4BXXJ

Arrested rna polymerase ii-bye1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4bxxJ00
2HI3A 2WV1A 1LE8A 2NVTJ 1PUFB 4MIMA 2XB0X 1MBEA 1W0TA 3IH4A 5K7FA 2DA4A 1Y1VJ 2O9LA 1HCRA 3A03A 1A6IA 2R5ZB 3GTLJ 1U78A 5M3MJ 4CYCA 3ZOBA 2LLKA 4DYCA 4Y52J 4A3BJ 1WPKA 3ZQCA 3HBLA 1QVUA 2JN6A 4XRSA 2E19A 2XPVA 2GM4A 3S1QJ 3Q0WA 3BQYA 2JA8J 2TRTA 1IUFA 2B63J 2DN0A 4S0HB 1T33A 1ETOA 1MBHA 2ECCA 2MSYA 3S1MJ 2NVYJ 5C3EJ 2EBIA 2D5VA 1K83J 4G12A 2K9NA 1B8IB 1ETKA 5FKMA 3BTJA 3A01A 3H3VK 5F27A 2K9SA 1ETYA 2AO9A 3PO2J 2DA5A 1FTZA 5IP6A 3LOCA 1QVTA 2CRGA 3HOYJ 3HDDA 3JRHA 2DMNA 3RKQA 2E2JJ 3JRDA 4UUSA 1R9TJ 1H89C 1JT0A 5IP7J 1APLC 2GBYA 3FK6A 5EDNA 4RBOA 1GV5A 2H1KA 2XSDC 2IBDA 2GLOA 4M3DA 2R5YA 4C3IJ 4DZPA 4XRMA 1TWAJ 2L7FP 3BTIA 3FK7A 3LSRA 2VPRA 3K2AA 3FISA 1IGNA 4IHYA 3RZDJ 2ID3A 5C44J 3S14J 3S2HJ 2VKVA 4A3FJ 3LSJA 5EEAA 1ZK8A 3QPLA 1IG7A 2X9DA 2FD5A 5IOZA 2NVQJ 1FTTA 3IH3A 1U8BA 3TW6A 2R92J 3S16J 5IYDJ 5C4JJ 1TWHJ 5J1YA 2DMPA 1OCTC 1YRNB 2Y9ZA 2NOGA 2WB1N 1Y1WJ 3TP3A 2CQXA 3CDLA 4JYKA 3WHCA 3I4MJ 2DA6A 3ZQLA 1K61A 1NK3P 4XICA 2R5ZA 4DZJA 1F36A 3RQIA 3SDGA 1D5YA 1RESA 3FIWA 2LR8A 3W6VA 2HYJA 1GDTA 1WH5A 5HODA 2VI6A 1RR7A 3DEWA 1AU7A 2JA5J 5F08A 1DU6A 4MFDA 4QIWN 1WGXA 1UMQA 4A3JJ 1JUPA 1OCPA 1B8IA 2NVXJ 2Y2ZA 1GUUA 1P7JA 5EZHA 2NS8A 2TCTA 4JX6A 5BNGA 1ETQA 2QCOA 2XGCA 1IV6A 2YUSA 1RKTA 2XGDA 3MKLA 1OJLA 4X1EA 2QF7A 4UUTA 5F0HA 3HEFA 3L1PA 5FKKA 5E3NA 2N8GA 1RPWA 3LSGA 5FKOA 1WH7A 4ABZA 3JRGA 1JJ8C 1I50J 2L9RA 2LTPA 1RKWA 5M5XJ 3CMYA 1G2HA 2DJNA 2DMQA 4XIDA 4FISA 1U9OA 4A3GJ 3S1NJ 4NDLA 5FJ8J 2VUMJ 1MBKA 4V2FA 3MVPA 2LP0A 3QQAA 3H0GJ 4RDUA 1BJZA 2FJ1A 3OSFA 3Q0UA 1O4XA 4X6AJ 1E3OC 3BT9A 1TC3C 5GPCA 4IEJA 4MFEA 1JGGA 5E3OA 1Z0XA 3HGGA 4L5EA 4D5CA 5J3LA 5M3FJ 1XG1A 1YRNA 4A3CJ 4QTRA 1MH4A 1MNMC 1ZTRA 2M8GX 2E2HJ 4Y7NJ 4A3DJ 3BR1A 3Q0VA 1ZGWA 1JKRC 2DMTA 2HOTA 4A3MJ 2O7OA 1X58A 2EZLA 2HXIA 3UKGA 1MSEC 2DA3A 3BR0A 5GP9A 4A69C 3HOVJ 1CQTA 4I6ZA 3S2DJ 3IH2A 3JRIA 4W97A 1FEXA 5IOYA 1ETWA 5F0FA 1FIAA 3PM1A 4BKXA 4DYQA 3HOUJ 2EH3A 1TWGJ 1AKHA 2KT0A 2LFBA 1ENHA 4IHWA 3HOWJ 4C3HJ 5FLMJ 1ITYA 5FLVA 2JA6J 3MN2A 1IDYA 1MH3A 2FX0A 2JWTA 3BR5A 1HOMA 1LE8B 3BTLA 1JKPC 1JKOC 5IP9J 3GTMJ 2Y0SN 2M2EA 3CQZJ 1PUFA 2R7ZJ 2JMWA 2EZKA 1VNDA 3S15J 4M6VA 1IDZA 1ZKGA 4XK4A 3D1NI 5JLXA 2R0QC 5F1JA 1DU0A 2DTZA 2XPWA 3HGYA 1B72B 1GV2A 3OIOA 2HOSA 1SANA 1XC5A 1JKQC 5M5WJ 3C2BA 2L0KA 3S17J 1S7EA 2L7ZA 2HOAA 2MG4A 3NARA 5F0CA 2EZHA 2JA7J 5EZGA 2E2IJ 5EGOB 3I4NJ 4XRSG 1GT0C 3ZQIA 1T56A 4A3KJ 3JRFA 2X6OA 5F04A 4M3EA 2ME0A 3BG3A 4JX4A 3JRBA 3F0CA 2M0CA 3SJMA 5DS9A 2ZB9A 5GPAA 3GBGA 2O8KA 1JJ6C 4AYBN 3GTJJ 1EF4A 4BY7J 3O8GA 1F43A 3GTKJ 1UHSA 5K7HA 1MBJA 1ZQ3P 1HDPA 2G0EA 3BQZA 2ECBA 4A3IJ 4IHXA 1P7IA 2FQ4A 3O8HA 3TEDA 2JJ7A 2XGEA 1JTXA 3G1MA 1JUSA 3WHBA 4D7NA 3E7LA 3JRAA 4IHVA 2MW8A 2L7MP 2HQ5A 3NAUA 5C4XJ 2CU7A 2HXOA 2WAQN 5J1UA 1A5JA 2M9HA 4C3JJ 3OSGA 3B6CA 5IYCJ 1BW5A 3GTOJ 2XB5A 3JR9A 1LFBA 2EQRA 2JK3A 3GTQJ 3HM5A 5JLWA 1H8AC 1RETA 1WCMJ 1OFCX 1I6HJ 5EYRA 4W1UA 2CUEA 2M34A 4GFBA 2K40A 1HF0A 2P81A 2CQQA 3ZQHA 4AC0A 9ANTA 2ID6A 4MO7A 4M3BA 4M3FA 2DMUA 4MLOA 1B72A 2PMZN 3GTPJ 3M4OJ 5E3MA 3M3YJ 3ZQFA 2LKXA 1H88C 3HKZN 2X48A 2LD5A 2RAEA 4B4CA 4EEFG 1VF9A 4FE4A 3IV5A 4A3LJ 3JRCA 4V2GA 2YU9J 5EGOA 1NK2P 2IAIA 1UG2A 1JTYA 3K7AJ 4DW6A 5M5YJ 2E1OA 4J19A 4D7MA 1W0UA 5DTDA 1IJWC 3BG5A 2DA7A 5EG0B 2K9QA 2OPTA 4LOCA 3BG9A 1MBGA 1POGA 2COBA 1FJLA 3OOUA 2DA1A 3HB9A 4BBSJ 3S1RJ 4A93J 4M3GA 5IPAA 1NTCA 2KDZA 1X2MA 2H8RA 1FIPA 2YS9A 1ZR2A 4JP0A 1MSFC 4CYCB 3DCFA 4JX5A 3TP0A 4AUXA 5EF6A 4B3AA 5FKLA 2LVSA 2AHQA 1BW6A 1HLVA 3QPSA 3SFIA 4D5FA 3B6AA 2MGQA 3ZQGA 3HOZJ 1JT6A 5K7ZA 1IC8A 1ETXA 1MBFA 3A02A 2XRLA 1I3QJ 4FCYA 1WI3A 2Y30A 2ELKA 3LNQA 3BR2A 1BA5A 3VPRA 4DYRA 1SFOJ 2VKEA 2EZIA 2DA2A 2OF7A 4BBRJ 2I10A 1XS9A 1ORKA 1GVDA 5E3LA 3A01B 4FTHA 1Q1VA 2CUFA 3BTCA 2Y9YA 2CJJA 1VFCA 2ME6A 3CCYA 1U9NA 2IEKA 1ZR4A 3TW7A 3G1OA 2Y31A 3BR6A 3BR3A 4UUSB 3HOXJ 2R93J 1TWFJ 1HDDC 1Z77A 3Q3SA 2XPUA 4HNVA 4A3EJ 4I76A 1BL0A 3G1LA 1X2NA 1LFUP 2R5YB 1JUMA 1QRYA 1AKHB 3FKIJ 1VI0A 4FE7A 2NS7A 4QSHA 5FKNA 3JREA 4B1RA 3LSPA 5J1RA 5IYBJ 3PO3J 5EG0A 2LK2A 4BXXJ 1QPIA 1IRZA 1AHDP 3GTGJ 1TWCJ 2LY9A 3RZOJ 4C2MJ 2W48A 4BY1J 2HDDA 1ETVA
chains in the Genus database with same CATH superfamily
1YQAA 4PZJA 1LE8A 4BYYA 4XQFA 3MEXA 1FBUA 4UB6C 3IH4A 3HRSA 2O9LA 1MJAA 3SZGA 2E1MC 1QHGA 3WTUC 3A03A 2O8XA 1WJCA 3GTLJ 1MW7A 4YFNF 1R58A 1HW2A 4HLXA 4ZTFA 1BOAA 3ZOBA 1R00A 5BPDA 2CQKA 1Z6TA 2LG4A 3NRVA 2E7XA 2E60A 2XPVA 3MWMA 2EK5A 2FQ3A 3EUHC 1OYIA 3SZTA 3S1QJ 2QQ8A 3RSNA 4NQWB 3IL2A 2HVQA 2UUZA 2QQAA 4HV5A 1P4WA 1EH8A 2RV8A 2KKOA 2BVLA 2ICWG 2XF7A 3ZP5A 1YIJI 3V8JA 2D5VA 4G12A 1VQ5I 2M4KA 3D5SC 1ETKA 3Q9SA 4A0ZA 4HBLA 2BXZA 1DP3A 2LYCA 4CGZA 2K9SA 4MTDA 4IZZA 5L3DA 2H1LA 2P5VA 2YX4A 3Q9VA 2CRGA 4A0YA 3HOYJ 1BC7C 4PFPA 1R36A 3HDDA 3JRHA 2DMNA 2HZTA 3DFGA 4JQFA 4ASNA 1R9TJ 2FU4A 1H89C 5IP7J 3H1CA 4LK1F 1APLC 2AQEA 2OAZA 3I55I 2V7FA 1U3EM 2A05A 4KIGA 3PQJA 2XSDC 2GLOA 4M3DA 2LDUA 2GOMA 3DBLB 2RC4A 5JR3A 2GOXB 4DZPA 4BHBA 3FK7A 3BTIA 5K5OA 2UWMA 4HA8A 4YRVA 5JI6A 2KIMA 5L3CA 2K5CA 1T0FC 1HKTA 2VKVA 4BHCA 2VKDA 4XORA 3L2QA 3QPLA 2R4GA 3C18A 2X9DA 3O3KA 5L3GA 2NVQJ 3IH3A 2R92J 3M1CA 2QVOA 3EETA 1CGPA 2DXIA 1YRNB 3ZR8X 3RTRA 2FBIA 3WHCA 2GXAA 1KONA 3ZQLA 1K61A 1E2XA 3N05A 3GFIA 2ZMEC 2LNBA 3RQIA 5LRSA 3SDGA 2P5KA 2GXBA 1EH6A 2QLZA 1RR8C 2BHYA 1P92A 3LAJA 1JE8A 3W6VA 1W4MA 3QU6A 3VDXA 2NRAC 3BC8A 4CZZA 5IT9K 1YO5C 1KA8A 1D0YA 3HL2A 4R1HA 2OJED 3DEWA 1PYVA 1R6RA 5LGNA 1AU7A 2JA5J 1RIOH 2XAGA 3I4PA 4KMUX 4RGUA 1ZG1A 4XKWA 2EV5A 1OCPA 4WXCA 4CCJA 1TT5B 4LJZF 1LEBA 1X3UA 5KK1A 3LFKA 3HRTA 2TCTA 2HFHA 4JX6A 3L00A 1D8JA 1ETQA 1ON1A 2XGCA 1RKTA 4O5VA 1OJLA 5KAFC 4X1EA 4UUTA 1X3WB 3HEFA 5FKKA 2BY3A 4S05A 2IXSA 5FKOA 1MDMA 1JJ8C 3CP2A 2VXZA 3DTEA 3CO6C 2LTPA 2M1BA 3ZMZA 1K79A 4M73A 3GUDA 3BROA 1G2HA 3NQOA 2ZSHB 5D5VB 4XNFA 1J59A 3S1NJ 2GAUA 2VUMJ 2P5LC 4JOMA 4HF0A 3VYRB 1OYYA 2QUFA 4V2FA 5FROA 5HVQC 2M7BA 2H8WA 5BOXA 2FJ1A 3OSFA 2Y0SA 2KMUA 1O4XA 4X6AJ 1XDSA 3OV8A 1E3OC 1TC3C 4U0VA 5D4SA 5E3OA 4IO9F 4D5CA 3HHGA 5J3LA 2WB1A 4BU2A 4UY8I 3LSTA 1UZCA 3I9V2 2KISA 1YRNA 2Z1DA 5BPIA 1MH4A 4F3QA 3CCUI 1U0JA 4P9FA 4A3DJ 3Q0VA 2VODA 3BZCA 2JPCA 4L9VA 2PN6A 3L9FA 1FLIA 2HKOA 3BZKA 4BEHB 1YJWI 4EM1A 1Z3YA 1ZRCA 2EZLA 2HXIA 4CA0A 1YJ9I 1SVOA 4WX9A 3ECOA 4EJTA 4PDKA 4FHTA 3HOVJ 1R5ID 3RYPA 5LEJA 2WBMA 4I6ZA 2KLOA 2LKSA 2LSOA 1BR2A 2H09A 3JRIA 4W97A 2O6GE 4EVIA 5IOYA 2Z99A 1ETWA 3B73A 4ESJA 5FO5A 3KPHA 2EIJH 2IP2A 4BKXA 2IA1A 1BI0A 4DYQA 3HOUJ 4KA4A 2LFBA 2VASA 1ITYA 3BJAA 3E5QA 1IN8A 1MH3A 1T08B 2FX0A 4IJAA 1HOMA 2B9SA 3PSFA 2BOLA 1MMAA 3BTLA 5FFXA 1JKPC 1JKOC 2IT0A 2Y0SN 1SD6A 1IRXA 1VQNI 2HQAA 2QGUA 2R7DA 1PUFA 4YEJA 4KJZA 5GAEJ 2FBHA 1U5TB 2A69F 1VQPI 2JMWA 3U9GA 2E1NA 2VQHA 4ZYGA 3S15J 3QWLA 4M6VA 3D1NI 4XK4A 2R0QC 3OY9A 1DU0A 1W5CC 3TKYA 3IRRA 3LA3A 3OIOA 2HOSA 3QOPA 2RQQA 1JKQC 3DTKA 1IW7F 4ZDLA 3KP4A 2COMA 2LBFB 2C6YA 1XMKA 2HOAA 1YE9A 2RKHA 1K6YA 2F5EA 4F55A 2E2IJ 5EGOB 3I58A 2E36A 2ZJQF 2F5DA 3ZPLA 3HYIA 3ZQIA 3PFYA 3JRFA 1ACIA 3MKZA 3KYCB 3QAHA 5E20A 2X6OA 5F04A 1YTYA 2ME0A 4JX4A 3TO7A 5CVJA 3CZ6A 1O3RA 3DPTA 3M7GA 2HQRA 3PL8A 5DS9A 3OR1C 5GPAA 4BEHA 3K4KA 3GTJJ 4MTEA 2K4BA 1ZRDA 1F43A 4R79A 1GXPA 1B9MA 1UHSA 2E1MB 5K7HA 1ZQ3P 2R7QA 3F72A 2ECBA 4A3IJ 3ZN1A 1R5HA 3TDZC 4G9YA 2XGEA 2BY2A 3G1MA 5HS9A 5TRDA 2DK8A 4HAMA 4IHVA 3E5XA 2FRHA 2A6TA 1QA6A 4ZYAA 2P7CB 1X3ZB 4RGRA 5J1UA 4UVCA 4GO1A 2KRCA 5E1XA 1A35A 2DW4A 5GAGJ 3H0DA 3U1DA 3T8RA 3JR9A 1DUXC 3CF2A 5F64A 3MD2A 4P9UA 3SHFA 3I56I 1YX5A 1IV8A 4RM3A 5J47A 4HQEA 2JK3A 2EPFA 2XRNA 1BI3A 3CJTB 3HM5A 3K4BA 3BPXA 5JLWA 1XTAA 2E71A 3GFLA 3F6OA 1WCMJ 3I53A 2RREA 1J5YA 3FBIB 1TBXA 4D1QA 2L01A 4B47A 3ZRGA 2IGMA 2LH9A 1D0ZA 2PQ8A 4RB2C 4BE2A 4MO7A 3J7ZI 1Z7UA 4JBAA 5H6QA 1DGRM 1KU3A 3TOAA 5DYMA 4DGWB 3M4OJ 5E3MA 3DBRB 1P9QC 3ZQFA 3G71I 4EM2A 4IOAF 5D5WB 3J7AO 1MMNA 3EQLF 3QP5A 1H88C 1KZHA 2E7WA 2CUJA 4KUMA 1Y0UA 3GF2A 2LD5A 3IV5A 3LWFA 3PNTA 2X1EA 2W7NA 5EGOA 3OIPA 4MGRA 4BH9A 1NK2P 4OIQF 1ZG5A 2DFFA 2KZGA 1W0UA 1TNTA 3I3LA 4ENKA 2DA7A 1FPQA 4A0XA 1YIOA 1IF1A 2QQBA 3RPUA 3ROUA 4KMFA 4PJNA 3P9KA 2V9VA 4Q5SF 1LJ9A 3OOUA 1SC7A 3BY6A 4ANJA 1UELB 3HB9A 4M6XA 3WE2A 3VOEA 4BBSJ 3GZ5A 2DT7B 3S1RJ 2DODA 2OC6A 1V4RA 3RIRA 3VEPA 3FXKA 3RPUD 1SAXA 1ZR2A 2YS9A 1SVLA 4JP0A 1MSFC 2EB7A 2BBYA 3WTVC 2XUBA 4B3AA 3WTXC 2V9KA 3VWBA 2FOKA 1IAWA 2LVSA 5DDGA 1BW6A 1T95A 3EUHA 1X1PA 1ZYRF 2JUGA 4UV9A 3S32A 3KYLA 1MBFA 3A02A 1QPMA 2XRLA 4FCYA 2Y30A 3LNQA 3F9KA 1BA5A 1OLTA 3K4JA 3VPRA 4DYRA 3E97A 2VKEA 4IXAA 2OD5A 3CDHA 2VBZA 3WGGA 1ZRFA 2PLYA 4EJUA 2FEZA 1XS9A 1QGPA 2XAFA 4RB3C 4U0YA 1EV7A 1HA8A 1Y0NA 1GVDA 3CMMA 4XM3A 2M4GA 3IWZA 3RPQA 2CUFA 3BTCA 2VKHA 4BE1A 5DD8A 2EFOA 1ODDA 3CCYA 3FXQA 3IRQA 3HPGA 1TW3A 3ZQQA 3W6KB 2V1DA 5HDKA 4BAYA 3BR3A 3HOXJ 4U7DA 1TWFJ 3Q3SA 1G8XA 4NC6A 3W2VA 2K3FA 4P55A 2BZTA 2JUCA 1LFUP 4AVZA 3G6EI 3EYIA 2R5YB 1STZA 3E6DA 1QRYA 2W24A 4PSWA 2EINH 3IC7A 3JREA 2NS7A 1BN5A 2LF7A 1T0FA 4LIVA 3PO3J 2E5NA 3F6VA 3WG9A 1R5GA 4LG0B 2VLAA 1AHDP 1WJDA 2X51A 2XASA 3LA2A 2WV1A 4PCQA 2L4AA 4MIMA 1MBEA 2HWVA 2HU9A 3KEOA 4GDFA 4LG3A 2G7HA 2E1CA 1TL8A 1HCRA 2XAUA 5LLQA 2IW5A 4HNTA 5M3MJ 2HGCA 1I3AA 2ISYA 2W85A 3R0JA 4GYIA 3ZQCA 2XDVA 3DWLE 3HBLA 2XROA 4HSTA 1OCCH 1RZ4A 4OMZA 3BQYA 5DCMA 2DOEA 1ETOA 1MBHA 2GA1A 5D5UB 5C3EJ 5ICEA 4BQAA 4CO8A 2HPIA 4M9SA 3DKXA 2QM3A 5LD2C 2VQCA 1NG7A 1E3HA 5F27A 4YFXF 3QPTA 1ETYA 2KDOA 2K3PA 3PO2J 4BDZA 2YPRA 3LOCA 4KITB 1QVTA 2FNPA 3SZPA 4F7ZA 2O03A 3RKQA 3LQRA 1JT0A 3BG7A 2V79A 1XN7A 1XMXA 3FK6A 4HG2A 1YS6A 3K69A 2DAOA 1DP7P 4ON0A 2H1KA 2VBXA 1WZ2A 4E70A 3FZVA 3WTZA 2VB6A 4K2EA 2R5YA 1ZLKA 4OMYA 4PJMA 1H0MA 2QENA 1R1UA 1UHMA 2O3FA 1LNWA 2HPMA 3FISA 3H5AA 3I71A 3M8EA 1IGNA 4IHYA 2KRFA 3OL4A 3HIFA 2F5VA 1ZK8A 1IG7A 4LG0A 5E8IA 4UB8C 5IOZA 4LLLA 3TO9A 2CYYA 3C7JA 3TW6A 2DTRA 2CV2A 3S16J 1DGWY 1QZEA 1OPCA 2V9PA 2A6HF 3S2WA 3HSEA 4R8HA 2DMPA 1D1BA 3L2RA 1ZARA 3CESA 1KYWA 1V5FA 4Y33A 3ZGKA 3ABUA 3TGNA 2DA6A 2W25A 2KP6A 3GCMA 3E3VA 3W2WA 3A0HC 2FMLA 3OYCA 5ERIA 4L9NA 4DZJA 5HLGA 1U5TC 3FXLA 1D5YA 4ENMA 2OQRA 1G3TA 2LR8A 4N9HA 2X6WA 2L3DA 3VSKA 1WWXA 4GGGA 2MLKA 3DP7A 3GLXA 5DV5A 2HYJA 2KL4A 3CLQA 3KEQA 1WH5A 4A5MA 2VI6A 3LA7A 3OS0A 2HVRA 1F9NA 1IRFA 5F08A 1J75A 2HDWA 4QIWN 4IX7A 1UMQA 3CUOA 1J9IA 2PG4A 1PP7U 2HTJA 5KNLA 3DU6A 1OCOH 2Y2ZA 1D8KA 5BNGA 5LGTA 3KP5A 2QCOA 3LL7A 4MQVA 3H35A 1IV6A 2ADUA 4TV7A 1SFEA 4EV0A 1LFPA 3MKWB 1SMTA 2GIVA 1Z21A 3ASNH 3GYHX 4KNYA 3G2BA 2N8GA 3JSPA 4IRGA 1I50J 2V26A 1I5ZA 2LF8A 3BCAA 1JXSA 3OS1A 2ESHA 3CMYA 2RVCA 4I02A 2DMQA 4LIUA 4II3A 3OYHA 4XSZF 1XDUA 1LPQA 2V1UA 1YOVB 3FMSA 2V4JC 4I98B 5EJCA 1RUNA 3ABKH 1MBKA 3DPUA 4FQGA 4A2UA 2VPLA 1LUJB 3MVPA 4G6QA 1MD0A 1XSDA 3H0GJ 1BJZA 2L7KA 3OYDA 4L0ZB 5HS8A 1K4SA 3Q0UA 1DQUA 3BT9A 3J81Z 2M8EA 4IEJA 1UJ8A 2XIGA 3HGGA 2STTA 5M3FJ 1FX7A 1XG1A 3AG2H 3BG6A 4BACA 2CQNA 2VC1A 2BEOA 2M8GX 2E2HJ 4NBQA 4UV8A 1P6RA 1JKRC 4CYDA 2O61A 1FBQA 3C3WA 4DBQA 2OV7A 1HC8A 1I1SA 1NHAA 1BBYA 2ESNA 1X58A 3WU0A 2V1XA 1MSEC 2Q0OA 1FMVA 3BR0A 3K1MA 5B1AH 5GP9A 3I59B 1SFXA 2VE8A 5EEHA 5FRMA 5FFZA 4C30A 3IWFA 2EJRA 3KP2A 1FEXA 3HOTA 4HRIA 1PJRA 3I5UA 2EWNA 5E1WA 4B8XA 1BC8C 3QOEA 1DPUA 2EIKH 1XGMA 2EH3A 2DT6A 2KT0A 3FXMA 4IHWA 3K0LA 4DOZA 4HF1A 2Q2EA 3MN2A 2XAQA 3ZMDA 3FHNA 1P4XA 4YELA 5LBQA 2UXNA 3M9AA 4L18B 4KIFA 1QHHD 3LQQA 1R71A 3M8JA 1R4NB 3WTYC 1TP4A 1K78B 5IP9J 2VJJA 3GTMJ 2L4MA 2JVHA 4BUPA 1XMAA 3CQZJ 3M07A 2ZXHA 2R7ZJ 2BE5F 1ZHFA 3SFZA 2WAQA 1XGOA 2WADA 2W00A 1FC3A 1AA7A 2KHMA 2EFNA 2HQNA 3CUQB 4AU7A 5JLXA 2QBYB 1PUEE 3CD6I 4G6TB 3FM5A 1B72B 4CUGA 2LKPA 3R0AA 1SANA 1XC5A 5FRNA 1YW9A 3N97A 2A61A 1YHQI 1YYVA 2MG4A 1SD5A 3H9QA 3T1BA 3NARA 1U6GA 3DLLF 5TISC 3R61A 4L5JA 1YLFA 1GT0C 3I4NJ 5KHDA 2X1DA 1XD7A 4NQWA 2CW0F 3F8MA 1A04A 4OIOF 4A3KJ 2VOPA 4ZZLA 5AIPA 4EQQA 3F22A 2QZ8A 1IXSB 2K02A 3S3MA 3CMEI 1KU7A 3JRBA 2NYXA 2VC0A 1VTNC 2P4WA 2F4IA 5D8LB 3CJRB 5K5RA 3DEUA 1D5VA 2FNAA 5L3FA 3KLOA 3GVAA 2KIQA 1UAAA 1FOKA 4M6YA 3GBGA 3U1KA 1S9HA 1JJ6C 2JSPA 2KJBA 4BY7J 1M1EB 4P1WA 1MBJA 1A36A 1IZ1A 3I59A 2GA2A 3CCJI 3KE2A 1P7IA 4NNJA 2A5WA 1HSJA 2VJIA 4D7NA 5GAHJ 3JRAA 1QBJA 1XGSA 5LGUA 3NAUA 1FYLA 2WAQN 2WY8Q 3PNYA 3CC4I 1A5JA 2M9HA 3JAMZ 4C3JJ 3O2PE 1AWCA 4OAYA 4B48A 3P9CA 4G94A 3GTOJ 5E8GA 3WG7H 1LFBA 3LSHA 3OYNA 2DBBA 3OOPA 1BOBA 5DCFA 2M7AA 2OTJI 2ELJA 5ILVA 1I1GA 4RGXA 1RETA 4HW0A 3H5RA 5JVGF 2Z16A 3S93A 2R7WA 1K78A 1N25A 4DQ2A 3OMYA 3KYDB 4G6DA 1I6HJ 3CJNA 1NG6A 5CPRB 2QQ9A 4F91B 1TT0A 1I27A 2K86A 3V42A 4GFBA 2HR3A 3ZQHA 1R23A 3NWTA 5AIQA 1ON2A 2ZJRF 3V8LA 2QBYA 4IHSA 2DMUA 1VQMI 1B72A 1MMDA 2V6EA 4ETSA 1YW8A 3HKZN 3R60A 4JK1X 5JVTA 2RAEA 4EEFG 1FOWA 1D1AA 4FE4A 4A3LJ 3JRCA 4B09A 3VYSB 3FX3A 2OQGA 3PQKA 1PP8F 2CUZA 1XGNA 2GXGA 5DM6F 5M5YJ 2E1OA 4J19A 1TTYA 4FX0A 1ZG3A 5DTDA 1IJWC 3JW4A 4RAFA 4ENJA 3E5UA 2A6EF 3W3CA 3RJPA 5EG0B 2K9QA 1EA3A 2OUMA 3BG9A 4LFUA 1FYMA 2DQLA 3BJ6A 1Z91A 4XONA 4V19K 4RGSA 3W2AA 4M9ZA 3DLAA 2P6SA 4Q48A 4BHPA 3WTWC 3B02A 4M3GA 3SYTA 3RDIA 1NTCA 1E0EA 1JGSA 2CS3A 3OYIA 3ZN0A 4QPOA 4OAZA 1SMYF 1WJEA 1X2MA 4H4KC 1O3TA 3AL0C 2DOFA 2CG4A 3V7CA 4CYCB 1V5EA 3DCFA 4JX5A 3ONQA 4AUXA 2Y69H 5FKLA 2BW3B 2AHQA 2YR2A 2VJ4A 4NC8A 1QU3A 1HLVA 2RGVA 3TO6A 3HOZJ 5K7ZA 1IC8A 1G6NA 1HW5A 2LREA 1WJAA 4N9IA 4G8XA 1VQOI 3BR2A 1JI8A 2WA0A 3BWGA 3C2HA 2WY7Q 2DO7A 3HPHA 2FE3A 2M45A 2DA2A 1G3YA 3E1SA 2HS5A 2I10A 3KP7A 2JRTA 5E3LA 3WODF 3A01B 1XSVA 1YI2I 4XKVA 1IXCA 2Y9YA 2CJJA 2ME6A 3W6JB 3UNGC 5D8KB 4I7HA 3TQNA 1T2KA 1IXRC 3ERMA 2VJ5A 4C2TA 3CMAI 3TW7A 2EFQA 4F52A 3SDBA 3CCEI 2L9SA 3K4CA 2FXAA 4A3EJ 2CSOA 3KP6A 4I76A 3MFKA 1BL0A 1QNTA 4PJJA 4OIRF 4E7LA 1JUMA 2H6BA 1QQIA 1AKHB 3FKIJ 1YFHA 3J81K 2KPMA 2F5CA 5J1RA 3QODA 5EG0A 4P5OA 3QPHA 4BXXJ 4E7ZA 3GTGJ 4XLAA 1EKEA 4BY1J 2W48A 5FLXZ 4J00A 4IKFA 4FT8A 2NVTJ 1IO2A 2NVUB 2VL8A 3F8CA 1FSHA 2DA4A 1Y1VJ 1S5LC 4E7SA 5DUIA 4I09A 5HDGA 1A6IA 1U5TA 3LSIA 3PFIA 2NXNB 4I99C 2R5ZB 4EGZA 4CYCA 3KZYA 2DFEA 3FMRA 2FOWA 2LLKA 1S7OA 4Y52J 4A3BJ 2WC2A 3L09A 5DD4A 1WPKA 2XSJC 2UXXA 1D3YA 2MC3A 4XRSA 3S3NA 4ZYDA 2LBFA 2JA8J 1MJ9A 2B63J 2E34A 4RB1A 2HOEA 3JSOA 2CMPA 4S0HB 3CDIA 2L5QA 2XF6A 2ECCA 2MSYA 3NEUA 2EBIA 3KP3A 4PK4A 3ZQ7A 1USSA 3HG9A 1K83J 2VN2A 2V1NA 1B8IB 2JQ7A 4DJAA 1UG0A 4CCLA 2Z33A 4E4HA 3BTJA 1RRJA 2L9NA 5J4YA 3A01A 3H3VK 2XKOA 2AO9A 1G3WA 2DA5A 2Z3YA 4CCKA 3OYMA 5HLTA 1ZELA 3ML6A 3DPLC 2XAHA 1K6OA 3GX4X 4ZDOA 3JRDA 3GEZA 3CTAA 2Z9OA 5EDNA 4RBOA 2M5WA 2HNHA 1GV5A 4XLCA 2EA4A 5KCMA 2AS5F 2EV6A 2DK5A 4MQ9F 2A5YB 5LHIA 5CLSA 3RCOA 5K1YA 1FP1D 2L7FP 3QYEA 4NB5A 3P9IA 2HTSA 4YG2F 3LSRA 2VPRA 1EH7A 1MJBA 3K2AA 3RZDJ 4L9TA 5C44J 3S14J 3S2HJ 4A3FJ 4EM0B 3LSJA 2LY1A 1S29A 4PGHA 3REOA 1FTTA 2BYVE 1TZLA 2DQRA 4RA2A 1VQ9I 4CH7A 2OCEA 4HX4A 5IYDJ 1X19A 2A3SA 3ECHA 5C4JJ 1TWHJ 5CVVA 1OCTC 2Y9ZA 1LVAA 3WU2C 3TP3A 1MKMA 2CQXA 4JYKA 3NWSA 3K4MA 5J4VA 3RYRA 1ONVA 2R5ZA 5JHFA 1HXDA 2F2EA 3H92A 5H20A 2IRFG 4UVAA 2BGCA 3BDDA 1VQKI 1F36A 1T6SA 1RESA 3FXJA 2Q1ZB 4YIIA 3HXLA 1S8NA 2LY2A 3CUQC 3D5LA 3AAFA 3GMEA 4BNCA 3JAMK 3CCLI 3T0YA 1BI1A 5E79C 3SXYA 3FBNB 3MZ8A 2ISZA 1ZLJA 2XF5A 2FSWA 4N4NB 1HBXG 1J2XA 4DBRA 1RNLA 3KETA 3DTIA 3HHHA 1WGXA 4IOCF 3GWZA 3TMOA 4A3JJ 3L2CA 2Z2SB 4DIQA 1B8IA 4CICA 2DT5A 6PAXA 1EJ9A 5F1RA 2NVXJ 1N77A 1IN4A 1GUUA 3A1YA 5EZHA 2NS8A 2XVCA 3HZJA 2PMUA 4U0WA 3H3ZA 3WTSC 1X1CA 2YUSA 2XGDA 2UV1A 3CCMI 1GVJA 2QF7A 3ZCOA 4CCNA 1RI7A 2QKLB 5E3NA 4XKCA 1RPWA 3ZMSA 5F6FA 5ILSA 3HSFA 2QSGX 3CO7C 3MCZA 1RKWA 1LDJA 2BHZA 1FSEA 4A3GJ 1C0WA 1BJAA 3CCRI 4FASD 4UHTA 4NC7A 3H36A 1IN6A 4RDUA 2QWWA 3PUBA 3ISPA 1WRJA 3ERED 1V5GA 1Y8QB 3WTTC 3MQ0A 1JGGA 1Z0XA 2CV0A 1OYWA 4ZDPA 5HS7A 4A3CJ 4QTRA 4OOIA 3U2RA 2NNYA 4Y7NJ 1GHCA 2MBFA 1K4TA 4OIPF 4X0GA 4Z6YA 1E17A 1J7KA 2KJCA 3IKTA 1MGTA 3CJQB 2R7VA 2W1OA 2XGXA 5CVIA 1Z9CA 3UKGA 2K4JA 2DA3A 1WSUA 1I39A 2O0YA 2QYOA 3AL0B 2DYSH 4A69C 3S8PA 1CQTA 2NNNA 2CWEA 5GADJ 3L2VA 1BM9A 3O6BB 3ELKA 3G4SI 2YX7A 5F0FA 4CCOA 3DF8A 1FIAA 4CXFA 4PJ0C 2CH0A 2HYGD 3WU1B 4D9JA 5B5EC 1TWGJ 1YITI 3L2UA 1KU2A 2XC7A 1U8RA 2FA5A 5FLVA 3CP8A 2H6CA 4E7HA 3BR5A 4RAZA 2ZFUA 3G73A 1LE8B 5E1ZB 2I8DA 5J8CA 3KFWX 5LHHA 4O6JA 5GTHC 2VXDA 3HSRA 2A07F 4ZJZA 4HYEA 1F1ZA 2P0WA 1HW1A 2EZKA 3GFMA 1G3SA 4H0EA 2WAFA 1YW7A 3IAS2 3KZZA 4NUBA 2ZJ2A 4A6EA 5LEKA 1ZKGA 1UHWA 2DTZA 2XPWA 3HGYA 4N4OB 4XSXF 5CVRA 5K5QA 2HVSA 4HSRA 3RQ4A 1UB9A 4KICA 2DPDA 4M71A 3OYJA 3E6CC 4QLCU 3KIOA 2L7ZA 1KU9A 2FMYA 4ZC3A 2MH2A 1WI9A 4II2A 2EZHA 2JA7J 2D1VA 2MFZA 4XRSG 4EATA 2W57A 1MMSA 3HJEA 3VB2A 5FLXK 5GTIC 5KVRA 2L02A 5EEGA 4BQOA 2F6CA 1ZGAA 3AG1H 4BQQA 4M3EA 2ACJA 3SJMA 4A12A 4OWRB 2L54A 3HRMA 4KFCA 4HX7A 4XLNF 3M1EA 2ZB9A 1D0XA 4GYGA 2QKMB 2ZXIA 2JPBA 3OYKA 3MAJA 3OS2A 2O8KA 4AYBN 3IAM2 2PEXA 2IS6A 3O8GA 3CCVI 3R4KA 2QSHX 1HDPA 2R3SA 3GFJA 2G0EA 1W7PB 3WE3A 2FQ4A 2JJ7A 5CJ9A 3WHBA 1JUSA 1LDDA 2AXTC 1OCZH 2MW8A 2ZNZA 3ABTA 4E7KA 2CU7A 2LMDA 2BV6A 1SVMA 1FY7A 3DXJF 1JHFA 4A6DA 4HNUA 3AG3H 4AVPA 3OYBA 5IYCJ 1WJ5A 1BW5A 4P96A 4MHGA 2XB5A 3MMYB 2EQRA 2CGPA 3PUFA 4QPQA 1FOYA 4XMYA 4G7OF 4XLEA 2EV0A 2LC2A 3FF5A 3QYBA 4OINF 3FXOA 4BS9A 1N78A 2NOJB 5ICGA 4GRIA 3H9GA 2HZDA 2R7FA 2H27A 5EYRA 2CUEA 2M34A 1W5TA 2IS1A 1HF0A 4HOBA 2P81A 5FD5A 4XBFA 9ANTA 2ID6A 2MD5A 2LOOA 3PIPF 3GW2A 5D6FA 2NS0A 4M3FA 4WXHA 2ZBKA 1S6LA 2G7UA 2LKXA 3P7NA 1B6AA 2QA4I 5AONA 3ULQB 4A5NA 2NAZA 2GIZA 2X48A 2VE9A 4B4CA 1REPC 2HEOA 3K4NA 4V2GA 1X4OA 2M0MA 2R7RA 3BJOA 3V7RA 2YU9J 4RLQA 3SEQA 1HKQA 1SEUA 2IAIA 1WJBA 1FMWA 1UG2A 1JTYA 2MABA 4ENNA 3Q5FA 4B3XA 2JRMA 4DW6A 4D7MA 1FNNA 1R1TA 1W36C 2KIUA 1MZBA 3GXOA 3BG5A 3ZMTA 2CFXA 2OPTA 4LOCA 1MBGA 3OWTA 4S04A 3IHUA 2MC4A 1FJLA 1FZPB 5FD6A 2DA1A 4MEXF 1KQ9A 1MDMB 2FF4A 3GZ6A 1NH3A 4Y4RA 2R7TA 3DU5A 4PFOA 4GCVA 4AIHA 1S7AA 1W7PA 3EPZA 3UR3C 5JHUA 1XSXA 1WKMA 3JTHA 1X1BA 3HRUA 1PDNC 1O3SA 1RUOA 1Y8RB 3TP0A 5EF6A 5FB2A 2L2OA 2DLLA 1ZN2A 3QPSA 4D5FA 3ZQGA 3K9TA 1JT6A 1ETXA 1W7PD 4BGDA 3T8TA 3HC7A 4IPAA 3MZHA 3FMQA 1I3QJ 3J7AY 1WI3A 3VODA 2ELKA 3LSMA 1YS7A 2J5OA 4HZFA 1OISA 2ZCWA 3FM3A 1O3QA 1ZH5A 2IS4A 4PJLA 4HDVA 1SFOJ 4D0PA 3F21A 1FP2A 2PJRB 3HTUA 1VQ7I 4RLFA 1ORKA 4AM3A 4FTHA 1Q1VA 3BOQA 2EA2A 2VT3A 3H9JA 1VFCA 1DDNA 4XN3A 1U9NA 2WAEA 2MLGA 3I64A 2H94A 5TGTA 2IEKA 3HKZA 3U21A 1ZR4A 3G1OA 1F4KA 3VSLA 4I0BA 4F93B 2Y31A 3BR6A 4KDPA 3OYAA 1O7LA 4UUSB 2K9MA 4AD9A 4RAGA 1HDDC 1Z77A 2XPUA 3KEYA 2VONA 4RB0A 3CC7I 1X2NA 2R7OA 4HX8A 4CSWA 2MA3A 4EMSA 1DPRA 1FWZA 1VI0A 4FE7A 4QSHA 2BVMA 4WWCA 3LSPA 4BJTA 4AIKA 4XOTA 3G3ZA 2VQGA 1QPIA 2MH9A 2ETHA 1S72I 1IRZA 2DFIA 3TOBA 4C2MJ 1S3JA 2HDDA 1MMGA 2DOAA 2M3AA 2HI3A 5LHGA 5A2QZ 4BJ6C 1PUFB 2XB0X 1W0TA 3TBIA 5ICCA 4XKBA 4EJOA 5K7FA 1RC9A 3FKJA 2X4HA 2VT2A 3CCQI 2J5PA 2L9VA 1YJNI 3FXRA 3OYGA 1SFUA 1U78A 4M9XA 2D2WA 2P8TA 3CUQA 1XPXA 2VOOA 2WV0A 4DYCA 1Y6IA 3FWEA 3C2GA 1XX5A 4PUSA 1QVUA 2JN6A 3T5XA 5LFAA 3TL4X 2PBIA 4HPQA 2E19A 4HDUA 2GM4A 3Q0WA 2TRTA 5D5XB 1IUFA 2DN0A 4M72A 5ICFA 1T33A 2DJIA 2K27A 3S1MJ 2NVYJ 4G7ZF 2RQPA 1Z1DA 4XOPA 3QU3A 1MNDA 2K9NA 3KX2A 4WXDA 2PJRA 4HLYA 3C1DA 1YX3A 1LVKA 5FKMA 3FHZA 4U87A 3F3XA 2X85A 1KYZA 4BXUA 1B9NA 5DUKA 4NHJA 2ZNYA 5HNFA 4KIBA 1CF7B 1FTZA 5IP6A 2E2JJ 1Y56A 4OU0A 1J09A 2XV4S 4UUSA 1XCBA 1R4MB 2DU9A 2GBYA 1LDKB 2JTVA 2CFOA 2Z5UA 4YIRX 4IL6C 5CKTA 2HKXA 2IBDA 1OR7C 2OU2A 2OZ6A 3COAC 4C3IJ 4XRMA 2ZFWA 1TWAJ 4HQMA 1HSTA 2XHKA 4B43A 3AG4H 2ID3A 3L2WA 1VQ4I 2G9WA 4ZZDA 1WFXA 3I0TA 4ZH4F 5EEAA 2XAJA 3F8NA 2FD5A 4B44A 3PJRA 2DDAA 1U8BA 3OYLA 3DV8A 1Z3XA 4ZTJA 5J1YA 3K4LA 2OA4A 2NOGA 3RI4A 2WB1N 1Y1WJ 3HUGB 2JA2A 3CDLA 3M8FA 4WK8F 3I4MJ 2F4MB 4Q4ZF 1A31A 1AOYA 1E3PA 1B59A 2K9LA 3OR2C 4XICA 1NK3P 2D45A 2PI0A 3BLYA 2Y48A 2OCCH 3KZIC 2WWYA 1T39A 3F8FA 2R7XA 3VFZA 3FIWA 4IVNA 4XN0A 4PSXA 2OBPA 3MZYA 2JVGA 4HF2A 2OZUA 1GDTA 3SEZA 4I01A 1T8IA 2W82A 5HODA 1SD4A 1RR7A 2GWRA 4ZYEA 2ZSIB 1X1AA 3DKYA 4KYWA 1DU6A 4MFDA 3D0SA 2RN7A 3QYFA 3IP4B 3J80Z 1JUPA 2IVMA 1IN5A 2HDCA 1P7JA 3MKLA 3QP6A 1KQ8A 2W4SA 1CF7A 5H2FC 5F0HA 2GQQA 3K6GA 4YFKF 1N75A 3DQVC 3L1PA 5E17F 3LSGA 3JRGA 1WH7A 4ABZA 2L9RA 3K1PA 2DFHA 5M5XJ 2W84A 3FXUA 2DJNA 2X1CA 4XIDA 4FISA 3L7WA 4IQJA 4BQNA 1U9OA 3RKYA 1VQ8I 1R1VA 2Y75A 4NDLA 2K85A 1TQIA 1GXQA 5FJ8J 2KFDA 2BW3A 4LLGF 5HOOA 1TQMA 4UVBA 3JCUC 2XKPA 2LP0A 2F48A 3QQAA 3ABLH 4N0BA 3K70D 3DEEA 2CW7A 5D6EA 5L3EA 1V54H 2DCEA 5GPCA 4MFEA 4L5EA 3V7SA 3N4MA 1Z67A 3WGHA 2RNJA 4BE0A 1BR4A 2DI3A 2WTEA 4LMYA 2ZXJA 2OTLI 1YG2A 5BMZA 2AQFA 4U7BA 3HUGA 1MNMC 1KQ0A 2A68F 4KN7X 3ABMH 4EGYA 1WJFA 1ZTRA 4Z2YA 2CO5A 2MYSA 4XL9A 3WGIA 3PIOF 3BR1A 3JTGA 3EUKL 1ZGWA 4LB6B 2DMTA 5KAIC 3K10A 4L9JA 2HOTA 5CQEA 1QZYA 4MEYF 2LRDA 4A3MJ 2O7OA 4IRHA 3LFUA 1W5SA 2ZKZA 1XB4A 1B1BA 2CW8A 4LB5A 3BZ6A 3EDPA 1G4DA 2O5RA 5HNHA 4FETA 4RAYA 2CV1A 3S2DJ 3IH2A 2ZO4A 1OQYA 5DEQA 3E6MA 5ILUA 1V55H 3PM1A 1BIBA 4L0YB 4QWQA 2VBWA 1R22A 3HOWJ 1AKHA 4G7HF 1ENHA 1R49A 4C3HJ 1O7FA 5FLMJ 1K7AA 2JA6J 1IDYA 4CDGA 2Q8KA 3V4GA 4BJ5C 4XRFA 1HQCA 2ZXWH 2JWTA 5CYVA 1IRGA 2AXLA 1FOXA 1MIJA 3ZMVA 2M2EA 2K7LA 2KZVA 2PMHA 3BCBA 1F5TA 2ZMEB 2Y0MA 2X6YA 1HKSA 1OKRA 1VNDA 2VBYA 5HLIA 2IGOA 3I54A 2BY0A 1VZ0A 5IY5H 1IDZA 1O57A 1P4AA 5F1JA 4L5IA 2VQLA 4XLPF 1GV2A 2YU3A 2P6TA 4RMNA 5M5WJ 1PVEA 3C2BA 2L0KA 5DCMB 3S17J 1S7EA 2YSRA 4AIDA 4UNOA 3F23A 5F0CA 5ED4A 2P7VB 4KT5C 3S3OA 5EZGA 1TW2A 2DDBA 3H5NA 1G59A 2V6CA 4HV6A 3GLLA 1T56A 1Z05A 3AKZA 1H9TA 5E18F 2VIXA 1TNSA 4HEA2 3A0BC 5A2QK 1TLHB 3BG3A 5FGMA 3F0CA 4IF4A 2M0CA 5DM7F 2STWA 2RDPA 2PMZA 2ZC2A 1VQ6I 1W36D 3DBHB 1EF4A 1USTA 1MNEA 2IGKA 3VYTB 1R7JA 1TQPA 4UUVA 2JZYA 3GTKJ 4Y17A 3H3UA 4Y3OA 4C9YA 2M87A 3BQZA 1T38A 4IHXA 4C2UA 1UFMA 3TEDA 3O8HA 4I0AA 1X1DA 1JTXA 3E7LA 4DNCA 1WQ2A 1A6QA 1FBSA 2B7EA 2L7MP 3ZMUA 2HQ5A 5C4XJ 3ASOH 2PJPA 2HXOA 4BL0B 3OSGA 3SQNA 1W1WE 3B6CA 1U2WA 3E0JB 2KIFA 5IT9Z 4J01A 4IQ4A 1QO0D 3RKWA 3KLNA 2QEXI 3AFHA 3OYEA 1X4PA 5BQTA 3GTQJ 5HDNA 1ZREA 2IPQX 1JHHA 4E7IA 1H8AC 3EYYA 1ZAOA 1FYKA 1OMIA 2GZWA 5B66C 2IA0A 1OFCX 2F5FA 1L0OC 2DPUA 4IHTA 2IGNA 4AWXB 4W1UA 1BR1A 2ZMEA 3VYUB 4CCMA 2K40A 3BP8A 4RS8A 1SD7A 4AC0A 2CQQA 4F92B 1P2FA 1Q1HA 4LITA 4Y13A 4M3BA 1T98A 1Y39A 4XLHA 3J7YJ 4I2OA 4MLOA 2PMZN 3IUOA 3GTPJ 3DKWA 1ZGJA 3M3YJ 5LRRA 3TDUC 3PSIA 4AIJA 3RKXA 1BI2A 5BS6A 2EILH 4FX4A 1VF9A 3PNVA 3K1NA 2D1HA 4Y15A 5TJJA 1ULYA 2ELHA 3EUAA 3LSKA 4WF2A 4E6KG 4EJVA 5J8FA 1H9GA 1LKXA 1UCRA 2CQ7A 3K7AJ 3CLOA 1BIAA 3ZXSA 2I5UA 4LGWA 5HLHA 1D1CA 4YIFA 2FUG2 4E7JA 2IA2A 3GZNB 5H6RA 4Q47A 1OCRH 5CVUA 1WVRA 1POGA 3E6BA 2BY1A 4CZCA 1L3LA 1GLNA 5B1BH 2COBA 3F8BA 4AYBA 1LEAA 1J0RA 2JSCA 3K2ZA 1KGSA 3D5RC 4M74A 3QRFF 4MNUA 4KT6A 4A93J 5IPAA 2IS2A 2KDZA 4XLFA 2FBKA 4XR6A 3A4CA 1Z6RA 4BDYA 1FIPA 4WCGA 2F4OB 2H8RA 3X2QH 4ESBA 2HYFA 1I6XA 2JT1A 2BXYA 2UZKA 1LB2A 5D4RA 2KRHA 3K70C 1IUYA 3SFIA 3CCSI 3B6AA 2MGQA 1SAUA 4KISA 3J80K 2X6XA 1QZZA 2E5ZA 3V8KA 3HTSB 4EJWA 2X0LA 2RNGA 3KCCA 5IT3A 3P5JA 4LD5A 3GO5A 1SFKA 2R7UA 2EZIA 3FDYA 1XCVA 3OYFA 2OF7A 3BPVA 3IKVA 4ITVA 4BBRJ 4KN4X 2PX9A 2ZJPF 3HOSA 4ESFA 4LK0F 4UXNA 4GXOA 2EIMH 3LMMA 5CQGA 2KQRA 2MD0A 2EFWA 4O3MA 5J40A 2R7SA 3LAPA 1WHUA 4CHUA 2PFBA 4BXFA 4LLNA 2IJLA 4ZYHA 2DYRH 2R93J 3CC2I 4U88A 5JFRA 4HNVA 1OR7A 1FT9A 3G1LA 4RM2A 3MKYB 3OIQA 5J6XA 2EFPA 5FKNA 5B3SH 3ESWB 4B1RA 1LQ1A 3CF5F 2Q2EB 5L3BA 5IYBJ 1V3FA 1VQLI 3A2KA 1Z7LA 1B4AA 2B0LA 2LK2A 3R6SA 2E35A 2M30A 4PGGA 2TDXA 1TWCJ 2QSFX 2LY9A 3RZOJ 1ERDA 4IRIA 1IN7A 3OL3A 1ETVA
chains in the Genus database with same CATH topology
2HI3A 2WV1A 1LE8A 2NVTJ 1PUFB 4MIMA 2XB0X 1MBEA 1W0TA 3IH4A 5K7FA 2DA4A 1Y1VJ 2O9LA 1HCRA 3A03A 1A6IA 2R5ZB 3GTLJ 1U78A 5M3MJ 4CYCA 3ZOBA 2LLKA 4DYCA 4Y52J 4A3BJ 1WPKA 3ZQCA 3HBLA 1QVUA 2JN6A 4XRSA 2E19A 2XPVA 2GM4A 3S1QJ 3Q0WA 3BQYA 2JA8J 2TRTA 1IUFA 2B63J 2DN0A 4S0HB 1T33A 1ETOA 1MBHA 2ECCA 2MSYA 3S1MJ 2NVYJ 5C3EJ 2EBIA 2D5VA 1K83J 4G12A 2K9NA 1B8IB 1ETKA 5FKMA 3BTJA 3A01A 3H3VK 5F27A 2K9SA 1ETYA 2AO9A 3PO2J 2DA5A 1FTZA 5IP6A 3LOCA 1QVTA 2CRGA 3HOYJ 3HDDA 3JRHA 2DMNA 3RKQA 2E2JJ 3JRDA 4UUSA 1R9TJ 1H89C 1JT0A 5IP7J 1APLC 2GBYA 3FK6A 5EDNA 4RBOA 1GV5A 2H1KA 2XSDC 2IBDA 2GLOA 4M3DA 2R5YA 4C3IJ 4DZPA 4XRMA 1TWAJ 2L7FP 3BTIA 3FK7A 3LSRA 2VPRA 3K2AA 3FISA 1IGNA 4IHYA 3RZDJ 2ID3A 5C44J 3S14J 3S2HJ 2VKVA 4A3FJ 3LSJA 5EEAA 1ZK8A 3QPLA 1IG7A 2X9DA 2FD5A 5IOZA 2NVQJ 1FTTA 3IH3A 1U8BA 3TW6A 2R92J 3S16J 5IYDJ 5C4JJ 1TWHJ 5J1YA 2DMPA 1OCTC 1YRNB 2Y9ZA 2NOGA 2WB1N 1Y1WJ 3TP3A 2CQXA 3CDLA 4JYKA 3WHCA 3I4MJ 2DA6A 3ZQLA 1K61A 1NK3P 4XICA 2R5ZA 4DZJA 1F36A 3RQIA 3SDGA 1D5YA 1RESA 3FIWA 2LR8A 3W6VA 2HYJA 1GDTA 1WH5A 5HODA 2VI6A 1RR7A 3DEWA 1AU7A 2JA5J 5F08A 1DU6A 4MFDA 4QIWN 1WGXA 1UMQA 4A3JJ 1JUPA 1OCPA 1B8IA 2NVXJ 2Y2ZA 1GUUA 1P7JA 5EZHA 2NS8A 2TCTA 4JX6A 5BNGA 1ETQA 2QCOA 2XGCA 1IV6A 2YUSA 1RKTA 2XGDA 3MKLA 1OJLA 4X1EA 2QF7A 4UUTA 5F0HA 3HEFA 3L1PA 5FKKA 5E3NA 2N8GA 1RPWA 3LSGA 5FKOA 1WH7A 4ABZA 3JRGA 1JJ8C 1I50J 2L9RA 2LTPA 1RKWA 5M5XJ 3CMYA 1G2HA 2DJNA 2DMQA 4XIDA 4FISA 1U9OA 4A3GJ 3S1NJ 4NDLA 5FJ8J 2VUMJ 1MBKA 4V2FA 3MVPA 2LP0A 3QQAA 3H0GJ 4RDUA 1BJZA 2FJ1A 3OSFA 3Q0UA 1O4XA 4X6AJ 1E3OC 3BT9A 1TC3C 5GPCA 4IEJA 4MFEA 1JGGA 5E3OA 1Z0XA 3HGGA 4L5EA 4D5CA 5J3LA 5M3FJ 1XG1A 1YRNA 4A3CJ 4QTRA 1MH4A 1MNMC 1ZTRA 2M8GX 2E2HJ 4Y7NJ 4A3DJ 3BR1A 3Q0VA 1ZGWA 1JKRC 2DMTA 2HOTA 4A3MJ 2O7OA 1X58A 2EZLA 2HXIA 3UKGA 1MSEC 2DA3A 3BR0A 5GP9A 4A69C 3HOVJ 1CQTA 4I6ZA 3S2DJ 3IH2A 3JRIA 4W97A 1FEXA 5IOYA 1ETWA 5F0FA 1FIAA 3PM1A 4BKXA 4DYQA 3HOUJ 2EH3A 1TWGJ 1AKHA 2KT0A 2LFBA 1ENHA 4IHWA 3HOWJ 4C3HJ 5FLMJ 1ITYA 5FLVA 2JA6J 3MN2A 1IDYA 1MH3A 2FX0A 2JWTA 3BR5A 1HOMA 1LE8B 3BTLA 1JKPC 1JKOC 5IP9J 3GTMJ 2Y0SN 2M2EA 3CQZJ 1PUFA 2R7ZJ 2JMWA 2EZKA 1VNDA 3S15J 4M6VA 1IDZA 1ZKGA 4XK4A 3D1NI 5JLXA 2R0QC 5F1JA 1DU0A 2DTZA 2XPWA 3HGYA 1B72B 1GV2A 3OIOA 2HOSA 1SANA 1XC5A 1JKQC 5M5WJ 3C2BA 2L0KA 3S17J 1S7EA 2L7ZA 2HOAA 2MG4A 3NARA 5F0CA 2EZHA 2JA7J 5EZGA 2E2IJ 5EGOB 3I4NJ 4XRSG 1GT0C 3ZQIA 1T56A 4A3KJ 3JRFA 2X6OA 5F04A 4M3EA 2ME0A 3BG3A 4JX4A 3JRBA 3F0CA 2M0CA 3SJMA 5DS9A 2ZB9A 5GPAA 3GBGA 2O8KA 1JJ6C 4AYBN 3GTJJ 1EF4A 4BY7J 3O8GA 1F43A 3GTKJ 1UHSA 5K7HA 1MBJA 1ZQ3P 1HDPA 2G0EA 3BQZA 2ECBA 4A3IJ 4IHXA 1P7IA 2FQ4A 3O8HA 3TEDA 2JJ7A 2XGEA 1JTXA 3G1MA 1JUSA 3WHBA 4D7NA 3E7LA 3JRAA 4IHVA 2MW8A 2L7MP 2HQ5A 3NAUA 5C4XJ 2CU7A 2HXOA 2WAQN 5J1UA 1A5JA 2M9HA 4C3JJ 3OSGA 3B6CA 5IYCJ 1BW5A 3GTOJ 2XB5A 3JR9A 1LFBA 2EQRA 2JK3A 3GTQJ 3HM5A 5JLWA 1H8AC 1RETA 1WCMJ 1OFCX 1I6HJ 5EYRA 4W1UA 2CUEA 2M34A 4GFBA 2K40A 1HF0A 2P81A 2CQQA 3ZQHA 4AC0A 9ANTA 2ID6A 4MO7A 4M3BA 4M3FA 2DMUA 4MLOA 1B72A 2PMZN 3GTPJ 3M4OJ 5E3MA 3M3YJ 3ZQFA 2LKXA 1H88C 3HKZN 2X48A 2LD5A 2RAEA 4B4CA 4EEFG 1VF9A 4FE4A 3IV5A 4A3LJ 3JRCA 4V2GA 2YU9J 5EGOA 1NK2P 2IAIA 1UG2A 1JTYA 3K7AJ 4DW6A 5M5YJ 2E1OA 4J19A 4D7MA 1W0UA 5DTDA 1IJWC 3BG5A 2DA7A 5EG0B 2K9QA 2OPTA 4LOCA 3BG9A 1MBGA 1POGA 2COBA 1FJLA 3OOUA 2DA1A 3HB9A 4BBSJ 3S1RJ 4A93J 4M3GA 5IPAA 1NTCA 2KDZA 1X2MA 2H8RA 1FIPA 2YS9A 1ZR2A 4JP0A 1MSFC 4CYCB 3DCFA 4JX5A 3TP0A 4AUXA 5EF6A 4B3AA 5FKLA 2LVSA 2AHQA 1BW6A 1HLVA 3QPSA 3SFIA 4D5FA 3B6AA 2MGQA 3ZQGA 3HOZJ 1JT6A 5K7ZA 1IC8A 1ETXA 1MBFA 3A02A 2XRLA 1I3QJ 4FCYA 1WI3A 2Y30A 2ELKA 3LNQA 3BR2A 1BA5A 3VPRA 4DYRA 1SFOJ 2VKEA 2EZIA 2DA2A 2OF7A 4BBRJ 2I10A 1XS9A 1ORKA 1GVDA 5E3LA 3A01B 4FTHA 1Q1VA 2CUFA 3BTCA 2Y9YA 2CJJA 1VFCA 2ME6A 3CCYA 1U9NA 2IEKA 1ZR4A 3TW7A 3G1OA 2Y31A 3BR6A 3BR3A 4UUSB 3HOXJ 2R93J 1TWFJ 1HDDC 1Z77A 3Q3SA 2XPUA 4HNVA 4A3EJ 4I76A 1BL0A 3G1LA 1X2NA 1LFUP 2R5YB 1JUMA 1QRYA 1AKHB 3FKIJ 1VI0A 4FE7A 2NS7A 4QSHA 5FKNA 3JREA 4B1RA 3LSPA 5J1RA 5IYBJ 3PO3J 5EG0A 2LK2A 4BXXJ 1QPIA 1IRZA 1AHDP 3GTGJ 1TWCJ 2LY9A 3RZOJ 4C2MJ 2W48A 4BY1J 2HDDA 1ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HI3 A;  2WV1 A;  1LE8 A;  2NVT J;  1PUF B;  4MIM A;  2XB0 X;  1MBE A;  1W0T A;  3IH4 A;  5K7F A;  2DA4 A;  1Y1V J;  2O9L A;  1HCR A;  3A03 A;  1A6I A;  2R5Z B;  3GTL J;  1U78 A;  5M3M J;  4CYC A;  3ZOB A;  2LLK A;  4DYC A;  4Y52 J;  4A3B J;  1WPK A;  3ZQC A;  3HBL A;  1QVU A;  2JN6 A;  4XRS A;  2E19 A;  2XPV A;  2GM4 A;  3S1Q J;  3Q0W A;  3BQY A;  2JA8 J;  2TRT A;  1IUF A;  2B63 J;  2DN0 A;  4S0H B;  1T33 A;  1ETO A;  1MBH A;  2ECC A;  2MSY A;  3S1M J;  2NVY J;  5C3E J;  2EBI A;  2D5V A;  1K83 J;  4G12 A;  2K9N A;  1B8I B;  1ETK A;  5FKM A;  3BTJ A;  3A01 A;  3H3V K;  5F27 A;  2K9S A;  1ETY A;  2AO9 A;  3PO2 J;  2DA5 A;  1FTZ A;  5IP6 A;  3LOC A;  1QVT A;  2CRG A;  3HOY J;  3HDD A;  3JRH A;  2DMN A;  3RKQ A;  2E2J J;  3JRD A;  4UUS A;  1R9T J;  1H89 C;  1JT0 A;  5IP7 J;  1APL C;  2GBY A;  3FK6 A;  5EDN A;  4RBO A;  1GV5 A;  2H1K A;  2XSD C;  2IBD A;  2GLO A;  4M3D A;  2R5Y A;  4C3I J;  4DZP A;  4XRM A;  1TWA J;  2L7F P;  3BTI A;  3FK7 A;  3LSR A;  2VPR A;  3K2A A;  3FIS A;  1IGN A;  4IHY A;  3RZD J;  2ID3 A;  5C44 J;  3S14 J;  3S2H J;  2VKV A;  4A3F J;  3LSJ A;  5EEA A;  1ZK8 A;  3QPL A;  1IG7 A;  2X9D A;  2FD5 A;  5IOZ A;  2NVQ J;  1FTT A;  3IH3 A;  1U8B A;  3TW6 A;  2R92 J;  3S16 J;  5IYD J;  5C4J J;  1TWH J;  5J1Y A;  2DMP A;  1OCT C;  1YRN B;  2Y9Z A;  2NOG A;  2WB1 N;  1Y1W J;  3TP3 A;  2CQX A;  3CDL A;  4JYK A;  3WHC A;  3I4M J;  2DA6 A;  3ZQL A;  1K61 A;  1NK3 P;  4XIC A;  2R5Z A;  4DZJ A;  1F36 A;  3RQI A;  3SDG A;  1D5Y A;  1RES A;  3FIW A;  2LR8 A;  3W6V A;  2HYJ A;  1GDT A;  1WH5 A;  5HOD A;  2VI6 A;  1RR7 A;  3DEW A;  1AU7 A;  2JA5 J;  5F08 A;  1DU6 A;  4MFD A;  4QIW N;  1WGX A;  1UMQ A;  4A3J J;  1JUP A;  1OCP A;  1B8I A;  2NVX J;  2Y2Z A;  1GUU A;  1P7J A;  5EZH A;  2NS8 A;  2TCT A;  4JX6 A;  5BNG A;  1ETQ A;  2QCO A;  2XGC A;  1IV6 A;  2YUS A;  1RKT A;  2XGD A;  3MKL A;  1OJL A;  4X1E A;  2QF7 A;  4UUT A;  5F0H A;  3HEF A;  3L1P A;  5FKK A;  5E3N A;  2N8G A;  1RPW A;  3LSG A;  5FKO A;  1WH7 A;  4ABZ A;  3JRG A;  1JJ8 C;  1I50 J;  2L9R A;  2LTP A;  1RKW A;  5M5X J;  3CMY A;  1G2H A;  2DJN A;  2DMQ A;  4XID A;  4FIS A;  1U9O A;  4A3G J;  3S1N J;  4NDL A;  5FJ8 J;  2VUM J;  1MBK A;  4V2F A;  3MVP A;  2LP0 A;  3QQA A;  3H0G J;  4RDU A;  1BJZ A;  2FJ1 A;  3OSF A;  3Q0U A;  1O4X A;  4X6A J;  1E3O C;  3BT9 A;  1TC3 C;  5GPC A;  4IEJ A;  4MFE A;  1JGG A;  5E3O A;  1Z0X A;  3HGG A;  4L5E A;  4D5C A;  5J3L A;  5M3F J;  1XG1 A;  1YRN A;  4A3C J;  4QTR A;  1MH4 A;  1MNM C;  1ZTR A;  2M8G X;  2E2H J;  4Y7N J;  4A3D J;  3BR1 A;  3Q0V A;  1ZGW A;  1JKR C;  2DMT A;  2HOT A;  4A3M J;  2O7O A;  1X58 A;  2EZL A;  2HXI A;  3UKG A;  1MSE C;  2DA3 A;  3BR0 A;  5GP9 A;  4A69 C;  3HOV J;  1CQT A;  4I6Z A;  3S2D J;  3IH2 A;  3JRI A;  4W97 A;  1FEX A;  5IOY A;  1ETW A;  5F0F A;  1FIA A;  3PM1 A;  4BKX A;  4DYQ A;  3HOU J;  2EH3 A;  1TWG J;  1AKH A;  2KT0 A;  2LFB A;  1ENH A;  4IHW A;  3HOW J;  4C3H J;  5FLM J;  1ITY A;  5FLV A;  2JA6 J;  3MN2 A;  1IDY A;  1MH3 A;  2FX0 A;  2JWT A;  3BR5 A;  1HOM A;  1LE8 B;  3BTL A;  1JKP C;  1JKO C;  5IP9 J;  3GTM J;  2Y0S N;  2M2E A;  3CQZ J;  1PUF A;  2R7Z J;  2JMW A;  2EZK A;  1VND A;  3S15 J;  4M6V A;  1IDZ A;  1ZKG A;  4XK4 A;  3D1N I;  5JLX A;  2R0Q C;  5F1J A;  1DU0 A;  2DTZ A;  2XPW A;  3HGY A;  1B72 B;  1GV2 A;  3OIO A;  2HOS A;  1SAN A;  1XC5 A;  1JKQ C;  5M5W J;  3C2B A;  2L0K A;  3S17 J;  1S7E A;  2L7Z A;  2HOA A;  2MG4 A;  3NAR A;  5F0C A;  2EZH A;  2JA7 J;  5EZG A;  2E2I J;  5EGO B;  3I4N J;  4XRS G;  1GT0 C;  3ZQI A;  1T56 A;  4A3K J;  3JRF A;  2X6O A;  5F04 A;  4M3E A;  2ME0 A;  3BG3 A;  4JX4 A;  3JRB A;  3F0C A;  2M0C A;  3SJM A;  5DS9 A;  2ZB9 A;  5GPA A;  3GBG A;  2O8K A;  1JJ6 C;  4AYB N;  3GTJ J;  1EF4 A;  4BY7 J;  3O8G A;  1F43 A;  3GTK J;  1UHS A;  5K7H A;  1MBJ A;  1ZQ3 P;  1HDP A;  2G0E A;  3BQZ A;  2ECB A;  4A3I J;  4IHX A;  1P7I A;  2FQ4 A;  3O8H A;  3TED A;  2JJ7 A;  2XGE A;  1JTX A;  3G1M A;  1JUS A;  3WHB A;  4D7N A;  3E7L A;  3JRA A;  4IHV A;  2MW8 A;  2L7M P;  2HQ5 A;  3NAU A;  5C4X J;  2CU7 A;  2HXO A;  2WAQ N;  5J1U A;  1A5J A;  2M9H A;  4C3J J;  3OSG A;  3B6C A;  5IYC J;  1BW5 A;  3GTO J;  2XB5 A;  3JR9 A;  1LFB A;  2EQR A;  2JK3 A;  3GTQ J;  3HM5 A;  5JLW A;  1H8A C;  1RET A;  1WCM J;  1OFC X;  1I6H J;  5EYR A;  4W1U A;  2CUE A;  2M34 A;  4GFB A;  2K40 A;  1HF0 A;  2P81 A;  2CQQ A;  3ZQH A;  4AC0 A;  9ANT A;  2ID6 A;  4MO7 A;  4M3B A;  4M3F A;  2DMU A;  4MLO A;  1B72 A;  2PMZ N;  3GTP J;  3M4O J;  5E3M A;  3M3Y J;  3ZQF A;  2LKX A;  1H88 C;  3HKZ N;  2X48 A;  2LD5 A;  2RAE A;  4B4C A;  4EEF G;  1VF9 A;  4FE4 A;  3IV5 A;  4A3L J;  3JRC A;  4V2G A;  2YU9 J;  5EGO A;  1NK2 P;  2IAI A;  1UG2 A;  1JTY A;  3K7A J;  4DW6 A;  5M5Y J;  2E1O A;  4J19 A;  4D7M A;  1W0U A;  5DTD A;  1IJW C;  3BG5 A;  2DA7 A;  5EG0 B;  2K9Q A;  2OPT A;  4LOC A;  3BG9 A;  1MBG A;  1POG A;  2COB A;  1FJL A;  3OOU A;  2DA1 A;  3HB9 A;  4BBS J;  3S1R J;  4A93 J;  4M3G A;  5IPA A;  1NTC A;  2KDZ A;  1X2M A;  2H8R A;  1FIP A;  2YS9 A;  1ZR2 A;  4JP0 A;  1MSF C;  4CYC B;  3DCF A;  4JX5 A;  3TP0 A;  4AUX A;  5EF6 A;  4B3A A;  5FKL A;  2LVS A;  2AHQ A;  1BW6 A;  1HLV A;  3QPS A;  3SFI A;  4D5F A;  3B6A A;  2MGQ A;  3ZQG A;  3HOZ J;  1JT6 A;  5K7Z A;  1IC8 A;  1ETX A;  1MBF A;  3A02 A;  2XRL A;  1I3Q J;  4FCY A;  1WI3 A;  2Y30 A;  2ELK A;  3LNQ A;  3BR2 A;  1BA5 A;  3VPR A;  4DYR A;  1SFO J;  2VKE A;  2EZI A;  2DA2 A;  2OF7 A;  4BBR J;  2I10 A;  1XS9 A;  1ORK A;  1GVD A;  5E3L A;  3A01 B;  4FTH A;  1Q1V A;  2CUF A;  3BTC A;  2Y9Y A;  2CJJ A;  1VFC A;  2ME6 A;  3CCY A;  1U9N A;  2IEK A;  1ZR4 A;  3TW7 A;  3G1O A;  2Y31 A;  3BR6 A;  3BR3 A;  4UUS B;  3HOX J;  2R93 J;  1TWF J;  1HDD C;  1Z77 A;  3Q3S A;  2XPU A;  4HNV A;  4A3E J;  4I76 A;  1BL0 A;  3G1L A;  1X2N A;  1LFU P;  2R5Y B;  1JUM A;  1QRY A;  1AKH B;  3FKI J;  1VI0 A;  4FE7 A;  2NS7 A;  4QSH A;  5FKN A;  3JRE A;  4B1R A;  3LSP A;  5J1R A;  5IYB J;  3PO3 J;  5EG0 A;  2LK2 A;  4BXX J;  1QPI A;  1IRZ A;  1AHD P;  3GTG J;  1TWC J;  2LY9 A;  3RZO J;  4C2M J;  2W48 A;  4BY1 J;  2HDD A;  1ETV A; 
#chains in the Genus database with same CATH topology
 1YQA A;  4PZJ A;  1LE8 A;  4BYY A;  4XQF A;  3MEX A;  1FBU A;  4UB6 C;  3IH4 A;  3HRS A;  2O9L A;  1MJA A;  3SZG A;  2E1M C;  1QHG A;  3WTU C;  3A03 A;  2O8X A;  1WJC A;  3GTL J;  1MW7 A;  4YFN F;  1R58 A;  1HW2 A;  4HLX A;  4ZTF A;  1BOA A;  3ZOB A;  1R00 A;  5BPD A;  2CQK A;  1Z6T A;  2LG4 A;  3NRV A;  2E7X A;  2E60 A;  2XPV A;  3MWM A;  2EK5 A;  2FQ3 A;  3EUH C;  1OYI A;  3SZT A;  3S1Q J;  2QQ8 A;  3RSN A;  4NQW B;  3IL2 A;  2HVQ A;  2UUZ A;  2QQA A;  4HV5 A;  1P4W A;  1EH8 A;  2RV8 A;  2KKO A;  2BVL A;  2ICW G;  2XF7 A;  3ZP5 A;  1YIJ I;  3V8J A;  2D5V A;  4G12 A;  1VQ5 I;  2M4K A;  3D5S C;  1ETK A;  3Q9S A;  4A0Z A;  4HBL A;  2BXZ A;  1DP3 A;  2LYC A;  4CGZ A;  2K9S A;  4MTD A;  4IZZ A;  5L3D A;  2H1L A;  2P5V A;  2YX4 A;  3Q9V A;  2CRG A;  4A0Y A;  3HOY J;  1BC7 C;  4PFP A;  1R36 A;  3HDD A;  3JRH A;  2DMN A;  2HZT A;  3DFG A;  4JQF A;  4ASN A;  1R9T J;  2FU4 A;  1H89 C;  5IP7 J;  3H1C A;  4LK1 F;  1APL C;  2AQE A;  2OAZ A;  3I55 I;  2V7F A;  1U3E M;  2A05 A;  4KIG A;  3PQJ A;  2XSD C;  2GLO A;  4M3D A;  2LDU A;  2GOM A;  3DBL B;  2RC4 A;  5JR3 A;  2GOX B;  4DZP A;  4BHB A;  3FK7 A;  3BTI A;  5K5O A;  2UWM A;  4HA8 A;  4YRV A;  5JI6 A;  2KIM A;  5L3C A;  2K5C A;  1T0F C;  1HKT A;  2VKV A;  4BHC A;  2VKD A;  4XOR A;  3L2Q A;  3QPL A;  2R4G A;  3C18 A;  2X9D A;  3O3K A;  5L3G A;  2NVQ J;  3IH3 A;  2R92 J;  3M1C A;  2QVO A;  3EET A;  1CGP A;  2DXI A;  1YRN B;  3ZR8 X;  3RTR A;  2FBI A;  3WHC A;  2GXA A;  1KON A;  3ZQL A;  1K61 A;  1E2X A;  3N05 A;  3GFI A;  2ZME C;  2LNB A;  3RQI A;  5LRS A;  3SDG A;  2P5K A;  2GXB A;  1EH6 A;  2QLZ A;  1RR8 C;  2BHY A;  1P92 A;  3LAJ A;  1JE8 A;  3W6V A;  1W4M A;  3QU6 A;  3VDX A;  2NRA C;  3BC8 A;  4CZZ A;  5IT9 K;  1YO5 C;  1KA8 A;  1D0Y A;  3HL2 A;  4R1H A;  2OJE D;  3DEW A;  1PYV A;  1R6R A;  5LGN A;  1AU7 A;  2JA5 J;  1RIO H;  2XAG A;  3I4P A;  4KMU X;  4RGU A;  1ZG1 A;  4XKW A;  2EV5 A;  1OCP A;  4WXC A;  4CCJ A;  1TT5 B;  4LJZ F;  1LEB A;  1X3U A;  5KK1 A;  3LFK A;  3HRT A;  2TCT A;  2HFH A;  4JX6 A;  3L00 A;  1D8J A;  1ETQ A;  1ON1 A;  2XGC A;  1RKT A;  4O5V A;  1OJL A;  5KAF C;  4X1E A;  4UUT A;  1X3W B;  3HEF A;  5FKK A;  2BY3 A;  4S05 A;  2IXS A;  5FKO A;  1MDM A;  1JJ8 C;  3CP2 A;  2VXZ A;  3DTE A;  3CO6 C;  2LTP A;  2M1B A;  3ZMZ A;  1K79 A;  4M73 A;  3GUD A;  3BRO A;  1G2H A;  3NQO A;  2ZSH B;  5D5V B;  4XNF A;  1J59 A;  3S1N J;  2GAU A;  2VUM J;  2P5L C;  4JOM A;  4HF0 A;  3VYR B;  1OYY A;  2QUF A;  4V2F A;  5FRO A;  5HVQ C;  2M7B A;  2H8W A;  5BOX A;  2FJ1 A;  3OSF A;  2Y0S A;  2KMU A;  1O4X A;  4X6A J;  1XDS A;  3OV8 A;  1E3O C;  1TC3 C;  4U0V A;  5D4S A;  5E3O A;  4IO9 F;  4D5C A;  3HHG A;  5J3L A;  2WB1 A;  4BU2 A;  4UY8 I;  3LST A;  1UZC A;  3I9V 2;  2KIS A;  1YRN A;  2Z1D A;  5BPI A;  1MH4 A;  4F3Q A;  3CCU I;  1U0J A;  4P9F A;  4A3D J;  3Q0V A;  2VOD A;  3BZC A;  2JPC A;  4L9V A;  2PN6 A;  3L9F A;  1FLI A;  2HKO A;  3BZK A;  4BEH B;  1YJW I;  4EM1 A;  1Z3Y A;  1ZRC A;  2EZL A;  2HXI A;  4CA0 A;  1YJ9 I;  1SVO A;  4WX9 A;  3ECO A;  4EJT A;  4PDK A;  4FHT A;  3HOV J;  1R5I D;  3RYP A;  5LEJ A;  2WBM A;  4I6Z A;  2KLO A;  2LKS A;  2LSO A;  1BR2 A;  2H09 A;  3JRI A;  4W97 A;  2O6G E;  4EVI A;  5IOY A;  2Z99 A;  1ETW A;  3B73 A;  4ESJ A;  5FO5 A;  3KPH A;  2EIJ H;  2IP2 A;  4BKX A;  2IA1 A;  1BI0 A;  4DYQ A;  3HOU J;  4KA4 A;  2LFB A;  2VAS A;  1ITY A;  3BJA A;  3E5Q A;  1IN8 A;  1MH3 A;  1T08 B;  2FX0 A;  4IJA A;  1HOM A;  2B9S A;  3PSF A;  2BOL A;  1MMA A;  3BTL A;  5FFX A;  1JKP C;  1JKO C;  2IT0 A;  2Y0S N;  1SD6 A;  1IRX A;  1VQN I;  2HQA A;  2QGU A;  2R7D A;  1PUF A;  4YEJ A;  4KJZ A;  5GAE J;  2FBH A;  1U5T B;  2A69 F;  1VQP I;  2JMW A;  3U9G A;  2E1N A;  2VQH A;  4ZYG A;  3S15 J;  3QWL A;  4M6V A;  3D1N I;  4XK4 A;  2R0Q C;  3OY9 A;  1DU0 A;  1W5C C;  3TKY A;  3IRR A;  3LA3 A;  3OIO A;  2HOS A;  3QOP A;  2RQQ A;  1JKQ C;  3DTK A;  1IW7 F;  4ZDL A;  3KP4 A;  2COM A;  2LBF B;  2C6Y A;  1XMK A;  2HOA A;  1YE9 A;  2RKH A;  1K6Y A;  2F5E A;  4F55 A;  2E2I J;  5EGO B;  3I58 A;  2E36 A;  2ZJQ F;  2F5D A;  3ZPL A;  3HYI A;  3ZQI A;  3PFY A;  3JRF A;  1ACI A;  3MKZ A;  3KYC B;  3QAH A;  5E20 A;  2X6O A;  5F04 A;  1YTY A;  2ME0 A;  4JX4 A;  3TO7 A;  5CVJ A;  3CZ6 A;  1O3R A;  3DPT A;  3M7G A;  2HQR A;  3PL8 A;  5DS9 A;  3OR1 C;  5GPA A;  4BEH A;  3K4K A;  3GTJ J;  4MTE A;  2K4B A;  1ZRD A;  1F43 A;  4R79 A;  1GXP A;  1B9M A;  1UHS A;  2E1M B;  5K7H A;  1ZQ3 P;  2R7Q A;  3F72 A;  2ECB A;  4A3I J;  3ZN1 A;  1R5H A;  3TDZ C;  4G9Y A;  2XGE A;  2BY2 A;  3G1M A;  5HS9 A;  5TRD A;  2DK8 A;  4HAM A;  4IHV A;  3E5X A;  2FRH A;  2A6T A;  1QA6 A;  4ZYA A;  2P7C B;  1X3Z B;  4RGR A;  5J1U A;  4UVC A;  4GO1 A;  2KRC A;  5E1X A;  1A35 A;  2DW4 A;  5GAG J;  3H0D A;  3U1D A;  3T8R A;  3JR9 A;  1DUX C;  3CF2 A;  5F64 A;  3MD2 A;  4P9U A;  3SHF A;  3I56 I;  1YX5 A;  1IV8 A;  4RM3 A;  5J47 A;  4HQE A;  2JK3 A;  2EPF A;  2XRN A;  1BI3 A;  3CJT B;  3HM5 A;  3K4B A;  3BPX A;  5JLW A;  1XTA A;  2E71 A;  3GFL A;  3F6O A;  1WCM J;  3I53 A;  2RRE A;  1J5Y A;  3FBI B;  1TBX A;  4D1Q A;  2L01 A;  4B47 A;  3ZRG A;  2IGM A;  2LH9 A;  1D0Z A;  2PQ8 A;  4RB2 C;  4BE2 A;  4MO7 A;  3J7Z I;  1Z7U A;  4JBA A;  5H6Q A;  1DGR M;  1KU3 A;  3TOA A;  5DYM A;  4DGW B;  3M4O J;  5E3M A;  3DBR B;  1P9Q C;  3ZQF A;  3G71 I;  4EM2 A;  4IOA F;  5D5W B;  3J7A O;  1MMN A;  3EQL F;  3QP5 A;  1H88 C;  1KZH A;  2E7W A;  2CUJ A;  4KUM A;  1Y0U A;  3GF2 A;  2LD5 A;  3IV5 A;  3LWF A;  3PNT A;  2X1E A;  2W7N A;  5EGO A;  3OIP A;  4MGR A;  4BH9 A;  1NK2 P;  4OIQ F;  1ZG5 A;  2DFF A;  2KZG A;  1W0U A;  1TNT A;  3I3L A;  4ENK A;  2DA7 A;  1FPQ A;  4A0X A;  1YIO A;  1IF1 A;  2QQB A;  3RPU A;  3ROU A;  4KMF A;  4PJN A;  3P9K A;  2V9V A;  4Q5S F;  1LJ9 A;  3OOU A;  1SC7 A;  3BY6 A;  4ANJ A;  1UEL B;  3HB9 A;  4M6X A;  3WE2 A;  3VOE A;  4BBS J;  3GZ5 A;  2DT7 B;  3S1R J;  2DOD A;  2OC6 A;  1V4R A;  3RIR A;  3VEP A;  3FXK A;  3RPU D;  1SAX A;  1ZR2 A;  2YS9 A;  1SVL A;  4JP0 A;  1MSF C;  2EB7 A;  2BBY A;  3WTV C;  2XUB A;  4B3A A;  3WTX C;  2V9K A;  3VWB A;  2FOK A;  1IAW A;  2LVS A;  5DDG A;  1BW6 A;  1T95 A;  3EUH A;  1X1P A;  1ZYR F;  2JUG A;  4UV9 A;  3S32 A;  3KYL A;  1MBF A;  3A02 A;  1QPM A;  2XRL A;  4FCY A;  2Y30 A;  3LNQ A;  3F9K A;  1BA5 A;  1OLT A;  3K4J A;  3VPR A;  4DYR A;  3E97 A;  2VKE A;  4IXA A;  2OD5 A;  3CDH A;  2VBZ A;  3WGG A;  1ZRF A;  2PLY A;  4EJU A;  2FEZ A;  1XS9 A;  1QGP A;  2XAF A;  4RB3 C;  4U0Y A;  1EV7 A;  1HA8 A;  1Y0N A;  1GVD A;  3CMM A;  4XM3 A;  2M4G A;  3IWZ A;  3RPQ A;  2CUF A;  3BTC A;  2VKH A;  4BE1 A;  5DD8 A;  2EFO A;  1ODD A;  3CCY A;  3FXQ A;  3IRQ A;  3HPG A;  1TW3 A;  3ZQQ A;  3W6K B;  2V1D A;  5HDK A;  4BAY A;  3BR3 A;  3HOX J;  4U7D A;  1TWF J;  3Q3S A;  1G8X A;  4NC6 A;  3W2V A;  2K3F A;  4P55 A;  2BZT A;  2JUC A;  1LFU P;  4AVZ A;  3G6E I;  3EYI A;  2R5Y B;  1STZ A;  3E6D A;  1QRY A;  2W24 A;  4PSW A;  2EIN H;  3IC7 A;  3JRE A;  2NS7 A;  1BN5 A;  2LF7 A;  1T0F A;  4LIV A;  3PO3 J;  2E5N A;  3F6V A;  3WG9 A;  1R5G A;  4LG0 B;  2VLA A;  1AHD P;  1WJD A;  2X51 A;  2XAS A;  3LA2 A;  2WV1 A;  4PCQ A;  2L4A A;  4MIM A;  1MBE A;  2HWV A;  2HU9 A;  3KEO A;  4GDF A;  4LG3 A;  2G7H A;  2E1C A;  1TL8 A;  1HCR A;  2XAU A;  5LLQ A;  2IW5 A;  4HNT A;  5M3M J;  2HGC A;  1I3A A;  2ISY A;  2W85 A;  3R0J A;  4GYI A;  3ZQC A;  2XDV A;  3DWL E;  3HBL A;  2XRO A;  4HST A;  1OCC H;  1RZ4 A;  4OMZ A;  3BQY A;  5DCM A;  2DOE A;  1ETO A;  1MBH A;  2GA1 A;  5D5U B;  5C3E J;  5ICE A;  4BQA A;  4CO8 A;  2HPI A;  4M9S A;  3DKX A;  2QM3 A;  5LD2 C;  2VQC A;  1NG7 A;  1E3H A;  5F27 A;  4YFX F;  3QPT A;  1ETY A;  2KDO A;  2K3P A;  3PO2 J;  4BDZ A;  2YPR A;  3LOC A;  4KIT B;  1QVT A;  2FNP A;  3SZP A;  4F7Z A;  2O03 A;  3RKQ A;  3LQR A;  1JT0 A;  3BG7 A;  2V79 A;  1XN7 A;  1XMX A;  3FK6 A;  4HG2 A;  1YS6 A;  3K69 A;  2DAO A;  1DP7 P;  4ON0 A;  2H1K A;  2VBX A;  1WZ2 A;  4E70 A;  3FZV A;  3WTZ A;  2VB6 A;  4K2E A;  2R5Y A;  1ZLK A;  4OMY A;  4PJM A;  1H0M A;  2QEN A;  1R1U A;  1UHM A;  2O3F A;  1LNW A;  2HPM A;  3FIS A;  3H5A A;  3I71 A;  3M8E A;  1IGN A;  4IHY A;  2KRF A;  3OL4 A;  3HIF A;  2F5V A;  1ZK8 A;  1IG7 A;  4LG0 A;  5E8I A;  4UB8 C;  5IOZ A;  4LLL A;  3TO9 A;  2CYY A;  3C7J A;  3TW6 A;  2DTR A;  2CV2 A;  3S16 J;  1DGW Y;  1QZE A;  1OPC A;  2V9P A;  2A6H F;  3S2W A;  3HSE A;  4R8H A;  2DMP A;  1D1B A;  3L2R A;  1ZAR A;  3CES A;  1KYW A;  1V5F A;  4Y33 A;  3ZGK A;  3ABU A;  3TGN A;  2DA6 A;  2W25 A;  2KP6 A;  3GCM A;  3E3V A;  3W2W A;  3A0H C;  2FML A;  3OYC A;  5ERI A;  4L9N A;  4DZJ A;  5HLG A;  1U5T C;  3FXL A;  1D5Y A;  4ENM A;  2OQR A;  1G3T A;  2LR8 A;  4N9H A;  2X6W A;  2L3D A;  3VSK A;  1WWX A;  4GGG A;  2MLK A;  3DP7 A;  3GLX A;  5DV5 A;  2HYJ A;  2KL4 A;  3CLQ A;  3KEQ A;  1WH5 A;  4A5M A;  2VI6 A;  3LA7 A;  3OS0 A;  2HVR A;  1F9N A;  1IRF A;  5F08 A;  1J75 A;  2HDW A;  4QIW N;  4IX7 A;  1UMQ A;  3CUO A;  1J9I A;  2PG4 A;  1PP7 U;  2HTJ A;  5KNL A;  3DU6 A;  1OCO H;  2Y2Z A;  1D8K A;  5BNG A;  5LGT A;  3KP5 A;  2QCO A;  3LL7 A;  4MQV A;  3H35 A;  1IV6 A;  2ADU A;  4TV7 A;  1SFE A;  4EV0 A;  1LFP A;  3MKW B;  1SMT A;  2GIV A;  1Z21 A;  3ASN H;  3GYH X;  4KNY A;  3G2B A;  2N8G A;  3JSP A;  4IRG A;  1I50 J;  2V26 A;  1I5Z A;  2LF8 A;  3BCA A;  1JXS A;  3OS1 A;  2ESH A;  3CMY A;  2RVC A;  4I02 A;  2DMQ A;  4LIU A;  4II3 A;  3OYH A;  4XSZ F;  1XDU A;  1LPQ A;  2V1U A;  1YOV B;  3FMS A;  2V4J C;  4I98 B;  5EJC A;  1RUN A;  3ABK H;  1MBK A;  3DPU A;  4FQG A;  4A2U A;  2VPL A;  1LUJ B;  3MVP A;  4G6Q A;  1MD0 A;  1XSD A;  3H0G J;  1BJZ A;  2L7K A;  3OYD A;  4L0Z B;  5HS8 A;  1K4S A;  3Q0U A;  1DQU A;  3BT9 A;  3J81 Z;  2M8E A;  4IEJ A;  1UJ8 A;  2XIG A;  3HGG A;  2STT A;  5M3F J;  1FX7 A;  1XG1 A;  3AG2 H;  3BG6 A;  4BAC A;  2CQN A;  2VC1 A;  2BEO A;  2M8G X;  2E2H J;  4NBQ A;  4UV8 A;  1P6R A;  1JKR C;  4CYD A;  2O61 A;  1FBQ A;  3C3W A;  4DBQ A;  2OV7 A;  1HC8 A;  1I1S A;  1NHA A;  1BBY A;  2ESN A;  1X58 A;  3WU0 A;  2V1X A;  1MSE C;  2Q0O A;  1FMV A;  3BR0 A;  3K1M A;  5B1A H;  5GP9 A;  3I59 B;  1SFX A;  2VE8 A;  5EEH A;  5FRM A;  5FFZ A;  4C30 A;  3IWF A;  2EJR A;  3KP2 A;  1FEX A;  3HOT A;  4HRI A;  1PJR A;  3I5U A;  2EWN A;  5E1W A;  4B8X A;  1BC8 C;  3QOE A;  1DPU A;  2EIK H;  1XGM A;  2EH3 A;  2DT6 A;  2KT0 A;  3FXM A;  4IHW A;  3K0L A;  4DOZ A;  4HF1 A;  2Q2E A;  3MN2 A;  2XAQ A;  3ZMD A;  3FHN A;  1P4X A;  4YEL A;  5LBQ A;  2UXN A;  3M9A A;  4L18 B;  4KIF A;  1QHH D;  3LQQ A;  1R71 A;  3M8J A;  1R4N B;  3WTY C;  1TP4 A;  1K78 B;  5IP9 J;  2VJJ A;  3GTM J;  2L4M A;  2JVH A;  4BUP A;  1XMA A;  3CQZ J;  3M07 A;  2ZXH A;  2R7Z J;  2BE5 F;  1ZHF A;  3SFZ A;  2WAQ A;  1XGO A;  2WAD A;  2W00 A;  1FC3 A;  1AA7 A;  2KHM A;  2EFN A;  2HQN A;  3CUQ B;  4AU7 A;  5JLX A;  2QBY B;  1PUE E;  3CD6 I;  4G6T B;  3FM5 A;  1B72 B;  4CUG A;  2LKP A;  3R0A A;  1SAN A;  1XC5 A;  5FRN A;  1YW9 A;  3N97 A;  2A61 A;  1YHQ I;  1YYV A;  2MG4 A;  1SD5 A;  3H9Q A;  3T1B A;  3NAR A;  1U6G A;  3DLL F;  5TIS C;  3R61 A;  4L5J A;  1YLF A;  1GT0 C;  3I4N J;  5KHD A;  2X1D A;  1XD7 A;  4NQW A;  2CW0 F;  3F8M A;  1A04 A;  4OIO F;  4A3K J;  2VOP A;  4ZZL A;  5AIP A;  4EQQ A;  3F22 A;  2QZ8 A;  1IXS B;  2K02 A;  3S3M A;  3CME I;  1KU7 A;  3JRB A;  2NYX A;  2VC0 A;  1VTN C;  2P4W A;  2F4I A;  5D8L B;  3CJR B;  5K5R A;  3DEU A;  1D5V A;  2FNA A;  5L3F A;  3KLO A;  3GVA A;  2KIQ A;  1UAA A;  1FOK A;  4M6Y A;  3GBG A;  3U1K A;  1S9H A;  1JJ6 C;  2JSP A;  2KJB A;  4BY7 J;  1M1E B;  4P1W A;  1MBJ A;  1A36 A;  1IZ1 A;  3I59 A;  2GA2 A;  3CCJ I;  3KE2 A;  1P7I A;  4NNJ A;  2A5W A;  1HSJ A;  2VJI A;  4D7N A;  5GAH J;  3JRA A;  1QBJ A;  1XGS A;  5LGU A;  3NAU A;  1FYL A;  2WAQ N;  2WY8 Q;  3PNY A;  3CC4 I;  1A5J A;  2M9H A;  3JAM Z;  4C3J J;  3O2P E;  1AWC A;  4OAY A;  4B48 A;  3P9C A;  4G94 A;  3GTO J;  5E8G A;  3WG7 H;  1LFB A;  3LSH A;  3OYN A;  2DBB A;  3OOP A;  1BOB A;  5DCF A;  2M7A A;  2OTJ I;  2ELJ A;  5ILV A;  1I1G A;  4RGX A;  1RET A;  4HW0 A;  3H5R A;  5JVG F;  2Z16 A;  3S93 A;  2R7W A;  1K78 A;  1N25 A;  4DQ2 A;  3OMY A;  3KYD B;  4G6D A;  1I6H J;  3CJN A;  1NG6 A;  5CPR B;  2QQ9 A;  4F91 B;  1TT0 A;  1I27 A;  2K86 A;  3V42 A;  4GFB A;  2HR3 A;  3ZQH A;  1R23 A;  3NWT A;  5AIQ A;  1ON2 A;  2ZJR F;  3V8L A;  2QBY A;  4IHS A;  2DMU A;  1VQM I;  1B72 A;  1MMD A;  2V6E A;  4ETS A;  1YW8 A;  3HKZ N;  3R60 A;  4JK1 X;  5JVT A;  2RAE A;  4EEF G;  1FOW A;  1D1A A;  4FE4 A;  4A3L J;  3JRC A;  4B09 A;  3VYS B;  3FX3 A;  2OQG A;  3PQK A;  1PP8 F;  2CUZ A;  1XGN A;  2GXG A;  5DM6 F;  5M5Y J;  2E1O A;  4J19 A;  1TTY A;  4FX0 A;  1ZG3 A;  5DTD A;  1IJW C;  3JW4 A;  4RAF A;  4ENJ A;  3E5U A;  2A6E F;  3W3C A;  3RJP A;  5EG0 B;  2K9Q A;  1EA3 A;  2OUM A;  3BG9 A;  4LFU A;  1FYM A;  2DQL A;  3BJ6 A;  1Z91 A;  4XON A;  4V19 K;  4RGS A;  3W2A A;  4M9Z A;  3DLA A;  2P6S A;  4Q48 A;  4BHP A;  3WTW C;  3B02 A;  4M3G A;  3SYT A;  3RDI A;  1NTC A;  1E0E A;  1JGS A;  2CS3 A;  3OYI A;  3ZN0 A;  4QPO A;  4OAZ A;  1SMY F;  1WJE A;  1X2M A;  4H4K C;  1O3T A;  3AL0 C;  2DOF A;  2CG4 A;  3V7C A;  4CYC B;  1V5E A;  3DCF A;  4JX5 A;  3ONQ A;  4AUX A;  2Y69 H;  5FKL A;  2BW3 B;  2AHQ A;  2YR2 A;  2VJ4 A;  4NC8 A;  1QU3 A;  1HLV A;  2RGV A;  3TO6 A;  3HOZ J;  5K7Z A;  1IC8 A;  1G6N A;  1HW5 A;  2LRE A;  1WJA A;  4N9I A;  4G8X A;  1VQO I;  3BR2 A;  1JI8 A;  2WA0 A;  3BWG A;  3C2H A;  2WY7 Q;  2DO7 A;  3HPH A;  2FE3 A;  2M45 A;  2DA2 A;  1G3Y A;  3E1S A;  2HS5 A;  2I10 A;  3KP7 A;  2JRT A;  5E3L A;  3WOD F;  3A01 B;  1XSV A;  1YI2 I;  4XKV A;  1IXC A;  2Y9Y A;  2CJJ A;  2ME6 A;  3W6J B;  3UNG C;  5D8K B;  4I7H A;  3TQN A;  1T2K A;  1IXR C;  3ERM A;  2VJ5 A;  4C2T A;  3CMA I;  3TW7 A;  2EFQ A;  4F52 A;  3SDB A;  3CCE I;  2L9S A;  3K4C A;  2FXA A;  4A3E J;  2CSO A;  3KP6 A;  4I76 A;  3MFK A;  1BL0 A;  1QNT A;  4PJJ A;  4OIR F;  4E7L A;  1JUM A;  2H6B A;  1QQI A;  1AKH B;  3FKI J;  1YFH A;  3J81 K;  2KPM A;  2F5C A;  5J1R A;  3QOD A;  5EG0 A;  4P5O A;  3QPH A;  4BXX J;  4E7Z A;  3GTG J;  4XLA A;  1EKE A;  4BY1 J;  2W48 A;  5FLX Z;  4J00 A;  4IKF A;  4FT8 A;  2NVT J;  1IO2 A;  2NVU B;  2VL8 A;  3F8C A;  1FSH A;  2DA4 A;  1Y1V J;  1S5L C;  4E7S A;  5DUI A;  4I09 A;  5HDG A;  1A6I A;  1U5T A;  3LSI A;  3PFI A;  2NXN B;  4I99 C;  2R5Z B;  4EGZ A;  4CYC A;  3KZY A;  2DFE A;  3FMR A;  2FOW A;  2LLK A;  1S7O A;  4Y52 J;  4A3B J;  2WC2 A;  3L09 A;  5DD4 A;  1WPK A;  2XSJ C;  2UXX A;  1D3Y A;  2MC3 A;  4XRS A;  3S3N A;  4ZYD A;  2LBF A;  2JA8 J;  1MJ9 A;  2B63 J;  2E34 A;  4RB1 A;  2HOE A;  3JSO A;  2CMP A;  4S0H B;  3CDI A;  2L5Q A;  2XF6 A;  2ECC A;  2MSY A;  3NEU A;  2EBI A;  3KP3 A;  4PK4 A;  3ZQ7 A;  1USS A;  3HG9 A;  1K83 J;  2VN2 A;  2V1N A;  1B8I B;  2JQ7 A;  4DJA A;  1UG0 A;  4CCL A;  2Z33 A;  4E4H A;  3BTJ A;  1RRJ A;  2L9N A;  5J4Y A;  3A01 A;  3H3V K;  2XKO A;  2AO9 A;  1G3W A;  2DA5 A;  2Z3Y A;  4CCK A;  3OYM A;  5HLT A;  1ZEL A;  3ML6 A;  3DPL C;  2XAH A;  1K6O A;  3GX4 X;  4ZDO A;  3JRD A;  3GEZ A;  3CTA A;  2Z9O A;  5EDN A;  4RBO A;  2M5W A;  2HNH A;  1GV5 A;  4XLC A;  2EA4 A;  5KCM A;  2AS5 F;  2EV6 A;  2DK5 A;  4MQ9 F;  2A5Y B;  5LHI A;  5CLS A;  3RCO A;  5K1Y A;  1FP1 D;  2L7F P;  3QYE A;  4NB5 A;  3P9I A;  2HTS A;  4YG2 F;  3LSR A;  2VPR A;  1EH7 A;  1MJB A;  3K2A A;  3RZD J;  4L9T A;  5C44 J;  3S14 J;  3S2H J;  4A3F J;  4EM0 B;  3LSJ A;  2LY1 A;  1S29 A;  4PGH A;  3REO A;  1FTT A;  2BYV E;  1TZL A;  2DQR A;  4RA2 A;  1VQ9 I;  4CH7 A;  2OCE A;  4HX4 A;  5IYD J;  1X19 A;  2A3S A;  3ECH A;  5C4J J;  1TWH J;  5CVV A;  1OCT C;  2Y9Z A;  1LVA A;  3WU2 C;  3TP3 A;  1MKM A;  2CQX A;  4JYK A;  3NWS A;  3K4M A;  5J4V A;  3RYR A;  1ONV A;  2R5Z A;  5JHF A;  1HXD A;  2F2E A;  3H92 A;  5H20 A;  2IRF G;  4UVA A;  2BGC A;  3BDD A;  1VQK I;  1F36 A;  1T6S A;  1RES A;  3FXJ A;  2Q1Z B;  4YII A;  3HXL A;  1S8N A;  2LY2 A;  3CUQ C;  3D5L A;  3AAF A;  3GME A;  4BNC A;  3JAM K;  3CCL I;  3T0Y A;  1BI1 A;  5E79 C;  3SXY A;  3FBN B;  3MZ8 A;  2ISZ A;  1ZLJ A;  2XF5 A;  2FSW A;  4N4N B;  1HBX G;  1J2X A;  4DBR A;  1RNL A;  3KET A;  3DTI A;  3HHH A;  1WGX A;  4IOC F;  3GWZ A;  3TMO A;  4A3J J;  3L2C A;  2Z2S B;  4DIQ A;  1B8I A;  4CIC A;  2DT5 A;  6PAX A;  1EJ9 A;  5F1R A;  2NVX J;  1N77 A;  1IN4 A;  1GUU A;  3A1Y A;  5EZH A;  2NS8 A;  2XVC A;  3HZJ A;  2PMU A;  4U0W A;  3H3Z A;  3WTS C;  1X1C A;  2YUS A;  2XGD A;  2UV1 A;  3CCM I;  1GVJ A;  2QF7 A;  3ZCO A;  4CCN A;  1RI7 A;  2QKL B;  5E3N A;  4XKC A;  1RPW A;  3ZMS A;  5F6F A;  5ILS A;  3HSF A;  2QSG X;  3CO7 C;  3MCZ A;  1RKW A;  1LDJ A;  2BHZ A;  1FSE A;  4A3G J;  1C0W A;  1BJA A;  3CCR I;  4FAS D;  4UHT A;  4NC7 A;  3H36 A;  1IN6 A;  4RDU A;  2QWW A;  3PUB A;  3ISP A;  1WRJ A;  3ERE D;  1V5G A;  1Y8Q B;  3WTT C;  3MQ0 A;  1JGG A;  1Z0X A;  2CV0 A;  1OYW A;  4ZDP A;  5HS7 A;  4A3C J;  4QTR A;  4OOI A;  3U2R A;  2NNY A;  4Y7N J;  1GHC A;  2MBF A;  1K4T A;  4OIP F;  4X0G A;  4Z6Y A;  1E17 A;  1J7K A;  2KJC A;  3IKT A;  1MGT A;  3CJQ B;  2R7V A;  2W1O A;  2XGX A;  5CVI A;  1Z9C A;  3UKG A;  2K4J A;  2DA3 A;  1WSU A;  1I39 A;  2O0Y A;  2QYO A;  3AL0 B;  2DYS H;  4A69 C;  3S8P A;  1CQT A;  2NNN A;  2CWE A;  5GAD J;  3L2V A;  1BM9 A;  3O6B B;  3ELK A;  3G4S I;  2YX7 A;  5F0F A;  4CCO A;  3DF8 A;  1FIA A;  4CXF A;  4PJ0 C;  2CH0 A;  2HYG D;  3WU1 B;  4D9J A;  5B5E C;  1TWG J;  1YIT I;  3L2U A;  1KU2 A;  2XC7 A;  1U8R A;  2FA5 A;  5FLV A;  3CP8 A;  2H6C A;  4E7H A;  3BR5 A;  4RAZ A;  2ZFU A;  3G73 A;  1LE8 B;  5E1Z B;  2I8D A;  5J8C A;  3KFW X;  5LHH A;  4O6J A;  5GTH C;  2VXD A;  3HSR A;  2A07 F;  4ZJZ A;  4HYE A;  1F1Z A;  2P0W A;  1HW1 A;  2EZK A;  3GFM A;  1G3S A;  4H0E A;  2WAF A;  1YW7 A;  3IAS 2;  3KZZ A;  4NUB A;  2ZJ2 A;  4A6E A;  5LEK A;  1ZKG A;  1UHW A;  2DTZ A;  2XPW A;  3HGY A;  4N4O B;  4XSX F;  5CVR A;  5K5Q A;  2HVS A;  4HSR A;  3RQ4 A;  1UB9 A;  4KIC A;  2DPD A;  4M71 A;  3OYJ A;  3E6C C;  4QLC U;  3KIO A;  2L7Z A;  1KU9 A;  2FMY A;  4ZC3 A;  2MH2 A;  1WI9 A;  4II2 A;  2EZH A;  2JA7 J;  2D1V A;  2MFZ A;  4XRS G;  4EAT A;  2W57 A;  1MMS A;  3HJE A;  3VB2 A;  5FLX K;  5GTI C;  5KVR A;  2L02 A;  5EEG A;  4BQO A;  2F6C A;  1ZGA A;  3AG1 H;  4BQQ A;  4M3E A;  2ACJ A;  3SJM A;  4A12 A;  4OWR B;  2L54 A;  3HRM A;  4KFC A;  4HX7 A;  4XLN F;  3M1E A;  2ZB9 A;  1D0X A;  4GYG A;  2QKM B;  2ZXI A;  2JPB A;  3OYK A;  3MAJ A;  3OS2 A;  2O8K A;  4AYB N;  3IAM 2;  2PEX A;  2IS6 A;  3O8G A;  3CCV I;  3R4K A;  2QSH X;  1HDP A;  2R3S A;  3GFJ A;  2G0E A;  1W7P B;  3WE3 A;  2FQ4 A;  2JJ7 A;  5CJ9 A;  3WHB A;  1JUS A;  1LDD A;  2AXT C;  1OCZ H;  2MW8 A;  2ZNZ A;  3ABT A;  4E7K A;  2CU7 A;  2LMD A;  2BV6 A;  1SVM A;  1FY7 A;  3DXJ F;  1JHF A;  4A6D A;  4HNU A;  3AG3 H;  4AVP A;  3OYB A;  5IYC J;  1WJ5 A;  1BW5 A;  4P96 A;  4MHG A;  2XB5 A;  3MMY B;  2EQR A;  2CGP A;  3PUF A;  4QPQ A;  1FOY A;  4XMY A;  4G7O F;  4XLE A;  2EV0 A;  2LC2 A;  3FF5 A;  3QYB A;  4OIN F;  3FXO A;  4BS9 A;  1N78 A;  2NOJ B;  5ICG A;  4GRI A;  3H9G A;  2HZD A;  2R7F A;  2H27 A;  5EYR A;  2CUE A;  2M34 A;  1W5T A;  2IS1 A;  1HF0 A;  4HOB A;  2P81 A;  5FD5 A;  4XBF A;  9ANT A;  2ID6 A;  2MD5 A;  2LOO A;  3PIP F;  3GW2 A;  5D6F A;  2NS0 A;  4M3F A;  4WXH A;  2ZBK A;  1S6L A;  2G7U A;  2LKX A;  3P7N A;  1B6A A;  2QA4 I;  5AON A;  3ULQ B;  4A5N A;  2NAZ A;  2GIZ A;  2X48 A;  2VE9 A;  4B4C A;  1REP C;  2HEO A;  3K4N A;  4V2G A;  1X4O A;  2M0M A;  2R7R A;  3BJO A;  3V7R A;  2YU9 J;  4RLQ A;  3SEQ A;  1HKQ A;  1SEU A;  2IAI A;  1WJB A;  1FMW A;  1UG2 A;  1JTY A;  2MAB A;  4ENN A;  3Q5F A;  4B3X A;  2JRM A;  4DW6 A;  4D7M A;  1FNN A;  1R1T A;  1W36 C;  2KIU A;  1MZB A;  3GXO A;  3BG5 A;  3ZMT A;  2CFX A;  2OPT A;  4LOC A;  1MBG A;  3OWT A;  4S04 A;  3IHU A;  2MC4 A;  1FJL A;  1FZP B;  5FD6 A;  2DA1 A;  4MEX F;  1KQ9 A;  1MDM B;  2FF4 A;  3GZ6 A;  1NH3 A;  4Y4R A;  2R7T A;  3DU5 A;  4PFO A;  4GCV A;  4AIH A;  1S7A A;  1W7P A;  3EPZ A;  3UR3 C;  5JHU A;  1XSX A;  1WKM A;  3JTH A;  1X1B A;  3HRU A;  1PDN C;  1O3S A;  1RUO A;  1Y8R B;  3TP0 A;  5EF6 A;  5FB2 A;  2L2O A;  2DLL A;  1ZN2 A;  3QPS A;  4D5F A;  3ZQG A;  3K9T A;  1JT6 A;  1ETX A;  1W7P D;  4BGD A;  3T8T A;  3HC7 A;  4IPA A;  3MZH A;  3FMQ A;  1I3Q J;  3J7A Y;  1WI3 A;  3VOD A;  2ELK A;  3LSM A;  1YS7 A;  2J5O A;  4HZF A;  1OIS A;  2ZCW A;  3FM3 A;  1O3Q A;  1ZH5 A;  2IS4 A;  4PJL A;  4HDV A;  1SFO J;  4D0P A;  3F21 A;  1FP2 A;  2PJR B;  3HTU A;  1VQ7 I;  4RLF A;  1ORK A;  4AM3 A;  4FTH A;  1Q1V A;  3BOQ A;  2EA2 A;  2VT3 A;  3H9J A;  1VFC A;  1DDN A;  4XN3 A;  1U9N A;  2WAE A;  2MLG A;  3I64 A;  2H94 A;  5TGT A;  2IEK A;  3HKZ A;  3U21 A;  1ZR4 A;  3G1O A;  1F4K A;  3VSL A;  4I0B A;  4F93 B;  2Y31 A;  3BR6 A;  4KDP A;  3OYA A;  1O7L A;  4UUS B;  2K9M A;  4AD9 A;  4RAG A;  1HDD C;  1Z77 A;  2XPU A;  3KEY A;  2VON A;  4RB0 A;  3CC7 I;  1X2N A;  2R7O A;  4HX8 A;  4CSW A;  2MA3 A;  4EMS A;  1DPR A;  1FWZ A;  1VI0 A;  4FE7 A;  4QSH A;  2BVM A;  4WWC A;  3LSP A;  4BJT A;  4AIK A;  4XOT A;  3G3Z A;  2VQG A;  1QPI A;  2MH9 A;  2ETH A;  1S72 I;  1IRZ A;  2DFI A;  3TOB A;  4C2M J;  1S3J A;  2HDD A;  1MMG A;  2DOA A;  2M3A A;  2HI3 A;  5LHG A;  5A2Q Z;  4BJ6 C;  1PUF B;  2XB0 X;  1W0T A;  3TBI A;  5ICC A;  4XKB A;  4EJO A;  5K7F A;  1RC9 A;  3FKJ A;  2X4H A;  2VT2 A;  3CCQ I;  2J5P A;  2L9V A;  1YJN I;  3FXR A;  3OYG A;  1SFU A;  1U78 A;  4M9X A;  2D2W A;  2P8T A;  3CUQ A;  1XPX A;  2VOO A;  2WV0 A;  4DYC A;  1Y6I A;  3FWE A;  3C2G A;  1XX5 A;  4PUS A;  1QVU A;  2JN6 A;  3T5X A;  5LFA A;  3TL4 X;  2PBI A;  4HPQ A;  2E19 A;  4HDU A;  2GM4 A;  3Q0W A;  2TRT A;  5D5X B;  1IUF A;  2DN0 A;  4M72 A;  5ICF A;  1T33 A;  2DJI A;  2K27 A;  3S1M J;  2NVY J;  4G7Z F;  2RQP A;  1Z1D A;  4XOP A;  3QU3 A;  1MND A;  2K9N A;  3KX2 A;  4WXD A;  2PJR A;  4HLY A;  3C1D A;  1YX3 A;  1LVK A;  5FKM A;  3FHZ A;  4U87 A;  3F3X A;  2X85 A;  1KYZ A;  4BXU A;  1B9N A;  5DUK A;  4NHJ A;  2ZNY A;  5HNF A;  4KIB A;  1CF7 B;  1FTZ A;  5IP6 A;  2E2J J;  1Y56 A;  4OU0 A;  1J09 A;  2XV4 S;  4UUS A;  1XCB A;  1R4M B;  2DU9 A;  2GBY A;  1LDK B;  2JTV A;  2CFO A;  2Z5U A;  4YIR X;  4IL6 C;  5CKT A;  2HKX A;  2IBD A;  1OR7 C;  2OU2 A;  2OZ6 A;  3COA C;  4C3I J;  4XRM A;  2ZFW A;  1TWA J;  4HQM A;  1HST A;  2XHK A;  4B43 A;  3AG4 H;  2ID3 A;  3L2W A;  1VQ4 I;  2G9W A;  4ZZD A;  1WFX A;  3I0T A;  4ZH4 F;  5EEA A;  2XAJ A;  3F8N A;  2FD5 A;  4B44 A;  3PJR A;  2DDA A;  1U8B A;  3OYL A;  3DV8 A;  1Z3X A;  4ZTJ A;  5J1Y A;  3K4L A;  2OA4 A;  2NOG A;  3RI4 A;  2WB1 N;  1Y1W J;  3HUG B;  2JA2 A;  3CDL A;  3M8F A;  4WK8 F;  3I4M J;  2F4M B;  4Q4Z F;  1A31 A;  1AOY A;  1E3P A;  1B59 A;  2K9L A;  3OR2 C;  4XIC A;  1NK3 P;  2D45 A;  2PI0 A;  3BLY A;  2Y48 A;  2OCC H;  3KZI C;  2WWY A;  1T39 A;  3F8F A;  2R7X A;  3VFZ A;  3FIW A;  4IVN A;  4XN0 A;  4PSX A;  2OBP A;  3MZY A;  2JVG A;  4HF2 A;  2OZU A;  1GDT A;  3SEZ A;  4I01 A;  1T8I A;  2W82 A;  5HOD A;  1SD4 A;  1RR7 A;  2GWR A;  4ZYE A;  2ZSI B;  1X1A A;  3DKY A;  4KYW A;  1DU6 A;  4MFD A;  3D0S A;  2RN7 A;  3QYF A;  3IP4 B;  3J80 Z;  1JUP A;  2IVM A;  1IN5 A;  2HDC A;  1P7J A;  3MKL A;  3QP6 A;  1KQ8 A;  2W4S A;  1CF7 A;  5H2F C;  5F0H A;  2GQQ A;  3K6G A;  4YFK F;  1N75 A;  3DQV C;  3L1P A;  5E17 F;  3LSG A;  3JRG A;  1WH7 A;  4ABZ A;  2L9R A;  3K1P A;  2DFH A;  5M5X J;  2W84 A;  3FXU A;  2DJN A;  2X1C A;  4XID A;  4FIS A;  3L7W A;  4IQJ A;  4BQN A;  1U9O A;  3RKY A;  1VQ8 I;  1R1V A;  2Y75 A;  4NDL A;  2K85 A;  1TQI A;  1GXQ A;  5FJ8 J;  2KFD A;  2BW3 A;  4LLG F;  5HOO A;  1TQM A;  4UVB A;  3JCU C;  2XKP A;  2LP0 A;  2F48 A;  3QQA A;  3ABL H;  4N0B A;  3K70 D;  3DEE A;  2CW7 A;  5D6E A;  5L3E A;  1V54 H;  2DCE A;  5GPC A;  4MFE A;  4L5E A;  3V7S A;  3N4M A;  1Z67 A;  3WGH A;  2RNJ A;  4BE0 A;  1BR4 A;  2DI3 A;  2WTE A;  4LMY A;  2ZXJ A;  2OTL I;  1YG2 A;  5BMZ A;  2AQF A;  4U7B A;  3HUG A;  1MNM C;  1KQ0 A;  2A68 F;  4KN7 X;  3ABM H;  4EGY A;  1WJF A;  1ZTR A;  4Z2Y A;  2CO5 A;  2MYS A;  4XL9 A;  3WGI A;  3PIO F;  3BR1 A;  3JTG A;  3EUK L;  1ZGW A;  4LB6 B;  2DMT A;  5KAI C;  3K10 A;  4L9J A;  2HOT A;  5CQE A;  1QZY A;  4MEY F;  2LRD A;  4A3M J;  2O7O A;  4IRH A;  3LFU A;  1W5S A;  2ZKZ A;  1XB4 A;  1B1B A;  2CW8 A;  4LB5 A;  3BZ6 A;  3EDP A;  1G4D A;  2O5R A;  5HNH A;  4FET A;  4RAY A;  2CV1 A;  3S2D J;  3IH2 A;  2ZO4 A;  1OQY A;  5DEQ A;  3E6M A;  5ILU A;  1V55 H;  3PM1 A;  1BIB A;  4L0Y B;  4QWQ A;  2VBW A;  1R22 A;  3HOW J;  1AKH A;  4G7H F;  1ENH A;  1R49 A;  4C3H J;  1O7F A;  5FLM J;  1K7A A;  2JA6 J;  1IDY A;  4CDG A;  2Q8K A;  3V4G A;  4BJ5 C;  4XRF A;  1HQC A;  2ZXW H;  2JWT A;  5CYV A;  1IRG A;  2AXL A;  1FOX A;  1MIJ A;  3ZMV A;  2M2E A;  2K7L A;  2KZV A;  2PMH A;  3BCB A;  1F5T A;  2ZME B;  2Y0M A;  2X6Y A;  1HKS A;  1OKR A;  1VND A;  2VBY A;  5HLI A;  2IGO A;  3I54 A;  2BY0 A;  1VZ0 A;  5IY5 H;  1IDZ A;  1O57 A;  1P4A A;  5F1J A;  4L5I A;  2VQL A;  4XLP F;  1GV2 A;  2YU3 A;  2P6T A;  4RMN A;  5M5W J;  1PVE A;  3C2B A;  2L0K A;  5DCM B;  3S17 J;  1S7E A;  2YSR A;  4AID A;  4UNO A;  3F23 A;  5F0C A;  5ED4 A;  2P7V B;  4KT5 C;  3S3O A;  5EZG A;  1TW2 A;  2DDB A;  3H5N A;  1G59 A;  2V6C A;  4HV6 A;  3GLL A;  1T56 A;  1Z05 A;  3AKZ A;  1H9T A;  5E18 F;  2VIX A;  1TNS A;  4HEA 2;  3A0B C;  5A2Q K;  1TLH B;  3BG3 A;  5FGM A;  3F0C A;  4IF4 A;  2M0C A;  5DM7 F;  2STW A;  2RDP A;  2PMZ A;  2ZC2 A;  1VQ6 I;  1W36 D;  3DBH B;  1EF4 A;  1UST A;  1MNE A;  2IGK A;  3VYT B;  1R7J A;  1TQP A;  4UUV A;  2JZY A;  3GTK J;  4Y17 A;  3H3U A;  4Y3O A;  4C9Y A;  2M87 A;  3BQZ A;  1T38 A;  4IHX A;  4C2U A;  1UFM A;  3TED A;  3O8H A;  4I0A A;  1X1D A;  1JTX A;  3E7L A;  4DNC A;  1WQ2 A;  1A6Q A;  1FBS A;  2B7E A;  2L7M P;  3ZMU A;  2HQ5 A;  5C4X J;  3ASO H;  2PJP A;  2HXO A;  4BL0 B;  3OSG A;  3SQN A;  1W1W E;  3B6C A;  1U2W A;  3E0J B;  2KIF A;  5IT9 Z;  4J01 A;  4IQ4 A;  1QO0 D;  3RKW A;  3KLN A;  2QEX I;  3AFH A;  3OYE A;  1X4P A;  5BQT A;  3GTQ J;  5HDN A;  1ZRE A;  2IPQ X;  1JHH A;  4E7I A;  1H8A C;  3EYY A;  1ZAO A;  1FYK A;  1OMI A;  2GZW A;  5B66 C;  2IA0 A;  1OFC X;  2F5F A;  1L0O C;  2DPU A;  4IHT A;  2IGN A;  4AWX B;  4W1U A;  1BR1 A;  2ZME A;  3VYU B;  4CCM A;  2K40 A;  3BP8 A;  4RS8 A;  1SD7 A;  4AC0 A;  2CQQ A;  4F92 B;  1P2F A;  1Q1H A;  4LIT A;  4Y13 A;  4M3B A;  1T98 A;  1Y39 A;  4XLH A;  3J7Y J;  4I2O A;  4MLO A;  2PMZ N;  3IUO A;  3GTP J;  3DKW A;  1ZGJ A;  3M3Y J;  5LRR A;  3TDU C;  3PSI A;  4AIJ A;  3RKX A;  1BI2 A;  5BS6 A;  2EIL H;  4FX4 A;  1VF9 A;  3PNV A;  3K1N A;  2D1H A;  4Y15 A;  5TJJ A;  1ULY A;  2ELH A;  3EUA A;  3LSK A;  4WF2 A;  4E6K G;  4EJV A;  5J8F A;  1H9G A;  1LKX A;  1UCR A;  2CQ7 A;  3K7A J;  3CLO A;  1BIA A;  3ZXS A;  2I5U A;  4LGW A;  5HLH A;  1D1C A;  4YIF A;  2FUG 2;  4E7J A;  2IA2 A;  3GZN B;  5H6R A;  4Q47 A;  1OCR H;  5CVU A;  1WVR A;  1POG A;  3E6B A;  2BY1 A;  4CZC A;  1L3L A;  1GLN A;  5B1B H;  2COB A;  3F8B A;  4AYB A;  1LEA A;  1J0R A;  2JSC A;  3K2Z A;  1KGS A;  3D5R C;  4M74 A;  3QRF F;  4MNU A;  4KT6 A;  4A93 J;  5IPA A;  2IS2 A;  2KDZ A;  4XLF A;  2FBK A;  4XR6 A;  3A4C A;  1Z6R A;  4BDY A;  1FIP A;  4WCG A;  2F4O B;  2H8R A;  3X2Q H;  4ESB A;  2HYF A;  1I6X A;  2JT1 A;  2BXY A;  2UZK A;  1LB2 A;  5D4R A;  2KRH A;  3K70 C;  1IUY A;  3SFI A;  3CCS I;  3B6A A;  2MGQ A;  1SAU A;  4KIS A;  3J80 K;  2X6X A;  1QZZ A;  2E5Z A;  3V8K A;  3HTS B;  4EJW A;  2X0L A;  2RNG A;  3KCC A;  5IT3 A;  3P5J A;  4LD5 A;  3GO5 A;  1SFK A;  2R7U A;  2EZI A;  3FDY A;  1XCV A;  3OYF A;  2OF7 A;  3BPV A;  3IKV A;  4ITV A;  4BBR J;  4KN4 X;  2PX9 A;  2ZJP F;  3HOS A;  4ESF A;  4LK0 F;  4UXN A;  4GXO A;  2EIM H;  3LMM A;  5CQG A;  2KQR A;  2MD0 A;  2EFW A;  4O3M A;  5J40 A;  2R7S A;  3LAP A;  1WHU A;  4CHU A;  2PFB A;  4BXF A;  4LLN A;  2IJL A;  4ZYH A;  2DYR H;  2R93 J;  3CC2 I;  4U88 A;  5JFR A;  4HNV A;  1OR7 A;  1FT9 A;  3G1L A;  4RM2 A;  3MKY B;  3OIQ A;  5J6X A;  2EFP A;  5FKN A;  5B3S H;  3ESW B;  4B1R A;  1LQ1 A;  3CF5 F;  2Q2E B;  5L3B A;  5IYB J;  1V3F A;  1VQL I;  3A2K A;  1Z7L A;  1B4A A;  2B0L A;  2LK2 A;  3R6S A;  2E35 A;  2M30 A;  4PGG A;  2TDX A;  1TWC J;  2QSF X;  2LY9 A;  3RZO J;  1ERD A;  4IRI A;  1IN7 A;  3OL3 A;  1ETV A; 
#chains in the Genus database with same CATH homology
 2HI3 A;  2WV1 A;  1LE8 A;  2NVT J;  1PUF B;  4MIM A;  2XB0 X;  1MBE A;  1W0T A;  3IH4 A;  5K7F A;  2DA4 A;  1Y1V J;  2O9L A;  1HCR A;  3A03 A;  1A6I A;  2R5Z B;  3GTL J;  1U78 A;  5M3M J;  4CYC A;  3ZOB A;  2LLK A;  4DYC A;  4Y52 J;  4A3B J;  1WPK A;  3ZQC A;  3HBL A;  1QVU A;  2JN6 A;  4XRS A;  2E19 A;  2XPV A;  2GM4 A;  3S1Q J;  3Q0W A;  3BQY A;  2JA8 J;  2TRT A;  1IUF A;  2B63 J;  2DN0 A;  4S0H B;  1T33 A;  1ETO A;  1MBH A;  2ECC A;  2MSY A;  3S1M J;  2NVY J;  5C3E J;  2EBI A;  2D5V A;  1K83 J;  4G12 A;  2K9N A;  1B8I B;  1ETK A;  5FKM A;  3BTJ A;  3A01 A;  3H3V K;  5F27 A;  2K9S A;  1ETY A;  2AO9 A;  3PO2 J;  2DA5 A;  1FTZ A;  5IP6 A;  3LOC A;  1QVT A;  2CRG A;  3HOY J;  3HDD A;  3JRH A;  2DMN A;  3RKQ A;  2E2J J;  3JRD A;  4UUS A;  1R9T J;  1H89 C;  1JT0 A;  5IP7 J;  1APL C;  2GBY A;  3FK6 A;  5EDN A;  4RBO A;  1GV5 A;  2H1K A;  2XSD C;  2IBD A;  2GLO A;  4M3D A;  2R5Y A;  4C3I J;  4DZP A;  4XRM A;  1TWA J;  2L7F P;  3BTI A;  3FK7 A;  3LSR A;  2VPR A;  3K2A A;  3FIS A;  1IGN A;  4IHY A;  3RZD J;  2ID3 A;  5C44 J;  3S14 J;  3S2H J;  2VKV A;  4A3F J;  3LSJ A;  5EEA A;  1ZK8 A;  3QPL A;  1IG7 A;  2X9D A;  2FD5 A;  5IOZ A;  2NVQ J;  1FTT A;  3IH3 A;  1U8B A;  3TW6 A;  2R92 J;  3S16 J;  5IYD J;  5C4J J;  1TWH J;  5J1Y A;  2DMP A;  1OCT C;  1YRN B;  2Y9Z A;  2NOG A;  2WB1 N;  1Y1W J;  3TP3 A;  2CQX A;  3CDL A;  4JYK A;  3WHC A;  3I4M J;  2DA6 A;  3ZQL A;  1K61 A;  1NK3 P;  4XIC A;  2R5Z A;  4DZJ A;  1F36 A;  3RQI A;  3SDG A;  1D5Y A;  1RES A;  3FIW A;  2LR8 A;  3W6V A;  2HYJ A;  1GDT A;  1WH5 A;  5HOD A;  2VI6 A;  1RR7 A;  3DEW A;  1AU7 A;  2JA5 J;  5F08 A;  1DU6 A;  4MFD A;  4QIW N;  1WGX A;  1UMQ A;  4A3J J;  1JUP A;  1OCP A;  1B8I A;  2NVX J;  2Y2Z A;  1GUU A;  1P7J A;  5EZH A;  2NS8 A;  2TCT A;  4JX6 A;  5BNG A;  1ETQ A;  2QCO A;  2XGC A;  1IV6 A;  2YUS A;  1RKT A;  2XGD A;  3MKL A;  1OJL A;  4X1E A;  2QF7 A;  4UUT A;  5F0H A;  3HEF A;  3L1P A;  5FKK A;  5E3N A;  2N8G A;  1RPW A;  3LSG A;  5FKO A;  1WH7 A;  4ABZ A;  3JRG A;  1JJ8 C;  1I50 J;  2L9R A;  2LTP A;  1RKW A;  5M5X J;  3CMY A;  1G2H A;  2DJN A;  2DMQ A;  4XID A;  4FIS A;  1U9O A;  4A3G J;  3S1N J;  4NDL A;  5FJ8 J;  2VUM J;  1MBK A;  4V2F A;  3MVP A;  2LP0 A;  3QQA A;  3H0G J;  4RDU A;  1BJZ A;  2FJ1 A;  3OSF A;  3Q0U A;  1O4X A;  4X6A J;  1E3O C;  3BT9 A;  1TC3 C;  5GPC A;  4IEJ A;  4MFE A;  1JGG A;  5E3O A;  1Z0X A;  3HGG A;  4L5E A;  4D5C A;  5J3L A;  5M3F J;  1XG1 A;  1YRN A;  4A3C J;  4QTR A;  1MH4 A;  1MNM C;  1ZTR A;  2M8G X;  2E2H J;  4Y7N J;  4A3D J;  3BR1 A;  3Q0V A;  1ZGW A;  1JKR C;  2DMT A;  2HOT A;  4A3M J;  2O7O A;  1X58 A;  2EZL A;  2HXI A;  3UKG A;  1MSE C;  2DA3 A;  3BR0 A;  5GP9 A;  4A69 C;  3HOV J;  1CQT A;  4I6Z A;  3S2D J;  3IH2 A;  3JRI A;  4W97 A;  1FEX A;  5IOY A;  1ETW A;  5F0F A;  1FIA A;  3PM1 A;  4BKX A;  4DYQ A;  3HOU J;  2EH3 A;  1TWG J;  1AKH A;  2KT0 A;  2LFB A;  1ENH A;  4IHW A;  3HOW J;  4C3H J;  5FLM J;  1ITY A;  5FLV A;  2JA6 J;  3MN2 A;  1IDY A;  1MH3 A;  2FX0 A;  2JWT A;  3BR5 A;  1HOM A;  1LE8 B;  3BTL A;  1JKP C;  1JKO C;  5IP9 J;  3GTM J;  2Y0S N;  2M2E A;  3CQZ J;  1PUF A;  2R7Z J;  2JMW A;  2EZK A;  1VND A;  3S15 J;  4M6V A;  1IDZ A;  1ZKG A;  4XK4 A;  3D1N I;  5JLX A;  2R0Q C;  5F1J A;  1DU0 A;  2DTZ A;  2XPW A;  3HGY A;  1B72 B;  1GV2 A;  3OIO A;  2HOS A;  1SAN A;  1XC5 A;  1JKQ C;  5M5W J;  3C2B A;  2L0K A;  3S17 J;  1S7E A;  2L7Z A;  2HOA A;  2MG4 A;  3NAR A;  5F0C A;  2EZH A;  2JA7 J;  5EZG A;  2E2I J;  5EGO B;  3I4N J;  4XRS G;  1GT0 C;  3ZQI A;  1T56 A;  4A3K J;  3JRF A;  2X6O A;  5F04 A;  4M3E A;  2ME0 A;  3BG3 A;  4JX4 A;  3JRB A;  3F0C A;  2M0C A;  3SJM A;  5DS9 A;  2ZB9 A;  5GPA A;  3GBG A;  2O8K A;  1JJ6 C;  4AYB N;  3GTJ J;  1EF4 A;  4BY7 J;  3O8G A;  1F43 A;  3GTK J;  1UHS A;  5K7H A;  1MBJ A;  1ZQ3 P;  1HDP A;  2G0E A;  3BQZ A;  2ECB A;  4A3I J;  4IHX A;  1P7I A;  2FQ4 A;  3O8H A;  3TED A;  2JJ7 A;  2XGE A;  1JTX A;  3G1M A;  1JUS A;  3WHB A;  4D7N A;  3E7L A;  3JRA A;  4IHV A;  2MW8 A;  2L7M P;  2HQ5 A;  3NAU A;  5C4X J;  2CU7 A;  2HXO A;  2WAQ N;  5J1U A;  1A5J A;  2M9H A;  4C3J J;  3OSG A;  3B6C A;  5IYC J;  1BW5 A;  3GTO J;  2XB5 A;  3JR9 A;  1LFB A;  2EQR A;  2JK3 A;  3GTQ J;  3HM5 A;  5JLW A;  1H8A C;  1RET A;  1WCM J;  1OFC X;  1I6H J;  5EYR A;  4W1U A;  2CUE A;  2M34 A;  4GFB A;  2K40 A;  1HF0 A;  2P81 A;  2CQQ A;  3ZQH A;  4AC0 A;  9ANT A;  2ID6 A;  4MO7 A;  4M3B A;  4M3F A;  2DMU A;  4MLO A;  1B72 A;  2PMZ N;  3GTP J;  3M4O J;  5E3M A;  3M3Y J;  3ZQF A;  2LKX A;  1H88 C;  3HKZ N;  2X48 A;  2LD5 A;  2RAE A;  4B4C A;  4EEF G;  1VF9 A;  4FE4 A;  3IV5 A;  4A3L J;  3JRC A;  4V2G A;  2YU9 J;  5EGO A;  1NK2 P;  2IAI A;  1UG2 A;  1JTY A;  3K7A J;  4DW6 A;  5M5Y J;  2E1O A;  4J19 A;  4D7M A;  1W0U A;  5DTD A;  1IJW C;  3BG5 A;  2DA7 A;  5EG0 B;  2K9Q A;  2OPT A;  4LOC A;  3BG9 A;  1MBG A;  1POG A;  2COB A;  1FJL A;  3OOU A;  2DA1 A;  3HB9 A;  4BBS J;  3S1R J;  4A93 J;  4M3G A;  5IPA A;  1NTC A;  2KDZ A;  1X2M A;  2H8R A;  1FIP A;  2YS9 A;  1ZR2 A;  4JP0 A;  1MSF C;  4CYC B;  3DCF A;  4JX5 A;  3TP0 A;  4AUX A;  5EF6 A;  4B3A A;  5FKL A;  2LVS A;  2AHQ A;  1BW6 A;  1HLV A;  3QPS A;  3SFI A;  4D5F A;  3B6A A;  2MGQ A;  3ZQG A;  3HOZ J;  1JT6 A;  5K7Z A;  1IC8 A;  1ETX A;  1MBF A;  3A02 A;  2XRL A;  1I3Q J;  4FCY A;  1WI3 A;  2Y30 A;  2ELK A;  3LNQ A;  3BR2 A;  1BA5 A;  3VPR A;  4DYR A;  1SFO J;  2VKE A;  2EZI A;  2DA2 A;  2OF7 A;  4BBR J;  2I10 A;  1XS9 A;  1ORK A;  1GVD A;  5E3L A;  3A01 B;  4FTH A;  1Q1V A;  2CUF A;  3BTC A;  2Y9Y A;  2CJJ A;  1VFC A;  2ME6 A;  3CCY A;  1U9N A;  2IEK A;  1ZR4 A;  3TW7 A;  3G1O A;  2Y31 A;  3BR6 A;  3BR3 A;  4UUS B;  3HOX J;  2R93 J;  1TWF J;  1HDD C;  1Z77 A;  3Q3S A;  2XPU A;  4HNV A;  4A3E J;  4I76 A;  1BL0 A;  3G1L A;  1X2N A;  1LFU P;  2R5Y B;  1JUM A;  1QRY A;  1AKH B;  3FKI J;  1VI0 A;  4FE7 A;  2NS7 A;  4QSH A;  5FKN A;  3JRE A;  4B1R A;  3LSP A;  5J1R A;  5IYB J;  3PO3 J;  5EG0 A;  2LK2 A;  4BXX J;  1QPI A;  1IRZ A;  1AHD P;  3GTG J;  1TWC J;  2LY9 A;  3RZO J;  4C2M J;  2W48 A;  4BY1 J;  2HDD A;  1ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...