3WE3A

Structure of blm rqc domain bound to an arsenate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bloom syndrome protein
publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we3A00
3ZQ7A 3L09A 2KJCA 4RGSA 4CICA 3IRRA 5BOXA 2NYXA 5LBQA 2Z33A 5L3BA 4HX7A 1XCBA 1LDDA 1MZBA 3GUDA 4MQ9F 1L0OC 5HLGA 4Q47A 1YG2A 3ZMVA 1QNTA 2BV6A 3G73A 3TO7A 4HDVA 5E1WA 3D5LA 1MGTA 4PDKA 1YS6A 2IVMA 2WWYA 5DD4A 2XRNA 1SFXA 1U6GA 1TBXA 5E8GA 4GGGA 1FBSA 3TKYA 3LQRA 3HYIA 2RQPA 3SZPA 1SFEA 2PBIA 4MGRA 3F8NA 1HSJA 1ZRFA 3HHHA 2DT5A 5F1RA 5CYVA 3O6BB 3I53A 1J9IA 1DPRA 1B1BA 1KU3A 4NQWA 5JVTA 1FZPB 2UWMA 4I09A 2P7CB 2EV6A 3ULQB 4MEXF 3KLNA 2PFBA 2V9VA 3V8JA 1L3LA 2EV0A 1XCVA 1DPUA 2IA0A 5IT9K 2ETHA 3I71A 5F6FA 1IN8A 3FWEA 3AAFA 2OD5A 2MLGA 2P7VB 2PMHA 3WTWC 3SQNA 2VE8A 1O57A 3MAJA 2K7LA 2ZMEA 1A04A 4XBFA 2JSCA 3V7CA 4HDUA 4R1HA 1FP1D 4ZH4F 4BQAA 4OIOF 5K5RA 2L3DA 2VBXA 4P55A 4L0ZB 3E6DA 2K86A 3M8FA 2OBPA 1XMAA 3V7RA 2L01A 2FSWA 2DQLA 1IUYA 3LAPA 3CUQC 3U2RA 2R7DA 1UFMA 1TNSA 3I58A 2ESHA 3RJPA 5DV5A 1O3SA 3FZVA 4AIHA 3JAMK 3F3XA 3V4GA 4IRIA 2VBWA 2ZMEB 3WE2A 2Z5UA 3MEXA 2STWA 4LGWA 1G6NA 4A0XA 2CFXA 4KNYA 4AWXB 4G94A 3NRVA 2A6HF 2DTRA 4CXFA 3T1BA 1LVAA 3OOPA 1FBQA 4KICA 2COMA 1P4AA 3BROA 4BH9A 1BI3A 2HQNA 3R0JA 2CG4A 4EV0A 5F64A 4KMFA 2KKOA 2GA1A 4G9YA 2MA3A 3MWMA 1K78A 4LG0A 5D5WB 5EEGA 4G8XA 1FYLA 4ZZLA 1I1GA 3IC7A 4HF0A 3ERED 1BOAA 1U5TA 2CW0F 3RKXA 1YLFA 2ZXJA 3MQ0A 2YX7A 1ZGAA 4OIPF 4EJTA 4QWQA 3K1MA 4WXHA 3IKVA 5DCFA 4XRFA 1ODDA 4CZZA 1ZYRF 2DU9A 2DK8A 1K79A 4D0PA 1K78B 1XGMA 4LG0B 2O03A 3BJ6A 5H6RA 4KMUX 5HS9A 3KP4A 1U5TB 2FU4A 2KJBA 2G9WA 4M74A 2EFPA 4KDPA 1XGOA 5TRDA 1H9GA 4DNCA 2GQQA 2W24A 5BQTA 1CF7A 2E1NA 4GYIA 5DYMA 4GXOA 4E70A 1Z9CA 2HKOA 2R7FA 2HYGD 5HVQC 4R8HA 2WC2A 2P5VA 3EETA 2CO5A 3ABUA 2QM3A 3HRSA 3N4MA 2JRTA 1Z05A 4ZYDA 2H27A 3J81K 4M6YA 2Q2EA 1BBYA 5A2QK 1LQ1A 1RI7A 4U7BA 1ZLKA 4HBLA 3HSRA 3FXQA 1CF7B 1LEBA 4IRGA 2F5FA 1USSA 2GAUA 2AS5F 1U8RA 2V1XA 5JFRA 1BIAA 1MJ9A 4A6EA 4MTDA 2PLYA 5BPDA 1RZ4A 3GXOA 2EFWA 1QO0D 3GX4X 2VONA 5K5OA 1V4RA 1R36A 1TQMA 4FT8A 5ERIA 1S7OA 4BNCA 3I54A 2XKPA 1DDNA 1TLHB 2DBBA 3CUQA 3PQJA 5EEHA 2D2WA 2ZBKA 2LF8A 1KU9A 1RIOH 3J81Z 3QRFF 4Y13A 3C18A 4EJUA 5A2QZ 5ICEA 1TW2A 1Z1DA 2UXXA 3F6OA 1QBJA 4ZYHA 3ECOA 1PP8F 5ILSA 3VEPA 3BPXA 1SAXA 3CUQB 4Z2YA 3HOTA 1UHMA 1ZRCA 3G3ZA 5HS8A 4AVPA 3WTTC 2ELHA 4EJOA 2IA2A 3WODF 2GXGA 1WI9A 1OMIA 3K9TA 4HQMA 1LJ9A 3GZ6A 2EWNA 3GO5A 3TOBA 4UHTA 5HS7A 4GYGA 1B6AA 3JSOA 4BHBA 1YFHA 4A12A 1NHAA 1T0FA 3V8LA 5JHUA 3E6BA 3O2PE 4WXDA 3IL2A 2K02A 2M30A 1J59A 4L9NA 4MNUA 5HDNA 3QPTA 4LB5A 3P9CA 2Z9OA 5E1XA 5BS6A 3E5XA 4Q5SF 5HLIA 4L5IA 2QBYA 3T0YA 3RYRA 1ZLJA 1IN7A 2IP2A 1FSHA 2VBYA 2HWVA 1YS7A 3S2WA 1BJAA 2VE9A 5CLSA 1HKQA 2OZUA 4Y15A 5ICCA 2FMLA 2NNYA 5FD5A 2FE3A 2M1BA 2BYVE 3JW4A 4HV5A 2ZO4A 5CVIA 1P92A 4P96A 2M5WA 4L9JA 4ENNA 2FMYA 2FRHA 4PCQA 4A5MA 4WCGA 1XSVA 2P4WA 3ZMZA 3HRMA 2QBYB 5E1ZB 3Q9SA 2EK5A 5D4SA 1S8NA 3RDIA 2LDUA 1O3QA 4ZZDA 4N9IA 2DPUA 1FNNA 4EGYA 2FNPA 5FD6A 3F22A 3HSEA 1Z91A 2W57A 1YTYA 1YIOA 4O6JA 2F5EA 3ROUA 1E2XA 3QOPA 3V8KA 1IN5A 2H09A 2D45A 4IVNA 3P7NA 1HQCA 2RC4A 4UUVA 3M1EA 2HKXA 3RIRA 2G7UA 2GXBA 4UXNA 4ENJA 3KZZA 2HEOA 4PZJA 1K7AA 2ZFWA 2GIVA 4KUMA 1G3SA 1MJBA 3IWZA 3FM5A 4WX9A 3SHFA 3LAJA 1BI2A 3K1PA 5LLQA 1DUXC 3DFGA 1P4WA 4KT5C 1LB2A 4BXUA 1W4MA 2A6EF 2W25A 2M8EA 4RB3C 4Q4ZF 1XMKA 5FGMA 2F5DA 1O7FA 4HLXA 2A07F 1Z7UA 3FX3A 3BDDA 3LWFA 5D5UB 4RAYA 1R7JA 2YSRA 4EJVA 4OOIA 1I1SA 1XD7A 2XIGA 4L18B 4ETSA 1FYMA 4P5OA 4EMSA 4GCVA 5K1YA 3WU0A 2PJPA 2RVCA 2ZCWA 3RPUA 4LLNA 1FBUA 3H3ZA 1REPC 2HTSA 5FFXA 4JBAA 4L9TA 1TW3A 1PDNC 5DUKA 5D5VB 4ENMA 2WTEA 1T6SA 3HSFA 5D5XB 1FSEA 1H9TA 1ZG1A 3COAC 2G7HA 1HW2A 3VODA 1KGSA 2QYOA 2XAJA 1FPQA 2VXZA 4M6XA 1BI1A 3GYHX 2MH9A 2BGCA 3I59A 1TQPA 3L9FA 2YX4A 1TNTA 3DPLC 3CO6C 3DXJF 1QZZA 3R6SA 4HQEA 1R5GA 4IRHA 2KIUA 2Z99A 1R1VA 3FMRA 2V1DA 3I5UA 4U88A 1KQ8A 3RYPA 5E18F 3GF2A 3I59B 3PQKA 3U9GA 5JR3A 3U1DA 1DP7P 1S29A 3I64A 3FMQA 3R4KA 3H3UA 2UZKA 4F7ZA 3MZYA 3KP2A 1HKTA 1J75A 4YFNF 1HBXG 4KN7X 1C0WA 3GZ5A 1KQ9A 2NRAC 2A68F 2VT3A 2XUBA 1FLIA 1FC3A 2EFOA 2ZKZA 2XGXA 3WTZA 4RB1A 4OMZA 2RN7A 4P9FA 1J7KA 2E7WA 3EDPA 1XN7A 3E6CC 1FYKA 3GFLA 3LA7A 1R00A 2H6BA 2DI3A 2NAZA 3R61A 1XB4A 3FXRA 4DQ2A 2YR2A 4RS8A 4ESBA 2HR3A 2VC1A 1ON1A 4NB5A 3QP6A 2F5CA 1RNLA 2P6SA 1IXSB 4G6DA 4I2OA 4YG2F 5AIQA 4N0BA 3RPQA 1I6XA 1D8JA 5LHIA 2DQRA 1MDMA 2Z3YA 3T5XA 4BAYA 1F1ZA 1T2KA 1QPMA 4WWCA 3K69A 3MFKA 3BZ6A 5DUIA 5D8KB 4EGZA 3QU3A 3B02A 2BEOA 1IW7F 1YQAA 2Y0MA 3B73A 3QPHA 5ICFA 4KFCA 3BP8A 3WGHA 1WWXA 2V1UA 2VODA 2EV5A 5CVUA 1B59A 1J5YA 3RKWA 3Q5FA 2HFHA 1EH7A 3C7JA 3RTRA 1QGPA 3FF5A 2VOPA 5IT3A 3MZHA 4LMYA 1F9NA 1OKRA 2IJLA 3DKWA 3F8FA 1HXDA 5FLXZ 3WTUC 4I0AA 2MC3A 4RGRA 1U78A 5LGUA 1MKMA 2OA4A 4PGGA 1V3FA 3BWGA 3F6VA 1FP2A 1STZA 5CJ9A 1BN5A 5KVRA 3H92A 3E5QA 1F5TA 4G7OF 5DCMA 1BC7C 4IHSA 1UB9A 2QQBA 1WQ2A 2X0LA 1ZHFA 2EB7A 1G4DA 5JI6A 4G7ZF 2QQAA 3RI4A 4AD9A 4OIQF 5BPIA 2B0LA 2FF4A 2V79A 1P4XA 2IW5A 1P6RA 2X4HA 3F23A 1PUEE 1LDKB 4AIJA 2JZYA 1IXCA 3KFWX 1S7AA 3M9AA 4H0EA 4S05A 1ZH5A 2FEZA 4MEYF 5DCMB 4WK8F 4K2EA 4HX4A 5J6XA 3WGGA 3FM3A 2PI0A 5LGNA 1CGPA 1YW7A 3WTYC 4Y17A 5D6FA 3GLXA 1HKSA 4UVBA 3DV8A 3HHGA 3I4PA 2OQGA 2A5YB 3TGNA 4U0YA 2M45A 2F2EA 3ML6A 3ZMSA 3K0LA 3ZP5A 3WE3A 1GXPA 1S6LA 2O0YA 4HW0A 4LD5A 2CWEA 4YFXF 1GHCA 3J80Z 1SD7A 1R1TA 3ABTA 4HX8A 1JHFA 3EUHA 4M71A 4BHCA 5FO5A 2MH2A 5CVJA 1IN4A 2RKHA 4ON0A 2PQ8A 3IWFA 5K5QA 3IRQA 4A0YA 5DDGA 1E17A 2CQKA 4LLGF 1AOYA 2P5LC 1XGNA 2HYFA 1USTA 5LEJA 5CVRA 1G3TA 3TO9A 2LNBA 2QVOA 1EH6A 1IF1A 4BHPA 2IPQX 1QZYA 2XASA 1I5ZA 3E5UA 5LEKA 1ZRDA 3KE2A 3BOQA 3ZN0A 4JK1X 2Q8KA 1LEAA 2FNAA 2DFIA 3JTGA 1ZN2A 2RV8A 2XAGA 4B8XA 2DLLA 4KIGA 2Y75A 2JTVA 3CTAA 1B4AA 2IT0A 1LDJA 2QENA 1D3YA 3L7WA 3E6MA 2O6GE 2EA2A 2ZNYA 2QLZA 4BYYA 2DAOA 3FHZA 3R60A 4KIFA 4ESJA 2FBIA 1JGSA 2P5KA 1ULYA 1R5HA 4LLLA 2A69F 3REOA 1HW5A 2AXLA 3LQQA 4M9XA 5LHHA 3HTSB 5KK1A 4HOBA 3L00A 4NHJA 2D1VA 3IHUA 5L3EA 1OR7A 3VOEA 4FHTA 2VBZA 1B9MA 1ON2A 2JPCA 1WRJA 4A0ZA 1GXQA 2C6YA 3NQOA 3P9IA 4XLNF 3KP7A 4UVCA 3LFKA 3KETA 4OIRF 4M9ZA 4O3MA 4S04A 2A3SA 2L4MA 3WTSC 3GEZA 1KQ0A 2HS5A 2Y48A 5J8CA 5L3GA 1ZGJA 1R23A 5E8IA 4M72A 3W6JB 4HF1A 4XSZF 5ILUA 4U7DA 1WKMA 2OU2A 3W6KB 3HRUA 2DPDA 3TO6A 4IJAA 3BJAA 4MHGA 5D4RA 2FBKA 3MCZA 2O61A 3HOSA 4WF2A 4A5NA 3KEOA 4HA8A 3JTHA 4XSXF 1JXSA 4G7HF 4L0YB 1AWCA 1OYWA 3GVAA 4RGXA 1FX7A 2E1CA 1YW9A 1U3EM 2ZJ2A 1IXRC 1W7PA 1FOKA 3KLOA 1T98A 1QQIA 4IXAA 5TJJA 4QLCU 3QAHA 4IF4A 1KU7A 3KZYA 4U0WA 4FX0A 1R1UA 3ZMTA 2EJRA 3HTUA 1IN6A 3IKTA 1EV7A 4I0BA 1X3UA 1WSUA 2TDXA 3GWZA 1LNWA 4ASNA 1ZARA 2EFQA 4I02A 1D5VA 5LRSA 1W7PB 1F4KA 1BM9A 4AIKA 2OAZA 2RDPA 2PG4A 3E3VA 1EH8A 5ICGA 2IA1A 2XAFA 4OU0A 3C3WA 2OQRA 1SFUA 5HDKA 3KP6A 4LK1F 4TV7A 4UV9A 1ZAOA 2ZNZA 3LSTA 1T38A 1XDSA 2P6TA 5E20A 2V6CA 3GFJA 2CSOA 2GWRA 1W5TA 4RB2C 4Q48A 4M9SA 3N97A 4L5JA 3RKYA 2PEXA 1Z6TA 3CJNA 3I0TA 5IT9Z 1XDUA 3ECHA 4HZFA 2O8XA 1XSDA 2J5OA 3ZPLA 5HLHA 3EQLF 5E17F 4A2UA 3DP7A 3CDHA 1XSXA 5L3FA 4HF2A 2QQ9A 2D1HA 4U0VA 2OZ6A 3R0AA 1SD4A 1UCRA 4IHTA 1KA8A 4RGUA 1JE8A 1SMTA 2IRFG 3CUOA 1ZREA 1RUNA 2VN2A 2QZ8A 4OMYA 1KU2A 2R3SA 3SZTA 5FLXK 4CDGA 4EM0B 4RAZA 4WXCA 2DO7A 3JAMZ 3BPVA 3HIFA 5D6EA 5L3DA 3QP5A 1YW8A 4KIBA 2NS0A 4IPAA 1TTYA 2FA5A 4HV6A 1R22A 4R79A 4CO8A 2L54A 4RB0A 2GZWA 3KEQA 4ZYGA 2CYYA 2ISYA 4I98B 3K2ZA 3KP3A 2MBFA 4HYEA 1JHHA 5LHGA 1MD0A 4EVIA 3VFZA 2NNNA 4HAMA 1MDMB 1O3TA 2LF7A 1Z6RA 1K6OA 3M7GA 3ELKA 3F8BA 4MQVA 2M87A 1BIBA 1ZG3A 3HUGA 2RGVA 3C1DA 4I01A 3F72A 3EYYA 3KCCA 1U2WA 4PGHA 2P8TA 2VT2A 2HQRA 3FXUA 1J0RA 2GA2A 2E7XA 3L2CA 3F8MA 3GFIA 1IRGA 4KYWA 1W5SA 1KYZA 4ESFA 3LA3A 5D8LB 2BE5F 2H94A 3J7AO 3DF8A 1P2FA 2HTJA 3T8TA 4EM1A 2DW4A 2ACJA 4MTEA 2EFNA 1GVJA 3EYIA 4ZYEA 3CLOA 5DD8A 2HOEA 1T39A 1SD5A 3K1NA 3DPTA 1G3WA 4LK0F 5CVVA 4EJWA 2FBHA 2JT1A 2KIFA 5FB2A 1W7PD 3WU1B 3TOAA 3QU6A 2WV0A 3J80K 2K27A 2CGPA 5AONA 5HOOA 2ADUA 3GFMA 4KA4A 1O7LA 4B09A 3FMSA 2RNJA 2XV4S 3PFIA 2ESNA 1SD6A 2K4JA 3GW2A 2PN6A 4A6DA 1ZG5A 3ISPA 2FOKA 3BY6A 1RUOA 3SFZA 2DK5A 1B9NA 2KRFA 5L3CA 4JQFA 2QWWA 3NEUA 3T8RA 5LGTA 1YYVA 2EA4A 4FX4A 4YFKF 2VOOA 2STTA 1G3YA 2FXAA 2PMUA 3KP5A 2W84A 2YPRA 1UHWA 1OYYA 4I7HA 2J5PA 4EQQA 1PP7U 3HRTA 4UVAA 5LRRA 1FWZA 1FY7A 1XGSA 3V7SA 4YIFA 4HLYA 4UV8A 2YU3A 1HSTA 3P9KA 1R58A 5BMZA 5ILVA 2HDCA 2H6CA 3TQNA 3F21A 2XROA 3D0SA 1YO5C 1IAWA 1IZ1A 4G6QA 4CHUA 4OINF 4CGZA 6PAXA 3VB2A 5AIPA 2LKPA 5J8FA 4GO1A 5H6QA 1D8KA 3ZN1A 5FFZA 2KIMA 1BC8C 3DQVC 2O3FA 1H0MA 1BI0A 2VC0A 5HDGA 1HW1A 1VTNC 1FT9A 2HGCA 1OYIA 2XAHA 1I27A 3OV8A 4P9UA 1S3JA 1O3RA 1KYWA 3Q9VA 1MJAA 3TDZC 4YIIA 5ED4A 1IRFA 1Q1HA 2L4AA 3SXYA 3M8EA 2FQ3A 3WGIA 4XLPF 2MD5A 2QUFA 5DEQA 1Y0UA 4N9HA 2LSOA 4LFUA 3BJOA 2A61A 1J2XA 4UNOA 3LA2A 2XKOA 4LB6B 4LJZF 2BBYA 3CO7C 1OPCA 4ENKA 3E97A 2W85A 4CYDA 5H20A 2XHKA 3WG9A 1TQIA 2UXNA 2ISZA 4M73A 4KN4X 4L9VA 3ZMDA 2XVCA 3DEUA 2MLKA 3WTXC 1SMYF 2L02A 3ZMUA 3JSPA 3F8CA 2JPBA 2XAQA 2K4BA 3O3KA 3WTVC 2Q0OA 4O5VA 4EM2A 1U5TC 2HZTA 3TDUC 1ONVA
chains in the Genus database with same CATH superfamily
2WAFA 1XS9A 3ZQ7A 3L09A 3S1NJ 2KJCA 4RGSA 4CICA 2JVHA 3IRRA 5BOXA 2R7VA 4DGWB 1A35A 4FISA 3VYTB 3JRIA 2E1OA 2NYXA 5LBQA 2Z33A 2ZXIA 2JUCA 5L3BA 2M0CA 2KZGA 4HX7A 3LSPA 1XCBA 3A01A 1LDDA 1MZBA 2XF7A 3GUDA 1L0OC 4MQ9F 4Q47A 1JUSA 1YG2A 5HLGA 3ZMVA 1HA8A 2Q1ZB 1QNTA 2R7XA 1DGRM 2BV6A 3G73A 3TO7A 2YU9J 4HDVA 4FETA 5E1WA 1O4XA 3D5LA 5F0CA 2B9SA 1MGTA 4PDKA 5IP7J 4IOCF 2NVYJ 1YS6A 2IVMA 2LTPA 2RAEA 1UMQA 5DD4A 2EH3A 2XRNA 2WWYA 2E2IJ 5IYBJ 5EGOB 1SFXA 1U6GA 1TBXA 5E8GA 3OSFA 1WFXA 4GGGA 4CH7A 1FBSA 2ZSIB 3TKYA 3LQRA 3HYIA 2RQPA 1ZTRA 1SFEA 2H8WA 4LITA 3SZPA 5FLMJ 3MKWB 1Z7LA 2PBIA 3UR3C 4MGRA 3F8NA 1HSJA 2JA2A 1ZRFA 4D5CA 3HHHA 3ZXSA 1YE9A 2DT5A 5F1RA 4QSHA 1YX3A 3HOXJ 5CYVA 2LRDA 2CV0A 4NBQA 4PSWA 3W2AA 1IUFA 3O6BB 3I53A 1J9IA 2IGKA 3DTEA 2XB0X 1DPRA 4MO7A 4NC8A 1B1BA 2CUZA 1KU3A 1EF4A 2BVMA 4JYKA 4JX5A 4NQWA 4HNVA 5JVTA 1FZPB 3CJRB 3OR1C 2UWMA 4I09A 2P7CB 2EV6A 3ULQB 3FBNB 4B47A 1X1AA 3BR2A 2OF7A 3LSJA 4MEXF 2F4OB 3ABMH 1IJWC 5CPRB 3KLNA 1VQ6I 2HQAA 4M3BA 2PFBA 3PNTA 2R7ZJ 2V9VA 3V8JA 2JRMA 2JMWA 1L3LA 2EV0A 3OWTA 1XCVA 3BTIA 3CC2I 2DA1A 1DPUA 2IA0A 1UHSA 1OJLA 2B63J 5IT9K 4QPQA 5HLTA 5E3LA 2ETHA 3I71A 5F6FA 1IN8A 3FWEA 1WGXA 4PJLA 2CUJA 3AAFA 2OD5A 4ANJA 4NNJA 2MLGA 2P7VB 2K9LA 2PMHA 3WTWC 1OCCH 4HRIA 3SQNA 1V5FA 2VI6A 2VE8A 2K5CA 3S3MA 4NQWB 1O57A 2Y0SA 3MAJA 4DYRA 2ZMEA 1GVDA 1A04A 2K7LA 2JSCA 4XBFA 3V7CA 4HDUA 1QHHD 4R1HA 4A93J 4DOZA 2IS6A 1FP1D 4ZH4F 4BQAA 4OIOF 5K5RA 1H88C 2HU9A 2L3DA 2VBXA 4P55A 4L0ZB 3E6DA 2K86A 2A05A 2OBPA 3M8FA 2V4JC 1XMAA 4ZDOA 2GIZA 3V7RA 5KHDA 2KP6A 2MGQA 2WY7Q 2L01A 2FSWA 3BTCA 4BJ5C 2DQLA 1IUYA 3LAPA 1D1CA 3CUQC 2HOSA 1FOYA 3U2RA 4LIUA 2R7DA 1UFMA 3NAUA 1CQTA 3S32A 1P9QC 1DQUA 5GTHC 2DDBA 1TNSA 3OYIA 3I58A 2ESHA 3RJPA 5DV5A 1O3SA 1HDDC 4AU7A 3FZVA 4AIHA 3K4KA 3JAMK 3RCOA 3F3XA 1K83J 3V4GA 4IRIA 5C3EJ 2VBWA 2ZMEB 1OLTA 3WE2A 2Z5UA 2OC6A 1ZKGA 3HM5A 3BC8A 2VJ5A 3MEXA 2STWA 4LGWA 2VB6A 1G6NA 3ZQGA 4A0XA 2CFXA 2ZB9A 4A3EJ 1MNEA 4KNYA 1K4SA 4AWXB 4G94A 2K3PA 1D0ZA 3NRVA 1N77A 2A6HF 3HKZN 2IXSA 4XICA 3SJMA 1W36C 2DTRA 4CXFA 3T1BA 4HPQA 4PJ0C 1LVAA 3OOPA 1FBQA 5FRMA 4KICA 2COMA 1P4AA 1MW7A 4A3GJ 3BROA 5F1JA 2DDAA 4B4CA 4BH9A 1AA7A 1Z67A 1TWGJ 3BT9A 1BI3A 3PSFA 3K70D 1PUFA 3QODA 2HQNA 2I10A 4XN0A 3OMYA 3R0JA 2CG4A 2KLOA 4EV0A 5F64A 3OS0A 4KMFA 5KCMA 2KKOA 2GA1A 4G9YA 2MA3A 3FISA 3GLLA 3MWMA 1K78A 2R7TA 4LG0A 5D5WB 5EEGA 4RAFA 4G8XA 5JVGF 4B48A 3PIPF 5FKMA 1FYLA 1GLNA 4ZZLA 3KPHA 1I1GA 1T0FC 4XNFA 3IC7A 3KZIC 2KMUA 4HF0A 1BOAA 2V9PA 1U5TA 3K4NA 2CW0F 3PUBA 4PFOA 4ZDLA 3RKXA 1YLFA 2ZXJA 4X0GA 4XLHA 3MQ0A 2O8KA 3IAS2 2E35A 2YX7A 1ZGAA 4OIPF 4EJTA 3H1CA 4QWQA 3K1MA 2CW8A 4WXHA 5K7FA 3IKVA 2BOLA 5DCFA 1DP3A 4XRFA 5M5XJ 1NH3A 1ODDA 2O5RA 4CZZA 1PUFB 3DBHB 2IGMA 5EG0A 1ZYRF 1UZCA 3IH2A 3NWTA 3HL2A 2DU9A 1MNDA 2DK8A 1Z3XA 4ZYAA 4D0PA 1K79A 1K78B 1XGMA 4LG0B 5C4JJ 2VJJA 2VPLA 2P81A 3CMEI 3Q3SA 1JKQC 2O03A 3BJ6A 4XORA 1TP4A 2XRLA 1GV2A 3LSMA 5H6RA 1YITI 3HOVJ 3S15J 3PFYA 4KMUX 1IV6A 4IL6C 1WCMJ 5HS9A 4NC7A 2LG4A 3KP4A 5GPCA 1U5TB 2DFEA 2FU4A 2KJBA 1B72A 2G9WA 1W0TA 2LREA 4M74A 3LFUA 2EFPA 4D5FA 1VQOI 4KDPA 1XGOA 2EQRA 2CQXA 1H9GA 4DNCA 5TRDA 2GQQA 2W24A 5BQTA 3A0HC 1CF7A 3KYLA 4XKVA 4DZPA 2O7OA 5EG0B 2NVTJ 2VXDA 2E1NA 2M34A 4GYIA 4H4KC 4GXOA 5DYMA 2ZC2A 3S17J 4E70A 1Z9CA 1VNDA 2HKOA 2R7FA 2DODA 2HYGD 5HVQC 4R8HA 2WC2A 2P5VA 3EETA 2CO5A 3ABUA 2XGCA 2QM3A 5JHFA 1A36A 3HRSA 3KEYA 1VFCA 3N4MA 2JRTA 1Z05A 4ZYDA 4LOCA 2H27A 2XGEA 3J81K 1B72B 4M6YA 3JRBA 2JA6J 2E36A 2Q2EA 1BBYA 4XLAA 5A2QK 1LQ1A 1RI7A 4U7BA 4M3GA 1ZLKA 3DKXA 4HBLA 3HSRA 3FXQA 1CF7B 1LEBA 4IRGA 4ZC3A 2F5FA 2EIJH 2KRCA 1USSA 3OYNA 1OCOH 4FQGA 2GAUA 1MMAA 4CYCA 2AS5F 4YEJA 2RNGA 1U8RA 2V1XA 3BTLA 3KYCB 2EBIA 3RZDJ 1TT5B 3M4OJ 5JFRA 1G2HA 1BIAA 1MJ9A 5FKNA 4A6EA 4MTDA 2PLYA 5BPDA 4II3A 3CCVI 1D0XA 1RZ4A 3GXOA 3DEEA 2EFWA 1MBEA 3CC4I 1N78A 3A02A 3S3NA 2WA0A 1AHDP 1QO0D 3GX4X 2VONA 3ONQA 5K5OA 1V4RA 2EZLA 2KDOA 2Q2EB 1R36A 1OQYA 1TQMA 4FT8A 3DCFA 4C3HJ 3JRFA 3QQAA 5K7HA 3VSLA 1IRZA 5ERIA 2XSDC 1S7OA 4BNCA 3MN2A 3I54A 2XKPA 1DDNA 2BXZA 1TLHB 2DBBA 2JUGA 3CUQA 3PQJA 2MSYA 5EEHA 1X4PA 2D2WA 2DJNA 4CYCB 1VQ4I 4Y4RA 2ZBKA 2LF8A 1KU9A 2OUMA 2V9KA 3PIOF 1RIOH 3J81Z 3QRFF 3OL4A 4UY8I 4Y13A 3C18A 4EJUA 3PL8A 1JKPC 5A2QZ 5ICEA 1TW2A 1Z1DA 2MW8A 2UXXA 3F6OA 1QBJA 3BR5A 4BJ6C 4ZYHA 3ECOA 1PP8F 1SVMA 2QGUA 5ILSA 3VEPA 1KZHA 3BPXA 3AL0C 1I6HJ 2L5QA 1SAXA 4PSXA 3O8GA 2XPVA 3V42A 3OY9A 3BG5A 3CUQB 4Z2YA 3HOTA 1UHMA 2V1NA 1S7EA 4QIWN 4KITB 1ZRCA 3G3ZA 5HS8A 1U9NA 3JRHA 4AVPA 2VL8A 4AUXA 3WTTC 2ELHA 4EJOA 3HJEA 2IA2A 3WODF 2GXGA 4RBOA 3S1MJ 1WI9A 1OMIA 2M2EA 3K9TA 3NARA 4FCYA 2R7UA 4HQMA 1LJ9A 3GZ6A 5HNHA 2NXNB 3S2DJ 2EWNA 3GO5A 3TOBA 3HC7A 4UHTA 1YJWI 2QSHX 3DBLB 2X6YA 1NK2P 5HS7A 4GYGA 1B6AA 3GTPJ 2M7BA 3JSOA 1W5CC 1V5EA 3QOEA 4BHBA 2MFZA 3ASNH 1YFHA 4A12A 1NHAA 1T0FA 3OL3A 3V8LA 5JHUA 3E6BA 1K4TA 3O2PE 4WXDA 2E2JJ 3IL2A 1Y56A 2K02A 3OIQA 2M30A 2DOAA 1J59A 4L9NA 1T08B 4MNUA 5HDNA 1G59A 3QPTA 2Z1DA 3J7ZI 4LB5A 3P9CA 2Z9OA 4PFPA 5E1XA 5BS6A 2ELKA 3E5XA 2TCTA 4Q5SF 1SVLA 5HLIA 2M4GA 3TL4X 3RZOJ 4L5IA 1IV8A 3LSKA 3FHNA 3SDBA 3T0YA 2QBYA 3OYAA 1X58A 3RYRA 1ZLJA 1D5YA 1IN7A 2IP2A 1FSHA 2VBYA 1E0EA 2HWVA 1YS7A 2DMUA 1RR7A 1OFCX 1VQ7I 4A3MJ 3S2WA 1BJAA 2VE9A 1FIAA 5CLSA 2XGDA 1HKQA 1IDZA 4AC0A 5IOZA 2OZUA 4Y15A 5ICCA 2FMLA 3S16J 2NNYA 1FOWA 2DTZA 5FD5A 3EUKL 2FE3A 2XB5A 2M1BA 2BYVE 3AG3H 4XIDA 3JW4A 3SEZA 4HV5A 2ZO4A 3JRAA 5CVIA 3GTGJ 1P92A 4P96A 2M5WA 1X4OA 2OCEA 1ETOA 4L9JA 5EEAA 4ENNA 2FMYA 2FRHA 4PCQA 1FOXA 2E5ZA 4A5MA 4WCGA 1XSVA 4BE2A 4CSWA 2P4WA 3ZMZA 3HRMA 2DA3A 2QBYB 1PJRA 5E1ZB 3Q9SA 2EK5A 2XC7A 5D4SA 2HVRA 2LMDA 1S8NA 4XRSG 2R7SA 3RDIA 2LDUA 2AXTC 1HCRA 1O3QA 1LKXA 1U9OA 4ZZDA 2X1CA 4N9IA 4BEHA 2DPUA 1FNNA 4NUBA 4EGYA 2FNPA 3BZKA 5FD6A 3F22A 4ZTFA 3HSEA 3BR6A 1Z91A 2W57A 2XSJC 1SVOA 1YTYA 1YIOA 3LNQA 4O6JA 2F5EA 3ZGKA 3ROUA 3WHCA 1E2XA 3QOPA 3V8KA 1IN5A 2AHQA 2H09A 2O9LA 4BJTA 2D45A 3GTJJ 2JN6A 2CV2A 4DW6A 4IVNA 3P7NA 2H1KA 1HQCA 2RC4A 2WAQA 1NG7A 2CW7A 4UUVA 2HXIA 4CCMA 4XLCA 1N25A 3M1EA 2HKXA 3RIRA 4UUSA 2NOJB 3VWBA 4IX7A 2JWTA 2G7UA 2GXBA 4UXNA 3H3VK 4ENJA 3KZZA 4C3JJ 1WZ2A 1R49A 3BQZA 2HEOA 4PZJA 1JGGA 1K7AA 2ZFWA 1DU0A 2GIVA 2FOWA 4FE4A 4KUMA 4BEHB 1G3SA 3CF5F 3S93A 2R92J 3DTKA 1MJBA 2IGOA 2VPRA 2BHYA 5M3MJ 3IWZA 2W1OA 2XPUA 3FM5A 3W2WA 4WX9A 3EUAA 3SHFA 3LAJA 1BI2A 3K1PA 5LLQA 3H5RA 1EA3A 1DUXC 3L2VA 3DFGA 1P4WA 4KT5C 1LB2A 1YRNA 2PMZA 3VYRB 3S1QJ 4BXUA 1W4MA 2A6EF 4UUSB 1LE8A 2ZJRF 2W25A 2M9HA 2HDDA 1T8IA 4D9JA 4JP0A 3FIWA 2M8EA 4E4HA 4RB3C 5DM7F 4Q4ZF 1XMKA 5FGMA 2F5DA 4DBRA 4BDZA 2W7NA 2L7ZA 2L0KA 1O7FA 1SC7A 4HLXA 5B66C 2LKSA 2A07F 4XLFA 1Z7UA 2P0WA 3HEFA 3FX3A 2ZFUA 3BDDA 3LWFA 4HG2A 5D5UB 4ZJZA 4RAYA 1R7JA 5J3LA 2VUMJ 2YSRA 4EJVA 3NWSA 4OOIA 1I1SA 2LY2A 1XD7A 2XIGA 1YIJI 4L18B 4ETSA 4BU2A 5GPAA 3CCJI 1FYMA 1IRXA 4P5OA 3VSKA 4EMSA 4GCVA 5K1YA 3WU0A 5GAGJ 2PJPA 2RVCA 1YRNB 2ZCWA 2HDWA 5F0HA 1TWAJ 3OIOA 3RPUA 4LLNA 9ANTA 1FBUA 1EJ9A 3H3ZA 1REPC 2HTSA 5FFXA 4A69C 1JT6A 3OYCA 4JBAA 4L9TA 1ZQ3P 3GTKJ 1TW3A 2ZJPF 1PDNC 5DUKA 5D5VB 4ENMA 4BXFA 2WTEA 3ASOH 1R6RA 1U78A 2K9NA 3A01B 4Y52J 1T6SA 3HSFA 5D5XB 2XAUA 4XOTA 4N4NB 1VQNI 2CUFA 1FSEA 1H9TA 2WB1A 2M4KA 1ZG1A 3AL0B 3COAC 2G7HA 5IPAA 1X1PA 3G1MA 1HW2A 2JK3A 3VODA 1MSEC 3A2KA 1HDPA 1KGSA 4F92B 3G2BA 3HXLA 3QPSA 4L5EA 2QYOA 2XAJA 1FPQA 3BZCA 1YOVB 3H5AA 2VXZA 4I99C 1Y1WJ 1W36D 5K7ZA 4M6XA 2V6EA 3FKJA 3HBLA 1BI1A 3GYHX 2MH9A 1HOMA 2BGCA 3FXKA 1TQPA 3I59A 2CJJA 3L9FA 2GOMA 2YX4A 1VQMI 2KIQA 3OR2C 1QVUA 2F4MB 1TNTA 4GFBA 2F6CA 5F0FA 3U21A 3J7YJ 3DPLC 3CO6C 3UKGA 2MYSA 5JLWA 3DXJF 1QZZA 4EATA 3CZ6A 3R6SA 3DTIA 4HQEA 3I4MJ 5EDNA 2E19A 3DPUA 3H0GJ 1R5GA 1P7IA 4IRHA 1JTXA 2KIUA 2Z99A 3M1CA 3PNYA 4BQQA 1R1VA 2AQEA 3FMRA 4M6VA 4MFEA 1MBJA 2LH9A 4IEJA 3RKQA 1HLVA 3ZQQA 5J40A 2V1DA 1Y6IA 3I5UA 4XKBA 1JKOC 3I9V2 4IHWA 4U88A 1KQ8A 3RYPA 5E18F 4BBRJ 2DYRH 3GF2A 3I59B 1TZLA 5J47A 1GV5A 5EZHA 3AFHA 5LD2C 3KIOA 3PQKA 3U9GA 2DT7B 5JR3A 3JRGA 3U1DA 1DP7P 1S29A 3I64A 1VQ5I 4E6KG 3FMQA 2CFOA 3R4KA 3H3UA 1VQKI 2UZKA 2KT0A 1ZR2A 4F7ZA 2VQGA 3MZYA 4NC6A 2JVGA 4U87A 3KP2A 1LFPA 1WH7A 1JT0A 3MKLA 2EPFA 4RMNA 1HKTA 1J75A 4YFNF 1HBXG 2WV1A 4KN7X 2ID3A 1C0WA 3GZ5A 3P5JA 1KQ9A 2NRAC 2A68F 2VT3A 2XUBA 4II2A 4BY7J 2VQHA 1FLIA 1FC3A 4Y33A 3OYLA 3H5NA 2EFOA 2ZKZA 3S8PA 1MIJA 2X9DA 3OYFA 2XGXA 3WTZA 4A3CJ 4RB1A 4OMZA 2RN7A 3HOZJ 4P9FA 1J7KA 4BL0B 2E7WA 3EDPA 1XN7A 3E6CC 1FYKA 3GFLA 3LA7A 1R00A 2H6BA 1MBHA 2DI3A 2NAZA 2RQQA 1ETQA 3R61A 1FTZA 1XB4A 2MD0A 3FXRA 4DQ2A 3S14J 2YR2A 3C2HA 4RS8A 4ESBA 2HR3A 2BY3A 3EUHC 4IKFA 2VC1A 1ON1A 4NB5A 3S3OA 1QHGA 3HPHA 3QP6A 1ACIA 2F5CA 1MMSA 1H8AC 3K7AJ 1AKHA 1RNLA 3JRDA 2P6SA 1IXSB 4G6DA 2VIXA 4EEFG 4I2OA 2Y31A 4YG2F 5AIQA 4N0BA 4CCLA 3OYHA 3RPQA 1I6XA 1R71A 3CDIA 1D8JA 5IY5H 4OAZA 3GTOJ 3ZCOA 5C44J 5LHIA 3OYMA 2DQRA 1MDMA 3S2HJ 5GAEJ 2Z3YA 4CUGA 3T5XA 4BAYA 2XDVA 1F1ZA 1I39A 3TP0A 1T2KA 3FK7A 1QPMA 2L7FP 1X1DA 4WWCA 4UB8C 2QF7A 3K69A 3MFKA 4DJAA 3BZ6A 5DUIA 5D8KB 3RSNA 4EGZA 3QU3A 3CCLI 2VJ4A 3B02A 2BEOA 1A5JA 1IW7F 1YQAA 2Y0MA 3B73A 3QPHA 1E3OC 5ICFA 4X6AJ 4KFCA 1M1EB 4FE7A 1MMGA 3U1KA 3DWLE 5F08A 1GT0C 1QU3A 3GTMJ 1Z77A 3BP8A 3WGHA 1WWXA 1V54H 2V1UA 2VODA 2EV5A 2LVSA 5CVUA 4A3FJ 2EINH 2ZXWH 1B59A 3IAM2 1R4MB 1J5YA 2FUG2 3RKWA 2FQ4A 2DOFA 3OYEA 1POGA 5HNFA 3TBIA 2HFHA 3Q5FA 1EH7A 3C7JA 5M5YJ 4E7KA 3RTRA 1QGPA 3K4BA 3FF5A 2E71A 2VOPA 1F43A 5IT3A 5CQGA 4M3DA 3MZHA 4LMYA 3CC7I 3BG3A 5JLXA 1F9NA 3ZOBA 1OKRA 2IJLA 5IP9J 3DKWA 2IAIA 4ZDPA 3ZQFA 3FDYA 3F8FA 1HXDA 1MBGA 2OJED 3QPLA 3KYDB 5FLXZ 1XTAA 2MC3A 4GRIA 4HSRA 3GBGA 4I0AA 4RGRA 5LGUA 3WTUC 1MKMA 3RQ4A 3HOUJ 2KPMA 2NS8A 2HPIA 5M3FJ 1BL0A 2OA4A 3ABKH 4YELA 4PGGA 3IP4B 2DFHA 2CU7A 2NOGA 2E1MC 3DKYA 1V3FA 3RPUD 3HKZA 3BWGA 3MKZA 3F6VA 1FP2A 2ME0A 1X2NA 1STZA 5CJ9A 5E3NA 4BDYA 1HF0A 4V2FA 2Y30A 2YUSA 1BJZA 1BN5A 5KVRA 1WHUA 3E1SA 1RR8C 2DXIA 4XM3A 3H92A 3E5QA 4E7LA 1F5TA 4G7OF 4PK4A 3MMYB 5DCMA 1BC7C 4IHSA 2HOTA 1UB9A 4F93B 2QQBA 5FRNA 3GMEA 3LSHA 4JX4A 1WQ2A 2X0LA 3HZJA 1ZHFA 1N75A 2EB7A 4XMYA 2GM4A 1X3ZB 4YRVA 5JI6A 2KRHA 4G7ZF 1G4DA 4DIQA 3BG9A 2QQAA 3RI4A 1ZK8A 2QKMB 5FROA 4AD9A 3I55I 4OIQF 5BPIA 1OR7C 5BNGA 1BW6A 2B0LA 2FF4A 2V79A 1ENHA 1P4XA 1LPQA 2CQNA 2IW5A 3HOYJ 1AU7A 1P6RA 2X4HA 3F23A 4X1EA 1PUEE 1LDKB 4AIJA 4GDFA 2JZYA 1IXCA 1MNMC 3KFWX 1S7AA 3GCMA 3M9AA 4H0EA 4S05A 1ZH5A 2FEZA 4MEYF 5F04A 4A3BJ 5DCMB 4WK8F 2V26A 4K2EA 4HX4A 4XN3A 2BY2A 4RAGA 3B6CA 5J6XA 2LBFA 3HG9A 3WGGA 3FM3A 1PYVA 2VASA 4CCKA 2PI0A 3X2QH 5LGNA 2DA4A 1CGPA 1YW7A 3WTYC 4Y17A 4DYQA 5D6FA 3GLXA 1HKSA 4UVBA 3DV8A 4J19A 3HHGA 3I4PA 1E3PA 2OQGA 2AQFA 1FMVA 2A5YB 2K3FA 3TGNA 4U0YA 3DLAA 1X19A 4AYBA 4XKCA 2M45A 3D1NI 2F2EA 3ML6A 3ZMSA 3K0LA 3ZP5A 3L2QA 5GTIC 3VYSB 5IYCJ 2CV1A 3PJRA 2F5VA 3WE3A 3PSIA 5CQEA 2MG4A 2GLOA 1GXPA 1S6LA 2O0YA 2LBFB 4XL9A 3TW7A 2EIKH 2R5ZA 4HW0A 4LD5A 2H1LA 3D5SC 1SEUA 2CWEA 2JSPA 3F9KA 4YFXF 4C30A 1GHCA 3J80Z 4P1WA 4BGDA 5IP6A 3A03A 1SD7A 4DZJA 1R1TA 3ABTA 1NG6A 4HX8A 1JHFA 3EUHA 4M71A 4V2GA 3QYEA 1WJBA 3LL7A 4BHCA 2KDZA 5FO5A 2MH2A 5CVJA 1IN4A 2BY0A 2RKHA 3M8JA 2PQ8A 4ON0A 3IWFA 5K5QA 3IRQA 4ZTJA 2JA5J 2HOAA 3ABLH 4A0YA 5DDGA 1E17A 2CQKA 1X2MA 4LLGF 4W1UA 1AOYA 2P5LC 2NVXJ 1Y8RB 1XGNA 2HYFA 3E7LA 4DYCA 1LUJB 1U0JA 1USTA 4BKXA 3ZR8X 2R5ZB 5EJCA 4J01A 5LEJA 4AM3A 5CVRA 1G3TA 3TO9A 1UG0A 2LNBA 2QVOA 2UV1A 3VYUB 4XRSA 1EH6A 1IF1A 4BHPA 2IPQX 5KNLA 3ZRGA 1QZYA 2XASA 1QA6A 1I5ZA 2ECBA 3CJQB 3E5UA 5LEKA 2HI3A 1ZRDA 3KE2A 2COBA 4XRMA 3BOQA 3ZN0A 4IO9F 2BZTA 4JK1X 2Q8KA 4CCNA 1LEAA 3DU5A 2FNAA 2DA5A 2QKLB 3MKYB 2DFIA 4OWRB 4A3IJ 1F36A 1NK3P 2LY9A 3JTGA 2CMPA 1ZN2A 1MSFC 2RV8A 2XAGA 4F91B 3FBIB 4B8XA 2DLLA 1IGNA 4KIGA 2IGNA 2Y75A 3Q0UA 2JTVA 3CTAA 4B3XA 1B4AA 2IT0A 3OSGA 3JRCA 1SFOJ 4E7IA 3SYTA 1LDJA 3HB9A 2QENA 1D3YA 1TWFJ 3L7WA 3E6MA 5FJ8J 3H9GA 3L2WA 1D1BA 1Y1VJ 2O6GE 2EA2A 2ZNYA 3C2GA 1FTTA 4XOPA 2QLZA 4A3LJ 3CMMA 5FKOA 2L2OA 4BYYA 1QVTA 1RKTA 2DAOA 3R60A 3FHZA 4KIFA 4ESJA 2VKDA 2FBIA 1DU6A 2E5NA 1Y0NA 3ERMA 3CP2A 4I6ZA 3PM1A 1ORKA 5DM6F 1JGSA 2P5KA 1ULYA 1R5HA 2WBMA 2VKHA 2ELJA 4LLLA 5DS9A 1D0YA 2A69F 2K40A 2L9NA 1I3QJ 3REOA 1HW5A 5KAFC 2AXLA 3HGGA 3LQQA 4M9XA 4RLQA 5LHHA 3HTSB 5KK1A 1ETVA 4CZCA 1G8XA 4HOBA 3C2BA 3L2RA 4XQFA 2Y2ZA 4NDLA 2DMQA 4V19K 3L00A 4NHJA 2D1VA 1D1AA 2PX9A 3K4CA 3M07A 1MH4A 3IHUA 4DBQA 5L3EA 1OR7A 3VOEA 1KONA 1ITYA 4FHTA 3MD2A 2R4GA 2VBZA 3SEQA 1TL8A 1B9MA 3LSIA 1ON2A 1H89C 4PJJA 2JPCA 1YHQI 1WRJA 4RA2A 3WG7H 4A0ZA 1GXQA 3FXMA 1B8IA 5B1AH 3NQOA 2C6YA 3G4SI 1BR2A 3P9IA 1TWCJ 3A1YA 2DJIA 4E7JA 3FXJA 3KP7A 4XLNF 4UVCA 3LFKA 1APLC 2ZXHA 1LVKA 2Y0SN 3KETA 2CS3A 4OIRF 4M9ZA 3IH3A 4O3MA 5EF6A 1ERDA 4S04A 2EIMH 2A3SA 2L4MA 2R7OA 3WTSC 3CCRI 1VQ8I 3WU2C 3GEZA 3JR9A 1KQ0A 2HS5A 1OISA 2Y48A 1RRJA 5J8CA 1ZR4A 5L3GA 1ZGJA 1R23A 2DA2A 5E8IA 4M72A 2HVQA 3W6JB 3FXLA 2D5VA 1MBKA 3ZQIA 4HF1A 4RDUA 4XSZF 5ILUA 2YS9A 4U7DA 4E7HA 1A31A 4HSTA 3FKIJ 2OV7A 1T95A 3OS1A 1WKMA 1B8IB 2OU2A 2UUZA 3HRUA 3EPZA 2GOXB 3IH4A 3W6KB 2DPDA 3TO6A 2VJIA 2IBDA 1BR4A 4IJAA 1LE8B 1FIPA 4B44A 2R7QA 4F3QA 1VQPI 3OIPA 3A4CA 4N4OB 3BJAA 3BCBA 2JQ7A 4MHGA 5D4RA 2FBKA 3MCZA 3IV5A 2O61A 3FXOA 3HOSA 3D5RC 4C3IJ 4WF2A 5LFAA 4A5NA 3KEOA 1J09A 4HA8A 3MZ8A 4QTRA 1WJFA 2HNHA 1W0UA 1XG1A 2W48A 3JTHA 4XSXF 4FASD 3CD6I 1JXSA 4G7HF 2ID6A 4L0YB 2JA7J 4KJZA 3I56I 3H36A 1AWCA 1WH5A 1OYWA 3GVAA 4RGXA 1FX7A 2E1CA 3Q0VA 3E0JB 2L9SA 1YW9A 4IZZA 1RESA 1XPXA 1U3EM 4C2MJ 1JJ6C 5GAHJ 2IS4A 4BACA 1XX5A 2ZJ2A 1GDTA 2CRGA 3CP8A 1IXRC 1W7PA 2DA6A 1FOKA 3KLOA 2BXYA 1JI8A 1T98A 1QQIA 4IXAA 5TJJA 2B7EA 3CF2A 3CCQI 4QLCU 3QAHA 4IF4A 4AIDA 1KU7A 3KZYA 3TEDA 3I4NJ 4U0WA 2DOEA 4FX0A 1R1UA 1OCTC 3ZMTA 3ZQHA 4YIRX 1BW5A 1Q1VA 4Z6YA 2EJRA 3LSGA 3HTUA 1IN6A 3IKTA 1EV7A 4C2TA 3GTLJ 4I0BA 1X3UA 2HQ5A 1WSUA 2TDXA 4Y3OA 3GWZA 1LNWA 4ASNA 2X1EA 1ETYA 5J4VA 1ZARA 4IQ4A 2XPWA 2EFQA 4D7NA 4I02A 2FJ1A 1D5VA 3H35A 5LRSA 1W7PB 1VQ9I 3ERED 1F4KA 1BM9A 4AIKA 2Z2SB 2OAZA 4LIVA 2RDPA 2PJRA 1LFBA 1OCZH 2PG4A 3E3VA 1EH8A 5ICGA 2IA1A 2XAFA 2LR8A 4KT6A 2X6XA 4OU0A 1YX5A 3C3WA 1YI2I 2OQRA 3PO3J 2LLKA 2N8GA 1MH3A 4RM3A 2LY1A 1ETWA 1SFUA 2M8GX 3VPRA 4IOAF 2X48A 2A6TA 1NTCA 5HDKA 2QEXI 2KHMA 3KP6A 4LK1F 4TV7A 1S9HA 1U8BA 2BY1A 4UV9A 1R9TJ 1SANA 1ZAOA 2OCCH 2ZNZA 4F55A 4J00A 2ICWG 3LSTA 1T38A 1XDSA 4HNUA 4CCOA 2P6TA 5E20A 2V6CA 2OTJI 1XMXA 3GTQJ 3SZGA 3GFJA 3W2VA 2CSOA 1A6IA 2QQ8A 2GWRA 1W5TA 2K9SA 4RB2C 2PJRB 1WJDA 4Q48A 3BR1A 2I5UA 4M9SA 5IOYA 1VZ0A 3ZQCA 3N97A 3ESWB 4L5JA 3RKYA 2PEXA 1HC8A 2LFBA 1Z6TA 3CJNA 3I0TA 5IT9Z 1XDUA 2K85A 3ECHA 2O8XA 4HZFA 2J5OA 1XSDA 3ZPLA 2HPMA 2LKXA 5GADJ 5HLHA 1R4NB 1T56A 2CQQA 1UJ8A 3EQLF 5E17F 4A2UA 5E79C 3DP7A 3CDHA 1XSXA 2DMTA 2TRTA 5L3FA 1BA5A 2LD5A 4HF2A 1I50J 2IEKA 4MIMA 2VQCA 3J7AY 2QQ9A 2D1HA 3CLQA 3LSRA 4U0VA 3BLYA 1XC5A 2OZ6A 3R0AA 1MMDA 3H0DA 2K9MA 1SD4A 2CH0A 4G12A 1K6YA 3B6AA 3SFIA 1UCRA 4IHTA 2BVLA 1KA8A 4W97A 1VQLI 4RGUA 1JE8A 2MABA 1SMTA 3TMOA 2IRFG 3CUOA 1ZREA 1RUNA 1TWHJ 3CDLA 4XONA 2VN2A 3CMAI 1X1CA 2K9QA 3FK6A 2QZ8A 2L9VA 4OMYA 1KU2A 2R3SA 3SZTA 5FLXK 5J1UA 3HPGA 4CDGA 3L1PA 2HXOA 4EM0B 4RAZA 3IUOA 5FKKA 4B1RA 2DCEA 2MC4A 4WXCA 2DO7A 3JAMZ 2KL4A 3BPVA 1PVEA 3JREA 3HIFA 4CA0A 2GXAA 5D6EA 1WJEA 5L3DA 3ZQLA 3QP5A 1YW8A 2V7FA 2G0EA 2NS0A 4KIBA 1S72I 2IS1A 1X1BA 2Y69H 4IPAA 3BR3A 1JJ8C 1TTYA 2FA5A 4HV6A 1R22A 4R79A 4CO8A 2CQ7A 2LC2A 2X85A 2L54A 4RB0A 3AKZA 3VDXA 1AKHB 2GZWA 3KEQA 3PO2J 1UG2A 4ZYGA 2CYYA 1WPKA 5J4YA 2HVSA 2ISYA 4I98B 3K2ZA 3KP3A 2MBFA 4HYEA 1JHHA 3I3LA 2WAEA 5FKLA 4S0HB 5LHGA 1MD0A 3RQIA 3OOUA 4EVIA 4BQOA 3VFZA 2NNNA 4HAMA 1MDMB 3CCSI 1GUUA 3H9QA 4IHVA 1FMWA 1O3TA 2LF7A 1P7JA 1Z6RA 4FTHA 1K6OA 2KFDA 4PUSA 4C9YA 3OYDA 1Z0XA 1UELB 3M7GA 4AYBN 3ELKA 3F8BA 3DBRB 1VI0A 5TGTA 2L7KA 4MQVA 2M87A 2HYJA 4CCJA 5IYDJ 2E60A 2ZSHB 1BIBA 4KISA 2HZDA 3CCYA 1K61A 3OYGA 1ZG3A 3HDDA 3HUGA 4BY1J 2RGVA 3C1DA 1Z21A 4I01A 4Y7NJ 3F72A 3EYYA 1V5GA 3KCCA 1U2WA 4PGHA 3K70C 3CJTB 2H8RA 2R5YA 1RC9A 2P8TA 2VT2A 2HQRA 3FXUA 1J0RA 1ETXA 4BE1A 2GA2A 5J1YA 2E7XA 1WJAA 3L2CA 3OYKA 2L7MP 3F8MA 4E7SA 3MVPA 3GFIA 1IRGA 3LMMA 4KYWA 3LOCA 1Y8QB 2OPTA 1W5SA 4B43A 2NVQJ 1I3AA 1KYZA 4ESFA 3LA3A 4ITVA 5D8LB 2BE5F 2WY8Q 2H94A 4MLOA 3L2UA 3AG2H 5EYRA 4AVZA 2JJ7A 2QSGX 2DYSH 3J7AO 4RLFA 4LG3A 3DF8A 2Z16A 1P2FA 2HTJA 1JUMA 3T8TA 1ZELA 3W3CA 4I76A 5GP9A 4EM1A 3KX2A 2DW4A 2ACJA 3HUGB 4MTEA 2EFNA 1GVJA 1A6QA 3EYIA 4ZYEA 3CLOA 5DD8A 1JKRC 2HOEA 3K2AA 1T39A 1SD5A 3K1NA 1OCRH 3DPTA 1WI3A 1G3WA 3CESA 3QYBA 5B3SH 2R5YB 4LK0F 5CVVA 2W00A 4EJWA 3AG4H 1TT0A 2FBHA 3GZNB 2X6WA 3QWLA 2M7AA 2JT1A 2KIFA 5FB2A 1W7PD 3BR0A 3WU1B 3TOAA 1BR1A 3QU6A 2WV0A 3J80K 2K27A 2EILH 5AONA 2X1DA 2CGPA 1WVRA 5HODA 2GBYA 2I8DA 3DU6A 5HOOA 3DEWA 1IDYA 3CCUI 3BG6A 2ADUA 3GFMA 4KA4A 1O7LA 4B09A 3FMSA 2RNJA 2ECCA 2XV4S 3K4MA 3PFIA 2WADA 1JUPA 3UNGC 5B1BH 2ESNA 2VKEA 2RREA 2FD5A 1SD6A 2DN0A 2K4JA 4BUPA 3GW2A 2PN6A 2XF6A 4JX6A 4A6DA 2E2HJ 1ZG5A 3ISPA 2FOKA 3BY6A 1RUOA 3SFZA 2DK5A 1B9NA 4A3JJ 4M3FA 1WJCA 2IS2A 1T33A 2AO9A 2KRFA 3K4LA 4XK4A 1IG7A 2LK2A 1YJNI 5L3CA 1UAAA 4HEA2 4JQFA 2EZHA 4A3DJ 5DTDA 2QWWA 3NEUA 3T8RA 5LGTA 2F4IA 4G6TB 1YYVA 1BOBA 1W1WE 2EA4A 2Y9YA 3DLLF 4D7MA 4FX4A 4YFKF 5B5EC 5FLVA 2VOOA 1DGWY 2STTA 3K10A 4D1QA 1G3YA 2FXAA 2PMUA 3KP5A 1Y39A 2W84A 2WAQN 3OS2A 3W6VA 3QYFA 1S5LC 2YPRA 1UHWA 2XF5A 2R0QC 1OYYA 4I7HA 2DT6A 2J5PA 2EZIA 1TC3C 1WJ5A 4EQQA 1PP7U 3HRTA 4UVAA 5LRRA 1VF9A 4XLEA 1QZEA 2A5WA 1QPIA 4C2UA 5H2FC 3CCMI 4IHXA 1FWZA 1FY7A 2EZKA 3SDGA 1XGSA 2E34A 3V7SA 4YIFA 5KAIC 2VQLA 2LOOA 4HLYA 4UV8A 2YU3A 1HSTA 3P9KA 1R58A 2DA7A 3G71I 5BMZA 5ILVA 2HDCA 1LFUP 2H6CA 2BW3A 3TQNA 5J1RA 2KISA 2JA8J 3K6GA 3G6EI 3F21A 1SAUA 3BG7A 2XROA 3D0SA 3TW6A 2PMZN 2FX0A 1YO5C 1FEXA 4XR6A 4RM2A 1IAWA 1IZ1A 3JCUC 2W82A 4G6QA 4CHUA 4PJMA 4F52A 1IO2A 3BQYA 4OINF 4UB6C 4CGZA 3WHBA 2NS7A 2BHZA 6PAXA 3VB2A 2VKVA 5AIPA 2LKPA 5J8FA 4GO1A 5M5WJ 5H6QA 1D8KA 1MBFA 2Y9ZA 3PUFA 3ZN1A 5FFZA 2KIMA 1BC8C 3DQVC 4A3KJ 1Z3YA 2O3FA 1RKWA 1H0MA 1BI0A 2OTLI 2VC0A 5CKTA 2BW3B 5HDGA 1HW1A 1OCPA 2ZMEC 1VTNC 2DMNA 1FT9A 2HGCA 4IHYA 1OYIA 2XAHA 1I27A 3OV8A 4P9UA 1S3JA 1IC8A 1YJ9I 4HNTA 1O3RA 4E7ZA 3CQZJ 3M3YJ 5E3MA 1KYWA 3Q9VA 1MJAA 3TDZC 4YIIA 5ED4A 3HOWJ 4BQNA 1IRFA 1Q1HA 4XKWA 2L4AA 1R5ID 4M3EA 4BS9A 3SXYA 3M8EA 2FQ3A 2QCOA 3WGIA 4XLPF 2MD5A 2QUFA 5DEQA 3A0BC 1Y0UA 4N9HA 1RETA 2LSOA 4LFUA 2DFFA 3BJOA 3BCAA 4UUTA 2A61A 1J2XA 5C4XJ 1ETKA 1EKEA 1SFKA 3CCEI 4UNOA 3LA2A 2XKOA 2DMPA 4LB6B 1X3WB 4LJZF 2BBYA 3CO7C 1OPCA 4BE0A 2WB1N 4ENKA 1JTYA 3E97A 2LYCA 4OAYA 2X6OA 2W85A 2W4SA 3AG1H 4CYDA 2QSFX 2M0MA 3HGYA 5F27A 2R93J 1MMNA 3TP3A 5H20A 2KQRA 2XHKA 2QA4I 3Q0WA 3F0CA 4BBSJ 3WG9A 4B3AA 1TQIA 3G1OA 2UXNA 2R7RA 2R7WA 5EZGA 2E1MB 2ISZA 4M73A 1V55H 4KN4X 2NVUB 5TISC 4BXXJ 4L9VA 3K4JA 1QRYA 1E3HA 2X51A 2XVCA 3ZMDA 3DEUA 2ZJQF 3O8HA 2MLKA 3S1RJ 2KZVA 4ABZA 3WTXC 1SMYF 4JOMA 2L02A 3PNVA 3ZMUA 3JSPA 2VLAA 5E3OA 3G1LA 4PJNA 3N05A 3H9JA 3F8CA 2JPBA 3BTJA 1FJLA 2XAQA 2LP0A 2K4BA 3CMYA 3O3KA 5EGOA 2Q0OA 4O5VA 2CUEA 4EM2A 4QPOA 1RPWA 3WTVC 3OYBA 2L9RA 4IQJA 2F48A 1U5TC 4MFDA 2HZTA 3TDUC 1ZGWA 2ME6A 3OYJA 2M3AA 1ONVA
chains in the Genus database with same CATH topology
3ZQ7A 3L09A 2KJCA 4RGSA 4CICA 3IRRA 5BOXA 2NYXA 5LBQA 2Z33A 5L3BA 4HX7A 1XCBA 1LDDA 1MZBA 3GUDA 4MQ9F 1L0OC 5HLGA 4Q47A 1YG2A 3ZMVA 1QNTA 2BV6A 3G73A 3TO7A 4HDVA 5E1WA 3D5LA 1MGTA 4PDKA 1YS6A 2IVMA 2WWYA 5DD4A 2XRNA 1SFXA 1U6GA 1TBXA 5E8GA 4GGGA 1FBSA 3TKYA 3LQRA 3HYIA 2RQPA 3SZPA 1SFEA 2PBIA 4MGRA 3F8NA 1HSJA 1ZRFA 3HHHA 2DT5A 5F1RA 5CYVA 3O6BB 3I53A 1J9IA 1DPRA 1B1BA 1KU3A 4NQWA 5JVTA 1FZPB 2UWMA 4I09A 2P7CB 2EV6A 3ULQB 4MEXF 3KLNA 2PFBA 2V9VA 3V8JA 1L3LA 2EV0A 1XCVA 1DPUA 2IA0A 5IT9K 2ETHA 3I71A 5F6FA 1IN8A 3FWEA 3AAFA 2OD5A 2MLGA 2P7VB 2PMHA 3WTWC 3SQNA 2VE8A 1O57A 3MAJA 2K7LA 2ZMEA 1A04A 4XBFA 2JSCA 3V7CA 4HDUA 4R1HA 1FP1D 4ZH4F 4BQAA 4OIOF 5K5RA 2L3DA 2VBXA 4P55A 4L0ZB 3E6DA 2K86A 3M8FA 2OBPA 1XMAA 3V7RA 2L01A 2FSWA 2DQLA 1IUYA 3LAPA 3CUQC 3U2RA 2R7DA 1UFMA 1TNSA 3I58A 2ESHA 3RJPA 5DV5A 1O3SA 3FZVA 4AIHA 3JAMK 3F3XA 3V4GA 4IRIA 2VBWA 2ZMEB 3WE2A 2Z5UA 3MEXA 2STWA 4LGWA 1G6NA 4A0XA 2CFXA 4KNYA 4AWXB 4G94A 3NRVA 2A6HF 2DTRA 4CXFA 3T1BA 1LVAA 3OOPA 1FBQA 4KICA 2COMA 1P4AA 3BROA 4BH9A 1BI3A 2HQNA 3R0JA 2CG4A 4EV0A 5F64A 4KMFA 2KKOA 2GA1A 4G9YA 2MA3A 3MWMA 1K78A 4LG0A 5D5WB 5EEGA 4G8XA 1FYLA 4ZZLA 1I1GA 3IC7A 4HF0A 3ERED 1BOAA 1U5TA 2CW0F 3RKXA 1YLFA 2ZXJA 3MQ0A 2YX7A 1ZGAA 4OIPF 4EJTA 4QWQA 3K1MA 4WXHA 3IKVA 5DCFA 4XRFA 1ODDA 4CZZA 1ZYRF 2DU9A 2DK8A 1K79A 4D0PA 1K78B 1XGMA 4LG0B 2O03A 3BJ6A 5H6RA 4KMUX 5HS9A 3KP4A 1U5TB 2FU4A 2KJBA 2G9WA 4M74A 2EFPA 4KDPA 1XGOA 5TRDA 1H9GA 4DNCA 2GQQA 2W24A 5BQTA 1CF7A 2E1NA 4GYIA 5DYMA 4GXOA 4E70A 1Z9CA 2HKOA 2R7FA 2HYGD 5HVQC 4R8HA 2WC2A 2P5VA 3EETA 2CO5A 3ABUA 2QM3A 3HRSA 3N4MA 2JRTA 1Z05A 4ZYDA 2H27A 3J81K 4M6YA 2Q2EA 1BBYA 5A2QK 1LQ1A 1RI7A 4U7BA 1ZLKA 4HBLA 3HSRA 3FXQA 1CF7B 1LEBA 4IRGA 2F5FA 1USSA 2GAUA 2AS5F 1U8RA 2V1XA 5JFRA 1BIAA 1MJ9A 4A6EA 4MTDA 2PLYA 5BPDA 1RZ4A 3GXOA 2EFWA 1QO0D 3GX4X 2VONA 5K5OA 1V4RA 1R36A 1TQMA 4FT8A 5ERIA 1S7OA 4BNCA 3I54A 2XKPA 1DDNA 1TLHB 2DBBA 3CUQA 3PQJA 5EEHA 2D2WA 2ZBKA 2LF8A 1KU9A 1RIOH 3J81Z 3QRFF 4Y13A 3C18A 4EJUA 5A2QZ 5ICEA 1TW2A 1Z1DA 2UXXA 3F6OA 1QBJA 4ZYHA 3ECOA 1PP8F 5ILSA 3VEPA 3BPXA 1SAXA 3CUQB 4Z2YA 3HOTA 1UHMA 1ZRCA 3G3ZA 5HS8A 4AVPA 3WTTC 2ELHA 4EJOA 2IA2A 3WODF 2GXGA 1WI9A 1OMIA 3K9TA 4HQMA 1LJ9A 3GZ6A 2EWNA 3GO5A 3TOBA 4UHTA 5HS7A 4GYGA 1B6AA 3JSOA 4BHBA 1YFHA 4A12A 1NHAA 1T0FA 3V8LA 5JHUA 3E6BA 3O2PE 4WXDA 3IL2A 2K02A 2M30A 1J59A 4L9NA 4MNUA 5HDNA 3QPTA 4LB5A 3P9CA 2Z9OA 5E1XA 5BS6A 3E5XA 4Q5SF 5HLIA 4L5IA 2QBYA 3T0YA 3RYRA 1ZLJA 1IN7A 2IP2A 1FSHA 2VBYA 2HWVA 1YS7A 3S2WA 1BJAA 2VE9A 5CLSA 1HKQA 2OZUA 4Y15A 5ICCA 2FMLA 2NNYA 5FD5A 2FE3A 2M1BA 2BYVE 3JW4A 4HV5A 2ZO4A 5CVIA 1P92A 4P96A 2M5WA 4L9JA 4ENNA 2FMYA 2FRHA 4PCQA 4A5MA 4WCGA 1XSVA 2P4WA 3ZMZA 3HRMA 2QBYB 5E1ZB 3Q9SA 2EK5A 5D4SA 1S8NA 3RDIA 2LDUA 1O3QA 4ZZDA 4N9IA 2DPUA 1FNNA 4EGYA 2FNPA 5FD6A 3F22A 3HSEA 1Z91A 2W57A 1YTYA 1YIOA 4O6JA 2F5EA 3ROUA 1E2XA 3QOPA 3V8KA 1IN5A 2H09A 2D45A 4IVNA 3P7NA 1HQCA 2RC4A 4UUVA 3M1EA 2HKXA 3RIRA 2G7UA 2GXBA 4UXNA 4ENJA 3KZZA 2HEOA 4PZJA 1K7AA 2ZFWA 2GIVA 4KUMA 1G3SA 1MJBA 3IWZA 3FM5A 4WX9A 3SHFA 3LAJA 1BI2A 3K1PA 5LLQA 1DUXC 3DFGA 1P4WA 4KT5C 1LB2A 4BXUA 1W4MA 2A6EF 2W25A 2M8EA 4RB3C 4Q4ZF 1XMKA 5FGMA 2F5DA 1O7FA 4HLXA 2A07F 1Z7UA 3FX3A 3BDDA 3LWFA 5D5UB 4RAYA 1R7JA 2YSRA 4EJVA 4OOIA 1I1SA 1XD7A 2XIGA 4L18B 4ETSA 1FYMA 4P5OA 4EMSA 4GCVA 5K1YA 3WU0A 2PJPA 2RVCA 2ZCWA 3RPUA 4LLNA 1FBUA 3H3ZA 1REPC 2HTSA 5FFXA 4JBAA 4L9TA 1TW3A 1PDNC 5DUKA 5D5VB 4ENMA 2WTEA 1T6SA 3HSFA 5D5XB 1FSEA 1H9TA 1ZG1A 3COAC 2G7HA 1HW2A 3VODA 1KGSA 2QYOA 2XAJA 1FPQA 2VXZA 4M6XA 1BI1A 3GYHX 2MH9A 2BGCA 3I59A 1TQPA 3L9FA 2YX4A 1TNTA 3DPLC 3CO6C 3DXJF 1QZZA 3R6SA 4HQEA 1R5GA 4IRHA 2KIUA 2Z99A 1R1VA 3FMRA 2V1DA 3I5UA 4U88A 1KQ8A 3RYPA 5E18F 3GF2A 3I59B 3PQKA 3U9GA 5JR3A 3U1DA 1DP7P 1S29A 3I64A 3FMQA 3R4KA 3H3UA 2UZKA 4F7ZA 3MZYA 3KP2A 1HKTA 1J75A 4YFNF 1HBXG 4KN7X 1C0WA 3GZ5A 1KQ9A 2NRAC 2A68F 2VT3A 2XUBA 1FLIA 1FC3A 2EFOA 2ZKZA 2XGXA 3WTZA 4RB1A 4OMZA 2RN7A 4P9FA 1J7KA 2E7WA 3EDPA 1XN7A 3E6CC 1FYKA 3GFLA 3LA7A 1R00A 2H6BA 2DI3A 2NAZA 3R61A 1XB4A 3FXRA 4DQ2A 2YR2A 4RS8A 4ESBA 2HR3A 2VC1A 1ON1A 4NB5A 3QP6A 2F5CA 1RNLA 2P6SA 1IXSB 4G6DA 4I2OA 4YG2F 5AIQA 4N0BA 3RPQA 1I6XA 1D8JA 5LHIA 2DQRA 1MDMA 2Z3YA 3T5XA 4BAYA 1F1ZA 1T2KA 1QPMA 4WWCA 3K69A 3MFKA 3BZ6A 5DUIA 5D8KB 4EGZA 3QU3A 3B02A 2BEOA 1IW7F 1YQAA 2Y0MA 3B73A 3QPHA 5ICFA 4KFCA 3BP8A 3WGHA 1WWXA 2V1UA 2VODA 2EV5A 5CVUA 1B59A 1J5YA 3RKWA 3Q5FA 2HFHA 1EH7A 3C7JA 3RTRA 1QGPA 3FF5A 2VOPA 5IT3A 3MZHA 4LMYA 1F9NA 1OKRA 2IJLA 3DKWA 3F8FA 1HXDA 5FLXZ 3WTUC 4I0AA 2MC3A 4RGRA 1U78A 5LGUA 1MKMA 2OA4A 4PGGA 1V3FA 3BWGA 3F6VA 1FP2A 1STZA 5CJ9A 1BN5A 5KVRA 3H92A 3E5QA 1F5TA 4G7OF 5DCMA 1BC7C 4IHSA 1UB9A 2QQBA 1WQ2A 2X0LA 1ZHFA 2EB7A 1G4DA 5JI6A 4G7ZF 2QQAA 3RI4A 4AD9A 4OIQF 5BPIA 2B0LA 2FF4A 2V79A 1P4XA 2IW5A 1P6RA 2X4HA 3F23A 1PUEE 1LDKB 4AIJA 2JZYA 1IXCA 3KFWX 1S7AA 3M9AA 4H0EA 4S05A 1ZH5A 2FEZA 4MEYF 5DCMB 4WK8F 4K2EA 4HX4A 5J6XA 3WGGA 3FM3A 2PI0A 5LGNA 1CGPA 1YW7A 3WTYC 4Y17A 5D6FA 3GLXA 1HKSA 4UVBA 3DV8A 3HHGA 3I4PA 2OQGA 2A5YB 3TGNA 4U0YA 2M45A 2F2EA 3ML6A 3ZMSA 3K0LA 3ZP5A 3WE3A 1GXPA 1S6LA 2O0YA 4HW0A 4LD5A 2CWEA 4YFXF 1GHCA 3J80Z 1SD7A 1R1TA 3ABTA 4HX8A 1JHFA 3EUHA 4M71A 4BHCA 5FO5A 2MH2A 5CVJA 1IN4A 2RKHA 4ON0A 2PQ8A 3IWFA 5K5QA 3IRQA 4A0YA 5DDGA 1E17A 2CQKA 4LLGF 1AOYA 2P5LC 1XGNA 2HYFA 1USTA 5LEJA 5CVRA 1G3TA 3TO9A 2LNBA 2QVOA 1EH6A 1IF1A 4BHPA 2IPQX 1QZYA 2XASA 1I5ZA 3E5UA 5LEKA 1ZRDA 3KE2A 3BOQA 3ZN0A 4JK1X 2Q8KA 1LEAA 2FNAA 2DFIA 3JTGA 1ZN2A 2RV8A 2XAGA 4B8XA 2DLLA 4KIGA 2Y75A 2JTVA 3CTAA 1B4AA 2IT0A 1LDJA 2QENA 1D3YA 3L7WA 3E6MA 2O6GE 2EA2A 2ZNYA 2QLZA 4BYYA 2DAOA 3FHZA 3R60A 4KIFA 4ESJA 2FBIA 1JGSA 2P5KA 1ULYA 1R5HA 4LLLA 2A69F 3REOA 1HW5A 2AXLA 3LQQA 4M9XA 5LHHA 3HTSB 5KK1A 4HOBA 3L00A 4NHJA 2D1VA 3IHUA 5L3EA 1OR7A 3VOEA 4FHTA 2VBZA 1B9MA 1ON2A 2JPCA 1WRJA 4A0ZA 1GXQA 2C6YA 3NQOA 3P9IA 4XLNF 3KP7A 4UVCA 3LFKA 3KETA 4OIRF 4M9ZA 4O3MA 4S04A 2A3SA 2L4MA 3WTSC 3GEZA 1KQ0A 2HS5A 2Y48A 5J8CA 5L3GA 1ZGJA 1R23A 5E8IA 4M72A 3W6JB 4HF1A 4XSZF 5ILUA 4U7DA 1WKMA 2OU2A 3W6KB 3HRUA 2DPDA 3TO6A 4IJAA 3BJAA 4MHGA 5D4RA 2FBKA 3MCZA 2O61A 3HOSA 4WF2A 4A5NA 3KEOA 4HA8A 3JTHA 4XSXF 1JXSA 4G7HF 4L0YB 1AWCA 1OYWA 3GVAA 4RGXA 1FX7A 2E1CA 1YW9A 1U3EM 2ZJ2A 1IXRC 1W7PA 1FOKA 3KLOA 1T98A 1QQIA 4IXAA 5TJJA 4QLCU 3QAHA 4IF4A 1KU7A 3KZYA 4U0WA 4FX0A 1R1UA 3ZMTA 2EJRA 3HTUA 1IN6A 3IKTA 1EV7A 4I0BA 1X3UA 1WSUA 2TDXA 3GWZA 1LNWA 4ASNA 1ZARA 2EFQA 4I02A 1D5VA 5LRSA 1W7PB 1F4KA 1BM9A 4AIKA 2OAZA 2RDPA 2PG4A 3E3VA 1EH8A 5ICGA 2IA1A 2XAFA 4OU0A 3C3WA 2OQRA 1SFUA 5HDKA 3KP6A 4LK1F 4TV7A 4UV9A 1ZAOA 2ZNZA 3LSTA 1T38A 1XDSA 2P6TA 5E20A 2V6CA 3GFJA 2CSOA 2GWRA 1W5TA 4RB2C 4Q48A 4M9SA 3N97A 4L5JA 3RKYA 2PEXA 1Z6TA 3CJNA 3I0TA 5IT9Z 1XDUA 3ECHA 4HZFA 2O8XA 1XSDA 2J5OA 3ZPLA 5HLHA 3EQLF 5E17F 4A2UA 3DP7A 3CDHA 1XSXA 5L3FA 4HF2A 2QQ9A 2D1HA 4U0VA 2OZ6A 3R0AA 1SD4A 1UCRA 4IHTA 1KA8A 4RGUA 1JE8A 1SMTA 2IRFG 3CUOA 1ZREA 1RUNA 2VN2A 2QZ8A 4OMYA 1KU2A 2R3SA 3SZTA 5FLXK 4CDGA 4EM0B 4RAZA 4WXCA 2DO7A 3JAMZ 3BPVA 3HIFA 5D6EA 5L3DA 3QP5A 1YW8A 4KIBA 2NS0A 4IPAA 1TTYA 2FA5A 4HV6A 1R22A 4R79A 4CO8A 2L54A 4RB0A 2GZWA 3KEQA 4ZYGA 2CYYA 2ISYA 4I98B 3K2ZA 3KP3A 2MBFA 4HYEA 1JHHA 5LHGA 1MD0A 4EVIA 3VFZA 2NNNA 4HAMA 1MDMB 1O3TA 2LF7A 1Z6RA 1K6OA 3M7GA 3ELKA 3F8BA 4MQVA 2M87A 1BIBA 1ZG3A 3HUGA 2RGVA 3C1DA 4I01A 3F72A 3EYYA 3KCCA 1U2WA 4PGHA 2P8TA 2VT2A 2HQRA 3FXUA 1J0RA 2GA2A 2E7XA 3L2CA 3F8MA 3GFIA 1IRGA 4KYWA 1W5SA 1KYZA 4ESFA 3LA3A 5D8LB 2BE5F 2H94A 3J7AO 3DF8A 1P2FA 2HTJA 3T8TA 4EM1A 2DW4A 2ACJA 4MTEA 2EFNA 1GVJA 3EYIA 4ZYEA 3CLOA 5DD8A 2HOEA 1T39A 1SD5A 3K1NA 3DPTA 1G3WA 4LK0F 5CVVA 4EJWA 2FBHA 2JT1A 2KIFA 5FB2A 1W7PD 3WU1B 3TOAA 3QU6A 2WV0A 3J80K 2K27A 2CGPA 5AONA 5HOOA 2ADUA 3GFMA 4KA4A 1O7LA 4B09A 3FMSA 2RNJA 2XV4S 3PFIA 2ESNA 1SD6A 2K4JA 3GW2A 2PN6A 4A6DA 1ZG5A 3ISPA 2FOKA 3BY6A 1RUOA 3SFZA 2DK5A 1B9NA 2KRFA 5L3CA 4JQFA 2QWWA 3NEUA 3T8RA 5LGTA 1YYVA 2EA4A 4FX4A 4YFKF 2VOOA 2STTA 1G3YA 2FXAA 2PMUA 3KP5A 2W84A 2YPRA 1UHWA 1OYYA 4I7HA 2J5PA 4EQQA 1PP7U 3HRTA 4UVAA 5LRRA 1FWZA 1FY7A 1XGSA 3V7SA 4YIFA 4HLYA 4UV8A 2YU3A 1HSTA 3P9KA 1R58A 5BMZA 5ILVA 2HDCA 2H6CA 3TQNA 3F21A 2XROA 3D0SA 1YO5C 1IAWA 1IZ1A 4G6QA 4CHUA 4OINF 4CGZA 6PAXA 3VB2A 5AIPA 2LKPA 5J8FA 4GO1A 5H6QA 1D8KA 3ZN1A 5FFZA 2KIMA 1BC8C 3DQVC 2O3FA 1H0MA 1BI0A 2VC0A 5HDGA 1HW1A 1VTNC 1FT9A 2HGCA 1OYIA 2XAHA 1I27A 3OV8A 4P9UA 1S3JA 1O3RA 1KYWA 3Q9VA 1MJAA 3TDZC 4YIIA 5ED4A 1IRFA 1Q1HA 2L4AA 3SXYA 3M8EA 2FQ3A 3WGIA 4XLPF 2MD5A 2QUFA 5DEQA 1Y0UA 4N9HA 2LSOA 4LFUA 3BJOA 2A61A 1J2XA 4UNOA 3LA2A 2XKOA 4LB6B 4LJZF 2BBYA 3CO7C 1OPCA 4ENKA 3E97A 2W85A 4CYDA 5H20A 2XHKA 3WG9A 1TQIA 2UXNA 2ISZA 4M73A 4KN4X 4L9VA 3ZMDA 2XVCA 3DEUA 2MLKA 3WTXC 1SMYF 2L02A 3ZMUA 3JSPA 3F8CA 2JPBA 2XAQA 2K4BA 3O3KA 3WTVC 2Q0OA 4O5VA 4EM2A 1U5TC 2HZTA 3TDUC 1ONVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ7 A;  3L09 A;  2KJC A;  4RGS A;  4CIC A;  3IRR A;  5BOX A;  2NYX A;  5LBQ A;  2Z33 A;  5L3B A;  4HX7 A;  1XCB A;  1LDD A;  1MZB A;  3GUD A;  4MQ9 F;  1L0O C;  5HLG A;  4Q47 A;  1YG2 A;  3ZMV A;  1QNT A;  2BV6 A;  3G73 A;  3TO7 A;  4HDV A;  5E1W A;  3D5L A;  1MGT A;  4PDK A;  1YS6 A;  2IVM A;  2WWY A;  5DD4 A;  2XRN A;  1SFX A;  1U6G A;  1TBX A;  5E8G A;  4GGG A;  1FBS A;  3TKY A;  3LQR A;  3HYI A;  2RQP A;  3SZP A;  1SFE A;  2PBI A;  4MGR A;  3F8N A;  1HSJ A;  1ZRF A;  3HHH A;  2DT5 A;  5F1R A;  5CYV A;  3O6B B;  3I53 A;  1J9I A;  1DPR A;  1B1B A;  1KU3 A;  4NQW A;  5JVT A;  1FZP B;  2UWM A;  4I09 A;  2P7C B;  2EV6 A;  3ULQ B;  4MEX F;  3KLN A;  2PFB A;  2V9V A;  3V8J A;  1L3L A;  2EV0 A;  1XCV A;  1DPU A;  2IA0 A;  5IT9 K;  2ETH A;  3I71 A;  5F6F A;  1IN8 A;  3FWE A;  3AAF A;  2OD5 A;  2MLG A;  2P7V B;  2PMH A;  3WTW C;  3SQN A;  2VE8 A;  1O57 A;  3MAJ A;  2K7L A;  2ZME A;  1A04 A;  4XBF A;  2JSC A;  3V7C A;  4HDU A;  4R1H A;  1FP1 D;  4ZH4 F;  4BQA A;  4OIO F;  5K5R A;  2L3D A;  2VBX A;  4P55 A;  4L0Z B;  3E6D A;  2K86 A;  3M8F A;  2OBP A;  1XMA A;  3V7R A;  2L01 A;  2FSW A;  2DQL A;  1IUY A;  3LAP A;  3CUQ C;  3U2R A;  2R7D A;  1UFM A;  1TNS A;  3I58 A;  2ESH A;  3RJP A;  5DV5 A;  1O3S A;  3FZV A;  4AIH A;  3JAM K;  3F3X A;  3V4G A;  4IRI A;  2VBW A;  2ZME B;  3WE2 A;  2Z5U A;  3MEX A;  2STW A;  4LGW A;  1G6N A;  4A0X A;  2CFX A;  4KNY A;  4AWX B;  4G94 A;  3NRV A;  2A6H F;  2DTR A;  4CXF A;  3T1B A;  1LVA A;  3OOP A;  1FBQ A;  4KIC A;  2COM A;  1P4A A;  3BRO A;  4BH9 A;  1BI3 A;  2HQN A;  3R0J A;  2CG4 A;  4EV0 A;  5F64 A;  4KMF A;  2KKO A;  2GA1 A;  4G9Y A;  2MA3 A;  3MWM A;  1K78 A;  4LG0 A;  5D5W B;  5EEG A;  4G8X A;  1FYL A;  4ZZL A;  1I1G A;  3IC7 A;  4HF0 A;  3ERE D;  1BOA A;  1U5T A;  2CW0 F;  3RKX A;  1YLF A;  2ZXJ A;  3MQ0 A;  2YX7 A;  1ZGA A;  4OIP F;  4EJT A;  4QWQ A;  3K1M A;  4WXH A;  3IKV A;  5DCF A;  4XRF A;  1ODD A;  4CZZ A;  1ZYR F;  2DU9 A;  2DK8 A;  1K79 A;  4D0P A;  1K78 B;  1XGM A;  4LG0 B;  2O03 A;  3BJ6 A;  5H6R A;  4KMU X;  5HS9 A;  3KP4 A;  1U5T B;  2FU4 A;  2KJB A;  2G9W A;  4M74 A;  2EFP A;  4KDP A;  1XGO A;  5TRD A;  1H9G A;  4DNC A;  2GQQ A;  2W24 A;  5BQT A;  1CF7 A;  2E1N A;  4GYI A;  5DYM A;  4GXO A;  4E70 A;  1Z9C A;  2HKO A;  2R7F A;  2HYG D;  5HVQ C;  4R8H A;  2WC2 A;  2P5V A;  3EET A;  2CO5 A;  3ABU A;  2QM3 A;  3HRS A;  3N4M A;  2JRT A;  1Z05 A;  4ZYD A;  2H27 A;  3J81 K;  4M6Y A;  2Q2E A;  1BBY A;  5A2Q K;  1LQ1 A;  1RI7 A;  4U7B A;  1ZLK A;  4HBL A;  3HSR A;  3FXQ A;  1CF7 B;  1LEB A;  4IRG A;  2F5F A;  1USS A;  2GAU A;  2AS5 F;  1U8R A;  2V1X A;  5JFR A;  1BIA A;  1MJ9 A;  4A6E A;  4MTD A;  2PLY A;  5BPD A;  1RZ4 A;  3GXO A;  2EFW A;  1QO0 D;  3GX4 X;  2VON A;  5K5O A;  1V4R A;  1R36 A;  1TQM A;  4FT8 A;  5ERI A;  1S7O A;  4BNC A;  3I54 A;  2XKP A;  1DDN A;  1TLH B;  2DBB A;  3CUQ A;  3PQJ A;  5EEH A;  2D2W A;  2ZBK A;  2LF8 A;  1KU9 A;  1RIO H;  3J81 Z;  3QRF F;  4Y13 A;  3C18 A;  4EJU A;  5A2Q Z;  5ICE A;  1TW2 A;  1Z1D A;  2UXX A;  3F6O A;  1QBJ A;  4ZYH A;  3ECO A;  1PP8 F;  5ILS A;  3VEP A;  3BPX A;  1SAX A;  3CUQ B;  4Z2Y A;  3HOT A;  1UHM A;  1ZRC A;  3G3Z A;  5HS8 A;  4AVP A;  3WTT C;  2ELH A;  4EJO A;  2IA2 A;  3WOD F;  2GXG A;  1WI9 A;  1OMI A;  3K9T A;  4HQM A;  1LJ9 A;  3GZ6 A;  2EWN A;  3GO5 A;  3TOB A;  4UHT A;  5HS7 A;  4GYG A;  1B6A A;  3JSO A;  4BHB A;  1YFH A;  4A12 A;  1NHA A;  1T0F A;  3V8L A;  5JHU A;  3E6B A;  3O2P E;  4WXD A;  3IL2 A;  2K02 A;  2M30 A;  1J59 A;  4L9N A;  4MNU A;  5HDN A;  3QPT A;  4LB5 A;  3P9C A;  2Z9O A;  5E1X A;  5BS6 A;  3E5X A;  4Q5S F;  5HLI A;  4L5I A;  2QBY A;  3T0Y A;  3RYR A;  1ZLJ A;  1IN7 A;  2IP2 A;  1FSH A;  2VBY A;  2HWV A;  1YS7 A;  3S2W A;  1BJA A;  2VE9 A;  5CLS A;  1HKQ A;  2OZU A;  4Y15 A;  5ICC A;  2FML A;  2NNY A;  5FD5 A;  2FE3 A;  2M1B A;  2BYV E;  3JW4 A;  4HV5 A;  2ZO4 A;  5CVI A;  1P92 A;  4P96 A;  2M5W A;  4L9J A;  4ENN A;  2FMY A;  2FRH A;  4PCQ A;  4A5M A;  4WCG A;  1XSV A;  2P4W A;  3ZMZ A;  3HRM A;  2QBY B;  5E1Z B;  3Q9S A;  2EK5 A;  5D4S A;  1S8N A;  3RDI A;  2LDU A;  1O3Q A;  4ZZD A;  4N9I A;  2DPU A;  1FNN A;  4EGY A;  2FNP A;  5FD6 A;  3F22 A;  3HSE A;  1Z91 A;  2W57 A;  1YTY A;  1YIO A;  4O6J A;  2F5E A;  3ROU A;  1E2X A;  3QOP A;  3V8K A;  1IN5 A;  2H09 A;  2D45 A;  4IVN A;  3P7N A;  1HQC A;  2RC4 A;  4UUV A;  3M1E A;  2HKX A;  3RIR A;  2G7U A;  2GXB A;  4UXN A;  4ENJ A;  3KZZ A;  2HEO A;  4PZJ A;  1K7A A;  2ZFW A;  2GIV A;  4KUM A;  1G3S A;  1MJB A;  3IWZ A;  3FM5 A;  4WX9 A;  3SHF A;  3LAJ A;  1BI2 A;  3K1P A;  5LLQ A;  1DUX C;  3DFG A;  1P4W A;  4KT5 C;  1LB2 A;  4BXU A;  1W4M A;  2A6E F;  2W25 A;  2M8E A;  4RB3 C;  4Q4Z F;  1XMK A;  5FGM A;  2F5D A;  1O7F A;  4HLX A;  2A07 F;  1Z7U A;  3FX3 A;  3BDD A;  3LWF A;  5D5U B;  4RAY A;  1R7J A;  2YSR A;  4EJV A;  4OOI A;  1I1S A;  1XD7 A;  2XIG A;  4L18 B;  4ETS A;  1FYM A;  4P5O A;  4EMS A;  4GCV A;  5K1Y A;  3WU0 A;  2PJP A;  2RVC A;  2ZCW A;  3RPU A;  4LLN A;  1FBU A;  3H3Z A;  1REP C;  2HTS A;  5FFX A;  4JBA A;  4L9T A;  1TW3 A;  1PDN C;  5DUK A;  5D5V B;  4ENM A;  2WTE A;  1T6S A;  3HSF A;  5D5X B;  1FSE A;  1H9T A;  1ZG1 A;  3COA C;  2G7H A;  1HW2 A;  3VOD A;  1KGS A;  2QYO A;  2XAJ A;  1FPQ A;  2VXZ A;  4M6X A;  1BI1 A;  3GYH X;  2MH9 A;  2BGC A;  3I59 A;  1TQP A;  3L9F A;  2YX4 A;  1TNT A;  3DPL C;  3CO6 C;  3DXJ F;  1QZZ A;  3R6S A;  4HQE A;  1R5G A;  4IRH A;  2KIU A;  2Z99 A;  1R1V A;  3FMR A;  2V1D A;  3I5U A;  4U88 A;  1KQ8 A;  3RYP A;  5E18 F;  3GF2 A;  3I59 B;  3PQK A;  3U9G A;  5JR3 A;  3U1D A;  1DP7 P;  1S29 A;  3I64 A;  3FMQ A;  3R4K A;  3H3U A;  2UZK A;  4F7Z A;  3MZY A;  3KP2 A;  1HKT A;  1J75 A;  4YFN F;  1HBX G;  4KN7 X;  1C0W A;  3GZ5 A;  1KQ9 A;  2NRA C;  2A68 F;  2VT3 A;  2XUB A;  1FLI A;  1FC3 A;  2EFO A;  2ZKZ A;  2XGX A;  3WTZ A;  4RB1 A;  4OMZ A;  2RN7 A;  4P9F A;  1J7K A;  2E7W A;  3EDP A;  1XN7 A;  3E6C C;  1FYK A;  3GFL A;  3LA7 A;  1R00 A;  2H6B A;  2DI3 A;  2NAZ A;  3R61 A;  1XB4 A;  3FXR A;  4DQ2 A;  2YR2 A;  4RS8 A;  4ESB A;  2HR3 A;  2VC1 A;  1ON1 A;  4NB5 A;  3QP6 A;  2F5C A;  1RNL A;  2P6S A;  1IXS B;  4G6D A;  4I2O A;  4YG2 F;  5AIQ A;  4N0B A;  3RPQ A;  1I6X A;  1D8J A;  5LHI A;  2DQR A;  1MDM A;  2Z3Y A;  3T5X A;  4BAY A;  1F1Z A;  1T2K A;  1QPM A;  4WWC A;  3K69 A;  3MFK A;  3BZ6 A;  5DUI A;  5D8K B;  4EGZ A;  3QU3 A;  3B02 A;  2BEO A;  1IW7 F;  1YQA A;  2Y0M A;  3B73 A;  3QPH A;  5ICF A;  4KFC A;  3BP8 A;  3WGH A;  1WWX A;  2V1U A;  2VOD A;  2EV5 A;  5CVU A;  1B59 A;  1J5Y A;  3RKW A;  3Q5F A;  2HFH A;  1EH7 A;  3C7J A;  3RTR A;  1QGP A;  3FF5 A;  2VOP A;  5IT3 A;  3MZH A;  4LMY A;  1F9N A;  1OKR A;  2IJL A;  3DKW A;  3F8F A;  1HXD A;  5FLX Z;  3WTU C;  4I0A A;  2MC3 A;  4RGR A;  1U78 A;  5LGU A;  1MKM A;  2OA4 A;  4PGG A;  1V3F A;  3BWG A;  3F6V A;  1FP2 A;  1STZ A;  5CJ9 A;  1BN5 A;  5KVR A;  3H92 A;  3E5Q A;  1F5T A;  4G7O F;  5DCM A;  1BC7 C;  4IHS A;  1UB9 A;  2QQB A;  1WQ2 A;  2X0L A;  1ZHF A;  2EB7 A;  1G4D A;  5JI6 A;  4G7Z F;  2QQA A;  3RI4 A;  4AD9 A;  4OIQ F;  5BPI A;  2B0L A;  2FF4 A;  2V79 A;  1P4X A;  2IW5 A;  1P6R A;  2X4H A;  3F23 A;  1PUE E;  1LDK B;  4AIJ A;  2JZY A;  1IXC A;  3KFW X;  1S7A A;  3M9A A;  4H0E A;  4S05 A;  1ZH5 A;  2FEZ A;  4MEY F;  5DCM B;  4WK8 F;  4K2E A;  4HX4 A;  5J6X A;  3WGG A;  3FM3 A;  2PI0 A;  5LGN A;  1CGP A;  1YW7 A;  3WTY C;  4Y17 A;  5D6F A;  3GLX A;  1HKS A;  4UVB A;  3DV8 A;  3HHG A;  3I4P A;  2OQG A;  2A5Y B;  3TGN A;  4U0Y A;  2M45 A;  2F2E A;  3ML6 A;  3ZMS A;  3K0L A;  3ZP5 A;  3WE3 A;  1GXP A;  1S6L A;  2O0Y A;  4HW0 A;  4LD5 A;  2CWE A;  4YFX F;  1GHC A;  3J80 Z;  1SD7 A;  1R1T A;  3ABT A;  4HX8 A;  1JHF A;  3EUH A;  4M71 A;  4BHC A;  5FO5 A;  2MH2 A;  5CVJ A;  1IN4 A;  2RKH A;  4ON0 A;  2PQ8 A;  3IWF A;  5K5Q A;  3IRQ A;  4A0Y A;  5DDG A;  1E17 A;  2CQK A;  4LLG F;  1AOY A;  2P5L C;  1XGN A;  2HYF A;  1UST A;  5LEJ A;  5CVR A;  1G3T A;  3TO9 A;  2LNB A;  2QVO A;  1EH6 A;  1IF1 A;  4BHP A;  2IPQ X;  1QZY A;  2XAS A;  1I5Z A;  3E5U A;  5LEK A;  1ZRD A;  3KE2 A;  3BOQ A;  3ZN0 A;  4JK1 X;  2Q8K A;  1LEA A;  2FNA A;  2DFI A;  3JTG A;  1ZN2 A;  2RV8 A;  2XAG A;  4B8X A;  2DLL A;  4KIG A;  2Y75 A;  2JTV A;  3CTA A;  1B4A A;  2IT0 A;  1LDJ A;  2QEN A;  1D3Y A;  3L7W A;  3E6M A;  2O6G E;  2EA2 A;  2ZNY A;  2QLZ A;  4BYY A;  2DAO A;  3FHZ A;  3R60 A;  4KIF A;  4ESJ A;  2FBI A;  1JGS A;  2P5K A;  1ULY A;  1R5H A;  4LLL A;  2A69 F;  3REO A;  1HW5 A;  2AXL A;  3LQQ A;  4M9X A;  5LHH A;  3HTS B;  5KK1 A;  4HOB A;  3L00 A;  4NHJ A;  2D1V A;  3IHU A;  5L3E A;  1OR7 A;  3VOE A;  4FHT A;  2VBZ A;  1B9M A;  1ON2 A;  2JPC A;  1WRJ A;  4A0Z A;  1GXQ A;  2C6Y A;  3NQO A;  3P9I A;  4XLN F;  3KP7 A;  4UVC A;  3LFK A;  3KET A;  4OIR F;  4M9Z A;  4O3M A;  4S04 A;  2A3S A;  2L4M A;  3WTS C;  3GEZ A;  1KQ0 A;  2HS5 A;  2Y48 A;  5J8C A;  5L3G A;  1ZGJ A;  1R23 A;  5E8I A;  4M72 A;  3W6J B;  4HF1 A;  4XSZ F;  5ILU A;  4U7D A;  1WKM A;  2OU2 A;  3W6K B;  3HRU A;  2DPD A;  3TO6 A;  4IJA A;  3BJA A;  4MHG A;  5D4R A;  2FBK A;  3MCZ A;  2O61 A;  3HOS A;  4WF2 A;  4A5N A;  3KEO A;  4HA8 A;  3JTH A;  4XSX F;  1JXS A;  4G7H F;  4L0Y B;  1AWC A;  1OYW A;  3GVA A;  4RGX A;  1FX7 A;  2E1C A;  1YW9 A;  1U3E M;  2ZJ2 A;  1IXR C;  1W7P A;  1FOK A;  3KLO A;  1T98 A;  1QQI A;  4IXA A;  5TJJ A;  4QLC U;  3QAH A;  4IF4 A;  1KU7 A;  3KZY A;  4U0W A;  4FX0 A;  1R1U A;  3ZMT A;  2EJR A;  3HTU A;  1IN6 A;  3IKT A;  1EV7 A;  4I0B A;  1X3U A;  1WSU A;  2TDX A;  3GWZ A;  1LNW A;  4ASN A;  1ZAR A;  2EFQ A;  4I02 A;  1D5V A;  5LRS A;  1W7P B;  1F4K A;  1BM9 A;  4AIK A;  2OAZ A;  2RDP A;  2PG4 A;  3E3V A;  1EH8 A;  5ICG A;  2IA1 A;  2XAF A;  4OU0 A;  3C3W A;  2OQR A;  1SFU A;  5HDK A;  3KP6 A;  4LK1 F;  4TV7 A;  4UV9 A;  1ZAO A;  2ZNZ A;  3LST A;  1T38 A;  1XDS A;  2P6T A;  5E20 A;  2V6C A;  3GFJ A;  2CSO A;  2GWR A;  1W5T A;  4RB2 C;  4Q48 A;  4M9S A;  3N97 A;  4L5J A;  3RKY A;  2PEX A;  1Z6T A;  3CJN A;  3I0T A;  5IT9 Z;  1XDU A;  3ECH A;  4HZF A;  2O8X A;  1XSD A;  2J5O A;  3ZPL A;  5HLH A;  3EQL F;  5E17 F;  4A2U A;  3DP7 A;  3CDH A;  1XSX A;  5L3F A;  4HF2 A;  2QQ9 A;  2D1H A;  4U0V A;  2OZ6 A;  3R0A A;  1SD4 A;  1UCR A;  4IHT A;  1KA8 A;  4RGU A;  1JE8 A;  1SMT A;  2IRF G;  3CUO A;  1ZRE A;  1RUN A;  2VN2 A;  2QZ8 A;  4OMY A;  1KU2 A;  2R3S A;  3SZT A;  5FLX K;  4CDG A;  4EM0 B;  4RAZ A;  4WXC A;  2DO7 A;  3JAM Z;  3BPV A;  3HIF A;  5D6E A;  5L3D A;  3QP5 A;  1YW8 A;  4KIB A;  2NS0 A;  4IPA A;  1TTY A;  2FA5 A;  4HV6 A;  1R22 A;  4R79 A;  4CO8 A;  2L54 A;  4RB0 A;  2GZW A;  3KEQ A;  4ZYG A;  2CYY A;  2ISY A;  4I98 B;  3K2Z A;  3KP3 A;  2MBF A;  4HYE A;  1JHH A;  5LHG A;  1MD0 A;  4EVI A;  3VFZ A;  2NNN A;  4HAM A;  1MDM B;  1O3T A;  2LF7 A;  1Z6R A;  1K6O A;  3M7G A;  3ELK A;  3F8B A;  4MQV A;  2M87 A;  1BIB A;  1ZG3 A;  3HUG A;  2RGV A;  3C1D A;  4I01 A;  3F72 A;  3EYY A;  3KCC A;  1U2W A;  4PGH A;  2P8T A;  2VT2 A;  2HQR A;  3FXU A;  1J0R A;  2GA2 A;  2E7X A;  3L2C A;  3F8M A;  3GFI A;  1IRG A;  4KYW A;  1W5S A;  1KYZ A;  4ESF A;  3LA3 A;  5D8L B;  2BE5 F;  2H94 A;  3J7A O;  3DF8 A;  1P2F A;  2HTJ A;  3T8T A;  4EM1 A;  2DW4 A;  2ACJ A;  4MTE A;  2EFN A;  1GVJ A;  3EYI A;  4ZYE A;  3CLO A;  5DD8 A;  2HOE A;  1T39 A;  1SD5 A;  3K1N A;  3DPT A;  1G3W A;  4LK0 F;  5CVV A;  4EJW A;  2FBH A;  2JT1 A;  2KIF A;  5FB2 A;  1W7P D;  3WU1 B;  3TOA A;  3QU6 A;  2WV0 A;  3J80 K;  2K27 A;  2CGP A;  5AON A;  5HOO A;  2ADU A;  3GFM A;  4KA4 A;  1O7L A;  4B09 A;  3FMS A;  2RNJ A;  2XV4 S;  3PFI A;  2ESN A;  1SD6 A;  2K4J A;  3GW2 A;  2PN6 A;  4A6D A;  1ZG5 A;  3ISP A;  2FOK A;  3BY6 A;  1RUO A;  3SFZ A;  2DK5 A;  1B9N A;  2KRF A;  5L3C A;  4JQF A;  2QWW A;  3NEU A;  3T8R A;  5LGT A;  1YYV A;  2EA4 A;  4FX4 A;  4YFK F;  2VOO A;  2STT A;  1G3Y A;  2FXA A;  2PMU A;  3KP5 A;  2W84 A;  2YPR A;  1UHW A;  1OYY A;  4I7H A;  2J5P A;  4EQQ A;  1PP7 U;  3HRT A;  4UVA A;  5LRR A;  1FWZ A;  1FY7 A;  1XGS A;  3V7S A;  4YIF A;  4HLY A;  4UV8 A;  2YU3 A;  1HST A;  3P9K A;  1R58 A;  5BMZ A;  5ILV A;  2HDC A;  2H6C A;  3TQN A;  3F21 A;  2XRO A;  3D0S A;  1YO5 C;  1IAW A;  1IZ1 A;  4G6Q A;  4CHU A;  4OIN F;  4CGZ A;  6PAX A;  3VB2 A;  5AIP A;  2LKP A;  5J8F A;  4GO1 A;  5H6Q A;  1D8K A;  3ZN1 A;  5FFZ A;  2KIM A;  1BC8 C;  3DQV C;  2O3F A;  1H0M A;  1BI0 A;  2VC0 A;  5HDG A;  1HW1 A;  1VTN C;  1FT9 A;  2HGC A;  1OYI A;  2XAH A;  1I27 A;  3OV8 A;  4P9U A;  1S3J A;  1O3R A;  1KYW A;  3Q9V A;  1MJA A;  3TDZ C;  4YII A;  5ED4 A;  1IRF A;  1Q1H A;  2L4A A;  3SXY A;  3M8E A;  2FQ3 A;  3WGI A;  4XLP F;  2MD5 A;  2QUF A;  5DEQ A;  1Y0U A;  4N9H A;  2LSO A;  4LFU A;  3BJO A;  2A61 A;  1J2X A;  4UNO A;  3LA2 A;  2XKO A;  4LB6 B;  4LJZ F;  2BBY A;  3CO7 C;  1OPC A;  4ENK A;  3E97 A;  2W85 A;  4CYD A;  5H20 A;  2XHK A;  3WG9 A;  1TQI A;  2UXN A;  2ISZ A;  4M73 A;  4KN4 X;  4L9V A;  3ZMD A;  2XVC A;  3DEU A;  2MLK A;  3WTX C;  1SMY F;  2L02 A;  3ZMU A;  3JSP A;  3F8C A;  2JPB A;  2XAQ A;  2K4B A;  3O3K A;  3WTV C;  2Q0O A;  4O5V A;  4EM2 A;  1U5T C;  2HZT A;  3TDU C;  1ONV A; 
#chains in the Genus database with same CATH topology
 2WAF A;  1XS9 A;  3ZQ7 A;  3L09 A;  3S1N J;  2KJC A;  4RGS A;  4CIC A;  2JVH A;  3IRR A;  5BOX A;  2R7V A;  4DGW B;  1A35 A;  4FIS A;  3VYT B;  3JRI A;  2E1O A;  2NYX A;  5LBQ A;  2Z33 A;  2ZXI A;  2JUC A;  5L3B A;  2M0C A;  2KZG A;  4HX7 A;  3LSP A;  1XCB A;  3A01 A;  1LDD A;  1MZB A;  2XF7 A;  3GUD A;  1L0O C;  4MQ9 F;  4Q47 A;  1JUS A;  1YG2 A;  5HLG A;  3ZMV A;  1HA8 A;  2Q1Z B;  1QNT A;  2R7X A;  1DGR M;  2BV6 A;  3G73 A;  3TO7 A;  2YU9 J;  4HDV A;  4FET A;  5E1W A;  1O4X A;  3D5L A;  5F0C A;  2B9S A;  1MGT A;  4PDK A;  5IP7 J;  4IOC F;  2NVY J;  1YS6 A;  2IVM A;  2LTP A;  2RAE A;  1UMQ A;  5DD4 A;  2EH3 A;  2XRN A;  2WWY A;  2E2I J;  5IYB J;  5EGO B;  1SFX A;  1U6G A;  1TBX A;  5E8G A;  3OSF A;  1WFX A;  4GGG A;  4CH7 A;  1FBS A;  2ZSI B;  3TKY A;  3LQR A;  3HYI A;  2RQP A;  1ZTR A;  1SFE A;  2H8W A;  4LIT A;  3SZP A;  5FLM J;  3MKW B;  1Z7L A;  2PBI A;  3UR3 C;  4MGR A;  3F8N A;  1HSJ A;  2JA2 A;  1ZRF A;  4D5C A;  3HHH A;  3ZXS A;  1YE9 A;  2DT5 A;  5F1R A;  4QSH A;  1YX3 A;  3HOX J;  5CYV A;  2LRD A;  2CV0 A;  4NBQ A;  4PSW A;  3W2A A;  1IUF A;  3O6B B;  3I53 A;  1J9I A;  2IGK A;  3DTE A;  2XB0 X;  1DPR A;  4MO7 A;  4NC8 A;  1B1B A;  2CUZ A;  1KU3 A;  1EF4 A;  2BVM A;  4JYK A;  4JX5 A;  4NQW A;  4HNV A;  5JVT A;  1FZP B;  3CJR B;  3OR1 C;  2UWM A;  4I09 A;  2P7C B;  2EV6 A;  3ULQ B;  3FBN B;  4B47 A;  1X1A A;  3BR2 A;  2OF7 A;  3LSJ A;  4MEX F;  2F4O B;  3ABM H;  1IJW C;  5CPR B;  3KLN A;  1VQ6 I;  2HQA A;  4M3B A;  2PFB A;  3PNT A;  2R7Z J;  2V9V A;  3V8J A;  2JRM A;  2JMW A;  1L3L A;  2EV0 A;  3OWT A;  1XCV A;  3BTI A;  3CC2 I;  2DA1 A;  1DPU A;  2IA0 A;  1UHS A;  1OJL A;  2B63 J;  5IT9 K;  4QPQ A;  5HLT A;  5E3L A;  2ETH A;  3I71 A;  5F6F A;  1IN8 A;  3FWE A;  1WGX A;  4PJL A;  2CUJ A;  3AAF A;  2OD5 A;  4ANJ A;  4NNJ A;  2MLG A;  2P7V B;  2K9L A;  2PMH A;  3WTW C;  1OCC H;  4HRI A;  3SQN A;  1V5F A;  2VI6 A;  2VE8 A;  2K5C A;  3S3M A;  4NQW B;  1O57 A;  2Y0S A;  3MAJ A;  4DYR A;  2ZME A;  1GVD A;  1A04 A;  2K7L A;  2JSC A;  4XBF A;  3V7C A;  4HDU A;  1QHH D;  4R1H A;  4A93 J;  4DOZ A;  2IS6 A;  1FP1 D;  4ZH4 F;  4BQA A;  4OIO F;  5K5R A;  1H88 C;  2HU9 A;  2L3D A;  2VBX A;  4P55 A;  4L0Z B;  3E6D A;  2K86 A;  2A05 A;  2OBP A;  3M8F A;  2V4J C;  1XMA A;  4ZDO A;  2GIZ A;  3V7R A;  5KHD A;  2KP6 A;  2MGQ A;  2WY7 Q;  2L01 A;  2FSW A;  3BTC A;  4BJ5 C;  2DQL A;  1IUY A;  3LAP A;  1D1C A;  3CUQ C;  2HOS A;  1FOY A;  3U2R A;  4LIU A;  2R7D A;  1UFM A;  3NAU A;  1CQT A;  3S32 A;  1P9Q C;  1DQU A;  5GTH C;  2DDB A;  1TNS A;  3OYI A;  3I58 A;  2ESH A;  3RJP A;  5DV5 A;  1O3S A;  1HDD C;  4AU7 A;  3FZV A;  4AIH A;  3K4K A;  3JAM K;  3RCO A;  3F3X A;  1K83 J;  3V4G A;  4IRI A;  5C3E J;  2VBW A;  2ZME B;  1OLT A;  3WE2 A;  2Z5U A;  2OC6 A;  1ZKG A;  3HM5 A;  3BC8 A;  2VJ5 A;  3MEX A;  2STW A;  4LGW A;  2VB6 A;  1G6N A;  3ZQG A;  4A0X A;  2CFX A;  2ZB9 A;  4A3E J;  1MNE A;  4KNY A;  1K4S A;  4AWX B;  4G94 A;  2K3P A;  1D0Z A;  3NRV A;  1N77 A;  2A6H F;  3HKZ N;  2IXS A;  4XIC A;  3SJM A;  1W36 C;  2DTR A;  4CXF A;  3T1B A;  4HPQ A;  4PJ0 C;  1LVA A;  3OOP A;  1FBQ A;  5FRM A;  4KIC A;  2COM A;  1P4A A;  1MW7 A;  4A3G J;  3BRO A;  5F1J A;  2DDA A;  4B4C A;  4BH9 A;  1AA7 A;  1Z67 A;  1TWG J;  3BT9 A;  1BI3 A;  3PSF A;  3K70 D;  1PUF A;  3QOD A;  2HQN A;  2I10 A;  4XN0 A;  3OMY A;  3R0J A;  2CG4 A;  2KLO A;  4EV0 A;  5F64 A;  3OS0 A;  4KMF A;  5KCM A;  2KKO A;  2GA1 A;  4G9Y A;  2MA3 A;  3FIS A;  3GLL A;  3MWM A;  1K78 A;  2R7T A;  4LG0 A;  5D5W B;  5EEG A;  4RAF A;  4G8X A;  5JVG F;  4B48 A;  3PIP F;  5FKM A;  1FYL A;  1GLN A;  4ZZL A;  3KPH A;  1I1G A;  1T0F C;  4XNF A;  3IC7 A;  3KZI C;  2KMU A;  4HF0 A;  1BOA A;  2V9P A;  1U5T A;  3K4N A;  2CW0 F;  3PUB A;  4PFO A;  4ZDL A;  3RKX A;  1YLF A;  2ZXJ A;  4X0G A;  4XLH A;  3MQ0 A;  2O8K A;  3IAS 2;  2E35 A;  2YX7 A;  1ZGA A;  4OIP F;  4EJT A;  3H1C A;  4QWQ A;  3K1M A;  2CW8 A;  4WXH A;  5K7F A;  3IKV A;  2BOL A;  5DCF A;  1DP3 A;  4XRF A;  5M5X J;  1NH3 A;  1ODD A;  2O5R A;  4CZZ A;  1PUF B;  3DBH B;  2IGM A;  5EG0 A;  1ZYR F;  1UZC A;  3IH2 A;  3NWT A;  3HL2 A;  2DU9 A;  1MND A;  2DK8 A;  1Z3X A;  4ZYA A;  4D0P A;  1K79 A;  1K78 B;  1XGM A;  4LG0 B;  5C4J J;  2VJJ A;  2VPL A;  2P81 A;  3CME I;  3Q3S A;  1JKQ C;  2O03 A;  3BJ6 A;  4XOR A;  1TP4 A;  2XRL A;  1GV2 A;  3LSM A;  5H6R A;  1YIT I;  3HOV J;  3S15 J;  3PFY A;  4KMU X;  1IV6 A;  4IL6 C;  1WCM J;  5HS9 A;  4NC7 A;  2LG4 A;  3KP4 A;  5GPC A;  1U5T B;  2DFE A;  2FU4 A;  2KJB A;  1B72 A;  2G9W A;  1W0T A;  2LRE A;  4M74 A;  3LFU A;  2EFP A;  4D5F A;  1VQO I;  4KDP A;  1XGO A;  2EQR A;  2CQX A;  1H9G A;  4DNC A;  5TRD A;  2GQQ A;  2W24 A;  5BQT A;  3A0H C;  1CF7 A;  3KYL A;  4XKV A;  4DZP A;  2O7O A;  5EG0 B;  2NVT J;  2VXD A;  2E1N A;  2M34 A;  4GYI A;  4H4K C;  4GXO A;  5DYM A;  2ZC2 A;  3S17 J;  4E70 A;  1Z9C A;  1VND A;  2HKO A;  2R7F A;  2DOD A;  2HYG D;  5HVQ C;  4R8H A;  2WC2 A;  2P5V A;  3EET A;  2CO5 A;  3ABU A;  2XGC A;  2QM3 A;  5JHF A;  1A36 A;  3HRS A;  3KEY A;  1VFC A;  3N4M A;  2JRT A;  1Z05 A;  4ZYD A;  4LOC A;  2H27 A;  2XGE A;  3J81 K;  1B72 B;  4M6Y A;  3JRB A;  2JA6 J;  2E36 A;  2Q2E A;  1BBY A;  4XLA A;  5A2Q K;  1LQ1 A;  1RI7 A;  4U7B A;  4M3G A;  1ZLK A;  3DKX A;  4HBL A;  3HSR A;  3FXQ A;  1CF7 B;  1LEB A;  4IRG A;  4ZC3 A;  2F5F A;  2EIJ H;  2KRC A;  1USS A;  3OYN A;  1OCO H;  4FQG A;  2GAU A;  1MMA A;  4CYC A;  2AS5 F;  4YEJ A;  2RNG A;  1U8R A;  2V1X A;  3BTL A;  3KYC B;  2EBI A;  3RZD J;  1TT5 B;  3M4O J;  5JFR A;  1G2H A;  1BIA A;  1MJ9 A;  5FKN A;  4A6E A;  4MTD A;  2PLY A;  5BPD A;  4II3 A;  3CCV I;  1D0X A;  1RZ4 A;  3GXO A;  3DEE A;  2EFW A;  1MBE A;  3CC4 I;  1N78 A;  3A02 A;  3S3N A;  2WA0 A;  1AHD P;  1QO0 D;  3GX4 X;  2VON A;  3ONQ A;  5K5O A;  1V4R A;  2EZL A;  2KDO A;  2Q2E B;  1R36 A;  1OQY A;  1TQM A;  4FT8 A;  3DCF A;  4C3H J;  3JRF A;  3QQA A;  5K7H A;  3VSL A;  1IRZ A;  5ERI A;  2XSD C;  1S7O A;  4BNC A;  3MN2 A;  3I54 A;  2XKP A;  1DDN A;  2BXZ A;  1TLH B;  2DBB A;  2JUG A;  3CUQ A;  3PQJ A;  2MSY A;  5EEH A;  1X4P A;  2D2W A;  2DJN A;  4CYC B;  1VQ4 I;  4Y4R A;  2ZBK A;  2LF8 A;  1KU9 A;  2OUM A;  2V9K A;  3PIO F;  1RIO H;  3J81 Z;  3QRF F;  3OL4 A;  4UY8 I;  4Y13 A;  3C18 A;  4EJU A;  3PL8 A;  1JKP C;  5A2Q Z;  5ICE A;  1TW2 A;  1Z1D A;  2MW8 A;  2UXX A;  3F6O A;  1QBJ A;  3BR5 A;  4BJ6 C;  4ZYH A;  3ECO A;  1PP8 F;  1SVM A;  2QGU A;  5ILS A;  3VEP A;  1KZH A;  3BPX A;  3AL0 C;  1I6H J;  2L5Q A;  1SAX A;  4PSX A;  3O8G A;  2XPV A;  3V42 A;  3OY9 A;  3BG5 A;  3CUQ B;  4Z2Y A;  3HOT A;  1UHM A;  2V1N A;  1S7E A;  4QIW N;  4KIT B;  1ZRC A;  3G3Z A;  5HS8 A;  1U9N A;  3JRH A;  4AVP A;  2VL8 A;  4AUX A;  3WTT C;  2ELH A;  4EJO A;  3HJE A;  2IA2 A;  3WOD F;  2GXG A;  4RBO A;  3S1M J;  1WI9 A;  1OMI A;  2M2E A;  3K9T A;  3NAR A;  4FCY A;  2R7U A;  4HQM A;  1LJ9 A;  3GZ6 A;  5HNH A;  2NXN B;  3S2D J;  2EWN A;  3GO5 A;  3TOB A;  3HC7 A;  4UHT A;  1YJW I;  2QSH X;  3DBL B;  2X6Y A;  1NK2 P;  5HS7 A;  4GYG A;  1B6A A;  3GTP J;  2M7B A;  3JSO A;  1W5C C;  1V5E A;  3QOE A;  4BHB A;  2MFZ A;  3ASN H;  1YFH A;  4A12 A;  1NHA A;  1T0F A;  3OL3 A;  3V8L A;  5JHU A;  3E6B A;  1K4T A;  3O2P E;  4WXD A;  2E2J J;  3IL2 A;  1Y56 A;  2K02 A;  3OIQ A;  2M30 A;  2DOA A;  1J59 A;  4L9N A;  1T08 B;  4MNU A;  5HDN A;  1G59 A;  3QPT A;  2Z1D A;  3J7Z I;  4LB5 A;  3P9C A;  2Z9O A;  4PFP A;  5E1X A;  5BS6 A;  2ELK A;  3E5X A;  2TCT A;  4Q5S F;  1SVL A;  5HLI A;  2M4G A;  3TL4 X;  3RZO J;  4L5I A;  1IV8 A;  3LSK A;  3FHN A;  3SDB A;  3T0Y A;  2QBY A;  3OYA A;  1X58 A;  3RYR A;  1ZLJ A;  1D5Y A;  1IN7 A;  2IP2 A;  1FSH A;  2VBY A;  1E0E A;  2HWV A;  1YS7 A;  2DMU A;  1RR7 A;  1OFC X;  1VQ7 I;  4A3M J;  3S2W A;  1BJA A;  2VE9 A;  1FIA A;  5CLS A;  2XGD A;  1HKQ A;  1IDZ A;  4AC0 A;  5IOZ A;  2OZU A;  4Y15 A;  5ICC A;  2FML A;  3S16 J;  2NNY A;  1FOW A;  2DTZ A;  5FD5 A;  3EUK L;  2FE3 A;  2XB5 A;  2M1B A;  2BYV E;  3AG3 H;  4XID A;  3JW4 A;  3SEZ A;  4HV5 A;  2ZO4 A;  3JRA A;  5CVI A;  3GTG J;  1P92 A;  4P96 A;  2M5W A;  1X4O A;  2OCE A;  1ETO A;  4L9J A;  5EEA A;  4ENN A;  2FMY A;  2FRH A;  4PCQ A;  1FOX A;  2E5Z A;  4A5M A;  4WCG A;  1XSV A;  4BE2 A;  4CSW A;  2P4W A;  3ZMZ A;  3HRM A;  2DA3 A;  2QBY B;  1PJR A;  5E1Z B;  3Q9S A;  2EK5 A;  2XC7 A;  5D4S A;  2HVR A;  2LMD A;  1S8N A;  4XRS G;  2R7S A;  3RDI A;  2LDU A;  2AXT C;  1HCR A;  1O3Q A;  1LKX A;  1U9O A;  4ZZD A;  2X1C A;  4N9I A;  4BEH A;  2DPU A;  1FNN A;  4NUB A;  4EGY A;  2FNP A;  3BZK A;  5FD6 A;  3F22 A;  4ZTF A;  3HSE A;  3BR6 A;  1Z91 A;  2W57 A;  2XSJ C;  1SVO A;  1YTY A;  1YIO A;  3LNQ A;  4O6J A;  2F5E A;  3ZGK A;  3ROU A;  3WHC A;  1E2X A;  3QOP A;  3V8K A;  1IN5 A;  2AHQ A;  2H09 A;  2O9L A;  4BJT A;  2D45 A;  3GTJ J;  2JN6 A;  2CV2 A;  4DW6 A;  4IVN A;  3P7N A;  2H1K A;  1HQC A;  2RC4 A;  2WAQ A;  1NG7 A;  2CW7 A;  4UUV A;  2HXI A;  4CCM A;  4XLC A;  1N25 A;  3M1E A;  2HKX A;  3RIR A;  4UUS A;  2NOJ B;  3VWB A;  4IX7 A;  2JWT A;  2G7U A;  2GXB A;  4UXN A;  3H3V K;  4ENJ A;  3KZZ A;  4C3J J;  1WZ2 A;  1R49 A;  3BQZ A;  2HEO A;  4PZJ A;  1JGG A;  1K7A A;  2ZFW A;  1DU0 A;  2GIV A;  2FOW A;  4FE4 A;  4KUM A;  4BEH B;  1G3S A;  3CF5 F;  3S93 A;  2R92 J;  3DTK A;  1MJB A;  2IGO A;  2VPR A;  2BHY A;  5M3M J;  3IWZ A;  2W1O A;  2XPU A;  3FM5 A;  3W2W A;  4WX9 A;  3EUA A;  3SHF A;  3LAJ A;  1BI2 A;  3K1P A;  5LLQ A;  3H5R A;  1EA3 A;  1DUX C;  3L2V A;  3DFG A;  1P4W A;  4KT5 C;  1LB2 A;  1YRN A;  2PMZ A;  3VYR B;  3S1Q J;  4BXU A;  1W4M A;  2A6E F;  4UUS B;  1LE8 A;  2ZJR F;  2W25 A;  2M9H A;  2HDD A;  1T8I A;  4D9J A;  4JP0 A;  3FIW A;  2M8E A;  4E4H A;  4RB3 C;  5DM7 F;  4Q4Z F;  1XMK A;  5FGM A;  2F5D A;  4DBR A;  4BDZ A;  2W7N A;  2L7Z A;  2L0K A;  1O7F A;  1SC7 A;  4HLX A;  5B66 C;  2LKS A;  2A07 F;  4XLF A;  1Z7U A;  2P0W A;  3HEF A;  3FX3 A;  2ZFU A;  3BDD A;  3LWF A;  4HG2 A;  5D5U B;  4ZJZ A;  4RAY A;  1R7J A;  5J3L A;  2VUM J;  2YSR A;  4EJV A;  3NWS A;  4OOI A;  1I1S A;  2LY2 A;  1XD7 A;  2XIG A;  1YIJ I;  4L18 B;  4ETS A;  4BU2 A;  5GPA A;  3CCJ I;  1FYM A;  1IRX A;  4P5O A;  3VSK A;  4EMS A;  4GCV A;  5K1Y A;  3WU0 A;  5GAG J;  2PJP A;  2RVC A;  1YRN B;  2ZCW A;  2HDW A;  5F0H A;  1TWA J;  3OIO A;  3RPU A;  4LLN A;  9ANT A;  1FBU A;  1EJ9 A;  3H3Z A;  1REP C;  2HTS A;  5FFX A;  4A69 C;  1JT6 A;  3OYC A;  4JBA A;  4L9T A;  1ZQ3 P;  3GTK J;  1TW3 A;  2ZJP F;  1PDN C;  5DUK A;  5D5V B;  4ENM A;  4BXF A;  2WTE A;  3ASO H;  1R6R A;  1U78 A;  2K9N A;  3A01 B;  4Y52 J;  1T6S A;  3HSF A;  5D5X B;  2XAU A;  4XOT A;  4N4N B;  1VQN I;  2CUF A;  1FSE A;  1H9T A;  2WB1 A;  2M4K A;  1ZG1 A;  3AL0 B;  3COA C;  2G7H A;  5IPA A;  1X1P A;  3G1M A;  1HW2 A;  2JK3 A;  3VOD A;  1MSE C;  3A2K A;  1HDP A;  1KGS A;  4F92 B;  3G2B A;  3HXL A;  3QPS A;  4L5E A;  2QYO A;  2XAJ A;  1FPQ A;  3BZC A;  1YOV B;  3H5A A;  2VXZ A;  4I99 C;  1Y1W J;  1W36 D;  5K7Z A;  4M6X A;  2V6E A;  3FKJ A;  3HBL A;  1BI1 A;  3GYH X;  2MH9 A;  1HOM A;  2BGC A;  3FXK A;  1TQP A;  3I59 A;  2CJJ A;  3L9F A;  2GOM A;  2YX4 A;  1VQM I;  2KIQ A;  3OR2 C;  1QVU A;  2F4M B;  1TNT A;  4GFB A;  2F6C A;  5F0F A;  3U21 A;  3J7Y J;  3DPL C;  3CO6 C;  3UKG A;  2MYS A;  5JLW A;  3DXJ F;  1QZZ A;  4EAT A;  3CZ6 A;  3R6S A;  3DTI A;  4HQE A;  3I4M J;  5EDN A;  2E19 A;  3DPU A;  3H0G J;  1R5G A;  1P7I A;  4IRH A;  1JTX A;  2KIU A;  2Z99 A;  3M1C A;  3PNY A;  4BQQ A;  1R1V A;  2AQE A;  3FMR A;  4M6V A;  4MFE A;  1MBJ A;  2LH9 A;  4IEJ A;  3RKQ A;  1HLV A;  3ZQQ A;  5J40 A;  2V1D A;  1Y6I A;  3I5U A;  4XKB A;  1JKO C;  3I9V 2;  4IHW A;  4U88 A;  1KQ8 A;  3RYP A;  5E18 F;  4BBR J;  2DYR H;  3GF2 A;  3I59 B;  1TZL A;  5J47 A;  1GV5 A;  5EZH A;  3AFH A;  5LD2 C;  3KIO A;  3PQK A;  3U9G A;  2DT7 B;  5JR3 A;  3JRG A;  3U1D A;  1DP7 P;  1S29 A;  3I64 A;  1VQ5 I;  4E6K G;  3FMQ A;  2CFO A;  3R4K A;  3H3U A;  1VQK I;  2UZK A;  2KT0 A;  1ZR2 A;  4F7Z A;  2VQG A;  3MZY A;  4NC6 A;  2JVG A;  4U87 A;  3KP2 A;  1LFP A;  1WH7 A;  1JT0 A;  3MKL A;  2EPF A;  4RMN A;  1HKT A;  1J75 A;  4YFN F;  1HBX G;  2WV1 A;  4KN7 X;  2ID3 A;  1C0W A;  3GZ5 A;  3P5J A;  1KQ9 A;  2NRA C;  2A68 F;  2VT3 A;  2XUB A;  4II2 A;  4BY7 J;  2VQH A;  1FLI A;  1FC3 A;  4Y33 A;  3OYL A;  3H5N A;  2EFO A;  2ZKZ A;  3S8P A;  1MIJ A;  2X9D A;  3OYF A;  2XGX A;  3WTZ A;  4A3C J;  4RB1 A;  4OMZ A;  2RN7 A;  3HOZ J;  4P9F A;  1J7K A;  4BL0 B;  2E7W A;  3EDP A;  1XN7 A;  3E6C C;  1FYK A;  3GFL A;  3LA7 A;  1R00 A;  2H6B A;  1MBH A;  2DI3 A;  2NAZ A;  2RQQ A;  1ETQ A;  3R61 A;  1FTZ A;  1XB4 A;  2MD0 A;  3FXR A;  4DQ2 A;  3S14 J;  2YR2 A;  3C2H A;  4RS8 A;  4ESB A;  2HR3 A;  2BY3 A;  3EUH C;  4IKF A;  2VC1 A;  1ON1 A;  4NB5 A;  3S3O A;  1QHG A;  3HPH A;  3QP6 A;  1ACI A;  2F5C A;  1MMS A;  1H8A C;  3K7A J;  1AKH A;  1RNL A;  3JRD A;  2P6S A;  1IXS B;  4G6D A;  2VIX A;  4EEF G;  4I2O A;  2Y31 A;  4YG2 F;  5AIQ A;  4N0B A;  4CCL A;  3OYH A;  3RPQ A;  1I6X A;  1R71 A;  3CDI A;  1D8J A;  5IY5 H;  4OAZ A;  3GTO J;  3ZCO A;  5C44 J;  5LHI A;  3OYM A;  2DQR A;  1MDM A;  3S2H J;  5GAE J;  2Z3Y A;  4CUG A;  3T5X A;  4BAY A;  2XDV A;  1F1Z A;  1I39 A;  3TP0 A;  1T2K A;  3FK7 A;  1QPM A;  2L7F P;  1X1D A;  4WWC A;  4UB8 C;  2QF7 A;  3K69 A;  3MFK A;  4DJA A;  3BZ6 A;  5DUI A;  5D8K B;  3RSN A;  4EGZ A;  3QU3 A;  3CCL I;  2VJ4 A;  3B02 A;  2BEO A;  1A5J A;  1IW7 F;  1YQA A;  2Y0M A;  3B73 A;  3QPH A;  1E3O C;  5ICF A;  4X6A J;  4KFC A;  1M1E B;  4FE7 A;  1MMG A;  3U1K A;  3DWL E;  5F08 A;  1GT0 C;  1QU3 A;  3GTM J;  1Z77 A;  3BP8 A;  3WGH A;  1WWX A;  1V54 H;  2V1U A;  2VOD A;  2EV5 A;  2LVS A;  5CVU A;  4A3F J;  2EIN H;  2ZXW H;  1B59 A;  3IAM 2;  1R4M B;  1J5Y A;  2FUG 2;  3RKW A;  2FQ4 A;  2DOF A;  3OYE A;  1POG A;  5HNF A;  3TBI A;  2HFH A;  3Q5F A;  1EH7 A;  3C7J A;  5M5Y J;  4E7K A;  3RTR A;  1QGP A;  3K4B A;  3FF5 A;  2E71 A;  2VOP A;  1F43 A;  5IT3 A;  5CQG A;  4M3D A;  3MZH A;  4LMY A;  3CC7 I;  3BG3 A;  5JLX A;  1F9N A;  3ZOB A;  1OKR A;  2IJL A;  5IP9 J;  3DKW A;  2IAI A;  4ZDP A;  3ZQF A;  3FDY A;  3F8F A;  1HXD A;  1MBG A;  2OJE D;  3QPL A;  3KYD B;  5FLX Z;  1XTA A;  2MC3 A;  4GRI A;  4HSR A;  3GBG A;  4I0A A;  4RGR A;  5LGU A;  3WTU C;  1MKM A;  3RQ4 A;  3HOU J;  2KPM A;  2NS8 A;  2HPI A;  5M3F J;  1BL0 A;  2OA4 A;  3ABK H;  4YEL A;  4PGG A;  3IP4 B;  2DFH A;  2CU7 A;  2NOG A;  2E1M C;  3DKY A;  1V3F A;  3RPU D;  3HKZ A;  3BWG A;  3MKZ A;  3F6V A;  1FP2 A;  2ME0 A;  1X2N A;  1STZ A;  5CJ9 A;  5E3N A;  4BDY A;  1HF0 A;  4V2F A;  2Y30 A;  2YUS A;  1BJZ A;  1BN5 A;  5KVR A;  1WHU A;  3E1S A;  1RR8 C;  2DXI A;  4XM3 A;  3H92 A;  3E5Q A;  4E7L A;  1F5T A;  4G7O F;  4PK4 A;  3MMY B;  5DCM A;  1BC7 C;  4IHS A;  2HOT A;  1UB9 A;  4F93 B;  2QQB A;  5FRN A;  3GME A;  3LSH A;  4JX4 A;  1WQ2 A;  2X0L A;  3HZJ A;  1ZHF A;  1N75 A;  2EB7 A;  4XMY A;  2GM4 A;  1X3Z B;  4YRV A;  5JI6 A;  2KRH A;  4G7Z F;  1G4D A;  4DIQ A;  3BG9 A;  2QQA A;  3RI4 A;  1ZK8 A;  2QKM B;  5FRO A;  4AD9 A;  3I55 I;  4OIQ F;  5BPI A;  1OR7 C;  5BNG A;  1BW6 A;  2B0L A;  2FF4 A;  2V79 A;  1ENH A;  1P4X A;  1LPQ A;  2CQN A;  2IW5 A;  3HOY J;  1AU7 A;  1P6R A;  2X4H A;  3F23 A;  4X1E A;  1PUE E;  1LDK B;  4AIJ A;  4GDF A;  2JZY A;  1IXC A;  1MNM C;  3KFW X;  1S7A A;  3GCM A;  3M9A A;  4H0E A;  4S05 A;  1ZH5 A;  2FEZ A;  4MEY F;  5F04 A;  4A3B J;  5DCM B;  4WK8 F;  2V26 A;  4K2E A;  4HX4 A;  4XN3 A;  2BY2 A;  4RAG A;  3B6C A;  5J6X A;  2LBF A;  3HG9 A;  3WGG A;  3FM3 A;  1PYV A;  2VAS A;  4CCK A;  2PI0 A;  3X2Q H;  5LGN A;  2DA4 A;  1CGP A;  1YW7 A;  3WTY C;  4Y17 A;  4DYQ A;  5D6F A;  3GLX A;  1HKS A;  4UVB A;  3DV8 A;  4J19 A;  3HHG A;  3I4P A;  1E3P A;  2OQG A;  2AQF A;  1FMV A;  2A5Y B;  2K3F A;  3TGN A;  4U0Y A;  3DLA A;  1X19 A;  4AYB A;  4XKC A;  2M45 A;  3D1N I;  2F2E A;  3ML6 A;  3ZMS A;  3K0L A;  3ZP5 A;  3L2Q A;  5GTI C;  3VYS B;  5IYC J;  2CV1 A;  3PJR A;  2F5V A;  3WE3 A;  3PSI A;  5CQE A;  2MG4 A;  2GLO A;  1GXP A;  1S6L A;  2O0Y A;  2LBF B;  4XL9 A;  3TW7 A;  2EIK H;  2R5Z A;  4HW0 A;  4LD5 A;  2H1L A;  3D5S C;  1SEU A;  2CWE A;  2JSP A;  3F9K A;  4YFX F;  4C30 A;  1GHC A;  3J80 Z;  4P1W A;  4BGD A;  5IP6 A;  3A03 A;  1SD7 A;  4DZJ A;  1R1T A;  3ABT A;  1NG6 A;  4HX8 A;  1JHF A;  3EUH A;  4M71 A;  4V2G A;  3QYE A;  1WJB A;  3LL7 A;  4BHC A;  2KDZ A;  5FO5 A;  2MH2 A;  5CVJ A;  1IN4 A;  2BY0 A;  2RKH A;  3M8J A;  2PQ8 A;  4ON0 A;  3IWF A;  5K5Q A;  3IRQ A;  4ZTJ A;  2JA5 J;  2HOA A;  3ABL H;  4A0Y A;  5DDG A;  1E17 A;  2CQK A;  1X2M A;  4LLG F;  4W1U A;  1AOY A;  2P5L C;  2NVX J;  1Y8R B;  1XGN A;  2HYF A;  3E7L A;  4DYC A;  1LUJ B;  1U0J A;  1UST A;  4BKX A;  3ZR8 X;  2R5Z B;  5EJC A;  4J01 A;  5LEJ A;  4AM3 A;  5CVR A;  1G3T A;  3TO9 A;  1UG0 A;  2LNB A;  2QVO A;  2UV1 A;  3VYU B;  4XRS A;  1EH6 A;  1IF1 A;  4BHP A;  2IPQ X;  5KNL A;  3ZRG A;  1QZY A;  2XAS A;  1QA6 A;  1I5Z A;  2ECB A;  3CJQ B;  3E5U A;  5LEK A;  2HI3 A;  1ZRD A;  3KE2 A;  2COB A;  4XRM A;  3BOQ A;  3ZN0 A;  4IO9 F;  2BZT A;  4JK1 X;  2Q8K A;  4CCN A;  1LEA A;  3DU5 A;  2FNA A;  2DA5 A;  2QKL B;  3MKY B;  2DFI A;  4OWR B;  4A3I J;  1F36 A;  1NK3 P;  2LY9 A;  3JTG A;  2CMP A;  1ZN2 A;  1MSF C;  2RV8 A;  2XAG A;  4F91 B;  3FBI B;  4B8X A;  2DLL A;  1IGN A;  4KIG A;  2IGN A;  2Y75 A;  3Q0U A;  2JTV A;  3CTA A;  4B3X A;  1B4A A;  2IT0 A;  3OSG A;  3JRC A;  1SFO J;  4E7I A;  3SYT A;  1LDJ A;  3HB9 A;  2QEN A;  1D3Y A;  1TWF J;  3L7W A;  3E6M A;  5FJ8 J;  3H9G A;  3L2W A;  1D1B A;  1Y1V J;  2O6G E;  2EA2 A;  2ZNY A;  3C2G A;  1FTT A;  4XOP A;  2QLZ A;  4A3L J;  3CMM A;  5FKO A;  2L2O A;  4BYY A;  1QVT A;  1RKT A;  2DAO A;  3R60 A;  3FHZ A;  4KIF A;  4ESJ A;  2VKD A;  2FBI A;  1DU6 A;  2E5N A;  1Y0N A;  3ERM A;  3CP2 A;  4I6Z A;  3PM1 A;  1ORK A;  5DM6 F;  1JGS A;  2P5K A;  1ULY A;  1R5H A;  2WBM A;  2VKH A;  2ELJ A;  4LLL A;  5DS9 A;  1D0Y A;  2A69 F;  2K40 A;  2L9N A;  1I3Q J;  3REO A;  1HW5 A;  5KAF C;  2AXL A;  3HGG A;  3LQQ A;  4M9X A;  4RLQ A;  5LHH A;  3HTS B;  5KK1 A;  1ETV A;  4CZC A;  1G8X A;  4HOB A;  3C2B A;  3L2R A;  4XQF A;  2Y2Z A;  4NDL A;  2DMQ A;  4V19 K;  3L00 A;  4NHJ A;  2D1V A;  1D1A A;  2PX9 A;  3K4C A;  3M07 A;  1MH4 A;  3IHU A;  4DBQ A;  5L3E A;  1OR7 A;  3VOE A;  1KON A;  1ITY A;  4FHT A;  3MD2 A;  2R4G A;  2VBZ A;  3SEQ A;  1TL8 A;  1B9M A;  3LSI A;  1ON2 A;  1H89 C;  4PJJ A;  2JPC A;  1YHQ I;  1WRJ A;  4RA2 A;  3WG7 H;  4A0Z A;  1GXQ A;  3FXM A;  1B8I A;  5B1A H;  3NQO A;  2C6Y A;  3G4S I;  1BR2 A;  3P9I A;  1TWC J;  3A1Y A;  2DJI A;  4E7J A;  3FXJ A;  3KP7 A;  4XLN F;  4UVC A;  3LFK A;  1APL C;  2ZXH A;  1LVK A;  2Y0S N;  3KET A;  2CS3 A;  4OIR F;  4M9Z A;  3IH3 A;  4O3M A;  5EF6 A;  1ERD A;  4S04 A;  2EIM H;  2A3S A;  2L4M A;  2R7O A;  3WTS C;  3CCR I;  1VQ8 I;  3WU2 C;  3GEZ A;  3JR9 A;  1KQ0 A;  2HS5 A;  1OIS A;  2Y48 A;  1RRJ A;  5J8C A;  1ZR4 A;  5L3G A;  1ZGJ A;  1R23 A;  2DA2 A;  5E8I A;  4M72 A;  2HVQ A;  3W6J B;  3FXL A;  2D5V A;  1MBK A;  3ZQI A;  4HF1 A;  4RDU A;  4XSZ F;  5ILU A;  2YS9 A;  4U7D A;  4E7H A;  1A31 A;  4HST A;  3FKI J;  2OV7 A;  1T95 A;  3OS1 A;  1WKM A;  1B8I B;  2OU2 A;  2UUZ A;  3HRU A;  3EPZ A;  2GOX B;  3IH4 A;  3W6K B;  2DPD A;  3TO6 A;  2VJI A;  2IBD A;  1BR4 A;  4IJA A;  1LE8 B;  1FIP A;  4B44 A;  2R7Q A;  4F3Q A;  1VQP I;  3OIP A;  3A4C A;  4N4O B;  3BJA A;  3BCB A;  2JQ7 A;  4MHG A;  5D4R A;  2FBK A;  3MCZ A;  3IV5 A;  2O61 A;  3FXO A;  3HOS A;  3D5R C;  4C3I J;  4WF2 A;  5LFA A;  4A5N A;  3KEO A;  1J09 A;  4HA8 A;  3MZ8 A;  4QTR A;  1WJF A;  2HNH A;  1W0U A;  1XG1 A;  2W48 A;  3JTH A;  4XSX F;  4FAS D;  3CD6 I;  1JXS A;  4G7H F;  2ID6 A;  4L0Y B;  2JA7 J;  4KJZ A;  3I56 I;  3H36 A;  1AWC A;  1WH5 A;  1OYW A;  3GVA A;  4RGX A;  1FX7 A;  2E1C A;  3Q0V A;  3E0J B;  2L9S A;  1YW9 A;  4IZZ A;  1RES A;  1XPX A;  1U3E M;  4C2M J;  1JJ6 C;  5GAH J;  2IS4 A;  4BAC A;  1XX5 A;  2ZJ2 A;  1GDT A;  2CRG A;  3CP8 A;  1IXR C;  1W7P A;  2DA6 A;  1FOK A;  3KLO A;  2BXY A;  1JI8 A;  1T98 A;  1QQI A;  4IXA A;  5TJJ A;  2B7E A;  3CF2 A;  3CCQ I;  4QLC U;  3QAH A;  4IF4 A;  4AID A;  1KU7 A;  3KZY A;  3TED A;  3I4N J;  4U0W A;  2DOE A;  4FX0 A;  1R1U A;  1OCT C;  3ZMT A;  3ZQH A;  4YIR X;  1BW5 A;  1Q1V A;  4Z6Y A;  2EJR A;  3LSG A;  3HTU A;  1IN6 A;  3IKT A;  1EV7 A;  4C2T A;  3GTL J;  4I0B A;  1X3U A;  2HQ5 A;  1WSU A;  2TDX A;  4Y3O A;  3GWZ A;  1LNW A;  4ASN A;  2X1E A;  1ETY A;  5J4V A;  1ZAR A;  4IQ4 A;  2XPW A;  2EFQ A;  4D7N A;  4I02 A;  2FJ1 A;  1D5V A;  3H35 A;  5LRS A;  1W7P B;  1VQ9 I;  3ERE D;  1F4K A;  1BM9 A;  4AIK A;  2Z2S B;  2OAZ A;  4LIV A;  2RDP A;  2PJR A;  1LFB A;  1OCZ H;  2PG4 A;  3E3V A;  1EH8 A;  5ICG A;  2IA1 A;  2XAF A;  2LR8 A;  4KT6 A;  2X6X A;  4OU0 A;  1YX5 A;  3C3W A;  1YI2 I;  2OQR A;  3PO3 J;  2LLK A;  2N8G A;  1MH3 A;  4RM3 A;  2LY1 A;  1ETW A;  1SFU A;  2M8G X;  3VPR A;  4IOA F;  2X48 A;  2A6T A;  1NTC A;  5HDK A;  2QEX I;  2KHM A;  3KP6 A;  4LK1 F;  4TV7 A;  1S9H A;  1U8B A;  2BY1 A;  4UV9 A;  1R9T J;  1SAN A;  1ZAO A;  2OCC H;  2ZNZ A;  4F55 A;  4J00 A;  2ICW G;  3LST A;  1T38 A;  1XDS A;  4HNU A;  4CCO A;  2P6T A;  5E20 A;  2V6C A;  2OTJ I;  1XMX A;  3GTQ J;  3SZG A;  3GFJ A;  3W2V A;  2CSO A;  1A6I A;  2QQ8 A;  2GWR A;  1W5T A;  2K9S A;  4RB2 C;  2PJR B;  1WJD A;  4Q48 A;  3BR1 A;  2I5U A;  4M9S A;  5IOY A;  1VZ0 A;  3ZQC A;  3N97 A;  3ESW B;  4L5J A;  3RKY A;  2PEX A;  1HC8 A;  2LFB A;  1Z6T A;  3CJN A;  3I0T A;  5IT9 Z;  1XDU A;  2K85 A;  3ECH A;  2O8X A;  4HZF A;  2J5O A;  1XSD A;  3ZPL A;  2HPM A;  2LKX A;  5GAD J;  5HLH A;  1R4N B;  1T56 A;  2CQQ A;  1UJ8 A;  3EQL F;  5E17 F;  4A2U A;  5E79 C;  3DP7 A;  3CDH A;  1XSX A;  2DMT A;  2TRT A;  5L3F A;  1BA5 A;  2LD5 A;  4HF2 A;  1I50 J;  2IEK A;  4MIM A;  2VQC A;  3J7A Y;  2QQ9 A;  2D1H A;  3CLQ A;  3LSR A;  4U0V A;  3BLY A;  1XC5 A;  2OZ6 A;  3R0A A;  1MMD A;  3H0D A;  2K9M A;  1SD4 A;  2CH0 A;  4G12 A;  1K6Y A;  3B6A A;  3SFI A;  1UCR A;  4IHT A;  2BVL A;  1KA8 A;  4W97 A;  1VQL I;  4RGU A;  1JE8 A;  2MAB A;  1SMT A;  3TMO A;  2IRF G;  3CUO A;  1ZRE A;  1RUN A;  1TWH J;  3CDL A;  4XON A;  2VN2 A;  3CMA I;  1X1C A;  2K9Q A;  3FK6 A;  2QZ8 A;  2L9V A;  4OMY A;  1KU2 A;  2R3S A;  3SZT A;  5FLX K;  5J1U A;  3HPG A;  4CDG A;  3L1P A;  2HXO A;  4EM0 B;  4RAZ A;  3IUO A;  5FKK A;  4B1R A;  2DCE A;  2MC4 A;  4WXC A;  2DO7 A;  3JAM Z;  2KL4 A;  3BPV A;  1PVE A;  3JRE A;  3HIF A;  4CA0 A;  2GXA A;  5D6E A;  1WJE A;  5L3D A;  3ZQL A;  3QP5 A;  1YW8 A;  2V7F A;  2G0E A;  2NS0 A;  4KIB A;  1S72 I;  2IS1 A;  1X1B A;  2Y69 H;  4IPA A;  3BR3 A;  1JJ8 C;  1TTY A;  2FA5 A;  4HV6 A;  1R22 A;  4R79 A;  4CO8 A;  2CQ7 A;  2LC2 A;  2X85 A;  2L54 A;  4RB0 A;  3AKZ A;  3VDX A;  1AKH B;  2GZW A;  3KEQ A;  3PO2 J;  1UG2 A;  4ZYG A;  2CYY A;  1WPK A;  5J4Y A;  2HVS A;  2ISY A;  4I98 B;  3K2Z A;  3KP3 A;  2MBF A;  4HYE A;  1JHH A;  3I3L A;  2WAE A;  5FKL A;  4S0H B;  5LHG A;  1MD0 A;  3RQI A;  3OOU A;  4EVI A;  4BQO A;  3VFZ A;  2NNN A;  4HAM A;  1MDM B;  3CCS I;  1GUU A;  3H9Q A;  4IHV A;  1FMW A;  1O3T A;  2LF7 A;  1P7J A;  1Z6R A;  4FTH A;  1K6O A;  2KFD A;  4PUS A;  4C9Y A;  3OYD A;  1Z0X A;  1UEL B;  3M7G A;  4AYB N;  3ELK A;  3F8B A;  3DBR B;  1VI0 A;  5TGT A;  2L7K A;  4MQV A;  2M87 A;  2HYJ A;  4CCJ A;  5IYD J;  2E60 A;  2ZSH B;  1BIB A;  4KIS A;  2HZD A;  3CCY A;  1K61 A;  3OYG A;  1ZG3 A;  3HDD A;  3HUG A;  4BY1 J;  2RGV A;  3C1D A;  1Z21 A;  4I01 A;  4Y7N J;  3F72 A;  3EYY A;  1V5G A;  3KCC A;  1U2W A;  4PGH A;  3K70 C;  3CJT B;  2H8R A;  2R5Y A;  1RC9 A;  2P8T A;  2VT2 A;  2HQR A;  3FXU A;  1J0R A;  1ETX A;  4BE1 A;  2GA2 A;  5J1Y A;  2E7X A;  1WJA A;  3L2C A;  3OYK A;  2L7M P;  3F8M A;  4E7S A;  3MVP A;  3GFI A;  1IRG A;  3LMM A;  4KYW A;  3LOC A;  1Y8Q B;  2OPT A;  1W5S A;  4B43 A;  2NVQ J;  1I3A A;  1KYZ A;  4ESF A;  3LA3 A;  4ITV A;  5D8L B;  2BE5 F;  2WY8 Q;  2H94 A;  4MLO A;  3L2U A;  3AG2 H;  5EYR A;  4AVZ A;  2JJ7 A;  2QSG X;  2DYS H;  3J7A O;  4RLF A;  4LG3 A;  3DF8 A;  2Z16 A;  1P2F A;  2HTJ A;  1JUM A;  3T8T A;  1ZEL A;  3W3C A;  4I76 A;  5GP9 A;  4EM1 A;  3KX2 A;  2DW4 A;  2ACJ A;  3HUG B;  4MTE A;  2EFN A;  1GVJ A;  1A6Q A;  3EYI A;  4ZYE A;  3CLO A;  5DD8 A;  1JKR C;  2HOE A;  3K2A A;  1T39 A;  1SD5 A;  3K1N A;  1OCR H;  3DPT A;  1WI3 A;  1G3W A;  3CES A;  3QYB A;  5B3S H;  2R5Y B;  4LK0 F;  5CVV A;  2W00 A;  4EJW A;  3AG4 H;  1TT0 A;  2FBH A;  3GZN B;  2X6W A;  3QWL A;  2M7A A;  2JT1 A;  2KIF A;  5FB2 A;  1W7P D;  3BR0 A;  3WU1 B;  3TOA A;  1BR1 A;  3QU6 A;  2WV0 A;  3J80 K;  2K27 A;  2EIL H;  5AON A;  2X1D A;  2CGP A;  1WVR A;  5HOD A;  2GBY A;  2I8D A;  3DU6 A;  5HOO A;  3DEW A;  1IDY A;  3CCU I;  3BG6 A;  2ADU A;  3GFM A;  4KA4 A;  1O7L A;  4B09 A;  3FMS A;  2RNJ A;  2ECC A;  2XV4 S;  3K4M A;  3PFI A;  2WAD A;  1JUP A;  3UNG C;  5B1B H;  2ESN A;  2VKE A;  2RRE A;  2FD5 A;  1SD6 A;  2DN0 A;  2K4J A;  4BUP A;  3GW2 A;  2PN6 A;  2XF6 A;  4JX6 A;  4A6D A;  2E2H J;  1ZG5 A;  3ISP A;  2FOK A;  3BY6 A;  1RUO A;  3SFZ A;  2DK5 A;  1B9N A;  4A3J J;  4M3F A;  1WJC A;  2IS2 A;  1T33 A;  2AO9 A;  2KRF A;  3K4L A;  4XK4 A;  1IG7 A;  2LK2 A;  1YJN I;  5L3C A;  1UAA A;  4HEA 2;  4JQF A;  2EZH A;  4A3D J;  5DTD A;  2QWW A;  3NEU A;  3T8R A;  5LGT A;  2F4I A;  4G6T B;  1YYV A;  1BOB A;  1W1W E;  2EA4 A;  2Y9Y A;  3DLL F;  4D7M A;  4FX4 A;  4YFK F;  5B5E C;  5FLV A;  2VOO A;  1DGW Y;  2STT A;  3K10 A;  4D1Q A;  1G3Y A;  2FXA A;  2PMU A;  3KP5 A;  1Y39 A;  2W84 A;  2WAQ N;  3OS2 A;  3W6V A;  3QYF A;  1S5L C;  2YPR A;  1UHW A;  2XF5 A;  2R0Q C;  1OYY A;  4I7H A;  2DT6 A;  2J5P A;  2EZI A;  1TC3 C;  1WJ5 A;  4EQQ A;  1PP7 U;  3HRT A;  4UVA A;  5LRR A;  1VF9 A;  4XLE A;  1QZE A;  2A5W A;  1QPI A;  4C2U A;  5H2F C;  3CCM I;  4IHX A;  1FWZ A;  1FY7 A;  2EZK A;  3SDG A;  1XGS A;  2E34 A;  3V7S A;  4YIF A;  5KAI C;  2VQL A;  2LOO A;  4HLY A;  4UV8 A;  2YU3 A;  1HST A;  3P9K A;  1R58 A;  2DA7 A;  3G71 I;  5BMZ A;  5ILV A;  2HDC A;  1LFU P;  2H6C A;  2BW3 A;  3TQN A;  5J1R A;  2KIS A;  2JA8 J;  3K6G A;  3G6E I;  3F21 A;  1SAU A;  3BG7 A;  2XRO A;  3D0S A;  3TW6 A;  2PMZ N;  2FX0 A;  1YO5 C;  1FEX A;  4XR6 A;  4RM2 A;  1IAW A;  1IZ1 A;  3JCU C;  2W82 A;  4G6Q A;  4CHU A;  4PJM A;  4F52 A;  1IO2 A;  3BQY A;  4OIN F;  4UB6 C;  4CGZ A;  3WHB A;  2NS7 A;  2BHZ A;  6PAX A;  3VB2 A;  2VKV A;  5AIP A;  2LKP A;  5J8F A;  4GO1 A;  5M5W J;  5H6Q A;  1D8K A;  1MBF A;  2Y9Z A;  3PUF A;  3ZN1 A;  5FFZ A;  2KIM A;  1BC8 C;  3DQV C;  4A3K J;  1Z3Y A;  2O3F A;  1RKW A;  1H0M A;  1BI0 A;  2OTL I;  2VC0 A;  5CKT A;  2BW3 B;  5HDG A;  1HW1 A;  1OCP A;  2ZME C;  1VTN C;  2DMN A;  1FT9 A;  2HGC A;  4IHY A;  1OYI A;  2XAH A;  1I27 A;  3OV8 A;  4P9U A;  1S3J A;  1IC8 A;  1YJ9 I;  4HNT A;  1O3R A;  4E7Z A;  3CQZ J;  3M3Y J;  5E3M A;  1KYW A;  3Q9V A;  1MJA A;  3TDZ C;  4YII A;  5ED4 A;  3HOW J;  4BQN A;  1IRF A;  1Q1H A;  4XKW A;  2L4A A;  1R5I D;  4M3E A;  4BS9 A;  3SXY A;  3M8E A;  2FQ3 A;  2QCO A;  3WGI A;  4XLP F;  2MD5 A;  2QUF A;  5DEQ A;  3A0B C;  1Y0U A;  4N9H A;  1RET A;  2LSO A;  4LFU A;  2DFF A;  3BJO A;  3BCA A;  4UUT A;  2A61 A;  1J2X A;  5C4X J;  1ETK A;  1EKE A;  1SFK A;  3CCE I;  4UNO A;  3LA2 A;  2XKO A;  2DMP A;  4LB6 B;  1X3W B;  4LJZ F;  2BBY A;  3CO7 C;  1OPC A;  4BE0 A;  2WB1 N;  4ENK A;  1JTY A;  3E97 A;  2LYC A;  4OAY A;  2X6O A;  2W85 A;  2W4S A;  3AG1 H;  4CYD A;  2QSF X;  2M0M A;  3HGY A;  5F27 A;  2R93 J;  1MMN A;  3TP3 A;  5H20 A;  2KQR A;  2XHK A;  2QA4 I;  3Q0W A;  3F0C A;  4BBS J;  3WG9 A;  4B3A A;  1TQI A;  3G1O A;  2UXN A;  2R7R A;  2R7W A;  5EZG A;  2E1M B;  2ISZ A;  4M73 A;  1V55 H;  4KN4 X;  2NVU B;  5TIS C;  4BXX J;  4L9V A;  3K4J A;  1QRY A;  1E3H A;  2X51 A;  2XVC A;  3ZMD A;  3DEU A;  2ZJQ F;  3O8H A;  2MLK A;  3S1R J;  2KZV A;  4ABZ A;  3WTX C;  1SMY F;  4JOM A;  2L02 A;  3PNV A;  3ZMU A;  3JSP A;  2VLA A;  5E3O A;  3G1L A;  4PJN A;  3N05 A;  3H9J A;  3F8C A;  2JPB A;  3BTJ A;  1FJL A;  2XAQ A;  2LP0 A;  2K4B A;  3CMY A;  3O3K A;  5EGO A;  2Q0O A;  4O5V A;  2CUE A;  4EM2 A;  4QPO A;  1RPW A;  3WTV C;  3OYB A;  2L9R A;  4IQJ A;  2F48 A;  1U5T C;  4MFD A;  2HZT A;  3TDU C;  1ZGW A;  2ME6 A;  3OYJ A;  2M3A A;  1ONV A; 
#chains in the Genus database with same CATH homology
 3ZQ7 A;  3L09 A;  2KJC A;  4RGS A;  4CIC A;  3IRR A;  5BOX A;  2NYX A;  5LBQ A;  2Z33 A;  5L3B A;  4HX7 A;  1XCB A;  1LDD A;  1MZB A;  3GUD A;  4MQ9 F;  1L0O C;  5HLG A;  4Q47 A;  1YG2 A;  3ZMV A;  1QNT A;  2BV6 A;  3G73 A;  3TO7 A;  4HDV A;  5E1W A;  3D5L A;  1MGT A;  4PDK A;  1YS6 A;  2IVM A;  2WWY A;  5DD4 A;  2XRN A;  1SFX A;  1U6G A;  1TBX A;  5E8G A;  4GGG A;  1FBS A;  3TKY A;  3LQR A;  3HYI A;  2RQP A;  3SZP A;  1SFE A;  2PBI A;  4MGR A;  3F8N A;  1HSJ A;  1ZRF A;  3HHH A;  2DT5 A;  5F1R A;  5CYV A;  3O6B B;  3I53 A;  1J9I A;  1DPR A;  1B1B A;  1KU3 A;  4NQW A;  5JVT A;  1FZP B;  2UWM A;  4I09 A;  2P7C B;  2EV6 A;  3ULQ B;  4MEX F;  3KLN A;  2PFB A;  2V9V A;  3V8J A;  1L3L A;  2EV0 A;  1XCV A;  1DPU A;  2IA0 A;  5IT9 K;  2ETH A;  3I71 A;  5F6F A;  1IN8 A;  3FWE A;  3AAF A;  2OD5 A;  2MLG A;  2P7V B;  2PMH A;  3WTW C;  3SQN A;  2VE8 A;  1O57 A;  3MAJ A;  2K7L A;  2ZME A;  1A04 A;  4XBF A;  2JSC A;  3V7C A;  4HDU A;  4R1H A;  1FP1 D;  4ZH4 F;  4BQA A;  4OIO F;  5K5R A;  2L3D A;  2VBX A;  4P55 A;  4L0Z B;  3E6D A;  2K86 A;  3M8F A;  2OBP A;  1XMA A;  3V7R A;  2L01 A;  2FSW A;  2DQL A;  1IUY A;  3LAP A;  3CUQ C;  3U2R A;  2R7D A;  1UFM A;  1TNS A;  3I58 A;  2ESH A;  3RJP A;  5DV5 A;  1O3S A;  3FZV A;  4AIH A;  3JAM K;  3F3X A;  3V4G A;  4IRI A;  2VBW A;  2ZME B;  3WE2 A;  2Z5U A;  3MEX A;  2STW A;  4LGW A;  1G6N A;  4A0X A;  2CFX A;  4KNY A;  4AWX B;  4G94 A;  3NRV A;  2A6H F;  2DTR A;  4CXF A;  3T1B A;  1LVA A;  3OOP A;  1FBQ A;  4KIC A;  2COM A;  1P4A A;  3BRO A;  4BH9 A;  1BI3 A;  2HQN A;  3R0J A;  2CG4 A;  4EV0 A;  5F64 A;  4KMF A;  2KKO A;  2GA1 A;  4G9Y A;  2MA3 A;  3MWM A;  1K78 A;  4LG0 A;  5D5W B;  5EEG A;  4G8X A;  1FYL A;  4ZZL A;  1I1G A;  3IC7 A;  4HF0 A;  3ERE D;  1BOA A;  1U5T A;  2CW0 F;  3RKX A;  1YLF A;  2ZXJ A;  3MQ0 A;  2YX7 A;  1ZGA A;  4OIP F;  4EJT A;  4QWQ A;  3K1M A;  4WXH A;  3IKV A;  5DCF A;  4XRF A;  1ODD A;  4CZZ A;  1ZYR F;  2DU9 A;  2DK8 A;  1K79 A;  4D0P A;  1K78 B;  1XGM A;  4LG0 B;  2O03 A;  3BJ6 A;  5H6R A;  4KMU X;  5HS9 A;  3KP4 A;  1U5T B;  2FU4 A;  2KJB A;  2G9W A;  4M74 A;  2EFP A;  4KDP A;  1XGO A;  5TRD A;  1H9G A;  4DNC A;  2GQQ A;  2W24 A;  5BQT A;  1CF7 A;  2E1N A;  4GYI A;  5DYM A;  4GXO A;  4E70 A;  1Z9C A;  2HKO A;  2R7F A;  2HYG D;  5HVQ C;  4R8H A;  2WC2 A;  2P5V A;  3EET A;  2CO5 A;  3ABU A;  2QM3 A;  3HRS A;  3N4M A;  2JRT A;  1Z05 A;  4ZYD A;  2H27 A;  3J81 K;  4M6Y A;  2Q2E A;  1BBY A;  5A2Q K;  1LQ1 A;  1RI7 A;  4U7B A;  1ZLK A;  4HBL A;  3HSR A;  3FXQ A;  1CF7 B;  1LEB A;  4IRG A;  2F5F A;  1USS A;  2GAU A;  2AS5 F;  1U8R A;  2V1X A;  5JFR A;  1BIA A;  1MJ9 A;  4A6E A;  4MTD A;  2PLY A;  5BPD A;  1RZ4 A;  3GXO A;  2EFW A;  1QO0 D;  3GX4 X;  2VON A;  5K5O A;  1V4R A;  1R36 A;  1TQM A;  4FT8 A;  5ERI A;  1S7O A;  4BNC A;  3I54 A;  2XKP A;  1DDN A;  1TLH B;  2DBB A;  3CUQ A;  3PQJ A;  5EEH A;  2D2W A;  2ZBK A;  2LF8 A;  1KU9 A;  1RIO H;  3J81 Z;  3QRF F;  4Y13 A;  3C18 A;  4EJU A;  5A2Q Z;  5ICE A;  1TW2 A;  1Z1D A;  2UXX A;  3F6O A;  1QBJ A;  4ZYH A;  3ECO A;  1PP8 F;  5ILS A;  3VEP A;  3BPX A;  1SAX A;  3CUQ B;  4Z2Y A;  3HOT A;  1UHM A;  1ZRC A;  3G3Z A;  5HS8 A;  4AVP A;  3WTT C;  2ELH A;  4EJO A;  2IA2 A;  3WOD F;  2GXG A;  1WI9 A;  1OMI A;  3K9T A;  4HQM A;  1LJ9 A;  3GZ6 A;  2EWN A;  3GO5 A;  3TOB A;  4UHT A;  5HS7 A;  4GYG A;  1B6A A;  3JSO A;  4BHB A;  1YFH A;  4A12 A;  1NHA A;  1T0F A;  3V8L A;  5JHU A;  3E6B A;  3O2P E;  4WXD A;  3IL2 A;  2K02 A;  2M30 A;  1J59 A;  4L9N A;  4MNU A;  5HDN A;  3QPT A;  4LB5 A;  3P9C A;  2Z9O A;  5E1X A;  5BS6 A;  3E5X A;  4Q5S F;  5HLI A;  4L5I A;  2QBY A;  3T0Y A;  3RYR A;  1ZLJ A;  1IN7 A;  2IP2 A;  1FSH A;  2VBY A;  2HWV A;  1YS7 A;  3S2W A;  1BJA A;  2VE9 A;  5CLS A;  1HKQ A;  2OZU A;  4Y15 A;  5ICC A;  2FML A;  2NNY A;  5FD5 A;  2FE3 A;  2M1B A;  2BYV E;  3JW4 A;  4HV5 A;  2ZO4 A;  5CVI A;  1P92 A;  4P96 A;  2M5W A;  4L9J A;  4ENN A;  2FMY A;  2FRH A;  4PCQ A;  4A5M A;  4WCG A;  1XSV A;  2P4W A;  3ZMZ A;  3HRM A;  2QBY B;  5E1Z B;  3Q9S A;  2EK5 A;  5D4S A;  1S8N A;  3RDI A;  2LDU A;  1O3Q A;  4ZZD A;  4N9I A;  2DPU A;  1FNN A;  4EGY A;  2FNP A;  5FD6 A;  3F22 A;  3HSE A;  1Z91 A;  2W57 A;  1YTY A;  1YIO A;  4O6J A;  2F5E A;  3ROU A;  1E2X A;  3QOP A;  3V8K A;  1IN5 A;  2H09 A;  2D45 A;  4IVN A;  3P7N A;  1HQC A;  2RC4 A;  4UUV A;  3M1E A;  2HKX A;  3RIR A;  2G7U A;  2GXB A;  4UXN A;  4ENJ A;  3KZZ A;  2HEO A;  4PZJ A;  1K7A A;  2ZFW A;  2GIV A;  4KUM A;  1G3S A;  1MJB A;  3IWZ A;  3FM5 A;  4WX9 A;  3SHF A;  3LAJ A;  1BI2 A;  3K1P A;  5LLQ A;  1DUX C;  3DFG A;  1P4W A;  4KT5 C;  1LB2 A;  4BXU A;  1W4M A;  2A6E F;  2W25 A;  2M8E A;  4RB3 C;  4Q4Z F;  1XMK A;  5FGM A;  2F5D A;  1O7F A;  4HLX A;  2A07 F;  1Z7U A;  3FX3 A;  3BDD A;  3LWF A;  5D5U B;  4RAY A;  1R7J A;  2YSR A;  4EJV A;  4OOI A;  1I1S A;  1XD7 A;  2XIG A;  4L18 B;  4ETS A;  1FYM A;  4P5O A;  4EMS A;  4GCV A;  5K1Y A;  3WU0 A;  2PJP A;  2RVC A;  2ZCW A;  3RPU A;  4LLN A;  1FBU A;  3H3Z A;  1REP C;  2HTS A;  5FFX A;  4JBA A;  4L9T A;  1TW3 A;  1PDN C;  5DUK A;  5D5V B;  4ENM A;  2WTE A;  1T6S A;  3HSF A;  5D5X B;  1FSE A;  1H9T A;  1ZG1 A;  3COA C;  2G7H A;  1HW2 A;  3VOD A;  1KGS A;  2QYO A;  2XAJ A;  1FPQ A;  2VXZ A;  4M6X A;  1BI1 A;  3GYH X;  2MH9 A;  2BGC A;  3I59 A;  1TQP A;  3L9F A;  2YX4 A;  1TNT A;  3DPL C;  3CO6 C;  3DXJ F;  1QZZ A;  3R6S A;  4HQE A;  1R5G A;  4IRH A;  2KIU A;  2Z99 A;  1R1V A;  3FMR A;  2V1D A;  3I5U A;  4U88 A;  1KQ8 A;  3RYP A;  5E18 F;  3GF2 A;  3I59 B;  3PQK A;  3U9G A;  5JR3 A;  3U1D A;  1DP7 P;  1S29 A;  3I64 A;  3FMQ A;  3R4K A;  3H3U A;  2UZK A;  4F7Z A;  3MZY A;  3KP2 A;  1HKT A;  1J75 A;  4YFN F;  1HBX G;  4KN7 X;  1C0W A;  3GZ5 A;  1KQ9 A;  2NRA C;  2A68 F;  2VT3 A;  2XUB A;  1FLI A;  1FC3 A;  2EFO A;  2ZKZ A;  2XGX A;  3WTZ A;  4RB1 A;  4OMZ A;  2RN7 A;  4P9F A;  1J7K A;  2E7W A;  3EDP A;  1XN7 A;  3E6C C;  1FYK A;  3GFL A;  3LA7 A;  1R00 A;  2H6B A;  2DI3 A;  2NAZ A;  3R61 A;  1XB4 A;  3FXR A;  4DQ2 A;  2YR2 A;  4RS8 A;  4ESB A;  2HR3 A;  2VC1 A;  1ON1 A;  4NB5 A;  3QP6 A;  2F5C A;  1RNL A;  2P6S A;  1IXS B;  4G6D A;  4I2O A;  4YG2 F;  5AIQ A;  4N0B A;  3RPQ A;  1I6X A;  1D8J A;  5LHI A;  2DQR A;  1MDM A;  2Z3Y A;  3T5X A;  4BAY A;  1F1Z A;  1T2K A;  1QPM A;  4WWC A;  3K69 A;  3MFK A;  3BZ6 A;  5DUI A;  5D8K B;  4EGZ A;  3QU3 A;  3B02 A;  2BEO A;  1IW7 F;  1YQA A;  2Y0M A;  3B73 A;  3QPH A;  5ICF A;  4KFC A;  3BP8 A;  3WGH A;  1WWX A;  2V1U A;  2VOD A;  2EV5 A;  5CVU A;  1B59 A;  1J5Y A;  3RKW A;  3Q5F A;  2HFH A;  1EH7 A;  3C7J A;  3RTR A;  1QGP A;  3FF5 A;  2VOP A;  5IT3 A;  3MZH A;  4LMY A;  1F9N A;  1OKR A;  2IJL A;  3DKW A;  3F8F A;  1HXD A;  5FLX Z;  3WTU C;  4I0A A;  2MC3 A;  4RGR A;  1U78 A;  5LGU A;  1MKM A;  2OA4 A;  4PGG A;  1V3F A;  3BWG A;  3F6V A;  1FP2 A;  1STZ A;  5CJ9 A;  1BN5 A;  5KVR A;  3H92 A;  3E5Q A;  1F5T A;  4G7O F;  5DCM A;  1BC7 C;  4IHS A;  1UB9 A;  2QQB A;  1WQ2 A;  2X0L A;  1ZHF A;  2EB7 A;  1G4D A;  5JI6 A;  4G7Z F;  2QQA A;  3RI4 A;  4AD9 A;  4OIQ F;  5BPI A;  2B0L A;  2FF4 A;  2V79 A;  1P4X A;  2IW5 A;  1P6R A;  2X4H A;  3F23 A;  1PUE E;  1LDK B;  4AIJ A;  2JZY A;  1IXC A;  3KFW X;  1S7A A;  3M9A A;  4H0E A;  4S05 A;  1ZH5 A;  2FEZ A;  4MEY F;  5DCM B;  4WK8 F;  4K2E A;  4HX4 A;  5J6X A;  3WGG A;  3FM3 A;  2PI0 A;  5LGN A;  1CGP A;  1YW7 A;  3WTY C;  4Y17 A;  5D6F A;  3GLX A;  1HKS A;  4UVB A;  3DV8 A;  3HHG A;  3I4P A;  2OQG A;  2A5Y B;  3TGN A;  4U0Y A;  2M45 A;  2F2E A;  3ML6 A;  3ZMS A;  3K0L A;  3ZP5 A;  3WE3 A;  1GXP A;  1S6L A;  2O0Y A;  4HW0 A;  4LD5 A;  2CWE A;  4YFX F;  1GHC A;  3J80 Z;  1SD7 A;  1R1T A;  3ABT A;  4HX8 A;  1JHF A;  3EUH A;  4M71 A;  4BHC A;  5FO5 A;  2MH2 A;  5CVJ A;  1IN4 A;  2RKH A;  4ON0 A;  2PQ8 A;  3IWF A;  5K5Q A;  3IRQ A;  4A0Y A;  5DDG A;  1E17 A;  2CQK A;  4LLG F;  1AOY A;  2P5L C;  1XGN A;  2HYF A;  1UST A;  5LEJ A;  5CVR A;  1G3T A;  3TO9 A;  2LNB A;  2QVO A;  1EH6 A;  1IF1 A;  4BHP A;  2IPQ X;  1QZY A;  2XAS A;  1I5Z A;  3E5U A;  5LEK A;  1ZRD A;  3KE2 A;  3BOQ A;  3ZN0 A;  4JK1 X;  2Q8K A;  1LEA A;  2FNA A;  2DFI A;  3JTG A;  1ZN2 A;  2RV8 A;  2XAG A;  4B8X A;  2DLL A;  4KIG A;  2Y75 A;  2JTV A;  3CTA A;  1B4A A;  2IT0 A;  1LDJ A;  2QEN A;  1D3Y A;  3L7W A;  3E6M A;  2O6G E;  2EA2 A;  2ZNY A;  2QLZ A;  4BYY A;  2DAO A;  3FHZ A;  3R60 A;  4KIF A;  4ESJ A;  2FBI A;  1JGS A;  2P5K A;  1ULY A;  1R5H A;  4LLL A;  2A69 F;  3REO A;  1HW5 A;  2AXL A;  3LQQ A;  4M9X A;  5LHH A;  3HTS B;  5KK1 A;  4HOB A;  3L00 A;  4NHJ A;  2D1V A;  3IHU A;  5L3E A;  1OR7 A;  3VOE A;  4FHT A;  2VBZ A;  1B9M A;  1ON2 A;  2JPC A;  1WRJ A;  4A0Z A;  1GXQ A;  2C6Y A;  3NQO A;  3P9I A;  4XLN F;  3KP7 A;  4UVC A;  3LFK A;  3KET A;  4OIR F;  4M9Z A;  4O3M A;  4S04 A;  2A3S A;  2L4M A;  3WTS C;  3GEZ A;  1KQ0 A;  2HS5 A;  2Y48 A;  5J8C A;  5L3G A;  1ZGJ A;  1R23 A;  5E8I A;  4M72 A;  3W6J B;  4HF1 A;  4XSZ F;  5ILU A;  4U7D A;  1WKM A;  2OU2 A;  3W6K B;  3HRU A;  2DPD A;  3TO6 A;  4IJA A;  3BJA A;  4MHG A;  5D4R A;  2FBK A;  3MCZ A;  2O61 A;  3HOS A;  4WF2 A;  4A5N A;  3KEO A;  4HA8 A;  3JTH A;  4XSX F;  1JXS A;  4G7H F;  4L0Y B;  1AWC A;  1OYW A;  3GVA A;  4RGX A;  1FX7 A;  2E1C A;  1YW9 A;  1U3E M;  2ZJ2 A;  1IXR C;  1W7P A;  1FOK A;  3KLO A;  1T98 A;  1QQI A;  4IXA A;  5TJJ A;  4QLC U;  3QAH A;  4IF4 A;  1KU7 A;  3KZY A;  4U0W A;  4FX0 A;  1R1U A;  3ZMT A;  2EJR A;  3HTU A;  1IN6 A;  3IKT A;  1EV7 A;  4I0B A;  1X3U A;  1WSU A;  2TDX A;  3GWZ A;  1LNW A;  4ASN A;  1ZAR A;  2EFQ A;  4I02 A;  1D5V A;  5LRS A;  1W7P B;  1F4K A;  1BM9 A;  4AIK A;  2OAZ A;  2RDP A;  2PG4 A;  3E3V A;  1EH8 A;  5ICG A;  2IA1 A;  2XAF A;  4OU0 A;  3C3W A;  2OQR A;  1SFU A;  5HDK A;  3KP6 A;  4LK1 F;  4TV7 A;  4UV9 A;  1ZAO A;  2ZNZ A;  3LST A;  1T38 A;  1XDS A;  2P6T A;  5E20 A;  2V6C A;  3GFJ A;  2CSO A;  2GWR A;  1W5T A;  4RB2 C;  4Q48 A;  4M9S A;  3N97 A;  4L5J A;  3RKY A;  2PEX A;  1Z6T A;  3CJN A;  3I0T A;  5IT9 Z;  1XDU A;  3ECH A;  4HZF A;  2O8X A;  1XSD A;  2J5O A;  3ZPL A;  5HLH A;  3EQL F;  5E17 F;  4A2U A;  3DP7 A;  3CDH A;  1XSX A;  5L3F A;  4HF2 A;  2QQ9 A;  2D1H A;  4U0V A;  2OZ6 A;  3R0A A;  1SD4 A;  1UCR A;  4IHT A;  1KA8 A;  4RGU A;  1JE8 A;  1SMT A;  2IRF G;  3CUO A;  1ZRE A;  1RUN A;  2VN2 A;  2QZ8 A;  4OMY A;  1KU2 A;  2R3S A;  3SZT A;  5FLX K;  4CDG A;  4EM0 B;  4RAZ A;  4WXC A;  2DO7 A;  3JAM Z;  3BPV A;  3HIF A;  5D6E A;  5L3D A;  3QP5 A;  1YW8 A;  4KIB A;  2NS0 A;  4IPA A;  1TTY A;  2FA5 A;  4HV6 A;  1R22 A;  4R79 A;  4CO8 A;  2L54 A;  4RB0 A;  2GZW A;  3KEQ A;  4ZYG A;  2CYY A;  2ISY A;  4I98 B;  3K2Z A;  3KP3 A;  2MBF A;  4HYE A;  1JHH A;  5LHG A;  1MD0 A;  4EVI A;  3VFZ A;  2NNN A;  4HAM A;  1MDM B;  1O3T A;  2LF7 A;  1Z6R A;  1K6O A;  3M7G A;  3ELK A;  3F8B A;  4MQV A;  2M87 A;  1BIB A;  1ZG3 A;  3HUG A;  2RGV A;  3C1D A;  4I01 A;  3F72 A;  3EYY A;  3KCC A;  1U2W A;  4PGH A;  2P8T A;  2VT2 A;  2HQR A;  3FXU A;  1J0R A;  2GA2 A;  2E7X A;  3L2C A;  3F8M A;  3GFI A;  1IRG A;  4KYW A;  1W5S A;  1KYZ A;  4ESF A;  3LA3 A;  5D8L B;  2BE5 F;  2H94 A;  3J7A O;  3DF8 A;  1P2F A;  2HTJ A;  3T8T A;  4EM1 A;  2DW4 A;  2ACJ A;  4MTE A;  2EFN A;  1GVJ A;  3EYI A;  4ZYE A;  3CLO A;  5DD8 A;  2HOE A;  1T39 A;  1SD5 A;  3K1N A;  3DPT A;  1G3W A;  4LK0 F;  5CVV A;  4EJW A;  2FBH A;  2JT1 A;  2KIF A;  5FB2 A;  1W7P D;  3WU1 B;  3TOA A;  3QU6 A;  2WV0 A;  3J80 K;  2K27 A;  2CGP A;  5AON A;  5HOO A;  2ADU A;  3GFM A;  4KA4 A;  1O7L A;  4B09 A;  3FMS A;  2RNJ A;  2XV4 S;  3PFI A;  2ESN A;  1SD6 A;  2K4J A;  3GW2 A;  2PN6 A;  4A6D A;  1ZG5 A;  3ISP A;  2FOK A;  3BY6 A;  1RUO A;  3SFZ A;  2DK5 A;  1B9N A;  2KRF A;  5L3C A;  4JQF A;  2QWW A;  3NEU A;  3T8R A;  5LGT A;  1YYV A;  2EA4 A;  4FX4 A;  4YFK F;  2VOO A;  2STT A;  1G3Y A;  2FXA A;  2PMU A;  3KP5 A;  2W84 A;  2YPR A;  1UHW A;  1OYY A;  4I7H A;  2J5P A;  4EQQ A;  1PP7 U;  3HRT A;  4UVA A;  5LRR A;  1FWZ A;  1FY7 A;  1XGS A;  3V7S A;  4YIF A;  4HLY A;  4UV8 A;  2YU3 A;  1HST A;  3P9K A;  1R58 A;  5BMZ A;  5ILV A;  2HDC A;  2H6C A;  3TQN A;  3F21 A;  2XRO A;  3D0S A;  1YO5 C;  1IAW A;  1IZ1 A;  4G6Q A;  4CHU A;  4OIN F;  4CGZ A;  6PAX A;  3VB2 A;  5AIP A;  2LKP A;  5J8F A;  4GO1 A;  5H6Q A;  1D8K A;  3ZN1 A;  5FFZ A;  2KIM A;  1BC8 C;  3DQV C;  2O3F A;  1H0M A;  1BI0 A;  2VC0 A;  5HDG A;  1HW1 A;  1VTN C;  1FT9 A;  2HGC A;  1OYI A;  2XAH A;  1I27 A;  3OV8 A;  4P9U A;  1S3J A;  1O3R A;  1KYW A;  3Q9V A;  1MJA A;  3TDZ C;  4YII A;  5ED4 A;  1IRF A;  1Q1H A;  2L4A A;  3SXY A;  3M8E A;  2FQ3 A;  3WGI A;  4XLP F;  2MD5 A;  2QUF A;  5DEQ A;  1Y0U A;  4N9H A;  2LSO A;  4LFU A;  3BJO A;  2A61 A;  1J2X A;  4UNO A;  3LA2 A;  2XKO A;  4LB6 B;  4LJZ F;  2BBY A;  3CO7 C;  1OPC A;  4ENK A;  3E97 A;  2W85 A;  4CYD A;  5H20 A;  2XHK A;  3WG9 A;  1TQI A;  2UXN A;  2ISZ A;  4M73 A;  4KN4 X;  4L9V A;  3ZMD A;  2XVC A;  3DEU A;  2MLK A;  3WTX C;  1SMY F;  2L02 A;  3ZMU A;  3JSP A;  3F8C A;  2JPB A;  2XAQ A;  2K4B A;  3O3K A;  3WTV C;  2Q0O A;  4O5V A;  4EM2 A;  1U5T C;  2HZT A;  3TDU C;  1ONV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...