3WE3A

Structure of blm rqc domain bound to an arsenate ion
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
121
structure length
121
Chain Sequence
TRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQAIAYVMLGNKAQTVLNGNLKVDFMETEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bloom syndrome protein
publication title Structure of the RecQ C-terminal Domain of Human Bloom Syndrome Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3we3A00
2GAUA 3EQLF 3KEQA 4KA4A 3GVAA 2RDPA 4S04A 4Q47A 1W7PB 4HAMA 4RGXA 4Q48A 4RAZA 1S6LA 4BXUA 4M9ZA 2H94A 1YS6A 2XAJA 3WTUC 4CDGA 2CGPA 4ESFA 3Q5FA 3P9CA 4IRHA 3ZMDA 3CJNA 5IT3A 5L3CA 3ZN1A 3KCCA 2NNYA 4ENMA 4XLPF 4A12A 1FLIA 1BI1A 4N9IA 2CYYA 4YFKF 5LHGA 5A2QZ 3ISPA 4BAYA 3QU3A 2HDCA 3HRMA 1OYWA 1BM9A 3T8RA 5D8LB 4LLLA 4H0EA 3ZMVA 3I59B 5FFXA 4WK8F 1FYKA 5D5VB 3DEUA 4HV6A 4JBAA 3KZYA 1FYLA 3ULQB 1WRJA 3E5XA 2XKOA 1I5ZA 4XBFA 3BJ6A 1IN7A 4UV9A 1R58A 3P9KA 2WV0A 1S8NA 2RN7A 1LDKB 2L01A 2RGVA 4UVBA 4AD9A 4JQFA 4L5IA 4HQEA 2OBPA 1GVJA 1ONVA 4ZYEA 3IWZA 3SZPA 3V7SA 3E6MA 1OPCA 1W7PA 4I0AA 4XSZF 3LWFA 5TJJA 3C3WA 1Z9CA 1QQIA 5CYVA 1KU7A 4U0VA 3GZ5A 3K9TA 4UVAA 3F8MA 3QPHA 2V1XA 2HZTA 5J8CA 5K5QA 1MJBA 2IA0A 3KLOA 3JSPA 5FD5A 5FLXK 4EJOA 2Y48A 1EV7A 4N9HA 2O0YA 4HX4A 1HSTA 3T8TA 1R36A 5HOOA 4O3MA 1DDNA 2CWEA 2NS0A 1Z7UA 2UXNA 2A3SA 2FQ3A 3I59A 1KYWA 3CUQB 2Q2EA 3O2PE 4KICA 2RKHA 4HF0A 4I98B 2QQBA 3NRVA 5D5UB 2EA2A 3CO6C 1KQ0A 3KP3A 1KA8A 5LBQA 3J7AO 5ERIA 4KDPA 5E18F 5FD6A 1ZG5A 1KU3A 3NEUA 3D0SA 4MTEA 4LGWA 1XGNA 2FMLA 4KMUX 2NNNA 1R1UA 2IJLA 4EJVA 3JAMZ 1WSUA 1B6AA 4CYDA 4UXNA 3ZMTA 3B02A 2DQLA 1W5SA 2HYFA 4WXCA 2K02A 3BY6A 2W85A 3FXQA 1BC7C 1J0RA 2Y0MA 2A5YB 3R0AA 1U5TB 1R7JA 3KP2A 3KEOA 2ESNA 3CUQC 1TNTA 4D0PA 4Q5SF 4HLXA 2Y75A 3CUQA 1Y0UA 3TOAA 4YG2F 3K69A 5ED4A 1K7AA 5JR3A 1SD5A 1E2XA 4A0ZA 3IC7A 3GWZA 1XCVA 4MQ9F 2V1DA 1FZPB 1IW7F 2O03A 2OA4A 2DPDA 2VC1A 4P55A 4Z2YA 3JTHA 5H6RA 4YFNF 2STWA 5EEGA 1V3FA 3T1BA 3ABTA 5F1RA 2VC0A 2ELHA 2RVCA 2FU4A 2FOKA 3LQQA 4NHJA 5HDGA 3I58A 3K1PA 3V7RA 4GYIA 1ZRFA 2XVCA 3ZPLA 1J7KA 5HLHA 1KGSA 5D6FA 2WC2A 3LQRA 3FZVA 3FX3A 3E6DA 3WGGA 4ENJA 3P9IA 2DFIA 4Q4ZF 4S05A 2A07F 1R22A 4ENNA 1XSDA 3E6CC 1KQ9A 5EEHA 1FY7A 1U5TC 1ULYA 2M1BA 2R7DA 3R60A 3COAC 1TLHB 2RC4A 1U5TA 3J81Z 4R79A 3K1NA 2KJBA 3H3ZA 1G3WA 1IXRC 5JFRA 1QGPA 2XAGA 1IZ1A 2ISZA 4KUMA 3ZN0A 5E20A 1I27A 4LB5A 2M30A 2ACJA 1TQMA 4JK1X 1GXPA 1ZRDA 4YFXF 1OKRA 3V8JA 3PQKA 1XGMA 5F6FA 3WU1B 4U7BA 1ZG3A 1LB2A 3BWGA 5D4RA 2LF8A 1IUYA 5LGNA 5E1XA 4HX8A 2DQRA 3U1DA 5E17F 4LLGF 5CVIA 4A0YA 4XRFA 1P92A 1USTA 1U2WA 1T2KA 1ZYRF 2FMYA 5CVVA 3U2RA 1Q1HA 1BI3A 2G7HA 3S2WA 1R5HA 1FP1D 2P6TA 3BJAA 4RB1A 3BOQA 1QPMA 2Q8KA 3FMRA 4NB5A 1S3JA 2Z99A 1H9TA 1RIOH 3H3UA 2PBIA 2F5CA 5D4SA 2VBXA 3GLXA 1LQ1A 4L18B 1PP8F 3AAFA 1ODDA 5FB2A 4F7ZA 4KIGA 4AIKA 4U0WA 1IAWA 4EJWA 3SQNA 2B0LA 2EFNA 5ILVA 3KP5A 4EMSA 2DBBA 1FWZA 5DCFA 5AONA 2J5PA 4ZZDA 3WTSC 2EJRA 1ZAOA 4A6EA 2YSRA 4OMYA 5J8FA 2FEZA 2QWWA 3IKVA 5K5RA 1CGPA 2W24A 2GWRA 2L3DA 4LG0B 1JE8A 1HKTA 2P5LC 2A61A 1I6XA 1LEBA 1S29A 2OU2A 2P5VA 4I7HA 3MZYA 1IXSB 1HKQA 3EETA 2GA1A 4G7OF 4BYYA 5BPDA 2HKOA 1LJ9A 5ICCA 3WTXC 2UZKA 2GXBA 3Q9VA 3K1MA 1BJAA 2FA5A 3DPTA 2FBKA 3CLOA 3WGIA 4DNCA 4A0XA 2G9WA 3HHGA 4HOBA 1RZ4A 1MJ9A 3RKXA 2QUFA 2H27A 2ZXJA 2HEOA 1HXDA 1YW8A 1P4AA 3DF8A 3ROUA 1FP2A 5HS8A 3O6BB 4IRGA 4WCGA 1DPRA 3WODF 2JZYA 3R0JA 2P4WA 1U3EM 4KT5C 4EGYA 2YR2A 2FXAA 2WTEA 1O7FA 1A04A 4Y13A 1JGSA 1R1VA 1BI0A 3OV8A 3QRFF 2IPQX 1YW7A 1NHAA 4PDKA 3MQ0A 2VE9A 2KIUA 2Q0OA 4HA8A 2J5OA 3V8LA 4LG0A 3K2ZA 1B59A 3FWEA 2L54A 3FMSA 2PJPA 1YLFA 2ZNZA 1TQIA 1PP7U 1XSVA 3G3ZA 3GF2A 5DEQA 4AVPA 5DUIA 2JSCA 2HFHA 2BE5F 4IHTA 3N97A 2EK5A 3I5UA 3F8FA 4MGRA 2HKXA 3L00A 1FOKA 1BIAA 1XD7A 1YO5C 1W7PD 4AIJA 5JVTA 1UCRA 4M72A 2HS5A 2DW4A 1U8RA 4M73A 4BNCA 5K1YA 1BN5A 4HQMA 2F5DA 2V79A 4BHPA 1SFXA 4PCQA 4WF2A 1IN5A 3PFIA 3RI4A 2OD5A 4ZYDA 3TO6A 4IJAA 2HQRA 4L0YB 4GO1A 2CSOA 1L0OC 1GHCA 4BHCA 2XROA 2JRTA 3WTVC 4RB0A 2JPBA 1GXQA 1F4KA 1YIOA 5LGUA 3TDZC 4M9XA 2UXXA 5D5WB 1YW9A 5DV5A 1HW2A 4M6XA 2CQKA 4O5VA 3ZMZA 2RQPA 3WTTC 2VT2A 1MKMA 1X3UA 2BEOA 4KFCA 1SMYF 5H20A 2EV6A 5FFZA 1R1TA 3CTAA 2R3SA 3JSOA 1P4WA 2AS5F 3JTGA 1I1GA 1FPQA 3OOPA 5JHUA 4G94A 5CVJA 2VE8A 5J6XA 3GO5A 2DK8A 5CVUA 1Z6RA 5BS6A 2XAHA 1WQ2A 2Z3YA 4WX9A 4OIRF 4UVCA 1RI7A 3HSFA 1PUEE 3SHFA 1K6OA 1BC8C 3T0YA 1B1BA 2EFWA 3TO9A 2V9VA 4ESJA 3GFLA 3TOBA 3F22A 3RPQA 2E1CA 3EUHA 2BGCA 4LK1F 3HYIA 2COMA 4ZYHA 4RGUA 1S7OA 3KP4A 4IPAA 5D6EA 2PN6A 4CZZA 3WTYC 5ICGA 1WI9A 2GXGA 4KMFA 2OZ6A 1Z6TA 1YYVA 2A6HF 2YX4A 4EGZA 2LF7A 1TBXA 1XMAA 4LFUA 3L9FA 2OQRA 2F5FA 3M9AA 4A6DA 1YS7A 3DKWA 2E1NA 4KYWA 3W6JB 5L3EA 2MA3A 3EYYA 3I64A 4ZYGA 2P5KA 1DP7P 1H9GA 3J81K 4M9SA 3ZMSA 2O6GE 1Z91A 1D8KA 1FNNA 3F8CA 1HBXG 1YG2A 1AWCA 3KFWX 5AIPA 1YQAA 2X0LA 5KK1A 2HTJA 5KVRA 3J80Z 1T6SA 3GZ6A 3MWMA 2EB7A 2QM3A 3MFKA 3RJPA 1U6GA 5IT9K 3TQNA 4OMZA 2GA2A 4I02A 3VB2A 3QU6A 3RDIA 5HVQC 1JHFA 3G73A 2EWNA 4KNYA 1O3RA 2MC3A 2EFQA 1TW3A 1HQCA 2XIGA 3GFJA 1UHWA 2MH9A 1K79A 4P9UA 2CG4A 2HOEA 4P96A 2AXLA 2EFOA 4RAYA 4HF2A 3M1EA 4MQVA 1IF1A 1MD0A 5D8KB 2VN2A 2JT1A 5CLSA 3L7WA 2D1HA 3BJOA 4FT8A 2DTRA 1MDMB 2FNPA 2G7UA 2MLGA 2O3FA 3LA7A 4TV7A 4P5OA 1TQPA 3SXYA 3BROA 4G6DA 3GW2A 3I53A 4RB2C 2OZUA 1USSA 1G6NA 1C0WA 1ZHFA 1SFEA 4EM0B 2JPCA 3DXJF 1J59A 3HOSA 2DLLA 3KP6A 1T39A 2E7XA 4E70A 6PAXA 3GXOA 3DQVC 2OAZA 4EM2A 2PLYA 3ELKA 2GZWA 3RTRA 1S7AA 2FE3A 2LSOA 1JXSA 5DDGA 4CXFA 1TNSA 3HSRA 1FYMA 5LEKA 3KE2A 3I54A 1W5TA 4I09A 4CGZA 4ENKA 1DUXC 4AWXB 5HLGA 3VEPA 4ZZLA 3O3KA 1PDNC 1D8JA 5L3GA 4RGSA 3I71A 3RPUA 2HYGD 2K4BA 2P7VB 5HS7A 2VBWA 4ESBA 4U88A 1FBUA 1MDMA 5ILUA 3E3VA 3P7NA 3C18A 5JI6A 3M8EA 4P9FA 4K2EA 1FBSA 1ON2A 1BBYA 3HSEA 3TO7A 5L3FA 2LKPA 4KN4X 4XSXF 1AOYA 2FSWA 1EH8A 2QVOA 4R1HA 5F64A 1YFHA 3GFIA 4G8XA 5A2QK 3F8BA 4IHSA 1SD7A 1F5TA 3VFZA 3HTSB 2ZMEB 3I0TA 1IRFA 2ESHA 3LA3A 1LVAA 3BZ6A 1FT9A 2DO7A 4IF4A 1LDJA 3IRRA 1P4XA 2ZKZA 1T98A 3LAJA 4HLYA 4HX7A 2NYXA 3BDDA 1XN7A 2K4JA 4IRIA 4XLNF 2K86A 3F21A 4M6YA 4RGRA 3LAPA 1J75A 2O8XA 1SMTA 1SFUA 1LEAA 1P2FA 2Z33A 2LNBA 3KP7A 3MAJA 5L3BA 2R7FA 3KETA 4N0BA 5FO5A 3SZTA 2K27A 4BHBA 3WGHA 2STTA 3R61A 4ASNA 2H6CA 2P6SA 1YTYA 4PGHA 1ON1A 2XRNA 2D45A 1IN8A 3WU0A 3ERED 1E17A 4EQQA 2CFXA 4UNOA 3TGNA 4WWCA 2P8TA 2VODA 1U78A 3QOPA 3IHUA 5TRDA 1F1ZA 1Z1DA 4MEXF 2DU9A 4Y15A 4HZFA 1MZBA 2QYOA 2HQNA 2ZMEA 4I01A 3FHZA 1RUNA 3E5QA 2DT5A 1T0FA 4RS8A 2A69F 2FF4A 3QAHA 5DUKA 4KIBA 2XAFA 3B73A 3H92A 4UHTA 2PQ8A 3EYIA 4GGGA 4RB3C 2TDXA 1O3SA 1T38A 2V1UA 3RIRA 4WXDA 4Y17A 1REPC 1F9NA 1J2XA 1FSHA 4YIIA 5BMZA 1UB9A 2QENA 2K7LA 3QP5A 3GUDA 4BQAA 3GEZA 2XV4S 1ZLKA 4MNUA 3JAMK 2GIVA 3QP6A 1Z05A 2MH2A 2X4HA 2HTSA 3FF5A 1HW1A 2KRFA 3LA2A 1LDDA 3ECOA 5AIQA 5K5OA 1WKMA 4IVNA 5BQTA 1ZARA 2D2WA 1LNWA 1IN4A 1OYIA 1JHHA 2NRAC 2F2EA 5LEJA 3DPLC 2KJCA 3HUGA 4L9JA 2EFPA 2EV0A 4LMYA 2PEXA 3DFGA 1L3LA 4OIQF 4HV5A 2HWVA 4QWQA 2M87A 2E7WA 1K78B 5HLIA 5HS9A 2YPRA 4NQWA 3FMQA 4CICA 5H6QA 1EH6A 4CO8A 1FC3A 2W84A 3CDHA 5BOXA 4GCVA 2XGXA 1KU9A 4IXAA 3J80K 1RUOA 2MBFA 3IRQA 4ON0A 4L0ZB 3L09A 1ZRCA 2W57A 1MJAA 2QZ8A 3WG9A 1QBJA 4PZJA 3HRSA 5D5XB 2VOOA 3WE3A 4L9NA 5LRSA 3HRUA 2VXZA 2DPUA 2HR3A 1RNLA 3QPTA 2D1VA 1QZZA 5DYMA 4OINF 4A5MA 1BOAA 2KIFA 2C6YA 2ZNYA 4AIHA 4R8HA 1B9NA 2FRHA 2ZFWA 1QNTA 2CO5A 2BBYA 3E97A 2PI0A 1QO0D 1XMKA 2MLKA 3WTWC 3IWFA 3WE2A 1OR7A 3F6VA 1HW5A 4UV8A 3NQOA 2RV8A 3V7CA 4LD5A 5FLXZ 2NAZA 1R5GA 1FBQA 5ICEA 1XSXA 3LFKA 5CVRA 3GX4X 1SD6A 1ZG1A 4FX0A 2RNJA 5ILSA 4HDUA 1K78A 3BP8A 1UHMA 3RYRA 1ZH5A 4OIPF 3ABUA 1BI2A 1WWXA 4EV0A 4EVIA 3F72A 3V8KA 3W6KB 3ML6A 3MEXA 2QBYB 1ZGAA 3M8FA 3F3XA 2O61A 2BV6A 4I0BA 1O3QA 4FX4A 2EA4A 5LHHA 2KKOA 1G3YA 5LGTA 2PMUA 1J9IA 1ZLJA 3JW4A 5LHIA 2MD5A 5HDNA 4A2UA 4HDVA 4HYEA 2IP2A 4GXOA 2L02A 1R23A 3FXUA 4ETSA 2IT0A 5L3DA 4M74A 1O3TA 3FXRA 2UWMA 1IRGA 1ZN2A 4A5NA 3ZP5A 4I2OA 4LJZF 2YU3A 2ZJ2A 3IL2A 3D5LA 4MTDA 1ZREA 1R00A 2KIMA 3TDUC 1MGTA 4U7DA 3DV8A 2IA2A 3HTUA 4KN7X 3R4KA 4HW0A 2JTVA 5DD8A 3RKWA 2ZCWA 3WTZA 2QQAA 4HBLA 3M7GA 1G3SA 3GYHX 3F6OA 2FNAA 3Q9SA 1DPUA 3CUOA 5FGMA 1XCBA 3KZZA 5ICFA 2VBYA 3HRTA 1QZYA 1SD4A 3HOTA 2GQQA 3BPXA 3F23A 3KLNA 2OQGA 5LRRA 1ZGJA 2DAOA 1STZA 1W4MA 4EM1A 3REOA 3CO7C 4G7ZF 2VOPA 3FM5A 1EH7A 4HF1A 4MEYF 1TW2A 2H6BA 3TKYA 2XASA 3U9GA 2ISYA 3ECHA 2L4AA 1XGSA 2YX7A 3L2CA 2QBYA 2HGCA 2EV5A 3I4PA 1H0MA 4EJUA 3MZHA 3EDPA 4LK0F 1G4DA 1OMIA 4G7HF 5DCMB 3PQJA 2H09A 4UUVA 1P6RA 2A68F 2XKPA 1XB4A 4L9VA 4OU0A 3ZMUA 2P7CB 2BYVE 5IT9Z 3E5UA 2XUBA 5E1ZB 1O7LA 1KQ8A 4LLNA 2ZO4A 4QLCU 3HHHA 2FBIA 3R6SA 2ETHA 2FBHA 3BPVA 4O6JA 1O57A 1B9MA 1FSEA 3MCZA 1TTYA 1I1SA 4OIOF 2F5EA 2DI3A 3VOEA 3IKTA 1CF7B 1HSJA 4B09A 2Z5UA 2M45A 2W25A 2XAQA 2ZBKA 1HKSA 1FX7A 3DP7A 3ZQ7A 4G6QA 5DD4A 1KU2A 3SFZA 3GFMA 4LB6B 2V6CA 4FHTA 1IN6A 4PGGA 1B4AA 4L9TA 4YIFA 4M71A 1SAXA 2VBZA 3E6BA 1V4RA 4L5JA 3C1DA 3N4MA 2WWYA 2L4MA 1D5VA 4ZH4F 2IVMA 4B8XA 1BIBA 2IA1A 4U0YA 2IRFG 2Z9OA 5CJ9A 3HIFA 1VTNC 5DCMA 2VT3A 5LLQA 4OOIA 2PG4A 1OYYA 2QQ9A 2CW0F 1XDSA 4KIFA 2PFBA 3RYPA 1UFMA 2PMHA 4MHGA 4BH9A 2QLZA 5E8IA 1G3TA 2IW5A 2LDUA 2M5WA 3LSTA 1XGOA 1D3YA 2ADUA 2XHKA 2VONA 3FM3A 3C7JA 4G9YA 1KYZA 1J5YA 2DK5A 3VODA 1IXCA 1CF7A 2A6EF 1XDUA 3T5XA 4CHUA 2M8EA 3RKYA 3K0LA 4DQ2A 4EJTA 5E8GA 5E1WA 5BPIA 3V4GA 4WXHA 4GYGA 3F8NA 5HDKA
chains in the Genus database with same CATH superfamily
2GAUA 4I6ZA 2LK2A 2NOGA 3EQLF 1FIAA 2WBMA 3OYMA 2KZVA 1DGRM 1MNDA 3HGGA 5IYDJ 3KEQA 4KA4A 3GVAA 2RDPA 1QU3A 3BR6A 1XC5A 4S04A 2BY3A 4Q47A 1W7PB 2OJED 4HAMA 4RGXA 4Q48A 4RAZA 1S6LA 3GCMA 2D5VA 4BXUA 2O8KA 4M9ZA 2MYSA 3CCMI 3OL4A 1ETVA 2LVSA 2VXDA 1Y6IA 2H94A 1YS6A 2XAJA 4PUSA 3WTUC 1OCZH 5TISC 1OCCH 3MKYB 4CDGA 3KZIC 5CPRB 2CGPA 2IS2A 4ESFA 3Q5FA 2K85A 3P9CA 4IRHA 2F4MB 3ZMDA 4PSXA 1ERDA 5F0FA 5GTIC 3CJNA 5IT3A 5L3CA 3ZN1A 3KCCA 2NNYA 4ENMA 2F6CA 4XLPF 4CYCB 4A12A 2BHYA 1FLIA 3IUOA 1BI1A 4N9IA 2CYYA 3CC2I 1DU0A 4V2FA 5J3LA 3ZQHA 2CJJA 4YFKF 4A3LJ 2EZIA 2L9NA 5LHGA 3P5JA 5A2QZ 1JT0A 2WADA 3ISPA 5F27A 4BAYA 3S15J 3QU3A 2DFFA 3NWSA 3HOXJ 2HDCA 3HRMA 1OYWA 5BNGA 1BM9A 1F36A 2CQNA 1WH7A 4HSTA 3T8RA 4BQQA 3BZKA 4RMNA 3K4KA 5D8LB 4LLLA 4H0EA 4XLFA 3ZMVA 3I59B 2BZTA 5FFXA 4C9YA 4WK8F 2Q2EB 1FYKA 2PJRB 3G1OA 2M4KA 5D5VB 2YUSA 2K3PA 3DEUA 2QEXI 3GTOJ 1IV6A 4HV6A 1Z67A 1BW6A 3KZYA 2LC2A 4JBAA 5JLXA 3ULQB 4XKCA 1FYLA 4E7LA 1WRJA 3E5XA 2XKOA 1I5ZA 4FE4A 5CQGA 5IP7J 4XBFA 2YS9A 3BJ6A 1IN7A 2K3FA 4UV9A 1X1CA 3HPGA 3AL0C 4RM3A 1IRXA 1R58A 1JJ6C 2VKHA 3P9KA 2E1MB 4CH7A 2WV0A 1S8NA 4J00A 1VF9A 2LD5A 1LFPA 2RN7A 1EF4A 1LDKB 2L01A 1K83J 2RGVA 4UVBA 2R7RA 1SVLA 3ZQIA 3K4CA 1Z3YA 2W82A 3G1LA 4AD9A 4JQFA 4L5IA 4HQEA 3H9JA 2OBPA 1GVJA 4F92B 1ONVA 4ZYEA 5M5YJ 4Y7NJ 3IWZA 3SZPA 3V7SA 4KISA 3E6MA 1OPCA 1W7PA 4I0AA 4XSZF 3AKZA 4W97A 4HRIA 3LWFA 2FUG2 2TCTA 5TJJA 3L1PA 3C3WA 1FMVA 2CW7A 1H88C 3BTLA 2K9NA 1Z9CA 3HG9A 1QHGA 4HNUA 1T33A 1TC3C 4B1RA 1RC9A 2XPUA 1QQIA 3G71I 1UG0A 3Q0UA 2DMUA 5CYVA 1DGWY 4U0VA 3GZ5A 1YITI 1KU7A 2KRCA 1DQUA 4ZTFA 3K9TA 4CZCA 4UVAA 3F8MA 2K5CA 3QPHA 1YJWI 2V1XA 2HZTA 5J8CA 5KAFC 5K5QA 4CYCA 1MJBA 2IA0A 3KLOA 3JSPA 3PJRA 3ABKH 3ESWB 5FD5A 2R7ZJ 4EJOA 5FLXK 4E6KG 2Y48A 3IH3A 1EV7A 2HQ5A 4N9HA 3RKQA 4B44A 5JLWA 2O0YA 2NVYJ 4HX4A 1HSTA 3T8TA 1R36A 2CH0A 3HGYA 5HOOA 4O3MA 1DDNA 2CWEA 2NS0A 1Z7UA 5DM6F 3CJQB 1RR7A 4XONA 2UXNA 2A3SA 2FQ3A 2A5WA 3I59A 1KYWA 3QODA 1QA6A 3CUQB 2Q2EA 3O2PE 2PJRA 4KICA 1A35A 4A3JJ 2RKHA 3S1RJ 3H9QA 4N4OB 4DZPA 4HF0A 2XF6A 4I98B 2QQBA 3NRVA 5D5UB 2EA2A 2LMDA 2QSGX 3CO6C 1KQ0A 2WY7Q 3KP3A 4HEA2 1KA8A 2E1MC 5LBQA 2IS6A 2CUJA 3FK6A 3J7AO 2VJIA 2IGNA 5FKLA 2GLOA 1WVRA 5ERIA 4KDPA 3JRIA 3I4MJ 5E18F 5FD6A 3LFUA 2XB5A 1ZG5A 4PJLA 1U9OA 2V9PA 5FKOA 5DTDA 1KU3A 1NG7A 4BXFA 3NEUA 2X6YA 3D0SA 3LSRA 2BVLA 4MTEA 3BR2A 3EUHC 4LGWA 5E3OA 4ZC3A 4BS9A 1XGNA 4BUPA 2CMPA 4B3XA 3DTEA 1XG1A 2FMLA 5HLTA 4KMUX 2NNNA 1MBGA 1GVDA 3U1KA 4N4NB 1RETA 1R1UA 2IJLA 4EJVA 2JA8J 1UG2A 4L5EA 2VL8A 4A3GJ 1X19A 2VB6A 3JAMZ 1JTYA 3H5NA 1WSUA 2VQLA 1B6AA 1MSEC 1MH3A 4UXNA 3ZMTA 4CYDA 1NK2P 3B02A 1G2HA 2DQLA 4XRSA 1YE9A 2VI6A 1W5SA 2HYFA 4WXCA 3SFIA 4NC8A 3AG1H 4CUGA 3CCUI 3HOZJ 2MD0A 4FTHA 1LVKA 4HPQA 1WHUA 3MMYB 3ZXSA 2K02A 2Y69H 4XLHA 4CCLA 3BY6A 1PUFB 2W85A 2EPFA 3FXQA 4IQ4A 1BC7C 1BW5A 3BC8A 2QSHX 1MNEA 3QQAA 1A6QA 1EJ9A 1MBHA 1J0RA 2Y0MA 1D5YA 4M3DA 2A5YB 2DYRH 3R0AA 5J1RA 2X1EA 1U5TB 1R7JA 3KP2A 3RSNA 2XRLA 2E71A 2ESNA 3KEOA 3CUQC 1TNTA 3PIPF 3LNQA 4D0PA 4Q5SF 4HLXA 3OR1C 3FXKA 2Y75A 2E35A 3CUQA 4LITA 1Y0UA 4RM2A 2IS1A 2I10A 1MMAA 3TOAA 2JSPA 4YG2F 3K69A 3FDYA 2LG4A 3M1CA 5ED4A 1WJFA 1K7AA 3OIOA 5JR3A 1SD5A 1E2XA 4A0ZA 3IC7A 1YX3A 3GWZA 1XCVA 2IAIA 3QYEA 4D5CA 4MQ9F 2V1DA 2KDOA 3W6VA 1FZPB 2CW8A 1IW7F 4A93J 4X6AJ 2EH3A 2O03A 2LOOA 2OA4A 2DPDA 2VC1A 2RAEA 2KRHA 2XSDC 4P55A 4Z2YA 4BACA 1GV5A 3K4BA 2JQ7A 2E1OA 5EJCA 3JTHA 1VQ6I 5H6RA 4YFNF 2STWA 4XL9A 5EEGA 1V3FA 1FOWA 3T1BA 3OSFA 3ABTA 1ETYA 1ORKA 5F1RA 2VC0A 2ELHA 2RVCA 3WHCA 4DIQA 2FU4A 2FOKA 3FXMA 3OWTA 3HOYJ 3LQQA 4NHJA 5HDGA 1WGXA 3I58A 4BJTA 3K1PA 4HSRA 2HZDA 3V7RA 4GYIA 2K9SA 1ZRFA 2XVCA 3ZPLA 4UY8I 1J7KA 5HLHA 2B7EA 1ETXA 1KGSA 5D6FA 4I99C 1TWHJ 2WC2A 3OR2C 3LQRA 3FZVA 5C4XJ 3FX3A 1BR1A 3E6DA 2VQCA 3WGGA 4ENJA 3P9IA 2ID6A 4XRMA 2DFIA 2BXYA 1OCOH 4Q4ZF 1PUFA 4S05A 4B48A 1R22A 2A07F 4ENNA 1XSDA 3JRGA 3E6CC 1KQ9A 5EEHA 1FY7A 1JUPA 3RCOA 3IH2A 1U5TC 4C2TA 5GADJ 2R7SA 1ULYA 2M1BA 2R7DA 3R60A 3COAC 2VLAA 1WFXA 1TLHB 2RC4A 3TBIA 1U5TA 3J81Z 5FLVA 4R79A 3K1NA 2KJBA 3H3ZA 1G3WA 1IXRC 4Y4RA 3G2BA 1I3QJ 1FMWA 5JFRA 1SANA 1QGPA 3OYNA 2XAGA 1IZ1A 2ISZA 1K6YA 2WAQA 3JRFA 4KUMA 3ZN0A 2CUEA 3CCJI 5E20A 3SZGA 5C3EJ 1E3OC 2CUFA 3OYCA 1I27A 2EQRA 4LB5A 3D5RC 3HBLA 3IH4A 2M30A 2ACJA 1TQMA 4JK1X 1GXPA 1ZRDA 4YFXF 1M1EB 2ME0A 1OKRA 2ZXIA 4BY7J 1WCMJ 4IO9F 3V8JA 4X0GA 5FRNA 4W1UA 4LOCA 3PQKA 5E3MA 1XGMA 3CF5F 5F6FA 3NWTA 2DA2A 3GBGA 3WU1B 4U7BA 1YJ9I 1MMGA 2B9SA 1IO2A 1ZG3A 1JT6A 1LB2A 3BWGA 3H3VK 1P9QC 5D4RA 3CDLA 2LF8A 4B4CA 1IUYA 2CUZA 5LGNA 5E1XA 4JX5A 3HZJA 4KJZA 3LL7A 4HX8A 5FKMA 2DQRA 2DCEA 1YOVB 5KHDA 2JMWA 2HVSA 3U1DA 1FTZA 5E17F 4E7SA 4LLGF 5CVIA 4A0YA 3ZQLA 1TT5B 4XRFA 3CJRB 4DBQA 1P92A 1USTA 3S17J 1U2WA 1D1BA 1FIPA 2FJ1A 1T2KA 1ZYRF 2FMYA 4A3DJ 5CVVA 4V19K 3HJEA 3VPRA 2AQFA 3O8GA 3U2RA 1XS9A 2W48A 1Q1HA 1BI3A 2G7HA 4BDZA 2LRDA 3S2WA 1R5HA 1FP1D 2HI3A 3C2GA 3FXLA 2W00A 2P6TA 3BJAA 4S0HB 2DJNA 4CA0A 2M4GA 4RB1A 4BE1A 3BOQA 1ZR4A 1MBFA 1QPMA 5F1JA 2Q8KA 3FMRA 4NB5A 1S3JA 2H8WA 2Z99A 1H9TA 3KX2A 1RIOH 1XPXA 3H3UA 5J4VA 4A3FJ 2PBIA 2F5CA 2R7VA 4ZDOA 3S3OA 2R93J 5D4SA 3PO3J 1UJ8A 1R4NB 2VBXA 3AFHA 4D1QA 4MO7A 1Z7LA 3LSJA 3GLXA 4OAYA 1LQ1A 4L18B 1WJCA 2HDWA 1PP8F 2DOEA 3AAFA 1ODDA 5FB2A 4IHVA 3S1NJ 3EUAA 1YJNI 4F7ZA 4KIGA 4AIKA 4U0WA 3G4SI 5LFAA 1BOBA 2KQRA 1W0UA 1IAWA 1R6RA 4EJWA 3J7YJ 3SQNA 2B0LA 2HOAA 1HLVA 3BQZA 3ZQQA 2EFNA 5ILVA 3GMEA 1ITYA 3KP5A 4EMSA 2DBBA 1MIJA 1FWZA 4YIRX 5DCFA 5AONA 1IV8A 2J5PA 4ZZDA 3WTSC 2GBYA 3HM5A 2EJRA 2HXOA 2XB0X 1ZAOA 4A6EA 2OCCH 1X4PA 2XF5A 2YSRA 2DA1A 5FJ8J 4OMYA 2HOSA 1Y39A 4FISA 3G1MA 2FEZA 3OIPA 4RAFA 5J8FA 2QWWA 3SEQA 3IKVA 4Z6YA 5K5RA 1CGPA 2W24A 2GWRA 1Y0NA 2L3DA 5B66C 4XIDA 4AU7A 1B72B 4LG0B 1JE8A 3DEEA 1HKTA 2CQQA 2R5ZB 3MKWB 1OFCX 3I56I 5J1UA 4YRVA 2P5LC 2A61A 2QF7A 2VQGA 4C3IJ 3J7AY 1I6XA 5F08A 4DBRA 1LEBA 3S3NA 2KLOA 1S29A 2OU2A 2P5VA 1Y56A 3MZYA 3PFYA 4I7HA 4NC6A 5E3LA 2LR8A 1IXSB 1HKQA 3EETA 1TWFJ 2GA1A 4G7OF 1MBEA 3DU6A 4BYYA 5BPDA 2HKOA 1LJ9A 5ICCA 3WTXC 2UZKA 2X1CA 4G6TB 3A01B 2GXBA 1UAAA 2VKEA 3Q9VA 4OAZA 4BBSJ 1WH5A 3K1MA 2OV7A 2H1LA 5KCMA 1MW7A 1BJAA 4ZTJA 3GLLA 2FA5A 3H5RA 3AL0B 3DPTA 2FBKA 2L7KA 1MSFC 2WY8Q 3CLOA 3WGIA 4DNCA 4A0XA 2G9WA 1MBKA 4H4KC 9ANTA 3HHGA 3CESA 4HOBA 1RZ4A 2XF7A 3OYBA 4PSWA 1MJ9A 3RKXA 3VWBA 2QUFA 2EZKA 2X1DA 2R7UA 2H27A 2ZXJA 3OYDA 2HEOA 1HXDA 1YW8A 5KNLA 4E7JA 3F0CA 1P4AA 4A3MJ 3DF8A 2DMNA 5JHFA 2R7TA 4FETA 3ROUA 4EEFG 1FP2A 3OS1A 2XPWA 3O6BB 5HS8A 2JN6A 2R7OA 4M3EA 4P1WA 4IRGA 4WCGA 1DPRA 2DMTA 2K9LA 3LSKA 3WODF 1NH3A 5FROA 2Y0SA 3GZNB 3ZQGA 2JZYA 1R9TJ 3KIOA 1RPWA 3R0JA 2P4WA 1U3EM 4MFEA 1ETOA 1V54H 3MKZA 1OJLA 3A02A 3OOUA 4KT5C 3IAS2 3CZ6A 3ABLH 2WV1A 4EGYA 2YR2A 2FXAA 2WTEA 1O7FA 2NVTJ 1WI3A 5TGTA 1JKOC 2PMZN 1A04A 1E3PA 4Y13A 1JGSA 1R1VA 1TZLA 1BI0A 1YX5A 2W7NA 3OV8A 4A3IJ 4V2GA 3QRFF 1XMXA 2IPQX 2AXTC 1T95A 1YW7A 3LSMA 4D7NA 1NHAA 5EGOB 4PDKA 3MQ0A 2VE9A 2KIUA 4D5FA 2FX0A 2JK3A 2Q0OA 4HA8A 1LE8B 2J5OA 3V8LA 4LG0A 1B72A 1VQ7I 3PNTA 1IUFA 2ZMEC 1ZKGA 3OYEA 3K2ZA 2R5ZA 3PNYA 2ZJRF 1B59A 1OISA 4JP0A 3OSGA 3FWEA 2L54A 3FMSA 2PJPA 4RDUA 1YLFA 3DBHB 2ZNZA 1TQIA 2KDZA 1PP7U 1XSVA 3G3ZA 3GF2A 5DEQA 4AVPA 5DUIA 1HC8A 2DOFA 1MH4A 2JSCA 2HFHA 2O9LA 3S32A 4BY1J 2BE5F 4IHTA 3FISA 3N97A 2EK5A 3BZCA 3BG7A 3DBLB 3I5UA 3F8FA 5HNHA 3A01A 4MGRA 3CCSI 1W36D 2L7ZA 5GP9A 4FE7A 3JR9A 2V4JC 1VQPI 1EKEA 4XR6A 2HKXA 3RQ4A 2R0QC 4J01A 3L00A 1FOKA 1ACIA 1BIAA 1XD7A 4IEJA 1YO5C 1W7PD 4C2MJ 4AIJA 4XN0A 5JVTA 1UCRA 4M72A 2HS5A 3OS2A 2DW4A 1U8RA 2JUCA 3HOVJ 4M73A 4BNCA 5K1YA 1WZ2A 2K40A 1BN5A 4HQMA 2F5DA 2V79A 5KAIC 4BHPA 2HVRA 1N78A 1FOYA 1SFXA 5E79C 4A3CJ 2QSFX 1UZCA 1GUUA 4PCQA 3FHNA 4WF2A 1IN5A 3PFIA 3RI4A 2OD5A 3K4MA 3OY9A 4ZYDA 3TO6A 4IJAA 1X58A 2HQRA 4L0YB 4GO1A 1VI0A 1TWAJ 2CSOA 1L0OC 3BR3A 1GHCA 4BHCA 4IOCF 2M0MA 2XROA 2JRTA 3BG9A 3WTVC 4RB0A 2L5QA 2JPBA 2KPMA 1GXQA 1F4KA 1YIOA 1PJRA 2Z16A 1ETWA 5LGUA 4U87A 3TDZC 4M9XA 4BE2A 2ME6A 2UXXA 5D5WB 1YW9A 5DV5A 5HNFA 2H1KA 1HW2A 1MNMC 3TW6A 4M6XA 2CQKA 3BR5A 4O5VA 3ZMZA 2RQPA 3WTTC 3L2RA 2VT2A 1MKMA 3SDBA 5EDNA 1X3UA 3A2KA 1ZK8A 2BEOA 4KFCA 1SMYF 5EGOA 4II3A 5H20A 3OYFA 2EV6A 2XC7A 5IP6A 3MD2A 1R1TA 5FFZA 1LE8A 2Z1DA 4BBRJ 4CCKA 2FOWA 3TP3A 3CTAA 2R3SA 3JSOA 1P4WA 2OC6A 3CDIA 2AS5F 3ERMA 3JTGA 3TEDA 2LKSA 2ZJPF 1I1GA 3M8JA 1FPQA 1JUMA 3OOPA 3GTJJ 5JHUA 4G94A 4AYBN 5CVJA 3C2HA 2VE8A 5J6XA 5C4JJ 2N8GA 5M5XJ 3GO5A 3VYRB 4DGWB 2DK8A 5CVUA 3FXJA 1Z6RA 5BS6A 2XAHA 1WQ2A 2M7BA 2Z3YA 2M9HA 3GTPJ 3A0BC 2ZXHA 4WX9A 4OIRF 4UVCA 1RI7A 3HSFA 3U21A 5EEAA 1PUEE 3H1CA 3SHFA 2MC4A 2EZHA 3ZRGA 1K6OA 2K9MA 3T0YA 1BC8C 2EBIA 1B1BA 2EFWA 3TO9A 2MFZA 4XRSG 1HA8A 2V9VA 5EYRA 3S2DJ 4ESJA 3OYLA 2CV0A 3GFLA 3AG2H 4BDYA 3TOBA 2LY9A 4NBQA 3F22A 3RPQA 1W0TA 2E36A 2E1CA 3EUHA 3W2VA 2BGCA 1SEUA 4LK1F 3HYIA 2COMA 1ZQ3P 1X1PA 3A03A 4UB8C 4ZYHA 3H0DA 1JJ8C 1NK3P 4RGUA 1S7OA 3KP4A 4IPAA 3EPZA 2E2IJ 5D6EA 1FTTA 2PN6A 4CZZA 2R7WA 2B63J 1ZGWA 1H89C 3M07A 3WTYC 2HOTA 4II2A 5B1AH 1BR2A 5ICGA 1WI9A 2JVHA 4HG2A 2O5RA 2GXGA 4KMFA 2OZ6A 2V6EA 1Z6TA 1YYVA 3Q0WA 2EIJH 1T08B 2A6HF 1IGNA 2YX4A 2MABA 4EGZA 2LF7A 3WG7H 1OCTC 1TBXA 1XMAA 4LFUA 4NNJA 3L9FA 2OQRA 2F5FA 2BW3B 3LMMA 3M9AA 4A6DA 4DYQA 3K10A 1YS7A 3DKWA 2VQHA 2E1NA 4KYWA 1Y8RB 3FBIB 3W6JB 5L3EA 2MA3A 3EYYA 3K70C 2KFDA 2HQAA 3I64A 4ZYGA 2P5KA 3Q3SA 4XKWA 1DP7P 1H9GA 3VYUB 1W1WE 3CCQI 3J81K 4M9SA 3QOEA 3ZMSA 2KT0A 2O6GE 3AG3H 1Z91A 4OWRB 4JYKA 1D8KA 1FNNA 1S7EA 3BTIA 4ITVA 3F8CA 3HKZN 5M5WJ 3JRAA 1HBXG 1YG2A 1AWCA 3EUKL 1VQLI 4E7HA 3KFWX 5AIPA 1YQAA 2X0LA 5JVGF 5IOYA 4IQJA 1VQNI 5KK1A 2HTJA 1U8BA 5KVRA 2NXNB 3J80Z 1T6SA 1J09A 3GZ6A 3F9KA 4MLOA 4BL0B 3L2UA 3MWMA 3VYTB 2EB7A 2E2HJ 3KPHA 2QM3A 3MFKA 3RJPA 1U6GA 5IT9K 3A0HC 3TQNA 1TWGJ 2GA2A 4I02A 1OCPA 1QVTA 4OMZA 2CQXA 2COBA 3VB2A 5M3FJ 4XLAA 1IC8A 3QU6A 3RDIA 5HVQC 1JHFA 5M3MJ 4ABZA 2TRTA 3G73A 2EWNA 4KNYA 1O3RA 2MC3A 2EFQA 3K2AA 1TW3A 1HQCA 2NS7A 2XIGA 4RLFA 3GFJA 5EG0B 4NUBA 1D1AA 2HPIA 4LG3A 1D0XA 1UHWA 2MH9A 1K79A 1BR4A 1N75A 2X6WA 4P9UA 2CG4A 2HOEA 4P96A 2AXLA 1DU6A 2EFOA 1G8XA 4RAYA 1WJ5A 4HF2A 3OL3A 1OQYA 3M1EA 4MQVA 4DYCA 1IF1A 3OYJA 1MD0A 5GPCA 5D8KB 2VN2A 2BW3A 3BR0A 2A05A 1APLC 3HB9A 2JT1A 4J19A 5EZGA 5CLSA 1ZR2A 3L7WA 4BXXJ 2JRMA 2LTPA 4YEJA 3WU2C 2D1HA 2L0KA 2WB1N 3BJOA 4MFDA 4FT8A 2DTRA 4C2UA 4DW6A 5DS9A 2L2OA 1LKXA 4DZJA 3CMMA 1MDMB 2FNPA 1F43A 2G7UA 4XLCA 2MLGA 2O3FA 3LA7A 3JRBA 2E34A 1N77A 4TV7A 4P5OA 2RQQA 1SC7A 3DPUA 3A4CA 2XGEA 1TQPA 3MKLA 3SXYA 1B8IB 5IYCJ 2YU9J 3S93A 1QVUA 3DTKA 1V5FA 2L9VA 3BROA 1R4MB 2MSYA 4GFBA 4UB6C 4G6DA 3GW2A 3I53A 1VQMI 4RB2C 2OZUA 1USSA 1G6NA 2DMPA 1C0WA 3K7AJ 1ZHFA 1LFUP 1SFEA 2JA6J 4EM0B 2EIKH 2JPCA 4YELA 4JX6A 3DXJF 1J59A 3HOSA 2DLLA 3KP6A 4LIVA 3LSGA 2E7XA 1T39A 4E70A 6PAXA 3GXOA 1ENHA 3L2VA 3DQVC 3ASOH 2L7MP 2OAZA 3S3MA 4EM2A 2I8DA 4XMYA 2PLYA 2DDBA 3ELKA 3DKYA 2GZWA 2QKMB 3RTRA 3KYDB 5HODA 3QPSA 4M3BA 1S7AA 2FE3A 2LSOA 2HU9A 5B1BH 1MBJA 3J7ZI 4LIUA 5E3NA 5EG0A 5IOZA 1T56A 1JXSA 4QSHA 5DDGA 4CXFA 1TNSA 3HSRA 3N05A 1FYMA 5LEKA 2ID3A 3KE2A 4BU2A 3I54A 4I76A 1W5TA 4I09A 4CGZA 4M3GA 4ENKA 1DUXC 3HDDA 4AWXB 5HLGA 5CKTA 4XN3A 2ZC2A 3OYAA 3VEPA 4ZZLA 4HNVA 1A31A 3O3KA 2LREA 1PDNC 4UUSB 2Y9YA 1D8JA 5L3GA 2NOJB 4RGSA 1NG6A 3HEFA 3I71A 3RPUA 5IYBJ 2HYGD 3L2WA 1Q1VA 3BG3A 2K4BA 2P7VB 5HS7A 1GLNA 1LPQA 1GDTA 2VBWA 4ESBA 1X1AA 4U88A 2KL4A 1I39A 2CV1A 1FBUA 1MDMA 5ILUA 4E7KA 1FOXA 3E3VA 4Y3OA 3P7NA 2XGDA 3C18A 1GV2A 5JI6A 3O8HA 4CCJA 2DN0A 3M8EA 4P9FA 4B3AA 1Z0XA 3BG6A 2DODA 1V5EA 4K2EA 1B8IA 1WJDA 4G12A 2XAUA 1FBSA 1ON2A 2X9DA 1HCRA 1BBYA 3KEYA 3HSEA 1AA7A 3TO7A 5L3FA 2LKPA 3NARA 2QA4I 2GOMA 4KN4X 2GXAA 4XSXF 3CP8A 4XQFA 1AOYA 2FSWA 2LP0A 1EH8A 2QVOA 4R1HA 4PJNA 5F64A 1YFHA 3H36A 1SVOA 4DJAA 2KMUA 2LYCA 1GT0C 4PFOA 2L9RA 3GFIA 4G8XA 1R71A 1MMNA 2R4GA 3CCYA 2JA2A 3MN2A 4XOPA 3QPLA 3DLAA 3K4NA 3QWLA 1A6IA 4BE0A 2MW8A 5A2QK 3F8BA 2M0CA 3S1QJ 4XKBA 2E19A 4IHSA 1JKQC 1SD7A 1F5TA 3M4OJ 2ELKA 3VFZA 4PFPA 3HTSB 4B47A 2ZMEB 2GM4A 3S14J 3I0TA 2M7AA 3DKXA 1IRFA 3SYTA 2ESHA 3LA3A 1LVAA 1X2NA 1K4TA 3BZ6A 1FT9A 2M34A 1XX5A 2LKXA 2DO7A 4KITB 4IF4A 1K4SA 1LDJA 3IRRA 3QYFA 4XLEA 1P4XA 3BG5A 1QPIA 2DTZA 3HL2A 2ZKZA 2MG4A 4F55A 1T98A 4Y33A 3LAJA 4FQGA 2GIZA 4HLYA 4HX7A 2NYXA 3BDDA 1XN7A 4UUSA 2K4JA 3CCEI 4IRIA 3ZOBA 1JTXA 4ZDPA 4XLNF 4IHYA 2K86A 3F21A 3SJMA 5LD2C 4M6YA 1E3HA 4GRIA 4RGRA 3LAPA 1J75A 2O8XA 5DM7F 1SMTA 3H0GJ 1SFUA 1LEAA 1P2FA 2BY1A 2Z33A 2LNBA 3KP7A 2DA6A 3MAJA 5L3BA 3KYLA 2R7FA 2F5VA 3HOWJ 4F52A 3KETA 4N0BA 2VPRA 2E5NA 2P0WA 5FO5A 3SZTA 1N25A 2K27A 4PJMA 4BHBA 3DTIA 1UMQA 2X85A 3S8PA 3WGHA 3BLYA 3PUBA 1I6HJ 2STTA 1RKTA 3ASNH 3UKGA 3R61A 4ASNA 2H6CA 1RESA 2P6SA 2IEKA 1YTYA 1JI8A 5J1YA 4PGHA 1BL0A 2QGUA 1ON1A 2XRNA 2D45A 1IN8A 3WU0A 3ERED 3OYIA 1E17A 2G0EA 4EQQA 2CFXA 4C30A 2CV2A 4E7ZA 3S1MJ 4UNOA 3PO2J 1D0YA 1X4OA 3CMAI 3TGNA 4WWCA 3LSPA 2VASA 2CFOA 2E2JJ 2X6XA 2P8TA 2VODA 2DYSH 1U78A 2F48A 3QOPA 1D1CA 1AU7A 1OLTA 2V26A 3GTLJ 3IHUA 3FBNB 5TRDA 1F1ZA 2WAEA 3ZGKA 1Z1DA 4MEXF 2DU9A 1RRJA 4Y15A 3HUGB 4HZFA 2NS8A 3E1SA 4RLQA 1MZBA 2EILH 1T0FC 1TP4A 2HQNA 2QYOA 3DBRB 2ZMEA 4I01A 3FHZA 3HC7A 1SFOJ 1RUNA 3E5QA 2ZB9A 2FQ4A 2DT5A 3ONQA 1T0FA 4RS8A 3I55I 2A69F 2FF4A 1V55H 3QAHA 4KIBA 5DUKA 2XAFA 4NQWB 3B73A 3H92A 2ELJA 5B5EC 4UHTA 3G6EI 2PQ8A 2L7FP 3CJTB 5GTHC 2VIXA 3L2QA 3EYIA 4GGGA 4RB3C 2TDXA 1O3SA 3LSHA 4XM3A 1T38A 2V1UA 3TMOA 2ECBA 3W2WA 3RIRA 4B43A 2Q1ZB 3H5AA 4MIMA 2DA3A 2KHMA 4WXDA 2V7FA 5GPAA 3CF2A 3OYKA 4Y17A 1REPC 1I3AA 5EF6A 3CMYA 1EA3A 3UNGC 3FXOA 4XKVA 1F9NA 1J2XA 1YIJI 1FSHA 4YIIA 3HPHA 5BMZA 1UB9A 2QENA 2K7LA 4NDLA 1W36C 3QP5A 3OS0A 3AG4H 2X6OA 3GUDA 2PMZA 4BQAA 2R5YB 4AIDA 3BCAA 1SVMA 3FKJA 3GEZA 3JRDA 4XK4A 3BR1A 4A69C 1HF0A 2XV4S 1ZLKA 4MNUA 3JAMK 2HDDA 2GIVA 3QP6A 1Z05A 1R5ID 3ABMH 1IG7A 2JWTA 1WJAA 3DEWA 2UUZA 2MH2A 2X4HA 5FLMJ 2HTSA 3FF5A 2E5ZA 1HW1A 2KRFA 3LA2A 1LDDA 3ECOA 2LY2A 5AIQA 2EZLA 5K5OA 1WKMA 2OCEA 4IVNA 2Z2SB 1ZARA 5BQTA 2F4IA 2EIMH 4M3FA 1QZEA 2D2WA 1VNDA 1LNWA 2F4OB 3JCUC 3OMYA 3A1YA 1IN4A 1UHSA 1OYIA 2IGOA 1JHHA 1PYVA 2NRAC 2F2EA 1Z21A 5LEJA 3DPLC 2KJCA 3HUGA 3W3CA 4JX4A 2EFPA 2EV0A 4L9JA 4LMYA 5J40A 3H35A 2R7QA 2PEXA 3DFGA 1L3LA 1IDYA 4FCYA 4OIQF 4HV5A 2XPVA 2HWVA 2DJIA 3PSIA 1KONA 2OPTA 2HXIA 4QWQA 2M87A 3DCFA 2H8RA 2E7WA 1K78B 5HLIA 1DP3A 1JUSA 5HS9A 5B3SH 2YPRA 4NQWA 4A3KJ 4IL6C 3D5SC 3FMQA 5F0HA 4CICA 1A5JA 5H6QA 1X2MA 1EH6A 4CO8A 4X1EA 1FC3A 2W84A 3CDHA 5BOXA 4GCVA 2XGXA 3S2HJ 1NTCA 1KU9A 4IXAA 3H9GA 4IZZA 2QKLB 3J80K 3UR3C 4D7MA 1RUOA 4RA2A 4XNFA 4QTRA 2MBFA 3IRQA 2ZJQF 1U9NA 3WHBA 4ON0A 4L0ZB 1YHQI 2L9SA 3L09A 2E60A 2HNHA 2W57A 1MJAA 2ZFUA 4NC7A 1ZRCA 1VQ9I 2QZ8A 3WG9A 1QBJA 2CS3A 4PZJA 3HRSA 5D5XB 4CCMA 4ZDLA 2OTLI 2VOOA 3GTQJ 3WE3A 4L9NA 2DXIA 5LRSA 3HRUA 2M3AA 3S16J 4CCOA 2R5YA 2VXZA 2X51A 3RZDJ 2DPUA 2HR3A 1RNLA 3QPTA 4FASD 2D1VA 1QZZA 1WJBA 3E0JB 5DYMA 4OINF 4GDFA 1X1BA 4A5MA 1BOAA 2KIFA 2C6YA 2ZNYA 4AIHA 3GTGJ 2KIQA 4ZJZA 4R8HA 1B9NA 2FRHA 1S5LC 2ZFWA 1QNTA 2CO5A 2O7OA 3K70D 2BBYA 3CQZJ 3BT9A 4QPOA 1KZHA 1OR7C 1A36A 3E97A 2PI0A 1QO0D 4EATA 1XMKA 2JUGA 2CRGA 2MLKA 3OIQA 5FKKA 3WTWC 3IWFA 2BY0A 3WE2A 2JJ7A 1OR7A 4AYBA 1VQ4I 3F6VA 1HW5A 4UV8A 2HVQA 3NQOA 1HOMA 2RV8A 3V7CA 4LD5A 4F93B 2NAZA 1R5GA 1QHHD 5FLXZ 1FBQA 3TL4X 2DA5A 5ICEA 2BOLA 2MGQA 1XSXA 2NVXJ 3LFKA 5CVRA 2DA4A 3GX4X 1SD6A 3CCVI 1ZG1A 3I3LA 4AVZA 3FKIJ 3QYBA 4FX0A 2RNJA 3DWLE 5ILSA 4HDUA 3HXLA 2DT7B 1K78A 3DLLF 3BP8A 2ECCA 1UHMA 3RYRA 4RBOA 1ZH5A 2EINH 3PSFA 2VJ4A 4OIPF 3ABUA 2JA7J 1BI2A 1WWXA 4EV0A 2M2EA 4EVIA 3F72A 3V8KA 1VQKI 3W6KB 3Q0VA 3ML6A 3MEXA 2DOAA 2QBYB 2IS4A 1X1DA 1ZGAA 1T8IA 3M8FA 3F3XA 1G59A 2O61A 1JGGA 2BV6A 4I0BA 1O3QA 1LUJB 4FX4A 2EA4A 5LHHA 3BTJA 3CD6I 1WJEA 2KKOA 1Y1VJ 1G3YA 2VJJA 3ZR8X 1POGA 5LGTA 3CCRI 2PMUA 1J9IA 1ZLJA 3RQIA 4HNTA 2IGMA 1YRNB 3JW4A 5LHIA 1IDZA 2MD5A 5HDNA 4A2UA 3V42A 1QRYA 4HYEA 2IP2A 4HDVA 5J47A 2WAQN 4GXOA 3LSIA 2L02A 5IPAA 1VQOI 2JVGA 3M3YJ 1R23A 3FXUA 4ETSA 1TL8A 1P7IA 4AM3A 2IT0A 5L3DA 1SFKA 2WAFA 4M74A 2IXSA 1Z3XA 3TW7A 4DOZA 1O3TA 3FXRA 2K9QA 2UWMA 4BJ6C 1IRGA 1ZN2A 1I50J 4A5NA 3ZP5A 1VQ8I 4I2OA 4LJZF 2YU3A 2ZJ2A 3GTKJ 3TP0A 3IL2A 4PJJA 3D5LA 1MMDA 4MTDA 1ZREA 1R00A 2KISA 2KIMA 3TDUC 1MGTA 4U7DA 3DV8A 2IA2A 3HTUA 2HPMA 4KN7X 4KT6A 4AC0A 3C2BA 3R4KA 3BCBA 4HW0A 3NAUA 4E4HA 3CCLI 3GTMJ 2JTVA 5DD8A 2LLKA 3RKWA 4D9JA 1FEXA 2ZCWA 3WTZA 2QQAA 4HBLA 5EZHA 4A3BJ 3B6CA 1LFBA 3M7GA 1G3SA 1HDDC 2NVUB 3PL8A 3F6OA 3ZQFA 3GYHX 3KYCB 5C44J 2FNAA 3Q9SA 1DPUA 3CUOA 2AO9A 5FGMA 1XCBA 5K7HA 4UUTA 2HYJA 3HKZA 1BJZA 2A6TA 3IAM2 3KZZA 5ICFA 2VJ5A 5J4YA 2VBYA 1X3ZB 1QZYA 1SD4A 3HRTA 3VDXA 2VKVA 3HOTA 2GQQA 3LOCA 4BQOA 3BPXA 3F23A 4A3EJ 3KLNA 4BQNA 2OQGA 5LRRA 1O4XA 4BKXA 1ZGJA 2DAOA 1Z77A 1STZA 1W4MA 2QQ8A 2LH9A 3I9V2 4EM1A 3JRHA 3REOA 3CO7C 4G7ZF 2VOPA 3FM5A 1Y8QB 5FRMA 1EH7A 2IBDA 1ZELA 4HF1A 4MEYF 2BHZA 4IOAF 1HDPA 1TW2A 3BQYA 2W4SA 2H6BA 3TKYA 2XASA 4QIWN 3BTCA 3U9GA 2ISYA 4F91B 3ECHA 2I5UA 2JA5J 2L4AA 3CP2A 3VSKA 1XGSA 2YX7A 2ZSIB 3L2CA 2QBYA 2HGCA 2KZGA 3K4LA 1D0ZA 1RR8C 2EV5A 3I4PA 1YI2I 3W2AA 2OUMA 1H0MA 4EJUA 3MZHA 2LFBA 3EDPA 4LK0F 1G4DA 1OMIA 4G7HF 4ZYAA 5F0CA 5DCMB 1U0JA 3MZ8A 2ZXWH 1YRNA 1VZ0A 2M8GX 3PQJA 4BGDA 2V1NA 1Y1WJ 2H09A 4UUVA 1P6RA 2A68F 3OYHA 3CLQA 2XKPA 1XB4A 4L9VA 4IKFA 4OU0A 3ZMUA 2P7CB 2BYVE 2XDVA 5IT9Z 3E5UA 2XUBA 1TT0A 1H8AC 4RAGA 2Y31A 5E1ZB 1O7LA 2PX9A 2DFHA 1UELB 1MMSA 1KQ8A 2FD5A 3OYGA 4LLNA 1XTAA 3ZCOA 2ZO4A 3RPUD 4E7IA 1IRZA 4XORA 2OTJI 2CU7A 5K7FA 4PJ0C 3X2QH 2VUMJ 2DMQA 4BEHB 4QLCU 3HHHA 2FBIA 1ETQA 3R6SA 2WB1A 2ETHA 2FBHA 3BPVA 1IJWC 4O6JA 1JKPC 1O57A 2BY2A 1B9MA 1FSEA 3MCZA 1AHDP 1TTYA 1I1SA 3CMEI 3DU5A 3K4JA 4OIOF 2CQ7A 2DI3A 2F5EA 3VOEA 5H2FC 3IKTA 1CF7B 4CCNA 1HSJA 2LBFB 4B09A 1AKHB 1CQTA 2Z5UA 2M45A 2OF7A 2W25A 2XAQA 2AHQA 2ZBKA 5CQEA 1HKSA 2Y30A 1FX7A 1R49A 3DP7A 2BXZA 3ZQ7A 4G6QA 5DD4A 3CC7I 1OCRH 4JOMA 2ICWG 4XICA 1KU2A 1SAUA 3SFZA 2UV1A 1TWCJ 2XSJC 3GFMA 4LB6B 2V6CA 4FHTA 1IN6A 4PGGA 4M6VA 1B4AA 4ANJA 4L9TA 4YIFA 4C3JJ 3CC4I 2DFEA 4M71A 5IY5H 3B6AA 2IGKA 1SAXA 2VKDA 1S9HA 2NVQJ 1BA5A 2VBZA 3E6BA 1VFCA 1V4RA 4IHXA 4L5JA 3C1DA 3N4MA 2WWYA 2DT6A 2L4MA 1D5VA 1E0EA 4ZH4F 3D1NI 4AUXA 2IVMA 1P7JA 2QCOA 3PNVA 4CSWA 4B8XA 2Y9ZA 1BIBA 2IA1A 4U0YA 2P81A 4IX7A 1FJLA 3RZOJ 3PIOF 3I4NJ 2IRFG 2Z9OA 5CJ9A 3HIFA 2RREA 1VTNC 2AQEA 5DCMA 2VT3A 5LLQA 1W5CC 4OOIA 2PG4A 3PM1A 1RKWA 3E7LA 1OYYA 2QQ9A 5GAGJ 2CW0F 1XDSA 2ZSHB 4C3HJ 2Y2ZA 4KIFA 1VQ5I 2PFBA 3SEZA 4QPQA 2Y0SN 3RYPA 2WA0A 1UFMA 2XGCA 2KP6A 2PMHA 4MHGA 2QLZA 4BH9A 5E8IA 1G3TA 3ZQCA 2IW5A 3K6GA 4F3QA 2LDUA 2M5WA 3LSTA 3IV5A 4PK4A 1ETKA 1XGOA 1D3YA 2ADUA 4BEHA 4IHWA 2XHKA 5FKNA 3VYSB 1JKRC 2VPLA 3JREA 3FIWA 5F04A 1K61A 2VONA 5GAEJ 3SDGA 2LY1A 4DYRA 2DDAA 3FM3A 3C7JA 4Y52J 4G9YA 1KYZA 1J5YA 2DK5A 2BVMA 3VODA 1V5GA 5GAHJ 1IXCA 1WPKA 2A6EF 1CF7A 1XDUA 3HOUJ 1AKHA 2LBFA 3T5XA 1X3WB 3FK7A 4CHUA 2M8EA 5K7ZA 3RKYA 2R7XA 3K0LA 4DQ2A 4EJTA 2RNGA 3PUFA 3VSLA 2W1OA 5E8GA 3IP4B 5E1WA 5IP9J 5BPIA 3V4GA 2DA7A 4WXHA 1S72I 1ZTRA 4BJ5C 4GYGA 3JRCA 1PVEA 2V9KA 2R92J 2X48A 3F8NA 2GOXB 3MVPA 5HDKA 4XOTA
chains in the Genus database with same CATH topology
2GAUA 3EQLF 3KEQA 4KA4A 3GVAA 2RDPA 4S04A 4Q47A 1W7PB 4HAMA 4RGXA 4Q48A 4RAZA 1S6LA 4BXUA 4M9ZA 2H94A 1YS6A 2XAJA 3WTUC 4CDGA 2CGPA 4ESFA 3Q5FA 3P9CA 4IRHA 3ZMDA 3CJNA 5IT3A 5L3CA 3ZN1A 3KCCA 2NNYA 4ENMA 4XLPF 4A12A 1FLIA 1BI1A 4N9IA 2CYYA 4YFKF 5LHGA 5A2QZ 3ISPA 4BAYA 3QU3A 2HDCA 3HRMA 1OYWA 1BM9A 3T8RA 5D8LB 4LLLA 4H0EA 3ZMVA 3I59B 5FFXA 4WK8F 1FYKA 5D5VB 3DEUA 4HV6A 4JBAA 3KZYA 1FYLA 3ULQB 1WRJA 3E5XA 2XKOA 1I5ZA 4XBFA 3BJ6A 1IN7A 4UV9A 1R58A 3P9KA 2WV0A 1S8NA 2RN7A 1LDKB 2L01A 2RGVA 4UVBA 4AD9A 4JQFA 4L5IA 4HQEA 2OBPA 1GVJA 1ONVA 4ZYEA 3IWZA 3SZPA 3V7SA 3E6MA 1OPCA 1W7PA 4I0AA 4XSZF 3LWFA 5TJJA 3C3WA 1Z9CA 1QQIA 5CYVA 1KU7A 4U0VA 3GZ5A 3K9TA 4UVAA 3F8MA 3QPHA 2V1XA 2HZTA 5J8CA 5K5QA 1MJBA 2IA0A 3KLOA 3JSPA 5FD5A 5FLXK 4EJOA 2Y48A 1EV7A 4N9HA 2O0YA 4HX4A 1HSTA 3T8TA 1R36A 5HOOA 4O3MA 1DDNA 2CWEA 2NS0A 1Z7UA 2UXNA 2A3SA 2FQ3A 3I59A 1KYWA 3CUQB 2Q2EA 3O2PE 4KICA 2RKHA 4HF0A 4I98B 2QQBA 3NRVA 5D5UB 2EA2A 3CO6C 1KQ0A 3KP3A 1KA8A 5LBQA 3J7AO 5ERIA 4KDPA 5E18F 5FD6A 1ZG5A 1KU3A 3NEUA 3D0SA 4MTEA 4LGWA 1XGNA 2FMLA 4KMUX 2NNNA 1R1UA 2IJLA 4EJVA 3JAMZ 1WSUA 1B6AA 4CYDA 4UXNA 3ZMTA 3B02A 2DQLA 1W5SA 2HYFA 4WXCA 2K02A 3BY6A 2W85A 3FXQA 1BC7C 1J0RA 2Y0MA 2A5YB 3R0AA 1U5TB 1R7JA 3KP2A 3KEOA 2ESNA 3CUQC 1TNTA 4D0PA 4Q5SF 4HLXA 2Y75A 3CUQA 1Y0UA 3TOAA 4YG2F 3K69A 5ED4A 1K7AA 5JR3A 1SD5A 1E2XA 4A0ZA 3IC7A 3GWZA 1XCVA 4MQ9F 2V1DA 1FZPB 1IW7F 2O03A 2OA4A 2DPDA 2VC1A 4P55A 4Z2YA 3JTHA 5H6RA 4YFNF 2STWA 5EEGA 1V3FA 3T1BA 3ABTA 5F1RA 2VC0A 2ELHA 2RVCA 2FU4A 2FOKA 3LQQA 4NHJA 5HDGA 3I58A 3K1PA 3V7RA 4GYIA 1ZRFA 2XVCA 3ZPLA 1J7KA 5HLHA 1KGSA 5D6FA 2WC2A 3LQRA 3FZVA 3FX3A 3E6DA 3WGGA 4ENJA 3P9IA 2DFIA 4Q4ZF 4S05A 2A07F 1R22A 4ENNA 1XSDA 3E6CC 1KQ9A 5EEHA 1FY7A 1U5TC 1ULYA 2M1BA 2R7DA 3R60A 3COAC 1TLHB 2RC4A 1U5TA 3J81Z 4R79A 3K1NA 2KJBA 3H3ZA 1G3WA 1IXRC 5JFRA 1QGPA 2XAGA 1IZ1A 2ISZA 4KUMA 3ZN0A 5E20A 1I27A 4LB5A 2M30A 2ACJA 1TQMA 4JK1X 1GXPA 1ZRDA 4YFXF 1OKRA 3V8JA 3PQKA 1XGMA 5F6FA 3WU1B 4U7BA 1ZG3A 1LB2A 3BWGA 5D4RA 2LF8A 1IUYA 5LGNA 5E1XA 4HX8A 2DQRA 3U1DA 5E17F 4LLGF 5CVIA 4A0YA 4XRFA 1P92A 1USTA 1U2WA 1T2KA 1ZYRF 2FMYA 5CVVA 3U2RA 1Q1HA 1BI3A 2G7HA 3S2WA 1R5HA 1FP1D 2P6TA 3BJAA 4RB1A 3BOQA 1QPMA 2Q8KA 3FMRA 4NB5A 1S3JA 2Z99A 1H9TA 1RIOH 3H3UA 2PBIA 2F5CA 5D4SA 2VBXA 3GLXA 1LQ1A 4L18B 1PP8F 3AAFA 1ODDA 5FB2A 4F7ZA 4KIGA 4AIKA 4U0WA 1IAWA 4EJWA 3SQNA 2B0LA 2EFNA 5ILVA 3KP5A 4EMSA 2DBBA 1FWZA 5DCFA 5AONA 2J5PA 4ZZDA 3WTSC 2EJRA 1ZAOA 4A6EA 2YSRA 4OMYA 5J8FA 2FEZA 2QWWA 3IKVA 5K5RA 1CGPA 2W24A 2GWRA 2L3DA 4LG0B 1JE8A 1HKTA 2P5LC 2A61A 1I6XA 1LEBA 1S29A 2OU2A 2P5VA 4I7HA 3MZYA 1IXSB 1HKQA 3EETA 2GA1A 4G7OF 4BYYA 5BPDA 2HKOA 1LJ9A 5ICCA 3WTXC 2UZKA 2GXBA 3Q9VA 3K1MA 1BJAA 2FA5A 3DPTA 2FBKA 3CLOA 3WGIA 4DNCA 4A0XA 2G9WA 3HHGA 4HOBA 1RZ4A 1MJ9A 3RKXA 2QUFA 2H27A 2ZXJA 2HEOA 1HXDA 1YW8A 1P4AA 3DF8A 3ROUA 1FP2A 5HS8A 3O6BB 4IRGA 4WCGA 1DPRA 3WODF 2JZYA 3R0JA 2P4WA 1U3EM 4KT5C 4EGYA 2YR2A 2FXAA 2WTEA 1O7FA 1A04A 4Y13A 1JGSA 1R1VA 1BI0A 3OV8A 3QRFF 2IPQX 1YW7A 1NHAA 4PDKA 3MQ0A 2VE9A 2KIUA 2Q0OA 4HA8A 2J5OA 3V8LA 4LG0A 3K2ZA 1B59A 3FWEA 2L54A 3FMSA 2PJPA 1YLFA 2ZNZA 1TQIA 1PP7U 1XSVA 3G3ZA 3GF2A 5DEQA 4AVPA 5DUIA 2JSCA 2HFHA 2BE5F 4IHTA 3N97A 2EK5A 3I5UA 3F8FA 4MGRA 2HKXA 3L00A 1FOKA 1BIAA 1XD7A 1YO5C 1W7PD 4AIJA 5JVTA 1UCRA 4M72A 2HS5A 2DW4A 1U8RA 4M73A 4BNCA 5K1YA 1BN5A 4HQMA 2F5DA 2V79A 4BHPA 1SFXA 4PCQA 4WF2A 1IN5A 3PFIA 3RI4A 2OD5A 4ZYDA 3TO6A 4IJAA 2HQRA 4L0YB 4GO1A 2CSOA 1L0OC 1GHCA 4BHCA 2XROA 2JRTA 3WTVC 4RB0A 2JPBA 1GXQA 1F4KA 1YIOA 5LGUA 3TDZC 4M9XA 2UXXA 5D5WB 1YW9A 5DV5A 1HW2A 4M6XA 2CQKA 4O5VA 3ZMZA 2RQPA 3WTTC 2VT2A 1MKMA 1X3UA 2BEOA 4KFCA 1SMYF 5H20A 2EV6A 5FFZA 1R1TA 3CTAA 2R3SA 3JSOA 1P4WA 2AS5F 3JTGA 1I1GA 1FPQA 3OOPA 5JHUA 4G94A 5CVJA 2VE8A 5J6XA 3GO5A 2DK8A 5CVUA 1Z6RA 5BS6A 2XAHA 1WQ2A 2Z3YA 4WX9A 4OIRF 4UVCA 1RI7A 3HSFA 1PUEE 3SHFA 1K6OA 1BC8C 3T0YA 1B1BA 2EFWA 3TO9A 2V9VA 4ESJA 3GFLA 3TOBA 3F22A 3RPQA 2E1CA 3EUHA 2BGCA 4LK1F 3HYIA 2COMA 4ZYHA 4RGUA 1S7OA 3KP4A 4IPAA 5D6EA 2PN6A 4CZZA 3WTYC 5ICGA 1WI9A 2GXGA 4KMFA 2OZ6A 1Z6TA 1YYVA 2A6HF 2YX4A 4EGZA 2LF7A 1TBXA 1XMAA 4LFUA 3L9FA 2OQRA 2F5FA 3M9AA 4A6DA 1YS7A 3DKWA 2E1NA 4KYWA 3W6JB 5L3EA 2MA3A 3EYYA 3I64A 4ZYGA 2P5KA 1DP7P 1H9GA 3J81K 4M9SA 3ZMSA 2O6GE 1Z91A 1D8KA 1FNNA 3F8CA 1HBXG 1YG2A 1AWCA 3KFWX 5AIPA 1YQAA 2X0LA 5KK1A 2HTJA 5KVRA 3J80Z 1T6SA 3GZ6A 3MWMA 2EB7A 2QM3A 3MFKA 3RJPA 1U6GA 5IT9K 3TQNA 4OMZA 2GA2A 4I02A 3VB2A 3QU6A 3RDIA 5HVQC 1JHFA 3G73A 2EWNA 4KNYA 1O3RA 2MC3A 2EFQA 1TW3A 1HQCA 2XIGA 3GFJA 1UHWA 2MH9A 1K79A 4P9UA 2CG4A 2HOEA 4P96A 2AXLA 2EFOA 4RAYA 4HF2A 3M1EA 4MQVA 1IF1A 1MD0A 5D8KB 2VN2A 2JT1A 5CLSA 3L7WA 2D1HA 3BJOA 4FT8A 2DTRA 1MDMB 2FNPA 2G7UA 2MLGA 2O3FA 3LA7A 4TV7A 4P5OA 1TQPA 3SXYA 3BROA 4G6DA 3GW2A 3I53A 4RB2C 2OZUA 1USSA 1G6NA 1C0WA 1ZHFA 1SFEA 4EM0B 2JPCA 3DXJF 1J59A 3HOSA 2DLLA 3KP6A 1T39A 2E7XA 4E70A 6PAXA 3GXOA 3DQVC 2OAZA 4EM2A 2PLYA 3ELKA 2GZWA 3RTRA 1S7AA 2FE3A 2LSOA 1JXSA 5DDGA 4CXFA 1TNSA 3HSRA 1FYMA 5LEKA 3KE2A 3I54A 1W5TA 4I09A 4CGZA 4ENKA 1DUXC 4AWXB 5HLGA 3VEPA 4ZZLA 3O3KA 1PDNC 1D8JA 5L3GA 4RGSA 3I71A 3RPUA 2HYGD 2K4BA 2P7VB 5HS7A 2VBWA 4ESBA 4U88A 1FBUA 1MDMA 5ILUA 3E3VA 3P7NA 3C18A 5JI6A 3M8EA 4P9FA 4K2EA 1FBSA 1ON2A 1BBYA 3HSEA 3TO7A 5L3FA 2LKPA 4KN4X 4XSXF 1AOYA 2FSWA 1EH8A 2QVOA 4R1HA 5F64A 1YFHA 3GFIA 4G8XA 5A2QK 3F8BA 4IHSA 1SD7A 1F5TA 3VFZA 3HTSB 2ZMEB 3I0TA 1IRFA 2ESHA 3LA3A 1LVAA 3BZ6A 1FT9A 2DO7A 4IF4A 1LDJA 3IRRA 1P4XA 2ZKZA 1T98A 3LAJA 4HLYA 4HX7A 2NYXA 3BDDA 1XN7A 2K4JA 4IRIA 4XLNF 2K86A 3F21A 4M6YA 4RGRA 3LAPA 1J75A 2O8XA 1SMTA 1SFUA 1LEAA 1P2FA 2Z33A 2LNBA 3KP7A 3MAJA 5L3BA 2R7FA 3KETA 4N0BA 5FO5A 3SZTA 2K27A 4BHBA 3WGHA 2STTA 3R61A 4ASNA 2H6CA 2P6SA 1YTYA 4PGHA 1ON1A 2XRNA 2D45A 1IN8A 3WU0A 3ERED 1E17A 4EQQA 2CFXA 4UNOA 3TGNA 4WWCA 2P8TA 2VODA 1U78A 3QOPA 3IHUA 5TRDA 1F1ZA 1Z1DA 4MEXF 2DU9A 4Y15A 4HZFA 1MZBA 2QYOA 2HQNA 2ZMEA 4I01A 3FHZA 1RUNA 3E5QA 2DT5A 1T0FA 4RS8A 2A69F 2FF4A 3QAHA 5DUKA 4KIBA 2XAFA 3B73A 3H92A 4UHTA 2PQ8A 3EYIA 4GGGA 4RB3C 2TDXA 1O3SA 1T38A 2V1UA 3RIRA 4WXDA 4Y17A 1REPC 1F9NA 1J2XA 1FSHA 4YIIA 5BMZA 1UB9A 2QENA 2K7LA 3QP5A 3GUDA 4BQAA 3GEZA 2XV4S 1ZLKA 4MNUA 3JAMK 2GIVA 3QP6A 1Z05A 2MH2A 2X4HA 2HTSA 3FF5A 1HW1A 2KRFA 3LA2A 1LDDA 3ECOA 5AIQA 5K5OA 1WKMA 4IVNA 5BQTA 1ZARA 2D2WA 1LNWA 1IN4A 1OYIA 1JHHA 2NRAC 2F2EA 5LEJA 3DPLC 2KJCA 3HUGA 4L9JA 2EFPA 2EV0A 4LMYA 2PEXA 3DFGA 1L3LA 4OIQF 4HV5A 2HWVA 4QWQA 2M87A 2E7WA 1K78B 5HLIA 5HS9A 2YPRA 4NQWA 3FMQA 4CICA 5H6QA 1EH6A 4CO8A 1FC3A 2W84A 3CDHA 5BOXA 4GCVA 2XGXA 1KU9A 4IXAA 3J80K 1RUOA 2MBFA 3IRQA 4ON0A 4L0ZB 3L09A 1ZRCA 2W57A 1MJAA 2QZ8A 3WG9A 1QBJA 4PZJA 3HRSA 5D5XB 2VOOA 3WE3A 4L9NA 5LRSA 3HRUA 2VXZA 2DPUA 2HR3A 1RNLA 3QPTA 2D1VA 1QZZA 5DYMA 4OINF 4A5MA 1BOAA 2KIFA 2C6YA 2ZNYA 4AIHA 4R8HA 1B9NA 2FRHA 2ZFWA 1QNTA 2CO5A 2BBYA 3E97A 2PI0A 1QO0D 1XMKA 2MLKA 3WTWC 3IWFA 3WE2A 1OR7A 3F6VA 1HW5A 4UV8A 3NQOA 2RV8A 3V7CA 4LD5A 5FLXZ 2NAZA 1R5GA 1FBQA 5ICEA 1XSXA 3LFKA 5CVRA 3GX4X 1SD6A 1ZG1A 4FX0A 2RNJA 5ILSA 4HDUA 1K78A 3BP8A 1UHMA 3RYRA 1ZH5A 4OIPF 3ABUA 1BI2A 1WWXA 4EV0A 4EVIA 3F72A 3V8KA 3W6KB 3ML6A 3MEXA 2QBYB 1ZGAA 3M8FA 3F3XA 2O61A 2BV6A 4I0BA 1O3QA 4FX4A 2EA4A 5LHHA 2KKOA 1G3YA 5LGTA 2PMUA 1J9IA 1ZLJA 3JW4A 5LHIA 2MD5A 5HDNA 4A2UA 4HDVA 4HYEA 2IP2A 4GXOA 2L02A 1R23A 3FXUA 4ETSA 2IT0A 5L3DA 4M74A 1O3TA 3FXRA 2UWMA 1IRGA 1ZN2A 4A5NA 3ZP5A 4I2OA 4LJZF 2YU3A 2ZJ2A 3IL2A 3D5LA 4MTDA 1ZREA 1R00A 2KIMA 3TDUC 1MGTA 4U7DA 3DV8A 2IA2A 3HTUA 4KN7X 3R4KA 4HW0A 2JTVA 5DD8A 3RKWA 2ZCWA 3WTZA 2QQAA 4HBLA 3M7GA 1G3SA 3GYHX 3F6OA 2FNAA 3Q9SA 1DPUA 3CUOA 5FGMA 1XCBA 3KZZA 5ICFA 2VBYA 3HRTA 1QZYA 1SD4A 3HOTA 2GQQA 3BPXA 3F23A 3KLNA 2OQGA 5LRRA 1ZGJA 2DAOA 1STZA 1W4MA 4EM1A 3REOA 3CO7C 4G7ZF 2VOPA 3FM5A 1EH7A 4HF1A 4MEYF 1TW2A 2H6BA 3TKYA 2XASA 3U9GA 2ISYA 3ECHA 2L4AA 1XGSA 2YX7A 3L2CA 2QBYA 2HGCA 2EV5A 3I4PA 1H0MA 4EJUA 3MZHA 3EDPA 4LK0F 1G4DA 1OMIA 4G7HF 5DCMB 3PQJA 2H09A 4UUVA 1P6RA 2A68F 2XKPA 1XB4A 4L9VA 4OU0A 3ZMUA 2P7CB 2BYVE 5IT9Z 3E5UA 2XUBA 5E1ZB 1O7LA 1KQ8A 4LLNA 2ZO4A 4QLCU 3HHHA 2FBIA 3R6SA 2ETHA 2FBHA 3BPVA 4O6JA 1O57A 1B9MA 1FSEA 3MCZA 1TTYA 1I1SA 4OIOF 2F5EA 2DI3A 3VOEA 3IKTA 1CF7B 1HSJA 4B09A 2Z5UA 2M45A 2W25A 2XAQA 2ZBKA 1HKSA 1FX7A 3DP7A 3ZQ7A 4G6QA 5DD4A 1KU2A 3SFZA 3GFMA 4LB6B 2V6CA 4FHTA 1IN6A 4PGGA 1B4AA 4L9TA 4YIFA 4M71A 1SAXA 2VBZA 3E6BA 1V4RA 4L5JA 3C1DA 3N4MA 2WWYA 2L4MA 1D5VA 4ZH4F 2IVMA 4B8XA 1BIBA 2IA1A 4U0YA 2IRFG 2Z9OA 5CJ9A 3HIFA 1VTNC 5DCMA 2VT3A 5LLQA 4OOIA 2PG4A 1OYYA 2QQ9A 2CW0F 1XDSA 4KIFA 2PFBA 3RYPA 1UFMA 2PMHA 4MHGA 4BH9A 2QLZA 5E8IA 1G3TA 2IW5A 2LDUA 2M5WA 3LSTA 1XGOA 1D3YA 2ADUA 2XHKA 2VONA 3FM3A 3C7JA 4G9YA 1KYZA 1J5YA 2DK5A 3VODA 1IXCA 1CF7A 2A6EF 1XDUA 3T5XA 4CHUA 2M8EA 3RKYA 3K0LA 4DQ2A 4EJTA 5E8GA 5E1WA 5BPIA 3V4GA 4WXHA 4GYGA 3F8NA 5HDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAU A;  3EQL F;  3KEQ A;  4KA4 A;  3GVA A;  2RDP A;  4S04 A;  4Q47 A;  1W7P B;  4HAM A;  4RGX A;  4Q48 A;  4RAZ A;  1S6L A;  4BXU A;  4M9Z A;  2H94 A;  1YS6 A;  2XAJ A;  3WTU C;  4CDG A;  2CGP A;  4ESF A;  3Q5F A;  3P9C A;  4IRH A;  3ZMD A;  3CJN A;  5IT3 A;  5L3C A;  3ZN1 A;  3KCC A;  2NNY A;  4ENM A;  4XLP F;  4A12 A;  1FLI A;  1BI1 A;  4N9I A;  2CYY A;  4YFK F;  5LHG A;  5A2Q Z;  3ISP A;  4BAY A;  3QU3 A;  2HDC A;  3HRM A;  1OYW A;  1BM9 A;  3T8R A;  5D8L B;  4LLL A;  4H0E A;  3ZMV A;  3I59 B;  5FFX A;  4WK8 F;  1FYK A;  5D5V B;  3DEU A;  4HV6 A;  4JBA A;  3KZY A;  1FYL A;  3ULQ B;  1WRJ A;  3E5X A;  2XKO A;  1I5Z A;  4XBF A;  3BJ6 A;  1IN7 A;  4UV9 A;  1R58 A;  3P9K A;  2WV0 A;  1S8N A;  2RN7 A;  1LDK B;  2L01 A;  2RGV A;  4UVB A;  4AD9 A;  4JQF A;  4L5I A;  4HQE A;  2OBP A;  1GVJ A;  1ONV A;  4ZYE A;  3IWZ A;  3SZP A;  3V7S A;  3E6M A;  1OPC A;  1W7P A;  4I0A A;  4XSZ F;  3LWF A;  5TJJ A;  3C3W A;  1Z9C A;  1QQI A;  5CYV A;  1KU7 A;  4U0V A;  3GZ5 A;  3K9T A;  4UVA A;  3F8M A;  3QPH A;  2V1X A;  2HZT A;  5J8C A;  5K5Q A;  1MJB A;  2IA0 A;  3KLO A;  3JSP A;  5FD5 A;  5FLX K;  4EJO A;  2Y48 A;  1EV7 A;  4N9H A;  2O0Y A;  4HX4 A;  1HST A;  3T8T A;  1R36 A;  5HOO A;  4O3M A;  1DDN A;  2CWE A;  2NS0 A;  1Z7U A;  2UXN A;  2A3S A;  2FQ3 A;  3I59 A;  1KYW A;  3CUQ B;  2Q2E A;  3O2P E;  4KIC A;  2RKH A;  4HF0 A;  4I98 B;  2QQB A;  3NRV A;  5D5U B;  2EA2 A;  3CO6 C;  1KQ0 A;  3KP3 A;  1KA8 A;  5LBQ A;  3J7A O;  5ERI A;  4KDP A;  5E18 F;  5FD6 A;  1ZG5 A;  1KU3 A;  3NEU A;  3D0S A;  4MTE A;  4LGW A;  1XGN A;  2FML A;  4KMU X;  2NNN A;  1R1U A;  2IJL A;  4EJV A;  3JAM Z;  1WSU A;  1B6A A;  4CYD A;  4UXN A;  3ZMT A;  3B02 A;  2DQL A;  1W5S A;  2HYF A;  4WXC A;  2K02 A;  3BY6 A;  2W85 A;  3FXQ A;  1BC7 C;  1J0R A;  2Y0M A;  2A5Y B;  3R0A A;  1U5T B;  1R7J A;  3KP2 A;  3KEO A;  2ESN A;  3CUQ C;  1TNT A;  4D0P A;  4Q5S F;  4HLX A;  2Y75 A;  3CUQ A;  1Y0U A;  3TOA A;  4YG2 F;  3K69 A;  5ED4 A;  1K7A A;  5JR3 A;  1SD5 A;  1E2X A;  4A0Z A;  3IC7 A;  3GWZ A;  1XCV A;  4MQ9 F;  2V1D A;  1FZP B;  1IW7 F;  2O03 A;  2OA4 A;  2DPD A;  2VC1 A;  4P55 A;  4Z2Y A;  3JTH A;  5H6R A;  4YFN F;  2STW A;  5EEG A;  1V3F A;  3T1B A;  3ABT A;  5F1R A;  2VC0 A;  2ELH A;  2RVC A;  2FU4 A;  2FOK A;  3LQQ A;  4NHJ A;  5HDG A;  3I58 A;  3K1P A;  3V7R A;  4GYI A;  1ZRF A;  2XVC A;  3ZPL A;  1J7K A;  5HLH A;  1KGS A;  5D6F A;  2WC2 A;  3LQR A;  3FZV A;  3FX3 A;  3E6D A;  3WGG A;  4ENJ A;  3P9I A;  2DFI A;  4Q4Z F;  4S05 A;  2A07 F;  1R22 A;  4ENN A;  1XSD A;  3E6C C;  1KQ9 A;  5EEH A;  1FY7 A;  1U5T C;  1ULY A;  2M1B A;  2R7D A;  3R60 A;  3COA C;  1TLH B;  2RC4 A;  1U5T A;  3J81 Z;  4R79 A;  3K1N A;  2KJB A;  3H3Z A;  1G3W A;  1IXR C;  5JFR A;  1QGP A;  2XAG A;  1IZ1 A;  2ISZ A;  4KUM A;  3ZN0 A;  5E20 A;  1I27 A;  4LB5 A;  2M30 A;  2ACJ A;  1TQM A;  4JK1 X;  1GXP A;  1ZRD A;  4YFX F;  1OKR A;  3V8J A;  3PQK A;  1XGM A;  5F6F A;  3WU1 B;  4U7B A;  1ZG3 A;  1LB2 A;  3BWG A;  5D4R A;  2LF8 A;  1IUY A;  5LGN A;  5E1X A;  4HX8 A;  2DQR A;  3U1D A;  5E17 F;  4LLG F;  5CVI A;  4A0Y A;  4XRF A;  1P92 A;  1UST A;  1U2W A;  1T2K A;  1ZYR F;  2FMY A;  5CVV A;  3U2R A;  1Q1H A;  1BI3 A;  2G7H A;  3S2W A;  1R5H A;  1FP1 D;  2P6T A;  3BJA A;  4RB1 A;  3BOQ A;  1QPM A;  2Q8K A;  3FMR A;  4NB5 A;  1S3J A;  2Z99 A;  1H9T A;  1RIO H;  3H3U A;  2PBI A;  2F5C A;  5D4S A;  2VBX A;  3GLX A;  1LQ1 A;  4L18 B;  1PP8 F;  3AAF A;  1ODD A;  5FB2 A;  4F7Z A;  4KIG A;  4AIK A;  4U0W A;  1IAW A;  4EJW A;  3SQN A;  2B0L A;  2EFN A;  5ILV A;  3KP5 A;  4EMS A;  2DBB A;  1FWZ A;  5DCF A;  5AON A;  2J5P A;  4ZZD A;  3WTS C;  2EJR A;  1ZAO A;  4A6E A;  2YSR A;  4OMY A;  5J8F A;  2FEZ A;  2QWW A;  3IKV A;  5K5R A;  1CGP A;  2W24 A;  2GWR A;  2L3D A;  4LG0 B;  1JE8 A;  1HKT A;  2P5L C;  2A61 A;  1I6X A;  1LEB A;  1S29 A;  2OU2 A;  2P5V A;  4I7H A;  3MZY A;  1IXS B;  1HKQ A;  3EET A;  2GA1 A;  4G7O F;  4BYY A;  5BPD A;  2HKO A;  1LJ9 A;  5ICC A;  3WTX C;  2UZK A;  2GXB A;  3Q9V A;  3K1M A;  1BJA A;  2FA5 A;  3DPT A;  2FBK A;  3CLO A;  3WGI A;  4DNC A;  4A0X A;  2G9W A;  3HHG A;  4HOB A;  1RZ4 A;  1MJ9 A;  3RKX A;  2QUF A;  2H27 A;  2ZXJ A;  2HEO A;  1HXD A;  1YW8 A;  1P4A A;  3DF8 A;  3ROU A;  1FP2 A;  5HS8 A;  3O6B B;  4IRG A;  4WCG A;  1DPR A;  3WOD F;  2JZY A;  3R0J A;  2P4W A;  1U3E M;  4KT5 C;  4EGY A;  2YR2 A;  2FXA A;  2WTE A;  1O7F A;  1A04 A;  4Y13 A;  1JGS A;  1R1V A;  1BI0 A;  3OV8 A;  3QRF F;  2IPQ X;  1YW7 A;  1NHA A;  4PDK A;  3MQ0 A;  2VE9 A;  2KIU A;  2Q0O A;  4HA8 A;  2J5O A;  3V8L A;  4LG0 A;  3K2Z A;  1B59 A;  3FWE A;  2L54 A;  3FMS A;  2PJP A;  1YLF A;  2ZNZ A;  1TQI A;  1PP7 U;  1XSV A;  3G3Z A;  3GF2 A;  5DEQ A;  4AVP A;  5DUI A;  2JSC A;  2HFH A;  2BE5 F;  4IHT A;  3N97 A;  2EK5 A;  3I5U A;  3F8F A;  4MGR A;  2HKX A;  3L00 A;  1FOK A;  1BIA A;  1XD7 A;  1YO5 C;  1W7P D;  4AIJ A;  5JVT A;  1UCR A;  4M72 A;  2HS5 A;  2DW4 A;  1U8R A;  4M73 A;  4BNC A;  5K1Y A;  1BN5 A;  4HQM A;  2F5D A;  2V79 A;  4BHP A;  1SFX A;  4PCQ A;  4WF2 A;  1IN5 A;  3PFI A;  3RI4 A;  2OD5 A;  4ZYD A;  3TO6 A;  4IJA A;  2HQR A;  4L0Y B;  4GO1 A;  2CSO A;  1L0O C;  1GHC A;  4BHC A;  2XRO A;  2JRT A;  3WTV C;  4RB0 A;  2JPB A;  1GXQ A;  1F4K A;  1YIO A;  5LGU A;  3TDZ C;  4M9X A;  2UXX A;  5D5W B;  1YW9 A;  5DV5 A;  1HW2 A;  4M6X A;  2CQK A;  4O5V A;  3ZMZ A;  2RQP A;  3WTT C;  2VT2 A;  1MKM A;  1X3U A;  2BEO A;  4KFC A;  1SMY F;  5H20 A;  2EV6 A;  5FFZ A;  1R1T A;  3CTA A;  2R3S A;  3JSO A;  1P4W A;  2AS5 F;  3JTG A;  1I1G A;  1FPQ A;  3OOP A;  5JHU A;  4G94 A;  5CVJ A;  2VE8 A;  5J6X A;  3GO5 A;  2DK8 A;  5CVU A;  1Z6R A;  5BS6 A;  2XAH A;  1WQ2 A;  2Z3Y A;  4WX9 A;  4OIR F;  4UVC A;  1RI7 A;  3HSF A;  1PUE E;  3SHF A;  1K6O A;  1BC8 C;  3T0Y A;  1B1B A;  2EFW A;  3TO9 A;  2V9V A;  4ESJ A;  3GFL A;  3TOB A;  3F22 A;  3RPQ A;  2E1C A;  3EUH A;  2BGC A;  4LK1 F;  3HYI A;  2COM A;  4ZYH A;  4RGU A;  1S7O A;  3KP4 A;  4IPA A;  5D6E A;  2PN6 A;  4CZZ A;  3WTY C;  5ICG A;  1WI9 A;  2GXG A;  4KMF A;  2OZ6 A;  1Z6T A;  1YYV A;  2A6H F;  2YX4 A;  4EGZ A;  2LF7 A;  1TBX A;  1XMA A;  4LFU A;  3L9F A;  2OQR A;  2F5F A;  3M9A A;  4A6D A;  1YS7 A;  3DKW A;  2E1N A;  4KYW A;  3W6J B;  5L3E A;  2MA3 A;  3EYY A;  3I64 A;  4ZYG A;  2P5K A;  1DP7 P;  1H9G A;  3J81 K;  4M9S A;  3ZMS A;  2O6G E;  1Z91 A;  1D8K A;  1FNN A;  3F8C A;  1HBX G;  1YG2 A;  1AWC A;  3KFW X;  5AIP A;  1YQA A;  2X0L A;  5KK1 A;  2HTJ A;  5KVR A;  3J80 Z;  1T6S A;  3GZ6 A;  3MWM A;  2EB7 A;  2QM3 A;  3MFK A;  3RJP A;  1U6G A;  5IT9 K;  3TQN A;  4OMZ A;  2GA2 A;  4I02 A;  3VB2 A;  3QU6 A;  3RDI A;  5HVQ C;  1JHF A;  3G73 A;  2EWN A;  4KNY A;  1O3R A;  2MC3 A;  2EFQ A;  1TW3 A;  1HQC A;  2XIG A;  3GFJ A;  1UHW A;  2MH9 A;  1K79 A;  4P9U A;  2CG4 A;  2HOE A;  4P96 A;  2AXL A;  2EFO A;  4RAY A;  4HF2 A;  3M1E A;  4MQV A;  1IF1 A;  1MD0 A;  5D8K B;  2VN2 A;  2JT1 A;  5CLS A;  3L7W A;  2D1H A;  3BJO A;  4FT8 A;  2DTR A;  1MDM B;  2FNP A;  2G7U A;  2MLG A;  2O3F A;  3LA7 A;  4TV7 A;  4P5O A;  1TQP A;  3SXY A;  3BRO A;  4G6D A;  3GW2 A;  3I53 A;  4RB2 C;  2OZU A;  1USS A;  1G6N A;  1C0W A;  1ZHF A;  1SFE A;  4EM0 B;  2JPC A;  3DXJ F;  1J59 A;  3HOS A;  2DLL A;  3KP6 A;  1T39 A;  2E7X A;  4E70 A;  6PAX A;  3GXO A;  3DQV C;  2OAZ A;  4EM2 A;  2PLY A;  3ELK A;  2GZW A;  3RTR A;  1S7A A;  2FE3 A;  2LSO A;  1JXS A;  5DDG A;  4CXF A;  1TNS A;  3HSR A;  1FYM A;  5LEK A;  3KE2 A;  3I54 A;  1W5T A;  4I09 A;  4CGZ A;  4ENK A;  1DUX C;  4AWX B;  5HLG A;  3VEP A;  4ZZL A;  3O3K A;  1PDN C;  1D8J A;  5L3G A;  4RGS A;  3I71 A;  3RPU A;  2HYG D;  2K4B A;  2P7V B;  5HS7 A;  2VBW A;  4ESB A;  4U88 A;  1FBU A;  1MDM A;  5ILU A;  3E3V A;  3P7N A;  3C18 A;  5JI6 A;  3M8E A;  4P9F A;  4K2E A;  1FBS A;  1ON2 A;  1BBY A;  3HSE A;  3TO7 A;  5L3F A;  2LKP A;  4KN4 X;  4XSX F;  1AOY A;  2FSW A;  1EH8 A;  2QVO A;  4R1H A;  5F64 A;  1YFH A;  3GFI A;  4G8X A;  5A2Q K;  3F8B A;  4IHS A;  1SD7 A;  1F5T A;  3VFZ A;  3HTS B;  2ZME B;  3I0T A;  1IRF A;  2ESH A;  3LA3 A;  1LVA A;  3BZ6 A;  1FT9 A;  2DO7 A;  4IF4 A;  1LDJ A;  3IRR A;  1P4X A;  2ZKZ A;  1T98 A;  3LAJ A;  4HLY A;  4HX7 A;  2NYX A;  3BDD A;  1XN7 A;  2K4J A;  4IRI A;  4XLN F;  2K86 A;  3F21 A;  4M6Y A;  4RGR A;  3LAP A;  1J75 A;  2O8X A;  1SMT A;  1SFU A;  1LEA A;  1P2F A;  2Z33 A;  2LNB A;  3KP7 A;  3MAJ A;  5L3B A;  2R7F A;  3KET A;  4N0B A;  5FO5 A;  3SZT A;  2K27 A;  4BHB A;  3WGH A;  2STT A;  3R61 A;  4ASN A;  2H6C A;  2P6S A;  1YTY A;  4PGH A;  1ON1 A;  2XRN A;  2D45 A;  1IN8 A;  3WU0 A;  3ERE D;  1E17 A;  4EQQ A;  2CFX A;  4UNO A;  3TGN A;  4WWC A;  2P8T A;  2VOD A;  1U78 A;  3QOP A;  3IHU A;  5TRD A;  1F1Z A;  1Z1D A;  4MEX F;  2DU9 A;  4Y15 A;  4HZF A;  1MZB A;  2QYO A;  2HQN A;  2ZME A;  4I01 A;  3FHZ A;  1RUN A;  3E5Q A;  2DT5 A;  1T0F A;  4RS8 A;  2A69 F;  2FF4 A;  3QAH A;  5DUK A;  4KIB A;  2XAF A;  3B73 A;  3H92 A;  4UHT A;  2PQ8 A;  3EYI A;  4GGG A;  4RB3 C;  2TDX A;  1O3S A;  1T38 A;  2V1U A;  3RIR A;  4WXD A;  4Y17 A;  1REP C;  1F9N A;  1J2X A;  1FSH A;  4YII A;  5BMZ A;  1UB9 A;  2QEN A;  2K7L A;  3QP5 A;  3GUD A;  4BQA A;  3GEZ A;  2XV4 S;  1ZLK A;  4MNU A;  3JAM K;  2GIV A;  3QP6 A;  1Z05 A;  2MH2 A;  2X4H A;  2HTS A;  3FF5 A;  1HW1 A;  2KRF A;  3LA2 A;  1LDD A;  3ECO A;  5AIQ A;  5K5O A;  1WKM A;  4IVN A;  5BQT A;  1ZAR A;  2D2W A;  1LNW A;  1IN4 A;  1OYI A;  1JHH A;  2NRA C;  2F2E A;  5LEJ A;  3DPL C;  2KJC A;  3HUG A;  4L9J A;  2EFP A;  2EV0 A;  4LMY A;  2PEX A;  3DFG A;  1L3L A;  4OIQ F;  4HV5 A;  2HWV A;  4QWQ A;  2M87 A;  2E7W A;  1K78 B;  5HLI A;  5HS9 A;  2YPR A;  4NQW A;  3FMQ A;  4CIC A;  5H6Q A;  1EH6 A;  4CO8 A;  1FC3 A;  2W84 A;  3CDH A;  5BOX A;  4GCV A;  2XGX A;  1KU9 A;  4IXA A;  3J80 K;  1RUO A;  2MBF A;  3IRQ A;  4ON0 A;  4L0Z B;  3L09 A;  1ZRC A;  2W57 A;  1MJA A;  2QZ8 A;  3WG9 A;  1QBJ A;  4PZJ A;  3HRS A;  5D5X B;  2VOO A;  3WE3 A;  4L9N A;  5LRS A;  3HRU A;  2VXZ A;  2DPU A;  2HR3 A;  1RNL A;  3QPT A;  2D1V A;  1QZZ A;  5DYM A;  4OIN F;  4A5M A;  1BOA A;  2KIF A;  2C6Y A;  2ZNY A;  4AIH A;  4R8H A;  1B9N A;  2FRH A;  2ZFW A;  1QNT A;  2CO5 A;  2BBY A;  3E97 A;  2PI0 A;  1QO0 D;  1XMK A;  2MLK A;  3WTW C;  3IWF A;  3WE2 A;  1OR7 A;  3F6V A;  1HW5 A;  4UV8 A;  3NQO A;  2RV8 A;  3V7C A;  4LD5 A;  5FLX Z;  2NAZ A;  1R5G A;  1FBQ A;  5ICE A;  1XSX A;  3LFK A;  5CVR A;  3GX4 X;  1SD6 A;  1ZG1 A;  4FX0 A;  2RNJ A;  5ILS A;  4HDU A;  1K78 A;  3BP8 A;  1UHM A;  3RYR A;  1ZH5 A;  4OIP F;  3ABU A;  1BI2 A;  1WWX A;  4EV0 A;  4EVI A;  3F72 A;  3V8K A;  3W6K B;  3ML6 A;  3MEX A;  2QBY B;  1ZGA A;  3M8F A;  3F3X A;  2O61 A;  2BV6 A;  4I0B A;  1O3Q A;  4FX4 A;  2EA4 A;  5LHH A;  2KKO A;  1G3Y A;  5LGT A;  2PMU A;  1J9I A;  1ZLJ A;  3JW4 A;  5LHI A;  2MD5 A;  5HDN A;  4A2U A;  4HDV A;  4HYE A;  2IP2 A;  4GXO A;  2L02 A;  1R23 A;  3FXU A;  4ETS A;  2IT0 A;  5L3D A;  4M74 A;  1O3T A;  3FXR A;  2UWM A;  1IRG A;  1ZN2 A;  4A5N A;  3ZP5 A;  4I2O A;  4LJZ F;  2YU3 A;  2ZJ2 A;  3IL2 A;  3D5L A;  4MTD A;  1ZRE A;  1R00 A;  2KIM A;  3TDU C;  1MGT A;  4U7D A;  3DV8 A;  2IA2 A;  3HTU A;  4KN7 X;  3R4K A;  4HW0 A;  2JTV A;  5DD8 A;  3RKW A;  2ZCW A;  3WTZ A;  2QQA A;  4HBL A;  3M7G A;  1G3S A;  3GYH X;  3F6O A;  2FNA A;  3Q9S A;  1DPU A;  3CUO A;  5FGM A;  1XCB A;  3KZZ A;  5ICF A;  2VBY A;  3HRT A;  1QZY A;  1SD4 A;  3HOT A;  2GQQ A;  3BPX A;  3F23 A;  3KLN A;  2OQG A;  5LRR A;  1ZGJ A;  2DAO A;  1STZ A;  1W4M A;  4EM1 A;  3REO A;  3CO7 C;  4G7Z F;  2VOP A;  3FM5 A;  1EH7 A;  4HF1 A;  4MEY F;  1TW2 A;  2H6B A;  3TKY A;  2XAS A;  3U9G A;  2ISY A;  3ECH A;  2L4A A;  1XGS A;  2YX7 A;  3L2C A;  2QBY A;  2HGC A;  2EV5 A;  3I4P A;  1H0M A;  4EJU A;  3MZH A;  3EDP A;  4LK0 F;  1G4D A;  1OMI A;  4G7H F;  5DCM B;  3PQJ A;  2H09 A;  4UUV A;  1P6R A;  2A68 F;  2XKP A;  1XB4 A;  4L9V A;  4OU0 A;  3ZMU A;  2P7C B;  2BYV E;  5IT9 Z;  3E5U A;  2XUB A;  5E1Z B;  1O7L A;  1KQ8 A;  4LLN A;  2ZO4 A;  4QLC U;  3HHH A;  2FBI A;  3R6S A;  2ETH A;  2FBH A;  3BPV A;  4O6J A;  1O57 A;  1B9M A;  1FSE A;  3MCZ A;  1TTY A;  1I1S A;  4OIO F;  2F5E A;  2DI3 A;  3VOE A;  3IKT A;  1CF7 B;  1HSJ A;  4B09 A;  2Z5U A;  2M45 A;  2W25 A;  2XAQ A;  2ZBK A;  1HKS A;  1FX7 A;  3DP7 A;  3ZQ7 A;  4G6Q A;  5DD4 A;  1KU2 A;  3SFZ A;  3GFM A;  4LB6 B;  2V6C A;  4FHT A;  1IN6 A;  4PGG A;  1B4A A;  4L9T A;  4YIF A;  4M71 A;  1SAX A;  2VBZ A;  3E6B A;  1V4R A;  4L5J A;  3C1D A;  3N4M A;  2WWY A;  2L4M A;  1D5V A;  4ZH4 F;  2IVM A;  4B8X A;  1BIB A;  2IA1 A;  4U0Y A;  2IRF G;  2Z9O A;  5CJ9 A;  3HIF A;  1VTN C;  5DCM A;  2VT3 A;  5LLQ A;  4OOI A;  2PG4 A;  1OYY A;  2QQ9 A;  2CW0 F;  1XDS A;  4KIF A;  2PFB A;  3RYP A;  1UFM A;  2PMH A;  4MHG A;  4BH9 A;  2QLZ A;  5E8I A;  1G3T A;  2IW5 A;  2LDU A;  2M5W A;  3LST A;  1XGO A;  1D3Y A;  2ADU A;  2XHK A;  2VON A;  3FM3 A;  3C7J A;  4G9Y A;  1KYZ A;  1J5Y A;  2DK5 A;  3VOD A;  1IXC A;  1CF7 A;  2A6E F;  1XDU A;  3T5X A;  4CHU A;  2M8E A;  3RKY A;  3K0L A;  4DQ2 A;  4EJT A;  5E8G A;  5E1W A;  5BPI A;  3V4G A;  4WXH A;  4GYG A;  3F8N A;  5HDK A; 
#chains in the Genus database with same CATH topology
 2GAU A;  4I6Z A;  2LK2 A;  2NOG A;  3EQL F;  1FIA A;  2WBM A;  3OYM A;  2KZV A;  1DGR M;  1MND A;  3HGG A;  5IYD J;  3KEQ A;  4KA4 A;  3GVA A;  2RDP A;  1QU3 A;  3BR6 A;  1XC5 A;  4S04 A;  2BY3 A;  4Q47 A;  1W7P B;  2OJE D;  4HAM A;  4RGX A;  4Q48 A;  4RAZ A;  1S6L A;  3GCM A;  2D5V A;  4BXU A;  2O8K A;  4M9Z A;  2MYS A;  3CCM I;  3OL4 A;  1ETV A;  2LVS A;  2VXD A;  1Y6I A;  2H94 A;  1YS6 A;  2XAJ A;  4PUS A;  3WTU C;  1OCZ H;  5TIS C;  1OCC H;  3MKY B;  4CDG A;  3KZI C;  5CPR B;  2CGP A;  2IS2 A;  4ESF A;  3Q5F A;  2K85 A;  3P9C A;  4IRH A;  2F4M B;  3ZMD A;  4PSX A;  1ERD A;  5F0F A;  5GTI C;  3CJN A;  5IT3 A;  5L3C A;  3ZN1 A;  3KCC A;  2NNY A;  4ENM A;  2F6C A;  4XLP F;  4CYC B;  4A12 A;  2BHY A;  1FLI A;  3IUO A;  1BI1 A;  4N9I A;  2CYY A;  3CC2 I;  1DU0 A;  4V2F A;  5J3L A;  3ZQH A;  2CJJ A;  4YFK F;  4A3L J;  2EZI A;  2L9N A;  5LHG A;  3P5J A;  5A2Q Z;  1JT0 A;  2WAD A;  3ISP A;  5F27 A;  4BAY A;  3S15 J;  3QU3 A;  2DFF A;  3NWS A;  3HOX J;  2HDC A;  3HRM A;  1OYW A;  5BNG A;  1BM9 A;  1F36 A;  2CQN A;  1WH7 A;  4HST A;  3T8R A;  4BQQ A;  3BZK A;  4RMN A;  3K4K A;  5D8L B;  4LLL A;  4H0E A;  4XLF A;  3ZMV A;  3I59 B;  2BZT A;  5FFX A;  4C9Y A;  4WK8 F;  2Q2E B;  1FYK A;  2PJR B;  3G1O A;  2M4K A;  5D5V B;  2YUS A;  2K3P A;  3DEU A;  2QEX I;  3GTO J;  1IV6 A;  4HV6 A;  1Z67 A;  1BW6 A;  3KZY A;  2LC2 A;  4JBA A;  5JLX A;  3ULQ B;  4XKC A;  1FYL A;  4E7L A;  1WRJ A;  3E5X A;  2XKO A;  1I5Z A;  4FE4 A;  5CQG A;  5IP7 J;  4XBF A;  2YS9 A;  3BJ6 A;  1IN7 A;  2K3F A;  4UV9 A;  1X1C A;  3HPG A;  3AL0 C;  4RM3 A;  1IRX A;  1R58 A;  1JJ6 C;  2VKH A;  3P9K A;  2E1M B;  4CH7 A;  2WV0 A;  1S8N A;  4J00 A;  1VF9 A;  2LD5 A;  1LFP A;  2RN7 A;  1EF4 A;  1LDK B;  2L01 A;  1K83 J;  2RGV A;  4UVB A;  2R7R A;  1SVL A;  3ZQI A;  3K4C A;  1Z3Y A;  2W82 A;  3G1L A;  4AD9 A;  4JQF A;  4L5I A;  4HQE A;  3H9J A;  2OBP A;  1GVJ A;  4F92 B;  1ONV A;  4ZYE A;  5M5Y J;  4Y7N J;  3IWZ A;  3SZP A;  3V7S A;  4KIS A;  3E6M A;  1OPC A;  1W7P A;  4I0A A;  4XSZ F;  3AKZ A;  4W97 A;  4HRI A;  3LWF A;  2FUG 2;  2TCT A;  5TJJ A;  3L1P A;  3C3W A;  1FMV A;  2CW7 A;  1H88 C;  3BTL A;  2K9N A;  1Z9C A;  3HG9 A;  1QHG A;  4HNU A;  1T33 A;  1TC3 C;  4B1R A;  1RC9 A;  2XPU A;  1QQI A;  3G71 I;  1UG0 A;  3Q0U A;  2DMU A;  5CYV A;  1DGW Y;  4U0V A;  3GZ5 A;  1YIT I;  1KU7 A;  2KRC A;  1DQU A;  4ZTF A;  3K9T A;  4CZC A;  4UVA A;  3F8M A;  2K5C A;  3QPH A;  1YJW I;  2V1X A;  2HZT A;  5J8C A;  5KAF C;  5K5Q A;  4CYC A;  1MJB A;  2IA0 A;  3KLO A;  3JSP A;  3PJR A;  3ABK H;  3ESW B;  5FD5 A;  2R7Z J;  4EJO A;  5FLX K;  4E6K G;  2Y48 A;  3IH3 A;  1EV7 A;  2HQ5 A;  4N9H A;  3RKQ A;  4B44 A;  5JLW A;  2O0Y A;  2NVY J;  4HX4 A;  1HST A;  3T8T A;  1R36 A;  2CH0 A;  3HGY A;  5HOO A;  4O3M A;  1DDN A;  2CWE A;  2NS0 A;  1Z7U A;  5DM6 F;  3CJQ B;  1RR7 A;  4XON A;  2UXN A;  2A3S A;  2FQ3 A;  2A5W A;  3I59 A;  1KYW A;  3QOD A;  1QA6 A;  3CUQ B;  2Q2E A;  3O2P E;  2PJR A;  4KIC A;  1A35 A;  4A3J J;  2RKH A;  3S1R J;  3H9Q A;  4N4O B;  4DZP A;  4HF0 A;  2XF6 A;  4I98 B;  2QQB A;  3NRV A;  5D5U B;  2EA2 A;  2LMD A;  2QSG X;  3CO6 C;  1KQ0 A;  2WY7 Q;  3KP3 A;  4HEA 2;  1KA8 A;  2E1M C;  5LBQ A;  2IS6 A;  2CUJ A;  3FK6 A;  3J7A O;  2VJI A;  2IGN A;  5FKL A;  2GLO A;  1WVR A;  5ERI A;  4KDP A;  3JRI A;  3I4M J;  5E18 F;  5FD6 A;  3LFU A;  2XB5 A;  1ZG5 A;  4PJL A;  1U9O A;  2V9P A;  5FKO A;  5DTD A;  1KU3 A;  1NG7 A;  4BXF A;  3NEU A;  2X6Y A;  3D0S A;  3LSR A;  2BVL A;  4MTE A;  3BR2 A;  3EUH C;  4LGW A;  5E3O A;  4ZC3 A;  4BS9 A;  1XGN A;  4BUP A;  2CMP A;  4B3X A;  3DTE A;  1XG1 A;  2FML A;  5HLT A;  4KMU X;  2NNN A;  1MBG A;  1GVD A;  3U1K A;  4N4N B;  1RET A;  1R1U A;  2IJL A;  4EJV A;  2JA8 J;  1UG2 A;  4L5E A;  2VL8 A;  4A3G J;  1X19 A;  2VB6 A;  3JAM Z;  1JTY A;  3H5N A;  1WSU A;  2VQL A;  1B6A A;  1MSE C;  1MH3 A;  4UXN A;  3ZMT A;  4CYD A;  1NK2 P;  3B02 A;  1G2H A;  2DQL A;  4XRS A;  1YE9 A;  2VI6 A;  1W5S A;  2HYF A;  4WXC A;  3SFI A;  4NC8 A;  3AG1 H;  4CUG A;  3CCU I;  3HOZ J;  2MD0 A;  4FTH A;  1LVK A;  4HPQ A;  1WHU A;  3MMY B;  3ZXS A;  2K02 A;  2Y69 H;  4XLH A;  4CCL A;  3BY6 A;  1PUF B;  2W85 A;  2EPF A;  3FXQ A;  4IQ4 A;  1BC7 C;  1BW5 A;  3BC8 A;  2QSH X;  1MNE A;  3QQA A;  1A6Q A;  1EJ9 A;  1MBH A;  1J0R A;  2Y0M A;  1D5Y A;  4M3D A;  2A5Y B;  2DYR H;  3R0A A;  5J1R A;  2X1E A;  1U5T B;  1R7J A;  3KP2 A;  3RSN A;  2XRL A;  2E71 A;  2ESN A;  3KEO A;  3CUQ C;  1TNT A;  3PIP F;  3LNQ A;  4D0P A;  4Q5S F;  4HLX A;  3OR1 C;  3FXK A;  2Y75 A;  2E35 A;  3CUQ A;  4LIT A;  1Y0U A;  4RM2 A;  2IS1 A;  2I10 A;  1MMA A;  3TOA A;  2JSP A;  4YG2 F;  3K69 A;  3FDY A;  2LG4 A;  3M1C A;  5ED4 A;  1WJF A;  1K7A A;  3OIO A;  5JR3 A;  1SD5 A;  1E2X A;  4A0Z A;  3IC7 A;  1YX3 A;  3GWZ A;  1XCV A;  2IAI A;  3QYE A;  4D5C A;  4MQ9 F;  2V1D A;  2KDO A;  3W6V A;  1FZP B;  2CW8 A;  1IW7 F;  4A93 J;  4X6A J;  2EH3 A;  2O03 A;  2LOO A;  2OA4 A;  2DPD A;  2VC1 A;  2RAE A;  2KRH A;  2XSD C;  4P55 A;  4Z2Y A;  4BAC A;  1GV5 A;  3K4B A;  2JQ7 A;  2E1O A;  5EJC A;  3JTH A;  1VQ6 I;  5H6R A;  4YFN F;  2STW A;  4XL9 A;  5EEG A;  1V3F A;  1FOW A;  3T1B A;  3OSF A;  3ABT A;  1ETY A;  1ORK A;  5F1R A;  2VC0 A;  2ELH A;  2RVC A;  3WHC A;  4DIQ A;  2FU4 A;  2FOK A;  3FXM A;  3OWT A;  3HOY J;  3LQQ A;  4NHJ A;  5HDG A;  1WGX A;  3I58 A;  4BJT A;  3K1P A;  4HSR A;  2HZD A;  3V7R A;  4GYI A;  2K9S A;  1ZRF A;  2XVC A;  3ZPL A;  4UY8 I;  1J7K A;  5HLH A;  2B7E A;  1ETX A;  1KGS A;  5D6F A;  4I99 C;  1TWH J;  2WC2 A;  3OR2 C;  3LQR A;  3FZV A;  5C4X J;  3FX3 A;  1BR1 A;  3E6D A;  2VQC A;  3WGG A;  4ENJ A;  3P9I A;  2ID6 A;  4XRM A;  2DFI A;  2BXY A;  1OCO H;  4Q4Z F;  1PUF A;  4S05 A;  4B48 A;  1R22 A;  2A07 F;  4ENN A;  1XSD A;  3JRG A;  3E6C C;  1KQ9 A;  5EEH A;  1FY7 A;  1JUP A;  3RCO A;  3IH2 A;  1U5T C;  4C2T A;  5GAD J;  2R7S A;  1ULY A;  2M1B A;  2R7D A;  3R60 A;  3COA C;  2VLA A;  1WFX A;  1TLH B;  2RC4 A;  3TBI A;  1U5T A;  3J81 Z;  5FLV A;  4R79 A;  3K1N A;  2KJB A;  3H3Z A;  1G3W A;  1IXR C;  4Y4R A;  3G2B A;  1I3Q J;  1FMW A;  5JFR A;  1SAN A;  1QGP A;  3OYN A;  2XAG A;  1IZ1 A;  2ISZ A;  1K6Y A;  2WAQ A;  3JRF A;  4KUM A;  3ZN0 A;  2CUE A;  3CCJ I;  5E20 A;  3SZG A;  5C3E J;  1E3O C;  2CUF A;  3OYC A;  1I27 A;  2EQR A;  4LB5 A;  3D5R C;  3HBL A;  3IH4 A;  2M30 A;  2ACJ A;  1TQM A;  4JK1 X;  1GXP A;  1ZRD A;  4YFX F;  1M1E B;  2ME0 A;  1OKR A;  2ZXI A;  4BY7 J;  1WCM J;  4IO9 F;  3V8J A;  4X0G A;  5FRN A;  4W1U A;  4LOC A;  3PQK A;  5E3M A;  1XGM A;  3CF5 F;  5F6F A;  3NWT A;  2DA2 A;  3GBG A;  3WU1 B;  4U7B A;  1YJ9 I;  1MMG A;  2B9S A;  1IO2 A;  1ZG3 A;  1JT6 A;  1LB2 A;  3BWG A;  3H3V K;  1P9Q C;  5D4R A;  3CDL A;  2LF8 A;  4B4C A;  1IUY A;  2CUZ A;  5LGN A;  5E1X A;  4JX5 A;  3HZJ A;  4KJZ A;  3LL7 A;  4HX8 A;  5FKM A;  2DQR A;  2DCE A;  1YOV B;  5KHD A;  2JMW A;  2HVS A;  3U1D A;  1FTZ A;  5E17 F;  4E7S A;  4LLG F;  5CVI A;  4A0Y A;  3ZQL A;  1TT5 B;  4XRF A;  3CJR B;  4DBQ A;  1P92 A;  1UST A;  3S17 J;  1U2W A;  1D1B A;  1FIP A;  2FJ1 A;  1T2K A;  1ZYR F;  2FMY A;  4A3D J;  5CVV A;  4V19 K;  3HJE A;  3VPR A;  2AQF A;  3O8G A;  3U2R A;  1XS9 A;  2W48 A;  1Q1H A;  1BI3 A;  2G7H A;  4BDZ A;  2LRD A;  3S2W A;  1R5H A;  1FP1 D;  2HI3 A;  3C2G A;  3FXL A;  2W00 A;  2P6T A;  3BJA A;  4S0H B;  2DJN A;  4CA0 A;  2M4G A;  4RB1 A;  4BE1 A;  3BOQ A;  1ZR4 A;  1MBF A;  1QPM A;  5F1J A;  2Q8K A;  3FMR A;  4NB5 A;  1S3J A;  2H8W A;  2Z99 A;  1H9T A;  3KX2 A;  1RIO H;  1XPX A;  3H3U A;  5J4V A;  4A3F J;  2PBI A;  2F5C A;  2R7V A;  4ZDO A;  3S3O A;  2R93 J;  5D4S A;  3PO3 J;  1UJ8 A;  1R4N B;  2VBX A;  3AFH A;  4D1Q A;  4MO7 A;  1Z7L A;  3LSJ A;  3GLX A;  4OAY A;  1LQ1 A;  4L18 B;  1WJC A;  2HDW A;  1PP8 F;  2DOE A;  3AAF A;  1ODD A;  5FB2 A;  4IHV A;  3S1N J;  3EUA A;  1YJN I;  4F7Z A;  4KIG A;  4AIK A;  4U0W A;  3G4S I;  5LFA A;  1BOB A;  2KQR A;  1W0U A;  1IAW A;  1R6R A;  4EJW A;  3J7Y J;  3SQN A;  2B0L A;  2HOA A;  1HLV A;  3BQZ A;  3ZQQ A;  2EFN A;  5ILV A;  3GME A;  1ITY A;  3KP5 A;  4EMS A;  2DBB A;  1MIJ A;  1FWZ A;  4YIR X;  5DCF A;  5AON A;  1IV8 A;  2J5P A;  4ZZD A;  3WTS C;  2GBY A;  3HM5 A;  2EJR A;  2HXO A;  2XB0 X;  1ZAO A;  4A6E A;  2OCC H;  1X4P A;  2XF5 A;  2YSR A;  2DA1 A;  5FJ8 J;  4OMY A;  2HOS A;  1Y39 A;  4FIS A;  3G1M A;  2FEZ A;  3OIP A;  4RAF A;  5J8F A;  2QWW A;  3SEQ A;  3IKV A;  4Z6Y A;  5K5R A;  1CGP A;  2W24 A;  2GWR A;  1Y0N A;  2L3D A;  5B66 C;  4XID A;  4AU7 A;  1B72 B;  4LG0 B;  1JE8 A;  3DEE A;  1HKT A;  2CQQ A;  2R5Z B;  3MKW B;  1OFC X;  3I56 I;  5J1U A;  4YRV A;  2P5L C;  2A61 A;  2QF7 A;  2VQG A;  4C3I J;  3J7A Y;  1I6X A;  5F08 A;  4DBR A;  1LEB A;  3S3N A;  2KLO A;  1S29 A;  2OU2 A;  2P5V A;  1Y56 A;  3MZY A;  3PFY A;  4I7H A;  4NC6 A;  5E3L A;  2LR8 A;  1IXS B;  1HKQ A;  3EET A;  1TWF J;  2GA1 A;  4G7O F;  1MBE A;  3DU6 A;  4BYY A;  5BPD A;  2HKO A;  1LJ9 A;  5ICC A;  3WTX C;  2UZK A;  2X1C A;  4G6T B;  3A01 B;  2GXB A;  1UAA A;  2VKE A;  3Q9V A;  4OAZ A;  4BBS J;  1WH5 A;  3K1M A;  2OV7 A;  2H1L A;  5KCM A;  1MW7 A;  1BJA A;  4ZTJ A;  3GLL A;  2FA5 A;  3H5R A;  3AL0 B;  3DPT A;  2FBK A;  2L7K A;  1MSF C;  2WY8 Q;  3CLO A;  3WGI A;  4DNC A;  4A0X A;  2G9W A;  1MBK A;  4H4K C;  9ANT A;  3HHG A;  3CES A;  4HOB A;  1RZ4 A;  2XF7 A;  3OYB A;  4PSW A;  1MJ9 A;  3RKX A;  3VWB A;  2QUF A;  2EZK A;  2X1D A;  2R7U A;  2H27 A;  2ZXJ A;  3OYD A;  2HEO A;  1HXD A;  1YW8 A;  5KNL A;  4E7J A;  3F0C A;  1P4A A;  4A3M J;  3DF8 A;  2DMN A;  5JHF A;  2R7T A;  4FET A;  3ROU A;  4EEF G;  1FP2 A;  3OS1 A;  2XPW A;  3O6B B;  5HS8 A;  2JN6 A;  2R7O A;  4M3E A;  4P1W A;  4IRG A;  4WCG A;  1DPR A;  2DMT A;  2K9L A;  3LSK A;  3WOD F;  1NH3 A;  5FRO A;  2Y0S A;  3GZN B;  3ZQG A;  2JZY A;  1R9T J;  3KIO A;  1RPW A;  3R0J A;  2P4W A;  1U3E M;  4MFE A;  1ETO A;  1V54 H;  3MKZ A;  1OJL A;  3A02 A;  3OOU A;  4KT5 C;  3IAS 2;  3CZ6 A;  3ABL H;  2WV1 A;  4EGY A;  2YR2 A;  2FXA A;  2WTE A;  1O7F A;  2NVT J;  1WI3 A;  5TGT A;  1JKO C;  2PMZ N;  1A04 A;  1E3P A;  4Y13 A;  1JGS A;  1R1V A;  1TZL A;  1BI0 A;  1YX5 A;  2W7N A;  3OV8 A;  4A3I J;  4V2G A;  3QRF F;  1XMX A;  2IPQ X;  2AXT C;  1T95 A;  1YW7 A;  3LSM A;  4D7N A;  1NHA A;  5EGO B;  4PDK A;  3MQ0 A;  2VE9 A;  2KIU A;  4D5F A;  2FX0 A;  2JK3 A;  2Q0O A;  4HA8 A;  1LE8 B;  2J5O A;  3V8L A;  4LG0 A;  1B72 A;  1VQ7 I;  3PNT A;  1IUF A;  2ZME C;  1ZKG A;  3OYE A;  3K2Z A;  2R5Z A;  3PNY A;  2ZJR F;  1B59 A;  1OIS A;  4JP0 A;  3OSG A;  3FWE A;  2L54 A;  3FMS A;  2PJP A;  4RDU A;  1YLF A;  3DBH B;  2ZNZ A;  1TQI A;  2KDZ A;  1PP7 U;  1XSV A;  3G3Z A;  3GF2 A;  5DEQ A;  4AVP A;  5DUI A;  1HC8 A;  2DOF A;  1MH4 A;  2JSC A;  2HFH A;  2O9L A;  3S32 A;  4BY1 J;  2BE5 F;  4IHT A;  3FIS A;  3N97 A;  2EK5 A;  3BZC A;  3BG7 A;  3DBL B;  3I5U A;  3F8F A;  5HNH A;  3A01 A;  4MGR A;  3CCS I;  1W36 D;  2L7Z A;  5GP9 A;  4FE7 A;  3JR9 A;  2V4J C;  1VQP I;  1EKE A;  4XR6 A;  2HKX A;  3RQ4 A;  2R0Q C;  4J01 A;  3L00 A;  1FOK A;  1ACI A;  1BIA A;  1XD7 A;  4IEJ A;  1YO5 C;  1W7P D;  4C2M J;  4AIJ A;  4XN0 A;  5JVT A;  1UCR A;  4M72 A;  2HS5 A;  3OS2 A;  2DW4 A;  1U8R A;  2JUC A;  3HOV J;  4M73 A;  4BNC A;  5K1Y A;  1WZ2 A;  2K40 A;  1BN5 A;  4HQM A;  2F5D A;  2V79 A;  5KAI C;  4BHP A;  2HVR A;  1N78 A;  1FOY A;  1SFX A;  5E79 C;  4A3C J;  2QSF X;  1UZC A;  1GUU A;  4PCQ A;  3FHN A;  4WF2 A;  1IN5 A;  3PFI A;  3RI4 A;  2OD5 A;  3K4M A;  3OY9 A;  4ZYD A;  3TO6 A;  4IJA A;  1X58 A;  2HQR A;  4L0Y B;  4GO1 A;  1VI0 A;  1TWA J;  2CSO A;  1L0O C;  3BR3 A;  1GHC A;  4BHC A;  4IOC F;  2M0M A;  2XRO A;  2JRT A;  3BG9 A;  3WTV C;  4RB0 A;  2L5Q A;  2JPB A;  2KPM A;  1GXQ A;  1F4K A;  1YIO A;  1PJR A;  2Z16 A;  1ETW A;  5LGU A;  4U87 A;  3TDZ C;  4M9X A;  4BE2 A;  2ME6 A;  2UXX A;  5D5W B;  1YW9 A;  5DV5 A;  5HNF A;  2H1K A;  1HW2 A;  1MNM C;  3TW6 A;  4M6X A;  2CQK A;  3BR5 A;  4O5V A;  3ZMZ A;  2RQP A;  3WTT C;  3L2R A;  2VT2 A;  1MKM A;  3SDB A;  5EDN A;  1X3U A;  3A2K A;  1ZK8 A;  2BEO A;  4KFC A;  1SMY F;  5EGO A;  4II3 A;  5H20 A;  3OYF A;  2EV6 A;  2XC7 A;  5IP6 A;  3MD2 A;  1R1T A;  5FFZ A;  1LE8 A;  2Z1D A;  4BBR J;  4CCK A;  2FOW A;  3TP3 A;  3CTA A;  2R3S A;  3JSO A;  1P4W A;  2OC6 A;  3CDI A;  2AS5 F;  3ERM A;  3JTG A;  3TED A;  2LKS A;  2ZJP F;  1I1G A;  3M8J A;  1FPQ A;  1JUM A;  3OOP A;  3GTJ J;  5JHU A;  4G94 A;  4AYB N;  5CVJ A;  3C2H A;  2VE8 A;  5J6X A;  5C4J J;  2N8G A;  5M5X J;  3GO5 A;  3VYR B;  4DGW B;  2DK8 A;  5CVU A;  3FXJ A;  1Z6R A;  5BS6 A;  2XAH A;  1WQ2 A;  2M7B A;  2Z3Y A;  2M9H A;  3GTP J;  3A0B C;  2ZXH A;  4WX9 A;  4OIR F;  4UVC A;  1RI7 A;  3HSF A;  3U21 A;  5EEA A;  1PUE E;  3H1C A;  3SHF A;  2MC4 A;  2EZH A;  3ZRG A;  1K6O A;  2K9M A;  3T0Y A;  1BC8 C;  2EBI A;  1B1B A;  2EFW A;  3TO9 A;  2MFZ A;  4XRS G;  1HA8 A;  2V9V A;  5EYR A;  3S2D J;  4ESJ A;  3OYL A;  2CV0 A;  3GFL A;  3AG2 H;  4BDY A;  3TOB A;  2LY9 A;  4NBQ A;  3F22 A;  3RPQ A;  1W0T A;  2E36 A;  2E1C A;  3EUH A;  3W2V A;  2BGC A;  1SEU A;  4LK1 F;  3HYI A;  2COM A;  1ZQ3 P;  1X1P A;  3A03 A;  4UB8 C;  4ZYH A;  3H0D A;  1JJ8 C;  1NK3 P;  4RGU A;  1S7O A;  3KP4 A;  4IPA A;  3EPZ A;  2E2I J;  5D6E A;  1FTT A;  2PN6 A;  4CZZ A;  2R7W A;  2B63 J;  1ZGW A;  1H89 C;  3M07 A;  3WTY C;  2HOT A;  4II2 A;  5B1A H;  1BR2 A;  5ICG A;  1WI9 A;  2JVH A;  4HG2 A;  2O5R A;  2GXG A;  4KMF A;  2OZ6 A;  2V6E A;  1Z6T A;  1YYV A;  3Q0W A;  2EIJ H;  1T08 B;  2A6H F;  1IGN A;  2YX4 A;  2MAB A;  4EGZ A;  2LF7 A;  3WG7 H;  1OCT C;  1TBX A;  1XMA A;  4LFU A;  4NNJ A;  3L9F A;  2OQR A;  2F5F A;  2BW3 B;  3LMM A;  3M9A A;  4A6D A;  4DYQ A;  3K10 A;  1YS7 A;  3DKW A;  2VQH A;  2E1N A;  4KYW A;  1Y8R B;  3FBI B;  3W6J B;  5L3E A;  2MA3 A;  3EYY A;  3K70 C;  2KFD A;  2HQA A;  3I64 A;  4ZYG A;  2P5K A;  3Q3S A;  4XKW A;  1DP7 P;  1H9G A;  3VYU B;  1W1W E;  3CCQ I;  3J81 K;  4M9S A;  3QOE A;  3ZMS A;  2KT0 A;  2O6G E;  3AG3 H;  1Z91 A;  4OWR B;  4JYK A;  1D8K A;  1FNN A;  1S7E A;  3BTI A;  4ITV A;  3F8C A;  3HKZ N;  5M5W J;  3JRA A;  1HBX G;  1YG2 A;  1AWC A;  3EUK L;  1VQL I;  4E7H A;  3KFW X;  5AIP A;  1YQA A;  2X0L A;  5JVG F;  5IOY A;  4IQJ A;  1VQN I;  5KK1 A;  2HTJ A;  1U8B A;  5KVR A;  2NXN B;  3J80 Z;  1T6S A;  1J09 A;  3GZ6 A;  3F9K A;  4MLO A;  4BL0 B;  3L2U A;  3MWM A;  3VYT B;  2EB7 A;  2E2H J;  3KPH A;  2QM3 A;  3MFK A;  3RJP A;  1U6G A;  5IT9 K;  3A0H C;  3TQN A;  1TWG J;  2GA2 A;  4I02 A;  1OCP A;  1QVT A;  4OMZ A;  2CQX A;  2COB A;  3VB2 A;  5M3F J;  4XLA A;  1IC8 A;  3QU6 A;  3RDI A;  5HVQ C;  1JHF A;  5M3M J;  4ABZ A;  2TRT A;  3G73 A;  2EWN A;  4KNY A;  1O3R A;  2MC3 A;  2EFQ A;  3K2A A;  1TW3 A;  1HQC A;  2NS7 A;  2XIG A;  4RLF A;  3GFJ A;  5EG0 B;  4NUB A;  1D1A A;  2HPI A;  4LG3 A;  1D0X A;  1UHW A;  2MH9 A;  1K79 A;  1BR4 A;  1N75 A;  2X6W A;  4P9U A;  2CG4 A;  2HOE A;  4P96 A;  2AXL A;  1DU6 A;  2EFO A;  1G8X A;  4RAY A;  1WJ5 A;  4HF2 A;  3OL3 A;  1OQY A;  3M1E A;  4MQV A;  4DYC A;  1IF1 A;  3OYJ A;  1MD0 A;  5GPC A;  5D8K B;  2VN2 A;  2BW3 A;  3BR0 A;  2A05 A;  1APL C;  3HB9 A;  2JT1 A;  4J19 A;  5EZG A;  5CLS A;  1ZR2 A;  3L7W A;  4BXX J;  2JRM A;  2LTP A;  4YEJ A;  3WU2 C;  2D1H A;  2L0K A;  2WB1 N;  3BJO A;  4MFD A;  4FT8 A;  2DTR A;  4C2U A;  4DW6 A;  5DS9 A;  2L2O A;  1LKX A;  4DZJ A;  3CMM A;  1MDM B;  2FNP A;  1F43 A;  2G7U A;  4XLC A;  2MLG A;  2O3F A;  3LA7 A;  3JRB A;  2E34 A;  1N77 A;  4TV7 A;  4P5O A;  2RQQ A;  1SC7 A;  3DPU A;  3A4C A;  2XGE A;  1TQP A;  3MKL A;  3SXY A;  1B8I B;  5IYC J;  2YU9 J;  3S93 A;  1QVU A;  3DTK A;  1V5F A;  2L9V A;  3BRO A;  1R4M B;  2MSY A;  4GFB A;  4UB6 C;  4G6D A;  3GW2 A;  3I53 A;  1VQM I;  4RB2 C;  2OZU A;  1USS A;  1G6N A;  2DMP A;  1C0W A;  3K7A J;  1ZHF A;  1LFU P;  1SFE A;  2JA6 J;  4EM0 B;  2EIK H;  2JPC A;  4YEL A;  4JX6 A;  3DXJ F;  1J59 A;  3HOS A;  2DLL A;  3KP6 A;  4LIV A;  3LSG A;  2E7X A;  1T39 A;  4E70 A;  6PAX A;  3GXO A;  1ENH A;  3L2V A;  3DQV C;  3ASO H;  2L7M P;  2OAZ A;  3S3M A;  4EM2 A;  2I8D A;  4XMY A;  2PLY A;  2DDB A;  3ELK A;  3DKY A;  2GZW A;  2QKM B;  3RTR A;  3KYD B;  5HOD A;  3QPS A;  4M3B A;  1S7A A;  2FE3 A;  2LSO A;  2HU9 A;  5B1B H;  1MBJ A;  3J7Z I;  4LIU A;  5E3N A;  5EG0 A;  5IOZ A;  1T56 A;  1JXS A;  4QSH A;  5DDG A;  4CXF A;  1TNS A;  3HSR A;  3N05 A;  1FYM A;  5LEK A;  2ID3 A;  3KE2 A;  4BU2 A;  3I54 A;  4I76 A;  1W5T A;  4I09 A;  4CGZ A;  4M3G A;  4ENK A;  1DUX C;  3HDD A;  4AWX B;  5HLG A;  5CKT A;  4XN3 A;  2ZC2 A;  3OYA A;  3VEP A;  4ZZL A;  4HNV A;  1A31 A;  3O3K A;  2LRE A;  1PDN C;  4UUS B;  2Y9Y A;  1D8J A;  5L3G A;  2NOJ B;  4RGS A;  1NG6 A;  3HEF A;  3I71 A;  3RPU A;  5IYB J;  2HYG D;  3L2W A;  1Q1V A;  3BG3 A;  2K4B A;  2P7V B;  5HS7 A;  1GLN A;  1LPQ A;  1GDT A;  2VBW A;  4ESB A;  1X1A A;  4U88 A;  2KL4 A;  1I39 A;  2CV1 A;  1FBU A;  1MDM A;  5ILU A;  4E7K A;  1FOX A;  3E3V A;  4Y3O A;  3P7N A;  2XGD A;  3C18 A;  1GV2 A;  5JI6 A;  3O8H A;  4CCJ A;  2DN0 A;  3M8E A;  4P9F A;  4B3A A;  1Z0X A;  3BG6 A;  2DOD A;  1V5E A;  4K2E A;  1B8I A;  1WJD A;  4G12 A;  2XAU A;  1FBS A;  1ON2 A;  2X9D A;  1HCR A;  1BBY A;  3KEY A;  3HSE A;  1AA7 A;  3TO7 A;  5L3F A;  2LKP A;  3NAR A;  2QA4 I;  2GOM A;  4KN4 X;  2GXA A;  4XSX F;  3CP8 A;  4XQF A;  1AOY A;  2FSW A;  2LP0 A;  1EH8 A;  2QVO A;  4R1H A;  4PJN A;  5F64 A;  1YFH A;  3H36 A;  1SVO A;  4DJA A;  2KMU A;  2LYC A;  1GT0 C;  4PFO A;  2L9R A;  3GFI A;  4G8X A;  1R71 A;  1MMN A;  2R4G A;  3CCY A;  2JA2 A;  3MN2 A;  4XOP A;  3QPL A;  3DLA A;  3K4N A;  3QWL A;  1A6I A;  4BE0 A;  2MW8 A;  5A2Q K;  3F8B A;  2M0C A;  3S1Q J;  4XKB A;  2E19 A;  4IHS A;  1JKQ C;  1SD7 A;  1F5T A;  3M4O J;  2ELK A;  3VFZ A;  4PFP A;  3HTS B;  4B47 A;  2ZME B;  2GM4 A;  3S14 J;  3I0T A;  2M7A A;  3DKX A;  1IRF A;  3SYT A;  2ESH A;  3LA3 A;  1LVA A;  1X2N A;  1K4T A;  3BZ6 A;  1FT9 A;  2M34 A;  1XX5 A;  2LKX A;  2DO7 A;  4KIT B;  4IF4 A;  1K4S A;  1LDJ A;  3IRR A;  3QYF A;  4XLE A;  1P4X A;  3BG5 A;  1QPI A;  2DTZ A;  3HL2 A;  2ZKZ A;  2MG4 A;  4F55 A;  1T98 A;  4Y33 A;  3LAJ A;  4FQG A;  2GIZ A;  4HLY A;  4HX7 A;  2NYX A;  3BDD A;  1XN7 A;  4UUS A;  2K4J A;  3CCE I;  4IRI A;  3ZOB A;  1JTX A;  4ZDP A;  4XLN F;  4IHY A;  2K86 A;  3F21 A;  3SJM A;  5LD2 C;  4M6Y A;  1E3H A;  4GRI A;  4RGR A;  3LAP A;  1J75 A;  2O8X A;  5DM7 F;  1SMT A;  3H0G J;  1SFU A;  1LEA A;  1P2F A;  2BY1 A;  2Z33 A;  2LNB A;  3KP7 A;  2DA6 A;  3MAJ A;  5L3B A;  3KYL A;  2R7F A;  2F5V A;  3HOW J;  4F52 A;  3KET A;  4N0B A;  2VPR A;  2E5N A;  2P0W A;  5FO5 A;  3SZT A;  1N25 A;  2K27 A;  4PJM A;  4BHB A;  3DTI A;  1UMQ A;  2X85 A;  3S8P A;  3WGH A;  3BLY A;  3PUB A;  1I6H J;  2STT A;  1RKT A;  3ASN H;  3UKG A;  3R61 A;  4ASN A;  2H6C A;  1RES A;  2P6S A;  2IEK A;  1YTY A;  1JI8 A;  5J1Y A;  4PGH A;  1BL0 A;  2QGU A;  1ON1 A;  2XRN A;  2D45 A;  1IN8 A;  3WU0 A;  3ERE D;  3OYI A;  1E17 A;  2G0E A;  4EQQ A;  2CFX A;  4C30 A;  2CV2 A;  4E7Z A;  3S1M J;  4UNO A;  3PO2 J;  1D0Y A;  1X4O A;  3CMA I;  3TGN A;  4WWC A;  3LSP A;  2VAS A;  2CFO A;  2E2J J;  2X6X A;  2P8T A;  2VOD A;  2DYS H;  1U78 A;  2F48 A;  3QOP A;  1D1C A;  1AU7 A;  1OLT A;  2V26 A;  3GTL J;  3IHU A;  3FBN B;  5TRD A;  1F1Z A;  2WAE A;  3ZGK A;  1Z1D A;  4MEX F;  2DU9 A;  1RRJ A;  4Y15 A;  3HUG B;  4HZF A;  2NS8 A;  3E1S A;  4RLQ A;  1MZB A;  2EIL H;  1T0F C;  1TP4 A;  2HQN A;  2QYO A;  3DBR B;  2ZME A;  4I01 A;  3FHZ A;  3HC7 A;  1SFO J;  1RUN A;  3E5Q A;  2ZB9 A;  2FQ4 A;  2DT5 A;  3ONQ A;  1T0F A;  4RS8 A;  3I55 I;  2A69 F;  2FF4 A;  1V55 H;  3QAH A;  4KIB A;  5DUK A;  2XAF A;  4NQW B;  3B73 A;  3H92 A;  2ELJ A;  5B5E C;  4UHT A;  3G6E I;  2PQ8 A;  2L7F P;  3CJT B;  5GTH C;  2VIX A;  3L2Q A;  3EYI A;  4GGG A;  4RB3 C;  2TDX A;  1O3S A;  3LSH A;  4XM3 A;  1T38 A;  2V1U A;  3TMO A;  2ECB A;  3W2W A;  3RIR A;  4B43 A;  2Q1Z B;  3H5A A;  4MIM A;  2DA3 A;  2KHM A;  4WXD A;  2V7F A;  5GPA A;  3CF2 A;  3OYK A;  4Y17 A;  1REP C;  1I3A A;  5EF6 A;  3CMY A;  1EA3 A;  3UNG C;  3FXO A;  4XKV A;  1F9N A;  1J2X A;  1YIJ I;  1FSH A;  4YII A;  3HPH A;  5BMZ A;  1UB9 A;  2QEN A;  2K7L A;  4NDL A;  1W36 C;  3QP5 A;  3OS0 A;  3AG4 H;  2X6O A;  3GUD A;  2PMZ A;  4BQA A;  2R5Y B;  4AID A;  3BCA A;  1SVM A;  3FKJ A;  3GEZ A;  3JRD A;  4XK4 A;  3BR1 A;  4A69 C;  1HF0 A;  2XV4 S;  1ZLK A;  4MNU A;  3JAM K;  2HDD A;  2GIV A;  3QP6 A;  1Z05 A;  1R5I D;  3ABM H;  1IG7 A;  2JWT A;  1WJA A;  3DEW A;  2UUZ A;  2MH2 A;  2X4H A;  5FLM J;  2HTS A;  3FF5 A;  2E5Z A;  1HW1 A;  2KRF A;  3LA2 A;  1LDD A;  3ECO A;  2LY2 A;  5AIQ A;  2EZL A;  5K5O A;  1WKM A;  2OCE A;  4IVN A;  2Z2S B;  1ZAR A;  5BQT A;  2F4I A;  2EIM H;  4M3F A;  1QZE A;  2D2W A;  1VND A;  1LNW A;  2F4O B;  3JCU C;  3OMY A;  3A1Y A;  1IN4 A;  1UHS A;  1OYI A;  2IGO A;  1JHH A;  1PYV A;  2NRA C;  2F2E A;  1Z21 A;  5LEJ A;  3DPL C;  2KJC A;  3HUG A;  3W3C A;  4JX4 A;  2EFP A;  2EV0 A;  4L9J A;  4LMY A;  5J40 A;  3H35 A;  2R7Q A;  2PEX A;  3DFG A;  1L3L A;  1IDY A;  4FCY A;  4OIQ F;  4HV5 A;  2XPV A;  2HWV A;  2DJI A;  3PSI A;  1KON A;  2OPT A;  2HXI A;  4QWQ A;  2M87 A;  3DCF A;  2H8R A;  2E7W A;  1K78 B;  5HLI A;  1DP3 A;  1JUS A;  5HS9 A;  5B3S H;  2YPR A;  4NQW A;  4A3K J;  4IL6 C;  3D5S C;  3FMQ A;  5F0H A;  4CIC A;  1A5J A;  5H6Q A;  1X2M A;  1EH6 A;  4CO8 A;  4X1E A;  1FC3 A;  2W84 A;  3CDH A;  5BOX A;  4GCV A;  2XGX A;  3S2H J;  1NTC A;  1KU9 A;  4IXA A;  3H9G A;  4IZZ A;  2QKL B;  3J80 K;  3UR3 C;  4D7M A;  1RUO A;  4RA2 A;  4XNF A;  4QTR A;  2MBF A;  3IRQ A;  2ZJQ F;  1U9N A;  3WHB A;  4ON0 A;  4L0Z B;  1YHQ I;  2L9S A;  3L09 A;  2E60 A;  2HNH A;  2W57 A;  1MJA A;  2ZFU A;  4NC7 A;  1ZRC A;  1VQ9 I;  2QZ8 A;  3WG9 A;  1QBJ A;  2CS3 A;  4PZJ A;  3HRS A;  5D5X B;  4CCM A;  4ZDL A;  2OTL I;  2VOO A;  3GTQ J;  3WE3 A;  4L9N A;  2DXI A;  5LRS A;  3HRU A;  2M3A A;  3S16 J;  4CCO A;  2R5Y A;  2VXZ A;  2X51 A;  3RZD J;  2DPU A;  2HR3 A;  1RNL A;  3QPT A;  4FAS D;  2D1V A;  1QZZ A;  1WJB A;  3E0J B;  5DYM A;  4OIN F;  4GDF A;  1X1B A;  4A5M A;  1BOA A;  2KIF A;  2C6Y A;  2ZNY A;  4AIH A;  3GTG J;  2KIQ A;  4ZJZ A;  4R8H A;  1B9N A;  2FRH A;  1S5L C;  2ZFW A;  1QNT A;  2CO5 A;  2O7O A;  3K70 D;  2BBY A;  3CQZ J;  3BT9 A;  4QPO A;  1KZH A;  1OR7 C;  1A36 A;  3E97 A;  2PI0 A;  1QO0 D;  4EAT A;  1XMK A;  2JUG A;  2CRG A;  2MLK A;  3OIQ A;  5FKK A;  3WTW C;  3IWF A;  2BY0 A;  3WE2 A;  2JJ7 A;  1OR7 A;  4AYB A;  1VQ4 I;  3F6V A;  1HW5 A;  4UV8 A;  2HVQ A;  3NQO A;  1HOM A;  2RV8 A;  3V7C A;  4LD5 A;  4F93 B;  2NAZ A;  1R5G A;  1QHH D;  5FLX Z;  1FBQ A;  3TL4 X;  2DA5 A;  5ICE A;  2BOL A;  2MGQ A;  1XSX A;  2NVX J;  3LFK A;  5CVR A;  2DA4 A;  3GX4 X;  1SD6 A;  3CCV I;  1ZG1 A;  3I3L A;  4AVZ A;  3FKI J;  3QYB A;  4FX0 A;  2RNJ A;  3DWL E;  5ILS A;  4HDU A;  3HXL A;  2DT7 B;  1K78 A;  3DLL F;  3BP8 A;  2ECC A;  1UHM A;  3RYR A;  4RBO A;  1ZH5 A;  2EIN H;  3PSF A;  2VJ4 A;  4OIP F;  3ABU A;  2JA7 J;  1BI2 A;  1WWX A;  4EV0 A;  2M2E A;  4EVI A;  3F72 A;  3V8K A;  1VQK I;  3W6K B;  3Q0V A;  3ML6 A;  3MEX A;  2DOA A;  2QBY B;  2IS4 A;  1X1D A;  1ZGA A;  1T8I A;  3M8F A;  3F3X A;  1G59 A;  2O61 A;  1JGG A;  2BV6 A;  4I0B A;  1O3Q A;  1LUJ B;  4FX4 A;  2EA4 A;  5LHH A;  3BTJ A;  3CD6 I;  1WJE A;  2KKO A;  1Y1V J;  1G3Y A;  2VJJ A;  3ZR8 X;  1POG A;  5LGT A;  3CCR I;  2PMU A;  1J9I A;  1ZLJ A;  3RQI A;  4HNT A;  2IGM A;  1YRN B;  3JW4 A;  5LHI A;  1IDZ A;  2MD5 A;  5HDN A;  4A2U A;  3V42 A;  1QRY A;  4HYE A;  2IP2 A;  4HDV A;  5J47 A;  2WAQ N;  4GXO A;  3LSI A;  2L02 A;  5IPA A;  1VQO I;  2JVG A;  3M3Y J;  1R23 A;  3FXU A;  4ETS A;  1TL8 A;  1P7I A;  4AM3 A;  2IT0 A;  5L3D A;  1SFK A;  2WAF A;  4M74 A;  2IXS A;  1Z3X A;  3TW7 A;  4DOZ A;  1O3T A;  3FXR A;  2K9Q A;  2UWM A;  4BJ6 C;  1IRG A;  1ZN2 A;  1I50 J;  4A5N A;  3ZP5 A;  1VQ8 I;  4I2O A;  4LJZ F;  2YU3 A;  2ZJ2 A;  3GTK J;  3TP0 A;  3IL2 A;  4PJJ A;  3D5L A;  1MMD A;  4MTD A;  1ZRE A;  1R00 A;  2KIS A;  2KIM A;  3TDU C;  1MGT A;  4U7D A;  3DV8 A;  2IA2 A;  3HTU A;  2HPM A;  4KN7 X;  4KT6 A;  4AC0 A;  3C2B A;  3R4K A;  3BCB A;  4HW0 A;  3NAU A;  4E4H A;  3CCL I;  3GTM J;  2JTV A;  5DD8 A;  2LLK A;  3RKW A;  4D9J A;  1FEX A;  2ZCW A;  3WTZ A;  2QQA A;  4HBL A;  5EZH A;  4A3B J;  3B6C A;  1LFB A;  3M7G A;  1G3S A;  1HDD C;  2NVU B;  3PL8 A;  3F6O A;  3ZQF A;  3GYH X;  3KYC B;  5C44 J;  2FNA A;  3Q9S A;  1DPU A;  3CUO A;  2AO9 A;  5FGM A;  1XCB A;  5K7H A;  4UUT A;  2HYJ A;  3HKZ A;  1BJZ A;  2A6T A;  3IAM 2;  3KZZ A;  5ICF A;  2VJ5 A;  5J4Y A;  2VBY A;  1X3Z B;  1QZY A;  1SD4 A;  3HRT A;  3VDX A;  2VKV A;  3HOT A;  2GQQ A;  3LOC A;  4BQO A;  3BPX A;  3F23 A;  4A3E J;  3KLN A;  4BQN A;  2OQG A;  5LRR A;  1O4X A;  4BKX A;  1ZGJ A;  2DAO A;  1Z77 A;  1STZ A;  1W4M A;  2QQ8 A;  2LH9 A;  3I9V 2;  4EM1 A;  3JRH A;  3REO A;  3CO7 C;  4G7Z F;  2VOP A;  3FM5 A;  1Y8Q B;  5FRM A;  1EH7 A;  2IBD A;  1ZEL A;  4HF1 A;  4MEY F;  2BHZ A;  4IOA F;  1HDP A;  1TW2 A;  3BQY A;  2W4S A;  2H6B A;  3TKY A;  2XAS A;  4QIW N;  3BTC A;  3U9G A;  2ISY A;  4F91 B;  3ECH A;  2I5U A;  2JA5 J;  2L4A A;  3CP2 A;  3VSK A;  1XGS A;  2YX7 A;  2ZSI B;  3L2C A;  2QBY A;  2HGC A;  2KZG A;  3K4L A;  1D0Z A;  1RR8 C;  2EV5 A;  3I4P A;  1YI2 I;  3W2A A;  2OUM A;  1H0M A;  4EJU A;  3MZH A;  2LFB A;  3EDP A;  4LK0 F;  1G4D A;  1OMI A;  4G7H F;  4ZYA A;  5F0C A;  5DCM B;  1U0J A;  3MZ8 A;  2ZXW H;  1YRN A;  1VZ0 A;  2M8G X;  3PQJ A;  4BGD A;  2V1N A;  1Y1W J;  2H09 A;  4UUV A;  1P6R A;  2A68 F;  3OYH A;  3CLQ A;  2XKP A;  1XB4 A;  4L9V A;  4IKF A;  4OU0 A;  3ZMU A;  2P7C B;  2BYV E;  2XDV A;  5IT9 Z;  3E5U A;  2XUB A;  1TT0 A;  1H8A C;  4RAG A;  2Y31 A;  5E1Z B;  1O7L A;  2PX9 A;  2DFH A;  1UEL B;  1MMS A;  1KQ8 A;  2FD5 A;  3OYG A;  4LLN A;  1XTA A;  3ZCO A;  2ZO4 A;  3RPU D;  4E7I A;  1IRZ A;  4XOR A;  2OTJ I;  2CU7 A;  5K7F A;  4PJ0 C;  3X2Q H;  2VUM J;  2DMQ A;  4BEH B;  4QLC U;  3HHH A;  2FBI A;  1ETQ A;  3R6S A;  2WB1 A;  2ETH A;  2FBH A;  3BPV A;  1IJW C;  4O6J A;  1JKP C;  1O57 A;  2BY2 A;  1B9M A;  1FSE A;  3MCZ A;  1AHD P;  1TTY A;  1I1S A;  3CME I;  3DU5 A;  3K4J A;  4OIO F;  2CQ7 A;  2DI3 A;  2F5E A;  3VOE A;  5H2F C;  3IKT A;  1CF7 B;  4CCN A;  1HSJ A;  2LBF B;  4B09 A;  1AKH B;  1CQT A;  2Z5U A;  2M45 A;  2OF7 A;  2W25 A;  2XAQ A;  2AHQ A;  2ZBK A;  5CQE A;  1HKS A;  2Y30 A;  1FX7 A;  1R49 A;  3DP7 A;  2BXZ A;  3ZQ7 A;  4G6Q A;  5DD4 A;  3CC7 I;  1OCR H;  4JOM A;  2ICW G;  4XIC A;  1KU2 A;  1SAU A;  3SFZ A;  2UV1 A;  1TWC J;  2XSJ C;  3GFM A;  4LB6 B;  2V6C A;  4FHT A;  1IN6 A;  4PGG A;  4M6V A;  1B4A A;  4ANJ A;  4L9T A;  4YIF A;  4C3J J;  3CC4 I;  2DFE A;  4M71 A;  5IY5 H;  3B6A A;  2IGK A;  1SAX A;  2VKD A;  1S9H A;  2NVQ J;  1BA5 A;  2VBZ A;  3E6B A;  1VFC A;  1V4R A;  4IHX A;  4L5J A;  3C1D A;  3N4M A;  2WWY A;  2DT6 A;  2L4M A;  1D5V A;  1E0E A;  4ZH4 F;  3D1N I;  4AUX A;  2IVM A;  1P7J A;  2QCO A;  3PNV A;  4CSW A;  4B8X A;  2Y9Z A;  1BIB A;  2IA1 A;  4U0Y A;  2P81 A;  4IX7 A;  1FJL A;  3RZO J;  3PIO F;  3I4N J;  2IRF G;  2Z9O A;  5CJ9 A;  3HIF A;  2RRE A;  1VTN C;  2AQE A;  5DCM A;  2VT3 A;  5LLQ A;  1W5C C;  4OOI A;  2PG4 A;  3PM1 A;  1RKW A;  3E7L A;  1OYY A;  2QQ9 A;  5GAG J;  2CW0 F;  1XDS A;  2ZSH B;  4C3H J;  2Y2Z A;  4KIF A;  1VQ5 I;  2PFB A;  3SEZ A;  4QPQ A;  2Y0S N;  3RYP A;  2WA0 A;  1UFM A;  2XGC A;  2KP6 A;  2PMH A;  4MHG A;  2QLZ A;  4BH9 A;  5E8I A;  1G3T A;  3ZQC A;  2IW5 A;  3K6G A;  4F3Q A;  2LDU A;  2M5W A;  3LST A;  3IV5 A;  4PK4 A;  1ETK A;  1XGO A;  1D3Y A;  2ADU A;  4BEH A;  4IHW A;  2XHK A;  5FKN A;  3VYS B;  1JKR C;  2VPL A;  3JRE A;  3FIW A;  5F04 A;  1K61 A;  2VON A;  5GAE J;  3SDG A;  2LY1 A;  4DYR A;  2DDA A;  3FM3 A;  3C7J A;  4Y52 J;  4G9Y A;  1KYZ A;  1J5Y A;  2DK5 A;  2BVM A;  3VOD A;  1V5G A;  5GAH J;  1IXC A;  1WPK A;  2A6E F;  1CF7 A;  1XDU A;  3HOU J;  1AKH A;  2LBF A;  3T5X A;  1X3W B;  3FK7 A;  4CHU A;  2M8E A;  5K7Z A;  3RKY A;  2R7X A;  3K0L A;  4DQ2 A;  4EJT A;  2RNG A;  3PUF A;  3VSL A;  2W1O A;  5E8G A;  3IP4 B;  5E1W A;  5IP9 J;  5BPI A;  3V4G A;  2DA7 A;  4WXH A;  1S72 I;  1ZTR A;  4BJ5 C;  4GYG A;  3JRC A;  1PVE A;  2V9K A;  2R92 J;  2X48 A;  3F8N A;  2GOX B;  3MVP A;  5HDK A;  4XOT A; 
#chains in the Genus database with same CATH homology
 2GAU A;  3EQL F;  3KEQ A;  4KA4 A;  3GVA A;  2RDP A;  4S04 A;  4Q47 A;  1W7P B;  4HAM A;  4RGX A;  4Q48 A;  4RAZ A;  1S6L A;  4BXU A;  4M9Z A;  2H94 A;  1YS6 A;  2XAJ A;  3WTU C;  4CDG A;  2CGP A;  4ESF A;  3Q5F A;  3P9C A;  4IRH A;  3ZMD A;  3CJN A;  5IT3 A;  5L3C A;  3ZN1 A;  3KCC A;  2NNY A;  4ENM A;  4XLP F;  4A12 A;  1FLI A;  1BI1 A;  4N9I A;  2CYY A;  4YFK F;  5LHG A;  5A2Q Z;  3ISP A;  4BAY A;  3QU3 A;  2HDC A;  3HRM A;  1OYW A;  1BM9 A;  3T8R A;  5D8L B;  4LLL A;  4H0E A;  3ZMV A;  3I59 B;  5FFX A;  4WK8 F;  1FYK A;  5D5V B;  3DEU A;  4HV6 A;  4JBA A;  3KZY A;  1FYL A;  3ULQ B;  1WRJ A;  3E5X A;  2XKO A;  1I5Z A;  4XBF A;  3BJ6 A;  1IN7 A;  4UV9 A;  1R58 A;  3P9K A;  2WV0 A;  1S8N A;  2RN7 A;  1LDK B;  2L01 A;  2RGV A;  4UVB A;  4AD9 A;  4JQF A;  4L5I A;  4HQE A;  2OBP A;  1GVJ A;  1ONV A;  4ZYE A;  3IWZ A;  3SZP A;  3V7S A;  3E6M A;  1OPC A;  1W7P A;  4I0A A;  4XSZ F;  3LWF A;  5TJJ A;  3C3W A;  1Z9C A;  1QQI A;  5CYV A;  1KU7 A;  4U0V A;  3GZ5 A;  3K9T A;  4UVA A;  3F8M A;  3QPH A;  2V1X A;  2HZT A;  5J8C A;  5K5Q A;  1MJB A;  2IA0 A;  3KLO A;  3JSP A;  5FD5 A;  5FLX K;  4EJO A;  2Y48 A;  1EV7 A;  4N9H A;  2O0Y A;  4HX4 A;  1HST A;  3T8T A;  1R36 A;  5HOO A;  4O3M A;  1DDN A;  2CWE A;  2NS0 A;  1Z7U A;  2UXN A;  2A3S A;  2FQ3 A;  3I59 A;  1KYW A;  3CUQ B;  2Q2E A;  3O2P E;  4KIC A;  2RKH A;  4HF0 A;  4I98 B;  2QQB A;  3NRV A;  5D5U B;  2EA2 A;  3CO6 C;  1KQ0 A;  3KP3 A;  1KA8 A;  5LBQ A;  3J7A O;  5ERI A;  4KDP A;  5E18 F;  5FD6 A;  1ZG5 A;  1KU3 A;  3NEU A;  3D0S A;  4MTE A;  4LGW A;  1XGN A;  2FML A;  4KMU X;  2NNN A;  1R1U A;  2IJL A;  4EJV A;  3JAM Z;  1WSU A;  1B6A A;  4CYD A;  4UXN A;  3ZMT A;  3B02 A;  2DQL A;  1W5S A;  2HYF A;  4WXC A;  2K02 A;  3BY6 A;  2W85 A;  3FXQ A;  1BC7 C;  1J0R A;  2Y0M A;  2A5Y B;  3R0A A;  1U5T B;  1R7J A;  3KP2 A;  3KEO A;  2ESN A;  3CUQ C;  1TNT A;  4D0P A;  4Q5S F;  4HLX A;  2Y75 A;  3CUQ A;  1Y0U A;  3TOA A;  4YG2 F;  3K69 A;  5ED4 A;  1K7A A;  5JR3 A;  1SD5 A;  1E2X A;  4A0Z A;  3IC7 A;  3GWZ A;  1XCV A;  4MQ9 F;  2V1D A;  1FZP B;  1IW7 F;  2O03 A;  2OA4 A;  2DPD A;  2VC1 A;  4P55 A;  4Z2Y A;  3JTH A;  5H6R A;  4YFN F;  2STW A;  5EEG A;  1V3F A;  3T1B A;  3ABT A;  5F1R A;  2VC0 A;  2ELH A;  2RVC A;  2FU4 A;  2FOK A;  3LQQ A;  4NHJ A;  5HDG A;  3I58 A;  3K1P A;  3V7R A;  4GYI A;  1ZRF A;  2XVC A;  3ZPL A;  1J7K A;  5HLH A;  1KGS A;  5D6F A;  2WC2 A;  3LQR A;  3FZV A;  3FX3 A;  3E6D A;  3WGG A;  4ENJ A;  3P9I A;  2DFI A;  4Q4Z F;  4S05 A;  2A07 F;  1R22 A;  4ENN A;  1XSD A;  3E6C C;  1KQ9 A;  5EEH A;  1FY7 A;  1U5T C;  1ULY A;  2M1B A;  2R7D A;  3R60 A;  3COA C;  1TLH B;  2RC4 A;  1U5T A;  3J81 Z;  4R79 A;  3K1N A;  2KJB A;  3H3Z A;  1G3W A;  1IXR C;  5JFR A;  1QGP A;  2XAG A;  1IZ1 A;  2ISZ A;  4KUM A;  3ZN0 A;  5E20 A;  1I27 A;  4LB5 A;  2M30 A;  2ACJ A;  1TQM A;  4JK1 X;  1GXP A;  1ZRD A;  4YFX F;  1OKR A;  3V8J A;  3PQK A;  1XGM A;  5F6F A;  3WU1 B;  4U7B A;  1ZG3 A;  1LB2 A;  3BWG A;  5D4R A;  2LF8 A;  1IUY A;  5LGN A;  5E1X A;  4HX8 A;  2DQR A;  3U1D A;  5E17 F;  4LLG F;  5CVI A;  4A0Y A;  4XRF A;  1P92 A;  1UST A;  1U2W A;  1T2K A;  1ZYR F;  2FMY A;  5CVV A;  3U2R A;  1Q1H A;  1BI3 A;  2G7H A;  3S2W A;  1R5H A;  1FP1 D;  2P6T A;  3BJA A;  4RB1 A;  3BOQ A;  1QPM A;  2Q8K A;  3FMR A;  4NB5 A;  1S3J A;  2Z99 A;  1H9T A;  1RIO H;  3H3U A;  2PBI A;  2F5C A;  5D4S A;  2VBX A;  3GLX A;  1LQ1 A;  4L18 B;  1PP8 F;  3AAF A;  1ODD A;  5FB2 A;  4F7Z A;  4KIG A;  4AIK A;  4U0W A;  1IAW A;  4EJW A;  3SQN A;  2B0L A;  2EFN A;  5ILV A;  3KP5 A;  4EMS A;  2DBB A;  1FWZ A;  5DCF A;  5AON A;  2J5P A;  4ZZD A;  3WTS C;  2EJR A;  1ZAO A;  4A6E A;  2YSR A;  4OMY A;  5J8F A;  2FEZ A;  2QWW A;  3IKV A;  5K5R A;  1CGP A;  2W24 A;  2GWR A;  2L3D A;  4LG0 B;  1JE8 A;  1HKT A;  2P5L C;  2A61 A;  1I6X A;  1LEB A;  1S29 A;  2OU2 A;  2P5V A;  4I7H A;  3MZY A;  1IXS B;  1HKQ A;  3EET A;  2GA1 A;  4G7O F;  4BYY A;  5BPD A;  2HKO A;  1LJ9 A;  5ICC A;  3WTX C;  2UZK A;  2GXB A;  3Q9V A;  3K1M A;  1BJA A;  2FA5 A;  3DPT A;  2FBK A;  3CLO A;  3WGI A;  4DNC A;  4A0X A;  2G9W A;  3HHG A;  4HOB A;  1RZ4 A;  1MJ9 A;  3RKX A;  2QUF A;  2H27 A;  2ZXJ A;  2HEO A;  1HXD A;  1YW8 A;  1P4A A;  3DF8 A;  3ROU A;  1FP2 A;  5HS8 A;  3O6B B;  4IRG A;  4WCG A;  1DPR A;  3WOD F;  2JZY A;  3R0J A;  2P4W A;  1U3E M;  4KT5 C;  4EGY A;  2YR2 A;  2FXA A;  2WTE A;  1O7F A;  1A04 A;  4Y13 A;  1JGS A;  1R1V A;  1BI0 A;  3OV8 A;  3QRF F;  2IPQ X;  1YW7 A;  1NHA A;  4PDK A;  3MQ0 A;  2VE9 A;  2KIU A;  2Q0O A;  4HA8 A;  2J5O A;  3V8L A;  4LG0 A;  3K2Z A;  1B59 A;  3FWE A;  2L54 A;  3FMS A;  2PJP A;  1YLF A;  2ZNZ A;  1TQI A;  1PP7 U;  1XSV A;  3G3Z A;  3GF2 A;  5DEQ A;  4AVP A;  5DUI A;  2JSC A;  2HFH A;  2BE5 F;  4IHT A;  3N97 A;  2EK5 A;  3I5U A;  3F8F A;  4MGR A;  2HKX A;  3L00 A;  1FOK A;  1BIA A;  1XD7 A;  1YO5 C;  1W7P D;  4AIJ A;  5JVT A;  1UCR A;  4M72 A;  2HS5 A;  2DW4 A;  1U8R A;  4M73 A;  4BNC A;  5K1Y A;  1BN5 A;  4HQM A;  2F5D A;  2V79 A;  4BHP A;  1SFX A;  4PCQ A;  4WF2 A;  1IN5 A;  3PFI A;  3RI4 A;  2OD5 A;  4ZYD A;  3TO6 A;  4IJA A;  2HQR A;  4L0Y B;  4GO1 A;  2CSO A;  1L0O C;  1GHC A;  4BHC A;  2XRO A;  2JRT A;  3WTV C;  4RB0 A;  2JPB A;  1GXQ A;  1F4K A;  1YIO A;  5LGU A;  3TDZ C;  4M9X A;  2UXX A;  5D5W B;  1YW9 A;  5DV5 A;  1HW2 A;  4M6X A;  2CQK A;  4O5V A;  3ZMZ A;  2RQP A;  3WTT C;  2VT2 A;  1MKM A;  1X3U A;  2BEO A;  4KFC A;  1SMY F;  5H20 A;  2EV6 A;  5FFZ A;  1R1T A;  3CTA A;  2R3S A;  3JSO A;  1P4W A;  2AS5 F;  3JTG A;  1I1G A;  1FPQ A;  3OOP A;  5JHU A;  4G94 A;  5CVJ A;  2VE8 A;  5J6X A;  3GO5 A;  2DK8 A;  5CVU A;  1Z6R A;  5BS6 A;  2XAH A;  1WQ2 A;  2Z3Y A;  4WX9 A;  4OIR F;  4UVC A;  1RI7 A;  3HSF A;  1PUE E;  3SHF A;  1K6O A;  1BC8 C;  3T0Y A;  1B1B A;  2EFW A;  3TO9 A;  2V9V A;  4ESJ A;  3GFL A;  3TOB A;  3F22 A;  3RPQ A;  2E1C A;  3EUH A;  2BGC A;  4LK1 F;  3HYI A;  2COM A;  4ZYH A;  4RGU A;  1S7O A;  3KP4 A;  4IPA A;  5D6E A;  2PN6 A;  4CZZ A;  3WTY C;  5ICG A;  1WI9 A;  2GXG A;  4KMF A;  2OZ6 A;  1Z6T A;  1YYV A;  2A6H F;  2YX4 A;  4EGZ A;  2LF7 A;  1TBX A;  1XMA A;  4LFU A;  3L9F A;  2OQR A;  2F5F A;  3M9A A;  4A6D A;  1YS7 A;  3DKW A;  2E1N A;  4KYW A;  3W6J B;  5L3E A;  2MA3 A;  3EYY A;  3I64 A;  4ZYG A;  2P5K A;  1DP7 P;  1H9G A;  3J81 K;  4M9S A;  3ZMS A;  2O6G E;  1Z91 A;  1D8K A;  1FNN A;  3F8C A;  1HBX G;  1YG2 A;  1AWC A;  3KFW X;  5AIP A;  1YQA A;  2X0L A;  5KK1 A;  2HTJ A;  5KVR A;  3J80 Z;  1T6S A;  3GZ6 A;  3MWM A;  2EB7 A;  2QM3 A;  3MFK A;  3RJP A;  1U6G A;  5IT9 K;  3TQN A;  4OMZ A;  2GA2 A;  4I02 A;  3VB2 A;  3QU6 A;  3RDI A;  5HVQ C;  1JHF A;  3G73 A;  2EWN A;  4KNY A;  1O3R A;  2MC3 A;  2EFQ A;  1TW3 A;  1HQC A;  2XIG A;  3GFJ A;  1UHW A;  2MH9 A;  1K79 A;  4P9U A;  2CG4 A;  2HOE A;  4P96 A;  2AXL A;  2EFO A;  4RAY A;  4HF2 A;  3M1E A;  4MQV A;  1IF1 A;  1MD0 A;  5D8K B;  2VN2 A;  2JT1 A;  5CLS A;  3L7W A;  2D1H A;  3BJO A;  4FT8 A;  2DTR A;  1MDM B;  2FNP A;  2G7U A;  2MLG A;  2O3F A;  3LA7 A;  4TV7 A;  4P5O A;  1TQP A;  3SXY A;  3BRO A;  4G6D A;  3GW2 A;  3I53 A;  4RB2 C;  2OZU A;  1USS A;  1G6N A;  1C0W A;  1ZHF A;  1SFE A;  4EM0 B;  2JPC A;  3DXJ F;  1J59 A;  3HOS A;  2DLL A;  3KP6 A;  1T39 A;  2E7X A;  4E70 A;  6PAX A;  3GXO A;  3DQV C;  2OAZ A;  4EM2 A;  2PLY A;  3ELK A;  2GZW A;  3RTR A;  1S7A A;  2FE3 A;  2LSO A;  1JXS A;  5DDG A;  4CXF A;  1TNS A;  3HSR A;  1FYM A;  5LEK A;  3KE2 A;  3I54 A;  1W5T A;  4I09 A;  4CGZ A;  4ENK A;  1DUX C;  4AWX B;  5HLG A;  3VEP A;  4ZZL A;  3O3K A;  1PDN C;  1D8J A;  5L3G A;  4RGS A;  3I71 A;  3RPU A;  2HYG D;  2K4B A;  2P7V B;  5HS7 A;  2VBW A;  4ESB A;  4U88 A;  1FBU A;  1MDM A;  5ILU A;  3E3V A;  3P7N A;  3C18 A;  5JI6 A;  3M8E A;  4P9F A;  4K2E A;  1FBS A;  1ON2 A;  1BBY A;  3HSE A;  3TO7 A;  5L3F A;  2LKP A;  4KN4 X;  4XSX F;  1AOY A;  2FSW A;  1EH8 A;  2QVO A;  4R1H A;  5F64 A;  1YFH A;  3GFI A;  4G8X A;  5A2Q K;  3F8B A;  4IHS A;  1SD7 A;  1F5T A;  3VFZ A;  3HTS B;  2ZME B;  3I0T A;  1IRF A;  2ESH A;  3LA3 A;  1LVA A;  3BZ6 A;  1FT9 A;  2DO7 A;  4IF4 A;  1LDJ A;  3IRR A;  1P4X A;  2ZKZ A;  1T98 A;  3LAJ A;  4HLY A;  4HX7 A;  2NYX A;  3BDD A;  1XN7 A;  2K4J A;  4IRI A;  4XLN F;  2K86 A;  3F21 A;  4M6Y A;  4RGR A;  3LAP A;  1J75 A;  2O8X A;  1SMT A;  1SFU A;  1LEA A;  1P2F A;  2Z33 A;  2LNB A;  3KP7 A;  3MAJ A;  5L3B A;  2R7F A;  3KET A;  4N0B A;  5FO5 A;  3SZT A;  2K27 A;  4BHB A;  3WGH A;  2STT A;  3R61 A;  4ASN A;  2H6C A;  2P6S A;  1YTY A;  4PGH A;  1ON1 A;  2XRN A;  2D45 A;  1IN8 A;  3WU0 A;  3ERE D;  1E17 A;  4EQQ A;  2CFX A;  4UNO A;  3TGN A;  4WWC A;  2P8T A;  2VOD A;  1U78 A;  3QOP A;  3IHU A;  5TRD A;  1F1Z A;  1Z1D A;  4MEX F;  2DU9 A;  4Y15 A;  4HZF A;  1MZB A;  2QYO A;  2HQN A;  2ZME A;  4I01 A;  3FHZ A;  1RUN A;  3E5Q A;  2DT5 A;  1T0F A;  4RS8 A;  2A69 F;  2FF4 A;  3QAH A;  5DUK A;  4KIB A;  2XAF A;  3B73 A;  3H92 A;  4UHT A;  2PQ8 A;  3EYI A;  4GGG A;  4RB3 C;  2TDX A;  1O3S A;  1T38 A;  2V1U A;  3RIR A;  4WXD A;  4Y17 A;  1REP C;  1F9N A;  1J2X A;  1FSH A;  4YII A;  5BMZ A;  1UB9 A;  2QEN A;  2K7L A;  3QP5 A;  3GUD A;  4BQA A;  3GEZ A;  2XV4 S;  1ZLK A;  4MNU A;  3JAM K;  2GIV A;  3QP6 A;  1Z05 A;  2MH2 A;  2X4H A;  2HTS A;  3FF5 A;  1HW1 A;  2KRF A;  3LA2 A;  1LDD A;  3ECO A;  5AIQ A;  5K5O A;  1WKM A;  4IVN A;  5BQT A;  1ZAR A;  2D2W A;  1LNW A;  1IN4 A;  1OYI A;  1JHH A;  2NRA C;  2F2E A;  5LEJ A;  3DPL C;  2KJC A;  3HUG A;  4L9J A;  2EFP A;  2EV0 A;  4LMY A;  2PEX A;  3DFG A;  1L3L A;  4OIQ F;  4HV5 A;  2HWV A;  4QWQ A;  2M87 A;  2E7W A;  1K78 B;  5HLI A;  5HS9 A;  2YPR A;  4NQW A;  3FMQ A;  4CIC A;  5H6Q A;  1EH6 A;  4CO8 A;  1FC3 A;  2W84 A;  3CDH A;  5BOX A;  4GCV A;  2XGX A;  1KU9 A;  4IXA A;  3J80 K;  1RUO A;  2MBF A;  3IRQ A;  4ON0 A;  4L0Z B;  3L09 A;  1ZRC A;  2W57 A;  1MJA A;  2QZ8 A;  3WG9 A;  1QBJ A;  4PZJ A;  3HRS A;  5D5X B;  2VOO A;  3WE3 A;  4L9N A;  5LRS A;  3HRU A;  2VXZ A;  2DPU A;  2HR3 A;  1RNL A;  3QPT A;  2D1V A;  1QZZ A;  5DYM A;  4OIN F;  4A5M A;  1BOA A;  2KIF A;  2C6Y A;  2ZNY A;  4AIH A;  4R8H A;  1B9N A;  2FRH A;  2ZFW A;  1QNT A;  2CO5 A;  2BBY A;  3E97 A;  2PI0 A;  1QO0 D;  1XMK A;  2MLK A;  3WTW C;  3IWF A;  3WE2 A;  1OR7 A;  3F6V A;  1HW5 A;  4UV8 A;  3NQO A;  2RV8 A;  3V7C A;  4LD5 A;  5FLX Z;  2NAZ A;  1R5G A;  1FBQ A;  5ICE A;  1XSX A;  3LFK A;  5CVR A;  3GX4 X;  1SD6 A;  1ZG1 A;  4FX0 A;  2RNJ A;  5ILS A;  4HDU A;  1K78 A;  3BP8 A;  1UHM A;  3RYR A;  1ZH5 A;  4OIP F;  3ABU A;  1BI2 A;  1WWX A;  4EV0 A;  4EVI A;  3F72 A;  3V8K A;  3W6K B;  3ML6 A;  3MEX A;  2QBY B;  1ZGA A;  3M8F A;  3F3X A;  2O61 A;  2BV6 A;  4I0B A;  1O3Q A;  4FX4 A;  2EA4 A;  5LHH A;  2KKO A;  1G3Y A;  5LGT A;  2PMU A;  1J9I A;  1ZLJ A;  3JW4 A;  5LHI A;  2MD5 A;  5HDN A;  4A2U A;  4HDV A;  4HYE A;  2IP2 A;  4GXO A;  2L02 A;  1R23 A;  3FXU A;  4ETS A;  2IT0 A;  5L3D A;  4M74 A;  1O3T A;  3FXR A;  2UWM A;  1IRG A;  1ZN2 A;  4A5N A;  3ZP5 A;  4I2O A;  4LJZ F;  2YU3 A;  2ZJ2 A;  3IL2 A;  3D5L A;  4MTD A;  1ZRE A;  1R00 A;  2KIM A;  3TDU C;  1MGT A;  4U7D A;  3DV8 A;  2IA2 A;  3HTU A;  4KN7 X;  3R4K A;  4HW0 A;  2JTV A;  5DD8 A;  3RKW A;  2ZCW A;  3WTZ A;  2QQA A;  4HBL A;  3M7G A;  1G3S A;  3GYH X;  3F6O A;  2FNA A;  3Q9S A;  1DPU A;  3CUO A;  5FGM A;  1XCB A;  3KZZ A;  5ICF A;  2VBY A;  3HRT A;  1QZY A;  1SD4 A;  3HOT A;  2GQQ A;  3BPX A;  3F23 A;  3KLN A;  2OQG A;  5LRR A;  1ZGJ A;  2DAO A;  1STZ A;  1W4M A;  4EM1 A;  3REO A;  3CO7 C;  4G7Z F;  2VOP A;  3FM5 A;  1EH7 A;  4HF1 A;  4MEY F;  1TW2 A;  2H6B A;  3TKY A;  2XAS A;  3U9G A;  2ISY A;  3ECH A;  2L4A A;  1XGS A;  2YX7 A;  3L2C A;  2QBY A;  2HGC A;  2EV5 A;  3I4P A;  1H0M A;  4EJU A;  3MZH A;  3EDP A;  4LK0 F;  1G4D A;  1OMI A;  4G7H F;  5DCM B;  3PQJ A;  2H09 A;  4UUV A;  1P6R A;  2A68 F;  2XKP A;  1XB4 A;  4L9V A;  4OU0 A;  3ZMU A;  2P7C B;  2BYV E;  5IT9 Z;  3E5U A;  2XUB A;  5E1Z B;  1O7L A;  1KQ8 A;  4LLN A;  2ZO4 A;  4QLC U;  3HHH A;  2FBI A;  3R6S A;  2ETH A;  2FBH A;  3BPV A;  4O6J A;  1O57 A;  1B9M A;  1FSE A;  3MCZ A;  1TTY A;  1I1S A;  4OIO F;  2F5E A;  2DI3 A;  3VOE A;  3IKT A;  1CF7 B;  1HSJ A;  4B09 A;  2Z5U A;  2M45 A;  2W25 A;  2XAQ A;  2ZBK A;  1HKS A;  1FX7 A;  3DP7 A;  3ZQ7 A;  4G6Q A;  5DD4 A;  1KU2 A;  3SFZ A;  3GFM A;  4LB6 B;  2V6C A;  4FHT A;  1IN6 A;  4PGG A;  1B4A A;  4L9T A;  4YIF A;  4M71 A;  1SAX A;  2VBZ A;  3E6B A;  1V4R A;  4L5J A;  3C1D A;  3N4M A;  2WWY A;  2L4M A;  1D5V A;  4ZH4 F;  2IVM A;  4B8X A;  1BIB A;  2IA1 A;  4U0Y A;  2IRF G;  2Z9O A;  5CJ9 A;  3HIF A;  1VTN C;  5DCM A;  2VT3 A;  5LLQ A;  4OOI A;  2PG4 A;  1OYY A;  2QQ9 A;  2CW0 F;  1XDS A;  4KIF A;  2PFB A;  3RYP A;  1UFM A;  2PMH A;  4MHG A;  4BH9 A;  2QLZ A;  5E8I A;  1G3T A;  2IW5 A;  2LDU A;  2M5W A;  3LST A;  1XGO A;  1D3Y A;  2ADU A;  2XHK A;  2VON A;  3FM3 A;  3C7J A;  4G9Y A;  1KYZ A;  1J5Y A;  2DK5 A;  3VOD A;  1IXC A;  1CF7 A;  2A6E F;  1XDU A;  3T5X A;  4CHU A;  2M8E A;  3RKY A;  3K0L A;  4DQ2 A;  4EJT A;  5E8G A;  5E1W A;  5BPI A;  3V4G A;  4WXH A;  4GYG A;  3F8N A;  5HDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...