3GF2A

Crystal structure of the hypothetical regulator st1710 complexed with sodium salicylate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gf2A00
4UVCA 4CXFA 1S7AA 2E7WA 2HKXA 1RI7A 4EM1A 3GFJA 4IRIA 1MZBA 5FLXK 4MNUA 3KP3A 2CWEA 4D0PA 1ZLJA 2XVCA 4GXOA 4EMSA 1KA8A 1JHHA 1XCVA 4FX4A 3T0YA 3FF5A 2DBBA 1PUEE 3WTVC 1LNWA 4U7BA 1LQ1A 2FE3A 3TOBA 3RI4A 3H3UA 1KQ8A 2V9VA 2M1BA 1TQMA 4H0EA 3ZMTA 4EM2A 4HF1A 1W4MA 5CJ9A 5BS6A 3EETA 3E6CC 3HTUA 2HDCA 3E3VA 1QBJA 1FP1D 2XAQA 4O6JA 1HW1A 1IXCA 4I0AA 4KT5C 2HTJA 3E5XA 2H6CA 2L54A 1DDNA 2X0LA 2QYOA 3ZQ7A 2EFNA 1UB9A 1Y0UA 1K6OA 5D6FA 2HTSA 3M7GA 1CF7B 4EJOA 4M74A 1BI3A 3GZ6A 1DP7P 2Z33A 2EFOA 3KP7A 1PDNC 3HRUA 1QGPA 4JK1X 4YFNF 4HBLA 2FOKA 1L3LA 3BP8A 3I0TA 2L3DA 1V3FA 1D8JA 2DTRA 2C6YA 3DPLC 5LRRA 1U2WA 3KP6A 1TQIA 2QENA 3WU0A 1XD7A 5DUKA 1P4AA 1ZRDA 2DI3A 4N9HA 2FMLA 3I71A 1SMYF 2W57A 2VE8A 3BROA 5DD4A 3Q9VA 3O2PE 5J6XA 4UVBA 2EWNA 3GYHX 2GXGA 2XAGA 1TW3A 1O3TA 4ZYHA 4LB5A 5K1YA 2KKOA 5HDNA 3N97A 1K7AA 4I01A 1ODDA 5ILSA 1TLHB 2K4BA 3H92A 5J8CA 2FBKA 3E5UA 4XSZF 1P4WA 4RGRA 2QQAA 4MEYF 2LKPA 1DPUA 1V4RA 4HLXA 5D8LB 1WWXA 4LLLA 4OINF 1G3WA 4EV0A 2M8EA 1J2XA 4L9NA 5H6RA 1XCBA 4I2OA 3LAJA 1SFUA 2XROA 1FNNA 2O61A 2NAZA 4G6QA 1EV7A 2O03A 5D8KB 3R61A 1G3TA 4CYDA 2EA2A 2PQ8A 2Z99A 4KUMA 4KN4X 3SQNA 3HUGA 2P5LC 2CO5A 1MDMA 3GFLA 1G3SA 3I5UA 1IRFA 2BBYA 2CSOA 4MHGA 2KIFA 1KQ9A 4IRGA 2OQRA 1K79A 3LA3A 4NQWA 2DAOA 2XGXA 2EJRA 3E6BA 2WWYA 4IPAA 2MLKA 4WWCA 1YG2A 3WTYC 3BY6A 4YIFA 4IRHA 1QZYA 2K27A 3MQ0A 2MBFA 4YFXF 4K2EA 1S29A 2PJPA 5EEHA 1FBSA 3BJOA 4U7DA 1C0WA 1YTYA 3FM5A 3E6DA 4OU0A 2HGCA 2QQ9A 3HOTA 1IN6A 3M8EA 2A07F 1YYVA 4LD5A 2BYVE 1K78A 4EJUA 2DT5A 2VT2A 2DK8A 1Z7UA 3ELKA 5F64A 3ZMSA 3HSEA 3LAPA 2RC4A 2DPUA 2EV5A 2RKHA 2PI0A 3DF8A 5LHHA 1YO5C 1MDMB 2MH9A 2Q8KA 3QOPA 2FXAA 4ENKA 1XMAA 2YU3A 4WF2A 1BM9A 4EJVA 3GVAA 4DQ2A 4LB6B 1I1GA 2V1XA 2P7VB 3ULQB 4BYYA 4KA4A 1B9MA 1O3QA 4EGZA 1P2FA 5K5QA 1E17A 4AD9A 4WX9A 1JHFA 5HS8A 4F7ZA 1XN7A 5ICFA 4G7ZF 4IHSA 5LRSA 2NNNA 4IXAA 3RIRA 1B4AA 2VBYA 2OQGA 5BQTA 4Y13A 2DQLA 3DV8A 2L02A 4HX8A 1JGSA 1IN5A 3U9GA 2IPQX 5ICGA 4NB5A 1WI9A 3TGNA 3KFWX 4XRFA 4OIQF 1G3YA 4M9ZA 3WE2A 1J7KA 3COAC 2FA5A 3RPUA 1SFEA 1IN7A 2CW0F 4G7OF 3VFZA 5LHIA 1XGSA 1PP7U 3D5LA 1H9GA 3L09A 1LB2A 3GWZA 5A2QK 3ERED 4M9SA 3FM3A 1QPMA 2RQPA 2FNPA 2BEOA 4ZH4F 1W7PB 2XAFA 1JE8A 2ZNZA 5ICCA 3QP6A 3VEPA 2VBZA 3ZMUA 3SZTA 4HF2A 4AIJA 3F3XA 4G9YA 1Z6TA 4LG0A 3OV8A 2W24A 1I6XA 1OYWA 1R23A 3F21A 3TDZC 4L9VA 4ESBA 2ZKZA 4HQMA 1MGTA 4U88A 1QO0D 1STZA 1U5TA 2DFIA 2PMUA 1QQIA 4M9XA 4FT8A 4HV6A 3ZPLA 3IL2A 5CYVA 1XSVA 2OBPA 3U2RA 2GZWA 2LF8A 4BAYA 4Z2YA 2MA3A 5DDGA 3F22A 3C3WA 3F6OA 2RDPA 2QUFA 3I4PA 1G6NA 5K5OA 3IC7A 3GEZA 3P9IA 3I64A 2GIVA 1WRJA 3F8BA 1BC7C 2Z9OA 2PFBA 4BNCA 1FY7A 5FGMA 3R0AA 2G7UA 2R7DA 2NYXA 3GLXA 4RGXA 4UUVA 1DPRA 4G7HF 1W7PA 4R79A 4LLNA 4Q5SF 2Z3YA 3F8FA 4A6EA 4ENNA 3K69A 3V7RA 5ERIA 4UHTA 2D1HA 5JFRA 4TV7A 4E70A 2HKOA 3IRQA 1YLFA 3F72A 4R8HA 1BI2A 4RB1A 3GFIA 3IWFA 1G4DA 4XBFA 4A12A 2W84A 4L9JA 1R22A 4EJWA 1FYKA 1OMIA 3V4GA 1HXDA 5L3DA 3RYPA 5IT9K 3WGHA 2JRTA 3MZHA 2HZTA 2XV4S 1FBQA 2YX7A 2OA4A 2IW5A 4L18B 2E1NA 3FMRA 2HFHA 1E2XA 4I09A 1TQPA 4N9IA 3ML6A 4GCVA 4HDUA 4WXCA 2L01A 4ENMA 5EEGA 3KCCA 4JBAA 2Y0MA 1KYZA 3QU6A 1YW7A 1SMTA 2XUBA 3ZMZA 5HLIA 2LNBA 1OYYA 1ZGJA 4M6YA 1ULYA 5LHGA 3KETA 3DFGA 3Q9SA 3TDUC 5D4SA 1QNTA 1U5TC 4L0YB 1IAWA 2HYFA 1EH7A 1XGNA 3I54A 2CFXA 2EK5A 2VODA 5DUIA 5ICEA 3ROUA 3V8JA 3BDDA 2PEXA 4RAZA 1DUXC 4Q47A 1W5SA 5H20A 5IT3A 4ZYDA 1T98A 1ZN2A 1TNSA 3V8LA 3C1DA 4U0WA 2LF7A 2HYGD 2MC3A 4BH9A 2ESHA 1FBUA 3WU1B 1FPQA 5K5RA 1D8KA 1S3JA 3H3ZA 2VE9A 4OIRF 4UV8A 2GWRA 1UCRA 4CICA 3R60A 2DU9A 3LSTA 1HSTA 2QBYB 2P6TA 2K7LA 1ZG1A 4BQAA 3W6KB 2A6EF 1ZAOA 3ISPA 4KMUX 2ZFWA 3CUQB 3M8FA 1I5ZA 4AIHA 3T8TA 2F5EA 5CVJA 1UHMA 4L0ZB 3J7AO 1YW9A 4RS8A 2FU4A 1B6AA 4HOBA 3S2WA 5TRDA 4N0BA 4PZJA 4LMYA 2DPDA 3SHFA 5HDGA 2Z5UA 3BJ6A 1H9TA 4HW0A 2MD5A 1O57A 2FBHA 3P9KA 2BGCA 1T2KA 3E5QA 4BHPA 4U0VA 2HEOA 4AIKA 2B0LA 5HOOA 1T38A 3E97A 1RZ4A 5KK1A 3WTXC 3KE2A 3IKTA 2G7HA 3SXYA 4OIPF 3R6SA 2AXLA 3R4KA 3K1MA 2UWMA 5F6FA 2PLYA 5JI6A 3HSRA 4EJTA 4LLGF 3KP5A 1USSA 1WQ2A 1R7JA 1FT9A 3WGGA 2HQNA 1BI0A 4RGSA 1OYIA 3HHHA 2ZCWA 2GQQA 2JZYA 3ZMVA 2WV0A 3J81K 2DO7A 2HR3A 1LEBA 2O6GE 5FB2A 2V1DA 4A5NA 1R5HA 1U8RA 2G9WA 4KFCA 1TBXA 3QP5A 1HKSA 1KYWA 1IXSB 3WE3A 1PP8F 4A6DA 1U6GA 4CGZA 2VBWA 2CGPA 4KIFA 2VONA 2A3SA 2VXZA 1O3SA 1U3EM 3WTZA 4G6DA 4A5MA 5E20A 4HYEA 4ETSA 4KN7X 2HWVA 5E17F 3HHGA 1FWZA 3MEXA 1LJ9A 3IWZA 1WSUA 2QWWA 2X4HA 3FXRA 1QZZA 2VOOA 1RIOH 2JPCA 5D5VB 4ENJA 1KQ0A 3SZPA 3DKWA 4IF4A 3K9TA 2FF4A 2ISZA 3MFKA 2EV0A 4UVAA 4G8XA 2VN2A 3N4MA 3RKXA 4HX7A 1IZ1A 2VC0A 4HF0A 4UNOA 1TW2A 3V8KA 3T8RA 3PQJA 1HSJA 4M72A 3CJNA 1USTA 3RPQA 2HOEA 4GYIA 2XRNA 2VT3A 5IT9Z 4UXNA 4PDKA 1JXSA 2DQRA 2V79A 2ETHA 3WGIA 1B1BA 3FZVA 2J5OA 1LDKB 1VTNC 1J5YA 1FLIA 4PCQA 1YS7A 1Z1DA 1L0OC 2OU2A 3CUQA 3RTRA 2R7FA 1MJ9A 2Q0OA 4L5JA 1XSDA 1X3UA 1YS6A 4M71A 2YX4A 1BOAA 3GZ5A 3TO6A 3L7WA 2P5KA 5LGTA 1IF1A 4RB3C 2L4AA 4IJAA 4I98B 1AOYA 5ILUA 3GFMA 5JVTA 2NRAC 2YR2A 4KYWA 2JSCA 3PFIA 1ON1A 5L3GA 1U5TB 1S7OA 1FP2A 2MLGA 2M45A 1F4KA 3E6MA 1O7LA 3TOAA 1GVJA 4Y15A 4CZZA 2K02A 4RB2C 1HW2A 4IHTA 3IHUA 4PGGA 2IA1A 4LFUA 1S8NA 4B8XA 3WG9A 1K78B 3KZZA 4MGRA 5JR3A 5ED4A 1XSXA 3ABUA 2JPBA 1BIBA 1BC8C 2E7XA 2OZUA 3KP4A 2PMHA 3ECOA 1Z05A 4HX4A 3TQNA 5FLXZ 1P92A 4ZYGA 3D0SA 4JQFA 5AIPA 2NNYA 1YIOA 6PAXA 2V6CA 2M30A 4EVIA 2OZ6A 3NQOA 4HV5A 3ABTA 1FX7A 2CG4A 5D6EA 4WK8F 2P7CB 5LEKA 3GW2A 3HRSA 3DXJF 2J5PA 1O3RA 2KJBA 5CVRA 3DPTA 1R58A 1R00A 1TTYA 3C18A 1EH6A 2P5VA 2OAZA 4MQ9F 1MKMA 1Z91A 5CLSA 2H27A 4BHBA 1P6RA 3G73A 3ZN1A 1BN5A 1R36A 1RUNA 3HTSB 2WC2A 2QZ8A 3RYRA 1FSHA 3K2ZA 5CVVA 3FHZA 3BPVA 4CO8A 1OR7A 2HS5A 4OIOF 1H0MA 5FFZA 2DK5A 3JW4A 3L9FA 2QM3A 2M5WA 4KIBA 4MTEA 1OKRA 4YIIA 3WODF 3NEUA 5BPIA 3GX4X 5BPDA 1T6SA 2EB7A 3J81Z 1GXPA 3EYIA 1IRGA 1R1TA 1R1VA 2P4WA 3O3KA 1T39A 1FSEA 1XGOA 1KU9A 2R3SA 3J80Z 1BJAA 4M73A 2WTEA 1ZRCA 1FYLA 2F5CA 1XDUA 4L9TA 5L3CA 4Q4ZF 1HW5A 1Q1HA 3EQLF 1BBYA 3IKVA 1TNTA 5DCMA 1REPC 4PGHA 3O6BB 5DV5A 1MJAA 2L4MA 1SD6A 2QQBA 2K86A 2H6BA 4XLPF 4P96A 5TJJA 1OPCA 1J9IA 1Z6RA 2M87A 2ZMEB 3BWGA 3ECHA 1YFHA 5LLQA 3F6VA 3VODA 4Q48A 1BI1A 2A61A 4RGUA 4OMZA 3LQQA 1D3YA 4A2UA 4HA8A 5FD6A 1CGPA 3CDHA 5HDKA 3K0LA 2ADUA 4I0BA 2GA1A 3REOA 2FSWA 5FD5A 1R5GA 3F8CA 3HYIA 5FFXA 3K1NA 4GYGA 3KEOA 1XGMA 5H6QA 1KU2A 4UV9A 2GAUA 2PBIA 2TDXA 2DLLA 1W5TA 4I7HA 5E8GA 1ZG3A 1SD5A 3KP2A 1T0FA 2W85A 3V7CA 1UHWA 5HVQC 4M6XA 1ZG5A 2ESNA 3PQKA 1WKMA 5J8FA 3I59A 3W6JB 3EDPA 3P9CA 2F5DA 3LFKA 2XAJA 1ZRFA 4OOIA 1J0RA 1HQCA 2A68F 3OOPA 3F8NA 5KVRA 2JTVA 3LWFA 3M1EA 1XMKA 2EV6A 3HOSA 1MJBA 3L2CA 4ZZDA 3MAJA 2MH2A 4FX0A 4P9UA 4GGGA 1ZARA 4P9FA 1U78A 4B09A 1SFXA 3I53A 1LDDA 3J80K 4DNCA 2ZO4A 3DEUA 4GO1A 1HBXG 4A0XA 3HRTA 5E8IA 2JT1A 1IN8A 3GF2A 3B02A 4WCGA 2LDUA 3RJPA 2DW4A 3JAMZ 1AWCA 2P6SA 2VC1A 2O3FA 4ZYEA 4ZZLA 1KU7A 3KZYA 1HKTA 1LDJA 4WXDA 2EA4A 4U0YA 3MZYA 5LGNA 2STWA 4HLYA 2KRFA 3KLOA 3CO6C 2IRFG 1W7PD 1RNLA 3GXOA 3TKYA 2FEZA 2H09A 4ESFA 5LBQA 4BHCA 3V7SA 2F5FA 1YW8A 2KJCA 3F23A 4CDGA 3L00A 4BXUA 5CVUA 3Q5FA 4LK0F 1F9NA 4QLCU 5AIQA 4OMYA 1P4XA 1ZH5A 1B9NA 2NS0A 2D1VA 3TO7A 5L3EA 4LJZF 3F8MA 5JHUA 2D45A 3R0JA 2Q2EA 5E1XA 2ACJA 1GXQA 1IW7F 2RN7A 4ESJA 2COMA 2KIUA 3P7NA 2IT0A 3IRRA 4I02A 3SFZA 4YFKF 1ZREA 3LA2A 1IN4A 1KU3A 4KDPA 2UXXA 5BMZA 3CTAA 4MEXF 1ZGAA 4KIGA 3QPHA 2ZBKA 2OD5A 5CVIA 4RB0A 2A5YB 1D5VA 1I27A 3B73A 2F2EA 5D4RA 4MQVA 3KEQA 2ZNYA 1J75A 2W25A 2KIMA 3AAFA 3HIFA 1FYMA 2Y48A 2IVMA 4FHTA 3VB2A 1SD7A 3LQRA 2VOPA 3JAMK 2IP2A 4QWQA 2VBXA 3CUOA 1XDSA 1GHCA 4XSXF 2XHKA 5DCFA 2YSRA 2E1CA 1A04A 4LK1F 4YG2F 1I1SA 5D5UB 3EUHA 5HLHA 1UFMA 2ZXJA 4HQEA 5DD8A 3MWMA 1XB4A 3BOQA 1Z9CA 5D5WB 2O0YA 4MTDA 1ONVA 2QVOA 4WXHA 1ZYRF 4XLNF 2EFQA 2CQKA 5D5XB 4HZFA 3ZP5A 2ISYA 4L5IA 2XKPA 3EYYA 3BZ6A 4HAMA 2H94A 4EM0B 2XIGA 5ILVA 5DEQA 1FC3A 3WTUC 4KMFA 2P8TA 2BE5F 2IA2A 4ON0A 1KGSA 4P5OA 3QRFF 2EFPA 2FQ3A 4A0ZA 4Y17A 2ZJ2A 5E1WA 1HKQA 2RV8A 1RUOA 2V1UA 3CUQC 2FNAA 3JSOA 2ELHA 4S04A 1NHAA 4ASNA 3CLOA 2ZMEA 3JTHA 4O5VA 3LA7A 3GUDA 5DCMB 3KLNA 3JSPA 2GXBA 2PG4A 2BV6A 3MCZA 3WTWC 3FMSA 1LEAA 1B59A 2RVCA 3FMQA 4IVNA 2PN6A 1FZPB 3T5XA 3HRMA 2O8XA 4AWXB 4HDVA 2UXNA 5AONA 3QU3A 5L3FA 2YPRA 1CF7A 2XASA 2AS5F 2HQRA 4NHJA 3T1BA 4RAYA 5L3BA 4LG0B 3RKYA 3QAHA 3DP7A 4KNYA 3GO5A 1J59A 2IJLA 1S6LA 3JTGA 4S05A 5BOXA 1F5TA 4CHUA 4P55A 5F1RA 3FXQA 1BIAA 2FRHA 2Y75A 3I59B 1LVAA 1IUYA 3TO9A 4O3MA 3BJAA 3VOEA 2XKOA 2XAHA 3BPXA 2RGVA 3K1PA 4R1HA 2RNJA 3NRVA 5A2QZ 2D2WA 3FX3A 1SAXA 1IXRC 3FWEA 3RKWA 5HS7A 1ZHFA 3FXUA 3CO7C 2A6HF 1R1UA 3QPTA 2K4JA 2FBIA 2GA2A 3C7JA 1EH8A 5LGUA 4EQQA 4AVPA 3ZMDA 2UZKA 3U1DA 4G94A 2QLZA 4LGWA 3WTTC 2EFWA 4KICA 2FMYA 1YQAA 3I58A 1F1ZA 5LEJA 4A0YA 3WTSC 2QBYA 5HLGA 3HSFA 3RDIA 1SD4A 4EGYA 1ZLKA 2IA0A 5HS9A 3ZN0A 2STTA 3M9AA 2CYYA 1MD0A 5E1ZB 5DYMA 1FOKA 2LSOA 5FO5A 3G3ZA 3DQVC 1O7FA 5E18F 1ON2A 2A69F
chains in the Genus database with same CATH superfamily
3QQAA 1AA7A 3LL7A 1JGGA 2VB6A 2FQ4A 4UVCA 3CP2A 1RKTA 4MIMA 4CXFA 4IQJA 1S7AA 2E7WA 3JCUC 1A6QA 2HKXA 5FKNA 1RI7A 3UKGA 4EM1A 1B72A 3GFJA 1JUPA 1MZBA 2HNHA 4IRIA 5FLXK 3VSKA 4P1WA 1VQ9I 4MNUA 2QEXI 2QCOA 2QKLB 1XTAA 1EKEA 3KP3A 2CWEA 2Q2EB 5DTDA 3QPLA 4D0PA 3RKQA 1H8AC 2CW7A 1X1PA 2EZLA 5FKOA 1X3WB 3S3OA 1ZLJA 4UB8C 2XVCA 3CCVI 4GXOA 4EMSA 2K40A 4A3DJ 1KA8A 4KT6A 1JHHA 2W00A 1XCVA 4FX4A 1T33A 3T0YA 3FF5A 2DBBA 1PUEE 2W48A 3WTVC 1DQUA 1LNWA 1UHSA 3OYMA 1XS9A 1HOMA 4U7BA 1K6YA 1FMVA 1LQ1A 4XLCA 2FE3A 1MMSA 3TOBA 3RI4A 3H3UA 3OS1A 4IKFA 1KQ8A 2V9VA 3H3VK 2M1BA 1IV8A 1U9OA 2WADA 4D5FA 1TQMA 4H0EA 2B7EA 3ZMTA 4EM2A 4HF1A 4D7MA 1W4MA 1LE8A 1WVRA 2F4IA 5CJ9A 5BS6A 1VQ6I 3EETA 3E6CC 3ESWB 3HTUA 2OC6A 2HDCA 3E3VA 1QBJA 1FP1D 2XAQA 4O6JA 1HW1A 3IUOA 1IXCA 4I0AA 4KT5C 1BA5A 4ZDPA 2HTJA 3L2QA 3E5XA 3GMEA 2H6CA 2L54A 1MH4A 1DDNA 3JRHA 2EILH 2X0LA 2QYOA 3ZQ7A 4NNJA 2EFNA 1UB9A 4RMNA 1Y0UA 4JP0A 5J40A 2EZHA 2DA6A 5D6FA 1K6OA 2HTSA 3WHBA 1MBFA 4D7NA 3M7GA 1WJFA 1CF7B 5GPCA 2BY0A 3KEYA 1YITI 2CFOA 4EJOA 4M74A 1BI3A 3GZ6A 4XOPA 4HSRA 2A6TA 1DP7P 2Z33A 2DA1A 2DODA 1Q1VA 2EFOA 3KP7A 3EUHC 5IY5H 1PDNC 3HRUA 3MZ8A 1QGPA 4JK1X 4YFNF 5HNHA 2Q1ZB 4HBLA 1YX5A 2FOKA 3FXMA 5CPRB 2OCEA 2Y30A 1L3LA 3BP8A 3I0TA 4E4HA 2L3DA 4RA2A 1V3FA 1D8JA 2DTRA 2C6YA 2Y31A 3DPLC 5LRRA 3G71I 5E79C 3W2AA 1U2WA 2JWTA 3BQZA 2VJIA 3KP6A 5EG0A 2RREA 2OF7A 1TQIA 2VKVA 3HOVJ 2QENA 3WU0A 1Y1WJ 1XD7A 4F55A 5DUKA 2CJJA 1P4AA 4ANJA 4MFEA 2KZVA 1ZRDA 2O8KA 2DI3A 4N9HA 2FMLA 4ZJZA 3I71A 1SMYF 4II2A 2W57A 4I76A 2GLOA 2VE8A 2NVYJ 5E3LA 5FKKA 3M8JA 2DMPA 3BROA 5DD4A 3DLAA 3Q9VA 1FIAA 1ZELA 3O2PE 5J6XA 4UVBA 1IGNA 2EWNA 3S1QJ 3GYHX 3CF5F 2GXGA 2HVQA 1Y0NA 4XMYA 2JA7J 2XAGA 1TW3A 1O3TA 4BJ5C 4NBQA 4ZYHA 4LB5A 2XSDC 5K1YA 2LD5A 2KKOA 4CZCA 2VLAA 2CQ7A 2E1OA 4B1RA 1F36A 2IS1A 3WG7H 3WU2C 5HDNA 2E5NA 3KYDB 4X0GA 3DU6A 3N97A 1K7AA 4I01A 1ODDA 5ILSA 1TLHB 2K4BA 3H92A 5J8CA 1I39A 2FBKA 3E5UA 4XSZF 1P4WA 4RGRA 2QQAA 4MEYF 1W5CC 2WY8Q 2LKPA 1DPUA 1V4RA 4HLXA 5D8LB 1WWXA 4LLLA 4OINF 1G3WA 4EV0A 4A3JJ 3IAM2 3I9V2 1MW7A 2M8EA 4XONA 4A3EJ 1J2XA 3A02A 4QTRA 4IHVA 4BU2A 3FXKA 4L9NA 5H6RA 4UUSB 1XCBA 4XLHA 3LAJA 1SFUA 4I2OA 3LSJA 2XROA 1FNNA 2O61A 2KT0A 2E1MB 2NAZA 4G6QA 1EV7A 2Y69H 2O03A 5D8KB 2X1DA 3R61A 1G3TA 1N25A 4QPOA 4CYDA 2EA2A 2PQ8A 4FE7A 2Z99A 1X3ZB 4KUMA 3X2QH 2MFZA 4KN4X 3SQNA 4DYRA 1N77A 3OOUA 3BG5A 4DYQA 3HUGA 2P5LC 2CO5A 1A6IA 1MDMA 2X51A 1BL0A 2BHZA 4J01A 2AXTC 3GFLA 1G3SA 3I5UA 1MNEA 4PJNA 1VFCA 1IRFA 1LFUP 2BBYA 2CSOA 4MHGA 2KIFA 3DU5A 2DJNA 2XPWA 1JKQC 2QGUA 4BBSJ 3OR2C 4J19A 2H1LA 3QYFA 1KQ9A 4XN3A 4IRGA 2L0KA 2OQRA 4D1QA 5B1BH 1K79A 1G59A 3GTOJ 3CJTB 3LA3A 4NQWA 4UY8I 2DAOA 2XGXA 2EJRA 4E7JA 3E6BA 2WWYA 3BCBA 2Y0SA 3AG4H 4IPAA 2L9NA 1Y8QB 2MLKA 3OS2A 1ENHA 4WWCA 1YG2A 3WTYC 3BY6A 4YIFA 4BQOA 1NK2P 4IRHA 1QZYA 2K27A 3MQ0A 2FD5A 2MBFA 5KCMA 1G8XA 4YFXF 4K2EA 1S29A 4IL6C 3PUFA 2PJPA 2L7MP 3S93A 5EEHA 1FBSA 1SEUA 2M4KA 3BJOA 5C3EJ 4U7DA 1C0WA 3ZGKA 3HEFA 3S8PA 2H8RA 4RLQA 1YTYA 3FM5A 1A35A 2IAIA 3E6DA 2JA8J 3FKJA 3BTJA 4OU0A 2HGCA 4CH7A 2QQ9A 3HOTA 1IN6A 2W7NA 3OL4A 2CQNA 3M8EA 2A07F 1YYVA 4LD5A 2BYVE 2ELKA 2JVHA 3H36A 1K78A 5F27A 3C2BA 2X6XA 4EJUA 1IUFA 2CS3A 1WI3A 2DT5A 1FTZA 2VT2A 2DK8A 1JTYA 2QSHX 2X1CA 1Z7UA 1ZKGA 2IGKA 3ELKA 5F64A 3ZMSA 3HSEA 3LAPA 2RC4A 2DPUA 2DOFA 1ERDA 1MMGA 2EV5A 3A4CA 3GZNB 3MKLA 4A3LJ 1GVDA 2RKHA 2PI0A 3CCQI 3DF8A 2BZTA 5LHHA 2IS6A 4XIDA 2EIMH 3OSGA 1YO5C 1MDMB 2X6OA 4AM3A 1W0TA 1WJ5A 2MH9A 3TBIA 2Q8KA 3QOPA 2FXAA 4DJAA 3HJEA 4ENKA 1XMAA 1D0YA 3F9KA 2YU3A 2RQQA 4WF2A 1F43A 1BM9A 4EJVA 3GVAA 5HLTA 3QPSA 1VQKI 1ETVA 2VKDA 2R7QA 4XKWA 4DQ2A 4LB6B 1HCRA 1I1GA 1GUUA 4JYKA 2E2IJ 2V1XA 1QRYA 2V1NA 1ETKA 2OUMA 4II3A 4GDFA 2M2EA 2MGQA 2P7VB 4XRSA 2EIJH 3ULQB 4BYYA 4LITA 4KA4A 5IYDJ 1B9MA 1W36D 1O3QA 4EGZA 1P2FA 3FXJA 5K5QA 1E17A 1DU6A 4AD9A 4WX9A 4RBOA 1JHFA 5HS8A 4F7ZA 2ZMEC 1W0UA 4ITVA 1XN7A 5ICFA 4G7ZF 4IHSA 2LY2A 2EZKA 2QF7A 4BUPA 5LRSA 1RR8C 3PSIA 2NNNA 4IXAA 4DBQA 1FJLA 3RIRA 4A3IJ 1B4AA 2VBYA 4ZTJA 1BW5A 2OQGA 5BQTA 3EPZA 2M4GA 4Y13A 2DQLA 3DV8A 2L02A 2VI6A 3H5AA 5FRMA 4HX8A 3JRFA 1JGSA 3S1MJ 1IN5A 3U9GA 2F4MB 2IPQX 5ICGA 4NB5A 1T8IA 2IGMA 1WI9A 3TGNA 3KFWX 4XRFA 4OIQF 1G3YA 2KMUA 4M9ZA 3WE2A 1J7KA 1QVUA 3LMMA 3COAC 2FA5A 2AHQA 3HPHA 4XM3A 3RPUA 2QA4I 2HPIA 1SFEA 2MSYA 1IN7A 2DTZA 5GTHC 2CW0F 2CW8A 1FTTA 4G7OF 2Y9ZA 4M3EA 3VFZA 5LHIA 1XGSA 1PP7U 1X1BA 3HUGB 3D5LA 3GLLA 1OLTA 4CCMA 1PUFB 1JTXA 1H9GA 2DMNA 3L09A 2CUEA 2LVSA 1LB2A 2O7OA 2WY7Q 3GWZA 3K7AJ 5A2QK 1VQ7I 3ERED 4DZPA 2LBFA 4M9SA 3BG7A 2R7WA 3FM3A 1QPMA 2RQPA 1DGRM 2FNPA 4PJLA 2BEOA 4HG2A 4X1EA 4ZH4F 1IDZA 3GTMJ 1W7PB 1XC5A 2XAFA 2CUFA 1GT0C 2XGEA 1JE8A 2K9LA 2ZNZA 2BY1A 1OCRH 5ICCA 4BDZA 1D1BA 2PJRA 3QP6A 3VEPA 4IOCF 2VBZA 2HOTA 3ZMUA 3SZTA 4BXXJ 4HF2A 4B43A 4AIJA 3FKIJ 2R92J 3F3XA 4G9YA 2ZC2A 1Z6TA 2M7BA 4FISA 4LG0A 2VXDA 3CF2A 3OV8A 4XICA 3PNYA 2W24A 1I6XA 1OYWA 2MG4A 1R23A 3KX2A 3TDZC 3F21A 3BTLA 4L9VA 5J1YA 3BT9A 3A03A 4ESBA 1FEXA 2ZKZA 4HQMA 1MGTA 2WAFA 4U88A 3RZDJ 3HOXJ 1QO0D 3A01B 1STZA 1U5TA 1VQ8I 2DFIA 2PMUA 1QQIA 3HM5A 4FT8A 4M9XA 1MMAA 1XPXA 4FCYA 3DBLB 2HU9A 4HV6A 4CCKA 2E60A 3ZPLA 3IL2A 3CJRB 2BHYA 5CYVA 1XSVA 1RRJA 5J1UA 1X2MA 2OBPA 3U2RA 2GZWA 3BLYA 3IV5A 2LF8A 3KPHA 1TWCJ 4BAYA 4CCJA 2JUGA 5B1AH 3JRCA 2L5QA 1MH3A 4Z2YA 1ORKA 2MYSA 2MA3A 2FUG2 5DDGA 3F22A 1PJRA 3S17J 3C3WA 2LREA 3EUKL 4CCNA 3F6OA 1TWGJ 2RDPA 2QUFA 1WJCA 3I4PA 4H4KC 1G6NA 4Y7NJ 2DDAA 1OCOH 1YJNI 3W6VA 1APLC 3AL0B 5K5OA 3IC7A 4XKVA 3GEZA 2E19A 2WV1A 3P9IA 2I5UA 3I64A 5F0HA 2GIVA 4FETA 1WRJA 3F8BA 1BC7C 2Z9OA 2PFBA 4BNCA 4F91B 2GBYA 3OYBA 1CQTA 1FY7A 2DA3A 5FGMA 1QU3A 3R0AA 9ANTA 4DBRA 2G7UA 4KITB 1VNDA 2DFHA 4XN0A 4E7KA 2LLKA 5FKLA 2R7DA 2NYXA 1OCPA 3GLXA 4RGXA 4UUVA 5M3MJ 3KYLA 1DPRA 2AQFA 4G7HF 1BOBA 1W7PA 2HZDA 4FQGA 4R79A 4RDUA 4CCLA 4LLNA 4Q5SF 2FX0A 1YE9A 3A0BC 2Z3YA 3F8FA 3PO2J 4A6EA 4ENNA 3K69A 3V7RA 3JRDA 5ERIA 4UHTA 2D1HA 5JFRA 4TV7A 4E70A 3HOUJ 5F04A 2HKOA 1JJ6C 2XB5A 1YOVB 3IRQA 1YLFA 3F72A 4R8HA 1BI2A 1VF9A 4RB1A 2NVUB 3GFIA 2JJ7A 2OCCH 5FRNA 4DIQA 4UUSA 2DT7B 3HXLA 1TC3C 1Z7LA 2DYRH 3IWFA 1G4DA 4XBFA 4A12A 2W84A 4L9JA 3Q0UA 1R22A 3CC4I 2KP6A 4EJWA 1FYKA 1OMIA 1R4NB 1U0JA 3HGYA 1V5FA 1HXDA 3V4GA 5L3DA 3RYPA 1ZR2A 3FISA 1BR4A 1Y39A 5IT9K 3WGHA 2JRTA 2HZTA 2XV4S 3MZHA 1LE8B 1FBQA 2YX7A 2OA4A 2IW5A 4L18B 2E1NA 3FMRA 1H88C 2HFHA 1E2XA 2ID6A 3ASNH 4I09A 1ACIA 2ZSIB 1TQPA 2RNGA 3SEZA 1YHQI 2R7SA 4N9IA 3ML6A 3UR3C 4GCVA 4HDUA 2HYJA 3FK6A 3JREA 3DKXA 4CA0A 2R7UA 3ZQIA 2DCEA 4WXCA 2EQRA 2L01A 1Z67A 4ENMA 4CSWA 5EEGA 3KCCA 4QIWN 3OR1C 4JBAA 2K9NA 2Y0MA 1KYZA 1X1CA 3QU6A 4AVZA 4HNVA 5IOZA 1YW7A 2I10A 1MBEA 1SMTA 2DJIA 1AU7A 1JI8A 2CQQA 2XUBA 3ZMZA 5HLIA 2LNBA 1OYYA 1ZGJA 2GOXB 3J7AY 1VQNI 4I6ZA 5K7ZA 2KFDA 3HPGA 4M6YA 1ULYA 5LHGA 3DLLF 1TZLA 3KETA 3DFGA 1B8IA 1D1CA 3Q9SA 4IQ4A 3TDUC 2Z2SB 5D4SA 4A3FJ 1QNTA 2R5ZB 1U5TC 4L0YB 1IAWA 2NVQJ 2HYFA 1EH7A 1X1AA 1XGNA 3I54A 3ONQA 2DT6A 1EJ9A 5M3FJ 4S0HB 2CFXA 2EK5A 4PJJA 2X85A 4B47A 2VODA 2GM4A 1WHUA 1R5ID 1RETA 5DUIA 1UMQA 3ROUA 5ICEA 3V8JA 3JR9A 2OV7A 2PEXA 3BDDA 4RAZA 1IC8A 1DUXC 3FXOA 4Q47A 1SFKA 1W5SA 2ZXHA 5H20A 3BR0A 5IT3A 2CU7A 4D9JA 3GTJJ 4ZYDA 2WA0A 2B9SA 3OWTA 2HQ5A 4IHXA 1S9HA 1T98A 1WPKA 3OY9A 1ZN2A 1TNSA 3V8LA 3C1DA 4U0WA 4LOCA 2LF7A 3K70C 2HYGD 3IP4B 2MC3A 4BY1J 4BH9A 2ESHA 1FBUA 3WU1B 1FPQA 2H1KA 5K5RA 2LC2A 1D8KA 1MBHA 1S3JA 3H3ZA 5EZHA 3TEDA 2CRGA 3AG2H 4IHWA 3VYRB 1JKRC 4IX7A 2VE9A 2F48A 2M9HA 4OIRF 4UV8A 2GWRA 5KHDA 1UCRA 5DM7F 4CICA 3R60A 2DU9A 2R7XA 3LSTA 1HSTA 1Z21A 3FIWA 2QBYB 3ZQCA 2M0CA 3I55I 3CMMA 3DPUA 1Z3YA 3UNGC 1IRZA 2P6TA 2K7LA 3TMOA 1ZG1A 5EZGA 2XSJC 4BQAA 3W6KB 3G2BA 2A6EF 2PMZA 1ZAOA 4ZC3A 3ISPA 1A31A 4KMUX 4XLFA 3CC2I 2ZFWA 3CUQB 1MMDA 3M8FA 1I5ZA 4AIHA 3BQYA 3T8TA 2F5EA 2CV1A 5CVJA 3AFHA 4XRSG 1UHMA 4L0ZB 4FASD 3J7AO 2V9KA 1YW9A 4RS8A 2FU4A 3DWLE 2XC7A 1QHHD 1HA8A 1B6AA 4HOBA 2V9PA 3S2WA 5TRDA 1K4TA 4N0BA 2Z1DA 4PZJA 1E3OC 4LMYA 3G1LA 2DPDA 3SHFA 4BE0A 5EF6A 5HDGA 2Z5UA 1SANA 3BJ6A 4BE1A 1H9TA 3S14J 4HW0A 2MD5A 1O57A 5TISC 4BE2A 1UELB 2FBHA 5TGTA 3WHCA 3P9KA 2E35A 2BGCA 1T2KA 3E5QA 2DA7A 1I50J 2ECCA 4X6AJ 4BHPA 4U0VA 2HEOA 2P0WA 3QOEA 2JN6A 4AIKA 2B0LA 1OCCH 5HOOA 1T38A 3E97A 3OYNA 4NC7A 1RZ4A 4FTHA 5KK1A 3WTXC 3KE2A 3CCYA 3IKTA 2G7HA 2QSGX 3SXYA 1Z77A 4OIPF 3R6SA 2AXLA 3R4KA 3OYHA 3K1MA 4IEJA 2DA5A 2UWMA 1IV6A 4E6KG 2VKEA 3V42A 1MSFC 2MC4A 3SYTA 1S72I 3DCFA 5F6FA 5EGOA 1XG1A 2PLYA 4U87A 5JI6A 3HSRA 4EJTA 2HXIA 4LLGF 2QKMB 3KP5A 1USSA 2XAUA 2NVXJ 4HNTA 1AHDP 1WQ2A 1R7JA 1FT9A 3WGGA 2KDOA 2E5ZA 3ZCOA 3OYCA 2HQNA 1BI0A 4RGSA 1OCTC 1OYIA 3HHHA 2ZCWA 5DM6F 3W3CA 2GQQA 2JZYA 3ZMVA 2WV0A 4C2TA 3Q0WA 3J81K 1ZGWA 2DO7A 2HR3A 2VJ5A 3CDLA 3HGGA 2VPRA 4BY7J 1LEBA 2O6GE 5FB2A 2V1DA 4A5NA 1R5HA 1U8RA 2G9WA 4KFCA 2K9SA 1TBXA 3QP5A 1HKSA 2DMTA 1KYWA 1OFCX 2MD0A 4Y3OA 1IXSB 3WE3A 1PP8F 4A6DA 3OSFA 1TWAJ 1U6GA 4CGZA 2VBWA 1MNDA 3FHNA 2CGPA 1NG7A 2JK3A 4KIFA 2R7VA 4YELA 2VONA 2A3SA 2VXZA 1O3SA 1U3EM 3WTZA 4G6DA 4A5MA 4OAYA 3Q0VA 3K4BA 5E20A 3LSHA 3CJQB 3DBRB 1AKHB 4HYEA 3LOCA 4ETSA 3S2HJ 2GIZA 2X1EA 4KN7X 2HWVA 5E17F 1OISA 4V19K 2K3FA 3HHGA 1FWZA 3MEXA 1LJ9A 4A3MJ 3IWZA 3A1YA 1WSUA 2LOOA 3F0CA 2QWWA 2X4HA 3FXRA 1QZZA 5JLWA 1SFOJ 2VOOA 1HC8A 2HOAA 2DYSH 5E3NA 1RIOH 1T95A 1WCMJ 4YIRX 4XQFA 3W2VA 1Y6IA 2JPCA 4BBRJ 5D5VB 4KISA 2M3AA 3ZR8X 1U8BA 1Y8RB 5IP7J 3L1PA 3RQ4A 4ENJA 1KQ0A 3SZPA 2JA2A 3DKWA 1ZR4A 4AYBN 4IF4A 5GAHJ 3K9TA 2P81A 2FF4A 2E2JJ 3LNQA 2K5CA 3EUAA 3TP0A 2ISZA 3MFKA 2EV0A 4UVAA 1J09A 3HC7A 3OL3A 4G8XA 2VN2A 4C30A 4ZDLA 2O9LA 3PM1A 3N4MA 3QODA 3RKXA 2TCTA 3LSGA 4HX7A 4BJ6C 1V55H 3A01A 1R71A 1QA6A 1IZ1A 1RKWA 2VC0A 3BC8A 4HF0A 4UNOA 1TW2A 1HLVA 1WJEA 3T8RA 3V8KA 1Y56A 3TW6A 3PQJA 1HSJA 4M72A 3CJNA 5M5YJ 1USTA 4OAZA 1R4MB 3RPQA 2HOEA 4GYIA 5FROA 2XRNA 2NVTJ 2CQXA 1R9TJ 4NDLA 4NC6A 2VT3A 4OWRB 5IT9Z 2LR8A 3H1CA 4C2MJ 4UXNA 4PDKA 1JUSA 3HDDA 4C3JJ 1JXSA 2DQRA 3ZQHA 2V79A 2ETHA 1AKHA 3WGIA 4LG3A 1B1BA 2Y0SN 3FZVA 3HKZN 2J5OA 4B44A 1LDKB 1VTNC 1J5YA 1FLIA 2E34A 1YS7A 4PCQA 3JRBA 1Z1DA 2KRCA 1LPQA 2X6YA 1E3PA 1L0OC 2V7FA 3A0HC 2OU2A 3CUQA 1VQMI 3RTRA 2R7FA 2X6WA 1MJ9A 2Q0OA 4L5JA 1XSDA 1X3UA 1JKOC 1YS6A 4M71A 2EH3A 2YX4A 2IS2A 1BOAA 3GZ5A 3HB9A 1ETWA 5KAIC 1Z3XA 1I6HJ 3TO6A 3L7WA 2P5KA 2BVLA 2VQCA 3E7LA 5LGTA 4RB3C 1IF1A 5J47A 3ASOH 4XLAA 4XOTA 1A36A 1PVEA 4AIDA 4A93J 2L4AA 3W2WA 1MNMC 2PJRB 2GOMA 5GAEJ 4IJAA 3L2UA 4I98B 1AOYA 5ILUA 3GFMA 5JVTA 2NRAC 2YR2A 4C9YA 4KYWA 2JSCA 3K4CA 1WFXA 1YX3A 3PFIA 3CCEI 3OYLA 3H35A 1ON1A 2KHMA 1GV2A 2G0EA 2F6CA 5L3GA 1U5TB 1WH5A 1WJAA 1FOXA 1S7OA 3FDYA 2R0QC 4ZYAA 1FP2A 2MLGA 2M45A 3QYBA 4V2GA 1F4KA 2LY1A 3E6MA 3S2DJ 1O7LA 3S32A 3TOAA 2XF5A 1GVJA 3VDXA 4Y15A 4CZZA 2K02A 4BEHB 4Y52J 4RB2C 1HW2A 2MW8A 2KQRA 4PFOA 4IHTA 3IHUA 1P9QC 4PGGA 3IAS2 1WJBA 2IA1A 4LFUA 1SVMA 1ITYA 1S8NA 4B8XA 2A05A 3H0GJ 2B63J 4A69C 3WG9A 4RAFA 3CDIA 2K85A 4M3GA 2JUCA 1K78B 1SAUA 1EA3A 3KZZA 4MGRA 4XK4A 5JR3A 1LFBA 2K9QA 5ED4A 3AG1H 4PFPA 1XSXA 2Z16A 3ABUA 2JPBA 1TL8A 1BIBA 1BC8C 2BY2A 2E7XA 2OZUA 3I3LA 3KP4A 1LFPA 5B3SH 2OPTA 4DZJA 2PMHA 2Y2ZA 3ECOA 1Z05A 2EZIA 3BG6A 4HX4A 1P92A 3MVPA 3TQNA 4ZYGA 5FLXZ 1NH3A 2COBA 2VQLA 2GXAA 3D0SA 4JOMA 3K4JA 3CESA 4F92B 1RR7A 4JQFA 5AIPA 2NNYA 1YIOA 6PAXA 1D0XA 1ETXA 1O4XA 1M1EB 2IGNA 2V6CA 2M30A 4EVIA 2HXOA 2OZ6A 3NQOA 4HV5A 3ABTA 1FX7A 2CG4A 5D6EA 4WK8F 4XR6A 2LTPA 2P7CB 5LEKA 3GW2A 3HRSA 3CCMI 3K4MA 3ABMH 3DXJF 2J5PA 1E0EA 1O3RA 1YRNB 2HDWA 1OR7C 4BQNA 3LSMA 3BR5A 3K4NA 2R7TA 2KJBA 5CVRA 2XPVA 3DPTA 2W4SA 1R58A 3CCJI 3H0DA 2BOLA 4F93B 1POGA 2ZSHB 4IHYA 2DA2A 4I99C 2LYCA 1R00A 1TTYA 4AC0A 1S5LC 2DOAA 3C18A 4GRIA 1EH6A 2P5VA 2OAZA 4MQ9F 1MKMA 3BZKA 1Z91A 1VQOI 5CLSA 2HQAA 2LK2A 4BHBA 3CMYA 2H27A 4GFBA 1P6RA 4Y4RA 3G73A 3ZN1A 2DA4A 1BN5A 2W82A 1R36A 1UG2A 3MKWB 2VIXA 1RUNA 3HTSB 5EEAA 2WC2A 2QZ8A 3BR3A 3RYRA 1FSHA 3K2ZA 1LUJB 5CVVA 2IS4A 3FHZA 2ECBA 4RM2A 3BPVA 4CO8A 1OR7A 3CCLI 1ETYA 3AL0C 2BVMA 2HS5A 4OIOF 1H0MA 5FFZA 2OTJI 2DK5A 3ZQLA 3JW4A 3L9FA 2QM3A 1KONA 2M5WA 5GAGJ 1TT5B 4KIBA 4MTEA 2ME6A 1OKRA 2NXNB 4YIIA 5KNLA 1ZQ3P 2DOEA 3WODF 3NEUA 4V2FA 1GDTA 5BPIA 4HRIA 3H9QA 3GX4X 1QPIA 5BPDA 1T6SA 2EB7A 3J81Z 3BG3A 4CYCB 3IH2A 4Z6YA 3AKZA 1GXPA 5E3MA 3EYIA 1JUMA 1EF4A 4A3BJ 1R1TA 1R1VA 1IRGA 1I3QJ 2JVGA 2P4WA 3O3KA 1B8IB 2EIKH 2X9DA 1P7JA 4C3HJ 1T39A 2VJJA 3ZRGA 2N8GA 1FSEA 2M0MA 1XGOA 1KU9A 3M4OJ 2R3SA 3J80Z 1BJAA 4M73A 2D5VA 4E7ZA 2WTEA 1ZRCA 4M3DA 2LKXA 1FYLA 2F5CA 1MMNA 1XDUA 4E7HA 4L9TA 3B6CA 3BG9A 1A5JA 5L3CA 1MSEC 3RSNA 3PO3J 2R93J 3FXLA 4Q4ZF 1HW5A 1Q1HA 1JT0A 4BL0B 1NK3P 3ZQFA 1K83J 3EQLF 1BBYA 2ICWG 3IKVA 1TNTA 5DCMA 3E0JB 2DMQA 3AG3H 1REPC 2CUZA 1ETOA 4PGHA 2L9VA 4M3BA 2E1MC 3O6BB 2JQ7A 1OJLA 4NQWB 4PUSA 1NTCA 3CD6I 3CCRI 3HZJA 1YIJI 1PUFA 5DV5A 1MJAA 2L4MA 4NC8A 1SD6A 1TT0A 2QQBA 2K86A 3OMYA 2H6BA 2KL4A 4XLPF 4L5EA 4P96A 5TJJA 4E7SA 5B66C 1OPCA 2XF7A 1J9IA 1X19A 1Z6RA 4ZTFA 2HPMA 2M87A 4EATA 2KPMA 1I3AA 5J1RA 2ZMEB 3BWGA 3ECHA 3JRIA 1YFHA 5LLQA 4DOZA 3F6VA 3HBLA 3VODA 4Q48A 3LSRA 5EJCA 1BI1A 3VYUB 1TWFJ 2A61A 1VQLI 3L2VA 3PNTA 4RGUA 4OMZA 2BXYA 3LQQA 3OIOA 3JRGA 4XKBA 2CV0A 2NOJB 1D3YA 5CQEA 4A2UA 4HA8A 5K7HA 4JX6A 4YRVA 5M5XJ 3RPUD 2LMDA 3MMYB 5FD6A 2EBIA 4N4OB 1CGPA 3CDHA 5HDKA 3K0LA 2ADUA 4F3QA 4Y33A 4I0BA 2GA1A 3REOA 1DU0A 2FSWA 5J4YA 5EG0B 2JA5J 5FD5A 1R5GA 5GTIC 3F8CA 3ZQQA 3NARA 1D0ZA 3HYIA 5FFXA 3NWSA 1MBKA 3K1NA 4GYGA 2R5ZA 3PL8A 5BNGA 4A3CJ 3KEOA 2F4OB 2XGCA 1XGMA 5H6QA 1KU2A 4IZZA 2M8GX 4UV9A 2GAUA 2PBIA 2TDXA 3MN2A 3A2KA 2DLLA 1W5TA 2L2OA 2WBMA 3DTEA 1UG0A 3OYFA 5JVGF 2RAEA 4I7HA 5E8GA 1ZG3A 4FE4A 3Q3SA 1SD5A 1IJWC 3KP2A 3VPRA 1T0FA 2W85A 2WAQN 3B6AA 2XDVA 1LKXA 3V7CA 2BW3A 1UHWA 2VPLA 4AUXA 5HVQC 4M6XA 1ZG5A 4BEHA 2ESNA 3PIPF 3PQKA 4CUGA 1WKMA 5J8FA 3I59A 3W6JB 1G2HA 3BTCA 2M7AA 3EDPA 3P9CA 2F5DA 1JJ8C 3LFKA 2KLOA 1VQ4I 2XAJA 2QQ8A 1ZRFA 4OOIA 1J0RA 1HQCA 1ZK8A 2A68F 3BR1A 1VQPI 3OOPA 5J4VA 5C4XJ 2BXZA 3F8NA 5KVRA 4HEA2 2JTVA 1HDDC 3S15J 3LWFA 3PNVA 3M1EA 3H5NA 1XMKA 2XPUA 2EV6A 3ABKH 3HOSA 3S3MA 1TWHJ 3PIOF 4YEJA 2R4GA 1MJBA 3DTIA 1K61A 1VI0A 3L2CA 3OIQA 4ZZDA 3MAJA 3NAUA 1IDYA 2NOGA 2MH2A 4FX0A 4P9UA 4GGGA 4B3XA 1ZARA 4P9FA 1U78A 1VQ5I 4B09A 1SFXA 3I53A 1LDDA 3H9GA 5E3OA 3J80K 1R6RA 5CKTA 2ZO4A 3DEUA 2LFBA 4GO1A 4JX4A 4DNCA 3PUBA 4A0XA 1MBJA 4A3KJ 1HBXG 3RQIA 2DDBA 3HRTA 2M34A 5E8IA 3OYIA 3KZIC 2JT1A 1IN8A 3TW7A 3GF2A 3B02A 1P7IA 3CZ6A 4WCGA 2LDUA 3RJPA 2DW4A 1QZEA 4M6VA 3JAMZ 4PJMA 5EYRA 1AWCA 2P6SA 2VC1A 2O3FA 3VSLA 2ZJPF 4ZYEA 3MKYB 4ZZLA 3M3YJ 4NUBA 3MD2A 3PSFA 2ZB9A 5CQGA 2O5RA 1KU7A 2F5VA 3KZYA 1RPWA 1SVLA 4QPQA 5C4JJ 3OYAA 1HKTA 1LDJA 1DGWY 3SJMA 5HODA 4WXDA 2EA4A 4U0YA 4F52A 3SFIA 3MZYA 5LGNA 2STWA 4HLYA 3BZCA 2I8DA 2UV1A 5GPAA 1RESA 1ZTRA 1W36C 2LH9A 1UZCA 4HSTA 4XRMA 2ZFUA 3RCOA 2DN0A 2KRFA 3KLOA 3CO6C 2IRFG 1W7PD 1RNLA 2R7OA 3GXOA 5J3LA 3TKYA 2FEZA 2KISA 2H09A 2CUJA 4ESFA 5LBQA 4BHCA 3V7SA 2F5FA 1YW8A 3TP3A 4E7LA 2KJCA 3DEEA 3F23A 4CDGA 3L00A 4BXUA 5CVUA 3Q5FA 1R49A 3VYTB 3U1KA 4LK0F 1YRNA 1F9NA 4QLCU 5F1JA 5AIQA 4M3FA 5IOYA 4OMYA 1V5EA 1KZHA 3BR6A 5HNFA 2VQHA 2W1OA 4ZDOA 1P4XA 3CMEI 3I56I 5FLVA 1ZH5A 3FBNB 1B9NA 2NS0A 2D1VA 1WH7A 2FOWA 3TO7A 5IP9J 5L3EA 4B4CA 4LJZF 3F8MA 4N4NB 5JHUA 2D45A 2R7RA 3R0JA 2Q2EA 5E1XA 3DTKA 3PFYA 2ACJA 1QVTA 1GXQA 2KIQA 1IW7F 2XF6A 1LVKA 2VL8A 1X58A 2RN7A 1T08B 2EINH 3G1OA 4ESJA 4B48A 2L9RA 2COMA 3OYDA 3H9JA 4XLEA 3CMAI 2KIUA 3P7NA 2IT0A 2FJ1A 3IRRA 4I02A 4J00A 3SFZA 3GTQJ 4YFKF 2IGOA 1ZREA 3LA2A 3SEQA 3ABLH 1IN4A 1KU3A 4KDPA 2UXXA 3HOZJ 5BMZA 5DS9A 3CTAA 2CV2A 1D5YA 4DW6A 4MEXF 1ZGAA 1HF0A 4KIGA 3QPHA 3FBIB 4PSXA 3CC7I 2ZBKA 2OD5A 3LFUA 5CVIA 4RB0A 2A5YB 2KZGA 1D5VA 3CQZJ 4BKXA 1I27A 3B73A 3U21A 4B3AA 4BDYA 4JX5A 2F2EA 5D4RA 4MQVA 1BW6A 3KEQA 2ZNYA 1ETQA 1J75A 2PX9A 2W25A 2KIMA 2EPFA 3AAFA 3HIFA 1FYMA 2Y48A 2IVMA 2NS7A 1H89C 4FHTA 3OIPA 5IYBJ 2AQEA 4DGWB 5IYCJ 2LP0A 3G4SI 2OJED 3VB2A 1SD7A 3LSIA 3LQRA 2K9MA 2VOPA 1FMWA 4MFDA 4UUTA 3ERMA 3JAMK 2IP2A 4AU7A 4QWQA 2VBXA 3CUOA 1XDSA 1GHCA 1T56A 4XSXF 4CCOA 3PJRA 3FK7A 2XHKA 5DCFA 2YSRA 5GP9A 3P5JA 2E1CA 1S7EA 2ZXWH 1A04A 2KRHA 3M1CA 1K4SA 2VKHA 4LK1F 1FOWA 1QHGA 5IPAA 4YG2F 1I1SA 1BR1A 5D5UB 2IBDA 3EUHA 5HLHA 5KAFC 3D1NI 2R5YA 2XGDA 2A5WA 2BY3A 3ZXSA 3CCUI 1UFMA 2ZXJA 4BJTA 2E2HJ 3I4NJ 4HQEA 3JRAA 3C2GA 2IEKA 5DD8A 4E7IA 1IO2A 3S1RJ 4C2UA 3MWMA 1OCZH 1XB4A 3BOQA 1Z9CA 5D5WB 2WAEA 2O0YA 4MTDA 1ONVA 1X2NA 2QVOA 4WXHA 1ZYRF 4IOAF 4XLNF 2EFQA 2CQKA 5D5XB 3GTLJ 4HZFA 3ZP5A 3H5RA 2L7FP 2H8WA 1PYVA 2ISYA 4L5IA 2XKPA 3EYYA 1MBGA 3BZ6A 2OTLI 2JA6J 3C2HA 2H94A 4HAMA 2XIGA 4EM0B 2LG4A 5ILVA 2KDZA 5EDNA 4RAGA 5DEQA 2LRDA 1FC3A 1OQYA 1XX5A 3WTUC 4EEFG 4KMFA 5JHFA 1D1AA 5FKMA 2P8TA 5LFAA 2L9SA 2BE5F 2IA2A 2VQGA 3D5SC 3K4KA 2CMPA 4ON0A 1TP4A 1KGSA 4P5OA 3QRFF 1GV5A 2EFPA 2FQ3A 3IH4A 1DP3A 1X1DA 3DBHB 4A0ZA 3OYKA 4Y17A 3TL4X 2ZJ2A 5E1WA 1HKQA 2L7ZA 3N05A 2RV8A 2JRMA 1RUOA 1RC9A 2ELJA 2V1UA 1X4OA 2FNAA 2BW3B 3CUQC 1V54H 4PK4A 5F08A 3D5RC 3JSOA 1YJWI 4UB6C 3GBGA 3HKZA 4D5CA 3VWBA 3DEWA 2ELHA 4S04A 2HI3A 2HVSA 2NS8A 2YU9J 1N78A 2WB1A 1NHAA 2DFEA 4HPQA 4ASNA 3VYSB 1WGXA 3CLOA 2VUMJ 2ZMEA 3JTHA 3OYGA 4O5VA 1YI2I 3LA7A 3GUDA 2IXSA 4C3IJ 4XKCA 1Z0XA 3BCAA 5DCMB 3QWLA 3KLNA 3O8GA 1FOYA 3JSPA 3CLQA 2GXBA 2PG4A 1HDPA 2BV6A 5IP6A 1FIPA 5FJ8J 3M07A 3MCZA 4W1UA 3WTWC 3FMSA 1LEAA 1B59A 2RVCA 3FMQA 3CP8A 4W97A 4IVNA 4DYCA 3GTPJ 2V4JC 2PN6A 4IO9F 2E71A 1FZPB 3ZOBA 3T5XA 2JMWA 3HRMA 1E3HA 3BTIA 2O8XA 3BR2A 4AWXB 4HDVA 5EGOB 2UXNA 5AONA 5JLXA 3HL2A 2VJ4A 1B72B 3QU3A 5L3FA 2YPRA 1CF7A 2L7KA 2XASA 5F0CA 2AS5F 4XNFA 3J7YJ 2HQRA 4NHJA 3LSPA 3G6EI 3K70D 3T1BA 4RAYA 5L3BA 1WZ2A 5M5WJ 4LG0B 2V6EA 3RKYA 3QAHA 3DP7A 3J7ZI 4AYBA 4KNYA 4BQQA 2ID3A 4PJ0C 3GO5A 3OS0A 1J59A 2IJLA 2R7ZJ 1IG7A 1S6LA 2XB0X 3HOYJ 4QSHA 3GTGJ 5C44J 1UJ8A 3JTGA 1JT6A 1MIJA 2VASA 1GLNA 4MO7A 4S05A 5BOXA 2CH0A 1F5TA 4CHUA 4P55A 4BS9A 1BR2A 1VZ0A 5F1RA 3FXQA 1BIAA 4LIUA 4BXFA 2FRHA 2Y75A 3I59B 2HVRA 3QYEA 1LVAA 5F0FA 1IUYA 2ZJQF 3TO9A 4O3MA 3BJAA 2R5YB 3GTKJ 3VOEA 2WB1N 1X4PA 2XKOA 3K2AA 2XAHA 3BPXA 3K4LA 2DXIA 3S3NA 4LIVA 3KYCB 2RGVA 3K1PA 4PSWA 1W1WE 4G6TB 4R1HA 2RNJA 4XL9A 2UUZA 3NRVA 2PMZN 5A2QZ 2YUSA 2D2WA 3FX3A 3MKZA 2MABA 1SAXA 1XMXA 2WAQA 1IXRC 4ABZA 1YJ9I 3FWEA 3RKWA 2HOSA 5HS7A 3S1NJ 3HG9A 4CYCA 1ZHFA 3GCMA 4HNUA 3G1MA 2TRTA 3FXUA 3SDBA 3CO7C 2A6HF 1R1UA 3SDGA 3QPTA 4G12A 2K4JA 2FBIA 2GA2A 3L2RA 1N75A 2JSPA 3SZGA 5LD2C 3C7JA 1JKPC 2LY9A 3NWTA 1EH8A 3IH3A 2V26A 5LGUA 2DMUA 5K7FA 3K6GA 4EQQA 2ZXIA 4AVPA 2Y9YA 3ZMDA 2UZKA 1Y1VJ 3U1DA 2DFFA 4G94A 3O8HA 2QSFX 2QLZA 4LGWA 3WTTC 1WJDA 2EFWA 4KICA 4RLFA 2FMYA 1T0FC 3I4MJ 1SVOA 3L2WA 3OYEA 3S16J 1YQAA 3I58A 2LKSA 1BJZA 1F1ZA 5H2FC 4A3GJ 5LEJA 2XRLA 2E36A 4A0YA 3LSKA 4RM3A 3WTSC 2ME0A 1V5GA 3DKYA 1SC7A 2QBYA 2AO9A 2X48A 5HLGA 3HSFA 3RDIA 1SD4A 3CCSI 4EGYA 4BACA 1ZLKA 3HOWJ 2IA0A 5HS9A 3ZN0A 2STTA 2YS9A 3M9AA 1NG6A 2CYYA 3OYJA 5B5EC 3ZQGA 3E1SA 1MD0A 5E1ZB 4BGDA 2K3PA 5DYMA 2LBFB 1FOKA 2LSOA 2ZJRF 5FO5A 5FLMJ 3KIOA 3RZOJ 3G3ZA 4KJZA 2HDDA 3DQVC 4MLOA 3K10A 1O7FA 5GADJ 1IRXA 5E18F 1ON2A 1U9NA 2A69F 4XORA 1UAAA
chains in the Genus database with same CATH topology
4UVCA 4CXFA 1S7AA 2E7WA 2HKXA 1RI7A 4EM1A 3GFJA 4IRIA 1MZBA 5FLXK 4MNUA 3KP3A 2CWEA 4D0PA 1ZLJA 2XVCA 4GXOA 4EMSA 1KA8A 1JHHA 1XCVA 4FX4A 3T0YA 3FF5A 2DBBA 1PUEE 3WTVC 1LNWA 4U7BA 1LQ1A 2FE3A 3TOBA 3RI4A 3H3UA 1KQ8A 2V9VA 2M1BA 1TQMA 4H0EA 3ZMTA 4EM2A 4HF1A 1W4MA 5CJ9A 5BS6A 3EETA 3E6CC 3HTUA 2HDCA 3E3VA 1QBJA 1FP1D 2XAQA 4O6JA 1HW1A 1IXCA 4I0AA 4KT5C 2HTJA 3E5XA 2H6CA 2L54A 1DDNA 2X0LA 2QYOA 3ZQ7A 2EFNA 1UB9A 1Y0UA 1K6OA 5D6FA 2HTSA 3M7GA 1CF7B 4EJOA 4M74A 1BI3A 3GZ6A 1DP7P 2Z33A 2EFOA 3KP7A 1PDNC 3HRUA 1QGPA 4JK1X 4YFNF 4HBLA 2FOKA 1L3LA 3BP8A 3I0TA 2L3DA 1V3FA 1D8JA 2DTRA 2C6YA 3DPLC 5LRRA 1U2WA 3KP6A 1TQIA 2QENA 3WU0A 1XD7A 5DUKA 1P4AA 1ZRDA 2DI3A 4N9HA 2FMLA 3I71A 1SMYF 2W57A 2VE8A 3BROA 5DD4A 3Q9VA 3O2PE 5J6XA 4UVBA 2EWNA 3GYHX 2GXGA 2XAGA 1TW3A 1O3TA 4ZYHA 4LB5A 5K1YA 2KKOA 5HDNA 3N97A 1K7AA 4I01A 1ODDA 5ILSA 1TLHB 2K4BA 3H92A 5J8CA 2FBKA 3E5UA 4XSZF 1P4WA 4RGRA 2QQAA 4MEYF 2LKPA 1DPUA 1V4RA 4HLXA 5D8LB 1WWXA 4LLLA 4OINF 1G3WA 4EV0A 2M8EA 1J2XA 4L9NA 5H6RA 1XCBA 4I2OA 3LAJA 1SFUA 2XROA 1FNNA 2O61A 2NAZA 4G6QA 1EV7A 2O03A 5D8KB 3R61A 1G3TA 4CYDA 2EA2A 2PQ8A 2Z99A 4KUMA 4KN4X 3SQNA 3HUGA 2P5LC 2CO5A 1MDMA 3GFLA 1G3SA 3I5UA 1IRFA 2BBYA 2CSOA 4MHGA 2KIFA 1KQ9A 4IRGA 2OQRA 1K79A 3LA3A 4NQWA 2DAOA 2XGXA 2EJRA 3E6BA 2WWYA 4IPAA 2MLKA 4WWCA 1YG2A 3WTYC 3BY6A 4YIFA 4IRHA 1QZYA 2K27A 3MQ0A 2MBFA 4YFXF 4K2EA 1S29A 2PJPA 5EEHA 1FBSA 3BJOA 4U7DA 1C0WA 1YTYA 3FM5A 3E6DA 4OU0A 2HGCA 2QQ9A 3HOTA 1IN6A 3M8EA 2A07F 1YYVA 4LD5A 2BYVE 1K78A 4EJUA 2DT5A 2VT2A 2DK8A 1Z7UA 3ELKA 5F64A 3ZMSA 3HSEA 3LAPA 2RC4A 2DPUA 2EV5A 2RKHA 2PI0A 3DF8A 5LHHA 1YO5C 1MDMB 2MH9A 2Q8KA 3QOPA 2FXAA 4ENKA 1XMAA 2YU3A 4WF2A 1BM9A 4EJVA 3GVAA 4DQ2A 4LB6B 1I1GA 2V1XA 2P7VB 3ULQB 4BYYA 4KA4A 1B9MA 1O3QA 4EGZA 1P2FA 5K5QA 1E17A 4AD9A 4WX9A 1JHFA 5HS8A 4F7ZA 1XN7A 5ICFA 4G7ZF 4IHSA 5LRSA 2NNNA 4IXAA 3RIRA 1B4AA 2VBYA 2OQGA 5BQTA 4Y13A 2DQLA 3DV8A 2L02A 4HX8A 1JGSA 1IN5A 3U9GA 2IPQX 5ICGA 4NB5A 1WI9A 3TGNA 3KFWX 4XRFA 4OIQF 1G3YA 4M9ZA 3WE2A 1J7KA 3COAC 2FA5A 3RPUA 1SFEA 1IN7A 2CW0F 4G7OF 3VFZA 5LHIA 1XGSA 1PP7U 3D5LA 1H9GA 3L09A 1LB2A 3GWZA 5A2QK 3ERED 4M9SA 3FM3A 1QPMA 2RQPA 2FNPA 2BEOA 4ZH4F 1W7PB 2XAFA 1JE8A 2ZNZA 5ICCA 3QP6A 3VEPA 2VBZA 3ZMUA 3SZTA 4HF2A 4AIJA 3F3XA 4G9YA 1Z6TA 4LG0A 3OV8A 2W24A 1I6XA 1OYWA 1R23A 3F21A 3TDZC 4L9VA 4ESBA 2ZKZA 4HQMA 1MGTA 4U88A 1QO0D 1STZA 1U5TA 2DFIA 2PMUA 1QQIA 4M9XA 4FT8A 4HV6A 3ZPLA 3IL2A 5CYVA 1XSVA 2OBPA 3U2RA 2GZWA 2LF8A 4BAYA 4Z2YA 2MA3A 5DDGA 3F22A 3C3WA 3F6OA 2RDPA 2QUFA 3I4PA 1G6NA 5K5OA 3IC7A 3GEZA 3P9IA 3I64A 2GIVA 1WRJA 3F8BA 1BC7C 2Z9OA 2PFBA 4BNCA 1FY7A 5FGMA 3R0AA 2G7UA 2R7DA 2NYXA 3GLXA 4RGXA 4UUVA 1DPRA 4G7HF 1W7PA 4R79A 4LLNA 4Q5SF 2Z3YA 3F8FA 4A6EA 4ENNA 3K69A 3V7RA 5ERIA 4UHTA 2D1HA 5JFRA 4TV7A 4E70A 2HKOA 3IRQA 1YLFA 3F72A 4R8HA 1BI2A 4RB1A 3GFIA 3IWFA 1G4DA 4XBFA 4A12A 2W84A 4L9JA 1R22A 4EJWA 1FYKA 1OMIA 3V4GA 1HXDA 5L3DA 3RYPA 5IT9K 3WGHA 2JRTA 3MZHA 2HZTA 2XV4S 1FBQA 2YX7A 2OA4A 2IW5A 4L18B 2E1NA 3FMRA 2HFHA 1E2XA 4I09A 1TQPA 4N9IA 3ML6A 4GCVA 4HDUA 4WXCA 2L01A 4ENMA 5EEGA 3KCCA 4JBAA 2Y0MA 1KYZA 3QU6A 1YW7A 1SMTA 2XUBA 3ZMZA 5HLIA 2LNBA 1OYYA 1ZGJA 4M6YA 1ULYA 5LHGA 3KETA 3DFGA 3Q9SA 3TDUC 5D4SA 1QNTA 1U5TC 4L0YB 1IAWA 2HYFA 1EH7A 1XGNA 3I54A 2CFXA 2EK5A 2VODA 5DUIA 5ICEA 3ROUA 3V8JA 3BDDA 2PEXA 4RAZA 1DUXC 4Q47A 1W5SA 5H20A 5IT3A 4ZYDA 1T98A 1ZN2A 1TNSA 3V8LA 3C1DA 4U0WA 2LF7A 2HYGD 2MC3A 4BH9A 2ESHA 1FBUA 3WU1B 1FPQA 5K5RA 1D8KA 1S3JA 3H3ZA 2VE9A 4OIRF 4UV8A 2GWRA 1UCRA 4CICA 3R60A 2DU9A 3LSTA 1HSTA 2QBYB 2P6TA 2K7LA 1ZG1A 4BQAA 3W6KB 2A6EF 1ZAOA 3ISPA 4KMUX 2ZFWA 3CUQB 3M8FA 1I5ZA 4AIHA 3T8TA 2F5EA 5CVJA 1UHMA 4L0ZB 3J7AO 1YW9A 4RS8A 2FU4A 1B6AA 4HOBA 3S2WA 5TRDA 4N0BA 4PZJA 4LMYA 2DPDA 3SHFA 5HDGA 2Z5UA 3BJ6A 1H9TA 4HW0A 2MD5A 1O57A 2FBHA 3P9KA 2BGCA 1T2KA 3E5QA 4BHPA 4U0VA 2HEOA 4AIKA 2B0LA 5HOOA 1T38A 3E97A 1RZ4A 5KK1A 3WTXC 3KE2A 3IKTA 2G7HA 3SXYA 4OIPF 3R6SA 2AXLA 3R4KA 3K1MA 2UWMA 5F6FA 2PLYA 5JI6A 3HSRA 4EJTA 4LLGF 3KP5A 1USSA 1WQ2A 1R7JA 1FT9A 3WGGA 2HQNA 1BI0A 4RGSA 1OYIA 3HHHA 2ZCWA 2GQQA 2JZYA 3ZMVA 2WV0A 3J81K 2DO7A 2HR3A 1LEBA 2O6GE 5FB2A 2V1DA 4A5NA 1R5HA 1U8RA 2G9WA 4KFCA 1TBXA 3QP5A 1HKSA 1KYWA 1IXSB 3WE3A 1PP8F 4A6DA 1U6GA 4CGZA 2VBWA 2CGPA 4KIFA 2VONA 2A3SA 2VXZA 1O3SA 1U3EM 3WTZA 4G6DA 4A5MA 5E20A 4HYEA 4ETSA 4KN7X 2HWVA 5E17F 3HHGA 1FWZA 3MEXA 1LJ9A 3IWZA 1WSUA 2QWWA 2X4HA 3FXRA 1QZZA 2VOOA 1RIOH 2JPCA 5D5VB 4ENJA 1KQ0A 3SZPA 3DKWA 4IF4A 3K9TA 2FF4A 2ISZA 3MFKA 2EV0A 4UVAA 4G8XA 2VN2A 3N4MA 3RKXA 4HX7A 1IZ1A 2VC0A 4HF0A 4UNOA 1TW2A 3V8KA 3T8RA 3PQJA 1HSJA 4M72A 3CJNA 1USTA 3RPQA 2HOEA 4GYIA 2XRNA 2VT3A 5IT9Z 4UXNA 4PDKA 1JXSA 2DQRA 2V79A 2ETHA 3WGIA 1B1BA 3FZVA 2J5OA 1LDKB 1VTNC 1J5YA 1FLIA 4PCQA 1YS7A 1Z1DA 1L0OC 2OU2A 3CUQA 3RTRA 2R7FA 1MJ9A 2Q0OA 4L5JA 1XSDA 1X3UA 1YS6A 4M71A 2YX4A 1BOAA 3GZ5A 3TO6A 3L7WA 2P5KA 5LGTA 1IF1A 4RB3C 2L4AA 4IJAA 4I98B 1AOYA 5ILUA 3GFMA 5JVTA 2NRAC 2YR2A 4KYWA 2JSCA 3PFIA 1ON1A 5L3GA 1U5TB 1S7OA 1FP2A 2MLGA 2M45A 1F4KA 3E6MA 1O7LA 3TOAA 1GVJA 4Y15A 4CZZA 2K02A 4RB2C 1HW2A 4IHTA 3IHUA 4PGGA 2IA1A 4LFUA 1S8NA 4B8XA 3WG9A 1K78B 3KZZA 4MGRA 5JR3A 5ED4A 1XSXA 3ABUA 2JPBA 1BIBA 1BC8C 2E7XA 2OZUA 3KP4A 2PMHA 3ECOA 1Z05A 4HX4A 3TQNA 5FLXZ 1P92A 4ZYGA 3D0SA 4JQFA 5AIPA 2NNYA 1YIOA 6PAXA 2V6CA 2M30A 4EVIA 2OZ6A 3NQOA 4HV5A 3ABTA 1FX7A 2CG4A 5D6EA 4WK8F 2P7CB 5LEKA 3GW2A 3HRSA 3DXJF 2J5PA 1O3RA 2KJBA 5CVRA 3DPTA 1R58A 1R00A 1TTYA 3C18A 1EH6A 2P5VA 2OAZA 4MQ9F 1MKMA 1Z91A 5CLSA 2H27A 4BHBA 1P6RA 3G73A 3ZN1A 1BN5A 1R36A 1RUNA 3HTSB 2WC2A 2QZ8A 3RYRA 1FSHA 3K2ZA 5CVVA 3FHZA 3BPVA 4CO8A 1OR7A 2HS5A 4OIOF 1H0MA 5FFZA 2DK5A 3JW4A 3L9FA 2QM3A 2M5WA 4KIBA 4MTEA 1OKRA 4YIIA 3WODF 3NEUA 5BPIA 3GX4X 5BPDA 1T6SA 2EB7A 3J81Z 1GXPA 3EYIA 1IRGA 1R1TA 1R1VA 2P4WA 3O3KA 1T39A 1FSEA 1XGOA 1KU9A 2R3SA 3J80Z 1BJAA 4M73A 2WTEA 1ZRCA 1FYLA 2F5CA 1XDUA 4L9TA 5L3CA 4Q4ZF 1HW5A 1Q1HA 3EQLF 1BBYA 3IKVA 1TNTA 5DCMA 1REPC 4PGHA 3O6BB 5DV5A 1MJAA 2L4MA 1SD6A 2QQBA 2K86A 2H6BA 4XLPF 4P96A 5TJJA 1OPCA 1J9IA 1Z6RA 2M87A 2ZMEB 3BWGA 3ECHA 1YFHA 5LLQA 3F6VA 3VODA 4Q48A 1BI1A 2A61A 4RGUA 4OMZA 3LQQA 1D3YA 4A2UA 4HA8A 5FD6A 1CGPA 3CDHA 5HDKA 3K0LA 2ADUA 4I0BA 2GA1A 3REOA 2FSWA 5FD5A 1R5GA 3F8CA 3HYIA 5FFXA 3K1NA 4GYGA 3KEOA 1XGMA 5H6QA 1KU2A 4UV9A 2GAUA 2PBIA 2TDXA 2DLLA 1W5TA 4I7HA 5E8GA 1ZG3A 1SD5A 3KP2A 1T0FA 2W85A 3V7CA 1UHWA 5HVQC 4M6XA 1ZG5A 2ESNA 3PQKA 1WKMA 5J8FA 3I59A 3W6JB 3EDPA 3P9CA 2F5DA 3LFKA 2XAJA 1ZRFA 4OOIA 1J0RA 1HQCA 2A68F 3OOPA 3F8NA 5KVRA 2JTVA 3LWFA 3M1EA 1XMKA 2EV6A 3HOSA 1MJBA 3L2CA 4ZZDA 3MAJA 2MH2A 4FX0A 4P9UA 4GGGA 1ZARA 4P9FA 1U78A 4B09A 1SFXA 3I53A 1LDDA 3J80K 4DNCA 2ZO4A 3DEUA 4GO1A 1HBXG 4A0XA 3HRTA 5E8IA 2JT1A 1IN8A 3GF2A 3B02A 4WCGA 2LDUA 3RJPA 2DW4A 3JAMZ 1AWCA 2P6SA 2VC1A 2O3FA 4ZYEA 4ZZLA 1KU7A 3KZYA 1HKTA 1LDJA 4WXDA 2EA4A 4U0YA 3MZYA 5LGNA 2STWA 4HLYA 2KRFA 3KLOA 3CO6C 2IRFG 1W7PD 1RNLA 3GXOA 3TKYA 2FEZA 2H09A 4ESFA 5LBQA 4BHCA 3V7SA 2F5FA 1YW8A 2KJCA 3F23A 4CDGA 3L00A 4BXUA 5CVUA 3Q5FA 4LK0F 1F9NA 4QLCU 5AIQA 4OMYA 1P4XA 1ZH5A 1B9NA 2NS0A 2D1VA 3TO7A 5L3EA 4LJZF 3F8MA 5JHUA 2D45A 3R0JA 2Q2EA 5E1XA 2ACJA 1GXQA 1IW7F 2RN7A 4ESJA 2COMA 2KIUA 3P7NA 2IT0A 3IRRA 4I02A 3SFZA 4YFKF 1ZREA 3LA2A 1IN4A 1KU3A 4KDPA 2UXXA 5BMZA 3CTAA 4MEXF 1ZGAA 4KIGA 3QPHA 2ZBKA 2OD5A 5CVIA 4RB0A 2A5YB 1D5VA 1I27A 3B73A 2F2EA 5D4RA 4MQVA 3KEQA 2ZNYA 1J75A 2W25A 2KIMA 3AAFA 3HIFA 1FYMA 2Y48A 2IVMA 4FHTA 3VB2A 1SD7A 3LQRA 2VOPA 3JAMK 2IP2A 4QWQA 2VBXA 3CUOA 1XDSA 1GHCA 4XSXF 2XHKA 5DCFA 2YSRA 2E1CA 1A04A 4LK1F 4YG2F 1I1SA 5D5UB 3EUHA 5HLHA 1UFMA 2ZXJA 4HQEA 5DD8A 3MWMA 1XB4A 3BOQA 1Z9CA 5D5WB 2O0YA 4MTDA 1ONVA 2QVOA 4WXHA 1ZYRF 4XLNF 2EFQA 2CQKA 5D5XB 4HZFA 3ZP5A 2ISYA 4L5IA 2XKPA 3EYYA 3BZ6A 4HAMA 2H94A 4EM0B 2XIGA 5ILVA 5DEQA 1FC3A 3WTUC 4KMFA 2P8TA 2BE5F 2IA2A 4ON0A 1KGSA 4P5OA 3QRFF 2EFPA 2FQ3A 4A0ZA 4Y17A 2ZJ2A 5E1WA 1HKQA 2RV8A 1RUOA 2V1UA 3CUQC 2FNAA 3JSOA 2ELHA 4S04A 1NHAA 4ASNA 3CLOA 2ZMEA 3JTHA 4O5VA 3LA7A 3GUDA 5DCMB 3KLNA 3JSPA 2GXBA 2PG4A 2BV6A 3MCZA 3WTWC 3FMSA 1LEAA 1B59A 2RVCA 3FMQA 4IVNA 2PN6A 1FZPB 3T5XA 3HRMA 2O8XA 4AWXB 4HDVA 2UXNA 5AONA 3QU3A 5L3FA 2YPRA 1CF7A 2XASA 2AS5F 2HQRA 4NHJA 3T1BA 4RAYA 5L3BA 4LG0B 3RKYA 3QAHA 3DP7A 4KNYA 3GO5A 1J59A 2IJLA 1S6LA 3JTGA 4S05A 5BOXA 1F5TA 4CHUA 4P55A 5F1RA 3FXQA 1BIAA 2FRHA 2Y75A 3I59B 1LVAA 1IUYA 3TO9A 4O3MA 3BJAA 3VOEA 2XKOA 2XAHA 3BPXA 2RGVA 3K1PA 4R1HA 2RNJA 3NRVA 5A2QZ 2D2WA 3FX3A 1SAXA 1IXRC 3FWEA 3RKWA 5HS7A 1ZHFA 3FXUA 3CO7C 2A6HF 1R1UA 3QPTA 2K4JA 2FBIA 2GA2A 3C7JA 1EH8A 5LGUA 4EQQA 4AVPA 3ZMDA 2UZKA 3U1DA 4G94A 2QLZA 4LGWA 3WTTC 2EFWA 4KICA 2FMYA 1YQAA 3I58A 1F1ZA 5LEJA 4A0YA 3WTSC 2QBYA 5HLGA 3HSFA 3RDIA 1SD4A 4EGYA 1ZLKA 2IA0A 5HS9A 3ZN0A 2STTA 3M9AA 2CYYA 1MD0A 5E1ZB 5DYMA 1FOKA 2LSOA 5FO5A 3G3ZA 3DQVC 1O7FA 5E18F 1ON2A 2A69F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVC A;  4CXF A;  1S7A A;  2E7W A;  2HKX A;  1RI7 A;  4EM1 A;  3GFJ A;  4IRI A;  1MZB A;  5FLX K;  4MNU A;  3KP3 A;  2CWE A;  4D0P A;  1ZLJ A;  2XVC A;  4GXO A;  4EMS A;  1KA8 A;  1JHH A;  1XCV A;  4FX4 A;  3T0Y A;  3FF5 A;  2DBB A;  1PUE E;  3WTV C;  1LNW A;  4U7B A;  1LQ1 A;  2FE3 A;  3TOB A;  3RI4 A;  3H3U A;  1KQ8 A;  2V9V A;  2M1B A;  1TQM A;  4H0E A;  3ZMT A;  4EM2 A;  4HF1 A;  1W4M A;  5CJ9 A;  5BS6 A;  3EET A;  3E6C C;  3HTU A;  2HDC A;  3E3V A;  1QBJ A;  1FP1 D;  2XAQ A;  4O6J A;  1HW1 A;  1IXC A;  4I0A A;  4KT5 C;  2HTJ A;  3E5X A;  2H6C A;  2L54 A;  1DDN A;  2X0L A;  2QYO A;  3ZQ7 A;  2EFN A;  1UB9 A;  1Y0U A;  1K6O A;  5D6F A;  2HTS A;  3M7G A;  1CF7 B;  4EJO A;  4M74 A;  1BI3 A;  3GZ6 A;  1DP7 P;  2Z33 A;  2EFO A;  3KP7 A;  1PDN C;  3HRU A;  1QGP A;  4JK1 X;  4YFN F;  4HBL A;  2FOK A;  1L3L A;  3BP8 A;  3I0T A;  2L3D A;  1V3F A;  1D8J A;  2DTR A;  2C6Y A;  3DPL C;  5LRR A;  1U2W A;  3KP6 A;  1TQI A;  2QEN A;  3WU0 A;  1XD7 A;  5DUK A;  1P4A A;  1ZRD A;  2DI3 A;  4N9H A;  2FML A;  3I71 A;  1SMY F;  2W57 A;  2VE8 A;  3BRO A;  5DD4 A;  3Q9V A;  3O2P E;  5J6X A;  4UVB A;  2EWN A;  3GYH X;  2GXG A;  2XAG A;  1TW3 A;  1O3T A;  4ZYH A;  4LB5 A;  5K1Y A;  2KKO A;  5HDN A;  3N97 A;  1K7A A;  4I01 A;  1ODD A;  5ILS A;  1TLH B;  2K4B A;  3H92 A;  5J8C A;  2FBK A;  3E5U A;  4XSZ F;  1P4W A;  4RGR A;  2QQA A;  4MEY F;  2LKP A;  1DPU A;  1V4R A;  4HLX A;  5D8L B;  1WWX A;  4LLL A;  4OIN F;  1G3W A;  4EV0 A;  2M8E A;  1J2X A;  4L9N A;  5H6R A;  1XCB A;  4I2O A;  3LAJ A;  1SFU A;  2XRO A;  1FNN A;  2O61 A;  2NAZ A;  4G6Q A;  1EV7 A;  2O03 A;  5D8K B;  3R61 A;  1G3T A;  4CYD A;  2EA2 A;  2PQ8 A;  2Z99 A;  4KUM A;  4KN4 X;  3SQN A;  3HUG A;  2P5L C;  2CO5 A;  1MDM A;  3GFL A;  1G3S A;  3I5U A;  1IRF A;  2BBY A;  2CSO A;  4MHG A;  2KIF A;  1KQ9 A;  4IRG A;  2OQR A;  1K79 A;  3LA3 A;  4NQW A;  2DAO A;  2XGX A;  2EJR A;  3E6B A;  2WWY A;  4IPA A;  2MLK A;  4WWC A;  1YG2 A;  3WTY C;  3BY6 A;  4YIF A;  4IRH A;  1QZY A;  2K27 A;  3MQ0 A;  2MBF A;  4YFX F;  4K2E A;  1S29 A;  2PJP A;  5EEH A;  1FBS A;  3BJO A;  4U7D A;  1C0W A;  1YTY A;  3FM5 A;  3E6D A;  4OU0 A;  2HGC A;  2QQ9 A;  3HOT A;  1IN6 A;  3M8E A;  2A07 F;  1YYV A;  4LD5 A;  2BYV E;  1K78 A;  4EJU A;  2DT5 A;  2VT2 A;  2DK8 A;  1Z7U A;  3ELK A;  5F64 A;  3ZMS A;  3HSE A;  3LAP A;  2RC4 A;  2DPU A;  2EV5 A;  2RKH A;  2PI0 A;  3DF8 A;  5LHH A;  1YO5 C;  1MDM B;  2MH9 A;  2Q8K A;  3QOP A;  2FXA A;  4ENK A;  1XMA A;  2YU3 A;  4WF2 A;  1BM9 A;  4EJV A;  3GVA A;  4DQ2 A;  4LB6 B;  1I1G A;  2V1X A;  2P7V B;  3ULQ B;  4BYY A;  4KA4 A;  1B9M A;  1O3Q A;  4EGZ A;  1P2F A;  5K5Q A;  1E17 A;  4AD9 A;  4WX9 A;  1JHF A;  5HS8 A;  4F7Z A;  1XN7 A;  5ICF A;  4G7Z F;  4IHS A;  5LRS A;  2NNN A;  4IXA A;  3RIR A;  1B4A A;  2VBY A;  2OQG A;  5BQT A;  4Y13 A;  2DQL A;  3DV8 A;  2L02 A;  4HX8 A;  1JGS A;  1IN5 A;  3U9G A;  2IPQ X;  5ICG A;  4NB5 A;  1WI9 A;  3TGN A;  3KFW X;  4XRF A;  4OIQ F;  1G3Y A;  4M9Z A;  3WE2 A;  1J7K A;  3COA C;  2FA5 A;  3RPU A;  1SFE A;  1IN7 A;  2CW0 F;  4G7O F;  3VFZ A;  5LHI A;  1XGS A;  1PP7 U;  3D5L A;  1H9G A;  3L09 A;  1LB2 A;  3GWZ A;  5A2Q K;  3ERE D;  4M9S A;  3FM3 A;  1QPM A;  2RQP A;  2FNP A;  2BEO A;  4ZH4 F;  1W7P B;  2XAF A;  1JE8 A;  2ZNZ A;  5ICC A;  3QP6 A;  3VEP A;  2VBZ A;  3ZMU A;  3SZT A;  4HF2 A;  4AIJ A;  3F3X A;  4G9Y A;  1Z6T A;  4LG0 A;  3OV8 A;  2W24 A;  1I6X A;  1OYW A;  1R23 A;  3F21 A;  3TDZ C;  4L9V A;  4ESB A;  2ZKZ A;  4HQM A;  1MGT A;  4U88 A;  1QO0 D;  1STZ A;  1U5T A;  2DFI A;  2PMU A;  1QQI A;  4M9X A;  4FT8 A;  4HV6 A;  3ZPL A;  3IL2 A;  5CYV A;  1XSV A;  2OBP A;  3U2R A;  2GZW A;  2LF8 A;  4BAY A;  4Z2Y A;  2MA3 A;  5DDG A;  3F22 A;  3C3W A;  3F6O A;  2RDP A;  2QUF A;  3I4P A;  1G6N A;  5K5O A;  3IC7 A;  3GEZ A;  3P9I A;  3I64 A;  2GIV A;  1WRJ A;  3F8B A;  1BC7 C;  2Z9O A;  2PFB A;  4BNC A;  1FY7 A;  5FGM A;  3R0A A;  2G7U A;  2R7D A;  2NYX A;  3GLX A;  4RGX A;  4UUV A;  1DPR A;  4G7H F;  1W7P A;  4R79 A;  4LLN A;  4Q5S F;  2Z3Y A;  3F8F A;  4A6E A;  4ENN A;  3K69 A;  3V7R A;  5ERI A;  4UHT A;  2D1H A;  5JFR A;  4TV7 A;  4E70 A;  2HKO A;  3IRQ A;  1YLF A;  3F72 A;  4R8H A;  1BI2 A;  4RB1 A;  3GFI A;  3IWF A;  1G4D A;  4XBF A;  4A12 A;  2W84 A;  4L9J A;  1R22 A;  4EJW A;  1FYK A;  1OMI A;  3V4G A;  1HXD A;  5L3D A;  3RYP A;  5IT9 K;  3WGH A;  2JRT A;  3MZH A;  2HZT A;  2XV4 S;  1FBQ A;  2YX7 A;  2OA4 A;  2IW5 A;  4L18 B;  2E1N A;  3FMR A;  2HFH A;  1E2X A;  4I09 A;  1TQP A;  4N9I A;  3ML6 A;  4GCV A;  4HDU A;  4WXC A;  2L01 A;  4ENM A;  5EEG A;  3KCC A;  4JBA A;  2Y0M A;  1KYZ A;  3QU6 A;  1YW7 A;  1SMT A;  2XUB A;  3ZMZ A;  5HLI A;  2LNB A;  1OYY A;  1ZGJ A;  4M6Y A;  1ULY A;  5LHG A;  3KET A;  3DFG A;  3Q9S A;  3TDU C;  5D4S A;  1QNT A;  1U5T C;  4L0Y B;  1IAW A;  2HYF A;  1EH7 A;  1XGN A;  3I54 A;  2CFX A;  2EK5 A;  2VOD A;  5DUI A;  5ICE A;  3ROU A;  3V8J A;  3BDD A;  2PEX A;  4RAZ A;  1DUX C;  4Q47 A;  1W5S A;  5H20 A;  5IT3 A;  4ZYD A;  1T98 A;  1ZN2 A;  1TNS A;  3V8L A;  3C1D A;  4U0W A;  2LF7 A;  2HYG D;  2MC3 A;  4BH9 A;  2ESH A;  1FBU A;  3WU1 B;  1FPQ A;  5K5R A;  1D8K A;  1S3J A;  3H3Z A;  2VE9 A;  4OIR F;  4UV8 A;  2GWR A;  1UCR A;  4CIC A;  3R60 A;  2DU9 A;  3LST A;  1HST A;  2QBY B;  2P6T A;  2K7L A;  1ZG1 A;  4BQA A;  3W6K B;  2A6E F;  1ZAO A;  3ISP A;  4KMU X;  2ZFW A;  3CUQ B;  3M8F A;  1I5Z A;  4AIH A;  3T8T A;  2F5E A;  5CVJ A;  1UHM A;  4L0Z B;  3J7A O;  1YW9 A;  4RS8 A;  2FU4 A;  1B6A A;  4HOB A;  3S2W A;  5TRD A;  4N0B A;  4PZJ A;  4LMY A;  2DPD A;  3SHF A;  5HDG A;  2Z5U A;  3BJ6 A;  1H9T A;  4HW0 A;  2MD5 A;  1O57 A;  2FBH A;  3P9K A;  2BGC A;  1T2K A;  3E5Q A;  4BHP A;  4U0V A;  2HEO A;  4AIK A;  2B0L A;  5HOO A;  1T38 A;  3E97 A;  1RZ4 A;  5KK1 A;  3WTX C;  3KE2 A;  3IKT A;  2G7H A;  3SXY A;  4OIP F;  3R6S A;  2AXL A;  3R4K A;  3K1M A;  2UWM A;  5F6F A;  2PLY A;  5JI6 A;  3HSR A;  4EJT A;  4LLG F;  3KP5 A;  1USS A;  1WQ2 A;  1R7J A;  1FT9 A;  3WGG A;  2HQN A;  1BI0 A;  4RGS A;  1OYI A;  3HHH A;  2ZCW A;  2GQQ A;  2JZY A;  3ZMV A;  2WV0 A;  3J81 K;  2DO7 A;  2HR3 A;  1LEB A;  2O6G E;  5FB2 A;  2V1D A;  4A5N A;  1R5H A;  1U8R A;  2G9W A;  4KFC A;  1TBX A;  3QP5 A;  1HKS A;  1KYW A;  1IXS B;  3WE3 A;  1PP8 F;  4A6D A;  1U6G A;  4CGZ A;  2VBW A;  2CGP A;  4KIF A;  2VON A;  2A3S A;  2VXZ A;  1O3S A;  1U3E M;  3WTZ A;  4G6D A;  4A5M A;  5E20 A;  4HYE A;  4ETS A;  4KN7 X;  2HWV A;  5E17 F;  3HHG A;  1FWZ A;  3MEX A;  1LJ9 A;  3IWZ A;  1WSU A;  2QWW A;  2X4H A;  3FXR A;  1QZZ A;  2VOO A;  1RIO H;  2JPC A;  5D5V B;  4ENJ A;  1KQ0 A;  3SZP A;  3DKW A;  4IF4 A;  3K9T A;  2FF4 A;  2ISZ A;  3MFK A;  2EV0 A;  4UVA A;  4G8X A;  2VN2 A;  3N4M A;  3RKX A;  4HX7 A;  1IZ1 A;  2VC0 A;  4HF0 A;  4UNO A;  1TW2 A;  3V8K A;  3T8R A;  3PQJ A;  1HSJ A;  4M72 A;  3CJN A;  1UST A;  3RPQ A;  2HOE A;  4GYI A;  2XRN A;  2VT3 A;  5IT9 Z;  4UXN A;  4PDK A;  1JXS A;  2DQR A;  2V79 A;  2ETH A;  3WGI A;  1B1B A;  3FZV A;  2J5O A;  1LDK B;  1VTN C;  1J5Y A;  1FLI A;  4PCQ A;  1YS7 A;  1Z1D A;  1L0O C;  2OU2 A;  3CUQ A;  3RTR A;  2R7F A;  1MJ9 A;  2Q0O A;  4L5J A;  1XSD A;  1X3U A;  1YS6 A;  4M71 A;  2YX4 A;  1BOA A;  3GZ5 A;  3TO6 A;  3L7W A;  2P5K A;  5LGT A;  1IF1 A;  4RB3 C;  2L4A A;  4IJA A;  4I98 B;  1AOY A;  5ILU A;  3GFM A;  5JVT A;  2NRA C;  2YR2 A;  4KYW A;  2JSC A;  3PFI A;  1ON1 A;  5L3G A;  1U5T B;  1S7O A;  1FP2 A;  2MLG A;  2M45 A;  1F4K A;  3E6M A;  1O7L A;  3TOA A;  1GVJ A;  4Y15 A;  4CZZ A;  2K02 A;  4RB2 C;  1HW2 A;  4IHT A;  3IHU A;  4PGG A;  2IA1 A;  4LFU A;  1S8N A;  4B8X A;  3WG9 A;  1K78 B;  3KZZ A;  4MGR A;  5JR3 A;  5ED4 A;  1XSX A;  3ABU A;  2JPB A;  1BIB A;  1BC8 C;  2E7X A;  2OZU A;  3KP4 A;  2PMH A;  3ECO A;  1Z05 A;  4HX4 A;  3TQN A;  5FLX Z;  1P92 A;  4ZYG A;  3D0S A;  4JQF A;  5AIP A;  2NNY A;  1YIO A;  6PAX A;  2V6C A;  2M30 A;  4EVI A;  2OZ6 A;  3NQO A;  4HV5 A;  3ABT A;  1FX7 A;  2CG4 A;  5D6E A;  4WK8 F;  2P7C B;  5LEK A;  3GW2 A;  3HRS A;  3DXJ F;  2J5P A;  1O3R A;  2KJB A;  5CVR A;  3DPT A;  1R58 A;  1R00 A;  1TTY A;  3C18 A;  1EH6 A;  2P5V A;  2OAZ A;  4MQ9 F;  1MKM A;  1Z91 A;  5CLS A;  2H27 A;  4BHB A;  1P6R A;  3G73 A;  3ZN1 A;  1BN5 A;  1R36 A;  1RUN A;  3HTS B;  2WC2 A;  2QZ8 A;  3RYR A;  1FSH A;  3K2Z A;  5CVV A;  3FHZ A;  3BPV A;  4CO8 A;  1OR7 A;  2HS5 A;  4OIO F;  1H0M A;  5FFZ A;  2DK5 A;  3JW4 A;  3L9F A;  2QM3 A;  2M5W A;  4KIB A;  4MTE A;  1OKR A;  4YII A;  3WOD F;  3NEU A;  5BPI A;  3GX4 X;  5BPD A;  1T6S A;  2EB7 A;  3J81 Z;  1GXP A;  3EYI A;  1IRG A;  1R1T A;  1R1V A;  2P4W A;  3O3K A;  1T39 A;  1FSE A;  1XGO A;  1KU9 A;  2R3S A;  3J80 Z;  1BJA A;  4M73 A;  2WTE A;  1ZRC A;  1FYL A;  2F5C A;  1XDU A;  4L9T A;  5L3C A;  4Q4Z F;  1HW5 A;  1Q1H A;  3EQL F;  1BBY A;  3IKV A;  1TNT A;  5DCM A;  1REP C;  4PGH A;  3O6B B;  5DV5 A;  1MJA A;  2L4M A;  1SD6 A;  2QQB A;  2K86 A;  2H6B A;  4XLP F;  4P96 A;  5TJJ A;  1OPC A;  1J9I A;  1Z6R A;  2M87 A;  2ZME B;  3BWG A;  3ECH A;  1YFH A;  5LLQ A;  3F6V A;  3VOD A;  4Q48 A;  1BI1 A;  2A61 A;  4RGU A;  4OMZ A;  3LQQ A;  1D3Y A;  4A2U A;  4HA8 A;  5FD6 A;  1CGP A;  3CDH A;  5HDK A;  3K0L A;  2ADU A;  4I0B A;  2GA1 A;  3REO A;  2FSW A;  5FD5 A;  1R5G A;  3F8C A;  3HYI A;  5FFX A;  3K1N A;  4GYG A;  3KEO A;  1XGM A;  5H6Q A;  1KU2 A;  4UV9 A;  2GAU A;  2PBI A;  2TDX A;  2DLL A;  1W5T A;  4I7H A;  5E8G A;  1ZG3 A;  1SD5 A;  3KP2 A;  1T0F A;  2W85 A;  3V7C A;  1UHW A;  5HVQ C;  4M6X A;  1ZG5 A;  2ESN A;  3PQK A;  1WKM A;  5J8F A;  3I59 A;  3W6J B;  3EDP A;  3P9C A;  2F5D A;  3LFK A;  2XAJ A;  1ZRF A;  4OOI A;  1J0R A;  1HQC A;  2A68 F;  3OOP A;  3F8N A;  5KVR A;  2JTV A;  3LWF A;  3M1E A;  1XMK A;  2EV6 A;  3HOS A;  1MJB A;  3L2C A;  4ZZD A;  3MAJ A;  2MH2 A;  4FX0 A;  4P9U A;  4GGG A;  1ZAR A;  4P9F A;  1U78 A;  4B09 A;  1SFX A;  3I53 A;  1LDD A;  3J80 K;  4DNC A;  2ZO4 A;  3DEU A;  4GO1 A;  1HBX G;  4A0X A;  3HRT A;  5E8I A;  2JT1 A;  1IN8 A;  3GF2 A;  3B02 A;  4WCG A;  2LDU A;  3RJP A;  2DW4 A;  3JAM Z;  1AWC A;  2P6S A;  2VC1 A;  2O3F A;  4ZYE A;  4ZZL A;  1KU7 A;  3KZY A;  1HKT A;  1LDJ A;  4WXD A;  2EA4 A;  4U0Y A;  3MZY A;  5LGN A;  2STW A;  4HLY A;  2KRF A;  3KLO A;  3CO6 C;  2IRF G;  1W7P D;  1RNL A;  3GXO A;  3TKY A;  2FEZ A;  2H09 A;  4ESF A;  5LBQ A;  4BHC A;  3V7S A;  2F5F A;  1YW8 A;  2KJC A;  3F23 A;  4CDG A;  3L00 A;  4BXU A;  5CVU A;  3Q5F A;  4LK0 F;  1F9N A;  4QLC U;  5AIQ A;  4OMY A;  1P4X A;  1ZH5 A;  1B9N A;  2NS0 A;  2D1V A;  3TO7 A;  5L3E A;  4LJZ F;  3F8M A;  5JHU A;  2D45 A;  3R0J A;  2Q2E A;  5E1X A;  2ACJ A;  1GXQ A;  1IW7 F;  2RN7 A;  4ESJ A;  2COM A;  2KIU A;  3P7N A;  2IT0 A;  3IRR A;  4I02 A;  3SFZ A;  4YFK F;  1ZRE A;  3LA2 A;  1IN4 A;  1KU3 A;  4KDP A;  2UXX A;  5BMZ A;  3CTA A;  4MEX F;  1ZGA A;  4KIG A;  3QPH A;  2ZBK A;  2OD5 A;  5CVI A;  4RB0 A;  2A5Y B;  1D5V A;  1I27 A;  3B73 A;  2F2E A;  5D4R A;  4MQV A;  3KEQ A;  2ZNY A;  1J75 A;  2W25 A;  2KIM A;  3AAF A;  3HIF A;  1FYM A;  2Y48 A;  2IVM A;  4FHT A;  3VB2 A;  1SD7 A;  3LQR A;  2VOP A;  3JAM K;  2IP2 A;  4QWQ A;  2VBX A;  3CUO A;  1XDS A;  1GHC A;  4XSX F;  2XHK A;  5DCF A;  2YSR A;  2E1C A;  1A04 A;  4LK1 F;  4YG2 F;  1I1S A;  5D5U B;  3EUH A;  5HLH A;  1UFM A;  2ZXJ A;  4HQE A;  5DD8 A;  3MWM A;  1XB4 A;  3BOQ A;  1Z9C A;  5D5W B;  2O0Y A;  4MTD A;  1ONV A;  2QVO A;  4WXH A;  1ZYR F;  4XLN F;  2EFQ A;  2CQK A;  5D5X B;  4HZF A;  3ZP5 A;  2ISY A;  4L5I A;  2XKP A;  3EYY A;  3BZ6 A;  4HAM A;  2H94 A;  4EM0 B;  2XIG A;  5ILV A;  5DEQ A;  1FC3 A;  3WTU C;  4KMF A;  2P8T A;  2BE5 F;  2IA2 A;  4ON0 A;  1KGS A;  4P5O A;  3QRF F;  2EFP A;  2FQ3 A;  4A0Z A;  4Y17 A;  2ZJ2 A;  5E1W A;  1HKQ A;  2RV8 A;  1RUO A;  2V1U A;  3CUQ C;  2FNA A;  3JSO A;  2ELH A;  4S04 A;  1NHA A;  4ASN A;  3CLO A;  2ZME A;  3JTH A;  4O5V A;  3LA7 A;  3GUD A;  5DCM B;  3KLN A;  3JSP A;  2GXB A;  2PG4 A;  2BV6 A;  3MCZ A;  3WTW C;  3FMS A;  1LEA A;  1B59 A;  2RVC A;  3FMQ A;  4IVN A;  2PN6 A;  1FZP B;  3T5X A;  3HRM A;  2O8X A;  4AWX B;  4HDV A;  2UXN A;  5AON A;  3QU3 A;  5L3F A;  2YPR A;  1CF7 A;  2XAS A;  2AS5 F;  2HQR A;  4NHJ A;  3T1B A;  4RAY A;  5L3B A;  4LG0 B;  3RKY A;  3QAH A;  3DP7 A;  4KNY A;  3GO5 A;  1J59 A;  2IJL A;  1S6L A;  3JTG A;  4S05 A;  5BOX A;  1F5T A;  4CHU A;  4P55 A;  5F1R A;  3FXQ A;  1BIA A;  2FRH A;  2Y75 A;  3I59 B;  1LVA A;  1IUY A;  3TO9 A;  4O3M A;  3BJA A;  3VOE A;  2XKO A;  2XAH A;  3BPX A;  2RGV A;  3K1P A;  4R1H A;  2RNJ A;  3NRV A;  5A2Q Z;  2D2W A;  3FX3 A;  1SAX A;  1IXR C;  3FWE A;  3RKW A;  5HS7 A;  1ZHF A;  3FXU A;  3CO7 C;  2A6H F;  1R1U A;  3QPT A;  2K4J A;  2FBI A;  2GA2 A;  3C7J A;  1EH8 A;  5LGU A;  4EQQ A;  4AVP A;  3ZMD A;  2UZK A;  3U1D A;  4G94 A;  2QLZ A;  4LGW A;  3WTT C;  2EFW A;  4KIC A;  2FMY A;  1YQA A;  3I58 A;  1F1Z A;  5LEJ A;  4A0Y A;  3WTS C;  2QBY A;  5HLG A;  3HSF A;  3RDI A;  1SD4 A;  4EGY A;  1ZLK A;  2IA0 A;  5HS9 A;  3ZN0 A;  2STT A;  3M9A A;  2CYY A;  1MD0 A;  5E1Z B;  5DYM A;  1FOK A;  2LSO A;  5FO5 A;  3G3Z A;  3DQV C;  1O7F A;  5E18 F;  1ON2 A;  2A69 F; 
#chains in the Genus database with same CATH topology
 3QQA A;  1AA7 A;  3LL7 A;  1JGG A;  2VB6 A;  2FQ4 A;  4UVC A;  3CP2 A;  1RKT A;  4MIM A;  4CXF A;  4IQJ A;  1S7A A;  2E7W A;  3JCU C;  1A6Q A;  2HKX A;  5FKN A;  1RI7 A;  3UKG A;  4EM1 A;  1B72 A;  3GFJ A;  1JUP A;  1MZB A;  2HNH A;  4IRI A;  5FLX K;  3VSK A;  4P1W A;  1VQ9 I;  4MNU A;  2QEX I;  2QCO A;  2QKL B;  1XTA A;  1EKE A;  3KP3 A;  2CWE A;  2Q2E B;  5DTD A;  3QPL A;  4D0P A;  3RKQ A;  1H8A C;  2CW7 A;  1X1P A;  2EZL A;  5FKO A;  1X3W B;  3S3O A;  1ZLJ A;  4UB8 C;  2XVC A;  3CCV I;  4GXO A;  4EMS A;  2K40 A;  4A3D J;  1KA8 A;  4KT6 A;  1JHH A;  2W00 A;  1XCV A;  4FX4 A;  1T33 A;  3T0Y A;  3FF5 A;  2DBB A;  1PUE E;  2W48 A;  3WTV C;  1DQU A;  1LNW A;  1UHS A;  3OYM A;  1XS9 A;  1HOM A;  4U7B A;  1K6Y A;  1FMV A;  1LQ1 A;  4XLC A;  2FE3 A;  1MMS A;  3TOB A;  3RI4 A;  3H3U A;  3OS1 A;  4IKF A;  1KQ8 A;  2V9V A;  3H3V K;  2M1B A;  1IV8 A;  1U9O A;  2WAD A;  4D5F A;  1TQM A;  4H0E A;  2B7E A;  3ZMT A;  4EM2 A;  4HF1 A;  4D7M A;  1W4M A;  1LE8 A;  1WVR A;  2F4I A;  5CJ9 A;  5BS6 A;  1VQ6 I;  3EET A;  3E6C C;  3ESW B;  3HTU A;  2OC6 A;  2HDC A;  3E3V A;  1QBJ A;  1FP1 D;  2XAQ A;  4O6J A;  1HW1 A;  3IUO A;  1IXC A;  4I0A A;  4KT5 C;  1BA5 A;  4ZDP A;  2HTJ A;  3L2Q A;  3E5X A;  3GME A;  2H6C A;  2L54 A;  1MH4 A;  1DDN A;  3JRH A;  2EIL H;  2X0L A;  2QYO A;  3ZQ7 A;  4NNJ A;  2EFN A;  1UB9 A;  4RMN A;  1Y0U A;  4JP0 A;  5J40 A;  2EZH A;  2DA6 A;  5D6F A;  1K6O A;  2HTS A;  3WHB A;  1MBF A;  4D7N A;  3M7G A;  1WJF A;  1CF7 B;  5GPC A;  2BY0 A;  3KEY A;  1YIT I;  2CFO A;  4EJO A;  4M74 A;  1BI3 A;  3GZ6 A;  4XOP A;  4HSR A;  2A6T A;  1DP7 P;  2Z33 A;  2DA1 A;  2DOD A;  1Q1V A;  2EFO A;  3KP7 A;  3EUH C;  5IY5 H;  1PDN C;  3HRU A;  3MZ8 A;  1QGP A;  4JK1 X;  4YFN F;  5HNH A;  2Q1Z B;  4HBL A;  1YX5 A;  2FOK A;  3FXM A;  5CPR B;  2OCE A;  2Y30 A;  1L3L A;  3BP8 A;  3I0T A;  4E4H A;  2L3D A;  4RA2 A;  1V3F A;  1D8J A;  2DTR A;  2C6Y A;  2Y31 A;  3DPL C;  5LRR A;  3G71 I;  5E79 C;  3W2A A;  1U2W A;  2JWT A;  3BQZ A;  2VJI A;  3KP6 A;  5EG0 A;  2RRE A;  2OF7 A;  1TQI A;  2VKV A;  3HOV J;  2QEN A;  3WU0 A;  1Y1W J;  1XD7 A;  4F55 A;  5DUK A;  2CJJ A;  1P4A A;  4ANJ A;  4MFE A;  2KZV A;  1ZRD A;  2O8K A;  2DI3 A;  4N9H A;  2FML A;  4ZJZ A;  3I71 A;  1SMY F;  4II2 A;  2W57 A;  4I76 A;  2GLO A;  2VE8 A;  2NVY J;  5E3L A;  5FKK A;  3M8J A;  2DMP A;  3BRO A;  5DD4 A;  3DLA A;  3Q9V A;  1FIA A;  1ZEL A;  3O2P E;  5J6X A;  4UVB A;  1IGN A;  2EWN A;  3S1Q J;  3GYH X;  3CF5 F;  2GXG A;  2HVQ A;  1Y0N A;  4XMY A;  2JA7 J;  2XAG A;  1TW3 A;  1O3T A;  4BJ5 C;  4NBQ A;  4ZYH A;  4LB5 A;  2XSD C;  5K1Y A;  2LD5 A;  2KKO A;  4CZC A;  2VLA A;  2CQ7 A;  2E1O A;  4B1R A;  1F36 A;  2IS1 A;  3WG7 H;  3WU2 C;  5HDN A;  2E5N A;  3KYD B;  4X0G A;  3DU6 A;  3N97 A;  1K7A A;  4I01 A;  1ODD A;  5ILS A;  1TLH B;  2K4B A;  3H92 A;  5J8C A;  1I39 A;  2FBK A;  3E5U A;  4XSZ F;  1P4W A;  4RGR A;  2QQA A;  4MEY F;  1W5C C;  2WY8 Q;  2LKP A;  1DPU A;  1V4R A;  4HLX A;  5D8L B;  1WWX A;  4LLL A;  4OIN F;  1G3W A;  4EV0 A;  4A3J J;  3IAM 2;  3I9V 2;  1MW7 A;  2M8E A;  4XON A;  4A3E J;  1J2X A;  3A02 A;  4QTR A;  4IHV A;  4BU2 A;  3FXK A;  4L9N A;  5H6R A;  4UUS B;  1XCB A;  4XLH A;  3LAJ A;  1SFU A;  4I2O A;  3LSJ A;  2XRO A;  1FNN A;  2O61 A;  2KT0 A;  2E1M B;  2NAZ A;  4G6Q A;  1EV7 A;  2Y69 H;  2O03 A;  5D8K B;  2X1D A;  3R61 A;  1G3T A;  1N25 A;  4QPO A;  4CYD A;  2EA2 A;  2PQ8 A;  4FE7 A;  2Z99 A;  1X3Z B;  4KUM A;  3X2Q H;  2MFZ A;  4KN4 X;  3SQN A;  4DYR A;  1N77 A;  3OOU A;  3BG5 A;  4DYQ A;  3HUG A;  2P5L C;  2CO5 A;  1A6I A;  1MDM A;  2X51 A;  1BL0 A;  2BHZ A;  4J01 A;  2AXT C;  3GFL A;  1G3S A;  3I5U A;  1MNE A;  4PJN A;  1VFC A;  1IRF A;  1LFU P;  2BBY A;  2CSO A;  4MHG A;  2KIF A;  3DU5 A;  2DJN A;  2XPW A;  1JKQ C;  2QGU A;  4BBS J;  3OR2 C;  4J19 A;  2H1L A;  3QYF A;  1KQ9 A;  4XN3 A;  4IRG A;  2L0K A;  2OQR A;  4D1Q A;  5B1B H;  1K79 A;  1G59 A;  3GTO J;  3CJT B;  3LA3 A;  4NQW A;  4UY8 I;  2DAO A;  2XGX A;  2EJR A;  4E7J A;  3E6B A;  2WWY A;  3BCB A;  2Y0S A;  3AG4 H;  4IPA A;  2L9N A;  1Y8Q B;  2MLK A;  3OS2 A;  1ENH A;  4WWC A;  1YG2 A;  3WTY C;  3BY6 A;  4YIF A;  4BQO A;  1NK2 P;  4IRH A;  1QZY A;  2K27 A;  3MQ0 A;  2FD5 A;  2MBF A;  5KCM A;  1G8X A;  4YFX F;  4K2E A;  1S29 A;  4IL6 C;  3PUF A;  2PJP A;  2L7M P;  3S93 A;  5EEH A;  1FBS A;  1SEU A;  2M4K A;  3BJO A;  5C3E J;  4U7D A;  1C0W A;  3ZGK A;  3HEF A;  3S8P A;  2H8R A;  4RLQ A;  1YTY A;  3FM5 A;  1A35 A;  2IAI A;  3E6D A;  2JA8 J;  3FKJ A;  3BTJ A;  4OU0 A;  2HGC A;  4CH7 A;  2QQ9 A;  3HOT A;  1IN6 A;  2W7N A;  3OL4 A;  2CQN A;  3M8E A;  2A07 F;  1YYV A;  4LD5 A;  2BYV E;  2ELK A;  2JVH A;  3H36 A;  1K78 A;  5F27 A;  3C2B A;  2X6X A;  4EJU A;  1IUF A;  2CS3 A;  1WI3 A;  2DT5 A;  1FTZ A;  2VT2 A;  2DK8 A;  1JTY A;  2QSH X;  2X1C A;  1Z7U A;  1ZKG A;  2IGK A;  3ELK A;  5F64 A;  3ZMS A;  3HSE A;  3LAP A;  2RC4 A;  2DPU A;  2DOF A;  1ERD A;  1MMG A;  2EV5 A;  3A4C A;  3GZN B;  3MKL A;  4A3L J;  1GVD A;  2RKH A;  2PI0 A;  3CCQ I;  3DF8 A;  2BZT A;  5LHH A;  2IS6 A;  4XID A;  2EIM H;  3OSG A;  1YO5 C;  1MDM B;  2X6O A;  4AM3 A;  1W0T A;  1WJ5 A;  2MH9 A;  3TBI A;  2Q8K A;  3QOP A;  2FXA A;  4DJA A;  3HJE A;  4ENK A;  1XMA A;  1D0Y A;  3F9K A;  2YU3 A;  2RQQ A;  4WF2 A;  1F43 A;  1BM9 A;  4EJV A;  3GVA A;  5HLT A;  3QPS A;  1VQK I;  1ETV A;  2VKD A;  2R7Q A;  4XKW A;  4DQ2 A;  4LB6 B;  1HCR A;  1I1G A;  1GUU A;  4JYK A;  2E2I J;  2V1X A;  1QRY A;  2V1N A;  1ETK A;  2OUM A;  4II3 A;  4GDF A;  2M2E A;  2MGQ A;  2P7V B;  4XRS A;  2EIJ H;  3ULQ B;  4BYY A;  4LIT A;  4KA4 A;  5IYD J;  1B9M A;  1W36 D;  1O3Q A;  4EGZ A;  1P2F A;  3FXJ A;  5K5Q A;  1E17 A;  1DU6 A;  4AD9 A;  4WX9 A;  4RBO A;  1JHF A;  5HS8 A;  4F7Z A;  2ZME C;  1W0U A;  4ITV A;  1XN7 A;  5ICF A;  4G7Z F;  4IHS A;  2LY2 A;  2EZK A;  2QF7 A;  4BUP A;  5LRS A;  1RR8 C;  3PSI A;  2NNN A;  4IXA A;  4DBQ A;  1FJL A;  3RIR A;  4A3I J;  1B4A A;  2VBY A;  4ZTJ A;  1BW5 A;  2OQG A;  5BQT A;  3EPZ A;  2M4G A;  4Y13 A;  2DQL A;  3DV8 A;  2L02 A;  2VI6 A;  3H5A A;  5FRM A;  4HX8 A;  3JRF A;  1JGS A;  3S1M J;  1IN5 A;  3U9G A;  2F4M B;  2IPQ X;  5ICG A;  4NB5 A;  1T8I A;  2IGM A;  1WI9 A;  3TGN A;  3KFW X;  4XRF A;  4OIQ F;  1G3Y A;  2KMU A;  4M9Z A;  3WE2 A;  1J7K A;  1QVU A;  3LMM A;  3COA C;  2FA5 A;  2AHQ A;  3HPH A;  4XM3 A;  3RPU A;  2QA4 I;  2HPI A;  1SFE A;  2MSY A;  1IN7 A;  2DTZ A;  5GTH C;  2CW0 F;  2CW8 A;  1FTT A;  4G7O F;  2Y9Z A;  4M3E A;  3VFZ A;  5LHI A;  1XGS A;  1PP7 U;  1X1B A;  3HUG B;  3D5L A;  3GLL A;  1OLT A;  4CCM A;  1PUF B;  1JTX A;  1H9G A;  2DMN A;  3L09 A;  2CUE A;  2LVS A;  1LB2 A;  2O7O A;  2WY7 Q;  3GWZ A;  3K7A J;  5A2Q K;  1VQ7 I;  3ERE D;  4DZP A;  2LBF A;  4M9S A;  3BG7 A;  2R7W A;  3FM3 A;  1QPM A;  2RQP A;  1DGR M;  2FNP A;  4PJL A;  2BEO A;  4HG2 A;  4X1E A;  4ZH4 F;  1IDZ A;  3GTM J;  1W7P B;  1XC5 A;  2XAF A;  2CUF A;  1GT0 C;  2XGE A;  1JE8 A;  2K9L A;  2ZNZ A;  2BY1 A;  1OCR H;  5ICC A;  4BDZ A;  1D1B A;  2PJR A;  3QP6 A;  3VEP A;  4IOC F;  2VBZ A;  2HOT A;  3ZMU A;  3SZT A;  4BXX J;  4HF2 A;  4B43 A;  4AIJ A;  3FKI J;  2R92 J;  3F3X A;  4G9Y A;  2ZC2 A;  1Z6T A;  2M7B A;  4FIS A;  4LG0 A;  2VXD A;  3CF2 A;  3OV8 A;  4XIC A;  3PNY A;  2W24 A;  1I6X A;  1OYW A;  2MG4 A;  1R23 A;  3KX2 A;  3TDZ C;  3F21 A;  3BTL A;  4L9V A;  5J1Y A;  3BT9 A;  3A03 A;  4ESB A;  1FEX A;  2ZKZ A;  4HQM A;  1MGT A;  2WAF A;  4U88 A;  3RZD J;  3HOX J;  1QO0 D;  3A01 B;  1STZ A;  1U5T A;  1VQ8 I;  2DFI A;  2PMU A;  1QQI A;  3HM5 A;  4FT8 A;  4M9X A;  1MMA A;  1XPX A;  4FCY A;  3DBL B;  2HU9 A;  4HV6 A;  4CCK A;  2E60 A;  3ZPL A;  3IL2 A;  3CJR B;  2BHY A;  5CYV A;  1XSV A;  1RRJ A;  5J1U A;  1X2M A;  2OBP A;  3U2R A;  2GZW A;  3BLY A;  3IV5 A;  2LF8 A;  3KPH A;  1TWC J;  4BAY A;  4CCJ A;  2JUG A;  5B1A H;  3JRC A;  2L5Q A;  1MH3 A;  4Z2Y A;  1ORK A;  2MYS A;  2MA3 A;  2FUG 2;  5DDG A;  3F22 A;  1PJR A;  3S17 J;  3C3W A;  2LRE A;  3EUK L;  4CCN A;  3F6O A;  1TWG J;  2RDP A;  2QUF A;  1WJC A;  3I4P A;  4H4K C;  1G6N A;  4Y7N J;  2DDA A;  1OCO H;  1YJN I;  3W6V A;  1APL C;  3AL0 B;  5K5O A;  3IC7 A;  4XKV A;  3GEZ A;  2E19 A;  2WV1 A;  3P9I A;  2I5U A;  3I64 A;  5F0H A;  2GIV A;  4FET A;  1WRJ A;  3F8B A;  1BC7 C;  2Z9O A;  2PFB A;  4BNC A;  4F91 B;  2GBY A;  3OYB A;  1CQT A;  1FY7 A;  2DA3 A;  5FGM A;  1QU3 A;  3R0A A;  9ANT A;  4DBR A;  2G7U A;  4KIT B;  1VND A;  2DFH A;  4XN0 A;  4E7K A;  2LLK A;  5FKL A;  2R7D A;  2NYX A;  1OCP A;  3GLX A;  4RGX A;  4UUV A;  5M3M J;  3KYL A;  1DPR A;  2AQF A;  4G7H F;  1BOB A;  1W7P A;  2HZD A;  4FQG A;  4R79 A;  4RDU A;  4CCL A;  4LLN A;  4Q5S F;  2FX0 A;  1YE9 A;  3A0B C;  2Z3Y A;  3F8F A;  3PO2 J;  4A6E A;  4ENN A;  3K69 A;  3V7R A;  3JRD A;  5ERI A;  4UHT A;  2D1H A;  5JFR A;  4TV7 A;  4E70 A;  3HOU J;  5F04 A;  2HKO A;  1JJ6 C;  2XB5 A;  1YOV B;  3IRQ A;  1YLF A;  3F72 A;  4R8H A;  1BI2 A;  1VF9 A;  4RB1 A;  2NVU B;  3GFI A;  2JJ7 A;  2OCC H;  5FRN A;  4DIQ A;  4UUS A;  2DT7 B;  3HXL A;  1TC3 C;  1Z7L A;  2DYR H;  3IWF A;  1G4D A;  4XBF A;  4A12 A;  2W84 A;  4L9J A;  3Q0U A;  1R22 A;  3CC4 I;  2KP6 A;  4EJW A;  1FYK A;  1OMI A;  1R4N B;  1U0J A;  3HGY A;  1V5F A;  1HXD A;  3V4G A;  5L3D A;  3RYP A;  1ZR2 A;  3FIS A;  1BR4 A;  1Y39 A;  5IT9 K;  3WGH A;  2JRT A;  2HZT A;  2XV4 S;  3MZH A;  1LE8 B;  1FBQ A;  2YX7 A;  2OA4 A;  2IW5 A;  4L18 B;  2E1N A;  3FMR A;  1H88 C;  2HFH A;  1E2X A;  2ID6 A;  3ASN H;  4I09 A;  1ACI A;  2ZSI B;  1TQP A;  2RNG A;  3SEZ A;  1YHQ I;  2R7S A;  4N9I A;  3ML6 A;  3UR3 C;  4GCV A;  4HDU A;  2HYJ A;  3FK6 A;  3JRE A;  3DKX A;  4CA0 A;  2R7U A;  3ZQI A;  2DCE A;  4WXC A;  2EQR A;  2L01 A;  1Z67 A;  4ENM A;  4CSW A;  5EEG A;  3KCC A;  4QIW N;  3OR1 C;  4JBA A;  2K9N A;  2Y0M A;  1KYZ A;  1X1C A;  3QU6 A;  4AVZ A;  4HNV A;  5IOZ A;  1YW7 A;  2I10 A;  1MBE A;  1SMT A;  2DJI A;  1AU7 A;  1JI8 A;  2CQQ A;  2XUB A;  3ZMZ A;  5HLI A;  2LNB A;  1OYY A;  1ZGJ A;  2GOX B;  3J7A Y;  1VQN I;  4I6Z A;  5K7Z A;  2KFD A;  3HPG A;  4M6Y A;  1ULY A;  5LHG A;  3DLL F;  1TZL A;  3KET A;  3DFG A;  1B8I A;  1D1C A;  3Q9S A;  4IQ4 A;  3TDU C;  2Z2S B;  5D4S A;  4A3F J;  1QNT A;  2R5Z B;  1U5T C;  4L0Y B;  1IAW A;  2NVQ J;  2HYF A;  1EH7 A;  1X1A A;  1XGN A;  3I54 A;  3ONQ A;  2DT6 A;  1EJ9 A;  5M3F J;  4S0H B;  2CFX A;  2EK5 A;  4PJJ A;  2X85 A;  4B47 A;  2VOD A;  2GM4 A;  1WHU A;  1R5I D;  1RET A;  5DUI A;  1UMQ A;  3ROU A;  5ICE A;  3V8J A;  3JR9 A;  2OV7 A;  2PEX A;  3BDD A;  4RAZ A;  1IC8 A;  1DUX C;  3FXO A;  4Q47 A;  1SFK A;  1W5S A;  2ZXH A;  5H20 A;  3BR0 A;  5IT3 A;  2CU7 A;  4D9J A;  3GTJ J;  4ZYD A;  2WA0 A;  2B9S A;  3OWT A;  2HQ5 A;  4IHX A;  1S9H A;  1T98 A;  1WPK A;  3OY9 A;  1ZN2 A;  1TNS A;  3V8L A;  3C1D A;  4U0W A;  4LOC A;  2LF7 A;  3K70 C;  2HYG D;  3IP4 B;  2MC3 A;  4BY1 J;  4BH9 A;  2ESH A;  1FBU A;  3WU1 B;  1FPQ A;  2H1K A;  5K5R A;  2LC2 A;  1D8K A;  1MBH A;  1S3J A;  3H3Z A;  5EZH A;  3TED A;  2CRG A;  3AG2 H;  4IHW A;  3VYR B;  1JKR C;  4IX7 A;  2VE9 A;  2F48 A;  2M9H A;  4OIR F;  4UV8 A;  2GWR A;  5KHD A;  1UCR A;  5DM7 F;  4CIC A;  3R60 A;  2DU9 A;  2R7X A;  3LST A;  1HST A;  1Z21 A;  3FIW A;  2QBY B;  3ZQC A;  2M0C A;  3I55 I;  3CMM A;  3DPU A;  1Z3Y A;  3UNG C;  1IRZ A;  2P6T A;  2K7L A;  3TMO A;  1ZG1 A;  5EZG A;  2XSJ C;  4BQA A;  3W6K B;  3G2B A;  2A6E F;  2PMZ A;  1ZAO A;  4ZC3 A;  3ISP A;  1A31 A;  4KMU X;  4XLF A;  3CC2 I;  2ZFW A;  3CUQ B;  1MMD A;  3M8F A;  1I5Z A;  4AIH A;  3BQY A;  3T8T A;  2F5E A;  2CV1 A;  5CVJ A;  3AFH A;  4XRS G;  1UHM A;  4L0Z B;  4FAS D;  3J7A O;  2V9K A;  1YW9 A;  4RS8 A;  2FU4 A;  3DWL E;  2XC7 A;  1QHH D;  1HA8 A;  1B6A A;  4HOB A;  2V9P A;  3S2W A;  5TRD A;  1K4T A;  4N0B A;  2Z1D A;  4PZJ A;  1E3O C;  4LMY A;  3G1L A;  2DPD A;  3SHF A;  4BE0 A;  5EF6 A;  5HDG A;  2Z5U A;  1SAN A;  3BJ6 A;  4BE1 A;  1H9T A;  3S14 J;  4HW0 A;  2MD5 A;  1O57 A;  5TIS C;  4BE2 A;  1UEL B;  2FBH A;  5TGT A;  3WHC A;  3P9K A;  2E35 A;  2BGC A;  1T2K A;  3E5Q A;  2DA7 A;  1I50 J;  2ECC A;  4X6A J;  4BHP A;  4U0V A;  2HEO A;  2P0W A;  3QOE A;  2JN6 A;  4AIK A;  2B0L A;  1OCC H;  5HOO A;  1T38 A;  3E97 A;  3OYN A;  4NC7 A;  1RZ4 A;  4FTH A;  5KK1 A;  3WTX C;  3KE2 A;  3CCY A;  3IKT A;  2G7H A;  2QSG X;  3SXY A;  1Z77 A;  4OIP F;  3R6S A;  2AXL A;  3R4K A;  3OYH A;  3K1M A;  4IEJ A;  2DA5 A;  2UWM A;  1IV6 A;  4E6K G;  2VKE A;  3V42 A;  1MSF C;  2MC4 A;  3SYT A;  1S72 I;  3DCF A;  5F6F A;  5EGO A;  1XG1 A;  2PLY A;  4U87 A;  5JI6 A;  3HSR A;  4EJT A;  2HXI A;  4LLG F;  2QKM B;  3KP5 A;  1USS A;  2XAU A;  2NVX J;  4HNT A;  1AHD P;  1WQ2 A;  1R7J A;  1FT9 A;  3WGG A;  2KDO A;  2E5Z A;  3ZCO A;  3OYC A;  2HQN A;  1BI0 A;  4RGS A;  1OCT C;  1OYI A;  3HHH A;  2ZCW A;  5DM6 F;  3W3C A;  2GQQ A;  2JZY A;  3ZMV A;  2WV0 A;  4C2T A;  3Q0W A;  3J81 K;  1ZGW A;  2DO7 A;  2HR3 A;  2VJ5 A;  3CDL A;  3HGG A;  2VPR A;  4BY7 J;  1LEB A;  2O6G E;  5FB2 A;  2V1D A;  4A5N A;  1R5H A;  1U8R A;  2G9W A;  4KFC A;  2K9S A;  1TBX A;  3QP5 A;  1HKS A;  2DMT A;  1KYW A;  1OFC X;  2MD0 A;  4Y3O A;  1IXS B;  3WE3 A;  1PP8 F;  4A6D A;  3OSF A;  1TWA J;  1U6G A;  4CGZ A;  2VBW A;  1MND A;  3FHN A;  2CGP A;  1NG7 A;  2JK3 A;  4KIF A;  2R7V A;  4YEL A;  2VON A;  2A3S A;  2VXZ A;  1O3S A;  1U3E M;  3WTZ A;  4G6D A;  4A5M A;  4OAY A;  3Q0V A;  3K4B A;  5E20 A;  3LSH A;  3CJQ B;  3DBR B;  1AKH B;  4HYE A;  3LOC A;  4ETS A;  3S2H J;  2GIZ A;  2X1E A;  4KN7 X;  2HWV A;  5E17 F;  1OIS A;  4V19 K;  2K3F A;  3HHG A;  1FWZ A;  3MEX A;  1LJ9 A;  4A3M J;  3IWZ A;  3A1Y A;  1WSU A;  2LOO A;  3F0C A;  2QWW A;  2X4H A;  3FXR A;  1QZZ A;  5JLW A;  1SFO J;  2VOO A;  1HC8 A;  2HOA A;  2DYS H;  5E3N A;  1RIO H;  1T95 A;  1WCM J;  4YIR X;  4XQF A;  3W2V A;  1Y6I A;  2JPC A;  4BBR J;  5D5V B;  4KIS A;  2M3A A;  3ZR8 X;  1U8B A;  1Y8R B;  5IP7 J;  3L1P A;  3RQ4 A;  4ENJ A;  1KQ0 A;  3SZP A;  2JA2 A;  3DKW A;  1ZR4 A;  4AYB N;  4IF4 A;  5GAH J;  3K9T A;  2P81 A;  2FF4 A;  2E2J J;  3LNQ A;  2K5C A;  3EUA A;  3TP0 A;  2ISZ A;  3MFK A;  2EV0 A;  4UVA A;  1J09 A;  3HC7 A;  3OL3 A;  4G8X A;  2VN2 A;  4C30 A;  4ZDL A;  2O9L A;  3PM1 A;  3N4M A;  3QOD A;  3RKX A;  2TCT A;  3LSG A;  4HX7 A;  4BJ6 C;  1V55 H;  3A01 A;  1R71 A;  1QA6 A;  1IZ1 A;  1RKW A;  2VC0 A;  3BC8 A;  4HF0 A;  4UNO A;  1TW2 A;  1HLV A;  1WJE A;  3T8R A;  3V8K A;  1Y56 A;  3TW6 A;  3PQJ A;  1HSJ A;  4M72 A;  3CJN A;  5M5Y J;  1UST A;  4OAZ A;  1R4M B;  3RPQ A;  2HOE A;  4GYI A;  5FRO A;  2XRN A;  2NVT J;  2CQX A;  1R9T J;  4NDL A;  4NC6 A;  2VT3 A;  4OWR B;  5IT9 Z;  2LR8 A;  3H1C A;  4C2M J;  4UXN A;  4PDK A;  1JUS A;  3HDD A;  4C3J J;  1JXS A;  2DQR A;  3ZQH A;  2V79 A;  2ETH A;  1AKH A;  3WGI A;  4LG3 A;  1B1B A;  2Y0S N;  3FZV A;  3HKZ N;  2J5O A;  4B44 A;  1LDK B;  1VTN C;  1J5Y A;  1FLI A;  2E34 A;  1YS7 A;  4PCQ A;  3JRB A;  1Z1D A;  2KRC A;  1LPQ A;  2X6Y A;  1E3P A;  1L0O C;  2V7F A;  3A0H C;  2OU2 A;  3CUQ A;  1VQM I;  3RTR A;  2R7F A;  2X6W A;  1MJ9 A;  2Q0O A;  4L5J A;  1XSD A;  1X3U A;  1JKO C;  1YS6 A;  4M71 A;  2EH3 A;  2YX4 A;  2IS2 A;  1BOA A;  3GZ5 A;  3HB9 A;  1ETW A;  5KAI C;  1Z3X A;  1I6H J;  3TO6 A;  3L7W A;  2P5K A;  2BVL A;  2VQC A;  3E7L A;  5LGT A;  4RB3 C;  1IF1 A;  5J47 A;  3ASO H;  4XLA A;  4XOT A;  1A36 A;  1PVE A;  4AID A;  4A93 J;  2L4A A;  3W2W A;  1MNM C;  2PJR B;  2GOM A;  5GAE J;  4IJA A;  3L2U A;  4I98 B;  1AOY A;  5ILU A;  3GFM A;  5JVT A;  2NRA C;  2YR2 A;  4C9Y A;  4KYW A;  2JSC A;  3K4C A;  1WFX A;  1YX3 A;  3PFI A;  3CCE I;  3OYL A;  3H35 A;  1ON1 A;  2KHM A;  1GV2 A;  2G0E A;  2F6C A;  5L3G A;  1U5T B;  1WH5 A;  1WJA A;  1FOX A;  1S7O A;  3FDY A;  2R0Q C;  4ZYA A;  1FP2 A;  2MLG A;  2M45 A;  3QYB A;  4V2G A;  1F4K A;  2LY1 A;  3E6M A;  3S2D J;  1O7L A;  3S32 A;  3TOA A;  2XF5 A;  1GVJ A;  3VDX A;  4Y15 A;  4CZZ A;  2K02 A;  4BEH B;  4Y52 J;  4RB2 C;  1HW2 A;  2MW8 A;  2KQR A;  4PFO A;  4IHT A;  3IHU A;  1P9Q C;  4PGG A;  3IAS 2;  1WJB A;  2IA1 A;  4LFU A;  1SVM A;  1ITY A;  1S8N A;  4B8X A;  2A05 A;  3H0G J;  2B63 J;  4A69 C;  3WG9 A;  4RAF A;  3CDI A;  2K85 A;  4M3G A;  2JUC A;  1K78 B;  1SAU A;  1EA3 A;  3KZZ A;  4MGR A;  4XK4 A;  5JR3 A;  1LFB A;  2K9Q A;  5ED4 A;  3AG1 H;  4PFP A;  1XSX A;  2Z16 A;  3ABU A;  2JPB A;  1TL8 A;  1BIB A;  1BC8 C;  2BY2 A;  2E7X A;  2OZU A;  3I3L A;  3KP4 A;  1LFP A;  5B3S H;  2OPT A;  4DZJ A;  2PMH A;  2Y2Z A;  3ECO A;  1Z05 A;  2EZI A;  3BG6 A;  4HX4 A;  1P92 A;  3MVP A;  3TQN A;  4ZYG A;  5FLX Z;  1NH3 A;  2COB A;  2VQL A;  2GXA A;  3D0S A;  4JOM A;  3K4J A;  3CES A;  4F92 B;  1RR7 A;  4JQF A;  5AIP A;  2NNY A;  1YIO A;  6PAX A;  1D0X A;  1ETX A;  1O4X A;  1M1E B;  2IGN A;  2V6C A;  2M30 A;  4EVI A;  2HXO A;  2OZ6 A;  3NQO A;  4HV5 A;  3ABT A;  1FX7 A;  2CG4 A;  5D6E A;  4WK8 F;  4XR6 A;  2LTP A;  2P7C B;  5LEK A;  3GW2 A;  3HRS A;  3CCM I;  3K4M A;  3ABM H;  3DXJ F;  2J5P A;  1E0E A;  1O3R A;  1YRN B;  2HDW A;  1OR7 C;  4BQN A;  3LSM A;  3BR5 A;  3K4N A;  2R7T A;  2KJB A;  5CVR A;  2XPV A;  3DPT A;  2W4S A;  1R58 A;  3CCJ I;  3H0D A;  2BOL A;  4F93 B;  1POG A;  2ZSH B;  4IHY A;  2DA2 A;  4I99 C;  2LYC A;  1R00 A;  1TTY A;  4AC0 A;  1S5L C;  2DOA A;  3C18 A;  4GRI A;  1EH6 A;  2P5V A;  2OAZ A;  4MQ9 F;  1MKM A;  3BZK A;  1Z91 A;  1VQO I;  5CLS A;  2HQA A;  2LK2 A;  4BHB A;  3CMY A;  2H27 A;  4GFB A;  1P6R A;  4Y4R A;  3G73 A;  3ZN1 A;  2DA4 A;  1BN5 A;  2W82 A;  1R36 A;  1UG2 A;  3MKW B;  2VIX A;  1RUN A;  3HTS B;  5EEA A;  2WC2 A;  2QZ8 A;  3BR3 A;  3RYR A;  1FSH A;  3K2Z A;  1LUJ B;  5CVV A;  2IS4 A;  3FHZ A;  2ECB A;  4RM2 A;  3BPV A;  4CO8 A;  1OR7 A;  3CCL I;  1ETY A;  3AL0 C;  2BVM A;  2HS5 A;  4OIO F;  1H0M A;  5FFZ A;  2OTJ I;  2DK5 A;  3ZQL A;  3JW4 A;  3L9F A;  2QM3 A;  1KON A;  2M5W A;  5GAG J;  1TT5 B;  4KIB A;  4MTE A;  2ME6 A;  1OKR A;  2NXN B;  4YII A;  5KNL A;  1ZQ3 P;  2DOE A;  3WOD F;  3NEU A;  4V2F A;  1GDT A;  5BPI A;  4HRI A;  3H9Q A;  3GX4 X;  1QPI A;  5BPD A;  1T6S A;  2EB7 A;  3J81 Z;  3BG3 A;  4CYC B;  3IH2 A;  4Z6Y A;  3AKZ A;  1GXP A;  5E3M A;  3EYI A;  1JUM A;  1EF4 A;  4A3B J;  1R1T A;  1R1V A;  1IRG A;  1I3Q J;  2JVG A;  2P4W A;  3O3K A;  1B8I B;  2EIK H;  2X9D A;  1P7J A;  4C3H J;  1T39 A;  2VJJ A;  3ZRG A;  2N8G A;  1FSE A;  2M0M A;  1XGO A;  1KU9 A;  3M4O J;  2R3S A;  3J80 Z;  1BJA A;  4M73 A;  2D5V A;  4E7Z A;  2WTE A;  1ZRC A;  4M3D A;  2LKX A;  1FYL A;  2F5C A;  1MMN A;  1XDU A;  4E7H A;  4L9T A;  3B6C A;  3BG9 A;  1A5J A;  5L3C A;  1MSE C;  3RSN A;  3PO3 J;  2R93 J;  3FXL A;  4Q4Z F;  1HW5 A;  1Q1H A;  1JT0 A;  4BL0 B;  1NK3 P;  3ZQF A;  1K83 J;  3EQL F;  1BBY A;  2ICW G;  3IKV A;  1TNT A;  5DCM A;  3E0J B;  2DMQ A;  3AG3 H;  1REP C;  2CUZ A;  1ETO A;  4PGH A;  2L9V A;  4M3B A;  2E1M C;  3O6B B;  2JQ7 A;  1OJL A;  4NQW B;  4PUS A;  1NTC A;  3CD6 I;  3CCR I;  3HZJ A;  1YIJ I;  1PUF A;  5DV5 A;  1MJA A;  2L4M A;  4NC8 A;  1SD6 A;  1TT0 A;  2QQB A;  2K86 A;  3OMY A;  2H6B A;  2KL4 A;  4XLP F;  4L5E A;  4P96 A;  5TJJ A;  4E7S A;  5B66 C;  1OPC A;  2XF7 A;  1J9I A;  1X19 A;  1Z6R A;  4ZTF A;  2HPM A;  2M87 A;  4EAT A;  2KPM A;  1I3A A;  5J1R A;  2ZME B;  3BWG A;  3ECH A;  3JRI A;  1YFH A;  5LLQ A;  4DOZ A;  3F6V A;  3HBL A;  3VOD A;  4Q48 A;  3LSR A;  5EJC A;  1BI1 A;  3VYU B;  1TWF J;  2A61 A;  1VQL I;  3L2V A;  3PNT A;  4RGU A;  4OMZ A;  2BXY A;  3LQQ A;  3OIO A;  3JRG A;  4XKB A;  2CV0 A;  2NOJ B;  1D3Y A;  5CQE A;  4A2U A;  4HA8 A;  5K7H A;  4JX6 A;  4YRV A;  5M5X J;  3RPU D;  2LMD A;  3MMY B;  5FD6 A;  2EBI A;  4N4O B;  1CGP A;  3CDH A;  5HDK A;  3K0L A;  2ADU A;  4F3Q A;  4Y33 A;  4I0B A;  2GA1 A;  3REO A;  1DU0 A;  2FSW A;  5J4Y A;  5EG0 B;  2JA5 J;  5FD5 A;  1R5G A;  5GTI C;  3F8C A;  3ZQQ A;  3NAR A;  1D0Z A;  3HYI A;  5FFX A;  3NWS A;  1MBK A;  3K1N A;  4GYG A;  2R5Z A;  3PL8 A;  5BNG A;  4A3C J;  3KEO A;  2F4O B;  2XGC A;  1XGM A;  5H6Q A;  1KU2 A;  4IZZ A;  2M8G X;  4UV9 A;  2GAU A;  2PBI A;  2TDX A;  3MN2 A;  3A2K A;  2DLL A;  1W5T A;  2L2O A;  2WBM A;  3DTE A;  1UG0 A;  3OYF A;  5JVG F;  2RAE A;  4I7H A;  5E8G A;  1ZG3 A;  4FE4 A;  3Q3S A;  1SD5 A;  1IJW C;  3KP2 A;  3VPR A;  1T0F A;  2W85 A;  2WAQ N;  3B6A A;  2XDV A;  1LKX A;  3V7C A;  2BW3 A;  1UHW A;  2VPL A;  4AUX A;  5HVQ C;  4M6X A;  1ZG5 A;  4BEH A;  2ESN A;  3PIP F;  3PQK A;  4CUG A;  1WKM A;  5J8F A;  3I59 A;  3W6J B;  1G2H A;  3BTC A;  2M7A A;  3EDP A;  3P9C A;  2F5D A;  1JJ8 C;  3LFK A;  2KLO A;  1VQ4 I;  2XAJ A;  2QQ8 A;  1ZRF A;  4OOI A;  1J0R A;  1HQC A;  1ZK8 A;  2A68 F;  3BR1 A;  1VQP I;  3OOP A;  5J4V A;  5C4X J;  2BXZ A;  3F8N A;  5KVR A;  4HEA 2;  2JTV A;  1HDD C;  3S15 J;  3LWF A;  3PNV A;  3M1E A;  3H5N A;  1XMK A;  2XPU A;  2EV6 A;  3ABK H;  3HOS A;  3S3M A;  1TWH J;  3PIO F;  4YEJ A;  2R4G A;  1MJB A;  3DTI A;  1K61 A;  1VI0 A;  3L2C A;  3OIQ A;  4ZZD A;  3MAJ A;  3NAU A;  1IDY A;  2NOG A;  2MH2 A;  4FX0 A;  4P9U A;  4GGG A;  4B3X A;  1ZAR A;  4P9F A;  1U78 A;  1VQ5 I;  4B09 A;  1SFX A;  3I53 A;  1LDD A;  3H9G A;  5E3O A;  3J80 K;  1R6R A;  5CKT A;  2ZO4 A;  3DEU A;  2LFB A;  4GO1 A;  4JX4 A;  4DNC A;  3PUB A;  4A0X A;  1MBJ A;  4A3K J;  1HBX G;  3RQI A;  2DDB A;  3HRT A;  2M34 A;  5E8I A;  3OYI A;  3KZI C;  2JT1 A;  1IN8 A;  3TW7 A;  3GF2 A;  3B02 A;  1P7I A;  3CZ6 A;  4WCG A;  2LDU A;  3RJP A;  2DW4 A;  1QZE A;  4M6V A;  3JAM Z;  4PJM A;  5EYR A;  1AWC A;  2P6S A;  2VC1 A;  2O3F A;  3VSL A;  2ZJP F;  4ZYE A;  3MKY B;  4ZZL A;  3M3Y J;  4NUB A;  3MD2 A;  3PSF A;  2ZB9 A;  5CQG A;  2O5R A;  1KU7 A;  2F5V A;  3KZY A;  1RPW A;  1SVL A;  4QPQ A;  5C4J J;  3OYA A;  1HKT A;  1LDJ A;  1DGW Y;  3SJM A;  5HOD A;  4WXD A;  2EA4 A;  4U0Y A;  4F52 A;  3SFI A;  3MZY A;  5LGN A;  2STW A;  4HLY A;  3BZC A;  2I8D A;  2UV1 A;  5GPA A;  1RES A;  1ZTR A;  1W36 C;  2LH9 A;  1UZC A;  4HST A;  4XRM A;  2ZFU A;  3RCO A;  2DN0 A;  2KRF A;  3KLO A;  3CO6 C;  2IRF G;  1W7P D;  1RNL A;  2R7O A;  3GXO A;  5J3L A;  3TKY A;  2FEZ A;  2KIS A;  2H09 A;  2CUJ A;  4ESF A;  5LBQ A;  4BHC A;  3V7S A;  2F5F A;  1YW8 A;  3TP3 A;  4E7L A;  2KJC A;  3DEE A;  3F23 A;  4CDG A;  3L00 A;  4BXU A;  5CVU A;  3Q5F A;  1R49 A;  3VYT B;  3U1K A;  4LK0 F;  1YRN A;  1F9N A;  4QLC U;  5F1J A;  5AIQ A;  4M3F A;  5IOY A;  4OMY A;  1V5E A;  1KZH A;  3BR6 A;  5HNF A;  2VQH A;  2W1O A;  4ZDO A;  1P4X A;  3CME I;  3I56 I;  5FLV A;  1ZH5 A;  3FBN B;  1B9N A;  2NS0 A;  2D1V A;  1WH7 A;  2FOW A;  3TO7 A;  5IP9 J;  5L3E A;  4B4C A;  4LJZ F;  3F8M A;  4N4N B;  5JHU A;  2D45 A;  2R7R A;  3R0J A;  2Q2E A;  5E1X A;  3DTK A;  3PFY A;  2ACJ A;  1QVT A;  1GXQ A;  2KIQ A;  1IW7 F;  2XF6 A;  1LVK A;  2VL8 A;  1X58 A;  2RN7 A;  1T08 B;  2EIN H;  3G1O A;  4ESJ A;  4B48 A;  2L9R A;  2COM A;  3OYD A;  3H9J A;  4XLE A;  3CMA I;  2KIU A;  3P7N A;  2IT0 A;  2FJ1 A;  3IRR A;  4I02 A;  4J00 A;  3SFZ A;  3GTQ J;  4YFK F;  2IGO A;  1ZRE A;  3LA2 A;  3SEQ A;  3ABL H;  1IN4 A;  1KU3 A;  4KDP A;  2UXX A;  3HOZ J;  5BMZ A;  5DS9 A;  3CTA A;  2CV2 A;  1D5Y A;  4DW6 A;  4MEX F;  1ZGA A;  1HF0 A;  4KIG A;  3QPH A;  3FBI B;  4PSX A;  3CC7 I;  2ZBK A;  2OD5 A;  3LFU A;  5CVI A;  4RB0 A;  2A5Y B;  2KZG A;  1D5V A;  3CQZ J;  4BKX A;  1I27 A;  3B73 A;  3U21 A;  4B3A A;  4BDY A;  4JX5 A;  2F2E A;  5D4R A;  4MQV A;  1BW6 A;  3KEQ A;  2ZNY A;  1ETQ A;  1J75 A;  2PX9 A;  2W25 A;  2KIM A;  2EPF A;  3AAF A;  3HIF A;  1FYM A;  2Y48 A;  2IVM A;  2NS7 A;  1H89 C;  4FHT A;  3OIP A;  5IYB J;  2AQE A;  4DGW B;  5IYC J;  2LP0 A;  3G4S I;  2OJE D;  3VB2 A;  1SD7 A;  3LSI A;  3LQR A;  2K9M A;  2VOP A;  1FMW A;  4MFD A;  4UUT A;  3ERM A;  3JAM K;  2IP2 A;  4AU7 A;  4QWQ A;  2VBX A;  3CUO A;  1XDS A;  1GHC A;  1T56 A;  4XSX F;  4CCO A;  3PJR A;  3FK7 A;  2XHK A;  5DCF A;  2YSR A;  5GP9 A;  3P5J A;  2E1C A;  1S7E A;  2ZXW H;  1A04 A;  2KRH A;  3M1C A;  1K4S A;  2VKH A;  4LK1 F;  1FOW A;  1QHG A;  5IPA A;  4YG2 F;  1I1S A;  1BR1 A;  5D5U B;  2IBD A;  3EUH A;  5HLH A;  5KAF C;  3D1N I;  2R5Y A;  2XGD A;  2A5W A;  2BY3 A;  3ZXS A;  3CCU I;  1UFM A;  2ZXJ A;  4BJT A;  2E2H J;  3I4N J;  4HQE A;  3JRA A;  3C2G A;  2IEK A;  5DD8 A;  4E7I A;  1IO2 A;  3S1R J;  4C2U A;  3MWM A;  1OCZ H;  1XB4 A;  3BOQ A;  1Z9C A;  5D5W B;  2WAE A;  2O0Y A;  4MTD A;  1ONV A;  1X2N A;  2QVO A;  4WXH A;  1ZYR F;  4IOA F;  4XLN F;  2EFQ A;  2CQK A;  5D5X B;  3GTL J;  4HZF A;  3ZP5 A;  3H5R A;  2L7F P;  2H8W A;  1PYV A;  2ISY A;  4L5I A;  2XKP A;  3EYY A;  1MBG A;  3BZ6 A;  2OTL I;  2JA6 J;  3C2H A;  2H94 A;  4HAM A;  2XIG A;  4EM0 B;  2LG4 A;  5ILV A;  2KDZ A;  5EDN A;  4RAG A;  5DEQ A;  2LRD A;  1FC3 A;  1OQY A;  1XX5 A;  3WTU C;  4EEF G;  4KMF A;  5JHF A;  1D1A A;  5FKM A;  2P8T A;  5LFA A;  2L9S A;  2BE5 F;  2IA2 A;  2VQG A;  3D5S C;  3K4K A;  2CMP A;  4ON0 A;  1TP4 A;  1KGS A;  4P5O A;  3QRF F;  1GV5 A;  2EFP A;  2FQ3 A;  3IH4 A;  1DP3 A;  1X1D A;  3DBH B;  4A0Z A;  3OYK A;  4Y17 A;  3TL4 X;  2ZJ2 A;  5E1W A;  1HKQ A;  2L7Z A;  3N05 A;  2RV8 A;  2JRM A;  1RUO A;  1RC9 A;  2ELJ A;  2V1U A;  1X4O A;  2FNA A;  2BW3 B;  3CUQ C;  1V54 H;  4PK4 A;  5F08 A;  3D5R C;  3JSO A;  1YJW I;  4UB6 C;  3GBG A;  3HKZ A;  4D5C A;  3VWB A;  3DEW A;  2ELH A;  4S04 A;  2HI3 A;  2HVS A;  2NS8 A;  2YU9 J;  1N78 A;  2WB1 A;  1NHA A;  2DFE A;  4HPQ A;  4ASN A;  3VYS B;  1WGX A;  3CLO A;  2VUM J;  2ZME A;  3JTH A;  3OYG A;  4O5V A;  1YI2 I;  3LA7 A;  3GUD A;  2IXS A;  4C3I J;  4XKC A;  1Z0X A;  3BCA A;  5DCM B;  3QWL A;  3KLN A;  3O8G A;  1FOY A;  3JSP A;  3CLQ A;  2GXB A;  2PG4 A;  1HDP A;  2BV6 A;  5IP6 A;  1FIP A;  5FJ8 J;  3M07 A;  3MCZ A;  4W1U A;  3WTW C;  3FMS A;  1LEA A;  1B59 A;  2RVC A;  3FMQ A;  3CP8 A;  4W97 A;  4IVN A;  4DYC A;  3GTP J;  2V4J C;  2PN6 A;  4IO9 F;  2E71 A;  1FZP B;  3ZOB A;  3T5X A;  2JMW A;  3HRM A;  1E3H A;  3BTI A;  2O8X A;  3BR2 A;  4AWX B;  4HDV A;  5EGO B;  2UXN A;  5AON A;  5JLX A;  3HL2 A;  2VJ4 A;  1B72 B;  3QU3 A;  5L3F A;  2YPR A;  1CF7 A;  2L7K A;  2XAS A;  5F0C A;  2AS5 F;  4XNF A;  3J7Y J;  2HQR A;  4NHJ A;  3LSP A;  3G6E I;  3K70 D;  3T1B A;  4RAY A;  5L3B A;  1WZ2 A;  5M5W J;  4LG0 B;  2V6E A;  3RKY A;  3QAH A;  3DP7 A;  3J7Z I;  4AYB A;  4KNY A;  4BQQ A;  2ID3 A;  4PJ0 C;  3GO5 A;  3OS0 A;  1J59 A;  2IJL A;  2R7Z J;  1IG7 A;  1S6L A;  2XB0 X;  3HOY J;  4QSH A;  3GTG J;  5C44 J;  1UJ8 A;  3JTG A;  1JT6 A;  1MIJ A;  2VAS A;  1GLN A;  4MO7 A;  4S05 A;  5BOX A;  2CH0 A;  1F5T A;  4CHU A;  4P55 A;  4BS9 A;  1BR2 A;  1VZ0 A;  5F1R A;  3FXQ A;  1BIA A;  4LIU A;  4BXF A;  2FRH A;  2Y75 A;  3I59 B;  2HVR A;  3QYE A;  1LVA A;  5F0F A;  1IUY A;  2ZJQ F;  3TO9 A;  4O3M A;  3BJA A;  2R5Y B;  3GTK J;  3VOE A;  2WB1 N;  1X4P A;  2XKO A;  3K2A A;  2XAH A;  3BPX A;  3K4L A;  2DXI A;  3S3N A;  4LIV A;  3KYC B;  2RGV A;  3K1P A;  4PSW A;  1W1W E;  4G6T B;  4R1H A;  2RNJ A;  4XL9 A;  2UUZ A;  3NRV A;  2PMZ N;  5A2Q Z;  2YUS A;  2D2W A;  3FX3 A;  3MKZ A;  2MAB A;  1SAX A;  1XMX A;  2WAQ A;  1IXR C;  4ABZ A;  1YJ9 I;  3FWE A;  3RKW A;  2HOS A;  5HS7 A;  3S1N J;  3HG9 A;  4CYC A;  1ZHF A;  3GCM A;  4HNU A;  3G1M A;  2TRT A;  3FXU A;  3SDB A;  3CO7 C;  2A6H F;  1R1U A;  3SDG A;  3QPT A;  4G12 A;  2K4J A;  2FBI A;  2GA2 A;  3L2R A;  1N75 A;  2JSP A;  3SZG A;  5LD2 C;  3C7J A;  1JKP C;  2LY9 A;  3NWT A;  1EH8 A;  3IH3 A;  2V26 A;  5LGU A;  2DMU A;  5K7F A;  3K6G A;  4EQQ A;  2ZXI A;  4AVP A;  2Y9Y A;  3ZMD A;  2UZK A;  1Y1V J;  3U1D A;  2DFF A;  4G94 A;  3O8H A;  2QSF X;  2QLZ A;  4LGW A;  3WTT C;  1WJD A;  2EFW A;  4KIC A;  4RLF A;  2FMY A;  1T0F C;  3I4M J;  1SVO A;  3L2W A;  3OYE A;  3S16 J;  1YQA A;  3I58 A;  2LKS A;  1BJZ A;  1F1Z A;  5H2F C;  4A3G J;  5LEJ A;  2XRL A;  2E36 A;  4A0Y A;  3LSK A;  4RM3 A;  3WTS C;  2ME0 A;  1V5G A;  3DKY A;  1SC7 A;  2QBY A;  2AO9 A;  2X48 A;  5HLG A;  3HSF A;  3RDI A;  1SD4 A;  3CCS I;  4EGY A;  4BAC A;  1ZLK A;  3HOW J;  2IA0 A;  5HS9 A;  3ZN0 A;  2STT A;  2YS9 A;  3M9A A;  1NG6 A;  2CYY A;  3OYJ A;  5B5E C;  3ZQG A;  3E1S A;  1MD0 A;  5E1Z B;  4BGD A;  2K3P A;  5DYM A;  2LBF B;  1FOK A;  2LSO A;  2ZJR F;  5FO5 A;  5FLM J;  3KIO A;  3RZO J;  3G3Z A;  4KJZ A;  2HDD A;  3DQV C;  4MLO A;  3K10 A;  1O7F A;  5GAD J;  1IRX A;  5E18 F;  1ON2 A;  1U9N A;  2A69 F;  4XOR A;  1UAA A; 
#chains in the Genus database with same CATH homology
 4UVC A;  4CXF A;  1S7A A;  2E7W A;  2HKX A;  1RI7 A;  4EM1 A;  3GFJ A;  4IRI A;  1MZB A;  5FLX K;  4MNU A;  3KP3 A;  2CWE A;  4D0P A;  1ZLJ A;  2XVC A;  4GXO A;  4EMS A;  1KA8 A;  1JHH A;  1XCV A;  4FX4 A;  3T0Y A;  3FF5 A;  2DBB A;  1PUE E;  3WTV C;  1LNW A;  4U7B A;  1LQ1 A;  2FE3 A;  3TOB A;  3RI4 A;  3H3U A;  1KQ8 A;  2V9V A;  2M1B A;  1TQM A;  4H0E A;  3ZMT A;  4EM2 A;  4HF1 A;  1W4M A;  5CJ9 A;  5BS6 A;  3EET A;  3E6C C;  3HTU A;  2HDC A;  3E3V A;  1QBJ A;  1FP1 D;  2XAQ A;  4O6J A;  1HW1 A;  1IXC A;  4I0A A;  4KT5 C;  2HTJ A;  3E5X A;  2H6C A;  2L54 A;  1DDN A;  2X0L A;  2QYO A;  3ZQ7 A;  2EFN A;  1UB9 A;  1Y0U A;  1K6O A;  5D6F A;  2HTS A;  3M7G A;  1CF7 B;  4EJO A;  4M74 A;  1BI3 A;  3GZ6 A;  1DP7 P;  2Z33 A;  2EFO A;  3KP7 A;  1PDN C;  3HRU A;  1QGP A;  4JK1 X;  4YFN F;  4HBL A;  2FOK A;  1L3L A;  3BP8 A;  3I0T A;  2L3D A;  1V3F A;  1D8J A;  2DTR A;  2C6Y A;  3DPL C;  5LRR A;  1U2W A;  3KP6 A;  1TQI A;  2QEN A;  3WU0 A;  1XD7 A;  5DUK A;  1P4A A;  1ZRD A;  2DI3 A;  4N9H A;  2FML A;  3I71 A;  1SMY F;  2W57 A;  2VE8 A;  3BRO A;  5DD4 A;  3Q9V A;  3O2P E;  5J6X A;  4UVB A;  2EWN A;  3GYH X;  2GXG A;  2XAG A;  1TW3 A;  1O3T A;  4ZYH A;  4LB5 A;  5K1Y A;  2KKO A;  5HDN A;  3N97 A;  1K7A A;  4I01 A;  1ODD A;  5ILS A;  1TLH B;  2K4B A;  3H92 A;  5J8C A;  2FBK A;  3E5U A;  4XSZ F;  1P4W A;  4RGR A;  2QQA A;  4MEY F;  2LKP A;  1DPU A;  1V4R A;  4HLX A;  5D8L B;  1WWX A;  4LLL A;  4OIN F;  1G3W A;  4EV0 A;  2M8E A;  1J2X A;  4L9N A;  5H6R A;  1XCB A;  4I2O A;  3LAJ A;  1SFU A;  2XRO A;  1FNN A;  2O61 A;  2NAZ A;  4G6Q A;  1EV7 A;  2O03 A;  5D8K B;  3R61 A;  1G3T A;  4CYD A;  2EA2 A;  2PQ8 A;  2Z99 A;  4KUM A;  4KN4 X;  3SQN A;  3HUG A;  2P5L C;  2CO5 A;  1MDM A;  3GFL A;  1G3S A;  3I5U A;  1IRF A;  2BBY A;  2CSO A;  4MHG A;  2KIF A;  1KQ9 A;  4IRG A;  2OQR A;  1K79 A;  3LA3 A;  4NQW A;  2DAO A;  2XGX A;  2EJR A;  3E6B A;  2WWY A;  4IPA A;  2MLK A;  4WWC A;  1YG2 A;  3WTY C;  3BY6 A;  4YIF A;  4IRH A;  1QZY A;  2K27 A;  3MQ0 A;  2MBF A;  4YFX F;  4K2E A;  1S29 A;  2PJP A;  5EEH A;  1FBS A;  3BJO A;  4U7D A;  1C0W A;  1YTY A;  3FM5 A;  3E6D A;  4OU0 A;  2HGC A;  2QQ9 A;  3HOT A;  1IN6 A;  3M8E A;  2A07 F;  1YYV A;  4LD5 A;  2BYV E;  1K78 A;  4EJU A;  2DT5 A;  2VT2 A;  2DK8 A;  1Z7U A;  3ELK A;  5F64 A;  3ZMS A;  3HSE A;  3LAP A;  2RC4 A;  2DPU A;  2EV5 A;  2RKH A;  2PI0 A;  3DF8 A;  5LHH A;  1YO5 C;  1MDM B;  2MH9 A;  2Q8K A;  3QOP A;  2FXA A;  4ENK A;  1XMA A;  2YU3 A;  4WF2 A;  1BM9 A;  4EJV A;  3GVA A;  4DQ2 A;  4LB6 B;  1I1G A;  2V1X A;  2P7V B;  3ULQ B;  4BYY A;  4KA4 A;  1B9M A;  1O3Q A;  4EGZ A;  1P2F A;  5K5Q A;  1E17 A;  4AD9 A;  4WX9 A;  1JHF A;  5HS8 A;  4F7Z A;  1XN7 A;  5ICF A;  4G7Z F;  4IHS A;  5LRS A;  2NNN A;  4IXA A;  3RIR A;  1B4A A;  2VBY A;  2OQG A;  5BQT A;  4Y13 A;  2DQL A;  3DV8 A;  2L02 A;  4HX8 A;  1JGS A;  1IN5 A;  3U9G A;  2IPQ X;  5ICG A;  4NB5 A;  1WI9 A;  3TGN A;  3KFW X;  4XRF A;  4OIQ F;  1G3Y A;  4M9Z A;  3WE2 A;  1J7K A;  3COA C;  2FA5 A;  3RPU A;  1SFE A;  1IN7 A;  2CW0 F;  4G7O F;  3VFZ A;  5LHI A;  1XGS A;  1PP7 U;  3D5L A;  1H9G A;  3L09 A;  1LB2 A;  3GWZ A;  5A2Q K;  3ERE D;  4M9S A;  3FM3 A;  1QPM A;  2RQP A;  2FNP A;  2BEO A;  4ZH4 F;  1W7P B;  2XAF A;  1JE8 A;  2ZNZ A;  5ICC A;  3QP6 A;  3VEP A;  2VBZ A;  3ZMU A;  3SZT A;  4HF2 A;  4AIJ A;  3F3X A;  4G9Y A;  1Z6T A;  4LG0 A;  3OV8 A;  2W24 A;  1I6X A;  1OYW A;  1R23 A;  3F21 A;  3TDZ C;  4L9V A;  4ESB A;  2ZKZ A;  4HQM A;  1MGT A;  4U88 A;  1QO0 D;  1STZ A;  1U5T A;  2DFI A;  2PMU A;  1QQI A;  4M9X A;  4FT8 A;  4HV6 A;  3ZPL A;  3IL2 A;  5CYV A;  1XSV A;  2OBP A;  3U2R A;  2GZW A;  2LF8 A;  4BAY A;  4Z2Y A;  2MA3 A;  5DDG A;  3F22 A;  3C3W A;  3F6O A;  2RDP A;  2QUF A;  3I4P A;  1G6N A;  5K5O A;  3IC7 A;  3GEZ A;  3P9I A;  3I64 A;  2GIV A;  1WRJ A;  3F8B A;  1BC7 C;  2Z9O A;  2PFB A;  4BNC A;  1FY7 A;  5FGM A;  3R0A A;  2G7U A;  2R7D A;  2NYX A;  3GLX A;  4RGX A;  4UUV A;  1DPR A;  4G7H F;  1W7P A;  4R79 A;  4LLN A;  4Q5S F;  2Z3Y A;  3F8F A;  4A6E A;  4ENN A;  3K69 A;  3V7R A;  5ERI A;  4UHT A;  2D1H A;  5JFR A;  4TV7 A;  4E70 A;  2HKO A;  3IRQ A;  1YLF A;  3F72 A;  4R8H A;  1BI2 A;  4RB1 A;  3GFI A;  3IWF A;  1G4D A;  4XBF A;  4A12 A;  2W84 A;  4L9J A;  1R22 A;  4EJW A;  1FYK A;  1OMI A;  3V4G A;  1HXD A;  5L3D A;  3RYP A;  5IT9 K;  3WGH A;  2JRT A;  3MZH A;  2HZT A;  2XV4 S;  1FBQ A;  2YX7 A;  2OA4 A;  2IW5 A;  4L18 B;  2E1N A;  3FMR A;  2HFH A;  1E2X A;  4I09 A;  1TQP A;  4N9I A;  3ML6 A;  4GCV A;  4HDU A;  4WXC A;  2L01 A;  4ENM A;  5EEG A;  3KCC A;  4JBA A;  2Y0M A;  1KYZ A;  3QU6 A;  1YW7 A;  1SMT A;  2XUB A;  3ZMZ A;  5HLI A;  2LNB A;  1OYY A;  1ZGJ A;  4M6Y A;  1ULY A;  5LHG A;  3KET A;  3DFG A;  3Q9S A;  3TDU C;  5D4S A;  1QNT A;  1U5T C;  4L0Y B;  1IAW A;  2HYF A;  1EH7 A;  1XGN A;  3I54 A;  2CFX A;  2EK5 A;  2VOD A;  5DUI A;  5ICE A;  3ROU A;  3V8J A;  3BDD A;  2PEX A;  4RAZ A;  1DUX C;  4Q47 A;  1W5S A;  5H20 A;  5IT3 A;  4ZYD A;  1T98 A;  1ZN2 A;  1TNS A;  3V8L A;  3C1D A;  4U0W A;  2LF7 A;  2HYG D;  2MC3 A;  4BH9 A;  2ESH A;  1FBU A;  3WU1 B;  1FPQ A;  5K5R A;  1D8K A;  1S3J A;  3H3Z A;  2VE9 A;  4OIR F;  4UV8 A;  2GWR A;  1UCR A;  4CIC A;  3R60 A;  2DU9 A;  3LST A;  1HST A;  2QBY B;  2P6T A;  2K7L A;  1ZG1 A;  4BQA A;  3W6K B;  2A6E F;  1ZAO A;  3ISP A;  4KMU X;  2ZFW A;  3CUQ B;  3M8F A;  1I5Z A;  4AIH A;  3T8T A;  2F5E A;  5CVJ A;  1UHM A;  4L0Z B;  3J7A O;  1YW9 A;  4RS8 A;  2FU4 A;  1B6A A;  4HOB A;  3S2W A;  5TRD A;  4N0B A;  4PZJ A;  4LMY A;  2DPD A;  3SHF A;  5HDG A;  2Z5U A;  3BJ6 A;  1H9T A;  4HW0 A;  2MD5 A;  1O57 A;  2FBH A;  3P9K A;  2BGC A;  1T2K A;  3E5Q A;  4BHP A;  4U0V A;  2HEO A;  4AIK A;  2B0L A;  5HOO A;  1T38 A;  3E97 A;  1RZ4 A;  5KK1 A;  3WTX C;  3KE2 A;  3IKT A;  2G7H A;  3SXY A;  4OIP F;  3R6S A;  2AXL A;  3R4K A;  3K1M A;  2UWM A;  5F6F A;  2PLY A;  5JI6 A;  3HSR A;  4EJT A;  4LLG F;  3KP5 A;  1USS A;  1WQ2 A;  1R7J A;  1FT9 A;  3WGG A;  2HQN A;  1BI0 A;  4RGS A;  1OYI A;  3HHH A;  2ZCW A;  2GQQ A;  2JZY A;  3ZMV A;  2WV0 A;  3J81 K;  2DO7 A;  2HR3 A;  1LEB A;  2O6G E;  5FB2 A;  2V1D A;  4A5N A;  1R5H A;  1U8R A;  2G9W A;  4KFC A;  1TBX A;  3QP5 A;  1HKS A;  1KYW A;  1IXS B;  3WE3 A;  1PP8 F;  4A6D A;  1U6G A;  4CGZ A;  2VBW A;  2CGP A;  4KIF A;  2VON A;  2A3S A;  2VXZ A;  1O3S A;  1U3E M;  3WTZ A;  4G6D A;  4A5M A;  5E20 A;  4HYE A;  4ETS A;  4KN7 X;  2HWV A;  5E17 F;  3HHG A;  1FWZ A;  3MEX A;  1LJ9 A;  3IWZ A;  1WSU A;  2QWW A;  2X4H A;  3FXR A;  1QZZ A;  2VOO A;  1RIO H;  2JPC A;  5D5V B;  4ENJ A;  1KQ0 A;  3SZP A;  3DKW A;  4IF4 A;  3K9T A;  2FF4 A;  2ISZ A;  3MFK A;  2EV0 A;  4UVA A;  4G8X A;  2VN2 A;  3N4M A;  3RKX A;  4HX7 A;  1IZ1 A;  2VC0 A;  4HF0 A;  4UNO A;  1TW2 A;  3V8K A;  3T8R A;  3PQJ A;  1HSJ A;  4M72 A;  3CJN A;  1UST A;  3RPQ A;  2HOE A;  4GYI A;  2XRN A;  2VT3 A;  5IT9 Z;  4UXN A;  4PDK A;  1JXS A;  2DQR A;  2V79 A;  2ETH A;  3WGI A;  1B1B A;  3FZV A;  2J5O A;  1LDK B;  1VTN C;  1J5Y A;  1FLI A;  4PCQ A;  1YS7 A;  1Z1D A;  1L0O C;  2OU2 A;  3CUQ A;  3RTR A;  2R7F A;  1MJ9 A;  2Q0O A;  4L5J A;  1XSD A;  1X3U A;  1YS6 A;  4M71 A;  2YX4 A;  1BOA A;  3GZ5 A;  3TO6 A;  3L7W A;  2P5K A;  5LGT A;  1IF1 A;  4RB3 C;  2L4A A;  4IJA A;  4I98 B;  1AOY A;  5ILU A;  3GFM A;  5JVT A;  2NRA C;  2YR2 A;  4KYW A;  2JSC A;  3PFI A;  1ON1 A;  5L3G A;  1U5T B;  1S7O A;  1FP2 A;  2MLG A;  2M45 A;  1F4K A;  3E6M A;  1O7L A;  3TOA A;  1GVJ A;  4Y15 A;  4CZZ A;  2K02 A;  4RB2 C;  1HW2 A;  4IHT A;  3IHU A;  4PGG A;  2IA1 A;  4LFU A;  1S8N A;  4B8X A;  3WG9 A;  1K78 B;  3KZZ A;  4MGR A;  5JR3 A;  5ED4 A;  1XSX A;  3ABU A;  2JPB A;  1BIB A;  1BC8 C;  2E7X A;  2OZU A;  3KP4 A;  2PMH A;  3ECO A;  1Z05 A;  4HX4 A;  3TQN A;  5FLX Z;  1P92 A;  4ZYG A;  3D0S A;  4JQF A;  5AIP A;  2NNY A;  1YIO A;  6PAX A;  2V6C A;  2M30 A;  4EVI A;  2OZ6 A;  3NQO A;  4HV5 A;  3ABT A;  1FX7 A;  2CG4 A;  5D6E A;  4WK8 F;  2P7C B;  5LEK A;  3GW2 A;  3HRS A;  3DXJ F;  2J5P A;  1O3R A;  2KJB A;  5CVR A;  3DPT A;  1R58 A;  1R00 A;  1TTY A;  3C18 A;  1EH6 A;  2P5V A;  2OAZ A;  4MQ9 F;  1MKM A;  1Z91 A;  5CLS A;  2H27 A;  4BHB A;  1P6R A;  3G73 A;  3ZN1 A;  1BN5 A;  1R36 A;  1RUN A;  3HTS B;  2WC2 A;  2QZ8 A;  3RYR A;  1FSH A;  3K2Z A;  5CVV A;  3FHZ A;  3BPV A;  4CO8 A;  1OR7 A;  2HS5 A;  4OIO F;  1H0M A;  5FFZ A;  2DK5 A;  3JW4 A;  3L9F A;  2QM3 A;  2M5W A;  4KIB A;  4MTE A;  1OKR A;  4YII A;  3WOD F;  3NEU A;  5BPI A;  3GX4 X;  5BPD A;  1T6S A;  2EB7 A;  3J81 Z;  1GXP A;  3EYI A;  1IRG A;  1R1T A;  1R1V A;  2P4W A;  3O3K A;  1T39 A;  1FSE A;  1XGO A;  1KU9 A;  2R3S A;  3J80 Z;  1BJA A;  4M73 A;  2WTE A;  1ZRC A;  1FYL A;  2F5C A;  1XDU A;  4L9T A;  5L3C A;  4Q4Z F;  1HW5 A;  1Q1H A;  3EQL F;  1BBY A;  3IKV A;  1TNT A;  5DCM A;  1REP C;  4PGH A;  3O6B B;  5DV5 A;  1MJA A;  2L4M A;  1SD6 A;  2QQB A;  2K86 A;  2H6B A;  4XLP F;  4P96 A;  5TJJ A;  1OPC A;  1J9I A;  1Z6R A;  2M87 A;  2ZME B;  3BWG A;  3ECH A;  1YFH A;  5LLQ A;  3F6V A;  3VOD A;  4Q48 A;  1BI1 A;  2A61 A;  4RGU A;  4OMZ A;  3LQQ A;  1D3Y A;  4A2U A;  4HA8 A;  5FD6 A;  1CGP A;  3CDH A;  5HDK A;  3K0L A;  2ADU A;  4I0B A;  2GA1 A;  3REO A;  2FSW A;  5FD5 A;  1R5G A;  3F8C A;  3HYI A;  5FFX A;  3K1N A;  4GYG A;  3KEO A;  1XGM A;  5H6Q A;  1KU2 A;  4UV9 A;  2GAU A;  2PBI A;  2TDX A;  2DLL A;  1W5T A;  4I7H A;  5E8G A;  1ZG3 A;  1SD5 A;  3KP2 A;  1T0F A;  2W85 A;  3V7C A;  1UHW A;  5HVQ C;  4M6X A;  1ZG5 A;  2ESN A;  3PQK A;  1WKM A;  5J8F A;  3I59 A;  3W6J B;  3EDP A;  3P9C A;  2F5D A;  3LFK A;  2XAJ A;  1ZRF A;  4OOI A;  1J0R A;  1HQC A;  2A68 F;  3OOP A;  3F8N A;  5KVR A;  2JTV A;  3LWF A;  3M1E A;  1XMK A;  2EV6 A;  3HOS A;  1MJB A;  3L2C A;  4ZZD A;  3MAJ A;  2MH2 A;  4FX0 A;  4P9U A;  4GGG A;  1ZAR A;  4P9F A;  1U78 A;  4B09 A;  1SFX A;  3I53 A;  1LDD A;  3J80 K;  4DNC A;  2ZO4 A;  3DEU A;  4GO1 A;  1HBX G;  4A0X A;  3HRT A;  5E8I A;  2JT1 A;  1IN8 A;  3GF2 A;  3B02 A;  4WCG A;  2LDU A;  3RJP A;  2DW4 A;  3JAM Z;  1AWC A;  2P6S A;  2VC1 A;  2O3F A;  4ZYE A;  4ZZL A;  1KU7 A;  3KZY A;  1HKT A;  1LDJ A;  4WXD A;  2EA4 A;  4U0Y A;  3MZY A;  5LGN A;  2STW A;  4HLY A;  2KRF A;  3KLO A;  3CO6 C;  2IRF G;  1W7P D;  1RNL A;  3GXO A;  3TKY A;  2FEZ A;  2H09 A;  4ESF A;  5LBQ A;  4BHC A;  3V7S A;  2F5F A;  1YW8 A;  2KJC A;  3F23 A;  4CDG A;  3L00 A;  4BXU A;  5CVU A;  3Q5F A;  4LK0 F;  1F9N A;  4QLC U;  5AIQ A;  4OMY A;  1P4X A;  1ZH5 A;  1B9N A;  2NS0 A;  2D1V A;  3TO7 A;  5L3E A;  4LJZ F;  3F8M A;  5JHU A;  2D45 A;  3R0J A;  2Q2E A;  5E1X A;  2ACJ A;  1GXQ A;  1IW7 F;  2RN7 A;  4ESJ A;  2COM A;  2KIU A;  3P7N A;  2IT0 A;  3IRR A;  4I02 A;  3SFZ A;  4YFK F;  1ZRE A;  3LA2 A;  1IN4 A;  1KU3 A;  4KDP A;  2UXX A;  5BMZ A;  3CTA A;  4MEX F;  1ZGA A;  4KIG A;  3QPH A;  2ZBK A;  2OD5 A;  5CVI A;  4RB0 A;  2A5Y B;  1D5V A;  1I27 A;  3B73 A;  2F2E A;  5D4R A;  4MQV A;  3KEQ A;  2ZNY A;  1J75 A;  2W25 A;  2KIM A;  3AAF A;  3HIF A;  1FYM A;  2Y48 A;  2IVM A;  4FHT A;  3VB2 A;  1SD7 A;  3LQR A;  2VOP A;  3JAM K;  2IP2 A;  4QWQ A;  2VBX A;  3CUO A;  1XDS A;  1GHC A;  4XSX F;  2XHK A;  5DCF A;  2YSR A;  2E1C A;  1A04 A;  4LK1 F;  4YG2 F;  1I1S A;  5D5U B;  3EUH A;  5HLH A;  1UFM A;  2ZXJ A;  4HQE A;  5DD8 A;  3MWM A;  1XB4 A;  3BOQ A;  1Z9C A;  5D5W B;  2O0Y A;  4MTD A;  1ONV A;  2QVO A;  4WXH A;  1ZYR F;  4XLN F;  2EFQ A;  2CQK A;  5D5X B;  4HZF A;  3ZP5 A;  2ISY A;  4L5I A;  2XKP A;  3EYY A;  3BZ6 A;  4HAM A;  2H94 A;  4EM0 B;  2XIG A;  5ILV A;  5DEQ A;  1FC3 A;  3WTU C;  4KMF A;  2P8T A;  2BE5 F;  2IA2 A;  4ON0 A;  1KGS A;  4P5O A;  3QRF F;  2EFP A;  2FQ3 A;  4A0Z A;  4Y17 A;  2ZJ2 A;  5E1W A;  1HKQ A;  2RV8 A;  1RUO A;  2V1U A;  3CUQ C;  2FNA A;  3JSO A;  2ELH A;  4S04 A;  1NHA A;  4ASN A;  3CLO A;  2ZME A;  3JTH A;  4O5V A;  3LA7 A;  3GUD A;  5DCM B;  3KLN A;  3JSP A;  2GXB A;  2PG4 A;  2BV6 A;  3MCZ A;  3WTW C;  3FMS A;  1LEA A;  1B59 A;  2RVC A;  3FMQ A;  4IVN A;  2PN6 A;  1FZP B;  3T5X A;  3HRM A;  2O8X A;  4AWX B;  4HDV A;  2UXN A;  5AON A;  3QU3 A;  5L3F A;  2YPR A;  1CF7 A;  2XAS A;  2AS5 F;  2HQR A;  4NHJ A;  3T1B A;  4RAY A;  5L3B A;  4LG0 B;  3RKY A;  3QAH A;  3DP7 A;  4KNY A;  3GO5 A;  1J59 A;  2IJL A;  1S6L A;  3JTG A;  4S05 A;  5BOX A;  1F5T A;  4CHU A;  4P55 A;  5F1R A;  3FXQ A;  1BIA A;  2FRH A;  2Y75 A;  3I59 B;  1LVA A;  1IUY A;  3TO9 A;  4O3M A;  3BJA A;  3VOE A;  2XKO A;  2XAH A;  3BPX A;  2RGV A;  3K1P A;  4R1H A;  2RNJ A;  3NRV A;  5A2Q Z;  2D2W A;  3FX3 A;  1SAX A;  1IXR C;  3FWE A;  3RKW A;  5HS7 A;  1ZHF A;  3FXU A;  3CO7 C;  2A6H F;  1R1U A;  3QPT A;  2K4J A;  2FBI A;  2GA2 A;  3C7J A;  1EH8 A;  5LGU A;  4EQQ A;  4AVP A;  3ZMD A;  2UZK A;  3U1D A;  4G94 A;  2QLZ A;  4LGW A;  3WTT C;  2EFW A;  4KIC A;  2FMY A;  1YQA A;  3I58 A;  1F1Z A;  5LEJ A;  4A0Y A;  3WTS C;  2QBY A;  5HLG A;  3HSF A;  3RDI A;  1SD4 A;  4EGY A;  1ZLK A;  2IA0 A;  5HS9 A;  3ZN0 A;  2STT A;  3M9A A;  2CYY A;  1MD0 A;  5E1Z B;  5DYM A;  1FOK A;  2LSO A;  5FO5 A;  3G3Z A;  3DQV C;  1O7F A;  5E18 F;  1ON2 A;  2A69 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...