1FLIA

Dna-binding domain of fli-1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords FLI-1
publication title Solution structure of the ets domain of Fli-1 when bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1994-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fliA00
3K0LA 5DUIA 1R7JA 1ZG5A 3DV8A 2VBYA 2PI0A 4RB0A 3FMSA 1B4AA 3WTXC 4KIGA 2DO7A 4XBFA 4A2UA 1TNTA 1MZBA 2LF8A 3H3UA 3I64A 3VB2A 2DW4A 1YS7A 2D1VA 4KN4X 3T8RA 3ABUA 1FP1D 3T1BA 2D2WA 1IN7A 1Z1DA 1S7OA 2AXLA 3RYRA 3BROA 1R1TA 4HX7A 3KEOA 1L0OC 3K1PA 2NAZA 2FF4A 3JTGA 3FF5A 4IXAA 4YG2F 1USSA 2GZWA 3LSTA 2P5VA 4LLNA 1B1BA 5L3GA 3M8EA 2K86A 5HS7A 3ZQ7A 4BQAA 1YQAA 3TOBA 1XDSA 1BIBA 5ILVA 2FXAA 4OIQF 3QOPA 1B9NA 1WQ2A 2PBIA 3KETA 4HX8A 2PG4A 4IF4A 2DAOA 1XMAA 5L3EA 3WG9A 2QBYA 1UCRA 3FX3A 4ESJA 1IXRC 2WC2A 5KVRA 3NRVA 2KIMA 5DD8A 1G3YA 1FP2A 1W5SA 3TGNA 3TKYA 4MEYF 3ECHA 1LVAA 3W6KB 4ZZLA 2J5PA 4L9VA 4XSZF 4YFNF 3RIRA 3MZYA 5E1WA 4DNCA 1ZHFA 2FSWA 3D0SA 4I0BA 4XRFA 3BDDA 4ENNA 1IXCA 2VOOA 2HGCA 3VEPA 4F7ZA 1QQIA 1OR7A 2VXZA 3WTYC 3P9CA 4UV9A 1V3FA 3ISPA 3FHZA 1YG2A 3LA3A 2IW5A 5E20A 3WTTC 4Y13A 3KZYA 4JK1X 3F8BA 3H92A 4M9SA 2ISZA 1JHHA 2EA4A 3V8KA 5FLXK 2A68F 3HRTA 1K7AA 3C1DA 2YX4A 5BOXA 3BJAA 1XGNA 3F3XA 1S8NA 3R0AA 1VTNC 2RQPA 2EFNA 5LRRA 4MGRA 3QAHA 4O6JA 1G6NA 1IZ1A 2VBWA 1UB9A 2E1CA 4KYWA 4WXCA 4L9TA 2QQAA 2YU3A 3GFIA 1LQ1A 1IAWA 1BI2A 4BHPA 4EM1A 3BY6A 3ELKA 1O7FA 4U0YA 1SD7A 4B09A 3RJPA 2FMYA 2A5YB 3I59A 2W84A 3HUGA 2DQLA 3COAC 3RTRA 1O3RA 1B59A 1G3WA 2JZYA 4P96A 1FSHA 5JR3A 5F64A 1SFUA 1HSJA 2JSCA 2NNNA 1AOYA 3CTAA 2XAQA 5F6FA 1FYMA 4M71A 4CHUA 1I1SA 1PDNC 3SHFA 4OINF 1UFMA 1DPRA 1I5ZA 2EK5A 5IT9K 2EFPA 2DQRA 2GWRA 1FT9A 5K5OA 5JFRA 4FX0A 5EEGA 4E70A 3TDZC 4UVAA 1FYKA 3IKVA 4HF2A 5CVVA 2OA4A 2CGPA 4DQ2A 4PZJA 2UXXA 3LA7A 2YX7A 5HVQC 5IT9Z 1YW9A 4WF2A 3HSEA 3EUHA 1ZLKA 3J7AO 2R7DA 1ZYRF 2K7LA 4A0ZA 1ZN2A 3QPTA 3NQOA 2XAFA 2Z5UA 1PUEE 4EM0B 2XASA 2YR2A 4U7BA 3T8TA 5BS6A 4IRGA 4L18B 3P7NA 2XIGA 2OZ6A 4BH9A 1KQ9A 3FXRA 2CYYA 5L3BA 1P92A 4EJVA 4IRHA 3C7JA 2UXNA 4ZYHA 1MGTA 2LDUA 2XGXA 5DDGA 1JGSA 4P9FA 5J6XA 2QLZA 1GXPA 2H27A 3EETA 1FYLA 5LHIA 4RAZA 4RS8A 1XCBA 4ZYGA 2PLYA 4L9JA 3LAPA 3GEZA 1SD4A 5HS8A 1BC8C 1R22A 1BIAA 3ZMSA 5E1ZB 3TQNA 4EM2A 4LB5A 3FMRA 1T98A 3V7RA 4WCGA 1I1GA 3VOEA 1KU2A 2V6CA 1HKQA 3WTUC 1H9TA 1SFEA 4KUMA 3HYIA 3SQNA 4YFKF 2IA1A 3ZMVA 4HQMA 2B0LA 2WTEA 2A6EF 3F8FA 3QP6A 3N97A 3QP5A 5DCMB 5A2QK 1YLFA 2QZ8A 1LJ9A 4LK1F 4BHCA 2XAHA 4LLLA 2ZFWA 1KGSA 1T0FA 1SMYF 4HW0A 3WGIA 4MNUA 5HLGA 1LDKB 2XKOA 4RAYA 1TLHB 4ZH4F 3J81K 2VC0A 5E1XA 1DUXC 3BOQA 5ICGA 3HSRA 2L4AA 5A2QZ 3CUQB 3ZP5A 3EDPA 2GQQA 4U88A 4KN7X 4Q48A 1IN5A 3CO6C 1UHMA 3GZ5A 5LGUA 3F8CA 4CDGA 3SZPA 1KYZA 3DF8A 5D8KB 3B73A 3J81Z 5HDKA 4IHTA 4M9XA 4LGWA 1IUYA 2IA2A 3VODA 2A07F 1KU9A 1Z7UA 1RNLA 1YYVA 3K2ZA 1IN4A 3F6OA 1FY7A 3J80Z 3L2CA 3WE3A 1LEAA 1RI7A 4JBAA 1JHFA 4BXUA 3GVAA 1MJBA 4BAYA 2FNAA 2D45A 1H9GA 1H0MA 1IN6A 1SD5A 1XSVA 2IPQX 4EMSA 4OMZA 2HYFA 1S7AA 4PGHA 2JRTA 3R0JA 2ZKZA 4G6DA 5L3DA 5D5UB 2HKXA 1QNTA 4LK0F 2FU4A 2MH2A 3ERED 4M9ZA 2DBBA 2VE8A 4L0YB 1RUOA 3QU3A 5AIPA 3S2WA 4Q4ZF 1V4RA 4N9IA 1FOKA 3KFWX 4HF1A 2ELHA 4MEXF 3HIFA 3GFLA 2VBZA 4I2OA 4PCQA 2KIFA 2M87A 2V1DA 2M1BA 5K5RA 2XRNA 4MTEA 2BE5F 3GLXA 4G7ZF 4LJZF 1D8JA 3FM5A 4L0ZB 5D8LB 4UV8A 4UXNA 3Q9VA 3IKTA 2QBYB 4I98B 2FNPA 1GVJA 4ZZDA 4CICA 1R36A 2FRHA 2BV6A 1O3SA 1U5TC 1OKRA 5TRDA 2XAJA 4FHTA 2QM3A 1Z05A 3KLOA 5FD5A 2C6YA 3Q5FA 3JSOA 5D4SA 4I09A 5E8IA 3U1DA 2HDCA 2GAUA 2M45A 1SD6A 4K2EA 5HDGA 5ICCA 3V8LA 2CW0F 1EH7A 2W57A 3I4PA 3MAJA 3RPUA 2DK8A 2XROA 5H6QA 4M73A 2L01A 1YO5C 1XN7A 1RZ4A 2PJPA 3E6MA 1UHWA 4OIOF 1J0RA 1OYWA 2HFHA 3M8FA 3SFZA 1XSDA 2OAZA 3CJNA 1FZPB 2IRFG 5E18F 5D5VB 4HZFA 5TJJA 1HQCA 3LQQA 3EQLF 4RB2C 1QGPA 3V4GA 2DTRA 2AS5F 2Z3YA 1DDNA 3KEQA 3HSFA 1O7LA 4EV0A 1J59A 1KA8A 2EFOA 2ETHA 2F5CA 2HQNA 1J7KA 3H3ZA 2MLKA 2GA1A 4G6QA 1FC3A 2KIUA 2RKHA 4WXDA 4YIFA 5K1YA 3JAMK 3TO6A 3KP3A 3HTSB 2H6CA 4O5VA 4MQ9F 2VT2A 4ENJA 1F5TA 1KQ8A 3IL2A 5FGMA 5H20A 1ZRDA 2XV4S 5LEKA 4JQFA 2O6GE 1G4DA 3OV8A 1PP8F 2HEOA 3I59B 1O3QA 5DV5A 3D5LA 2ZCWA 3R6SA 1XB4A 3FXQA 2RV8A 2FBIA 4GXOA 1LEBA 2DLLA 3JAMZ 2Y75A 2LSOA 5HS9A 5LEJA 4KIBA 5FLXZ 1BI3A 1REPC 3E97A 4N9HA 3IRQA 3DKWA 3FZVA 1FNNA 2L54A 3WODF 2K4BA 1RUNA 3BJOA 1HSTA 3F72A 2Z9OA 2W25A 3ZMZA 1I27A 1FBSA 2EV6A 4Z2YA 2PN6A 4G9YA 4I0AA 4NB5A 4ENKA 1R58A 3RKYA 1YFHA 4KDPA 3RI4A 2MA3A 4I02A 1YIOA 3IWZA 1XD7A 1DPUA 5CVUA 4AIJA 5HLIA 2NYXA 5FB2A 1ZG3A 5BQTA 4RB3C 4MTDA 3L00A 3T0YA 2FBHA 2EWNA 1O3TA 3LAJA 4BNCA 3DXJF 3IRRA 4P9UA 4XLPF 2EA2A 4P55A 3CUOA 2K27A 4LB6B 1F1ZA 2EFWA 5KK1A 4YIIA 5FFZA 4AWXB 5CVIA 1JE8A 2IA0A 1U5TA 4A12A 2RVCA 4RGRA 1HKTA 3ZMUA 2CQKA 3MEXA 4QLCU 3KP2A 3MCZA 3BPXA 2A61A 5CJ9A 2YSRA 4KMUX 4ASNA 2UZKA 2BBYA 1KU3A 2PQ8A 2OBPA 4RB1A 1LNWA 3RKXA 3BWGA 3CDHA 3JW4A 1T38A 5LHGA 2WV0A 2KJBA 1SMTA 4HDVA 2OQGA 2P6TA 3RDIA 4ESBA 4LFUA 1IRGA 4H0EA 1YW8A 3L09A 3RYPA 2VN2A 2QYOA 3RKWA 2NRAC 5ED4A 2G7UA 1OYIA 2VBXA 2V1UA 1U6GA 2MBFA 1BI1A 5IT3A 3KP6A 1A04A 1P4XA 4RGUA 4KICA 2FQ3A 4KT5C 1W4MA 3ZN1A 2MLGA 1D8KA 3DEUA 2O61A 1XGMA 1TBXA 2Z33A 2RGVA 1EV7A 4KNYA 3F22A 2F5DA 4U0VA 4RGXA 1TTYA 4Q5SF 3OOPA 2X0LA 5DCFA 3E6DA 1K79A 3DP7A 2ESHA 3WTVC 1MDMA 4ZYDA 4IPAA 4Y15A 3E3VA 3QPHA 2QQ9A 1BI0A 4NHJA 4HLXA 2DI3A 2FA5A 4HF0A 2R7FA 1QO0D 2XVCA 3DQVC 2HQRA 1U8RA 2HTJA 3KP7A 3R60A 2P5KA 3KP5A 3HHHA 3CLOA 4G94A 5JI6A 1BBYA 1TQPA 4M6YA 4G8XA 4CO8A 2ESNA 5FFXA 2DPUA 1R1UA 5D5XB 2QUFA 2HZTA 3M9AA 4HDUA 3I58A 1WI9A 2J5OA 1J5YA 4A5MA 1W7PB 3GUDA 2BGCA 4WX9A 1R23A 1G3TA 4EQQA 3ECOA 3U9GA 1WSUA 4HQEA 4S05A 4KFCA 4WXHA 1Z9CA 5D6FA 4AD9A 2RN7A 1FLIA 4KIFA 1X3UA 1QZZA 2BEOA 3CO7C 2D1HA 4HV5A 1ZARA 1Y0UA 2DPDA 2VE9A 4XSXF 3P9KA 2CO5A 2MD5A 3WGGA 2M8EA 1J2XA 3WGHA 4RGSA 2F5EA 1W7PA 2UWMA 2CFXA 4D0PA 1R5HA 1E17A 2KKOA 3ZPLA 2ZO4A 3U2RA 4GYIA 1ZRFA 3KZZA 3GFMA 2A3SA 5D5WB 1G3SA 1K78B 2O8XA 4L9NA 3O3KA 3QU6A 1LDDA 2ZJ2A 3GXOA 3ZMDA 4L5IA 1XGSA 4OIPF 5E17F 3HOTA 2GXBA 4LMYA 2G7HA 1MJAA 1MD0A 2P7VB 4GO1A 3VFZA 5DUKA 1TQIA 2GIVA 4EGZA 1HW5A 1FSEA 2ZNZA 3JTHA 4ETSA 3ML6A 3O6BB 2XAGA 2XKPA 2P8TA 1RIOH 4TV7A 2OD5A 1Z6RA 5AONA 1T39A 2QQBA 1IW7F 1FWZA 2HR3A 2G9WA 1K78A 2K4JA 2Q8KA 4EJWA 2FOKA 3I53A 3T5XA 3QRFF 4CGZA 1F4KA 4EJUA 2Y48A 5DEQA 1HBXG 1BC7C 2YPRA 1S3JA 2F2EA 4S04A 5HLHA 2K02A 2KJCA 3M1EA 2DFIA 3B02A 4R1HA 1IRFA 2HWVA 1ZREA 1HXDA 1FBQA 3E6BA 1QZYA 2LKPA 1WKMA 4HBLA 1FX7A 4R8HA 1R1VA 4AIKA 5ILUA 2Q0OA 2W85A 5JVTA 4O3MA 2KRFA 1HW1A 2LF7A 5CLSA 3JSPA 1ZG1A 3R61A 1U2WA 4LG0B 1ON1A 4CZZA 4WWCA 3KCCA 2ADUA 4L5JA 1BN5A 1ODDA 2A6HF 1B6AA 1S29A 4KA4A 2QWWA 2V1XA 1B9MA 2E7WA 3F23A 1L3LA 1EH6A 4HOBA 2R3SA 3TO7A 5FO5A 4LG0A 3WTWC 1KQ0A 4EJTA 3WU0A 2LNBA 3SZTA 3C18A 2EV5A 2F5FA 3FXUA 2P4WA 4MQVA 2VODA 1R00A 1QBJA 2STWA 4G7OF 2EJRA 3LA2A 5BMZA 4WK8F 2RC4A 1FPQA 4YFXF 3PFIA 5EEHA 4QWQA 2IT0A 2HS5A 2W24A 2HOEA 1U3EM 2TDXA 4OU0A 5LGTA 1ZRCA 4A0YA 5HDNA 3GW2A 2HYGD 2QVOA 4LD5A 4M74A 5L3CA 2P6SA 5ILSA 1OYYA 1J75A 2ZBKA 1ZH5A 3GYHX 3IWFA 1ZGAA 1OMIA 3V8JA 2PMHA 4XLNF 4P5OA 2FEZA 3HRSA 1ZLJA 1Q1HA 2OU2A 4M72A 1XSXA 4MHGA 4B8XA 4Y17A 4AVPA 3ULQB 1GXQA 4ESFA 1XGOA 5DD4A 5AIQA 2PFBA 3O2PE 3WTZA 1EH8A 3GWZA 3V7SA 4I01A 4R79A 3F8MA 3TDUC 1TNSA 2GXGA 3C3WA 2HKOA 2Z99A 1IXSB 3K69A 1W7PD 1MJ9A 1CF7B 4EJOA 4PGGA 4A6DA 4EVIA 3LFKA 1ULYA 1C0WA 1E2XA 3BPVA 1STZA 1OPCA 1BM9A 2FE3A 2L4MA 3MZHA 1LDJA 4GCVA 2EB7A 3FM3A 5J8CA 5D6EA 3LQRA 1U5TB 2H94A 4Q47A 2ZMEB 1KU7A 2M5WA 1P6RA 5CYVA 1O57A 3PQKA 2X4HA 2FMLA 3IC7A 5LRSA 1CF7A 1XCVA 5ICEA 2IP2A 4NQWA 1XMKA 4HAMA 1YS6A 2EV0A 2MH9A 2RDPA 4HX4A 1YTYA 2P7CB 2L02A 1F9NA 1WRJA 3HTUA 2IVMA 1P2FA 1W5TA 1T6SA 1YW7A 4M6XA 1NHAA 2XUBA 2ZMEA 3BP8A 2P5LC 1QPMA 2IJLA 3ROUA 3E5UA 3L7WA 3CUQC 3GF2A 2VONA 3HHGA 1DP7P 5JHUA 4IRIA 5BPIA 3TO9A 2JPCA 1JXSA 1SFXA 2Y0MA 3F8NA 1Z91A 2V9VA 5DYMA 1HKSA 4IHSA 5HOOA 3F21A 2COMA 3L9FA 1IN8A 3K1MA 3KE2A 4IJAA 1LB2A 1TW3A 1XDUA 3DPLC 3M7GA 3GZ6A 3Q9SA 3N4MA 2JTVA 4ZYEA 4CXFA 1MDMB 1P4WA 4U0WA 1CGPA 3HRUA 5E8GA 2O03A 3E5QA 5ERIA 5CVRA 3P9IA 5LLQA 4BHBA 4FT8A 3HOSA 1IF1A 3I0TA 1BJAA 1D3YA 3GO5A 1ONVA 3W6JB 4A5NA 4KMFA 3MQ0A 5FD6A 3E5XA 3E6CC 4HV6A 1HW2A 3PQJA 4N0BA 3K1NA 1ON2A 4A6EA 4OMYA 2VOPA 1GHCA 4I7HA 1TQMA 3WE2A 3ZMTA 4UVCA 2NS0A 2PMUA 1SAXA 2EFQA 2ISYA 2H6BA 3FMQA 3REOA 5CVJA 2M30A 3I54A 5H6RA 3BJ6A 3SXYA 5LBQA 2E7XA 3FWEA 3DFGA 1P4AA 1U78A 2STTA 4FX4A 2GA2A 3V7CA 4OIRF 3DPTA 3R4KA 1D5VA 3EYYA 3EYIA 3MFKA 1I6XA 5LHHA 2Q2EA 3G3ZA 1BOAA 4LLGF 3IHUA 4HLYA 4IVNA 3ZN0A 1R5GA 5J8FA 4OOIA 2VT3A 4ON0A 3TOAA 2CSOA 2PEXA 4A0XA 2VC1A 2V79A 3K9TA 5BPDA 2DT5A 2QENA 2CG4A 1ZGJA 5L3FA 3GX4X 1KYWA 3I71A 3HRMA 4UHTA 4UUVA 4HA8A 1S6LA 2JPBA 5DCMA 2L3DA 4GYGA 2ZXJA 4BYYA 2ZNYA 5D4RA 3GFJA 2A69F 3J80K 2JT1A 2BYVE 4UNOA 3KLNA 3BZ6A 1USTA 4HYEA 1Z6TA 3KP4A 5F1RA 2DU9A 3RPQA 2OZUA 1FBUA 4G7HF 2WWYA 4UVBA 3I5UA 1PP7U 3CUQA 2FBKA 1MKMA 2NNYA 3WU1B 3NEUA 4CYDA 1TW2A 3F6VA 3LWFA 1ZAOA 1J9IA 4AIHA 2HTSA 3AAFA 3ABTA 1T2KA 1K6OA 3MWMA 3WTSC 1WWXA 4EGYA 2H09A 2RNJA 1AWCA 2OQRA 5K5QA 2MC3A 4PDKA 2CWEA 6PAXA 4U7DA 5ICFA 4GGGA 2O0YA 2DK5A 2O3FA 4ENMA 2E1NA 2XHKA 2ACJA 5LGNA 3G73A
chains in the Genus database with same CATH superfamily
3K0LA 5DUIA 1LVKA 1R7JA 5IP7J 1ZG5A 1APLC 3IAM2 3DV8A 4DYCA 1UAAA 5CPRB 3FKJA 3CF5F 2LC2A 2VBYA 2PI0A 3KYDB 3J7YJ 4RB0A 1DGRM 3FMSA 1B4AA 3WTXC 4KIGA 1SVMA 2DO7A 4XBFA 3GTQJ 2LBFB 4A2UA 1TNTA 1MZBA 2LF8A 3H3UA 2GOXB 3I64A 3VB2A 2XC7A 2DW4A 2DA6A 1YS7A 4BGDA 2D1VA 3J7ZI 2OUMA 4KN4X 2H8RA 3T8RA 3ABUA 1FP1D 4UUTA 3T1BA 2HVRA 2D2WA 1IN7A 1Z1DA 5FLMJ 3BG5A 1S7OA 5EGOA 3BZKA 1D0XA 2AXLA 2HXOA 2CV0A 3RYRA 5C4JJ 4RDUA 3BROA 1R1TA 2X6YA 4HX7A 4M6VA 3KEOA 4NNJA 4RLQA 1L0OC 5FKLA 1NG6A 3K1PA 2WAQA 2NAZA 2K5CA 2FF4A 3MVPA 2CH0A 3JTGA 3FF5A 2CQNA 4F92B 4IXAA 4YG2F 1USSA 2GZWA 3LSTA 2P5VA 1ZQ3P 4LLNA 1B1BA 4E4HA 3M8EA 5L3GA 2K9LA 4BL0B 2K86A 5HS7A 3ZQ7A 2M0CA 4BQAA 2E2HJ 3BR1A 1YQAA 3TOBA 5IOYA 2V4JC 1FIAA 1XDSA 3S1RJ 1BIBA 5ILVA 2FXAA 3JRCA 4OIQF 2R92J 3QOPA 1B9NA 1WQ2A 2PBIA 3KETA 1NTCA 4BJ6C 4QPQA 5C3EJ 4HX8A 3EUHC 2PG4A 4Z6YA 4IF4A 5JVGF 2DAOA 4XN0A 1XMAA 5L3EA 3WG9A 1ETOA 1X1BA 2QBYA 2DFHA 3HOXJ 2JA7J 1UCRA 3M4OJ 3FX3A 4ESJA 1IXRC 2WC2A 5KVRA 3NRVA 3CMAI 1T33A 2KMUA 4XNFA 3A02A 2KIMA 4IHWA 3OYJA 5DD8A 3BCBA 1G3YA 1FP2A 1W5SA 2W1OA 3TGNA 3TKYA 3K2AA 4HG2A 4MEYF 3ECHA 3OYMA 1LVAA 1A5JA 2IAIA 3W6KB 4FE4A 3TBIA 3ZQCA 2OTJI 4ZZLA 2J5PA 4L9VA 4J00A 4XSZF 3RSNA 4C2MJ 4YFNF 1P7JA 1LFBA 3RIRA 2ZXIA 1BR2A 2DJIA 3MZYA 4XIDA 3AL0B 1TT5B 1HDPA 5E1WA 1AA7A 3DBLB 4DNCA 1ZHFA 5HLTA 1S9HA 2FSWA 3D0SA 4I0BA 3BDDA 4XRFA 1KZHA 4BDZA 1EKEA 4XICA 4ENNA 2ELJA 2HDDA 3DKYA 1IXCA 2VOOA 2HGCA 3VEPA 1FTZA 1I3AA 5GTHC 4C2UA 5B66C 4F7ZA 2V9PA 1N77A 4UUSB 1QQIA 1OR7A 2VXZA 1S72I 4F3QA 3WTYC 3P9CA 4OWRB 4UV9A 4BDYA 2DYSH 4XRMA 1QA6A 1FEXA 1V3FA 3ISPA 5F0CA 1YG2A 3FHZA 3LA3A 2L5QA 2IW5A 3LSKA 4MO7A 5E20A 5IYCJ 3WTTC 4KISA 3L2UA 2KP6A 4II2A 1RC9A 4Y13A 2UV1A 3JRGA 2VPRA 1VQNI 3KZYA 4JK1X 3F8BA 3H92A 4M9SA 2ISZA 1JHHA 4JX6A 2EA4A 3V8KA 5FLXK 2A68F 2E5ZA 2MYSA 3HRTA 2R7RA 4XQFA 1K7AA 4C3IJ 2WY7Q 3C1DA 2YX4A 1VQ8I 2G0EA 5BOXA 3BJAA 2XPVA 2E71A 3HOVJ 4A3IJ 1XGNA 3F3XA 5C4XJ 1S8NA 4A3KJ 3R0AA 1VTNC 3HUGB 2RQPA 4ITVA 4UUSA 1B8IB 1K83J 3H9QA 2EFNA 3LL7A 5LRRA 2IS1A 2WB1N 4MGRA 3QAHA 4O6JA 2L9NA 2BVMA 1G6NA 2EPFA 4M3GA 1IZ1A 5KAIC 2RAEA 3K4BA 2VBWA 4NQWB 2R7SA 1UB9A 2E1CA 4KYWA 3BC8A 2D5VA 4BACA 2HOSA 3PJRA 3MKWB 3CF2A 1IV6A 2AXTC 4WXCA 1GDTA 2FJ1A 4AYBN 4L9TA 1Q1VA 2QQAA 3A01B 2YU3A 4QPOA 3K4CA 3GFIA 1NK3P 1LQ1A 1IAWA 1BI2A 1T0FC 4BHPA 4EM1A 3BY6A 3ELKA 1O7FA 4AC0A 2IS4A 3BR0A 1UJ8A 1SD7A 4B09A 4U0YA 3RJPA 3D5RC 3OYKA 3J7AY 2FMYA 2A5YB 2M8GX 3I59A 1T95A 2W84A 3HUGA 2DQLA 3COAC 3RTRA 1O3RA 2OJED 4DGWB 1B59A 1FMVA 3S2DJ 1B8IA 1MMDA 1G3WA 2F4IA 2JZYA 1UZCA 4P96A 2ZJQF 1FSHA 1E3PA 2VUMJ 5JR3A 5F64A 3L2VA 3HXLA 2ID6A 1SFUA 1HSJA 2JSCA 2NNNA 1AOYA 3CTAA 1VQ7I 2XAQA 5F6FA 3U21A 1FYMA 4M71A 2CJJA 2P0WA 4IZZA 1G59A 4CHUA 4CZCA 1I1SA 1PDNC 3SHFA 4OINF 1UFMA 1JI8A 1DPRA 1I5ZA 1VQ6I 2CUFA 3A01A 2CV1A 2EK5A 3ESWB 2YU9J 4XRSA 1JKOC 5IT9K 5GTIC 2EFPA 2DQRA 2GWRA 1FT9A 3HJEA 5K5OA 5JFRA 3GLLA 3H5RA 1IRZA 2CQXA 4FX0A 5EEGA 4E70A 3QYBA 3TDZC 4UVAA 5B1BH 2XGDA 1LFUP 3VSKA 1R49A 1FYKA 2E34A 3GZNB 3IKVA 4HF2A 5CVVA 3S1QJ 3Q3SA 1WCMJ 3HOWJ 2OA4A 3A0HC 4NBQA 1Y0NA 2LK2A 5FJ8J 2CGPA 4DQ2A 3ZQHA 4PZJA 2UXXA 3D1NI 3BTJA 1W0UA 3LA7A 2YX7A 5HVQC 3RZOJ 3SFIA 5IT9Z 2DA4A 5FKOA 3MD2A 5EYRA 1YW9A 4WF2A 3HSEA 1MBEA 4BJ5C 4I6ZA 1F43A 4Y52J 1OCOH 1AU7A 2DFEA 3EUHA 2EZKA 4X6AJ 2F48A 3ZRGA 1ZLKA 3J7AO 2LR8A 1B72B 2R7DA 3F9KA 1R4NB 1ZYRF 2QSHX 1GVDA 2L7MP 3FXOA 3GTOJ 1BA5A 2K7LA 4A0ZA 4ZDPA 1J09A 1ZN2A 4AVZA 4PFOA 2E5NA 3IH2A 3QPTA 2WAFA 3AKZA 3NQOA 3OR1C 3PL8A 3ABKH 2XAFA 1U8BA 1NH3A 3I4MJ 2Z5UA 4RBOA 1PUEE 4EM0B 1ENHA 1OCZH 1Z3YA 2XASA 2YR2A 4U7BA 1YI2I 3T8TA 5BS6A 4IRGA 4L18B 2ZXHA 3O8HA 2XIGA 3P7NA 2OZ6A 4BH9A 1KQ9A 3FXRA 3G4SI 2CYYA 2R5YB 3A03A 1XS9A 4CCJA 1W5CC 3W2WA 4PUSA 2OV7A 2R0QC 5L3BA 2K3FA 3S1MJ 1P92A 4AM3A 4EJVA 2NXNB 1DP3A 4IRHA 2X1EA 2V26A 3C7JA 2UXNA 4ZYHA 1O4XA 1MGTA 2LDUA 2XGXA 5JLWA 3S3MA 2LP0A 5DDGA 1FMWA 1JGSA 3K4KA 4P9FA 5EG0B 5J6XA 2QLZA 1GXPA 2ZJPF 1NK2P 3RQ4A 2H27A 1R9TJ 3SEZA 2COBA 3EETA 1FYLA 5LHIA 1XTAA 2KRHA 4RAZA 4RS8A 1XCBA 3HC7A 4B47A 1MSEC 4ZYGA 4W97A 2PLYA 4L9JA 3LAPA 3GEZA 1ETYA 1SD4A 3SEQA 3L2QA 2KQRA 3FXLA 1U9OA 3W2VA 5HS8A 2MG4A 1X1DA 2B7EA 4XR6A 3V42A 1BC8C 1VQKI 3W2AA 1UG2A 2NS7A 2IGKA 1X1CA 2LVSA 1R22A 3CZ6A 2R5YA 1QRYA 1BIAA 3ZMSA 1KONA 5E1ZB 2QKMB 3TQNA 2E1MB 4EM2A 4LB5A 5F27A 3FMRA 1T98A 3V7RA 4WCGA 1I1GA 1RPWA 2XPUA 1XC5A 3VOEA 1KU2A 3GTGJ 2L0KA 2V6CA 3WHBA 1HKQA 2HQAA 2M34A 2M4GA 3WTUC 1H9TA 4L5EA 1SFEA 4KUMA 2JUGA 3HYIA 3SQNA 2KRCA 4QTRA 5IYBJ 4YFKF 2IA1A 3ZMVA 4HQMA 4GDFA 2B0LA 2WTEA 5FKMA 4D9JA 4ZTJA 4HNTA 2A6EF 4RAGA 2DMQA 3F8FA 3QP6A 1JKRC 2BW3B 4Y7NJ 3CMEI 5E3OA 4DOZA 4RMNA 4IX7A 2CW8A 3N97A 4IHXA 3QP5A 2NVTJ 4Y33A 1FOWA 5DCMB 5A2QK 3JRHA 1YLFA 3KEYA 4PJMA 3EPZA 2QZ8A 1LJ9A 2HXIA 3JR9A 4LK1F 3BQZA 3HGGA 4D7MA 4BHCA 5J1YA 1WVRA 2VQLA 2XAHA 4LLLA 4BEHB 4E7IA 2ZFWA 1KGSA 1MSFC 1T0FA 1SMYF 4HW0A 3WGIA 2UUZA 4HSTA 4MNUA 1VQ4I 2VPLA 5HLGA 1LDKB 2XKOA 4A3BJ 1S7EA 4RAYA 3RCOA 1TLHB 5E3NA 4ZH4F 3JRDA 3I55I 3J81K 3S3NA 2VC0A 5E1XA 1DUXC 2OTLI 3BOQA 2B63J 5ICGA 3HSRA 2L4AA 5A2QZ 1TWFJ 3CUQB 2JUCA 4HSRA 3ZP5A 3HBLA 3EDPA 2GQQA 3CC2I 3DCFA 1WI3A 4U88A 3AG3H 4KN7X 4Q48A 1BR4A 3A1YA 3JRAA 1IN5A 1X1PA 3CO6C 1UHMA 2NOJB 3GZ5A 3OIOA 3UKGA 5LGUA 3F8CA 3CMMA 4GRIA 4DZJA 4CDGA 2M3AA 1ZKGA 1ORKA 3SZPA 4A3FJ 1KYZA 3DF8A 1MBKA 5D8KB 1E3HA 2EZIA 1JKQC 3B73A 3J81Z 5HDKA 3DLLF 5LD2C 1H89C 4IHTA 4M9XA 3O8GA 4AU7A 4LGWA 1IUYA 2IA2A 1W36C 3FXKA 3VODA 2A07F 4C30A 1KU9A 4YRVA 1Z7UA 2W82A 1RNLA 2JWTA 1YYVA 3H36A 3K2ZA 1IN4A 1W0TA 3F6OA 1FY7A 2R7UA 4YEJA 3J80Z 2HPMA 3L2CA 4PFPA 2DA3A 4IOAF 3WE3A 1LEAA 2L7ZA 4CCOA 1RI7A 1FOXA 4JBAA 3K70C 1JHFA 4BQNA 3FK7A 4BXUA 4UB8C 1HC8A 3ABMH 3CP2A 1MJBA 3GVAA 4BAYA 2FNAA 2DJNA 3S32A 2D45A 1H9GA 1JTXA 2BY1A 1WJ5A 5DS9A 2ZSHB 2M9HA 1H0MA 1IN6A 1SD5A 3H5NA 4D5FA 1VI0A 1HA8A 2KT0A 3CCEI 2JA2A 1XSVA 2IPQX 3C2GA 1SVOA 4EMSA 1LFPA 3ZXSA 1IG7A 4OMZA 2HYFA 3HKZN 1S7AA 2XDVA 2EINH 3QYFA 4PGHA 2JRTA 2LLKA 3R0JA 2ZKZA 4FTHA 4G6DA 5TGTA 5KNLA 5L3DA 3PSFA 5D5UB 2HKXA 5EGOB 2R7WA 3M3YJ 1QNTA 1A6IA 4LK0F 3K4MA 4OAZA 2FU4A 2MH2A 3ERED 2CW7A 4M9ZA 1ERDA 1JUMA 3ZGKA 2DBBA 1EF4A 2VE8A 1R71A 3TL4X 2DFFA 4L0YB 1RUOA 2PJRA 4UB6C 3QU3A 5AIPA 3RKQA 3S2WA 1YITI 4Q4ZF 1V4RA 3M8JA 2NVXJ 1VQMI 4N9IA 1WJBA 1FOKA 4XK4A 3KFWX 4HF1A 2ELHA 3H3VK 3H35A 3OS0A 4MEXF 2ELKA 3HIFA 3GFLA 2VBZA 3ABLH 4PCQA 4I2OA 3S2HJ 2KIFA 3OYNA 4C3JJ 5FKNA 2M87A 4E7JA 2V1DA 2M1BA 2XRNA 5K5RA 1P7IA 4MTEA 2VQGA 2ZC2A 2BE5F 3GLXA 2KZGA 2JVGA 4G7ZF 1PVEA 2MD0A 3BG9A 4LJZF 3FM5A 4L0ZB 5D8LB 4UV8A 3LSMA 4UXNA 1D8JA 3Q9VA 3IKTA 2QBYB 1IDZA 2VI6A 3GBGA 2M7AA 4I98B 4D1QA 2FNPA 4JP0A 1GVJA 4XOTA 1T08B 4ZZDA 3PUBA 2E19A 4CICA 2A5WA 3IP4B 1R36A 2FRHA 2BV6A 1O3SA 4RA2A 1R5ID 3G1OA 1U5TC 3DTIA 1OKRA 5TRDA 1UMQA 2XAJA 4FHTA 1RR7A 2BY3A 3VYRB 1JJ6C 4JYKA 3FDYA 2TRTA 4ANJA 2O8KA 3Q0VA 1RR8C 2QM3A 2TCTA 2KL4A 2DA5A 1Z05A 3PSIA 3KLOA 5FD5A 2BZTA 2C6YA 3Q5FA 5CKTA 3JSOA 4BBSJ 5D4SA 4I09A 4BXFA 4M3BA 5E8IA 3U1DA 2HDCA 2ME6A 1X58A 2OCCH 4I76A 1MMAA 2GAUA 2V7FA 5B3SH 2M45A 3CCYA 4B48A 1A31A 3K10A 1SD6A 4K2EA 5HDGA 5ICCA 5J4YA 1VQ9I 3DEEA 4XMYA 3PIPF 3V8LA 2CW0F 1EH7A 2W57A 1MH4A 3I4PA 4E7ZA 3MAJA 3RPUA 3SYTA 4F93B 5M5WJ 1Z3XA 1JJ8C 2DK8A 2XROA 5H6QA 1Y39A 2WAQN 4M73A 4B4CA 2L01A 1PJRA 3S3OA 1YO5C 1XN7A 1MIJA 3OYHA 1RZ4A 3PNYA 4KJZA 2PJPA 3E6MA 1UHWA 2V9KA 2OCEA 4OIOF 1J0RA 1OYWA 1H88C 2HFHA 3M8FA 4JX4A 4CUGA 2DDBA 2EZLA 3IH3A 3SFZA 1XSDA 2OAZA 3CJNA 3PO3J 2L9RA 2ZFUA 1FZPB 5E3MA 3W3CA 2IRFG 5E18F 3LMMA 1EJ9A 5D5VB 4HZFA 2K85A 3I9V2 5TJJA 2QF7A 1Y1WJ 1HQCA 3LQQA 4XL9A 2F4MB 3SJMA 3EQLF 4RB2C 3S14J 1JGGA 2XSJC 1QGPA 3V4GA 2DTRA 3CC4I 2AS5F 2Z3YA 1DDNA 4NUBA 2QKLB 3KEQA 3HSFA 1QPIA 5EZHA 4LITA 3FXJA 1O7LA 4EV0A 5H2FC 1J59A 2MSYA 2I8DA 1KA8A 2K3PA 2EFOA 1Y8QB 2XPWA 4A3GJ 2DTZA 1N75A 2ETHA 2F5CA 2HQNA 1WJAA 1J7KA 3EUKL 3H3ZA 2HYJA 2MLKA 2GA1A 4IO9F 1R4MB 4G6QA 1WJFA 1FC3A 2KIUA 2RKHA 3MZ8A 4WXDA 4YIFA 5K1YA 3TO6A 3JAMK 2B9SA 1HLVA 3LSJA 3DTKA 3KP3A 5IP9J 1Z67A 3HTSB 2H6CA 4O5VA 4BS9A 4MQ9F 2VT2A 4ENJA 1YJWI 1F5TA 4A3JJ 1KQ8A 1SC7A 2Z2SB 3CCSI 3IL2A 5FGMA 5H20A 1ZRDA 2XV4S 3VSLA 1MNEA 5LEKA 4JQFA 2O6GE 1G4DA 3OV8A 4XN3A 2DA2A 1PP8F 2HVQA 2HEOA 3I59B 1O3QA 5DV5A 3D5LA 3PNVA 2HI3A 2ZCWA 4DYRA 1P9QC 3R6SA 1RESA 1XB4A 3FXQA 2Q1ZB 2RV8A 2FBIA 1ETKA 4GXOA 2PMZA 1OQYA 1LEBA 1U0JA 2DLLA 1MMGA 3JAMZ 3OYEA 1SEUA 2Y75A 2LSOA 1GV2A 3TEDA 3CQZJ 4W1UA 5HS9A 5LEJA 4KIBA 1ETXA 4D7NA 2AHQA 2F6CA 1BI3A 2JJ7A 5FLXZ 5JHFA 4YIRX 4E7SA 1Z7LA 2VKEA 2IXSA 3E97A 4N9HA 5C44J 3OS1A 1REPC 3IRQA 3DWLE 2FX0A 1MBGA 2VASA 3DKWA 3JRFA 3FZVA 1FNNA 2L54A 4CCMA 3WODF 4B44A 2K4BA 1VF9A 1X19A 1RUNA 4DBQA 3BJOA 1T56A 3BTIA 1HSTA 3G2BA 3F72A 2Y30A 5GPAA 3ZQGA 2Z9OA 2R93J 2W25A 2VLAA 3MKYB 3ZMZA 1I27A 4BJTA 1FBSA 2EV6A 3OR2C 4Z2YA 2PN6A 4G9YA 4I0AA 2E36A 4NB5A 3VPRA 4ENKA 1R58A 2HNHA 1TWAJ 4MIMA 3RKYA 3G1MA 4E7KA 1YFHA 4KDPA 3GTMJ 5IP6A 3RI4A 2MA3A 4I02A 5EJCA 5F08A 1YIOA 3IWZA 4DJAA 1XD7A 1DPUA 5CVUA 4AIJA 5HLIA 2NYXA 5FB2A 1WJEA 2P81A 1FJLA 1ZG3A 5BQTA 4RB3C 4MTDA 3L00A 3T0YA 2FBHA 2EWNA 1O3TA 2RREA 4XKBA 3GMEA 3LAJA 4BNCA 1WH5A 3DXJF 3IRRA 4P9UA 4XLPF 2EA2A 3G71I 1TL8A 4P55A 3CUOA 2K27A 4LB6B 1F1ZA 2EFWA 5KK1A 4YIIA 5FFZA 3EUAA 4BQOA 5EDNA 4AWXB 2A6TA 4E7HA 5CVIA 1JE8A 4UY8I 2IA0A 1U5TA 4XLCA 2CS3A 3OYLA 4DYQA 4A12A 4Y4RA 2RVCA 3Q0UA 4RGRA 4BU2A 2L9VA 2F4OB 1HKTA 2CFOA 3ZMUA 2MGQA 2CQKA 3MEXA 4QLCU 3KP2A 3MCZA 3BPXA 2XF5A 2A05A 2A61A 5CJ9A 2YSRA 4KMUX 1TWHJ 3QWLA 3Q0WA 4ASNA 2UZKA 1ZR2A 2BBYA 1KU3A 2PQ8A 2OBPA 1WGXA 4RB1A 1LNWA 3RKXA 3BWGA 1DU6A 3CDHA 3JW4A 1ETQA 2ZB9A 5B1AH 1QHHD 1RKWA 4XOPA 5LHGA 1T38A 2WV0A 1X4OA 2Y0SA 2KJBA 1SMTA 2GIZA 3M1CA 2ZJRF 4HDVA 3PUFA 3B6CA 2OQGA 3IH4A 2MC4A 2P6TA 1OFCX 2MABA 3GTLJ 3RDIA 4ESBA 1LE8A 4LFUA 4CSWA 2L2OA 1IRGA 4H0EA 1FTTA 4DIQA 4C3HJ 2AQEA 1YW8A 3L09A 3RYPA 3K4JA 2VN2A 2QYOA 3RKWA 2XB0X 2NRAC 5ED4A 3ZQLA 2G7UA 1OYIA 4PJNA 3P5JA 3QPLA 2VBXA 2V1UA 2M0MA 5M3FJ 3NARA 1UHSA 3CCUI 1U6GA 3CC7I 2MBFA 1BI1A 5IT3A 1JT6A 2R5ZB 3VYUB 3GCMA 3CJTB 1V55H 1A04A 3TP3A 3H0DA 3OYCA 3GTKJ 3QYEA 2E2JJ 1P4XA 1WFXA 3BR3A 4RGUA 4KICA 2FQ3A 4KT5C 1VFCA 5HNHA 1W4MA 3ZN1A 2MLGA 1MBFA 1D8KA 1SANA 3DEUA 3FBIB 5GAHJ 1XMXA 3CDIA 3U1KA 4S0HB 3RPUD 3OS2A 5DM7F 5EF6A 2QSGX 2O61A 1XGMA 4C2TA 2BHYA 2DDAA 1TBXA 2H1KA 2Z33A 2RGVA 1EV7A 2MFZA 4KNYA 3F22A 2F5DA 2IBDA 4U0VA 2K9SA 4RGXA 1TTYA 4Q5SF 3OOPA 1WZ2A 2X0LA 5DCFA 1JTYA 2CV2A 3E6DA 4IHYA 1HOMA 1SAUA 2KZVA 2IGMA 4RM3A 1K4TA 2DOEA 1K79A 3DP7A 2ESHA 4IL6C 3WTVC 2R5ZA 1WJCA 1MDMA 1OLTA 1A35A 3CJRB 1N78A 3NWTA 4C9YA 2IS2A 2R7QA 4ZYDA 2OF7A 4IPAA 4KITB 3OMYA 4Y15A 3E3VA 3QPHA 4F91B 3HOUJ 2AO9A 3HEFA 3KYLA 1JKPC 2QQ9A 1BI0A 4NHJA 3S15J 4HLXA 2DI3A 3BT9A 4RM2A 4CYCA 2W4SA 3S16J 1Z21A 2FA5A 4HF0A 2R7FA 4PJJA 4BY1J 1QO0D 2XVCA 3DQVC 2HQRA 4HPQA 2W48A 1U8RA 2Z1DA 2HTJA 2OPTA 1TT0A 1IC8A 3KP7A 1W36D 3AG2H 1VQ5I 2HQ5A 3MKZA 2CU7A 3R60A 2I10A 4CCLA 2P5KA 3KP5A 3AG1H 3HHHA 2LY1A 3CLOA 4G94A 5JI6A 1DU0A 1BBYA 1TQPA 5FROA 2DXIA 4M6YA 4G8XA 3GTJJ 4CO8A 3BG7A 3IAS2 2ESNA 5FFXA 2DPUA 1QU3A 1LUJB 2X51A 1R1UA 1SFKA 2QSFX 5D5XB 1JT0A 3FKIJ 1EA3A 4Y3OA 2I5UA 1MBHA 2XGCA 3ZOBA 2QUFA 2WBMA 4II3A 2HZTA 1MMSA 3M9AA 3DBRB 3K70D 5FRMA 4HDUA 4B3XA 3JRIA 2BXYA 3H0GJ 3I58A 2K40A 1WI9A 2J5OA 4ZDOA 1J5YA 3HG9A 4A5MA 1PYVA 2QQ8A 2R7VA 3G6EI 2H8WA 4V2FA 1W7PB 3GUDA 1TWGJ 2BGCA 2IEKA 4WX9A 1R23A 2KDOA 3OYAA 1G3TA 4EQQA 1YOVB 4P1WA 3ECOA 1IGNA 3U9GA 2JA5J 4G6TB 1WSUA 5J40A 4BY7J 4B1RA 1LPQA 1Y8RB 2DCEA 2HPIA 4HQEA 4S05A 4KFCA 2GOMA 3MN2A 4WXHA 1Z9CA 2Y31A 5D6FA 2RN7A 4AD9A 1VQOI 4IEJA 2LTPA 1FLIA 3CCVI 4KIFA 4FASD 1ETWA 4BBRJ 3LSHA 3CJQB 3OYFA 1X3UA 1YJ9I 1QZZA 2FD5A 2VKHA 2BEOA 2VJIA 2VXDA 3HOYJ 3CO7C 2D1HA 4HV5A 2DOAA 4XKWA 3SDBA 1ZARA 4F55A 3TMOA 3WU2C 5GPCA 1Y0UA 2DPDA 2VE9A 4XSXF 3P9KA 3BG6A 2CO5A 2MD5A 2LD5A 1VZ0A 3WGGA 2M8EA 1J2XA 3WGHA 1IJWC 4RGSA 3K7AJ 2JA6J 2F5EA 2XB5A 2F5VA 5F0FA 1W7PA 4A93J 2UWMA 2CFXA 3OY9A 2ZSIB 3C2HA 4D0PA 1R5HA 1OCRH 1X3WB 1YE9A 2KKOA 2LRDA 4HEA2 3E0JB 1E17A 3KZIC 2KISA 2ZO4A 2GM4A 3U2RA 3ZPLA 2DYRH 4GYIA 1M1EB 1ZRFA 3KZZA 3AFHA 3GFMA 3S93A 3HPHA 2A3SA 4CH7A 4PJLA 5D5WB 4BE0A 1G3SA 1K78B 2O8XA 4L9NA 3ASNH 3O3KA 3QU6A 2Y9ZA 1LDDA 2ZJ2A 1ZR4A 2DN0A 3GXOA 3ZMDA 4QIWN 4L5IA 1XGSA 3ZQQA 4CA0A 4OIPF 5E17F 2LREA 3HOTA 5FLVA 2GXBA 3AL0C 4LG3A 4XRSG 4BXXJ 2E2IJ 4V19K 2PJRB 4HRIA 1IRXA 2EIMH 2G7HA 4LMYA 3ZQFA 1MJAA 1MD0A 2P7VB 4GO1A 1WH7A 3VFZA 4B43A 3I56I 2HU9A 5DUKA 1TQIA 2GIVA 4EGZA 1HW5A 1FSEA 1Y56A 1X1AA 1QVUA 2ZNZA 3JTHA 4LIVA 4ETSA 4AUXA 4HNVA 4ABZA 4M3FA 3G1LA 1IV8A 3ML6A 1PUFA 3ASOH 2JN6A 3O6BB 2XAGA 2XKPA 2P8TA 2XF6A 3FXMA 1RIOH 1XPXA 2PX9A 2ID3A 4TV7A 2LKSA 1VNDA 2OD5A 4BE2A 3DPUA 4FQGA 1V5GA 1Z6RA 3LSGA 5AONA 3S8PA 2QQBA 1IW7F 1FWZA 2HR3A 2VL8A 3K6GA 4MFEA 1T39A 2G9WA 2H1LA 1K78A 2R7OA 1OCTC 3ONQA 2K4JA 2K9QA 2Q8KA 4EJWA 3N05A 2FOKA 5E79C 3CCRI 2ZXWH 2M4KA 2DMNA 1TWCJ 3I53A 2O5RA 3T5XA 3QRFF 4CGZA 1F4KA 4EJUA 2Y48A 3CP8A 2WV1A 5DEQA 1HBXG 2V1NA 2VKVA 1RKTA 1HDDC 1BC7C 1TC3C 1ACIA 4CCNA 2YPRA 1OJLA 2HZDA 2CUJA 2CQ7A 1S3JA 3DBHB 2F2EA 4S04A 5HLHA 2K02A 1GT0C 2KJCA 3M1EA 3PO2J 2DFIA 2Y9YA 2DMTA 3B02A 4R1HA 1IRFA 3RQIA 5J1RA 1ITYA 2XRLA 2BY2A 2HWVA 3BR5A 3QOEA 1JUPA 2Y2ZA 5LFAA 1ZREA 1HXDA 2DT7B 2ECBA 1FBQA 2E35A 2FQ4A 3E6BA 1QZYA 1S5LC 2LKPA 1WKMA 2FUG2 4HBLA 4PSWA 1FX7A 4R8HA 1R1VA 1DQUA 4AIKA 5ILUA 2Q0OA 2QGUA 2W85A 5JVTA 5KCMA 3NAUA 2KRFA 1HW1A 4O3MA 2LF7A 5CLSA 3JSPA 1SFOJ 3TW7A 1I6HJ 2ZMEC 1ZG1A 2HOAA 2QCOA 1YIJI 1IDYA 3R61A 1U2WA 4LG0B 1D0ZA 1ON1A 4CZZA 3DEWA 3KPHA 4WWCA 3KCCA 3CDLA 3OWTA 2ADUA 3ZQIA 3K4NA 3LSPA 3ZCOA 4L5JA 1BW6A 1BN5A 1ODDA 3BZCA 1XG1A 4NC7A 2EIJH 2A6HF 3MKLA 4DZPA 1B6AA 1S29A 2KLOA 2KFDA 2LBFA 3JCUC 4KA4A 2QWWA 2V1XA 1YRNB 2FOWA 3OL4A 1B9MA 3LSIA 2E7WA 2ECCA 3UR3C 3F23A 1L3LA 1YJNI 1EH6A 3E7LA 4HOBA 5GAEJ 4E7LA 3QQAA 2R3SA 3TO7A 2CQQA 1D1AA 2XSDC 1OCCH 1X2NA 3BR2A 2EH3A 3OSFA 5HNFA 2EIKH 5FO5A 2VKDA 4LG0A 3WTWC 1RRJA 1AHDP 1KQ0A 2KPMA 2JRMA 3BLYA 4A3EJ 3WU0A 4EJTA 2LNBA 3SZTA 3C18A 4BKXA 2EV5A 2F5FA 4XORA 4BUPA 1BOBA 3PM1A 3FXUA 4BQQA 2P4WA 4MQVA 3SZGA 2VODA 1R00A 5F0HA 1QBJA 4M3DA 2STWA 4IOCF 4PSXA 5EZGA 2EJRA 4G7OF 5M5YJ 1V5EA 3LA2A 1HCRA 5BMZA 1Z77A 1YRNA 1BW5A 4WK8F 2RC4A 1FPQA 4YFXF 3PFIA 1BR1A 5EEHA 4QWQA 2IT0A 2NVYJ 2HS5A 2W24A 2HOEA 2NS8A 2TDXA 1U3EM 4OU0A 3C2BA 5CQGA 5LGTA 4NC8A 5E3LA 4J01A 1ZRCA 4A0YA 5HDNA 3GW2A 2HYGD 2JVHA 2NOGA 3IUOA 2QVOA 4LD5A 1D5YA 4XLAA 4M74A 5M5XJ 5L3CA 3WHCA 2P6SA 5ILSA 1OYYA 1J75A 4IQ4A 2ZBKA 3B6AA 1ZH5A 2LMDA 3GYHX 2WB1A 3IWFA 3HB9A 1ZGAA 1OMIA 2LH9A 2PMHA 4XLNF 3V8JA 5FKKA 1A36A 4P5OA 4V2GA 2FEZA 3DLAA 3HRSA 1ZLJA 4KT6A 5J3LA 1HF0A 1Q1HA 2OU2A 4M72A 1XSXA 4CCKA 4MHGA 4B8XA 4Y17A 4ZYAA 1E3OC 4AVPA 3FIWA 3ULQB 3JREA 4AYBA 1GXQA 4ESFA 2L9SA 5K7HA 1XGOA 1QVTA 5DD4A 1X2MA 3FBNB 5AIQA 2DMUA 2PFBA 3O2PE 1TP4A 3WTZA 3JRBA 1EH8A 3GWZA 3V7SA 2BHZA 4I01A 3LOCA 4R79A 3F8MA 3TDUC 1TNSA 2GXGA 3C3WA 2HKOA 2Z99A 1IXSB 3K69A 4NC6A 1ZGWA 1W7PD 1MJ9A 1CF7B 4N4NB 1I50J 4JX5A 4EJOA 5DTDA 4DBRA 4PGGA 4A6DA 2NVQJ 4EVIA 3L1PA 3LFKA 4ZTFA 1ULYA 1C0WA 1E2XA 1AKHB 3BPVA 1STZA 3BG3A 2LKXA 5TISC 3M07A 1H8AC 1OPCA 1R6RA 1BM9A 2FE3A 2L4MA 3MZHA 3ZR8X 4ZJZA 1MH3A 2X48A 3OYBA 3CCJI 2E1MC 4XLFA 5HODA 1LDJA 4GCVA 2EB7A 4ZC3A 5J1UA 5M3MJ 3FM3A 1IUFA 3SDGA 4MFDA 5J8CA 3QPSA 5FRNA 3I4NJ 5D6EA 3LQRA 1U5TB 2PMZN 2H94A 3OIQA 4Q47A 2ZMEB 2XAUA 3A0BC 2DOFA 2RNGA 1KU7A 2M5WA 1P6RA 2ICWG 5CYVA 5IPAA 2CUEA 1O57A 1MNDA 3PQKA 2BXZA 2X4HA 2VJJA 2VJ4A 4XLEA 2FMLA 5KAFC 3IC7A 2OC6A 1D1CA 5LRSA 1CF7A 3HPGA 1XCVA 5F1JA 5ICEA 2IP2A 2JK3A 4NQWA 1XMKA 3FK6A 1AKHA 4HAMA 3TP0A 1YS6A 1MBJA 4I99C 2E1OA 2EV0A 2MH9A 3FISA 2RDPA 4HX4A 1YTYA 1I3QJ 1ETVA 2EBIA 1F9NA 2L02A 2P7CB 1WRJA 3HTUA 3OIPA 2IVMA 1P2FA 1W5TA 1LE8B 2BOLA 1W1WE 1OCPA 1T6SA 1YW7A 2VQHA 4FE7A 3L2RA 3CMYA 2WADA 2KIQA 4M6XA 1NHAA 4XKCA 2XUBA 2ZMEA 1YX5A 2X85A 3BP8A 3F0CA 2R7ZJ 2P5LC 2M7BA 1QPMA 4A3CJ 2IJLA 4GFBA 2N8GA 3ROUA 3E5UA 2VIXA 4LOCA 3MMYB 3H5AA 1D1BA 3L7WA 3CUQC 2X6XA 1MMNA 1A6QA 3GF2A 2HDWA 2VONA 3KYCB 1WHUA 5EEAA 3HHGA 5JLXA 3HDDA 1DP7P 5JHUA 3IV5A 1V54H 2JA8J 2CUZA 5BNGA 4IRIA 4IQJA 2JMWA 5BPIA 1VQLI 4M3EA 3TO9A 2JPCA 2DA1A 4J19A 2R7XA 1JXSA 2IS6A 3CCLI 1SFXA 2Y0MA 2R7TA 2VJ5A 3F8NA 2L7FP 1WPKA 3BTLA 1ZTRA 1Z91A 2V9VA 4XONA 5DYMA 1G2HA 2R4GA 1HKSA 4IHSA 2BY0A 2DA7A 3OOUA 5HOOA 3F21A 2COMA 1POGA 3A2KA 3L9FA 1IN8A 2XF7A 3K1MA 3KE2A 1MNMC 4IJAA 2Y69H 3FHNA 1FIPA 1X3ZB 1TW3A 1XDUA 3DPLC 5GP9A 3M7GA 4DW6A 1LB2A 2K9NA 3GZ6A 3Q9SA 2QA4I 3N4MA 2JTVA 4ZYEA 4CXFA 4RAFA 1MDMB 1P4WA 5DM6F 2DT6A 1U9NA 4U0WA 2RQQA 3HRUA 1CGPA 2BVLA 2X1DA 5E8GA 2EZHA 2O03A 3E5QA 5ERIA 5CVRA 4A3DJ 2Y0SN 5KHDA 1Y6IA 3CD6I 3P9IA 5LLQA 2X1CA 4BHBA 1K61A 4FT8A 3HOSA 2X6WA 1IF1A 2HOTA 4HNUA 4E6KG 3I0TA 1BJAA 1D3YA 1JUSA 3GO5A 4FISA 4CYCB 3BQYA 1ONVA 2O7OA 3ERMA 3W6JB 1GUUA 4A5NA 1B72A 4KMFA 2GLOA 3MQ0A 5FD6A 3E5XA 3E6CC 4HV6A 1HW2A 3KX2A 4EATA 3PQJA 4N0BA 3K1NA 1TZLA 1Y1VJ 2X6OA 1ON2A 4A6EA 4OMYA 2VOPA 1GHCA 3VYSB 4I7HA 2LFBA 2X9DA 5GADJ 3D5SC 2AQFA 1TQMA 3DKXA 3WE2A 3ZMTA 2MW8A 3KIOA 4UVCA 2NS0A 3H9GA 1D0YA 2PMUA 4PJ0C 1SAXA 1UG0A 2EFQA 2ISYA 4BE1A 2H6BA 2M2EA 3BCAA 2GBYA 2YUSA 1IO2A 2Q2EB 3FMQA 3REOA 5CVJA 2M30A 3BR6A 3I54A 4YELA 5H6RA 3BJ6A 3SXYA 4U87A 1YHQI 5EG0A 1WJDA 4D5CA 2WAEA 5LBQA 3S17J 2E7XA 2NVUB 3DU6A 3FWEA 3DFGA 1P4AA 1U78A 2STTA 4FX4A 4IKFA 1V5FA 2GA2A 3QODA 3X2QH 4QSHA 3V7CA 1F36A 4OIRF 2L7KA 3DPTA 3R4KA 4G12A 3W6VA 1D5VA 2KHMA 1UELB 3EYYA 3RZDJ 1BL0A 3EYIA 3MFKA 1DGWY 1I6XA 2LY2A 3K4LA 3WG7H 5LHHA 2LG4A 2KDZA 3PIOF 4A3LJ 2E60A 3DTEA 4FCYA 1E0EA 1Z0XA 1MW7A 1RETA 2ME0A 3E1SA 2Q2EA 3H9JA 3CESA 4MLOA 1X4PA 3NWSA 3G3ZA 1BOAA 4LLGF 1XX5A 2W00A 3IHUA 3UNGC 4HLYA 4IVNA 3OSGA 3ZN0A 2CMPA 1R5GA 3OYGA 5J47A 3GTPJ 3H1CA 5J8FA 1YX3A 2W7NA 1T8IA 4OOIA 2VT3A 4ON0A 1VQPI 3TOAA 2CSOA 2LYCA 2PEXA 4A0XA 2VC1A 2V79A 3K9TA 5BPDA 2DT5A 2QENA 2CG4A 1ZGJA 2VB6A 5L3FA 3GX4X 3AG4H 2WA0A 1QHGA 1KYWA 2K9MA 2BW3A 1I39A 3HRMA 3I71A 4UHTA 4UUVA 4HA8A 1S6LA 2JPBA 1GV5A 2Z16A 4IHVA 5DCMA 4X0GA 2L3DA 2VQCA 5IY5H 4PK4A 4GYGA 2ZXJA 4H4KC 5GAGJ 1GLNA 3VWBA 3OL3A 2JSPA 4BYYA 1SVLA 5CQEA 2ZNYA 2XGEA 4XLHA 3PFYA 5D4RA 1BJZA 5F04A 3PNTA 3VYTB 4A69C 3GFJA 1LKXA 4BEHA 2A69F 3J80K 4A3MJ 2JT1A 2BYVE 4UNOA 1K4SA 4OAYA 1OR7C 1PUFB 3KLNA 3BZ6A 1USTA 3A4CA 1QZEA 1Z6TA 2DMPA 4HYEA 2CRGA 3KP4A 5F1RA 4N4OB 2DU9A 3RPQA 1K6YA 2OZUA 1FBUA 4G7HF 3I3LA 2WWYA 4FETA 3I5UA 4UVBA 3OYDA 1PP7U 3CCMI 3CUQA 5J4VA 2FBKA 4EEFG 1MKMA 3HKZA 2HVSA 2NNYA 5B5EC 3L2WA 1NG7A 5K7ZA 3HGYA 3HM5A 1CQTA 3WU1B 3VDXA 4F52A 5IYDJ 2IGOA 3NEUA 4CYDA 1TW2A 3F6VA 3LWFA 5K7FA 1ZAOA 2EILH 3HOZJ 4AIDA 2YS9A 2LOOA 4ZDLA 1N25A 1ZELA 1J9IA 4JOMA 4AIHA 5IOZA 2JQ7A 2HTSA 3AAFA 4XM3A 2V6EA 1FOYA 4B3AA 3ABTA 1T2KA 1K6OA 3MWMA 1OISA 3WTSC 1WWXA 4EGYA 2H09A 3S1NJ 1ZK8A 2RNJA 1AWCA 2QEXI 3HZJA 3BTCA 2EQRA 3HL2A 3LFUA 4X1EA 2OQRA 4XKVA 5K5QA 2MC3A 3CLQA 4PDKA 2LY9A 2CWEA 2IGNA 6PAXA 4RLFA 4U7DA 5ICFA 2O9LA 2WY8Q 3CCQI 4GGGA 3TW6A 4NDLA 2O0YA 2GXAA 2DK5A 2DODA 9ANTA 2O3FA 4ENMA 2E1NA 2XHKA 3LNQA 2ACJA 4LIUA 5LGNA 3LSRA 3DU5A 3G73A 1G8XA 3KP6A 3OYIA
chains in the Genus database with same CATH topology
3K0LA 5DUIA 1R7JA 1ZG5A 3DV8A 2VBYA 2PI0A 4RB0A 3FMSA 1B4AA 3WTXC 4KIGA 2DO7A 4XBFA 4A2UA 1TNTA 1MZBA 2LF8A 3H3UA 3I64A 3VB2A 2DW4A 1YS7A 2D1VA 4KN4X 3T8RA 3ABUA 1FP1D 3T1BA 2D2WA 1IN7A 1Z1DA 1S7OA 2AXLA 3RYRA 3BROA 1R1TA 4HX7A 3KEOA 1L0OC 3K1PA 2NAZA 2FF4A 3JTGA 3FF5A 4IXAA 4YG2F 1USSA 2GZWA 3LSTA 2P5VA 4LLNA 1B1BA 5L3GA 3M8EA 2K86A 5HS7A 3ZQ7A 4BQAA 1YQAA 3TOBA 1XDSA 1BIBA 5ILVA 2FXAA 4OIQF 3QOPA 1B9NA 1WQ2A 2PBIA 3KETA 4HX8A 2PG4A 4IF4A 2DAOA 1XMAA 5L3EA 3WG9A 2QBYA 1UCRA 3FX3A 4ESJA 1IXRC 2WC2A 5KVRA 3NRVA 2KIMA 5DD8A 1G3YA 1FP2A 1W5SA 3TGNA 3TKYA 4MEYF 3ECHA 1LVAA 3W6KB 4ZZLA 2J5PA 4L9VA 4XSZF 4YFNF 3RIRA 3MZYA 5E1WA 4DNCA 1ZHFA 2FSWA 3D0SA 4I0BA 4XRFA 3BDDA 4ENNA 1IXCA 2VOOA 2HGCA 3VEPA 4F7ZA 1QQIA 1OR7A 2VXZA 3WTYC 3P9CA 4UV9A 1V3FA 3ISPA 3FHZA 1YG2A 3LA3A 2IW5A 5E20A 3WTTC 4Y13A 3KZYA 4JK1X 3F8BA 3H92A 4M9SA 2ISZA 1JHHA 2EA4A 3V8KA 5FLXK 2A68F 3HRTA 1K7AA 3C1DA 2YX4A 5BOXA 3BJAA 1XGNA 3F3XA 1S8NA 3R0AA 1VTNC 2RQPA 2EFNA 5LRRA 4MGRA 3QAHA 4O6JA 1G6NA 1IZ1A 2VBWA 1UB9A 2E1CA 4KYWA 4WXCA 4L9TA 2QQAA 2YU3A 3GFIA 1LQ1A 1IAWA 1BI2A 4BHPA 4EM1A 3BY6A 3ELKA 1O7FA 4U0YA 1SD7A 4B09A 3RJPA 2FMYA 2A5YB 3I59A 2W84A 3HUGA 2DQLA 3COAC 3RTRA 1O3RA 1B59A 1G3WA 2JZYA 4P96A 1FSHA 5JR3A 5F64A 1SFUA 1HSJA 2JSCA 2NNNA 1AOYA 3CTAA 2XAQA 5F6FA 1FYMA 4M71A 4CHUA 1I1SA 1PDNC 3SHFA 4OINF 1UFMA 1DPRA 1I5ZA 2EK5A 5IT9K 2EFPA 2DQRA 2GWRA 1FT9A 5K5OA 5JFRA 4FX0A 5EEGA 4E70A 3TDZC 4UVAA 1FYKA 3IKVA 4HF2A 5CVVA 2OA4A 2CGPA 4DQ2A 4PZJA 2UXXA 3LA7A 2YX7A 5HVQC 5IT9Z 1YW9A 4WF2A 3HSEA 3EUHA 1ZLKA 3J7AO 2R7DA 1ZYRF 2K7LA 4A0ZA 1ZN2A 3QPTA 3NQOA 2XAFA 2Z5UA 1PUEE 4EM0B 2XASA 2YR2A 4U7BA 3T8TA 5BS6A 4IRGA 4L18B 3P7NA 2XIGA 2OZ6A 4BH9A 1KQ9A 3FXRA 2CYYA 5L3BA 1P92A 4EJVA 4IRHA 3C7JA 2UXNA 4ZYHA 1MGTA 2LDUA 2XGXA 5DDGA 1JGSA 4P9FA 5J6XA 2QLZA 1GXPA 2H27A 3EETA 1FYLA 5LHIA 4RAZA 4RS8A 1XCBA 4ZYGA 2PLYA 4L9JA 3LAPA 3GEZA 1SD4A 5HS8A 1BC8C 1R22A 1BIAA 3ZMSA 5E1ZB 3TQNA 4EM2A 4LB5A 3FMRA 1T98A 3V7RA 4WCGA 1I1GA 3VOEA 1KU2A 2V6CA 1HKQA 3WTUC 1H9TA 1SFEA 4KUMA 3HYIA 3SQNA 4YFKF 2IA1A 3ZMVA 4HQMA 2B0LA 2WTEA 2A6EF 3F8FA 3QP6A 3N97A 3QP5A 5DCMB 5A2QK 1YLFA 2QZ8A 1LJ9A 4LK1F 4BHCA 2XAHA 4LLLA 2ZFWA 1KGSA 1T0FA 1SMYF 4HW0A 3WGIA 4MNUA 5HLGA 1LDKB 2XKOA 4RAYA 1TLHB 4ZH4F 3J81K 2VC0A 5E1XA 1DUXC 3BOQA 5ICGA 3HSRA 2L4AA 5A2QZ 3CUQB 3ZP5A 3EDPA 2GQQA 4U88A 4KN7X 4Q48A 1IN5A 3CO6C 1UHMA 3GZ5A 5LGUA 3F8CA 4CDGA 3SZPA 1KYZA 3DF8A 5D8KB 3B73A 3J81Z 5HDKA 4IHTA 4M9XA 4LGWA 1IUYA 2IA2A 3VODA 2A07F 1KU9A 1Z7UA 1RNLA 1YYVA 3K2ZA 1IN4A 3F6OA 1FY7A 3J80Z 3L2CA 3WE3A 1LEAA 1RI7A 4JBAA 1JHFA 4BXUA 3GVAA 1MJBA 4BAYA 2FNAA 2D45A 1H9GA 1H0MA 1IN6A 1SD5A 1XSVA 2IPQX 4EMSA 4OMZA 2HYFA 1S7AA 4PGHA 2JRTA 3R0JA 2ZKZA 4G6DA 5L3DA 5D5UB 2HKXA 1QNTA 4LK0F 2FU4A 2MH2A 3ERED 4M9ZA 2DBBA 2VE8A 4L0YB 1RUOA 3QU3A 5AIPA 3S2WA 4Q4ZF 1V4RA 4N9IA 1FOKA 3KFWX 4HF1A 2ELHA 4MEXF 3HIFA 3GFLA 2VBZA 4I2OA 4PCQA 2KIFA 2M87A 2V1DA 2M1BA 5K5RA 2XRNA 4MTEA 2BE5F 3GLXA 4G7ZF 4LJZF 1D8JA 3FM5A 4L0ZB 5D8LB 4UV8A 4UXNA 3Q9VA 3IKTA 2QBYB 4I98B 2FNPA 1GVJA 4ZZDA 4CICA 1R36A 2FRHA 2BV6A 1O3SA 1U5TC 1OKRA 5TRDA 2XAJA 4FHTA 2QM3A 1Z05A 3KLOA 5FD5A 2C6YA 3Q5FA 3JSOA 5D4SA 4I09A 5E8IA 3U1DA 2HDCA 2GAUA 2M45A 1SD6A 4K2EA 5HDGA 5ICCA 3V8LA 2CW0F 1EH7A 2W57A 3I4PA 3MAJA 3RPUA 2DK8A 2XROA 5H6QA 4M73A 2L01A 1YO5C 1XN7A 1RZ4A 2PJPA 3E6MA 1UHWA 4OIOF 1J0RA 1OYWA 2HFHA 3M8FA 3SFZA 1XSDA 2OAZA 3CJNA 1FZPB 2IRFG 5E18F 5D5VB 4HZFA 5TJJA 1HQCA 3LQQA 3EQLF 4RB2C 1QGPA 3V4GA 2DTRA 2AS5F 2Z3YA 1DDNA 3KEQA 3HSFA 1O7LA 4EV0A 1J59A 1KA8A 2EFOA 2ETHA 2F5CA 2HQNA 1J7KA 3H3ZA 2MLKA 2GA1A 4G6QA 1FC3A 2KIUA 2RKHA 4WXDA 4YIFA 5K1YA 3JAMK 3TO6A 3KP3A 3HTSB 2H6CA 4O5VA 4MQ9F 2VT2A 4ENJA 1F5TA 1KQ8A 3IL2A 5FGMA 5H20A 1ZRDA 2XV4S 5LEKA 4JQFA 2O6GE 1G4DA 3OV8A 1PP8F 2HEOA 3I59B 1O3QA 5DV5A 3D5LA 2ZCWA 3R6SA 1XB4A 3FXQA 2RV8A 2FBIA 4GXOA 1LEBA 2DLLA 3JAMZ 2Y75A 2LSOA 5HS9A 5LEJA 4KIBA 5FLXZ 1BI3A 1REPC 3E97A 4N9HA 3IRQA 3DKWA 3FZVA 1FNNA 2L54A 3WODF 2K4BA 1RUNA 3BJOA 1HSTA 3F72A 2Z9OA 2W25A 3ZMZA 1I27A 1FBSA 2EV6A 4Z2YA 2PN6A 4G9YA 4I0AA 4NB5A 4ENKA 1R58A 3RKYA 1YFHA 4KDPA 3RI4A 2MA3A 4I02A 1YIOA 3IWZA 1XD7A 1DPUA 5CVUA 4AIJA 5HLIA 2NYXA 5FB2A 1ZG3A 5BQTA 4RB3C 4MTDA 3L00A 3T0YA 2FBHA 2EWNA 1O3TA 3LAJA 4BNCA 3DXJF 3IRRA 4P9UA 4XLPF 2EA2A 4P55A 3CUOA 2K27A 4LB6B 1F1ZA 2EFWA 5KK1A 4YIIA 5FFZA 4AWXB 5CVIA 1JE8A 2IA0A 1U5TA 4A12A 2RVCA 4RGRA 1HKTA 3ZMUA 2CQKA 3MEXA 4QLCU 3KP2A 3MCZA 3BPXA 2A61A 5CJ9A 2YSRA 4KMUX 4ASNA 2UZKA 2BBYA 1KU3A 2PQ8A 2OBPA 4RB1A 1LNWA 3RKXA 3BWGA 3CDHA 3JW4A 1T38A 5LHGA 2WV0A 2KJBA 1SMTA 4HDVA 2OQGA 2P6TA 3RDIA 4ESBA 4LFUA 1IRGA 4H0EA 1YW8A 3L09A 3RYPA 2VN2A 2QYOA 3RKWA 2NRAC 5ED4A 2G7UA 1OYIA 2VBXA 2V1UA 1U6GA 2MBFA 1BI1A 5IT3A 3KP6A 1A04A 1P4XA 4RGUA 4KICA 2FQ3A 4KT5C 1W4MA 3ZN1A 2MLGA 1D8KA 3DEUA 2O61A 1XGMA 1TBXA 2Z33A 2RGVA 1EV7A 4KNYA 3F22A 2F5DA 4U0VA 4RGXA 1TTYA 4Q5SF 3OOPA 2X0LA 5DCFA 3E6DA 1K79A 3DP7A 2ESHA 3WTVC 1MDMA 4ZYDA 4IPAA 4Y15A 3E3VA 3QPHA 2QQ9A 1BI0A 4NHJA 4HLXA 2DI3A 2FA5A 4HF0A 2R7FA 1QO0D 2XVCA 3DQVC 2HQRA 1U8RA 2HTJA 3KP7A 3R60A 2P5KA 3KP5A 3HHHA 3CLOA 4G94A 5JI6A 1BBYA 1TQPA 4M6YA 4G8XA 4CO8A 2ESNA 5FFXA 2DPUA 1R1UA 5D5XB 2QUFA 2HZTA 3M9AA 4HDUA 3I58A 1WI9A 2J5OA 1J5YA 4A5MA 1W7PB 3GUDA 2BGCA 4WX9A 1R23A 1G3TA 4EQQA 3ECOA 3U9GA 1WSUA 4HQEA 4S05A 4KFCA 4WXHA 1Z9CA 5D6FA 4AD9A 2RN7A 1FLIA 4KIFA 1X3UA 1QZZA 2BEOA 3CO7C 2D1HA 4HV5A 1ZARA 1Y0UA 2DPDA 2VE9A 4XSXF 3P9KA 2CO5A 2MD5A 3WGGA 2M8EA 1J2XA 3WGHA 4RGSA 2F5EA 1W7PA 2UWMA 2CFXA 4D0PA 1R5HA 1E17A 2KKOA 3ZPLA 2ZO4A 3U2RA 4GYIA 1ZRFA 3KZZA 3GFMA 2A3SA 5D5WB 1G3SA 1K78B 2O8XA 4L9NA 3O3KA 3QU6A 1LDDA 2ZJ2A 3GXOA 3ZMDA 4L5IA 1XGSA 4OIPF 5E17F 3HOTA 2GXBA 4LMYA 2G7HA 1MJAA 1MD0A 2P7VB 4GO1A 3VFZA 5DUKA 1TQIA 2GIVA 4EGZA 1HW5A 1FSEA 2ZNZA 3JTHA 4ETSA 3ML6A 3O6BB 2XAGA 2XKPA 2P8TA 1RIOH 4TV7A 2OD5A 1Z6RA 5AONA 1T39A 2QQBA 1IW7F 1FWZA 2HR3A 2G9WA 1K78A 2K4JA 2Q8KA 4EJWA 2FOKA 3I53A 3T5XA 3QRFF 4CGZA 1F4KA 4EJUA 2Y48A 5DEQA 1HBXG 1BC7C 2YPRA 1S3JA 2F2EA 4S04A 5HLHA 2K02A 2KJCA 3M1EA 2DFIA 3B02A 4R1HA 1IRFA 2HWVA 1ZREA 1HXDA 1FBQA 3E6BA 1QZYA 2LKPA 1WKMA 4HBLA 1FX7A 4R8HA 1R1VA 4AIKA 5ILUA 2Q0OA 2W85A 5JVTA 4O3MA 2KRFA 1HW1A 2LF7A 5CLSA 3JSPA 1ZG1A 3R61A 1U2WA 4LG0B 1ON1A 4CZZA 4WWCA 3KCCA 2ADUA 4L5JA 1BN5A 1ODDA 2A6HF 1B6AA 1S29A 4KA4A 2QWWA 2V1XA 1B9MA 2E7WA 3F23A 1L3LA 1EH6A 4HOBA 2R3SA 3TO7A 5FO5A 4LG0A 3WTWC 1KQ0A 4EJTA 3WU0A 2LNBA 3SZTA 3C18A 2EV5A 2F5FA 3FXUA 2P4WA 4MQVA 2VODA 1R00A 1QBJA 2STWA 4G7OF 2EJRA 3LA2A 5BMZA 4WK8F 2RC4A 1FPQA 4YFXF 3PFIA 5EEHA 4QWQA 2IT0A 2HS5A 2W24A 2HOEA 1U3EM 2TDXA 4OU0A 5LGTA 1ZRCA 4A0YA 5HDNA 3GW2A 2HYGD 2QVOA 4LD5A 4M74A 5L3CA 2P6SA 5ILSA 1OYYA 1J75A 2ZBKA 1ZH5A 3GYHX 3IWFA 1ZGAA 1OMIA 3V8JA 2PMHA 4XLNF 4P5OA 2FEZA 3HRSA 1ZLJA 1Q1HA 2OU2A 4M72A 1XSXA 4MHGA 4B8XA 4Y17A 4AVPA 3ULQB 1GXQA 4ESFA 1XGOA 5DD4A 5AIQA 2PFBA 3O2PE 3WTZA 1EH8A 3GWZA 3V7SA 4I01A 4R79A 3F8MA 3TDUC 1TNSA 2GXGA 3C3WA 2HKOA 2Z99A 1IXSB 3K69A 1W7PD 1MJ9A 1CF7B 4EJOA 4PGGA 4A6DA 4EVIA 3LFKA 1ULYA 1C0WA 1E2XA 3BPVA 1STZA 1OPCA 1BM9A 2FE3A 2L4MA 3MZHA 1LDJA 4GCVA 2EB7A 3FM3A 5J8CA 5D6EA 3LQRA 1U5TB 2H94A 4Q47A 2ZMEB 1KU7A 2M5WA 1P6RA 5CYVA 1O57A 3PQKA 2X4HA 2FMLA 3IC7A 5LRSA 1CF7A 1XCVA 5ICEA 2IP2A 4NQWA 1XMKA 4HAMA 1YS6A 2EV0A 2MH9A 2RDPA 4HX4A 1YTYA 2P7CB 2L02A 1F9NA 1WRJA 3HTUA 2IVMA 1P2FA 1W5TA 1T6SA 1YW7A 4M6XA 1NHAA 2XUBA 2ZMEA 3BP8A 2P5LC 1QPMA 2IJLA 3ROUA 3E5UA 3L7WA 3CUQC 3GF2A 2VONA 3HHGA 1DP7P 5JHUA 4IRIA 5BPIA 3TO9A 2JPCA 1JXSA 1SFXA 2Y0MA 3F8NA 1Z91A 2V9VA 5DYMA 1HKSA 4IHSA 5HOOA 3F21A 2COMA 3L9FA 1IN8A 3K1MA 3KE2A 4IJAA 1LB2A 1TW3A 1XDUA 3DPLC 3M7GA 3GZ6A 3Q9SA 3N4MA 2JTVA 4ZYEA 4CXFA 1MDMB 1P4WA 4U0WA 1CGPA 3HRUA 5E8GA 2O03A 3E5QA 5ERIA 5CVRA 3P9IA 5LLQA 4BHBA 4FT8A 3HOSA 1IF1A 3I0TA 1BJAA 1D3YA 3GO5A 1ONVA 3W6JB 4A5NA 4KMFA 3MQ0A 5FD6A 3E5XA 3E6CC 4HV6A 1HW2A 3PQJA 4N0BA 3K1NA 1ON2A 4A6EA 4OMYA 2VOPA 1GHCA 4I7HA 1TQMA 3WE2A 3ZMTA 4UVCA 2NS0A 2PMUA 1SAXA 2EFQA 2ISYA 2H6BA 3FMQA 3REOA 5CVJA 2M30A 3I54A 5H6RA 3BJ6A 3SXYA 5LBQA 2E7XA 3FWEA 3DFGA 1P4AA 1U78A 2STTA 4FX4A 2GA2A 3V7CA 4OIRF 3DPTA 3R4KA 1D5VA 3EYYA 3EYIA 3MFKA 1I6XA 5LHHA 2Q2EA 3G3ZA 1BOAA 4LLGF 3IHUA 4HLYA 4IVNA 3ZN0A 1R5GA 5J8FA 4OOIA 2VT3A 4ON0A 3TOAA 2CSOA 2PEXA 4A0XA 2VC1A 2V79A 3K9TA 5BPDA 2DT5A 2QENA 2CG4A 1ZGJA 5L3FA 3GX4X 1KYWA 3I71A 3HRMA 4UHTA 4UUVA 4HA8A 1S6LA 2JPBA 5DCMA 2L3DA 4GYGA 2ZXJA 4BYYA 2ZNYA 5D4RA 3GFJA 2A69F 3J80K 2JT1A 2BYVE 4UNOA 3KLNA 3BZ6A 1USTA 4HYEA 1Z6TA 3KP4A 5F1RA 2DU9A 3RPQA 2OZUA 1FBUA 4G7HF 2WWYA 4UVBA 3I5UA 1PP7U 3CUQA 2FBKA 1MKMA 2NNYA 3WU1B 3NEUA 4CYDA 1TW2A 3F6VA 3LWFA 1ZAOA 1J9IA 4AIHA 2HTSA 3AAFA 3ABTA 1T2KA 1K6OA 3MWMA 3WTSC 1WWXA 4EGYA 2H09A 2RNJA 1AWCA 2OQRA 5K5QA 2MC3A 4PDKA 2CWEA 6PAXA 4U7DA 5ICFA 4GGGA 2O0YA 2DK5A 2O3FA 4ENMA 2E1NA 2XHKA 2ACJA 5LGNA 3G73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0L A;  5DUI A;  1R7J A;  1ZG5 A;  3DV8 A;  2VBY A;  2PI0 A;  4RB0 A;  3FMS A;  1B4A A;  3WTX C;  4KIG A;  2DO7 A;  4XBF A;  4A2U A;  1TNT A;  1MZB A;  2LF8 A;  3H3U A;  3I64 A;  3VB2 A;  2DW4 A;  1YS7 A;  2D1V A;  4KN4 X;  3T8R A;  3ABU A;  1FP1 D;  3T1B A;  2D2W A;  1IN7 A;  1Z1D A;  1S7O A;  2AXL A;  3RYR A;  3BRO A;  1R1T A;  4HX7 A;  3KEO A;  1L0O C;  3K1P A;  2NAZ A;  2FF4 A;  3JTG A;  3FF5 A;  4IXA A;  4YG2 F;  1USS A;  2GZW A;  3LST A;  2P5V A;  4LLN A;  1B1B A;  5L3G A;  3M8E A;  2K86 A;  5HS7 A;  3ZQ7 A;  4BQA A;  1YQA A;  3TOB A;  1XDS A;  1BIB A;  5ILV A;  2FXA A;  4OIQ F;  3QOP A;  1B9N A;  1WQ2 A;  2PBI A;  3KET A;  4HX8 A;  2PG4 A;  4IF4 A;  2DAO A;  1XMA A;  5L3E A;  3WG9 A;  2QBY A;  1UCR A;  3FX3 A;  4ESJ A;  1IXR C;  2WC2 A;  5KVR A;  3NRV A;  2KIM A;  5DD8 A;  1G3Y A;  1FP2 A;  1W5S A;  3TGN A;  3TKY A;  4MEY F;  3ECH A;  1LVA A;  3W6K B;  4ZZL A;  2J5P A;  4L9V A;  4XSZ F;  4YFN F;  3RIR A;  3MZY A;  5E1W A;  4DNC A;  1ZHF A;  2FSW A;  3D0S A;  4I0B A;  4XRF A;  3BDD A;  4ENN A;  1IXC A;  2VOO A;  2HGC A;  3VEP A;  4F7Z A;  1QQI A;  1OR7 A;  2VXZ A;  3WTY C;  3P9C A;  4UV9 A;  1V3F A;  3ISP A;  3FHZ A;  1YG2 A;  3LA3 A;  2IW5 A;  5E20 A;  3WTT C;  4Y13 A;  3KZY A;  4JK1 X;  3F8B A;  3H92 A;  4M9S A;  2ISZ A;  1JHH A;  2EA4 A;  3V8K A;  5FLX K;  2A68 F;  3HRT A;  1K7A A;  3C1D A;  2YX4 A;  5BOX A;  3BJA A;  1XGN A;  3F3X A;  1S8N A;  3R0A A;  1VTN C;  2RQP A;  2EFN A;  5LRR A;  4MGR A;  3QAH A;  4O6J A;  1G6N A;  1IZ1 A;  2VBW A;  1UB9 A;  2E1C A;  4KYW A;  4WXC A;  4L9T A;  2QQA A;  2YU3 A;  3GFI A;  1LQ1 A;  1IAW A;  1BI2 A;  4BHP A;  4EM1 A;  3BY6 A;  3ELK A;  1O7F A;  4U0Y A;  1SD7 A;  4B09 A;  3RJP A;  2FMY A;  2A5Y B;  3I59 A;  2W84 A;  3HUG A;  2DQL A;  3COA C;  3RTR A;  1O3R A;  1B59 A;  1G3W A;  2JZY A;  4P96 A;  1FSH A;  5JR3 A;  5F64 A;  1SFU A;  1HSJ A;  2JSC A;  2NNN A;  1AOY A;  3CTA A;  2XAQ A;  5F6F A;  1FYM A;  4M71 A;  4CHU A;  1I1S A;  1PDN C;  3SHF A;  4OIN F;  1UFM A;  1DPR A;  1I5Z A;  2EK5 A;  5IT9 K;  2EFP A;  2DQR A;  2GWR A;  1FT9 A;  5K5O A;  5JFR A;  4FX0 A;  5EEG A;  4E70 A;  3TDZ C;  4UVA A;  1FYK A;  3IKV A;  4HF2 A;  5CVV A;  2OA4 A;  2CGP A;  4DQ2 A;  4PZJ A;  2UXX A;  3LA7 A;  2YX7 A;  5HVQ C;  5IT9 Z;  1YW9 A;  4WF2 A;  3HSE A;  3EUH A;  1ZLK A;  3J7A O;  2R7D A;  1ZYR F;  2K7L A;  4A0Z A;  1ZN2 A;  3QPT A;  3NQO A;  2XAF A;  2Z5U A;  1PUE E;  4EM0 B;  2XAS A;  2YR2 A;  4U7B A;  3T8T A;  5BS6 A;  4IRG A;  4L18 B;  3P7N A;  2XIG A;  2OZ6 A;  4BH9 A;  1KQ9 A;  3FXR A;  2CYY A;  5L3B A;  1P92 A;  4EJV A;  4IRH A;  3C7J A;  2UXN A;  4ZYH A;  1MGT A;  2LDU A;  2XGX A;  5DDG A;  1JGS A;  4P9F A;  5J6X A;  2QLZ A;  1GXP A;  2H27 A;  3EET A;  1FYL A;  5LHI A;  4RAZ A;  4RS8 A;  1XCB A;  4ZYG A;  2PLY A;  4L9J A;  3LAP A;  3GEZ A;  1SD4 A;  5HS8 A;  1BC8 C;  1R22 A;  1BIA A;  3ZMS A;  5E1Z B;  3TQN A;  4EM2 A;  4LB5 A;  3FMR A;  1T98 A;  3V7R A;  4WCG A;  1I1G A;  3VOE A;  1KU2 A;  2V6C A;  1HKQ A;  3WTU C;  1H9T A;  1SFE A;  4KUM A;  3HYI A;  3SQN A;  4YFK F;  2IA1 A;  3ZMV A;  4HQM A;  2B0L A;  2WTE A;  2A6E F;  3F8F A;  3QP6 A;  3N97 A;  3QP5 A;  5DCM B;  5A2Q K;  1YLF A;  2QZ8 A;  1LJ9 A;  4LK1 F;  4BHC A;  2XAH A;  4LLL A;  2ZFW A;  1KGS A;  1T0F A;  1SMY F;  4HW0 A;  3WGI A;  4MNU A;  5HLG A;  1LDK B;  2XKO A;  4RAY A;  1TLH B;  4ZH4 F;  3J81 K;  2VC0 A;  5E1X A;  1DUX C;  3BOQ A;  5ICG A;  3HSR A;  2L4A A;  5A2Q Z;  3CUQ B;  3ZP5 A;  3EDP A;  2GQQ A;  4U88 A;  4KN7 X;  4Q48 A;  1IN5 A;  3CO6 C;  1UHM A;  3GZ5 A;  5LGU A;  3F8C A;  4CDG A;  3SZP A;  1KYZ A;  3DF8 A;  5D8K B;  3B73 A;  3J81 Z;  5HDK A;  4IHT A;  4M9X A;  4LGW A;  1IUY A;  2IA2 A;  3VOD A;  2A07 F;  1KU9 A;  1Z7U A;  1RNL A;  1YYV A;  3K2Z A;  1IN4 A;  3F6O A;  1FY7 A;  3J80 Z;  3L2C A;  3WE3 A;  1LEA A;  1RI7 A;  4JBA A;  1JHF A;  4BXU A;  3GVA A;  1MJB A;  4BAY A;  2FNA A;  2D45 A;  1H9G A;  1H0M A;  1IN6 A;  1SD5 A;  1XSV A;  2IPQ X;  4EMS A;  4OMZ A;  2HYF A;  1S7A A;  4PGH A;  2JRT A;  3R0J A;  2ZKZ A;  4G6D A;  5L3D A;  5D5U B;  2HKX A;  1QNT A;  4LK0 F;  2FU4 A;  2MH2 A;  3ERE D;  4M9Z A;  2DBB A;  2VE8 A;  4L0Y B;  1RUO A;  3QU3 A;  5AIP A;  3S2W A;  4Q4Z F;  1V4R A;  4N9I A;  1FOK A;  3KFW X;  4HF1 A;  2ELH A;  4MEX F;  3HIF A;  3GFL A;  2VBZ A;  4I2O A;  4PCQ A;  2KIF A;  2M87 A;  2V1D A;  2M1B A;  5K5R A;  2XRN A;  4MTE A;  2BE5 F;  3GLX A;  4G7Z F;  4LJZ F;  1D8J A;  3FM5 A;  4L0Z B;  5D8L B;  4UV8 A;  4UXN A;  3Q9V A;  3IKT A;  2QBY B;  4I98 B;  2FNP A;  1GVJ A;  4ZZD A;  4CIC A;  1R36 A;  2FRH A;  2BV6 A;  1O3S A;  1U5T C;  1OKR A;  5TRD A;  2XAJ A;  4FHT A;  2QM3 A;  1Z05 A;  3KLO A;  5FD5 A;  2C6Y A;  3Q5F A;  3JSO A;  5D4S A;  4I09 A;  5E8I A;  3U1D A;  2HDC A;  2GAU A;  2M45 A;  1SD6 A;  4K2E A;  5HDG A;  5ICC A;  3V8L A;  2CW0 F;  1EH7 A;  2W57 A;  3I4P A;  3MAJ A;  3RPU A;  2DK8 A;  2XRO A;  5H6Q A;  4M73 A;  2L01 A;  1YO5 C;  1XN7 A;  1RZ4 A;  2PJP A;  3E6M A;  1UHW A;  4OIO F;  1J0R A;  1OYW A;  2HFH A;  3M8F A;  3SFZ A;  1XSD A;  2OAZ A;  3CJN A;  1FZP B;  2IRF G;  5E18 F;  5D5V B;  4HZF A;  5TJJ A;  1HQC A;  3LQQ A;  3EQL F;  4RB2 C;  1QGP A;  3V4G A;  2DTR A;  2AS5 F;  2Z3Y A;  1DDN A;  3KEQ A;  3HSF A;  1O7L A;  4EV0 A;  1J59 A;  1KA8 A;  2EFO A;  2ETH A;  2F5C A;  2HQN A;  1J7K A;  3H3Z A;  2MLK A;  2GA1 A;  4G6Q A;  1FC3 A;  2KIU A;  2RKH A;  4WXD A;  4YIF A;  5K1Y A;  3JAM K;  3TO6 A;  3KP3 A;  3HTS B;  2H6C A;  4O5V A;  4MQ9 F;  2VT2 A;  4ENJ A;  1F5T A;  1KQ8 A;  3IL2 A;  5FGM A;  5H20 A;  1ZRD A;  2XV4 S;  5LEK A;  4JQF A;  2O6G E;  1G4D A;  3OV8 A;  1PP8 F;  2HEO A;  3I59 B;  1O3Q A;  5DV5 A;  3D5L A;  2ZCW A;  3R6S A;  1XB4 A;  3FXQ A;  2RV8 A;  2FBI A;  4GXO A;  1LEB A;  2DLL A;  3JAM Z;  2Y75 A;  2LSO A;  5HS9 A;  5LEJ A;  4KIB A;  5FLX Z;  1BI3 A;  1REP C;  3E97 A;  4N9H A;  3IRQ A;  3DKW A;  3FZV A;  1FNN A;  2L54 A;  3WOD F;  2K4B A;  1RUN A;  3BJO A;  1HST A;  3F72 A;  2Z9O A;  2W25 A;  3ZMZ A;  1I27 A;  1FBS A;  2EV6 A;  4Z2Y A;  2PN6 A;  4G9Y A;  4I0A A;  4NB5 A;  4ENK A;  1R58 A;  3RKY A;  1YFH A;  4KDP A;  3RI4 A;  2MA3 A;  4I02 A;  1YIO A;  3IWZ A;  1XD7 A;  1DPU A;  5CVU A;  4AIJ A;  5HLI A;  2NYX A;  5FB2 A;  1ZG3 A;  5BQT A;  4RB3 C;  4MTD A;  3L00 A;  3T0Y A;  2FBH A;  2EWN A;  1O3T A;  3LAJ A;  4BNC A;  3DXJ F;  3IRR A;  4P9U A;  4XLP F;  2EA2 A;  4P55 A;  3CUO A;  2K27 A;  4LB6 B;  1F1Z A;  2EFW A;  5KK1 A;  4YII A;  5FFZ A;  4AWX B;  5CVI A;  1JE8 A;  2IA0 A;  1U5T A;  4A12 A;  2RVC A;  4RGR A;  1HKT A;  3ZMU A;  2CQK A;  3MEX A;  4QLC U;  3KP2 A;  3MCZ A;  3BPX A;  2A61 A;  5CJ9 A;  2YSR A;  4KMU X;  4ASN A;  2UZK A;  2BBY A;  1KU3 A;  2PQ8 A;  2OBP A;  4RB1 A;  1LNW A;  3RKX A;  3BWG A;  3CDH A;  3JW4 A;  1T38 A;  5LHG A;  2WV0 A;  2KJB A;  1SMT A;  4HDV A;  2OQG A;  2P6T A;  3RDI A;  4ESB A;  4LFU A;  1IRG A;  4H0E A;  1YW8 A;  3L09 A;  3RYP A;  2VN2 A;  2QYO A;  3RKW A;  2NRA C;  5ED4 A;  2G7U A;  1OYI A;  2VBX A;  2V1U A;  1U6G A;  2MBF A;  1BI1 A;  5IT3 A;  3KP6 A;  1A04 A;  1P4X A;  4RGU A;  4KIC A;  2FQ3 A;  4KT5 C;  1W4M A;  3ZN1 A;  2MLG A;  1D8K A;  3DEU A;  2O61 A;  1XGM A;  1TBX A;  2Z33 A;  2RGV A;  1EV7 A;  4KNY A;  3F22 A;  2F5D A;  4U0V A;  4RGX A;  1TTY A;  4Q5S F;  3OOP A;  2X0L A;  5DCF A;  3E6D A;  1K79 A;  3DP7 A;  2ESH A;  3WTV C;  1MDM A;  4ZYD A;  4IPA A;  4Y15 A;  3E3V A;  3QPH A;  2QQ9 A;  1BI0 A;  4NHJ A;  4HLX A;  2DI3 A;  2FA5 A;  4HF0 A;  2R7F A;  1QO0 D;  2XVC A;  3DQV C;  2HQR A;  1U8R A;  2HTJ A;  3KP7 A;  3R60 A;  2P5K A;  3KP5 A;  3HHH A;  3CLO A;  4G94 A;  5JI6 A;  1BBY A;  1TQP A;  4M6Y A;  4G8X A;  4CO8 A;  2ESN A;  5FFX A;  2DPU A;  1R1U A;  5D5X B;  2QUF A;  2HZT A;  3M9A A;  4HDU A;  3I58 A;  1WI9 A;  2J5O A;  1J5Y A;  4A5M A;  1W7P B;  3GUD A;  2BGC A;  4WX9 A;  1R23 A;  1G3T A;  4EQQ A;  3ECO A;  3U9G A;  1WSU A;  4HQE A;  4S05 A;  4KFC A;  4WXH A;  1Z9C A;  5D6F A;  4AD9 A;  2RN7 A;  1FLI A;  4KIF A;  1X3U A;  1QZZ A;  2BEO A;  3CO7 C;  2D1H A;  4HV5 A;  1ZAR A;  1Y0U A;  2DPD A;  2VE9 A;  4XSX F;  3P9K A;  2CO5 A;  2MD5 A;  3WGG A;  2M8E A;  1J2X A;  3WGH A;  4RGS A;  2F5E A;  1W7P A;  2UWM A;  2CFX A;  4D0P A;  1R5H A;  1E17 A;  2KKO A;  3ZPL A;  2ZO4 A;  3U2R A;  4GYI A;  1ZRF A;  3KZZ A;  3GFM A;  2A3S A;  5D5W B;  1G3S A;  1K78 B;  2O8X A;  4L9N A;  3O3K A;  3QU6 A;  1LDD A;  2ZJ2 A;  3GXO A;  3ZMD A;  4L5I A;  1XGS A;  4OIP F;  5E17 F;  3HOT A;  2GXB A;  4LMY A;  2G7H A;  1MJA A;  1MD0 A;  2P7V B;  4GO1 A;  3VFZ A;  5DUK A;  1TQI A;  2GIV A;  4EGZ A;  1HW5 A;  1FSE A;  2ZNZ A;  3JTH A;  4ETS A;  3ML6 A;  3O6B B;  2XAG A;  2XKP A;  2P8T A;  1RIO H;  4TV7 A;  2OD5 A;  1Z6R A;  5AON A;  1T39 A;  2QQB A;  1IW7 F;  1FWZ A;  2HR3 A;  2G9W A;  1K78 A;  2K4J A;  2Q8K A;  4EJW A;  2FOK A;  3I53 A;  3T5X A;  3QRF F;  4CGZ A;  1F4K A;  4EJU A;  2Y48 A;  5DEQ A;  1HBX G;  1BC7 C;  2YPR A;  1S3J A;  2F2E A;  4S04 A;  5HLH A;  2K02 A;  2KJC A;  3M1E A;  2DFI A;  3B02 A;  4R1H A;  1IRF A;  2HWV A;  1ZRE A;  1HXD A;  1FBQ A;  3E6B A;  1QZY A;  2LKP A;  1WKM A;  4HBL A;  1FX7 A;  4R8H A;  1R1V A;  4AIK A;  5ILU A;  2Q0O A;  2W85 A;  5JVT A;  4O3M A;  2KRF A;  1HW1 A;  2LF7 A;  5CLS A;  3JSP A;  1ZG1 A;  3R61 A;  1U2W A;  4LG0 B;  1ON1 A;  4CZZ A;  4WWC A;  3KCC A;  2ADU A;  4L5J A;  1BN5 A;  1ODD A;  2A6H F;  1B6A A;  1S29 A;  4KA4 A;  2QWW A;  2V1X A;  1B9M A;  2E7W A;  3F23 A;  1L3L A;  1EH6 A;  4HOB A;  2R3S A;  3TO7 A;  5FO5 A;  4LG0 A;  3WTW C;  1KQ0 A;  4EJT A;  3WU0 A;  2LNB A;  3SZT A;  3C18 A;  2EV5 A;  2F5F A;  3FXU A;  2P4W A;  4MQV A;  2VOD A;  1R00 A;  1QBJ A;  2STW A;  4G7O F;  2EJR A;  3LA2 A;  5BMZ A;  4WK8 F;  2RC4 A;  1FPQ A;  4YFX F;  3PFI A;  5EEH A;  4QWQ A;  2IT0 A;  2HS5 A;  2W24 A;  2HOE A;  1U3E M;  2TDX A;  4OU0 A;  5LGT A;  1ZRC A;  4A0Y A;  5HDN A;  3GW2 A;  2HYG D;  2QVO A;  4LD5 A;  4M74 A;  5L3C A;  2P6S A;  5ILS A;  1OYY A;  1J75 A;  2ZBK A;  1ZH5 A;  3GYH X;  3IWF A;  1ZGA A;  1OMI A;  3V8J A;  2PMH A;  4XLN F;  4P5O A;  2FEZ A;  3HRS A;  1ZLJ A;  1Q1H A;  2OU2 A;  4M72 A;  1XSX A;  4MHG A;  4B8X A;  4Y17 A;  4AVP A;  3ULQ B;  1GXQ A;  4ESF A;  1XGO A;  5DD4 A;  5AIQ A;  2PFB A;  3O2P E;  3WTZ A;  1EH8 A;  3GWZ A;  3V7S A;  4I01 A;  4R79 A;  3F8M A;  3TDU C;  1TNS A;  2GXG A;  3C3W A;  2HKO A;  2Z99 A;  1IXS B;  3K69 A;  1W7P D;  1MJ9 A;  1CF7 B;  4EJO A;  4PGG A;  4A6D A;  4EVI A;  3LFK A;  1ULY A;  1C0W A;  1E2X A;  3BPV A;  1STZ A;  1OPC A;  1BM9 A;  2FE3 A;  2L4M A;  3MZH A;  1LDJ A;  4GCV A;  2EB7 A;  3FM3 A;  5J8C A;  5D6E A;  3LQR A;  1U5T B;  2H94 A;  4Q47 A;  2ZME B;  1KU7 A;  2M5W A;  1P6R A;  5CYV A;  1O57 A;  3PQK A;  2X4H A;  2FML A;  3IC7 A;  5LRS A;  1CF7 A;  1XCV A;  5ICE A;  2IP2 A;  4NQW A;  1XMK A;  4HAM A;  1YS6 A;  2EV0 A;  2MH9 A;  2RDP A;  4HX4 A;  1YTY A;  2P7C B;  2L02 A;  1F9N A;  1WRJ A;  3HTU A;  2IVM A;  1P2F A;  1W5T A;  1T6S A;  1YW7 A;  4M6X A;  1NHA A;  2XUB A;  2ZME A;  3BP8 A;  2P5L C;  1QPM A;  2IJL A;  3ROU A;  3E5U A;  3L7W A;  3CUQ C;  3GF2 A;  2VON A;  3HHG A;  1DP7 P;  5JHU A;  4IRI A;  5BPI A;  3TO9 A;  2JPC A;  1JXS A;  1SFX A;  2Y0M A;  3F8N A;  1Z91 A;  2V9V A;  5DYM A;  1HKS A;  4IHS A;  5HOO A;  3F21 A;  2COM A;  3L9F A;  1IN8 A;  3K1M A;  3KE2 A;  4IJA A;  1LB2 A;  1TW3 A;  1XDU A;  3DPL C;  3M7G A;  3GZ6 A;  3Q9S A;  3N4M A;  2JTV A;  4ZYE A;  4CXF A;  1MDM B;  1P4W A;  4U0W A;  1CGP A;  3HRU A;  5E8G A;  2O03 A;  3E5Q A;  5ERI A;  5CVR A;  3P9I A;  5LLQ A;  4BHB A;  4FT8 A;  3HOS A;  1IF1 A;  3I0T A;  1BJA A;  1D3Y A;  3GO5 A;  1ONV A;  3W6J B;  4A5N A;  4KMF A;  3MQ0 A;  5FD6 A;  3E5X A;  3E6C C;  4HV6 A;  1HW2 A;  3PQJ A;  4N0B A;  3K1N A;  1ON2 A;  4A6E A;  4OMY A;  2VOP A;  1GHC A;  4I7H A;  1TQM A;  3WE2 A;  3ZMT A;  4UVC A;  2NS0 A;  2PMU A;  1SAX A;  2EFQ A;  2ISY A;  2H6B A;  3FMQ A;  3REO A;  5CVJ A;  2M30 A;  3I54 A;  5H6R A;  3BJ6 A;  3SXY A;  5LBQ A;  2E7X A;  3FWE A;  3DFG A;  1P4A A;  1U78 A;  2STT A;  4FX4 A;  2GA2 A;  3V7C A;  4OIR F;  3DPT A;  3R4K A;  1D5V A;  3EYY A;  3EYI A;  3MFK A;  1I6X A;  5LHH A;  2Q2E A;  3G3Z A;  1BOA A;  4LLG F;  3IHU A;  4HLY A;  4IVN A;  3ZN0 A;  1R5G A;  5J8F A;  4OOI A;  2VT3 A;  4ON0 A;  3TOA A;  2CSO A;  2PEX A;  4A0X A;  2VC1 A;  2V79 A;  3K9T A;  5BPD A;  2DT5 A;  2QEN A;  2CG4 A;  1ZGJ A;  5L3F A;  3GX4 X;  1KYW A;  3I71 A;  3HRM A;  4UHT A;  4UUV A;  4HA8 A;  1S6L A;  2JPB A;  5DCM A;  2L3D A;  4GYG A;  2ZXJ A;  4BYY A;  2ZNY A;  5D4R A;  3GFJ A;  2A69 F;  3J80 K;  2JT1 A;  2BYV E;  4UNO A;  3KLN A;  3BZ6 A;  1UST A;  4HYE A;  1Z6T A;  3KP4 A;  5F1R A;  2DU9 A;  3RPQ A;  2OZU A;  1FBU A;  4G7H F;  2WWY A;  4UVB A;  3I5U A;  1PP7 U;  3CUQ A;  2FBK A;  1MKM A;  2NNY A;  3WU1 B;  3NEU A;  4CYD A;  1TW2 A;  3F6V A;  3LWF A;  1ZAO A;  1J9I A;  4AIH A;  2HTS A;  3AAF A;  3ABT A;  1T2K A;  1K6O A;  3MWM A;  3WTS C;  1WWX A;  4EGY A;  2H09 A;  2RNJ A;  1AWC A;  2OQR A;  5K5Q A;  2MC3 A;  4PDK A;  2CWE A;  6PAX A;  4U7D A;  5ICF A;  4GGG A;  2O0Y A;  2DK5 A;  2O3F A;  4ENM A;  2E1N A;  2XHK A;  2ACJ A;  5LGN A;  3G73 A; 
#chains in the Genus database with same CATH topology
 3K0L A;  5DUI A;  1LVK A;  1R7J A;  5IP7 J;  1ZG5 A;  1APL C;  3IAM 2;  3DV8 A;  4DYC A;  1UAA A;  5CPR B;  3FKJ A;  3CF5 F;  2LC2 A;  2VBY A;  2PI0 A;  3KYD B;  3J7Y J;  4RB0 A;  1DGR M;  3FMS A;  1B4A A;  3WTX C;  4KIG A;  1SVM A;  2DO7 A;  4XBF A;  3GTQ J;  2LBF B;  4A2U A;  1TNT A;  1MZB A;  2LF8 A;  3H3U A;  2GOX B;  3I64 A;  3VB2 A;  2XC7 A;  2DW4 A;  2DA6 A;  1YS7 A;  4BGD A;  2D1V A;  3J7Z I;  2OUM A;  4KN4 X;  2H8R A;  3T8R A;  3ABU A;  1FP1 D;  4UUT A;  3T1B A;  2HVR A;  2D2W A;  1IN7 A;  1Z1D A;  5FLM J;  3BG5 A;  1S7O A;  5EGO A;  3BZK A;  1D0X A;  2AXL A;  2HXO A;  2CV0 A;  3RYR A;  5C4J J;  4RDU A;  3BRO A;  1R1T A;  2X6Y A;  4HX7 A;  4M6V A;  3KEO A;  4NNJ A;  4RLQ A;  1L0O C;  5FKL A;  1NG6 A;  3K1P A;  2WAQ A;  2NAZ A;  2K5C A;  2FF4 A;  3MVP A;  2CH0 A;  3JTG A;  3FF5 A;  2CQN A;  4F92 B;  4IXA A;  4YG2 F;  1USS A;  2GZW A;  3LST A;  2P5V A;  1ZQ3 P;  4LLN A;  1B1B A;  4E4H A;  3M8E A;  5L3G A;  2K9L A;  4BL0 B;  2K86 A;  5HS7 A;  3ZQ7 A;  2M0C A;  4BQA A;  2E2H J;  3BR1 A;  1YQA A;  3TOB A;  5IOY A;  2V4J C;  1FIA A;  1XDS A;  3S1R J;  1BIB A;  5ILV A;  2FXA A;  3JRC A;  4OIQ F;  2R92 J;  3QOP A;  1B9N A;  1WQ2 A;  2PBI A;  3KET A;  1NTC A;  4BJ6 C;  4QPQ A;  5C3E J;  4HX8 A;  3EUH C;  2PG4 A;  4Z6Y A;  4IF4 A;  5JVG F;  2DAO A;  4XN0 A;  1XMA A;  5L3E A;  3WG9 A;  1ETO A;  1X1B A;  2QBY A;  2DFH A;  3HOX J;  2JA7 J;  1UCR A;  3M4O J;  3FX3 A;  4ESJ A;  1IXR C;  2WC2 A;  5KVR A;  3NRV A;  3CMA I;  1T33 A;  2KMU A;  4XNF A;  3A02 A;  2KIM A;  4IHW A;  3OYJ A;  5DD8 A;  3BCB A;  1G3Y A;  1FP2 A;  1W5S A;  2W1O A;  3TGN A;  3TKY A;  3K2A A;  4HG2 A;  4MEY F;  3ECH A;  3OYM A;  1LVA A;  1A5J A;  2IAI A;  3W6K B;  4FE4 A;  3TBI A;  3ZQC A;  2OTJ I;  4ZZL A;  2J5P A;  4L9V A;  4J00 A;  4XSZ F;  3RSN A;  4C2M J;  4YFN F;  1P7J A;  1LFB A;  3RIR A;  2ZXI A;  1BR2 A;  2DJI A;  3MZY A;  4XID A;  3AL0 B;  1TT5 B;  1HDP A;  5E1W A;  1AA7 A;  3DBL B;  4DNC A;  1ZHF A;  5HLT A;  1S9H A;  2FSW A;  3D0S A;  4I0B A;  3BDD A;  4XRF A;  1KZH A;  4BDZ A;  1EKE A;  4XIC A;  4ENN A;  2ELJ A;  2HDD A;  3DKY A;  1IXC A;  2VOO A;  2HGC A;  3VEP A;  1FTZ A;  1I3A A;  5GTH C;  4C2U A;  5B66 C;  4F7Z A;  2V9P A;  1N77 A;  4UUS B;  1QQI A;  1OR7 A;  2VXZ A;  1S72 I;  4F3Q A;  3WTY C;  3P9C A;  4OWR B;  4UV9 A;  4BDY A;  2DYS H;  4XRM A;  1QA6 A;  1FEX A;  1V3F A;  3ISP A;  5F0C A;  1YG2 A;  3FHZ A;  3LA3 A;  2L5Q A;  2IW5 A;  3LSK A;  4MO7 A;  5E20 A;  5IYC J;  3WTT C;  4KIS A;  3L2U A;  2KP6 A;  4II2 A;  1RC9 A;  4Y13 A;  2UV1 A;  3JRG A;  2VPR A;  1VQN I;  3KZY A;  4JK1 X;  3F8B A;  3H92 A;  4M9S A;  2ISZ A;  1JHH A;  4JX6 A;  2EA4 A;  3V8K A;  5FLX K;  2A68 F;  2E5Z A;  2MYS A;  3HRT A;  2R7R A;  4XQF A;  1K7A A;  4C3I J;  2WY7 Q;  3C1D A;  2YX4 A;  1VQ8 I;  2G0E A;  5BOX A;  3BJA A;  2XPV A;  2E71 A;  3HOV J;  4A3I J;  1XGN A;  3F3X A;  5C4X J;  1S8N A;  4A3K J;  3R0A A;  1VTN C;  3HUG B;  2RQP A;  4ITV A;  4UUS A;  1B8I B;  1K83 J;  3H9Q A;  2EFN A;  3LL7 A;  5LRR A;  2IS1 A;  2WB1 N;  4MGR A;  3QAH A;  4O6J A;  2L9N A;  2BVM A;  1G6N A;  2EPF A;  4M3G A;  1IZ1 A;  5KAI C;  2RAE A;  3K4B A;  2VBW A;  4NQW B;  2R7S A;  1UB9 A;  2E1C A;  4KYW A;  3BC8 A;  2D5V A;  4BAC A;  2HOS A;  3PJR A;  3MKW B;  3CF2 A;  1IV6 A;  2AXT C;  4WXC A;  1GDT A;  2FJ1 A;  4AYB N;  4L9T A;  1Q1V A;  2QQA A;  3A01 B;  2YU3 A;  4QPO A;  3K4C A;  3GFI A;  1NK3 P;  1LQ1 A;  1IAW A;  1BI2 A;  1T0F C;  4BHP A;  4EM1 A;  3BY6 A;  3ELK A;  1O7F A;  4AC0 A;  2IS4 A;  3BR0 A;  1UJ8 A;  1SD7 A;  4B09 A;  4U0Y A;  3RJP A;  3D5R C;  3OYK A;  3J7A Y;  2FMY A;  2A5Y B;  2M8G X;  3I59 A;  1T95 A;  2W84 A;  3HUG A;  2DQL A;  3COA C;  3RTR A;  1O3R A;  2OJE D;  4DGW B;  1B59 A;  1FMV A;  3S2D J;  1B8I A;  1MMD A;  1G3W A;  2F4I A;  2JZY A;  1UZC A;  4P96 A;  2ZJQ F;  1FSH A;  1E3P A;  2VUM J;  5JR3 A;  5F64 A;  3L2V A;  3HXL A;  2ID6 A;  1SFU A;  1HSJ A;  2JSC A;  2NNN A;  1AOY A;  3CTA A;  1VQ7 I;  2XAQ A;  5F6F A;  3U21 A;  1FYM A;  4M71 A;  2CJJ A;  2P0W A;  4IZZ A;  1G59 A;  4CHU A;  4CZC A;  1I1S A;  1PDN C;  3SHF A;  4OIN F;  1UFM A;  1JI8 A;  1DPR A;  1I5Z A;  1VQ6 I;  2CUF A;  3A01 A;  2CV1 A;  2EK5 A;  3ESW B;  2YU9 J;  4XRS A;  1JKO C;  5IT9 K;  5GTI C;  2EFP A;  2DQR A;  2GWR A;  1FT9 A;  3HJE A;  5K5O A;  5JFR A;  3GLL A;  3H5R A;  1IRZ A;  2CQX A;  4FX0 A;  5EEG A;  4E70 A;  3QYB A;  3TDZ C;  4UVA A;  5B1B H;  2XGD A;  1LFU P;  3VSK A;  1R49 A;  1FYK A;  2E34 A;  3GZN B;  3IKV A;  4HF2 A;  5CVV A;  3S1Q J;  3Q3S A;  1WCM J;  3HOW J;  2OA4 A;  3A0H C;  4NBQ A;  1Y0N A;  2LK2 A;  5FJ8 J;  2CGP A;  4DQ2 A;  3ZQH A;  4PZJ A;  2UXX A;  3D1N I;  3BTJ A;  1W0U A;  3LA7 A;  2YX7 A;  5HVQ C;  3RZO J;  3SFI A;  5IT9 Z;  2DA4 A;  5FKO A;  3MD2 A;  5EYR A;  1YW9 A;  4WF2 A;  3HSE A;  1MBE A;  4BJ5 C;  4I6Z A;  1F43 A;  4Y52 J;  1OCO H;  1AU7 A;  2DFE A;  3EUH A;  2EZK A;  4X6A J;  2F48 A;  3ZRG A;  1ZLK A;  3J7A O;  2LR8 A;  1B72 B;  2R7D A;  3F9K A;  1R4N B;  1ZYR F;  2QSH X;  1GVD A;  2L7M P;  3FXO A;  3GTO J;  1BA5 A;  2K7L A;  4A0Z A;  4ZDP A;  1J09 A;  1ZN2 A;  4AVZ A;  4PFO A;  2E5N A;  3IH2 A;  3QPT A;  2WAF A;  3AKZ A;  3NQO A;  3OR1 C;  3PL8 A;  3ABK H;  2XAF A;  1U8B A;  1NH3 A;  3I4M J;  2Z5U A;  4RBO A;  1PUE E;  4EM0 B;  1ENH A;  1OCZ H;  1Z3Y A;  2XAS A;  2YR2 A;  4U7B A;  1YI2 I;  3T8T A;  5BS6 A;  4IRG A;  4L18 B;  2ZXH A;  3O8H A;  2XIG A;  3P7N A;  2OZ6 A;  4BH9 A;  1KQ9 A;  3FXR A;  3G4S I;  2CYY A;  2R5Y B;  3A03 A;  1XS9 A;  4CCJ A;  1W5C C;  3W2W A;  4PUS A;  2OV7 A;  2R0Q C;  5L3B A;  2K3F A;  3S1M J;  1P92 A;  4AM3 A;  4EJV A;  2NXN B;  1DP3 A;  4IRH A;  2X1E A;  2V26 A;  3C7J A;  2UXN A;  4ZYH A;  1O4X A;  1MGT A;  2LDU A;  2XGX A;  5JLW A;  3S3M A;  2LP0 A;  5DDG A;  1FMW A;  1JGS A;  3K4K A;  4P9F A;  5EG0 B;  5J6X A;  2QLZ A;  1GXP A;  2ZJP F;  1NK2 P;  3RQ4 A;  2H27 A;  1R9T J;  3SEZ A;  2COB A;  3EET A;  1FYL A;  5LHI A;  1XTA A;  2KRH A;  4RAZ A;  4RS8 A;  1XCB A;  3HC7 A;  4B47 A;  1MSE C;  4ZYG A;  4W97 A;  2PLY A;  4L9J A;  3LAP A;  3GEZ A;  1ETY A;  1SD4 A;  3SEQ A;  3L2Q A;  2KQR A;  3FXL A;  1U9O A;  3W2V A;  5HS8 A;  2MG4 A;  1X1D A;  2B7E A;  4XR6 A;  3V42 A;  1BC8 C;  1VQK I;  3W2A A;  1UG2 A;  2NS7 A;  2IGK A;  1X1C A;  2LVS A;  1R22 A;  3CZ6 A;  2R5Y A;  1QRY A;  1BIA A;  3ZMS A;  1KON A;  5E1Z B;  2QKM B;  3TQN A;  2E1M B;  4EM2 A;  4LB5 A;  5F27 A;  3FMR A;  1T98 A;  3V7R A;  4WCG A;  1I1G A;  1RPW A;  2XPU A;  1XC5 A;  3VOE A;  1KU2 A;  3GTG J;  2L0K A;  2V6C A;  3WHB A;  1HKQ A;  2HQA A;  2M34 A;  2M4G A;  3WTU C;  1H9T A;  4L5E A;  1SFE A;  4KUM A;  2JUG A;  3HYI A;  3SQN A;  2KRC A;  4QTR A;  5IYB J;  4YFK F;  2IA1 A;  3ZMV A;  4HQM A;  4GDF A;  2B0L A;  2WTE A;  5FKM A;  4D9J A;  4ZTJ A;  4HNT A;  2A6E F;  4RAG A;  2DMQ A;  3F8F A;  3QP6 A;  1JKR C;  2BW3 B;  4Y7N J;  3CME I;  5E3O A;  4DOZ A;  4RMN A;  4IX7 A;  2CW8 A;  3N97 A;  4IHX A;  3QP5 A;  2NVT J;  4Y33 A;  1FOW A;  5DCM B;  5A2Q K;  3JRH A;  1YLF A;  3KEY A;  4PJM A;  3EPZ A;  2QZ8 A;  1LJ9 A;  2HXI A;  3JR9 A;  4LK1 F;  3BQZ A;  3HGG A;  4D7M A;  4BHC A;  5J1Y A;  1WVR A;  2VQL A;  2XAH A;  4LLL A;  4BEH B;  4E7I A;  2ZFW A;  1KGS A;  1MSF C;  1T0F A;  1SMY F;  4HW0 A;  3WGI A;  2UUZ A;  4HST A;  4MNU A;  1VQ4 I;  2VPL A;  5HLG A;  1LDK B;  2XKO A;  4A3B J;  1S7E A;  4RAY A;  3RCO A;  1TLH B;  5E3N A;  4ZH4 F;  3JRD A;  3I55 I;  3J81 K;  3S3N A;  2VC0 A;  5E1X A;  1DUX C;  2OTL I;  3BOQ A;  2B63 J;  5ICG A;  3HSR A;  2L4A A;  5A2Q Z;  1TWF J;  3CUQ B;  2JUC A;  4HSR A;  3ZP5 A;  3HBL A;  3EDP A;  2GQQ A;  3CC2 I;  3DCF A;  1WI3 A;  4U88 A;  3AG3 H;  4KN7 X;  4Q48 A;  1BR4 A;  3A1Y A;  3JRA A;  1IN5 A;  1X1P A;  3CO6 C;  1UHM A;  2NOJ B;  3GZ5 A;  3OIO A;  3UKG A;  5LGU A;  3F8C A;  3CMM A;  4GRI A;  4DZJ A;  4CDG A;  2M3A A;  1ZKG A;  1ORK A;  3SZP A;  4A3F J;  1KYZ A;  3DF8 A;  1MBK A;  5D8K B;  1E3H A;  2EZI A;  1JKQ C;  3B73 A;  3J81 Z;  5HDK A;  3DLL F;  5LD2 C;  1H89 C;  4IHT A;  4M9X A;  3O8G A;  4AU7 A;  4LGW A;  1IUY A;  2IA2 A;  1W36 C;  3FXK A;  3VOD A;  2A07 F;  4C30 A;  1KU9 A;  4YRV A;  1Z7U A;  2W82 A;  1RNL A;  2JWT A;  1YYV A;  3H36 A;  3K2Z A;  1IN4 A;  1W0T A;  3F6O A;  1FY7 A;  2R7U A;  4YEJ A;  3J80 Z;  2HPM A;  3L2C A;  4PFP A;  2DA3 A;  4IOA F;  3WE3 A;  1LEA A;  2L7Z A;  4CCO A;  1RI7 A;  1FOX A;  4JBA A;  3K70 C;  1JHF A;  4BQN A;  3FK7 A;  4BXU A;  4UB8 C;  1HC8 A;  3ABM H;  3CP2 A;  1MJB A;  3GVA A;  4BAY A;  2FNA A;  2DJN A;  3S32 A;  2D45 A;  1H9G A;  1JTX A;  2BY1 A;  1WJ5 A;  5DS9 A;  2ZSH B;  2M9H A;  1H0M A;  1IN6 A;  1SD5 A;  3H5N A;  4D5F A;  1VI0 A;  1HA8 A;  2KT0 A;  3CCE I;  2JA2 A;  1XSV A;  2IPQ X;  3C2G A;  1SVO A;  4EMS A;  1LFP A;  3ZXS A;  1IG7 A;  4OMZ A;  2HYF A;  3HKZ N;  1S7A A;  2XDV A;  2EIN H;  3QYF A;  4PGH A;  2JRT A;  2LLK A;  3R0J A;  2ZKZ A;  4FTH A;  4G6D A;  5TGT A;  5KNL A;  5L3D A;  3PSF A;  5D5U B;  2HKX A;  5EGO B;  2R7W A;  3M3Y J;  1QNT A;  1A6I A;  4LK0 F;  3K4M A;  4OAZ A;  2FU4 A;  2MH2 A;  3ERE D;  2CW7 A;  4M9Z A;  1ERD A;  1JUM A;  3ZGK A;  2DBB A;  1EF4 A;  2VE8 A;  1R71 A;  3TL4 X;  2DFF A;  4L0Y B;  1RUO A;  2PJR A;  4UB6 C;  3QU3 A;  5AIP A;  3RKQ A;  3S2W A;  1YIT I;  4Q4Z F;  1V4R A;  3M8J A;  2NVX J;  1VQM I;  4N9I A;  1WJB A;  1FOK A;  4XK4 A;  3KFW X;  4HF1 A;  2ELH A;  3H3V K;  3H35 A;  3OS0 A;  4MEX F;  2ELK A;  3HIF A;  3GFL A;  2VBZ A;  3ABL H;  4PCQ A;  4I2O A;  3S2H J;  2KIF A;  3OYN A;  4C3J J;  5FKN A;  2M87 A;  4E7J A;  2V1D A;  2M1B A;  2XRN A;  5K5R A;  1P7I A;  4MTE A;  2VQG A;  2ZC2 A;  2BE5 F;  3GLX A;  2KZG A;  2JVG A;  4G7Z F;  1PVE A;  2MD0 A;  3BG9 A;  4LJZ F;  3FM5 A;  4L0Z B;  5D8L B;  4UV8 A;  3LSM A;  4UXN A;  1D8J A;  3Q9V A;  3IKT A;  2QBY B;  1IDZ A;  2VI6 A;  3GBG A;  2M7A A;  4I98 B;  4D1Q A;  2FNP A;  4JP0 A;  1GVJ A;  4XOT A;  1T08 B;  4ZZD A;  3PUB A;  2E19 A;  4CIC A;  2A5W A;  3IP4 B;  1R36 A;  2FRH A;  2BV6 A;  1O3S A;  4RA2 A;  1R5I D;  3G1O A;  1U5T C;  3DTI A;  1OKR A;  5TRD A;  1UMQ A;  2XAJ A;  4FHT A;  1RR7 A;  2BY3 A;  3VYR B;  1JJ6 C;  4JYK A;  3FDY A;  2TRT A;  4ANJ A;  2O8K A;  3Q0V A;  1RR8 C;  2QM3 A;  2TCT A;  2KL4 A;  2DA5 A;  1Z05 A;  3PSI A;  3KLO A;  5FD5 A;  2BZT A;  2C6Y A;  3Q5F A;  5CKT A;  3JSO A;  4BBS J;  5D4S A;  4I09 A;  4BXF A;  4M3B A;  5E8I A;  3U1D A;  2HDC A;  2ME6 A;  1X58 A;  2OCC H;  4I76 A;  1MMA A;  2GAU A;  2V7F A;  5B3S H;  2M45 A;  3CCY A;  4B48 A;  1A31 A;  3K10 A;  1SD6 A;  4K2E A;  5HDG A;  5ICC A;  5J4Y A;  1VQ9 I;  3DEE A;  4XMY A;  3PIP F;  3V8L A;  2CW0 F;  1EH7 A;  2W57 A;  1MH4 A;  3I4P A;  4E7Z A;  3MAJ A;  3RPU A;  3SYT A;  4F93 B;  5M5W J;  1Z3X A;  1JJ8 C;  2DK8 A;  2XRO A;  5H6Q A;  1Y39 A;  2WAQ N;  4M73 A;  4B4C A;  2L01 A;  1PJR A;  3S3O A;  1YO5 C;  1XN7 A;  1MIJ A;  3OYH A;  1RZ4 A;  3PNY A;  4KJZ A;  2PJP A;  3E6M A;  1UHW A;  2V9K A;  2OCE A;  4OIO F;  1J0R A;  1OYW A;  1H88 C;  2HFH A;  3M8F A;  4JX4 A;  4CUG A;  2DDB A;  2EZL A;  3IH3 A;  3SFZ A;  1XSD A;  2OAZ A;  3CJN A;  3PO3 J;  2L9R A;  2ZFU A;  1FZP B;  5E3M A;  3W3C A;  2IRF G;  5E18 F;  3LMM A;  1EJ9 A;  5D5V B;  4HZF A;  2K85 A;  3I9V 2;  5TJJ A;  2QF7 A;  1Y1W J;  1HQC A;  3LQQ A;  4XL9 A;  2F4M B;  3SJM A;  3EQL F;  4RB2 C;  3S14 J;  1JGG A;  2XSJ C;  1QGP A;  3V4G A;  2DTR A;  3CC4 I;  2AS5 F;  2Z3Y A;  1DDN A;  4NUB A;  2QKL B;  3KEQ A;  3HSF A;  1QPI A;  5EZH A;  4LIT A;  3FXJ A;  1O7L A;  4EV0 A;  5H2F C;  1J59 A;  2MSY A;  2I8D A;  1KA8 A;  2K3P A;  2EFO A;  1Y8Q B;  2XPW A;  4A3G J;  2DTZ A;  1N75 A;  2ETH A;  2F5C A;  2HQN A;  1WJA A;  1J7K A;  3EUK L;  3H3Z A;  2HYJ A;  2MLK A;  2GA1 A;  4IO9 F;  1R4M B;  4G6Q A;  1WJF A;  1FC3 A;  2KIU A;  2RKH A;  3MZ8 A;  4WXD A;  4YIF A;  5K1Y A;  3TO6 A;  3JAM K;  2B9S A;  1HLV A;  3LSJ A;  3DTK A;  3KP3 A;  5IP9 J;  1Z67 A;  3HTS B;  2H6C A;  4O5V A;  4BS9 A;  4MQ9 F;  2VT2 A;  4ENJ A;  1YJW I;  1F5T A;  4A3J J;  1KQ8 A;  1SC7 A;  2Z2S B;  3CCS I;  3IL2 A;  5FGM A;  5H20 A;  1ZRD A;  2XV4 S;  3VSL A;  1MNE A;  5LEK A;  4JQF A;  2O6G E;  1G4D A;  3OV8 A;  4XN3 A;  2DA2 A;  1PP8 F;  2HVQ A;  2HEO A;  3I59 B;  1O3Q A;  5DV5 A;  3D5L A;  3PNV A;  2HI3 A;  2ZCW A;  4DYR A;  1P9Q C;  3R6S A;  1RES A;  1XB4 A;  3FXQ A;  2Q1Z B;  2RV8 A;  2FBI A;  1ETK A;  4GXO A;  2PMZ A;  1OQY A;  1LEB A;  1U0J A;  2DLL A;  1MMG A;  3JAM Z;  3OYE A;  1SEU A;  2Y75 A;  2LSO A;  1GV2 A;  3TED A;  3CQZ J;  4W1U A;  5HS9 A;  5LEJ A;  4KIB A;  1ETX A;  4D7N A;  2AHQ A;  2F6C A;  1BI3 A;  2JJ7 A;  5FLX Z;  5JHF A;  4YIR X;  4E7S A;  1Z7L A;  2VKE A;  2IXS A;  3E97 A;  4N9H A;  5C44 J;  3OS1 A;  1REP C;  3IRQ A;  3DWL E;  2FX0 A;  1MBG A;  2VAS A;  3DKW A;  3JRF A;  3FZV A;  1FNN A;  2L54 A;  4CCM A;  3WOD F;  4B44 A;  2K4B A;  1VF9 A;  1X19 A;  1RUN A;  4DBQ A;  3BJO A;  1T56 A;  3BTI A;  1HST A;  3G2B A;  3F72 A;  2Y30 A;  5GPA A;  3ZQG A;  2Z9O A;  2R93 J;  2W25 A;  2VLA A;  3MKY B;  3ZMZ A;  1I27 A;  4BJT A;  1FBS A;  2EV6 A;  3OR2 C;  4Z2Y A;  2PN6 A;  4G9Y A;  4I0A A;  2E36 A;  4NB5 A;  3VPR A;  4ENK A;  1R58 A;  2HNH A;  1TWA J;  4MIM A;  3RKY A;  3G1M A;  4E7K A;  1YFH A;  4KDP A;  3GTM J;  5IP6 A;  3RI4 A;  2MA3 A;  4I02 A;  5EJC A;  5F08 A;  1YIO A;  3IWZ A;  4DJA A;  1XD7 A;  1DPU A;  5CVU A;  4AIJ A;  5HLI A;  2NYX A;  5FB2 A;  1WJE A;  2P81 A;  1FJL A;  1ZG3 A;  5BQT A;  4RB3 C;  4MTD A;  3L00 A;  3T0Y A;  2FBH A;  2EWN A;  1O3T A;  2RRE A;  4XKB A;  3GME A;  3LAJ A;  4BNC A;  1WH5 A;  3DXJ F;  3IRR A;  4P9U A;  4XLP F;  2EA2 A;  3G71 I;  1TL8 A;  4P55 A;  3CUO A;  2K27 A;  4LB6 B;  1F1Z A;  2EFW A;  5KK1 A;  4YII A;  5FFZ A;  3EUA A;  4BQO A;  5EDN A;  4AWX B;  2A6T A;  4E7H A;  5CVI A;  1JE8 A;  4UY8 I;  2IA0 A;  1U5T A;  4XLC A;  2CS3 A;  3OYL A;  4DYQ A;  4A12 A;  4Y4R A;  2RVC A;  3Q0U A;  4RGR A;  4BU2 A;  2L9V A;  2F4O B;  1HKT A;  2CFO A;  3ZMU A;  2MGQ A;  2CQK A;  3MEX A;  4QLC U;  3KP2 A;  3MCZ A;  3BPX A;  2XF5 A;  2A05 A;  2A61 A;  5CJ9 A;  2YSR A;  4KMU X;  1TWH J;  3QWL A;  3Q0W A;  4ASN A;  2UZK A;  1ZR2 A;  2BBY A;  1KU3 A;  2PQ8 A;  2OBP A;  1WGX A;  4RB1 A;  1LNW A;  3RKX A;  3BWG A;  1DU6 A;  3CDH A;  3JW4 A;  1ETQ A;  2ZB9 A;  5B1A H;  1QHH D;  1RKW A;  4XOP A;  5LHG A;  1T38 A;  2WV0 A;  1X4O A;  2Y0S A;  2KJB A;  1SMT A;  2GIZ A;  3M1C A;  2ZJR F;  4HDV A;  3PUF A;  3B6C A;  2OQG A;  3IH4 A;  2MC4 A;  2P6T A;  1OFC X;  2MAB A;  3GTL J;  3RDI A;  4ESB A;  1LE8 A;  4LFU A;  4CSW A;  2L2O A;  1IRG A;  4H0E A;  1FTT A;  4DIQ A;  4C3H J;  2AQE A;  1YW8 A;  3L09 A;  3RYP A;  3K4J A;  2VN2 A;  2QYO A;  3RKW A;  2XB0 X;  2NRA C;  5ED4 A;  3ZQL A;  2G7U A;  1OYI A;  4PJN A;  3P5J A;  3QPL A;  2VBX A;  2V1U A;  2M0M A;  5M3F J;  3NAR A;  1UHS A;  3CCU I;  1U6G A;  3CC7 I;  2MBF A;  1BI1 A;  5IT3 A;  1JT6 A;  2R5Z B;  3VYU B;  3GCM A;  3CJT B;  1V55 H;  1A04 A;  3TP3 A;  3H0D A;  3OYC A;  3GTK J;  3QYE A;  2E2J J;  1P4X A;  1WFX A;  3BR3 A;  4RGU A;  4KIC A;  2FQ3 A;  4KT5 C;  1VFC A;  5HNH A;  1W4M A;  3ZN1 A;  2MLG A;  1MBF A;  1D8K A;  1SAN A;  3DEU A;  3FBI B;  5GAH J;  1XMX A;  3CDI A;  3U1K A;  4S0H B;  3RPU D;  3OS2 A;  5DM7 F;  5EF6 A;  2QSG X;  2O61 A;  1XGM A;  4C2T A;  2BHY A;  2DDA A;  1TBX A;  2H1K A;  2Z33 A;  2RGV A;  1EV7 A;  2MFZ A;  4KNY A;  3F22 A;  2F5D A;  2IBD A;  4U0V A;  2K9S A;  4RGX A;  1TTY A;  4Q5S F;  3OOP A;  1WZ2 A;  2X0L A;  5DCF A;  1JTY A;  2CV2 A;  3E6D A;  4IHY A;  1HOM A;  1SAU A;  2KZV A;  2IGM A;  4RM3 A;  1K4T A;  2DOE A;  1K79 A;  3DP7 A;  2ESH A;  4IL6 C;  3WTV C;  2R5Z A;  1WJC A;  1MDM A;  1OLT A;  1A35 A;  3CJR B;  1N78 A;  3NWT A;  4C9Y A;  2IS2 A;  2R7Q A;  4ZYD A;  2OF7 A;  4IPA A;  4KIT B;  3OMY A;  4Y15 A;  3E3V A;  3QPH A;  4F91 B;  3HOU J;  2AO9 A;  3HEF A;  3KYL A;  1JKP C;  2QQ9 A;  1BI0 A;  4NHJ A;  3S15 J;  4HLX A;  2DI3 A;  3BT9 A;  4RM2 A;  4CYC A;  2W4S A;  3S16 J;  1Z21 A;  2FA5 A;  4HF0 A;  2R7F A;  4PJJ A;  4BY1 J;  1QO0 D;  2XVC A;  3DQV C;  2HQR A;  4HPQ A;  2W48 A;  1U8R A;  2Z1D A;  2HTJ A;  2OPT A;  1TT0 A;  1IC8 A;  3KP7 A;  1W36 D;  3AG2 H;  1VQ5 I;  2HQ5 A;  3MKZ A;  2CU7 A;  3R60 A;  2I10 A;  4CCL A;  2P5K A;  3KP5 A;  3AG1 H;  3HHH A;  2LY1 A;  3CLO A;  4G94 A;  5JI6 A;  1DU0 A;  1BBY A;  1TQP A;  5FRO A;  2DXI A;  4M6Y A;  4G8X A;  3GTJ J;  4CO8 A;  3BG7 A;  3IAS 2;  2ESN A;  5FFX A;  2DPU A;  1QU3 A;  1LUJ B;  2X51 A;  1R1U A;  1SFK A;  2QSF X;  5D5X B;  1JT0 A;  3FKI J;  1EA3 A;  4Y3O A;  2I5U A;  1MBH A;  2XGC A;  3ZOB A;  2QUF A;  2WBM A;  4II3 A;  2HZT A;  1MMS A;  3M9A A;  3DBR B;  3K70 D;  5FRM A;  4HDU A;  4B3X A;  3JRI A;  2BXY A;  3H0G J;  3I58 A;  2K40 A;  1WI9 A;  2J5O A;  4ZDO A;  1J5Y A;  3HG9 A;  4A5M A;  1PYV A;  2QQ8 A;  2R7V A;  3G6E I;  2H8W A;  4V2F A;  1W7P B;  3GUD A;  1TWG J;  2BGC A;  2IEK A;  4WX9 A;  1R23 A;  2KDO A;  3OYA A;  1G3T A;  4EQQ A;  1YOV B;  4P1W A;  3ECO A;  1IGN A;  3U9G A;  2JA5 J;  4G6T B;  1WSU A;  5J40 A;  4BY7 J;  4B1R A;  1LPQ A;  1Y8R B;  2DCE A;  2HPI A;  4HQE A;  4S05 A;  4KFC A;  2GOM A;  3MN2 A;  4WXH A;  1Z9C A;  2Y31 A;  5D6F A;  2RN7 A;  4AD9 A;  1VQO I;  4IEJ A;  2LTP A;  1FLI A;  3CCV I;  4KIF A;  4FAS D;  1ETW A;  4BBR J;  3LSH A;  3CJQ B;  3OYF A;  1X3U A;  1YJ9 I;  1QZZ A;  2FD5 A;  2VKH A;  2BEO A;  2VJI A;  2VXD A;  3HOY J;  3CO7 C;  2D1H A;  4HV5 A;  2DOA A;  4XKW A;  3SDB A;  1ZAR A;  4F55 A;  3TMO A;  3WU2 C;  5GPC A;  1Y0U A;  2DPD A;  2VE9 A;  4XSX F;  3P9K A;  3BG6 A;  2CO5 A;  2MD5 A;  2LD5 A;  1VZ0 A;  3WGG A;  2M8E A;  1J2X A;  3WGH A;  1IJW C;  4RGS A;  3K7A J;  2JA6 J;  2F5E A;  2XB5 A;  2F5V A;  5F0F A;  1W7P A;  4A93 J;  2UWM A;  2CFX A;  3OY9 A;  2ZSI B;  3C2H A;  4D0P A;  1R5H A;  1OCR H;  1X3W B;  1YE9 A;  2KKO A;  2LRD A;  4HEA 2;  3E0J B;  1E17 A;  3KZI C;  2KIS A;  2ZO4 A;  2GM4 A;  3U2R A;  3ZPL A;  2DYR H;  4GYI A;  1M1E B;  1ZRF A;  3KZZ A;  3AFH A;  3GFM A;  3S93 A;  3HPH A;  2A3S A;  4CH7 A;  4PJL A;  5D5W B;  4BE0 A;  1G3S A;  1K78 B;  2O8X A;  4L9N A;  3ASN H;  3O3K A;  3QU6 A;  2Y9Z A;  1LDD A;  2ZJ2 A;  1ZR4 A;  2DN0 A;  3GXO A;  3ZMD A;  4QIW N;  4L5I A;  1XGS A;  3ZQQ A;  4CA0 A;  4OIP F;  5E17 F;  2LRE A;  3HOT A;  5FLV A;  2GXB A;  3AL0 C;  4LG3 A;  4XRS G;  4BXX J;  2E2I J;  4V19 K;  2PJR B;  4HRI A;  1IRX A;  2EIM H;  2G7H A;  4LMY A;  3ZQF A;  1MJA A;  1MD0 A;  2P7V B;  4GO1 A;  1WH7 A;  3VFZ A;  4B43 A;  3I56 I;  2HU9 A;  5DUK A;  1TQI A;  2GIV A;  4EGZ A;  1HW5 A;  1FSE A;  1Y56 A;  1X1A A;  1QVU A;  2ZNZ A;  3JTH A;  4LIV A;  4ETS A;  4AUX A;  4HNV A;  4ABZ A;  4M3F A;  3G1L A;  1IV8 A;  3ML6 A;  1PUF A;  3ASO H;  2JN6 A;  3O6B B;  2XAG A;  2XKP A;  2P8T A;  2XF6 A;  3FXM A;  1RIO H;  1XPX A;  2PX9 A;  2ID3 A;  4TV7 A;  2LKS A;  1VND A;  2OD5 A;  4BE2 A;  3DPU A;  4FQG A;  1V5G A;  1Z6R A;  3LSG A;  5AON A;  3S8P A;  2QQB A;  1IW7 F;  1FWZ A;  2HR3 A;  2VL8 A;  3K6G A;  4MFE A;  1T39 A;  2G9W A;  2H1L A;  1K78 A;  2R7O A;  1OCT C;  3ONQ A;  2K4J A;  2K9Q A;  2Q8K A;  4EJW A;  3N05 A;  2FOK A;  5E79 C;  3CCR I;  2ZXW H;  2M4K A;  2DMN A;  1TWC J;  3I53 A;  2O5R A;  3T5X A;  3QRF F;  4CGZ A;  1F4K A;  4EJU A;  2Y48 A;  3CP8 A;  2WV1 A;  5DEQ A;  1HBX G;  2V1N A;  2VKV A;  1RKT A;  1HDD C;  1BC7 C;  1TC3 C;  1ACI A;  4CCN A;  2YPR A;  1OJL A;  2HZD A;  2CUJ A;  2CQ7 A;  1S3J A;  3DBH B;  2F2E A;  4S04 A;  5HLH A;  2K02 A;  1GT0 C;  2KJC A;  3M1E A;  3PO2 J;  2DFI A;  2Y9Y A;  2DMT A;  3B02 A;  4R1H A;  1IRF A;  3RQI A;  5J1R A;  1ITY A;  2XRL A;  2BY2 A;  2HWV A;  3BR5 A;  3QOE A;  1JUP A;  2Y2Z A;  5LFA A;  1ZRE A;  1HXD A;  2DT7 B;  2ECB A;  1FBQ A;  2E35 A;  2FQ4 A;  3E6B A;  1QZY A;  1S5L C;  2LKP A;  1WKM A;  2FUG 2;  4HBL A;  4PSW A;  1FX7 A;  4R8H A;  1R1V A;  1DQU A;  4AIK A;  5ILU A;  2Q0O A;  2QGU A;  2W85 A;  5JVT A;  5KCM A;  3NAU A;  2KRF A;  1HW1 A;  4O3M A;  2LF7 A;  5CLS A;  3JSP A;  1SFO J;  3TW7 A;  1I6H J;  2ZME C;  1ZG1 A;  2HOA A;  2QCO A;  1YIJ I;  1IDY A;  3R61 A;  1U2W A;  4LG0 B;  1D0Z A;  1ON1 A;  4CZZ A;  3DEW A;  3KPH A;  4WWC A;  3KCC A;  3CDL A;  3OWT A;  2ADU A;  3ZQI A;  3K4N A;  3LSP A;  3ZCO A;  4L5J A;  1BW6 A;  1BN5 A;  1ODD A;  3BZC A;  1XG1 A;  4NC7 A;  2EIJ H;  2A6H F;  3MKL A;  4DZP A;  1B6A A;  1S29 A;  2KLO A;  2KFD A;  2LBF A;  3JCU C;  4KA4 A;  2QWW A;  2V1X A;  1YRN B;  2FOW A;  3OL4 A;  1B9M A;  3LSI A;  2E7W A;  2ECC A;  3UR3 C;  3F23 A;  1L3L A;  1YJN I;  1EH6 A;  3E7L A;  4HOB A;  5GAE J;  4E7L A;  3QQA A;  2R3S A;  3TO7 A;  2CQQ A;  1D1A A;  2XSD C;  1OCC H;  1X2N A;  3BR2 A;  2EH3 A;  3OSF A;  5HNF A;  2EIK H;  5FO5 A;  2VKD A;  4LG0 A;  3WTW C;  1RRJ A;  1AHD P;  1KQ0 A;  2KPM A;  2JRM A;  3BLY A;  4A3E J;  3WU0 A;  4EJT A;  2LNB A;  3SZT A;  3C18 A;  4BKX A;  2EV5 A;  2F5F A;  4XOR A;  4BUP A;  1BOB A;  3PM1 A;  3FXU A;  4BQQ A;  2P4W A;  4MQV A;  3SZG A;  2VOD A;  1R00 A;  5F0H A;  1QBJ A;  4M3D A;  2STW A;  4IOC F;  4PSX A;  5EZG A;  2EJR A;  4G7O F;  5M5Y J;  1V5E A;  3LA2 A;  1HCR A;  5BMZ A;  1Z77 A;  1YRN A;  1BW5 A;  4WK8 F;  2RC4 A;  1FPQ A;  4YFX F;  3PFI A;  1BR1 A;  5EEH A;  4QWQ A;  2IT0 A;  2NVY J;  2HS5 A;  2W24 A;  2HOE A;  2NS8 A;  2TDX A;  1U3E M;  4OU0 A;  3C2B A;  5CQG A;  5LGT A;  4NC8 A;  5E3L A;  4J01 A;  1ZRC A;  4A0Y A;  5HDN A;  3GW2 A;  2HYG D;  2JVH A;  2NOG A;  3IUO A;  2QVO A;  4LD5 A;  1D5Y A;  4XLA A;  4M74 A;  5M5X J;  5L3C A;  3WHC A;  2P6S A;  5ILS A;  1OYY A;  1J75 A;  4IQ4 A;  2ZBK A;  3B6A A;  1ZH5 A;  2LMD A;  3GYH X;  2WB1 A;  3IWF A;  3HB9 A;  1ZGA A;  1OMI A;  2LH9 A;  2PMH A;  4XLN F;  3V8J A;  5FKK A;  1A36 A;  4P5O A;  4V2G A;  2FEZ A;  3DLA A;  3HRS A;  1ZLJ A;  4KT6 A;  5J3L A;  1HF0 A;  1Q1H A;  2OU2 A;  4M72 A;  1XSX A;  4CCK A;  4MHG A;  4B8X A;  4Y17 A;  4ZYA A;  1E3O C;  4AVP A;  3FIW A;  3ULQ B;  3JRE A;  4AYB A;  1GXQ A;  4ESF A;  2L9S A;  5K7H A;  1XGO A;  1QVT A;  5DD4 A;  1X2M A;  3FBN B;  5AIQ A;  2DMU A;  2PFB A;  3O2P E;  1TP4 A;  3WTZ A;  3JRB A;  1EH8 A;  3GWZ A;  3V7S A;  2BHZ A;  4I01 A;  3LOC A;  4R79 A;  3F8M A;  3TDU C;  1TNS A;  2GXG A;  3C3W A;  2HKO A;  2Z99 A;  1IXS B;  3K69 A;  4NC6 A;  1ZGW A;  1W7P D;  1MJ9 A;  1CF7 B;  4N4N B;  1I50 J;  4JX5 A;  4EJO A;  5DTD A;  4DBR A;  4PGG A;  4A6D A;  2NVQ J;  4EVI A;  3L1P A;  3LFK A;  4ZTF A;  1ULY A;  1C0W A;  1E2X A;  1AKH B;  3BPV A;  1STZ A;  3BG3 A;  2LKX A;  5TIS C;  3M07 A;  1H8A C;  1OPC A;  1R6R A;  1BM9 A;  2FE3 A;  2L4M A;  3MZH A;  3ZR8 X;  4ZJZ A;  1MH3 A;  2X48 A;  3OYB A;  3CCJ I;  2E1M C;  4XLF A;  5HOD A;  1LDJ A;  4GCV A;  2EB7 A;  4ZC3 A;  5J1U A;  5M3M J;  3FM3 A;  1IUF A;  3SDG A;  4MFD A;  5J8C A;  3QPS A;  5FRN A;  3I4N J;  5D6E A;  3LQR A;  1U5T B;  2PMZ N;  2H94 A;  3OIQ A;  4Q47 A;  2ZME B;  2XAU A;  3A0B C;  2DOF A;  2RNG A;  1KU7 A;  2M5W A;  1P6R A;  2ICW G;  5CYV A;  5IPA A;  2CUE A;  1O57 A;  1MND A;  3PQK A;  2BXZ A;  2X4H A;  2VJJ A;  2VJ4 A;  4XLE A;  2FML A;  5KAF C;  3IC7 A;  2OC6 A;  1D1C A;  5LRS A;  1CF7 A;  3HPG A;  1XCV A;  5F1J A;  5ICE A;  2IP2 A;  2JK3 A;  4NQW A;  1XMK A;  3FK6 A;  1AKH A;  4HAM A;  3TP0 A;  1YS6 A;  1MBJ A;  4I99 C;  2E1O A;  2EV0 A;  2MH9 A;  3FIS A;  2RDP A;  4HX4 A;  1YTY A;  1I3Q J;  1ETV A;  2EBI A;  1F9N A;  2L02 A;  2P7C B;  1WRJ A;  3HTU A;  3OIP A;  2IVM A;  1P2F A;  1W5T A;  1LE8 B;  2BOL A;  1W1W E;  1OCP A;  1T6S A;  1YW7 A;  2VQH A;  4FE7 A;  3L2R A;  3CMY A;  2WAD A;  2KIQ A;  4M6X A;  1NHA A;  4XKC A;  2XUB A;  2ZME A;  1YX5 A;  2X85 A;  3BP8 A;  3F0C A;  2R7Z J;  2P5L C;  2M7B A;  1QPM A;  4A3C J;  2IJL A;  4GFB A;  2N8G A;  3ROU A;  3E5U A;  2VIX A;  4LOC A;  3MMY B;  3H5A A;  1D1B A;  3L7W A;  3CUQ C;  2X6X A;  1MMN A;  1A6Q A;  3GF2 A;  2HDW A;  2VON A;  3KYC B;  1WHU A;  5EEA A;  3HHG A;  5JLX A;  3HDD A;  1DP7 P;  5JHU A;  3IV5 A;  1V54 H;  2JA8 J;  2CUZ A;  5BNG A;  4IRI A;  4IQJ A;  2JMW A;  5BPI A;  1VQL I;  4M3E A;  3TO9 A;  2JPC A;  2DA1 A;  4J19 A;  2R7X A;  1JXS A;  2IS6 A;  3CCL I;  1SFX A;  2Y0M A;  2R7T A;  2VJ5 A;  3F8N A;  2L7F P;  1WPK A;  3BTL A;  1ZTR A;  1Z91 A;  2V9V A;  4XON A;  5DYM A;  1G2H A;  2R4G A;  1HKS A;  4IHS A;  2BY0 A;  2DA7 A;  3OOU A;  5HOO A;  3F21 A;  2COM A;  1POG A;  3A2K A;  3L9F A;  1IN8 A;  2XF7 A;  3K1M A;  3KE2 A;  1MNM C;  4IJA A;  2Y69 H;  3FHN A;  1FIP A;  1X3Z B;  1TW3 A;  1XDU A;  3DPL C;  5GP9 A;  3M7G A;  4DW6 A;  1LB2 A;  2K9N A;  3GZ6 A;  3Q9S A;  2QA4 I;  3N4M A;  2JTV A;  4ZYE A;  4CXF A;  4RAF A;  1MDM B;  1P4W A;  5DM6 F;  2DT6 A;  1U9N A;  4U0W A;  2RQQ A;  3HRU A;  1CGP A;  2BVL A;  2X1D A;  5E8G A;  2EZH A;  2O03 A;  3E5Q A;  5ERI A;  5CVR A;  4A3D J;  2Y0S N;  5KHD A;  1Y6I A;  3CD6 I;  3P9I A;  5LLQ A;  2X1C A;  4BHB A;  1K61 A;  4FT8 A;  3HOS A;  2X6W A;  1IF1 A;  2HOT A;  4HNU A;  4E6K G;  3I0T A;  1BJA A;  1D3Y A;  1JUS A;  3GO5 A;  4FIS A;  4CYC B;  3BQY A;  1ONV A;  2O7O A;  3ERM A;  3W6J B;  1GUU A;  4A5N A;  1B72 A;  4KMF A;  2GLO A;  3MQ0 A;  5FD6 A;  3E5X A;  3E6C C;  4HV6 A;  1HW2 A;  3KX2 A;  4EAT A;  3PQJ A;  4N0B A;  3K1N A;  1TZL A;  1Y1V J;  2X6O A;  1ON2 A;  4A6E A;  4OMY A;  2VOP A;  1GHC A;  3VYS B;  4I7H A;  2LFB A;  2X9D A;  5GAD J;  3D5S C;  2AQF A;  1TQM A;  3DKX A;  3WE2 A;  3ZMT A;  2MW8 A;  3KIO A;  4UVC A;  2NS0 A;  3H9G A;  1D0Y A;  2PMU A;  4PJ0 C;  1SAX A;  1UG0 A;  2EFQ A;  2ISY A;  4BE1 A;  2H6B A;  2M2E A;  3BCA A;  2GBY A;  2YUS A;  1IO2 A;  2Q2E B;  3FMQ A;  3REO A;  5CVJ A;  2M30 A;  3BR6 A;  3I54 A;  4YEL A;  5H6R A;  3BJ6 A;  3SXY A;  4U87 A;  1YHQ I;  5EG0 A;  1WJD A;  4D5C A;  2WAE A;  5LBQ A;  3S17 J;  2E7X A;  2NVU B;  3DU6 A;  3FWE A;  3DFG A;  1P4A A;  1U78 A;  2STT A;  4FX4 A;  4IKF A;  1V5F A;  2GA2 A;  3QOD A;  3X2Q H;  4QSH A;  3V7C A;  1F36 A;  4OIR F;  2L7K A;  3DPT A;  3R4K A;  4G12 A;  3W6V A;  1D5V A;  2KHM A;  1UEL B;  3EYY A;  3RZD J;  1BL0 A;  3EYI A;  3MFK A;  1DGW Y;  1I6X A;  2LY2 A;  3K4L A;  3WG7 H;  5LHH A;  2LG4 A;  2KDZ A;  3PIO F;  4A3L J;  2E60 A;  3DTE A;  4FCY A;  1E0E A;  1Z0X A;  1MW7 A;  1RET A;  2ME0 A;  3E1S A;  2Q2E A;  3H9J A;  3CES A;  4MLO A;  1X4P A;  3NWS A;  3G3Z A;  1BOA A;  4LLG F;  1XX5 A;  2W00 A;  3IHU A;  3UNG C;  4HLY A;  4IVN A;  3OSG A;  3ZN0 A;  2CMP A;  1R5G A;  3OYG A;  5J47 A;  3GTP J;  3H1C A;  5J8F A;  1YX3 A;  2W7N A;  1T8I A;  4OOI A;  2VT3 A;  4ON0 A;  1VQP I;  3TOA A;  2CSO A;  2LYC A;  2PEX A;  4A0X A;  2VC1 A;  2V79 A;  3K9T A;  5BPD A;  2DT5 A;  2QEN A;  2CG4 A;  1ZGJ A;  2VB6 A;  5L3F A;  3GX4 X;  3AG4 H;  2WA0 A;  1QHG A;  1KYW A;  2K9M A;  2BW3 A;  1I39 A;  3HRM A;  3I71 A;  4UHT A;  4UUV A;  4HA8 A;  1S6L A;  2JPB A;  1GV5 A;  2Z16 A;  4IHV A;  5DCM A;  4X0G A;  2L3D A;  2VQC A;  5IY5 H;  4PK4 A;  4GYG A;  2ZXJ A;  4H4K C;  5GAG J;  1GLN A;  3VWB A;  3OL3 A;  2JSP A;  4BYY A;  1SVL A;  5CQE A;  2ZNY A;  2XGE A;  4XLH A;  3PFY A;  5D4R A;  1BJZ A;  5F04 A;  3PNT A;  3VYT B;  4A69 C;  3GFJ A;  1LKX A;  4BEH A;  2A69 F;  3J80 K;  4A3M J;  2JT1 A;  2BYV E;  4UNO A;  1K4S A;  4OAY A;  1OR7 C;  1PUF B;  3KLN A;  3BZ6 A;  1UST A;  3A4C A;  1QZE A;  1Z6T A;  2DMP A;  4HYE A;  2CRG A;  3KP4 A;  5F1R A;  4N4O B;  2DU9 A;  3RPQ A;  1K6Y A;  2OZU A;  1FBU A;  4G7H F;  3I3L A;  2WWY A;  4FET A;  3I5U A;  4UVB A;  3OYD A;  1PP7 U;  3CCM I;  3CUQ A;  5J4V A;  2FBK A;  4EEF G;  1MKM A;  3HKZ A;  2HVS A;  2NNY A;  5B5E C;  3L2W A;  1NG7 A;  5K7Z A;  3HGY A;  3HM5 A;  1CQT A;  3WU1 B;  3VDX A;  4F52 A;  5IYD J;  2IGO A;  3NEU A;  4CYD A;  1TW2 A;  3F6V A;  3LWF A;  5K7F A;  1ZAO A;  2EIL H;  3HOZ J;  4AID A;  2YS9 A;  2LOO A;  4ZDL A;  1N25 A;  1ZEL A;  1J9I A;  4JOM A;  4AIH A;  5IOZ A;  2JQ7 A;  2HTS A;  3AAF A;  4XM3 A;  2V6E A;  1FOY A;  4B3A A;  3ABT A;  1T2K A;  1K6O A;  3MWM A;  1OIS A;  3WTS C;  1WWX A;  4EGY A;  2H09 A;  3S1N J;  1ZK8 A;  2RNJ A;  1AWC A;  2QEX I;  3HZJ A;  3BTC A;  2EQR A;  3HL2 A;  3LFU A;  4X1E A;  2OQR A;  4XKV A;  5K5Q A;  2MC3 A;  3CLQ A;  4PDK A;  2LY9 A;  2CWE A;  2IGN A;  6PAX A;  4RLF A;  4U7D A;  5ICF A;  2O9L A;  2WY8 Q;  3CCQ I;  4GGG A;  3TW6 A;  4NDL A;  2O0Y A;  2GXA A;  2DK5 A;  2DOD A;  9ANT A;  2O3F A;  4ENM A;  2E1N A;  2XHK A;  3LNQ A;  2ACJ A;  4LIU A;  5LGN A;  3LSR A;  3DU5 A;  3G73 A;  1G8X A;  3KP6 A;  3OYI A; 
#chains in the Genus database with same CATH homology
 3K0L A;  5DUI A;  1R7J A;  1ZG5 A;  3DV8 A;  2VBY A;  2PI0 A;  4RB0 A;  3FMS A;  1B4A A;  3WTX C;  4KIG A;  2DO7 A;  4XBF A;  4A2U A;  1TNT A;  1MZB A;  2LF8 A;  3H3U A;  3I64 A;  3VB2 A;  2DW4 A;  1YS7 A;  2D1V A;  4KN4 X;  3T8R A;  3ABU A;  1FP1 D;  3T1B A;  2D2W A;  1IN7 A;  1Z1D A;  1S7O A;  2AXL A;  3RYR A;  3BRO A;  1R1T A;  4HX7 A;  3KEO A;  1L0O C;  3K1P A;  2NAZ A;  2FF4 A;  3JTG A;  3FF5 A;  4IXA A;  4YG2 F;  1USS A;  2GZW A;  3LST A;  2P5V A;  4LLN A;  1B1B A;  5L3G A;  3M8E A;  2K86 A;  5HS7 A;  3ZQ7 A;  4BQA A;  1YQA A;  3TOB A;  1XDS A;  1BIB A;  5ILV A;  2FXA A;  4OIQ F;  3QOP A;  1B9N A;  1WQ2 A;  2PBI A;  3KET A;  4HX8 A;  2PG4 A;  4IF4 A;  2DAO A;  1XMA A;  5L3E A;  3WG9 A;  2QBY A;  1UCR A;  3FX3 A;  4ESJ A;  1IXR C;  2WC2 A;  5KVR A;  3NRV A;  2KIM A;  5DD8 A;  1G3Y A;  1FP2 A;  1W5S A;  3TGN A;  3TKY A;  4MEY F;  3ECH A;  1LVA A;  3W6K B;  4ZZL A;  2J5P A;  4L9V A;  4XSZ F;  4YFN F;  3RIR A;  3MZY A;  5E1W A;  4DNC A;  1ZHF A;  2FSW A;  3D0S A;  4I0B A;  4XRF A;  3BDD A;  4ENN A;  1IXC A;  2VOO A;  2HGC A;  3VEP A;  4F7Z A;  1QQI A;  1OR7 A;  2VXZ A;  3WTY C;  3P9C A;  4UV9 A;  1V3F A;  3ISP A;  3FHZ A;  1YG2 A;  3LA3 A;  2IW5 A;  5E20 A;  3WTT C;  4Y13 A;  3KZY A;  4JK1 X;  3F8B A;  3H92 A;  4M9S A;  2ISZ A;  1JHH A;  2EA4 A;  3V8K A;  5FLX K;  2A68 F;  3HRT A;  1K7A A;  3C1D A;  2YX4 A;  5BOX A;  3BJA A;  1XGN A;  3F3X A;  1S8N A;  3R0A A;  1VTN C;  2RQP A;  2EFN A;  5LRR A;  4MGR A;  3QAH A;  4O6J A;  1G6N A;  1IZ1 A;  2VBW A;  1UB9 A;  2E1C A;  4KYW A;  4WXC A;  4L9T A;  2QQA A;  2YU3 A;  3GFI A;  1LQ1 A;  1IAW A;  1BI2 A;  4BHP A;  4EM1 A;  3BY6 A;  3ELK A;  1O7F A;  4U0Y A;  1SD7 A;  4B09 A;  3RJP A;  2FMY A;  2A5Y B;  3I59 A;  2W84 A;  3HUG A;  2DQL A;  3COA C;  3RTR A;  1O3R A;  1B59 A;  1G3W A;  2JZY A;  4P96 A;  1FSH A;  5JR3 A;  5F64 A;  1SFU A;  1HSJ A;  2JSC A;  2NNN A;  1AOY A;  3CTA A;  2XAQ A;  5F6F A;  1FYM A;  4M71 A;  4CHU A;  1I1S A;  1PDN C;  3SHF A;  4OIN F;  1UFM A;  1DPR A;  1I5Z A;  2EK5 A;  5IT9 K;  2EFP A;  2DQR A;  2GWR A;  1FT9 A;  5K5O A;  5JFR A;  4FX0 A;  5EEG A;  4E70 A;  3TDZ C;  4UVA A;  1FYK A;  3IKV A;  4HF2 A;  5CVV A;  2OA4 A;  2CGP A;  4DQ2 A;  4PZJ A;  2UXX A;  3LA7 A;  2YX7 A;  5HVQ C;  5IT9 Z;  1YW9 A;  4WF2 A;  3HSE A;  3EUH A;  1ZLK A;  3J7A O;  2R7D A;  1ZYR F;  2K7L A;  4A0Z A;  1ZN2 A;  3QPT A;  3NQO A;  2XAF A;  2Z5U A;  1PUE E;  4EM0 B;  2XAS A;  2YR2 A;  4U7B A;  3T8T A;  5BS6 A;  4IRG A;  4L18 B;  3P7N A;  2XIG A;  2OZ6 A;  4BH9 A;  1KQ9 A;  3FXR A;  2CYY A;  5L3B A;  1P92 A;  4EJV A;  4IRH A;  3C7J A;  2UXN A;  4ZYH A;  1MGT A;  2LDU A;  2XGX A;  5DDG A;  1JGS A;  4P9F A;  5J6X A;  2QLZ A;  1GXP A;  2H27 A;  3EET A;  1FYL A;  5LHI A;  4RAZ A;  4RS8 A;  1XCB A;  4ZYG A;  2PLY A;  4L9J A;  3LAP A;  3GEZ A;  1SD4 A;  5HS8 A;  1BC8 C;  1R22 A;  1BIA A;  3ZMS A;  5E1Z B;  3TQN A;  4EM2 A;  4LB5 A;  3FMR A;  1T98 A;  3V7R A;  4WCG A;  1I1G A;  3VOE A;  1KU2 A;  2V6C A;  1HKQ A;  3WTU C;  1H9T A;  1SFE A;  4KUM A;  3HYI A;  3SQN A;  4YFK F;  2IA1 A;  3ZMV A;  4HQM A;  2B0L A;  2WTE A;  2A6E F;  3F8F A;  3QP6 A;  3N97 A;  3QP5 A;  5DCM B;  5A2Q K;  1YLF A;  2QZ8 A;  1LJ9 A;  4LK1 F;  4BHC A;  2XAH A;  4LLL A;  2ZFW A;  1KGS A;  1T0F A;  1SMY F;  4HW0 A;  3WGI A;  4MNU A;  5HLG A;  1LDK B;  2XKO A;  4RAY A;  1TLH B;  4ZH4 F;  3J81 K;  2VC0 A;  5E1X A;  1DUX C;  3BOQ A;  5ICG A;  3HSR A;  2L4A A;  5A2Q Z;  3CUQ B;  3ZP5 A;  3EDP A;  2GQQ A;  4U88 A;  4KN7 X;  4Q48 A;  1IN5 A;  3CO6 C;  1UHM A;  3GZ5 A;  5LGU A;  3F8C A;  4CDG A;  3SZP A;  1KYZ A;  3DF8 A;  5D8K B;  3B73 A;  3J81 Z;  5HDK A;  4IHT A;  4M9X A;  4LGW A;  1IUY A;  2IA2 A;  3VOD A;  2A07 F;  1KU9 A;  1Z7U A;  1RNL A;  1YYV A;  3K2Z A;  1IN4 A;  3F6O A;  1FY7 A;  3J80 Z;  3L2C A;  3WE3 A;  1LEA A;  1RI7 A;  4JBA A;  1JHF A;  4BXU A;  3GVA A;  1MJB A;  4BAY A;  2FNA A;  2D45 A;  1H9G A;  1H0M A;  1IN6 A;  1SD5 A;  1XSV A;  2IPQ X;  4EMS A;  4OMZ A;  2HYF A;  1S7A A;  4PGH A;  2JRT A;  3R0J A;  2ZKZ A;  4G6D A;  5L3D A;  5D5U B;  2HKX A;  1QNT A;  4LK0 F;  2FU4 A;  2MH2 A;  3ERE D;  4M9Z A;  2DBB A;  2VE8 A;  4L0Y B;  1RUO A;  3QU3 A;  5AIP A;  3S2W A;  4Q4Z F;  1V4R A;  4N9I A;  1FOK A;  3KFW X;  4HF1 A;  2ELH A;  4MEX F;  3HIF A;  3GFL A;  2VBZ A;  4I2O A;  4PCQ A;  2KIF A;  2M87 A;  2V1D A;  2M1B A;  5K5R A;  2XRN A;  4MTE A;  2BE5 F;  3GLX A;  4G7Z F;  4LJZ F;  1D8J A;  3FM5 A;  4L0Z B;  5D8L B;  4UV8 A;  4UXN A;  3Q9V A;  3IKT A;  2QBY B;  4I98 B;  2FNP A;  1GVJ A;  4ZZD A;  4CIC A;  1R36 A;  2FRH A;  2BV6 A;  1O3S A;  1U5T C;  1OKR A;  5TRD A;  2XAJ A;  4FHT A;  2QM3 A;  1Z05 A;  3KLO A;  5FD5 A;  2C6Y A;  3Q5F A;  3JSO A;  5D4S A;  4I09 A;  5E8I A;  3U1D A;  2HDC A;  2GAU A;  2M45 A;  1SD6 A;  4K2E A;  5HDG A;  5ICC A;  3V8L A;  2CW0 F;  1EH7 A;  2W57 A;  3I4P A;  3MAJ A;  3RPU A;  2DK8 A;  2XRO A;  5H6Q A;  4M73 A;  2L01 A;  1YO5 C;  1XN7 A;  1RZ4 A;  2PJP A;  3E6M A;  1UHW A;  4OIO F;  1J0R A;  1OYW A;  2HFH A;  3M8F A;  3SFZ A;  1XSD A;  2OAZ A;  3CJN A;  1FZP B;  2IRF G;  5E18 F;  5D5V B;  4HZF A;  5TJJ A;  1HQC A;  3LQQ A;  3EQL F;  4RB2 C;  1QGP A;  3V4G A;  2DTR A;  2AS5 F;  2Z3Y A;  1DDN A;  3KEQ A;  3HSF A;  1O7L A;  4EV0 A;  1J59 A;  1KA8 A;  2EFO A;  2ETH A;  2F5C A;  2HQN A;  1J7K A;  3H3Z A;  2MLK A;  2GA1 A;  4G6Q A;  1FC3 A;  2KIU A;  2RKH A;  4WXD A;  4YIF A;  5K1Y A;  3JAM K;  3TO6 A;  3KP3 A;  3HTS B;  2H6C A;  4O5V A;  4MQ9 F;  2VT2 A;  4ENJ A;  1F5T A;  1KQ8 A;  3IL2 A;  5FGM A;  5H20 A;  1ZRD A;  2XV4 S;  5LEK A;  4JQF A;  2O6G E;  1G4D A;  3OV8 A;  1PP8 F;  2HEO A;  3I59 B;  1O3Q A;  5DV5 A;  3D5L A;  2ZCW A;  3R6S A;  1XB4 A;  3FXQ A;  2RV8 A;  2FBI A;  4GXO A;  1LEB A;  2DLL A;  3JAM Z;  2Y75 A;  2LSO A;  5HS9 A;  5LEJ A;  4KIB A;  5FLX Z;  1BI3 A;  1REP C;  3E97 A;  4N9H A;  3IRQ A;  3DKW A;  3FZV A;  1FNN A;  2L54 A;  3WOD F;  2K4B A;  1RUN A;  3BJO A;  1HST A;  3F72 A;  2Z9O A;  2W25 A;  3ZMZ A;  1I27 A;  1FBS A;  2EV6 A;  4Z2Y A;  2PN6 A;  4G9Y A;  4I0A A;  4NB5 A;  4ENK A;  1R58 A;  3RKY A;  1YFH A;  4KDP A;  3RI4 A;  2MA3 A;  4I02 A;  1YIO A;  3IWZ A;  1XD7 A;  1DPU A;  5CVU A;  4AIJ A;  5HLI A;  2NYX A;  5FB2 A;  1ZG3 A;  5BQT A;  4RB3 C;  4MTD A;  3L00 A;  3T0Y A;  2FBH A;  2EWN A;  1O3T A;  3LAJ A;  4BNC A;  3DXJ F;  3IRR A;  4P9U A;  4XLP F;  2EA2 A;  4P55 A;  3CUO A;  2K27 A;  4LB6 B;  1F1Z A;  2EFW A;  5KK1 A;  4YII A;  5FFZ A;  4AWX B;  5CVI A;  1JE8 A;  2IA0 A;  1U5T A;  4A12 A;  2RVC A;  4RGR A;  1HKT A;  3ZMU A;  2CQK A;  3MEX A;  4QLC U;  3KP2 A;  3MCZ A;  3BPX A;  2A61 A;  5CJ9 A;  2YSR A;  4KMU X;  4ASN A;  2UZK A;  2BBY A;  1KU3 A;  2PQ8 A;  2OBP A;  4RB1 A;  1LNW A;  3RKX A;  3BWG A;  3CDH A;  3JW4 A;  1T38 A;  5LHG A;  2WV0 A;  2KJB A;  1SMT A;  4HDV A;  2OQG A;  2P6T A;  3RDI A;  4ESB A;  4LFU A;  1IRG A;  4H0E A;  1YW8 A;  3L09 A;  3RYP A;  2VN2 A;  2QYO A;  3RKW A;  2NRA C;  5ED4 A;  2G7U A;  1OYI A;  2VBX A;  2V1U A;  1U6G A;  2MBF A;  1BI1 A;  5IT3 A;  3KP6 A;  1A04 A;  1P4X A;  4RGU A;  4KIC A;  2FQ3 A;  4KT5 C;  1W4M A;  3ZN1 A;  2MLG A;  1D8K A;  3DEU A;  2O61 A;  1XGM A;  1TBX A;  2Z33 A;  2RGV A;  1EV7 A;  4KNY A;  3F22 A;  2F5D A;  4U0V A;  4RGX A;  1TTY A;  4Q5S F;  3OOP A;  2X0L A;  5DCF A;  3E6D A;  1K79 A;  3DP7 A;  2ESH A;  3WTV C;  1MDM A;  4ZYD A;  4IPA A;  4Y15 A;  3E3V A;  3QPH A;  2QQ9 A;  1BI0 A;  4NHJ A;  4HLX A;  2DI3 A;  2FA5 A;  4HF0 A;  2R7F A;  1QO0 D;  2XVC A;  3DQV C;  2HQR A;  1U8R A;  2HTJ A;  3KP7 A;  3R60 A;  2P5K A;  3KP5 A;  3HHH A;  3CLO A;  4G94 A;  5JI6 A;  1BBY A;  1TQP A;  4M6Y A;  4G8X A;  4CO8 A;  2ESN A;  5FFX A;  2DPU A;  1R1U A;  5D5X B;  2QUF A;  2HZT A;  3M9A A;  4HDU A;  3I58 A;  1WI9 A;  2J5O A;  1J5Y A;  4A5M A;  1W7P B;  3GUD A;  2BGC A;  4WX9 A;  1R23 A;  1G3T A;  4EQQ A;  3ECO A;  3U9G A;  1WSU A;  4HQE A;  4S05 A;  4KFC A;  4WXH A;  1Z9C A;  5D6F A;  4AD9 A;  2RN7 A;  1FLI A;  4KIF A;  1X3U A;  1QZZ A;  2BEO A;  3CO7 C;  2D1H A;  4HV5 A;  1ZAR A;  1Y0U A;  2DPD A;  2VE9 A;  4XSX F;  3P9K A;  2CO5 A;  2MD5 A;  3WGG A;  2M8E A;  1J2X A;  3WGH A;  4RGS A;  2F5E A;  1W7P A;  2UWM A;  2CFX A;  4D0P A;  1R5H A;  1E17 A;  2KKO A;  3ZPL A;  2ZO4 A;  3U2R A;  4GYI A;  1ZRF A;  3KZZ A;  3GFM A;  2A3S A;  5D5W B;  1G3S A;  1K78 B;  2O8X A;  4L9N A;  3O3K A;  3QU6 A;  1LDD A;  2ZJ2 A;  3GXO A;  3ZMD A;  4L5I A;  1XGS A;  4OIP F;  5E17 F;  3HOT A;  2GXB A;  4LMY A;  2G7H A;  1MJA A;  1MD0 A;  2P7V B;  4GO1 A;  3VFZ A;  5DUK A;  1TQI A;  2GIV A;  4EGZ A;  1HW5 A;  1FSE A;  2ZNZ A;  3JTH A;  4ETS A;  3ML6 A;  3O6B B;  2XAG A;  2XKP A;  2P8T A;  1RIO H;  4TV7 A;  2OD5 A;  1Z6R A;  5AON A;  1T39 A;  2QQB A;  1IW7 F;  1FWZ A;  2HR3 A;  2G9W A;  1K78 A;  2K4J A;  2Q8K A;  4EJW A;  2FOK A;  3I53 A;  3T5X A;  3QRF F;  4CGZ A;  1F4K A;  4EJU A;  2Y48 A;  5DEQ A;  1HBX G;  1BC7 C;  2YPR A;  1S3J A;  2F2E A;  4S04 A;  5HLH A;  2K02 A;  2KJC A;  3M1E A;  2DFI A;  3B02 A;  4R1H A;  1IRF A;  2HWV A;  1ZRE A;  1HXD A;  1FBQ A;  3E6B A;  1QZY A;  2LKP A;  1WKM A;  4HBL A;  1FX7 A;  4R8H A;  1R1V A;  4AIK A;  5ILU A;  2Q0O A;  2W85 A;  5JVT A;  4O3M A;  2KRF A;  1HW1 A;  2LF7 A;  5CLS A;  3JSP A;  1ZG1 A;  3R61 A;  1U2W A;  4LG0 B;  1ON1 A;  4CZZ A;  4WWC A;  3KCC A;  2ADU A;  4L5J A;  1BN5 A;  1ODD A;  2A6H F;  1B6A A;  1S29 A;  4KA4 A;  2QWW A;  2V1X A;  1B9M A;  2E7W A;  3F23 A;  1L3L A;  1EH6 A;  4HOB A;  2R3S A;  3TO7 A;  5FO5 A;  4LG0 A;  3WTW C;  1KQ0 A;  4EJT A;  3WU0 A;  2LNB A;  3SZT A;  3C18 A;  2EV5 A;  2F5F A;  3FXU A;  2P4W A;  4MQV A;  2VOD A;  1R00 A;  1QBJ A;  2STW A;  4G7O F;  2EJR A;  3LA2 A;  5BMZ A;  4WK8 F;  2RC4 A;  1FPQ A;  4YFX F;  3PFI A;  5EEH A;  4QWQ A;  2IT0 A;  2HS5 A;  2W24 A;  2HOE A;  1U3E M;  2TDX A;  4OU0 A;  5LGT A;  1ZRC A;  4A0Y A;  5HDN A;  3GW2 A;  2HYG D;  2QVO A;  4LD5 A;  4M74 A;  5L3C A;  2P6S A;  5ILS A;  1OYY A;  1J75 A;  2ZBK A;  1ZH5 A;  3GYH X;  3IWF A;  1ZGA A;  1OMI A;  3V8J A;  2PMH A;  4XLN F;  4P5O A;  2FEZ A;  3HRS A;  1ZLJ A;  1Q1H A;  2OU2 A;  4M72 A;  1XSX A;  4MHG A;  4B8X A;  4Y17 A;  4AVP A;  3ULQ B;  1GXQ A;  4ESF A;  1XGO A;  5DD4 A;  5AIQ A;  2PFB A;  3O2P E;  3WTZ A;  1EH8 A;  3GWZ A;  3V7S A;  4I01 A;  4R79 A;  3F8M A;  3TDU C;  1TNS A;  2GXG A;  3C3W A;  2HKO A;  2Z99 A;  1IXS B;  3K69 A;  1W7P D;  1MJ9 A;  1CF7 B;  4EJO A;  4PGG A;  4A6D A;  4EVI A;  3LFK A;  1ULY A;  1C0W A;  1E2X A;  3BPV A;  1STZ A;  1OPC A;  1BM9 A;  2FE3 A;  2L4M A;  3MZH A;  1LDJ A;  4GCV A;  2EB7 A;  3FM3 A;  5J8C A;  5D6E A;  3LQR A;  1U5T B;  2H94 A;  4Q47 A;  2ZME B;  1KU7 A;  2M5W A;  1P6R A;  5CYV A;  1O57 A;  3PQK A;  2X4H A;  2FML A;  3IC7 A;  5LRS A;  1CF7 A;  1XCV A;  5ICE A;  2IP2 A;  4NQW A;  1XMK A;  4HAM A;  1YS6 A;  2EV0 A;  2MH9 A;  2RDP A;  4HX4 A;  1YTY A;  2P7C B;  2L02 A;  1F9N A;  1WRJ A;  3HTU A;  2IVM A;  1P2F A;  1W5T A;  1T6S A;  1YW7 A;  4M6X A;  1NHA A;  2XUB A;  2ZME A;  3BP8 A;  2P5L C;  1QPM A;  2IJL A;  3ROU A;  3E5U A;  3L7W A;  3CUQ C;  3GF2 A;  2VON A;  3HHG A;  1DP7 P;  5JHU A;  4IRI A;  5BPI A;  3TO9 A;  2JPC A;  1JXS A;  1SFX A;  2Y0M A;  3F8N A;  1Z91 A;  2V9V A;  5DYM A;  1HKS A;  4IHS A;  5HOO A;  3F21 A;  2COM A;  3L9F A;  1IN8 A;  3K1M A;  3KE2 A;  4IJA A;  1LB2 A;  1TW3 A;  1XDU A;  3DPL C;  3M7G A;  3GZ6 A;  3Q9S A;  3N4M A;  2JTV A;  4ZYE A;  4CXF A;  1MDM B;  1P4W A;  4U0W A;  1CGP A;  3HRU A;  5E8G A;  2O03 A;  3E5Q A;  5ERI A;  5CVR A;  3P9I A;  5LLQ A;  4BHB A;  4FT8 A;  3HOS A;  1IF1 A;  3I0T A;  1BJA A;  1D3Y A;  3GO5 A;  1ONV A;  3W6J B;  4A5N A;  4KMF A;  3MQ0 A;  5FD6 A;  3E5X A;  3E6C C;  4HV6 A;  1HW2 A;  3PQJ A;  4N0B A;  3K1N A;  1ON2 A;  4A6E A;  4OMY A;  2VOP A;  1GHC A;  4I7H A;  1TQM A;  3WE2 A;  3ZMT A;  4UVC A;  2NS0 A;  2PMU A;  1SAX A;  2EFQ A;  2ISY A;  2H6B A;  3FMQ A;  3REO A;  5CVJ A;  2M30 A;  3I54 A;  5H6R A;  3BJ6 A;  3SXY A;  5LBQ A;  2E7X A;  3FWE A;  3DFG A;  1P4A A;  1U78 A;  2STT A;  4FX4 A;  2GA2 A;  3V7C A;  4OIR F;  3DPT A;  3R4K A;  1D5V A;  3EYY A;  3EYI A;  3MFK A;  1I6X A;  5LHH A;  2Q2E A;  3G3Z A;  1BOA A;  4LLG F;  3IHU A;  4HLY A;  4IVN A;  3ZN0 A;  1R5G A;  5J8F A;  4OOI A;  2VT3 A;  4ON0 A;  3TOA A;  2CSO A;  2PEX A;  4A0X A;  2VC1 A;  2V79 A;  3K9T A;  5BPD A;  2DT5 A;  2QEN A;  2CG4 A;  1ZGJ A;  5L3F A;  3GX4 X;  1KYW A;  3I71 A;  3HRM A;  4UHT A;  4UUV A;  4HA8 A;  1S6L A;  2JPB A;  5DCM A;  2L3D A;  4GYG A;  2ZXJ A;  4BYY A;  2ZNY A;  5D4R A;  3GFJ A;  2A69 F;  3J80 K;  2JT1 A;  2BYV E;  4UNO A;  3KLN A;  3BZ6 A;  1UST A;  4HYE A;  1Z6T A;  3KP4 A;  5F1R A;  2DU9 A;  3RPQ A;  2OZU A;  1FBU A;  4G7H F;  2WWY A;  4UVB A;  3I5U A;  1PP7 U;  3CUQ A;  2FBK A;  1MKM A;  2NNY A;  3WU1 B;  3NEU A;  4CYD A;  1TW2 A;  3F6V A;  3LWF A;  1ZAO A;  1J9I A;  4AIH A;  2HTS A;  3AAF A;  3ABT A;  1T2K A;  1K6O A;  3MWM A;  3WTS C;  1WWX A;  4EGY A;  2H09 A;  2RNJ A;  1AWC A;  2OQR A;  5K5Q A;  2MC3 A;  4PDK A;  2CWE A;  6PAX A;  4U7D A;  5ICF A;  4GGG A;  2O0Y A;  2DK5 A;  2O3F A;  4ENM A;  2E1N A;  2XHK A;  2ACJ A;  5LGN A;  3G73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...