJ A;  2KL4 A;  2QQ8 A;  5LBQ A;  1IN4 A;  3BPV A;  2QSF X;  5J1R A;  2PBI A;  3ZCO A;  1J59 A;  3K9T A;  2M8G X;  2YPR A;  2OA4 A;  1RI7 A;  4ZZL A;  1V55 H;  2O3F A;  2VOO A;  2LBF A;  2RC4 A;  3I9V 2;  1KYW A;  2HWV A;  1RKT A;  3WTU C;  4N0B A;  2CSO A;  2M1B A;  4HX8 A;  1GLN A;  4EJU A;  2OCE A;  4G6T B;  4ZDP A;  2KMU A;  5IYB J;  3F8M A;  1J09 A;  2DYR H;  4I09 A;  2LDU A;  3K1P A;  2DA2 A;  2E5Z A;  3L2C A;  4HAM A;  2R7U A;  3VSK A;  5JLW A;  3HOY J;  4HZF A;  1QNT A;  3D5L A;  1LE8 B;  3HRM A;  4IHT A;  3V8L A;  4LOC A;  2FX0 A;  4EJV A;  1WWX A;  1EKE A;  3HEF A;  2WY7 Q;  1R71 A;  2IVM A;  1KQ0 A;  3VYT B;  3MD2 A;  2PX9 A;  2R5Y A;  5IYD J;  2V1N A;  3RKX A;  4CA0 A;  4UNO A;  1FLI A;  3BR2 A;  4PK4 A;  2AQE A;  3TL4 X;  2NNN A;  4XM3 A;  2E1N A;  2A05 A;  1IN8 A;  4M9S A;  3OYJ A;  2Y0S A;  1DUX C;  3J7A O;  1FWZ A;  2X6X A;  5EZG A;  3JSO A;  1S72 I;  3NAR A;  3OYC A;  3L7W A;  3MAJ A;  5LEK A;  2DA6 A;  2VQH A;  5FD5 A;  3CF2 A;  4A3K J;  2FEZ A;  1MH3 A;  2JJ7 A;  1T6S A;  1BC7 C;  4FAS D;  2BXZ A;  2EFQ A;  1MND A;  3KYC B;  1APL C;  2C6Y A;  2Y2Z A;  2RRE A;  4JX4 A;  2P7C B;  1SFU A;  2BHZ A;  1ZYR F;  5LHI A;  2P5K A;  1IUY A;  1ON2 A;  3RKQ A;  3RYR A;  3CLQ A;  5H2F C;  1T2K A;  1QVU A;  3AG3 H;  1YYV A;  1VQ5 I;  1SVM A;  2GAU A;  1T0F C;  5HLT A;  2MW8 A;  1IV6 A;  1YIT I;  1O3T A;  4BL0 B;  4IQ4 A;  3BJO A;  1MJ9 A;  4IOA F;  4A3B J;  1P4A A;  3VYR B;  3R6S A;  2JN6 A;  2KIQ A;  3VDX A;  3J81 Z;  2F6C A;  2V9K A;  2IS6 A;  2I5U A;  1TWH J;  4F55 A;  1RKW A;  1Z21 A;  1LFU P;  2ZKZ A;  2V1D A;  1F43 A;  5BNG A;  4WF2 A;  4CCN A;  1XMA A;  3GFJ A;  1Y6I A;  2G0E A;  4IF4 A;  5C44 J;  1IGN A;  1X19 A;  1MKM A;  3BCB A;  1MBH A;  4EMS A;  2B7E A;  1VQP I;  1JXS A;  2ELH A;  1J2X A;  5F6F A;  4KIF A;  4BS9 A;  4ENM A;  4B1R A;  2JMW A;  1ZHF A;  2PMZ A;  3GTQ J;  1XB4 A;  3DP7 A;  4A0X A;  4AIK A;  3E3V A;  4OAZ A;  2GQQ A;  4JOM A;  1Z05 A;  4NQW A;  3LSK A;  2J5P A;  2N8G A;  1XD7 A;  2VKH A;  4Q5S F;  3CCV I;  3HIF A;  3JR9 A;  2L02 A;  5FKN A;  4P55 A;  3E6D A;  1MBK A;  1BI3 A;  3Q9V A;  4BKX A;  3I4N J;  2KIM A;  3L09 A;  4EAT A;  4IEJ A;  3HUG B;  2V6E A;  1YIJ I;  1MZB A;  2EPF A;  5JHU A;  4RAY A;  1MBF A;  4XLH A;  2BE5 F;  3F0C A;  3GTL J;  2XF7 A;  5JR3 A;  1RIO H;  1Z0X A;  1QHH D;  2HI3 A;  4NQW B;  4HDV A;  2UWM A;  2E1M B;  3RPU A;  4M6X A;  1T39 A;  1R4M B;  3C2H A;  1HA8 A;  3FMQ A;  1UG0 A;  4UB6 C;  4XOR A;  3VWB A;  1IRX A;  3I54 A;  2V9V A;  3LSG A;  3A01 A;  1WGX A;  2IP2 A;  3H5A A;  3RJP A;  2DMN A;  2QKM B;  5L3B A;  5GAG J;  2IAI A;  2IT0 A;  2R5Z A;  1U8B A;  2EZL A;  1D0Z A;  4YFX F;  1USS A;  2ELK A;  5FLX K;  3U21 A;  1HW2 A;  4XRF A;  1V5F A;  1FX7 A;  4ITV A;  3OYA A;  1Y8Q B;  4AM3 A;  2Y9Z A;  4GYI A;  2O8K A;  3G1O A;  3CMY A;  2HZD A;  3ZXS A;  2K86 A;  4C9Y A;  2LYC A;  2RNJ A;  2ZFU A;  1LUJ B;  1RUO A;  3VPR A;  2MSY A;  3ZMD A;  1NK2 P;  3TED A;  1I27 A;  4HV6 A;  1LFB A;  2CG4 A;  3HOW J;  5FFX A;  1YW9 A;  2HQR A;  3CDI A;  1P7J A;  4XMY A;  2HOE A;  2D1V A;  3HOX J;  2IS4 A;  3KP2 A;  4HX4 A;  1MJA A;  3IAM 2;  4CGZ A;  2F5C A;  3L2Q A;  1T56 A;  1RC9 A;  4B3A A;  3GTJ J;  2ZCW A;  3PNT A;  2ZME C;  3W3C A;  2OQR A;  3DXJ F;  3H9Q A;  1IXS B;  1G8X A;  4CIC A;  1UHW A;  4J01 A;  1JUS A;  3KIO A;  2HR3 A;  4L0Z B;  2GM4 A;  4LB6 B;  3BWG A;  1HCR A;  1D1A A;  4J00 A;  5HDK A;  2CO5 A;  1X3W B;  1JJ8 C;  5DS9 A;  3R61 A;  3JAM K;  1KU7 A;  5J8C A;  2GXG A;  1YI2 I;  5BPD A;  2H1K A;  1BI1 A;  1OKR A;  2JTV A;  1Z3Y A;  1BM9 A; 
#chains in the Genus database with same CATH homology
 3BR0 A;  4L5E A;  4IHW A;  4XK4 A;  4C2M J;  5IPA A;  3QPS A;  3FK6 A;  2JWT A;  2FJ1 A;  3MKL A;  2HOT A;  2DMT A;  2L7M P;  4BBS J;  1ZR4 A;  2EH3 A;  5GP9 A;  5E3N A;  2NOG A;  2E2I J;  2K9Q A;  1POG A;  2O9L A;  2XB5 A;  3D1N I;  2L7Z A;  2RAE A;  4IHY A;  4GFB A;  5J3L A;  1VF9 A;  1MBG A;  4A3D J;  4C3J J;  2NVY J;  3ZOB A;  4RDU A;  1ETQ A;  4V2F A;  1WCM J;  5IYC J;  4DYR A;  1PUF B;  3BR6 A;  1IDY A;  3JRC A;  2ECC A;  2JA8 J;  4CYC B;  3S1M J;  1X2M A;  1WH7 A;  5J1U A;  4UUS A;  1GVD A;  2E2J J;  2L9R A;  4D5C A;  3HDD A;  5EF6 A;  1ETV A;  2OF7 A;  3HB9 A;  1QRY A;  2KT0 A;  5M5W J;  3ZQG A;  5E3L A;  5EDN A;  2DTZ A;  5K7H A;  3Q0U A;  1WH5 A;  3CDL A;  1HF0 A;  2Y9Y A;  3RQI A;  3BR5 A;  1MSF C;  1JT6 A;  2MG4 A;  1JKP C;  1OCP A;  1QPI A;  1FTZ A;  2HOS A;  3G1M A;  1LE8 A;  3FKI J;  1D5Y A;  4A93 J;  4IHX A;  1I6H J;  3H0G J;  3BG9 A;  2KDZ A;  4I76 A;  1FEX A;  4DYC A;  3JRI A;  4M3F A;  3K2A A;  3GTO J;  1RPW A;  4A3I J;  1AKH A;  2XSD C;  2X6O A;  5FKL A;  1OCT C;  3DCF A;  3IH2 A;  1Z77 A;  3HOZ J;  1ETK A;  3ZQC A;  2XPU A;  3O8H A;  2EZH A;  1IG7 A;  4ABZ A;  5M3M J;  1GUU A;  2I10 A;  4A3C J;  2K9N A;  1JUP A;  2HDD A;  4BBR J;  4W1U A;  3JRA A;  1U9N A;  2M34 A;  1A6I A;  2FQ4 A;  1UMQ A;  2AO9 A;  5E3O A;  5EG0 B;  2HOA A;  2HYJ A;  3S17 J;  3IH4 A;  4NDL A;  5IOY A;  3JRB A;  1GDT A;  1JT0 A;  3GTG J;  3O8G A;  3BTL A;  2CQX A;  2R92 J;  4FTH A;  2R93 J;  4Y52 J;  1JKO C;  3BTC A;  2ID6 A;  1IRZ A;  2XB0 X;  3JRG A;  4A69 C;  1VFC A;  4D5F A;  4A3G J;  3L1P A;  2H8R A;  9ANT A;  3BQZ A;  3C2B A;  1JGG A;  1AKH B;  4A3J J;  2DMP A;  5F0H A;  2E1O A;  2VKE A;  3A02 A;  5FJ8 J;  3PO2 J;  5FLM J;  4X6A J;  3OSG A;  5K7Z A;  4V2G A;  3WHB A;  3S1N J;  2TRT A;  4MFD A;  1IC8 A;  1GV5 A;  1B8I B;  1BW6 A;  2WB1 N;  1ETY A;  3CCY A;  2K9S A;  2VI6 A;  1BW5 A;  3BQY A;  1H8A C;  1HDP A;  4XRS G;  3S15 J;  1GT0 C;  3I4M J;  1UG2 A;  5F27 A;  3ZQH A;  3B6A A;  1SAN A;  1JKQ C;  2Y0S N;  4A3E J;  3CQZ J;  1B8I A;  1HDD C;  3S2D J;  3QQA A;  2GBY A;  2ME0 A;  2R5Y B;  5IP7 J;  1IUF A;  1YRN A;  1F36 A;  1MH4 A;  1P7I A;  4XRS A;  3K7A J;  2IBD A;  1MBE A;  2MGQ A;  3FIW A;  3FK7 A;  2LLK A;  2P81 A;  5M5X J;  3RZO J;  3QPL A;  3IV5 A;  5C4X J;  2YUS A;  2XRL A;  2Y31 A;  4BY7 J;  1I3Q J;  2TCT A;  1TWC J;  5K7F A;  4A3F J;  4B4C A;  1YRN B;  1QVT A;  4JX5 A;  2K40 A;  2M2E A;  1GV2 A;  4M6V A;  2VPR A;  4S0H B;  3S1Q J;  3BT9 A;  4QIW N;  2L0K A;  4M3B A;  4W97 A;  3SDG A;  3JRE A;  4DYQ A;  3S16 J;  1MBJ A;  2VUM J;  3HOU J;  5C3E J;  3H3V K;  1JTY A;  1RES A;  3TP0 A;  2LD5 A;  1W0U A;  1IDZ A;  1RET A;  5IP9 J;  3OOU A;  4IHV A;  2XGD A;  1DU0 A;  5J1R A;  1FTT A;  2DMQ A;  4UUT A;  4UUS B;  1BJZ A;  2PMZ N;  5FKO A;  3HM5 A;  4D7M A;  2M8G X;  3BG3 A;  5M3F J;  2E19 A;  3LSR A;  3NAU A;  2CUF A;  5FLV A;  3PO3 J;  3TP3 A;  3JRF A;  1XC5 A;  3LNQ A;  3WHC A;  1U78 A;  2ECB A;  1RKT A;  5F08 A;  2NS8 A;  3BR1 A;  5DTD A;  4DZJ A;  1FIP A;  4MFE A;  2XPV A;  1Y1W J;  5JLX A;  5IYB J;  4XIC A;  4QSH A;  3GTM J;  2X9D A;  2DA3 A;  4JX6 A;  1JKR C;  1B72 A;  2DA2 A;  4AYB N;  5JLW A;  1HLV A;  3HOY J;  1FIA A;  1LE8 B;  3JRH A;  3PM1 A;  3HOV J;  4LOC A;  2FX0 A;  3W6V A;  1ITY A;  3HEF A;  4EEF G;  4G12 A;  2LY9 A;  4A3L J;  2CQQ A;  2R5Y A;  5IYD J;  2AHQ A;  3Q0V A;  1ZK8 A;  3BR2 A;  2EZK A;  5C4J J;  3TW7 A;  1O4X A;  3DEW A;  4A3M J;  1ZR2 A;  3A03 A;  4M3D A;  2E2H J;  2JA5 J;  5EEA A;  1WI3 A;  1W0T A;  1JTX A;  1I50 J;  5EZG A;  5HOD A;  3NAR A;  2LKX A;  2HXI A;  1TWA J;  2D5V A;  2DA6 A;  1FJL A;  4A3K J;  2HXO A;  2EBI A;  1MH3 A;  3B6C A;  2JJ7 A;  5E3M A;  4MO7 A;  1VI0 A;  2WV1 A;  5M5Y J;  1APL C;  2Y2Z A;  4I6Z A;  3E7L A;  3HGG A;  4JX4 A;  5IP6 A;  1ZQ3 P;  4MIM A;  2JA6 J;  5EGO A;  3SFI A;  3OSF A;  3GBG A;  1IJW C;  2R7Z J;  1K83 J;  4M3G A;  1H88 C;  1NK3 P;  2DA5 A;  2R0Q C;  3RKQ A;  1PUF A;  1E3O C;  2M9H A;  4JYK A;  3MN2 A;  4M3E A;  1QVU A;  1ZGW A;  1TWF J;  1JJ6 C;  1UHS A;  2FD5 A;  3OIO A;  4QTR A;  1RR7 A;  2WAQ N;  2MW8 A;  1IV6 A;  3ZQL A;  5GPC A;  1BL0 A;  4A3B J;  3S2H J;  3LSJ A;  5EGO B;  2JN6 A;  4J19 A;  1TWH J;  1WPK A;  2JA7 J;  1RKW A;  1LFU P;  4JP0 A;  1TWG J;  2DA1 A;  5EG0 A;  1F43 A;  5BNG A;  1EF4 A;  5FKM A;  4XRM A;  2G0E A;  5C44 J;  1IGN A;  2CUE A;  1MBH A;  3G1L A;  5GPA A;  3HBL A;  4FCY A;  2COB A;  4AUX A;  3FIS A;  2R5Z B;  2ME6 A;  4X1E A;  2JMW A;  4B1R A;  2W48 A;  1AU7 A;  2IEK A;  2XGE A;  3GTQ J;  2CU7 A;  1R9T J;  1G2H A;  3S14 J;  2DN0 A;  2B63 J;  3BTI A;  1X58 A;  2NVQ J;  1A5J A;  1S7E A;  2N8G A;  1DU6 A;  2LP0 A;  1H89 C;  3GTK J;  3JR9 A;  5FKN A;  1MBK A;  4D7N A;  2EQR A;  4BKX A;  3I4N J;  1X2N A;  4IEJ A;  2DMU A;  1VND A;  1U9O A;  1MBF A;  4RBO A;  2LFB A;  3RZD J;  1Q1V A;  3F0C A;  3S1R J;  3GTL J;  2M0C A;  1JUM A;  1Z0X A;  1CQT A;  1MNM C;  2HI3 A;  1NTC A;  4FE4 A;  1ETO A;  3ZQF A;  4AC0 A;  4DW6 A;  3Q3S A;  1SFO J;  1ZKG A;  2JK3 A;  3BG5 A;  3LSG A;  3A01 A;  4HNV A;  1WGX A;  1T33 A;  1MSE C;  3JRD A;  3MVP A;  2X48 A;  5F0F A;  2DMN A;  5EYR A;  1ENH A;  2IAI A;  3BR3 A;  2YS9 A;  2R5Z A;  2EZL A;  1U8B A;  2VKV A;  3GTP J;  2NS7 A;  2GLO A;  2ELK A;  4FE7 A;  5FKK A;  4Y7N J;  4BXX J;  4MLO A;  5EZH A;  4FIS A;  2LK2 A;  3LSP A;  2YU9 J;  1ETW A;  1XS9 A;  1K61 A;  3A01 B;  2Y9Z A;  2EZI A;  2NVX J;  3ZQI A;  3G1O A;  3CMY A;  2O8K A;  4BY1 J;  2LR8 A;  2HQ5 A;  2O7O A;  3HKZ N;  3VPR A;  1ZTR A;  2LVS A;  2MSY A;  2XPW A;  3HGY A;  1NK2 P;  3TED A;  5IOZ A;  1LFB A;  3TW6 A;  3HOW J;  2DA4 A;  2L7F P;  2QCO A;  3BTJ A;  1P7J A;  2OPT A;  2XGC A;  1OFC X;  3HOX J;  2CRG A;  2LTP A;  1OJL A;  1B72 B;  1ORK A;  1T56 A;  4C3H J;  4B3A A;  4C3I J;  3GTJ J;  2QF7 A;  2DA7 A;  2NVT J;  1BA5 A;  5F1J A;  2ID3 A;  1JUS A;  4CYC A;  1XG1 A;  3M4O J;  2GM4 A;  1HOM A;  1HCR A;  2ZB9 A;  3UKG A;  1AHD P;  5F04 A;  2CJJ A;  1JJ8 C;  5DS9 A;  3LOC A;  5J1Y A;  5F0C A;  4DZP A;  4XID A;  3M3Y J;  2H1K A;  1TC3 C;  1ETX A;  2Y30 A;  3Q0W A;  3IH3 A;  2DJN A;  1Y1V J;  3SJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...