3ZRGA

Crystal structure of rxlr effector pexrd2 from phytophthora infestans
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
66
structure length
66
Chain Sequence
GPALNTEKMKTMLKAGMTVDDYAAKLKLTDKIAAAANSARAMEKLGETLKMKKLLRYLNYVAEHTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords PEXRD2 FAMILY SECRETED RXLR EFFECTOR PEPTIDE, PUTATIVE
publication title Structures of Phytophthora Rxlr Effector Proteins: A Conserved But Adaptable Fold Underpins Functional Diversity.
pubmed doi rcsb
source organism Phytophthora infestans
total genus 24
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3zrgA00
3ZRGA
chains in the Genus database with same CATH superfamily
1FP2A 1KGSA 3CDIA 1MSEC 2FNPA 2XAGA 3KYDB 4PJLA 2HI3A 1ODDA 2JQ7A 3JRAA 4LLNA 5ERIA 1D0YA 2FD5A 2M8EA 1MJAA 3GVAA 1YS6A 1TW2A 2AQFA 3BTJA 3TMOA 2X51A 4XRMA 3FHZA 1Z3YA 2VQCA 3CD6I 1NK2P 3FHNA 4EQQA 1G3SA 1WRJA 2QQAA 4UB8C 4RGUA 2M45A 2PMZA 3AFHA 3VDXA 4FE4A 4A3EJ 4KMFA 1YJWI 4AIJA 2KP6A 4FQGA 4QPOA 1Z1DA 3HYIA 5ICGA 1T38A 3GFLA 3HC7A 1D1BA 1R9TJ 2H1LA 4G7OF 1SFKA 1R1UA 1YX3A 2L3DA 5JI6A 3JRIA 1U8RA 4BACA 2MFZA 5D5XB 3X2QH 1VQMI 1YIOA 2R7ZJ 1TP4A 2E36A 3A0BC 3LSJA 2JUGA 2PX9A 1SFOJ 3OWTA 1JI8A 4G6TB 3F8MA 2ADUA 4GFBA 2ACJA 4DZPA 5J8CA 1P2FA 2EZIA 4DYCA 2FNAA 2Q8KA 1T08B 3ONQA 2A6TA 2RQPA 2M2EA 4CYCA 2L02A 1NG6A 2Z33A 3FXKA 3HUGB 5DTDA 5ILVA 2HNHA 1LDJA 1HSTA 3PQKA 2DOFA 4LMYA 2H8WA 3BQYA 3VSKA 3GZ5A 2GIVA 2X6WA 3IP4B 3DBLB 2DFFA 3RZOJ 2HVRA 3CLQA 2VXZA 2HVQA 4RBOA 2P81A 5KAIC 2W25A 5FB2A 3KP4A 3F8NA 3T1BA 5J40A 4HPQA 1B9MA 1O3TA 1PP7U 4BUPA 1UMQA 2DODA 3IAM2 3HEFA 1J75A 2IS6A 2VC1A 2FUG2 1MBFA 3ZN0A 1G2HA 5H6RA 2L01A 2M1BA 1TC3C 1W5CC 3S1NJ 2XC7A 3UKGA 2GXAA 3QRFF 3QODA 2W7NA 1P4AA 3BY6A 3M1EA 4BXFA 1BIBA 3DPLC 3RDIA 1D8JA 1HKTA 1YX5A 4H0EA 4RLQA 4NBQA 3VYRB 5LRSA 2ZO4A 4D1QA 2ZFWA 3SXYA 3FXRA 2VLAA 3ZQCA 5F1JA 1SVMA 2QYOA 5EEAA 4IHVA 2Q2EA 3D0SA 3COAC 2PI0A 3KLOA 3I5UA 3PSFA 1E2XA 5LLQA 1UELB 2DQRA 1ZELA 3ZOBA 3WTWC 4GYGA 3ZMZA 3CP2A 4II2A 1V3FA 5E3LA 5DM7F 4PFOA 2ZJ2A 2LBFB 2ZNZA 2A6HF 4CH7A 1V4RA 2VKDA 2QZ8A 2E19A 3IWZA 4HQMA 3R6SA 4C9YA 5GTHC 5KHDA 3QPHA 4ZC3A 4TV7A 1SANA 1AWCA 1I50J 2DYRH 2RVCA 2M5WA 3HXLA 4XLAA 2LTPA 3RZDJ 2PJRB 2LKSA 2HOEA 4HDUA 3CC7I 2QM3A 3OIOA 5EF6A 3DP7A 3K69A 1R7JA 2HGCA 5FRNA 1S5LC 3K2AA 1MIJA 2V6CA 3ZQLA 3CESA 3FISA 4MEYF 1DQUA 1QHHD 1KONA 2EWNA 5JHFA 1QPMA 1VQ5I 5BMZA 2V1XA 3PIPF 3E97A 1HW5A 3CMYA 1Z91A 3DBHB 1LB2A 4Y7NJ 5E79C 2DPUA 3S14J 2UXNA 1H0MA 2P7VB 1J7KA 1BIAA 3S93A 1SEUA 2MGQA 1YW9A 1YE9A 2IPQX 3JRBA 2R7UA 3BTLA 4BNCA 2L7FP 3LSKA 3M7GA 2YPRA 3NAUA 3F8BA 2VKHA 2K9QA 4RGRA 3CCLI 2MH9A 4IOCF 1XCVA 1I1SA 1X58A 3MCZA 3F8CA 4CGZA 5IP6A 1U9OA 2LFBA 1XG1A 5FFZA 5K5QA 2O03A 4KN7X 3P9CA 2UZKA 3CUQC 3BG5A 2LY1A 3V42A 1ETXA 3FDYA 3E6DA 1R23A 1X2NA 3R4KA 2CV0A 3HRMA 3HKZA 3OY9A 3OV8A 4OIPF 5D4RA 3S2DJ 5H6QA 4XLNF 5BPIA 1YG2A 1XSDA 2F5DA 2YX7A 4FX0A 1JJ8C 3GLXA 2EH3A 4DZJA 2WAQA 3DTEA 2BY3A 2M0MA 1O7LA 1F1ZA 3DPUA 2DW4A 5J1YA 2XHKA 1ERDA 2X48A 3TL4X 1BL0A 2GA2A 1XD7A 1YRNA 3WGGA 1P9QC 2DDAA 3LNQA 2KJBA 2CQKA 3T5XA 3L2CA 4P9FA 2HPMA 1GUUA 3BJAA 3J81Z 1SD4A 5HLIA 1QQIA 3L2QA 2HTSA 2DA6A 3BG9A 3S3MA 1MMDA 3M1CA 4FX4A 1PDNC 2XAHA 3GFJA 2DPDA 2Y31A 2ZXHA 2V9KA 4BY7J 3HHGA 5CVVA 3U9GA 4MEXF 1B8IA 1CGPA 5CYVA 4KJZA 2V6EA 5IYBJ 1FOYA 1Z6RA 1QA6A 5FROA 2STWA 2CYYA 3FM3A 3IRQA 1AA7A 3CMAI 3TDZC 5J47A 4HQEA 3QAHA 4OU0A 3LAJA 4A93J 2H6BA 2MH2A 5E3OA 3F72A 5GTIC 1KYZA 2M9HA 4DW6A 2TRTA 5IPAA 1SVLA 4XBFA 3AG1H 4LOCA 4BQNA 1G3TA 1ZGWA 2O61A 2VC0A 2GM4A 3L2VA 2VJ5A 3BG7A 4HSTA 2HWVA 4DNCA 2W1OA 3SDGA 2PFBA 4CZCA 2CO5A 4XK4A 3VFZA 5DUKA 1OMIA 3OYJA 5BOXA 3GXOA 1K6YA 1TNTA 1MNEA 1R36A 1U78A 4QLCU 2RAEA 1BW5A 3ISPA 3HPGA 3KP3A 4RDUA 5J4VA 3LA7A 3NEUA 3BTCA 3WTTC 3MKZA 2P5KA 3DEWA 3QYFA 3ZXSA 3KEYA 2KJCA 4WX9A 2ZJQF 1SD7A 3IH2A 3ZMDA 2FBHA 1TNSA 1VI0A 3L2UA 3OR1C 1U5TC 3VEPA 4S04A 3S8PA 4WCGA 3CO6C 1Y56A 1NTCA 3OIQA 3B6AA 4E7JA 3HZJA 2XASA 5BNGA 4S0HB 4KITB 3CCJI 1IV6A 4BJ5C 1TWFJ 4E7HA 2FOKA 3G4SI 3L9FA 2EIKH 3WU2C 4BU2A 2ZMEB 2R92J 4A6DA 2DA4A 2VOOA 2VPLA 3M8EA 1TLHB 4AVZA 2W82A 3G71I 5AIQA 4MLOA 3WU1B 1FOWA 4MQ9F 4BKXA 1Q1VA 2EV6A 2VUMJ 4M72A 2M7BA 2E7XA 4BE0A 3S16J 4XN0A 4BHPA 2OV7A 1S29A 3H36A 3OS0A 1AKHA 4Y4RA 2XGDA 2F6CA 3IHUA 2ME6A 4JX5A 1JT0A 1CF7A 1LDKB 3O6BB 5B5EC 4XKVA 3A0HC 3EUAA 3G2BA 2LRDA 1VQ7I 1W5TA 3K4NA 1HW1A 3ZCOA 5FKMA 1RUOA 2ELJA 5IP9J 4EEFG 3S3OA 3M3YJ 2EFWA 5J6XA 3IV5A 3GTOJ 1R49A 3DU5A 2BOLA 3H9QA 1IDZA 2QQBA 2KDZA 3BTIA 3MN2A 1IC8A 5EGOA 4LB5A 1GT0C 1HF0A 3ZQFA 2XGXA 2A05A 5E1XA 4OIOF 3LQQA 4JOMA 1ZLJA 3ZMTA 5M3MJ 2UWMA 3LSHA 3DEEA 3G1LA 1MMSA 2OA4A 1BJZA 1QZYA 2EINH 5K1YA 2QBYA 2ZJPF 4UVBA 4A5NA 3BPXA 1Z67A 3FK6A 5FFXA 1EA3A 1JHHA 2XF5A 4G12A 3CJQB 2CUFA 4Q48A 5HDGA 2DQLA 1K78A 1I3QJ 3U1KA 1ETYA 1V54H 1QBJA 2PMZN 2E5NA 3E3VA 4JQFA 1G3WA 4XOTA 3QPTA 4BDYA 5F08A 1CQTA 2KLOA 2K4BA 2JZYA 1PUFA 4KIFA 3O2PE 4LB6B 3CCVI 4KN4X 1K79A 3F0CA 4GYIA 2COMA 1FMWA 3RKXA 3TO9A 5GAEJ 2WV0A 4BQQA 1J09A 5M5XJ 1USSA 3BR5A 3H0GJ 3HIFA 4DOZA 4BBRJ 3ASOH 3F6OA 3VYUB 1R5ID 2MLKA 2M87A 2BE5F 1HA8A 3VWBA 2FJ1A 5LBQA 4ENMA 4U0YA 3BLYA 3HOYJ 2ZXIA 4HYEA 4OWRB 3W6JB 3OL4A 2ZMEC 4IO9F 2P6SA 2QCOA 2E60A 4QIWN 3FMRA 4LG0A 4IOAF 2ICWG 1XMKA 4ZJZA 4C2TA 1ZAOA 4NC7A 1DUXC 5D4SA 4CYDA 2NS7A 2XAJA 3HJEA 1ZRDA 1N78A 2ZNYA 5F0HA 3BR0A 1PYVA 4S05A 3CCUI 4ETSA 3PIOF 1A36A 4LFUA 4IRHA 3LA3A 1S9HA 4DJAA 3S15J 1XN7A 1BOAA 2R5YA 4A3DJ 5EEHA 2XRNA 1ZLKA 3KP6A 1U3EM 2MYSA 4D7MA 4PGGA 3CCQI 1TWHJ 3TP3A 1XSXA 4G7ZF 2E2IJ 4UV9A 4M9XA 4KUMA 2CMPA 4XRSA 1RRJA 1OCCH 1MW7A 3GCMA 1HC8A 1JT6A 3P7NA 1G3YA 2BVLA 2ECCA 3I9V2 2V79A 2HTJA 4HV6A 2P0WA 2K86A 4AU7A 1A6QA 3DLAA 2DCEA 5CVUA 3IKTA 1WJCA 2X1DA 1NG7A 2NOJB 2ISYA 9ANTA 4A3JJ 3SZTA 1ZTRA 4XOPA 2VQGA 4LLLA 1IJWC 2OCCH 3GTPJ 2DT6A 2X1CA 4IEJA 4AYBN 3TBIA 1WJDA 2K9NA 3UNGC 1BI2A 3KIOA 4ABZA 3ERED 2FF4A 1A5JA 1IV8A 4KISA 1HKQA 4B3XA 4A0YA 2XPVA 3K4JA 5BS6A 3CUOA 3RI4A 3O8HA 2R7QA 2L0KA 4HZFA 3GX4X 3HDDA 2HKOA 1S8NA 1G6NA 2R7VA 2E1NA 3BT9A 1HW2A 3SDBA 4AIKA 2KIMA 5H2FC 3P9IA 1O3SA 1LE8A 3V7CA 2CFXA 3RPQA 5DUIA 2YU9J 2FU4A 2GWRA 2GLOA 2OJED 3DKWA 5IOYA 1ZG1A 4RS8A 1FOXA 2F2EA 3CUQA 5JLWA 1OFCX 1JTXA 4RLFA 4HRIA 2R7OA 1E3PA 4E4HA 3CDHA 1GDTA 5E17F 2JSPA 2JN6A 4QSHA 3ROUA 3LFUA 1AHDP 3WTUC 1DGRM 1A35A 1T98A 3CZ6A 3ELKA 2HDCA 5JLXA 2DA2A 2YSRA 4F92B 2K9LA 1GV5A 3GWZA 3OR2C 2K9SA 4L5JA 3L1PA 4Q4ZF 2IRFG 2EK5A 5LGUA 3A1YA 2NVQJ 2DT7B 2E1MC 2VN2A 3G73A 1IUYA 3LSRA 3IH4A 2BZTA 1Z21A 1RNLA 3ERMA 3LQRA 3O8GA 1FEXA 3BROA 4ESBA 2JPCA 2DA3A 1FNNA 1VNDA 3OOUA 4O3MA 1ZARA 2AO9A 2HXOA 3GZ6A 1YOVB 1JHFA 3DTIA 1JUMA 2LBFA 2LSOA 5KVRA 1U6GA 3CC4I 3GTLJ 2H94A 1BR1A 1HBXG 2X6XA 2ESNA 1RC9A 2JWTA 1FPQA 4NC6A 5EG0B 2GAUA 4CUGA 2CS3A 1R6RA 2VBXA 1H9GA 2WADA 5FLVA 1YW8A 2R5ZA 3WU0A 1ITYA 1N25A 5D6FA 3SEQA 3AG3H 1STZA 4I0AA 4EM2A 1PUEE 2O3FA 3PO2J 1Z7UA 3WGIA 1VQ4I 1YITI 1W0TA 2Z16A 2RDPA 4YG2F 4YFXF 3RQIA 2Z9OA 2QLZA 1FLIA 4L18B 1X1PA 1GHCA 4F52A 1MDMB 3N97A 1GVDA 3HGYA 2JA7J 4I98B 2IEKA 2O8XA 4X1EA 3OYCA 2J5PA 4I99C 4XRFA 5F0FA 3I56I 1XGNA 2L9VA 4RGSA 5D5VB 3S1QJ 2DA5A 1U5TA 2VQHA 1KU9A 3C2BA 5LHIA 1Y8QB 3K1NA 5HNFA 1OCZH 1XDUA 2XUBA 1F4KA 1J9IA 3QYBA 3H0DA 2IVMA 3A01B 4N4NB 3OS2A 2DK5A 3VYTB 4UVCA 1A31A 4DGWB 4ESJA 1USTA 1WI3A 3HRSA 5F04A 5E3MA 1IXRC 4BJ6C 1L0OC 3K9TA 2EA2A 1V5FA 2RREA 1QO0D 4II3A 4PGHA 3FIWA 2HOSA 1FYMA 4RGXA 3F21A 1J59A 2CGPA 1FSHA 2BY2A 2IA1A 1W4MA 4V2GA 3Q9SA 1W1WE 3E0JB 1R00A 4ENKA 4KA4A 1MBJA 2WV1A 3OL3A 3V8KA 2IAIA 4Y33A 2XF6A 2OPTA 5LGTA 4WXHA 2W48A 2KMUA 1FYLA 3OYLA 5E8IA 2H8RA 3HPHA 4PDKA 4B8XA 2EIJH 3IWFA 3RJPA 4J19A 5C4XJ 2GOXB 2ZSIB 2VPRA 2IA2A 1MMAA 1S7EA 3K0LA 2GIZA 2LP0A 2JA5J 1YLFA 4PJJA 3FKIJ 3A2KA 1GVJA 4ITVA 2HXIA 3J80K 2X6OA 2ID6A 4FISA 2Y0SN 4O5VA 5LHGA 2L9RA 2K9MA 1WJAA 3BG6A 3L7WA 2DXIA 3W3CA 2CUJA 4GCVA 1VZ0A 2HZTA 3TOBA 2VXDA 3F8FA 2CU7A 3K4CA 3LSTA 3EPZA 4FT8A 4ZDOA 1MNDA 4F55A 1I39A 3H3UA 3QU6A 5B3SH 2WY8Q 3ABTA 1EJ9A 3G1MA 2LMDA 1X3UA 1YIJI 4XM3A 1OYWA 5H20A 4C3HJ 2LREA 4JX4A 4XLHA 3TEDA 1LEBA 4H4KC 2HYJA 1ZR2A 1WWXA 4K2EA 1OPCA 2CG4A 5HS7A 4AM3A 3MEXA 2KIUA 3GTMJ 1JUPA 2I10A 4BE1A 2COBA 3PQJA 4AYBA 3EETA 2GXBA 2EZLA 2CSOA 3ZGKA 3H3VK 2QKLB 4LK0F 1X2MA 4CCKA 5E3NA 2VBZA 4XSZF 1FYKA 1TT5B 3E5UA 2WB1N 1Y6IA 2EV0A 2DMNA 3K7AJ 3I59B 2JA2A 3R0JA 4ZYAA 4UY8I 1LJ9A 4ZH4F 2K85A 3FMQA 1JGSA 3JAMK 2BXYA 1J0RA 2KIFA 4UVAA 1S72I 4A3CJ 4JBAA 3TW6A 2QUFA 1XC5A 3MKLA 3A03A 2DAOA 1WH7A 2DYSH 4MNUA 2RC4A 3F9KA 4FCYA 3PNYA 5DEQA 3OYGA 3CJNA 1B9NA 3F6VA 2ZB9A 3OYDA 3BZ6A 4NQWA 2EV5A 4W1UA 1YO5C 2JK3A 1P92A 2ZBKA 2WC2A 3ZN1A 1YQAA 2IGOA 1BI3A 3RYRA 2QSGX 2EFOA 1R4NB 3GZNB 3JW4A 3IC7A 2R7RA 2HDDA 4CCMA 2ID3A 2GA1A 5J1UA 1B6AA 2XROA 2A07F 2OD5A 4EJOA 2LG4A 2FQ3A 3GUDA 4R1HA 1QRYA 1Z77A 2MD5A 5ICEA 2FQ4A 3ZR8X 2R93J 1FT9A 2P5VA 3HG9A 3CCEI 2DFIA 5DCMB 3VPRA 4MIMA 3ZMVA 4PSWA 4R8HA 3HOWJ 2JRMA 1U0JA 4BBSJ 5J8FA 4UXNA 3I4PA 2F5FA 4M9SA 2V1DA 5L3FA 3K10A 3DV8A 3L09A 4G94A 4MHGA 4RB3C 4YIFA 5DDGA 4G8XA 1BOBA 3WTZA 1I6HJ 5A2QK 3RTRA 6PAXA 2VJIA 2OZ6A 3M9AA 1R4MB 1B72A 3KX2A 4AIHA 2ETHA 1TBXA 4U87A 4CCLA 3J7YJ 5JVGF 1XB4A 3K2ZA 1OKRA 4XNFA 2VODA 2Y69H 1MBKA 2OU2A 2L7MP 1XGOA 5DCFA 2FX0A 1TQIA 4L9VA 3W6KB 4BHBA 3ZP5A 1YW7A 1W36C 1KU3A 3RIRA 2BYVE 3HRTA 5EZGA 1OLTA 4BAYA 1UG0A 3IAS2 5KCMA 4CA0A 3OIPA 4CYCB 1SD5A 1VQPI 3ESWB 3JRCA 1RUNA 3PO3J 3ZMSA 2LH9A 2M4KA 4MFDA 3H1CA 4P55A 3PM1A 4IQJA 2E7WA 2QGUA 5K7ZA 4L5EA 1ZG3A 3BG3A 1BM9A 3MQ0A 1Q1HA 2G9WA 4EV0A 4HDVA 5CQGA 4D7NA 4E7KA 2MA3A 1SAXA 1ZQ3P 3BJOA 2OTLI 1W7PA 2CQ7A 3V7RA 4Z6YA 3FBNB 4HBLA 1JKRC 1TL8A 2QF7A 1AU7A 4A12A 5LGNA 3DLLF 3QYEA 3CMEI 1JTYA 5CPRB 3SJMA 3E1SA 2PN6A 5HNHA 3ZMUA 1YS7A 2BV6A 1K83J 4N9HA 1D5YA 3FXOA 1UZCA 3PFIA 2Y2ZA 3CF2A 3J7AY 3KE2A 4BGDA 4QPQA 2FBIA 3F23A 4ASNA 2XAFA 1ZRFA 2XB0X 3JRGA 1BR4A 2OC6A 4A6EA 5GADJ 1K6OA 4E7SA 4I6ZA 2X1EA 4GGGA 3WG9A 3OYAA 2CJJA 2Q2EB 2W57A 1W7PD 4A3MJ 3OYKA 2R7TA 2A61A 4WXCA 3TP0A 4XIDA 5C44J 2VJ4A 4PJMA 4MFEA 5TISC 4KDPA 1IXCA 1ON1A 2RKHA 4NDLA 3S2WA 1LNWA 2Y0SA 2RN7A 3D5SC 2HZDA 5AONA 3RCOA 2IS1A 3L00A 2VONA 3Q9VA 4Z2YA 3MFKA 3M8JA 2AS5F 3CCSI 4IL6C 3CJRB 2K7LA 3SFIA 2CH0A 3KP7A 2ELHA 1S6LA 1SVOA 3MMYB 1TQMA 2W24A 3KZYA 3VYSB 5LRRA 5GAHJ 4AIDA 3H35A 1W5SA 1IZ1A 3ABUA 2IA0A 2ZFUA 3MVPA 3REOA 2KL4A 1XTAA 2Q1ZB 3HSFA 1XPXA 2GZWA 4ANJA 2IS2A 2R7SA 4XQFA 2H6CA 2IP2A 1FX7A 2HFHA 2F4OB 2E71A 4U88A 5J1RA 5JVTA 2M7AA 1EH6A 2YS9A 3KLNA 2OF7A 4M3DA 5E1ZB 4M74A 2WB1A 2ECBA 1ZK8A 3GEZA 2B63J 3QPLA 3FXUA 2KISA 3KETA 4Y52J 4M6YA 1LFPA 5M5WJ 4HNTA 5GAGJ 3AKZA 1TWCJ 2IBDA 1HKSA 2A69F 4EATA 2PMUA 3MD2A 3FWEA 4ZYGA 1GXQA 2DJNA 4IHXA 5FKKA 1FIPA 4ENJA 3LWFA 3CCYA 1ULYA 2MD0A 2EFPA 4XL9A 4HEA2 4XLFA 1BW6A 1R71A 1X4PA 1LPQA 1ETVA 1I27A 1OR7C 2BW3A 2XSJC 3LMMA 1G4DA 2E35A 4AUXA 2FOWA 2VT2A 2DTRA 1T39A 2OQGA 1AOYA 2G0EA 4I0BA 3NARA 2LK2A 2DBBA 2ZJRF 2KZVA 4YFKF 3J7AO 5LEKA 4ZDLA 1IAWA 2VKVA 5FLXK 2FSWA 5FD5A 2NNYA 4FETA 1TTYA 2NNNA 4OMZA 3VSLA 1H9TA 3WTSC 1I5ZA 1FC3A 1YRNB 2K27A 5L3CA 2DTZA 4IJAA 1IW7F 2PEXA 3I64A 4NUBA 1HXDA 3WHBA 5TJJA 4M3EA 2LNBA 5ICCA 3ZQIA 2L4MA 2V1NA 4PCQA 4EMSA 4E7ZA 3JSOA 1JKQC 3TQNA 1BC8C 3EDPA 3R60A 3T8TA 2ZXWH 1OYYA 2WY7Q 2MABA 5IT3A 3Q0UA 2DN0A 3ECOA 1B8IB 3BC8A 2AXLA 2QSFX 2O9LA 4HX7A 3C1DA 4NC8A 4ZTJA 4RB0A 1IN7A 2EB7A 2WWYA 1ETQA 5EYRA 1JE8A 1WJEA 2NVYJ 4BQOA 3MKWB 3I58A 3WODF 4G9YA 3OSGA 1A6IA 1DU0A 1VQLI 4A3BJ 5IT9K 1VQKI 4LGWA 2LDUA 4B47A 4BY1J 1U9NA 3TDUC 1XSVA 1FZPB 3HHHA 1UJ8A 2DJIA 3MKYB 1YJ9I 3CJTB 4HF0A 1FP1D 2CQQA 3WG7H 1P7IA 3FF5A 4EJUA 4I09A 4LIVA 4XONA 1MMNA 2LR8A 3M07A 1JKOC 1OCTC 4BL0B 1G59A 3D1NI 4KNYA 4G6QA 3QP5A 1IGNA 4ZTFA 1ZGAA 5JFRA 1V5GA 1O57A 2VQLA 3CDLA 3GFMA 4BYYA 1QHGA 5M5YJ 2A5YB 5ICFA 4RMNA 1HSJA 2P5LC 1LQ1A 1MBHA 2NVUB 1NK3P 2B0LA 3GO5A 4WF2A 2FRHA 3DU6A 4MTDA 3OYMA 2R7FA 3QP6A 2BY1A 2PG4A 5CLSA 3HSRA 3E7LA 4C2MJ 3KEQA 3W6VA 3HUGA 1QZEA 3K70C 2DA7A 2RQQA 4B44A 3FXQA 2K3FA 1SFEA 4M6XA 5CQEA 2X9DA 3K4BA 4LD5A 4HX8A 1ACIA 1K7AA 1EH8A 1OISA 3BCBA 4ON0A 1HCRA 2TCTA 1BR2A 4KMUX 1WHUA 4B09A 2QVOA 2E5ZA 2IW5A 4XICA 1X4OA 3DCFA 5D6EA 3I55I 1Y1WJ 3KZIC 2JPBA 3GTKJ 4LIUA 3JCUC 2XB5A 3AG2H 2NRAC 2NAZA 2PJPA 3Q5FA 3KFWX 4BE2A 1BBYA 2M34A 1AKHB 5KNLA 1BC7C 4UV8A 3S1MJ 4QTRA 4XR6A 1CF7B 2WBMA 2EFQA 4V2FA 1FSEA 3B73A 2W4SA 5B66C 3WHCA 1ONVA 3KP5A 2NXNB 3ML6A 3FZVA 4E6KG 3L2WA 5BPDA 3O3KA 3WE3A 1IN5A 2O8KA 4WK8F 3TKYA 1O4XA 1ON2A 2W85A 1BJAA 2V7FA 3E6BA 4N9IA 2DMPA 4CZZA 3EUKL 1V5EA 5EGOB 3A02A 4L0ZB 2F5CA 2EBIA 3SZGA 3TO7A 4BHCA 2IGMA 3FXJA 4EM1A 1G8XA 4BQAA 2L7KA 3J80Z 2XIGA 1UHMA 4XLEA 2EZHA 1RETA 3H3ZA 4RAYA 2CW7A 2QBYB 3I59A 4A69C 3HM5A 2FMLA 3OYEA 2MC4A 3FX3A 1UCRA 2PJRA 2HU9A 3K6GA 5JR3A 4MQVA 5C3EJ 2LOOA 4XLCA 4L9TA 1K78B 1RZ4A 1FWZA 3W2VA 4M71A 2G7UA 2K5CA 2CQNA 4KT6A 3BJ6A 2F5VA 2CW0F 4Y17A 2P6TA 4F91B 2HQ5A 5ILUA 5E8GA 5GPCA 3T0YA 3HOXJ 2HDWA 3LA2A 1PUFB 4HAMA 3B02A 2Z2SB 4NNJA 4KYWA 1W0UA 2I5UA 2KPMA 4IQ4A 1WI9A 2N8GA 3G6EI 4I02A 4KIGA 4M3FA 4PJ0C 2DU9A 3OYHA 3SZPA 2OZUA 1K4SA 2XAUA 3G1OA 2QQ8A 2HOAA 1W36D 1R1TA 4HW0A 1LVKA 1T56A 2V26A 4B3AA 2CUEA 3KEOA 4I01A 2LYCA 2HEOA 3U1DA 4FASD 3SYTA 3FK7A 3MAJA 1HDDC 4HA8A 4LG0B 3HTSB 2OQRA 3JAMZ 2PQ8A 3DF8A 3TGNA 3T8RA 1XCBA 1QVTA 4HSRA 4D9JA 4L9JA 3GLLA 5DCMA 1T33A 3ASNH 5L3EA 2BHZA 1BA5A 1T0FC 2NOGA 4PJNA 1Y39A 2CRGA 1FJLA 3I71A 1JXSA 2Y9ZA 3OS1A 2ZXJA 4XN3A 2ESHA 2R5YB 4J01A 1J5YA 1E0EA 3I53A 5FO5A 2RGVA 2V1UA 3CF5F 1LDDA 2LKXA 1FY7A 2AHQA 1RPWA 5IP7J 1T8IA 4C2UA 2PBIA 2MLGA 5F0CA 5KK1A 2Z99A 2EA4A 3JTHA 1RR8C 4RB1A 3HRUA 4HV5A 2X85A 1WJ5A 4YEJA 3BP8A 4IHTA 2CQXA 1UHSA 2HQNA 2HYGD 1ZG5A 5EDNA 1GV2A 2VE8A 1F43A 1VQ8I 4UUSB 2MW8A 5BQTA 4YFNF 3LOCA 5LD2C 1Y0UA 4M9ZA 4IVNA 1P6RA 2M4GA 3CTAA 3CQZJ 2WA0A 5IY5H 4Y3OA 5D5UB 4IXAA 4IKFA 2XKOA 5HDNA 4F93B 1E3OC 4V19K 3DXJF 1O3QA 2BBYA 1VQ6I 5HLHA 3QOPA 3OYBA 2WAEA 5A2QZ 3NWTA 4F7ZA 5L3BA 1FBUA 3GMEA 2UV1A 1BI1A 2WTEA 3PUFA 1IF1A 3D5LA 2TDXA 2OCEA 5E20A 1K4TA 2L5QA 1LE8B 5K7FA 3CP8A 5F6FA 5B1BH 2Y48A 4EVIA 4L0YB 4ZYDA 1IRXA 3EYYA 3H5AA 2E34A 3IUOA 3CUQB 2EFNA 3GFIA 2K3PA 1LKXA 2DK8A 1FTTA 4EGZA 1OR7A 1TT0A 1WJBA 1KQ9A 5E1WA 4CDGA 4AC0A 3N4MA 1RESA 2K02A 3LSPA 2R3SA 2Y9YA 2Z3YA 4B4CA 4U7BA 1VTNC 1C0WA 3K1PA 1EF4A 2XKPA 2OBPA 2CV2A 2ZC2A 1QPIA 2DT5A 3I54A 3R0AA 5CVIA 1LVAA 3P5JA 3HOSA 1YTYA 2VBWA 4G6DA 3NWSA 4E70A 1F5TA 1UFMA 2XSDC 1LFUP 2MG4A 1SMTA 3DEUA 1RIOH 2X4HA 2KQRA 2YR2A 3QU3A 2JTVA 5FKNA 4R79A 1O7FA 1WQ2A 3BWGA 2ZMEA 2NS8A 3ZRGA 4RAZA 1ETKA 1D3YA 4CICA 1QGPA 2H09A 2KRFA 1D1CA 2M3AA 1E3HA 2DFHA 5DV5A 3SHFA 3NRVA 2D45A 4N0BA 4YIRX 1MJBA 3VOEA 2A6EF 3ZQQA 4C3JJ 1X1AA 1DPRA 3JSPA 4LLGF 1P4WA 1U8BA 4RAFA 2EJRA 1F36A 2FXAA 2M0CA 3EUHC 4AD9A 5HLTA 2HR3A 4E7LA 5FKOA 1FBQA 2H1KA 2R5ZB 3S3NA 1XMAA 2IT0A 2NS0A 1NH3A 1WGXA 3G3ZA 4U0VA 1B59A 3HL2A 3EYIA 2CFOA 4X0GA 5J3LA 5LFAA 2V9PA 3DBRB 3LL7A 1ETOA 2L2OA 4I7HA 4OMYA 1R1VA 1RKTA 4HLXA 3DKXA 2DLLA 1IRZA 1SC7A 5LEJA 4HNUA 2DFEA 1LFBA 2LVSA 2LKPA 4FE7A 5F27A 1MZBA 3BDDA 4JK1X 2Y75A 2FMYA 1R5GA 1WKMA 4XSXF 1RR7A 1SAUA 2VIXA 2QSHX 2JVGA 3HOVJ 1KU7A 1R5HA 5FRMA 1IG7A 4ESFA 4M3GA 2F4IA 1XX5A 1Z05A 4OAZA 2JA6J 2R7DA 5IOZA 1ZKGA 2E1OA 1GLNA 2KRCA 4NB5A 4BEHA 3E5QA 2ZCWA 2P7CB 1EH7A 1X1BA 1U5TB 1D0XA 3RKWA 3ABLH 2JA8J 3M4OJ 5CJ9A 1SMYF 1TWGJ 3V8LA 1Z7LA 3LSIA 5D8KB 1ZR4A 4YELA 2QA4I 5EEGA 2P4WA 2XAQA 2AXTC 2LF8A 5F64A 4N4OB 5D5WB 3CO7C 2FE3A 2NVTJ 2JT1A 3CLOA 2B7EA 1MJ9A 2GXGA 2NVXJ 1Z9CA 1PVEA 3KP2A 4QWQA 4W97A 3H92A 1RI7A 1K61A 2LD5A 1SFXA 1YI2I 4DBQA 3ABKH 4CXFA 3A4CA 1KQ0A 1WCMJ 2W00A 1KA8A 3IKVA 3KYCB 4L5IA 2YX4A 1IN8A 4IF4A 3IH3A 4P96A 3JTGA 3FM5A 2O7OA 4EGYA 2G7HA 3OYFA 2NYXA 2EIMH 1WZ2A 3K70D 1KQ8A 2QKMB 1UHWA 4UUVA 2UUZA 2JMWA 2J5OA 3AL0B 1I6XA 4IHSA 2BGCA 2DA1A 1IRFA 1OCRH 3JREA 2BVMA 1R58A 3OYIA 3Q0WA 5KAFC 5IYCJ 2GOMA 4UUTA 5F1RA 4U7DA 4A3IJ 1MNMC 4MTEA 1H8AC 2HOTA 5ILSA 1O3RA 4D0PA 3WTVC 1XS9A 4M3BA 5FLXZ 2VOPA 3GTJJ 4XKWA 1YJNI 1OCPA 3HGGA 5K5OA 3LFKA 3FXLA 1A04A 1Z0XA 4P9UA 2DOAA 3MZHA 3GTGJ 3JR9A 1ENHA 3S32A 5HVQC 3GW2A 3NQOA 3DFGA 1MMGA 1R22A 2ME0A 2R7WA 1V55H 3E5XA 2W84A 2E2JJ 1DP7P 4IRIA 1DU6A 3HB9A 2E1CA 2YUSA 1S7AA 2A68F 4DQ2A 1FBSA 2E2HJ 2CV1A 2ISZA 2R7XA 1Y0NA 1ZREA 3K1MA 1OYIA 1WJFA 3ECHA 2O0YA 4A3GJ 4YIIA 1EKEA 3RKYA 4IHWA 1APLC 5IYDJ 2DMQA 4FHTA 4B43A 1WPKA 3OYNA 5GPAA 3MWMA 5CVRA 5FKLA 1MSFC 1D5VA 2VI6A 5IT9Z 3QPSA 2HPIA 3DQVC 2IJLA 3VB2A 1MH3A 1YYVA 3I4MJ 4UB6C 4GO1A 1X3ZB 3F22A 2A3SA 4HF1A 2JSCA 1REPC 2IGKA 5EJCA 3RYPA 5DM6F 2DMTA 4IPAA 3MZYA 1UB9A 3ABMH 5HS8A 3HOUJ 4XMYA 3Q0VA 5HOOA 2FBKA 4Q47A 2RV8A 3OOPA 2L9NA 4JP0A 3PFYA 2A5WA 2QENA 4IRGA 4IZZA 4HNVA 5L3GA 2WAFA 4CHUA 2IXSA 2UXXA 1EV7A 3BCAA 1JKPC 1YFHA 1QU3A 3V4GA 2MSYA 4PFPA 2VB6A 1U2WA 2EPFA 4NQWB 4J00A 5DD8A 2D1VA 2BY0A 1T0FA 4PSXA 3OMYA 2O6GE 2V4JC 3H9GA 2XGEA 2DOEA 1LEAA 1VQ9I 4D5CA 3E6CC 4AVPA 4RM3A 2KZGA 1MD0A 5ED4A 1ZYRF 2L4AA 3FXMA 2KIQA 3BQZA 3FBIB 1IUFA 3SQNA 3I4NJ 1D0ZA 2HQRA 2Y30A 2DMUA 3HBLA 2XVCA 3KPHA 3BOQA 3AL0C 4RB2C 3J81K 1T2KA 1ZGJA 3ZQ7A 3C18A 3N05A 4A2UA 5HDKA 2D1HA 2JJ7A 2VASA 3BR2A 2XPWA 2M8GX 1I3AA 1XDSA 2CW8A 4XORA 2IS4A 4EJWA 3BR3A 1DDNA 4M6VA 1MBGA 1X3WB 3GBGA 3L2RA 2EQRA 2KT0A 4XKBA 5HODA 3HSEA 5EZHA 3JRDA 4PZJA 3F3XA 4G7HF 4IHYA 1T6SA 4HOBA 1IO2A 1Z6TA 1TWAJ 5FJ8J 1VF9A 3RQ4A 1TZLA 2D2WA 1HLVA 3PJRA 3BPVA 3V8JA 1SFUA 2MC3A 1TW3A 5L3DA 1POGA 5TGTA 5EG0A 3JRFA 4EM0B 2K4JA 3EQLF 1JJ6C 2B9SA 1P7JA 2XPUA 1XMXA 3DWLE 4JX6A 3U21A 2KFDA 4EJVA 2GBYA 1B72B 3TW7A 2JRTA 4IX7A 4F3QA 4U0WA 3RKQA 1B1BA 4GRIA 1MKMA 1MBEA 4OAYA 1WVRA 3CMMA 2HYFA 3BZCA 3SEZA 3WE2A 1KYWA 2JVHA 1MH4A 2DDBA 1BN5A 1ORKA 1YHQI 1DPUA 4WXDA 4OIRF 3HOZJ 3C2HA 4CSWA 1RKWA 4XKCA 3TOAA 4DYRA 3J7ZI 2YU3A 1MGTA 1N77A 2LF7A 3I0TA 4L9NA 4CCJA 4CO8A 1ZN2A 4A0ZA 3QOEA 1SD6A 5HS9A 2L7ZA 1MDMA 2BHYA 2OTJI 1BI0A 2LY2A 2FEZA 3IL2A 3PUBA 2VBYA 3U2RA 3HOTA 1XGMA 1IN4A 3CCMI 3LAPA 4HG2A 1JUSA 4Q5SF 1W7PB 3H9JA 1FTZA 3JRHA 2DI3A 5K5RA 1M1EB 3Q3SA 2Z5UA 4P1WA 4DBRA 4RAGA 1FIAA 2CWEA 3M8FA 1X1CA 5B1AH 3C3WA 2E1MB 2VT3A 3H5NA 4CCNA 2L9SA 2Z1DA 4LK1F 1H88C 5LHHA 2DO7A 4BH9A 2KHMA 3A01A 2F4MB 1PJRA 2HVSA 2Y0MA 1PP8F 4AWXB 2OAZA 1IDYA 1J2XA 2K40A 1VQOI 1Y1VJ 2M30A 1IN6A 2VKEA 3IRRA 5J4YA 1DP3A 2LC2A 4P5OA 2LY9A 4DIQA 2RNJA 1LUJB 3QWLA 3K4KA 2R0QC 1T95A 3HTUA 3GTQJ 1WFXA 3LSGA 5E18F 5CKTA 4FTHA 2MBFA 2KKOA 3H5RA 3EUHA 5DYMA 4CCOA 4MGRA 3LSMA 1VQNI 1ZHFA 3BR6A 2QWWA 5FD6A 5M3FJ 2C6YA 4BXUA 3BZKA 1DGWY 2HKXA 1Y8RB 4PK4A 4X6AJ 3E6MA 1WSUA 1HQCA 4KFCA 2VJJA 4OOIA 4UUSA 4Y15A 2LLKA 2ZSHB 2PMHA 2HS5A 3CCRI 1HOMA 3R61A 3FKJA 2QQ9A 2O5RA 3P9KA 1N75A 4BEHB 3V7SA 2QEXI 2XV4S 2XRLA 3S2HJ 3KCCA 2STTA 2X6YA 3DTKA 1S3JA 2D5VA 1ZRCA 2RNGA 4BS9A 4PUSA 2L54A 5D8LB 4BJTA 1UAAA 4XRSG 1L3LA 4HF2A 2H27A 2F48A 2OUMA 2AQEA 3C2GA 4A3KJ 4MO7A 3RPUA 4GXOA 1OQYA 2PLYA 4GDFA 4B1RA 4JYKA 2F5EA 4ZYEA 2CUZA 2EZKA 3MZ8A 3AAFA 1P4XA 5FGMA 4OIQF 4HLYA 5AIPA 1WH5A 3K4LA 3S17J 4RM2A 4I76A 4ZDPA 2BXZA 5DS9A 4KICA 3RSNA 3PSIA 4LITA 1GXPA 4UHTA 3PNTA 4LJZF 4KIBA 4ENNA 5HLGA 1ZH5A 5CVJA 1I1GA 4UNOA 5FLMJ 1F9NA 2GQQA 2I8DA 3GYHX 4A5MA 2FA5A 2X0LA 1QNTA 3GF2A 1S7OA 1IXSB 4DYQA 1HDPA 1QVUA 3AG4H 5TRDA 3W2AA 3DKYA 4Y13A 2KDOA 4ZYHA 2VL8A 2XF7A 4M73A 3WTYC 5K7HA 3K4MA 3PNVA 2V9VA 4OINF 4BDZA 3ZQHA 3ZPLA 4C30A 1QZZA 2HQAA 3S1RJ 4BXXJ 2P8TA 4RA2A 3KYLA 4E7IA 3RPUD 1H89C 5JHUA 3CC2I 1X1DA 3TO6A 3BR1A 4I2OA 2XGCA 4YRVA 2BW3B 1D8KA 3ZQGA 3QQAA 3KZZA 4LG3A 1UG2A 3UR3C 3DPTA 3D5RC 2IGNA 3FMSA 3W2WA 4XLPF 2BEOA 4A3LJ 1E17A 5C4JJ 2EILH 1NHAA 1Z3XA 3VODA 1IRGA 1VFCA 1XGSA 3SFZA 4KT5C 1FOKA 3WGHA 4ZZDA 2R4GA 1D1AA 2VE9A 4A3FJ 1KU2A 1TQPA 3HKZN 3ULQB 1OCOH 3I3LA 4C3IJ 4D5FA 2ELKA 4B48A 4ZZLA 1ETWA 3WTXC 1X19A 2Q0OA 3OSFA 1OJLA 2ZKZA 5DD4A 2XDVA 3B6CA 3PL8A 1KZHA 4HX4A 4A0XA 2JUCA 3C7JA 4WWCA 4NHJA 2WAQN 1B4AA 1JGGA 2KRHA 1FMVA 4O6JA 4EJTA 5GP9A
chains in the Genus database with same CATH topology
3EUHC 4PJLA 5HLTA 2MYSA 2Y0SA 3D5SC 4E7LA 2HZDA 3RCOA 2IS1A 1D0YA 3S3NA 2AQFA 3M8JA 2CMPA 2X51A 3TMOA 3CJRB 1MW7A 1Z3YA 3HL2A 2VQCA 2CH0A 2CFOA 2BVLA 3FHNA 3I9V2 4X0GA 5LFAA 3LL7A 2P0WA 2PMZA 3VDXA 3AFHA 2L2OA 3MMYB 4AU7A 2KP6A 3DKXA 3DLAA 4QPOA 3VYSB 3H35A 2DCEA 4HNUA 2ZFUA 3HC7A 1WJCA 1D1BA 2KL4A 2X1DA 1NG7A 1SFKA 1YX3A 2NOJB 2Q1ZB 4ANJA 4XOPA 2VQGA 4BACA 2R7SA 2MFZA 4XQFA 2IS2A 1SAUA 2VIXA 2JVGA 2DT6A 2X1CA 3TBIA 1WJDA 3UNGC 5FRMA 2JUGA 4KISA 1JI8A 4B3XA 3OWTA 2M7AA 3K4JA 2F4IA 4G6TB 4OAZA 2R7QA 1GLNA 2KRCA 4BEHA 2WB1A 2R7VA 1X1BA 1D0XA 1LFPA 3SDBA 3ONQA 4HNTA 2A6TA 3AKZA 1NG6A 1Z7LA 3LSIA 3HUGB 4YELA 4EATA 3MD2A 2HNHA 4N4OB 3VSKA 2X6WA 3IP4B 4RLFA 2HVRA 2MD0A 2VXZA 2HVQA 2R7OA 4HRIA 4E4HA 4XL9A 4HEA2 4XLFA 2JSPA 4DBQA 1X4PA 3LFUA 4HPQA 3A4CA 1DGRM 1OR7C 3CZ6A 2BW3A 2W00A 2XSJC 3LMMA 4BUPA 4F92B 2K9LA 2IS6A 3OR2C 3IAM2 2FUG2 3OYFA 2KZVA 3A1YA 4ZDLA 2DT7B 2E1MC 3K70D 2QKMB 4FETA 2XC7A 1Z21A 2UUZA 3QODA 3VSLA 2W7NA 3AL0B 3OOUA 4BXFA 3DPLC 1YX5A 2BVMA 4RLQA 3VYRB 3OYIA 4NUBA 3DTIA 4D1QA 2LBFA 2GOMA 2VLAA 2V1NA 4E7ZA 1BR1A 2X6XA 3PSFA 4XKWA 1UELB 2WY7Q 1ZELA 2MABA 2DOAA 3CP2A 2CS3A 3BC8A 1R6RA 4CUGA 4II2A 3S32A 5HVQC 2WADA 4NC8A 4ZTJA 4PFOA 1MMGA 2LBFB 1WJEA 2R7WA 4BQOA 3MKWB 4CH7A 2VKDA 5KHDA 3SEQA 4C9YA 4B47A 4ZC3A 3HXLA 4XLAA 2PJRB 2DJIA 2CV1A 3MKYB 2R7XA 2Z16A 1WJFA 5FRNA 4LIVA 4XONA 1MMNA 4B43A 4F52A 4BL0B 1G59A 3OYNA 4ZTFA 2HPIA 3CESA 3DQVC 3OYCA 1DQUA 1QHHD 1KONA 1V5GA 2VQLA 5JHFA 1QHGA 2IGKA 4RMNA 4XMYA 3DU6A 5HOOA 2VQHA 3OYMA 5HNFA 2L9NA 3S93A 3QYBA 3PFYA 1YE9A 2A5WA 3H0DA 2R7UA 4N4NB 3LSKA 3OS2A 4IZZA 2VKHA 2WAFA 2IXSA 3BCAA 3VYTB 3K70C 1QU3A 2RQQA 4B44A 4DGWB 4PFPA 2VB6A 4J00A 4NQWB 4BJ6C 5CQEA 4PSXA 3K4BA 1V5FA 3OMYA 2RREA 3BCBA 4II3A 1BR2A 2V4JC 3H9GA 2E5ZA 4RM3A 2LY1A 3V42A 1X4OA 3FDYA 2CV0A 3FBIB 3HKZA 3OY9A 1D0ZA 3AL0C 3E0JB 4LIUA 3OL3A 4Y33A 2XF6A 3N05A 4BE2A 5KNLA 2VASA 2KMUA 2CW8A 4XR6A 2WAQA 3OYLA 3DTEA 3HPHA 4XORA 2WBMA 2M0MA 2IS4A 3DPUA 1ERDA 3TL4X 2W4SA 2GOXB 2ZSIB 3GBGA 3L2RA 1P9QC 4XKBA 1MMAA 2HPMA 4E6KG 3L2WA 4PJJA 3L2QA 3A2KA 4ITVA 3S3MA 1MMDA 3RQ4A 1TZLA 3M1CA 3PJRA 2K9MA 1WJAA 2ZXHA 2V7FA 3BG6A 2DXIA 3W3CA 2V9KA 2CUJA 5TGTA 1VZ0A 2VXDA 3K4CA 3EPZA 3EUKL 1V5EA 3DWLE 4KJZA 2V6EA 4ZDOA 1MNDA 3U21A 4F55A 2WY8Q 3SZGA 5FROA 2IGMA 1G8XA 1AA7A 4IX7A 2L7KA 4F3QA 4XM3A 4GRIA 2LREA 4XLHA 4H4KC 4OAYA 3CMMA 4XLEA 3SEZA 2JVHA 2CW7A 3OYEA 2MC4A 4BE1A 2PJRA 2HU9A 4BQNA 3C2HA 3K6GA 4AYBA 4CSWA 4XKCA 3L2VA 2VJ5A 3BG7A 2LOOA 4HSTA 4XLCA 1N77A 2W1OA 3W2VA 4CCJA 3ZGKA 2K5CA 4KT6A 4CZCA 2QKLB 2F5VA 4F91B 3QOEA 3OYJA 2HDWA 2LY2A 4CCKA 1K6YA 2Z2SB 1MNEA 4NNJA 1Y6IA 3PUBA 2KPMA 4IQ4A 2JA2A 3HOTA 3HPGA 4ZYAA 4HG2A 3H9JA 3OYHA 2XAUA 4P1WA 4DBRA 3MKZA 1W36D 1X1CA 3ZXSA 3QYFA 1LVKA 2E1MB 3H5NA 3KEYA 4CCNA 2L9SA 2V26A 2Z1DA 2LYCA 3F9KA 4FASD 3L2UA 2KHMA 3SYTA 3OR1C 2HVSA 1PJRA 3PNYA 3OYGA 3S8PA 3OYDA 1Y56A 3OIQA 4E7JA 4KITB 1DP3A 2LC2A 4BJ5C 4P5OA 4E7HA 4DIQA 2IGOA 4BU2A 4HSRA 4D9JA 2VPLA 2R7RA 4AVZA 3K4KA 1T95A 2W82A 1T0FC 4PJNA 1WFXA 3LSGA 4CCMA 4MLOA 5CKTA 3H5RA 2M7BA 4BE0A 4CCOA 4XN0A 3OS1A 2LG4A 2OV7A 3LSMA 4XN3A 3OS0A 4J01A 1DGWY 1E0EA 4Y4RA 4PK4A 2F6CA 3ZR8X 3HG9A 1LDKB 2VJJA 4C2UA 4XKVA 2ZSHB 3EUAA 4PSWA 3G2BA 2LRDA 1U0JA 3K4NA 3FKJA 2O5RA 3ZCOA 2ELJA 1N75A 2X85A 3S3OA 3K10A 1WJ5A 4YEJA 2X6YA 2BOLA 3DU5A 3DTKA 3H9QA 2RNGA 4BS9A 1BOBA 4PUSA 3RTRA 4BJTA 2VJIA 1UAAA 2OUMA 2AQEA 3C2GA 5LD2C 2M4GA 3KX2A 2WA0A 4JOMA 4Y3OA 2CUZA 4U87A 4CCLA 2UWMA 3LSHA 3DEEA 4XNFA 4IKFA 3K4LA 4F93B 4RM2A 4ZDPA 1W36C 3VYUB 4BEHB 1EA3A 2XF5A 3RSNA 3OYBA 3CJQB 3PSIA 2WAEA 4LITA 3PNTA 3NWTA 1OLTA 2UV1A 1UG0A 3IAS2 3D5LA 5KCMA 2E5NA 2I8DA 3OIPA 4CA0A 4JQFA 2L5QA 3CP8A 4XOTA 4BDYA 3W2AA 3DKYA 2KDOA 1IRXA 2LH9A 2M4KA 2VL8A 2KLOA 3H5AA 3IUOA 4IQJA 2XF7A 2K3PA 1LKXA 1FMWA 5CQGA 1WJBA 1TT0A 1J09A 3K4MA 3PNVA 4BQQA 4E7KA 4DOZA 4BDZA 4C30A 2HQAA 4E7IA 3KYLA 3FBNB 3RPUD 1HA8A 3VWBA 1X1DA 4U7BA 4YRVA 2BW3B 3QYEA 2CV2A 5CPRB 4LG3A 3BLYA 3E1SA 2ZXIA 3DPTA 3UR3C 3HOSA 3NWSA 4OWRB 3D5RC 2IGNA 5HNHA 3W2WA 3OL4A 2E60A 1Z3XA 3CF2A 3J7AY 4ZJZA 4C2TA 4BGDA 2R4GA 4NC7A 4QPQA 1D1AA 2KQRA 3I3LA 4R79A 4B48A 1N78A 1BR4A 2OC6A 1X19A 3ZRGA 1PYVA 4E7SA 2XDVA 1D1CA 2M3AA 2X1EA 3PL8A 3OYAA 2Q2EB 2R7TA 3OYKA 1S9HA 3ZQQA 4DJAA 2KRHA 1FMVA 1X1AA 2VJ4A 4PJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRG A; 
#chains in the Genus database with same CATH topology
 1FP2 A;  1KGS A;  3CDI A;  1MSE C;  2FNP A;  2XAG A;  3KYD B;  4PJL A;  2HI3 A;  1ODD A;  2JQ7 A;  3JRA A;  4LLN A;  5ERI A;  1D0Y A;  2FD5 A;  2M8E A;  1MJA A;  3GVA A;  1YS6 A;  1TW2 A;  2AQF A;  3BTJ A;  3TMO A;  2X51 A;  4XRM A;  3FHZ A;  1Z3Y A;  2VQC A;  3CD6 I;  1NK2 P;  3FHN A;  4EQQ A;  1G3S A;  1WRJ A;  2QQA A;  4UB8 C;  4RGU A;  2M45 A;  2PMZ A;  3AFH A;  3VDX A;  4FE4 A;  4A3E J;  4KMF A;  1YJW I;  4AIJ A;  2KP6 A;  4FQG A;  4QPO A;  1Z1D A;  3HYI A;  5ICG A;  1T38 A;  3GFL A;  3HC7 A;  1D1B A;  1R9T J;  2H1L A;  4G7O F;  1SFK A;  1R1U A;  1YX3 A;  2L3D A;  5JI6 A;  3JRI A;  1U8R A;  4BAC A;  2MFZ A;  5D5X B;  3X2Q H;  1VQM I;  1YIO A;  2R7Z J;  1TP4 A;  2E36 A;  3A0B C;  3LSJ A;  2JUG A;  2PX9 A;  1SFO J;  3OWT A;  1JI8 A;  4G6T B;  3F8M A;  2ADU A;  4GFB A;  2ACJ A;  4DZP A;  5J8C A;  1P2F A;  2EZI A;  4DYC A;  2FNA A;  2Q8K A;  1T08 B;  3ONQ A;  2A6T A;  2RQP A;  2M2E A;  4CYC A;  2L02 A;  1NG6 A;  2Z33 A;  3FXK A;  3HUG B;  5DTD A;  5ILV A;  2HNH A;  1LDJ A;  1HST A;  3PQK A;  2DOF A;  4LMY A;  2H8W A;  3BQY A;  3VSK A;  3GZ5 A;  2GIV A;  2X6W A;  3IP4 B;  3DBL B;  2DFF A;  3RZO J;  2HVR A;  3CLQ A;  2VXZ A;  2HVQ A;  4RBO A;  2P81 A;  5KAI C;  2W25 A;  5FB2 A;  3KP4 A;  3F8N A;  3T1B A;  5J40 A;  4HPQ A;  1B9M A;  1O3T A;  1PP7 U;  4BUP A;  1UMQ A;  2DOD A;  3IAM 2;  3HEF A;  1J75 A;  2IS6 A;  2VC1 A;  2FUG 2;  1MBF A;  3ZN0 A;  1G2H A;  5H6R A;  2L01 A;  2M1B A;  1TC3 C;  1W5C C;  3S1N J;  2XC7 A;  3UKG A;  2GXA A;  3QRF F;  3QOD A;  2W7N A;  1P4A A;  3BY6 A;  3M1E A;  4BXF A;  1BIB A;  3DPL C;  3RDI A;  1D8J A;  1HKT A;  1YX5 A;  4H0E A;  4RLQ A;  4NBQ A;  3VYR B;  5LRS A;  2ZO4 A;  4D1Q A;  2ZFW A;  3SXY A;  3FXR A;  2VLA A;  3ZQC A;  5F1J A;  1SVM A;  2QYO A;  5EEA A;  4IHV A;  2Q2E A;  3D0S A;  3COA C;  2PI0 A;  3KLO A;  3I5U A;  3PSF A;  1E2X A;  5LLQ A;  1UEL B;  2DQR A;  1ZEL A;  3ZOB A;  3WTW C;  4GYG A;  3ZMZ A;  3CP2 A;  4II2 A;  1V3F A;  5E3L A;  5DM7 F;  4PFO A;  2ZJ2 A;  2LBF B;  2ZNZ A;  2A6H F;  4CH7 A;  1V4R A;  2VKD A;  2QZ8 A;  2E19 A;  3IWZ A;  4HQM A;  3R6S A;  4C9Y A;  5GTH C;  5KHD A;  3QPH A;  4ZC3 A;  4TV7 A;  1SAN A;  1AWC A;  1I50 J;  2DYR H;  2RVC A;  2M5W A;  3HXL A;  4XLA A;  2LTP A;  3RZD J;  2PJR B;  2LKS A;  2HOE A;  4HDU A;  3CC7 I;  2QM3 A;  3OIO A;  5EF6 A;  3DP7 A;  3K69 A;  1R7J A;  2HGC A;  5FRN A;  1S5L C;  3K2A A;  1MIJ A;  2V6C A;  3ZQL A;  3CES A;  3FIS A;  4MEY F;  1DQU A;  1QHH D;  1KON A;  2EWN A;  5JHF A;  1QPM A;  1VQ5 I;  5BMZ A;  2V1X A;  3PIP F;  3E97 A;  1HW5 A;  3CMY A;  1Z91 A;  3DBH B;  1LB2 A;  4Y7N J;  5E79 C;  2DPU A;  3S14 J;  2UXN A;  1H0M A;  2P7V B;  1J7K A;  1BIA A;  3S93 A;  1SEU A;  2MGQ A;  1YW9 A;  1YE9 A;  2IPQ X;  3JRB A;  2R7U A;  3BTL A;  4BNC A;  2L7F P;  3LSK A;  3M7G A;  2YPR A;  3NAU A;  3F8B A;  2VKH A;  2K9Q A;  4RGR A;  3CCL I;  2MH9 A;  4IOC F;  1XCV A;  1I1S A;  1X58 A;  3MCZ A;  3F8C A;  4CGZ A;  5IP6 A;  1U9O A;  2LFB A;  1XG1 A;  5FFZ A;  5K5Q A;  2O03 A;  4KN7 X;  3P9C A;  2UZK A;  3CUQ C;  3BG5 A;  2LY1 A;  3V42 A;  1ETX A;  3FDY A;  3E6D A;  1R23 A;  1X2N A;  3R4K A;  2CV0 A;  3HRM A;  3HKZ A;  3OY9 A;  3OV8 A;  4OIP F;  5D4R A;  3S2D J;  5H6Q A;  4XLN F;  5BPI A;  1YG2 A;  1XSD A;  2F5D A;  2YX7 A;  4FX0 A;  1JJ8 C;  3GLX A;  2EH3 A;  4DZJ A;  2WAQ A;  3DTE A;  2BY3 A;  2M0M A;  1O7L A;  1F1Z A;  3DPU A;  2DW4 A;  5J1Y A;  2XHK A;  1ERD A;  2X48 A;  3TL4 X;  1BL0 A;  2GA2 A;  1XD7 A;  1YRN A;  3WGG A;  1P9Q C;  2DDA A;  3LNQ A;  2KJB A;  2CQK A;  3T5X A;  3L2C A;  4P9F A;  2HPM A;  1GUU A;  3BJA A;  3J81 Z;  1SD4 A;  5HLI A;  1QQI A;  3L2Q A;  2HTS A;  2DA6 A;  3BG9 A;  3S3M A;  1MMD A;  3M1C A;  4FX4 A;  1PDN C;  2XAH A;  3GFJ A;  2DPD A;  2Y31 A;  2ZXH A;  2V9K A;  4BY7 J;  3HHG A;  5CVV A;  3U9G A;  4MEX F;  1B8I A;  1CGP A;  5CYV A;  4KJZ A;  2V6E A;  5IYB J;  1FOY A;  1Z6R A;  1QA6 A;  5FRO A;  2STW A;  2CYY A;  3FM3 A;  3IRQ A;  1AA7 A;  3CMA I;  3TDZ C;  5J47 A;  4HQE A;  3QAH A;  4OU0 A;  3LAJ A;  4A93 J;  2H6B A;  2MH2 A;  5E3O A;  3F72 A;  5GTI C;  1KYZ A;  2M9H A;  4DW6 A;  2TRT A;  5IPA A;  1SVL A;  4XBF A;  3AG1 H;  4LOC A;  4BQN A;  1G3T A;  1ZGW A;  2O61 A;  2VC0 A;  2GM4 A;  3L2V A;  2VJ5 A;  3BG7 A;  4HST A;  2HWV A;  4DNC A;  2W1O A;  3SDG A;  2PFB A;  4CZC A;  2CO5 A;  4XK4 A;  3VFZ A;  5DUK A;  1OMI A;  3OYJ A;  5BOX A;  3GXO A;  1K6Y A;  1TNT A;  1MNE A;  1R36 A;  1U78 A;  4QLC U;  2RAE A;  1BW5 A;  3ISP A;  3HPG A;  3KP3 A;  4RDU A;  5J4V A;  3LA7 A;  3NEU A;  3BTC A;  3WTT C;  3MKZ A;  2P5K A;  3DEW A;  3QYF A;  3ZXS A;  3KEY A;  2KJC A;  4WX9 A;  2ZJQ F;  1SD7 A;  3IH2 A;  3ZMD A;  2FBH A;  1TNS A;  1VI0 A;  3L2U A;  3OR1 C;  1U5T C;  3VEP A;  4S04 A;  3S8P A;  4WCG A;  3CO6 C;  1Y56 A;  1NTC A;  3OIQ A;  3B6A A;  4E7J A;  3HZJ A;  2XAS A;  5BNG A;  4S0H B;  4KIT B;  3CCJ I;  1IV6 A;  4BJ5 C;  1TWF J;  4E7H A;  2FOK A;  3G4S I;  3L9F A;  2EIK H;  3WU2 C;  4BU2 A;  2ZME B;  2R92 J;  4A6D A;  2DA4 A;  2VOO A;  2VPL A;  3M8E A;  1TLH B;  4AVZ A;  2W82 A;  3G71 I;  5AIQ A;  4MLO A;  3WU1 B;  1FOW A;  4MQ9 F;  4BKX A;  1Q1V A;  2EV6 A;  2VUM J;  4M72 A;  2M7B A;  2E7X A;  4BE0 A;  3S16 J;  4XN0 A;  4BHP A;  2OV7 A;  1S29 A;  3H36 A;  3OS0 A;  1AKH A;  4Y4R A;  2XGD A;  2F6C A;  3IHU A;  2ME6 A;  4JX5 A;  1JT0 A;  1CF7 A;  1LDK B;  3O6B B;  5B5E C;  4XKV A;  3A0H C;  3EUA A;  3G2B A;  2LRD A;  1VQ7 I;  1W5T A;  3K4N A;  1HW1 A;  3ZCO A;  5FKM A;  1RUO A;  2ELJ A;  5IP9 J;  4EEF G;  3S3O A;  3M3Y J;  2EFW A;  5J6X A;  3IV5 A;  3GTO J;  1R49 A;  3DU5 A;  2BOL A;  3H9Q A;  1IDZ A;  2QQB A;  2KDZ A;  3BTI A;  3MN2 A;  1IC8 A;  5EGO A;  4LB5 A;  1GT0 C;  1HF0 A;  3ZQF A;  2XGX A;  2A05 A;  5E1X A;  4OIO F;  3LQQ A;  4JOM A;  1ZLJ A;  3ZMT A;  5M3M J;  2UWM A;  3LSH A;  3DEE A;  3G1L A;  1MMS A;  2OA4 A;  1BJZ A;  1QZY A;  2EIN H;  5K1Y A;  2QBY A;  2ZJP F;  4UVB A;  4A5N A;  3BPX A;  1Z67 A;  3FK6 A;  5FFX A;  1EA3 A;  1JHH A;  2XF5 A;  4G12 A;  3CJQ B;  2CUF A;  4Q48 A;  5HDG A;  2DQL A;  1K78 A;  1I3Q J;  3U1K A;  1ETY A;  1V54 H;  1QBJ A;  2PMZ N;  2E5N A;  3E3V A;  4JQF A;  1G3W A;  4XOT A;  3QPT A;  4BDY A;  5F08 A;  1CQT A;  2KLO A;  2K4B A;  2JZY A;  1PUF A;  4KIF A;  3O2P E;  4LB6 B;  3CCV I;  4KN4 X;  1K79 A;  3F0C A;  4GYI A;  2COM A;  1FMW A;  3RKX A;  3TO9 A;  5GAE J;  2WV0 A;  4BQQ A;  1J09 A;  5M5X J;  1USS A;  3BR5 A;  3H0G J;  3HIF A;  4DOZ A;  4BBR J;  3ASO H;  3F6O A;  3VYU B;  1R5I D;  2MLK A;  2M87 A;  2BE5 F;  1HA8 A;  3VWB A;  2FJ1 A;  5LBQ A;  4ENM A;  4U0Y A;  3BLY A;  3HOY J;  2ZXI A;  4HYE A;  4OWR B;  3W6J B;  3OL4 A;  2ZME C;  4IO9 F;  2P6S A;  2QCO A;  2E60 A;  4QIW N;  3FMR A;  4LG0 A;  4IOA F;  2ICW G;  1XMK A;  4ZJZ A;  4C2T A;  1ZAO A;  4NC7 A;  1DUX C;  5D4S A;  4CYD A;  2NS7 A;  2XAJ A;  3HJE A;  1ZRD A;  1N78 A;  2ZNY A;  5F0H A;  3BR0 A;  1PYV A;  4S05 A;  3CCU I;  4ETS A;  3PIO F;  1A36 A;  4LFU A;  4IRH A;  3LA3 A;  1S9H A;  4DJA A;  3S15 J;  1XN7 A;  1BOA A;  2R5Y A;  4A3D J;  5EEH A;  2XRN A;  1ZLK A;  3KP6 A;  1U3E M;  2MYS A;  4D7M A;  4PGG A;  3CCQ I;  1TWH J;  3TP3 A;  1XSX A;  4G7Z F;  2E2I J;  4UV9 A;  4M9X A;  4KUM A;  2CMP A;  4XRS A;  1RRJ A;  1OCC H;  1MW7 A;  3GCM A;  1HC8 A;  1JT6 A;  3P7N A;  1G3Y A;  2BVL A;  2ECC A;  3I9V 2;  2V79 A;  2HTJ A;  4HV6 A;  2P0W A;  2K86 A;  4AU7 A;  1A6Q A;  3DLA A;  2DCE A;  5CVU A;  3IKT A;  1WJC A;  2X1D A;  1NG7 A;  2NOJ B;  2ISY A;  9ANT A;  4A3J J;  3SZT A;  1ZTR A;  4XOP A;  2VQG A;  4LLL A;  1IJW C;  2OCC H;  3GTP J;  2DT6 A;  2X1C A;  4IEJ A;  4AYB N;  3TBI A;  1WJD A;  2K9N A;  3UNG C;  1BI2 A;  3KIO A;  4ABZ A;  3ERE D;  2FF4 A;  1A5J A;  1IV8 A;  4KIS A;  1HKQ A;  4B3X A;  4A0Y A;  2XPV A;  3K4J A;  5BS6 A;  3CUO A;  3RI4 A;  3O8H A;  2R7Q A;  2L0K A;  4HZF A;  3GX4 X;  3HDD A;  2HKO A;  1S8N A;  1G6N A;  2R7V A;  2E1N A;  3BT9 A;  1HW2 A;  3SDB A;  4AIK A;  2KIM A;  5H2F C;  3P9I A;  1O3S A;  1LE8 A;  3V7C A;  2CFX A;  3RPQ A;  5DUI A;  2YU9 J;  2FU4 A;  2GWR A;  2GLO A;  2OJE D;  3DKW A;  5IOY A;  1ZG1 A;  4RS8 A;  1FOX A;  2F2E A;  3CUQ A;  5JLW A;  1OFC X;  1JTX A;  4RLF A;  4HRI A;  2R7O A;  1E3P A;  4E4H A;  3CDH A;  1GDT A;  5E17 F;  2JSP A;  2JN6 A;  4QSH A;  3ROU A;  3LFU A;  1AHD P;  3WTU C;  1DGR M;  1A35 A;  1T98 A;  3CZ6 A;  3ELK A;  2HDC A;  5JLX A;  2DA2 A;  2YSR A;  4F92 B;  2K9L A;  1GV5 A;  3GWZ A;  3OR2 C;  2K9S A;  4L5J A;  3L1P A;  4Q4Z F;  2IRF G;  2EK5 A;  5LGU A;  3A1Y A;  2NVQ J;  2DT7 B;  2E1M C;  2VN2 A;  3G73 A;  1IUY A;  3LSR A;  3IH4 A;  2BZT A;  1Z21 A;  1RNL A;  3ERM A;  3LQR A;  3O8G A;  1FEX A;  3BRO A;  4ESB A;  2JPC A;  2DA3 A;  1FNN A;  1VND A;  3OOU A;  4O3M A;  1ZAR A;  2AO9 A;  2HXO A;  3GZ6 A;  1YOV B;  1JHF A;  3DTI A;  1JUM A;  2LBF A;  2LSO A;  5KVR A;  1U6G A;  3CC4 I;  3GTL J;  2H94 A;  1BR1 A;  1HBX G;  2X6X A;  2ESN A;  1RC9 A;  2JWT A;  1FPQ A;  4NC6 A;  5EG0 B;  2GAU A;  4CUG A;  2CS3 A;  1R6R A;  2VBX A;  1H9G A;  2WAD A;  5FLV A;  1YW8 A;  2R5Z A;  3WU0 A;  1ITY A;  1N25 A;  5D6F A;  3SEQ A;  3AG3 H;  1STZ A;  4I0A A;  4EM2 A;  1PUE E;  2O3F A;  3PO2 J;  1Z7U A;  3WGI A;  1VQ4 I;  1YIT I;  1W0T A;  2Z16 A;  2RDP A;  4YG2 F;  4YFX F;  3RQI A;  2Z9O A;  2QLZ A;  1FLI A;  4L18 B;  1X1P A;  1GHC A;  4F52 A;  1MDM B;  3N97 A;  1GVD A;  3HGY A;  2JA7 J;  4I98 B;  2IEK A;  2O8X A;  4X1E A;  3OYC A;  2J5P A;  4I99 C;  4XRF A;  5F0F A;  3I56 I;  1XGN A;  2L9V A;  4RGS A;  5D5V B;  3S1Q J;  2DA5 A;  1U5T A;  2VQH A;  1KU9 A;  3C2B A;  5LHI A;  1Y8Q B;  3K1N A;  5HNF A;  1OCZ H;  1XDU A;  2XUB A;  1F4K A;  1J9I A;  3QYB A;  3H0D A;  2IVM A;  3A01 B;  4N4N B;  3OS2 A;  2DK5 A;  3VYT B;  4UVC A;  1A31 A;  4DGW B;  4ESJ A;  1UST A;  1WI3 A;  3HRS A;  5F04 A;  5E3M A;  1IXR C;  4BJ6 C;  1L0O C;  3K9T A;  2EA2 A;  1V5F A;  2RRE A;  1QO0 D;  4II3 A;  4PGH A;  3FIW A;  2HOS A;  1FYM A;  4RGX A;  3F21 A;  1J59 A;  2CGP A;  1FSH A;  2BY2 A;  2IA1 A;  1W4M A;  4V2G A;  3Q9S A;  1W1W E;  3E0J B;  1R00 A;  4ENK A;  4KA4 A;  1MBJ A;  2WV1 A;  3OL3 A;  3V8K A;  2IAI A;  4Y33 A;  2XF6 A;  2OPT A;  5LGT A;  4WXH A;  2W48 A;  2KMU A;  1FYL A;  3OYL A;  5E8I A;  2H8R A;  3HPH A;  4PDK A;  4B8X A;  2EIJ H;  3IWF A;  3RJP A;  4J19 A;  5C4X J;  2GOX B;  2ZSI B;  2VPR A;  2IA2 A;  1MMA A;  1S7E A;  3K0L A;  2GIZ A;  2LP0 A;  2JA5 J;  1YLF A;  4PJJ A;  3FKI J;  3A2K A;  1GVJ A;  4ITV A;  2HXI A;  3J80 K;  2X6O A;  2ID6 A;  4FIS A;  2Y0S N;  4O5V A;  5LHG A;  2L9R A;  2K9M A;  1WJA A;  3BG6 A;  3L7W A;  2DXI A;  3W3C A;  2CUJ A;  4GCV A;  1VZ0 A;  2HZT A;  3TOB A;  2VXD A;  3F8F A;  2CU7 A;  3K4C A;  3LST A;  3EPZ A;  4FT8 A;  4ZDO A;  1MND A;  4F55 A;  1I39 A;  3H3U A;  3QU6 A;  5B3S H;  2WY8 Q;  3ABT A;  1EJ9 A;  3G1M A;  2LMD A;  1X3U A;  1YIJ I;  4XM3 A;  1OYW A;  5H20 A;  4C3H J;  2LRE A;  4JX4 A;  4XLH A;  3TED A;  1LEB A;  4H4K C;  2HYJ A;  1ZR2 A;  1WWX A;  4K2E A;  1OPC A;  2CG4 A;  5HS7 A;  4AM3 A;  3MEX A;  2KIU A;  3GTM J;  1JUP A;  2I10 A;  4BE1 A;  2COB A;  3PQJ A;  4AYB A;  3EET A;  2GXB A;  2EZL A;  2CSO A;  3ZGK A;  3H3V K;  2QKL B;  4LK0 F;  1X2M A;  4CCK A;  5E3N A;  2VBZ A;  4XSZ F;  1FYK A;  1TT5 B;  3E5U A;  2WB1 N;  1Y6I A;  2EV0 A;  2DMN A;  3K7A J;  3I59 B;  2JA2 A;  3R0J A;  4ZYA A;  4UY8 I;  1LJ9 A;  4ZH4 F;  2K85 A;  3FMQ A;  1JGS A;  3JAM K;  2BXY A;  1J0R A;  2KIF A;  4UVA A;  1S72 I;  4A3C J;  4JBA A;  3TW6 A;  2QUF A;  1XC5 A;  3MKL A;  3A03 A;  2DAO A;  1WH7 A;  2DYS H;  4MNU A;  2RC4 A;  3F9K A;  4FCY A;  3PNY A;  5DEQ A;  3OYG A;  3CJN A;  1B9N A;  3F6V A;  2ZB9 A;  3OYD A;  3BZ6 A;  4NQW A;  2EV5 A;  4W1U A;  1YO5 C;  2JK3 A;  1P92 A;  2ZBK A;  2WC2 A;  3ZN1 A;  1YQA A;  2IGO A;  1BI3 A;  3RYR A;  2QSG X;  2EFO A;  1R4N B;  3GZN B;  3JW4 A;  3IC7 A;  2R7R A;  2HDD A;  4CCM A;  2ID3 A;  2GA1 A;  5J1U A;  1B6A A;  2XRO A;  2A07 F;  2OD5 A;  4EJO A;  2LG4 A;  2FQ3 A;  3GUD A;  4R1H A;  1QRY A;  1Z77 A;  2MD5 A;  5ICE A;  2FQ4 A;  3ZR8 X;  2R93 J;  1FT9 A;  2P5V A;  3HG9 A;  3CCE I;  2DFI A;  5DCM B;  3VPR A;  4MIM A;  3ZMV A;  4PSW A;  4R8H A;  3HOW J;  2JRM A;  1U0J A;  4BBS J;  5J8F A;  4UXN A;  3I4P A;  2F5F A;  4M9S A;  2V1D A;  5L3F A;  3K10 A;  3DV8 A;  3L09 A;  4G94 A;  4MHG A;  4RB3 C;  4YIF A;  5DDG A;  4G8X A;  1BOB A;  3WTZ A;  1I6H J;  5A2Q K;  3RTR A;  6PAX A;  2VJI A;  2OZ6 A;  3M9A A;  1R4M B;  1B72 A;  3KX2 A;  4AIH A;  2ETH A;  1TBX A;  4U87 A;  4CCL A;  3J7Y J;  5JVG F;  1XB4 A;  3K2Z A;  1OKR A;  4XNF A;  2VOD A;  2Y69 H;  1MBK A;  2OU2 A;  2L7M P;  1XGO A;  5DCF A;  2FX0 A;  1TQI A;  4L9V A;  3W6K B;  4BHB A;  3ZP5 A;  1YW7 A;  1W36 C;  1KU3 A;  3RIR A;  2BYV E;  3HRT A;  5EZG A;  1OLT A;  4BAY A;  1UG0 A;  3IAS 2;  5KCM A;  4CA0 A;  3OIP A;  4CYC B;  1SD5 A;  1VQP I;  3ESW B;  3JRC A;  1RUN A;  3PO3 J;  3ZMS A;  2LH9 A;  2M4K A;  4MFD A;  3H1C A;  4P55 A;  3PM1 A;  4IQJ A;  2E7W A;  2QGU A;  5K7Z A;  4L5E A;  1ZG3 A;  3BG3 A;  1BM9 A;  3MQ0 A;  1Q1H A;  2G9W A;  4EV0 A;  4HDV A;  5CQG A;  4D7N A;  4E7K A;  2MA3 A;  1SAX A;  1ZQ3 P;  3BJO A;  2OTL I;  1W7P A;  2CQ7 A;  3V7R A;  4Z6Y A;  3FBN B;  4HBL A;  1JKR C;  1TL8 A;  2QF7 A;  1AU7 A;  4A12 A;  5LGN A;  3DLL F;  3QYE A;  3CME I;  1JTY A;  5CPR B;  3SJM A;  3E1S A;  2PN6 A;  5HNH A;  3ZMU A;  1YS7 A;  2BV6 A;  1K83 J;  4N9H A;  1D5Y A;  3FXO A;  1UZC A;  3PFI A;  2Y2Z A;  3CF2 A;  3J7A Y;  3KE2 A;  4BGD A;  4QPQ A;  2FBI A;  3F23 A;  4ASN A;  2XAF A;  1ZRF A;  2XB0 X;  3JRG A;  1BR4 A;  2OC6 A;  4A6E A;  5GAD J;  1K6O A;  4E7S A;  4I6Z A;  2X1E A;  4GGG A;  3WG9 A;  3OYA A;  2CJJ A;  2Q2E B;  2W57 A;  1W7P D;  4A3M J;  3OYK A;  2R7T A;  2A61 A;  4WXC A;  3TP0 A;  4XID A;  5C44 J;  2VJ4 A;  4PJM A;  4MFE A;  5TIS C;  4KDP A;  1IXC A;  1ON1 A;  2RKH A;  4NDL A;  3S2W A;  1LNW A;  2Y0S A;  2RN7 A;  3D5S C;  2HZD A;  5AON A;  3RCO A;  2IS1 A;  3L00 A;  2VON A;  3Q9V A;  4Z2Y A;  3MFK A;  3M8J A;  2AS5 F;  3CCS I;  4IL6 C;  3CJR B;  2K7L A;  3SFI A;  2CH0 A;  3KP7 A;  2ELH A;  1S6L A;  1SVO A;  3MMY B;  1TQM A;  2W24 A;  3KZY A;  3VYS B;  5LRR A;  5GAH J;  4AID A;  3H35 A;  1W5S A;  1IZ1 A;  3ABU A;  2IA0 A;  2ZFU A;  3MVP A;  3REO A;  2KL4 A;  1XTA A;  2Q1Z B;  3HSF A;  1XPX A;  2GZW A;  4ANJ A;  2IS2 A;  2R7S A;  4XQF A;  2H6C A;  2IP2 A;  1FX7 A;  2HFH A;  2F4O B;  2E71 A;  4U88 A;  5J1R A;  5JVT A;  2M7A A;  1EH6 A;  2YS9 A;  3KLN A;  2OF7 A;  4M3D A;  5E1Z B;  4M74 A;  2WB1 A;  2ECB A;  1ZK8 A;  3GEZ A;  2B63 J;  3QPL A;  3FXU A;  2KIS A;  3KET A;  4Y52 J;  4M6Y A;  1LFP A;  5M5W J;  4HNT A;  5GAG J;  3AKZ A;  1TWC J;  2IBD A;  1HKS A;  2A69 F;  4EAT A;  2PMU A;  3MD2 A;  3FWE A;  4ZYG A;  1GXQ A;  2DJN A;  4IHX A;  5FKK A;  1FIP A;  4ENJ A;  3LWF A;  3CCY A;  1ULY A;  2MD0 A;  2EFP A;  4XL9 A;  4HEA 2;  4XLF A;  1BW6 A;  1R71 A;  1X4P A;  1LPQ A;  1ETV A;  1I27 A;  1OR7 C;  2BW3 A;  2XSJ C;  3LMM A;  1G4D A;  2E35 A;  4AUX A;  2FOW A;  2VT2 A;  2DTR A;  1T39 A;  2OQG A;  1AOY A;  2G0E A;  4I0B A;  3NAR A;  2LK2 A;  2DBB A;  2ZJR F;  2KZV A;  4YFK F;  3J7A O;  5LEK A;  4ZDL A;  1IAW A;  2VKV A;  5FLX K;  2FSW A;  5FD5 A;  2NNY A;  4FET A;  1TTY A;  2NNN A;  4OMZ A;  3VSL A;  1H9T A;  3WTS C;  1I5Z A;  1FC3 A;  1YRN B;  2K27 A;  5L3C A;  2DTZ A;  4IJA A;  1IW7 F;  2PEX A;  3I64 A;  4NUB A;  1HXD A;  3WHB A;  5TJJ A;  4M3E A;  2LNB A;  5ICC A;  3ZQI A;  2L4M A;  2V1N A;  4PCQ A;  4EMS A;  4E7Z A;  3JSO A;  1JKQ C;  3TQN A;  1BC8 C;  3EDP A;  3R60 A;  3T8T A;  2ZXW H;  1OYY A;  2WY7 Q;  2MAB A;  5IT3 A;  3Q0U A;  2DN0 A;  3ECO A;  1B8I B;  3BC8 A;  2AXL A;  2QSF X;  2O9L A;  4HX7 A;  3C1D A;  4NC8 A;  4ZTJ A;  4RB0 A;  1IN7 A;  2EB7 A;  2WWY A;  1ETQ A;  5EYR A;  1JE8 A;  1WJE A;  2NVY J;  4BQO A;  3MKW B;  3I58 A;  3WOD F;  4G9Y A;  3OSG A;  1A6I A;  1DU0 A;  1VQL I;  4A3B J;  5IT9 K;  1VQK I;  4LGW A;  2LDU A;  4B47 A;  4BY1 J;  1U9N A;  3TDU C;  1XSV A;  1FZP B;  3HHH A;  1UJ8 A;  2DJI A;  3MKY B;  1YJ9 I;  3CJT B;  4HF0 A;  1FP1 D;  2CQQ A;  3WG7 H;  1P7I A;  3FF5 A;  4EJU A;  4I09 A;  4LIV A;  4XON A;  1MMN A;  2LR8 A;  3M07 A;  1JKO C;  1OCT C;  4BL0 B;  1G59 A;  3D1N I;  4KNY A;  4G6Q A;  3QP5 A;  1IGN A;  4ZTF A;  1ZGA A;  5JFR A;  1V5G A;  1O57 A;  2VQL A;  3CDL A;  3GFM A;  4BYY A;  1QHG A;  5M5Y J;  2A5Y B;  5ICF A;  4RMN A;  1HSJ A;  2P5L C;  1LQ1 A;  1MBH A;  2NVU B;  1NK3 P;  2B0L A;  3GO5 A;  4WF2 A;  2FRH A;  3DU6 A;  4MTD A;  3OYM A;  2R7F A;  3QP6 A;  2BY1 A;  2PG4 A;  5CLS A;  3HSR A;  3E7L A;  4C2M J;  3KEQ A;  3W6V A;  3HUG A;  1QZE A;  3K70 C;  2DA7 A;  2RQQ A;  4B44 A;  3FXQ A;  2K3F A;  1SFE A;  4M6X A;  5CQE A;  2X9D A;  3K4B A;  4LD5 A;  4HX8 A;  1ACI A;  1K7A A;  1EH8 A;  1OIS A;  3BCB A;  4ON0 A;  1HCR A;  2TCT A;  1BR2 A;  4KMU X;  1WHU A;  4B09 A;  2QVO A;  2E5Z A;  2IW5 A;  4XIC A;  1X4O A;  3DCF A;  5D6E A;  3I55 I;  1Y1W J;  3KZI C;  2JPB A;  3GTK J;  4LIU A;  3JCU C;  2XB5 A;  3AG2 H;  2NRA C;  2NAZ A;  2PJP A;  3Q5F A;  3KFW X;  4BE2 A;  1BBY A;  2M34 A;  1AKH B;  5KNL A;  1BC7 C;  4UV8 A;  3S1M J;  4QTR A;  4XR6 A;  1CF7 B;  2WBM A;  2EFQ A;  4V2F A;  1FSE A;  3B73 A;  2W4S A;  5B66 C;  3WHC A;  1ONV A;  3KP5 A;  2NXN B;  3ML6 A;  3FZV A;  4E6K G;  3L2W A;  5BPD A;  3O3K A;  3WE3 A;  1IN5 A;  2O8K A;  4WK8 F;  3TKY A;  1O4X A;  1ON2 A;  2W85 A;  1BJA A;  2V7F A;  3E6B A;  4N9I A;  2DMP A;  4CZZ A;  3EUK L;  1V5E A;  5EGO B;  3A02 A;  4L0Z B;  2F5C A;  2EBI A;  3SZG A;  3TO7 A;  4BHC A;  2IGM A;  3FXJ A;  4EM1 A;  1G8X A;  4BQA A;  2L7K A;  3J80 Z;  2XIG A;  1UHM A;  4XLE A;  2EZH A;  1RET A;  3H3Z A;  4RAY A;  2CW7 A;  2QBY B;  3I59 A;  4A69 C;  3HM5 A;  2FML A;  3OYE A;  2MC4 A;  3FX3 A;  1UCR A;  2PJR A;  2HU9 A;  3K6G A;  5JR3 A;  4MQV A;  5C3E J;  2LOO A;  4XLC A;  4L9T A;  1K78 B;  1RZ4 A;  1FWZ A;  3W2V A;  4M71 A;  2G7U A;  2K5C A;  2CQN A;  4KT6 A;  3BJ6 A;  2F5V A;  2CW0 F;  4Y17 A;  2P6T A;  4F91 B;  2HQ5 A;  5ILU A;  5E8G A;  5GPC A;  3T0Y A;  3HOX J;  2HDW A;  3LA2 A;  1PUF B;  4HAM A;  3B02 A;  2Z2S B;  4NNJ A;  4KYW A;  1W0U A;  2I5U A;  2KPM A;  4IQ4 A;  1WI9 A;  2N8G A;  3G6E I;  4I02 A;  4KIG A;  4M3F A;  4PJ0 C;  2DU9 A;  3OYH A;  3SZP A;  2OZU A;  1K4S A;  2XAU A;  3G1O A;  2QQ8 A;  2HOA A;  1W36 D;  1R1T A;  4HW0 A;  1LVK A;  1T56 A;  2V26 A;  4B3A A;  2CUE A;  3KEO A;  4I01 A;  2LYC A;  2HEO A;  3U1D A;  4FAS D;  3SYT A;  3FK7 A;  3MAJ A;  1HDD C;  4HA8 A;  4LG0 B;  3HTS B;  2OQR A;  3JAM Z;  2PQ8 A;  3DF8 A;  3TGN A;  3T8R A;  1XCB A;  1QVT A;  4HSR A;  4D9J A;  4L9J A;  3GLL A;  5DCM A;  1T33 A;  3ASN H;  5L3E A;  2BHZ A;  1BA5 A;  1T0F C;  2NOG A;  4PJN A;  1Y39 A;  2CRG A;  1FJL A;  3I71 A;  1JXS A;  2Y9Z A;  3OS1 A;  2ZXJ A;  4XN3 A;  2ESH A;  2R5Y B;  4J01 A;  1J5Y A;  1E0E A;  3I53 A;  5FO5 A;  2RGV A;  2V1U A;  3CF5 F;  1LDD A;  2LKX A;  1FY7 A;  2AHQ A;  1RPW A;  5IP7 J;  1T8I A;  4C2U A;  2PBI A;  2MLG A;  5F0C A;  5KK1 A;  2Z99 A;  2EA4 A;  3JTH A;  1RR8 C;  4RB1 A;  3HRU A;  4HV5 A;  2X85 A;  1WJ5 A;  4YEJ A;  3BP8 A;  4IHT A;  2CQX A;  1UHS A;  2HQN A;  2HYG D;  1ZG5 A;  5EDN A;  1GV2 A;  2VE8 A;  1F43 A;  1VQ8 I;  4UUS B;  2MW8 A;  5BQT A;  4YFN F;  3LOC A;  5LD2 C;  1Y0U A;  4M9Z A;  4IVN A;  1P6R A;  2M4G A;  3CTA A;  3CQZ J;  2WA0 A;  5IY5 H;  4Y3O A;  5D5U B;  4IXA A;  4IKF A;  2XKO A;  5HDN A;  4F93 B;  1E3O C;  4V19 K;  3DXJ F;  1O3Q A;  2BBY A;  1VQ6 I;  5HLH A;  3QOP A;  3OYB A;  2WAE A;  5A2Q Z;  3NWT A;  4F7Z A;  5L3B A;  1FBU A;  3GME A;  2UV1 A;  1BI1 A;  2WTE A;  3PUF A;  1IF1 A;  3D5L A;  2TDX A;  2OCE A;  5E20 A;  1K4T A;  2L5Q A;  1LE8 B;  5K7F A;  3CP8 A;  5F6F A;  5B1B H;  2Y48 A;  4EVI A;  4L0Y B;  4ZYD A;  1IRX A;  3EYY A;  3H5A A;  2E34 A;  3IUO A;  3CUQ B;  2EFN A;  3GFI A;  2K3P A;  1LKX A;  2DK8 A;  1FTT A;  4EGZ A;  1OR7 A;  1TT0 A;  1WJB A;  1KQ9 A;  5E1W A;  4CDG A;  4AC0 A;  3N4M A;  1RES A;  2K02 A;  3LSP A;  2R3S A;  2Y9Y A;  2Z3Y A;  4B4C A;  4U7B A;  1VTN C;  1C0W A;  3K1P A;  1EF4 A;  2XKP A;  2OBP A;  2CV2 A;  2ZC2 A;  1QPI A;  2DT5 A;  3I54 A;  3R0A A;  5CVI A;  1LVA A;  3P5J A;  3HOS A;  1YTY A;  2VBW A;  4G6D A;  3NWS A;  4E70 A;  1F5T A;  1UFM A;  2XSD C;  1LFU P;  2MG4 A;  1SMT A;  3DEU A;  1RIO H;  2X4H A;  2KQR A;  2YR2 A;  3QU3 A;  2JTV A;  5FKN A;  4R79 A;  1O7F A;  1WQ2 A;  3BWG A;  2ZME A;  2NS8 A;  3ZRG A;  4RAZ A;  1ETK A;  1D3Y A;  4CIC A;  1QGP A;  2H09 A;  2KRF A;  1D1C A;  2M3A A;  1E3H A;  2DFH A;  5DV5 A;  3SHF A;  3NRV A;  2D45 A;  4N0B A;  4YIR X;  1MJB A;  3VOE A;  2A6E F;  3ZQQ A;  4C3J J;  1X1A A;  1DPR A;  3JSP A;  4LLG F;  1P4W A;  1U8B A;  4RAF A;  2EJR A;  1F36 A;  2FXA A;  2M0C A;  3EUH C;  4AD9 A;  5HLT A;  2HR3 A;  4E7L A;  5FKO A;  1FBQ A;  2H1K A;  2R5Z B;  3S3N A;  1XMA A;  2IT0 A;  2NS0 A;  1NH3 A;  1WGX A;  3G3Z A;  4U0V A;  1B59 A;  3HL2 A;  3EYI A;  2CFO A;  4X0G A;  5J3L A;  5LFA A;  2V9P A;  3DBR B;  3LL7 A;  1ETO A;  2L2O A;  4I7H A;  4OMY A;  1R1V A;  1RKT A;  4HLX A;  3DKX A;  2DLL A;  1IRZ A;  1SC7 A;  5LEJ A;  4HNU A;  2DFE A;  1LFB A;  2LVS A;  2LKP A;  4FE7 A;  5F27 A;  1MZB A;  3BDD A;  4JK1 X;  2Y75 A;  2FMY A;  1R5G A;  1WKM A;  4XSX F;  1RR7 A;  1SAU A;  2VIX A;  2QSH X;  2JVG A;  3HOV J;  1KU7 A;  1R5H A;  5FRM A;  1IG7 A;  4ESF A;  4M3G A;  2F4I A;  1XX5 A;  1Z05 A;  4OAZ A;  2JA6 J;  2R7D A;  5IOZ A;  1ZKG A;  2E1O A;  1GLN A;  2KRC A;  4NB5 A;  4BEH A;  3E5Q A;  2ZCW A;  2P7C B;  1EH7 A;  1X1B A;  1U5T B;  1D0X A;  3RKW A;  3ABL H;  2JA8 J;  3M4O J;  5CJ9 A;  1SMY F;  1TWG J;  3V8L A;  1Z7L A;  3LSI A;  5D8K B;  1ZR4 A;  4YEL A;  2QA4 I;  5EEG A;  2P4W A;  2XAQ A;  2AXT C;  2LF8 A;  5F64 A;  4N4O B;  5D5W B;  3CO7 C;  2FE3 A;  2NVT J;  2JT1 A;  3CLO A;  2B7E A;  1MJ9 A;  2GXG A;  2NVX J;  1Z9C A;  1PVE A;  3KP2 A;  4QWQ A;  4W97 A;  3H92 A;  1RI7 A;  1K61 A;  2LD5 A;  1SFX A;  1YI2 I;  4DBQ A;  3ABK H;  4CXF A;  3A4C A;  1KQ0 A;  1WCM J;  2W00 A;  1KA8 A;  3IKV A;  3KYC B;  4L5I A;  2YX4 A;  1IN8 A;  4IF4 A;  3IH3 A;  4P96 A;  3JTG A;  3FM5 A;  2O7O A;  4EGY A;  2G7H A;  3OYF A;  2NYX A;  2EIM H;  1WZ2 A;  3K70 D;  1KQ8 A;  2QKM B;  1UHW A;  4UUV A;  2UUZ A;  2JMW A;  2J5O A;  3AL0 B;  1I6X A;  4IHS A;  2BGC A;  2DA1 A;  1IRF A;  1OCR H;  3JRE A;  2BVM A;  1R58 A;  3OYI A;  3Q0W A;  5KAF C;  5IYC J;  2GOM A;  4UUT A;  5F1R A;  4U7D A;  4A3I J;  1MNM C;  4MTE A;  1H8A C;  2HOT A;  5ILS A;  1O3R A;  4D0P A;  3WTV C;  1XS9 A;  4M3B A;  5FLX Z;  2VOP A;  3GTJ J;  4XKW A;  1YJN I;  1OCP A;  3HGG A;  5K5O A;  3LFK A;  3FXL A;  1A04 A;  1Z0X A;  4P9U A;  2DOA A;  3MZH A;  3GTG J;  3JR9 A;  1ENH A;  3S32 A;  5HVQ C;  3GW2 A;  3NQO A;  3DFG A;  1MMG A;  1R22 A;  2ME0 A;  2R7W A;  1V55 H;  3E5X A;  2W84 A;  2E2J J;  1DP7 P;  4IRI A;  1DU6 A;  3HB9 A;  2E1C A;  2YUS A;  1S7A A;  2A68 F;  4DQ2 A;  1FBS A;  2E2H J;  2CV1 A;  2ISZ A;  2R7X A;  1Y0N A;  1ZRE A;  3K1M A;  1OYI A;  1WJF A;  3ECH A;  2O0Y A;  4A3G J;  4YII A;  1EKE A;  3RKY A;  4IHW A;  1APL C;  5IYD J;  2DMQ A;  4FHT A;  4B43 A;  1WPK A;  3OYN A;  5GPA A;  3MWM A;  5CVR A;  5FKL A;  1MSF C;  1D5V A;  2VI6 A;  5IT9 Z;  3QPS A;  2HPI A;  3DQV C;  2IJL A;  3VB2 A;  1MH3 A;  1YYV A;  3I4M J;  4UB6 C;  4GO1 A;  1X3Z B;  3F22 A;  2A3S A;  4HF1 A;  2JSC A;  1REP C;  2IGK A;  5EJC A;  3RYP A;  5DM6 F;  2DMT A;  4IPA A;  3MZY A;  1UB9 A;  3ABM H;  5HS8 A;  3HOU J;  4XMY A;  3Q0V A;  5HOO A;  2FBK A;  4Q47 A;  2RV8 A;  3OOP A;  2L9N A;  4JP0 A;  3PFY A;  2A5W A;  2QEN A;  4IRG A;  4IZZ A;  4HNV A;  5L3G A;  2WAF A;  4CHU A;  2IXS A;  2UXX A;  1EV7 A;  3BCA A;  1JKP C;  1YFH A;  1QU3 A;  3V4G A;  2MSY A;  4PFP A;  2VB6 A;  1U2W A;  2EPF A;  4NQW B;  4J00 A;  5DD8 A;  2D1V A;  2BY0 A;  1T0F A;  4PSX A;  3OMY A;  2O6G E;  2V4J C;  3H9G A;  2XGE A;  2DOE A;  1LEA A;  1VQ9 I;  4D5C A;  3E6C C;  4AVP A;  4RM3 A;  2KZG A;  1MD0 A;  5ED4 A;  1ZYR F;  2L4A A;  3FXM A;  2KIQ A;  3BQZ A;  3FBI B;  1IUF A;  3SQN A;  3I4N J;  1D0Z A;  2HQR A;  2Y30 A;  2DMU A;  3HBL A;  2XVC A;  3KPH A;  3BOQ A;  3AL0 C;  4RB2 C;  3J81 K;  1T2K A;  1ZGJ A;  3ZQ7 A;  3C18 A;  3N05 A;  4A2U A;  5HDK A;  2D1H A;  2JJ7 A;  2VAS A;  3BR2 A;  2XPW A;  2M8G X;  1I3A A;  1XDS A;  2CW8 A;  4XOR A;  2IS4 A;  4EJW A;  3BR3 A;  1DDN A;  4M6V A;  1MBG A;  1X3W B;  3GBG A;  3L2R A;  2EQR A;  2KT0 A;  4XKB A;  5HOD A;  3HSE A;  5EZH A;  3JRD A;  4PZJ A;  3F3X A;  4G7H F;  4IHY A;  1T6S A;  4HOB A;  1IO2 A;  1Z6T A;  1TWA J;  5FJ8 J;  1VF9 A;  3RQ4 A;  1TZL A;  2D2W A;  1HLV A;  3PJR A;  3BPV A;  3V8J A;  1SFU A;  2MC3 A;  1TW3 A;  5L3D A;  1POG A;  5TGT A;  5EG0 A;  3JRF A;  4EM0 B;  2K4J A;  3EQL F;  1JJ6 C;  2B9S A;  1P7J A;  2XPU A;  1XMX A;  3DWL E;  4JX6 A;  3U21 A;  2KFD A;  4EJV A;  2GBY A;  1B72 B;  3TW7 A;  2JRT A;  4IX7 A;  4F3Q A;  4U0W A;  3RKQ A;  1B1B A;  4GRI A;  1MKM A;  1MBE A;  4OAY A;  1WVR A;  3CMM A;  2HYF A;  3BZC A;  3SEZ A;  3WE2 A;  1KYW A;  2JVH A;  1MH4 A;  2DDB A;  1BN5 A;  1ORK A;  1YHQ I;  1DPU A;  4WXD A;  4OIR F;  3HOZ J;  3C2H A;  4CSW A;  1RKW A;  4XKC A;  3TOA A;  4DYR A;  3J7Z I;  2YU3 A;  1MGT A;  1N77 A;  2LF7 A;  3I0T A;  4L9N A;  4CCJ A;  4CO8 A;  1ZN2 A;  4A0Z A;  3QOE A;  1SD6 A;  5HS9 A;  2L7Z A;  1MDM A;  2BHY A;  2OTJ I;  1BI0 A;  2LY2 A;  2FEZ A;  3IL2 A;  3PUB A;  2VBY A;  3U2R A;  3HOT A;  1XGM A;  1IN4 A;  3CCM I;  3LAP A;  4HG2 A;  1JUS A;  4Q5S F;  1W7P B;  3H9J A;  1FTZ A;  3JRH A;  2DI3 A;  5K5R A;  1M1E B;  3Q3S A;  2Z5U A;  4P1W A;  4DBR A;  4RAG A;  1FIA A;  2CWE A;  3M8F A;  1X1C A;  5B1A H;  3C3W A;  2E1M B;  2VT3 A;  3H5N A;  4CCN A;  2L9S A;  2Z1D A;  4LK1 F;  1H88 C;  5LHH A;  2DO7 A;  4BH9 A;  2KHM A;  3A01 A;  2F4M B;  1PJR A;  2HVS A;  2Y0M A;  1PP8 F;  4AWX B;  2OAZ A;  1IDY A;  1J2X A;  2K40 A;  1VQO I;  1Y1V J;  2M30 A;  1IN6 A;  2VKE A;  3IRR A;  5J4Y A;  1DP3 A;  2LC2 A;  4P5O A;  2LY9 A;  4DIQ A;  2RNJ A;  1LUJ B;  3QWL A;  3K4K A;  2R0Q C;  1T95 A;  3HTU A;  3GTQ J;  1WFX A;  3LSG A;  5E18 F;  5CKT A;  4FTH A;  2MBF A;  2KKO A;  3H5R A;  3EUH A;  5DYM A;  4CCO A;  4MGR A;  3LSM A;  1VQN I;  1ZHF A;  3BR6 A;  2QWW A;  5FD6 A;  5M3F J;  2C6Y A;  4BXU A;  3BZK A;  1DGW Y;  2HKX A;  1Y8R B;  4PK4 A;  4X6A J;  3E6M A;  1WSU A;  1HQC A;  4KFC A;  2VJJ A;  4OOI A;  4UUS A;  4Y15 A;  2LLK A;  2ZSH B;  2PMH A;  2HS5 A;  3CCR I;  1HOM A;  3R61 A;  3FKJ A;  2QQ9 A;  2O5R A;  3P9K A;  1N75 A;  4BEH B;  3V7S A;  2QEX I;  2XV4 S;  2XRL A;  3S2H J;  3KCC A;  2STT A;  2X6Y A;  3DTK A;  1S3J A;  2D5V A;  1ZRC A;  2RNG A;  4BS9 A;  4PUS A;  2L54 A;  5D8L B;  4BJT A;  1UAA A;  4XRS G;  1L3L A;  4HF2 A;  2H27 A;  2F48 A;  2OUM A;  2AQE A;  3C2G A;  4A3K J;  4MO7 A;  3RPU A;  4GXO A;  1OQY A;  2PLY A;  4GDF A;  4B1R A;  4JYK A;  2F5E A;  4ZYE A;  2CUZ A;  2EZK A;  3MZ8 A;  3AAF A;  1P4X A;  5FGM A;  4OIQ F;  4HLY A;  5AIP A;  1WH5 A;  3K4L A;  3S17 J;  4RM2 A;  4I76 A;  4ZDP A;  2BXZ A;  5DS9 A;  4KIC A;  3RSN A;  3PSI A;  4LIT A;  1GXP A;  4UHT A;  3PNT A;  4LJZ F;  4KIB A;  4ENN A;  5HLG A;  1ZH5 A;  5CVJ A;  1I1G A;  4UNO A;  5FLM J;  1F9N A;  2GQQ A;  2I8D A;  3GYH X;  4A5M A;  2FA5 A;  2X0L A;  1QNT A;  3GF2 A;  1S7O A;  1IXS B;  4DYQ A;  1HDP A;  1QVU A;  3AG4 H;  5TRD A;  3W2A A;  3DKY A;  4Y13 A;  2KDO A;  4ZYH A;  2VL8 A;  2XF7 A;  4M73 A;  3WTY C;  5K7H A;  3K4M A;  3PNV A;  2V9V A;  4OIN F;  4BDZ A;  3ZQH A;  3ZPL A;  4C30 A;  1QZZ A;  2HQA A;  3S1R J;  4BXX J;  2P8T A;  4RA2 A;  3KYL A;  4E7I A;  3RPU D;  1H89 C;  5JHU A;  3CC2 I;  1X1D A;  3TO6 A;  3BR1 A;  4I2O A;  2XGC A;  4YRV A;  2BW3 B;  1D8K A;  3ZQG A;  3QQA A;  3KZZ A;  4LG3 A;  1UG2 A;  3UR3 C;  3DPT A;  3D5R C;  2IGN A;  3FMS A;  3W2W A;  4XLP F;  2BEO A;  4A3L J;  1E17 A;  5C4J J;  2EIL H;  1NHA A;  1Z3X A;  3VOD A;  1IRG A;  1VFC A;  1XGS A;  3SFZ A;  4KT5 C;  1FOK A;  3WGH A;  4ZZD A;  2R4G A;  1D1A A;  2VE9 A;  4A3F J;  1KU2 A;  1TQP A;  3HKZ N;  3ULQ B;  1OCO H;  3I3L A;  4C3I J;  4D5F A;  2ELK A;  4B48 A;  4ZZL A;  1ETW A;  3WTX C;  1X19 A;  2Q0O A;  3OSF A;  1OJL A;  2ZKZ A;  5DD4 A;  2XDV A;  3B6C A;  3PL8 A;  1KZH A;  4HX4 A;  4A0X A;  2JUC A;  3C7J A;  4WWC A;  4NHJ A;  2WAQ N;  1B4A A;  1JGG A;  2KRH A;  1FMV A;  4O6J A;  4EJT A;  5GP9 A; 
#chains in the Genus database with same CATH homology
 3EUH C;  4PJL A;  5HLT A;  2MYS A;  2Y0S A;  3D5S C;  4E7L A;  2HZD A;  3RCO A;  2IS1 A;  1D0Y A;  3S3N A;  2AQF A;  3M8J A;  2CMP A;  2X51 A;  3TMO A;  3CJR B;  1MW7 A;  1Z3Y A;  3HL2 A;  2VQC A;  2CH0 A;  2CFO A;  2BVL A;  3FHN A;  3I9V 2;  4X0G A;  5LFA A;  3LL7 A;  2P0W A;  2PMZ A;  3VDX A;  3AFH A;  2L2O A;  3MMY B;  4AU7 A;  2KP6 A;  3DKX A;  3DLA A;  4QPO A;  3VYS B;  3H35 A;  2DCE A;  4HNU A;  2ZFU A;  3HC7 A;  1WJC A;  1D1B A;  2KL4 A;  2X1D A;  1NG7 A;  1SFK A;  1YX3 A;  2NOJ B;  2Q1Z B;  4ANJ A;  4XOP A;  2VQG A;  4BAC A;  2R7S A;  2MFZ A;  4XQF A;  2IS2 A;  1SAU A;  2VIX A;  2JVG A;  2DT6 A;  2X1C A;  3TBI A;  1WJD A;  3UNG C;  5FRM A;  2JUG A;  4KIS A;  1JI8 A;  4B3X A;  3OWT A;  2M7A A;  3K4J A;  2F4I A;  4G6T B;  4OAZ A;  2R7Q A;  1GLN A;  2KRC A;  4BEH A;  2WB1 A;  2R7V A;  1X1B A;  1D0X A;  1LFP A;  3SDB A;  3ONQ A;  4HNT A;  2A6T A;  3AKZ A;  1NG6 A;  1Z7L A;  3LSI A;  3HUG B;  4YEL A;  4EAT A;  3MD2 A;  2HNH A;  4N4O B;  3VSK A;  2X6W A;  3IP4 B;  4RLF A;  2HVR A;  2MD0 A;  2VXZ A;  2HVQ A;  2R7O A;  4HRI A;  4E4H A;  4XL9 A;  4HEA 2;  4XLF A;  2JSP A;  4DBQ A;  1X4P A;  3LFU A;  4HPQ A;  3A4C A;  1DGR M;  1OR7 C;  3CZ6 A;  2BW3 A;  2W00 A;  2XSJ C;  3LMM A;  4BUP A;  4F92 B;  2K9L A;  2IS6 A;  3OR2 C;  3IAM 2;  2FUG 2;  3OYF A;  2KZV A;  3A1Y A;  4ZDL A;  2DT7 B;  2E1M C;  3K70 D;  2QKM B;  4FET A;  2XC7 A;  1Z21 A;  2UUZ A;  3QOD A;  3VSL A;  2W7N A;  3AL0 B;  3OOU A;  4BXF A;  3DPL C;  1YX5 A;  2BVM A;  4RLQ A;  3VYR B;  3OYI A;  4NUB A;  3DTI A;  4D1Q A;  2LBF A;  2GOM A;  2VLA A;  2V1N A;  4E7Z A;  1BR1 A;  2X6X A;  3PSF A;  4XKW A;  1UEL B;  2WY7 Q;  1ZEL A;  2MAB A;  2DOA A;  3CP2 A;  2CS3 A;  3BC8 A;  1R6R A;  4CUG A;  4II2 A;  3S32 A;  5HVQ C;  2WAD A;  4NC8 A;  4ZTJ A;  4PFO A;  1MMG A;  2LBF B;  1WJE A;  2R7W A;  4BQO A;  3MKW B;  4CH7 A;  2VKD A;  5KHD A;  3SEQ A;  4C9Y A;  4B47 A;  4ZC3 A;  3HXL A;  4XLA A;  2PJR B;  2DJI A;  2CV1 A;  3MKY B;  2R7X A;  2Z16 A;  1WJF A;  5FRN A;  4LIV A;  4XON A;  1MMN A;  4B43 A;  4F52 A;  4BL0 B;  1G59 A;  3OYN A;  4ZTF A;  2HPI A;  3CES A;  3DQV C;  3OYC A;  1DQU A;  1QHH D;  1KON A;  1V5G A;  2VQL A;  5JHF A;  1QHG A;  2IGK A;  4RMN A;  4XMY A;  3DU6 A;  5HOO A;  2VQH A;  3OYM A;  5HNF A;  2L9N A;  3S93 A;  3QYB A;  3PFY A;  1YE9 A;  2A5W A;  3H0D A;  2R7U A;  4N4N B;  3LSK A;  3OS2 A;  4IZZ A;  2VKH A;  2WAF A;  2IXS A;  3BCA A;  3VYT B;  3K70 C;  1QU3 A;  2RQQ A;  4B44 A;  4DGW B;  4PFP A;  2VB6 A;  4J00 A;  4NQW B;  4BJ6 C;  5CQE A;  4PSX A;  3K4B A;  1V5F A;  3OMY A;  2RRE A;  3BCB A;  4II3 A;  1BR2 A;  2V4J C;  3H9G A;  2E5Z A;  4RM3 A;  2LY1 A;  3V42 A;  1X4O A;  3FDY A;  2CV0 A;  3FBI B;  3HKZ A;  3OY9 A;  1D0Z A;  3AL0 C;  3E0J B;  4LIU A;  3OL3 A;  4Y33 A;  2XF6 A;  3N05 A;  4BE2 A;  5KNL A;  2VAS A;  2KMU A;  2CW8 A;  4XR6 A;  2WAQ A;  3OYL A;  3DTE A;  3HPH A;  4XOR A;  2WBM A;  2M0M A;  2IS4 A;  3DPU A;  1ERD A;  3TL4 X;  2W4S A;  2GOX B;  2ZSI B;  3GBG A;  3L2R A;  1P9Q C;  4XKB A;  1MMA A;  2HPM A;  4E6K G;  3L2W A;  4PJJ A;  3L2Q A;  3A2K A;  4ITV A;  3S3M A;  1MMD A;  3RQ4 A;  1TZL A;  3M1C A;  3PJR A;  2K9M A;  1WJA A;  2ZXH A;  2V7F A;  3BG6 A;  2DXI A;  3W3C A;  2V9K A;  2CUJ A;  5TGT A;  1VZ0 A;  2VXD A;  3K4C A;  3EPZ A;  3EUK L;  1V5E A;  3DWL E;  4KJZ A;  2V6E A;  4ZDO A;  1MND A;  3U21 A;  4F55 A;  2WY8 Q;  3SZG A;  5FRO A;  2IGM A;  1G8X A;  1AA7 A;  4IX7 A;  2L7K A;  4F3Q A;  4XM3 A;  4GRI A;  2LRE A;  4XLH A;  4H4K C;  4OAY A;  3CMM A;  4XLE A;  3SEZ A;  2JVH A;  2CW7 A;  3OYE A;  2MC4 A;  4BE1 A;  2PJR A;  2HU9 A;  4BQN A;  3C2H A;  3K6G A;  4AYB A;  4CSW A;  4XKC A;  3L2V A;  2VJ5 A;  3BG7 A;  2LOO A;  4HST A;  4XLC A;  1N77 A;  2W1O A;  3W2V A;  4CCJ A;  3ZGK A;  2K5C A;  4KT6 A;  4CZC A;  2QKL B;  2F5V A;  4F91 B;  3QOE A;  3OYJ A;  2HDW A;  2LY2 A;  4CCK A;  1K6Y A;  2Z2S B;  1MNE A;  4NNJ A;  1Y6I A;  3PUB A;  2KPM A;  4IQ4 A;  2JA2 A;  3HOT A;  3HPG A;  4ZYA A;  4HG2 A;  3H9J A;  3OYH A;  2XAU A;  4P1W A;  4DBR A;  3MKZ A;  1W36 D;  1X1C A;  3ZXS A;  3QYF A;  1LVK A;  2E1M B;  3H5N A;  3KEY A;  4CCN A;  2L9S A;  2V26 A;  2Z1D A;  2LYC A;  3F9K A;  4FAS D;  3L2U A;  2KHM A;  3SYT A;  3OR1 C;  2HVS A;  1PJR A;  3PNY A;  3OYG A;  3S8P A;  3OYD A;  1Y56 A;  3OIQ A;  4E7J A;  4KIT B;  1DP3 A;  2LC2 A;  4BJ5 C;  4P5O A;  4E7H A;  4DIQ A;  2IGO A;  4BU2 A;  4HSR A;  4D9J A;  2VPL A;  2R7R A;  4AVZ A;  3K4K A;  1T95 A;  2W82 A;  1T0F C;  4PJN A;  1WFX A;  3LSG A;  4CCM A;  4MLO A;  5CKT A;  3H5R A;  2M7B A;  4BE0 A;  4CCO A;  4XN0 A;  3OS1 A;  2LG4 A;  2OV7 A;  3LSM A;  4XN3 A;  3OS0 A;  4J01 A;  1DGW Y;  1E0E A;  4Y4R A;  4PK4 A;  2F6C A;  3ZR8 X;  3HG9 A;  1LDK B;  2VJJ A;  4C2U A;  4XKV A;  2ZSH B;  3EUA A;  4PSW A;  3G2B A;  2LRD A;  1U0J A;  3K4N A;  3FKJ A;  2O5R A;  3ZCO A;  2ELJ A;  1N75 A;  2X85 A;  3S3O A;  3K10 A;  1WJ5 A;  4YEJ A;  2X6Y A;  2BOL A;  3DU5 A;  3DTK A;  3H9Q A;  2RNG A;  4BS9 A;  1BOB A;  4PUS A;  3RTR A;  4BJT A;  2VJI A;  1UAA A;  2OUM A;  2AQE A;  3C2G A;  5LD2 C;  2M4G A;  3KX2 A;  2WA0 A;  4JOM A;  4Y3O A;  2CUZ A;  4U87 A;  4CCL A;  2UWM A;  3LSH A;  3DEE A;  4XNF A;  4IKF A;  3K4L A;  4F93 B;  4RM2 A;  4ZDP A;  1W36 C;  3VYU B;  4BEH B;  1EA3 A;  2XF5 A;  3RSN A;  3OYB A;  3CJQ B;  3PSI A;  2WAE A;  4LIT A;  3PNT A;  3NWT A;  1OLT A;  2UV1 A;  1UG0 A;  3IAS 2;  3D5L A;  5KCM A;  2E5N A;  2I8D A;  3OIP A;  4CA0 A;  4JQF A;  2L5Q A;  3CP8 A;  4XOT A;  4BDY A;  3W2A A;  3DKY A;  2KDO A;  1IRX A;  2LH9 A;  2M4K A;  2VL8 A;  2KLO A;  3H5A A;  3IUO A;  4IQJ A;  2XF7 A;  2K3P A;  1LKX A;  1FMW A;  5CQG A;  1WJB A;  1TT0 A;  1J09 A;  3K4M A;  3PNV A;  4BQQ A;  4E7K A;  4DOZ A;  4BDZ A;  4C30 A;  2HQA A;  4E7I A;  3KYL A;  3FBN B;  3RPU D;  1HA8 A;  3VWB A;  1X1D A;  4U7B A;  4YRV A;  2BW3 B;  3QYE A;  2CV2 A;  5CPR B;  4LG3 A;  3BLY A;  3E1S A;  2ZXI A;  3DPT A;  3UR3 C;  3HOS A;  3NWS A;  4OWR B;  3D5R C;  2IGN A;  5HNH A;  3W2W A;  3OL4 A;  2E60 A;  1Z3X A;  3CF2 A;  3J7A Y;  4ZJZ A;  4C2T A;  4BGD A;  2R4G A;  4NC7 A;  4QPQ A;  1D1A A;  2KQR A;  3I3L A;  4R79 A;  4B48 A;  1N78 A;  1BR4 A;  2OC6 A;  1X19 A;  3ZRG A;  1PYV A;  4E7S A;  2XDV A;  1D1C A;  2M3A A;  2X1E A;  3PL8 A;  3OYA A;  2Q2E B;  2R7T A;  3OYK A;  1S9H A;  3ZQQ A;  4DJA A;  2KRH A;  1FMV A;  1X1A A;  2VJ4 A;  4PJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...