4GXOA

Crystal structure of staphylococcus aureus protein sarz mutant c13e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
GSHMYLSKQLEFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MarR family regulatory protein
publication title Protein cysteine phosphorylation of SarA/MgrA family transcriptional regulators mediates bacterial virulence and antibiotic resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gxoA00
3TOBA 2MBFA 3KCCA 1LJ9A 3V8JA 3SQNA 4L0ZB 3NQOA 4O5VA 1EH8A 1YFHA 2ZMEA 2VC1A 4XRFA 4ZZDA 3QU3A 2OQRA 1MGTA 3MZHA 1D5VA 1FT9A 2ZXJA 3T5XA 1YIOA 1BI2A 1LQ1A 3KETA 1H9GA 2QQBA 5D6FA 4CXFA 2DFIA 4KDPA 1FYLA 1UFMA 1A04A 4UVBA 3BY6A 4A6EA 5HLIA 1UCRA 3FXQA 4WCGA 1IN5A 1TTYA 4OIQF 1XSVA 2MH2A 2BV6A 2VXZA 2QZ8A 4I01A 4EM0B 1G3TA 1T98A 1FX7A 3B02A 4ZYGA 1FNNA 1J2XA 2FBIA 1R7JA 4I02A 5FD5A 2W24A 4IRHA 3RKYA 4A0ZA 1SFEA 4RGUA 1L0OC 2CQKA 3GZ5A 2Q0OA 1OYYA 5LHHA 4LLNA 1PP7U 3IRQA 1E2XA 1U6GA 3U2RA 1O7LA 2HYFA 1REPC 1H0MA 4TV7A 4LB6B 2QQ9A 4FX0A 1ZN2A 3C7JA 3E5XA 5HDNA 2ZCWA 1WWXA 3TOAA 2HTSA 4I7HA 5CVRA 4UUVA 2CW0F 3K1PA 1KU2A 5ERIA 2E1NA 3BOQA 3CUQC 3P9KA 2XRNA 1SMYF 5LGTA 3T1BA 3N97A 1U3EM 2AS5F 5H6RA 2F5DA 2WC2A 3ZMVA 3JAMK 1KU7A 4DQ2A 2VBXA 3L00A 2F2EA 2RNJA 1FSHA 1XGSA 1TNTA 2H6CA 4XBFA 4ESFA 2M30A 1C0WA 1K78A 3I71A 3CUOA 5DYMA 1P4XA 4KMUX 3WTWC 2EA2A 2GA1A 2L4MA 1PUEE 1W5TA 2XUBA 3WTYC 4O3MA 1G3WA 2FBHA 1I1SA 1U5TB 1HSJA 5LRRA 4P55A 2XV4S 4U0VA 5LRSA 5JVTA 1XB4A 2KIFA 3K2ZA 2ZJ2A 1F4KA 3ZMSA 2MA3A 4HAMA 3E5UA 2R7FA 4I98B 5JI6A 1FYKA 3BJ6A 2ISZA 4B8XA 3G3ZA 3FX3A 4A0YA 2ACJA 4HQEA 1I27A 2P5VA 4ENJA 2K27A 3ERED 1T6SA 3M1EA 3HYIA 3MAJA 4PGGA 2X4HA 4B09A 4HX8A 1ODDA 1P6RA 3DP7A 1KQ0A 4EJUA 4M6XA 3BJOA 3DXJF 2YR2A 2STTA 4NHJA 3CO7C 4EJOA 3CTAA 1NHAA 4G9YA 1IAWA 1MJBA 1QO0D 3TDUC 1I5ZA 3HRTA 3HRSA 3LAPA 2VONA 4FHTA 1J0RA 3ZN0A 2DU9A 5K5OA 5BMZA 1SD5A 2PMHA 4P9UA 1MDMA 3HTUA 1TNSA 4Z2YA 1G3SA 3WTZA 3ML6A 4RB2C 3CO6C 1ONVA 2QENA 2EV6A 1B9NA 3E3VA 1TW3A 1W7PD 2GAUA 1O7FA 3KP5A 5TRDA 2L02A 4M71A 4I2OA 1ZHFA 1P92A 2XVCA 2FMLA 1LVAA 3V8KA 4A6DA 4G7HF 2XAHA 2KIUA 3GW2A 2HR3A 2JRTA 3ZMDA 2YX7A 3DV8A 4AD9A 3BROA 2RDPA 2DK5A 3FZVA 3ECHA 2NNYA 1YW7A 2IPQX 4Q47A 2VE8A 4E70A 4AIJA 2XROA 1T2KA 1XD7A 3R60A 5BPDA 2DO7A 4EJTA 1HW5A 1KU3A 2DPUA 1F1ZA 1BJAA 4S05A 4KT5C 1E17A 4MGRA 2XIGA 4BHPA 1DUXC 2PMUA 5BQTA 4KN7X 3WU0A 3E97A 2P4WA 1RZ4A 3KFWX 4HA8A 2A68F 2VN2A 2A69F 4RAYA 2Y0MA 1S6LA 2EFNA 4IRGA 2E7XA 4NB5A 2OBPA 3L9FA 1LDDA 1W7PB 3EETA 5A2QZ 1IF1A 3L7WA 1ZRCA 4EGYA 2DLLA 4EMSA 1TW2A 5ICFA 2L54A 5L3DA 1RUNA 2EFPA 2K7LA 1XN7A 4ZYEA 4YFKF 3TO6A 1MD0A 3GUDA 3BP8A 4YG2F 3WG9A 1YYVA 4HLYA 4BAYA 3HTSB 1B6AA 3DQVC 5BOXA 3H3UA 3QRFF 2FSWA 5E1XA 1FWZA 4JQFA 4RGRA 2HZTA 1WSUA 2M8EA 1T39A 5HDKA 4MEXF 3KZZA 3LA3A 2JZYA 3WTUC 5D4RA 3PQJA 4R8HA 4U88A 4LG0A 2EWNA 4M74A 5DUKA 2CWEA 5D5UB 1UB9A 1T0FA 1ULYA 2FF4A 3DEUA 3TKYA 2Z9OA 3F21A 2IT0A 4ZZLA 2EFOA 3BJAA 3LFKA 5L3GA 3KLNA 5CYVA 1R23A 2BBYA 1ZG1A 1D3YA 3J80Z 1BC8C 2JTVA 2HYGD 5FFXA 5JR3A 3OV8A 5JHUA 2K86A 3MQ0A 3QP5A 5ICEA 5LGNA 3QU6A 4XLPF 3WTTC 4WF2A 2P6SA 1IXCA 3HIFA 1FP2A 1GXQA 2H6BA 1F9NA 2ZFWA 3ZP5A 2HEOA 4KFCA 4GYIA 1SMTA 3RKXA 1KYWA 4PZJA 1QZYA 2W25A 3HSRA 1HKQA 1Y0UA 4A5NA 4KN4X 3JAMZ 1ZREA 1YLFA 3HSFA 1XGMA 4LK0F 1O3TA 2O6GE 2IA0A 2HS5A 4RB3C 5DCMB 3D5LA 4HLXA 4RS8A 2EB7A 3U1DA 1EH7A 3O2PE 2G7UA 1FY7A 1KGSA 5D8KB 1O3SA 5D4SA 1Z7UA 3D0SA 4MHGA 3F22A 1XGOA 1Z6RA 5DD4A 2VODA 2XGXA 3JW4A 2LKPA 2HDCA 3TQNA 4G8XA 1Z91A 4G7ZF 4M6YA 4HF1A 5K5QA 3IC7A 5J8FA 4IXAA 3F8BA 4O6JA 2K4JA 2HKXA 5IT9K 2X0LA 3TO9A 4JBAA 2L01A 3ECOA 3HSEA 2MH9A 1TBXA 5DDGA 4LGWA 2BYVE 6PAXA 2ZBKA 3V8LA 2HQRA 1GHCA 2YPRA 5LLQA 2M1BA 5DEQA 1BBYA 3ISPA 3C3WA 1U5TA 2VE9A 1YW8A 5J6XA 1FBSA 5IT3A 1LDKB 3T8RA 1RNLA 4OIPF 4IHTA 3N4MA 5EEGA 3EYYA 2ESNA 1VTNC 4HQMA 1O3QA 3ULQB 2FOKA 2O61A 4IRIA 4GXOA 2HOEA 4L9NA 4KUMA 1UHWA 1T38A 2HFHA 1ZH5A 2LF7A 1ON2A 2GA2A 4L18B 1JE8A 3U9GA 4HF0A 4UV9A 2ELHA 2GXGA 4YIIA 3HRUA 2QWWA 5FLXZ 4OMYA 4ZH4F 5HLHA 3SZPA 3SZTA 4MNUA 4L5JA 4P5OA 4PDKA 2V9VA 4KIBA 1JHFA 1R58A 3TGNA 2ADUA 5LEKA 3ZQ7A 2V1UA 3NRVA 3GEZA 3Q5FA 2M5WA 1IW7F 1K79A 2Q8KA 3M8EA 4NQWA 2OAZA 4ESBA 2K4BA 2CO5A 3F8MA 1OYWA 2PEXA 3LAJA 2VBZA 3KP3A 2KIMA 2TDXA 4S04A 1HW2A 4M9XA 2QBYB 1BOAA 4FT8A 4AWXB 3WGIA 1MJ9A 1AOYA 3RI4A 2RC4A 5HDGA 4OMZA 4BH9A 2DAOA 5E1WA 2VT3A 3QAHA 2PQ8A 4PCQA 1F5TA 4ON0A 1D8KA 1QQIA 2VOPA 1ZLKA 2EV0A 2LNBA 2NS0A 2OD5A 3RDIA 3QPHA 1ZRDA 3ROUA 5L3CA 4K2EA 4CDGA 1P4WA 3CUQB 2ZKZA 3CJNA 1R1VA 2LSOA 4U0YA 5D6EA 2FXAA 3I4PA 4U7DA 2VBWA 4CGZA 3BDDA 2BEOA 2W84A 4UXNA 1U78A 1Q1HA 2R7DA 3F8FA 3L09A 3R6SA 1IZ1A 4RGSA 2IA2A 4UHTA 2BGCA 1J5YA 1YO5C 2DTRA 3SFZA 3MWMA 4MTDA 1W7PA 5CVUA 2HWVA 1XGNA 3H92A 3KEOA 2UZKA 4P96A 3IWZA 1MZBA 3VEPA 1L3LA 2FEZA 4AIHA 3GFIA 1FSEA 3F23A 1ZAOA 1HQCA 3TDZC 2QVOA 2D1HA 3IHUA 3IL2A 3GLXA 1XDUA 4CZZA 3LA2A 4ENKA 2CYYA 4KYWA 3JSOA 2A6EF 4D0PA 1S8NA 5L3EA 4KIFA 1MKMA 3KEQA 2CGPA 4ASNA 4WXDA 2YSRA 4ESJA 1QPMA 1R1TA 5FFZA 1HKSA 3WODF 3IKTA 1BC7C 3E6MA 4N9IA 3P9IA 1R1UA 2GIVA 4BNCA 5D5VB 3F3XA 5KK1A 1R36A 3J81Z 1WI9A 2B0LA 3Q9VA 4P9FA 4IVNA 2HTJA 3HUGA 3P7NA 1U8RA 2RKHA 3K9TA 3GFJA 1HKTA 3O3KA 3ZMTA 2CSOA 1X3UA 1QGPA 4IJAA 3F72A 3S2WA 4QWQA 2DW4A 3ZMUA 1XDSA 4RB1A 5AONA 2NYXA 3RYPA 1FC3A 4G94A 3GWZA 1XCBA 4Y15A 1EH6A 5DV5A 1IN4A 1G6NA 3R61A 1IN8A 2PLYA 2QLZA 2O8XA 3BWGA 3PQKA 1R22A 3T0YA 4WXCA 4M72A 1OKRA 2XKOA 3E5QA 1WRJA 5HS8A 2VOOA 5DCFA 2H27A 1LEAA 3CDHA 2XAJA 3KP4A 3REOA 2EA4A 2D1VA 1YG2A 1J75A 4EJVA 4ENMA 2ZNYA 3FM5A 3KP6A 4LD5A 2YU3A 5IT9Z 2E1CA 1BI3A 2MLKA 3WTSC 4I0AA 2H94A 1JXSA 3GYHX 1CF7B 5DCMA 3GX4X 5CVJA 2COMA 2A6HF 4I0BA 1FBQA 5E8IA 3ZN1A 5LHGA 2IJLA 2RQPA 3FXUA 2HKOA 4ZYHA 3RPQA 3K1MA 2L4AA 3GF2A 1B4AA 3EQLF 4UNOA 4KICA 3QOPA 4Y13A 3WGHA 4KIGA 5F64A 4LK1F 4Q48A 4YFNF 1ZGAA 1I1GA 2A61A 2GQQA 5CJ9A 4WX9A 3COAC 1Z9CA 2Z99A 1W5SA 2RN7A 3L2CA 3I58A 4M73A 5FD6A 4UV8A 3WE2A 4XSXF 1FYMA 5E17F 4RB0A 2ZO4A 2VT2A 4G6QA 3NEUA 3RTRA 3RJPA 3LSTA 5L3FA 1V4RA 1Z6TA 2RGVA 4IPAA 4CYDA 4WWCA 3VB2A 2OZUA 5K5RA 3I53A 3I0TA 3E6DA 3WTXC 1IXRC 3RPUA 3W6KB 3KP7A 4HF2A 3E6BA 1Z1DA 4HOBA 2JPCA 4MEYF 4QLCU 1O57A 2OU2A 1JGSA 4GCVA 2F5CA 4XLNF 5CVIA 3AAFA 2IRFG 3DF8A 3DKWA 2BE5F 1ZG3A 2E7WA 1O3RA 2FNAA 4M9ZA 2O0YA 3ABTA 5H6QA 5E1ZB 2L3DA 2IA1A 5JFRA 3DPLC 5E20A 5ILVA 4KMFA 4Q5SF 1OYIA 2DPDA 4FX4A 1I6XA 1R5GA 1S7AA 4LMYA 3HHGA 3WU1B 1YW9A 4JK1X 1GXPA 4WK8F 1IRFA 1Z05A 3K69A 4HYEA 1QNTA 3BPXA 1SD4A 2JT1A 2NNNA 2CFXA 2PI0A 3VOEA 2OQGA 3IWFA 2PFBA 4EGZA 2QYOA 3SHFA 3B73A 1USSA 1S7OA 5BPIA 2EV5A 2F5EA 2QQAA 5KVRA 1FBUA 4RAZA 5LHIA 1SAXA 2QBYA 3MZYA 5H20A 4IHSA 1KYZA 4HDUA 1S3JA 3FMRA 2NAZA 3G73A 2MLGA 1KQ9A 4A5MA 4G6DA 3MEXA 2Y75A 1TLHB 5HLGA 4BYYA 4MTEA 2GWRA 2D45A 5HVQC 4G7OF 4EQQA 1TQMA 3J80K 1U5TC 5D5WB 4A0XA 4ZYDA 2C6YA 4HV6A 3I59B 4UVCA 1KQ8A 2YX4A 2FNPA 3EYIA 3BPVA 2UWMA 4AIKA 2DQLA 1PP8F 3CUQA 1KU9A 2V1DA 1R00A 1XSXA 4BHCA 4LFUA 2DT5A 5FGMA 3FF5A 5ED4A 1BM9A 2XASA 3T8TA 4DNCA 3P9CA 2XHKA 4L0YB 1LB2A 2P8TA 2ZMEB 4BQAA 2FRHA 1MJAA 1XSDA 4L9JA 3VFZA 1EV7A 2HQNA 3I5UA 1YS7A 1DDNA 3R4KA 1IN7A 4OOIA 5J8CA 3QP6A 4OU0A 2PJPA 3BZ6A 2W57A 1STZA 2Q2EA 3JTHA 3V4GA 1SD7A 1B9MA 4EV0A 5F6FA 5HS9A 2MC3A 2DBBA 3MCZA 3MFKA 2V6CA 2W85A 3V7SA 1HW1A 1LNWA 2EK5A 3HOTA 2XKPA 2ESHA 3WTVC 4U0WA 4GYGA 1H9TA 2WWYA 2F5FA 2P6TA 3FMQA 5CLSA 2P7VB 2EJRA 4RGXA 5HS7A 3LWFA 1HXDA 5LBQA 3LA7A 1FZPB 1OPCA 5K1YA 1B59A 1OR7A 3SXYA 3ABUA 4LLLA 4Q4ZF 1SFXA 1W4MA 3R0AA 3K0LA 3RYRA 1IUYA 1BN5A 2STWA 3Q9SA 1BI0A 2H09A 4GGGA 1LEBA 3EUHA 3EDPA 3JTGA 1RUOA 1QZZA 3KE2A 4R79A 5FO5A 4H0EA 3I54A 1FLIA 4MQ9F 1BIBA 2MD5A 2J5OA 3E6CC 1K6OA 3LQQA 3IRRA 4KNYA 1YS6A 2P7CB 1WKMA 2KJCA 1ZARA 3WGGA 4UVAA 1QBJA 4LLGF 1PDNC 5DUIA 5ILUA 2IP2A 3O6BB 1HSTA 4EJWA 3JSPA 1K78B 4HW0A 3J7AO 1B1BA 1P2FA 2GZWA 2OA4A 2R3SA 4WXHA 2XAFA 4N0BA 2M45A 4PGHA 3FMSA 4BHBA 5HOOA 4HX7A 1AWCA 3IKVA 5ICGA 1ON1A 2Z33A 1TQIA 2Y48A 1KA8A 1V3FA 1U2WA 1OMIA 3F6OA 4EM1A 3R0JA 4L5IA 2A3SA 4IF4A 3FXRA 2KJBA 3QPTA 1CF7A 4U7BA 3DFGA 2QUFA 3V7RA 2FA5A 5FLXK 2ZNZA 1XCVA 2AXLA 4R1HA 1USTA 2K02A 1ZRFA 3DPTA 2WTEA 2JSCA 3H3ZA 4MQVA 4A12A 3VODA 4YFXF 2V79A 4ENNA 3M8FA 1SFUA 3HHHA 4A2UA 1SD6A 4OIRF 1YTYA 1GVJA 4CO8A 3F8NA 1RIOH 4F7ZA 3GXOA 4EM2A 5D5XB 2Z3YA 1K7AA 5LGUA 2P5KA 2FBKA 2WV0A 4OINF 2DI3A 2LF8A 3FM3A 5F1RA 3PFIA 1ZG5A 2XAGA 2KKOA 1IRGA 3ZMZA 2VC0A 4LB5A 3WE3A 2KRFA 1BI1A 1FPQA 3GVAA 1XMAA 4HV5A 5L3BA 1J9IA 1G3YA 1MDMB 2J5PA 5CVVA 2UXNA 2IVMA 2D2WA 1R5HA 2P5LC 1BIAA 1DPUA 2FE3A 5ICCA 3K1NA 4AVPA 5TJJA 2G7HA 4KA4A 4BXUA 5FB2A 5E18F 3F8CA 2FU4A 4I09A 4GO1A 2ETHA 1TQPA 5EEHA 2QM3A 5E8GA 2PG4A 3V7CA 2PBIA 4XSZF 5DD8A 3ZPLA 4LJZF 3KZYA 2VBYA 3GFMA 3M7GA 3F6VA 2IW5A 4HDVA 4HX4A 4L9VA 1LDJA 5AIQA 4CICA 2HGCA 1JHHA 1D8JA 3FWEA 4OIOF 3RKWA 3CLOA 5AIPA 3KLOA 1P4AA 2O3FA 2EFQA 2NRAC 4HBLA 2GXBA 5D8LB 4N9HA 2OZ6A 3FHZA 1ZLJA 2FQ3A 2JPBA 2CG4A 2LDUA 5LEJA 1IXSB 2M87A 4CHUA 3GZ6A 3I64A 2XAQA 3RIRA 3ELKA 2A07F 3HOSA 3KP2A 1G4DA 1J7KA 3W6JB 4M9SA 4ETSA 2FMYA 1IN6A 2O03A 2PN6A 1YQAA 1FOKA 2UXXA 2RVCA 2Z5UA 2RV8A 2DK8A 3J81K 3M9AA 3LQRA 2ISYA 2DQRA 2EFWA 2G9WA 3C1DA 1WQ2A 4YIFA 1ZGJA 3HRMA 1RI7A 4Y17A 1XMKA 3GFLA 4HZFA 5ILSA 3GO5A 4L9TA 1FP1D 1ZYRF 3OOPA 5BS6A 1CGPA 1J59A 1HBXG 4EVIA 3TO7A 1S29A 3I59A 1UHMA 5A2QK 3C18A 2A5YB 1DP7P 1DPRA 4LG0B 2V1XA
chains in the Genus database with same CATH superfamily
3TOBA 4IHXA 2MBFA 2LVSA 3KCCA 1LJ9A 3V8JA 4E7KA 3SQNA 4L0ZB 3HPGA 1YJWI 3NQOA 1RPWA 3CC7I 1DU0A 1GV2A 4O5VA 2MG4A 1EH8A 4IQ4A 2M2EA 4CCJA 2ZMEA 3CCEI 1YFHA 5LFAA 2VC1A 4XRFA 1MNEA 4ZZDA 3QU3A 2HDWA 2OQRA 3A02A 5M3FJ 4GFBA 1Y1VJ 2OF7A 1MGTA 3MZHA 2R0QC 1D5VA 1FT9A 2ZXJA 3T5XA 2R7QA 4XICA 3OSGA 2VKVA 1YIOA 1BI2A 1LQ1A 4A3CJ 3KETA 1H9GA 2FQ4A 3QYBA 2QQBA 2DMTA 3SZGA 4BUPA 3FKIJ 5D6FA 4CXFA 2DFIA 4KDPA 3ZQCA 1FYLA 3OWTA 3LSJA 1UFMA 1A04A 3W2VA 3Q0VA 5M5WJ 2DOFA 2HXIA 4UVBA 4LITA 3H9QA 4B3XA 1LE8B 2DDAA 1ETOA 3A01A 3BY6A 4A6EA 5HLIA 1UCRA 2FOWA 2LFBA 3FXQA 4YIRX 4WCGA 2DMUA 1IN5A 1TTYA 4I76A 4OIQF 1XSVA 4X6AJ 2MH2A 2BV6A 2VXZA 3MVPA 2QZ8A 5J4YA 4I01A 2I5UA 4EM0B 1ZELA 1G3TA 1T98A 4RBOA 1JKPC 1FX7A 5EZGA 3B02A 3ESWB 4ZYGA 1FNNA 1DGWY 1J2XA 2FBIA 1K83J 1R7JA 4I02A 3BTIA 5FD5A 2W24A 4BACA 2VPRA 4IRHA 1ZQ3P 3BR2A 3DBLB 3RKYA 4A0ZA 1SFKA 1SFEA 4RGUA 3WHCA 4D9JA 2CW8A 1QHGA 1L0OC 2CQKA 3GZ5A 2Q0OA 1OYYA 3CCYA 2A05A 2CU7A 5LHHA 1WI3A 4HNTA 4LLNA 1PP7U 2B7EA 3IRQA 1E2XA 2V9KA 2KMUA 3E1SA 1MBFA 1QPIA 1U6GA 3U2RA 1GT0C 1O7LA 2HYFA 2VQHA 2M0CA 1REPC 4ZDLA 1H0MA 3HM5A 4TV7A 3DU6A 4LB6B 2QQ9A 1V5GA 1RR7A 4FX0A 1ZN2A 3C7JA 3E5XA 3DEWA 3HGYA 3ONQA 5HDNA 3AKZA 2ZCWA 1WWXA 3PUBA 3TOAA 4XN3A 5FKOA 2HTSA 4I7HA 5CVRA 5J1UA 4UUVA 4XM3A 2VKDA 5DS9A 2CW0F 3K1PA 1KU2A 5EG0A 5ERIA 2E1NA 3BOQA 3CUQC 5E79C 1CQTA 3MMYB 3P9KA 2XRNA 3BTCA 1SMYF 1T95A 4JOMA 5LGTA 1SAUA 3DPUA 3T1BA 3N97A 1U3EM 2AS5F 1VQKI 5H6RA 2F5DA 2WC2A 5GADJ 3ZMVA 3JAMK 1KU7A 2NVTJ 1T08B 1HC8A 4DQ2A 1GDTA 5CQEA 3FBNB 1A6IA 2FD5A 2VBXA 4Y4RA 3L00A 2F2EA 4LIVA 2RNJA 1FSHA 3QPLA 3J7YJ 4Z6YA 4ITVA 1XGSA 2KHMA 1TNTA 3LSGA 2EIKH 2H6CA 4XBFA 2R7RA 4ESFA 2M30A 3OYIA 1C0WA 1K78A 1P9QC 3A01B 3VSLA 1R6RA 1S9HA 1AA7A 1X4OA 3I71A 3CUOA 4DJAA 3DLAA 2NVUB 5DYMA 2VKHA 1P4XA 4KMUX 4XNFA 3WTWC 2EA2A 1GLNA 2GA1A 2L4MA 1OLTA 2V4JC 3IP4B 5M5YJ 3DEEA 1PUEE 1W5TA 2XUBA 3WTYC 4O3MA 1G3WA 2FBHA 1I1SA 1U5TB 1HSJA 3A4CA 5LRRA 2I8DA 4XKVA 4P55A 2XV4S 4U0VA 1D1CA 5LRSA 3C2HA 2F4MB 5JVTA 1FOYA 1XB4A 2KIFA 2OV7A 3K2ZA 4XK4A 2ZJ2A 2FUG2 4PUSA 1F4KA 4XRSG 3OSFA 3ZMSA 5E3NA 4QSHA 2MA3A 1FIAA 2R92J 3BG5A 3BC8A 4HAMA 1SC7A 2E60A 3G2BA 3E5UA 2R7FA 4I98B 1HLVA 1H89C 5JLXA 5JI6A 1FYKA 3JRAA 1IGNA 2MW8A 3BJ6A 4XRSA 3LNQA 2ISZA 4Y7NJ 4B8XA 2AHQA 2WBMA 3G3ZA 3FX3A 4XN0A 4F92B 4A0YA 2ACJA 4HQEA 1I27A 1GUUA 4F93B 2P5VA 4ENJA 3S1NJ 5IOYA 2K27A 3ERED 1T6SA 2MABA 3M1EA 4HRIA 5BNGA 3QYEA 3HYIA 3MAJA 4BXFA 1VQ5I 4AIDA 2R5ZA 4PGGA 4LOCA 2X4HA 5M5XJ 1T56A 4B44A 2E71A 1XPXA 3HGGA 4B09A 1OR7C 2K9QA 4HX8A 1ODDA 1P6RA 1Y6IA 3DP7A 1KQ0A 3QYFA 1U9OA 3BR6A 3NAUA 4RM2A 4BY7J 1G59A 1ETQA 4EJUA 4M6XA 3BJOA 3CCLI 3DXJF 2YR2A 2STTA 2A6TA 3CP8A 4NHJA 3CO7C 3OR1C 1HCRA 4JYKA 5E3MA 3AG1H 1X1DA 4EJOA 3OYDA 3CTAA 3EUHC 1NHAA 2JSPA 4G9YA 3SFIA 2R5YB 1IAWA 1MJBA 1QO0D 3BTJA 2BVMA 2M3AA 3GMEA 5IYBJ 5B5EC 3S3OA 5FROA 2JUGA 3TDUC 3KYCB 4XORA 1I5ZA 4PK4A 3HRTA 3HRSA 4E7SA 4KJZA 3LAPA 2R7TA 2VONA 4FHTA 3PM1A 2VJIA 4BE1A 1J0RA 4A3IJ 3ZN0A 2DU9A 5K5OA 5BMZA 3PNTA 2WY8Q 1SD5A 2PMHA 2E34A 2KRHA 4P9UA 1BW5A 4NQWB 1R49A 2KT0A 1MDMA 3HTUA 4IHWA 1TNSA 4Z2YA 2ICWG 2HNHA 1G3SA 3WTZA 3ML6A 4RB2C 2CH0A 1I6HJ 2R7OA 2L9NA 3CO6C 1ONVA 2QENA 2EV6A 1B9NA 3E3VA 1VQ6I 3ABMH 1TW3A 3S8PA 1DU6A 1W7PD 2GAUA 1O7FA 5GTHC 1UZCA 3KP5A 5TRDA 2L02A 4M71A 4I2OA 1ZHFA 1P92A 2XVCA 3U1KA 2FMLA 1LVAA 3V8KA 3K4MA 4A6DA 3NARA 4G7HF 1MH3A 5JHFA 3PIOF 2XAHA 2KIUA 4B4CA 1AU7A 1TT5B 3GW2A 2HR3A 1Z67A 2JRTA 3D5RC 2E1MB 3ZMDA 2CUZA 2YX7A 1VZ0A 3DV8A 3A03A 4AD9A 3K7AJ 1W5CC 2XGDA 3BROA 2RDPA 3ZQIA 2DK5A 3HKZA 4E7ZA 3FZVA 3KYDB 3HDDA 2F4IA 3ECHA 2NNYA 1YW7A 2IPQX 4Q47A 2VE8A 4E70A 3FISA 4GDFA 5F27A 4AIJA 4MO7A 1LPQA 2XROA 4HSRA 1T2KA 1XD7A 3R60A 5BPDA 2DO7A 4EJTA 4XKBA 5IYCJ 1HW5A 5GTIC 1KU3A 3UNGC 2DPUA 1F1ZA 1BJAA 4C2UA 1B8IB 2W4SA 2IS2A 3CQZJ 3F0CA 1ETWA 4S05A 4KT5C 2DXIA 1JTYA 3LSMA 2Z2SB 2X51A 1E17A 4MGRA 2XIGA 4BHPA 1IDYA 1LFPA 1DUXC 2PMUA 5BQTA 5FLMJ 4KN7X 4UB6C 3WU0A 3E97A 4IQJA 2P4WA 1RZ4A 3KFWX 4HA8A 1BR2A 1TWAJ 2A68F 1BOBA 2VN2A 4LIUA 3TP3A 4BQQA 3TW7A 2A69F 4IL6C 4RAYA 2BOLA 1ACIA 2Y0MA 2OJED 1S6LA 2EFNA 1X3ZB 3CJTB 1FEXA 4IRGA 2GOXB 3CCMI 2YU9J 2E7XA 4NB5A 2OBPA 1V55H 3CLQA 4GRIA 2DT6A 4XLCA 4F91B 3L9FA 3H36A 1WJDA 1YJNI 2WAFA 1LDDA 1Y1WJ 1W7PB 3OYCA 3EETA 5A2QZ 2HVQA 3AL0C 1IF1A 3L7WA 1ZRCA 3AFHA 2LG4A 1SVMA 2BY2A 2DLLA 3M8JA 4EGYA 4EMSA 2EINH 1TW2A 5ICFA 5F0CA 4A93J 4NBQA 3VYUB 2L54A 2XGCA 5L3DA 1RUNA 3S15J 1ETVA 2IGMA 1TC3C 2EFPA 1D1AA 1MNMC 2K7LA 5IP7J 2DMPA 1LKXA 1POGA 3Q0WA 3VDXA 2IS4A 2E5NA 1ETKA 3H5RA 1XN7A 4HNVA 2MYSA 4ZYEA 1IRXA 4YFKF 3TO6A 3FK7A 4NDLA 1MD0A 3GUDA 2M4GA 3BP8A 4YG2F 5KHDA 2ZJRF 3WG9A 1YYVA 4HLYA 5DM7F 4BAYA 3OYNA 1M1EB 2HVSA 4X1EA 3OIQA 5GPAA 3BG7A 3HTSB 1B6AA 2H8RA 2R7ZJ 4QPOA 3DQVC 3HOXJ 4RLQA 2QF7A 5BOXA 3H3UA 2ECBA 3QRFF 2FSWA 2TRTA 5E1XA 1FWZA 2KZGA 3G4SI 4JQFA 1WZ2A 3QWLA 4RGRA 1X2NA 1D1BA 2HDDA 2EQRA 2HZTA 1Y8QB 1WSUA 2M8EA 4KITB 1T39A 1UHSA 5HDKA 4MEXF 1OJLA 3KZZA 2VXDA 3LA3A 3IAM2 2IS1A 2A5WA 2JZYA 2Q1ZB 3WTUC 1ZGWA 2DFEA 1UAAA 4A3LJ 5D4RA 3PQJA 2GBYA 4R8HA 4E4HA 4U88A 2WADA 4C3HJ 3OYHA 1TL8A 4LG0A 2DA2A 3A0BC 3FXLA 2E2JJ 2EWNA 2JN6A 4M74A 5DUKA 2VB6A 2CWEA 5D5UB 3HUGB 1UB9A 1T0FA 1ULYA 2FF4A 3DEUA 2ME6A 3TKYA 2Z9OA 2VJ4A 3K2AA 3F21A 4S0HB 2HOTA 2IT0A 4ZZLA 2EFOA 1Y56A 3BJAA 3LFKA 1MMSA 5L3GA 3E0JB 2CV1A 3KLNA 2JUCA 1V5EA 2W82A 5CYVA 4NC6A 2WY7Q 2EBIA 1MMGA 2XF7A 1K6YA 2LYCA 3D1NI 1R23A 2BBYA 3DBRB 1ZG1A 3RQIA 1D3YA 3J80Z 4G6TB 4XOPA 1BC8C 2JTVA 5K7HA 2HYGD 3K4LA 5FFXA 5JR3A 2CUEA 3OV8A 2L7KA 2ZC2A 3RCOA 3KYLA 2R7UA 2EZLA 5IYDJ 5JHUA 2VUMJ 3VYRB 3CC4I 2JVHA 2K86A 4Y33A 2HOSA 3MQ0A 3L2VA 3QP5A 5ICEA 5LGNA 3QU6A 4AYBN 4XLPF 3FXJA 2CQ7A 3WTTC 3GTPJ 4JX5A 3HJEA 4WF2A 2P6SA 2FJ1A 1IXCA 1YE9A 3B6CA 4MFDA 3S1MJ 2JA2A 2K9LA 3HIFA 1XS9A 1FP2A 1GXQA 2X6OA 1YJ9I 2VQLA 2H6BA 1F9NA 2ZFWA 3ZP5A 1LE8A 2LLKA 4PJLA 4ZDOA 4D1QA 1JJ6C 2HEOA 4KFCA 5KAFC 3N05A 3HBLA 2LBFB 4BS9A 1JT6A 1WJBA 3CCJI 4GYIA 2CQQA 1SMTA 2JJ7A 2G0EA 4NC7A 3RKXA 2KIQA 1A35A 1KYWA 3K70C 4PZJA 3S32A 2KPMA 1QZYA 1MMDA 2W25A 3HSRA 2MC4A 4BKXA 2OUMA 3BG9A 3H9JA 1HKQA 1Y0UA 4A5NA 4KN4X 3JAMZ 1ZREA 1YLFA 3HSFA 1XGMA 4LK0F 1O3TA 2EIMH 2E2HJ 3PNYA 2O6GE 2IA0A 2HS5A 2LC2A 4G12A 4RB3C 5DCMB 3GTOJ 1ORKA 2FX0A 3D5LA 4DYQA 5J1YA 4HLXA 1S5LC 2EB7A 2AQEA 4RS8A 2R4GA 3U1DA 1YHQI 2LR8A 3GTQJ 1EH7A 2V1NA 3O2PE 1SFOJ 2G7UA 2XRLA 1FY7A 1KGSA 2JK3A 3U21A 4W1UA 2DYSH 5D8KB 5FKKA 3OIOA 1O3SA 5D4SA 2BY3A 3I55I 1JKRC 1Z7UA 3KX2A 3D0SA 4MHGA 4PSXA 2ZJQF 2DFHA 3F22A 1XGOA 1Z6RA 2Y0SN 5DD4A 4EEFG 2VODA 2XGXA 3DTEA 4BEHB 1X19A 3OL3A 3JW4A 2CJJA 3PSIA 4AYBA 2LKPA 3FKJA 2HDCA 4MIMA 4XLFA 4G8XA 1Z91A 3BG3A 3RPUD 3TQNA 4G7ZF 3MD2A 1R71A 1B72B 1QVUA 4M6YA 4A3GJ 3H1CA 5E3LA 3IC7A 5K5QA 4HF1A 3KIOA 1E3HA 3FBIB 5J8FA 1SANA 4II2A 4IXAA 3F8BA 4O6JA 2K4JA 1Y8RB 5EJCA 2HKXA 4AC0A 5J47A 5IT9K 1MBEA 2IAIA 4D5FA 4ZTFA 3HEFA 2X0LA 3TO9A 1QA6A 4JBAA 3WU2C 2L01A 3SDGA 3ECOA 2XDVA 3HSEA 2Z1DA 1W0TA 2QGUA 2NVYJ 2HI3A 3OR2C 2ZMEC 4BBRJ 4D7NA 2MH9A 1TBXA 5DDGA 4LGWA 1RRJA 1IUFA 4E7IA 1A31A 1G8XA 2QKLB 3G1OA 2DCEA 5EZHA 2BYVE 2BHYA 6PAXA 2ZBKA 4C30A 3V8LA 2HQRA 5E3OA 1GHCA 4RLFA 2YPRA 5LLQA 2ZB9A 3CC2I 2M1BA 5DEQA 1BBYA 3CMAI 1ZR4A 3MKYB 3HL2A 2CRGA 2WAQA 3ISPA 2VJ5A 4M3EA 1RESA 3OS0A 4A3EJ 1MH4A 3H35A 3C3WA 1U5TA 3HXLA 3L2RA 2L2OA 2VE9A 5IP6A 1YW8A 5J6XA 2WA0A 1FBSA 5IT3A 1LDKB 4RM3A 1XC5A 3T8RA 1RNLA 4KISA 2VKEA 4OIPF 4IHTA 3N4MA 1RR8C 4XRMA 4B47A 5EEGA 3EYYA 2ESNA 1VTNC 4HQMA 5K7FA 3NWSA 2M9HA 2ZXIA 3DTKA 2VPLA 2W00A 3K4JA 2BXZA 3SEQA 4PFOA 1R4MB 5KAIC 5F1JA 4CYCB 1O3QA 3HC7A 3ULQB 2FOKA 2O61A 4IRIA 4GXOA 2HOEA 4L9NA 4KUMA 1UHWA 5B1AH 3GTLJ 1T38A 1JTXA 1PUFB 2HFHA 2DA6A 4RA2A 1ZH5A 4PJNA 2LF7A 4DOZA 1ON2A 3EUAA 2GA2A 4L18B 1JE8A 3U9GA 1YOVB 3ZR8X 1BR4A 4HF0A 1FIPA 4UV9A 2ELHA 1E3OC 2GXGA 4YIIA 3CCQI 3HRUA 3LSKA 3E7LA 4B1RA 1I39A 2HXOA 2QWWA 3OY9A 3HB9A 3TW6A 1XMXA 4ZTJA 2XB0X 5FLXZ 4OMYA 4ZH4F 5HLHA 3SZPA 3SZTA 4U87A 4MNUA 4L5JA 4P5OA 4PDKA 2V9VA 4KIBA 1JHFA 2JA6J 3TP0A 3BG6A 1R58A 5K7ZA 3TGNA 3OYBA 3ASNH 1APLC 2ADUA 2Z16A 2Y9YA 2R7SA 2R5YA 3H0DA 2DYRH 2JMWA 3ZQ7A 5LEKA 3HOWJ 3GZNB 2V1UA 1JI8A 3GCMA 3NRVA 4JP0A 3GEZA 3OYLA 3JRHA 3Q5FA 2M5WA 1OCPA 2BZTA 3BT9A 1IW7F 3J7AY 3CF2A 1K79A 2Q8KA 2NXNB 4QIWN 3MKZA 4JX4A 2M8GX 3M8EA 2Y2ZA 4OWRB 2DMNA 4ABZA 3W3CA 4HG2A 4NQWA 4D5CA 1KZHA 2OAZA 1K4SA 4ESBA 2K4BA 2CO5A 3F8MA 4NNJA 1OYWA 2B9SA 2PEXA 1WFXA 2ZXHA 2O5RA 3LAJA 2VBZA 2BHZA 2GOMA 3KP3A 2KIMA 2TDXA 4DW6A 3CCRI 3VSKA 3QPSA 1IC8A 4S04A 1HW2A 4M9XA 1MIJA 2QBYB 4II3A 1BOAA 4FT8A 1MSFC 1FTZA 5TISC 2GM4A 2PMZN 5B1BH 4AWXB 3WGIA 1MJ9A 3M4OJ 1AOYA 3RI4A 2RC4A 2COBA 5HDGA 1TZLA 4OMZA 1Y0NA 1TWCJ 5M3MJ 4BH9A 2DAOA 5E1WA 2VT3A 3QAHA 4MLOA 1JUMA 2F48A 2PQ8A 4PCQA 1F5TA 4ON0A 3G1LA 2LRDA 1P7IA 2ELJA 3UR3C 1D8KA 2M7BA 1QQIA 3OOUA 5LD2C 2XC7A 2VOPA 1ZLKA 2EV0A 2LNBA 2NS0A 2OD5A 3RDIA 3QPHA 1ZRDA 3ROUA 2DA1A 5L3CA 4B48A 4K2EA 5FRNA 3H3VK 1X3WB 4CDGA 1P4WA 3CUQB 1Y39A 2ZKZA 1U8BA 2XAUA 3X2QH 4MFEA 3CJNA 1R1VA 2XF5A 2LSOA 4H4KC 3ZCOA 4U0YA 5D6EA 4AM3A 1VF9A 2FXAA 3I4PA 2K9MA 4A3JJ 1B8IA 1AKHB 5KCMA 2HOAA 5HLTA 4U7DA 2MGQA 2VBWA 4CGZA 3BDDA 2BEOA 2W84A 4N4NB 4UXNA 4IO9F 3S3NA 2TCTA 1BL0A 4C3IJ 1U78A 3ASOH 1NTCA 2M7AA 1MBGA 1Q1HA 1IJWC 2R7DA 3F8FA 2LY1A 3L09A 2R93J 1BR1A 2HQAA 2K40A 2IS6A 2X6WA 1VQMI 4BDZA 3R6SA 2DA7A 1IZ1A 4RGSA 3L2WA 3GTGJ 2IA2A 4UHTA 4BDYA 2BGCA 1J5YA 4N4OB 5EEAA 1YO5C 3SEZA 2DTRA 3QODA 3SFZA 3MWMA 4MTDA 3BQYA 4C2MJ 1W7PA 5CVUA 3PL8A 2HWVA 1XGNA 3H92A 3KEOA 2UZKA 4P96A 3IWZA 1MZBA 2Q2EB 3VEPA 4A3KJ 1L3LA 2FEZA 4AIHA 3GFIA 1FSEA 3F23A 3PUFA 1ZAOA 1HQCA 4BGDA 2XPUA 3CDLA 3IH4A 3TDZC 2QVOA 2D1HA 1W1WE 2E36A 3O8HA 3IHUA 3IL2A 3GLXA 1IO2A 3H5NA 1XDUA 1VQOI 4CZZA 1ERDA 3LA2A 1W0UA 4ENKA 3HOVJ 4Y52J 2CYYA 4KYWA 4B43A 4F3QA 3JSOA 2A6EF 4F55A 4D0PA 1S8NA 3DKXA 5L3EA 4KIFA 1MKMA 3KEQA 2CGPA 4ASNA 4WXDA 3W6VA 2YSRA 4ESJA 4ZDPA 1X2MA 3M3YJ 1QPMA 1QRYA 3JREA 1HF0A 1R1TA 5FFZA 5FKLA 1IDZA 1IG7A 2NS7A 1HKSA 2HYJA 4UB8C 2WB1N 1WJAA 5FKNA 3E6MA 3WODF 3IKTA 1BC7C 4N9IA 2PJRA 1DQUA 4DBQA 3P9IA 3FXKA 1R1UA 2GIVA 3AG4H 4BNCA 1WH7A 3LOCA 5D5VB 3CZ6A 4CCKA 1TWGJ 5F0HA 3F3XA 5KK1A 1R36A 1NG7A 3J81Z 1WI9A 1FOWA 3JRFA 2B0LA 3LSPA 3Q9VA 2LKSA 4P9FA 2R7WA 4IVNA 2HTJA 2AXTC 4NUBA 2GXAA 3S2DJ 3CDIA 3HUGA 2M0MA 1N75A 3P7NA 1U8RA 2RKHA 4CCOA 5IP9J 2CFOA 3K9TA 3GFJA 4RDUA 1HKTA 3O3KA 3ZMTA 2CSOA 3VWBA 1X3UA 1QGPA 2W1OA 3F72A 4IJAA 3S2WA 4XLHA 4QWQA 3JRDA 2DW4A 3ZMUA 1XDSA 4E7HA 1K61A 2CQXA 4CCMA 1OISA 3JRIA 4RB1A 1TWFJ 5AONA 3LFUA 2NYXA 3RYPA 1J09A 1FC3A 5F0FA 4B3AA 4RMNA 4G94A 3GWZA 1UMQA 1XCBA 2BY0A 4Y15A 1EH6A 5DV5A 3S16J 1IN4A 4HSTA 1G6NA 3R61A 5KNLA 1IN8A 2ZSHB 2PLYA 2QLZA 2O8XA 3BWGA 3PQKA 1R22A 3TBIA 4BU2A 2L7MP 1BA5A 3I56I 2K3PA 3T0YA 2DN0A 5GAEJ 4WXCA 1PVEA 3A0HC 2BXYA 3A2KA 4M72A 2X6YA 1UG0A 1OKRA 3FK6A 2XKOA 3E5QA 3ZQGA 3OYKA 1WRJA 5HS8A 5FJ8J 5DCFA 2VOOA 2WB1A 3PO3J 2H27A 1LEAA 3W2AA 3CDHA 2X1EA 2LBFA 1YX5A 3HOUJ 2XAJA 3ZRGA 3MN2A 3KP4A 5FRMA 3TMOA 3REOA 2EA4A 2D1VA 2H1KA 1YG2A 2EH3A 4YELA 1J75A 4EJVA 4ENMA 2ZNYA 4XQFA 3FM5A 3KP6A 4LD5A 2LOOA 2YU3A 1U9NA 5IT9Z 2XF6A 1BI3A 4I99C 2E1CA 2MLKA 3C2GA 2OPTA 3WTSC 4I0AA 2H94A 1JXSA 1W36C 3GYHX 3CCUI 2H8WA 2W7NA 1CF7B 2L9RA 2PJRB 3DCFA 5DCMA 4NC8A 3GX4X 4C2TA 5CVJA 5GP9A 2COMA 2A6HF 4I0BA 1FBQA 5E8IA 3ZN1A 2CV0A 5LHGA 4XOTA 3P5JA 2IJLA 2RQPA 3FXUA 2HKOA 4ZYHA 1WCMJ 3RPQA 1R5ID 3K1MA 2XB5A 2L4AA 1HDPA 3GF2A 1S7EA 3PSFA 3DKYA 1B4AA 2ZJPF 1FOXA 3EQLF 4BEHA 3VPRA 2IXSA 4UNOA 4KICA 1NG6A 4P1WA 2ELKA 3QOPA 1OCTC 2HQ5A 3LSHA 3A1YA 1B72A 4Y13A 1ENHA 1Z3YA 3WGHA 3BR5A 4KIGA 5F64A 2LD5A 2AQFA 4LK1F 4Q48A 4AVZA 4YFNF 1ZGAA 3AL0B 1I1GA 3S1RJ 1Q1VA 2A61A 2GQQA 3L1PA 5CJ9A 1A5JA 5EF6A 3ABLH 4WX9A 3COAC 1Z9CA 1T0FC 2Z99A 1N78A 1W5SA 3GTMJ 2CS3A 2RN7A 3BQZA 5HNFA 4QPQA 3L2CA 2EZIA 1YRNB 3I58A 1TT0A 3BCBA 4M73A 5FD6A 4E7LA 4DBRA 4UV8A 1VQNI 1HOMA 2DODA 3WE2A 1I3QJ 4XSXF 4FASD 1FYMA 1ZKGA 4XKCA 5E17F 2JVGA 4E6KG 2K9NA 4RB0A 3H5AA 1FMWA 2V9PA 2ZO4A 1R4NB 1PJRA 1JUSA 2VT2A 3S93A 1N77A 4G6QA 2QCOA 3NEUA 3HZJA 3RTRA 3RJPA 5CPRB 4A3DJ 3LSTA 4ZJZA 2RNGA 4YEJA 2GIZA 4IHVA 2IEKA 4PFPA 5L3FA 3RSNA 3ABKH 1YIJI 1PYVA 2NVQJ 4I6ZA 4ANJA 1V4RA 1Z6TA 3G71I 3O8GA 4XIDA 1X1PA 2RGVA 4IPAA 3ZGKA 4CYDA 2QA4I 1ETYA 4WWCA 3K70D 3S2HJ 3VB2A 2OZUA 4FE4A 1H88C 2Y30A 5K5RA 2DOAA 4F52A 1N25A 2E5ZA 1RC9A 4XLAA 4DIQA 3I53A 3I0TA 4V2FA 3E6DA 3I3LA 3WTXC 1Z7LA 1IXRC 4HPQA 3RPUA 3KP7A 3W6KB 1X1CA 4HF2A 3CMEI 2K5CA 1JKQC 4XONA 1VQ9I 3E6BA 1Z1DA 4HOBA 1UELB 2JPCA 4MEYF 2VLAA 4QLCU 3OS1A 1IV6A 1O57A 2OU2A 1JGSA 4GCVA 2F5CA 3OL4A 2RQQA 4CYCA 4XLNF 1JKOC 4IOAF 2UUZA 4XMYA 5CVIA 4J19A 2WAEA 3AAFA 5EYRA 2VIXA 2IRFG 3DF8A 3DKWA 3AG3H 2BE5F 2HPIA 1ZG3A 3OYEA 2E7WA 3DU5A 2LH9A 2DA3A 1HDDC 1O3RA 1X58A 2FNAA 4M9ZA 1PUFA 2O0YA 3ABTA 5H6QA 5E1ZB 3HG9A 5CKTA 2L3DA 2BW3B 2IA1A 2M4KA 5JFRA 2NS8A 2JA7J 3DPLC 5E20A 5ILVA 2LY9A 4KMFA 1ZR2A 4Q5SF 3F9KA 1OYIA 3IAS2 2DT7B 1XTAA 3BR1A 2DPDA 4FX4A 3H0GJ 1I6XA 2E1OA 4BE2A 4UUSB 1R5GA 1ZK8A 3JRBA 1S7AA 4LMYA 3HHGA 3WU1B 1WJ5A 2LKXA 2QSHX 3BLYA 3QQAA 1VQ8I 2YUSA 1KONA 1YW9A 4JK1X 1MW7A 4DZPA 1GXPA 4WK8F 4CCLA 3CMYA 1IRFA 1Z05A 3K69A 4C9YA 4HYEA 3EUKL 2QQ8A 3HOZJ 1QNTA 3BPXA 1SD4A 2M34A 3TL4X 2JT1A 1XX5A 2NNNA 2CFXA 3WHBA 3VOEA 2PI0A 2VL8A 2OQGA 1VQLI 3IWFA 2PFBA 4EGZA 2ID3A 2QYOA 3NWTA 1RETA 1EKEA 3SHFA 3B73A 1QU3A 1USSA 1S7OA 1OCOH 5BPIA 3MKLA 1F43A 2EV5A 2F5EA 2QQAA 2L7ZA 1UJ8A 5KVRA 2OTLI 1FBUA 2O9LA 4RAZA 4M3GA 2XSDC 4JX6A 2O7OA 2KFDA 5LHIA 2Y0SA 2ZSIB 3VYTB 1SAXA 2QBYA 3MZYA 3KZIC 5H20A 4IHSA 1KYZA 3DWLE 4HDUA 1S3JA 2KLOA 3FMRA 2NAZA 3M07A 1WJCA 4PJJA 3G73A 2MLGA 2DTZA 1KQ9A 4A5MA 4G6DA 2HU9A 3MEXA 1DGRM 3RZOJ 2Y75A 3JCUC 1ITYA 1TLHB 5HLGA 3CJRB 4BYYA 4MTEA 2DJIA 4DYCA 2GWRA 2D45A 5HVQC 4G7OF 4EQQA 1ZTRA 1TQMA 3J80K 1U5TC 4L5EA 5D5WB 3K4KA 4A0XA 1I50J 4ZYDA 2C6YA 2LREA 1WVRA 4HV6A 3GTJJ 4DZJA 2OC6A 3I59B 4UVCA 2JWTA 3GTKJ 5C4JJ 9ANTA 3ZXSA 2AO9A 4RAFA 2YX4A 2FNPA 3EYIA 3S1QJ 3BPVA 4IOCF 1KQ8A 2UWMA 4AIKA 2DQLA 4IX7A 3CUQA 1PP8F 1FJLA 1KU9A 2V1DA 1OCRH 1R00A 1XSXA 4BHCA 2KZVA 4LFUA 2DT5A 5FGMA 5JLWA 3FF5A 2KDZA 5ED4A 2E2IJ 1TP4A 1BJZA 2KP6A 1AKHA 3CJQB 1BM9A 1NK2P 2XASA 1NH3A 1NK3P 3T8TA 4DNCA 3P9CA 2XHKA 4L0YB 4FCYA 2P8TA 1LB2A 4LG3A 3L2QA 2ZMEB 2NVXJ 4BQAA 1T33A 3RQ4A 2FRHA 4CH7A 1MJAA 1Z0XA 1XSDA 5EGOA 4L9JA 3VFZA 1EV7A 1GVDA 2HQNA 3OYGA 3I5UA 1YS7A 5B3SH 5J1RA 4DYRA 1DDNA 3R4KA 1IN7A 4RAGA 4OOIA 2HVRA 4CA0A 5HODA 2LMDA 5J8CA 3QP6A 1VFCA 4BL0B 4OU0A 2EZHA 2ID6A 2LK2A 3OYFA 2PJPA 3BZ6A 3GBGA 4XLEA 2NOGA 1LUJB 2W57A 2YS9A 1STZA 3PIPF 3CCSI 2Q2EA 3JTHA 3V4GA 1SD7A 3KEYA 1B9MA 4EV0A 1BW6A 1WJEA 5F6FA 4AU7A 5HS9A 4XL9A 2MC3A 2DBBA 1SVOA 2KISA 2P81A 3MCZA 4EATA 3MFKA 2HZDA 5J4VA 3IH2A 4CSWA 2V6CA 2W85A 4M6VA 3IV5A 2QEXI 4BE0A 3V7SA 5GAHJ 1HW1A 2CUJA 3LSRA 1LNWA 2O8KA 2L9VA 2EK5A 3HOTA 2XKPA 2ESHA 3WTVC 3DBHB 4U0WA 3Q3SA 1OQYA 4GYGA 3BR3A 1H8AC 3JRCA 2LP0A 3LSIA 1H9TA 2WWYA 2F5FA 2JQ7A 3EPZA 4A3MJ 2N8GA 2P0WA 2P6TA 3FMQA 4PJMA 5CLSA 2DA4A 2P7VB 2CUFA 2EJRA 3PNVA 4RGXA 5HS7A 4AUXA 1JGGA 2OTJI 3LWFA 4IEJA 3W2WA 3G1MA 1MNDA 4XKWA 1HXDA 5LBQA 5TGTA 2L7FP 3LA7A 1FZPB 1OPCA 2DFFA 5K1YA 2BY1A 1B59A 2X1CA 4QTRA 4BQNA 1OR7A 3SXYA 2XGEA 4M3BA 4C3JJ 1D0XA 3ABUA 3HPHA 2X48A 1WH5A 4LLLA 2H1LA 3CD6I 4HNUA 4Q4ZF 5DM6F 1SFXA 1W4MA 3R0AA 3K0LA 3DTIA 3RYRA 2ECCA 1IUYA 1BN5A 2STWA 4X0GA 2E1MC 1MMAA 1ETXA 2CQNA 3OYJA 4KT6A 1WPKA 3OYAA 4FISA 3Q9SA 2VASA 1EA3A 1BI0A 2H09A 5J3LA 4GGGA 1LEBA 4FQGA 4PSWA 3EUHA 4BJ6C 3OS2A 3EDPA 2JA8J 5EG0B 3JTGA 2BVLA 1RUOA 1QZZA 2EZKA 3KE2A 5EGOB 4R79A 5FO5A 4J01A 4H0EA 1RKWA 2MD0A 3I54A 1FLIA 5IPAA 4MQ9F 3L2UA 1YX3A 1UG2A 1BIBA 2MD5A 1MSEC 1D0YA 2Y69H 2J5OA 3E6CC 3HKZN 1K6OA 2DOEA 2IGKA 2PMZA 3LQQA 3K4BA 2IGNA 3IRRA 4KNYA 1YS6A 3K10A 2P7CB 1WKMA 2KJCA 1AHDP 1MBKA 1FMVA 3RKQA 3VYSB 1ZARA 3J7ZI 3WGGA 4UVAA 1QBJA 4LLGF 1PDNC 5DUIA 5ILUA 2IP2A 1OCZH 4CZCA 3PFYA 3O6BB 1YITI 1HSTA 2VQGA 4EJWA 3JSPA 4HW0A 1K78B 3J7AO 1B1BA 1P2FA 2GZWA 2OA4A 2R3SA 4WXHA 2R7VA 2XAFA 4N0BA 2M45A 2OCEA 3C2BA 4PGHA 3FMSA 4BHBA 2X9DA 5HOOA 4HX7A 1AWCA 1G2HA 1VQ4I 3IH3A 3IKVA 5ICGA 1EJ9A 1ON1A 2Z33A 5JVGF 1O4XA 1TQIA 5GAGJ 2Y48A 4PJ0C 4YRVA 4CUGA 5J40A 2VQCA 1KA8A 1V3FA 1T8IA 1U2WA 1OMIA 1F36A 3D5SC 3F6OA 3K4CA 4EM1A 3BZKA 2CW7A 2K3FA 3R0JA 4L5IA 2A3SA 4IZZA 2KRCA 4IF4A 2XSJC 3FXRA 2KJBA 3QPTA 1X4PA 1CF7A 1Z21A 5F04A 2JA5J 4U7BA 3CCVI 3DFGA 1QZEA 4FETA 2KQRA 2R7XA 2QUFA 3V7RA 2FA5A 5FLXK 2ZNZA 2ZFUA 2MSYA 4V2GA 4BXXJ 3V42A 1XCVA 2AXLA 4R1HA 2VI6A 1USTA 4FTHA 2ZXWH 3SJMA 3PO2J 1JT0A 2K02A 1ZRFA 5FLVA 1OFCX 2L9SA 4DGWB 3DPTA 2RREA 2WTEA 3OIPA 1XG1A 2JSCA 3H3ZA 4MQVA 4A12A 2X6XA 1TWHJ 2F4OB 3VODA 4A3FJ 4YFXF 2I10A 3LL7A 2D5VA 1JUPA 2K85A 4UUTA 1LFBA 2V79A 4ENNA 3RZDJ 3JR9A 1OCCH 2OCCH 3M8FA 3BZCA 1SFUA 3HHHA 2R5ZB 4A2UA 1SD6A 4OIRF 5C3EJ 1YTYA 1GVJA 1SEUA 5FKMA 3BR0A 4CO8A 2PX9A 1HA8A 3FHNA 3F8NA 1RIOH 1JJ8C 2F6CA 2WV1A 2QKMB 4M3FA 4F7ZA 3MZ8A 3GXOA 2IBDA 4EM2A 5D5XB 2Z3YA 1K7AA 3H9GA 5LGUA 2P5KA 2FBKA 2WV0A 2XPWA 2QSFX 3ERMA 4OINF 2DI3A 1YRNA 2LF8A 3FIWA 1I3AA 3ZQLA 2V7FA 3FM3A 5F1RA 5EDNA 3PFIA 3CF5F 1ZG5A 2XAGA 4ZYAA 5H2FC 2X1DA 2KKOA 3GLLA 2V6EA 1IRGA 3ZMZA 2IGOA 2VC0A 3UKGA 4LB5A 3WE3A 2KRFA 1LVKA 3AG2H 3QOEA 1BI1A 2K9SA 2QSGX 3DLLF 4HEA2 1FPQA 3GVAA 1MMNA 1XMAA 4HV5A 5L3BA 3G6EI 1MBHA 1J9IA 1G3YA 1MDMB 3FDYA 2J5PA 5CVVA 1WJFA 1D5YA 2UXNA 2IVMA 2D2WA 3HOYJ 1R5HA 2P5LC 3BCAA 1BIAA 1DPUA 4M3DA 2FE3A 3M1CA 5ICCA 3IUOA 3K1NA 4AVPA 5TJJA 4Y3OA 1X1BA 2LY2A 2G7HA 2CV2A 2UV1A 1E0EA 1YI2I 5DTDA 4KA4A 3I4NJ 2L5QA 4W97A 4A69C 2JRMA 4BXUA 5IOZA 3F8CA 5FB2A 5HNHA 5E18F 3OYMA 1W36D 2FU4A 3Q0UA 2RAEA 4I09A 2CMPA 4GO1A 2ETHA 3TEDA 1TQPA 2KL4A 3OMYA 5EEHA 2QM3A 5E8GA 2PG4A 3V7CA 1A6QA 2PBIA 4XSZF 5DD8A 3ZPLA 4LJZF 2EIJH 3SDBA 2E19A 3KZYA 2VBYA 4XR6A 3GFMA 3M7GA 3F6VA 2IW5A 3PJRA 4HDVA 3CMMA 4HX4A 4L9VA 1LDJA 3K6GA 5AIQA 2HPMA 1FTTA 4CICA 3S3MA 2LTPA 1LFUP 2HGCA 1JHHA 1WHUA 3LMMA 3FWEA 1A36A 1D8JA 1WGXA 2L0KA 1GV5A 1Z3XA 4OIOF 3RKWA 3CLOA 5AIPA 2BW3A 1EF4A 5B66C 3KLOA 4UY8I 1RKTA 1P4AA 2O3FA 5CQGA 2X85A 2Y31A 1VI0A 2EFQA 2NRAC 4HBLA 2GXBA 3I4MJ 5D8LB 4D7MA 4BY1J 4N9HA 2MFZA 4IHYA 2V26A 2OZ6A 4UUSA 3FHZA 2B63J 1ZLJA 2F5VA 1U0JA 4IKFA 2FQ3A 4CCNA 2JPBA 2CG4A 3I9V2 1VQ7I 2DMQA 2LDUA 5LEJA 1IXSB 2M87A 2W48A 4CHUA 3S14J 3GZ6A 1E3PA 3I64A 2XAQA 1V54H 5F08A 3RIRA 3SYTA 4BBSJ 3ELKA 2A07F 5C4XJ 4OAZA 3HOSA 1P7JA 3KP2A 2Y9ZA 2ME0A 3CP2A 3ZOBA 1G4DA 1J7KA 3W6JB 3FXOA 1K4TA 4M9SA 4ETSA 2DJNA 4BJTA 2FMYA 1IN6A 2O03A 2PN6A 3WG7H 1YQAA 1FOKA 2UXXA 1R9TJ 2RVCA 3BTLA 2VJJA 5C44J 2Z5UA 2RV8A 2DK8A 3J81K 4BQOA 3M9AA 3LQRA 2ISYA 2DQRA 2E35A 2EFWA 1QHHD 2G9WA 3C1DA 1WQ2A 5GPCA 4YIFA 1MBJA 2EILH 3MKWB 1ZGJA 3HRMA 1RI7A 1IV8A 1VNDA 4Y17A 1IRZA 3S17J 1XMKA 3B6AA 2NOJB 5IY5H 3GFLA 1QVTA 4HZFA 5ILSA 2EPFA 1S72I 3GO5A 4L9TA 1FP1D 1ZYRF 3OOPA 5BS6A 3JRGA 2XPVA 4V19K 4E7JA 4J00A 1V5FA 1X1AA 3KPHA 2DA5A 3ZQFA 1CGPA 2GLOA 1J59A 1HBXG 3CESA 4EVIA 1DP3A 3TO7A 1S29A 3ZQHA 3I59A 1D0ZA 1UHMA 2KDOA 2DDBA 2WAQN 3C18A 5A2QK 4OAYA 1SVLA 2A5YB 1DP7P 1VQPI 4FE7A 4ZC3A 1DPRA 4A3BJ 4LG0B 3ZQQA 2V1XA 3K4NA 4BJ5C 1Z77A 3FXMA
chains in the Genus database with same CATH topology
3TOBA 2MBFA 3KCCA 1LJ9A 3V8JA 3SQNA 4L0ZB 3NQOA 4O5VA 1EH8A 1YFHA 2ZMEA 2VC1A 4XRFA 4ZZDA 3QU3A 2OQRA 1MGTA 3MZHA 1D5VA 1FT9A 2ZXJA 3T5XA 1YIOA 1BI2A 1LQ1A 3KETA 1H9GA 2QQBA 5D6FA 4CXFA 2DFIA 4KDPA 1FYLA 1UFMA 1A04A 4UVBA 3BY6A 4A6EA 5HLIA 1UCRA 3FXQA 4WCGA 1IN5A 1TTYA 4OIQF 1XSVA 2MH2A 2BV6A 2VXZA 2QZ8A 4I01A 4EM0B 1G3TA 1T98A 1FX7A 3B02A 4ZYGA 1FNNA 1J2XA 2FBIA 1R7JA 4I02A 5FD5A 2W24A 4IRHA 3RKYA 4A0ZA 1SFEA 4RGUA 1L0OC 2CQKA 3GZ5A 2Q0OA 1OYYA 5LHHA 4LLNA 1PP7U 3IRQA 1E2XA 1U6GA 3U2RA 1O7LA 2HYFA 1REPC 1H0MA 4TV7A 4LB6B 2QQ9A 4FX0A 1ZN2A 3C7JA 3E5XA 5HDNA 2ZCWA 1WWXA 3TOAA 2HTSA 4I7HA 5CVRA 4UUVA 2CW0F 3K1PA 1KU2A 5ERIA 2E1NA 3BOQA 3CUQC 3P9KA 2XRNA 1SMYF 5LGTA 3T1BA 3N97A 1U3EM 2AS5F 5H6RA 2F5DA 2WC2A 3ZMVA 3JAMK 1KU7A 4DQ2A 2VBXA 3L00A 2F2EA 2RNJA 1FSHA 1XGSA 1TNTA 2H6CA 4XBFA 4ESFA 2M30A 1C0WA 1K78A 3I71A 3CUOA 5DYMA 1P4XA 4KMUX 3WTWC 2EA2A 2GA1A 2L4MA 1PUEE 1W5TA 2XUBA 3WTYC 4O3MA 1G3WA 2FBHA 1I1SA 1U5TB 1HSJA 5LRRA 4P55A 2XV4S 4U0VA 5LRSA 5JVTA 1XB4A 2KIFA 3K2ZA 2ZJ2A 1F4KA 3ZMSA 2MA3A 4HAMA 3E5UA 2R7FA 4I98B 5JI6A 1FYKA 3BJ6A 2ISZA 4B8XA 3G3ZA 3FX3A 4A0YA 2ACJA 4HQEA 1I27A 2P5VA 4ENJA 2K27A 3ERED 1T6SA 3M1EA 3HYIA 3MAJA 4PGGA 2X4HA 4B09A 4HX8A 1ODDA 1P6RA 3DP7A 1KQ0A 4EJUA 4M6XA 3BJOA 3DXJF 2YR2A 2STTA 4NHJA 3CO7C 4EJOA 3CTAA 1NHAA 4G9YA 1IAWA 1MJBA 1QO0D 3TDUC 1I5ZA 3HRTA 3HRSA 3LAPA 2VONA 4FHTA 1J0RA 3ZN0A 2DU9A 5K5OA 5BMZA 1SD5A 2PMHA 4P9UA 1MDMA 3HTUA 1TNSA 4Z2YA 1G3SA 3WTZA 3ML6A 4RB2C 3CO6C 1ONVA 2QENA 2EV6A 1B9NA 3E3VA 1TW3A 1W7PD 2GAUA 1O7FA 3KP5A 5TRDA 2L02A 4M71A 4I2OA 1ZHFA 1P92A 2XVCA 2FMLA 1LVAA 3V8KA 4A6DA 4G7HF 2XAHA 2KIUA 3GW2A 2HR3A 2JRTA 3ZMDA 2YX7A 3DV8A 4AD9A 3BROA 2RDPA 2DK5A 3FZVA 3ECHA 2NNYA 1YW7A 2IPQX 4Q47A 2VE8A 4E70A 4AIJA 2XROA 1T2KA 1XD7A 3R60A 5BPDA 2DO7A 4EJTA 1HW5A 1KU3A 2DPUA 1F1ZA 1BJAA 4S05A 4KT5C 1E17A 4MGRA 2XIGA 4BHPA 1DUXC 2PMUA 5BQTA 4KN7X 3WU0A 3E97A 2P4WA 1RZ4A 3KFWX 4HA8A 2A68F 2VN2A 2A69F 4RAYA 2Y0MA 1S6LA 2EFNA 4IRGA 2E7XA 4NB5A 2OBPA 3L9FA 1LDDA 1W7PB 3EETA 5A2QZ 1IF1A 3L7WA 1ZRCA 4EGYA 2DLLA 4EMSA 1TW2A 5ICFA 2L54A 5L3DA 1RUNA 2EFPA 2K7LA 1XN7A 4ZYEA 4YFKF 3TO6A 1MD0A 3GUDA 3BP8A 4YG2F 3WG9A 1YYVA 4HLYA 4BAYA 3HTSB 1B6AA 3DQVC 5BOXA 3H3UA 3QRFF 2FSWA 5E1XA 1FWZA 4JQFA 4RGRA 2HZTA 1WSUA 2M8EA 1T39A 5HDKA 4MEXF 3KZZA 3LA3A 2JZYA 3WTUC 5D4RA 3PQJA 4R8HA 4U88A 4LG0A 2EWNA 4M74A 5DUKA 2CWEA 5D5UB 1UB9A 1T0FA 1ULYA 2FF4A 3DEUA 3TKYA 2Z9OA 3F21A 2IT0A 4ZZLA 2EFOA 3BJAA 3LFKA 5L3GA 3KLNA 5CYVA 1R23A 2BBYA 1ZG1A 1D3YA 3J80Z 1BC8C 2JTVA 2HYGD 5FFXA 5JR3A 3OV8A 5JHUA 2K86A 3MQ0A 3QP5A 5ICEA 5LGNA 3QU6A 4XLPF 3WTTC 4WF2A 2P6SA 1IXCA 3HIFA 1FP2A 1GXQA 2H6BA 1F9NA 2ZFWA 3ZP5A 2HEOA 4KFCA 4GYIA 1SMTA 3RKXA 1KYWA 4PZJA 1QZYA 2W25A 3HSRA 1HKQA 1Y0UA 4A5NA 4KN4X 3JAMZ 1ZREA 1YLFA 3HSFA 1XGMA 4LK0F 1O3TA 2O6GE 2IA0A 2HS5A 4RB3C 5DCMB 3D5LA 4HLXA 4RS8A 2EB7A 3U1DA 1EH7A 3O2PE 2G7UA 1FY7A 1KGSA 5D8KB 1O3SA 5D4SA 1Z7UA 3D0SA 4MHGA 3F22A 1XGOA 1Z6RA 5DD4A 2VODA 2XGXA 3JW4A 2LKPA 2HDCA 3TQNA 4G8XA 1Z91A 4G7ZF 4M6YA 4HF1A 5K5QA 3IC7A 5J8FA 4IXAA 3F8BA 4O6JA 2K4JA 2HKXA 5IT9K 2X0LA 3TO9A 4JBAA 2L01A 3ECOA 3HSEA 2MH9A 1TBXA 5DDGA 4LGWA 2BYVE 6PAXA 2ZBKA 3V8LA 2HQRA 1GHCA 2YPRA 5LLQA 2M1BA 5DEQA 1BBYA 3ISPA 3C3WA 1U5TA 2VE9A 1YW8A 5J6XA 1FBSA 5IT3A 1LDKB 3T8RA 1RNLA 4OIPF 4IHTA 3N4MA 5EEGA 3EYYA 2ESNA 1VTNC 4HQMA 1O3QA 3ULQB 2FOKA 2O61A 4IRIA 4GXOA 2HOEA 4L9NA 4KUMA 1UHWA 1T38A 2HFHA 1ZH5A 2LF7A 1ON2A 2GA2A 4L18B 1JE8A 3U9GA 4HF0A 4UV9A 2ELHA 2GXGA 4YIIA 3HRUA 2QWWA 5FLXZ 4OMYA 4ZH4F 5HLHA 3SZPA 3SZTA 4MNUA 4L5JA 4P5OA 4PDKA 2V9VA 4KIBA 1JHFA 1R58A 3TGNA 2ADUA 5LEKA 3ZQ7A 2V1UA 3NRVA 3GEZA 3Q5FA 2M5WA 1IW7F 1K79A 2Q8KA 3M8EA 4NQWA 2OAZA 4ESBA 2K4BA 2CO5A 3F8MA 1OYWA 2PEXA 3LAJA 2VBZA 3KP3A 2KIMA 2TDXA 4S04A 1HW2A 4M9XA 2QBYB 1BOAA 4FT8A 4AWXB 3WGIA 1MJ9A 1AOYA 3RI4A 2RC4A 5HDGA 4OMZA 4BH9A 2DAOA 5E1WA 2VT3A 3QAHA 2PQ8A 4PCQA 1F5TA 4ON0A 1D8KA 1QQIA 2VOPA 1ZLKA 2EV0A 2LNBA 2NS0A 2OD5A 3RDIA 3QPHA 1ZRDA 3ROUA 5L3CA 4K2EA 4CDGA 1P4WA 3CUQB 2ZKZA 3CJNA 1R1VA 2LSOA 4U0YA 5D6EA 2FXAA 3I4PA 4U7DA 2VBWA 4CGZA 3BDDA 2BEOA 2W84A 4UXNA 1U78A 1Q1HA 2R7DA 3F8FA 3L09A 3R6SA 1IZ1A 4RGSA 2IA2A 4UHTA 2BGCA 1J5YA 1YO5C 2DTRA 3SFZA 3MWMA 4MTDA 1W7PA 5CVUA 2HWVA 1XGNA 3H92A 3KEOA 2UZKA 4P96A 3IWZA 1MZBA 3VEPA 1L3LA 2FEZA 4AIHA 3GFIA 1FSEA 3F23A 1ZAOA 1HQCA 3TDZC 2QVOA 2D1HA 3IHUA 3IL2A 3GLXA 1XDUA 4CZZA 3LA2A 4ENKA 2CYYA 4KYWA 3JSOA 2A6EF 4D0PA 1S8NA 5L3EA 4KIFA 1MKMA 3KEQA 2CGPA 4ASNA 4WXDA 2YSRA 4ESJA 1QPMA 1R1TA 5FFZA 1HKSA 3WODF 3IKTA 1BC7C 3E6MA 4N9IA 3P9IA 1R1UA 2GIVA 4BNCA 5D5VB 3F3XA 5KK1A 1R36A 3J81Z 1WI9A 2B0LA 3Q9VA 4P9FA 4IVNA 2HTJA 3HUGA 3P7NA 1U8RA 2RKHA 3K9TA 3GFJA 1HKTA 3O3KA 3ZMTA 2CSOA 1X3UA 1QGPA 4IJAA 3F72A 3S2WA 4QWQA 2DW4A 3ZMUA 1XDSA 4RB1A 5AONA 2NYXA 3RYPA 1FC3A 4G94A 3GWZA 1XCBA 4Y15A 1EH6A 5DV5A 1IN4A 1G6NA 3R61A 1IN8A 2PLYA 2QLZA 2O8XA 3BWGA 3PQKA 1R22A 3T0YA 4WXCA 4M72A 1OKRA 2XKOA 3E5QA 1WRJA 5HS8A 2VOOA 5DCFA 2H27A 1LEAA 3CDHA 2XAJA 3KP4A 3REOA 2EA4A 2D1VA 1YG2A 1J75A 4EJVA 4ENMA 2ZNYA 3FM5A 3KP6A 4LD5A 2YU3A 5IT9Z 2E1CA 1BI3A 2MLKA 3WTSC 4I0AA 2H94A 1JXSA 3GYHX 1CF7B 5DCMA 3GX4X 5CVJA 2COMA 2A6HF 4I0BA 1FBQA 5E8IA 3ZN1A 5LHGA 2IJLA 2RQPA 3FXUA 2HKOA 4ZYHA 3RPQA 3K1MA 2L4AA 3GF2A 1B4AA 3EQLF 4UNOA 4KICA 3QOPA 4Y13A 3WGHA 4KIGA 5F64A 4LK1F 4Q48A 4YFNF 1ZGAA 1I1GA 2A61A 2GQQA 5CJ9A 4WX9A 3COAC 1Z9CA 2Z99A 1W5SA 2RN7A 3L2CA 3I58A 4M73A 5FD6A 4UV8A 3WE2A 4XSXF 1FYMA 5E17F 4RB0A 2ZO4A 2VT2A 4G6QA 3NEUA 3RTRA 3RJPA 3LSTA 5L3FA 1V4RA 1Z6TA 2RGVA 4IPAA 4CYDA 4WWCA 3VB2A 2OZUA 5K5RA 3I53A 3I0TA 3E6DA 3WTXC 1IXRC 3RPUA 3W6KB 3KP7A 4HF2A 3E6BA 1Z1DA 4HOBA 2JPCA 4MEYF 4QLCU 1O57A 2OU2A 1JGSA 4GCVA 2F5CA 4XLNF 5CVIA 3AAFA 2IRFG 3DF8A 3DKWA 2BE5F 1ZG3A 2E7WA 1O3RA 2FNAA 4M9ZA 2O0YA 3ABTA 5H6QA 5E1ZB 2L3DA 2IA1A 5JFRA 3DPLC 5E20A 5ILVA 4KMFA 4Q5SF 1OYIA 2DPDA 4FX4A 1I6XA 1R5GA 1S7AA 4LMYA 3HHGA 3WU1B 1YW9A 4JK1X 1GXPA 4WK8F 1IRFA 1Z05A 3K69A 4HYEA 1QNTA 3BPXA 1SD4A 2JT1A 2NNNA 2CFXA 2PI0A 3VOEA 2OQGA 3IWFA 2PFBA 4EGZA 2QYOA 3SHFA 3B73A 1USSA 1S7OA 5BPIA 2EV5A 2F5EA 2QQAA 5KVRA 1FBUA 4RAZA 5LHIA 1SAXA 2QBYA 3MZYA 5H20A 4IHSA 1KYZA 4HDUA 1S3JA 3FMRA 2NAZA 3G73A 2MLGA 1KQ9A 4A5MA 4G6DA 3MEXA 2Y75A 1TLHB 5HLGA 4BYYA 4MTEA 2GWRA 2D45A 5HVQC 4G7OF 4EQQA 1TQMA 3J80K 1U5TC 5D5WB 4A0XA 4ZYDA 2C6YA 4HV6A 3I59B 4UVCA 1KQ8A 2YX4A 2FNPA 3EYIA 3BPVA 2UWMA 4AIKA 2DQLA 1PP8F 3CUQA 1KU9A 2V1DA 1R00A 1XSXA 4BHCA 4LFUA 2DT5A 5FGMA 3FF5A 5ED4A 1BM9A 2XASA 3T8TA 4DNCA 3P9CA 2XHKA 4L0YB 1LB2A 2P8TA 2ZMEB 4BQAA 2FRHA 1MJAA 1XSDA 4L9JA 3VFZA 1EV7A 2HQNA 3I5UA 1YS7A 1DDNA 3R4KA 1IN7A 4OOIA 5J8CA 3QP6A 4OU0A 2PJPA 3BZ6A 2W57A 1STZA 2Q2EA 3JTHA 3V4GA 1SD7A 1B9MA 4EV0A 5F6FA 5HS9A 2MC3A 2DBBA 3MCZA 3MFKA 2V6CA 2W85A 3V7SA 1HW1A 1LNWA 2EK5A 3HOTA 2XKPA 2ESHA 3WTVC 4U0WA 4GYGA 1H9TA 2WWYA 2F5FA 2P6TA 3FMQA 5CLSA 2P7VB 2EJRA 4RGXA 5HS7A 3LWFA 1HXDA 5LBQA 3LA7A 1FZPB 1OPCA 5K1YA 1B59A 1OR7A 3SXYA 3ABUA 4LLLA 4Q4ZF 1SFXA 1W4MA 3R0AA 3K0LA 3RYRA 1IUYA 1BN5A 2STWA 3Q9SA 1BI0A 2H09A 4GGGA 1LEBA 3EUHA 3EDPA 3JTGA 1RUOA 1QZZA 3KE2A 4R79A 5FO5A 4H0EA 3I54A 1FLIA 4MQ9F 1BIBA 2MD5A 2J5OA 3E6CC 1K6OA 3LQQA 3IRRA 4KNYA 1YS6A 2P7CB 1WKMA 2KJCA 1ZARA 3WGGA 4UVAA 1QBJA 4LLGF 1PDNC 5DUIA 5ILUA 2IP2A 3O6BB 1HSTA 4EJWA 3JSPA 1K78B 4HW0A 3J7AO 1B1BA 1P2FA 2GZWA 2OA4A 2R3SA 4WXHA 2XAFA 4N0BA 2M45A 4PGHA 3FMSA 4BHBA 5HOOA 4HX7A 1AWCA 3IKVA 5ICGA 1ON1A 2Z33A 1TQIA 2Y48A 1KA8A 1V3FA 1U2WA 1OMIA 3F6OA 4EM1A 3R0JA 4L5IA 2A3SA 4IF4A 3FXRA 2KJBA 3QPTA 1CF7A 4U7BA 3DFGA 2QUFA 3V7RA 2FA5A 5FLXK 2ZNZA 1XCVA 2AXLA 4R1HA 1USTA 2K02A 1ZRFA 3DPTA 2WTEA 2JSCA 3H3ZA 4MQVA 4A12A 3VODA 4YFXF 2V79A 4ENNA 3M8FA 1SFUA 3HHHA 4A2UA 1SD6A 4OIRF 1YTYA 1GVJA 4CO8A 3F8NA 1RIOH 4F7ZA 3GXOA 4EM2A 5D5XB 2Z3YA 1K7AA 5LGUA 2P5KA 2FBKA 2WV0A 4OINF 2DI3A 2LF8A 3FM3A 5F1RA 3PFIA 1ZG5A 2XAGA 2KKOA 1IRGA 3ZMZA 2VC0A 4LB5A 3WE3A 2KRFA 1BI1A 1FPQA 3GVAA 1XMAA 4HV5A 5L3BA 1J9IA 1G3YA 1MDMB 2J5PA 5CVVA 2UXNA 2IVMA 2D2WA 1R5HA 2P5LC 1BIAA 1DPUA 2FE3A 5ICCA 3K1NA 4AVPA 5TJJA 2G7HA 4KA4A 4BXUA 5FB2A 5E18F 3F8CA 2FU4A 4I09A 4GO1A 2ETHA 1TQPA 5EEHA 2QM3A 5E8GA 2PG4A 3V7CA 2PBIA 4XSZF 5DD8A 3ZPLA 4LJZF 3KZYA 2VBYA 3GFMA 3M7GA 3F6VA 2IW5A 4HDVA 4HX4A 4L9VA 1LDJA 5AIQA 4CICA 2HGCA 1JHHA 1D8JA 3FWEA 4OIOF 3RKWA 3CLOA 5AIPA 3KLOA 1P4AA 2O3FA 2EFQA 2NRAC 4HBLA 2GXBA 5D8LB 4N9HA 2OZ6A 3FHZA 1ZLJA 2FQ3A 2JPBA 2CG4A 2LDUA 5LEJA 1IXSB 2M87A 4CHUA 3GZ6A 3I64A 2XAQA 3RIRA 3ELKA 2A07F 3HOSA 3KP2A 1G4DA 1J7KA 3W6JB 4M9SA 4ETSA 2FMYA 1IN6A 2O03A 2PN6A 1YQAA 1FOKA 2UXXA 2RVCA 2Z5UA 2RV8A 2DK8A 3J81K 3M9AA 3LQRA 2ISYA 2DQRA 2EFWA 2G9WA 3C1DA 1WQ2A 4YIFA 1ZGJA 3HRMA 1RI7A 4Y17A 1XMKA 3GFLA 4HZFA 5ILSA 3GO5A 4L9TA 1FP1D 1ZYRF 3OOPA 5BS6A 1CGPA 1J59A 1HBXG 4EVIA 3TO7A 1S29A 3I59A 1UHMA 5A2QK 3C18A 2A5YB 1DP7P 1DPRA 4LG0B 2V1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOB A;  2MBF A;  3KCC A;  1LJ9 A;  3V8J A;  3SQN A;  4L0Z B;  3NQO A;  4O5V A;  1EH8 A;  1YFH A;  2ZME A;  2VC1 A;  4XRF A;  4ZZD A;  3QU3 A;  2OQR A;  1MGT A;  3MZH A;  1D5V A;  1FT9 A;  2ZXJ A;  3T5X A;  1YIO A;  1BI2 A;  1LQ1 A;  3KET A;  1H9G A;  2QQB A;  5D6F A;  4CXF A;  2DFI A;  4KDP A;  1FYL A;  1UFM A;  1A04 A;  4UVB A;  3BY6 A;  4A6E A;  5HLI A;  1UCR A;  3FXQ A;  4WCG A;  1IN5 A;  1TTY A;  4OIQ F;  1XSV A;  2MH2 A;  2BV6 A;  2VXZ A;  2QZ8 A;  4I01 A;  4EM0 B;  1G3T A;  1T98 A;  1FX7 A;  3B02 A;  4ZYG A;  1FNN A;  1J2X A;  2FBI A;  1R7J A;  4I02 A;  5FD5 A;  2W24 A;  4IRH A;  3RKY A;  4A0Z A;  1SFE A;  4RGU A;  1L0O C;  2CQK A;  3GZ5 A;  2Q0O A;  1OYY A;  5LHH A;  4LLN A;  1PP7 U;  3IRQ A;  1E2X A;  1U6G A;  3U2R A;  1O7L A;  2HYF A;  1REP C;  1H0M A;  4TV7 A;  4LB6 B;  2QQ9 A;  4FX0 A;  1ZN2 A;  3C7J A;  3E5X A;  5HDN A;  2ZCW A;  1WWX A;  3TOA A;  2HTS A;  4I7H A;  5CVR A;  4UUV A;  2CW0 F;  3K1P A;  1KU2 A;  5ERI A;  2E1N A;  3BOQ A;  3CUQ C;  3P9K A;  2XRN A;  1SMY F;  5LGT A;  3T1B A;  3N97 A;  1U3E M;  2AS5 F;  5H6R A;  2F5D A;  2WC2 A;  3ZMV A;  3JAM K;  1KU7 A;  4DQ2 A;  2VBX A;  3L00 A;  2F2E A;  2RNJ A;  1FSH A;  1XGS A;  1TNT A;  2H6C A;  4XBF A;  4ESF A;  2M30 A;  1C0W A;  1K78 A;  3I71 A;  3CUO A;  5DYM A;  1P4X A;  4KMU X;  3WTW C;  2EA2 A;  2GA1 A;  2L4M A;  1PUE E;  1W5T A;  2XUB A;  3WTY C;  4O3M A;  1G3W A;  2FBH A;  1I1S A;  1U5T B;  1HSJ A;  5LRR A;  4P55 A;  2XV4 S;  4U0V A;  5LRS A;  5JVT A;  1XB4 A;  2KIF A;  3K2Z A;  2ZJ2 A;  1F4K A;  3ZMS A;  2MA3 A;  4HAM A;  3E5U A;  2R7F A;  4I98 B;  5JI6 A;  1FYK A;  3BJ6 A;  2ISZ A;  4B8X A;  3G3Z A;  3FX3 A;  4A0Y A;  2ACJ A;  4HQE A;  1I27 A;  2P5V A;  4ENJ A;  2K27 A;  3ERE D;  1T6S A;  3M1E A;  3HYI A;  3MAJ A;  4PGG A;  2X4H A;  4B09 A;  4HX8 A;  1ODD A;  1P6R A;  3DP7 A;  1KQ0 A;  4EJU A;  4M6X A;  3BJO A;  3DXJ F;  2YR2 A;  2STT A;  4NHJ A;  3CO7 C;  4EJO A;  3CTA A;  1NHA A;  4G9Y A;  1IAW A;  1MJB A;  1QO0 D;  3TDU C;  1I5Z A;  3HRT A;  3HRS A;  3LAP A;  2VON A;  4FHT A;  1J0R A;  3ZN0 A;  2DU9 A;  5K5O A;  5BMZ A;  1SD5 A;  2PMH A;  4P9U A;  1MDM A;  3HTU A;  1TNS A;  4Z2Y A;  1G3S A;  3WTZ A;  3ML6 A;  4RB2 C;  3CO6 C;  1ONV A;  2QEN A;  2EV6 A;  1B9N A;  3E3V A;  1TW3 A;  1W7P D;  2GAU A;  1O7F A;  3KP5 A;  5TRD A;  2L02 A;  4M71 A;  4I2O A;  1ZHF A;  1P92 A;  2XVC A;  2FML A;  1LVA A;  3V8K A;  4A6D A;  4G7H F;  2XAH A;  2KIU A;  3GW2 A;  2HR3 A;  2JRT A;  3ZMD A;  2YX7 A;  3DV8 A;  4AD9 A;  3BRO A;  2RDP A;  2DK5 A;  3FZV A;  3ECH A;  2NNY A;  1YW7 A;  2IPQ X;  4Q47 A;  2VE8 A;  4E70 A;  4AIJ A;  2XRO A;  1T2K A;  1XD7 A;  3R60 A;  5BPD A;  2DO7 A;  4EJT A;  1HW5 A;  1KU3 A;  2DPU A;  1F1Z A;  1BJA A;  4S05 A;  4KT5 C;  1E17 A;  4MGR A;  2XIG A;  4BHP A;  1DUX C;  2PMU A;  5BQT A;  4KN7 X;  3WU0 A;  3E97 A;  2P4W A;  1RZ4 A;  3KFW X;  4HA8 A;  2A68 F;  2VN2 A;  2A69 F;  4RAY A;  2Y0M A;  1S6L A;  2EFN A;  4IRG A;  2E7X A;  4NB5 A;  2OBP A;  3L9F A;  1LDD A;  1W7P B;  3EET A;  5A2Q Z;  1IF1 A;  3L7W A;  1ZRC A;  4EGY A;  2DLL A;  4EMS A;  1TW2 A;  5ICF A;  2L54 A;  5L3D A;  1RUN A;  2EFP A;  2K7L A;  1XN7 A;  4ZYE A;  4YFK F;  3TO6 A;  1MD0 A;  3GUD A;  3BP8 A;  4YG2 F;  3WG9 A;  1YYV A;  4HLY A;  4BAY A;  3HTS B;  1B6A A;  3DQV C;  5BOX A;  3H3U A;  3QRF F;  2FSW A;  5E1X A;  1FWZ A;  4JQF A;  4RGR A;  2HZT A;  1WSU A;  2M8E A;  1T39 A;  5HDK A;  4MEX F;  3KZZ A;  3LA3 A;  2JZY A;  3WTU C;  5D4R A;  3PQJ A;  4R8H A;  4U88 A;  4LG0 A;  2EWN A;  4M74 A;  5DUK A;  2CWE A;  5D5U B;  1UB9 A;  1T0F A;  1ULY A;  2FF4 A;  3DEU A;  3TKY A;  2Z9O A;  3F21 A;  2IT0 A;  4ZZL A;  2EFO A;  3BJA A;  3LFK A;  5L3G A;  3KLN A;  5CYV A;  1R23 A;  2BBY A;  1ZG1 A;  1D3Y A;  3J80 Z;  1BC8 C;  2JTV A;  2HYG D;  5FFX A;  5JR3 A;  3OV8 A;  5JHU A;  2K86 A;  3MQ0 A;  3QP5 A;  5ICE A;  5LGN A;  3QU6 A;  4XLP F;  3WTT C;  4WF2 A;  2P6S A;  1IXC A;  3HIF A;  1FP2 A;  1GXQ A;  2H6B A;  1F9N A;  2ZFW A;  3ZP5 A;  2HEO A;  4KFC A;  4GYI A;  1SMT A;  3RKX A;  1KYW A;  4PZJ A;  1QZY A;  2W25 A;  3HSR A;  1HKQ A;  1Y0U A;  4A5N A;  4KN4 X;  3JAM Z;  1ZRE A;  1YLF A;  3HSF A;  1XGM A;  4LK0 F;  1O3T A;  2O6G E;  2IA0 A;  2HS5 A;  4RB3 C;  5DCM B;  3D5L A;  4HLX A;  4RS8 A;  2EB7 A;  3U1D A;  1EH7 A;  3O2P E;  2G7U A;  1FY7 A;  1KGS A;  5D8K B;  1O3S A;  5D4S A;  1Z7U A;  3D0S A;  4MHG A;  3F22 A;  1XGO A;  1Z6R A;  5DD4 A;  2VOD A;  2XGX A;  3JW4 A;  2LKP A;  2HDC A;  3TQN A;  4G8X A;  1Z91 A;  4G7Z F;  4M6Y A;  4HF1 A;  5K5Q A;  3IC7 A;  5J8F A;  4IXA A;  3F8B A;  4O6J A;  2K4J A;  2HKX A;  5IT9 K;  2X0L A;  3TO9 A;  4JBA A;  2L01 A;  3ECO A;  3HSE A;  2MH9 A;  1TBX A;  5DDG A;  4LGW A;  2BYV E;  6PAX A;  2ZBK A;  3V8L A;  2HQR A;  1GHC A;  2YPR A;  5LLQ A;  2M1B A;  5DEQ A;  1BBY A;  3ISP A;  3C3W A;  1U5T A;  2VE9 A;  1YW8 A;  5J6X A;  1FBS A;  5IT3 A;  1LDK B;  3T8R A;  1RNL A;  4OIP F;  4IHT A;  3N4M A;  5EEG A;  3EYY A;  2ESN A;  1VTN C;  4HQM A;  1O3Q A;  3ULQ B;  2FOK A;  2O61 A;  4IRI A;  4GXO A;  2HOE A;  4L9N A;  4KUM A;  1UHW A;  1T38 A;  2HFH A;  1ZH5 A;  2LF7 A;  1ON2 A;  2GA2 A;  4L18 B;  1JE8 A;  3U9G A;  4HF0 A;  4UV9 A;  2ELH A;  2GXG A;  4YII A;  3HRU A;  2QWW A;  5FLX Z;  4OMY A;  4ZH4 F;  5HLH A;  3SZP A;  3SZT A;  4MNU A;  4L5J A;  4P5O A;  4PDK A;  2V9V A;  4KIB A;  1JHF A;  1R58 A;  3TGN A;  2ADU A;  5LEK A;  3ZQ7 A;  2V1U A;  3NRV A;  3GEZ A;  3Q5F A;  2M5W A;  1IW7 F;  1K79 A;  2Q8K A;  3M8E A;  4NQW A;  2OAZ A;  4ESB A;  2K4B A;  2CO5 A;  3F8M A;  1OYW A;  2PEX A;  3LAJ A;  2VBZ A;  3KP3 A;  2KIM A;  2TDX A;  4S04 A;  1HW2 A;  4M9X A;  2QBY B;  1BOA A;  4FT8 A;  4AWX B;  3WGI A;  1MJ9 A;  1AOY A;  3RI4 A;  2RC4 A;  5HDG A;  4OMZ A;  4BH9 A;  2DAO A;  5E1W A;  2VT3 A;  3QAH A;  2PQ8 A;  4PCQ A;  1F5T A;  4ON0 A;  1D8K A;  1QQI A;  2VOP A;  1ZLK A;  2EV0 A;  2LNB A;  2NS0 A;  2OD5 A;  3RDI A;  3QPH A;  1ZRD A;  3ROU A;  5L3C A;  4K2E A;  4CDG A;  1P4W A;  3CUQ B;  2ZKZ A;  3CJN A;  1R1V A;  2LSO A;  4U0Y A;  5D6E A;  2FXA A;  3I4P A;  4U7D A;  2VBW A;  4CGZ A;  3BDD A;  2BEO A;  2W84 A;  4UXN A;  1U78 A;  1Q1H A;  2R7D A;  3F8F A;  3L09 A;  3R6S A;  1IZ1 A;  4RGS A;  2IA2 A;  4UHT A;  2BGC A;  1J5Y A;  1YO5 C;  2DTR A;  3SFZ A;  3MWM A;  4MTD A;  1W7P A;  5CVU A;  2HWV A;  1XGN A;  3H92 A;  3KEO A;  2UZK A;  4P96 A;  3IWZ A;  1MZB A;  3VEP A;  1L3L A;  2FEZ A;  4AIH A;  3GFI A;  1FSE A;  3F23 A;  1ZAO A;  1HQC A;  3TDZ C;  2QVO A;  2D1H A;  3IHU A;  3IL2 A;  3GLX A;  1XDU A;  4CZZ A;  3LA2 A;  4ENK A;  2CYY A;  4KYW A;  3JSO A;  2A6E F;  4D0P A;  1S8N A;  5L3E A;  4KIF A;  1MKM A;  3KEQ A;  2CGP A;  4ASN A;  4WXD A;  2YSR A;  4ESJ A;  1QPM A;  1R1T A;  5FFZ A;  1HKS A;  3WOD F;  3IKT A;  1BC7 C;  3E6M A;  4N9I A;  3P9I A;  1R1U A;  2GIV A;  4BNC A;  5D5V B;  3F3X A;  5KK1 A;  1R36 A;  3J81 Z;  1WI9 A;  2B0L A;  3Q9V A;  4P9F A;  4IVN A;  2HTJ A;  3HUG A;  3P7N A;  1U8R A;  2RKH A;  3K9T A;  3GFJ A;  1HKT A;  3O3K A;  3ZMT A;  2CSO A;  1X3U A;  1QGP A;  4IJA A;  3F72 A;  3S2W A;  4QWQ A;  2DW4 A;  3ZMU A;  1XDS A;  4RB1 A;  5AON A;  2NYX A;  3RYP A;  1FC3 A;  4G94 A;  3GWZ A;  1XCB A;  4Y15 A;  1EH6 A;  5DV5 A;  1IN4 A;  1G6N A;  3R61 A;  1IN8 A;  2PLY A;  2QLZ A;  2O8X A;  3BWG A;  3PQK A;  1R22 A;  3T0Y A;  4WXC A;  4M72 A;  1OKR A;  2XKO A;  3E5Q A;  1WRJ A;  5HS8 A;  2VOO A;  5DCF A;  2H27 A;  1LEA A;  3CDH A;  2XAJ A;  3KP4 A;  3REO A;  2EA4 A;  2D1V A;  1YG2 A;  1J75 A;  4EJV A;  4ENM A;  2ZNY A;  3FM5 A;  3KP6 A;  4LD5 A;  2YU3 A;  5IT9 Z;  2E1C A;  1BI3 A;  2MLK A;  3WTS C;  4I0A A;  2H94 A;  1JXS A;  3GYH X;  1CF7 B;  5DCM A;  3GX4 X;  5CVJ A;  2COM A;  2A6H F;  4I0B A;  1FBQ A;  5E8I A;  3ZN1 A;  5LHG A;  2IJL A;  2RQP A;  3FXU A;  2HKO A;  4ZYH A;  3RPQ A;  3K1M A;  2L4A A;  3GF2 A;  1B4A A;  3EQL F;  4UNO A;  4KIC A;  3QOP A;  4Y13 A;  3WGH A;  4KIG A;  5F64 A;  4LK1 F;  4Q48 A;  4YFN F;  1ZGA A;  1I1G A;  2A61 A;  2GQQ A;  5CJ9 A;  4WX9 A;  3COA C;  1Z9C A;  2Z99 A;  1W5S A;  2RN7 A;  3L2C A;  3I58 A;  4M73 A;  5FD6 A;  4UV8 A;  3WE2 A;  4XSX F;  1FYM A;  5E17 F;  4RB0 A;  2ZO4 A;  2VT2 A;  4G6Q A;  3NEU A;  3RTR A;  3RJP A;  3LST A;  5L3F A;  1V4R A;  1Z6T A;  2RGV A;  4IPA A;  4CYD A;  4WWC A;  3VB2 A;  2OZU A;  5K5R A;  3I53 A;  3I0T A;  3E6D A;  3WTX C;  1IXR C;  3RPU A;  3W6K B;  3KP7 A;  4HF2 A;  3E6B A;  1Z1D A;  4HOB A;  2JPC A;  4MEY F;  4QLC U;  1O57 A;  2OU2 A;  1JGS A;  4GCV A;  2F5C A;  4XLN F;  5CVI A;  3AAF A;  2IRF G;  3DF8 A;  3DKW A;  2BE5 F;  1ZG3 A;  2E7W A;  1O3R A;  2FNA A;  4M9Z A;  2O0Y A;  3ABT A;  5H6Q A;  5E1Z B;  2L3D A;  2IA1 A;  5JFR A;  3DPL C;  5E20 A;  5ILV A;  4KMF A;  4Q5S F;  1OYI A;  2DPD A;  4FX4 A;  1I6X A;  1R5G A;  1S7A A;  4LMY A;  3HHG A;  3WU1 B;  1YW9 A;  4JK1 X;  1GXP A;  4WK8 F;  1IRF A;  1Z05 A;  3K69 A;  4HYE A;  1QNT A;  3BPX A;  1SD4 A;  2JT1 A;  2NNN A;  2CFX A;  2PI0 A;  3VOE A;  2OQG A;  3IWF A;  2PFB A;  4EGZ A;  2QYO A;  3SHF A;  3B73 A;  1USS A;  1S7O A;  5BPI A;  2EV5 A;  2F5E A;  2QQA A;  5KVR A;  1FBU A;  4RAZ A;  5LHI A;  1SAX A;  2QBY A;  3MZY A;  5H20 A;  4IHS A;  1KYZ A;  4HDU A;  1S3J A;  3FMR A;  2NAZ A;  3G73 A;  2MLG A;  1KQ9 A;  4A5M A;  4G6D A;  3MEX A;  2Y75 A;  1TLH B;  5HLG A;  4BYY A;  4MTE A;  2GWR A;  2D45 A;  5HVQ C;  4G7O F;  4EQQ A;  1TQM A;  3J80 K;  1U5T C;  5D5W B;  4A0X A;  4ZYD A;  2C6Y A;  4HV6 A;  3I59 B;  4UVC A;  1KQ8 A;  2YX4 A;  2FNP A;  3EYI A;  3BPV A;  2UWM A;  4AIK A;  2DQL A;  1PP8 F;  3CUQ A;  1KU9 A;  2V1D A;  1R00 A;  1XSX A;  4BHC A;  4LFU A;  2DT5 A;  5FGM A;  3FF5 A;  5ED4 A;  1BM9 A;  2XAS A;  3T8T A;  4DNC A;  3P9C A;  2XHK A;  4L0Y B;  1LB2 A;  2P8T A;  2ZME B;  4BQA A;  2FRH A;  1MJA A;  1XSD A;  4L9J A;  3VFZ A;  1EV7 A;  2HQN A;  3I5U A;  1YS7 A;  1DDN A;  3R4K A;  1IN7 A;  4OOI A;  5J8C A;  3QP6 A;  4OU0 A;  2PJP A;  3BZ6 A;  2W57 A;  1STZ A;  2Q2E A;  3JTH A;  3V4G A;  1SD7 A;  1B9M A;  4EV0 A;  5F6F A;  5HS9 A;  2MC3 A;  2DBB A;  3MCZ A;  3MFK A;  2V6C A;  2W85 A;  3V7S A;  1HW1 A;  1LNW A;  2EK5 A;  3HOT A;  2XKP A;  2ESH A;  3WTV C;  4U0W A;  4GYG A;  1H9T A;  2WWY A;  2F5F A;  2P6T A;  3FMQ A;  5CLS A;  2P7V B;  2EJR A;  4RGX A;  5HS7 A;  3LWF A;  1HXD A;  5LBQ A;  3LA7 A;  1FZP B;  1OPC A;  5K1Y A;  1B59 A;  1OR7 A;  3SXY A;  3ABU A;  4LLL A;  4Q4Z F;  1SFX A;  1W4M A;  3R0A A;  3K0L A;  3RYR A;  1IUY A;  1BN5 A;  2STW A;  3Q9S A;  1BI0 A;  2H09 A;  4GGG A;  1LEB A;  3EUH A;  3EDP A;  3JTG A;  1RUO A;  1QZZ A;  3KE2 A;  4R79 A;  5FO5 A;  4H0E A;  3I54 A;  1FLI A;  4MQ9 F;  1BIB A;  2MD5 A;  2J5O A;  3E6C C;  1K6O A;  3LQQ A;  3IRR A;  4KNY A;  1YS6 A;  2P7C B;  1WKM A;  2KJC A;  1ZAR A;  3WGG A;  4UVA A;  1QBJ A;  4LLG F;  1PDN C;  5DUI A;  5ILU A;  2IP2 A;  3O6B B;  1HST A;  4EJW A;  3JSP A;  1K78 B;  4HW0 A;  3J7A O;  1B1B A;  1P2F A;  2GZW A;  2OA4 A;  2R3S A;  4WXH A;  2XAF A;  4N0B A;  2M45 A;  4PGH A;  3FMS A;  4BHB A;  5HOO A;  4HX7 A;  1AWC A;  3IKV A;  5ICG A;  1ON1 A;  2Z33 A;  1TQI A;  2Y48 A;  1KA8 A;  1V3F A;  1U2W A;  1OMI A;  3F6O A;  4EM1 A;  3R0J A;  4L5I A;  2A3S A;  4IF4 A;  3FXR A;  2KJB A;  3QPT A;  1CF7 A;  4U7B A;  3DFG A;  2QUF A;  3V7R A;  2FA5 A;  5FLX K;  2ZNZ A;  1XCV A;  2AXL A;  4R1H A;  1UST A;  2K02 A;  1ZRF A;  3DPT A;  2WTE A;  2JSC A;  3H3Z A;  4MQV A;  4A12 A;  3VOD A;  4YFX F;  2V79 A;  4ENN A;  3M8F A;  1SFU A;  3HHH A;  4A2U A;  1SD6 A;  4OIR F;  1YTY A;  1GVJ A;  4CO8 A;  3F8N A;  1RIO H;  4F7Z A;  3GXO A;  4EM2 A;  5D5X B;  2Z3Y A;  1K7A A;  5LGU A;  2P5K A;  2FBK A;  2WV0 A;  4OIN F;  2DI3 A;  2LF8 A;  3FM3 A;  5F1R A;  3PFI A;  1ZG5 A;  2XAG A;  2KKO A;  1IRG A;  3ZMZ A;  2VC0 A;  4LB5 A;  3WE3 A;  2KRF A;  1BI1 A;  1FPQ A;  3GVA A;  1XMA A;  4HV5 A;  5L3B A;  1J9I A;  1G3Y A;  1MDM B;  2J5P A;  5CVV A;  2UXN A;  2IVM A;  2D2W A;  1R5H A;  2P5L C;  1BIA A;  1DPU A;  2FE3 A;  5ICC A;  3K1N A;  4AVP A;  5TJJ A;  2G7H A;  4KA4 A;  4BXU A;  5FB2 A;  5E18 F;  3F8C A;  2FU4 A;  4I09 A;  4GO1 A;  2ETH A;  1TQP A;  5EEH A;  2QM3 A;  5E8G A;  2PG4 A;  3V7C A;  2PBI A;  4XSZ F;  5DD8 A;  3ZPL A;  4LJZ F;  3KZY A;  2VBY A;  3GFM A;  3M7G A;  3F6V A;  2IW5 A;  4HDV A;  4HX4 A;  4L9V A;  1LDJ A;  5AIQ A;  4CIC A;  2HGC A;  1JHH A;  1D8J A;  3FWE A;  4OIO F;  3RKW A;  3CLO A;  5AIP A;  3KLO A;  1P4A A;  2O3F A;  2EFQ A;  2NRA C;  4HBL A;  2GXB A;  5D8L B;  4N9H A;  2OZ6 A;  3FHZ A;  1ZLJ A;  2FQ3 A;  2JPB A;  2CG4 A;  2LDU A;  5LEJ A;  1IXS B;  2M87 A;  4CHU A;  3GZ6 A;  3I64 A;  2XAQ A;  3RIR A;  3ELK A;  2A07 F;  3HOS A;  3KP2 A;  1G4D A;  1J7K A;  3W6J B;  4M9S A;  4ETS A;  2FMY A;  1IN6 A;  2O03 A;  2PN6 A;  1YQA A;  1FOK A;  2UXX A;  2RVC A;  2Z5U A;  2RV8 A;  2DK8 A;  3J81 K;  3M9A A;  3LQR A;  2ISY A;  2DQR A;  2EFW A;  2G9W A;  3C1D A;  1WQ2 A;  4YIF A;  1ZGJ A;  3HRM A;  1RI7 A;  4Y17 A;  1XMK A;  3GFL A;  4HZF A;  5ILS A;  3GO5 A;  4L9T A;  1FP1 D;  1ZYR F;  3OOP A;  5BS6 A;  1CGP A;  1J59 A;  1HBX G;  4EVI A;  3TO7 A;  1S29 A;  3I59 A;  1UHM A;  5A2Q K;  3C18 A;  2A5Y B;  1DP7 P;  1DPR A;  4LG0 B;  2V1X A; 
#chains in the Genus database with same CATH topology
 3TOB A;  4IHX A;  2MBF A;  2LVS A;  3KCC A;  1LJ9 A;  3V8J A;  4E7K A;  3SQN A;  4L0Z B;  3HPG A;  1YJW I;  3NQO A;  1RPW A;  3CC7 I;  1DU0 A;  1GV2 A;  4O5V A;  2MG4 A;  1EH8 A;  4IQ4 A;  2M2E A;  4CCJ A;  2ZME A;  3CCE I;  1YFH A;  5LFA A;  2VC1 A;  4XRF A;  1MNE A;  4ZZD A;  3QU3 A;  2HDW A;  2OQR A;  3A02 A;  5M3F J;  4GFB A;  1Y1V J;  2OF7 A;  1MGT A;  3MZH A;  2R0Q C;  1D5V A;  1FT9 A;  2ZXJ A;  3T5X A;  2R7Q A;  4XIC A;  3OSG A;  2VKV A;  1YIO A;  1BI2 A;  1LQ1 A;  4A3C J;  3KET A;  1H9G A;  2FQ4 A;  3QYB A;  2QQB A;  2DMT A;  3SZG A;  4BUP A;  3FKI J;  5D6F A;  4CXF A;  2DFI A;  4KDP A;  3ZQC A;  1FYL A;  3OWT A;  3LSJ A;  1UFM A;  1A04 A;  3W2V A;  3Q0V A;  5M5W J;  2DOF A;  2HXI A;  4UVB A;  4LIT A;  3H9Q A;  4B3X A;  1LE8 B;  2DDA A;  1ETO A;  3A01 A;  3BY6 A;  4A6E A;  5HLI A;  1UCR A;  2FOW A;  2LFB A;  3FXQ A;  4YIR X;  4WCG A;  2DMU A;  1IN5 A;  1TTY A;  4I76 A;  4OIQ F;  1XSV A;  4X6A J;  2MH2 A;  2BV6 A;  2VXZ A;  3MVP A;  2QZ8 A;  5J4Y A;  4I01 A;  2I5U A;  4EM0 B;  1ZEL A;  1G3T A;  1T98 A;  4RBO A;  1JKP C;  1FX7 A;  5EZG A;  3B02 A;  3ESW B;  4ZYG A;  1FNN A;  1DGW Y;  1J2X A;  2FBI A;  1K83 J;  1R7J A;  4I02 A;  3BTI A;  5FD5 A;  2W24 A;  4BAC A;  2VPR A;  4IRH A;  1ZQ3 P;  3BR2 A;  3DBL B;  3RKY A;  4A0Z A;  1SFK A;  1SFE A;  4RGU A;  3WHC A;  4D9J A;  2CW8 A;  1QHG A;  1L0O C;  2CQK A;  3GZ5 A;  2Q0O A;  1OYY A;  3CCY A;  2A05 A;  2CU7 A;  5LHH A;  1WI3 A;  4HNT A;  4LLN A;  1PP7 U;  2B7E A;  3IRQ A;  1E2X A;  2V9K A;  2KMU A;  3E1S A;  1MBF A;  1QPI A;  1U6G A;  3U2R A;  1GT0 C;  1O7L A;  2HYF A;  2VQH A;  2M0C A;  1REP C;  4ZDL A;  1H0M A;  3HM5 A;  4TV7 A;  3DU6 A;  4LB6 B;  2QQ9 A;  1V5G A;  1RR7 A;  4FX0 A;  1ZN2 A;  3C7J A;  3E5X A;  3DEW A;  3HGY A;  3ONQ A;  5HDN A;  3AKZ A;  2ZCW A;  1WWX A;  3PUB A;  3TOA A;  4XN3 A;  5FKO A;  2HTS A;  4I7H A;  5CVR A;  5J1U A;  4UUV A;  4XM3 A;  2VKD A;  5DS9 A;  2CW0 F;  3K1P A;  1KU2 A;  5EG0 A;  5ERI A;  2E1N A;  3BOQ A;  3CUQ C;  5E79 C;  1CQT A;  3MMY B;  3P9K A;  2XRN A;  3BTC A;  1SMY F;  1T95 A;  4JOM A;  5LGT A;  1SAU A;  3DPU A;  3T1B A;  3N97 A;  1U3E M;  2AS5 F;  1VQK I;  5H6R A;  2F5D A;  2WC2 A;  5GAD J;  3ZMV A;  3JAM K;  1KU7 A;  2NVT J;  1T08 B;  1HC8 A;  4DQ2 A;  1GDT A;  5CQE A;  3FBN B;  1A6I A;  2FD5 A;  2VBX A;  4Y4R A;  3L00 A;  2F2E A;  4LIV A;  2RNJ A;  1FSH A;  3QPL A;  3J7Y J;  4Z6Y A;  4ITV A;  1XGS A;  2KHM A;  1TNT A;  3LSG A;  2EIK H;  2H6C A;  4XBF A;  2R7R A;  4ESF A;  2M30 A;  3OYI A;  1C0W A;  1K78 A;  1P9Q C;  3A01 B;  3VSL A;  1R6R A;  1S9H A;  1AA7 A;  1X4O A;  3I71 A;  3CUO A;  4DJA A;  3DLA A;  2NVU B;  5DYM A;  2VKH A;  1P4X A;  4KMU X;  4XNF A;  3WTW C;  2EA2 A;  1GLN A;  2GA1 A;  2L4M A;  1OLT A;  2V4J C;  3IP4 B;  5M5Y J;  3DEE A;  1PUE E;  1W5T A;  2XUB A;  3WTY C;  4O3M A;  1G3W A;  2FBH A;  1I1S A;  1U5T B;  1HSJ A;  3A4C A;  5LRR A;  2I8D A;  4XKV A;  4P55 A;  2XV4 S;  4U0V A;  1D1C A;  5LRS A;  3C2H A;  2F4M B;  5JVT A;  1FOY A;  1XB4 A;  2KIF A;  2OV7 A;  3K2Z A;  4XK4 A;  2ZJ2 A;  2FUG 2;  4PUS A;  1F4K A;  4XRS G;  3OSF A;  3ZMS A;  5E3N A;  4QSH A;  2MA3 A;  1FIA A;  2R92 J;  3BG5 A;  3BC8 A;  4HAM A;  1SC7 A;  2E60 A;  3G2B A;  3E5U A;  2R7F A;  4I98 B;  1HLV A;  1H89 C;  5JLX A;  5JI6 A;  1FYK A;  3JRA A;  1IGN A;  2MW8 A;  3BJ6 A;  4XRS A;  3LNQ A;  2ISZ A;  4Y7N J;  4B8X A;  2AHQ A;  2WBM A;  3G3Z A;  3FX3 A;  4XN0 A;  4F92 B;  4A0Y A;  2ACJ A;  4HQE A;  1I27 A;  1GUU A;  4F93 B;  2P5V A;  4ENJ A;  3S1N J;  5IOY A;  2K27 A;  3ERE D;  1T6S A;  2MAB A;  3M1E A;  4HRI A;  5BNG A;  3QYE A;  3HYI A;  3MAJ A;  4BXF A;  1VQ5 I;  4AID A;  2R5Z A;  4PGG A;  4LOC A;  2X4H A;  5M5X J;  1T56 A;  4B44 A;  2E71 A;  1XPX A;  3HGG A;  4B09 A;  1OR7 C;  2K9Q A;  4HX8 A;  1ODD A;  1P6R A;  1Y6I A;  3DP7 A;  1KQ0 A;  3QYF A;  1U9O A;  3BR6 A;  3NAU A;  4RM2 A;  4BY7 J;  1G59 A;  1ETQ A;  4EJU A;  4M6X A;  3BJO A;  3CCL I;  3DXJ F;  2YR2 A;  2STT A;  2A6T A;  3CP8 A;  4NHJ A;  3CO7 C;  3OR1 C;  1HCR A;  4JYK A;  5E3M A;  3AG1 H;  1X1D A;  4EJO A;  3OYD A;  3CTA A;  3EUH C;  1NHA A;  2JSP A;  4G9Y A;  3SFI A;  2R5Y B;  1IAW A;  1MJB A;  1QO0 D;  3BTJ A;  2BVM A;  2M3A A;  3GME A;  5IYB J;  5B5E C;  3S3O A;  5FRO A;  2JUG A;  3TDU C;  3KYC B;  4XOR A;  1I5Z A;  4PK4 A;  3HRT A;  3HRS A;  4E7S A;  4KJZ A;  3LAP A;  2R7T A;  2VON A;  4FHT A;  3PM1 A;  2VJI A;  4BE1 A;  1J0R A;  4A3I J;  3ZN0 A;  2DU9 A;  5K5O A;  5BMZ A;  3PNT A;  2WY8 Q;  1SD5 A;  2PMH A;  2E34 A;  2KRH A;  4P9U A;  1BW5 A;  4NQW B;  1R49 A;  2KT0 A;  1MDM A;  3HTU A;  4IHW A;  1TNS A;  4Z2Y A;  2ICW G;  2HNH A;  1G3S A;  3WTZ A;  3ML6 A;  4RB2 C;  2CH0 A;  1I6H J;  2R7O A;  2L9N A;  3CO6 C;  1ONV A;  2QEN A;  2EV6 A;  1B9N A;  3E3V A;  1VQ6 I;  3ABM H;  1TW3 A;  3S8P A;  1DU6 A;  1W7P D;  2GAU A;  1O7F A;  5GTH C;  1UZC A;  3KP5 A;  5TRD A;  2L02 A;  4M71 A;  4I2O A;  1ZHF A;  1P92 A;  2XVC A;  3U1K A;  2FML A;  1LVA A;  3V8K A;  3K4M A;  4A6D A;  3NAR A;  4G7H F;  1MH3 A;  5JHF A;  3PIO F;  2XAH A;  2KIU A;  4B4C A;  1AU7 A;  1TT5 B;  3GW2 A;  2HR3 A;  1Z67 A;  2JRT A;  3D5R C;  2E1M B;  3ZMD A;  2CUZ A;  2YX7 A;  1VZ0 A;  3DV8 A;  3A03 A;  4AD9 A;  3K7A J;  1W5C C;  2XGD A;  3BRO A;  2RDP A;  3ZQI A;  2DK5 A;  3HKZ A;  4E7Z A;  3FZV A;  3KYD B;  3HDD A;  2F4I A;  3ECH A;  2NNY A;  1YW7 A;  2IPQ X;  4Q47 A;  2VE8 A;  4E70 A;  3FIS A;  4GDF A;  5F27 A;  4AIJ A;  4MO7 A;  1LPQ A;  2XRO A;  4HSR A;  1T2K A;  1XD7 A;  3R60 A;  5BPD A;  2DO7 A;  4EJT A;  4XKB A;  5IYC J;  1HW5 A;  5GTI C;  1KU3 A;  3UNG C;  2DPU A;  1F1Z A;  1BJA A;  4C2U A;  1B8I B;  2W4S A;  2IS2 A;  3CQZ J;  3F0C A;  1ETW A;  4S05 A;  4KT5 C;  2DXI A;  1JTY A;  3LSM A;  2Z2S B;  2X51 A;  1E17 A;  4MGR A;  2XIG A;  4BHP A;  1IDY A;  1LFP A;  1DUX C;  2PMU A;  5BQT A;  5FLM J;  4KN7 X;  4UB6 C;  3WU0 A;  3E97 A;  4IQJ A;  2P4W A;  1RZ4 A;  3KFW X;  4HA8 A;  1BR2 A;  1TWA J;  2A68 F;  1BOB A;  2VN2 A;  4LIU A;  3TP3 A;  4BQQ A;  3TW7 A;  2A69 F;  4IL6 C;  4RAY A;  2BOL A;  1ACI A;  2Y0M A;  2OJE D;  1S6L A;  2EFN A;  1X3Z B;  3CJT B;  1FEX A;  4IRG A;  2GOX B;  3CCM I;  2YU9 J;  2E7X A;  4NB5 A;  2OBP A;  1V55 H;  3CLQ A;  4GRI A;  2DT6 A;  4XLC A;  4F91 B;  3L9F A;  3H36 A;  1WJD A;  1YJN I;  2WAF A;  1LDD A;  1Y1W J;  1W7P B;  3OYC A;  3EET A;  5A2Q Z;  2HVQ A;  3AL0 C;  1IF1 A;  3L7W A;  1ZRC A;  3AFH A;  2LG4 A;  1SVM A;  2BY2 A;  2DLL A;  3M8J A;  4EGY A;  4EMS A;  2EIN H;  1TW2 A;  5ICF A;  5F0C A;  4A93 J;  4NBQ A;  3VYU B;  2L54 A;  2XGC A;  5L3D A;  1RUN A;  3S15 J;  1ETV A;  2IGM A;  1TC3 C;  2EFP A;  1D1A A;  1MNM C;  2K7L A;  5IP7 J;  2DMP A;  1LKX A;  1POG A;  3Q0W A;  3VDX A;  2IS4 A;  2E5N A;  1ETK A;  3H5R A;  1XN7 A;  4HNV A;  2MYS A;  4ZYE A;  1IRX A;  4YFK F;  3TO6 A;  3FK7 A;  4NDL A;  1MD0 A;  3GUD A;  2M4G A;  3BP8 A;  4YG2 F;  5KHD A;  2ZJR F;  3WG9 A;  1YYV A;  4HLY A;  5DM7 F;  4BAY A;  3OYN A;  1M1E B;  2HVS A;  4X1E A;  3OIQ A;  5GPA A;  3BG7 A;  3HTS B;  1B6A A;  2H8R A;  2R7Z J;  4QPO A;  3DQV C;  3HOX J;  4RLQ A;  2QF7 A;  5BOX A;  3H3U A;  2ECB A;  3QRF F;  2FSW A;  2TRT A;  5E1X A;  1FWZ A;  2KZG A;  3G4S I;  4JQF A;  1WZ2 A;  3QWL A;  4RGR A;  1X2N A;  1D1B A;  2HDD A;  2EQR A;  2HZT A;  1Y8Q B;  1WSU A;  2M8E A;  4KIT B;  1T39 A;  1UHS A;  5HDK A;  4MEX F;  1OJL A;  3KZZ A;  2VXD A;  3LA3 A;  3IAM 2;  2IS1 A;  2A5W A;  2JZY A;  2Q1Z B;  3WTU C;  1ZGW A;  2DFE A;  1UAA A;  4A3L J;  5D4R A;  3PQJ A;  2GBY A;  4R8H A;  4E4H A;  4U88 A;  2WAD A;  4C3H J;  3OYH A;  1TL8 A;  4LG0 A;  2DA2 A;  3A0B C;  3FXL A;  2E2J J;  2EWN A;  2JN6 A;  4M74 A;  5DUK A;  2VB6 A;  2CWE A;  5D5U B;  3HUG B;  1UB9 A;  1T0F A;  1ULY A;  2FF4 A;  3DEU A;  2ME6 A;  3TKY A;  2Z9O A;  2VJ4 A;  3K2A A;  3F21 A;  4S0H B;  2HOT A;  2IT0 A;  4ZZL A;  2EFO A;  1Y56 A;  3BJA A;  3LFK A;  1MMS A;  5L3G A;  3E0J B;  2CV1 A;  3KLN A;  2JUC A;  1V5E A;  2W82 A;  5CYV A;  4NC6 A;  2WY7 Q;  2EBI A;  1MMG A;  2XF7 A;  1K6Y A;  2LYC A;  3D1N I;  1R23 A;  2BBY A;  3DBR B;  1ZG1 A;  3RQI A;  1D3Y A;  3J80 Z;  4G6T B;  4XOP A;  1BC8 C;  2JTV A;  5K7H A;  2HYG D;  3K4L A;  5FFX A;  5JR3 A;  2CUE A;  3OV8 A;  2L7K A;  2ZC2 A;  3RCO A;  3KYL A;  2R7U A;  2EZL A;  5IYD J;  5JHU A;  2VUM J;  3VYR B;  3CC4 I;  2JVH A;  2K86 A;  4Y33 A;  2HOS A;  3MQ0 A;  3L2V A;  3QP5 A;  5ICE A;  5LGN A;  3QU6 A;  4AYB N;  4XLP F;  3FXJ A;  2CQ7 A;  3WTT C;  3GTP J;  4JX5 A;  3HJE A;  4WF2 A;  2P6S A;  2FJ1 A;  1IXC A;  1YE9 A;  3B6C A;  4MFD A;  3S1M J;  2JA2 A;  2K9L A;  3HIF A;  1XS9 A;  1FP2 A;  1GXQ A;  2X6O A;  1YJ9 I;  2VQL A;  2H6B A;  1F9N A;  2ZFW A;  3ZP5 A;  1LE8 A;  2LLK A;  4PJL A;  4ZDO A;  4D1Q A;  1JJ6 C;  2HEO A;  4KFC A;  5KAF C;  3N05 A;  3HBL A;  2LBF B;  4BS9 A;  1JT6 A;  1WJB A;  3CCJ I;  4GYI A;  2CQQ A;  1SMT A;  2JJ7 A;  2G0E A;  4NC7 A;  3RKX A;  2KIQ A;  1A35 A;  1KYW A;  3K70 C;  4PZJ A;  3S32 A;  2KPM A;  1QZY A;  1MMD A;  2W25 A;  3HSR A;  2MC4 A;  4BKX A;  2OUM A;  3BG9 A;  3H9J A;  1HKQ A;  1Y0U A;  4A5N A;  4KN4 X;  3JAM Z;  1ZRE A;  1YLF A;  3HSF A;  1XGM A;  4LK0 F;  1O3T A;  2EIM H;  2E2H J;  3PNY A;  2O6G E;  2IA0 A;  2HS5 A;  2LC2 A;  4G12 A;  4RB3 C;  5DCM B;  3GTO J;  1ORK A;  2FX0 A;  3D5L A;  4DYQ A;  5J1Y A;  4HLX A;  1S5L C;  2EB7 A;  2AQE A;  4RS8 A;  2R4G A;  3U1D A;  1YHQ I;  2LR8 A;  3GTQ J;  1EH7 A;  2V1N A;  3O2P E;  1SFO J;  2G7U A;  2XRL A;  1FY7 A;  1KGS A;  2JK3 A;  3U21 A;  4W1U A;  2DYS H;  5D8K B;  5FKK A;  3OIO A;  1O3S A;  5D4S A;  2BY3 A;  3I55 I;  1JKR C;  1Z7U A;  3KX2 A;  3D0S A;  4MHG A;  4PSX A;  2ZJQ F;  2DFH A;  3F22 A;  1XGO A;  1Z6R A;  2Y0S N;  5DD4 A;  4EEF G;  2VOD A;  2XGX A;  3DTE A;  4BEH B;  1X19 A;  3OL3 A;  3JW4 A;  2CJJ A;  3PSI A;  4AYB A;  2LKP A;  3FKJ A;  2HDC A;  4MIM A;  4XLF A;  4G8X A;  1Z91 A;  3BG3 A;  3RPU D;  3TQN A;  4G7Z F;  3MD2 A;  1R71 A;  1B72 B;  1QVU A;  4M6Y A;  4A3G J;  3H1C A;  5E3L A;  3IC7 A;  5K5Q A;  4HF1 A;  3KIO A;  1E3H A;  3FBI B;  5J8F A;  1SAN A;  4II2 A;  4IXA A;  3F8B A;  4O6J A;  2K4J A;  1Y8R B;  5EJC A;  2HKX A;  4AC0 A;  5J47 A;  5IT9 K;  1MBE A;  2IAI A;  4D5F A;  4ZTF A;  3HEF A;  2X0L A;  3TO9 A;  1QA6 A;  4JBA A;  3WU2 C;  2L01 A;  3SDG A;  3ECO A;  2XDV A;  3HSE A;  2Z1D A;  1W0T A;  2QGU A;  2NVY J;  2HI3 A;  3OR2 C;  2ZME C;  4BBR J;  4D7N A;  2MH9 A;  1TBX A;  5DDG A;  4LGW A;  1RRJ A;  1IUF A;  4E7I A;  1A31 A;  1G8X A;  2QKL B;  3G1O A;  2DCE A;  5EZH A;  2BYV E;  2BHY A;  6PAX A;  2ZBK A;  4C30 A;  3V8L A;  2HQR A;  5E3O A;  1GHC A;  4RLF A;  2YPR A;  5LLQ A;  2ZB9 A;  3CC2 I;  2M1B A;  5DEQ A;  1BBY A;  3CMA I;  1ZR4 A;  3MKY B;  3HL2 A;  2CRG A;  2WAQ A;  3ISP A;  2VJ5 A;  4M3E A;  1RES A;  3OS0 A;  4A3E J;  1MH4 A;  3H35 A;  3C3W A;  1U5T A;  3HXL A;  3L2R A;  2L2O A;  2VE9 A;  5IP6 A;  1YW8 A;  5J6X A;  2WA0 A;  1FBS A;  5IT3 A;  1LDK B;  4RM3 A;  1XC5 A;  3T8R A;  1RNL A;  4KIS A;  2VKE A;  4OIP F;  4IHT A;  3N4M A;  1RR8 C;  4XRM A;  4B47 A;  5EEG A;  3EYY A;  2ESN A;  1VTN C;  4HQM A;  5K7F A;  3NWS A;  2M9H A;  2ZXI A;  3DTK A;  2VPL A;  2W00 A;  3K4J A;  2BXZ A;  3SEQ A;  4PFO A;  1R4M B;  5KAI C;  5F1J A;  4CYC B;  1O3Q A;  3HC7 A;  3ULQ B;  2FOK A;  2O61 A;  4IRI A;  4GXO A;  2HOE A;  4L9N A;  4KUM A;  1UHW A;  5B1A H;  3GTL J;  1T38 A;  1JTX A;  1PUF B;  2HFH A;  2DA6 A;  4RA2 A;  1ZH5 A;  4PJN A;  2LF7 A;  4DOZ A;  1ON2 A;  3EUA A;  2GA2 A;  4L18 B;  1JE8 A;  3U9G A;  1YOV B;  3ZR8 X;  1BR4 A;  4HF0 A;  1FIP A;  4UV9 A;  2ELH A;  1E3O C;  2GXG A;  4YII A;  3CCQ I;  3HRU A;  3LSK A;  3E7L A;  4B1R A;  1I39 A;  2HXO A;  2QWW A;  3OY9 A;  3HB9 A;  3TW6 A;  1XMX A;  4ZTJ A;  2XB0 X;  5FLX Z;  4OMY A;  4ZH4 F;  5HLH A;  3SZP A;  3SZT A;  4U87 A;  4MNU A;  4L5J A;  4P5O A;  4PDK A;  2V9V A;  4KIB A;  1JHF A;  2JA6 J;  3TP0 A;  3BG6 A;  1R58 A;  5K7Z A;  3TGN A;  3OYB A;  3ASN H;  1APL C;  2ADU A;  2Z16 A;  2Y9Y A;  2R7S A;  2R5Y A;  3H0D A;  2DYR H;  2JMW A;  3ZQ7 A;  5LEK A;  3HOW J;  3GZN B;  2V1U A;  1JI8 A;  3GCM A;  3NRV A;  4JP0 A;  3GEZ A;  3OYL A;  3JRH A;  3Q5F A;  2M5W A;  1OCP A;  2BZT A;  3BT9 A;  1IW7 F;  3J7A Y;  3CF2 A;  1K79 A;  2Q8K A;  2NXN B;  4QIW N;  3MKZ A;  4JX4 A;  2M8G X;  3M8E A;  2Y2Z A;  4OWR B;  2DMN A;  4ABZ A;  3W3C A;  4HG2 A;  4NQW A;  4D5C A;  1KZH A;  2OAZ A;  1K4S A;  4ESB A;  2K4B A;  2CO5 A;  3F8M A;  4NNJ A;  1OYW A;  2B9S A;  2PEX A;  1WFX A;  2ZXH A;  2O5R A;  3LAJ A;  2VBZ A;  2BHZ A;  2GOM A;  3KP3 A;  2KIM A;  2TDX A;  4DW6 A;  3CCR I;  3VSK A;  3QPS A;  1IC8 A;  4S04 A;  1HW2 A;  4M9X A;  1MIJ A;  2QBY B;  4II3 A;  1BOA A;  4FT8 A;  1MSF C;  1FTZ A;  5TIS C;  2GM4 A;  2PMZ N;  5B1B H;  4AWX B;  3WGI A;  1MJ9 A;  3M4O J;  1AOY A;  3RI4 A;  2RC4 A;  2COB A;  5HDG A;  1TZL A;  4OMZ A;  1Y0N A;  1TWC J;  5M3M J;  4BH9 A;  2DAO A;  5E1W A;  2VT3 A;  3QAH A;  4MLO A;  1JUM A;  2F48 A;  2PQ8 A;  4PCQ A;  1F5T A;  4ON0 A;  3G1L A;  2LRD A;  1P7I A;  2ELJ A;  3UR3 C;  1D8K A;  2M7B A;  1QQI A;  3OOU A;  5LD2 C;  2XC7 A;  2VOP A;  1ZLK A;  2EV0 A;  2LNB A;  2NS0 A;  2OD5 A;  3RDI A;  3QPH A;  1ZRD A;  3ROU A;  2DA1 A;  5L3C A;  4B48 A;  4K2E A;  5FRN A;  3H3V K;  1X3W B;  4CDG A;  1P4W A;  3CUQ B;  1Y39 A;  2ZKZ A;  1U8B A;  2XAU A;  3X2Q H;  4MFE A;  3CJN A;  1R1V A;  2XF5 A;  2LSO A;  4H4K C;  3ZCO A;  4U0Y A;  5D6E A;  4AM3 A;  1VF9 A;  2FXA A;  3I4P A;  2K9M A;  4A3J J;  1B8I A;  1AKH B;  5KCM A;  2HOA A;  5HLT A;  4U7D A;  2MGQ A;  2VBW A;  4CGZ A;  3BDD A;  2BEO A;  2W84 A;  4N4N B;  4UXN A;  4IO9 F;  3S3N A;  2TCT A;  1BL0 A;  4C3I J;  1U78 A;  3ASO H;  1NTC A;  2M7A A;  1MBG A;  1Q1H A;  1IJW C;  2R7D A;  3F8F A;  2LY1 A;  3L09 A;  2R93 J;  1BR1 A;  2HQA A;  2K40 A;  2IS6 A;  2X6W A;  1VQM I;  4BDZ A;  3R6S A;  2DA7 A;  1IZ1 A;  4RGS A;  3L2W A;  3GTG J;  2IA2 A;  4UHT A;  4BDY A;  2BGC A;  1J5Y A;  4N4O B;  5EEA A;  1YO5 C;  3SEZ A;  2DTR A;  3QOD A;  3SFZ A;  3MWM A;  4MTD A;  3BQY A;  4C2M J;  1W7P A;  5CVU A;  3PL8 A;  2HWV A;  1XGN A;  3H92 A;  3KEO A;  2UZK A;  4P96 A;  3IWZ A;  1MZB A;  2Q2E B;  3VEP A;  4A3K J;  1L3L A;  2FEZ A;  4AIH A;  3GFI A;  1FSE A;  3F23 A;  3PUF A;  1ZAO A;  1HQC A;  4BGD A;  2XPU A;  3CDL A;  3IH4 A;  3TDZ C;  2QVO A;  2D1H A;  1W1W E;  2E36 A;  3O8H A;  3IHU A;  3IL2 A;  3GLX A;  1IO2 A;  3H5N A;  1XDU A;  1VQO I;  4CZZ A;  1ERD A;  3LA2 A;  1W0U A;  4ENK A;  3HOV J;  4Y52 J;  2CYY A;  4KYW A;  4B43 A;  4F3Q A;  3JSO A;  2A6E F;  4F55 A;  4D0P A;  1S8N A;  3DKX A;  5L3E A;  4KIF A;  1MKM A;  3KEQ A;  2CGP A;  4ASN A;  4WXD A;  3W6V A;  2YSR A;  4ESJ A;  4ZDP A;  1X2M A;  3M3Y J;  1QPM A;  1QRY A;  3JRE A;  1HF0 A;  1R1T A;  5FFZ A;  5FKL A;  1IDZ A;  1IG7 A;  2NS7 A;  1HKS A;  2HYJ A;  4UB8 C;  2WB1 N;  1WJA A;  5FKN A;  3E6M A;  3WOD F;  3IKT A;  1BC7 C;  4N9I A;  2PJR A;  1DQU A;  4DBQ A;  3P9I A;  3FXK A;  1R1U A;  2GIV A;  3AG4 H;  4BNC A;  1WH7 A;  3LOC A;  5D5V B;  3CZ6 A;  4CCK A;  1TWG J;  5F0H A;  3F3X A;  5KK1 A;  1R36 A;  1NG7 A;  3J81 Z;  1WI9 A;  1FOW A;  3JRF A;  2B0L A;  3LSP A;  3Q9V A;  2LKS A;  4P9F A;  2R7W A;  4IVN A;  2HTJ A;  2AXT C;  4NUB A;  2GXA A;  3S2D J;  3CDI A;  3HUG A;  2M0M A;  1N75 A;  3P7N A;  1U8R A;  2RKH A;  4CCO A;  5IP9 J;  2CFO A;  3K9T A;  3GFJ A;  4RDU A;  1HKT A;  3O3K A;  3ZMT A;  2CSO A;  3VWB A;  1X3U A;  1QGP A;  2W1O A;  3F72 A;  4IJA A;  3S2W A;  4XLH A;  4QWQ A;  3JRD A;  2DW4 A;  3ZMU A;  1XDS A;  4E7H A;  1K61 A;  2CQX A;  4CCM A;  1OIS A;  3JRI A;  4RB1 A;  1TWF J;  5AON A;  3LFU A;  2NYX A;  3RYP A;  1J09 A;  1FC3 A;  5F0F A;  4B3A A;  4RMN A;  4G94 A;  3GWZ A;  1UMQ A;  1XCB A;  2BY0 A;  4Y15 A;  1EH6 A;  5DV5 A;  3S16 J;  1IN4 A;  4HST A;  1G6N A;  3R61 A;  5KNL A;  1IN8 A;  2ZSH B;  2PLY A;  2QLZ A;  2O8X A;  3BWG A;  3PQK A;  1R22 A;  3TBI A;  4BU2 A;  2L7M P;  1BA5 A;  3I56 I;  2K3P A;  3T0Y A;  2DN0 A;  5GAE J;  4WXC A;  1PVE A;  3A0H C;  2BXY A;  3A2K A;  4M72 A;  2X6Y A;  1UG0 A;  1OKR A;  3FK6 A;  2XKO A;  3E5Q A;  3ZQG A;  3OYK A;  1WRJ A;  5HS8 A;  5FJ8 J;  5DCF A;  2VOO A;  2WB1 A;  3PO3 J;  2H27 A;  1LEA A;  3W2A A;  3CDH A;  2X1E A;  2LBF A;  1YX5 A;  3HOU J;  2XAJ A;  3ZRG A;  3MN2 A;  3KP4 A;  5FRM A;  3TMO A;  3REO A;  2EA4 A;  2D1V A;  2H1K A;  1YG2 A;  2EH3 A;  4YEL A;  1J75 A;  4EJV A;  4ENM A;  2ZNY A;  4XQF A;  3FM5 A;  3KP6 A;  4LD5 A;  2LOO A;  2YU3 A;  1U9N A;  5IT9 Z;  2XF6 A;  1BI3 A;  4I99 C;  2E1C A;  2MLK A;  3C2G A;  2OPT A;  3WTS C;  4I0A A;  2H94 A;  1JXS A;  1W36 C;  3GYH X;  3CCU I;  2H8W A;  2W7N A;  1CF7 B;  2L9R A;  2PJR B;  3DCF A;  5DCM A;  4NC8 A;  3GX4 X;  4C2T A;  5CVJ A;  5GP9 A;  2COM A;  2A6H F;  4I0B A;  1FBQ A;  5E8I A;  3ZN1 A;  2CV0 A;  5LHG A;  4XOT A;  3P5J A;  2IJL A;  2RQP A;  3FXU A;  2HKO A;  4ZYH A;  1WCM J;  3RPQ A;  1R5I D;  3K1M A;  2XB5 A;  2L4A A;  1HDP A;  3GF2 A;  1S7E A;  3PSF A;  3DKY A;  1B4A A;  2ZJP F;  1FOX A;  3EQL F;  4BEH A;  3VPR A;  2IXS A;  4UNO A;  4KIC A;  1NG6 A;  4P1W A;  2ELK A;  3QOP A;  1OCT C;  2HQ5 A;  3LSH A;  3A1Y A;  1B72 A;  4Y13 A;  1ENH A;  1Z3Y A;  3WGH A;  3BR5 A;  4KIG A;  5F64 A;  2LD5 A;  2AQF A;  4LK1 F;  4Q48 A;  4AVZ A;  4YFN F;  1ZGA A;  3AL0 B;  1I1G A;  3S1R J;  1Q1V A;  2A61 A;  2GQQ A;  3L1P A;  5CJ9 A;  1A5J A;  5EF6 A;  3ABL H;  4WX9 A;  3COA C;  1Z9C A;  1T0F C;  2Z99 A;  1N78 A;  1W5S A;  3GTM J;  2CS3 A;  2RN7 A;  3BQZ A;  5HNF A;  4QPQ A;  3L2C A;  2EZI A;  1YRN B;  3I58 A;  1TT0 A;  3BCB A;  4M73 A;  5FD6 A;  4E7L A;  4DBR A;  4UV8 A;  1VQN I;  1HOM A;  2DOD A;  3WE2 A;  1I3Q J;  4XSX F;  4FAS D;  1FYM A;  1ZKG A;  4XKC A;  5E17 F;  2JVG A;  4E6K G;  2K9N A;  4RB0 A;  3H5A A;  1FMW A;  2V9P A;  2ZO4 A;  1R4N B;  1PJR A;  1JUS A;  2VT2 A;  3S93 A;  1N77 A;  4G6Q A;  2QCO A;  3NEU A;  3HZJ A;  3RTR A;  3RJP A;  5CPR B;  4A3D J;  3LST A;  4ZJZ A;  2RNG A;  4YEJ A;  2GIZ A;  4IHV A;  2IEK A;  4PFP A;  5L3F A;  3RSN A;  3ABK H;  1YIJ I;  1PYV A;  2NVQ J;  4I6Z A;  4ANJ A;  1V4R A;  1Z6T A;  3G71 I;  3O8G A;  4XID A;  1X1P A;  2RGV A;  4IPA A;  3ZGK A;  4CYD A;  2QA4 I;  1ETY A;  4WWC A;  3K70 D;  3S2H J;  3VB2 A;  2OZU A;  4FE4 A;  1H88 C;  2Y30 A;  5K5R A;  2DOA A;  4F52 A;  1N25 A;  2E5Z A;  1RC9 A;  4XLA A;  4DIQ A;  3I53 A;  3I0T A;  4V2F A;  3E6D A;  3I3L A;  3WTX C;  1Z7L A;  1IXR C;  4HPQ A;  3RPU A;  3KP7 A;  3W6K B;  1X1C A;  4HF2 A;  3CME I;  2K5C A;  1JKQ C;  4XON A;  1VQ9 I;  3E6B A;  1Z1D A;  4HOB A;  1UEL B;  2JPC A;  4MEY F;  2VLA A;  4QLC U;  3OS1 A;  1IV6 A;  1O57 A;  2OU2 A;  1JGS A;  4GCV A;  2F5C A;  3OL4 A;  2RQQ A;  4CYC A;  4XLN F;  1JKO C;  4IOA F;  2UUZ A;  4XMY A;  5CVI A;  4J19 A;  2WAE A;  3AAF A;  5EYR A;  2VIX A;  2IRF G;  3DF8 A;  3DKW A;  3AG3 H;  2BE5 F;  2HPI A;  1ZG3 A;  3OYE A;  2E7W A;  3DU5 A;  2LH9 A;  2DA3 A;  1HDD C;  1O3R A;  1X58 A;  2FNA A;  4M9Z A;  1PUF A;  2O0Y A;  3ABT A;  5H6Q A;  5E1Z B;  3HG9 A;  5CKT A;  2L3D A;  2BW3 B;  2IA1 A;  2M4K A;  5JFR A;  2NS8 A;  2JA7 J;  3DPL C;  5E20 A;  5ILV A;  2LY9 A;  4KMF A;  1ZR2 A;  4Q5S F;  3F9K A;  1OYI A;  3IAS 2;  2DT7 B;  1XTA A;  3BR1 A;  2DPD A;  4FX4 A;  3H0G J;  1I6X A;  2E1O A;  4BE2 A;  4UUS B;  1R5G A;  1ZK8 A;  3JRB A;  1S7A A;  4LMY A;  3HHG A;  3WU1 B;  1WJ5 A;  2LKX A;  2QSH X;  3BLY A;  3QQA A;  1VQ8 I;  2YUS A;  1KON A;  1YW9 A;  4JK1 X;  1MW7 A;  4DZP A;  1GXP A;  4WK8 F;  4CCL A;  3CMY A;  1IRF A;  1Z05 A;  3K69 A;  4C9Y A;  4HYE A;  3EUK L;  2QQ8 A;  3HOZ J;  1QNT A;  3BPX A;  1SD4 A;  2M34 A;  3TL4 X;  2JT1 A;  1XX5 A;  2NNN A;  2CFX A;  3WHB A;  3VOE A;  2PI0 A;  2VL8 A;  2OQG A;  1VQL I;  3IWF A;  2PFB A;  4EGZ A;  2ID3 A;  2QYO A;  3NWT A;  1RET A;  1EKE A;  3SHF A;  3B73 A;  1QU3 A;  1USS A;  1S7O A;  1OCO H;  5BPI A;  3MKL A;  1F43 A;  2EV5 A;  2F5E A;  2QQA A;  2L7Z A;  1UJ8 A;  5KVR A;  2OTL I;  1FBU A;  2O9L A;  4RAZ A;  4M3G A;  2XSD C;  4JX6 A;  2O7O A;  2KFD A;  5LHI A;  2Y0S A;  2ZSI B;  3VYT B;  1SAX A;  2QBY A;  3MZY A;  3KZI C;  5H20 A;  4IHS A;  1KYZ A;  3DWL E;  4HDU A;  1S3J A;  2KLO A;  3FMR A;  2NAZ A;  3M07 A;  1WJC A;  4PJJ A;  3G73 A;  2MLG A;  2DTZ A;  1KQ9 A;  4A5M A;  4G6D A;  2HU9 A;  3MEX A;  1DGR M;  3RZO J;  2Y75 A;  3JCU C;  1ITY A;  1TLH B;  5HLG A;  3CJR B;  4BYY A;  4MTE A;  2DJI A;  4DYC A;  2GWR A;  2D45 A;  5HVQ C;  4G7O F;  4EQQ A;  1ZTR A;  1TQM A;  3J80 K;  1U5T C;  4L5E A;  5D5W B;  3K4K A;  4A0X A;  1I50 J;  4ZYD A;  2C6Y A;  2LRE A;  1WVR A;  4HV6 A;  3GTJ J;  4DZJ A;  2OC6 A;  3I59 B;  4UVC A;  2JWT A;  3GTK J;  5C4J J;  9ANT A;  3ZXS A;  2AO9 A;  4RAF A;  2YX4 A;  2FNP A;  3EYI A;  3S1Q J;  3BPV A;  4IOC F;  1KQ8 A;  2UWM A;  4AIK A;  2DQL A;  4IX7 A;  3CUQ A;  1PP8 F;  1FJL A;  1KU9 A;  2V1D A;  1OCR H;  1R00 A;  1XSX A;  4BHC A;  2KZV A;  4LFU A;  2DT5 A;  5FGM A;  5JLW A;  3FF5 A;  2KDZ A;  5ED4 A;  2E2I J;  1TP4 A;  1BJZ A;  2KP6 A;  1AKH A;  3CJQ B;  1BM9 A;  1NK2 P;  2XAS A;  1NH3 A;  1NK3 P;  3T8T A;  4DNC A;  3P9C A;  2XHK A;  4L0Y B;  4FCY A;  2P8T A;  1LB2 A;  4LG3 A;  3L2Q A;  2ZME B;  2NVX J;  4BQA A;  1T33 A;  3RQ4 A;  2FRH A;  4CH7 A;  1MJA A;  1Z0X A;  1XSD A;  5EGO A;  4L9J A;  3VFZ A;  1EV7 A;  1GVD A;  2HQN A;  3OYG A;  3I5U A;  1YS7 A;  5B3S H;  5J1R A;  4DYR A;  1DDN A;  3R4K A;  1IN7 A;  4RAG A;  4OOI A;  2HVR A;  4CA0 A;  5HOD A;  2LMD A;  5J8C A;  3QP6 A;  1VFC A;  4BL0 B;  4OU0 A;  2EZH A;  2ID6 A;  2LK2 A;  3OYF A;  2PJP A;  3BZ6 A;  3GBG A;  4XLE A;  2NOG A;  1LUJ B;  2W57 A;  2YS9 A;  1STZ A;  3PIP F;  3CCS I;  2Q2E A;  3JTH A;  3V4G A;  1SD7 A;  3KEY A;  1B9M A;  4EV0 A;  1BW6 A;  1WJE A;  5F6F A;  4AU7 A;  5HS9 A;  4XL9 A;  2MC3 A;  2DBB A;  1SVO A;  2KIS A;  2P81 A;  3MCZ A;  4EAT A;  3MFK A;  2HZD A;  5J4V A;  3IH2 A;  4CSW A;  2V6C A;  2W85 A;  4M6V A;  3IV5 A;  2QEX I;  4BE0 A;  3V7S A;  5GAH J;  1HW1 A;  2CUJ A;  3LSR A;  1LNW A;  2O8K A;  2L9V A;  2EK5 A;  3HOT A;  2XKP A;  2ESH A;  3WTV C;  3DBH B;  4U0W A;  3Q3S A;  1OQY A;  4GYG A;  3BR3 A;  1H8A C;  3JRC A;  2LP0 A;  3LSI A;  1H9T A;  2WWY A;  2F5F A;  2JQ7 A;  3EPZ A;  4A3M J;  2N8G A;  2P0W A;  2P6T A;  3FMQ A;  4PJM A;  5CLS A;  2DA4 A;  2P7V B;  2CUF A;  2EJR A;  3PNV A;  4RGX A;  5HS7 A;  4AUX A;  1JGG A;  2OTJ I;  3LWF A;  4IEJ A;  3W2W A;  3G1M A;  1MND A;  4XKW A;  1HXD A;  5LBQ A;  5TGT A;  2L7F P;  3LA7 A;  1FZP B;  1OPC A;  2DFF A;  5K1Y A;  2BY1 A;  1B59 A;  2X1C A;  4QTR A;  4BQN A;  1OR7 A;  3SXY A;  2XGE A;  4M3B A;  4C3J J;  1D0X A;  3ABU A;  3HPH A;  2X48 A;  1WH5 A;  4LLL A;  2H1L A;  3CD6 I;  4HNU A;  4Q4Z F;  5DM6 F;  1SFX A;  1W4M A;  3R0A A;  3K0L A;  3DTI A;  3RYR A;  2ECC A;  1IUY A;  1BN5 A;  2STW A;  4X0G A;  2E1M C;  1MMA A;  1ETX A;  2CQN A;  3OYJ A;  4KT6 A;  1WPK A;  3OYA A;  4FIS A;  3Q9S A;  2VAS A;  1EA3 A;  1BI0 A;  2H09 A;  5J3L A;  4GGG A;  1LEB A;  4FQG A;  4PSW A;  3EUH A;  4BJ6 C;  3OS2 A;  3EDP A;  2JA8 J;  5EG0 B;  3JTG A;  2BVL A;  1RUO A;  1QZZ A;  2EZK A;  3KE2 A;  5EGO B;  4R79 A;  5FO5 A;  4J01 A;  4H0E A;  1RKW A;  2MD0 A;  3I54 A;  1FLI A;  5IPA A;  4MQ9 F;  3L2U A;  1YX3 A;  1UG2 A;  1BIB A;  2MD5 A;  1MSE C;  1D0Y A;  2Y69 H;  2J5O A;  3E6C C;  3HKZ N;  1K6O A;  2DOE A;  2IGK A;  2PMZ A;  3LQQ A;  3K4B A;  2IGN A;  3IRR A;  4KNY A;  1YS6 A;  3K10 A;  2P7C B;  1WKM A;  2KJC A;  1AHD P;  1MBK A;  1FMV A;  3RKQ A;  3VYS B;  1ZAR A;  3J7Z I;  3WGG A;  4UVA A;  1QBJ A;  4LLG F;  1PDN C;  5DUI A;  5ILU A;  2IP2 A;  1OCZ H;  4CZC A;  3PFY A;  3O6B B;  1YIT I;  1HST A;  2VQG A;  4EJW A;  3JSP A;  4HW0 A;  1K78 B;  3J7A O;  1B1B A;  1P2F A;  2GZW A;  2OA4 A;  2R3S A;  4WXH A;  2R7V A;  2XAF A;  4N0B A;  2M45 A;  2OCE A;  3C2B A;  4PGH A;  3FMS A;  4BHB A;  2X9D A;  5HOO A;  4HX7 A;  1AWC A;  1G2H A;  1VQ4 I;  3IH3 A;  3IKV A;  5ICG A;  1EJ9 A;  1ON1 A;  2Z33 A;  5JVG F;  1O4X A;  1TQI A;  5GAG J;  2Y48 A;  4PJ0 C;  4YRV A;  4CUG A;  5J40 A;  2VQC A;  1KA8 A;  1V3F A;  1T8I A;  1U2W A;  1OMI A;  1F36 A;  3D5S C;  3F6O A;  3K4C A;  4EM1 A;  3BZK A;  2CW7 A;  2K3F A;  3R0J A;  4L5I A;  2A3S A;  4IZZ A;  2KRC A;  4IF4 A;  2XSJ C;  3FXR A;  2KJB A;  3QPT A;  1X4P A;  1CF7 A;  1Z21 A;  5F04 A;  2JA5 J;  4U7B A;  3CCV I;  3DFG A;  1QZE A;  4FET A;  2KQR A;  2R7X A;  2QUF A;  3V7R A;  2FA5 A;  5FLX K;  2ZNZ A;  2ZFU A;  2MSY A;  4V2G A;  4BXX J;  3V42 A;  1XCV A;  2AXL A;  4R1H A;  2VI6 A;  1UST A;  4FTH A;  2ZXW H;  3SJM A;  3PO2 J;  1JT0 A;  2K02 A;  1ZRF A;  5FLV A;  1OFC X;  2L9S A;  4DGW B;  3DPT A;  2RRE A;  2WTE A;  3OIP A;  1XG1 A;  2JSC A;  3H3Z A;  4MQV A;  4A12 A;  2X6X A;  1TWH J;  2F4O B;  3VOD A;  4A3F J;  4YFX F;  2I10 A;  3LL7 A;  2D5V A;  1JUP A;  2K85 A;  4UUT A;  1LFB A;  2V79 A;  4ENN A;  3RZD J;  3JR9 A;  1OCC H;  2OCC H;  3M8F A;  3BZC A;  1SFU A;  3HHH A;  2R5Z B;  4A2U A;  1SD6 A;  4OIR F;  5C3E J;  1YTY A;  1GVJ A;  1SEU A;  5FKM A;  3BR0 A;  4CO8 A;  2PX9 A;  1HA8 A;  3FHN A;  3F8N A;  1RIO H;  1JJ8 C;  2F6C A;  2WV1 A;  2QKM B;  4M3F A;  4F7Z A;  3MZ8 A;  3GXO A;  2IBD A;  4EM2 A;  5D5X B;  2Z3Y A;  1K7A A;  3H9G A;  5LGU A;  2P5K A;  2FBK A;  2WV0 A;  2XPW A;  2QSF X;  3ERM A;  4OIN F;  2DI3 A;  1YRN A;  2LF8 A;  3FIW A;  1I3A A;  3ZQL A;  2V7F A;  3FM3 A;  5F1R A;  5EDN A;  3PFI A;  3CF5 F;  1ZG5 A;  2XAG A;  4ZYA A;  5H2F C;  2X1D A;  2KKO A;  3GLL A;  2V6E A;  1IRG A;  3ZMZ A;  2IGO A;  2VC0 A;  3UKG A;  4LB5 A;  3WE3 A;  2KRF A;  1LVK A;  3AG2 H;  3QOE A;  1BI1 A;  2K9S A;  2QSG X;  3DLL F;  4HEA 2;  1FPQ A;  3GVA A;  1MMN A;  1XMA A;  4HV5 A;  5L3B A;  3G6E I;  1MBH A;  1J9I A;  1G3Y A;  1MDM B;  3FDY A;  2J5P A;  5CVV A;  1WJF A;  1D5Y A;  2UXN A;  2IVM A;  2D2W A;  3HOY J;  1R5H A;  2P5L C;  3BCA A;  1BIA A;  1DPU A;  4M3D A;  2FE3 A;  3M1C A;  5ICC A;  3IUO A;  3K1N A;  4AVP A;  5TJJ A;  4Y3O A;  1X1B A;  2LY2 A;  2G7H A;  2CV2 A;  2UV1 A;  1E0E A;  1YI2 I;  5DTD A;  4KA4 A;  3I4N J;  2L5Q A;  4W97 A;  4A69 C;  2JRM A;  4BXU A;  5IOZ A;  3F8C A;  5FB2 A;  5HNH A;  5E18 F;  3OYM A;  1W36 D;  2FU4 A;  3Q0U A;  2RAE A;  4I09 A;  2CMP A;  4GO1 A;  2ETH A;  3TED A;  1TQP A;  2KL4 A;  3OMY A;  5EEH A;  2QM3 A;  5E8G A;  2PG4 A;  3V7C A;  1A6Q A;  2PBI A;  4XSZ F;  5DD8 A;  3ZPL A;  4LJZ F;  2EIJ H;  3SDB A;  2E19 A;  3KZY A;  2VBY A;  4XR6 A;  3GFM A;  3M7G A;  3F6V A;  2IW5 A;  3PJR A;  4HDV A;  3CMM A;  4HX4 A;  4L9V A;  1LDJ A;  3K6G A;  5AIQ A;  2HPM A;  1FTT A;  4CIC A;  3S3M A;  2LTP A;  1LFU P;  2HGC A;  1JHH A;  1WHU A;  3LMM A;  3FWE A;  1A36 A;  1D8J A;  1WGX A;  2L0K A;  1GV5 A;  1Z3X A;  4OIO F;  3RKW A;  3CLO A;  5AIP A;  2BW3 A;  1EF4 A;  5B66 C;  3KLO A;  4UY8 I;  1RKT A;  1P4A A;  2O3F A;  5CQG A;  2X85 A;  2Y31 A;  1VI0 A;  2EFQ A;  2NRA C;  4HBL A;  2GXB A;  3I4M J;  5D8L B;  4D7M A;  4BY1 J;  4N9H A;  2MFZ A;  4IHY A;  2V26 A;  2OZ6 A;  4UUS A;  3FHZ A;  2B63 J;  1ZLJ A;  2F5V A;  1U0J A;  4IKF A;  2FQ3 A;  4CCN A;  2JPB A;  2CG4 A;  3I9V 2;  1VQ7 I;  2DMQ A;  2LDU A;  5LEJ A;  1IXS B;  2M87 A;  2W48 A;  4CHU A;  3S14 J;  3GZ6 A;  1E3P A;  3I64 A;  2XAQ A;  1V54 H;  5F08 A;  3RIR A;  3SYT A;  4BBS J;  3ELK A;  2A07 F;  5C4X J;  4OAZ A;  3HOS A;  1P7J A;  3KP2 A;  2Y9Z A;  2ME0 A;  3CP2 A;  3ZOB A;  1G4D A;  1J7K A;  3W6J B;  3FXO A;  1K4T A;  4M9S A;  4ETS A;  2DJN A;  4BJT A;  2FMY A;  1IN6 A;  2O03 A;  2PN6 A;  3WG7 H;  1YQA A;  1FOK A;  2UXX A;  1R9T J;  2RVC A;  3BTL A;  2VJJ A;  5C44 J;  2Z5U A;  2RV8 A;  2DK8 A;  3J81 K;  4BQO A;  3M9A A;  3LQR A;  2ISY A;  2DQR A;  2E35 A;  2EFW A;  1QHH D;  2G9W A;  3C1D A;  1WQ2 A;  5GPC A;  4YIF A;  1MBJ A;  2EIL H;  3MKW B;  1ZGJ A;  3HRM A;  1RI7 A;  1IV8 A;  1VND A;  4Y17 A;  1IRZ A;  3S17 J;  1XMK A;  3B6A A;  2NOJ B;  5IY5 H;  3GFL A;  1QVT A;  4HZF A;  5ILS A;  2EPF A;  1S72 I;  3GO5 A;  4L9T A;  1FP1 D;  1ZYR F;  3OOP A;  5BS6 A;  3JRG A;  2XPV A;  4V19 K;  4E7J A;  4J00 A;  1V5F A;  1X1A A;  3KPH A;  2DA5 A;  3ZQF A;  1CGP A;  2GLO A;  1J59 A;  1HBX G;  3CES A;  4EVI A;  1DP3 A;  3TO7 A;  1S29 A;  3ZQH A;  3I59 A;  1D0Z A;  1UHM A;  2KDO A;  2DDB A;  2WAQ N;  3C18 A;  5A2Q K;  4OAY A;  1SVL A;  2A5Y B;  1DP7 P;  1VQP I;  4FE7 A;  4ZC3 A;  1DPR A;  4A3B J;  4LG0 B;  3ZQQ A;  2V1X A;  3K4N A;  4BJ5 C;  1Z77 A;  3FXM A; 
#chains in the Genus database with same CATH homology
 3TOB A;  2MBF A;  3KCC A;  1LJ9 A;  3V8J A;  3SQN A;  4L0Z B;  3NQO A;  4O5V A;  1EH8 A;  1YFH A;  2ZME A;  2VC1 A;  4XRF A;  4ZZD A;  3QU3 A;  2OQR A;  1MGT A;  3MZH A;  1D5V A;  1FT9 A;  2ZXJ A;  3T5X A;  1YIO A;  1BI2 A;  1LQ1 A;  3KET A;  1H9G A;  2QQB A;  5D6F A;  4CXF A;  2DFI A;  4KDP A;  1FYL A;  1UFM A;  1A04 A;  4UVB A;  3BY6 A;  4A6E A;  5HLI A;  1UCR A;  3FXQ A;  4WCG A;  1IN5 A;  1TTY A;  4OIQ F;  1XSV A;  2MH2 A;  2BV6 A;  2VXZ A;  2QZ8 A;  4I01 A;  4EM0 B;  1G3T A;  1T98 A;  1FX7 A;  3B02 A;  4ZYG A;  1FNN A;  1J2X A;  2FBI A;  1R7J A;  4I02 A;  5FD5 A;  2W24 A;  4IRH A;  3RKY A;  4A0Z A;  1SFE A;  4RGU A;  1L0O C;  2CQK A;  3GZ5 A;  2Q0O A;  1OYY A;  5LHH A;  4LLN A;  1PP7 U;  3IRQ A;  1E2X A;  1U6G A;  3U2R A;  1O7L A;  2HYF A;  1REP C;  1H0M A;  4TV7 A;  4LB6 B;  2QQ9 A;  4FX0 A;  1ZN2 A;  3C7J A;  3E5X A;  5HDN A;  2ZCW A;  1WWX A;  3TOA A;  2HTS A;  4I7H A;  5CVR A;  4UUV A;  2CW0 F;  3K1P A;  1KU2 A;  5ERI A;  2E1N A;  3BOQ A;  3CUQ C;  3P9K A;  2XRN A;  1SMY F;  5LGT A;  3T1B A;  3N97 A;  1U3E M;  2AS5 F;  5H6R A;  2F5D A;  2WC2 A;  3ZMV A;  3JAM K;  1KU7 A;  4DQ2 A;  2VBX A;  3L00 A;  2F2E A;  2RNJ A;  1FSH A;  1XGS A;  1TNT A;  2H6C A;  4XBF A;  4ESF A;  2M30 A;  1C0W A;  1K78 A;  3I71 A;  3CUO A;  5DYM A;  1P4X A;  4KMU X;  3WTW C;  2EA2 A;  2GA1 A;  2L4M A;  1PUE E;  1W5T A;  2XUB A;  3WTY C;  4O3M A;  1G3W A;  2FBH A;  1I1S A;  1U5T B;  1HSJ A;  5LRR A;  4P55 A;  2XV4 S;  4U0V A;  5LRS A;  5JVT A;  1XB4 A;  2KIF A;  3K2Z A;  2ZJ2 A;  1F4K A;  3ZMS A;  2MA3 A;  4HAM A;  3E5U A;  2R7F A;  4I98 B;  5JI6 A;  1FYK A;  3BJ6 A;  2ISZ A;  4B8X A;  3G3Z A;  3FX3 A;  4A0Y A;  2ACJ A;  4HQE A;  1I27 A;  2P5V A;  4ENJ A;  2K27 A;  3ERE D;  1T6S A;  3M1E A;  3HYI A;  3MAJ A;  4PGG A;  2X4H A;  4B09 A;  4HX8 A;  1ODD A;  1P6R A;  3DP7 A;  1KQ0 A;  4EJU A;  4M6X A;  3BJO A;  3DXJ F;  2YR2 A;  2STT A;  4NHJ A;  3CO7 C;  4EJO A;  3CTA A;  1NHA A;  4G9Y A;  1IAW A;  1MJB A;  1QO0 D;  3TDU C;  1I5Z A;  3HRT A;  3HRS A;  3LAP A;  2VON A;  4FHT A;  1J0R A;  3ZN0 A;  2DU9 A;  5K5O A;  5BMZ A;  1SD5 A;  2PMH A;  4P9U A;  1MDM A;  3HTU A;  1TNS A;  4Z2Y A;  1G3S A;  3WTZ A;  3ML6 A;  4RB2 C;  3CO6 C;  1ONV A;  2QEN A;  2EV6 A;  1B9N A;  3E3V A;  1TW3 A;  1W7P D;  2GAU A;  1O7F A;  3KP5 A;  5TRD A;  2L02 A;  4M71 A;  4I2O A;  1ZHF A;  1P92 A;  2XVC A;  2FML A;  1LVA A;  3V8K A;  4A6D A;  4G7H F;  2XAH A;  2KIU A;  3GW2 A;  2HR3 A;  2JRT A;  3ZMD A;  2YX7 A;  3DV8 A;  4AD9 A;  3BRO A;  2RDP A;  2DK5 A;  3FZV A;  3ECH A;  2NNY A;  1YW7 A;  2IPQ X;  4Q47 A;  2VE8 A;  4E70 A;  4AIJ A;  2XRO A;  1T2K A;  1XD7 A;  3R60 A;  5BPD A;  2DO7 A;  4EJT A;  1HW5 A;  1KU3 A;  2DPU A;  1F1Z A;  1BJA A;  4S05 A;  4KT5 C;  1E17 A;  4MGR A;  2XIG A;  4BHP A;  1DUX C;  2PMU A;  5BQT A;  4KN7 X;  3WU0 A;  3E97 A;  2P4W A;  1RZ4 A;  3KFW X;  4HA8 A;  2A68 F;  2VN2 A;  2A69 F;  4RAY A;  2Y0M A;  1S6L A;  2EFN A;  4IRG A;  2E7X A;  4NB5 A;  2OBP A;  3L9F A;  1LDD A;  1W7P B;  3EET A;  5A2Q Z;  1IF1 A;  3L7W A;  1ZRC A;  4EGY A;  2DLL A;  4EMS A;  1TW2 A;  5ICF A;  2L54 A;  5L3D A;  1RUN A;  2EFP A;  2K7L A;  1XN7 A;  4ZYE A;  4YFK F;  3TO6 A;  1MD0 A;  3GUD A;  3BP8 A;  4YG2 F;  3WG9 A;  1YYV A;  4HLY A;  4BAY A;  3HTS B;  1B6A A;  3DQV C;  5BOX A;  3H3U A;  3QRF F;  2FSW A;  5E1X A;  1FWZ A;  4JQF A;  4RGR A;  2HZT A;  1WSU A;  2M8E A;  1T39 A;  5HDK A;  4MEX F;  3KZZ A;  3LA3 A;  2JZY A;  3WTU C;  5D4R A;  3PQJ A;  4R8H A;  4U88 A;  4LG0 A;  2EWN A;  4M74 A;  5DUK A;  2CWE A;  5D5U B;  1UB9 A;  1T0F A;  1ULY A;  2FF4 A;  3DEU A;  3TKY A;  2Z9O A;  3F21 A;  2IT0 A;  4ZZL A;  2EFO A;  3BJA A;  3LFK A;  5L3G A;  3KLN A;  5CYV A;  1R23 A;  2BBY A;  1ZG1 A;  1D3Y A;  3J80 Z;  1BC8 C;  2JTV A;  2HYG D;  5FFX A;  5JR3 A;  3OV8 A;  5JHU A;  2K86 A;  3MQ0 A;  3QP5 A;  5ICE A;  5LGN A;  3QU6 A;  4XLP F;  3WTT C;  4WF2 A;  2P6S A;  1IXC A;  3HIF A;  1FP2 A;  1GXQ A;  2H6B A;  1F9N A;  2ZFW A;  3ZP5 A;  2HEO A;  4KFC A;  4GYI A;  1SMT A;  3RKX A;  1KYW A;  4PZJ A;  1QZY A;  2W25 A;  3HSR A;  1HKQ A;  1Y0U A;  4A5N A;  4KN4 X;  3JAM Z;  1ZRE A;  1YLF A;  3HSF A;  1XGM A;  4LK0 F;  1O3T A;  2O6G E;  2IA0 A;  2HS5 A;  4RB3 C;  5DCM B;  3D5L A;  4HLX A;  4RS8 A;  2EB7 A;  3U1D A;  1EH7 A;  3O2P E;  2G7U A;  1FY7 A;  1KGS A;  5D8K B;  1O3S A;  5D4S A;  1Z7U A;  3D0S A;  4MHG A;  3F22 A;  1XGO A;  1Z6R A;  5DD4 A;  2VOD A;  2XGX A;  3JW4 A;  2LKP A;  2HDC A;  3TQN A;  4G8X A;  1Z91 A;  4G7Z F;  4M6Y A;  4HF1 A;  5K5Q A;  3IC7 A;  5J8F A;  4IXA A;  3F8B A;  4O6J A;  2K4J A;  2HKX A;  5IT9 K;  2X0L A;  3TO9 A;  4JBA A;  2L01 A;  3ECO A;  3HSE A;  2MH9 A;  1TBX A;  5DDG A;  4LGW A;  2BYV E;  6PAX A;  2ZBK A;  3V8L A;  2HQR A;  1GHC A;  2YPR A;  5LLQ A;  2M1B A;  5DEQ A;  1BBY A;  3ISP A;  3C3W A;  1U5T A;  2VE9 A;  1YW8 A;  5J6X A;  1FBS A;  5IT3 A;  1LDK B;  3T8R A;  1RNL A;  4OIP F;  4IHT A;  3N4M A;  5EEG A;  3EYY A;  2ESN A;  1VTN C;  4HQM A;  1O3Q A;  3ULQ B;  2FOK A;  2O61 A;  4IRI A;  4GXO A;  2HOE A;  4L9N A;  4KUM A;  1UHW A;  1T38 A;  2HFH A;  1ZH5 A;  2LF7 A;  1ON2 A;  2GA2 A;  4L18 B;  1JE8 A;  3U9G A;  4HF0 A;  4UV9 A;  2ELH A;  2GXG A;  4YII A;  3HRU A;  2QWW A;  5FLX Z;  4OMY A;  4ZH4 F;  5HLH A;  3SZP A;  3SZT A;  4MNU A;  4L5J A;  4P5O A;  4PDK A;  2V9V A;  4KIB A;  1JHF A;  1R58 A;  3TGN A;  2ADU A;  5LEK A;  3ZQ7 A;  2V1U A;  3NRV A;  3GEZ A;  3Q5F A;  2M5W A;  1IW7 F;  1K79 A;  2Q8K A;  3M8E A;  4NQW A;  2OAZ A;  4ESB A;  2K4B A;  2CO5 A;  3F8M A;  1OYW A;  2PEX A;  3LAJ A;  2VBZ A;  3KP3 A;  2KIM A;  2TDX A;  4S04 A;  1HW2 A;  4M9X A;  2QBY B;  1BOA A;  4FT8 A;  4AWX B;  3WGI A;  1MJ9 A;  1AOY A;  3RI4 A;  2RC4 A;  5HDG A;  4OMZ A;  4BH9 A;  2DAO A;  5E1W A;  2VT3 A;  3QAH A;  2PQ8 A;  4PCQ A;  1F5T A;  4ON0 A;  1D8K A;  1QQI A;  2VOP A;  1ZLK A;  2EV0 A;  2LNB A;  2NS0 A;  2OD5 A;  3RDI A;  3QPH A;  1ZRD A;  3ROU A;  5L3C A;  4K2E A;  4CDG A;  1P4W A;  3CUQ B;  2ZKZ A;  3CJN A;  1R1V A;  2LSO A;  4U0Y A;  5D6E A;  2FXA A;  3I4P A;  4U7D A;  2VBW A;  4CGZ A;  3BDD A;  2BEO A;  2W84 A;  4UXN A;  1U78 A;  1Q1H A;  2R7D A;  3F8F A;  3L09 A;  3R6S A;  1IZ1 A;  4RGS A;  2IA2 A;  4UHT A;  2BGC A;  1J5Y A;  1YO5 C;  2DTR A;  3SFZ A;  3MWM A;  4MTD A;  1W7P A;  5CVU A;  2HWV A;  1XGN A;  3H92 A;  3KEO A;  2UZK A;  4P96 A;  3IWZ A;  1MZB A;  3VEP A;  1L3L A;  2FEZ A;  4AIH A;  3GFI A;  1FSE A;  3F23 A;  1ZAO A;  1HQC A;  3TDZ C;  2QVO A;  2D1H A;  3IHU A;  3IL2 A;  3GLX A;  1XDU A;  4CZZ A;  3LA2 A;  4ENK A;  2CYY A;  4KYW A;  3JSO A;  2A6E F;  4D0P A;  1S8N A;  5L3E A;  4KIF A;  1MKM A;  3KEQ A;  2CGP A;  4ASN A;  4WXD A;  2YSR A;  4ESJ A;  1QPM A;  1R1T A;  5FFZ A;  1HKS A;  3WOD F;  3IKT A;  1BC7 C;  3E6M A;  4N9I A;  3P9I A;  1R1U A;  2GIV A;  4BNC A;  5D5V B;  3F3X A;  5KK1 A;  1R36 A;  3J81 Z;  1WI9 A;  2B0L A;  3Q9V A;  4P9F A;  4IVN A;  2HTJ A;  3HUG A;  3P7N A;  1U8R A;  2RKH A;  3K9T A;  3GFJ A;  1HKT A;  3O3K A;  3ZMT A;  2CSO A;  1X3U A;  1QGP A;  4IJA A;  3F72 A;  3S2W A;  4QWQ A;  2DW4 A;  3ZMU A;  1XDS A;  4RB1 A;  5AON A;  2NYX A;  3RYP A;  1FC3 A;  4G94 A;  3GWZ A;  1XCB A;  4Y15 A;  1EH6 A;  5DV5 A;  1IN4 A;  1G6N A;  3R61 A;  1IN8 A;  2PLY A;  2QLZ A;  2O8X A;  3BWG A;  3PQK A;  1R22 A;  3T0Y A;  4WXC A;  4M72 A;  1OKR A;  2XKO A;  3E5Q A;  1WRJ A;  5HS8 A;  2VOO A;  5DCF A;  2H27 A;  1LEA A;  3CDH A;  2XAJ A;  3KP4 A;  3REO A;  2EA4 A;  2D1V A;  1YG2 A;  1J75 A;  4EJV A;  4ENM A;  2ZNY A;  3FM5 A;  3KP6 A;  4LD5 A;  2YU3 A;  5IT9 Z;  2E1C A;  1BI3 A;  2MLK A;  3WTS C;  4I0A A;  2H94 A;  1JXS A;  3GYH X;  1CF7 B;  5DCM A;  3GX4 X;  5CVJ A;  2COM A;  2A6H F;  4I0B A;  1FBQ A;  5E8I A;  3ZN1 A;  5LHG A;  2IJL A;  2RQP A;  3FXU A;  2HKO A;  4ZYH A;  3RPQ A;  3K1M A;  2L4A A;  3GF2 A;  1B4A A;  3EQL F;  4UNO A;  4KIC A;  3QOP A;  4Y13 A;  3WGH A;  4KIG A;  5F64 A;  4LK1 F;  4Q48 A;  4YFN F;  1ZGA A;  1I1G A;  2A61 A;  2GQQ A;  5CJ9 A;  4WX9 A;  3COA C;  1Z9C A;  2Z99 A;  1W5S A;  2RN7 A;  3L2C A;  3I58 A;  4M73 A;  5FD6 A;  4UV8 A;  3WE2 A;  4XSX F;  1FYM A;  5E17 F;  4RB0 A;  2ZO4 A;  2VT2 A;  4G6Q A;  3NEU A;  3RTR A;  3RJP A;  3LST A;  5L3F A;  1V4R A;  1Z6T A;  2RGV A;  4IPA A;  4CYD A;  4WWC A;  3VB2 A;  2OZU A;  5K5R A;  3I53 A;  3I0T A;  3E6D A;  3WTX C;  1IXR C;  3RPU A;  3W6K B;  3KP7 A;  4HF2 A;  3E6B A;  1Z1D A;  4HOB A;  2JPC A;  4MEY F;  4QLC U;  1O57 A;  2OU2 A;  1JGS A;  4GCV A;  2F5C A;  4XLN F;  5CVI A;  3AAF A;  2IRF G;  3DF8 A;  3DKW A;  2BE5 F;  1ZG3 A;  2E7W A;  1O3R A;  2FNA A;  4M9Z A;  2O0Y A;  3ABT A;  5H6Q A;  5E1Z B;  2L3D A;  2IA1 A;  5JFR A;  3DPL C;  5E20 A;  5ILV A;  4KMF A;  4Q5S F;  1OYI A;  2DPD A;  4FX4 A;  1I6X A;  1R5G A;  1S7A A;  4LMY A;  3HHG A;  3WU1 B;  1YW9 A;  4JK1 X;  1GXP A;  4WK8 F;  1IRF A;  1Z05 A;  3K69 A;  4HYE A;  1QNT A;  3BPX A;  1SD4 A;  2JT1 A;  2NNN A;  2CFX A;  2PI0 A;  3VOE A;  2OQG A;  3IWF A;  2PFB A;  4EGZ A;  2QYO A;  3SHF A;  3B73 A;  1USS A;  1S7O A;  5BPI A;  2EV5 A;  2F5E A;  2QQA A;  5KVR A;  1FBU A;  4RAZ A;  5LHI A;  1SAX A;  2QBY A;  3MZY A;  5H20 A;  4IHS A;  1KYZ A;  4HDU A;  1S3J A;  3FMR A;  2NAZ A;  3G73 A;  2MLG A;  1KQ9 A;  4A5M A;  4G6D A;  3MEX A;  2Y75 A;  1TLH B;  5HLG A;  4BYY A;  4MTE A;  2GWR A;  2D45 A;  5HVQ C;  4G7O F;  4EQQ A;  1TQM A;  3J80 K;  1U5T C;  5D5W B;  4A0X A;  4ZYD A;  2C6Y A;  4HV6 A;  3I59 B;  4UVC A;  1KQ8 A;  2YX4 A;  2FNP A;  3EYI A;  3BPV A;  2UWM A;  4AIK A;  2DQL A;  1PP8 F;  3CUQ A;  1KU9 A;  2V1D A;  1R00 A;  1XSX A;  4BHC A;  4LFU A;  2DT5 A;  5FGM A;  3FF5 A;  5ED4 A;  1BM9 A;  2XAS A;  3T8T A;  4DNC A;  3P9C A;  2XHK A;  4L0Y B;  1LB2 A;  2P8T A;  2ZME B;  4BQA A;  2FRH A;  1MJA A;  1XSD A;  4L9J A;  3VFZ A;  1EV7 A;  2HQN A;  3I5U A;  1YS7 A;  1DDN A;  3R4K A;  1IN7 A;  4OOI A;  5J8C A;  3QP6 A;  4OU0 A;  2PJP A;  3BZ6 A;  2W57 A;  1STZ A;  2Q2E A;  3JTH A;  3V4G A;  1SD7 A;  1B9M A;  4EV0 A;  5F6F A;  5HS9 A;  2MC3 A;  2DBB A;  3MCZ A;  3MFK A;  2V6C A;  2W85 A;  3V7S A;  1HW1 A;  1LNW A;  2EK5 A;  3HOT A;  2XKP A;  2ESH A;  3WTV C;  4U0W A;  4GYG A;  1H9T A;  2WWY A;  2F5F A;  2P6T A;  3FMQ A;  5CLS A;  2P7V B;  2EJR A;  4RGX A;  5HS7 A;  3LWF A;  1HXD A;  5LBQ A;  3LA7 A;  1FZP B;  1OPC A;  5K1Y A;  1B59 A;  1OR7 A;  3SXY A;  3ABU A;  4LLL A;  4Q4Z F;  1SFX A;  1W4M A;  3R0A A;  3K0L A;  3RYR A;  1IUY A;  1BN5 A;  2STW A;  3Q9S A;  1BI0 A;  2H09 A;  4GGG A;  1LEB A;  3EUH A;  3EDP A;  3JTG A;  1RUO A;  1QZZ A;  3KE2 A;  4R79 A;  5FO5 A;  4H0E A;  3I54 A;  1FLI A;  4MQ9 F;  1BIB A;  2MD5 A;  2J5O A;  3E6C C;  1K6O A;  3LQQ A;  3IRR A;  4KNY A;  1YS6 A;  2P7C B;  1WKM A;  2KJC A;  1ZAR A;  3WGG A;  4UVA A;  1QBJ A;  4LLG F;  1PDN C;  5DUI A;  5ILU A;  2IP2 A;  3O6B B;  1HST A;  4EJW A;  3JSP A;  1K78 B;  4HW0 A;  3J7A O;  1B1B A;  1P2F A;  2GZW A;  2OA4 A;  2R3S A;  4WXH A;  2XAF A;  4N0B A;  2M45 A;  4PGH A;  3FMS A;  4BHB A;  5HOO A;  4HX7 A;  1AWC A;  3IKV A;  5ICG A;  1ON1 A;  2Z33 A;  1TQI A;  2Y48 A;  1KA8 A;  1V3F A;  1U2W A;  1OMI A;  3F6O A;  4EM1 A;  3R0J A;  4L5I A;  2A3S A;  4IF4 A;  3FXR A;  2KJB A;  3QPT A;  1CF7 A;  4U7B A;  3DFG A;  2QUF A;  3V7R A;  2FA5 A;  5FLX K;  2ZNZ A;  1XCV A;  2AXL A;  4R1H A;  1UST A;  2K02 A;  1ZRF A;  3DPT A;  2WTE A;  2JSC A;  3H3Z A;  4MQV A;  4A12 A;  3VOD A;  4YFX F;  2V79 A;  4ENN A;  3M8F A;  1SFU A;  3HHH A;  4A2U A;  1SD6 A;  4OIR F;  1YTY A;  1GVJ A;  4CO8 A;  3F8N A;  1RIO H;  4F7Z A;  3GXO A;  4EM2 A;  5D5X B;  2Z3Y A;  1K7A A;  5LGU A;  2P5K A;  2FBK A;  2WV0 A;  4OIN F;  2DI3 A;  2LF8 A;  3FM3 A;  5F1R A;  3PFI A;  1ZG5 A;  2XAG A;  2KKO A;  1IRG A;  3ZMZ A;  2VC0 A;  4LB5 A;  3WE3 A;  2KRF A;  1BI1 A;  1FPQ A;  3GVA A;  1XMA A;  4HV5 A;  5L3B A;  1J9I A;  1G3Y A;  1MDM B;  2J5P A;  5CVV A;  2UXN A;  2IVM A;  2D2W A;  1R5H A;  2P5L C;  1BIA A;  1DPU A;  2FE3 A;  5ICC A;  3K1N A;  4AVP A;  5TJJ A;  2G7H A;  4KA4 A;  4BXU A;  5FB2 A;  5E18 F;  3F8C A;  2FU4 A;  4I09 A;  4GO1 A;  2ETH A;  1TQP A;  5EEH A;  2QM3 A;  5E8G A;  2PG4 A;  3V7C A;  2PBI A;  4XSZ F;  5DD8 A;  3ZPL A;  4LJZ F;  3KZY A;  2VBY A;  3GFM A;  3M7G A;  3F6V A;  2IW5 A;  4HDV A;  4HX4 A;  4L9V A;  1LDJ A;  5AIQ A;  4CIC A;  2HGC A;  1JHH A;  1D8J A;  3FWE A;  4OIO F;  3RKW A;  3CLO A;  5AIP A;  3KLO A;  1P4A A;  2O3F A;  2EFQ A;  2NRA C;  4HBL A;  2GXB A;  5D8L B;  4N9H A;  2OZ6 A;  3FHZ A;  1ZLJ A;  2FQ3 A;  2JPB A;  2CG4 A;  2LDU A;  5LEJ A;  1IXS B;  2M87 A;  4CHU A;  3GZ6 A;  3I64 A;  2XAQ A;  3RIR A;  3ELK A;  2A07 F;  3HOS A;  3KP2 A;  1G4D A;  1J7K A;  3W6J B;  4M9S A;  4ETS A;  2FMY A;  1IN6 A;  2O03 A;  2PN6 A;  1YQA A;  1FOK A;  2UXX A;  2RVC A;  2Z5U A;  2RV8 A;  2DK8 A;  3J81 K;  3M9A A;  3LQR A;  2ISY A;  2DQR A;  2EFW A;  2G9W A;  3C1D A;  1WQ2 A;  4YIF A;  1ZGJ A;  3HRM A;  1RI7 A;  4Y17 A;  1XMK A;  3GFL A;  4HZF A;  5ILS A;  3GO5 A;  4L9T A;  1FP1 D;  1ZYR F;  3OOP A;  5BS6 A;  1CGP A;  1J59 A;  1HBX G;  4EVI A;  3TO7 A;  1S29 A;  3I59 A;  1UHM A;  5A2Q K;  3C18 A;  2A5Y B;  1DP7 P;  1DPR A;  4LG0 B;  2V1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...