3GF2A

Crystal structure of the hypothetical regulator st1710 complexed with sodium salicylate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gf2A00
3R60A 1XN7A 4ZZDA 3WTUC 5TJJA 5LBQA 2HQNA 3RTRA 1J9IA 5L3EA 3RYRA 2MC3A 1R1TA 2KJBA 1IRFA 1LB2A 1ZG5A 1XSDA 2R7FA 2HS5A 2KIFA 1EV7A 4I0AA 4ESJA 1J2XA 4WXDA 2P5KA 1QNTA 2GZWA 1IW7F 2DBBA 4A0XA 1PP8F 5E1XA 2GQQA 1AOYA 2LNBA 1JGSA 2EWNA 2UXNA 1SMYF 1UCRA 1IN8A 3NQOA 2FE3A 3P7NA 2YX7A 5H20A 3HTSB 5DCFA 2FNPA 2AXLA 4U0YA 4O6JA 2VT2A 5A2QK 1KQ8A 1FPQA 2HDCA 2MH9A 4XLPF 3I59B 4ZH4F 4CGZA 4MQ9F 3WTTC 3QU6A 3GZ6A 2NAZA 1KQ0A 1QO0D 3E5QA 1U5TC 2A68F 2HQRA 3LAJA 3RIRA 2ZNYA 5ILSA 1R22A 2WTEA 4EMSA 5D4RA 3F72A 2CGPA 3V7RA 1HXDA 1QZZA 4P55A 5CVUA 5CYVA 4XLNF 3DFGA 4RGUA 2HKXA 4PGHA 3RJPA 1ZG1A 2FU4A 3JSPA 2EV6A 5ILUA 1MJAA 3LQQA 2PBIA 2Z3YA 1D5VA 2JPBA 2WC2A 3L09A 3SHFA 4U0VA 1IXRC 4AVPA 4HDUA 5AIQA 3EDPA 3O6BB 5DEQA 3FM3A 3KEQA 4R1HA 1W7PA 1E17A 3WTXC 4XRFA 3G73A 1B4AA 1BM9A 1SAXA 3ZMUA 4AWXB 3M8FA 2G7UA 4JBAA 4HV6A 2PQ8A 2VC0A 3E5XA 4RB2C 2RDPA 2K86A 1XSVA 1RNLA 4KIBA 4HLYA 1YTYA 3BROA 3KP3A 4N0BA 4A0YA 2Q8KA 2VN2A 5HOOA 3EYYA 6PAXA 3MCZA 1YW7A 2D1VA 3CUQA 3M1EA 2VBWA 3T0YA 1S29A 3RPQA 1WRJA 4LG0A 4FT8A 4PCQA 3IRRA 2DK8A 2P8TA 3RI4A 1BI2A 1LNWA 5E1ZB 1XMAA 2NNYA 1O7LA 3L7WA 4OU0A 1KU7A 1REPC 2F5FA 1ZARA 3V8JA 3B73A 5LRRA 2R3SA 4P9FA 2VOPA 5BS6A 1Z91A 5FB2A 3IWZA 5FFXA 1WSUA 1T6SA 2DU9A 2QBYB 4HW0A 2CG4A 4IVNA 2IT0A 1FBUA 1ZRCA 2W24A 2VXZA 5BPIA 5IT3A 1I27A 5JFRA 5HDKA 4LFUA 1K7AA 2XUBA 3IRQA 3RDIA 2CO5A 5FFZA 5CJ9A 4YFXF 2J5PA 1YO5C 4KFCA 3KP2A 5CVRA 2FEZA 3WU0A 1O3QA 3R61A 3ERED 1SD4A 2EB7A 2M1BA 2RNJA 4UHTA 2VC1A 2D2WA 1ZLKA 2XKPA 1S7OA 2XAJA 5L3FA 4HX8A 2HOEA 4RB0A 5K5OA 1H0MA 4L18B 3KETA 2MH2A 4NQWA 3K1PA 4R79A 1U3EM 4EJWA 4WF2A 2EFWA 2JSCA 2RGVA 1T98A 1LEAA 3DV8A 2NNNA 1J7KA 2HTSA 1SD6A 4RB1A 4O3MA 3H3UA 1GXPA 5ED4A 1T2KA 3S2WA 1EH7A 2L02A 1Z9CA 3E3VA 3ZQ7A 2E1NA 2IA2A 1GVJA 3P9CA 4G6QA 4CYDA 4MTEA 2Z9OA 2IRFG 3ABUA 5D8KB 2STWA 2EFOA 4A5MA 3H3ZA 4M71A 1G6NA 2IA0A 2DFIA 1WQ2A 1C0WA 5DCMA 4NHJA 3WG9A 3I71A 1O3SA 3HRUA 3RPUA 4IF4A 4EM1A 3WTZA 2KJCA 2O0YA 3PFIA 2PI0A 2ADUA 4OOIA 5IT9K 2R7DA 1K6OA 2K4BA 5DYMA 3RYPA 4L9JA 1TQIA 3K1NA 4HA8A 3CUQC 3REOA 2JZYA 1Z7UA 3GZ5A 4L9VA 2BV6A 1I5ZA 2ACJA 4D0PA 4EV0A 2VE8A 2CSOA 3EYIA 3U9GA 2YX4A 4ON0A 4HAMA 2MA3A 5HLHA 3HOSA 3F8NA 5AONA 5JVTA 2UZKA 2FBIA 4Q5SF 3TDUC 2DAOA 5HVQC 2DT5A 2EA4A 4MTDA 4HLXA 3ULQB 3I5UA 2XIGA 3CJNA 3E6DA 5LGTA 3OOPA 3DXJF 2GA2A 3LAPA 2CQKA 4AIHA 4CHUA 3B02A 4GXOA 5E17F 2M8EA 1G3TA 4IRGA 1B9NA 4N9IA 1O3RA 3COAC 2JT1A 1U5TA 2O3FA 1UB9A 4EGZA 1XGMA 1MD0A 1JXSA 2ZJ2A 3T8RA 1W4MA 4L5JA 1U78A 5EEHA 3ZP5A 2HFHA 4EGYA 1B6AA 1BIBA 1MJBA 4Q47A 4RB3C 1R7JA 4G7OF 3BJ6A 1HW2A 1XGNA 3BY6A 2B0LA 5ERIA 3HSRA 1ODDA 5HS9A 4L5IA 3LA2A 2RVCA 1FP2A 4OIPF 4M6XA 4MNUA 2Y48A 3J81K 4ENNA 2EK5A 2VOOA 4LLNA 3IL2A 2P6TA 2VBYA 2JRTA 2DI3A 3DEUA 1RZ4A 1USSA 3V8KA 2GXGA 1BI1A 1EH8A 4KT5C 3SXYA 4FX4A 3P9IA 5DUIA 4N9HA 1YW8A 4I09A 1HSTA 1R36A 1FLIA 4Q48A 5D4SA 1ZRFA 3DP7A 2D1HA 4GYGA 3JTHA 4BHCA 3I58A 3KFWX 2RQPA 3RKYA 3F21A 2PLYA 4QLCU 4GO1A 3HHGA 2QM3A 3CDHA 1J75A 3IHUA 2XHKA 4U7BA 3F6VA 3GX4X 3M9AA 5F6FA 1WWXA 3VODA 5IT9Z 3WE3A 5L3CA 5K5RA 1TW3A 2XROA 3JW4A 4L9TA 5D5VB 3CLOA 2FRHA 1YW9A 2P6SA 1KU3A 2FMYA 1YIOA 3BDDA 1ZLJA 3ABTA 5ICEA 4RGSA 1STZA 2ZXJA 1K78A 1W5TA 2BYVE 4Y17A 2GA1A 1HW5A 4RGXA 3EQLF 4P96A 2OZUA 1FYLA 2PJPA 5K1YA 2XASA 2FQ3A 1ZYRF 3LQRA 1KU9A 2FBKA 2YR2A 5D6EA 3KP5A 4HV5A 2P7CB 3U1DA 3CO7C 1IN4A 4RGRA 1GHCA 3BPVA 4HQMA 4YIIA 2E7WA 1DUXC 4LLLA 3GEZA 2IP2A 2P7VB 5D6FA 2M5WA 4UV8A 3HIFA 3D0SA 1CF7A 4UVAA 1I6XA 2JTVA 4KICA 4BXUA 2BEOA 2HTJA 2Z99A 4KDPA 3O3KA 3RKXA 5TRDA 2E1CA 3P9KA 2VBXA 3HSFA 5BQTA 5CVJA 4KMUX 4ZYGA 1TNTA 3QPTA 2A6HF 3LSTA 2PEXA 2NRAC 2QQ9A 5HS7A 2H09A 3ISPA 2Z33A 3J81Z 4HDVA 4G94A 3LA7A 3NEUA 4IHSA 1K79A 2ZO4A 2EV5A 1NHAA 1A04A 5LGNA 3WGGA 1IRGA 4ESFA 4HF1A 2YSRA 3WTSC 3GO5A 3F3XA 2P4WA 5E1WA 3KLNA 1B9MA 2YU3A 1SFEA 1MDMA 3FWEA 4XBFA 1FY7A 1BJAA 5DDGA 2RKHA 3ZN1A 5LGUA 3V7CA 2LDUA 1HKTA 1LDJA 1ZH5A 1DP7P 2A5YB 3TDZC 1IF1A 4GYIA 4LGWA 1P4AA 2XKOA 1FBSA 2GWRA 1H9GA 1R1VA 1O7FA 4HF2A 1XCVA 4Q4ZF 2FMLA 1FBQA 4WXCA 4I7HA 3R0AA 2D45A 3WGIA 2ELHA 1J0RA 3ECOA 2EV0A 1I1GA 3TOBA 4BYYA 2H27A 1MZBA 1YQAA 2FBHA 2IVMA 5HLIA 3K69A 1ZGJA 3WE2A 1UFMA 1HQCA 3WTYC 5CLSA 5FD6A 3G3ZA 4HBLA 1ZN2A 3GVAA 4BAYA 2V6CA 3HUGA 5LRSA 3HOTA 1G4DA 2QQBA 5L3BA 1BN5A 2EFPA 3PQJA 2FXAA 1FNNA 5JHUA 1RUNA 3TOAA 3GW2A 3LFKA 5FLXK 4AIKA 4BQAA 2M45A 1HBXG 3GUDA 2DQLA 4XSXF 3HRSA 3ZMZA 1U5TB 4YIFA 3ZMTA 3PQKA 3GF2A 2HGCA 4YFNF 4H0EA 4MQVA 5AIPA 1P6RA 4QWQA 1TBXA 3QP5A 1IXSB 3FXQA 2L54A 4Y15A 2LKPA 4I0BA 2QYOA 2W84A 4LMYA 3M8EA 3VEPA 1PUEE 3KCCA 2RV8A 3HRMA 2K7LA 3OV8A 1BOAA 2OAZA 4ASNA 3BZ6A 1IXCA 2UXXA 2HR3A 5EEGA 3M7GA 3SZTA 2H6BA 3WGHA 3FMSA 3ELKA 3N97A 2E7XA 1YYVA 1ON1A 2CYYA 1LVAA 2K27A 1JHHA 4WX9A 2G9WA 2YPRA 3GFJA 1KQ9A 2G7HA 4BHPA 5DUKA 4M9XA 4RS8A 1SFUA 1OR7A 5E18F 1YS6A 3BJAA 3R6SA 1U8RA 4ZYHA 3DPTA 3NRVA 1B1BA 4LJZF 2HYGD 1SD5A 2J5OA 2PN6A 2KRFA 4EJVA 1BBYA 4KYWA 1SMTA 4LK1F 3ZN0A 1J5YA 2CWEA 2M30A 1OYYA 3QRFF 1FC3A 2L4MA 4CXFA 3BP8A 4XSZF 1LQ1A 3K2ZA 4Z2YA 4OIQF 3R0JA 2DPDA 4M72A 4BNCA 2F2EA 4HX4A 3JAMK 1MKMA 1ZG3A 5CVIA 1KYZA 1W7PD 4HYEA 3E6CC 2BE5F 5D5WB 3FM5A 3TO9A 1O57A 4EM2A 3GFIA 3ZPLA 4GGGA 4IJAA 2QVOA 1ZAOA 3GLXA 3ZMVA 1TQPA 2C6YA 4S04A 3JTGA 1I1SA 1G3YA 2H6CA 4EM0B 4HQEA 4EJTA 3V8LA 1OMIA 4L0YB 2Y0MA 1D8KA 2WV0A 1HSJA 1LJ9A 2VT3A 4G9YA 5BPDA 2PFBA 2XAGA 1YG2A 4A0ZA 4DQ2A 1EH6A 2V9VA 4E70A 4EQQA 1SFXA 2UWMA 1XD7A 5FLXZ 4BHBA 3IC7A 2DK5A 4ZZLA 2OQRA 2TDXA 1JHFA 4I98B 1F9NA 2CW0F 1WKMA 1DPRA 1R58A 5FGMA 2IJLA 1FYKA 1BI0A 1B59A 3W6JB 2BBYA 3W6KB 1R5HA 2OQGA 3MZYA 3DQVC 2V79A 2V1XA 1S6LA 1S3JA 1TQMA 4ETSA 1J59A 3EUHA 3DKWA 2MLGA 3SZPA 4I2OA 4L0ZB 4KN4X 5J8FA 3DPLC 1DPUA 1W7PB 3J80K 2DO7A 3HYIA 2DPUA 1ZRDA 1LEBA 1IN5A 3ML6A 5FD5A 2A07F 1FWZA 2FSWA 4ENMA 3VFZA 4R8HA 1D3YA 3V7SA 1FSEA 1TW2A 5FO5A 2L3DA 2IA1A 2XGXA 2ESHA 2Q2EA 3I0TA 4LB6B 3KP7A 3CUQB 1YFHA 1RIOH 1BC7C 4OMYA 3C3WA 4KNYA 4A12A 3VOEA 1KYWA 4WXHA 5HS8A 2OA4A 4HF0A 4RAYA 3N4MA 4LG0B 1IUYA 3BJOA 4BH9A 1FOKA 2X4HA 5LEJA 2A6EF 2OZ6A 4PZJA 3ROUA 2O03A 2EJRA 3QU3A 2A61A 4HZFA 2ZMEA 5LHGA 4G7ZF 5BMZA 5BOXA 1QPMA 1FZPB 4U7DA 3MQ0A 2COMA 5H6RA 1F5TA 2GAUA 3JAMZ 2RC4A 1T39A 4G7HF 3KEOA 4G8XA 5DD4A 1QZYA 1W5SA 1XMKA 5L3DA 3KZYA 4S05A 1IN7A 4M9ZA 2FF4A 1T38A 3QPHA 1OKRA 3FMQA 1Z6TA 2A3SA 2PG4A 4M9SA 2HYFA 1QBJA 5E20A 3F8BA 3WTVC 1ONVA 1BI3A 1ULYA 2X0LA 4A5NA 2V1DA 1T0FA 4JK1X 2HZTA 1XCBA 1D8JA 4OINF 2BGCA 2VONA 4LD5A 4IHTA 5ICFA 4UNOA 4AIJA 4B09A 1OPCA 5HDGA 4YFKF 1XGSA 1R00A 4O5VA 1LDKB 5DD8A 1XSXA 2OBPA 1P4XA 1S8NA 1ZGAA 3HHHA 5LEKA 3SQNA 2QLZA 1R1UA 3KE2A 2NS0A 3I54A 1UHWA 4ESBA 3FMRA 1V3FA 4HOBA 5F64A 5LLQA 2XAFA 4UV9A 1IZ1A 2P5VA 4CICA 2HKOA 4A2UA 2PMUA 2OD5A 2W25A 4IRIA 4UXNA 3MFKA 1F1ZA 2VE9A 5DCMB 5J8CA 1P2FA 2K02A 1Q1HA 1UHMA 4ENJA 4MEXF 4WCGA 2F5DA 3J80Z 3KLOA 2ISZA 4KIFA 1R23A 4KIGA 3E6MA 4OMZA 1RUOA 1RI7A 2Y75A 3F8CA 2XRNA 3FXUA 4B8XA 3F23A 2F5EA 2Z5UA 4ZYDA 5LHIA 2MLKA 3VB2A 1ZREA 3QAHA 3WU1B 3F8MA 3CTAA 5DV5A 2LF8A 3DF8A 2V1UA 3LA3A 4K2EA 1MJ9A 2ZCWA 1IAWA 5J6XA 1TLHB 2JPCA 1QQIA 3C1DA 4PGGA 5JI6A 1PP7U 4UVCA 1TTYA 2MD5A 4GCVA 4KUMA 4RAZA 5L3GA 1U6GA 1BIAA 3JSOA 2CFXA 1HKQA 4P9UA 2PMHA 1G3WA 3D5LA 3HRTA 2HWVA 2ESNA 1Z05A 3RKWA 1KU2A 2QUFA 3I59A 3WODF 3I64A 2XAQA 2ETHA 2XVCA 1L0OC 2L01A 4IRHA 2NYXA 2QENA 1ZHFA 3H92A 3T8TA 2W57A 2EFQA 2DQRA 3MAJA 1YLFA 3E97A 5KK1A 2VODA 2W85A 4OIRF 2ZKZA 1G3SA 5A2QZ 4A6EA 1TNSA 1V4RA 4DNCA 4MHGA 3LWFA 1P92A 1WI9A 2O8XA 3MEXA 4ZYEA 5E8IA 3QP6A 4U88A 3BWGA 1XDUA 5ILVA 1E2XA 1FP1D 1XDSA 2ZBKA 1Y0UA 2XV4S 1XB4A 4EJOA 3GYHX 1IN6A 1U2WA 1LDDA 4CZZA 4M74A 4M6YA 3L00A 2AS5F 2XAHA 4NB5A 2QZ8A 2KKOA 3E6BA 3FZVA 1OYWA 4CDGA 3T5XA 4KN7X 4YG2F 5H6QA 3BOQA 4L9NA 2EA2A 4FHTA 1X3UA 3CUOA 2K4JA 1HW1A 5LHHA 3I4PA 2ZNZA 5D5UB 2VBZA 5K5QA 1F4KA 2M87A 2F5CA 2FOKA 1PDNC 3TKYA 4LLGF 1Z6RA 2OU2A 2ZFWA 1KA8A 2Q0OA 5D5XB 3F8FA 5E8GA 4EVIA 4WK8F 2QQAA 2MBFA 3MWMA 3FF5A 5HLGA 2HEOA 3GFLA 2QBYA 3TQNA 1VTNC 3IWFA 3T1BA 5F1RA 1K78B 4P5OA 1CGPA 2O6GE 4FX0A 4AD9A 1AWCA 1SD7A 2EFNA 2ZMEB 3TGNA 2KIUA 3KZZA 4UVBA 2H94A 3E5UA 3KP6A 3EETA 1GXQA 2DLLA 3ECHA 1FSHA 4G6DA 4OIOF 3V4GA 2O61A 2IPQX 1FX7A 3ZMSA 2QWWA 1O3TA 3K9TA 1FYMA 4UUVA 4Y13A 3C7JA 5CVVA 1BC8C 5D8LB 5ICCA 2LF7A 4F7ZA 1YS7A 3F22A 3CO6C 1MGTA 4IPAA 3Q9SA 2RN7A 3KP4A 2GXBA 3J7AO 3F6OA 2GIVA 3I53A 3K0LA 1CF7B 1R5GA 3BPXA 1OYIA 3FX3A 3O2PE 4PDKA 4CO8A 4M73A 4TV7A 2P5LC 1ON2A 4LB5A 3GFMA 3SFZA 3ZMDA 5ICGA 3K1MA 2A69F 4JQFA 4I01A 1HKSA 3L9FA 4KMFA 3WTWC 2DW4A 3IKVA 5JR3A 1QGPA 3TO7A 1L3LA 1S7AA 5KVRA 4LK0F 2FNAA 4U0WA 3GWZA 5HDNA 1H9TA 3L2CA 4MEYF 4WWCA 3R4KA 1KGSA 2LSOA 4HX7A 2STTA 2DTRA 1P4WA 3IKTA 2L4AA 3Q5FA 3HSEA 4A6DA 3FHZA 4MGRA 3AAFA 2WWYA 3GXOA 1DDNA 1MDMB 4EJUA 3Q9VA 3U2RA 1USTA 4IXAA 1Z1DA 3QOPA 1JE8A 3C18A 4I02A 1XGOA 2FA5A 2KIMA 1FT9A 2ISYA 3FXRA 2IW5A 3HTUA 3TO6A 4ENKA 4KA4A 3MZHA
chains in the Genus database with same CATH superfamily
3R60A 1HF0A 1WCMJ 2PMZA 1I50J 1QU3A 1XN7A 3IH4A 4ZZDA 4UUSA 4A3DJ 2KRCA 3A2KA 2DOEA 1KZHA 3WTUC 5TJJA 2XF6A 5GAEJ 5LBQA 2HQNA 2E34A 4XN3A 1QVUA 1RPWA 3E1SA 3RTRA 1J9IA 3J7AY 5L3EA 3PL8A 3RYRA 4DZJA 4Y52J 3MKZA 2LR8A 2MC3A 2PX9A 4RLFA 1R1TA 2JVGA 3D1NI 2KJBA 1IRFA 1LB2A 1RKTA 4XMYA 1OLTA 1ZG5A 1XSDA 2R7FA 1SVOA 2HS5A 2KIFA 1EV7A 3OWTA 4I0AA 4ESJA 1J2XA 4WXDA 2VJIA 2P5KA 1IDYA 1QNTA 2GZWA 2O5RA 5C3EJ 1IW7F 2DBBA 1X1PA 4A0XA 1A6QA 2WAFA 1PP8F 5E1XA 2GQQA 4E7IA 4A3MJ 1AOYA 2LNBA 1JGSA 5J1UA 2EWNA 2UXNA 1SMYF 1UCRA 4FETA 1T33A 1IN8A 3NQOA 2FE3A 3HUGB 4ZTFA 3P7NA 2YX7A 5H20A 3HTSB 3GTMJ 2Z16A 5DCFA 2Y9YA 1A31A 2FNPA 2AXLA 4AU7A 4U0YA 4O6JA 2VT2A 2ME6A 5A2QK 3V42A 1LUJB 1P7JA 4CYCB 1FPQA 4DOZA 1KQ8A 1B8IA 2HDCA 2MH9A 2VASA 4XLPF 1FTTA 3I59B 2JUGA 2QF7A 4ZH4F 4CGZA 4MQ9F 3WTTC 1GT0C 3QU6A 2WA0A 3GZ6A 2NAZA 1KQ0A 4BEHB 1QO0D 3E5QA 1U5TC 1DU0A 2A68F 4FQGA 2HQRA 3LAJA 2GM4A 3RIRA 2ZNYA 1ZQ3P 5ILSA 4Y4RA 1R22A 2WTEA 4EMSA 2L7ZA 2MSYA 5EF6A 3F72A 5D4RA 2CGPA 3V7RA 1HXDA 1QZZA 3J7ZI 2WB1N 4P55A 5CVUA 2QEXI 5CYVA 4XLNF 3DFGA 1Y8QB 4RGUA 2HKXA 4PGHA 3N05A 1ETKA 3RJPA 1Y39A 1ZG1A 3CCMI 2FU4A 3JSPA 3DWLE 2EV6A 5ILUA 1K83J 1MJAA 2BY1A 2VJ5A 2X6OA 4B1RA 3OYFA 1I6HJ 5IP7J 3LQQA 2PBIA 4QSHA 2Z3YA 1VFCA 5J4VA 1D5VA 2CH0A 2JPBA 2WC2A 3L09A 1VQ8I 3SHFA 4U0VA 1X1BA 1IXRC 4F55A 2K40A 1WI3A 3WHCA 3L2VA 4AVPA 2LYCA 4HDUA 2ZC2A 5AIQA 2E2JJ 2DN0A 1YI2I 2LY1A 3EDPA 3MN2A 3O6BB 5DEQA 3FM3A 3JRBA 1MBEA 3DTEA 3KEQA 3M1CA 1W7PA 4R1HA 1E17A 5HODA 3WTXC 2CQ7A 4XRFA 2VB6A 1T8IA 1B4AA 1BM9A 3G73A 1SAXA 3ZMUA 1FEXA 4AWXB 3M8FA 2G7UA 4JBAA 4HV6A 2PQ8A 2ZXIA 4Y33A 1FOYA 2VC0A 4RDUA 3E5XA 4RB2C 3CCRI 2RDPA 3AG1H 2K86A 1XSVA 1RNLA 4KIBA 4HLYA 1YTYA 1T08B 3BROA 1HDPA 3KP3A 4N0BA 4A0YA 1ZKGA 1LFPA 2Q8KA 2DMTA 4NNJA 1ZK8A 5J3LA 2VN2A 2CW7A 3D5RC 5HOOA 1Z67A 3EYYA 2R5ZB 3CC2I 6PAXA 1ETVA 3HGYA 3MCZA 5EG0B 1XG1A 1YW7A 2D1VA 3CUQA 3M1EA 2VBWA 4B43A 4EEFG 3T0YA 2HDDA 4UY8I 1Z21A 3SZGA 4A3CJ 3VSKA 1Z77A 2XC7A 1S29A 3RPQA 2FD5A 2L7KA 2VUMJ 1WRJA 3E7LA 2DCEA 4LG0A 4FT8A 4PCQA 1YJWI 3ESWB 2DK8A 2P8TA 2M0CA 3IRRA 3RI4A 1BI2A 1K61A 3GTQJ 3LNQA 1LNWA 5E1ZB 3LL7A 1XMAA 1TWCJ 2NNYA 2AXTC 1O7LA 3CESA 2KIQA 3L7WA 4OU0A 1KU7A 2E2HJ 1REPC 3RCOA 1BW6A 2ZSIB 2VJJA 2F5FA 1ZARA 3V8JA 3UR3C 2Y69H 1OCOH 1V5GA 2X6XA 1PUFB 1FTZA 1BA5A 3B73A 3QPSA 2F6CA 5LRRA 2R3SA 2A5WA 1BR4A 1TWAJ 5FKLA 2BHYA 4P9FA 3OY9A 1S72I 2VOPA 2JRMA 5BS6A 4BU2A 1Z91A 5FB2A 3IWZA 5FFXA 1WSUA 2QCOA 2TCTA 1T6SA 3G1MA 2DU9A 5DTDA 2QBYB 4HW0A 2CG4A 3OR1C 3OS2A 3NAUA 4IVNA 4XKWA 1FBUA 2E5NA 2IT0A 1E0EA 1XTAA 4BJTA 4C2MJ 4IOCF 3DLAA 3KYCB 1ZRCA 3CJRB 2W24A 2VXZA 5BPIA 2B7EA 5IT3A 5C4XJ 3A02A 1I27A 3QQAA 1JJ6C 3BZCA 5JFRA 3ABKH 3QYFA 5TISC 5HDKA 1VZ0A 4LFUA 1K7AA 2CRGA 2XUBA 3IRQA 3BCAA 3RDIA 1S7EA 2CO5A 2E1MB 5FFZA 5CJ9A 4YFXF 1HDDC 1JUPA 1SAUA 1M1EB 1ETOA 4D5CA 2J5PA 3C2BA 1YO5C 4KFCA 3KP2A 2ZJPF 5CVRA 4J00A 3G1OA 4PJMA 2FEZA 3WU0A 1O3QA 3R61A 3SYTA 1MBJA 3ERED 3LSKA 1SD4A 5J47A 2EB7A 2M1BA 2RNJA 4UHTA 2VC1A 2O8KA 4A3GJ 4C3IJ 2D2WA 4A3IJ 3M07A 3RSNA 1ZLKA 2XKPA 1WJDA 1S7OA 2FOWA 2XAJA 5L3FA 4HX8A 3EUAA 4FCYA 2OTJI 2K3PA 2WBMA 2HOEA 4DJAA 4RB0A 1I39A 5J1YA 5K5OA 3SEQA 4B3AA 1FIAA 1ACIA 1H0MA 3L2UA 2VJ4A 3KETA 1TWFJ 4L18B 2M8GX 3HM5A 2MH2A 4NQWA 3K1PA 4R79A 4CCJA 1JTXA 2I8DA 4U87A 4WF2A 4EJWA 2EFWA 1JUMA 1U3EM 4IHXA 2JSCA 3KZIC 2RGVA 1MMDA 1T98A 1LEAA 1DQUA 3DV8A 2NNNA 2KRHA 1J7KA 2HVRA 4HNVA 2RREA 2HTSA 4XLHA 1SD6A 4S0HB 4RB1A 3OYHA 4O3MA 3H3UA 1GXPA 3GZNB 3RQIA 1N25A 5ED4A 1T2KA 3S2WA 1EH7A 2L02A 4XL9A 1Z9CA 4J19A 3E3VA 3ZQ7A 4D7NA 2E1NA 2IA2A 1XC5A 1GVJA 3P9CA 1V55H 4G6QA 1VQPI 5B5EC 1VQ7I 3KX2A 4CYDA 4MTEA 1TC3C 2OJED 2Z9OA 2IRFG 3ABUA 2F4OB 5D8KB 2STWA 2EFOA 1Z0XA 4A5MA 2L2OA 3H3ZA 1D0XA 4M71A 3O8HA 1G6NA 3OYCA 2R7RA 2BXYA 2IA0A 2DFIA 1WQ2A 1C0WA 5DCMA 3Q0VA 4NHJA 3WG9A 5CQGA 2XF7A 3I71A 1O3SA 3HRUA 2VQGA 3RPUA 4IF4A 1VF9A 1MMGA 4I76A 3PJRA 4EM1A 3EPZA 5KCMA 3WTZA 2KJCA 2O0YA 3RZDJ 3PFIA 3IP4B 2PI0A 2ADUA 4OOIA 5IT9K 4MLOA 2R7DA 1K6OA 2K4BA 3D5SC 4H4KC 5DYMA 3RYPA 3IAS2 4L9JA 4BQNA 2GLOA 4HRIA 1TQIA 3K1NA 4HA8A 2L0KA 3CUQC 3REOA 2H1LA 2JZYA 1X1DA 1Z7UA 3GZ5A 4L9VA 3FIWA 2BV6A 1U9OA 1I5ZA 2ACJA 4D0PA 4EV0A 1S5LC 3OYGA 2VE8A 2CV0A 2CSOA 2X1DA 2EQRA 5HNFA 3M3YJ 4IQ4A 2BZTA 3PIOF 3S3OA 2HOSA 3EYIA 3JREA 3U9GA 2ID3A 3JRAA 2YX4A 4ON0A 4HAMA 2MA3A 5HLHA 2KDOA 3HOSA 1Y56A 3F8NA 2K9SA 4IEJA 5AONA 2LP0A 5JVTA 2UZKA 1IO2A 2FBIA 4M6VA 4Q5SF 3TDUC 2DAOA 2IGOA 5HVQC 4IOAF 5FKKA 2DT5A 2EA4A 2XF5A 3CMMA 4MTDA 1I3AA 4HLXA 3ULQB 2X6YA 3I5UA 3OIPA 3HL2A 3OIOA 3AG4H 4C2TA 4CUGA 1MSEC 3H5NA 2K5CA 1FOXA 2XIGA 3CJNA 3E6DA 1IUFA 5LGTA 3OOPA 4OAZA 2NOGA 4X0GA 1BJZA 1B72A 2KZVA 3DXJF 2JA7J 4E7KA 2GA2A 3JRFA 3HOVJ 3LAPA 5M5XJ 2ICWG 3AKZA 3S8PA 3HZJA 1RR8C 2CQKA 4AIHA 4CHUA 1IRXA 3B02A 1QRYA 1YRNA 4GXOA 4BJ5C 2M8EA 1G3TA 5E17F 3PNYA 3E0JB 4IRGA 2I10A 1B9NA 2OC6A 2R4GA 3BR5A 1W0UA 3QOEA 4N9IA 2DA6A 1O3RA 3PSIA 5FROA 3FBNB 3COAC 2JT1A 2DXIA 1U5TA 2JA5J 4BXXJ 2O3FA 1UB9A 3PNVA 4HSRA 4EGZA 2KISA 1XGMA 1B8IB 4BQQA 3CCYA 1MD0A 1JXSA 3PO3J 2ZJ2A 3T8RA 4X1EA 3GMEA 2VPRA 1HA8A 1W4MA 4L5JA 1U78A 1Y0NA 5EEHA 2XAUA 4HPQA 4GRIA 3BTIA 3CCUI 3K70C 3ZP5A 3CDIA 3HPGA 3HOWJ 2HFHA 2ECCA 4EGYA 1B6AA 1LPQA 1BIBA 3MZ8A 1MJBA 5IOZA 4Q47A 4RB3C 1R7JA 2DODA 2MFZA 2XDVA 3BJ6A 3ERMA 4G7OF 2X85A 2XPVA 1HW2A 1XGNA 5M3FJ 3BY6A 2YU9J 2B0LA 5ERIA 3HSRA 2VQCA 3DKYA 1D1BA 1ODDA 5HS9A 2R7SA 3BG5A 4L5IA 3LA2A 3C2GA 2RVCA 2I5UA 3S2DJ 1FP2A 2A6TA 1WVRA 4OIPF 4M6XA 2PMZN 4MNUA 2Y48A 3J81K 2KDZA 3LSHA 4ENNA 1BOBA 1VI0A 2LH9A 4FTHA 1U8BA 2R7UA 3H9GA 2EK5A 3L1PA 2VOOA 2QKLB 4LLNA 3IL2A 2P6TA 2VBYA 2JRTA 2DI3A 4XORA 1MH3A 3DEUA 2DOFA 1RZ4A 4AYBA 1E3HA 1USSA 3V8KA 2KMUA 2NVTJ 2GXGA 2M9HA 1DGRM 1BI1A 1EH8A 4KT5C 3SXYA 5IOYA 4FX4A 4V19K 3P9IA 5DUIA 3L2QA 4N9HA 3BLYA 3AL0C 2B63J 1YW8A 2LMDA 4I09A 3HB9A 1HSTA 1V54H 5BNGA 1R36A 1FLIA 4Q48A 5D4SA 2DT6A 1ZRFA 3DP7A 2D1HA 4GYGA 3TL4X 3JTHA 3B6CA 4BHCA 2L5QA 3TEDA 2R92J 1OCPA 3I58A 3KFWX 2RQPA 3CQZJ 3RKYA 1TWGJ 2LK2A 3F21A 2PLYA 1X58A 2HQAA 4QLCU 1D5YA 1RR7A 4JYKA 3ZXSA 4GO1A 4BGDA 3FKJA 4BDYA 3HHGA 2QM3A 3CDHA 2LD5A 1J75A 1ZTRA 3IHUA 2XHKA 1D0ZA 4U7BA 3F6VA 3H1CA 5K7ZA 2MABA 4N4NB 3GX4X 2JN6A 4C3JJ 1W36D 3M9AA 5F6FA 1WWXA 3DCFA 3VODA 5IT9Z 2CV1A 5C44J 3WE3A 2PJRB 5L3CA 3K10A 1TW3A 5K5RA 2BY0A 2HQ5A 3JW4A 3KEYA 2XROA 4L9TA 3KYDB 3UNGC 5D5VB 3CLOA 1UZCA 1FOWA 2V9KA 3CF2A 5IPAA 2L9SA 5EEAA 1A5JA 1OCCH 5JHFA 2FRHA 4ZDPA 1YW9A 2P6SA 1KU3A 2FMYA 1YIOA 3PUBA 5CQEA 3DLLF 4ZC3A 3BDDA 4I6ZA 4J01A 1ZLJA 4F52A 2VLAA 2Y30A 1X4PA 3GTJJ 3ABTA 5ICEA 4HNUA 4RGSA 1STZA 2COBA 2ZXJA 4PJJA 1K78A 3OIQA 1W5TA 2Q1ZB 3DTKA 3HKZN 4RAGA 2BYVE 2WV1A 3CMYA 3JRGA 2VKHA 4Y17A 4BUPA 2GA1A 3GTKJ 4XONA 1HW5A 4DZPA 4RGXA 3W2AA 4M3BA 2M4KA 3EQLF 5FKOA 1MNDA 4P96A 2JJ7A 1WJAA 4A3KJ 4CSWA 5GP9A 4MFEA 2OZUA 1FYLA 2PJPA 1V5FA 1UG2A 2K9QA 3A0BC 2R7VA 5K1YA 2YUSA 2XASA 2QQ8A 2FQ3A 1ZYRF 2ME0A 3LQRA 1KU9A 3KYLA 3PSFA 2FBKA 4AUXA 2YR2A 1OCTC 4C9YA 5D6EA 1AKHA 3KP5A 2CJJA 5GPAA 4HV5A 3P5JA 2P7CB 1QPIA 4XKBA 3VWBA 3BTCA 4CCNA 1KONA 2DT7B 2L9VA 4YELA 3U1DA 4ZJZA 1QA6A 3CO7C 3CJTB 1EJ9A 3HGGA 1YIJI 1LKXA 5E3OA 1IN4A 2DA3A 4RGRA 3K4CA 1GHCA 4RBOA 3BPVA 3PFYA 4HQMA 3K4LA 4YIIA 3DU5A 3BR3A 2E7WA 2K9MA 1DUXC 1UELB 4A3FJ 4LLLA 1VQOI 3GEZA 4BY7J 2IP2A 2P7VB 5D6FA 2XGEA 4B48A 2CFOA 2M5WA 4UV8A 5EZHA 3KPHA 1VQ9I 3HIFA 3D0SA 4BBSJ 1CF7A 1Q1VA 4UVAA 4ANJA 1I6XA 3LSGA 2JTVA 2EIJH 1G2HA 2GIZA 4KICA 4BXUA 2OTLI 4KISA 2BEOA 3I3LA 3MD2A 3O8GA 2HTJA 3HXLA 2Z99A 5EGOA 4KDPA 3O3KA 5E3LA 2M34A 3RKXA 5TRDA 2QKMB 2K9LA 3S93A 3GTGJ 2E1CA 3P9KA 2VBXA 2NS8A 4C2UA 2NVQJ 3Q3SA 3HSFA 5BQTA 5CVJA 4KMUX 4ZYGA 1TNTA 1JKRC 3QPTA 2X1EA 3OYAA 2A6HF 3LSTA 4P1WA 1X2NA 2PEXA 2NRAC 2QQ9A 2OV7A 1JKOC 1IG7A 1SVLA 5HS7A 3WHBA 3Q0UA 5HNHA 2H09A 3ISPA 3PM1A 2Z33A 1JTYA 3J81Z 2OPTA 1R4MB 4HDVA 4G94A 3HPHA 3LA7A 2DA5A 3NEUA 4ZDLA 3OYNA 3LMMA 4IHSA 1K79A 3BC8A 2ZO4A 2EV5A 2HU9A 1NHAA 1A04A 5LGNA 3WGGA 2JA6J 5EDNA 1K4SA 1I3QJ 1IRGA 2BW3A 4ESFA 1JJ8C 1X4OA 2K3FA 4HF1A 4V2GA 4B4CA 2YSRA 2E36A 4F3QA 3WTSC 3GO5A 3F3XA 2P4WA 5E1WA 3KLNA 1B9MA 2ZSHB 1Y1VJ 1LE8A 1GV5A 1OCRH 3CC4I 2YU3A 4W1UA 2LREA 1X19A 1N78A 1SFEA 1MDMA 3FWEA 2A05A 4XBFA 1FY7A 4ZTJA 2LY2A 1BJAA 4IHWA 3OSFA 3OMYA 5DDGA 2RKHA 3ZN1A 5LGUA 2LBFA 5KAFC 1XMXA 3V7CA 2LDUA 3K2AA 1HKTA 1LDJA 1ZH5A 2RAEA 3BR1A 1DP7P 2A5YB 2WAEA 3TDZC 1IF1A 4GYIA 4D1QA 2P81A 4LGWA 1P4AA 2H1KA 2XKOA 1ETXA 1FBSA 2GWRA 1VQNI 1H9GA 2IS4A 5KAIC 1JI8A 1R1VA 2FJ1A 1O7FA 3A01A 3IUOA 4HF2A 1XCVA 3H35A 4Q4ZF 1CQTA 2FMLA 2IS6A 1MNMC 1FBQA 4WXCA 4I7HA 2AO9A 4XRMA 3BQZA 3R0AA 2D45A 3WGIA 5IYDJ 2ELHA 1J0RA 1NTCA 4F93B 2IAIA 4XLCA 3ECOA 3FHNA 2EV0A 1I1GA 3TOBA 1JT0A 1SANA 4BYYA 1R4NB 2H27A 1MZBA 1YQAA 2FBHA 2IVMA 5HLIA 5IP9J 5E3MA 3K69A 1ZGJA 3WE2A 3A1YA 1LFBA 1UFMA 1HQCA 2CQNA 3WTYC 2E1OA 1MIJA 3NWTA 5CLSA 5FD6A 3G3ZA 4HBLA 1ZN2A 1R71A 2VIXA 5TGTA 3GVAA 3K4MA 4BAYA 2R7WA 5F0FA 3BCBA 2V6CA 3S1RJ 3HUGA 5LRSA 3HOTA 1G4DA 2QQBA 5L3BA 3ASOH 1SC7A 1BN5A 2EFPA 3PQJA 2FXAA 3VPRA 1FNNA 5JHUA 1RUNA 3TOAA 1R49A 2KL4A 3GW2A 2KQRA 3LFKA 3OR2C 4HG2A 1TT5B 3ZGKA 5FLXK 3HOYJ 4AIKA 3BR0A 4BQAA 1Z7LA 1MBKA 2CU7A 1VQMI 2M45A 3JRIA 1HBXG 2LG4A 2JUCA 2M4GA 4PJNA 2CQXA 3CCLI 3GUDA 2DQLA 4XSXF 3PNTA 2CQQA 3HRSA 2DYRH 3ZMZA 1U5TB 4YIFA 3ZMTA 2FX0A 1H8AC 3PQKA 3GF2A 2UUZA 2HGCA 4YFNF 2DFFA 3W3CA 3A4CA 3ZQQA 4GDFA 1GDTA 4H0EA 1UHSA 4MQVA 5AIPA 1P6RA 3BG3A 4DYCA 2EZLA 4BE0A 4QWQA 1TBXA 2Y0SA 3K4NA 5GADJ 1NK2P 3QP5A 1IXSB 4AC0A 3FXQA 2R7ZJ 2L54A 4Y15A 4LIVA 4UUTA 2LKPA 2F48A 4I0BA 2IGKA 2QYOA 2NVYJ 2W84A 3QYBA 4LMYA 5DS9A 3M8EA 3VEPA 4XLAA 3HOUJ 4QTRA 2XPUA 1PUEE 2TRTA 1VNDA 4IO9F 1VQLI 2Y31A 4OAYA 3KCCA 2RV8A 3HRMA 2K7LA 5EJCA 3OV8A 1BOAA 2OAZA 4ASNA 2V6EA 2W1OA 4CZCA 3U1KA 3BZ6A 3CCJI 1IXCA 2UXXA 2HR3A 3H36A 5EEGA 3M7GA 3SZTA 5J4YA 1P9QC 2H6BA 3DPUA 3WGHA 1F36A 4E6KG 3OYKA 1E3OC 4FE7A 3FMSA 1IJWC 3ELKA 3N97A 1Y8RB 2E7XA 1YYVA 1ON1A 4X6AJ 2CYYA 1LVAA 2K27A 1JHHA 5F04A 2WY7Q 4IHVA 2QSFX 5F1JA 2HVSA 4RMNA 4WX9A 2G9WA 2KP6A 2F5VA 2YPRA 3GFJA 1KQ9A 3GTLJ 2G7HA 5GTHC 2JQ7A 4BHPA 3DU6A 2ELJA 5DUKA 4M9XA 4RS8A 1SFUA 1OR7A 2LKXA 2EBIA 1WPKA 1YS6A 3BJAA 3R6SA 5E18F 1U8RA 4ZYHA 3DPTA 3LFUA 1W5CC 3NRVA 1B1BA 1Z3XA 4LJZF 2HYGD 1SD5A 2J5OA 2PN6A 2KRFA 2W82A 4EJVA 2GOXB 1BBYA 1Y1WJ 4KYWA 1SMTA 4LK1F 3ZN0A 2VXDA 5FKNA 3S1NJ 3TBIA 1TZLA 1J5YA 2CWEA 2VKDA 2X9DA 1SFKA 3HG9A 2M30A 2GOMA 1AHDP 1OYYA 3QRFF 1FC3A 1IRZA 1JT6A 2L4MA 4CXFA 3BP8A 4XSZF 5M5WJ 1LQ1A 2GBYA 4DW6A 1OQYA 3K2ZA 1FMWA 4Z2YA 4OIQF 2XRLA 2XSDC 3R0JA 3VSLA 4UUSB 3OOUA 2KT0A 4M72A 2R0QC 2V7FA 2DPDA 2BVMA 1MBHA 4BNCA 1JUSA 2F2EA 4DYQA 4D9JA 3LSJA 5FLVA 1PUFA 4XN0A 4HX4A 2DA1A 3K7AJ 1R6RA 3JAMK 1HLVA 1MKMA 3DBHB 4E7ZA 5K7FA 1ZG3A 1W1WE 3OS1A 5CVIA 1KYZA 1W7PD 3CCQI 3H0DA 2V9PA 4PJLA 3H5AA 4HYEA 2VI6A 2VL8A 3BG6A 3E6CC 2BE5F 2L9RA 5D5WB 3FM5A 3TO9A 5KHDA 1O57A 3K4BA 4EM2A 3GFIA 3ZPLA 4GGGA 4IJAA 4Z6YA 2QVOA 1ZAOA 3GLXA 3ZMVA 1E3PA 3VYSB 4BKXA 1TQPA 2IEKA 4JX5A 5E79C 2C6YA 2DA7A 3CMAI 3OYMA 4ZYAA 1JKPC 4BS9A 4S04A 4GFBA 5J1RA 3JTGA 1I1SA 5GAGJ 1G3YA 1ZELA 2H6CA 3X2QH 4EM0B 4HQEA 4EJTA 2IXSA 3V8LA 1OMIA 2HVQA 1IDZA 4L0YB 2BXZA 4F91B 4KA4A 2Y0MA 1D8KA 3ONQA 3S3NA 2X1CA 4AYBN 2WV0A 1HSJA 1YOVB 1MMNA 1LJ9A 2VT3A 3A0HC 3HJEA 4G9YA 2NVXJ 5DM7F 5BPDA 1OISA 2PFBA 2H8RA 2XB0X 2XAGA 4LITA 4A69C 4BL0B 1YG2A 4A0ZA 4DQ2A 1EH6A 2V9VA 2V1NA 4XKVA 1TT0A 2CMPA 4E70A 3FK6A 4EQQA 2CUFA 2E19A 2IS2A 1SFXA 2UWMA 3S17J 1XD7A 2L9NA 2OCEA 3ZCOA 3CD6I 5FLXZ 4BHBA 3IC7A 2DK5A 3LSMA 4ZZLA 2OQRA 2TDXA 2CS3A 1JHFA 4I98B 1F9NA 2CW0F 1WKMA 1DPRA 2DMPA 1R58A 5CKTA 2E5ZA 5FGMA 1HOMA 1BW5A 3K4JA 1G8XA 2IJLA 5JLWA 1FYKA 1BI0A 1VQ6I 1WJFA 1ENHA 3VYRB 1B59A 3L2RA 4V2FA 3W6JB 2BBYA 3W6KB 1R5HA 2OQGA 1NG6A 3MZYA 1W36C 9ANTA 2V26A 3DQVC 2V79A 1RETA 2V1XA 1S6LA 1S3JA 1TQMA 4ETSA 4FE4A 3OS0A 3OSGA 1J59A 3GTPJ 3EUHA 2WY8Q 3DKWA 1W0TA 1ORKA 2DMUA 2MLGA 3SZPA 4Y7NJ 5KNLA 2CV2A 4M3FA 4I2OA 1ZR2A 4L0ZB 2MGQA 2MG4A 2BY2A 4KN4X 3LOCA 5J8FA 3DPLC 2AQFA 1W7PB 4IL6C 3J80K 2CW8A 1DPUA 2DO7A 2DJNA 4AIDA 2XB5A 3HYIA 2DPUA 1ZRDA 4BDZA 3ZQFA 1LEBA 5B66C 1IN5A 3FDYA 1U9NA 3ML6A 3S16J 4W97A 4Y3OA 5FD5A 2A07F 2L7FP 1FWZA 5C4JJ 2AQEA 2FSWA 4ENMA 3VFZA 4E7HA 3EUKL 4R8HA 1D3YA 3W2WA 3V7SA 1FSEA 2Z2SB 3M4OJ 1TW2A 4N4OB 5FO5A 2L3DA 2WAQA 2IA1A 2JA8J 2XGXA 2ESHA 2RQQA 1BR1A 2Q2EA 3I0TA 3SEZA 4F92B 1OR7C 4DIQA 4LB6B 2EZKA 3KP7A 3CUQB 3VYTB 1MSFC 5FKMA 1YFHA 3JCUC 3VDXA 1RIOH 1LE8B 1BC7C 3CCVI 2EZIA 4OMYA 2P0WA 3S32A 3C3WA 4KJZA 4KNYA 4A12A 1QHGA 1UJ8A 3VOEA 1T56A 4E7SA 1KYWA 4E7LA 2XGDA 2K9NA 4WXHA 5HS8A 2OA4A 4HF0A 4RAYA 3N4MA 4LG0B 4YEJA 1IUYA 1GVDA 2FUG2 2QA4I 3DEEA 4RA2A 3I9V2 1XPXA 3ZR8X 1H89C 2DDBA 5F27A 3SFIA 5DM6F 3BJOA 3CLQA 3I55I 2X6WA 4XNFA 4PUSA 3H5RA 4BH9A 1K4TA 1FOKA 3K6GA 2X4HA 4QPOA 5LEJA 2A6EF 1NK3P 4HNTA 2OZ6A 2HI3A 2JK3A 4DBRA 3A01B 4FASD 2HOAA 3WG7H 4PZJA 3ROUA 2O03A 1WZ2A 2EJRA 3QU3A 3CMEI 3LSIA 2A61A 2IGMA 5GPCA 4HZFA 2ZMEA 5LHGA 4G7ZF 1XS9A 2CUZA 1PVEA 1QPMA 2K85A 5BMZA 5BOXA 2R7QA 1FZPB 2HDWA 2EINH 4QPQA 3MQ0A 2COMA 5H6RA 4U7DA 3W6VA 1F5TA 4MIMA 1FMVA 5K7HA 3MZHA 2GAUA 3JAMZ 2RC4A 3RPUD 1T39A 1TP4A 3CJQB 1EA3A 4G7HF 1MMSA 3KEOA 1RC9A 4G8XA 5DD4A 1QZYA 1W5SA 1XMKA 3K4KA 3AG2H 3B6AA 5L3DA 2DMNA 3ZOBA 3HEFA 4PK4A 2W48A 3KZYA 4S05A 1IN7A 4XM3A 4M9ZA 2FF4A 1T38A 1ZR4A 3QPHA 4HEA2 1OKRA 3FMQA 2YS9A 1Z6TA 3OYIA 2E1MC 2A3SA 2PG4A 4M9SA 1MH4A 1N77A 2HYFA 1QBJA 5E20A 2KZGA 3F8BA 4UB6C 2LY9A 1D1AA 2W00A 3WTVC 1ONVA 2XGCA 3IH2A 2IGNA 2DTZA 1BI3A 1ULYA 2X0LA 3QYEA 5EYRA 4A5NA 3CCSI 2V1DA 1T0FA 4JK1X 1OFCX 2HZTA 1XCBA 1D8JA 4OINF 2DOAA 2BGCA 1FJLA 4LD5A 4IHTA 5ICFA 2E71A 2VONA 3S2HJ 4UNOA 4AIJA 2HNHA 1ZGWA 4B09A 1OPCA 5HDGA 4CCMA 4YFKF 1R00A 4O5VA 3F0CA 1LDKB 1Z3YA 2MD0A 4BE1A 5DD8A 1XSXA 2OBPA 1P4XA 2DDAA 4XRSA 3I56I 1S8NA 1ZGAA 1BL0A 1MBFA 1WH5A 2ZXWH 1YX3A 3ABLH 3C2HA 3HHHA 4NQWB 3MKYB 2R5YA 5LEKA 2UV1A 3KIOA 3SQNA 2VKVA 2QLZA 5IYBJ 3DEWA 1R1UA 4LOCA 3KE2A 1JKQC 3HKZA 2NS0A 1Y6IA 3MVPA 3I54A 1RESA 3G6EI 1UHWA 4ESBA 2M3AA 3FMRA 4PFPA 1V3FA 4E7JA 4HOBA 5F64A 5LLQA 2ID6A 2XAFA 4UV9A 1IZ1A 3EUHC 4JX6A 2P5VA 2R7OA 4CICA 2E35A 2HKOA 4A2UA 3F9KA 3HDDA 1OCZH 3I4NJ 2PMUA 4XLFA 2OD5A 3DBLB 2E60A 2W25A 2M2EA 5B1AH 3H0GJ 4IRIA 4UXNA 3MFKA 1YITI 4II2A 3AL0B 1F1ZA 1GLNA 2VE9A 5DCMB 3GBGA 4CCOA 5J8CA 1DU6A 4AM3A 1P2FA 2K02A 2ZJQF 2KPMA 2Y2ZA 1Q1HA 1UHMA 4ENJA 4MEXF 4WCGA 2F5DA 1YJNI 2BOLA 4ABZA 1UG0A 3J80Z 3KLOA 4MO7A 2ISZA 3LSRA 3BG7A 1JGGA 4KIFA 1R23A 4KIGA 2WB1A 3E6MA 4OMZA 1RUOA 1RI7A 5H2FC 1OJLA 5M3MJ 2Y75A 3F8CA 4ITVA 2E2IJ 1ETYA 2W7NA 2XRNA 4A3LJ 3FXUA 4B8XA 3F23A 2L7MP 1QVTA 2F5EA 1GV2A 5B3SH 2Z5UA 2D5VA 3FXOA 4HSTA 2F4IA 2ZFUA 2G0EA 2PJRA 1AA7A 3L2WA 4ZYDA 1A6IA 4BQOA 2MLKA 4RLQA 5LHIA 5FLMJ 2ZJRF 2OCCH 3VB2A 4A3JJ 2XPWA 4LG3A 1QZEA 1ZREA 3QAHA 3WU1B 5B1BH 3F8MA 4M3DA 3CTAA 5DV5A 5EZGA 3MKWB 2LF8A 3HC7A 3DF8A 4DBQA 2HOTA 2EZHA 2V1UA 4IKFA 3LA3A 1ETQA 3PO2J 4K2EA 1LVKA 1MJ9A 2ZCWA 3G71I 1IAWA 3OYDA 3DBRB 4B47A 5J6XA 1TLHB 1V5EA 2JPCA 3VYUB 1QQIA 5F0HA 3CF5F 1YX5A 3C1DA 4PGGA 5JI6A 1PP7U 2VKEA 3MMYB 4UVCA 1VQ5I 1S9HA 1TTYA 2Y0SN 2MD5A 1PJRA 4GCVA 3FK7A 4KUMA 2ZMEC 4RAZA 5L3GA 1U6GA 2BHZA 1R9TJ 1BIAA 1F43A 3SJMA 4E4HA 3S14J 3JSOA 3ZQLA 1LFUP 3OYJA 4DYRA 2CFXA 2W4SA 3G1LA 1HKQA 4P9UA 4PSXA 2R7TA 4DGWB 2PMHA 3I4MJ 1B72B 2MYSA 3CP8A 1G3WA 3D5LA 3HRTA 1GUUA 2HWVA 2JWTA 4BBRJ 4IZZA 2ESNA 1Z05A 1MBGA 4D5FA 3RKWA 1KU2A 1YRNB 4CYCA 2EH3A 4XLEA 1MNEA 2QUFA 3M8JA 3HBLA 3GTOJ 3I59A 2NVUB 3WODF 4XIDA 3I64A 2JVHA 1HC8A 3H9QA 2XAQA 2ETHA 2LC2A 2XVCA 4IX7A 4EATA 4BEHA 1L0OC 2L01A 4IRHA 2B9SA 2NYXA 2QENA 5IY5H 4XR6A 3G2BA 5JLXA 2LKSA 3S15J 1ZHFA 3H92A 3T8TA 4XICA 2W57A 2EFQA 1T0FC 2DQRA 3BQYA 2QSHX 2XSJC 3MAJA 4CH7A 2AHQA 3S3MA 4A93J 4B3XA 1R5ID 1YLFA 3E97A 5KK1A 4A3EJ 2VODA 2W85A 4OIRF 2ZKZA 1G3SA 4UB8C 2JA2A 1UMQA 2VQLA 5A2QZ 1VQKI 2R93J 4A6EA 2JMWA 1TNSA 1V4RA 4DNCA 4XRSG 5J40A 4MHGA 1X2MA 2LLKA 4YIRX 3LWFA 5GAHJ 1YJ9I 1P92A 3CP2A 1HCRA 1WI9A 2O8XA 3RKQA 3BT9A 3MEXA 4JOMA 1ERDA 4ZYEA 5LD2C 5E8IA 3H3VK 3FBIB 3QP6A 1K6YA 1N75A 1WFXA 4U88A 2Z1DA 3ASNH 3BWGA 4G6TB 4LIUA 1XDUA 3FXLA 5GTIC 5ILVA 1E2XA 1FP1D 2F4MB 1WJBA 3WU2C 1XDSA 1X3ZB 2ZBKA 1Y0UA 2BY3A 2XV4S 3FISA 1XB4A 3QWLA 2EIMH 1EKEA 4EJOA 1SVMA 3GYHX 1IN6A 2M7AA 1U2WA 3OYEA 1LDDA 3J7YJ 2DJIA 3FXMA 4CZZA 1MW7A 3TP0A 4M74A 2HYJA 2HXIA 2GXAA 4QIWN 1DGWY 4M6YA 3L00A 2AS5F 2XAHA 2KLOA 3ZRGA 4NB5A 2LTPA 3OL4A 3SDGA 1X1AA 3CCEI 2QZ8A 1A35A 2KKOA 3CC7I 3E6BA 3FZVA 3AG3H 1OYWA 2M0MA 4L5EA 1RRJA 4CDGA 2X51A 4M3GA 3T5XA 2R5ZA 2MC4A 4KN7X 4D7MA 2DFEA 3Q0WA 5H6QA 4YG2F 4JP0A 2WADA 5IP6A 3BOQA 5EG0A 4L9NA 3MKLA 4PJ0C 2EA2A 4FHTA 3TW7A 1X3UA 3CUOA 5E3NA 1T95A 3QODA 3ZQHA 2K4JA 4YRVA 3ZQCA 2IBDA 1HW1A 4B44A 5LHHA 1APLC 3TMOA 3I4PA 2LVSA 2ZNZA 5D5UB 4NBQA 3U21A 1PYVA 3TP3A 2VBZA 3NWSA 5K5QA 1F4KA 2Q2EB 4PFOA 3RZOJ 2M87A 2F5CA 2FOKA 1PDNC 2EILH 1WJCA 3TKYA 1TL8A 4LLGF 2O9LA 3CZ6A 1Z6RA 2OU2A 2ZFWA 1VQ4I 1KA8A 2ECBA 3ABMH 3DKXA 1IV8A 2VQHA 3A03A 1UAAA 2Q0OA 5D5XB 3F8FA 4XKCA 3UKGA 5F08A 4CCKA 2R7XA 1U0JA 5E8GA 2RNGA 1P7IA 1X3WB 3PUFA 1BR2A 4EVIA 4RM3A 4KITB 4WK8F 2QGUA 2QQAA 2MBFA 3MWMA 1FIPA 2LFBA 3FF5A 1AU7A 1POGA 1D1CA 5HLGA 2HEOA 4IHYA 3OL3A 3GFLA 4OWRB 4NC6A 2QBYA 3PIPF 3TQNA 1VTNC 3IWFA 4C30A 4IQJA 1WJ5A 3T1BA 5F1RA 4P5OA 1QHHD 1K78B 1CGPA 3FKIJ 5HLTA 2O6GE 2DFHA 1J09A 4FX0A 4AD9A 1AWCA 1SD7A 4KT6A 3LSPA 2EFNA 2ZMEB 3TGNA 5FJ8J 1EF4A 2KIUA 4CCLA 3KZZA 1XX5A 2M7BA 4UVBA 2H94A 2NS7A 3E5UA 4PSWA 1WHUA 5FRMA 3KP6A 1NH3A 3EETA 5CPRB 1DP3A 2HZDA 2DA4A 3OYLA 4CA0A 3HOXJ 2ZXHA 1GXQA 2KFDA 2DLLA 2BVLA 3ECHA 2DYSH 1FSHA 2NXNB 4G6DA 3BG9A 4OIOF 3V4GA 4G12A 1X1CA 2OUMA 2LRDA 2O61A 2JSPA 1AKHB 2IPQX 1FX7A 2MW8A 2OF7A 3ZMSA 2QWWA 3S1MJ 5LFAA 4BXFA 1O3TA 3K9TA 1FYMA 4UUVA 1A36A 2DMQA 4Y13A 1G59A 3HOZJ 1WH7A 3C7JA 4AVZA 3ZQIA 5CVVA 4A3BJ 1BC8C 5D8LB 5ICCA 5FRNA 2LF7A 4F7ZA 1YS7A 3F22A 3CO6C 1MGTA 3G4SI 1H88C 2LOOA 3NARA 4IPAA 3Q9SA 4BY1J 2RN7A 2WAQN 3KP4A 2N8GA 2Y9ZA 4XOTA 5M5YJ 2GXBA 3J7AO 3F6OA 2GIVA 3GCMA 1MMAA 2V4JC 2ZB9A 3I53A 2IS1A 3BZKA 3IH3A 3K0LA 5F0CA 1R5GA 1CF7B 3IAM2 3BPXA 1OYIA 3FX3A 3O2PE 4PDKA 3TW6A 3OYBA 4BACA 3FXKA 4CO8A 4XOPA 3JRHA 4M73A 4TV7A 3RQ4A 5IYCJ 4JX4A 2P5LC 1IC8A 1ON2A 2R5YB 1WJEA 5EGOB 3QPLA 4LB5A 3GFMA 3SFZA 3JR9A 3GLLA 3ZMDA 5ICGA 3K1MA 2A69F 4JQFA 4I01A 1RKWA 3S1QJ 4FISA 3AFHA 2ELKA 2H8WA 4MFDA 3H9JA 1HKSA 3JRDA 4II3A 1IV6A 3L9FA 2FQ4A 4KMFA 4XQFA 3WTWC 4ZDOA 1NG7A 2DW4A 4BJ6C 3BTJA 3IKVA 1QGPA 5JR3A 3TO7A 2VPLA 4BE2A 1L3LA 3FXJA 1S7AA 2EIKH 3DTIA 4LK0F 4RM2A 5KVRA 2FNAA 4U0WA 2EPFA 2HPIA 3GWZA 2HXOA 3BR6A 4NUBA 5HDNA 4I99C 1H9TA 4RAFA 3L2CA 4MEYF 4WWCA 3IV5A 3R4KA 1KGSA 2LSOA 4HX7A 2STTA 2DTRA 2BW3B 2CUEA 2NOJB 1P4WA 3IKTA 2L4AA 4NC8A 1WGXA 4XK4A 3Q5FA 4M3EA 1YHQI 3K70D 3HSEA 4A6DA 3FHZA 3JRCA 4MGRA 3BTLA 1SFOJ 3AAFA 1YE9A 2QSGX 2HPMA 3W2VA 3ZQGA 3GXOA 2WWYA 1IGNA 1DDNA 1MDMB 4EJUA 3Q9VA 3U2RA 1USTA 4NC7A 5JVGF 2O7OA 4IXAA 1Z1DA 4C3HJ 3QOPA 2LBFB 1ITYA 1JE8A 2X48A 1ETWA 3C18A 3BR2A 4I02A 1SEUA 1XGOA 2CUJA 4NDLA 3SDBA 2KHMA 2DA2A 2FA5A 3CDLA 1O4XA 2KIMA 1FT9A 2ISYA 3FXRA 2IW5A 3HTUA 3TO6A 4ENKA 1TWHJ 1D0YA 1XGSA
chains in the Genus database with same CATH topology
3R60A 1XN7A 4ZZDA 3WTUC 5TJJA 5LBQA 2HQNA 3RTRA 1J9IA 5L3EA 3RYRA 2MC3A 1R1TA 2KJBA 1IRFA 1LB2A 1ZG5A 1XSDA 2R7FA 2HS5A 2KIFA 1EV7A 4I0AA 4ESJA 1J2XA 4WXDA 2P5KA 1QNTA 2GZWA 1IW7F 2DBBA 4A0XA 1PP8F 5E1XA 2GQQA 1AOYA 2LNBA 1JGSA 2EWNA 2UXNA 1SMYF 1UCRA 1IN8A 3NQOA 2FE3A 3P7NA 2YX7A 5H20A 3HTSB 5DCFA 2FNPA 2AXLA 4U0YA 4O6JA 2VT2A 5A2QK 1KQ8A 1FPQA 2HDCA 2MH9A 4XLPF 3I59B 4ZH4F 4CGZA 4MQ9F 3WTTC 3QU6A 3GZ6A 2NAZA 1KQ0A 1QO0D 3E5QA 1U5TC 2A68F 2HQRA 3LAJA 3RIRA 2ZNYA 5ILSA 1R22A 2WTEA 4EMSA 5D4RA 3F72A 2CGPA 3V7RA 1HXDA 1QZZA 4P55A 5CVUA 5CYVA 4XLNF 3DFGA 4RGUA 2HKXA 4PGHA 3RJPA 1ZG1A 2FU4A 3JSPA 2EV6A 5ILUA 1MJAA 3LQQA 2PBIA 2Z3YA 1D5VA 2JPBA 2WC2A 3L09A 3SHFA 4U0VA 1IXRC 4AVPA 4HDUA 5AIQA 3EDPA 3O6BB 5DEQA 3FM3A 3KEQA 4R1HA 1W7PA 1E17A 3WTXC 4XRFA 3G73A 1B4AA 1BM9A 1SAXA 3ZMUA 4AWXB 3M8FA 2G7UA 4JBAA 4HV6A 2PQ8A 2VC0A 3E5XA 4RB2C 2RDPA 2K86A 1XSVA 1RNLA 4KIBA 4HLYA 1YTYA 3BROA 3KP3A 4N0BA 4A0YA 2Q8KA 2VN2A 5HOOA 3EYYA 6PAXA 3MCZA 1YW7A 2D1VA 3CUQA 3M1EA 2VBWA 3T0YA 1S29A 3RPQA 1WRJA 4LG0A 4FT8A 4PCQA 3IRRA 2DK8A 2P8TA 3RI4A 1BI2A 1LNWA 5E1ZB 1XMAA 2NNYA 1O7LA 3L7WA 4OU0A 1KU7A 1REPC 2F5FA 1ZARA 3V8JA 3B73A 5LRRA 2R3SA 4P9FA 2VOPA 5BS6A 1Z91A 5FB2A 3IWZA 5FFXA 1WSUA 1T6SA 2DU9A 2QBYB 4HW0A 2CG4A 4IVNA 2IT0A 1FBUA 1ZRCA 2W24A 2VXZA 5BPIA 5IT3A 1I27A 5JFRA 5HDKA 4LFUA 1K7AA 2XUBA 3IRQA 3RDIA 2CO5A 5FFZA 5CJ9A 4YFXF 2J5PA 1YO5C 4KFCA 3KP2A 5CVRA 2FEZA 3WU0A 1O3QA 3R61A 3ERED 1SD4A 2EB7A 2M1BA 2RNJA 4UHTA 2VC1A 2D2WA 1ZLKA 2XKPA 1S7OA 2XAJA 5L3FA 4HX8A 2HOEA 4RB0A 5K5OA 1H0MA 4L18B 3KETA 2MH2A 4NQWA 3K1PA 4R79A 1U3EM 4EJWA 4WF2A 2EFWA 2JSCA 2RGVA 1T98A 1LEAA 3DV8A 2NNNA 1J7KA 2HTSA 1SD6A 4RB1A 4O3MA 3H3UA 1GXPA 5ED4A 1T2KA 3S2WA 1EH7A 2L02A 1Z9CA 3E3VA 3ZQ7A 2E1NA 2IA2A 1GVJA 3P9CA 4G6QA 4CYDA 4MTEA 2Z9OA 2IRFG 3ABUA 5D8KB 2STWA 2EFOA 4A5MA 3H3ZA 4M71A 1G6NA 2IA0A 2DFIA 1WQ2A 1C0WA 5DCMA 4NHJA 3WG9A 3I71A 1O3SA 3HRUA 3RPUA 4IF4A 4EM1A 3WTZA 2KJCA 2O0YA 3PFIA 2PI0A 2ADUA 4OOIA 5IT9K 2R7DA 1K6OA 2K4BA 5DYMA 3RYPA 4L9JA 1TQIA 3K1NA 4HA8A 3CUQC 3REOA 2JZYA 1Z7UA 3GZ5A 4L9VA 2BV6A 1I5ZA 2ACJA 4D0PA 4EV0A 2VE8A 2CSOA 3EYIA 3U9GA 2YX4A 4ON0A 4HAMA 2MA3A 5HLHA 3HOSA 3F8NA 5AONA 5JVTA 2UZKA 2FBIA 4Q5SF 3TDUC 2DAOA 5HVQC 2DT5A 2EA4A 4MTDA 4HLXA 3ULQB 3I5UA 2XIGA 3CJNA 3E6DA 5LGTA 3OOPA 3DXJF 2GA2A 3LAPA 2CQKA 4AIHA 4CHUA 3B02A 4GXOA 5E17F 2M8EA 1G3TA 4IRGA 1B9NA 4N9IA 1O3RA 3COAC 2JT1A 1U5TA 2O3FA 1UB9A 4EGZA 1XGMA 1MD0A 1JXSA 2ZJ2A 3T8RA 1W4MA 4L5JA 1U78A 5EEHA 3ZP5A 2HFHA 4EGYA 1B6AA 1BIBA 1MJBA 4Q47A 4RB3C 1R7JA 4G7OF 3BJ6A 1HW2A 1XGNA 3BY6A 2B0LA 5ERIA 3HSRA 1ODDA 5HS9A 4L5IA 3LA2A 2RVCA 1FP2A 4OIPF 4M6XA 4MNUA 2Y48A 3J81K 4ENNA 2EK5A 2VOOA 4LLNA 3IL2A 2P6TA 2VBYA 2JRTA 2DI3A 3DEUA 1RZ4A 1USSA 3V8KA 2GXGA 1BI1A 1EH8A 4KT5C 3SXYA 4FX4A 3P9IA 5DUIA 4N9HA 1YW8A 4I09A 1HSTA 1R36A 1FLIA 4Q48A 5D4SA 1ZRFA 3DP7A 2D1HA 4GYGA 3JTHA 4BHCA 3I58A 3KFWX 2RQPA 3RKYA 3F21A 2PLYA 4QLCU 4GO1A 3HHGA 2QM3A 3CDHA 1J75A 3IHUA 2XHKA 4U7BA 3F6VA 3GX4X 3M9AA 5F6FA 1WWXA 3VODA 5IT9Z 3WE3A 5L3CA 5K5RA 1TW3A 2XROA 3JW4A 4L9TA 5D5VB 3CLOA 2FRHA 1YW9A 2P6SA 1KU3A 2FMYA 1YIOA 3BDDA 1ZLJA 3ABTA 5ICEA 4RGSA 1STZA 2ZXJA 1K78A 1W5TA 2BYVE 4Y17A 2GA1A 1HW5A 4RGXA 3EQLF 4P96A 2OZUA 1FYLA 2PJPA 5K1YA 2XASA 2FQ3A 1ZYRF 3LQRA 1KU9A 2FBKA 2YR2A 5D6EA 3KP5A 4HV5A 2P7CB 3U1DA 3CO7C 1IN4A 4RGRA 1GHCA 3BPVA 4HQMA 4YIIA 2E7WA 1DUXC 4LLLA 3GEZA 2IP2A 2P7VB 5D6FA 2M5WA 4UV8A 3HIFA 3D0SA 1CF7A 4UVAA 1I6XA 2JTVA 4KICA 4BXUA 2BEOA 2HTJA 2Z99A 4KDPA 3O3KA 3RKXA 5TRDA 2E1CA 3P9KA 2VBXA 3HSFA 5BQTA 5CVJA 4KMUX 4ZYGA 1TNTA 3QPTA 2A6HF 3LSTA 2PEXA 2NRAC 2QQ9A 5HS7A 2H09A 3ISPA 2Z33A 3J81Z 4HDVA 4G94A 3LA7A 3NEUA 4IHSA 1K79A 2ZO4A 2EV5A 1NHAA 1A04A 5LGNA 3WGGA 1IRGA 4ESFA 4HF1A 2YSRA 3WTSC 3GO5A 3F3XA 2P4WA 5E1WA 3KLNA 1B9MA 2YU3A 1SFEA 1MDMA 3FWEA 4XBFA 1FY7A 1BJAA 5DDGA 2RKHA 3ZN1A 5LGUA 3V7CA 2LDUA 1HKTA 1LDJA 1ZH5A 1DP7P 2A5YB 3TDZC 1IF1A 4GYIA 4LGWA 1P4AA 2XKOA 1FBSA 2GWRA 1H9GA 1R1VA 1O7FA 4HF2A 1XCVA 4Q4ZF 2FMLA 1FBQA 4WXCA 4I7HA 3R0AA 2D45A 3WGIA 2ELHA 1J0RA 3ECOA 2EV0A 1I1GA 3TOBA 4BYYA 2H27A 1MZBA 1YQAA 2FBHA 2IVMA 5HLIA 3K69A 1ZGJA 3WE2A 1UFMA 1HQCA 3WTYC 5CLSA 5FD6A 3G3ZA 4HBLA 1ZN2A 3GVAA 4BAYA 2V6CA 3HUGA 5LRSA 3HOTA 1G4DA 2QQBA 5L3BA 1BN5A 2EFPA 3PQJA 2FXAA 1FNNA 5JHUA 1RUNA 3TOAA 3GW2A 3LFKA 5FLXK 4AIKA 4BQAA 2M45A 1HBXG 3GUDA 2DQLA 4XSXF 3HRSA 3ZMZA 1U5TB 4YIFA 3ZMTA 3PQKA 3GF2A 2HGCA 4YFNF 4H0EA 4MQVA 5AIPA 1P6RA 4QWQA 1TBXA 3QP5A 1IXSB 3FXQA 2L54A 4Y15A 2LKPA 4I0BA 2QYOA 2W84A 4LMYA 3M8EA 3VEPA 1PUEE 3KCCA 2RV8A 3HRMA 2K7LA 3OV8A 1BOAA 2OAZA 4ASNA 3BZ6A 1IXCA 2UXXA 2HR3A 5EEGA 3M7GA 3SZTA 2H6BA 3WGHA 3FMSA 3ELKA 3N97A 2E7XA 1YYVA 1ON1A 2CYYA 1LVAA 2K27A 1JHHA 4WX9A 2G9WA 2YPRA 3GFJA 1KQ9A 2G7HA 4BHPA 5DUKA 4M9XA 4RS8A 1SFUA 1OR7A 5E18F 1YS6A 3BJAA 3R6SA 1U8RA 4ZYHA 3DPTA 3NRVA 1B1BA 4LJZF 2HYGD 1SD5A 2J5OA 2PN6A 2KRFA 4EJVA 1BBYA 4KYWA 1SMTA 4LK1F 3ZN0A 1J5YA 2CWEA 2M30A 1OYYA 3QRFF 1FC3A 2L4MA 4CXFA 3BP8A 4XSZF 1LQ1A 3K2ZA 4Z2YA 4OIQF 3R0JA 2DPDA 4M72A 4BNCA 2F2EA 4HX4A 3JAMK 1MKMA 1ZG3A 5CVIA 1KYZA 1W7PD 4HYEA 3E6CC 2BE5F 5D5WB 3FM5A 3TO9A 1O57A 4EM2A 3GFIA 3ZPLA 4GGGA 4IJAA 2QVOA 1ZAOA 3GLXA 3ZMVA 1TQPA 2C6YA 4S04A 3JTGA 1I1SA 1G3YA 2H6CA 4EM0B 4HQEA 4EJTA 3V8LA 1OMIA 4L0YB 2Y0MA 1D8KA 2WV0A 1HSJA 1LJ9A 2VT3A 4G9YA 5BPDA 2PFBA 2XAGA 1YG2A 4A0ZA 4DQ2A 1EH6A 2V9VA 4E70A 4EQQA 1SFXA 2UWMA 1XD7A 5FLXZ 4BHBA 3IC7A 2DK5A 4ZZLA 2OQRA 2TDXA 1JHFA 4I98B 1F9NA 2CW0F 1WKMA 1DPRA 1R58A 5FGMA 2IJLA 1FYKA 1BI0A 1B59A 3W6JB 2BBYA 3W6KB 1R5HA 2OQGA 3MZYA 3DQVC 2V79A 2V1XA 1S6LA 1S3JA 1TQMA 4ETSA 1J59A 3EUHA 3DKWA 2MLGA 3SZPA 4I2OA 4L0ZB 4KN4X 5J8FA 3DPLC 1DPUA 1W7PB 3J80K 2DO7A 3HYIA 2DPUA 1ZRDA 1LEBA 1IN5A 3ML6A 5FD5A 2A07F 1FWZA 2FSWA 4ENMA 3VFZA 4R8HA 1D3YA 3V7SA 1FSEA 1TW2A 5FO5A 2L3DA 2IA1A 2XGXA 2ESHA 2Q2EA 3I0TA 4LB6B 3KP7A 3CUQB 1YFHA 1RIOH 1BC7C 4OMYA 3C3WA 4KNYA 4A12A 3VOEA 1KYWA 4WXHA 5HS8A 2OA4A 4HF0A 4RAYA 3N4MA 4LG0B 1IUYA 3BJOA 4BH9A 1FOKA 2X4HA 5LEJA 2A6EF 2OZ6A 4PZJA 3ROUA 2O03A 2EJRA 3QU3A 2A61A 4HZFA 2ZMEA 5LHGA 4G7ZF 5BMZA 5BOXA 1QPMA 1FZPB 4U7DA 3MQ0A 2COMA 5H6RA 1F5TA 2GAUA 3JAMZ 2RC4A 1T39A 4G7HF 3KEOA 4G8XA 5DD4A 1QZYA 1W5SA 1XMKA 5L3DA 3KZYA 4S05A 1IN7A 4M9ZA 2FF4A 1T38A 3QPHA 1OKRA 3FMQA 1Z6TA 2A3SA 2PG4A 4M9SA 2HYFA 1QBJA 5E20A 3F8BA 3WTVC 1ONVA 1BI3A 1ULYA 2X0LA 4A5NA 2V1DA 1T0FA 4JK1X 2HZTA 1XCBA 1D8JA 4OINF 2BGCA 2VONA 4LD5A 4IHTA 5ICFA 4UNOA 4AIJA 4B09A 1OPCA 5HDGA 4YFKF 1XGSA 1R00A 4O5VA 1LDKB 5DD8A 1XSXA 2OBPA 1P4XA 1S8NA 1ZGAA 3HHHA 5LEKA 3SQNA 2QLZA 1R1UA 3KE2A 2NS0A 3I54A 1UHWA 4ESBA 3FMRA 1V3FA 4HOBA 5F64A 5LLQA 2XAFA 4UV9A 1IZ1A 2P5VA 4CICA 2HKOA 4A2UA 2PMUA 2OD5A 2W25A 4IRIA 4UXNA 3MFKA 1F1ZA 2VE9A 5DCMB 5J8CA 1P2FA 2K02A 1Q1HA 1UHMA 4ENJA 4MEXF 4WCGA 2F5DA 3J80Z 3KLOA 2ISZA 4KIFA 1R23A 4KIGA 3E6MA 4OMZA 1RUOA 1RI7A 2Y75A 3F8CA 2XRNA 3FXUA 4B8XA 3F23A 2F5EA 2Z5UA 4ZYDA 5LHIA 2MLKA 3VB2A 1ZREA 3QAHA 3WU1B 3F8MA 3CTAA 5DV5A 2LF8A 3DF8A 2V1UA 3LA3A 4K2EA 1MJ9A 2ZCWA 1IAWA 5J6XA 1TLHB 2JPCA 1QQIA 3C1DA 4PGGA 5JI6A 1PP7U 4UVCA 1TTYA 2MD5A 4GCVA 4KUMA 4RAZA 5L3GA 1U6GA 1BIAA 3JSOA 2CFXA 1HKQA 4P9UA 2PMHA 1G3WA 3D5LA 3HRTA 2HWVA 2ESNA 1Z05A 3RKWA 1KU2A 2QUFA 3I59A 3WODF 3I64A 2XAQA 2ETHA 2XVCA 1L0OC 2L01A 4IRHA 2NYXA 2QENA 1ZHFA 3H92A 3T8TA 2W57A 2EFQA 2DQRA 3MAJA 1YLFA 3E97A 5KK1A 2VODA 2W85A 4OIRF 2ZKZA 1G3SA 5A2QZ 4A6EA 1TNSA 1V4RA 4DNCA 4MHGA 3LWFA 1P92A 1WI9A 2O8XA 3MEXA 4ZYEA 5E8IA 3QP6A 4U88A 3BWGA 1XDUA 5ILVA 1E2XA 1FP1D 1XDSA 2ZBKA 1Y0UA 2XV4S 1XB4A 4EJOA 3GYHX 1IN6A 1U2WA 1LDDA 4CZZA 4M74A 4M6YA 3L00A 2AS5F 2XAHA 4NB5A 2QZ8A 2KKOA 3E6BA 3FZVA 1OYWA 4CDGA 3T5XA 4KN7X 4YG2F 5H6QA 3BOQA 4L9NA 2EA2A 4FHTA 1X3UA 3CUOA 2K4JA 1HW1A 5LHHA 3I4PA 2ZNZA 5D5UB 2VBZA 5K5QA 1F4KA 2M87A 2F5CA 2FOKA 1PDNC 3TKYA 4LLGF 1Z6RA 2OU2A 2ZFWA 1KA8A 2Q0OA 5D5XB 3F8FA 5E8GA 4EVIA 4WK8F 2QQAA 2MBFA 3MWMA 3FF5A 5HLGA 2HEOA 3GFLA 2QBYA 3TQNA 1VTNC 3IWFA 3T1BA 5F1RA 1K78B 4P5OA 1CGPA 2O6GE 4FX0A 4AD9A 1AWCA 1SD7A 2EFNA 2ZMEB 3TGNA 2KIUA 3KZZA 4UVBA 2H94A 3E5UA 3KP6A 3EETA 1GXQA 2DLLA 3ECHA 1FSHA 4G6DA 4OIOF 3V4GA 2O61A 2IPQX 1FX7A 3ZMSA 2QWWA 1O3TA 3K9TA 1FYMA 4UUVA 4Y13A 3C7JA 5CVVA 1BC8C 5D8LB 5ICCA 2LF7A 4F7ZA 1YS7A 3F22A 3CO6C 1MGTA 4IPAA 3Q9SA 2RN7A 3KP4A 2GXBA 3J7AO 3F6OA 2GIVA 3I53A 3K0LA 1CF7B 1R5GA 3BPXA 1OYIA 3FX3A 3O2PE 4PDKA 4CO8A 4M73A 4TV7A 2P5LC 1ON2A 4LB5A 3GFMA 3SFZA 3ZMDA 5ICGA 3K1MA 2A69F 4JQFA 4I01A 1HKSA 3L9FA 4KMFA 3WTWC 2DW4A 3IKVA 5JR3A 1QGPA 3TO7A 1L3LA 1S7AA 5KVRA 4LK0F 2FNAA 4U0WA 3GWZA 5HDNA 1H9TA 3L2CA 4MEYF 4WWCA 3R4KA 1KGSA 2LSOA 4HX7A 2STTA 2DTRA 1P4WA 3IKTA 2L4AA 3Q5FA 3HSEA 4A6DA 3FHZA 4MGRA 3AAFA 2WWYA 3GXOA 1DDNA 1MDMB 4EJUA 3Q9VA 3U2RA 1USTA 4IXAA 1Z1DA 3QOPA 1JE8A 3C18A 4I02A 1XGOA 2FA5A 2KIMA 1FT9A 2ISYA 3FXRA 2IW5A 3HTUA 3TO6A 4ENKA 4KA4A 3MZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R60 A;  1XN7 A;  4ZZD A;  3WTU C;  5TJJ A;  5LBQ A;  2HQN A;  3RTR A;  1J9I A;  5L3E A;  3RYR A;  2MC3 A;  1R1T A;  2KJB A;  1IRF A;  1LB2 A;  1ZG5 A;  1XSD A;  2R7F A;  2HS5 A;  2KIF A;  1EV7 A;  4I0A A;  4ESJ A;  1J2X A;  4WXD A;  2P5K A;  1QNT A;  2GZW A;  1IW7 F;  2DBB A;  4A0X A;  1PP8 F;  5E1X A;  2GQQ A;  1AOY A;  2LNB A;  1JGS A;  2EWN A;  2UXN A;  1SMY F;  1UCR A;  1IN8 A;  3NQO A;  2FE3 A;  3P7N A;  2YX7 A;  5H20 A;  3HTS B;  5DCF A;  2FNP A;  2AXL A;  4U0Y A;  4O6J A;  2VT2 A;  5A2Q K;  1KQ8 A;  1FPQ A;  2HDC A;  2MH9 A;  4XLP F;  3I59 B;  4ZH4 F;  4CGZ A;  4MQ9 F;  3WTT C;  3QU6 A;  3GZ6 A;  2NAZ A;  1KQ0 A;  1QO0 D;  3E5Q A;  1U5T C;  2A68 F;  2HQR A;  3LAJ A;  3RIR A;  2ZNY A;  5ILS A;  1R22 A;  2WTE A;  4EMS A;  5D4R A;  3F72 A;  2CGP A;  3V7R A;  1HXD A;  1QZZ A;  4P55 A;  5CVU A;  5CYV A;  4XLN F;  3DFG A;  4RGU A;  2HKX A;  4PGH A;  3RJP A;  1ZG1 A;  2FU4 A;  3JSP A;  2EV6 A;  5ILU A;  1MJA A;  3LQQ A;  2PBI A;  2Z3Y A;  1D5V A;  2JPB A;  2WC2 A;  3L09 A;  3SHF A;  4U0V A;  1IXR C;  4AVP A;  4HDU A;  5AIQ A;  3EDP A;  3O6B B;  5DEQ A;  3FM3 A;  3KEQ A;  4R1H A;  1W7P A;  1E17 A;  3WTX C;  4XRF A;  3G73 A;  1B4A A;  1BM9 A;  1SAX A;  3ZMU A;  4AWX B;  3M8F A;  2G7U A;  4JBA A;  4HV6 A;  2PQ8 A;  2VC0 A;  3E5X A;  4RB2 C;  2RDP A;  2K86 A;  1XSV A;  1RNL A;  4KIB A;  4HLY A;  1YTY A;  3BRO A;  3KP3 A;  4N0B A;  4A0Y A;  2Q8K A;  2VN2 A;  5HOO A;  3EYY A;  6PAX A;  3MCZ A;  1YW7 A;  2D1V A;  3CUQ A;  3M1E A;  2VBW A;  3T0Y A;  1S29 A;  3RPQ A;  1WRJ A;  4LG0 A;  4FT8 A;  4PCQ A;  3IRR A;  2DK8 A;  2P8T A;  3RI4 A;  1BI2 A;  1LNW A;  5E1Z B;  1XMA A;  2NNY A;  1O7L A;  3L7W A;  4OU0 A;  1KU7 A;  1REP C;  2F5F A;  1ZAR A;  3V8J A;  3B73 A;  5LRR A;  2R3S A;  4P9F A;  2VOP A;  5BS6 A;  1Z91 A;  5FB2 A;  3IWZ A;  5FFX A;  1WSU A;  1T6S A;  2DU9 A;  2QBY B;  4HW0 A;  2CG4 A;  4IVN A;  2IT0 A;  1FBU A;  1ZRC A;  2W24 A;  2VXZ A;  5BPI A;  5IT3 A;  1I27 A;  5JFR A;  5HDK A;  4LFU A;  1K7A A;  2XUB A;  3IRQ A;  3RDI A;  2CO5 A;  5FFZ A;  5CJ9 A;  4YFX F;  2J5P A;  1YO5 C;  4KFC A;  3KP2 A;  5CVR A;  2FEZ A;  3WU0 A;  1O3Q A;  3R61 A;  3ERE D;  1SD4 A;  2EB7 A;  2M1B A;  2RNJ A;  4UHT A;  2VC1 A;  2D2W A;  1ZLK A;  2XKP A;  1S7O A;  2XAJ A;  5L3F A;  4HX8 A;  2HOE A;  4RB0 A;  5K5O A;  1H0M A;  4L18 B;  3KET A;  2MH2 A;  4NQW A;  3K1P A;  4R79 A;  1U3E M;  4EJW A;  4WF2 A;  2EFW A;  2JSC A;  2RGV A;  1T98 A;  1LEA A;  3DV8 A;  2NNN A;  1J7K A;  2HTS A;  1SD6 A;  4RB1 A;  4O3M A;  3H3U A;  1GXP A;  5ED4 A;  1T2K A;  3S2W A;  1EH7 A;  2L02 A;  1Z9C A;  3E3V A;  3ZQ7 A;  2E1N A;  2IA2 A;  1GVJ A;  3P9C A;  4G6Q A;  4CYD A;  4MTE A;  2Z9O A;  2IRF G;  3ABU A;  5D8K B;  2STW A;  2EFO A;  4A5M A;  3H3Z A;  4M71 A;  1G6N A;  2IA0 A;  2DFI A;  1WQ2 A;  1C0W A;  5DCM A;  4NHJ A;  3WG9 A;  3I71 A;  1O3S A;  3HRU A;  3RPU A;  4IF4 A;  4EM1 A;  3WTZ A;  2KJC A;  2O0Y A;  3PFI A;  2PI0 A;  2ADU A;  4OOI A;  5IT9 K;  2R7D A;  1K6O A;  2K4B A;  5DYM A;  3RYP A;  4L9J A;  1TQI A;  3K1N A;  4HA8 A;  3CUQ C;  3REO A;  2JZY A;  1Z7U A;  3GZ5 A;  4L9V A;  2BV6 A;  1I5Z A;  2ACJ A;  4D0P A;  4EV0 A;  2VE8 A;  2CSO A;  3EYI A;  3U9G A;  2YX4 A;  4ON0 A;  4HAM A;  2MA3 A;  5HLH A;  3HOS A;  3F8N A;  5AON A;  5JVT A;  2UZK A;  2FBI A;  4Q5S F;  3TDU C;  2DAO A;  5HVQ C;  2DT5 A;  2EA4 A;  4MTD A;  4HLX A;  3ULQ B;  3I5U A;  2XIG A;  3CJN A;  3E6D A;  5LGT A;  3OOP A;  3DXJ F;  2GA2 A;  3LAP A;  2CQK A;  4AIH A;  4CHU A;  3B02 A;  4GXO A;  5E17 F;  2M8E A;  1G3T A;  4IRG A;  1B9N A;  4N9I A;  1O3R A;  3COA C;  2JT1 A;  1U5T A;  2O3F A;  1UB9 A;  4EGZ A;  1XGM A;  1MD0 A;  1JXS A;  2ZJ2 A;  3T8R A;  1W4M A;  4L5J A;  1U78 A;  5EEH A;  3ZP5 A;  2HFH A;  4EGY A;  1B6A A;  1BIB A;  1MJB A;  4Q47 A;  4RB3 C;  1R7J A;  4G7O F;  3BJ6 A;  1HW2 A;  1XGN A;  3BY6 A;  2B0L A;  5ERI A;  3HSR A;  1ODD A;  5HS9 A;  4L5I A;  3LA2 A;  2RVC A;  1FP2 A;  4OIP F;  4M6X A;  4MNU A;  2Y48 A;  3J81 K;  4ENN A;  2EK5 A;  2VOO A;  4LLN A;  3IL2 A;  2P6T A;  2VBY A;  2JRT A;  2DI3 A;  3DEU A;  1RZ4 A;  1USS A;  3V8K A;  2GXG A;  1BI1 A;  1EH8 A;  4KT5 C;  3SXY A;  4FX4 A;  3P9I A;  5DUI A;  4N9H A;  1YW8 A;  4I09 A;  1HST A;  1R36 A;  1FLI A;  4Q48 A;  5D4S A;  1ZRF A;  3DP7 A;  2D1H A;  4GYG A;  3JTH A;  4BHC A;  3I58 A;  3KFW X;  2RQP A;  3RKY A;  3F21 A;  2PLY A;  4QLC U;  4GO1 A;  3HHG A;  2QM3 A;  3CDH A;  1J75 A;  3IHU A;  2XHK A;  4U7B A;  3F6V A;  3GX4 X;  3M9A A;  5F6F A;  1WWX A;  3VOD A;  5IT9 Z;  3WE3 A;  5L3C A;  5K5R A;  1TW3 A;  2XRO A;  3JW4 A;  4L9T A;  5D5V B;  3CLO A;  2FRH A;  1YW9 A;  2P6S A;  1KU3 A;  2FMY A;  1YIO A;  3BDD A;  1ZLJ A;  3ABT A;  5ICE A;  4RGS A;  1STZ A;  2ZXJ A;  1K78 A;  1W5T A;  2BYV E;  4Y17 A;  2GA1 A;  1HW5 A;  4RGX A;  3EQL F;  4P96 A;  2OZU A;  1FYL A;  2PJP A;  5K1Y A;  2XAS A;  2FQ3 A;  1ZYR F;  3LQR A;  1KU9 A;  2FBK A;  2YR2 A;  5D6E A;  3KP5 A;  4HV5 A;  2P7C B;  3U1D A;  3CO7 C;  1IN4 A;  4RGR A;  1GHC A;  3BPV A;  4HQM A;  4YII A;  2E7W A;  1DUX C;  4LLL A;  3GEZ A;  2IP2 A;  2P7V B;  5D6F A;  2M5W A;  4UV8 A;  3HIF A;  3D0S A;  1CF7 A;  4UVA A;  1I6X A;  2JTV A;  4KIC A;  4BXU A;  2BEO A;  2HTJ A;  2Z99 A;  4KDP A;  3O3K A;  3RKX A;  5TRD A;  2E1C A;  3P9K A;  2VBX A;  3HSF A;  5BQT A;  5CVJ A;  4KMU X;  4ZYG A;  1TNT A;  3QPT A;  2A6H F;  3LST A;  2PEX A;  2NRA C;  2QQ9 A;  5HS7 A;  2H09 A;  3ISP A;  2Z33 A;  3J81 Z;  4HDV A;  4G94 A;  3LA7 A;  3NEU A;  4IHS A;  1K79 A;  2ZO4 A;  2EV5 A;  1NHA A;  1A04 A;  5LGN A;  3WGG A;  1IRG A;  4ESF A;  4HF1 A;  2YSR A;  3WTS C;  3GO5 A;  3F3X A;  2P4W A;  5E1W A;  3KLN A;  1B9M A;  2YU3 A;  1SFE A;  1MDM A;  3FWE A;  4XBF A;  1FY7 A;  1BJA A;  5DDG A;  2RKH A;  3ZN1 A;  5LGU A;  3V7C A;  2LDU A;  1HKT A;  1LDJ A;  1ZH5 A;  1DP7 P;  2A5Y B;  3TDZ C;  1IF1 A;  4GYI A;  4LGW A;  1P4A A;  2XKO A;  1FBS A;  2GWR A;  1H9G A;  1R1V A;  1O7F A;  4HF2 A;  1XCV A;  4Q4Z F;  2FML A;  1FBQ A;  4WXC A;  4I7H A;  3R0A A;  2D45 A;  3WGI A;  2ELH A;  1J0R A;  3ECO A;  2EV0 A;  1I1G A;  3TOB A;  4BYY A;  2H27 A;  1MZB A;  1YQA A;  2FBH A;  2IVM A;  5HLI A;  3K69 A;  1ZGJ A;  3WE2 A;  1UFM A;  1HQC A;  3WTY C;  5CLS A;  5FD6 A;  3G3Z A;  4HBL A;  1ZN2 A;  3GVA A;  4BAY A;  2V6C A;  3HUG A;  5LRS A;  3HOT A;  1G4D A;  2QQB A;  5L3B A;  1BN5 A;  2EFP A;  3PQJ A;  2FXA A;  1FNN A;  5JHU A;  1RUN A;  3TOA A;  3GW2 A;  3LFK A;  5FLX K;  4AIK A;  4BQA A;  2M45 A;  1HBX G;  3GUD A;  2DQL A;  4XSX F;  3HRS A;  3ZMZ A;  1U5T B;  4YIF A;  3ZMT A;  3PQK A;  3GF2 A;  2HGC A;  4YFN F;  4H0E A;  4MQV A;  5AIP A;  1P6R A;  4QWQ A;  1TBX A;  3QP5 A;  1IXS B;  3FXQ A;  2L54 A;  4Y15 A;  2LKP A;  4I0B A;  2QYO A;  2W84 A;  4LMY A;  3M8E A;  3VEP A;  1PUE E;  3KCC A;  2RV8 A;  3HRM A;  2K7L A;  3OV8 A;  1BOA A;  2OAZ A;  4ASN A;  3BZ6 A;  1IXC A;  2UXX A;  2HR3 A;  5EEG A;  3M7G A;  3SZT A;  2H6B A;  3WGH A;  3FMS A;  3ELK A;  3N97 A;  2E7X A;  1YYV A;  1ON1 A;  2CYY A;  1LVA A;  2K27 A;  1JHH A;  4WX9 A;  2G9W A;  2YPR A;  3GFJ A;  1KQ9 A;  2G7H A;  4BHP A;  5DUK A;  4M9X A;  4RS8 A;  1SFU A;  1OR7 A;  5E18 F;  1YS6 A;  3BJA A;  3R6S A;  1U8R A;  4ZYH A;  3DPT A;  3NRV A;  1B1B A;  4LJZ F;  2HYG D;  1SD5 A;  2J5O A;  2PN6 A;  2KRF A;  4EJV A;  1BBY A;  4KYW A;  1SMT A;  4LK1 F;  3ZN0 A;  1J5Y A;  2CWE A;  2M30 A;  1OYY A;  3QRF F;  1FC3 A;  2L4M A;  4CXF A;  3BP8 A;  4XSZ F;  1LQ1 A;  3K2Z A;  4Z2Y A;  4OIQ F;  3R0J A;  2DPD A;  4M72 A;  4BNC A;  2F2E A;  4HX4 A;  3JAM K;  1MKM A;  1ZG3 A;  5CVI A;  1KYZ A;  1W7P D;  4HYE A;  3E6C C;  2BE5 F;  5D5W B;  3FM5 A;  3TO9 A;  1O57 A;  4EM2 A;  3GFI A;  3ZPL A;  4GGG A;  4IJA A;  2QVO A;  1ZAO A;  3GLX A;  3ZMV A;  1TQP A;  2C6Y A;  4S04 A;  3JTG A;  1I1S A;  1G3Y A;  2H6C A;  4EM0 B;  4HQE A;  4EJT A;  3V8L A;  1OMI A;  4L0Y B;  2Y0M A;  1D8K A;  2WV0 A;  1HSJ A;  1LJ9 A;  2VT3 A;  4G9Y A;  5BPD A;  2PFB A;  2XAG A;  1YG2 A;  4A0Z A;  4DQ2 A;  1EH6 A;  2V9V A;  4E70 A;  4EQQ A;  1SFX A;  2UWM A;  1XD7 A;  5FLX Z;  4BHB A;  3IC7 A;  2DK5 A;  4ZZL A;  2OQR A;  2TDX A;  1JHF A;  4I98 B;  1F9N A;  2CW0 F;  1WKM A;  1DPR A;  1R58 A;  5FGM A;  2IJL A;  1FYK A;  1BI0 A;  1B59 A;  3W6J B;  2BBY A;  3W6K B;  1R5H A;  2OQG A;  3MZY A;  3DQV C;  2V79 A;  2V1X A;  1S6L A;  1S3J A;  1TQM A;  4ETS A;  1J59 A;  3EUH A;  3DKW A;  2MLG A;  3SZP A;  4I2O A;  4L0Z B;  4KN4 X;  5J8F A;  3DPL C;  1DPU A;  1W7P B;  3J80 K;  2DO7 A;  3HYI A;  2DPU A;  1ZRD A;  1LEB A;  1IN5 A;  3ML6 A;  5FD5 A;  2A07 F;  1FWZ A;  2FSW A;  4ENM A;  3VFZ A;  4R8H A;  1D3Y A;  3V7S A;  1FSE A;  1TW2 A;  5FO5 A;  2L3D A;  2IA1 A;  2XGX A;  2ESH A;  2Q2E A;  3I0T A;  4LB6 B;  3KP7 A;  3CUQ B;  1YFH A;  1RIO H;  1BC7 C;  4OMY A;  3C3W A;  4KNY A;  4A12 A;  3VOE A;  1KYW A;  4WXH A;  5HS8 A;  2OA4 A;  4HF0 A;  4RAY A;  3N4M A;  4LG0 B;  1IUY A;  3BJO A;  4BH9 A;  1FOK A;  2X4H A;  5LEJ A;  2A6E F;  2OZ6 A;  4PZJ A;  3ROU A;  2O03 A;  2EJR A;  3QU3 A;  2A61 A;  4HZF A;  2ZME A;  5LHG A;  4G7Z F;  5BMZ A;  5BOX A;  1QPM A;  1FZP B;  4U7D A;  3MQ0 A;  2COM A;  5H6R A;  1F5T A;  2GAU A;  3JAM Z;  2RC4 A;  1T39 A;  4G7H F;  3KEO A;  4G8X A;  5DD4 A;  1QZY A;  1W5S A;  1XMK A;  5L3D A;  3KZY A;  4S05 A;  1IN7 A;  4M9Z A;  2FF4 A;  1T38 A;  3QPH A;  1OKR A;  3FMQ A;  1Z6T A;  2A3S A;  2PG4 A;  4M9S A;  2HYF A;  1QBJ A;  5E20 A;  3F8B A;  3WTV C;  1ONV A;  1BI3 A;  1ULY A;  2X0L A;  4A5N A;  2V1D A;  1T0F A;  4JK1 X;  2HZT A;  1XCB A;  1D8J A;  4OIN F;  2BGC A;  2VON A;  4LD5 A;  4IHT A;  5ICF A;  4UNO A;  4AIJ A;  4B09 A;  1OPC A;  5HDG A;  4YFK F;  1XGS A;  1R00 A;  4O5V A;  1LDK B;  5DD8 A;  1XSX A;  2OBP A;  1P4X A;  1S8N A;  1ZGA A;  3HHH A;  5LEK A;  3SQN A;  2QLZ A;  1R1U A;  3KE2 A;  2NS0 A;  3I54 A;  1UHW A;  4ESB A;  3FMR A;  1V3F A;  4HOB A;  5F64 A;  5LLQ A;  2XAF A;  4UV9 A;  1IZ1 A;  2P5V A;  4CIC A;  2HKO A;  4A2U A;  2PMU A;  2OD5 A;  2W25 A;  4IRI A;  4UXN A;  3MFK A;  1F1Z A;  2VE9 A;  5DCM B;  5J8C A;  1P2F A;  2K02 A;  1Q1H A;  1UHM A;  4ENJ A;  4MEX F;  4WCG A;  2F5D A;  3J80 Z;  3KLO A;  2ISZ A;  4KIF A;  1R23 A;  4KIG A;  3E6M A;  4OMZ A;  1RUO A;  1RI7 A;  2Y75 A;  3F8C A;  2XRN A;  3FXU A;  4B8X A;  3F23 A;  2F5E A;  2Z5U A;  4ZYD A;  5LHI A;  2MLK A;  3VB2 A;  1ZRE A;  3QAH A;  3WU1 B;  3F8M A;  3CTA A;  5DV5 A;  2LF8 A;  3DF8 A;  2V1U A;  3LA3 A;  4K2E A;  1MJ9 A;  2ZCW A;  1IAW A;  5J6X A;  1TLH B;  2JPC A;  1QQI A;  3C1D A;  4PGG A;  5JI6 A;  1PP7 U;  4UVC A;  1TTY A;  2MD5 A;  4GCV A;  4KUM A;  4RAZ A;  5L3G A;  1U6G A;  1BIA A;  3JSO A;  2CFX A;  1HKQ A;  4P9U A;  2PMH A;  1G3W A;  3D5L A;  3HRT A;  2HWV A;  2ESN A;  1Z05 A;  3RKW A;  1KU2 A;  2QUF A;  3I59 A;  3WOD F;  3I64 A;  2XAQ A;  2ETH A;  2XVC A;  1L0O C;  2L01 A;  4IRH A;  2NYX A;  2QEN A;  1ZHF A;  3H92 A;  3T8T A;  2W57 A;  2EFQ A;  2DQR A;  3MAJ A;  1YLF A;  3E97 A;  5KK1 A;  2VOD A;  2W85 A;  4OIR F;  2ZKZ A;  1G3S A;  5A2Q Z;  4A6E A;  1TNS A;  1V4R A;  4DNC A;  4MHG A;  3LWF A;  1P92 A;  1WI9 A;  2O8X A;  3MEX A;  4ZYE A;  5E8I A;  3QP6 A;  4U88 A;  3BWG A;  1XDU A;  5ILV A;  1E2X A;  1FP1 D;  1XDS A;  2ZBK A;  1Y0U A;  2XV4 S;  1XB4 A;  4EJO A;  3GYH X;  1IN6 A;  1U2W A;  1LDD A;  4CZZ A;  4M74 A;  4M6Y A;  3L00 A;  2AS5 F;  2XAH A;  4NB5 A;  2QZ8 A;  2KKO A;  3E6B A;  3FZV A;  1OYW A;  4CDG A;  3T5X A;  4KN7 X;  4YG2 F;  5H6Q A;  3BOQ A;  4L9N A;  2EA2 A;  4FHT A;  1X3U A;  3CUO A;  2K4J A;  1HW1 A;  5LHH A;  3I4P A;  2ZNZ A;  5D5U B;  2VBZ A;  5K5Q A;  1F4K A;  2M87 A;  2F5C A;  2FOK A;  1PDN C;  3TKY A;  4LLG F;  1Z6R A;  2OU2 A;  2ZFW A;  1KA8 A;  2Q0O A;  5D5X B;  3F8F A;  5E8G A;  4EVI A;  4WK8 F;  2QQA A;  2MBF A;  3MWM A;  3FF5 A;  5HLG A;  2HEO A;  3GFL A;  2QBY A;  3TQN A;  1VTN C;  3IWF A;  3T1B A;  5F1R A;  1K78 B;  4P5O A;  1CGP A;  2O6G E;  4FX0 A;  4AD9 A;  1AWC A;  1SD7 A;  2EFN A;  2ZME B;  3TGN A;  2KIU A;  3KZZ A;  4UVB A;  2H94 A;  3E5U A;  3KP6 A;  3EET A;  1GXQ A;  2DLL A;  3ECH A;  1FSH A;  4G6D A;  4OIO F;  3V4G A;  2O61 A;  2IPQ X;  1FX7 A;  3ZMS A;  2QWW A;  1O3T A;  3K9T A;  1FYM A;  4UUV A;  4Y13 A;  3C7J A;  5CVV A;  1BC8 C;  5D8L B;  5ICC A;  2LF7 A;  4F7Z A;  1YS7 A;  3F22 A;  3CO6 C;  1MGT A;  4IPA A;  3Q9S A;  2RN7 A;  3KP4 A;  2GXB A;  3J7A O;  3F6O A;  2GIV A;  3I53 A;  3K0L A;  1CF7 B;  1R5G A;  3BPX A;  1OYI A;  3FX3 A;  3O2P E;  4PDK A;  4CO8 A;  4M73 A;  4TV7 A;  2P5L C;  1ON2 A;  4LB5 A;  3GFM A;  3SFZ A;  3ZMD A;  5ICG A;  3K1M A;  2A69 F;  4JQF A;  4I01 A;  1HKS A;  3L9F A;  4KMF A;  3WTW C;  2DW4 A;  3IKV A;  5JR3 A;  1QGP A;  3TO7 A;  1L3L A;  1S7A A;  5KVR A;  4LK0 F;  2FNA A;  4U0W A;  3GWZ A;  5HDN A;  1H9T A;  3L2C A;  4MEY F;  4WWC A;  3R4K A;  1KGS A;  2LSO A;  4HX7 A;  2STT A;  2DTR A;  1P4W A;  3IKT A;  2L4A A;  3Q5F A;  3HSE A;  4A6D A;  3FHZ A;  4MGR A;  3AAF A;  2WWY A;  3GXO A;  1DDN A;  1MDM B;  4EJU A;  3Q9V A;  3U2R A;  1UST A;  4IXA A;  1Z1D A;  3QOP A;  1JE8 A;  3C18 A;  4I02 A;  1XGO A;  2FA5 A;  2KIM A;  1FT9 A;  2ISY A;  3FXR A;  2IW5 A;  3HTU A;  3TO6 A;  4ENK A;  4KA4 A;  3MZH A; 
#chains in the Genus database with same CATH topology
 3R60 A;  1HF0 A;  1WCM J;  2PMZ A;  1I50 J;  1QU3 A;  1XN7 A;  3IH4 A;  4ZZD A;  4UUS A;  4A3D J;  2KRC A;  3A2K A;  2DOE A;  1KZH A;  3WTU C;  5TJJ A;  2XF6 A;  5GAE J;  5LBQ A;  2HQN A;  2E34 A;  4XN3 A;  1QVU A;  1RPW A;  3E1S A;  3RTR A;  1J9I A;  3J7A Y;  5L3E A;  3PL8 A;  3RYR A;  4DZJ A;  4Y52 J;  3MKZ A;  2LR8 A;  2MC3 A;  2PX9 A;  4RLF A;  1R1T A;  2JVG A;  3D1N I;  2KJB A;  1IRF A;  1LB2 A;  1RKT A;  4XMY A;  1OLT A;  1ZG5 A;  1XSD A;  2R7F A;  1SVO A;  2HS5 A;  2KIF A;  1EV7 A;  3OWT A;  4I0A A;  4ESJ A;  1J2X A;  4WXD A;  2VJI A;  2P5K A;  1IDY A;  1QNT A;  2GZW A;  2O5R A;  5C3E J;  1IW7 F;  2DBB A;  1X1P A;  4A0X A;  1A6Q A;  2WAF A;  1PP8 F;  5E1X A;  2GQQ A;  4E7I A;  4A3M J;  1AOY A;  2LNB A;  1JGS A;  5J1U A;  2EWN A;  2UXN A;  1SMY F;  1UCR A;  4FET A;  1T33 A;  1IN8 A;  3NQO A;  2FE3 A;  3HUG B;  4ZTF A;  3P7N A;  2YX7 A;  5H20 A;  3HTS B;  3GTM J;  2Z16 A;  5DCF A;  2Y9Y A;  1A31 A;  2FNP A;  2AXL A;  4AU7 A;  4U0Y A;  4O6J A;  2VT2 A;  2ME6 A;  5A2Q K;  3V42 A;  1LUJ B;  1P7J A;  4CYC B;  1FPQ A;  4DOZ A;  1KQ8 A;  1B8I A;  2HDC A;  2MH9 A;  2VAS A;  4XLP F;  1FTT A;  3I59 B;  2JUG A;  2QF7 A;  4ZH4 F;  4CGZ A;  4MQ9 F;  3WTT C;  1GT0 C;  3QU6 A;  2WA0 A;  3GZ6 A;  2NAZ A;  1KQ0 A;  4BEH B;  1QO0 D;  3E5Q A;  1U5T C;  1DU0 A;  2A68 F;  4FQG A;  2HQR A;  3LAJ A;  2GM4 A;  3RIR A;  2ZNY A;  1ZQ3 P;  5ILS A;  4Y4R A;  1R22 A;  2WTE A;  4EMS A;  2L7Z A;  2MSY A;  5EF6 A;  3F72 A;  5D4R A;  2CGP A;  3V7R A;  1HXD A;  1QZZ A;  3J7Z I;  2WB1 N;  4P55 A;  5CVU A;  2QEX I;  5CYV A;  4XLN F;  3DFG A;  1Y8Q B;  4RGU A;  2HKX A;  4PGH A;  3N05 A;  1ETK A;  3RJP A;  1Y39 A;  1ZG1 A;  3CCM I;  2FU4 A;  3JSP A;  3DWL E;  2EV6 A;  5ILU A;  1K83 J;  1MJA A;  2BY1 A;  2VJ5 A;  2X6O A;  4B1R A;  3OYF A;  1I6H J;  5IP7 J;  3LQQ A;  2PBI A;  4QSH A;  2Z3Y A;  1VFC A;  5J4V A;  1D5V A;  2CH0 A;  2JPB A;  2WC2 A;  3L09 A;  1VQ8 I;  3SHF A;  4U0V A;  1X1B A;  1IXR C;  4F55 A;  2K40 A;  1WI3 A;  3WHC A;  3L2V A;  4AVP A;  2LYC A;  4HDU A;  2ZC2 A;  5AIQ A;  2E2J J;  2DN0 A;  1YI2 I;  2LY1 A;  3EDP A;  3MN2 A;  3O6B B;  5DEQ A;  3FM3 A;  3JRB A;  1MBE A;  3DTE A;  3KEQ A;  3M1C A;  1W7P A;  4R1H A;  1E17 A;  5HOD A;  3WTX C;  2CQ7 A;  4XRF A;  2VB6 A;  1T8I A;  1B4A A;  1BM9 A;  3G73 A;  1SAX A;  3ZMU A;  1FEX A;  4AWX B;  3M8F A;  2G7U A;  4JBA A;  4HV6 A;  2PQ8 A;  2ZXI A;  4Y33 A;  1FOY A;  2VC0 A;  4RDU A;  3E5X A;  4RB2 C;  3CCR I;  2RDP A;  3AG1 H;  2K86 A;  1XSV A;  1RNL A;  4KIB A;  4HLY A;  1YTY A;  1T08 B;  3BRO A;  1HDP A;  3KP3 A;  4N0B A;  4A0Y A;  1ZKG A;  1LFP A;  2Q8K A;  2DMT A;  4NNJ A;  1ZK8 A;  5J3L A;  2VN2 A;  2CW7 A;  3D5R C;  5HOO A;  1Z67 A;  3EYY A;  2R5Z B;  3CC2 I;  6PAX A;  1ETV A;  3HGY A;  3MCZ A;  5EG0 B;  1XG1 A;  1YW7 A;  2D1V A;  3CUQ A;  3M1E A;  2VBW A;  4B43 A;  4EEF G;  3T0Y A;  2HDD A;  4UY8 I;  1Z21 A;  3SZG A;  4A3C J;  3VSK A;  1Z77 A;  2XC7 A;  1S29 A;  3RPQ A;  2FD5 A;  2L7K A;  2VUM J;  1WRJ A;  3E7L A;  2DCE A;  4LG0 A;  4FT8 A;  4PCQ A;  1YJW I;  3ESW B;  2DK8 A;  2P8T A;  2M0C A;  3IRR A;  3RI4 A;  1BI2 A;  1K61 A;  3GTQ J;  3LNQ A;  1LNW A;  5E1Z B;  3LL7 A;  1XMA A;  1TWC J;  2NNY A;  2AXT C;  1O7L A;  3CES A;  2KIQ A;  3L7W A;  4OU0 A;  1KU7 A;  2E2H J;  1REP C;  3RCO A;  1BW6 A;  2ZSI B;  2VJJ A;  2F5F A;  1ZAR A;  3V8J A;  3UR3 C;  2Y69 H;  1OCO H;  1V5G A;  2X6X A;  1PUF B;  1FTZ A;  1BA5 A;  3B73 A;  3QPS A;  2F6C A;  5LRR A;  2R3S A;  2A5W A;  1BR4 A;  1TWA J;  5FKL A;  2BHY A;  4P9F A;  3OY9 A;  1S72 I;  2VOP A;  2JRM A;  5BS6 A;  4BU2 A;  1Z91 A;  5FB2 A;  3IWZ A;  5FFX A;  1WSU A;  2QCO A;  2TCT A;  1T6S A;  3G1M A;  2DU9 A;  5DTD A;  2QBY B;  4HW0 A;  2CG4 A;  3OR1 C;  3OS2 A;  3NAU A;  4IVN A;  4XKW A;  1FBU A;  2E5N A;  2IT0 A;  1E0E A;  1XTA A;  4BJT A;  4C2M J;  4IOC F;  3DLA A;  3KYC B;  1ZRC A;  3CJR B;  2W24 A;  2VXZ A;  5BPI A;  2B7E A;  5IT3 A;  5C4X J;  3A02 A;  1I27 A;  3QQA A;  1JJ6 C;  3BZC A;  5JFR A;  3ABK H;  3QYF A;  5TIS C;  5HDK A;  1VZ0 A;  4LFU A;  1K7A A;  2CRG A;  2XUB A;  3IRQ A;  3BCA A;  3RDI A;  1S7E A;  2CO5 A;  2E1M B;  5FFZ A;  5CJ9 A;  4YFX F;  1HDD C;  1JUP A;  1SAU A;  1M1E B;  1ETO A;  4D5C A;  2J5P A;  3C2B A;  1YO5 C;  4KFC A;  3KP2 A;  2ZJP F;  5CVR A;  4J00 A;  3G1O A;  4PJM A;  2FEZ A;  3WU0 A;  1O3Q A;  3R61 A;  3SYT A;  1MBJ A;  3ERE D;  3LSK A;  1SD4 A;  5J47 A;  2EB7 A;  2M1B A;  2RNJ A;  4UHT A;  2VC1 A;  2O8K A;  4A3G J;  4C3I J;  2D2W A;  4A3I J;  3M07 A;  3RSN A;  1ZLK A;  2XKP A;  1WJD A;  1S7O A;  2FOW A;  2XAJ A;  5L3F A;  4HX8 A;  3EUA A;  4FCY A;  2OTJ I;  2K3P A;  2WBM A;  2HOE A;  4DJA A;  4RB0 A;  1I39 A;  5J1Y A;  5K5O A;  3SEQ A;  4B3A A;  1FIA A;  1ACI A;  1H0M A;  3L2U A;  2VJ4 A;  3KET A;  1TWF J;  4L18 B;  2M8G X;  3HM5 A;  2MH2 A;  4NQW A;  3K1P A;  4R79 A;  4CCJ A;  1JTX A;  2I8D A;  4U87 A;  4WF2 A;  4EJW A;  2EFW A;  1JUM A;  1U3E M;  4IHX A;  2JSC A;  3KZI C;  2RGV A;  1MMD A;  1T98 A;  1LEA A;  1DQU A;  3DV8 A;  2NNN A;  2KRH A;  1J7K A;  2HVR A;  4HNV A;  2RRE A;  2HTS A;  4XLH A;  1SD6 A;  4S0H B;  4RB1 A;  3OYH A;  4O3M A;  3H3U A;  1GXP A;  3GZN B;  3RQI A;  1N25 A;  5ED4 A;  1T2K A;  3S2W A;  1EH7 A;  2L02 A;  4XL9 A;  1Z9C A;  4J19 A;  3E3V A;  3ZQ7 A;  4D7N A;  2E1N A;  2IA2 A;  1XC5 A;  1GVJ A;  3P9C A;  1V55 H;  4G6Q A;  1VQP I;  5B5E C;  1VQ7 I;  3KX2 A;  4CYD A;  4MTE A;  1TC3 C;  2OJE D;  2Z9O A;  2IRF G;  3ABU A;  2F4O B;  5D8K B;  2STW A;  2EFO A;  1Z0X A;  4A5M A;  2L2O A;  3H3Z A;  1D0X A;  4M71 A;  3O8H A;  1G6N A;  3OYC A;  2R7R A;  2BXY A;  2IA0 A;  2DFI A;  1WQ2 A;  1C0W A;  5DCM A;  3Q0V A;  4NHJ A;  3WG9 A;  5CQG A;  2XF7 A;  3I71 A;  1O3S A;  3HRU A;  2VQG A;  3RPU A;  4IF4 A;  1VF9 A;  1MMG A;  4I76 A;  3PJR A;  4EM1 A;  3EPZ A;  5KCM A;  3WTZ A;  2KJC A;  2O0Y A;  3RZD J;  3PFI A;  3IP4 B;  2PI0 A;  2ADU A;  4OOI A;  5IT9 K;  4MLO A;  2R7D A;  1K6O A;  2K4B A;  3D5S C;  4H4K C;  5DYM A;  3RYP A;  3IAS 2;  4L9J A;  4BQN A;  2GLO A;  4HRI A;  1TQI A;  3K1N A;  4HA8 A;  2L0K A;  3CUQ C;  3REO A;  2H1L A;  2JZY A;  1X1D A;  1Z7U A;  3GZ5 A;  4L9V A;  3FIW A;  2BV6 A;  1U9O A;  1I5Z A;  2ACJ A;  4D0P A;  4EV0 A;  1S5L C;  3OYG A;  2VE8 A;  2CV0 A;  2CSO A;  2X1D A;  2EQR A;  5HNF A;  3M3Y J;  4IQ4 A;  2BZT A;  3PIO F;  3S3O A;  2HOS A;  3EYI A;  3JRE A;  3U9G A;  2ID3 A;  3JRA A;  2YX4 A;  4ON0 A;  4HAM A;  2MA3 A;  5HLH A;  2KDO A;  3HOS A;  1Y56 A;  3F8N A;  2K9S A;  4IEJ A;  5AON A;  2LP0 A;  5JVT A;  2UZK A;  1IO2 A;  2FBI A;  4M6V A;  4Q5S F;  3TDU C;  2DAO A;  2IGO A;  5HVQ C;  4IOA F;  5FKK A;  2DT5 A;  2EA4 A;  2XF5 A;  3CMM A;  4MTD A;  1I3A A;  4HLX A;  3ULQ B;  2X6Y A;  3I5U A;  3OIP A;  3HL2 A;  3OIO A;  3AG4 H;  4C2T A;  4CUG A;  1MSE C;  3H5N A;  2K5C A;  1FOX A;  2XIG A;  3CJN A;  3E6D A;  1IUF A;  5LGT A;  3OOP A;  4OAZ A;  2NOG A;  4X0G A;  1BJZ A;  1B72 A;  2KZV A;  3DXJ F;  2JA7 J;  4E7K A;  2GA2 A;  3JRF A;  3HOV J;  3LAP A;  5M5X J;  2ICW G;  3AKZ A;  3S8P A;  3HZJ A;  1RR8 C;  2CQK A;  4AIH A;  4CHU A;  1IRX A;  3B02 A;  1QRY A;  1YRN A;  4GXO A;  4BJ5 C;  2M8E A;  1G3T A;  5E17 F;  3PNY A;  3E0J B;  4IRG A;  2I10 A;  1B9N A;  2OC6 A;  2R4G A;  3BR5 A;  1W0U A;  3QOE A;  4N9I A;  2DA6 A;  1O3R A;  3PSI A;  5FRO A;  3FBN B;  3COA C;  2JT1 A;  2DXI A;  1U5T A;  2JA5 J;  4BXX J;  2O3F A;  1UB9 A;  3PNV A;  4HSR A;  4EGZ A;  2KIS A;  1XGM A;  1B8I B;  4BQQ A;  3CCY A;  1MD0 A;  1JXS A;  3PO3 J;  2ZJ2 A;  3T8R A;  4X1E A;  3GME A;  2VPR A;  1HA8 A;  1W4M A;  4L5J A;  1U78 A;  1Y0N A;  5EEH A;  2XAU A;  4HPQ A;  4GRI A;  3BTI A;  3CCU I;  3K70 C;  3ZP5 A;  3CDI A;  3HPG A;  3HOW J;  2HFH A;  2ECC A;  4EGY A;  1B6A A;  1LPQ A;  1BIB A;  3MZ8 A;  1MJB A;  5IOZ A;  4Q47 A;  4RB3 C;  1R7J A;  2DOD A;  2MFZ A;  2XDV A;  3BJ6 A;  3ERM A;  4G7O F;  2X85 A;  2XPV A;  1HW2 A;  1XGN A;  5M3F J;  3BY6 A;  2YU9 J;  2B0L A;  5ERI A;  3HSR A;  2VQC A;  3DKY A;  1D1B A;  1ODD A;  5HS9 A;  2R7S A;  3BG5 A;  4L5I A;  3LA2 A;  3C2G A;  2RVC A;  2I5U A;  3S2D J;  1FP2 A;  2A6T A;  1WVR A;  4OIP F;  4M6X A;  2PMZ N;  4MNU A;  2Y48 A;  3J81 K;  2KDZ A;  3LSH A;  4ENN A;  1BOB A;  1VI0 A;  2LH9 A;  4FTH A;  1U8B A;  2R7U A;  3H9G A;  2EK5 A;  3L1P A;  2VOO A;  2QKL B;  4LLN A;  3IL2 A;  2P6T A;  2VBY A;  2JRT A;  2DI3 A;  4XOR A;  1MH3 A;  3DEU A;  2DOF A;  1RZ4 A;  4AYB A;  1E3H A;  1USS A;  3V8K A;  2KMU A;  2NVT J;  2GXG A;  2M9H A;  1DGR M;  1BI1 A;  1EH8 A;  4KT5 C;  3SXY A;  5IOY A;  4FX4 A;  4V19 K;  3P9I A;  5DUI A;  3L2Q A;  4N9H A;  3BLY A;  3AL0 C;  2B63 J;  1YW8 A;  2LMD A;  4I09 A;  3HB9 A;  1HST A;  1V54 H;  5BNG A;  1R36 A;  1FLI A;  4Q48 A;  5D4S A;  2DT6 A;  1ZRF A;  3DP7 A;  2D1H A;  4GYG A;  3TL4 X;  3JTH A;  3B6C A;  4BHC A;  2L5Q A;  3TED A;  2R92 J;  1OCP A;  3I58 A;  3KFW X;  2RQP A;  3CQZ J;  3RKY A;  1TWG J;  2LK2 A;  3F21 A;  2PLY A;  1X58 A;  2HQA A;  4QLC U;  1D5Y A;  1RR7 A;  4JYK A;  3ZXS A;  4GO1 A;  4BGD A;  3FKJ A;  4BDY A;  3HHG A;  2QM3 A;  3CDH A;  2LD5 A;  1J75 A;  1ZTR A;  3IHU A;  2XHK A;  1D0Z A;  4U7B A;  3F6V A;  3H1C A;  5K7Z A;  2MAB A;  4N4N B;  3GX4 X;  2JN6 A;  4C3J J;  1W36 D;  3M9A A;  5F6F A;  1WWX A;  3DCF A;  3VOD A;  5IT9 Z;  2CV1 A;  5C44 J;  3WE3 A;  2PJR B;  5L3C A;  3K10 A;  1TW3 A;  5K5R A;  2BY0 A;  2HQ5 A;  3JW4 A;  3KEY A;  2XRO A;  4L9T A;  3KYD B;  3UNG C;  5D5V B;  3CLO A;  1UZC A;  1FOW A;  2V9K A;  3CF2 A;  5IPA A;  2L9S A;  5EEA A;  1A5J A;  1OCC H;  5JHF A;  2FRH A;  4ZDP A;  1YW9 A;  2P6S A;  1KU3 A;  2FMY A;  1YIO A;  3PUB A;  5CQE A;  3DLL F;  4ZC3 A;  3BDD A;  4I6Z A;  4J01 A;  1ZLJ A;  4F52 A;  2VLA A;  2Y30 A;  1X4P A;  3GTJ J;  3ABT A;  5ICE A;  4HNU A;  4RGS A;  1STZ A;  2COB A;  2ZXJ A;  4PJJ A;  1K78 A;  3OIQ A;  1W5T A;  2Q1Z B;  3DTK A;  3HKZ N;  4RAG A;  2BYV E;  2WV1 A;  3CMY A;  3JRG A;  2VKH A;  4Y17 A;  4BUP A;  2GA1 A;  3GTK J;  4XON A;  1HW5 A;  4DZP A;  4RGX A;  3W2A A;  4M3B A;  2M4K A;  3EQL F;  5FKO A;  1MND A;  4P96 A;  2JJ7 A;  1WJA A;  4A3K J;  4CSW A;  5GP9 A;  4MFE A;  2OZU A;  1FYL A;  2PJP A;  1V5F A;  1UG2 A;  2K9Q A;  3A0B C;  2R7V A;  5K1Y A;  2YUS A;  2XAS A;  2QQ8 A;  2FQ3 A;  1ZYR F;  2ME0 A;  3LQR A;  1KU9 A;  3KYL A;  3PSF A;  2FBK A;  4AUX A;  2YR2 A;  1OCT C;  4C9Y A;  5D6E A;  1AKH A;  3KP5 A;  2CJJ A;  5GPA A;  4HV5 A;  3P5J A;  2P7C B;  1QPI A;  4XKB A;  3VWB A;  3BTC A;  4CCN A;  1KON A;  2DT7 B;  2L9V A;  4YEL A;  3U1D A;  4ZJZ A;  1QA6 A;  3CO7 C;  3CJT B;  1EJ9 A;  3HGG A;  1YIJ I;  1LKX A;  5E3O A;  1IN4 A;  2DA3 A;  4RGR A;  3K4C A;  1GHC A;  4RBO A;  3BPV A;  3PFY A;  4HQM A;  3K4L A;  4YII A;  3DU5 A;  3BR3 A;  2E7W A;  2K9M A;  1DUX C;  1UEL B;  4A3F J;  4LLL A;  1VQO I;  3GEZ A;  4BY7 J;  2IP2 A;  2P7V B;  5D6F A;  2XGE A;  4B48 A;  2CFO A;  2M5W A;  4UV8 A;  5EZH A;  3KPH A;  1VQ9 I;  3HIF A;  3D0S A;  4BBS J;  1CF7 A;  1Q1V A;  4UVA A;  4ANJ A;  1I6X A;  3LSG A;  2JTV A;  2EIJ H;  1G2H A;  2GIZ A;  4KIC A;  4BXU A;  2OTL I;  4KIS A;  2BEO A;  3I3L A;  3MD2 A;  3O8G A;  2HTJ A;  3HXL A;  2Z99 A;  5EGO A;  4KDP A;  3O3K A;  5E3L A;  2M34 A;  3RKX A;  5TRD A;  2QKM B;  2K9L A;  3S93 A;  3GTG J;  2E1C A;  3P9K A;  2VBX A;  2NS8 A;  4C2U A;  2NVQ J;  3Q3S A;  3HSF A;  5BQT A;  5CVJ A;  4KMU X;  4ZYG A;  1TNT A;  1JKR C;  3QPT A;  2X1E A;  3OYA A;  2A6H F;  3LST A;  4P1W A;  1X2N A;  2PEX A;  2NRA C;  2QQ9 A;  2OV7 A;  1JKO C;  1IG7 A;  1SVL A;  5HS7 A;  3WHB A;  3Q0U A;  5HNH A;  2H09 A;  3ISP A;  3PM1 A;  2Z33 A;  1JTY A;  3J81 Z;  2OPT A;  1R4M B;  4HDV A;  4G94 A;  3HPH A;  3LA7 A;  2DA5 A;  3NEU A;  4ZDL A;  3OYN A;  3LMM A;  4IHS A;  1K79 A;  3BC8 A;  2ZO4 A;  2EV5 A;  2HU9 A;  1NHA A;  1A04 A;  5LGN A;  3WGG A;  2JA6 J;  5EDN A;  1K4S A;  1I3Q J;  1IRG A;  2BW3 A;  4ESF A;  1JJ8 C;  1X4O A;  2K3F A;  4HF1 A;  4V2G A;  4B4C A;  2YSR A;  2E36 A;  4F3Q A;  3WTS C;  3GO5 A;  3F3X A;  2P4W A;  5E1W A;  3KLN A;  1B9M A;  2ZSH B;  1Y1V J;  1LE8 A;  1GV5 A;  1OCR H;  3CC4 I;  2YU3 A;  4W1U A;  2LRE A;  1X19 A;  1N78 A;  1SFE A;  1MDM A;  3FWE A;  2A05 A;  4XBF A;  1FY7 A;  4ZTJ A;  2LY2 A;  1BJA A;  4IHW A;  3OSF A;  3OMY A;  5DDG A;  2RKH A;  3ZN1 A;  5LGU A;  2LBF A;  5KAF C;  1XMX A;  3V7C A;  2LDU A;  3K2A A;  1HKT A;  1LDJ A;  1ZH5 A;  2RAE A;  3BR1 A;  1DP7 P;  2A5Y B;  2WAE A;  3TDZ C;  1IF1 A;  4GYI A;  4D1Q A;  2P81 A;  4LGW A;  1P4A A;  2H1K A;  2XKO A;  1ETX A;  1FBS A;  2GWR A;  1VQN I;  1H9G A;  2IS4 A;  5KAI C;  1JI8 A;  1R1V A;  2FJ1 A;  1O7F A;  3A01 A;  3IUO A;  4HF2 A;  1XCV A;  3H35 A;  4Q4Z F;  1CQT A;  2FML A;  2IS6 A;  1MNM C;  1FBQ A;  4WXC A;  4I7H A;  2AO9 A;  4XRM A;  3BQZ A;  3R0A A;  2D45 A;  3WGI A;  5IYD J;  2ELH A;  1J0R A;  1NTC A;  4F93 B;  2IAI A;  4XLC A;  3ECO A;  3FHN A;  2EV0 A;  1I1G A;  3TOB A;  1JT0 A;  1SAN A;  4BYY A;  1R4N B;  2H27 A;  1MZB A;  1YQA A;  2FBH A;  2IVM A;  5HLI A;  5IP9 J;  5E3M A;  3K69 A;  1ZGJ A;  3WE2 A;  3A1Y A;  1LFB A;  1UFM A;  1HQC A;  2CQN A;  3WTY C;  2E1O A;  1MIJ A;  3NWT A;  5CLS A;  5FD6 A;  3G3Z A;  4HBL A;  1ZN2 A;  1R71 A;  2VIX A;  5TGT A;  3GVA A;  3K4M A;  4BAY A;  2R7W A;  5F0F A;  3BCB A;  2V6C A;  3S1R J;  3HUG A;  5LRS A;  3HOT A;  1G4D A;  2QQB A;  5L3B A;  3ASO H;  1SC7 A;  1BN5 A;  2EFP A;  3PQJ A;  2FXA A;  3VPR A;  1FNN A;  5JHU A;  1RUN A;  3TOA A;  1R49 A;  2KL4 A;  3GW2 A;  2KQR A;  3LFK A;  3OR2 C;  4HG2 A;  1TT5 B;  3ZGK A;  5FLX K;  3HOY J;  4AIK A;  3BR0 A;  4BQA A;  1Z7L A;  1MBK A;  2CU7 A;  1VQM I;  2M45 A;  3JRI A;  1HBX G;  2LG4 A;  2JUC A;  2M4G A;  4PJN A;  2CQX A;  3CCL I;  3GUD A;  2DQL A;  4XSX F;  3PNT A;  2CQQ A;  3HRS A;  2DYR H;  3ZMZ A;  1U5T B;  4YIF A;  3ZMT A;  2FX0 A;  1H8A C;  3PQK A;  3GF2 A;  2UUZ A;  2HGC A;  4YFN F;  2DFF A;  3W3C A;  3A4C A;  3ZQQ A;  4GDF A;  1GDT A;  4H0E A;  1UHS A;  4MQV A;  5AIP A;  1P6R A;  3BG3 A;  4DYC A;  2EZL A;  4BE0 A;  4QWQ A;  1TBX A;  2Y0S A;  3K4N A;  5GAD J;  1NK2 P;  3QP5 A;  1IXS B;  4AC0 A;  3FXQ A;  2R7Z J;  2L54 A;  4Y15 A;  4LIV A;  4UUT A;  2LKP A;  2F48 A;  4I0B A;  2IGK A;  2QYO A;  2NVY J;  2W84 A;  3QYB A;  4LMY A;  5DS9 A;  3M8E A;  3VEP A;  4XLA A;  3HOU J;  4QTR A;  2XPU A;  1PUE E;  2TRT A;  1VND A;  4IO9 F;  1VQL I;  2Y31 A;  4OAY A;  3KCC A;  2RV8 A;  3HRM A;  2K7L A;  5EJC A;  3OV8 A;  1BOA A;  2OAZ A;  4ASN A;  2V6E A;  2W1O A;  4CZC A;  3U1K A;  3BZ6 A;  3CCJ I;  1IXC A;  2UXX A;  2HR3 A;  3H36 A;  5EEG A;  3M7G A;  3SZT A;  5J4Y A;  1P9Q C;  2H6B A;  3DPU A;  3WGH A;  1F36 A;  4E6K G;  3OYK A;  1E3O C;  4FE7 A;  3FMS A;  1IJW C;  3ELK A;  3N97 A;  1Y8R B;  2E7X A;  1YYV A;  1ON1 A;  4X6A J;  2CYY A;  1LVA A;  2K27 A;  1JHH A;  5F04 A;  2WY7 Q;  4IHV A;  2QSF X;  5F1J A;  2HVS A;  4RMN A;  4WX9 A;  2G9W A;  2KP6 A;  2F5V A;  2YPR A;  3GFJ A;  1KQ9 A;  3GTL J;  2G7H A;  5GTH C;  2JQ7 A;  4BHP A;  3DU6 A;  2ELJ A;  5DUK A;  4M9X A;  4RS8 A;  1SFU A;  1OR7 A;  2LKX A;  2EBI A;  1WPK A;  1YS6 A;  3BJA A;  3R6S A;  5E18 F;  1U8R A;  4ZYH A;  3DPT A;  3LFU A;  1W5C C;  3NRV A;  1B1B A;  1Z3X A;  4LJZ F;  2HYG D;  1SD5 A;  2J5O A;  2PN6 A;  2KRF A;  2W82 A;  4EJV A;  2GOX B;  1BBY A;  1Y1W J;  4KYW A;  1SMT A;  4LK1 F;  3ZN0 A;  2VXD A;  5FKN A;  3S1N J;  3TBI A;  1TZL A;  1J5Y A;  2CWE A;  2VKD A;  2X9D A;  1SFK A;  3HG9 A;  2M30 A;  2GOM A;  1AHD P;  1OYY A;  3QRF F;  1FC3 A;  1IRZ A;  1JT6 A;  2L4M A;  4CXF A;  3BP8 A;  4XSZ F;  5M5W J;  1LQ1 A;  2GBY A;  4DW6 A;  1OQY A;  3K2Z A;  1FMW A;  4Z2Y A;  4OIQ F;  2XRL A;  2XSD C;  3R0J A;  3VSL A;  4UUS B;  3OOU A;  2KT0 A;  4M72 A;  2R0Q C;  2V7F A;  2DPD A;  2BVM A;  1MBH A;  4BNC A;  1JUS A;  2F2E A;  4DYQ A;  4D9J A;  3LSJ A;  5FLV A;  1PUF A;  4XN0 A;  4HX4 A;  2DA1 A;  3K7A J;  1R6R A;  3JAM K;  1HLV A;  1MKM A;  3DBH B;  4E7Z A;  5K7F A;  1ZG3 A;  1W1W E;  3OS1 A;  5CVI A;  1KYZ A;  1W7P D;  3CCQ I;  3H0D A;  2V9P A;  4PJL A;  3H5A A;  4HYE A;  2VI6 A;  2VL8 A;  3BG6 A;  3E6C C;  2BE5 F;  2L9R A;  5D5W B;  3FM5 A;  3TO9 A;  5KHD A;  1O57 A;  3K4B A;  4EM2 A;  3GFI A;  3ZPL A;  4GGG A;  4IJA A;  4Z6Y A;  2QVO A;  1ZAO A;  3GLX A;  3ZMV A;  1E3P A;  3VYS B;  4BKX A;  1TQP A;  2IEK A;  4JX5 A;  5E79 C;  2C6Y A;  2DA7 A;  3CMA I;  3OYM A;  4ZYA A;  1JKP C;  4BS9 A;  4S04 A;  4GFB A;  5J1R A;  3JTG A;  1I1S A;  5GAG J;  1G3Y A;  1ZEL A;  2H6C A;  3X2Q H;  4EM0 B;  4HQE A;  4EJT A;  2IXS A;  3V8L A;  1OMI A;  2HVQ A;  1IDZ A;  4L0Y B;  2BXZ A;  4F91 B;  4KA4 A;  2Y0M A;  1D8K A;  3ONQ A;  3S3N A;  2X1C A;  4AYB N;  2WV0 A;  1HSJ A;  1YOV B;  1MMN A;  1LJ9 A;  2VT3 A;  3A0H C;  3HJE A;  4G9Y A;  2NVX J;  5DM7 F;  5BPD A;  1OIS A;  2PFB A;  2H8R A;  2XB0 X;  2XAG A;  4LIT A;  4A69 C;  4BL0 B;  1YG2 A;  4A0Z A;  4DQ2 A;  1EH6 A;  2V9V A;  2V1N A;  4XKV A;  1TT0 A;  2CMP A;  4E70 A;  3FK6 A;  4EQQ A;  2CUF A;  2E19 A;  2IS2 A;  1SFX A;  2UWM A;  3S17 J;  1XD7 A;  2L9N A;  2OCE A;  3ZCO A;  3CD6 I;  5FLX Z;  4BHB A;  3IC7 A;  2DK5 A;  3LSM A;  4ZZL A;  2OQR A;  2TDX A;  2CS3 A;  1JHF A;  4I98 B;  1F9N A;  2CW0 F;  1WKM A;  1DPR A;  2DMP A;  1R58 A;  5CKT A;  2E5Z A;  5FGM A;  1HOM A;  1BW5 A;  3K4J A;  1G8X A;  2IJL A;  5JLW A;  1FYK A;  1BI0 A;  1VQ6 I;  1WJF A;  1ENH A;  3VYR B;  1B59 A;  3L2R A;  4V2F A;  3W6J B;  2BBY A;  3W6K B;  1R5H A;  2OQG A;  1NG6 A;  3MZY A;  1W36 C;  9ANT A;  2V26 A;  3DQV C;  2V79 A;  1RET A;  2V1X A;  1S6L A;  1S3J A;  1TQM A;  4ETS A;  4FE4 A;  3OS0 A;  3OSG A;  1J59 A;  3GTP J;  3EUH A;  2WY8 Q;  3DKW A;  1W0T A;  1ORK A;  2DMU A;  2MLG A;  3SZP A;  4Y7N J;  5KNL A;  2CV2 A;  4M3F A;  4I2O A;  1ZR2 A;  4L0Z B;  2MGQ A;  2MG4 A;  2BY2 A;  4KN4 X;  3LOC A;  5J8F A;  3DPL C;  2AQF A;  1W7P B;  4IL6 C;  3J80 K;  2CW8 A;  1DPU A;  2DO7 A;  2DJN A;  4AID A;  2XB5 A;  3HYI A;  2DPU A;  1ZRD A;  4BDZ A;  3ZQF A;  1LEB A;  5B66 C;  1IN5 A;  3FDY A;  1U9N A;  3ML6 A;  3S16 J;  4W97 A;  4Y3O A;  5FD5 A;  2A07 F;  2L7F P;  1FWZ A;  5C4J J;  2AQE A;  2FSW A;  4ENM A;  3VFZ A;  4E7H A;  3EUK L;  4R8H A;  1D3Y A;  3W2W A;  3V7S A;  1FSE A;  2Z2S B;  3M4O J;  1TW2 A;  4N4O B;  5FO5 A;  2L3D A;  2WAQ A;  2IA1 A;  2JA8 J;  2XGX A;  2ESH A;  2RQQ A;  1BR1 A;  2Q2E A;  3I0T A;  3SEZ A;  4F92 B;  1OR7 C;  4DIQ A;  4LB6 B;  2EZK A;  3KP7 A;  3CUQ B;  3VYT B;  1MSF C;  5FKM A;  1YFH A;  3JCU C;  3VDX A;  1RIO H;  1LE8 B;  1BC7 C;  3CCV I;  2EZI A;  4OMY A;  2P0W A;  3S32 A;  3C3W A;  4KJZ A;  4KNY A;  4A12 A;  1QHG A;  1UJ8 A;  3VOE A;  1T56 A;  4E7S A;  1KYW A;  4E7L A;  2XGD A;  2K9N A;  4WXH A;  5HS8 A;  2OA4 A;  4HF0 A;  4RAY A;  3N4M A;  4LG0 B;  4YEJ A;  1IUY A;  1GVD A;  2FUG 2;  2QA4 I;  3DEE A;  4RA2 A;  3I9V 2;  1XPX A;  3ZR8 X;  1H89 C;  2DDB A;  5F27 A;  3SFI A;  5DM6 F;  3BJO A;  3CLQ A;  3I55 I;  2X6W A;  4XNF A;  4PUS A;  3H5R A;  4BH9 A;  1K4T A;  1FOK A;  3K6G A;  2X4H A;  4QPO A;  5LEJ A;  2A6E F;  1NK3 P;  4HNT A;  2OZ6 A;  2HI3 A;  2JK3 A;  4DBR A;  3A01 B;  4FAS D;  2HOA A;  3WG7 H;  4PZJ A;  3ROU A;  2O03 A;  1WZ2 A;  2EJR A;  3QU3 A;  3CME I;  3LSI A;  2A61 A;  2IGM A;  5GPC A;  4HZF A;  2ZME A;  5LHG A;  4G7Z F;  1XS9 A;  2CUZ A;  1PVE A;  1QPM A;  2K85 A;  5BMZ A;  5BOX A;  2R7Q A;  1FZP B;  2HDW A;  2EIN H;  4QPQ A;  3MQ0 A;  2COM A;  5H6R A;  4U7D A;  3W6V A;  1F5T A;  4MIM A;  1FMV A;  5K7H A;  3MZH A;  2GAU A;  3JAM Z;  2RC4 A;  3RPU D;  1T39 A;  1TP4 A;  3CJQ B;  1EA3 A;  4G7H F;  1MMS A;  3KEO A;  1RC9 A;  4G8X A;  5DD4 A;  1QZY A;  1W5S A;  1XMK A;  3K4K A;  3AG2 H;  3B6A A;  5L3D A;  2DMN A;  3ZOB A;  3HEF A;  4PK4 A;  2W48 A;  3KZY A;  4S05 A;  1IN7 A;  4XM3 A;  4M9Z A;  2FF4 A;  1T38 A;  1ZR4 A;  3QPH A;  4HEA 2;  1OKR A;  3FMQ A;  2YS9 A;  1Z6T A;  3OYI A;  2E1M C;  2A3S A;  2PG4 A;  4M9S A;  1MH4 A;  1N77 A;  2HYF A;  1QBJ A;  5E20 A;  2KZG A;  3F8B A;  4UB6 C;  2LY9 A;  1D1A A;  2W00 A;  3WTV C;  1ONV A;  2XGC A;  3IH2 A;  2IGN A;  2DTZ A;  1BI3 A;  1ULY A;  2X0L A;  3QYE A;  5EYR A;  4A5N A;  3CCS I;  2V1D A;  1T0F A;  4JK1 X;  1OFC X;  2HZT A;  1XCB A;  1D8J A;  4OIN F;  2DOA A;  2BGC A;  1FJL A;  4LD5 A;  4IHT A;  5ICF A;  2E71 A;  2VON A;  3S2H J;  4UNO A;  4AIJ A;  2HNH A;  1ZGW A;  4B09 A;  1OPC A;  5HDG A;  4CCM A;  4YFK F;  1R00 A;  4O5V A;  3F0C A;  1LDK B;  1Z3Y A;  2MD0 A;  4BE1 A;  5DD8 A;  1XSX A;  2OBP A;  1P4X A;  2DDA A;  4XRS A;  3I56 I;  1S8N A;  1ZGA A;  1BL0 A;  1MBF A;  1WH5 A;  2ZXW H;  1YX3 A;  3ABL H;  3C2H A;  3HHH A;  4NQW B;  3MKY B;  2R5Y A;  5LEK A;  2UV1 A;  3KIO A;  3SQN A;  2VKV A;  2QLZ A;  5IYB J;  3DEW A;  1R1U A;  4LOC A;  3KE2 A;  1JKQ C;  3HKZ A;  2NS0 A;  1Y6I A;  3MVP A;  3I54 A;  1RES A;  3G6E I;  1UHW A;  4ESB A;  2M3A A;  3FMR A;  4PFP A;  1V3F A;  4E7J A;  4HOB A;  5F64 A;  5LLQ A;  2ID6 A;  2XAF A;  4UV9 A;  1IZ1 A;  3EUH C;  4JX6 A;  2P5V A;  2R7O A;  4CIC A;  2E35 A;  2HKO A;  4A2U A;  3F9K A;  3HDD A;  1OCZ H;  3I4N J;  2PMU A;  4XLF A;  2OD5 A;  3DBL B;  2E60 A;  2W25 A;  2M2E A;  5B1A H;  3H0G J;  4IRI A;  4UXN A;  3MFK A;  1YIT I;  4II2 A;  3AL0 B;  1F1Z A;  1GLN A;  2VE9 A;  5DCM B;  3GBG A;  4CCO A;  5J8C A;  1DU6 A;  4AM3 A;  1P2F A;  2K02 A;  2ZJQ F;  2KPM A;  2Y2Z A;  1Q1H A;  1UHM A;  4ENJ A;  4MEX F;  4WCG A;  2F5D A;  1YJN I;  2BOL A;  4ABZ A;  1UG0 A;  3J80 Z;  3KLO A;  4MO7 A;  2ISZ A;  3LSR A;  3BG7 A;  1JGG A;  4KIF A;  1R23 A;  4KIG A;  2WB1 A;  3E6M A;  4OMZ A;  1RUO A;  1RI7 A;  5H2F C;  1OJL A;  5M3M J;  2Y75 A;  3F8C A;  4ITV A;  2E2I J;  1ETY A;  2W7N A;  2XRN A;  4A3L J;  3FXU A;  4B8X A;  3F23 A;  2L7M P;  1QVT A;  2F5E A;  1GV2 A;  5B3S H;  2Z5U A;  2D5V A;  3FXO A;  4HST A;  2F4I A;  2ZFU A;  2G0E A;  2PJR A;  1AA7 A;  3L2W A;  4ZYD A;  1A6I A;  4BQO A;  2MLK A;  4RLQ A;  5LHI A;  5FLM J;  2ZJR F;  2OCC H;  3VB2 A;  4A3J J;  2XPW A;  4LG3 A;  1QZE A;  1ZRE A;  3QAH A;  3WU1 B;  5B1B H;  3F8M A;  4M3D A;  3CTA A;  5DV5 A;  5EZG A;  3MKW B;  2LF8 A;  3HC7 A;  3DF8 A;  4DBQ A;  2HOT A;  2EZH A;  2V1U A;  4IKF A;  3LA3 A;  1ETQ A;  3PO2 J;  4K2E A;  1LVK A;  1MJ9 A;  2ZCW A;  3G71 I;  1IAW A;  3OYD A;  3DBR B;  4B47 A;  5J6X A;  1TLH B;  1V5E A;  2JPC A;  3VYU B;  1QQI A;  5F0H A;  3CF5 F;  1YX5 A;  3C1D A;  4PGG A;  5JI6 A;  1PP7 U;  2VKE A;  3MMY B;  4UVC A;  1VQ5 I;  1S9H A;  1TTY A;  2Y0S N;  2MD5 A;  1PJR A;  4GCV A;  3FK7 A;  4KUM A;  2ZME C;  4RAZ A;  5L3G A;  1U6G A;  2BHZ A;  1R9T J;  1BIA A;  1F43 A;  3SJM A;  4E4H A;  3S14 J;  3JSO A;  3ZQL A;  1LFU P;  3OYJ A;  4DYR A;  2CFX A;  2W4S A;  3G1L A;  1HKQ A;  4P9U A;  4PSX A;  2R7T A;  4DGW B;  2PMH A;  3I4M J;  1B72 B;  2MYS A;  3CP8 A;  1G3W A;  3D5L A;  3HRT A;  1GUU A;  2HWV A;  2JWT A;  4BBR J;  4IZZ A;  2ESN A;  1Z05 A;  1MBG A;  4D5F A;  3RKW A;  1KU2 A;  1YRN B;  4CYC A;  2EH3 A;  4XLE A;  1MNE A;  2QUF A;  3M8J A;  3HBL A;  3GTO J;  3I59 A;  2NVU B;  3WOD F;  4XID A;  3I64 A;  2JVH A;  1HC8 A;  3H9Q A;  2XAQ A;  2ETH A;  2LC2 A;  2XVC A;  4IX7 A;  4EAT A;  4BEH A;  1L0O C;  2L01 A;  4IRH A;  2B9S A;  2NYX A;  2QEN A;  5IY5 H;  4XR6 A;  3G2B A;  5JLX A;  2LKS A;  3S15 J;  1ZHF A;  3H92 A;  3T8T A;  4XIC A;  2W57 A;  2EFQ A;  1T0F C;  2DQR A;  3BQY A;  2QSH X;  2XSJ C;  3MAJ A;  4CH7 A;  2AHQ A;  3S3M A;  4A93 J;  4B3X A;  1R5I D;  1YLF A;  3E97 A;  5KK1 A;  4A3E J;  2VOD A;  2W85 A;  4OIR F;  2ZKZ A;  1G3S A;  4UB8 C;  2JA2 A;  1UMQ A;  2VQL A;  5A2Q Z;  1VQK I;  2R93 J;  4A6E A;  2JMW A;  1TNS A;  1V4R A;  4DNC A;  4XRS G;  5J40 A;  4MHG A;  1X2M A;  2LLK A;  4YIR X;  3LWF A;  5GAH J;  1YJ9 I;  1P92 A;  3CP2 A;  1HCR A;  1WI9 A;  2O8X A;  3RKQ A;  3BT9 A;  3MEX A;  4JOM A;  1ERD A;  4ZYE A;  5LD2 C;  5E8I A;  3H3V K;  3FBI B;  3QP6 A;  1K6Y A;  1N75 A;  1WFX A;  4U88 A;  2Z1D A;  3ASN H;  3BWG A;  4G6T B;  4LIU A;  1XDU A;  3FXL A;  5GTI C;  5ILV A;  1E2X A;  1FP1 D;  2F4M B;  1WJB A;  3WU2 C;  1XDS A;  1X3Z B;  2ZBK A;  1Y0U A;  2BY3 A;  2XV4 S;  3FIS A;  1XB4 A;  3QWL A;  2EIM H;  1EKE A;  4EJO A;  1SVM A;  3GYH X;  1IN6 A;  2M7A A;  1U2W A;  3OYE A;  1LDD A;  3J7Y J;  2DJI A;  3FXM A;  4CZZ A;  1MW7 A;  3TP0 A;  4M74 A;  2HYJ A;  2HXI A;  2GXA A;  4QIW N;  1DGW Y;  4M6Y A;  3L00 A;  2AS5 F;  2XAH A;  2KLO A;  3ZRG A;  4NB5 A;  2LTP A;  3OL4 A;  3SDG A;  1X1A A;  3CCE I;  2QZ8 A;  1A35 A;  2KKO A;  3CC7 I;  3E6B A;  3FZV A;  3AG3 H;  1OYW A;  2M0M A;  4L5E A;  1RRJ A;  4CDG A;  2X51 A;  4M3G A;  3T5X A;  2R5Z A;  2MC4 A;  4KN7 X;  4D7M A;  2DFE A;  3Q0W A;  5H6Q A;  4YG2 F;  4JP0 A;  2WAD A;  5IP6 A;  3BOQ A;  5EG0 A;  4L9N A;  3MKL A;  4PJ0 C;  2EA2 A;  4FHT A;  3TW7 A;  1X3U A;  3CUO A;  5E3N A;  1T95 A;  3QOD A;  3ZQH A;  2K4J A;  4YRV A;  3ZQC A;  2IBD A;  1HW1 A;  4B44 A;  5LHH A;  1APL C;  3TMO A;  3I4P A;  2LVS A;  2ZNZ A;  5D5U B;  4NBQ A;  3U21 A;  1PYV A;  3TP3 A;  2VBZ A;  3NWS A;  5K5Q A;  1F4K A;  2Q2E B;  4PFO A;  3RZO J;  2M87 A;  2F5C A;  2FOK A;  1PDN C;  2EIL H;  1WJC A;  3TKY A;  1TL8 A;  4LLG F;  2O9L A;  3CZ6 A;  1Z6R A;  2OU2 A;  2ZFW A;  1VQ4 I;  1KA8 A;  2ECB A;  3ABM H;  3DKX A;  1IV8 A;  2VQH A;  3A03 A;  1UAA A;  2Q0O A;  5D5X B;  3F8F A;  4XKC A;  3UKG A;  5F08 A;  4CCK A;  2R7X A;  1U0J A;  5E8G A;  2RNG A;  1P7I A;  1X3W B;  3PUF A;  1BR2 A;  4EVI A;  4RM3 A;  4KIT B;  4WK8 F;  2QGU A;  2QQA A;  2MBF A;  3MWM A;  1FIP A;  2LFB A;  3FF5 A;  1AU7 A;  1POG A;  1D1C A;  5HLG A;  2HEO A;  4IHY A;  3OL3 A;  3GFL A;  4OWR B;  4NC6 A;  2QBY A;  3PIP F;  3TQN A;  1VTN C;  3IWF A;  4C30 A;  4IQJ A;  1WJ5 A;  3T1B A;  5F1R A;  4P5O A;  1QHH D;  1K78 B;  1CGP A;  3FKI J;  5HLT A;  2O6G E;  2DFH A;  1J09 A;  4FX0 A;  4AD9 A;  1AWC A;  1SD7 A;  4KT6 A;  3LSP A;  2EFN A;  2ZME B;  3TGN A;  5FJ8 J;  1EF4 A;  2KIU A;  4CCL A;  3KZZ A;  1XX5 A;  2M7B A;  4UVB A;  2H94 A;  2NS7 A;  3E5U A;  4PSW A;  1WHU A;  5FRM A;  3KP6 A;  1NH3 A;  3EET A;  5CPR B;  1DP3 A;  2HZD A;  2DA4 A;  3OYL A;  4CA0 A;  3HOX J;  2ZXH A;  1GXQ A;  2KFD A;  2DLL A;  2BVL A;  3ECH A;  2DYS H;  1FSH A;  2NXN B;  4G6D A;  3BG9 A;  4OIO F;  3V4G A;  4G12 A;  1X1C A;  2OUM A;  2LRD A;  2O61 A;  2JSP A;  1AKH B;  2IPQ X;  1FX7 A;  2MW8 A;  2OF7 A;  3ZMS A;  2QWW A;  3S1M J;  5LFA A;  4BXF A;  1O3T A;  3K9T A;  1FYM A;  4UUV A;  1A36 A;  2DMQ A;  4Y13 A;  1G59 A;  3HOZ J;  1WH7 A;  3C7J A;  4AVZ A;  3ZQI A;  5CVV A;  4A3B J;  1BC8 C;  5D8L B;  5ICC A;  5FRN A;  2LF7 A;  4F7Z A;  1YS7 A;  3F22 A;  3CO6 C;  1MGT A;  3G4S I;  1H88 C;  2LOO A;  3NAR A;  4IPA A;  3Q9S A;  4BY1 J;  2RN7 A;  2WAQ N;  3KP4 A;  2N8G A;  2Y9Z A;  4XOT A;  5M5Y J;  2GXB A;  3J7A O;  3F6O A;  2GIV A;  3GCM A;  1MMA A;  2V4J C;  2ZB9 A;  3I53 A;  2IS1 A;  3BZK A;  3IH3 A;  3K0L A;  5F0C A;  1R5G A;  1CF7 B;  3IAM 2;  3BPX A;  1OYI A;  3FX3 A;  3O2P E;  4PDK A;  3TW6 A;  3OYB A;  4BAC A;  3FXK A;  4CO8 A;  4XOP A;  3JRH A;  4M73 A;  4TV7 A;  3RQ4 A;  5IYC J;  4JX4 A;  2P5L C;  1IC8 A;  1ON2 A;  2R5Y B;  1WJE A;  5EGO B;  3QPL A;  4LB5 A;  3GFM A;  3SFZ A;  3JR9 A;  3GLL A;  3ZMD A;  5ICG A;  3K1M A;  2A69 F;  4JQF A;  4I01 A;  1RKW A;  3S1Q J;  4FIS A;  3AFH A;  2ELK A;  2H8W A;  4MFD A;  3H9J A;  1HKS A;  3JRD A;  4II3 A;  1IV6 A;  3L9F A;  2FQ4 A;  4KMF A;  4XQF A;  3WTW C;  4ZDO A;  1NG7 A;  2DW4 A;  4BJ6 C;  3BTJ A;  3IKV A;  1QGP A;  5JR3 A;  3TO7 A;  2VPL A;  4BE2 A;  1L3L A;  3FXJ A;  1S7A A;  2EIK H;  3DTI A;  4LK0 F;  4RM2 A;  5KVR A;  2FNA A;  4U0W A;  2EPF A;  2HPI A;  3GWZ A;  2HXO A;  3BR6 A;  4NUB A;  5HDN A;  4I99 C;  1H9T A;  4RAF A;  3L2C A;  4MEY F;  4WWC A;  3IV5 A;  3R4K A;  1KGS A;  2LSO A;  4HX7 A;  2STT A;  2DTR A;  2BW3 B;  2CUE A;  2NOJ B;  1P4W A;  3IKT A;  2L4A A;  4NC8 A;  1WGX A;  4XK4 A;  3Q5F A;  4M3E A;  1YHQ I;  3K70 D;  3HSE A;  4A6D A;  3FHZ A;  3JRC A;  4MGR A;  3BTL A;  1SFO J;  3AAF A;  1YE9 A;  2QSG X;  2HPM A;  3W2V A;  3ZQG A;  3GXO A;  2WWY A;  1IGN A;  1DDN A;  1MDM B;  4EJU A;  3Q9V A;  3U2R A;  1UST A;  4NC7 A;  5JVG F;  2O7O A;  4IXA A;  1Z1D A;  4C3H J;  3QOP A;  2LBF B;  1ITY A;  1JE8 A;  2X48 A;  1ETW A;  3C18 A;  3BR2 A;  4I02 A;  1SEU A;  1XGO A;  2CUJ A;  4NDL A;  3SDB A;  2KHM A;  2DA2 A;  2FA5 A;  3CDL A;  1O4X A;  2KIM A;  1FT9 A;  2ISY A;  3FXR A;  2IW5 A;  3HTU A;  3TO6 A;  4ENK A;  1TWH J;  1D0Y A;  1XGS A; 
#chains in the Genus database with same CATH homology
 3R60 A;  1XN7 A;  4ZZD A;  3WTU C;  5TJJ A;  5LBQ A;  2HQN A;  3RTR A;  1J9I A;  5L3E A;  3RYR A;  2MC3 A;  1R1T A;  2KJB A;  1IRF A;  1LB2 A;  1ZG5 A;  1XSD A;  2R7F A;  2HS5 A;  2KIF A;  1EV7 A;  4I0A A;  4ESJ A;  1J2X A;  4WXD A;  2P5K A;  1QNT A;  2GZW A;  1IW7 F;  2DBB A;  4A0X A;  1PP8 F;  5E1X A;  2GQQ A;  1AOY A;  2LNB A;  1JGS A;  2EWN A;  2UXN A;  1SMY F;  1UCR A;  1IN8 A;  3NQO A;  2FE3 A;  3P7N A;  2YX7 A;  5H20 A;  3HTS B;  5DCF A;  2FNP A;  2AXL A;  4U0Y A;  4O6J A;  2VT2 A;  5A2Q K;  1KQ8 A;  1FPQ A;  2HDC A;  2MH9 A;  4XLP F;  3I59 B;  4ZH4 F;  4CGZ A;  4MQ9 F;  3WTT C;  3QU6 A;  3GZ6 A;  2NAZ A;  1KQ0 A;  1QO0 D;  3E5Q A;  1U5T C;  2A68 F;  2HQR A;  3LAJ A;  3RIR A;  2ZNY A;  5ILS A;  1R22 A;  2WTE A;  4EMS A;  5D4R A;  3F72 A;  2CGP A;  3V7R A;  1HXD A;  1QZZ A;  4P55 A;  5CVU A;  5CYV A;  4XLN F;  3DFG A;  4RGU A;  2HKX A;  4PGH A;  3RJP A;  1ZG1 A;  2FU4 A;  3JSP A;  2EV6 A;  5ILU A;  1MJA A;  3LQQ A;  2PBI A;  2Z3Y A;  1D5V A;  2JPB A;  2WC2 A;  3L09 A;  3SHF A;  4U0V A;  1IXR C;  4AVP A;  4HDU A;  5AIQ A;  3EDP A;  3O6B B;  5DEQ A;  3FM3 A;  3KEQ A;  4R1H A;  1W7P A;  1E17 A;  3WTX C;  4XRF A;  3G73 A;  1B4A A;  1BM9 A;  1SAX A;  3ZMU A;  4AWX B;  3M8F A;  2G7U A;  4JBA A;  4HV6 A;  2PQ8 A;  2VC0 A;  3E5X A;  4RB2 C;  2RDP A;  2K86 A;  1XSV A;  1RNL A;  4KIB A;  4HLY A;  1YTY A;  3BRO A;  3KP3 A;  4N0B A;  4A0Y A;  2Q8K A;  2VN2 A;  5HOO A;  3EYY A;  6PAX A;  3MCZ A;  1YW7 A;  2D1V A;  3CUQ A;  3M1E A;  2VBW A;  3T0Y A;  1S29 A;  3RPQ A;  1WRJ A;  4LG0 A;  4FT8 A;  4PCQ A;  3IRR A;  2DK8 A;  2P8T A;  3RI4 A;  1BI2 A;  1LNW A;  5E1Z B;  1XMA A;  2NNY A;  1O7L A;  3L7W A;  4OU0 A;  1KU7 A;  1REP C;  2F5F A;  1ZAR A;  3V8J A;  3B73 A;  5LRR A;  2R3S A;  4P9F A;  2VOP A;  5BS6 A;  1Z91 A;  5FB2 A;  3IWZ A;  5FFX A;  1WSU A;  1T6S A;  2DU9 A;  2QBY B;  4HW0 A;  2CG4 A;  4IVN A;  2IT0 A;  1FBU A;  1ZRC A;  2W24 A;  2VXZ A;  5BPI A;  5IT3 A;  1I27 A;  5JFR A;  5HDK A;  4LFU A;  1K7A A;  2XUB A;  3IRQ A;  3RDI A;  2CO5 A;  5FFZ A;  5CJ9 A;  4YFX F;  2J5P A;  1YO5 C;  4KFC A;  3KP2 A;  5CVR A;  2FEZ A;  3WU0 A;  1O3Q A;  3R61 A;  3ERE D;  1SD4 A;  2EB7 A;  2M1B A;  2RNJ A;  4UHT A;  2VC1 A;  2D2W A;  1ZLK A;  2XKP A;  1S7O A;  2XAJ A;  5L3F A;  4HX8 A;  2HOE A;  4RB0 A;  5K5O A;  1H0M A;  4L18 B;  3KET A;  2MH2 A;  4NQW A;  3K1P A;  4R79 A;  1U3E M;  4EJW A;  4WF2 A;  2EFW A;  2JSC A;  2RGV A;  1T98 A;  1LEA A;  3DV8 A;  2NNN A;  1J7K A;  2HTS A;  1SD6 A;  4RB1 A;  4O3M A;  3H3U A;  1GXP A;  5ED4 A;  1T2K A;  3S2W A;  1EH7 A;  2L02 A;  1Z9C A;  3E3V A;  3ZQ7 A;  2E1N A;  2IA2 A;  1GVJ A;  3P9C A;  4G6Q A;  4CYD A;  4MTE A;  2Z9O A;  2IRF G;  3ABU A;  5D8K B;  2STW A;  2EFO A;  4A5M A;  3H3Z A;  4M71 A;  1G6N A;  2IA0 A;  2DFI A;  1WQ2 A;  1C0W A;  5DCM A;  4NHJ A;  3WG9 A;  3I71 A;  1O3S A;  3HRU A;  3RPU A;  4IF4 A;  4EM1 A;  3WTZ A;  2KJC A;  2O0Y A;  3PFI A;  2PI0 A;  2ADU A;  4OOI A;  5IT9 K;  2R7D A;  1K6O A;  2K4B A;  5DYM A;  3RYP A;  4L9J A;  1TQI A;  3K1N A;  4HA8 A;  3CUQ C;  3REO A;  2JZY A;  1Z7U A;  3GZ5 A;  4L9V A;  2BV6 A;  1I5Z A;  2ACJ A;  4D0P A;  4EV0 A;  2VE8 A;  2CSO A;  3EYI A;  3U9G A;  2YX4 A;  4ON0 A;  4HAM A;  2MA3 A;  5HLH A;  3HOS A;  3F8N A;  5AON A;  5JVT A;  2UZK A;  2FBI A;  4Q5S F;  3TDU C;  2DAO A;  5HVQ C;  2DT5 A;  2EA4 A;  4MTD A;  4HLX A;  3ULQ B;  3I5U A;  2XIG A;  3CJN A;  3E6D A;  5LGT A;  3OOP A;  3DXJ F;  2GA2 A;  3LAP A;  2CQK A;  4AIH A;  4CHU A;  3B02 A;  4GXO A;  5E17 F;  2M8E A;  1G3T A;  4IRG A;  1B9N A;  4N9I A;  1O3R A;  3COA C;  2JT1 A;  1U5T A;  2O3F A;  1UB9 A;  4EGZ A;  1XGM A;  1MD0 A;  1JXS A;  2ZJ2 A;  3T8R A;  1W4M A;  4L5J A;  1U78 A;  5EEH A;  3ZP5 A;  2HFH A;  4EGY A;  1B6A A;  1BIB A;  1MJB A;  4Q47 A;  4RB3 C;  1R7J A;  4G7O F;  3BJ6 A;  1HW2 A;  1XGN A;  3BY6 A;  2B0L A;  5ERI A;  3HSR A;  1ODD A;  5HS9 A;  4L5I A;  3LA2 A;  2RVC A;  1FP2 A;  4OIP F;  4M6X A;  4MNU A;  2Y48 A;  3J81 K;  4ENN A;  2EK5 A;  2VOO A;  4LLN A;  3IL2 A;  2P6T A;  2VBY A;  2JRT A;  2DI3 A;  3DEU A;  1RZ4 A;  1USS A;  3V8K A;  2GXG A;  1BI1 A;  1EH8 A;  4KT5 C;  3SXY A;  4FX4 A;  3P9I A;  5DUI A;  4N9H A;  1YW8 A;  4I09 A;  1HST A;  1R36 A;  1FLI A;  4Q48 A;  5D4S A;  1ZRF A;  3DP7 A;  2D1H A;  4GYG A;  3JTH A;  4BHC A;  3I58 A;  3KFW X;  2RQP A;  3RKY A;  3F21 A;  2PLY A;  4QLC U;  4GO1 A;  3HHG A;  2QM3 A;  3CDH A;  1J75 A;  3IHU A;  2XHK A;  4U7B A;  3F6V A;  3GX4 X;  3M9A A;  5F6F A;  1WWX A;  3VOD A;  5IT9 Z;  3WE3 A;  5L3C A;  5K5R A;  1TW3 A;  2XRO A;  3JW4 A;  4L9T A;  5D5V B;  3CLO A;  2FRH A;  1YW9 A;  2P6S A;  1KU3 A;  2FMY A;  1YIO A;  3BDD A;  1ZLJ A;  3ABT A;  5ICE A;  4RGS A;  1STZ A;  2ZXJ A;  1K78 A;  1W5T A;  2BYV E;  4Y17 A;  2GA1 A;  1HW5 A;  4RGX A;  3EQL F;  4P96 A;  2OZU A;  1FYL A;  2PJP A;  5K1Y A;  2XAS A;  2FQ3 A;  1ZYR F;  3LQR A;  1KU9 A;  2FBK A;  2YR2 A;  5D6E A;  3KP5 A;  4HV5 A;  2P7C B;  3U1D A;  3CO7 C;  1IN4 A;  4RGR A;  1GHC A;  3BPV A;  4HQM A;  4YII A;  2E7W A;  1DUX C;  4LLL A;  3GEZ A;  2IP2 A;  2P7V B;  5D6F A;  2M5W A;  4UV8 A;  3HIF A;  3D0S A;  1CF7 A;  4UVA A;  1I6X A;  2JTV A;  4KIC A;  4BXU A;  2BEO A;  2HTJ A;  2Z99 A;  4KDP A;  3O3K A;  3RKX A;  5TRD A;  2E1C A;  3P9K A;  2VBX A;  3HSF A;  5BQT A;  5CVJ A;  4KMU X;  4ZYG A;  1TNT A;  3QPT A;  2A6H F;  3LST A;  2PEX A;  2NRA C;  2QQ9 A;  5HS7 A;  2H09 A;  3ISP A;  2Z33 A;  3J81 Z;  4HDV A;  4G94 A;  3LA7 A;  3NEU A;  4IHS A;  1K79 A;  2ZO4 A;  2EV5 A;  1NHA A;  1A04 A;  5LGN A;  3WGG A;  1IRG A;  4ESF A;  4HF1 A;  2YSR A;  3WTS C;  3GO5 A;  3F3X A;  2P4W A;  5E1W A;  3KLN A;  1B9M A;  2YU3 A;  1SFE A;  1MDM A;  3FWE A;  4XBF A;  1FY7 A;  1BJA A;  5DDG A;  2RKH A;  3ZN1 A;  5LGU A;  3V7C A;  2LDU A;  1HKT A;  1LDJ A;  1ZH5 A;  1DP7 P;  2A5Y B;  3TDZ C;  1IF1 A;  4GYI A;  4LGW A;  1P4A A;  2XKO A;  1FBS A;  2GWR A;  1H9G A;  1R1V A;  1O7F A;  4HF2 A;  1XCV A;  4Q4Z F;  2FML A;  1FBQ A;  4WXC A;  4I7H A;  3R0A A;  2D45 A;  3WGI A;  2ELH A;  1J0R A;  3ECO A;  2EV0 A;  1I1G A;  3TOB A;  4BYY A;  2H27 A;  1MZB A;  1YQA A;  2FBH A;  2IVM A;  5HLI A;  3K69 A;  1ZGJ A;  3WE2 A;  1UFM A;  1HQC A;  3WTY C;  5CLS A;  5FD6 A;  3G3Z A;  4HBL A;  1ZN2 A;  3GVA A;  4BAY A;  2V6C A;  3HUG A;  5LRS A;  3HOT A;  1G4D A;  2QQB A;  5L3B A;  1BN5 A;  2EFP A;  3PQJ A;  2FXA A;  1FNN A;  5JHU A;  1RUN A;  3TOA A;  3GW2 A;  3LFK A;  5FLX K;  4AIK A;  4BQA A;  2M45 A;  1HBX G;  3GUD A;  2DQL A;  4XSX F;  3HRS A;  3ZMZ A;  1U5T B;  4YIF A;  3ZMT A;  3PQK A;  3GF2 A;  2HGC A;  4YFN F;  4H0E A;  4MQV A;  5AIP A;  1P6R A;  4QWQ A;  1TBX A;  3QP5 A;  1IXS B;  3FXQ A;  2L54 A;  4Y15 A;  2LKP A;  4I0B A;  2QYO A;  2W84 A;  4LMY A;  3M8E A;  3VEP A;  1PUE E;  3KCC A;  2RV8 A;  3HRM A;  2K7L A;  3OV8 A;  1BOA A;  2OAZ A;  4ASN A;  3BZ6 A;  1IXC A;  2UXX A;  2HR3 A;  5EEG A;  3M7G A;  3SZT A;  2H6B A;  3WGH A;  3FMS A;  3ELK A;  3N97 A;  2E7X A;  1YYV A;  1ON1 A;  2CYY A;  1LVA A;  2K27 A;  1JHH A;  4WX9 A;  2G9W A;  2YPR A;  3GFJ A;  1KQ9 A;  2G7H A;  4BHP A;  5DUK A;  4M9X A;  4RS8 A;  1SFU A;  1OR7 A;  5E18 F;  1YS6 A;  3BJA A;  3R6S A;  1U8R A;  4ZYH A;  3DPT A;  3NRV A;  1B1B A;  4LJZ F;  2HYG D;  1SD5 A;  2J5O A;  2PN6 A;  2KRF A;  4EJV A;  1BBY A;  4KYW A;  1SMT A;  4LK1 F;  3ZN0 A;  1J5Y A;  2CWE A;  2M30 A;  1OYY A;  3QRF F;  1FC3 A;  2L4M A;  4CXF A;  3BP8 A;  4XSZ F;  1LQ1 A;  3K2Z A;  4Z2Y A;  4OIQ F;  3R0J A;  2DPD A;  4M72 A;  4BNC A;  2F2E A;  4HX4 A;  3JAM K;  1MKM A;  1ZG3 A;  5CVI A;  1KYZ A;  1W7P D;  4HYE A;  3E6C C;  2BE5 F;  5D5W B;  3FM5 A;  3TO9 A;  1O57 A;  4EM2 A;  3GFI A;  3ZPL A;  4GGG A;  4IJA A;  2QVO A;  1ZAO A;  3GLX A;  3ZMV A;  1TQP A;  2C6Y A;  4S04 A;  3JTG A;  1I1S A;  1G3Y A;  2H6C A;  4EM0 B;  4HQE A;  4EJT A;  3V8L A;  1OMI A;  4L0Y B;  2Y0M A;  1D8K A;  2WV0 A;  1HSJ A;  1LJ9 A;  2VT3 A;  4G9Y A;  5BPD A;  2PFB A;  2XAG A;  1YG2 A;  4A0Z A;  4DQ2 A;  1EH6 A;  2V9V A;  4E70 A;  4EQQ A;  1SFX A;  2UWM A;  1XD7 A;  5FLX Z;  4BHB A;  3IC7 A;  2DK5 A;  4ZZL A;  2OQR A;  2TDX A;  1JHF A;  4I98 B;  1F9N A;  2CW0 F;  1WKM A;  1DPR A;  1R58 A;  5FGM A;  2IJL A;  1FYK A;  1BI0 A;  1B59 A;  3W6J B;  2BBY A;  3W6K B;  1R5H A;  2OQG A;  3MZY A;  3DQV C;  2V79 A;  2V1X A;  1S6L A;  1S3J A;  1TQM A;  4ETS A;  1J59 A;  3EUH A;  3DKW A;  2MLG A;  3SZP A;  4I2O A;  4L0Z B;  4KN4 X;  5J8F A;  3DPL C;  1DPU A;  1W7P B;  3J80 K;  2DO7 A;  3HYI A;  2DPU A;  1ZRD A;  1LEB A;  1IN5 A;  3ML6 A;  5FD5 A;  2A07 F;  1FWZ A;  2FSW A;  4ENM A;  3VFZ A;  4R8H A;  1D3Y A;  3V7S A;  1FSE A;  1TW2 A;  5FO5 A;  2L3D A;  2IA1 A;  2XGX A;  2ESH A;  2Q2E A;  3I0T A;  4LB6 B;  3KP7 A;  3CUQ B;  1YFH A;  1RIO H;  1BC7 C;  4OMY A;  3C3W A;  4KNY A;  4A12 A;  3VOE A;  1KYW A;  4WXH A;  5HS8 A;  2OA4 A;  4HF0 A;  4RAY A;  3N4M A;  4LG0 B;  1IUY A;  3BJO A;  4BH9 A;  1FOK A;  2X4H A;  5LEJ A;  2A6E F;  2OZ6 A;  4PZJ A;  3ROU A;  2O03 A;  2EJR A;  3QU3 A;  2A61 A;  4HZF A;  2ZME A;  5LHG A;  4G7Z F;  5BMZ A;  5BOX A;  1QPM A;  1FZP B;  4U7D A;  3MQ0 A;  2COM A;  5H6R A;  1F5T A;  2GAU A;  3JAM Z;  2RC4 A;  1T39 A;  4G7H F;  3KEO A;  4G8X A;  5DD4 A;  1QZY A;  1W5S A;  1XMK A;  5L3D A;  3KZY A;  4S05 A;  1IN7 A;  4M9Z A;  2FF4 A;  1T38 A;  3QPH A;  1OKR A;  3FMQ A;  1Z6T A;  2A3S A;  2PG4 A;  4M9S A;  2HYF A;  1QBJ A;  5E20 A;  3F8B A;  3WTV C;  1ONV A;  1BI3 A;  1ULY A;  2X0L A;  4A5N A;  2V1D A;  1T0F A;  4JK1 X;  2HZT A;  1XCB A;  1D8J A;  4OIN F;  2BGC A;  2VON A;  4LD5 A;  4IHT A;  5ICF A;  4UNO A;  4AIJ A;  4B09 A;  1OPC A;  5HDG A;  4YFK F;  1XGS A;  1R00 A;  4O5V A;  1LDK B;  5DD8 A;  1XSX A;  2OBP A;  1P4X A;  1S8N A;  1ZGA A;  3HHH A;  5LEK A;  3SQN A;  2QLZ A;  1R1U A;  3KE2 A;  2NS0 A;  3I54 A;  1UHW A;  4ESB A;  3FMR A;  1V3F A;  4HOB A;  5F64 A;  5LLQ A;  2XAF A;  4UV9 A;  1IZ1 A;  2P5V A;  4CIC A;  2HKO A;  4A2U A;  2PMU A;  2OD5 A;  2W25 A;  4IRI A;  4UXN A;  3MFK A;  1F1Z A;  2VE9 A;  5DCM B;  5J8C A;  1P2F A;  2K02 A;  1Q1H A;  1UHM A;  4ENJ A;  4MEX F;  4WCG A;  2F5D A;  3J80 Z;  3KLO A;  2ISZ A;  4KIF A;  1R23 A;  4KIG A;  3E6M A;  4OMZ A;  1RUO A;  1RI7 A;  2Y75 A;  3F8C A;  2XRN A;  3FXU A;  4B8X A;  3F23 A;  2F5E A;  2Z5U A;  4ZYD A;  5LHI A;  2MLK A;  3VB2 A;  1ZRE A;  3QAH A;  3WU1 B;  3F8M A;  3CTA A;  5DV5 A;  2LF8 A;  3DF8 A;  2V1U A;  3LA3 A;  4K2E A;  1MJ9 A;  2ZCW A;  1IAW A;  5J6X A;  1TLH B;  2JPC A;  1QQI A;  3C1D A;  4PGG A;  5JI6 A;  1PP7 U;  4UVC A;  1TTY A;  2MD5 A;  4GCV A;  4KUM A;  4RAZ A;  5L3G A;  1U6G A;  1BIA A;  3JSO A;  2CFX A;  1HKQ A;  4P9U A;  2PMH A;  1G3W A;  3D5L A;  3HRT A;  2HWV A;  2ESN A;  1Z05 A;  3RKW A;  1KU2 A;  2QUF A;  3I59 A;  3WOD F;  3I64 A;  2XAQ A;  2ETH A;  2XVC A;  1L0O C;  2L01 A;  4IRH A;  2NYX A;  2QEN A;  1ZHF A;  3H92 A;  3T8T A;  2W57 A;  2EFQ A;  2DQR A;  3MAJ A;  1YLF A;  3E97 A;  5KK1 A;  2VOD A;  2W85 A;  4OIR F;  2ZKZ A;  1G3S A;  5A2Q Z;  4A6E A;  1TNS A;  1V4R A;  4DNC A;  4MHG A;  3LWF A;  1P92 A;  1WI9 A;  2O8X A;  3MEX A;  4ZYE A;  5E8I A;  3QP6 A;  4U88 A;  3BWG A;  1XDU A;  5ILV A;  1E2X A;  1FP1 D;  1XDS A;  2ZBK A;  1Y0U A;  2XV4 S;  1XB4 A;  4EJO A;  3GYH X;  1IN6 A;  1U2W A;  1LDD A;  4CZZ A;  4M74 A;  4M6Y A;  3L00 A;  2AS5 F;  2XAH A;  4NB5 A;  2QZ8 A;  2KKO A;  3E6B A;  3FZV A;  1OYW A;  4CDG A;  3T5X A;  4KN7 X;  4YG2 F;  5H6Q A;  3BOQ A;  4L9N A;  2EA2 A;  4FHT A;  1X3U A;  3CUO A;  2K4J A;  1HW1 A;  5LHH A;  3I4P A;  2ZNZ A;  5D5U B;  2VBZ A;  5K5Q A;  1F4K A;  2M87 A;  2F5C A;  2FOK A;  1PDN C;  3TKY A;  4LLG F;  1Z6R A;  2OU2 A;  2ZFW A;  1KA8 A;  2Q0O A;  5D5X B;  3F8F A;  5E8G A;  4EVI A;  4WK8 F;  2QQA A;  2MBF A;  3MWM A;  3FF5 A;  5HLG A;  2HEO A;  3GFL A;  2QBY A;  3TQN A;  1VTN C;  3IWF A;  3T1B A;  5F1R A;  1K78 B;  4P5O A;  1CGP A;  2O6G E;  4FX0 A;  4AD9 A;  1AWC A;  1SD7 A;  2EFN A;  2ZME B;  3TGN A;  2KIU A;  3KZZ A;  4UVB A;  2H94 A;  3E5U A;  3KP6 A;  3EET A;  1GXQ A;  2DLL A;  3ECH A;  1FSH A;  4G6D A;  4OIO F;  3V4G A;  2O61 A;  2IPQ X;  1FX7 A;  3ZMS A;  2QWW A;  1O3T A;  3K9T A;  1FYM A;  4UUV A;  4Y13 A;  3C7J A;  5CVV A;  1BC8 C;  5D8L B;  5ICC A;  2LF7 A;  4F7Z A;  1YS7 A;  3F22 A;  3CO6 C;  1MGT A;  4IPA A;  3Q9S A;  2RN7 A;  3KP4 A;  2GXB A;  3J7A O;  3F6O A;  2GIV A;  3I53 A;  3K0L A;  1CF7 B;  1R5G A;  3BPX A;  1OYI A;  3FX3 A;  3O2P E;  4PDK A;  4CO8 A;  4M73 A;  4TV7 A;  2P5L C;  1ON2 A;  4LB5 A;  3GFM A;  3SFZ A;  3ZMD A;  5ICG A;  3K1M A;  2A69 F;  4JQF A;  4I01 A;  1HKS A;  3L9F A;  4KMF A;  3WTW C;  2DW4 A;  3IKV A;  5JR3 A;  1QGP A;  3TO7 A;  1L3L A;  1S7A A;  5KVR A;  4LK0 F;  2FNA A;  4U0W A;  3GWZ A;  5HDN A;  1H9T A;  3L2C A;  4MEY F;  4WWC A;  3R4K A;  1KGS A;  2LSO A;  4HX7 A;  2STT A;  2DTR A;  1P4W A;  3IKT A;  2L4A A;  3Q5F A;  3HSE A;  4A6D A;  3FHZ A;  4MGR A;  3AAF A;  2WWY A;  3GXO A;  1DDN A;  1MDM B;  4EJU A;  3Q9V A;  3U2R A;  1UST A;  4IXA A;  1Z1D A;  3QOP A;  1JE8 A;  3C18 A;  4I02 A;  1XGO A;  2FA5 A;  2KIM A;  1FT9 A;  2ISY A;  3FXR A;  2IW5 A;  3HTU A;  3TO6 A;  4ENK A;  4KA4 A;  3MZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...