1TNTA

A novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
MELWVSPKELANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAALLLRQGEIETSLGYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MU-TRANSPOSASE
publication title A novel class of winged helix-turn-helix protein: the DNA-binding domain of Mu transposase.
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 11
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1994-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tntA00
4A12A 1ZGJA 2ZCWA 5CJ9A 1I1SA 2O3FA 5BMZA 1XDUA 4MTEA 5ICGA 5D8LB 3KZZA 3HOSA 3NRVA 3TOAA 2XHKA 3ERED 4IHSA 1GHCA 1QZZA 2E7XA 3VEPA 1L3LA 3BPXA 4BQAA 2PMHA 3AAFA 1HSJA 1WRJA 2QQBA 4MQVA 3FM3A 4OIPF 5FD5A 1Y0UA 1I1GA 1F5TA 1BBYA 1TW3A 4I0BA 3PFIA 3IRQA 1R22A 3JSPA 3HRMA 3BJ6A 1IUYA 3BPVA 2O0YA 1O3SA 2V1UA 1W7PD 2JT1A 3DQVC 3FM5A 2F5DA 2OU2A 1T38A 2LSOA 2Z99A 4IVNA 1XGOA 1TQMA 2NRAC 4PDKA 1B59A 1UB9A 1IAWA 2Y0MA 2ZO4A 3RDIA 2FE3A 5AIQA 1FYMA 4WK8F 4CHUA 3CO7C 2VOOA 1ULYA 6PAXA 4IRGA 4IXAA 2M87A 2HQRA 2DPDA 2HYFA 1V3FA 5FFZA 1BM9A 2LKPA 3WG9A 5E8IA 2BYVE 2XAGA 5HLHA 2WC2A 2VXZA 5CVRA 3JAMZ 1TTYA 1U2WA 3GLXA 3WTSC 3WE3A 4MQ9F 1RNLA 1S6LA 1XDSA 4EM0B 3G3ZA 4EGYA 4M6YA 2LF7A 2MH2A 4XSZF 1SMTA 3E5UA 1ZHFA 2WWYA 3D5LA 2XIGA 3REOA 1TNSA 4Y15A 2FQ3A 2CSOA 1O3QA 2BBYA 5ICEA 1SMYF 3I0TA 4G6DA 1SD6A 3C18A 2OA4A 2CYYA 2ZNZA 3MQ0A 2XGXA 2BEOA 1HQCA 5L3BA 3KP6A 2EJRA 4KUMA 2EFQA 4A5MA 3F72A 1V4RA 1ZGAA 2HS5A 3RKXA 5D5XB 4BH9A 4N0BA 2V1DA 4Q47A 3COAC 1I5ZA 3TO9A 2K4BA 1MD0A 3M1EA 3O6BB 2K4JA 2FNAA 4DQ2A 4ZZLA 3K0LA 3DPLC 2V9VA 1BI3A 2O61A 1T0FA 3MZYA 1BOAA 3ULQB 1R1TA 3KEQA 2DW4A 1YW7A 3HSFA 1P4AA 3DFGA 4EJTA 4NHJA 2QQAA 3BP8A 5L3FA 3FF5A 3P9CA 5FB2A 3TGNA 3SFZA 5D6FA 2AXLA 3K2ZA 1LQ1A 1AWCA 2CGPA 3J81Z 1ZG5A 1ZLJA 2KIUA 2RDPA 5HOOA 2PEXA 3GX4X 5L3GA 1KQ8A 1IXSB 3ZP5A 1Z7UA 4HV5A 4Y13A 5BPDA 1BN5A 4UVAA 5HS8A 3J7AO 3U9GA 3K1NA 4HA8A 1IN6A 2OQGA 2H6CA 5LGNA 1XSDA 1FZPB 2LNBA 1R5GA 2PBIA 3ECHA 4ESBA 3L9FA 1R00A 4ASNA 2X0LA 1OMIA 3GW2A 5E18F 3ABUA 4FT8A 3D0SA 2EFPA 1P92A 3ROUA 3SZPA 1OYWA 5J8CA 3QP6A 4KDPA 3GZ6A 3MFKA 2RV8A 2YX7A 5FD6A 4RB1A 3K9TA 1LJ9A 3NQOA 2XKPA 4A5NA 3E6MA 5BPIA 1YYVA 1XSXA 2HYGD 3MCZA 1J2XA 4I02A 1MDMB 1B4AA 2HKXA 1FY7A 3N4MA 3C7JA 1FT9A 1TLHB 3QU6A 4LFUA 5LHHA 3BY6A 1MJBA 1G6NA 3ZMUA 1HKQA 2LDUA 4B09A 5LRRA 1T39A 2ZMEB 4PCQA 4ENKA 1CGPA 4MNUA 1ZRFA 1XB4A 4ZZDA 4XRFA 3I4PA 2ADUA 4EJUA 5IT9Z 2EFOA 2ISYA 3F8BA 4HLXA 1UCRA 3HRUA 4KMUX 2V6CA 2WV0A 3LFKA 2UWMA 1D3YA 2CWEA 2H6BA 3OV8A 4WXDA 4KN4X 1G3WA 2LF8A 4N9IA 2PG4A 4P96A 4ON0A 1OR7A 4LMYA 2P5KA 4JK1X 4RGUA 2CW0F 4LGWA 1JGSA 3JTGA 4BHPA 2XROA 1JHFA 1WI9A 1YG2A 1RZ4A 4HF0A 2CG4A 4WXHA 2A61A 3EQLF 1BIBA 2L54A 3WTWC 2GAUA 4WCGA 4HF1A 4P5OA 2ISZA 1IN8A 2JPCA 3KP7A 3WGHA 3GEZA 2XAQA 3OOPA 2W57A 1G3SA 1R23A 3EYIA 2GZWA 1J7KA 1T6SA 3MZHA 1D5VA 4XLNF 4FX0A 2O03A 3TDUC 1D8KA 2FOKA 3CLOA 3R0AA 4QWQA 3T1BA 2QQ9A 2VT3A 2JSCA 2M30A 3NEUA 4YFNF 1A04A 3Q9SA 4KN7X 1XSVA 5D6EA 4OIQF 3G73A 2D1HA 5F1RA 1U5TA 4KA4A 2P7CB 2P8TA 1R36A 1TQIA 3H92A 4BYYA 2HWVA 1FOKA 1FSHA 1ZG1A 3IWZA 2EB7A 2HZTA 5L3CA 3L2CA 1YFHA 5FO5A 4DNCA 1RI7A 2AS5F 1H0MA 4RAZA 1JE8A 1SD5A 3T5XA 1ZARA 4UV9A 2TDXA 1E17A 2PMUA 4IHTA 1ZG3A 2O6GE 1ZRDA 2DK5A 3JW4A 1Z6TA 2YU3A 3RKWA 4I01A 2PLYA 5DCMB 2ZJ2A 1KU3A 1YLFA 3WU1B 1U6GA 3KE2A 4G94A 4ENMA 1P6RA 5HS9A 1XGNA 4F7ZA 5ERIA 3TO7A 5ILVA 5E8GA 5F64A 3R6SA 2EV0A 4YIFA 2Z33A 4M71A 4GGGA 5HDNA 3C1DA 2QWWA 1L0OC 3BOQA 1U5TC 3I64A 1B9NA 4EM2A 3QRFF 3HHHA 3CUQB 1PUEE 2RVCA 3TDZC 4UVCA 2GXGA 5E1XA 3IL2A 1XGMA 4IPAA 2XKOA 2IVMA 3GXOA 2DO7A 1DUXC 3QPHA 3F21A 4M72A 4Q5SF 3KETA 1LEAA 2ESHA 2JZYA 4OIOF 2KJCA 3B02A 1TW2A 3ABTA 2QENA 2VODA 2WTEA 2L4MA 5K5QA 2Y75A 2JTVA 3ZMDA 2HGCA 4L9JA 3FWEA 5KVRA 1UHMA 2L3DA 2MC3A 3M7GA 3GFLA 3RYPA 3I5UA 4GYIA 3BDDA 3EETA 2O8XA 1ZN2A 3U1DA 1U78A 2Q8KA 3QU3A 3ECOA 1J75A 3W6JB 3F8FA 1MJ9A 2DT5A 4G9YA 2VOPA 2DK8A 2QUFA 1FPQA 2YR2A 2ZKZA 1K78B 1ON1A 2DPUA 1ON2A 4EM1A 1J9IA 3MEXA 4M74A 3I53A 5LGUA 2MLGA 3HTSB 4ZYEA 4CYDA 1P2FA 4AVPA 3F22A 3WTUC 4CO8A 1FP2A 5CLSA 1WKMA 4BAYA 5L3EA 3ZMTA 3V7CA 2ELHA 4GXOA 4UNOA 1Z9CA 4EJOA 1YO5C 5DYMA 5ILUA 4RB3C 1BI1A 4S05A 5AIPA 2STWA 3F23A 2HTSA 1R1VA 3GYHX 2QVOA 4HX4A 4YFKF 3CJNA 1EH7A 4M73A 5H6RA 5BOXA 2OD5A 2XUBA 2ACJA 2NNNA 2F5CA 2K27A 3M9AA 1SAXA 1HKSA 2GQQA 3IKVA 4NB5A 1S3JA 4EVIA 3QP5A 3IWFA 2Q2EA 2DAOA 1CF7A 4L5IA 5EEHA 3WTTC 4RGSA 2K02A 3IC7A 1BJAA 1KA8A 1HKTA 5DD4A 2RGVA 2FMYA 3WODF 4YIIA 5FFXA 3E97A 1SFEA 5K5RA 3BZ6A 1SD7A 3WTZA 4KFCA 2IA1A 2XVCA 2A6HF 2HKOA 3QPTA 2FA5A 1KU7A 5EEGA 3RI4A 1DPUA 4KYWA 2FRHA 2GWRA 4G7HF 3R0JA 3GVAA 4LG0B 1XN7A 1Z05A 2VBWA 4WWCA 1BC8C 4ETSA 2FMLA 2MH9A 2R3SA 2VBZA 3GUDA 2FBIA 4Y17A 3LQRA 2E1CA 3BJAA 1W5TA 4KIGA 1MKMA 4I7HA 4HOBA 2QYOA 2XAJA 2NS0A 3P7NA 1PP7U 5E17F 2L01A 1OKRA 3QAHA 2EFWA 4AIJA 3L09A 1F1ZA 2OZUA 3L00A 4KIBA 2BV6A 4RGXA 4WF2A 1MDMA 3BWGA 5J6XA 1C0WA 2KKOA 1ZLKA 3QOPA 3S2WA 2C6YA 1XCBA 2JPBA 4ENJA 2HQNA 3ZPLA 2A69F 2MA3A 3V8JA 1ZREA 3KCCA 3K69A 4FHTA 1S7OA 3ZMZA 3SZTA 1HSTA 2FBKA 3RIRA 5ED4A 4R8HA 2QLZA 1TQPA 2UXNA 5DCFA 2P4WA 2VN2A 1G3YA 2PI0A 4KMFA 3KP3A 1YIOA 1IN5A 1ONVA 2UXXA 2VT2A 1DP7P 4MEXF 3DEUA 3FMQA 3T8TA 2CFXA 1IXCA 4HX7A 4MEYF 2P6SA 4I09A 2K86A 2ZFWA 2YX4A 5A2QZ 3VODA 2HTJA 1B6AA 3TOBA 4MGRA 1QNTA 3E6DA 1J59A 2ESNA 2W24A 3DP7A 4ENNA 4MHGA 2BGCA 4HYEA 2Q0OA 4A0YA 5LEKA 4LJZF 2R7FA 1SFUA 1D8JA 2Z3YA 4GO1A 1O3TA 1LDKB 4PGHA 2K7LA 1T98A 3FMRA 1QO0D 2A68F 2L4AA 4WXCA 2MBFA 5TRDA 5H6QA 5D5UB 3SHFA 2XASA 3FZVA 4OMZA 2QZ8A 2BE5F 1MJAA 4BHBA 4AWXB 2ZBKA 5J8FA 5A2QK 1SD4A 4N9HA 1OYYA 4U7BA 4IJAA 2RNJA 3IKTA 1YS7A 3TKYA 4I98B 2XRNA 1I27A 2OZ6A 5D4RA 1QBJA 4IRIA 1U3EM 1W7PA 3HRTA 2H94A 3GF2A 2G7UA 4G6QA 4JQFA 5LEJA 4OIRF 3F3XA 2VE9A 2MLKA 2RN7A 3I59B 4U0WA 1ZH5A 3ML6A 2OQRA 4EV0A 3RKYA 4D0PA 3EYYA 3F6VA 2ZNYA 3ZN0A 3I54A 3C3WA 2ZXJA 1UHWA 5DUKA 2IP2A 3DKWA 3CUOA 3JSOA 5AONA 2DU9A 1E2XA 1HW2A 1WSUA 3WTVC 3O2PE 1Z1DA 1RUNA 4L0ZB 2J5OA 3LAPA 3ZQ7A 3ISPA 3LWFA 4RB0A 4UVBA 5JVTA 2IRFG 2PN6A 1TNTA 4U7DA 3H3ZA 4HQEA 4PGGA 3LSTA 3W6KB 1HW5A 3PQKA 4EJVA 1R5HA 3ZN1A 3SXYA 5TJJA 2KJBA 1BC7C 3GO5A 1QGPA 2VBXA 4CXFA 4CICA 1KQ9A 4R79A 1EH8A 2JRTA 1GXPA 1FC3A 1YS6A 4IF4A 4KICA 2EV5A 3F8NA 4HAMA 1FX7A 3KLNA 1B9MA 3MWMA 3L7WA 4A2UA 4LK1F 1EV7A 1FSEA 4K2EA 4U88A 4I2OA 4LB6B 3V7RA 4M9SA 3U2RA 5HLGA 2P6TA 2R7DA 1R7JA 4Q4ZF 3T0YA 3E5XA 3BROA 1PP8F 3FXUA 5ILSA 1F4KA 5BS6A 2G9WA 4G7ZF 3HTUA 2D2WA 1K78A 2FU4A 3CUQC 1JHHA 1XCVA 3J80K 4XBFA 2QBYB 2VONA 3M8FA 2FNPA 4M9ZA 5FLXK 1G3TA 1S8NA 1LB2A 4BNCA 1R58A 4RGRA 1UFMA 3E5QA 1DPRA 1REPC 2YPRA 2FBHA 2P5VA 4ZYDA 4KT5C 1USTA 3B73A 1OYIA 2HEOA 4ESFA 2DI3A 2FEZA 3V7SA 1IZ1A 4HBLA 5IT3A 3F8CA 1I6XA 1KU9A 4UHTA 3ZMVA 2VE8A 3KP5A 5L3DA 4RAYA 3GWZA 4P55A 1USSA 5LBQA 1FWZA 2FXAA 2Y48A 1IRGA 1FBQA 1NHAA 1BI0A 1O3RA 2A3SA 4JBAA 2XAFA 2DTRA 3K1MA 4ZYHA 3KP2A 1VTNC 3KEOA 3FHZA 3R4KA 2EA4A 1IW7F 3DXJF 1EH6A 4A0XA 1MZBA 3HUGA 4BXUA 4RS8A 2DQLA 4ZYGA 5D8KB 1LNWA 4BHCA 3EUHA 4PZJA 2H27A 5ICFA 5ICCA 1QPMA 1H9GA 3KLOA 4L9TA 4MTDA 1IRFA 2D45A 2E1NA 4HF2A 2H09A 5HS7A 4GCVA 4YFXF 1F9NA 1GVJA 4LG0A 1J0RA 1IN7A 2L02A 3HRSA 3E6BA 1LVAA 2RQPA 3SQNA 2GIVA 2IPQX 4NQWA 3TQNA 4U0YA 1K79A 3BJOA 4KNYA 2X4HA 1JXSA 3PQJA 4LLLA 4CGZA 1PDNC 2IJLA 3I71A 2IT0A 1SFXA 1AOYA 4HQMA 5DV5A 2D1VA 1IXRC 4P9UA 1QQIA 2W85A 2HFHA 3FXRA 3LA7A 3WU0A 1WWXA 2OBPA 3N97A 1CF7B 3MAJA 3FX3A 3JAMK 3K1PA 2M45A 1ODDA 2Z5UA 1KU2A 1YW8A 5H20A 1WQ2A 5LRSA 3WGIA 2YSRA 1RIOH 2F2EA 1O57A 2KIMA 1S29A 4R1HA 1ZAOA 4HZFA 1K7AA 4HV6A 1LDJA 3ELKA 1T2KA 4AD9A 3WTYC 5JR3A 3TO6A 4O5VA 4OU0A 2V1XA 1R1UA 4M6XA 3I58A 2NAZA 4TV7A 1IF1A 4FX4A 1BIAA 2COMA 1OPCA 3R60A 2EFNA 1YW9A 1DDNA 3RPQA 5HDKA 5CVUA 1S7AA 5E20A 4WX9A 5HLIA 5CVJA 5CYVA 5JI6A 4Z2YA 3DV8A 3KFWX 3EDPA 4EMSA 1RUOA 4LLNA 2DQRA 4EQQA 1P4XA 3Q9VA 2ZMEA 2HR3A 2A5YB 3WE2A 3RJPA 3M8EA 4OINF 3KZYA 2PFBA 2J5PA 2FF4A 1QZYA 4OOIA 3GFJA 4G8XA 1W5SA 3GFMA 4HDUA 3VB2A 3P9KA 5F6FA 3FMSA 1B1BA 5LHGA 4RB2C 2M8EA 5DUIA 2FSWA 2G7HA 2IA2A 1FNNA 3J81K 1KYWA 4CDGA 1FBSA 4U0VA 3V8LA 3FXQA 3HSEA 3F6OA 1YQAA 2CQKA 1TBXA 3R61A 5K1YA 5HDGA 3RTRA 4AIKA 2MD5A 1XD7A 3F8MA 2ETHA 2KIFA 2RKHA 3HYIA 2XV4S 3Q5FA 3V4GA 3HHGA 4Q48A 4UUVA 2RC4A 2V79A 1J5YA 4HW0A 3HIFA 1U8RA 4IRHA 1G4DA 1LDDA 3LA3A 2VC1A 4KIFA 3T8RA 5JHUA 2F5EA 2OAZA 2W84A 1FYKA 3VFZA 3CTAA 4EJWA 1O7FA 2PQ8A 3CO6C 2P7VB 4L9NA 5BQTA 4I0AA 4O3MA 2NYXA 1ZYRF 2EWNA 3IRRA 2HOEA 3I59A 3O3KA 2STTA 2DBBA 4UV8A 5K5OA 3ZMSA 2NNYA 4UXNA 3LAJA 2PJPA 3HOTA 1O7LA 3LQQA 4A6DA 1P4WA 5DEQA 2CO5A 5E1ZB 4EGZA 1W4MA 2IW5A 4CZZA 5IT9K 4M9XA 2GA2A 2DFIA 5FGMA 2GXBA 4HLYA 3WTXC 5DD8A 1FP1D 1HW1A 3RPUA 2M1BA 3DF8A 4A0ZA 1ZRCA 2F5FA 3E6CC 4H0EA 4O6JA 5CVVA 1H9TA 3VOEA 4S04A 4LLGF 3LA2A 4XLPF 2P5LC 1IN4A 3WGGA 2VC0A 3GFIA 3V8KA 3KP4A 5DCMA 4GYGA 1YTYA 1FBUA 4QLCU 2DLLA 2GA1A 1KQ0A 1X3UA 4G7OF 5JFRA 5LHIA 2EA2A 1XMAA 1W7PB 5HVQC 3E3VA 4XSXF 2E7WA 1KYZA 1FYLA 3RYRA 3GZ5A 1STZA 2EV6A 4A6EA 4AIHA 3CUQA 3H3UA 1MGTA 1HBXG 1K6OA 4HDVA 2HDCA 1U5TB 3JTHA 2VBYA 2M5WA 1XMKA 3HSRA 4B8XA 2A6EF 4E70A 5LLQA 2EK5A 5KK1A 5D5VB 1Z6RA 5E1WA 4LD5A 3J80Z 4P9FA 2Z9OA 3CDHA 2KRFA 5CVIA 1LEBA 2W25A 5DDGA 4OMYA 5FLXZ 1BI2A 1XGSA 4LB5A 1FLIA 3P9IA 1Z91A 3DPTA 4YG2F 1Q1HA 5D5WB 2QBYA 4LK0F 4L0YB 2A07F 2UZKA 4L18B 4L5JA 3IHUA 2IA0A 4ZH4F 2QM3A 4ESJA 4HX8A 1KGSA 1GXQA 2XAHA 2B0LA 4L9VA 5LGTA 1HXDA 5D4SA
chains in the Genus database with same CATH superfamily
4A12A 2B7EA 1Y0NA 1ZGJA 4JX4A 2ZCWA 4XRSA 3DEWA 5CJ9A 1I1SA 2GOXB 3AG4H 2O3FA 5BMZA 1XDUA 4MTEA 5ICGA 1FMWA 3ERMA 5D8LB 2ELKA 4UUSB 4BUPA 2NOJB 4UB6C 2X51A 3KZZA 3HOSA 3NRVA 3OSFA 3TOAA 2XHKA 4C9YA 3ZQIA 3ERED 4IHSA 1GHCA 1QZZA 4PJJA 2E7XA 3L2UA 3VEPA 1L3LA 3BPXA 3BZCA 3CCMI 1VQNI 3QPLA 3HKZN 2MABA 3LSPA 4BQAA 2NVUB 2LTPA 2PMHA 2WAEA 3AAFA 2L2OA 1MNEA 1HSJA 1WRJA 2QEXI 2QQBA 3QODA 2OF7A 4MQVA 3TW6A 3FM3A 4OIPF 2HQAA 5FD5A 1RKWA 1Y0UA 2EH3A 1I1GA 1XMXA 2MD0A 1V5FA 1F5TA 1BBYA 3DU5A 3ZQLA 1TW3A 3G1LA 2W48A 5K7FA 1A6IA 2FX0A 2M4GA 4I0BA 3FXJA 3PFIA 3IRQA 3KYCB 1R22A 2L5QA 4ZJZA 1D0YA 2ID6A 3JSPA 1QVUA 2KFDA 2EZHA 3BJ6A 3HRMA 4DBRA 3BPVA 2ZC2A 1IUYA 1PJRA 2P81A 2QGUA 3EPZA 1LFBA 2O0YA 5IP7J 1O3SA 2V1UA 2L9VA 2Y9YA 2CUZA 3WHCA 1W7PD 2JT1A 2EILH 3DQVC 3FM5A 2DA5A 2F5DA 2OU2A 2CV1A 1T38A 2LSOA 3LSHA 2OCCH 2Z99A 4B4CA 4IVNA 1XGOA 1TQMA 3I56I 1IC8A 2NRAC 4PDKA 1OCZH 1B59A 1UB9A 2IEKA 2F4OB 5H2FC 3ASNH 5EGOA 3OS1A 1IAWA 2Y0MA 1X1BA 4BE1A 2HDWA 1X1CA 2L7MP 1SFOJ 4QSHA 1AKHA 3H35A 3F0CA 4YRVA 2ZO4A 1N75A 1TWGJ 3G1MA 3RDIA 2FE3A 3GTJJ 5AIQA 1FYMA 4WK8F 4CHUA 3CO7C 2VOOA 3GZNB 1APLC 1ULYA 6PAXA 2DT7B 3DTEA 1X2NA 4IRGA 1QPIA 4IXAA 2M87A 2YS9A 1TC3C 3TL4X 4M3EA 2HQRA 4BY7J 1IRXA 2DPDA 2CW8A 2HYFA 3VSKA 3RZOJ 1V3FA 4ANJA 4DYCA 1BR4A 1MBEA 2DA1A 5FFZA 5C4JJ 3MKWB 1BM9A 2L7KA 5M5XJ 5JLXA 5M3FJ 3DBRB 2Y0SN 3ZQGA 4RLFA 2LKPA 2DA7A 2ECCA 3WG9A 2QCOA 5E8IA 5M3MJ 2BYVE 2XAGA 4CYCA 5HLHA 2WAQN 2WC2A 1F36A 4HSRA 1BW5A 2VXZA 1RESA 5CVRA 3JAMZ 1TTYA 1U2WA 3GLXA 2K5CA 1LE8B 3S3MA 3D5RC 3WTSC 3K4KA 3WE3A 4MQ9F 1XX5A 1RNLA 5KAFC 1S6LA 1XDSA 3BG3A 2E2HJ 2GLOA 4EM0B 3G3ZA 4EGYA 2LBFB 1GT0C 4M6YA 1S7EA 2LF7A 2MH2A 2M0CA 4XSZF 3VYUB 3OL4A 5HNHA 2CQXA 1SMTA 3E5UA 1ZHFA 2BY3A 2BY2A 3HEFA 1KONA 2WWYA 2W7NA 2LOOA 3D5LA 4BEHA 2XIGA 3REOA 2G0EA 3OYJA 1TNSA 4Y15A 3HKZA 1VQLI 2FQ3A 2CSOA 4IOCF 5B66C 1O3QA 1ZK8A 2BBYA 3BR2A 5ICEA 1SMYF 3MKLA 3I0TA 4G6DA 4PK4A 1IV6A 1SD6A 3C18A 5CKTA 2OA4A 2CYYA 2ZNZA 4BACA 1A5JA 3MQ0A 2FJ1A 1EKEA 2XGXA 3ZQFA 2OUMA 2R4GA 2BEOA 1HQCA 4ABZA 5L3BA 2ZJQF 3M4OJ 2Q2EB 1RPWA 3KP6A 1QVTA 2EJRA 4KUMA 4XM3A 2EFQA 1ETXA 3F72A 4A5MA 1T8IA 1V4RA 1ETQA 2MG4A 1ZGAA 2HS5A 3RKXA 4XN0A 2K9NA 5D5XB 4BH9A 1VQMI 4N0BA 2CU7A 3DLAA 2V1DA 4Q47A 3COAC 1I5ZA 2O8KA 1I39A 4Y3OA 3TO9A 2K4BA 3OYNA 2R7WA 1MD0A 3M1EA 3O6BB 2K4JA 2WADA 1FOYA 2FNAA 2VKHA 4M6VA 4DQ2A 4ZZLA 2KRCA 3K0LA 4DIQA 1X58A 3DPLC 3OSGA 2V9VA 1BI3A 2O61A 2KMUA 1TWHJ 1T0FA 1WFXA 3MZYA 5FKOA 3CC4I 1BOAA 4NC8A 3ULQB 3RQIA 2ME0A 1R1TA 3KEQA 3S1QJ 2DW4A 1YW7A 5CPRB 3HDDA 5B1AH 1QHGA 3HSFA 4HNVA 1B8IB 1P4AA 3DFGA 5EJCA 4EJTA 4NHJA 1Q1VA 2QQAA 2VI6A 3ZCOA 5EYRA 4NC7A 3H5RA 2JA2A 3GTMJ 3BP8A 5L3FA 3FF5A 3P9CA 5FB2A 3TGNA 1TT0A 3SFZA 2Z16A 4A3FJ 1NG6A 5D6FA 1ACIA 1T56A 2AXLA 2ZXHA 2GM4A 1ETOA 3PSIA 4C3HJ 3K2ZA 2XSDC 1LQ1A 1AWCA 2CGPA 3J81Z 1ZG5A 1JJ8C 1ZLJA 2KIUA 2M4KA 2RDPA 2PEXA 5HOOA 3GX4X 5L3GA 3MN2A 1KQ8A 1IXSB 3ZP5A 2RREA 1BOBA 1YJ9I 1Z7UA 4HV5A 4Y13A 3CCJI 5BPDA 2FUG2 1V55H 1BN5A 2A5WA 3MKZA 3PO2J 4UVAA 4XQFA 5HS8A 3J7AO 3U9GA 4DOZA 3K1NA 4HA8A 1IN6A 2OQGA 5J4VA 2H6CA 3GTKJ 4V19K 2MSYA 1ORKA 2WAQA 3VYRB 2JWTA 5LGNA 4XRMA 1XSDA 1FZPB 2IS4A 2LNBA 1R5GA 2PBIA 3CQZJ 3ECHA 3S8PA 5GAHJ 2CV2A 2M9HA 4ESBA 3L9FA 1R00A 4MO7A 4ASNA 2X0LA 4RMNA 4XKVA 3HXLA 4HEA2 5F04A 1OMIA 3GW2A 5E18F 3ABUA 4FT8A 1OCRH 3D0SA 2LY9A 4HG2A 2EFPA 1P92A 1T0FC 4RM2A 3ROUA 3SZPA 1OYWA 5J8CA 3QP6A 3TBIA 4KDPA 3GZ6A 3MFKA 4E6KG 2RV8A 2YX7A 5FD6A 2K9QA 4RB1A 5FRNA 1MBHA 3K9TA 1LJ9A 3NQOA 5C44J 3G71I 2XKPA 4A5NA 3E6MA 5BPIA 1YYVA 2K9LA 4BE2A 1XSXA 2HYGD 1VI0A 2V26A 3MCZA 5F27A 1J2XA 4I02A 1MDMB 1D1BA 1YRNB 3L2WA 1BA5A 2X85A 1B4AA 1IGNA 2HKXA 1FY7A 3N4MA 3C7JA 1FT9A 2VQGA 1TLHB 4PFPA 3QU6A 4LFUA 4II3A 2HVRA 1YOVB 5LHHA 3BY6A 2KPMA 1MJBA 1G6NA 3H9QA 3ZMUA 3IH4A 5TGTA 1HKQA 5JVGF 2LDUA 4B09A 1X4PA 5LRRA 3VSLA 1T39A 2CS3A 2M34A 2ZMEB 4PCQA 2JA8J 2KISA 3SFIA 4ENKA 1CGPA 2LY2A 4MNUA 4BKXA 1R49A 1ZRFA 1X1AA 5J1RA 1XB4A 4ZZDA 3LFUA 2H8RA 1OCTC 4XRFA 2RAEA 2GXAA 3I4PA 9ANTA 4LOCA 2ADUA 4C2TA 4EJUA 2M7AA 5IT9Z 1YX5A 2LH9A 5FKKA 2EFOA 2ISYA 3F8BA 2TCTA 2XGCA 4HLXA 1MBKA 1UCRA 1X19A 4X1EA 3HRUA 3JREA 4KMUX 4XKBA 3OYAA 4E7HA 2V6CA 3K4CA 3HJEA 3CMEI 1K61A 1GV5A 2WV0A 2XPUA 3LFKA 2UWMA 1D3YA 2CWEA 1G2HA 4AM3A 2H6BA 3OV8A 2M8GX 4WXDA 4CCMA 3SEZA 4KN4X 1G3WA 1UG0A 2LF8A 2PG4A 3FK6A 4N9IA 4P96A 4ON0A 1OR7A 4LMYA 2P5KA 4JK1X 1ZR4A 1AA7A 2KP6A 1X1PA 4XIDA 4DYRA 4RGUA 4CCNA 4IEJA 3HGGA 3EUKL 2XGDA 2CW0F 4LGWA 1JGSA 3JTGA 4BHPA 2XROA 1WPKA 2VQHA 2CQNA 1JHFA 3IUOA 4F92B 2XC7A 2E2IJ 2DYSH 1WI9A 4XONA 1YG2A 1MBGA 1RZ4A 5JLWA 1HC8A 3CCSI 1A31A 4HF0A 2UV1A 2CG4A 4WXHA 1RETA 2A61A 3EQLF 1BIBA 3ZQHA 1A35A 2LVSA 3VPRA 2L54A 1NK3P 3WTWC 3JCUC 2GAUA 4WCGA 3MZ8A 3RQ4A 3K4BA 4HF1A 4P5OA 2ISZA 1DU0A 4LIUA 1IN8A 2NS7A 2RQQA 3LSIA 2JPCA 3KP7A 3WGHA 3GEZA 2XAQA 2CRGA 4A3CJ 2R7VA 3OOPA 2W57A 1G3SA 4DZPA 3BG6A 1R23A 3EYIA 3I4MJ 2GZWA 3DCFA 2X1CA 2GIZA 3S14J 3HOYJ 3BCBA 3OS2A 4PFOA 1J7KA 5KAIC 3W2WA 3OYHA 2JRMA 3KYLA 1T6SA 3MZHA 1D5VA 2D5VA 4XLNF 4L5EA 3NWTA 4FX0A 2O03A 3TDUC 2LP0A 4FE4A 1D8KA 2FOKA 3CLOA 4BBRJ 5EG0B 5GPCA 3R0AA 4IQJA 2HQ5A 4QWQA 3T1BA 2QQ9A 2R5ZA 2VT3A 2JSCA 2M30A 2Z2SB 3NEUA 4ZDPA 4IZZA 4YFNF 4FTHA 1A04A 3Q9SA 2XPVA 4KN7X 1XSVA 2QSFX 5D6EA 4OIQF 3BR6A 3G73A 1E3OC 1OR7C 2D1HA 5F1RA 1U5TA 4KA4A 2P7CB 2P8TA 1R36A 1TQIA 3H92A 3SZGA 1HLVA 4BYYA 2HWVA 1FOKA 1FSHA 1ZG1A 3IWZA 2EB7A 2YUSA 2HZTA 5L3CA 4ZDLA 2QF7A 3BC8A 2VJJA 1IJWC 2HOAA 5GADJ 3L2CA 1YFHA 1HCRA 5FO5A 4DNCA 1RI7A 2AS5F 1H0MA 4RAZA 3KIOA 3J7AY 3CCEI 1VFCA 1ETVA 2OCEA 1JE8A 1SD5A 3T5XA 2FOWA 1XC5A 1ZARA 3CMAI 2HPIA 4UV9A 3CC7I 1B72B 2TDXA 3HB9A 1E17A 2PMUA 4IHTA 2COBA 1ZG3A 2O6GE 1ZRDA 2H1LA 2DK5A 1U9NA 3CESA 3JW4A 4I99C 4AYBN 4BGDA 1Z6TA 2YU3A 3RKWA 1MMAA 4I01A 1D1AA 2PLYA 5DCMB 4KISA 2O5RA 3GTOJ 2DMUA 3H0DA 1WI3A 1EF4A 2ZJ2A 4HNTA 2E34A 1KU3A 2OTJI 1YLFA 3WU1B 1U6GA 1UJ8A 3KE2A 4G94A 2R7SA 4ENMA 2ZXWH 1QRYA 4AU7A 1P6RA 5HS9A 3LL7A 1XGNA 2ME6A 4F7ZA 3W3CA 1N78A 1TP4A 5ERIA 3TO7A 5ILVA 5E8GA 5DTDA 1WH7A 5F64A 5JHFA 1X2MA 2EV0A 3R6SA 4YIFA 2Z33A 4M71A 4CCJA 5IOZA 3H5NA 3QPSA 1TWCJ 2CFOA 4GGGA 5HDNA 4D5CA 2X1DA 3C1DA 3K70C 2QWWA 1L0OC 5HODA 2LKXA 3BOQA 3A02A 3BG5A 2EIKH 1U5TC 3M8JA 3I64A 4XLCA 2JVHA 4P1WA 1B9NA 4EM2A 1QU3A 3QRFF 3HHHA 3CUQB 2E60A 2R7QA 3E1SA 1PUEE 4G12A 3KZIC 2RVCA 3TDZC 3I4NJ 4UVCA 2GXGA 5E1XA 3ZQQA 3IL2A 1MMDA 1XGMA 2HOTA 4IPAA 2JUGA 3JRIA 2XKOA 2IVMA 4XR6A 3GXOA 2DO7A 1DUXC 2K40A 1BW6A 3QPHA 3F21A 4AUXA 4W1UA 2OV7A 4M72A 4Q5SF 3AL0C 3KETA 1LEAA 1A36A 2ESHA 2JZYA 2F4MB 5IP6A 4X6AJ 4OIOF 2O7OA 2Q1ZB 2KJCA 3B02A 1TW2A 3ABTA 5FKMA 2QENA 1EJ9A 2Z1DA 2WTEA 5FROA 4F52A 3OYKA 2VODA 1OCPA 2L4MA 5K5QA 2Y75A 4C30A 4M3GA 2JTVA 4NUBA 3ZMDA 2HGCA 4IO9F 3BR5A 4L9JA 5FLMJ 3FWEA 1DQUA 3E0JB 3DKXA 1P7IA 5KVRA 2XDVA 1UHMA 2L3DA 4NBQA 2NVTJ 1ITYA 1SC7A 2MC3A 3M7GA 3GFLA 4B44A 3RYPA 3LSGA 3I5UA 4GYIA 1Y8RB 3ZQCA 4XMYA 3BDDA 1JGGA 3EETA 2R0QC 5DS9A 2O8XA 3DWLE 1ZN2A 2JMWA 3U1DA 4LITA 2VB6A 1U78A 5DM7F 2Q8KA 1D5YA 3QU3A 2LLKA 3ECOA 4FASD 1ZQ3P 1J75A 3W6JB 1S72I 2EZKA 2EBIA 4M3DA 3F8FA 2XSJC 1MJ9A 2DT5A 2FQ4A 3L1PA 5CQEA 2LC2A 4G9YA 4PUSA 3Q3SA 4LG3A 2VOPA 1NK2P 2R5YA 2DK8A 2WB1A 3CJTB 2QUFA 2LMDA 1FPQA 2VKEA 4OAYA 2YR2A 4JX6A 2DA2A 2ZKZA 1K78B 1ON1A 2P0WA 3ESWB 2DPUA 1VF9A 1ON2A 4EM1A 2NVQJ 3SDGA 2WY8Q 1J9IA 3MEXA 3ASOH 4M74A 2EZLA 3I53A 5LGUA 2MLGA 3HTSB 4AYBA 4ZYEA 3J7ZI 4MFDA 4CYDA 1P2FA 4AVPA 3F22A 3WTUC 3FBNB 1FP2A 4CO8A 5CLSA 3RPUD 2R7TA 3AG1H 1WKMA 2BOLA 4BAYA 5L3EA 3ZMTA 3V7CA 2ELHA 4GXOA 4UNOA 1Z7LA 4F3QA 3N05A 4FQGA 2M3AA 3G1OA 1Z9CA 2YU9J 4BXFA 1T95A 4EJOA 1YO5C 5DYMA 3D1NI 4A3JJ 5ILUA 4RB3C 3HZJA 2LYCA 4ZC3A 1BI1A 4S05A 1LE8A 2R93J 1GV2A 4Y33A 2DMTA 3BTIA 5AIPA 3S93A 1R6RA 1G8XA 2STWA 3F23A 2HTSA 1R1VA 2GOMA 5E3MA 3A01A 4M3FA 3HGYA 4MFEA 3GYHX 3JRAA 3QOEA 3OR1C 2QVOA 4HX4A 4XKCA 4XK4A 3AKZA 3PM1A 1R4MB 3CJNA 4YFKF 2VIXA 1EH7A 4M73A 5H6RA 5BOXA 2OD5A 2XUBA 2ACJA 2NNNA 4N4NB 2F5CA 2Y69H 1MSFC 2K27A 3K4MA 3M9AA 2BHZA 3S2DJ 1SAXA 2HU9A 2XB5A 2QKLB 1QA6A 5EDNA 1HKSA 2QQ8A 2GQQA 3IKVA 4NB5A 4IX7A 1S3JA 3M1CA 3L2VA 5EZHA 5EGOB 4JOMA 4EVIA 3QP5A 1IUFA 3W2AA 2K9SA 3IWFA 2Q2EA 2DODA 2DAOA 2XRLA 2X6YA 4XN3A 1CF7A 4L5IA 3LOCA 5EEHA 2CUFA 1VQ9I 3WTTC 4RGSA 1AKHB 2K02A 3IC7A 1BJAA 3OMYA 1KA8A 1HKTA 3HUGB 5DD4A 2RGVA 2R92J 1Z77A 4ZDOA 5B5EC 2FMYA 1UZCA 3HM5A 2E2JJ 3WODF 4UUTA 2Y9ZA 4YIIA 5FFXA 4AIDA 2KL4A 3E97A 1SFEA 5K5RA 3BZ6A 1SD7A 2JUCA 1YHQI 3RSNA 1S9HA 3WTZA 3ABMH 2IS1A 4KFCA 2IA1A 2XVCA 2A6HF 2VKDA 2LD5A 4C2MJ 2HKOA 3QPTA 1SVOA 2FA5A 2HXIA 2JJ7A 3K6GA 1KU7A 5EEGA 2BY1A 4B47A 3RI4A 4IHVA 4KYWA 1DPUA 2FRHA 4A3LJ 2GWRA 4DZJA 4G7HF 1B8IA 2K3PA 1DP3A 4CYCB 4FETA 3R0JA 3GVAA 4LG0B 1XN7A 3U21A 1Z05A 4DJAA 2VBWA 1RRJA 4WWCA 3B6AA 1MSEC 5GAEJ 1BC8C 1VZ0A 3FHNA 2DOFA 1IV8A 5FLVA 4ETSA 4X0GA 3SJMA 2FMLA 1YJNI 2MH9A 3IAM2 4NQWB 2R3SA 2IXSA 2VBZA 4MIMA 1OCCH 2CUJA 2DOEA 3GUDA 1ETWA 2FBIA 4C3JJ 4Y17A 3LQRA 5IYCJ 2LY1A 2E1CA 5GTHC 3BJAA 1X1DA 3EUAA 1W5TA 4KIGA 1MKMA 3MVPA 5DM6F 3S32A 4I7HA 1GVDA 3PO3J 4HOBA 2ICWG 2QYOA 2XAJA 2NVXJ 2NS0A 3UKGA 2WV1A 2E5ZA 2DTZA 3HOZJ 3CCLI 1YIJI 2PX9A 2ZXIA 3FBIB 3OYLA 2QSGX 3P7NA 2HVQA 1PP7U 3CLQA 5E17F 4D9JA 1WZ2A 1F43A 2L01A 5J47A 3TW7A 1IDZA 1OKRA 3NARA 3QAHA 3PFYA 2M0MA 3G2BA 1JT6A 2VXDA 4BQQA 2EFWA 3GTGJ 4AIJA 3P5JA 3G6EI 5LD2C 3L09A 2O9LA 2Y0SA 5E3OA 1F1ZA 2OZUA 1LVKA 4QTRA 3L00A 4PSXA 3S15J 4E7LA 3PNTA 1W0UA 4KIBA 2BV6A 4RGXA 4WF2A 1M1EB 1ZR2A 3BWGA 1MDMA 3JRCA 1MH3A 1YRNA 5J6XA 3OY9A 1C0WA 2R7ZJ 2KKOA 1ZLKA 3QOPA 3MD2A 1BJZA 3S2WA 1K4SA 2C6YA 1XCBA 3UNGC 2JPBA 3A4CA 4ENJA 1XS9A 2HQNA 3ZPLA 2A69F 2MA3A 3C2BA 4XRSG 3V8JA 3ZRGA 3GLLA 3KCCA 1ZREA 3X2QH 3K69A 4FHTA 1S7OA 1Z0XA 3ZMZA 4QPOA 3SZTA 1MNMC 1HSTA 1SAUA 4NDLA 3KEYA 2FBKA 3RIRA 5ED4A 3OWTA 2Y2ZA 1LPQA 4R8HA 2QLZA 1FEXA 1TQPA 1SEUA 2UXNA 4Y7NJ 5DCFA 3OYMA 4BJ5C 1LKXA 1HDDC 4Y52J 3OYEA 3S3NA 2P4WA 2VJIA 2VN2A 1G3YA 2I5UA 3BR0A 4B3AA 2PI0A 2KDZA 4KMFA 5IP9J 3KP3A 4HRIA 1YIOA 1IN5A 1ONVA 2BVLA 2UXXA 2VT2A 1OQYA 1DP7P 4MEXF 2K3FA 1FMVA 3DEUA 3J7YJ 3FMQA 3T8TA 2KRHA 3FXMA 5F1JA 2CFXA 1FOXA 4XOTA 1D0XA 2VLAA 1IXCA 4HX7A 4D7MA 4I76A 3CCYA 1Y1VJ 4MEYF 2P6SA 2EIJH 3KPHA 5J3LA 1WJBA 5FRMA 3L2QA 4I09A 2K86A 2ZFWA 3BTCA 3CMMA 3L2RA 1X4OA 2YX4A 5A2QZ 2PJRB 2JA7J 3IAS2 3GBGA 2VQLA 3VODA 1TT5B 4B1RA 3I55I 4M3BA 2HTJA 3CDLA 4JP0A 1B6AA 3FDYA 3HOXJ 2VQCA 3TOBA 4MGRA 1QNTA 5J1UA 1XG1A 3E6DA 2CJJA 1ZTRA 1J59A 2ESNA 2W24A 3DP7A 4ENNA 4MHGA 2BGCA 4HYEA 2Q0OA 3H0GJ 4J00A 1MBFA 1TWAJ 4A0YA 5LEKA 3LSMA 2LKSA 1MMNA 1WGXA 1YE9A 2ZMEC 4LJZF 2R7FA 1SFUA 1D8JA 2Z3YA 4GO1A 3CC2I 3S1MJ 1O3TA 1LDKB 1I3QJ 4PGHA 2K7LA 1T98A 1IO2A 3FMRA 1QO0D 3OYCA 2A68F 2L4AA 1UMQA 1S5LC 2JSPA 2HYJA 3O8HA 4WXCA 2MBFA 5TRDA 5H6QA 5D5UB 3SHFA 2XASA 3FZVA 4EEFG 2RNGA 2QZ8A 4OMZA 2BE5F 1QHHD 3IH3A 4CCKA 1MJAA 4BHBA 2FD5A 1U8BA 4AWXB 2KQRA 5EG0A 4IL6C 2IS2A 1I6HJ 2ZBKA 1PVEA 2BHYA 4Y4RA 5J8FA 5K7HA 5A2QK 1SD4A 4FCYA 2MC4A 2N8GA 4N9HA 2F6CA 1OYYA 4U7BA 4IJAA 3JRGA 1O4XA 2RNJA 2DJNA 3IKTA 2DA4A 1YS7A 3TKYA 4A93J 4I98B 3MKYB 2XRNA 1I27A 1R9TJ 2OZ6A 1YI2I 4QPQA 1PUFA 5D4RA 1D0ZA 3SDBA 1U3EM 1QBJA 4IRIA 5E3LA 1W7PA 4RAFA 2JN6A 3ABKH 3ZR8X 3HC7A 3HRTA 1E3HA 2H94A 2OJED 3GF2A 2G7UA 4G6QA 4B48A 1JKRC 4GFBA 4JQFA 5LEJA 3G4SI 2R7RA 2AHQA 4OIRF 3QYFA 4ZTFA 1W36D 3F3XA 2VE9A 2MLKA 4XICA 2RN7A 3I59B 1YITI 4U0WA 1ZH5A 1MW7A 3ML6A 3OIPA 2OQRA 4EV0A 1BR1A 3RKYA 1B72A 3WU2C 4D0PA 3EYYA 5M5WJ 3K4NA 3F6VA 3JRBA 2W4SA 2ZNYA 2WAFA 3ZN0A 3I54A 3TP3A 3H9JA 4QIWN 3C3WA 4XNFA 2ZXJA 4PJMA 2JA6J 3HL2A 4PSWA 1UHWA 2JVGA 2M2EA 3GTPJ 1I3AA 5DUKA 2IP2A 3DKWA 3CUOA 4EATA 3JSOA 3CCUI 5AONA 2KZVA 2DU9A 2X6XA 1E2XA 2DFFA 1VQ6I 1HW2A 1WSUA 2MYSA 3WTVC 3O2PE 1Z3XA 3LSKA 1EA3A 2R7XA 1H89C 3BTLA 1Z1DA 1RUNA 1JI8A 2LFBA 4RBOA 1ZELA 1RC9A 2R7UA 4L0ZB 2J5OA 4PJ0C 1XTAA 3LAPA 4GDFA 3ZQ7A 4XLFA 3ISPA 3LWFA 1ENHA 4RB0A 1X3WB 4UVBA 5JVTA 2BW3A 2IRFG 5IYDJ 3AG2H 2PN6A 2E1MB 1TNTA 4U7DA 1JTYA 3H3ZA 2KIQA 2R5ZB 4HQEA 4PGGA 3LSTA 2BVMA 3W6KB 1HW5A 4IOAF 2X6OA 2QKMB 3PQKA 4EJVA 1R5HA 3ZN1A 3SXYA 5TJJA 2KJBA 3OYIA 1BC7C 4UB8C 1OJLA 3GO5A 1QGPA 1VQOI 2VBXA 4CXFA 4CICA 2MGQA 1OFCX 1KQ9A 1MH4A 4OAZA 3CP2A 4YELA 4R79A 1EH8A 4C2UA 2VJ4A 2JRTA 2UUZA 3H5AA 2EZIA 1GXPA 1FC3A 1YS6A 2HI3A 4BQOA 3SEQA 4IF4A 4KICA 4UUSA 2EV5A 3F8NA 4HAMA 1FX7A 3KLNA 1B9MA 3OL3A 3PNVA 4XORA 4C3IJ 3MWMA 3L7WA 4A2UA 4LK1F 1EV7A 1FSEA 1WHUA 3DBLB 4K2EA 4U88A 3RZDJ 1VQ7I 4I2OA 4LB6B 2BXYA 4MLOA 2EINH 3B6CA 4M9SA 5GP9A 3V7RA 3U2RA 5HLGA 1POGA 2P6TA 1FIAA 1NTCA 1CQTA 2R7DA 4CUGA 1R7JA 4Q4ZF 3T0YA 3WHBA 1W5CC 2OTLI 4D7NA 3BQZA 3E5XA 3BROA 2DN0A 1PP8F 2L0KA 3FXUA 1A6QA 4BXXJ 4XKWA 1WH5A 3HBLA 4OWRB 5ILSA 1KZHA 4DGWB 4BDYA 1F4KA 3I9V2 4F55A 5BS6A 2XPWA 5M5YJ 2G9WA 3CF5F 1LFUP 4IHXA 4G7ZF 2H1KA 3HTUA 1FTTA 2D2WA 2ZJRF 1K78A 2FU4A 3CUQC 2V1NA 4F93B 1JHHA 3KYDB 2KDOA 1XCVA 2HDDA 4F91B 3J80K 1OISA 4XBFA 2QBYB 2L7FP 2VONA 1V5EA 4IQ4A 3M8FA 3BZKA 2FNPA 4M9ZA 2L9RA 1G3TA 5FLXK 1S8NA 1LB2A 4BNCA 3TMOA 3M3YJ 1Y56A 1R58A 3BR3A 4RGRA 2LRDA 1UFMA 3E5QA 1K4TA 4A3BJ 1HF0A 1WJFA 2DJIA 1DPRA 5E79C 3M07A 1REPC 2DFEA 3C2GA 1Z3YA 2YPRA 2FBHA 2P5VA 4ZYDA 1WVRA 3FKIJ 5FKLA 3CMYA 4KT5C 2VPRA 3FXLA 3FISA 2DMQA 4BDZA 1USTA 2MFZA 3B73A 3PUBA 3TEDA 1SVLA 3NAUA 1OYIA 2HEOA 2DMPA 2DI3A 4ESFA 4HSTA 4XLHA 1W1WE 3S1RJ 2FEZA 3V7SA 1IZ1A 4HBLA 5IT3A 2ZJPF 4E7JA 1X3ZB 3F8CA 1I6XA 1KU9A 4UHTA 3ZMVA 3LSRA 2QA4I 3ZOBA 2AO9A 3H3VK 2ZSHB 4KITB 4ZTJA 2L7ZA 2OPTA 2VE8A 1VQ8I 4BY1J 3KP5A 2VL8A 4GRIA 5L3DA 4CH7A 1OLTA 4RAYA 2L9SA 4CCOA 1JKQC 2E5NA 3GWZA 4P55A 1USSA 5LBQA 4RA2A 1FWZA 2FXAA 2Y48A 1IRGA 3K4JA 3K10A 3VYSB 1FBQA 1NHAA 2E36A 3U1KA 4A3KJ 1BI0A 1O3RA 2A3SA 2NOGA 4JBAA 2XAFA 2DTRA 3K1MA 4ZYHA 3KP2A 1VTNC 2V9KA 3KEOA 1AU7A 3QYEA 3FHZA 3CF2A 3Q0WA 5HNFA 2E19A 5EZGA 1HOMA 3R4KA 2EA4A 3DBHB 4E7KA 1IW7F 2LBFA 3DXJF 2R7OA 3PJRA 1EH6A 4A0XA 2R5YB 1MZBA 5C3EJ 2OC6A 3HUGA 3K70D 4BXUA 2IGKA 4RS8A 3H36A 2DQLA 4ZYGA 5IOYA 5D8KB 3DPUA 5TISC 1WJEA 1LNWA 4BHCA 3EUHA 4PZJA 5CQGA 2M7BA 3VDXA 2H27A 2DYRH 5ICFA 5ICCA 1QPMA 1H9GA 2HZDA 3A03A 3D5SC 3NWSA 1LUJB 3KLOA 4L9TA 4BS9A 4NC6A 4MTDA 1IRFA 2D45A 2E1OA 2F48A 2E1NA 2CH0A 4HF2A 3DTKA 2H09A 2K9MA 5HS7A 2BXZA 1YJWI 1U9OA 4FE7A 4GCVA 4YFXF 1F9NA 3LMMA 4XLEA 2TRTA 3ABLH 1GVJA 3K7AJ 4LG0A 1J0RA 3I3LA 4FISA 1IN7A 1JTXA 3Q0UA 1VQ4I 2DMNA 4B43A 1V54H 3OYDA 2L02A 3DKYA 3HRSA 3RCOA 4D1QA 1Z21A 3IV5A 1W0TA 1RR7A 4A3GJ 1UELB 3E6BA 4V2FA 1LVAA 2X9DA 4BBSJ 2MW8A 3BR1A 2RQPA 2ZB9A 3SQNA 3A01B 2GIVA 2IPQX 4NQWA 3A0BC 3TQNA 5E3NA 4U0YA 4BQNA 1K79A 3BJOA 1QZEA 4KNYA 1U0JA 5J4YA 3PIPF 2X4HA 3JRHA 1JXSA 4XOPA 3WG7H 1UHSA 3PQJA 2CQ7A 4LLLA 4UY8I 4HPQA 4CGZA 1PDNC 2IJLA 3I71A 4BJTA 1TZLA 2IT0A 1SFXA 1AOYA 5EEAA 2KHMA 4HQMA 4U87A 5DV5A 2D1VA 3OYBA 1IXRC 4P9UA 1QQIA 2W85A 3S3OA 2HFHA 2V4JC 1ZGWA 2HVSA 3FXRA 4E7SA 3LA7A 3WU0A 5B3SH 2IAIA 2IGOA 1HDPA 1WWXA 1Y8QB 5C4XJ 2OBPA 4BU2A 2ZFUA 3EUHC 3N97A 2Y30A 1CF7B 3PL8A 3MAJA 3FX3A 3JAMK 3K1PA 2XB0X 2M45A 1R4NB 3MMYB 1ODDA 1GUUA 2Z5UA 1KU2A 1YW8A 5H20A 1WQ2A 2ID3A 3A0HC 4AC0A 1ETYA 5LRSA 4BEHB 3WGIA 1JUSA 2YSRA 1RIOH 2F2EA 1O57A 1T08B 1JKOC 3JRFA 2KIMA 2AQFA 1S29A 4R1HA 1ZAOA 4HZFA 1GDTA 2W00A 1K7AA 4YEJA 1JUPA 4HV6A 1I50J 1LDJA 2A6TA 2LREA 3ELKA 3HPHA 2PMZN 3OR2C 3VYTB 1T2KA 2CV0A 2Y31A 4AD9A 3BLYA 3IP4B 3WTYC 2L9NA 2XAUA 5JR3A 2WY7Q 3TO6A 3CZ6A 4O5VA 4OU0A 2V1XA 1R1UA 5BNGA 4M6XA 3I58A 2NAZA 5B1BH 3CCVI 2DT6A 1SANA 1RKTA 4A3DJ 4TV7A 4RAGA 1IF1A 4IHWA 1H8AC 3AG3H 4FX4A 1BIAA 3VWBA 1MNDA 2COMA 2KT0A 3QWLA 1OPCA 3DTIA 3R60A 2EFNA 1SFKA 3BQYA 4KJZA 3JRDA 3QYBA 1YW9A 2EPFA 1DDNA 2DA3A 3RPQA 5HDKA 5CVUA 4PJLA 1S7AA 5E20A 4CCLA 2F5VA 3H1CA 4WX9A 5KNLA 3OIQA 5HLIA 4N4OB 3FKJA 3PSFA 5CVJA 3GTLJ 3GTQJ 1G59A 1DGRM 5CYVA 1VQ5I 4CZCA 5JI6A 4Z2YA 3DV8A 3KFWX 1MBJA 4Z6YA 2IBDA 3EDPA 4EMSA 1RUOA 3OS0A 4LLNA 1IRZA 3DEEA 2DQRA 4EQQA 3OIOA 4ITVA 1P4XA 3Q9VA 3BTJA 2ZMEA 2HR3A 3E7LA 2X48A 1P9QC 4BJ6C 2A5YB 3WE2A 3RJPA 4XL9A 2LK2A 1E0EA 3M8EA 1DGWY 4OINF 4DW6A 3KZYA 2PFBA 3HOUJ 2J5PA 2FF4A 1QZYA 4OOIA 4PJNA 3GFJA 2DA6A 1W36C 2V9PA 5F0HA 4G8XA 1W5SA 3K4LA 3BG9A 3DLLF 3GFMA 4HDUA 2PJRA 4DBQA 3VB2A 2CMPA 2VASA 3P9KA 1ETKA 3S2HJ 5F6FA 2BY0A 3ZXSA 1P7JA 3FMSA 1B1BA 1VQPI 5LHGA 4RB2C 2M8EA 5DUIA 2FSWA 2G7HA 2IA2A 1FNNA 3J81K 1KYWA 4CDGA 4D5FA 1FBSA 4U0VA 4V2GA 3V8LA 2AQEA 5IYBJ 3OYGA 1BL0A 2HXOA 1JJ6C 5F0FA 3FXQA 3HSEA 3S1NJ 3F6OA 1YQAA 4IHYA 1TBXA 2CQKA 2HOSA 3BCAA 3R61A 4A69C 5K1YA 5HDGA 3RTRA 4AIKA 2W1OA 2MD5A 1WJDA 2I10A 4W97A 3IH2A 5KHDA 1XD7A 3F8MA 2ETHA 2NXNB 1D1CA 2KIFA 2RKHA 3HYIA 4JYKA 1GLNA 2XV4S 4E4HA 4RM3A 3Q5FA 3V4GA 3FK7A 2B63J 2K85A 3HHGA 2H8WA 1K6YA 5F0CA 3CCRI 4Q48A 5LFAA 2V7FA 1H88C 4UUVA 3DU6A 2RC4A 2V79A 1FIPA 1J5YA 2A05A 4J19A 3RKQA 2DXIA 4HW0A 1WCMJ 2QSHX 3HIFA 2IS6A 1Y6IA 1U8RA 4IRHA 1G4DA 1LDDA 2PMZA 3C2HA 3LA3A 3A2KA 2VC1A 4S0HB 4KIFA 1K83J 1RR8C 2KLOA 2E35A 3T8RA 1IG7A 5JHUA 2F5EA 2ELJA 2DCEA 2OAZA 4DYQA 1JKPC 2W84A 1FYKA 3VFZA 2F4IA 3CTAA 4EJWA 1O7FA 4A3MJ 2PQ8A 3CO6C 5J1YA 5HLTA 2P7VB 4L9NA 4XLAA 5BQTA 4I0AA 3UR3C 4O3MA 2EIMH 2NYXA 1FJLA 3PUFA 1ZYRF 2EWNA 2JQ7A 1OCOH 3IRRA 1DU6A 1N25A 2HOEA 4NNJA 3I59A 3O3KA 2STTA 3PNYA 2XGEA 1ERDA 2DBBA 4UV8A 5K5OA 3ZMSA 3GMEA 3HG9A 2NNYA 1PYVA 4UXNA 1XPXA 3LAJA 2PJPA 1SVMA 3HOTA 2XF6A 3HPGA 4G6TB 5J40A 1O7LA 3LQQA 4A6DA 1P4WA 5DEQA 2CO5A 5E1ZB 4EGZA 1W4MA 4H4KC 2IW5A 2DDBA 2X1EA 2KZGA 5EF6A 4CZZA 3F9KA 5IT9K 4M9XA 1LFPA 2GA2A 4A3EJ 1WJAA 3ONQA 3S17J 2DFIA 2LG4A 5FGMA 2GXBA 4HLYA 2W82A 3WTXC 1Z67A 2GBYA 5DD8A 1FP1D 1HW1A 3RPUA 1MIJA 3GCMA 2M1BA 1Y39A 4ZYAA 3W6VA 3DF8A 3HOVJ 1VQKI 4A0ZA 2NVYJ 1ZRCA 3FXKA 3ZGKA 2F5FA 3PIOF 3CP8A 3E6CC 4H0EA 4O6JA 5CVVA 1H9TA 3VOEA 4KT6A 4S04A 4LLGF 3LA2A 4XLPF 2P5LC 2DDAA 1IDYA 4LIVA 1IN4A 1VNDA 3WGGA 3CCQI 2JA5J 2CUEA 2VJ5A 4JX5A 3OYFA 2XF5A 2LR8A 4IKFA 2VC0A 3GFIA 3V8KA 1MMGA 3KP4A 5DCMA 4E7ZA 3JR9A 1FOWA 1NH3A 4AVZA 4GYGA 2CW7A 1YTYA 1TWFJ 2B9SA 1FBUA 1MMSA 5IPAA 1TL8A 4QLCU 1HA8A 2DLLA 4I6ZA 3OOUA 2GA1A 3O8GA 1KQ0A 5IY5H 1X3UA 2WA0A 4G7OF 5JFRA 5LHIA 2AXTC 1PUFB 2EA2A 1NG7A 1XMAA 3SYTA 1W7PB 4CA0A 5HVQC 3E3VA 1JUMA 3W2VA 4XSXF 3HOWJ 2E7WA 4RLQA 3AFHA 1E3PA 5FJ8J 1KYZA 1FYLA 4E7IA 3RYRA 3GZ5A 4BE0A 2ZSIB 3KX2A 2WB1N 4CSWA 1STZA 2EV6A 3BG7A 1YX3A 4A6EA 4AIHA 3CJQB 5GAGJ 3CUQA 3CD6I 1JT0A 3H3UA 1MGTA 3LNQA 1HBXG 2NS8A 1T33A 1K6OA 5KCMA 1UAAA 2WBMA 4HDVA 1BR2A 2I8DA 3FXOA 1R71A 1U5TB 2HDCA 3JTHA 2VBYA 2CQQA 2M5WA 1XMKA 3HSRA 4B8XA 2A6EF 2BZTA 4E70A 5LLQA 1V5GA 4J01A 2EK5A 1UG2A 5FKNA 2V6EA 4HNUA 5KK1A 3V42A 2X6WA 5D5VB 1Z6RA 5E1WA 2HPMA 4LD5A 3J80Z 4P9FA 2Z9OA 2IGNA 2E71A 2KRFA 3CDHA 5CVIA 1LEBA 3H9GA 1J09A 2W25A 4BL0B 5DDGA 4OMYA 2XF7A 5FLXZ 1Y1WJ 2E1MC 1BI2A 3CJRB 3AL0B 1XGSA 4LB5A 1FLIA 3P9IA 4A3IJ 1Z91A 3DPTA 3BT9A 3Q0VA 5GPAA 1ZKGA 4YG2F 5K7ZA 2HNHA 1Q1HA 4RDUA 5D5WB 3A1YA 4B3XA 5F08A 2QBYA 3TP0A 2BW3B 4LK0F 1WJCA 1AHDP 4YIRX 4L0YB 2A07F 2VKVA 2DOAA 4II2A 1WJ5A 2UZKA 4L18B 4L5JA 2JK3A 3IHUA 2DFHA 2ECBA 1FTZA 2IA0A 5GTIC 3S16J 4ZH4F 2EQRA 2QM3A 4ESJA 4HX8A 2VPLA 1KGSA 2IGMA 1N77A 1GXQA 2XAHA 1R5ID 3K2AA 2B0LA 2VUMJ 4L9VA 5LGTA 3LSJA 3QQAA 1HXDA 5D4SA 3FIWA 3CDIA
chains in the Genus database with same CATH topology
4A12A 1ZGJA 2ZCWA 5CJ9A 1I1SA 2O3FA 5BMZA 1XDUA 4MTEA 5ICGA 5D8LB 3KZZA 3HOSA 3NRVA 3TOAA 2XHKA 3ERED 4IHSA 1GHCA 1QZZA 2E7XA 3VEPA 1L3LA 3BPXA 4BQAA 2PMHA 3AAFA 1HSJA 1WRJA 2QQBA 4MQVA 3FM3A 4OIPF 5FD5A 1Y0UA 1I1GA 1F5TA 1BBYA 1TW3A 4I0BA 3PFIA 3IRQA 1R22A 3JSPA 3HRMA 3BJ6A 1IUYA 3BPVA 2O0YA 1O3SA 2V1UA 1W7PD 2JT1A 3DQVC 3FM5A 2F5DA 2OU2A 1T38A 2LSOA 2Z99A 4IVNA 1XGOA 1TQMA 2NRAC 4PDKA 1B59A 1UB9A 1IAWA 2Y0MA 2ZO4A 3RDIA 2FE3A 5AIQA 1FYMA 4WK8F 4CHUA 3CO7C 2VOOA 1ULYA 6PAXA 4IRGA 4IXAA 2M87A 2HQRA 2DPDA 2HYFA 1V3FA 5FFZA 1BM9A 2LKPA 3WG9A 5E8IA 2BYVE 2XAGA 5HLHA 2WC2A 2VXZA 5CVRA 3JAMZ 1TTYA 1U2WA 3GLXA 3WTSC 3WE3A 4MQ9F 1RNLA 1S6LA 1XDSA 4EM0B 3G3ZA 4EGYA 4M6YA 2LF7A 2MH2A 4XSZF 1SMTA 3E5UA 1ZHFA 2WWYA 3D5LA 2XIGA 3REOA 1TNSA 4Y15A 2FQ3A 2CSOA 1O3QA 2BBYA 5ICEA 1SMYF 3I0TA 4G6DA 1SD6A 3C18A 2OA4A 2CYYA 2ZNZA 3MQ0A 2XGXA 2BEOA 1HQCA 5L3BA 3KP6A 2EJRA 4KUMA 2EFQA 4A5MA 3F72A 1V4RA 1ZGAA 2HS5A 3RKXA 5D5XB 4BH9A 4N0BA 2V1DA 4Q47A 3COAC 1I5ZA 3TO9A 2K4BA 1MD0A 3M1EA 3O6BB 2K4JA 2FNAA 4DQ2A 4ZZLA 3K0LA 3DPLC 2V9VA 1BI3A 2O61A 1T0FA 3MZYA 1BOAA 3ULQB 1R1TA 3KEQA 2DW4A 1YW7A 3HSFA 1P4AA 3DFGA 4EJTA 4NHJA 2QQAA 3BP8A 5L3FA 3FF5A 3P9CA 5FB2A 3TGNA 3SFZA 5D6FA 2AXLA 3K2ZA 1LQ1A 1AWCA 2CGPA 3J81Z 1ZG5A 1ZLJA 2KIUA 2RDPA 5HOOA 2PEXA 3GX4X 5L3GA 1KQ8A 1IXSB 3ZP5A 1Z7UA 4HV5A 4Y13A 5BPDA 1BN5A 4UVAA 5HS8A 3J7AO 3U9GA 3K1NA 4HA8A 1IN6A 2OQGA 2H6CA 5LGNA 1XSDA 1FZPB 2LNBA 1R5GA 2PBIA 3ECHA 4ESBA 3L9FA 1R00A 4ASNA 2X0LA 1OMIA 3GW2A 5E18F 3ABUA 4FT8A 3D0SA 2EFPA 1P92A 3ROUA 3SZPA 1OYWA 5J8CA 3QP6A 4KDPA 3GZ6A 3MFKA 2RV8A 2YX7A 5FD6A 4RB1A 3K9TA 1LJ9A 3NQOA 2XKPA 4A5NA 3E6MA 5BPIA 1YYVA 1XSXA 2HYGD 3MCZA 1J2XA 4I02A 1MDMB 1B4AA 2HKXA 1FY7A 3N4MA 3C7JA 1FT9A 1TLHB 3QU6A 4LFUA 5LHHA 3BY6A 1MJBA 1G6NA 3ZMUA 1HKQA 2LDUA 4B09A 5LRRA 1T39A 2ZMEB 4PCQA 4ENKA 1CGPA 4MNUA 1ZRFA 1XB4A 4ZZDA 4XRFA 3I4PA 2ADUA 4EJUA 5IT9Z 2EFOA 2ISYA 3F8BA 4HLXA 1UCRA 3HRUA 4KMUX 2V6CA 2WV0A 3LFKA 2UWMA 1D3YA 2CWEA 2H6BA 3OV8A 4WXDA 4KN4X 1G3WA 2LF8A 4N9IA 2PG4A 4P96A 4ON0A 1OR7A 4LMYA 2P5KA 4JK1X 4RGUA 2CW0F 4LGWA 1JGSA 3JTGA 4BHPA 2XROA 1JHFA 1WI9A 1YG2A 1RZ4A 4HF0A 2CG4A 4WXHA 2A61A 3EQLF 1BIBA 2L54A 3WTWC 2GAUA 4WCGA 4HF1A 4P5OA 2ISZA 1IN8A 2JPCA 3KP7A 3WGHA 3GEZA 2XAQA 3OOPA 2W57A 1G3SA 1R23A 3EYIA 2GZWA 1J7KA 1T6SA 3MZHA 1D5VA 4XLNF 4FX0A 2O03A 3TDUC 1D8KA 2FOKA 3CLOA 3R0AA 4QWQA 3T1BA 2QQ9A 2VT3A 2JSCA 2M30A 3NEUA 4YFNF 1A04A 3Q9SA 4KN7X 1XSVA 5D6EA 4OIQF 3G73A 2D1HA 5F1RA 1U5TA 4KA4A 2P7CB 2P8TA 1R36A 1TQIA 3H92A 4BYYA 2HWVA 1FOKA 1FSHA 1ZG1A 3IWZA 2EB7A 2HZTA 5L3CA 3L2CA 1YFHA 5FO5A 4DNCA 1RI7A 2AS5F 1H0MA 4RAZA 1JE8A 1SD5A 3T5XA 1ZARA 4UV9A 2TDXA 1E17A 2PMUA 4IHTA 1ZG3A 2O6GE 1ZRDA 2DK5A 3JW4A 1Z6TA 2YU3A 3RKWA 4I01A 2PLYA 5DCMB 2ZJ2A 1KU3A 1YLFA 3WU1B 1U6GA 3KE2A 4G94A 4ENMA 1P6RA 5HS9A 1XGNA 4F7ZA 5ERIA 3TO7A 5ILVA 5E8GA 5F64A 3R6SA 2EV0A 4YIFA 2Z33A 4M71A 4GGGA 5HDNA 3C1DA 2QWWA 1L0OC 3BOQA 1U5TC 3I64A 1B9NA 4EM2A 3QRFF 3HHHA 3CUQB 1PUEE 2RVCA 3TDZC 4UVCA 2GXGA 5E1XA 3IL2A 1XGMA 4IPAA 2XKOA 2IVMA 3GXOA 2DO7A 1DUXC 3QPHA 3F21A 4M72A 4Q5SF 3KETA 1LEAA 2ESHA 2JZYA 4OIOF 2KJCA 3B02A 1TW2A 3ABTA 2QENA 2VODA 2WTEA 2L4MA 5K5QA 2Y75A 2JTVA 3ZMDA 2HGCA 4L9JA 3FWEA 5KVRA 1UHMA 2L3DA 2MC3A 3M7GA 3GFLA 3RYPA 3I5UA 4GYIA 3BDDA 3EETA 2O8XA 1ZN2A 3U1DA 1U78A 2Q8KA 3QU3A 3ECOA 1J75A 3W6JB 3F8FA 1MJ9A 2DT5A 4G9YA 2VOPA 2DK8A 2QUFA 1FPQA 2YR2A 2ZKZA 1K78B 1ON1A 2DPUA 1ON2A 4EM1A 1J9IA 3MEXA 4M74A 3I53A 5LGUA 2MLGA 3HTSB 4ZYEA 4CYDA 1P2FA 4AVPA 3F22A 3WTUC 4CO8A 1FP2A 5CLSA 1WKMA 4BAYA 5L3EA 3ZMTA 3V7CA 2ELHA 4GXOA 4UNOA 1Z9CA 4EJOA 1YO5C 5DYMA 5ILUA 4RB3C 1BI1A 4S05A 5AIPA 2STWA 3F23A 2HTSA 1R1VA 3GYHX 2QVOA 4HX4A 4YFKF 3CJNA 1EH7A 4M73A 5H6RA 5BOXA 2OD5A 2XUBA 2ACJA 2NNNA 2F5CA 2K27A 3M9AA 1SAXA 1HKSA 2GQQA 3IKVA 4NB5A 1S3JA 4EVIA 3QP5A 3IWFA 2Q2EA 2DAOA 1CF7A 4L5IA 5EEHA 3WTTC 4RGSA 2K02A 3IC7A 1BJAA 1KA8A 1HKTA 5DD4A 2RGVA 2FMYA 3WODF 4YIIA 5FFXA 3E97A 1SFEA 5K5RA 3BZ6A 1SD7A 3WTZA 4KFCA 2IA1A 2XVCA 2A6HF 2HKOA 3QPTA 2FA5A 1KU7A 5EEGA 3RI4A 1DPUA 4KYWA 2FRHA 2GWRA 4G7HF 3R0JA 3GVAA 4LG0B 1XN7A 1Z05A 2VBWA 4WWCA 1BC8C 4ETSA 2FMLA 2MH9A 2R3SA 2VBZA 3GUDA 2FBIA 4Y17A 3LQRA 2E1CA 3BJAA 1W5TA 4KIGA 1MKMA 4I7HA 4HOBA 2QYOA 2XAJA 2NS0A 3P7NA 1PP7U 5E17F 2L01A 1OKRA 3QAHA 2EFWA 4AIJA 3L09A 1F1ZA 2OZUA 3L00A 4KIBA 2BV6A 4RGXA 4WF2A 1MDMA 3BWGA 5J6XA 1C0WA 2KKOA 1ZLKA 3QOPA 3S2WA 2C6YA 1XCBA 2JPBA 4ENJA 2HQNA 3ZPLA 2A69F 2MA3A 3V8JA 1ZREA 3KCCA 3K69A 4FHTA 1S7OA 3ZMZA 3SZTA 1HSTA 2FBKA 3RIRA 5ED4A 4R8HA 2QLZA 1TQPA 2UXNA 5DCFA 2P4WA 2VN2A 1G3YA 2PI0A 4KMFA 3KP3A 1YIOA 1IN5A 1ONVA 2UXXA 2VT2A 1DP7P 4MEXF 3DEUA 3FMQA 3T8TA 2CFXA 1IXCA 4HX7A 4MEYF 2P6SA 4I09A 2K86A 2ZFWA 2YX4A 5A2QZ 3VODA 2HTJA 1B6AA 3TOBA 4MGRA 1QNTA 3E6DA 1J59A 2ESNA 2W24A 3DP7A 4ENNA 4MHGA 2BGCA 4HYEA 2Q0OA 4A0YA 5LEKA 4LJZF 2R7FA 1SFUA 1D8JA 2Z3YA 4GO1A 1O3TA 1LDKB 4PGHA 2K7LA 1T98A 3FMRA 1QO0D 2A68F 2L4AA 4WXCA 2MBFA 5TRDA 5H6QA 5D5UB 3SHFA 2XASA 3FZVA 4OMZA 2QZ8A 2BE5F 1MJAA 4BHBA 4AWXB 2ZBKA 5J8FA 5A2QK 1SD4A 4N9HA 1OYYA 4U7BA 4IJAA 2RNJA 3IKTA 1YS7A 3TKYA 4I98B 2XRNA 1I27A 2OZ6A 5D4RA 1QBJA 4IRIA 1U3EM 1W7PA 3HRTA 2H94A 3GF2A 2G7UA 4G6QA 4JQFA 5LEJA 4OIRF 3F3XA 2VE9A 2MLKA 2RN7A 3I59B 4U0WA 1ZH5A 3ML6A 2OQRA 4EV0A 3RKYA 4D0PA 3EYYA 3F6VA 2ZNYA 3ZN0A 3I54A 3C3WA 2ZXJA 1UHWA 5DUKA 2IP2A 3DKWA 3CUOA 3JSOA 5AONA 2DU9A 1E2XA 1HW2A 1WSUA 3WTVC 3O2PE 1Z1DA 1RUNA 4L0ZB 2J5OA 3LAPA 3ZQ7A 3ISPA 3LWFA 4RB0A 4UVBA 5JVTA 2IRFG 2PN6A 1TNTA 4U7DA 3H3ZA 4HQEA 4PGGA 3LSTA 3W6KB 1HW5A 3PQKA 4EJVA 1R5HA 3ZN1A 3SXYA 5TJJA 2KJBA 1BC7C 3GO5A 1QGPA 2VBXA 4CXFA 4CICA 1KQ9A 4R79A 1EH8A 2JRTA 1GXPA 1FC3A 1YS6A 4IF4A 4KICA 2EV5A 3F8NA 4HAMA 1FX7A 3KLNA 1B9MA 3MWMA 3L7WA 4A2UA 4LK1F 1EV7A 1FSEA 4K2EA 4U88A 4I2OA 4LB6B 3V7RA 4M9SA 3U2RA 5HLGA 2P6TA 2R7DA 1R7JA 4Q4ZF 3T0YA 3E5XA 3BROA 1PP8F 3FXUA 5ILSA 1F4KA 5BS6A 2G9WA 4G7ZF 3HTUA 2D2WA 1K78A 2FU4A 3CUQC 1JHHA 1XCVA 3J80K 4XBFA 2QBYB 2VONA 3M8FA 2FNPA 4M9ZA 5FLXK 1G3TA 1S8NA 1LB2A 4BNCA 1R58A 4RGRA 1UFMA 3E5QA 1DPRA 1REPC 2YPRA 2FBHA 2P5VA 4ZYDA 4KT5C 1USTA 3B73A 1OYIA 2HEOA 4ESFA 2DI3A 2FEZA 3V7SA 1IZ1A 4HBLA 5IT3A 3F8CA 1I6XA 1KU9A 4UHTA 3ZMVA 2VE8A 3KP5A 5L3DA 4RAYA 3GWZA 4P55A 1USSA 5LBQA 1FWZA 2FXAA 2Y48A 1IRGA 1FBQA 1NHAA 1BI0A 1O3RA 2A3SA 4JBAA 2XAFA 2DTRA 3K1MA 4ZYHA 3KP2A 1VTNC 3KEOA 3FHZA 3R4KA 2EA4A 1IW7F 3DXJF 1EH6A 4A0XA 1MZBA 3HUGA 4BXUA 4RS8A 2DQLA 4ZYGA 5D8KB 1LNWA 4BHCA 3EUHA 4PZJA 2H27A 5ICFA 5ICCA 1QPMA 1H9GA 3KLOA 4L9TA 4MTDA 1IRFA 2D45A 2E1NA 4HF2A 2H09A 5HS7A 4GCVA 4YFXF 1F9NA 1GVJA 4LG0A 1J0RA 1IN7A 2L02A 3HRSA 3E6BA 1LVAA 2RQPA 3SQNA 2GIVA 2IPQX 4NQWA 3TQNA 4U0YA 1K79A 3BJOA 4KNYA 2X4HA 1JXSA 3PQJA 4LLLA 4CGZA 1PDNC 2IJLA 3I71A 2IT0A 1SFXA 1AOYA 4HQMA 5DV5A 2D1VA 1IXRC 4P9UA 1QQIA 2W85A 2HFHA 3FXRA 3LA7A 3WU0A 1WWXA 2OBPA 3N97A 1CF7B 3MAJA 3FX3A 3JAMK 3K1PA 2M45A 1ODDA 2Z5UA 1KU2A 1YW8A 5H20A 1WQ2A 5LRSA 3WGIA 2YSRA 1RIOH 2F2EA 1O57A 2KIMA 1S29A 4R1HA 1ZAOA 4HZFA 1K7AA 4HV6A 1LDJA 3ELKA 1T2KA 4AD9A 3WTYC 5JR3A 3TO6A 4O5VA 4OU0A 2V1XA 1R1UA 4M6XA 3I58A 2NAZA 4TV7A 1IF1A 4FX4A 1BIAA 2COMA 1OPCA 3R60A 2EFNA 1YW9A 1DDNA 3RPQA 5HDKA 5CVUA 1S7AA 5E20A 4WX9A 5HLIA 5CVJA 5CYVA 5JI6A 4Z2YA 3DV8A 3KFWX 3EDPA 4EMSA 1RUOA 4LLNA 2DQRA 4EQQA 1P4XA 3Q9VA 2ZMEA 2HR3A 2A5YB 3WE2A 3RJPA 3M8EA 4OINF 3KZYA 2PFBA 2J5PA 2FF4A 1QZYA 4OOIA 3GFJA 4G8XA 1W5SA 3GFMA 4HDUA 3VB2A 3P9KA 5F6FA 3FMSA 1B1BA 5LHGA 4RB2C 2M8EA 5DUIA 2FSWA 2G7HA 2IA2A 1FNNA 3J81K 1KYWA 4CDGA 1FBSA 4U0VA 3V8LA 3FXQA 3HSEA 3F6OA 1YQAA 2CQKA 1TBXA 3R61A 5K1YA 5HDGA 3RTRA 4AIKA 2MD5A 1XD7A 3F8MA 2ETHA 2KIFA 2RKHA 3HYIA 2XV4S 3Q5FA 3V4GA 3HHGA 4Q48A 4UUVA 2RC4A 2V79A 1J5YA 4HW0A 3HIFA 1U8RA 4IRHA 1G4DA 1LDDA 3LA3A 2VC1A 4KIFA 3T8RA 5JHUA 2F5EA 2OAZA 2W84A 1FYKA 3VFZA 3CTAA 4EJWA 1O7FA 2PQ8A 3CO6C 2P7VB 4L9NA 5BQTA 4I0AA 4O3MA 2NYXA 1ZYRF 2EWNA 3IRRA 2HOEA 3I59A 3O3KA 2STTA 2DBBA 4UV8A 5K5OA 3ZMSA 2NNYA 4UXNA 3LAJA 2PJPA 3HOTA 1O7LA 3LQQA 4A6DA 1P4WA 5DEQA 2CO5A 5E1ZB 4EGZA 1W4MA 2IW5A 4CZZA 5IT9K 4M9XA 2GA2A 2DFIA 5FGMA 2GXBA 4HLYA 3WTXC 5DD8A 1FP1D 1HW1A 3RPUA 2M1BA 3DF8A 4A0ZA 1ZRCA 2F5FA 3E6CC 4H0EA 4O6JA 5CVVA 1H9TA 3VOEA 4S04A 4LLGF 3LA2A 4XLPF 2P5LC 1IN4A 3WGGA 2VC0A 3GFIA 3V8KA 3KP4A 5DCMA 4GYGA 1YTYA 1FBUA 4QLCU 2DLLA 2GA1A 1KQ0A 1X3UA 4G7OF 5JFRA 5LHIA 2EA2A 1XMAA 1W7PB 5HVQC 3E3VA 4XSXF 2E7WA 1KYZA 1FYLA 3RYRA 3GZ5A 1STZA 2EV6A 4A6EA 4AIHA 3CUQA 3H3UA 1MGTA 1HBXG 1K6OA 4HDVA 2HDCA 1U5TB 3JTHA 2VBYA 2M5WA 1XMKA 3HSRA 4B8XA 2A6EF 4E70A 5LLQA 2EK5A 5KK1A 5D5VB 1Z6RA 5E1WA 4LD5A 3J80Z 4P9FA 2Z9OA 3CDHA 2KRFA 5CVIA 1LEBA 2W25A 5DDGA 4OMYA 5FLXZ 1BI2A 1XGSA 4LB5A 1FLIA 3P9IA 1Z91A 3DPTA 4YG2F 1Q1HA 5D5WB 2QBYA 4LK0F 4L0YB 2A07F 2UZKA 4L18B 4L5JA 3IHUA 2IA0A 4ZH4F 2QM3A 4ESJA 4HX8A 1KGSA 1GXQA 2XAHA 2B0LA 4L9VA 5LGTA 1HXDA 5D4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A12 A;  1ZGJ A;  2ZCW A;  5CJ9 A;  1I1S A;  2O3F A;  5BMZ A;  1XDU A;  4MTE A;  5ICG A;  5D8L B;  3KZZ A;  3HOS A;  3NRV A;  3TOA A;  2XHK A;  3ERE D;  4IHS A;  1GHC A;  1QZZ A;  2E7X A;  3VEP A;  1L3L A;  3BPX A;  4BQA A;  2PMH A;  3AAF A;  1HSJ A;  1WRJ A;  2QQB A;  4MQV A;  3FM3 A;  4OIP F;  5FD5 A;  1Y0U A;  1I1G A;  1F5T A;  1BBY A;  1TW3 A;  4I0B A;  3PFI A;  3IRQ A;  1R22 A;  3JSP A;  3HRM A;  3BJ6 A;  1IUY A;  3BPV A;  2O0Y A;  1O3S A;  2V1U A;  1W7P D;  2JT1 A;  3DQV C;  3FM5 A;  2F5D A;  2OU2 A;  1T38 A;  2LSO A;  2Z99 A;  4IVN A;  1XGO A;  1TQM A;  2NRA C;  4PDK A;  1B59 A;  1UB9 A;  1IAW A;  2Y0M A;  2ZO4 A;  3RDI A;  2FE3 A;  5AIQ A;  1FYM A;  4WK8 F;  4CHU A;  3CO7 C;  2VOO A;  1ULY A;  6PAX A;  4IRG A;  4IXA A;  2M87 A;  2HQR A;  2DPD A;  2HYF A;  1V3F A;  5FFZ A;  1BM9 A;  2LKP A;  3WG9 A;  5E8I A;  2BYV E;  2XAG A;  5HLH A;  2WC2 A;  2VXZ A;  5CVR A;  3JAM Z;  1TTY A;  1U2W A;  3GLX A;  3WTS C;  3WE3 A;  4MQ9 F;  1RNL A;  1S6L A;  1XDS A;  4EM0 B;  3G3Z A;  4EGY A;  4M6Y A;  2LF7 A;  2MH2 A;  4XSZ F;  1SMT A;  3E5U A;  1ZHF A;  2WWY A;  3D5L A;  2XIG A;  3REO A;  1TNS A;  4Y15 A;  2FQ3 A;  2CSO A;  1O3Q A;  2BBY A;  5ICE A;  1SMY F;  3I0T A;  4G6D A;  1SD6 A;  3C18 A;  2OA4 A;  2CYY A;  2ZNZ A;  3MQ0 A;  2XGX A;  2BEO A;  1HQC A;  5L3B A;  3KP6 A;  2EJR A;  4KUM A;  2EFQ A;  4A5M A;  3F72 A;  1V4R A;  1ZGA A;  2HS5 A;  3RKX A;  5D5X B;  4BH9 A;  4N0B A;  2V1D A;  4Q47 A;  3COA C;  1I5Z A;  3TO9 A;  2K4B A;  1MD0 A;  3M1E A;  3O6B B;  2K4J A;  2FNA A;  4DQ2 A;  4ZZL A;  3K0L A;  3DPL C;  2V9V A;  1BI3 A;  2O61 A;  1T0F A;  3MZY A;  1BOA A;  3ULQ B;  1R1T A;  3KEQ A;  2DW4 A;  1YW7 A;  3HSF A;  1P4A A;  3DFG A;  4EJT A;  4NHJ A;  2QQA A;  3BP8 A;  5L3F A;  3FF5 A;  3P9C A;  5FB2 A;  3TGN A;  3SFZ A;  5D6F A;  2AXL A;  3K2Z A;  1LQ1 A;  1AWC A;  2CGP A;  3J81 Z;  1ZG5 A;  1ZLJ A;  2KIU A;  2RDP A;  5HOO A;  2PEX A;  3GX4 X;  5L3G A;  1KQ8 A;  1IXS B;  3ZP5 A;  1Z7U A;  4HV5 A;  4Y13 A;  5BPD A;  1BN5 A;  4UVA A;  5HS8 A;  3J7A O;  3U9G A;  3K1N A;  4HA8 A;  1IN6 A;  2OQG A;  2H6C A;  5LGN A;  1XSD A;  1FZP B;  2LNB A;  1R5G A;  2PBI A;  3ECH A;  4ESB A;  3L9F A;  1R00 A;  4ASN A;  2X0L A;  1OMI A;  3GW2 A;  5E18 F;  3ABU A;  4FT8 A;  3D0S A;  2EFP A;  1P92 A;  3ROU A;  3SZP A;  1OYW A;  5J8C A;  3QP6 A;  4KDP A;  3GZ6 A;  3MFK A;  2RV8 A;  2YX7 A;  5FD6 A;  4RB1 A;  3K9T A;  1LJ9 A;  3NQO A;  2XKP A;  4A5N A;  3E6M A;  5BPI A;  1YYV A;  1XSX A;  2HYG D;  3MCZ A;  1J2X A;  4I02 A;  1MDM B;  1B4A A;  2HKX A;  1FY7 A;  3N4M A;  3C7J A;  1FT9 A;  1TLH B;  3QU6 A;  4LFU A;  5LHH A;  3BY6 A;  1MJB A;  1G6N A;  3ZMU A;  1HKQ A;  2LDU A;  4B09 A;  5LRR A;  1T39 A;  2ZME B;  4PCQ A;  4ENK A;  1CGP A;  4MNU A;  1ZRF A;  1XB4 A;  4ZZD A;  4XRF A;  3I4P A;  2ADU A;  4EJU A;  5IT9 Z;  2EFO A;  2ISY A;  3F8B A;  4HLX A;  1UCR A;  3HRU A;  4KMU X;  2V6C A;  2WV0 A;  3LFK A;  2UWM A;  1D3Y A;  2CWE A;  2H6B A;  3OV8 A;  4WXD A;  4KN4 X;  1G3W A;  2LF8 A;  4N9I A;  2PG4 A;  4P96 A;  4ON0 A;  1OR7 A;  4LMY A;  2P5K A;  4JK1 X;  4RGU A;  2CW0 F;  4LGW A;  1JGS A;  3JTG A;  4BHP A;  2XRO A;  1JHF A;  1WI9 A;  1YG2 A;  1RZ4 A;  4HF0 A;  2CG4 A;  4WXH A;  2A61 A;  3EQL F;  1BIB A;  2L54 A;  3WTW C;  2GAU A;  4WCG A;  4HF1 A;  4P5O A;  2ISZ A;  1IN8 A;  2JPC A;  3KP7 A;  3WGH A;  3GEZ A;  2XAQ A;  3OOP A;  2W57 A;  1G3S A;  1R23 A;  3EYI A;  2GZW A;  1J7K A;  1T6S A;  3MZH A;  1D5V A;  4XLN F;  4FX0 A;  2O03 A;  3TDU C;  1D8K A;  2FOK A;  3CLO A;  3R0A A;  4QWQ A;  3T1B A;  2QQ9 A;  2VT3 A;  2JSC A;  2M30 A;  3NEU A;  4YFN F;  1A04 A;  3Q9S A;  4KN7 X;  1XSV A;  5D6E A;  4OIQ F;  3G73 A;  2D1H A;  5F1R A;  1U5T A;  4KA4 A;  2P7C B;  2P8T A;  1R36 A;  1TQI A;  3H92 A;  4BYY A;  2HWV A;  1FOK A;  1FSH A;  1ZG1 A;  3IWZ A;  2EB7 A;  2HZT A;  5L3C A;  3L2C A;  1YFH A;  5FO5 A;  4DNC A;  1RI7 A;  2AS5 F;  1H0M A;  4RAZ A;  1JE8 A;  1SD5 A;  3T5X A;  1ZAR A;  4UV9 A;  2TDX A;  1E17 A;  2PMU A;  4IHT A;  1ZG3 A;  2O6G E;  1ZRD A;  2DK5 A;  3JW4 A;  1Z6T A;  2YU3 A;  3RKW A;  4I01 A;  2PLY A;  5DCM B;  2ZJ2 A;  1KU3 A;  1YLF A;  3WU1 B;  1U6G A;  3KE2 A;  4G94 A;  4ENM A;  1P6R A;  5HS9 A;  1XGN A;  4F7Z A;  5ERI A;  3TO7 A;  5ILV A;  5E8G A;  5F64 A;  3R6S A;  2EV0 A;  4YIF A;  2Z33 A;  4M71 A;  4GGG A;  5HDN A;  3C1D A;  2QWW A;  1L0O C;  3BOQ A;  1U5T C;  3I64 A;  1B9N A;  4EM2 A;  3QRF F;  3HHH A;  3CUQ B;  1PUE E;  2RVC A;  3TDZ C;  4UVC A;  2GXG A;  5E1X A;  3IL2 A;  1XGM A;  4IPA A;  2XKO A;  2IVM A;  3GXO A;  2DO7 A;  1DUX C;  3QPH A;  3F21 A;  4M72 A;  4Q5S F;  3KET A;  1LEA A;  2ESH A;  2JZY A;  4OIO F;  2KJC A;  3B02 A;  1TW2 A;  3ABT A;  2QEN A;  2VOD A;  2WTE A;  2L4M A;  5K5Q A;  2Y75 A;  2JTV A;  3ZMD A;  2HGC A;  4L9J A;  3FWE A;  5KVR A;  1UHM A;  2L3D A;  2MC3 A;  3M7G A;  3GFL A;  3RYP A;  3I5U A;  4GYI A;  3BDD A;  3EET A;  2O8X A;  1ZN2 A;  3U1D A;  1U78 A;  2Q8K A;  3QU3 A;  3ECO A;  1J75 A;  3W6J B;  3F8F A;  1MJ9 A;  2DT5 A;  4G9Y A;  2VOP A;  2DK8 A;  2QUF A;  1FPQ A;  2YR2 A;  2ZKZ A;  1K78 B;  1ON1 A;  2DPU A;  1ON2 A;  4EM1 A;  1J9I A;  3MEX A;  4M74 A;  3I53 A;  5LGU A;  2MLG A;  3HTS B;  4ZYE A;  4CYD A;  1P2F A;  4AVP A;  3F22 A;  3WTU C;  4CO8 A;  1FP2 A;  5CLS A;  1WKM A;  4BAY A;  5L3E A;  3ZMT A;  3V7C A;  2ELH A;  4GXO A;  4UNO A;  1Z9C A;  4EJO A;  1YO5 C;  5DYM A;  5ILU A;  4RB3 C;  1BI1 A;  4S05 A;  5AIP A;  2STW A;  3F23 A;  2HTS A;  1R1V A;  3GYH X;  2QVO A;  4HX4 A;  4YFK F;  3CJN A;  1EH7 A;  4M73 A;  5H6R A;  5BOX A;  2OD5 A;  2XUB A;  2ACJ A;  2NNN A;  2F5C A;  2K27 A;  3M9A A;  1SAX A;  1HKS A;  2GQQ A;  3IKV A;  4NB5 A;  1S3J A;  4EVI A;  3QP5 A;  3IWF A;  2Q2E A;  2DAO A;  1CF7 A;  4L5I A;  5EEH A;  3WTT C;  4RGS A;  2K02 A;  3IC7 A;  1BJA A;  1KA8 A;  1HKT A;  5DD4 A;  2RGV A;  2FMY A;  3WOD F;  4YII A;  5FFX A;  3E97 A;  1SFE A;  5K5R A;  3BZ6 A;  1SD7 A;  3WTZ A;  4KFC A;  2IA1 A;  2XVC A;  2A6H F;  2HKO A;  3QPT A;  2FA5 A;  1KU7 A;  5EEG A;  3RI4 A;  1DPU A;  4KYW A;  2FRH A;  2GWR A;  4G7H F;  3R0J A;  3GVA A;  4LG0 B;  1XN7 A;  1Z05 A;  2VBW A;  4WWC A;  1BC8 C;  4ETS A;  2FML A;  2MH9 A;  2R3S A;  2VBZ A;  3GUD A;  2FBI A;  4Y17 A;  3LQR A;  2E1C A;  3BJA A;  1W5T A;  4KIG A;  1MKM A;  4I7H A;  4HOB A;  2QYO A;  2XAJ A;  2NS0 A;  3P7N A;  1PP7 U;  5E17 F;  2L01 A;  1OKR A;  3QAH A;  2EFW A;  4AIJ A;  3L09 A;  1F1Z A;  2OZU A;  3L00 A;  4KIB A;  2BV6 A;  4RGX A;  4WF2 A;  1MDM A;  3BWG A;  5J6X A;  1C0W A;  2KKO A;  1ZLK A;  3QOP A;  3S2W A;  2C6Y A;  1XCB A;  2JPB A;  4ENJ A;  2HQN A;  3ZPL A;  2A69 F;  2MA3 A;  3V8J A;  1ZRE A;  3KCC A;  3K69 A;  4FHT A;  1S7O A;  3ZMZ A;  3SZT A;  1HST A;  2FBK A;  3RIR A;  5ED4 A;  4R8H A;  2QLZ A;  1TQP A;  2UXN A;  5DCF A;  2P4W A;  2VN2 A;  1G3Y A;  2PI0 A;  4KMF A;  3KP3 A;  1YIO A;  1IN5 A;  1ONV A;  2UXX A;  2VT2 A;  1DP7 P;  4MEX F;  3DEU A;  3FMQ A;  3T8T A;  2CFX A;  1IXC A;  4HX7 A;  4MEY F;  2P6S A;  4I09 A;  2K86 A;  2ZFW A;  2YX4 A;  5A2Q Z;  3VOD A;  2HTJ A;  1B6A A;  3TOB A;  4MGR A;  1QNT A;  3E6D A;  1J59 A;  2ESN A;  2W24 A;  3DP7 A;  4ENN A;  4MHG A;  2BGC A;  4HYE A;  2Q0O A;  4A0Y A;  5LEK A;  4LJZ F;  2R7F A;  1SFU A;  1D8J A;  2Z3Y A;  4GO1 A;  1O3T A;  1LDK B;  4PGH A;  2K7L A;  1T98 A;  3FMR A;  1QO0 D;  2A68 F;  2L4A A;  4WXC A;  2MBF A;  5TRD A;  5H6Q A;  5D5U B;  3SHF A;  2XAS A;  3FZV A;  4OMZ A;  2QZ8 A;  2BE5 F;  1MJA A;  4BHB A;  4AWX B;  2ZBK A;  5J8F A;  5A2Q K;  1SD4 A;  4N9H A;  1OYY A;  4U7B A;  4IJA A;  2RNJ A;  3IKT A;  1YS7 A;  3TKY A;  4I98 B;  2XRN A;  1I27 A;  2OZ6 A;  5D4R A;  1QBJ A;  4IRI A;  1U3E M;  1W7P A;  3HRT A;  2H94 A;  3GF2 A;  2G7U A;  4G6Q A;  4JQF A;  5LEJ A;  4OIR F;  3F3X A;  2VE9 A;  2MLK A;  2RN7 A;  3I59 B;  4U0W A;  1ZH5 A;  3ML6 A;  2OQR A;  4EV0 A;  3RKY A;  4D0P A;  3EYY A;  3F6V A;  2ZNY A;  3ZN0 A;  3I54 A;  3C3W A;  2ZXJ A;  1UHW A;  5DUK A;  2IP2 A;  3DKW A;  3CUO A;  3JSO A;  5AON A;  2DU9 A;  1E2X A;  1HW2 A;  1WSU A;  3WTV C;  3O2P E;  1Z1D A;  1RUN A;  4L0Z B;  2J5O A;  3LAP A;  3ZQ7 A;  3ISP A;  3LWF A;  4RB0 A;  4UVB A;  5JVT A;  2IRF G;  2PN6 A;  1TNT A;  4U7D A;  3H3Z A;  4HQE A;  4PGG A;  3LST A;  3W6K B;  1HW5 A;  3PQK A;  4EJV A;  1R5H A;  3ZN1 A;  3SXY A;  5TJJ A;  2KJB A;  1BC7 C;  3GO5 A;  1QGP A;  2VBX A;  4CXF A;  4CIC A;  1KQ9 A;  4R79 A;  1EH8 A;  2JRT A;  1GXP A;  1FC3 A;  1YS6 A;  4IF4 A;  4KIC A;  2EV5 A;  3F8N A;  4HAM A;  1FX7 A;  3KLN A;  1B9M A;  3MWM A;  3L7W A;  4A2U A;  4LK1 F;  1EV7 A;  1FSE A;  4K2E A;  4U88 A;  4I2O A;  4LB6 B;  3V7R A;  4M9S A;  3U2R A;  5HLG A;  2P6T A;  2R7D A;  1R7J A;  4Q4Z F;  3T0Y A;  3E5X A;  3BRO A;  1PP8 F;  3FXU A;  5ILS A;  1F4K A;  5BS6 A;  2G9W A;  4G7Z F;  3HTU A;  2D2W A;  1K78 A;  2FU4 A;  3CUQ C;  1JHH A;  1XCV A;  3J80 K;  4XBF A;  2QBY B;  2VON A;  3M8F A;  2FNP A;  4M9Z A;  5FLX K;  1G3T A;  1S8N A;  1LB2 A;  4BNC A;  1R58 A;  4RGR A;  1UFM A;  3E5Q A;  1DPR A;  1REP C;  2YPR A;  2FBH A;  2P5V A;  4ZYD A;  4KT5 C;  1UST A;  3B73 A;  1OYI A;  2HEO A;  4ESF A;  2DI3 A;  2FEZ A;  3V7S A;  1IZ1 A;  4HBL A;  5IT3 A;  3F8C A;  1I6X A;  1KU9 A;  4UHT A;  3ZMV A;  2VE8 A;  3KP5 A;  5L3D A;  4RAY A;  3GWZ A;  4P55 A;  1USS A;  5LBQ A;  1FWZ A;  2FXA A;  2Y48 A;  1IRG A;  1FBQ A;  1NHA A;  1BI0 A;  1O3R A;  2A3S A;  4JBA A;  2XAF A;  2DTR A;  3K1M A;  4ZYH A;  3KP2 A;  1VTN C;  3KEO A;  3FHZ A;  3R4K A;  2EA4 A;  1IW7 F;  3DXJ F;  1EH6 A;  4A0X A;  1MZB A;  3HUG A;  4BXU A;  4RS8 A;  2DQL A;  4ZYG A;  5D8K B;  1LNW A;  4BHC A;  3EUH A;  4PZJ A;  2H27 A;  5ICF A;  5ICC A;  1QPM A;  1H9G A;  3KLO A;  4L9T A;  4MTD A;  1IRF A;  2D45 A;  2E1N A;  4HF2 A;  2H09 A;  5HS7 A;  4GCV A;  4YFX F;  1F9N A;  1GVJ A;  4LG0 A;  1J0R A;  1IN7 A;  2L02 A;  3HRS A;  3E6B A;  1LVA A;  2RQP A;  3SQN A;  2GIV A;  2IPQ X;  4NQW A;  3TQN A;  4U0Y A;  1K79 A;  3BJO A;  4KNY A;  2X4H A;  1JXS A;  3PQJ A;  4LLL A;  4CGZ A;  1PDN C;  2IJL A;  3I71 A;  2IT0 A;  1SFX A;  1AOY A;  4HQM A;  5DV5 A;  2D1V A;  1IXR C;  4P9U A;  1QQI A;  2W85 A;  2HFH A;  3FXR A;  3LA7 A;  3WU0 A;  1WWX A;  2OBP A;  3N97 A;  1CF7 B;  3MAJ A;  3FX3 A;  3JAM K;  3K1P A;  2M45 A;  1ODD A;  2Z5U A;  1KU2 A;  1YW8 A;  5H20 A;  1WQ2 A;  5LRS A;  3WGI A;  2YSR A;  1RIO H;  2F2E A;  1O57 A;  2KIM A;  1S29 A;  4R1H A;  1ZAO A;  4HZF A;  1K7A A;  4HV6 A;  1LDJ A;  3ELK A;  1T2K A;  4AD9 A;  3WTY C;  5JR3 A;  3TO6 A;  4O5V A;  4OU0 A;  2V1X A;  1R1U A;  4M6X A;  3I58 A;  2NAZ A;  4TV7 A;  1IF1 A;  4FX4 A;  1BIA A;  2COM A;  1OPC A;  3R60 A;  2EFN A;  1YW9 A;  1DDN A;  3RPQ A;  5HDK A;  5CVU A;  1S7A A;  5E20 A;  4WX9 A;  5HLI A;  5CVJ A;  5CYV A;  5JI6 A;  4Z2Y A;  3DV8 A;  3KFW X;  3EDP A;  4EMS A;  1RUO A;  4LLN A;  2DQR A;  4EQQ A;  1P4X A;  3Q9V A;  2ZME A;  2HR3 A;  2A5Y B;  3WE2 A;  3RJP A;  3M8E A;  4OIN F;  3KZY A;  2PFB A;  2J5P A;  2FF4 A;  1QZY A;  4OOI A;  3GFJ A;  4G8X A;  1W5S A;  3GFM A;  4HDU A;  3VB2 A;  3P9K A;  5F6F A;  3FMS A;  1B1B A;  5LHG A;  4RB2 C;  2M8E A;  5DUI A;  2FSW A;  2G7H A;  2IA2 A;  1FNN A;  3J81 K;  1KYW A;  4CDG A;  1FBS A;  4U0V A;  3V8L A;  3FXQ A;  3HSE A;  3F6O A;  1YQA A;  2CQK A;  1TBX A;  3R61 A;  5K1Y A;  5HDG A;  3RTR A;  4AIK A;  2MD5 A;  1XD7 A;  3F8M A;  2ETH A;  2KIF A;  2RKH A;  3HYI A;  2XV4 S;  3Q5F A;  3V4G A;  3HHG A;  4Q48 A;  4UUV A;  2RC4 A;  2V79 A;  1J5Y A;  4HW0 A;  3HIF A;  1U8R A;  4IRH A;  1G4D A;  1LDD A;  3LA3 A;  2VC1 A;  4KIF A;  3T8R A;  5JHU A;  2F5E A;  2OAZ A;  2W84 A;  1FYK A;  3VFZ A;  3CTA A;  4EJW A;  1O7F A;  2PQ8 A;  3CO6 C;  2P7V B;  4L9N A;  5BQT A;  4I0A A;  4O3M A;  2NYX A;  1ZYR F;  2EWN A;  3IRR A;  2HOE A;  3I59 A;  3O3K A;  2STT A;  2DBB A;  4UV8 A;  5K5O A;  3ZMS A;  2NNY A;  4UXN A;  3LAJ A;  2PJP A;  3HOT A;  1O7L A;  3LQQ A;  4A6D A;  1P4W A;  5DEQ A;  2CO5 A;  5E1Z B;  4EGZ A;  1W4M A;  2IW5 A;  4CZZ A;  5IT9 K;  4M9X A;  2GA2 A;  2DFI A;  5FGM A;  2GXB A;  4HLY A;  3WTX C;  5DD8 A;  1FP1 D;  1HW1 A;  3RPU A;  2M1B A;  3DF8 A;  4A0Z A;  1ZRC A;  2F5F A;  3E6C C;  4H0E A;  4O6J A;  5CVV A;  1H9T A;  3VOE A;  4S04 A;  4LLG F;  3LA2 A;  4XLP F;  2P5L C;  1IN4 A;  3WGG A;  2VC0 A;  3GFI A;  3V8K A;  3KP4 A;  5DCM A;  4GYG A;  1YTY A;  1FBU A;  4QLC U;  2DLL A;  2GA1 A;  1KQ0 A;  1X3U A;  4G7O F;  5JFR A;  5LHI A;  2EA2 A;  1XMA A;  1W7P B;  5HVQ C;  3E3V A;  4XSX F;  2E7W A;  1KYZ A;  1FYL A;  3RYR A;  3GZ5 A;  1STZ A;  2EV6 A;  4A6E A;  4AIH A;  3CUQ A;  3H3U A;  1MGT A;  1HBX G;  1K6O A;  4HDV A;  2HDC A;  1U5T B;  3JTH A;  2VBY A;  2M5W A;  1XMK A;  3HSR A;  4B8X A;  2A6E F;  4E70 A;  5LLQ A;  2EK5 A;  5KK1 A;  5D5V B;  1Z6R A;  5E1W A;  4LD5 A;  3J80 Z;  4P9F A;  2Z9O A;  3CDH A;  2KRF A;  5CVI A;  1LEB A;  2W25 A;  5DDG A;  4OMY A;  5FLX Z;  1BI2 A;  1XGS A;  4LB5 A;  1FLI A;  3P9I A;  1Z91 A;  3DPT A;  4YG2 F;  1Q1H A;  5D5W B;  2QBY A;  4LK0 F;  4L0Y B;  2A07 F;  2UZK A;  4L18 B;  4L5J A;  3IHU A;  2IA0 A;  4ZH4 F;  2QM3 A;  4ESJ A;  4HX8 A;  1KGS A;  1GXQ A;  2XAH A;  2B0L A;  4L9V A;  5LGT A;  1HXD A;  5D4S A; 
#chains in the Genus database with same CATH topology
 4A12 A;  2B7E A;  1Y0N A;  1ZGJ A;  4JX4 A;  2ZCW A;  4XRS A;  3DEW A;  5CJ9 A;  1I1S A;  2GOX B;  3AG4 H;  2O3F A;  5BMZ A;  1XDU A;  4MTE A;  5ICG A;  1FMW A;  3ERM A;  5D8L B;  2ELK A;  4UUS B;  4BUP A;  2NOJ B;  4UB6 C;  2X51 A;  3KZZ A;  3HOS A;  3NRV A;  3OSF A;  3TOA A;  2XHK A;  4C9Y A;  3ZQI A;  3ERE D;  4IHS A;  1GHC A;  1QZZ A;  4PJJ A;  2E7X A;  3L2U A;  3VEP A;  1L3L A;  3BPX A;  3BZC A;  3CCM I;  1VQN I;  3QPL A;  3HKZ N;  2MAB A;  3LSP A;  4BQA A;  2NVU B;  2LTP A;  2PMH A;  2WAE A;  3AAF A;  2L2O A;  1MNE A;  1HSJ A;  1WRJ A;  2QEX I;  2QQB A;  3QOD A;  2OF7 A;  4MQV A;  3TW6 A;  3FM3 A;  4OIP F;  2HQA A;  5FD5 A;  1RKW A;  1Y0U A;  2EH3 A;  1I1G A;  1XMX A;  2MD0 A;  1V5F A;  1F5T A;  1BBY A;  3DU5 A;  3ZQL A;  1TW3 A;  3G1L A;  2W48 A;  5K7F A;  1A6I A;  2FX0 A;  2M4G A;  4I0B A;  3FXJ A;  3PFI A;  3IRQ A;  3KYC B;  1R22 A;  2L5Q A;  4ZJZ A;  1D0Y A;  2ID6 A;  3JSP A;  1QVU A;  2KFD A;  2EZH A;  3BJ6 A;  3HRM A;  4DBR A;  3BPV A;  2ZC2 A;  1IUY A;  1PJR A;  2P81 A;  2QGU A;  3EPZ A;  1LFB A;  2O0Y A;  5IP7 J;  1O3S A;  2V1U A;  2L9V A;  2Y9Y A;  2CUZ A;  3WHC A;  1W7P D;  2JT1 A;  2EIL H;  3DQV C;  3FM5 A;  2DA5 A;  2F5D A;  2OU2 A;  2CV1 A;  1T38 A;  2LSO A;  3LSH A;  2OCC H;  2Z99 A;  4B4C A;  4IVN A;  1XGO A;  1TQM A;  3I56 I;  1IC8 A;  2NRA C;  4PDK A;  1OCZ H;  1B59 A;  1UB9 A;  2IEK A;  2F4O B;  5H2F C;  3ASN H;  5EGO A;  3OS1 A;  1IAW A;  2Y0M A;  1X1B A;  4BE1 A;  2HDW A;  1X1C A;  2L7M P;  1SFO J;  4QSH A;  1AKH A;  3H35 A;  3F0C A;  4YRV A;  2ZO4 A;  1N75 A;  1TWG J;  3G1M A;  3RDI A;  2FE3 A;  3GTJ J;  5AIQ A;  1FYM A;  4WK8 F;  4CHU A;  3CO7 C;  2VOO A;  3GZN B;  1APL C;  1ULY A;  6PAX A;  2DT7 B;  3DTE A;  1X2N A;  4IRG A;  1QPI A;  4IXA A;  2M87 A;  2YS9 A;  1TC3 C;  3TL4 X;  4M3E A;  2HQR A;  4BY7 J;  1IRX A;  2DPD A;  2CW8 A;  2HYF A;  3VSK A;  3RZO J;  1V3F A;  4ANJ A;  4DYC A;  1BR4 A;  1MBE A;  2DA1 A;  5FFZ A;  5C4J J;  3MKW B;  1BM9 A;  2L7K A;  5M5X J;  5JLX A;  5M3F J;  3DBR B;  2Y0S N;  3ZQG A;  4RLF A;  2LKP A;  2DA7 A;  2ECC A;  3WG9 A;  2QCO A;  5E8I A;  5M3M J;  2BYV E;  2XAG A;  4CYC A;  5HLH A;  2WAQ N;  2WC2 A;  1F36 A;  4HSR A;  1BW5 A;  2VXZ A;  1RES A;  5CVR A;  3JAM Z;  1TTY A;  1U2W A;  3GLX A;  2K5C A;  1LE8 B;  3S3M A;  3D5R C;  3WTS C;  3K4K A;  3WE3 A;  4MQ9 F;  1XX5 A;  1RNL A;  5KAF C;  1S6L A;  1XDS A;  3BG3 A;  2E2H J;  2GLO A;  4EM0 B;  3G3Z A;  4EGY A;  2LBF B;  1GT0 C;  4M6Y A;  1S7E A;  2LF7 A;  2MH2 A;  2M0C A;  4XSZ F;  3VYU B;  3OL4 A;  5HNH A;  2CQX A;  1SMT A;  3E5U A;  1ZHF A;  2BY3 A;  2BY2 A;  3HEF A;  1KON A;  2WWY A;  2W7N A;  2LOO A;  3D5L A;  4BEH A;  2XIG A;  3REO A;  2G0E A;  3OYJ A;  1TNS A;  4Y15 A;  3HKZ A;  1VQL I;  2FQ3 A;  2CSO A;  4IOC F;  5B66 C;  1O3Q A;  1ZK8 A;  2BBY A;  3BR2 A;  5ICE A;  1SMY F;  3MKL A;  3I0T A;  4G6D A;  4PK4 A;  1IV6 A;  1SD6 A;  3C18 A;  5CKT A;  2OA4 A;  2CYY A;  2ZNZ A;  4BAC A;  1A5J A;  3MQ0 A;  2FJ1 A;  1EKE A;  2XGX A;  3ZQF A;  2OUM A;  2R4G A;  2BEO A;  1HQC A;  4ABZ A;  5L3B A;  2ZJQ F;  3M4O J;  2Q2E B;  1RPW A;  3KP6 A;  1QVT A;  2EJR A;  4KUM A;  4XM3 A;  2EFQ A;  1ETX A;  3F72 A;  4A5M A;  1T8I A;  1V4R A;  1ETQ A;  2MG4 A;  1ZGA A;  2HS5 A;  3RKX A;  4XN0 A;  2K9N A;  5D5X B;  4BH9 A;  1VQM I;  4N0B A;  2CU7 A;  3DLA A;  2V1D A;  4Q47 A;  3COA C;  1I5Z A;  2O8K A;  1I39 A;  4Y3O A;  3TO9 A;  2K4B A;  3OYN A;  2R7W A;  1MD0 A;  3M1E A;  3O6B B;  2K4J A;  2WAD A;  1FOY A;  2FNA A;  2VKH A;  4M6V A;  4DQ2 A;  4ZZL A;  2KRC A;  3K0L A;  4DIQ A;  1X58 A;  3DPL C;  3OSG A;  2V9V A;  1BI3 A;  2O61 A;  2KMU A;  1TWH J;  1T0F A;  1WFX A;  3MZY A;  5FKO A;  3CC4 I;  1BOA A;  4NC8 A;  3ULQ B;  3RQI A;  2ME0 A;  1R1T A;  3KEQ A;  3S1Q J;  2DW4 A;  1YW7 A;  5CPR B;  3HDD A;  5B1A H;  1QHG A;  3HSF A;  4HNV A;  1B8I B;  1P4A A;  3DFG A;  5EJC A;  4EJT A;  4NHJ A;  1Q1V A;  2QQA A;  2VI6 A;  3ZCO A;  5EYR A;  4NC7 A;  3H5R A;  2JA2 A;  3GTM J;  3BP8 A;  5L3F A;  3FF5 A;  3P9C A;  5FB2 A;  3TGN A;  1TT0 A;  3SFZ A;  2Z16 A;  4A3F J;  1NG6 A;  5D6F A;  1ACI A;  1T56 A;  2AXL A;  2ZXH A;  2GM4 A;  1ETO A;  3PSI A;  4C3H J;  3K2Z A;  2XSD C;  1LQ1 A;  1AWC A;  2CGP A;  3J81 Z;  1ZG5 A;  1JJ8 C;  1ZLJ A;  2KIU A;  2M4K A;  2RDP A;  2PEX A;  5HOO A;  3GX4 X;  5L3G A;  3MN2 A;  1KQ8 A;  1IXS B;  3ZP5 A;  2RRE A;  1BOB A;  1YJ9 I;  1Z7U A;  4HV5 A;  4Y13 A;  3CCJ I;  5BPD A;  2FUG 2;  1V55 H;  1BN5 A;  2A5W A;  3MKZ A;  3PO2 J;  4UVA A;  4XQF A;  5HS8 A;  3J7A O;  3U9G A;  4DOZ A;  3K1N A;  4HA8 A;  1IN6 A;  2OQG A;  5J4V A;  2H6C A;  3GTK J;  4V19 K;  2MSY A;  1ORK A;  2WAQ A;  3VYR B;  2JWT A;  5LGN A;  4XRM A;  1XSD A;  1FZP B;  2IS4 A;  2LNB A;  1R5G A;  2PBI A;  3CQZ J;  3ECH A;  3S8P A;  5GAH J;  2CV2 A;  2M9H A;  4ESB A;  3L9F A;  1R00 A;  4MO7 A;  4ASN A;  2X0L A;  4RMN A;  4XKV A;  3HXL A;  4HEA 2;  5F04 A;  1OMI A;  3GW2 A;  5E18 F;  3ABU A;  4FT8 A;  1OCR H;  3D0S A;  2LY9 A;  4HG2 A;  2EFP A;  1P92 A;  1T0F C;  4RM2 A;  3ROU A;  3SZP A;  1OYW A;  5J8C A;  3QP6 A;  3TBI A;  4KDP A;  3GZ6 A;  3MFK A;  4E6K G;  2RV8 A;  2YX7 A;  5FD6 A;  2K9Q A;  4RB1 A;  5FRN A;  1MBH A;  3K9T A;  1LJ9 A;  3NQO A;  5C44 J;  3G71 I;  2XKP A;  4A5N A;  3E6M A;  5BPI A;  1YYV A;  2K9L A;  4BE2 A;  1XSX A;  2HYG D;  1VI0 A;  2V26 A;  3MCZ A;  5F27 A;  1J2X A;  4I02 A;  1MDM B;  1D1B A;  1YRN B;  3L2W A;  1BA5 A;  2X85 A;  1B4A A;  1IGN A;  2HKX A;  1FY7 A;  3N4M A;  3C7J A;  1FT9 A;  2VQG A;  1TLH B;  4PFP A;  3QU6 A;  4LFU A;  4II3 A;  2HVR A;  1YOV B;  5LHH A;  3BY6 A;  2KPM A;  1MJB A;  1G6N A;  3H9Q A;  3ZMU A;  3IH4 A;  5TGT A;  1HKQ A;  5JVG F;  2LDU A;  4B09 A;  1X4P A;  5LRR A;  3VSL A;  1T39 A;  2CS3 A;  2M34 A;  2ZME B;  4PCQ A;  2JA8 J;  2KIS A;  3SFI A;  4ENK A;  1CGP A;  2LY2 A;  4MNU A;  4BKX A;  1R49 A;  1ZRF A;  1X1A A;  5J1R A;  1XB4 A;  4ZZD A;  3LFU A;  2H8R A;  1OCT C;  4XRF A;  2RAE A;  2GXA A;  3I4P A;  9ANT A;  4LOC A;  2ADU A;  4C2T A;  4EJU A;  2M7A A;  5IT9 Z;  1YX5 A;  2LH9 A;  5FKK A;  2EFO A;  2ISY A;  3F8B A;  2TCT A;  2XGC A;  4HLX A;  1MBK A;  1UCR A;  1X19 A;  4X1E A;  3HRU A;  3JRE A;  4KMU X;  4XKB A;  3OYA A;  4E7H A;  2V6C A;  3K4C A;  3HJE A;  3CME I;  1K61 A;  1GV5 A;  2WV0 A;  2XPU A;  3LFK A;  2UWM A;  1D3Y A;  2CWE A;  1G2H A;  4AM3 A;  2H6B A;  3OV8 A;  2M8G X;  4WXD A;  4CCM A;  3SEZ A;  4KN4 X;  1G3W A;  1UG0 A;  2LF8 A;  2PG4 A;  3FK6 A;  4N9I A;  4P96 A;  4ON0 A;  1OR7 A;  4LMY A;  2P5K A;  4JK1 X;  1ZR4 A;  1AA7 A;  2KP6 A;  1X1P A;  4XID A;  4DYR A;  4RGU A;  4CCN A;  4IEJ A;  3HGG A;  3EUK L;  2XGD A;  2CW0 F;  4LGW A;  1JGS A;  3JTG A;  4BHP A;  2XRO A;  1WPK A;  2VQH A;  2CQN A;  1JHF A;  3IUO A;  4F92 B;  2XC7 A;  2E2I J;  2DYS H;  1WI9 A;  4XON A;  1YG2 A;  1MBG A;  1RZ4 A;  5JLW A;  1HC8 A;  3CCS I;  1A31 A;  4HF0 A;  2UV1 A;  2CG4 A;  4WXH A;  1RET A;  2A61 A;  3EQL F;  1BIB A;  3ZQH A;  1A35 A;  2LVS A;  3VPR A;  2L54 A;  1NK3 P;  3WTW C;  3JCU C;  2GAU A;  4WCG A;  3MZ8 A;  3RQ4 A;  3K4B A;  4HF1 A;  4P5O A;  2ISZ A;  1DU0 A;  4LIU A;  1IN8 A;  2NS7 A;  2RQQ A;  3LSI A;  2JPC A;  3KP7 A;  3WGH A;  3GEZ A;  2XAQ A;  2CRG A;  4A3C J;  2R7V A;  3OOP A;  2W57 A;  1G3S A;  4DZP A;  3BG6 A;  1R23 A;  3EYI A;  3I4M J;  2GZW A;  3DCF A;  2X1C A;  2GIZ A;  3S14 J;  3HOY J;  3BCB A;  3OS2 A;  4PFO A;  1J7K A;  5KAI C;  3W2W A;  3OYH A;  2JRM A;  3KYL A;  1T6S A;  3MZH A;  1D5V A;  2D5V A;  4XLN F;  4L5E A;  3NWT A;  4FX0 A;  2O03 A;  3TDU C;  2LP0 A;  4FE4 A;  1D8K A;  2FOK A;  3CLO A;  4BBR J;  5EG0 B;  5GPC A;  3R0A A;  4IQJ A;  2HQ5 A;  4QWQ A;  3T1B A;  2QQ9 A;  2R5Z A;  2VT3 A;  2JSC A;  2M30 A;  2Z2S B;  3NEU A;  4ZDP A;  4IZZ A;  4YFN F;  4FTH A;  1A04 A;  3Q9S A;  2XPV A;  4KN7 X;  1XSV A;  2QSF X;  5D6E A;  4OIQ F;  3BR6 A;  3G73 A;  1E3O C;  1OR7 C;  2D1H A;  5F1R A;  1U5T A;  4KA4 A;  2P7C B;  2P8T A;  1R36 A;  1TQI A;  3H92 A;  3SZG A;  1HLV A;  4BYY A;  2HWV A;  1FOK A;  1FSH A;  1ZG1 A;  3IWZ A;  2EB7 A;  2YUS A;  2HZT A;  5L3C A;  4ZDL A;  2QF7 A;  3BC8 A;  2VJJ A;  1IJW C;  2HOA A;  5GAD J;  3L2C A;  1YFH A;  1HCR A;  5FO5 A;  4DNC A;  1RI7 A;  2AS5 F;  1H0M A;  4RAZ A;  3KIO A;  3J7A Y;  3CCE I;  1VFC A;  1ETV A;  2OCE A;  1JE8 A;  1SD5 A;  3T5X A;  2FOW A;  1XC5 A;  1ZAR A;  3CMA I;  2HPI A;  4UV9 A;  3CC7 I;  1B72 B;  2TDX A;  3HB9 A;  1E17 A;  2PMU A;  4IHT A;  2COB A;  1ZG3 A;  2O6G E;  1ZRD A;  2H1L A;  2DK5 A;  1U9N A;  3CES A;  3JW4 A;  4I99 C;  4AYB N;  4BGD A;  1Z6T A;  2YU3 A;  3RKW A;  1MMA A;  4I01 A;  1D1A A;  2PLY A;  5DCM B;  4KIS A;  2O5R A;  3GTO J;  2DMU A;  3H0D A;  1WI3 A;  1EF4 A;  2ZJ2 A;  4HNT A;  2E34 A;  1KU3 A;  2OTJ I;  1YLF A;  3WU1 B;  1U6G A;  1UJ8 A;  3KE2 A;  4G94 A;  2R7S A;  4ENM A;  2ZXW H;  1QRY A;  4AU7 A;  1P6R A;  5HS9 A;  3LL7 A;  1XGN A;  2ME6 A;  4F7Z A;  3W3C A;  1N78 A;  1TP4 A;  5ERI A;  3TO7 A;  5ILV A;  5E8G A;  5DTD A;  1WH7 A;  5F64 A;  5JHF A;  1X2M A;  2EV0 A;  3R6S A;  4YIF A;  2Z33 A;  4M71 A;  4CCJ A;  5IOZ A;  3H5N A;  3QPS A;  1TWC J;  2CFO A;  4GGG A;  5HDN A;  4D5C A;  2X1D A;  3C1D A;  3K70 C;  2QWW A;  1L0O C;  5HOD A;  2LKX A;  3BOQ A;  3A02 A;  3BG5 A;  2EIK H;  1U5T C;  3M8J A;  3I64 A;  4XLC A;  2JVH A;  4P1W A;  1B9N A;  4EM2 A;  1QU3 A;  3QRF F;  3HHH A;  3CUQ B;  2E60 A;  2R7Q A;  3E1S A;  1PUE E;  4G12 A;  3KZI C;  2RVC A;  3TDZ C;  3I4N J;  4UVC A;  2GXG A;  5E1X A;  3ZQQ A;  3IL2 A;  1MMD A;  1XGM A;  2HOT A;  4IPA A;  2JUG A;  3JRI A;  2XKO A;  2IVM A;  4XR6 A;  3GXO A;  2DO7 A;  1DUX C;  2K40 A;  1BW6 A;  3QPH A;  3F21 A;  4AUX A;  4W1U A;  2OV7 A;  4M72 A;  4Q5S F;  3AL0 C;  3KET A;  1LEA A;  1A36 A;  2ESH A;  2JZY A;  2F4M B;  5IP6 A;  4X6A J;  4OIO F;  2O7O A;  2Q1Z B;  2KJC A;  3B02 A;  1TW2 A;  3ABT A;  5FKM A;  2QEN A;  1EJ9 A;  2Z1D A;  2WTE A;  5FRO A;  4F52 A;  3OYK A;  2VOD A;  1OCP A;  2L4M A;  5K5Q A;  2Y75 A;  4C30 A;  4M3G A;  2JTV A;  4NUB A;  3ZMD A;  2HGC A;  4IO9 F;  3BR5 A;  4L9J A;  5FLM J;  3FWE A;  1DQU A;  3E0J B;  3DKX A;  1P7I A;  5KVR A;  2XDV A;  1UHM A;  2L3D A;  4NBQ A;  2NVT J;  1ITY A;  1SC7 A;  2MC3 A;  3M7G A;  3GFL A;  4B44 A;  3RYP A;  3LSG A;  3I5U A;  4GYI A;  1Y8R B;  3ZQC A;  4XMY A;  3BDD A;  1JGG A;  3EET A;  2R0Q C;  5DS9 A;  2O8X A;  3DWL E;  1ZN2 A;  2JMW A;  3U1D A;  4LIT A;  2VB6 A;  1U78 A;  5DM7 F;  2Q8K A;  1D5Y A;  3QU3 A;  2LLK A;  3ECO A;  4FAS D;  1ZQ3 P;  1J75 A;  3W6J B;  1S72 I;  2EZK A;  2EBI A;  4M3D A;  3F8F A;  2XSJ C;  1MJ9 A;  2DT5 A;  2FQ4 A;  3L1P A;  5CQE A;  2LC2 A;  4G9Y A;  4PUS A;  3Q3S A;  4LG3 A;  2VOP A;  1NK2 P;  2R5Y A;  2DK8 A;  2WB1 A;  3CJT B;  2QUF A;  2LMD A;  1FPQ A;  2VKE A;  4OAY A;  2YR2 A;  4JX6 A;  2DA2 A;  2ZKZ A;  1K78 B;  1ON1 A;  2P0W A;  3ESW B;  2DPU A;  1VF9 A;  1ON2 A;  4EM1 A;  2NVQ J;  3SDG A;  2WY8 Q;  1J9I A;  3MEX A;  3ASO H;  4M74 A;  2EZL A;  3I53 A;  5LGU A;  2MLG A;  3HTS B;  4AYB A;  4ZYE A;  3J7Z I;  4MFD A;  4CYD A;  1P2F A;  4AVP A;  3F22 A;  3WTU C;  3FBN B;  1FP2 A;  4CO8 A;  5CLS A;  3RPU D;  2R7T A;  3AG1 H;  1WKM A;  2BOL A;  4BAY A;  5L3E A;  3ZMT A;  3V7C A;  2ELH A;  4GXO A;  4UNO A;  1Z7L A;  4F3Q A;  3N05 A;  4FQG A;  2M3A A;  3G1O A;  1Z9C A;  2YU9 J;  4BXF A;  1T95 A;  4EJO A;  1YO5 C;  5DYM A;  3D1N I;  4A3J J;  5ILU A;  4RB3 C;  3HZJ A;  2LYC A;  4ZC3 A;  1BI1 A;  4S05 A;  1LE8 A;  2R93 J;  1GV2 A;  4Y33 A;  2DMT A;  3BTI A;  5AIP A;  3S93 A;  1R6R A;  1G8X A;  2STW A;  3F23 A;  2HTS A;  1R1V A;  2GOM A;  5E3M A;  3A01 A;  4M3F A;  3HGY A;  4MFE A;  3GYH X;  3JRA A;  3QOE A;  3OR1 C;  2QVO A;  4HX4 A;  4XKC A;  4XK4 A;  3AKZ A;  3PM1 A;  1R4M B;  3CJN A;  4YFK F;  2VIX A;  1EH7 A;  4M73 A;  5H6R A;  5BOX A;  2OD5 A;  2XUB A;  2ACJ A;  2NNN A;  4N4N B;  2F5C A;  2Y69 H;  1MSF C;  2K27 A;  3K4M A;  3M9A A;  2BHZ A;  3S2D J;  1SAX A;  2HU9 A;  2XB5 A;  2QKL B;  1QA6 A;  5EDN A;  1HKS A;  2QQ8 A;  2GQQ A;  3IKV A;  4NB5 A;  4IX7 A;  1S3J A;  3M1C A;  3L2V A;  5EZH A;  5EGO B;  4JOM A;  4EVI A;  3QP5 A;  1IUF A;  3W2A A;  2K9S A;  3IWF A;  2Q2E A;  2DOD A;  2DAO A;  2XRL A;  2X6Y A;  4XN3 A;  1CF7 A;  4L5I A;  3LOC A;  5EEH A;  2CUF A;  1VQ9 I;  3WTT C;  4RGS A;  1AKH B;  2K02 A;  3IC7 A;  1BJA A;  3OMY A;  1KA8 A;  1HKT A;  3HUG B;  5DD4 A;  2RGV A;  2R92 J;  1Z77 A;  4ZDO A;  5B5E C;  2FMY A;  1UZC A;  3HM5 A;  2E2J J;  3WOD F;  4UUT A;  2Y9Z A;  4YII A;  5FFX A;  4AID A;  2KL4 A;  3E97 A;  1SFE A;  5K5R A;  3BZ6 A;  1SD7 A;  2JUC A;  1YHQ I;  3RSN A;  1S9H A;  3WTZ A;  3ABM H;  2IS1 A;  4KFC A;  2IA1 A;  2XVC A;  2A6H F;  2VKD A;  2LD5 A;  4C2M J;  2HKO A;  3QPT A;  1SVO A;  2FA5 A;  2HXI A;  2JJ7 A;  3K6G A;  1KU7 A;  5EEG A;  2BY1 A;  4B47 A;  3RI4 A;  4IHV A;  4KYW A;  1DPU A;  2FRH A;  4A3L J;  2GWR A;  4DZJ A;  4G7H F;  1B8I A;  2K3P A;  1DP3 A;  4CYC B;  4FET A;  3R0J A;  3GVA A;  4LG0 B;  1XN7 A;  3U21 A;  1Z05 A;  4DJA A;  2VBW A;  1RRJ A;  4WWC A;  3B6A A;  1MSE C;  5GAE J;  1BC8 C;  1VZ0 A;  3FHN A;  2DOF A;  1IV8 A;  5FLV A;  4ETS A;  4X0G A;  3SJM A;  2FML A;  1YJN I;  2MH9 A;  3IAM 2;  4NQW B;  2R3S A;  2IXS A;  2VBZ A;  4MIM A;  1OCC H;  2CUJ A;  2DOE A;  3GUD A;  1ETW A;  2FBI A;  4C3J J;  4Y17 A;  3LQR A;  5IYC J;  2LY1 A;  2E1C A;  5GTH C;  3BJA A;  1X1D A;  3EUA A;  1W5T A;  4KIG A;  1MKM A;  3MVP A;  5DM6 F;  3S32 A;  4I7H A;  1GVD A;  3PO3 J;  4HOB A;  2ICW G;  2QYO A;  2XAJ A;  2NVX J;  2NS0 A;  3UKG A;  2WV1 A;  2E5Z A;  2DTZ A;  3HOZ J;  3CCL I;  1YIJ I;  2PX9 A;  2ZXI A;  3FBI B;  3OYL A;  2QSG X;  3P7N A;  2HVQ A;  1PP7 U;  3CLQ A;  5E17 F;  4D9J A;  1WZ2 A;  1F43 A;  2L01 A;  5J47 A;  3TW7 A;  1IDZ A;  1OKR A;  3NAR A;  3QAH A;  3PFY A;  2M0M A;  3G2B A;  1JT6 A;  2VXD A;  4BQQ A;  2EFW A;  3GTG J;  4AIJ A;  3P5J A;  3G6E I;  5LD2 C;  3L09 A;  2O9L A;  2Y0S A;  5E3O A;  1F1Z A;  2OZU A;  1LVK A;  4QTR A;  3L00 A;  4PSX A;  3S15 J;  4E7L A;  3PNT A;  1W0U A;  4KIB A;  2BV6 A;  4RGX A;  4WF2 A;  1M1E B;  1ZR2 A;  3BWG A;  1MDM A;  3JRC A;  1MH3 A;  1YRN A;  5J6X A;  3OY9 A;  1C0W A;  2R7Z J;  2KKO A;  1ZLK A;  3QOP A;  3MD2 A;  1BJZ A;  3S2W A;  1K4S A;  2C6Y A;  1XCB A;  3UNG C;  2JPB A;  3A4C A;  4ENJ A;  1XS9 A;  2HQN A;  3ZPL A;  2A69 F;  2MA3 A;  3C2B A;  4XRS G;  3V8J A;  3ZRG A;  3GLL A;  3KCC A;  1ZRE A;  3X2Q H;  3K69 A;  4FHT A;  1S7O A;  1Z0X A;  3ZMZ A;  4QPO A;  3SZT A;  1MNM C;  1HST A;  1SAU A;  4NDL A;  3KEY A;  2FBK A;  3RIR A;  5ED4 A;  3OWT A;  2Y2Z A;  1LPQ A;  4R8H A;  2QLZ A;  1FEX A;  1TQP A;  1SEU A;  2UXN A;  4Y7N J;  5DCF A;  3OYM A;  4BJ5 C;  1LKX A;  1HDD C;  4Y52 J;  3OYE A;  3S3N A;  2P4W A;  2VJI A;  2VN2 A;  1G3Y A;  2I5U A;  3BR0 A;  4B3A A;  2PI0 A;  2KDZ A;  4KMF A;  5IP9 J;  3KP3 A;  4HRI A;  1YIO A;  1IN5 A;  1ONV A;  2BVL A;  2UXX A;  2VT2 A;  1OQY A;  1DP7 P;  4MEX F;  2K3F A;  1FMV A;  3DEU A;  3J7Y J;  3FMQ A;  3T8T A;  2KRH A;  3FXM A;  5F1J A;  2CFX A;  1FOX A;  4XOT A;  1D0X A;  2VLA A;  1IXC A;  4HX7 A;  4D7M A;  4I76 A;  3CCY A;  1Y1V J;  4MEY F;  2P6S A;  2EIJ H;  3KPH A;  5J3L A;  1WJB A;  5FRM A;  3L2Q A;  4I09 A;  2K86 A;  2ZFW A;  3BTC A;  3CMM A;  3L2R A;  1X4O A;  2YX4 A;  5A2Q Z;  2PJR B;  2JA7 J;  3IAS 2;  3GBG A;  2VQL A;  3VOD A;  1TT5 B;  4B1R A;  3I55 I;  4M3B A;  2HTJ A;  3CDL A;  4JP0 A;  1B6A A;  3FDY A;  3HOX J;  2VQC A;  3TOB A;  4MGR A;  1QNT A;  5J1U A;  1XG1 A;  3E6D A;  2CJJ A;  1ZTR A;  1J59 A;  2ESN A;  2W24 A;  3DP7 A;  4ENN A;  4MHG A;  2BGC A;  4HYE A;  2Q0O A;  3H0G J;  4J00 A;  1MBF A;  1TWA J;  4A0Y A;  5LEK A;  3LSM A;  2LKS A;  1MMN A;  1WGX A;  1YE9 A;  2ZME C;  4LJZ F;  2R7F A;  1SFU A;  1D8J A;  2Z3Y A;  4GO1 A;  3CC2 I;  3S1M J;  1O3T A;  1LDK B;  1I3Q J;  4PGH A;  2K7L A;  1T98 A;  1IO2 A;  3FMR A;  1QO0 D;  3OYC A;  2A68 F;  2L4A A;  1UMQ A;  1S5L C;  2JSP A;  2HYJ A;  3O8H A;  4WXC A;  2MBF A;  5TRD A;  5H6Q A;  5D5U B;  3SHF A;  2XAS A;  3FZV A;  4EEF G;  2RNG A;  2QZ8 A;  4OMZ A;  2BE5 F;  1QHH D;  3IH3 A;  4CCK A;  1MJA A;  4BHB A;  2FD5 A;  1U8B A;  4AWX B;  2KQR A;  5EG0 A;  4IL6 C;  2IS2 A;  1I6H J;  2ZBK A;  1PVE A;  2BHY A;  4Y4R A;  5J8F A;  5K7H A;  5A2Q K;  1SD4 A;  4FCY A;  2MC4 A;  2N8G A;  4N9H A;  2F6C A;  1OYY A;  4U7B A;  4IJA A;  3JRG A;  1O4X A;  2RNJ A;  2DJN A;  3IKT A;  2DA4 A;  1YS7 A;  3TKY A;  4A93 J;  4I98 B;  3MKY B;  2XRN A;  1I27 A;  1R9T J;  2OZ6 A;  1YI2 I;  4QPQ A;  1PUF A;  5D4R A;  1D0Z A;  3SDB A;  1U3E M;  1QBJ A;  4IRI A;  5E3L A;  1W7P A;  4RAF A;  2JN6 A;  3ABK H;  3ZR8 X;  3HC7 A;  3HRT A;  1E3H A;  2H94 A;  2OJE D;  3GF2 A;  2G7U A;  4G6Q A;  4B48 A;  1JKR C;  4GFB A;  4JQF A;  5LEJ A;  3G4S I;  2R7R A;  2AHQ A;  4OIR F;  3QYF A;  4ZTF A;  1W36 D;  3F3X A;  2VE9 A;  2MLK A;  4XIC A;  2RN7 A;  3I59 B;  1YIT I;  4U0W A;  1ZH5 A;  1MW7 A;  3ML6 A;  3OIP A;  2OQR A;  4EV0 A;  1BR1 A;  3RKY A;  1B72 A;  3WU2 C;  4D0P A;  3EYY A;  5M5W J;  3K4N A;  3F6V A;  3JRB A;  2W4S A;  2ZNY A;  2WAF A;  3ZN0 A;  3I54 A;  3TP3 A;  3H9J A;  4QIW N;  3C3W A;  4XNF A;  2ZXJ A;  4PJM A;  2JA6 J;  3HL2 A;  4PSW A;  1UHW A;  2JVG A;  2M2E A;  3GTP J;  1I3A A;  5DUK A;  2IP2 A;  3DKW A;  3CUO A;  4EAT A;  3JSO A;  3CCU I;  5AON A;  2KZV A;  2DU9 A;  2X6X A;  1E2X A;  2DFF A;  1VQ6 I;  1HW2 A;  1WSU A;  2MYS A;  3WTV C;  3O2P E;  1Z3X A;  3LSK A;  1EA3 A;  2R7X A;  1H89 C;  3BTL A;  1Z1D A;  1RUN A;  1JI8 A;  2LFB A;  4RBO A;  1ZEL A;  1RC9 A;  2R7U A;  4L0Z B;  2J5O A;  4PJ0 C;  1XTA A;  3LAP A;  4GDF A;  3ZQ7 A;  4XLF A;  3ISP A;  3LWF A;  1ENH A;  4RB0 A;  1X3W B;  4UVB A;  5JVT A;  2BW3 A;  2IRF G;  5IYD J;  3AG2 H;  2PN6 A;  2E1M B;  1TNT A;  4U7D A;  1JTY A;  3H3Z A;  2KIQ A;  2R5Z B;  4HQE A;  4PGG A;  3LST A;  2BVM A;  3W6K B;  1HW5 A;  4IOA F;  2X6O A;  2QKM B;  3PQK A;  4EJV A;  1R5H A;  3ZN1 A;  3SXY A;  5TJJ A;  2KJB A;  3OYI A;  1BC7 C;  4UB8 C;  1OJL A;  3GO5 A;  1QGP A;  1VQO I;  2VBX A;  4CXF A;  4CIC A;  2MGQ A;  1OFC X;  1KQ9 A;  1MH4 A;  4OAZ A;  3CP2 A;  4YEL A;  4R79 A;  1EH8 A;  4C2U A;  2VJ4 A;  2JRT A;  2UUZ A;  3H5A A;  2EZI A;  1GXP A;  1FC3 A;  1YS6 A;  2HI3 A;  4BQO A;  3SEQ A;  4IF4 A;  4KIC A;  4UUS A;  2EV5 A;  3F8N A;  4HAM A;  1FX7 A;  3KLN A;  1B9M A;  3OL3 A;  3PNV A;  4XOR A;  4C3I J;  3MWM A;  3L7W A;  4A2U A;  4LK1 F;  1EV7 A;  1FSE A;  1WHU A;  3DBL B;  4K2E A;  4U88 A;  3RZD J;  1VQ7 I;  4I2O A;  4LB6 B;  2BXY A;  4MLO A;  2EIN H;  3B6C A;  4M9S A;  5GP9 A;  3V7R A;  3U2R A;  5HLG A;  1POG A;  2P6T A;  1FIA A;  1NTC A;  1CQT A;  2R7D A;  4CUG A;  1R7J A;  4Q4Z F;  3T0Y A;  3WHB A;  1W5C C;  2OTL I;  4D7N A;  3BQZ A;  3E5X A;  3BRO A;  2DN0 A;  1PP8 F;  2L0K A;  3FXU A;  1A6Q A;  4BXX J;  4XKW A;  1WH5 A;  3HBL A;  4OWR B;  5ILS A;  1KZH A;  4DGW B;  4BDY A;  1F4K A;  3I9V 2;  4F55 A;  5BS6 A;  2XPW A;  5M5Y J;  2G9W A;  3CF5 F;  1LFU P;  4IHX A;  4G7Z F;  2H1K A;  3HTU A;  1FTT A;  2D2W A;  2ZJR F;  1K78 A;  2FU4 A;  3CUQ C;  2V1N A;  4F93 B;  1JHH A;  3KYD B;  2KDO A;  1XCV A;  2HDD A;  4F91 B;  3J80 K;  1OIS A;  4XBF A;  2QBY B;  2L7F P;  2VON A;  1V5E A;  4IQ4 A;  3M8F A;  3BZK A;  2FNP A;  4M9Z A;  2L9R A;  1G3T A;  5FLX K;  1S8N A;  1LB2 A;  4BNC A;  3TMO A;  3M3Y J;  1Y56 A;  1R58 A;  3BR3 A;  4RGR A;  2LRD A;  1UFM A;  3E5Q A;  1K4T A;  4A3B J;  1HF0 A;  1WJF A;  2DJI A;  1DPR A;  5E79 C;  3M07 A;  1REP C;  2DFE A;  3C2G A;  1Z3Y A;  2YPR A;  2FBH A;  2P5V A;  4ZYD A;  1WVR A;  3FKI J;  5FKL A;  3CMY A;  4KT5 C;  2VPR A;  3FXL A;  3FIS A;  2DMQ A;  4BDZ A;  1UST A;  2MFZ A;  3B73 A;  3PUB A;  3TED A;  1SVL A;  3NAU A;  1OYI A;  2HEO A;  2DMP A;  2DI3 A;  4ESF A;  4HST A;  4XLH A;  1W1W E;  3S1R J;  2FEZ A;  3V7S A;  1IZ1 A;  4HBL A;  5IT3 A;  2ZJP F;  4E7J A;  1X3Z B;  3F8C A;  1I6X A;  1KU9 A;  4UHT A;  3ZMV A;  3LSR A;  2QA4 I;  3ZOB A;  2AO9 A;  3H3V K;  2ZSH B;  4KIT B;  4ZTJ A;  2L7Z A;  2OPT A;  2VE8 A;  1VQ8 I;  4BY1 J;  3KP5 A;  2VL8 A;  4GRI A;  5L3D A;  4CH7 A;  1OLT A;  4RAY A;  2L9S A;  4CCO A;  1JKQ C;  2E5N A;  3GWZ A;  4P55 A;  1USS A;  5LBQ A;  4RA2 A;  1FWZ A;  2FXA A;  2Y48 A;  1IRG A;  3K4J A;  3K10 A;  3VYS B;  1FBQ A;  1NHA A;  2E36 A;  3U1K A;  4A3K J;  1BI0 A;  1O3R A;  2A3S A;  2NOG A;  4JBA A;  2XAF A;  2DTR A;  3K1M A;  4ZYH A;  3KP2 A;  1VTN C;  2V9K A;  3KEO A;  1AU7 A;  3QYE A;  3FHZ A;  3CF2 A;  3Q0W A;  5HNF A;  2E19 A;  5EZG A;  1HOM A;  3R4K A;  2EA4 A;  3DBH B;  4E7K A;  1IW7 F;  2LBF A;  3DXJ F;  2R7O A;  3PJR A;  1EH6 A;  4A0X A;  2R5Y B;  1MZB A;  5C3E J;  2OC6 A;  3HUG A;  3K70 D;  4BXU A;  2IGK A;  4RS8 A;  3H36 A;  2DQL A;  4ZYG A;  5IOY A;  5D8K B;  3DPU A;  5TIS C;  1WJE A;  1LNW A;  4BHC A;  3EUH A;  4PZJ A;  5CQG A;  2M7B A;  3VDX A;  2H27 A;  2DYR H;  5ICF A;  5ICC A;  1QPM A;  1H9G A;  2HZD A;  3A03 A;  3D5S C;  3NWS A;  1LUJ B;  3KLO A;  4L9T A;  4BS9 A;  4NC6 A;  4MTD A;  1IRF A;  2D45 A;  2E1O A;  2F48 A;  2E1N A;  2CH0 A;  4HF2 A;  3DTK A;  2H09 A;  2K9M A;  5HS7 A;  2BXZ A;  1YJW I;  1U9O A;  4FE7 A;  4GCV A;  4YFX F;  1F9N A;  3LMM A;  4XLE A;  2TRT A;  3ABL H;  1GVJ A;  3K7A J;  4LG0 A;  1J0R A;  3I3L A;  4FIS A;  1IN7 A;  1JTX A;  3Q0U A;  1VQ4 I;  2DMN A;  4B43 A;  1V54 H;  3OYD A;  2L02 A;  3DKY A;  3HRS A;  3RCO A;  4D1Q A;  1Z21 A;  3IV5 A;  1W0T A;  1RR7 A;  4A3G J;  1UEL B;  3E6B A;  4V2F A;  1LVA A;  2X9D A;  4BBS J;  2MW8 A;  3BR1 A;  2RQP A;  2ZB9 A;  3SQN A;  3A01 B;  2GIV A;  2IPQ X;  4NQW A;  3A0B C;  3TQN A;  5E3N A;  4U0Y A;  4BQN A;  1K79 A;  3BJO A;  1QZE A;  4KNY A;  1U0J A;  5J4Y A;  3PIP F;  2X4H A;  3JRH A;  1JXS A;  4XOP A;  3WG7 H;  1UHS A;  3PQJ A;  2CQ7 A;  4LLL A;  4UY8 I;  4HPQ A;  4CGZ A;  1PDN C;  2IJL A;  3I71 A;  4BJT A;  1TZL A;  2IT0 A;  1SFX A;  1AOY A;  5EEA A;  2KHM A;  4HQM A;  4U87 A;  5DV5 A;  2D1V A;  3OYB A;  1IXR C;  4P9U A;  1QQI A;  2W85 A;  3S3O A;  2HFH A;  2V4J C;  1ZGW A;  2HVS A;  3FXR A;  4E7S A;  3LA7 A;  3WU0 A;  5B3S H;  2IAI A;  2IGO A;  1HDP A;  1WWX A;  1Y8Q B;  5C4X J;  2OBP A;  4BU2 A;  2ZFU A;  3EUH C;  3N97 A;  2Y30 A;  1CF7 B;  3PL8 A;  3MAJ A;  3FX3 A;  3JAM K;  3K1P A;  2XB0 X;  2M45 A;  1R4N B;  3MMY B;  1ODD A;  1GUU A;  2Z5U A;  1KU2 A;  1YW8 A;  5H20 A;  1WQ2 A;  2ID3 A;  3A0H C;  4AC0 A;  1ETY A;  5LRS A;  4BEH B;  3WGI A;  1JUS A;  2YSR A;  1RIO H;  2F2E A;  1O57 A;  1T08 B;  1JKO C;  3JRF A;  2KIM A;  2AQF A;  1S29 A;  4R1H A;  1ZAO A;  4HZF A;  1GDT A;  2W00 A;  1K7A A;  4YEJ A;  1JUP A;  4HV6 A;  1I50 J;  1LDJ A;  2A6T A;  2LRE A;  3ELK A;  3HPH A;  2PMZ N;  3OR2 C;  3VYT B;  1T2K A;  2CV0 A;  2Y31 A;  4AD9 A;  3BLY A;  3IP4 B;  3WTY C;  2L9N A;  2XAU A;  5JR3 A;  2WY7 Q;  3TO6 A;  3CZ6 A;  4O5V A;  4OU0 A;  2V1X A;  1R1U A;  5BNG A;  4M6X A;  3I58 A;  2NAZ A;  5B1B H;  3CCV I;  2DT6 A;  1SAN A;  1RKT A;  4A3D J;  4TV7 A;  4RAG A;  1IF1 A;  4IHW A;  1H8A C;  3AG3 H;  4FX4 A;  1BIA A;  3VWB A;  1MND A;  2COM A;  2KT0 A;  3QWL A;  1OPC A;  3DTI A;  3R60 A;  2EFN A;  1SFK A;  3BQY A;  4KJZ A;  3JRD A;  3QYB A;  1YW9 A;  2EPF A;  1DDN A;  2DA3 A;  3RPQ A;  5HDK A;  5CVU A;  4PJL A;  1S7A A;  5E20 A;  4CCL A;  2F5V A;  3H1C A;  4WX9 A;  5KNL A;  3OIQ A;  5HLI A;  4N4O B;  3FKJ A;  3PSF A;  5CVJ A;  3GTL J;  3GTQ J;  1G59 A;  1DGR M;  5CYV A;  1VQ5 I;  4CZC A;  5JI6 A;  4Z2Y A;  3DV8 A;  3KFW X;  1MBJ A;  4Z6Y A;  2IBD A;  3EDP A;  4EMS A;  1RUO A;  3OS0 A;  4LLN A;  1IRZ A;  3DEE A;  2DQR A;  4EQQ A;  3OIO A;  4ITV A;  1P4X A;  3Q9V A;  3BTJ A;  2ZME A;  2HR3 A;  3E7L A;  2X48 A;  1P9Q C;  4BJ6 C;  2A5Y B;  3WE2 A;  3RJP A;  4XL9 A;  2LK2 A;  1E0E A;  3M8E A;  1DGW Y;  4OIN F;  4DW6 A;  3KZY A;  2PFB A;  3HOU J;  2J5P A;  2FF4 A;  1QZY A;  4OOI A;  4PJN A;  3GFJ A;  2DA6 A;  1W36 C;  2V9P A;  5F0H A;  4G8X A;  1W5S A;  3K4L A;  3BG9 A;  3DLL F;  3GFM A;  4HDU A;  2PJR A;  4DBQ A;  3VB2 A;  2CMP A;  2VAS A;  3P9K A;  1ETK A;  3S2H J;  5F6F A;  2BY0 A;  3ZXS A;  1P7J A;  3FMS A;  1B1B A;  1VQP I;  5LHG A;  4RB2 C;  2M8E A;  5DUI A;  2FSW A;  2G7H A;  2IA2 A;  1FNN A;  3J81 K;  1KYW A;  4CDG A;  4D5F A;  1FBS A;  4U0V A;  4V2G A;  3V8L A;  2AQE A;  5IYB J;  3OYG A;  1BL0 A;  2HXO A;  1JJ6 C;  5F0F A;  3FXQ A;  3HSE A;  3S1N J;  3F6O A;  1YQA A;  4IHY A;  1TBX A;  2CQK A;  2HOS A;  3BCA A;  3R61 A;  4A69 C;  5K1Y A;  5HDG A;  3RTR A;  4AIK A;  2W1O A;  2MD5 A;  1WJD A;  2I10 A;  4W97 A;  3IH2 A;  5KHD A;  1XD7 A;  3F8M A;  2ETH A;  2NXN B;  1D1C A;  2KIF A;  2RKH A;  3HYI A;  4JYK A;  1GLN A;  2XV4 S;  4E4H A;  4RM3 A;  3Q5F A;  3V4G A;  3FK7 A;  2B63 J;  2K85 A;  3HHG A;  2H8W A;  1K6Y A;  5F0C A;  3CCR I;  4Q48 A;  5LFA A;  2V7F A;  1H88 C;  4UUV A;  3DU6 A;  2RC4 A;  2V79 A;  1FIP A;  1J5Y A;  2A05 A;  4J19 A;  3RKQ A;  2DXI A;  4HW0 A;  1WCM J;  2QSH X;  3HIF A;  2IS6 A;  1Y6I A;  1U8R A;  4IRH A;  1G4D A;  1LDD A;  2PMZ A;  3C2H A;  3LA3 A;  3A2K A;  2VC1 A;  4S0H B;  4KIF A;  1K83 J;  1RR8 C;  2KLO A;  2E35 A;  3T8R A;  1IG7 A;  5JHU A;  2F5E A;  2ELJ A;  2DCE A;  2OAZ A;  4DYQ A;  1JKP C;  2W84 A;  1FYK A;  3VFZ A;  2F4I A;  3CTA A;  4EJW A;  1O7F A;  4A3M J;  2PQ8 A;  3CO6 C;  5J1Y A;  5HLT A;  2P7V B;  4L9N A;  4XLA A;  5BQT A;  4I0A A;  3UR3 C;  4O3M A;  2EIM H;  2NYX A;  1FJL A;  3PUF A;  1ZYR F;  2EWN A;  2JQ7 A;  1OCO H;  3IRR A;  1DU6 A;  1N25 A;  2HOE A;  4NNJ A;  3I59 A;  3O3K A;  2STT A;  3PNY A;  2XGE A;  1ERD A;  2DBB A;  4UV8 A;  5K5O A;  3ZMS A;  3GME A;  3HG9 A;  2NNY A;  1PYV A;  4UXN A;  1XPX A;  3LAJ A;  2PJP A;  1SVM A;  3HOT A;  2XF6 A;  3HPG A;  4G6T B;  5J40 A;  1O7L A;  3LQQ A;  4A6D A;  1P4W A;  5DEQ A;  2CO5 A;  5E1Z B;  4EGZ A;  1W4M A;  4H4K C;  2IW5 A;  2DDB A;  2X1E A;  2KZG A;  5EF6 A;  4CZZ A;  3F9K A;  5IT9 K;  4M9X A;  1LFP A;  2GA2 A;  4A3E J;  1WJA A;  3ONQ A;  3S17 J;  2DFI A;  2LG4 A;  5FGM A;  2GXB A;  4HLY A;  2W82 A;  3WTX C;  1Z67 A;  2GBY A;  5DD8 A;  1FP1 D;  1HW1 A;  3RPU A;  1MIJ A;  3GCM A;  2M1B A;  1Y39 A;  4ZYA A;  3W6V A;  3DF8 A;  3HOV J;  1VQK I;  4A0Z A;  2NVY J;  1ZRC A;  3FXK A;  3ZGK A;  2F5F A;  3PIO F;  3CP8 A;  3E6C C;  4H0E A;  4O6J A;  5CVV A;  1H9T A;  3VOE A;  4KT6 A;  4S04 A;  4LLG F;  3LA2 A;  4XLP F;  2P5L C;  2DDA A;  1IDY A;  4LIV A;  1IN4 A;  1VND A;  3WGG A;  3CCQ I;  2JA5 J;  2CUE A;  2VJ5 A;  4JX5 A;  3OYF A;  2XF5 A;  2LR8 A;  4IKF A;  2VC0 A;  3GFI A;  3V8K A;  1MMG A;  3KP4 A;  5DCM A;  4E7Z A;  3JR9 A;  1FOW A;  1NH3 A;  4AVZ A;  4GYG A;  2CW7 A;  1YTY A;  1TWF J;  2B9S A;  1FBU A;  1MMS A;  5IPA A;  1TL8 A;  4QLC U;  1HA8 A;  2DLL A;  4I6Z A;  3OOU A;  2GA1 A;  3O8G A;  1KQ0 A;  5IY5 H;  1X3U A;  2WA0 A;  4G7O F;  5JFR A;  5LHI A;  2AXT C;  1PUF B;  2EA2 A;  1NG7 A;  1XMA A;  3SYT A;  1W7P B;  4CA0 A;  5HVQ C;  3E3V A;  1JUM A;  3W2V A;  4XSX F;  3HOW J;  2E7W A;  4RLQ A;  3AFH A;  1E3P A;  5FJ8 J;  1KYZ A;  1FYL A;  4E7I A;  3RYR A;  3GZ5 A;  4BE0 A;  2ZSI B;  3KX2 A;  2WB1 N;  4CSW A;  1STZ A;  2EV6 A;  3BG7 A;  1YX3 A;  4A6E A;  4AIH A;  3CJQ B;  5GAG J;  3CUQ A;  3CD6 I;  1JT0 A;  3H3U A;  1MGT A;  3LNQ A;  1HBX G;  2NS8 A;  1T33 A;  1K6O A;  5KCM A;  1UAA A;  2WBM A;  4HDV A;  1BR2 A;  2I8D A;  3FXO A;  1R71 A;  1U5T B;  2HDC A;  3JTH A;  2VBY A;  2CQQ A;  2M5W A;  1XMK A;  3HSR A;  4B8X A;  2A6E F;  2BZT A;  4E70 A;  5LLQ A;  1V5G A;  4J01 A;  2EK5 A;  1UG2 A;  5FKN A;  2V6E A;  4HNU A;  5KK1 A;  3V42 A;  2X6W A;  5D5V B;  1Z6R A;  5E1W A;  2HPM A;  4LD5 A;  3J80 Z;  4P9F A;  2Z9O A;  2IGN A;  2E71 A;  2KRF A;  3CDH A;  5CVI A;  1LEB A;  3H9G A;  1J09 A;  2W25 A;  4BL0 B;  5DDG A;  4OMY A;  2XF7 A;  5FLX Z;  1Y1W J;  2E1M C;  1BI2 A;  3CJR B;  3AL0 B;  1XGS A;  4LB5 A;  1FLI A;  3P9I A;  4A3I J;  1Z91 A;  3DPT A;  3BT9 A;  3Q0V A;  5GPA A;  1ZKG A;  4YG2 F;  5K7Z A;  2HNH A;  1Q1H A;  4RDU A;  5D5W B;  3A1Y A;  4B3X A;  5F08 A;  2QBY A;  3TP0 A;  2BW3 B;  4LK0 F;  1WJC A;  1AHD P;  4YIR X;  4L0Y B;  2A07 F;  2VKV A;  2DOA A;  4II2 A;  1WJ5 A;  2UZK A;  4L18 B;  4L5J A;  2JK3 A;  3IHU A;  2DFH A;  2ECB A;  1FTZ A;  2IA0 A;  5GTI C;  3S16 J;  4ZH4 F;  2EQR A;  2QM3 A;  4ESJ A;  4HX8 A;  2VPL A;  1KGS A;  2IGM A;  1N77 A;  1GXQ A;  2XAH A;  1R5I D;  3K2A A;  2B0L A;  2VUM J;  4L9V A;  5LGT A;  3LSJ A;  3QQA A;  1HXD A;  5D4S A;  3FIW A;  3CDI A; 
#chains in the Genus database with same CATH homology
 4A12 A;  1ZGJ A;  2ZCW A;  5CJ9 A;  1I1S A;  2O3F A;  5BMZ A;  1XDU A;  4MTE A;  5ICG A;  5D8L B;  3KZZ A;  3HOS A;  3NRV A;  3TOA A;  2XHK A;  3ERE D;  4IHS A;  1GHC A;  1QZZ A;  2E7X A;  3VEP A;  1L3L A;  3BPX A;  4BQA A;  2PMH A;  3AAF A;  1HSJ A;  1WRJ A;  2QQB A;  4MQV A;  3FM3 A;  4OIP F;  5FD5 A;  1Y0U A;  1I1G A;  1F5T A;  1BBY A;  1TW3 A;  4I0B A;  3PFI A;  3IRQ A;  1R22 A;  3JSP A;  3HRM A;  3BJ6 A;  1IUY A;  3BPV A;  2O0Y A;  1O3S A;  2V1U A;  1W7P D;  2JT1 A;  3DQV C;  3FM5 A;  2F5D A;  2OU2 A;  1T38 A;  2LSO A;  2Z99 A;  4IVN A;  1XGO A;  1TQM A;  2NRA C;  4PDK A;  1B59 A;  1UB9 A;  1IAW A;  2Y0M A;  2ZO4 A;  3RDI A;  2FE3 A;  5AIQ A;  1FYM A;  4WK8 F;  4CHU A;  3CO7 C;  2VOO A;  1ULY A;  6PAX A;  4IRG A;  4IXA A;  2M87 A;  2HQR A;  2DPD A;  2HYF A;  1V3F A;  5FFZ A;  1BM9 A;  2LKP A;  3WG9 A;  5E8I A;  2BYV E;  2XAG A;  5HLH A;  2WC2 A;  2VXZ A;  5CVR A;  3JAM Z;  1TTY A;  1U2W A;  3GLX A;  3WTS C;  3WE3 A;  4MQ9 F;  1RNL A;  1S6L A;  1XDS A;  4EM0 B;  3G3Z A;  4EGY A;  4M6Y A;  2LF7 A;  2MH2 A;  4XSZ F;  1SMT A;  3E5U A;  1ZHF A;  2WWY A;  3D5L A;  2XIG A;  3REO A;  1TNS A;  4Y15 A;  2FQ3 A;  2CSO A;  1O3Q A;  2BBY A;  5ICE A;  1SMY F;  3I0T A;  4G6D A;  1SD6 A;  3C18 A;  2OA4 A;  2CYY A;  2ZNZ A;  3MQ0 A;  2XGX A;  2BEO A;  1HQC A;  5L3B A;  3KP6 A;  2EJR A;  4KUM A;  2EFQ A;  4A5M A;  3F72 A;  1V4R A;  1ZGA A;  2HS5 A;  3RKX A;  5D5X B;  4BH9 A;  4N0B A;  2V1D A;  4Q47 A;  3COA C;  1I5Z A;  3TO9 A;  2K4B A;  1MD0 A;  3M1E A;  3O6B B;  2K4J A;  2FNA A;  4DQ2 A;  4ZZL A;  3K0L A;  3DPL C;  2V9V A;  1BI3 A;  2O61 A;  1T0F A;  3MZY A;  1BOA A;  3ULQ B;  1R1T A;  3KEQ A;  2DW4 A;  1YW7 A;  3HSF A;  1P4A A;  3DFG A;  4EJT A;  4NHJ A;  2QQA A;  3BP8 A;  5L3F A;  3FF5 A;  3P9C A;  5FB2 A;  3TGN A;  3SFZ A;  5D6F A;  2AXL A;  3K2Z A;  1LQ1 A;  1AWC A;  2CGP A;  3J81 Z;  1ZG5 A;  1ZLJ A;  2KIU A;  2RDP A;  5HOO A;  2PEX A;  3GX4 X;  5L3G A;  1KQ8 A;  1IXS B;  3ZP5 A;  1Z7U A;  4HV5 A;  4Y13 A;  5BPD A;  1BN5 A;  4UVA A;  5HS8 A;  3J7A O;  3U9G A;  3K1N A;  4HA8 A;  1IN6 A;  2OQG A;  2H6C A;  5LGN A;  1XSD A;  1FZP B;  2LNB A;  1R5G A;  2PBI A;  3ECH A;  4ESB A;  3L9F A;  1R00 A;  4ASN A;  2X0L A;  1OMI A;  3GW2 A;  5E18 F;  3ABU A;  4FT8 A;  3D0S A;  2EFP A;  1P92 A;  3ROU A;  3SZP A;  1OYW A;  5J8C A;  3QP6 A;  4KDP A;  3GZ6 A;  3MFK A;  2RV8 A;  2YX7 A;  5FD6 A;  4RB1 A;  3K9T A;  1LJ9 A;  3NQO A;  2XKP A;  4A5N A;  3E6M A;  5BPI A;  1YYV A;  1XSX A;  2HYG D;  3MCZ A;  1J2X A;  4I02 A;  1MDM B;  1B4A A;  2HKX A;  1FY7 A;  3N4M A;  3C7J A;  1FT9 A;  1TLH B;  3QU6 A;  4LFU A;  5LHH A;  3BY6 A;  1MJB A;  1G6N A;  3ZMU A;  1HKQ A;  2LDU A;  4B09 A;  5LRR A;  1T39 A;  2ZME B;  4PCQ A;  4ENK A;  1CGP A;  4MNU A;  1ZRF A;  1XB4 A;  4ZZD A;  4XRF A;  3I4P A;  2ADU A;  4EJU A;  5IT9 Z;  2EFO A;  2ISY A;  3F8B A;  4HLX A;  1UCR A;  3HRU A;  4KMU X;  2V6C A;  2WV0 A;  3LFK A;  2UWM A;  1D3Y A;  2CWE A;  2H6B A;  3OV8 A;  4WXD A;  4KN4 X;  1G3W A;  2LF8 A;  4N9I A;  2PG4 A;  4P96 A;  4ON0 A;  1OR7 A;  4LMY A;  2P5K A;  4JK1 X;  4RGU A;  2CW0 F;  4LGW A;  1JGS A;  3JTG A;  4BHP A;  2XRO A;  1JHF A;  1WI9 A;  1YG2 A;  1RZ4 A;  4HF0 A;  2CG4 A;  4WXH A;  2A61 A;  3EQL F;  1BIB A;  2L54 A;  3WTW C;  2GAU A;  4WCG A;  4HF1 A;  4P5O A;  2ISZ A;  1IN8 A;  2JPC A;  3KP7 A;  3WGH A;  3GEZ A;  2XAQ A;  3OOP A;  2W57 A;  1G3S A;  1R23 A;  3EYI A;  2GZW A;  1J7K A;  1T6S A;  3MZH A;  1D5V A;  4XLN F;  4FX0 A;  2O03 A;  3TDU C;  1D8K A;  2FOK A;  3CLO A;  3R0A A;  4QWQ A;  3T1B A;  2QQ9 A;  2VT3 A;  2JSC A;  2M30 A;  3NEU A;  4YFN F;  1A04 A;  3Q9S A;  4KN7 X;  1XSV A;  5D6E A;  4OIQ F;  3G73 A;  2D1H A;  5F1R A;  1U5T A;  4KA4 A;  2P7C B;  2P8T A;  1R36 A;  1TQI A;  3H92 A;  4BYY A;  2HWV A;  1FOK A;  1FSH A;  1ZG1 A;  3IWZ A;  2EB7 A;  2HZT A;  5L3C A;  3L2C A;  1YFH A;  5FO5 A;  4DNC A;  1RI7 A;  2AS5 F;  1H0M A;  4RAZ A;  1JE8 A;  1SD5 A;  3T5X A;  1ZAR A;  4UV9 A;  2TDX A;  1E17 A;  2PMU A;  4IHT A;  1ZG3 A;  2O6G E;  1ZRD A;  2DK5 A;  3JW4 A;  1Z6T A;  2YU3 A;  3RKW A;  4I01 A;  2PLY A;  5DCM B;  2ZJ2 A;  1KU3 A;  1YLF A;  3WU1 B;  1U6G A;  3KE2 A;  4G94 A;  4ENM A;  1P6R A;  5HS9 A;  1XGN A;  4F7Z A;  5ERI A;  3TO7 A;  5ILV A;  5E8G A;  5F64 A;  3R6S A;  2EV0 A;  4YIF A;  2Z33 A;  4M71 A;  4GGG A;  5HDN A;  3C1D A;  2QWW A;  1L0O C;  3BOQ A;  1U5T C;  3I64 A;  1B9N A;  4EM2 A;  3QRF F;  3HHH A;  3CUQ B;  1PUE E;  2RVC A;  3TDZ C;  4UVC A;  2GXG A;  5E1X A;  3IL2 A;  1XGM A;  4IPA A;  2XKO A;  2IVM A;  3GXO A;  2DO7 A;  1DUX C;  3QPH A;  3F21 A;  4M72 A;  4Q5S F;  3KET A;  1LEA A;  2ESH A;  2JZY A;  4OIO F;  2KJC A;  3B02 A;  1TW2 A;  3ABT A;  2QEN A;  2VOD A;  2WTE A;  2L4M A;  5K5Q A;  2Y75 A;  2JTV A;  3ZMD A;  2HGC A;  4L9J A;  3FWE A;  5KVR A;  1UHM A;  2L3D A;  2MC3 A;  3M7G A;  3GFL A;  3RYP A;  3I5U A;  4GYI A;  3BDD A;  3EET A;  2O8X A;  1ZN2 A;  3U1D A;  1U78 A;  2Q8K A;  3QU3 A;  3ECO A;  1J75 A;  3W6J B;  3F8F A;  1MJ9 A;  2DT5 A;  4G9Y A;  2VOP A;  2DK8 A;  2QUF A;  1FPQ A;  2YR2 A;  2ZKZ A;  1K78 B;  1ON1 A;  2DPU A;  1ON2 A;  4EM1 A;  1J9I A;  3MEX A;  4M74 A;  3I53 A;  5LGU A;  2MLG A;  3HTS B;  4ZYE A;  4CYD A;  1P2F A;  4AVP A;  3F22 A;  3WTU C;  4CO8 A;  1FP2 A;  5CLS A;  1WKM A;  4BAY A;  5L3E A;  3ZMT A;  3V7C A;  2ELH A;  4GXO A;  4UNO A;  1Z9C A;  4EJO A;  1YO5 C;  5DYM A;  5ILU A;  4RB3 C;  1BI1 A;  4S05 A;  5AIP A;  2STW A;  3F23 A;  2HTS A;  1R1V A;  3GYH X;  2QVO A;  4HX4 A;  4YFK F;  3CJN A;  1EH7 A;  4M73 A;  5H6R A;  5BOX A;  2OD5 A;  2XUB A;  2ACJ A;  2NNN A;  2F5C A;  2K27 A;  3M9A A;  1SAX A;  1HKS A;  2GQQ A;  3IKV A;  4NB5 A;  1S3J A;  4EVI A;  3QP5 A;  3IWF A;  2Q2E A;  2DAO A;  1CF7 A;  4L5I A;  5EEH A;  3WTT C;  4RGS A;  2K02 A;  3IC7 A;  1BJA A;  1KA8 A;  1HKT A;  5DD4 A;  2RGV A;  2FMY A;  3WOD F;  4YII A;  5FFX A;  3E97 A;  1SFE A;  5K5R A;  3BZ6 A;  1SD7 A;  3WTZ A;  4KFC A;  2IA1 A;  2XVC A;  2A6H F;  2HKO A;  3QPT A;  2FA5 A;  1KU7 A;  5EEG A;  3RI4 A;  1DPU A;  4KYW A;  2FRH A;  2GWR A;  4G7H F;  3R0J A;  3GVA A;  4LG0 B;  1XN7 A;  1Z05 A;  2VBW A;  4WWC A;  1BC8 C;  4ETS A;  2FML A;  2MH9 A;  2R3S A;  2VBZ A;  3GUD A;  2FBI A;  4Y17 A;  3LQR A;  2E1C A;  3BJA A;  1W5T A;  4KIG A;  1MKM A;  4I7H A;  4HOB A;  2QYO A;  2XAJ A;  2NS0 A;  3P7N A;  1PP7 U;  5E17 F;  2L01 A;  1OKR A;  3QAH A;  2EFW A;  4AIJ A;  3L09 A;  1F1Z A;  2OZU A;  3L00 A;  4KIB A;  2BV6 A;  4RGX A;  4WF2 A;  1MDM A;  3BWG A;  5J6X A;  1C0W A;  2KKO A;  1ZLK A;  3QOP A;  3S2W A;  2C6Y A;  1XCB A;  2JPB A;  4ENJ A;  2HQN A;  3ZPL A;  2A69 F;  2MA3 A;  3V8J A;  1ZRE A;  3KCC A;  3K69 A;  4FHT A;  1S7O A;  3ZMZ A;  3SZT A;  1HST A;  2FBK A;  3RIR A;  5ED4 A;  4R8H A;  2QLZ A;  1TQP A;  2UXN A;  5DCF A;  2P4W A;  2VN2 A;  1G3Y A;  2PI0 A;  4KMF A;  3KP3 A;  1YIO A;  1IN5 A;  1ONV A;  2UXX A;  2VT2 A;  1DP7 P;  4MEX F;  3DEU A;  3FMQ A;  3T8T A;  2CFX A;  1IXC A;  4HX7 A;  4MEY F;  2P6S A;  4I09 A;  2K86 A;  2ZFW A;  2YX4 A;  5A2Q Z;  3VOD A;  2HTJ A;  1B6A A;  3TOB A;  4MGR A;  1QNT A;  3E6D A;  1J59 A;  2ESN A;  2W24 A;  3DP7 A;  4ENN A;  4MHG A;  2BGC A;  4HYE A;  2Q0O A;  4A0Y A;  5LEK A;  4LJZ F;  2R7F A;  1SFU A;  1D8J A;  2Z3Y A;  4GO1 A;  1O3T A;  1LDK B;  4PGH A;  2K7L A;  1T98 A;  3FMR A;  1QO0 D;  2A68 F;  2L4A A;  4WXC A;  2MBF A;  5TRD A;  5H6Q A;  5D5U B;  3SHF A;  2XAS A;  3FZV A;  4OMZ A;  2QZ8 A;  2BE5 F;  1MJA A;  4BHB A;  4AWX B;  2ZBK A;  5J8F A;  5A2Q K;  1SD4 A;  4N9H A;  1OYY A;  4U7B A;  4IJA A;  2RNJ A;  3IKT A;  1YS7 A;  3TKY A;  4I98 B;  2XRN A;  1I27 A;  2OZ6 A;  5D4R A;  1QBJ A;  4IRI A;  1U3E M;  1W7P A;  3HRT A;  2H94 A;  3GF2 A;  2G7U A;  4G6Q A;  4JQF A;  5LEJ A;  4OIR F;  3F3X A;  2VE9 A;  2MLK A;  2RN7 A;  3I59 B;  4U0W A;  1ZH5 A;  3ML6 A;  2OQR A;  4EV0 A;  3RKY A;  4D0P A;  3EYY A;  3F6V A;  2ZNY A;  3ZN0 A;  3I54 A;  3C3W A;  2ZXJ A;  1UHW A;  5DUK A;  2IP2 A;  3DKW A;  3CUO A;  3JSO A;  5AON A;  2DU9 A;  1E2X A;  1HW2 A;  1WSU A;  3WTV C;  3O2P E;  1Z1D A;  1RUN A;  4L0Z B;  2J5O A;  3LAP A;  3ZQ7 A;  3ISP A;  3LWF A;  4RB0 A;  4UVB A;  5JVT A;  2IRF G;  2PN6 A;  1TNT A;  4U7D A;  3H3Z A;  4HQE A;  4PGG A;  3LST A;  3W6K B;  1HW5 A;  3PQK A;  4EJV A;  1R5H A;  3ZN1 A;  3SXY A;  5TJJ A;  2KJB A;  1BC7 C;  3GO5 A;  1QGP A;  2VBX A;  4CXF A;  4CIC A;  1KQ9 A;  4R79 A;  1EH8 A;  2JRT A;  1GXP A;  1FC3 A;  1YS6 A;  4IF4 A;  4KIC A;  2EV5 A;  3F8N A;  4HAM A;  1FX7 A;  3KLN A;  1B9M A;  3MWM A;  3L7W A;  4A2U A;  4LK1 F;  1EV7 A;  1FSE A;  4K2E A;  4U88 A;  4I2O A;  4LB6 B;  3V7R A;  4M9S A;  3U2R A;  5HLG A;  2P6T A;  2R7D A;  1R7J A;  4Q4Z F;  3T0Y A;  3E5X A;  3BRO A;  1PP8 F;  3FXU A;  5ILS A;  1F4K A;  5BS6 A;  2G9W A;  4G7Z F;  3HTU A;  2D2W A;  1K78 A;  2FU4 A;  3CUQ C;  1JHH A;  1XCV A;  3J80 K;  4XBF A;  2QBY B;  2VON A;  3M8F A;  2FNP A;  4M9Z A;  5FLX K;  1G3T A;  1S8N A;  1LB2 A;  4BNC A;  1R58 A;  4RGR A;  1UFM A;  3E5Q A;  1DPR A;  1REP C;  2YPR A;  2FBH A;  2P5V A;  4ZYD A;  4KT5 C;  1UST A;  3B73 A;  1OYI A;  2HEO A;  4ESF A;  2DI3 A;  2FEZ A;  3V7S A;  1IZ1 A;  4HBL A;  5IT3 A;  3F8C A;  1I6X A;  1KU9 A;  4UHT A;  3ZMV A;  2VE8 A;  3KP5 A;  5L3D A;  4RAY A;  3GWZ A;  4P55 A;  1USS A;  5LBQ A;  1FWZ A;  2FXA A;  2Y48 A;  1IRG A;  1FBQ A;  1NHA A;  1BI0 A;  1O3R A;  2A3S A;  4JBA A;  2XAF A;  2DTR A;  3K1M A;  4ZYH A;  3KP2 A;  1VTN C;  3KEO A;  3FHZ A;  3R4K A;  2EA4 A;  1IW7 F;  3DXJ F;  1EH6 A;  4A0X A;  1MZB A;  3HUG A;  4BXU A;  4RS8 A;  2DQL A;  4ZYG A;  5D8K B;  1LNW A;  4BHC A;  3EUH A;  4PZJ A;  2H27 A;  5ICF A;  5ICC A;  1QPM A;  1H9G A;  3KLO A;  4L9T A;  4MTD A;  1IRF A;  2D45 A;  2E1N A;  4HF2 A;  2H09 A;  5HS7 A;  4GCV A;  4YFX F;  1F9N A;  1GVJ A;  4LG0 A;  1J0R A;  1IN7 A;  2L02 A;  3HRS A;  3E6B A;  1LVA A;  2RQP A;  3SQN A;  2GIV A;  2IPQ X;  4NQW A;  3TQN A;  4U0Y A;  1K79 A;  3BJO A;  4KNY A;  2X4H A;  1JXS A;  3PQJ A;  4LLL A;  4CGZ A;  1PDN C;  2IJL A;  3I71 A;  2IT0 A;  1SFX A;  1AOY A;  4HQM A;  5DV5 A;  2D1V A;  1IXR C;  4P9U A;  1QQI A;  2W85 A;  2HFH A;  3FXR A;  3LA7 A;  3WU0 A;  1WWX A;  2OBP A;  3N97 A;  1CF7 B;  3MAJ A;  3FX3 A;  3JAM K;  3K1P A;  2M45 A;  1ODD A;  2Z5U A;  1KU2 A;  1YW8 A;  5H20 A;  1WQ2 A;  5LRS A;  3WGI A;  2YSR A;  1RIO H;  2F2E A;  1O57 A;  2KIM A;  1S29 A;  4R1H A;  1ZAO A;  4HZF A;  1K7A A;  4HV6 A;  1LDJ A;  3ELK A;  1T2K A;  4AD9 A;  3WTY C;  5JR3 A;  3TO6 A;  4O5V A;  4OU0 A;  2V1X A;  1R1U A;  4M6X A;  3I58 A;  2NAZ A;  4TV7 A;  1IF1 A;  4FX4 A;  1BIA A;  2COM A;  1OPC A;  3R60 A;  2EFN A;  1YW9 A;  1DDN A;  3RPQ A;  5HDK A;  5CVU A;  1S7A A;  5E20 A;  4WX9 A;  5HLI A;  5CVJ A;  5CYV A;  5JI6 A;  4Z2Y A;  3DV8 A;  3KFW X;  3EDP A;  4EMS A;  1RUO A;  4LLN A;  2DQR A;  4EQQ A;  1P4X A;  3Q9V A;  2ZME A;  2HR3 A;  2A5Y B;  3WE2 A;  3RJP A;  3M8E A;  4OIN F;  3KZY A;  2PFB A;  2J5P A;  2FF4 A;  1QZY A;  4OOI A;  3GFJ A;  4G8X A;  1W5S A;  3GFM A;  4HDU A;  3VB2 A;  3P9K A;  5F6F A;  3FMS A;  1B1B A;  5LHG A;  4RB2 C;  2M8E A;  5DUI A;  2FSW A;  2G7H A;  2IA2 A;  1FNN A;  3J81 K;  1KYW A;  4CDG A;  1FBS A;  4U0V A;  3V8L A;  3FXQ A;  3HSE A;  3F6O A;  1YQA A;  2CQK A;  1TBX A;  3R61 A;  5K1Y A;  5HDG A;  3RTR A;  4AIK A;  2MD5 A;  1XD7 A;  3F8M A;  2ETH A;  2KIF A;  2RKH A;  3HYI A;  2XV4 S;  3Q5F A;  3V4G A;  3HHG A;  4Q48 A;  4UUV A;  2RC4 A;  2V79 A;  1J5Y A;  4HW0 A;  3HIF A;  1U8R A;  4IRH A;  1G4D A;  1LDD A;  3LA3 A;  2VC1 A;  4KIF A;  3T8R A;  5JHU A;  2F5E A;  2OAZ A;  2W84 A;  1FYK A;  3VFZ A;  3CTA A;  4EJW A;  1O7F A;  2PQ8 A;  3CO6 C;  2P7V B;  4L9N A;  5BQT A;  4I0A A;  4O3M A;  2NYX A;  1ZYR F;  2EWN A;  3IRR A;  2HOE A;  3I59 A;  3O3K A;  2STT A;  2DBB A;  4UV8 A;  5K5O A;  3ZMS A;  2NNY A;  4UXN A;  3LAJ A;  2PJP A;  3HOT A;  1O7L A;  3LQQ A;  4A6D A;  1P4W A;  5DEQ A;  2CO5 A;  5E1Z B;  4EGZ A;  1W4M A;  2IW5 A;  4CZZ A;  5IT9 K;  4M9X A;  2GA2 A;  2DFI A;  5FGM A;  2GXB A;  4HLY A;  3WTX C;  5DD8 A;  1FP1 D;  1HW1 A;  3RPU A;  2M1B A;  3DF8 A;  4A0Z A;  1ZRC A;  2F5F A;  3E6C C;  4H0E A;  4O6J A;  5CVV A;  1H9T A;  3VOE A;  4S04 A;  4LLG F;  3LA2 A;  4XLP F;  2P5L C;  1IN4 A;  3WGG A;  2VC0 A;  3GFI A;  3V8K A;  3KP4 A;  5DCM A;  4GYG A;  1YTY A;  1FBU A;  4QLC U;  2DLL A;  2GA1 A;  1KQ0 A;  1X3U A;  4G7O F;  5JFR A;  5LHI A;  2EA2 A;  1XMA A;  1W7P B;  5HVQ C;  3E3V A;  4XSX F;  2E7W A;  1KYZ A;  1FYL A;  3RYR A;  3GZ5 A;  1STZ A;  2EV6 A;  4A6E A;  4AIH A;  3CUQ A;  3H3U A;  1MGT A;  1HBX G;  1K6O A;  4HDV A;  2HDC A;  1U5T B;  3JTH A;  2VBY A;  2M5W A;  1XMK A;  3HSR A;  4B8X A;  2A6E F;  4E70 A;  5LLQ A;  2EK5 A;  5KK1 A;  5D5V B;  1Z6R A;  5E1W A;  4LD5 A;  3J80 Z;  4P9F A;  2Z9O A;  3CDH A;  2KRF A;  5CVI A;  1LEB A;  2W25 A;  5DDG A;  4OMY A;  5FLX Z;  1BI2 A;  1XGS A;  4LB5 A;  1FLI A;  3P9I A;  1Z91 A;  3DPT A;  4YG2 F;  1Q1H A;  5D5W B;  2QBY A;  4LK0 F;  4L0Y B;  2A07 F;  2UZK A;  4L18 B;  4L5J A;  3IHU A;  2IA0 A;  4ZH4 F;  2QM3 A;  4ESJ A;  4HX8 A;  1KGS A;  1GXQ A;  2XAH A;  2B0L A;  4L9V A;  5LGT A;  1HXD A;  5D4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...