3ZRGA

Crystal structure of rxlr effector pexrd2 from phytophthora infestans
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
GPALNTEKMKTMLKAGMTVDDYAAKLKLTDKIAAAANSARAMEKLGETLKMKKLLRYLNYVAEHTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEXRD2 FAMILY SECRETED RXLR EFFECTOR PEPTIDE, PUTATIVE
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora infestans
molecule tags Protein binding
total genus 24
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zrgA00
3ZRGA
chains in the Genus database with same CATH superfamily
5E3LA 1TL8A 3LSJA 3RI4A 3Q0UA 2OTLI 1LFUP 1A04A 1IUYA 4M71A 4U0YA 4J00A 2VKHA 1NHAA 3V8LA 4J19A 4AM3A 3WTSC 2L2OA 5J47A 3H5AA 1QBJA 2LY1A 3HGGA 4AC0A 5ILVA 2UXXA 5GADJ 2MD0A 1KYZA 4II3A 5KCMA 4M6XA 4OINF 1TW2A 4LIVA 3KYLA 3OYNA 5D6EA 3VSLA 2HDDA 4PJNA 1YX3A 1B9NA 1YS7A 4LG3A 1GVDA 4JX6A 2D2WA 4JBAA 2A68F 2ICWG 1YRNB 3GTOJ 3GMEA 2JA5J 1JUSA 2R7DA 3OSFA 2O5RA 5LRSA 3AG1H 3CCMI 1KA8A 4XQFA 1MNDA 4JX5A 4BY7J 3JAMZ 4HQMA 2PBIA 4RB2C 1B4AA 3FM3A 3I4MJ 1XCBA 1RPWA 1Y8RB 1WJAA 3GWZA 2FRHA 3CLQA 3PUBA 1F1ZA 3LNQA 3MKYB 2JPCA 2Z1DA 4I2OA 2IS6A 2DA2A 5KNLA 2LREA 4O5VA 4HLYA 3ELKA 3H3UA 1W4MA 4PGGA 2F5CA 4AU7A 4F92B 4RMNA 4IOCF 4HYEA 4QTRA 2YX7A 4RGUA 4HF2A 3ZR8X 3P5JA 1K6OA 1FOWA 2X6YA 2JVHA 2P7CB 3IH3A 2MA3A 4G8XA 1SVLA 1ZTRA 1C0WA 1IN8A 2RREA 3OIQA 1O4XA 1OCPA 2M8EA 4A6EA 3OIPA 3LQRA 3BDDA 4P5OA 4KJZA 2YPRA 4FE4A 4ZZLA 2CUFA 5K1YA 5DCFA 1FJLA 1IRFA 5ILUA 4BE0A 2BY1A 3DPTA 3COAC 5JHUA 4L9TA 1RUNA 1Z67A 4G94A 4NQWB 4RAYA 2DK8A 3C2GA 2NS0A 3MZ8A 2V9VA 2HNHA 1TP4A 1SAUA 1QVTA 2XPVA 5H6RA 2QLZA 5E79C 2G0EA 4A93J 2M7BA 2M0CA 4EM2A 2NNNA 1JGGA 5FO5A 5IYDJ 1V54H 1W7PA 1UJ8A 3N4MA 1MJAA 1R00A 2BY3A 4IXAA 2BGCA 1WGXA 3M7GA 4HQEA 1VQLI 2AQFA 3R0AA 1SANA 4PSWA 3GTQJ 2K9LA 3FXQA 2IJLA 4OMZA 2QCOA 1ETOA 4XICA 4BHCA 1Z05A 4XLHA 4A3DJ 1GDTA 4PK4A 3ISPA 3CUQA 1FY7A 4JX4A 2JSPA 1P7JA 3GLLA 2FBKA 3BQZA 2V1DA 3HSFA 4CCMA 4P55A 4DOZA 2P6SA 2MC4A 3EPZA 3KPHA 4IHWA 3EUKL 1EF4A 4XORA 5IYCJ 3EQLF 2L01A 2FMYA 2PX9A 4Y15A 5HNHA 4TV7A 2BEOA 4BQAA 1G3SA 2R7UA 3PM1A 1T2KA 2HI3A 1DP3A 3HSRA 2KRCA 4L5EA 1P4AA 2EZKA 1HDPA 4KT5C 4Z2YA 2DFEA 1HOMA 3LSHA 1AKHA 5H2FC 1X1DA 3WTXC 4L5IA 1HA8A 2CGPA 1A6IA 4ZDLA 2BHYA 4MQVA 4I0AA 3DBLB 5F6FA 5D5WB 1U8BA 2CMPA 3PO3J 2V7FA 4LMYA 2EFNA 3OR1C 5GAGJ 1A6QA 3J7AO 2EWNA 1BR1A 2FBHA 3IUOA 3VPRA 2MW8A 4GXOA 1F9NA 1A31A 2VBZA 1HKQA 1IXSB 2W57A 3OS1A 4KIGA 3JTGA 4IEJA 2LOOA 3H35A 1JTXA 1ETXA 1MSEC 4S04A 1Y1VJ 1U0JA 5DD8A 3GTGJ 1GXPA 2QYOA 4KA4A 3R60A 2BZTA 1LEBA 5B66C 3H9QA 2ESHA 2VBWA 2L4MA 5IT3A 2VODA 4G9YA 4YIFA 2HOSA 2HEOA 1I3QJ 5AONA 4RGXA 1WJDA 5EG0A 2VOPA 4BQQA 1LEAA 1XX5A 3HHHA 1TNTA 5J8CA 2ECCA 4IO9F 3ZQGA 2YX4A 3BG9A 1W5TA 3HM5A 1I1SA 3I53A 4R79A 2R7WA 3LSPA 2EZHA 1S7EA 1DU6A 1N25A 3DQVC 3MCZA 3WTUC 3LA3A 4ZYEA 2STWA 3ZPLA 4JYKA 2Z2SB 2IA2A 1OCTC 3ASNH 3I55I 3BG5A 2FX0A 3LSMA 2VIXA 3H0DA 3ZQFA 3D5LA 3JRIA 3WGGA 3GLXA 1E3HA 1OCOH 2K7LA 1YITI 5FLMJ 3MD2A 4OU0A 3CJQB 5C3EJ 1ZQ3P 3GTPJ 3S14J 1VQ5I 3BZCA 5F1JA 3RQIA 1FLIA 1KQ9A 2Y48A 3CF2A 4M74A 3G71I 5K7HA 1NTCA 5DEQA 4I76A 2G7HA 3CDLA 3KEOA 2DT7B 2RQPA 4C2UA 4BXXJ 1Y39A 4NC6A 4HOBA 4B09A 1LVAA 3QU6A 5FD5A 1Y56A 1F36A 2K02A 2CU7A 1BC8C 4KDPA 4A3BJ 2JWTA 3MVPA 1MZBA 2M45A 1T33A 3CP8A 1OPCA 4LK0F 3SXYA 2LDUA 4S05A 4M73A 2HWVA 1VQPI 2V79A 2MGQA 2RKHA 4F52A 3K6GA 3ZOBA 1Z6TA 2VB6A 4HV6A 4U0WA 3OYBA 4R1HA 3ONQA 3REOA 5E3OA 2HDCA 1VF9A 2Q0OA 1H9TA 2KRFA 1IRZA 2OZUA 4BEHB 1PJRA 5DD4A 2E2HJ 3H5NA 3CCVI 3CZ6A 3CCSI 3GBGA 1D1CA 4A3EJ 3BR2A 2BVLA 2CQKA 4AIJA 4XRSG 1RKWA 3IRRA 4RAGA 3S15J 4LLLA 2A3SA 4CH7A 2AQEA 1J59A 2O6GE 1ZKGA 3BZKA 3BTCA 2RDPA 1FP1D 2LNBA 2ZSHB 1FTZA 1SVMA 1ZLJA 2E35A 4FQGA 4BDYA 4KITB 4BGDA 4B1RA 2V6EA 1HSJA 3LWFA 1H8AC 2GLOA 2XF5A 2D1HA 5DYMA 1VI0A 1XMXA 3C3WA 2MBFA 4CCJA 5FJ8J 1RKTA 4L0ZB 2VLAA 3NARA 4MNUA 1R22A 3IWZA 2XASA 1X19A 2LR8A 2R7VA 2WY8Q 1OR7A 2PI0A 4BNCA 2QQAA 5HOOA 4BEHA 4A0XA 1I3AA 2LY9A 1QZYA 4CZZA 1LE8A 3DTEA 3HKZN 3BC8A 2DK5A 4LB6B 4E70A 2F4IA 4CYCB 4U0VA 2Z3YA 3OYLA 2QBYB 1W5CC 5J40A 3BTJA 2XPWA 2IA0A 2FE3A 5FROA 3LFKA 3F6OA 4P9FA 1VQKI 3SFZA 4YFKF 1YOVB 2VQGA 2DFIA 4WXCA 2ME6A 1ZLKA 5K7ZA 1K4SA 2X9DA 4FHTA 3G1MA 2NOJB 1R5GA 1WH7A 4DGWB 2P6TA 5EYRA 1APLC 3ZQ7A 1IN5A 4XK4A 4XN3A 1JJ6C 3DPLC 2Y2ZA 5L3BA 6PAXA 1CGPA 2GOXB 3ZMDA 2Z33A 1R23A 5FKLA 4ZYDA 4OAYA 1W0TA 5FLXK 4EGYA 4ZYAA 1MDMA 1WI9A 3IH4A 5GAEJ 3ERMA 2WADA 5D6FA 4W97A 2MG4A 3IKTA 2KIQA 4IRIA 2QKLB 1CF7B 2V1NA 2Q2EA 4DJAA 2R5ZB 2R5YB 1RZ4A 2VJ5A 4CICA 2WC2A 3JCUC 3JRBA 1KQ8A 4NBQA 3K2ZA 4B43A 4H0EA 4IKFA 1NG7A 2ZO4A 1FEXA 2ZB9A 2Y30A 5LEKA 4BE1A 1ZG3A 1U5TC 4EM1A 4BY1J 2ECBA 1MJ9A 3D0SA 3OL4A 1R5ID 3E6MA 5DM6F 3JRFA 2BY2A 3P7NA 1L0OC 4UB6C 1QHHD 2A61A 3AG3H 1SFKA 1YQAA 1PP8F 1D0YA 3OYIA 3A02A 1IDZA 3G73A 1UHSA 3OMYA 3NQOA 3EETA 1CF7A 4HA8A 2R5ZA 2R5YA 1EJ9A 3QYEA 2L9RA 3TBIA 3S8PA 5M5XJ 4XRSA 3IL2A 1T6SA 3LFUA 5ICEA 2ZMEA 2XGDA 4DBRA 3KIOA 5D5VB 3GTLJ 3H3ZA 2X48A 3Q5FA 4NB5A 1LB2A 2E71A 1BI0A 2KIUA 1GLNA 3G1LA 3I64A 4DW6A 1K78A 2CV2A 3VODA 1XD7A 1RNLA 1H9GA 2FD5A 1WH5A 2Y0SA 2LP0A 2OQGA 3QRFF 3HZJA 3I4NJ 2HDWA 4MHGA 3F8CA 2L7FP 2OC6A 3CMMA 2KZVA 2IT0A 1U3EM 3ZRGA 1YJ9I 5GP9A 4AIDA 5IOYA 2BYVE 3ZQIA 3F6VA 4B47A 5HDKA 2QSGX 4D7NA 3ABMH 1DUXC 1MH3A 3ZMSA 4DYRA 2GXGA 1OKRA 1DPUA 3K10A 4CHUA 3IRQA 1NK3P 5E3NA 1AU7A 4YFXF 2M3AA 2EILH 5B1AH 1HF0A 1IV6A 5GTHC 4A3FJ 2QVOA 4QIWN 2I5UA 2KMUA 2DYSH 3FXMA 4A6DA 1BM9A 1P9QC 3WGHA 4AVZA 4EMSA 2GXAA 2HOTA 2RNJA 1YHQI 5M3MJ 4CCKA 3MZYA 4PZJA 1I6HJ 4NDLA 1YI2I 2JT1A 1Z1DA 3DEWA 1ON1A 4WWCA 3PIOF 3WTTC 4DYCA 5F0CA 1VZ0A 2V26A 5L3DA 3TP3A 2CW7A 3CLOA 2OAZA 1MBFA 1A35A 3ZN1A 1P2FA 4OMYA 2VJJA 1SFOJ 4KYWA 2ZKZA 5J4VA 1E3PA 1SMTA 2BW3A 1W5SA 3DP7A 3C18A 4EEFG 1D8KA 3H5RA 1MGTA 4HLXA 3V42A 1R5HA 3Q9VA 1BC7C 2W85A 2B7EA 1DGWY 2L5QA 2M9HA 3HJEA 4JQFA 2EIKH 2HXIA 2PN6A 2YU9J 3LMMA 4AD9A 2VKEA 2XIGA 4PJJA 5LGUA 3MEXA 5IP7J 1KU3A 5J3LA 1REPC 3BG6A 3QODA 2KHMA 1ENHA 1R1UA 3B6AA 3F9KA 4BYYA 1TT5B 2TDXA 5AIQA 4FTHA 1HC8A 4Q4ZF 3W3CA 3OYHA 2EA2A 1FIAA 3QPTA 3MKZA 2RC4A 1FBQA 1SD5A 1RRJA 1R36A 2VT2A 4BS9A 1LNWA 3JRDA 4LLNA 4PGHA 3BR6A 4BJTA 4WK8F 3K4KA 2VC1A 2OV7A 2ID3A 5FFXA 2EBIA 1EH8A 1ONVA 3OYDA 1RESA 1XG1A 2KZGA 3FBIB 2PJRA 3FXOA 4I09A 2R0QC 2IS4A 3F8NA 3ZQHA 4LGWA 2P5KA 1E3OC 2LY2A 1R1VA 4D7MA 4GDFA 3OOUA 4LOCA 2RAEA 2Y75A 4OIQF 3S1MJ 2PMHA 3FHNA 3N05A 3NWTA 2V6CA 2ELHA 1YX5A 1BIBA 3UR3C 2HQ5A 2QSHX 1ZGAA 4UNOA 2KP6A 4A3JJ 1ON2A 1B9MA 3FXRA 3H0GJ 4IHSA 2FJ1A 2K4BA 3RZDJ 4AIHA 3BG7A 3SDBA 3CCQI 1POGA 1G3YA 2H8WA 3LSTA 4MIMA 1W36C 3MFKA 3A4CA 3HOSA 1VQMI 2YUSA 3OIOA 2A6TA 1XGNA 3CUOA 5HNFA 3OL3A 4FCYA 1HCRA 1WJEA 3K4LA 1BN5A 5EEHA 2IRFG 1TC3C 3VDXA 4Q47A 4BH9A 1USSA 1EH7A 1G8XA 3M3YJ 2VKVA 2XAHA 2OA4A 1CQTA 1N75A 2DBBA 1QGPA 3OY9A 2JRTA 2MYSA 5DTDA 2DYRH 5HLTA 2Y0MA 1JXSA 2VC0A 3K1PA 3ZQCA 2WAFA 4M3BA 3DEUA 4ZH4F 5HLHA 3S32A 2QQ9A 4XMYA 3OSGA 1PP7U 1VQ7I 2A6EF 5D4SA 4IRGA 4Y17A 5HS7A 4EJWA 1QHGA 1SFXA 4D5FA 1TLHB 1WJFA 1XN7A 5C44J 2XGXA 3PFIA 2B0LA 2KJCA 5KHDA 3OS2A 2LLKA 3HGYA 4L9NA 3Q9SA 4XL9A 3HSEA 3WU2C 1SD4A 4IOAF 1VQOI 1TWGJ 1MBEA 5BOXA 1YS6A 4A3KJ 1YW8A 1ETQA 2ZSIB 3CC7I 9ANTA 4C30A 4A0YA 1S7OA 2IP2A 2Z5UA 1OCCH 3BLYA 3ULQB 2Y9YA 2GAUA 3M8JA 4QPOA 2XSDC 2NS8A 3I56I 1U8RA 2PG4A 2IGMA 3SZPA 1WVRA 2DDBA 2KPMA 2VBYA 1YG2A 2DT5A 3EUHC 4P1WA 4HDUA 4B48A 1D0ZA 2V1XA 1XPXA 1E0EA 3ZMUA 3L00A 1FX7A 1R71A 2R7ZJ 1ZREA 2LVSA 3AKZA 2R7XA 3FZVA 2BVMA 4U87A 2E7WA 4I98B 2XAJA 1W7PB 3IAM2 4NHJA 5AIPA 1TWFJ 1UFMA 2DMUA 3PSFA 2DU9A 2NVUB 4U7BA 4UB8C 1XGSA 3JRCA 2HVSA 4G12A 3SQNA 3T5XA 1B72A 4EJUA 1X3WB 2CQ7A 3F0CA 4GO1A 4V2FA 3G1OA 4C3JJ 3AG2H 3OYGA 3T8TA 1LDDA 1T0FA 2DPUA 1IN4A 2EH3A 3CUQB 1A36A 2BY0A 4RB3C 5K5OA 1I39A 3A1YA 4BHPA 4QLCU 2GXBA 3S2WA 4XBFA 4CCNA 3H92A 3F22A 2RN7A 3OV8A 2FQ4A 1MIJA 3ZP5A 2KFDA 3WTVC 4AYBA 2L7MP 4BXFA 5DV5A 4K2EA 2EJRA 4C2MJ 3DF8A 2CQQA 4OIRF 4EJOA 2KIFA 5E8GA 3K70D 4HZFA 4ON0A 2QKMB 3E3VA 3O3KA 4OAZA 4BQOA 4WXHA 4YELA 1OYYA 3QYFA 2ZJQF 1WI3A 3M1CA 2ID6A 3KP3A 3VEPA 2JTVA 1AKHB 4UVBA 3SJMA 1FMWA 4I01A 3CMYA 2XC7A 2DA4A 3L2RA 3RKQA 4A0ZA 3FMSA 2OJED 3E97A 3PSIA 1MMAA 2O9LA 4X1EA 2RNGA 1BA5A 2DCEA 2LBFA 2K27A 4MTEA 2DW4A 2PMZA 2X6WA 3L7WA 1XGMA 1TWCJ 2AHQA 2H6BA 3DTIA 4KIBA 4KN4X 4Y3OA 1W0UA 2W4SA 4DQ2A 3E5QA 4IHXA 3V8KA 5C4JJ 4OOIA 3BP8A 2Y9ZA 5IY5H 1JKPC 1VQ4I 2CUEA 4HF1A 4HX8A 3TDZC 4P96A 4F93B 2UZKA 2DMQA 4RLFA 2VBXA 2O8XA 2CQNA 3QYBA 1EH6A 2E1MB 2ZJRF 1GT0C 4NNJA 3CCLI 3HEFA 1B8IA 2A6HF 4RBOA 3CC4I 5CQEA 3GZ5A 3CF5F 2AXTC 1YIJI 5TGTA 2DTRA 2L02A 3GF2A 5EG0B 2E2IJ 3EYIA 2VE9A 2F5VA 1D0XA 2DOAA 3JTHA 3QOPA 1GHCA 2XAQA 3H9JA 2EIJH 3IH2A 4LB5A 3O6BB 3V4GA 1U9NA 3K9TA 1PUEE 2DJNA 2OTJI 1IXRC 3K4JA 3KZYA 4MFEA 2WB1A 4M3EA 2V9PA 3LA2A 3M8FA 3DU6A 2LSOA 2DMPA 3VSKA 4FE7A 2DAOA 2DJIA 5C4XJ 1ZR2A 5HLGA 4HRIA 4RAFA 1RUOA 1UHMA 1B59A 1XTAA 4UVCA 2QEXI 1V3FA 1BW5A 3J81Z 1I5ZA 2HXOA 1JT0A 5GAHJ 2Q8KA 2D5VA 3DPUA 1QU3A 1KQ0A 5E17F 3PIPF 1TW3A 2M4KA 3MN2A 3OOPA 5JHFA 4ENJA 1OR7C 1TWAJ 2ZJPF 2XGEA 2E34A 2IVMA 4KNYA 3I59A 1J75A 2XGCA 3V7SA 4YRVA 2DPDA 4EQQA 1FPQA 1MD0A 1XC5A 5LFAA 3X2QH 3Q0WA 2ISZA 2R3SA 4ZYGA 4FT8A 2EINH 3Q3SA 2AXLA 4PJMA 4XLCA 5ICCA 2G7UA 5GPCA 2STTA 5DM7F 1IGNA 1J2XA 2VXZA 3K1NA 2JVGA 2K5CA 2GA2A 2ADUA 3ESWB 2BHZA 3RSNA 5EGOA 3P9IA 3F3XA 3K4NA 1MBJA 2DN0A 2GZWA 3IC7A 3BPXA 4RGSA 3TL4X 4XONA 1SVOA 3W6JB 4BXUA 5FGMA 1XMKA 3UNGC 2IW5A 3TW6A 1K4TA 1KU2A 3H1CA 1JE8A 2IA1A 2QZ8A 4Y4RA 3BJ6A 4QWQA 2VPRA 1ZH5A 4L9JA 4YIIA 3VFZA 1Z9CA 5IP9J 4JOMA 2H27A 4E7JA 3IWFA 3KP5A 1UZCA 4XR6A 1F43A 3CO7C 2LRDA 1MNMC 2I8DA 2XF7A 3RJPA 3FHZA 1XS9A 3LQQA 1QZEA 1USTA 5IYBJ 3ABKH 2JZYA 5DUIA 3CJTB 1ZRDA 4O3MA 4MFDA 2LKXA 2K86A 1ZARA 1TQIA 1G4DA 1R58A 1LE8B 5LEJA 2W84A 2XAUA 5F64A 5F0FA 3GUDA 3D5RC 1X3UA 3FDYA 4EGZA 1SEUA 2CH0A 2JUCA 2Z9OA 2O8KA 2DOFA 2IGNA 2HQRA 1ORKA 5F0HA 3OYMA 2EB7A 4BU2A 2ZNYA 4EJTA 2IEKA 2E36A 2IXSA 3PUFA 4A3LJ 3EYYA 3FXJA 3BJAA 2DQLA 2AO9A 1XGOA 4ASNA 3SDGA 1FOXA 5E20A 4IHYA 3BR0A 1ETWA 3FXLA 2KQRA 4BHBA 1IJWC 4A5MA 3KEYA 2EA4A 4KUMA 1LDJA 3QPSA 2XDVA 4M72A 3BTIA 3PQJA 4I99C 1YJNI 3RPQA 3IAS2 3HOVJ 2NVTJ 2OD5A 3F21A 2K9NA 4KMUX 1G2HA 2DA7A 2EFQA 1MDMB 2NOGA 1HW2A 3RKWA 1TQPA 2F4MB 1XCVA 5DCMA 3WE2A 5BQTA 4E7LA 4PSXA 2LTPA 5BPIA 3GYHX 2XPUA 1ZELA 2RV8A 5K5QA 2Q2EB 2ZCWA 4ANJA 5LHHA 4M9XA 2JPBA 4UV9A 4FETA 3R0JA 5HDNA 1O3SA 3VWBA 4CGZA 1I1GA 2NS7A 1J0RA 1BL0A 1HW5A 3H3VK 3F23A 4CYDA 2DODA 2M2EA 1FNNA 3I4PA 4HNVA 1MMSA 1D1AA 1FBUA 1WHUA 4ESFA 4IHVA 3JR9A 3CMEI 4UHTA 5L3FA 1S9HA 2FOWA 2P7VB 1UG0A 4YEJA 4BJ6C 4BL0B 1R4NB 1STZA 2BBYA 3G3ZA 1AWCA 4QSHA 4IVNA 5K7FA 2RQQA 4XKCA 4N0BA 1OJLA 4XLAA 2LC2A 1BOBA 2E5ZA 1SD6A 1HLVA 2NVQJ 3LSGA 4CSWA 2OUMA 3LL7A 5ICFA 3ASOH 2W24A 4II2A 5JLXA 2X1CA 2FQ3A 3K7AJ 1GVJA 1J5YA 1I6XA 3L9FA 3ECHA 4M3GA 2K40A 1Y0NA 1JKQC 1V4RA 1ETYA 1T39A 1P6RA 5FFZA 3JREA 2WAQA 3O8HA 3I58A 3OYAA 4BAYA 3CC2I 2ZMEB 1OCRH 1X3ZB 5KAFC 2LD5A 1AA7A 3HRUA 1DGRM 2OBPA 2VKDA 2R4GA 2H8RA 1K78B 2GM4A 3S3OA 2FMLA 3P9CA 4OWRB 1D5YA 2W48A 4MEXF 4LLGF 4RM2A 2P8TA 3GEZA 1RIOH 3AL0B 1MBHA 2LKPA 3KEQA 2XAGA 2XSJC 3CMAI 5E8IA 4B3AA 2VQLA 4HNUA 2ZXWH 4UUSB 4FX0A 4QPQA 5IOZA 3PNYA 2W25A 1XSDA 2ZXJA 1UHWA 1NG6A 3S2HJ 1I50J 5B1BH 4RB0A 2ZFWA 2ZC2A 2DOEA 3HIFA 4E7SA 5HVQC 4EM0B 4DZJA 1WQ2A 4E7KA 3A0BC 5ERIA 2C6YA 4C2TA 1VTNC 2VPLA 3PNTA 1JTYA 1V5GA 3SZTA 2VQHA 3TOBA 2DFFA 3FXKA 1QRYA 1HBXG 4N9IA 1TTYA 1KU9A 1WWXA 2DFHA 4BBRJ 3HYIA 1IAWA 2L54A 1N77A 2R7TA 5LGNA 4LK1F 2V9KA 2ME0A 1H0MA 1DU0A 2PJPA 2R93J 3TW7A 2DO7A 4FASD 1B6AA 1TZLA 1W36D 3QP6A 3LOCA 3HUGA 3JAMK 1QVUA 2PEXA 1VQ6I 2VJIA 2KDZA 3TGNA 4D1QA 2TRTA 3I5UA 5JVTA 5HDGA 4UUSA 2R7SA 2PMUA 3G6EI 1V5EA 2BW3B 1ULYA 1LVKA 5EZGA 1TNSA 2FUG2 3NRVA 4GYIA 3BOQA 4RA2A 1O7LA 3B73A 4S0HB 2LMDA 2XAFA 2M34A 2RVCA 5J8FA 2WY7Q 3AG4H 1ZK8A 3BTLA 3MQ0A 1MH4A 2P5VA 4I0BA 4Z6YA 1YW9A 3HRMA 3FK7A 2K9QA 1FOKA 1T98A 2MLGA 1WKMA 3I3LA 5FKOA 2EFPA 1X2MA 1HDDC 3NAUA 3K0LA 1PVEA 3CTAA 4U88A 2QGUA 1JUPA 2QSFX 2M8GX 1XB4A 3FX3A 3FWEA 1Z21A 1U2WA 2LG4A 3W6VA 2DQRA 4MQ9F 5JFRA 2M7AA 1S5LC 3S3MA 5KVRA 2QF7A 1ZG1A 3K4MA 2Y0SN 4HSTA 3GTKJ 1V55H 1QQIA 3D5SC 2EV6A 4JP0A 2NXNB 3QQAA 3BR1A 2PJRB 3MKWB 1P4XA 1S7AA 4H4KC 2E2JJ 2H94A 1X2NA 2KISA 3HXLA 5IPAA 3KETA 3DV8A 3V8JA 2WBMA 4E7HA 1F5TA 2P81A 2O7OA 3LSRA 5EJCA 2F4OB 2FEZA 2UUZA 2H6CA 3OS0A 3W2VA 4G7HF 1MMDA 1LFBA 4XOTA 2XF6A 4M6VA 3E6CC 2GBYA 4Y33A 2E19A 5LBQA 4V19K 1U5TA 1UB9A 2Q1ZB 3FISA 3ZMVA 3RYPA 3L2VA 3J7YJ 1L3LA 1OISA 2DA3A 3CCUI 3L09A 3CESA 1G3TA 4LG0A 3ZQQA 4ESJA 1SMYF 4F7ZA 1UMQA 5K5RA 1O3TA 1K61A 2OCCH 3CO6C 1NK2P 3AAFA 4PCQA 3BPVA 2UWMA 1SFEA 2IPQX 2W82A 3HOZJ 1G3WA 4HF0A 4RM3A 2ZNZA 4XLPF 3LAPA 1QO0D 4DZPA 4P9UA 2X6OA 1KYWA 2VASA 2DA6A 5A2QK 3M4OJ 4ZDPA 3KE2A 2VUMJ 3DXJF 1JUMA 4BQNA 1ZRFA 1X1PA 3NWSA 1N78A 2R92J 2Z99A 4LD5A 3PO2J 1JHHA 2F2EA 2L0KA 3IKVA 3ZN0A 3PL8A 3PJRA 4KMFA 3MWMA 1RR7A 5JR3A 5J1RA 1R49A 2D45A 2GA1A 2M30A 3GZNB 1PYVA 2DMNA 3E5UA 5FLXZ 2H1KA 2EFOA 5B5EC 5L3CA 5B3SH 3CP2A 5KAIC 1T56A 2KLOA 3E0JB 1HKTA 2HKOA 5D8LB 1MMNA 1YJWI 3DBRB 2XROA 1ZAOA 5L3GA 4IF4A 4MO7A 2HVRA 3HBLA 2MD5A 1H89C 2K9MA 1X4OA 2KIMA 1RETA 3R61A 4IQ4A 4N4NB 4UV8A 4B8XA 4RGRA 2HS5A 5E3MA 2MH2A 3FKIJ 3V7CA 3WODF 2ZXIA 4DBQA 3L2QA 1HKSA 3O2PE 2HTJA 2H09A 3BG3A 1ZGJA 2XRLA 5LGTA 1Z77A 1ZR4A 1WRJA 3CUQC 1KU7A 3MMYB 3TO7A 3BCBA 3BR5A 5E1ZB 1AOYA 1PDNC 4B44A 4CO8A 1DP7P 4OIOF 2FU4A 5ILSA 2V4JC 1DPRA 2WWYA 1ITYA 2L3DA 3S17J 3JSOA 3FIWA 4FX4A 3BR3A 3CCJI 3MZHA 2JQ7A 1B72B 2HYGD 3HG9A 2KJBA 3RCOA 2KL4A 4O6JA 3F72A 1BI1A 4G6QA 2LH9A 1IO2A 3KZZA 1R9TJ 4DIQA 1JGSA 3N97A 3DU5A 2MLKA 3I54A 1Y6IA 2JSCA 1FIPA 1FTTA 3LAJA 5EZHA 3WE3A 4ZDOA 3VYRB 4X6AJ 2BXZA 1UCRA 2BE5F 3J80K 4OIPF 3W2AA 2MFZA 2EPFA 4FISA 3ML6A 4BACA 4U7DA 3HC7A 1YO5C 1S29A 4E7ZA 4ENNA 2HU9A 1WPKA 2W1OA 3B6CA 4YG2F 3SHFA 4IQJA 1E17A 3MKLA 4M3DA 1YLFA 2XB5A 4RB1A 3QP5A 4KIFA 3S1RJ 3J7AY 2FNPA 1IRGA 2DA1A 2ETHA 4ZZDA 2CG4A 3ZCOA 1S72I 2YS9A 4ZTJA 2AS5F 3ERED 1OCZH 3DKYA 1FYMA 3LSKA 3OYJA 4I7HA 1W1WE 2HQNA 2LBFB 2E1MC 4M6YA 5H6QA 2VXDA 2CV1A 1AHDP 4G7ZF 3W2WA 1GV2A 3CCRI 1YRNA 5D5UB 1IW7F 2HQAA 3IV5A 5EDNA 4KICA 4BUPA 1FWZA 5CVIA 4ETSA 1LQ1A 4ZYHA 1QA6A 1D1BA 1LFPA 2H1LA 2JK3A 3RPUA 3IP4B 1MJBA 4C9YA 4NC8A 1VQ9I 2OQRA 3VYSB 2HTSA 2VE8A 3F8FA 1ZN2A 1X1BA 1YTYA 1B8IB 4HG2A 2L9NA 4KT6A 3RIRA 4IX7A 3JRHA 3S16J 1ZRCA 2O0YA 3FBNB 3GX4X 3M9AA 3VYUB 4R8HA 3S1QJ 2DMTA 2FOKA 3D1NI 5H20A 3OYCA 3KP7A 4G6DA 2M87A 4Y7NJ 2NYXA 2HOEA 1BBYA 2ISYA 4C3IJ 2JA6J 2I10A 3U1KA 5CKTA 3FM5A 4AVPA 1GV5A 2X1EA 3J7ZI 5J6XA 3HOXJ 1YE9A 2EFWA 3Q0VA 2K4JA 3DLAA 2HPMA 2XV4S 1XSXA 1X4PA 2CS3A 4CUGA 3OYKA 2GWRA 2QM3A 3U1DA 1YYVA 5DUKA 4UUVA 4M3FA 3V7RA 3TEDA 4Q5SF 1WSUA 2W00A 2FBIA 4HX4A 1YFHA 4EVIA 2XKPA 4NQWA 2WV1A 1X1CA 1BI2A 1LDKB 2E1NA 4IJAA 4AYBN 1P4WA 1WZ2A 2DI3A 2DDAA 5BMZA 1X1AA 3M07A 2HZTA 3K2AA 1V5FA 2M4GA 1KONA 1Y0UA 2DXIA 1Q1VA 4PUSA 2O3FA 3CD6I 1JHFA 3CJNA 5F08A 4GCVA 4RDUA 4WXDA 2W7NA 4ENMA 5A2QZ 2CO5A 3I59B 3HHGA 4MEYF 3HOWJ 2FF4A 3WG9A 3H36A 1K7AA 1YIOA 2NVXJ 2HYFA 3EUHA 3BY6A 5F04A 5EEGA 1TWHJ 2F6CA 3F8MA 2QQBA 3U21A 2PMZN 3GFLA 2IGKA 2D1VA 5EF6A 2XUBA 3ECOA 3KFWX 1ETKA 4HEA2 5EGOB 2K3FA 3QPLA 1IV8A 5J1YA 5LRRA 3WU0A 4XLFA 1I27A 1K83J 3M1EA 2VN2A 2CYYA 4D9JA 1QPMA 2E5NA 5TJJA 2VT3A 1Z6RA 3F8BA 3KX2A 5FKMA 2B63J 2LF8A 3L2WA 1Z7LA 2DA5A 5ED4A 3ABLH 3BQYA 5DDGA 4XKBA 5DS9A 4RS8A 4A12A 4XIDA 1D8JA 2WAEA 4HDVA 1TBXA 2ACJA 2EV0A 1ZGWA 3GTJJ 3LA7A 2ZJ2A 2WB1N 2DLLA 1SC7A 3CCEI 5IT9K 2Y69H 3ABTA 2A07F 2P0WA 2E60A 2LK2A 1IDYA 2CSOA 1BR2A 2X51A 3WGIA 4XLEA 1E2XA 3EUAA 5CJ9A 3ROUA 3JW4A 2OU2A 5TRDA 1MW7A 2G9WA 3T0YA 4D0PA 4PFOA 1T8IA 4I02A 2CJJA 3J80Z 1R6RA 4KN7X 4UXNA 1BJAA 1VQ8I 3O8GA 3K70C 5IP6A 3BCAA 1YW7A 3C2HA 5FLVA 1ZHFA 1P7IA 1Z3XA 4L9VA 1XDUA 2E1CA 2PLYA 1U6GA 2X1DA 2XHKA 3S1NJ 2CRGA 2HVQA 2QWWA 3HPGA 5CVJA 3SYTA 3A01B 3UKGA 1IZ1A 3FK6A 1DDNA 2CFOA 2V1UA 1Y8QB 5FD6A 2CW8A 2JA8J 1O7FA 1MBGA 2L4AA 4HAMA 3L2CA 5HODA 1J9IA 3RZOJ 1WJBA 4ZJZA 4ENKA 1Y1WJ 5DCMB 2M0MA 4IPAA 3OWTA 1QZZA 3TQNA 1PUFB 4ZC3A 3OYFA 1JKRC 2BV6A 5D5XB 1T95A 3HKZA 1MKMA 2XB0X 1K79A 3JRGA 3KYCB 4A3CJ 2Z16A 2J5PA 4F55A 1M1EB 4GYGA 4W1UA 1HQCA 3HRSA 4CCOA 5FB2A 1BW6A 4PJ0C 2BXYA 3A0HC 3HTSB 2MABA 1MSFC 2FNAA 2L9VA 4EATA 2R7QA 3DWLE 5F27A 3SZGA 1Z3YA 4HPQA 2GQQA 4PFPA 3A01A 2ZMEC 1OYIA 3NEUA 3PFYA 2A5WA 4N4OB 5CPRB 4HBLA 5LHIA 1D5VA 3FF5A 3DKXA 4EV0A 4PDKA 4NC7A 3K69A 4LJZF 3WU1B 3AL0C 4MTDA 2KKOA 3IHUA 4HW0A 2A69F 1FC3A 1RC9A 4IZZA 1MNEA 4AWXB 2E7XA 4WCGA 2HR3A 1PUFA 2NVYJ 1IN6A 1TT0A 2CV0A 2JMWA 2NAZA 2Y31A 5HLIA 5D8KB 5BS6A 1QPIA 4UY8I 3HL2A 1GXQA 4GRIA 3VB2A 1VFCA 3QPHA 1X58A 3QAHA 1R4MB 3EDPA 3RDIA 2FA5A 5KK1A 4GGGA 3R6SA 1QNTA 1XDSA 2A5YB 2KT0A 3I71A 3QWLA 4CCLA 5BPDA 2COMA 3ABUA 3GXOA 3KLOA 3KP6A 3ZGKA 2F5EA 4A3GJ 3DKWA 3CDHA 5CQGA 4V2GA 2CWEA 1LKXA 2ELKA 1IC8A 3CJRB 3U2RA 4A5NA 1FSEA 3GW2A 5CVRA 4XRMA 2ESNA 2K85A 2DT6A 2P5LC 2KRHA 4WF2A 3GO5A 4A2UA 2L9SA 1WCMJ 1WJ5A 3A03A 3TO6A 4HV5A 2EZLA 2LKSA 4E7IA 1BIAA 4LFUA 1D3YA 2EK5A 1FT9A 3ZXSA 4X0GA 4IL6C 2X0LA 3GZ6A 2ELJA 4C3HJ 4DNCA 2FSWA 5JVGF 2EZIA 1BJZA 1FMVA 4XKVA 4UUTA 1IN7A 2ZBKA 3RTRA 4CZCA 2B9SA 1H88C 3HB9A 2NNYA 5BNGA 1A5JA 2JUGA 2P4WA 5E1XA 4JK1X 4L18B 1IRXA 2IGOA 4XSZF 1GUUA 3U9GA 2OF7A 3DEEA 2WA0A 4CYCA 3RKXA 3OYEA 4ITVA 1OQYA 4CXFA 2QBYA 5EEAA 2VI6A 3HTUA 4A3IJ 3BROA 2HOAA 3HUGB 4XLNF 3KLNA 4HNTA 4MLOA 1SD7A 3I9V2 2R7RA 3GFJA 2MC3A 2LFBA 1WJCA 3HRTA 2CUZA 3GFMA 5ICGA 5E18F 3GVAA 4LIUA 3TMOA 5LHGA 1Q1HA 3B02A 3LSIA 4L5JA 5LLQA 1NH3A 3KP4A 3SEZA 5D4RA 3E1SA 3FKJA 3WTWC 1XSVA 5FRNA 2CQXA 2N8GA 3AFHA 1FP2A 3WHBA 4XN0A 2GIZA 2HGCA 3RPUD 1LPQA 2VOOA 3MAJA 3PQKA 3GTMJ 4Y52J 2CW0F 2VQCA 3FMQA 3L1PA 3HPHA 4ESBA 2F48A 3SFIA 2X6XA 1Z91A 2WAQN 2VONA 3R4KA 5L3EA 2RGVA 4YFNF 5JI6A 2HKXA 2JA2A 1UG2A 3E5XA 3S2DJ 4G7OF 3ZQLA 4ABZA 4L0YB 2O61A 5IT9Z 1JT6A 1OFCX 3FXUA 5CVVA 4RAZA 4AUXA 4E4HA 4F91B 2M1BA 1KGSA 3E7LA 4XSXF 4XNFA 5LD2C 1RR8C 2HFHA 4Q48A 2X85A 1W7PD 3JRAA 5FRMA 3WTYC 2LYCA 3BWGA 2ZXHA 4IHTA 1G59A 4BE2A 2HPIA 2HZDA 3SEQA 2GOMA 1ERDA 3TDUC 3W6KB 2IBDA 4A3MJ 1R1TA 2L7ZA 4BJ5C 1MMGA 2ZFUA 2J5OA 3KZIC 2IS1A 2TCTA 1J7KA 3CQZJ 3BT9A 2GIVA 2VL8A 1P92A 1T38A 1IXCA 1O3RA 3VOEA 3I0TA 3S93A 3TKYA 2K9SA 2OCEA 1IUFA 4ZTFA 4B4CA 1U5TB 3G2BA 2O03A 1JKOC 2XRNA 3WG7H 1JJ8C 3PNVA 3L2UA 2EQRA 2FXAA 5JLWA 4LG0B 1G6NA 1FYLA 3VYTB 1VQNI 4Y13A 4D5CA 1EV7A 1FBSA 1SAXA 3FMRA 1S6LA 3QOEA 2A05A 5HS9A 4XM3A 4PJLA 1ODDA 5E1WA 4BBSJ 2CUJA 1RI7A 1JI8A 3RKYA 2F5DA 2XKOA 4I6ZA 2CFXA 2IS2A 4M9SA 1B1BA 4GFBA 3TO9A 3P9KA 2OZ6A 5J1UA 1HXDA 1OLTA 4J01A 4WX9A 2YU3A 3WHCA 4LITA 1BR4A 2QUFA 3OR2C 4E6KG 4CA0A 1KZHA 1Z7UA 1R7JA 1K6YA 1HW1A 4KISA 1XMAA 5GPAA 1DQUA 1F4KA 5GTIC 3ZMTA 3DTKA 4BKXA 1OYWA 2EV5A 3C7JA 3C1DA 3CCYA 3T1BA 3E6BA 3HOYJ 1SFUA 4XKWA 5M5WJ 3HDDA 4EJVA 2L7KA 3RYRA 2KDOA 2QA4I 2UV1A 2JJ7A 2JN6A 1ZG5A 2M5WA 3C2BA 1Z0XA 1ETVA 2UXNA 2VJ4A 3K4BA 5FKNA 2X4HA 2JRMA 4CDGA 2EIMH 3CDIA 3KYDB 2R7FA 1MBKA 5CVUA 3GFIA 1FSHA 4IRHA 2IAIA 1FYKA 1O57A 2YSRA 1T0FC 3TOAA 3TP0A 4YIRX 3GCMA 1EA3A 2WV0A 4HSRA 5F1RA 4XOPA 4N9HA 1UAAA 4A69C 4UVAA 1OMIA 1O3QA 1ACIA 3BZ6A 4DYQA 1UELB 2MH9A 1WFXA 2WTEA 2HYJA 2YR2A 1HSTA 2PQ8A 3RQ4A 3KCCA 3T8RA 2JA7J 2F5FA 2QQ8A 1ZYRF 3K4CA 3ZMZA 4RLQA 2OPTA 2NRAC 2E1OA 3WTZA 1IG7A 3DCFA 2K3PA 5TISC 5M3FJ 1LUJB 1EKEA 3G4SI 3KP2A 1VNDA 4AIKA 1BOAA 1IF1A 4BDZA 3DFGA 1S8NA 2PFBA 3DBHB 5M5YJ 3J81K 4KFCA 1TQMA 3HOUJ 5CYVA 3JSPA 2R7OA 4G6TB 3BJOA 3H9GA 4XRFA 4F3QA 3HOTA 3S3NA 2DTZA 3A2KA 2LF7A 5J4YA 1LJ9A 5CLSA 1T08B 4M9ZA 1S3JA 5HS8A 2QENA 4MGRA 4B3XA 3M8EA 3QU3A 1U78A 4HX7A 1FOYA 1J09A 2BOLA 3DLLF 5FKKA 2COBA 1BI3A 2XVCA 3K1MA 3E6DA 1FZPB 1U9OA 2MSYA 4NUBA
chains in the Genus database with same CATH topology
3KEYA 2XDVA 3IAS2 4J00A 2M3AA 2VKHA 2L2OA 3H5AA 2LY1A 2KMUA 1P9QC 2MD0A 4AVZA 4II3A 4E7LA 5KCMA 2F6CA 4PSXA 3U21A 1ZELA 4LIVA 3OYNA 3KYLA 2IGKA 3VSLA 4CCKA 2Q2EB 4ANJA 4PJNA 1YX3A 4LG3A 4HEA2 4FETA 3VWBA 1VZ0A 4XLFA 2V26A 2O5RA 2CW7A 1D1AA 4D9JA 4XQFA 1MNDA 2E5NA 3KX2A 1S9HA 2VJJA 1UG0A 1WJAA 3L2WA 4YEJA 1Z7LA 2BW3A 3PUBA 4BJ6C 4BL0B 3MKYB 2Z1DA 2IS6A 4XKBA 3H5RA 5KNLA 3V42A 2LREA 2RQQA 4XKCA 4XLAA 2LC2A 2L5QA 1DGWY 1BOBA 2E5ZA 4JQFA 4AU7A 4RMNA 3LSGA 4F92B 2WAEA 4CSWA 2OUMA 3LL7A 3LMMA 4II2A 2X1CA 4PJJA 3ZR8X 2X6YA 2JVHA 3BG6A 3QODA 2KHMA 2P0WA 3F9KA 2RREA 3OIQA 2WAQA 2E60A 3OIPA 3W3CA 3OYAA 1BR2A 4P5OA 3OYHA 4KJZA 2X51A 3MKZA 1AA7A 1DGRM 4BS9A 4BE0A 4XLEA 2VKDA 2R4GA 3DPTA 4BJTA 3S3OA 4OWRB 3EUAA 4RM2A 4NQWB 3AL0B 3K4KA 2OV7A 3C2GA 1MW7A 3OYDA 2HNHA 3FBIB 2PJRA 2XSJC 4PFOA 1SAUA 2IS4A 1R6RA 3K70C 3BCAA 2VQLA 3C2HA 2LY2A 4HNUA 2M7BA 1Z3XA 4QPQA 3OOUA 3PNYA 2X1DA 1NG6A 3FHNA 3N05A 3NWTA 3SYTA 2HVQA 3HPGA 2AQFA 1YX5A 4PSWA 2CFOA 3UR3C 2K9LA 4E7SA 5HVQC 2CW8A 2KP6A 4E7KA 4C2TA 2VPLA 3PNTA 1V5GA 1WJBA 4ZJZA 2VQHA 4XLHA 2M0MA 3BG7A 4PK4A 3SDBA 3OWTA 4ZC3A 3OYFA 1W36C 3HOSA 3A4CA 1T95A 2A6TA 1N77A 2JSPA 3HKZA 5HNFA 3OL3A 2R7TA 2V9KA 1WJEA 3K4LA 4FASD 2Z16A 4CCMA 4DOZA 1TZLA 4F55A 3EPZA 2MC4A 1W36D 4CCOA 3EUKL 2VJIA 4XORA 3VDXA 4D1QA 5HNHA 2MABA 1G8XA 2R7SA 4EATA 2R7QA 3DWLE 2R7UA 1N75A 1V5EA 3SZGA 3OY9A 2MYSA 1Z3YA 2BW3B 4HPQA 1LVKA 5HLTA 1DP3A 4PFPA 2KRCA 2FUG2 5CPRB 3PFYA 4N4OB 2A5WA 2WAFA 3S32A 4XMYA 3LSHA 3DKXA 1X1DA 2WY7Q 4NC7A 1HA8A 3AL0C 4ZDLA 1QHGA 1WJFA 2CMPA 3I3LA 2V7FA 3OR1C 4IZZA 1MNEA 1TT0A 5KHDA 3OS2A 2CV0A 1BR1A 3IUOA 4XL9A 3HL2A 4GRIA 2ZSIB 3OS1A 1Z21A 4C30A 2LOOA 4CCLA 3H35A 2LG4A 3ZGKA 3BLYA 2M7AA 5CQGA 3S3MA 3M8JA 4QPOA 1U0JA 1LKXA 3K4MA 4HSTA 2IGMA 3CJRB 2KPMA 3D5SC 3EUHC 4P1WA 4B48A 1D0ZA 2PJRB 2DT6A 3MKWB 1E0EA 3H9QA 2KRHA 4H4KC 2L9SA 3HXLA 1WJ5A 2WBMA 3AKZA 4E7HA 2R7XA 2BVMA 4U87A 4E7IA 1WJDA 3ZXSA 4X0GA 3IAM2 4BQQA 2ELJA 2UUZA 3PSFA 4U7BA 3OS0A 3W2VA 1FMVA 4XKVA 1MMDA 2HVSA 3RTRA 4XOTA 2XF6A 4R79A 4CZCA 2R7WA 4Y33A 2Q1ZB 3DQVC 3L2VA 2JUGA 2Z2SB 3CESA 1IRXA 2IGOA 3OYGA 3ZQQA 3DEEA 2WA0A 3OYEA 4ITVA 3LSMA 2VIXA 3A1YA 3H0DA 3D5LA 4CCNA 2UWMA 2W82A 3HUGB 3MD2A 4RM3A 4HNTA 4MLOA 3I9V2 2R7RA 3CJQB 4AYBA 1WJCA 2VASA 2CUZA 4BXFA 4LIUA 3TMOA 4ZDPA 3CF2A 3K70D 3LSIA 4BQNA 2QKMB 4BQOA 4OAZA 4YELA 2DT7B 3NWSA 3QYFA 3SEZA 4C2UA 1N78A 3E1SA 3FKJA 3M1CA 5FRNA 3AFHA 1FMWA 1Y56A 4XN0A 2XC7A 3PL8A 3PJRA 3L2RA 3RPUD 3CP8A 3PSIA 1MMAA 1PYVA 2VQCA 2RNGA 3HPHA 2DCEA 2LBFA 2X6XA 3CP2A 4F52A 3K6GA 3E0JB 2KLOA 2VB6A 1MMNA 3OYBA 2PMZA 2X6WA 2JA2A 3ONQA 4Y3OA 3DTIA 2W4SA 2HVRA 4BEHB 4E4HA 4F91B 1PJRA 2K9MA 1X4OA 4XNFA 5LD2C 4IQ4A 4N4NB 3H5NA 5FRMA 2X85A 3CZ6A 3GBGA 1D1CA 2LYCA 2ZXHA 2BVLA 1G59A 4BE2A 2ZXIA 2HPIA 4DBQA 3L2QA 2HZDA 4F93B 3SEQA 4RLFA 2GOMA 4CH7A 2AQEA 3QYBA 1ERDA 2E1MB 4NNJA 4BJ5C 2ZSHB 1MMGA 2ZFUA 3MMYB 5CQEA 2IS1A 3BCBA 4KITB 4BDYA 5TGTA 4BGDA 4B44A 2V6EA 2VL8A 2F5VA 1D0XA 2XF5A 2DOAA 2V4JC 3H9JA 3S93A 4CCJA 2VLAA 4ZTFA 3G2BA 3K4JA 1X19A 3HG9A 2WB1A 2R7VA 3RCOA 2WY8Q 2KL4A 3DU6A 3PNVA 5HOOA 3L2UA 4BEHA 2LH9A 3VSKA 4DIQA 3DTEA 3BC8A 2DJIA 3DU5A 2F4IA 1Y6IA 3OYLA 3VYTB 4HRIA 4ZDOA 3VYRB 3W2AA 2MFZA 5FROA 3QOEA 4BACA 3DPUA 4XM3A 3HC7A 1QU3A 4PJLA 2VQGA 4E7ZA 2HU9A 2CUJA 1JI8A 2M4KA 2W1OA 2IS2A 4IQJA 2NOJB 5JHFA 1OR7C 4DGWB 4J01A 1OLTA 3J7AY 4LITA 1BR4A 3OR2C 4E6KG 4XN3A 4CA0A 3DPLC 4YRVA 1K6YA 2GOXB 4KISA 3ZCOA 5LFAA 4ZTJA 4OAYA 1DQUA 4ZYAA 3DTKA 3DKYA 4PJMA 4XLCA 3LSKA 3OYJA 2WADA 2E1MC 2LBFB 2VXZA 2VXDA 2JVGA 2QKLB 2CV1A 2K5CA 4XKWA 2V1NA 4DJAA 2L7KA 2VJ5A 2KDOA 3W2WA 4B43A 3RSNA 4IKFA 1NG7A 2UV1A 3K4NA 2HQAA 4BUPA 4BE1A 1D1BA 1LFPA 2VJ4A 3K4BA 3TL4X 3IP4B 4XONA 3OL4A 4C9YA 4NC8A 3UNGC 3VYSB 4Y4RA 1T0FC 1X1BA 1EA3A 4HSRA 4HG2A 2L9NA 4XOPA 4KT6A 1UAAA 1QHHD 4IX7A 1SFKA 3FBNB 4JOMA 1UELB 3VYUB 1WFXA 4E7JA 4XR6A 3RQ4A 3OYCA 2LRDA 1D0YA 3OYIA 2I8DA 2XF7A 3OMYA 3K4CA 4RLQA 5CKTA 2X1EA 3QYEA 2K3PA 1YE9A 3TBIA 3S8PA 3LFUA 3DLAA 2HPMA 1X4PA 2CS3A 4CUGA 2XAUA 4BDZA 3OYKA 4DBRA 3D5RC 3FDYA 2CH0A 1GLNA 2CV2A 2W00A 2R7OA 2IGNA 4G6TB 3H9GA 1X1CA 3OYMA 1LDKB 2Y0SA 4BU2A 4F3QA 3HOTA 3S3NA 3A2KA 1X1AA 2HDWA 2OC6A 3CMMA 4B3XA 1V5FA 2IXSA 2KZVA 2M4GA 1KONA 2DXIA 4PUSA 3ZRGA 1J09A 4B47A 2BOLA 2KQRA 2W7NA 4NUBA 3K10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRG A; 
#chains in the Genus database with same CATH topology
 5E3L A;  1TL8 A;  3LSJ A;  3RI4 A;  3Q0U A;  2OTL I;  1LFU P;  1A04 A;  1IUY A;  4M71 A;  4U0Y A;  4J00 A;  2VKH A;  1NHA A;  3V8L A;  4J19 A;  4AM3 A;  3WTS C;  2L2O A;  5J47 A;  3H5A A;  1QBJ A;  2LY1 A;  3HGG A;  4AC0 A;  5ILV A;  2UXX A;  5GAD J;  2MD0 A;  1KYZ A;  4II3 A;  5KCM A;  4M6X A;  4OIN F;  1TW2 A;  4LIV A;  3KYL A;  3OYN A;  5D6E A;  3VSL A;  2HDD A;  4PJN A;  1YX3 A;  1B9N A;  1YS7 A;  4LG3 A;  1GVD A;  4JX6 A;  2D2W A;  4JBA A;  2A68 F;  2ICW G;  1YRN B;  3GTO J;  3GME A;  2JA5 J;  1JUS A;  2R7D A;  3OSF A;  2O5R A;  5LRS A;  3AG1 H;  3CCM I;  1KA8 A;  4XQF A;  1MND A;  4JX5 A;  4BY7 J;  3JAM Z;  4HQM A;  2PBI A;  4RB2 C;  1B4A A;  3FM3 A;  3I4M J;  1XCB A;  1RPW A;  1Y8R B;  1WJA A;  3GWZ A;  2FRH A;  3CLQ A;  3PUB A;  1F1Z A;  3LNQ A;  3MKY B;  2JPC A;  2Z1D A;  4I2O A;  2IS6 A;  2DA2 A;  5KNL A;  2LRE A;  4O5V A;  4HLY A;  3ELK A;  3H3U A;  1W4M A;  4PGG A;  2F5C A;  4AU7 A;  4F92 B;  4RMN A;  4IOC F;  4HYE A;  4QTR A;  2YX7 A;  4RGU A;  4HF2 A;  3ZR8 X;  3P5J A;  1K6O A;  1FOW A;  2X6Y A;  2JVH A;  2P7C B;  3IH3 A;  2MA3 A;  4G8X A;  1SVL A;  1ZTR A;  1C0W A;  1IN8 A;  2RRE A;  3OIQ A;  1O4X A;  1OCP A;  2M8E A;  4A6E A;  3OIP A;  3LQR A;  3BDD A;  4P5O A;  4KJZ A;  2YPR A;  4FE4 A;  4ZZL A;  2CUF A;  5K1Y A;  5DCF A;  1FJL A;  1IRF A;  5ILU A;  4BE0 A;  2BY1 A;  3DPT A;  3COA C;  5JHU A;  4L9T A;  1RUN A;  1Z67 A;  4G94 A;  4NQW B;  4RAY A;  2DK8 A;  3C2G A;  2NS0 A;  3MZ8 A;  2V9V A;  2HNH A;  1TP4 A;  1SAU A;  1QVT A;  2XPV A;  5H6R A;  2QLZ A;  5E79 C;  2G0E A;  4A93 J;  2M7B A;  2M0C A;  4EM2 A;  2NNN A;  1JGG A;  5FO5 A;  5IYD J;  1V54 H;  1W7P A;  1UJ8 A;  3N4M A;  1MJA A;  1R00 A;  2BY3 A;  4IXA A;  2BGC A;  1WGX A;  3M7G A;  4HQE A;  1VQL I;  2AQF A;  3R0A A;  1SAN A;  4PSW A;  3GTQ J;  2K9L A;  3FXQ A;  2IJL A;  4OMZ A;  2QCO A;  1ETO A;  4XIC A;  4BHC A;  1Z05 A;  4XLH A;  4A3D J;  1GDT A;  4PK4 A;  3ISP A;  3CUQ A;  1FY7 A;  4JX4 A;  2JSP A;  1P7J A;  3GLL A;  2FBK A;  3BQZ A;  2V1D A;  3HSF A;  4CCM A;  4P55 A;  4DOZ A;  2P6S A;  2MC4 A;  3EPZ A;  3KPH A;  4IHW A;  3EUK L;  1EF4 A;  4XOR A;  5IYC J;  3EQL F;  2L01 A;  2FMY A;  2PX9 A;  4Y15 A;  5HNH A;  4TV7 A;  2BEO A;  4BQA A;  1G3S A;  2R7U A;  3PM1 A;  1T2K A;  2HI3 A;  1DP3 A;  3HSR A;  2KRC A;  4L5E A;  1P4A A;  2EZK A;  1HDP A;  4KT5 C;  4Z2Y A;  2DFE A;  1HOM A;  3LSH A;  1AKH A;  5H2F C;  1X1D A;  3WTX C;  4L5I A;  1HA8 A;  2CGP A;  1A6I A;  4ZDL A;  2BHY A;  4MQV A;  4I0A A;  3DBL B;  5F6F A;  5D5W B;  1U8B A;  2CMP A;  3PO3 J;  2V7F A;  4LMY A;  2EFN A;  3OR1 C;  5GAG J;  1A6Q A;  3J7A O;  2EWN A;  1BR1 A;  2FBH A;  3IUO A;  3VPR A;  2MW8 A;  4GXO A;  1F9N A;  1A31 A;  2VBZ A;  1HKQ A;  1IXS B;  2W57 A;  3OS1 A;  4KIG A;  3JTG A;  4IEJ A;  2LOO A;  3H35 A;  1JTX A;  1ETX A;  1MSE C;  4S04 A;  1Y1V J;  1U0J A;  5DD8 A;  3GTG J;  1GXP A;  2QYO A;  4KA4 A;  3R60 A;  2BZT A;  1LEB A;  5B66 C;  3H9Q A;  2ESH A;  2VBW A;  2L4M A;  5IT3 A;  2VOD A;  4G9Y A;  4YIF A;  2HOS A;  2HEO A;  1I3Q J;  5AON A;  4RGX A;  1WJD A;  5EG0 A;  2VOP A;  4BQQ A;  1LEA A;  1XX5 A;  3HHH A;  1TNT A;  5J8C A;  2ECC A;  4IO9 F;  3ZQG A;  2YX4 A;  3BG9 A;  1W5T A;  3HM5 A;  1I1S A;  3I53 A;  4R79 A;  2R7W A;  3LSP A;  2EZH A;  1S7E A;  1DU6 A;  1N25 A;  3DQV C;  3MCZ A;  3WTU C;  3LA3 A;  4ZYE A;  2STW A;  3ZPL A;  4JYK A;  2Z2S B;  2IA2 A;  1OCT C;  3ASN H;  3I55 I;  3BG5 A;  2FX0 A;  3LSM A;  2VIX A;  3H0D A;  3ZQF A;  3D5L A;  3JRI A;  3WGG A;  3GLX A;  1E3H A;  1OCO H;  2K7L A;  1YIT I;  5FLM J;  3MD2 A;  4OU0 A;  3CJQ B;  5C3E J;  1ZQ3 P;  3GTP J;  3S14 J;  1VQ5 I;  3BZC A;  5F1J A;  3RQI A;  1FLI A;  1KQ9 A;  2Y48 A;  3CF2 A;  4M74 A;  3G71 I;  5K7H A;  1NTC A;  5DEQ A;  4I76 A;  2G7H A;  3CDL A;  3KEO A;  2DT7 B;  2RQP A;  4C2U A;  4BXX J;  1Y39 A;  4NC6 A;  4HOB A;  4B09 A;  1LVA A;  3QU6 A;  5FD5 A;  1Y56 A;  1F36 A;  2K02 A;  2CU7 A;  1BC8 C;  4KDP A;  4A3B J;  2JWT A;  3MVP A;  1MZB A;  2M45 A;  1T33 A;  3CP8 A;  1OPC A;  4LK0 F;  3SXY A;  2LDU A;  4S05 A;  4M73 A;  2HWV A;  1VQP I;  2V79 A;  2MGQ A;  2RKH A;  4F52 A;  3K6G A;  3ZOB A;  1Z6T A;  2VB6 A;  4HV6 A;  4U0W A;  3OYB A;  4R1H A;  3ONQ A;  3REO A;  5E3O A;  2HDC A;  1VF9 A;  2Q0O A;  1H9T A;  2KRF A;  1IRZ A;  2OZU A;  4BEH B;  1PJR A;  5DD4 A;  2E2H J;  3H5N A;  3CCV I;  3CZ6 A;  3CCS I;  3GBG A;  1D1C A;  4A3E J;  3BR2 A;  2BVL A;  2CQK A;  4AIJ A;  4XRS G;  1RKW A;  3IRR A;  4RAG A;  3S15 J;  4LLL A;  2A3S A;  4CH7 A;  2AQE A;  1J59 A;  2O6G E;  1ZKG A;  3BZK A;  3BTC A;  2RDP A;  1FP1 D;  2LNB A;  2ZSH B;  1FTZ A;  1SVM A;  1ZLJ A;  2E35 A;  4FQG A;  4BDY A;  4KIT B;  4BGD A;  4B1R A;  2V6E A;  1HSJ A;  3LWF A;  1H8A C;  2GLO A;  2XF5 A;  2D1H A;  5DYM A;  1VI0 A;  1XMX A;  3C3W A;  2MBF A;  4CCJ A;  5FJ8 J;  1RKT A;  4L0Z B;  2VLA A;  3NAR A;  4MNU A;  1R22 A;  3IWZ A;  2XAS A;  1X19 A;  2LR8 A;  2R7V A;  2WY8 Q;  1OR7 A;  2PI0 A;  4BNC A;  2QQA A;  5HOO A;  4BEH A;  4A0X A;  1I3A A;  2LY9 A;  1QZY A;  4CZZ A;  1LE8 A;  3DTE A;  3HKZ N;  3BC8 A;  2DK5 A;  4LB6 B;  4E70 A;  2F4I A;  4CYC B;  4U0V A;  2Z3Y A;  3OYL A;  2QBY B;  1W5C C;  5J40 A;  3BTJ A;  2XPW A;  2IA0 A;  2FE3 A;  5FRO A;  3LFK A;  3F6O A;  4P9F A;  1VQK I;  3SFZ A;  4YFK F;  1YOV B;  2VQG A;  2DFI A;  4WXC A;  2ME6 A;  1ZLK A;  5K7Z A;  1K4S A;  2X9D A;  4FHT A;  3G1M A;  2NOJ B;  1R5G A;  1WH7 A;  4DGW B;  2P6T A;  5EYR A;  1APL C;  3ZQ7 A;  1IN5 A;  4XK4 A;  4XN3 A;  1JJ6 C;  3DPL C;  2Y2Z A;  5L3B A;  6PAX A;  1CGP A;  2GOX B;  3ZMD A;  2Z33 A;  1R23 A;  5FKL A;  4ZYD A;  4OAY A;  1W0T A;  5FLX K;  4EGY A;  4ZYA A;  1MDM A;  1WI9 A;  3IH4 A;  5GAE J;  3ERM A;  2WAD A;  5D6F A;  4W97 A;  2MG4 A;  3IKT A;  2KIQ A;  4IRI A;  2QKL B;  1CF7 B;  2V1N A;  2Q2E A;  4DJA A;  2R5Z B;  2R5Y B;  1RZ4 A;  2VJ5 A;  4CIC A;  2WC2 A;  3JCU C;  3JRB A;  1KQ8 A;  4NBQ A;  3K2Z A;  4B43 A;  4H0E A;  4IKF A;  1NG7 A;  2ZO4 A;  1FEX A;  2ZB9 A;  2Y30 A;  5LEK A;  4BE1 A;  1ZG3 A;  1U5T C;  4EM1 A;  4BY1 J;  2ECB A;  1MJ9 A;  3D0S A;  3OL4 A;  1R5I D;  3E6M A;  5DM6 F;  3JRF A;  2BY2 A;  3P7N A;  1L0O C;  4UB6 C;  1QHH D;  2A61 A;  3AG3 H;  1SFK A;  1YQA A;  1PP8 F;  1D0Y A;  3OYI A;  3A02 A;  1IDZ A;  3G73 A;  1UHS A;  3OMY A;  3NQO A;  3EET A;  1CF7 A;  4HA8 A;  2R5Z A;  2R5Y A;  1EJ9 A;  3QYE A;  2L9R A;  3TBI A;  3S8P A;  5M5X J;  4XRS A;  3IL2 A;  1T6S A;  3LFU A;  5ICE A;  2ZME A;  2XGD A;  4DBR A;  3KIO A;  5D5V B;  3GTL J;  3H3Z A;  2X48 A;  3Q5F A;  4NB5 A;  1LB2 A;  2E71 A;  1BI0 A;  2KIU A;  1GLN A;  3G1L A;  3I64 A;  4DW6 A;  1K78 A;  2CV2 A;  3VOD A;  1XD7 A;  1RNL A;  1H9G A;  2FD5 A;  1WH5 A;  2Y0S A;  2LP0 A;  2OQG A;  3QRF F;  3HZJ A;  3I4N J;  2HDW A;  4MHG A;  3F8C A;  2L7F P;  2OC6 A;  3CMM A;  2KZV A;  2IT0 A;  1U3E M;  3ZRG A;  1YJ9 I;  5GP9 A;  4AID A;  5IOY A;  2BYV E;  3ZQI A;  3F6V A;  4B47 A;  5HDK A;  2QSG X;  4D7N A;  3ABM H;  1DUX C;  1MH3 A;  3ZMS A;  4DYR A;  2GXG A;  1OKR A;  1DPU A;  3K10 A;  4CHU A;  3IRQ A;  1NK3 P;  5E3N A;  1AU7 A;  4YFX F;  2M3A A;  2EIL H;  5B1A H;  1HF0 A;  1IV6 A;  5GTH C;  4A3F J;  2QVO A;  4QIW N;  2I5U A;  2KMU A;  2DYS H;  3FXM A;  4A6D A;  1BM9 A;  1P9Q C;  3WGH A;  4AVZ A;  4EMS A;  2GXA A;  2HOT A;  2RNJ A;  1YHQ I;  5M3M J;  4CCK A;  3MZY A;  4PZJ A;  1I6H J;  4NDL A;  1YI2 I;  2JT1 A;  1Z1D A;  3DEW A;  1ON1 A;  4WWC A;  3PIO F;  3WTT C;  4DYC A;  5F0C A;  1VZ0 A;  2V26 A;  5L3D A;  3TP3 A;  2CW7 A;  3CLO A;  2OAZ A;  1MBF A;  1A35 A;  3ZN1 A;  1P2F A;  4OMY A;  2VJJ A;  1SFO J;  4KYW A;  2ZKZ A;  5J4V A;  1E3P A;  1SMT A;  2BW3 A;  1W5S A;  3DP7 A;  3C18 A;  4EEF G;  1D8K A;  3H5R A;  1MGT A;  4HLX A;  3V42 A;  1R5H A;  3Q9V A;  1BC7 C;  2W85 A;  2B7E A;  1DGW Y;  2L5Q A;  2M9H A;  3HJE A;  4JQF A;  2EIK H;  2HXI A;  2PN6 A;  2YU9 J;  3LMM A;  4AD9 A;  2VKE A;  2XIG A;  4PJJ A;  5LGU A;  3MEX A;  5IP7 J;  1KU3 A;  5J3L A;  1REP C;  3BG6 A;  3QOD A;  2KHM A;  1ENH A;  1R1U A;  3B6A A;  3F9K A;  4BYY A;  1TT5 B;  2TDX A;  5AIQ A;  4FTH A;  1HC8 A;  4Q4Z F;  3W3C A;  3OYH A;  2EA2 A;  1FIA A;  3QPT A;  3MKZ A;  2RC4 A;  1FBQ A;  1SD5 A;  1RRJ A;  1R36 A;  2VT2 A;  4BS9 A;  1LNW A;  3JRD A;  4LLN A;  4PGH A;  3BR6 A;  4BJT A;  4WK8 F;  3K4K A;  2VC1 A;  2OV7 A;  2ID3 A;  5FFX A;  2EBI A;  1EH8 A;  1ONV A;  3OYD A;  1RES A;  1XG1 A;  2KZG A;  3FBI B;  2PJR A;  3FXO A;  4I09 A;  2R0Q C;  2IS4 A;  3F8N A;  3ZQH A;  4LGW A;  2P5K A;  1E3O C;  2LY2 A;  1R1V A;  4D7M A;  4GDF A;  3OOU A;  4LOC A;  2RAE A;  2Y75 A;  4OIQ F;  3S1M J;  2PMH A;  3FHN A;  3N05 A;  3NWT A;  2V6C A;  2ELH A;  1YX5 A;  1BIB A;  3UR3 C;  2HQ5 A;  2QSH X;  1ZGA A;  4UNO A;  2KP6 A;  4A3J J;  1ON2 A;  1B9M A;  3FXR A;  3H0G J;  4IHS A;  2FJ1 A;  2K4B A;  3RZD J;  4AIH A;  3BG7 A;  3SDB A;  3CCQ I;  1POG A;  1G3Y A;  2H8W A;  3LST A;  4MIM A;  1W36 C;  3MFK A;  3A4C A;  3HOS A;  1VQM I;  2YUS A;  3OIO A;  2A6T A;  1XGN A;  3CUO A;  5HNF A;  3OL3 A;  4FCY A;  1HCR A;  1WJE A;  3K4L A;  1BN5 A;  5EEH A;  2IRF G;  1TC3 C;  3VDX A;  4Q47 A;  4BH9 A;  1USS A;  1EH7 A;  1G8X A;  3M3Y J;  2VKV A;  2XAH A;  2OA4 A;  1CQT A;  1N75 A;  2DBB A;  1QGP A;  3OY9 A;  2JRT A;  2MYS A;  5DTD A;  2DYR H;  5HLT A;  2Y0M A;  1JXS A;  2VC0 A;  3K1P A;  3ZQC A;  2WAF A;  4M3B A;  3DEU A;  4ZH4 F;  5HLH A;  3S32 A;  2QQ9 A;  4XMY A;  3OSG A;  1PP7 U;  1VQ7 I;  2A6E F;  5D4S A;  4IRG A;  4Y17 A;  5HS7 A;  4EJW A;  1QHG A;  1SFX A;  4D5F A;  1TLH B;  1WJF A;  1XN7 A;  5C44 J;  2XGX A;  3PFI A;  2B0L A;  2KJC A;  5KHD A;  3OS2 A;  2LLK A;  3HGY A;  4L9N A;  3Q9S A;  4XL9 A;  3HSE A;  3WU2 C;  1SD4 A;  4IOA F;  1VQO I;  1TWG J;  1MBE A;  5BOX A;  1YS6 A;  4A3K J;  1YW8 A;  1ETQ A;  2ZSI B;  3CC7 I;  9ANT A;  4C30 A;  4A0Y A;  1S7O A;  2IP2 A;  2Z5U A;  1OCC H;  3BLY A;  3ULQ B;  2Y9Y A;  2GAU A;  3M8J A;  4QPO A;  2XSD C;  2NS8 A;  3I56 I;  1U8R A;  2PG4 A;  2IGM A;  3SZP A;  1WVR A;  2DDB A;  2KPM A;  2VBY A;  1YG2 A;  2DT5 A;  3EUH C;  4P1W A;  4HDU A;  4B48 A;  1D0Z A;  2V1X A;  1XPX A;  1E0E A;  3ZMU A;  3L00 A;  1FX7 A;  1R71 A;  2R7Z J;  1ZRE A;  2LVS A;  3AKZ A;  2R7X A;  3FZV A;  2BVM A;  4U87 A;  2E7W A;  4I98 B;  2XAJ A;  1W7P B;  3IAM 2;  4NHJ A;  5AIP A;  1TWF J;  1UFM A;  2DMU A;  3PSF A;  2DU9 A;  2NVU B;  4U7B A;  4UB8 C;  1XGS A;  3JRC A;  2HVS A;  4G12 A;  3SQN A;  3T5X A;  1B72 A;  4EJU A;  1X3W B;  2CQ7 A;  3F0C A;  4GO1 A;  4V2F A;  3G1O A;  4C3J J;  3AG2 H;  3OYG A;  3T8T A;  1LDD A;  1T0F A;  2DPU A;  1IN4 A;  2EH3 A;  3CUQ B;  1A36 A;  2BY0 A;  4RB3 C;  5K5O A;  1I39 A;  3A1Y A;  4BHP A;  4QLC U;  2GXB A;  3S2W A;  4XBF A;  4CCN A;  3H92 A;  3F22 A;  2RN7 A;  3OV8 A;  2FQ4 A;  1MIJ A;  3ZP5 A;  2KFD A;  3WTV C;  4AYB A;  2L7M P;  4BXF A;  5DV5 A;  4K2E A;  2EJR A;  4C2M J;  3DF8 A;  2CQQ A;  4OIR F;  4EJO A;  2KIF A;  5E8G A;  3K70 D;  4HZF A;  4ON0 A;  2QKM B;  3E3V A;  3O3K A;  4OAZ A;  4BQO A;  4WXH A;  4YEL A;  1OYY A;  3QYF A;  2ZJQ F;  1WI3 A;  3M1C A;  2ID6 A;  3KP3 A;  3VEP A;  2JTV A;  1AKH B;  4UVB A;  3SJM A;  1FMW A;  4I01 A;  3CMY A;  2XC7 A;  2DA4 A;  3L2R A;  3RKQ A;  4A0Z A;  3FMS A;  2OJE D;  3E97 A;  3PSI A;  1MMA A;  2O9L A;  4X1E A;  2RNG A;  1BA5 A;  2DCE A;  2LBF A;  2K27 A;  4MTE A;  2DW4 A;  2PMZ A;  2X6W A;  3L7W A;  1XGM A;  1TWC J;  2AHQ A;  2H6B A;  3DTI A;  4KIB A;  4KN4 X;  4Y3O A;  1W0U A;  2W4S A;  4DQ2 A;  3E5Q A;  4IHX A;  3V8K A;  5C4J J;  4OOI A;  3BP8 A;  2Y9Z A;  5IY5 H;  1JKP C;  1VQ4 I;  2CUE A;  4HF1 A;  4HX8 A;  3TDZ C;  4P96 A;  4F93 B;  2UZK A;  2DMQ A;  4RLF A;  2VBX A;  2O8X A;  2CQN A;  3QYB A;  1EH6 A;  2E1M B;  2ZJR F;  1GT0 C;  4NNJ A;  3CCL I;  3HEF A;  1B8I A;  2A6H F;  4RBO A;  3CC4 I;  5CQE A;  3GZ5 A;  3CF5 F;  2AXT C;  1YIJ I;  5TGT A;  2DTR A;  2L02 A;  3GF2 A;  5EG0 B;  2E2I J;  3EYI A;  2VE9 A;  2F5V A;  1D0X A;  2DOA A;  3JTH A;  3QOP A;  1GHC A;  2XAQ A;  3H9J A;  2EIJ H;  3IH2 A;  4LB5 A;  3O6B B;  3V4G A;  1U9N A;  3K9T A;  1PUE E;  2DJN A;  2OTJ I;  1IXR C;  3K4J A;  3KZY A;  4MFE A;  2WB1 A;  4M3E A;  2V9P A;  3LA2 A;  3M8F A;  3DU6 A;  2LSO A;  2DMP A;  3VSK A;  4FE7 A;  2DAO A;  2DJI A;  5C4X J;  1ZR2 A;  5HLG A;  4HRI A;  4RAF A;  1RUO A;  1UHM A;  1B59 A;  1XTA A;  4UVC A;  2QEX I;  1V3F A;  1BW5 A;  3J81 Z;  1I5Z A;  2HXO A;  1JT0 A;  5GAH J;  2Q8K A;  2D5V A;  3DPU A;  1QU3 A;  1KQ0 A;  5E17 F;  3PIP F;  1TW3 A;  2M4K A;  3MN2 A;  3OOP A;  5JHF A;  4ENJ A;  1OR7 C;  1TWA J;  2ZJP F;  2XGE A;  2E34 A;  2IVM A;  4KNY A;  3I59 A;  1J75 A;  2XGC A;  3V7S A;  4YRV A;  2DPD A;  4EQQ A;  1FPQ A;  1MD0 A;  1XC5 A;  5LFA A;  3X2Q H;  3Q0W A;  2ISZ A;  2R3S A;  4ZYG A;  4FT8 A;  2EIN H;  3Q3S A;  2AXL A;  4PJM A;  4XLC A;  5ICC A;  2G7U A;  5GPC A;  2STT A;  5DM7 F;  1IGN A;  1J2X A;  2VXZ A;  3K1N A;  2JVG A;  2K5C A;  2GA2 A;  2ADU A;  3ESW B;  2BHZ A;  3RSN A;  5EGO A;  3P9I A;  3F3X A;  3K4N A;  1MBJ A;  2DN0 A;  2GZW A;  3IC7 A;  3BPX A;  4RGS A;  3TL4 X;  4XON A;  1SVO A;  3W6J B;  4BXU A;  5FGM A;  1XMK A;  3UNG C;  2IW5 A;  3TW6 A;  1K4T A;  1KU2 A;  3H1C A;  1JE8 A;  2IA1 A;  2QZ8 A;  4Y4R A;  3BJ6 A;  4QWQ A;  2VPR A;  1ZH5 A;  4L9J A;  4YII A;  3VFZ A;  1Z9C A;  5IP9 J;  4JOM A;  2H27 A;  4E7J A;  3IWF A;  3KP5 A;  1UZC A;  4XR6 A;  1F43 A;  3CO7 C;  2LRD A;  1MNM C;  2I8D A;  2XF7 A;  3RJP A;  3FHZ A;  1XS9 A;  3LQQ A;  1QZE A;  1UST A;  5IYB J;  3ABK H;  2JZY A;  5DUI A;  3CJT B;  1ZRD A;  4O3M A;  4MFD A;  2LKX A;  2K86 A;  1ZAR A;  1TQI A;  1G4D A;  1R58 A;  1LE8 B;  5LEJ A;  2W84 A;  2XAU A;  5F64 A;  5F0F A;  3GUD A;  3D5R C;  1X3U A;  3FDY A;  4EGZ A;  1SEU A;  2CH0 A;  2JUC A;  2Z9O A;  2O8K A;  2DOF A;  2IGN A;  2HQR A;  1ORK A;  5F0H A;  3OYM A;  2EB7 A;  4BU2 A;  2ZNY A;  4EJT A;  2IEK A;  2E36 A;  2IXS A;  3PUF A;  4A3L J;  3EYY A;  3FXJ A;  3BJA A;  2DQL A;  2AO9 A;  1XGO A;  4ASN A;  3SDG A;  1FOX A;  5E20 A;  4IHY A;  3BR0 A;  1ETW A;  3FXL A;  2KQR A;  4BHB A;  1IJW C;  4A5M A;  3KEY A;  2EA4 A;  4KUM A;  1LDJ A;  3QPS A;  2XDV A;  4M72 A;  3BTI A;  3PQJ A;  4I99 C;  1YJN I;  3RPQ A;  3IAS 2;  3HOV J;  2NVT J;  2OD5 A;  3F21 A;  2K9N A;  4KMU X;  1G2H A;  2DA7 A;  2EFQ A;  1MDM B;  2NOG A;  1HW2 A;  3RKW A;  1TQP A;  2F4M B;  1XCV A;  5DCM A;  3WE2 A;  5BQT A;  4E7L A;  4PSX A;  2LTP A;  5BPI A;  3GYH X;  2XPU A;  1ZEL A;  2RV8 A;  5K5Q A;  2Q2E B;  2ZCW A;  4ANJ A;  5LHH A;  4M9X A;  2JPB A;  4UV9 A;  4FET A;  3R0J A;  5HDN A;  1O3S A;  3VWB A;  4CGZ A;  1I1G A;  2NS7 A;  1J0R A;  1BL0 A;  1HW5 A;  3H3V K;  3F23 A;  4CYD A;  2DOD A;  2M2E A;  1FNN A;  3I4P A;  4HNV A;  1MMS A;  1D1A A;  1FBU A;  1WHU A;  4ESF A;  4IHV A;  3JR9 A;  3CME I;  4UHT A;  5L3F A;  1S9H A;  2FOW A;  2P7V B;  1UG0 A;  4YEJ A;  4BJ6 C;  4BL0 B;  1R4N B;  1STZ A;  2BBY A;  3G3Z A;  1AWC A;  4QSH A;  4IVN A;  5K7F A;  2RQQ A;  4XKC A;  4N0B A;  1OJL A;  4XLA A;  2LC2 A;  1BOB A;  2E5Z A;  1SD6 A;  1HLV A;  2NVQ J;  3LSG A;  4CSW A;  2OUM A;  3LL7 A;  5ICF A;  3ASO H;  2W24 A;  4II2 A;  5JLX A;  2X1C A;  2FQ3 A;  3K7A J;  1GVJ A;  1J5Y A;  1I6X A;  3L9F A;  3ECH A;  4M3G A;  2K40 A;  1Y0N A;  1JKQ C;  1V4R A;  1ETY A;  1T39 A;  1P6R A;  5FFZ A;  3JRE A;  2WAQ A;  3O8H A;  3I58 A;  3OYA A;  4BAY A;  3CC2 I;  2ZME B;  1OCR H;  1X3Z B;  5KAF C;  2LD5 A;  1AA7 A;  3HRU A;  1DGR M;  2OBP A;  2VKD A;  2R4G A;  2H8R A;  1K78 B;  2GM4 A;  3S3O A;  2FML A;  3P9C A;  4OWR B;  1D5Y A;  2W48 A;  4MEX F;  4LLG F;  4RM2 A;  2P8T A;  3GEZ A;  1RIO H;  3AL0 B;  1MBH A;  2LKP A;  3KEQ A;  2XAG A;  2XSJ C;  3CMA I;  5E8I A;  4B3A A;  2VQL A;  4HNU A;  2ZXW H;  4UUS B;  4FX0 A;  4QPQ A;  5IOZ A;  3PNY A;  2W25 A;  1XSD A;  2ZXJ A;  1UHW A;  1NG6 A;  3S2H J;  1I50 J;  5B1B H;  4RB0 A;  2ZFW A;  2ZC2 A;  2DOE A;  3HIF A;  4E7S A;  5HVQ C;  4EM0 B;  4DZJ A;  1WQ2 A;  4E7K A;  3A0B C;  5ERI A;  2C6Y A;  4C2T A;  1VTN C;  2VPL A;  3PNT A;  1JTY A;  1V5G A;  3SZT A;  2VQH A;  3TOB A;  2DFF A;  3FXK A;  1QRY A;  1HBX G;  4N9I A;  1TTY A;  1KU9 A;  1WWX A;  2DFH A;  4BBR J;  3HYI A;  1IAW A;  2L54 A;  1N77 A;  2R7T A;  5LGN A;  4LK1 F;  2V9K A;  2ME0 A;  1H0M A;  1DU0 A;  2PJP A;  2R93 J;  3TW7 A;  2DO7 A;  4FAS D;  1B6A A;  1TZL A;  1W36 D;  3QP6 A;  3LOC A;  3HUG A;  3JAM K;  1QVU A;  2PEX A;  1VQ6 I;  2VJI A;  2KDZ A;  3TGN A;  4D1Q A;  2TRT A;  3I5U A;  5JVT A;  5HDG A;  4UUS A;  2R7S A;  2PMU A;  3G6E I;  1V5E A;  2BW3 B;  1ULY A;  1LVK A;  5EZG A;  1TNS A;  2FUG 2;  3NRV A;  4GYI A;  3BOQ A;  4RA2 A;  1O7L A;  3B73 A;  4S0H B;  2LMD A;  2XAF A;  2M34 A;  2RVC A;  5J8F A;  2WY7 Q;  3AG4 H;  1ZK8 A;  3BTL A;  3MQ0 A;  1MH4 A;  2P5V A;  4I0B A;  4Z6Y A;  1YW9 A;  3HRM A;  3FK7 A;  2K9Q A;  1FOK A;  1T98 A;  2MLG A;  1WKM A;  3I3L A;  5FKO A;  2EFP A;  1X2M A;  1HDD C;  3NAU A;  3K0L A;  1PVE A;  3CTA A;  4U88 A;  2QGU A;  1JUP A;  2QSF X;  2M8G X;  1XB4 A;  3FX3 A;  3FWE A;  1Z21 A;  1U2W A;  2LG4 A;  3W6V A;  2DQR A;  4MQ9 F;  5JFR A;  2M7A A;  1S5L C;  3S3M A;  5KVR A;  2QF7 A;  1ZG1 A;  3K4M A;  2Y0S N;  4HST A;  3GTK J;  1V55 H;  1QQI A;  3D5S C;  2EV6 A;  4JP0 A;  2NXN B;  3QQA A;  3BR1 A;  2PJR B;  3MKW B;  1P4X A;  1S7A A;  4H4K C;  2E2J J;  2H94 A;  1X2N A;  2KIS A;  3HXL A;  5IPA A;  3KET A;  3DV8 A;  3V8J A;  2WBM A;  4E7H A;  1F5T A;  2P81 A;  2O7O A;  3LSR A;  5EJC A;  2F4O B;  2FEZ A;  2UUZ A;  2H6C A;  3OS0 A;  3W2V A;  4G7H F;  1MMD A;  1LFB A;  4XOT A;  2XF6 A;  4M6V A;  3E6C C;  2GBY A;  4Y33 A;  2E19 A;  5LBQ A;  4V19 K;  1U5T A;  1UB9 A;  2Q1Z B;  3FIS A;  3ZMV A;  3RYP A;  3L2V A;  3J7Y J;  1L3L A;  1OIS A;  2DA3 A;  3CCU I;  3L09 A;  3CES A;  1G3T A;  4LG0 A;  3ZQQ A;  4ESJ A;  1SMY F;  4F7Z A;  1UMQ A;  5K5R A;  1O3T A;  1K61 A;  2OCC H;  3CO6 C;  1NK2 P;  3AAF A;  4PCQ A;  3BPV A;  2UWM A;  1SFE A;  2IPQ X;  2W82 A;  3HOZ J;  1G3W A;  4HF0 A;  4RM3 A;  2ZNZ A;  4XLP F;  3LAP A;  1QO0 D;  4DZP A;  4P9U A;  2X6O A;  1KYW A;  2VAS A;  2DA6 A;  5A2Q K;  3M4O J;  4ZDP A;  3KE2 A;  2VUM J;  3DXJ F;  1JUM A;  4BQN A;  1ZRF A;  1X1P A;  3NWS A;  1N78 A;  2R92 J;  2Z99 A;  4LD5 A;  3PO2 J;  1JHH A;  2F2E A;  2L0K A;  3IKV A;  3ZN0 A;  3PL8 A;  3PJR A;  4KMF A;  3MWM A;  1RR7 A;  5JR3 A;  5J1R A;  1R49 A;  2D45 A;  2GA1 A;  2M30 A;  3GZN B;  1PYV A;  2DMN A;  3E5U A;  5FLX Z;  2H1K A;  2EFO A;  5B5E C;  5L3C A;  5B3S H;  3CP2 A;  5KAI C;  1T56 A;  2KLO A;  3E0J B;  1HKT A;  2HKO A;  5D8L B;  1MMN A;  1YJW I;  3DBR B;  2XRO A;  1ZAO A;  5L3G A;  4IF4 A;  4MO7 A;  2HVR A;  3HBL A;  2MD5 A;  1H89 C;  2K9M A;  1X4O A;  2KIM A;  1RET A;  3R61 A;  4IQ4 A;  4N4N B;  4UV8 A;  4B8X A;  4RGR A;  2HS5 A;  5E3M A;  2MH2 A;  3FKI J;  3V7C A;  3WOD F;  2ZXI A;  4DBQ A;  3L2Q A;  1HKS A;  3O2P E;  2HTJ A;  2H09 A;  3BG3 A;  1ZGJ A;  2XRL A;  5LGT A;  1Z77 A;  1ZR4 A;  1WRJ A;  3CUQ C;  1KU7 A;  3MMY B;  3TO7 A;  3BCB A;  3BR5 A;  5E1Z B;  1AOY A;  1PDN C;  4B44 A;  4CO8 A;  1DP7 P;  4OIO F;  2FU4 A;  5ILS A;  2V4J C;  1DPR A;  2WWY A;  1ITY A;  2L3D A;  3S17 J;  3JSO A;  3FIW A;  4FX4 A;  3BR3 A;  3CCJ I;  3MZH A;  2JQ7 A;  1B72 B;  2HYG D;  3HG9 A;  2KJB A;  3RCO A;  2KL4 A;  4O6J A;  3F72 A;  1BI1 A;  4G6Q A;  2LH9 A;  1IO2 A;  3KZZ A;  1R9T J;  4DIQ A;  1JGS A;  3N97 A;  3DU5 A;  2MLK A;  3I54 A;  1Y6I A;  2JSC A;  1FIP A;  1FTT A;  3LAJ A;  5EZH A;  3WE3 A;  4ZDO A;  3VYR B;  4X6A J;  2BXZ A;  1UCR A;  2BE5 F;  3J80 K;  4OIP F;  3W2A A;  2MFZ A;  2EPF A;  4FIS A;  3ML6 A;  4BAC A;  4U7D A;  3HC7 A;  1YO5 C;  1S29 A;  4E7Z A;  4ENN A;  2HU9 A;  1WPK A;  2W1O A;  3B6C A;  4YG2 F;  3SHF A;  4IQJ A;  1E17 A;  3MKL A;  4M3D A;  1YLF A;  2XB5 A;  4RB1 A;  3QP5 A;  4KIF A;  3S1R J;  3J7A Y;  2FNP A;  1IRG A;  2DA1 A;  2ETH A;  4ZZD A;  2CG4 A;  3ZCO A;  1S72 I;  2YS9 A;  4ZTJ A;  2AS5 F;  3ERE D;  1OCZ H;  3DKY A;  1FYM A;  3LSK A;  3OYJ A;  4I7H A;  1W1W E;  2HQN A;  2LBF B;  2E1M C;  4M6Y A;  5H6Q A;  2VXD A;  2CV1 A;  1AHD P;  4G7Z F;  3W2W A;  1GV2 A;  3CCR I;  1YRN A;  5D5U B;  1IW7 F;  2HQA A;  3IV5 A;  5EDN A;  4KIC A;  4BUP A;  1FWZ A;  5CVI A;  4ETS A;  1LQ1 A;  4ZYH A;  1QA6 A;  1D1B A;  1LFP A;  2H1L A;  2JK3 A;  3RPU A;  3IP4 B;  1MJB A;  4C9Y A;  4NC8 A;  1VQ9 I;  2OQR A;  3VYS B;  2HTS A;  2VE8 A;  3F8F A;  1ZN2 A;  1X1B A;  1YTY A;  1B8I B;  4HG2 A;  2L9N A;  4KT6 A;  3RIR A;  4IX7 A;  3JRH A;  3S16 J;  1ZRC A;  2O0Y A;  3FBN B;  3GX4 X;  3M9A A;  3VYU B;  4R8H A;  3S1Q J;  2DMT A;  2FOK A;  3D1N I;  5H20 A;  3OYC A;  3KP7 A;  4G6D A;  2M87 A;  4Y7N J;  2NYX A;  2HOE A;  1BBY A;  2ISY A;  4C3I J;  2JA6 J;  2I10 A;  3U1K A;  5CKT A;  3FM5 A;  4AVP A;  1GV5 A;  2X1E A;  3J7Z I;  5J6X A;  3HOX J;  1YE9 A;  2EFW A;  3Q0V A;  2K4J A;  3DLA A;  2HPM A;  2XV4 S;  1XSX A;  1X4P A;  2CS3 A;  4CUG A;  3OYK A;  2GWR A;  2QM3 A;  3U1D A;  1YYV A;  5DUK A;  4UUV A;  4M3F A;  3V7R A;  3TED A;  4Q5S F;  1WSU A;  2W00 A;  2FBI A;  4HX4 A;  1YFH A;  4EVI A;  2XKP A;  4NQW A;  2WV1 A;  1X1C A;  1BI2 A;  1LDK B;  2E1N A;  4IJA A;  4AYB N;  1P4W A;  1WZ2 A;  2DI3 A;  2DDA A;  5BMZ A;  1X1A A;  3M07 A;  2HZT A;  3K2A A;  1V5F A;  2M4G A;  1KON A;  1Y0U A;  2DXI A;  1Q1V A;  4PUS A;  2O3F A;  3CD6 I;  1JHF A;  3CJN A;  5F08 A;  4GCV A;  4RDU A;  4WXD A;  2W7N A;  4ENM A;  5A2Q Z;  2CO5 A;  3I59 B;  3HHG A;  4MEY F;  3HOW J;  2FF4 A;  3WG9 A;  3H36 A;  1K7A A;  1YIO A;  2NVX J;  2HYF A;  3EUH A;  3BY6 A;  5F04 A;  5EEG A;  1TWH J;  2F6C A;  3F8M A;  2QQB A;  3U21 A;  2PMZ N;  3GFL A;  2IGK A;  2D1V A;  5EF6 A;  2XUB A;  3ECO A;  3KFW X;  1ETK A;  4HEA 2;  5EGO B;  2K3F A;  3QPL A;  1IV8 A;  5J1Y A;  5LRR A;  3WU0 A;  4XLF A;  1I27 A;  1K83 J;  3M1E A;  2VN2 A;  2CYY A;  4D9J A;  1QPM A;  2E5N A;  5TJJ A;  2VT3 A;  1Z6R A;  3F8B A;  3KX2 A;  5FKM A;  2B63 J;  2LF8 A;  3L2W A;  1Z7L A;  2DA5 A;  5ED4 A;  3ABL H;  3BQY A;  5DDG A;  4XKB A;  5DS9 A;  4RS8 A;  4A12 A;  4XID A;  1D8J A;  2WAE A;  4HDV A;  1TBX A;  2ACJ A;  2EV0 A;  1ZGW A;  3GTJ J;  3LA7 A;  2ZJ2 A;  2WB1 N;  2DLL A;  1SC7 A;  3CCE I;  5IT9 K;  2Y69 H;  3ABT A;  2A07 F;  2P0W A;  2E60 A;  2LK2 A;  1IDY A;  2CSO A;  1BR2 A;  2X51 A;  3WGI A;  4XLE A;  1E2X A;  3EUA A;  5CJ9 A;  3ROU A;  3JW4 A;  2OU2 A;  5TRD A;  1MW7 A;  2G9W A;  3T0Y A;  4D0P A;  4PFO A;  1T8I A;  4I02 A;  2CJJ A;  3J80 Z;  1R6R A;  4KN7 X;  4UXN A;  1BJA A;  1VQ8 I;  3O8G A;  3K70 C;  5IP6 A;  3BCA A;  1YW7 A;  3C2H A;  5FLV A;  1ZHF A;  1P7I A;  1Z3X A;  4L9V A;  1XDU A;  2E1C A;  2PLY A;  1U6G A;  2X1D A;  2XHK A;  3S1N J;  2CRG A;  2HVQ A;  2QWW A;  3HPG A;  5CVJ A;  3SYT A;  3A01 B;  3UKG A;  1IZ1 A;  3FK6 A;  1DDN A;  2CFO A;  2V1U A;  1Y8Q B;  5FD6 A;  2CW8 A;  2JA8 J;  1O7F A;  1MBG A;  2L4A A;  4HAM A;  3L2C A;  5HOD A;  1J9I A;  3RZO J;  1WJB A;  4ZJZ A;  4ENK A;  1Y1W J;  5DCM B;  2M0M A;  4IPA A;  3OWT A;  1QZZ A;  3TQN A;  1PUF B;  4ZC3 A;  3OYF A;  1JKR C;  2BV6 A;  5D5X B;  1T95 A;  3HKZ A;  1MKM A;  2XB0 X;  1K79 A;  3JRG A;  3KYC B;  4A3C J;  2Z16 A;  2J5P A;  4F55 A;  1M1E B;  4GYG A;  4W1U A;  1HQC A;  3HRS A;  4CCO A;  5FB2 A;  1BW6 A;  4PJ0 C;  2BXY A;  3A0H C;  3HTS B;  2MAB A;  1MSF C;  2FNA A;  2L9V A;  4EAT A;  2R7Q A;  3DWL E;  5F27 A;  3SZG A;  1Z3Y A;  4HPQ A;  2GQQ A;  4PFP A;  3A01 A;  2ZME C;  1OYI A;  3NEU A;  3PFY A;  2A5W A;  4N4O B;  5CPR B;  4HBL A;  5LHI A;  1D5V A;  3FF5 A;  3DKX A;  4EV0 A;  4PDK A;  4NC7 A;  3K69 A;  4LJZ F;  3WU1 B;  3AL0 C;  4MTD A;  2KKO A;  3IHU A;  4HW0 A;  2A69 F;  1FC3 A;  1RC9 A;  4IZZ A;  1MNE A;  4AWX B;  2E7X A;  4WCG A;  2HR3 A;  1PUF A;  2NVY J;  1IN6 A;  1TT0 A;  2CV0 A;  2JMW A;  2NAZ A;  2Y31 A;  5HLI A;  5D8K B;  5BS6 A;  1QPI A;  4UY8 I;  3HL2 A;  1GXQ A;  4GRI A;  3VB2 A;  1VFC A;  3QPH A;  1X58 A;  3QAH A;  1R4M B;  3EDP A;  3RDI A;  2FA5 A;  5KK1 A;  4GGG A;  3R6S A;  1QNT A;  1XDS A;  2A5Y B;  2KT0 A;  3I71 A;  3QWL A;  4CCL A;  5BPD A;  2COM A;  3ABU A;  3GXO A;  3KLO A;  3KP6 A;  3ZGK A;  2F5E A;  4A3G J;  3DKW A;  3CDH A;  5CQG A;  4V2G A;  2CWE A;  1LKX A;  2ELK A;  1IC8 A;  3CJR B;  3U2R A;  4A5N A;  1FSE A;  3GW2 A;  5CVR A;  4XRM A;  2ESN A;  2K85 A;  2DT6 A;  2P5L C;  2KRH A;  4WF2 A;  3GO5 A;  4A2U A;  2L9S A;  1WCM J;  1WJ5 A;  3A03 A;  3TO6 A;  4HV5 A;  2EZL A;  2LKS A;  4E7I A;  1BIA A;  4LFU A;  1D3Y A;  2EK5 A;  1FT9 A;  3ZXS A;  4X0G A;  4IL6 C;  2X0L A;  3GZ6 A;  2ELJ A;  4C3H J;  4DNC A;  2FSW A;  5JVG F;  2EZI A;  1BJZ A;  1FMV A;  4XKV A;  4UUT A;  1IN7 A;  2ZBK A;  3RTR A;  4CZC A;  2B9S A;  1H88 C;  3HB9 A;  2NNY A;  5BNG A;  1A5J A;  2JUG A;  2P4W A;  5E1X A;  4JK1 X;  4L18 B;  1IRX A;  2IGO A;  4XSZ F;  1GUU A;  3U9G A;  2OF7 A;  3DEE A;  2WA0 A;  4CYC A;  3RKX A;  3OYE A;  4ITV A;  1OQY A;  4CXF A;  2QBY A;  5EEA A;  2VI6 A;  3HTU A;  4A3I J;  3BRO A;  2HOA A;  3HUG B;  4XLN F;  3KLN A;  4HNT A;  4MLO A;  1SD7 A;  3I9V 2;  2R7R A;  3GFJ A;  2MC3 A;  2LFB A;  1WJC A;  3HRT A;  2CUZ A;  3GFM A;  5ICG A;  5E18 F;  3GVA A;  4LIU A;  3TMO A;  5LHG A;  1Q1H A;  3B02 A;  3LSI A;  4L5J A;  5LLQ A;  1NH3 A;  3KP4 A;  3SEZ A;  5D4R A;  3E1S A;  3FKJ A;  3WTW C;  1XSV A;  5FRN A;  2CQX A;  2N8G A;  3AFH A;  1FP2 A;  3WHB A;  4XN0 A;  2GIZ A;  2HGC A;  3RPU D;  1LPQ A;  2VOO A;  3MAJ A;  3PQK A;  3GTM J;  4Y52 J;  2CW0 F;  2VQC A;  3FMQ A;  3L1P A;  3HPH A;  4ESB A;  2F48 A;  3SFI A;  2X6X A;  1Z91 A;  2WAQ N;  2VON A;  3R4K A;  5L3E A;  2RGV A;  4YFN F;  5JI6 A;  2HKX A;  2JA2 A;  1UG2 A;  3E5X A;  3S2D J;  4G7O F;  3ZQL A;  4ABZ A;  4L0Y B;  2O61 A;  5IT9 Z;  1JT6 A;  1OFC X;  3FXU A;  5CVV A;  4RAZ A;  4AUX A;  4E4H A;  4F91 B;  2M1B A;  1KGS A;  3E7L A;  4XSX F;  4XNF A;  5LD2 C;  1RR8 C;  2HFH A;  4Q48 A;  2X85 A;  1W7P D;  3JRA A;  5FRM A;  3WTY C;  2LYC A;  3BWG A;  2ZXH A;  4IHT A;  1G59 A;  4BE2 A;  2HPI A;  2HZD A;  3SEQ A;  2GOM A;  1ERD A;  3TDU C;  3W6K B;  2IBD A;  4A3M J;  1R1T A;  2L7Z A;  4BJ5 C;  1MMG A;  2ZFU A;  2J5O A;  3KZI C;  2IS1 A;  2TCT A;  1J7K A;  3CQZ J;  3BT9 A;  2GIV A;  2VL8 A;  1P92 A;  1T38 A;  1IXC A;  1O3R A;  3VOE A;  3I0T A;  3S93 A;  3TKY A;  2K9S A;  2OCE A;  1IUF A;  4ZTF A;  4B4C A;  1U5T B;  3G2B A;  2O03 A;  1JKO C;  2XRN A;  3WG7 H;  1JJ8 C;  3PNV A;  3L2U A;  2EQR A;  2FXA A;  5JLW A;  4LG0 B;  1G6N A;  1FYL A;  3VYT B;  1VQN I;  4Y13 A;  4D5C A;  1EV7 A;  1FBS A;  1SAX A;  3FMR A;  1S6L A;  3QOE A;  2A05 A;  5HS9 A;  4XM3 A;  4PJL A;  1ODD A;  5E1W A;  4BBS J;  2CUJ A;  1RI7 A;  1JI8 A;  3RKY A;  2F5D A;  2XKO A;  4I6Z A;  2CFX A;  2IS2 A;  4M9S A;  1B1B A;  4GFB A;  3TO9 A;  3P9K A;  2OZ6 A;  5J1U A;  1HXD A;  1OLT A;  4J01 A;  4WX9 A;  2YU3 A;  3WHC A;  4LIT A;  1BR4 A;  2QUF A;  3OR2 C;  4E6K G;  4CA0 A;  1KZH A;  1Z7U A;  1R7J A;  1K6Y A;  1HW1 A;  4KIS A;  1XMA A;  5GPA A;  1DQU A;  1F4K A;  5GTI C;  3ZMT A;  3DTK A;  4BKX A;  1OYW A;  2EV5 A;  3C7J A;  3C1D A;  3CCY A;  3T1B A;  3E6B A;  3HOY J;  1SFU A;  4XKW A;  5M5W J;  3HDD A;  4EJV A;  2L7K A;  3RYR A;  2KDO A;  2QA4 I;  2UV1 A;  2JJ7 A;  2JN6 A;  1ZG5 A;  2M5W A;  3C2B A;  1Z0X A;  1ETV A;  2UXN A;  2VJ4 A;  3K4B A;  5FKN A;  2X4H A;  2JRM A;  4CDG A;  2EIM H;  3CDI A;  3KYD B;  2R7F A;  1MBK A;  5CVU A;  3GFI A;  1FSH A;  4IRH A;  2IAI A;  1FYK A;  1O57 A;  2YSR A;  1T0F C;  3TOA A;  3TP0 A;  4YIR X;  3GCM A;  1EA3 A;  2WV0 A;  4HSR A;  5F1R A;  4XOP A;  4N9H A;  1UAA A;  4A69 C;  4UVA A;  1OMI A;  1O3Q A;  1ACI A;  3BZ6 A;  4DYQ A;  1UEL B;  2MH9 A;  1WFX A;  2WTE A;  2HYJ A;  2YR2 A;  1HST A;  2PQ8 A;  3RQ4 A;  3KCC A;  3T8R A;  2JA7 J;  2F5F A;  2QQ8 A;  1ZYR F;  3K4C A;  3ZMZ A;  4RLQ A;  2OPT A;  2NRA C;  2E1O A;  3WTZ A;  1IG7 A;  3DCF A;  2K3P A;  5TIS C;  5M3F J;  1LUJ B;  1EKE A;  3G4S I;  3KP2 A;  1VND A;  4AIK A;  1BOA A;  1IF1 A;  4BDZ A;  3DFG A;  1S8N A;  2PFB A;  3DBH B;  5M5Y J;  3J81 K;  4KFC A;  1TQM A;  3HOU J;  5CYV A;  3JSP A;  2R7O A;  4G6T B;  3BJO A;  3H9G A;  4XRF A;  4F3Q A;  3HOT A;  3S3N A;  2DTZ A;  3A2K A;  2LF7 A;  5J4Y A;  1LJ9 A;  5CLS A;  1T08 B;  4M9Z A;  1S3J A;  5HS8 A;  2QEN A;  4MGR A;  4B3X A;  3M8E A;  3QU3 A;  1U78 A;  4HX7 A;  1FOY A;  1J09 A;  2BOL A;  3DLL F;  5FKK A;  2COB A;  1BI3 A;  2XVC A;  3K1M A;  3E6D A;  1FZP B;  1U9O A;  2MSY A;  4NUB A; 
#chains in the Genus database with same CATH homology
 3KEY A;  2XDV A;  3IAS 2;  4J00 A;  2M3A A;  2VKH A;  2L2O A;  3H5A A;  2LY1 A;  2KMU A;  1P9Q C;  2MD0 A;  4AVZ A;  4II3 A;  4E7L A;  5KCM A;  2F6C A;  4PSX A;  3U21 A;  1ZEL A;  4LIV A;  3OYN A;  3KYL A;  2IGK A;  3VSL A;  4CCK A;  2Q2E B;  4ANJ A;  4PJN A;  1YX3 A;  4LG3 A;  4HEA 2;  4FET A;  3VWB A;  1VZ0 A;  4XLF A;  2V26 A;  2O5R A;  2CW7 A;  1D1A A;  4D9J A;  4XQF A;  1MND A;  2E5N A;  3KX2 A;  1S9H A;  2VJJ A;  1UG0 A;  1WJA A;  3L2W A;  4YEJ A;  1Z7L A;  2BW3 A;  3PUB A;  4BJ6 C;  4BL0 B;  3MKY B;  2Z1D A;  2IS6 A;  4XKB A;  3H5R A;  5KNL A;  3V42 A;  2LRE A;  2RQQ A;  4XKC A;  4XLA A;  2LC2 A;  2L5Q A;  1DGW Y;  1BOB A;  2E5Z A;  4JQF A;  4AU7 A;  4RMN A;  3LSG A;  4F92 B;  2WAE A;  4CSW A;  2OUM A;  3LL7 A;  3LMM A;  4II2 A;  2X1C A;  4PJJ A;  3ZR8 X;  2X6Y A;  2JVH A;  3BG6 A;  3QOD A;  2KHM A;  2P0W A;  3F9K A;  2RRE A;  3OIQ A;  2WAQ A;  2E60 A;  3OIP A;  3W3C A;  3OYA A;  1BR2 A;  4P5O A;  3OYH A;  4KJZ A;  2X51 A;  3MKZ A;  1AA7 A;  1DGR M;  4BS9 A;  4BE0 A;  4XLE A;  2VKD A;  2R4G A;  3DPT A;  4BJT A;  3S3O A;  4OWR B;  3EUA A;  4RM2 A;  4NQW B;  3AL0 B;  3K4K A;  2OV7 A;  3C2G A;  1MW7 A;  3OYD A;  2HNH A;  3FBI B;  2PJR A;  2XSJ C;  4PFO A;  1SAU A;  2IS4 A;  1R6R A;  3K70 C;  3BCA A;  2VQL A;  3C2H A;  2LY2 A;  4HNU A;  2M7B A;  1Z3X A;  4QPQ A;  3OOU A;  3PNY A;  2X1D A;  1NG6 A;  3FHN A;  3N05 A;  3NWT A;  3SYT A;  2HVQ A;  3HPG A;  2AQF A;  1YX5 A;  4PSW A;  2CFO A;  3UR3 C;  2K9L A;  4E7S A;  5HVQ C;  2CW8 A;  2KP6 A;  4E7K A;  4C2T A;  2VPL A;  3PNT A;  1V5G A;  1WJB A;  4ZJZ A;  2VQH A;  4XLH A;  2M0M A;  3BG7 A;  4PK4 A;  3SDB A;  3OWT A;  4ZC3 A;  3OYF A;  1W36 C;  3HOS A;  3A4C A;  1T95 A;  2A6T A;  1N77 A;  2JSP A;  3HKZ A;  5HNF A;  3OL3 A;  2R7T A;  2V9K A;  1WJE A;  3K4L A;  4FAS D;  2Z16 A;  4CCM A;  4DOZ A;  1TZL A;  4F55 A;  3EPZ A;  2MC4 A;  1W36 D;  4CCO A;  3EUK L;  2VJI A;  4XOR A;  3VDX A;  4D1Q A;  5HNH A;  2MAB A;  1G8X A;  2R7S A;  4EAT A;  2R7Q A;  3DWL E;  2R7U A;  1N75 A;  1V5E A;  3SZG A;  3OY9 A;  2MYS A;  1Z3Y A;  2BW3 B;  4HPQ A;  1LVK A;  5HLT A;  1DP3 A;  4PFP A;  2KRC A;  2FUG 2;  5CPR B;  3PFY A;  4N4O B;  2A5W A;  2WAF A;  3S32 A;  4XMY A;  3LSH A;  3DKX A;  1X1D A;  2WY7 Q;  4NC7 A;  1HA8 A;  3AL0 C;  4ZDL A;  1QHG A;  1WJF A;  2CMP A;  3I3L A;  2V7F A;  3OR1 C;  4IZZ A;  1MNE A;  1TT0 A;  5KHD A;  3OS2 A;  2CV0 A;  1BR1 A;  3IUO A;  4XL9 A;  3HL2 A;  4GRI A;  2ZSI B;  3OS1 A;  1Z21 A;  4C30 A;  2LOO A;  4CCL A;  3H35 A;  2LG4 A;  3ZGK A;  3BLY A;  2M7A A;  5CQG A;  3S3M A;  3M8J A;  4QPO A;  1U0J A;  1LKX A;  3K4M A;  4HST A;  2IGM A;  3CJR B;  2KPM A;  3D5S C;  3EUH C;  4P1W A;  4B48 A;  1D0Z A;  2PJR B;  2DT6 A;  3MKW B;  1E0E A;  3H9Q A;  2KRH A;  4H4K C;  2L9S A;  3HXL A;  1WJ5 A;  2WBM A;  3AKZ A;  4E7H A;  2R7X A;  2BVM A;  4U87 A;  4E7I A;  1WJD A;  3ZXS A;  4X0G A;  3IAM 2;  4BQQ A;  2ELJ A;  2UUZ A;  3PSF A;  4U7B A;  3OS0 A;  3W2V A;  1FMV A;  4XKV A;  1MMD A;  2HVS A;  3RTR A;  4XOT A;  2XF6 A;  4R79 A;  4CZC A;  2R7W A;  4Y33 A;  2Q1Z B;  3DQV C;  3L2V A;  2JUG A;  2Z2S B;  3CES A;  1IRX A;  2IGO A;  3OYG A;  3ZQQ A;  3DEE A;  2WA0 A;  3OYE A;  4ITV A;  3LSM A;  2VIX A;  3A1Y A;  3H0D A;  3D5L A;  4CCN A;  2UWM A;  2W82 A;  3HUG B;  3MD2 A;  4RM3 A;  4HNT A;  4MLO A;  3I9V 2;  2R7R A;  3CJQ B;  4AYB A;  1WJC A;  2VAS A;  2CUZ A;  4BXF A;  4LIU A;  3TMO A;  4ZDP A;  3CF2 A;  3K70 D;  3LSI A;  4BQN A;  2QKM B;  4BQO A;  4OAZ A;  4YEL A;  2DT7 B;  3NWS A;  3QYF A;  3SEZ A;  4C2U A;  1N78 A;  3E1S A;  3FKJ A;  3M1C A;  5FRN A;  3AFH A;  1FMW A;  1Y56 A;  4XN0 A;  2XC7 A;  3PL8 A;  3PJR A;  3L2R A;  3RPU D;  3CP8 A;  3PSI A;  1MMA A;  1PYV A;  2VQC A;  2RNG A;  3HPH A;  2DCE A;  2LBF A;  2X6X A;  3CP2 A;  4F52 A;  3K6G A;  3E0J B;  2KLO A;  2VB6 A;  1MMN A;  3OYB A;  2PMZ A;  2X6W A;  2JA2 A;  3ONQ A;  4Y3O A;  3DTI A;  2W4S A;  2HVR A;  4BEH B;  4E4H A;  4F91 B;  1PJR A;  2K9M A;  1X4O A;  4XNF A;  5LD2 C;  4IQ4 A;  4N4N B;  3H5N A;  5FRM A;  2X85 A;  3CZ6 A;  3GBG A;  1D1C A;  2LYC A;  2ZXH A;  2BVL A;  1G59 A;  4BE2 A;  2ZXI A;  2HPI A;  4DBQ A;  3L2Q A;  2HZD A;  4F93 B;  3SEQ A;  4RLF A;  2GOM A;  4CH7 A;  2AQE A;  3QYB A;  1ERD A;  2E1M B;  4NNJ A;  4BJ5 C;  2ZSH B;  1MMG A;  2ZFU A;  3MMY B;  5CQE A;  2IS1 A;  3BCB A;  4KIT B;  4BDY A;  5TGT A;  4BGD A;  4B44 A;  2V6E A;  2VL8 A;  2F5V A;  1D0X A;  2XF5 A;  2DOA A;  2V4J C;  3H9J A;  3S93 A;  4CCJ A;  2VLA A;  4ZTF A;  3G2B A;  3K4J A;  1X19 A;  3HG9 A;  2WB1 A;  2R7V A;  3RCO A;  2WY8 Q;  2KL4 A;  3DU6 A;  3PNV A;  5HOO A;  3L2U A;  4BEH A;  2LH9 A;  3VSK A;  4DIQ A;  3DTE A;  3BC8 A;  2DJI A;  3DU5 A;  2F4I A;  1Y6I A;  3OYL A;  3VYT B;  4HRI A;  4ZDO A;  3VYR B;  3W2A A;  2MFZ A;  5FRO A;  3QOE A;  4BAC A;  3DPU A;  4XM3 A;  3HC7 A;  1QU3 A;  4PJL A;  2VQG A;  4E7Z A;  2HU9 A;  2CUJ A;  1JI8 A;  2M4K A;  2W1O A;  2IS2 A;  4IQJ A;  2NOJ B;  5JHF A;  1OR7 C;  4DGW B;  4J01 A;  1OLT A;  3J7A Y;  4LIT A;  1BR4 A;  3OR2 C;  4E6K G;  4XN3 A;  4CA0 A;  3DPL C;  4YRV A;  1K6Y A;  2GOX B;  4KIS A;  3ZCO A;  5LFA A;  4ZTJ A;  4OAY A;  1DQU A;  4ZYA A;  3DTK A;  3DKY A;  4PJM A;  4XLC A;  3LSK A;  3OYJ A;  2WAD A;  2E1M C;  2LBF B;  2VXZ A;  2VXD A;  2JVG A;  2QKL B;  2CV1 A;  2K5C A;  4XKW A;  2V1N A;  4DJA A;  2L7K A;  2VJ5 A;  2KDO A;  3W2W A;  4B43 A;  3RSN A;  4IKF A;  1NG7 A;  2UV1 A;  3K4N A;  2HQA A;  4BUP A;  4BE1 A;  1D1B A;  1LFP A;  2VJ4 A;  3K4B A;  3TL4 X;  3IP4 B;  4XON A;  3OL4 A;  4C9Y A;  4NC8 A;  3UNG C;  3VYS B;  4Y4R A;  1T0F C;  1X1B A;  1EA3 A;  4HSR A;  4HG2 A;  2L9N A;  4XOP A;  4KT6 A;  1UAA A;  1QHH D;  4IX7 A;  1SFK A;  3FBN B;  4JOM A;  1UEL B;  3VYU B;  1WFX A;  4E7J A;  4XR6 A;  3RQ4 A;  3OYC A;  2LRD A;  1D0Y A;  3OYI A;  2I8D A;  2XF7 A;  3OMY A;  3K4C A;  4RLQ A;  5CKT A;  2X1E A;  3QYE A;  2K3P A;  1YE9 A;  3TBI A;  3S8P A;  3LFU A;  3DLA A;  2HPM A;  1X4P A;  2CS3 A;  4CUG A;  2XAU A;  4BDZ A;  3OYK A;  4DBR A;  3D5R C;  3FDY A;  2CH0 A;  1GLN A;  2CV2 A;  2W00 A;  2R7O A;  2IGN A;  4G6T B;  3H9G A;  1X1C A;  3OYM A;  1LDK B;  2Y0S A;  4BU2 A;  4F3Q A;  3HOT A;  3S3N A;  3A2K A;  1X1A A;  2HDW A;  2OC6 A;  3CMM A;  4B3X A;  1V5F A;  2IXS A;  2KZV A;  2M4G A;  1KON A;  2DXI A;  4PUS A;  3ZRG A;  1J09 A;  4B47 A;  2BOL A;  2KQR A;  2W7N A;  4NUB A;  3K10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...