1FLIA

Dna-binding domain of fli-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLI-1
publication title Solution structure of the ets domain of Fli-1 when bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1994-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fliA00
5FB2A 1T38A 2MH9A 1OR7A 1KYZA 2IA1A 2XAJA 3GW2A 3SFZA 3MQ0A 3RPUA 4YFXF 1TBXA 1FLIA 2FNPA 1JHFA 4XSZF 4IJAA 4EM1A 1MKMA 3DV8A 3CO7C 1W7PA 3RIRA 2Y0MA 1UHMA 2K4BA 5LRRA 3I53A 2B0LA 5ICCA 5K5OA 1PDNC 4HQMA 2HDCA 2OD5A 1TLHB 2EFNA 1J0RA 1ZRCA 2VC1A 5D5VB 1ZREA 3COAC 4YFKF 2KKOA 1YO5C 3ULQB 5HDGA 1XMAA 1YW8A 4BHPA 3JAMZ 3LFKA 1FSHA 2D1VA 4MEXF 3EYIA 1QZYA 2HFHA 5LLQA 3HHGA 4PGGA 1HKSA 3WGHA 4FX0A 3TQNA 4LJZF 1CGPA 1IXCA 4EJWA 1BI0A 2GAUA 3WTUC 5D6FA 2QQ9A 4WXHA 1U6GA 4KYWA 3J80Z 1UHWA 1O57A 2IT0A 2PJPA 4RB3C 1Z05A 3KP3A 1G4DA 4KUMA 4HW0A 2KRFA 2Z99A 1YFHA 1U5TB 2M87A 2W84A 3PFIA 4KIGA 4MQVA 3KLNA 3RKWA 1R1TA 2MBFA 1S29A 3GZ6A 5ICGA 3WGIA 3F6OA 2ESNA 5CVUA 1EV7A 3M9AA 4M74A 4ENJA 1G3TA 3RKYA 3T1BA 4XBFA 4IVNA 1W5SA 1J7KA 3FMRA 2K86A 2VOPA 3RYRA 1IZ1A 3IKVA 4KICA 3CJNA 1DUXC 2FMYA 4P96A 4OIRF 4I0BA 1HXDA 3TOBA 1XMKA 4RGSA 2STWA 3N97A 1A04A 3MAJA 2P8TA 2NAZA 3V8LA 3M8FA 1IW7F 4IRGA 3I58A 2IJLA 1ZLKA 1JGSA 2RV8A 4EGZA 1AOYA 3BWGA 2VN2A 4L18B 4WK8F 2DPDA 3FHZA 2HYGD 4G94A 5AIQA 3R60A 2DK5A 4IXAA 3VB2A 2RNJA 1HSJA 3HRSA 5D8KB 1ZYRF 6PAXA 3K1PA 2GZWA 2HR3A 4GGGA 4U7BA 3MFKA 3QU3A 5E1ZB 4OOIA 3DQVC 4P55A 3K2ZA 3F23A 1J75A 1R00A 1KA8A 1QPMA 1SD7A 2LNBA 4EGYA 5F6FA 4Q47A 5ILUA 1BOAA 5F1RA 2XIGA 2ACJA 2ZNZA 3HSEA 3IL2A 2F2EA 4LLNA 1U78A 1ODDA 4L5JA 1OKRA 2DFIA 3K0LA 2ZNYA 4HZFA 4RB0A 5KVRA 3LA7A 5JFRA 2OU2A 1DPRA 1GXQA 4BHCA 3HSFA 5J8FA 2TDXA 3SZTA 1JXSA 3DXJF 4GYIA 1EH8A 1WRJA 5IT3A 4BNCA 1L3LA 4BXUA 3MEXA 1DP7P 2XAGA 1FT9A 3ZMDA 1W5TA 4A5NA 5D4SA 3WODF 2FRHA 2O0YA 3ZMSA 2CO5A 1ON1A 3EUHA 5K5RA 2DI3A 3E5UA 4OINF 1GXPA 2M1BA 1LEAA 3V7CA 4EM0B 1U5TA 3KZZA 5DV5A 1IN4A 1BN5A 3H3UA 4I98B 3G73A 4TV7A 2EB7A 2HQRA 3KP6A 4KA4A 4ENNA 2VT3A 2RQPA 1FWZA 3L00A 1P92A 1KGSA 3LAPA 2EK5A 3E97A 2EV0A 2BBYA 2DU9A 1IF1A 2ZFWA 3PQKA 1OYWA 4U0WA 1K6OA 3VODA 5D5UB 3DKWA 4A0XA 2EA4A 2HGCA 1SD5A 2CFXA 2DK8A 2ZBKA 2H27A 1TW2A 1ZG5A 4YIIA 2C6YA 3IC7A 2ZJ2A 4NB5A 3CUQB 2DTRA 2Z33A 5CVVA 3BDDA 2A6EF 2D45A 3REOA 3BROA 4MTDA 5CVRA 1KQ0A 1E17A 3HSRA 1DDNA 2QM3A 1FZPB 2FF4A 4IHTA 1YW9A 4FT8A 2MA3A 3ML6A 2CQKA 3CLOA 5TJJA 1TQMA 2H6BA 2IP2A 3BJ6A 4WWCA 4D0PA 3GEZA 5DDGA 3ZQ7A 4KMUX 2ISYA 2O8XA 3EETA 4BQAA 4LK1F 1B6AA 1MJ9A 4A0YA 1U2WA 1O3SA 1HW5A 2QENA 4OMYA 1GHCA 3FM3A 3F8BA 1J5YA 1VTNC 3GFLA 3V4GA 3LA2A 3HTSB 1YW7A 1ZH5A 2FBHA 4MNUA 4M72A 5E1XA 4HLYA 2XKPA 2JPBA 4NQWA 3F21A 4BHBA 4GCVA 2W25A 2ZMEB 4I7HA 2PEXA 5AIPA 1XDUA 3JSPA 2WWYA 2HQNA 1IN7A 3F8CA 1EH6A 3ZN1A 1E2XA 4JK1X 2HEOA 5HS9A 1CF7A 1R1VA 4ESJA 4HX8A 4L0YB 3Q5FA 4XLPF 1WKMA 1BIAA 2STTA 2XUBA 2RN7A 4EVIA 5BS6A 5LGUA 1H0MA 2GA2A 5HOOA 2V1XA 1NHAA 2ZO4A 3N4MA 2X4HA 3MCZA 1RIOH 1KQ9A 2XAFA 1UFMA 1K7AA 2Q8KA 3V8JA 2P4WA 3R6SA 4N9IA 5ILSA 4UNOA 3ZPLA 5E20A 5LGTA 3WTVC 4UVCA 3E6CC 3L2CA 2X0LA 5LEKA 3P9CA 1XGNA 1I5ZA 2A5YB 2FXAA 2F5CA 3CUQA 3LSTA 4HLXA 5EEGA 1G3YA 4ENKA 1R5GA 4LK0F 2QLZA 1YQAA 4AWXB 1WWXA 3EDPA 4LGWA 1T6SA 5CVIA 3TDZC 4A2UA 5H20A 3LQQA 2DBBA 2JPCA 5BMZA 3I54A 3L9FA 3E6BA 1BBYA 1B4AA 1XN7A 4EJVA 4UVBA 3F3XA 1PUEE 4CHUA 2GWRA 4A0ZA 3J81Z 3QP5A 3J7AO 3JW4A 4CDGA 5JVTA 4HV5A 4KNYA 3DEUA 4MQ9F 5FD5A 1HBXG 3GO5A 1T0FA 4CYDA 1FC3A 2LKPA 1Z7UA 1LEBA 5L3GA 4HAMA 1QNTA 1FP2A 2HZTA 1X3UA 3GXOA 5A2QZ 3DPLC 3BJOA 2QQAA 1REPC 2ZMEA 5JI6A 5FLXK 2XROA 4AIHA 1IN8A 2JRTA 1BC7C 3HOTA 3IWZA 3I59B 3D5LA 2LDUA 5LHIA 3GFJA 5K5QA 1QBJA 3DPTA 2L4AA 4ENMA 4HX4A 3WTSC 1IN6A 1YS6A 5E18F 4HOBA 3KEQA 2CGPA 2VONA 1U3EM 3ZP5A 3FXQA 3I64A 2ELHA 1FYLA 5LBQA 3IHUA 4UV8A 3HYIA 2CSOA 3M1EA 2VT2A 2KJBA 3WTXC 4CICA 3HIFA 2EFQA 4QWQA 5AONA 2YSRA 3MZHA 1F9NA 1EH7A 4JQFA 3RI4A 2DPUA 2HS5A 2IA2A 2V9VA 1MZBA 2K4JA 1Z6TA 5L3FA 3FMQA 2VOOA 1BI3A 2P5VA 2FA5A 4ASNA 3ECOA 2DW4A 3QPHA 4BH9A 1XDSA 1SMYF 3ISPA 5CLSA 3Q9SA 4B09A 2XHKA 2W57A 2P7VB 1LVAA 4AVPA 1Z9CA 4KN4X 4RGUA 2VE8A 3B02A 5CJ9A 1UB9A 2OAZA 3FMSA 1MJAA 1OYYA 2L02A 3U2RA 3I0TA 4AD9A 3WTTC 1FX7A 2G7UA 4CZZA 2PG4A 1S7OA 2M30A 5D8LB 1J59A 5E17F 1IXSB 4CXFA 3M8EA 3D0SA 5ICFA 4E70A 1XCVA 3K1NA 4R8HA 1BM9A 1FNNA 4N0BA 1ZLJA 2QZ8A 3CDHA 1P4XA 2MD5A 4MEYF 4HDUA 3V8KA 4GYGA 1O3TA 2MLKA 3HRTA 3GYHX 2OZ6A 2NNNA 4KDPA 2VODA 2NS0A 3HUGA 2EFOA 3ERED 2W24A 1F5TA 2ESHA 3O2PE 5HLIA 2XVCA 1BC8C 5FO5A 2VBZA 2JT1A 4LG0B 1FY7A 5LGNA 2DQRA 4IRHA 3SXYA 1P4WA 5DUIA 1R36A 4GO1A 2W85A 4ESFA 2FU4A 4ZYEA 2Q2EA 1D8KA 1R22A 1FBQA 4YG2F 2L3DA 2CYYA 1ONVA 2XV4S 3RPQA 3I59A 2XGXA 3TO7A 1ZARA 1G3SA 4KT5C 1KQ8A 2FQ3A 3VFZA 4A12A 2RDPA 5CVJA 4RGXA 3JTHA 1YG2A 4S04A 2WC2A 2OQRA 3WE2A 3LWFA 3K69A 3QRFF 4P5OA 2V1UA 2Y48A 1LQ1A 3RYPA 3QPTA 3OOPA 4H0EA 2EJRA 2BEOA 1S7AA 4M6XA 1ZRFA 1T98A 4RAZA 4XRFA 2FBKA 4M6YA 4GXOA 3E5QA 3IRRA 2FE3A 4L5IA 3V7RA 1WSUA 1TQPA 3VOEA 3SZPA 3RTRA 1AWCA 1BIBA 2E7WA 1RNLA 4S05A 4HA8A 2O6GE 2MLGA 2IPQX 3J81K 1FYMA 4L0ZB 1STZA 4LB6B 5KK1A 5DD8A 3WU0A 1QO0D 5D6EA 2MH2A 2YX7A 3JAMK 3E6MA 5D5XB 1LJ9A 2ZCWA 2BGCA 1PP7U 3ZMUA 4EQQA 5ERIA 1ZGJA 1FYKA 4EJUA 4ESBA 4I01A 4UUVA 3DF8A 3U1DA 2OBPA 4OIOF 2VBXA 3ZMVA 2EA2A 4G6QA 1ZG1A 4ZZDA 2G7HA 1MGTA 3I4PA 2O03A 2VE9A 1O3RA 2E1CA 4LG0A 3WTWC 3J80K 1JHHA 4ZZLA 3G3ZA 2COMA 1D8JA 4HF0A 2NYXA 3K1MA 3H3ZA 2PLYA 4KMFA 2OA4A 2O61A 3E3VA 1MDMB 2L54A 4PCQA 3HRUA 4O6JA 5H6RA 2EFWA 5DCMB 4M71A 2F5DA 3W6JB 3TGNA 2OQGA 5CYVA 3U9GA 3BPXA 4P9FA 3T0YA 4BYYA 4LLGF 5HDKA 4A6DA 2R3SA 3L7WA 4MGRA 1IXRC 1GVJA 4FX4A 1QZZA 2HOEA 3SQNA 1U5TC 4Y15A 1KU7A 3RKXA 1SFXA 3EYYA 3KEOA 2BV6A 2H09A 1QGPA 5IT9Z 1B9NA 4MTEA 1OYIA 4KIFA 2XASA 3GFMA 4MHGA 3QAHA 3ZN0A 3RDIA 2WV0A 1I1GA 5DEQA 1I27A 3F22A 2HTJA 1G3WA 1YLFA 4EJOA 3M7GA 3F8NA 1LDDA 5FGMA 4LLLA 1K79A 1K78B 2XAHA 3TO9A 3OV8A 2YU3A 2PQ8A 3ECHA 3TO6A 3R0AA 2K02A 4Q4ZF 4WXDA 1HQCA 3LA3A 2CWEA 2RKHA 4KFCA 1SFEA 3GX4X 1WI9A 5L3CA 1LNWA 5E8GA 2DO7A 3PQJA 2Z3YA 2GA1A 1L0OC 5FD6A 2E1NA 3WTZA 2UWMA 2D1HA 4ZH4F 4IHSA 4XSXF 4LMYA 1RUNA 1XD7A 3QP6A 3VEPA 1SFUA 3P9KA 2QUFA 1HKQA 1B59A 4IF4A 2XAQA 5LRSA 2CW0F 2KIFA 1XGOA 2GIVA 4P9UA 1ZGAA 2M5WA 2AXLA 1U8RA 1IUYA 2PMUA 1USSA 3ZMTA 1RZ4A 4U7DA 4OIPF 2LF8A 5F64A 4Q48A 2PI0A 4K2EA 1I6XA 2G9WA 3IKTA 5ILVA 4ETSA 4HF2A 1TQIA 1S3JA 1BI2A 2IRFG 2JSCA 5DUKA 4G8XA 4JBAA 3C7JA 1MDMA 4WCGA 3KP4A 3NEUA 2FEZA 4WXCA 3F8FA 5DCMA 3TKYA 3WE3A 3BP8A 3R4KA 3GVAA 3E5XA 1V4RA 2HYFA 3T8TA 5D5WB 3F72A 4UXNA 4F7ZA 1ZRDA 4RB1A 1LDKB 5ICEA 3KP7A 4I02A 1C0WA 4RGRA 4M73A 4ZYDA 3FZVA 1G6NA 2BE5F 2FOKA 5LHHA 1WQ2A 3KP2A 3KETA 1TNTA 3R0JA 4Y17A 4XLNF 3FXUA 2NRAC 2RC4A 3HHHA 3SHFA 2WTEA 1JE8A 2RGVA 1MD0A 4HBLA 2QBYB 2K27A 5HLGA 4KN7X 4G7HF 3RJPA 1O3QA 1YS7A 1Z91A 4L9JA 1HSTA 1K78A 1DPUA 2IVMA 4HDVA 3O6BB 1ZN2A 4U0VA 2R7DA 1XCBA 3ABTA 1UCRA 3HOSA 4HYEA 4DNCA 3GUDA 2ISZA 1TW3A 2J5OA 4NHJA 2XRNA 3TOAA 1RI7A 4R79A 1TNSA 1O7FA 1XGMA 3CUQC 3H92A 1P2FA 4HF1A 2ZXJA 1FBUA 4PZJA 3TDUC 5DYMA 2RVCA 5EEHA 2FBIA 2PMHA 4PGHA 2LSOA 2M45A 4L9NA 3T8RA 4CO8A 1YTYA 3ELKA 4Y13A 4N9HA 1B1BA 3LAJA 1ZG3A 3GZ5A 5ED4A 3DP7A 4Z2YA 3P7NA 2Z9OA 2ZKZA 2V79A 3GWZA 4YFNF 1B9MA 1KYWA 3IWFA 3KCCA 4Q5SF 2HWVA 2DLLA 1BJAA 1T2KA 3E6DA 5BPIA 3CTAA 1HW1A 2FSWA 2IW5A 2PFBA 3I71A 2GXGA 3ZMZA 2KIMA 1USTA 2ADUA 2EV5A 5J6XA 5D4RA 1Q1HA 1XGSA 2DQLA 4L9VA 5E8IA 2A68F 1XSXA 5BOXA 4AIKA 2UXNA 2GXBA 2PN6A 4OU0A 1MJBA 3WU1B 4OIQF 2JZYA 5IT9K 4G7OF 3R61A 4M9SA 4RB2C 2F5EA 4G9YA 4LD5A 4A6EA 1ON2A 2QQBA 1PP8F 4HV6A 1S8NA 1SD4A 3JSOA 5TRDA 1J9IA 2Y75A 2UXXA 3FWEA 3MWMA 4CGZA 5HLHA 2CG4A 2VC0A 2KIUA 4U88A 3LQRA 1FBSA 2L01A 3P9IA 2A61A 2Z5UA 4M9XA 3I5UA 2F5FA 3GF2A 3GFIA 4M9ZA 2HKXA 3IRQA 4KIBA 2GQQA 3S2WA 1XSVA 1OMIA 1LDJA 1KU2A 1KU3A 2QBYA 5H6QA 2J5PA 3MZYA 1CF7B 2P7CB 4PDKA 5HS7A 1ZHFA 5HVQC 4UVAA 4IPAA 2H94A 5L3EA 4HQEA 5FLXZ 1I1SA 3C1DA 1SMTA 3F8MA 1Z1DA 3K9TA 1ULYA 2QYOA 2ETHA 3KZYA 3WTYC 3CO6C 3KE2A 2NNYA 4BAYA 3AAFA 4EM2A 5HS8A 5BPDA 2EWNA 2Q0OA 3NQOA 2P5LC 3O3KA 4EMSA 1F4KA 2V6CA 2FNAA 4LB5A 3GLXA 3FF5A 4I0AA 1H9TA 1V3FA 4YIFA 2HKOA 1XB4A 5A2QK 5K1YA 2VBWA 5FFXA 2YX4A 1BI1A 4HX7A 5HDNA 4O5VA 3DFGA 4QLCU 3WGGA 1YYVA 2DAOA 3F6VA 2O3FA 3BPVA 5BQTA 4ON0A 1ZAOA 4WX9A 2QWWA 2XKOA 1W7PB 5LHGA 2DT5A 4O3MA 2P6SA 1HKTA 4B8XA 4FHTA 1Z6RA 3BOQA 1YIOA 3FM5A 1HW2A 2EV6A 2P5KA 4OMZA 5DD4A 3NRVA 1R7JA 1FPQA 1FSEA 4DQ2A 2A6HF 2VXZA 3KFWX 4EJTA 1RUOA 2VBYA 2LF7A 4G6DA 1P6RA 1IN5A 1TTYA 1QQIA 5E1WA 1LB2A 5L3DA 5JR3A 4EV0A 1W7PD 4IRIA 5L3BA 2H6CA 4U0YA 1IAWA 1IRGA 2KJCA 1F1ZA 1FOKA 5J8CA 3C18A 3FX3A 2UZKA 4UHTA 2BYVE 3HRMA 4RS8A 1OPCA 2A69F 1J2XA 3CUOA 2V1DA 1KU9A 2IA0A 2YPRA 3EQLF 2L4MA 1P4AA 4G7ZF 3BJAA 3Q9VA 1R5HA 4L9TA 3BZ6A 3ABUA 2D2WA 3ROUA 4R1HA 2FMLA 1XSDA 3T5XA 4A5MA 4RAYA 3WG9A 4ZYHA 2MC3A 3W6KB 5LEJA 3HTUA 3JTGA 3QOPA 2JTVA 2AS5F 1FP1D 1R58A 2OZUA 1D3YA 1SD6A 3QU6A 5FFZA 4LFUA 4I09A 3V7SA 4ZYGA 3KLOA 3KP5A 2QVOA 3FXRA 4UV9A 3C3WA 2A07F 3BY6A 3L09A 1SAXA 2P6TA 2EFPA 1Y0UA 2M8EA 5DCFA 1IRFA 1S6LA 2R7FA 5JHUA 1H9GA 1O7LA 1R1UA 4I2OA 2PBIA 1R23A 2K7LA 2E7XA 3B73A 2HTSA 2YR2A 4AIJA 1D5VA 4WF2A 2A3SA 1T39A 1W4MA
chains in the Genus database with same CATH superfamily
5FB2A 1T38A 1Z0XA 3D5SC 1V5EA 2MH9A 1OR7A 1KYZA 3BQYA 3OIQA 4ITVA 4ABZA 4B43A 1I50J 1FMWA 2IA1A 4IX7A 2XAJA 3GW2A 4CCJA 3OMYA 3SFZA 4RA2A 3MQ0A 4HNUA 3RPUA 4YFXF 4M3DA 2FOWA 1TBXA 1FLIA 1D0YA 2FNPA 1JHFA 4XSZF 4ZYAA 4IJAA 3VSKA 2NVYJ 4EM1A 3BTIA 1MKMA 3DV8A 3CO7C 2KISA 2JUGA 4FETA 1FTTA 1W7PA 3RIRA 2Y0MA 1UHMA 2K4BA 5LRRA 3CP8A 4PJJA 1MBKA 3I53A 2B0LA 2EBIA 5ICCA 4IHXA 4B48A 5K5OA 2E19A 2X1DA 1PDNC 4BXXJ 2WY7Q 4GRIA 4HQMA 2HDCA 2OD5A 1TLHB 4X1EA 3SFIA 3SYTA 2EFNA 1WH7A 1J0RA 1OFCX 2KZGA 3AG4H 3S3OA 4D7NA 5JVGF 3OL3A 1ENHA 1ZRCA 3HUGB 2VC1A 5D5VB 3GTQJ 1ZREA 3CLQA 3COAC 1JTXA 4YFKF 2KKOA 4LIUA 3I4MJ 4Y4RA 3ZQQA 1YO5C 3HXLA 3S15J 3ULQB 5HDGA 3S93A 2E34A 1XMAA 4YELA 1YW8A 4BHPA 3JAMZ 3RKQA 3IAS2 3LFKA 2DYRH 1FSHA 3PUFA 2D1VA 2CQNA 4MEXF 3EYIA 1QZYA 4UY8I 2HFHA 2VJIA 2JUCA 5LLQA 1R6RA 3HHGA 3FXKA 2KHMA 2ZXHA 3HOZJ 4PGGA 4XICA 1WJDA 1HKSA 3WGHA 2HOAA 2CUZA 4FX0A 3TQNA 4XR6A 4LJZF 2XB5A 1CGPA 2XSDC 5K7FA 1MW7A 1IXCA 2BY0A 4EJWA 1BI0A 1TC3C 2JA5J 2JA8J 2GAUA 3FK6A 3WTUC 5D6FA 2FQ4A 2I10A 4XIDA 1NG6A 1VQOI 1JT0A 2HQAA 2QQ9A 4WXHA 1U6GA 1WJ5A 4KYWA 3J80Z 2DODA 2LMDA 3K4KA 1VQ5I 4HSTA 1RKWA 1UHWA 3BR5A 1O57A 1RKTA 2V9KA 2IT0A 3K6GA 2ZC2A 3HG9A 3SDBA 2PJPA 2NOJB 2V9PA 4RB3C 2E36A 1X19A 4QPQA 1Z05A 3BR1A 3KP3A 1G4DA 4KUMA 4HW0A 2KRFA 4MLOA 2Z99A 2ZXIA 1YFHA 3JRHA 5LD2C 1U5TB 2M87A 2W84A 3RQ4A 2LBFA 5IOZA 3PFIA 4KIGA 4MQVA 3IV5A 3TW6A 3KLNA 3ZR8X 3ESWB 4A3LJ 2DA7A 4IHWA 3W3CA 2ZSIB 3RKWA 1PVEA 1OCTC 2MGQA 1R1TA 2MBFA 2VKDA 1S29A 3GZ6A 4XMYA 5ICGA 3CJQB 3G1LA 1X1BA 5HODA 3WGIA 3F6OA 4N4NB 1WI3A 1TWCJ 2ESNA 5CVUA 1EV7A 4M6VA 2KIQA 2MC4A 1W0UA 2R7ZJ 3M9AA 4M74A 1D5YA 2BXYA 5J1UA 4ENJA 3HB9A 1G3TA 2LRDA 3RKYA 3T1BA 4XBFA 3B6AA 4IVNA 1W5SA 1J7KA 3FMRA 2K86A 2VUMJ 2VOPA 3RYRA 1IZ1A 2ZB9A 3IKVA 4KICA 3CJNA 1LFBA 1DUXC 2FMYA 4P96A 4OIRF 3DKYA 4I0BA 3E0JB 1HXDA 3TOBA 2VKHA 5BNGA 1XMKA 2Y31A 1ZTRA 3L2QA 4RGSA 2IXSA 2STWA 2EZLA 3N97A 2Y9YA 2HVQA 5FKNA 1A04A 3MAJA 2P8TA 2NAZA 3V8LA 4XKCA 3M8FA 1IW7F 1NK2P 4IRGA 3I58A 2IJLA 3BR3A 3TMOA 1JGSA 3OYDA 1ZLKA 2RV8A 4ANJA 4EGZA 1AOYA 3BWGA 2M7BA 2VN2A 3S2DJ 3NAUA 4L18B 4WK8F 2DPDA 3FHZA 2HYGD 4G94A 2WAQA 4BUPA 2DK5A 3R60A 4IXAA 5AIQA 3SEQA 3VB2A 2CV1A 2E1MB 1HSJA 2RNJA 4KT6A 1X4PA 3HRSA 3CMMA 5D8KB 3S1MJ 1A35A 4IL6C 3DWLE 1X1DA 2A6TA 1ZYRF 6PAXA 3K1PA 5FKLA 2GZWA 5HLTA 1ZR2A 2HR3A 4GGGA 4U7BA 3MFKA 2JSPA 1X58A 2IGKA 1FOWA 3QU3A 1GUUA 2KMUA 3DBLB 4EEFG 2L9NA 5E1ZB 4DBQA 1ZELA 4OOIA 1GVDA 3S3MA 3DQVC 2LH9A 4P55A 3MD2A 3ZQGA 2LTPA 1I39A 2W00A 3K2ZA 3F23A 1VQMI 1J75A 3MVPA 1R00A 4DJAA 1KA8A 1QPMA 1SD7A 2LNBA 4BJ6C 3JRGA 4C3JJ 4EGYA 5F6FA 2DMQA 1IO2A 4Q47A 5ILUA 2NXNB 5IYCJ 2LG4A 2KDOA 1BOAA 2PJRB 5F1RA 3MN2A 2XIGA 2ACJA 2ZNZA 3HSEA 3IL2A 2F2EA 3Q0VA 2DMPA 2BVLA 3S8PA 1VQ9I 4LLNA 1U78A 1ODDA 4L5JA 1OKRA 3CJRB 3VYRB 2I8DA 2DFIA 3OYAA 3CESA 3K0LA 2ZNYA 3Q0UA 4HZFA 4RB0A 5KVRA 3LA7A 1IGNA 5JFRA 4NQWB 3BTCA 2OU2A 1DPRA 3JRDA 1GXQA 3FBNB 2YU9J 3SZGA 4BHCA 1R4NB 2VJ4A 3HSFA 1MBHA 5J8FA 3HPGA 2TDXA 1O4XA 3SZTA 1JXSA 3DXJF 4GYIA 1EH8A 1WRJA 2DA5A 2VJJA 5IT3A 2W48A 3OL4A 4BNCA 1L3LA 4BXUA 3H9JA 5HNFA 1IG7A 1TL8A 3MEXA 1DP7P 3AG3H 2KRCA 2HDWA 2XAGA 4FTHA 3FXJA 1FT9A 3ZMDA 4BS9A 1MMDA 2ZJRF 1H8AC 1W5TA 2MABA 1IDZA 2KFDA 4A5NA 5D4SA 2KPMA 3WODF 2B7EA 4ZDPA 2FRHA 2O0YA 4UB8C 2ECBA 3ZMSA 2CO5A 2DOFA 1ON1A 3EUHA 4A3EJ 1E0EA 3A2KA 1U0JA 5K5RA 2DI3A 3E5UA 4OINF 3BT9A 1GXPA 2M1BA 1LEAA 2M34A 1S72I 3V7CA 1PJRA 1SVMA 4EM0B 4B3XA 1U5TA 4PJ0C 4BY1J 3FHNA 3KZZA 5DV5A 4G6TB 1IN4A 1BN5A 5EF6A 5C3EJ 3H3UA 1P7JA 4I98B 3G73A 4TV7A 2EB7A 2HQRA 3KP6A 4KA4A 4ENNA 2QF7A 2VT3A 3OYCA 2RQPA 1FWZA 3L00A 3DPUA 1P92A 1KGSA 3FXLA 4M3BA 3LAPA 2CQ7A 2EK5A 1D1CA 3E97A 2EV0A 3CCYA 2BBYA 3PIPF 1VNDA 2DU9A 5C4XJ 1IF1A 2ZFWA 4LG3A 2EH3A 3PQKA 2R4GA 2L9VA 5EJCA 1OYWA 5DM6F 4AIDA 2CU7A 4U0WA 2K9MA 4BE0A 1K6OA 3VYUB 1Z7LA 3FIWA 3VODA 1Y1VJ 2MW8A 3CCSI 2A5WA 5D5UB 4BY7J 4A69C 3IAM2 3DKWA 4A0XA 5E3MA 1A36A 2MYSA 2EA4A 2E5ZA 3ZRGA 2HGCA 1OCPA 1SD5A 2CFXA 2DK8A 2ZBKA 2H27A 3K70C 3NARA 2DXIA 1TW2A 2QQ8A 2Z16A 1ZG5A 2HI3A 4YIIA 2C6YA 3IC7A 2V7FA 2QEXI 2ZJ2A 4NB5A 3CUQB 2DTRA 2Z33A 1CQTA 3QPSA 5CVVA 3BDDA 2BW3B 3A4CA 2A6EF 2A05A 2LC2A 3REOA 2D45A 3BROA 3ONQA 4MTDA 1FEXA 5CVRA 1KQ0A 5JLWA 1AKHB 1E17A 3HSRA 1DDNA 2QM3A 2XF7A 1FZPB 2FF4A 4IHTA 3VSLA 1YW9A 4FT8A 2MA3A 4BJTA 3ML6A 1Y0NA 4PK4A 4E7ZA 3D1NI 2CQKA 3CF2A 3CLOA 3K4CA 5TJJA 3OIOA 1TQMA 2H6BA 2IP2A 4ZTJA 1ZR4A 3BJ6A 4WWCA 1YX3A 1ZQ3P 4NC6A 4ZTFA 4D0PA 3GEZA 3S3NA 5DDGA 4RLQA 4XLFA 3ZQ7A 4NC7A 4IHYA 1S9HA 1EF4A 4KMUX 2ISYA 3SEZA 2O8XA 2OUMA 3EETA 2LKXA 1JUSA 4J01A 4PJMA 4BQAA 3CCJI 4LK1F 4DGWB 4J00A 1B6AA 1MJ9A 4HG2A 4A0YA 1U2WA 1O3SA 2LP0A 3PO2J 1HW5A 2QENA 4OMYA 1GHCA 1XC5A 2MFZA 3FM3A 3F8BA 3UR3C 1J5YA 4CCOA 5KCMA 2PJRA 3VWBA 1VTNC 3RQIA 3GFLA 4CYCB 3V4GA 3LA2A 2V1NA 3HTSB 1YW7A 5GAHJ 2XGEA 1ZH5A 2ID3A 2FBHA 2MD0A 4MNUA 4M72A 2GIZA 5E1XA 5DM7F 4HLYA 1QA6A 2XKPA 5KAIC 1OCCH 2JPBA 4NQWA 2KLOA 1W36D 1EA3A 3F21A 3LSIA 4BHBA 4UB6C 2WA0A 1F43A 4GCVA 2W25A 2M4GA 3GCMA 1WZ2A 2WB1A 3M3YJ 2XGDA 2QA4I 1X3WB 1Z67A 2ZMEB 2M3AA 3HGGA 4I7HA 3LSRA 2JWTA 2PEXA 2NVTJ 2R7QA 2D5VA 1BW6A 4C9YA 5AIPA 1XDUA 3JSPA 2WWYA 1MSFC 3OOUA 3GBGA 2DT6A 2HQNA 1IN7A 2X1EA 2L2OA 1G8XA 3F8CA 1EH6A 3QODA 3ZN1A 5CKTA 1NG7A 1E2XA 2DFHA 3BR0A 2W7NA 3SDGA 4JK1X 5KNLA 2HEOA 5HS9A 2VQHA 3KX2A 3ZQHA 1MMAA 3RSNA 1CF7A 2YS9A 2EZKA 1R1VA 4XLEA 2ECCA 4ESJA 1RR7A 4I99C 4HX8A 4OWRB 3Q5FA 4L0YB 3A0BC 4XLPF 4KISA 2IBDA 1T95A 1T8IA 1WKMA 3CF5F 1BIAA 2STTA 2XUBA 3QYBA 3RCOA 1B8IA 2RN7A 3BG9A 2R7WA 2EPFA 4EVIA 5BS6A 2R7VA 3HBLA 5LGUA 1H0MA 2GA2A 5HOOA 2R0QC 2V1XA 2R93J 1NHAA 2ZO4A 3N4MA 5J4VA 2X4HA 5M5XJ 3MCZA 1RIOH 5J3LA 1KQ9A 2DA1A 2XAFA 1E3HA 5KAFC 3CMEI 4RAFA 2LD5A 1UFMA 1YI2I 3HOUJ 2DFEA 2B63J 1ETYA 4DYRA 1K7AA 2Q8KA 3V8JA 3L2UA 2P4WA 3R6SA 1ERDA 2Y69H 4N9IA 5ILSA 3OYLA 1X1CA 2VJ5A 1K83J 4UNOA 3ZPLA 3H35A 4PFOA 5E20A 1QPIA 4BBSJ 1E3PA 4A3DJ 2XSJC 5LGTA 2CV0A 3WTVC 4UVCA 3E6CC 2I5UA 2LY2A 4LOCA 3L2CA 2R7RA 2X0LA 5LEKA 2WY8Q 3P9CA 3S1RJ 1XGNA 1I5ZA 1I6HJ 1QHGA 2A5YB 1PUFB 2FXAA 3GTPJ 2BY3A 1HC8A 2F5CA 3CUQA 3LSTA 5DTDA 2HVRA 4HLXA 2L5QA 4B3AA 2BW3A 5EEGA 4DZPA 1U9OA 2K9NA 1GT0C 2R7TA 4C2UA 1AKHA 1G3YA 3A01B 1D0ZA 4ENKA 1IRZA 1R5GA 2M0CA 3BG3A 4LK0F 2QLZA 1QHHD 1YQAA 4AWXB 1WWXA 3EDPA 4Y7NJ 4LGWA 2EILH 2HVSA 1GV2A 4MFEA 1WJFA 1YITI 3CQZJ 3HZJA 1T6SA 3FKJA 5CVIA 3TDZC 5F0CA 1E3OC 2M8GX 4B4CA 4DW6A 4A2UA 5H20A 3LQQA 2DBBA 4I6ZA 2JPCA 2MG4A 5BMZA 3I54A 2K40A 2ZXWH 2GBYA 5E79C 2DCEA 3L9FA 2ZJQF 3Q3SA 3E6BA 1BBYA 5EGOB 2BY1A 2X1CA 1B4AA 3M07A 1XN7A 4BKXA 1YRNB 1Z3YA 4EJVA 2K3FA 2XAUA 4UVBA 2KP6A 3F3XA 1PUEE 4CHUA 2E2IJ 4BQQA 2RNGA 2GWRA 1K61A 1FIAA 4A0ZA 3J81Z 3AL0B 5B3SH 2R7XA 3QP5A 5M3MJ 2XRLA 2BHZA 5EDNA 3J7AO 3KEYA 3PM1A 3JW4A 4CDGA 5JVTA 4JYKA 4HV5A 4CYCA 4KNYA 3H3VK 3DEUA 4MQ9F 1VQKI 2YUSA 5FD5A 4JOMA 3GO5A 1T0FA 3G1MA 4CYDA 3TP3A 4FASD 1HBXG 1FC3A 3DEWA 4D7MA 2LKPA 1Z7UA 1LEBA 2CQQA 5L3GA 4HAMA 1QNTA 2ID6A 1FP2A 2HZTA 1V5GA 2M4KA 2RQQA 3F0CA 3ZQFA 4JX5A 1JTYA 3BCBA 1X3UA 3GXOA 5A2QZ 1G59A 2E35A 2LY9A 2EZIA 2JQ7A 3DPLC 3BJOA 2QQAA 2ME0A 2Q2EB 1REPC 4E6KG 2QKMB 2ZMEA 2LYCA 1TT5B 5IPAA 3C2GA 3O8HA 5JI6A 3MKYB 4XN0A 3CZ6A 5FLXK 1JGGA 2XROA 4AIHA 1XG1A 1IN8A 2JRTA 1BC7C 3HOTA 3IWZA 3I59B 2FJ1A 3D5LA 3IH3A 4N4OB 3I3LA 1BR4A 1TWFJ 2LDUA 3GFJA 5LHIA 5K5QA 4E7LA 1X2NA 5CPRB 1QBJA 2VQLA 3DPTA 2L4AA 3S32A 4HX4A 4ENMA 3WTSC 1IN6A 2ICWG 1QU3A 2W1OA 1R71A 2ELKA 1YS6A 2DN0A 5E18F 3OYBA 4HOBA 3KEQA 2CGPA 2V6EA 3CCMI 2BXZA 2VONA 1HA8A 4FISA 1U3EM 3E1SA 1J09A 1OCZH 4F55A 4A3KJ 1M1EB 2LKSA 1JJ8C 2X6YA 3ZP5A 3FXQA 3I64A 2ELHA 3DTKA 4XK4A 3PIOF 1MNMC 2LR8A 3M4OJ 1FYLA 5LBQA 3IHUA 4UV8A 5GAGJ 3HYIA 1IV8A 2X48A 2CSOA 3AG2H 3M1EA 1YJ9I 2VT2A 2KJBA 3WTXC 3FKIJ 2HPIA 3OYNA 5C44J 4HRIA 4CICA 2LK2A 1UAAA 1LFUP 3HIFA 2EFQA 4QWQA 5AONA 2YSRA 4D9JA 4JX4A 3MZHA 1F9NA 2DOAA 1HDDC 1EH7A 3W2WA 4JQFA 3JRAA 2L7FP 3RI4A 2DPUA 3IH4A 1BR1A 1JKOC 2HS5A 2IA2A 3GTLJ 4ZDOA 2V9VA 1MZBA 2K4JA 1Z6TA 3S2HJ 2O7OA 5L3FA 3FMQA 2IS2A 2VOOA 1BI3A 2P5VA 2FA5A 2X85A 4ASNA 3AFHA 3HOVJ 3QOEA 3ECOA 2DW4A 3QPHA 4BH9A 3OS1A 1XDSA 1SMYF 3ISPA 3LSPA 5CLSA 3Q9SA 5JLXA 3WHBA 4B09A 3E7LA 2XHKA 2W57A 2P7VB 1LVAA 4AVPA 1Z9CA 4KN4X 4RGUA 1BOBA 4HPQA 2VE8A 3B02A 1FMVA 2XPVA 5CJ9A 1PUFA 3V42A 1UB9A 2OAZA 3FMSA 3GTGJ 1MJAA 1OYYA 1OR7C 5F08A 2L02A 4BEHB 4BGDA 3U2RA 3HM5A 2VQGA 3I0TA 4AD9A 3WTTC 1FX7A 4RMNA 4V19K 4BQNA 2G7UA 3S16J 1ZKGA 2KZVA 4F93B 4CZZA 2PG4A 3I56I 1YJNI 1HDPA 5TGTA 1S7OA 4XONA 1SANA 2M30A 5D8LB 2KDZA 3JR9A 3C2BA 2P81A 4E7KA 1J59A 1LPQA 5E17F 1N25A 1IXSB 4HEA2 1Q1VA 5EEAA 4CXFA 2UV1A 3D0SA 3M8EA 5ICFA 4E70A 3I55I 1XCVA 3K1NA 1ZK8A 4R8HA 1BM9A 4PSXA 4HSRA 4IEJA 3HL2A 4YRVA 1ETVA 1FNNA 4N0BA 1YOVB 1ZLJA 5IY5H 2HZDA 2QZ8A 3HJEA 3CDHA 1P4XA 2MD5A 4MEYF 2JA7J 1MMGA 2Z2SB 4HDUA 3MKZA 5EGOA 4F3QA 5FLMJ 3V8KA 2Y0SN 3H5RA 4GYGA 1O3TA 1Y1WJ 2K9LA 3LSJA 2MLKA 1YRNA 3KYDB 3HRTA 3GYHX 2OZ6A 2NNNA 2H8RA 4KDPA 2JVHA 2VODA 2DJIA 2NS0A 3HUGA 1S5LC 2EFOA 4FE4A 1V5FA 3ERED 1Y8QB 1T0FC 2W24A 3I4NJ 1F5TA 2ESHA 2W82A 5E3LA 1UJ8A 3O2PE 1YHQI 1T08B 4A93J 5HLIA 1QRYA 1W1WE 2XVCA 1BC8C 5FO5A 2VBZA 2JT1A 4LG0B 2OTJI 1FY7A 1KONA 5LGNA 2DQRA 4IRHA 1VZ0A 5IP7J 3SXYA 4P1WA 1P4WA 5DUIA 1R36A 4GO1A 2W85A 4NNJA 1GLNA 1Y6IA 2K85A 3BLYA 2B9SA 4ESFA 2FU4A 4ZYEA 3JRBA 2XGCA 2E1OA 2Q2EA 1D8KA 3OY9A 3DU5A 3CD6I 1R22A 1FBQA 4YG2F 3G4SI 3JRCA 3WHCA 2L3DA 2CYYA 2CW8A 5J1RA 1ONVA 2XV4S 5GPAA 3I59A 4OAZA 3RPQA 1XX5A 3FDYA 2XGXA 3TO7A 1ZARA 5E3OA 1G3SA 3ASNH 4KT5C 4IOCF 1KQ8A 2FQ3A 3VFZA 4A12A 2RDPA 4XRMA 3K4BA 3K4LA 3ZQIA 2EZHA 5CVJA 3PL8A 2HQ5A 2X6OA 4RGXA 4BACA 1Z3XA 2ZFUA 1YG2A 3JTHA 1DP3A 4B1RA 4S04A 2WC2A 2OQRA 1P7IA 3LWFA 3WE2A 2VI6A 5B5EC 4D5FA 2IGMA 1D1BA 2R5ZB 3K69A 3N05A 2BY2A 4CCNA 3CMAI 3QRFF 4P5OA 3GTKJ 2V1UA 2VKEA 2Y48A 3BZKA 4UUTA 5F1JA 1LQ1A 2IAIA 4II3A 3WG7H 3H5NA 3H9GA 3RYPA 3QPTA 3OOPA 4H0EA 2EJRA 2BEOA 1IC8A 1S7AA 2M2EA 1XPXA 4XLHA 4M6XA 5IOYA 2XPWA 3TP0A 2O5RA 4E4HA 4E7IA 2DJNA 2OCCH 2PX9A 3LL7A 1ZRFA 3G1OA 1T98A 4A3CJ 3CCLI 1JKRC 3CC7I 3TEDA 4RAZA 4XRFA 2FBKA 4M6YA 4XLCA 4A3MJ 2DDAA 4GXOA 1W5CC 3E5QA 5EYRA 3IRRA 2FE3A 4L5IA 3V7RA 4NUBA 1YIJI 1WSUA 1TQPA 3JRIA 1F36A 2VPRA 5F0HA 3VOEA 3SZPA 4QSHA 4W1UA 1Y8RB 2ZSHB 4XOTA 3C2HA 4MFDA 3RTRA 5HNHA 2XDVA 1T33A 2QKLB 1AWCA 2X51A 2LFBA 3Q0WA 1BIBA 2F48A 2E7WA 2PMZN 1RNLA 4I76A 4BL0B 5K7ZA 4S05A 3BR2A 4BEHA 1DU6A 5IYDJ 2OTLI 1V54H 1OJLA 3OSFA 4RM2A 4HA8A 4KJZA 2O6GE 1XTAA 2MLGA 2IPQX 3J81K 1FYMA 4L0ZB 3EUAA 1RETA 1RRJA 1STZA 4LB6B 1MH4A 5KK1A 5FKOA 5DD8A 3ZOBA 3WU0A 1QO0D 4CH7A 5D6EA 3ABKH 2L9SA 5FKKA 4XKBA 3JREA 2MH2A 2YX7A 1SVLA 3JAMK 4ZDLA 3MKLA 2L7KA 3E6MA 2HU9A 3VPRA 2ZJPF 3J7ZI 4M3EA 5D5XB 1MBGA 1LJ9A 2OPTA 3NWTA 2ZCWA 2WAFA 3BTLA 4M3FA 2BGCA 1PP7U 3ZMUA 4EQQA 5ERIA 1ZGJA 1N78A 1FYKA 4EJUA 4ESBA 3OYIA 4I01A 4UUVA 2X9DA 4CCMA 1N75A 3DF8A 3U1DA 2OBPA 2QCOA 4OIOF 2VBXA 3WU2C 3ZGKA 3ZMVA 3L2RA 4IO9F 2R7OA 2EA2A 4G6QA 2LREA 1D0XA 1ZG1A 4ZZDA 3PSIA 2O9LA 2G7HA 1MGTA 2Y2ZA 3OYFA 3I4PA 2O03A 2VE9A 4AYBN 1O3RA 1R5ID 2GM4A 2E1CA 4LG0A 3WTWC 3SJMA 3PNYA 2OF7A 3J80K 1JHHA 4L5EA 3G3ZA 2DMUA 4F52A 4ZZLA 1OCOH 4D1QA 2COMA 4DOZA 2K5CA 1D8JA 3VYSB 3OSGA 4HF0A 2NYXA 2XF5A 3K1MA 2CUFA 3H3ZA 5J4YA 2PLYA 1U9NA 3AKZA 2IGOA 3W6VA 4KMFA 2OA4A 2O61A 3E3VA 1MDMB 2L54A 2H1KA 3PUBA 4PCQA 2F4IA 5FLVA 1UELB 4DZJA 3KYLA 3HRUA 4BXFA 4XOPA 3DBRB 2HXOA 4O6JA 1SVOA 3GTMJ 3ABLH 1MNEA 4XM3A 5H6RA 5DCMB 2EFWA 3BG5A 3GTOJ 4M71A 2K9QA 2F5DA 4ZC3A 3W6JB 3TGNA 4D5CA 2M9HA 2OQGA 5IP9J 2JK3A 4QPOA 5C4JJ 1ETKA 1HF0A 5CYVA 3U9GA 3J7AY 1EKEA 3BPXA 2L7ZA 4P9FA 3T0YA 4BYYA 4LLGF 4X6AJ 3BTJA 3EUHC 5M5WJ 1OCRH 5HDKA 4BDYA 4A6DA 3HC7A 2R3SA 3L7WA 4MGRA 1X1AA 3OR2C 1X4OA 5B1BH 1IXRC 1GVJA 4FX4A 2R5ZA 2QGUA 5J47A 1QZZA 2HOEA 4C30A 3K7AJ 3SQNA 1U5TC 2AO9A 4Y15A 1KU7A 3RKXA 1SFXA 3EYYA 3KEOA 4RLFA 2BV6A 2DFFA 4NBQA 2H09A 1QGPA 2DMNA 5IT9Z 4NDLA 1B9NA 1OLTA 2FX0A 4BU2A 4MTEA 1OYIA 3TW7A 4KIFA 2JA6J 1WVRA 3LSGA 2BHYA 1N77A 2XASA 3OYMA 3TL4X 3GFMA 4MHGA 3DTEA 3QAHA 3ZN0A 1Y39A 3RDIA 2WV0A 3A03A 4XQFA 1I1GA 5DEQA 2KRHA 1JKPC 4GFBA 1I27A 3LSKA 2HTJA 3F22A 1G3WA 4IZZA 2W4SA 1YLFA 3CC4I 4EJOA 2AQFA 1TT0A 2M7AA 2KL4A 3M7GA 2OC6A 3F8NA 1TP4A 4BQOA 1LDDA 5FGMA 4LLLA 3KIOA 1K79A 4YIRX 1K78B 3PJRA 2Z1DA 2CMPA 2XAHA 3TO9A 2DMTA 2HXIA 3VDXA 3OV8A 2YU3A 4EATA 2PQ8A 1KZHA 4S0HB 2HDDA 1I3QJ 3ECHA 1IV6A 3BCAA 1VFCA 3TO6A 3X2QH 3R0AA 2K02A 4Q4ZF 2DOEA 4WXDA 1MIJA 1HQCA 3LA3A 2CWEA 2RKHA 3BR6A 4KFCA 5DS9A 3F9KA 1SFEA 2R5YB 3MKWB 3GX4X 1WI9A 5L3CA 1LNWA 4A3JJ 4A3GJ 2GLOA 5E8GA 2DO7A 4QIWN 4CZCA 3CCQI 3HDDA 3PQJA 2Z3YA 2GA1A 2E1MC 1X1PA 2OV7A 1L0OC 1JKQC 5FD6A 2E1NA 3WTZA 1LVKA 3H36A 3MMYB 2XF6A 1EJ9A 2UWMA 2D1HA 4ZH4F 2UUZA 4IHSA 2F4MB 4XSXF 2AHQA 1H88C 4Z6YA 2R7SA 4LMYA 1RUNA 1XD7A 3M1CA 3LNQA 3QP6A 3HKZA 4B47A 3S17J 1YJWI 2EINH 3VEPA 3OYGA 3BQZA 1SFUA 4F91B 1K4TA 3P9KA 3DLLF 3OR1C 4U87A 2EQRA 3IP4B 5CQGA 2QUFA 2IS1A 2DTZA 1HKQA 1A31A 2NVQJ 1B59A 4IF4A 2IS6A 2XAQA 5LRSA 2CW0F 2KIFA 1XGOA 1WH5A 2GIVA 3CJTB 3OWTA 4P9UA 1ZGAA 2M5WA 2AXLA 2AQEA 1T56A 1U8RA 1IUYA 2PMUA 2R7UA 1Y56A 1R9TJ 3UKGA 1USSA 3ZMTA 1RZ4A 4U7DA 4OIPF 2LF8A 5F64A 4Q48A 3H0DA 4A3IJ 2PI0A 1FIPA 4IQ4A 4K2EA 3DKXA 1I6XA 2G9WA 4IOAF 2E2JJ 3IKTA 4BJ5C 5ILVA 3HOWJ 4ETSA 4HF2A 1TQIA 3K4JA 1S3JA 1BI2A 2R92J 2IRFG 4XNFA 2JSCA 5DUKA 1ORKA 5B1AH 3U1KA 4G8XA 4DYQA 4JBAA 3C7JA 4M3GA 4XKWA 1MDMA 4WCGA 1WPKA 3KP4A 3HOXJ 2EIKH 3K70D 2Y9ZA 3NEUA 5K7HA 3ZQLA 2FEZA 2WADA 4WXCA 2VIXA 3F8FA 5DCMA 1GV5A 3TKYA 2X6XA 3WE3A 4IKFA 3K4NA 3BP8A 3FXMA 3GVAA 3R4KA 3O8GA 1UG2A 3E5XA 4XORA 1V4RA 1YX5A 2JJ7A 2HYFA 1V55H 3HKZN 3T8TA 1JI8A 4DIQA 2GOXB 3PNTA 5D5WB 3BC8A 2CW7A 2WV1A 3F72A 4UXNA 1VF9A 4F7ZA 1ZRDA 4RB1A 1LDKB 3VYTB 5ICEA 3H5AA 4J19A 3KP7A 2TCTA 4I02A 1C0WA 2CFOA 4M73A 4RGRA 4ZYDA 3FZVA 3PFYA 2K3PA 2IS4A 1G6NA 2DYSH 1RC9A 2BE5F 2FOKA 2WBMA 1WQ2A 5LHHA 5J1YA 2RAEA 1SAUA 3KP2A 1VQNI 4QTRA 3KETA 1TNTA 2EIMH 3R0JA 4Y17A 4XLNF 1JJ6C 3FK7A 5E3NA 3FXUA 3G2BA 2NRAC 2RC4A 3HHHA 3SHFA 2WTEA 3ERMA 1JE8A 1NK3P 5EZHA 4II2A 2RGVA 3BG7A 1MD0A 4HBLA 2QBYB 5LFAA 4XKVA 1UHSA 2K27A 1XMXA 2Y0SA 1BJZA 2IEKA 2L0KA 5HLGA 4Y52J 4KN7X 4G7HF 4PJLA 3RJPA 1RR8C 2G0EA 1O3QA 1YS7A 3PNVA 1Z91A 4L9JA 4C2TA 3K2AA 3OIPA 1HSTA 1K78A 1DPUA 2IVMA 4HDVA 3O6BB 1ZN2A 4U0VA 4XRSA 2R7DA 4AU7A 1XCBA 3ABTA 1UCRA 3HOSA 2JA2A 1A6IA 5FRMA 4HYEA 4DNCA 2WAEA 3UNGC 4HNTA 2CS3A 3GUDA 3OS0A 3RZDJ 2ISZA 1NH3A 1G2HA 1TW3A 2J5OA 4NHJA 2XRNA 3TOAA 1FJLA 1RI7A 1QVUA 4R79A 1TNSA 1SFOJ 1O7FA 1XGMA 3CUQC 3FBIB 3H92A 2R5YA 1VQ8I 1P2FA 4HF1A 2ZXJA 1FBUA 1LUJB 3P5JA 4PZJA 3TDUC 5DYMA 2RVCA 1HOMA 5EEHA 2FBIA 2O8KA 2PMHA 3KYCB 4LIVA 4PGHA 4AM3A 2LSOA 2M45A 4L9NA 1ZGWA 3T8RA 4CO8A 1YTYA 3A01A 1W36C 3ELKA 4Y13A 4N9HA 4AVZA 3H1CA 1B1BA 3LAJA 5EG0B 4XRSG 4IHVA 1ZG3A 2VXDA 3GZ5A 5ED4A 4C3IJ 3BZCA 4RBOA 2E60A 2VL8A 4PJNA 1LFPA 3DP7A 2JVGA 4Z2YA 4CUGA 1WJCA 3P7NA 2L9RA 2Z9OA 2ZKZA 1YE9A 2V79A 1JT6A 3GWZA 2Q1ZB 3K10A 2LVSA 4G12A 3LOCA 2DA3A 3S1QJ 4YFNF 2E2HJ 1WJEA 3CCVI 1B9MA 1KYWA 3IWFA 3KCCA 1IJWC 3DBHB 2BOLA 4A3BJ 4Q5SF 2K9SA 2FD5A 1WFXA 2HWVA 2AXTC 5FROA 1VI0A 1BJAA 2DLLA 1T2KA 2VLAA 3E6DA 2LLKA 3CTAA 2LOOA 1HW1A 2FSWA 1MMNA 2IW5A 2PFBA 4FE7A 5BPIA 2HOSA 2HYJA 2L7MP 3AG1H 3MZ8A 3I71A 1K6YA 2VQCA 3LMMA 2GXGA 3ZMZA 2KIMA 1USTA 4AC0A 3K4MA 2ADUA 5GADJ 2EV5A 2CUEA 5J6XA 4CCKA 5D4RA 3FXOA 4BE2A 2E5NA 1Q1HA 3LSMA 4C3HJ 3ZXSA 2QSHX 5M5YJ 4E7JA 3J7YJ 5F04A 1XGSA 1SFKA 3LFUA 1AA7A 2DQLA 4L9VA 5E8IA 3OYKA 2A68F 1XSXA 1VQ7I 5BOXA 4AIKA 2ZMEC 2UXNA 2GXBA 3RZOJ 2OCEA 1OQYA 2PN6A 4OU0A 4CSWA 1MJBA 2DA2A 3WU1B 3CDLA 4OIQF 2JZYA 1ITYA 2IGNA 4G7OF 1IRXA 5IT9K 3R61A 4M9SA 4RB2C 2F5EA 5FRNA 1NTCA 2N8GA 4G9YA 4LD5A 4A6EA 1ON2A 9ANTA 2QQBA 2CUJA 1PP8F 3B6CA 4CCLA 3L2WA 4HV6A 1S8NA 5EZGA 5JHFA 3CMYA 1SD4A 3JSOA 5TRDA 5F27A 1XS9A 1P9QC 2PMZA 1B72B 1DQUA 2LY1A 2P0WA 1J9IA 3S1NJ 2TRTA 2Y75A 2UXXA 3H9QA 5GTIC 1H89C 3FWEA 3MWMA 4CGZA 5HLHA 4X0GA 3HOYJ 1UG0A 3CDIA 1R49A 2CG4A 2VC0A 2KIUA 4W97A 4LITA 4U88A 2HPMA 2WAQN 3LQRA 5IYBJ 1FBSA 2L01A 1IDYA 3P9IA 2A61A 3JRFA 2JN6A 2Z5UA 4M9XA 3I5UA 2F5FA 3GF2A 3GFIA 2XPUA 5GP9A 3OYEA 4UUSB 4M9ZA 4BBRJ 2HKXA 3IRQA 4KIBA 2GQQA 4DYCA 4RAGA 3S2WA 1XSVA 2CQXA 1OMIA 4JX6A 1LDJA 1KU2A 1KU3A 2VB6A 1A6QA 3QQAA 3ZQCA 3OYJA 3A02A 1QVTA 2QBYA 4E7HA 5H6QA 3KZIC 2J5PA 1ACIA 3MZYA 1WJAA 3GZNB 1CF7B 2P7CB 2H1LA 2CH0A 4PDKA 5HS7A 4KITB 4E7SA 1ZHFA 3HPHA 3EPZA 2ME6A 5HVQC 4UVAA 4IPAA 4F92B 1ETQA 1HCRA 4ZJZA 2H94A 1BL0A 3PSFA 5L3EA 1ETOA 5M3FJ 4FCYA 4HQEA 5FLXZ 2XB0X 1B8IB 4GDFA 1OISA 5GPCA 1I1SA 1HLVA 1MBEA 3C1DA 3HEFA 1GDTA 4H4KC 1SMTA 3F8MA 4AYBA 3H0GJ 1Z1DA 3K9TA 1WHUA 1ULYA 2QYOA 2ETHA 3KZYA 3WTYC 3CCRI 1UMQA 1MMSA 3CO6C 3KE2A 4AUXA 5TISC 1WJBA 2NNYA 4BAYA 3AAFA 1WCMJ 2GXAA 4EM2A 5HS8A 2XC7A 5BPDA 3OYHA 1TWGJ 2EWNA 2Q0OA 3NQOA 2P5LC 5F0FA 3O3KA 2VASA 1QZEA 4EMSA 4BDZA 1MH3A 1F4KA 1I3AA 1VQLI 2V6CA 5EG0A 5CQEA 3QYEA 1ETWA 2FNAA 2E71A 4LB5A 4PSWA 2NVUB 3GLXA 3FF5A 4I0AA 2NVXJ 1LE8B 4MIMA 3GTJJ 1H9TA 1V3FA 4YIFA 2HNHA 3S14J 2DA4A 2HKOA 3BG6A 1XB4A 5A2QK 2JRMA 4XL9A 3G6EI 3L1PA 1K4SA 2GOMA 4C2MJ 1LKXA 3FISA 4V2FA 5K1YA 1VQ4I 4YEJA 4MO7A 2DA6A 3LSHA 3DU6A 1A5JA 1BW5A 2VBWA 5FFXA 2YX4A 1BI1A 2CRGA 4HX7A 3W2AA 3AL0C 5HDNA 4O5VA 1DGRM 1S7EA 3DFGA 3TBIA 3W2VA 4QLCU 2H8WA 1MNDA 3QYFA 3WGGA 1YYVA 2DAOA 2NOGA 3F6VA 2HOTA 2O3FA 3BPVA 5BQTA 4ON0A 1ZAOA 1VQ6I 2FUG2 4WX9A 2QWWA 2XKOA 4V2GA 1W7PB 5LHGA 2OJED 2DT5A 4O3MA 1W0TA 3KPHA 2P6SA 1HKTA 4B8XA 4JP0A 4RDUA 4FHTA 3EUKL 1Z6RA 2V4JC 2V26A 3BOQA 5FKMA 1X3ZB 2F6CA 2Y30A 2DDBA 3QPLA 4IQJA 1YIOA 3FM5A 4OAYA 1AU7A 3CP2A 1HW2A 1JUMA 4NC8A 2EV6A 2P5KA 4OMZA 5DD4A 3ASOH 2ELJA 1R7JA 3NRVA 2VPLA 1FPQA 2BVMA 3IUOA 1FSEA 3A0HC 4DQ2A 2CJJA 5FJ8J 1MBJA 2A6HF 3ZCOA 2VXZA 3KFWX 4EJTA 1RUOA 1UZCA 2VBYA 1B72A 2LF7A 2RREA 1APLC 4G6DA 1P6RA 1D1AA 1IN5A 3RPUD 1TTYA 1QQIA 1FOXA 1BA5A 5E1WA 1LB2A 2MSYA 5L3DA 1TWAJ 1SC7A 1RESA 5JR3A 4EV0A 1W7PD 4IRIA 3HGYA 1AHDP 5KHDA 5L3BA 2H6CA 1ETXA 2KT0A 4U0YA 1IAWA 1IRGA 2KJCA 3GLLA 1Z21A 3IH2A 1F1ZA 1RPWA 1FOKA 4UUSA 5J8CA 1X2MA 3C18A 3FX3A 4Y33A 1DU0A 2UZKA 1WGXA 2M0MA 4UHTA 2BYVE 3QWLA 3HRMA 1DGWY 4RS8A 1OPCA 2F5VA 2A69F 1J2XA 2NS7A 5GTHC 3CUOA 2QSFX 5J40A 3I9V2 2V1DA 1KU9A 2IA0A 2YPRA 3EQLF 2L4MA 3DCFA 1VQPI 1P4AA 2X6WA 4G7ZF 3BJAA 3Q9VA 1MBFA 1R5HA 2BZTA 3DTIA 4L9TA 3BZ6A 3A1YA 1U8BA 3ABUA 2D2WA 3ROUA 2VKVA 4R1HA 3OS2A 5GAEJ 3CCEI 1R4MB 3DLAA 5B66C 2EIJH 2FMLA 3L2VA 3U21A 1XSDA 3T5XA 1JUPA 2DT7B 3DEEA 2LBFB 3GMEA 4A5MA 4RAYA 4RM3A 3WG9A 4ZYHA 1FOYA 4CA0A 4A3FJ 4XLAA 4DBRA 1IUFA 2MC3A 3W6KB 5LEJA 2NS8A 3HTUA 3M8JA 3QOPA 3JTGA 2JTVA 2AS5F 1FP1D 1R58A 2OZUA 1D3YA 4BE1A 1PYVA 2CV2A 5IP6A 4FQGA 1SD6A 3QU6A 5FFZA 4LFUA 4I09A 3V7SA 1FTZA 4ZYGA 1SEUA 3KLOA 3KP5A 3CC2I 4XN3A 2QVOA 3FXRA 4UV9A 3C3WA 2A07F 3BY6A 3L09A 4Y3OA 2WB1N 2P6TA 1SAXA 2EFPA 1Y0UA 1Z77A 2M8EA 5DCFA 1IRFA 1S6LA 2R7FA 5JHUA 1H9GA 1O7LA 5H2FC 1R1UA 1MSEC 4I2OA 2PBIA 2JMWA 2QSGX 4B44A 1R23A 3ABMH 1TZLA 2K7LA 2COBA 2F4OB 3PO3J 2E7XA 1BR2A 3B73A 4HNVA 3CCUI 2HTSA 1LE8A 2YR2A 1TWHJ 2KQRA 1POGA 4AIJA 1D5VA 3G71I 4PFPA 3D5RC 4WF2A 3NWSA 2A3SA 1T39A 4PUSA 1W4MA 3JCUC
chains in the Genus database with same CATH topology
5FB2A 1T38A 2MH9A 1OR7A 1KYZA 2IA1A 2XAJA 3GW2A 3SFZA 3MQ0A 3RPUA 4YFXF 1TBXA 1FLIA 2FNPA 1JHFA 4XSZF 4IJAA 4EM1A 1MKMA 3DV8A 3CO7C 1W7PA 3RIRA 2Y0MA 1UHMA 2K4BA 5LRRA 3I53A 2B0LA 5ICCA 5K5OA 1PDNC 4HQMA 2HDCA 2OD5A 1TLHB 2EFNA 1J0RA 1ZRCA 2VC1A 5D5VB 1ZREA 3COAC 4YFKF 2KKOA 1YO5C 3ULQB 5HDGA 1XMAA 1YW8A 4BHPA 3JAMZ 3LFKA 1FSHA 2D1VA 4MEXF 3EYIA 1QZYA 2HFHA 5LLQA 3HHGA 4PGGA 1HKSA 3WGHA 4FX0A 3TQNA 4LJZF 1CGPA 1IXCA 4EJWA 1BI0A 2GAUA 3WTUC 5D6FA 2QQ9A 4WXHA 1U6GA 4KYWA 3J80Z 1UHWA 1O57A 2IT0A 2PJPA 4RB3C 1Z05A 3KP3A 1G4DA 4KUMA 4HW0A 2KRFA 2Z99A 1YFHA 1U5TB 2M87A 2W84A 3PFIA 4KIGA 4MQVA 3KLNA 3RKWA 1R1TA 2MBFA 1S29A 3GZ6A 5ICGA 3WGIA 3F6OA 2ESNA 5CVUA 1EV7A 3M9AA 4M74A 4ENJA 1G3TA 3RKYA 3T1BA 4XBFA 4IVNA 1W5SA 1J7KA 3FMRA 2K86A 2VOPA 3RYRA 1IZ1A 3IKVA 4KICA 3CJNA 1DUXC 2FMYA 4P96A 4OIRF 4I0BA 1HXDA 3TOBA 1XMKA 4RGSA 2STWA 3N97A 1A04A 3MAJA 2P8TA 2NAZA 3V8LA 3M8FA 1IW7F 4IRGA 3I58A 2IJLA 1ZLKA 1JGSA 2RV8A 4EGZA 1AOYA 3BWGA 2VN2A 4L18B 4WK8F 2DPDA 3FHZA 2HYGD 4G94A 5AIQA 3R60A 2DK5A 4IXAA 3VB2A 2RNJA 1HSJA 3HRSA 5D8KB 1ZYRF 6PAXA 3K1PA 2GZWA 2HR3A 4GGGA 4U7BA 3MFKA 3QU3A 5E1ZB 4OOIA 3DQVC 4P55A 3K2ZA 3F23A 1J75A 1R00A 1KA8A 1QPMA 1SD7A 2LNBA 4EGYA 5F6FA 4Q47A 5ILUA 1BOAA 5F1RA 2XIGA 2ACJA 2ZNZA 3HSEA 3IL2A 2F2EA 4LLNA 1U78A 1ODDA 4L5JA 1OKRA 2DFIA 3K0LA 2ZNYA 4HZFA 4RB0A 5KVRA 3LA7A 5JFRA 2OU2A 1DPRA 1GXQA 4BHCA 3HSFA 5J8FA 2TDXA 3SZTA 1JXSA 3DXJF 4GYIA 1EH8A 1WRJA 5IT3A 4BNCA 1L3LA 4BXUA 3MEXA 1DP7P 2XAGA 1FT9A 3ZMDA 1W5TA 4A5NA 5D4SA 3WODF 2FRHA 2O0YA 3ZMSA 2CO5A 1ON1A 3EUHA 5K5RA 2DI3A 3E5UA 4OINF 1GXPA 2M1BA 1LEAA 3V7CA 4EM0B 1U5TA 3KZZA 5DV5A 1IN4A 1BN5A 3H3UA 4I98B 3G73A 4TV7A 2EB7A 2HQRA 3KP6A 4KA4A 4ENNA 2VT3A 2RQPA 1FWZA 3L00A 1P92A 1KGSA 3LAPA 2EK5A 3E97A 2EV0A 2BBYA 2DU9A 1IF1A 2ZFWA 3PQKA 1OYWA 4U0WA 1K6OA 3VODA 5D5UB 3DKWA 4A0XA 2EA4A 2HGCA 1SD5A 2CFXA 2DK8A 2ZBKA 2H27A 1TW2A 1ZG5A 4YIIA 2C6YA 3IC7A 2ZJ2A 4NB5A 3CUQB 2DTRA 2Z33A 5CVVA 3BDDA 2A6EF 2D45A 3REOA 3BROA 4MTDA 5CVRA 1KQ0A 1E17A 3HSRA 1DDNA 2QM3A 1FZPB 2FF4A 4IHTA 1YW9A 4FT8A 2MA3A 3ML6A 2CQKA 3CLOA 5TJJA 1TQMA 2H6BA 2IP2A 3BJ6A 4WWCA 4D0PA 3GEZA 5DDGA 3ZQ7A 4KMUX 2ISYA 2O8XA 3EETA 4BQAA 4LK1F 1B6AA 1MJ9A 4A0YA 1U2WA 1O3SA 1HW5A 2QENA 4OMYA 1GHCA 3FM3A 3F8BA 1J5YA 1VTNC 3GFLA 3V4GA 3LA2A 3HTSB 1YW7A 1ZH5A 2FBHA 4MNUA 4M72A 5E1XA 4HLYA 2XKPA 2JPBA 4NQWA 3F21A 4BHBA 4GCVA 2W25A 2ZMEB 4I7HA 2PEXA 5AIPA 1XDUA 3JSPA 2WWYA 2HQNA 1IN7A 3F8CA 1EH6A 3ZN1A 1E2XA 4JK1X 2HEOA 5HS9A 1CF7A 1R1VA 4ESJA 4HX8A 4L0YB 3Q5FA 4XLPF 1WKMA 1BIAA 2STTA 2XUBA 2RN7A 4EVIA 5BS6A 5LGUA 1H0MA 2GA2A 5HOOA 2V1XA 1NHAA 2ZO4A 3N4MA 2X4HA 3MCZA 1RIOH 1KQ9A 2XAFA 1UFMA 1K7AA 2Q8KA 3V8JA 2P4WA 3R6SA 4N9IA 5ILSA 4UNOA 3ZPLA 5E20A 5LGTA 3WTVC 4UVCA 3E6CC 3L2CA 2X0LA 5LEKA 3P9CA 1XGNA 1I5ZA 2A5YB 2FXAA 2F5CA 3CUQA 3LSTA 4HLXA 5EEGA 1G3YA 4ENKA 1R5GA 4LK0F 2QLZA 1YQAA 4AWXB 1WWXA 3EDPA 4LGWA 1T6SA 5CVIA 3TDZC 4A2UA 5H20A 3LQQA 2DBBA 2JPCA 5BMZA 3I54A 3L9FA 3E6BA 1BBYA 1B4AA 1XN7A 4EJVA 4UVBA 3F3XA 1PUEE 4CHUA 2GWRA 4A0ZA 3J81Z 3QP5A 3J7AO 3JW4A 4CDGA 5JVTA 4HV5A 4KNYA 3DEUA 4MQ9F 5FD5A 1HBXG 3GO5A 1T0FA 4CYDA 1FC3A 2LKPA 1Z7UA 1LEBA 5L3GA 4HAMA 1QNTA 1FP2A 2HZTA 1X3UA 3GXOA 5A2QZ 3DPLC 3BJOA 2QQAA 1REPC 2ZMEA 5JI6A 5FLXK 2XROA 4AIHA 1IN8A 2JRTA 1BC7C 3HOTA 3IWZA 3I59B 3D5LA 2LDUA 5LHIA 3GFJA 5K5QA 1QBJA 3DPTA 2L4AA 4ENMA 4HX4A 3WTSC 1IN6A 1YS6A 5E18F 4HOBA 3KEQA 2CGPA 2VONA 1U3EM 3ZP5A 3FXQA 3I64A 2ELHA 1FYLA 5LBQA 3IHUA 4UV8A 3HYIA 2CSOA 3M1EA 2VT2A 2KJBA 3WTXC 4CICA 3HIFA 2EFQA 4QWQA 5AONA 2YSRA 3MZHA 1F9NA 1EH7A 4JQFA 3RI4A 2DPUA 2HS5A 2IA2A 2V9VA 1MZBA 2K4JA 1Z6TA 5L3FA 3FMQA 2VOOA 1BI3A 2P5VA 2FA5A 4ASNA 3ECOA 2DW4A 3QPHA 4BH9A 1XDSA 1SMYF 3ISPA 5CLSA 3Q9SA 4B09A 2XHKA 2W57A 2P7VB 1LVAA 4AVPA 1Z9CA 4KN4X 4RGUA 2VE8A 3B02A 5CJ9A 1UB9A 2OAZA 3FMSA 1MJAA 1OYYA 2L02A 3U2RA 3I0TA 4AD9A 3WTTC 1FX7A 2G7UA 4CZZA 2PG4A 1S7OA 2M30A 5D8LB 1J59A 5E17F 1IXSB 4CXFA 3M8EA 3D0SA 5ICFA 4E70A 1XCVA 3K1NA 4R8HA 1BM9A 1FNNA 4N0BA 1ZLJA 2QZ8A 3CDHA 1P4XA 2MD5A 4MEYF 4HDUA 3V8KA 4GYGA 1O3TA 2MLKA 3HRTA 3GYHX 2OZ6A 2NNNA 4KDPA 2VODA 2NS0A 3HUGA 2EFOA 3ERED 2W24A 1F5TA 2ESHA 3O2PE 5HLIA 2XVCA 1BC8C 5FO5A 2VBZA 2JT1A 4LG0B 1FY7A 5LGNA 2DQRA 4IRHA 3SXYA 1P4WA 5DUIA 1R36A 4GO1A 2W85A 4ESFA 2FU4A 4ZYEA 2Q2EA 1D8KA 1R22A 1FBQA 4YG2F 2L3DA 2CYYA 1ONVA 2XV4S 3RPQA 3I59A 2XGXA 3TO7A 1ZARA 1G3SA 4KT5C 1KQ8A 2FQ3A 3VFZA 4A12A 2RDPA 5CVJA 4RGXA 3JTHA 1YG2A 4S04A 2WC2A 2OQRA 3WE2A 3LWFA 3K69A 3QRFF 4P5OA 2V1UA 2Y48A 1LQ1A 3RYPA 3QPTA 3OOPA 4H0EA 2EJRA 2BEOA 1S7AA 4M6XA 1ZRFA 1T98A 4RAZA 4XRFA 2FBKA 4M6YA 4GXOA 3E5QA 3IRRA 2FE3A 4L5IA 3V7RA 1WSUA 1TQPA 3VOEA 3SZPA 3RTRA 1AWCA 1BIBA 2E7WA 1RNLA 4S05A 4HA8A 2O6GE 2MLGA 2IPQX 3J81K 1FYMA 4L0ZB 1STZA 4LB6B 5KK1A 5DD8A 3WU0A 1QO0D 5D6EA 2MH2A 2YX7A 3JAMK 3E6MA 5D5XB 1LJ9A 2ZCWA 2BGCA 1PP7U 3ZMUA 4EQQA 5ERIA 1ZGJA 1FYKA 4EJUA 4ESBA 4I01A 4UUVA 3DF8A 3U1DA 2OBPA 4OIOF 2VBXA 3ZMVA 2EA2A 4G6QA 1ZG1A 4ZZDA 2G7HA 1MGTA 3I4PA 2O03A 2VE9A 1O3RA 2E1CA 4LG0A 3WTWC 3J80K 1JHHA 4ZZLA 3G3ZA 2COMA 1D8JA 4HF0A 2NYXA 3K1MA 3H3ZA 2PLYA 4KMFA 2OA4A 2O61A 3E3VA 1MDMB 2L54A 4PCQA 3HRUA 4O6JA 5H6RA 2EFWA 5DCMB 4M71A 2F5DA 3W6JB 3TGNA 2OQGA 5CYVA 3U9GA 3BPXA 4P9FA 3T0YA 4BYYA 4LLGF 5HDKA 4A6DA 2R3SA 3L7WA 4MGRA 1IXRC 1GVJA 4FX4A 1QZZA 2HOEA 3SQNA 1U5TC 4Y15A 1KU7A 3RKXA 1SFXA 3EYYA 3KEOA 2BV6A 2H09A 1QGPA 5IT9Z 1B9NA 4MTEA 1OYIA 4KIFA 2XASA 3GFMA 4MHGA 3QAHA 3ZN0A 3RDIA 2WV0A 1I1GA 5DEQA 1I27A 3F22A 2HTJA 1G3WA 1YLFA 4EJOA 3M7GA 3F8NA 1LDDA 5FGMA 4LLLA 1K79A 1K78B 2XAHA 3TO9A 3OV8A 2YU3A 2PQ8A 3ECHA 3TO6A 3R0AA 2K02A 4Q4ZF 4WXDA 1HQCA 3LA3A 2CWEA 2RKHA 4KFCA 1SFEA 3GX4X 1WI9A 5L3CA 1LNWA 5E8GA 2DO7A 3PQJA 2Z3YA 2GA1A 1L0OC 5FD6A 2E1NA 3WTZA 2UWMA 2D1HA 4ZH4F 4IHSA 4XSXF 4LMYA 1RUNA 1XD7A 3QP6A 3VEPA 1SFUA 3P9KA 2QUFA 1HKQA 1B59A 4IF4A 2XAQA 5LRSA 2CW0F 2KIFA 1XGOA 2GIVA 4P9UA 1ZGAA 2M5WA 2AXLA 1U8RA 1IUYA 2PMUA 1USSA 3ZMTA 1RZ4A 4U7DA 4OIPF 2LF8A 5F64A 4Q48A 2PI0A 4K2EA 1I6XA 2G9WA 3IKTA 5ILVA 4ETSA 4HF2A 1TQIA 1S3JA 1BI2A 2IRFG 2JSCA 5DUKA 4G8XA 4JBAA 3C7JA 1MDMA 4WCGA 3KP4A 3NEUA 2FEZA 4WXCA 3F8FA 5DCMA 3TKYA 3WE3A 3BP8A 3R4KA 3GVAA 3E5XA 1V4RA 2HYFA 3T8TA 5D5WB 3F72A 4UXNA 4F7ZA 1ZRDA 4RB1A 1LDKB 5ICEA 3KP7A 4I02A 1C0WA 4RGRA 4M73A 4ZYDA 3FZVA 1G6NA 2BE5F 2FOKA 5LHHA 1WQ2A 3KP2A 3KETA 1TNTA 3R0JA 4Y17A 4XLNF 3FXUA 2NRAC 2RC4A 3HHHA 3SHFA 2WTEA 1JE8A 2RGVA 1MD0A 4HBLA 2QBYB 2K27A 5HLGA 4KN7X 4G7HF 3RJPA 1O3QA 1YS7A 1Z91A 4L9JA 1HSTA 1K78A 1DPUA 2IVMA 4HDVA 3O6BB 1ZN2A 4U0VA 2R7DA 1XCBA 3ABTA 1UCRA 3HOSA 4HYEA 4DNCA 3GUDA 2ISZA 1TW3A 2J5OA 4NHJA 2XRNA 3TOAA 1RI7A 4R79A 1TNSA 1O7FA 1XGMA 3CUQC 3H92A 1P2FA 4HF1A 2ZXJA 1FBUA 4PZJA 3TDUC 5DYMA 2RVCA 5EEHA 2FBIA 2PMHA 4PGHA 2LSOA 2M45A 4L9NA 3T8RA 4CO8A 1YTYA 3ELKA 4Y13A 4N9HA 1B1BA 3LAJA 1ZG3A 3GZ5A 5ED4A 3DP7A 4Z2YA 3P7NA 2Z9OA 2ZKZA 2V79A 3GWZA 4YFNF 1B9MA 1KYWA 3IWFA 3KCCA 4Q5SF 2HWVA 2DLLA 1BJAA 1T2KA 3E6DA 5BPIA 3CTAA 1HW1A 2FSWA 2IW5A 2PFBA 3I71A 2GXGA 3ZMZA 2KIMA 1USTA 2ADUA 2EV5A 5J6XA 5D4RA 1Q1HA 1XGSA 2DQLA 4L9VA 5E8IA 2A68F 1XSXA 5BOXA 4AIKA 2UXNA 2GXBA 2PN6A 4OU0A 1MJBA 3WU1B 4OIQF 2JZYA 5IT9K 4G7OF 3R61A 4M9SA 4RB2C 2F5EA 4G9YA 4LD5A 4A6EA 1ON2A 2QQBA 1PP8F 4HV6A 1S8NA 1SD4A 3JSOA 5TRDA 1J9IA 2Y75A 2UXXA 3FWEA 3MWMA 4CGZA 5HLHA 2CG4A 2VC0A 2KIUA 4U88A 3LQRA 1FBSA 2L01A 3P9IA 2A61A 2Z5UA 4M9XA 3I5UA 2F5FA 3GF2A 3GFIA 4M9ZA 2HKXA 3IRQA 4KIBA 2GQQA 3S2WA 1XSVA 1OMIA 1LDJA 1KU2A 1KU3A 2QBYA 5H6QA 2J5PA 3MZYA 1CF7B 2P7CB 4PDKA 5HS7A 1ZHFA 5HVQC 4UVAA 4IPAA 2H94A 5L3EA 4HQEA 5FLXZ 1I1SA 3C1DA 1SMTA 3F8MA 1Z1DA 3K9TA 1ULYA 2QYOA 2ETHA 3KZYA 3WTYC 3CO6C 3KE2A 2NNYA 4BAYA 3AAFA 4EM2A 5HS8A 5BPDA 2EWNA 2Q0OA 3NQOA 2P5LC 3O3KA 4EMSA 1F4KA 2V6CA 2FNAA 4LB5A 3GLXA 3FF5A 4I0AA 1H9TA 1V3FA 4YIFA 2HKOA 1XB4A 5A2QK 5K1YA 2VBWA 5FFXA 2YX4A 1BI1A 4HX7A 5HDNA 4O5VA 3DFGA 4QLCU 3WGGA 1YYVA 2DAOA 3F6VA 2O3FA 3BPVA 5BQTA 4ON0A 1ZAOA 4WX9A 2QWWA 2XKOA 1W7PB 5LHGA 2DT5A 4O3MA 2P6SA 1HKTA 4B8XA 4FHTA 1Z6RA 3BOQA 1YIOA 3FM5A 1HW2A 2EV6A 2P5KA 4OMZA 5DD4A 3NRVA 1R7JA 1FPQA 1FSEA 4DQ2A 2A6HF 2VXZA 3KFWX 4EJTA 1RUOA 2VBYA 2LF7A 4G6DA 1P6RA 1IN5A 1TTYA 1QQIA 5E1WA 1LB2A 5L3DA 5JR3A 4EV0A 1W7PD 4IRIA 5L3BA 2H6CA 4U0YA 1IAWA 1IRGA 2KJCA 1F1ZA 1FOKA 5J8CA 3C18A 3FX3A 2UZKA 4UHTA 2BYVE 3HRMA 4RS8A 1OPCA 2A69F 1J2XA 3CUOA 2V1DA 1KU9A 2IA0A 2YPRA 3EQLF 2L4MA 1P4AA 4G7ZF 3BJAA 3Q9VA 1R5HA 4L9TA 3BZ6A 3ABUA 2D2WA 3ROUA 4R1HA 2FMLA 1XSDA 3T5XA 4A5MA 4RAYA 3WG9A 4ZYHA 2MC3A 3W6KB 5LEJA 3HTUA 3JTGA 3QOPA 2JTVA 2AS5F 1FP1D 1R58A 2OZUA 1D3YA 1SD6A 3QU6A 5FFZA 4LFUA 4I09A 3V7SA 4ZYGA 3KLOA 3KP5A 2QVOA 3FXRA 4UV9A 3C3WA 2A07F 3BY6A 3L09A 1SAXA 2P6TA 2EFPA 1Y0UA 2M8EA 5DCFA 1IRFA 1S6LA 2R7FA 5JHUA 1H9GA 1O7LA 1R1UA 4I2OA 2PBIA 1R23A 2K7LA 2E7XA 3B73A 2HTSA 2YR2A 4AIJA 1D5VA 4WF2A 2A3SA 1T39A 1W4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB2 A;  1T38 A;  2MH9 A;  1OR7 A;  1KYZ A;  2IA1 A;  2XAJ A;  3GW2 A;  3SFZ A;  3MQ0 A;  3RPU A;  4YFX F;  1TBX A;  1FLI A;  2FNP A;  1JHF A;  4XSZ F;  4IJA A;  4EM1 A;  1MKM A;  3DV8 A;  3CO7 C;  1W7P A;  3RIR A;  2Y0M A;  1UHM A;  2K4B A;  5LRR A;  3I53 A;  2B0L A;  5ICC A;  5K5O A;  1PDN C;  4HQM A;  2HDC A;  2OD5 A;  1TLH B;  2EFN A;  1J0R A;  1ZRC A;  2VC1 A;  5D5V B;  1ZRE A;  3COA C;  4YFK F;  2KKO A;  1YO5 C;  3ULQ B;  5HDG A;  1XMA A;  1YW8 A;  4BHP A;  3JAM Z;  3LFK A;  1FSH A;  2D1V A;  4MEX F;  3EYI A;  1QZY A;  2HFH A;  5LLQ A;  3HHG A;  4PGG A;  1HKS A;  3WGH A;  4FX0 A;  3TQN A;  4LJZ F;  1CGP A;  1IXC A;  4EJW A;  1BI0 A;  2GAU A;  3WTU C;  5D6F A;  2QQ9 A;  4WXH A;  1U6G A;  4KYW A;  3J80 Z;  1UHW A;  1O57 A;  2IT0 A;  2PJP A;  4RB3 C;  1Z05 A;  3KP3 A;  1G4D A;  4KUM A;  4HW0 A;  2KRF A;  2Z99 A;  1YFH A;  1U5T B;  2M87 A;  2W84 A;  3PFI A;  4KIG A;  4MQV A;  3KLN A;  3RKW A;  1R1T A;  2MBF A;  1S29 A;  3GZ6 A;  5ICG A;  3WGI A;  3F6O A;  2ESN A;  5CVU A;  1EV7 A;  3M9A A;  4M74 A;  4ENJ A;  1G3T A;  3RKY A;  3T1B A;  4XBF A;  4IVN A;  1W5S A;  1J7K A;  3FMR A;  2K86 A;  2VOP A;  3RYR A;  1IZ1 A;  3IKV A;  4KIC A;  3CJN A;  1DUX C;  2FMY A;  4P96 A;  4OIR F;  4I0B A;  1HXD A;  3TOB A;  1XMK A;  4RGS A;  2STW A;  3N97 A;  1A04 A;  3MAJ A;  2P8T A;  2NAZ A;  3V8L A;  3M8F A;  1IW7 F;  4IRG A;  3I58 A;  2IJL A;  1ZLK A;  1JGS A;  2RV8 A;  4EGZ A;  1AOY A;  3BWG A;  2VN2 A;  4L18 B;  4WK8 F;  2DPD A;  3FHZ A;  2HYG D;  4G94 A;  5AIQ A;  3R60 A;  2DK5 A;  4IXA A;  3VB2 A;  2RNJ A;  1HSJ A;  3HRS A;  5D8K B;  1ZYR F;  6PAX A;  3K1P A;  2GZW A;  2HR3 A;  4GGG A;  4U7B A;  3MFK A;  3QU3 A;  5E1Z B;  4OOI A;  3DQV C;  4P55 A;  3K2Z A;  3F23 A;  1J75 A;  1R00 A;  1KA8 A;  1QPM A;  1SD7 A;  2LNB A;  4EGY A;  5F6F A;  4Q47 A;  5ILU A;  1BOA A;  5F1R A;  2XIG A;  2ACJ A;  2ZNZ A;  3HSE A;  3IL2 A;  2F2E A;  4LLN A;  1U78 A;  1ODD A;  4L5J A;  1OKR A;  2DFI A;  3K0L A;  2ZNY A;  4HZF A;  4RB0 A;  5KVR A;  3LA7 A;  5JFR A;  2OU2 A;  1DPR A;  1GXQ A;  4BHC A;  3HSF A;  5J8F A;  2TDX A;  3SZT A;  1JXS A;  3DXJ F;  4GYI A;  1EH8 A;  1WRJ A;  5IT3 A;  4BNC A;  1L3L A;  4BXU A;  3MEX A;  1DP7 P;  2XAG A;  1FT9 A;  3ZMD A;  1W5T A;  4A5N A;  5D4S A;  3WOD F;  2FRH A;  2O0Y A;  3ZMS A;  2CO5 A;  1ON1 A;  3EUH A;  5K5R A;  2DI3 A;  3E5U A;  4OIN F;  1GXP A;  2M1B A;  1LEA A;  3V7C A;  4EM0 B;  1U5T A;  3KZZ A;  5DV5 A;  1IN4 A;  1BN5 A;  3H3U A;  4I98 B;  3G73 A;  4TV7 A;  2EB7 A;  2HQR A;  3KP6 A;  4KA4 A;  4ENN A;  2VT3 A;  2RQP A;  1FWZ A;  3L00 A;  1P92 A;  1KGS A;  3LAP A;  2EK5 A;  3E97 A;  2EV0 A;  2BBY A;  2DU9 A;  1IF1 A;  2ZFW A;  3PQK A;  1OYW A;  4U0W A;  1K6O A;  3VOD A;  5D5U B;  3DKW A;  4A0X A;  2EA4 A;  2HGC A;  1SD5 A;  2CFX A;  2DK8 A;  2ZBK A;  2H27 A;  1TW2 A;  1ZG5 A;  4YII A;  2C6Y A;  3IC7 A;  2ZJ2 A;  4NB5 A;  3CUQ B;  2DTR A;  2Z33 A;  5CVV A;  3BDD A;  2A6E F;  2D45 A;  3REO A;  3BRO A;  4MTD A;  5CVR A;  1KQ0 A;  1E17 A;  3HSR A;  1DDN A;  2QM3 A;  1FZP B;  2FF4 A;  4IHT A;  1YW9 A;  4FT8 A;  2MA3 A;  3ML6 A;  2CQK A;  3CLO A;  5TJJ A;  1TQM A;  2H6B A;  2IP2 A;  3BJ6 A;  4WWC A;  4D0P A;  3GEZ A;  5DDG A;  3ZQ7 A;  4KMU X;  2ISY A;  2O8X A;  3EET A;  4BQA A;  4LK1 F;  1B6A A;  1MJ9 A;  4A0Y A;  1U2W A;  1O3S A;  1HW5 A;  2QEN A;  4OMY A;  1GHC A;  3FM3 A;  3F8B A;  1J5Y A;  1VTN C;  3GFL A;  3V4G A;  3LA2 A;  3HTS B;  1YW7 A;  1ZH5 A;  2FBH A;  4MNU A;  4M72 A;  5E1X A;  4HLY A;  2XKP A;  2JPB A;  4NQW A;  3F21 A;  4BHB A;  4GCV A;  2W25 A;  2ZME B;  4I7H A;  2PEX A;  5AIP A;  1XDU A;  3JSP A;  2WWY A;  2HQN A;  1IN7 A;  3F8C A;  1EH6 A;  3ZN1 A;  1E2X A;  4JK1 X;  2HEO A;  5HS9 A;  1CF7 A;  1R1V A;  4ESJ A;  4HX8 A;  4L0Y B;  3Q5F A;  4XLP F;  1WKM A;  1BIA A;  2STT A;  2XUB A;  2RN7 A;  4EVI A;  5BS6 A;  5LGU A;  1H0M A;  2GA2 A;  5HOO A;  2V1X A;  1NHA A;  2ZO4 A;  3N4M A;  2X4H A;  3MCZ A;  1RIO H;  1KQ9 A;  2XAF A;  1UFM A;  1K7A A;  2Q8K A;  3V8J A;  2P4W A;  3R6S A;  4N9I A;  5ILS A;  4UNO A;  3ZPL A;  5E20 A;  5LGT A;  3WTV C;  4UVC A;  3E6C C;  3L2C A;  2X0L A;  5LEK A;  3P9C A;  1XGN A;  1I5Z A;  2A5Y B;  2FXA A;  2F5C A;  3CUQ A;  3LST A;  4HLX A;  5EEG A;  1G3Y A;  4ENK A;  1R5G A;  4LK0 F;  2QLZ A;  1YQA A;  4AWX B;  1WWX A;  3EDP A;  4LGW A;  1T6S A;  5CVI A;  3TDZ C;  4A2U A;  5H20 A;  3LQQ A;  2DBB A;  2JPC A;  5BMZ A;  3I54 A;  3L9F A;  3E6B A;  1BBY A;  1B4A A;  1XN7 A;  4EJV A;  4UVB A;  3F3X A;  1PUE E;  4CHU A;  2GWR A;  4A0Z A;  3J81 Z;  3QP5 A;  3J7A O;  3JW4 A;  4CDG A;  5JVT A;  4HV5 A;  4KNY A;  3DEU A;  4MQ9 F;  5FD5 A;  1HBX G;  3GO5 A;  1T0F A;  4CYD A;  1FC3 A;  2LKP A;  1Z7U A;  1LEB A;  5L3G A;  4HAM A;  1QNT A;  1FP2 A;  2HZT A;  1X3U A;  3GXO A;  5A2Q Z;  3DPL C;  3BJO A;  2QQA A;  1REP C;  2ZME A;  5JI6 A;  5FLX K;  2XRO A;  4AIH A;  1IN8 A;  2JRT A;  1BC7 C;  3HOT A;  3IWZ A;  3I59 B;  3D5L A;  2LDU A;  5LHI A;  3GFJ A;  5K5Q A;  1QBJ A;  3DPT A;  2L4A A;  4ENM A;  4HX4 A;  3WTS C;  1IN6 A;  1YS6 A;  5E18 F;  4HOB A;  3KEQ A;  2CGP A;  2VON A;  1U3E M;  3ZP5 A;  3FXQ A;  3I64 A;  2ELH A;  1FYL A;  5LBQ A;  3IHU A;  4UV8 A;  3HYI A;  2CSO A;  3M1E A;  2VT2 A;  2KJB A;  3WTX C;  4CIC A;  3HIF A;  2EFQ A;  4QWQ A;  5AON A;  2YSR A;  3MZH A;  1F9N A;  1EH7 A;  4JQF A;  3RI4 A;  2DPU A;  2HS5 A;  2IA2 A;  2V9V A;  1MZB A;  2K4J A;  1Z6T A;  5L3F A;  3FMQ A;  2VOO A;  1BI3 A;  2P5V A;  2FA5 A;  4ASN A;  3ECO A;  2DW4 A;  3QPH A;  4BH9 A;  1XDS A;  1SMY F;  3ISP A;  5CLS A;  3Q9S A;  4B09 A;  2XHK A;  2W57 A;  2P7V B;  1LVA A;  4AVP A;  1Z9C A;  4KN4 X;  4RGU A;  2VE8 A;  3B02 A;  5CJ9 A;  1UB9 A;  2OAZ A;  3FMS A;  1MJA A;  1OYY A;  2L02 A;  3U2R A;  3I0T A;  4AD9 A;  3WTT C;  1FX7 A;  2G7U A;  4CZZ A;  2PG4 A;  1S7O A;  2M30 A;  5D8L B;  1J59 A;  5E17 F;  1IXS B;  4CXF A;  3M8E A;  3D0S A;  5ICF A;  4E70 A;  1XCV A;  3K1N A;  4R8H A;  1BM9 A;  1FNN A;  4N0B A;  1ZLJ A;  2QZ8 A;  3CDH A;  1P4X A;  2MD5 A;  4MEY F;  4HDU A;  3V8K A;  4GYG A;  1O3T A;  2MLK A;  3HRT A;  3GYH X;  2OZ6 A;  2NNN A;  4KDP A;  2VOD A;  2NS0 A;  3HUG A;  2EFO A;  3ERE D;  2W24 A;  1F5T A;  2ESH A;  3O2P E;  5HLI A;  2XVC A;  1BC8 C;  5FO5 A;  2VBZ A;  2JT1 A;  4LG0 B;  1FY7 A;  5LGN A;  2DQR A;  4IRH A;  3SXY A;  1P4W A;  5DUI A;  1R36 A;  4GO1 A;  2W85 A;  4ESF A;  2FU4 A;  4ZYE A;  2Q2E A;  1D8K A;  1R22 A;  1FBQ A;  4YG2 F;  2L3D A;  2CYY A;  1ONV A;  2XV4 S;  3RPQ A;  3I59 A;  2XGX A;  3TO7 A;  1ZAR A;  1G3S A;  4KT5 C;  1KQ8 A;  2FQ3 A;  3VFZ A;  4A12 A;  2RDP A;  5CVJ A;  4RGX A;  3JTH A;  1YG2 A;  4S04 A;  2WC2 A;  2OQR A;  3WE2 A;  3LWF A;  3K69 A;  3QRF F;  4P5O A;  2V1U A;  2Y48 A;  1LQ1 A;  3RYP A;  3QPT A;  3OOP A;  4H0E A;  2EJR A;  2BEO A;  1S7A A;  4M6X A;  1ZRF A;  1T98 A;  4RAZ A;  4XRF A;  2FBK A;  4M6Y A;  4GXO A;  3E5Q A;  3IRR A;  2FE3 A;  4L5I A;  3V7R A;  1WSU A;  1TQP A;  3VOE A;  3SZP A;  3RTR A;  1AWC A;  1BIB A;  2E7W A;  1RNL A;  4S05 A;  4HA8 A;  2O6G E;  2MLG A;  2IPQ X;  3J81 K;  1FYM A;  4L0Z B;  1STZ A;  4LB6 B;  5KK1 A;  5DD8 A;  3WU0 A;  1QO0 D;  5D6E A;  2MH2 A;  2YX7 A;  3JAM K;  3E6M A;  5D5X B;  1LJ9 A;  2ZCW A;  2BGC A;  1PP7 U;  3ZMU A;  4EQQ A;  5ERI A;  1ZGJ A;  1FYK A;  4EJU A;  4ESB A;  4I01 A;  4UUV A;  3DF8 A;  3U1D A;  2OBP A;  4OIO F;  2VBX A;  3ZMV A;  2EA2 A;  4G6Q A;  1ZG1 A;  4ZZD A;  2G7H A;  1MGT A;  3I4P A;  2O03 A;  2VE9 A;  1O3R A;  2E1C A;  4LG0 A;  3WTW C;  3J80 K;  1JHH A;  4ZZL A;  3G3Z A;  2COM A;  1D8J A;  4HF0 A;  2NYX A;  3K1M A;  3H3Z A;  2PLY A;  4KMF A;  2OA4 A;  2O61 A;  3E3V A;  1MDM B;  2L54 A;  4PCQ A;  3HRU A;  4O6J A;  5H6R A;  2EFW A;  5DCM B;  4M71 A;  2F5D A;  3W6J B;  3TGN A;  2OQG A;  5CYV A;  3U9G A;  3BPX A;  4P9F A;  3T0Y A;  4BYY A;  4LLG F;  5HDK A;  4A6D A;  2R3S A;  3L7W A;  4MGR A;  1IXR C;  1GVJ A;  4FX4 A;  1QZZ A;  2HOE A;  3SQN A;  1U5T C;  4Y15 A;  1KU7 A;  3RKX A;  1SFX A;  3EYY A;  3KEO A;  2BV6 A;  2H09 A;  1QGP A;  5IT9 Z;  1B9N A;  4MTE A;  1OYI A;  4KIF A;  2XAS A;  3GFM A;  4MHG A;  3QAH A;  3ZN0 A;  3RDI A;  2WV0 A;  1I1G A;  5DEQ A;  1I27 A;  3F22 A;  2HTJ A;  1G3W A;  1YLF A;  4EJO A;  3M7G A;  3F8N A;  1LDD A;  5FGM A;  4LLL A;  1K79 A;  1K78 B;  2XAH A;  3TO9 A;  3OV8 A;  2YU3 A;  2PQ8 A;  3ECH A;  3TO6 A;  3R0A A;  2K02 A;  4Q4Z F;  4WXD A;  1HQC A;  3LA3 A;  2CWE A;  2RKH A;  4KFC A;  1SFE A;  3GX4 X;  1WI9 A;  5L3C A;  1LNW A;  5E8G A;  2DO7 A;  3PQJ A;  2Z3Y A;  2GA1 A;  1L0O C;  5FD6 A;  2E1N A;  3WTZ A;  2UWM A;  2D1H A;  4ZH4 F;  4IHS A;  4XSX F;  4LMY A;  1RUN A;  1XD7 A;  3QP6 A;  3VEP A;  1SFU A;  3P9K A;  2QUF A;  1HKQ A;  1B59 A;  4IF4 A;  2XAQ A;  5LRS A;  2CW0 F;  2KIF A;  1XGO A;  2GIV A;  4P9U A;  1ZGA A;  2M5W A;  2AXL A;  1U8R A;  1IUY A;  2PMU A;  1USS A;  3ZMT A;  1RZ4 A;  4U7D A;  4OIP F;  2LF8 A;  5F64 A;  4Q48 A;  2PI0 A;  4K2E A;  1I6X A;  2G9W A;  3IKT A;  5ILV A;  4ETS A;  4HF2 A;  1TQI A;  1S3J A;  1BI2 A;  2IRF G;  2JSC A;  5DUK A;  4G8X A;  4JBA A;  3C7J A;  1MDM A;  4WCG A;  3KP4 A;  3NEU A;  2FEZ A;  4WXC A;  3F8F A;  5DCM A;  3TKY A;  3WE3 A;  3BP8 A;  3R4K A;  3GVA A;  3E5X A;  1V4R A;  2HYF A;  3T8T A;  5D5W B;  3F72 A;  4UXN A;  4F7Z A;  1ZRD A;  4RB1 A;  1LDK B;  5ICE A;  3KP7 A;  4I02 A;  1C0W A;  4RGR A;  4M73 A;  4ZYD A;  3FZV A;  1G6N A;  2BE5 F;  2FOK A;  5LHH A;  1WQ2 A;  3KP2 A;  3KET A;  1TNT A;  3R0J A;  4Y17 A;  4XLN F;  3FXU A;  2NRA C;  2RC4 A;  3HHH A;  3SHF A;  2WTE A;  1JE8 A;  2RGV A;  1MD0 A;  4HBL A;  2QBY B;  2K27 A;  5HLG A;  4KN7 X;  4G7H F;  3RJP A;  1O3Q A;  1YS7 A;  1Z91 A;  4L9J A;  1HST A;  1K78 A;  1DPU A;  2IVM A;  4HDV A;  3O6B B;  1ZN2 A;  4U0V A;  2R7D A;  1XCB A;  3ABT A;  1UCR A;  3HOS A;  4HYE A;  4DNC A;  3GUD A;  2ISZ A;  1TW3 A;  2J5O A;  4NHJ A;  2XRN A;  3TOA A;  1RI7 A;  4R79 A;  1TNS A;  1O7F A;  1XGM A;  3CUQ C;  3H92 A;  1P2F A;  4HF1 A;  2ZXJ A;  1FBU A;  4PZJ A;  3TDU C;  5DYM A;  2RVC A;  5EEH A;  2FBI A;  2PMH A;  4PGH A;  2LSO A;  2M45 A;  4L9N A;  3T8R A;  4CO8 A;  1YTY A;  3ELK A;  4Y13 A;  4N9H A;  1B1B A;  3LAJ A;  1ZG3 A;  3GZ5 A;  5ED4 A;  3DP7 A;  4Z2Y A;  3P7N A;  2Z9O A;  2ZKZ A;  2V79 A;  3GWZ A;  4YFN F;  1B9M A;  1KYW A;  3IWF A;  3KCC A;  4Q5S F;  2HWV A;  2DLL A;  1BJA A;  1T2K A;  3E6D A;  5BPI A;  3CTA A;  1HW1 A;  2FSW A;  2IW5 A;  2PFB A;  3I71 A;  2GXG A;  3ZMZ A;  2KIM A;  1UST A;  2ADU A;  2EV5 A;  5J6X A;  5D4R A;  1Q1H A;  1XGS A;  2DQL A;  4L9V A;  5E8I A;  2A68 F;  1XSX A;  5BOX A;  4AIK A;  2UXN A;  2GXB A;  2PN6 A;  4OU0 A;  1MJB A;  3WU1 B;  4OIQ F;  2JZY A;  5IT9 K;  4G7O F;  3R61 A;  4M9S A;  4RB2 C;  2F5E A;  4G9Y A;  4LD5 A;  4A6E A;  1ON2 A;  2QQB A;  1PP8 F;  4HV6 A;  1S8N A;  1SD4 A;  3JSO A;  5TRD A;  1J9I A;  2Y75 A;  2UXX A;  3FWE A;  3MWM A;  4CGZ A;  5HLH A;  2CG4 A;  2VC0 A;  2KIU A;  4U88 A;  3LQR A;  1FBS A;  2L01 A;  3P9I A;  2A61 A;  2Z5U A;  4M9X A;  3I5U A;  2F5F A;  3GF2 A;  3GFI A;  4M9Z A;  2HKX A;  3IRQ A;  4KIB A;  2GQQ A;  3S2W A;  1XSV A;  1OMI A;  1LDJ A;  1KU2 A;  1KU3 A;  2QBY A;  5H6Q A;  2J5P A;  3MZY A;  1CF7 B;  2P7C B;  4PDK A;  5HS7 A;  1ZHF A;  5HVQ C;  4UVA A;  4IPA A;  2H94 A;  5L3E A;  4HQE A;  5FLX Z;  1I1S A;  3C1D A;  1SMT A;  3F8M A;  1Z1D A;  3K9T A;  1ULY A;  2QYO A;  2ETH A;  3KZY A;  3WTY C;  3CO6 C;  3KE2 A;  2NNY A;  4BAY A;  3AAF A;  4EM2 A;  5HS8 A;  5BPD A;  2EWN A;  2Q0O A;  3NQO A;  2P5L C;  3O3K A;  4EMS A;  1F4K A;  2V6C A;  2FNA A;  4LB5 A;  3GLX A;  3FF5 A;  4I0A A;  1H9T A;  1V3F A;  4YIF A;  2HKO A;  1XB4 A;  5A2Q K;  5K1Y A;  2VBW A;  5FFX A;  2YX4 A;  1BI1 A;  4HX7 A;  5HDN A;  4O5V A;  3DFG A;  4QLC U;  3WGG A;  1YYV A;  2DAO A;  3F6V A;  2O3F A;  3BPV A;  5BQT A;  4ON0 A;  1ZAO A;  4WX9 A;  2QWW A;  2XKO A;  1W7P B;  5LHG A;  2DT5 A;  4O3M A;  2P6S A;  1HKT A;  4B8X A;  4FHT A;  1Z6R A;  3BOQ A;  1YIO A;  3FM5 A;  1HW2 A;  2EV6 A;  2P5K A;  4OMZ A;  5DD4 A;  3NRV A;  1R7J A;  1FPQ A;  1FSE A;  4DQ2 A;  2A6H F;  2VXZ A;  3KFW X;  4EJT A;  1RUO A;  2VBY A;  2LF7 A;  4G6D A;  1P6R A;  1IN5 A;  1TTY A;  1QQI A;  5E1W A;  1LB2 A;  5L3D A;  5JR3 A;  4EV0 A;  1W7P D;  4IRI A;  5L3B A;  2H6C A;  4U0Y A;  1IAW A;  1IRG A;  2KJC A;  1F1Z A;  1FOK A;  5J8C A;  3C18 A;  3FX3 A;  2UZK A;  4UHT A;  2BYV E;  3HRM A;  4RS8 A;  1OPC A;  2A69 F;  1J2X A;  3CUO A;  2V1D A;  1KU9 A;  2IA0 A;  2YPR A;  3EQL F;  2L4M A;  1P4A A;  4G7Z F;  3BJA A;  3Q9V A;  1R5H A;  4L9T A;  3BZ6 A;  3ABU A;  2D2W A;  3ROU A;  4R1H A;  2FML A;  1XSD A;  3T5X A;  4A5M A;  4RAY A;  3WG9 A;  4ZYH A;  2MC3 A;  3W6K B;  5LEJ A;  3HTU A;  3JTG A;  3QOP A;  2JTV A;  2AS5 F;  1FP1 D;  1R58 A;  2OZU A;  1D3Y A;  1SD6 A;  3QU6 A;  5FFZ A;  4LFU A;  4I09 A;  3V7S A;  4ZYG A;  3KLO A;  3KP5 A;  2QVO A;  3FXR A;  4UV9 A;  3C3W A;  2A07 F;  3BY6 A;  3L09 A;  1SAX A;  2P6T A;  2EFP A;  1Y0U A;  2M8E A;  5DCF A;  1IRF A;  1S6L A;  2R7F A;  5JHU A;  1H9G A;  1O7L A;  1R1U A;  4I2O A;  2PBI A;  1R23 A;  2K7L A;  2E7X A;  3B73 A;  2HTS A;  2YR2 A;  4AIJ A;  1D5V A;  4WF2 A;  2A3S A;  1T39 A;  1W4M A; 
#chains in the Genus database with same CATH topology
 5FB2 A;  1T38 A;  1Z0X A;  3D5S C;  1V5E A;  2MH9 A;  1OR7 A;  1KYZ A;  3BQY A;  3OIQ A;  4ITV A;  4ABZ A;  4B43 A;  1I50 J;  1FMW A;  2IA1 A;  4IX7 A;  2XAJ A;  3GW2 A;  4CCJ A;  3OMY A;  3SFZ A;  4RA2 A;  3MQ0 A;  4HNU A;  3RPU A;  4YFX F;  4M3D A;  2FOW A;  1TBX A;  1FLI A;  1D0Y A;  2FNP A;  1JHF A;  4XSZ F;  4ZYA A;  4IJA A;  3VSK A;  2NVY J;  4EM1 A;  3BTI A;  1MKM A;  3DV8 A;  3CO7 C;  2KIS A;  2JUG A;  4FET A;  1FTT A;  1W7P A;  3RIR A;  2Y0M A;  1UHM A;  2K4B A;  5LRR A;  3CP8 A;  4PJJ A;  1MBK A;  3I53 A;  2B0L A;  2EBI A;  5ICC A;  4IHX A;  4B48 A;  5K5O A;  2E19 A;  2X1D A;  1PDN C;  4BXX J;  2WY7 Q;  4GRI A;  4HQM A;  2HDC A;  2OD5 A;  1TLH B;  4X1E A;  3SFI A;  3SYT A;  2EFN A;  1WH7 A;  1J0R A;  1OFC X;  2KZG A;  3AG4 H;  3S3O A;  4D7N A;  5JVG F;  3OL3 A;  1ENH A;  1ZRC A;  3HUG B;  2VC1 A;  5D5V B;  3GTQ J;  1ZRE A;  3CLQ A;  3COA C;  1JTX A;  4YFK F;  2KKO A;  4LIU A;  3I4M J;  4Y4R A;  3ZQQ A;  1YO5 C;  3HXL A;  3S15 J;  3ULQ B;  5HDG A;  3S93 A;  2E34 A;  1XMA A;  4YEL A;  1YW8 A;  4BHP A;  3JAM Z;  3RKQ A;  3IAS 2;  3LFK A;  2DYR H;  1FSH A;  3PUF A;  2D1V A;  2CQN A;  4MEX F;  3EYI A;  1QZY A;  4UY8 I;  2HFH A;  2VJI A;  2JUC A;  5LLQ A;  1R6R A;  3HHG A;  3FXK A;  2KHM A;  2ZXH A;  3HOZ J;  4PGG A;  4XIC A;  1WJD A;  1HKS A;  3WGH A;  2HOA A;  2CUZ A;  4FX0 A;  3TQN A;  4XR6 A;  4LJZ F;  2XB5 A;  1CGP A;  2XSD C;  5K7F A;  1MW7 A;  1IXC A;  2BY0 A;  4EJW A;  1BI0 A;  1TC3 C;  2JA5 J;  2JA8 J;  2GAU A;  3FK6 A;  3WTU C;  5D6F A;  2FQ4 A;  2I10 A;  4XID A;  1NG6 A;  1VQO I;  1JT0 A;  2HQA A;  2QQ9 A;  4WXH A;  1U6G A;  1WJ5 A;  4KYW A;  3J80 Z;  2DOD A;  2LMD A;  3K4K A;  1VQ5 I;  4HST A;  1RKW A;  1UHW A;  3BR5 A;  1O57 A;  1RKT A;  2V9K A;  2IT0 A;  3K6G A;  2ZC2 A;  3HG9 A;  3SDB A;  2PJP A;  2NOJ B;  2V9P A;  4RB3 C;  2E36 A;  1X19 A;  4QPQ A;  1Z05 A;  3BR1 A;  3KP3 A;  1G4D A;  4KUM A;  4HW0 A;  2KRF A;  4MLO A;  2Z99 A;  2ZXI A;  1YFH A;  3JRH A;  5LD2 C;  1U5T B;  2M87 A;  2W84 A;  3RQ4 A;  2LBF A;  5IOZ A;  3PFI A;  4KIG A;  4MQV A;  3IV5 A;  3TW6 A;  3KLN A;  3ZR8 X;  3ESW B;  4A3L J;  2DA7 A;  4IHW A;  3W3C A;  2ZSI B;  3RKW A;  1PVE A;  1OCT C;  2MGQ A;  1R1T A;  2MBF A;  2VKD A;  1S29 A;  3GZ6 A;  4XMY A;  5ICG A;  3CJQ B;  3G1L A;  1X1B A;  5HOD A;  3WGI A;  3F6O A;  4N4N B;  1WI3 A;  1TWC J;  2ESN A;  5CVU A;  1EV7 A;  4M6V A;  2KIQ A;  2MC4 A;  1W0U A;  2R7Z J;  3M9A A;  4M74 A;  1D5Y A;  2BXY A;  5J1U A;  4ENJ A;  3HB9 A;  1G3T A;  2LRD A;  3RKY A;  3T1B A;  4XBF A;  3B6A A;  4IVN A;  1W5S A;  1J7K A;  3FMR A;  2K86 A;  2VUM J;  2VOP A;  3RYR A;  1IZ1 A;  2ZB9 A;  3IKV A;  4KIC A;  3CJN A;  1LFB A;  1DUX C;  2FMY A;  4P96 A;  4OIR F;  3DKY A;  4I0B A;  3E0J B;  1HXD A;  3TOB A;  2VKH A;  5BNG A;  1XMK A;  2Y31 A;  1ZTR A;  3L2Q A;  4RGS A;  2IXS A;  2STW A;  2EZL A;  3N97 A;  2Y9Y A;  2HVQ A;  5FKN A;  1A04 A;  3MAJ A;  2P8T A;  2NAZ A;  3V8L A;  4XKC A;  3M8F A;  1IW7 F;  1NK2 P;  4IRG A;  3I58 A;  2IJL A;  3BR3 A;  3TMO A;  1JGS A;  3OYD A;  1ZLK A;  2RV8 A;  4ANJ A;  4EGZ A;  1AOY A;  3BWG A;  2M7B A;  2VN2 A;  3S2D J;  3NAU A;  4L18 B;  4WK8 F;  2DPD A;  3FHZ A;  2HYG D;  4G94 A;  2WAQ A;  4BUP A;  2DK5 A;  3R60 A;  4IXA A;  5AIQ A;  3SEQ A;  3VB2 A;  2CV1 A;  2E1M B;  1HSJ A;  2RNJ A;  4KT6 A;  1X4P A;  3HRS A;  3CMM A;  5D8K B;  3S1M J;  1A35 A;  4IL6 C;  3DWL E;  1X1D A;  2A6T A;  1ZYR F;  6PAX A;  3K1P A;  5FKL A;  2GZW A;  5HLT A;  1ZR2 A;  2HR3 A;  4GGG A;  4U7B A;  3MFK A;  2JSP A;  1X58 A;  2IGK A;  1FOW A;  3QU3 A;  1GUU A;  2KMU A;  3DBL B;  4EEF G;  2L9N A;  5E1Z B;  4DBQ A;  1ZEL A;  4OOI A;  1GVD A;  3S3M A;  3DQV C;  2LH9 A;  4P55 A;  3MD2 A;  3ZQG A;  2LTP A;  1I39 A;  2W00 A;  3K2Z A;  3F23 A;  1VQM I;  1J75 A;  3MVP A;  1R00 A;  4DJA A;  1KA8 A;  1QPM A;  1SD7 A;  2LNB A;  4BJ6 C;  3JRG A;  4C3J J;  4EGY A;  5F6F A;  2DMQ A;  1IO2 A;  4Q47 A;  5ILU A;  2NXN B;  5IYC J;  2LG4 A;  2KDO A;  1BOA A;  2PJR B;  5F1R A;  3MN2 A;  2XIG A;  2ACJ A;  2ZNZ A;  3HSE A;  3IL2 A;  2F2E A;  3Q0V A;  2DMP A;  2BVL A;  3S8P A;  1VQ9 I;  4LLN A;  1U78 A;  1ODD A;  4L5J A;  1OKR A;  3CJR B;  3VYR B;  2I8D A;  2DFI A;  3OYA A;  3CES A;  3K0L A;  2ZNY A;  3Q0U A;  4HZF A;  4RB0 A;  5KVR A;  3LA7 A;  1IGN A;  5JFR A;  4NQW B;  3BTC A;  2OU2 A;  1DPR A;  3JRD A;  1GXQ A;  3FBN B;  2YU9 J;  3SZG A;  4BHC A;  1R4N B;  2VJ4 A;  3HSF A;  1MBH A;  5J8F A;  3HPG A;  2TDX A;  1O4X A;  3SZT A;  1JXS A;  3DXJ F;  4GYI A;  1EH8 A;  1WRJ A;  2DA5 A;  2VJJ A;  5IT3 A;  2W48 A;  3OL4 A;  4BNC A;  1L3L A;  4BXU A;  3H9J A;  5HNF A;  1IG7 A;  1TL8 A;  3MEX A;  1DP7 P;  3AG3 H;  2KRC A;  2HDW A;  2XAG A;  4FTH A;  3FXJ A;  1FT9 A;  3ZMD A;  4BS9 A;  1MMD A;  2ZJR F;  1H8A C;  1W5T A;  2MAB A;  1IDZ A;  2KFD A;  4A5N A;  5D4S A;  2KPM A;  3WOD F;  2B7E A;  4ZDP A;  2FRH A;  2O0Y A;  4UB8 C;  2ECB A;  3ZMS A;  2CO5 A;  2DOF A;  1ON1 A;  3EUH A;  4A3E J;  1E0E A;  3A2K A;  1U0J A;  5K5R A;  2DI3 A;  3E5U A;  4OIN F;  3BT9 A;  1GXP A;  2M1B A;  1LEA A;  2M34 A;  1S72 I;  3V7C A;  1PJR A;  1SVM A;  4EM0 B;  4B3X A;  1U5T A;  4PJ0 C;  4BY1 J;  3FHN A;  3KZZ A;  5DV5 A;  4G6T B;  1IN4 A;  1BN5 A;  5EF6 A;  5C3E J;  3H3U A;  1P7J A;  4I98 B;  3G73 A;  4TV7 A;  2EB7 A;  2HQR A;  3KP6 A;  4KA4 A;  4ENN A;  2QF7 A;  2VT3 A;  3OYC A;  2RQP A;  1FWZ A;  3L00 A;  3DPU A;  1P92 A;  1KGS A;  3FXL A;  4M3B A;  3LAP A;  2CQ7 A;  2EK5 A;  1D1C A;  3E97 A;  2EV0 A;  3CCY A;  2BBY A;  3PIP F;  1VND A;  2DU9 A;  5C4X J;  1IF1 A;  2ZFW A;  4LG3 A;  2EH3 A;  3PQK A;  2R4G A;  2L9V A;  5EJC A;  1OYW A;  5DM6 F;  4AID A;  2CU7 A;  4U0W A;  2K9M A;  4BE0 A;  1K6O A;  3VYU B;  1Z7L A;  3FIW A;  3VOD A;  1Y1V J;  2MW8 A;  3CCS I;  2A5W A;  5D5U B;  4BY7 J;  4A69 C;  3IAM 2;  3DKW A;  4A0X A;  5E3M A;  1A36 A;  2MYS A;  2EA4 A;  2E5Z A;  3ZRG A;  2HGC A;  1OCP A;  1SD5 A;  2CFX A;  2DK8 A;  2ZBK A;  2H27 A;  3K70 C;  3NAR A;  2DXI A;  1TW2 A;  2QQ8 A;  2Z16 A;  1ZG5 A;  2HI3 A;  4YII A;  2C6Y A;  3IC7 A;  2V7F A;  2QEX I;  2ZJ2 A;  4NB5 A;  3CUQ B;  2DTR A;  2Z33 A;  1CQT A;  3QPS A;  5CVV A;  3BDD A;  2BW3 B;  3A4C A;  2A6E F;  2A05 A;  2LC2 A;  3REO A;  2D45 A;  3BRO A;  3ONQ A;  4MTD A;  1FEX A;  5CVR A;  1KQ0 A;  5JLW A;  1AKH B;  1E17 A;  3HSR A;  1DDN A;  2QM3 A;  2XF7 A;  1FZP B;  2FF4 A;  4IHT A;  3VSL A;  1YW9 A;  4FT8 A;  2MA3 A;  4BJT A;  3ML6 A;  1Y0N A;  4PK4 A;  4E7Z A;  3D1N I;  2CQK A;  3CF2 A;  3CLO A;  3K4C A;  5TJJ A;  3OIO A;  1TQM A;  2H6B A;  2IP2 A;  4ZTJ A;  1ZR4 A;  3BJ6 A;  4WWC A;  1YX3 A;  1ZQ3 P;  4NC6 A;  4ZTF A;  4D0P A;  3GEZ A;  3S3N A;  5DDG A;  4RLQ A;  4XLF A;  3ZQ7 A;  4NC7 A;  4IHY A;  1S9H A;  1EF4 A;  4KMU X;  2ISY A;  3SEZ A;  2O8X A;  2OUM A;  3EET A;  2LKX A;  1JUS A;  4J01 A;  4PJM A;  4BQA A;  3CCJ I;  4LK1 F;  4DGW B;  4J00 A;  1B6A A;  1MJ9 A;  4HG2 A;  4A0Y A;  1U2W A;  1O3S A;  2LP0 A;  3PO2 J;  1HW5 A;  2QEN A;  4OMY A;  1GHC A;  1XC5 A;  2MFZ A;  3FM3 A;  3F8B A;  3UR3 C;  1J5Y A;  4CCO A;  5KCM A;  2PJR A;  3VWB A;  1VTN C;  3RQI A;  3GFL A;  4CYC B;  3V4G A;  3LA2 A;  2V1N A;  3HTS B;  1YW7 A;  5GAH J;  2XGE A;  1ZH5 A;  2ID3 A;  2FBH A;  2MD0 A;  4MNU A;  4M72 A;  2GIZ A;  5E1X A;  5DM7 F;  4HLY A;  1QA6 A;  2XKP A;  5KAI C;  1OCC H;  2JPB A;  4NQW A;  2KLO A;  1W36 D;  1EA3 A;  3F21 A;  3LSI A;  4BHB A;  4UB6 C;  2WA0 A;  1F43 A;  4GCV A;  2W25 A;  2M4G A;  3GCM A;  1WZ2 A;  2WB1 A;  3M3Y J;  2XGD A;  2QA4 I;  1X3W B;  1Z67 A;  2ZME B;  2M3A A;  3HGG A;  4I7H A;  3LSR A;  2JWT A;  2PEX A;  2NVT J;  2R7Q A;  2D5V A;  1BW6 A;  4C9Y A;  5AIP A;  1XDU A;  3JSP A;  2WWY A;  1MSF C;  3OOU A;  3GBG A;  2DT6 A;  2HQN A;  1IN7 A;  2X1E A;  2L2O A;  1G8X A;  3F8C A;  1EH6 A;  3QOD A;  3ZN1 A;  5CKT A;  1NG7 A;  1E2X A;  2DFH A;  3BR0 A;  2W7N A;  3SDG A;  4JK1 X;  5KNL A;  2HEO A;  5HS9 A;  2VQH A;  3KX2 A;  3ZQH A;  1MMA A;  3RSN A;  1CF7 A;  2YS9 A;  2EZK A;  1R1V A;  4XLE A;  2ECC A;  4ESJ A;  1RR7 A;  4I99 C;  4HX8 A;  4OWR B;  3Q5F A;  4L0Y B;  3A0B C;  4XLP F;  4KIS A;  2IBD A;  1T95 A;  1T8I A;  1WKM A;  3CF5 F;  1BIA A;  2STT A;  2XUB A;  3QYB A;  3RCO A;  1B8I A;  2RN7 A;  3BG9 A;  2R7W A;  2EPF A;  4EVI A;  5BS6 A;  2R7V A;  3HBL A;  5LGU A;  1H0M A;  2GA2 A;  5HOO A;  2R0Q C;  2V1X A;  2R93 J;  1NHA A;  2ZO4 A;  3N4M A;  5J4V A;  2X4H A;  5M5X J;  3MCZ A;  1RIO H;  5J3L A;  1KQ9 A;  2DA1 A;  2XAF A;  1E3H A;  5KAF C;  3CME I;  4RAF A;  2LD5 A;  1UFM A;  1YI2 I;  3HOU J;  2DFE A;  2B63 J;  1ETY A;  4DYR A;  1K7A A;  2Q8K A;  3V8J A;  3L2U A;  2P4W A;  3R6S A;  1ERD A;  2Y69 H;  4N9I A;  5ILS A;  3OYL A;  1X1C A;  2VJ5 A;  1K83 J;  4UNO A;  3ZPL A;  3H35 A;  4PFO A;  5E20 A;  1QPI A;  4BBS J;  1E3P A;  4A3D J;  2XSJ C;  5LGT A;  2CV0 A;  3WTV C;  4UVC A;  3E6C C;  2I5U A;  2LY2 A;  4LOC A;  3L2C A;  2R7R A;  2X0L A;  5LEK A;  2WY8 Q;  3P9C A;  3S1R J;  1XGN A;  1I5Z A;  1I6H J;  1QHG A;  2A5Y B;  1PUF B;  2FXA A;  3GTP J;  2BY3 A;  1HC8 A;  2F5C A;  3CUQ A;  3LST A;  5DTD A;  2HVR A;  4HLX A;  2L5Q A;  4B3A A;  2BW3 A;  5EEG A;  4DZP A;  1U9O A;  2K9N A;  1GT0 C;  2R7T A;  4C2U A;  1AKH A;  1G3Y A;  3A01 B;  1D0Z A;  4ENK A;  1IRZ A;  1R5G A;  2M0C A;  3BG3 A;  4LK0 F;  2QLZ A;  1QHH D;  1YQA A;  4AWX B;  1WWX A;  3EDP A;  4Y7N J;  4LGW A;  2EIL H;  2HVS A;  1GV2 A;  4MFE A;  1WJF A;  1YIT I;  3CQZ J;  3HZJ A;  1T6S A;  3FKJ A;  5CVI A;  3TDZ C;  5F0C A;  1E3O C;  2M8G X;  4B4C A;  4DW6 A;  4A2U A;  5H20 A;  3LQQ A;  2DBB A;  4I6Z A;  2JPC A;  2MG4 A;  5BMZ A;  3I54 A;  2K40 A;  2ZXW H;  2GBY A;  5E79 C;  2DCE A;  3L9F A;  2ZJQ F;  3Q3S A;  3E6B A;  1BBY A;  5EGO B;  2BY1 A;  2X1C A;  1B4A A;  3M07 A;  1XN7 A;  4BKX A;  1YRN B;  1Z3Y A;  4EJV A;  2K3F A;  2XAU A;  4UVB A;  2KP6 A;  3F3X A;  1PUE E;  4CHU A;  2E2I J;  4BQQ A;  2RNG A;  2GWR A;  1K61 A;  1FIA A;  4A0Z A;  3J81 Z;  3AL0 B;  5B3S H;  2R7X A;  3QP5 A;  5M3M J;  2XRL A;  2BHZ A;  5EDN A;  3J7A O;  3KEY A;  3PM1 A;  3JW4 A;  4CDG A;  5JVT A;  4JYK A;  4HV5 A;  4CYC A;  4KNY A;  3H3V K;  3DEU A;  4MQ9 F;  1VQK I;  2YUS A;  5FD5 A;  4JOM A;  3GO5 A;  1T0F A;  3G1M A;  4CYD A;  3TP3 A;  4FAS D;  1HBX G;  1FC3 A;  3DEW A;  4D7M A;  2LKP A;  1Z7U A;  1LEB A;  2CQQ A;  5L3G A;  4HAM A;  1QNT A;  2ID6 A;  1FP2 A;  2HZT A;  1V5G A;  2M4K A;  2RQQ A;  3F0C A;  3ZQF A;  4JX5 A;  1JTY A;  3BCB A;  1X3U A;  3GXO A;  5A2Q Z;  1G59 A;  2E35 A;  2LY9 A;  2EZI A;  2JQ7 A;  3DPL C;  3BJO A;  2QQA A;  2ME0 A;  2Q2E B;  1REP C;  4E6K G;  2QKM B;  2ZME A;  2LYC A;  1TT5 B;  5IPA A;  3C2G A;  3O8H A;  5JI6 A;  3MKY B;  4XN0 A;  3CZ6 A;  5FLX K;  1JGG A;  2XRO A;  4AIH A;  1XG1 A;  1IN8 A;  2JRT A;  1BC7 C;  3HOT A;  3IWZ A;  3I59 B;  2FJ1 A;  3D5L A;  3IH3 A;  4N4O B;  3I3L A;  1BR4 A;  1TWF J;  2LDU A;  3GFJ A;  5LHI A;  5K5Q A;  4E7L A;  1X2N A;  5CPR B;  1QBJ A;  2VQL A;  3DPT A;  2L4A A;  3S32 A;  4HX4 A;  4ENM A;  3WTS C;  1IN6 A;  2ICW G;  1QU3 A;  2W1O A;  1R71 A;  2ELK A;  1YS6 A;  2DN0 A;  5E18 F;  3OYB A;  4HOB A;  3KEQ A;  2CGP A;  2V6E A;  3CCM I;  2BXZ A;  2VON A;  1HA8 A;  4FIS A;  1U3E M;  3E1S A;  1J09 A;  1OCZ H;  4F55 A;  4A3K J;  1M1E B;  2LKS A;  1JJ8 C;  2X6Y A;  3ZP5 A;  3FXQ A;  3I64 A;  2ELH A;  3DTK A;  4XK4 A;  3PIO F;  1MNM C;  2LR8 A;  3M4O J;  1FYL A;  5LBQ A;  3IHU A;  4UV8 A;  5GAG J;  3HYI A;  1IV8 A;  2X48 A;  2CSO A;  3AG2 H;  3M1E A;  1YJ9 I;  2VT2 A;  2KJB A;  3WTX C;  3FKI J;  2HPI A;  3OYN A;  5C44 J;  4HRI A;  4CIC A;  2LK2 A;  1UAA A;  1LFU P;  3HIF A;  2EFQ A;  4QWQ A;  5AON A;  2YSR A;  4D9J A;  4JX4 A;  3MZH A;  1F9N A;  2DOA A;  1HDD C;  1EH7 A;  3W2W A;  4JQF A;  3JRA A;  2L7F P;  3RI4 A;  2DPU A;  3IH4 A;  1BR1 A;  1JKO C;  2HS5 A;  2IA2 A;  3GTL J;  4ZDO A;  2V9V A;  1MZB A;  2K4J A;  1Z6T A;  3S2H J;  2O7O A;  5L3F A;  3FMQ A;  2IS2 A;  2VOO A;  1BI3 A;  2P5V A;  2FA5 A;  2X85 A;  4ASN A;  3AFH A;  3HOV J;  3QOE A;  3ECO A;  2DW4 A;  3QPH A;  4BH9 A;  3OS1 A;  1XDS A;  1SMY F;  3ISP A;  3LSP A;  5CLS A;  3Q9S A;  5JLX A;  3WHB A;  4B09 A;  3E7L A;  2XHK A;  2W57 A;  2P7V B;  1LVA A;  4AVP A;  1Z9C A;  4KN4 X;  4RGU A;  1BOB A;  4HPQ A;  2VE8 A;  3B02 A;  1FMV A;  2XPV A;  5CJ9 A;  1PUF A;  3V42 A;  1UB9 A;  2OAZ A;  3FMS A;  3GTG J;  1MJA A;  1OYY A;  1OR7 C;  5F08 A;  2L02 A;  4BEH B;  4BGD A;  3U2R A;  3HM5 A;  2VQG A;  3I0T A;  4AD9 A;  3WTT C;  1FX7 A;  4RMN A;  4V19 K;  4BQN A;  2G7U A;  3S16 J;  1ZKG A;  2KZV A;  4F93 B;  4CZZ A;  2PG4 A;  3I56 I;  1YJN I;  1HDP A;  5TGT A;  1S7O A;  4XON A;  1SAN A;  2M30 A;  5D8L B;  2KDZ A;  3JR9 A;  3C2B A;  2P81 A;  4E7K A;  1J59 A;  1LPQ A;  5E17 F;  1N25 A;  1IXS B;  4HEA 2;  1Q1V A;  5EEA A;  4CXF A;  2UV1 A;  3D0S A;  3M8E A;  5ICF A;  4E70 A;  3I55 I;  1XCV A;  3K1N A;  1ZK8 A;  4R8H A;  1BM9 A;  4PSX A;  4HSR A;  4IEJ A;  3HL2 A;  4YRV A;  1ETV A;  1FNN A;  4N0B A;  1YOV B;  1ZLJ A;  5IY5 H;  2HZD A;  2QZ8 A;  3HJE A;  3CDH A;  1P4X A;  2MD5 A;  4MEY F;  2JA7 J;  1MMG A;  2Z2S B;  4HDU A;  3MKZ A;  5EGO A;  4F3Q A;  5FLM J;  3V8K A;  2Y0S N;  3H5R A;  4GYG A;  1O3T A;  1Y1W J;  2K9L A;  3LSJ A;  2MLK A;  1YRN A;  3KYD B;  3HRT A;  3GYH X;  2OZ6 A;  2NNN A;  2H8R A;  4KDP A;  2JVH A;  2VOD A;  2DJI A;  2NS0 A;  3HUG A;  1S5L C;  2EFO A;  4FE4 A;  1V5F A;  3ERE D;  1Y8Q B;  1T0F C;  2W24 A;  3I4N J;  1F5T A;  2ESH A;  2W82 A;  5E3L A;  1UJ8 A;  3O2P E;  1YHQ I;  1T08 B;  4A93 J;  5HLI A;  1QRY A;  1W1W E;  2XVC A;  1BC8 C;  5FO5 A;  2VBZ A;  2JT1 A;  4LG0 B;  2OTJ I;  1FY7 A;  1KON A;  5LGN A;  2DQR A;  4IRH A;  1VZ0 A;  5IP7 J;  3SXY A;  4P1W A;  1P4W A;  5DUI A;  1R36 A;  4GO1 A;  2W85 A;  4NNJ A;  1GLN A;  1Y6I A;  2K85 A;  3BLY A;  2B9S A;  4ESF A;  2FU4 A;  4ZYE A;  3JRB A;  2XGC A;  2E1O A;  2Q2E A;  1D8K A;  3OY9 A;  3DU5 A;  3CD6 I;  1R22 A;  1FBQ A;  4YG2 F;  3G4S I;  3JRC A;  3WHC A;  2L3D A;  2CYY A;  2CW8 A;  5J1R A;  1ONV A;  2XV4 S;  5GPA A;  3I59 A;  4OAZ A;  3RPQ A;  1XX5 A;  3FDY A;  2XGX A;  3TO7 A;  1ZAR A;  5E3O A;  1G3S A;  3ASN H;  4KT5 C;  4IOC F;  1KQ8 A;  2FQ3 A;  3VFZ A;  4A12 A;  2RDP A;  4XRM A;  3K4B A;  3K4L A;  3ZQI A;  2EZH A;  5CVJ A;  3PL8 A;  2HQ5 A;  2X6O A;  4RGX A;  4BAC A;  1Z3X A;  2ZFU A;  1YG2 A;  3JTH A;  1DP3 A;  4B1R A;  4S04 A;  2WC2 A;  2OQR A;  1P7I A;  3LWF A;  3WE2 A;  2VI6 A;  5B5E C;  4D5F A;  2IGM A;  1D1B A;  2R5Z B;  3K69 A;  3N05 A;  2BY2 A;  4CCN A;  3CMA I;  3QRF F;  4P5O A;  3GTK J;  2V1U A;  2VKE A;  2Y48 A;  3BZK A;  4UUT A;  5F1J A;  1LQ1 A;  2IAI A;  4II3 A;  3WG7 H;  3H5N A;  3H9G A;  3RYP A;  3QPT A;  3OOP A;  4H0E A;  2EJR A;  2BEO A;  1IC8 A;  1S7A A;  2M2E A;  1XPX A;  4XLH A;  4M6X A;  5IOY A;  2XPW A;  3TP0 A;  2O5R A;  4E4H A;  4E7I A;  2DJN A;  2OCC H;  2PX9 A;  3LL7 A;  1ZRF A;  3G1O A;  1T98 A;  4A3C J;  3CCL I;  1JKR C;  3CC7 I;  3TED A;  4RAZ A;  4XRF A;  2FBK A;  4M6Y A;  4XLC A;  4A3M J;  2DDA A;  4GXO A;  1W5C C;  3E5Q A;  5EYR A;  3IRR A;  2FE3 A;  4L5I A;  3V7R A;  4NUB A;  1YIJ I;  1WSU A;  1TQP A;  3JRI A;  1F36 A;  2VPR A;  5F0H A;  3VOE A;  3SZP A;  4QSH A;  4W1U A;  1Y8R B;  2ZSH B;  4XOT A;  3C2H A;  4MFD A;  3RTR A;  5HNH A;  2XDV A;  1T33 A;  2QKL B;  1AWC A;  2X51 A;  2LFB A;  3Q0W A;  1BIB A;  2F48 A;  2E7W A;  2PMZ N;  1RNL A;  4I76 A;  4BL0 B;  5K7Z A;  4S05 A;  3BR2 A;  4BEH A;  1DU6 A;  5IYD J;  2OTL I;  1V54 H;  1OJL A;  3OSF A;  4RM2 A;  4HA8 A;  4KJZ A;  2O6G E;  1XTA A;  2MLG A;  2IPQ X;  3J81 K;  1FYM A;  4L0Z B;  3EUA A;  1RET A;  1RRJ A;  1STZ A;  4LB6 B;  1MH4 A;  5KK1 A;  5FKO A;  5DD8 A;  3ZOB A;  3WU0 A;  1QO0 D;  4CH7 A;  5D6E A;  3ABK H;  2L9S A;  5FKK A;  4XKB A;  3JRE A;  2MH2 A;  2YX7 A;  1SVL A;  3JAM K;  4ZDL A;  3MKL A;  2L7K A;  3E6M A;  2HU9 A;  3VPR A;  2ZJP F;  3J7Z I;  4M3E A;  5D5X B;  1MBG A;  1LJ9 A;  2OPT A;  3NWT A;  2ZCW A;  2WAF A;  3BTL A;  4M3F A;  2BGC A;  1PP7 U;  3ZMU A;  4EQQ A;  5ERI A;  1ZGJ A;  1N78 A;  1FYK A;  4EJU A;  4ESB A;  3OYI A;  4I01 A;  4UUV A;  2X9D A;  4CCM A;  1N75 A;  3DF8 A;  3U1D A;  2OBP A;  2QCO A;  4OIO F;  2VBX A;  3WU2 C;  3ZGK A;  3ZMV A;  3L2R A;  4IO9 F;  2R7O A;  2EA2 A;  4G6Q A;  2LRE A;  1D0X A;  1ZG1 A;  4ZZD A;  3PSI A;  2O9L A;  2G7H A;  1MGT A;  2Y2Z A;  3OYF A;  3I4P A;  2O03 A;  2VE9 A;  4AYB N;  1O3R A;  1R5I D;  2GM4 A;  2E1C A;  4LG0 A;  3WTW C;  3SJM A;  3PNY A;  2OF7 A;  3J80 K;  1JHH A;  4L5E A;  3G3Z A;  2DMU A;  4F52 A;  4ZZL A;  1OCO H;  4D1Q A;  2COM A;  4DOZ A;  2K5C A;  1D8J A;  3VYS B;  3OSG A;  4HF0 A;  2NYX A;  2XF5 A;  3K1M A;  2CUF A;  3H3Z A;  5J4Y A;  2PLY A;  1U9N A;  3AKZ A;  2IGO A;  3W6V A;  4KMF A;  2OA4 A;  2O61 A;  3E3V A;  1MDM B;  2L54 A;  2H1K A;  3PUB A;  4PCQ A;  2F4I A;  5FLV A;  1UEL B;  4DZJ A;  3KYL A;  3HRU A;  4BXF A;  4XOP A;  3DBR B;  2HXO A;  4O6J A;  1SVO A;  3GTM J;  3ABL H;  1MNE A;  4XM3 A;  5H6R A;  5DCM B;  2EFW A;  3BG5 A;  3GTO J;  4M71 A;  2K9Q A;  2F5D A;  4ZC3 A;  3W6J B;  3TGN A;  4D5C A;  2M9H A;  2OQG A;  5IP9 J;  2JK3 A;  4QPO A;  5C4J J;  1ETK A;  1HF0 A;  5CYV A;  3U9G A;  3J7A Y;  1EKE A;  3BPX A;  2L7Z A;  4P9F A;  3T0Y A;  4BYY A;  4LLG F;  4X6A J;  3BTJ A;  3EUH C;  5M5W J;  1OCR H;  5HDK A;  4BDY A;  4A6D A;  3HC7 A;  2R3S A;  3L7W A;  4MGR A;  1X1A A;  3OR2 C;  1X4O A;  5B1B H;  1IXR C;  1GVJ A;  4FX4 A;  2R5Z A;  2QGU A;  5J47 A;  1QZZ A;  2HOE A;  4C30 A;  3K7A J;  3SQN A;  1U5T C;  2AO9 A;  4Y15 A;  1KU7 A;  3RKX A;  1SFX A;  3EYY A;  3KEO A;  4RLF A;  2BV6 A;  2DFF A;  4NBQ A;  2H09 A;  1QGP A;  2DMN A;  5IT9 Z;  4NDL A;  1B9N A;  1OLT A;  2FX0 A;  4BU2 A;  4MTE A;  1OYI A;  3TW7 A;  4KIF A;  2JA6 J;  1WVR A;  3LSG A;  2BHY A;  1N77 A;  2XAS A;  3OYM A;  3TL4 X;  3GFM A;  4MHG A;  3DTE A;  3QAH A;  3ZN0 A;  1Y39 A;  3RDI A;  2WV0 A;  3A03 A;  4XQF A;  1I1G A;  5DEQ A;  2KRH A;  1JKP C;  4GFB A;  1I27 A;  3LSK A;  2HTJ A;  3F22 A;  1G3W A;  4IZZ A;  2W4S A;  1YLF A;  3CC4 I;  4EJO A;  2AQF A;  1TT0 A;  2M7A A;  2KL4 A;  3M7G A;  2OC6 A;  3F8N A;  1TP4 A;  4BQO A;  1LDD A;  5FGM A;  4LLL A;  3KIO A;  1K79 A;  4YIR X;  1K78 B;  3PJR A;  2Z1D A;  2CMP A;  2XAH A;  3TO9 A;  2DMT A;  2HXI A;  3VDX A;  3OV8 A;  2YU3 A;  4EAT A;  2PQ8 A;  1KZH A;  4S0H B;  2HDD A;  1I3Q J;  3ECH A;  1IV6 A;  3BCA A;  1VFC A;  3TO6 A;  3X2Q H;  3R0A A;  2K02 A;  4Q4Z F;  2DOE A;  4WXD A;  1MIJ A;  1HQC A;  3LA3 A;  2CWE A;  2RKH A;  3BR6 A;  4KFC A;  5DS9 A;  3F9K A;  1SFE A;  2R5Y B;  3MKW B;  3GX4 X;  1WI9 A;  5L3C A;  1LNW A;  4A3J J;  4A3G J;  2GLO A;  5E8G A;  2DO7 A;  4QIW N;  4CZC A;  3CCQ I;  3HDD A;  3PQJ A;  2Z3Y A;  2GA1 A;  2E1M C;  1X1P A;  2OV7 A;  1L0O C;  1JKQ C;  5FD6 A;  2E1N A;  3WTZ A;  1LVK A;  3H36 A;  3MMY B;  2XF6 A;  1EJ9 A;  2UWM A;  2D1H A;  4ZH4 F;  2UUZ A;  4IHS A;  2F4M B;  4XSX F;  2AHQ A;  1H88 C;  4Z6Y A;  2R7S A;  4LMY A;  1RUN A;  1XD7 A;  3M1C A;  3LNQ A;  3QP6 A;  3HKZ A;  4B47 A;  3S17 J;  1YJW I;  2EIN H;  3VEP A;  3OYG A;  3BQZ A;  1SFU A;  4F91 B;  1K4T A;  3P9K A;  3DLL F;  3OR1 C;  4U87 A;  2EQR A;  3IP4 B;  5CQG A;  2QUF A;  2IS1 A;  2DTZ A;  1HKQ A;  1A31 A;  2NVQ J;  1B59 A;  4IF4 A;  2IS6 A;  2XAQ A;  5LRS A;  2CW0 F;  2KIF A;  1XGO A;  1WH5 A;  2GIV A;  3CJT B;  3OWT A;  4P9U A;  1ZGA A;  2M5W A;  2AXL A;  2AQE A;  1T56 A;  1U8R A;  1IUY A;  2PMU A;  2R7U A;  1Y56 A;  1R9T J;  3UKG A;  1USS A;  3ZMT A;  1RZ4 A;  4U7D A;  4OIP F;  2LF8 A;  5F64 A;  4Q48 A;  3H0D A;  4A3I J;  2PI0 A;  1FIP A;  4IQ4 A;  4K2E A;  3DKX A;  1I6X A;  2G9W A;  4IOA F;  2E2J J;  3IKT A;  4BJ5 C;  5ILV A;  3HOW J;  4ETS A;  4HF2 A;  1TQI A;  3K4J A;  1S3J A;  1BI2 A;  2R92 J;  2IRF G;  4XNF A;  2JSC A;  5DUK A;  1ORK A;  5B1A H;  3U1K A;  4G8X A;  4DYQ A;  4JBA A;  3C7J A;  4M3G A;  4XKW A;  1MDM A;  4WCG A;  1WPK A;  3KP4 A;  3HOX J;  2EIK H;  3K70 D;  2Y9Z A;  3NEU A;  5K7H A;  3ZQL A;  2FEZ A;  2WAD A;  4WXC A;  2VIX A;  3F8F A;  5DCM A;  1GV5 A;  3TKY A;  2X6X A;  3WE3 A;  4IKF A;  3K4N A;  3BP8 A;  3FXM A;  3GVA A;  3R4K A;  3O8G A;  1UG2 A;  3E5X A;  4XOR A;  1V4R A;  1YX5 A;  2JJ7 A;  2HYF A;  1V55 H;  3HKZ N;  3T8T A;  1JI8 A;  4DIQ A;  2GOX B;  3PNT A;  5D5W B;  3BC8 A;  2CW7 A;  2WV1 A;  3F72 A;  4UXN A;  1VF9 A;  4F7Z A;  1ZRD A;  4RB1 A;  1LDK B;  3VYT B;  5ICE A;  3H5A A;  4J19 A;  3KP7 A;  2TCT A;  4I02 A;  1C0W A;  2CFO A;  4M73 A;  4RGR A;  4ZYD A;  3FZV A;  3PFY A;  2K3P A;  2IS4 A;  1G6N A;  2DYS H;  1RC9 A;  2BE5 F;  2FOK A;  2WBM A;  1WQ2 A;  5LHH A;  5J1Y A;  2RAE A;  1SAU A;  3KP2 A;  1VQN I;  4QTR A;  3KET A;  1TNT A;  2EIM H;  3R0J A;  4Y17 A;  4XLN F;  1JJ6 C;  3FK7 A;  5E3N A;  3FXU A;  3G2B A;  2NRA C;  2RC4 A;  3HHH A;  3SHF A;  2WTE A;  3ERM A;  1JE8 A;  1NK3 P;  5EZH A;  4II2 A;  2RGV A;  3BG7 A;  1MD0 A;  4HBL A;  2QBY B;  5LFA A;  4XKV A;  1UHS A;  2K27 A;  1XMX A;  2Y0S A;  1BJZ A;  2IEK A;  2L0K A;  5HLG A;  4Y52 J;  4KN7 X;  4G7H F;  4PJL A;  3RJP A;  1RR8 C;  2G0E A;  1O3Q A;  1YS7 A;  3PNV A;  1Z91 A;  4L9J A;  4C2T A;  3K2A A;  3OIP A;  1HST A;  1K78 A;  1DPU A;  2IVM A;  4HDV A;  3O6B B;  1ZN2 A;  4U0V A;  4XRS A;  2R7D A;  4AU7 A;  1XCB A;  3ABT A;  1UCR A;  3HOS A;  2JA2 A;  1A6I A;  5FRM A;  4HYE A;  4DNC A;  2WAE A;  3UNG C;  4HNT A;  2CS3 A;  3GUD A;  3OS0 A;  3RZD J;  2ISZ A;  1NH3 A;  1G2H A;  1TW3 A;  2J5O A;  4NHJ A;  2XRN A;  3TOA A;  1FJL A;  1RI7 A;  1QVU A;  4R79 A;  1TNS A;  1SFO J;  1O7F A;  1XGM A;  3CUQ C;  3FBI B;  3H92 A;  2R5Y A;  1VQ8 I;  1P2F A;  4HF1 A;  2ZXJ A;  1FBU A;  1LUJ B;  3P5J A;  4PZJ A;  3TDU C;  5DYM A;  2RVC A;  1HOM A;  5EEH A;  2FBI A;  2O8K A;  2PMH A;  3KYC B;  4LIV A;  4PGH A;  4AM3 A;  2LSO A;  2M45 A;  4L9N A;  1ZGW A;  3T8R A;  4CO8 A;  1YTY A;  3A01 A;  1W36 C;  3ELK A;  4Y13 A;  4N9H A;  4AVZ A;  3H1C A;  1B1B A;  3LAJ A;  5EG0 B;  4XRS G;  4IHV A;  1ZG3 A;  2VXD A;  3GZ5 A;  5ED4 A;  4C3I J;  3BZC A;  4RBO A;  2E60 A;  2VL8 A;  4PJN A;  1LFP A;  3DP7 A;  2JVG A;  4Z2Y A;  4CUG A;  1WJC A;  3P7N A;  2L9R A;  2Z9O A;  2ZKZ A;  1YE9 A;  2V79 A;  1JT6 A;  3GWZ A;  2Q1Z B;  3K10 A;  2LVS A;  4G12 A;  3LOC A;  2DA3 A;  3S1Q J;  4YFN F;  2E2H J;  1WJE A;  3CCV I;  1B9M A;  1KYW A;  3IWF A;  3KCC A;  1IJW C;  3DBH B;  2BOL A;  4A3B J;  4Q5S F;  2K9S A;  2FD5 A;  1WFX A;  2HWV A;  2AXT C;  5FRO A;  1VI0 A;  1BJA A;  2DLL A;  1T2K A;  2VLA A;  3E6D A;  2LLK A;  3CTA A;  2LOO A;  1HW1 A;  2FSW A;  1MMN A;  2IW5 A;  2PFB A;  4FE7 A;  5BPI A;  2HOS A;  2HYJ A;  2L7M P;  3AG1 H;  3MZ8 A;  3I71 A;  1K6Y A;  2VQC A;  3LMM A;  2GXG A;  3ZMZ A;  2KIM A;  1UST A;  4AC0 A;  3K4M A;  2ADU A;  5GAD J;  2EV5 A;  2CUE A;  5J6X A;  4CCK A;  5D4R A;  3FXO A;  4BE2 A;  2E5N A;  1Q1H A;  3LSM A;  4C3H J;  3ZXS A;  2QSH X;  5M5Y J;  4E7J A;  3J7Y J;  5F04 A;  1XGS A;  1SFK A;  3LFU A;  1AA7 A;  2DQL A;  4L9V A;  5E8I A;  3OYK A;  2A68 F;  1XSX A;  1VQ7 I;  5BOX A;  4AIK A;  2ZME C;  2UXN A;  2GXB A;  3RZO J;  2OCE A;  1OQY A;  2PN6 A;  4OU0 A;  4CSW A;  1MJB A;  2DA2 A;  3WU1 B;  3CDL A;  4OIQ F;  2JZY A;  1ITY A;  2IGN A;  4G7O F;  1IRX A;  5IT9 K;  3R61 A;  4M9S A;  4RB2 C;  2F5E A;  5FRN A;  1NTC A;  2N8G A;  4G9Y A;  4LD5 A;  4A6E A;  1ON2 A;  9ANT A;  2QQB A;  2CUJ A;  1PP8 F;  3B6C A;  4CCL A;  3L2W A;  4HV6 A;  1S8N A;  5EZG A;  5JHF A;  3CMY A;  1SD4 A;  3JSO A;  5TRD A;  5F27 A;  1XS9 A;  1P9Q C;  2PMZ A;  1B72 B;  1DQU A;  2LY1 A;  2P0W A;  1J9I A;  3S1N J;  2TRT A;  2Y75 A;  2UXX A;  3H9Q A;  5GTI C;  1H89 C;  3FWE A;  3MWM A;  4CGZ A;  5HLH A;  4X0G A;  3HOY J;  1UG0 A;  3CDI A;  1R49 A;  2CG4 A;  2VC0 A;  2KIU A;  4W97 A;  4LIT A;  4U88 A;  2HPM A;  2WAQ N;  3LQR A;  5IYB J;  1FBS A;  2L01 A;  1IDY A;  3P9I A;  2A61 A;  3JRF A;  2JN6 A;  2Z5U A;  4M9X A;  3I5U A;  2F5F A;  3GF2 A;  3GFI A;  2XPU A;  5GP9 A;  3OYE A;  4UUS B;  4M9Z A;  4BBR J;  2HKX A;  3IRQ A;  4KIB A;  2GQQ A;  4DYC A;  4RAG A;  3S2W A;  1XSV A;  2CQX A;  1OMI A;  4JX6 A;  1LDJ A;  1KU2 A;  1KU3 A;  2VB6 A;  1A6Q A;  3QQA A;  3ZQC A;  3OYJ A;  3A02 A;  1QVT A;  2QBY A;  4E7H A;  5H6Q A;  3KZI C;  2J5P A;  1ACI A;  3MZY A;  1WJA A;  3GZN B;  1CF7 B;  2P7C B;  2H1L A;  2CH0 A;  4PDK A;  5HS7 A;  4KIT B;  4E7S A;  1ZHF A;  3HPH A;  3EPZ A;  2ME6 A;  5HVQ C;  4UVA A;  4IPA A;  4F92 B;  1ETQ A;  1HCR A;  4ZJZ A;  2H94 A;  1BL0 A;  3PSF A;  5L3E A;  1ETO A;  5M3F J;  4FCY A;  4HQE A;  5FLX Z;  2XB0 X;  1B8I B;  4GDF A;  1OIS A;  5GPC A;  1I1S A;  1HLV A;  1MBE A;  3C1D A;  3HEF A;  1GDT A;  4H4K C;  1SMT A;  3F8M A;  4AYB A;  3H0G J;  1Z1D A;  3K9T A;  1WHU A;  1ULY A;  2QYO A;  2ETH A;  3KZY A;  3WTY C;  3CCR I;  1UMQ A;  1MMS A;  3CO6 C;  3KE2 A;  4AUX A;  5TIS C;  1WJB A;  2NNY A;  4BAY A;  3AAF A;  1WCM J;  2GXA A;  4EM2 A;  5HS8 A;  2XC7 A;  5BPD A;  3OYH A;  1TWG J;  2EWN A;  2Q0O A;  3NQO A;  2P5L C;  5F0F A;  3O3K A;  2VAS A;  1QZE A;  4EMS A;  4BDZ A;  1MH3 A;  1F4K A;  1I3A A;  1VQL I;  2V6C A;  5EG0 A;  5CQE A;  3QYE A;  1ETW A;  2FNA A;  2E71 A;  4LB5 A;  4PSW A;  2NVU B;  3GLX A;  3FF5 A;  4I0A A;  2NVX J;  1LE8 B;  4MIM A;  3GTJ J;  1H9T A;  1V3F A;  4YIF A;  2HNH A;  3S14 J;  2DA4 A;  2HKO A;  3BG6 A;  1XB4 A;  5A2Q K;  2JRM A;  4XL9 A;  3G6E I;  3L1P A;  1K4S A;  2GOM A;  4C2M J;  1LKX A;  3FIS A;  4V2F A;  5K1Y A;  1VQ4 I;  4YEJ A;  4MO7 A;  2DA6 A;  3LSH A;  3DU6 A;  1A5J A;  1BW5 A;  2VBW A;  5FFX A;  2YX4 A;  1BI1 A;  2CRG A;  4HX7 A;  3W2A A;  3AL0 C;  5HDN A;  4O5V A;  1DGR M;  1S7E A;  3DFG A;  3TBI A;  3W2V A;  4QLC U;  2H8W A;  1MND A;  3QYF A;  3WGG A;  1YYV A;  2DAO A;  2NOG A;  3F6V A;  2HOT A;  2O3F A;  3BPV A;  5BQT A;  4ON0 A;  1ZAO A;  1VQ6 I;  2FUG 2;  4WX9 A;  2QWW A;  2XKO A;  4V2G A;  1W7P B;  5LHG A;  2OJE D;  2DT5 A;  4O3M A;  1W0T A;  3KPH A;  2P6S A;  1HKT A;  4B8X A;  4JP0 A;  4RDU A;  4FHT A;  3EUK L;  1Z6R A;  2V4J C;  2V26 A;  3BOQ A;  5FKM A;  1X3Z B;  2F6C A;  2Y30 A;  2DDB A;  3QPL A;  4IQJ A;  1YIO A;  3FM5 A;  4OAY A;  1AU7 A;  3CP2 A;  1HW2 A;  1JUM A;  4NC8 A;  2EV6 A;  2P5K A;  4OMZ A;  5DD4 A;  3ASO H;  2ELJ A;  1R7J A;  3NRV A;  2VPL A;  1FPQ A;  2BVM A;  3IUO A;  1FSE A;  3A0H C;  4DQ2 A;  2CJJ A;  5FJ8 J;  1MBJ A;  2A6H F;  3ZCO A;  2VXZ A;  3KFW X;  4EJT A;  1RUO A;  1UZC A;  2VBY A;  1B72 A;  2LF7 A;  2RRE A;  1APL C;  4G6D A;  1P6R A;  1D1A A;  1IN5 A;  3RPU D;  1TTY A;  1QQI A;  1FOX A;  1BA5 A;  5E1W A;  1LB2 A;  2MSY A;  5L3D A;  1TWA J;  1SC7 A;  1RES A;  5JR3 A;  4EV0 A;  1W7P D;  4IRI A;  3HGY A;  1AHD P;  5KHD A;  5L3B A;  2H6C A;  1ETX A;  2KT0 A;  4U0Y A;  1IAW A;  1IRG A;  2KJC A;  3GLL A;  1Z21 A;  3IH2 A;  1F1Z A;  1RPW A;  1FOK A;  4UUS A;  5J8C A;  1X2M A;  3C18 A;  3FX3 A;  4Y33 A;  1DU0 A;  2UZK A;  1WGX A;  2M0M A;  4UHT A;  2BYV E;  3QWL A;  3HRM A;  1DGW Y;  4RS8 A;  1OPC A;  2F5V A;  2A69 F;  1J2X A;  2NS7 A;  5GTH C;  3CUO A;  2QSF X;  5J40 A;  3I9V 2;  2V1D A;  1KU9 A;  2IA0 A;  2YPR A;  3EQL F;  2L4M A;  3DCF A;  1VQP I;  1P4A A;  2X6W A;  4G7Z F;  3BJA A;  3Q9V A;  1MBF A;  1R5H A;  2BZT A;  3DTI A;  4L9T A;  3BZ6 A;  3A1Y A;  1U8B A;  3ABU A;  2D2W A;  3ROU A;  2VKV A;  4R1H A;  3OS2 A;  5GAE J;  3CCE I;  1R4M B;  3DLA A;  5B66 C;  2EIJ H;  2FML A;  3L2V A;  3U21 A;  1XSD A;  3T5X A;  1JUP A;  2DT7 B;  3DEE A;  2LBF B;  3GME A;  4A5M A;  4RAY A;  4RM3 A;  3WG9 A;  4ZYH A;  1FOY A;  4CA0 A;  4A3F J;  4XLA A;  4DBR A;  1IUF A;  2MC3 A;  3W6K B;  5LEJ A;  2NS8 A;  3HTU A;  3M8J A;  3QOP A;  3JTG A;  2JTV A;  2AS5 F;  1FP1 D;  1R58 A;  2OZU A;  1D3Y A;  4BE1 A;  1PYV A;  2CV2 A;  5IP6 A;  4FQG A;  1SD6 A;  3QU6 A;  5FFZ A;  4LFU A;  4I09 A;  3V7S A;  1FTZ A;  4ZYG A;  1SEU A;  3KLO A;  3KP5 A;  3CC2 I;  4XN3 A;  2QVO A;  3FXR A;  4UV9 A;  3C3W A;  2A07 F;  3BY6 A;  3L09 A;  4Y3O A;  2WB1 N;  2P6T A;  1SAX A;  2EFP A;  1Y0U A;  1Z77 A;  2M8E A;  5DCF A;  1IRF A;  1S6L A;  2R7F A;  5JHU A;  1H9G A;  1O7L A;  5H2F C;  1R1U A;  1MSE C;  4I2O A;  2PBI A;  2JMW A;  2QSG X;  4B44 A;  1R23 A;  3ABM H;  1TZL A;  2K7L A;  2COB A;  2F4O B;  3PO3 J;  2E7X A;  1BR2 A;  3B73 A;  4HNV A;  3CCU I;  2HTS A;  1LE8 A;  2YR2 A;  1TWH J;  2KQR A;  1POG A;  4AIJ A;  1D5V A;  3G71 I;  4PFP A;  3D5R C;  4WF2 A;  3NWS A;  2A3S A;  1T39 A;  4PUS A;  1W4M A;  3JCU C; 
#chains in the Genus database with same CATH homology
 5FB2 A;  1T38 A;  2MH9 A;  1OR7 A;  1KYZ A;  2IA1 A;  2XAJ A;  3GW2 A;  3SFZ A;  3MQ0 A;  3RPU A;  4YFX F;  1TBX A;  1FLI A;  2FNP A;  1JHF A;  4XSZ F;  4IJA A;  4EM1 A;  1MKM A;  3DV8 A;  3CO7 C;  1W7P A;  3RIR A;  2Y0M A;  1UHM A;  2K4B A;  5LRR A;  3I53 A;  2B0L A;  5ICC A;  5K5O A;  1PDN C;  4HQM A;  2HDC A;  2OD5 A;  1TLH B;  2EFN A;  1J0R A;  1ZRC A;  2VC1 A;  5D5V B;  1ZRE A;  3COA C;  4YFK F;  2KKO A;  1YO5 C;  3ULQ B;  5HDG A;  1XMA A;  1YW8 A;  4BHP A;  3JAM Z;  3LFK A;  1FSH A;  2D1V A;  4MEX F;  3EYI A;  1QZY A;  2HFH A;  5LLQ A;  3HHG A;  4PGG A;  1HKS A;  3WGH A;  4FX0 A;  3TQN A;  4LJZ F;  1CGP A;  1IXC A;  4EJW A;  1BI0 A;  2GAU A;  3WTU C;  5D6F A;  2QQ9 A;  4WXH A;  1U6G A;  4KYW A;  3J80 Z;  1UHW A;  1O57 A;  2IT0 A;  2PJP A;  4RB3 C;  1Z05 A;  3KP3 A;  1G4D A;  4KUM A;  4HW0 A;  2KRF A;  2Z99 A;  1YFH A;  1U5T B;  2M87 A;  2W84 A;  3PFI A;  4KIG A;  4MQV A;  3KLN A;  3RKW A;  1R1T A;  2MBF A;  1S29 A;  3GZ6 A;  5ICG A;  3WGI A;  3F6O A;  2ESN A;  5CVU A;  1EV7 A;  3M9A A;  4M74 A;  4ENJ A;  1G3T A;  3RKY A;  3T1B A;  4XBF A;  4IVN A;  1W5S A;  1J7K A;  3FMR A;  2K86 A;  2VOP A;  3RYR A;  1IZ1 A;  3IKV A;  4KIC A;  3CJN A;  1DUX C;  2FMY A;  4P96 A;  4OIR F;  4I0B A;  1HXD A;  3TOB A;  1XMK A;  4RGS A;  2STW A;  3N97 A;  1A04 A;  3MAJ A;  2P8T A;  2NAZ A;  3V8L A;  3M8F A;  1IW7 F;  4IRG A;  3I58 A;  2IJL A;  1ZLK A;  1JGS A;  2RV8 A;  4EGZ A;  1AOY A;  3BWG A;  2VN2 A;  4L18 B;  4WK8 F;  2DPD A;  3FHZ A;  2HYG D;  4G94 A;  5AIQ A;  3R60 A;  2DK5 A;  4IXA A;  3VB2 A;  2RNJ A;  1HSJ A;  3HRS A;  5D8K B;  1ZYR F;  6PAX A;  3K1P A;  2GZW A;  2HR3 A;  4GGG A;  4U7B A;  3MFK A;  3QU3 A;  5E1Z B;  4OOI A;  3DQV C;  4P55 A;  3K2Z A;  3F23 A;  1J75 A;  1R00 A;  1KA8 A;  1QPM A;  1SD7 A;  2LNB A;  4EGY A;  5F6F A;  4Q47 A;  5ILU A;  1BOA A;  5F1R A;  2XIG A;  2ACJ A;  2ZNZ A;  3HSE A;  3IL2 A;  2F2E A;  4LLN A;  1U78 A;  1ODD A;  4L5J A;  1OKR A;  2DFI A;  3K0L A;  2ZNY A;  4HZF A;  4RB0 A;  5KVR A;  3LA7 A;  5JFR A;  2OU2 A;  1DPR A;  1GXQ A;  4BHC A;  3HSF A;  5J8F A;  2TDX A;  3SZT A;  1JXS A;  3DXJ F;  4GYI A;  1EH8 A;  1WRJ A;  5IT3 A;  4BNC A;  1L3L A;  4BXU A;  3MEX A;  1DP7 P;  2XAG A;  1FT9 A;  3ZMD A;  1W5T A;  4A5N A;  5D4S A;  3WOD F;  2FRH A;  2O0Y A;  3ZMS A;  2CO5 A;  1ON1 A;  3EUH A;  5K5R A;  2DI3 A;  3E5U A;  4OIN F;  1GXP A;  2M1B A;  1LEA A;  3V7C A;  4EM0 B;  1U5T A;  3KZZ A;  5DV5 A;  1IN4 A;  1BN5 A;  3H3U A;  4I98 B;  3G73 A;  4TV7 A;  2EB7 A;  2HQR A;  3KP6 A;  4KA4 A;  4ENN A;  2VT3 A;  2RQP A;  1FWZ A;  3L00 A;  1P92 A;  1KGS A;  3LAP A;  2EK5 A;  3E97 A;  2EV0 A;  2BBY A;  2DU9 A;  1IF1 A;  2ZFW A;  3PQK A;  1OYW A;  4U0W A;  1K6O A;  3VOD A;  5D5U B;  3DKW A;  4A0X A;  2EA4 A;  2HGC A;  1SD5 A;  2CFX A;  2DK8 A;  2ZBK A;  2H27 A;  1TW2 A;  1ZG5 A;  4YII A;  2C6Y A;  3IC7 A;  2ZJ2 A;  4NB5 A;  3CUQ B;  2DTR A;  2Z33 A;  5CVV A;  3BDD A;  2A6E F;  2D45 A;  3REO A;  3BRO A;  4MTD A;  5CVR A;  1KQ0 A;  1E17 A;  3HSR A;  1DDN A;  2QM3 A;  1FZP B;  2FF4 A;  4IHT A;  1YW9 A;  4FT8 A;  2MA3 A;  3ML6 A;  2CQK A;  3CLO A;  5TJJ A;  1TQM A;  2H6B A;  2IP2 A;  3BJ6 A;  4WWC A;  4D0P A;  3GEZ A;  5DDG A;  3ZQ7 A;  4KMU X;  2ISY A;  2O8X A;  3EET A;  4BQA A;  4LK1 F;  1B6A A;  1MJ9 A;  4A0Y A;  1U2W A;  1O3S A;  1HW5 A;  2QEN A;  4OMY A;  1GHC A;  3FM3 A;  3F8B A;  1J5Y A;  1VTN C;  3GFL A;  3V4G A;  3LA2 A;  3HTS B;  1YW7 A;  1ZH5 A;  2FBH A;  4MNU A;  4M72 A;  5E1X A;  4HLY A;  2XKP A;  2JPB A;  4NQW A;  3F21 A;  4BHB A;  4GCV A;  2W25 A;  2ZME B;  4I7H A;  2PEX A;  5AIP A;  1XDU A;  3JSP A;  2WWY A;  2HQN A;  1IN7 A;  3F8C A;  1EH6 A;  3ZN1 A;  1E2X A;  4JK1 X;  2HEO A;  5HS9 A;  1CF7 A;  1R1V A;  4ESJ A;  4HX8 A;  4L0Y B;  3Q5F A;  4XLP F;  1WKM A;  1BIA A;  2STT A;  2XUB A;  2RN7 A;  4EVI A;  5BS6 A;  5LGU A;  1H0M A;  2GA2 A;  5HOO A;  2V1X A;  1NHA A;  2ZO4 A;  3N4M A;  2X4H A;  3MCZ A;  1RIO H;  1KQ9 A;  2XAF A;  1UFM A;  1K7A A;  2Q8K A;  3V8J A;  2P4W A;  3R6S A;  4N9I A;  5ILS A;  4UNO A;  3ZPL A;  5E20 A;  5LGT A;  3WTV C;  4UVC A;  3E6C C;  3L2C A;  2X0L A;  5LEK A;  3P9C A;  1XGN A;  1I5Z A;  2A5Y B;  2FXA A;  2F5C A;  3CUQ A;  3LST A;  4HLX A;  5EEG A;  1G3Y A;  4ENK A;  1R5G A;  4LK0 F;  2QLZ A;  1YQA A;  4AWX B;  1WWX A;  3EDP A;  4LGW A;  1T6S A;  5CVI A;  3TDZ C;  4A2U A;  5H20 A;  3LQQ A;  2DBB A;  2JPC A;  5BMZ A;  3I54 A;  3L9F A;  3E6B A;  1BBY A;  1B4A A;  1XN7 A;  4EJV A;  4UVB A;  3F3X A;  1PUE E;  4CHU A;  2GWR A;  4A0Z A;  3J81 Z;  3QP5 A;  3J7A O;  3JW4 A;  4CDG A;  5JVT A;  4HV5 A;  4KNY A;  3DEU A;  4MQ9 F;  5FD5 A;  1HBX G;  3GO5 A;  1T0F A;  4CYD A;  1FC3 A;  2LKP A;  1Z7U A;  1LEB A;  5L3G A;  4HAM A;  1QNT A;  1FP2 A;  2HZT A;  1X3U A;  3GXO A;  5A2Q Z;  3DPL C;  3BJO A;  2QQA A;  1REP C;  2ZME A;  5JI6 A;  5FLX K;  2XRO A;  4AIH A;  1IN8 A;  2JRT A;  1BC7 C;  3HOT A;  3IWZ A;  3I59 B;  3D5L A;  2LDU A;  5LHI A;  3GFJ A;  5K5Q A;  1QBJ A;  3DPT A;  2L4A A;  4ENM A;  4HX4 A;  3WTS C;  1IN6 A;  1YS6 A;  5E18 F;  4HOB A;  3KEQ A;  2CGP A;  2VON A;  1U3E M;  3ZP5 A;  3FXQ A;  3I64 A;  2ELH A;  1FYL A;  5LBQ A;  3IHU A;  4UV8 A;  3HYI A;  2CSO A;  3M1E A;  2VT2 A;  2KJB A;  3WTX C;  4CIC A;  3HIF A;  2EFQ A;  4QWQ A;  5AON A;  2YSR A;  3MZH A;  1F9N A;  1EH7 A;  4JQF A;  3RI4 A;  2DPU A;  2HS5 A;  2IA2 A;  2V9V A;  1MZB A;  2K4J A;  1Z6T A;  5L3F A;  3FMQ A;  2VOO A;  1BI3 A;  2P5V A;  2FA5 A;  4ASN A;  3ECO A;  2DW4 A;  3QPH A;  4BH9 A;  1XDS A;  1SMY F;  3ISP A;  5CLS A;  3Q9S A;  4B09 A;  2XHK A;  2W57 A;  2P7V B;  1LVA A;  4AVP A;  1Z9C A;  4KN4 X;  4RGU A;  2VE8 A;  3B02 A;  5CJ9 A;  1UB9 A;  2OAZ A;  3FMS A;  1MJA A;  1OYY A;  2L02 A;  3U2R A;  3I0T A;  4AD9 A;  3WTT C;  1FX7 A;  2G7U A;  4CZZ A;  2PG4 A;  1S7O A;  2M30 A;  5D8L B;  1J59 A;  5E17 F;  1IXS B;  4CXF A;  3M8E A;  3D0S A;  5ICF A;  4E70 A;  1XCV A;  3K1N A;  4R8H A;  1BM9 A;  1FNN A;  4N0B A;  1ZLJ A;  2QZ8 A;  3CDH A;  1P4X A;  2MD5 A;  4MEY F;  4HDU A;  3V8K A;  4GYG A;  1O3T A;  2MLK A;  3HRT A;  3GYH X;  2OZ6 A;  2NNN A;  4KDP A;  2VOD A;  2NS0 A;  3HUG A;  2EFO A;  3ERE D;  2W24 A;  1F5T A;  2ESH A;  3O2P E;  5HLI A;  2XVC A;  1BC8 C;  5FO5 A;  2VBZ A;  2JT1 A;  4LG0 B;  1FY7 A;  5LGN A;  2DQR A;  4IRH A;  3SXY A;  1P4W A;  5DUI A;  1R36 A;  4GO1 A;  2W85 A;  4ESF A;  2FU4 A;  4ZYE A;  2Q2E A;  1D8K A;  1R22 A;  1FBQ A;  4YG2 F;  2L3D A;  2CYY A;  1ONV A;  2XV4 S;  3RPQ A;  3I59 A;  2XGX A;  3TO7 A;  1ZAR A;  1G3S A;  4KT5 C;  1KQ8 A;  2FQ3 A;  3VFZ A;  4A12 A;  2RDP A;  5CVJ A;  4RGX A;  3JTH A;  1YG2 A;  4S04 A;  2WC2 A;  2OQR A;  3WE2 A;  3LWF A;  3K69 A;  3QRF F;  4P5O A;  2V1U A;  2Y48 A;  1LQ1 A;  3RYP A;  3QPT A;  3OOP A;  4H0E A;  2EJR A;  2BEO A;  1S7A A;  4M6X A;  1ZRF A;  1T98 A;  4RAZ A;  4XRF A;  2FBK A;  4M6Y A;  4GXO A;  3E5Q A;  3IRR A;  2FE3 A;  4L5I A;  3V7R A;  1WSU A;  1TQP A;  3VOE A;  3SZP A;  3RTR A;  1AWC A;  1BIB A;  2E7W A;  1RNL A;  4S05 A;  4HA8 A;  2O6G E;  2MLG A;  2IPQ X;  3J81 K;  1FYM A;  4L0Z B;  1STZ A;  4LB6 B;  5KK1 A;  5DD8 A;  3WU0 A;  1QO0 D;  5D6E A;  2MH2 A;  2YX7 A;  3JAM K;  3E6M A;  5D5X B;  1LJ9 A;  2ZCW A;  2BGC A;  1PP7 U;  3ZMU A;  4EQQ A;  5ERI A;  1ZGJ A;  1FYK A;  4EJU A;  4ESB A;  4I01 A;  4UUV A;  3DF8 A;  3U1D A;  2OBP A;  4OIO F;  2VBX A;  3ZMV A;  2EA2 A;  4G6Q A;  1ZG1 A;  4ZZD A;  2G7H A;  1MGT A;  3I4P A;  2O03 A;  2VE9 A;  1O3R A;  2E1C A;  4LG0 A;  3WTW C;  3J80 K;  1JHH A;  4ZZL A;  3G3Z A;  2COM A;  1D8J A;  4HF0 A;  2NYX A;  3K1M A;  3H3Z A;  2PLY A;  4KMF A;  2OA4 A;  2O61 A;  3E3V A;  1MDM B;  2L54 A;  4PCQ A;  3HRU A;  4O6J A;  5H6R A;  2EFW A;  5DCM B;  4M71 A;  2F5D A;  3W6J B;  3TGN A;  2OQG A;  5CYV A;  3U9G A;  3BPX A;  4P9F A;  3T0Y A;  4BYY A;  4LLG F;  5HDK A;  4A6D A;  2R3S A;  3L7W A;  4MGR A;  1IXR C;  1GVJ A;  4FX4 A;  1QZZ A;  2HOE A;  3SQN A;  1U5T C;  4Y15 A;  1KU7 A;  3RKX A;  1SFX A;  3EYY A;  3KEO A;  2BV6 A;  2H09 A;  1QGP A;  5IT9 Z;  1B9N A;  4MTE A;  1OYI A;  4KIF A;  2XAS A;  3GFM A;  4MHG A;  3QAH A;  3ZN0 A;  3RDI A;  2WV0 A;  1I1G A;  5DEQ A;  1I27 A;  3F22 A;  2HTJ A;  1G3W A;  1YLF A;  4EJO A;  3M7G A;  3F8N A;  1LDD A;  5FGM A;  4LLL A;  1K79 A;  1K78 B;  2XAH A;  3TO9 A;  3OV8 A;  2YU3 A;  2PQ8 A;  3ECH A;  3TO6 A;  3R0A A;  2K02 A;  4Q4Z F;  4WXD A;  1HQC A;  3LA3 A;  2CWE A;  2RKH A;  4KFC A;  1SFE A;  3GX4 X;  1WI9 A;  5L3C A;  1LNW A;  5E8G A;  2DO7 A;  3PQJ A;  2Z3Y A;  2GA1 A;  1L0O C;  5FD6 A;  2E1N A;  3WTZ A;  2UWM A;  2D1H A;  4ZH4 F;  4IHS A;  4XSX F;  4LMY A;  1RUN A;  1XD7 A;  3QP6 A;  3VEP A;  1SFU A;  3P9K A;  2QUF A;  1HKQ A;  1B59 A;  4IF4 A;  2XAQ A;  5LRS A;  2CW0 F;  2KIF A;  1XGO A;  2GIV A;  4P9U A;  1ZGA A;  2M5W A;  2AXL A;  1U8R A;  1IUY A;  2PMU A;  1USS A;  3ZMT A;  1RZ4 A;  4U7D A;  4OIP F;  2LF8 A;  5F64 A;  4Q48 A;  2PI0 A;  4K2E A;  1I6X A;  2G9W A;  3IKT A;  5ILV A;  4ETS A;  4HF2 A;  1TQI A;  1S3J A;  1BI2 A;  2IRF G;  2JSC A;  5DUK A;  4G8X A;  4JBA A;  3C7J A;  1MDM A;  4WCG A;  3KP4 A;  3NEU A;  2FEZ A;  4WXC A;  3F8F A;  5DCM A;  3TKY A;  3WE3 A;  3BP8 A;  3R4K A;  3GVA A;  3E5X A;  1V4R A;  2HYF A;  3T8T A;  5D5W B;  3F72 A;  4UXN A;  4F7Z A;  1ZRD A;  4RB1 A;  1LDK B;  5ICE A;  3KP7 A;  4I02 A;  1C0W A;  4RGR A;  4M73 A;  4ZYD A;  3FZV A;  1G6N A;  2BE5 F;  2FOK A;  5LHH A;  1WQ2 A;  3KP2 A;  3KET A;  1TNT A;  3R0J A;  4Y17 A;  4XLN F;  3FXU A;  2NRA C;  2RC4 A;  3HHH A;  3SHF A;  2WTE A;  1JE8 A;  2RGV A;  1MD0 A;  4HBL A;  2QBY B;  2K27 A;  5HLG A;  4KN7 X;  4G7H F;  3RJP A;  1O3Q A;  1YS7 A;  1Z91 A;  4L9J A;  1HST A;  1K78 A;  1DPU A;  2IVM A;  4HDV A;  3O6B B;  1ZN2 A;  4U0V A;  2R7D A;  1XCB A;  3ABT A;  1UCR A;  3HOS A;  4HYE A;  4DNC A;  3GUD A;  2ISZ A;  1TW3 A;  2J5O A;  4NHJ A;  2XRN A;  3TOA A;  1RI7 A;  4R79 A;  1TNS A;  1O7F A;  1XGM A;  3CUQ C;  3H92 A;  1P2F A;  4HF1 A;  2ZXJ A;  1FBU A;  4PZJ A;  3TDU C;  5DYM A;  2RVC A;  5EEH A;  2FBI A;  2PMH A;  4PGH A;  2LSO A;  2M45 A;  4L9N A;  3T8R A;  4CO8 A;  1YTY A;  3ELK A;  4Y13 A;  4N9H A;  1B1B A;  3LAJ A;  1ZG3 A;  3GZ5 A;  5ED4 A;  3DP7 A;  4Z2Y A;  3P7N A;  2Z9O A;  2ZKZ A;  2V79 A;  3GWZ A;  4YFN F;  1B9M A;  1KYW A;  3IWF A;  3KCC A;  4Q5S F;  2HWV A;  2DLL A;  1BJA A;  1T2K A;  3E6D A;  5BPI A;  3CTA A;  1HW1 A;  2FSW A;  2IW5 A;  2PFB A;  3I71 A;  2GXG A;  3ZMZ A;  2KIM A;  1UST A;  2ADU A;  2EV5 A;  5J6X A;  5D4R A;  1Q1H A;  1XGS A;  2DQL A;  4L9V A;  5E8I A;  2A68 F;  1XSX A;  5BOX A;  4AIK A;  2UXN A;  2GXB A;  2PN6 A;  4OU0 A;  1MJB A;  3WU1 B;  4OIQ F;  2JZY A;  5IT9 K;  4G7O F;  3R61 A;  4M9S A;  4RB2 C;  2F5E A;  4G9Y A;  4LD5 A;  4A6E A;  1ON2 A;  2QQB A;  1PP8 F;  4HV6 A;  1S8N A;  1SD4 A;  3JSO A;  5TRD A;  1J9I A;  2Y75 A;  2UXX A;  3FWE A;  3MWM A;  4CGZ A;  5HLH A;  2CG4 A;  2VC0 A;  2KIU A;  4U88 A;  3LQR A;  1FBS A;  2L01 A;  3P9I A;  2A61 A;  2Z5U A;  4M9X A;  3I5U A;  2F5F A;  3GF2 A;  3GFI A;  4M9Z A;  2HKX A;  3IRQ A;  4KIB A;  2GQQ A;  3S2W A;  1XSV A;  1OMI A;  1LDJ A;  1KU2 A;  1KU3 A;  2QBY A;  5H6Q A;  2J5P A;  3MZY A;  1CF7 B;  2P7C B;  4PDK A;  5HS7 A;  1ZHF A;  5HVQ C;  4UVA A;  4IPA A;  2H94 A;  5L3E A;  4HQE A;  5FLX Z;  1I1S A;  3C1D A;  1SMT A;  3F8M A;  1Z1D A;  3K9T A;  1ULY A;  2QYO A;  2ETH A;  3KZY A;  3WTY C;  3CO6 C;  3KE2 A;  2NNY A;  4BAY A;  3AAF A;  4EM2 A;  5HS8 A;  5BPD A;  2EWN A;  2Q0O A;  3NQO A;  2P5L C;  3O3K A;  4EMS A;  1F4K A;  2V6C A;  2FNA A;  4LB5 A;  3GLX A;  3FF5 A;  4I0A A;  1H9T A;  1V3F A;  4YIF A;  2HKO A;  1XB4 A;  5A2Q K;  5K1Y A;  2VBW A;  5FFX A;  2YX4 A;  1BI1 A;  4HX7 A;  5HDN A;  4O5V A;  3DFG A;  4QLC U;  3WGG A;  1YYV A;  2DAO A;  3F6V A;  2O3F A;  3BPV A;  5BQT A;  4ON0 A;  1ZAO A;  4WX9 A;  2QWW A;  2XKO A;  1W7P B;  5LHG A;  2DT5 A;  4O3M A;  2P6S A;  1HKT A;  4B8X A;  4FHT A;  1Z6R A;  3BOQ A;  1YIO A;  3FM5 A;  1HW2 A;  2EV6 A;  2P5K A;  4OMZ A;  5DD4 A;  3NRV A;  1R7J A;  1FPQ A;  1FSE A;  4DQ2 A;  2A6H F;  2VXZ A;  3KFW X;  4EJT A;  1RUO A;  2VBY A;  2LF7 A;  4G6D A;  1P6R A;  1IN5 A;  1TTY A;  1QQI A;  5E1W A;  1LB2 A;  5L3D A;  5JR3 A;  4EV0 A;  1W7P D;  4IRI A;  5L3B A;  2H6C A;  4U0Y A;  1IAW A;  1IRG A;  2KJC A;  1F1Z A;  1FOK A;  5J8C A;  3C18 A;  3FX3 A;  2UZK A;  4UHT A;  2BYV E;  3HRM A;  4RS8 A;  1OPC A;  2A69 F;  1J2X A;  3CUO A;  2V1D A;  1KU9 A;  2IA0 A;  2YPR A;  3EQL F;  2L4M A;  1P4A A;  4G7Z F;  3BJA A;  3Q9V A;  1R5H A;  4L9T A;  3BZ6 A;  3ABU A;  2D2W A;  3ROU A;  4R1H A;  2FML A;  1XSD A;  3T5X A;  4A5M A;  4RAY A;  3WG9 A;  4ZYH A;  2MC3 A;  3W6K B;  5LEJ A;  3HTU A;  3JTG A;  3QOP A;  2JTV A;  2AS5 F;  1FP1 D;  1R58 A;  2OZU A;  1D3Y A;  1SD6 A;  3QU6 A;  5FFZ A;  4LFU A;  4I09 A;  3V7S A;  4ZYG A;  3KLO A;  3KP5 A;  2QVO A;  3FXR A;  4UV9 A;  3C3W A;  2A07 F;  3BY6 A;  3L09 A;  1SAX A;  2P6T A;  2EFP A;  1Y0U A;  2M8E A;  5DCF A;  1IRF A;  1S6L A;  2R7F A;  5JHU A;  1H9G A;  1O7L A;  1R1U A;  4I2O A;  2PBI A;  1R23 A;  2K7L A;  2E7X A;  3B73 A;  2HTS A;  2YR2 A;  4AIJ A;  1D5V A;  4WF2 A;  2A3S A;  1T39 A;  1W4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...