4GXOA

Crystal structure of staphylococcus aureus protein sarz mutant c13e
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
GSHMYLSKQLEFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family regulatory protein
publication title Protein cysteine phosphorylation of SarA/MgrA family transcriptional regulators mediates bacterial virulence and antibiotic resistance.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 49
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gxoA00
4UVBA 5D5WB 4WCGA 2UXNA 2FE3A 4LK1F 2CO5A 3REOA 3ZMUA 2HDCA 3KCCA 1OKRA 2DI3A 3V7RA 2DQRA 1BBYA 1U5TA 4Q4ZF 3WGGA 3F22A 2CFXA 1SMYF 1MJ9A 2ACJA 1K78A 1GVJA 1FP2A 1XSDA 4LB6B 3EQLF 1WQ2A 2QWWA 4YFNF 2WTEA 3FXQA 1RNLA 4BHPA 5L3FA 4XLPF 3GXOA 1OYWA 1XMKA 2FU4A 2DPUA 3L2CA 5D5UB 1O3TA 3WU0A 4KIGA 3AAFA 4MEXF 5DCMA 5LGTA 3MZYA 3EUHA 5ICGA 4PDKA 5LLQA 3SFZA 3KETA 3G3ZA 4A5MA 4FHTA 3K1MA 4I98B 2DK5A 1ZRFA 3DPLC 1R22A 5E17F 3V7SA 2EWNA 5L3EA 4A5NA 3CLOA 4N0BA 2DFIA 1XGSA 2MH2A 2R3SA 3BOQA 3WTVC 2HR3A 2A6EF 2D45A 3K2ZA 2P7CB 4GO1A 3KEQA 2OA4A 5F64A 3RDIA 3JTGA 4OMZA 3QP6A 4XSXF 4CGZA 3TDZC 4LJZF 1JHHA 2O3FA 5CYVA 4HZFA 4RAYA 2E1NA 2STTA 1R00A 3CJNA 1R1UA 2PMUA 3RIRA 1XGNA 1SFXA 2VOOA 1BC7C 3KP5A 2ADUA 2ZO4A 1WWXA 1ZGJA 1NHAA 2V9VA 3IRQA 3BY6A 2PMHA 3T1BA 1VTNC 4ENMA 1USTA 4JK1X 1TLHB 3GFJA 2RC4A 4XRFA 1DUXC 2FXAA 4OIOF 2YX7A 5FO5A 1YFHA 1S7OA 2FMYA 3HSRA 1CF7A 4UNOA 3BROA 1O7FA 2GZWA 3GUDA 1G3SA 3EYIA 2LF7A 1FC3A 2R7FA 3BJOA 5E8IA 5HDKA 4U7BA 2W84A 3T0YA 2A6HF 1ZG1A 2HFHA 3MCZA 1T38A 2MD5A 4G6DA 4HF2A 1YQAA 2L02A 2VC1A 4L0ZB 4WXHA 3HOTA 1G3WA 4HV6A 2QBYB 2MC3A 1B9NA 1J0RA 3SQNA 3V8JA 3E5QA 3F6VA 1D8KA 3IHUA 5FB2A 1DPUA 1YG2A 2LF8A 1O3SA 3GO5A 4UVCA 4I0BA 2VC0A 1LDKB 5ILVA 3BPVA 2W24A 4KA4A 3WTUC 2G7HA 2QENA 1ZARA 3MFKA 2K02A 4LLGF 5FD6A 2XKPA 2A07F 4BQAA 2F5FA 4ZYDA 4HDUA 3MQ0A 1FLIA 2DO7A 3KE2A 5TJJA 3RPQA 3FHZA 3TKYA 2OQGA 2VXZA 4ZZLA 1XSVA 1S29A 1BM9A 2QQAA 2PG4A 2D1HA 2P5KA 4L9NA 1ODDA 3BJ6A 2PLYA 1LDJA 1IN4A 1F5TA 3OOPA 5HDGA 3WGHA 2BBYA 2DAOA 1JHFA 2KKOA 3J81K 5A2QK 1R1VA 3LA3A 1ZAOA 3O2PE 5TRDA 4L0YB 1LQ1A 4MQVA 4A0XA 5IT9Z 4A2UA 4XSZF 5J8CA 4A6EA 5ILUA 2PJPA 4Y15A 2ZMEA 4P9UA 1QZYA 4HAMA 3K9TA 1ULYA 3RYPA 1ON2A 3KZYA 4HYEA 5D8LB 5EEGA 4MQ9F 5BQTA 2P4WA 4I01A 1T6SA 4AVPA 4UUVA 3GZ6A 3I58A 4ON0A 3CO6C 4KICA 4PCQA 3HRSA 3BZ6A 3JSOA 3IWZA 3HTSB 3T5XA 1RUNA 5E1WA 2VBXA 3VB2A 2P5VA 1KU7A 4IPAA 2HTJA 3HYIA 5E20A 5AIQA 4HX7A 2IPQX 3E6CC 4IF4A 2L01A 4LFUA 4ENKA 1OYYA 2Y0MA 1TNTA 2ISYA 1ZH5A 2HKOA 5CVJA 5J8FA 3HSEA 1V4RA 3GW2A 2HTSA 1B59A 3D5LA 3RTRA 2KJCA 2QVOA 1UHMA 4D0PA 1AWCA 1FWZA 2DBBA 2E1CA 3DQVC 2XVCA 2GA1A 1ZYRF 4BYYA 4LLNA 1QGPA 3P9IA 5LHIA 1U5TB 1Z91A 1WSUA 2FBKA 3PFIA 3K0LA 4LG0A 2OZ6A 1P4XA 1QO0D 4AWXB 1IN6A 2QUFA 1HBXG 5JFRA 1FYMA 1LEAA 1R5HA 1ZHFA 3WGIA 5CJ9A 4RB3C 4WK8F 5DEQA 5DCFA 2IRFG 2RDPA 1PP8F 2ZBKA 3Q5FA 4EMSA 4N9HA 4G7OF 2O61A 3C7JA 2FMLA 3WE3A 1YS6A 4NQWA 2QYOA 2XKOA 4U0VA 1Q1HA 3U1DA 2UWMA 2EFPA 2BYVE 4RGXA 1FBQA 2JTVA 3ZMTA 4M9SA 5CVUA 2F2EA 3KP3A 3KLNA 4Z2YA 3HUGA 3S2WA 2PI0A 1QBJA 3R0JA 3EDPA 4E70A 3E3VA 1FYKA 1C0WA 5K1YA 3F8FA 4LLLA 3KEOA 4Y17A 4HX8A 4G8XA 1IAWA 2A69F 4KMFA 3KP2A 2C6YA 4IHSA 2L4MA 4N9IA 4ZYEA 2V1XA 3SZTA 2E7XA 4H0EA 1XGMA 2OQRA 5AONA 3FZVA 2HEOA 4LMYA 4EQQA 3GWZA 3ZMDA 2GXGA 3DF8A 1IXCA 2Z33A 3C3WA 3HRTA 1XCVA 4RGRA 3I53A 3FM3A 1CF7B 3DPTA 3SHFA 3ELKA 3WTYC 5BOXA 5A2QZ 3BP8A 5E1XA 3MZHA 1H9GA 3CUOA 1R5GA 2EFWA 1ON1A 1BI0A 4L18B 1L0OC 3VODA 2P6SA 2CG4A 3WU1B 4ENNA 1MGTA 3VOEA 3TOAA 3LQRA 3FMSA 2RVCA 2Y75A 2GWRA 2EV6A 3COAC 1Z05A 2STWA 2DQLA 1P92A 1P4AA 2MBFA 3D0SA 1YW9A 2J5OA 5FFXA 2YU3A 1QQIA 3MAJA 1ZG5A 1LDDA 2QQ9A 3JAMK 3QRFF 3ROUA 2WWYA 1REPC 1TTYA 3GFIA 4LD5A 4R8HA 4S04A 2ZNZA 2BGCA 4P9FA 4UVAA 2BEOA 3FF5A 3NEUA 4KIFA 1F1ZA 3TQNA 2A68F 4IHTA 1MD0A 1W5SA 3F8CA 2KRFA 1STZA 3KLOA 3HOSA 1WI9A 1U2WA 3C18A 3LAPA 1JE8A 3E6BA 3FMQA 3QPHA 2NRAC 1SD6A 4P96A 2K4JA 1I1GA 4M6XA 3FM5A 4G7ZF 2V1UA 1R1TA 1OR7A 1PUEE 5E18F 3I5UA 4I0AA 3P7NA 3IWFA 2GA2A 4WXCA 2XIGA 4RGUA 2QLZA 3QU6A 4YFKF 3Q9VA 3BJAA 1FBSA 3B02A 2G9WA 2AXLA 2YSRA 2HS5A 2R7DA 2ZMEB 3IKTA 2IJLA 4ZYHA 3LQQA 3RPUA 1QZZA 1TNSA 4CDGA 2Q0OA 4HBLA 1R7JA 3ISPA 4MTEA 3R6SA 3I59A 3L09A 3T8RA 4RB1A 4LB5A 4PZJA 2VT3A 3F21A 2LKPA 4KT5C 1XGOA 1MJBA 2DLLA 5LEKA 3PQJA 5LHHA 2EA4A 3QOPA 4OOIA 3L7WA 4QLCU 1TBXA 2XGXA 5CVIA 6PAXA 5F6FA 2UXXA 4IXAA 2XV4S 4Q48A 3IC7A 2K86A 5H6RA 3ZP5A 1ZRCA 1P6RA 4EM0B 2FRHA 2NNNA 2DU9A 5HS9A 1O3QA 1HKQA 5FD5A 2ZCWA 2HYFA 5LEJA 1U3EM 5ICFA 4NHJA 3BDDA 2OU2A 4PGHA 4EGYA 3O3KA 3DV8A 1MDMB 2M87A 2FF4A 4YFXF 5JVTA 1XCBA 1KGSA 1MZBA 3CUQA 1JXSA 2IA1A 5ED4A 4ESBA 2OBPA 1BC8C 2FOKA 4LG0B 1BOAA 4I2OA 1HKSA 1LNWA 1W4MA 2GIVA 2EV0A 1U6GA 4UV9A 1YW7A 3NRVA 3C1DA 2PFBA 2CW0F 4M9XA 3M8EA 1MJAA 3ECOA 3J80K 2TDXA 3H3UA 1IUYA 3G73A 3B73A 1T98A 4Q47A 1Z6TA 5KVRA 1S8NA 5FLXK 2QM3A 1ZG3A 3GVAA 3I54A 4HLYA 5ICCA 3HRMA 1G3TA 3L9FA 2F5CA 1J7KA 3LA2A 2YR2A 1USSA 2RGVA 3VEPA 5IT3A 4I09A 4HQEA 3MWMA 3F72A 1IRGA 2D1VA 1IXSB 3JAMZ 4AD9A 1B6AA 3WG9A 2KIMA 4R1HA 5ICEA 4UV8A 2H09A 4BAYA 1TQPA 2VE8A 4IRGA 2X0LA 5BS6A 4CICA 3WTXC 5JR3A 2HYGD 1GHCA 5BPDA 3LWFA 1ZRDA 4A0ZA 2O6GE 2IA2A 4EJVA 2XASA 2L4AA 1D3YA 3WTZA 4ZYGA 3K1NA 2J5PA 3R4KA 4WX9A 1W5TA 1F9NA 1DPRA 2W85A 3ERED 1RUOA 4KNYA 2A5YB 2ZNYA 4OIQF 3FXUA 1SD7A 1V3FA 1IN5A 2W57A 3ABUA 4HOBA 1FYLA 5HLGA 3CO7C 3LFKA 1KQ0A 1D8JA 5LGNA 2L3DA 3GX4X 4OIPF 2H27A 4ZZDA 2W25A 2P6TA 1TW3A 2EJRA 2OAZA 3E97A 4Y13A 1F4KA 3W6KB 2XAGA 2ESHA 3I0TA 3KP7A 1B1BA 1YIOA 1J9IA 4HLXA 2P8TA 1K78B 4KN4X 3FX3A 5BMZA 2XAJA 4O6JA 1FZPB 2OZUA 2HQNA 1D5VA 3J7AO 1EH8A 5HDNA 2VT2A 2IP2A 4IVNA 3LSTA 1IXRC 2RQPA 5DCMB 2FQ3A 3DEUA 1QNTA 4M73A 2GXBA 1XN7A 5L3BA 3E5UA 1SD5A 4A6DA 2KJBA 5D6FA 5L3CA 1KA8A 2DPDA 3RKWA 2NAZA 1HSJA 1K7AA 1RI7A 2H6CA 3M9AA 3ML6A 4M74A 3EYYA 4WF2A 2X4HA 4WXDA 5D6EA 1BIBA 3P9KA 3KP4A 2EFNA 4P55A 2JZYA 3E6DA 5EEHA 4I7HA 3M7GA 4MGRA 3HRUA 1EV7A 5DD8A 2DTRA 1K6OA 1X3UA 3V7CA 3DKWA 4K2EA 1S7AA 5D5XB 1K79A 3TO9A 1SD4A 4XLNF 2GQQA 3RJPA 1G6NA 4KDPA 2CSOA 3M8FA 1XD7A 1E2XA 3R60A 3RKYA 4OIRF 3ZQ7A 1KU3A 3ECHA 2WV0A 4ASNA 3F8MA 1UHWA 2MH9A 5HS7A 5BPIA 3Q9SA 5ILSA 4KUMA 2EB7A 1FBUA 1EH7A 3J80Z 2VBZA 1E17A 3J81Z 3H92A 2XHKA 3I59B 4KN7X 2JPBA 2FNPA 2XAHA 4CO8A 2L54A 4QWQA 5FLXZ 4G94A 1YLFA 4ESJA 4IRHA 4GCVA 4U7DA 3DP7A 2FBIA 3HTUA 3ZPLA 3I71A 3SZPA 1O57A 1PP7U 2JRTA 5IT9K 2ESNA 2LDUA 1P4WA 1MKMA 3N97A 5HLIA 4RAZA 2LSOA 1QPMA 1TQIA 1FSHA 4HW0A 2VONA 4BHCA 4F7ZA 1UFMA 1W7PA 4LGWA 3FMRA 1HW2A 3F3XA 3HHHA 1O3RA 2VBWA 2XAQA 2EFOA 4FX0A 2F5DA 1I6XA 4EJOA 2EV5A 5J6XA 1H0MA 3WE2A 3GFLA 5HS8A 3IKVA 4KIBA 1A04A 1IW7F 3WODF 5FFZA 3TGNA 1DP7P 1HQCA 1ZGAA 5K5QA 3CUQB 5CVRA 1GXQA 3JTHA 5F1RA 3GYHX 1SAXA 2H6BA 3RYRA 3KP6A 2ZFWA 1FT9A 1FNNA 1HW1A 4P5OA 2Z99A 1OYIA 4L9JA 3TO6A 2QQBA 1KQ8A 4G9YA 4U88A 5LRRA 1R58A 4OINF 4DQ2A 2XAFA 1HSTA 4AIKA 4OU0A 1KU9A 2G7UA 1SMTA 1UB9A 4M72A 4U0WA 4U0YA 3FXRA 5LBQA 2CGPA 5CVVA 2K4BA 1U5TC 2EA2A 4M9ZA 2RKHA 1O7LA 5HVQC 4ZH4F 3ABTA 1IN8A 5DDGA 4KFCA 2Z5UA 1XSXA 4CHUA 4AIHA 1ZN2A 4GXOA 2PN6A 1W7PD 2H94A 1U78A 3F6OA 2EK5A 1J2XA 3BPXA 1S3JA 3TO7A 2ZXJA 3JW4A 4MTDA 3MEXA 3WTWC 1KYZA 4RGSA 2HKXA 2O03A 3U9GA 1FX7A 1DDNA 2PBIA 3RKXA 3R61A 4Q5SF 2P5LC 4IRIA 1LVAA 2M8EA 2WC2A 4A0YA 2CQKA 4ESFA 4FT8A 3NQOA 5DV5A 1SFUA 3H3ZA 4NB5A 1ZREA 2M5WA 1H9TA 2M30A 3ZN0A 1FY7A 4M71A 1R36A 2FEZA 3WTSC 4YIIA 1KQ9A 5D4SA 2NYXA 1Z1DA 2O0YA 4JQFA 5H6QA 1Z9CA 1L3LA 5JI6A 5ERIA 4RB2C 3GFMA 2A3SA 1I5ZA 4HF1A 4BXUA 4L9VA 4L5JA 4EVIA 4TV7A 3GLXA 2Q2EA 1TQMA 3JSPA 1YS7A 4RS8A 5H20A 1ZLKA 2GAUA 4XBFA 3N4MA 3ULQB 4PGGA 1KU2A 2Q8KA 3M1EA 2NNYA 3IL2A 3GEZA 3HSFA 1T2KA 3V8KA 3F8BA 4CYDA 4HF0A 4MHGA 4BNCA 4KMUX 2YX4A 2DK8A 2V6CA 4HQMA 3I4PA 1Z6RA 1HW5A 2MA3A 1ONVA 1B9MA 4GGGA 4HDVA 2V1DA 2HZTA 1XB4A 2XROA 1T39A 2ETHA 1YW8A 3ZMZA 2DW4A 1AOYA 4GYIA 3TOBA 3OV8A 4CXFA 5L3DA 4EV0A 1LEBA 3E6MA 1U8RA 1J5YA 2CYYA 3IRRA 5E1ZB 3V4GA 1T0FA 1BI2A 1RIOH 3T8TA 4ETSA 3U2RA 4MNUA 2BE5F 2ZJ2A 4YG2F 2FNAA 3P9CA 4RB0A 4I02A 4B8XA 3ZMVA 3PQKA 3EETA 1HXDA 1P2FA 2FSWA 4L5IA 4JBAA 2MLGA 4EM2A 2MLKA 1Y0UA 1Z7UA 1HKTA 3DXJF 1WKMA 5FGMA 3CUQC 4EJWA 4O3MA 1RZ4A 4HA8A 3W6JB 2IVMA 5CLSA 1BIAA 4IJAA 1LB2A 2KIUA 5DUIA 3GF2A 3L00A 1FP1D 2QBYA 2IT0A 1BJAA 2IW5A 5HOOA 1I1SA 1OPCA 1IZ1A 4DNCA 4O5VA 2ELHA 5AIPA 2Z9OA 2JPCA 1B4AA 4WWCA 2PEXA 5DD4A 2LNBA 4UXNA 2B0LA 1KYWA 4M6YA 3WTTC 3QPTA 2YPRA 2ZKZA 5LGUA 2HGCA 4B09A 1FOKA 1FSEA 2K7LA 2FBHA 5LHGA 4KYWA 2RV8A 2DT5A 2VODA 2K27A 1BI3A 3K69A 1MDMA 5HLHA 5E8GA 2O8XA 1JGSA 4R79A 1SFEA 4G6QA 4A12A 1YTYA 4GYGA 2XUBA 4G7HF 3LA7A 2IA0A 3V8LA 1I27A 1W7PB 5D5VB 1EH6A 2OD5A 3GZ5A 1XDSA 2NS0A 3QAHA 1OMIA 5D4RA 2AS5F 3K1PA 2P7VB 3O6BB 3HIFA 4EJUA 2QZ8A 4UHTA 1XDUA 5D8KB 2F5EA 2UZKA 2HOEA 1ZLJA 2PQ8A 2VE9A 3RI4A 3ZN1A 1IN7A 1FPQA 1S6LA 3F8NA 3ZMSA 4LK0F 2ISZA 1J75A 2COMA 3KFWX 2M45A 3E5XA 1CGPA 3SXYA 3QP5A 2D2WA 3QU3A 2E7WA 3CTAA 4OMYA 4FX4A 3BWGA 2HQRA 1GXPA 1IRFA 3TDUC 4L9TA 4BH9A 4AIJA 1G3YA 3FWEA 1XMAA 1J59A 4EJTA 5DUKA 3I64A 1G4DA 2XRNA 4BHBA 4EGZA 5LRSA 4EM1A 3F23A 5DYMA 4S05A 1BI1A 1WRJA 2V79A 4YIFA 5JHUA 2CWEA 4ENJA 1R23A 2VBYA 2RNJA 4MEYF 2Y48A 3HHGA 5K5RA 1YO5C 3DFGA 5K5OA 2JSCA 2EFQA 3LAJA 1UCRA 2M1BA 2VOPA 3KZZA 3R0AA 2HWVA 4HX4A 5L3GA 2RN7A 1TW2A 2VN2A 1YYVA 2JT1A 1IF1A 2BV6A 4HV5A 4CZZA 3CDHA 3VFZA 2Z3YA 2FA5A 1BN5A 1LJ9A 1PDNC 2A61A 5KK1A 2KIFA
chains in the Genus database with same CATH superfamily
4UVBA 5D5WB 5F0FA 4HNTA 4WCGA 2UXNA 2FE3A 2R7OA 2R7ZJ 4LK1F 2CO5A 2R5YA 3REOA 3ZMUA 2R7WA 2HDCA 2CUZA 3KCCA 3NARA 1VQNI 2LP0A 4S0HB 3ZQIA 1R49A 2HVSA 1AU7A 1OKRA 2DI3A 1Q1VA 4F52A 3V7RA 2DQRA 3CDIA 1BBYA 3K70D 4W97A 4ZJZA 3OIOA 1T8IA 4ABZA 1U5TA 4Q4ZF 3WGGA 3F22A 1LE8B 1TWGJ 1MMSA 2CFXA 2R7TA 1SMYF 4V2GA 4IZZA 2JVHA 1MJ9A 3A03A 3FK6A 4HNVA 3CCUI 1LFBA 2ACJA 2QGUA 1AKHB 4B48A 2X6WA 1K78A 1GVJA 1FP2A 2X51A 1WJBA 3PSIA 3AL0B 2XGDA 1XSDA 4LB6B 1WZ2A 2L9SA 3EQLF 3GTPJ 3GLLA 3HG9A 3HXLA 1WQ2A 2RAEA 2QWWA 4YFNF 2WTEA 4PJNA 4FTHA 5FKOA 3TP0A 3FXQA 4BDYA 1RNLA 2HOTA 1TWFJ 4BHPA 5L3FA 4XLPF 3GXOA 1OYWA 1XMKA 2Q1ZB 2FU4A 2DPUA 3L2CA 3GTQJ 5D5UB 1O3TA 3O8GA 3WU0A 3ZRGA 5IP6A 4KIGA 3AAFA 4A3IJ 4MEXF 2Q2EB 5DCMA 5LGTA 3CD6I 3MZYA 3EUHA 5ICGA 3HGGA 2X1EA 4PDKA 5E79C 5LLQA 1V54H 1IUFA 1WFXA 3SFZA 3KETA 3G3ZA 4A5MA 2HQAA 2I5UA 4FHTA 3K1MA 4I98B 2DK5A 3OSGA 1ZRFA 3DPLC 4BE1A 1R22A 5E17F 3V7SA 2BXYA 1VQ6I 2CW7A 2EWNA 3BC8A 5L3EA 4A5NA 3CLOA 3H9GA 2DFIA 4N0BA 1XGSA 3LSRA 2MH2A 2R3SA 3BOQA 3H36A 3WTVC 3S3MA 5HNHA 3S17J 2HR3A 3I56I 3CCMI 2A6EF 2DA2A 2D45A 3K2ZA 2P7CB 4GO1A 3KEQA 2OA4A 4OWRB 3EPZA 5F64A 1JJ8C 1HC8A 3HB9A 4IX7A 3RDIA 3JTGA 4OMZA 3QP6A 3W2AA 4XSXF 2MW8A 4CGZA 2XSJC 3TDZC 1HDPA 2GLOA 3OYNA 4LJZF 1JHHA 2O3FA 1GT0C 5CYVA 4HZFA 4AVZA 3ZQCA 2JA5J 4RAYA 1V5FA 3JRBA 1SFKA 2A6TA 2X6YA 2E1NA 1IDYA 3P5JA 1YOVB 2BVMA 3OL3A 4XR6A 2STTA 1R00A 1R4NB 5F27A 1YRNB 4RAFA 5J40A 4PJMA 3CJNA 1R1UA 2PMUA 1VQ5I 2KP6A 2X9DA 1WJCA 3RIRA 1XGNA 1QRYA 1SFXA 2CQ7A 3H9JA 2KDZA 2VOOA 1BC7C 4B4CA 3KP5A 2ADUA 2HVRA 2ZO4A 3BTCA 2RQQA 1WWXA 1ZGJA 1NHAA 2V9VA 3IRQA 3BY6A 3C2GA 2PMHA 3T1BA 1P7JA 4C2UA 1HA8A 3BG5A 4N4NB 1VTNC 4ENMA 2LR8A 2E5NA 1USTA 2EH3A 3OYLA 5TGTA 2VJIA 4JK1X 1TLHB 2V9KA 3GFJA 2KFDA 2RC4A 4XRFA 1DUXC 2FXAA 4OIOF 2YX7A 3S16J 5KCMA 5FO5A 1FTTA 3S3OA 1YFHA 1S7OA 5GAEJ 2FMYA 3HKZN 3HSRA 1VQLI 1CF7A 1VQ7I 1NG6A 3GZNB 4UNOA 3BROA 4F3QA 1O7FA 2GZWA 3W2VA 3GUDA 3JRDA 1G3SA 3Q0WA 4FQGA 4H4KC 4PUSA 3EYIA 2VKDA 1B72B 2LF7A 1FC3A 2R7FA 3BJOA 5E8IA 5HDKA 4U7BA 2W84A 3T0YA 1MMGA 4IQJA 4I76A 2A6HF 1ZG1A 3K2AA 2HFHA 3M3YJ 3MCZA 5JLXA 2LBFB 1U9OA 4JX4A 2OCEA 1T38A 2MD5A 5EG0A 4Y7NJ 1H89C 4G6DA 4HF2A 2W4SA 4GDFA 4D7NA 2IBDA 3RZDJ 1YQAA 2L02A 2VC1A 2E1MC 4DIQA 4DW6A 4L0ZB 2IGKA 4WXHA 1X2NA 3DWLE 2VPLA 3MKLA 1RKTA 2P81A 3HOTA 4A93J 1G3WA 3DBLB 3ZQLA 4IHYA 3QPLA 2ZC2A 4HV6A 2QBYB 1XMXA 2MC3A 2NVXJ 1B9NA 1J0RA 3SQNA 3V8JA 3LSJA 3SDGA 3E5QA 2HDDA 4BGDA 3F6VA 1D8KA 3IHUA 1GLNA 5FB2A 2XGCA 1DPUA 2WAEA 1YG2A 2LF8A 1O3SA 3GO5A 2PJRB 4UVCA 4BJ6C 2L7KA 3RSNA 3FKJA 1E3PA 1XC5A 4I0BA 2VC0A 1UHSA 3KX2A 1LDKB 4RBOA 5ILVA 3BPVA 5E3MA 1IJWC 3BR1A 2GIZA 2HXOA 2W24A 4KA4A 4Z6YA 2JQ7A 3WTUC 3S1NJ 2G7HA 2QENA 2CW8A 1ZARA 3MFKA 4NBQA 2K02A 1I50J 4LLGF 5LD2C 5FD6A 2XKPA 2LKXA 2A07F 2GM4A 4BQAA 5IOZA 1JUPA 2F5FA 4ZYDA 3S1MJ 3I4NJ 4HDUA 1JKOC 3MQ0A 2NVTJ 1FOYA 2VJ5A 2PMZA 4B44A 1FLIA 2DO7A 4E7JA 4HSTA 3KE2A 5TJJA 1E0EA 3K4KA 3RPQA 1X1CA 3FHZA 3TKYA 3HL2A 2OQGA 4RLQA 2VXZA 4E7HA 4JX6A 1XSVA 3ASOH 2KRHA 4ZZLA 1X3ZB 5C3EJ 1S29A 1BM9A 2QQAA 1GV5A 3IV5A 2PG4A 2D1HA 2P5KA 4L9NA 5J4VA 1ODDA 3BJ6A 5M3MJ 2PLYA 3FIWA 2OC6A 1LDJA 1IN4A 1F5TA 3OOPA 5HDGA 3VSLA 3WGHA 1TC3C 2EZIA 4D9JA 2BBYA 2DA4A 1WCMJ 2DAOA 1JHFA 1B8IA 2KKOA 3PUFA 3HOZJ 3J81K 5IPAA 3J7ZI 1ETYA 5A2QK 2BHYA 4UUSB 1R1VA 3LA3A 1ZAOA 5JLWA 3O2PE 3PM1A 3B6CA 5TRDA 4L0YB 1LQ1A 4MQVA 4A0XA 5IT9Z 4A2UA 2EZHA 4XN0A 4CCLA 1CQTA 4XSZF 2O8KA 1TL8A 5J8CA 4A6EA 5ILUA 2PJPA 2R5ZA 1WI3A 4BQOA 4XLAA 4XMYA 4Y15A 2ZMEA 4P9UA 3MKWB 1QZYA 2XPWA 1JJ6C 4HAMA 3K9TA 2FD5A 4ZTFA 1JKPC 2XPVA 3AL0C 1ULYA 3RYPA 1ON2A 3KZYA 4HYEA 5D8LB 3X2QH 1XG1A 5EEGA 1DGWY 5B66C 3J7AY 3G71I 4M3EA 3LSGA 4MQ9F 5BQTA 2F4MB 5GP9A 3DLLF 3DEWA 2P4WA 4I01A 1T6SA 1X1PA 4AVPA 4UUVA 2PMZN 3GZ6A 4UB8C 3JRIA 3I58A 4NC6A 5F08A 2M0CA 4CCNA 2IS2A 1OCRH 2DYRH 4ON0A 3CO6C 3DKXA 4KICA 4D5FA 1POGA 3HRSA 2NXNB 4PCQA 4RA2A 2OF7A 5FKLA 3BZ6A 3JSOA 2R0QC 3IWZA 3HTSB 4BY7J 2HI3A 3T5XA 2QKLB 2O7OA 3J7YJ 1RUNA 5E1WA 2X1DA 2VBXA 3VB2A 4AYBA 2P5VA 3CF5F 3BZKA 1KU7A 5GTHC 2HNHA 2DN0A 2IS4A 5FKNA 4IPAA 2HTJA 3M8JA 2IGNA 3HYIA 5E20A 5AIQA 4HX7A 2LTPA 2IPQX 3CF2A 3K4NA 3E6CC 4V19K 1RPWA 3SYTA 4IF4A 2L01A 3FHNA 3OYEA 4LFUA 3BCBA 4XL9A 3HM5A 3TW6A 3L2WA 1MMAA 4ENKA 1OYYA 1TT0A 2LY1A 2Y0MA 1TNTA 1X2MA 2ISYA 3CC7I 2HKOA 1ZH5A 2VUMJ 3OR2C 2K9QA 4HNUA 5J1YA 5CVJA 5J8FA 2LY2A 1K61A 3HSEA 2XC7A 1V4RA 2X1CA 3GW2A 4EATA 2HTSA 2GOMA 2EINH 2R5YB 1B59A 4FCYA 2HXIA 3D5LA 1BR1A 1VI0A 3RTRA 2KJCA 3DKYA 2QVOA 1UHMA 4D0PA 1UMQA 1OCTC 2XB0X 3K10A 3G1LA 1AWCA 1KONA 1FWZA 1Y8QB 2DBBA 3N05A 1U0JA 2E1CA 2GXAA 2CQQA 3DQVC 2XVCA 4IO9F 2GA1A 1ZYRF 4C3IJ 2JN6A 4BYYA 4LLNA 4ZDPA 1QGPA 2EBIA 3P9IA 5LHIA 1U5TB 2VI6A 1Z91A 1MBJA 1WSUA 1T0FC 2ZFUA 2A5WA 2L9VA 2FBKA 1A6IA 3PFIA 3K0LA 2VKEA 2OZ6A 4MFDA 4LG0A 3HOXJ 1P4XA 1QO0D 1KZHA 1IN6A 4AWXB 1GV2A 2CUEA 2QUFA 1HBXG 4DBQA 1T08B 3SFIA 2DYSH 5JFRA 1FYMA 2CH0A 9ANTA 3HJEA 1LEAA 1WGXA 1R5HA 1N25A 2YS9A 1ZHFA 3WGIA 1QA6A 2R92J 5CJ9A 1D0YA 2K3PA 4RB3C 4WK8F 5DEQA 3OYGA 4UUTA 2DODA 3FXOA 3WHBA 5DCFA 2IRFG 2RDPA 2JA8J 1PP8F 4KISA 4AYBN 1FEXA 1VQPI 2ZBKA 3Q5FA 4EMSA 4N9HA 4G7OF 1ZK8A 3C7JA 2FMLA 3Q0VA 2O61A 3WE3A 3BQYA 1YS6A 3Q0UA 5K7HA 4NUBA 3FBIB 4NQWA 2QYOA 2XKOA 3VYRB 4U0VA 1Q1HA 5IYBJ 3U1DA 2R7SA 3A0BC 3M07A 2UWMA 2EFPA 2BYVE 4RGXA 1FBQA 2JTVA 3ZMTA 4M9SA 5CVUA 2DOFA 1WJDA 1EKEA 3K4LA 4FISA 2F2EA 5JHFA 3KP3A 3KLNA 1DU6A 4Z2YA 3BG6A 1BW5A 3HUGA 3H0GJ 3S2WA 2PI0A 2WB1A 2V9PA 1EJ9A 1MBKA 4BL0B 1QBJA 2O5RA 1BW6A 3R0JA 3EDPA 1OFCX 1Z3XA 1NK3P 1AA7A 1SVMA 2ELKA 2DJNA 4E70A 2KMUA 4XIDA 3E3VA 1FYKA 1C0WA 2QSHX 3CCEI 3K4JA 2X6XA 2ZJRF 1IG7A 3H35A 3HOWJ 3ZQHA 5K1YA 4PJJA 2ZSIB 4JX5A 3F8FA 4LLLA 3KEOA 2VB6A 4Y17A 3AG4H 4HX8A 2CS3A 3BG9A 4G8XA 1RRJA 1HCRA 1W36D 1IAWA 2VL8A 2A69F 1ETVA 5FRNA 1UELB 3UKGA 4IHXA 4KMFA 3KP2A 4CSWA 2C6YA 2E2JJ 4IHSA 2L4MA 4N9IA 4ZYEA 2DA5A 5F0CA 2AXTC 3PNYA 3CCQI 2V1XA 3H3VK 3NWTA 3SZTA 2E71A 1V5GA 2E7XA 4QPOA 5M3FJ 2DA7A 3QPSA 4I99C 1XGMA 2OQRA 2WBMA 4H0EA 2R93J 5AONA 1ETXA 1JKQC 2CU7A 2ZJPF 3FZVA 2HEOA 4LMYA 1PUFA 4EQQA 1OCPA 2CV0A 3GWZA 3ZMDA 2GXGA 2YU9J 3DF8A 1IXCA 2Z33A 2DA6A 3C3WA 3BR2A 3HBLA 3HRTA 1XCVA 3A1YA 4RGRA 3I53A 1IO2A 2V1NA 3FM3A 2AO9A 1CF7B 5IY5H 2LKSA 4RLFA 3DPTA 3SHFA 1QVUA 3ELKA 5EEAA 3WTYC 1ERDA 4MFEA 2MSYA 5BOXA 5A2QZ 4CA0A 3BP8A 2LLKA 5E1XA 3MZHA 3OYDA 4C30A 4ZYAA 3TP3A 1VQOI 1H9GA 2WB1N 2BY2A 3CUOA 1P7IA 1R5GA 3VDXA 2EFWA 1ON1A 1BI0A 4CYCA 4XLEA 4L18B 2DA1A 1L0OC 3VODA 2VASA 2P6SA 2OCCH 1HF0A 4A3LJ 1MH4A 2CG4A 4X0GA 3WU1B 3MKZA 4ENNA 1MGTA 1Z0XA 3VOEA 2DDBA 2W82A 3LQRA 2DMNA 4ITVA 3TOAA 3FMSA 5B1BH 2RVCA 5BNGA 3ZQGA 2CRGA 2Y75A 3K70C 3BR6A 4M3BA 2JMWA 2CJJA 2GWRA 1D0ZA 5CQEA 2EV6A 3UR3C 2FQ4A 3COAC 4XKVA 1Z05A 2STWA 1LFPA 2DQLA 3FXMA 1P92A 2HOAA 2DTZA 2LRDA 1P4AA 5FKMA 2MBFA 3A4CA 4D7MA 2BOLA 2XPUA 3D0SA 4DGWB 1YW9A 2J5OA 5FFXA 2W7NA 2YU3A 1QQIA 4OAZA 4AIDA 1SVOA 3MAJA 3LL7A 1ZG5A 1LDDA 2A05A 1FMWA 2QQ9A 4XLHA 3JAMK 2DOEA 4M6VA 2KZGA 2M8GX 3QRFF 3ROUA 2DOAA 2K9SA 2MGQA 2WAQA 3FXJA 3DBHB 3HOVJ 3QODA 2VKHA 1UJ8A 2WWYA 1Z3YA 1REPC 1TTYA 3GFIA 1ETQA 4A3EJ 2O9LA 4LD5A 4R8HA 1JUSA 2R7RA 4S04A 2ZNZA 2BGCA 2CUFA 5J1UA 1H8AC 4P9FA 4XOTA 4UVAA 2BEOA 1QHGA 3FF5A 2Y30A 4BS9A 4BUPA 3NEUA 4KIFA 1F1ZA 4B3XA 1TWHJ 2JA2A 2ME0A 3M1CA 5FKKA 3TQNA 1S5LC 2A68F 4E7ZA 4IHTA 3BG3A 5E3NA 1MD0A 1W5SA 4A3DJ 2M34A 3I55I 3F8CA 2JWTA 2KRFA 2RNGA 1STZA 3KLOA 3JRCA 3HOSA 2CMPA 1WI9A 1JUMA 1U2WA 2H1LA 4E7SA 3S3NA 3C18A 3LAPA 1JE8A 2LH9A 5F0HA 1N78A 1P9QC 3E6BA 1MNEA 3FMQA 3QOEA 2E35A 3QPHA 4BU2A 2NRAC 3H9QA 1YJNI 2M3AA 3OYBA 4LIUA 4G6TB 2MFZA 2X48A 2R4GA 4HEA2 3UNGC 1SD6A 4P96A 1HOMA 2K4JA 1I1GA 4M6XA 3FM5A 4G7ZF 2V1UA 1R1TA 3OYHA 1OR7A 3HGYA 3E1SA 1PUEE 2VPRA 1FIAA 2COBA 1Y6IA 2Y9ZA 5E18F 3I5UA 4I0AA 1W1WE 1RR7A 3P7NA 2EZKA 5IP7J 4E7IA 3IWFA 4IHWA 1SEUA 2GA2A 2Y0SA 4WXCA 4DOZA 3TEDA 2XIGA 4RGUA 2QLZA 3WG7H 3QU6A 4YFKF 3Q9VA 3BJAA 1FBSA 3OYKA 3OWTA 3B02A 2G9WA 2AXLA 2R5ZB 4G12A 2VQGA 4II3A 2AQFA 2YSRA 3S93A 2HS5A 2R7DA 2ZMEB 3IKTA 2IJLA 4ZYHA 3LQQA 3LSHA 3RPUA 1QZZA 2CFOA 2WAQN 5EJCA 1TNSA 3ZOBA 2BW3A 4CDGA 1IV8A 2QQ8A 2Q0OA 4L5EA 2Y31A 1BR4A 2K9NA 4HBLA 3K4CA 3W6VA 2LK2A 3GTJJ 1R7JA 2HPMA 3ISPA 3MD2A 4MTEA 3R6SA 3I59A 3L09A 3T8RA 4RB1A 4LB5A 4PZJA 3IH4A 3QWLA 4BE2A 2VT3A 2HDWA 2ECCA 1VNDA 2LKPA 3F21A 4KT5C 3CQZJ 1XGOA 1MJBA 2JUGA 3EUHC 2DLLA 5LEKA 3PQJA 4Y4RA 5LHHA 2EA4A 1NG7A 1Y39A 4FASD 3QOPA 1OLTA 2M7AA 2QKMB 5GAHJ 4OOIA 3L7WA 5KAFC 3KYDB 2KHMA 1BL0A 4QLCU 1TBXA 2VKVA 1R5ID 2WV1A 2DMUA 2XGXA 3ZQQA 4XRMA 5CVIA 5DS9A 6PAXA 5F6FA 2UXXA 4IXAA 2XV4S 4Q48A 3PIPF 4HRIA 1TWAJ 2JVGA 3IC7A 1RC9A 3PNVA 5FLVA 2K86A 4FE7A 5H6RA 3ZP5A 1ZRCA 1QVTA 2NS8A 4XKBA 1P6RA 2R7QA 1YITI 4EM0B 2FRHA 3AG2H 2NNNA 3QYBA 2DU9A 5HS9A 1O3QA 4PJLA 2Y0SN 1HKQA 5FD5A 2ZCWA 3M4OJ 3SEZA 5J4YA 4C9YA 1F43A 1QPIA 2HYFA 3S1QJ 3OR1C 5LEJA 4YRVA 1U3EM 3HDDA 1WPKA 1ZELA 5ICFA 4NHJA 3BDDA 2OU2A 4PGHA 4B47A 1ZR4A 3BR3A 2JA6J 1WJFA 4EGYA 1ZTRA 2E36A 3O3KA 3DV8A 3DTKA 4M3DA 2IGMA 3BR0A 4A3FJ 3IUOA 1MDMB 3CCRI 2M87A 2FF4A 1YJWI 4ZC3A 4YFXF 1BJZA 3GTGJ 5JVTA 3S14J 1XCBA 4BXXJ 5GAGJ 4F55A 1KGSA 1MZBA 3CUQA 4XQFA 1JXSA 2IA1A 5ED4A 3HOYJ 4ESBA 2JJ7A 3BTLA 3O8HA 4CZCA 2OBPA 2JA7J 1BC8C 2FOKA 4LG0B 1BOAA 2M2EA 4DZJA 1HKSA 4I2OA 2EIKH 1LNWA 2N8GA 3RQ4A 2QF7A 1W4MA 2EILH 4E7LA 2KL4A 2GIVA 2R7VA 2EV0A 1U6GA 4UV9A 2NOGA 3ERMA 2XF5A 1YW7A 2K85A 3NRVA 4UY8I 2EIJH 3C1DA 2PFBA 2CW0F 3PNTA 4M9XA 3M8EA 3HPGA 1MJAA 4KJZA 3ECOA 3J80K 2TDXA 3H3UA 2P0WA 1IUYA 4PFOA 3G73A 1YE9A 3ABKH 1ITYA 5M5XJ 3B73A 1T98A 2OJED 3IAM2 2L7FP 4Q47A 1Z6TA 4HSRA 5KVRA 1ACIA 1S8NA 2R7UA 5FLXK 4NQWB 1QZEA 4CUGA 3JRFA 4BDZA 2QM3A 3FK7A 1TP4A 1ZG3A 2MD0A 3GVAA 2PX9A 1X4PA 5FROA 2HU9A 3I54A 4HLYA 5ICCA 2CQNA 3HRMA 1G3TA 3AFHA 3E0JB 2YUSA 3S1RJ 3OL4A 2IS6A 4DYRA 2BY3A 3HUGB 1MBGA 3L9FA 2LC2A 2F5CA 2M4KA 4NC7A 1J7KA 3LA2A 2QSGX 2YR2A 1USSA 1TZLA 1YX5A 2RGVA 1WH7A 3VEPA 5IT3A 2JUCA 4J19A 4I09A 4HQEA 3MWMA 3S32A 3F72A 1IRGA 3IAS2 1GUUA 2D5VA 1EF4A 5E3LA 2D1VA 2VJJA 5EZGA 4A3MJ 2LFBA 4IKFA 1IXSB 2BZTA 3JAMZ 4AD9A 1B6AA 3WG9A 1D1BA 2KIMA 2L7MP 4JYKA 4R1HA 5ICEA 4I6ZA 4W1UA 4UV8A 2H09A 4BAYA 1TQPA 4XRSG 1OJLA 2VE8A 3FBNB 1X58A 1W5CC 4IRGA 4E6KG 2X0LA 3DTEA 5BS6A 3I4MJ 4CICA 4BQQA 3WTXC 1FMVA 5JR3A 1K6YA 2HYGD 1GHCA 4MO7A 5BPDA 3LWFA 1B72A 1RETA 1VQ9I 1ZRDA 2XB5A 3K4BA 1JI8A 5K7ZA 3CLQA 4A0ZA 3BZCA 1D1AA 1Y1VJ 2IA2A 3BT9A 4BACA 2NS7A 4EJVA 2O6GE 4C2MJ 3H0DA 4LOCA 2XASA 5DM6F 3PJRA 2L4AA 1S72I 1D3YA 4C3HJ 1PUFB 3TL4X 3IP4B 1PVEA 1R4MB 3WTZA 4B43A 3K1NA 4ZYGA 2J5PA 5EDNA 3RQIA 3R4KA 2VIXA 4DYQA 1W5TA 5B1AH 4WX9A 4GFBA 2KIQA 3S8PA 1F9NA 1DPRA 2EZLA 2VQLA 5C4JJ 4NC8A 1TWCJ 4YEJA 4XOPA 2W85A 3ERED 1RUOA 1DU0A 2VQHA 3FKIJ 3TBIA 4KNYA 4A69C 2F6CA 2A5YB 4IQ4A 3BTIA 2M7BA 2ZNYA 2DMTA 2MG4A 4OIQF 3FXUA 4Y33A 1SD7A 1V3FA 1IN5A 2W57A 3ABUA 3DBRB 4HOBA 1FYLA 3CMEI 2F48A 5HLGA 3RZOJ 4BY1J 2QCOA 2ZXIA 3CO7C 3U21A 2PJRA 3CC2I 3LFKA 1KQ0A 1D8JA 5LGNA 2L3DA 3GX4X 2ZXWH 4CCJA 4PJ0C 1DQUA 2LG4A 3QQAA 4OIPF 4CYCB 3VYUB 2H27A 1BR2A 4U87A 4ZZDA 4XNFA 4B1RA 5KHDA 2W25A 2P6TA 2OTJI 1TW3A 4PFPA 2EJRA 2LD5A 2OAZA 3E97A 2ZMEC 4Y13A 1BA5A 1F4KA 3W6KB 2XAGA 2ESHA 3I0TA 3KP7A 1AHDP 1N75A 1B1BA 1YIOA 3L2UA 2MYSA 4QSHA 4DJAA 1J9IA 4HLXA 2P8TA 1K78B 5GTIC 4KN4X 1IGNA 4A3CJ 3FX3A 2FJ1A 1I3QJ 4JOMA 5BMZA 4DBRA 2XAJA 1IRZA 4O6JA 2F5VA 1FZPB 2OZUA 3EUAA 2HQNA 4XICA 3F9KA 4KITB 2L0KA 2BXZA 3B6AA 2BY1A 1MMNA 2B9SA 2VJ4A 2CQXA 1D5VA 2Z1DA 2ID3A 5EGOA 3J7AO 1ORKA 1EH8A 4J00A 3KPHA 5HDNA 2VT2A 4QIWN 2IP2A 4IVNA 2TRTA 3SDBA 3LSTA 1IXRC 1D5YA 2RQPA 5DCMB 2FQ3A 5M5WJ 3DEUA 2UV1A 5EZHA 3WHCA 1QNTA 4M73A 1RESA 1K4SA 3JRGA 2GXBA 1XN7A 1G8XA 3TMOA 1I39A 1MH3A 5J47A 2ZSHB 3E5UA 5L3BA 1SD5A 4A6DA 2KJBA 5D6FA 5L3CA 2V4JC 1KA8A 2DPDA 2JRMA 4HPQA 3RKWA 3RKQA 2NAZA 1J09A 2VQCA 1HSJA 1A31A 2F4IA 1K7AA 1RI7A 2H6CA 3ABLH 3DU5A 5M5YJ 3M9AA 3IH2A 2GOXB 3ML6A 3NAUA 4M74A 3EYYA 4Y3OA 4WF2A 2X85A 4XONA 1JT6A 2X4HA 4WXDA 1NK2P 5D6EA 1MW7A 1BIBA 1ENHA 1MNDA 1SVLA 3KP4A 3P9KA 1GVDA 2NOJB 2EFNA 4P55A 3U1KA 2JZYA 3E6DA 5EEHA 4RAGA 1H88C 1V5EA 2KDOA 3K4MA 4I7HA 3M7GA 4MGRA 3HRUA 1EV7A 5DD8A 5EF6A 4QPQA 2DTRA 1K6OA 4BJ5C 1X3UA 3V7CA 4BEHA 3DKWA 5F04A 4K2EA 4BJTA 1S7AA 5D5XB 2M4GA 1VF9A 2IS1A 3ZQFA 5TISC 3TO9A 1SD4A 1K79A 4XLNF 1A35A 2Y2ZA 2GQQA 3LOCA 4XN3A 3RJPA 1G6NA 4CH7A 2RREA 3OYJA 2CSOA 4KDPA 3BTJA 3M8FA 1W36C 3PUBA 2W1OA 5C4XJ 1XD7A 1E2XA 2WA0A 3R60A 2B7EA 3RKYA 4OIRF 2ME6A 4DYCA 4A3BJ 3ZQ7A 1KU3A 3ECHA 3OS1A 3JCUC 2WV0A 4ASNA 4LITA 5FJ8J 3F8MA 1BOBA 1UHWA 2MH9A 2XRLA 5HS7A 5C44J 3CJRB 5BPIA 3Q9SA 1PYVA 5ILSA 3E7LA 3OIPA 3ABMH 4KUMA 2EB7A 1FBUA 5HNFA 2DA3A 1EH7A 3J80Z 2VBZA 4UB6C 1E17A 3J81Z 3A01A 3H92A 1XTAA 2XHKA 3I59B 4KN7X 4FETA 1W0TA 2JPBA 1MIJA 2DFHA 4C3JJ 2FNPA 4F93B 3OYMA 2XAHA 3HC7A 2L54A 4CO8A 4QWQA 2CUJA 5FLXZ 2HQ5A 4G94A 1YLFA 1VZ0A 1W0UA 2L5QA 5GADJ 3ESWB 5EG0B 2E1OA 3VWBA 4ESJA 4IRHA 1Y0NA 4GCVA 4U7DA 4A3JJ 1GDTA 4BKXA 2NVQJ 2KISA 2LMDA 3HPHA 1SC7A 2DFFA 3JRHA 3DTIA 1N77A 2UUZA 3K7AJ 4LG3A 4BE0A 2I10A 3DP7A 2FBIA 3HTUA 3ZPLA 3I71A 1OCOH 3SZPA 1O57A 2DJIA 1PP7U 3C2BA 1MSFC 3FISA 4J01A 2JRTA 1A5JA 2AQEA 2ZB9A 5DM7F 2EPFA 2ESNA 5IT9K 2MABA 2LDUA 1P4WA 2E2IJ 1MKMA 2FOWA 3N97A 5HLIA 4PK4A 2LSOA 1QPMA 1TQIA 1LKXA 2Z16A 4RAZA 4V2FA 1FSHA 3D5RC 1OQYA 4HW0A 3D5SC 4BHCA 2VONA 4F7ZA 1UZCA 4QTRA 1UFMA 1W7PA 4LGWA 1TT5B 3FMRA 3SEQA 4X6AJ 3JR9A 4M3GA 1XPXA 1FJLA 5JVGF 2HOSA 2CV1A 1Z7LA 3KIOA 1HW2A 3F3XA 3HHHA 1O3RA 2VBWA 2VLAA 2DMPA 3ONQA 2XAQA 2EFOA 2QEXI 1E3OC 4FX0A 2F5DA 1I6XA 1YI2I 2DFEA 3FDYA 4EJOA 1PJRA 2EV5A 5J6XA 1H0MA 3WE2A 2KPMA 3TW7A 2OV7A 3GFLA 2B63J 3KYCB 4F92B 5HS8A 1X1BA 4ZDLA 3IKVA 1NH3A 3QYEA 4KIBA 1A04A 1IW7F 4IHVA 3WODF 5FFZA 3TGNA 1DP7P 3QYFA 1HQCA 2ELJA 1ZGAA 5K5QA 1JGGA 3CUQB 4HG2A 5CVRA 1GXQA 3JTHA 5F1RA 3GYHX 3HKZA 1SAXA 4IEJA 2H6BA 3CC4I 2V26A 3RYRA 5GPAA 2WY7Q 3BCAA 3KP6A 3PSFA 3GCMA 2ZFWA 3LFUA 2W48A 1FT9A 2LY9A 1FNNA 1HW1A 4P5OA 2Z99A 1OYIA 4L9JA 3TO6A 4KT6A 1SFOJ 3LNQA 1WJAA 5FRMA 2QQBA 1KQ8A 1ZR2A 1R71A 1B8IB 4G9YA 4U88A 4ANJA 2L9RA 4PSXA 3LSKA 3NWSA 5LRRA 1R58A 4OINF 2WY8Q 2XAUA 3DCFA 1APLC 3PL8A 3OY9A 4DQ2A 2XAFA 1HSTA 4AIKA 4OU0A 1KU9A 2G7UA 1ETOA 1SMTA 1UB9A 4M72A 2V7FA 3MMYB 1VQKI 4U0WA 4U0YA 3FXRA 5LBQA 2CGPA 1T33A 5CVVA 5KNLA 1JTXA 2K4BA 3GTLJ 1U5TC 5H2FC 2EA2A 4M9ZA 2RKHA 1EA3A 3AG3H 3VSKA 3OYIA 4BBRJ 1G2HA 1O7LA 2E2HJ 5HVQC 4ZH4F 1WH5A 1IN8A 3ABTA 5DDGA 4KFCA 3H5AA 1YIJI 2Z5UA 1XSXA 4CHUA 3L2RA 4AIHA 3DLAA 1MBEA 1ZN2A 4GXOA 2PN6A 1A6QA 1W7PD 2H94A 3S2DJ 4IOAF 1U78A 3F6OA 2EK5A 1J2XA 3BPXA 3GTMJ 1S3JA 3VPRA 3TO7A 3L2QA 4MIMA 2ZXJA 3WU2C 3JW4A 4MTDA 3MEXA 2K40A 1D0XA 3WTWC 3CCSI 1KYZA 4RGSA 1IRXA 1SAUA 1JT0A 3D1NI 1UAAA 2HKXA 2O03A 4XORA 3U9GA 1UG0A 1FX7A 2DDAA 1DDNA 2PBIA 3RKXA 3OYAA 2XGEA 5F1JA 1S7EA 1QHHD 3R61A 4Q5SF 1X3WB 1Y56A 2P5LC 1X4OA 4IRIA 1LVAA 2M8EA 2WC2A 4A0YA 2CQKA 4ESFA 2K9MA 2WADA 3CJTB 1DP3A 4FT8A 2GBYA 3NQOA 3CCVI 5DV5A 1SFUA 3H3ZA 4NB5A 5K7FA 1ZREA 2K9LA 3DU6A 3ASNH 2M5WA 1H9TA 1RR8C 4XKCA 3OSFA 2M30A 2XF7A 4FE4A 1I6HJ 3CCYA 2X6OA 3ZN0A 1FY7A 4M71A 1R36A 1X1AA 1LE8A 3A02A 2FEZA 2KRCA 1HDDC 3PFYA 3WTSC 2WAFA 4B3AA 2BY0A 3HEFA 4YIIA 1KQ9A 2Y69H 1U9NA 1U8BA 1AKHA 5D4SA 1ETWA 1OISA 2NYXA 1Z1DA 2O0YA 4JQFA 2L2OA 4YELA 5H6QA 1MNMC 2IXSA 1Z9CA 2LVSA 1VFCA 1L3LA 5JI6A 1E3HA 5ERIA 1OR7C 2EIMH 4RB2C 3GFMA 2A3SA 4ZDOA 3W2WA 3OS2A 1I5ZA 4HF1A 1NTCA 2I8DA 1VQMI 4BXUA 4L9VA 4L5JA 4EVIA 3CMMA 2MC4A 4TV7A 3RPUD 3GLXA 1UG2A 2E34A 4D1QA 2Q2EA 1TQMA 3JSPA 1YS7A 4RS8A 5H20A 1ZLKA 4A3KJ 2GAUA 2FUG2 4XBFA 3N4MA 2AHQA 4DZPA 3ULQB 4PGGA 1R9TJ 4F91B 1ETKA 1KU2A 2Q8KA 4BBSJ 3M1EA 2NNYA 1YJ9I 3IL2A 3GEZA 3MN2A 3LSPA 2L9NA 1IC8A 3HSFA 1T2KA 2XDVA 1Z21A 3V8KA 4N4OB 4YIRX 5CPRB 3F8BA 3OOUA 3OYFA 2CV2A 3PIOF 4D5CA 3MKYB 4CYDA 4HF0A 4MHGA 1XS9A 3CDLA 4XRSA 2HZDA 4BNCA 5EGOB 2OUMA 2HYJA 2DT6A 4CCKA 4CCOA 4KMUX 2YX4A 4A3GJ 2DK8A 2NVYJ 3BR5A 1R6RA 2V6CA 2KLOA 1IDZA 5LFAA 1SANA 4HQMA 5CQGA 3I4PA 1Z6RA 4E7KA 1HW5A 5DTDA 2MA3A 3AG1H 1ONVA 3W3CA 1B9MA 4GGGA 4HDVA 2V1DA 2HZTA 1XB4A 3OIQA 2XROA 3V42A 5B3SH 4AU7A 1T39A 3MVPA 2ETHA 1YW8A 2QA4I 3ZMZA 3BLYA 2DW4A 4XKWA 1YRNA 1AOYA 3CMYA 4GYIA 3DEEA 3TOBA 3OV8A 4CXFA 1MSEC 4XLFA 5L3DA 4EV0A 3S2HJ 1LEBA 2H8WA 3E6MA 2JK3A 1I3AA 1F36A 1U8RA 1J5YA 2CYYA 3IRRA 5E1ZB 3V4GA 1T0FA 1VQ4I 3SJMA 3H1CA 1BI2A 1MBFA 3T8TA 1RIOH 2KQRA 1LFUP 4ETSA 1A36A 3U2RA 4MNUA 3F0CA 2BE5F 3A2KA 2ZJ2A 3HZJA 3CESA 4YG2F 2FNAA 4BEHB 3OYCA 3P9CA 4RB0A 3BQZA 4I02A 4B8XA 2BHZA 3ZMVA 5B5EC 3PQKA 3EETA 1HXDA 1P2FA 4RDUA 1FOXA 1T95A 2FSWA 4AUXA 4EEFG 4L5IA 1IV6A 4JBAA 2DT7B 2MLGA 4EM2A 2OPTA 4IOCF 2MLKA 1Y0UA 1Z7UA 2JSPA 4Y52J 1Y1WJ 3PO3J 2LBFA 1HKTA 3DXJF 1WKMA 5FGMA 3CUQC 4EJWA 2IEKA 3Q3SA 4O3MA 1RZ4A 4HA8A 3W6JB 2IVMA 1JTYA 1MMDA 1WJ5A 1K83J 1BIAA 5CLSA 3G4SI 4IJAA 4JP0A 1LB2A 2ICWG 2KIUA 1T56A 1ZQ3P 1YX3A 3PO2J 2F4OB 3MZ8A 5DUIA 3GF2A 3L00A 2ZJQF 1FP1D 3GTKJ 2QBYA 3A0HC 2IT0A 4II2A 1BJAA 3IH3A 3GMEA 2OTLI 2IW5A 5HOOA 5IOYA 1I1SA 1OPCA 1IZ1A 4DNCA 4O5VA 5IP9J 2ELHA 3A01B 5HODA 5AIPA 3G2BA 2ZXHA 1G59A 2JPCA 1B4AA 4XK4A 4BQNA 2Z9OA 4WWCA 2PEXA 5DD4A 3H5NA 2LNBA 4UXNA 2B0LA 2HPIA 1KYWA 1WJEA 3G1MA 4M6YA 3WTTC 1S9HA 1XX5A 1Z77A 3FXLA 3K6GA 3QPTA 2YPRA 2ZKZA 1QU3A 5LGUA 2HGCA 3GBGA 4B09A 3OMYA 1FOKA 1FIPA 1FSEA 2K7LA 4PSWA 2FBHA 2L7ZA 2LOOA 5LHGA 4KYWA 2RV8A 2DT5A 2VODA 2K27A 5EYRA 3BG7A 2DXIA 3CP2A 1BI3A 3K69A 1MDMA 5HLHA 5E8GA 2O8XA 2EQRA 2K5CA 3KYLA 1JGSA 4M3FA 1SFEA 4R79A 1JKRC 4G6QA 4A12A 1YTYA 4GYGA 1YHQI 2XUBA 4LIVA 4G7HF 2LYCA 3LA7A 3ZGKA 3S15J 2IA0A 5GPCA 3V8LA 3C2HA 4XM3A 1I27A 1RKWA 1W7PB 1O4XA 1EH6A 2OD5A 3GZ5A 3LMMA 1XDSA 2NS0A 3LSMA 1OMIA 3QAHA 5D5VB 5D4RA 2AS5F 3K1PA 2P7VB 3O6BB 1FOWA 3HIFA 4EJUA 2QZ8A 4NDLA 2V6EA 4UHTA 1XDUA 5D8KB 5FLMJ 2E19A 2F5EA 3CJQB 2UZKA 2HOEA 3HOUJ 1ZLJA 5J3LA 2PQ8A 2VE9A 2M0MA 3RI4A 2NVUB 3ZN1A 1IN7A 1ZKGA 4XLCA 1LVKA 2HVQA 2IAIA 4UUSA 5IYCJ 1FPQA 1S6LA 3ZXSA 3F8NA 1OCZH 3ZMSA 4LK0F 2ISZA 3LSIA 1J75A 2VXDA 4C2TA 1WVRA 2COMA 3KFWX 2M45A 3E5XA 1CGPA 1HLVA 3SXYA 4BXFA 4MLOA 1OCCH 3CCJI 3QP5A 4P1WA 2D2WA 3DPUA 3QU3A 2E1MB 3EUKL 2H1KA 2E7WA 3CTAA 3KEYA 4OMYA 4FX4A 3BWGA 2HQRA 1DGRM 1GXPA 1IRFA 3TDUC 2FX0A 2ID6A 3ZCOA 2Y9YA 4L9TA 4BH9A 3AKZA 1LUJB 2Z2SB 1FTZA 4AIJA 1G3YA 3G6EI 2H8RA 1D1CA 3FWEA 2IGOA 1XMAA 1J59A 4AC0A 4EJTA 5DUKA 4OAYA 3I64A 1G4DA 4AM3A 2XRNA 2XSDC 4BHBA 4EGZA 5E3OA 5LRSA 3I3LA 1WHUA 3H5RA 4EM1A 3F23A 4IL6C 2DCEA 4NNJA 2W00A 5DYMA 4S05A 3JREA 1X19A 1BI1A 3OS0A 3L2VA 1WRJA 2G0EA 5J1RA 5IYDJ 2V79A 4CCMA 2TCTA 2M9HA 2E60A 4YIFA 5JHUA 2CWEA 1X1DA 4ENJA 1R23A 2VBYA 5KAIC 1Z67A 1VQ8I 2RNJA 3VYSB 3ZR8X 3FXKA 4MEYF 2Y48A 3HHGA 5K5RA 1YO5C 3DFGA 5K5OA 2JSCA 3CMAI 4ZTJA 2EFQA 3LAJA 3VYTB 3CZ6A 4GRIA 1UCRA 4X1EA 1V55H 2BVLA 3CCLI 4RMNA 2M1BA 2VOPA 2DMQA 3KZZA 3R0AA 2HWVA 4HX4A 3I9V2 2BW3B 2XF6A 1LPQA 5L3GA 2RN7A 4RM3A 3L1PA 3KZIC 1TW2A 2VN2A 5HLTA 1MBHA 2K3FA 3CP8A 1YYVA 2LREA 2JT1A 2R7XA 1IF1A 3GTOJ 2BV6A 4HV5A 2QSFX 4CZZA 3CDHA 5CKTA 3G1OA 3VFZA 4E4HA 2Z3YA 2FA5A 3SZGA 1BN5A 3RCOA 1LJ9A 1PDNC 4RM2A 1K4TA 2KT0A 1Y8RB 2KZVA 2A61A 3JRAA 2ECBA 2E5ZA 1ZGWA 1M1EB 5KK1A 2KIFA
chains in the Genus database with same CATH topology
4UVBA 5D5WB 4WCGA 2UXNA 2FE3A 4LK1F 2CO5A 3REOA 3ZMUA 2HDCA 3KCCA 1OKRA 2DI3A 3V7RA 2DQRA 1BBYA 1U5TA 4Q4ZF 3WGGA 3F22A 2CFXA 1SMYF 1MJ9A 2ACJA 1K78A 1GVJA 1FP2A 1XSDA 4LB6B 3EQLF 1WQ2A 2QWWA 4YFNF 2WTEA 3FXQA 1RNLA 4BHPA 5L3FA 4XLPF 3GXOA 1OYWA 1XMKA 2FU4A 2DPUA 3L2CA 5D5UB 1O3TA 3WU0A 4KIGA 3AAFA 4MEXF 5DCMA 5LGTA 3MZYA 3EUHA 5ICGA 4PDKA 5LLQA 3SFZA 3KETA 3G3ZA 4A5MA 4FHTA 3K1MA 4I98B 2DK5A 1ZRFA 3DPLC 1R22A 5E17F 3V7SA 2EWNA 5L3EA 4A5NA 3CLOA 4N0BA 2DFIA 1XGSA 2MH2A 2R3SA 3BOQA 3WTVC 2HR3A 2A6EF 2D45A 3K2ZA 2P7CB 4GO1A 3KEQA 2OA4A 5F64A 3RDIA 3JTGA 4OMZA 3QP6A 4XSXF 4CGZA 3TDZC 4LJZF 1JHHA 2O3FA 5CYVA 4HZFA 4RAYA 2E1NA 2STTA 1R00A 3CJNA 1R1UA 2PMUA 3RIRA 1XGNA 1SFXA 2VOOA 1BC7C 3KP5A 2ADUA 2ZO4A 1WWXA 1ZGJA 1NHAA 2V9VA 3IRQA 3BY6A 2PMHA 3T1BA 1VTNC 4ENMA 1USTA 4JK1X 1TLHB 3GFJA 2RC4A 4XRFA 1DUXC 2FXAA 4OIOF 2YX7A 5FO5A 1YFHA 1S7OA 2FMYA 3HSRA 1CF7A 4UNOA 3BROA 1O7FA 2GZWA 3GUDA 1G3SA 3EYIA 2LF7A 1FC3A 2R7FA 3BJOA 5E8IA 5HDKA 4U7BA 2W84A 3T0YA 2A6HF 1ZG1A 2HFHA 3MCZA 1T38A 2MD5A 4G6DA 4HF2A 1YQAA 2L02A 2VC1A 4L0ZB 4WXHA 3HOTA 1G3WA 4HV6A 2QBYB 2MC3A 1B9NA 1J0RA 3SQNA 3V8JA 3E5QA 3F6VA 1D8KA 3IHUA 5FB2A 1DPUA 1YG2A 2LF8A 1O3SA 3GO5A 4UVCA 4I0BA 2VC0A 1LDKB 5ILVA 3BPVA 2W24A 4KA4A 3WTUC 2G7HA 2QENA 1ZARA 3MFKA 2K02A 4LLGF 5FD6A 2XKPA 2A07F 4BQAA 2F5FA 4ZYDA 4HDUA 3MQ0A 1FLIA 2DO7A 3KE2A 5TJJA 3RPQA 3FHZA 3TKYA 2OQGA 2VXZA 4ZZLA 1XSVA 1S29A 1BM9A 2QQAA 2PG4A 2D1HA 2P5KA 4L9NA 1ODDA 3BJ6A 2PLYA 1LDJA 1IN4A 1F5TA 3OOPA 5HDGA 3WGHA 2BBYA 2DAOA 1JHFA 2KKOA 3J81K 5A2QK 1R1VA 3LA3A 1ZAOA 3O2PE 5TRDA 4L0YB 1LQ1A 4MQVA 4A0XA 5IT9Z 4A2UA 4XSZF 5J8CA 4A6EA 5ILUA 2PJPA 4Y15A 2ZMEA 4P9UA 1QZYA 4HAMA 3K9TA 1ULYA 3RYPA 1ON2A 3KZYA 4HYEA 5D8LB 5EEGA 4MQ9F 5BQTA 2P4WA 4I01A 1T6SA 4AVPA 4UUVA 3GZ6A 3I58A 4ON0A 3CO6C 4KICA 4PCQA 3HRSA 3BZ6A 3JSOA 3IWZA 3HTSB 3T5XA 1RUNA 5E1WA 2VBXA 3VB2A 2P5VA 1KU7A 4IPAA 2HTJA 3HYIA 5E20A 5AIQA 4HX7A 2IPQX 3E6CC 4IF4A 2L01A 4LFUA 4ENKA 1OYYA 2Y0MA 1TNTA 2ISYA 1ZH5A 2HKOA 5CVJA 5J8FA 3HSEA 1V4RA 3GW2A 2HTSA 1B59A 3D5LA 3RTRA 2KJCA 2QVOA 1UHMA 4D0PA 1AWCA 1FWZA 2DBBA 2E1CA 3DQVC 2XVCA 2GA1A 1ZYRF 4BYYA 4LLNA 1QGPA 3P9IA 5LHIA 1U5TB 1Z91A 1WSUA 2FBKA 3PFIA 3K0LA 4LG0A 2OZ6A 1P4XA 1QO0D 4AWXB 1IN6A 2QUFA 1HBXG 5JFRA 1FYMA 1LEAA 1R5HA 1ZHFA 3WGIA 5CJ9A 4RB3C 4WK8F 5DEQA 5DCFA 2IRFG 2RDPA 1PP8F 2ZBKA 3Q5FA 4EMSA 4N9HA 4G7OF 2O61A 3C7JA 2FMLA 3WE3A 1YS6A 4NQWA 2QYOA 2XKOA 4U0VA 1Q1HA 3U1DA 2UWMA 2EFPA 2BYVE 4RGXA 1FBQA 2JTVA 3ZMTA 4M9SA 5CVUA 2F2EA 3KP3A 3KLNA 4Z2YA 3HUGA 3S2WA 2PI0A 1QBJA 3R0JA 3EDPA 4E70A 3E3VA 1FYKA 1C0WA 5K1YA 3F8FA 4LLLA 3KEOA 4Y17A 4HX8A 4G8XA 1IAWA 2A69F 4KMFA 3KP2A 2C6YA 4IHSA 2L4MA 4N9IA 4ZYEA 2V1XA 3SZTA 2E7XA 4H0EA 1XGMA 2OQRA 5AONA 3FZVA 2HEOA 4LMYA 4EQQA 3GWZA 3ZMDA 2GXGA 3DF8A 1IXCA 2Z33A 3C3WA 3HRTA 1XCVA 4RGRA 3I53A 3FM3A 1CF7B 3DPTA 3SHFA 3ELKA 3WTYC 5BOXA 5A2QZ 3BP8A 5E1XA 3MZHA 1H9GA 3CUOA 1R5GA 2EFWA 1ON1A 1BI0A 4L18B 1L0OC 3VODA 2P6SA 2CG4A 3WU1B 4ENNA 1MGTA 3VOEA 3TOAA 3LQRA 3FMSA 2RVCA 2Y75A 2GWRA 2EV6A 3COAC 1Z05A 2STWA 2DQLA 1P92A 1P4AA 2MBFA 3D0SA 1YW9A 2J5OA 5FFXA 2YU3A 1QQIA 3MAJA 1ZG5A 1LDDA 2QQ9A 3JAMK 3QRFF 3ROUA 2WWYA 1REPC 1TTYA 3GFIA 4LD5A 4R8HA 4S04A 2ZNZA 2BGCA 4P9FA 4UVAA 2BEOA 3FF5A 3NEUA 4KIFA 1F1ZA 3TQNA 2A68F 4IHTA 1MD0A 1W5SA 3F8CA 2KRFA 1STZA 3KLOA 3HOSA 1WI9A 1U2WA 3C18A 3LAPA 1JE8A 3E6BA 3FMQA 3QPHA 2NRAC 1SD6A 4P96A 2K4JA 1I1GA 4M6XA 3FM5A 4G7ZF 2V1UA 1R1TA 1OR7A 1PUEE 5E18F 3I5UA 4I0AA 3P7NA 3IWFA 2GA2A 4WXCA 2XIGA 4RGUA 2QLZA 3QU6A 4YFKF 3Q9VA 3BJAA 1FBSA 3B02A 2G9WA 2AXLA 2YSRA 2HS5A 2R7DA 2ZMEB 3IKTA 2IJLA 4ZYHA 3LQQA 3RPUA 1QZZA 1TNSA 4CDGA 2Q0OA 4HBLA 1R7JA 3ISPA 4MTEA 3R6SA 3I59A 3L09A 3T8RA 4RB1A 4LB5A 4PZJA 2VT3A 3F21A 2LKPA 4KT5C 1XGOA 1MJBA 2DLLA 5LEKA 3PQJA 5LHHA 2EA4A 3QOPA 4OOIA 3L7WA 4QLCU 1TBXA 2XGXA 5CVIA 6PAXA 5F6FA 2UXXA 4IXAA 2XV4S 4Q48A 3IC7A 2K86A 5H6RA 3ZP5A 1ZRCA 1P6RA 4EM0B 2FRHA 2NNNA 2DU9A 5HS9A 1O3QA 1HKQA 5FD5A 2ZCWA 2HYFA 5LEJA 1U3EM 5ICFA 4NHJA 3BDDA 2OU2A 4PGHA 4EGYA 3O3KA 3DV8A 1MDMB 2M87A 2FF4A 4YFXF 5JVTA 1XCBA 1KGSA 1MZBA 3CUQA 1JXSA 2IA1A 5ED4A 4ESBA 2OBPA 1BC8C 2FOKA 4LG0B 1BOAA 4I2OA 1HKSA 1LNWA 1W4MA 2GIVA 2EV0A 1U6GA 4UV9A 1YW7A 3NRVA 3C1DA 2PFBA 2CW0F 4M9XA 3M8EA 1MJAA 3ECOA 3J80K 2TDXA 3H3UA 1IUYA 3G73A 3B73A 1T98A 4Q47A 1Z6TA 5KVRA 1S8NA 5FLXK 2QM3A 1ZG3A 3GVAA 3I54A 4HLYA 5ICCA 3HRMA 1G3TA 3L9FA 2F5CA 1J7KA 3LA2A 2YR2A 1USSA 2RGVA 3VEPA 5IT3A 4I09A 4HQEA 3MWMA 3F72A 1IRGA 2D1VA 1IXSB 3JAMZ 4AD9A 1B6AA 3WG9A 2KIMA 4R1HA 5ICEA 4UV8A 2H09A 4BAYA 1TQPA 2VE8A 4IRGA 2X0LA 5BS6A 4CICA 3WTXC 5JR3A 2HYGD 1GHCA 5BPDA 3LWFA 1ZRDA 4A0ZA 2O6GE 2IA2A 4EJVA 2XASA 2L4AA 1D3YA 3WTZA 4ZYGA 3K1NA 2J5PA 3R4KA 4WX9A 1W5TA 1F9NA 1DPRA 2W85A 3ERED 1RUOA 4KNYA 2A5YB 2ZNYA 4OIQF 3FXUA 1SD7A 1V3FA 1IN5A 2W57A 3ABUA 4HOBA 1FYLA 5HLGA 3CO7C 3LFKA 1KQ0A 1D8JA 5LGNA 2L3DA 3GX4X 4OIPF 2H27A 4ZZDA 2W25A 2P6TA 1TW3A 2EJRA 2OAZA 3E97A 4Y13A 1F4KA 3W6KB 2XAGA 2ESHA 3I0TA 3KP7A 1B1BA 1YIOA 1J9IA 4HLXA 2P8TA 1K78B 4KN4X 3FX3A 5BMZA 2XAJA 4O6JA 1FZPB 2OZUA 2HQNA 1D5VA 3J7AO 1EH8A 5HDNA 2VT2A 2IP2A 4IVNA 3LSTA 1IXRC 2RQPA 5DCMB 2FQ3A 3DEUA 1QNTA 4M73A 2GXBA 1XN7A 5L3BA 3E5UA 1SD5A 4A6DA 2KJBA 5D6FA 5L3CA 1KA8A 2DPDA 3RKWA 2NAZA 1HSJA 1K7AA 1RI7A 2H6CA 3M9AA 3ML6A 4M74A 3EYYA 4WF2A 2X4HA 4WXDA 5D6EA 1BIBA 3P9KA 3KP4A 2EFNA 4P55A 2JZYA 3E6DA 5EEHA 4I7HA 3M7GA 4MGRA 3HRUA 1EV7A 5DD8A 2DTRA 1K6OA 1X3UA 3V7CA 3DKWA 4K2EA 1S7AA 5D5XB 1K79A 3TO9A 1SD4A 4XLNF 2GQQA 3RJPA 1G6NA 4KDPA 2CSOA 3M8FA 1XD7A 1E2XA 3R60A 3RKYA 4OIRF 3ZQ7A 1KU3A 3ECHA 2WV0A 4ASNA 3F8MA 1UHWA 2MH9A 5HS7A 5BPIA 3Q9SA 5ILSA 4KUMA 2EB7A 1FBUA 1EH7A 3J80Z 2VBZA 1E17A 3J81Z 3H92A 2XHKA 3I59B 4KN7X 2JPBA 2FNPA 2XAHA 4CO8A 2L54A 4QWQA 5FLXZ 4G94A 1YLFA 4ESJA 4IRHA 4GCVA 4U7DA 3DP7A 2FBIA 3HTUA 3ZPLA 3I71A 3SZPA 1O57A 1PP7U 2JRTA 5IT9K 2ESNA 2LDUA 1P4WA 1MKMA 3N97A 5HLIA 4RAZA 2LSOA 1QPMA 1TQIA 1FSHA 4HW0A 2VONA 4BHCA 4F7ZA 1UFMA 1W7PA 4LGWA 3FMRA 1HW2A 3F3XA 3HHHA 1O3RA 2VBWA 2XAQA 2EFOA 4FX0A 2F5DA 1I6XA 4EJOA 2EV5A 5J6XA 1H0MA 3WE2A 3GFLA 5HS8A 3IKVA 4KIBA 1A04A 1IW7F 3WODF 5FFZA 3TGNA 1DP7P 1HQCA 1ZGAA 5K5QA 3CUQB 5CVRA 1GXQA 3JTHA 5F1RA 3GYHX 1SAXA 2H6BA 3RYRA 3KP6A 2ZFWA 1FT9A 1FNNA 1HW1A 4P5OA 2Z99A 1OYIA 4L9JA 3TO6A 2QQBA 1KQ8A 4G9YA 4U88A 5LRRA 1R58A 4OINF 4DQ2A 2XAFA 1HSTA 4AIKA 4OU0A 1KU9A 2G7UA 1SMTA 1UB9A 4M72A 4U0WA 4U0YA 3FXRA 5LBQA 2CGPA 5CVVA 2K4BA 1U5TC 2EA2A 4M9ZA 2RKHA 1O7LA 5HVQC 4ZH4F 3ABTA 1IN8A 5DDGA 4KFCA 2Z5UA 1XSXA 4CHUA 4AIHA 1ZN2A 4GXOA 2PN6A 1W7PD 2H94A 1U78A 3F6OA 2EK5A 1J2XA 3BPXA 1S3JA 3TO7A 2ZXJA 3JW4A 4MTDA 3MEXA 3WTWC 1KYZA 4RGSA 2HKXA 2O03A 3U9GA 1FX7A 1DDNA 2PBIA 3RKXA 3R61A 4Q5SF 2P5LC 4IRIA 1LVAA 2M8EA 2WC2A 4A0YA 2CQKA 4ESFA 4FT8A 3NQOA 5DV5A 1SFUA 3H3ZA 4NB5A 1ZREA 2M5WA 1H9TA 2M30A 3ZN0A 1FY7A 4M71A 1R36A 2FEZA 3WTSC 4YIIA 1KQ9A 5D4SA 2NYXA 1Z1DA 2O0YA 4JQFA 5H6QA 1Z9CA 1L3LA 5JI6A 5ERIA 4RB2C 3GFMA 2A3SA 1I5ZA 4HF1A 4BXUA 4L9VA 4L5JA 4EVIA 4TV7A 3GLXA 2Q2EA 1TQMA 3JSPA 1YS7A 4RS8A 5H20A 1ZLKA 2GAUA 4XBFA 3N4MA 3ULQB 4PGGA 1KU2A 2Q8KA 3M1EA 2NNYA 3IL2A 3GEZA 3HSFA 1T2KA 3V8KA 3F8BA 4CYDA 4HF0A 4MHGA 4BNCA 4KMUX 2YX4A 2DK8A 2V6CA 4HQMA 3I4PA 1Z6RA 1HW5A 2MA3A 1ONVA 1B9MA 4GGGA 4HDVA 2V1DA 2HZTA 1XB4A 2XROA 1T39A 2ETHA 1YW8A 3ZMZA 2DW4A 1AOYA 4GYIA 3TOBA 3OV8A 4CXFA 5L3DA 4EV0A 1LEBA 3E6MA 1U8RA 1J5YA 2CYYA 3IRRA 5E1ZB 3V4GA 1T0FA 1BI2A 1RIOH 3T8TA 4ETSA 3U2RA 4MNUA 2BE5F 2ZJ2A 4YG2F 2FNAA 3P9CA 4RB0A 4I02A 4B8XA 3ZMVA 3PQKA 3EETA 1HXDA 1P2FA 2FSWA 4L5IA 4JBAA 2MLGA 4EM2A 2MLKA 1Y0UA 1Z7UA 1HKTA 3DXJF 1WKMA 5FGMA 3CUQC 4EJWA 4O3MA 1RZ4A 4HA8A 3W6JB 2IVMA 5CLSA 1BIAA 4IJAA 1LB2A 2KIUA 5DUIA 3GF2A 3L00A 1FP1D 2QBYA 2IT0A 1BJAA 2IW5A 5HOOA 1I1SA 1OPCA 1IZ1A 4DNCA 4O5VA 2ELHA 5AIPA 2Z9OA 2JPCA 1B4AA 4WWCA 2PEXA 5DD4A 2LNBA 4UXNA 2B0LA 1KYWA 4M6YA 3WTTC 3QPTA 2YPRA 2ZKZA 5LGUA 2HGCA 4B09A 1FOKA 1FSEA 2K7LA 2FBHA 5LHGA 4KYWA 2RV8A 2DT5A 2VODA 2K27A 1BI3A 3K69A 1MDMA 5HLHA 5E8GA 2O8XA 1JGSA 4R79A 1SFEA 4G6QA 4A12A 1YTYA 4GYGA 2XUBA 4G7HF 3LA7A 2IA0A 3V8LA 1I27A 1W7PB 5D5VB 1EH6A 2OD5A 3GZ5A 1XDSA 2NS0A 3QAHA 1OMIA 5D4RA 2AS5F 3K1PA 2P7VB 3O6BB 3HIFA 4EJUA 2QZ8A 4UHTA 1XDUA 5D8KB 2F5EA 2UZKA 2HOEA 1ZLJA 2PQ8A 2VE9A 3RI4A 3ZN1A 1IN7A 1FPQA 1S6LA 3F8NA 3ZMSA 4LK0F 2ISZA 1J75A 2COMA 3KFWX 2M45A 3E5XA 1CGPA 3SXYA 3QP5A 2D2WA 3QU3A 2E7WA 3CTAA 4OMYA 4FX4A 3BWGA 2HQRA 1GXPA 1IRFA 3TDUC 4L9TA 4BH9A 4AIJA 1G3YA 3FWEA 1XMAA 1J59A 4EJTA 5DUKA 3I64A 1G4DA 2XRNA 4BHBA 4EGZA 5LRSA 4EM1A 3F23A 5DYMA 4S05A 1BI1A 1WRJA 2V79A 4YIFA 5JHUA 2CWEA 4ENJA 1R23A 2VBYA 2RNJA 4MEYF 2Y48A 3HHGA 5K5RA 1YO5C 3DFGA 5K5OA 2JSCA 2EFQA 3LAJA 1UCRA 2M1BA 2VOPA 3KZZA 3R0AA 2HWVA 4HX4A 5L3GA 2RN7A 1TW2A 2VN2A 1YYVA 2JT1A 1IF1A 2BV6A 4HV5A 4CZZA 3CDHA 3VFZA 2Z3YA 2FA5A 1BN5A 1LJ9A 1PDNC 2A61A 5KK1A 2KIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVB A;  5D5W B;  4WCG A;  2UXN A;  2FE3 A;  4LK1 F;  2CO5 A;  3REO A;  3ZMU A;  2HDC A;  3KCC A;  1OKR A;  2DI3 A;  3V7R A;  2DQR A;  1BBY A;  1U5T A;  4Q4Z F;  3WGG A;  3F22 A;  2CFX A;  1SMY F;  1MJ9 A;  2ACJ A;  1K78 A;  1GVJ A;  1FP2 A;  1XSD A;  4LB6 B;  3EQL F;  1WQ2 A;  2QWW A;  4YFN F;  2WTE A;  3FXQ A;  1RNL A;  4BHP A;  5L3F A;  4XLP F;  3GXO A;  1OYW A;  1XMK A;  2FU4 A;  2DPU A;  3L2C A;  5D5U B;  1O3T A;  3WU0 A;  4KIG A;  3AAF A;  4MEX F;  5DCM A;  5LGT A;  3MZY A;  3EUH A;  5ICG A;  4PDK A;  5LLQ A;  3SFZ A;  3KET A;  3G3Z A;  4A5M A;  4FHT A;  3K1M A;  4I98 B;  2DK5 A;  1ZRF A;  3DPL C;  1R22 A;  5E17 F;  3V7S A;  2EWN A;  5L3E A;  4A5N A;  3CLO A;  4N0B A;  2DFI A;  1XGS A;  2MH2 A;  2R3S A;  3BOQ A;  3WTV C;  2HR3 A;  2A6E F;  2D45 A;  3K2Z A;  2P7C B;  4GO1 A;  3KEQ A;  2OA4 A;  5F64 A;  3RDI A;  3JTG A;  4OMZ A;  3QP6 A;  4XSX F;  4CGZ A;  3TDZ C;  4LJZ F;  1JHH A;  2O3F A;  5CYV A;  4HZF A;  4RAY A;  2E1N A;  2STT A;  1R00 A;  3CJN A;  1R1U A;  2PMU A;  3RIR A;  1XGN A;  1SFX A;  2VOO A;  1BC7 C;  3KP5 A;  2ADU A;  2ZO4 A;  1WWX A;  1ZGJ A;  1NHA A;  2V9V A;  3IRQ A;  3BY6 A;  2PMH A;  3T1B A;  1VTN C;  4ENM A;  1UST A;  4JK1 X;  1TLH B;  3GFJ A;  2RC4 A;  4XRF A;  1DUX C;  2FXA A;  4OIO F;  2YX7 A;  5FO5 A;  1YFH A;  1S7O A;  2FMY A;  3HSR A;  1CF7 A;  4UNO A;  3BRO A;  1O7F A;  2GZW A;  3GUD A;  1G3S A;  3EYI A;  2LF7 A;  1FC3 A;  2R7F A;  3BJO A;  5E8I A;  5HDK A;  4U7B A;  2W84 A;  3T0Y A;  2A6H F;  1ZG1 A;  2HFH A;  3MCZ A;  1T38 A;  2MD5 A;  4G6D A;  4HF2 A;  1YQA A;  2L02 A;  2VC1 A;  4L0Z B;  4WXH A;  3HOT A;  1G3W A;  4HV6 A;  2QBY B;  2MC3 A;  1B9N A;  1J0R A;  3SQN A;  3V8J A;  3E5Q A;  3F6V A;  1D8K A;  3IHU A;  5FB2 A;  1DPU A;  1YG2 A;  2LF8 A;  1O3S A;  3GO5 A;  4UVC A;  4I0B A;  2VC0 A;  1LDK B;  5ILV A;  3BPV A;  2W24 A;  4KA4 A;  3WTU C;  2G7H A;  2QEN A;  1ZAR A;  3MFK A;  2K02 A;  4LLG F;  5FD6 A;  2XKP A;  2A07 F;  4BQA A;  2F5F A;  4ZYD A;  4HDU A;  3MQ0 A;  1FLI A;  2DO7 A;  3KE2 A;  5TJJ A;  3RPQ A;  3FHZ A;  3TKY A;  2OQG A;  2VXZ A;  4ZZL A;  1XSV A;  1S29 A;  1BM9 A;  2QQA A;  2PG4 A;  2D1H A;  2P5K A;  4L9N A;  1ODD A;  3BJ6 A;  2PLY A;  1LDJ A;  1IN4 A;  1F5T A;  3OOP A;  5HDG A;  3WGH A;  2BBY A;  2DAO A;  1JHF A;  2KKO A;  3J81 K;  5A2Q K;  1R1V A;  3LA3 A;  1ZAO A;  3O2P E;  5TRD A;  4L0Y B;  1LQ1 A;  4MQV A;  4A0X A;  5IT9 Z;  4A2U A;  4XSZ F;  5J8C A;  4A6E A;  5ILU A;  2PJP A;  4Y15 A;  2ZME A;  4P9U A;  1QZY A;  4HAM A;  3K9T A;  1ULY A;  3RYP A;  1ON2 A;  3KZY A;  4HYE A;  5D8L B;  5EEG A;  4MQ9 F;  5BQT A;  2P4W A;  4I01 A;  1T6S A;  4AVP A;  4UUV A;  3GZ6 A;  3I58 A;  4ON0 A;  3CO6 C;  4KIC A;  4PCQ A;  3HRS A;  3BZ6 A;  3JSO A;  3IWZ A;  3HTS B;  3T5X A;  1RUN A;  5E1W A;  2VBX A;  3VB2 A;  2P5V A;  1KU7 A;  4IPA A;  2HTJ A;  3HYI A;  5E20 A;  5AIQ A;  4HX7 A;  2IPQ X;  3E6C C;  4IF4 A;  2L01 A;  4LFU A;  4ENK A;  1OYY A;  2Y0M A;  1TNT A;  2ISY A;  1ZH5 A;  2HKO A;  5CVJ A;  5J8F A;  3HSE A;  1V4R A;  3GW2 A;  2HTS A;  1B59 A;  3D5L A;  3RTR A;  2KJC A;  2QVO A;  1UHM A;  4D0P A;  1AWC A;  1FWZ A;  2DBB A;  2E1C A;  3DQV C;  2XVC A;  2GA1 A;  1ZYR F;  4BYY A;  4LLN A;  1QGP A;  3P9I A;  5LHI A;  1U5T B;  1Z91 A;  1WSU A;  2FBK A;  3PFI A;  3K0L A;  4LG0 A;  2OZ6 A;  1P4X A;  1QO0 D;  4AWX B;  1IN6 A;  2QUF A;  1HBX G;  5JFR A;  1FYM A;  1LEA A;  1R5H A;  1ZHF A;  3WGI A;  5CJ9 A;  4RB3 C;  4WK8 F;  5DEQ A;  5DCF A;  2IRF G;  2RDP A;  1PP8 F;  2ZBK A;  3Q5F A;  4EMS A;  4N9H A;  4G7O F;  2O61 A;  3C7J A;  2FML A;  3WE3 A;  1YS6 A;  4NQW A;  2QYO A;  2XKO A;  4U0V A;  1Q1H A;  3U1D A;  2UWM A;  2EFP A;  2BYV E;  4RGX A;  1FBQ A;  2JTV A;  3ZMT A;  4M9S A;  5CVU A;  2F2E A;  3KP3 A;  3KLN A;  4Z2Y A;  3HUG A;  3S2W A;  2PI0 A;  1QBJ A;  3R0J A;  3EDP A;  4E70 A;  3E3V A;  1FYK A;  1C0W A;  5K1Y A;  3F8F A;  4LLL A;  3KEO A;  4Y17 A;  4HX8 A;  4G8X A;  1IAW A;  2A69 F;  4KMF A;  3KP2 A;  2C6Y A;  4IHS A;  2L4M A;  4N9I A;  4ZYE A;  2V1X A;  3SZT A;  2E7X A;  4H0E A;  1XGM A;  2OQR A;  5AON A;  3FZV A;  2HEO A;  4LMY A;  4EQQ A;  3GWZ A;  3ZMD A;  2GXG A;  3DF8 A;  1IXC A;  2Z33 A;  3C3W A;  3HRT A;  1XCV A;  4RGR A;  3I53 A;  3FM3 A;  1CF7 B;  3DPT A;  3SHF A;  3ELK A;  3WTY C;  5BOX A;  5A2Q Z;  3BP8 A;  5E1X A;  3MZH A;  1H9G A;  3CUO A;  1R5G A;  2EFW A;  1ON1 A;  1BI0 A;  4L18 B;  1L0O C;  3VOD A;  2P6S A;  2CG4 A;  3WU1 B;  4ENN A;  1MGT A;  3VOE A;  3TOA A;  3LQR A;  3FMS A;  2RVC A;  2Y75 A;  2GWR A;  2EV6 A;  3COA C;  1Z05 A;  2STW A;  2DQL A;  1P92 A;  1P4A A;  2MBF A;  3D0S A;  1YW9 A;  2J5O A;  5FFX A;  2YU3 A;  1QQI A;  3MAJ A;  1ZG5 A;  1LDD A;  2QQ9 A;  3JAM K;  3QRF F;  3ROU A;  2WWY A;  1REP C;  1TTY A;  3GFI A;  4LD5 A;  4R8H A;  4S04 A;  2ZNZ A;  2BGC A;  4P9F A;  4UVA A;  2BEO A;  3FF5 A;  3NEU A;  4KIF A;  1F1Z A;  3TQN A;  2A68 F;  4IHT A;  1MD0 A;  1W5S A;  3F8C A;  2KRF A;  1STZ A;  3KLO A;  3HOS A;  1WI9 A;  1U2W A;  3C18 A;  3LAP A;  1JE8 A;  3E6B A;  3FMQ A;  3QPH A;  2NRA C;  1SD6 A;  4P96 A;  2K4J A;  1I1G A;  4M6X A;  3FM5 A;  4G7Z F;  2V1U A;  1R1T A;  1OR7 A;  1PUE E;  5E18 F;  3I5U A;  4I0A A;  3P7N A;  3IWF A;  2GA2 A;  4WXC A;  2XIG A;  4RGU A;  2QLZ A;  3QU6 A;  4YFK F;  3Q9V A;  3BJA A;  1FBS A;  3B02 A;  2G9W A;  2AXL A;  2YSR A;  2HS5 A;  2R7D A;  2ZME B;  3IKT A;  2IJL A;  4ZYH A;  3LQQ A;  3RPU A;  1QZZ A;  1TNS A;  4CDG A;  2Q0O A;  4HBL A;  1R7J A;  3ISP A;  4MTE A;  3R6S A;  3I59 A;  3L09 A;  3T8R A;  4RB1 A;  4LB5 A;  4PZJ A;  2VT3 A;  3F21 A;  2LKP A;  4KT5 C;  1XGO A;  1MJB A;  2DLL A;  5LEK A;  3PQJ A;  5LHH A;  2EA4 A;  3QOP A;  4OOI A;  3L7W A;  4QLC U;  1TBX A;  2XGX A;  5CVI A;  6PAX A;  5F6F A;  2UXX A;  4IXA A;  2XV4 S;  4Q48 A;  3IC7 A;  2K86 A;  5H6R A;  3ZP5 A;  1ZRC A;  1P6R A;  4EM0 B;  2FRH A;  2NNN A;  2DU9 A;  5HS9 A;  1O3Q A;  1HKQ A;  5FD5 A;  2ZCW A;  2HYF A;  5LEJ A;  1U3E M;  5ICF A;  4NHJ A;  3BDD A;  2OU2 A;  4PGH A;  4EGY A;  3O3K A;  3DV8 A;  1MDM B;  2M87 A;  2FF4 A;  4YFX F;  5JVT A;  1XCB A;  1KGS A;  1MZB A;  3CUQ A;  1JXS A;  2IA1 A;  5ED4 A;  4ESB A;  2OBP A;  1BC8 C;  2FOK A;  4LG0 B;  1BOA A;  4I2O A;  1HKS A;  1LNW A;  1W4M A;  2GIV A;  2EV0 A;  1U6G A;  4UV9 A;  1YW7 A;  3NRV A;  3C1D A;  2PFB A;  2CW0 F;  4M9X A;  3M8E A;  1MJA A;  3ECO A;  3J80 K;  2TDX A;  3H3U A;  1IUY A;  3G73 A;  3B73 A;  1T98 A;  4Q47 A;  1Z6T A;  5KVR A;  1S8N A;  5FLX K;  2QM3 A;  1ZG3 A;  3GVA A;  3I54 A;  4HLY A;  5ICC A;  3HRM A;  1G3T A;  3L9F A;  2F5C A;  1J7K A;  3LA2 A;  2YR2 A;  1USS A;  2RGV A;  3VEP A;  5IT3 A;  4I09 A;  4HQE A;  3MWM A;  3F72 A;  1IRG A;  2D1V A;  1IXS B;  3JAM Z;  4AD9 A;  1B6A A;  3WG9 A;  2KIM A;  4R1H A;  5ICE A;  4UV8 A;  2H09 A;  4BAY A;  1TQP A;  2VE8 A;  4IRG A;  2X0L A;  5BS6 A;  4CIC A;  3WTX C;  5JR3 A;  2HYG D;  1GHC A;  5BPD A;  3LWF A;  1ZRD A;  4A0Z A;  2O6G E;  2IA2 A;  4EJV A;  2XAS A;  2L4A A;  1D3Y A;  3WTZ A;  4ZYG A;  3K1N A;  2J5P A;  3R4K A;  4WX9 A;  1W5T A;  1F9N A;  1DPR A;  2W85 A;  3ERE D;  1RUO A;  4KNY A;  2A5Y B;  2ZNY A;  4OIQ F;  3FXU A;  1SD7 A;  1V3F A;  1IN5 A;  2W57 A;  3ABU A;  4HOB A;  1FYL A;  5HLG A;  3CO7 C;  3LFK A;  1KQ0 A;  1D8J A;  5LGN A;  2L3D A;  3GX4 X;  4OIP F;  2H27 A;  4ZZD A;  2W25 A;  2P6T A;  1TW3 A;  2EJR A;  2OAZ A;  3E97 A;  4Y13 A;  1F4K A;  3W6K B;  2XAG A;  2ESH A;  3I0T A;  3KP7 A;  1B1B A;  1YIO A;  1J9I A;  4HLX A;  2P8T A;  1K78 B;  4KN4 X;  3FX3 A;  5BMZ A;  2XAJ A;  4O6J A;  1FZP B;  2OZU A;  2HQN A;  1D5V A;  3J7A O;  1EH8 A;  5HDN A;  2VT2 A;  2IP2 A;  4IVN A;  3LST A;  1IXR C;  2RQP A;  5DCM B;  2FQ3 A;  3DEU A;  1QNT A;  4M73 A;  2GXB A;  1XN7 A;  5L3B A;  3E5U A;  1SD5 A;  4A6D A;  2KJB A;  5D6F A;  5L3C A;  1KA8 A;  2DPD A;  3RKW A;  2NAZ A;  1HSJ A;  1K7A A;  1RI7 A;  2H6C A;  3M9A A;  3ML6 A;  4M74 A;  3EYY A;  4WF2 A;  2X4H A;  4WXD A;  5D6E A;  1BIB A;  3P9K A;  3KP4 A;  2EFN A;  4P55 A;  2JZY A;  3E6D A;  5EEH A;  4I7H A;  3M7G A;  4MGR A;  3HRU A;  1EV7 A;  5DD8 A;  2DTR A;  1K6O A;  1X3U A;  3V7C A;  3DKW A;  4K2E A;  1S7A A;  5D5X B;  1K79 A;  3TO9 A;  1SD4 A;  4XLN F;  2GQQ A;  3RJP A;  1G6N A;  4KDP A;  2CSO A;  3M8F A;  1XD7 A;  1E2X A;  3R60 A;  3RKY A;  4OIR F;  3ZQ7 A;  1KU3 A;  3ECH A;  2WV0 A;  4ASN A;  3F8M A;  1UHW A;  2MH9 A;  5HS7 A;  5BPI A;  3Q9S A;  5ILS A;  4KUM A;  2EB7 A;  1FBU A;  1EH7 A;  3J80 Z;  2VBZ A;  1E17 A;  3J81 Z;  3H92 A;  2XHK A;  3I59 B;  4KN7 X;  2JPB A;  2FNP A;  2XAH A;  4CO8 A;  2L54 A;  4QWQ A;  5FLX Z;  4G94 A;  1YLF A;  4ESJ A;  4IRH A;  4GCV A;  4U7D A;  3DP7 A;  2FBI A;  3HTU A;  3ZPL A;  3I71 A;  3SZP A;  1O57 A;  1PP7 U;  2JRT A;  5IT9 K;  2ESN A;  2LDU A;  1P4W A;  1MKM A;  3N97 A;  5HLI A;  4RAZ A;  2LSO A;  1QPM A;  1TQI A;  1FSH A;  4HW0 A;  2VON A;  4BHC A;  4F7Z A;  1UFM A;  1W7P A;  4LGW A;  3FMR A;  1HW2 A;  3F3X A;  3HHH A;  1O3R A;  2VBW A;  2XAQ A;  2EFO A;  4FX0 A;  2F5D A;  1I6X A;  4EJO A;  2EV5 A;  5J6X A;  1H0M A;  3WE2 A;  3GFL A;  5HS8 A;  3IKV A;  4KIB A;  1A04 A;  1IW7 F;  3WOD F;  5FFZ A;  3TGN A;  1DP7 P;  1HQC A;  1ZGA A;  5K5Q A;  3CUQ B;  5CVR A;  1GXQ A;  3JTH A;  5F1R A;  3GYH X;  1SAX A;  2H6B A;  3RYR A;  3KP6 A;  2ZFW A;  1FT9 A;  1FNN A;  1HW1 A;  4P5O A;  2Z99 A;  1OYI A;  4L9J A;  3TO6 A;  2QQB A;  1KQ8 A;  4G9Y A;  4U88 A;  5LRR A;  1R58 A;  4OIN F;  4DQ2 A;  2XAF A;  1HST A;  4AIK A;  4OU0 A;  1KU9 A;  2G7U A;  1SMT A;  1UB9 A;  4M72 A;  4U0W A;  4U0Y A;  3FXR A;  5LBQ A;  2CGP A;  5CVV A;  2K4B A;  1U5T C;  2EA2 A;  4M9Z A;  2RKH A;  1O7L A;  5HVQ C;  4ZH4 F;  3ABT A;  1IN8 A;  5DDG A;  4KFC A;  2Z5U A;  1XSX A;  4CHU A;  4AIH A;  1ZN2 A;  4GXO A;  2PN6 A;  1W7P D;  2H94 A;  1U78 A;  3F6O A;  2EK5 A;  1J2X A;  3BPX A;  1S3J A;  3TO7 A;  2ZXJ A;  3JW4 A;  4MTD A;  3MEX A;  3WTW C;  1KYZ A;  4RGS A;  2HKX A;  2O03 A;  3U9G A;  1FX7 A;  1DDN A;  2PBI A;  3RKX A;  3R61 A;  4Q5S F;  2P5L C;  4IRI A;  1LVA A;  2M8E A;  2WC2 A;  4A0Y A;  2CQK A;  4ESF A;  4FT8 A;  3NQO A;  5DV5 A;  1SFU A;  3H3Z A;  4NB5 A;  1ZRE A;  2M5W A;  1H9T A;  2M30 A;  3ZN0 A;  1FY7 A;  4M71 A;  1R36 A;  2FEZ A;  3WTS C;  4YII A;  1KQ9 A;  5D4S A;  2NYX A;  1Z1D A;  2O0Y A;  4JQF A;  5H6Q A;  1Z9C A;  1L3L A;  5JI6 A;  5ERI A;  4RB2 C;  3GFM A;  2A3S A;  1I5Z A;  4HF1 A;  4BXU A;  4L9V A;  4L5J A;  4EVI A;  4TV7 A;  3GLX A;  2Q2E A;  1TQM A;  3JSP A;  1YS7 A;  4RS8 A;  5H20 A;  1ZLK A;  2GAU A;  4XBF A;  3N4M A;  3ULQ B;  4PGG A;  1KU2 A;  2Q8K A;  3M1E A;  2NNY A;  3IL2 A;  3GEZ A;  3HSF A;  1T2K A;  3V8K A;  3F8B A;  4CYD A;  4HF0 A;  4MHG A;  4BNC A;  4KMU X;  2YX4 A;  2DK8 A;  2V6C A;  4HQM A;  3I4P A;  1Z6R A;  1HW5 A;  2MA3 A;  1ONV A;  1B9M A;  4GGG A;  4HDV A;  2V1D A;  2HZT A;  1XB4 A;  2XRO A;  1T39 A;  2ETH A;  1YW8 A;  3ZMZ A;  2DW4 A;  1AOY A;  4GYI A;  3TOB A;  3OV8 A;  4CXF A;  5L3D A;  4EV0 A;  1LEB A;  3E6M A;  1U8R A;  1J5Y A;  2CYY A;  3IRR A;  5E1Z B;  3V4G A;  1T0F A;  1BI2 A;  1RIO H;  3T8T A;  4ETS A;  3U2R A;  4MNU A;  2BE5 F;  2ZJ2 A;  4YG2 F;  2FNA A;  3P9C A;  4RB0 A;  4I02 A;  4B8X A;  3ZMV A;  3PQK A;  3EET A;  1HXD A;  1P2F A;  2FSW A;  4L5I A;  4JBA A;  2MLG A;  4EM2 A;  2MLK A;  1Y0U A;  1Z7U A;  1HKT A;  3DXJ F;  1WKM A;  5FGM A;  3CUQ C;  4EJW A;  4O3M A;  1RZ4 A;  4HA8 A;  3W6J B;  2IVM A;  5CLS A;  1BIA A;  4IJA A;  1LB2 A;  2KIU A;  5DUI A;  3GF2 A;  3L00 A;  1FP1 D;  2QBY A;  2IT0 A;  1BJA A;  2IW5 A;  5HOO A;  1I1S A;  1OPC A;  1IZ1 A;  4DNC A;  4O5V A;  2ELH A;  5AIP A;  2Z9O A;  2JPC A;  1B4A A;  4WWC A;  2PEX A;  5DD4 A;  2LNB A;  4UXN A;  2B0L A;  1KYW A;  4M6Y A;  3WTT C;  3QPT A;  2YPR A;  2ZKZ A;  5LGU A;  2HGC A;  4B09 A;  1FOK A;  1FSE A;  2K7L A;  2FBH A;  5LHG A;  4KYW A;  2RV8 A;  2DT5 A;  2VOD A;  2K27 A;  1BI3 A;  3K69 A;  1MDM A;  5HLH A;  5E8G A;  2O8X A;  1JGS A;  4R79 A;  1SFE A;  4G6Q A;  4A12 A;  1YTY A;  4GYG A;  2XUB A;  4G7H F;  3LA7 A;  2IA0 A;  3V8L A;  1I27 A;  1W7P B;  5D5V B;  1EH6 A;  2OD5 A;  3GZ5 A;  1XDS A;  2NS0 A;  3QAH A;  1OMI A;  5D4R A;  2AS5 F;  3K1P A;  2P7V B;  3O6B B;  3HIF A;  4EJU A;  2QZ8 A;  4UHT A;  1XDU A;  5D8K B;  2F5E A;  2UZK A;  2HOE A;  1ZLJ A;  2PQ8 A;  2VE9 A;  3RI4 A;  3ZN1 A;  1IN7 A;  1FPQ A;  1S6L A;  3F8N A;  3ZMS A;  4LK0 F;  2ISZ A;  1J75 A;  2COM A;  3KFW X;  2M45 A;  3E5X A;  1CGP A;  3SXY A;  3QP5 A;  2D2W A;  3QU3 A;  2E7W A;  3CTA A;  4OMY A;  4FX4 A;  3BWG A;  2HQR A;  1GXP A;  1IRF A;  3TDU C;  4L9T A;  4BH9 A;  4AIJ A;  1G3Y A;  3FWE A;  1XMA A;  1J59 A;  4EJT A;  5DUK A;  3I64 A;  1G4D A;  2XRN A;  4BHB A;  4EGZ A;  5LRS A;  4EM1 A;  3F23 A;  5DYM A;  4S05 A;  1BI1 A;  1WRJ A;  2V79 A;  4YIF A;  5JHU A;  2CWE A;  4ENJ A;  1R23 A;  2VBY A;  2RNJ A;  4MEY F;  2Y48 A;  3HHG A;  5K5R A;  1YO5 C;  3DFG A;  5K5O A;  2JSC A;  2EFQ A;  3LAJ A;  1UCR A;  2M1B A;  2VOP A;  3KZZ A;  3R0A A;  2HWV A;  4HX4 A;  5L3G A;  2RN7 A;  1TW2 A;  2VN2 A;  1YYV A;  2JT1 A;  1IF1 A;  2BV6 A;  4HV5 A;  4CZZ A;  3CDH A;  3VFZ A;  2Z3Y A;  2FA5 A;  1BN5 A;  1LJ9 A;  1PDN C;  2A61 A;  5KK1 A;  2KIF A; 
#chains in the Genus database with same CATH topology
 4UVB A;  5D5W B;  5F0F A;  4HNT A;  4WCG A;  2UXN A;  2FE3 A;  2R7O A;  2R7Z J;  4LK1 F;  2CO5 A;  2R5Y A;  3REO A;  3ZMU A;  2R7W A;  2HDC A;  2CUZ A;  3KCC A;  3NAR A;  1VQN I;  2LP0 A;  4S0H B;  3ZQI A;  1R49 A;  2HVS A;  1AU7 A;  1OKR A;  2DI3 A;  1Q1V A;  4F52 A;  3V7R A;  2DQR A;  3CDI A;  1BBY A;  3K70 D;  4W97 A;  4ZJZ A;  3OIO A;  1T8I A;  4ABZ A;  1U5T A;  4Q4Z F;  3WGG A;  3F22 A;  1LE8 B;  1TWG J;  1MMS A;  2CFX A;  2R7T A;  1SMY F;  4V2G A;  4IZZ A;  2JVH A;  1MJ9 A;  3A03 A;  3FK6 A;  4HNV A;  3CCU I;  1LFB A;  2ACJ A;  2QGU A;  1AKH B;  4B48 A;  2X6W A;  1K78 A;  1GVJ A;  1FP2 A;  2X51 A;  1WJB A;  3PSI A;  3AL0 B;  2XGD A;  1XSD A;  4LB6 B;  1WZ2 A;  2L9S A;  3EQL F;  3GTP J;  3GLL A;  3HG9 A;  3HXL A;  1WQ2 A;  2RAE A;  2QWW A;  4YFN F;  2WTE A;  4PJN A;  4FTH A;  5FKO A;  3TP0 A;  3FXQ A;  4BDY A;  1RNL A;  2HOT A;  1TWF J;  4BHP A;  5L3F A;  4XLP F;  3GXO A;  1OYW A;  1XMK A;  2Q1Z B;  2FU4 A;  2DPU A;  3L2C A;  3GTQ J;  5D5U B;  1O3T A;  3O8G A;  3WU0 A;  3ZRG A;  5IP6 A;  4KIG A;  3AAF A;  4A3I J;  4MEX F;  2Q2E B;  5DCM A;  5LGT A;  3CD6 I;  3MZY A;  3EUH A;  5ICG A;  3HGG A;  2X1E A;  4PDK A;  5E79 C;  5LLQ A;  1V54 H;  1IUF A;  1WFX A;  3SFZ A;  3KET A;  3G3Z A;  4A5M A;  2HQA A;  2I5U A;  4FHT A;  3K1M A;  4I98 B;  2DK5 A;  3OSG A;  1ZRF A;  3DPL C;  4BE1 A;  1R22 A;  5E17 F;  3V7S A;  2BXY A;  1VQ6 I;  2CW7 A;  2EWN A;  3BC8 A;  5L3E A;  4A5N A;  3CLO A;  3H9G A;  2DFI A;  4N0B A;  1XGS A;  3LSR A;  2MH2 A;  2R3S A;  3BOQ A;  3H36 A;  3WTV C;  3S3M A;  5HNH A;  3S17 J;  2HR3 A;  3I56 I;  3CCM I;  2A6E F;  2DA2 A;  2D45 A;  3K2Z A;  2P7C B;  4GO1 A;  3KEQ A;  2OA4 A;  4OWR B;  3EPZ A;  5F64 A;  1JJ8 C;  1HC8 A;  3HB9 A;  4IX7 A;  3RDI A;  3JTG A;  4OMZ A;  3QP6 A;  3W2A A;  4XSX F;  2MW8 A;  4CGZ A;  2XSJ C;  3TDZ C;  1HDP A;  2GLO A;  3OYN A;  4LJZ F;  1JHH A;  2O3F A;  1GT0 C;  5CYV A;  4HZF A;  4AVZ A;  3ZQC A;  2JA5 J;  4RAY A;  1V5F A;  3JRB A;  1SFK A;  2A6T A;  2X6Y A;  2E1N A;  1IDY A;  3P5J A;  1YOV B;  2BVM A;  3OL3 A;  4XR6 A;  2STT A;  1R00 A;  1R4N B;  5F27 A;  1YRN B;  4RAF A;  5J40 A;  4PJM A;  3CJN A;  1R1U A;  2PMU A;  1VQ5 I;  2KP6 A;  2X9D A;  1WJC A;  3RIR A;  1XGN A;  1QRY A;  1SFX A;  2CQ7 A;  3H9J A;  2KDZ A;  2VOO A;  1BC7 C;  4B4C A;  3KP5 A;  2ADU A;  2HVR A;  2ZO4 A;  3BTC A;  2RQQ A;  1WWX A;  1ZGJ A;  1NHA A;  2V9V A;  3IRQ A;  3BY6 A;  3C2G A;  2PMH A;  3T1B A;  1P7J A;  4C2U A;  1HA8 A;  3BG5 A;  4N4N B;  1VTN C;  4ENM A;  2LR8 A;  2E5N A;  1UST A;  2EH3 A;  3OYL A;  5TGT A;  2VJI A;  4JK1 X;  1TLH B;  2V9K A;  3GFJ A;  2KFD A;  2RC4 A;  4XRF A;  1DUX C;  2FXA A;  4OIO F;  2YX7 A;  3S16 J;  5KCM A;  5FO5 A;  1FTT A;  3S3O A;  1YFH A;  1S7O A;  5GAE J;  2FMY A;  3HKZ N;  3HSR A;  1VQL I;  1CF7 A;  1VQ7 I;  1NG6 A;  3GZN B;  4UNO A;  3BRO A;  4F3Q A;  1O7F A;  2GZW A;  3W2V A;  3GUD A;  3JRD A;  1G3S A;  3Q0W A;  4FQG A;  4H4K C;  4PUS A;  3EYI A;  2VKD A;  1B72 B;  2LF7 A;  1FC3 A;  2R7F A;  3BJO A;  5E8I A;  5HDK A;  4U7B A;  2W84 A;  3T0Y A;  1MMG A;  4IQJ A;  4I76 A;  2A6H F;  1ZG1 A;  3K2A A;  2HFH A;  3M3Y J;  3MCZ A;  5JLX A;  2LBF B;  1U9O A;  4JX4 A;  2OCE A;  1T38 A;  2MD5 A;  5EG0 A;  4Y7N J;  1H89 C;  4G6D A;  4HF2 A;  2W4S A;  4GDF A;  4D7N A;  2IBD A;  3RZD J;  1YQA A;  2L02 A;  2VC1 A;  2E1M C;  4DIQ A;  4DW6 A;  4L0Z B;  2IGK A;  4WXH A;  1X2N A;  3DWL E;  2VPL A;  3MKL A;  1RKT A;  2P81 A;  3HOT A;  4A93 J;  1G3W A;  3DBL B;  3ZQL A;  4IHY A;  3QPL A;  2ZC2 A;  4HV6 A;  2QBY B;  1XMX A;  2MC3 A;  2NVX J;  1B9N A;  1J0R A;  3SQN A;  3V8J A;  3LSJ A;  3SDG A;  3E5Q A;  2HDD A;  4BGD A;  3F6V A;  1D8K A;  3IHU A;  1GLN A;  5FB2 A;  2XGC A;  1DPU A;  2WAE A;  1YG2 A;  2LF8 A;  1O3S A;  3GO5 A;  2PJR B;  4UVC A;  4BJ6 C;  2L7K A;  3RSN A;  3FKJ A;  1E3P A;  1XC5 A;  4I0B A;  2VC0 A;  1UHS A;  3KX2 A;  1LDK B;  4RBO A;  5ILV A;  3BPV A;  5E3M A;  1IJW C;  3BR1 A;  2GIZ A;  2HXO A;  2W24 A;  4KA4 A;  4Z6Y A;  2JQ7 A;  3WTU C;  3S1N J;  2G7H A;  2QEN A;  2CW8 A;  1ZAR A;  3MFK A;  4NBQ A;  2K02 A;  1I50 J;  4LLG F;  5LD2 C;  5FD6 A;  2XKP A;  2LKX A;  2A07 F;  2GM4 A;  4BQA A;  5IOZ A;  1JUP A;  2F5F A;  4ZYD A;  3S1M J;  3I4N J;  4HDU A;  1JKO C;  3MQ0 A;  2NVT J;  1FOY A;  2VJ5 A;  2PMZ A;  4B44 A;  1FLI A;  2DO7 A;  4E7J A;  4HST A;  3KE2 A;  5TJJ A;  1E0E A;  3K4K A;  3RPQ A;  1X1C A;  3FHZ A;  3TKY A;  3HL2 A;  2OQG A;  4RLQ A;  2VXZ A;  4E7H A;  4JX6 A;  1XSV A;  3ASO H;  2KRH A;  4ZZL A;  1X3Z B;  5C3E J;  1S29 A;  1BM9 A;  2QQA A;  1GV5 A;  3IV5 A;  2PG4 A;  2D1H A;  2P5K A;  4L9N A;  5J4V A;  1ODD A;  3BJ6 A;  5M3M J;  2PLY A;  3FIW A;  2OC6 A;  1LDJ A;  1IN4 A;  1F5T A;  3OOP A;  5HDG A;  3VSL A;  3WGH A;  1TC3 C;  2EZI A;  4D9J A;  2BBY A;  2DA4 A;  1WCM J;  2DAO A;  1JHF A;  1B8I A;  2KKO A;  3PUF A;  3HOZ J;  3J81 K;  5IPA A;  3J7Z I;  1ETY A;  5A2Q K;  2BHY A;  4UUS B;  1R1V A;  3LA3 A;  1ZAO A;  5JLW A;  3O2P E;  3PM1 A;  3B6C A;  5TRD A;  4L0Y B;  1LQ1 A;  4MQV A;  4A0X A;  5IT9 Z;  4A2U A;  2EZH A;  4XN0 A;  4CCL A;  1CQT A;  4XSZ F;  2O8K A;  1TL8 A;  5J8C A;  4A6E A;  5ILU A;  2PJP A;  2R5Z A;  1WI3 A;  4BQO A;  4XLA A;  4XMY A;  4Y15 A;  2ZME A;  4P9U A;  3MKW B;  1QZY A;  2XPW A;  1JJ6 C;  4HAM A;  3K9T A;  2FD5 A;  4ZTF A;  1JKP C;  2XPV A;  3AL0 C;  1ULY A;  3RYP A;  1ON2 A;  3KZY A;  4HYE A;  5D8L B;  3X2Q H;  1XG1 A;  5EEG A;  1DGW Y;  5B66 C;  3J7A Y;  3G71 I;  4M3E A;  3LSG A;  4MQ9 F;  5BQT A;  2F4M B;  5GP9 A;  3DLL F;  3DEW A;  2P4W A;  4I01 A;  1T6S A;  1X1P A;  4AVP A;  4UUV A;  2PMZ N;  3GZ6 A;  4UB8 C;  3JRI A;  3I58 A;  4NC6 A;  5F08 A;  2M0C A;  4CCN A;  2IS2 A;  1OCR H;  2DYR H;  4ON0 A;  3CO6 C;  3DKX A;  4KIC A;  4D5F A;  1POG A;  3HRS A;  2NXN B;  4PCQ A;  4RA2 A;  2OF7 A;  5FKL A;  3BZ6 A;  3JSO A;  2R0Q C;  3IWZ A;  3HTS B;  4BY7 J;  2HI3 A;  3T5X A;  2QKL B;  2O7O A;  3J7Y J;  1RUN A;  5E1W A;  2X1D A;  2VBX A;  3VB2 A;  4AYB A;  2P5V A;  3CF5 F;  3BZK A;  1KU7 A;  5GTH C;  2HNH A;  2DN0 A;  2IS4 A;  5FKN A;  4IPA A;  2HTJ A;  3M8J A;  2IGN A;  3HYI A;  5E20 A;  5AIQ A;  4HX7 A;  2LTP A;  2IPQ X;  3CF2 A;  3K4N A;  3E6C C;  4V19 K;  1RPW A;  3SYT A;  4IF4 A;  2L01 A;  3FHN A;  3OYE A;  4LFU A;  3BCB A;  4XL9 A;  3HM5 A;  3TW6 A;  3L2W A;  1MMA A;  4ENK A;  1OYY A;  1TT0 A;  2LY1 A;  2Y0M A;  1TNT A;  1X2M A;  2ISY A;  3CC7 I;  2HKO A;  1ZH5 A;  2VUM J;  3OR2 C;  2K9Q A;  4HNU A;  5J1Y A;  5CVJ A;  5J8F A;  2LY2 A;  1K61 A;  3HSE A;  2XC7 A;  1V4R A;  2X1C A;  3GW2 A;  4EAT A;  2HTS A;  2GOM A;  2EIN H;  2R5Y B;  1B59 A;  4FCY A;  2HXI A;  3D5L A;  1BR1 A;  1VI0 A;  3RTR A;  2KJC A;  3DKY A;  2QVO A;  1UHM A;  4D0P A;  1UMQ A;  1OCT C;  2XB0 X;  3K10 A;  3G1L A;  1AWC A;  1KON A;  1FWZ A;  1Y8Q B;  2DBB A;  3N05 A;  1U0J A;  2E1C A;  2GXA A;  2CQQ A;  3DQV C;  2XVC A;  4IO9 F;  2GA1 A;  1ZYR F;  4C3I J;  2JN6 A;  4BYY A;  4LLN A;  4ZDP A;  1QGP A;  2EBI A;  3P9I A;  5LHI A;  1U5T B;  2VI6 A;  1Z91 A;  1MBJ A;  1WSU A;  1T0F C;  2ZFU A;  2A5W A;  2L9V A;  2FBK A;  1A6I A;  3PFI A;  3K0L A;  2VKE A;  2OZ6 A;  4MFD A;  4LG0 A;  3HOX J;  1P4X A;  1QO0 D;  1KZH A;  1IN6 A;  4AWX B;  1GV2 A;  2CUE A;  2QUF A;  1HBX G;  4DBQ A;  1T08 B;  3SFI A;  2DYS H;  5JFR A;  1FYM A;  2CH0 A;  9ANT A;  3HJE A;  1LEA A;  1WGX A;  1R5H A;  1N25 A;  2YS9 A;  1ZHF A;  3WGI A;  1QA6 A;  2R92 J;  5CJ9 A;  1D0Y A;  2K3P A;  4RB3 C;  4WK8 F;  5DEQ A;  3OYG A;  4UUT A;  2DOD A;  3FXO A;  3WHB A;  5DCF A;  2IRF G;  2RDP A;  2JA8 J;  1PP8 F;  4KIS A;  4AYB N;  1FEX A;  1VQP I;  2ZBK A;  3Q5F A;  4EMS A;  4N9H A;  4G7O F;  1ZK8 A;  3C7J A;  2FML A;  3Q0V A;  2O61 A;  3WE3 A;  3BQY A;  1YS6 A;  3Q0U A;  5K7H A;  4NUB A;  3FBI B;  4NQW A;  2QYO A;  2XKO A;  3VYR B;  4U0V A;  1Q1H A;  5IYB J;  3U1D A;  2R7S A;  3A0B C;  3M07 A;  2UWM A;  2EFP A;  2BYV E;  4RGX A;  1FBQ A;  2JTV A;  3ZMT A;  4M9S A;  5CVU A;  2DOF A;  1WJD A;  1EKE A;  3K4L A;  4FIS A;  2F2E A;  5JHF A;  3KP3 A;  3KLN A;  1DU6 A;  4Z2Y A;  3BG6 A;  1BW5 A;  3HUG A;  3H0G J;  3S2W A;  2PI0 A;  2WB1 A;  2V9P A;  1EJ9 A;  1MBK A;  4BL0 B;  1QBJ A;  2O5R A;  1BW6 A;  3R0J A;  3EDP A;  1OFC X;  1Z3X A;  1NK3 P;  1AA7 A;  1SVM A;  2ELK A;  2DJN A;  4E70 A;  2KMU A;  4XID A;  3E3V A;  1FYK A;  1C0W A;  2QSH X;  3CCE I;  3K4J A;  2X6X A;  2ZJR F;  1IG7 A;  3H35 A;  3HOW J;  3ZQH A;  5K1Y A;  4PJJ A;  2ZSI B;  4JX5 A;  3F8F A;  4LLL A;  3KEO A;  2VB6 A;  4Y17 A;  3AG4 H;  4HX8 A;  2CS3 A;  3BG9 A;  4G8X A;  1RRJ A;  1HCR A;  1W36 D;  1IAW A;  2VL8 A;  2A69 F;  1ETV A;  5FRN A;  1UEL B;  3UKG A;  4IHX A;  4KMF A;  3KP2 A;  4CSW A;  2C6Y A;  2E2J J;  4IHS A;  2L4M A;  4N9I A;  4ZYE A;  2DA5 A;  5F0C A;  2AXT C;  3PNY A;  3CCQ I;  2V1X A;  3H3V K;  3NWT A;  3SZT A;  2E71 A;  1V5G A;  2E7X A;  4QPO A;  5M3F J;  2DA7 A;  3QPS A;  4I99 C;  1XGM A;  2OQR A;  2WBM A;  4H0E A;  2R93 J;  5AON A;  1ETX A;  1JKQ C;  2CU7 A;  2ZJP F;  3FZV A;  2HEO A;  4LMY A;  1PUF A;  4EQQ A;  1OCP A;  2CV0 A;  3GWZ A;  3ZMD A;  2GXG A;  2YU9 J;  3DF8 A;  1IXC A;  2Z33 A;  2DA6 A;  3C3W A;  3BR2 A;  3HBL A;  3HRT A;  1XCV A;  3A1Y A;  4RGR A;  3I53 A;  1IO2 A;  2V1N A;  3FM3 A;  2AO9 A;  1CF7 B;  5IY5 H;  2LKS A;  4RLF A;  3DPT A;  3SHF A;  1QVU A;  3ELK A;  5EEA A;  3WTY C;  1ERD A;  4MFE A;  2MSY A;  5BOX A;  5A2Q Z;  4CA0 A;  3BP8 A;  2LLK A;  5E1X A;  3MZH A;  3OYD A;  4C30 A;  4ZYA A;  3TP3 A;  1VQO I;  1H9G A;  2WB1 N;  2BY2 A;  3CUO A;  1P7I A;  1R5G A;  3VDX A;  2EFW A;  1ON1 A;  1BI0 A;  4CYC A;  4XLE A;  4L18 B;  2DA1 A;  1L0O C;  3VOD A;  2VAS A;  2P6S A;  2OCC H;  1HF0 A;  4A3L J;  1MH4 A;  2CG4 A;  4X0G A;  3WU1 B;  3MKZ A;  4ENN A;  1MGT A;  1Z0X A;  3VOE A;  2DDB A;  2W82 A;  3LQR A;  2DMN A;  4ITV A;  3TOA A;  3FMS A;  5B1B H;  2RVC A;  5BNG A;  3ZQG A;  2CRG A;  2Y75 A;  3K70 C;  3BR6 A;  4M3B A;  2JMW A;  2CJJ A;  2GWR A;  1D0Z A;  5CQE A;  2EV6 A;  3UR3 C;  2FQ4 A;  3COA C;  4XKV A;  1Z05 A;  2STW A;  1LFP A;  2DQL A;  3FXM A;  1P92 A;  2HOA A;  2DTZ A;  2LRD A;  1P4A A;  5FKM A;  2MBF A;  3A4C A;  4D7M A;  2BOL A;  2XPU A;  3D0S A;  4DGW B;  1YW9 A;  2J5O A;  5FFX A;  2W7N A;  2YU3 A;  1QQI A;  4OAZ A;  4AID A;  1SVO A;  3MAJ A;  3LL7 A;  1ZG5 A;  1LDD A;  2A05 A;  1FMW A;  2QQ9 A;  4XLH A;  3JAM K;  2DOE A;  4M6V A;  2KZG A;  2M8G X;  3QRF F;  3ROU A;  2DOA A;  2K9S A;  2MGQ A;  2WAQ A;  3FXJ A;  3DBH B;  3HOV J;  3QOD A;  2VKH A;  1UJ8 A;  2WWY A;  1Z3Y A;  1REP C;  1TTY A;  3GFI A;  1ETQ A;  4A3E J;  2O9L A;  4LD5 A;  4R8H A;  1JUS A;  2R7R A;  4S04 A;  2ZNZ A;  2BGC A;  2CUF A;  5J1U A;  1H8A C;  4P9F A;  4XOT A;  4UVA A;  2BEO A;  1QHG A;  3FF5 A;  2Y30 A;  4BS9 A;  4BUP A;  3NEU A;  4KIF A;  1F1Z A;  4B3X A;  1TWH J;  2JA2 A;  2ME0 A;  3M1C A;  5FKK A;  3TQN A;  1S5L C;  2A68 F;  4E7Z A;  4IHT A;  3BG3 A;  5E3N A;  1MD0 A;  1W5S A;  4A3D J;  2M34 A;  3I55 I;  3F8C A;  2JWT A;  2KRF A;  2RNG A;  1STZ A;  3KLO A;  3JRC A;  3HOS A;  2CMP A;  1WI9 A;  1JUM A;  1U2W A;  2H1L A;  4E7S A;  3S3N A;  3C18 A;  3LAP A;  1JE8 A;  2LH9 A;  5F0H A;  1N78 A;  1P9Q C;  3E6B A;  1MNE A;  3FMQ A;  3QOE A;  2E35 A;  3QPH A;  4BU2 A;  2NRA C;  3H9Q A;  1YJN I;  2M3A A;  3OYB A;  4LIU A;  4G6T B;  2MFZ A;  2X48 A;  2R4G A;  4HEA 2;  3UNG C;  1SD6 A;  4P96 A;  1HOM A;  2K4J A;  1I1G A;  4M6X A;  3FM5 A;  4G7Z F;  2V1U A;  1R1T A;  3OYH A;  1OR7 A;  3HGY A;  3E1S A;  1PUE E;  2VPR A;  1FIA A;  2COB A;  1Y6I A;  2Y9Z A;  5E18 F;  3I5U A;  4I0A A;  1W1W E;  1RR7 A;  3P7N A;  2EZK A;  5IP7 J;  4E7I A;  3IWF A;  4IHW A;  1SEU A;  2GA2 A;  2Y0S A;  4WXC A;  4DOZ A;  3TED A;  2XIG A;  4RGU A;  2QLZ A;  3WG7 H;  3QU6 A;  4YFK F;  3Q9V A;  3BJA A;  1FBS A;  3OYK A;  3OWT A;  3B02 A;  2G9W A;  2AXL A;  2R5Z B;  4G12 A;  2VQG A;  4II3 A;  2AQF A;  2YSR A;  3S93 A;  2HS5 A;  2R7D A;  2ZME B;  3IKT A;  2IJL A;  4ZYH A;  3LQQ A;  3LSH A;  3RPU A;  1QZZ A;  2CFO A;  2WAQ N;  5EJC A;  1TNS A;  3ZOB A;  2BW3 A;  4CDG A;  1IV8 A;  2QQ8 A;  2Q0O A;  4L5E A;  2Y31 A;  1BR4 A;  2K9N A;  4HBL A;  3K4C A;  3W6V A;  2LK2 A;  3GTJ J;  1R7J A;  2HPM A;  3ISP A;  3MD2 A;  4MTE A;  3R6S A;  3I59 A;  3L09 A;  3T8R A;  4RB1 A;  4LB5 A;  4PZJ A;  3IH4 A;  3QWL A;  4BE2 A;  2VT3 A;  2HDW A;  2ECC A;  1VND A;  2LKP A;  3F21 A;  4KT5 C;  3CQZ J;  1XGO A;  1MJB A;  2JUG A;  3EUH C;  2DLL A;  5LEK A;  3PQJ A;  4Y4R A;  5LHH A;  2EA4 A;  1NG7 A;  1Y39 A;  4FAS D;  3QOP A;  1OLT A;  2M7A A;  2QKM B;  5GAH J;  4OOI A;  3L7W A;  5KAF C;  3KYD B;  2KHM A;  1BL0 A;  4QLC U;  1TBX A;  2VKV A;  1R5I D;  2WV1 A;  2DMU A;  2XGX A;  3ZQQ A;  4XRM A;  5CVI A;  5DS9 A;  6PAX A;  5F6F A;  2UXX A;  4IXA A;  2XV4 S;  4Q48 A;  3PIP F;  4HRI A;  1TWA J;  2JVG A;  3IC7 A;  1RC9 A;  3PNV A;  5FLV A;  2K86 A;  4FE7 A;  5H6R A;  3ZP5 A;  1ZRC A;  1QVT A;  2NS8 A;  4XKB A;  1P6R A;  2R7Q A;  1YIT I;  4EM0 B;  2FRH A;  3AG2 H;  2NNN A;  3QYB A;  2DU9 A;  5HS9 A;  1O3Q A;  4PJL A;  2Y0S N;  1HKQ A;  5FD5 A;  2ZCW A;  3M4O J;  3SEZ A;  5J4Y A;  4C9Y A;  1F43 A;  1QPI A;  2HYF A;  3S1Q J;  3OR1 C;  5LEJ A;  4YRV A;  1U3E M;  3HDD A;  1WPK A;  1ZEL A;  5ICF A;  4NHJ A;  3BDD A;  2OU2 A;  4PGH A;  4B47 A;  1ZR4 A;  3BR3 A;  2JA6 J;  1WJF A;  4EGY A;  1ZTR A;  2E36 A;  3O3K A;  3DV8 A;  3DTK A;  4M3D A;  2IGM A;  3BR0 A;  4A3F J;  3IUO A;  1MDM B;  3CCR I;  2M87 A;  2FF4 A;  1YJW I;  4ZC3 A;  4YFX F;  1BJZ A;  3GTG J;  5JVT A;  3S14 J;  1XCB A;  4BXX J;  5GAG J;  4F55 A;  1KGS A;  1MZB A;  3CUQ A;  4XQF A;  1JXS A;  2IA1 A;  5ED4 A;  3HOY J;  4ESB A;  2JJ7 A;  3BTL A;  3O8H A;  4CZC A;  2OBP A;  2JA7 J;  1BC8 C;  2FOK A;  4LG0 B;  1BOA A;  2M2E A;  4DZJ A;  1HKS A;  4I2O A;  2EIK H;  1LNW A;  2N8G A;  3RQ4 A;  2QF7 A;  1W4M A;  2EIL H;  4E7L A;  2KL4 A;  2GIV A;  2R7V A;  2EV0 A;  1U6G A;  4UV9 A;  2NOG A;  3ERM A;  2XF5 A;  1YW7 A;  2K85 A;  3NRV A;  4UY8 I;  2EIJ H;  3C1D A;  2PFB A;  2CW0 F;  3PNT A;  4M9X A;  3M8E A;  3HPG A;  1MJA A;  4KJZ A;  3ECO A;  3J80 K;  2TDX A;  3H3U A;  2P0W A;  1IUY A;  4PFO A;  3G73 A;  1YE9 A;  3ABK H;  1ITY A;  5M5X J;  3B73 A;  1T98 A;  2OJE D;  3IAM 2;  2L7F P;  4Q47 A;  1Z6T A;  4HSR A;  5KVR A;  1ACI A;  1S8N A;  2R7U A;  5FLX K;  4NQW B;  1QZE A;  4CUG A;  3JRF A;  4BDZ A;  2QM3 A;  3FK7 A;  1TP4 A;  1ZG3 A;  2MD0 A;  3GVA A;  2PX9 A;  1X4P A;  5FRO A;  2HU9 A;  3I54 A;  4HLY A;  5ICC A;  2CQN A;  3HRM A;  1G3T A;  3AFH A;  3E0J B;  2YUS A;  3S1R J;  3OL4 A;  2IS6 A;  4DYR A;  2BY3 A;  3HUG B;  1MBG A;  3L9F A;  2LC2 A;  2F5C A;  2M4K A;  4NC7 A;  1J7K A;  3LA2 A;  2QSG X;  2YR2 A;  1USS A;  1TZL A;  1YX5 A;  2RGV A;  1WH7 A;  3VEP A;  5IT3 A;  2JUC A;  4J19 A;  4I09 A;  4HQE A;  3MWM A;  3S32 A;  3F72 A;  1IRG A;  3IAS 2;  1GUU A;  2D5V A;  1EF4 A;  5E3L A;  2D1V A;  2VJJ A;  5EZG A;  4A3M J;  2LFB A;  4IKF A;  1IXS B;  2BZT A;  3JAM Z;  4AD9 A;  1B6A A;  3WG9 A;  1D1B A;  2KIM A;  2L7M P;  4JYK A;  4R1H A;  5ICE A;  4I6Z A;  4W1U A;  4UV8 A;  2H09 A;  4BAY A;  1TQP A;  4XRS G;  1OJL A;  2VE8 A;  3FBN B;  1X58 A;  1W5C C;  4IRG A;  4E6K G;  2X0L A;  3DTE A;  5BS6 A;  3I4M J;  4CIC A;  4BQQ A;  3WTX C;  1FMV A;  5JR3 A;  1K6Y A;  2HYG D;  1GHC A;  4MO7 A;  5BPD A;  3LWF A;  1B72 A;  1RET A;  1VQ9 I;  1ZRD A;  2XB5 A;  3K4B A;  1JI8 A;  5K7Z A;  3CLQ A;  4A0Z A;  3BZC A;  1D1A A;  1Y1V J;  2IA2 A;  3BT9 A;  4BAC A;  2NS7 A;  4EJV A;  2O6G E;  4C2M J;  3H0D A;  4LOC A;  2XAS A;  5DM6 F;  3PJR A;  2L4A A;  1S72 I;  1D3Y A;  4C3H J;  1PUF B;  3TL4 X;  3IP4 B;  1PVE A;  1R4M B;  3WTZ A;  4B43 A;  3K1N A;  4ZYG A;  2J5P A;  5EDN A;  3RQI A;  3R4K A;  2VIX A;  4DYQ A;  1W5T A;  5B1A H;  4WX9 A;  4GFB A;  2KIQ A;  3S8P A;  1F9N A;  1DPR A;  2EZL A;  2VQL A;  5C4J J;  4NC8 A;  1TWC J;  4YEJ A;  4XOP A;  2W85 A;  3ERE D;  1RUO A;  1DU0 A;  2VQH A;  3FKI J;  3TBI A;  4KNY A;  4A69 C;  2F6C A;  2A5Y B;  4IQ4 A;  3BTI A;  2M7B A;  2ZNY A;  2DMT A;  2MG4 A;  4OIQ F;  3FXU A;  4Y33 A;  1SD7 A;  1V3F A;  1IN5 A;  2W57 A;  3ABU A;  3DBR B;  4HOB A;  1FYL A;  3CME I;  2F48 A;  5HLG A;  3RZO J;  4BY1 J;  2QCO A;  2ZXI A;  3CO7 C;  3U21 A;  2PJR A;  3CC2 I;  3LFK A;  1KQ0 A;  1D8J A;  5LGN A;  2L3D A;  3GX4 X;  2ZXW H;  4CCJ A;  4PJ0 C;  1DQU A;  2LG4 A;  3QQA A;  4OIP F;  4CYC B;  3VYU B;  2H27 A;  1BR2 A;  4U87 A;  4ZZD A;  4XNF A;  4B1R A;  5KHD A;  2W25 A;  2P6T A;  2OTJ I;  1TW3 A;  4PFP A;  2EJR A;  2LD5 A;  2OAZ A;  3E97 A;  2ZME C;  4Y13 A;  1BA5 A;  1F4K A;  3W6K B;  2XAG A;  2ESH A;  3I0T A;  3KP7 A;  1AHD P;  1N75 A;  1B1B A;  1YIO A;  3L2U A;  2MYS A;  4QSH A;  4DJA A;  1J9I A;  4HLX A;  2P8T A;  1K78 B;  5GTI C;  4KN4 X;  1IGN A;  4A3C J;  3FX3 A;  2FJ1 A;  1I3Q J;  4JOM A;  5BMZ A;  4DBR A;  2XAJ A;  1IRZ A;  4O6J A;  2F5V A;  1FZP B;  2OZU A;  3EUA A;  2HQN A;  4XIC A;  3F9K A;  4KIT B;  2L0K A;  2BXZ A;  3B6A A;  2BY1 A;  1MMN A;  2B9S A;  2VJ4 A;  2CQX A;  1D5V A;  2Z1D A;  2ID3 A;  5EGO A;  3J7A O;  1ORK A;  1EH8 A;  4J00 A;  3KPH A;  5HDN A;  2VT2 A;  4QIW N;  2IP2 A;  4IVN A;  2TRT A;  3SDB A;  3LST A;  1IXR C;  1D5Y A;  2RQP A;  5DCM B;  2FQ3 A;  5M5W J;  3DEU A;  2UV1 A;  5EZH A;  3WHC A;  1QNT A;  4M73 A;  1RES A;  1K4S A;  3JRG A;  2GXB A;  1XN7 A;  1G8X A;  3TMO A;  1I39 A;  1MH3 A;  5J47 A;  2ZSH B;  3E5U A;  5L3B A;  1SD5 A;  4A6D A;  2KJB A;  5D6F A;  5L3C A;  2V4J C;  1KA8 A;  2DPD A;  2JRM A;  4HPQ A;  3RKW A;  3RKQ A;  2NAZ A;  1J09 A;  2VQC A;  1HSJ A;  1A31 A;  2F4I A;  1K7A A;  1RI7 A;  2H6C A;  3ABL H;  3DU5 A;  5M5Y J;  3M9A A;  3IH2 A;  2GOX B;  3ML6 A;  3NAU A;  4M74 A;  3EYY A;  4Y3O A;  4WF2 A;  2X85 A;  4XON A;  1JT6 A;  2X4H A;  4WXD A;  1NK2 P;  5D6E A;  1MW7 A;  1BIB A;  1ENH A;  1MND A;  1SVL A;  3KP4 A;  3P9K A;  1GVD A;  2NOJ B;  2EFN A;  4P55 A;  3U1K A;  2JZY A;  3E6D A;  5EEH A;  4RAG A;  1H88 C;  1V5E A;  2KDO A;  3K4M A;  4I7H A;  3M7G A;  4MGR A;  3HRU A;  1EV7 A;  5DD8 A;  5EF6 A;  4QPQ A;  2DTR A;  1K6O A;  4BJ5 C;  1X3U A;  3V7C A;  4BEH A;  3DKW A;  5F04 A;  4K2E A;  4BJT A;  1S7A A;  5D5X B;  2M4G A;  1VF9 A;  2IS1 A;  3ZQF A;  5TIS C;  3TO9 A;  1SD4 A;  1K79 A;  4XLN F;  1A35 A;  2Y2Z A;  2GQQ A;  3LOC A;  4XN3 A;  3RJP A;  1G6N A;  4CH7 A;  2RRE A;  3OYJ A;  2CSO A;  4KDP A;  3BTJ A;  3M8F A;  1W36 C;  3PUB A;  2W1O A;  5C4X J;  1XD7 A;  1E2X A;  2WA0 A;  3R60 A;  2B7E A;  3RKY A;  4OIR F;  2ME6 A;  4DYC A;  4A3B J;  3ZQ7 A;  1KU3 A;  3ECH A;  3OS1 A;  3JCU C;  2WV0 A;  4ASN A;  4LIT A;  5FJ8 J;  3F8M A;  1BOB A;  1UHW A;  2MH9 A;  2XRL A;  5HS7 A;  5C44 J;  3CJR B;  5BPI A;  3Q9S A;  1PYV A;  5ILS A;  3E7L A;  3OIP A;  3ABM H;  4KUM A;  2EB7 A;  1FBU A;  5HNF A;  2DA3 A;  1EH7 A;  3J80 Z;  2VBZ A;  4UB6 C;  1E17 A;  3J81 Z;  3A01 A;  3H92 A;  1XTA A;  2XHK A;  3I59 B;  4KN7 X;  4FET A;  1W0T A;  2JPB A;  1MIJ A;  2DFH A;  4C3J J;  2FNP A;  4F93 B;  3OYM A;  2XAH A;  3HC7 A;  2L54 A;  4CO8 A;  4QWQ A;  2CUJ A;  5FLX Z;  2HQ5 A;  4G94 A;  1YLF A;  1VZ0 A;  1W0U A;  2L5Q A;  5GAD J;  3ESW B;  5EG0 B;  2E1O A;  3VWB A;  4ESJ A;  4IRH A;  1Y0N A;  4GCV A;  4U7D A;  4A3J J;  1GDT A;  4BKX A;  2NVQ J;  2KIS A;  2LMD A;  3HPH A;  1SC7 A;  2DFF A;  3JRH A;  3DTI A;  1N77 A;  2UUZ A;  3K7A J;  4LG3 A;  4BE0 A;  2I10 A;  3DP7 A;  2FBI A;  3HTU A;  3ZPL A;  3I71 A;  1OCO H;  3SZP A;  1O57 A;  2DJI A;  1PP7 U;  3C2B A;  1MSF C;  3FIS A;  4J01 A;  2JRT A;  1A5J A;  2AQE A;  2ZB9 A;  5DM7 F;  2EPF A;  2ESN A;  5IT9 K;  2MAB A;  2LDU A;  1P4W A;  2E2I J;  1MKM A;  2FOW A;  3N97 A;  5HLI A;  4PK4 A;  2LSO A;  1QPM A;  1TQI A;  1LKX A;  2Z16 A;  4RAZ A;  4V2F A;  1FSH A;  3D5R C;  1OQY A;  4HW0 A;  3D5S C;  4BHC A;  2VON A;  4F7Z A;  1UZC A;  4QTR A;  1UFM A;  1W7P A;  4LGW A;  1TT5 B;  3FMR A;  3SEQ A;  4X6A J;  3JR9 A;  4M3G A;  1XPX A;  1FJL A;  5JVG F;  2HOS A;  2CV1 A;  1Z7L A;  3KIO A;  1HW2 A;  3F3X A;  3HHH A;  1O3R A;  2VBW A;  2VLA A;  2DMP A;  3ONQ A;  2XAQ A;  2EFO A;  2QEX I;  1E3O C;  4FX0 A;  2F5D A;  1I6X A;  1YI2 I;  2DFE A;  3FDY A;  4EJO A;  1PJR A;  2EV5 A;  5J6X A;  1H0M A;  3WE2 A;  2KPM A;  3TW7 A;  2OV7 A;  3GFL A;  2B63 J;  3KYC B;  4F92 B;  5HS8 A;  1X1B A;  4ZDL A;  3IKV A;  1NH3 A;  3QYE A;  4KIB A;  1A04 A;  1IW7 F;  4IHV A;  3WOD F;  5FFZ A;  3TGN A;  1DP7 P;  3QYF A;  1HQC A;  2ELJ A;  1ZGA A;  5K5Q A;  1JGG A;  3CUQ B;  4HG2 A;  5CVR A;  1GXQ A;  3JTH A;  5F1R A;  3GYH X;  3HKZ A;  1SAX A;  4IEJ A;  2H6B A;  3CC4 I;  2V26 A;  3RYR A;  5GPA A;  2WY7 Q;  3BCA A;  3KP6 A;  3PSF A;  3GCM A;  2ZFW A;  3LFU A;  2W48 A;  1FT9 A;  2LY9 A;  1FNN A;  1HW1 A;  4P5O A;  2Z99 A;  1OYI A;  4L9J A;  3TO6 A;  4KT6 A;  1SFO J;  3LNQ A;  1WJA A;  5FRM A;  2QQB A;  1KQ8 A;  1ZR2 A;  1R71 A;  1B8I B;  4G9Y A;  4U88 A;  4ANJ A;  2L9R A;  4PSX A;  3LSK A;  3NWS A;  5LRR A;  1R58 A;  4OIN F;  2WY8 Q;  2XAU A;  3DCF A;  1APL C;  3PL8 A;  3OY9 A;  4DQ2 A;  2XAF A;  1HST A;  4AIK A;  4OU0 A;  1KU9 A;  2G7U A;  1ETO A;  1SMT A;  1UB9 A;  4M72 A;  2V7F A;  3MMY B;  1VQK I;  4U0W A;  4U0Y A;  3FXR A;  5LBQ A;  2CGP A;  1T33 A;  5CVV A;  5KNL A;  1JTX A;  2K4B A;  3GTL J;  1U5T C;  5H2F C;  2EA2 A;  4M9Z A;  2RKH A;  1EA3 A;  3AG3 H;  3VSK A;  3OYI A;  4BBR J;  1G2H A;  1O7L A;  2E2H J;  5HVQ C;  4ZH4 F;  1WH5 A;  1IN8 A;  3ABT A;  5DDG A;  4KFC A;  3H5A A;  1YIJ I;  2Z5U A;  1XSX A;  4CHU A;  3L2R A;  4AIH A;  3DLA A;  1MBE A;  1ZN2 A;  4GXO A;  2PN6 A;  1A6Q A;  1W7P D;  2H94 A;  3S2D J;  4IOA F;  1U78 A;  3F6O A;  2EK5 A;  1J2X A;  3BPX A;  3GTM J;  1S3J A;  3VPR A;  3TO7 A;  3L2Q A;  4MIM A;  2ZXJ A;  3WU2 C;  3JW4 A;  4MTD A;  3MEX A;  2K40 A;  1D0X A;  3WTW C;  3CCS I;  1KYZ A;  4RGS A;  1IRX A;  1SAU A;  1JT0 A;  3D1N I;  1UAA A;  2HKX A;  2O03 A;  4XOR A;  3U9G A;  1UG0 A;  1FX7 A;  2DDA A;  1DDN A;  2PBI A;  3RKX A;  3OYA A;  2XGE A;  5F1J A;  1S7E A;  1QHH D;  3R61 A;  4Q5S F;  1X3W B;  1Y56 A;  2P5L C;  1X4O A;  4IRI A;  1LVA A;  2M8E A;  2WC2 A;  4A0Y A;  2CQK A;  4ESF A;  2K9M A;  2WAD A;  3CJT B;  1DP3 A;  4FT8 A;  2GBY A;  3NQO A;  3CCV I;  5DV5 A;  1SFU A;  3H3Z A;  4NB5 A;  5K7F A;  1ZRE A;  2K9L A;  3DU6 A;  3ASN H;  2M5W A;  1H9T A;  1RR8 C;  4XKC A;  3OSF A;  2M30 A;  2XF7 A;  4FE4 A;  1I6H J;  3CCY A;  2X6O A;  3ZN0 A;  1FY7 A;  4M71 A;  1R36 A;  1X1A A;  1LE8 A;  3A02 A;  2FEZ A;  2KRC A;  1HDD C;  3PFY A;  3WTS C;  2WAF A;  4B3A A;  2BY0 A;  3HEF A;  4YII A;  1KQ9 A;  2Y69 H;  1U9N A;  1U8B A;  1AKH A;  5D4S A;  1ETW A;  1OIS A;  2NYX A;  1Z1D A;  2O0Y A;  4JQF A;  2L2O A;  4YEL A;  5H6Q A;  1MNM C;  2IXS A;  1Z9C A;  2LVS A;  1VFC A;  1L3L A;  5JI6 A;  1E3H A;  5ERI A;  1OR7 C;  2EIM H;  4RB2 C;  3GFM A;  2A3S A;  4ZDO A;  3W2W A;  3OS2 A;  1I5Z A;  4HF1 A;  1NTC A;  2I8D A;  1VQM I;  4BXU A;  4L9V A;  4L5J A;  4EVI A;  3CMM A;  2MC4 A;  4TV7 A;  3RPU D;  3GLX A;  1UG2 A;  2E34 A;  4D1Q A;  2Q2E A;  1TQM A;  3JSP A;  1YS7 A;  4RS8 A;  5H20 A;  1ZLK A;  4A3K J;  2GAU A;  2FUG 2;  4XBF A;  3N4M A;  2AHQ A;  4DZP A;  3ULQ B;  4PGG A;  1R9T J;  4F91 B;  1ETK A;  1KU2 A;  2Q8K A;  4BBS J;  3M1E A;  2NNY A;  1YJ9 I;  3IL2 A;  3GEZ A;  3MN2 A;  3LSP A;  2L9N A;  1IC8 A;  3HSF A;  1T2K A;  2XDV A;  1Z21 A;  3V8K A;  4N4O B;  4YIR X;  5CPR B;  3F8B A;  3OOU A;  3OYF A;  2CV2 A;  3PIO F;  4D5C A;  3MKY B;  4CYD A;  4HF0 A;  4MHG A;  1XS9 A;  3CDL A;  4XRS A;  2HZD A;  4BNC A;  5EGO B;  2OUM A;  2HYJ A;  2DT6 A;  4CCK A;  4CCO A;  4KMU X;  2YX4 A;  4A3G J;  2DK8 A;  2NVY J;  3BR5 A;  1R6R A;  2V6C A;  2KLO A;  1IDZ A;  5LFA A;  1SAN A;  4HQM A;  5CQG A;  3I4P A;  1Z6R A;  4E7K A;  1HW5 A;  5DTD A;  2MA3 A;  3AG1 H;  1ONV A;  3W3C A;  1B9M A;  4GGG A;  4HDV A;  2V1D A;  2HZT A;  1XB4 A;  3OIQ A;  2XRO A;  3V42 A;  5B3S H;  4AU7 A;  1T39 A;  3MVP A;  2ETH A;  1YW8 A;  2QA4 I;  3ZMZ A;  3BLY A;  2DW4 A;  4XKW A;  1YRN A;  1AOY A;  3CMY A;  4GYI A;  3DEE A;  3TOB A;  3OV8 A;  4CXF A;  1MSE C;  4XLF A;  5L3D A;  4EV0 A;  3S2H J;  1LEB A;  2H8W A;  3E6M A;  2JK3 A;  1I3A A;  1F36 A;  1U8R A;  1J5Y A;  2CYY A;  3IRR A;  5E1Z B;  3V4G A;  1T0F A;  1VQ4 I;  3SJM A;  3H1C A;  1BI2 A;  1MBF A;  3T8T A;  1RIO H;  2KQR A;  1LFU P;  4ETS A;  1A36 A;  3U2R A;  4MNU A;  3F0C A;  2BE5 F;  3A2K A;  2ZJ2 A;  3HZJ A;  3CES A;  4YG2 F;  2FNA A;  4BEH B;  3OYC A;  3P9C A;  4RB0 A;  3BQZ A;  4I02 A;  4B8X A;  2BHZ A;  3ZMV A;  5B5E C;  3PQK A;  3EET A;  1HXD A;  1P2F A;  4RDU A;  1FOX A;  1T95 A;  2FSW A;  4AUX A;  4EEF G;  4L5I A;  1IV6 A;  4JBA A;  2DT7 B;  2MLG A;  4EM2 A;  2OPT A;  4IOC F;  2MLK A;  1Y0U A;  1Z7U A;  2JSP A;  4Y52 J;  1Y1W J;  3PO3 J;  2LBF A;  1HKT A;  3DXJ F;  1WKM A;  5FGM A;  3CUQ C;  4EJW A;  2IEK A;  3Q3S A;  4O3M A;  1RZ4 A;  4HA8 A;  3W6J B;  2IVM A;  1JTY A;  1MMD A;  1WJ5 A;  1K83 J;  1BIA A;  5CLS A;  3G4S I;  4IJA A;  4JP0 A;  1LB2 A;  2ICW G;  2KIU A;  1T56 A;  1ZQ3 P;  1YX3 A;  3PO2 J;  2F4O B;  3MZ8 A;  5DUI A;  3GF2 A;  3L00 A;  2ZJQ F;  1FP1 D;  3GTK J;  2QBY A;  3A0H C;  2IT0 A;  4II2 A;  1BJA A;  3IH3 A;  3GME A;  2OTL I;  2IW5 A;  5HOO A;  5IOY A;  1I1S A;  1OPC A;  1IZ1 A;  4DNC A;  4O5V A;  5IP9 J;  2ELH A;  3A01 B;  5HOD A;  5AIP A;  3G2B A;  2ZXH A;  1G59 A;  2JPC A;  1B4A A;  4XK4 A;  4BQN A;  2Z9O A;  4WWC A;  2PEX A;  5DD4 A;  3H5N A;  2LNB A;  4UXN A;  2B0L A;  2HPI A;  1KYW A;  1WJE A;  3G1M A;  4M6Y A;  3WTT C;  1S9H A;  1XX5 A;  1Z77 A;  3FXL A;  3K6G A;  3QPT A;  2YPR A;  2ZKZ A;  1QU3 A;  5LGU A;  2HGC A;  3GBG A;  4B09 A;  3OMY A;  1FOK A;  1FIP A;  1FSE A;  2K7L A;  4PSW A;  2FBH A;  2L7Z A;  2LOO A;  5LHG A;  4KYW A;  2RV8 A;  2DT5 A;  2VOD A;  2K27 A;  5EYR A;  3BG7 A;  2DXI A;  3CP2 A;  1BI3 A;  3K69 A;  1MDM A;  5HLH A;  5E8G A;  2O8X A;  2EQR A;  2K5C A;  3KYL A;  1JGS A;  4M3F A;  1SFE A;  4R79 A;  1JKR C;  4G6Q A;  4A12 A;  1YTY A;  4GYG A;  1YHQ I;  2XUB A;  4LIV A;  4G7H F;  2LYC A;  3LA7 A;  3ZGK A;  3S15 J;  2IA0 A;  5GPC A;  3V8L A;  3C2H A;  4XM3 A;  1I27 A;  1RKW A;  1W7P B;  1O4X A;  1EH6 A;  2OD5 A;  3GZ5 A;  3LMM A;  1XDS A;  2NS0 A;  3LSM A;  1OMI A;  3QAH A;  5D5V B;  5D4R A;  2AS5 F;  3K1P A;  2P7V B;  3O6B B;  1FOW A;  3HIF A;  4EJU A;  2QZ8 A;  4NDL A;  2V6E A;  4UHT A;  1XDU A;  5D8K B;  5FLM J;  2E19 A;  2F5E A;  3CJQ B;  2UZK A;  2HOE A;  3HOU J;  1ZLJ A;  5J3L A;  2PQ8 A;  2VE9 A;  2M0M A;  3RI4 A;  2NVU B;  3ZN1 A;  1IN7 A;  1ZKG A;  4XLC A;  1LVK A;  2HVQ A;  2IAI A;  4UUS A;  5IYC J;  1FPQ A;  1S6L A;  3ZXS A;  3F8N A;  1OCZ H;  3ZMS A;  4LK0 F;  2ISZ A;  3LSI A;  1J75 A;  2VXD A;  4C2T A;  1WVR A;  2COM A;  3KFW X;  2M45 A;  3E5X A;  1CGP A;  1HLV A;  3SXY A;  4BXF A;  4MLO A;  1OCC H;  3CCJ I;  3QP5 A;  4P1W A;  2D2W A;  3DPU A;  3QU3 A;  2E1M B;  3EUK L;  2H1K A;  2E7W A;  3CTA A;  3KEY A;  4OMY A;  4FX4 A;  3BWG A;  2HQR A;  1DGR M;  1GXP A;  1IRF A;  3TDU C;  2FX0 A;  2ID6 A;  3ZCO A;  2Y9Y A;  4L9T A;  4BH9 A;  3AKZ A;  1LUJ B;  2Z2S B;  1FTZ A;  4AIJ A;  1G3Y A;  3G6E I;  2H8R A;  1D1C A;  3FWE A;  2IGO A;  1XMA A;  1J59 A;  4AC0 A;  4EJT A;  5DUK A;  4OAY A;  3I64 A;  1G4D A;  4AM3 A;  2XRN A;  2XSD C;  4BHB A;  4EGZ A;  5E3O A;  5LRS A;  3I3L A;  1WHU A;  3H5R A;  4EM1 A;  3F23 A;  4IL6 C;  2DCE A;  4NNJ A;  2W00 A;  5DYM A;  4S05 A;  3JRE A;  1X19 A;  1BI1 A;  3OS0 A;  3L2V A;  1WRJ A;  2G0E A;  5J1R A;  5IYD J;  2V79 A;  4CCM A;  2TCT A;  2M9H A;  2E60 A;  4YIF A;  5JHU A;  2CWE A;  1X1D A;  4ENJ A;  1R23 A;  2VBY A;  5KAI C;  1Z67 A;  1VQ8 I;  2RNJ A;  3VYS B;  3ZR8 X;  3FXK A;  4MEY F;  2Y48 A;  3HHG A;  5K5R A;  1YO5 C;  3DFG A;  5K5O A;  2JSC A;  3CMA I;  4ZTJ A;  2EFQ A;  3LAJ A;  3VYT B;  3CZ6 A;  4GRI A;  1UCR A;  4X1E A;  1V55 H;  2BVL A;  3CCL I;  4RMN A;  2M1B A;  2VOP A;  2DMQ A;  3KZZ A;  3R0A A;  2HWV A;  4HX4 A;  3I9V 2;  2BW3 B;  2XF6 A;  1LPQ A;  5L3G A;  2RN7 A;  4RM3 A;  3L1P A;  3KZI C;  1TW2 A;  2VN2 A;  5HLT A;  1MBH A;  2K3F A;  3CP8 A;  1YYV A;  2LRE A;  2JT1 A;  2R7X A;  1IF1 A;  3GTO J;  2BV6 A;  4HV5 A;  2QSF X;  4CZZ A;  3CDH A;  5CKT A;  3G1O A;  3VFZ A;  4E4H A;  2Z3Y A;  2FA5 A;  3SZG A;  1BN5 A;  3RCO A;  1LJ9 A;  1PDN C;  4RM2 A;  1K4T A;  2KT0 A;  1Y8R B;  2KZV A;  2A61 A;  3JRA A;  2ECB A;  2E5Z A;  1ZGW A;  1M1E B;  5KK1 A;  2KIF A; 
#chains in the Genus database with same CATH homology
 4UVB A;  5D5W B;  4WCG A;  2UXN A;  2FE3 A;  4LK1 F;  2CO5 A;  3REO A;  3ZMU A;  2HDC A;  3KCC A;  1OKR A;  2DI3 A;  3V7R A;  2DQR A;  1BBY A;  1U5T A;  4Q4Z F;  3WGG A;  3F22 A;  2CFX A;  1SMY F;  1MJ9 A;  2ACJ A;  1K78 A;  1GVJ A;  1FP2 A;  1XSD A;  4LB6 B;  3EQL F;  1WQ2 A;  2QWW A;  4YFN F;  2WTE A;  3FXQ A;  1RNL A;  4BHP A;  5L3F A;  4XLP F;  3GXO A;  1OYW A;  1XMK A;  2FU4 A;  2DPU A;  3L2C A;  5D5U B;  1O3T A;  3WU0 A;  4KIG A;  3AAF A;  4MEX F;  5DCM A;  5LGT A;  3MZY A;  3EUH A;  5ICG A;  4PDK A;  5LLQ A;  3SFZ A;  3KET A;  3G3Z A;  4A5M A;  4FHT A;  3K1M A;  4I98 B;  2DK5 A;  1ZRF A;  3DPL C;  1R22 A;  5E17 F;  3V7S A;  2EWN A;  5L3E A;  4A5N A;  3CLO A;  4N0B A;  2DFI A;  1XGS A;  2MH2 A;  2R3S A;  3BOQ A;  3WTV C;  2HR3 A;  2A6E F;  2D45 A;  3K2Z A;  2P7C B;  4GO1 A;  3KEQ A;  2OA4 A;  5F64 A;  3RDI A;  3JTG A;  4OMZ A;  3QP6 A;  4XSX F;  4CGZ A;  3TDZ C;  4LJZ F;  1JHH A;  2O3F A;  5CYV A;  4HZF A;  4RAY A;  2E1N A;  2STT A;  1R00 A;  3CJN A;  1R1U A;  2PMU A;  3RIR A;  1XGN A;  1SFX A;  2VOO A;  1BC7 C;  3KP5 A;  2ADU A;  2ZO4 A;  1WWX A;  1ZGJ A;  1NHA A;  2V9V A;  3IRQ A;  3BY6 A;  2PMH A;  3T1B A;  1VTN C;  4ENM A;  1UST A;  4JK1 X;  1TLH B;  3GFJ A;  2RC4 A;  4XRF A;  1DUX C;  2FXA A;  4OIO F;  2YX7 A;  5FO5 A;  1YFH A;  1S7O A;  2FMY A;  3HSR A;  1CF7 A;  4UNO A;  3BRO A;  1O7F A;  2GZW A;  3GUD A;  1G3S A;  3EYI A;  2LF7 A;  1FC3 A;  2R7F A;  3BJO A;  5E8I A;  5HDK A;  4U7B A;  2W84 A;  3T0Y A;  2A6H F;  1ZG1 A;  2HFH A;  3MCZ A;  1T38 A;  2MD5 A;  4G6D A;  4HF2 A;  1YQA A;  2L02 A;  2VC1 A;  4L0Z B;  4WXH A;  3HOT A;  1G3W A;  4HV6 A;  2QBY B;  2MC3 A;  1B9N A;  1J0R A;  3SQN A;  3V8J A;  3E5Q A;  3F6V A;  1D8K A;  3IHU A;  5FB2 A;  1DPU A;  1YG2 A;  2LF8 A;  1O3S A;  3GO5 A;  4UVC A;  4I0B A;  2VC0 A;  1LDK B;  5ILV A;  3BPV A;  2W24 A;  4KA4 A;  3WTU C;  2G7H A;  2QEN A;  1ZAR A;  3MFK A;  2K02 A;  4LLG F;  5FD6 A;  2XKP A;  2A07 F;  4BQA A;  2F5F A;  4ZYD A;  4HDU A;  3MQ0 A;  1FLI A;  2DO7 A;  3KE2 A;  5TJJ A;  3RPQ A;  3FHZ A;  3TKY A;  2OQG A;  2VXZ A;  4ZZL A;  1XSV A;  1S29 A;  1BM9 A;  2QQA A;  2PG4 A;  2D1H A;  2P5K A;  4L9N A;  1ODD A;  3BJ6 A;  2PLY A;  1LDJ A;  1IN4 A;  1F5T A;  3OOP A;  5HDG A;  3WGH A;  2BBY A;  2DAO A;  1JHF A;  2KKO A;  3J81 K;  5A2Q K;  1R1V A;  3LA3 A;  1ZAO A;  3O2P E;  5TRD A;  4L0Y B;  1LQ1 A;  4MQV A;  4A0X A;  5IT9 Z;  4A2U A;  4XSZ F;  5J8C A;  4A6E A;  5ILU A;  2PJP A;  4Y15 A;  2ZME A;  4P9U A;  1QZY A;  4HAM A;  3K9T A;  1ULY A;  3RYP A;  1ON2 A;  3KZY A;  4HYE A;  5D8L B;  5EEG A;  4MQ9 F;  5BQT A;  2P4W A;  4I01 A;  1T6S A;  4AVP A;  4UUV A;  3GZ6 A;  3I58 A;  4ON0 A;  3CO6 C;  4KIC A;  4PCQ A;  3HRS A;  3BZ6 A;  3JSO A;  3IWZ A;  3HTS B;  3T5X A;  1RUN A;  5E1W A;  2VBX A;  3VB2 A;  2P5V A;  1KU7 A;  4IPA A;  2HTJ A;  3HYI A;  5E20 A;  5AIQ A;  4HX7 A;  2IPQ X;  3E6C C;  4IF4 A;  2L01 A;  4LFU A;  4ENK A;  1OYY A;  2Y0M A;  1TNT A;  2ISY A;  1ZH5 A;  2HKO A;  5CVJ A;  5J8F A;  3HSE A;  1V4R A;  3GW2 A;  2HTS A;  1B59 A;  3D5L A;  3RTR A;  2KJC A;  2QVO A;  1UHM A;  4D0P A;  1AWC A;  1FWZ A;  2DBB A;  2E1C A;  3DQV C;  2XVC A;  2GA1 A;  1ZYR F;  4BYY A;  4LLN A;  1QGP A;  3P9I A;  5LHI A;  1U5T B;  1Z91 A;  1WSU A;  2FBK A;  3PFI A;  3K0L A;  4LG0 A;  2OZ6 A;  1P4X A;  1QO0 D;  4AWX B;  1IN6 A;  2QUF A;  1HBX G;  5JFR A;  1FYM A;  1LEA A;  1R5H A;  1ZHF A;  3WGI A;  5CJ9 A;  4RB3 C;  4WK8 F;  5DEQ A;  5DCF A;  2IRF G;  2RDP A;  1PP8 F;  2ZBK A;  3Q5F A;  4EMS A;  4N9H A;  4G7O F;  2O61 A;  3C7J A;  2FML A;  3WE3 A;  1YS6 A;  4NQW A;  2QYO A;  2XKO A;  4U0V A;  1Q1H A;  3U1D A;  2UWM A;  2EFP A;  2BYV E;  4RGX A;  1FBQ A;  2JTV A;  3ZMT A;  4M9S A;  5CVU A;  2F2E A;  3KP3 A;  3KLN A;  4Z2Y A;  3HUG A;  3S2W A;  2PI0 A;  1QBJ A;  3R0J A;  3EDP A;  4E70 A;  3E3V A;  1FYK A;  1C0W A;  5K1Y A;  3F8F A;  4LLL A;  3KEO A;  4Y17 A;  4HX8 A;  4G8X A;  1IAW A;  2A69 F;  4KMF A;  3KP2 A;  2C6Y A;  4IHS A;  2L4M A;  4N9I A;  4ZYE A;  2V1X A;  3SZT A;  2E7X A;  4H0E A;  1XGM A;  2OQR A;  5AON A;  3FZV A;  2HEO A;  4LMY A;  4EQQ A;  3GWZ A;  3ZMD A;  2GXG A;  3DF8 A;  1IXC A;  2Z33 A;  3C3W A;  3HRT A;  1XCV A;  4RGR A;  3I53 A;  3FM3 A;  1CF7 B;  3DPT A;  3SHF A;  3ELK A;  3WTY C;  5BOX A;  5A2Q Z;  3BP8 A;  5E1X A;  3MZH A;  1H9G A;  3CUO A;  1R5G A;  2EFW A;  1ON1 A;  1BI0 A;  4L18 B;  1L0O C;  3VOD A;  2P6S A;  2CG4 A;  3WU1 B;  4ENN A;  1MGT A;  3VOE A;  3TOA A;  3LQR A;  3FMS A;  2RVC A;  2Y75 A;  2GWR A;  2EV6 A;  3COA C;  1Z05 A;  2STW A;  2DQL A;  1P92 A;  1P4A A;  2MBF A;  3D0S A;  1YW9 A;  2J5O A;  5FFX A;  2YU3 A;  1QQI A;  3MAJ A;  1ZG5 A;  1LDD A;  2QQ9 A;  3JAM K;  3QRF F;  3ROU A;  2WWY A;  1REP C;  1TTY A;  3GFI A;  4LD5 A;  4R8H A;  4S04 A;  2ZNZ A;  2BGC A;  4P9F A;  4UVA A;  2BEO A;  3FF5 A;  3NEU A;  4KIF A;  1F1Z A;  3TQN A;  2A68 F;  4IHT A;  1MD0 A;  1W5S A;  3F8C A;  2KRF A;  1STZ A;  3KLO A;  3HOS A;  1WI9 A;  1U2W A;  3C18 A;  3LAP A;  1JE8 A;  3E6B A;  3FMQ A;  3QPH A;  2NRA C;  1SD6 A;  4P96 A;  2K4J A;  1I1G A;  4M6X A;  3FM5 A;  4G7Z F;  2V1U A;  1R1T A;  1OR7 A;  1PUE E;  5E18 F;  3I5U A;  4I0A A;  3P7N A;  3IWF A;  2GA2 A;  4WXC A;  2XIG A;  4RGU A;  2QLZ A;  3QU6 A;  4YFK F;  3Q9V A;  3BJA A;  1FBS A;  3B02 A;  2G9W A;  2AXL A;  2YSR A;  2HS5 A;  2R7D A;  2ZME B;  3IKT A;  2IJL A;  4ZYH A;  3LQQ A;  3RPU A;  1QZZ A;  1TNS A;  4CDG A;  2Q0O A;  4HBL A;  1R7J A;  3ISP A;  4MTE A;  3R6S A;  3I59 A;  3L09 A;  3T8R A;  4RB1 A;  4LB5 A;  4PZJ A;  2VT3 A;  3F21 A;  2LKP A;  4KT5 C;  1XGO A;  1MJB A;  2DLL A;  5LEK A;  3PQJ A;  5LHH A;  2EA4 A;  3QOP A;  4OOI A;  3L7W A;  4QLC U;  1TBX A;  2XGX A;  5CVI A;  6PAX A;  5F6F A;  2UXX A;  4IXA A;  2XV4 S;  4Q48 A;  3IC7 A;  2K86 A;  5H6R A;  3ZP5 A;  1ZRC A;  1P6R A;  4EM0 B;  2FRH A;  2NNN A;  2DU9 A;  5HS9 A;  1O3Q A;  1HKQ A;  5FD5 A;  2ZCW A;  2HYF A;  5LEJ A;  1U3E M;  5ICF A;  4NHJ A;  3BDD A;  2OU2 A;  4PGH A;  4EGY A;  3O3K A;  3DV8 A;  1MDM B;  2M87 A;  2FF4 A;  4YFX F;  5JVT A;  1XCB A;  1KGS A;  1MZB A;  3CUQ A;  1JXS A;  2IA1 A;  5ED4 A;  4ESB A;  2OBP A;  1BC8 C;  2FOK A;  4LG0 B;  1BOA A;  4I2O A;  1HKS A;  1LNW A;  1W4M A;  2GIV A;  2EV0 A;  1U6G A;  4UV9 A;  1YW7 A;  3NRV A;  3C1D A;  2PFB A;  2CW0 F;  4M9X A;  3M8E A;  1MJA A;  3ECO A;  3J80 K;  2TDX A;  3H3U A;  1IUY A;  3G73 A;  3B73 A;  1T98 A;  4Q47 A;  1Z6T A;  5KVR A;  1S8N A;  5FLX K;  2QM3 A;  1ZG3 A;  3GVA A;  3I54 A;  4HLY A;  5ICC A;  3HRM A;  1G3T A;  3L9F A;  2F5C A;  1J7K A;  3LA2 A;  2YR2 A;  1USS A;  2RGV A;  3VEP A;  5IT3 A;  4I09 A;  4HQE A;  3MWM A;  3F72 A;  1IRG A;  2D1V A;  1IXS B;  3JAM Z;  4AD9 A;  1B6A A;  3WG9 A;  2KIM A;  4R1H A;  5ICE A;  4UV8 A;  2H09 A;  4BAY A;  1TQP A;  2VE8 A;  4IRG A;  2X0L A;  5BS6 A;  4CIC A;  3WTX C;  5JR3 A;  2HYG D;  1GHC A;  5BPD A;  3LWF A;  1ZRD A;  4A0Z A;  2O6G E;  2IA2 A;  4EJV A;  2XAS A;  2L4A A;  1D3Y A;  3WTZ A;  4ZYG A;  3K1N A;  2J5P A;  3R4K A;  4WX9 A;  1W5T A;  1F9N A;  1DPR A;  2W85 A;  3ERE D;  1RUO A;  4KNY A;  2A5Y B;  2ZNY A;  4OIQ F;  3FXU A;  1SD7 A;  1V3F A;  1IN5 A;  2W57 A;  3ABU A;  4HOB A;  1FYL A;  5HLG A;  3CO7 C;  3LFK A;  1KQ0 A;  1D8J A;  5LGN A;  2L3D A;  3GX4 X;  4OIP F;  2H27 A;  4ZZD A;  2W25 A;  2P6T A;  1TW3 A;  2EJR A;  2OAZ A;  3E97 A;  4Y13 A;  1F4K A;  3W6K B;  2XAG A;  2ESH A;  3I0T A;  3KP7 A;  1B1B A;  1YIO A;  1J9I A;  4HLX A;  2P8T A;  1K78 B;  4KN4 X;  3FX3 A;  5BMZ A;  2XAJ A;  4O6J A;  1FZP B;  2OZU A;  2HQN A;  1D5V A;  3J7A O;  1EH8 A;  5HDN A;  2VT2 A;  2IP2 A;  4IVN A;  3LST A;  1IXR C;  2RQP A;  5DCM B;  2FQ3 A;  3DEU A;  1QNT A;  4M73 A;  2GXB A;  1XN7 A;  5L3B A;  3E5U A;  1SD5 A;  4A6D A;  2KJB A;  5D6F A;  5L3C A;  1KA8 A;  2DPD A;  3RKW A;  2NAZ A;  1HSJ A;  1K7A A;  1RI7 A;  2H6C A;  3M9A A;  3ML6 A;  4M74 A;  3EYY A;  4WF2 A;  2X4H A;  4WXD A;  5D6E A;  1BIB A;  3P9K A;  3KP4 A;  2EFN A;  4P55 A;  2JZY A;  3E6D A;  5EEH A;  4I7H A;  3M7G A;  4MGR A;  3HRU A;  1EV7 A;  5DD8 A;  2DTR A;  1K6O A;  1X3U A;  3V7C A;  3DKW A;  4K2E A;  1S7A A;  5D5X B;  1K79 A;  3TO9 A;  1SD4 A;  4XLN F;  2GQQ A;  3RJP A;  1G6N A;  4KDP A;  2CSO A;  3M8F A;  1XD7 A;  1E2X A;  3R60 A;  3RKY A;  4OIR F;  3ZQ7 A;  1KU3 A;  3ECH A;  2WV0 A;  4ASN A;  3F8M A;  1UHW A;  2MH9 A;  5HS7 A;  5BPI A;  3Q9S A;  5ILS A;  4KUM A;  2EB7 A;  1FBU A;  1EH7 A;  3J80 Z;  2VBZ A;  1E17 A;  3J81 Z;  3H92 A;  2XHK A;  3I59 B;  4KN7 X;  2JPB A;  2FNP A;  2XAH A;  4CO8 A;  2L54 A;  4QWQ A;  5FLX Z;  4G94 A;  1YLF A;  4ESJ A;  4IRH A;  4GCV A;  4U7D A;  3DP7 A;  2FBI A;  3HTU A;  3ZPL A;  3I71 A;  3SZP A;  1O57 A;  1PP7 U;  2JRT A;  5IT9 K;  2ESN A;  2LDU A;  1P4W A;  1MKM A;  3N97 A;  5HLI A;  4RAZ A;  2LSO A;  1QPM A;  1TQI A;  1FSH A;  4HW0 A;  2VON A;  4BHC A;  4F7Z A;  1UFM A;  1W7P A;  4LGW A;  3FMR A;  1HW2 A;  3F3X A;  3HHH A;  1O3R A;  2VBW A;  2XAQ A;  2EFO A;  4FX0 A;  2F5D A;  1I6X A;  4EJO A;  2EV5 A;  5J6X A;  1H0M A;  3WE2 A;  3GFL A;  5HS8 A;  3IKV A;  4KIB A;  1A04 A;  1IW7 F;  3WOD F;  5FFZ A;  3TGN A;  1DP7 P;  1HQC A;  1ZGA A;  5K5Q A;  3CUQ B;  5CVR A;  1GXQ A;  3JTH A;  5F1R A;  3GYH X;  1SAX A;  2H6B A;  3RYR A;  3KP6 A;  2ZFW A;  1FT9 A;  1FNN A;  1HW1 A;  4P5O A;  2Z99 A;  1OYI A;  4L9J A;  3TO6 A;  2QQB A;  1KQ8 A;  4G9Y A;  4U88 A;  5LRR A;  1R58 A;  4OIN F;  4DQ2 A;  2XAF A;  1HST A;  4AIK A;  4OU0 A;  1KU9 A;  2G7U A;  1SMT A;  1UB9 A;  4M72 A;  4U0W A;  4U0Y A;  3FXR A;  5LBQ A;  2CGP A;  5CVV A;  2K4B A;  1U5T C;  2EA2 A;  4M9Z A;  2RKH A;  1O7L A;  5HVQ C;  4ZH4 F;  3ABT A;  1IN8 A;  5DDG A;  4KFC A;  2Z5U A;  1XSX A;  4CHU A;  4AIH A;  1ZN2 A;  4GXO A;  2PN6 A;  1W7P D;  2H94 A;  1U78 A;  3F6O A;  2EK5 A;  1J2X A;  3BPX A;  1S3J A;  3TO7 A;  2ZXJ A;  3JW4 A;  4MTD A;  3MEX A;  3WTW C;  1KYZ A;  4RGS A;  2HKX A;  2O03 A;  3U9G A;  1FX7 A;  1DDN A;  2PBI A;  3RKX A;  3R61 A;  4Q5S F;  2P5L C;  4IRI A;  1LVA A;  2M8E A;  2WC2 A;  4A0Y A;  2CQK A;  4ESF A;  4FT8 A;  3NQO A;  5DV5 A;  1SFU A;  3H3Z A;  4NB5 A;  1ZRE A;  2M5W A;  1H9T A;  2M30 A;  3ZN0 A;  1FY7 A;  4M71 A;  1R36 A;  2FEZ A;  3WTS C;  4YII A;  1KQ9 A;  5D4S A;  2NYX A;  1Z1D A;  2O0Y A;  4JQF A;  5H6Q A;  1Z9C A;  1L3L A;  5JI6 A;  5ERI A;  4RB2 C;  3GFM A;  2A3S A;  1I5Z A;  4HF1 A;  4BXU A;  4L9V A;  4L5J A;  4EVI A;  4TV7 A;  3GLX A;  2Q2E A;  1TQM A;  3JSP A;  1YS7 A;  4RS8 A;  5H20 A;  1ZLK A;  2GAU A;  4XBF A;  3N4M A;  3ULQ B;  4PGG A;  1KU2 A;  2Q8K A;  3M1E A;  2NNY A;  3IL2 A;  3GEZ A;  3HSF A;  1T2K A;  3V8K A;  3F8B A;  4CYD A;  4HF0 A;  4MHG A;  4BNC A;  4KMU X;  2YX4 A;  2DK8 A;  2V6C A;  4HQM A;  3I4P A;  1Z6R A;  1HW5 A;  2MA3 A;  1ONV A;  1B9M A;  4GGG A;  4HDV A;  2V1D A;  2HZT A;  1XB4 A;  2XRO A;  1T39 A;  2ETH A;  1YW8 A;  3ZMZ A;  2DW4 A;  1AOY A;  4GYI A;  3TOB A;  3OV8 A;  4CXF A;  5L3D A;  4EV0 A;  1LEB A;  3E6M A;  1U8R A;  1J5Y A;  2CYY A;  3IRR A;  5E1Z B;  3V4G A;  1T0F A;  1BI2 A;  1RIO H;  3T8T A;  4ETS A;  3U2R A;  4MNU A;  2BE5 F;  2ZJ2 A;  4YG2 F;  2FNA A;  3P9C A;  4RB0 A;  4I02 A;  4B8X A;  3ZMV A;  3PQK A;  3EET A;  1HXD A;  1P2F A;  2FSW A;  4L5I A;  4JBA A;  2MLG A;  4EM2 A;  2MLK A;  1Y0U A;  1Z7U A;  1HKT A;  3DXJ F;  1WKM A;  5FGM A;  3CUQ C;  4EJW A;  4O3M A;  1RZ4 A;  4HA8 A;  3W6J B;  2IVM A;  5CLS A;  1BIA A;  4IJA A;  1LB2 A;  2KIU A;  5DUI A;  3GF2 A;  3L00 A;  1FP1 D;  2QBY A;  2IT0 A;  1BJA A;  2IW5 A;  5HOO A;  1I1S A;  1OPC A;  1IZ1 A;  4DNC A;  4O5V A;  2ELH A;  5AIP A;  2Z9O A;  2JPC A;  1B4A A;  4WWC A;  2PEX A;  5DD4 A;  2LNB A;  4UXN A;  2B0L A;  1KYW A;  4M6Y A;  3WTT C;  3QPT A;  2YPR A;  2ZKZ A;  5LGU A;  2HGC A;  4B09 A;  1FOK A;  1FSE A;  2K7L A;  2FBH A;  5LHG A;  4KYW A;  2RV8 A;  2DT5 A;  2VOD A;  2K27 A;  1BI3 A;  3K69 A;  1MDM A;  5HLH A;  5E8G A;  2O8X A;  1JGS A;  4R79 A;  1SFE A;  4G6Q A;  4A12 A;  1YTY A;  4GYG A;  2XUB A;  4G7H F;  3LA7 A;  2IA0 A;  3V8L A;  1I27 A;  1W7P B;  5D5V B;  1EH6 A;  2OD5 A;  3GZ5 A;  1XDS A;  2NS0 A;  3QAH A;  1OMI A;  5D4R A;  2AS5 F;  3K1P A;  2P7V B;  3O6B B;  3HIF A;  4EJU A;  2QZ8 A;  4UHT A;  1XDU A;  5D8K B;  2F5E A;  2UZK A;  2HOE A;  1ZLJ A;  2PQ8 A;  2VE9 A;  3RI4 A;  3ZN1 A;  1IN7 A;  1FPQ A;  1S6L A;  3F8N A;  3ZMS A;  4LK0 F;  2ISZ A;  1J75 A;  2COM A;  3KFW X;  2M45 A;  3E5X A;  1CGP A;  3SXY A;  3QP5 A;  2D2W A;  3QU3 A;  2E7W A;  3CTA A;  4OMY A;  4FX4 A;  3BWG A;  2HQR A;  1GXP A;  1IRF A;  3TDU C;  4L9T A;  4BH9 A;  4AIJ A;  1G3Y A;  3FWE A;  1XMA A;  1J59 A;  4EJT A;  5DUK A;  3I64 A;  1G4D A;  2XRN A;  4BHB A;  4EGZ A;  5LRS A;  4EM1 A;  3F23 A;  5DYM A;  4S05 A;  1BI1 A;  1WRJ A;  2V79 A;  4YIF A;  5JHU A;  2CWE A;  4ENJ A;  1R23 A;  2VBY A;  2RNJ A;  4MEY F;  2Y48 A;  3HHG A;  5K5R A;  1YO5 C;  3DFG A;  5K5O A;  2JSC A;  2EFQ A;  3LAJ A;  1UCR A;  2M1B A;  2VOP A;  3KZZ A;  3R0A A;  2HWV A;  4HX4 A;  5L3G A;  2RN7 A;  1TW2 A;  2VN2 A;  1YYV A;  2JT1 A;  1IF1 A;  2BV6 A;  4HV5 A;  4CZZ A;  3CDH A;  3VFZ A;  2Z3Y A;  2FA5 A;  1BN5 A;  1LJ9 A;  1PDN C;  2A61 A;  5KK1 A;  2KIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...