3ZRGA

Crystal structure of rxlr effector pexrd2 from phytophthora infestans
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
b'GPALNTEKMKTMLKAGMTVDDYAAKLKLTDKIAAAANSARAMEKLGETLKMKKLLRYLNYVAEHTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEXRD2 FAMILY SECRETED RXLR EFFECTOR PEPTIDE, PUTATIVE
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora infestans
molecule tags Protein binding
total genus 24
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zrgA00
3ZRGA
chains in the Genus database with same CATH superfamily
3TO6A 3DF8A 2XC7A 3PNVA 1G4DA 4PGGA 1BI1A 1RKTA 2VKEA 1SFUA 1LFPA 4LG3A 2BBYA 3HSRA 3F8MA 3H3VK 5K7FA 3ZQIA 1RC9A 1TW3A 1U5TC 2BY0A 2XAGA 3TO9A 4IEJA 1ITYA 3IRRA 1RI7A 4A2UA 1XGOA 1G3WA 2Y2ZA 1JKPC 1TLHB 3N97A 4OIOF 1ODDA 3PO3J 3C2BA 1KGSA 4UB6C 2F4IA 1ZKGA 5J4VA 1D1AA 4P96A 3ZP5A 1ZRCA 1OYYA 2ELJA 3CMAI 3CC2I 2IGKA 3QYFA 4ESFA 3S16J 3I64A 2WWYA 4HF2A 1BOBA 3W6JB 5HDNA 4KIGA 2DA3A 4D1QA 1B8IB 1BW5A 2L2OA 2IXSA 1BIBA 4BXFA 2Z99A 3OV8A 2RNGA 4RB0A 5F64A 4DW6A 1T0FC 2ECCA 1E3PA 2YSRA 5KCMA 3BR2A 2ZMEA 3WU0A 3M8EA 4BXXJ 1HC8A 5GAHJ 4UNOA 2X9DA 5J1UA 2HS5A 1I6XA 4ENJA 4A93J 3I59A 1L0OC 1WJDA 1LEAA 1GV5A 3BG7A 2DMUA 1Y6IA 3IKVA 4G9YA 2LP0A 1YS7A 4MEXF 2XKPA 3BJ6A 1Q1VA 1F36A 2UXXA 1VQOI 2EFPA 5HOOA 2ISYA 3IWZA 1BJAA 3LSGA 2ZNYA 1OMIA 4EJUA 4MLOA 3HM5A 2PLYA 5BNGA 4FX4A 2LH9A 2NVTJ 4L9TA 3TL4X 3MN2A 1SFEA 4D5FA 1HCRA 1IJWC 4UXNA 3K4NA 3CC4I 5F1RA 1ZGJA 4DGWB 3RZOJ 2HQNA 2XSJC 1R23A 2BXZA 3PUBA 4XLEA 2B7EA 2WY7Q 1SEUA 3BQYA 5ICCA 2RDPA 1JT0A 1IUFA 1F1ZA 2LY2A 1REPC 4MQ9F 3MKZA 2FNAA 2DA2A 3ZQCA 5IOZA 4C9YA 2P5VA 2G7HA 4MIMA 5FKLA 4I98B 2IS2A 1HDPA 2OU2A 3DWLE 4D7MA 4EEFG 2RKHA 1WJBA 3HUGB 2ZNZA 2HGCA 4RGSA 4AVPA 1XX5A 1B8IA 1ENHA 4EM2A 3QP6A 4ENMA 2P6SA 3IH3A 1G3SA 3FKJA 2VBYA 4DYRA 2O9LA 1JKOC 2V9PA 2HNHA 3OL4A 1MMNA 1E2XA 2X48A 1OISA 3HDDA 1T95A 5CPRB 3V8JA 1Y0UA 3LSJA 1W7PD 3JRGA 2P7CB 1EH6A 3FF5A 2DFFA 2HR3A 3IH2A 3O8HA 3DPTA 4Q48A 4HW0A 3HOVJ 4C3JJ 1FYLA 4XLFA 4IZZA 2MABA 3TW6A 4E7ZA 2ME0A 5TJJA 4ZYHA 1ETVA 2VE9A 2P6TA 2DU9A 1ZELA 2NVYJ 1Z05A 3K70D 3ZN1A 2F5VA 2OC6A 2AS5F 4A3LJ 1J9IA 3DXJF 3E1SA 3BG5A 2K4BA 4EJVA 1OCOH 2DOFA 5FLMJ 4A3IJ 1IRZA 1H8AC 4D7NA 1OJLA 3S15J 1K78B 4TV7A 1WPKA 2E2IJ 5HDGA 4LB6B 1XPXA 2IA1A 1SFOJ 3K1MA 3WGIA 4JBAA 1BC7C 5KNLA 5E1WA 2QCOA 2MH9A 5IP6A 3BY6A 2EPFA 2KIMA 3K7AJ 3DTEA 4I2OA 1S7EA 4ETSA 4BEHB 4AIHA 3M8FA 4L0YB 2BZTA 3NQOA 4NNJA 4A3FJ 1IV8A 1QZZA 3M8JA 1DDNA 2FX0A 2HKOA 3HKZA 5AIQA 3T1BA 1P4XA 4CCJA 2QKLB 4PK4A 1VF9A 3HUGA 2WADA 4ON0A 4XIDA 3WTUC 3S1RJ 1T56A 4R79A 1QVUA 5LRSA 4HV6A 1VNDA 2R3SA 4RBOA 3IUOA 4RGXA 3FWEA 3CDLA 3BZKA 2R7DA 2NAZA 1FOYA 1UZCA 4XLCA 1O4XA 4IOAF 2VASA 2Y0MA 3ABLH 3HPGA 3AG2H 4GXOA 1T38A 5LGNA 2ADUA 3I55I 4DBRA 4CH7A 2VODA 2O5RA 2FUG2 2E2HJ 1Z6RA 4CCKA 3UR3C 3ZCOA 3ZGKA 1ZRDA 2JSCA 3RDIA 2HU9A 4XN0A 1GXQA 3DEWA 2JT1A 1S72I 1SC7A 4WF2A 1B9NA 1MKMA 5AONA 1SAUA 2W25A 4BQQA 2HDWA 1FLIA 2NS7A 5EEHA 1HOMA 1BBYA 2LREA 4UUVA 2Y75A 2UWMA 1HW1A 1YRNA 3A01A 1FP1D 5LRRA 2KZVA 1FYMA 5L3FA 4BGDA 2VQLA 3OYGA 5ERIA 3DU5A 4G7OF 3OYCA 3F8NA 2ZFUA 3VDXA 1GHCA 2XAUA 2WV1A 2AQFA 5HLTA 2R7UA 2C6YA 4JK1X 3KLNA 2MW8A 4M3EA 3K1PA 1V5FA 3ULQB 4FASD 4BEHA 1M1EB 4UVAA 1MMGA 3HZJA 3FXMA 3FXJA 4OINF 3K70C 3S2DJ 4FX0A 2HQ5A 4XLNF 3S1QJ 3R0AA 2BVLA 1HKSA 2M0MA 3HHHA 5FGMA 3FXOA 3DKWA 2QA4I 4M72A 5J4YA 1SVLA 1OCRH 3CCMI 3H9QA 1WFXA 2G9WA 2V79A 1APLC 1QZEA 2HQRA 2JQ7A 2P5KA 3ECHA 3RQ4A 3GEZA 3P9IA 4S0HB 2QYOA 5HLIA 2M0CA 1ZH5A 3K0LA 4ZTJA 3QP5A 2CQNA 1P6RA 4AIKA 5IYDJ 1RZ4A 4CHUA 1VTNC 1X3ZB 1FY7A 2B0LA 3AAFA 2DT5A 5DTDA 2FQ4A 5D4RA 2VBXA 2OTJI 5LGTA 1V3FA 3MWMA 4UVCA 4AM3A 2W84A 4KITB 2NRAC 4YG2F 1BN5A 4HNVA 4M6YA 2Z5UA 3P5JA 2H1KA 4UHTA 1W1WE 1Z9CA 4PUSA 3H5RA 3RIRA 4HX7A 5DCMA 4CZZA 5BMZA 3WTVC 4A3GJ 2OZ6A 3F0CA 2WTEA 3BLYA 1ZG1A 3PSIA 3I4NJ 4AIJA 4W1UA 5C44J 3G1OA 2LVSA 4H0EA 4NB5A 1RETA 5FRNA 2FOKA 4PJMA 3MD2A 4LITA 2P81A 3JTGA 2KHMA 2DBBA 2QWWA 1A04A 5GPCA 1VQ7I 3H5NA 4NHJA 2CV2A 4QSHA 4KDPA 3G1MA 1E17A 4EM1A 1UAAA 3NWTA 2L9NA 1AU7A 3A2KA 1KQ8A 4B44A 4ZDOA 1NG6A 4M9SA 5EEGA 4B09A 1WGXA 1HSTA 1U9OA 2EV0A 4F55A 3I3LA 2KJCA 4HBLA 3ERED 3GTQJ 3RJPA 2LRDA 1T33A 2X6WA 3FX3A 1I5ZA 2BXYA 2KLOA 5DD4A 3C2HA 2VC1A 2OPTA 2M45A 3VEPA 4HLYA 5BPDA 1R71A 1IC8A 3BR0A 2EA4A 2GA2A 2WB1A 1PVEA 1ZK8A 5FFZA 1ZGWA 4B3XA 1F5TA 3IHUA 1IUYA 3D5RC 4XLHA 3GCMA 2L9VA 1W36D 2KJBA 3G6EI 4P55A 3BR5A 1HKQA 1RNLA 3IH4A 2FEZA 2K5CA 1FJLA 1FZPB 4HA8A 3GTLJ 5DUIA 4I0BA 1OPCA 4M3DA 5J1YA 2KRFA 1R5HA 2DI3A 4XOTA 3RZDJ 5J8CA 1MBJA 3GLXA 1D3YA 2QQBA 3M1CA 1KU3A 4XOPA 5FKNA 1D0XA 2H6BA 2GWRA 4CCOA 1R1VA 1YJWI 2M7AA 2WAQN 5FLXZ 1ZHFA 4XR6A 2ZB9A 1OR7C 4DIQA 2EFNA 3KIOA 4U0VA 2BHYA 4PJNA 1IZ1A 2K7LA 4IHYA 3OSGA 3BTCA 2M8EA 1U5TA 3QYBA 1VQ9I 5JI6A 4OIPF 1ETWA 2PQ8A 4N9HA 4XLPF 3GVAA 4BJ5C 1BR1A 2RREA 1ZARA 2M9HA 2FBIA 2EZIA 2O3FA 2XPWA 1U3EM 5FRMA 2V1NA 3HGGA 4KMFA 3DLLF 2JA8J 1N78A 2FD5A 1B1BA 3ZN0A 2IGNA 4XKBA 3CF5F 3A4CA 3MKWB 5DDGA 1D8JA 4XRSA 4C2UA 2ZXIA 1LKXA 2MFZA 4RGUA 1YX5A 4NC8A 3KETA 2IVMA 3LAPA 2E2JJ 3SEQA 2OA4A 2VL8A 2JK3A 5GAGJ 4YFNF 1SD4A 2Z16A 2OAZA 2YX4A 2DXIA 2KIFA 3GFMA 4B8XA 2CUEA 5CYVA 1T0FA 2VOPA 1FTTA 3HOWJ 3ZMZA 3R6SA 3WE3A 1J09A 4CO8A 3S2HJ 2WV0A 2V4JC 2Y9ZA 2OV7A 1K83J 1R6RA 1UG2A 1U6GA 2UV1A 1ORKA 3L2UA 5L3DA 2DA5A 4WX9A 1V54H 4L9NA 5B1AH 2DT6A 1OQYA 2E34A 4IX7A 2R7ZJ 3GO5A 3IAM2 3H9GA 4AC0A 2OCCH 4NUBA 2E1OA 4D9JA 5J1RA 2XGEA 2E5ZA 3K6GA 3F21A 3BR1A 1XB4A 3ABUA 4HOBA 3KYCB 4G7ZF 3N4MA 3QPSA 1TW2A 1XCBA 2D1VA 4II3A 1XMXA 5JR3A 1T2KA 3X2QH 4ENKA 2M4GA 3F3XA 2MGQA 5JVTA 2GBYA 3C7JA 2ICWG 1H9TA 3CZ6A 1IF1A 5FLVA 2COMA 3VODA 2VXDA 3B02A 3BP8A 3ZPLA 1OCPA 4E4HA 5JHUA 4IOCF 1R9TJ 2DQRA 2TCTA 2HEOA 1W36C 2D45A 2L01A 5J47A 5FLXK 4FQGA 4ZZLA 3TDUC 2TDXA 2HDDA 3KYLA 2XB5A 1MGTA 3DTKA 4I7HA 1S8NA 4N0BA 3BTLA 3FXQA 3Q9SA 4CUGA 1R4NB 1QHGA 4KICA 4Y4RA 5K7ZA 2PI0A 3OYAA 1TT5B 2EILH 2DFHA 2PMHA 3M9AA 2DTRA 3CF2A 5F0HA 2DT7B 5CLSA 4CSWA 3HOTA 3FDYA 1FP2A 2VE8A 4A12A 3FM3A 1PUFA 1FOXA 2CH0A 2Q2EB 4A6EA 1AOYA 3SXYA 3CCUI 2E7WA 4HLXA 1XGSA 4RAYA 1GUUA 3ABKH 1O7LA 2LF7A 2BY2A 4WCGA 1EKEA 3BOQA 4M9ZA 3S8PA 4XBFA 4RLFA 5EF6A 5HVQC 2XSDC 3CCYA 2VJIA 3L09A 5HDKA 3OYMA 4IQ4A 3CCRI 3PJRA 4UUSB 3EETA 2O8XA 4J01A 3WG9A 2MLGA 5F08A 1LVAA 4M73A 5LHGA 4YELA 3K4KA 3VB2A 1J5YA 1V5GA 2FF4A 3AFHA 1GVJA 3QOEA 2Q8KA 4QIWN 1T39A 1AKHB 2ZKZA 2PMZN 1V4RA 1ZG5A 3GZ5A 2F4OB 2Z33A 5TISC 1K7AA 3FBNB 3R0JA 4MEYF 3WHCA 3S32A 2BY3A 3IC7A 3P7NA 5JVGF 2VPRA 3DBRB 2W48A 2HYGD 4IF4A 2ELKA 3IWFA 2W82A 4CICA 3CCJI 1I3AA 3J7AY 2HTJA 2R4GA 4HEA2 2XGCA 2W00A 2ZXWH 4YRVA 1JUMA 5TGTA 5ICEA 4BYYA 1FYKA 3LSKA 4CA0A 2OUMA 1JGSA 4AIDA 5B66C 4ZYGA 1ACIA 1XMAA 1OCZH 2XPVA 2A05A 3BC8A 3W2WA 2Y69H 2XHKA 2LK2A 4HDUA 2HVQA 4S05A 1ZTRA 1VQ5I 1ZN2A 1MW7A 2M87A 2F5FA 4BKXA 1VQNI 4PJ0C 3BTJA 1DGWY 4FE4A 2NS0A 3OYJA 2QGUA 3GBGA 2XRNA 2DTZA 3CTAA 3KZYA 1Y1VJ 2JA2A 2ZSHB 1OCCH 1ETOA 3A1YA 3MKLA 4FISA 4JX4A 4O6JA 5E1ZB 5LBQA 4LB5A 1MMDA 2Z2SB 3VYTB 1MNEA 3CD6I 1YYVA 3G73A 2R7WA 1B4AA 1IDYA 1ZGAA 3AG4H 2EQRA 2HXOA 1GT0C 5IT9Z 1WI9A 3LSHA 1BM9A 3F22A 1FSHA 4BQNA 1IN6A 1MSFC 1X4PA 3G4SI 3S1MJ 1UJ8A 1NK3P 2PG4A 3TW7A 4UUSA 5FKKA 2K86A 4EATA 1TWCJ 3CDIA 1ZYRF 2JSPA 3JCUC 3NEUA 1QA6A 4OIQF 4LK0F 2VIXA 1WJFA 4BDYA 4ENNA 3V7CA 2K9SA 2L7KA 5EG0B 1RESA 3D0SA 4CXFA 4PZJA 4ZH4F 5LLQA 2M1BA 3S3OA 1OYIA 2CS3A 1NTCA 1OLTA 4Y17A 1AKHA 2H94A 1QVTA 4XQFA 3BJAA 3JREA 1NHAA 2Z1DA 2MA3A 2BHZA 2VT2A 4K2EA 4XKWA 1VQKI 3KCCA 4HG2A 2M8GX 3WGHA 3R4KA 4Y7NJ 3SZGA 1XS9A 3U1KA 1HLVA 2JA5J 4IHWA 4CGZA 2OJED 3CCSI 1A6QA 2QF7A 2X1EA 3U9GA 1WH5A 4HYEA 4E7JA 2QQ8A 1WSUA 2VT3A 2EK5A 1PUEE 2CV0A 5FKOA 3LSPA 1Y56A 2QZ8A 1IW7F 3WE2A 1YLFA 4DJAA 2E7XA 3NRVA 4M6VA 4BBRJ 3HOZJ 3ZQFA 2ZXHA 3U1DA 3KYDB 4LFUA 3U2RA 1P4AA 4EMSA 1LJ9A 2MSYA 3L2RA 1GVDA 3DKYA 1FBUA 2DA7A 2I8DA 5J40A 2M5WA 5M5XJ 1JXSA 2H8RA 2RVCA 3ASNH 4HF0A 4ZYDA 3OYFA 4JX6A 1OCTC 1SMTA 3H0DA 3PQJA 1TWGJ 4BS9A 5FKMA 3VSKA 5FB2A 5E3MA 4LLNA 1WJ5A 1K6OA 3DEEA 3RPQA 5L3CA 2XB0X 4ZDLA 4DYQA 1U9NA 3A0BC 2L4MA 3GXOA 3OIQA 3DP7A 5IT9K 3AG1H 2YR2A 3ZQHA 2JJ7A 3JSPA 3EUKL 3ZMSA 2F5EA 4U88A 1X1PA 5TRDA 2IA2A 1Z91A 5EG0A 2STTA 2L02A 1JUSA 2ESNA 1DU0A 2EJRA 3SEZA 2L4AA 3T0YA 4A3MJ 2FJ1A 2PX9A 1I27A 5DCFA 3G2BA 2R7SA 4BDZA 3LFKA 2QM3A 2LOOA 1S9HA 3RPUD 2RC4A 5D6EA 2KKOA 2LLKA 1AHDP 1YOVB 5L3BA 1MBGA 2CUJA 4JP0A 2A07F 3DU6A 2MD5A 2DO7A 1OKRA 4M9XA 4PSWA 2DQLA 2WAFA 3MZ8A 1K6YA 1MDMB 1Z77A 1LDJA 1Z7UA 3D5SC 2UXNA 4CDGA 4KIFA 1FC3A 1I39A 4IKFA 3TO7A 1WHUA 5HNHA 5EEAA 4F91B 1GV2A 1Z1DA 3P9KA 3W3CA 2OD5A 5HS8A 2ETHA 3E3VA 1YRNB 3A01B 1U8RA 3LFUA 3FBIB 4BU2A 4MNUA 2GQQA 2R7RA 2P0WA 1FBSA 2E19A 4CYCA 2GIZA 4D5CA 1RPWA 3SFZA 1VQLI 1OR7A 2EZLA 4XN3A 3S17J 1O3SA 6PAXA 3H3ZA 3LOCA 2VJJA 2DA6A 3FHNA 4BL0B 2PFBA 4XKCA 1IAWA 5BQTA 3ONQA 1N75A 4AUXA 3C18A 4PJJA 3OYKA 3I58A 2CGPA 2XF5A 1A31A 2DMNA 2LYCA 3PNYA 4D0PA 4IRHA 4BJTA 3K2ZA 4X1EA 2DMPA 2ECBA 4L5EA 1I1SA 3W2VA 5HNFA 1H0MA 1QZYA 4F93B 1MNDA 1UCRA 2QKMB 4OAZA 2OF7A 4G12A 5GPAA 1O3TA 3LSIA 1TQPA 1FTZA 4P5OA 1FWZA 5FD6A 3B73A 2AO9A 2ZJRF 1LDKB 3IAS2 4QLCU 1BR4A 1Y8QB 1CF7A 5K7HA 5K5QA 1IN5A 1J0RA 2M2EA 3TP3A 3BCAA 4BNCA 2L7ZA 2STWA 1R5GA 5CVRA 2F48A 3U21A 5K5RA 1MDMA 1IO2A 1DP7P 1O57A 1J75A 5D5VB 4AU7A 5KVRA 2QLZA 4LLGF 5ICGA 4KNYA 3MEXA 3KP7A 3I4PA 5FO5A 3E6CC 3KLOA 2ESHA 2XKOA 5FROA 5DCMB 1JTYA 4AYBN 4ZC3A 3LSTA 2DMTA 2VQGA 1FSEA 2P5LC 2IBDA 3FXLA 3VYRB 1RKWA 3M1EA 5JLXA 4V19K 1K79A 2F5DA 2M3AA 2AHQA 5KAIC 2EH3A 3WODF 3F9KA 5C4XJ 2MC4A 3FMRA 3R60A 5ILVA 3WTZA 2VKHA 3CESA 4I09A 1WJEA 2MH2A 3GF2A 1IXRC 4BY7J 5E8GA 5B5EC 4RB2C 1W0TA 4FE7A 3HRTA 5CKTA 4HPQA 4L5JA 2HQAA 4B43A 1ZR2A 2E1MC 3QU6A 3HSEA 3LSRA 2R7QA 3V7RA 2A5YB 5KAFC 4HV5A 1JUPA 3DBHB 3RTRA 5ICFA 2TRTA 1TT0A 2V6CA 1USSA 1WI3A 3JRAA 4KMUX 3J80Z 2Q1ZB 2CW8A 1XSDA 4IL6C 1KU2A 5IPAA 4UUTA 3SDGA 2DFEA 2HDCA 2ZMEC 3V8LA 2COBA 2VQHA 1ULYA 2E1CA 4R1HA 3A0HC 3BWGA 3QPHA 4C2TA 3LA2A 1EA3A 4Y52J 1BI3A 1MJ9A 1HF0A 5F0FA 5D5UB 5J6XA 4F7ZA 2RNJA 4XMYA 2F2EA 4U7DA 2EIKH 4GCVA 3WTXC 3MFKA 2NS8A 4HAMA 2VJ5A 2WBMA 1Y39A 2GIVA 3BR3A 3ZMDA 2LY9A 2ZC2A 1U5TB 4N4NB 1YIOA 2EZKA 3DPLC 3J81Z 3IRQA 2ZO4A 4DOZA 3OS1A 1MJAA 2Y9YA 1W0UA 4I6ZA 3PIOF 2K4JA 3KEYA 3PM1A 1IN8A 1C0WA 1LUJB 2JUCA 4XICA 1P9QC 3TBIA 1LB2A 3CC7I 1LE8B 2K9LA 2AXTC 2JZYA 3HPHA 1YW7A 1XG1A 3ZXSA 4P9FA 3ZOBA 3C3WA 2K02A 1JKRC 1P92A 3AKZA 9ANTA 4PSXA 5J8FA 2X4HA 4NBQA 3W2AA 1UHMA 4IRIA 4ZZDA 3P9CA 2VBWA 1R7JA 3LQRA 2ME6A 2HPMA 4BE2A 5K5OA 3CUQC 4RB3C 3FM5A 4B1RA 1KONA 1R00A 2R7FA 3KPHA 2JN6A 3PL8A 2V1UA 3Q0VA 4PFPA 5F04A 2JUGA 3HYIA 2KIUA 4KISA 3OR2C 1FX7A 5J3LA 1Y8RB 4OMZA 1X19A 4GYIA 2DW4A 4IXAA 3IP4B 5KK1A 3D5LA 3CJTB 4G8XA 2DJIA 3BPVA 4OWRB 2K40A 2CFOA 2FU4A 1QPIA 2O6GE 2QUFA 3O2PE 4IHXA 3L2VA 1T98A 1GDTA 2DAOA 3KP6A 1LVKA 3J80K 2YS9A 4WK8F 1WVRA 1YE9A 2JA7J 2CG4A 3OYHA 4UV8A 1OYWA 3ELKA 4A0YA 3HL2A 1G8XA 2GM4A 2QQ9A 3R61A 4Z6YA 4A5MA 3MQ0A 2BY1A 3RKWA 1VQ4I 2DOEA 4UB8C 3QPLA 3L00A 4DYCA 3KP5A 1X4OA 2CQXA 5CVIA 3CCQI 1TWHJ 4KFCA 3CO6C 2GOXB 2LFBA 1Z7LA 3H35A 1EJ9A 5GTIC 2MLKA 4CZCA 2P8TA 2IRFG 2BVMA 1JJ8C 2R92J 1FIPA 3ABTA 3VSLA 4ANJA 1YG2A 4MFEA 4C2MJ 4B47A 5JFRA 4N9IA 2V1XA 3VYSB 3Q9VA 5EZGA 2EV6A 1TP4A 2DCEA 2JWTA 4RM2A 3JRDA 3EUHC 2KQRA 3IKTA 2JRTA 1I1GA 3V4GA 1LE8A 3AL0C 2J5PA 3F8CA 4BQAA 2E36A 2JPCA 1VFCA 4LJZF 2HZDA 2DLLA 4U0WA 2Y30A 3BZCA 4RLQA 1BA5A 2WAQA 1PP8F 2D5VA 5HLGA 4XL9A 1TTYA 1ON1A 2Y0SN 4LGWA 2G0EA 1PUFB 2DA4A 3DV8A 2A61A 3GTGJ 5E1XA 4FTHA 1E0EA 1FEXA 1IDZA 4OIRF 2XIGA 3MZYA 2OTLI 1TL8A 1QHHD 3BG3A 2K3PA 1XDSA 3HRMA 4XRSG 2A6HF 2E5NA 1NG7A 5H6QA 3OL3A 1TWFJ 4RAGA 4RDUA 3CLOA 1MNMC 2QSFX 1ERDA 4MO7A 1W5TA 5C4JJ 4E7IA 1DP3A 3CDHA 3WU2C 2O61A 5H2FC 2IW5A 4G6TB 2CQKA 4B48A 2GZWA 3T5XA 5CVVA 4I0AA 5M3MJ 1WKMA 1GLNA 2Y48A 3HSFA 4M3GA 4XORA 1Y1WJ 3I5UA 3DBLB 4CYDA 4M3BA 5GAEJ 1SVMA 3A02A 1MBFA 4KIBA 3V42A 2PJRB 4HSTA 2XUBA 4Q47A 4KA4A 1ONVA 2ELHA 5CQEA 3RKYA 2KPMA 1XN7A 2CW7A 5D8KB 2L7MP 3FHZA 2KL4A 3RYPA 3I71A 5M5WJ 2JPBA 4GYGA 4EGZA 3K4CA 3KFWX 3M7GA 3JRHA 4L5IA 2DJNA 3L9FA 2RN7A 1D1CA 1YX3A 2MC3A 4PGHA 5DM7F 3A03A 2MBFA 3BDDA 5EJCA 4IJAA 3I56I 1ETXA 4GRIA 1IXCA 1DPUA 1UMQA 4RS8A 1X2NA 3RYRA 1KZHA 1P7JA 3QPTA 3EPZA 3TOAA 4BACA 1R1UA 3SZTA 3HIFA 4YIFA 2QVOA 2JTVA 1XCVA 3CJNA 1I6HJ 1U0JA 2XDVA 1HW5A 3I53A 4QPQA 2EIMH 1IRXA 2X6OA 4IVNA 3QYEA 4LG0B 3CO7C 1LQ1A 5IOYA 1IGNA 5DYMA 2WY8Q 1RR8C 2CJJA 3HOUJ 4LIUA 4E70A 4EQQA 1FOKA 1DQUA 4UV9A 4O5VA 2NVXJ 3M07A 2W85A 2JA6J 2BOLA 1B6AA 3HOSA 5DV5A 3ZMUA 1VI0A 4FETA 3SFIA 3ZQGA 4V2FA 2GXBA 1D0ZA 4FT8A 3FXRA 3WTTC 2HOTA 3E97A 3H1CA 4OU0A 4IO9F 2PEXA 5ILSA 5E3OA 2DFIA 4PDKA 1QPMA 2ID3A 1W7PB 2BYVE 4J19A 3ERMA 5F6FA 2M4KA 4BE1A 2O8KA 5IY5H 5FJ8J 2PJRA 4E7KA 2W24A 3LQQA 4ZYEA 2EV5A 4EGYA 2DODA 1JI8A 1TNTA 2BEOA 2JMWA 1POGA 4NQWB 1XSXA 3WG7H 2E1MB 4II2A 3WGGA 2D1HA 1WRJA 3B6CA 4A3JJ 4C30A 4E7SA 4J00A 3LAJA 1D8KA 3LWFA 3QQAA 5F0CA 3UNGC 3JRFA 4L9VA 1Z6TA 3K9TA 3D1NI 3OMYA 2F5CA 3KP3A 1A6IA 2Q0OA 3LA7A 4G94A 5DD8A 4EJTA 2VXZA 2XGXA 3QAHA 3WU1B 3ASOH 2H27A 4RAZA 2HOSA 2ZJQF 2CO5A 1USTA 2W1OA 3GFJA 1R49A 3LNQA 2VLAA 2VQCA 3ROUA 3Q3SA 5BPIA 5JLWA 1HDDC 1L3LA 5F1JA 1J59A 2B63J 2EINH 3HG9A 2PMZA 1EH8A 4AD9A 3JSOA 3QU3A 2DPDA 3OIOA 1I50J 2LSOA 3E0JB 1P4WA 4LLLA 2EB7A 1AA7A 3FKIJ 3MKYB 4IPAA 3TKYA 4RGRA 4LOCA 2CU7A 2AXLA 2CQQA 1MBKA 4LG0A 3CP8A 2V26A 3L2QA 1LFBA 5H6RA 3F8FA 4I01A 2YX7A 4HF1A 3EYIA 2R7VA 2E60A 3G71I 3LMMA 4X6AJ 3GFLA 2VI6A 5DEQA 1ZG3A 3H36A 4RM3A 2XVCA 2CFXA 4HRIA 2LBFB 2D2WA 1HBXG 3PFYA 2ZJ2A 4MHGA 1FMWA 4CCMA 2DN0A 2E35A 2FBKA 4HQEA 3W6VA 3DCFA 1SD7A 1B59A 3KEQA 4A5NA 1U78A 1MIJA 1R58A 3OOUA 1LFUP 3FXKA 3GLLA 5CVJA 3RPUA 2OQGA 1D5YA 2NVQJ 4ITVA 3MAJA 1W7PA 2CUZA 3PQKA 2HFHA 1BJZA 2CMPA 2M7BA 1JTXA 5M5YJ 3CUQB 1HQCA 3TP0A 3ZQQA 1FNNA 4NQWA 1FBQA 5D4SA 3HEFA 3HOXJ 5D5WB 4NDLA 3V8KA 2KZGA 4BBSJ 3FMSA 2V1DA 3JAMZ 3H5AA 2PJPA 2BV6A 5DM6F 3K1NA 1EV7A 4LK1F 3GTOJ 1WQ2A 2QEXI 5IYCJ 4A69C 3Q0UA 2R0QC 2Z3YA 3MCZA 2IEKA 3E5UA 4YFKF 2XAFA 2ID6A 2XPUA 3K69A 2DMQA 2X1DA 3O3KA 2HVRA 2NOJB 1S7AA 3CQZJ 1JJ6C 3CMMA 2DDAA 3KE2A 3J7AO 1WWXA 3HXLA 2XAJA 3CJRB 3OIPA 5AIPA 1IN7A 2HYFA 3I9V2 3VPRA 1F43A 1JHFA 1X3WB 2WAEA 2XASA 3HRSA 3I54A 1XD7A 4BE0A 3L2CA 1KYZA 4CYCB 3ABMH 4NC6A 4JOMA 1I3QJ 3PUFA 1TQMA 1MBEA 1YJ9I 2CWEA 2RGVA 4BHPA 4GGGA 2J5OA 3VYUB 2VC0A 1G6NA 5E3LA 4A3KJ 2CW0F 2CUFA 1XTAA 2FA5A 1QBJA 5A2QZ 4U7BA 4Q4ZF 1SAXA 4XNFA 1QQIA 1YHQI 1KYWA 2LBFA 5EDNA 4YIIA 4YFXF 2DDBA 1UHSA 2K9QA 3AL0B 2EWNA 4X0GA 3GZ6A 3DKXA 2LKSA 1X1CA 3IL2A 3GUDA 4HQMA 2KP6A 3SQNA 2VBZA 1N77A 2X6YA 3MZHA 3FIWA 1P2FA 3B6AA 4I02A 3GTJJ 1XSVA 4E6KG 3F6OA 2RQQA 2H1LA 1H89C 2VJ4A 4B3AA 3H0GJ 1YFHA 4MQVA 1XMKA 4XRMA 3GMEA 4KT6A 3CUQA 3SZPA 4WXCA 1PJRA 1WH7A 1CF7B 1G2HA 1RR7A 1LPQA 1G59A 5B3SH 3FISA 2FMYA 2GOMA 4LD5A 4RAFA 3SHFA 3HTSB 3OYLA 1H88C 2F6CA 3JRCA 5IP9J 4Y13A 3BZ6A 1IV6A 1EH7A 3JAMK 3IV5A 2DYRH 2CSOA 3E6BA 1ZLKA 2A5WA 1SFKA 2GXAA 3CJQB 1G3TA 2NXNB 4JYKA 2QQAA 2V9VA 2ZXJA 1VZ0A 2XF6A 5HODA 3CCVI 1UB9A 2A69F 1QRYA 4BAYA 5ED4A 3OWTA 1V5EA 3CP2A 3GZNB 2X51A 1S7OA 3PNTA 4OOIA 3Q5FA 4BY1J 4HDVA 2IGMA 2GLOA 2R7XA 4PFOA 1X3UA 4P1WA 1NH3A 2OCEA 4GDFA 3KZIC 1ZLJA 4E7LA 3LSMA 3BT9A 2VN2A 1F4KA 4HX8A 4BJ6C 4BHCA 1ZQ3P 3HKZN 2LF8A 2M34A 5ILUA 4ZDPA 2KRHA 2W57A 3EDPA 1D5VA 4KUMA 4DZPA 1QNTA 3EUHA 3O6BB 5LHHA 1S29A 4U87A 5LD2C 1XGMA 2ACJA 3HHGA 1T8IA 3BG9A 4KT5C 2ZBKA 1Z0XA 5A2QK 3G1LA 4HNTA 2W7NA 1HKTA 1X58A 3ESWB 5E17F 5IP7J 3BQZA 4AWXB 3RCOA 2VKDA 4NC7A 5DUKA 4G6QA 4ABZA 3KP4A 3G3ZA 2L5QA 3ZQLA 2JRMA 1BIAA 2ZJPF 3CCEI 5BOXA 2VONA 3OYBA 2VKVA 3BCBA 4ZYAA 1MJBA 4DZJA 4PJLA 2XRLA 4F52A 4HNUA 1D0YA 3DQVC 3EUAA 5E20A 4W97A 5HS7A 2K9MA 1YIJI 3Q0WA 3CMEI 1BC8C 2EFWA 3JRIA 5GADJ 2K3FA 1O3RA 5M3FJ 3NARA 3CUOA 2JVHA 2KDZA 4I76A 4BUPA 2MYSA 2E1NA 5E79C 3V7SA 1S3JA 2LY1A 4WWCA 3QWLA 2EZHA 5EZHA 3OYNA 4P9UA 2JVGA 1MH4A 3S2WA 2HZTA 1SANA 2FBHA 1B9MA 4GFBA 3GWZA 2IPQX 2A6EF 1MSEC 3LA3A 1OFCX 2DPUA 2HOAA 2MD0A 1XDUA 1MD0A 2L0KA 2XAQA 2YU9J 3BROA 4LIVA 2FE3A 2L7FP 3RI4A 2LC2A 1NK2P 5EYRA 5B1BH 1IN4A 4MFDA 2L9RA 4M71A 3T8TA 3ZMTA 1A35A 2XGDA 1J2XA 3OS2A 1JT6A 2CYYA 3K4LA 3SYTA 2QENA 4WXHA 3I4MJ 2R93J 1LEBA 3ZQ7A 4C3IJ 2WA0A 4BQOA 5L3GA 2HXIA 1ZAOA 2ZCWA 2EA2A 4L0ZB 3PFIA 4AYBA 2NOGA 4XM3A 1K78A 3FK6A 3HOYJ 1SVOA 5LHIA 2LD5A 3WTYC 2FSWA 3TMOA 2A68F 3RQIA 2DK8A 5E8IA 5E3NA 3HJEA 3S14J 2VUMJ 2LTPA 3S1NJ 3RKQA 3WHBA 1TZLA 2LNBA 4G6DA 1U8BA 1G3YA 4KN4X 1TBXA 2IJLA 4EJWA 5IT3A 2BE5F 2V9KA 4E7HA 1VQMI 1FOWA 4BHBA 4V2GA 3K2AA 3NAUA 2YUSA 3E5QA 3FK7A 3M4OJ 5FFXA 4IHVA 2HTSA 1O7FA 5E18F 1YW8A 1BL0A 3F8BA 3E7LA 4A0XA 3SDBA 2HWVA 2R5YB 2HOEA 2R7OA 5CJ9A 2ISZA 3GTMJ 2UZKA 1MMAA 1FT9A 2MG4A 1DGRM 3WTSC 2ZFWA 4ASNA 3F23A 5LGUA 2GXGA 4A6DA 2FQ3A 2H8WA 3GYHX 2H6CA 3O8GA 2LG4A 2RQPA 4RMNA 5D5XB 3REOA 5D6FA 4GO1A 3RSNA 4L9JA 4CCLA 2QSGX 1V55H 1FPQA 1FMVA 5BS6A 2BW3B 3ECOA 1KQ9A 5K1YA 2NVUB 2Z9OA 2O0YA 3WTWC 1YW9A 3PSFA 4F92B 2FXAA 1JE8A 4KJZA 2PN6A 4XLAA 2L54A 3L7WA 2YPRA 1GXPA 2VB6A 1S5LC 1X1DA 1KQ0A 3GX4X 2HVSA 4G7HF 2WB1N 1R5ID 1UG0A 4ESJA 1A5JA 4Y3OA 2DA1A 2VOOA 1A36A 1XGNA 1PDNC 2V7FA 1YITI 1DU6A 2L3DA 2EBIA 2IS1A 2GAUA 3M3YJ 1Y0NA 3BTIA 1YTYA 2DK5A 4UY8I 1IXSB 2NNNA 2QSHX 3TEDA 1YI2I 1E3HA 3J7ZI 4M3FA 1RRJA 2NNYA 4A3EJ 2EFOA 3E5XA 1P7IA 2IS6A 1LDDA 3HRUA 4HZFA 1YO5C 4A3CJ 3MMYB 3OYEA 2O7OA 1QO0D 1W5CC 3K4JA 2A6TA 5CQGA 2K27A 3AG3H 2R5ZB 4LMYA 3EYYA 2R5YA 4JX5A 2X1CA 3H3UA 4KYWA 2CRGA 1JKQC 1F9NA 4Y15A 4R8HA 4HSRA 1R36A 2DOAA 1SFXA 1WJAA 3TGNA 1PYVA 1T6SA 3K4MA 3ZR8X 3CCLI 1T08B 1MMSA 5EGOB 1ETQA 2P7VB 1KA8A 3LL7A 3BR6A 1TC3C 3F6VA 4Y33A 1AWCA 4PCQA 3J81K 4H4KC 2X6XA 2R7TA 2BW3A 2RAEA 3OSFA 2N8GA 3QOPA 5HLHA 1FIAA 2IA0A 1HW2A 2YU3A 2LMDA 4OMYA 3HGYA 5C3EJ 2FOWA 1TNSA 3DFGA 2XROA 5F27A 1UFMA 3T8RA 3TOBA 1VQ8I 3QODA 4I99C 4B4CA 1IRGA 1TQIA 1MZBA 3ISPA 2OBPA 4L18B 3OY9A 2KRCA 3RKXA 1DUXC 2LKXA 1RUNA 4BH9A 1Z67A 2HPIA 1B72B 1E3OC 4ZTFA 2I10A 1WZ2A 5LEJA 1O3QA 2HKXA 3VOEA 5JHFA 1DPRA 1LNWA 2BGCA 1Z3YA 5L3EA 2LDUA 2K85A 2IT0A 2DYSH 4IHSA 2Y0SA 1BOAA 4IQJA 1STZA 3K10A 4A3BJ 2R5ZA 3MVPA 3JRBA 5HS9A 1VQ6I 3DPUA 3FXUA 2KDOA 1WJCA 5LEKA 4IRGA 1XC5A 3OS0A 3L2WA 1ON2A 2XAHA 2QBYB 3L1PA 4M6XA 3SJMA 2NYXA 3HBLA 3TQNA 2IS4A 4XKVA 1QGPA 5IYBJ 2L9SA 1W4MA 4QTRA 3GW2A 5LFAA 2LR8A 1PP7U 5EGOA 3GTKJ 5CVUA 4U0YA 2KIQA 2OQRA 4Z2YA 3HB9A 3S3MA 3H9JA 4CCNA 3QRFF 1Q1HA 2EIJH 1ZR4A 3FZVA 1ETYA 4HX4A 2WC2A 4Q5SF 4MGRA 3TDZC 3NWSA 1SMYF 1ZRFA 3N05A 3S93A 3COAC 4N4OB 5GTHC 1Z21A 5GP9A 1X2MA 2KT0A 4QWQA 4EJOA 3I0TA 4MTDA 3J7YJ 1KU7A 4ZJZA 2X85A 3UKGA 1X1AA 1Z3XA 3ZMVA 2FMLA 2KMUA 1X1BA 4OAYA 4A0ZA 2IGOA 2P4WA 1S6LA 4DNCA 2F4MB 1MH3A 4FCYA 1R1TA 4DQ2A 1IG7A 4S04A 2GA1A 2FNPA 2X0LA 1B72A 2B9SA 2IP2A 1W5SA 3KP2A 1CGPA 1SD5A 5D8LB 3BJOA 2CQ7A 3VFZA 4KN7X 4BXUA 5DS9A 3C1DA 4EM0B 3E6DA 3ML6A 3OR1C 4YEJA 4XK4A 2EFQA 1MBHA 1BI2A 1SD6A 1K61A 2G7UA 2HI3A 1ETKA 4ESBA 3DTIA 1YJNI 2FRHA 4MTEA 2HYJA 4DBQA 3BPXA 1K4SA 1HA8A 3DEUA 2O03A 4AVZA 3S3NA 4XRFA 5H20A 3VWBA 4C3HJ 2KFDA 2QBYA 2XV4S 1VQPI 1R4MB 1H9GA 3JW4A 2IAIA 3JR9A 1HXDA 1R22A 2ZSIB 1RUOA 2I5UA 1K4TA 1EF4A 3OYIA 3CMYA 4JQFA 4UVBA 3PIPF 1N25A 1UELB 2PMUA 2CV1A 1YS6A 2VPLA 4XSXF 1YQAA 3E6MA 1IRFA 1JHHA 4QPOA 2RV8A 4YIRX 5FD5A 3C2GA 1UHWA 3OYDA 1HSJA 2W4SA 1BR2A 3EQLF 3KX2A 2XF7A 2OZUA 2ZMEB 3JTHA 3HTUA 2M30A 4RB1A 1RIOH 1QU3A 2V6EA 1U2WA 3FMQA 2PBIA 2E71A 3I59B 4XSZF 1D1BA 4A3DJ 1WCMJ 3H92A 1J7KA 3HC7A 1ZREA 3K4BA 1KU9A 2A3SA 2K9NA 1TWAJ 1BW6A 4FHTA 4F3QA 3KEOA 2KISA 2Y31A 2LKPA 3GTPJ 3KZZA 3OOPA 3ZRGA 2AQEA 2UUZA 1CQTA 4EV0A 4O3MA 3W6KB 3BG6A 4RA2A 2H09A 4EVIA 1JGGA 3GFIA 3PO2J 3CLQA 3DLAA 4M74A 1BI0A 5KHDA 4WXDA 4IHTA 2Q2EA 4XONA 3F72A
chains in the Genus database with same CATH topology
2XC7A 3PNVA 4N4NB 3DPLC 2IGMA 4DOZA 4II3A 3OS1A 4PFOA 2R7XA 1LFPA 4P1WA 4LG3A 3KEYA 4E7LA 3LSMA 2M4GA 1P9QC 3TBIA 4BJ6C 2K9LA 3CZ6A 3HPHA 3ZXSA 4ZDPA 2KRHA 2VXDA 4U87A 4E4HA 5LD2C 3AKZA 4PSXA 3W2AA 2F4IA 1W36C 4HNTA 1D1AA 2ELJA 2W7NA 2HPMA 4BE2A 2IGKA 3QYFA 3KYLA 3RCOA 3DTKA 1BOBA 1KONA 2VKDA 4NC7A 4D1QA 2L2OA 2IXSA 3PL8A 4PFPA 4BXFA 2JUGA 2RNGA 2L5QA 4KISA 3OR2C 4CUGA 1QHGA 1T0FC 3OYBA 3BCBA 4ZYAA 1X19A 4Y4RA 4PJLA 5KCMA 4F52A 4HNUA 3IP4B 1D0YA 3OYAA 3D5LA 3DQVC 3EUAA 2DJIA 2K9MA 3CF2A 4OWRB 2CFOA 2DT7B 4CSWA 3HOTA 3FDYA 2CH0A 1WJDA 2Q2EB 3L2VA 3BG7A 1Y6IA 1LVKA 2JVHA 4BUPA 1YE9A 2MYSA 3OYHA 3HL2A 1G8XA 2LY1A 5HOOA 3S8PA 4RLFA 3OYNA 2JVGA 5HVQC 3LSGA 2VJIA 3OYMA 4IQ4A 1X4OA 4MLOA 3PJRA 2GOXB 2MD0A 1Z7LA 2LH9A 3H35A 4J01A 4CZCA 2BVMA 3TL4X 4LIVA 2LC2A 4YELA 4ANJA 3VSLA 3K4KA 3K4NA 4B47A 1V5GA 3VYSB 4DGWB 2XSJC 3AFHA 3PUBA 4XLEA 3QOEA 3OS2A 2WY7Q 2DCEA 4RM2A 3EUHC 2KQRA 3K4LA 3SYTA 2LY2A 3FBNB 3MKZA 3AL0C 3S32A 2WA0A 4BQOA 2W82A 2HZDA 4AYBA 3J7AY 4XM3A 4C9YA 2R4GA 4HEA2 2W00A 4YRVA 5TGTA 3TMOA 4RLQA 2WAQA 3LSKA 2IS2A 4CA0A 2OUMA 4XL9A 3DWLE 1TZLA 1WJBA 3HUGB 1E0EA 3BC8A 3W2WA 2HVQA 2V9KA 1QHHD 2K3PA 4E7HA 3FKJA 1MW7A 2E5NA 1NG7A 2HNHA 3OL4A 1MMNA 3OL3A 1DGWY 1T95A 5CPRB 3OYJA 3GBGA 3SDBA 2R7OA 1ERDA 4E7IA 2JA2A 1DP3A 2ZSHB 1MMAA 4G6TB 4B48A 3A1YA 3DPTA 1DGRM 1GLNA 1MMDA 2Z2SB 3VYTB 1MNEA 4XORA 4XLFA 4IZZA 2R7WA 2MABA 4E7ZA 3LSHA 2LG4A 4RMNA 1ZELA 4BQNA 3V42A 3K70D 2F5VA 2OC6A 1X4PA 2PJRB 4HSTA 3RSNA 4CCLA 3E1SA 1FMVA 2BW3B 5CQEA 4EATA 2JSPA 2KPMA 2CW7A 2KL4A 2VIXA 1WJFA 4BDYA 3PSFA 4F92B 2L7KA 4KJZA 4XLAA 3K4CA 3S3OA 2VB6A 5KNLA 2CS3A 1OLTA 1X1DA 1D1CA 1YX3A 2HVSA 4XQFA 1UG0A 3DTEA 4Y3OA 4BEHB 2Z1DA 4GRIA 4NNJA 4XKWA 4HG2A 2V7FA 3M8JA 2IS1A 3SZGA 3EPZA 3HKZA 2X1EA 4BACA 4E7JA 4CCJA 2QKLB 4PK4A 2WADA 2CV0A 1U0JA 2XDVA 4R79A 4QPQA 1IRXA 2IS6A 1Y56A 3IUOA 3QYEA 4DJAA 2WY8Q 3MMYB 3OYEA 4LIUA 3K4JA 2A6TA 4XLCA 5CQGA 2VASA 1DQUA 2ZXHA 3HPGA 4DBRA 3L2RA 3DKYA 2BOLA 4CH7A 2I8DA 3HOSA 2O5RA 2FUG2 4HSRA 4FETA 4CCKA 2DOAA 3UR3C 3ZCOA 3ZGKA 1WJAA 3OYFA 1D0ZA 1PYVA 2HU9A 3K4MA 4XN0A 3ZR8X 3H0DA 4BS9A 1SAUA 3VSKA 4BQQA 2HDWA 3LL7A 1WJ5A 4Y33A 4BE1A 2M4KA 2LREA 3DEEA 2PJRA 4E7KA 2UWMA 4H4KC 4ZDLA 2X6XA 2R7TA 2KZVA 1JI8A 4NQWB 2BW3A 3OIQA 2E1MB 4II2A 4BGDA 2VQLA 3OYGA 3EUKL 4C30A 4E7SA 4J00A 3UNGC 3DU5A 3OYCA 3OMYA 3QODA 3VDXA 2ZFUA 2XAUA 2VXZA 2AQFA 3SEZA 5HLTA 2R7UA 2W1OA 3OY9A 2KRCA 1V5FA 2VLAA 4FASD 2VQCA 3G2BA 4BEHA 2R7SA 4BDZA 1MMGA 2LOOA 1S9HA 3RPUD 3HG9A 2PMZA 2HPIA 3K70C 4ZTFA 2CUJA 3E0JB 2BVLA 3DU6A 2M0MA 1AA7A 4PSWA 3MKYB 5JHFA 2WAFA 1K6YA 1Z3YA 3H9QA 1WFXA 3D5SC 3RQ4A 3CP8A 4IKFA 5HNHA 2Y0SA 2V26A 3L2QA 4F91B 4IQJA 4ZTJA 3K10A 2R7VA 2E60A 3LMMA 3W3CA 3DPUA 2KDOA 1WJCA 3LFUA 3FBIB 4RM3A 3L2WA 3OS0A 4BU2A 4HRIA 2LBFB 2R7RA 3PFYA 4KITB 1FMWA 4CCMA 2P0WA 2IS4A 4XKVA 2L9SA 3OOUA 5LFAA 4XN3A 4PUSA 3H5RA 3S3MA 4ITVA 3H9JA 4CCNA 2CUZA 2VJJA 3FHNA 4BL0B 3BLYA 2CMPA 2M7BA 3PSIA 4XKCA 5FRNA 3ZQQA 3ONQA 1N75A 4PJMA 3NWSA 4PJJA 3OYKA 3MD2A 4LITA 2KHMA 3N05A 3S93A 2XF5A 2LYCA 3H5NA 3PNYA 3H5AA 4N4OB 4BJTA 2CV2A 1Z21A 1UAAA 3NWTA 2L9NA 3A2KA 4B44A 4ZDOA 1NG6A 4F55A 3I3LA 3W2VA 4ZJZA 5HNFA 2X85A 1X1AA 1Z3XA 4F93B 1MNDA 2LRDA 2QKMB 2KMUA 1X1BA 2X6WA 2X1DA 4OAZA 4OAYA 2IGOA 2HVRA 3LSIA 2KLOA 2NOJB 3C2HA 4P5OA 3CMMA 2WB1A 1LDKB 3IAS2 1BR4A 4B3XA 3HXLA 3D5RC 3CJRB 4XLHA 3OIPA 1W36D 3I9V2 3BCAA 2WAEA 3U21A 4BE0A 4AU7A 4YEJA 3OR1C 2K5CA 4JOMA 3DTIA 5FROA 4XOTA 3VYUB 4ZC3A 3M1CA 4DBQA 4XOPA 1HA8A 2VQGA 1D0XA 4U7BA 4AVZA 3VYRB 4XNFA 4CCOA 3S3NA 2M7AA 4XR6A 3VWBA 1OR7C 4DIQA 2LBFA 2M3AA 4PJNA 3F9KA 3QYBA 3AL0B 2MC4A 2ZSIB 4X0GA 4BJ5C 2VKHA 3CESA 1BR1A 1WJEA 2RREA 3DKXA 1X1CA 2KP6A 3OYIA 5FRMA 2V1NA 2X6YA 1N77A 1N78A 4JQFA 5CKTA 4HPQA 2IGNA 2HQAA 4B43A 4E6KG 2RQQA 1UELB 2E1MC 2VJ4A 4XKBA 2CV1A 3A4CA 2VPLA 3MKWB 2R7QA 2ZXIA 4C2UA 1LKXA 2MFZA 1YX5A 4KT6A 4NC8A 4QPOA 3RTRA 3SEQA 3C2GA 2VL8A 1TT0A 1PJRA 3OYDA 2W4SA 3KX2A 1BR2A 2XF7A 2Z16A 2DXIA 1G59A 2Q1ZB 2CW8A 1QU3A 2V6EA 2GOMA 3OYLA 1D1BA 1J09A 2F6CA 3HC7A 2V4JC 3K4BA 2VQHA 2OV7A 1R6RA 2UV1A 3L2UA 4F3QA 4C2TA 2A5WA 1SFKA 2DT6A 1EA3A 3CJQB 4IX7A 3ZRGA 3IAM2 3H9GA 2AQEA 2UUZA 4XMYA 1VZ0A 3BG6A 2XF6A 4NUBA 4D9JA 2VJ5A 2WBMA 2E5ZA 3K6GA 3DLAA 3OWTA 1V5EA 3CP2A 5KHDA 2X51A 2X1CA 3PNTA 4XONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRG A; 
#chains in the Genus database with same CATH topology
 3TO6 A;  3DF8 A;  2XC7 A;  3PNV A;  1G4D A;  4PGG A;  1BI1 A;  1RKT A;  2VKE A;  1SFU A;  1LFP A;  4LG3 A;  2BBY A;  3HSR A;  3F8M A;  3H3V K;  5K7F A;  3ZQI A;  1RC9 A;  1TW3 A;  1U5T C;  2BY0 A;  2XAG A;  3TO9 A;  4IEJ A;  1ITY A;  3IRR A;  1RI7 A;  4A2U A;  1XGO A;  1G3W A;  2Y2Z A;  1JKP C;  1TLH B;  3N97 A;  4OIO F;  1ODD A;  3PO3 J;  3C2B A;  1KGS A;  4UB6 C;  2F4I A;  1ZKG A;  5J4V A;  1D1A A;  4P96 A;  3ZP5 A;  1ZRC A;  1OYY A;  2ELJ A;  3CMA I;  3CC2 I;  2IGK A;  3QYF A;  4ESF A;  3S16 J;  3I64 A;  2WWY A;  4HF2 A;  1BOB A;  3W6J B;  5HDN A;  4KIG A;  2DA3 A;  4D1Q A;  1B8I B;  1BW5 A;  2L2O A;  2IXS A;  1BIB A;  4BXF A;  2Z99 A;  3OV8 A;  2RNG A;  4RB0 A;  5F64 A;  4DW6 A;  1T0F C;  2ECC A;  1E3P A;  2YSR A;  5KCM A;  3BR2 A;  2ZME A;  3WU0 A;  3M8E A;  4BXX J;  1HC8 A;  5GAH J;  4UNO A;  2X9D A;  5J1U A;  2HS5 A;  1I6X A;  4ENJ A;  4A93 J;  3I59 A;  1L0O C;  1WJD A;  1LEA A;  1GV5 A;  3BG7 A;  2DMU A;  1Y6I A;  3IKV A;  4G9Y A;  2LP0 A;  1YS7 A;  4MEX F;  2XKP A;  3BJ6 A;  1Q1V A;  1F36 A;  2UXX A;  1VQO I;  2EFP A;  5HOO A;  2ISY A;  3IWZ A;  1BJA A;  3LSG A;  2ZNY A;  1OMI A;  4EJU A;  4MLO A;  3HM5 A;  2PLY A;  5BNG A;  4FX4 A;  2LH9 A;  2NVT J;  4L9T A;  3TL4 X;  3MN2 A;  1SFE A;  4D5F A;  1HCR A;  1IJW C;  4UXN A;  3K4N A;  3CC4 I;  5F1R A;  1ZGJ A;  4DGW B;  3RZO J;  2HQN A;  2XSJ C;  1R23 A;  2BXZ A;  3PUB A;  4XLE A;  2B7E A;  2WY7 Q;  1SEU A;  3BQY A;  5ICC A;  2RDP A;  1JT0 A;  1IUF A;  1F1Z A;  2LY2 A;  1REP C;  4MQ9 F;  3MKZ A;  2FNA A;  2DA2 A;  3ZQC A;  5IOZ A;  4C9Y A;  2P5V A;  2G7H A;  4MIM A;  5FKL A;  4I98 B;  2IS2 A;  1HDP A;  2OU2 A;  3DWL E;  4D7M A;  4EEF G;  2RKH A;  1WJB A;  3HUG B;  2ZNZ A;  2HGC A;  4RGS A;  4AVP A;  1XX5 A;  1B8I A;  1ENH A;  4EM2 A;  3QP6 A;  4ENM A;  2P6S A;  3IH3 A;  1G3S A;  3FKJ A;  2VBY A;  4DYR A;  2O9L A;  1JKO C;  2V9P A;  2HNH A;  3OL4 A;  1MMN A;  1E2X A;  2X48 A;  1OIS A;  3HDD A;  1T95 A;  5CPR B;  3V8J A;  1Y0U A;  3LSJ A;  1W7P D;  3JRG A;  2P7C B;  1EH6 A;  3FF5 A;  2DFF A;  2HR3 A;  3IH2 A;  3O8H A;  3DPT A;  4Q48 A;  4HW0 A;  3HOV J;  4C3J J;  1FYL A;  4XLF A;  4IZZ A;  2MAB A;  3TW6 A;  4E7Z A;  2ME0 A;  5TJJ A;  4ZYH A;  1ETV A;  2VE9 A;  2P6T A;  2DU9 A;  1ZEL A;  2NVY J;  1Z05 A;  3K70 D;  3ZN1 A;  2F5V A;  2OC6 A;  2AS5 F;  4A3L J;  1J9I A;  3DXJ F;  3E1S A;  3BG5 A;  2K4B A;  4EJV A;  1OCO H;  2DOF A;  5FLM J;  4A3I J;  1IRZ A;  1H8A C;  4D7N A;  1OJL A;  3S15 J;  1K78 B;  4TV7 A;  1WPK A;  2E2I J;  5HDG A;  4LB6 B;  1XPX A;  2IA1 A;  1SFO J;  3K1M A;  3WGI A;  4JBA A;  1BC7 C;  5KNL A;  5E1W A;  2QCO A;  2MH9 A;  5IP6 A;  3BY6 A;  2EPF A;  2KIM A;  3K7A J;  3DTE A;  4I2O A;  1S7E A;  4ETS A;  4BEH B;  4AIH A;  3M8F A;  4L0Y B;  2BZT A;  3NQO A;  4NNJ A;  4A3F J;  1IV8 A;  1QZZ A;  3M8J A;  1DDN A;  2FX0 A;  2HKO A;  3HKZ A;  5AIQ A;  3T1B A;  1P4X A;  4CCJ A;  2QKL B;  4PK4 A;  1VF9 A;  3HUG A;  2WAD A;  4ON0 A;  4XID A;  3WTU C;  3S1R J;  1T56 A;  4R79 A;  1QVU A;  5LRS A;  4HV6 A;  1VND A;  2R3S A;  4RBO A;  3IUO A;  4RGX A;  3FWE A;  3CDL A;  3BZK A;  2R7D A;  2NAZ A;  1FOY A;  1UZC A;  4XLC A;  1O4X A;  4IOA F;  2VAS A;  2Y0M A;  3ABL H;  3HPG A;  3AG2 H;  4GXO A;  1T38 A;  5LGN A;  2ADU A;  3I55 I;  4DBR A;  4CH7 A;  2VOD A;  2O5R A;  2FUG 2;  2E2H J;  1Z6R A;  4CCK A;  3UR3 C;  3ZCO A;  3ZGK A;  1ZRD A;  2JSC A;  3RDI A;  2HU9 A;  4XN0 A;  1GXQ A;  3DEW A;  2JT1 A;  1S72 I;  1SC7 A;  4WF2 A;  1B9N A;  1MKM A;  5AON A;  1SAU A;  2W25 A;  4BQQ A;  2HDW A;  1FLI A;  2NS7 A;  5EEH A;  1HOM A;  1BBY A;  2LRE A;  4UUV A;  2Y75 A;  2UWM A;  1HW1 A;  1YRN A;  3A01 A;  1FP1 D;  5LRR A;  2KZV A;  1FYM A;  5L3F A;  4BGD A;  2VQL A;  3OYG A;  5ERI A;  3DU5 A;  4G7O F;  3OYC A;  3F8N A;  2ZFU A;  3VDX A;  1GHC A;  2XAU A;  2WV1 A;  2AQF A;  5HLT A;  2R7U A;  2C6Y A;  4JK1 X;  3KLN A;  2MW8 A;  4M3E A;  3K1P A;  1V5F A;  3ULQ B;  4FAS D;  4BEH A;  1M1E B;  4UVA A;  1MMG A;  3HZJ A;  3FXM A;  3FXJ A;  4OIN F;  3K70 C;  3S2D J;  4FX0 A;  2HQ5 A;  4XLN F;  3S1Q J;  3R0A A;  2BVL A;  1HKS A;  2M0M A;  3HHH A;  5FGM A;  3FXO A;  3DKW A;  2QA4 I;  4M72 A;  5J4Y A;  1SVL A;  1OCR H;  3CCM I;  3H9Q A;  1WFX A;  2G9W A;  2V79 A;  1APL C;  1QZE A;  2HQR A;  2JQ7 A;  2P5K A;  3ECH A;  3RQ4 A;  3GEZ A;  3P9I A;  4S0H B;  2QYO A;  5HLI A;  2M0C A;  1ZH5 A;  3K0L A;  4ZTJ A;  3QP5 A;  2CQN A;  1P6R A;  4AIK A;  5IYD J;  1RZ4 A;  4CHU A;  1VTN C;  1X3Z B;  1FY7 A;  2B0L A;  3AAF A;  2DT5 A;  5DTD A;  2FQ4 A;  5D4R A;  2VBX A;  2OTJ I;  5LGT A;  1V3F A;  3MWM A;  4UVC A;  4AM3 A;  2W84 A;  4KIT B;  2NRA C;  4YG2 F;  1BN5 A;  4HNV A;  4M6Y A;  2Z5U A;  3P5J A;  2H1K A;  4UHT A;  1W1W E;  1Z9C A;  4PUS A;  3H5R A;  3RIR A;  4HX7 A;  5DCM A;  4CZZ A;  5BMZ A;  3WTV C;  4A3G J;  2OZ6 A;  3F0C A;  2WTE A;  3BLY A;  1ZG1 A;  3PSI A;  3I4N J;  4AIJ A;  4W1U A;  5C44 J;  3G1O A;  2LVS A;  4H0E A;  4NB5 A;  1RET A;  5FRN A;  2FOK A;  4PJM A;  3MD2 A;  4LIT A;  2P81 A;  3JTG A;  2KHM A;  2DBB A;  2QWW A;  1A04 A;  5GPC A;  1VQ7 I;  3H5N A;  4NHJ A;  2CV2 A;  4QSH A;  4KDP A;  3G1M A;  1E17 A;  4EM1 A;  1UAA A;  3NWT A;  2L9N A;  1AU7 A;  3A2K A;  1KQ8 A;  4B44 A;  4ZDO A;  1NG6 A;  4M9S A;  5EEG A;  4B09 A;  1WGX A;  1HST A;  1U9O A;  2EV0 A;  4F55 A;  3I3L A;  2KJC A;  4HBL A;  3ERE D;  3GTQ J;  3RJP A;  2LRD A;  1T33 A;  2X6W A;  3FX3 A;  1I5Z A;  2BXY A;  2KLO A;  5DD4 A;  3C2H A;  2VC1 A;  2OPT A;  2M45 A;  3VEP A;  4HLY A;  5BPD A;  1R71 A;  1IC8 A;  3BR0 A;  2EA4 A;  2GA2 A;  2WB1 A;  1PVE A;  1ZK8 A;  5FFZ A;  1ZGW A;  4B3X A;  1F5T A;  3IHU A;  1IUY A;  3D5R C;  4XLH A;  3GCM A;  2L9V A;  1W36 D;  2KJB A;  3G6E I;  4P55 A;  3BR5 A;  1HKQ A;  1RNL A;  3IH4 A;  2FEZ A;  2K5C A;  1FJL A;  1FZP B;  4HA8 A;  3GTL J;  5DUI A;  4I0B A;  1OPC A;  4M3D A;  5J1Y A;  2KRF A;  1R5H A;  2DI3 A;  4XOT A;  3RZD J;  5J8C A;  1MBJ A;  3GLX A;  1D3Y A;  2QQB A;  3M1C A;  1KU3 A;  4XOP A;  5FKN A;  1D0X A;  2H6B A;  2GWR A;  4CCO A;  1R1V A;  1YJW I;  2M7A A;  2WAQ N;  5FLX Z;  1ZHF A;  4XR6 A;  2ZB9 A;  1OR7 C;  4DIQ A;  2EFN A;  3KIO A;  4U0V A;  2BHY A;  4PJN A;  1IZ1 A;  2K7L A;  4IHY A;  3OSG A;  3BTC A;  2M8E A;  1U5T A;  3QYB A;  1VQ9 I;  5JI6 A;  4OIP F;  1ETW A;  2PQ8 A;  4N9H A;  4XLP F;  3GVA A;  4BJ5 C;  1BR1 A;  2RRE A;  1ZAR A;  2M9H A;  2FBI A;  2EZI A;  2O3F A;  2XPW A;  1U3E M;  5FRM A;  2V1N A;  3HGG A;  4KMF A;  3DLL F;  2JA8 J;  1N78 A;  2FD5 A;  1B1B A;  3ZN0 A;  2IGN A;  4XKB A;  3CF5 F;  3A4C A;  3MKW B;  5DDG A;  1D8J A;  4XRS A;  4C2U A;  2ZXI A;  1LKX A;  2MFZ A;  4RGU A;  1YX5 A;  4NC8 A;  3KET A;  2IVM A;  3LAP A;  2E2J J;  3SEQ A;  2OA4 A;  2VL8 A;  2JK3 A;  5GAG J;  4YFN F;  1SD4 A;  2Z16 A;  2OAZ A;  2YX4 A;  2DXI A;  2KIF A;  3GFM A;  4B8X A;  2CUE A;  5CYV A;  1T0F A;  2VOP A;  1FTT A;  3HOW J;  3ZMZ A;  3R6S A;  3WE3 A;  1J09 A;  4CO8 A;  3S2H J;  2WV0 A;  2V4J C;  2Y9Z A;  2OV7 A;  1K83 J;  1R6R A;  1UG2 A;  1U6G A;  2UV1 A;  1ORK A;  3L2U A;  5L3D A;  2DA5 A;  4WX9 A;  1V54 H;  4L9N A;  5B1A H;  2DT6 A;  1OQY A;  2E34 A;  4IX7 A;  2R7Z J;  3GO5 A;  3IAM 2;  3H9G A;  4AC0 A;  2OCC H;  4NUB A;  2E1O A;  4D9J A;  5J1R A;  2XGE A;  2E5Z A;  3K6G A;  3F21 A;  3BR1 A;  1XB4 A;  3ABU A;  4HOB A;  3KYC B;  4G7Z F;  3N4M A;  3QPS A;  1TW2 A;  1XCB A;  2D1V A;  4II3 A;  1XMX A;  5JR3 A;  1T2K A;  3X2Q H;  4ENK A;  2M4G A;  3F3X A;  2MGQ A;  5JVT A;  2GBY A;  3C7J A;  2ICW G;  1H9T A;  3CZ6 A;  1IF1 A;  5FLV A;  2COM A;  3VOD A;  2VXD A;  3B02 A;  3BP8 A;  3ZPL A;  1OCP A;  4E4H A;  5JHU A;  4IOC F;  1R9T J;  2DQR A;  2TCT A;  2HEO A;  1W36 C;  2D45 A;  2L01 A;  5J47 A;  5FLX K;  4FQG A;  4ZZL A;  3TDU C;  2TDX A;  2HDD A;  3KYL A;  2XB5 A;  1MGT A;  3DTK A;  4I7H A;  1S8N A;  4N0B A;  3BTL A;  3FXQ A;  3Q9S A;  4CUG A;  1R4N B;  1QHG A;  4KIC A;  4Y4R A;  5K7Z A;  2PI0 A;  3OYA A;  1TT5 B;  2EIL H;  2DFH A;  2PMH A;  3M9A A;  2DTR A;  3CF2 A;  5F0H A;  2DT7 B;  5CLS A;  4CSW A;  3HOT A;  3FDY A;  1FP2 A;  2VE8 A;  4A12 A;  3FM3 A;  1PUF A;  1FOX A;  2CH0 A;  2Q2E B;  4A6E A;  1AOY A;  3SXY A;  3CCU I;  2E7W A;  4HLX A;  1XGS A;  4RAY A;  1GUU A;  3ABK H;  1O7L A;  2LF7 A;  2BY2 A;  4WCG A;  1EKE A;  3BOQ A;  4M9Z A;  3S8P A;  4XBF A;  4RLF A;  5EF6 A;  5HVQ C;  2XSD C;  3CCY A;  2VJI A;  3L09 A;  5HDK A;  3OYM A;  4IQ4 A;  3CCR I;  3PJR A;  4UUS B;  3EET A;  2O8X A;  4J01 A;  3WG9 A;  2MLG A;  5F08 A;  1LVA A;  4M73 A;  5LHG A;  4YEL A;  3K4K A;  3VB2 A;  1J5Y A;  1V5G A;  2FF4 A;  3AFH A;  1GVJ A;  3QOE A;  2Q8K A;  4QIW N;  1T39 A;  1AKH B;  2ZKZ A;  2PMZ N;  1V4R A;  1ZG5 A;  3GZ5 A;  2F4O B;  2Z33 A;  5TIS C;  1K7A A;  3FBN B;  3R0J A;  4MEY F;  3WHC A;  3S32 A;  2BY3 A;  3IC7 A;  3P7N A;  5JVG F;  2VPR A;  3DBR B;  2W48 A;  2HYG D;  4IF4 A;  2ELK A;  3IWF A;  2W82 A;  4CIC A;  3CCJ I;  1I3A A;  3J7A Y;  2HTJ A;  2R4G A;  4HEA 2;  2XGC A;  2W00 A;  2ZXW H;  4YRV A;  1JUM A;  5TGT A;  5ICE A;  4BYY A;  1FYK A;  3LSK A;  4CA0 A;  2OUM A;  1JGS A;  4AID A;  5B66 C;  4ZYG A;  1ACI A;  1XMA A;  1OCZ H;  2XPV A;  2A05 A;  3BC8 A;  3W2W A;  2Y69 H;  2XHK A;  2LK2 A;  4HDU A;  2HVQ A;  4S05 A;  1ZTR A;  1VQ5 I;  1ZN2 A;  1MW7 A;  2M87 A;  2F5F A;  4BKX A;  1VQN I;  4PJ0 C;  3BTJ A;  1DGW Y;  4FE4 A;  2NS0 A;  3OYJ A;  2QGU A;  3GBG A;  2XRN A;  2DTZ A;  3CTA A;  3KZY A;  1Y1V J;  2JA2 A;  2ZSH B;  1OCC H;  1ETO A;  3A1Y A;  3MKL A;  4FIS A;  4JX4 A;  4O6J A;  5E1Z B;  5LBQ A;  4LB5 A;  1MMD A;  2Z2S B;  3VYT B;  1MNE A;  3CD6 I;  1YYV A;  3G73 A;  2R7W A;  1B4A A;  1IDY A;  1ZGA A;  3AG4 H;  2EQR A;  2HXO A;  1GT0 C;  5IT9 Z;  1WI9 A;  3LSH A;  1BM9 A;  3F22 A;  1FSH A;  4BQN A;  1IN6 A;  1MSF C;  1X4P A;  3G4S I;  3S1M J;  1UJ8 A;  1NK3 P;  2PG4 A;  3TW7 A;  4UUS A;  5FKK A;  2K86 A;  4EAT A;  1TWC J;  3CDI A;  1ZYR F;  2JSP A;  3JCU C;  3NEU A;  1QA6 A;  4OIQ F;  4LK0 F;  2VIX A;  1WJF A;  4BDY A;  4ENN A;  3V7C A;  2K9S A;  2L7K A;  5EG0 B;  1RES A;  3D0S A;  4CXF A;  4PZJ A;  4ZH4 F;  5LLQ A;  2M1B A;  3S3O A;  1OYI A;  2CS3 A;  1NTC A;  1OLT A;  4Y17 A;  1AKH A;  2H94 A;  1QVT A;  4XQF A;  3BJA A;  3JRE A;  1NHA A;  2Z1D A;  2MA3 A;  2BHZ A;  2VT2 A;  4K2E A;  4XKW A;  1VQK I;  3KCC A;  4HG2 A;  2M8G X;  3WGH A;  3R4K A;  4Y7N J;  3SZG A;  1XS9 A;  3U1K A;  1HLV A;  2JA5 J;  4IHW A;  4CGZ A;  2OJE D;  3CCS I;  1A6Q A;  2QF7 A;  2X1E A;  3U9G A;  1WH5 A;  4HYE A;  4E7J A;  2QQ8 A;  1WSU A;  2VT3 A;  2EK5 A;  1PUE E;  2CV0 A;  5FKO A;  3LSP A;  1Y56 A;  2QZ8 A;  1IW7 F;  3WE2 A;  1YLF A;  4DJA A;  2E7X A;  3NRV A;  4M6V A;  4BBR J;  3HOZ J;  3ZQF A;  2ZXH A;  3U1D A;  3KYD B;  4LFU A;  3U2R A;  1P4A A;  4EMS A;  1LJ9 A;  2MSY A;  3L2R A;  1GVD A;  3DKY A;  1FBU A;  2DA7 A;  2I8D A;  5J40 A;  2M5W A;  5M5X J;  1JXS A;  2H8R A;  2RVC A;  3ASN H;  4HF0 A;  4ZYD A;  3OYF A;  4JX6 A;  1OCT C;  1SMT A;  3H0D A;  3PQJ A;  1TWG J;  4BS9 A;  5FKM A;  3VSK A;  5FB2 A;  5E3M A;  4LLN A;  1WJ5 A;  1K6O A;  3DEE A;  3RPQ A;  5L3C A;  2XB0 X;  4ZDL A;  4DYQ A;  1U9N A;  3A0B C;  2L4M A;  3GXO A;  3OIQ A;  3DP7 A;  5IT9 K;  3AG1 H;  2YR2 A;  3ZQH A;  2JJ7 A;  3JSP A;  3EUK L;  3ZMS A;  2F5E A;  4U88 A;  1X1P A;  5TRD A;  2IA2 A;  1Z91 A;  5EG0 A;  2STT A;  2L02 A;  1JUS A;  2ESN A;  1DU0 A;  2EJR A;  3SEZ A;  2L4A A;  3T0Y A;  4A3M J;  2FJ1 A;  2PX9 A;  1I27 A;  5DCF A;  3G2B A;  2R7S A;  4BDZ A;  3LFK A;  2QM3 A;  2LOO A;  1S9H A;  3RPU D;  2RC4 A;  5D6E A;  2KKO A;  2LLK A;  1AHD P;  1YOV B;  5L3B A;  1MBG A;  2CUJ A;  4JP0 A;  2A07 F;  3DU6 A;  2MD5 A;  2DO7 A;  1OKR A;  4M9X A;  4PSW A;  2DQL A;  2WAF A;  3MZ8 A;  1K6Y A;  1MDM B;  1Z77 A;  1LDJ A;  1Z7U A;  3D5S C;  2UXN A;  4CDG A;  4KIF A;  1FC3 A;  1I39 A;  4IKF A;  3TO7 A;  1WHU A;  5HNH A;  5EEA A;  4F91 B;  1GV2 A;  1Z1D A;  3P9K A;  3W3C A;  2OD5 A;  5HS8 A;  2ETH A;  3E3V A;  1YRN B;  3A01 B;  1U8R A;  3LFU A;  3FBI B;  4BU2 A;  4MNU A;  2GQQ A;  2R7R A;  2P0W A;  1FBS A;  2E19 A;  4CYC A;  2GIZ A;  4D5C A;  1RPW A;  3SFZ A;  1VQL I;  1OR7 A;  2EZL A;  4XN3 A;  3S17 J;  1O3S A;  6PAX A;  3H3Z A;  3LOC A;  2VJJ A;  2DA6 A;  3FHN A;  4BL0 B;  2PFB A;  4XKC A;  1IAW A;  5BQT A;  3ONQ A;  1N75 A;  4AUX A;  3C18 A;  4PJJ A;  3OYK A;  3I58 A;  2CGP A;  2XF5 A;  1A31 A;  2DMN A;  2LYC A;  3PNY A;  4D0P A;  4IRH A;  4BJT A;  3K2Z A;  4X1E A;  2DMP A;  2ECB A;  4L5E A;  1I1S A;  3W2V A;  5HNF A;  1H0M A;  1QZY A;  4F93 B;  1MND A;  1UCR A;  2QKM B;  4OAZ A;  2OF7 A;  4G12 A;  5GPA A;  1O3T A;  3LSI A;  1TQP A;  1FTZ A;  4P5O A;  1FWZ A;  5FD6 A;  3B73 A;  2AO9 A;  2ZJR F;  1LDK B;  3IAS 2;  4QLC U;  1BR4 A;  1Y8Q B;  1CF7 A;  5K7H A;  5K5Q A;  1IN5 A;  1J0R A;  2M2E A;  3TP3 A;  3BCA A;  4BNC A;  2L7Z A;  2STW A;  1R5G A;  5CVR A;  2F48 A;  3U21 A;  5K5R A;  1MDM A;  1IO2 A;  1DP7 P;  1O57 A;  1J75 A;  5D5V B;  4AU7 A;  5KVR A;  2QLZ A;  4LLG F;  5ICG A;  4KNY A;  3MEX A;  3KP7 A;  3I4P A;  5FO5 A;  3E6C C;  3KLO A;  2ESH A;  2XKO A;  5FRO A;  5DCM B;  1JTY A;  4AYB N;  4ZC3 A;  3LST A;  2DMT A;  2VQG A;  1FSE A;  2P5L C;  2IBD A;  3FXL A;  3VYR B;  1RKW A;  3M1E A;  5JLX A;  4V19 K;  1K79 A;  2F5D A;  2M3A A;  2AHQ A;  5KAI C;  2EH3 A;  3WOD F;  3F9K A;  5C4X J;  2MC4 A;  3FMR A;  3R60 A;  5ILV A;  3WTZ A;  2VKH A;  3CES A;  4I09 A;  1WJE A;  2MH2 A;  3GF2 A;  1IXR C;  4BY7 J;  5E8G A;  5B5E C;  4RB2 C;  1W0T A;  4FE7 A;  3HRT A;  5CKT A;  4HPQ A;  4L5J A;  2HQA A;  4B43 A;  1ZR2 A;  2E1M C;  3QU6 A;  3HSE A;  3LSR A;  2R7Q A;  3V7R A;  2A5Y B;  5KAF C;  4HV5 A;  1JUP A;  3DBH B;  3RTR A;  5ICF A;  2TRT A;  1TT0 A;  2V6C A;  1USS A;  1WI3 A;  3JRA A;  4KMU X;  3J80 Z;  2Q1Z B;  2CW8 A;  1XSD A;  4IL6 C;  1KU2 A;  5IPA A;  4UUT A;  3SDG A;  2DFE A;  2HDC A;  2ZME C;  3V8L A;  2COB A;  2VQH A;  1ULY A;  2E1C A;  4R1H A;  3A0H C;  3BWG A;  3QPH A;  4C2T A;  3LA2 A;  1EA3 A;  4Y52 J;  1BI3 A;  1MJ9 A;  1HF0 A;  5F0F A;  5D5U B;  5J6X A;  4F7Z A;  2RNJ A;  4XMY A;  2F2E A;  4U7D A;  2EIK H;  4GCV A;  3WTX C;  3MFK A;  2NS8 A;  4HAM A;  2VJ5 A;  2WBM A;  1Y39 A;  2GIV A;  3BR3 A;  3ZMD A;  2LY9 A;  2ZC2 A;  1U5T B;  4N4N B;  1YIO A;  2EZK A;  3DPL C;  3J81 Z;  3IRQ A;  2ZO4 A;  4DOZ A;  3OS1 A;  1MJA A;  2Y9Y A;  1W0U A;  4I6Z A;  3PIO F;  2K4J A;  3KEY A;  3PM1 A;  1IN8 A;  1C0W A;  1LUJ B;  2JUC A;  4XIC A;  1P9Q C;  3TBI A;  1LB2 A;  3CC7 I;  1LE8 B;  2K9L A;  2AXT C;  2JZY A;  3HPH A;  1YW7 A;  1XG1 A;  3ZXS A;  4P9F A;  3ZOB A;  3C3W A;  2K02 A;  1JKR C;  1P92 A;  3AKZ A;  9ANT A;  4PSX A;  5J8F A;  2X4H A;  4NBQ A;  3W2A A;  1UHM A;  4IRI A;  4ZZD A;  3P9C A;  2VBW A;  1R7J A;  3LQR A;  2ME6 A;  2HPM A;  4BE2 A;  5K5O A;  3CUQ C;  4RB3 C;  3FM5 A;  4B1R A;  1KON A;  1R00 A;  2R7F A;  3KPH A;  2JN6 A;  3PL8 A;  2V1U A;  3Q0V A;  4PFP A;  5F04 A;  2JUG A;  3HYI A;  2KIU A;  4KIS A;  3OR2 C;  1FX7 A;  5J3L A;  1Y8R B;  4OMZ A;  1X19 A;  4GYI A;  2DW4 A;  4IXA A;  3IP4 B;  5KK1 A;  3D5L A;  3CJT B;  4G8X A;  2DJI A;  3BPV A;  4OWR B;  2K40 A;  2CFO A;  2FU4 A;  1QPI A;  2O6G E;  2QUF A;  3O2P E;  4IHX A;  3L2V A;  1T98 A;  1GDT A;  2DAO A;  3KP6 A;  1LVK A;  3J80 K;  2YS9 A;  4WK8 F;  1WVR A;  1YE9 A;  2JA7 J;  2CG4 A;  3OYH A;  4UV8 A;  1OYW A;  3ELK A;  4A0Y A;  3HL2 A;  1G8X A;  2GM4 A;  2QQ9 A;  3R61 A;  4Z6Y A;  4A5M A;  3MQ0 A;  2BY1 A;  3RKW A;  1VQ4 I;  2DOE A;  4UB8 C;  3QPL A;  3L00 A;  4DYC A;  3KP5 A;  1X4O A;  2CQX A;  5CVI A;  3CCQ I;  1TWH J;  4KFC A;  3CO6 C;  2GOX B;  2LFB A;  1Z7L A;  3H35 A;  1EJ9 A;  5GTI C;  2MLK A;  4CZC A;  2P8T A;  2IRF G;  2BVM A;  1JJ8 C;  2R92 J;  1FIP A;  3ABT A;  3VSL A;  4ANJ A;  1YG2 A;  4MFE A;  4C2M J;  4B47 A;  5JFR A;  4N9I A;  2V1X A;  3VYS B;  3Q9V A;  5EZG A;  2EV6 A;  1TP4 A;  2DCE A;  2JWT A;  4RM2 A;  3JRD A;  3EUH C;  2KQR A;  3IKT A;  2JRT A;  1I1G A;  3V4G A;  1LE8 A;  3AL0 C;  2J5P A;  3F8C A;  4BQA A;  2E36 A;  2JPC A;  1VFC A;  4LJZ F;  2HZD A;  2DLL A;  4U0W A;  2Y30 A;  3BZC A;  4RLQ A;  1BA5 A;  2WAQ A;  1PP8 F;  2D5V A;  5HLG A;  4XL9 A;  1TTY A;  1ON1 A;  2Y0S N;  4LGW A;  2G0E A;  1PUF B;  2DA4 A;  3DV8 A;  2A61 A;  3GTG J;  5E1X A;  4FTH A;  1E0E A;  1FEX A;  1IDZ A;  4OIR F;  2XIG A;  3MZY A;  2OTL I;  1TL8 A;  1QHH D;  3BG3 A;  2K3P A;  1XDS A;  3HRM A;  4XRS G;  2A6H F;  2E5N A;  1NG7 A;  5H6Q A;  3OL3 A;  1TWF J;  4RAG A;  4RDU A;  3CLO A;  1MNM C;  2QSF X;  1ERD A;  4MO7 A;  1W5T A;  5C4J J;  4E7I A;  1DP3 A;  3CDH A;  3WU2 C;  2O61 A;  5H2F C;  2IW5 A;  4G6T B;  2CQK A;  4B48 A;  2GZW A;  3T5X A;  5CVV A;  4I0A A;  5M3M J;  1WKM A;  1GLN A;  2Y48 A;  3HSF A;  4M3G A;  4XOR A;  1Y1W J;  3I5U A;  3DBL B;  4CYD A;  4M3B A;  5GAE J;  1SVM A;  3A02 A;  1MBF A;  4KIB A;  3V42 A;  2PJR B;  4HST A;  2XUB A;  4Q47 A;  4KA4 A;  1ONV A;  2ELH A;  5CQE A;  3RKY A;  2KPM A;  1XN7 A;  2CW7 A;  5D8K B;  2L7M P;  3FHZ A;  2KL4 A;  3RYP A;  3I71 A;  5M5W J;  2JPB A;  4GYG A;  4EGZ A;  3K4C A;  3KFW X;  3M7G A;  3JRH A;  4L5I A;  2DJN A;  3L9F A;  2RN7 A;  1D1C A;  1YX3 A;  2MC3 A;  4PGH A;  5DM7 F;  3A03 A;  2MBF A;  3BDD A;  5EJC A;  4IJA A;  3I56 I;  1ETX A;  4GRI A;  1IXC A;  1DPU A;  1UMQ A;  4RS8 A;  1X2N A;  3RYR A;  1KZH A;  1P7J A;  3QPT A;  3EPZ A;  3TOA A;  4BAC A;  1R1U A;  3SZT A;  3HIF A;  4YIF A;  2QVO A;  2JTV A;  1XCV A;  3CJN A;  1I6H J;  1U0J A;  2XDV A;  1HW5 A;  3I53 A;  4QPQ A;  2EIM H;  1IRX A;  2X6O A;  4IVN A;  3QYE A;  4LG0 B;  3CO7 C;  1LQ1 A;  5IOY A;  1IGN A;  5DYM A;  2WY8 Q;  1RR8 C;  2CJJ A;  3HOU J;  4LIU A;  4E70 A;  4EQQ A;  1FOK A;  1DQU A;  4UV9 A;  4O5V A;  2NVX J;  3M07 A;  2W85 A;  2JA6 J;  2BOL A;  1B6A A;  3HOS A;  5DV5 A;  3ZMU A;  1VI0 A;  4FET A;  3SFI A;  3ZQG A;  4V2F A;  2GXB A;  1D0Z A;  4FT8 A;  3FXR A;  3WTT C;  2HOT A;  3E97 A;  3H1C A;  4OU0 A;  4IO9 F;  2PEX A;  5ILS A;  5E3O A;  2DFI A;  4PDK A;  1QPM A;  2ID3 A;  1W7P B;  2BYV E;  4J19 A;  3ERM A;  5F6F A;  2M4K A;  4BE1 A;  2O8K A;  5IY5 H;  5FJ8 J;  2PJR A;  4E7K A;  2W24 A;  3LQQ A;  4ZYE A;  2EV5 A;  4EGY A;  2DOD A;  1JI8 A;  1TNT A;  2BEO A;  2JMW A;  1POG A;  4NQW B;  1XSX A;  3WG7 H;  2E1M B;  4II2 A;  3WGG A;  2D1H A;  1WRJ A;  3B6C A;  4A3J J;  4C30 A;  4E7S A;  4J00 A;  3LAJ A;  1D8K A;  3LWF A;  3QQA A;  5F0C A;  3UNG C;  3JRF A;  4L9V A;  1Z6T A;  3K9T A;  3D1N I;  3OMY A;  2F5C A;  3KP3 A;  1A6I A;  2Q0O A;  3LA7 A;  4G94 A;  5DD8 A;  4EJT A;  2VXZ A;  2XGX A;  3QAH A;  3WU1 B;  3ASO H;  2H27 A;  4RAZ A;  2HOS A;  2ZJQ F;  2CO5 A;  1UST A;  2W1O A;  3GFJ A;  1R49 A;  3LNQ A;  2VLA A;  2VQC A;  3ROU A;  3Q3S A;  5BPI A;  5JLW A;  1HDD C;  1L3L A;  5F1J A;  1J59 A;  2B63 J;  2EIN H;  3HG9 A;  2PMZ A;  1EH8 A;  4AD9 A;  3JSO A;  3QU3 A;  2DPD A;  3OIO A;  1I50 J;  2LSO A;  3E0J B;  1P4W A;  4LLL A;  2EB7 A;  1AA7 A;  3FKI J;  3MKY B;  4IPA A;  3TKY A;  4RGR A;  4LOC A;  2CU7 A;  2AXL A;  2CQQ A;  1MBK A;  4LG0 A;  3CP8 A;  2V26 A;  3L2Q A;  1LFB A;  5H6R A;  3F8F A;  4I01 A;  2YX7 A;  4HF1 A;  3EYI A;  2R7V A;  2E60 A;  3G71 I;  3LMM A;  4X6A J;  3GFL A;  2VI6 A;  5DEQ A;  1ZG3 A;  3H36 A;  4RM3 A;  2XVC A;  2CFX A;  4HRI A;  2LBF B;  2D2W A;  1HBX G;  3PFY A;  2ZJ2 A;  4MHG A;  1FMW A;  4CCM A;  2DN0 A;  2E35 A;  2FBK A;  4HQE A;  3W6V A;  3DCF A;  1SD7 A;  1B59 A;  3KEQ A;  4A5N A;  1U78 A;  1MIJ A;  1R58 A;  3OOU A;  1LFU P;  3FXK A;  3GLL A;  5CVJ A;  3RPU A;  2OQG A;  1D5Y A;  2NVQ J;  4ITV A;  3MAJ A;  1W7P A;  2CUZ A;  3PQK A;  2HFH A;  1BJZ A;  2CMP A;  2M7B A;  1JTX A;  5M5Y J;  3CUQ B;  1HQC A;  3TP0 A;  3ZQQ A;  1FNN A;  4NQW A;  1FBQ A;  5D4S A;  3HEF A;  3HOX J;  5D5W B;  4NDL A;  3V8K A;  2KZG A;  4BBS J;  3FMS A;  2V1D A;  3JAM Z;  3H5A A;  2PJP A;  2BV6 A;  5DM6 F;  3K1N A;  1EV7 A;  4LK1 F;  3GTO J;  1WQ2 A;  2QEX I;  5IYC J;  4A69 C;  3Q0U A;  2R0Q C;  2Z3Y A;  3MCZ A;  2IEK A;  3E5U A;  4YFK F;  2XAF A;  2ID6 A;  2XPU A;  3K69 A;  2DMQ A;  2X1D A;  3O3K A;  2HVR A;  2NOJ B;  1S7A A;  3CQZ J;  1JJ6 C;  3CMM A;  2DDA A;  3KE2 A;  3J7A O;  1WWX A;  3HXL A;  2XAJ A;  3CJR B;  3OIP A;  5AIP A;  1IN7 A;  2HYF A;  3I9V 2;  3VPR A;  1F43 A;  1JHF A;  1X3W B;  2WAE A;  2XAS A;  3HRS A;  3I54 A;  1XD7 A;  4BE0 A;  3L2C A;  1KYZ A;  4CYC B;  3ABM H;  4NC6 A;  4JOM A;  1I3Q J;  3PUF A;  1TQM A;  1MBE A;  1YJ9 I;  2CWE A;  2RGV A;  4BHP A;  4GGG A;  2J5O A;  3VYU B;  2VC0 A;  1G6N A;  5E3L A;  4A3K J;  2CW0 F;  2CUF A;  1XTA A;  2FA5 A;  1QBJ A;  5A2Q Z;  4U7B A;  4Q4Z F;  1SAX A;  4XNF A;  1QQI A;  1YHQ I;  1KYW A;  2LBF A;  5EDN A;  4YII A;  4YFX F;  2DDB A;  1UHS A;  2K9Q A;  3AL0 B;  2EWN A;  4X0G A;  3GZ6 A;  3DKX A;  2LKS A;  1X1C A;  3IL2 A;  3GUD A;  4HQM A;  2KP6 A;  3SQN A;  2VBZ A;  1N77 A;  2X6Y A;  3MZH A;  3FIW A;  1P2F A;  3B6A A;  4I02 A;  3GTJ J;  1XSV A;  4E6K G;  3F6O A;  2RQQ A;  2H1L A;  1H89 C;  2VJ4 A;  4B3A A;  3H0G J;  1YFH A;  4MQV A;  1XMK A;  4XRM A;  3GME A;  4KT6 A;  3CUQ A;  3SZP A;  4WXC A;  1PJR A;  1WH7 A;  1CF7 B;  1G2H A;  1RR7 A;  1LPQ A;  1G59 A;  5B3S H;  3FIS A;  2FMY A;  2GOM A;  4LD5 A;  4RAF A;  3SHF A;  3HTS B;  3OYL A;  1H88 C;  2F6C A;  3JRC A;  5IP9 J;  4Y13 A;  3BZ6 A;  1IV6 A;  1EH7 A;  3JAM K;  3IV5 A;  2DYR H;  2CSO A;  3E6B A;  1ZLK A;  2A5W A;  1SFK A;  2GXA A;  3CJQ B;  1G3T A;  2NXN B;  4JYK A;  2QQA A;  2V9V A;  2ZXJ A;  1VZ0 A;  2XF6 A;  5HOD A;  3CCV I;  1UB9 A;  2A69 F;  1QRY A;  4BAY A;  5ED4 A;  3OWT A;  1V5E A;  3CP2 A;  3GZN B;  2X51 A;  1S7O A;  3PNT A;  4OOI A;  3Q5F A;  4BY1 J;  4HDV A;  2IGM A;  2GLO A;  2R7X A;  4PFO A;  1X3U A;  4P1W A;  1NH3 A;  2OCE A;  4GDF A;  3KZI C;  1ZLJ A;  4E7L A;  3LSM A;  3BT9 A;  2VN2 A;  1F4K A;  4HX8 A;  4BJ6 C;  4BHC A;  1ZQ3 P;  3HKZ N;  2LF8 A;  2M34 A;  5ILU A;  4ZDP A;  2KRH A;  2W57 A;  3EDP A;  1D5V A;  4KUM A;  4DZP A;  1QNT A;  3EUH A;  3O6B B;  5LHH A;  1S29 A;  4U87 A;  5LD2 C;  1XGM A;  2ACJ A;  3HHG A;  1T8I A;  3BG9 A;  4KT5 C;  2ZBK A;  1Z0X A;  5A2Q K;  3G1L A;  4HNT A;  2W7N A;  1HKT A;  1X58 A;  3ESW B;  5E17 F;  5IP7 J;  3BQZ A;  4AWX B;  3RCO A;  2VKD A;  4NC7 A;  5DUK A;  4G6Q A;  4ABZ A;  3KP4 A;  3G3Z A;  2L5Q A;  3ZQL A;  2JRM A;  1BIA A;  2ZJP F;  3CCE I;  5BOX A;  2VON A;  3OYB A;  2VKV A;  3BCB A;  4ZYA A;  1MJB A;  4DZJ A;  4PJL A;  2XRL A;  4F52 A;  4HNU A;  1D0Y A;  3DQV C;  3EUA A;  5E20 A;  4W97 A;  5HS7 A;  2K9M A;  1YIJ I;  3Q0W A;  3CME I;  1BC8 C;  2EFW A;  3JRI A;  5GAD J;  2K3F A;  1O3R A;  5M3F J;  3NAR A;  3CUO A;  2JVH A;  2KDZ A;  4I76 A;  4BUP A;  2MYS A;  2E1N A;  5E79 C;  3V7S A;  1S3J A;  2LY1 A;  4WWC A;  3QWL A;  2EZH A;  5EZH A;  3OYN A;  4P9U A;  2JVG A;  1MH4 A;  3S2W A;  2HZT A;  1SAN A;  2FBH A;  1B9M A;  4GFB A;  3GWZ A;  2IPQ X;  2A6E F;  1MSE C;  3LA3 A;  1OFC X;  2DPU A;  2HOA A;  2MD0 A;  1XDU A;  1MD0 A;  2L0K A;  2XAQ A;  2YU9 J;  3BRO A;  4LIV A;  2FE3 A;  2L7F P;  3RI4 A;  2LC2 A;  1NK2 P;  5EYR A;  5B1B H;  1IN4 A;  4MFD A;  2L9R A;  4M71 A;  3T8T A;  3ZMT A;  1A35 A;  2XGD A;  1J2X A;  3OS2 A;  1JT6 A;  2CYY A;  3K4L A;  3SYT A;  2QEN A;  4WXH A;  3I4M J;  2R93 J;  1LEB A;  3ZQ7 A;  4C3I J;  2WA0 A;  4BQO A;  5L3G A;  2HXI A;  1ZAO A;  2ZCW A;  2EA2 A;  4L0Z B;  3PFI A;  4AYB A;  2NOG A;  4XM3 A;  1K78 A;  3FK6 A;  3HOY J;  1SVO A;  5LHI A;  2LD5 A;  3WTY C;  2FSW A;  3TMO A;  2A68 F;  3RQI A;  2DK8 A;  5E8I A;  5E3N A;  3HJE A;  3S14 J;  2VUM J;  2LTP A;  3S1N J;  3RKQ A;  3WHB A;  1TZL A;  2LNB A;  4G6D A;  1U8B A;  1G3Y A;  4KN4 X;  1TBX A;  2IJL A;  4EJW A;  5IT3 A;  2BE5 F;  2V9K A;  4E7H A;  1VQM I;  1FOW A;  4BHB A;  4V2G A;  3K2A A;  3NAU A;  2YUS A;  3E5Q A;  3FK7 A;  3M4O J;  5FFX A;  4IHV A;  2HTS A;  1O7F A;  5E18 F;  1YW8 A;  1BL0 A;  3F8B A;  3E7L A;  4A0X A;  3SDB A;  2HWV A;  2R5Y B;  2HOE A;  2R7O A;  5CJ9 A;  2ISZ A;  3GTM J;  2UZK A;  1MMA A;  1FT9 A;  2MG4 A;  1DGR M;  3WTS C;  2ZFW A;  4ASN A;  3F23 A;  5LGU A;  2GXG A;  4A6D A;  2FQ3 A;  2H8W A;  3GYH X;  2H6C A;  3O8G A;  2LG4 A;  2RQP A;  4RMN A;  5D5X B;  3REO A;  5D6F A;  4GO1 A;  3RSN A;  4L9J A;  4CCL A;  2QSG X;  1V55 H;  1FPQ A;  1FMV A;  5BS6 A;  2BW3 B;  3ECO A;  1KQ9 A;  5K1Y A;  2NVU B;  2Z9O A;  2O0Y A;  3WTW C;  1YW9 A;  3PSF A;  4F92 B;  2FXA A;  1JE8 A;  4KJZ A;  2PN6 A;  4XLA A;  2L54 A;  3L7W A;  2YPR A;  1GXP A;  2VB6 A;  1S5L C;  1X1D A;  1KQ0 A;  3GX4 X;  2HVS A;  4G7H F;  2WB1 N;  1R5I D;  1UG0 A;  4ESJ A;  1A5J A;  4Y3O A;  2DA1 A;  2VOO A;  1A36 A;  1XGN A;  1PDN C;  2V7F A;  1YIT I;  1DU6 A;  2L3D A;  2EBI A;  2IS1 A;  2GAU A;  3M3Y J;  1Y0N A;  3BTI A;  1YTY A;  2DK5 A;  4UY8 I;  1IXS B;  2NNN A;  2QSH X;  3TED A;  1YI2 I;  1E3H A;  3J7Z I;  4M3F A;  1RRJ A;  2NNY A;  4A3E J;  2EFO A;  3E5X A;  1P7I A;  2IS6 A;  1LDD A;  3HRU A;  4HZF A;  1YO5 C;  4A3C J;  3MMY B;  3OYE A;  2O7O A;  1QO0 D;  1W5C C;  3K4J A;  2A6T A;  5CQG A;  2K27 A;  3AG3 H;  2R5Z B;  4LMY A;  3EYY A;  2R5Y A;  4JX5 A;  2X1C A;  3H3U A;  4KYW A;  2CRG A;  1JKQ C;  1F9N A;  4Y15 A;  4R8H A;  4HSR A;  1R36 A;  2DOA A;  1SFX A;  1WJA A;  3TGN A;  1PYV A;  1T6S A;  3K4M A;  3ZR8 X;  3CCL I;  1T08 B;  1MMS A;  5EGO B;  1ETQ A;  2P7V B;  1KA8 A;  3LL7 A;  3BR6 A;  1TC3 C;  3F6V A;  4Y33 A;  1AWC A;  4PCQ A;  3J81 K;  4H4K C;  2X6X A;  2R7T A;  2BW3 A;  2RAE A;  3OSF A;  2N8G A;  3QOP A;  5HLH A;  1FIA A;  2IA0 A;  1HW2 A;  2YU3 A;  2LMD A;  4OMY A;  3HGY A;  5C3E J;  2FOW A;  1TNS A;  3DFG A;  2XRO A;  5F27 A;  1UFM A;  3T8R A;  3TOB A;  1VQ8 I;  3QOD A;  4I99 C;  4B4C A;  1IRG A;  1TQI A;  1MZB A;  3ISP A;  2OBP A;  4L18 B;  3OY9 A;  2KRC A;  3RKX A;  1DUX C;  2LKX A;  1RUN A;  4BH9 A;  1Z67 A;  2HPI A;  1B72 B;  1E3O C;  4ZTF A;  2I10 A;  1WZ2 A;  5LEJ A;  1O3Q A;  2HKX A;  3VOE A;  5JHF A;  1DPR A;  1LNW A;  2BGC A;  1Z3Y A;  5L3E A;  2LDU A;  2K85 A;  2IT0 A;  2DYS H;  4IHS A;  2Y0S A;  1BOA A;  4IQJ A;  1STZ A;  3K10 A;  4A3B J;  2R5Z A;  3MVP A;  3JRB A;  5HS9 A;  1VQ6 I;  3DPU A;  3FXU A;  2KDO A;  1WJC A;  5LEK A;  4IRG A;  1XC5 A;  3OS0 A;  3L2W A;  1ON2 A;  2XAH A;  2QBY B;  3L1P A;  4M6X A;  3SJM A;  2NYX A;  3HBL A;  3TQN A;  2IS4 A;  4XKV A;  1QGP A;  5IYB J;  2L9S A;  1W4M A;  4QTR A;  3GW2 A;  5LFA A;  2LR8 A;  1PP7 U;  5EGO A;  3GTK J;  5CVU A;  4U0Y A;  2KIQ A;  2OQR A;  4Z2Y A;  3HB9 A;  3S3M A;  3H9J A;  4CCN A;  3QRF F;  1Q1H A;  2EIJ H;  1ZR4 A;  3FZV A;  1ETY A;  4HX4 A;  2WC2 A;  4Q5S F;  4MGR A;  3TDZ C;  3NWS A;  1SMY F;  1ZRF A;  3N05 A;  3S93 A;  3COA C;  4N4O B;  5GTH C;  1Z21 A;  5GP9 A;  1X2M A;  2KT0 A;  4QWQ A;  4EJO A;  3I0T A;  4MTD A;  3J7Y J;  1KU7 A;  4ZJZ A;  2X85 A;  3UKG A;  1X1A A;  1Z3X A;  3ZMV A;  2FML A;  2KMU A;  1X1B A;  4OAY A;  4A0Z A;  2IGO A;  2P4W A;  1S6L A;  4DNC A;  2F4M B;  1MH3 A;  4FCY A;  1R1T A;  4DQ2 A;  1IG7 A;  4S04 A;  2GA1 A;  2FNP A;  2X0L A;  1B72 A;  2B9S A;  2IP2 A;  1W5S A;  3KP2 A;  1CGP A;  1SD5 A;  5D8L B;  3BJO A;  2CQ7 A;  3VFZ A;  4KN7 X;  4BXU A;  5DS9 A;  3C1D A;  4EM0 B;  3E6D A;  3ML6 A;  3OR1 C;  4YEJ A;  4XK4 A;  2EFQ A;  1MBH A;  1BI2 A;  1SD6 A;  1K61 A;  2G7U A;  2HI3 A;  1ETK A;  4ESB A;  3DTI A;  1YJN I;  2FRH A;  4MTE A;  2HYJ A;  4DBQ A;  3BPX A;  1K4S A;  1HA8 A;  3DEU A;  2O03 A;  4AVZ A;  3S3N A;  4XRF A;  5H20 A;  3VWB A;  4C3H J;  2KFD A;  2QBY A;  2XV4 S;  1VQP I;  1R4M B;  1H9G A;  3JW4 A;  2IAI A;  3JR9 A;  1HXD A;  1R22 A;  2ZSI B;  1RUO A;  2I5U A;  1K4T A;  1EF4 A;  3OYI A;  3CMY A;  4JQF A;  4UVB A;  3PIP F;  1N25 A;  1UEL B;  2PMU A;  2CV1 A;  1YS6 A;  2VPL A;  4XSX F;  1YQA A;  3E6M A;  1IRF A;  1JHH A;  4QPO A;  2RV8 A;  4YIR X;  5FD5 A;  3C2G A;  1UHW A;  3OYD A;  1HSJ A;  2W4S A;  1BR2 A;  3EQL F;  3KX2 A;  2XF7 A;  2OZU A;  2ZME B;  3JTH A;  3HTU A;  2M30 A;  4RB1 A;  1RIO H;  1QU3 A;  2V6E A;  1U2W A;  3FMQ A;  2PBI A;  2E71 A;  3I59 B;  4XSZ F;  1D1B A;  4A3D J;  1WCM J;  3H92 A;  1J7K A;  3HC7 A;  1ZRE A;  3K4B A;  1KU9 A;  2A3S A;  2K9N A;  1TWA J;  1BW6 A;  4FHT A;  4F3Q A;  3KEO A;  2KIS A;  2Y31 A;  2LKP A;  3GTP J;  3KZZ A;  3OOP A;  3ZRG A;  2AQE A;  2UUZ A;  1CQT A;  4EV0 A;  4O3M A;  3W6K B;  3BG6 A;  4RA2 A;  2H09 A;  4EVI A;  1JGG A;  3GFI A;  3PO2 J;  3CLQ A;  3DLA A;  4M74 A;  1BI0 A;  5KHD A;  4WXD A;  4IHT A;  2Q2E A;  4XON A;  3F72 A; 
#chains in the Genus database with same CATH homology
 2XC7 A;  3PNV A;  4N4N B;  3DPL C;  2IGM A;  4DOZ A;  4II3 A;  3OS1 A;  4PFO A;  2R7X A;  1LFP A;  4P1W A;  4LG3 A;  3KEY A;  4E7L A;  3LSM A;  2M4G A;  1P9Q C;  3TBI A;  4BJ6 C;  2K9L A;  3CZ6 A;  3HPH A;  3ZXS A;  4ZDP A;  2KRH A;  2VXD A;  4U87 A;  4E4H A;  5LD2 C;  3AKZ A;  4PSX A;  3W2A A;  2F4I A;  1W36 C;  4HNT A;  1D1A A;  2ELJ A;  2W7N A;  2HPM A;  4BE2 A;  2IGK A;  3QYF A;  3KYL A;  3RCO A;  3DTK A;  1BOB A;  1KON A;  2VKD A;  4NC7 A;  4D1Q A;  2L2O A;  2IXS A;  3PL8 A;  4PFP A;  4BXF A;  2JUG A;  2RNG A;  2L5Q A;  4KIS A;  3OR2 C;  4CUG A;  1QHG A;  1T0F C;  3OYB A;  3BCB A;  4ZYA A;  1X19 A;  4Y4R A;  4PJL A;  5KCM A;  4F52 A;  4HNU A;  3IP4 B;  1D0Y A;  3OYA A;  3D5L A;  3DQV C;  3EUA A;  2DJI A;  2K9M A;  3CF2 A;  4OWR B;  2CFO A;  2DT7 B;  4CSW A;  3HOT A;  3FDY A;  2CH0 A;  1WJD A;  2Q2E B;  3L2V A;  3BG7 A;  1Y6I A;  1LVK A;  2JVH A;  4BUP A;  1YE9 A;  2MYS A;  3OYH A;  3HL2 A;  1G8X A;  2LY1 A;  5HOO A;  3S8P A;  4RLF A;  3OYN A;  2JVG A;  5HVQ C;  3LSG A;  2VJI A;  3OYM A;  4IQ4 A;  1X4O A;  4MLO A;  3PJR A;  2GOX B;  2MD0 A;  1Z7L A;  2LH9 A;  3H35 A;  4J01 A;  4CZC A;  2BVM A;  3TL4 X;  4LIV A;  2LC2 A;  4YEL A;  4ANJ A;  3VSL A;  3K4K A;  3K4N A;  4B47 A;  1V5G A;  3VYS B;  4DGW B;  2XSJ C;  3AFH A;  3PUB A;  4XLE A;  3QOE A;  3OS2 A;  2WY7 Q;  2DCE A;  4RM2 A;  3EUH C;  2KQR A;  3K4L A;  3SYT A;  2LY2 A;  3FBN B;  3MKZ A;  3AL0 C;  3S32 A;  2WA0 A;  4BQO A;  2W82 A;  2HZD A;  4AYB A;  3J7A Y;  4XM3 A;  4C9Y A;  2R4G A;  4HEA 2;  2W00 A;  4YRV A;  5TGT A;  3TMO A;  4RLQ A;  2WAQ A;  3LSK A;  2IS2 A;  4CA0 A;  2OUM A;  4XL9 A;  3DWL E;  1TZL A;  1WJB A;  3HUG B;  1E0E A;  3BC8 A;  3W2W A;  2HVQ A;  2V9K A;  1QHH D;  2K3P A;  4E7H A;  3FKJ A;  1MW7 A;  2E5N A;  1NG7 A;  2HNH A;  3OL4 A;  1MMN A;  3OL3 A;  1DGW Y;  1T95 A;  5CPR B;  3OYJ A;  3GBG A;  3SDB A;  2R7O A;  1ERD A;  4E7I A;  2JA2 A;  1DP3 A;  2ZSH B;  1MMA A;  4G6T B;  4B48 A;  3A1Y A;  3DPT A;  1DGR M;  1GLN A;  1MMD A;  2Z2S B;  3VYT B;  1MNE A;  4XOR A;  4XLF A;  4IZZ A;  2R7W A;  2MAB A;  4E7Z A;  3LSH A;  2LG4 A;  4RMN A;  1ZEL A;  4BQN A;  3V42 A;  3K70 D;  2F5V A;  2OC6 A;  1X4P A;  2PJR B;  4HST A;  3RSN A;  4CCL A;  3E1S A;  1FMV A;  2BW3 B;  5CQE A;  4EAT A;  2JSP A;  2KPM A;  2CW7 A;  2KL4 A;  2VIX A;  1WJF A;  4BDY A;  3PSF A;  4F92 B;  2L7K A;  4KJZ A;  4XLA A;  3K4C A;  3S3O A;  2VB6 A;  5KNL A;  2CS3 A;  1OLT A;  1X1D A;  1D1C A;  1YX3 A;  2HVS A;  4XQF A;  1UG0 A;  3DTE A;  4Y3O A;  4BEH B;  2Z1D A;  4GRI A;  4NNJ A;  4XKW A;  4HG2 A;  2V7F A;  3M8J A;  2IS1 A;  3SZG A;  3EPZ A;  3HKZ A;  2X1E A;  4BAC A;  4E7J A;  4CCJ A;  2QKL B;  4PK4 A;  2WAD A;  2CV0 A;  1U0J A;  2XDV A;  4R79 A;  4QPQ A;  1IRX A;  2IS6 A;  1Y56 A;  3IUO A;  3QYE A;  4DJA A;  2WY8 Q;  3MMY B;  3OYE A;  4LIU A;  3K4J A;  2A6T A;  4XLC A;  5CQG A;  2VAS A;  1DQU A;  2ZXH A;  3HPG A;  4DBR A;  3L2R A;  3DKY A;  2BOL A;  4CH7 A;  2I8D A;  3HOS A;  2O5R A;  2FUG 2;  4HSR A;  4FET A;  4CCK A;  2DOA A;  3UR3 C;  3ZCO A;  3ZGK A;  1WJA A;  3OYF A;  1D0Z A;  1PYV A;  2HU9 A;  3K4M A;  4XN0 A;  3ZR8 X;  3H0D A;  4BS9 A;  1SAU A;  3VSK A;  4BQQ A;  2HDW A;  3LL7 A;  1WJ5 A;  4Y33 A;  4BE1 A;  2M4K A;  2LRE A;  3DEE A;  2PJR A;  4E7K A;  2UWM A;  4H4K C;  4ZDL A;  2X6X A;  2R7T A;  2KZV A;  1JI8 A;  4NQW B;  2BW3 A;  3OIQ A;  2E1M B;  4II2 A;  4BGD A;  2VQL A;  3OYG A;  3EUK L;  4C30 A;  4E7S A;  4J00 A;  3UNG C;  3DU5 A;  3OYC A;  3OMY A;  3QOD A;  3VDX A;  2ZFU A;  2XAU A;  2VXZ A;  2AQF A;  3SEZ A;  5HLT A;  2R7U A;  2W1O A;  3OY9 A;  2KRC A;  1V5F A;  2VLA A;  4FAS D;  2VQC A;  3G2B A;  4BEH A;  2R7S A;  4BDZ A;  1MMG A;  2LOO A;  1S9H A;  3RPU D;  3HG9 A;  2PMZ A;  2HPI A;  3K70 C;  4ZTF A;  2CUJ A;  3E0J B;  2BVL A;  3DU6 A;  2M0M A;  1AA7 A;  4PSW A;  3MKY B;  5JHF A;  2WAF A;  1K6Y A;  1Z3Y A;  3H9Q A;  1WFX A;  3D5S C;  3RQ4 A;  3CP8 A;  4IKF A;  5HNH A;  2Y0S A;  2V26 A;  3L2Q A;  4F91 B;  4IQJ A;  4ZTJ A;  3K10 A;  2R7V A;  2E60 A;  3LMM A;  3W3C A;  3DPU A;  2KDO A;  1WJC A;  3LFU A;  3FBI B;  4RM3 A;  3L2W A;  3OS0 A;  4BU2 A;  4HRI A;  2LBF B;  2R7R A;  3PFY A;  4KIT B;  1FMW A;  4CCM A;  2P0W A;  2IS4 A;  4XKV A;  2L9S A;  3OOU A;  5LFA A;  4XN3 A;  4PUS A;  3H5R A;  3S3M A;  4ITV A;  3H9J A;  4CCN A;  2CUZ A;  2VJJ A;  3FHN A;  4BL0 B;  3BLY A;  2CMP A;  2M7B A;  3PSI A;  4XKC A;  5FRN A;  3ZQQ A;  3ONQ A;  1N75 A;  4PJM A;  3NWS A;  4PJJ A;  3OYK A;  3MD2 A;  4LIT A;  2KHM A;  3N05 A;  3S93 A;  2XF5 A;  2LYC A;  3H5N A;  3PNY A;  3H5A A;  4N4O B;  4BJT A;  2CV2 A;  1Z21 A;  1UAA A;  3NWT A;  2L9N A;  3A2K A;  4B44 A;  4ZDO A;  1NG6 A;  4F55 A;  3I3L A;  3W2V A;  4ZJZ A;  5HNF A;  2X85 A;  1X1A A;  1Z3X A;  4F93 B;  1MND A;  2LRD A;  2QKM B;  2KMU A;  1X1B A;  2X6W A;  2X1D A;  4OAZ A;  4OAY A;  2IGO A;  2HVR A;  3LSI A;  2KLO A;  2NOJ B;  3C2H A;  4P5O A;  3CMM A;  2WB1 A;  1LDK B;  3IAS 2;  1BR4 A;  4B3X A;  3HXL A;  3D5R C;  3CJR B;  4XLH A;  3OIP A;  1W36 D;  3I9V 2;  3BCA A;  2WAE A;  3U21 A;  4BE0 A;  4AU7 A;  4YEJ A;  3OR1 C;  2K5C A;  4JOM A;  3DTI A;  5FRO A;  4XOT A;  3VYU B;  4ZC3 A;  3M1C A;  4DBQ A;  4XOP A;  1HA8 A;  2VQG A;  1D0X A;  4U7B A;  4AVZ A;  3VYR B;  4XNF A;  4CCO A;  3S3N A;  2M7A A;  4XR6 A;  3VWB A;  1OR7 C;  4DIQ A;  2LBF A;  2M3A A;  4PJN A;  3F9K A;  3QYB A;  3AL0 B;  2MC4 A;  2ZSI B;  4X0G A;  4BJ5 C;  2VKH A;  3CES A;  1BR1 A;  1WJE A;  2RRE A;  3DKX A;  1X1C A;  2KP6 A;  3OYI A;  5FRM A;  2V1N A;  2X6Y A;  1N77 A;  1N78 A;  4JQF A;  5CKT A;  4HPQ A;  2IGN A;  2HQA A;  4B43 A;  4E6K G;  2RQQ A;  1UEL B;  2E1M C;  2VJ4 A;  4XKB A;  2CV1 A;  3A4C A;  2VPL A;  3MKW B;  2R7Q A;  2ZXI A;  4C2U A;  1LKX A;  2MFZ A;  1YX5 A;  4KT6 A;  4NC8 A;  4QPO A;  3RTR A;  3SEQ A;  3C2G A;  2VL8 A;  1TT0 A;  1PJR A;  3OYD A;  2W4S A;  3KX2 A;  1BR2 A;  2XF7 A;  2Z16 A;  2DXI A;  1G59 A;  2Q1Z B;  2CW8 A;  1QU3 A;  2V6E A;  2GOM A;  3OYL A;  1D1B A;  1J09 A;  2F6C A;  3HC7 A;  2V4J C;  3K4B A;  2VQH A;  2OV7 A;  1R6R A;  2UV1 A;  3L2U A;  4F3Q A;  4C2T A;  2A5W A;  1SFK A;  2DT6 A;  1EA3 A;  3CJQ B;  4IX7 A;  3ZRG A;  3IAM 2;  3H9G A;  2AQE A;  2UUZ A;  4XMY A;  1VZ0 A;  3BG6 A;  2XF6 A;  4NUB A;  4D9J A;  2VJ5 A;  2WBM A;  2E5Z A;  3K6G A;  3DLA A;  3OWT A;  1V5E A;  3CP2 A;  5KHD A;  2X51 A;  2X1C A;  3PNT A;  4XON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...