4GXOA

Crystal structure of staphylococcus aureus protein sarz mutant c13e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
GSHMYLSKQLEFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family regulatory protein
publication title Protein cysteine phosphorylation of SarA/MgrA family transcriptional regulators mediates bacterial virulence and antibiotic resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 49
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gxoA00
4XSXF 3RKYA 3RKXA 1MJ9A 1DDNA 4GGGA 3P9KA 1GXPA 3QU6A 4RAYA 5F64A 4M6YA 1IXSB 1SMTA 5E20A 2MLKA 2K86A 3MZYA 2FSWA 3E5QA 1JE8A 3HRUA 3WE2A 2W25A 4A12A 3ROUA 4BYYA 4RGUA 5ICFA 3V4GA 2IPQX 2CO5A 4FHTA 2BBYA 4BXUA 1DPRA 4G7ZF 3HOTA 1H9GA 2IA1A 3Q9VA 5K5OA 2P7CB 3JW4A 3LA2A 5E8IA 4O5VA 2JPBA 3I54A 3RYRA 4JQFA 4BNCA 1FYKA 3WTYC 4KN7X 3EUHA 2PBIA 3I59B 4I0BA 3D5LA 3I71A 5E1WA 1AOYA 1R36A 4HAMA 2PEXA 4OU0A 3GYHX 1XDSA 4M71A 4CO8A 2FXAA 5KVRA 4CXFA 2Q2EA 5L3CA 3ZN0A 4G7OF 1PP8F 1YW9A 3E6BA 2EK5A 1Q1HA 2W57A 2XAFA 2EV0A 1KU9A 3BDDA 5D5XB 1LVAA 1VTNC 3N4MA 1HBXG 3SHFA 1BIAA 2STTA 3FF5A 4M72A 4EGYA 3KP5A 5L3DA 5ILVA 4NHJA 2XASA 2EA4A 1IW7F 4PZJA 2JTVA 1BI2A 1J2XA 2IJLA 5HS9A 4EJTA 4Y17A 1T0FA 4B8XA 4ESFA 2HFHA 4M9XA 1TBXA 4IRIA 1F5TA 3NQOA 2HTSA 3IHUA 1ZHFA 4I01A 5FD6A 4MQVA 1TLHB 1W7PB 4N9HA 2EV5A 1ON1A 1KU3A 1J0RA 1JHFA 1R23A 1XN7A 2EV6A 1XGOA 3E5XA 3LAJA 2E1CA 3IWFA 2Y48A 2WWYA 1YO5C 5FO5A 5EEGA 3HSRA 2RGVA 3FXQA 4KMFA 4RS8A 1FOKA 1RIOH 3RYPA 5L3FA 1ZG1A 2GXGA 1ZLJA 5DDGA 5HS8A 3R0JA 3RTRA 1R00A 2NNNA 3QP5A 5K1YA 5FFZA 2O0YA 5HVQC 4WWCA 5DD4A 1OR7A 1W7PA 4EJVA 2A68F 3GO5A 3W6KB 2EJRA 3FMSA 2QWWA 4AWXB 4Y13A 4L5IA 3CO7C 3WGIA 3LFKA 1MDMB 4OIOF 1U3EM 2EB7A 2DBBA 3P9CA 5KK1A 4P9FA 4ZZDA 2ADUA 4EV0A 3K2ZA 3BJAA 3L2CA 4MEYF 5E1ZB 2QQBA 1O3QA 3CTAA 4GXOA 5J8CA 2FA5A 4WX9A 1D3YA 4M9ZA 2KJBA 4A6DA 3TDZC 2OQGA 1PP7U 1U2WA 2K27A 4FX0A 2HZTA 1ZLKA 5L3GA 2C6YA 3WG9A 2ZNYA 3TO7A 1IN6A 2ZMEB 1W5TA 4UNOA 1GVJA 5CVRA 5EEHA 5FFXA 1MDMA 1KQ0A 3FX3A 3GFMA 2WV0A 3TKYA 2EFOA 2Y0MA 1ZRCA 2ZO4A 4ENMA 4OMZA 1RI7A 3WGGA 2QUFA 4IVNA 3HRMA 2M5WA 2COMA 4PGGA 2XROA 2BYVE 2FBHA 2V1UA 4N9IA 4A0ZA 2GWRA 1SFEA 3M1EA 4IPAA 3WU1B 2Z9OA 1YYVA 4LLGF 1FT9A 3F6VA 5ILSA 1TW3A 4A0XA 4HLYA 5ICGA 2HS5A 3IWZA 3K1PA 1FP1D 1P2FA 4ENJA 1F1ZA 1RUOA 1RZ4A 5F1RA 2EA2A 3BROA 3BPVA 2ZMEA 2KIMA 2XV4S 1REPC 1J75A 1RNLA 4I09A 1G4DA 4L9VA 3GF2A 4U88A 5K5RA 3EQLF 3QRFF 2XAHA 2DU9A 5H6QA 3HSEA 2O6GE 2V79A 3EDPA 1FBUA 4KICA 1U5TC 1BOAA 3LSTA 2PG4A 4GYGA 2P4WA 3LA7A 1I6XA 1WI9A 3DXJF 1EV7A 2OBPA 4RB1A 4G6QA 2LF7A 1JXSA 1LNWA 3KE2A 2HEOA 3VOEA 3GUDA 4PDKA 6PAXA 2D45A 1HQCA 2OU2A 2HYFA 3KFWX 1MD0A 3V8LA 5CVIA 4IHTA 3WODF 1P6RA 2EWNA 1IF1A 5LLQA 3ZN1A 1KA8A 2XVCA 3SFZA 1ZG5A 3IL2A 4KYWA 2OZUA 4HF0A 3W6JB 3H3ZA 2LF8A 1FZPB 3KP2A 1I1GA 5JI6A 3WTXC 5L3BA 3ZQ7A 2DQRA 3SXYA 4MTEA 4A5MA 2CWEA 3ERED 3OOPA 3C18A 1FSEA 3QOPA 3GEZA 1P92A 1F9NA 3FXUA 1KYWA 3F8BA 1P4AA 1BC7C 2L01A 4KIGA 5LHIA 3E6DA 2VC1A 1XGNA 3LA3A 2CYYA 5FD5A 5HDNA 1G3SA 3T8TA 2ACJA 3KETA 5JFRA 3M9AA 1R1TA 2AS5F 1T38A 4Q5SF 2R7FA 3K1NA 1LDDA 3JAMZ 4RAZA 2A6EF 2FEZA 3U9GA 3J81Z 4U0WA 1E17A 4G7HF 3WTUC 2QQ9A 2KRFA 4HW0A 2FE3A 4RB0A 2DK5A 2G7UA 4MHGA 5CVVA 4K2EA 4AIKA 1BBYA 4FX4A 1XMKA 1R58A 5AIQA 4BAYA 2GIVA 1IXCA 2QZ8A 4ETSA 3CO6C 2MA3A 1S29A 5HDGA 1HKQA 2CW0F 3CUQC 2XRNA 2L02A 1QPMA 3RKWA 3I58A 1L0OC 1NHAA 5D5UB 2V6CA 2MC3A 5A2QZ 3G73A 1I5ZA 4L9JA 2P6SA 1XB4A 1X3UA 2Z99A 5JHUA 4ZZLA 4KIBA 4I98B 4BHCA 3HSFA 4LGWA 3T5XA 3V8KA 3H92A 2ETHA 3TDUC 5BQTA 1G3TA 3JTHA 3QPTA 2VN2A 5BS6A 1U8RA 1FBQA 3HTUA 4ESJA 1ONVA 2MH9A 1T39A 3I53A 2QVOA 4LK0F 4HZFA 1W5SA 1YG2A 3JAMK 2L3DA 2E7WA 1YLFA 3KZYA 3J81K 1YFHA 1Z1DA 2B0LA 3E5UA 3WTSC 2O61A 1TQIA 5E1XA 1SMYF 1B1BA 3CJNA 2BE5F 2JSCA 1HKSA 2RKHA 4ON0A 1R22A 4BH9A 3DP7A 3VFZA 3BJOA 1FNNA 4I2OA 1V3FA 2VT2A 1ULYA 1QZZA 2OQRA 1D8JA 3CUOA 3RDIA 2RN7A 3ECOA 2A3SA 3GXOA 5LHGA 2CG4A 1FSHA 4CYDA 3BY6A 2M87A 2F5CA 4XSZF 1O3RA 3HYIA 2UXNA 1B6AA 1FP2A 4UXNA 5D6FA 2K7LA 1UHMA 4G6DA 4EM2A 2PLYA 2EFQA 2XAGA 1IRGA 4R79A 1ODDA 4KN4X 2FNAA 5ERIA 3VB2A 4WXDA 3V7SA 2DPUA 2K4BA 3TO6A 1ZGAA 2IW5A 1YW8A 2QLZA 3OV8A 4HQEA 2VBYA 5E17F 4NQWA 2YPRA 1QNTA 1BN5A 3WGHA 4AIJA 1O3TA 2CGPA 2V9VA 4AVPA 4GCVA 5LHHA 2ZNZA 4U7BA 4KNYA 3ZMZA 5DYMA 3P9IA 4HDVA 1D8KA 5K5QA 2ELHA 3BZ6A 5AONA 3T0YA 2V1DA 4LMYA 3ZMUA 1WRJA 4G94A 1YW7A 1K7AA 3GFIA 3NRVA 2F5FA 2RDPA 4HV6A 2HKXA 3F72A 5D4RA 4S05A 2XGXA 5E18F 2GA1A 4A6EA 4XBFA 3ZMDA 4WXHA 4P55A 5D6EA 1J7KA 5FB2A 4CHUA 4HF1A 1TQMA 3IC7A 4GO1A 4AIHA 4I0AA 3C1DA 2QQAA 2EFWA 5IT9Z 2IA2A 3E6MA 2Y75A 3RPQA 1WQ2A 3ABTA 1LQ1A 3SZTA 1QBJA 5DUKA 3G3ZA 4WK8F 4KMUX 3RI4A 1ZAOA 3E3VA 4H0EA 4MEXF 2VBWA 2LSOA 2LKPA 2J5PA 4LLNA 4LG0B 4PGHA 1B9MA 4UVAA 1IAWA 2RVCA 3CLOA 2HYGD 4IRGA 5DEQA 3WE3A 1FWZA 3FMRA 4HX7A 2D1VA 3JSOA 3F21A 1XSDA 2M8EA 4HLXA 2VE8A 4RGSA 3K69A 4WF2A 3RIRA 4LFUA 5D5VB 2MD5A 1AWCA 4OIRF 3MWMA 5HS7A 1MGTA 1QZYA 1C0WA 2PN6A 5H6RA 2DI3A 2P5LC 2ZBKA 2E7XA 4U0YA 4ESBA 1UHWA 2O3FA 4L0YB 2M30A 1J9IA 3J80Z 2OD5A 4ENKA 1HKTA 1P4XA 1S7AA 3H3UA 3TOAA 4B09A 3Q5FA 4LG0A 2K4JA 1HW5A 2XHKA 3KP6A 4HX8A 3L7WA 3F8CA 4GYIA 2W85A 4OIQF 3E6CC 3MCZA 3QP6A 1RUNA 4YG2F 2OZ6A 2H94A 1UFMA 5CVJA 1XCVA 2AXLA 1B4AA 2MLGA 1HW1A 3FXRA 3F6OA 2YSRA 2VOOA 1T6SA 4Q47A 1XGSA 5LRSA 1BIBA 3ML6A 3GLXA 1KQ9A 2IA0A 1IN8A 1FBSA 3TOBA 3GW2A 2VODA 1IN7A 3FM5A 2L54A 4MGRA 2KIFA 3E97A 2NRAC 2WC2A 4QWQA 3IKTA 3T8RA 2BV6A 1SFUA 3F23A 5D8LB 1S7OA 3ZMVA 3QPHA 2CSOA 2ZFWA 2DT5A 2ESNA 3FMQA 1E2XA 1ZG3A 5HLGA 2Z5UA 5CYVA 2GXBA 1LDJA 3NEUA 3AAFA 1FY7A 1SD5A 2V1XA 2H6CA 4IRHA 1CF7B 3EETA 1S6LA 3COAC 4DQ2A 1BC8C 1FX7A 3LQRA 5BOXA 1XGMA 5CJ9A 1YTYA 2EFPA 1B59A 4ZYGA 2G7HA 2HQNA 3HTSB 1EH7A 4A0YA 3ZMSA 1SD4A 3FHZA 2DAOA 4F7ZA 2P8TA 5DV5A 3WU0A 3LQQA 4A5NA 5LGTA 3RJPA 4P96A 2RC4A 4OMYA 3QAHA 2FQ3A 4CGZA 4HBLA 3HHGA 4IF4A 3PQJA 4LD5A 3HRTA 2D1HA 4P9UA 2PMUA 2XKOA 2UWMA 3QU3A 2FBIA 2HGCA 2DTRA 4S04A 4ZYHA 3I5UA 4E70A 1YS7A 3I0TA 3MFKA 4L9TA 4QLCU 3SQNA 4HQMA 1CF7A 5D8KB 3LWFA 2ESHA 1QQIA 2GAUA 3DF8A 2JT1A 3C3WA 2OA4A 2VOPA 2Q0OA 2VXZA 4BQAA 3FZVA 1XMAA 1Z05A 2VBXA 3BJ6A 5D5WB 5DCMB 2KIUA 3DPLC 3DPTA 2LDUA 1STZA 2RQPA 4UV9A 1JHHA 4OOIA 4OIPF 4KIFA 3ISPA 4FT8A 2ZCWA 1DPUA 1V4RA 1UCRA 1WSUA 1S8NA 1XD7A 3MQ0A 4JK1X 3P7NA 1MJBA 3ECHA 3VEPA 3DFGA 2HWVA 1BI3A 3WTZA 2FMYA 3GWZA 5F6FA 1O7FA 4NB5A 4BHPA 4HDUA 4EM0B 1USTA 2J5OA 1G6NA 2EFNA 3Q9SA 1H9TA 1OYWA 1I27A 2IRFG 4N0BA 1Z9CA 3GZ5A 3K1MA 5DCMA 3R6SA 2Z33A 1R7JA 3KP3A 1H0MA 5FGMA 1TQPA 4HYEA 5JVTA 4KT5C 1DUXC 2UZKA 1F4KA 2X4HA 1U78A 5ICCA 4L18B 1L3LA 4ZH4F 4CICA 2H27A 4R8HA 2L4AA 2ISZA 4RB3C 3U1DA 3K0LA 3HRSA 4KDPA 1G3YA 2VC0A 2XKPA 1HXDA 1EH8A 2MBFA 4Q48A 3DV8A 1T2KA 4RGRA 2CFXA 4MTDA 4EJWA 4EM1A 2QBYB 2FNPA 1IZ1A 1Z6RA 5DUIA 2M45A 4Y15A 4P5OA 1FPQA 3EYYA 2E1NA 5L3EA 1BM9A 1O3SA 3VODA 3GX4X 1GXQA 5BPIA 4R1HA 4EVIA 3MZHA 3ZP5A 2FBKA 1XCBA 2A07F 2P7VB 3RPUA 1XSVA 2RV8A 2DK8A 4EGZA 1IXRC 4M6XA 2PQ8A 1HSJA 4CDGA 5A2QK 2QM3A 4AD9A 2NYXA 3L09A 1XSXA 2W24A 4LJZF 1BI1A 4L9NA 1B9NA 1WWXA 2FF4A 3ZPLA 2QYOA 1YQAA 2GQQA 4A2UA 5HLHA 2R7DA 4D0PA 2QBYA 4U7DA 3D0SA 2Z3YA 1LEBA 2H09A 3I59A 2WTEA 4KA4A 4ZYDA 3GVAA 2TDXA 4EQQA 3KP7A 1IN4A 3TQNA 4I02A 3FM3A 3HOSA 3K9TA 3ABUA 4HX4A 1ZYRF 4WCGA 3LAPA 4RB2C 1O57A 4O6JA 3GFLA 2A6HF 2F5DA 2KKOA 4IJAA 1FYLA 5J6XA 2ZXJA 4L0ZB 1O7LA 2XUBA 3I4PA 2H6BA 2HOEA 1PDNC 1CGPA 1SD6A 1JGSA 4G8XA 2HKOA 4XRFA 1OPCA 3KP4A 5IT3A 2K02A 5J8FA 3I64A 4WXCA 1K79A 5BPDA 1W7PD 3WTWC 1SAXA 4M73A 2FRHA 1R1VA 2DFIA 3KLNA 4EJOA 3N97A 1S3JA 2DPDA 3KLOA 3F8MA 3JSPA 4MNUA 4HA8A 2NS0A 4M9SA 3BOQA 2QENA 2JZYA 2ZKZA 4IXAA 5DCFA 2R3SA 4DNCA 5LEKA 5E8GA 5JR3A 4LB6B 1Z91A 1ZRFA 2IP2A 2A69F 1HW2A 3V7CA 2Q8KA 3R60A 5LRRA 2CQKA 1SFXA 1TW2A 1ZREA 1KU7A 3R0AA 1W4MA 2O8XA 1OMIA 4ASNA 1PUEE 4LLLA 3ULQB 3C7JA 3V8JA 2YU3A 5BMZA 2GZWA 2STWA 1U5TB 2PJPA 4BHBA 4L5JA 2DW4A 1D5VA 5HOOA 1ZN2A 3GZ6A 4ZYEA 2L4MA 5D4SA 1LB2A 4CZZA 3BPXA 2DQLA 2GA2A 4YFNF 3SZPA 2O03A 2BGCA 4UUVA 2VONA 2BEOA 3DQVC 1ZRDA 1A04A 4LB5A 2OAZA 4EJUA 1ZGJA 3FWEA 3KEQA 2PFBA 3BP8A 5HLIA 1R5HA 1TNTA 1LDKB 2DO7A 2F2EA 1DP7P 4RGXA 1HSTA 3CDHA 1KYZA 3HHHA 5IT9K 1P4WA 1Z7UA 1ON2A 1UB9A 2P5KA 1IUYA 3WTVC 4UHTA 1U5TA 1QGPA 1KGSA 1SD7A 3BWGA 1OYYA 2HTJA 2VE9A 1R1UA 2XAQA 1OYIA 1XDUA 1MKMA 2FU4A 4YIIA 3O6BB 4ENNA 4HF2A 5LBQA 1T98A 1TNSA 3T1BA 4YFXF 4IHSA 3U2RA 5ILUA 4O3MA 3JTGA 1LJ9A 1ZH5A 2JRTA 5LGUA 2ISYA 3KEOA 1IN5A 2VT3A 4UV8A 3F8NA 1J59A 5LGNA 5FLXZ 2W84A 2A61A 1BJAA 3IKVA 2A5YB 3MAJA 2F5EA 1KU2A 4OINF 4KUMA 2JPCA 2D2WA 3HUGA 2YX7A 2IVMA 4YIFA 3J7AO 4LK1F 3J80K 1YIOA 4YFKF 3M8EA 1QO0D 5H20A 2FMLA 1FLIA 1LEAA 3F22A 2PMHA 2NNYA 2XAJA 1J5YA 2HR3A 2M1BA 4PCQA 3B02A 2XIGA 1IRFA 4Z2YA 1R5GA 3TGNA 3ELKA 5CVUA 5HDKA 3TO9A 2G9WA 3F8FA 3M7GA 4HV5A 5DD8A 3CUQB 3KZZA 2P6TA 5TRDA 2MH2A 1USSA 5TJJA 5AIPA 1MZBA 1K78B 3S2WA 3PFIA 2YX4A 1OKRA 2X0LA 5LEJA 1G3WA 4JBAA 2FOKA 3HIFA 2P5VA 3R61A 3MEXA 2UXXA 1WKMA 2YR2A 3REOA 2NAZA 4I7HA 4G9YA 5CLSA 1TTYA 2KJCA 2RNJA 4U0VA 4Q4ZF 3GFJA 5FLXK 4UVBA 1FC3A 3IRRA 2HDCA 4M74A 3ZMTA 1GHCA 1U6GA 1ZARA 1Y0UA 1I1SA 5ICEA 2DLLA 3PQKA 1YS6A 1K6OA 4XLNF 3CUQA 3EYIA 1K78A 2ZJ2A 4TV7A 1FYMA 2HQRA 1KQ8A 3V7RA 3KCCA 3O2PE 4UVCA 1BI0A 3WTTC 3B73A 3F3XA 2IT0A 4HOBA 5ED4A 4XLPF 3R4KA 2VBZA 1EH6A 3L00A 3M8FA 1Z6TA 2PI0A 3O3KA 4KFCA 2LNBA 3L9FA 3DKWA 3IRQA 1MJAA 4EMSA 3DEUA 4MQ9F
chains in the Genus database with same CATH superfamily
1A6IA 4AYBN 5J1RA 4XSXF 3BG5A 3RKYA 1P7IA 3RKXA 1E0EA 1MJ9A 5GP9A 1DGWY 1DDNA 2XSDC 4E7KA 4GGGA 4V19K 3P9KA 1GXPA 3QU6A 3HKZA 2E1OA 4RAYA 5F64A 2E1MC 4M6YA 1IXSB 1SMTA 5E20A 1JJ6C 2MLKA 1ITYA 2K86A 2BW3B 3MZYA 2QSFX 3NAUA 2FSWA 3E5QA 1JE8A 5FRNA 4M3EA 4AU7A 2VL8A 3ABMH 3HRUA 1RPWA 2YU9J 4ZDOA 2KRCA 2HYJA 3WE2A 2W25A 4A12A 3ROUA 1ETXA 4BYYA 1JTYA 4RGUA 5ICFA 3V4GA 2Q2EB 1YJWI 2IPQX 3S3NA 3LL7A 3KYLA 2CO5A 3MMYB 2CUJA 2NS7A 1LE8B 4FHTA 1OCPA 2BBYA 4BXUA 3CQZJ 1DPRA 2WB1A 4G7ZF 3OYHA 3HOTA 1H9GA 2IA1A 3Q9VA 4EMSA 3S16J 5K5OA 2P7CB 3JW4A 3A4CA 1SC7A 4RBOA 3OMYA 4JX4A 2DJNA 3LA2A 5E8IA 4O5VA 3CZ6A 2JPBA 4PJJA 3I54A 5J1YA 3RYRA 4JQFA 2KL4A 4BNCA 4LOCA 5FLMJ 3JRAA 4C3JJ 1FYKA 2R7QA 5IY5H 2YUSA 3H36A 3WTYC 4KN7X 2Y0SN 3EUHA 2PBIA 3I59B 2VJIA 4I0BA 3D5LA 3CC4I 5F0CA 3D1NI 3I71A 5E1WA 3QODA 1AOYA 1QVUA 1R36A 2BW3A 4HAMA 3KPHA 3HGYA 2X48A 2PEXA 3BQZA 1OCOH 3A1YA 5J3LA 4OU0A 4FETA 3GYHX 1XDSA 4M71A 4CO8A 2FXAA 5KVRA 1WJBA 3GCMA 5KAIC 3RZDJ 4CXFA 1QA6A 2Q2EA 5L3CA 3LSIA 1P9QC 3ZN0A 3OYIA 4G7OF 1LE8A 1PP8F 1GLNA 1JTXA 1DU6A 2JA7J 1YW9A 2JN6A 3E6BA 2EK5A 1Q1HA 2W57A 2XAFA 2EV0A 3PM1A 1V5EA 1KU9A 3BDDA 5D5XB 3VDXA 2CU7A 2E35A 1LVAA 1VTNC 4KISA 3N4MA 3PO2J 2XC7A 3SHFA 1HBXG 1BIAA 2STTA 1V5GA 3C2GA 1ACIA 1SFOJ 1TC3C 3FF5A 2L9RA 3ABKH 4M72A 4EGYA 5CKTA 4G6TB 3KP5A 3JRCA 3CJQB 2HVQA 3CLQA 1ZR2A 4QPQA 5L3DA 5ILVA 4NHJA 2VI6A 3GMEA 5JLWA 2XASA 1D1CA 2EA4A 2ME0A 3ZQGA 4BACA 1IW7F 4PZJA 2JTVA 1BI2A 2DDAA 1J2XA 2IJLA 5HS9A 2KT0A 4EJTA 1CQTA 2HVSA 4Y17A 1T0FA 1VQ9I 2R7SA 1YHQI 4B8XA 4ESFA 1WH7A 2HFHA 4M9XA 1TBXA 1Z3YA 1F5TA 2DYSH 4IRIA 3NQOA 3ZQFA 1TL8A 2HTSA 3IHUA 3K6GA 3LSKA 5GAHJ 1ZHFA 4I01A 5FD6A 4MQVA 2R7ZJ 1MBJA 2X85A 1TLHB 1W7PB 3EUAA 3OSFA 1RR8C 1ZR4A 2BXYA 4HNUA 2KDZA 4N9HA 2EV5A 1GVDA 4LIVA 4ABZA 1ON1A 1KU3A 1J0RA 3BTLA 1JHFA 1R23A 1V5FA 1XN7A 2EV6A 1XGOA 2L7ZA 3E5XA 3LAJA 4BEHB 3VYTB 1JUSA 3MD2A 4XLFA 2XB5A 5F0HA 1Z3XA 2PJRB 1KZHA 1XC5A 2E1CA 3IWFA 4EATA 1LUJB 2Y48A 2WWYA 2DA3A 3HGGA 1WJAA 1XX5A 3VYRB 1YO5C 5FO5A 2I10A 4IQ4A 4OAYA 5EEGA 3HSRA 2RGVA 3FXQA 4KMFA 4KJZA 4RS8A 1FOKA 1RIOH 1UG0A 3RYPA 5L3FA 2NVQJ 1ZG1A 2GXGA 5KAFC 1D1AA 1ZLJA 5DDGA 3G1LA 5HS8A 3CMAI 2A05A 3R0JA 4C2TA 3RTRA 1R00A 3ZGKA 3JREA 2NNNA 3QP5A 5K1YA 5FFZA 3VYSB 3S1QJ 1X1DA 2O0YA 4OWRB 4E6KG 5HVQC 4HNVA 4WWCA 5DD4A 1OR7A 3L2VA 1ETOA 3GTGJ 3HEFA 3Q3SA 1ZELA 4V2FA 4XOPA 1W7PA 5B1BH 3BG9A 4EJVA 2JJ7A 2A68F 3GO5A 1K4SA 2OF7A 2LREA 3W6KB 2EJRA 3FMSA 2QWWA 3LSGA 4AWXB 4L5IA 4Y13A 5IP6A 2CS3A 3LFKA 3WGIA 2W00A 1MDMB 4OIOF 1U3EM 3QQAA 4FQGA 4BEHA 5F04A 2EB7A 4IZZA 2DBBA 1ERDA 3P9CA 1AKHB 2P0WA 2X6YA 5KK1A 2L5QA 4P9FA 4ZZDA 2ADUA 3E1SA 4EV0A 3I4NJ 1RR7A 3K2ZA 3LMMA 2OCEA 3BJAA 3L2CA 2ZXHA 3L2RA 3DTIA 4MEYF 5E1ZB 4I6ZA 3A0HC 2QQBA 1O3QA 3CTAA 4NUBA 1H89C 4GXOA 5J8CA 2FA5A 1VQ4I 5E3OA 4WX9A 3TBIA 2EIJH 1TWCJ 2P81A 1SVLA 3HOWJ 1N25A 2XF6A 2IS1A 5K7HA 4LITA 1D3YA 5FROA 4M9ZA 2KJBA 2ZXIA 4A6DA 2LLKA 2VASA 3TDZC 2R7UA 2OQGA 1PP7U 1U2WA 2L0KA 2NOJB 3K4NA 2K27A 2K3PA 1OLTA 4FX0A 3FIWA 2HZTA 1ZLKA 5L3GA 2C6YA 3WG9A 2ZNYA 2DMUA 4MO7A 3TO7A 1IN6A 3CMYA 2R7XA 2ZMEB 1W5TA 4A3LJ 4UNOA 3V42A 1QZEA 1GVJA 5CVRA 5EEHA 5FFXA 4J00A 1MDMA 1KQ0A 3FX3A 3QYFA 1JKOC 2Q1ZB 3GFMA 1AA7A 2LKSA 3SDGA 2ECBA 1TP4A 2WV0A 3TKYA 1AKHA 3OYBA 2EFOA 2Y0MA 1VNDA 4RLQA 1X4OA 4X6AJ 2KPMA 1Y39A 3DCFA 2XPVA 1ZRCA 4X1EA 2ZO4A 3BR0A 4ENMA 2UUZA 1EKEA 3DEWA 3FKJA 4FCYA 4OMZA 1RI7A 3WGGA 2E5ZA 2QUFA 4IVNA 3HRMA 1U0JA 2M5WA 2VQLA 2COMA 4PGGA 2XROA 2BYVE 2FBHA 1ETWA 2Y9YA 2V1UA 3B6AA 4N9IA 4NBQA 4A0ZA 1WVRA 2GWRA 5J4YA 1SFEA 3M1EA 4IPAA 4E7ZA 3WU1B 4BY7J 3NWTA 2Z9OA 5C4JJ 1YYVA 4LLGF 4PSWA 2EPFA 2V9PA 1FT9A 3F6VA 2RQQA 5ILSA 1MNEA 1TWGJ 2AO9A 2R4GA 1TW3A 3HUGB 4A0XA 4HLYA 1U8BA 5ICGA 2HS5A 1FMVA 3IWZA 3K1PA 4YIRX 1FP1D 1P2FA 4ENJA 2EZIA 1F1ZA 1RUOA 1RZ4A 1EF4A 5F1RA 2EA2A 2DA4A 2QCOA 3HPGA 3BROA 3BPVA 2ZMEA 5EZHA 2HXOA 2KIMA 3WG7H 2XV4S 1YRNB 4IOAF 3BT9A 1REPC 1R6RA 5TGTA 1J75A 1RNLA 4I09A 2I5UA 1M1EB 3GF2A 4L9VA 4U88A 5K5RA 1G4DA 3EQLF 3QRFF 2XAHA 2DU9A 5H6QA 1QHGA 1R4NB 3HSEA 2Z16A 4BS9A 2HZDA 2O6GE 3PNYA 2V79A 2OC6A 3EDPA 3S93A 1FBUA 4KICA 2Y30A 1U5TC 2WY8Q 4RA2A 1BOAA 3LSTA 2PG4A 4GYGA 1FIPA 4G12A 2EH3A 4IL6C 4S0HB 3H3VK 4KT6A 5F27A 1GDTA 4XKVA 4BDYA 2P4WA 3LA7A 1MMNA 1I6XA 1D5YA 1WI9A 3DXJF 2UV1A 3CCRI 1VQOI 1BJZA 1EV7A 5IYDJ 2OTJI 2OBPA 4RB1A 3PIOF 3DEEA 4G6QA 4I76A 2LTPA 4YEJA 1WJEA 2L7MP 3DTKA 2LF7A 4DZPA 4F91B 1FTZA 1YX5A 4EEFG 4OAZA 1JXSA 1LNWA 4PK4A 3KE2A 3MKWB 2HEOA 3VOEA 1ETQA 3LNQA 1YITI 1SFKA 2HOAA 2ZJQF 3GUDA 4PDKA 6PAXA 1K4TA 2D45A 1ENHA 1YRNA 1HQCA 2KFDA 2OU2A 1UMQA 1RC9A 2IS6A 3PJRA 2HYFA 2EIKH 3KFWX 1MD0A 3IP4B 3SDBA 3V8LA 1A31A 5HLTA 1IGNA 2MFZA 4DGWB 5CVIA 4IHTA 3WODF 1P6RA 1TWFJ 2EWNA 1T08B 1G2HA 1IF1A 5LLQA 2K3FA 3W6VA 3ZN1A 1PUFB 2F5VA 1KA8A 4A3CJ 1IJWC 1VF9A 4CH7A 2XVCA 1KONA 3SFZA 1ZG5A 3IL2A 2QA4I 4KYWA 2OZUA 3PUFA 3HB9A 4HF0A 3ERMA 3W6JB 1Z21A 3H3ZA 4BE1A 5IYCJ 2QGUA 1I39A 2LF8A 4DYCA 1FZPB 3KP2A 1I1GA 5JI6A 2HU9A 2KLOA 1NK3P 3WTXC 1UHSA 5L3BA 3ZQ7A 3OYGA 2LVSA 2F4OB 2DQRA 5K7ZA 1Z0XA 3SXYA 2VPRA 1SVOA 2DA5A 4XKBA 4MTEA 4A5MA 2V4JC 2CWEA 3ERED 1X1AA 3H5RA 2M3AA 3C18A 3OOPA 1WFXA 1FSEA 2IGMA 3QOPA 1TT5B 1LVKA 1N75A 3GEZA 5EGOB 1P92A 3AG1H 3RQIA 1F43A 1F9NA 3FXUA 1KYWA 3F8BA 3SYTA 1P4AA 5B3SH 1BC7C 3GTQJ 2L01A 2MABA 4KIGA 3D5RC 2HOSA 1MMGA 5LHIA 3E6DA 1G59A 4ZC3A 4HNTA 2HVRA 4ZDLA 4B1RA 4F55A 2VC1A 2FX0A 5BNGA 1XGNA 1PUFA 3LA3A 2CYYA 3ZXSA 5FD5A 5HDNA 1G3SA 3T8TA 2ACJA 3FXLA 3K70C 5JFRA 3KETA 3M9AA 1R1TA 2AS5F 1T38A 4Q5SF 5KNLA 2R7FA 3K1NA 3F0CA 1LDDA 3FISA 2BZTA 4CCKA 3JAMZ 3CF2A 4RAZA 2A6EF 2FEZA 3U9GA 1X19A 3J81Z 2MGQA 2Z2SB 4U0WA 1WZ2A 1E17A 4G7HF 3WTUC 1HC8A 1Y8RB 3BR2A 3W2VA 3BCAA 2DT7B 2QQ9A 2KRFA 2BY0A 5GPCA 3ZRGA 3KZIC 4HW0A 3O8GA 2IBDA 2EZLA 2FE3A 4RB0A 1RETA 2DK5A 2G7UA 3QPSA 4MHGA 4FE4A 5CVVA 5IOYA 4K2EA 5EGOA 5M5WJ 4AIKA 1BBYA 5E3MA 2LR8A 1W0UA 4FX4A 2DYRH 1XMKA 3OWTA 1R58A 5AIQA 4BAYA 2GIVA 4DYQA 1IXCA 2LC2A 2QZ8A 4E7IA 4H4KC 4ETSA 2LP0A 3CO6C 2MA3A 3A2KA 5JHFA 2M0CA 1X3WB 4XKCA 1S29A 3DKYA 3LSMA 5HDGA 2X1EA 3FXOA 2HQ5A 2G0EA 1HKQA 2AHQA 3W2WA 1ETKA 2CW0F 3CUQC 2XRNA 2XPWA 2HXIA 2L02A 1VQPI 1NH3A 1QPMA 3RKWA 3I58A 1L0OC 1NHAA 4JOMA 1TWHJ 5D5UB 1HDDC 2K9LA 3NARA 4M3DA 4P1WA 1FIAA 2V6CA 2MC3A 4QPOA 5A2QZ 1MMDA 3G4SI 3G73A 3CCVI 1I5ZA 2ZSIB 4L9JA 1WH5A 2BHYA 3HKZN 5FKMA 2P6SA 2LKXA 4BY1J 2M7AA 1XB4A 1X3UA 3ZQCA 2Z99A 1S7EA 2M7BA 3J7YJ 5JHUA 4ZZLA 4KIBA 3FBNB 4I98B 3SEZA 4BHCA 4IOCF 2VKDA 3HSFA 4LGWA 3BG3A 3T5XA 2YS9A 3V8KA 3H92A 2ETHA 3TDUC 2R7WA 5BQTA 3L1PA 4ANJA 1B8IB 1G3TA 3HM5A 4BXXJ 1ORKA 3JTHA 1R5ID 2X6XA 4RM2A 3VWBA 3OYJA 3IH3A 1U9NA 2VJ5A 3QPTA 2VN2A 3CJRB 5BS6A 1U8RA 3H9GA 3I55I 3MKLA 3OIPA 1FBQA 3HTUA 4ESJA 1ONVA 2MH9A 1T39A 3OYCA 1VQNI 3I53A 2QVOA 4LK0F 4A69C 4HZFA 1SVMA 1W5SA 1YG2A 1UJ8A 4CCOA 3JAMK 2L3DA 3U21A 2LOOA 1LFUP 4IO9F 2L7KA 3I3LA 1VQ6I 2E7WA 1YLFA 3KZYA 4B3AA 4DBRA 3J81K 1YFHA 2IEKA 1Z1DA 2B0LA 3E5UA 3WTSC 2O61A 1TQIA 1R9TJ 3A02A 5E1XA 4RAGA 2Y69H 1SMYF 2XF7A 1B1BA 3CJNA 3SZGA 2BE5F 3S1NJ 3TW7A 2JSCA 1HKSA 2RKHA 4ON0A 3S3OA 2IS4A 1FOXA 4BUPA 3BR1A 2ELKA 1QU3A 1R4MB 2WAEA 4DOZA 1R22A 4BH9A 1GUUA 3DP7A 4A3JJ 1I3QJ 1NTCA 3VFZA 3BJOA 1FNNA 4I2OA 2KZGA 2V26A 4MFEA 1V3FA 1B8IA 5E3NA 2QSHX 2L9VA 2BY2A 2VT2A 1ULYA 3TMOA 4HRIA 3HC7A 3RPUD 4NQWB 1QZZA 2OQRA 1D8JA 3CUOA 4B48A 4W97A 1D1BA 2DFFA 3EUHC 1WCMJ 2RN7A 3MN2A 4V2GA 5EZGA 3ECOA 3RDIA 5EEAA 4GFBA 2R5ZB 2A3SA 3FDYA 3G2BA 3GXOA 5LHGA 2CG4A 1FSHA 2MC4A 1JKRC 4CYDA 3AFHA 3BY6A 3JRDA 2M87A 2HQAA 4IQJA 2F5CA 4I99C 3M1CA 4XSZF 3CF5F 1O3RA 3HYIA 1WJFA 2UXNA 2DFHA 4E4HA 1OISA 1B6AA 3HXLA 1FP2A 2DT6A 1OFCX 4UXNA 5D6FA 2NVXJ 2K7LA 5IOZA 2DN0A 1UHMA 2CJJA 4G6DA 4EM2A 1FOYA 5GAGJ 2JA5J 2EFQA 2VXDA 2PLYA 1IUFA 2FUG2 2M8GX 1IV8A 2XAGA 3LSPA 1IRGA 4R79A 1ODDA 4AIDA 2NVTJ 4KN4X 2FNAA 4J19A 1X58A 5ERIA 4BQNA 3VB2A 1A36A 1MIJA 4WXDA 5TISC 2FOWA 4D5FA 5JLXA 4XRMA 2VQGA 2KHMA 2CW8A 4XORA 3V7SA 2DPUA 2K4BA 3TO6A 1ZGAA 2IW5A 1YW8A 2QLZA 4F52A 4QIWN 3C2BA 1NK2P 3CC7I 3OOUA 3OV8A 2VBYA 4HQEA 5E17F 4AVZA 2JK3A 4NQWA 1RKWA 2YPRA 2E71A 1QNTA 3RKQA 4E7JA 3S1MJ 1BN5A 2PMZA 3WGHA 3RSNA 4AIJA 1O3TA 2CGPA 2Y9ZA 2XGDA 2A5WA 2V9VA 2R5ZA 3D5SC 1FMWA 4AVPA 4GCVA 5LHHA 2ZNZA 3E7LA 3JRHA 5FKLA 1PYVA 4U7BA 4KNYA 1HA8A 3ZMZA 3K2AA 1XG1A 2ZC2A 5DYMA 3P9IA 2CRGA 4HDVA 2EQRA 3CP8A 2OV7A 1D8KA 3Q0UA 2K9NA 2KZVA 5K5QA 2ELHA 3BZ6A 3ZQHA 5AONA 4XKWA 2VKHA 3T0YA 1T33A 2V1DA 1AHDP 4PJMA 4LMYA 3ZMUA 3DKXA 2O5RA 5H2FC 1WRJA 3K4KA 2WAQN 4G94A 1JUPA 4A3KJ 1YW7A 2WY7Q 4A3GJ 1K7AA 1LFBA 3GBGA 4XICA 1Y0NA 3J7AY 3GFIA 2H1LA 3NRVA 4UUSA 2F5FA 2RDPA 4HV6A 2IGKA 2DMNA 1WJ5A 2HKXA 3M4OJ 3F72A 1B72B 5D4RA 5F1JA 2M2EA 4S05A 2XGXA 5E18F 1IRZA 1YE9A 2GA1A 4A6EA 4DZJA 4XBFA 3AL0B 4XK4A 3ZMDA 4WXHA 4P55A 5D6EA 1WHUA 1J7KA 4QSHA 1ZGWA 1E3OC 2OPTA 5FB2A 4CHUA 2AQFA 3EUKL 4HF1A 1TQMA 3IC7A 4F93B 2E2IJ 4GO1A 2KISA 4AIHA 4I0AA 3C1DA 2GOMA 2QQAA 1MNDA 1SANA 4XN3A 3A01B 2EFWA 5IT9Z 2IA2A 5FKNA 2EZKA 3E6MA 2Y75A 2DA2A 2TRTA 5KHDA 3RPQA 1WQ2A 3ABTA 3QYEA 4CCJA 1LQ1A 3ZQLA 3SZTA 1OR7C 2BVLA 2R7RA 1QBJA 2LYCA 5DUKA 1S72I 4Y33A 3G3ZA 4D7NA 4WK8F 2E60A 3PFYA 4KMUX 3RI4A 1ZAOA 1IG7A 3E3VA 4H0EA 4MEXF 2VBWA 3BR3A 1Y6IA 2LSOA 1PVEA 2LKPA 2J5PA 4LLNA 4LG0B 4MLOA 4PGHA 4JX5A 1B9MA 4UVAA 1IAWA 2RVCA 3CLOA 2NVYJ 3BC8A 2HYGD 4XM3A 1EJ9A 1R71A 4IRGA 5DEQA 2COBA 3WE3A 1FWZA 3FMRA 4CCNA 4HX7A 2D1VA 4B44A 1D0XA 2JWTA 4BGDA 1MBHA 3JSOA 3F21A 1B72A 1XSDA 2M8EA 1HLVA 1IDYA 4HLXA 2VE8A 4RGSA 2OTLI 4YELA 3K69A 4WF2A 4BU2A 4BJ6C 2IGNA 3IAM2 2BHZA 2RAEA 1Y56A 3JRBA 3BG6A 3RIRA 3OS0A 3VSKA 4LFUA 5D5VB 2MD5A 1Y1VJ 3DPUA 1AWCA 2ID6A 4OIRF 3S15J 4PFPA 4B3XA 3HPHA 1XPXA 2L9NA 2GIZA 3MWMA 5HS7A 3A01A 2H8RA 1MGTA 2CUEA 1QHHD 2DXIA 1QZYA 1C0WA 3ZQQA 2CW7A 1EA3A 5FKOA 2EBIA 5B66C 3F9KA 1X3ZB 2PN6A 5H6RA 2DI3A 2P5LC 1YIJI 2ZBKA 2K9SA 2E7XA 4U0YA 5EJCA 4ESBA 1UHWA 2O3FA 3MZ8A 1R49A 2M30A 4L0YB 1J9IA 3J80Z 2M34A 2OD5A 1HDPA 2MG4A 4ENKA 1HKTA 1NG6A 1P4XA 1S7AA 3BTCA 4JYKA 3H3UA 3TOAA 4B09A 3Q5FA 3FK6A 1Y1WJ 4LG0A 5KCMA 2K4JA 3I9V2 1HW5A 2HNHA 4HPQA 4BBSJ 2XHKA 2LK2A 4XRSA 3KP6A 3GZNB 3CCJI 3S1RJ 1POGA 4ZYAA 4HX8A 3L7WA 3F8CA 3OYEA 2ZFUA 2W85A 4GYIA 1BR1A 4RM3A 1OJLA 4OIQF 3E6CC 3MCZA 2NOGA 5CQGA 3QP6A 1RUNA 4YG2F 2OZ6A 3OL4A 2H94A 1UFMA 1IRXA 5CVJA 3SFIA 1HOMA 1XCVA 4BKXA 4D5CA 2AXLA 1MH4A 1B4AA 1GV2A 2MLGA 3IAS2 3KIOA 1HW1A 1Z7LA 3FXRA 1RKTA 3M07A 3F6OA 2YSRA 5J4VA 2VOOA 1T6SA 1JT6A 2IGOA 4Q47A 3IH2A 1XGSA 5LRSA 1BIBA 3ML6A 3GLXA 2W1OA 1KQ9A 3FK7A 2IA0A 3RCOA 1ETYA 1IN8A 1FBSA 3TOBA 3GW2A 3AG3H 2VODA 4FTHA 3BZKA 1RRJA 3ASOH 1IN7A 3FM5A 4CYCB 2L54A 4MGRA 2JUCA 2KIFA 3E97A 4E7HA 2NRAC 2DA7A 1MSEC 1IDZA 2JVHA 4W1UA 4XLAA 3G6EI 2WC2A 4QWQA 1V54H 3JRIA 1W36C 1NG7A 1UZCA 3IKTA 2GBYA 3T8RA 2NS8A 1YJNI 4HG2A 2BV6A 1SFUA 1X1PA 2KMUA 3F23A 1S5LC 1WJDA 1JGGA 3JRFA 2E2JJ 3OY9A 4U87A 5D8LB 1S7OA 1A5JA 2JRMA 4B4CA 1JT0A 3ZMVA 3OYMA 1VQ7I 3QPHA 2O9LA 3DBRB 2CSOA 3BQYA 2JA6J 2R7VA 2DOAA 2KRHA 4N4NB 2ZFWA 3S14J 2ZJPF 2DT5A 2ESNA 1TZLA 3FMQA 4UB6C 2E5NA 1E2XA 3CD6I 5B1AH 1TWAJ 1VQLI 5J47A 1ZG3A 5HLGA 1MH3A 2XB0X 3DBLB 2OUMA 2Z5UA 5CYVA 2GXBA 2V9KA 1Q1VA 1LDJA 2VQCA 3AG4H 4A3FJ 2ZB9A 5IP9J 2O7OA 3NEUA 3AAFA 1FY7A 2WADA 4CYCA 2E34A 4BE2A 1WGXA 1SD5A 4BQOA 2V1XA 2WA0A 2H6CA 4IRHA 1CF7B 3EETA 1S6LA 4NC6A 4DQ2A 3COAC 1BC8C 1FX7A 3LQRA 5BOXA 1XGMA 4D1QA 5CJ9A 1YTYA 2EFPA 3QPLA 1B59A 1VQ8I 4ZYGA 5F0FA 2G7HA 2HQNA 1APLC 2DMQA 2QSGX 3HTSB 2MYSA 2KIQA 1EH7A 4A0YA 3ZMSA 1SD4A 2W7NA 3FHZA 2DAOA 4F7ZA 2P8TA 4NDLA 5DV5A 3WU0A 3GTKJ 2DA1A 3LQQA 4A5NA 4XLEA 5CPRB 3OSGA 1BR4A 1ZK8A 4NNJA 3RJPA 2XSJC 2RC4A 4P96A 5LGTA 4OMYA 3QYBA 3K70D 3QAHA 2FQ3A 4CGZA 4HBLA 2XF5A 3HHGA 3UR3C 4IF4A 3PQJA 5E79C 4LD5A 3HRTA 2D1HA 4P9UA 5HNHA 2HDWA 2PMUA 2XKOA 2UWMA 4CCMA 2HPIA 3K4LA 3K4MA 3QU3A 2QKMB 2FBIA 2HGCA 4PJLA 4A3DJ 2DTRA 2K9QA 4S04A 4ZYHA 4D7MA 3I5UA 1Z67A 4Y52J 4E70A 1VI0A 4FE7A 3ZCOA 1YS7A 3I0TA 3MFKA 4L9TA 2X1CA 2DMPA 1GT0C 2WAFA 2A6TA 3Q0WA 4QLCU 3SQNA 4HQMA 1CF7A 5D8KB 1OCZH 2JSPA 3LWFA 4Y7NJ 2KQRA 5HNFA 2ESHA 1QQIA 4ZTJA 2GAUA 1QPIA 1T8IA 3DF8A 3WU2C 2JT1A 2E1MB 1WJCA 1N78A 3C3WA 2OA4A 3PIPF 2VOPA 5C3EJ 2Q0OA 2VXZA 1DU0A 5F08A 2CUZA 3FZVA 4BQAA 1XMAA 1OQYA 1BR2A 1Z77A 1Z05A 2VBXA 2CH0A 3BJ6A 4CSWA 5D5WB 5DCMB 2KIUA 3DPLC 3KEYA 3DPTA 2HOTA 3C2HA 2LDUA 1STZA 2DDBA 1Y8QB 3BG7A 2RQPA 4UV9A 1JHHA 3J7ZI 4OOIA 4JP0A 4OIPF 2FJ1A 4KIFA 3ISPA 4FT8A 1WPKA 2ZCWA 1DPUA 1V4RA 3JRGA 1UCRA 1WSUA 4AUXA 1S8NA 1XD7A 3MQ0A 4JK1X 3P7NA 3L2WA 3DBHB 1MJBA 3ECHA 3VEPA 2PX9A 3CC2I 3DFGA 2HWVA 3K7AJ 1BI3A 3WTZA 3RZOJ 1IC8A 4XQFA 4J01A 2FMYA 3GWZA 5F6FA 1O7FA 4XN0A 5EDNA 4NB5A 4BHPA 4HDUA 4EM0B 5M3MJ 3OYLA 1USTA 1JUMA 2QEXI 3CCUI 1W0TA 5FLVA 3CMEI 1YX3A 1G6NA 2EFNA 2J5OA 3DU6A 3Q9SA 1OYWA 1I27A 1H9TA 2IRFG 4N0BA 3S17J 1Z9CA 3AKZA 3GZ5A 3PSIA 3TP0A 4C3HJ 3K1MA 5DCMA 3R6SA 1RESA 4CZCA 2Z33A 2X51A 3K4JA 2K85A 1R7JA 3AG2H 4F3QA 1OCTC 3KP3A 4AYBA 3TP3A 2XPUA 4RLFA 4CA0A 2N8GA 1H0MA 4LIUA 1TQPA 5FGMA 2WB1N 4M3BA 4HYEA 2DODA 5JVTA 4KT5C 1DUXC 2K9MA 3GTJJ 2UZKA 1F4KA 2DCEA 2OJED 2X4HA 1U78A 5ICCA 4L18B 1QRYA 2ZSHB 3UKGA 1BL0A 1GV5A 1L3LA 3QOEA 4ZH4F 4Y3OA 4CICA 2H27A 3JCUC 4KITB 3G1MA 1T56A 1FJLA 3X2QH 4BQQA 4JX6A 4R8HA 2L4AA 3HOZJ 5GADJ 1UG2A 2ISZA 2XDVA 5LD2C 4A3EJ 1TT0A 4RB3C 2V6EA 2MD0A 3U1DA 2CQNA 1BOBA 3HRSA 3K0LA 5J1UA 4KDPA 1G3YA 2VC0A 2XKPA 1HXDA 3M8JA 1EH8A 4RMNA 4F92B 2K5CA 2X6WA 2MBFA 4Q48A 3DV8A 2EZHA 1T2KA 4RDUA 3L2QA 4RGRA 2CFXA 4MTDA 4EJWA 4EM1A 1BW5A 2DJIA 2LRDA 2QBYB 1WI3A 1SAUA 4BJ5C 4DJAA 2MSYA 3LSRA 1A35A 2CV0A 2FNPA 2VB6A 1IZ1A 1Z6RA 2EIMH 5DUIA 2M45A 2JUGA 4Y15A 4P5OA 1FPQA 3EYYA 3MKYB 2E1NA 5L3EA 1BM9A 2LH9A 2Y0SA 1PJRA 3PSFA 1O3SA 3VODA 3GX4X 4MQ9F 2GM4A 1GXQA 4UB8C 5BPIA 4R1HA 2W82A 3W3CA 2CQ7A 2MW8A 3CCYA 3PNTA 5EYRA 1I3AA 4EVIA 1JKPC 3MZHA 3ZP5A 2FBKA 1XCBA 2XGCA 1XMXA 2A07F 4BXFA 2P7VB 3RPUA 1XSVA 2RV8A 3HBLA 3ASNH 2DK8A 4EGZA 3TEDA 1N77A 1IXRC 4M6XA 2PQ8A 1HSJA 4CDGA 5A2QK 2ID3A 3HDDA 1D0ZA 2ECCA 2QM3A 4AD9A 2NYXA 3L09A 1XSXA 1BA5A 2M4GA 2W24A 4LJZF 1MNMC 1BI1A 4L9NA 1B9NA 1WWXA 2FF4A 3ZPLA 2QYOA 1YQAA 3HOXJ 2GQQA 2BY1A 1AU7A 4Y4RA 3G1OA 4HSRA 4A2UA 5HLHA 1SEUA 4PFOA 4UY8I 2R7DA 4D0PA 2QBYA 5FRMA 4U7DA 2RREA 4UUSB 3D0SA 2Z3YA 3PUBA 1LEBA 2H09A 3OYNA 4ITVA 3I59A 2WTEA 4KA4A 4DBQA 3HL2A 4ZYDA 2PMZN 3GVAA 3OL3A 2TDXA 3FXJA 4GRIA 4EQQA 3KP7A 2M0MA 1IN4A 4D9JA 1I50J 3S2DJ 1I6HJ 2LY1A 3TQNA 1DGRM 3FM3A 4I02A 3K9TA 3HOSA 3ABUA 3KYCB 4HX4A 3H1CA 3A0BC 1ZYRF 4WCGA 2JMWA 3LAPA 1YI2I 4RB2C 2H1KA 2NVUB 2AQEA 1O57A 4O6JA 4BL0B 2L2OA 1T0FC 3GFLA 2A6HF 2F5DA 2KKOA 4IKFA 4IJAA 3O8HA 2IXSA 3GTPJ 2CQXA 2R7OA 5DM6F 4XLCA 1FYLA 5J6XA 4LG3A 2CV1A 2ZXJA 4PSXA 4L0ZB 2R0QC 1O7LA 3SEQA 3VYUB 1ZTRA 2XUBA 3I4PA 2H6BA 2L7FP 3VSLA 2HOEA 4HSTA 5J40A 3M3YJ 3FXMA 3FBIB 1LFPA 1PDNC 1J09A 3CP2A 4IHVA 3UNGC 2AXTC 4PJ0C 1CGPA 3OYKA 3IV5A 1SD6A 1JGSA 4Z6YA 2DFEA 1G8XA 2M4KA 4G8XA 2HKOA 4XRFA 1OPCA 1S9HA 3KP4A 2O8KA 5IT3A 2K02A 2R5YB 5J8FA 1W5CC 5DS9A 1F36A 1QVTA 1E3HA 4C2UA 2VQHA 4ZDPA 3I64A 2XAUA 4WXCA 1K79A 5DTDA 3HOYJ 2JVGA 5BPDA 1W7PD 4GDFA 3WTWC 2QQ8A 1E3PA 2WAQA 2E19A 1SAXA 4M73A 4II2A 2FRHA 2XRLA 1R1VA 2W4SA 3BR5A 4AM3A 2JA8J 4NC8A 2DFIA 4M6VA 2ZXWH 3KLNA 4EJOA 2DMTA 3H0DA 3DLLF 3JR9A 3N97A 1S3JA 3TL4X 2DPDA 3KLOA 3F8MA 3WHCA 5IP7J 3JSPA 2HPMA 4MNUA 2OCCH 4HA8A 2CV2A 3HOUJ 2NS0A 1XTAA 4M9SA 2LBFB 3BOQA 2QENA 2JZYA 4B47A 3L2UA 2ZKZA 3OIOA 4IXAA 4XONA 5DCFA 2R3SA 4DNCA 5LEKA 5E8GA 4C9YA 2L9SA 5JR3A 4DW6A 5M5XJ 4FASD 4LB6B 4M3GA 2PJRA 4II3A 3K10A 1MMSA 1Z91A 2F6CA 1ZRFA 3HZJA 2F4IA 2IP2A 2A69F 1HW2A 3V7CA 2Q8KA 3R60A 5LRRA 3BTJA 2CQKA 2ME6A 1SFXA 1YJ9I 3OYFA 2R5YA 1TW2A 1MW7A 1ZREA 1KU7A 3R0AA 4A3MJ 3OS1A 1W4MA 2O8XA 1OMIA 2B7EA 4ASNA 5HODA 2X6OA 2M9HA 1PUEE 2X9DA 4LLLA 3ULQB 3CCMI 3FKIJ 1XS9A 3C7JA 3S8PA 2CQQA 3V8JA 1FEXA 5C44J 2YU3A 5BMZA 2RNGA 1VQ5I 2GZWA 2H8WA 3K4CA 1K83J 3K4BA 3Q0VA 3U1KA 2STWA 1U5TB 2K40A 2BVMA 2PJPA 2FQ4A 4BHBA 2LBFA 4L5JA 2DW4A 2DTZA 2B63J 1D5VA 3KX2A 5HOOA 1ZN2A 3GZ6A 4ZYEA 2L4MA 4MIMA 5D4SA 1LB2A 4CZZA 3BPXA 2DQLA 2GA2A 4YFNF 3AL0C 1JJ8C 3SZPA 2O03A 2Z1DA 2R93J 2BGCA 4UUVA 1DP3A 3DWLE 1ETVA 5IPAA 1MBFA 1D0YA 4XOTA 2VONA 2BEOA 2VKVA 3DQVC 1ZRDA 1A04A 3OS2A 4LB5A 3DLAA 5LFAA 2VKEA 2OAZA 1X2NA 2TCTA 4EJUA 1ZGJA 3HG9A 3BTIA 3FHNA 3FWEA 3KEQA 2PFBA 3BP8A 2FD5A 3PNVA 5HLIA 1R5HA 1TNTA 4C30A 1VFCA 1LDKB 2DO7A 2F2EA 1DP7P 4RGXA 4DYRA 1HSTA 2CMPA 5EG0B 3CDHA 1KYZA 5C4XJ 3HHHA 1MMAA 4BBRJ 5IT9K 5M5YJ 1P4WA 1Z7UA 3EPZA 2DA6A 1ON2A 2HDDA 3HOVJ 1UB9A 2P5KA 4A3IJ 3ABLH 1IUYA 1YOVB 3WTVC 3MVPA 4UHTA 4XLHA 2DOFA 1U5TA 1W36D 2B9SA 1QGPA 4NC7A 1KGSA 1SD7A 2LG4A 3BWGA 1OYYA 2HTJA 4YRVA 1IO2A 3I4MJ 2VE9A 1R1UA 5M3FJ 1HCRA 4C3IJ 3N05A 2LFBA 2XAQA 1OYIA 1XDUA 3GTLJ 1MKMA 1H8AC 2FU4A 4YIIA 3O6BB 2KP6A 4ENNA 4HF2A 5LBQA 3QWLA 1T98A 3WHBA 1TNSA 1P7JA 3T1BA 4YFXF 1H88C 2ZMEC 4IHSA 3H0GJ 3GTMJ 3U2RA 4C2MJ 3PO3J 5ILUA 4O3MA 3JTGA 1V55H 2Y31A 3OYAA 4MFDA 1LJ9A 4XRSG 2JRTA 1ZH5A 5LGUA 3IUOA 2BOLA 3ZOBA 2ISYA 3KEOA 4RAFA 2VIXA 5FKKA 3RQ4A 3BR6A 1IN5A 4E7SA 2VT3A 4UV8A 1MBKA 3ONQA 2Y2ZA 4XMYA 2ELJA 3F8NA 1J59A 5LGNA 3BCBA 4CCLA 5FLXZ 1K61A 1X1CA 2W84A 4XR6A 2A61A 1BJAA 2QF7A 1OCRH 1VZ0A 4XL9A 3IKVA 3OIQA 5EG0A 2A5YB 3VPRA 3MAJA 2F5EA 2IAIA 2V7FA 1KU2A 1MSFC 4OINF 4KUMA 3ZR8X 1JKQC 4ZTFA 2JPCA 4X0GA 2D2WA 3BZCA 3HUGA 2YX7A 3G71I 3ESWB 2VJJA 2IVMA 3PL8A 4YIFA 3J7AO 2WBMA 2JA2A 4IEJA 4LK1F 2E36A 3B6CA 3J80K 1BW6A 2VLAA 1YIOA 2WV1A 4YFKF 2KDOA 3M8EA 3GLLA 5IYBJ 3MKZA 1QO0D 2XGEA 5H20A 9ANTA 5JVGF 3ZQIA 3CCQI 4A93J 2FMLA 1FLIA 1LEAA 2QKLB 3OYDA 1JI8A 2R92J 2V1NA 2EILH 4XIDA 3F22A 1OCCH 2PMHA 3CESA 2HI3A 2NNYA 4M3FA 3CO7C 4BE0A 2XAJA 4A3BJ 3DU5A 5B5EC 3KYDB 1J5YA 1LKXA 4CUGA 2HR3A 2M1BA 4N4OB 3HJEA 5DM7F 4PCQA 5EF6A 3B02A 3LSJA 5GTIC 2XIGA 1IRFA 4Z2YA 1R5GA 4BJTA 3CDIA 3W2AA 3TGNA 1W1WE 3ELKA 2F4MB 5K7FA 5CVUA 5HDKA 2GLOA 1U9OA 5GAEJ 1X1BA 4UUTA 3TO9A 3TW6A 3BLYA 3H9QA 1T95A 2G9WA 3S2HJ 2EINH 2LD5A 1MBEA 3CCLI 2VUMJ 1FOWA 1FTTA 3F8FA 3M7GA 4HV5A 1VQKI 5DD8A 3CUQB 3KZZA 2P6TA 5FJ8J 5TRDA 4IHWA 1X2MA 4B43A 2MH2A 1USSA 5TJJA 1LPQA 2R7TA 2CUFA 5AIPA 1MZBA 3H35A 2E2HJ 1K78B 1IV6A 2ICWG 5E3LA 2D5VA 3S2WA 3PFIA 2YX4A 1OKRA 2X0LA 5LEJA 1G3WA 4JBAA 2FOKA 4HEA2 3HIFA 2P5VA 5CQEA 3CJTB 3R61A 3MEXA 2UXXA 3CCEI 1DQUA 3IH4A 1UAAA 3OR2C 2W48A 3A03A 1WKMA 2YR2A 3S3MA 3REOA 2NAZA 4I7HA 4G9YA 3H5AA 5CLSA 4IHXA 1TTYA 2I8DA 1ZKGA 3H9JA 2RNJA 2KJCA 1MBGA 3OR1C 2BY3A 4U0VA 3LSHA 4Q4ZF 5GTHC 3GFJA 5FLXK 2ZJRF 4UVBA 1FC3A 2JQ7A 3IRRA 3FXKA 3LOCA 2CFOA 2HDCA 4M74A 1K6YA 4L5EA 1UELB 3ZMTA 1GHCA 1U6GA 1HF0A 3S32A 1ZARA 1Y0UA 1I1SA 2F48A 5ICEA 4DIQA 2DLLA 3PQKA 1YS6A 1K6OA 4XLNF 3SJMA 4E7LA 3NWSA 3CDLA 2DOEA 3CUQA 4AC0A 2GXAA 3EYIA 1K78A 2ZJ2A 4ZJZA 4TV7A 1FYMA 2HQRA 1KQ8A 2LY9A 3V7RA 3KCCA 4PUSA 3O2PE 1A6QA 2VPLA 3P5JA 4UVCA 1BI0A 4BDZA 4IX7A 3WTTC 2GOXB 3LFUA 3B73A 3CCSI 3F3XA 4IHYA 2IT0A 4HOBA 2NXNB 5ED4A 3H5NA 4XLPF 3R4KA 3CMMA 1O4XA 2VBZA 4QTRA 2IS2A 1X4PA 3GTOJ 5GPAA 1EH6A 3L00A 3M8FA 1Z6TA 2VJ4A 2PI0A 3O3KA 3E0JB 2X1DA 1ZQ3P 3I56I 4KFCA 2BXZA 3DTEA 2LNBA 4PJNA 1VQMI 3L9FA 3DKWA 3IRQA 4XNFA 1MJAA 2LMDA 3DEUA 4FISA 2LY2A
chains in the Genus database with same CATH topology
4XSXF 3RKYA 3RKXA 1MJ9A 1DDNA 4GGGA 3P9KA 1GXPA 3QU6A 4RAYA 5F64A 4M6YA 1IXSB 1SMTA 5E20A 2MLKA 2K86A 3MZYA 2FSWA 3E5QA 1JE8A 3HRUA 3WE2A 2W25A 4A12A 3ROUA 4BYYA 4RGUA 5ICFA 3V4GA 2IPQX 2CO5A 4FHTA 2BBYA 4BXUA 1DPRA 4G7ZF 3HOTA 1H9GA 2IA1A 3Q9VA 5K5OA 2P7CB 3JW4A 3LA2A 5E8IA 4O5VA 2JPBA 3I54A 3RYRA 4JQFA 4BNCA 1FYKA 3WTYC 4KN7X 3EUHA 2PBIA 3I59B 4I0BA 3D5LA 3I71A 5E1WA 1AOYA 1R36A 4HAMA 2PEXA 4OU0A 3GYHX 1XDSA 4M71A 4CO8A 2FXAA 5KVRA 4CXFA 2Q2EA 5L3CA 3ZN0A 4G7OF 1PP8F 1YW9A 3E6BA 2EK5A 1Q1HA 2W57A 2XAFA 2EV0A 1KU9A 3BDDA 5D5XB 1LVAA 1VTNC 3N4MA 1HBXG 3SHFA 1BIAA 2STTA 3FF5A 4M72A 4EGYA 3KP5A 5L3DA 5ILVA 4NHJA 2XASA 2EA4A 1IW7F 4PZJA 2JTVA 1BI2A 1J2XA 2IJLA 5HS9A 4EJTA 4Y17A 1T0FA 4B8XA 4ESFA 2HFHA 4M9XA 1TBXA 4IRIA 1F5TA 3NQOA 2HTSA 3IHUA 1ZHFA 4I01A 5FD6A 4MQVA 1TLHB 1W7PB 4N9HA 2EV5A 1ON1A 1KU3A 1J0RA 1JHFA 1R23A 1XN7A 2EV6A 1XGOA 3E5XA 3LAJA 2E1CA 3IWFA 2Y48A 2WWYA 1YO5C 5FO5A 5EEGA 3HSRA 2RGVA 3FXQA 4KMFA 4RS8A 1FOKA 1RIOH 3RYPA 5L3FA 1ZG1A 2GXGA 1ZLJA 5DDGA 5HS8A 3R0JA 3RTRA 1R00A 2NNNA 3QP5A 5K1YA 5FFZA 2O0YA 5HVQC 4WWCA 5DD4A 1OR7A 1W7PA 4EJVA 2A68F 3GO5A 3W6KB 2EJRA 3FMSA 2QWWA 4AWXB 4Y13A 4L5IA 3CO7C 3WGIA 3LFKA 1MDMB 4OIOF 1U3EM 2EB7A 2DBBA 3P9CA 5KK1A 4P9FA 4ZZDA 2ADUA 4EV0A 3K2ZA 3BJAA 3L2CA 4MEYF 5E1ZB 2QQBA 1O3QA 3CTAA 4GXOA 5J8CA 2FA5A 4WX9A 1D3YA 4M9ZA 2KJBA 4A6DA 3TDZC 2OQGA 1PP7U 1U2WA 2K27A 4FX0A 2HZTA 1ZLKA 5L3GA 2C6YA 3WG9A 2ZNYA 3TO7A 1IN6A 2ZMEB 1W5TA 4UNOA 1GVJA 5CVRA 5EEHA 5FFXA 1MDMA 1KQ0A 3FX3A 3GFMA 2WV0A 3TKYA 2EFOA 2Y0MA 1ZRCA 2ZO4A 4ENMA 4OMZA 1RI7A 3WGGA 2QUFA 4IVNA 3HRMA 2M5WA 2COMA 4PGGA 2XROA 2BYVE 2FBHA 2V1UA 4N9IA 4A0ZA 2GWRA 1SFEA 3M1EA 4IPAA 3WU1B 2Z9OA 1YYVA 4LLGF 1FT9A 3F6VA 5ILSA 1TW3A 4A0XA 4HLYA 5ICGA 2HS5A 3IWZA 3K1PA 1FP1D 1P2FA 4ENJA 1F1ZA 1RUOA 1RZ4A 5F1RA 2EA2A 3BROA 3BPVA 2ZMEA 2KIMA 2XV4S 1REPC 1J75A 1RNLA 4I09A 1G4DA 4L9VA 3GF2A 4U88A 5K5RA 3EQLF 3QRFF 2XAHA 2DU9A 5H6QA 3HSEA 2O6GE 2V79A 3EDPA 1FBUA 4KICA 1U5TC 1BOAA 3LSTA 2PG4A 4GYGA 2P4WA 3LA7A 1I6XA 1WI9A 3DXJF 1EV7A 2OBPA 4RB1A 4G6QA 2LF7A 1JXSA 1LNWA 3KE2A 2HEOA 3VOEA 3GUDA 4PDKA 6PAXA 2D45A 1HQCA 2OU2A 2HYFA 3KFWX 1MD0A 3V8LA 5CVIA 4IHTA 3WODF 1P6RA 2EWNA 1IF1A 5LLQA 3ZN1A 1KA8A 2XVCA 3SFZA 1ZG5A 3IL2A 4KYWA 2OZUA 4HF0A 3W6JB 3H3ZA 2LF8A 1FZPB 3KP2A 1I1GA 5JI6A 3WTXC 5L3BA 3ZQ7A 2DQRA 3SXYA 4MTEA 4A5MA 2CWEA 3ERED 3OOPA 3C18A 1FSEA 3QOPA 3GEZA 1P92A 1F9NA 3FXUA 1KYWA 3F8BA 1P4AA 1BC7C 2L01A 4KIGA 5LHIA 3E6DA 2VC1A 1XGNA 3LA3A 2CYYA 5FD5A 5HDNA 1G3SA 3T8TA 2ACJA 3KETA 5JFRA 3M9AA 1R1TA 2AS5F 1T38A 4Q5SF 2R7FA 3K1NA 1LDDA 3JAMZ 4RAZA 2A6EF 2FEZA 3U9GA 3J81Z 4U0WA 1E17A 4G7HF 3WTUC 2QQ9A 2KRFA 4HW0A 2FE3A 4RB0A 2DK5A 2G7UA 4MHGA 5CVVA 4K2EA 4AIKA 1BBYA 4FX4A 1XMKA 1R58A 5AIQA 4BAYA 2GIVA 1IXCA 2QZ8A 4ETSA 3CO6C 2MA3A 1S29A 5HDGA 1HKQA 2CW0F 3CUQC 2XRNA 2L02A 1QPMA 3RKWA 3I58A 1L0OC 1NHAA 5D5UB 2V6CA 2MC3A 5A2QZ 3G73A 1I5ZA 4L9JA 2P6SA 1XB4A 1X3UA 2Z99A 5JHUA 4ZZLA 4KIBA 4I98B 4BHCA 3HSFA 4LGWA 3T5XA 3V8KA 3H92A 2ETHA 3TDUC 5BQTA 1G3TA 3JTHA 3QPTA 2VN2A 5BS6A 1U8RA 1FBQA 3HTUA 4ESJA 1ONVA 2MH9A 1T39A 3I53A 2QVOA 4LK0F 4HZFA 1W5SA 1YG2A 3JAMK 2L3DA 2E7WA 1YLFA 3KZYA 3J81K 1YFHA 1Z1DA 2B0LA 3E5UA 3WTSC 2O61A 1TQIA 5E1XA 1SMYF 1B1BA 3CJNA 2BE5F 2JSCA 1HKSA 2RKHA 4ON0A 1R22A 4BH9A 3DP7A 3VFZA 3BJOA 1FNNA 4I2OA 1V3FA 2VT2A 1ULYA 1QZZA 2OQRA 1D8JA 3CUOA 3RDIA 2RN7A 3ECOA 2A3SA 3GXOA 5LHGA 2CG4A 1FSHA 4CYDA 3BY6A 2M87A 2F5CA 4XSZF 1O3RA 3HYIA 2UXNA 1B6AA 1FP2A 4UXNA 5D6FA 2K7LA 1UHMA 4G6DA 4EM2A 2PLYA 2EFQA 2XAGA 1IRGA 4R79A 1ODDA 4KN4X 2FNAA 5ERIA 3VB2A 4WXDA 3V7SA 2DPUA 2K4BA 3TO6A 1ZGAA 2IW5A 1YW8A 2QLZA 3OV8A 4HQEA 2VBYA 5E17F 4NQWA 2YPRA 1QNTA 1BN5A 3WGHA 4AIJA 1O3TA 2CGPA 2V9VA 4AVPA 4GCVA 5LHHA 2ZNZA 4U7BA 4KNYA 3ZMZA 5DYMA 3P9IA 4HDVA 1D8KA 5K5QA 2ELHA 3BZ6A 5AONA 3T0YA 2V1DA 4LMYA 3ZMUA 1WRJA 4G94A 1YW7A 1K7AA 3GFIA 3NRVA 2F5FA 2RDPA 4HV6A 2HKXA 3F72A 5D4RA 4S05A 2XGXA 5E18F 2GA1A 4A6EA 4XBFA 3ZMDA 4WXHA 4P55A 5D6EA 1J7KA 5FB2A 4CHUA 4HF1A 1TQMA 3IC7A 4GO1A 4AIHA 4I0AA 3C1DA 2QQAA 2EFWA 5IT9Z 2IA2A 3E6MA 2Y75A 3RPQA 1WQ2A 3ABTA 1LQ1A 3SZTA 1QBJA 5DUKA 3G3ZA 4WK8F 4KMUX 3RI4A 1ZAOA 3E3VA 4H0EA 4MEXF 2VBWA 2LSOA 2LKPA 2J5PA 4LLNA 4LG0B 4PGHA 1B9MA 4UVAA 1IAWA 2RVCA 3CLOA 2HYGD 4IRGA 5DEQA 3WE3A 1FWZA 3FMRA 4HX7A 2D1VA 3JSOA 3F21A 1XSDA 2M8EA 4HLXA 2VE8A 4RGSA 3K69A 4WF2A 3RIRA 4LFUA 5D5VB 2MD5A 1AWCA 4OIRF 3MWMA 5HS7A 1MGTA 1QZYA 1C0WA 2PN6A 5H6RA 2DI3A 2P5LC 2ZBKA 2E7XA 4U0YA 4ESBA 1UHWA 2O3FA 4L0YB 2M30A 1J9IA 3J80Z 2OD5A 4ENKA 1HKTA 1P4XA 1S7AA 3H3UA 3TOAA 4B09A 3Q5FA 4LG0A 2K4JA 1HW5A 2XHKA 3KP6A 4HX8A 3L7WA 3F8CA 4GYIA 2W85A 4OIQF 3E6CC 3MCZA 3QP6A 1RUNA 4YG2F 2OZ6A 2H94A 1UFMA 5CVJA 1XCVA 2AXLA 1B4AA 2MLGA 1HW1A 3FXRA 3F6OA 2YSRA 2VOOA 1T6SA 4Q47A 1XGSA 5LRSA 1BIBA 3ML6A 3GLXA 1KQ9A 2IA0A 1IN8A 1FBSA 3TOBA 3GW2A 2VODA 1IN7A 3FM5A 2L54A 4MGRA 2KIFA 3E97A 2NRAC 2WC2A 4QWQA 3IKTA 3T8RA 2BV6A 1SFUA 3F23A 5D8LB 1S7OA 3ZMVA 3QPHA 2CSOA 2ZFWA 2DT5A 2ESNA 3FMQA 1E2XA 1ZG3A 5HLGA 2Z5UA 5CYVA 2GXBA 1LDJA 3NEUA 3AAFA 1FY7A 1SD5A 2V1XA 2H6CA 4IRHA 1CF7B 3EETA 1S6LA 3COAC 4DQ2A 1BC8C 1FX7A 3LQRA 5BOXA 1XGMA 5CJ9A 1YTYA 2EFPA 1B59A 4ZYGA 2G7HA 2HQNA 3HTSB 1EH7A 4A0YA 3ZMSA 1SD4A 3FHZA 2DAOA 4F7ZA 2P8TA 5DV5A 3WU0A 3LQQA 4A5NA 5LGTA 3RJPA 4P96A 2RC4A 4OMYA 3QAHA 2FQ3A 4CGZA 4HBLA 3HHGA 4IF4A 3PQJA 4LD5A 3HRTA 2D1HA 4P9UA 2PMUA 2XKOA 2UWMA 3QU3A 2FBIA 2HGCA 2DTRA 4S04A 4ZYHA 3I5UA 4E70A 1YS7A 3I0TA 3MFKA 4L9TA 4QLCU 3SQNA 4HQMA 1CF7A 5D8KB 3LWFA 2ESHA 1QQIA 2GAUA 3DF8A 2JT1A 3C3WA 2OA4A 2VOPA 2Q0OA 2VXZA 4BQAA 3FZVA 1XMAA 1Z05A 2VBXA 3BJ6A 5D5WB 5DCMB 2KIUA 3DPLC 3DPTA 2LDUA 1STZA 2RQPA 4UV9A 1JHHA 4OOIA 4OIPF 4KIFA 3ISPA 4FT8A 2ZCWA 1DPUA 1V4RA 1UCRA 1WSUA 1S8NA 1XD7A 3MQ0A 4JK1X 3P7NA 1MJBA 3ECHA 3VEPA 3DFGA 2HWVA 1BI3A 3WTZA 2FMYA 3GWZA 5F6FA 1O7FA 4NB5A 4BHPA 4HDUA 4EM0B 1USTA 2J5OA 1G6NA 2EFNA 3Q9SA 1H9TA 1OYWA 1I27A 2IRFG 4N0BA 1Z9CA 3GZ5A 3K1MA 5DCMA 3R6SA 2Z33A 1R7JA 3KP3A 1H0MA 5FGMA 1TQPA 4HYEA 5JVTA 4KT5C 1DUXC 2UZKA 1F4KA 2X4HA 1U78A 5ICCA 4L18B 1L3LA 4ZH4F 4CICA 2H27A 4R8HA 2L4AA 2ISZA 4RB3C 3U1DA 3K0LA 3HRSA 4KDPA 1G3YA 2VC0A 2XKPA 1HXDA 1EH8A 2MBFA 4Q48A 3DV8A 1T2KA 4RGRA 2CFXA 4MTDA 4EJWA 4EM1A 2QBYB 2FNPA 1IZ1A 1Z6RA 5DUIA 2M45A 4Y15A 4P5OA 1FPQA 3EYYA 2E1NA 5L3EA 1BM9A 1O3SA 3VODA 3GX4X 1GXQA 5BPIA 4R1HA 4EVIA 3MZHA 3ZP5A 2FBKA 1XCBA 2A07F 2P7VB 3RPUA 1XSVA 2RV8A 2DK8A 4EGZA 1IXRC 4M6XA 2PQ8A 1HSJA 4CDGA 5A2QK 2QM3A 4AD9A 2NYXA 3L09A 1XSXA 2W24A 4LJZF 1BI1A 4L9NA 1B9NA 1WWXA 2FF4A 3ZPLA 2QYOA 1YQAA 2GQQA 4A2UA 5HLHA 2R7DA 4D0PA 2QBYA 4U7DA 3D0SA 2Z3YA 1LEBA 2H09A 3I59A 2WTEA 4KA4A 4ZYDA 3GVAA 2TDXA 4EQQA 3KP7A 1IN4A 3TQNA 4I02A 3FM3A 3HOSA 3K9TA 3ABUA 4HX4A 1ZYRF 4WCGA 3LAPA 4RB2C 1O57A 4O6JA 3GFLA 2A6HF 2F5DA 2KKOA 4IJAA 1FYLA 5J6XA 2ZXJA 4L0ZB 1O7LA 2XUBA 3I4PA 2H6BA 2HOEA 1PDNC 1CGPA 1SD6A 1JGSA 4G8XA 2HKOA 4XRFA 1OPCA 3KP4A 5IT3A 2K02A 5J8FA 3I64A 4WXCA 1K79A 5BPDA 1W7PD 3WTWC 1SAXA 4M73A 2FRHA 1R1VA 2DFIA 3KLNA 4EJOA 3N97A 1S3JA 2DPDA 3KLOA 3F8MA 3JSPA 4MNUA 4HA8A 2NS0A 4M9SA 3BOQA 2QENA 2JZYA 2ZKZA 4IXAA 5DCFA 2R3SA 4DNCA 5LEKA 5E8GA 5JR3A 4LB6B 1Z91A 1ZRFA 2IP2A 2A69F 1HW2A 3V7CA 2Q8KA 3R60A 5LRRA 2CQKA 1SFXA 1TW2A 1ZREA 1KU7A 3R0AA 1W4MA 2O8XA 1OMIA 4ASNA 1PUEE 4LLLA 3ULQB 3C7JA 3V8JA 2YU3A 5BMZA 2GZWA 2STWA 1U5TB 2PJPA 4BHBA 4L5JA 2DW4A 1D5VA 5HOOA 1ZN2A 3GZ6A 4ZYEA 2L4MA 5D4SA 1LB2A 4CZZA 3BPXA 2DQLA 2GA2A 4YFNF 3SZPA 2O03A 2BGCA 4UUVA 2VONA 2BEOA 3DQVC 1ZRDA 1A04A 4LB5A 2OAZA 4EJUA 1ZGJA 3FWEA 3KEQA 2PFBA 3BP8A 5HLIA 1R5HA 1TNTA 1LDKB 2DO7A 2F2EA 1DP7P 4RGXA 1HSTA 3CDHA 1KYZA 3HHHA 5IT9K 1P4WA 1Z7UA 1ON2A 1UB9A 2P5KA 1IUYA 3WTVC 4UHTA 1U5TA 1QGPA 1KGSA 1SD7A 3BWGA 1OYYA 2HTJA 2VE9A 1R1UA 2XAQA 1OYIA 1XDUA 1MKMA 2FU4A 4YIIA 3O6BB 4ENNA 4HF2A 5LBQA 1T98A 1TNSA 3T1BA 4YFXF 4IHSA 3U2RA 5ILUA 4O3MA 3JTGA 1LJ9A 1ZH5A 2JRTA 5LGUA 2ISYA 3KEOA 1IN5A 2VT3A 4UV8A 3F8NA 1J59A 5LGNA 5FLXZ 2W84A 2A61A 1BJAA 3IKVA 2A5YB 3MAJA 2F5EA 1KU2A 4OINF 4KUMA 2JPCA 2D2WA 3HUGA 2YX7A 2IVMA 4YIFA 3J7AO 4LK1F 3J80K 1YIOA 4YFKF 3M8EA 1QO0D 5H20A 2FMLA 1FLIA 1LEAA 3F22A 2PMHA 2NNYA 2XAJA 1J5YA 2HR3A 2M1BA 4PCQA 3B02A 2XIGA 1IRFA 4Z2YA 1R5GA 3TGNA 3ELKA 5CVUA 5HDKA 3TO9A 2G9WA 3F8FA 3M7GA 4HV5A 5DD8A 3CUQB 3KZZA 2P6TA 5TRDA 2MH2A 1USSA 5TJJA 5AIPA 1MZBA 1K78B 3S2WA 3PFIA 2YX4A 1OKRA 2X0LA 5LEJA 1G3WA 4JBAA 2FOKA 3HIFA 2P5VA 3R61A 3MEXA 2UXXA 1WKMA 2YR2A 3REOA 2NAZA 4I7HA 4G9YA 5CLSA 1TTYA 2KJCA 2RNJA 4U0VA 4Q4ZF 3GFJA 5FLXK 4UVBA 1FC3A 3IRRA 2HDCA 4M74A 3ZMTA 1GHCA 1U6GA 1ZARA 1Y0UA 1I1SA 5ICEA 2DLLA 3PQKA 1YS6A 1K6OA 4XLNF 3CUQA 3EYIA 1K78A 2ZJ2A 4TV7A 1FYMA 2HQRA 1KQ8A 3V7RA 3KCCA 3O2PE 4UVCA 1BI0A 3WTTC 3B73A 3F3XA 2IT0A 4HOBA 5ED4A 4XLPF 3R4KA 2VBZA 1EH6A 3L00A 3M8FA 1Z6TA 2PI0A 3O3KA 4KFCA 2LNBA 3L9FA 3DKWA 3IRQA 1MJAA 4EMSA 3DEUA 4MQ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSX F;  3RKY A;  3RKX A;  1MJ9 A;  1DDN A;  4GGG A;  3P9K A;  1GXP A;  3QU6 A;  4RAY A;  5F64 A;  4M6Y A;  1IXS B;  1SMT A;  5E20 A;  2MLK A;  2K86 A;  3MZY A;  2FSW A;  3E5Q A;  1JE8 A;  3HRU A;  3WE2 A;  2W25 A;  4A12 A;  3ROU A;  4BYY A;  4RGU A;  5ICF A;  3V4G A;  2IPQ X;  2CO5 A;  4FHT A;  2BBY A;  4BXU A;  1DPR A;  4G7Z F;  3HOT A;  1H9G A;  2IA1 A;  3Q9V A;  5K5O A;  2P7C B;  3JW4 A;  3LA2 A;  5E8I A;  4O5V A;  2JPB A;  3I54 A;  3RYR A;  4JQF A;  4BNC A;  1FYK A;  3WTY C;  4KN7 X;  3EUH A;  2PBI A;  3I59 B;  4I0B A;  3D5L A;  3I71 A;  5E1W A;  1AOY A;  1R36 A;  4HAM A;  2PEX A;  4OU0 A;  3GYH X;  1XDS A;  4M71 A;  4CO8 A;  2FXA A;  5KVR A;  4CXF A;  2Q2E A;  5L3C A;  3ZN0 A;  4G7O F;  1PP8 F;  1YW9 A;  3E6B A;  2EK5 A;  1Q1H A;  2W57 A;  2XAF A;  2EV0 A;  1KU9 A;  3BDD A;  5D5X B;  1LVA A;  1VTN C;  3N4M A;  1HBX G;  3SHF A;  1BIA A;  2STT A;  3FF5 A;  4M72 A;  4EGY A;  3KP5 A;  5L3D A;  5ILV A;  4NHJ A;  2XAS A;  2EA4 A;  1IW7 F;  4PZJ A;  2JTV A;  1BI2 A;  1J2X A;  2IJL A;  5HS9 A;  4EJT A;  4Y17 A;  1T0F A;  4B8X A;  4ESF A;  2HFH A;  4M9X A;  1TBX A;  4IRI A;  1F5T A;  3NQO A;  2HTS A;  3IHU A;  1ZHF A;  4I01 A;  5FD6 A;  4MQV A;  1TLH B;  1W7P B;  4N9H A;  2EV5 A;  1ON1 A;  1KU3 A;  1J0R A;  1JHF A;  1R23 A;  1XN7 A;  2EV6 A;  1XGO A;  3E5X A;  3LAJ A;  2E1C A;  3IWF A;  2Y48 A;  2WWY A;  1YO5 C;  5FO5 A;  5EEG A;  3HSR A;  2RGV A;  3FXQ A;  4KMF A;  4RS8 A;  1FOK A;  1RIO H;  3RYP A;  5L3F A;  1ZG1 A;  2GXG A;  1ZLJ A;  5DDG A;  5HS8 A;  3R0J A;  3RTR A;  1R00 A;  2NNN A;  3QP5 A;  5K1Y A;  5FFZ A;  2O0Y A;  5HVQ C;  4WWC A;  5DD4 A;  1OR7 A;  1W7P A;  4EJV A;  2A68 F;  3GO5 A;  3W6K B;  2EJR A;  3FMS A;  2QWW A;  4AWX B;  4Y13 A;  4L5I A;  3CO7 C;  3WGI A;  3LFK A;  1MDM B;  4OIO F;  1U3E M;  2EB7 A;  2DBB A;  3P9C A;  5KK1 A;  4P9F A;  4ZZD A;  2ADU A;  4EV0 A;  3K2Z A;  3BJA A;  3L2C A;  4MEY F;  5E1Z B;  2QQB A;  1O3Q A;  3CTA A;  4GXO A;  5J8C A;  2FA5 A;  4WX9 A;  1D3Y A;  4M9Z A;  2KJB A;  4A6D A;  3TDZ C;  2OQG A;  1PP7 U;  1U2W A;  2K27 A;  4FX0 A;  2HZT A;  1ZLK A;  5L3G A;  2C6Y A;  3WG9 A;  2ZNY A;  3TO7 A;  1IN6 A;  2ZME B;  1W5T A;  4UNO A;  1GVJ A;  5CVR A;  5EEH A;  5FFX A;  1MDM A;  1KQ0 A;  3FX3 A;  3GFM A;  2WV0 A;  3TKY A;  2EFO A;  2Y0M A;  1ZRC A;  2ZO4 A;  4ENM A;  4OMZ A;  1RI7 A;  3WGG A;  2QUF A;  4IVN A;  3HRM A;  2M5W A;  2COM A;  4PGG A;  2XRO A;  2BYV E;  2FBH A;  2V1U A;  4N9I A;  4A0Z A;  2GWR A;  1SFE A;  3M1E A;  4IPA A;  3WU1 B;  2Z9O A;  1YYV A;  4LLG F;  1FT9 A;  3F6V A;  5ILS A;  1TW3 A;  4A0X A;  4HLY A;  5ICG A;  2HS5 A;  3IWZ A;  3K1P A;  1FP1 D;  1P2F A;  4ENJ A;  1F1Z A;  1RUO A;  1RZ4 A;  5F1R A;  2EA2 A;  3BRO A;  3BPV A;  2ZME A;  2KIM A;  2XV4 S;  1REP C;  1J75 A;  1RNL A;  4I09 A;  1G4D A;  4L9V A;  3GF2 A;  4U88 A;  5K5R A;  3EQL F;  3QRF F;  2XAH A;  2DU9 A;  5H6Q A;  3HSE A;  2O6G E;  2V79 A;  3EDP A;  1FBU A;  4KIC A;  1U5T C;  1BOA A;  3LST A;  2PG4 A;  4GYG A;  2P4W A;  3LA7 A;  1I6X A;  1WI9 A;  3DXJ F;  1EV7 A;  2OBP A;  4RB1 A;  4G6Q A;  2LF7 A;  1JXS A;  1LNW A;  3KE2 A;  2HEO A;  3VOE A;  3GUD A;  4PDK A;  6PAX A;  2D45 A;  1HQC A;  2OU2 A;  2HYF A;  3KFW X;  1MD0 A;  3V8L A;  5CVI A;  4IHT A;  3WOD F;  1P6R A;  2EWN A;  1IF1 A;  5LLQ A;  3ZN1 A;  1KA8 A;  2XVC A;  3SFZ A;  1ZG5 A;  3IL2 A;  4KYW A;  2OZU A;  4HF0 A;  3W6J B;  3H3Z A;  2LF8 A;  1FZP B;  3KP2 A;  1I1G A;  5JI6 A;  3WTX C;  5L3B A;  3ZQ7 A;  2DQR A;  3SXY A;  4MTE A;  4A5M A;  2CWE A;  3ERE D;  3OOP A;  3C18 A;  1FSE A;  3QOP A;  3GEZ A;  1P92 A;  1F9N A;  3FXU A;  1KYW A;  3F8B A;  1P4A A;  1BC7 C;  2L01 A;  4KIG A;  5LHI A;  3E6D A;  2VC1 A;  1XGN A;  3LA3 A;  2CYY A;  5FD5 A;  5HDN A;  1G3S A;  3T8T A;  2ACJ A;  3KET A;  5JFR A;  3M9A A;  1R1T A;  2AS5 F;  1T38 A;  4Q5S F;  2R7F A;  3K1N A;  1LDD A;  3JAM Z;  4RAZ A;  2A6E F;  2FEZ A;  3U9G A;  3J81 Z;  4U0W A;  1E17 A;  4G7H F;  3WTU C;  2QQ9 A;  2KRF A;  4HW0 A;  2FE3 A;  4RB0 A;  2DK5 A;  2G7U A;  4MHG A;  5CVV A;  4K2E A;  4AIK A;  1BBY A;  4FX4 A;  1XMK A;  1R58 A;  5AIQ A;  4BAY A;  2GIV A;  1IXC A;  2QZ8 A;  4ETS A;  3CO6 C;  2MA3 A;  1S29 A;  5HDG A;  1HKQ A;  2CW0 F;  3CUQ C;  2XRN A;  2L02 A;  1QPM A;  3RKW A;  3I58 A;  1L0O C;  1NHA A;  5D5U B;  2V6C A;  2MC3 A;  5A2Q Z;  3G73 A;  1I5Z A;  4L9J A;  2P6S A;  1XB4 A;  1X3U A;  2Z99 A;  5JHU A;  4ZZL A;  4KIB A;  4I98 B;  4BHC A;  3HSF A;  4LGW A;  3T5X A;  3V8K A;  3H92 A;  2ETH A;  3TDU C;  5BQT A;  1G3T A;  3JTH A;  3QPT A;  2VN2 A;  5BS6 A;  1U8R A;  1FBQ A;  3HTU A;  4ESJ A;  1ONV A;  2MH9 A;  1T39 A;  3I53 A;  2QVO A;  4LK0 F;  4HZF A;  1W5S A;  1YG2 A;  3JAM K;  2L3D A;  2E7W A;  1YLF A;  3KZY A;  3J81 K;  1YFH A;  1Z1D A;  2B0L A;  3E5U A;  3WTS C;  2O61 A;  1TQI A;  5E1X A;  1SMY F;  1B1B A;  3CJN A;  2BE5 F;  2JSC A;  1HKS A;  2RKH A;  4ON0 A;  1R22 A;  4BH9 A;  3DP7 A;  3VFZ A;  3BJO A;  1FNN A;  4I2O A;  1V3F A;  2VT2 A;  1ULY A;  1QZZ A;  2OQR A;  1D8J A;  3CUO A;  3RDI A;  2RN7 A;  3ECO A;  2A3S A;  3GXO A;  5LHG A;  2CG4 A;  1FSH A;  4CYD A;  3BY6 A;  2M87 A;  2F5C A;  4XSZ F;  1O3R A;  3HYI A;  2UXN A;  1B6A A;  1FP2 A;  4UXN A;  5D6F A;  2K7L A;  1UHM A;  4G6D A;  4EM2 A;  2PLY A;  2EFQ A;  2XAG A;  1IRG A;  4R79 A;  1ODD A;  4KN4 X;  2FNA A;  5ERI A;  3VB2 A;  4WXD A;  3V7S A;  2DPU A;  2K4B A;  3TO6 A;  1ZGA A;  2IW5 A;  1YW8 A;  2QLZ A;  3OV8 A;  4HQE A;  2VBY A;  5E17 F;  4NQW A;  2YPR A;  1QNT A;  1BN5 A;  3WGH A;  4AIJ A;  1O3T A;  2CGP A;  2V9V A;  4AVP A;  4GCV A;  5LHH A;  2ZNZ A;  4U7B A;  4KNY A;  3ZMZ A;  5DYM A;  3P9I A;  4HDV A;  1D8K A;  5K5Q A;  2ELH A;  3BZ6 A;  5AON A;  3T0Y A;  2V1D A;  4LMY A;  3ZMU A;  1WRJ A;  4G94 A;  1YW7 A;  1K7A A;  3GFI A;  3NRV A;  2F5F A;  2RDP A;  4HV6 A;  2HKX A;  3F72 A;  5D4R A;  4S05 A;  2XGX A;  5E18 F;  2GA1 A;  4A6E A;  4XBF A;  3ZMD A;  4WXH A;  4P55 A;  5D6E A;  1J7K A;  5FB2 A;  4CHU A;  4HF1 A;  1TQM A;  3IC7 A;  4GO1 A;  4AIH A;  4I0A A;  3C1D A;  2QQA A;  2EFW A;  5IT9 Z;  2IA2 A;  3E6M A;  2Y75 A;  3RPQ A;  1WQ2 A;  3ABT A;  1LQ1 A;  3SZT A;  1QBJ A;  5DUK A;  3G3Z A;  4WK8 F;  4KMU X;  3RI4 A;  1ZAO A;  3E3V A;  4H0E A;  4MEX F;  2VBW A;  2LSO A;  2LKP A;  2J5P A;  4LLN A;  4LG0 B;  4PGH A;  1B9M A;  4UVA A;  1IAW A;  2RVC A;  3CLO A;  2HYG D;  4IRG A;  5DEQ A;  3WE3 A;  1FWZ A;  3FMR A;  4HX7 A;  2D1V A;  3JSO A;  3F21 A;  1XSD A;  2M8E A;  4HLX A;  2VE8 A;  4RGS A;  3K69 A;  4WF2 A;  3RIR A;  4LFU A;  5D5V B;  2MD5 A;  1AWC A;  4OIR F;  3MWM A;  5HS7 A;  1MGT A;  1QZY A;  1C0W A;  2PN6 A;  5H6R A;  2DI3 A;  2P5L C;  2ZBK A;  2E7X A;  4U0Y A;  4ESB A;  1UHW A;  2O3F A;  4L0Y B;  2M30 A;  1J9I A;  3J80 Z;  2OD5 A;  4ENK A;  1HKT A;  1P4X A;  1S7A A;  3H3U A;  3TOA A;  4B09 A;  3Q5F A;  4LG0 A;  2K4J A;  1HW5 A;  2XHK A;  3KP6 A;  4HX8 A;  3L7W A;  3F8C A;  4GYI A;  2W85 A;  4OIQ F;  3E6C C;  3MCZ A;  3QP6 A;  1RUN A;  4YG2 F;  2OZ6 A;  2H94 A;  1UFM A;  5CVJ A;  1XCV A;  2AXL A;  1B4A A;  2MLG A;  1HW1 A;  3FXR A;  3F6O A;  2YSR A;  2VOO A;  1T6S A;  4Q47 A;  1XGS A;  5LRS A;  1BIB A;  3ML6 A;  3GLX A;  1KQ9 A;  2IA0 A;  1IN8 A;  1FBS A;  3TOB A;  3GW2 A;  2VOD A;  1IN7 A;  3FM5 A;  2L54 A;  4MGR A;  2KIF A;  3E97 A;  2NRA C;  2WC2 A;  4QWQ A;  3IKT A;  3T8R A;  2BV6 A;  1SFU A;  3F23 A;  5D8L B;  1S7O A;  3ZMV A;  3QPH A;  2CSO A;  2ZFW A;  2DT5 A;  2ESN A;  3FMQ A;  1E2X A;  1ZG3 A;  5HLG A;  2Z5U A;  5CYV A;  2GXB A;  1LDJ A;  3NEU A;  3AAF A;  1FY7 A;  1SD5 A;  2V1X A;  2H6C A;  4IRH A;  1CF7 B;  3EET A;  1S6L A;  3COA C;  4DQ2 A;  1BC8 C;  1FX7 A;  3LQR A;  5BOX A;  1XGM A;  5CJ9 A;  1YTY A;  2EFP A;  1B59 A;  4ZYG A;  2G7H A;  2HQN A;  3HTS B;  1EH7 A;  4A0Y A;  3ZMS A;  1SD4 A;  3FHZ A;  2DAO A;  4F7Z A;  2P8T A;  5DV5 A;  3WU0 A;  3LQQ A;  4A5N A;  5LGT A;  3RJP A;  4P96 A;  2RC4 A;  4OMY A;  3QAH A;  2FQ3 A;  4CGZ A;  4HBL A;  3HHG A;  4IF4 A;  3PQJ A;  4LD5 A;  3HRT A;  2D1H A;  4P9U A;  2PMU A;  2XKO A;  2UWM A;  3QU3 A;  2FBI A;  2HGC A;  2DTR A;  4S04 A;  4ZYH A;  3I5U A;  4E70 A;  1YS7 A;  3I0T A;  3MFK A;  4L9T A;  4QLC U;  3SQN A;  4HQM A;  1CF7 A;  5D8K B;  3LWF A;  2ESH A;  1QQI A;  2GAU A;  3DF8 A;  2JT1 A;  3C3W A;  2OA4 A;  2VOP A;  2Q0O A;  2VXZ A;  4BQA A;  3FZV A;  1XMA A;  1Z05 A;  2VBX A;  3BJ6 A;  5D5W B;  5DCM B;  2KIU A;  3DPL C;  3DPT A;  2LDU A;  1STZ A;  2RQP A;  4UV9 A;  1JHH A;  4OOI A;  4OIP F;  4KIF A;  3ISP A;  4FT8 A;  2ZCW A;  1DPU A;  1V4R A;  1UCR A;  1WSU A;  1S8N A;  1XD7 A;  3MQ0 A;  4JK1 X;  3P7N A;  1MJB A;  3ECH A;  3VEP A;  3DFG A;  2HWV A;  1BI3 A;  3WTZ A;  2FMY A;  3GWZ A;  5F6F A;  1O7F A;  4NB5 A;  4BHP A;  4HDU A;  4EM0 B;  1UST A;  2J5O A;  1G6N A;  2EFN A;  3Q9S A;  1H9T A;  1OYW A;  1I27 A;  2IRF G;  4N0B A;  1Z9C A;  3GZ5 A;  3K1M A;  5DCM A;  3R6S A;  2Z33 A;  1R7J A;  3KP3 A;  1H0M A;  5FGM A;  1TQP A;  4HYE A;  5JVT A;  4KT5 C;  1DUX C;  2UZK A;  1F4K A;  2X4H A;  1U78 A;  5ICC A;  4L18 B;  1L3L A;  4ZH4 F;  4CIC A;  2H27 A;  4R8H A;  2L4A A;  2ISZ A;  4RB3 C;  3U1D A;  3K0L A;  3HRS A;  4KDP A;  1G3Y A;  2VC0 A;  2XKP A;  1HXD A;  1EH8 A;  2MBF A;  4Q48 A;  3DV8 A;  1T2K A;  4RGR A;  2CFX A;  4MTD A;  4EJW A;  4EM1 A;  2QBY B;  2FNP A;  1IZ1 A;  1Z6R A;  5DUI A;  2M45 A;  4Y15 A;  4P5O A;  1FPQ A;  3EYY A;  2E1N A;  5L3E A;  1BM9 A;  1O3S A;  3VOD A;  3GX4 X;  1GXQ A;  5BPI A;  4R1H A;  4EVI A;  3MZH A;  3ZP5 A;  2FBK A;  1XCB A;  2A07 F;  2P7V B;  3RPU A;  1XSV A;  2RV8 A;  2DK8 A;  4EGZ A;  1IXR C;  4M6X A;  2PQ8 A;  1HSJ A;  4CDG A;  5A2Q K;  2QM3 A;  4AD9 A;  2NYX A;  3L09 A;  1XSX A;  2W24 A;  4LJZ F;  1BI1 A;  4L9N A;  1B9N A;  1WWX A;  2FF4 A;  3ZPL A;  2QYO A;  1YQA A;  2GQQ A;  4A2U A;  5HLH A;  2R7D A;  4D0P A;  2QBY A;  4U7D A;  3D0S A;  2Z3Y A;  1LEB A;  2H09 A;  3I59 A;  2WTE A;  4KA4 A;  4ZYD A;  3GVA A;  2TDX A;  4EQQ A;  3KP7 A;  1IN4 A;  3TQN A;  4I02 A;  3FM3 A;  3HOS A;  3K9T A;  3ABU A;  4HX4 A;  1ZYR F;  4WCG A;  3LAP A;  4RB2 C;  1O57 A;  4O6J A;  3GFL A;  2A6H F;  2F5D A;  2KKO A;  4IJA A;  1FYL A;  5J6X A;  2ZXJ A;  4L0Z B;  1O7L A;  2XUB A;  3I4P A;  2H6B A;  2HOE A;  1PDN C;  1CGP A;  1SD6 A;  1JGS A;  4G8X A;  2HKO A;  4XRF A;  1OPC A;  3KP4 A;  5IT3 A;  2K02 A;  5J8F A;  3I64 A;  4WXC A;  1K79 A;  5BPD A;  1W7P D;  3WTW C;  1SAX A;  4M73 A;  2FRH A;  1R1V A;  2DFI A;  3KLN A;  4EJO A;  3N97 A;  1S3J A;  2DPD A;  3KLO A;  3F8M A;  3JSP A;  4MNU A;  4HA8 A;  2NS0 A;  4M9S A;  3BOQ A;  2QEN A;  2JZY A;  2ZKZ A;  4IXA A;  5DCF A;  2R3S A;  4DNC A;  5LEK A;  5E8G A;  5JR3 A;  4LB6 B;  1Z91 A;  1ZRF A;  2IP2 A;  2A69 F;  1HW2 A;  3V7C A;  2Q8K A;  3R60 A;  5LRR A;  2CQK A;  1SFX A;  1TW2 A;  1ZRE A;  1KU7 A;  3R0A A;  1W4M A;  2O8X A;  1OMI A;  4ASN A;  1PUE E;  4LLL A;  3ULQ B;  3C7J A;  3V8J A;  2YU3 A;  5BMZ A;  2GZW A;  2STW A;  1U5T B;  2PJP A;  4BHB A;  4L5J A;  2DW4 A;  1D5V A;  5HOO A;  1ZN2 A;  3GZ6 A;  4ZYE A;  2L4M A;  5D4S A;  1LB2 A;  4CZZ A;  3BPX A;  2DQL A;  2GA2 A;  4YFN F;  3SZP A;  2O03 A;  2BGC A;  4UUV A;  2VON A;  2BEO A;  3DQV C;  1ZRD A;  1A04 A;  4LB5 A;  2OAZ A;  4EJU A;  1ZGJ A;  3FWE A;  3KEQ A;  2PFB A;  3BP8 A;  5HLI A;  1R5H A;  1TNT A;  1LDK B;  2DO7 A;  2F2E A;  1DP7 P;  4RGX A;  1HST A;  3CDH A;  1KYZ A;  3HHH A;  5IT9 K;  1P4W A;  1Z7U A;  1ON2 A;  1UB9 A;  2P5K A;  1IUY A;  3WTV C;  4UHT A;  1U5T A;  1QGP A;  1KGS A;  1SD7 A;  3BWG A;  1OYY A;  2HTJ A;  2VE9 A;  1R1U A;  2XAQ A;  1OYI A;  1XDU A;  1MKM A;  2FU4 A;  4YII A;  3O6B B;  4ENN A;  4HF2 A;  5LBQ A;  1T98 A;  1TNS A;  3T1B A;  4YFX F;  4IHS A;  3U2R A;  5ILU A;  4O3M A;  3JTG A;  1LJ9 A;  1ZH5 A;  2JRT A;  5LGU A;  2ISY A;  3KEO A;  1IN5 A;  2VT3 A;  4UV8 A;  3F8N A;  1J59 A;  5LGN A;  5FLX Z;  2W84 A;  2A61 A;  1BJA A;  3IKV A;  2A5Y B;  3MAJ A;  2F5E A;  1KU2 A;  4OIN F;  4KUM A;  2JPC A;  2D2W A;  3HUG A;  2YX7 A;  2IVM A;  4YIF A;  3J7A O;  4LK1 F;  3J80 K;  1YIO A;  4YFK F;  3M8E A;  1QO0 D;  5H20 A;  2FML A;  1FLI A;  1LEA A;  3F22 A;  2PMH A;  2NNY A;  2XAJ A;  1J5Y A;  2HR3 A;  2M1B A;  4PCQ A;  3B02 A;  2XIG A;  1IRF A;  4Z2Y A;  1R5G A;  3TGN A;  3ELK A;  5CVU A;  5HDK A;  3TO9 A;  2G9W A;  3F8F A;  3M7G A;  4HV5 A;  5DD8 A;  3CUQ B;  3KZZ A;  2P6T A;  5TRD A;  2MH2 A;  1USS A;  5TJJ A;  5AIP A;  1MZB A;  1K78 B;  3S2W A;  3PFI A;  2YX4 A;  1OKR A;  2X0L A;  5LEJ A;  1G3W A;  4JBA A;  2FOK A;  3HIF A;  2P5V A;  3R61 A;  3MEX A;  2UXX A;  1WKM A;  2YR2 A;  3REO A;  2NAZ A;  4I7H A;  4G9Y A;  5CLS A;  1TTY A;  2KJC A;  2RNJ A;  4U0V A;  4Q4Z F;  3GFJ A;  5FLX K;  4UVB A;  1FC3 A;  3IRR A;  2HDC A;  4M74 A;  3ZMT A;  1GHC A;  1U6G A;  1ZAR A;  1Y0U A;  1I1S A;  5ICE A;  2DLL A;  3PQK A;  1YS6 A;  1K6O A;  4XLN F;  3CUQ A;  3EYI A;  1K78 A;  2ZJ2 A;  4TV7 A;  1FYM A;  2HQR A;  1KQ8 A;  3V7R A;  3KCC A;  3O2P E;  4UVC A;  1BI0 A;  3WTT C;  3B73 A;  3F3X A;  2IT0 A;  4HOB A;  5ED4 A;  4XLP F;  3R4K A;  2VBZ A;  1EH6 A;  3L00 A;  3M8F A;  1Z6T A;  2PI0 A;  3O3K A;  4KFC A;  2LNB A;  3L9F A;  3DKW A;  3IRQ A;  1MJA A;  4EMS A;  3DEU A;  4MQ9 F; 
#chains in the Genus database with same CATH topology
 1A6I A;  4AYB N;  5J1R A;  4XSX F;  3BG5 A;  3RKY A;  1P7I A;  3RKX A;  1E0E A;  1MJ9 A;  5GP9 A;  1DGW Y;  1DDN A;  2XSD C;  4E7K A;  4GGG A;  4V19 K;  3P9K A;  1GXP A;  3QU6 A;  3HKZ A;  2E1O A;  4RAY A;  5F64 A;  2E1M C;  4M6Y A;  1IXS B;  1SMT A;  5E20 A;  1JJ6 C;  2MLK A;  1ITY A;  2K86 A;  2BW3 B;  3MZY A;  2QSF X;  3NAU A;  2FSW A;  3E5Q A;  1JE8 A;  5FRN A;  4M3E A;  4AU7 A;  2VL8 A;  3ABM H;  3HRU A;  1RPW A;  2YU9 J;  4ZDO A;  2KRC A;  2HYJ A;  3WE2 A;  2W25 A;  4A12 A;  3ROU A;  1ETX A;  4BYY A;  1JTY A;  4RGU A;  5ICF A;  3V4G A;  2Q2E B;  1YJW I;  2IPQ X;  3S3N A;  3LL7 A;  3KYL A;  2CO5 A;  3MMY B;  2CUJ A;  2NS7 A;  1LE8 B;  4FHT A;  1OCP A;  2BBY A;  4BXU A;  3CQZ J;  1DPR A;  2WB1 A;  4G7Z F;  3OYH A;  3HOT A;  1H9G A;  2IA1 A;  3Q9V A;  4EMS A;  3S16 J;  5K5O A;  2P7C B;  3JW4 A;  3A4C A;  1SC7 A;  4RBO A;  3OMY A;  4JX4 A;  2DJN A;  3LA2 A;  5E8I A;  4O5V A;  3CZ6 A;  2JPB A;  4PJJ A;  3I54 A;  5J1Y A;  3RYR A;  4JQF A;  2KL4 A;  4BNC A;  4LOC A;  5FLM J;  3JRA A;  4C3J J;  1FYK A;  2R7Q A;  5IY5 H;  2YUS A;  3H36 A;  3WTY C;  4KN7 X;  2Y0S N;  3EUH A;  2PBI A;  3I59 B;  2VJI A;  4I0B A;  3D5L A;  3CC4 I;  5F0C A;  3D1N I;  3I71 A;  5E1W A;  3QOD A;  1AOY A;  1QVU A;  1R36 A;  2BW3 A;  4HAM A;  3KPH A;  3HGY A;  2X48 A;  2PEX A;  3BQZ A;  1OCO H;  3A1Y A;  5J3L A;  4OU0 A;  4FET A;  3GYH X;  1XDS A;  4M71 A;  4CO8 A;  2FXA A;  5KVR A;  1WJB A;  3GCM A;  5KAI C;  3RZD J;  4CXF A;  1QA6 A;  2Q2E A;  5L3C A;  3LSI A;  1P9Q C;  3ZN0 A;  3OYI A;  4G7O F;  1LE8 A;  1PP8 F;  1GLN A;  1JTX A;  1DU6 A;  2JA7 J;  1YW9 A;  2JN6 A;  3E6B A;  2EK5 A;  1Q1H A;  2W57 A;  2XAF A;  2EV0 A;  3PM1 A;  1V5E A;  1KU9 A;  3BDD A;  5D5X B;  3VDX A;  2CU7 A;  2E35 A;  1LVA A;  1VTN C;  4KIS A;  3N4M A;  3PO2 J;  2XC7 A;  3SHF A;  1HBX G;  1BIA A;  2STT A;  1V5G A;  3C2G A;  1ACI A;  1SFO J;  1TC3 C;  3FF5 A;  2L9R A;  3ABK H;  4M72 A;  4EGY A;  5CKT A;  4G6T B;  3KP5 A;  3JRC A;  3CJQ B;  2HVQ A;  3CLQ A;  1ZR2 A;  4QPQ A;  5L3D A;  5ILV A;  4NHJ A;  2VI6 A;  3GME A;  5JLW A;  2XAS A;  1D1C A;  2EA4 A;  2ME0 A;  3ZQG A;  4BAC A;  1IW7 F;  4PZJ A;  2JTV A;  1BI2 A;  2DDA A;  1J2X A;  2IJL A;  5HS9 A;  2KT0 A;  4EJT A;  1CQT A;  2HVS A;  4Y17 A;  1T0F A;  1VQ9 I;  2R7S A;  1YHQ I;  4B8X A;  4ESF A;  1WH7 A;  2HFH A;  4M9X A;  1TBX A;  1Z3Y A;  1F5T A;  2DYS H;  4IRI A;  3NQO A;  3ZQF A;  1TL8 A;  2HTS A;  3IHU A;  3K6G A;  3LSK A;  5GAH J;  1ZHF A;  4I01 A;  5FD6 A;  4MQV A;  2R7Z J;  1MBJ A;  2X85 A;  1TLH B;  1W7P B;  3EUA A;  3OSF A;  1RR8 C;  1ZR4 A;  2BXY A;  4HNU A;  2KDZ A;  4N9H A;  2EV5 A;  1GVD A;  4LIV A;  4ABZ A;  1ON1 A;  1KU3 A;  1J0R A;  3BTL A;  1JHF A;  1R23 A;  1V5F A;  1XN7 A;  2EV6 A;  1XGO A;  2L7Z A;  3E5X A;  3LAJ A;  4BEH B;  3VYT B;  1JUS A;  3MD2 A;  4XLF A;  2XB5 A;  5F0H A;  1Z3X A;  2PJR B;  1KZH A;  1XC5 A;  2E1C A;  3IWF A;  4EAT A;  1LUJ B;  2Y48 A;  2WWY A;  2DA3 A;  3HGG A;  1WJA A;  1XX5 A;  3VYR B;  1YO5 C;  5FO5 A;  2I10 A;  4IQ4 A;  4OAY A;  5EEG A;  3HSR A;  2RGV A;  3FXQ A;  4KMF A;  4KJZ A;  4RS8 A;  1FOK A;  1RIO H;  1UG0 A;  3RYP A;  5L3F A;  2NVQ J;  1ZG1 A;  2GXG A;  5KAF C;  1D1A A;  1ZLJ A;  5DDG A;  3G1L A;  5HS8 A;  3CMA I;  2A05 A;  3R0J A;  4C2T A;  3RTR A;  1R00 A;  3ZGK A;  3JRE A;  2NNN A;  3QP5 A;  5K1Y A;  5FFZ A;  3VYS B;  3S1Q J;  1X1D A;  2O0Y A;  4OWR B;  4E6K G;  5HVQ C;  4HNV A;  4WWC A;  5DD4 A;  1OR7 A;  3L2V A;  1ETO A;  3GTG J;  3HEF A;  3Q3S A;  1ZEL A;  4V2F A;  4XOP A;  1W7P A;  5B1B H;  3BG9 A;  4EJV A;  2JJ7 A;  2A68 F;  3GO5 A;  1K4S A;  2OF7 A;  2LRE A;  3W6K B;  2EJR A;  3FMS A;  2QWW A;  3LSG A;  4AWX B;  4L5I A;  4Y13 A;  5IP6 A;  2CS3 A;  3LFK A;  3WGI A;  2W00 A;  1MDM B;  4OIO F;  1U3E M;  3QQA A;  4FQG A;  4BEH A;  5F04 A;  2EB7 A;  4IZZ A;  2DBB A;  1ERD A;  3P9C A;  1AKH B;  2P0W A;  2X6Y A;  5KK1 A;  2L5Q A;  4P9F A;  4ZZD A;  2ADU A;  3E1S A;  4EV0 A;  3I4N J;  1RR7 A;  3K2Z A;  3LMM A;  2OCE A;  3BJA A;  3L2C A;  2ZXH A;  3L2R A;  3DTI A;  4MEY F;  5E1Z B;  4I6Z A;  3A0H C;  2QQB A;  1O3Q A;  3CTA A;  4NUB A;  1H89 C;  4GXO A;  5J8C A;  2FA5 A;  1VQ4 I;  5E3O A;  4WX9 A;  3TBI A;  2EIJ H;  1TWC J;  2P81 A;  1SVL A;  3HOW J;  1N25 A;  2XF6 A;  2IS1 A;  5K7H A;  4LIT A;  1D3Y A;  5FRO A;  4M9Z A;  2KJB A;  2ZXI A;  4A6D A;  2LLK A;  2VAS A;  3TDZ C;  2R7U A;  2OQG A;  1PP7 U;  1U2W A;  2L0K A;  2NOJ B;  3K4N A;  2K27 A;  2K3P A;  1OLT A;  4FX0 A;  3FIW A;  2HZT A;  1ZLK A;  5L3G A;  2C6Y A;  3WG9 A;  2ZNY A;  2DMU A;  4MO7 A;  3TO7 A;  1IN6 A;  3CMY A;  2R7X A;  2ZME B;  1W5T A;  4A3L J;  4UNO A;  3V42 A;  1QZE A;  1GVJ A;  5CVR A;  5EEH A;  5FFX A;  4J00 A;  1MDM A;  1KQ0 A;  3FX3 A;  3QYF A;  1JKO C;  2Q1Z B;  3GFM A;  1AA7 A;  2LKS A;  3SDG A;  2ECB A;  1TP4 A;  2WV0 A;  3TKY A;  1AKH A;  3OYB A;  2EFO A;  2Y0M A;  1VND A;  4RLQ A;  1X4O A;  4X6A J;  2KPM A;  1Y39 A;  3DCF A;  2XPV A;  1ZRC A;  4X1E A;  2ZO4 A;  3BR0 A;  4ENM A;  2UUZ A;  1EKE A;  3DEW A;  3FKJ A;  4FCY A;  4OMZ A;  1RI7 A;  3WGG A;  2E5Z A;  2QUF A;  4IVN A;  3HRM A;  1U0J A;  2M5W A;  2VQL A;  2COM A;  4PGG A;  2XRO A;  2BYV E;  2FBH A;  1ETW A;  2Y9Y A;  2V1U A;  3B6A A;  4N9I A;  4NBQ A;  4A0Z A;  1WVR A;  2GWR A;  5J4Y A;  1SFE A;  3M1E A;  4IPA A;  4E7Z A;  3WU1 B;  4BY7 J;  3NWT A;  2Z9O A;  5C4J J;  1YYV A;  4LLG F;  4PSW A;  2EPF A;  2V9P A;  1FT9 A;  3F6V A;  2RQQ A;  5ILS A;  1MNE A;  1TWG J;  2AO9 A;  2R4G A;  1TW3 A;  3HUG B;  4A0X A;  4HLY A;  1U8B A;  5ICG A;  2HS5 A;  1FMV A;  3IWZ A;  3K1P A;  4YIR X;  1FP1 D;  1P2F A;  4ENJ A;  2EZI A;  1F1Z A;  1RUO A;  1RZ4 A;  1EF4 A;  5F1R A;  2EA2 A;  2DA4 A;  2QCO A;  3HPG A;  3BRO A;  3BPV A;  2ZME A;  5EZH A;  2HXO A;  2KIM A;  3WG7 H;  2XV4 S;  1YRN B;  4IOA F;  3BT9 A;  1REP C;  1R6R A;  5TGT A;  1J75 A;  1RNL A;  4I09 A;  2I5U A;  1M1E B;  3GF2 A;  4L9V A;  4U88 A;  5K5R A;  1G4D A;  3EQL F;  3QRF F;  2XAH A;  2DU9 A;  5H6Q A;  1QHG A;  1R4N B;  3HSE A;  2Z16 A;  4BS9 A;  2HZD A;  2O6G E;  3PNY A;  2V79 A;  2OC6 A;  3EDP A;  3S93 A;  1FBU A;  4KIC A;  2Y30 A;  1U5T C;  2WY8 Q;  4RA2 A;  1BOA A;  3LST A;  2PG4 A;  4GYG A;  1FIP A;  4G12 A;  2EH3 A;  4IL6 C;  4S0H B;  3H3V K;  4KT6 A;  5F27 A;  1GDT A;  4XKV A;  4BDY A;  2P4W A;  3LA7 A;  1MMN A;  1I6X A;  1D5Y A;  1WI9 A;  3DXJ F;  2UV1 A;  3CCR I;  1VQO I;  1BJZ A;  1EV7 A;  5IYD J;  2OTJ I;  2OBP A;  4RB1 A;  3PIO F;  3DEE A;  4G6Q A;  4I76 A;  2LTP A;  4YEJ A;  1WJE A;  2L7M P;  3DTK A;  2LF7 A;  4DZP A;  4F91 B;  1FTZ A;  1YX5 A;  4EEF G;  4OAZ A;  1JXS A;  1LNW A;  4PK4 A;  3KE2 A;  3MKW B;  2HEO A;  3VOE A;  1ETQ A;  3LNQ A;  1YIT I;  1SFK A;  2HOA A;  2ZJQ F;  3GUD A;  4PDK A;  6PAX A;  1K4T A;  2D45 A;  1ENH A;  1YRN A;  1HQC A;  2KFD A;  2OU2 A;  1UMQ A;  1RC9 A;  2IS6 A;  3PJR A;  2HYF A;  2EIK H;  3KFW X;  1MD0 A;  3IP4 B;  3SDB A;  3V8L A;  1A31 A;  5HLT A;  1IGN A;  2MFZ A;  4DGW B;  5CVI A;  4IHT A;  3WOD F;  1P6R A;  1TWF J;  2EWN A;  1T08 B;  1G2H A;  1IF1 A;  5LLQ A;  2K3F A;  3W6V A;  3ZN1 A;  1PUF B;  2F5V A;  1KA8 A;  4A3C J;  1IJW C;  1VF9 A;  4CH7 A;  2XVC A;  1KON A;  3SFZ A;  1ZG5 A;  3IL2 A;  2QA4 I;  4KYW A;  2OZU A;  3PUF A;  3HB9 A;  4HF0 A;  3ERM A;  3W6J B;  1Z21 A;  3H3Z A;  4BE1 A;  5IYC J;  2QGU A;  1I39 A;  2LF8 A;  4DYC A;  1FZP B;  3KP2 A;  1I1G A;  5JI6 A;  2HU9 A;  2KLO A;  1NK3 P;  3WTX C;  1UHS A;  5L3B A;  3ZQ7 A;  3OYG A;  2LVS A;  2F4O B;  2DQR A;  5K7Z A;  1Z0X A;  3SXY A;  2VPR A;  1SVO A;  2DA5 A;  4XKB A;  4MTE A;  4A5M A;  2V4J C;  2CWE A;  3ERE D;  1X1A A;  3H5R A;  2M3A A;  3C18 A;  3OOP A;  1WFX A;  1FSE A;  2IGM A;  3QOP A;  1TT5 B;  1LVK A;  1N75 A;  3GEZ A;  5EGO B;  1P92 A;  3AG1 H;  3RQI A;  1F43 A;  1F9N A;  3FXU A;  1KYW A;  3F8B A;  3SYT A;  1P4A A;  5B3S H;  1BC7 C;  3GTQ J;  2L01 A;  2MAB A;  4KIG A;  3D5R C;  2HOS A;  1MMG A;  5LHI A;  3E6D A;  1G59 A;  4ZC3 A;  4HNT A;  2HVR A;  4ZDL A;  4B1R A;  4F55 A;  2VC1 A;  2FX0 A;  5BNG A;  1XGN A;  1PUF A;  3LA3 A;  2CYY A;  3ZXS A;  5FD5 A;  5HDN A;  1G3S A;  3T8T A;  2ACJ A;  3FXL A;  3K70 C;  5JFR A;  3KET A;  3M9A A;  1R1T A;  2AS5 F;  1T38 A;  4Q5S F;  5KNL A;  2R7F A;  3K1N A;  3F0C A;  1LDD A;  3FIS A;  2BZT A;  4CCK A;  3JAM Z;  3CF2 A;  4RAZ A;  2A6E F;  2FEZ A;  3U9G A;  1X19 A;  3J81 Z;  2MGQ A;  2Z2S B;  4U0W A;  1WZ2 A;  1E17 A;  4G7H F;  3WTU C;  1HC8 A;  1Y8R B;  3BR2 A;  3W2V A;  3BCA A;  2DT7 B;  2QQ9 A;  2KRF A;  2BY0 A;  5GPC A;  3ZRG A;  3KZI C;  4HW0 A;  3O8G A;  2IBD A;  2EZL A;  2FE3 A;  4RB0 A;  1RET A;  2DK5 A;  2G7U A;  3QPS A;  4MHG A;  4FE4 A;  5CVV A;  5IOY A;  4K2E A;  5EGO A;  5M5W J;  4AIK A;  1BBY A;  5E3M A;  2LR8 A;  1W0U A;  4FX4 A;  2DYR H;  1XMK A;  3OWT A;  1R58 A;  5AIQ A;  4BAY A;  2GIV A;  4DYQ A;  1IXC A;  2LC2 A;  2QZ8 A;  4E7I A;  4H4K C;  4ETS A;  2LP0 A;  3CO6 C;  2MA3 A;  3A2K A;  5JHF A;  2M0C A;  1X3W B;  4XKC A;  1S29 A;  3DKY A;  3LSM A;  5HDG A;  2X1E A;  3FXO A;  2HQ5 A;  2G0E A;  1HKQ A;  2AHQ A;  3W2W A;  1ETK A;  2CW0 F;  3CUQ C;  2XRN A;  2XPW A;  2HXI A;  2L02 A;  1VQP I;  1NH3 A;  1QPM A;  3RKW A;  3I58 A;  1L0O C;  1NHA A;  4JOM A;  1TWH J;  5D5U B;  1HDD C;  2K9L A;  3NAR A;  4M3D A;  4P1W A;  1FIA A;  2V6C A;  2MC3 A;  4QPO A;  5A2Q Z;  1MMD A;  3G4S I;  3G73 A;  3CCV I;  1I5Z A;  2ZSI B;  4L9J A;  1WH5 A;  2BHY A;  3HKZ N;  5FKM A;  2P6S A;  2LKX A;  4BY1 J;  2M7A A;  1XB4 A;  1X3U A;  3ZQC A;  2Z99 A;  1S7E A;  2M7B A;  3J7Y J;  5JHU A;  4ZZL A;  4KIB A;  3FBN B;  4I98 B;  3SEZ A;  4BHC A;  4IOC F;  2VKD A;  3HSF A;  4LGW A;  3BG3 A;  3T5X A;  2YS9 A;  3V8K A;  3H92 A;  2ETH A;  3TDU C;  2R7W A;  5BQT A;  3L1P A;  4ANJ A;  1B8I B;  1G3T A;  3HM5 A;  4BXX J;  1ORK A;  3JTH A;  1R5I D;  2X6X A;  4RM2 A;  3VWB A;  3OYJ A;  3IH3 A;  1U9N A;  2VJ5 A;  3QPT A;  2VN2 A;  3CJR B;  5BS6 A;  1U8R A;  3H9G A;  3I55 I;  3MKL A;  3OIP A;  1FBQ A;  3HTU A;  4ESJ A;  1ONV A;  2MH9 A;  1T39 A;  3OYC A;  1VQN I;  3I53 A;  2QVO A;  4LK0 F;  4A69 C;  4HZF A;  1SVM A;  1W5S A;  1YG2 A;  1UJ8 A;  4CCO A;  3JAM K;  2L3D A;  3U21 A;  2LOO A;  1LFU P;  4IO9 F;  2L7K A;  3I3L A;  1VQ6 I;  2E7W A;  1YLF A;  3KZY A;  4B3A A;  4DBR A;  3J81 K;  1YFH A;  2IEK A;  1Z1D A;  2B0L A;  3E5U A;  3WTS C;  2O61 A;  1TQI A;  1R9T J;  3A02 A;  5E1X A;  4RAG A;  2Y69 H;  1SMY F;  2XF7 A;  1B1B A;  3CJN A;  3SZG A;  2BE5 F;  3S1N J;  3TW7 A;  2JSC A;  1HKS A;  2RKH A;  4ON0 A;  3S3O A;  2IS4 A;  1FOX A;  4BUP A;  3BR1 A;  2ELK A;  1QU3 A;  1R4M B;  2WAE A;  4DOZ A;  1R22 A;  4BH9 A;  1GUU A;  3DP7 A;  4A3J J;  1I3Q J;  1NTC A;  3VFZ A;  3BJO A;  1FNN A;  4I2O A;  2KZG A;  2V26 A;  4MFE A;  1V3F A;  1B8I A;  5E3N A;  2QSH X;  2L9V A;  2BY2 A;  2VT2 A;  1ULY A;  3TMO A;  4HRI A;  3HC7 A;  3RPU D;  4NQW B;  1QZZ A;  2OQR A;  1D8J A;  3CUO A;  4B48 A;  4W97 A;  1D1B A;  2DFF A;  3EUH C;  1WCM J;  2RN7 A;  3MN2 A;  4V2G A;  5EZG A;  3ECO A;  3RDI A;  5EEA A;  4GFB A;  2R5Z B;  2A3S A;  3FDY A;  3G2B A;  3GXO A;  5LHG A;  2CG4 A;  1FSH A;  2MC4 A;  1JKR C;  4CYD A;  3AFH A;  3BY6 A;  3JRD A;  2M87 A;  2HQA A;  4IQJ A;  2F5C A;  4I99 C;  3M1C A;  4XSZ F;  3CF5 F;  1O3R A;  3HYI A;  1WJF A;  2UXN A;  2DFH A;  4E4H A;  1OIS A;  1B6A A;  3HXL A;  1FP2 A;  2DT6 A;  1OFC X;  4UXN A;  5D6F A;  2NVX J;  2K7L A;  5IOZ A;  2DN0 A;  1UHM A;  2CJJ A;  4G6D A;  4EM2 A;  1FOY A;  5GAG J;  2JA5 J;  2EFQ A;  2VXD A;  2PLY A;  1IUF A;  2FUG 2;  2M8G X;  1IV8 A;  2XAG A;  3LSP A;  1IRG A;  4R79 A;  1ODD A;  4AID A;  2NVT J;  4KN4 X;  2FNA A;  4J19 A;  1X58 A;  5ERI A;  4BQN A;  3VB2 A;  1A36 A;  1MIJ A;  4WXD A;  5TIS C;  2FOW A;  4D5F A;  5JLX A;  4XRM A;  2VQG A;  2KHM A;  2CW8 A;  4XOR A;  3V7S A;  2DPU A;  2K4B A;  3TO6 A;  1ZGA A;  2IW5 A;  1YW8 A;  2QLZ A;  4F52 A;  4QIW N;  3C2B A;  1NK2 P;  3CC7 I;  3OOU A;  3OV8 A;  2VBY A;  4HQE A;  5E17 F;  4AVZ A;  2JK3 A;  4NQW A;  1RKW A;  2YPR A;  2E71 A;  1QNT A;  3RKQ A;  4E7J A;  3S1M J;  1BN5 A;  2PMZ A;  3WGH A;  3RSN A;  4AIJ A;  1O3T A;  2CGP A;  2Y9Z A;  2XGD A;  2A5W A;  2V9V A;  2R5Z A;  3D5S C;  1FMW A;  4AVP A;  4GCV A;  5LHH A;  2ZNZ A;  3E7L A;  3JRH A;  5FKL A;  1PYV A;  4U7B A;  4KNY A;  1HA8 A;  3ZMZ A;  3K2A A;  1XG1 A;  2ZC2 A;  5DYM A;  3P9I A;  2CRG A;  4HDV A;  2EQR A;  3CP8 A;  2OV7 A;  1D8K A;  3Q0U A;  2K9N A;  2KZV A;  5K5Q A;  2ELH A;  3BZ6 A;  3ZQH A;  5AON A;  4XKW A;  2VKH A;  3T0Y A;  1T33 A;  2V1D A;  1AHD P;  4PJM A;  4LMY A;  3ZMU A;  3DKX A;  2O5R A;  5H2F C;  1WRJ A;  3K4K A;  2WAQ N;  4G94 A;  1JUP A;  4A3K J;  1YW7 A;  2WY7 Q;  4A3G J;  1K7A A;  1LFB A;  3GBG A;  4XIC A;  1Y0N A;  3J7A Y;  3GFI A;  2H1L A;  3NRV A;  4UUS A;  2F5F A;  2RDP A;  4HV6 A;  2IGK A;  2DMN A;  1WJ5 A;  2HKX A;  3M4O J;  3F72 A;  1B72 B;  5D4R A;  5F1J A;  2M2E A;  4S05 A;  2XGX A;  5E18 F;  1IRZ A;  1YE9 A;  2GA1 A;  4A6E A;  4DZJ A;  4XBF A;  3AL0 B;  4XK4 A;  3ZMD A;  4WXH A;  4P55 A;  5D6E A;  1WHU A;  1J7K A;  4QSH A;  1ZGW A;  1E3O C;  2OPT A;  5FB2 A;  4CHU A;  2AQF A;  3EUK L;  4HF1 A;  1TQM A;  3IC7 A;  4F93 B;  2E2I J;  4GO1 A;  2KIS A;  4AIH A;  4I0A A;  3C1D A;  2GOM A;  2QQA A;  1MND A;  1SAN A;  4XN3 A;  3A01 B;  2EFW A;  5IT9 Z;  2IA2 A;  5FKN A;  2EZK A;  3E6M A;  2Y75 A;  2DA2 A;  2TRT A;  5KHD A;  3RPQ A;  1WQ2 A;  3ABT A;  3QYE A;  4CCJ A;  1LQ1 A;  3ZQL A;  3SZT A;  1OR7 C;  2BVL A;  2R7R A;  1QBJ A;  2LYC A;  5DUK A;  1S72 I;  4Y33 A;  3G3Z A;  4D7N A;  4WK8 F;  2E60 A;  3PFY A;  4KMU X;  3RI4 A;  1ZAO A;  1IG7 A;  3E3V A;  4H0E A;  4MEX F;  2VBW A;  3BR3 A;  1Y6I A;  2LSO A;  1PVE A;  2LKP A;  2J5P A;  4LLN A;  4LG0 B;  4MLO A;  4PGH A;  4JX5 A;  1B9M A;  4UVA A;  1IAW A;  2RVC A;  3CLO A;  2NVY J;  3BC8 A;  2HYG D;  4XM3 A;  1EJ9 A;  1R71 A;  4IRG A;  5DEQ A;  2COB A;  3WE3 A;  1FWZ A;  3FMR A;  4CCN A;  4HX7 A;  2D1V A;  4B44 A;  1D0X A;  2JWT A;  4BGD A;  1MBH A;  3JSO A;  3F21 A;  1B72 A;  1XSD A;  2M8E A;  1HLV A;  1IDY A;  4HLX A;  2VE8 A;  4RGS A;  2OTL I;  4YEL A;  3K69 A;  4WF2 A;  4BU2 A;  4BJ6 C;  2IGN A;  3IAM 2;  2BHZ A;  2RAE A;  1Y56 A;  3JRB A;  3BG6 A;  3RIR A;  3OS0 A;  3VSK A;  4LFU A;  5D5V B;  2MD5 A;  1Y1V J;  3DPU A;  1AWC A;  2ID6 A;  4OIR F;  3S15 J;  4PFP A;  4B3X A;  3HPH A;  1XPX A;  2L9N A;  2GIZ A;  3MWM A;  5HS7 A;  3A01 A;  2H8R A;  1MGT A;  2CUE A;  1QHH D;  2DXI A;  1QZY A;  1C0W A;  3ZQQ A;  2CW7 A;  1EA3 A;  5FKO A;  2EBI A;  5B66 C;  3F9K A;  1X3Z B;  2PN6 A;  5H6R A;  2DI3 A;  2P5L C;  1YIJ I;  2ZBK A;  2K9S A;  2E7X A;  4U0Y A;  5EJC A;  4ESB A;  1UHW A;  2O3F A;  3MZ8 A;  1R49 A;  2M30 A;  4L0Y B;  1J9I A;  3J80 Z;  2M34 A;  2OD5 A;  1HDP A;  2MG4 A;  4ENK A;  1HKT A;  1NG6 A;  1P4X A;  1S7A A;  3BTC A;  4JYK A;  3H3U A;  3TOA A;  4B09 A;  3Q5F A;  3FK6 A;  1Y1W J;  4LG0 A;  5KCM A;  2K4J A;  3I9V 2;  1HW5 A;  2HNH A;  4HPQ A;  4BBS J;  2XHK A;  2LK2 A;  4XRS A;  3KP6 A;  3GZN B;  3CCJ I;  3S1R J;  1POG A;  4ZYA A;  4HX8 A;  3L7W A;  3F8C A;  3OYE A;  2ZFU A;  2W85 A;  4GYI A;  1BR1 A;  4RM3 A;  1OJL A;  4OIQ F;  3E6C C;  3MCZ A;  2NOG A;  5CQG A;  3QP6 A;  1RUN A;  4YG2 F;  2OZ6 A;  3OL4 A;  2H94 A;  1UFM A;  1IRX A;  5CVJ A;  3SFI A;  1HOM A;  1XCV A;  4BKX A;  4D5C A;  2AXL A;  1MH4 A;  1B4A A;  1GV2 A;  2MLG A;  3IAS 2;  3KIO A;  1HW1 A;  1Z7L A;  3FXR A;  1RKT A;  3M07 A;  3F6O A;  2YSR A;  5J4V A;  2VOO A;  1T6S A;  1JT6 A;  2IGO A;  4Q47 A;  3IH2 A;  1XGS A;  5LRS A;  1BIB A;  3ML6 A;  3GLX A;  2W1O A;  1KQ9 A;  3FK7 A;  2IA0 A;  3RCO A;  1ETY A;  1IN8 A;  1FBS A;  3TOB A;  3GW2 A;  3AG3 H;  2VOD A;  4FTH A;  3BZK A;  1RRJ A;  3ASO H;  1IN7 A;  3FM5 A;  4CYC B;  2L54 A;  4MGR A;  2JUC A;  2KIF A;  3E97 A;  4E7H A;  2NRA C;  2DA7 A;  1MSE C;  1IDZ A;  2JVH A;  4W1U A;  4XLA A;  3G6E I;  2WC2 A;  4QWQ A;  1V54 H;  3JRI A;  1W36 C;  1NG7 A;  1UZC A;  3IKT A;  2GBY A;  3T8R A;  2NS8 A;  1YJN I;  4HG2 A;  2BV6 A;  1SFU A;  1X1P A;  2KMU A;  3F23 A;  1S5L C;  1WJD A;  1JGG A;  3JRF A;  2E2J J;  3OY9 A;  4U87 A;  5D8L B;  1S7O A;  1A5J A;  2JRM A;  4B4C A;  1JT0 A;  3ZMV A;  3OYM A;  1VQ7 I;  3QPH A;  2O9L A;  3DBR B;  2CSO A;  3BQY A;  2JA6 J;  2R7V A;  2DOA A;  2KRH A;  4N4N B;  2ZFW A;  3S14 J;  2ZJP F;  2DT5 A;  2ESN A;  1TZL A;  3FMQ A;  4UB6 C;  2E5N A;  1E2X A;  3CD6 I;  5B1A H;  1TWA J;  1VQL I;  5J47 A;  1ZG3 A;  5HLG A;  1MH3 A;  2XB0 X;  3DBL B;  2OUM A;  2Z5U A;  5CYV A;  2GXB A;  2V9K A;  1Q1V A;  1LDJ A;  2VQC A;  3AG4 H;  4A3F J;  2ZB9 A;  5IP9 J;  2O7O A;  3NEU A;  3AAF A;  1FY7 A;  2WAD A;  4CYC A;  2E34 A;  4BE2 A;  1WGX A;  1SD5 A;  4BQO A;  2V1X A;  2WA0 A;  2H6C A;  4IRH A;  1CF7 B;  3EET A;  1S6L A;  4NC6 A;  4DQ2 A;  3COA C;  1BC8 C;  1FX7 A;  3LQR A;  5BOX A;  1XGM A;  4D1Q A;  5CJ9 A;  1YTY A;  2EFP A;  3QPL A;  1B59 A;  1VQ8 I;  4ZYG A;  5F0F A;  2G7H A;  2HQN A;  1APL C;  2DMQ A;  2QSG X;  3HTS B;  2MYS A;  2KIQ A;  1EH7 A;  4A0Y A;  3ZMS A;  1SD4 A;  2W7N A;  3FHZ A;  2DAO A;  4F7Z A;  2P8T A;  4NDL A;  5DV5 A;  3WU0 A;  3GTK J;  2DA1 A;  3LQQ A;  4A5N A;  4XLE A;  5CPR B;  3OSG A;  1BR4 A;  1ZK8 A;  4NNJ A;  3RJP A;  2XSJ C;  2RC4 A;  4P96 A;  5LGT A;  4OMY A;  3QYB A;  3K70 D;  3QAH A;  2FQ3 A;  4CGZ A;  4HBL A;  2XF5 A;  3HHG A;  3UR3 C;  4IF4 A;  3PQJ A;  5E79 C;  4LD5 A;  3HRT A;  2D1H A;  4P9U A;  5HNH A;  2HDW A;  2PMU A;  2XKO A;  2UWM A;  4CCM A;  2HPI A;  3K4L A;  3K4M A;  3QU3 A;  2QKM B;  2FBI A;  2HGC A;  4PJL A;  4A3D J;  2DTR A;  2K9Q A;  4S04 A;  4ZYH A;  4D7M A;  3I5U A;  1Z67 A;  4Y52 J;  4E70 A;  1VI0 A;  4FE7 A;  3ZCO A;  1YS7 A;  3I0T A;  3MFK A;  4L9T A;  2X1C A;  2DMP A;  1GT0 C;  2WAF A;  2A6T A;  3Q0W A;  4QLC U;  3SQN A;  4HQM A;  1CF7 A;  5D8K B;  1OCZ H;  2JSP A;  3LWF A;  4Y7N J;  2KQR A;  5HNF A;  2ESH A;  1QQI A;  4ZTJ A;  2GAU A;  1QPI A;  1T8I A;  3DF8 A;  3WU2 C;  2JT1 A;  2E1M B;  1WJC A;  1N78 A;  3C3W A;  2OA4 A;  3PIP F;  2VOP A;  5C3E J;  2Q0O A;  2VXZ A;  1DU0 A;  5F08 A;  2CUZ A;  3FZV A;  4BQA A;  1XMA A;  1OQY A;  1BR2 A;  1Z77 A;  1Z05 A;  2VBX A;  2CH0 A;  3BJ6 A;  4CSW A;  5D5W B;  5DCM B;  2KIU A;  3DPL C;  3KEY A;  3DPT A;  2HOT A;  3C2H A;  2LDU A;  1STZ A;  2DDB A;  1Y8Q B;  3BG7 A;  2RQP A;  4UV9 A;  1JHH A;  3J7Z I;  4OOI A;  4JP0 A;  4OIP F;  2FJ1 A;  4KIF A;  3ISP A;  4FT8 A;  1WPK A;  2ZCW A;  1DPU A;  1V4R A;  3JRG A;  1UCR A;  1WSU A;  4AUX A;  1S8N A;  1XD7 A;  3MQ0 A;  4JK1 X;  3P7N A;  3L2W A;  3DBH B;  1MJB A;  3ECH A;  3VEP A;  2PX9 A;  3CC2 I;  3DFG A;  2HWV A;  3K7A J;  1BI3 A;  3WTZ A;  3RZO J;  1IC8 A;  4XQF A;  4J01 A;  2FMY A;  3GWZ A;  5F6F A;  1O7F A;  4XN0 A;  5EDN A;  4NB5 A;  4BHP A;  4HDU A;  4EM0 B;  5M3M J;  3OYL A;  1UST A;  1JUM A;  2QEX I;  3CCU I;  1W0T A;  5FLV A;  3CME I;  1YX3 A;  1G6N A;  2EFN A;  2J5O A;  3DU6 A;  3Q9S A;  1OYW A;  1I27 A;  1H9T A;  2IRF G;  4N0B A;  3S17 J;  1Z9C A;  3AKZ A;  3GZ5 A;  3PSI A;  3TP0 A;  4C3H J;  3K1M A;  5DCM A;  3R6S A;  1RES A;  4CZC A;  2Z33 A;  2X51 A;  3K4J A;  2K85 A;  1R7J A;  3AG2 H;  4F3Q A;  1OCT C;  3KP3 A;  4AYB A;  3TP3 A;  2XPU A;  4RLF A;  4CA0 A;  2N8G A;  1H0M A;  4LIU A;  1TQP A;  5FGM A;  2WB1 N;  4M3B A;  4HYE A;  2DOD A;  5JVT A;  4KT5 C;  1DUX C;  2K9M A;  3GTJ J;  2UZK A;  1F4K A;  2DCE A;  2OJE D;  2X4H A;  1U78 A;  5ICC A;  4L18 B;  1QRY A;  2ZSH B;  3UKG A;  1BL0 A;  1GV5 A;  1L3L A;  3QOE A;  4ZH4 F;  4Y3O A;  4CIC A;  2H27 A;  3JCU C;  4KIT B;  3G1M A;  1T56 A;  1FJL A;  3X2Q H;  4BQQ A;  4JX6 A;  4R8H A;  2L4A A;  3HOZ J;  5GAD J;  1UG2 A;  2ISZ A;  2XDV A;  5LD2 C;  4A3E J;  1TT0 A;  4RB3 C;  2V6E A;  2MD0 A;  3U1D A;  2CQN A;  1BOB A;  3HRS A;  3K0L A;  5J1U A;  4KDP A;  1G3Y A;  2VC0 A;  2XKP A;  1HXD A;  3M8J A;  1EH8 A;  4RMN A;  4F92 B;  2K5C A;  2X6W A;  2MBF A;  4Q48 A;  3DV8 A;  2EZH A;  1T2K A;  4RDU A;  3L2Q A;  4RGR A;  2CFX A;  4MTD A;  4EJW A;  4EM1 A;  1BW5 A;  2DJI A;  2LRD A;  2QBY B;  1WI3 A;  1SAU A;  4BJ5 C;  4DJA A;  2MSY A;  3LSR A;  1A35 A;  2CV0 A;  2FNP A;  2VB6 A;  1IZ1 A;  1Z6R A;  2EIM H;  5DUI A;  2M45 A;  2JUG A;  4Y15 A;  4P5O A;  1FPQ A;  3EYY A;  3MKY B;  2E1N A;  5L3E A;  1BM9 A;  2LH9 A;  2Y0S A;  1PJR A;  3PSF A;  1O3S A;  3VOD A;  3GX4 X;  4MQ9 F;  2GM4 A;  1GXQ A;  4UB8 C;  5BPI A;  4R1H A;  2W82 A;  3W3C A;  2CQ7 A;  2MW8 A;  3CCY A;  3PNT A;  5EYR A;  1I3A A;  4EVI A;  1JKP C;  3MZH A;  3ZP5 A;  2FBK A;  1XCB A;  2XGC A;  1XMX A;  2A07 F;  4BXF A;  2P7V B;  3RPU A;  1XSV A;  2RV8 A;  3HBL A;  3ASN H;  2DK8 A;  4EGZ A;  3TED A;  1N77 A;  1IXR C;  4M6X A;  2PQ8 A;  1HSJ A;  4CDG A;  5A2Q K;  2ID3 A;  3HDD A;  1D0Z A;  2ECC A;  2QM3 A;  4AD9 A;  2NYX A;  3L09 A;  1XSX A;  1BA5 A;  2M4G A;  2W24 A;  4LJZ F;  1MNM C;  1BI1 A;  4L9N A;  1B9N A;  1WWX A;  2FF4 A;  3ZPL A;  2QYO A;  1YQA A;  3HOX J;  2GQQ A;  2BY1 A;  1AU7 A;  4Y4R A;  3G1O A;  4HSR A;  4A2U A;  5HLH A;  1SEU A;  4PFO A;  4UY8 I;  2R7D A;  4D0P A;  2QBY A;  5FRM A;  4U7D A;  2RRE A;  4UUS B;  3D0S A;  2Z3Y A;  3PUB A;  1LEB A;  2H09 A;  3OYN A;  4ITV A;  3I59 A;  2WTE A;  4KA4 A;  4DBQ A;  3HL2 A;  4ZYD A;  2PMZ N;  3GVA A;  3OL3 A;  2TDX A;  3FXJ A;  4GRI A;  4EQQ A;  3KP7 A;  2M0M A;  1IN4 A;  4D9J A;  1I50 J;  3S2D J;  1I6H J;  2LY1 A;  3TQN A;  1DGR M;  3FM3 A;  4I02 A;  3K9T A;  3HOS A;  3ABU A;  3KYC B;  4HX4 A;  3H1C A;  3A0B C;  1ZYR F;  4WCG A;  2JMW A;  3LAP A;  1YI2 I;  4RB2 C;  2H1K A;  2NVU B;  2AQE A;  1O57 A;  4O6J A;  4BL0 B;  2L2O A;  1T0F C;  3GFL A;  2A6H F;  2F5D A;  2KKO A;  4IKF A;  4IJA A;  3O8H A;  2IXS A;  3GTP J;  2CQX A;  2R7O A;  5DM6 F;  4XLC A;  1FYL A;  5J6X A;  4LG3 A;  2CV1 A;  2ZXJ A;  4PSX A;  4L0Z B;  2R0Q C;  1O7L A;  3SEQ A;  3VYU B;  1ZTR A;  2XUB A;  3I4P A;  2H6B A;  2L7F P;  3VSL A;  2HOE A;  4HST A;  5J40 A;  3M3Y J;  3FXM A;  3FBI B;  1LFP A;  1PDN C;  1J09 A;  3CP2 A;  4IHV A;  3UNG C;  2AXT C;  4PJ0 C;  1CGP A;  3OYK A;  3IV5 A;  1SD6 A;  1JGS A;  4Z6Y A;  2DFE A;  1G8X A;  2M4K A;  4G8X A;  2HKO A;  4XRF A;  1OPC A;  1S9H A;  3KP4 A;  2O8K A;  5IT3 A;  2K02 A;  2R5Y B;  5J8F A;  1W5C C;  5DS9 A;  1F36 A;  1QVT A;  1E3H A;  4C2U A;  2VQH A;  4ZDP A;  3I64 A;  2XAU A;  4WXC A;  1K79 A;  5DTD A;  3HOY J;  2JVG A;  5BPD A;  1W7P D;  4GDF A;  3WTW C;  2QQ8 A;  1E3P A;  2WAQ A;  2E19 A;  1SAX A;  4M73 A;  4II2 A;  2FRH A;  2XRL A;  1R1V A;  2W4S A;  3BR5 A;  4AM3 A;  2JA8 J;  4NC8 A;  2DFI A;  4M6V A;  2ZXW H;  3KLN A;  4EJO A;  2DMT A;  3H0D A;  3DLL F;  3JR9 A;  3N97 A;  1S3J A;  3TL4 X;  2DPD A;  3KLO A;  3F8M A;  3WHC A;  5IP7 J;  3JSP A;  2HPM A;  4MNU A;  2OCC H;  4HA8 A;  2CV2 A;  3HOU J;  2NS0 A;  1XTA A;  4M9S A;  2LBF B;  3BOQ A;  2QEN A;  2JZY A;  4B47 A;  3L2U A;  2ZKZ A;  3OIO A;  4IXA A;  4XON A;  5DCF A;  2R3S A;  4DNC A;  5LEK A;  5E8G A;  4C9Y A;  2L9S A;  5JR3 A;  4DW6 A;  5M5X J;  4FAS D;  4LB6 B;  4M3G A;  2PJR A;  4II3 A;  3K10 A;  1MMS A;  1Z91 A;  2F6C A;  1ZRF A;  3HZJ A;  2F4I A;  2IP2 A;  2A69 F;  1HW2 A;  3V7C A;  2Q8K A;  3R60 A;  5LRR A;  3BTJ A;  2CQK A;  2ME6 A;  1SFX A;  1YJ9 I;  3OYF A;  2R5Y A;  1TW2 A;  1MW7 A;  1ZRE A;  1KU7 A;  3R0A A;  4A3M J;  3OS1 A;  1W4M A;  2O8X A;  1OMI A;  2B7E A;  4ASN A;  5HOD A;  2X6O A;  2M9H A;  1PUE E;  2X9D A;  4LLL A;  3ULQ B;  3CCM I;  3FKI J;  1XS9 A;  3C7J A;  3S8P A;  2CQQ A;  3V8J A;  1FEX A;  5C44 J;  2YU3 A;  5BMZ A;  2RNG A;  1VQ5 I;  2GZW A;  2H8W A;  3K4C A;  1K83 J;  3K4B A;  3Q0V A;  3U1K A;  2STW A;  1U5T B;  2K40 A;  2BVM A;  2PJP A;  2FQ4 A;  4BHB A;  2LBF A;  4L5J A;  2DW4 A;  2DTZ A;  2B63 J;  1D5V A;  3KX2 A;  5HOO A;  1ZN2 A;  3GZ6 A;  4ZYE A;  2L4M A;  4MIM A;  5D4S A;  1LB2 A;  4CZZ A;  3BPX A;  2DQL A;  2GA2 A;  4YFN F;  3AL0 C;  1JJ8 C;  3SZP A;  2O03 A;  2Z1D A;  2R93 J;  2BGC A;  4UUV A;  1DP3 A;  3DWL E;  1ETV A;  5IPA A;  1MBF A;  1D0Y A;  4XOT A;  2VON A;  2BEO A;  2VKV A;  3DQV C;  1ZRD A;  1A04 A;  3OS2 A;  4LB5 A;  3DLA A;  5LFA A;  2VKE A;  2OAZ A;  1X2N A;  2TCT A;  4EJU A;  1ZGJ A;  3HG9 A;  3BTI A;  3FHN A;  3FWE A;  3KEQ A;  2PFB A;  3BP8 A;  2FD5 A;  3PNV A;  5HLI A;  1R5H A;  1TNT A;  4C30 A;  1VFC A;  1LDK B;  2DO7 A;  2F2E A;  1DP7 P;  4RGX A;  4DYR A;  1HST A;  2CMP A;  5EG0 B;  3CDH A;  1KYZ A;  5C4X J;  3HHH A;  1MMA A;  4BBR J;  5IT9 K;  5M5Y J;  1P4W A;  1Z7U A;  3EPZ A;  2DA6 A;  1ON2 A;  2HDD A;  3HOV J;  1UB9 A;  2P5K A;  4A3I J;  3ABL H;  1IUY A;  1YOV B;  3WTV C;  3MVP A;  4UHT A;  4XLH A;  2DOF A;  1U5T A;  1W36 D;  2B9S A;  1QGP A;  4NC7 A;  1KGS A;  1SD7 A;  2LG4 A;  3BWG A;  1OYY A;  2HTJ A;  4YRV A;  1IO2 A;  3I4M J;  2VE9 A;  1R1U A;  5M3F J;  1HCR A;  4C3I J;  3N05 A;  2LFB A;  2XAQ A;  1OYI A;  1XDU A;  3GTL J;  1MKM A;  1H8A C;  2FU4 A;  4YII A;  3O6B B;  2KP6 A;  4ENN A;  4HF2 A;  5LBQ A;  3QWL A;  1T98 A;  3WHB A;  1TNS A;  1P7J A;  3T1B A;  4YFX F;  1H88 C;  2ZME C;  4IHS A;  3H0G J;  3GTM J;  3U2R A;  4C2M J;  3PO3 J;  5ILU A;  4O3M A;  3JTG A;  1V55 H;  2Y31 A;  3OYA A;  4MFD A;  1LJ9 A;  4XRS G;  2JRT A;  1ZH5 A;  5LGU A;  3IUO A;  2BOL A;  3ZOB A;  2ISY A;  3KEO A;  4RAF A;  2VIX A;  5FKK A;  3RQ4 A;  3BR6 A;  1IN5 A;  4E7S A;  2VT3 A;  4UV8 A;  1MBK A;  3ONQ A;  2Y2Z A;  4XMY A;  2ELJ A;  3F8N A;  1J59 A;  5LGN A;  3BCB A;  4CCL A;  5FLX Z;  1K61 A;  1X1C A;  2W84 A;  4XR6 A;  2A61 A;  1BJA A;  2QF7 A;  1OCR H;  1VZ0 A;  4XL9 A;  3IKV A;  3OIQ A;  5EG0 A;  2A5Y B;  3VPR A;  3MAJ A;  2F5E A;  2IAI A;  2V7F A;  1KU2 A;  1MSF C;  4OIN F;  4KUM A;  3ZR8 X;  1JKQ C;  4ZTF A;  2JPC A;  4X0G A;  2D2W A;  3BZC A;  3HUG A;  2YX7 A;  3G71 I;  3ESW B;  2VJJ A;  2IVM A;  3PL8 A;  4YIF A;  3J7A O;  2WBM A;  2JA2 A;  4IEJ A;  4LK1 F;  2E36 A;  3B6C A;  3J80 K;  1BW6 A;  2VLA A;  1YIO A;  2WV1 A;  4YFK F;  2KDO A;  3M8E A;  3GLL A;  5IYB J;  3MKZ A;  1QO0 D;  2XGE A;  5H20 A;  9ANT A;  5JVG F;  3ZQI A;  3CCQ I;  4A93 J;  2FML A;  1FLI A;  1LEA A;  2QKL B;  3OYD A;  1JI8 A;  2R92 J;  2V1N A;  2EIL H;  4XID A;  3F22 A;  1OCC H;  2PMH A;  3CES A;  2HI3 A;  2NNY A;  4M3F A;  3CO7 C;  4BE0 A;  2XAJ A;  4A3B J;  3DU5 A;  5B5E C;  3KYD B;  1J5Y A;  1LKX A;  4CUG A;  2HR3 A;  2M1B A;  4N4O B;  3HJE A;  5DM7 F;  4PCQ A;  5EF6 A;  3B02 A;  3LSJ A;  5GTI C;  2XIG A;  1IRF A;  4Z2Y A;  1R5G A;  4BJT A;  3CDI A;  3W2A A;  3TGN A;  1W1W E;  3ELK A;  2F4M B;  5K7F A;  5CVU A;  5HDK A;  2GLO A;  1U9O A;  5GAE J;  1X1B A;  4UUT A;  3TO9 A;  3TW6 A;  3BLY A;  3H9Q A;  1T95 A;  2G9W A;  3S2H J;  2EIN H;  2LD5 A;  1MBE A;  3CCL I;  2VUM J;  1FOW A;  1FTT A;  3F8F A;  3M7G A;  4HV5 A;  1VQK I;  5DD8 A;  3CUQ B;  3KZZ A;  2P6T A;  5FJ8 J;  5TRD A;  4IHW A;  1X2M A;  4B43 A;  2MH2 A;  1USS A;  5TJJ A;  1LPQ A;  2R7T A;  2CUF A;  5AIP A;  1MZB A;  3H35 A;  2E2H J;  1K78 B;  1IV6 A;  2ICW G;  5E3L A;  2D5V A;  3S2W A;  3PFI A;  2YX4 A;  1OKR A;  2X0L A;  5LEJ A;  1G3W A;  4JBA A;  2FOK A;  4HEA 2;  3HIF A;  2P5V A;  5CQE A;  3CJT B;  3R61 A;  3MEX A;  2UXX A;  3CCE I;  1DQU A;  3IH4 A;  1UAA A;  3OR2 C;  2W48 A;  3A03 A;  1WKM A;  2YR2 A;  3S3M A;  3REO A;  2NAZ A;  4I7H A;  4G9Y A;  3H5A A;  5CLS A;  4IHX A;  1TTY A;  2I8D A;  1ZKG A;  3H9J A;  2RNJ A;  2KJC A;  1MBG A;  3OR1 C;  2BY3 A;  4U0V A;  3LSH A;  4Q4Z F;  5GTH C;  3GFJ A;  5FLX K;  2ZJR F;  4UVB A;  1FC3 A;  2JQ7 A;  3IRR A;  3FXK A;  3LOC A;  2CFO A;  2HDC A;  4M74 A;  1K6Y A;  4L5E A;  1UEL B;  3ZMT A;  1GHC A;  1U6G A;  1HF0 A;  3S32 A;  1ZAR A;  1Y0U A;  1I1S A;  2F48 A;  5ICE A;  4DIQ A;  2DLL A;  3PQK A;  1YS6 A;  1K6O A;  4XLN F;  3SJM A;  4E7L A;  3NWS A;  3CDL A;  2DOE A;  3CUQ A;  4AC0 A;  2GXA A;  3EYI A;  1K78 A;  2ZJ2 A;  4ZJZ A;  4TV7 A;  1FYM A;  2HQR A;  1KQ8 A;  2LY9 A;  3V7R A;  3KCC A;  4PUS A;  3O2P E;  1A6Q A;  2VPL A;  3P5J A;  4UVC A;  1BI0 A;  4BDZ A;  4IX7 A;  3WTT C;  2GOX B;  3LFU A;  3B73 A;  3CCS I;  3F3X A;  4IHY A;  2IT0 A;  4HOB A;  2NXN B;  5ED4 A;  3H5N A;  4XLP F;  3R4K A;  3CMM A;  1O4X A;  2VBZ A;  4QTR A;  2IS2 A;  1X4P A;  3GTO J;  5GPA A;  1EH6 A;  3L00 A;  3M8F A;  1Z6T A;  2VJ4 A;  2PI0 A;  3O3K A;  3E0J B;  2X1D A;  1ZQ3 P;  3I56 I;  4KFC A;  2BXZ A;  3DTE A;  2LNB A;  4PJN A;  1VQM I;  3L9F A;  3DKW A;  3IRQ A;  4XNF A;  1MJA A;  2LMD A;  3DEU A;  4FIS A;  2LY2 A; 
#chains in the Genus database with same CATH homology
 4XSX F;  3RKY A;  3RKX A;  1MJ9 A;  1DDN A;  4GGG A;  3P9K A;  1GXP A;  3QU6 A;  4RAY A;  5F64 A;  4M6Y A;  1IXS B;  1SMT A;  5E20 A;  2MLK A;  2K86 A;  3MZY A;  2FSW A;  3E5Q A;  1JE8 A;  3HRU A;  3WE2 A;  2W25 A;  4A12 A;  3ROU A;  4BYY A;  4RGU A;  5ICF A;  3V4G A;  2IPQ X;  2CO5 A;  4FHT A;  2BBY A;  4BXU A;  1DPR A;  4G7Z F;  3HOT A;  1H9G A;  2IA1 A;  3Q9V A;  5K5O A;  2P7C B;  3JW4 A;  3LA2 A;  5E8I A;  4O5V A;  2JPB A;  3I54 A;  3RYR A;  4JQF A;  4BNC A;  1FYK A;  3WTY C;  4KN7 X;  3EUH A;  2PBI A;  3I59 B;  4I0B A;  3D5L A;  3I71 A;  5E1W A;  1AOY A;  1R36 A;  4HAM A;  2PEX A;  4OU0 A;  3GYH X;  1XDS A;  4M71 A;  4CO8 A;  2FXA A;  5KVR A;  4CXF A;  2Q2E A;  5L3C A;  3ZN0 A;  4G7O F;  1PP8 F;  1YW9 A;  3E6B A;  2EK5 A;  1Q1H A;  2W57 A;  2XAF A;  2EV0 A;  1KU9 A;  3BDD A;  5D5X B;  1LVA A;  1VTN C;  3N4M A;  1HBX G;  3SHF A;  1BIA A;  2STT A;  3FF5 A;  4M72 A;  4EGY A;  3KP5 A;  5L3D A;  5ILV A;  4NHJ A;  2XAS A;  2EA4 A;  1IW7 F;  4PZJ A;  2JTV A;  1BI2 A;  1J2X A;  2IJL A;  5HS9 A;  4EJT A;  4Y17 A;  1T0F A;  4B8X A;  4ESF A;  2HFH A;  4M9X A;  1TBX A;  4IRI A;  1F5T A;  3NQO A;  2HTS A;  3IHU A;  1ZHF A;  4I01 A;  5FD6 A;  4MQV A;  1TLH B;  1W7P B;  4N9H A;  2EV5 A;  1ON1 A;  1KU3 A;  1J0R A;  1JHF A;  1R23 A;  1XN7 A;  2EV6 A;  1XGO A;  3E5X A;  3LAJ A;  2E1C A;  3IWF A;  2Y48 A;  2WWY A;  1YO5 C;  5FO5 A;  5EEG A;  3HSR A;  2RGV A;  3FXQ A;  4KMF A;  4RS8 A;  1FOK A;  1RIO H;  3RYP A;  5L3F A;  1ZG1 A;  2GXG A;  1ZLJ A;  5DDG A;  5HS8 A;  3R0J A;  3RTR A;  1R00 A;  2NNN A;  3QP5 A;  5K1Y A;  5FFZ A;  2O0Y A;  5HVQ C;  4WWC A;  5DD4 A;  1OR7 A;  1W7P A;  4EJV A;  2A68 F;  3GO5 A;  3W6K B;  2EJR A;  3FMS A;  2QWW A;  4AWX B;  4Y13 A;  4L5I A;  3CO7 C;  3WGI A;  3LFK A;  1MDM B;  4OIO F;  1U3E M;  2EB7 A;  2DBB A;  3P9C A;  5KK1 A;  4P9F A;  4ZZD A;  2ADU A;  4EV0 A;  3K2Z A;  3BJA A;  3L2C A;  4MEY F;  5E1Z B;  2QQB A;  1O3Q A;  3CTA A;  4GXO A;  5J8C A;  2FA5 A;  4WX9 A;  1D3Y A;  4M9Z A;  2KJB A;  4A6D A;  3TDZ C;  2OQG A;  1PP7 U;  1U2W A;  2K27 A;  4FX0 A;  2HZT A;  1ZLK A;  5L3G A;  2C6Y A;  3WG9 A;  2ZNY A;  3TO7 A;  1IN6 A;  2ZME B;  1W5T A;  4UNO A;  1GVJ A;  5CVR A;  5EEH A;  5FFX A;  1MDM A;  1KQ0 A;  3FX3 A;  3GFM A;  2WV0 A;  3TKY A;  2EFO A;  2Y0M A;  1ZRC A;  2ZO4 A;  4ENM A;  4OMZ A;  1RI7 A;  3WGG A;  2QUF A;  4IVN A;  3HRM A;  2M5W A;  2COM A;  4PGG A;  2XRO A;  2BYV E;  2FBH A;  2V1U A;  4N9I A;  4A0Z A;  2GWR A;  1SFE A;  3M1E A;  4IPA A;  3WU1 B;  2Z9O A;  1YYV A;  4LLG F;  1FT9 A;  3F6V A;  5ILS A;  1TW3 A;  4A0X A;  4HLY A;  5ICG A;  2HS5 A;  3IWZ A;  3K1P A;  1FP1 D;  1P2F A;  4ENJ A;  1F1Z A;  1RUO A;  1RZ4 A;  5F1R A;  2EA2 A;  3BRO A;  3BPV A;  2ZME A;  2KIM A;  2XV4 S;  1REP C;  1J75 A;  1RNL A;  4I09 A;  1G4D A;  4L9V A;  3GF2 A;  4U88 A;  5K5R A;  3EQL F;  3QRF F;  2XAH A;  2DU9 A;  5H6Q A;  3HSE A;  2O6G E;  2V79 A;  3EDP A;  1FBU A;  4KIC A;  1U5T C;  1BOA A;  3LST A;  2PG4 A;  4GYG A;  2P4W A;  3LA7 A;  1I6X A;  1WI9 A;  3DXJ F;  1EV7 A;  2OBP A;  4RB1 A;  4G6Q A;  2LF7 A;  1JXS A;  1LNW A;  3KE2 A;  2HEO A;  3VOE A;  3GUD A;  4PDK A;  6PAX A;  2D45 A;  1HQC A;  2OU2 A;  2HYF A;  3KFW X;  1MD0 A;  3V8L A;  5CVI A;  4IHT A;  3WOD F;  1P6R A;  2EWN A;  1IF1 A;  5LLQ A;  3ZN1 A;  1KA8 A;  2XVC A;  3SFZ A;  1ZG5 A;  3IL2 A;  4KYW A;  2OZU A;  4HF0 A;  3W6J B;  3H3Z A;  2LF8 A;  1FZP B;  3KP2 A;  1I1G A;  5JI6 A;  3WTX C;  5L3B A;  3ZQ7 A;  2DQR A;  3SXY A;  4MTE A;  4A5M A;  2CWE A;  3ERE D;  3OOP A;  3C18 A;  1FSE A;  3QOP A;  3GEZ A;  1P92 A;  1F9N A;  3FXU A;  1KYW A;  3F8B A;  1P4A A;  1BC7 C;  2L01 A;  4KIG A;  5LHI A;  3E6D A;  2VC1 A;  1XGN A;  3LA3 A;  2CYY A;  5FD5 A;  5HDN A;  1G3S A;  3T8T A;  2ACJ A;  3KET A;  5JFR A;  3M9A A;  1R1T A;  2AS5 F;  1T38 A;  4Q5S F;  2R7F A;  3K1N A;  1LDD A;  3JAM Z;  4RAZ A;  2A6E F;  2FEZ A;  3U9G A;  3J81 Z;  4U0W A;  1E17 A;  4G7H F;  3WTU C;  2QQ9 A;  2KRF A;  4HW0 A;  2FE3 A;  4RB0 A;  2DK5 A;  2G7U A;  4MHG A;  5CVV A;  4K2E A;  4AIK A;  1BBY A;  4FX4 A;  1XMK A;  1R58 A;  5AIQ A;  4BAY A;  2GIV A;  1IXC A;  2QZ8 A;  4ETS A;  3CO6 C;  2MA3 A;  1S29 A;  5HDG A;  1HKQ A;  2CW0 F;  3CUQ C;  2XRN A;  2L02 A;  1QPM A;  3RKW A;  3I58 A;  1L0O C;  1NHA A;  5D5U B;  2V6C A;  2MC3 A;  5A2Q Z;  3G73 A;  1I5Z A;  4L9J A;  2P6S A;  1XB4 A;  1X3U A;  2Z99 A;  5JHU A;  4ZZL A;  4KIB A;  4I98 B;  4BHC A;  3HSF A;  4LGW A;  3T5X A;  3V8K A;  3H92 A;  2ETH A;  3TDU C;  5BQT A;  1G3T A;  3JTH A;  3QPT A;  2VN2 A;  5BS6 A;  1U8R A;  1FBQ A;  3HTU A;  4ESJ A;  1ONV A;  2MH9 A;  1T39 A;  3I53 A;  2QVO A;  4LK0 F;  4HZF A;  1W5S A;  1YG2 A;  3JAM K;  2L3D A;  2E7W A;  1YLF A;  3KZY A;  3J81 K;  1YFH A;  1Z1D A;  2B0L A;  3E5U A;  3WTS C;  2O61 A;  1TQI A;  5E1X A;  1SMY F;  1B1B A;  3CJN A;  2BE5 F;  2JSC A;  1HKS A;  2RKH A;  4ON0 A;  1R22 A;  4BH9 A;  3DP7 A;  3VFZ A;  3BJO A;  1FNN A;  4I2O A;  1V3F A;  2VT2 A;  1ULY A;  1QZZ A;  2OQR A;  1D8J A;  3CUO A;  3RDI A;  2RN7 A;  3ECO A;  2A3S A;  3GXO A;  5LHG A;  2CG4 A;  1FSH A;  4CYD A;  3BY6 A;  2M87 A;  2F5C A;  4XSZ F;  1O3R A;  3HYI A;  2UXN A;  1B6A A;  1FP2 A;  4UXN A;  5D6F A;  2K7L A;  1UHM A;  4G6D A;  4EM2 A;  2PLY A;  2EFQ A;  2XAG A;  1IRG A;  4R79 A;  1ODD A;  4KN4 X;  2FNA A;  5ERI A;  3VB2 A;  4WXD A;  3V7S A;  2DPU A;  2K4B A;  3TO6 A;  1ZGA A;  2IW5 A;  1YW8 A;  2QLZ A;  3OV8 A;  4HQE A;  2VBY A;  5E17 F;  4NQW A;  2YPR A;  1QNT A;  1BN5 A;  3WGH A;  4AIJ A;  1O3T A;  2CGP A;  2V9V A;  4AVP A;  4GCV A;  5LHH A;  2ZNZ A;  4U7B A;  4KNY A;  3ZMZ A;  5DYM A;  3P9I A;  4HDV A;  1D8K A;  5K5Q A;  2ELH A;  3BZ6 A;  5AON A;  3T0Y A;  2V1D A;  4LMY A;  3ZMU A;  1WRJ A;  4G94 A;  1YW7 A;  1K7A A;  3GFI A;  3NRV A;  2F5F A;  2RDP A;  4HV6 A;  2HKX A;  3F72 A;  5D4R A;  4S05 A;  2XGX A;  5E18 F;  2GA1 A;  4A6E A;  4XBF A;  3ZMD A;  4WXH A;  4P55 A;  5D6E A;  1J7K A;  5FB2 A;  4CHU A;  4HF1 A;  1TQM A;  3IC7 A;  4GO1 A;  4AIH A;  4I0A A;  3C1D A;  2QQA A;  2EFW A;  5IT9 Z;  2IA2 A;  3E6M A;  2Y75 A;  3RPQ A;  1WQ2 A;  3ABT A;  1LQ1 A;  3SZT A;  1QBJ A;  5DUK A;  3G3Z A;  4WK8 F;  4KMU X;  3RI4 A;  1ZAO A;  3E3V A;  4H0E A;  4MEX F;  2VBW A;  2LSO A;  2LKP A;  2J5P A;  4LLN A;  4LG0 B;  4PGH A;  1B9M A;  4UVA A;  1IAW A;  2RVC A;  3CLO A;  2HYG D;  4IRG A;  5DEQ A;  3WE3 A;  1FWZ A;  3FMR A;  4HX7 A;  2D1V A;  3JSO A;  3F21 A;  1XSD A;  2M8E A;  4HLX A;  2VE8 A;  4RGS A;  3K69 A;  4WF2 A;  3RIR A;  4LFU A;  5D5V B;  2MD5 A;  1AWC A;  4OIR F;  3MWM A;  5HS7 A;  1MGT A;  1QZY A;  1C0W A;  2PN6 A;  5H6R A;  2DI3 A;  2P5L C;  2ZBK A;  2E7X A;  4U0Y A;  4ESB A;  1UHW A;  2O3F A;  4L0Y B;  2M30 A;  1J9I A;  3J80 Z;  2OD5 A;  4ENK A;  1HKT A;  1P4X A;  1S7A A;  3H3U A;  3TOA A;  4B09 A;  3Q5F A;  4LG0 A;  2K4J A;  1HW5 A;  2XHK A;  3KP6 A;  4HX8 A;  3L7W A;  3F8C A;  4GYI A;  2W85 A;  4OIQ F;  3E6C C;  3MCZ A;  3QP6 A;  1RUN A;  4YG2 F;  2OZ6 A;  2H94 A;  1UFM A;  5CVJ A;  1XCV A;  2AXL A;  1B4A A;  2MLG A;  1HW1 A;  3FXR A;  3F6O A;  2YSR A;  2VOO A;  1T6S A;  4Q47 A;  1XGS A;  5LRS A;  1BIB A;  3ML6 A;  3GLX A;  1KQ9 A;  2IA0 A;  1IN8 A;  1FBS A;  3TOB A;  3GW2 A;  2VOD A;  1IN7 A;  3FM5 A;  2L54 A;  4MGR A;  2KIF A;  3E97 A;  2NRA C;  2WC2 A;  4QWQ A;  3IKT A;  3T8R A;  2BV6 A;  1SFU A;  3F23 A;  5D8L B;  1S7O A;  3ZMV A;  3QPH A;  2CSO A;  2ZFW A;  2DT5 A;  2ESN A;  3FMQ A;  1E2X A;  1ZG3 A;  5HLG A;  2Z5U A;  5CYV A;  2GXB A;  1LDJ A;  3NEU A;  3AAF A;  1FY7 A;  1SD5 A;  2V1X A;  2H6C A;  4IRH A;  1CF7 B;  3EET A;  1S6L A;  3COA C;  4DQ2 A;  1BC8 C;  1FX7 A;  3LQR A;  5BOX A;  1XGM A;  5CJ9 A;  1YTY A;  2EFP A;  1B59 A;  4ZYG A;  2G7H A;  2HQN A;  3HTS B;  1EH7 A;  4A0Y A;  3ZMS A;  1SD4 A;  3FHZ A;  2DAO A;  4F7Z A;  2P8T A;  5DV5 A;  3WU0 A;  3LQQ A;  4A5N A;  5LGT A;  3RJP A;  4P96 A;  2RC4 A;  4OMY A;  3QAH A;  2FQ3 A;  4CGZ A;  4HBL A;  3HHG A;  4IF4 A;  3PQJ A;  4LD5 A;  3HRT A;  2D1H A;  4P9U A;  2PMU A;  2XKO A;  2UWM A;  3QU3 A;  2FBI A;  2HGC A;  2DTR A;  4S04 A;  4ZYH A;  3I5U A;  4E70 A;  1YS7 A;  3I0T A;  3MFK A;  4L9T A;  4QLC U;  3SQN A;  4HQM A;  1CF7 A;  5D8K B;  3LWF A;  2ESH A;  1QQI A;  2GAU A;  3DF8 A;  2JT1 A;  3C3W A;  2OA4 A;  2VOP A;  2Q0O A;  2VXZ A;  4BQA A;  3FZV A;  1XMA A;  1Z05 A;  2VBX A;  3BJ6 A;  5D5W B;  5DCM B;  2KIU A;  3DPL C;  3DPT A;  2LDU A;  1STZ A;  2RQP A;  4UV9 A;  1JHH A;  4OOI A;  4OIP F;  4KIF A;  3ISP A;  4FT8 A;  2ZCW A;  1DPU A;  1V4R A;  1UCR A;  1WSU A;  1S8N A;  1XD7 A;  3MQ0 A;  4JK1 X;  3P7N A;  1MJB A;  3ECH A;  3VEP A;  3DFG A;  2HWV A;  1BI3 A;  3WTZ A;  2FMY A;  3GWZ A;  5F6F A;  1O7F A;  4NB5 A;  4BHP A;  4HDU A;  4EM0 B;  1UST A;  2J5O A;  1G6N A;  2EFN A;  3Q9S A;  1H9T A;  1OYW A;  1I27 A;  2IRF G;  4N0B A;  1Z9C A;  3GZ5 A;  3K1M A;  5DCM A;  3R6S A;  2Z33 A;  1R7J A;  3KP3 A;  1H0M A;  5FGM A;  1TQP A;  4HYE A;  5JVT A;  4KT5 C;  1DUX C;  2UZK A;  1F4K A;  2X4H A;  1U78 A;  5ICC A;  4L18 B;  1L3L A;  4ZH4 F;  4CIC A;  2H27 A;  4R8H A;  2L4A A;  2ISZ A;  4RB3 C;  3U1D A;  3K0L A;  3HRS A;  4KDP A;  1G3Y A;  2VC0 A;  2XKP A;  1HXD A;  1EH8 A;  2MBF A;  4Q48 A;  3DV8 A;  1T2K A;  4RGR A;  2CFX A;  4MTD A;  4EJW A;  4EM1 A;  2QBY B;  2FNP A;  1IZ1 A;  1Z6R A;  5DUI A;  2M45 A;  4Y15 A;  4P5O A;  1FPQ A;  3EYY A;  2E1N A;  5L3E A;  1BM9 A;  1O3S A;  3VOD A;  3GX4 X;  1GXQ A;  5BPI A;  4R1H A;  4EVI A;  3MZH A;  3ZP5 A;  2FBK A;  1XCB A;  2A07 F;  2P7V B;  3RPU A;  1XSV A;  2RV8 A;  2DK8 A;  4EGZ A;  1IXR C;  4M6X A;  2PQ8 A;  1HSJ A;  4CDG A;  5A2Q K;  2QM3 A;  4AD9 A;  2NYX A;  3L09 A;  1XSX A;  2W24 A;  4LJZ F;  1BI1 A;  4L9N A;  1B9N A;  1WWX A;  2FF4 A;  3ZPL A;  2QYO A;  1YQA A;  2GQQ A;  4A2U A;  5HLH A;  2R7D A;  4D0P A;  2QBY A;  4U7D A;  3D0S A;  2Z3Y A;  1LEB A;  2H09 A;  3I59 A;  2WTE A;  4KA4 A;  4ZYD A;  3GVA A;  2TDX A;  4EQQ A;  3KP7 A;  1IN4 A;  3TQN A;  4I02 A;  3FM3 A;  3HOS A;  3K9T A;  3ABU A;  4HX4 A;  1ZYR F;  4WCG A;  3LAP A;  4RB2 C;  1O57 A;  4O6J A;  3GFL A;  2A6H F;  2F5D A;  2KKO A;  4IJA A;  1FYL A;  5J6X A;  2ZXJ A;  4L0Z B;  1O7L A;  2XUB A;  3I4P A;  2H6B A;  2HOE A;  1PDN C;  1CGP A;  1SD6 A;  1JGS A;  4G8X A;  2HKO A;  4XRF A;  1OPC A;  3KP4 A;  5IT3 A;  2K02 A;  5J8F A;  3I64 A;  4WXC A;  1K79 A;  5BPD A;  1W7P D;  3WTW C;  1SAX A;  4M73 A;  2FRH A;  1R1V A;  2DFI A;  3KLN A;  4EJO A;  3N97 A;  1S3J A;  2DPD A;  3KLO A;  3F8M A;  3JSP A;  4MNU A;  4HA8 A;  2NS0 A;  4M9S A;  3BOQ A;  2QEN A;  2JZY A;  2ZKZ A;  4IXA A;  5DCF A;  2R3S A;  4DNC A;  5LEK A;  5E8G A;  5JR3 A;  4LB6 B;  1Z91 A;  1ZRF A;  2IP2 A;  2A69 F;  1HW2 A;  3V7C A;  2Q8K A;  3R60 A;  5LRR A;  2CQK A;  1SFX A;  1TW2 A;  1ZRE A;  1KU7 A;  3R0A A;  1W4M A;  2O8X A;  1OMI A;  4ASN A;  1PUE E;  4LLL A;  3ULQ B;  3C7J A;  3V8J A;  2YU3 A;  5BMZ A;  2GZW A;  2STW A;  1U5T B;  2PJP A;  4BHB A;  4L5J A;  2DW4 A;  1D5V A;  5HOO A;  1ZN2 A;  3GZ6 A;  4ZYE A;  2L4M A;  5D4S A;  1LB2 A;  4CZZ A;  3BPX A;  2DQL A;  2GA2 A;  4YFN F;  3SZP A;  2O03 A;  2BGC A;  4UUV A;  2VON A;  2BEO A;  3DQV C;  1ZRD A;  1A04 A;  4LB5 A;  2OAZ A;  4EJU A;  1ZGJ A;  3FWE A;  3KEQ A;  2PFB A;  3BP8 A;  5HLI A;  1R5H A;  1TNT A;  1LDK B;  2DO7 A;  2F2E A;  1DP7 P;  4RGX A;  1HST A;  3CDH A;  1KYZ A;  3HHH A;  5IT9 K;  1P4W A;  1Z7U A;  1ON2 A;  1UB9 A;  2P5K A;  1IUY A;  3WTV C;  4UHT A;  1U5T A;  1QGP A;  1KGS A;  1SD7 A;  3BWG A;  1OYY A;  2HTJ A;  2VE9 A;  1R1U A;  2XAQ A;  1OYI A;  1XDU A;  1MKM A;  2FU4 A;  4YII A;  3O6B B;  4ENN A;  4HF2 A;  5LBQ A;  1T98 A;  1TNS A;  3T1B A;  4YFX F;  4IHS A;  3U2R A;  5ILU A;  4O3M A;  3JTG A;  1LJ9 A;  1ZH5 A;  2JRT A;  5LGU A;  2ISY A;  3KEO A;  1IN5 A;  2VT3 A;  4UV8 A;  3F8N A;  1J59 A;  5LGN A;  5FLX Z;  2W84 A;  2A61 A;  1BJA A;  3IKV A;  2A5Y B;  3MAJ A;  2F5E A;  1KU2 A;  4OIN F;  4KUM A;  2JPC A;  2D2W A;  3HUG A;  2YX7 A;  2IVM A;  4YIF A;  3J7A O;  4LK1 F;  3J80 K;  1YIO A;  4YFK F;  3M8E A;  1QO0 D;  5H20 A;  2FML A;  1FLI A;  1LEA A;  3F22 A;  2PMH A;  2NNY A;  2XAJ A;  1J5Y A;  2HR3 A;  2M1B A;  4PCQ A;  3B02 A;  2XIG A;  1IRF A;  4Z2Y A;  1R5G A;  3TGN A;  3ELK A;  5CVU A;  5HDK A;  3TO9 A;  2G9W A;  3F8F A;  3M7G A;  4HV5 A;  5DD8 A;  3CUQ B;  3KZZ A;  2P6T A;  5TRD A;  2MH2 A;  1USS A;  5TJJ A;  5AIP A;  1MZB A;  1K78 B;  3S2W A;  3PFI A;  2YX4 A;  1OKR A;  2X0L A;  5LEJ A;  1G3W A;  4JBA A;  2FOK A;  3HIF A;  2P5V A;  3R61 A;  3MEX A;  2UXX A;  1WKM A;  2YR2 A;  3REO A;  2NAZ A;  4I7H A;  4G9Y A;  5CLS A;  1TTY A;  2KJC A;  2RNJ A;  4U0V A;  4Q4Z F;  3GFJ A;  5FLX K;  4UVB A;  1FC3 A;  3IRR A;  2HDC A;  4M74 A;  3ZMT A;  1GHC A;  1U6G A;  1ZAR A;  1Y0U A;  1I1S A;  5ICE A;  2DLL A;  3PQK A;  1YS6 A;  1K6O A;  4XLN F;  3CUQ A;  3EYI A;  1K78 A;  2ZJ2 A;  4TV7 A;  1FYM A;  2HQR A;  1KQ8 A;  3V7R A;  3KCC A;  3O2P E;  4UVC A;  1BI0 A;  3WTT C;  3B73 A;  3F3X A;  2IT0 A;  4HOB A;  5ED4 A;  4XLP F;  3R4K A;  2VBZ A;  1EH6 A;  3L00 A;  3M8F A;  1Z6T A;  2PI0 A;  3O3K A;  4KFC A;  2LNB A;  3L9F A;  3DKW A;  3IRQ A;  1MJA A;  4EMS A;  3DEU A;  4MQ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...