3GF2A

Crystal structure of the hypothetical regulator st1710 complexed with sodium salicylate
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gf2A00
2DPUA 3RJPA 2P4WA 1P2FA 4GYGA 4M9ZA 3SFZA 2A6EF 3ZQ7A 3KLOA 2ZMEA 1GVJA 5ILUA 2X0LA 2EA2A 3ERED 2RQPA 2V1DA 2KIFA 4L5IA 1S7AA 2EFPA 3IRQA 3CUOA 2H6BA 5E18F 2MC3A 2H6CA 2F2EA 1FPQA 4QLCU 1OYWA 1E2XA 1F4KA 4EQQA 5DUIA 4P96A 3DF8A 2OAZA 5HDKA 5DD8A 1B6AA 3J81K 4HZFA 2M87A 4YFKF 2V1UA 3WGGA 1HKSA 2G9WA 2QWWA 3CUQB 5KK1A 3L9FA 5BPIA 1F9NA 3FXQA 4EM0B 2A68F 1RI7A 5BMZA 3CJNA 1IRGA 1W5TA 1YTYA 2IA1A 3DV8A 2EFNA 1K7AA 4A5NA 3V7CA 3FMSA 4JBAA 1O3QA 3EDPA 1IN5A 5D5XB 1CGPA 5LGUA 2DBBA 2YR2A 4A0XA 4N0BA 2H27A 3P7NA 2HS5A 2IJLA 5L3CA 3PQKA 2P5LC 4G7HF 1D5VA 1HW2A 1FYLA 2DAOA 4U0WA 2VT2A 1PDNC 2CFXA 5HS8A 2XV4S 4EJVA 1P92A 3HSFA 1JE8A 2HYGD 4EJUA 3E5UA 1FZPB 3FMRA 2UZKA 4EJOA 3ECHA 5TRDA 2A6HF 3F6OA 3B02A 3VODA 2VC0A 2EFQA 3MWMA 3W6KB 3E6BA 3MEXA 1HW5A 1EV7A 4RS8A 2WTEA 1J0RA 2HTJA 3DPTA 3RKWA 2Y75A 1BJAA 2Z33A 4UV8A 2O0YA 3NEUA 1S29A 2M8EA 1TTYA 2MBFA 5CJ9A 3F8CA 3LWFA 4BXUA 5E20A 1F5TA 2K4BA 2JPBA 1IUYA 2YPRA 3U2RA 2KKOA 3QRFF 2VOOA 4KIBA 3HTSB 4KT5C 3LAJA 5DV5A 2HOEA 2DK8A 4G6DA 3CDHA 3GVAA 2ZMEB 1U6GA 4ZYGA 3FM3A 5FFXA 3BP8A 3F8FA 4S05A 1S3JA 1SD7A 4LJZF 4AD9A 2IA2A 1KQ9A 4ZYDA 5JHUA 1BC7C 1BBYA 4HA8A 4ETSA 5D5WB 2H09A 4UHTA 1R5GA 2R3SA 2K02A 5CVJA 1T0FA 1ULYA 1MGTA 2PG4A 3I59A 1B59A 1QQIA 1K78B 3ZMVA 2OU2A 3IWZA 2RVCA 2CG4A 2XROA 4U88A 4LGWA 3F3XA 4RB3C 1WI9A 5D6EA 3GZ5A 3TO7A 3BPVA 4LFUA 3BWGA 1F1ZA 3VB2A 1U5TA 5ILSA 3GO5A 5LGNA 4G9YA 1KU7A 3J7AO 3M8EA 1W5SA 1OR7A 1FSHA 3HYIA 4RAYA 1Y0UA 4XSZF 4B09A 4ZYHA 1JXSA 2NRAC 3RKXA 4BNCA 1IN4A 3Q9VA 4GCVA 3ML6A 2DT5A 2LF7A 2ZBKA 1XDUA 3QAHA 5TJJA 1KYZA 5BS6A 3J80Z 4AIKA 4OIQF 2CO5A 1ZG5A 4RB1A 3IHUA 3G3ZA 3KE2A 2P5KA 3TQNA 1A04A 3GEZA 2QM3A 1Z05A 5ICCA 4UXNA 4LG0A 3WE3A 4RGXA 3U1DA 2ADUA 3I53A 4A12A 4L9JA 1B9NA 4TV7A 3V8LA 2VBWA 1BI2A 3MZHA 3E6DA 3WU1B 4ESFA 1YG2A 4IRGA 2V79A 3ZP5A 2Z3YA 2OZUA 2KJBA 3NQOA 5H6QA 4A2UA 2HKOA 4ZH4F 2FF4A 4PDKA 2K4JA 4S04A 1TQMA 1G3WA 3BJOA 5DYMA 4MQ9F 3WTXC 1YQAA 2EWNA 3KP5A 4ENKA 1T2KA 4Y15A 4K2EA 1P4WA 2GXBA 4KUMA 1IF1A 1J75A 5HLIA 3T8RA 2LF8A 3C18A 5HDGA 1HSTA 1ZRCA 3VEPA 2RN7A 3CUQA 5ICFA 5BOXA 1BM9A 2BE5F 3MQ0A 1I1GA 3JTHA 1ZLJA 3ZN0A 3HHHA 2YX7A 1YW9A 1K79A 1IN6A 3I64A 2MH2A 5H20A 3RPUA 2W84A 4M9SA 4CICA 3E6MA 2FBIA 2L4MA 5KVRA 2RDPA 1GHCA 1LEAA 3LA7A 1FBSA 5K1YA 3ECOA 2JPCA 2HWVA 2HTSA 4HYEA 1TQPA 3CTAA 4Q5SF 2M1BA 1FC3A 2GZWA 3I59B 4PGGA 1B1BA 5LEJA 1LDJA 5DCMA 3HRMA 3KP7A 2W24A 2V1XA 4UVBA 4L18B 1DUXC 2GQQA 1ZRDA 1TLHB 3JTGA 1ZRFA 2OQGA 1W7PB 4GYIA 4Y13A 2CYYA 1I6XA 1T39A 3I54A 2VBXA 1T38A 4O3MA 4O5VA 3L2CA 3I0TA 5BQTA 1ZGAA 2COMA 4KN7X 2ZJ2A 2HEOA 3C1DA 4RAZA 1XGSA 4P9FA 4LLLA 3KEOA 2J5PA 2P5VA 4BHCA 2OQRA 2ETHA 2PJPA 2XGXA 1IN7A 2ELHA 3D5LA 1S7OA 3KP6A 5FD6A 3HRUA 3LQRA 3E5XA 2HYFA 3JAMK 2FMLA 4OINF 4HLXA 1U78A 4Q48A 4FT8A 3F8NA 1QBJA 4EGZA 1NHAA 3R60A 1DPUA 1BI3A 3OV8A 1I27A 2EV6A 6PAXA 1R36A 1IXSB 5ED4A 2QYOA 3V4GA 3R4KA 5AONA 3O3KA 3H3ZA 2QBYB 2XKOA 5D6FA 3JSOA 2JSCA 4FX4A 5EEGA 2TDXA 4HV5A 1TQIA 4E70A 2O61A 3WTTC 1YS7A 5K5OA 2DI3A 1KQ8A 2DLLA 2L02A 2NNYA 5DD4A 3T0YA 1UB9A 4GO1A 1KU9A 1FX7A 1ODDA 1XGMA 2Z99A 1ON2A 2BBYA 1HQCA 1K78A 2QQ9A 3IKTA 4RB0A 4KNYA 3GFIA 5A2QZ 4A0ZA 5L3DA 4B8XA 1JHFA 4G94A 2RKHA 3QP6A 1Z7UA 2A5YB 4D0PA 2EB7A 4P5OA 2OD5A 2W25A 3WG9A 1QZZA 4RB2C 2FE3A 4I2OA 1SAXA 2FBHA 2D1HA 4NQWA 2GAUA 4M6XA 4A6DA 2F5FA 1CF7B 1ZGJA 1YO5C 1FBQA 4WXHA 4I98B 5E1ZB 4MEXF 5FD5A 2RV8A 5D5UB 3WTZA 4NHJA 4BHBA 1STZA 4IHTA 2CQKA 4GGGA 1U8RA 2WV0A 3H3UA 3TOAA 2M45A 2FNPA 2DQRA 3LAPA 1SD4A 3ZMSA 4ENJA 4IJAA 4CXFA 3IWFA 5DCMB 4UVCA 5ICEA 1B4AA 1OKRA 5FFZA 3WTUC 2Z9OA 2JRTA 3L00A 3R61A 3KCCA 2ACJA 1J2XA 2MA3A 3RTRA 3FZVA 2RNJA 4WXDA 3GWZA 4CYDA 1LB2A 5AIPA 4EVIA 2FBKA 3ZMDA 3M9AA 3V7SA 3L7WA 3FWEA 4M6YA 1XN7A 2XHKA 4UNOA 2XVCA 3S2WA 3U9GA 3WTWC 2AXLA 1XB4A 4FHTA 1FBUA 3FM5A 4ZZLA 2UXNA 2FU4A 5IT9Z 3O2PE 4MTEA 5LHIA 2ZNZA 3B73A 1KYWA 4MHGA 2XKPA 1R00A 3FHZA 1YIOA 5L3BA 2HQRA 1U5TC 3R0AA 4MQVA 2VBYA 2Y48A 1RUOA 1BIBA 1IXCA 3ULQB 4OIPF 4YFNF 2DQLA 3O6BB 5FLXK 3GLXA 1WWXA 2UXXA 2QZ8A 2VOPA 1XSVA 2JTVA 1EH6A 4IVNA 3E6CC 2FEZA 2P8TA 4L9TA 5D4SA 1BN5A 1LVAA 3PFIA 4LD5A 4WWCA 4N9HA 3AAFA 2DK5A 2Z5UA 2BV6A 5CVIA 3SZPA 1XSXA 1R5HA 4LLGF 2ZNYA 3K9TA 3V8JA 3EUHA 1MJAA 4I01A 1XDSA 4JK1X 4OU0A 4HDVA 1ZHFA 5F64A 3EETA 1G3TA 1WKMA 4G7ZF 1TBXA 5FO5A 3F22A 3F6VA 2D2WA 5DUKA 2O3FA 2L4AA 1OPCA 2E1NA 1FWZA 3LQQA 5DCFA 1QNTA 4KN4X 3KP2A 1W4MA 2F5EA 3PQJA 4AIJA 1KQ0A 1W7PA 2XIGA 4U0VA 1J5YA 1FP1D 3F23A 1KU3A 3CO7C 3IRRA 3D0SA 1HBXG 1J7KA 5LBQA 2F5CA 1UCRA 3MCZA 3COAC 2EK5A 1V3FA 2A3SA 3WTSC 5ERIA 1FSEA 3BDDA 3C7JA 5ICGA 1USTA 5D8KB 3RIRA 4L9NA 2XAQA 4CO8A 3KEQA 2D1VA 3CUQC 1SD5A 1X3UA 3F8MA 2E7XA 1VTNC 2VE9A 1OYYA 2O8XA 1XCVA 5JI6A 1EH8A 1USSA 2ESNA 3F72A 2VONA 4LB6B 5LRSA 1BOAA 2FQ3A 2QBYA 3I71A 1TNTA 2QLZA 4FX0A 5CVUA 2O03A 3RYRA 3GZ6A 3DXJF 3HSEA 3VFZA 4LMYA 2O6GE 2K86A 4R8HA 2ISYA 3GFJA 2LKPA 1HXDA 5JR3A 2DU9A 2FMYA 2HZTA 1IAWA 4HQEA 4PZJA 4HDUA 1XD7A 1BIAA 4Q47A 1RZ4A 4BAYA 2V9VA 3LFKA 3M7GA 3GXOA 4HF2A 2GXGA 1Z9CA 4L5JA 3QOPA 2FXAA 5LHHA 1O7FA 3K0LA 3C3WA 2FSWA 1IRFA 3P9IA 2CSOA 3WTYC 2L3DA 2MLKA 2WWYA 1QO0D 2XAFA 2EA4A 1Z91A 1BI1A 3J81Z 3EYYA 4G6QA 1ZAOA 4HF1A 4KYWA 5K5RA 3TO9A 2MLGA 1DP7P 4EJWA 4BYYA 1CF7A 3Q9SA 2STWA 5JFRA 1QPMA 4ON0A 1WQ2A 3TGNA 3K1NA 3HOSA 1ZYRF 3HUGA 3SXYA 3W6JB 3KFWX 2VE8A 3K69A 1WRJA 1YS6A 5D5VB 1K6OA 2VXZA 3QP5A 4EM1A 2HR3A 4Z2YA 3QPHA 4XRFA 4EGYA 3Q5FA 3L09A 4JQFA 1YLFA 1LEBA 4I02A 2HFHA 3N4MA 2KJCA 1T98A 2VN2A 1L0OC 1PUEE 2ZO4A 3VOEA 3KZYA 4P55A 1XCBA 4I7HA 3ZN1A 2DO7A 2Q2EA 2ZXJA 2K27A 1U3EM 3V8KA 4RGUA 4EJTA 2DFIA 2DTRA 2PBIA 3GFLA 1PP8F 5HLGA 3T5XA 1O3RA 3ELKA 1P4AA 1Z6RA 3FF5A 3HTUA 4HLYA 1XGOA 3KETA 2DPDA 2YU3A 2L54A 3M8FA 2BEOA 4I0BA 3KP3A 5AIQA 1ZARA 3WTVC 1ZH5A 2GIVA 3HSRA 2Q8KA 1HW1A 2PMUA 4O6JA 3HHGA 3TDUC 1YW8A 2HDCA 1LNWA 2OA4A 2VC1A 3R0JA 2YX4A 1SD6A 1IXRC 3RKYA 4XBFA 1SFXA 2KIUA 2MH9A 2Y0MA 4XLNF 1C0WA 5F6FA 2XAHA 1S6LA 2V6CA 2STTA 5K5QA 2JT1A 1REPC 1I5ZA 1OMIA 3BJAA 4HQMA 3OOPA 2GA1A 4KMUX 3ROUA 2HKXA 2IA0A 4HOBA 1SFUA 1ZN2A 3MZYA 4U7DA 1HKQA 3KP4A 4ZZDA 5LRRA 4OIRF 1I1SA 4I09A 4WK8F 4M9XA 1J59A 1R1VA 3TO6A 5D4RA 2YSRA 3H92A 3TKYA 3JSPA 4ENMA 2QQAA 1GXPA 3E3VA 2PFBA 2G7UA 4M71A 3ZPLA 5D8LB 4PCQA 4OIOF 5DEQA 4HX8A 2LNBA 4L9VA 2W57A 2HGCA 1BC8C 4MTDA 1G6NA 4A5MA 3MAJA 5LGTA 5J6XA 1GXQA 2G7HA 1O3SA 1D8KA 3R6SA 1JGSA 1TNSA 3V7RA 1AWCA 2OZ6A 2F5DA 4M72A 1P4XA 3RDIA 5HDNA 3F8BA 1V4RA 1ZLKA 4A0YA 1YYVA 3G73A 3GYHX 2ZCWA 1PP7U 1IZ1A 1KGSA 1W7PD 5E8IA 1U2WA 2QQBA 4QWQA 4DQ2A 4OMZA 3QU3A 2A07F 2D45A 1S8NA 4AWXB 4IRIA 1L3LA 1Z1DA 2NAZA 3LA3A 1RIOH 3HIFA 3QPTA 2PLYA 2QUFA 4R1HA 2MD5A 1IW7F 4YIIA 4IRHA 1KU2A 2C6YA 2BGCA 3F21A 3DQVC 2L01A 2H94A 1R22A 3HRTA 3I58A 5L3GA 2IP2A 4CHUA 4XSXF 2CWEA 1R58A 3IC7A 4HBLA 3BOQA 1Z6TA 1FOKA 1FLIA 3P9KA 1HKTA 1LQ1A 4L0YB 1MKMA 1EH7A 3NRVA 1J9IA 1TW3A 3K2ZA 5HS7A 3K1MA 2PEXA 5LEKA 1DPRA 2RC4A 1FT9A 3LA2A 1JHHA 3TDZC 1MDMA 4P9UA 1RNLA 3ZMUA 2PI0A 4EMSA 5EEHA 4G8XA 1DDNA 4KICA 2A69F 3MFKA 3GX4X 2PMHA 3FXRA 3E5QA 1R23A 4CGZA 3ZMTA 3BPXA 1O7LA 5FB2A 1LDKB 5A2QK 5E1XA 1O3TA 4UUVA 3GF2A 4EM2A 3BJ6A 2IVMA 2ISZA 2GA2A 1R7JA 2W85A 2DW4A 2XASA 2R7DA 3HRSA 2KIMA 3N97A 1ZREA 2ESHA 1QGPA 5E17F 2K7LA 1MJBA 4HX7A 2EFOA 1UHWA 1O57A 4Q4ZF 2M30A 2QENA 2ZFWA 3RI4A 2FRHA 2GWRA 3KZZA 1LJ9A 4F7ZA 1MJ9A 3K1PA 3SZTA 4N9IA 4GXOA 5CVRA 1FYMA 4XLPF 5E1WA 3GUDA 1ON1A 4U0YA 3ABUA 3LSTA 4OMYA 1SMTA 3IKVA 4WF2A 4HW0A 1FNNA 5FGMA 3IL2A 3BY6A 2XAJA 4MNUA 4ZYEA 3REOA 2VT3A 2ZKZA 5H6RA 1WSUA 4MEYF 4WCGA 2LSOA 3JAMZ 2IW5A 3FXUA 1OYIA 1BI0A 1YW7A 4DNCA 4G7OF 5CVVA 1H9GA 1D8JA 1QZYA 2CGPA 2B0LA 4ENNA 3FMQA 2LDUA 1LDDA 3E97A 3I5UA 3KLNA 1TW2A 4PGHA 4BQAA 5CYVA 4KIFA 2IT0A 5J8CA 1R1TA 2FOKA 5IT9K 2FA5A 4IXAA 2A61A 1UHMA 3WE2A 1B9MA 4MGRA 3BROA 2IPQX 5LLQA 2OBPA 2HQNA 1FYKA 4BH9A 2VODA 1MD0A 5L3FA 5DDGA 2EJRA 5HS9A 4M73A 1Q1HA 1UFMA 5F1RA 3DP7A 3P9CA 4IF4A 2J5OA 3EQLF 1ZG1A 5LHGA 4NB5A 3DPLC 5CLSA 5BPDA 5J8FA 4IHSA 4KIGA 4LB5A 1XGNA 1H9TA 1H0MA 4ASNA 2FNAA 2Q0OA 2P7CB 4UVAA 2R7FA 4HAMA 4WXCA 3WU0A 3BZ6A 2M5WA 2EFWA 3I4PA 4RGSA 1MDMB 3T8TA 4KFCA 2BYVE 5HLHA 4KMFA 3DKWA 3WGIA 4KDPA 1ZG3A 5HOOA 2NYXA 4U7BA 4YG2F 5ILVA 3SQNA 2NS0A 2VBZA 4CDGA 3ABTA 4Y17A 1T6SA 3T1BA 2AS5F 2WC2A 1D3YA 5L3EA 3RPQA 1HSJA 4ESBA 3QU6A 2XUBA 4OOIA 2EV0A 4KA4A 2RGVA 2P7VB 2UWMA 4AVPA 4H0EA 1IN8A 1G4DA 3M1EA 3SHFA 1KA8A 1P6RA 3RYPA 1FP2A 2E7WA 2E1CA 2XRNA 1XMAA 1R1UA 1U5TB 5JVTA 1SFEA 3TOBA 1SMYF 3ZMZA 1MZBA 3GW2A 1XSDA 3ISPA 4LLNA 4BHPA 3GFMA 4HV6A 4WX9A 3J80K 4YIFA 5E8GA 4EV0A 3EYIA 2P6TA 4LK1F 3WODF 4ESJA 2QVOA 2X4HA 4LK0F 1AOYA 4UV9A 1ONVA 1XMKA 3HOTA 3DFGA 4I0AA 4IPAA 4RGRA 4CZZA 1E17A 3CLOA 3JW4A 3DEUA 1G3SA 2P6SA 3FX3A 5HVQC 2XAGA 2PQ8A 4L0ZB 4HX4A 3CO6C 4M74A 1RUNA 2NNNA 2PN6A 4R79A 2KRFA 2CW0F 3WGHA 4AIHA 4HF0A 2EV5A 1FY7A 4A6EA 4YFXF 2IRFG 5IT3A 4LG0B 1YFHA 1G3YA 2JZYA 5FLXZ
chains in the Genus database with same CATH superfamily
5FKLA 2DPUA 3RJPA 1AKHA 1JT6A 1P2FA 2P4WA 3Q0VA 4GYGA 4IOAF 4M9ZA 3SFZA 1Y1WJ 1T56A 2A6EF 3ZQ7A 3KLOA 2ZMEA 3K4MA 4PK4A 4F93B 1XMXA 1GVJA 3VSKA 1WCMJ 2JK3A 4IHYA 5ILUA 2KT0A 2FD5A 3CCMI 1DQUA 2X0LA 4PJ0C 3NAUA 2EA2A 3ERED 2RQPA 2V1DA 2KIFA 2W1OA 1S7AA 4L5IA 2EFPA 2IGMA 5GP9A 5J1UA 3IRQA 3CUOA 1NG7A 2H6BA 5J1RA 5E18F 4BGDA 2MC3A 2H6CA 2F2EA 1FPQA 2BVMA 2JRMA 3G71I 4QLCU 1OYWA 4MLOA 2V4JC 4Z6YA 1E2XA 5C4JJ 1F4KA 4EQQA 3BLYA 2EZHA 3OYDA 2R7RA 1DU6A 1V5EA 1WJ5A 1IUFA 5GPCA 3LSMA 5DUIA 2YU9J 1QHHD 3BG7A 4P96A 3SDGA 3DF8A 2X48A 3FXJA 3VYTB 2OAZA 5HDKA 5DD8A 1B6AA 4B3XA 3J81K 3HEFA 3I55I 4HZFA 4XLFA 1XC5A 2M87A 4YFKF 1VQOI 1BL0A 3ABMH 2V1UA 3WGGA 1HKSA 2G9WA 2LVSA 2VKDA 2QWWA 3CUQB 5KK1A 2HXOA 3L9FA 4IHVA 5F0HA 5BPIA 1F9NA 3FXQA 4EM0B 4FASD 2A68F 3Q0UA 3MD2A 1TT5B 4CCOA 1RI7A 3IUOA 1N77A 5BMZA 3CJNA 1IRGA 5E79C 3M8JA 1W5TA 4N4NB 1YTYA 2IA1A 3DV8A 2EFNA 1K7AA 4A5NA 1TWGJ 2G0EA 2L7KA 5EDNA 3MKWB 5JHFA 3V7CA 1WJAA 3HZJA 2IS2A 3FMSA 4JBAA 1IGNA 1VQKI 1O3QA 4BU2A 3EDPA 1IN5A 5D5XB 1QPIA 2KFDA 1CGPA 5LGUA 2DBBA 1MNDA 5JVGF 2YR2A 3FBNB 2DA5A 1IV8A 5J4VA 2MD0A 4A0XA 4N0BA 4XQFA 2XDVA 2H27A 3BG3A 1G2HA 2DA1A 3P7NA 4BKXA 4KJZA 2EH3A 2HS5A 5EG0A 2IJLA 4HSTA 5KAIC 5L3CA 3S3NA 3PQKA 2P5LC 5BNGA 2DT6A 3BTCA 2XB0X 4G7HF 2R7OA 1D5VA 4BBRJ 1IRXA 3OL3A 1HW2A 1FYLA 2PJRB 2DAOA 3KYDB 4U0WA 3M3YJ 1FOYA 1X3WB 3BQYA 2VT2A 1PDNC 2GOMA 2K3PA 2CFXA 5HS8A 2XV4S 4EJVA 3QPLA 2PMZA 1P92A 4V19K 3HSFA 3LSJA 4AIDA 1JE8A 2HYGD 4EJUA 2H8WA 3E5UA 1FZPB 4NDLA 1HA8A 3FMRA 3H3VK 2UZKA 3UNGC 4EJOA 3ECHA 2E1OA 5TRDA 2A6HF 3F6OA 4CYCB 3B02A 3H9GA 2NVUB 3VODA 2VC0A 2EFQA 3JRBA 2MSYA 5KCMA 4IKFA 3HJEA 4ANJA 3BR1A 3MWMA 3H0GJ 1VQ6I 4JX4A 2I10A 4GRIA 3K4LA 3W6KB 3DU5A 2M9HA 3E6BA 3MEXA 3I56I 2F6CA 3ABLH 3ABKH 3W6VA 1HW5A 1EV7A 3FXKA 4RS8A 2WTEA 1QA6A 1J0RA 4FISA 4F3QA 2HTJA 3CDIA 3VSLA 2XF5A 3WU2C 3S15J 3QYFA 2B9SA 1FMVA 3DPTA 3RKWA 2Y75A 1FJLA 3WG7H 1BJAA 1E3HA 2Z33A 3HGGA 3S17J 4UV8A 2O0YA 3FIWA 3NEUA 3CC4I 3BR2A 3VPRA 4PUSA 2V9PA 1I39A 4A69C 1S29A 3C2BA 2M8EA 1JKQC 1TTYA 2WB1A 2MBFA 2V6EA 5CJ9A 3F8CA 3LWFA 4BXUA 2IGOA 5E20A 1F5TA 2K4BA 3CMEI 3JRIA 2JPBA 1IUYA 2YPRA 3U2RA 3GBGA 1YJ9I 2KKOA 1WZ2A 4IHXA 3QRFF 4XK4A 2R0QC 2VOOA 5IYBJ 3ZQGA 2P81A 2AO9A 2EZIA 4KIBA 3HTSB 4KT5C 3W3CA 3LAJA 1VQ4I 5DV5A 1AKHB 2HOEA 3M07A 3O8HA 2DK8A 4G6DA 3S8PA 3CDHA 4CCNA 3GVAA 2ZMEB 1U6GA 2CQ7A 2ZJPF 4F55A 4A3FJ 4ZYGA 3FM3A 3HKZN 5FFXA 2LBFB 3BP8A 3F8FA 3Q0WA 2RQQA 3MKZA 4S05A 1S3JA 1SD7A 4LJZF 4AD9A 3PNVA 2Y2ZA 2M0CA 2IA2A 1KQ9A 1IO2A 4XOPA 4ZYDA 1YX3A 5JHUA 4QPQA 1I50J 4IO9F 1BC7C 3EUKL 2JSPA 1BBYA 4XRSA 4HA8A 2X51A 2L2OA 4ETSA 5D5WB 3AKZA 2H09A 1MSFC 3OWTA 4UHTA 3OYFA 1R5GA 2R3SA 2K02A 5CVJA 1T0FA 1A31A 1ULYA 1JUPA 2E5ZA 2XGDA 2JQ7A 1MGTA 2GM4A 2PG4A 3I59A 1B59A 1QQIA 1K78B 3ZMVA 2OU2A 3SEZA 3IWZA 5CQGA 2RVCA 1HCRA 2CG4A 2DDAA 2XROA 2GBYA 4U88A 3OYEA 4PJMA 3CC7I 4LGWA 3CQZJ 1X4OA 2IAIA 3F3XA 1I6HJ 2OF7A 3JRFA 4RB3C 1WI9A 5D6EA 3GZ5A 3TO7A 4D9JA 3BPVA 4LFUA 3BWGA 1F1ZA 3K6GA 3CMMA 5E3NA 4A3CJ 3VB2A 1U5TA 3OOUA 5ILSA 3GO5A 5LGNA 3GTQJ 4G9YA 1Y8QB 1KU7A 3EUAA 2VQGA 3J7AO 3FKJA 3I3LA 3M8EA 2K9QA 3CJQB 1ENHA 1W5SA 4NQWB 4CCKA 2EPFA 1OR7A 5EGOA 2XSDC 1FSHA 3HYIA 1YHQI 2FX0A 1FOXA 4RAYA 1Y0UA 4XSZF 4B09A 4ZYHA 1MNMC 3CJRB 2D5VA 1JXSA 3H9QA 5J40A 2OCEA 2NRAC 3RKXA 4BNCA 1IN4A 4CH7A 3Q9VA 3AG3H 4GCVA 3ML6A 2DT5A 2LF7A 5EG0B 2ZBKA 4C3IJ 4C2TA 3ESWB 1XDUA 3QAHA 5TJJA 1KYZA 3DLAA 3AL0B 2KIQA 5BS6A 4C3JJ 1GV2A 2IEKA 3J80Z 1D1AA 4AIKA 1ORKA 4OIQF 2CO5A 3GZNB 1ZG5A 4RB1A 3IHUA 3S32A 3G3ZA 3KE2A 3GTMJ 2P5KA 4E7KA 2CRGA 3TQNA 1A04A 3GEZA 1YJNI 3IAS2 1YX5A 2QM3A 4XR6A 4A93J 1Z05A 3L2VA 5ICCA 3G4SI 4UXNA 3CESA 1TWFJ 2XF7A 2IGKA 4RGXA 4LG0A 3WE3A 1VQ7I 2WAEA 1SFKA 1H88C 2L9SA 3U1DA 3OYHA 1H89C 4CZCA 3GTOJ 1V55H 2ADUA 3I53A 2R7WA 4A12A 4OAZA 4QIWN 4L5EA 4L9JA 4ZJZA 3GTGJ 3BG9A 2LR8A 1B9NA 3BTLA 2V26A 3FXMA 4TV7A 3V8LA 3MN2A 5IY5H 4KT6A 5FKOA 4DIQA 2VBWA 1BI2A 4XM3A 1PUFB 1OCTC 3PIPF 3QQAA 3MZHA 3E6DA 1ETWA 2CQNA 4D5FA 3WU1B 2AHQA 4ESFA 1YG2A 3BZCA 4IRGA 2V79A 3ZP5A 3I9V2 2WY8Q 2Z3YA 1GUUA 3GTKJ 2OZUA 2KJBA 3NQOA 1X2NA 1TWCJ 5H6QA 4A2UA 2HKOA 4ZH4F 2CQXA 2FF4A 2K4JA 4PDKA 4S04A 1TQMA 1HOMA 1BOBA 1G3WA 3BJOA 4IX7A 5DYMA 4MQ9F 4BE2A 3WTXC 2XF6A 1YQAA 3H5AA 1MBFA 2LFBA 2EWNA 2W48A 3CCUI 3S1RJ 1LKXA 3KP5A 4ENKA 1T2KA 1DU0A 4Y15A 1UG2A 2DMNA 2P0WA 4K2EA 1P4WA 2GXBA 4KUMA 1T08B 1IF1A 1J75A 5HLIA 3JRDA 4II2A 3V42A 1BR4A 1LPQA 2E2HJ 2LF8A 3T8RA 3C18A 2OC6A 5HDGA 1P9QC 1HSTA 1ZRCA 1Y1VJ 3VEPA 2RN7A 3CUQA 5ICFA 5BOXA 1ZKGA 5M3FJ 3OR2C 4KITB 1BM9A 2BE5F 2WAQA 3MQ0A 1I1GA 1SEUA 3JTHA 1ZLJA 1X1AA 2VKEA 3ZN0A 2E19A 3HHHA 2CV1A 2M0MA 2YX7A 1YW9A 1K79A 5M3MJ 1IN6A 2ID6A 2E2JJ 4RLQA 3I64A 2MH2A 1A6IA 3C2GA 5H20A 3RPUA 4BJ6C 2W84A 1ZELA 2LC2A 3DU6A 4M9SA 4CICA 3E6MA 1LFUP 3U21A 3A0BC 2LLKA 2E2IJ 3FK6A 2FBIA 4GFBA 2L4MA 4PSWA 4UB6C 3QOEA 5EYRA 5KVRA 2W00A 2XSJC 3DLLF 2RDPA 1FTTA 1GHCA 1X58A 3HC7A 1TT0A 5KNLA 5IP9J 1APLC 1LEAA 3J7YJ 3LA7A 2IXSA 4U87A 4XLAA 1FBSA 4IZZA 5K1YA 3JRCA 3ECOA 2JPCA 5CKTA 2HWVA 4QTRA 2DA2A 2HTSA 4HYEA 1TQPA 3I4MJ 3CTAA 4Q5SF 2M1BA 3L2WA 2PJRA 2R7TA 1M1EB 3S16J 1FC3A 4YRVA 2GZWA 3I59B 1UHSA 1WGXA 2WAFA 1W5CC 4PGGA 1B1BA 3PUFA 5LEJA 1LDJA 5DCMA 3HRMA 3K10A 3KP7A 3S3OA 2W24A 2V1XA 4UVBA 4L18B 3RZDJ 1BR1A 5GAHJ 2IS6A 2ZMEC 1DUXC 2GQQA 1ZRDA 1TLHB 3JTGA 4IOCF 2L7FP 3QODA 2E36A 2Y9ZA 1ZRFA 2OQGA 1W7PB 4GYIA 2V9KA 4CYCA 2LOOA 4Y13A 3X2QH 5FROA 1Z3XA 1MMDA 2CYYA 3TBIA 1I6XA 1T39A 2R4GA 3I54A 2VBXA 1OCZH 1T38A 3H5NA 4O3MA 4O5VA 3J7AY 5J4YA 3L2CA 5F08A 3I0TA 3L2UA 2Y9YA 4CCMA 5BQTA 1ZGAA 2COMA 4KN7X 3K4CA 2ZJ2A 3AG2H 2HEOA 3PL8A 1IDYA 1U9OA 2BOLA 3AG1H 3C1DA 1XGSA 4RAZA 4P9FA 4LLLA 3KEOA 2Y0SN 2J5PA 3SEQA 4XLEA 2P5VA 3CF2A 1VZ0A 2DJIA 4BHCA 3ZQLA 2OQRA 1FMWA 2ETHA 2PJPA 4E7IA 1Y6IA 3HDDA 3G1OA 2XGXA 3HB9A 1IN7A 2JA8J 2ELHA 3D5LA 1S7OA 2OV7A 3S2DJ 3KP6A 5F27A 5FD6A 2QCOA 1AA7A 3HRUA 3LQRA 3E5XA 5DM6F 2HYFA 3ZR8X 3JAMK 2VQHA 2FMLA 4OINF 3MZ8A 4HLXA 2WBMA 1U78A 3M4OJ 3K4KA 4FT8A 3F8NA 4Q48A 1QBJA 4NC7A 4EGZA 1ZQ3P 2QEXI 1NHAA 3R60A 2WV1A 1DPUA 1BI3A 3OV8A 1I27A 1SVMA 2EV6A 6PAXA 1R36A 4ITVA 1ETVA 1GVDA 3K70D 2HQ5A 1IXSB 2M7BA 2QYOA 5ED4A 2Y31A 5LD2C 3ZQIA 3V4GA 3R4KA 5AONA 1ETKA 1QRYA 3O3KA 2KZGA 2DJNA 3H3ZA 3OYNA 3A03A 4E7HA 2XKOA 2QBYB 2X85A 2LBFA 5D6FA 3JSOA 2JSCA 3DTIA 5IP6A 5EEGA 4FX4A 1QHGA 3H5RA 1B72B 2TDXA 3WHBA 1ITYA 4HV5A 1TQIA 1SFOJ 4CUGA 4E70A 2LH9A 3A1YA 2ZXIA 4A3BJ 2O61A 4A3IJ 3WTTC 3G1LA 1YS7A 5K5OA 2DI3A 1KQ8A 2QGUA 2DLLA 2KZVA 2L02A 4BQOA 2NNYA 2COBA 2HOSA 3ZRGA 5DD4A 3T0YA 1UB9A 3BCAA 4GO1A 1KU9A 3VYUB 2LY9A 1FX7A 3GTPJ 3CD6I 4BXXJ 1ODDA 1XGMA 2XGEA 3OIQA 2Z99A 3OYBA 4HG2A 3PM1A 1ON2A 2L7MP 2BBYA 1HQCA 5FLMJ 1K78A 1HLVA 2QQ9A 1YIJI 3RQ4A 3K70C 3IKTA 4NC6A 1JKRC 3KEYA 2HVQA 4RB0A 4KNYA 2DTZA 4BEHB 3GFIA 4PJNA 5A2QZ 4A0ZA 4RLFA 5L3DA 4B8XA 1JHFA 4G94A 2RKHA 3QP6A 1Z7UA 2FJ1A 1Y56A 2A5YB 1X1BA 4D0PA 2EB7A 4P5OA 2ICWG 1OQYA 2OD5A 2W25A 4RAGA 4UY8I 3WG9A 2ZJRF 2CUZA 3LMMA 2XGCA 1QZZA 4RB2C 1WJEA 4CCLA 2FE3A 4I2OA 4N4OB 1SAXA 2FBHA 3LSKA 3S2HJ 2D1HA 4NQWA 2GAUA 4M6XA 4A6DA 2F5FA 3TEDA 1CF7B 2O8KA 1ZGJA 1YO5C 5IOYA 1FBQA 4WXHA 4I98B 4JOMA 5E1ZB 4MEXF 2QF7A 3DWLE 5FD5A 3OYGA 4JP0A 2RV8A 5D5UB 2VASA 1I3AA 2KPMA 3W2VA 3WTZA 4NHJA 4BHBA 1BW5A 4ZDPA 1STZA 2KL4A 3HUGB 5J47A 3CMYA 4IHTA 2CQKA 3BR5A 4GGGA 1Z21A 5EJCA 1U8RA 4RDUA 2WV0A 3H3UA 3TOAA 4AUXA 2M45A 1RKTA 2YS9A 1S9HA 3F9KA 1A36A 2FNPA 4ZYAA 5F04A 2KQRA 2DQRA 2MYSA 4LIVA 4CA0A 2DOFA 3LAPA 1SD4A 3ZMSA 4ENJA 3A01A 4IJAA 1S7EA 4CXFA 2VQCA 3IV5A 5K7HA 1TL8A 4IEJA 4NBQA 1R71A 2UUZA 3IWFA 3K4BA 5TISC 5DCMB 2OUMA 4UVCA 5ICEA 2FQ4A 3S14J 1WJBA 1B4AA 4B48A 4XLCA 1OKRA 3LSGA 5FFZA 3WTUC 2Z9OA 2JRTA 2LMDA 3L00A 1U9NA 3R61A 4FETA 5EF6A 3KCCA 3LSHA 2ACJA 2CW7A 1J2XA 2MA3A 2Z1DA 4JYKA 5LFAA 3RTRA 3FZVA 4A3DJ 3RZOJ 2AXTC 2RNJA 5J1YA 5IYCJ 2R5YA 4I6ZA 4WXDA 3GWZA 4ZDLA 1TP4A 4CYDA 1LB2A 5AIPA 4EVIA 3MMYB 4DBRA 1LE8B 2FBKA 3ZMDA 3M9AA 3A4CA 3V7SA 1LFBA 2Q2EB 5TGTA 3F0CA 1PUFA 3SZGA 1RRJA 1JJ8C 3L7WA 1G59A 3FWEA 4HSRA 3WHCA 4M6YA 1XN7A 2XHKA 3DEWA 4UNOA 2DT7B 3LFUA 2XVCA 4LOCA 3S2WA 4F91B 3U9GA 2R93J 1T0FC 3WTWC 2AXLA 1XB4A 5M5YJ 4FHTA 2F4OB 3K4NA 1FBUA 3FM5A 1K6YA 4ZZLA 2UXNA 1EKEA 5IYDJ 2FU4A 3S1QJ 4MIMA 5FKMA 5IT9Z 3O2PE 4MTEA 5LHIA 2ZNZA 3B73A 1Z0XA 1KYWA 3TW7A 4MHGA 1HF0A 2XKPA 3CP2A 3D5RC 2IS4A 1R00A 4W1UA 3CMAI 2DMUA 4XN0A 3FHZA 2IS1A 4GDFA 3DBLB 1YIOA 5L3BA 2HQRA 3N05A 3ZGKA 2BXYA 1U5TC 3R0AA 2EILH 4MQVA 1O4XA 1D0XA 4X6AJ 2VBYA 2Y48A 4DYQA 1RUOA 3DKXA 2OCCH 5E3OA 2WB1N 1BIBA 1MBGA 4BS9A 1IXCA 3ULQB 2LD5A 4OIPF 3IP4B 4UUSB 4YFNF 1OR7C 2KMUA 5CPRB 2DQLA 3O6BB 5FLXK 1WJFA 3CLQA 1WWXA 1X19A 3GLXA 4RBOA 2LTPA 2UXXA 2QZ8A 3CF5F 2VOPA 1MMGA 4PSXA 1XSVA 2JTVA 1EH6A 5GPAA 4IVNA 3E6CC 2FEZA 1QVTA 3MKLA 2JA7J 2P8TA 2EIJH 4L9TA 1X3ZB 5D4SA 3A2KA 3S1MJ 1BN5A 1LVAA 3PFIA 4LD5A 4WWCA 4N9HA 3IH4A 3AAFA 2DK5A 2Z5UA 2BV6A 2DMQA 5CVIA 3SZPA 2LREA 1OFCX 1XSXA 1R5HA 1UMQA 1Y39A 3O8GA 4LLGF 1GLNA 1JKPC 3BG5A 5DTDA 2ZNYA 3K9TA 4E7JA 4UB8C 3V8JA 3EUHA 1MJAA 4I01A 1VNDA 1XDSA 4JK1X 4OU0A 3K2AA 4RA2A 3LSRA 1ZHFA 5F64A 4HDVA 1W36D 2CV0A 2OTLI 2QSHX 3BR6A 3EETA 3KIOA 1G3TA 1WKMA 1W0TA 4G7ZF 3CJTB 1FEXA 1TBXA 5FO5A 4IQ4A 3DPUA 3F22A 2ECCA 1X1DA 3F6VA 2QQ8A 3ZOBA 2D2WA 5DUKA 2O3FA 2L4AA 1OPCA 2E1NA 1FWZA 2FUG2 4J01A 3FK7A 3LQQA 5DCFA 1QNTA 4KN4X 3KP2A 1W4MA 2F5EA 3PQJA 4AIJA 2ZC2A 1IDZA 4DGWB 3LSPA 1KQ0A 5JLXA 3CCLI 1BA5A 3JRAA 1W7PA 2XIGA 4U0VA 1ZK8A 2NS7A 1J5YA 2XAUA 3L2RA 2B63J 2LYCA 1D0ZA 2BHYA 1FP1D 3BQZA 3RPUD 3F23A 1SVLA 3FHNA 1KU3A 4A3JJ 4MFEA 3CO7C 3IRRA 3D0SA 1MMNA 1Z77A 2FOWA 4E4HA 1HBXG 1J7KA 2CU7A 5M5WJ 1W36C 5LBQA 1A6QA 2F5CA 1VQ8I 1KONA 1MW7A 1LVKA 2ZJQF 2DXIA 1UCRA 3MCZA 2X1EA 2ZFUA 3COAC 1IC8A 2EK5A 1V3FA 5F0FA 4XIDA 2A3SA 4BACA 3A02A 2NVTJ 2W7NA 3WTSC 5ERIA 2LP0A 4AYBA 1FSEA 3BDDA 3Q3SA 3C7JA 3ZQCA 5ICGA 1USTA 1JTXA 2QSFX 3RIRA 5D8KB 4L9NA 2XAQA 4CO8A 4XKWA 1MSEC 3KEQA 2D1VA 2DYSH 2JJ7A 3CUQC 1SD5A 1X3UA 2VPLA 4M3BA 2CFOA 3F8MA 2HOTA 1X1PA 1OCRH 2E7XA 5DM7F 1VTNC 2VXDA 4G6TB 2VE9A 1AU7A 2O5RA 3A01B 1OYYA 2O8XA 2HOAA 1XCVA 4NC8A 5JI6A 3ZXSA 3HPHA 1EH8A 4PFPA 3TL4X 2HPMA 3KX2A 2HVRA 5CQEA 1USSA 2OJED 1DGWY 4B4CA 4KISA 2ESNA 3F72A 2VONA 4LB6B 5LRSA 2R5ZA 5HLTA 1BOAA 2BW3A 1XS9A 1VQLI 2FQ3A 2R7UA 3K4JA 2R5YB 5B1AH 2QKMB 3H36A 3W2AA 2QBYA 3I71A 1TNTA 2ELJA 2QLZA 1R5ID 1WH5A 2TCTA 3B6AA 1B72A 5B3SH 4FX0A 4XKBA 5CVUA 2O03A 3NARA 3RYRA 3GZ6A 4XKCA 1F43A 4AVZA 3DXJF 2XPVA 3HSEA 4B1RA 3VFZA 1ETQA 4LMYA 4XRSG 2O6GE 2K86A 3HOWJ 3DKYA 3ZQHA 4R8HA 2ISYA 3CDLA 2LKPA 1HXDA 3GFJA 3H35A 4BE0A 5JR3A 2DU9A 2FMYA 2HZTA 2JVGA 4HQEA 1IAWA 3CP8A 5F0CA 4PZJA 3SFIA 4HDUA 1XD7A 1BIAA 1ETOA 4Q47A 1OLTA 1RZ4A 1YOVB 3DBHB 4BAYA 2V9VA 3BG6A 3LFKA 3M7GA 1VFCA 3GXOA 1EF4A 4HF2A 2LK2A 3GCMA 2GXGA 3VDXA 1Z9CA 1P7JA 2O9LA 4L5JA 3QOPA 2FXAA 3HL2A 3OYCA 5LHHA 1O7FA 2KLOA 3K0LA 2DMTA 4BEHA 2XB5A 3C3WA 2FSWA 1IRFA 3P9IA 1NK3P 1WPKA 2CSOA 2KDZA 2NVXJ 3B6CA 2HPIA 3WTYC 2L3DA 2MLKA 2WWYA 1QO0D 2XAFA 1G8XA 3PO2J 2L9VA 1ETYA 2EA4A 3E0JB 1Z91A 2DFEA 3CCSI 3CCVI 1BI1A 1SAUA 3ZQQA 3J81Z 3EYYA 3CCEI 4G6QA 1ZAOA 4HF1A 4KYWA 5K5RA 2HZDA 3TO9A 1MH4A 1WJDA 3PSIA 4XLHA 2MLGA 1DP7P 2XPWA 2BY1A 4EJWA 4BYYA 1CF7A 1WJCA 3Q9SA 2LG4A 3HPGA 4RM3A 5C4XJ 2E71A 5JFRA 2STWA 1QPMA 2VPRA 3I4NJ 4ON0A 2K9MA 1PVEA 4QSHA 4M3EA 1WQ2A 2I8DA 3LNQA 3PNYA 3BTIA 3DEEA 3TGNA 4II3A 1R4MB 3K1NA 3MKYB 1SANA 1UJ8A 2WADA 4M3FA 3HOSA 1ZYRF 3HUGA 3SXYA 2A6TA 3W6JB 2VI6A 3KFWX 2VE8A 3K69A 1WRJA 1YS6A 5D5VB 1K6OA 2VXZA 4V2GA 1UAAA 4E6KG 2OTJI 3QP5A 1CQTA 4EM1A 2HR3A 2JN6A 4Z2YA 3QPHA 4XRFA 4EGYA 3Q5FA 2JA6J 3L09A 3C2HA 3ONQA 4JQFA 1YLFA 1TWAJ 5EZHA 1N25A 1BR2A 1LEBA 4A3KJ 4AC0A 4ZTFA 3QPSA 4I02A 2X6WA 2HFHA 2MG4A 2X1CA 3N4MA 2LRDA 4HRIA 2KHMA 1E3PA 2KJCA 3SDBA 4A3LJ 1F36A 1T98A 2VN2A 4LITA 3PJRA 3HG9A 1L0OC 4IL6C 2PX9A 4M3DA 1PUEE 2ZO4A 3VOEA 4D7MA 3KZYA 4EEFG 4CSWA 1DP3A 1POGA 5B66C 1VI0A 4DZJA 4XRMA 4P55A 3RKQA 1XCBA 4I7HA 3ZN1A 4D7NA 1OCPA 2DO7A 2DFHA 1LE8A 1NTCA 2Q2EA 3MVPA 2ZXJA 2K27A 1U3EM 4E7LA 3V8KA 4RGUA 4EJTA 1A35A 3UR3C 5KAFC 1HC8A 2VJJA 2DFIA 3BR0A 2DTRA 4Y33A 1JGGA 1UG0A 2WY7Q 2PBIA 3U1KA 4OWRB 3GFLA 1K4TA 1W0UA 2VLAA 1PP8F 2M4GA 2XC7A 5HLGA 3T5XA 4I76A 1O3RA 3ELKA 3GTJJ 1YITI 1P4AA 2VL8A 5HNFA 1JT0A 1Z6RA 3FF5A 4HEA2 3HTUA 4HLYA 1XGOA 3DTKA 3KETA 2DPDA 4DOZA 3OL4A 2YU3A 2L54A 1FIPA 2CMPA 3M8FA 1VQMI 2Y0SA 2BEOA 2VQLA 2DFFA 1NH3A 1IG7A 4I0BA 3KP3A 2VJ5A 4NUBA 5AIQA 1ZARA 3WTVC 1ZH5A 4DBQA 3HOXJ 2GIVA 3HSRA 2M8GX 2Q8KA 1HW1A 4XICA 2PMUA 1I3QJ 4A3MJ 1IJWC 4O6JA 4JX6A 4UUSA 3HHGA 3TDUC 2Z16A 2R5ZB 1YW8A 2HDCA 4X1EA 4X0GA 1LNWA 2BW3B 2OA4A 4DYRA 1ZTRA 3PIOF 3CCRI 4BJTA 2DCEA 2VC1A 2YX4A 3R0JA 4BJ5C 4M3GA 1SD6A 1D1CA 2R7ZJ 1IXRC 1FOWA 4BXFA 2RAEA 3RKYA 4XBFA 1SFXA 2KIUA 1E3OC 1MBHA 2MH9A 2Y0MA 4HNVA 4XLNF 1T95A 1C0WA 1YJWI 5F6FA 3AL0C 2KDOA 3DBRB 1R6RA 4G12A 2BY0A 2W4SA 2XAHA 1S6LA 2V6CA 4V2FA 1SVOA 2VUMJ 2STTA 2HU9A 5K5QA 2JT1A 1REPC 4QPOA 2DODA 1NG6A 4FCYA 2JMWA 2CQQA 2RNGA 1I5ZA 4J19A 1KZHA 1OMIA 3OYAA 5IOZA 3TP0A 2L5QA 1DGRM 1N75A 2GIZA 1ZR4A 3ZCOA 3BJAA 1E0EA 2EZKA 5K7ZA 2CJJA 2YUSA 4HQMA 3OOPA 1QU3A 2GA1A 4KMUX 3HOYJ 3ROUA 4AU7A 4NNJA 2HKXA 2IA0A 3E1SA 4HOBA 1SFUA 1ZN2A 5GTHC 3MZYA 4U7DA 1HKQA 3KP4A 4ZZDA 1K61A 5EEAA 5LRRA 3JREA 4OIRF 1EA3A 3K7AJ 3NWSA 4EATA 4I09A 4BL0B 4WK8F 1I1SA 2NS8A 4M9XA 1J59A 2LY1A 2KP6A 1R1VA 2VIXA 3DTEA 3TO6A 5D4RA 1ZGWA 2CUFA 2YSRA 4Y52J 3H92A 3FXLA 3TKYA 3TMOA 3JSPA 4ENMA 2QQAA 3SJMA 1GXPA 2BHZA 3OSFA 3E3VA 3BR3A 1MIJA 2PFBA 4RAFA 3FISA 2DOAA 2G7UA 4M71A 3ZPLA 2X9DA 5D8LB 1MBJA 1WI3A 4PCQA 4BY7J 1Z7LA 2DA6A 2EZLA 3QYBA 4OIOF 5DEQA 5GAEJ 2DOEA 5IPAA 4HX8A 2ZSIB 2Q1ZB 3H0DA 2LNBA 4L9VA 3JR9A 2W57A 2HGCA 1BC8C 4MTDA 1G6NA 4A5MA 2GXAA 3MAJA 5LGTA 2NXNB 3S93A 1J09A 3TP3A 5J6XA 1GXQA 2L9NA 3FXOA 4HNTA 1RETA 4IQJA 2ELKA 4PJJA 4XMYA 2G7HA 1O3SA 1OCCH 1GV5A 1D8KA 2MC4A 4A3EJ 3ASOH 1JGSA 1MBKA 1TNSA 2DMPA 3R6SA 3V7RA 4DW6A 1AWCA 4ZDOA 2OZ6A 2VB6A 2F5DA 2K5CA 4M72A 1P4XA 2HXIA 3RDIA 3PNTA 4UUTA 2HYJA 5HDNA 1NK2P 3F8BA 2AQEA 3ERMA 1VQNI 1V4RA 1T8IA 5E3MA 1ZLKA 4A0YA 1YYVA 4ABZA 1ZR2A 3G73A 4B47A 5GAGJ 3S1NJ 4B3AA 3GYHX 3PO3J 2ZCWA 3JRHA 1PP7U 1IZ1A 1N78A 3LSIA 1KGSA 1Y8RB 3D5SC 2DN0A 5EZGA 1W7PD 2B7EA 2PMZN 5C3EJ 5E8IA 1U2WA 2QQBA 4QWQA 3OMYA 4DQ2A 3IAM2 4IHWA 4OMZA 1D5YA 5F1JA 3QU3A 2A07F 3NWTA 2D45A 1S8NA 3LOCA 3EUHC 4AWXB 4IRIA 3SYTA 1L3LA 1S72I 1Z1DA 4RMNA 2L7ZA 2NAZA 4PJLA 3LA3A 2X6OA 1MBEA 2NVYJ 1RIOH 4XNFA 1RESA 3D1NI 2CUJA 3HIFA 4LIUA 3QPTA 2DDBA 2PLYA 3OIPA 2QUFA 4R1HA 2MD5A 4XONA 1AHDP 1T33A 1IW7F 2L9RA 4IRHA 1D0YA 1KU2A 4YIIA 2C6YA 4XN3A 1P7IA 2BGCA 3F21A 3DQVC 3P5JA 2TRTA 2L01A 2H94A 1R22A 3HRTA 3I58A 5L3GA 2IP2A 1B8IA 3HOZJ 2LKXA 4CHUA 1RPWA 3AFHA 2NVQJ 4XSXF 3TW6A 5B1BH 2CWEA 1R58A 3IC7A 4HBLA 3BOQA 1Z6TA 1FOKA 4B43A 1FLIA 3P9KA 1HKTA 2KRHA 2E34A 1LQ1A 4L0YB 1MKMA 1EH7A 4B44A 2EIKH 4JX5A 3NRVA 3OSGA 1MMAA 1J9IA 2F4MB 4ZTJA 2QSGX 3OYLA 2E60A 1TW3A 3BT9A 1SC7A 3K2ZA 1V5FA 1JUMA 3IH3A 5HS7A 2ZB9A 1BJZA 4RM2A 2LY2A 5FLVA 3KYCB 3K1MA 3HM5A 1H8AC 2PEXA 5LEKA 1DPRA 2KISA 2CS3A 4HPQA 5JLWA 2RC4A 1FT9A 3LA2A 1JHHA 3TDZC 3A0HC 2BY2A 1MDMA 4P9UA 2EQRA 3HKZA 1RNLA 1VQ5I 2CUEA 2ECBA 3ZMUA 2R7QA 2PI0A 2M3AA 4EMSA 5EEHA 1FTZA 2KRCA 2JVHA 3HOVJ 3LL7A 3OS2A 4G8XA 1DDNA 3FBIB 4KICA 5DS9A 2E35A 2A69F 2XRLA 5HNHA 1HDDC 3MFKA 4J00A 3GX4X 4BY1J 2VJIA 2PMHA 3FXRA 3E5QA 2OPTA 2CV2A 1R23A 1W1WE 3ZMTA 4Y7NJ 3BPXA 4CGZA 2H1LA 1O7LA 5FB2A 2HI3A 4M6VA 1Z67A 4E7SA 1LDKB 2Y30A 5A2QK 5E1XA 1O3TA 1JTYA 3J7ZI 2K3FA 1UZCA 4UUVA 3GF2A 4EM2A 5FRMA 3BZKA 2E1MB 5IP7J 1Q1VA 1MH3A 2DA4A 5C44J 3BJ6A 2IVMA 2ISZA 2GA2A 2R7SA 1R7JA 2W85A 2UV1A 2DW4A 2XASA 2DA7A 2DA3A 2R7DA 4I99C 4YEJA 4A3GJ 3FDYA 2M7AA 3HRSA 3GTLJ 2R7XA 2RREA 2HVSA 2KIMA 3N97A 1ZREA 2ESHA 3RQIA 4DYCA 4AM3A 1QGPA 5E17F 2K7LA 1MJBA 2VKVA 3EPZA 2EFOA 4HX7A 3OIOA 5M5XJ 1ETXA 2JA5J 1UHWA 1O57A 4Q4ZF 1Y0NA 2M30A 2QENA 2Z2SB 2ZFWA 3HGYA 1UELB 5FKKA 3RI4A 4C9YA 3OR1C 2FRHA 2GWRA 3KZZA 2JUGA 2LKSA 4FE7A 5H2FC 1LJ9A 2L0KA 4LG3A 4F7ZA 1MJ9A 2I5UA 3ASNH 2Y69H 3K1PA 2K40A 3SZTA 4N9IA 4BUPA 1V54H 2M2EA 3CZ6A 3GMEA 3VWBA 1IRZA 4AYBN 1XTAA 2JWTA 4GXOA 5CVRA 1FYMA 4XLPF 5E1WA 2ME6A 3GUDA 1YRNA 1ON1A 1RKWA 4U0YA 2X1DA 3ABUA 3LSTA 2O7OA 4H4KC 4OMYA 1SMTA 3IKVA 4WF2A 3HOUJ 4HW0A 1FNNA 3HBLA 5GTIC 1BW6A 1WHUA 2W82A 5FGMA 3IL2A 2DYRH 5KHDA 3BY6A 2XAJA 4BQQA 2A05A 3VYSB 2F4IA 4MNUA 4S0HB 4P1WA 4ZYEA 3REOA 2VT3A 2ZKZA 2IGNA 5H6RA 1WSUA 4MEYF 1JKOC 3CC2I 4WCGA 2LSOA 2NOJB 2IW5A 4MO7A 3FXUA 3JAMZ 1OYIA 1BI0A 1YW7A 4DNCA 2R92J 5CVVA 4G7OF 2QKLB 1TC3C 1LFPA 2F5VA 5K7FA 3JRGA 1H9GA 3KYLA 1D8JA 1QZYA 2CGPA 2B0LA 4ENNA 2HDWA 3FMQA 2LDUA 3GLLA 2VJ4A 2K85A 1LDDA 1X4PA 3E97A 3I5UA 2BXZA 2H8RA 1V5GA 3KLNA 1TW2A 4PGHA 4BQAA 3OYKA 5CYVA 4KIFA 1RR7A 4C30A 2IT0A 5J8CA 1R1TA 2MABA 2FOKA 5IT9K 2FA5A 4IXAA 2A61A 3ZQFA 1QVUA 4FTHA 1S5LC 1OCOH 1UHMA 3WE2A 1B9MA 1OJLA 3BROA 2IPQX 4MGRA 5GADJ 5LLQA 3UKGA 2OBPA 3AG4H 2HQNA 2ZSHB 1FYKA 4BH9A 1B8IB 3G1MA 3KPHA 1MD0A 2VODA 2ME0A 5L3FA 4D1QA 5DDGA 2QA4I 2EJRA 5HS9A 4M73A 3H9JA 1Q1HA 1WVRA 1UFMA 2H1KA 5F1RA 2NOGA 1RR8C 2EINH 3DP7A 2ZXHA 1XPXA 3P9CA 4IF4A 4YIRX 2J5OA 3EQLF 2X6XA 3QYEA 5B5EC 1ZG1A 4BBSJ 5LHGA 4NB5A 3DPLC 5CLSA 3CCQI 5BPDA 1R9TJ 5FKNA 5J8FA 2VKHA 3W2WA 2JUCA 4IHSA 1VF9A 4CCJA 4KIGA 4LB5A 4W97A 4PFOA 3CCJI 1XGNA 2K9LA 1OISA 1H9TA 1H0MA 4ASNA 2FNAA 2WAQN 2M4KA 2Q0OA 1VQPI 2P7CB 4UVAA 4C2UA 2R7FA 4HAMA 4HNUA 4Y4RA 3G2BA 4XORA 4WXCA 4YELA 4C2MJ 3WU0A 4DZPA 1A5JA 3BZ6A 2CW8A 2M5WA 2EFWA 1RC9A 3I4PA 4BDZA 4RGSA 1MDMB 2A5WA 1YI2I 3T8TA 4KFCA 1U8BA 4F52A 4Y3OA 2BYVE 5HODA 1X2MA 3JCUC 5HLHA 1VQ9I 4KMFA 4D5CA 3DKWA 4E7ZA 3S3MA 3WGIA 4KDPA 1ZG3A 5HOOA 2NYXA 1XG1A 4U7BA 4YG2F 3CCYA 2HNHA 5ILVA 1D1BA 3QWLA 1K83J 3SQNA 1TZLA 2NS0A 2VBZA 4CDGA 1HDPA 2GLOA 4OAYA 3ABTA 4Y17A 1TWHJ 2X6YA 5FJ8J 1T6SA 2F48A 2N8GA 3T1BA 2AS5F 2WC2A 1IV6A 1D3YA 1MMSA 1U0JA 5L3EA 3OY9A 3RPQA 2WA0A 1HSJA 4ESBA 2M34A 2XUBA 3QU6A 4OOIA 2EV0A 3H1CA 4KA4A 2AQFA 3DCFA 3PSFA 4DJAA 2RGVA 4XOTA 4F92B 2P7VB 5E3LA 2UWMA 4AVPA 3OYJA 4H0EA 1ACIA 3BC8A 1IN8A 1G4DA 2K9SA 2XPUA 3M1EA 2JA2A 3SHFA 1KA8A 1P6RA 2MW8A 3L1PA 3OYMA 3RYPA 1R49A 5FRNA 1R4NB 4BDYA 1FP2A 2E7WA 2E1CA 2XRNA 1XMAA 1R1UA 3HXLA 1U5TB 5JVTA 3FKIJ 2EIMH 1SFEA 3M1CA 2V7FA 1JI8A 1WFXA 3TOBA 1SMYF 2K9NA 3KZIC 4FE4A 3ZMZA 1MZBA 4MFDA 3GW2A 1XSDA 3ISPA 1QZEA 1Z3YA 1JUSA 2E5NA 1XX5A 2CH0A 5EGOB 4XL9A 4BHPA 1YE9A 4LLNA 3GFMA 4HV6A 2BVLA 4WX9A 3J80K 4ZC3A 4YIFA 3PFYA 2E1MC 5E8GA 3G6EI 3PUBA 4EV0A 3EYIA 2P6TA 1YRNB 4LK1F 3WODF 3BTJA 3E7LA 2QVOA 4ESJA 1MNEA 2X4HA 4LK0F 1AOYA 1LUJB 1ONVA 4UV9A 1XMKA 3HOTA 1X1CA 5J3LA 2HQAA 3DFGA 4I0AA 1GT0C 4IPAA 4RGRA 4CZZA 1EJ9A 4XKVA 1E17A 3CLOA 3JW4A 3DEUA 4BQNA 2ZXWH 2HDDA 1G3SA 2P6SA 3OYIA 3FX3A 4FQGA 2EBIA 3OS1A 2XAGA 2PQ8A 5HVQC 4L0ZB 4HX4A 3CO6C 3BCBA 3RSNA 2R7VA 1PJRA 2BZTA 2BY3A 4M74A 3L2QA 1RUNA 2NNNA 1JJ6C 2PN6A 4R79A 3VYRB 2KRFA 2CW0F 2MGQA 1WH7A 1FIAA 2IBDA 3WGHA 4AIHA 2GOXB 4HF0A 2EV5A 1ERDA 3IH2A 2MFZA 1FY7A 1GDTA 4A6EA 3RCOA 4YFXF 2IRFG 5IT3A 4LG0B 4BE1A 1YFHA 2ID3A 1G3YA 2V1NA 3OS0A 4C3HJ 1PYVA 1K4SA 9ANTA 2JZYA 5FLXZ
chains in the Genus database with same CATH topology
2DPUA 3RJPA 2P4WA 1P2FA 4GYGA 4M9ZA 3SFZA 2A6EF 3ZQ7A 3KLOA 2ZMEA 1GVJA 5ILUA 2X0LA 2EA2A 3ERED 2RQPA 2V1DA 2KIFA 4L5IA 1S7AA 2EFPA 3IRQA 3CUOA 2H6BA 5E18F 2MC3A 2H6CA 2F2EA 1FPQA 4QLCU 1OYWA 1E2XA 1F4KA 4EQQA 5DUIA 4P96A 3DF8A 2OAZA 5HDKA 5DD8A 1B6AA 3J81K 4HZFA 2M87A 4YFKF 2V1UA 3WGGA 1HKSA 2G9WA 2QWWA 3CUQB 5KK1A 3L9FA 5BPIA 1F9NA 3FXQA 4EM0B 2A68F 1RI7A 5BMZA 3CJNA 1IRGA 1W5TA 1YTYA 2IA1A 3DV8A 2EFNA 1K7AA 4A5NA 3V7CA 3FMSA 4JBAA 1O3QA 3EDPA 1IN5A 5D5XB 1CGPA 5LGUA 2DBBA 2YR2A 4A0XA 4N0BA 2H27A 3P7NA 2HS5A 2IJLA 5L3CA 3PQKA 2P5LC 4G7HF 1D5VA 1HW2A 1FYLA 2DAOA 4U0WA 2VT2A 1PDNC 2CFXA 5HS8A 2XV4S 4EJVA 1P92A 3HSFA 1JE8A 2HYGD 4EJUA 3E5UA 1FZPB 3FMRA 2UZKA 4EJOA 3ECHA 5TRDA 2A6HF 3F6OA 3B02A 3VODA 2VC0A 2EFQA 3MWMA 3W6KB 3E6BA 3MEXA 1HW5A 1EV7A 4RS8A 2WTEA 1J0RA 2HTJA 3DPTA 3RKWA 2Y75A 1BJAA 2Z33A 4UV8A 2O0YA 3NEUA 1S29A 2M8EA 1TTYA 2MBFA 5CJ9A 3F8CA 3LWFA 4BXUA 5E20A 1F5TA 2K4BA 2JPBA 1IUYA 2YPRA 3U2RA 2KKOA 3QRFF 2VOOA 4KIBA 3HTSB 4KT5C 3LAJA 5DV5A 2HOEA 2DK8A 4G6DA 3CDHA 3GVAA 2ZMEB 1U6GA 4ZYGA 3FM3A 5FFXA 3BP8A 3F8FA 4S05A 1S3JA 1SD7A 4LJZF 4AD9A 2IA2A 1KQ9A 4ZYDA 5JHUA 1BC7C 1BBYA 4HA8A 4ETSA 5D5WB 2H09A 4UHTA 1R5GA 2R3SA 2K02A 5CVJA 1T0FA 1ULYA 1MGTA 2PG4A 3I59A 1B59A 1QQIA 1K78B 3ZMVA 2OU2A 3IWZA 2RVCA 2CG4A 2XROA 4U88A 4LGWA 3F3XA 4RB3C 1WI9A 5D6EA 3GZ5A 3TO7A 3BPVA 4LFUA 3BWGA 1F1ZA 3VB2A 1U5TA 5ILSA 3GO5A 5LGNA 4G9YA 1KU7A 3J7AO 3M8EA 1W5SA 1OR7A 1FSHA 3HYIA 4RAYA 1Y0UA 4XSZF 4B09A 4ZYHA 1JXSA 2NRAC 3RKXA 4BNCA 1IN4A 3Q9VA 4GCVA 3ML6A 2DT5A 2LF7A 2ZBKA 1XDUA 3QAHA 5TJJA 1KYZA 5BS6A 3J80Z 4AIKA 4OIQF 2CO5A 1ZG5A 4RB1A 3IHUA 3G3ZA 3KE2A 2P5KA 3TQNA 1A04A 3GEZA 2QM3A 1Z05A 5ICCA 4UXNA 4LG0A 3WE3A 4RGXA 3U1DA 2ADUA 3I53A 4A12A 4L9JA 1B9NA 4TV7A 3V8LA 2VBWA 1BI2A 3MZHA 3E6DA 3WU1B 4ESFA 1YG2A 4IRGA 2V79A 3ZP5A 2Z3YA 2OZUA 2KJBA 3NQOA 5H6QA 4A2UA 2HKOA 4ZH4F 2FF4A 4PDKA 2K4JA 4S04A 1TQMA 1G3WA 3BJOA 5DYMA 4MQ9F 3WTXC 1YQAA 2EWNA 3KP5A 4ENKA 1T2KA 4Y15A 4K2EA 1P4WA 2GXBA 4KUMA 1IF1A 1J75A 5HLIA 3T8RA 2LF8A 3C18A 5HDGA 1HSTA 1ZRCA 3VEPA 2RN7A 3CUQA 5ICFA 5BOXA 1BM9A 2BE5F 3MQ0A 1I1GA 3JTHA 1ZLJA 3ZN0A 3HHHA 2YX7A 1YW9A 1K79A 1IN6A 3I64A 2MH2A 5H20A 3RPUA 2W84A 4M9SA 4CICA 3E6MA 2FBIA 2L4MA 5KVRA 2RDPA 1GHCA 1LEAA 3LA7A 1FBSA 5K1YA 3ECOA 2JPCA 2HWVA 2HTSA 4HYEA 1TQPA 3CTAA 4Q5SF 2M1BA 1FC3A 2GZWA 3I59B 4PGGA 1B1BA 5LEJA 1LDJA 5DCMA 3HRMA 3KP7A 2W24A 2V1XA 4UVBA 4L18B 1DUXC 2GQQA 1ZRDA 1TLHB 3JTGA 1ZRFA 2OQGA 1W7PB 4GYIA 4Y13A 2CYYA 1I6XA 1T39A 3I54A 2VBXA 1T38A 4O3MA 4O5VA 3L2CA 3I0TA 5BQTA 1ZGAA 2COMA 4KN7X 2ZJ2A 2HEOA 3C1DA 4RAZA 1XGSA 4P9FA 4LLLA 3KEOA 2J5PA 2P5VA 4BHCA 2OQRA 2ETHA 2PJPA 2XGXA 1IN7A 2ELHA 3D5LA 1S7OA 3KP6A 5FD6A 3HRUA 3LQRA 3E5XA 2HYFA 3JAMK 2FMLA 4OINF 4HLXA 1U78A 4Q48A 4FT8A 3F8NA 1QBJA 4EGZA 1NHAA 3R60A 1DPUA 1BI3A 3OV8A 1I27A 2EV6A 6PAXA 1R36A 1IXSB 5ED4A 2QYOA 3V4GA 3R4KA 5AONA 3O3KA 3H3ZA 2QBYB 2XKOA 5D6FA 3JSOA 2JSCA 4FX4A 5EEGA 2TDXA 4HV5A 1TQIA 4E70A 2O61A 3WTTC 1YS7A 5K5OA 2DI3A 1KQ8A 2DLLA 2L02A 2NNYA 5DD4A 3T0YA 1UB9A 4GO1A 1KU9A 1FX7A 1ODDA 1XGMA 2Z99A 1ON2A 2BBYA 1HQCA 1K78A 2QQ9A 3IKTA 4RB0A 4KNYA 3GFIA 5A2QZ 4A0ZA 5L3DA 4B8XA 1JHFA 4G94A 2RKHA 3QP6A 1Z7UA 2A5YB 4D0PA 2EB7A 4P5OA 2OD5A 2W25A 3WG9A 1QZZA 4RB2C 2FE3A 4I2OA 1SAXA 2FBHA 2D1HA 4NQWA 2GAUA 4M6XA 4A6DA 2F5FA 1CF7B 1ZGJA 1YO5C 1FBQA 4WXHA 4I98B 5E1ZB 4MEXF 5FD5A 2RV8A 5D5UB 3WTZA 4NHJA 4BHBA 1STZA 4IHTA 2CQKA 4GGGA 1U8RA 2WV0A 3H3UA 3TOAA 2M45A 2FNPA 2DQRA 3LAPA 1SD4A 3ZMSA 4ENJA 4IJAA 4CXFA 3IWFA 5DCMB 4UVCA 5ICEA 1B4AA 1OKRA 5FFZA 3WTUC 2Z9OA 2JRTA 3L00A 3R61A 3KCCA 2ACJA 1J2XA 2MA3A 3RTRA 3FZVA 2RNJA 4WXDA 3GWZA 4CYDA 1LB2A 5AIPA 4EVIA 2FBKA 3ZMDA 3M9AA 3V7SA 3L7WA 3FWEA 4M6YA 1XN7A 2XHKA 4UNOA 2XVCA 3S2WA 3U9GA 3WTWC 2AXLA 1XB4A 4FHTA 1FBUA 3FM5A 4ZZLA 2UXNA 2FU4A 5IT9Z 3O2PE 4MTEA 5LHIA 2ZNZA 3B73A 1KYWA 4MHGA 2XKPA 1R00A 3FHZA 1YIOA 5L3BA 2HQRA 1U5TC 3R0AA 4MQVA 2VBYA 2Y48A 1RUOA 1BIBA 1IXCA 3ULQB 4OIPF 4YFNF 2DQLA 3O6BB 5FLXK 3GLXA 1WWXA 2UXXA 2QZ8A 2VOPA 1XSVA 2JTVA 1EH6A 4IVNA 3E6CC 2FEZA 2P8TA 4L9TA 5D4SA 1BN5A 1LVAA 3PFIA 4LD5A 4WWCA 4N9HA 3AAFA 2DK5A 2Z5UA 2BV6A 5CVIA 3SZPA 1XSXA 1R5HA 4LLGF 2ZNYA 3K9TA 3V8JA 3EUHA 1MJAA 4I01A 1XDSA 4JK1X 4OU0A 4HDVA 1ZHFA 5F64A 3EETA 1G3TA 1WKMA 4G7ZF 1TBXA 5FO5A 3F22A 3F6VA 2D2WA 5DUKA 2O3FA 2L4AA 1OPCA 2E1NA 1FWZA 3LQQA 5DCFA 1QNTA 4KN4X 3KP2A 1W4MA 2F5EA 3PQJA 4AIJA 1KQ0A 1W7PA 2XIGA 4U0VA 1J5YA 1FP1D 3F23A 1KU3A 3CO7C 3IRRA 3D0SA 1HBXG 1J7KA 5LBQA 2F5CA 1UCRA 3MCZA 3COAC 2EK5A 1V3FA 2A3SA 3WTSC 5ERIA 1FSEA 3BDDA 3C7JA 5ICGA 1USTA 5D8KB 3RIRA 4L9NA 2XAQA 4CO8A 3KEQA 2D1VA 3CUQC 1SD5A 1X3UA 3F8MA 2E7XA 1VTNC 2VE9A 1OYYA 2O8XA 1XCVA 5JI6A 1EH8A 1USSA 2ESNA 3F72A 2VONA 4LB6B 5LRSA 1BOAA 2FQ3A 2QBYA 3I71A 1TNTA 2QLZA 4FX0A 5CVUA 2O03A 3RYRA 3GZ6A 3DXJF 3HSEA 3VFZA 4LMYA 2O6GE 2K86A 4R8HA 2ISYA 3GFJA 2LKPA 1HXDA 5JR3A 2DU9A 2FMYA 2HZTA 1IAWA 4HQEA 4PZJA 4HDUA 1XD7A 1BIAA 4Q47A 1RZ4A 4BAYA 2V9VA 3LFKA 3M7GA 3GXOA 4HF2A 2GXGA 1Z9CA 4L5JA 3QOPA 2FXAA 5LHHA 1O7FA 3K0LA 3C3WA 2FSWA 1IRFA 3P9IA 2CSOA 3WTYC 2L3DA 2MLKA 2WWYA 1QO0D 2XAFA 2EA4A 1Z91A 1BI1A 3J81Z 3EYYA 4G6QA 1ZAOA 4HF1A 4KYWA 5K5RA 3TO9A 2MLGA 1DP7P 4EJWA 4BYYA 1CF7A 3Q9SA 2STWA 5JFRA 1QPMA 4ON0A 1WQ2A 3TGNA 3K1NA 3HOSA 1ZYRF 3HUGA 3SXYA 3W6JB 3KFWX 2VE8A 3K69A 1WRJA 1YS6A 5D5VB 1K6OA 2VXZA 3QP5A 4EM1A 2HR3A 4Z2YA 3QPHA 4XRFA 4EGYA 3Q5FA 3L09A 4JQFA 1YLFA 1LEBA 4I02A 2HFHA 3N4MA 2KJCA 1T98A 2VN2A 1L0OC 1PUEE 2ZO4A 3VOEA 3KZYA 4P55A 1XCBA 4I7HA 3ZN1A 2DO7A 2Q2EA 2ZXJA 2K27A 1U3EM 3V8KA 4RGUA 4EJTA 2DFIA 2DTRA 2PBIA 3GFLA 1PP8F 5HLGA 3T5XA 1O3RA 3ELKA 1P4AA 1Z6RA 3FF5A 3HTUA 4HLYA 1XGOA 3KETA 2DPDA 2YU3A 2L54A 3M8FA 2BEOA 4I0BA 3KP3A 5AIQA 1ZARA 3WTVC 1ZH5A 2GIVA 3HSRA 2Q8KA 1HW1A 2PMUA 4O6JA 3HHGA 3TDUC 1YW8A 2HDCA 1LNWA 2OA4A 2VC1A 3R0JA 2YX4A 1SD6A 1IXRC 3RKYA 4XBFA 1SFXA 2KIUA 2MH9A 2Y0MA 4XLNF 1C0WA 5F6FA 2XAHA 1S6LA 2V6CA 2STTA 5K5QA 2JT1A 1REPC 1I5ZA 1OMIA 3BJAA 4HQMA 3OOPA 2GA1A 4KMUX 3ROUA 2HKXA 2IA0A 4HOBA 1SFUA 1ZN2A 3MZYA 4U7DA 1HKQA 3KP4A 4ZZDA 5LRRA 4OIRF 1I1SA 4I09A 4WK8F 4M9XA 1J59A 1R1VA 3TO6A 5D4RA 2YSRA 3H92A 3TKYA 3JSPA 4ENMA 2QQAA 1GXPA 3E3VA 2PFBA 2G7UA 4M71A 3ZPLA 5D8LB 4PCQA 4OIOF 5DEQA 4HX8A 2LNBA 4L9VA 2W57A 2HGCA 1BC8C 4MTDA 1G6NA 4A5MA 3MAJA 5LGTA 5J6XA 1GXQA 2G7HA 1O3SA 1D8KA 3R6SA 1JGSA 1TNSA 3V7RA 1AWCA 2OZ6A 2F5DA 4M72A 1P4XA 3RDIA 5HDNA 3F8BA 1V4RA 1ZLKA 4A0YA 1YYVA 3G73A 3GYHX 2ZCWA 1PP7U 1IZ1A 1KGSA 1W7PD 5E8IA 1U2WA 2QQBA 4QWQA 4DQ2A 4OMZA 3QU3A 2A07F 2D45A 1S8NA 4AWXB 4IRIA 1L3LA 1Z1DA 2NAZA 3LA3A 1RIOH 3HIFA 3QPTA 2PLYA 2QUFA 4R1HA 2MD5A 1IW7F 4YIIA 4IRHA 1KU2A 2C6YA 2BGCA 3F21A 3DQVC 2L01A 2H94A 1R22A 3HRTA 3I58A 5L3GA 2IP2A 4CHUA 4XSXF 2CWEA 1R58A 3IC7A 4HBLA 3BOQA 1Z6TA 1FOKA 1FLIA 3P9KA 1HKTA 1LQ1A 4L0YB 1MKMA 1EH7A 3NRVA 1J9IA 1TW3A 3K2ZA 5HS7A 3K1MA 2PEXA 5LEKA 1DPRA 2RC4A 1FT9A 3LA2A 1JHHA 3TDZC 1MDMA 4P9UA 1RNLA 3ZMUA 2PI0A 4EMSA 5EEHA 4G8XA 1DDNA 4KICA 2A69F 3MFKA 3GX4X 2PMHA 3FXRA 3E5QA 1R23A 4CGZA 3ZMTA 3BPXA 1O7LA 5FB2A 1LDKB 5A2QK 5E1XA 1O3TA 4UUVA 3GF2A 4EM2A 3BJ6A 2IVMA 2ISZA 2GA2A 1R7JA 2W85A 2DW4A 2XASA 2R7DA 3HRSA 2KIMA 3N97A 1ZREA 2ESHA 1QGPA 5E17F 2K7LA 1MJBA 4HX7A 2EFOA 1UHWA 1O57A 4Q4ZF 2M30A 2QENA 2ZFWA 3RI4A 2FRHA 2GWRA 3KZZA 1LJ9A 4F7ZA 1MJ9A 3K1PA 3SZTA 4N9IA 4GXOA 5CVRA 1FYMA 4XLPF 5E1WA 3GUDA 1ON1A 4U0YA 3ABUA 3LSTA 4OMYA 1SMTA 3IKVA 4WF2A 4HW0A 1FNNA 5FGMA 3IL2A 3BY6A 2XAJA 4MNUA 4ZYEA 3REOA 2VT3A 2ZKZA 5H6RA 1WSUA 4MEYF 4WCGA 2LSOA 3JAMZ 2IW5A 3FXUA 1OYIA 1BI0A 1YW7A 4DNCA 4G7OF 5CVVA 1H9GA 1D8JA 1QZYA 2CGPA 2B0LA 4ENNA 3FMQA 2LDUA 1LDDA 3E97A 3I5UA 3KLNA 1TW2A 4PGHA 4BQAA 5CYVA 4KIFA 2IT0A 5J8CA 1R1TA 2FOKA 5IT9K 2FA5A 4IXAA 2A61A 1UHMA 3WE2A 1B9MA 4MGRA 3BROA 2IPQX 5LLQA 2OBPA 2HQNA 1FYKA 4BH9A 2VODA 1MD0A 5L3FA 5DDGA 2EJRA 5HS9A 4M73A 1Q1HA 1UFMA 5F1RA 3DP7A 3P9CA 4IF4A 2J5OA 3EQLF 1ZG1A 5LHGA 4NB5A 3DPLC 5CLSA 5BPDA 5J8FA 4IHSA 4KIGA 4LB5A 1XGNA 1H9TA 1H0MA 4ASNA 2FNAA 2Q0OA 2P7CB 4UVAA 2R7FA 4HAMA 4WXCA 3WU0A 3BZ6A 2M5WA 2EFWA 3I4PA 4RGSA 1MDMB 3T8TA 4KFCA 2BYVE 5HLHA 4KMFA 3DKWA 3WGIA 4KDPA 1ZG3A 5HOOA 2NYXA 4U7BA 4YG2F 5ILVA 3SQNA 2NS0A 2VBZA 4CDGA 3ABTA 4Y17A 1T6SA 3T1BA 2AS5F 2WC2A 1D3YA 5L3EA 3RPQA 1HSJA 4ESBA 3QU6A 2XUBA 4OOIA 2EV0A 4KA4A 2RGVA 2P7VB 2UWMA 4AVPA 4H0EA 1IN8A 1G4DA 3M1EA 3SHFA 1KA8A 1P6RA 3RYPA 1FP2A 2E7WA 2E1CA 2XRNA 1XMAA 1R1UA 1U5TB 5JVTA 1SFEA 3TOBA 1SMYF 3ZMZA 1MZBA 3GW2A 1XSDA 3ISPA 4LLNA 4BHPA 3GFMA 4HV6A 4WX9A 3J80K 4YIFA 5E8GA 4EV0A 3EYIA 2P6TA 4LK1F 3WODF 4ESJA 2QVOA 2X4HA 4LK0F 1AOYA 4UV9A 1ONVA 1XMKA 3HOTA 3DFGA 4I0AA 4IPAA 4RGRA 4CZZA 1E17A 3CLOA 3JW4A 3DEUA 1G3SA 2P6SA 3FX3A 5HVQC 2XAGA 2PQ8A 4L0ZB 4HX4A 3CO6C 4M74A 1RUNA 2NNNA 2PN6A 4R79A 2KRFA 2CW0F 3WGHA 4AIHA 4HF0A 2EV5A 1FY7A 4A6EA 4YFXF 2IRFG 5IT3A 4LG0B 1YFHA 1G3YA 2JZYA 5FLXZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPU A;  3RJP A;  2P4W A;  1P2F A;  4GYG A;  4M9Z A;  3SFZ A;  2A6E F;  3ZQ7 A;  3KLO A;  2ZME A;  1GVJ A;  5ILU A;  2X0L A;  2EA2 A;  3ERE D;  2RQP A;  2V1D A;  2KIF A;  4L5I A;  1S7A A;  2EFP A;  3IRQ A;  3CUO A;  2H6B A;  5E18 F;  2MC3 A;  2H6C A;  2F2E A;  1FPQ A;  4QLC U;  1OYW A;  1E2X A;  1F4K A;  4EQQ A;  5DUI A;  4P96 A;  3DF8 A;  2OAZ A;  5HDK A;  5DD8 A;  1B6A A;  3J81 K;  4HZF A;  2M87 A;  4YFK F;  2V1U A;  3WGG A;  1HKS A;  2G9W A;  2QWW A;  3CUQ B;  5KK1 A;  3L9F A;  5BPI A;  1F9N A;  3FXQ A;  4EM0 B;  2A68 F;  1RI7 A;  5BMZ A;  3CJN A;  1IRG A;  1W5T A;  1YTY A;  2IA1 A;  3DV8 A;  2EFN A;  1K7A A;  4A5N A;  3V7C A;  3FMS A;  4JBA A;  1O3Q A;  3EDP A;  1IN5 A;  5D5X B;  1CGP A;  5LGU A;  2DBB A;  2YR2 A;  4A0X A;  4N0B A;  2H27 A;  3P7N A;  2HS5 A;  2IJL A;  5L3C A;  3PQK A;  2P5L C;  4G7H F;  1D5V A;  1HW2 A;  1FYL A;  2DAO A;  4U0W A;  2VT2 A;  1PDN C;  2CFX A;  5HS8 A;  2XV4 S;  4EJV A;  1P92 A;  3HSF A;  1JE8 A;  2HYG D;  4EJU A;  3E5U A;  1FZP B;  3FMR A;  2UZK A;  4EJO A;  3ECH A;  5TRD A;  2A6H F;  3F6O A;  3B02 A;  3VOD A;  2VC0 A;  2EFQ A;  3MWM A;  3W6K B;  3E6B A;  3MEX A;  1HW5 A;  1EV7 A;  4RS8 A;  2WTE A;  1J0R A;  2HTJ A;  3DPT A;  3RKW A;  2Y75 A;  1BJA A;  2Z33 A;  4UV8 A;  2O0Y A;  3NEU A;  1S29 A;  2M8E A;  1TTY A;  2MBF A;  5CJ9 A;  3F8C A;  3LWF A;  4BXU A;  5E20 A;  1F5T A;  2K4B A;  2JPB A;  1IUY A;  2YPR A;  3U2R A;  2KKO A;  3QRF F;  2VOO A;  4KIB A;  3HTS B;  4KT5 C;  3LAJ A;  5DV5 A;  2HOE A;  2DK8 A;  4G6D A;  3CDH A;  3GVA A;  2ZME B;  1U6G A;  4ZYG A;  3FM3 A;  5FFX A;  3BP8 A;  3F8F A;  4S05 A;  1S3J A;  1SD7 A;  4LJZ F;  4AD9 A;  2IA2 A;  1KQ9 A;  4ZYD A;  5JHU A;  1BC7 C;  1BBY A;  4HA8 A;  4ETS A;  5D5W B;  2H09 A;  4UHT A;  1R5G A;  2R3S A;  2K02 A;  5CVJ A;  1T0F A;  1ULY A;  1MGT A;  2PG4 A;  3I59 A;  1B59 A;  1QQI A;  1K78 B;  3ZMV A;  2OU2 A;  3IWZ A;  2RVC A;  2CG4 A;  2XRO A;  4U88 A;  4LGW A;  3F3X A;  4RB3 C;  1WI9 A;  5D6E A;  3GZ5 A;  3TO7 A;  3BPV A;  4LFU A;  3BWG A;  1F1Z A;  3VB2 A;  1U5T A;  5ILS A;  3GO5 A;  5LGN A;  4G9Y A;  1KU7 A;  3J7A O;  3M8E A;  1W5S A;  1OR7 A;  1FSH A;  3HYI A;  4RAY A;  1Y0U A;  4XSZ F;  4B09 A;  4ZYH A;  1JXS A;  2NRA C;  3RKX A;  4BNC A;  1IN4 A;  3Q9V A;  4GCV A;  3ML6 A;  2DT5 A;  2LF7 A;  2ZBK A;  1XDU A;  3QAH A;  5TJJ A;  1KYZ A;  5BS6 A;  3J80 Z;  4AIK A;  4OIQ F;  2CO5 A;  1ZG5 A;  4RB1 A;  3IHU A;  3G3Z A;  3KE2 A;  2P5K A;  3TQN A;  1A04 A;  3GEZ A;  2QM3 A;  1Z05 A;  5ICC A;  4UXN A;  4LG0 A;  3WE3 A;  4RGX A;  3U1D A;  2ADU A;  3I53 A;  4A12 A;  4L9J A;  1B9N A;  4TV7 A;  3V8L A;  2VBW A;  1BI2 A;  3MZH A;  3E6D A;  3WU1 B;  4ESF A;  1YG2 A;  4IRG A;  2V79 A;  3ZP5 A;  2Z3Y A;  2OZU A;  2KJB A;  3NQO A;  5H6Q A;  4A2U A;  2HKO A;  4ZH4 F;  2FF4 A;  4PDK A;  2K4J A;  4S04 A;  1TQM A;  1G3W A;  3BJO A;  5DYM A;  4MQ9 F;  3WTX C;  1YQA A;  2EWN A;  3KP5 A;  4ENK A;  1T2K A;  4Y15 A;  4K2E A;  1P4W A;  2GXB A;  4KUM A;  1IF1 A;  1J75 A;  5HLI A;  3T8R A;  2LF8 A;  3C18 A;  5HDG A;  1HST A;  1ZRC A;  3VEP A;  2RN7 A;  3CUQ A;  5ICF A;  5BOX A;  1BM9 A;  2BE5 F;  3MQ0 A;  1I1G A;  3JTH A;  1ZLJ A;  3ZN0 A;  3HHH A;  2YX7 A;  1YW9 A;  1K79 A;  1IN6 A;  3I64 A;  2MH2 A;  5H20 A;  3RPU A;  2W84 A;  4M9S A;  4CIC A;  3E6M A;  2FBI A;  2L4M A;  5KVR A;  2RDP A;  1GHC A;  1LEA A;  3LA7 A;  1FBS A;  5K1Y A;  3ECO A;  2JPC A;  2HWV A;  2HTS A;  4HYE A;  1TQP A;  3CTA A;  4Q5S F;  2M1B A;  1FC3 A;  2GZW A;  3I59 B;  4PGG A;  1B1B A;  5LEJ A;  1LDJ A;  5DCM A;  3HRM A;  3KP7 A;  2W24 A;  2V1X A;  4UVB A;  4L18 B;  1DUX C;  2GQQ A;  1ZRD A;  1TLH B;  3JTG A;  1ZRF A;  2OQG A;  1W7P B;  4GYI A;  4Y13 A;  2CYY A;  1I6X A;  1T39 A;  3I54 A;  2VBX A;  1T38 A;  4O3M A;  4O5V A;  3L2C A;  3I0T A;  5BQT A;  1ZGA A;  2COM A;  4KN7 X;  2ZJ2 A;  2HEO A;  3C1D A;  4RAZ A;  1XGS A;  4P9F A;  4LLL A;  3KEO A;  2J5P A;  2P5V A;  4BHC A;  2OQR A;  2ETH A;  2PJP A;  2XGX A;  1IN7 A;  2ELH A;  3D5L A;  1S7O A;  3KP6 A;  5FD6 A;  3HRU A;  3LQR A;  3E5X A;  2HYF A;  3JAM K;  2FML A;  4OIN F;  4HLX A;  1U78 A;  4Q48 A;  4FT8 A;  3F8N A;  1QBJ A;  4EGZ A;  1NHA A;  3R60 A;  1DPU A;  1BI3 A;  3OV8 A;  1I27 A;  2EV6 A;  6PAX A;  1R36 A;  1IXS B;  5ED4 A;  2QYO A;  3V4G A;  3R4K A;  5AON A;  3O3K A;  3H3Z A;  2QBY B;  2XKO A;  5D6F A;  3JSO A;  2JSC A;  4FX4 A;  5EEG A;  2TDX A;  4HV5 A;  1TQI A;  4E70 A;  2O61 A;  3WTT C;  1YS7 A;  5K5O A;  2DI3 A;  1KQ8 A;  2DLL A;  2L02 A;  2NNY A;  5DD4 A;  3T0Y A;  1UB9 A;  4GO1 A;  1KU9 A;  1FX7 A;  1ODD A;  1XGM A;  2Z99 A;  1ON2 A;  2BBY A;  1HQC A;  1K78 A;  2QQ9 A;  3IKT A;  4RB0 A;  4KNY A;  3GFI A;  5A2Q Z;  4A0Z A;  5L3D A;  4B8X A;  1JHF A;  4G94 A;  2RKH A;  3QP6 A;  1Z7U A;  2A5Y B;  4D0P A;  2EB7 A;  4P5O A;  2OD5 A;  2W25 A;  3WG9 A;  1QZZ A;  4RB2 C;  2FE3 A;  4I2O A;  1SAX A;  2FBH A;  2D1H A;  4NQW A;  2GAU A;  4M6X A;  4A6D A;  2F5F A;  1CF7 B;  1ZGJ A;  1YO5 C;  1FBQ A;  4WXH A;  4I98 B;  5E1Z B;  4MEX F;  5FD5 A;  2RV8 A;  5D5U B;  3WTZ A;  4NHJ A;  4BHB A;  1STZ A;  4IHT A;  2CQK A;  4GGG A;  1U8R A;  2WV0 A;  3H3U A;  3TOA A;  2M45 A;  2FNP A;  2DQR A;  3LAP A;  1SD4 A;  3ZMS A;  4ENJ A;  4IJA A;  4CXF A;  3IWF A;  5DCM B;  4UVC A;  5ICE A;  1B4A A;  1OKR A;  5FFZ A;  3WTU C;  2Z9O A;  2JRT A;  3L00 A;  3R61 A;  3KCC A;  2ACJ A;  1J2X A;  2MA3 A;  3RTR A;  3FZV A;  2RNJ A;  4WXD A;  3GWZ A;  4CYD A;  1LB2 A;  5AIP A;  4EVI A;  2FBK A;  3ZMD A;  3M9A A;  3V7S A;  3L7W A;  3FWE A;  4M6Y A;  1XN7 A;  2XHK A;  4UNO A;  2XVC A;  3S2W A;  3U9G A;  3WTW C;  2AXL A;  1XB4 A;  4FHT A;  1FBU A;  3FM5 A;  4ZZL A;  2UXN A;  2FU4 A;  5IT9 Z;  3O2P E;  4MTE A;  5LHI A;  2ZNZ A;  3B73 A;  1KYW A;  4MHG A;  2XKP A;  1R00 A;  3FHZ A;  1YIO A;  5L3B A;  2HQR A;  1U5T C;  3R0A A;  4MQV A;  2VBY A;  2Y48 A;  1RUO A;  1BIB A;  1IXC A;  3ULQ B;  4OIP F;  4YFN F;  2DQL A;  3O6B B;  5FLX K;  3GLX A;  1WWX A;  2UXX A;  2QZ8 A;  2VOP A;  1XSV A;  2JTV A;  1EH6 A;  4IVN A;  3E6C C;  2FEZ A;  2P8T A;  4L9T A;  5D4S A;  1BN5 A;  1LVA A;  3PFI A;  4LD5 A;  4WWC A;  4N9H A;  3AAF A;  2DK5 A;  2Z5U A;  2BV6 A;  5CVI A;  3SZP A;  1XSX A;  1R5H A;  4LLG F;  2ZNY A;  3K9T A;  3V8J A;  3EUH A;  1MJA A;  4I01 A;  1XDS A;  4JK1 X;  4OU0 A;  4HDV A;  1ZHF A;  5F64 A;  3EET A;  1G3T A;  1WKM A;  4G7Z F;  1TBX A;  5FO5 A;  3F22 A;  3F6V A;  2D2W A;  5DUK A;  2O3F A;  2L4A A;  1OPC A;  2E1N A;  1FWZ A;  3LQQ A;  5DCF A;  1QNT A;  4KN4 X;  3KP2 A;  1W4M A;  2F5E A;  3PQJ A;  4AIJ A;  1KQ0 A;  1W7P A;  2XIG A;  4U0V A;  1J5Y A;  1FP1 D;  3F23 A;  1KU3 A;  3CO7 C;  3IRR A;  3D0S A;  1HBX G;  1J7K A;  5LBQ A;  2F5C A;  1UCR A;  3MCZ A;  3COA C;  2EK5 A;  1V3F A;  2A3S A;  3WTS C;  5ERI A;  1FSE A;  3BDD A;  3C7J A;  5ICG A;  1UST A;  5D8K B;  3RIR A;  4L9N A;  2XAQ A;  4CO8 A;  3KEQ A;  2D1V A;  3CUQ C;  1SD5 A;  1X3U A;  3F8M A;  2E7X A;  1VTN C;  2VE9 A;  1OYY A;  2O8X A;  1XCV A;  5JI6 A;  1EH8 A;  1USS A;  2ESN A;  3F72 A;  2VON A;  4LB6 B;  5LRS A;  1BOA A;  2FQ3 A;  2QBY A;  3I71 A;  1TNT A;  2QLZ A;  4FX0 A;  5CVU A;  2O03 A;  3RYR A;  3GZ6 A;  3DXJ F;  3HSE A;  3VFZ A;  4LMY A;  2O6G E;  2K86 A;  4R8H A;  2ISY A;  3GFJ A;  2LKP A;  1HXD A;  5JR3 A;  2DU9 A;  2FMY A;  2HZT A;  1IAW A;  4HQE A;  4PZJ A;  4HDU A;  1XD7 A;  1BIA A;  4Q47 A;  1RZ4 A;  4BAY A;  2V9V A;  3LFK A;  3M7G A;  3GXO A;  4HF2 A;  2GXG A;  1Z9C A;  4L5J A;  3QOP A;  2FXA A;  5LHH A;  1O7F A;  3K0L A;  3C3W A;  2FSW A;  1IRF A;  3P9I A;  2CSO A;  3WTY C;  2L3D A;  2MLK A;  2WWY A;  1QO0 D;  2XAF A;  2EA4 A;  1Z91 A;  1BI1 A;  3J81 Z;  3EYY A;  4G6Q A;  1ZAO A;  4HF1 A;  4KYW A;  5K5R A;  3TO9 A;  2MLG A;  1DP7 P;  4EJW A;  4BYY A;  1CF7 A;  3Q9S A;  2STW A;  5JFR A;  1QPM A;  4ON0 A;  1WQ2 A;  3TGN A;  3K1N A;  3HOS A;  1ZYR F;  3HUG A;  3SXY A;  3W6J B;  3KFW X;  2VE8 A;  3K69 A;  1WRJ A;  1YS6 A;  5D5V B;  1K6O A;  2VXZ A;  3QP5 A;  4EM1 A;  2HR3 A;  4Z2Y A;  3QPH A;  4XRF A;  4EGY A;  3Q5F A;  3L09 A;  4JQF A;  1YLF A;  1LEB A;  4I02 A;  2HFH A;  3N4M A;  2KJC A;  1T98 A;  2VN2 A;  1L0O C;  1PUE E;  2ZO4 A;  3VOE A;  3KZY A;  4P55 A;  1XCB A;  4I7H A;  3ZN1 A;  2DO7 A;  2Q2E A;  2ZXJ A;  2K27 A;  1U3E M;  3V8K A;  4RGU A;  4EJT A;  2DFI A;  2DTR A;  2PBI A;  3GFL A;  1PP8 F;  5HLG A;  3T5X A;  1O3R A;  3ELK A;  1P4A A;  1Z6R A;  3FF5 A;  3HTU A;  4HLY A;  1XGO A;  3KET A;  2DPD A;  2YU3 A;  2L54 A;  3M8F A;  2BEO A;  4I0B A;  3KP3 A;  5AIQ A;  1ZAR A;  3WTV C;  1ZH5 A;  2GIV A;  3HSR A;  2Q8K A;  1HW1 A;  2PMU A;  4O6J A;  3HHG A;  3TDU C;  1YW8 A;  2HDC A;  1LNW A;  2OA4 A;  2VC1 A;  3R0J A;  2YX4 A;  1SD6 A;  1IXR C;  3RKY A;  4XBF A;  1SFX A;  2KIU A;  2MH9 A;  2Y0M A;  4XLN F;  1C0W A;  5F6F A;  2XAH A;  1S6L A;  2V6C A;  2STT A;  5K5Q A;  2JT1 A;  1REP C;  1I5Z A;  1OMI A;  3BJA A;  4HQM A;  3OOP A;  2GA1 A;  4KMU X;  3ROU A;  2HKX A;  2IA0 A;  4HOB A;  1SFU A;  1ZN2 A;  3MZY A;  4U7D A;  1HKQ A;  3KP4 A;  4ZZD A;  5LRR A;  4OIR F;  1I1S A;  4I09 A;  4WK8 F;  4M9X A;  1J59 A;  1R1V A;  3TO6 A;  5D4R A;  2YSR A;  3H92 A;  3TKY A;  3JSP A;  4ENM A;  2QQA A;  1GXP A;  3E3V A;  2PFB A;  2G7U A;  4M71 A;  3ZPL A;  5D8L B;  4PCQ A;  4OIO F;  5DEQ A;  4HX8 A;  2LNB A;  4L9V A;  2W57 A;  2HGC A;  1BC8 C;  4MTD A;  1G6N A;  4A5M A;  3MAJ A;  5LGT A;  5J6X A;  1GXQ A;  2G7H A;  1O3S A;  1D8K A;  3R6S A;  1JGS A;  1TNS A;  3V7R A;  1AWC A;  2OZ6 A;  2F5D A;  4M72 A;  1P4X A;  3RDI A;  5HDN A;  3F8B A;  1V4R A;  1ZLK A;  4A0Y A;  1YYV A;  3G73 A;  3GYH X;  2ZCW A;  1PP7 U;  1IZ1 A;  1KGS A;  1W7P D;  5E8I A;  1U2W A;  2QQB A;  4QWQ A;  4DQ2 A;  4OMZ A;  3QU3 A;  2A07 F;  2D45 A;  1S8N A;  4AWX B;  4IRI A;  1L3L A;  1Z1D A;  2NAZ A;  3LA3 A;  1RIO H;  3HIF A;  3QPT A;  2PLY A;  2QUF A;  4R1H A;  2MD5 A;  1IW7 F;  4YII A;  4IRH A;  1KU2 A;  2C6Y A;  2BGC A;  3F21 A;  3DQV C;  2L01 A;  2H94 A;  1R22 A;  3HRT A;  3I58 A;  5L3G A;  2IP2 A;  4CHU A;  4XSX F;  2CWE A;  1R58 A;  3IC7 A;  4HBL A;  3BOQ A;  1Z6T A;  1FOK A;  1FLI A;  3P9K A;  1HKT A;  1LQ1 A;  4L0Y B;  1MKM A;  1EH7 A;  3NRV A;  1J9I A;  1TW3 A;  3K2Z A;  5HS7 A;  3K1M A;  2PEX A;  5LEK A;  1DPR A;  2RC4 A;  1FT9 A;  3LA2 A;  1JHH A;  3TDZ C;  1MDM A;  4P9U A;  1RNL A;  3ZMU A;  2PI0 A;  4EMS A;  5EEH A;  4G8X A;  1DDN A;  4KIC A;  2A69 F;  3MFK A;  3GX4 X;  2PMH A;  3FXR A;  3E5Q A;  1R23 A;  4CGZ A;  3ZMT A;  3BPX A;  1O7L A;  5FB2 A;  1LDK B;  5A2Q K;  5E1X A;  1O3T A;  4UUV A;  3GF2 A;  4EM2 A;  3BJ6 A;  2IVM A;  2ISZ A;  2GA2 A;  1R7J A;  2W85 A;  2DW4 A;  2XAS A;  2R7D A;  3HRS A;  2KIM A;  3N97 A;  1ZRE A;  2ESH A;  1QGP A;  5E17 F;  2K7L A;  1MJB A;  4HX7 A;  2EFO A;  1UHW A;  1O57 A;  4Q4Z F;  2M30 A;  2QEN A;  2ZFW A;  3RI4 A;  2FRH A;  2GWR A;  3KZZ A;  1LJ9 A;  4F7Z A;  1MJ9 A;  3K1P A;  3SZT A;  4N9I A;  4GXO A;  5CVR A;  1FYM A;  4XLP F;  5E1W A;  3GUD A;  1ON1 A;  4U0Y A;  3ABU A;  3LST A;  4OMY A;  1SMT A;  3IKV A;  4WF2 A;  4HW0 A;  1FNN A;  5FGM A;  3IL2 A;  3BY6 A;  2XAJ A;  4MNU A;  4ZYE A;  3REO A;  2VT3 A;  2ZKZ A;  5H6R A;  1WSU A;  4MEY F;  4WCG A;  2LSO A;  3JAM Z;  2IW5 A;  3FXU A;  1OYI A;  1BI0 A;  1YW7 A;  4DNC A;  4G7O F;  5CVV A;  1H9G A;  1D8J A;  1QZY A;  2CGP A;  2B0L A;  4ENN A;  3FMQ A;  2LDU A;  1LDD A;  3E97 A;  3I5U A;  3KLN A;  1TW2 A;  4PGH A;  4BQA A;  5CYV A;  4KIF A;  2IT0 A;  5J8C A;  1R1T A;  2FOK A;  5IT9 K;  2FA5 A;  4IXA A;  2A61 A;  1UHM A;  3WE2 A;  1B9M A;  4MGR A;  3BRO A;  2IPQ X;  5LLQ A;  2OBP A;  2HQN A;  1FYK A;  4BH9 A;  2VOD A;  1MD0 A;  5L3F A;  5DDG A;  2EJR A;  5HS9 A;  4M73 A;  1Q1H A;  1UFM A;  5F1R A;  3DP7 A;  3P9C A;  4IF4 A;  2J5O A;  3EQL F;  1ZG1 A;  5LHG A;  4NB5 A;  3DPL C;  5CLS A;  5BPD A;  5J8F A;  4IHS A;  4KIG A;  4LB5 A;  1XGN A;  1H9T A;  1H0M A;  4ASN A;  2FNA A;  2Q0O A;  2P7C B;  4UVA A;  2R7F A;  4HAM A;  4WXC A;  3WU0 A;  3BZ6 A;  2M5W A;  2EFW A;  3I4P A;  4RGS A;  1MDM B;  3T8T A;  4KFC A;  2BYV E;  5HLH A;  4KMF A;  3DKW A;  3WGI A;  4KDP A;  1ZG3 A;  5HOO A;  2NYX A;  4U7B A;  4YG2 F;  5ILV A;  3SQN A;  2NS0 A;  2VBZ A;  4CDG A;  3ABT A;  4Y17 A;  1T6S A;  3T1B A;  2AS5 F;  2WC2 A;  1D3Y A;  5L3E A;  3RPQ A;  1HSJ A;  4ESB A;  3QU6 A;  2XUB A;  4OOI A;  2EV0 A;  4KA4 A;  2RGV A;  2P7V B;  2UWM A;  4AVP A;  4H0E A;  1IN8 A;  1G4D A;  3M1E A;  3SHF A;  1KA8 A;  1P6R A;  3RYP A;  1FP2 A;  2E7W A;  2E1C A;  2XRN A;  1XMA A;  1R1U A;  1U5T B;  5JVT A;  1SFE A;  3TOB A;  1SMY F;  3ZMZ A;  1MZB A;  3GW2 A;  1XSD A;  3ISP A;  4LLN A;  4BHP A;  3GFM A;  4HV6 A;  4WX9 A;  3J80 K;  4YIF A;  5E8G A;  4EV0 A;  3EYI A;  2P6T A;  4LK1 F;  3WOD F;  4ESJ A;  2QVO A;  2X4H A;  4LK0 F;  1AOY A;  4UV9 A;  1ONV A;  1XMK A;  3HOT A;  3DFG A;  4I0A A;  4IPA A;  4RGR A;  4CZZ A;  1E17 A;  3CLO A;  3JW4 A;  3DEU A;  1G3S A;  2P6S A;  3FX3 A;  5HVQ C;  2XAG A;  2PQ8 A;  4L0Z B;  4HX4 A;  3CO6 C;  4M74 A;  1RUN A;  2NNN A;  2PN6 A;  4R79 A;  2KRF A;  2CW0 F;  3WGH A;  4AIH A;  4HF0 A;  2EV5 A;  1FY7 A;  4A6E A;  4YFX F;  2IRF G;  5IT3 A;  4LG0 B;  1YFH A;  1G3Y A;  2JZY A;  5FLX Z; 
#chains in the Genus database with same CATH topology
 5FKL A;  2DPU A;  3RJP A;  1AKH A;  1JT6 A;  1P2F A;  2P4W A;  3Q0V A;  4GYG A;  4IOA F;  4M9Z A;  3SFZ A;  1Y1W J;  1T56 A;  2A6E F;  3ZQ7 A;  3KLO A;  2ZME A;  3K4M A;  4PK4 A;  4F93 B;  1XMX A;  1GVJ A;  3VSK A;  1WCM J;  2JK3 A;  4IHY A;  5ILU A;  2KT0 A;  2FD5 A;  3CCM I;  1DQU A;  2X0L A;  4PJ0 C;  3NAU A;  2EA2 A;  3ERE D;  2RQP A;  2V1D A;  2KIF A;  2W1O A;  1S7A A;  4L5I A;  2EFP A;  2IGM A;  5GP9 A;  5J1U A;  3IRQ A;  3CUO A;  1NG7 A;  2H6B A;  5J1R A;  5E18 F;  4BGD A;  2MC3 A;  2H6C A;  2F2E A;  1FPQ A;  2BVM A;  2JRM A;  3G71 I;  4QLC U;  1OYW A;  4MLO A;  2V4J C;  4Z6Y A;  1E2X A;  5C4J J;  1F4K A;  4EQQ A;  3BLY A;  2EZH A;  3OYD A;  2R7R A;  1DU6 A;  1V5E A;  1WJ5 A;  1IUF A;  5GPC A;  3LSM A;  5DUI A;  2YU9 J;  1QHH D;  3BG7 A;  4P96 A;  3SDG A;  3DF8 A;  2X48 A;  3FXJ A;  3VYT B;  2OAZ A;  5HDK A;  5DD8 A;  1B6A A;  4B3X A;  3J81 K;  3HEF A;  3I55 I;  4HZF A;  4XLF A;  1XC5 A;  2M87 A;  4YFK F;  1VQO I;  1BL0 A;  3ABM H;  2V1U A;  3WGG A;  1HKS A;  2G9W A;  2LVS A;  2VKD A;  2QWW A;  3CUQ B;  5KK1 A;  2HXO A;  3L9F A;  4IHV A;  5F0H A;  5BPI A;  1F9N A;  3FXQ A;  4EM0 B;  4FAS D;  2A68 F;  3Q0U A;  3MD2 A;  1TT5 B;  4CCO A;  1RI7 A;  3IUO A;  1N77 A;  5BMZ A;  3CJN A;  1IRG A;  5E79 C;  3M8J A;  1W5T A;  4N4N B;  1YTY A;  2IA1 A;  3DV8 A;  2EFN A;  1K7A A;  4A5N A;  1TWG J;  2G0E A;  2L7K A;  5EDN A;  3MKW B;  5JHF A;  3V7C A;  1WJA A;  3HZJ A;  2IS2 A;  3FMS A;  4JBA A;  1IGN A;  1VQK I;  1O3Q A;  4BU2 A;  3EDP A;  1IN5 A;  5D5X B;  1QPI A;  2KFD A;  1CGP A;  5LGU A;  2DBB A;  1MND A;  5JVG F;  2YR2 A;  3FBN B;  2DA5 A;  1IV8 A;  5J4V A;  2MD0 A;  4A0X A;  4N0B A;  4XQF A;  2XDV A;  2H27 A;  3BG3 A;  1G2H A;  2DA1 A;  3P7N A;  4BKX A;  4KJZ A;  2EH3 A;  2HS5 A;  5EG0 A;  2IJL A;  4HST A;  5KAI C;  5L3C A;  3S3N A;  3PQK A;  2P5L C;  5BNG A;  2DT6 A;  3BTC A;  2XB0 X;  4G7H F;  2R7O A;  1D5V A;  4BBR J;  1IRX A;  3OL3 A;  1HW2 A;  1FYL A;  2PJR B;  2DAO A;  3KYD B;  4U0W A;  3M3Y J;  1FOY A;  1X3W B;  3BQY A;  2VT2 A;  1PDN C;  2GOM A;  2K3P A;  2CFX A;  5HS8 A;  2XV4 S;  4EJV A;  3QPL A;  2PMZ A;  1P92 A;  4V19 K;  3HSF A;  3LSJ A;  4AID A;  1JE8 A;  2HYG D;  4EJU A;  2H8W A;  3E5U A;  1FZP B;  4NDL A;  1HA8 A;  3FMR A;  3H3V K;  2UZK A;  3UNG C;  4EJO A;  3ECH A;  2E1O A;  5TRD A;  2A6H F;  3F6O A;  4CYC B;  3B02 A;  3H9G A;  2NVU B;  3VOD A;  2VC0 A;  2EFQ A;  3JRB A;  2MSY A;  5KCM A;  4IKF A;  3HJE A;  4ANJ A;  3BR1 A;  3MWM A;  3H0G J;  1VQ6 I;  4JX4 A;  2I10 A;  4GRI A;  3K4L A;  3W6K B;  3DU5 A;  2M9H A;  3E6B A;  3MEX A;  3I56 I;  2F6C A;  3ABL H;  3ABK H;  3W6V A;  1HW5 A;  1EV7 A;  3FXK A;  4RS8 A;  2WTE A;  1QA6 A;  1J0R A;  4FIS A;  4F3Q A;  2HTJ A;  3CDI A;  3VSL A;  2XF5 A;  3WU2 C;  3S15 J;  3QYF A;  2B9S A;  1FMV A;  3DPT A;  3RKW A;  2Y75 A;  1FJL A;  3WG7 H;  1BJA A;  1E3H A;  2Z33 A;  3HGG A;  3S17 J;  4UV8 A;  2O0Y A;  3FIW A;  3NEU A;  3CC4 I;  3BR2 A;  3VPR A;  4PUS A;  2V9P A;  1I39 A;  4A69 C;  1S29 A;  3C2B A;  2M8E A;  1JKQ C;  1TTY A;  2WB1 A;  2MBF A;  2V6E A;  5CJ9 A;  3F8C A;  3LWF A;  4BXU A;  2IGO A;  5E20 A;  1F5T A;  2K4B A;  3CME I;  3JRI A;  2JPB A;  1IUY A;  2YPR A;  3U2R A;  3GBG A;  1YJ9 I;  2KKO A;  1WZ2 A;  4IHX A;  3QRF F;  4XK4 A;  2R0Q C;  2VOO A;  5IYB J;  3ZQG A;  2P81 A;  2AO9 A;  2EZI A;  4KIB A;  3HTS B;  4KT5 C;  3W3C A;  3LAJ A;  1VQ4 I;  5DV5 A;  1AKH B;  2HOE A;  3M07 A;  3O8H A;  2DK8 A;  4G6D A;  3S8P A;  3CDH A;  4CCN A;  3GVA A;  2ZME B;  1U6G A;  2CQ7 A;  2ZJP F;  4F55 A;  4A3F J;  4ZYG A;  3FM3 A;  3HKZ N;  5FFX A;  2LBF B;  3BP8 A;  3F8F A;  3Q0W A;  2RQQ A;  3MKZ A;  4S05 A;  1S3J A;  1SD7 A;  4LJZ F;  4AD9 A;  3PNV A;  2Y2Z A;  2M0C A;  2IA2 A;  1KQ9 A;  1IO2 A;  4XOP A;  4ZYD A;  1YX3 A;  5JHU A;  4QPQ A;  1I50 J;  4IO9 F;  1BC7 C;  3EUK L;  2JSP A;  1BBY A;  4XRS A;  4HA8 A;  2X51 A;  2L2O A;  4ETS A;  5D5W B;  3AKZ A;  2H09 A;  1MSF C;  3OWT A;  4UHT A;  3OYF A;  1R5G A;  2R3S A;  2K02 A;  5CVJ A;  1T0F A;  1A31 A;  1ULY A;  1JUP A;  2E5Z A;  2XGD A;  2JQ7 A;  1MGT A;  2GM4 A;  2PG4 A;  3I59 A;  1B59 A;  1QQI A;  1K78 B;  3ZMV A;  2OU2 A;  3SEZ A;  3IWZ A;  5CQG A;  2RVC A;  1HCR A;  2CG4 A;  2DDA A;  2XRO A;  2GBY A;  4U88 A;  3OYE A;  4PJM A;  3CC7 I;  4LGW A;  3CQZ J;  1X4O A;  2IAI A;  3F3X A;  1I6H J;  2OF7 A;  3JRF A;  4RB3 C;  1WI9 A;  5D6E A;  3GZ5 A;  3TO7 A;  4D9J A;  3BPV A;  4LFU A;  3BWG A;  1F1Z A;  3K6G A;  3CMM A;  5E3N A;  4A3C J;  3VB2 A;  1U5T A;  3OOU A;  5ILS A;  3GO5 A;  5LGN A;  3GTQ J;  4G9Y A;  1Y8Q B;  1KU7 A;  3EUA A;  2VQG A;  3J7A O;  3FKJ A;  3I3L A;  3M8E A;  2K9Q A;  3CJQ B;  1ENH A;  1W5S A;  4NQW B;  4CCK A;  2EPF A;  1OR7 A;  5EGO A;  2XSD C;  1FSH A;  3HYI A;  1YHQ I;  2FX0 A;  1FOX A;  4RAY A;  1Y0U A;  4XSZ F;  4B09 A;  4ZYH A;  1MNM C;  3CJR B;  2D5V A;  1JXS A;  3H9Q A;  5J40 A;  2OCE A;  2NRA C;  3RKX A;  4BNC A;  1IN4 A;  4CH7 A;  3Q9V A;  3AG3 H;  4GCV A;  3ML6 A;  2DT5 A;  2LF7 A;  5EG0 B;  2ZBK A;  4C3I J;  4C2T A;  3ESW B;  1XDU A;  3QAH A;  5TJJ A;  1KYZ A;  3DLA A;  3AL0 B;  2KIQ A;  5BS6 A;  4C3J J;  1GV2 A;  2IEK A;  3J80 Z;  1D1A A;  4AIK A;  1ORK A;  4OIQ F;  2CO5 A;  3GZN B;  1ZG5 A;  4RB1 A;  3IHU A;  3S32 A;  3G3Z A;  3KE2 A;  3GTM J;  2P5K A;  4E7K A;  2CRG A;  3TQN A;  1A04 A;  3GEZ A;  1YJN I;  3IAS 2;  1YX5 A;  2QM3 A;  4XR6 A;  4A93 J;  1Z05 A;  3L2V A;  5ICC A;  3G4S I;  4UXN A;  3CES A;  1TWF J;  2XF7 A;  2IGK A;  4RGX A;  4LG0 A;  3WE3 A;  1VQ7 I;  2WAE A;  1SFK A;  1H88 C;  2L9S A;  3U1D A;  3OYH A;  1H89 C;  4CZC A;  3GTO J;  1V55 H;  2ADU A;  3I53 A;  2R7W A;  4A12 A;  4OAZ A;  4QIW N;  4L5E A;  4L9J A;  4ZJZ A;  3GTG J;  3BG9 A;  2LR8 A;  1B9N A;  3BTL A;  2V26 A;  3FXM A;  4TV7 A;  3V8L A;  3MN2 A;  5IY5 H;  4KT6 A;  5FKO A;  4DIQ A;  2VBW A;  1BI2 A;  4XM3 A;  1PUF B;  1OCT C;  3PIP F;  3QQA A;  3MZH A;  3E6D A;  1ETW A;  2CQN A;  4D5F A;  3WU1 B;  2AHQ A;  4ESF A;  1YG2 A;  3BZC A;  4IRG A;  2V79 A;  3ZP5 A;  3I9V 2;  2WY8 Q;  2Z3Y A;  1GUU A;  3GTK J;  2OZU A;  2KJB A;  3NQO A;  1X2N A;  1TWC J;  5H6Q A;  4A2U A;  2HKO A;  4ZH4 F;  2CQX A;  2FF4 A;  2K4J A;  4PDK A;  4S04 A;  1TQM A;  1HOM A;  1BOB A;  1G3W A;  3BJO A;  4IX7 A;  5DYM A;  4MQ9 F;  4BE2 A;  3WTX C;  2XF6 A;  1YQA A;  3H5A A;  1MBF A;  2LFB A;  2EWN A;  2W48 A;  3CCU I;  3S1R J;  1LKX A;  3KP5 A;  4ENK A;  1T2K A;  1DU0 A;  4Y15 A;  1UG2 A;  2DMN A;  2P0W A;  4K2E A;  1P4W A;  2GXB A;  4KUM A;  1T08 B;  1IF1 A;  1J75 A;  5HLI A;  3JRD A;  4II2 A;  3V42 A;  1BR4 A;  1LPQ A;  2E2H J;  2LF8 A;  3T8R A;  3C18 A;  2OC6 A;  5HDG A;  1P9Q C;  1HST A;  1ZRC A;  1Y1V J;  3VEP A;  2RN7 A;  3CUQ A;  5ICF A;  5BOX A;  1ZKG A;  5M3F J;  3OR2 C;  4KIT B;  1BM9 A;  2BE5 F;  2WAQ A;  3MQ0 A;  1I1G A;  1SEU A;  3JTH A;  1ZLJ A;  1X1A A;  2VKE A;  3ZN0 A;  2E19 A;  3HHH A;  2CV1 A;  2M0M A;  2YX7 A;  1YW9 A;  1K79 A;  5M3M J;  1IN6 A;  2ID6 A;  2E2J J;  4RLQ A;  3I64 A;  2MH2 A;  1A6I A;  3C2G A;  5H20 A;  3RPU A;  4BJ6 C;  2W84 A;  1ZEL A;  2LC2 A;  3DU6 A;  4M9S A;  4CIC A;  3E6M A;  1LFU P;  3U21 A;  3A0B C;  2LLK A;  2E2I J;  3FK6 A;  2FBI A;  4GFB A;  2L4M A;  4PSW A;  4UB6 C;  3QOE A;  5EYR A;  5KVR A;  2W00 A;  2XSJ C;  3DLL F;  2RDP A;  1FTT A;  1GHC A;  1X58 A;  3HC7 A;  1TT0 A;  5KNL A;  5IP9 J;  1APL C;  1LEA A;  3J7Y J;  3LA7 A;  2IXS A;  4U87 A;  4XLA A;  1FBS A;  4IZZ A;  5K1Y A;  3JRC A;  3ECO A;  2JPC A;  5CKT A;  2HWV A;  4QTR A;  2DA2 A;  2HTS A;  4HYE A;  1TQP A;  3I4M J;  3CTA A;  4Q5S F;  2M1B A;  3L2W A;  2PJR A;  2R7T A;  1M1E B;  3S16 J;  1FC3 A;  4YRV A;  2GZW A;  3I59 B;  1UHS A;  1WGX A;  2WAF A;  1W5C C;  4PGG A;  1B1B A;  3PUF A;  5LEJ A;  1LDJ A;  5DCM A;  3HRM A;  3K10 A;  3KP7 A;  3S3O A;  2W24 A;  2V1X A;  4UVB A;  4L18 B;  3RZD J;  1BR1 A;  5GAH J;  2IS6 A;  2ZME C;  1DUX C;  2GQQ A;  1ZRD A;  1TLH B;  3JTG A;  4IOC F;  2L7F P;  3QOD A;  2E36 A;  2Y9Z A;  1ZRF A;  2OQG A;  1W7P B;  4GYI A;  2V9K A;  4CYC A;  2LOO A;  4Y13 A;  3X2Q H;  5FRO A;  1Z3X A;  1MMD A;  2CYY A;  3TBI A;  1I6X A;  1T39 A;  2R4G A;  3I54 A;  2VBX A;  1OCZ H;  1T38 A;  3H5N A;  4O3M A;  4O5V A;  3J7A Y;  5J4Y A;  3L2C A;  5F08 A;  3I0T A;  3L2U A;  2Y9Y A;  4CCM A;  5BQT A;  1ZGA A;  2COM A;  4KN7 X;  3K4C A;  2ZJ2 A;  3AG2 H;  2HEO A;  3PL8 A;  1IDY A;  1U9O A;  2BOL A;  3AG1 H;  3C1D A;  1XGS A;  4RAZ A;  4P9F A;  4LLL A;  3KEO A;  2Y0S N;  2J5P A;  3SEQ A;  4XLE A;  2P5V A;  3CF2 A;  1VZ0 A;  2DJI A;  4BHC A;  3ZQL A;  2OQR A;  1FMW A;  2ETH A;  2PJP A;  4E7I A;  1Y6I A;  3HDD A;  3G1O A;  2XGX A;  3HB9 A;  1IN7 A;  2JA8 J;  2ELH A;  3D5L A;  1S7O A;  2OV7 A;  3S2D J;  3KP6 A;  5F27 A;  5FD6 A;  2QCO A;  1AA7 A;  3HRU A;  3LQR A;  3E5X A;  5DM6 F;  2HYF A;  3ZR8 X;  3JAM K;  2VQH A;  2FML A;  4OIN F;  3MZ8 A;  4HLX A;  2WBM A;  1U78 A;  3M4O J;  3K4K A;  4FT8 A;  3F8N A;  4Q48 A;  1QBJ A;  4NC7 A;  4EGZ A;  1ZQ3 P;  2QEX I;  1NHA A;  3R60 A;  2WV1 A;  1DPU A;  1BI3 A;  3OV8 A;  1I27 A;  1SVM A;  2EV6 A;  6PAX A;  1R36 A;  4ITV A;  1ETV A;  1GVD A;  3K70 D;  2HQ5 A;  1IXS B;  2M7B A;  2QYO A;  5ED4 A;  2Y31 A;  5LD2 C;  3ZQI A;  3V4G A;  3R4K A;  5AON A;  1ETK A;  1QRY A;  3O3K A;  2KZG A;  2DJN A;  3H3Z A;  3OYN A;  3A03 A;  4E7H A;  2XKO A;  2QBY B;  2X85 A;  2LBF A;  5D6F A;  3JSO A;  2JSC A;  3DTI A;  5IP6 A;  5EEG A;  4FX4 A;  1QHG A;  3H5R A;  1B72 B;  2TDX A;  3WHB A;  1ITY A;  4HV5 A;  1TQI A;  1SFO J;  4CUG A;  4E70 A;  2LH9 A;  3A1Y A;  2ZXI A;  4A3B J;  2O61 A;  4A3I J;  3WTT C;  3G1L A;  1YS7 A;  5K5O A;  2DI3 A;  1KQ8 A;  2QGU A;  2DLL A;  2KZV A;  2L02 A;  4BQO A;  2NNY A;  2COB A;  2HOS A;  3ZRG A;  5DD4 A;  3T0Y A;  1UB9 A;  3BCA A;  4GO1 A;  1KU9 A;  3VYU B;  2LY9 A;  1FX7 A;  3GTP J;  3CD6 I;  4BXX J;  1ODD A;  1XGM A;  2XGE A;  3OIQ A;  2Z99 A;  3OYB A;  4HG2 A;  3PM1 A;  1ON2 A;  2L7M P;  2BBY A;  1HQC A;  5FLM J;  1K78 A;  1HLV A;  2QQ9 A;  1YIJ I;  3RQ4 A;  3K70 C;  3IKT A;  4NC6 A;  1JKR C;  3KEY A;  2HVQ A;  4RB0 A;  4KNY A;  2DTZ A;  4BEH B;  3GFI A;  4PJN A;  5A2Q Z;  4A0Z A;  4RLF A;  5L3D A;  4B8X A;  1JHF A;  4G94 A;  2RKH A;  3QP6 A;  1Z7U A;  2FJ1 A;  1Y56 A;  2A5Y B;  1X1B A;  4D0P A;  2EB7 A;  4P5O A;  2ICW G;  1OQY A;  2OD5 A;  2W25 A;  4RAG A;  4UY8 I;  3WG9 A;  2ZJR F;  2CUZ A;  3LMM A;  2XGC A;  1QZZ A;  4RB2 C;  1WJE A;  4CCL A;  2FE3 A;  4I2O A;  4N4O B;  1SAX A;  2FBH A;  3LSK A;  3S2H J;  2D1H A;  4NQW A;  2GAU A;  4M6X A;  4A6D A;  2F5F A;  3TED A;  1CF7 B;  2O8K A;  1ZGJ A;  1YO5 C;  5IOY A;  1FBQ A;  4WXH A;  4I98 B;  4JOM A;  5E1Z B;  4MEX F;  2QF7 A;  3DWL E;  5FD5 A;  3OYG A;  4JP0 A;  2RV8 A;  5D5U B;  2VAS A;  1I3A A;  2KPM A;  3W2V A;  3WTZ A;  4NHJ A;  4BHB A;  1BW5 A;  4ZDP A;  1STZ A;  2KL4 A;  3HUG B;  5J47 A;  3CMY A;  4IHT A;  2CQK A;  3BR5 A;  4GGG A;  1Z21 A;  5EJC A;  1U8R A;  4RDU A;  2WV0 A;  3H3U A;  3TOA A;  4AUX A;  2M45 A;  1RKT A;  2YS9 A;  1S9H A;  3F9K A;  1A36 A;  2FNP A;  4ZYA A;  5F04 A;  2KQR A;  2DQR A;  2MYS A;  4LIV A;  4CA0 A;  2DOF A;  3LAP A;  1SD4 A;  3ZMS A;  4ENJ A;  3A01 A;  4IJA A;  1S7E A;  4CXF A;  2VQC A;  3IV5 A;  5K7H A;  1TL8 A;  4IEJ A;  4NBQ A;  1R71 A;  2UUZ A;  3IWF A;  3K4B A;  5TIS C;  5DCM B;  2OUM A;  4UVC A;  5ICE A;  2FQ4 A;  3S14 J;  1WJB A;  1B4A A;  4B48 A;  4XLC A;  1OKR A;  3LSG A;  5FFZ A;  3WTU C;  2Z9O A;  2JRT A;  2LMD A;  3L00 A;  1U9N A;  3R61 A;  4FET A;  5EF6 A;  3KCC A;  3LSH A;  2ACJ A;  2CW7 A;  1J2X A;  2MA3 A;  2Z1D A;  4JYK A;  5LFA A;  3RTR A;  3FZV A;  4A3D J;  3RZO J;  2AXT C;  2RNJ A;  5J1Y A;  5IYC J;  2R5Y A;  4I6Z A;  4WXD A;  3GWZ A;  4ZDL A;  1TP4 A;  4CYD A;  1LB2 A;  5AIP A;  4EVI A;  3MMY B;  4DBR A;  1LE8 B;  2FBK A;  3ZMD A;  3M9A A;  3A4C A;  3V7S A;  1LFB A;  2Q2E B;  5TGT A;  3F0C A;  1PUF A;  3SZG A;  1RRJ A;  1JJ8 C;  3L7W A;  1G59 A;  3FWE A;  4HSR A;  3WHC A;  4M6Y A;  1XN7 A;  2XHK A;  3DEW A;  4UNO A;  2DT7 B;  3LFU A;  2XVC A;  4LOC A;  3S2W A;  4F91 B;  3U9G A;  2R93 J;  1T0F C;  3WTW C;  2AXL A;  1XB4 A;  5M5Y J;  4FHT A;  2F4O B;  3K4N A;  1FBU A;  3FM5 A;  1K6Y A;  4ZZL A;  2UXN A;  1EKE A;  5IYD J;  2FU4 A;  3S1Q J;  4MIM A;  5FKM A;  5IT9 Z;  3O2P E;  4MTE A;  5LHI A;  2ZNZ A;  3B73 A;  1Z0X A;  1KYW A;  3TW7 A;  4MHG A;  1HF0 A;  2XKP A;  3CP2 A;  3D5R C;  2IS4 A;  1R00 A;  4W1U A;  3CMA I;  2DMU A;  4XN0 A;  3FHZ A;  2IS1 A;  4GDF A;  3DBL B;  1YIO A;  5L3B A;  2HQR A;  3N05 A;  3ZGK A;  2BXY A;  1U5T C;  3R0A A;  2EIL H;  4MQV A;  1O4X A;  1D0X A;  4X6A J;  2VBY A;  2Y48 A;  4DYQ A;  1RUO A;  3DKX A;  2OCC H;  5E3O A;  2WB1 N;  1BIB A;  1MBG A;  4BS9 A;  1IXC A;  3ULQ B;  2LD5 A;  4OIP F;  3IP4 B;  4UUS B;  4YFN F;  1OR7 C;  2KMU A;  5CPR B;  2DQL A;  3O6B B;  5FLX K;  1WJF A;  3CLQ A;  1WWX A;  1X19 A;  3GLX A;  4RBO A;  2LTP A;  2UXX A;  2QZ8 A;  3CF5 F;  2VOP A;  1MMG A;  4PSX A;  1XSV A;  2JTV A;  1EH6 A;  5GPA A;  4IVN A;  3E6C C;  2FEZ A;  1QVT A;  3MKL A;  2JA7 J;  2P8T A;  2EIJ H;  4L9T A;  1X3Z B;  5D4S A;  3A2K A;  3S1M J;  1BN5 A;  1LVA A;  3PFI A;  4LD5 A;  4WWC A;  4N9H A;  3IH4 A;  3AAF A;  2DK5 A;  2Z5U A;  2BV6 A;  2DMQ A;  5CVI A;  3SZP A;  2LRE A;  1OFC X;  1XSX A;  1R5H A;  1UMQ A;  1Y39 A;  3O8G A;  4LLG F;  1GLN A;  1JKP C;  3BG5 A;  5DTD A;  2ZNY A;  3K9T A;  4E7J A;  4UB8 C;  3V8J A;  3EUH A;  1MJA A;  4I01 A;  1VND A;  1XDS A;  4JK1 X;  4OU0 A;  3K2A A;  4RA2 A;  3LSR A;  1ZHF A;  5F64 A;  4HDV A;  1W36 D;  2CV0 A;  2OTL I;  2QSH X;  3BR6 A;  3EET A;  3KIO A;  1G3T A;  1WKM A;  1W0T A;  4G7Z F;  3CJT B;  1FEX A;  1TBX A;  5FO5 A;  4IQ4 A;  3DPU A;  3F22 A;  2ECC A;  1X1D A;  3F6V A;  2QQ8 A;  3ZOB A;  2D2W A;  5DUK A;  2O3F A;  2L4A A;  1OPC A;  2E1N A;  1FWZ A;  2FUG 2;  4J01 A;  3FK7 A;  3LQQ A;  5DCF A;  1QNT A;  4KN4 X;  3KP2 A;  1W4M A;  2F5E A;  3PQJ A;  4AIJ A;  2ZC2 A;  1IDZ A;  4DGW B;  3LSP A;  1KQ0 A;  5JLX A;  3CCL I;  1BA5 A;  3JRA A;  1W7P A;  2XIG A;  4U0V A;  1ZK8 A;  2NS7 A;  1J5Y A;  2XAU A;  3L2R A;  2B63 J;  2LYC A;  1D0Z A;  2BHY A;  1FP1 D;  3BQZ A;  3RPU D;  3F23 A;  1SVL A;  3FHN A;  1KU3 A;  4A3J J;  4MFE A;  3CO7 C;  3IRR A;  3D0S A;  1MMN A;  1Z77 A;  2FOW A;  4E4H A;  1HBX G;  1J7K A;  2CU7 A;  5M5W J;  1W36 C;  5LBQ A;  1A6Q A;  2F5C A;  1VQ8 I;  1KON A;  1MW7 A;  1LVK A;  2ZJQ F;  2DXI A;  1UCR A;  3MCZ A;  2X1E A;  2ZFU A;  3COA C;  1IC8 A;  2EK5 A;  1V3F A;  5F0F A;  4XID A;  2A3S A;  4BAC A;  3A02 A;  2NVT J;  2W7N A;  3WTS C;  5ERI A;  2LP0 A;  4AYB A;  1FSE A;  3BDD A;  3Q3S A;  3C7J A;  3ZQC A;  5ICG A;  1UST A;  1JTX A;  2QSF X;  3RIR A;  5D8K B;  4L9N A;  2XAQ A;  4CO8 A;  4XKW A;  1MSE C;  3KEQ A;  2D1V A;  2DYS H;  2JJ7 A;  3CUQ C;  1SD5 A;  1X3U A;  2VPL A;  4M3B A;  2CFO A;  3F8M A;  2HOT A;  1X1P A;  1OCR H;  2E7X A;  5DM7 F;  1VTN C;  2VXD A;  4G6T B;  2VE9 A;  1AU7 A;  2O5R A;  3A01 B;  1OYY A;  2O8X A;  2HOA A;  1XCV A;  4NC8 A;  5JI6 A;  3ZXS A;  3HPH A;  1EH8 A;  4PFP A;  3TL4 X;  2HPM A;  3KX2 A;  2HVR A;  5CQE A;  1USS A;  2OJE D;  1DGW Y;  4B4C A;  4KIS A;  2ESN A;  3F72 A;  2VON A;  4LB6 B;  5LRS A;  2R5Z A;  5HLT A;  1BOA A;  2BW3 A;  1XS9 A;  1VQL I;  2FQ3 A;  2R7U A;  3K4J A;  2R5Y B;  5B1A H;  2QKM B;  3H36 A;  3W2A A;  2QBY A;  3I71 A;  1TNT A;  2ELJ A;  2QLZ A;  1R5I D;  1WH5 A;  2TCT A;  3B6A A;  1B72 A;  5B3S H;  4FX0 A;  4XKB A;  5CVU A;  2O03 A;  3NAR A;  3RYR A;  3GZ6 A;  4XKC A;  1F43 A;  4AVZ A;  3DXJ F;  2XPV A;  3HSE A;  4B1R A;  3VFZ A;  1ETQ A;  4LMY A;  4XRS G;  2O6G E;  2K86 A;  3HOW J;  3DKY A;  3ZQH A;  4R8H A;  2ISY A;  3CDL A;  2LKP A;  1HXD A;  3GFJ A;  3H35 A;  4BE0 A;  5JR3 A;  2DU9 A;  2FMY A;  2HZT A;  2JVG A;  4HQE A;  1IAW A;  3CP8 A;  5F0C A;  4PZJ A;  3SFI A;  4HDU A;  1XD7 A;  1BIA A;  1ETO A;  4Q47 A;  1OLT A;  1RZ4 A;  1YOV B;  3DBH B;  4BAY A;  2V9V A;  3BG6 A;  3LFK A;  3M7G A;  1VFC A;  3GXO A;  1EF4 A;  4HF2 A;  2LK2 A;  3GCM A;  2GXG A;  3VDX A;  1Z9C A;  1P7J A;  2O9L A;  4L5J A;  3QOP A;  2FXA A;  3HL2 A;  3OYC A;  5LHH A;  1O7F A;  2KLO A;  3K0L A;  2DMT A;  4BEH A;  2XB5 A;  3C3W A;  2FSW A;  1IRF A;  3P9I A;  1NK3 P;  1WPK A;  2CSO A;  2KDZ A;  2NVX J;  3B6C A;  2HPI A;  3WTY C;  2L3D A;  2MLK A;  2WWY A;  1QO0 D;  2XAF A;  1G8X A;  3PO2 J;  2L9V A;  1ETY A;  2EA4 A;  3E0J B;  1Z91 A;  2DFE A;  3CCS I;  3CCV I;  1BI1 A;  1SAU A;  3ZQQ A;  3J81 Z;  3EYY A;  3CCE I;  4G6Q A;  1ZAO A;  4HF1 A;  4KYW A;  5K5R A;  2HZD A;  3TO9 A;  1MH4 A;  1WJD A;  3PSI A;  4XLH A;  2MLG A;  1DP7 P;  2XPW A;  2BY1 A;  4EJW A;  4BYY A;  1CF7 A;  1WJC A;  3Q9S A;  2LG4 A;  3HPG A;  4RM3 A;  5C4X J;  2E71 A;  5JFR A;  2STW A;  1QPM A;  2VPR A;  3I4N J;  4ON0 A;  2K9M A;  1PVE A;  4QSH A;  4M3E A;  1WQ2 A;  2I8D A;  3LNQ A;  3PNY A;  3BTI A;  3DEE A;  3TGN A;  4II3 A;  1R4M B;  3K1N A;  3MKY B;  1SAN A;  1UJ8 A;  2WAD A;  4M3F A;  3HOS A;  1ZYR F;  3HUG A;  3SXY A;  2A6T A;  3W6J B;  2VI6 A;  3KFW X;  2VE8 A;  3K69 A;  1WRJ A;  1YS6 A;  5D5V B;  1K6O A;  2VXZ A;  4V2G A;  1UAA A;  4E6K G;  2OTJ I;  3QP5 A;  1CQT A;  4EM1 A;  2HR3 A;  2JN6 A;  4Z2Y A;  3QPH A;  4XRF A;  4EGY A;  3Q5F A;  2JA6 J;  3L09 A;  3C2H A;  3ONQ A;  4JQF A;  1YLF A;  1TWA J;  5EZH A;  1N25 A;  1BR2 A;  1LEB A;  4A3K J;  4AC0 A;  4ZTF A;  3QPS A;  4I02 A;  2X6W A;  2HFH A;  2MG4 A;  2X1C A;  3N4M A;  2LRD A;  4HRI A;  2KHM A;  1E3P A;  2KJC A;  3SDB A;  4A3L J;  1F36 A;  1T98 A;  2VN2 A;  4LIT A;  3PJR A;  3HG9 A;  1L0O C;  4IL6 C;  2PX9 A;  4M3D A;  1PUE E;  2ZO4 A;  3VOE A;  4D7M A;  3KZY A;  4EEF G;  4CSW A;  1DP3 A;  1POG A;  5B66 C;  1VI0 A;  4DZJ A;  4XRM A;  4P55 A;  3RKQ A;  1XCB A;  4I7H A;  3ZN1 A;  4D7N A;  1OCP A;  2DO7 A;  2DFH A;  1LE8 A;  1NTC A;  2Q2E A;  3MVP A;  2ZXJ A;  2K27 A;  1U3E M;  4E7L A;  3V8K A;  4RGU A;  4EJT A;  1A35 A;  3UR3 C;  5KAF C;  1HC8 A;  2VJJ A;  2DFI A;  3BR0 A;  2DTR A;  4Y33 A;  1JGG A;  1UG0 A;  2WY7 Q;  2PBI A;  3U1K A;  4OWR B;  3GFL A;  1K4T A;  1W0U A;  2VLA A;  1PP8 F;  2M4G A;  2XC7 A;  5HLG A;  3T5X A;  4I76 A;  1O3R A;  3ELK A;  3GTJ J;  1YIT I;  1P4A A;  2VL8 A;  5HNF A;  1JT0 A;  1Z6R A;  3FF5 A;  4HEA 2;  3HTU A;  4HLY A;  1XGO A;  3DTK A;  3KET A;  2DPD A;  4DOZ A;  3OL4 A;  2YU3 A;  2L54 A;  1FIP A;  2CMP A;  3M8F A;  1VQM I;  2Y0S A;  2BEO A;  2VQL A;  2DFF A;  1NH3 A;  1IG7 A;  4I0B A;  3KP3 A;  2VJ5 A;  4NUB A;  5AIQ A;  1ZAR A;  3WTV C;  1ZH5 A;  4DBQ A;  3HOX J;  2GIV A;  3HSR A;  2M8G X;  2Q8K A;  1HW1 A;  4XIC A;  2PMU A;  1I3Q J;  4A3M J;  1IJW C;  4O6J A;  4JX6 A;  4UUS A;  3HHG A;  3TDU C;  2Z16 A;  2R5Z B;  1YW8 A;  2HDC A;  4X1E A;  4X0G A;  1LNW A;  2BW3 B;  2OA4 A;  4DYR A;  1ZTR A;  3PIO F;  3CCR I;  4BJT A;  2DCE A;  2VC1 A;  2YX4 A;  3R0J A;  4BJ5 C;  4M3G A;  1SD6 A;  1D1C A;  2R7Z J;  1IXR C;  1FOW A;  4BXF A;  2RAE A;  3RKY A;  4XBF A;  1SFX A;  2KIU A;  1E3O C;  1MBH A;  2MH9 A;  2Y0M A;  4HNV A;  4XLN F;  1T95 A;  1C0W A;  1YJW I;  5F6F A;  3AL0 C;  2KDO A;  3DBR B;  1R6R A;  4G12 A;  2BY0 A;  2W4S A;  2XAH A;  1S6L A;  2V6C A;  4V2F A;  1SVO A;  2VUM J;  2STT A;  2HU9 A;  5K5Q A;  2JT1 A;  1REP C;  4QPO A;  2DOD A;  1NG6 A;  4FCY A;  2JMW A;  2CQQ A;  2RNG A;  1I5Z A;  4J19 A;  1KZH A;  1OMI A;  3OYA A;  5IOZ A;  3TP0 A;  2L5Q A;  1DGR M;  1N75 A;  2GIZ A;  1ZR4 A;  3ZCO A;  3BJA A;  1E0E A;  2EZK A;  5K7Z A;  2CJJ A;  2YUS A;  4HQM A;  3OOP A;  1QU3 A;  2GA1 A;  4KMU X;  3HOY J;  3ROU A;  4AU7 A;  4NNJ A;  2HKX A;  2IA0 A;  3E1S A;  4HOB A;  1SFU A;  1ZN2 A;  5GTH C;  3MZY A;  4U7D A;  1HKQ A;  3KP4 A;  4ZZD A;  1K61 A;  5EEA A;  5LRR A;  3JRE A;  4OIR F;  1EA3 A;  3K7A J;  3NWS A;  4EAT A;  4I09 A;  4BL0 B;  4WK8 F;  1I1S A;  2NS8 A;  4M9X A;  1J59 A;  2LY1 A;  2KP6 A;  1R1V A;  2VIX A;  3DTE A;  3TO6 A;  5D4R A;  1ZGW A;  2CUF A;  2YSR A;  4Y52 J;  3H92 A;  3FXL A;  3TKY A;  3TMO A;  3JSP A;  4ENM A;  2QQA A;  3SJM A;  1GXP A;  2BHZ A;  3OSF A;  3E3V A;  3BR3 A;  1MIJ A;  2PFB A;  4RAF A;  3FIS A;  2DOA A;  2G7U A;  4M71 A;  3ZPL A;  2X9D A;  5D8L B;  1MBJ A;  1WI3 A;  4PCQ A;  4BY7 J;  1Z7L A;  2DA6 A;  2EZL A;  3QYB A;  4OIO F;  5DEQ A;  5GAE J;  2DOE A;  5IPA A;  4HX8 A;  2ZSI B;  2Q1Z B;  3H0D A;  2LNB A;  4L9V A;  3JR9 A;  2W57 A;  2HGC A;  1BC8 C;  4MTD A;  1G6N A;  4A5M A;  2GXA A;  3MAJ A;  5LGT A;  2NXN B;  3S93 A;  1J09 A;  3TP3 A;  5J6X A;  1GXQ A;  2L9N A;  3FXO A;  4HNT A;  1RET A;  4IQJ A;  2ELK A;  4PJJ A;  4XMY A;  2G7H A;  1O3S A;  1OCC H;  1GV5 A;  1D8K A;  2MC4 A;  4A3E J;  3ASO H;  1JGS A;  1MBK A;  1TNS A;  2DMP A;  3R6S A;  3V7R A;  4DW6 A;  1AWC A;  4ZDO A;  2OZ6 A;  2VB6 A;  2F5D A;  2K5C A;  4M72 A;  1P4X A;  2HXI A;  3RDI A;  3PNT A;  4UUT A;  2HYJ A;  5HDN A;  1NK2 P;  3F8B A;  2AQE A;  3ERM A;  1VQN I;  1V4R A;  1T8I A;  5E3M A;  1ZLK A;  4A0Y A;  1YYV A;  4ABZ A;  1ZR2 A;  3G73 A;  4B47 A;  5GAG J;  3S1N J;  4B3A A;  3GYH X;  3PO3 J;  2ZCW A;  3JRH A;  1PP7 U;  1IZ1 A;  1N78 A;  3LSI A;  1KGS A;  1Y8R B;  3D5S C;  2DN0 A;  5EZG A;  1W7P D;  2B7E A;  2PMZ N;  5C3E J;  5E8I A;  1U2W A;  2QQB A;  4QWQ A;  3OMY A;  4DQ2 A;  3IAM 2;  4IHW A;  4OMZ A;  1D5Y A;  5F1J A;  3QU3 A;  2A07 F;  3NWT A;  2D45 A;  1S8N A;  3LOC A;  3EUH C;  4AWX B;  4IRI A;  3SYT A;  1L3L A;  1S72 I;  1Z1D A;  4RMN A;  2L7Z A;  2NAZ A;  4PJL A;  3LA3 A;  2X6O A;  1MBE A;  2NVY J;  1RIO H;  4XNF A;  1RES A;  3D1N I;  2CUJ A;  3HIF A;  4LIU A;  3QPT A;  2DDB A;  2PLY A;  3OIP A;  2QUF A;  4R1H A;  2MD5 A;  4XON A;  1AHD P;  1T33 A;  1IW7 F;  2L9R A;  4IRH A;  1D0Y A;  1KU2 A;  4YII A;  2C6Y A;  4XN3 A;  1P7I A;  2BGC A;  3F21 A;  3DQV C;  3P5J A;  2TRT A;  2L01 A;  2H94 A;  1R22 A;  3HRT A;  3I58 A;  5L3G A;  2IP2 A;  1B8I A;  3HOZ J;  2LKX A;  4CHU A;  1RPW A;  3AFH A;  2NVQ J;  4XSX F;  3TW6 A;  5B1B H;  2CWE A;  1R58 A;  3IC7 A;  4HBL A;  3BOQ A;  1Z6T A;  1FOK A;  4B43 A;  1FLI A;  3P9K A;  1HKT A;  2KRH A;  2E34 A;  1LQ1 A;  4L0Y B;  1MKM A;  1EH7 A;  4B44 A;  2EIK H;  4JX5 A;  3NRV A;  3OSG A;  1MMA A;  1J9I A;  2F4M B;  4ZTJ A;  2QSG X;  3OYL A;  2E60 A;  1TW3 A;  3BT9 A;  1SC7 A;  3K2Z A;  1V5F A;  1JUM A;  3IH3 A;  5HS7 A;  2ZB9 A;  1BJZ A;  4RM2 A;  2LY2 A;  5FLV A;  3KYC B;  3K1M A;  3HM5 A;  1H8A C;  2PEX A;  5LEK A;  1DPR A;  2KIS A;  2CS3 A;  4HPQ A;  5JLW A;  2RC4 A;  1FT9 A;  3LA2 A;  1JHH A;  3TDZ C;  3A0H C;  2BY2 A;  1MDM A;  4P9U A;  2EQR A;  3HKZ A;  1RNL A;  1VQ5 I;  2CUE A;  2ECB A;  3ZMU A;  2R7Q A;  2PI0 A;  2M3A A;  4EMS A;  5EEH A;  1FTZ A;  2KRC A;  2JVH A;  3HOV J;  3LL7 A;  3OS2 A;  4G8X A;  1DDN A;  3FBI B;  4KIC A;  5DS9 A;  2E35 A;  2A69 F;  2XRL A;  5HNH A;  1HDD C;  3MFK A;  4J00 A;  3GX4 X;  4BY1 J;  2VJI A;  2PMH A;  3FXR A;  3E5Q A;  2OPT A;  2CV2 A;  1R23 A;  1W1W E;  3ZMT A;  4Y7N J;  3BPX A;  4CGZ A;  2H1L A;  1O7L A;  5FB2 A;  2HI3 A;  4M6V A;  1Z67 A;  4E7S A;  1LDK B;  2Y30 A;  5A2Q K;  5E1X A;  1O3T A;  1JTY A;  3J7Z I;  2K3F A;  1UZC A;  4UUV A;  3GF2 A;  4EM2 A;  5FRM A;  3BZK A;  2E1M B;  5IP7 J;  1Q1V A;  1MH3 A;  2DA4 A;  5C44 J;  3BJ6 A;  2IVM A;  2ISZ A;  2GA2 A;  2R7S A;  1R7J A;  2W85 A;  2UV1 A;  2DW4 A;  2XAS A;  2DA7 A;  2DA3 A;  2R7D A;  4I99 C;  4YEJ A;  4A3G J;  3FDY A;  2M7A A;  3HRS A;  3GTL J;  2R7X A;  2RRE A;  2HVS A;  2KIM A;  3N97 A;  1ZRE A;  2ESH A;  3RQI A;  4DYC A;  4AM3 A;  1QGP A;  5E17 F;  2K7L A;  1MJB A;  2VKV A;  3EPZ A;  2EFO A;  4HX7 A;  3OIO A;  5M5X J;  1ETX A;  2JA5 J;  1UHW A;  1O57 A;  4Q4Z F;  1Y0N A;  2M30 A;  2QEN A;  2Z2S B;  2ZFW A;  3HGY A;  1UEL B;  5FKK A;  3RI4 A;  4C9Y A;  3OR1 C;  2FRH A;  2GWR A;  3KZZ A;  2JUG A;  2LKS A;  4FE7 A;  5H2F C;  1LJ9 A;  2L0K A;  4LG3 A;  4F7Z A;  1MJ9 A;  2I5U A;  3ASN H;  2Y69 H;  3K1P A;  2K40 A;  3SZT A;  4N9I A;  4BUP A;  1V54 H;  2M2E A;  3CZ6 A;  3GME A;  3VWB A;  1IRZ A;  4AYB N;  1XTA A;  2JWT A;  4GXO A;  5CVR A;  1FYM A;  4XLP F;  5E1W A;  2ME6 A;  3GUD A;  1YRN A;  1ON1 A;  1RKW A;  4U0Y A;  2X1D A;  3ABU A;  3LST A;  2O7O A;  4H4K C;  4OMY A;  1SMT A;  3IKV A;  4WF2 A;  3HOU J;  4HW0 A;  1FNN A;  3HBL A;  5GTI C;  1BW6 A;  1WHU A;  2W82 A;  5FGM A;  3IL2 A;  2DYR H;  5KHD A;  3BY6 A;  2XAJ A;  4BQQ A;  2A05 A;  3VYS B;  2F4I A;  4MNU A;  4S0H B;  4P1W A;  4ZYE A;  3REO A;  2VT3 A;  2ZKZ A;  2IGN A;  5H6R A;  1WSU A;  4MEY F;  1JKO C;  3CC2 I;  4WCG A;  2LSO A;  2NOJ B;  2IW5 A;  4MO7 A;  3FXU A;  3JAM Z;  1OYI A;  1BI0 A;  1YW7 A;  4DNC A;  2R92 J;  5CVV A;  4G7O F;  2QKL B;  1TC3 C;  1LFP A;  2F5V A;  5K7F A;  3JRG A;  1H9G A;  3KYL A;  1D8J A;  1QZY A;  2CGP A;  2B0L A;  4ENN A;  2HDW A;  3FMQ A;  2LDU A;  3GLL A;  2VJ4 A;  2K85 A;  1LDD A;  1X4P A;  3E97 A;  3I5U A;  2BXZ A;  2H8R A;  1V5G A;  3KLN A;  1TW2 A;  4PGH A;  4BQA A;  3OYK A;  5CYV A;  4KIF A;  1RR7 A;  4C30 A;  2IT0 A;  5J8C A;  1R1T A;  2MAB A;  2FOK A;  5IT9 K;  2FA5 A;  4IXA A;  2A61 A;  3ZQF A;  1QVU A;  4FTH A;  1S5L C;  1OCO H;  1UHM A;  3WE2 A;  1B9M A;  1OJL A;  3BRO A;  2IPQ X;  4MGR A;  5GAD J;  5LLQ A;  3UKG A;  2OBP A;  3AG4 H;  2HQN A;  2ZSH B;  1FYK A;  4BH9 A;  1B8I B;  3G1M A;  3KPH A;  1MD0 A;  2VOD A;  2ME0 A;  5L3F A;  4D1Q A;  5DDG A;  2QA4 I;  2EJR A;  5HS9 A;  4M73 A;  3H9J A;  1Q1H A;  1WVR A;  1UFM A;  2H1K A;  5F1R A;  2NOG A;  1RR8 C;  2EIN H;  3DP7 A;  2ZXH A;  1XPX A;  3P9C A;  4IF4 A;  4YIR X;  2J5O A;  3EQL F;  2X6X A;  3QYE A;  5B5E C;  1ZG1 A;  4BBS J;  5LHG A;  4NB5 A;  3DPL C;  5CLS A;  3CCQ I;  5BPD A;  1R9T J;  5FKN A;  5J8F A;  2VKH A;  3W2W A;  2JUC A;  4IHS A;  1VF9 A;  4CCJ A;  4KIG A;  4LB5 A;  4W97 A;  4PFO A;  3CCJ I;  1XGN A;  2K9L A;  1OIS A;  1H9T A;  1H0M A;  4ASN A;  2FNA A;  2WAQ N;  2M4K A;  2Q0O A;  1VQP I;  2P7C B;  4UVA A;  4C2U A;  2R7F A;  4HAM A;  4HNU A;  4Y4R A;  3G2B A;  4XOR A;  4WXC A;  4YEL A;  4C2M J;  3WU0 A;  4DZP A;  1A5J A;  3BZ6 A;  2CW8 A;  2M5W A;  2EFW A;  1RC9 A;  3I4P A;  4BDZ A;  4RGS A;  1MDM B;  2A5W A;  1YI2 I;  3T8T A;  4KFC A;  1U8B A;  4F52 A;  4Y3O A;  2BYV E;  5HOD A;  1X2M A;  3JCU C;  5HLH A;  1VQ9 I;  4KMF A;  4D5C A;  3DKW A;  4E7Z A;  3S3M A;  3WGI A;  4KDP A;  1ZG3 A;  5HOO A;  2NYX A;  1XG1 A;  4U7B A;  4YG2 F;  3CCY A;  2HNH A;  5ILV A;  1D1B A;  3QWL A;  1K83 J;  3SQN A;  1TZL A;  2NS0 A;  2VBZ A;  4CDG A;  1HDP A;  2GLO A;  4OAY A;  3ABT A;  4Y17 A;  1TWH J;  2X6Y A;  5FJ8 J;  1T6S A;  2F48 A;  2N8G A;  3T1B A;  2AS5 F;  2WC2 A;  1IV6 A;  1D3Y A;  1MMS A;  1U0J A;  5L3E A;  3OY9 A;  3RPQ A;  2WA0 A;  1HSJ A;  4ESB A;  2M34 A;  2XUB A;  3QU6 A;  4OOI A;  2EV0 A;  3H1C A;  4KA4 A;  2AQF A;  3DCF A;  3PSF A;  4DJA A;  2RGV A;  4XOT A;  4F92 B;  2P7V B;  5E3L A;  2UWM A;  4AVP A;  3OYJ A;  4H0E A;  1ACI A;  3BC8 A;  1IN8 A;  1G4D A;  2K9S A;  2XPU A;  3M1E A;  2JA2 A;  3SHF A;  1KA8 A;  1P6R A;  2MW8 A;  3L1P A;  3OYM A;  3RYP A;  1R49 A;  5FRN A;  1R4N B;  4BDY A;  1FP2 A;  2E7W A;  2E1C A;  2XRN A;  1XMA A;  1R1U A;  3HXL A;  1U5T B;  5JVT A;  3FKI J;  2EIM H;  1SFE A;  3M1C A;  2V7F A;  1JI8 A;  1WFX A;  3TOB A;  1SMY F;  2K9N A;  3KZI C;  4FE4 A;  3ZMZ A;  1MZB A;  4MFD A;  3GW2 A;  1XSD A;  3ISP A;  1QZE A;  1Z3Y A;  1JUS A;  2E5N A;  1XX5 A;  2CH0 A;  5EGO B;  4XL9 A;  4BHP A;  1YE9 A;  4LLN A;  3GFM A;  4HV6 A;  2BVL A;  4WX9 A;  3J80 K;  4ZC3 A;  4YIF A;  3PFY A;  2E1M C;  5E8G A;  3G6E I;  3PUB A;  4EV0 A;  3EYI A;  2P6T A;  1YRN B;  4LK1 F;  3WOD F;  3BTJ A;  3E7L A;  2QVO A;  4ESJ A;  1MNE A;  2X4H A;  4LK0 F;  1AOY A;  1LUJ B;  1ONV A;  4UV9 A;  1XMK A;  3HOT A;  1X1C A;  5J3L A;  2HQA A;  3DFG A;  4I0A A;  1GT0 C;  4IPA A;  4RGR A;  4CZZ A;  1EJ9 A;  4XKV A;  1E17 A;  3CLO A;  3JW4 A;  3DEU A;  4BQN A;  2ZXW H;  2HDD A;  1G3S A;  2P6S A;  3OYI A;  3FX3 A;  4FQG A;  2EBI A;  3OS1 A;  2XAG A;  2PQ8 A;  5HVQ C;  4L0Z B;  4HX4 A;  3CO6 C;  3BCB A;  3RSN A;  2R7V A;  1PJR A;  2BZT A;  2BY3 A;  4M74 A;  3L2Q A;  1RUN A;  2NNN A;  1JJ6 C;  2PN6 A;  4R79 A;  3VYR B;  2KRF A;  2CW0 F;  2MGQ A;  1WH7 A;  1FIA A;  2IBD A;  3WGH A;  4AIH A;  2GOX B;  4HF0 A;  2EV5 A;  1ERD A;  3IH2 A;  2MFZ A;  1FY7 A;  1GDT A;  4A6E A;  3RCO A;  4YFX F;  2IRF G;  5IT3 A;  4LG0 B;  4BE1 A;  1YFH A;  2ID3 A;  1G3Y A;  2V1N A;  3OS0 A;  4C3H J;  1PYV A;  1K4S A;  9ANT A;  2JZY A;  5FLX Z; 
#chains in the Genus database with same CATH homology
 2DPU A;  3RJP A;  2P4W A;  1P2F A;  4GYG A;  4M9Z A;  3SFZ A;  2A6E F;  3ZQ7 A;  3KLO A;  2ZME A;  1GVJ A;  5ILU A;  2X0L A;  2EA2 A;  3ERE D;  2RQP A;  2V1D A;  2KIF A;  4L5I A;  1S7A A;  2EFP A;  3IRQ A;  3CUO A;  2H6B A;  5E18 F;  2MC3 A;  2H6C A;  2F2E A;  1FPQ A;  4QLC U;  1OYW A;  1E2X A;  1F4K A;  4EQQ A;  5DUI A;  4P96 A;  3DF8 A;  2OAZ A;  5HDK A;  5DD8 A;  1B6A A;  3J81 K;  4HZF A;  2M87 A;  4YFK F;  2V1U A;  3WGG A;  1HKS A;  2G9W A;  2QWW A;  3CUQ B;  5KK1 A;  3L9F A;  5BPI A;  1F9N A;  3FXQ A;  4EM0 B;  2A68 F;  1RI7 A;  5BMZ A;  3CJN A;  1IRG A;  1W5T A;  1YTY A;  2IA1 A;  3DV8 A;  2EFN A;  1K7A A;  4A5N A;  3V7C A;  3FMS A;  4JBA A;  1O3Q A;  3EDP A;  1IN5 A;  5D5X B;  1CGP A;  5LGU A;  2DBB A;  2YR2 A;  4A0X A;  4N0B A;  2H27 A;  3P7N A;  2HS5 A;  2IJL A;  5L3C A;  3PQK A;  2P5L C;  4G7H F;  1D5V A;  1HW2 A;  1FYL A;  2DAO A;  4U0W A;  2VT2 A;  1PDN C;  2CFX A;  5HS8 A;  2XV4 S;  4EJV A;  1P92 A;  3HSF A;  1JE8 A;  2HYG D;  4EJU A;  3E5U A;  1FZP B;  3FMR A;  2UZK A;  4EJO A;  3ECH A;  5TRD A;  2A6H F;  3F6O A;  3B02 A;  3VOD A;  2VC0 A;  2EFQ A;  3MWM A;  3W6K B;  3E6B A;  3MEX A;  1HW5 A;  1EV7 A;  4RS8 A;  2WTE A;  1J0R A;  2HTJ A;  3DPT A;  3RKW A;  2Y75 A;  1BJA A;  2Z33 A;  4UV8 A;  2O0Y A;  3NEU A;  1S29 A;  2M8E A;  1TTY A;  2MBF A;  5CJ9 A;  3F8C A;  3LWF A;  4BXU A;  5E20 A;  1F5T A;  2K4B A;  2JPB A;  1IUY A;  2YPR A;  3U2R A;  2KKO A;  3QRF F;  2VOO A;  4KIB A;  3HTS B;  4KT5 C;  3LAJ A;  5DV5 A;  2HOE A;  2DK8 A;  4G6D A;  3CDH A;  3GVA A;  2ZME B;  1U6G A;  4ZYG A;  3FM3 A;  5FFX A;  3BP8 A;  3F8F A;  4S05 A;  1S3J A;  1SD7 A;  4LJZ F;  4AD9 A;  2IA2 A;  1KQ9 A;  4ZYD A;  5JHU A;  1BC7 C;  1BBY A;  4HA8 A;  4ETS A;  5D5W B;  2H09 A;  4UHT A;  1R5G A;  2R3S A;  2K02 A;  5CVJ A;  1T0F A;  1ULY A;  1MGT A;  2PG4 A;  3I59 A;  1B59 A;  1QQI A;  1K78 B;  3ZMV A;  2OU2 A;  3IWZ A;  2RVC A;  2CG4 A;  2XRO A;  4U88 A;  4LGW A;  3F3X A;  4RB3 C;  1WI9 A;  5D6E A;  3GZ5 A;  3TO7 A;  3BPV A;  4LFU A;  3BWG A;  1F1Z A;  3VB2 A;  1U5T A;  5ILS A;  3GO5 A;  5LGN A;  4G9Y A;  1KU7 A;  3J7A O;  3M8E A;  1W5S A;  1OR7 A;  1FSH A;  3HYI A;  4RAY A;  1Y0U A;  4XSZ F;  4B09 A;  4ZYH A;  1JXS A;  2NRA C;  3RKX A;  4BNC A;  1IN4 A;  3Q9V A;  4GCV A;  3ML6 A;  2DT5 A;  2LF7 A;  2ZBK A;  1XDU A;  3QAH A;  5TJJ A;  1KYZ A;  5BS6 A;  3J80 Z;  4AIK A;  4OIQ F;  2CO5 A;  1ZG5 A;  4RB1 A;  3IHU A;  3G3Z A;  3KE2 A;  2P5K A;  3TQN A;  1A04 A;  3GEZ A;  2QM3 A;  1Z05 A;  5ICC A;  4UXN A;  4LG0 A;  3WE3 A;  4RGX A;  3U1D A;  2ADU A;  3I53 A;  4A12 A;  4L9J A;  1B9N A;  4TV7 A;  3V8L A;  2VBW A;  1BI2 A;  3MZH A;  3E6D A;  3WU1 B;  4ESF A;  1YG2 A;  4IRG A;  2V79 A;  3ZP5 A;  2Z3Y A;  2OZU A;  2KJB A;  3NQO A;  5H6Q A;  4A2U A;  2HKO A;  4ZH4 F;  2FF4 A;  4PDK A;  2K4J A;  4S04 A;  1TQM A;  1G3W A;  3BJO A;  5DYM A;  4MQ9 F;  3WTX C;  1YQA A;  2EWN A;  3KP5 A;  4ENK A;  1T2K A;  4Y15 A;  4K2E A;  1P4W A;  2GXB A;  4KUM A;  1IF1 A;  1J75 A;  5HLI A;  3T8R A;  2LF8 A;  3C18 A;  5HDG A;  1HST A;  1ZRC A;  3VEP A;  2RN7 A;  3CUQ A;  5ICF A;  5BOX A;  1BM9 A;  2BE5 F;  3MQ0 A;  1I1G A;  3JTH A;  1ZLJ A;  3ZN0 A;  3HHH A;  2YX7 A;  1YW9 A;  1K79 A;  1IN6 A;  3I64 A;  2MH2 A;  5H20 A;  3RPU A;  2W84 A;  4M9S A;  4CIC A;  3E6M A;  2FBI A;  2L4M A;  5KVR A;  2RDP A;  1GHC A;  1LEA A;  3LA7 A;  1FBS A;  5K1Y A;  3ECO A;  2JPC A;  2HWV A;  2HTS A;  4HYE A;  1TQP A;  3CTA A;  4Q5S F;  2M1B A;  1FC3 A;  2GZW A;  3I59 B;  4PGG A;  1B1B A;  5LEJ A;  1LDJ A;  5DCM A;  3HRM A;  3KP7 A;  2W24 A;  2V1X A;  4UVB A;  4L18 B;  1DUX C;  2GQQ A;  1ZRD A;  1TLH B;  3JTG A;  1ZRF A;  2OQG A;  1W7P B;  4GYI A;  4Y13 A;  2CYY A;  1I6X A;  1T39 A;  3I54 A;  2VBX A;  1T38 A;  4O3M A;  4O5V A;  3L2C A;  3I0T A;  5BQT A;  1ZGA A;  2COM A;  4KN7 X;  2ZJ2 A;  2HEO A;  3C1D A;  4RAZ A;  1XGS A;  4P9F A;  4LLL A;  3KEO A;  2J5P A;  2P5V A;  4BHC A;  2OQR A;  2ETH A;  2PJP A;  2XGX A;  1IN7 A;  2ELH A;  3D5L A;  1S7O A;  3KP6 A;  5FD6 A;  3HRU A;  3LQR A;  3E5X A;  2HYF A;  3JAM K;  2FML A;  4OIN F;  4HLX A;  1U78 A;  4Q48 A;  4FT8 A;  3F8N A;  1QBJ A;  4EGZ A;  1NHA A;  3R60 A;  1DPU A;  1BI3 A;  3OV8 A;  1I27 A;  2EV6 A;  6PAX A;  1R36 A;  1IXS B;  5ED4 A;  2QYO A;  3V4G A;  3R4K A;  5AON A;  3O3K A;  3H3Z A;  2QBY B;  2XKO A;  5D6F A;  3JSO A;  2JSC A;  4FX4 A;  5EEG A;  2TDX A;  4HV5 A;  1TQI A;  4E70 A;  2O61 A;  3WTT C;  1YS7 A;  5K5O A;  2DI3 A;  1KQ8 A;  2DLL A;  2L02 A;  2NNY A;  5DD4 A;  3T0Y A;  1UB9 A;  4GO1 A;  1KU9 A;  1FX7 A;  1ODD A;  1XGM A;  2Z99 A;  1ON2 A;  2BBY A;  1HQC A;  1K78 A;  2QQ9 A;  3IKT A;  4RB0 A;  4KNY A;  3GFI A;  5A2Q Z;  4A0Z A;  5L3D A;  4B8X A;  1JHF A;  4G94 A;  2RKH A;  3QP6 A;  1Z7U A;  2A5Y B;  4D0P A;  2EB7 A;  4P5O A;  2OD5 A;  2W25 A;  3WG9 A;  1QZZ A;  4RB2 C;  2FE3 A;  4I2O A;  1SAX A;  2FBH A;  2D1H A;  4NQW A;  2GAU A;  4M6X A;  4A6D A;  2F5F A;  1CF7 B;  1ZGJ A;  1YO5 C;  1FBQ A;  4WXH A;  4I98 B;  5E1Z B;  4MEX F;  5FD5 A;  2RV8 A;  5D5U B;  3WTZ A;  4NHJ A;  4BHB A;  1STZ A;  4IHT A;  2CQK A;  4GGG A;  1U8R A;  2WV0 A;  3H3U A;  3TOA A;  2M45 A;  2FNP A;  2DQR A;  3LAP A;  1SD4 A;  3ZMS A;  4ENJ A;  4IJA A;  4CXF A;  3IWF A;  5DCM B;  4UVC A;  5ICE A;  1B4A A;  1OKR A;  5FFZ A;  3WTU C;  2Z9O A;  2JRT A;  3L00 A;  3R61 A;  3KCC A;  2ACJ A;  1J2X A;  2MA3 A;  3RTR A;  3FZV A;  2RNJ A;  4WXD A;  3GWZ A;  4CYD A;  1LB2 A;  5AIP A;  4EVI A;  2FBK A;  3ZMD A;  3M9A A;  3V7S A;  3L7W A;  3FWE A;  4M6Y A;  1XN7 A;  2XHK A;  4UNO A;  2XVC A;  3S2W A;  3U9G A;  3WTW C;  2AXL A;  1XB4 A;  4FHT A;  1FBU A;  3FM5 A;  4ZZL A;  2UXN A;  2FU4 A;  5IT9 Z;  3O2P E;  4MTE A;  5LHI A;  2ZNZ A;  3B73 A;  1KYW A;  4MHG A;  2XKP A;  1R00 A;  3FHZ A;  1YIO A;  5L3B A;  2HQR A;  1U5T C;  3R0A A;  4MQV A;  2VBY A;  2Y48 A;  1RUO A;  1BIB A;  1IXC A;  3ULQ B;  4OIP F;  4YFN F;  2DQL A;  3O6B B;  5FLX K;  3GLX A;  1WWX A;  2UXX A;  2QZ8 A;  2VOP A;  1XSV A;  2JTV A;  1EH6 A;  4IVN A;  3E6C C;  2FEZ A;  2P8T A;  4L9T A;  5D4S A;  1BN5 A;  1LVA A;  3PFI A;  4LD5 A;  4WWC A;  4N9H A;  3AAF A;  2DK5 A;  2Z5U A;  2BV6 A;  5CVI A;  3SZP A;  1XSX A;  1R5H A;  4LLG F;  2ZNY A;  3K9T A;  3V8J A;  3EUH A;  1MJA A;  4I01 A;  1XDS A;  4JK1 X;  4OU0 A;  4HDV A;  1ZHF A;  5F64 A;  3EET A;  1G3T A;  1WKM A;  4G7Z F;  1TBX A;  5FO5 A;  3F22 A;  3F6V A;  2D2W A;  5DUK A;  2O3F A;  2L4A A;  1OPC A;  2E1N A;  1FWZ A;  3LQQ A;  5DCF A;  1QNT A;  4KN4 X;  3KP2 A;  1W4M A;  2F5E A;  3PQJ A;  4AIJ A;  1KQ0 A;  1W7P A;  2XIG A;  4U0V A;  1J5Y A;  1FP1 D;  3F23 A;  1KU3 A;  3CO7 C;  3IRR A;  3D0S A;  1HBX G;  1J7K A;  5LBQ A;  2F5C A;  1UCR A;  3MCZ A;  3COA C;  2EK5 A;  1V3F A;  2A3S A;  3WTS C;  5ERI A;  1FSE A;  3BDD A;  3C7J A;  5ICG A;  1UST A;  5D8K B;  3RIR A;  4L9N A;  2XAQ A;  4CO8 A;  3KEQ A;  2D1V A;  3CUQ C;  1SD5 A;  1X3U A;  3F8M A;  2E7X A;  1VTN C;  2VE9 A;  1OYY A;  2O8X A;  1XCV A;  5JI6 A;  1EH8 A;  1USS A;  2ESN A;  3F72 A;  2VON A;  4LB6 B;  5LRS A;  1BOA A;  2FQ3 A;  2QBY A;  3I71 A;  1TNT A;  2QLZ A;  4FX0 A;  5CVU A;  2O03 A;  3RYR A;  3GZ6 A;  3DXJ F;  3HSE A;  3VFZ A;  4LMY A;  2O6G E;  2K86 A;  4R8H A;  2ISY A;  3GFJ A;  2LKP A;  1HXD A;  5JR3 A;  2DU9 A;  2FMY A;  2HZT A;  1IAW A;  4HQE A;  4PZJ A;  4HDU A;  1XD7 A;  1BIA A;  4Q47 A;  1RZ4 A;  4BAY A;  2V9V A;  3LFK A;  3M7G A;  3GXO A;  4HF2 A;  2GXG A;  1Z9C A;  4L5J A;  3QOP A;  2FXA A;  5LHH A;  1O7F A;  3K0L A;  3C3W A;  2FSW A;  1IRF A;  3P9I A;  2CSO A;  3WTY C;  2L3D A;  2MLK A;  2WWY A;  1QO0 D;  2XAF A;  2EA4 A;  1Z91 A;  1BI1 A;  3J81 Z;  3EYY A;  4G6Q A;  1ZAO A;  4HF1 A;  4KYW A;  5K5R A;  3TO9 A;  2MLG A;  1DP7 P;  4EJW A;  4BYY A;  1CF7 A;  3Q9S A;  2STW A;  5JFR A;  1QPM A;  4ON0 A;  1WQ2 A;  3TGN A;  3K1N A;  3HOS A;  1ZYR F;  3HUG A;  3SXY A;  3W6J B;  3KFW X;  2VE8 A;  3K69 A;  1WRJ A;  1YS6 A;  5D5V B;  1K6O A;  2VXZ A;  3QP5 A;  4EM1 A;  2HR3 A;  4Z2Y A;  3QPH A;  4XRF A;  4EGY A;  3Q5F A;  3L09 A;  4JQF A;  1YLF A;  1LEB A;  4I02 A;  2HFH A;  3N4M A;  2KJC A;  1T98 A;  2VN2 A;  1L0O C;  1PUE E;  2ZO4 A;  3VOE A;  3KZY A;  4P55 A;  1XCB A;  4I7H A;  3ZN1 A;  2DO7 A;  2Q2E A;  2ZXJ A;  2K27 A;  1U3E M;  3V8K A;  4RGU A;  4EJT A;  2DFI A;  2DTR A;  2PBI A;  3GFL A;  1PP8 F;  5HLG A;  3T5X A;  1O3R A;  3ELK A;  1P4A A;  1Z6R A;  3FF5 A;  3HTU A;  4HLY A;  1XGO A;  3KET A;  2DPD A;  2YU3 A;  2L54 A;  3M8F A;  2BEO A;  4I0B A;  3KP3 A;  5AIQ A;  1ZAR A;  3WTV C;  1ZH5 A;  2GIV A;  3HSR A;  2Q8K A;  1HW1 A;  2PMU A;  4O6J A;  3HHG A;  3TDU C;  1YW8 A;  2HDC A;  1LNW A;  2OA4 A;  2VC1 A;  3R0J A;  2YX4 A;  1SD6 A;  1IXR C;  3RKY A;  4XBF A;  1SFX A;  2KIU A;  2MH9 A;  2Y0M A;  4XLN F;  1C0W A;  5F6F A;  2XAH A;  1S6L A;  2V6C A;  2STT A;  5K5Q A;  2JT1 A;  1REP C;  1I5Z A;  1OMI A;  3BJA A;  4HQM A;  3OOP A;  2GA1 A;  4KMU X;  3ROU A;  2HKX A;  2IA0 A;  4HOB A;  1SFU A;  1ZN2 A;  3MZY A;  4U7D A;  1HKQ A;  3KP4 A;  4ZZD A;  5LRR A;  4OIR F;  1I1S A;  4I09 A;  4WK8 F;  4M9X A;  1J59 A;  1R1V A;  3TO6 A;  5D4R A;  2YSR A;  3H92 A;  3TKY A;  3JSP A;  4ENM A;  2QQA A;  1GXP A;  3E3V A;  2PFB A;  2G7U A;  4M71 A;  3ZPL A;  5D8L B;  4PCQ A;  4OIO F;  5DEQ A;  4HX8 A;  2LNB A;  4L9V A;  2W57 A;  2HGC A;  1BC8 C;  4MTD A;  1G6N A;  4A5M A;  3MAJ A;  5LGT A;  5J6X A;  1GXQ A;  2G7H A;  1O3S A;  1D8K A;  3R6S A;  1JGS A;  1TNS A;  3V7R A;  1AWC A;  2OZ6 A;  2F5D A;  4M72 A;  1P4X A;  3RDI A;  5HDN A;  3F8B A;  1V4R A;  1ZLK A;  4A0Y A;  1YYV A;  3G73 A;  3GYH X;  2ZCW A;  1PP7 U;  1IZ1 A;  1KGS A;  1W7P D;  5E8I A;  1U2W A;  2QQB A;  4QWQ A;  4DQ2 A;  4OMZ A;  3QU3 A;  2A07 F;  2D45 A;  1S8N A;  4AWX B;  4IRI A;  1L3L A;  1Z1D A;  2NAZ A;  3LA3 A;  1RIO H;  3HIF A;  3QPT A;  2PLY A;  2QUF A;  4R1H A;  2MD5 A;  1IW7 F;  4YII A;  4IRH A;  1KU2 A;  2C6Y A;  2BGC A;  3F21 A;  3DQV C;  2L01 A;  2H94 A;  1R22 A;  3HRT A;  3I58 A;  5L3G A;  2IP2 A;  4CHU A;  4XSX F;  2CWE A;  1R58 A;  3IC7 A;  4HBL A;  3BOQ A;  1Z6T A;  1FOK A;  1FLI A;  3P9K A;  1HKT A;  1LQ1 A;  4L0Y B;  1MKM A;  1EH7 A;  3NRV A;  1J9I A;  1TW3 A;  3K2Z A;  5HS7 A;  3K1M A;  2PEX A;  5LEK A;  1DPR A;  2RC4 A;  1FT9 A;  3LA2 A;  1JHH A;  3TDZ C;  1MDM A;  4P9U A;  1RNL A;  3ZMU A;  2PI0 A;  4EMS A;  5EEH A;  4G8X A;  1DDN A;  4KIC A;  2A69 F;  3MFK A;  3GX4 X;  2PMH A;  3FXR A;  3E5Q A;  1R23 A;  4CGZ A;  3ZMT A;  3BPX A;  1O7L A;  5FB2 A;  1LDK B;  5A2Q K;  5E1X A;  1O3T A;  4UUV A;  3GF2 A;  4EM2 A;  3BJ6 A;  2IVM A;  2ISZ A;  2GA2 A;  1R7J A;  2W85 A;  2DW4 A;  2XAS A;  2R7D A;  3HRS A;  2KIM A;  3N97 A;  1ZRE A;  2ESH A;  1QGP A;  5E17 F;  2K7L A;  1MJB A;  4HX7 A;  2EFO A;  1UHW A;  1O57 A;  4Q4Z F;  2M30 A;  2QEN A;  2ZFW A;  3RI4 A;  2FRH A;  2GWR A;  3KZZ A;  1LJ9 A;  4F7Z A;  1MJ9 A;  3K1P A;  3SZT A;  4N9I A;  4GXO A;  5CVR A;  1FYM A;  4XLP F;  5E1W A;  3GUD A;  1ON1 A;  4U0Y A;  3ABU A;  3LST A;  4OMY A;  1SMT A;  3IKV A;  4WF2 A;  4HW0 A;  1FNN A;  5FGM A;  3IL2 A;  3BY6 A;  2XAJ A;  4MNU A;  4ZYE A;  3REO A;  2VT3 A;  2ZKZ A;  5H6R A;  1WSU A;  4MEY F;  4WCG A;  2LSO A;  3JAM Z;  2IW5 A;  3FXU A;  1OYI A;  1BI0 A;  1YW7 A;  4DNC A;  4G7O F;  5CVV A;  1H9G A;  1D8J A;  1QZY A;  2CGP A;  2B0L A;  4ENN A;  3FMQ A;  2LDU A;  1LDD A;  3E97 A;  3I5U A;  3KLN A;  1TW2 A;  4PGH A;  4BQA A;  5CYV A;  4KIF A;  2IT0 A;  5J8C A;  1R1T A;  2FOK A;  5IT9 K;  2FA5 A;  4IXA A;  2A61 A;  1UHM A;  3WE2 A;  1B9M A;  4MGR A;  3BRO A;  2IPQ X;  5LLQ A;  2OBP A;  2HQN A;  1FYK A;  4BH9 A;  2VOD A;  1MD0 A;  5L3F A;  5DDG A;  2EJR A;  5HS9 A;  4M73 A;  1Q1H A;  1UFM A;  5F1R A;  3DP7 A;  3P9C A;  4IF4 A;  2J5O A;  3EQL F;  1ZG1 A;  5LHG A;  4NB5 A;  3DPL C;  5CLS A;  5BPD A;  5J8F A;  4IHS A;  4KIG A;  4LB5 A;  1XGN A;  1H9T A;  1H0M A;  4ASN A;  2FNA A;  2Q0O A;  2P7C B;  4UVA A;  2R7F A;  4HAM A;  4WXC A;  3WU0 A;  3BZ6 A;  2M5W A;  2EFW A;  3I4P A;  4RGS A;  1MDM B;  3T8T A;  4KFC A;  2BYV E;  5HLH A;  4KMF A;  3DKW A;  3WGI A;  4KDP A;  1ZG3 A;  5HOO A;  2NYX A;  4U7B A;  4YG2 F;  5ILV A;  3SQN A;  2NS0 A;  2VBZ A;  4CDG A;  3ABT A;  4Y17 A;  1T6S A;  3T1B A;  2AS5 F;  2WC2 A;  1D3Y A;  5L3E A;  3RPQ A;  1HSJ A;  4ESB A;  3QU6 A;  2XUB A;  4OOI A;  2EV0 A;  4KA4 A;  2RGV A;  2P7V B;  2UWM A;  4AVP A;  4H0E A;  1IN8 A;  1G4D A;  3M1E A;  3SHF A;  1KA8 A;  1P6R A;  3RYP A;  1FP2 A;  2E7W A;  2E1C A;  2XRN A;  1XMA A;  1R1U A;  1U5T B;  5JVT A;  1SFE A;  3TOB A;  1SMY F;  3ZMZ A;  1MZB A;  3GW2 A;  1XSD A;  3ISP A;  4LLN A;  4BHP A;  3GFM A;  4HV6 A;  4WX9 A;  3J80 K;  4YIF A;  5E8G A;  4EV0 A;  3EYI A;  2P6T A;  4LK1 F;  3WOD F;  4ESJ A;  2QVO A;  2X4H A;  4LK0 F;  1AOY A;  4UV9 A;  1ONV A;  1XMK A;  3HOT A;  3DFG A;  4I0A A;  4IPA A;  4RGR A;  4CZZ A;  1E17 A;  3CLO A;  3JW4 A;  3DEU A;  1G3S A;  2P6S A;  3FX3 A;  5HVQ C;  2XAG A;  2PQ8 A;  4L0Z B;  4HX4 A;  3CO6 C;  4M74 A;  1RUN A;  2NNN A;  2PN6 A;  4R79 A;  2KRF A;  2CW0 F;  3WGH A;  4AIH A;  4HF0 A;  2EV5 A;  1FY7 A;  4A6E A;  4YFX F;  2IRF G;  5IT3 A;  4LG0 B;  1YFH A;  1G3Y A;  2JZY A;  5FLX Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...