3WE3A

Structure of blm rqc domain bound to an arsenate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Bloom syndrome protein
publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we3A00
1S6LA 1LNWA 2VONA 3ISPA 1ZAOA 5D8LB 1Z7UA 1R36A 4A0YA 1FYKA 3FM3A 3FXQA 1BM9A 4HQMA 2FOKA 2PEXA 3E5UA 1B9MA 5LBQA 3N4MA 1R23A 2ZNZA 1TNSA 2VT3A 2D45A 3BJ6A 4IF4A 4RAZA 3D0SA 1FX7A 2PG4A 4KIBA 1MJBA 1EH6A 1XDUA 3OOPA 2QZ8A 1KU3A 3FM5A 3KP3A 2H09A 3BY6A 3KEOA 4CHUA 2PN6A 4ZYGA 2FF4A 1E2XA 1G3SA 3MEXA 2XVCA 2IW5A 4UVCA 2EA2A 5ERIA 4I09A 2YSRA 4UXNA 4G8XA 4JQFA 1MDMA 1BIBA 2MH9A 1T6SA 4P5OA 1V3FA 3BDDA 4ESJA 2Z5UA 1O7FA 2DTRA 2NYXA 1IXRC 1R5HA 4KIFA 4I02A 3ZMTA 2G7HA 4G7HF 4R79A 2A6EF 4CDGA 1ZRCA 2DAOA 1TQIA 3ABUA 3E3VA 2VC1A 2STTA 1W5TA 3D5LA 3ZN1A 2X0LA 1Z05A 5L3FA 1J5YA 4M6XA 1IN7A 2LNBA 4FT8A 2UWMA 3IC7A 2HKXA 4ESFA 1K7AA 3WTSC 5IT9Z 1HSTA 1I5ZA 1G3YA 1R58A 1T39A 1CF7B 1YO5C 3OV8A 1FWZA 4BNCA 5FFZA 5AONA 2DU9A 4YFKF 3DEUA 1T98A 3EETA 1FLIA 4A0ZA 1HBXG 1B1BA 2J5OA 2JT1A 4L5JA 3ZMDA 1G3TA 1D8KA 4A0XA 4EJUA 4UUVA 1KU9A 4XSXF 1ZG3A 3EDPA 2K7LA 4A6EA 2VE9A 1F4KA 5HDNA 4I98B 3FHZA 3WG9A 3GXOA 4IRHA 3GF2A 2KJBA 1MZBA 3F8MA 1HSJA 1R1TA 4CYDA 5H6RA 3F8NA 2P5LC 2Q8KA 1I1GA 4LFUA 1HW1A 1NHAA 1SFEA 2OZ6A 4LLNA 1MDMB 4NB5A 2YX7A 1PP7U 3EYYA 3NQOA 3FMSA 3QPHA 4PGGA 2BEOA 2DK5A 1D3YA 1OMIA 3KFWX 2BV6A 4FX4A 4HX8A 5EEGA 3HRUA 2QQBA 2HKOA 1B4AA 1WWXA 1K78B 2XV4S 2EV6A 2GIVA 1XD7A 3CJNA 3VFZA 3E6MA 1WKMA 1OYIA 4HF1A 2LF8A 2V1XA 4YFXF 1B9NA 1O3RA 3ML6A 4BHCA 3T1BA 5L3GA 2LF7A 2FSWA 5BS6A 3F6VA 3REOA 3GFIA 4IPAA 5TRDA 2QLZA 4TV7A 1H9TA 2EFNA 5LGNA 3WODF 4OIQF 3CUQA 1KQ9A 2IPQX 1P2FA 3DKWA 3MCZA 1HKQA 2E7WA 2QWWA 2YX4A 4KN4X 2UXNA 2FBKA 4LJZF 2RKHA 4OMYA 2ZNYA 3WGGA 4BXUA 4LD5A 2PJPA 4UV8A 2XHKA 2Y0MA 4U0YA 1U5TC 2PMUA 2STWA 1YG2A 4ON0A 4R1HA 1BJAA 3MQ0A 1UHMA 4LLLA 4A5NA 3U1DA 1G6NA 3RI4A 1XGNA 1Z1DA 4WXDA 2FEZA 4RGSA 3RIRA 1FT9A 4MQ9F 5LLQA 4HX7A 4I0AA 4GO1A 5K1YA 2D2WA 5D8KB 4HLYA 3V8JA 5FLXK 3F22A 3WGHA 1SMTA 4K2EA 2Z33A 2DQRA 1BBYA 2FE3A 3IKTA 5E20A 3QP5A 2O03A 1RZ4A 4L5IA 1TTYA 1RUNA 4ENKA 4ZZDA 5ILVA 1WQ2A 2R7FA 2VBYA 3TQNA 3KLOA 2HYGD 2V6CA 3BPVA 2F5CA 1Z6TA 2EV0A 5FFXA 4N9HA 2EA4A 4OU0A 1XCVA 2WV0A 1TNTA 2ZMEA 2DLLA 3J81K 3L7WA 2RV8A 3QRFF 1GXQA 2J5PA 2DPUA 3HUGA 2Z9OA 3QU6A 2DW4A 3IWZA 4L0YB 2AS5F 3KZZA 3JAMK 2L4MA 3DF8A 4GXOA 1Z91A 3CUQB 3V7RA 1WRJA 2XAHA 2NRAC 1P92A 5CVVA 3RKYA 4G6QA 3BJAA 4OMZA 3T5XA 2ELHA 2LSOA 2XKPA 1XDSA 1LEBA 5DEQA 1Z9CA 1QQIA 3AAFA 3TO6A 1HKSA 4KFCA 4LLGF 4WX9A 3SZTA 1ZG5A 3Q5FA 4IJAA 2JPCA 3EYIA 1PUEE 4M74A 3MZHA 1SMYF 4EM2A 1AWCA 3VEPA 3E6CC 2O0YA 3M7GA 3I0TA 2RC4A 4ASNA 4KICA 4ZH4F 1JXSA 5J8CA 3O2PE 6PAXA 5KVRA 2DI3A 4F7ZA 2Y75A 2IP2A 3FMQA 2ACJA 2HR3A 1KYZA 3K9TA 2HOEA 1ZYRF 5BOXA 1YQAA 1T38A 1P4XA 4BYYA 3KP4A 3H3ZA 5E8IA 3WE2A 1SD4A 3G3ZA 3KETA 3VB2A 3K1PA 4BAYA 3TO9A 1HQCA 3IHUA 3IWFA 4P9FA 3N97A 4GYIA 5FD6A 4KMUX 3KEQA 3HOTA 4YIIA 4RB2C 2ADUA 5A2QK 3E6BA 2ZMEB 2Q2EA 4PGHA 3O3KA 2P4WA 4IXAA 1P4AA 3I59A 3HOSA 4EGZA 5CVRA 3LAJA 4EQQA 1KA8A 1O57A 1YLFA 1CF7A 5E18F 5CVUA 1RUOA 2PQ8A 2W25A 3ZN0A 2HEOA 5DYMA 4AWXB 2M87A 4OIRF 2F5DA 3QAHA 3DPLC 4G7OF 5LHGA 4M71A 3RDIA 3R6SA 4UV9A 1KGSA 4L9JA 2K4JA 5D4RA 3GX4X 4UHTA 1ULYA 2O8XA 1TQPA 4WK8F 2H27A 2IRFG 3S2WA 1R5GA 1XSVA 2CO5A 2MLKA 4Q4ZF 2WTEA 2M8EA 1O7LA 2XAJA 2OQGA 3L2CA 3SZPA 3HYIA 4LGWA 1IRFA 2CWEA 1BI1A 4G7ZF 4S04A 3BP8A 2ZKZA 4HQEA 4MEYF 2A61A 3GVAA 3H3UA 2A68F 3PQKA 3RJPA 1K78A 4HDVA 1FYLA 3L09A 3F6OA 3HHHA 2CFXA 5E8GA 1IUYA 4MNUA 5DUIA 4Q47A 2JPBA 5LRRA 2WC2A 4U7DA 3J7AO 2W84A 4ZYDA 3RPUA 3K69A 5L3DA 2BBYA 4XBFA 3GZ5A 4CGZA 2WWYA 5ICGA 3IL2A 3P9IA 4AIKA 2HDCA 1YW8A 1ZH5A 4LMYA 3WTYC 2JTVA 1UB9A 4Y15A 5JFRA 5JI6A 3LAPA 2FRHA 1JHHA 1OKRA 2V1UA 3I59B 4AVPA 4A2UA 5AIPA 1Y0UA 1FBSA 3DXJF 3M8EA 1STZA 3GLXA 4L9VA 2L54A 5DD8A 1D5VA 2FA5A 2H94A 2HGCA 2W57A 1HXDA 4Q5SF 3LQRA 2EV5A 3IRQA 5LGUA 3K2ZA 3C7JA 3EUHA 2KJCA 2P5VA 3MWMA 1CGPA 5CYVA 5ILSA 2ISZA 5CVIA 4RS8A 1H0MA 2KKOA 4KT5C 2QENA 2R7DA 3KP6A 2MLGA 1YIOA 3PQJA 4MGRA 5LEJA 4XLPF 2ETHA 1P4WA 3HIFA 1YW7A 1F9NA 3KCCA 5CJ9A 3J80K 5ICFA 1FC3A 2IA2A 3QU3A 3I4PA 4M72A 4DNCA 5BMZA 2KIMA 2RNJA 4HV6A 5AIQA 3GFMA 1GHCA 2PLYA 4XRFA 3L9FA 4HF0A 1LDKB 3T0YA 3LA2A 2D1VA 1HKTA 4KMFA 3V7CA 1O3TA 2ZFWA 1J2XA 1P6RA 5LHHA 2BE5F 2PFBA 3I53A 4EM0B 2E1CA 3T8TA 5D4SA 4NQWA 1JHFA 2M45A 4HA8A 3ZMVA 1GVJA 5HOOA 4CZZA 2VODA 2ZJ2A 4IRGA 4M9XA 4JK1X 4O3MA 4AD9A 2F5EA 2GAUA 3R0JA 3TDZC 3CUOA 4U88A 3BROA 4WWCA 4UNOA 2W85A 4KYWA 1BC8C 4EJVA 1XN7A 3HRSA 2OA4A 1A04A 4M73A 2H6CA 3GO5A 5BQTA 2H6BA 2DFIA 1MGTA 3P9CA 1ZRDA 1S29A 2EK5A 4LB5A 5DDGA 3ULQB 4P9UA 5F1RA 4IHSA 1XGSA 3GYHX 4BHPA 3DP7A 2VT2A 2EFPA 1G3WA 1SD7A 2A07F 1MJ9A 2CYYA 2OU2A 1ODDA 4XSZF 5D6FA 3ZPLA 5D5VB 3R60A 4HLXA 3F3XA 5L3CA 1SD6A 3RYRA 3V8KA 1DUXC 1IN5A 3BZ6A 2VE8A 2P7VB 5FLXZ 4LK0F 1SAXA 4U0WA 1QZZA 3F8CA 2OQRA 3ROUA 5J6XA 1IF1A 1EH8A 2RQPA 3QPTA 2E1NA 3CO6C 3V8LA 4E70A 5FD5A 1IRGA 3WTTC 3F8FA 1X3UA 2HQRA 4I2OA 2PBIA 2DBBA 2NS0A 4HOBA 5E1WA 2MBFA 2NNYA 2Y48A 1YYVA 2R3SA 2XUBA 4R8HA 5IT3A 5LRSA 3CUQC 3J81Z 5CVJA 2QM3A 1MJAA 2P8TA 2QBYA 2ESHA 1LB2A 2O6GE 1FP2A 3ZMSA 3KZYA 2Q0OA 4LB6B 3TOAA 1VTNC 5L3BA 3GZ6A 4WXCA 4ENJA 3BWGA 1S7AA 2OAZA 3K0LA 1UHWA 4YIFA 2EFOA 2FNPA 1EH7A 3COAC 1TBXA 4U7BA 3B02A 2GA1A 4EVIA 1I6XA 1W5SA 3KP7A 4MTEA 2O61A 5HLGA 1J75A 2CSOA 2EFQA 1LEAA 4HX4A 4QWQA 3E5QA 2L01A 2OBPA 3I5UA 4QLCU 1OYYA 3HSFA 3Q9VA 4S05A 4ESBA 3BPXA 2HWVA 1FBUA 3TOBA 3MAJA 4ETSA 1O3SA 5H6QA 1I27A 5TJJA 3F23A 4L18B 3TDUC 4HW0A 2GXGA 2VBZA 1XSDA 4I0BA 5K5RA 1JE8A 1ZLKA 4Z2YA 1S3JA 2FMLA 1IXSB 2OZUA 2F5FA 4RAYA 1QO0D 2KIFA 2D1HA 2L3DA 2A69F 1ONVA 3JW4A 1XGMA 1T2KA 1PDNC 1SFXA 2VBWA 3RPQA 3G73A 4YG2F 3ZMZA 3HTUA 1IAWA 1W7PD 1MKMA 3M9AA 5HDGA 2GWRA 2ESNA 2NNNA 5CLSA 2VOOA 3F8BA 5D6EA 2NAZA 3L00A 3K1NA 5A2QZ 2VC0A 3JSPA 2A5YB 2ZCWA 3FMRA 3HTSB 5JHUA 2HZTA 3TGNA 4HYEA 1QBJA 1ZN2A 1XCBA 3HSEA 2TDXA 2QBYB 3PFIA 4P55A 1BOAA 1D8JA 1XMAA 4HAMA 4UVBA 4IHTA 4OIPF 1RIOH 3F72A 2ZXJA 2IVMA 4AIJA 2HYFA 3HSRA 4IRIA 4CICA 3R4KA 2L4AA 3F21A 2G7UA 4BQAA 3WTWC 3DV8A 2CG4A 3EQLF 3B73A 1ON1A 2QQAA 3ECOA 3HHGA 3DQVC 1L3LA 2GA2A 4KUMA 5LGTA 1DP7P 1L0OC 2XROA 3RKXA 4BH9A 1QNTA 5EEHA 1B6AA 1IZ1A 3O6BB 4AIHA 2QVOA 4RGXA 2HS5A 1PP8F 1OPCA 1BC7C 3ZQ7A 2IA0A 3H92A 2XAQA 2BYVE 3KP2A 1ZARA 3MFKA 4Y17A 1ZREA 3K1MA 1HW2A 2CQKA 4G94A 4RB3C 2Z99A 5D5WB 4UVAA 5FO5A 1KQ0A 3KLNA 3NEUA 1FP1D 3FXUA 1ZG1A 2HFHA 4O5VA 4NHJA 3LSTA 5D5XB 1IN6A 3DFGA 1T0FA 5HS7A 1WI9A 1TW2A 4A12A 1YW9A 2XGXA 4HBLA 1F1ZA 2XKOA 3M8FA 1TQMA 1J9IA 4GGGA 1W7PA 2QUFA 1QGPA 4KN7X 3E5XA 3VOEA 1EV7A 2CW0F 3WTZA 3R61A 3GW2A 2K4BA 3ELKA 3BOQA 5JR3A 1QZYA 3LWFA 1ZHFA 2MA3A 5E17F 4Y13A 2DK8A 4HF2A 1FSHA 2VXZA 2ZBKA 3JSOA 2CGPA 1DPUA 3I58A 4M9SA 2V79A 2IA1A 2QQ9A 5FGMA 4GYGA 2FMYA 2AXLA 3GWZA 2VBXA 1K6OA 3FWEA 4LG0B 2YR2A 2Z3YA 2XAFA 3CO7C 3SXYA 5FB2A 4EGYA 3ERED 3C18A 3VODA 5IT9K 1WSUA 4MHGA 1RNLA 3GFJA 1FPQA 2G9WA 5HS8A 1LDJA 5J8FA 2ISYA 1YTYA 2MC3A 1ON2A 1LQ1A 5HVQC 4EV0A 4P96A 2PI0A 1TLHB 4L9TA 2RN7A 1B59A 1FSEA 5DUKA 1DPRA 1USSA 4ZYHA 3WU0A 3U9GA 1FNNA 1O3QA 3CTAA 1Q1HA 2FBIA 1LVAA 3Q9SA 2UXXA 3V7SA 1J59A 3JTGA 3RKWA 4MTDA 1ZLJA 3J80Z 4EJOA 3I71A 2E7XA 1OR7A 1U5TA 2EWNA 4Q48A 1C0WA 1R1UA 1I1SA 3R0AA 1BIAA 3HRMA 5ILUA 4CO8A 1R7JA 1YFHA 1R00A 3M1EA 4MQVA 1J0RA 5KK1A 2RGVA 3LQQA 1S7OA 4LK1F 1F5TA 2GXBA 4KIGA 3P7NA 1V4RA 1R22A 4M6YA 5DCMA 1REPC 4N9IA 4OINF 2K02A 2FXAA 4U0VA 3SHFA 2COMA 1XGOA 3E97A 4HZFA 2M1BA 1W7PB 4IVNA 2EFWA 4FHTA 4EMSA 4ENMA 3BJOA 1LDDA 2LKPA 1G4DA 1KYWA 2YPRA 3WU1B 5K5QA 2B0LA 4RB0A 4PCQA 5DD4A 1HW5A 1IN8A 2LDUA 3QOPA 1ZGAA 4FX0A 3HRTA 3ZMUA 3JTHA 3FX3A 3LA7A 2W24A 4A5MA 3GEZA 1FY7A 2ZO4A 5BPIA 3P9KA 1XB4A 4PDKA 1XSXA 5F64A 1U6GA 2RDPA 4H0EA 4RGRA 2MH2A 4M9ZA 2BGCA 5F6FA 3RYPA 1IXCA 2FQ3A 1SD5A 4KA4A 3GFLA 4DQ2A 1AOYA 2EB7A 1BI2A 1UFMA 4RB1A 1KU7A 1IN4A 1QPMA 3I54A 1ZRFA 5D5UB 3ZP5A 2XAGA 3LA3A 2A3SA 3T8RA 3ABTA 2EJRA 2KRFA 4CXFA 5L3EA 2IT0A 1U2WA 2X4HA 1U5TB 4HV5A 2FNAA 1K79A 5DV5A 5HS9A 2KIUA 4ZYEA 5H20A 1R1VA 1E17A 3WTUC 3TO7A 2VOPA 5ICEA 1U3EM 2K86A 1H9GA 2FBHA 2XIGA 4A6DA 3LFKA 4YFNF 1KU2A 4G6DA 1ZGJA 3DPTA 3KP5A 2F2EA 3GUDA 5DCMB 2FU4A 2HQNA 2V9VA 4OOIA 5E1ZB 4EJTA 1FYMA 2DO7A 3IKVA 2IJLA 2DT5A 3I64A 1XMKA 4D0PA 5ICCA 1BN5A 4G9YA 1BI3A 1BI0A 3SQNA 4WXHA 3JAMZ 2YU3A 2DPDA 2M5WA 2GZWA 2P6SA 2P7CB 3WTXC 3IRRA 3FF5A 1S8NA 4MEXF 2HTJA 1FBQA 2M30A 3C1DA 1JGSA 4JBAA 2C6YA 2L02A 5LEKA 5JVTA 2DQLA 2XASA 1SFUA 4B8XA 3V4GA 4L0ZB 1Z6RA 1UCRA 1RI7A 2RVCA 4HDUA 5ED4A 1DDNA 3U2RA 2P6TA 4B09A 1IW7F 4O6JA 4RGUA 5BPDA 1U78A 2V1DA 1USTA 3ECHA 4BHBA 2VN2A 4PZJA 3SFZA 1TW3A 3TKYA 3FXRA 2K27A 2XRNA 3WTVC 3W6JB 3C3WA 3QP6A 4ZZLA 4OIOF 4GCVA 1GXPA 4EJWA 2O3FA 3RTRA 2JRTA 4KNYA 2PMHA 4I01A 2P5KA 2JSCA 1YS7A 3E6DA 2GQQA 5K5OA 1MD0A 4L9NA 4KDPA 4WCGA 1J7KA 2A6HF 5HLHA 2JZYA 3WGIA 4XLNF 1OYWA 4EM1A 1U8RA 3W6KB 2OD5A 2QYOA 1FZPB 4N0BA 4ENNA 3CLOA 5E1XA 3WE3A 3KE2A 1KQ8A 1LJ9A 5HDKA 1W4MA 3FZVA 4WF2A 3NRVA 1YS6A 4LG0A 2MD5A 3CDHA 2HTSA 5HLIA 5DCFA 1FOKA 3MZYA 4I7HA 2UZKA 5LHIA
chains in the Genus database with same CATH superfamily
1S6LA 1LNWA 2CRGA 2HQAA 2VONA 3MKLA 2W82A 3CQZJ 3ISPA 3D1NI 1ZAOA 5D8LB 2EZHA 1X4OA 1R36A 1Z7UA 4A0YA 1FYKA 4A3LJ 3FM3A 3FXQA 1BM9A 4S0HB 5CQEA 4HQMA 2BW3A 3BTJA 2H1KA 2R7VA 2FOKA 2PEXA 4UB6C 5FKNA 3E5UA 1P9QC 4NUBA 1B9MA 5LBQA 2UV1A 3OYGA 2QSGX 3JR9A 3N4MA 2XDVA 1R23A 2LYCA 2ZNZA 1TNSA 2VT3A 1E3OC 3AKZA 2D45A 3BJ6A 4IF4A 4RAZA 3D0SA 1FX7A 2PG4A 4KIBA 4D1QA 1MJBA 1EH6A 1K6YA 4LG3A 1XDUA 1WJBA 2KZGA 3OOPA 2QZ8A 1KU3A 3FM5A 3KP3A 2H09A 4PJ0C 3BY6A 3KEOA 5J47A 2HZDA 3H35A 4CHUA 2PN6A 5EGOB 4ZYGA 3H5RA 3KYCB 4E7HA 2FF4A 1E2XA 1G3SA 3MEXA 2XVCA 3BTLA 2IW5A 3HZJA 1D0ZA 2IS2A 4UVCA 3BLYA 2EA2A 5ERIA 1RR7A 1S7EA 2EPFA 3MD2A 4BQQA 5CQGA 2PMZN 4I09A 3VYTB 2YSRA 1YOVB 2VKDA 2M7BA 4UXNA 1A36A 3DBLB 1UG0A 4DOZA 3CZ6A 4G8XA 1A35A 2O8KA 4JQFA 3LSKA 1MDMA 1XX5A 4AIDA 2MSYA 4XNFA 3OYBA 1BIBA 2MH9A 3VSKA 2DT6A 1T6SA 2ME0A 4M3FA 4P5OA 1V3FA 1I3AA 4BXXJ 1MNEA 2AQFA 3BDDA 4ESJA 2Z5UA 1O7FA 2MD0A 3S3NA 4UUSA 3L2UA 2DTRA 3W6VA 2NYXA 1H88C 1R4MB 1IXRC 2DA7A 1R5HA 4XN0A 4KIFA 2K9NA 4I02A 3ZMTA 1WJEA 2CUZA 2G7HA 4G7HF 4R79A 2BVMA 2A6EF 4CDGA 1ZRCA 2DAOA 2LY9A 2Y30A 1TQIA 1J09A 3HEFA 1UAAA 4Y3OA 3ABUA 2WY8Q 3K7AJ 4B1RA 3E3VA 2VC1A 2XPVA 2STTA 1W5TA 3D5LA 3ZN1A 2X0LA 1Z05A 5L3FA 1LPQA 1J5YA 3ABKH 2H1LA 4M6XA 1IN7A 2LNBA 4FT8A 5KNLA 4C2UA 2UWMA 3IC7A 2HKXA 4BS9A 2L0KA 1XG1A 3DEWA 3ZQCA 2BXYA 5FRNA 3S16J 3GLLA 2JRMA 4BJTA 2R5ZA 4D5FA 4XLAA 2BOLA 4ESFA 1MBEA 2Q2EB 1K7AA 2IGKA 1SEUA 3WTSC 4XKBA 5IT9Z 1CQTA 5CKTA 3U21A 1HSTA 2GIZA 1FEXA 1I5ZA 2WB1A 2MFZA 1G3YA 2OCEA 3FBIB 3KIOA 3ZQLA 1X2MA 4M3GA 1R58A 1T39A 1CF7B 1YO5C 1HDPA 2DDBA 3OV8A 3QYBA 1FWZA 4BNCA 5FFZA 5AONA 2DU9A 4YFKF 3AG1H 3DEUA 1T98A 4CZCA 4CCJA 3EETA 2BW3B 2BXZA 1FLIA 4A0ZA 1HBXG 4DJAA 3DLLF 4CCOA 2BHYA 4A3DJ 1B1BA 2J5OA 2JT1A 4L5JA 2M4KA 2P81A 3ZMDA 1G3TA 3SDBA 1D8KA 2JVGA 4A0XA 1Y6IA 2CQQA 4EJUA 4UUVA 1KU9A 4XSXF 3G1LA 2FX0A 1ZG3A 3EDPA 1IG7A 1IUFA 5GPAA 5J1YA 3HPHA 1MBFA 2HXIA 2K7LA 4A6EA 2VE9A 1F4KA 3QQAA 2DMTA 2CQXA 5HDNA 4I98B 3A2KA 3FHZA 3WU2C 3WG9A 3GXOA 2F4MB 4IRHA 5DM7F 3GF2A 3KEYA 1OCTC 4CA0A 2KJBA 1MZBA 2R0QC 5C3EJ 3HOZJ 2CU7A 3TW6A 3F8MA 1N25A 3OS2A 4A3GJ 1HSJA 1R1TA 4CYDA 5FKMA 1S5LC 1HDDC 5H6RA 1W1WE 3F8NA 4U87A 4F92B 2E71A 2P5LC 1ZTRA 2Q8KA 1DU6A 3BZCA 5FKLA 1KONA 1I1GA 4LFUA 5IP9J 1HW1A 3K4MA 1NHAA 4M3EA 5GPCA 1SFEA 1YE9A 2NOJB 2OZ6A 1WCMJ 4XORA 1YI2I 4LLNA 2JA6J 1MDMB 2KMUA 2OTLI 4NB5A 2JA7J 3ZQQA 5IOYA 2YX7A 2LTPA 1WJDA 2VB6A 1YHQI 2OV7A 3EYYA 3NQOA 1PP7U 1JTYA 3FMSA 3QPHA 4PGGA 2BEOA 2DK5A 1D3YA 1OMIA 3KFWX 5F04A 4IHVA 2BV6A 5IP7J 4FX4A 4HX8A 2MC4A 5EEGA 5J1UA 3HRUA 2QQBA 2HKOA 1B4AA 1WWXA 1T33A 2BHZA 2VKEA 4UUSB 4II2A 1K78B 2K9QA 2XV4S 3OIOA 2EV6A 2GIVA 1XD7A 4FE7A 3CJNA 3VFZA 5H2FC 3E6MA 3GBGA 1WKMA 1OYIA 4HF1A 5EDNA 1LUJB 2LF8A 2V1XA 3HBLA 4YFXF 3TW7A 2DTZA 1B9NA 1X19A 3ML6A 1O3RA 3OR1C 3S32A 1X1AA 4BHCA 3T1BA 2CUJA 2DYSH 3W2VA 5L3GA 2LF7A 2FSWA 2KDZA 5BS6A 3F6VA 3REOA 3GFIA 3DBHB 2R7QA 4IPAA 3BG6A 4LITA 3OS1A 2QSHX 5TRDA 3PIOF 1NK2P 2QLZA 4TV7A 3Q0WA 4AUXA 5DTDA 2BY3A 1H9TA 1KZHA 1X1PA 2EFNA 5LGNA 3WODF 1ZR4A 2DJNA 2X85A 4OIQF 3CUQA 2VXDA 1KQ9A 2K85A 2R5ZB 2IPQX 3A0HC 1Z67A 1P2FA 3DKWA 5E3MA 3MCZA 1HKQA 1WH7A 4XKWA 4DZJA 5JVGF 2E7WA 2QWWA 4E7IA 2YX4A 3S2DJ 2VIXA 4KN4X 2UXNA 2LK2A 3E0JB 3A01A 1VQNI 4BQNA 4BUPA 2FBKA 4LJZF 2RKHA 4OMYA 2ZNYA 4B4CA 3WGGA 4BXUA 2E19A 4Y7NJ 2LH9A 3WG7H 1QPIA 3UKGA 4LD5A 3OSGA 2VJIA 3MZ8A 2PJPA 4UV8A 2XHKA 2Y0MA 1OR7C 4U0YA 1U5TC 2PMUA 2DFHA 4JX6A 2STWA 1YG2A 4ON0A 3SEZA 4R1HA 3I55I 1BJAA 3DCFA 3MQ0A 1PVEA 1UHMA 3HOVJ 4LLLA 4A5NA 3BR3A 1POGA 3MMYB 1G6NA 3U1DA 1WPKA 2VQLA 5B5EC 4BE2A 3RI4A 1XGNA 1Z1DA 4XK4A 4C3HJ 4WXDA 2FEZA 4RGSA 3RIRA 1FT9A 4MQ9F 1V55H 5LLQA 1PUFA 1E3HA 3QOEA 4HX7A 4E7ZA 4XLEA 2E5NA 4I0AA 3VWBA 4GO1A 1Z3XA 5K1YA 2D2WA 5D8KB 4HLYA 4A3KJ 3V8JA 5FLXK 3F22A 4KITB 3WGHA 1SMTA 3KYLA 4K2EA 4FISA 5E3OA 2M0MA 5K7FA 3OYJA 3OY9A 2DQRA 2Z33A 1BBYA 5B1AH 2FE3A 5F08A 2ME6A 1G8XA 1T95A 3IKTA 1VQ8I 5E20A 3QP5A 2O03A 1RZ4A 1XMXA 1EKEA 4L5IA 2R7UA 1TTYA 1RUNA 2VQGA 4ENKA 4QSHA 3GTGJ 1D1CA 4ZZDA 5ILVA 1WQ2A 1W0TA 4GDFA 3KYDB 3AL0B 2R7FA 3W2WA 1UJ8A 1JT6A 5E3LA 2VBYA 3TQNA 3K70D 3RKQA 4BGDA 5F0CA 3CJRB 3KLOA 2HOSA 2HYGD 4RAGA 2IBDA 2V6CA 4A3CJ 3PNVA 3BPVA 1HA8A 2VQCA 2F5CA 2CS3A 5K7ZA 3DWLE 2OTJI 1Z6TA 2EV0A 5FFXA 2GXAA 3JREA 3N05A 4N9HA 2EA4A 5TISC 3FKIJ 1AHDP 2JK3A 2DA5A 4OU0A 1QA6A 2QKLB 1F36A 1XCVA 3GTMJ 2WV0A 2L5QA 2YU9J 2DA6A 1TNTA 2Y9ZA 2HOAA 2ZMEA 2DLLA 1TWGJ 4E7LA 3J81K 2CW8A 3L7WA 2RV8A 2WBMA 3QRFF 4A93J 3L2VA 1GXQA 4A3MJ 2J5PA 3B6AA 2DPUA 3HUGA 2Z9OA 1BR2A 5KCMA 3LSMA 2P0WA 3QU6A 2DW4A 4NQWB 1ENHA 4BBSJ 3IWZA 4L0YB 4E7JA 5EZHA 3H9GA 2Y2ZA 2AS5F 2PX9A 1HC8A 2HU9A 2OCCH 3KZZA 3V42A 3ABLH 3S8PA 3JAMK 2L4MA 1LFBA 1UZCA 2DOFA 3DF8A 1G59A 4DBRA 4GXOA 2L7KA 1Z91A 1T08B 2COBA 3CUQB 3V7RA 3LFUA 1WRJA 4C3IJ 2XAHA 3VYUB 2D5VA 1TL8A 4RBOA 2BVLA 2NRAC 1P92A 5CVVA 4CCKA 3RKYA 4E6KG 1GLNA 4G6QA 5E79C 2OUMA 3BJAA 1UG2A 1GT0C 1X3ZB 4OMZA 2TRTA 3T5XA 2ELHA 2LSOA 3UR3C 2XKPA 2W48A 1Z0XA 3K4LA 1XDSA 3K10A 1LEBA 5JLXA 1P7IA 5DEQA 3G6EI 1QQIA 2Y9YA 1Z9CA 3AAFA 3TO6A 4HNVA 1D1AA 4AVZA 2IEKA 1HKSA 4QIWN 5LFAA 4KFCA 4LLGF 4WX9A 1OCOH 2AQEA 3SZTA 1ZG5A 3Q5FA 1OCCH 3ZRGA 3DKYA 9ANTA 2EILH 4IJAA 4PJLA 2JPCA 3EYIA 3BR6A 2WAFA 4L5EA 5IYBJ 5IY5H 3MKYB 4GRIA 4CYCA 1PUEE 2I10A 5CPRB 2XB0X 4M74A 1OFCX 3MZHA 1SMYF 2FQ4A 2QEXI 4EM2A 1D0YA 4XLFA 1AWCA 1TP4A 4HG2A 3VEPA 3E6CC 2KIQA 2O0YA 3M7GA 3CF5F 3GTKJ 1SVLA 2I8DA 3FXJA 2KPMA 3I0TA 3M4OJ 2RC4A 3TP0A 4KICA 4ASNA 4ZH4F 3CCYA 1JXSA 2F4IA 1MNDA 1W5CC 4JYKA 5J8CA 1VQ7I 3O2PE 1PJRA 6PAXA 5KVRA 2DI3A 4F7ZA 1IRXA 2IXSA 2ZJPF 2Y75A 2IP2A 3FMQA 2ACJA 2EINH 1KYZA 2HR3A 3K9TA 2HOEA 2L9SA 1ZYRF 5BOXA 4B3AA 3C2BA 1YQAA 2M3AA 1T38A 4BE0A 1P4XA 2AHQA 4BYYA 4D9JA 3G2BA 2DXIA 4IHWA 3KP4A 3H3ZA 5E8IA 2XF6A 4XOTA 2HXOA 1SD4A 3ABMH 3G3ZA 3WE2A 3KETA 1VQOI 4XKVA 3VB2A 5FLMJ 3K1PA 1OQYA 4FTHA 2PJRA 4F91B 4MO7A 4BAYA 3TO9A 1HQCA 2JVHA 3IHUA 3OYDA 3OR2C 3IWFA 4P9FA 3N97A 2VPRA 4GYIA 4LOCA 5FD6A 4KMUX 2XGCA 1YJWI 3CP2A 1U9OA 3KEQA 3HOTA 4YIIA 3B6CA 4RB2C 2ADUA 4HEA2 3Q0VA 5A2QK 4DYCA 3E6BA 2ZMEB 2Q2EA 4F52A 4PGHA 2EBIA 3O3KA 3OL4A 2P4WA 1JUMA 4IXAA 1P4AA 3I59A 3HOSA 4EGZA 5CVRA 1V5EA 3LAJA 4EQQA 1PYVA 1KA8A 1O57A 4GFBA 1YLFA 4BY1J 3S93A 1CF7A 1U8BA 5E18F 5CVUA 3TMOA 1RUOA 2PQ8A 3HUGB 2W25A 3AG3H 3ZN0A 2HEOA 5DYMA 3PO3J 1ACIA 4AWXB 2L9VA 3BC8A 2JA8J 2M87A 3OWTA 4NC8A 1RESA 1ITYA 2ZXIA 2Z2SB 4OIRF 1OISA 2F5DA 2ZC2A 3QAHA 3DPLC 3K4JA 3GTQJ 2IGMA 4G7OF 1BW5A 3GTJJ 5LHGA 1IJWC 4IHYA 4M71A 2ECBA 3RDIA 4M3DA 2JSPA 3R6SA 3CCRI 3S14J 4UV9A 1KGSA 4L9JA 3A03A 2K4JA 2E1MB 5D4RA 3GX4X 3HJEA 1JJ6C 4UHTA 4IZZA 1NG6A 1ULYA 5C44J 2O8XA 1TQPA 4WK8F 2H27A 1BOBA 1YIJI 2IRFG 3S2WA 3OYKA 3MN2A 3DLAA 1R5GA 1XSVA 2CO5A 2MLKA 2FJ1A 3BG9A 3LSHA 4Q4ZF 1EA3A 3H36A 4BY7J 2WTEA 3MVPA 5HODA 2M8EA 3S17J 3PFYA 1O7LA 2XAJA 2OQGA 1WJAA 3OIPA 2XSJC 4BU2A 3L2CA 3OYNA 2MGQA 4BDZA 2R93J 3SZPA 3HYIA 1SAUA 4LGWA 3E7LA 1IRFA 2XAUA 1R71A 2CWEA 1ZR2A 3K6GA 5B3SH 1GVDA 3IAS2 1BI1A 4G7ZF 4S04A 3BP8A 1MBHA 1TZLA 4ZDLA 2ZKZA 4QPOA 1FIPA 1RPWA 4HQEA 3GMEA 5M3FJ 4MEYF 2A61A 2HNHA 4CYCB 3GVAA 2K3PA 1R6RA 4IHXA 4HPQA 3CCVI 3RZOJ 4W97A 2A6TA 3H3UA 3ZXSA 2M7AA 2M34A 4BE1A 3FDYA 3LSGA 4PUSA 3HOWJ 3CMYA 3A02A 2A68F 3PQKA 2KDOA 4XMYA 3RJPA 1V5FA 2EIKH 1K78A 2VL8A 4HDVA 2R7RA 2O9LA 1FYLA 4OAZA 3L09A 3F6OA 2M0CA 3HHHA 2CV0A 1OJLA 3F9KA 1ETQA 1JUSA 2CFXA 1WJ5A 4RLFA 5E8GA 1IUYA 4MNUA 2LG4A 1MMNA 1H8AC 2V4JC 4HSTA 5DUIA 2R5YA 3BR0A 2MABA 4Q47A 3KZIC 2JPBA 3BT9A 5LRRA 2WC2A 4U7DA 4CCMA 5F0HA 3J7AO 2CW7A 1JKOC 2W84A 4ZYDA 3WHBA 3RPUA 1Y1WJ 3K69A 2DA1A 1BL0A 3HC7A 2OJED 2O5RA 1S72I 5L3DA 2PJRB 2BBYA 4XBFA 3H0DA 2EQRA 3GZ5A 5GAGJ 4CGZA 2WWYA 2DOAA 4AYBN 5ICGA 4NNJA 2IAIA 3IL2A 1RKWA 3WHCA 3P9IA 1MSEC 3K2AA 4AIKA 5FKOA 2HDCA 1YW8A 1ZH5A 2VPLA 4LMYA 3WTYC 2JTVA 1UB9A 4Y15A 3OS0A 3CJQB 5JFRA 5JI6A 3LAPA 3TP3A 2DJIA 2FRHA 2XC7A 1JHHA 1OKRA 3JRBA 2V1UA 2W4SA 3I59B 4A3EJ 4AVPA 3PO2J 3SJMA 4A2UA 2RNGA 5AIPA 1I39A 3S1NJ 1Y0UA 1FBSA 4YEJA 4QTRA 3DXJF 1VI0A 3M8EA 1STZA 3HOUJ 3GLXA 4L9VA 2L54A 5DD8A 3HGYA 1D5VA 2FA5A 2H94A 2HGCA 4A3IJ 2W57A 1HXDA 3G4SI 2A05A 4Q5SF 3LQRA 2EV5A 3IRQA 5LGUA 3CMEI 1WGXA 2NVQJ 2EIMH 3DTEA 4DYRA 4V2GA 3K2ZA 3C7JA 4M6VA 3EUHA 2MYSA 2KJCA 4XQFA 3RQIA 2DT7B 3CC7I 2P5VA 3MWMA 1CGPA 2LVSA 5CYVA 1K4SA 5ILSA 2Y0SA 2ISZA 5CVIA 4RS8A 4J19A 2LR8A 3H9QA 1BR4A 1H0MA 2YUSA 2KKOA 4KT5C 3EUKL 2QENA 2R7DA 2DMQA 4PJMA 4F93B 1HCRA 3KP6A 3AG4H 3ESWB 2MLGA 4C30A 1YIOA 3PQJA 5E3NA 3O8GA 4MGRA 5LEJA 4XLPF 2NVYJ 4A3JJ 2ETHA 4IEJA 1MW7A 2WAQN 1P4WA 1YITI 3HIFA 3BQZA 1YW7A 1F9NA 1DQUA 1I50J 5B1BH 2IS6A 4X6AJ 3KCCA 5CJ9A 1BW6A 3J80K 1FMWA 1RETA 5ICFA 4LIUA 4OWRB 1FC3A 2IA2A 2OC6A 3QU3A 1Z21A 3C2GA 3I4PA 4M72A 1FIAA 3X2QH 3G71I 4DNCA 5BMZA 4XOPA 2VLAA 2KIMA 2RNJA 2V26A 4HV6A 5AIQA 3GFMA 1GHCA 4X1EA 4F55A 4FE4A 3JRCA 1K83J 1NH3A 2XF5A 1U9NA 2JWTA 1LFPA 2PLYA 4MFDA 4XRFA 3L9FA 4HF0A 1LDKB 3T0YA 3LA2A 2D1VA 2HYJA 3BR5A 2JUCA 1HKTA 4HRIA 3L2RA 4KMFA 3JRAA 5LD2C 2JA5J 3V7CA 1JJ8C 1O3TA 2ZFWA 1P7JA 2JMWA 3G1MA 2E1OA 1J2XA 1P6RA 3FXMA 4IQ4A 4XR6A 5LHHA 2KHMA 1MMDA 2BE5F 3FIWA 3CC2I 2R5YB 1IC8A 2XPUA 2PFBA 3I53A 3PSFA 4EM0B 2E1CA 4XLHA 3T8TA 2JA2A 2X6WA 5D4SA 4QPQA 2E5ZA 3UNGC 4NQWA 1JHFA 1YRNA 1S9HA 2M45A 1VZ0A 4HA8A 4JX4A 3ZMVA 1GVJA 1JUPA 4BEHB 2XGDA 3IUOA 1Z77A 5HOOA 4CZZA 2VODA 2ZJ2A 4IRGA 4M9XA 1N77A 3CDIA 3H5NA 1VQLI 4JK1X 3OYHA 3IV5A 1JKPC 4O3MA 2DA3A 4AD9A 3JRDA 2F5EA 2DN0A 2GAUA 2QCOA 3R0JA 2X6YA 3TDZC 2R7SA 3CUOA 4U88A 1R49A 3BROA 4WWCA 4UNOA 2W85A 4KYWA 1BC8C 4EJVA 3J7AY 1XN7A 3HRSA 2OA4A 1A04A 4M73A 2H6CA 4YELA 3GO5A 5BQTA 2IGNA 2H6BA 3LOCA 3CCQI 5EF6A 2DFIA 2VJ5A 1MGTA 3LL7A 2CV2A 2R92J 3CD6I 3P9CA 1XC5A 4RM2A 1ZRDA 5C4JJ 3QPSA 2DFFA 3P5JA 1S29A 1JKQC 2EK5A 2GOXB 4LB5A 4CCNA 2H8RA 5DDGA 2Y69H 2LC2A 4E4HA 2VI6A 3ULQB 4P9UA 5F1RA 3JCUC 1GV2A 4IHSA 3FISA 1XGSA 4N4OB 3PNYA 3GYHX 4BHPA 1D0XA 3DP7A 3H5AA 2VT2A 4LIVA 2EFPA 2V9PA 1B8IA 1G3WA 2V7FA 1SD7A 2A07F 4DZPA 1MJ9A 2CYYA 3GTOJ 2OU2A 1ODDA 4XSZF 3QYFA 5D6FA 1A6IA 3ZPLA 5D5VB 3AL0C 3R60A 4HLXA 3F3XA 5L3CA 2HVQA 5FRMA 1SD6A 1VQ6I 2L2OA 4CCLA 2PMZA 4PJJA 1GDTA 1K4TA 4I99C 3RYRA 3V8KA 3ZGKA 1DUXC 1Z7LA 1IN5A 3BZ6A 4XN3A 2VE8A 2P7VB 4BL0B 1LE8A 5FLXZ 4LK0F 1SAXA 4U0WA 1QZZA 3F8CA 2OQRA 1QVUA 3TL4X 3ROUA 5TGTA 5J6XA 1IF1A 3HL2A 2LBFA 2WV1A 4XONA 1ORKA 3BCBA 2R7WA 3ERMA 1EH8A 2NS8A 2RQPA 4OAYA 3ZCOA 5J4YA 3QPTA 2E2JJ 4HSRA 2E1NA 3CO6C 1RC9A 4RM3A 3CJTB 1JT0A 2N8GA 3V8LA 4E70A 4PSXA 5FD5A 3IH4A 4PFPA 1IRGA 1I6HJ 2LY1A 1VQ5I 5IP6A 3WTTC 3F8FA 1MMAA 1X3UA 1Y56A 4XLCA 2HQRA 4I2OA 2PBIA 2CQ7A 3BG7A 2DBBA 2NS0A 2I5UA 4HOBA 5E1WA 2MBFA 2X9DA 3IAM2 2NNYA 2Y48A 1YYVA 2R3SA 2ZSHB 3HGGA 3DTIA 1SVOA 2EZLA 5M5XJ 2XUBA 4R8HA 1B72B 3TBIA 1AKHA 5IT3A 1OCRH 5LRSA 3CUQC 3SEQA 3J81Z 2HQ5A 2K40A 5JLWA 1GUUA 5CVJA 2QM3A 1MJAA 2P8TA 1AA7A 2QKMB 4FETA 2QBYA 2KRCA 4RAFA 2X6XA 2ESHA 2E2HJ 1LB2A 2O6GE 3JRGA 1FP2A 1SFKA 3ZMSA 3KZYA 2Q0OA 4LB6B 1YRNB 3TOAA 1VTNC 5L3BA 3GZ6A 3MKZA 4WXCA 5M5WJ 3S1QJ 4ENJA 3BWGA 1S7AA 2NXNB 5IOZA 2OAZA 3IH3A 3K0LA 1UHWA 3OYFA 2WY7Q 2R7XA 2CH0A 4YIFA 2EFOA 2FNPA 2WA0A 1XPXA 1EH7A 5M5YJ 5GTHC 4C3JJ 1BR1A 3COAC 3Q0UA 1ETXA 1TBXA 4U7BA 3B02A 2GA1A 1U0JA 1SVMA 3GCMA 4EVIA 1I6XA 1W5SA 3KP7A 4MTEA 2O61A 5HLGA 4XRSG 1LVKA 1J75A 2VUMJ 3LSJA 2CSOA 3CCUI 4KJZA 2OPTA 5FKKA 2X6OA 2EFQA 3S1RJ 1X1BA 1OCZH 1LEAA 4HX4A 2QSFX 4QWQA 1TWCJ 3E5QA 2L01A 2OBPA 5EG0A 2DDAA 2QF7A 3I5UA 3W3CA 4QLCU 1OYYA 3HSFA 2HOTA 3Q9VA 3FXLA 2XRLA 1EJ9A 4S05A 3LNQA 4ESBA 1JGGA 4PJNA 3BPXA 3U1KA 1B8IB 2O7OA 2OF7A 1HLVA 2HWVA 1FBUA 2F5VA 4AC0A 3TOBA 3MAJA 4ETSA 3F0CA 4FQGA 1O3SA 5H6QA 1I27A 5TJJA 3F23A 2RREA 3BTIA 4L18B 3TDUC 4HW0A 2GXGA 2VBZA 4D7NA 1XSDA 4J01A 4I0BA 5K5RA 1JE8A 2EZKA 1ZLKA 3CMMA 2VKHA 1ZELA 4Z2YA 1T8IA 1S3JA 1IDYA 2FMLA 3GZNB 1LE8B 1IXSB 4BACA 2OZUA 2F5FA 5M3MJ 3CCLI 4RAYA 1QO0D 2KIFA 3FK7A 2LBFB 3FXKA 2ZMEC 2Q1ZB 4YRVA 3A4CA 2D1HA 2JQ7A 2L3DA 1ETKA 2A69F 3LSIA 1ONVA 3JW4A 1XGMA 1T2KA 3KPHA 1PDNC 1SFXA 1FTZA 2VBWA 4C2MJ 3M07A 3RPQA 1QVTA 2FUG2 3G73A 1Y0NA 4YG2F 1R5ID 3RPUD 1APLC 3DU6A 5HLTA 3ZMZA 1MMSA 3HTUA 1IAWA 1W7PD 1MKMA 3M9AA 4DW6A 5HDGA 2GWRA 2CFOA 2ESNA 2NNNA 2ZXWH 4M3BA 5CLSA 5FROA 2VOOA 1Q1VA 3SZGA 4HNTA 4BKXA 3F8BA 5D6EA 3DTKA 2NAZA 3L00A 5EJCA 3RQ4A 3K1NA 4JX5A 5A2QZ 1XS9A 4G6TB 4IQJA 2VC0A 2LRDA 1AKHB 2YS9A 2E1MC 3JSPA 2A5YB 2ZCWA 3FMRA 1V54H 3HTSB 5JHUA 2HZTA 3TGNA 4HYEA 1UMQA 3H0GJ 1QBJA 1ZN2A 4XICA 1XCBA 1Y1VJ 5J1RA 3HSEA 1ZKGA 1A5JA 1T56A 2TDXA 2QBYB 1VQ9I 3PFIA 4P55A 1BOAA 1D8JA 4NC7A 1XMAA 4HAMA 4UVBA 4BBRJ 5J4VA 4ZTFA 4IO9F 4IHTA 4OIPF 1RIOH 4E7KA 1JKRC 3JRFA 3F72A 4C9YA 2ZXJA 2JJ7A 1MSFC 2IVMA 2QA4I 3ZQGA 4AIJA 2LP0A 2HYFA 3HSRA 4IRIA 2ID6A 4CICA 3R4KA 2F48A 2L4AA 1N78A 3F21A 3AG2H 3Q3SA 2QQ8A 2G7UA 4BQAA 3CDLA 3K4KA 3WTWC 1VQKI 1QZEA 2L7MP 3VPRA 3DV8A 3HDDA 1WHUA 2CG4A 3L2WA 3EQLF 3B73A 1ON1A 2QQAA 3HOYJ 3ECOA 3HHGA 2HPIA 3OOUA 1X1CA 3DQVC 1L3LA 1SC7A 3CCSI 4Y52J 1YX3A 1W36D 2GA2A 4KUMA 2K3FA 5LGTA 1DP7P 1L0OC 3S3OA 1X2NA 1FOWA 2XROA 1NK3P 5EG0B 1DU0A 3RKXA 3VDXA 3ZR8X 4BH9A 3OYEA 1ZGWA 1QNTA 2DA2A 5EEHA 1B6AA 4I76A 1IZ1A 3O6BB 5F1JA 4MFEA 2ICWG 4AIHA 2QVOA 4RGXA 5GAHJ 3OYCA 2HS5A 4A3BJ 1PP8F 1OPCA 1BC7C 5IPAA 3ZQ7A 2IA0A 3H92A 2XAQA 2BYVE 3KP2A 3K70C 1ZARA 3FXOA 2K5CA 4Y4RA 3MFKA 4Y17A 1ZREA 4II3A 3K1MA 3RCOA 2MG4A 1HW2A 2CQKA 1LFUP 2HPMA 4G94A 4RB3C 4FCYA 2ELKA 2Z99A 5D5WB 4UVAA 1QHGA 3IP4B 5FO5A 5GTIC 3VYSB 1KQ0A 4H4KC 3KLNA 3NEUA 3NWSA 1NTCA 5EEAA 1FP1D 3FXUA 3HG9A 2LMDA 1M1EB 3PJRA 1D5YA 4F3QA 1ZG1A 2HFHA 2HDDA 4O5VA 4NHJA 3LSTA 5D5XB 3HB9A 2K9MA 4Z6YA 1IN6A 3DFGA 1T0FA 4MIMA 5HS7A 1WI9A 1W0UA 1TW2A 4A12A 2HVSA 1YW9A 2XGXA 5J40A 4HBLA 5DM6F 1F1ZA 2XKOA 3FHNA 3M8FA 3IH2A 3S1MJ 1TWHJ 1TQMA 1DP3A 4BEHA 1J9IA 1E3PA 2X1CA 2FD5A 4GGGA 1W7PA 2QUFA 1QGPA 1G2HA 4KN7X 3E5XA 1YJ9I 4IX7A 3VOEA 1TC3C 5HNHA 1EV7A 2CW0F 3WTZA 4JOMA 3R61A 3GW2A 1TT5B 2K4BA 4E7SA 2JN6A 2X51A 2G0EA 3C2HA 3BOQA 3ELKA 5JR3A 1QZYA 3LWFA 4A69C 1ZHFA 2CUEA 2MA3A 5E17F 4Y13A 2GLOA 2DK8A 3NWTA 4HF2A 3QYEA 1FSHA 3D5SC 1GV5A 2L9NA 2VXZA 2ZBKA 2UUZA 3JSOA 1Y8RB 3ONQA 2CGPA 1DPUA 2KFDA 1H89C 3I58A 2IGOA 4M9SA 4UB8C 2V79A 2IA1A 2HVRA 2QQ9A 2VJ4A 2DMPA 1BJZA 3PNTA 5FGMA 4BJ5C 4GYGA 2FMYA 5F0FA 2AXLA 1RKTA 3GWZA 2VBXA 2ZXHA 1K6OA 3FWEA 4LG0B 2YR2A 3LSPA 2Z3YA 2XAFA 3CO7C 3SXYA 3PUBA 2ECCA 5FB2A 4EGYA 3ZOBA 3ERED 3C18A 3VODA 5IT9K 3ASNH 4MHGA 1WSUA 3QODA 2ZFUA 1RNLA 3DBRB 3GFJA 3S3MA 1RR8C 1FPQA 2DCEA 2G9WA 5HS8A 2NVTJ 1LDJA 2V9KA 5J8FA 2ISYA 1YTYA 2MC3A 1ON2A 4N4NB 2ELJA 1LQ1A 5HVQC 2L7FP 2M2EA 4A3FJ 5K7HA 4ZYAA 3EPZA 1VNDA 4EV0A 2R7OA 4P96A 1WFXA 3TEDA 2PI0A 1TLHB 4L9TA 3ZQFA 2RN7A 4G12A 4XL9A 3BQYA 1B59A 3BCAA 2QGUA 3LMMA 2Y31A 1FSEA 3BZKA 5DUKA 1DPRA 2IS1A 2NVUB 1ETYA 2W1OA 1ERDA 1X4PA 2ID3A 3BR1A 1USSA 4XM3A 4ZYHA 4DYQA 3S15J 3WU0A 3U9GA 1R4NB 3G1OA 2NVXJ 3K4BA 4BJ6C 1FNNA 1O3QA 1IGNA 3CTAA 1Q1HA 2FBIA 1LVAA 3A1YA 3Q9SA 5FLVA 2UXXA 1ETOA 1JI8A 3V7SA 2AXTC 3RSNA 3VSLA 1YJNI 1J59A 2K9SA 3JTGA 2VJJA 3RKWA 4MTDA 4B48A 1ZLJA 2XB5A 3J80Z 1WZ2A 3SYTA 1ZQ3P 3M1CA 1OCPA 4EJOA 1FJLA 3I71A 1T0FC 2E7XA 3L2QA 1OR7A 1MMGA 1U5TA 1EF4A 2BY0A 2EWNA 2F4OB 4RA2A 3W2AA 4Q48A 1FTTA 1FOXA 1C0WA 2KT0A 1R1UA 2ZJQF 1I1SA 3ASOH 3R0AA 3OYLA 2GBYA 1BIAA 3K4NA 3HRMA 5ILUA 2DODA 3LSRA 4CO8A 4DGWB 1R7JA 1YFHA 4XKCA 3QPLA 3J7ZI 2IS4A 1R00A 2TCTA 3M1EA 2F6CA 1WJCA 3H3VK 3HKZN 4MQVA 4B44A 1B72A 1IRZA 2X1DA 3JRIA 1UHSA 2R7TA 1V5GA 1J0RA 5KK1A 2RGVA 3LQQA 1S7OA 4LK1F 1F5TA 2R7ZJ 2A5WA 2GXBA 5B66C 2ZJRF 1HF0A 2KISA 4KIGA 3JRHA 3P7NA 2BY2A 1V4RA 1R22A 3CF2A 4M6YA 3OSFA 2X1EA 2K9LA 2B7EA 5DCMA 2CV1A 1REPC 4N9IA 1FOYA 4MLOA 4OINF 5KAIC 2K02A 2FXAA 2EZIA 4U0VA 3SHFA 2COMA 3BG3A 1XGOA 3E97A 4HZFA 1IV8A 2NS7A 2M1BA 1W7PB 1SFOJ 2RQQA 1MBGA 3DPUA 2NOGA 1QU3A 5C4XJ 1Z3YA 2EIJH 4IVNA 2XGEA 2EFWA 4FHTA 3I56I 5F27A 1YX5A 4EMSA 4ENMA 1I3QJ 3BJOA 3ZQHA 1LDDA 2LKPA 3K4CA 1G4DA 5GP9A 3L1PA 3SFIA 2AO9A 3EUHC 2LKSA 1R9TJ 1KYWA 3HPGA 3CCEI 2YPRA 1VF9A 3WU1B 2L7ZA 5K5QA 2B0LA 4RB0A 5DS9A 4B47A 4PCQA 3FBNB 4BXFA 5DD4A 2B9SA 2KLOA 3M3YJ 1HW5A 4ABZA 2B63J 1W36C 1QRYA 2KQRA 3H9JA 3PSIA 1IN8A 2LDUA 3QOPA 4NBQA 4B43A 1QHHD 1VQ4I 1ZGAA 4ZJZA 2V6EA 4FX0A 3HRTA 3PUFA 3NAUA 3ZMUA 1K61A 1F43A 3JTHA 3FX3A 2KZVA 5IYDJ 1TWFJ 3LA7A 3DU5A 2W24A 4A5MA 1MNMC 3HM5A 5KHDA 3GEZA 2GOMA 2RAEA 1FY7A 2ZO4A 5FJ8J 4J00A 5BPIA 3P9KA 1XB4A 4C2TA 1MH3A 3GTPJ 3CESA 4PDKA 1XSXA 5F64A 1U6GA 2RDPA 4H0EA 3CP8A 4RGRA 2MH2A 4M9ZA 1X1DA 2BGCA 2VQHA 5F6FA 4B3XA 3CMAI 3RYPA 2V1NA 1IXCA 2FQ3A 1SD5A 4KA4A 3VYRB 4V19K 3GFLA 4DQ2A 1AOYA 4BQOA 2DYRH 2EB7A 4P1WA 3I3LA 4EEFG 2LD5A 1BI2A 1XTAA 1JTXA 2LLKA 1UFMA 4RB1A 1AU7A 1LKXA 4KISA 1KU7A 1IN4A 1QPMA 1WI3A 3DEEA 3I54A 1WJFA 1ZRFA 4ZDOA 1E0EA 5D5UB 4Y33A 3ZP5A 2XAGA 4X0GA 4PK4A 3LA3A 2A3SA 1WVRA 3T8RA 2W7NA 4ZTJA 3ABTA 2EJRA 2KRFA 4DBQA 4CXFA 5L3EA 2IT0A 1MIJA 1U2WA 1VQPI 2X4HA 1U5TB 4HV5A 1ETVA 2FNAA 4XRMA 1K79A 5DV5A 5HS9A 4ANJA 2H8WA 2KIUA 2Z16A 1N75A 3HXLA 4ZYEA 1BA5A 2KRHA 5H20A 2XSDC 1R1VA 1E17A 2M9HA 3WTUC 3TO7A 3AFHA 2VASA 4DIQA 2VOPA 2VKVA 5ICEA 4RLQA 2XPWA 1IV6A 1U3EM 4IKFA 4AU7A 2K86A 3ZQIA 1H9GA 4IOAF 3GTLJ 2FBHA 4HNUA 2XIGA 2DA4A 4A6DA 4YIRX 3LFKA 1TT0A 4PSWA 4YFNF 4AYBA 1KU2A 3M8JA 2CMPA 1ZGJA 3E1SA 4G6DA 3OYAA 3DPTA 3KP5A 2F2EA 3GUDA 1OLTA 5DCMB 4ZDPA 2E34A 2FU4A 4RMNA 2CJJA 2XF7A 1IO2A 2HQNA 5BNGA 2V9VA 4OOIA 5E1ZB 4EJTA 1FYMA 2DO7A 3IKVA 2IJLA 2L9RA 2W00A 2DT5A 3I64A 3OYMA 1XMKA 4ITVA 4D0PA 2WADA 5ICCA 1BN5A 4G9YA 1BI3A 1NG7A 1BI0A 3SQNA 4WXHA 3JAMZ 1MBKA 2JUGA 3S2HJ 2YU3A 2DPDA 2X48A 2ZSIB 2M5WA 2GZWA 2P6SA 2DOEA 4ZC3A 2E2IJ 2P7CB 2DMNA 3WTXC 3IRRA 1WH5A 3D5RC 3FF5A 2WB1N 4UUTA 4CUGA 2HDWA 1S8NA 3A0BC 2HTJA 3I9V2 4PFOA 3H1CA 4MEXF 5EYRA 1FBQA 2GM4A 3KX2A 4W1UA 1ZK8A 2M30A 3C1DA 2HI3A 3FKJA 1JGSA 3HOXJ 2FOWA 1ETWA 4JBAA 4V2FA 4I6ZA 2C6YA 2L02A 3PM1A 4AM3A 5LEKA 5JVTA 2DQLA 2XASA 1DGWY 1SFUA 2WAEA 2LY2A 4B8XA 3V4GA 4L0ZB 2KL4A 1Z6RA 1UCRA 1RI7A 5EGOA 3A01B 2E60A 2RVCA 3SDGA 4HDUA 5ED4A 2CUFA 1DDNA 4UY8I 3U2RA 1DGRM 2LREA 2BY1A 1X3WB 2WAQA 2Y0SN 5EZGA 2P6TA 4B09A 1RRJA 1X58A 1IW7F 3OIQA 4O6JA 1IDZA 4RGUA 5BPDA 3CCMI 4D5CA 1U78A 1A31A 2V1DA 1SANA 4CSWA 4IOCF 1USTA 3ECHA 2ZB9A 3CLQA 4BHBA 2LOOA 5GAEJ 2VN2A 4JP0A 4PZJA 3SFZA 2KP6A 4RDUA 2M8GX 1TW3A 4EATA 3TKYA 3PL8A 3FXRA 2K27A 2XRNA 4XRSA 2LFBA 2R4GA 3WTVC 4XIDA 1MH4A 3I4MJ 1PUFB 3W6JB 1VFCA 3C3WA 3QP6A 4ZZLA 4OIOF 4GCVA 1GXPA 2DMUA 4EJWA 2O3FA 2Z1DA 4D7MA 3RTRA 2JRTA 4KT6A 3CC4I 4KNYA 2PMHA 3MKWB 1FMVA 3HKZA 4NC6A 4I01A 2P5KA 3OYIA 4IL6C 2JSCA 2MW8A 3QWLA 1HOMA 1YS7A 3E6DA 1VQMI 5KAFC 2GQQA 1UELB 5K5OA 5J3LA 4BDYA 1MD0A 2E36A 4L9NA 3BR2A 4KDPA 3I4NJ 3OMYA 1MBJA 2DFEA 1D1BA 3NARA 4WCGA 1J7KA 2A6HF 5HLHA 2E35A 2JZYA 2LKXA 3WGIA 4XLNF 1OYWA 4EM1A 5JHFA 1U8RA 3W6KB 2OD5A 2QYOA 5GADJ 1FZPB 2BZTA 4N0BA 2CQNA 4ENNA 4FASD 3CLOA 5E1XA 3OL3A 3PIPF 3WE3A 3BTCA 5HNFA 2EH3A 3KE2A 1KQ8A 1LJ9A 3DKXA 5HDKA 1Y8QB 1W4MA 3FZVA 3FK6A 4WF2A 3BG5A 3NRVA 1YS6A 4LG0A 1A6QA 2MD5A 1O4XA 3CDHA 2HTSA 3RZDJ 5HLIA 1TWAJ 3J7YJ 3O8HA 4CH7A 2M4GA 3EUAA 5DCFA 4NDLA 1FOKA 3MZYA 4I7HA 2UZKA 3CCJI 5LHIA 1Y39A 5IYCJ
chains in the Genus database with same CATH topology
1S6LA 1LNWA 2VONA 3ISPA 1ZAOA 5D8LB 1Z7UA 1R36A 4A0YA 1FYKA 3FM3A 3FXQA 1BM9A 4HQMA 2FOKA 2PEXA 3E5UA 1B9MA 5LBQA 3N4MA 1R23A 2ZNZA 1TNSA 2VT3A 2D45A 3BJ6A 4IF4A 4RAZA 3D0SA 1FX7A 2PG4A 4KIBA 1MJBA 1EH6A 1XDUA 3OOPA 2QZ8A 1KU3A 3FM5A 3KP3A 2H09A 3BY6A 3KEOA 4CHUA 2PN6A 4ZYGA 2FF4A 1E2XA 1G3SA 3MEXA 2XVCA 2IW5A 4UVCA 2EA2A 5ERIA 4I09A 2YSRA 4UXNA 4G8XA 4JQFA 1MDMA 1BIBA 2MH9A 1T6SA 4P5OA 1V3FA 3BDDA 4ESJA 2Z5UA 1O7FA 2DTRA 2NYXA 1IXRC 1R5HA 4KIFA 4I02A 3ZMTA 2G7HA 4G7HF 4R79A 2A6EF 4CDGA 1ZRCA 2DAOA 1TQIA 3ABUA 3E3VA 2VC1A 2STTA 1W5TA 3D5LA 3ZN1A 2X0LA 1Z05A 5L3FA 1J5YA 4M6XA 1IN7A 2LNBA 4FT8A 2UWMA 3IC7A 2HKXA 4ESFA 1K7AA 3WTSC 5IT9Z 1HSTA 1I5ZA 1G3YA 1R58A 1T39A 1CF7B 1YO5C 3OV8A 1FWZA 4BNCA 5FFZA 5AONA 2DU9A 4YFKF 3DEUA 1T98A 3EETA 1FLIA 4A0ZA 1HBXG 1B1BA 2J5OA 2JT1A 4L5JA 3ZMDA 1G3TA 1D8KA 4A0XA 4EJUA 4UUVA 1KU9A 4XSXF 1ZG3A 3EDPA 2K7LA 4A6EA 2VE9A 1F4KA 5HDNA 4I98B 3FHZA 3WG9A 3GXOA 4IRHA 3GF2A 2KJBA 1MZBA 3F8MA 1HSJA 1R1TA 4CYDA 5H6RA 3F8NA 2P5LC 2Q8KA 1I1GA 4LFUA 1HW1A 1NHAA 1SFEA 2OZ6A 4LLNA 1MDMB 4NB5A 2YX7A 1PP7U 3EYYA 3NQOA 3FMSA 3QPHA 4PGGA 2BEOA 2DK5A 1D3YA 1OMIA 3KFWX 2BV6A 4FX4A 4HX8A 5EEGA 3HRUA 2QQBA 2HKOA 1B4AA 1WWXA 1K78B 2XV4S 2EV6A 2GIVA 1XD7A 3CJNA 3VFZA 3E6MA 1WKMA 1OYIA 4HF1A 2LF8A 2V1XA 4YFXF 1B9NA 1O3RA 3ML6A 4BHCA 3T1BA 5L3GA 2LF7A 2FSWA 5BS6A 3F6VA 3REOA 3GFIA 4IPAA 5TRDA 2QLZA 4TV7A 1H9TA 2EFNA 5LGNA 3WODF 4OIQF 3CUQA 1KQ9A 2IPQX 1P2FA 3DKWA 3MCZA 1HKQA 2E7WA 2QWWA 2YX4A 4KN4X 2UXNA 2FBKA 4LJZF 2RKHA 4OMYA 2ZNYA 3WGGA 4BXUA 4LD5A 2PJPA 4UV8A 2XHKA 2Y0MA 4U0YA 1U5TC 2PMUA 2STWA 1YG2A 4ON0A 4R1HA 1BJAA 3MQ0A 1UHMA 4LLLA 4A5NA 3U1DA 1G6NA 3RI4A 1XGNA 1Z1DA 4WXDA 2FEZA 4RGSA 3RIRA 1FT9A 4MQ9F 5LLQA 4HX7A 4I0AA 4GO1A 5K1YA 2D2WA 5D8KB 4HLYA 3V8JA 5FLXK 3F22A 3WGHA 1SMTA 4K2EA 2Z33A 2DQRA 1BBYA 2FE3A 3IKTA 5E20A 3QP5A 2O03A 1RZ4A 4L5IA 1TTYA 1RUNA 4ENKA 4ZZDA 5ILVA 1WQ2A 2R7FA 2VBYA 3TQNA 3KLOA 2HYGD 2V6CA 3BPVA 2F5CA 1Z6TA 2EV0A 5FFXA 4N9HA 2EA4A 4OU0A 1XCVA 2WV0A 1TNTA 2ZMEA 2DLLA 3J81K 3L7WA 2RV8A 3QRFF 1GXQA 2J5PA 2DPUA 3HUGA 2Z9OA 3QU6A 2DW4A 3IWZA 4L0YB 2AS5F 3KZZA 3JAMK 2L4MA 3DF8A 4GXOA 1Z91A 3CUQB 3V7RA 1WRJA 2XAHA 2NRAC 1P92A 5CVVA 3RKYA 4G6QA 3BJAA 4OMZA 3T5XA 2ELHA 2LSOA 2XKPA 1XDSA 1LEBA 5DEQA 1Z9CA 1QQIA 3AAFA 3TO6A 1HKSA 4KFCA 4LLGF 4WX9A 3SZTA 1ZG5A 3Q5FA 4IJAA 2JPCA 3EYIA 1PUEE 4M74A 3MZHA 1SMYF 4EM2A 1AWCA 3VEPA 3E6CC 2O0YA 3M7GA 3I0TA 2RC4A 4ASNA 4KICA 4ZH4F 1JXSA 5J8CA 3O2PE 6PAXA 5KVRA 2DI3A 4F7ZA 2Y75A 2IP2A 3FMQA 2ACJA 2HR3A 1KYZA 3K9TA 2HOEA 1ZYRF 5BOXA 1YQAA 1T38A 1P4XA 4BYYA 3KP4A 3H3ZA 5E8IA 3WE2A 1SD4A 3G3ZA 3KETA 3VB2A 3K1PA 4BAYA 3TO9A 1HQCA 3IHUA 3IWFA 4P9FA 3N97A 4GYIA 5FD6A 4KMUX 3KEQA 3HOTA 4YIIA 4RB2C 2ADUA 5A2QK 3E6BA 2ZMEB 2Q2EA 4PGHA 3O3KA 2P4WA 4IXAA 1P4AA 3I59A 3HOSA 4EGZA 5CVRA 3LAJA 4EQQA 1KA8A 1O57A 1YLFA 1CF7A 5E18F 5CVUA 1RUOA 2PQ8A 2W25A 3ZN0A 2HEOA 5DYMA 4AWXB 2M87A 4OIRF 2F5DA 3QAHA 3DPLC 4G7OF 5LHGA 4M71A 3RDIA 3R6SA 4UV9A 1KGSA 4L9JA 2K4JA 5D4RA 3GX4X 4UHTA 1ULYA 2O8XA 1TQPA 4WK8F 2H27A 2IRFG 3S2WA 1R5GA 1XSVA 2CO5A 2MLKA 4Q4ZF 2WTEA 2M8EA 1O7LA 2XAJA 2OQGA 3L2CA 3SZPA 3HYIA 4LGWA 1IRFA 2CWEA 1BI1A 4G7ZF 4S04A 3BP8A 2ZKZA 4HQEA 4MEYF 2A61A 3GVAA 3H3UA 2A68F 3PQKA 3RJPA 1K78A 4HDVA 1FYLA 3L09A 3F6OA 3HHHA 2CFXA 5E8GA 1IUYA 4MNUA 5DUIA 4Q47A 2JPBA 5LRRA 2WC2A 4U7DA 3J7AO 2W84A 4ZYDA 3RPUA 3K69A 5L3DA 2BBYA 4XBFA 3GZ5A 4CGZA 2WWYA 5ICGA 3IL2A 3P9IA 4AIKA 2HDCA 1YW8A 1ZH5A 4LMYA 3WTYC 2JTVA 1UB9A 4Y15A 5JFRA 5JI6A 3LAPA 2FRHA 1JHHA 1OKRA 2V1UA 3I59B 4AVPA 4A2UA 5AIPA 1Y0UA 1FBSA 3DXJF 3M8EA 1STZA 3GLXA 4L9VA 2L54A 5DD8A 1D5VA 2FA5A 2H94A 2HGCA 2W57A 1HXDA 4Q5SF 3LQRA 2EV5A 3IRQA 5LGUA 3K2ZA 3C7JA 3EUHA 2KJCA 2P5VA 3MWMA 1CGPA 5CYVA 5ILSA 2ISZA 5CVIA 4RS8A 1H0MA 2KKOA 4KT5C 2QENA 2R7DA 3KP6A 2MLGA 1YIOA 3PQJA 4MGRA 5LEJA 4XLPF 2ETHA 1P4WA 3HIFA 1YW7A 1F9NA 3KCCA 5CJ9A 3J80K 5ICFA 1FC3A 2IA2A 3QU3A 3I4PA 4M72A 4DNCA 5BMZA 2KIMA 2RNJA 4HV6A 5AIQA 3GFMA 1GHCA 2PLYA 4XRFA 3L9FA 4HF0A 1LDKB 3T0YA 3LA2A 2D1VA 1HKTA 4KMFA 3V7CA 1O3TA 2ZFWA 1J2XA 1P6RA 5LHHA 2BE5F 2PFBA 3I53A 4EM0B 2E1CA 3T8TA 5D4SA 4NQWA 1JHFA 2M45A 4HA8A 3ZMVA 1GVJA 5HOOA 4CZZA 2VODA 2ZJ2A 4IRGA 4M9XA 4JK1X 4O3MA 4AD9A 2F5EA 2GAUA 3R0JA 3TDZC 3CUOA 4U88A 3BROA 4WWCA 4UNOA 2W85A 4KYWA 1BC8C 4EJVA 1XN7A 3HRSA 2OA4A 1A04A 4M73A 2H6CA 3GO5A 5BQTA 2H6BA 2DFIA 1MGTA 3P9CA 1ZRDA 1S29A 2EK5A 4LB5A 5DDGA 3ULQB 4P9UA 5F1RA 4IHSA 1XGSA 3GYHX 4BHPA 3DP7A 2VT2A 2EFPA 1G3WA 1SD7A 2A07F 1MJ9A 2CYYA 2OU2A 1ODDA 4XSZF 5D6FA 3ZPLA 5D5VB 3R60A 4HLXA 3F3XA 5L3CA 1SD6A 3RYRA 3V8KA 1DUXC 1IN5A 3BZ6A 2VE8A 2P7VB 5FLXZ 4LK0F 1SAXA 4U0WA 1QZZA 3F8CA 2OQRA 3ROUA 5J6XA 1IF1A 1EH8A 2RQPA 3QPTA 2E1NA 3CO6C 3V8LA 4E70A 5FD5A 1IRGA 3WTTC 3F8FA 1X3UA 2HQRA 4I2OA 2PBIA 2DBBA 2NS0A 4HOBA 5E1WA 2MBFA 2NNYA 2Y48A 1YYVA 2R3SA 2XUBA 4R8HA 5IT3A 5LRSA 3CUQC 3J81Z 5CVJA 2QM3A 1MJAA 2P8TA 2QBYA 2ESHA 1LB2A 2O6GE 1FP2A 3ZMSA 3KZYA 2Q0OA 4LB6B 3TOAA 1VTNC 5L3BA 3GZ6A 4WXCA 4ENJA 3BWGA 1S7AA 2OAZA 3K0LA 1UHWA 4YIFA 2EFOA 2FNPA 1EH7A 3COAC 1TBXA 4U7BA 3B02A 2GA1A 4EVIA 1I6XA 1W5SA 3KP7A 4MTEA 2O61A 5HLGA 1J75A 2CSOA 2EFQA 1LEAA 4HX4A 4QWQA 3E5QA 2L01A 2OBPA 3I5UA 4QLCU 1OYYA 3HSFA 3Q9VA 4S05A 4ESBA 3BPXA 2HWVA 1FBUA 3TOBA 3MAJA 4ETSA 1O3SA 5H6QA 1I27A 5TJJA 3F23A 4L18B 3TDUC 4HW0A 2GXGA 2VBZA 1XSDA 4I0BA 5K5RA 1JE8A 1ZLKA 4Z2YA 1S3JA 2FMLA 1IXSB 2OZUA 2F5FA 4RAYA 1QO0D 2KIFA 2D1HA 2L3DA 2A69F 1ONVA 3JW4A 1XGMA 1T2KA 1PDNC 1SFXA 2VBWA 3RPQA 3G73A 4YG2F 3ZMZA 3HTUA 1IAWA 1W7PD 1MKMA 3M9AA 5HDGA 2GWRA 2ESNA 2NNNA 5CLSA 2VOOA 3F8BA 5D6EA 2NAZA 3L00A 3K1NA 5A2QZ 2VC0A 3JSPA 2A5YB 2ZCWA 3FMRA 3HTSB 5JHUA 2HZTA 3TGNA 4HYEA 1QBJA 1ZN2A 1XCBA 3HSEA 2TDXA 2QBYB 3PFIA 4P55A 1BOAA 1D8JA 1XMAA 4HAMA 4UVBA 4IHTA 4OIPF 1RIOH 3F72A 2ZXJA 2IVMA 4AIJA 2HYFA 3HSRA 4IRIA 4CICA 3R4KA 2L4AA 3F21A 2G7UA 4BQAA 3WTWC 3DV8A 2CG4A 3EQLF 3B73A 1ON1A 2QQAA 3ECOA 3HHGA 3DQVC 1L3LA 2GA2A 4KUMA 5LGTA 1DP7P 1L0OC 2XROA 3RKXA 4BH9A 1QNTA 5EEHA 1B6AA 1IZ1A 3O6BB 4AIHA 2QVOA 4RGXA 2HS5A 1PP8F 1OPCA 1BC7C 3ZQ7A 2IA0A 3H92A 2XAQA 2BYVE 3KP2A 1ZARA 3MFKA 4Y17A 1ZREA 3K1MA 1HW2A 2CQKA 4G94A 4RB3C 2Z99A 5D5WB 4UVAA 5FO5A 1KQ0A 3KLNA 3NEUA 1FP1D 3FXUA 1ZG1A 2HFHA 4O5VA 4NHJA 3LSTA 5D5XB 1IN6A 3DFGA 1T0FA 5HS7A 1WI9A 1TW2A 4A12A 1YW9A 2XGXA 4HBLA 1F1ZA 2XKOA 3M8FA 1TQMA 1J9IA 4GGGA 1W7PA 2QUFA 1QGPA 4KN7X 3E5XA 3VOEA 1EV7A 2CW0F 3WTZA 3R61A 3GW2A 2K4BA 3ELKA 3BOQA 5JR3A 1QZYA 3LWFA 1ZHFA 2MA3A 5E17F 4Y13A 2DK8A 4HF2A 1FSHA 2VXZA 2ZBKA 3JSOA 2CGPA 1DPUA 3I58A 4M9SA 2V79A 2IA1A 2QQ9A 5FGMA 4GYGA 2FMYA 2AXLA 3GWZA 2VBXA 1K6OA 3FWEA 4LG0B 2YR2A 2Z3YA 2XAFA 3CO7C 3SXYA 5FB2A 4EGYA 3ERED 3C18A 3VODA 5IT9K 1WSUA 4MHGA 1RNLA 3GFJA 1FPQA 2G9WA 5HS8A 1LDJA 5J8FA 2ISYA 1YTYA 2MC3A 1ON2A 1LQ1A 5HVQC 4EV0A 4P96A 2PI0A 1TLHB 4L9TA 2RN7A 1B59A 1FSEA 5DUKA 1DPRA 1USSA 4ZYHA 3WU0A 3U9GA 1FNNA 1O3QA 3CTAA 1Q1HA 2FBIA 1LVAA 3Q9SA 2UXXA 3V7SA 1J59A 3JTGA 3RKWA 4MTDA 1ZLJA 3J80Z 4EJOA 3I71A 2E7XA 1OR7A 1U5TA 2EWNA 4Q48A 1C0WA 1R1UA 1I1SA 3R0AA 1BIAA 3HRMA 5ILUA 4CO8A 1R7JA 1YFHA 1R00A 3M1EA 4MQVA 1J0RA 5KK1A 2RGVA 3LQQA 1S7OA 4LK1F 1F5TA 2GXBA 4KIGA 3P7NA 1V4RA 1R22A 4M6YA 5DCMA 1REPC 4N9IA 4OINF 2K02A 2FXAA 4U0VA 3SHFA 2COMA 1XGOA 3E97A 4HZFA 2M1BA 1W7PB 4IVNA 2EFWA 4FHTA 4EMSA 4ENMA 3BJOA 1LDDA 2LKPA 1G4DA 1KYWA 2YPRA 3WU1B 5K5QA 2B0LA 4RB0A 4PCQA 5DD4A 1HW5A 1IN8A 2LDUA 3QOPA 1ZGAA 4FX0A 3HRTA 3ZMUA 3JTHA 3FX3A 3LA7A 2W24A 4A5MA 3GEZA 1FY7A 2ZO4A 5BPIA 3P9KA 1XB4A 4PDKA 1XSXA 5F64A 1U6GA 2RDPA 4H0EA 4RGRA 2MH2A 4M9ZA 2BGCA 5F6FA 3RYPA 1IXCA 2FQ3A 1SD5A 4KA4A 3GFLA 4DQ2A 1AOYA 2EB7A 1BI2A 1UFMA 4RB1A 1KU7A 1IN4A 1QPMA 3I54A 1ZRFA 5D5UB 3ZP5A 2XAGA 3LA3A 2A3SA 3T8RA 3ABTA 2EJRA 2KRFA 4CXFA 5L3EA 2IT0A 1U2WA 2X4HA 1U5TB 4HV5A 2FNAA 1K79A 5DV5A 5HS9A 2KIUA 4ZYEA 5H20A 1R1VA 1E17A 3WTUC 3TO7A 2VOPA 5ICEA 1U3EM 2K86A 1H9GA 2FBHA 2XIGA 4A6DA 3LFKA 4YFNF 1KU2A 4G6DA 1ZGJA 3DPTA 3KP5A 2F2EA 3GUDA 5DCMB 2FU4A 2HQNA 2V9VA 4OOIA 5E1ZB 4EJTA 1FYMA 2DO7A 3IKVA 2IJLA 2DT5A 3I64A 1XMKA 4D0PA 5ICCA 1BN5A 4G9YA 1BI3A 1BI0A 3SQNA 4WXHA 3JAMZ 2YU3A 2DPDA 2M5WA 2GZWA 2P6SA 2P7CB 3WTXC 3IRRA 3FF5A 1S8NA 4MEXF 2HTJA 1FBQA 2M30A 3C1DA 1JGSA 4JBAA 2C6YA 2L02A 5LEKA 5JVTA 2DQLA 2XASA 1SFUA 4B8XA 3V4GA 4L0ZB 1Z6RA 1UCRA 1RI7A 2RVCA 4HDUA 5ED4A 1DDNA 3U2RA 2P6TA 4B09A 1IW7F 4O6JA 4RGUA 5BPDA 1U78A 2V1DA 1USTA 3ECHA 4BHBA 2VN2A 4PZJA 3SFZA 1TW3A 3TKYA 3FXRA 2K27A 2XRNA 3WTVC 3W6JB 3C3WA 3QP6A 4ZZLA 4OIOF 4GCVA 1GXPA 4EJWA 2O3FA 3RTRA 2JRTA 4KNYA 2PMHA 4I01A 2P5KA 2JSCA 1YS7A 3E6DA 2GQQA 5K5OA 1MD0A 4L9NA 4KDPA 4WCGA 1J7KA 2A6HF 5HLHA 2JZYA 3WGIA 4XLNF 1OYWA 4EM1A 1U8RA 3W6KB 2OD5A 2QYOA 1FZPB 4N0BA 4ENNA 3CLOA 5E1XA 3WE3A 3KE2A 1KQ8A 1LJ9A 5HDKA 1W4MA 3FZVA 4WF2A 3NRVA 1YS6A 4LG0A 2MD5A 3CDHA 2HTSA 5HLIA 5DCFA 1FOKA 3MZYA 4I7HA 2UZKA 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6L A;  1LNW A;  2VON A;  3ISP A;  1ZAO A;  5D8L B;  1Z7U A;  1R36 A;  4A0Y A;  1FYK A;  3FM3 A;  3FXQ A;  1BM9 A;  4HQM A;  2FOK A;  2PEX A;  3E5U A;  1B9M A;  5LBQ A;  3N4M A;  1R23 A;  2ZNZ A;  1TNS A;  2VT3 A;  2D45 A;  3BJ6 A;  4IF4 A;  4RAZ A;  3D0S A;  1FX7 A;  2PG4 A;  4KIB A;  1MJB A;  1EH6 A;  1XDU A;  3OOP A;  2QZ8 A;  1KU3 A;  3FM5 A;  3KP3 A;  2H09 A;  3BY6 A;  3KEO A;  4CHU A;  2PN6 A;  4ZYG A;  2FF4 A;  1E2X A;  1G3S A;  3MEX A;  2XVC A;  2IW5 A;  4UVC A;  2EA2 A;  5ERI A;  4I09 A;  2YSR A;  4UXN A;  4G8X A;  4JQF A;  1MDM A;  1BIB A;  2MH9 A;  1T6S A;  4P5O A;  1V3F A;  3BDD A;  4ESJ A;  2Z5U A;  1O7F A;  2DTR A;  2NYX A;  1IXR C;  1R5H A;  4KIF A;  4I02 A;  3ZMT A;  2G7H A;  4G7H F;  4R79 A;  2A6E F;  4CDG A;  1ZRC A;  2DAO A;  1TQI A;  3ABU A;  3E3V A;  2VC1 A;  2STT A;  1W5T A;  3D5L A;  3ZN1 A;  2X0L A;  1Z05 A;  5L3F A;  1J5Y A;  4M6X A;  1IN7 A;  2LNB A;  4FT8 A;  2UWM A;  3IC7 A;  2HKX A;  4ESF A;  1K7A A;  3WTS C;  5IT9 Z;  1HST A;  1I5Z A;  1G3Y A;  1R58 A;  1T39 A;  1CF7 B;  1YO5 C;  3OV8 A;  1FWZ A;  4BNC A;  5FFZ A;  5AON A;  2DU9 A;  4YFK F;  3DEU A;  1T98 A;  3EET A;  1FLI A;  4A0Z A;  1HBX G;  1B1B A;  2J5O A;  2JT1 A;  4L5J A;  3ZMD A;  1G3T A;  1D8K A;  4A0X A;  4EJU A;  4UUV A;  1KU9 A;  4XSX F;  1ZG3 A;  3EDP A;  2K7L A;  4A6E A;  2VE9 A;  1F4K A;  5HDN A;  4I98 B;  3FHZ A;  3WG9 A;  3GXO A;  4IRH A;  3GF2 A;  2KJB A;  1MZB A;  3F8M A;  1HSJ A;  1R1T A;  4CYD A;  5H6R A;  3F8N A;  2P5L C;  2Q8K A;  1I1G A;  4LFU A;  1HW1 A;  1NHA A;  1SFE A;  2OZ6 A;  4LLN A;  1MDM B;  4NB5 A;  2YX7 A;  1PP7 U;  3EYY A;  3NQO A;  3FMS A;  3QPH A;  4PGG A;  2BEO A;  2DK5 A;  1D3Y A;  1OMI A;  3KFW X;  2BV6 A;  4FX4 A;  4HX8 A;  5EEG A;  3HRU A;  2QQB A;  2HKO A;  1B4A A;  1WWX A;  1K78 B;  2XV4 S;  2EV6 A;  2GIV A;  1XD7 A;  3CJN A;  3VFZ A;  3E6M A;  1WKM A;  1OYI A;  4HF1 A;  2LF8 A;  2V1X A;  4YFX F;  1B9N A;  1O3R A;  3ML6 A;  4BHC A;  3T1B A;  5L3G A;  2LF7 A;  2FSW A;  5BS6 A;  3F6V A;  3REO A;  3GFI A;  4IPA A;  5TRD A;  2QLZ A;  4TV7 A;  1H9T A;  2EFN A;  5LGN A;  3WOD F;  4OIQ F;  3CUQ A;  1KQ9 A;  2IPQ X;  1P2F A;  3DKW A;  3MCZ A;  1HKQ A;  2E7W A;  2QWW A;  2YX4 A;  4KN4 X;  2UXN A;  2FBK A;  4LJZ F;  2RKH A;  4OMY A;  2ZNY A;  3WGG A;  4BXU A;  4LD5 A;  2PJP A;  4UV8 A;  2XHK A;  2Y0M A;  4U0Y A;  1U5T C;  2PMU A;  2STW A;  1YG2 A;  4ON0 A;  4R1H A;  1BJA A;  3MQ0 A;  1UHM A;  4LLL A;  4A5N A;  3U1D A;  1G6N A;  3RI4 A;  1XGN A;  1Z1D A;  4WXD A;  2FEZ A;  4RGS A;  3RIR A;  1FT9 A;  4MQ9 F;  5LLQ A;  4HX7 A;  4I0A A;  4GO1 A;  5K1Y A;  2D2W A;  5D8K B;  4HLY A;  3V8J A;  5FLX K;  3F22 A;  3WGH A;  1SMT A;  4K2E A;  2Z33 A;  2DQR A;  1BBY A;  2FE3 A;  3IKT A;  5E20 A;  3QP5 A;  2O03 A;  1RZ4 A;  4L5I A;  1TTY A;  1RUN A;  4ENK A;  4ZZD A;  5ILV A;  1WQ2 A;  2R7F A;  2VBY A;  3TQN A;  3KLO A;  2HYG D;  2V6C A;  3BPV A;  2F5C A;  1Z6T A;  2EV0 A;  5FFX A;  4N9H A;  2EA4 A;  4OU0 A;  1XCV A;  2WV0 A;  1TNT A;  2ZME A;  2DLL A;  3J81 K;  3L7W A;  2RV8 A;  3QRF F;  1GXQ A;  2J5P A;  2DPU A;  3HUG A;  2Z9O A;  3QU6 A;  2DW4 A;  3IWZ A;  4L0Y B;  2AS5 F;  3KZZ A;  3JAM K;  2L4M A;  3DF8 A;  4GXO A;  1Z91 A;  3CUQ B;  3V7R A;  1WRJ A;  2XAH A;  2NRA C;  1P92 A;  5CVV A;  3RKY A;  4G6Q A;  3BJA A;  4OMZ A;  3T5X A;  2ELH A;  2LSO A;  2XKP A;  1XDS A;  1LEB A;  5DEQ A;  1Z9C A;  1QQI A;  3AAF A;  3TO6 A;  1HKS A;  4KFC A;  4LLG F;  4WX9 A;  3SZT A;  1ZG5 A;  3Q5F A;  4IJA A;  2JPC A;  3EYI A;  1PUE E;  4M74 A;  3MZH A;  1SMY F;  4EM2 A;  1AWC A;  3VEP A;  3E6C C;  2O0Y A;  3M7G A;  3I0T A;  2RC4 A;  4ASN A;  4KIC A;  4ZH4 F;  1JXS A;  5J8C A;  3O2P E;  6PAX A;  5KVR A;  2DI3 A;  4F7Z A;  2Y75 A;  2IP2 A;  3FMQ A;  2ACJ A;  2HR3 A;  1KYZ A;  3K9T A;  2HOE A;  1ZYR F;  5BOX A;  1YQA A;  1T38 A;  1P4X A;  4BYY A;  3KP4 A;  3H3Z A;  5E8I A;  3WE2 A;  1SD4 A;  3G3Z A;  3KET A;  3VB2 A;  3K1P A;  4BAY A;  3TO9 A;  1HQC A;  3IHU A;  3IWF A;  4P9F A;  3N97 A;  4GYI A;  5FD6 A;  4KMU X;  3KEQ A;  3HOT A;  4YII A;  4RB2 C;  2ADU A;  5A2Q K;  3E6B A;  2ZME B;  2Q2E A;  4PGH A;  3O3K A;  2P4W A;  4IXA A;  1P4A A;  3I59 A;  3HOS A;  4EGZ A;  5CVR A;  3LAJ A;  4EQQ A;  1KA8 A;  1O57 A;  1YLF A;  1CF7 A;  5E18 F;  5CVU A;  1RUO A;  2PQ8 A;  2W25 A;  3ZN0 A;  2HEO A;  5DYM A;  4AWX B;  2M87 A;  4OIR F;  2F5D A;  3QAH A;  3DPL C;  4G7O F;  5LHG A;  4M71 A;  3RDI A;  3R6S A;  4UV9 A;  1KGS A;  4L9J A;  2K4J A;  5D4R A;  3GX4 X;  4UHT A;  1ULY A;  2O8X A;  1TQP A;  4WK8 F;  2H27 A;  2IRF G;  3S2W A;  1R5G A;  1XSV A;  2CO5 A;  2MLK A;  4Q4Z F;  2WTE A;  2M8E A;  1O7L A;  2XAJ A;  2OQG A;  3L2C A;  3SZP A;  3HYI A;  4LGW A;  1IRF A;  2CWE A;  1BI1 A;  4G7Z F;  4S04 A;  3BP8 A;  2ZKZ A;  4HQE A;  4MEY F;  2A61 A;  3GVA A;  3H3U A;  2A68 F;  3PQK A;  3RJP A;  1K78 A;  4HDV A;  1FYL A;  3L09 A;  3F6O A;  3HHH A;  2CFX A;  5E8G A;  1IUY A;  4MNU A;  5DUI A;  4Q47 A;  2JPB A;  5LRR A;  2WC2 A;  4U7D A;  3J7A O;  2W84 A;  4ZYD A;  3RPU A;  3K69 A;  5L3D A;  2BBY A;  4XBF A;  3GZ5 A;  4CGZ A;  2WWY A;  5ICG A;  3IL2 A;  3P9I A;  4AIK A;  2HDC A;  1YW8 A;  1ZH5 A;  4LMY A;  3WTY C;  2JTV A;  1UB9 A;  4Y15 A;  5JFR A;  5JI6 A;  3LAP A;  2FRH A;  1JHH A;  1OKR A;  2V1U A;  3I59 B;  4AVP A;  4A2U A;  5AIP A;  1Y0U A;  1FBS A;  3DXJ F;  3M8E A;  1STZ A;  3GLX A;  4L9V A;  2L54 A;  5DD8 A;  1D5V A;  2FA5 A;  2H94 A;  2HGC A;  2W57 A;  1HXD A;  4Q5S F;  3LQR A;  2EV5 A;  3IRQ A;  5LGU A;  3K2Z A;  3C7J A;  3EUH A;  2KJC A;  2P5V A;  3MWM A;  1CGP A;  5CYV A;  5ILS A;  2ISZ A;  5CVI A;  4RS8 A;  1H0M A;  2KKO A;  4KT5 C;  2QEN A;  2R7D A;  3KP6 A;  2MLG A;  1YIO A;  3PQJ A;  4MGR A;  5LEJ A;  4XLP F;  2ETH A;  1P4W A;  3HIF A;  1YW7 A;  1F9N A;  3KCC A;  5CJ9 A;  3J80 K;  5ICF A;  1FC3 A;  2IA2 A;  3QU3 A;  3I4P A;  4M72 A;  4DNC A;  5BMZ A;  2KIM A;  2RNJ A;  4HV6 A;  5AIQ A;  3GFM A;  1GHC A;  2PLY A;  4XRF A;  3L9F A;  4HF0 A;  1LDK B;  3T0Y A;  3LA2 A;  2D1V A;  1HKT A;  4KMF A;  3V7C A;  1O3T A;  2ZFW A;  1J2X A;  1P6R A;  5LHH A;  2BE5 F;  2PFB A;  3I53 A;  4EM0 B;  2E1C A;  3T8T A;  5D4S A;  4NQW A;  1JHF A;  2M45 A;  4HA8 A;  3ZMV A;  1GVJ A;  5HOO A;  4CZZ A;  2VOD A;  2ZJ2 A;  4IRG A;  4M9X A;  4JK1 X;  4O3M A;  4AD9 A;  2F5E A;  2GAU A;  3R0J A;  3TDZ C;  3CUO A;  4U88 A;  3BRO A;  4WWC A;  4UNO A;  2W85 A;  4KYW A;  1BC8 C;  4EJV A;  1XN7 A;  3HRS A;  2OA4 A;  1A04 A;  4M73 A;  2H6C A;  3GO5 A;  5BQT A;  2H6B A;  2DFI A;  1MGT A;  3P9C A;  1ZRD A;  1S29 A;  2EK5 A;  4LB5 A;  5DDG A;  3ULQ B;  4P9U A;  5F1R A;  4IHS A;  1XGS A;  3GYH X;  4BHP A;  3DP7 A;  2VT2 A;  2EFP A;  1G3W A;  1SD7 A;  2A07 F;  1MJ9 A;  2CYY A;  2OU2 A;  1ODD A;  4XSZ F;  5D6F A;  3ZPL A;  5D5V B;  3R60 A;  4HLX A;  3F3X A;  5L3C A;  1SD6 A;  3RYR A;  3V8K A;  1DUX C;  1IN5 A;  3BZ6 A;  2VE8 A;  2P7V B;  5FLX Z;  4LK0 F;  1SAX A;  4U0W A;  1QZZ A;  3F8C A;  2OQR A;  3ROU A;  5J6X A;  1IF1 A;  1EH8 A;  2RQP A;  3QPT A;  2E1N A;  3CO6 C;  3V8L A;  4E70 A;  5FD5 A;  1IRG A;  3WTT C;  3F8F A;  1X3U A;  2HQR A;  4I2O A;  2PBI A;  2DBB A;  2NS0 A;  4HOB A;  5E1W A;  2MBF A;  2NNY A;  2Y48 A;  1YYV A;  2R3S A;  2XUB A;  4R8H A;  5IT3 A;  5LRS A;  3CUQ C;  3J81 Z;  5CVJ A;  2QM3 A;  1MJA A;  2P8T A;  2QBY A;  2ESH A;  1LB2 A;  2O6G E;  1FP2 A;  3ZMS A;  3KZY A;  2Q0O A;  4LB6 B;  3TOA A;  1VTN C;  5L3B A;  3GZ6 A;  4WXC A;  4ENJ A;  3BWG A;  1S7A A;  2OAZ A;  3K0L A;  1UHW A;  4YIF A;  2EFO A;  2FNP A;  1EH7 A;  3COA C;  1TBX A;  4U7B A;  3B02 A;  2GA1 A;  4EVI A;  1I6X A;  1W5S A;  3KP7 A;  4MTE A;  2O61 A;  5HLG A;  1J75 A;  2CSO A;  2EFQ A;  1LEA A;  4HX4 A;  4QWQ A;  3E5Q A;  2L01 A;  2OBP A;  3I5U A;  4QLC U;  1OYY A;  3HSF A;  3Q9V A;  4S05 A;  4ESB A;  3BPX A;  2HWV A;  1FBU A;  3TOB A;  3MAJ A;  4ETS A;  1O3S A;  5H6Q A;  1I27 A;  5TJJ A;  3F23 A;  4L18 B;  3TDU C;  4HW0 A;  2GXG A;  2VBZ A;  1XSD A;  4I0B A;  5K5R A;  1JE8 A;  1ZLK A;  4Z2Y A;  1S3J A;  2FML A;  1IXS B;  2OZU A;  2F5F A;  4RAY A;  1QO0 D;  2KIF A;  2D1H A;  2L3D A;  2A69 F;  1ONV A;  3JW4 A;  1XGM A;  1T2K A;  1PDN C;  1SFX A;  2VBW A;  3RPQ A;  3G73 A;  4YG2 F;  3ZMZ A;  3HTU A;  1IAW A;  1W7P D;  1MKM A;  3M9A A;  5HDG A;  2GWR A;  2ESN A;  2NNN A;  5CLS A;  2VOO A;  3F8B A;  5D6E A;  2NAZ A;  3L00 A;  3K1N A;  5A2Q Z;  2VC0 A;  3JSP A;  2A5Y B;  2ZCW A;  3FMR A;  3HTS B;  5JHU A;  2HZT A;  3TGN A;  4HYE A;  1QBJ A;  1ZN2 A;  1XCB A;  3HSE A;  2TDX A;  2QBY B;  3PFI A;  4P55 A;  1BOA A;  1D8J A;  1XMA A;  4HAM A;  4UVB A;  4IHT A;  4OIP F;  1RIO H;  3F72 A;  2ZXJ A;  2IVM A;  4AIJ A;  2HYF A;  3HSR A;  4IRI A;  4CIC A;  3R4K A;  2L4A A;  3F21 A;  2G7U A;  4BQA A;  3WTW C;  3DV8 A;  2CG4 A;  3EQL F;  3B73 A;  1ON1 A;  2QQA A;  3ECO A;  3HHG A;  3DQV C;  1L3L A;  2GA2 A;  4KUM A;  5LGT A;  1DP7 P;  1L0O C;  2XRO A;  3RKX A;  4BH9 A;  1QNT A;  5EEH A;  1B6A A;  1IZ1 A;  3O6B B;  4AIH A;  2QVO A;  4RGX A;  2HS5 A;  1PP8 F;  1OPC A;  1BC7 C;  3ZQ7 A;  2IA0 A;  3H92 A;  2XAQ A;  2BYV E;  3KP2 A;  1ZAR A;  3MFK A;  4Y17 A;  1ZRE A;  3K1M A;  1HW2 A;  2CQK A;  4G94 A;  4RB3 C;  2Z99 A;  5D5W B;  4UVA A;  5FO5 A;  1KQ0 A;  3KLN A;  3NEU A;  1FP1 D;  3FXU A;  1ZG1 A;  2HFH A;  4O5V A;  4NHJ A;  3LST A;  5D5X B;  1IN6 A;  3DFG A;  1T0F A;  5HS7 A;  1WI9 A;  1TW2 A;  4A12 A;  1YW9 A;  2XGX A;  4HBL A;  1F1Z A;  2XKO A;  3M8F A;  1TQM A;  1J9I A;  4GGG A;  1W7P A;  2QUF A;  1QGP A;  4KN7 X;  3E5X A;  3VOE A;  1EV7 A;  2CW0 F;  3WTZ A;  3R61 A;  3GW2 A;  2K4B A;  3ELK A;  3BOQ A;  5JR3 A;  1QZY A;  3LWF A;  1ZHF A;  2MA3 A;  5E17 F;  4Y13 A;  2DK8 A;  4HF2 A;  1FSH A;  2VXZ A;  2ZBK A;  3JSO A;  2CGP A;  1DPU A;  3I58 A;  4M9S A;  2V79 A;  2IA1 A;  2QQ9 A;  5FGM A;  4GYG A;  2FMY A;  2AXL A;  3GWZ A;  2VBX A;  1K6O A;  3FWE A;  4LG0 B;  2YR2 A;  2Z3Y A;  2XAF A;  3CO7 C;  3SXY A;  5FB2 A;  4EGY A;  3ERE D;  3C18 A;  3VOD A;  5IT9 K;  1WSU A;  4MHG A;  1RNL A;  3GFJ A;  1FPQ A;  2G9W A;  5HS8 A;  1LDJ A;  5J8F A;  2ISY A;  1YTY A;  2MC3 A;  1ON2 A;  1LQ1 A;  5HVQ C;  4EV0 A;  4P96 A;  2PI0 A;  1TLH B;  4L9T A;  2RN7 A;  1B59 A;  1FSE A;  5DUK A;  1DPR A;  1USS A;  4ZYH A;  3WU0 A;  3U9G A;  1FNN A;  1O3Q A;  3CTA A;  1Q1H A;  2FBI A;  1LVA A;  3Q9S A;  2UXX A;  3V7S A;  1J59 A;  3JTG A;  3RKW A;  4MTD A;  1ZLJ A;  3J80 Z;  4EJO A;  3I71 A;  2E7X A;  1OR7 A;  1U5T A;  2EWN A;  4Q48 A;  1C0W A;  1R1U A;  1I1S A;  3R0A A;  1BIA A;  3HRM A;  5ILU A;  4CO8 A;  1R7J A;  1YFH A;  1R00 A;  3M1E A;  4MQV A;  1J0R A;  5KK1 A;  2RGV A;  3LQQ A;  1S7O A;  4LK1 F;  1F5T A;  2GXB A;  4KIG A;  3P7N A;  1V4R A;  1R22 A;  4M6Y A;  5DCM A;  1REP C;  4N9I A;  4OIN F;  2K02 A;  2FXA A;  4U0V A;  3SHF A;  2COM A;  1XGO A;  3E97 A;  4HZF A;  2M1B A;  1W7P B;  4IVN A;  2EFW A;  4FHT A;  4EMS A;  4ENM A;  3BJO A;  1LDD A;  2LKP A;  1G4D A;  1KYW A;  2YPR A;  3WU1 B;  5K5Q A;  2B0L A;  4RB0 A;  4PCQ A;  5DD4 A;  1HW5 A;  1IN8 A;  2LDU A;  3QOP A;  1ZGA A;  4FX0 A;  3HRT A;  3ZMU A;  3JTH A;  3FX3 A;  3LA7 A;  2W24 A;  4A5M A;  3GEZ A;  1FY7 A;  2ZO4 A;  5BPI A;  3P9K A;  1XB4 A;  4PDK A;  1XSX A;  5F64 A;  1U6G A;  2RDP A;  4H0E A;  4RGR A;  2MH2 A;  4M9Z A;  2BGC A;  5F6F A;  3RYP A;  1IXC A;  2FQ3 A;  1SD5 A;  4KA4 A;  3GFL A;  4DQ2 A;  1AOY A;  2EB7 A;  1BI2 A;  1UFM A;  4RB1 A;  1KU7 A;  1IN4 A;  1QPM A;  3I54 A;  1ZRF A;  5D5U B;  3ZP5 A;  2XAG A;  3LA3 A;  2A3S A;  3T8R A;  3ABT A;  2EJR A;  2KRF A;  4CXF A;  5L3E A;  2IT0 A;  1U2W A;  2X4H A;  1U5T B;  4HV5 A;  2FNA A;  1K79 A;  5DV5 A;  5HS9 A;  2KIU A;  4ZYE A;  5H20 A;  1R1V A;  1E17 A;  3WTU C;  3TO7 A;  2VOP A;  5ICE A;  1U3E M;  2K86 A;  1H9G A;  2FBH A;  2XIG A;  4A6D A;  3LFK A;  4YFN F;  1KU2 A;  4G6D A;  1ZGJ A;  3DPT A;  3KP5 A;  2F2E A;  3GUD A;  5DCM B;  2FU4 A;  2HQN A;  2V9V A;  4OOI A;  5E1Z B;  4EJT A;  1FYM A;  2DO7 A;  3IKV A;  2IJL A;  2DT5 A;  3I64 A;  1XMK A;  4D0P A;  5ICC A;  1BN5 A;  4G9Y A;  1BI3 A;  1BI0 A;  3SQN A;  4WXH A;  3JAM Z;  2YU3 A;  2DPD A;  2M5W A;  2GZW A;  2P6S A;  2P7C B;  3WTX C;  3IRR A;  3FF5 A;  1S8N A;  4MEX F;  2HTJ A;  1FBQ A;  2M30 A;  3C1D A;  1JGS A;  4JBA A;  2C6Y A;  2L02 A;  5LEK A;  5JVT A;  2DQL A;  2XAS A;  1SFU A;  4B8X A;  3V4G A;  4L0Z B;  1Z6R A;  1UCR A;  1RI7 A;  2RVC A;  4HDU A;  5ED4 A;  1DDN A;  3U2R A;  2P6T A;  4B09 A;  1IW7 F;  4O6J A;  4RGU A;  5BPD A;  1U78 A;  2V1D A;  1UST A;  3ECH A;  4BHB A;  2VN2 A;  4PZJ A;  3SFZ A;  1TW3 A;  3TKY A;  3FXR A;  2K27 A;  2XRN A;  3WTV C;  3W6J B;  3C3W A;  3QP6 A;  4ZZL A;  4OIO F;  4GCV A;  1GXP A;  4EJW A;  2O3F A;  3RTR A;  2JRT A;  4KNY A;  2PMH A;  4I01 A;  2P5K A;  2JSC A;  1YS7 A;  3E6D A;  2GQQ A;  5K5O A;  1MD0 A;  4L9N A;  4KDP A;  4WCG A;  1J7K A;  2A6H F;  5HLH A;  2JZY A;  3WGI A;  4XLN F;  1OYW A;  4EM1 A;  1U8R A;  3W6K B;  2OD5 A;  2QYO A;  1FZP B;  4N0B A;  4ENN A;  3CLO A;  5E1X A;  3WE3 A;  3KE2 A;  1KQ8 A;  1LJ9 A;  5HDK A;  1W4M A;  3FZV A;  4WF2 A;  3NRV A;  1YS6 A;  4LG0 A;  2MD5 A;  3CDH A;  2HTS A;  5HLI A;  5DCF A;  1FOK A;  3MZY A;  4I7H A;  2UZK A;  5LHI A; 
#chains in the Genus database with same CATH topology
 1S6L A;  1LNW A;  2CRG A;  2HQA A;  2VON A;  3MKL A;  2W82 A;  3CQZ J;  3ISP A;  3D1N I;  1ZAO A;  5D8L B;  2EZH A;  1X4O A;  1R36 A;  1Z7U A;  4A0Y A;  1FYK A;  4A3L J;  3FM3 A;  3FXQ A;  1BM9 A;  4S0H B;  5CQE A;  4HQM A;  2BW3 A;  3BTJ A;  2H1K A;  2R7V A;  2FOK A;  2PEX A;  4UB6 C;  5FKN A;  3E5U A;  1P9Q C;  4NUB A;  1B9M A;  5LBQ A;  2UV1 A;  3OYG A;  2QSG X;  3JR9 A;  3N4M A;  2XDV A;  1R23 A;  2LYC A;  2ZNZ A;  1TNS A;  2VT3 A;  1E3O C;  3AKZ A;  2D45 A;  3BJ6 A;  4IF4 A;  4RAZ A;  3D0S A;  1FX7 A;  2PG4 A;  4KIB A;  4D1Q A;  1MJB A;  1EH6 A;  1K6Y A;  4LG3 A;  1XDU A;  1WJB A;  2KZG A;  3OOP A;  2QZ8 A;  1KU3 A;  3FM5 A;  3KP3 A;  2H09 A;  4PJ0 C;  3BY6 A;  3KEO A;  5J47 A;  2HZD A;  3H35 A;  4CHU A;  2PN6 A;  5EGO B;  4ZYG A;  3H5R A;  3KYC B;  4E7H A;  2FF4 A;  1E2X A;  1G3S A;  3MEX A;  2XVC A;  3BTL A;  2IW5 A;  3HZJ A;  1D0Z A;  2IS2 A;  4UVC A;  3BLY A;  2EA2 A;  5ERI A;  1RR7 A;  1S7E A;  2EPF A;  3MD2 A;  4BQQ A;  5CQG A;  2PMZ N;  4I09 A;  3VYT B;  2YSR A;  1YOV B;  2VKD A;  2M7B A;  4UXN A;  1A36 A;  3DBL B;  1UG0 A;  4DOZ A;  3CZ6 A;  4G8X A;  1A35 A;  2O8K A;  4JQF A;  3LSK A;  1MDM A;  1XX5 A;  4AID A;  2MSY A;  4XNF A;  3OYB A;  1BIB A;  2MH9 A;  3VSK A;  2DT6 A;  1T6S A;  2ME0 A;  4M3F A;  4P5O A;  1V3F A;  1I3A A;  4BXX J;  1MNE A;  2AQF A;  3BDD A;  4ESJ A;  2Z5U A;  1O7F A;  2MD0 A;  3S3N A;  4UUS A;  3L2U A;  2DTR A;  3W6V A;  2NYX A;  1H88 C;  1R4M B;  1IXR C;  2DA7 A;  1R5H A;  4XN0 A;  4KIF A;  2K9N A;  4I02 A;  3ZMT A;  1WJE A;  2CUZ A;  2G7H A;  4G7H F;  4R79 A;  2BVM A;  2A6E F;  4CDG A;  1ZRC A;  2DAO A;  2LY9 A;  2Y30 A;  1TQI A;  1J09 A;  3HEF A;  1UAA A;  4Y3O A;  3ABU A;  2WY8 Q;  3K7A J;  4B1R A;  3E3V A;  2VC1 A;  2XPV A;  2STT A;  1W5T A;  3D5L A;  3ZN1 A;  2X0L A;  1Z05 A;  5L3F A;  1LPQ A;  1J5Y A;  3ABK H;  2H1L A;  4M6X A;  1IN7 A;  2LNB A;  4FT8 A;  5KNL A;  4C2U A;  2UWM A;  3IC7 A;  2HKX A;  4BS9 A;  2L0K A;  1XG1 A;  3DEW A;  3ZQC A;  2BXY A;  5FRN A;  3S16 J;  3GLL A;  2JRM A;  4BJT A;  2R5Z A;  4D5F A;  4XLA A;  2BOL A;  4ESF A;  1MBE A;  2Q2E B;  1K7A A;  2IGK A;  1SEU A;  3WTS C;  4XKB A;  5IT9 Z;  1CQT A;  5CKT A;  3U21 A;  1HST A;  2GIZ A;  1FEX A;  1I5Z A;  2WB1 A;  2MFZ A;  1G3Y A;  2OCE A;  3FBI B;  3KIO A;  3ZQL A;  1X2M A;  4M3G A;  1R58 A;  1T39 A;  1CF7 B;  1YO5 C;  1HDP A;  2DDB A;  3OV8 A;  3QYB A;  1FWZ A;  4BNC A;  5FFZ A;  5AON A;  2DU9 A;  4YFK F;  3AG1 H;  3DEU A;  1T98 A;  4CZC A;  4CCJ A;  3EET A;  2BW3 B;  2BXZ A;  1FLI A;  4A0Z A;  1HBX G;  4DJA A;  3DLL F;  4CCO A;  2BHY A;  4A3D J;  1B1B A;  2J5O A;  2JT1 A;  4L5J A;  2M4K A;  2P81 A;  3ZMD A;  1G3T A;  3SDB A;  1D8K A;  2JVG A;  4A0X A;  1Y6I A;  2CQQ A;  4EJU A;  4UUV A;  1KU9 A;  4XSX F;  3G1L A;  2FX0 A;  1ZG3 A;  3EDP A;  1IG7 A;  1IUF A;  5GPA A;  5J1Y A;  3HPH A;  1MBF A;  2HXI A;  2K7L A;  4A6E A;  2VE9 A;  1F4K A;  3QQA A;  2DMT A;  2CQX A;  5HDN A;  4I98 B;  3A2K A;  3FHZ A;  3WU2 C;  3WG9 A;  3GXO A;  2F4M B;  4IRH A;  5DM7 F;  3GF2 A;  3KEY A;  1OCT C;  4CA0 A;  2KJB A;  1MZB A;  2R0Q C;  5C3E J;  3HOZ J;  2CU7 A;  3TW6 A;  3F8M A;  1N25 A;  3OS2 A;  4A3G J;  1HSJ A;  1R1T A;  4CYD A;  5FKM A;  1S5L C;  1HDD C;  5H6R A;  1W1W E;  3F8N A;  4U87 A;  4F92 B;  2E71 A;  2P5L C;  1ZTR A;  2Q8K A;  1DU6 A;  3BZC A;  5FKL A;  1KON A;  1I1G A;  4LFU A;  5IP9 J;  1HW1 A;  3K4M A;  1NHA A;  4M3E A;  5GPC A;  1SFE A;  1YE9 A;  2NOJ B;  2OZ6 A;  1WCM J;  4XOR A;  1YI2 I;  4LLN A;  2JA6 J;  1MDM B;  2KMU A;  2OTL I;  4NB5 A;  2JA7 J;  3ZQQ A;  5IOY A;  2YX7 A;  2LTP A;  1WJD A;  2VB6 A;  1YHQ I;  2OV7 A;  3EYY A;  3NQO A;  1PP7 U;  1JTY A;  3FMS A;  3QPH A;  4PGG A;  2BEO A;  2DK5 A;  1D3Y A;  1OMI A;  3KFW X;  5F04 A;  4IHV A;  2BV6 A;  5IP7 J;  4FX4 A;  4HX8 A;  2MC4 A;  5EEG A;  5J1U A;  3HRU A;  2QQB A;  2HKO A;  1B4A A;  1WWX A;  1T33 A;  2BHZ A;  2VKE A;  4UUS B;  4II2 A;  1K78 B;  2K9Q A;  2XV4 S;  3OIO A;  2EV6 A;  2GIV A;  1XD7 A;  4FE7 A;  3CJN A;  3VFZ A;  5H2F C;  3E6M A;  3GBG A;  1WKM A;  1OYI A;  4HF1 A;  5EDN A;  1LUJ B;  2LF8 A;  2V1X A;  3HBL A;  4YFX F;  3TW7 A;  2DTZ A;  1B9N A;  1X19 A;  3ML6 A;  1O3R A;  3OR1 C;  3S32 A;  1X1A A;  4BHC A;  3T1B A;  2CUJ A;  2DYS H;  3W2V A;  5L3G A;  2LF7 A;  2FSW A;  2KDZ A;  5BS6 A;  3F6V A;  3REO A;  3GFI A;  3DBH B;  2R7Q A;  4IPA A;  3BG6 A;  4LIT A;  3OS1 A;  2QSH X;  5TRD A;  3PIO F;  1NK2 P;  2QLZ A;  4TV7 A;  3Q0W A;  4AUX A;  5DTD A;  2BY3 A;  1H9T A;  1KZH A;  1X1P A;  2EFN A;  5LGN A;  3WOD F;  1ZR4 A;  2DJN A;  2X85 A;  4OIQ F;  3CUQ A;  2VXD A;  1KQ9 A;  2K85 A;  2R5Z B;  2IPQ X;  3A0H C;  1Z67 A;  1P2F A;  3DKW A;  5E3M A;  3MCZ A;  1HKQ A;  1WH7 A;  4XKW A;  4DZJ A;  5JVG F;  2E7W A;  2QWW A;  4E7I A;  2YX4 A;  3S2D J;  2VIX A;  4KN4 X;  2UXN A;  2LK2 A;  3E0J B;  3A01 A;  1VQN I;  4BQN A;  4BUP A;  2FBK A;  4LJZ F;  2RKH A;  4OMY A;  2ZNY A;  4B4C A;  3WGG A;  4BXU A;  2E19 A;  4Y7N J;  2LH9 A;  3WG7 H;  1QPI A;  3UKG A;  4LD5 A;  3OSG A;  2VJI A;  3MZ8 A;  2PJP A;  4UV8 A;  2XHK A;  2Y0M A;  1OR7 C;  4U0Y A;  1U5T C;  2PMU A;  2DFH A;  4JX6 A;  2STW A;  1YG2 A;  4ON0 A;  3SEZ A;  4R1H A;  3I55 I;  1BJA A;  3DCF A;  3MQ0 A;  1PVE A;  1UHM A;  3HOV J;  4LLL A;  4A5N A;  3BR3 A;  1POG A;  3MMY B;  1G6N A;  3U1D A;  1WPK A;  2VQL A;  5B5E C;  4BE2 A;  3RI4 A;  1XGN A;  1Z1D A;  4XK4 A;  4C3H J;  4WXD A;  2FEZ A;  4RGS A;  3RIR A;  1FT9 A;  4MQ9 F;  1V55 H;  5LLQ A;  1PUF A;  1E3H A;  3QOE A;  4HX7 A;  4E7Z A;  4XLE A;  2E5N A;  4I0A A;  3VWB A;  4GO1 A;  1Z3X A;  5K1Y A;  2D2W A;  5D8K B;  4HLY A;  4A3K J;  3V8J A;  5FLX K;  3F22 A;  4KIT B;  3WGH A;  1SMT A;  3KYL A;  4K2E A;  4FIS A;  5E3O A;  2M0M A;  5K7F A;  3OYJ A;  3OY9 A;  2DQR A;  2Z33 A;  1BBY A;  5B1A H;  2FE3 A;  5F08 A;  2ME6 A;  1G8X A;  1T95 A;  3IKT A;  1VQ8 I;  5E20 A;  3QP5 A;  2O03 A;  1RZ4 A;  1XMX A;  1EKE A;  4L5I A;  2R7U A;  1TTY A;  1RUN A;  2VQG A;  4ENK A;  4QSH A;  3GTG J;  1D1C A;  4ZZD A;  5ILV A;  1WQ2 A;  1W0T A;  4GDF A;  3KYD B;  3AL0 B;  2R7F A;  3W2W A;  1UJ8 A;  1JT6 A;  5E3L A;  2VBY A;  3TQN A;  3K70 D;  3RKQ A;  4BGD A;  5F0C A;  3CJR B;  3KLO A;  2HOS A;  2HYG D;  4RAG A;  2IBD A;  2V6C A;  4A3C J;  3PNV A;  3BPV A;  1HA8 A;  2VQC A;  2F5C A;  2CS3 A;  5K7Z A;  3DWL E;  2OTJ I;  1Z6T A;  2EV0 A;  5FFX A;  2GXA A;  3JRE A;  3N05 A;  4N9H A;  2EA4 A;  5TIS C;  3FKI J;  1AHD P;  2JK3 A;  2DA5 A;  4OU0 A;  1QA6 A;  2QKL B;  1F36 A;  1XCV A;  3GTM J;  2WV0 A;  2L5Q A;  2YU9 J;  2DA6 A;  1TNT A;  2Y9Z A;  2HOA A;  2ZME A;  2DLL A;  1TWG J;  4E7L A;  3J81 K;  2CW8 A;  3L7W A;  2RV8 A;  2WBM A;  3QRF F;  4A93 J;  3L2V A;  1GXQ A;  4A3M J;  2J5P A;  3B6A A;  2DPU A;  3HUG A;  2Z9O A;  1BR2 A;  5KCM A;  3LSM A;  2P0W A;  3QU6 A;  2DW4 A;  4NQW B;  1ENH A;  4BBS J;  3IWZ A;  4L0Y B;  4E7J A;  5EZH A;  3H9G A;  2Y2Z A;  2AS5 F;  2PX9 A;  1HC8 A;  2HU9 A;  2OCC H;  3KZZ A;  3V42 A;  3ABL H;  3S8P A;  3JAM K;  2L4M A;  1LFB A;  1UZC A;  2DOF A;  3DF8 A;  1G59 A;  4DBR A;  4GXO A;  2L7K A;  1Z91 A;  1T08 B;  2COB A;  3CUQ B;  3V7R A;  3LFU A;  1WRJ A;  4C3I J;  2XAH A;  3VYU B;  2D5V A;  1TL8 A;  4RBO A;  2BVL A;  2NRA C;  1P92 A;  5CVV A;  4CCK A;  3RKY A;  4E6K G;  1GLN A;  4G6Q A;  5E79 C;  2OUM A;  3BJA A;  1UG2 A;  1GT0 C;  1X3Z B;  4OMZ A;  2TRT A;  3T5X A;  2ELH A;  2LSO A;  3UR3 C;  2XKP A;  2W48 A;  1Z0X A;  3K4L A;  1XDS A;  3K10 A;  1LEB A;  5JLX A;  1P7I A;  5DEQ A;  3G6E I;  1QQI A;  2Y9Y A;  1Z9C A;  3AAF A;  3TO6 A;  4HNV A;  1D1A A;  4AVZ A;  2IEK A;  1HKS A;  4QIW N;  5LFA A;  4KFC A;  4LLG F;  4WX9 A;  1OCO H;  2AQE A;  3SZT A;  1ZG5 A;  3Q5F A;  1OCC H;  3ZRG A;  3DKY A;  9ANT A;  2EIL H;  4IJA A;  4PJL A;  2JPC A;  3EYI A;  3BR6 A;  2WAF A;  4L5E A;  5IYB J;  5IY5 H;  3MKY B;  4GRI A;  4CYC A;  1PUE E;  2I10 A;  5CPR B;  2XB0 X;  4M74 A;  1OFC X;  3MZH A;  1SMY F;  2FQ4 A;  2QEX I;  4EM2 A;  1D0Y A;  4XLF A;  1AWC A;  1TP4 A;  4HG2 A;  3VEP A;  3E6C C;  2KIQ A;  2O0Y A;  3M7G A;  3CF5 F;  3GTK J;  1SVL A;  2I8D A;  3FXJ A;  2KPM A;  3I0T A;  3M4O J;  2RC4 A;  3TP0 A;  4KIC A;  4ASN A;  4ZH4 F;  3CCY A;  1JXS A;  2F4I A;  1MND A;  1W5C C;  4JYK A;  5J8C A;  1VQ7 I;  3O2P E;  1PJR A;  6PAX A;  5KVR A;  2DI3 A;  4F7Z A;  1IRX A;  2IXS A;  2ZJP F;  2Y75 A;  2IP2 A;  3FMQ A;  2ACJ A;  2EIN H;  1KYZ A;  2HR3 A;  3K9T A;  2HOE A;  2L9S A;  1ZYR F;  5BOX A;  4B3A A;  3C2B A;  1YQA A;  2M3A A;  1T38 A;  4BE0 A;  1P4X A;  2AHQ A;  4BYY A;  4D9J A;  3G2B A;  2DXI A;  4IHW A;  3KP4 A;  3H3Z A;  5E8I A;  2XF6 A;  4XOT A;  2HXO A;  1SD4 A;  3ABM H;  3G3Z A;  3WE2 A;  3KET A;  1VQO I;  4XKV A;  3VB2 A;  5FLM J;  3K1P A;  1OQY A;  4FTH A;  2PJR A;  4F91 B;  4MO7 A;  4BAY A;  3TO9 A;  1HQC A;  2JVH A;  3IHU A;  3OYD A;  3OR2 C;  3IWF A;  4P9F A;  3N97 A;  2VPR A;  4GYI A;  4LOC A;  5FD6 A;  4KMU X;  2XGC A;  1YJW I;  3CP2 A;  1U9O A;  3KEQ A;  3HOT A;  4YII A;  3B6C A;  4RB2 C;  2ADU A;  4HEA 2;  3Q0V A;  5A2Q K;  4DYC A;  3E6B A;  2ZME B;  2Q2E A;  4F52 A;  4PGH A;  2EBI A;  3O3K A;  3OL4 A;  2P4W A;  1JUM A;  4IXA A;  1P4A A;  3I59 A;  3HOS A;  4EGZ A;  5CVR A;  1V5E A;  3LAJ A;  4EQQ A;  1PYV A;  1KA8 A;  1O57 A;  4GFB A;  1YLF A;  4BY1 J;  3S93 A;  1CF7 A;  1U8B A;  5E18 F;  5CVU A;  3TMO A;  1RUO A;  2PQ8 A;  3HUG B;  2W25 A;  3AG3 H;  3ZN0 A;  2HEO A;  5DYM A;  3PO3 J;  1ACI A;  4AWX B;  2L9V A;  3BC8 A;  2JA8 J;  2M87 A;  3OWT A;  4NC8 A;  1RES A;  1ITY A;  2ZXI A;  2Z2S B;  4OIR F;  1OIS A;  2F5D A;  2ZC2 A;  3QAH A;  3DPL C;  3K4J A;  3GTQ J;  2IGM A;  4G7O F;  1BW5 A;  3GTJ J;  5LHG A;  1IJW C;  4IHY A;  4M71 A;  2ECB A;  3RDI A;  4M3D A;  2JSP A;  3R6S A;  3CCR I;  3S14 J;  4UV9 A;  1KGS A;  4L9J A;  3A03 A;  2K4J A;  2E1M B;  5D4R A;  3GX4 X;  3HJE A;  1JJ6 C;  4UHT A;  4IZZ A;  1NG6 A;  1ULY A;  5C44 J;  2O8X A;  1TQP A;  4WK8 F;  2H27 A;  1BOB A;  1YIJ I;  2IRF G;  3S2W A;  3OYK A;  3MN2 A;  3DLA A;  1R5G A;  1XSV A;  2CO5 A;  2MLK A;  2FJ1 A;  3BG9 A;  3LSH A;  4Q4Z F;  1EA3 A;  3H36 A;  4BY7 J;  2WTE A;  3MVP A;  5HOD A;  2M8E A;  3S17 J;  3PFY A;  1O7L A;  2XAJ A;  2OQG A;  1WJA A;  3OIP A;  2XSJ C;  4BU2 A;  3L2C A;  3OYN A;  2MGQ A;  4BDZ A;  2R93 J;  3SZP A;  3HYI A;  1SAU A;  4LGW A;  3E7L A;  1IRF A;  2XAU A;  1R71 A;  2CWE A;  1ZR2 A;  3K6G A;  5B3S H;  1GVD A;  3IAS 2;  1BI1 A;  4G7Z F;  4S04 A;  3BP8 A;  1MBH A;  1TZL A;  4ZDL A;  2ZKZ A;  4QPO A;  1FIP A;  1RPW A;  4HQE A;  3GME A;  5M3F J;  4MEY F;  2A61 A;  2HNH A;  4CYC B;  3GVA A;  2K3P A;  1R6R A;  4IHX A;  4HPQ A;  3CCV I;  3RZO J;  4W97 A;  2A6T A;  3H3U A;  3ZXS A;  2M7A A;  2M34 A;  4BE1 A;  3FDY A;  3LSG A;  4PUS A;  3HOW J;  3CMY A;  3A02 A;  2A68 F;  3PQK A;  2KDO A;  4XMY A;  3RJP A;  1V5F A;  2EIK H;  1K78 A;  2VL8 A;  4HDV A;  2R7R A;  2O9L A;  1FYL A;  4OAZ A;  3L09 A;  3F6O A;  2M0C A;  3HHH A;  2CV0 A;  1OJL A;  3F9K A;  1ETQ A;  1JUS A;  2CFX A;  1WJ5 A;  4RLF A;  5E8G A;  1IUY A;  4MNU A;  2LG4 A;  1MMN A;  1H8A C;  2V4J C;  4HST A;  5DUI A;  2R5Y A;  3BR0 A;  2MAB A;  4Q47 A;  3KZI C;  2JPB A;  3BT9 A;  5LRR A;  2WC2 A;  4U7D A;  4CCM A;  5F0H A;  3J7A O;  2CW7 A;  1JKO C;  2W84 A;  4ZYD A;  3WHB A;  3RPU A;  1Y1W J;  3K69 A;  2DA1 A;  1BL0 A;  3HC7 A;  2OJE D;  2O5R A;  1S72 I;  5L3D A;  2PJR B;  2BBY A;  4XBF A;  3H0D A;  2EQR A;  3GZ5 A;  5GAG J;  4CGZ A;  2WWY A;  2DOA A;  4AYB N;  5ICG A;  4NNJ A;  2IAI A;  3IL2 A;  1RKW A;  3WHC A;  3P9I A;  1MSE C;  3K2A A;  4AIK A;  5FKO A;  2HDC A;  1YW8 A;  1ZH5 A;  2VPL A;  4LMY A;  3WTY C;  2JTV A;  1UB9 A;  4Y15 A;  3OS0 A;  3CJQ B;  5JFR A;  5JI6 A;  3LAP A;  3TP3 A;  2DJI A;  2FRH A;  2XC7 A;  1JHH A;  1OKR A;  3JRB A;  2V1U A;  2W4S A;  3I59 B;  4A3E J;  4AVP A;  3PO2 J;  3SJM A;  4A2U A;  2RNG A;  5AIP A;  1I39 A;  3S1N J;  1Y0U A;  1FBS A;  4YEJ A;  4QTR A;  3DXJ F;  1VI0 A;  3M8E A;  1STZ A;  3HOU J;  3GLX A;  4L9V A;  2L54 A;  5DD8 A;  3HGY A;  1D5V A;  2FA5 A;  2H94 A;  2HGC A;  4A3I J;  2W57 A;  1HXD A;  3G4S I;  2A05 A;  4Q5S F;  3LQR A;  2EV5 A;  3IRQ A;  5LGU A;  3CME I;  1WGX A;  2NVQ J;  2EIM H;  3DTE A;  4DYR A;  4V2G A;  3K2Z A;  3C7J A;  4M6V A;  3EUH A;  2MYS A;  2KJC A;  4XQF A;  3RQI A;  2DT7 B;  3CC7 I;  2P5V A;  3MWM A;  1CGP A;  2LVS A;  5CYV A;  1K4S A;  5ILS A;  2Y0S A;  2ISZ A;  5CVI A;  4RS8 A;  4J19 A;  2LR8 A;  3H9Q A;  1BR4 A;  1H0M A;  2YUS A;  2KKO A;  4KT5 C;  3EUK L;  2QEN A;  2R7D A;  2DMQ A;  4PJM A;  4F93 B;  1HCR A;  3KP6 A;  3AG4 H;  3ESW B;  2MLG A;  4C30 A;  1YIO A;  3PQJ A;  5E3N A;  3O8G A;  4MGR A;  5LEJ A;  4XLP F;  2NVY J;  4A3J J;  2ETH A;  4IEJ A;  1MW7 A;  2WAQ N;  1P4W A;  1YIT I;  3HIF A;  3BQZ A;  1YW7 A;  1F9N A;  1DQU A;  1I50 J;  5B1B H;  2IS6 A;  4X6A J;  3KCC A;  5CJ9 A;  1BW6 A;  3J80 K;  1FMW A;  1RET A;  5ICF A;  4LIU A;  4OWR B;  1FC3 A;  2IA2 A;  2OC6 A;  3QU3 A;  1Z21 A;  3C2G A;  3I4P A;  4M72 A;  1FIA A;  3X2Q H;  3G71 I;  4DNC A;  5BMZ A;  4XOP A;  2VLA A;  2KIM A;  2RNJ A;  2V26 A;  4HV6 A;  5AIQ A;  3GFM A;  1GHC A;  4X1E A;  4F55 A;  4FE4 A;  3JRC A;  1K83 J;  1NH3 A;  2XF5 A;  1U9N A;  2JWT A;  1LFP A;  2PLY A;  4MFD A;  4XRF A;  3L9F A;  4HF0 A;  1LDK B;  3T0Y A;  3LA2 A;  2D1V A;  2HYJ A;  3BR5 A;  2JUC A;  1HKT A;  4HRI A;  3L2R A;  4KMF A;  3JRA A;  5LD2 C;  2JA5 J;  3V7C A;  1JJ8 C;  1O3T A;  2ZFW A;  1P7J A;  2JMW A;  3G1M A;  2E1O A;  1J2X A;  1P6R A;  3FXM A;  4IQ4 A;  4XR6 A;  5LHH A;  2KHM A;  1MMD A;  2BE5 F;  3FIW A;  3CC2 I;  2R5Y B;  1IC8 A;  2XPU A;  2PFB A;  3I53 A;  3PSF A;  4EM0 B;  2E1C A;  4XLH A;  3T8T A;  2JA2 A;  2X6W A;  5D4S A;  4QPQ A;  2E5Z A;  3UNG C;  4NQW A;  1JHF A;  1YRN A;  1S9H A;  2M45 A;  1VZ0 A;  4HA8 A;  4JX4 A;  3ZMV A;  1GVJ A;  1JUP A;  4BEH B;  2XGD A;  3IUO A;  1Z77 A;  5HOO A;  4CZZ A;  2VOD A;  2ZJ2 A;  4IRG A;  4M9X A;  1N77 A;  3CDI A;  3H5N A;  1VQL I;  4JK1 X;  3OYH A;  3IV5 A;  1JKP C;  4O3M A;  2DA3 A;  4AD9 A;  3JRD A;  2F5E A;  2DN0 A;  2GAU A;  2QCO A;  3R0J A;  2X6Y A;  3TDZ C;  2R7S A;  3CUO A;  4U88 A;  1R49 A;  3BRO A;  4WWC A;  4UNO A;  2W85 A;  4KYW A;  1BC8 C;  4EJV A;  3J7A Y;  1XN7 A;  3HRS A;  2OA4 A;  1A04 A;  4M73 A;  2H6C A;  4YEL A;  3GO5 A;  5BQT A;  2IGN A;  2H6B A;  3LOC A;  3CCQ I;  5EF6 A;  2DFI A;  2VJ5 A;  1MGT A;  3LL7 A;  2CV2 A;  2R92 J;  3CD6 I;  3P9C A;  1XC5 A;  4RM2 A;  1ZRD A;  5C4J J;  3QPS A;  2DFF A;  3P5J A;  1S29 A;  1JKQ C;  2EK5 A;  2GOX B;  4LB5 A;  4CCN A;  2H8R A;  5DDG A;  2Y69 H;  2LC2 A;  4E4H A;  2VI6 A;  3ULQ B;  4P9U A;  5F1R A;  3JCU C;  1GV2 A;  4IHS A;  3FIS A;  1XGS A;  4N4O B;  3PNY A;  3GYH X;  4BHP A;  1D0X A;  3DP7 A;  3H5A A;  2VT2 A;  4LIV A;  2EFP A;  2V9P A;  1B8I A;  1G3W A;  2V7F A;  1SD7 A;  2A07 F;  4DZP A;  1MJ9 A;  2CYY A;  3GTO J;  2OU2 A;  1ODD A;  4XSZ F;  3QYF A;  5D6F A;  1A6I A;  3ZPL A;  5D5V B;  3AL0 C;  3R60 A;  4HLX A;  3F3X A;  5L3C A;  2HVQ A;  5FRM A;  1SD6 A;  1VQ6 I;  2L2O A;  4CCL A;  2PMZ A;  4PJJ A;  1GDT A;  1K4T A;  4I99 C;  3RYR A;  3V8K A;  3ZGK A;  1DUX C;  1Z7L A;  1IN5 A;  3BZ6 A;  4XN3 A;  2VE8 A;  2P7V B;  4BL0 B;  1LE8 A;  5FLX Z;  4LK0 F;  1SAX A;  4U0W A;  1QZZ A;  3F8C A;  2OQR A;  1QVU A;  3TL4 X;  3ROU A;  5TGT A;  5J6X A;  1IF1 A;  3HL2 A;  2LBF A;  2WV1 A;  4XON A;  1ORK A;  3BCB A;  2R7W A;  3ERM A;  1EH8 A;  2NS8 A;  2RQP A;  4OAY A;  3ZCO A;  5J4Y A;  3QPT A;  2E2J J;  4HSR A;  2E1N A;  3CO6 C;  1RC9 A;  4RM3 A;  3CJT B;  1JT0 A;  2N8G A;  3V8L A;  4E70 A;  4PSX A;  5FD5 A;  3IH4 A;  4PFP A;  1IRG A;  1I6H J;  2LY1 A;  1VQ5 I;  5IP6 A;  3WTT C;  3F8F A;  1MMA A;  1X3U A;  1Y56 A;  4XLC A;  2HQR A;  4I2O A;  2PBI A;  2CQ7 A;  3BG7 A;  2DBB A;  2NS0 A;  2I5U A;  4HOB A;  5E1W A;  2MBF A;  2X9D A;  3IAM 2;  2NNY A;  2Y48 A;  1YYV A;  2R3S A;  2ZSH B;  3HGG A;  3DTI A;  1SVO A;  2EZL A;  5M5X J;  2XUB A;  4R8H A;  1B72 B;  3TBI A;  1AKH A;  5IT3 A;  1OCR H;  5LRS A;  3CUQ C;  3SEQ A;  3J81 Z;  2HQ5 A;  2K40 A;  5JLW A;  1GUU A;  5CVJ A;  2QM3 A;  1MJA A;  2P8T A;  1AA7 A;  2QKM B;  4FET A;  2QBY A;  2KRC A;  4RAF A;  2X6X A;  2ESH A;  2E2H J;  1LB2 A;  2O6G E;  3JRG A;  1FP2 A;  1SFK A;  3ZMS A;  3KZY A;  2Q0O A;  4LB6 B;  1YRN B;  3TOA A;  1VTN C;  5L3B A;  3GZ6 A;  3MKZ A;  4WXC A;  5M5W J;  3S1Q J;  4ENJ A;  3BWG A;  1S7A A;  2NXN B;  5IOZ A;  2OAZ A;  3IH3 A;  3K0L A;  1UHW A;  3OYF A;  2WY7 Q;  2R7X A;  2CH0 A;  4YIF A;  2EFO A;  2FNP A;  2WA0 A;  1XPX A;  1EH7 A;  5M5Y J;  5GTH C;  4C3J J;  1BR1 A;  3COA C;  3Q0U A;  1ETX A;  1TBX A;  4U7B A;  3B02 A;  2GA1 A;  1U0J A;  1SVM A;  3GCM A;  4EVI A;  1I6X A;  1W5S A;  3KP7 A;  4MTE A;  2O61 A;  5HLG A;  4XRS G;  1LVK A;  1J75 A;  2VUM J;  3LSJ A;  2CSO A;  3CCU I;  4KJZ A;  2OPT A;  5FKK A;  2X6O A;  2EFQ A;  3S1R J;  1X1B A;  1OCZ H;  1LEA A;  4HX4 A;  2QSF X;  4QWQ A;  1TWC J;  3E5Q A;  2L01 A;  2OBP A;  5EG0 A;  2DDA A;  2QF7 A;  3I5U A;  3W3C A;  4QLC U;  1OYY A;  3HSF A;  2HOT A;  3Q9V A;  3FXL A;  2XRL A;  1EJ9 A;  4S05 A;  3LNQ A;  4ESB A;  1JGG A;  4PJN A;  3BPX A;  3U1K A;  1B8I B;  2O7O A;  2OF7 A;  1HLV A;  2HWV A;  1FBU A;  2F5V A;  4AC0 A;  3TOB A;  3MAJ A;  4ETS A;  3F0C A;  4FQG A;  1O3S A;  5H6Q A;  1I27 A;  5TJJ A;  3F23 A;  2RRE A;  3BTI A;  4L18 B;  3TDU C;  4HW0 A;  2GXG A;  2VBZ A;  4D7N A;  1XSD A;  4J01 A;  4I0B A;  5K5R A;  1JE8 A;  2EZK A;  1ZLK A;  3CMM A;  2VKH A;  1ZEL A;  4Z2Y A;  1T8I A;  1S3J A;  1IDY A;  2FML A;  3GZN B;  1LE8 B;  1IXS B;  4BAC A;  2OZU A;  2F5F A;  5M3M J;  3CCL I;  4RAY A;  1QO0 D;  2KIF A;  3FK7 A;  2LBF B;  3FXK A;  2ZME C;  2Q1Z B;  4YRV A;  3A4C A;  2D1H A;  2JQ7 A;  2L3D A;  1ETK A;  2A69 F;  3LSI A;  1ONV A;  3JW4 A;  1XGM A;  1T2K A;  3KPH A;  1PDN C;  1SFX A;  1FTZ A;  2VBW A;  4C2M J;  3M07 A;  3RPQ A;  1QVT A;  2FUG 2;  3G73 A;  1Y0N A;  4YG2 F;  1R5I D;  3RPU D;  1APL C;  3DU6 A;  5HLT A;  3ZMZ A;  1MMS A;  3HTU A;  1IAW A;  1W7P D;  1MKM A;  3M9A A;  4DW6 A;  5HDG A;  2GWR A;  2CFO A;  2ESN A;  2NNN A;  2ZXW H;  4M3B A;  5CLS A;  5FRO A;  2VOO A;  1Q1V A;  3SZG A;  4HNT A;  4BKX A;  3F8B A;  5D6E A;  3DTK A;  2NAZ A;  3L00 A;  5EJC A;  3RQ4 A;  3K1N A;  4JX5 A;  5A2Q Z;  1XS9 A;  4G6T B;  4IQJ A;  2VC0 A;  2LRD A;  1AKH B;  2YS9 A;  2E1M C;  3JSP A;  2A5Y B;  2ZCW A;  3FMR A;  1V54 H;  3HTS B;  5JHU A;  2HZT A;  3TGN A;  4HYE A;  1UMQ A;  3H0G J;  1QBJ A;  1ZN2 A;  4XIC A;  1XCB A;  1Y1V J;  5J1R A;  3HSE A;  1ZKG A;  1A5J A;  1T56 A;  2TDX A;  2QBY B;  1VQ9 I;  3PFI A;  4P55 A;  1BOA A;  1D8J A;  4NC7 A;  1XMA A;  4HAM A;  4UVB A;  4BBR J;  5J4V A;  4ZTF A;  4IO9 F;  4IHT A;  4OIP F;  1RIO H;  4E7K A;  1JKR C;  3JRF A;  3F72 A;  4C9Y A;  2ZXJ A;  2JJ7 A;  1MSF C;  2IVM A;  2QA4 I;  3ZQG A;  4AIJ A;  2LP0 A;  2HYF A;  3HSR A;  4IRI A;  2ID6 A;  4CIC A;  3R4K A;  2F48 A;  2L4A A;  1N78 A;  3F21 A;  3AG2 H;  3Q3S A;  2QQ8 A;  2G7U A;  4BQA A;  3CDL A;  3K4K A;  3WTW C;  1VQK I;  1QZE A;  2L7M P;  3VPR A;  3DV8 A;  3HDD A;  1WHU A;  2CG4 A;  3L2W A;  3EQL F;  3B73 A;  1ON1 A;  2QQA A;  3HOY J;  3ECO A;  3HHG A;  2HPI A;  3OOU A;  1X1C A;  3DQV C;  1L3L A;  1SC7 A;  3CCS I;  4Y52 J;  1YX3 A;  1W36 D;  2GA2 A;  4KUM A;  2K3F A;  5LGT A;  1DP7 P;  1L0O C;  3S3O A;  1X2N A;  1FOW A;  2XRO A;  1NK3 P;  5EG0 B;  1DU0 A;  3RKX A;  3VDX A;  3ZR8 X;  4BH9 A;  3OYE A;  1ZGW A;  1QNT A;  2DA2 A;  5EEH A;  1B6A A;  4I76 A;  1IZ1 A;  3O6B B;  5F1J A;  4MFE A;  2ICW G;  4AIH A;  2QVO A;  4RGX A;  5GAH J;  3OYC A;  2HS5 A;  4A3B J;  1PP8 F;  1OPC A;  1BC7 C;  5IPA A;  3ZQ7 A;  2IA0 A;  3H92 A;  2XAQ A;  2BYV E;  3KP2 A;  3K70 C;  1ZAR A;  3FXO A;  2K5C A;  4Y4R A;  3MFK A;  4Y17 A;  1ZRE A;  4II3 A;  3K1M A;  3RCO A;  2MG4 A;  1HW2 A;  2CQK A;  1LFU P;  2HPM A;  4G94 A;  4RB3 C;  4FCY A;  2ELK A;  2Z99 A;  5D5W B;  4UVA A;  1QHG A;  3IP4 B;  5FO5 A;  5GTI C;  3VYS B;  1KQ0 A;  4H4K C;  3KLN A;  3NEU A;  3NWS A;  1NTC A;  5EEA A;  1FP1 D;  3FXU A;  3HG9 A;  2LMD A;  1M1E B;  3PJR A;  1D5Y A;  4F3Q A;  1ZG1 A;  2HFH A;  2HDD A;  4O5V A;  4NHJ A;  3LST A;  5D5X B;  3HB9 A;  2K9M A;  4Z6Y A;  1IN6 A;  3DFG A;  1T0F A;  4MIM A;  5HS7 A;  1WI9 A;  1W0U A;  1TW2 A;  4A12 A;  2HVS A;  1YW9 A;  2XGX A;  5J40 A;  4HBL A;  5DM6 F;  1F1Z A;  2XKO A;  3FHN A;  3M8F A;  3IH2 A;  3S1M J;  1TWH J;  1TQM A;  1DP3 A;  4BEH A;  1J9I A;  1E3P A;  2X1C A;  2FD5 A;  4GGG A;  1W7P A;  2QUF A;  1QGP A;  1G2H A;  4KN7 X;  3E5X A;  1YJ9 I;  4IX7 A;  3VOE A;  1TC3 C;  5HNH A;  1EV7 A;  2CW0 F;  3WTZ A;  4JOM A;  3R61 A;  3GW2 A;  1TT5 B;  2K4B A;  4E7S A;  2JN6 A;  2X51 A;  2G0E A;  3C2H A;  3BOQ A;  3ELK A;  5JR3 A;  1QZY A;  3LWF A;  4A69 C;  1ZHF A;  2CUE A;  2MA3 A;  5E17 F;  4Y13 A;  2GLO A;  2DK8 A;  3NWT A;  4HF2 A;  3QYE A;  1FSH A;  3D5S C;  1GV5 A;  2L9N A;  2VXZ A;  2ZBK A;  2UUZ A;  3JSO A;  1Y8R B;  3ONQ A;  2CGP A;  1DPU A;  2KFD A;  1H89 C;  3I58 A;  2IGO A;  4M9S A;  4UB8 C;  2V79 A;  2IA1 A;  2HVR A;  2QQ9 A;  2VJ4 A;  2DMP A;  1BJZ A;  3PNT A;  5FGM A;  4BJ5 C;  4GYG A;  2FMY A;  5F0F A;  2AXL A;  1RKT A;  3GWZ A;  2VBX A;  2ZXH A;  1K6O A;  3FWE A;  4LG0 B;  2YR2 A;  3LSP A;  2Z3Y A;  2XAF A;  3CO7 C;  3SXY A;  3PUB A;  2ECC A;  5FB2 A;  4EGY A;  3ZOB A;  3ERE D;  3C18 A;  3VOD A;  5IT9 K;  3ASN H;  4MHG A;  1WSU A;  3QOD A;  2ZFU A;  1RNL A;  3DBR B;  3GFJ A;  3S3M A;  1RR8 C;  1FPQ A;  2DCE A;  2G9W A;  5HS8 A;  2NVT J;  1LDJ A;  2V9K A;  5J8F A;  2ISY A;  1YTY A;  2MC3 A;  1ON2 A;  4N4N B;  2ELJ A;  1LQ1 A;  5HVQ C;  2L7F P;  2M2E A;  4A3F J;  5K7H A;  4ZYA A;  3EPZ A;  1VND A;  4EV0 A;  2R7O A;  4P96 A;  1WFX A;  3TED A;  2PI0 A;  1TLH B;  4L9T A;  3ZQF A;  2RN7 A;  4G12 A;  4XL9 A;  3BQY A;  1B59 A;  3BCA A;  2QGU A;  3LMM A;  2Y31 A;  1FSE A;  3BZK A;  5DUK A;  1DPR A;  2IS1 A;  2NVU B;  1ETY A;  2W1O A;  1ERD A;  1X4P A;  2ID3 A;  3BR1 A;  1USS A;  4XM3 A;  4ZYH A;  4DYQ A;  3S15 J;  3WU0 A;  3U9G A;  1R4N B;  3G1O A;  2NVX J;  3K4B A;  4BJ6 C;  1FNN A;  1O3Q A;  1IGN A;  3CTA A;  1Q1H A;  2FBI A;  1LVA A;  3A1Y A;  3Q9S A;  5FLV A;  2UXX A;  1ETO A;  1JI8 A;  3V7S A;  2AXT C;  3RSN A;  3VSL A;  1YJN I;  1J59 A;  2K9S A;  3JTG A;  2VJJ A;  3RKW A;  4MTD A;  4B48 A;  1ZLJ A;  2XB5 A;  3J80 Z;  1WZ2 A;  3SYT A;  1ZQ3 P;  3M1C A;  1OCP A;  4EJO A;  1FJL A;  3I71 A;  1T0F C;  2E7X A;  3L2Q A;  1OR7 A;  1MMG A;  1U5T A;  1EF4 A;  2BY0 A;  2EWN A;  2F4O B;  4RA2 A;  3W2A A;  4Q48 A;  1FTT A;  1FOX A;  1C0W A;  2KT0 A;  1R1U A;  2ZJQ F;  1I1S A;  3ASO H;  3R0A A;  3OYL A;  2GBY A;  1BIA A;  3K4N A;  3HRM A;  5ILU A;  2DOD A;  3LSR A;  4CO8 A;  4DGW B;  1R7J A;  1YFH A;  4XKC A;  3QPL A;  3J7Z I;  2IS4 A;  1R00 A;  2TCT A;  3M1E A;  2F6C A;  1WJC A;  3H3V K;  3HKZ N;  4MQV A;  4B44 A;  1B72 A;  1IRZ A;  2X1D A;  3JRI A;  1UHS A;  2R7T A;  1V5G A;  1J0R A;  5KK1 A;  2RGV A;  3LQQ A;  1S7O A;  4LK1 F;  1F5T A;  2R7Z J;  2A5W A;  2GXB A;  5B66 C;  2ZJR F;  1HF0 A;  2KIS A;  4KIG A;  3JRH A;  3P7N A;  2BY2 A;  1V4R A;  1R22 A;  3CF2 A;  4M6Y A;  3OSF A;  2X1E A;  2K9L A;  2B7E A;  5DCM A;  2CV1 A;  1REP C;  4N9I A;  1FOY A;  4MLO A;  4OIN F;  5KAI C;  2K02 A;  2FXA A;  2EZI A;  4U0V A;  3SHF A;  2COM A;  3BG3 A;  1XGO A;  3E97 A;  4HZF A;  1IV8 A;  2NS7 A;  2M1B A;  1W7P B;  1SFO J;  2RQQ A;  1MBG A;  3DPU A;  2NOG A;  1QU3 A;  5C4X J;  1Z3Y A;  2EIJ H;  4IVN A;  2XGE A;  2EFW A;  4FHT A;  3I56 I;  5F27 A;  1YX5 A;  4EMS A;  4ENM A;  1I3Q J;  3BJO A;  3ZQH A;  1LDD A;  2LKP A;  3K4C A;  1G4D A;  5GP9 A;  3L1P A;  3SFI A;  2AO9 A;  3EUH C;  2LKS A;  1R9T J;  1KYW A;  3HPG A;  3CCE I;  2YPR A;  1VF9 A;  3WU1 B;  2L7Z A;  5K5Q A;  2B0L A;  4RB0 A;  5DS9 A;  4B47 A;  4PCQ A;  3FBN B;  4BXF A;  5DD4 A;  2B9S A;  2KLO A;  3M3Y J;  1HW5 A;  4ABZ A;  2B63 J;  1W36 C;  1QRY A;  2KQR A;  3H9J A;  3PSI A;  1IN8 A;  2LDU A;  3QOP A;  4NBQ A;  4B43 A;  1QHH D;  1VQ4 I;  1ZGA A;  4ZJZ A;  2V6E A;  4FX0 A;  3HRT A;  3PUF A;  3NAU A;  3ZMU A;  1K61 A;  1F43 A;  3JTH A;  3FX3 A;  2KZV A;  5IYD J;  1TWF J;  3LA7 A;  3DU5 A;  2W24 A;  4A5M A;  1MNM C;  3HM5 A;  5KHD A;  3GEZ A;  2GOM A;  2RAE A;  1FY7 A;  2ZO4 A;  5FJ8 J;  4J00 A;  5BPI A;  3P9K A;  1XB4 A;  4C2T A;  1MH3 A;  3GTP J;  3CES A;  4PDK A;  1XSX A;  5F64 A;  1U6G A;  2RDP A;  4H0E A;  3CP8 A;  4RGR A;  2MH2 A;  4M9Z A;  1X1D A;  2BGC A;  2VQH A;  5F6F A;  4B3X A;  3CMA I;  3RYP A;  2V1N A;  1IXC A;  2FQ3 A;  1SD5 A;  4KA4 A;  3VYR B;  4V19 K;  3GFL A;  4DQ2 A;  1AOY A;  4BQO A;  2DYR H;  2EB7 A;  4P1W A;  3I3L A;  4EEF G;  2LD5 A;  1BI2 A;  1XTA A;  1JTX A;  2LLK A;  1UFM A;  4RB1 A;  1AU7 A;  1LKX A;  4KIS A;  1KU7 A;  1IN4 A;  1QPM A;  1WI3 A;  3DEE A;  3I54 A;  1WJF A;  1ZRF A;  4ZDO A;  1E0E A;  5D5U B;  4Y33 A;  3ZP5 A;  2XAG A;  4X0G A;  4PK4 A;  3LA3 A;  2A3S A;  1WVR A;  3T8R A;  2W7N A;  4ZTJ A;  3ABT A;  2EJR A;  2KRF A;  4DBQ A;  4CXF A;  5L3E A;  2IT0 A;  1MIJ A;  1U2W A;  1VQP I;  2X4H A;  1U5T B;  4HV5 A;  1ETV A;  2FNA A;  4XRM A;  1K79 A;  5DV5 A;  5HS9 A;  4ANJ A;  2H8W A;  2KIU A;  2Z16 A;  1N75 A;  3HXL A;  4ZYE A;  1BA5 A;  2KRH A;  5H20 A;  2XSD C;  1R1V A;  1E17 A;  2M9H A;  3WTU C;  3TO7 A;  3AFH A;  2VAS A;  4DIQ A;  2VOP A;  2VKV A;  5ICE A;  4RLQ A;  2XPW A;  1IV6 A;  1U3E M;  4IKF A;  4AU7 A;  2K86 A;  3ZQI A;  1H9G A;  4IOA F;  3GTL J;  2FBH A;  4HNU A;  2XIG A;  2DA4 A;  4A6D A;  4YIR X;  3LFK A;  1TT0 A;  4PSW A;  4YFN F;  4AYB A;  1KU2 A;  3M8J A;  2CMP A;  1ZGJ A;  3E1S A;  4G6D A;  3OYA A;  3DPT A;  3KP5 A;  2F2E A;  3GUD A;  1OLT A;  5DCM B;  4ZDP A;  2E34 A;  2FU4 A;  4RMN A;  2CJJ A;  2XF7 A;  1IO2 A;  2HQN A;  5BNG A;  2V9V A;  4OOI A;  5E1Z B;  4EJT A;  1FYM A;  2DO7 A;  3IKV A;  2IJL A;  2L9R A;  2W00 A;  2DT5 A;  3I64 A;  3OYM A;  1XMK A;  4ITV A;  4D0P A;  2WAD A;  5ICC A;  1BN5 A;  4G9Y A;  1BI3 A;  1NG7 A;  1BI0 A;  3SQN A;  4WXH A;  3JAM Z;  1MBK A;  2JUG A;  3S2H J;  2YU3 A;  2DPD A;  2X48 A;  2ZSI B;  2M5W A;  2GZW A;  2P6S A;  2DOE A;  4ZC3 A;  2E2I J;  2P7C B;  2DMN A;  3WTX C;  3IRR A;  1WH5 A;  3D5R C;  3FF5 A;  2WB1 N;  4UUT A;  4CUG A;  2HDW A;  1S8N A;  3A0B C;  2HTJ A;  3I9V 2;  4PFO A;  3H1C A;  4MEX F;  5EYR A;  1FBQ A;  2GM4 A;  3KX2 A;  4W1U A;  1ZK8 A;  2M30 A;  3C1D A;  2HI3 A;  3FKJ A;  1JGS A;  3HOX J;  2FOW A;  1ETW A;  4JBA A;  4V2F A;  4I6Z A;  2C6Y A;  2L02 A;  3PM1 A;  4AM3 A;  5LEK A;  5JVT A;  2DQL A;  2XAS A;  1DGW Y;  1SFU A;  2WAE A;  2LY2 A;  4B8X A;  3V4G A;  4L0Z B;  2KL4 A;  1Z6R A;  1UCR A;  1RI7 A;  5EGO A;  3A01 B;  2E60 A;  2RVC A;  3SDG A;  4HDU A;  5ED4 A;  2CUF A;  1DDN A;  4UY8 I;  3U2R A;  1DGR M;  2LRE A;  2BY1 A;  1X3W B;  2WAQ A;  2Y0S N;  5EZG A;  2P6T A;  4B09 A;  1RRJ A;  1X58 A;  1IW7 F;  3OIQ A;  4O6J A;  1IDZ A;  4RGU A;  5BPD A;  3CCM I;  4D5C A;  1U78 A;  1A31 A;  2V1D A;  1SAN A;  4CSW A;  4IOC F;  1UST A;  3ECH A;  2ZB9 A;  3CLQ A;  4BHB A;  2LOO A;  5GAE J;  2VN2 A;  4JP0 A;  4PZJ A;  3SFZ A;  2KP6 A;  4RDU A;  2M8G X;  1TW3 A;  4EAT A;  3TKY A;  3PL8 A;  3FXR A;  2K27 A;  2XRN A;  4XRS A;  2LFB A;  2R4G A;  3WTV C;  4XID A;  1MH4 A;  3I4M J;  1PUF B;  3W6J B;  1VFC A;  3C3W A;  3QP6 A;  4ZZL A;  4OIO F;  4GCV A;  1GXP A;  2DMU A;  4EJW A;  2O3F A;  2Z1D A;  4D7M A;  3RTR A;  2JRT A;  4KT6 A;  3CC4 I;  4KNY A;  2PMH A;  3MKW B;  1FMV A;  3HKZ A;  4NC6 A;  4I01 A;  2P5K A;  3OYI A;  4IL6 C;  2JSC A;  2MW8 A;  3QWL A;  1HOM A;  1YS7 A;  3E6D A;  1VQM I;  5KAF C;  2GQQ A;  1UEL B;  5K5O A;  5J3L A;  4BDY A;  1MD0 A;  2E36 A;  4L9N A;  3BR2 A;  4KDP A;  3I4N J;  3OMY A;  1MBJ A;  2DFE A;  1D1B A;  3NAR A;  4WCG A;  1J7K A;  2A6H F;  5HLH A;  2E35 A;  2JZY A;  2LKX A;  3WGI A;  4XLN F;  1OYW A;  4EM1 A;  5JHF A;  1U8R A;  3W6K B;  2OD5 A;  2QYO A;  5GAD J;  1FZP B;  2BZT A;  4N0B A;  2CQN A;  4ENN A;  4FAS D;  3CLO A;  5E1X A;  3OL3 A;  3PIP F;  3WE3 A;  3BTC A;  5HNF A;  2EH3 A;  3KE2 A;  1KQ8 A;  1LJ9 A;  3DKX A;  5HDK A;  1Y8Q B;  1W4M A;  3FZV A;  3FK6 A;  4WF2 A;  3BG5 A;  3NRV A;  1YS6 A;  4LG0 A;  1A6Q A;  2MD5 A;  1O4X A;  3CDH A;  2HTS A;  3RZD J;  5HLI A;  1TWA J;  3J7Y J;  3O8H A;  4CH7 A;  2M4G A;  3EUA A;  5DCF A;  4NDL A;  1FOK A;  3MZY A;  4I7H A;  2UZK A;  3CCJ I;  5LHI A;  1Y39 A;  5IYC J; 
#chains in the Genus database with same CATH homology
 1S6L A;  1LNW A;  2VON A;  3ISP A;  1ZAO A;  5D8L B;  1Z7U A;  1R36 A;  4A0Y A;  1FYK A;  3FM3 A;  3FXQ A;  1BM9 A;  4HQM A;  2FOK A;  2PEX A;  3E5U A;  1B9M A;  5LBQ A;  3N4M A;  1R23 A;  2ZNZ A;  1TNS A;  2VT3 A;  2D45 A;  3BJ6 A;  4IF4 A;  4RAZ A;  3D0S A;  1FX7 A;  2PG4 A;  4KIB A;  1MJB A;  1EH6 A;  1XDU A;  3OOP A;  2QZ8 A;  1KU3 A;  3FM5 A;  3KP3 A;  2H09 A;  3BY6 A;  3KEO A;  4CHU A;  2PN6 A;  4ZYG A;  2FF4 A;  1E2X A;  1G3S A;  3MEX A;  2XVC A;  2IW5 A;  4UVC A;  2EA2 A;  5ERI A;  4I09 A;  2YSR A;  4UXN A;  4G8X A;  4JQF A;  1MDM A;  1BIB A;  2MH9 A;  1T6S A;  4P5O A;  1V3F A;  3BDD A;  4ESJ A;  2Z5U A;  1O7F A;  2DTR A;  2NYX A;  1IXR C;  1R5H A;  4KIF A;  4I02 A;  3ZMT A;  2G7H A;  4G7H F;  4R79 A;  2A6E F;  4CDG A;  1ZRC A;  2DAO A;  1TQI A;  3ABU A;  3E3V A;  2VC1 A;  2STT A;  1W5T A;  3D5L A;  3ZN1 A;  2X0L A;  1Z05 A;  5L3F A;  1J5Y A;  4M6X A;  1IN7 A;  2LNB A;  4FT8 A;  2UWM A;  3IC7 A;  2HKX A;  4ESF A;  1K7A A;  3WTS C;  5IT9 Z;  1HST A;  1I5Z A;  1G3Y A;  1R58 A;  1T39 A;  1CF7 B;  1YO5 C;  3OV8 A;  1FWZ A;  4BNC A;  5FFZ A;  5AON A;  2DU9 A;  4YFK F;  3DEU A;  1T98 A;  3EET A;  1FLI A;  4A0Z A;  1HBX G;  1B1B A;  2J5O A;  2JT1 A;  4L5J A;  3ZMD A;  1G3T A;  1D8K A;  4A0X A;  4EJU A;  4UUV A;  1KU9 A;  4XSX F;  1ZG3 A;  3EDP A;  2K7L A;  4A6E A;  2VE9 A;  1F4K A;  5HDN A;  4I98 B;  3FHZ A;  3WG9 A;  3GXO A;  4IRH A;  3GF2 A;  2KJB A;  1MZB A;  3F8M A;  1HSJ A;  1R1T A;  4CYD A;  5H6R A;  3F8N A;  2P5L C;  2Q8K A;  1I1G A;  4LFU A;  1HW1 A;  1NHA A;  1SFE A;  2OZ6 A;  4LLN A;  1MDM B;  4NB5 A;  2YX7 A;  1PP7 U;  3EYY A;  3NQO A;  3FMS A;  3QPH A;  4PGG A;  2BEO A;  2DK5 A;  1D3Y A;  1OMI A;  3KFW X;  2BV6 A;  4FX4 A;  4HX8 A;  5EEG A;  3HRU A;  2QQB A;  2HKO A;  1B4A A;  1WWX A;  1K78 B;  2XV4 S;  2EV6 A;  2GIV A;  1XD7 A;  3CJN A;  3VFZ A;  3E6M A;  1WKM A;  1OYI A;  4HF1 A;  2LF8 A;  2V1X A;  4YFX F;  1B9N A;  1O3R A;  3ML6 A;  4BHC A;  3T1B A;  5L3G A;  2LF7 A;  2FSW A;  5BS6 A;  3F6V A;  3REO A;  3GFI A;  4IPA A;  5TRD A;  2QLZ A;  4TV7 A;  1H9T A;  2EFN A;  5LGN A;  3WOD F;  4OIQ F;  3CUQ A;  1KQ9 A;  2IPQ X;  1P2F A;  3DKW A;  3MCZ A;  1HKQ A;  2E7W A;  2QWW A;  2YX4 A;  4KN4 X;  2UXN A;  2FBK A;  4LJZ F;  2RKH A;  4OMY A;  2ZNY A;  3WGG A;  4BXU A;  4LD5 A;  2PJP A;  4UV8 A;  2XHK A;  2Y0M A;  4U0Y A;  1U5T C;  2PMU A;  2STW A;  1YG2 A;  4ON0 A;  4R1H A;  1BJA A;  3MQ0 A;  1UHM A;  4LLL A;  4A5N A;  3U1D A;  1G6N A;  3RI4 A;  1XGN A;  1Z1D A;  4WXD A;  2FEZ A;  4RGS A;  3RIR A;  1FT9 A;  4MQ9 F;  5LLQ A;  4HX7 A;  4I0A A;  4GO1 A;  5K1Y A;  2D2W A;  5D8K B;  4HLY A;  3V8J A;  5FLX K;  3F22 A;  3WGH A;  1SMT A;  4K2E A;  2Z33 A;  2DQR A;  1BBY A;  2FE3 A;  3IKT A;  5E20 A;  3QP5 A;  2O03 A;  1RZ4 A;  4L5I A;  1TTY A;  1RUN A;  4ENK A;  4ZZD A;  5ILV A;  1WQ2 A;  2R7F A;  2VBY A;  3TQN A;  3KLO A;  2HYG D;  2V6C A;  3BPV A;  2F5C A;  1Z6T A;  2EV0 A;  5FFX A;  4N9H A;  2EA4 A;  4OU0 A;  1XCV A;  2WV0 A;  1TNT A;  2ZME A;  2DLL A;  3J81 K;  3L7W A;  2RV8 A;  3QRF F;  1GXQ A;  2J5P A;  2DPU A;  3HUG A;  2Z9O A;  3QU6 A;  2DW4 A;  3IWZ A;  4L0Y B;  2AS5 F;  3KZZ A;  3JAM K;  2L4M A;  3DF8 A;  4GXO A;  1Z91 A;  3CUQ B;  3V7R A;  1WRJ A;  2XAH A;  2NRA C;  1P92 A;  5CVV A;  3RKY A;  4G6Q A;  3BJA A;  4OMZ A;  3T5X A;  2ELH A;  2LSO A;  2XKP A;  1XDS A;  1LEB A;  5DEQ A;  1Z9C A;  1QQI A;  3AAF A;  3TO6 A;  1HKS A;  4KFC A;  4LLG F;  4WX9 A;  3SZT A;  1ZG5 A;  3Q5F A;  4IJA A;  2JPC A;  3EYI A;  1PUE E;  4M74 A;  3MZH A;  1SMY F;  4EM2 A;  1AWC A;  3VEP A;  3E6C C;  2O0Y A;  3M7G A;  3I0T A;  2RC4 A;  4ASN A;  4KIC A;  4ZH4 F;  1JXS A;  5J8C A;  3O2P E;  6PAX A;  5KVR A;  2DI3 A;  4F7Z A;  2Y75 A;  2IP2 A;  3FMQ A;  2ACJ A;  2HR3 A;  1KYZ A;  3K9T A;  2HOE A;  1ZYR F;  5BOX A;  1YQA A;  1T38 A;  1P4X A;  4BYY A;  3KP4 A;  3H3Z A;  5E8I A;  3WE2 A;  1SD4 A;  3G3Z A;  3KET A;  3VB2 A;  3K1P A;  4BAY A;  3TO9 A;  1HQC A;  3IHU A;  3IWF A;  4P9F A;  3N97 A;  4GYI A;  5FD6 A;  4KMU X;  3KEQ A;  3HOT A;  4YII A;  4RB2 C;  2ADU A;  5A2Q K;  3E6B A;  2ZME B;  2Q2E A;  4PGH A;  3O3K A;  2P4W A;  4IXA A;  1P4A A;  3I59 A;  3HOS A;  4EGZ A;  5CVR A;  3LAJ A;  4EQQ A;  1KA8 A;  1O57 A;  1YLF A;  1CF7 A;  5E18 F;  5CVU A;  1RUO A;  2PQ8 A;  2W25 A;  3ZN0 A;  2HEO A;  5DYM A;  4AWX B;  2M87 A;  4OIR F;  2F5D A;  3QAH A;  3DPL C;  4G7O F;  5LHG A;  4M71 A;  3RDI A;  3R6S A;  4UV9 A;  1KGS A;  4L9J A;  2K4J A;  5D4R A;  3GX4 X;  4UHT A;  1ULY A;  2O8X A;  1TQP A;  4WK8 F;  2H27 A;  2IRF G;  3S2W A;  1R5G A;  1XSV A;  2CO5 A;  2MLK A;  4Q4Z F;  2WTE A;  2M8E A;  1O7L A;  2XAJ A;  2OQG A;  3L2C A;  3SZP A;  3HYI A;  4LGW A;  1IRF A;  2CWE A;  1BI1 A;  4G7Z F;  4S04 A;  3BP8 A;  2ZKZ A;  4HQE A;  4MEY F;  2A61 A;  3GVA A;  3H3U A;  2A68 F;  3PQK A;  3RJP A;  1K78 A;  4HDV A;  1FYL A;  3L09 A;  3F6O A;  3HHH A;  2CFX A;  5E8G A;  1IUY A;  4MNU A;  5DUI A;  4Q47 A;  2JPB A;  5LRR A;  2WC2 A;  4U7D A;  3J7A O;  2W84 A;  4ZYD A;  3RPU A;  3K69 A;  5L3D A;  2BBY A;  4XBF A;  3GZ5 A;  4CGZ A;  2WWY A;  5ICG A;  3IL2 A;  3P9I A;  4AIK A;  2HDC A;  1YW8 A;  1ZH5 A;  4LMY A;  3WTY C;  2JTV A;  1UB9 A;  4Y15 A;  5JFR A;  5JI6 A;  3LAP A;  2FRH A;  1JHH A;  1OKR A;  2V1U A;  3I59 B;  4AVP A;  4A2U A;  5AIP A;  1Y0U A;  1FBS A;  3DXJ F;  3M8E A;  1STZ A;  3GLX A;  4L9V A;  2L54 A;  5DD8 A;  1D5V A;  2FA5 A;  2H94 A;  2HGC A;  2W57 A;  1HXD A;  4Q5S F;  3LQR A;  2EV5 A;  3IRQ A;  5LGU A;  3K2Z A;  3C7J A;  3EUH A;  2KJC A;  2P5V A;  3MWM A;  1CGP A;  5CYV A;  5ILS A;  2ISZ A;  5CVI A;  4RS8 A;  1H0M A;  2KKO A;  4KT5 C;  2QEN A;  2R7D A;  3KP6 A;  2MLG A;  1YIO A;  3PQJ A;  4MGR A;  5LEJ A;  4XLP F;  2ETH A;  1P4W A;  3HIF A;  1YW7 A;  1F9N A;  3KCC A;  5CJ9 A;  3J80 K;  5ICF A;  1FC3 A;  2IA2 A;  3QU3 A;  3I4P A;  4M72 A;  4DNC A;  5BMZ A;  2KIM A;  2RNJ A;  4HV6 A;  5AIQ A;  3GFM A;  1GHC A;  2PLY A;  4XRF A;  3L9F A;  4HF0 A;  1LDK B;  3T0Y A;  3LA2 A;  2D1V A;  1HKT A;  4KMF A;  3V7C A;  1O3T A;  2ZFW A;  1J2X A;  1P6R A;  5LHH A;  2BE5 F;  2PFB A;  3I53 A;  4EM0 B;  2E1C A;  3T8T A;  5D4S A;  4NQW A;  1JHF A;  2M45 A;  4HA8 A;  3ZMV A;  1GVJ A;  5HOO A;  4CZZ A;  2VOD A;  2ZJ2 A;  4IRG A;  4M9X A;  4JK1 X;  4O3M A;  4AD9 A;  2F5E A;  2GAU A;  3R0J A;  3TDZ C;  3CUO A;  4U88 A;  3BRO A;  4WWC A;  4UNO A;  2W85 A;  4KYW A;  1BC8 C;  4EJV A;  1XN7 A;  3HRS A;  2OA4 A;  1A04 A;  4M73 A;  2H6C A;  3GO5 A;  5BQT A;  2H6B A;  2DFI A;  1MGT A;  3P9C A;  1ZRD A;  1S29 A;  2EK5 A;  4LB5 A;  5DDG A;  3ULQ B;  4P9U A;  5F1R A;  4IHS A;  1XGS A;  3GYH X;  4BHP A;  3DP7 A;  2VT2 A;  2EFP A;  1G3W A;  1SD7 A;  2A07 F;  1MJ9 A;  2CYY A;  2OU2 A;  1ODD A;  4XSZ F;  5D6F A;  3ZPL A;  5D5V B;  3R60 A;  4HLX A;  3F3X A;  5L3C A;  1SD6 A;  3RYR A;  3V8K A;  1DUX C;  1IN5 A;  3BZ6 A;  2VE8 A;  2P7V B;  5FLX Z;  4LK0 F;  1SAX A;  4U0W A;  1QZZ A;  3F8C A;  2OQR A;  3ROU A;  5J6X A;  1IF1 A;  1EH8 A;  2RQP A;  3QPT A;  2E1N A;  3CO6 C;  3V8L A;  4E70 A;  5FD5 A;  1IRG A;  3WTT C;  3F8F A;  1X3U A;  2HQR A;  4I2O A;  2PBI A;  2DBB A;  2NS0 A;  4HOB A;  5E1W A;  2MBF A;  2NNY A;  2Y48 A;  1YYV A;  2R3S A;  2XUB A;  4R8H A;  5IT3 A;  5LRS A;  3CUQ C;  3J81 Z;  5CVJ A;  2QM3 A;  1MJA A;  2P8T A;  2QBY A;  2ESH A;  1LB2 A;  2O6G E;  1FP2 A;  3ZMS A;  3KZY A;  2Q0O A;  4LB6 B;  3TOA A;  1VTN C;  5L3B A;  3GZ6 A;  4WXC A;  4ENJ A;  3BWG A;  1S7A A;  2OAZ A;  3K0L A;  1UHW A;  4YIF A;  2EFO A;  2FNP A;  1EH7 A;  3COA C;  1TBX A;  4U7B A;  3B02 A;  2GA1 A;  4EVI A;  1I6X A;  1W5S A;  3KP7 A;  4MTE A;  2O61 A;  5HLG A;  1J75 A;  2CSO A;  2EFQ A;  1LEA A;  4HX4 A;  4QWQ A;  3E5Q A;  2L01 A;  2OBP A;  3I5U A;  4QLC U;  1OYY A;  3HSF A;  3Q9V A;  4S05 A;  4ESB A;  3BPX A;  2HWV A;  1FBU A;  3TOB A;  3MAJ A;  4ETS A;  1O3S A;  5H6Q A;  1I27 A;  5TJJ A;  3F23 A;  4L18 B;  3TDU C;  4HW0 A;  2GXG A;  2VBZ A;  1XSD A;  4I0B A;  5K5R A;  1JE8 A;  1ZLK A;  4Z2Y A;  1S3J A;  2FML A;  1IXS B;  2OZU A;  2F5F A;  4RAY A;  1QO0 D;  2KIF A;  2D1H A;  2L3D A;  2A69 F;  1ONV A;  3JW4 A;  1XGM A;  1T2K A;  1PDN C;  1SFX A;  2VBW A;  3RPQ A;  3G73 A;  4YG2 F;  3ZMZ A;  3HTU A;  1IAW A;  1W7P D;  1MKM A;  3M9A A;  5HDG A;  2GWR A;  2ESN A;  2NNN A;  5CLS A;  2VOO A;  3F8B A;  5D6E A;  2NAZ A;  3L00 A;  3K1N A;  5A2Q Z;  2VC0 A;  3JSP A;  2A5Y B;  2ZCW A;  3FMR A;  3HTS B;  5JHU A;  2HZT A;  3TGN A;  4HYE A;  1QBJ A;  1ZN2 A;  1XCB A;  3HSE A;  2TDX A;  2QBY B;  3PFI A;  4P55 A;  1BOA A;  1D8J A;  1XMA A;  4HAM A;  4UVB A;  4IHT A;  4OIP F;  1RIO H;  3F72 A;  2ZXJ A;  2IVM A;  4AIJ A;  2HYF A;  3HSR A;  4IRI A;  4CIC A;  3R4K A;  2L4A A;  3F21 A;  2G7U A;  4BQA A;  3WTW C;  3DV8 A;  2CG4 A;  3EQL F;  3B73 A;  1ON1 A;  2QQA A;  3ECO A;  3HHG A;  3DQV C;  1L3L A;  2GA2 A;  4KUM A;  5LGT A;  1DP7 P;  1L0O C;  2XRO A;  3RKX A;  4BH9 A;  1QNT A;  5EEH A;  1B6A A;  1IZ1 A;  3O6B B;  4AIH A;  2QVO A;  4RGX A;  2HS5 A;  1PP8 F;  1OPC A;  1BC7 C;  3ZQ7 A;  2IA0 A;  3H92 A;  2XAQ A;  2BYV E;  3KP2 A;  1ZAR A;  3MFK A;  4Y17 A;  1ZRE A;  3K1M A;  1HW2 A;  2CQK A;  4G94 A;  4RB3 C;  2Z99 A;  5D5W B;  4UVA A;  5FO5 A;  1KQ0 A;  3KLN A;  3NEU A;  1FP1 D;  3FXU A;  1ZG1 A;  2HFH A;  4O5V A;  4NHJ A;  3LST A;  5D5X B;  1IN6 A;  3DFG A;  1T0F A;  5HS7 A;  1WI9 A;  1TW2 A;  4A12 A;  1YW9 A;  2XGX A;  4HBL A;  1F1Z A;  2XKO A;  3M8F A;  1TQM A;  1J9I A;  4GGG A;  1W7P A;  2QUF A;  1QGP A;  4KN7 X;  3E5X A;  3VOE A;  1EV7 A;  2CW0 F;  3WTZ A;  3R61 A;  3GW2 A;  2K4B A;  3ELK A;  3BOQ A;  5JR3 A;  1QZY A;  3LWF A;  1ZHF A;  2MA3 A;  5E17 F;  4Y13 A;  2DK8 A;  4HF2 A;  1FSH A;  2VXZ A;  2ZBK A;  3JSO A;  2CGP A;  1DPU A;  3I58 A;  4M9S A;  2V79 A;  2IA1 A;  2QQ9 A;  5FGM A;  4GYG A;  2FMY A;  2AXL A;  3GWZ A;  2VBX A;  1K6O A;  3FWE A;  4LG0 B;  2YR2 A;  2Z3Y A;  2XAF A;  3CO7 C;  3SXY A;  5FB2 A;  4EGY A;  3ERE D;  3C18 A;  3VOD A;  5IT9 K;  1WSU A;  4MHG A;  1RNL A;  3GFJ A;  1FPQ A;  2G9W A;  5HS8 A;  1LDJ A;  5J8F A;  2ISY A;  1YTY A;  2MC3 A;  1ON2 A;  1LQ1 A;  5HVQ C;  4EV0 A;  4P96 A;  2PI0 A;  1TLH B;  4L9T A;  2RN7 A;  1B59 A;  1FSE A;  5DUK A;  1DPR A;  1USS A;  4ZYH A;  3WU0 A;  3U9G A;  1FNN A;  1O3Q A;  3CTA A;  1Q1H A;  2FBI A;  1LVA A;  3Q9S A;  2UXX A;  3V7S A;  1J59 A;  3JTG A;  3RKW A;  4MTD A;  1ZLJ A;  3J80 Z;  4EJO A;  3I71 A;  2E7X A;  1OR7 A;  1U5T A;  2EWN A;  4Q48 A;  1C0W A;  1R1U A;  1I1S A;  3R0A A;  1BIA A;  3HRM A;  5ILU A;  4CO8 A;  1R7J A;  1YFH A;  1R00 A;  3M1E A;  4MQV A;  1J0R A;  5KK1 A;  2RGV A;  3LQQ A;  1S7O A;  4LK1 F;  1F5T A;  2GXB A;  4KIG A;  3P7N A;  1V4R A;  1R22 A;  4M6Y A;  5DCM A;  1REP C;  4N9I A;  4OIN F;  2K02 A;  2FXA A;  4U0V A;  3SHF A;  2COM A;  1XGO A;  3E97 A;  4HZF A;  2M1B A;  1W7P B;  4IVN A;  2EFW A;  4FHT A;  4EMS A;  4ENM A;  3BJO A;  1LDD A;  2LKP A;  1G4D A;  1KYW A;  2YPR A;  3WU1 B;  5K5Q A;  2B0L A;  4RB0 A;  4PCQ A;  5DD4 A;  1HW5 A;  1IN8 A;  2LDU A;  3QOP A;  1ZGA A;  4FX0 A;  3HRT A;  3ZMU A;  3JTH A;  3FX3 A;  3LA7 A;  2W24 A;  4A5M A;  3GEZ A;  1FY7 A;  2ZO4 A;  5BPI A;  3P9K A;  1XB4 A;  4PDK A;  1XSX A;  5F64 A;  1U6G A;  2RDP A;  4H0E A;  4RGR A;  2MH2 A;  4M9Z A;  2BGC A;  5F6F A;  3RYP A;  1IXC A;  2FQ3 A;  1SD5 A;  4KA4 A;  3GFL A;  4DQ2 A;  1AOY A;  2EB7 A;  1BI2 A;  1UFM A;  4RB1 A;  1KU7 A;  1IN4 A;  1QPM A;  3I54 A;  1ZRF A;  5D5U B;  3ZP5 A;  2XAG A;  3LA3 A;  2A3S A;  3T8R A;  3ABT A;  2EJR A;  2KRF A;  4CXF A;  5L3E A;  2IT0 A;  1U2W A;  2X4H A;  1U5T B;  4HV5 A;  2FNA A;  1K79 A;  5DV5 A;  5HS9 A;  2KIU A;  4ZYE A;  5H20 A;  1R1V A;  1E17 A;  3WTU C;  3TO7 A;  2VOP A;  5ICE A;  1U3E M;  2K86 A;  1H9G A;  2FBH A;  2XIG A;  4A6D A;  3LFK A;  4YFN F;  1KU2 A;  4G6D A;  1ZGJ A;  3DPT A;  3KP5 A;  2F2E A;  3GUD A;  5DCM B;  2FU4 A;  2HQN A;  2V9V A;  4OOI A;  5E1Z B;  4EJT A;  1FYM A;  2DO7 A;  3IKV A;  2IJL A;  2DT5 A;  3I64 A;  1XMK A;  4D0P A;  5ICC A;  1BN5 A;  4G9Y A;  1BI3 A;  1BI0 A;  3SQN A;  4WXH A;  3JAM Z;  2YU3 A;  2DPD A;  2M5W A;  2GZW A;  2P6S A;  2P7C B;  3WTX C;  3IRR A;  3FF5 A;  1S8N A;  4MEX F;  2HTJ A;  1FBQ A;  2M30 A;  3C1D A;  1JGS A;  4JBA A;  2C6Y A;  2L02 A;  5LEK A;  5JVT A;  2DQL A;  2XAS A;  1SFU A;  4B8X A;  3V4G A;  4L0Z B;  1Z6R A;  1UCR A;  1RI7 A;  2RVC A;  4HDU A;  5ED4 A;  1DDN A;  3U2R A;  2P6T A;  4B09 A;  1IW7 F;  4O6J A;  4RGU A;  5BPD A;  1U78 A;  2V1D A;  1UST A;  3ECH A;  4BHB A;  2VN2 A;  4PZJ A;  3SFZ A;  1TW3 A;  3TKY A;  3FXR A;  2K27 A;  2XRN A;  3WTV C;  3W6J B;  3C3W A;  3QP6 A;  4ZZL A;  4OIO F;  4GCV A;  1GXP A;  4EJW A;  2O3F A;  3RTR A;  2JRT A;  4KNY A;  2PMH A;  4I01 A;  2P5K A;  2JSC A;  1YS7 A;  3E6D A;  2GQQ A;  5K5O A;  1MD0 A;  4L9N A;  4KDP A;  4WCG A;  1J7K A;  2A6H F;  5HLH A;  2JZY A;  3WGI A;  4XLN F;  1OYW A;  4EM1 A;  1U8R A;  3W6K B;  2OD5 A;  2QYO A;  1FZP B;  4N0B A;  4ENN A;  3CLO A;  5E1X A;  3WE3 A;  3KE2 A;  1KQ8 A;  1LJ9 A;  5HDK A;  1W4M A;  3FZV A;  4WF2 A;  3NRV A;  1YS6 A;  4LG0 A;  2MD5 A;  3CDH A;  2HTS A;  5HLI A;  5DCF A;  1FOK A;  3MZY A;  4I7H A;  2UZK A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...