1J9IA

Structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into specific DNA recognition during the assembly of a viral genome packaging machine.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
molecule keywords TERMINASE SMALL SUBUNIT
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j9iA00
5LLQA 1HKTA 4ENMA 1U8RA 4YG2F 2P6TA 2VC0A 4IJAA 5IT9Z 2HGCA 2DI3A 4HF1A 1TW2A 2E7XA 5L3DA 1XSXA 1F1ZA 4EJUA 1RIOH 5ED4A 3CJNA 2P7CB 3KP2A 3WTSC 4PZJA 1YS6A 1JE8A 3EUHA 3JSOA 4MEYF 3VB2A 3HIFA 1FPQA 4A2UA 3M1EA 2ZMEA 3RKWA 3IC7A 1OR7A 3W6JB 2OU2A 4XSXF 3LQRA 5K5QA 2V1DA 1H9GA 2ACJA 1HSTA 2IP2A 2PEXA 3RPUA 3ZN1A 3ZP5A 4EVIA 4IXAA 5K5RA 4EJOA 4O6JA 3E5XA 4G6QA 4UHTA 2EFOA 3O2PE 5DEQA 5D8LB 2O6GE 4O3MA 1B4AA 4HDUA 2M1BA 5ERIA 4DNCA 4OIQF 1I5ZA 5H6RA 3BY6A 2Z3YA 3I64A 3I71A 4FX4A 1BOAA 2KIFA 1H0MA 5K1YA 3F8NA 3KEOA 4CXFA 1E17A 1GXPA 3NQOA 4KA4A 5DD8A 3C1DA 3E5UA 1T38A 3RYRA 2VT2A 3B73A 3MZHA 3SHFA 2NYXA 4KMUX 3FX3A 2MA3A 4M71A 4ENNA 3CUQB 3ABTA 4A6DA 3DQVC 4S05A 4HBLA 2ZJ2A 1MJBA 1AOYA 3MZYA 1ZH5A 2BV6A 2NAZA 2Q2EA 5ICFA 2CWEA 1ZRFA 1OKRA 1BI2A 2DQRA 1XSDA 4HYEA 2RN7A 5AIQA 1Z6TA 2OQGA 2F5CA 2MBFA 3T8RA 3FMQA 2Y48A 4ZYGA 1J7KA 5D6EA 3ISPA 2A3SA 2KKOA 3FM5A 2JRTA 3MCZA 1XDSA 4U0VA 2NNNA 1ZG3A 5HDNA 1SMYF 4R79A 2DK8A 3EYIA 1IW7F 2HQRA 1W7PD 5FGMA 4KNYA 2VC1A 2VOOA 3O3KA 3J81Z 4L9VA 1U5TB 5ICCA 4CHUA 3GXOA 5FB2A 2JPBA 2V79A 1G3SA 2W24A 5E8GA 1G3WA 1D8JA 3ZMVA 1FP1D 5L3BA 1HBXG 2HDCA 4S04A 4AVPA 5TJJA 2ESNA 2QZ8A 4HX4A 3BJAA 2FNAA 2DQLA 3FZVA 2QQAA 4IHTA 2OAZA 5ICGA 1L0OC 3N4MA 2VOPA 2PI0A 2EA2A 2TDXA 5LGTA 1R00A 3QOPA 4OIRF 3ZMDA 4LB6B 1LB2A 3DFGA 2FMYA 4E70A 2VONA 4HOBA 1X3UA 2HTSA 2JT1A 3KEQA 5LHIA 4TV7A 5KK1A 4BHPA 3TKYA 5D5WB 4GYIA 2R7DA 1DPUA 4BNCA 4MQ9F 1CF7B 2IT0A 2UXNA 4I0BA 1ZREA 1T39A 2OA4A 2ETHA 5FO5A 1LEAA 2MC3A 1CGPA 2VE8A 1OYYA 3IRQA 3D0SA 4G9YA 4G8XA 4CDGA 3TOAA 1P6RA 2DLLA 1K7AA 4MGRA 3MWMA 4M9SA 2BE5F 1BIBA 5E18F 4OIOF 4L5IA 4UVBA 1KA8A 3I59A 5D5UB 2ESHA 4LJZF 2GWRA 4CZZA 4I02A 4MNUA 3I53A 1TW3A 5DV5A 3E97A 1O3TA 1SFXA 1WRJA 1XGSA 4M72A 1KYZA 4Q48A 1YTYA 5D8KB 4EM0B 3RKYA 1XGOA 4A12A 2DT5A 2FSWA 3DPTA 3H3ZA 3U9GA 5IT9K 4N9HA 2Z5UA 1OMIA 4HW0A 2IA0A 2FE3A 3I5UA 2QENA 2A69F 2DPUA 2IA2A 3LA7A 3ZMUA 4AIKA 2L4MA 5LBQA 2YR2A 1FT9A 1RZ4A 4RGXA 1QGPA 1U2WA 5CVJA 2G7HA 3F21A 3KETA 2MLKA 2R7FA 5HLGA 3L00A 4AD9A 3ECOA 4NB5A 2PMHA 4PCQA 2VN2A 1DPRA 3BWGA 5ILSA 3BJOA 1FBUA 2M30A 1LEBA 4P55A 1XN7A 1R1VA 3K0LA 4RB1A 5LEJA 4Z2YA 1IRGA 4OINF 2ADUA 3C3WA 2FF4A 2WV0A 2L01A 3P9KA 4QLCU 2RC4A 2HKOA 1J59A 2VBYA 4KUMA 5FLXK 1YW9A 1P92A 1IF1A 1S7OA 2MH9A 4FHTA 2IRFG 2XROA 4ZZDA 2ELHA 2STWA 1FSEA 1BC8C 3F8FA 2FA5A 5D5XB 2J5PA 3V8KA 5BS6A 5E20A 2ZBKA 1IN8A 3LSTA 3ZMTA 1KU7A 4HAMA 3E6DA 1BBYA 4N0BA 1SD6A 3H3UA 2HTJA 1QZZA 3EQLF 4HA8A 1G4DA 2CGPA 4HF2A 1BM9A 4IRGA 2DFIA 3V7CA 1PDNC 5J6XA 2OZ6A 4LB5A 3RYPA 4KFCA 3EDPA 2XVCA 3DPLC 3HHHA 5EEHA 1ZRDA 3IKTA 4KT5C 1QO0D 3KP5A 1G3TA 4PGGA 3DP7A 5D4SA 4WF2A 2G7UA 1G3YA 4HQMA 1W4MA 1ZGAA 2PQ8A 3LWFA 2GZWA 5LRRA 3PQKA 3NEUA 4LK1F 3Q9SA 4U0YA 2VBWA 3TQNA 3F8CA 4XLPF 5BQTA 2E1CA 3J80Z 1P4AA 4JBAA 2VT3A 4P9UA 5JFRA 1F9NA 3O6BB 2HZTA 4KICA 2DU9A 2CO5A 2IW5A 2P6SA 1XSVA 4NQWA 1U5TA 2PN6A 5D5VB 3SZPA 2QBYA 4M6YA 2M87A 2E7WA 4HX8A 3EYYA 3ZMZA 4NHJA 3F72A 5A2QK 3CO6C 1F4KA 3JTHA 2BYVE 4Q4ZF 5BMZA 1DUXC 3WU0A 3IRRA 2C6YA 1REPC 2EV0A 3KP3A 3WTYC 1MZBA 3LFKA 2UZKA 4HF0A 4M73A 3WGIA 1STZA 1QPMA 5E8IA 3BP8A 1Z91A 3IHUA 2YX4A 3MQ0A 1FSHA 2CW0F 4UUVA 1G6NA 4F7ZA 4Y13A 4ZYHA 1ODDA 2PMUA 3KP4A 5J8FA 1O3QA 5F64A 1IN4A 2AS5F 4BQAA 1Z1DA 4FT8A 4EM2A 4LG0A 4CYDA 1J0RA 3LAPA 3MFKA 1IN6A 3TGNA 1R1TA 1MD0A 2KJCA 4G7ZF 2LF8A 1LJ9A 1B59A 1P4XA 1R36A 3SQNA 3FWEA 2XKOA 1A04A 3GZ5A 2VXZA 2P5VA 2M8EA 4OOIA 5DCFA 3KLNA 3I4PA 5E1ZB 4I98B 1YS7A 4MQVA 1W7PA 3RPQA 1EH7A 4RAZA 3U2RA 4EV0A 3IL2A 1Z05A 4G7HF 2W25A 4L9TA 5BOXA 1IXCA 4UVAA 1J9IA 2QYOA 3WTVC 2XKPA 3CLOA 1YO5C 1YW8A 1QNTA 3FMRA 1YIOA 4M6XA 2PLYA 2ZXJA 1I1GA 1GHCA 4GO1A 2Q8KA 1MKMA 3DF8A 3ZPLA 4XSZF 5E1WA 3HSFA 3ELKA 3HTUA 1WWXA 3RDIA 1XGNA 2O8XA 2F5DA 2D1HA 1B9MA 2LF7A 2D45A 2CG4A 2P5KA 3B02A 5DCMB 3WGHA 1D5VA 3LAJA 3CDHA 3ECHA 3CUOA 1CF7A 3HSRA 1L3LA 3GX4X 4G94A 2XUBA 2OZUA 4P9FA 4YFKF 2XAFA 3R0JA 4EJWA 2FNPA 3KFWX 4WCGA 1ZYRF 4WXHA 3QPTA 1YLFA 4EGYA 3RJPA 5HS8A 2CSOA 1FOKA 4B09A 2XAJA 4WWCA 1W5SA 4BHBA 2GXBA 2ZFWA 3JSPA 5E1XA 4LGWA 3JAMK 3HRSA 4AIJA 2B0LA 2UWMA 3LA3A 2FBHA 4JK1X 2P5LC 5CVUA 4U0WA 1R7JA 1PP8F 5CVRA 5ILUA 1WI9A 1KU3A 1BJAA 4HX7A 3CTAA 4R1HA 1KQ8A 1IN5A 3GVAA 1ON2A 1T2KA 1B1BA 4LD5A 4RGUA 2O3FA 1YQAA 3D5LA 3HTSB 1J75A 1Z7UA 1USTA 2A6EF 3ULQB 4BHCA 2XAQA 2NNYA 3VOEA 4KMFA 3I58A 2ZMEB 1R5GA 3T8TA 3CUQA 1Z6RA 3CO7C 1VTNC 1FY7A 3CUQC 3L7WA 3GZ6A 2PBIA 1XGMA 4EQQA 1JHFA 4KIGA 1R5HA 1TTYA 5AONA 4LMYA 4L18B 2OBPA 4QWQA 3BJ6A 1FBQA 4LK0F 1YG2A 4UV9A 2CQKA 2KJBA 2V1XA 2NS0A 3SXYA 1KQ0A 2EA4A 2HEOA 1SFUA 2Z99A 4UXNA 3M8FA 1I27A 1Q1HA 1OYIA 2L4AA 2W85A 1JXSA 1WSUA 2BEOA 2W57A 2Y75A 2H6CA 4ESFA 1USSA 2QUFA 3FMSA 4P96A 5CVIA 3ABUA 3BROA 3ROUA 1BI1A 2V9VA 1IRFA 1BC7C 2FBKA 4KN7X 1HSJA 5CLSA 2GQQA 4ENKA 2ISYA 3EETA 3RI4A 1FBSA 1TLHB 2IJLA 3QRFF 1K6OA 3G73A 1RNLA 3WGGA 2X0LA 1OPCA 2K7LA 2XGXA 4M74A 2FMLA 2WWYA 3C18A 3R6SA 5K5OA 1FYKA 3COAC 3BPVA 3TOBA 3F23A 3KE2A 3KZYA 4ZYDA 1FC3A 3N97A 1UCRA 3AAFA 4RGSA 3V7SA 1K78B 1IAWA 3FXQA 3FXUA 3M8EA 1OYWA 2QBYB 2V6CA 2X4HA 1XDUA 1P4WA 3L2CA 2YPRA 3KCCA 4OU0A 1LDJA 2MLGA 1EV7A 4GGGA 4H0EA 4D0PA 2LSOA 5H20A 4RB3C 5L3FA 1O57A 1BIAA 5H6QA 2HR3A 2K86A 1SMTA 1IUYA 3KLOA 2D2WA 3P9CA 3WODF 3F6VA 3SFZA 1GXQA 3W6KB 3F22A 1V3FA 4I7HA 1HW1A 1FLIA 2J5OA 3J7AO 2HYFA 3SZTA 4FX0A 4L9JA 2HS5A 3JTGA 4ZZLA 1J5YA 3QU3A 5F6FA 1ZHFA 5D6FA 4WXCA 4RS8A 5L3CA 1W7PB 3R0AA 4M9ZA 2EFPA 2VBXA 2IVMA 3HOSA 2RVCA 4EGZA 2Z9OA 3IKVA 1GVJA 4O5VA 2EFQA 1FX7A 1ZLJA 2ZNYA 4ZH4F 4I01A 1S3JA 4IF4A 4EM1A 5DCMA 1KU2A 1TQMA 2XRNA 5TRDA 3TO6A 1DDNA 2M45A 1O7LA 2UXXA 3HRTA 2STTA 4JQFA 4L5JA 2RV8A 1KU9A 3E6MA 1UFMA 2H94A 3IWZA 5CJ9A 4K2EA 2PJPA 2A5YB 2W84A 4XRFA 4IRIA 4OMZA 1AWCA 2H6BA 4RB0A 1JGSA 4ENJA 2QM3A 3GFIA 2K02A 3I54A 2HKXA 2CYYA 1S29A 4MEXF 4UVCA 5DD4A 4Q47A 1KQ9A 4XLNF 4LLLA 5HDKA 1T0FA 2VODA 5AIPA 4N9IA 3V8LA 2RQPA 3WTUC 4IPAA 3P7NA 2FU4A 2O61A 3HUGA 2VBZA 1HKQA 4OMYA 3IWFA 2LDUA 3QAHA 4MTEA 2RDPA 3FM3A 5A2QZ 1K79A 1S6LA 2QLZA 1QBJA 2GXGA 1S7AA 1SD7A 4A5MA 1SAXA 3KP6A 3G3ZA 4RB2C 1FYMA 1O3RA 3QP6A 3ZMSA 1MDMB 3RKXA 1NHAA 4R8HA 1R23A 1ONVA 1ZAOA 4MTDA 4LLGF 1V4RA 4GYGA 3MAJA 4KN4X 1PUEE 3K1MA 3ZQ7A 1UHMA 4ETSA 1WKMA 5LRSA 1HKSA 4Y17A 5CVVA 1U5TC 2RGVA 5FFXA 4A5NA 3V4GA 2K27A 2L3DA 1SD4A 3GWZA 3GO5A 4WK8F 2EV6A 4BXUA 3GFMA 1TQIA 1E2XA 4KIBA 4G7OF 2OD5A 2ZNZA 3GLXA 5LEKA 1MJAA 3F8MA 1B9NA 4ZYEA 4XBFA 1C0WA 2XV4S 1T98A 2Z33A 2YU3A 5HLIA 1FYLA 1ZG1A 1KYWA 1D8KA 1YW7A 4UNOA 3GF2A 4L0YB 3S2WA 4MHGA 2F2EA 5KVRA 3L09A 4DQ2A 1RUNA 4P5OA 3BZ6A 2EFNA 2JZYA 5FLXZ 1Y0UA 3M9AA 1TNTA 3I0TA 3MEXA 2BBYA 2M5WA 3ML6A 2G9WA 2XAGA 2A61A 3Q9VA 4RAYA 4CO8A 1ZLKA 2ZKZA 1WQ2A 2CFXA 1IZ1A 2DTRA 1QZYA 3R60A 1RI7A 2XASA 1TNSA 3DEUA 3GFJA 5ICEA 2LNBA 3HYIA 3QU6A 3WTXC 3GFLA 1ZG5A 2JSCA 2DW4A 2EK5A 2KRFA 3Q5FA 2DBBA 2LKPA 1T6SA 4ESJA 1MJ9A 4L9NA 2DAOA 2V1UA 4A0XA 2R3SA 3ERED 2KIUA 3J81K 2AXLA 5L3GA 3F6OA 2FQ3A 2IA1A 5DDGA 1LVAA 1ZN2A 1FZPB 2GA1A 2NRAC 1HQCA 4YFXF 1K78A 3VODA 6PAXA 3WTZA 1EH6A 3R61A 1XCBA 1U3EM 4LLNA 2A6HF 2MD5A 3KP7A 1O7FA 2GA2A 2FRHA 3M7GA 2L54A 3RIRA 3FHZA 3TO9A 3K1NA 3WE2A 3REOA 1I6XA 5EEGA 3TDZC 2Q0OA 5IT3A 3T0YA 4Y15A 2QVOA 3OV8A 1LDDA 3E5QA 1HW2A 1TBXA 3WTWC 3F3XA 1EH8A 3T5XA 2HFHA 3K9TA 4YIFA 3QP5A 1LNWA 2PG4A 2A68F 3R4KA 1XB4A 3BPXA 3GEZA 1S8NA 3C7JA 2EJRA 1R22A 3HHGA 1FNNA 1JHHA 1HW5A 2DK5A 1PP7U 4EMSA 3HSEA 2QQBA 2D1VA 4IHSA 3T1BA 5HOOA 4G6DA 4A0ZA 5HVQC 3WE3A 3I59B 4YFNF 2ZCWA 3PQJA 1MDMA 3K2ZA 2RKHA 5JHUA 1TQPA 1I1SA 4B8XA 3E3VA 3DV8A 5LGNA 3E6CC 4L0ZB 3DKWA 3LQQA 3FXRA 3VFZA 5JR3A 1F5TA 2QQ9A 4EJVA 3U1DA 4KIFA 3ZN0A 1XCVA 1LQ1A 2ISZA 5F1RA 4I2OA 3GW2A 4WX9A 2HYGD 4A0YA 3K69A 3OOPA 3HOTA 1D3YA 1SFEA 2DO7A 2XIGA 4LG0B 2JPCA 4IRHA 2JTVA 5CYVA 2H09A 2MH2A 5BPDA 1MGTA 4HZFA 1HXDA 3H92A 5JVTA 2WTEA 4AWXB 2Y0MA 2DPDA 3HRUA 2EB7A 4HV5A 2O0YA 4Q5SF 2EV5A 4GCVA 2ZO4A 3K1PA 4PGHA 2EWNA 1BI3A 2P8TA 1U78A 2RNJA 2P4WA 1KGSA 2QWWA 5JI6A 5ILVA 1IN7A 1FP2A 5E17F 3F8BA 1YFHA 3V8JA 5HS7A 2HOEA 3TO7A 1UHWA 1FWZA 2YSRA 4I0AA 1Z9CA 3V7RA 3RTRA 3L9FA 2FEZA 2GIVA 2KIMA 5FD5A 1UB9A 2EFWA 2PFBA 3WTTC 1XMKA 2XHKA 4U88A 1BN5A 4HDVA 4GXOA 1B6AA 4HLYA 2F5FA 1XD7A 4U7DA 2WC2A 2XAHA 1R58A 2GAUA 5HDGA 4U7BA 1RUOA 1XMAA 1O3SA 4BAYA 1W5TA 4PDKA 3WU1B 3BDDA 4RGRA 2IPQX 4ON0A 5HS9A 3JAMZ 4YIIA 3WG9A 1DP7P 4IVNA 3HRMA 2FXAA 3VEPA 5LGUA 1BI0A 2OQRA 4BYYA 1ZRCA 4KDPA 5DUIA 2A07F 4HLXA 1YYVA 5HLHA 3GYHX 1H9TA 4OIPF 4CICA 2COMA 1P2FA 2K4BA 1LDKB 5FD6A 3QPHA 5DYMA 5BPIA 4WXDA 4BH9A 5LHGA 3GUDA 2FBIA 1IXRC 2E1NA 2FOKA 3JW4A 1ULYA 3P9IA 1U6GA 4LFUA 4KYWA 2F5EA 2VE9A 3J80K 4I09A 3KZZA 5DUKA 3BOQA 2YX7A 2L02A 3PFIA 3E6BA 3DXJF 5LHHA 1ON1A 4HV6A 5D4RA 2H27A 1J2XA 4CGZA 1IXSB 2P7VB 3LA2A 3FF5A 4ASNA 4ESBA 2HQNA 1R1UA 3NRVA 2O03A 2BGCA 2HWVA 4UV8A 1SD5A 4AIHA 5J8CA 5L3EA 4HQEA 1ZGJA 1QQIA 2K4JA 5FFZA 4EJTA 4M9XA 4A6EA 1ZARA 3TDUC
chains in the Genus database with same CATH superfamily
5LLQA 1FOXA 4XLHA 4ENMA 1HKTA 2EPFA 1U8RA 4YG2F 3QOEA 2P6TA 2VC0A 2DFEA 3DU6A 3BTLA 4IJAA 1X1PA 5J3LA 4DYRA 4XICA 2GM4A 4BXFA 5IT9Z 1WJ5A 2HGCA 2DI3A 3JRIA 2E2HJ 4HF1A 1TW2A 3PM1A 2E7XA 5L3DA 2LK2A 1XSXA 3LSJA 3HL2A 2XDVA 1F1ZA 4EJUA 1RIOH 1AU7A 2PX9A 1OLTA 5ED4A 1A6IA 3CJNA 2K9SA 1X3ZB 4XLFA 2HXOA 4XK4A 4ZYAA 2HVSA 3Q0WA 2P7CB 3KP2A 3GTLJ 1ERDA 3WTSC 4PZJA 4AC0A 1OR7C 3ABKH 1YS6A 1JE8A 3EUHA 1JUMA 2LP0A 1Z21A 2FUG2 3K10A 3JSOA 1UMQA 4MEYF 3VB2A 3HIFA 3L2VA 1FPQA 5IOYA 2DOAA 4A2UA 3M1EA 5DM7F 2ZMEA 2F5VA 3RKWA 3IC7A 2R7XA 1OR7A 3W6JB 1R9TJ 3K4KA 1Z67A 2OU2A 2IAIA 4XSXF 3LQRA 5K5QA 2MFZA 2K3FA 1JJ6C 2V1DA 3OMYA 2EZIA 2HZDA 1H9GA 2ACJA 3P5JA 2X1CA 1HSTA 2VJJA 1JUPA 2IP2A 2PEXA 3RPUA 3ZN1A 4D9JA 3ZP5A 4EVIA 1HCRA 4IXAA 4XN0A 5K5RA 4EJOA 5EG0B 4O6JA 2RNGA 3OYMA 3OL3A 3E5XA 4G6QA 4UHTA 3JRCA 2EFOA 3O2PE 5DEQA 5D8LB 2O6GE 4O3MA 4C30A 1I6HJ 2DMQA 1B4AA 4HDUA 3TEDA 3TW6A 2M1BA 2M8GX 5ERIA 3C2GA 4DNCA 2ZJRF 3DLAA 4OIQF 1I5ZA 2AXTC 5H6RA 1YRNA 3BY6A 2JA5J 4BEHA 1XS9A 2Z3YA 2JUCA 2HOAA 3I64A 3I71A 4FX4A 1BOAA 2KIFA 1H0MA 5HNHA 5K1YA 3F8NA 4CA0A 4ZTJA 3KEOA 2M7AA 4CXFA 1JTYA 4JP0A 4AUXA 1E17A 1GXPA 3NQOA 3DU5A 1QRYA 4XKVA 1N25A 4KA4A 5DD8A 5J4VA 2IS2A 3C1DA 3AL0B 3E5UA 4F3QA 2W00A 1T38A 3VWBA 4PUSA 3CCQI 1IRXA 3RYRA 2VT2A 4D5FA 5KAIC 1YRNB 4Y52J 3B73A 3MZHA 3SHFA 2NYXA 1K61A 5JLWA 3QYBA 4KMUX 3FX3A 2MA3A 2OCEA 4DZPA 4M71A 1HA8A 4BKXA 1SEUA 4ENNA 3LL7A 2E1MC 3CUQB 2QKLB 3ABTA 2EIMH 2DN0A 4A6DA 3PJRA 3DQVC 4S05A 4HBLA 2ZJ2A 1MJBA 2DMNA 3DEEA 1AOYA 3MZYA 1ZH5A 2BV6A 3PIPF 2NAZA 5IP6A 2Q2EA 1O4XA 4HG2A 1TWCJ 5ICFA 2CWEA 1ZRFA 1OKRA 1AA7A 3DBHB 2D5VA 1BI2A 2DQRA 2R7QA 1XSDA 5C3EJ 2COBA 1OJLA 3MKYB 2QQ8A 1R4MB 4HYEA 2RN7A 5AIQA 3DTEA 1Z6TA 2KHMA 2KMUA 4XNFA 2OQGA 2F5CA 4E6KG 1T0FC 4BL0B 2MBFA 3BCAA 4M3GA 3T8RA 1XC5A 4V2FA 3FMQA 2Y48A 3ZGKA 4ZYGA 1J7KA 2E36A 5D6EA 2K9QA 5EDNA 3ISPA 4I99C 2QSHX 4A3DJ 2A3SA 2KKOA 3HUGB 3FDYA 2XPVA 3FM5A 2JRTA 3CDLA 1WJBA 3MCZA 1YOVB 2R7OA 3FKIJ 1U8BA 3OYAA 1XDSA 1WPKA 4U0VA 1TC3C 2NNNA 1ZG3A 3A02A 5HDNA 1SMYF 1OCZH 4BXXJ 4R79A 2DK8A 3GCMA 4B1RA 1HDDC 3EYIA 3DKYA 1IW7F 2HQRA 2L5QA 1W7PD 3H9JA 5FGMA 1YI2I 2VC1A 1GT0C 4KNYA 2VOOA 1IDZA 2QCOA 3O3KA 4GDFA 4FCYA 3GMEA 4BQQA 3J81Z 4PSXA 1UJ8A 4L9VA 3MKZA 1U5TB 5ICCA 4CHUA 3GXOA 4B44A 5FB2A 2JA2A 4II3A 5E3LA 3E1SA 5JLXA 2JPBA 1B8IB 2X6YA 2V79A 3PO2J 1G3SA 3OYLA 1H88C 4A3LJ 2W24A 2V9KA 5E8GA 1G3WA 1D8JA 1V5FA 3ZMVA 1FP1D 5L3BA 2HQ5A 1HBXG 2HDCA 1BA5A 5DTDA 2DA1A 2WV1A 3HOWJ 5GAHJ 4S04A 1Y0NA 2CU7A 2H8WA 1AKHA 4AVPA 4X6AJ 5TJJA 3H36A 3MVPA 2KLOA 5GTHC 1P7IA 2ESNA 2QZ8A 3SDBA 3HOXJ 3ZCOA 4HX4A 4D7MA 2EZKA 3BJAA 2R5YA 2FNAA 1ZTRA 2DQLA 3K4JA 3FZVA 1DQUA 2QQAA 3HGGA 4IHTA 2OAZA 1D0XA 5ICGA 4HRIA 3PUFA 1A6QA 1L0OC 3ZRGA 3MZ8A 3N4MA 2VOPA 2EBIA 3GTGJ 1JT0A 2NXNB 2PI0A 3I55I 2EA2A 1XG1A 2TDXA 5LGTA 3CCRI 3Q0VA 2R93J 2LOOA 1R00A 3QOPA 4OIRF 3CF2A 3ZMDA 4M3BA 2KL4A 4LB6B 1LB2A 4E7ZA 4HSTA 1XPXA 3DFGA 2FMYA 4E70A 2VONA 1VQKI 4HOBA 1X3UA 4F92B 2LTPA 2R7TA 2HTSA 2JT1A 3KEQA 3ZOBA 2JMWA 5LHIA 2CMPA 4B47A 2FQ4A 4TV7A 5KK1A 4BHPA 3K70C 3TKYA 4BJ5C 5D5WB 1MNMC 1DP3A 2AHQA 4GYIA 1ITYA 2R7DA 1W5CC 1DPUA 1J09A 1LFPA 1XTAA 4BNCA 2K9LA 4MQ9F 5BNGA 1CF7B 4ZDOA 2IT0A 2UXNA 3S1MJ 4I0BA 1ZREA 1T39A 2OA4A 2ETHA 2K9MA 2CQNA 1YITI 5FO5A 1LEAA 2MC3A 1CGPA 3FIWA 2VE8A 1OYYA 2MG4A 3IRQA 2NVTJ 3D0SA 1G8XA 4XL9A 1K83J 4G9YA 2PJRA 4CCLA 2DA7A 4G8XA 4CDGA 1YJ9I 3TOAA 3H9QA 1P6RA 2DLLA 4RDUA 3OYJA 1K7AA 3GBGA 3G6EI 2DOFA 3S1NJ 4GRIA 1WZ2A 3JRBA 1ZELA 4IKFA 4MGRA 3MWMA 4M9SA 2BE5F 1V5GA 3VYSB 3CCEI 2QEXI 1BIBA 3DBRB 3S17J 5E18F 4OIOF 4XLCA 4L5IA 4B3XA 4HNTA 4CCJA 4RAFA 4UVBA 3CDIA 1KA8A 3I59A 2MGQA 5D5UB 2ESHA 4LJZF 2GWRA 5J1RA 4CZZA 4I02A 2CW8A 1A36A 4MNUA 1VQ4I 2Y30A 3RPUD 3I53A 1R49A 1TW3A 3MKLA 5DV5A 3E97A 3SFIA 2X6OA 1O3TA 4M3EA 1SFXA 1DGRM 3KIOA 4ITVA 3A03A 1WRJA 1XGSA 4M72A 1JI8A 1KYZA 3AKZA 4Q48A 2JA7J 2XGDA 1YTYA 5D8KB 5F0CA 4EM0B 1LE8B 3RKYA 1XGOA 3BR0A 4A12A 2DT5A 2FSWA 2L9SA 3DPTA 5GADJ 1MBHA 3H3ZA 3U9GA 5IT9K 4N9HA 3PNVA 1WJFA 2Z5UA 1OMIA 4HW0A 2CUEA 2IA0A 2FE3A 2OJED 3I5UA 1FMWA 1ZR2A 2QENA 3BR3A 2A69F 3CMAI 3ASOH 2DPUA 2IS4A 4IHXA 2IA2A 3LA7A 3SZGA 2LG4A 4KT6A 3ZMUA 1X4OA 3QPLA 4AIKA 2L4MA 2NOGA 5LBQA 3TL4X 2YR2A 1FT9A 2R5ZA 1RZ4A 1V5EA 4RGXA 1QGPA 1U2WA 5CVJA 2G7HA 3F21A 3KETA 4IO9F 2MLKA 3OY9A 1UELB 3CC4I 2R7FA 3A0BC 5HLGA 3L00A 4AD9A 2DA4A 3ECOA 2VQGA 4PJ0C 4NB5A 2PMHA 4PCQA 2VN2A 1DPRA 4IOCF 1UAAA 3BWGA 5ILSA 3BJOA 1FBUA 1WH7A 2M30A 1LEBA 4P55A 1XN7A 2PJRB 2CQ7A 2X85A 2HNHA 3FBNB 1JKPC 1R1VA 3VYUB 4FE7A 1SVMA 2JN6A 3K0LA 4RB1A 3IAM2 5LEJA 2DYSH 4Z2YA 1IRGA 1BR4A 4RA2A 4OINF 2ADUA 2GOXB 2M4KA 3C3WA 4X0GA 2FF4A 2W4SA 2OUMA 2R7UA 1MIJA 3BG5A 3RQ4A 2WV0A 2L01A 3P9KA 4QLCU 3I3LA 3H0GJ 2RC4A 2HKOA 1Y8QB 3EPZA 2Y2ZA 1X2NA 4A3IJ 2IGKA 2FD5A 1J59A 2VBYA 4KUMA 3MKWB 4GFBA 1FIPA 5FLXK 1ACIA 1YW9A 1P92A 2NVQJ 1IF1A 1S7OA 2MH9A 4FHTA 2IRFG 3KX2A 2XROA 4ZZDA 2BW3B 2ELHA 3TBIA 4RM2A 2STWA 2M4GA 1NG7A 1XMXA 1FSEA 1BC8C 3F8FA 2FA5A 5D5XB 2Y0SA 2J5PA 5FKLA 3V8KA 5BS6A 5E20A 2ZBKA 2IGNA 1V54H 2K3PA 2ELJA 1IN8A 3C2BA 3LSTA 3ZMTA 1MNDA 1KU7A 1Z77A 5FRNA 4HAMA 4CUGA 3GLLA 3E6DA 2OPTA 4AU7A 5FLMJ 1BBYA 1ETVA 2VQCA 3SEZA 3JRFA 3LMMA 3CCVI 4N0BA 3AG4H 2QA4I 1G2HA 1K4SA 1SD6A 3H3UA 2HTJA 3GTJJ 1QZZA 3CP2A 3EQLF 4HA8A 1G4DA 2CGPA 3I4MJ 2GOMA 3JRDA 2O8KA 4HF2A 5EGOB 1KZHA 5EG0A 1BM9A 3JRGA 2XAUA 4IRGA 1ETWA 1QHGA 2DFIA 3V7CA 1PDNC 3IH2A 5J6XA 5C4XJ 3AFHA 2OZ6A 2DA6A 4RMNA 4LB5A 3RYPA 4KFCA 5F0HA 9ANTA 4IHWA 3EDPA 3ASNH 2XVCA 5EZGA 5EGOA 3DPLC 3HHHA 1ZK8A 5EEHA 1ZRDA 3PSIA 3IKTA 1IJWC 3K4NA 3H1CA 4KT5C 1Q1VA 4NBQA 1QO0D 3KP5A 1G3TA 3BG3A 2WBMA 1A5JA 4PGGA 3MMYB 3DP7A 2F48A 3ZQFA 5D4SA 4WF2A 2G7UA 1G3YA 2ME0A 5IPAA 2DOEA 4HQMA 4Y3OA 2WA0A 3OL4A 1PUFB 1W4MA 4NC8A 2R92J 1ZGAA 2R4GA 5GPCA 4IX7A 2H1KA 2PQ8A 3LWFA 2GZWA 3PQKA 5LRRA 3NEUA 2NVXJ 4LK1F 3Q9SA 5B1AH 2VBWA 4U0YA 1IGNA 1NK2P 3TQNA 4BE2A 1MMNA 3F8CA 3U21A 3L2UA 4XLPF 5BQTA 2E1CA 1JT6A 3J80Z 1E0EA 1P4AA 2ICWG 4JBAA 2VT3A 3I4NJ 5GTIC 4P9UA 1CQTA 4PFPA 5JFRA 2M34A 3DTKA 1LE8A 3H5AA 3BCBA 2KT0A 1DU6A 1F9NA 2XF6A 1OCOH 1VF9A 3O6BB 2HZTA 4JX5A 4KICA 3I56I 1QVTA 2DU9A 4BJ6C 2CO5A 2IW5A 2P6SA 1XSVA 4NQWA 1U5TA 2L7KA 2PN6A 5D5VB 4V19K 3SZPA 2OCCH 4E7JA 2VB6A 2BY0A 2QBYA 2HDWA 2Y69H 2E60A 4M6YA 3ZR8X 2M87A 1NH3A 4ZJZA 2E7WA 4HX8A 3IH3A 5FLVA 3EYYA 3ZMZA 2LVSA 4NHJA 3F72A 5IYBJ 1XX5A 5A2QK 3CO6C 3BR2A 3LSKA 3KEYA 1F4KA 1MMAA 1IV8A 2LBFB 3JTHA 1A35A 1IC8A 2BYVE 4MFEA 2ECCA 3QODA 4DYQA 4Q4ZF 2DA3A 4LIVA 5BMZA 2KDOA 3AG2H 1DUXC 1SFKA 3WU0A 1S5LC 3SYTA 4B3AA 4J00A 5IP9J 3IRRA 2C6YA 1REPC 3FHNA 2EV0A 3KP3A 3WTYC 1MZBA 3LFKA 5B1BH 2DT6A 2UZKA 2E2JJ 2DODA 4HF0A 2VI6A 4CH7A 3Q3SA 2K9NA 2ZXWH 4M73A 3WGIA 1STZA 1BL0A 4ZTFA 4BDYA 1QPMA 2Z1DA 3CJQB 5E8IA 3BP8A 1Z91A 4A69C 1VNDA 3IHUA 2YX4A 3MQ0A 1FSHA 4DOZA 4NC7A 2GIZA 3OYEA 2CW0F 1YJWI 4UUVA 2W7NA 1G6NA 1YE9A 2F4IA 2L9RA 4F7ZA 4Y13A 2JRMA 4ZYHA 1RPWA 1ODDA 2PMUA 1F43A 1W1WE 3KP4A 1D1BA 3DWLE 3G2BA 5J8FA 2JK3A 1VQMI 1O3QA 2CUFA 2ZXHA 5F64A 1IN4A 4CCKA 1VQLI 4UY8I 2AS5F 4BQAA 2OTJI 1Z1DA 4FT8A 2A5WA 4BY1J 4L5EA 4EM2A 4LG0A 4CYDA 4AYBN 1J0RA 4BJTA 3LAPA 3MFKA 4J19A 2CS3A 1IN6A 1FMVA 3TGNA 3RZOJ 1R1TA 3S1RJ 1MD0A 2KJCA 2BY1A 4G7ZF 2LF8A 1LJ9A 1TWFJ 2GBYA 4JOMA 1B59A 1P4XA 1MBEA 1R36A 3PL8A 2DA2A 2VKDA 3NWTA 3L2RA 3SQNA 2EQRA 1KONA 1X19A 2B7EA 3FWEA 4C3IJ 2DMUA 2TCTA 3IV5A 1JKRC 2XKOA 1PUFA 1A04A 2DMPA 3M4OJ 5J1UA 1WJDA 1FOYA 3GZ5A 2VXZA 1UZCA 2QSGX 3CZ6A 1X1DA 2P5VA 5J47A 2M8EA 5E3NA 4OOIA 5DCFA 3QPSA 2QF7A 2XF5A 4MO7A 1LVKA 2I5UA 2XB0X 3KLNA 3I4PA 4DIQA 5M5WJ 1HF0A 5E1ZB 4I98B 1YS7A 4MQVA 1W7PA 3RPQA 1EH7A 4RAZA 3U2RA 4RAGA 4OWRB 4EV0A 1SANA 2WAQN 3QQAA 3IL2A 1Z05A 4G7HF 1I3QJ 3DCFA 2BVMA 2W25A 4L9TA 5BOXA 1IXCA 4UVAA 1J9IA 1X3WB 2QYOA 3WTVC 2WB1N 1WJCA 3H35A 2XKPA 3CLOA 1YO5C 1YW8A 1QNTA 2JQ7A 2BHYA 2M7BA 3FMRA 1YIOA 4M6XA 2PLYA 1R5ID 4BY7J 3TP3A 2ZXJA 1SVLA 2V4JC 1I1GA 2XF7A 1S72I 4MLOA 1GHCA 4GO1A 2Q8KA 1MKMA 2EIKH 3DF8A 3ZPLA 4XSZF 5E1WA 3ONQA 3EUKL 2AQEA 3HSFA 2CQXA 3ELKA 2Y31A 3IUOA 1ZR4A 3HTUA 1WWXA 2KP6A 1R6RA 3ZQIA 2HVQA 3RDIA 1IDYA 1XGNA 2O8XA 2F5DA 2WY7Q 2DTZA 2ZSIB 2D1HA 1UG0A 4EATA 2XRLA 1B9MA 2LF7A 5IP7J 3OYCA 3FXMA 4FTHA 5HODA 4HPQA 2D45A 2CG4A 2P5KA 1MNEA 4BE0A 3B02A 5DCMB 1YJNI 2H1LA 1MBFA 3WGHA 1D5VA 3OR1C 3OYKA 2X51A 3LAJA 4BBSJ 3CDHA 1TP4A 3LSRA 3ECHA 3CUOA 3WHBA 3OS0A 5M5XJ 4F55A 2YS9A 1CF7A 3HSRA 1POGA 2VPRA 4ZDPA 1L3LA 1TWAJ 3S2DJ 3GX4X 4G94A 3OOUA 4G12A 4NQWB 2XUBA 3ERMA 2KZVA 3UNGC 4A3JJ 3OIOA 2OZUA 4D1QA 4P9FA 4YFKF 3HKZN 2KIQA 5F1JA 3M3YJ 2XAFA 3C2HA 3KZIC 3R0JA 2LR8A 1WVRA 1FJLA 4EJWA 3GTPJ 1K4TA 2FNPA 3KFWX 4WCGA 3B6CA 1ZYRF 1F36A 4WXHA 5HLTA 3OIPA 3QPTA 4RBOA 4F91B 3RSNA 1YLFA 4CCMA 2CV0A 4EGYA 2DYRH 3RJPA 3OIQA 3DTIA 2HOSA 5HS8A 1NTCA 3DBLB 2K40A 2CSOA 4E7LA 4B09A 2XAJA 3NARA 4WWCA 1FOKA 1W5SA 4NDLA 5FKOA 4BHBA 2GXBA 2M3AA 2CV1A 2ZFWA 3JSPA 5E1XA 4MFDA 3M1CA 4LGWA 3JAMK 3HRSA 2RQQA 4AIJA 2B0LA 4I6ZA 4XORA 3OYIA 4DJAA 5F08A 4CCOA 4E7HA 2UWMA 2BXYA 2A05A 1VQ9I 3LA3A 2FBHA 4JK1X 3FBIB 2BXZA 2P5LC 3OSGA 5CVUA 4U0WA 1R7JA 1W36D 1PP8F 5CVRA 5ILUA 4FASD 1X1CA 1AKHB 1WI9A 1KU3A 1BJAA 4HX7A 3CTAA 4R1HA 3OYDA 4W1UA 1ZKGA 3KYCB 1KQ8A 4XONA 1R71A 1IN5A 3GVAA 1ON2A 2W1OA 3BQZA 1B1BA 1T2KA 3BTJA 4LD5A 4RGUA 3VDXA 2O3FA 2HPIA 3BC8A 3G4SI 2VQHA 1YQAA 3D5LA 3HTSB 2Q2EB 1Z7UA 2HI3A 1J75A 2FX0A 1USTA 4C2UA 2A6EF 3ULQB 4X1EA 1RESA 2IEKA 4BHCA 3JRAA 3HXLA 2XAQA 1W0UA 1T95A 2NNYA 3VOEA 1RETA 4KMFA 1I39A 3I58A 2ZMEB 1R5GA 3T8TA 4F52A 2NVYJ 2AO9A 3CUQA 2DA5A 4QSHA 1Z6RA 3CO7C 1VQ6I 2ELKA 2KQRA 1VTNC 4XOPA 1JJ8C 1FY7A 3CUQC 3L7WA 3GZ6A 2PBIA 1XGMA 4EQQA 1JHFA 5FJ8J 4KIGA 1R5HA 1TTYA 3E7LA 5AONA 4S0HB 5FKMA 4LMYA 2LKXA 3BR6A 3K4BA 4L18B 3ZQGA 2L7FP 2OBPA 3A4CA 4QWQA 3BJ6A 1VI0A 1MH3A 1FBQA 4LK0F 1YG2A 5B3SH 1YHQI 4UV9A 2JA6J 2CQKA 4KJZA 4XKWA 2KJBA 2V1XA 1X1BA 4BGDA 2HOTA 2NS0A 3SXYA 1KQ0A 2EA4A 2HEOA 2KRHA 1SFUA 2Z99A 4UXNA 1WCMJ 3M8FA 3HPGA 1I27A 2HXIA 1Q1HA 5EF6A 2V6EA 2LY9A 2OC6A 1OYIA 2JVGA 2L4AA 4NUBA 4B43A 2HQAA 3GZNB 2W85A 1JXSA 1WSUA 4IEJA 3BTCA 5FROA 1MBKA 2BEOA 2W57A 2Y75A 4XR6A 2H6CA 4ESFA 1USSA 5EYRA 3CC7I 1ETQA 2QUFA 2E1OA 2EIJH 3FMSA 4A3FJ 4XIDA 3LSPA 4P96A 3X2QH 5CVIA 3ABUA 3BROA 4QPOA 5IYDJ 2CUJA 4PK4A 1VQ7I 3ROUA 1VQ8I 4BACA 2L2OA 2X6WA 4ABZA 1BI1A 2V9VA 1IRFA 1X2MA 4M6VA 4C9YA 3H3VK 1BC7C 1TWGJ 4B48A 2FBKA 2FJ1A 3BR1A 4KN7X 1HSJA 5CLSA 5M5YJ 5GPAA 2ECBA 2GQQA 3H0DA 4ENKA 2ISYA 3EETA 3RI4A 1FBSA 4N4OB 1TLHB 1MMDA 2IJLA 1WJEA 4D5CA 3QRFF 3FXKA 3G73A 1K6OA 4DGWB 2XPWA 1RNLA 3WGGA 4IQJA 2X0LA 1OPCA 2K7LA 2XGXA 3FXLA 4M74A 4C2MJ 1BW6A 2AQFA 2FMLA 2M2EA 3WHCA 4BS9A 2WWYA 3C18A 3R6SA 5K5OA 1FYKA 3HOZJ 3COAC 3BPVA 3TOBA 3F23A 3D1NI 3FISA 4XRSA 2DJNA 1A31A 3KE2A 5TGTA 3KZYA 3CF5F 1X4PA 1UG2A 1Y8RB 2X6XA 3LSIA 4ZYDA 1FC3A 4F93B 3UR3C 3ABMH 3N97A 3PNYA 2HU9A 4A3BJ 2ZJPF 1UCRA 3AAFA 3A01B 5KCMA 4RGSA 1QPIA 1MBJA 3V7SA 2JSPA 1K78B 1IAWA 2V1NA 4IHYA 3FXQA 3MD2A 3FXUA 3GTMJ 1FTTA 2JJ7A 1E3HA 3M8EA 1OYWA 2QBYB 3BLYA 2V6CA 2W48A 2X4HA 1XDUA 1P4WA 4C2TA 5LD2C 2E35A 4DW6A 3L2CA 3HDDA 2YPRA 5E79C 5KAFC 4A93J 3H5RA 5GAEJ 2E19A 1G59A 3KCCA 2DMTA 1V55H 5TISC 4OU0A 4KISA 2DXIA 1HC8A 3SDGA 1LDJA 2MLGA 1ORKA 1EV7A 2WB1A 4GGGA 4H0EA 4D0PA 2LSOA 5H20A 4RB3C 5L3FA 1SFOJ 4Y33A 1O57A 1LUJB 1BIAA 5H6QA 2HR3A 2MW8A 2K86A 1SMTA 1IUYA 3KLOA 2MABA 2XSJC 2D2WA 5CQEA 2IGOA 1H89C 3P9CA 3WODF 3F6VA 2KISA 3SFZA 3NWSA 1GXQA 3CCSI 1RRJA 2R7RA 3W6KB 2FOWA 3F22A 1V3FA 4I7HA 1HW1A 1FLIA 2J5OA 3K4LA 1JUSA 2Z16A 4PJJA 4ZDLA 3J7AO 2HYFA 3SZTA 4FX0A 4C3HJ 5GP9A 2A6TA 4L9JA 3K4MA 1LFBA 3M07A 3DKXA 4JX6A 2HS5A 3JTGA 3IH4A 4ZZLA 4JYKA 1J5YA 3QU3A 5DS9A 2KPMA 2EZHA 3HOVJ 5F6FA 3WU2C 3CCJI 1ZHFA 5D6FA 4WXCA 4RS8A 2RREA 2IS6A 5L3CA 4G6TB 1W7PB 3BTIA 1TZLA 3R0AA 2O5RA 4M9ZA 4PJNA 1MSEC 1MMGA 3ABLH 2EFPA 4A3GJ 2ZJQF 2VBXA 2IVMA 3HOSA 2RVCA 2O7OA 1TWHJ 4EGZA 3EUHC 4QTRA 3VYTB 2Z9OA 3IKVA 1GVJA 4O5VA 1Y39A 2EFQA 1FX7A 1ZLJA 2ZNYA 4ZH4F 3PSFA 5CKTA 3S3MA 4I01A 1LKXA 1S3JA 4IF4A 4EM1A 1RKWA 3QWLA 1JKQC 1MSFC 4P1WA 1OCPA 5DCMA 3O8GA 4FQGA 1KU2A 1TQMA 1MBGA 2MD0A 4A3EJ 1EKEA 2XRNA 5B5EC 5TRDA 4QPQA 3TO6A 5E3MA 1DDNA 4CYCA 2M45A 2LKSA 1O7LA 3HZJA 2UXXA 2VQLA 3HRTA 2STTA 4JQFA 4L5JA 2RV8A 1KU9A 3E6MA 1Z3YA 1UFMA 2H94A 3HBLA 3IWZA 5CJ9A 1U9OA 4K2EA 1S9HA 4YRVA 2R5YB 2PJPA 3HC7A 2OV7A 2ZFUA 4BDZA 3JREA 5K7ZA 1YIJI 2A5YB 2W84A 4XRFA 4IRIA 4OMZA 3E0JB 1M1EB 2I8DA 2ZXIA 1AWCA 3VPRA 2H6BA 2M0MA 4RB0A 1JGSA 4FE4A 4YELA 5JHFA 4ENJA 1EJ9A 4FETA 2QM3A 3GFIA 2EZLA 2K02A 4AIDA 2XGCA 4E4HA 2LMDA 3I54A 2HKXA 2P0WA 4XQFA 2CYYA 3IAS2 1S29A 2IS1A 4MEXF 4E7SA 1P7JA 4UVCA 5DD4A 4CZCA 1PJRA 4Q47A 1KQ9A 5C44J 4XLNF 4LLLA 5HDKA 1T0FA 1B72B 2VODA 5AIPA 4N9IA 4IHVA 2B63J 2LY2A 3V8LA 2RQPA 3WTUC 1VZ0A 3ZXSA 2VJ4A 3UKGA 4IPAA 1VQOI 3S2HJ 3P7NA 4D7NA 2FU4A 4DZJA 2O61A 3HUGA 2VBZA 1HKQA 4OMYA 3BZKA 3IWFA 4YIRX 1QZEA 1IRZA 3U1KA 1D0YA 1BJZA 2LDUA 3QAHA 4MTEA 2RDPA 3A0HC 1OCRH 1JKOC 3FM3A 3VSLA 5A2QZ 4XMYA 1K79A 5K7HA 2WY8Q 3CMMA 2UV1A 3S1QJ 1S6LA 3BG7A 3J7AY 2QLZA 1QBJA 2Y0SN 2GXGA 3N05A 1E3PA 1S7AA 1SD7A 4A5MA 2EILH 4UUSA 2XC7A 2W82A 4IZZA 1SAXA 3KP6A 3CQZJ 3G3ZA 1E3OC 1T8IA 4RB2C 1APLC 1FYMA 2ZB9A 2L9NA 4AVZA 4EEFG 1OCCH 3S14J 1JTXA 1JGGA 1O3RA 3QP6A 3ZMSA 3RKXA 1Y6IA 1MDMB 2E2IJ 1NHAA 3SEQA 2R7SA 4B4CA 4R8HA 3DPUA 2OTLI 3L1PA 4CSWA 5FRMA 2ZSHB 1FTZA 1R23A 3W2WA 1ONVA 1VQNI 1ZAOA 4MTDA 4XKCA 3OYHA 4LLGF 1V4RA 4GYGA 1TL8A 3MAJA 1MW7A 4KN4X 2IXSA 1PUEE 3Q0UA 3K1MA 3ZQ7A 1UHMA 4ETSA 1WKMA 4M3DA 5B66C 5LRSA 4RLFA 3S32A 1HKSA 2Y9YA 4Y17A 5CVVA 1W36C 2VLAA 2VKVA 1U5TC 1HDPA 2RGVA 5FFXA 4CCNA 2E5NA 4A5NA 2XPUA 3V4GA 2MYSA 2K27A 2LLKA 2GXAA 2L3DA 5IY5H 1SD4A 3GWZA 3GO5A 4OAZA 4M3FA 4YEJA 3HKZA 4WK8F 2BHZA 2F4OB 2EV6A 3RCOA 4BXUA 4CYCB 3GFMA 1TQIA 1E2XA 3PIOF 2TRTA 4KIBA 4II2A 5CQGA 4G7OF 2OD5A 4QIWN 2ZNZA 4BEHB 2R7WA 5E3OA 3GLXA 5LEKA 1MJAA 4BUPA 2HDDA 3F8MA 1B9NA 4ZYEA 2JVHA 1AHDP 4XKBA 4XBFA 1C0WA 2XV4S 1T98A 3CMYA 2YU3A 2Z33A 5HLIA 3FK7A 1FYLA 3AL0C 5DM6F 2RAEA 2WAEA 5F0FA 1ZG1A 1KYWA 2V9PA 1D8KA 1YW7A 4UNOA 3GF2A 5C4JJ 4L0YB 4A3CJ 3S2WA 4LIUA 4MHGA 2F2EA 3EUAA 3L09A 4XLAA 5KVRA 4DQ2A 2L7ZA 1RUNA 4P5OA 2YU9J 3BZ6A 2DJIA 1IG7A 1WI3A 2EFNA 2JZYA 5FLXZ 1Y0UA 3M9AA 4HNVA 1TNTA 3ZQHA 3I0TA 3MEXA 1MMSA 2BBYA 3LSHA 2M5WA 3ML6A 2G9WA 2L0KA 2XAGA 3S15J 2A61A 3FK6A 3Q9VA 4RAYA 4CO8A 2CQQA 4UB6C 2Y9ZA 1BR1A 1ZLKA 3SJMA 2VPLA 5FKKA 2XSDC 2KFDA 2ZKZA 1FIAA 2LYCA 4UB8C 1WQ2A 1IO2A 2CFXA 1IZ1A 2DTRA 2MSYA 2VKHA 1QZYA 1OCTC 3R60A 1RI7A 3HOUJ 2XASA 4UUTA 1TNSA 4PFOA 3V42A 3O8HA 3LSGA 2QGUA 2X9DA 2E71A 2X1EA 3DEUA 3A2KA 3GFJA 2M0CA 4JX4A 1HLVA 1FOWA 5ICEA 2LNBA 2LRDA 2NOJB 1WJAA 3K2AA 1SVOA 3HYIA 3QU6A 3WTXC 1H8AC 1W0TA 2E34A 2LBFA 3GFLA 1ZG5A 2JSCA 1BOBA 3MN2A 2DW4A 2EK5A 4XLEA 3S8PA 2B9SA 2KRFA 3Q5FA 2LH9A 2DBBA 2LKPA 1T6SA 3KYLA 4ESJA 3GTKJ 1ZGWA 1MJ9A 2KZGA 4L9NA 3BT9A 2DAOA 1VQ5I 2V1UA 4A0XA 1I3AA 2R3SA 3ERED 2KIUA 3J81K 2AXLA 1ETKA 5L3GA 2QKMB 2IBDA 3F6OA 2FQ3A 3G1MA 2IA1A 5DDGA 3B6AA 1X1AA 1LVAA 1WGXA 1ZN2A 2DDAA 2GA1A 1FZPB 2JUGA 2PMZA 2NRAC 1HQCA 1P9QC 4RLQA 5LFAA 5HNFA 2WADA 3OS1A 5K7FA 1T08B 4YFXF 2R0QC 1K78A 1QA6A 3VODA 3LSMA 1PYVA 3JCUC 6PAXA 3LNQA 2VUMJ 3WTZA 1D5YA 1EH6A 4KITB 3OYNA 3GTQJ 3R61A 1XCBA 5GAGJ 4A3KJ 1U3EM 4W97A 2DFFA 4HEA2 4LLNA 2L7MP 3IP4B 3G1LA 1GLNA 2A6HF 2MD5A 3KP7A 1O7FA 1UHSA 1X58A 2GA2A 2VASA 3K6GA 3CC2I 1GUUA 2FRHA 2L54A 3M7GA 3RIRA 3FHZA 3TO9A 3K1NA 3WE2A 3REOA 2F6CA 1I6XA 5EEGA 2PMZN 1OISA 2Q0OA 3D5SC 3TDZC 3TMOA 5IT3A 2JWTA 3T0YA 2F4MB 4Y15A 2QVOA 3OV8A 5IYCJ 2VIXA 1LDDA 3E5QA 1HW2A 1TBXA 2CFOA 3WTWC 3F3XA 1EH8A 3TP0A 3T5XA 2HFHA 3K9TA 2R7VA 2LC2A 2UUZA 3FXJA 4LITA 4YIFA 3QP5A 1LNWA 2PG4A 3H5NA 3CMEI 4E7KA 4E7IA 4LG3A 2WAQA 5FKNA 4BBRJ 2A68F 2VJIA 1WHUA 2BW3A 2DFHA 3RQIA 4XRMA 2BOLA 1IV6A 3R4KA 1XB4A 3FXOA 3CCUI 4DBRA 2EH3A 3PNTA 2NVUB 3BPXA 1N77A 5KHDA 3KPHA 3L2QA 3GEZA 5EZHA 1S8NA 2CJJA 3C7JA 5F04A 2EJRA 1R22A 3HHGA 3BQYA 5J40A 1FNNA 1JHHA 1HW5A 2DK5A 3CESA 3G1OA 3H9GA 1PP7U 5IOZA 4EMSA 1Y1VJ 3HSEA 4IL6C 1OFCX 2ZMEC 3BZCA 3OS2A 1ETYA 3ZQCA 1S7EA 2M9HA 2QQBA 2D1VA 3JRHA 4IHSA 3T1BA 5HOOA 1RR8C 3ZQLA 3JR9A 1NG6A 4G6DA 4A0ZA 5HVQC 4N4NB 3OYBA 3WE3A 3I59B 4YFNF 2K85A 1OQYA 2ZCWA 4PJMA 3PQJA 3QYEA 1MDMA 3K2ZA 3VSKA 2RKHA 5JHUA 1TQPA 4RM3A 1I1SA 4B8XA 4Y4RA 4BQOA 3E3VA 3DV8A 3J7YJ 5LGNA 3S3OA 3E6CC 3L2WA 4L0ZB 2E5ZA 3DKWA 3LQQA 3CP8A 2WAFA 3FXRA 3VFZA 5JR3A 5F27A 1F5TA 2QQ9A 2L9VA 2LREA 4EJVA 3U1DA 2NS7A 1YX3A 4KIFA 3RZDJ 3ZN0A 4Y7NJ 4IOAF 1XCVA 1LQ1A 4C3JJ 2ISZA 5F1RA 4A3MJ 4I2OA 3GW2A 2R7ZJ 4WX9A 2HYGD 4A0YA 3K69A 3OOPA 2DT7B 3VYRB 3OYGA 3HOTA 1D3YA 3CJTB 1SFEA 4LOCA 2DO7A 2XIGA 4LG0B 2JPCA 3QYFA 4HNUA 4IRHA 2JTVA 5CYVA 5EJCA 2H09A 2MH2A 2VL8A 5BPDA 2GLOA 1QU3A 1MGTA 4HZFA 1N75A 1HXDA 3H92A 1ETXA 5JVTA 1Y1WJ 2BVLA 4HSRA 2WTEA 3S3NA 4AWXB 2Y0MA 2DPDA 1BW5A 1GV5A 4H4KC 1N78A 1D1CA 2ID6A 3HRUA 2EB7A 4HV5A 2O0YA 4Q5SF 3CLQA 2EV5A 3I9V2 4GCVA 2ZO4A 3K1PA 2BY3A 3CCYA 3PFYA 4PGHA 2EWNA 3ZQQA 1BI3A 2P8TA 1U78A 5J4YA 2RNJA 3S16J 2P4WA 1KGSA 2QWWA 1WH5A 5JI6A 1HOMA 5ILVA 1IN7A 1RR7A 2BZTA 1FP2A 5E17F 2I10A 3F8BA 1YFHA 3V8JA 5HS7A 3K70D 3PUBA 2HOEA 3TO7A 1UHWA 1FWZA 2YSRA 3HPHA 5KNLA 4I0AA 1Z9CA 3V7RA 2X1DA 2V26A 1ETOA 3RTRA 1DGWY 3L9FA 1IUFA 4IQ4A 2FEZA 3KYDB 2GIVA 2CW7A 2Z2SB 2KIMA 5FD5A 5EEAA 2R5ZB 1UB9A 2EFWA 1PVEA 2PFBA 2YUSA 2CRGA 1U0JA 3WTTC 3G71I 1EF4A 4PSWA 1XMKA 2XHKA 4U88A 1BN5A 1I50J 1RC9A 2Q1ZB 3ESWB 2XGEA 4HDVA 2KDZA 1ZQ3P 2ZC2A 4FISA 1QHHD 3HB9A 4GXOA 1TT5B 1B6AA 4HLYA 1VFCA 3CD6I 1B72A 2F5FA 1XD7A 2CUZA 3K4CA 2CV2A 4U7DA 2WC2A 2KRCA 2XAHA 1Z7LA 1FEXA 3HJEA 2QSFX 1R58A 4ANJA 2GAUA 5HDGA 4U7BA 3BG9A 1NK3P 1RUOA 1XMAA 1O3SA 4MIMA 4XN3A 3TW7A 4BAYA 3DEWA 3AG1H 1W5TA 2ME6A 4PDKA 3WU1B 3CCLI 2H8RA 3OYFA 3BDDA 4RGRA 3AG3H 4UUSB 1Z3XA 2IPQX 3OR2C 4ON0A 5HS9A 3HGYA 2LFBA 3A1YA 3JAMZ 4YIIA 3WG9A 1DP7P 4IVNA 3HRMA 2FXAA 3VEPA 5LGUA 4XOTA 5H2FC 1BI0A 1LFUP 2DCEA 2OQRA 2HPMA 4BYYA 2O9LA 3HOYJ 3F9KA 2NS8A 1R4NB 1ZRCA 4KDPA 2N8GA 5DUIA 2A07F 1YX5A 1YYVA 4HLXA 5HLHA 3GYHX 1H9TA 4OIPF 2DDBA 5M3FJ 1TT0A 2COMA 4CICA 1P2FA 2P81A 1ENHA 2VXDA 1T33A 3GTOJ 3J7ZI 2K4BA 3DLLF 1EA3A 1LDKB 1T56A 5FD6A 2HYJA 3HEFA 3RKQA 1D0ZA 3QPHA 5DYMA 4AYBA 5BPIA 1DU0A 4WXDA 3K7AJ 5M3MJ 3W6VA 1Z0XA 4BH9A 5LHGA 1VQPI 3GUDA 3HG9A 2FBIA 3LFUA 4PJLA 2EINH 1K6YA 1IXRC 2E1NA 2FOKA 3JW4A 1ULYA 3P9IA 1U6GA 4BU2A 4LFUA 4KYWA 2F5EA 4OAYA 3PO3J 2OF7A 3F0CA 2VE9A 1SAUA 3J80K 5JVGF 4I09A 3S93A 2BY2A 3KZZA 5DUKA 3BOQA 2V7FA 2YX7A 2L02A 2IGMA 3WG7H 2XB5A 3PFIA 3E6BA 2X48A 2LY1A 3DXJF 3OSFA 3NAUA 3W2VA 4XRSG 4J01A 4I76A 1U9NA 3A01A 2ID3A 3LOCA 2VKEA 5LHHA 1ON1A 2K5CA 4HV6A 1D1AA 1WFXA 5D4RA 3FKJA 2H27A 3OWTA 1J2XA 1GV2A 3CCMI 4BE1A 4DYCA 4CGZA 1IXSB 4V2GA 4U87A 2E1MB 2P7VB 3LA2A 4BQNA 1RKTA 2VJ5A 3FF5A 4ASNA 4XM3A 3BG6A 4ESBA 2LD5A 2JA8J 4Z6YA 1QVUA 2HQNA 1R1UA 3D5RC 3M8JA 3NRVA 2O03A 3BR5A 4NC6A 5CPRB 2BGCA 2MC4A 4DBQA 2HWVA 4UV8A 1SD5A 4AIHA 5J8CA 1MH4A 1Y56A 2HVRA 5L3EA 4HQEA 3W2AA 1SC7A 4ZC3A 1ZGJA 3W3CA 4AM3A 3CJRB 5J1YA 1QQIA 4NNJA 2K4JA 5FFZA 4EJTA 4M9XA 1BR2A 1LPQA 1B8IA 1GVDA 3HM5A 4A6EA 1ZARA 2CH0A 1GDTA 3TDUC 2G0EA
chains in the Genus database with same CATH topology
5LLQA 1HKTA 4ENMA 1U8RA 4YG2F 2P6TA 2VC0A 4IJAA 5IT9Z 2HGCA 2DI3A 4HF1A 1TW2A 2E7XA 5L3DA 1XSXA 1F1ZA 4EJUA 1RIOH 5ED4A 3CJNA 2P7CB 3KP2A 3WTSC 4PZJA 1YS6A 1JE8A 3EUHA 3JSOA 4MEYF 3VB2A 3HIFA 1FPQA 4A2UA 3M1EA 2ZMEA 3RKWA 3IC7A 1OR7A 3W6JB 2OU2A 4XSXF 3LQRA 5K5QA 2V1DA 1H9GA 2ACJA 1HSTA 2IP2A 2PEXA 3RPUA 3ZN1A 3ZP5A 4EVIA 4IXAA 5K5RA 4EJOA 4O6JA 3E5XA 4G6QA 4UHTA 2EFOA 3O2PE 5DEQA 5D8LB 2O6GE 4O3MA 1B4AA 4HDUA 2M1BA 5ERIA 4DNCA 4OIQF 1I5ZA 5H6RA 3BY6A 2Z3YA 3I64A 3I71A 4FX4A 1BOAA 2KIFA 1H0MA 5K1YA 3F8NA 3KEOA 4CXFA 1E17A 1GXPA 3NQOA 4KA4A 5DD8A 3C1DA 3E5UA 1T38A 3RYRA 2VT2A 3B73A 3MZHA 3SHFA 2NYXA 4KMUX 3FX3A 2MA3A 4M71A 4ENNA 3CUQB 3ABTA 4A6DA 3DQVC 4S05A 4HBLA 2ZJ2A 1MJBA 1AOYA 3MZYA 1ZH5A 2BV6A 2NAZA 2Q2EA 5ICFA 2CWEA 1ZRFA 1OKRA 1BI2A 2DQRA 1XSDA 4HYEA 2RN7A 5AIQA 1Z6TA 2OQGA 2F5CA 2MBFA 3T8RA 3FMQA 2Y48A 4ZYGA 1J7KA 5D6EA 3ISPA 2A3SA 2KKOA 3FM5A 2JRTA 3MCZA 1XDSA 4U0VA 2NNNA 1ZG3A 5HDNA 1SMYF 4R79A 2DK8A 3EYIA 1IW7F 2HQRA 1W7PD 5FGMA 4KNYA 2VC1A 2VOOA 3O3KA 3J81Z 4L9VA 1U5TB 5ICCA 4CHUA 3GXOA 5FB2A 2JPBA 2V79A 1G3SA 2W24A 5E8GA 1G3WA 1D8JA 3ZMVA 1FP1D 5L3BA 1HBXG 2HDCA 4S04A 4AVPA 5TJJA 2ESNA 2QZ8A 4HX4A 3BJAA 2FNAA 2DQLA 3FZVA 2QQAA 4IHTA 2OAZA 5ICGA 1L0OC 3N4MA 2VOPA 2PI0A 2EA2A 2TDXA 5LGTA 1R00A 3QOPA 4OIRF 3ZMDA 4LB6B 1LB2A 3DFGA 2FMYA 4E70A 2VONA 4HOBA 1X3UA 2HTSA 2JT1A 3KEQA 5LHIA 4TV7A 5KK1A 4BHPA 3TKYA 5D5WB 4GYIA 2R7DA 1DPUA 4BNCA 4MQ9F 1CF7B 2IT0A 2UXNA 4I0BA 1ZREA 1T39A 2OA4A 2ETHA 5FO5A 1LEAA 2MC3A 1CGPA 2VE8A 1OYYA 3IRQA 3D0SA 4G9YA 4G8XA 4CDGA 3TOAA 1P6RA 2DLLA 1K7AA 4MGRA 3MWMA 4M9SA 2BE5F 1BIBA 5E18F 4OIOF 4L5IA 4UVBA 1KA8A 3I59A 5D5UB 2ESHA 4LJZF 2GWRA 4CZZA 4I02A 4MNUA 3I53A 1TW3A 5DV5A 3E97A 1O3TA 1SFXA 1WRJA 1XGSA 4M72A 1KYZA 4Q48A 1YTYA 5D8KB 4EM0B 3RKYA 1XGOA 4A12A 2DT5A 2FSWA 3DPTA 3H3ZA 3U9GA 5IT9K 4N9HA 2Z5UA 1OMIA 4HW0A 2IA0A 2FE3A 3I5UA 2QENA 2A69F 2DPUA 2IA2A 3LA7A 3ZMUA 4AIKA 2L4MA 5LBQA 2YR2A 1FT9A 1RZ4A 4RGXA 1QGPA 1U2WA 5CVJA 2G7HA 3F21A 3KETA 2MLKA 2R7FA 5HLGA 3L00A 4AD9A 3ECOA 4NB5A 2PMHA 4PCQA 2VN2A 1DPRA 3BWGA 5ILSA 3BJOA 1FBUA 2M30A 1LEBA 4P55A 1XN7A 1R1VA 3K0LA 4RB1A 5LEJA 4Z2YA 1IRGA 4OINF 2ADUA 3C3WA 2FF4A 2WV0A 2L01A 3P9KA 4QLCU 2RC4A 2HKOA 1J59A 2VBYA 4KUMA 5FLXK 1YW9A 1P92A 1IF1A 1S7OA 2MH9A 4FHTA 2IRFG 2XROA 4ZZDA 2ELHA 2STWA 1FSEA 1BC8C 3F8FA 2FA5A 5D5XB 2J5PA 3V8KA 5BS6A 5E20A 2ZBKA 1IN8A 3LSTA 3ZMTA 1KU7A 4HAMA 3E6DA 1BBYA 4N0BA 1SD6A 3H3UA 2HTJA 1QZZA 3EQLF 4HA8A 1G4DA 2CGPA 4HF2A 1BM9A 4IRGA 2DFIA 3V7CA 1PDNC 5J6XA 2OZ6A 4LB5A 3RYPA 4KFCA 3EDPA 2XVCA 3DPLC 3HHHA 5EEHA 1ZRDA 3IKTA 4KT5C 1QO0D 3KP5A 1G3TA 4PGGA 3DP7A 5D4SA 4WF2A 2G7UA 1G3YA 4HQMA 1W4MA 1ZGAA 2PQ8A 3LWFA 2GZWA 5LRRA 3PQKA 3NEUA 4LK1F 3Q9SA 4U0YA 2VBWA 3TQNA 3F8CA 4XLPF 5BQTA 2E1CA 3J80Z 1P4AA 4JBAA 2VT3A 4P9UA 5JFRA 1F9NA 3O6BB 2HZTA 4KICA 2DU9A 2CO5A 2IW5A 2P6SA 1XSVA 4NQWA 1U5TA 2PN6A 5D5VB 3SZPA 2QBYA 4M6YA 2M87A 2E7WA 4HX8A 3EYYA 3ZMZA 4NHJA 3F72A 5A2QK 3CO6C 1F4KA 3JTHA 2BYVE 4Q4ZF 5BMZA 1DUXC 3WU0A 3IRRA 2C6YA 1REPC 2EV0A 3KP3A 3WTYC 1MZBA 3LFKA 2UZKA 4HF0A 4M73A 3WGIA 1STZA 1QPMA 5E8IA 3BP8A 1Z91A 3IHUA 2YX4A 3MQ0A 1FSHA 2CW0F 4UUVA 1G6NA 4F7ZA 4Y13A 4ZYHA 1ODDA 2PMUA 3KP4A 5J8FA 1O3QA 5F64A 1IN4A 2AS5F 4BQAA 1Z1DA 4FT8A 4EM2A 4LG0A 4CYDA 1J0RA 3LAPA 3MFKA 1IN6A 3TGNA 1R1TA 1MD0A 2KJCA 4G7ZF 2LF8A 1LJ9A 1B59A 1P4XA 1R36A 3SQNA 3FWEA 2XKOA 1A04A 3GZ5A 2VXZA 2P5VA 2M8EA 4OOIA 5DCFA 3KLNA 3I4PA 5E1ZB 4I98B 1YS7A 4MQVA 1W7PA 3RPQA 1EH7A 4RAZA 3U2RA 4EV0A 3IL2A 1Z05A 4G7HF 2W25A 4L9TA 5BOXA 1IXCA 4UVAA 1J9IA 2QYOA 3WTVC 2XKPA 3CLOA 1YO5C 1YW8A 1QNTA 3FMRA 1YIOA 4M6XA 2PLYA 2ZXJA 1I1GA 1GHCA 4GO1A 2Q8KA 1MKMA 3DF8A 3ZPLA 4XSZF 5E1WA 3HSFA 3ELKA 3HTUA 1WWXA 3RDIA 1XGNA 2O8XA 2F5DA 2D1HA 1B9MA 2LF7A 2D45A 2CG4A 2P5KA 3B02A 5DCMB 3WGHA 1D5VA 3LAJA 3CDHA 3ECHA 3CUOA 1CF7A 3HSRA 1L3LA 3GX4X 4G94A 2XUBA 2OZUA 4P9FA 4YFKF 2XAFA 3R0JA 4EJWA 2FNPA 3KFWX 4WCGA 1ZYRF 4WXHA 3QPTA 1YLFA 4EGYA 3RJPA 5HS8A 2CSOA 1FOKA 4B09A 2XAJA 4WWCA 1W5SA 4BHBA 2GXBA 2ZFWA 3JSPA 5E1XA 4LGWA 3JAMK 3HRSA 4AIJA 2B0LA 2UWMA 3LA3A 2FBHA 4JK1X 2P5LC 5CVUA 4U0WA 1R7JA 1PP8F 5CVRA 5ILUA 1WI9A 1KU3A 1BJAA 4HX7A 3CTAA 4R1HA 1KQ8A 1IN5A 3GVAA 1ON2A 1T2KA 1B1BA 4LD5A 4RGUA 2O3FA 1YQAA 3D5LA 3HTSB 1J75A 1Z7UA 1USTA 2A6EF 3ULQB 4BHCA 2XAQA 2NNYA 3VOEA 4KMFA 3I58A 2ZMEB 1R5GA 3T8TA 3CUQA 1Z6RA 3CO7C 1VTNC 1FY7A 3CUQC 3L7WA 3GZ6A 2PBIA 1XGMA 4EQQA 1JHFA 4KIGA 1R5HA 1TTYA 5AONA 4LMYA 4L18B 2OBPA 4QWQA 3BJ6A 1FBQA 4LK0F 1YG2A 4UV9A 2CQKA 2KJBA 2V1XA 2NS0A 3SXYA 1KQ0A 2EA4A 2HEOA 1SFUA 2Z99A 4UXNA 3M8FA 1I27A 1Q1HA 1OYIA 2L4AA 2W85A 1JXSA 1WSUA 2BEOA 2W57A 2Y75A 2H6CA 4ESFA 1USSA 2QUFA 3FMSA 4P96A 5CVIA 3ABUA 3BROA 3ROUA 1BI1A 2V9VA 1IRFA 1BC7C 2FBKA 4KN7X 1HSJA 5CLSA 2GQQA 4ENKA 2ISYA 3EETA 3RI4A 1FBSA 1TLHB 2IJLA 3QRFF 1K6OA 3G73A 1RNLA 3WGGA 2X0LA 1OPCA 2K7LA 2XGXA 4M74A 2FMLA 2WWYA 3C18A 3R6SA 5K5OA 1FYKA 3COAC 3BPVA 3TOBA 3F23A 3KE2A 3KZYA 4ZYDA 1FC3A 3N97A 1UCRA 3AAFA 4RGSA 3V7SA 1K78B 1IAWA 3FXQA 3FXUA 3M8EA 1OYWA 2QBYB 2V6CA 2X4HA 1XDUA 1P4WA 3L2CA 2YPRA 3KCCA 4OU0A 1LDJA 2MLGA 1EV7A 4GGGA 4H0EA 4D0PA 2LSOA 5H20A 4RB3C 5L3FA 1O57A 1BIAA 5H6QA 2HR3A 2K86A 1SMTA 1IUYA 3KLOA 2D2WA 3P9CA 3WODF 3F6VA 3SFZA 1GXQA 3W6KB 3F22A 1V3FA 4I7HA 1HW1A 1FLIA 2J5OA 3J7AO 2HYFA 3SZTA 4FX0A 4L9JA 2HS5A 3JTGA 4ZZLA 1J5YA 3QU3A 5F6FA 1ZHFA 5D6FA 4WXCA 4RS8A 5L3CA 1W7PB 3R0AA 4M9ZA 2EFPA 2VBXA 2IVMA 3HOSA 2RVCA 4EGZA 2Z9OA 3IKVA 1GVJA 4O5VA 2EFQA 1FX7A 1ZLJA 2ZNYA 4ZH4F 4I01A 1S3JA 4IF4A 4EM1A 5DCMA 1KU2A 1TQMA 2XRNA 5TRDA 3TO6A 1DDNA 2M45A 1O7LA 2UXXA 3HRTA 2STTA 4JQFA 4L5JA 2RV8A 1KU9A 3E6MA 1UFMA 2H94A 3IWZA 5CJ9A 4K2EA 2PJPA 2A5YB 2W84A 4XRFA 4IRIA 4OMZA 1AWCA 2H6BA 4RB0A 1JGSA 4ENJA 2QM3A 3GFIA 2K02A 3I54A 2HKXA 2CYYA 1S29A 4MEXF 4UVCA 5DD4A 4Q47A 1KQ9A 4XLNF 4LLLA 5HDKA 1T0FA 2VODA 5AIPA 4N9IA 3V8LA 2RQPA 3WTUC 4IPAA 3P7NA 2FU4A 2O61A 3HUGA 2VBZA 1HKQA 4OMYA 3IWFA 2LDUA 3QAHA 4MTEA 2RDPA 3FM3A 5A2QZ 1K79A 1S6LA 2QLZA 1QBJA 2GXGA 1S7AA 1SD7A 4A5MA 1SAXA 3KP6A 3G3ZA 4RB2C 1FYMA 1O3RA 3QP6A 3ZMSA 1MDMB 3RKXA 1NHAA 4R8HA 1R23A 1ONVA 1ZAOA 4MTDA 4LLGF 1V4RA 4GYGA 3MAJA 4KN4X 1PUEE 3K1MA 3ZQ7A 1UHMA 4ETSA 1WKMA 5LRSA 1HKSA 4Y17A 5CVVA 1U5TC 2RGVA 5FFXA 4A5NA 3V4GA 2K27A 2L3DA 1SD4A 3GWZA 3GO5A 4WK8F 2EV6A 4BXUA 3GFMA 1TQIA 1E2XA 4KIBA 4G7OF 2OD5A 2ZNZA 3GLXA 5LEKA 1MJAA 3F8MA 1B9NA 4ZYEA 4XBFA 1C0WA 2XV4S 1T98A 2Z33A 2YU3A 5HLIA 1FYLA 1ZG1A 1KYWA 1D8KA 1YW7A 4UNOA 3GF2A 4L0YB 3S2WA 4MHGA 2F2EA 5KVRA 3L09A 4DQ2A 1RUNA 4P5OA 3BZ6A 2EFNA 2JZYA 5FLXZ 1Y0UA 3M9AA 1TNTA 3I0TA 3MEXA 2BBYA 2M5WA 3ML6A 2G9WA 2XAGA 2A61A 3Q9VA 4RAYA 4CO8A 1ZLKA 2ZKZA 1WQ2A 2CFXA 1IZ1A 2DTRA 1QZYA 3R60A 1RI7A 2XASA 1TNSA 3DEUA 3GFJA 5ICEA 2LNBA 3HYIA 3QU6A 3WTXC 3GFLA 1ZG5A 2JSCA 2DW4A 2EK5A 2KRFA 3Q5FA 2DBBA 2LKPA 1T6SA 4ESJA 1MJ9A 4L9NA 2DAOA 2V1UA 4A0XA 2R3SA 3ERED 2KIUA 3J81K 2AXLA 5L3GA 3F6OA 2FQ3A 2IA1A 5DDGA 1LVAA 1ZN2A 1FZPB 2GA1A 2NRAC 1HQCA 4YFXF 1K78A 3VODA 6PAXA 3WTZA 1EH6A 3R61A 1XCBA 1U3EM 4LLNA 2A6HF 2MD5A 3KP7A 1O7FA 2GA2A 2FRHA 3M7GA 2L54A 3RIRA 3FHZA 3TO9A 3K1NA 3WE2A 3REOA 1I6XA 5EEGA 3TDZC 2Q0OA 5IT3A 3T0YA 4Y15A 2QVOA 3OV8A 1LDDA 3E5QA 1HW2A 1TBXA 3WTWC 3F3XA 1EH8A 3T5XA 2HFHA 3K9TA 4YIFA 3QP5A 1LNWA 2PG4A 2A68F 3R4KA 1XB4A 3BPXA 3GEZA 1S8NA 3C7JA 2EJRA 1R22A 3HHGA 1FNNA 1JHHA 1HW5A 2DK5A 1PP7U 4EMSA 3HSEA 2QQBA 2D1VA 4IHSA 3T1BA 5HOOA 4G6DA 4A0ZA 5HVQC 3WE3A 3I59B 4YFNF 2ZCWA 3PQJA 1MDMA 3K2ZA 2RKHA 5JHUA 1TQPA 1I1SA 4B8XA 3E3VA 3DV8A 5LGNA 3E6CC 4L0ZB 3DKWA 3LQQA 3FXRA 3VFZA 5JR3A 1F5TA 2QQ9A 4EJVA 3U1DA 4KIFA 3ZN0A 1XCVA 1LQ1A 2ISZA 5F1RA 4I2OA 3GW2A 4WX9A 2HYGD 4A0YA 3K69A 3OOPA 3HOTA 1D3YA 1SFEA 2DO7A 2XIGA 4LG0B 2JPCA 4IRHA 2JTVA 5CYVA 2H09A 2MH2A 5BPDA 1MGTA 4HZFA 1HXDA 3H92A 5JVTA 2WTEA 4AWXB 2Y0MA 2DPDA 3HRUA 2EB7A 4HV5A 2O0YA 4Q5SF 2EV5A 4GCVA 2ZO4A 3K1PA 4PGHA 2EWNA 1BI3A 2P8TA 1U78A 2RNJA 2P4WA 1KGSA 2QWWA 5JI6A 5ILVA 1IN7A 1FP2A 5E17F 3F8BA 1YFHA 3V8JA 5HS7A 2HOEA 3TO7A 1UHWA 1FWZA 2YSRA 4I0AA 1Z9CA 3V7RA 3RTRA 3L9FA 2FEZA 2GIVA 2KIMA 5FD5A 1UB9A 2EFWA 2PFBA 3WTTC 1XMKA 2XHKA 4U88A 1BN5A 4HDVA 4GXOA 1B6AA 4HLYA 2F5FA 1XD7A 4U7DA 2WC2A 2XAHA 1R58A 2GAUA 5HDGA 4U7BA 1RUOA 1XMAA 1O3SA 4BAYA 1W5TA 4PDKA 3WU1B 3BDDA 4RGRA 2IPQX 4ON0A 5HS9A 3JAMZ 4YIIA 3WG9A 1DP7P 4IVNA 3HRMA 2FXAA 3VEPA 5LGUA 1BI0A 2OQRA 4BYYA 1ZRCA 4KDPA 5DUIA 2A07F 4HLXA 1YYVA 5HLHA 3GYHX 1H9TA 4OIPF 4CICA 2COMA 1P2FA 2K4BA 1LDKB 5FD6A 3QPHA 5DYMA 5BPIA 4WXDA 4BH9A 5LHGA 3GUDA 2FBIA 1IXRC 2E1NA 2FOKA 3JW4A 1ULYA 3P9IA 1U6GA 4LFUA 4KYWA 2F5EA 2VE9A 3J80K 4I09A 3KZZA 5DUKA 3BOQA 2YX7A 2L02A 3PFIA 3E6BA 3DXJF 5LHHA 1ON1A 4HV6A 5D4RA 2H27A 1J2XA 4CGZA 1IXSB 2P7VB 3LA2A 3FF5A 4ASNA 4ESBA 2HQNA 1R1UA 3NRVA 2O03A 2BGCA 2HWVA 4UV8A 1SD5A 4AIHA 5J8CA 5L3EA 4HQEA 1ZGJA 1QQIA 2K4JA 5FFZA 4EJTA 4M9XA 4A6EA 1ZARA 3TDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LLQ A;  1HKT A;  4ENM A;  1U8R A;  4YG2 F;  2P6T A;  2VC0 A;  4IJA A;  5IT9 Z;  2HGC A;  2DI3 A;  4HF1 A;  1TW2 A;  2E7X A;  5L3D A;  1XSX A;  1F1Z A;  4EJU A;  1RIO H;  5ED4 A;  3CJN A;  2P7C B;  3KP2 A;  3WTS C;  4PZJ A;  1YS6 A;  1JE8 A;  3EUH A;  3JSO A;  4MEY F;  3VB2 A;  3HIF A;  1FPQ A;  4A2U A;  3M1E A;  2ZME A;  3RKW A;  3IC7 A;  1OR7 A;  3W6J B;  2OU2 A;  4XSX F;  3LQR A;  5K5Q A;  2V1D A;  1H9G A;  2ACJ A;  1HST A;  2IP2 A;  2PEX A;  3RPU A;  3ZN1 A;  3ZP5 A;  4EVI A;  4IXA A;  5K5R A;  4EJO A;  4O6J A;  3E5X A;  4G6Q A;  4UHT A;  2EFO A;  3O2P E;  5DEQ A;  5D8L B;  2O6G E;  4O3M A;  1B4A A;  4HDU A;  2M1B A;  5ERI A;  4DNC A;  4OIQ F;  1I5Z A;  5H6R A;  3BY6 A;  2Z3Y A;  3I64 A;  3I71 A;  4FX4 A;  1BOA A;  2KIF A;  1H0M A;  5K1Y A;  3F8N A;  3KEO A;  4CXF A;  1E17 A;  1GXP A;  3NQO A;  4KA4 A;  5DD8 A;  3C1D A;  3E5U A;  1T38 A;  3RYR A;  2VT2 A;  3B73 A;  3MZH A;  3SHF A;  2NYX A;  4KMU X;  3FX3 A;  2MA3 A;  4M71 A;  4ENN A;  3CUQ B;  3ABT A;  4A6D A;  3DQV C;  4S05 A;  4HBL A;  2ZJ2 A;  1MJB A;  1AOY A;  3MZY A;  1ZH5 A;  2BV6 A;  2NAZ A;  2Q2E A;  5ICF A;  2CWE A;  1ZRF A;  1OKR A;  1BI2 A;  2DQR A;  1XSD A;  4HYE A;  2RN7 A;  5AIQ A;  1Z6T A;  2OQG A;  2F5C A;  2MBF A;  3T8R A;  3FMQ A;  2Y48 A;  4ZYG A;  1J7K A;  5D6E A;  3ISP A;  2A3S A;  2KKO A;  3FM5 A;  2JRT A;  3MCZ A;  1XDS A;  4U0V A;  2NNN A;  1ZG3 A;  5HDN A;  1SMY F;  4R79 A;  2DK8 A;  3EYI A;  1IW7 F;  2HQR A;  1W7P D;  5FGM A;  4KNY A;  2VC1 A;  2VOO A;  3O3K A;  3J81 Z;  4L9V A;  1U5T B;  5ICC A;  4CHU A;  3GXO A;  5FB2 A;  2JPB A;  2V79 A;  1G3S A;  2W24 A;  5E8G A;  1G3W A;  1D8J A;  3ZMV A;  1FP1 D;  5L3B A;  1HBX G;  2HDC A;  4S04 A;  4AVP A;  5TJJ A;  2ESN A;  2QZ8 A;  4HX4 A;  3BJA A;  2FNA A;  2DQL A;  3FZV A;  2QQA A;  4IHT A;  2OAZ A;  5ICG A;  1L0O C;  3N4M A;  2VOP A;  2PI0 A;  2EA2 A;  2TDX A;  5LGT A;  1R00 A;  3QOP A;  4OIR F;  3ZMD A;  4LB6 B;  1LB2 A;  3DFG A;  2FMY A;  4E70 A;  2VON A;  4HOB A;  1X3U A;  2HTS A;  2JT1 A;  3KEQ A;  5LHI A;  4TV7 A;  5KK1 A;  4BHP A;  3TKY A;  5D5W B;  4GYI A;  2R7D A;  1DPU A;  4BNC A;  4MQ9 F;  1CF7 B;  2IT0 A;  2UXN A;  4I0B A;  1ZRE A;  1T39 A;  2OA4 A;  2ETH A;  5FO5 A;  1LEA A;  2MC3 A;  1CGP A;  2VE8 A;  1OYY A;  3IRQ A;  3D0S A;  4G9Y A;  4G8X A;  4CDG A;  3TOA A;  1P6R A;  2DLL A;  1K7A A;  4MGR A;  3MWM A;  4M9S A;  2BE5 F;  1BIB A;  5E18 F;  4OIO F;  4L5I A;  4UVB A;  1KA8 A;  3I59 A;  5D5U B;  2ESH A;  4LJZ F;  2GWR A;  4CZZ A;  4I02 A;  4MNU A;  3I53 A;  1TW3 A;  5DV5 A;  3E97 A;  1O3T A;  1SFX A;  1WRJ A;  1XGS A;  4M72 A;  1KYZ A;  4Q48 A;  1YTY A;  5D8K B;  4EM0 B;  3RKY A;  1XGO A;  4A12 A;  2DT5 A;  2FSW A;  3DPT A;  3H3Z A;  3U9G A;  5IT9 K;  4N9H A;  2Z5U A;  1OMI A;  4HW0 A;  2IA0 A;  2FE3 A;  3I5U A;  2QEN A;  2A69 F;  2DPU A;  2IA2 A;  3LA7 A;  3ZMU A;  4AIK A;  2L4M A;  5LBQ A;  2YR2 A;  1FT9 A;  1RZ4 A;  4RGX A;  1QGP A;  1U2W A;  5CVJ A;  2G7H A;  3F21 A;  3KET A;  2MLK A;  2R7F A;  5HLG A;  3L00 A;  4AD9 A;  3ECO A;  4NB5 A;  2PMH A;  4PCQ A;  2VN2 A;  1DPR A;  3BWG A;  5ILS A;  3BJO A;  1FBU A;  2M30 A;  1LEB A;  4P55 A;  1XN7 A;  1R1V A;  3K0L A;  4RB1 A;  5LEJ A;  4Z2Y A;  1IRG A;  4OIN F;  2ADU A;  3C3W A;  2FF4 A;  2WV0 A;  2L01 A;  3P9K A;  4QLC U;  2RC4 A;  2HKO A;  1J59 A;  2VBY A;  4KUM A;  5FLX K;  1YW9 A;  1P92 A;  1IF1 A;  1S7O A;  2MH9 A;  4FHT A;  2IRF G;  2XRO A;  4ZZD A;  2ELH A;  2STW A;  1FSE A;  1BC8 C;  3F8F A;  2FA5 A;  5D5X B;  2J5P A;  3V8K A;  5BS6 A;  5E20 A;  2ZBK A;  1IN8 A;  3LST A;  3ZMT A;  1KU7 A;  4HAM A;  3E6D A;  1BBY A;  4N0B A;  1SD6 A;  3H3U A;  2HTJ A;  1QZZ A;  3EQL F;  4HA8 A;  1G4D A;  2CGP A;  4HF2 A;  1BM9 A;  4IRG A;  2DFI A;  3V7C A;  1PDN C;  5J6X A;  2OZ6 A;  4LB5 A;  3RYP A;  4KFC A;  3EDP A;  2XVC A;  3DPL C;  3HHH A;  5EEH A;  1ZRD A;  3IKT A;  4KT5 C;  1QO0 D;  3KP5 A;  1G3T A;  4PGG A;  3DP7 A;  5D4S A;  4WF2 A;  2G7U A;  1G3Y A;  4HQM A;  1W4M A;  1ZGA A;  2PQ8 A;  3LWF A;  2GZW A;  5LRR A;  3PQK A;  3NEU A;  4LK1 F;  3Q9S A;  4U0Y A;  2VBW A;  3TQN A;  3F8C A;  4XLP F;  5BQT A;  2E1C A;  3J80 Z;  1P4A A;  4JBA A;  2VT3 A;  4P9U A;  5JFR A;  1F9N A;  3O6B B;  2HZT A;  4KIC A;  2DU9 A;  2CO5 A;  2IW5 A;  2P6S A;  1XSV A;  4NQW A;  1U5T A;  2PN6 A;  5D5V B;  3SZP A;  2QBY A;  4M6Y A;  2M87 A;  2E7W A;  4HX8 A;  3EYY A;  3ZMZ A;  4NHJ A;  3F72 A;  5A2Q K;  3CO6 C;  1F4K A;  3JTH A;  2BYV E;  4Q4Z F;  5BMZ A;  1DUX C;  3WU0 A;  3IRR A;  2C6Y A;  1REP C;  2EV0 A;  3KP3 A;  3WTY C;  1MZB A;  3LFK A;  2UZK A;  4HF0 A;  4M73 A;  3WGI A;  1STZ A;  1QPM A;  5E8I A;  3BP8 A;  1Z91 A;  3IHU A;  2YX4 A;  3MQ0 A;  1FSH A;  2CW0 F;  4UUV A;  1G6N A;  4F7Z A;  4Y13 A;  4ZYH A;  1ODD A;  2PMU A;  3KP4 A;  5J8F A;  1O3Q A;  5F64 A;  1IN4 A;  2AS5 F;  4BQA A;  1Z1D A;  4FT8 A;  4EM2 A;  4LG0 A;  4CYD A;  1J0R A;  3LAP A;  3MFK A;  1IN6 A;  3TGN A;  1R1T A;  1MD0 A;  2KJC A;  4G7Z F;  2LF8 A;  1LJ9 A;  1B59 A;  1P4X A;  1R36 A;  3SQN A;  3FWE A;  2XKO A;  1A04 A;  3GZ5 A;  2VXZ A;  2P5V A;  2M8E A;  4OOI A;  5DCF A;  3KLN A;  3I4P A;  5E1Z B;  4I98 B;  1YS7 A;  4MQV A;  1W7P A;  3RPQ A;  1EH7 A;  4RAZ A;  3U2R A;  4EV0 A;  3IL2 A;  1Z05 A;  4G7H F;  2W25 A;  4L9T A;  5BOX A;  1IXC A;  4UVA A;  1J9I A;  2QYO A;  3WTV C;  2XKP A;  3CLO A;  1YO5 C;  1YW8 A;  1QNT A;  3FMR A;  1YIO A;  4M6X A;  2PLY A;  2ZXJ A;  1I1G A;  1GHC A;  4GO1 A;  2Q8K A;  1MKM A;  3DF8 A;  3ZPL A;  4XSZ F;  5E1W A;  3HSF A;  3ELK A;  3HTU A;  1WWX A;  3RDI A;  1XGN A;  2O8X A;  2F5D A;  2D1H A;  1B9M A;  2LF7 A;  2D45 A;  2CG4 A;  2P5K A;  3B02 A;  5DCM B;  3WGH A;  1D5V A;  3LAJ A;  3CDH A;  3ECH A;  3CUO A;  1CF7 A;  3HSR A;  1L3L A;  3GX4 X;  4G94 A;  2XUB A;  2OZU A;  4P9F A;  4YFK F;  2XAF A;  3R0J A;  4EJW A;  2FNP A;  3KFW X;  4WCG A;  1ZYR F;  4WXH A;  3QPT A;  1YLF A;  4EGY A;  3RJP A;  5HS8 A;  2CSO A;  1FOK A;  4B09 A;  2XAJ A;  4WWC A;  1W5S A;  4BHB A;  2GXB A;  2ZFW A;  3JSP A;  5E1X A;  4LGW A;  3JAM K;  3HRS A;  4AIJ A;  2B0L A;  2UWM A;  3LA3 A;  2FBH A;  4JK1 X;  2P5L C;  5CVU A;  4U0W A;  1R7J A;  1PP8 F;  5CVR A;  5ILU A;  1WI9 A;  1KU3 A;  1BJA A;  4HX7 A;  3CTA A;  4R1H A;  1KQ8 A;  1IN5 A;  3GVA A;  1ON2 A;  1T2K A;  1B1B A;  4LD5 A;  4RGU A;  2O3F A;  1YQA A;  3D5L A;  3HTS B;  1J75 A;  1Z7U A;  1UST A;  2A6E F;  3ULQ B;  4BHC A;  2XAQ A;  2NNY A;  3VOE A;  4KMF A;  3I58 A;  2ZME B;  1R5G A;  3T8T A;  3CUQ A;  1Z6R A;  3CO7 C;  1VTN C;  1FY7 A;  3CUQ C;  3L7W A;  3GZ6 A;  2PBI A;  1XGM A;  4EQQ A;  1JHF A;  4KIG A;  1R5H A;  1TTY A;  5AON A;  4LMY A;  4L18 B;  2OBP A;  4QWQ A;  3BJ6 A;  1FBQ A;  4LK0 F;  1YG2 A;  4UV9 A;  2CQK A;  2KJB A;  2V1X A;  2NS0 A;  3SXY A;  1KQ0 A;  2EA4 A;  2HEO A;  1SFU A;  2Z99 A;  4UXN A;  3M8F A;  1I27 A;  1Q1H A;  1OYI A;  2L4A A;  2W85 A;  1JXS A;  1WSU A;  2BEO A;  2W57 A;  2Y75 A;  2H6C A;  4ESF A;  1USS A;  2QUF A;  3FMS A;  4P96 A;  5CVI A;  3ABU A;  3BRO A;  3ROU A;  1BI1 A;  2V9V A;  1IRF A;  1BC7 C;  2FBK A;  4KN7 X;  1HSJ A;  5CLS A;  2GQQ A;  4ENK A;  2ISY A;  3EET A;  3RI4 A;  1FBS A;  1TLH B;  2IJL A;  3QRF F;  1K6O A;  3G73 A;  1RNL A;  3WGG A;  2X0L A;  1OPC A;  2K7L A;  2XGX A;  4M74 A;  2FML A;  2WWY A;  3C18 A;  3R6S A;  5K5O A;  1FYK A;  3COA C;  3BPV A;  3TOB A;  3F23 A;  3KE2 A;  3KZY A;  4ZYD A;  1FC3 A;  3N97 A;  1UCR A;  3AAF A;  4RGS A;  3V7S A;  1K78 B;  1IAW A;  3FXQ A;  3FXU A;  3M8E A;  1OYW A;  2QBY B;  2V6C A;  2X4H A;  1XDU A;  1P4W A;  3L2C A;  2YPR A;  3KCC A;  4OU0 A;  1LDJ A;  2MLG A;  1EV7 A;  4GGG A;  4H0E A;  4D0P A;  2LSO A;  5H20 A;  4RB3 C;  5L3F A;  1O57 A;  1BIA A;  5H6Q A;  2HR3 A;  2K86 A;  1SMT A;  1IUY A;  3KLO A;  2D2W A;  3P9C A;  3WOD F;  3F6V A;  3SFZ A;  1GXQ A;  3W6K B;  3F22 A;  1V3F A;  4I7H A;  1HW1 A;  1FLI A;  2J5O A;  3J7A O;  2HYF A;  3SZT A;  4FX0 A;  4L9J A;  2HS5 A;  3JTG A;  4ZZL A;  1J5Y A;  3QU3 A;  5F6F A;  1ZHF A;  5D6F A;  4WXC A;  4RS8 A;  5L3C A;  1W7P B;  3R0A A;  4M9Z A;  2EFP A;  2VBX A;  2IVM A;  3HOS A;  2RVC A;  4EGZ A;  2Z9O A;  3IKV A;  1GVJ A;  4O5V A;  2EFQ A;  1FX7 A;  1ZLJ A;  2ZNY A;  4ZH4 F;  4I01 A;  1S3J A;  4IF4 A;  4EM1 A;  5DCM A;  1KU2 A;  1TQM A;  2XRN A;  5TRD A;  3TO6 A;  1DDN A;  2M45 A;  1O7L A;  2UXX A;  3HRT A;  2STT A;  4JQF A;  4L5J A;  2RV8 A;  1KU9 A;  3E6M A;  1UFM A;  2H94 A;  3IWZ A;  5CJ9 A;  4K2E A;  2PJP A;  2A5Y B;  2W84 A;  4XRF A;  4IRI A;  4OMZ A;  1AWC A;  2H6B A;  4RB0 A;  1JGS A;  4ENJ A;  2QM3 A;  3GFI A;  2K02 A;  3I54 A;  2HKX A;  2CYY A;  1S29 A;  4MEX F;  4UVC A;  5DD4 A;  4Q47 A;  1KQ9 A;  4XLN F;  4LLL A;  5HDK A;  1T0F A;  2VOD A;  5AIP A;  4N9I A;  3V8L A;  2RQP A;  3WTU C;  4IPA A;  3P7N A;  2FU4 A;  2O61 A;  3HUG A;  2VBZ A;  1HKQ A;  4OMY A;  3IWF A;  2LDU A;  3QAH A;  4MTE A;  2RDP A;  3FM3 A;  5A2Q Z;  1K79 A;  1S6L A;  2QLZ A;  1QBJ A;  2GXG A;  1S7A A;  1SD7 A;  4A5M A;  1SAX A;  3KP6 A;  3G3Z A;  4RB2 C;  1FYM A;  1O3R A;  3QP6 A;  3ZMS A;  1MDM B;  3RKX A;  1NHA A;  4R8H A;  1R23 A;  1ONV A;  1ZAO A;  4MTD A;  4LLG F;  1V4R A;  4GYG A;  3MAJ A;  4KN4 X;  1PUE E;  3K1M A;  3ZQ7 A;  1UHM A;  4ETS A;  1WKM A;  5LRS A;  1HKS A;  4Y17 A;  5CVV A;  1U5T C;  2RGV A;  5FFX A;  4A5N A;  3V4G A;  2K27 A;  2L3D A;  1SD4 A;  3GWZ A;  3GO5 A;  4WK8 F;  2EV6 A;  4BXU A;  3GFM A;  1TQI A;  1E2X A;  4KIB A;  4G7O F;  2OD5 A;  2ZNZ A;  3GLX A;  5LEK A;  1MJA A;  3F8M A;  1B9N A;  4ZYE A;  4XBF A;  1C0W A;  2XV4 S;  1T98 A;  2Z33 A;  2YU3 A;  5HLI A;  1FYL A;  1ZG1 A;  1KYW A;  1D8K A;  1YW7 A;  4UNO A;  3GF2 A;  4L0Y B;  3S2W A;  4MHG A;  2F2E A;  5KVR A;  3L09 A;  4DQ2 A;  1RUN A;  4P5O A;  3BZ6 A;  2EFN A;  2JZY A;  5FLX Z;  1Y0U A;  3M9A A;  1TNT A;  3I0T A;  3MEX A;  2BBY A;  2M5W A;  3ML6 A;  2G9W A;  2XAG A;  2A61 A;  3Q9V A;  4RAY A;  4CO8 A;  1ZLK A;  2ZKZ A;  1WQ2 A;  2CFX A;  1IZ1 A;  2DTR A;  1QZY A;  3R60 A;  1RI7 A;  2XAS A;  1TNS A;  3DEU A;  3GFJ A;  5ICE A;  2LNB A;  3HYI A;  3QU6 A;  3WTX C;  3GFL A;  1ZG5 A;  2JSC A;  2DW4 A;  2EK5 A;  2KRF A;  3Q5F A;  2DBB A;  2LKP A;  1T6S A;  4ESJ A;  1MJ9 A;  4L9N A;  2DAO A;  2V1U A;  4A0X A;  2R3S A;  3ERE D;  2KIU A;  3J81 K;  2AXL A;  5L3G A;  3F6O A;  2FQ3 A;  2IA1 A;  5DDG A;  1LVA A;  1ZN2 A;  1FZP B;  2GA1 A;  2NRA C;  1HQC A;  4YFX F;  1K78 A;  3VOD A;  6PAX A;  3WTZ A;  1EH6 A;  3R61 A;  1XCB A;  1U3E M;  4LLN A;  2A6H F;  2MD5 A;  3KP7 A;  1O7F A;  2GA2 A;  2FRH A;  3M7G A;  2L54 A;  3RIR A;  3FHZ A;  3TO9 A;  3K1N A;  3WE2 A;  3REO A;  1I6X A;  5EEG A;  3TDZ C;  2Q0O A;  5IT3 A;  3T0Y A;  4Y15 A;  2QVO A;  3OV8 A;  1LDD A;  3E5Q A;  1HW2 A;  1TBX A;  3WTW C;  3F3X A;  1EH8 A;  3T5X A;  2HFH A;  3K9T A;  4YIF A;  3QP5 A;  1LNW A;  2PG4 A;  2A68 F;  3R4K A;  1XB4 A;  3BPX A;  3GEZ A;  1S8N A;  3C7J A;  2EJR A;  1R22 A;  3HHG A;  1FNN A;  1JHH A;  1HW5 A;  2DK5 A;  1PP7 U;  4EMS A;  3HSE A;  2QQB A;  2D1V A;  4IHS A;  3T1B A;  5HOO A;  4G6D A;  4A0Z A;  5HVQ C;  3WE3 A;  3I59 B;  4YFN F;  2ZCW A;  3PQJ A;  1MDM A;  3K2Z A;  2RKH A;  5JHU A;  1TQP A;  1I1S A;  4B8X A;  3E3V A;  3DV8 A;  5LGN A;  3E6C C;  4L0Z B;  3DKW A;  3LQQ A;  3FXR A;  3VFZ A;  5JR3 A;  1F5T A;  2QQ9 A;  4EJV A;  3U1D A;  4KIF A;  3ZN0 A;  1XCV A;  1LQ1 A;  2ISZ A;  5F1R A;  4I2O A;  3GW2 A;  4WX9 A;  2HYG D;  4A0Y A;  3K69 A;  3OOP A;  3HOT A;  1D3Y A;  1SFE A;  2DO7 A;  2XIG A;  4LG0 B;  2JPC A;  4IRH A;  2JTV A;  5CYV A;  2H09 A;  2MH2 A;  5BPD A;  1MGT A;  4HZF A;  1HXD A;  3H92 A;  5JVT A;  2WTE A;  4AWX B;  2Y0M A;  2DPD A;  3HRU A;  2EB7 A;  4HV5 A;  2O0Y A;  4Q5S F;  2EV5 A;  4GCV A;  2ZO4 A;  3K1P A;  4PGH A;  2EWN A;  1BI3 A;  2P8T A;  1U78 A;  2RNJ A;  2P4W A;  1KGS A;  2QWW A;  5JI6 A;  5ILV A;  1IN7 A;  1FP2 A;  5E17 F;  3F8B A;  1YFH A;  3V8J A;  5HS7 A;  2HOE A;  3TO7 A;  1UHW A;  1FWZ A;  2YSR A;  4I0A A;  1Z9C A;  3V7R A;  3RTR A;  3L9F A;  2FEZ A;  2GIV A;  2KIM A;  5FD5 A;  1UB9 A;  2EFW A;  2PFB A;  3WTT C;  1XMK A;  2XHK A;  4U88 A;  1BN5 A;  4HDV A;  4GXO A;  1B6A A;  4HLY A;  2F5F A;  1XD7 A;  4U7D A;  2WC2 A;  2XAH A;  1R58 A;  2GAU A;  5HDG A;  4U7B A;  1RUO A;  1XMA A;  1O3S A;  4BAY A;  1W5T A;  4PDK A;  3WU1 B;  3BDD A;  4RGR A;  2IPQ X;  4ON0 A;  5HS9 A;  3JAM Z;  4YII A;  3WG9 A;  1DP7 P;  4IVN A;  3HRM A;  2FXA A;  3VEP A;  5LGU A;  1BI0 A;  2OQR A;  4BYY A;  1ZRC A;  4KDP A;  5DUI A;  2A07 F;  4HLX A;  1YYV A;  5HLH A;  3GYH X;  1H9T A;  4OIP F;  4CIC A;  2COM A;  1P2F A;  2K4B A;  1LDK B;  5FD6 A;  3QPH A;  5DYM A;  5BPI A;  4WXD A;  4BH9 A;  5LHG A;  3GUD A;  2FBI A;  1IXR C;  2E1N A;  2FOK A;  3JW4 A;  1ULY A;  3P9I A;  1U6G A;  4LFU A;  4KYW A;  2F5E A;  2VE9 A;  3J80 K;  4I09 A;  3KZZ A;  5DUK A;  3BOQ A;  2YX7 A;  2L02 A;  3PFI A;  3E6B A;  3DXJ F;  5LHH A;  1ON1 A;  4HV6 A;  5D4R A;  2H27 A;  1J2X A;  4CGZ A;  1IXS B;  2P7V B;  3LA2 A;  3FF5 A;  4ASN A;  4ESB A;  2HQN A;  1R1U A;  3NRV A;  2O03 A;  2BGC A;  2HWV A;  4UV8 A;  1SD5 A;  4AIH A;  5J8C A;  5L3E A;  4HQE A;  1ZGJ A;  1QQI A;  2K4J A;  5FFZ A;  4EJT A;  4M9X A;  4A6E A;  1ZAR A;  3TDU C; 
#chains in the Genus database with same CATH topology
 5LLQ A;  1FOX A;  4XLH A;  4ENM A;  1HKT A;  2EPF A;  1U8R A;  4YG2 F;  3QOE A;  2P6T A;  2VC0 A;  2DFE A;  3DU6 A;  3BTL A;  4IJA A;  1X1P A;  5J3L A;  4DYR A;  4XIC A;  2GM4 A;  4BXF A;  5IT9 Z;  1WJ5 A;  2HGC A;  2DI3 A;  3JRI A;  2E2H J;  4HF1 A;  1TW2 A;  3PM1 A;  2E7X A;  5L3D A;  2LK2 A;  1XSX A;  3LSJ A;  3HL2 A;  2XDV A;  1F1Z A;  4EJU A;  1RIO H;  1AU7 A;  2PX9 A;  1OLT A;  5ED4 A;  1A6I A;  3CJN A;  2K9S A;  1X3Z B;  4XLF A;  2HXO A;  4XK4 A;  4ZYA A;  2HVS A;  3Q0W A;  2P7C B;  3KP2 A;  3GTL J;  1ERD A;  3WTS C;  4PZJ A;  4AC0 A;  1OR7 C;  3ABK H;  1YS6 A;  1JE8 A;  3EUH A;  1JUM A;  2LP0 A;  1Z21 A;  2FUG 2;  3K10 A;  3JSO A;  1UMQ A;  4MEY F;  3VB2 A;  3HIF A;  3L2V A;  1FPQ A;  5IOY A;  2DOA A;  4A2U A;  3M1E A;  5DM7 F;  2ZME A;  2F5V A;  3RKW A;  3IC7 A;  2R7X A;  1OR7 A;  3W6J B;  1R9T J;  3K4K A;  1Z67 A;  2OU2 A;  2IAI A;  4XSX F;  3LQR A;  5K5Q A;  2MFZ A;  2K3F A;  1JJ6 C;  2V1D A;  3OMY A;  2EZI A;  2HZD A;  1H9G A;  2ACJ A;  3P5J A;  2X1C A;  1HST A;  2VJJ A;  1JUP A;  2IP2 A;  2PEX A;  3RPU A;  3ZN1 A;  4D9J A;  3ZP5 A;  4EVI A;  1HCR A;  4IXA A;  4XN0 A;  5K5R A;  4EJO A;  5EG0 B;  4O6J A;  2RNG A;  3OYM A;  3OL3 A;  3E5X A;  4G6Q A;  4UHT A;  3JRC A;  2EFO A;  3O2P E;  5DEQ A;  5D8L B;  2O6G E;  4O3M A;  4C30 A;  1I6H J;  2DMQ A;  1B4A A;  4HDU A;  3TED A;  3TW6 A;  2M1B A;  2M8G X;  5ERI A;  3C2G A;  4DNC A;  2ZJR F;  3DLA A;  4OIQ F;  1I5Z A;  2AXT C;  5H6R A;  1YRN A;  3BY6 A;  2JA5 J;  4BEH A;  1XS9 A;  2Z3Y A;  2JUC A;  2HOA A;  3I64 A;  3I71 A;  4FX4 A;  1BOA A;  2KIF A;  1H0M A;  5HNH A;  5K1Y A;  3F8N A;  4CA0 A;  4ZTJ A;  3KEO A;  2M7A A;  4CXF A;  1JTY A;  4JP0 A;  4AUX A;  1E17 A;  1GXP A;  3NQO A;  3DU5 A;  1QRY A;  4XKV A;  1N25 A;  4KA4 A;  5DD8 A;  5J4V A;  2IS2 A;  3C1D A;  3AL0 B;  3E5U A;  4F3Q A;  2W00 A;  1T38 A;  3VWB A;  4PUS A;  3CCQ I;  1IRX A;  3RYR A;  2VT2 A;  4D5F A;  5KAI C;  1YRN B;  4Y52 J;  3B73 A;  3MZH A;  3SHF A;  2NYX A;  1K61 A;  5JLW A;  3QYB A;  4KMU X;  3FX3 A;  2MA3 A;  2OCE A;  4DZP A;  4M71 A;  1HA8 A;  4BKX A;  1SEU A;  4ENN A;  3LL7 A;  2E1M C;  3CUQ B;  2QKL B;  3ABT A;  2EIM H;  2DN0 A;  4A6D A;  3PJR A;  3DQV C;  4S05 A;  4HBL A;  2ZJ2 A;  1MJB A;  2DMN A;  3DEE A;  1AOY A;  3MZY A;  1ZH5 A;  2BV6 A;  3PIP F;  2NAZ A;  5IP6 A;  2Q2E A;  1O4X A;  4HG2 A;  1TWC J;  5ICF A;  2CWE A;  1ZRF A;  1OKR A;  1AA7 A;  3DBH B;  2D5V A;  1BI2 A;  2DQR A;  2R7Q A;  1XSD A;  5C3E J;  2COB A;  1OJL A;  3MKY B;  2QQ8 A;  1R4M B;  4HYE A;  2RN7 A;  5AIQ A;  3DTE A;  1Z6T A;  2KHM A;  2KMU A;  4XNF A;  2OQG A;  2F5C A;  4E6K G;  1T0F C;  4BL0 B;  2MBF A;  3BCA A;  4M3G A;  3T8R A;  1XC5 A;  4V2F A;  3FMQ A;  2Y48 A;  3ZGK A;  4ZYG A;  1J7K A;  2E36 A;  5D6E A;  2K9Q A;  5EDN A;  3ISP A;  4I99 C;  2QSH X;  4A3D J;  2A3S A;  2KKO A;  3HUG B;  3FDY A;  2XPV A;  3FM5 A;  2JRT A;  3CDL A;  1WJB A;  3MCZ A;  1YOV B;  2R7O A;  3FKI J;  1U8B A;  3OYA A;  1XDS A;  1WPK A;  4U0V A;  1TC3 C;  2NNN A;  1ZG3 A;  3A02 A;  5HDN A;  1SMY F;  1OCZ H;  4BXX J;  4R79 A;  2DK8 A;  3GCM A;  4B1R A;  1HDD C;  3EYI A;  3DKY A;  1IW7 F;  2HQR A;  2L5Q A;  1W7P D;  3H9J A;  5FGM A;  1YI2 I;  2VC1 A;  1GT0 C;  4KNY A;  2VOO A;  1IDZ A;  2QCO A;  3O3K A;  4GDF A;  4FCY A;  3GME A;  4BQQ A;  3J81 Z;  4PSX A;  1UJ8 A;  4L9V A;  3MKZ A;  1U5T B;  5ICC A;  4CHU A;  3GXO A;  4B44 A;  5FB2 A;  2JA2 A;  4II3 A;  5E3L A;  3E1S A;  5JLX A;  2JPB A;  1B8I B;  2X6Y A;  2V79 A;  3PO2 J;  1G3S A;  3OYL A;  1H88 C;  4A3L J;  2W24 A;  2V9K A;  5E8G A;  1G3W A;  1D8J A;  1V5F A;  3ZMV A;  1FP1 D;  5L3B A;  2HQ5 A;  1HBX G;  2HDC A;  1BA5 A;  5DTD A;  2DA1 A;  2WV1 A;  3HOW J;  5GAH J;  4S04 A;  1Y0N A;  2CU7 A;  2H8W A;  1AKH A;  4AVP A;  4X6A J;  5TJJ A;  3H36 A;  3MVP A;  2KLO A;  5GTH C;  1P7I A;  2ESN A;  2QZ8 A;  3SDB A;  3HOX J;  3ZCO A;  4HX4 A;  4D7M A;  2EZK A;  3BJA A;  2R5Y A;  2FNA A;  1ZTR A;  2DQL A;  3K4J A;  3FZV A;  1DQU A;  2QQA A;  3HGG A;  4IHT A;  2OAZ A;  1D0X A;  5ICG A;  4HRI A;  3PUF A;  1A6Q A;  1L0O C;  3ZRG A;  3MZ8 A;  3N4M A;  2VOP A;  2EBI A;  3GTG J;  1JT0 A;  2NXN B;  2PI0 A;  3I55 I;  2EA2 A;  1XG1 A;  2TDX A;  5LGT A;  3CCR I;  3Q0V A;  2R93 J;  2LOO A;  1R00 A;  3QOP A;  4OIR F;  3CF2 A;  3ZMD A;  4M3B A;  2KL4 A;  4LB6 B;  1LB2 A;  4E7Z A;  4HST A;  1XPX A;  3DFG A;  2FMY A;  4E70 A;  2VON A;  1VQK I;  4HOB A;  1X3U A;  4F92 B;  2LTP A;  2R7T A;  2HTS A;  2JT1 A;  3KEQ A;  3ZOB A;  2JMW A;  5LHI A;  2CMP A;  4B47 A;  2FQ4 A;  4TV7 A;  5KK1 A;  4BHP A;  3K70 C;  3TKY A;  4BJ5 C;  5D5W B;  1MNM C;  1DP3 A;  2AHQ A;  4GYI A;  1ITY A;  2R7D A;  1W5C C;  1DPU A;  1J09 A;  1LFP A;  1XTA A;  4BNC A;  2K9L A;  4MQ9 F;  5BNG A;  1CF7 B;  4ZDO A;  2IT0 A;  2UXN A;  3S1M J;  4I0B A;  1ZRE A;  1T39 A;  2OA4 A;  2ETH A;  2K9M A;  2CQN A;  1YIT I;  5FO5 A;  1LEA A;  2MC3 A;  1CGP A;  3FIW A;  2VE8 A;  1OYY A;  2MG4 A;  3IRQ A;  2NVT J;  3D0S A;  1G8X A;  4XL9 A;  1K83 J;  4G9Y A;  2PJR A;  4CCL A;  2DA7 A;  4G8X A;  4CDG A;  1YJ9 I;  3TOA A;  3H9Q A;  1P6R A;  2DLL A;  4RDU A;  3OYJ A;  1K7A A;  3GBG A;  3G6E I;  2DOF A;  3S1N J;  4GRI A;  1WZ2 A;  3JRB A;  1ZEL A;  4IKF A;  4MGR A;  3MWM A;  4M9S A;  2BE5 F;  1V5G A;  3VYS B;  3CCE I;  2QEX I;  1BIB A;  3DBR B;  3S17 J;  5E18 F;  4OIO F;  4XLC A;  4L5I A;  4B3X A;  4HNT A;  4CCJ A;  4RAF A;  4UVB A;  3CDI A;  1KA8 A;  3I59 A;  2MGQ A;  5D5U B;  2ESH A;  4LJZ F;  2GWR A;  5J1R A;  4CZZ A;  4I02 A;  2CW8 A;  1A36 A;  4MNU A;  1VQ4 I;  2Y30 A;  3RPU D;  3I53 A;  1R49 A;  1TW3 A;  3MKL A;  5DV5 A;  3E97 A;  3SFI A;  2X6O A;  1O3T A;  4M3E A;  1SFX A;  1DGR M;  3KIO A;  4ITV A;  3A03 A;  1WRJ A;  1XGS A;  4M72 A;  1JI8 A;  1KYZ A;  3AKZ A;  4Q48 A;  2JA7 J;  2XGD A;  1YTY A;  5D8K B;  5F0C A;  4EM0 B;  1LE8 B;  3RKY A;  1XGO A;  3BR0 A;  4A12 A;  2DT5 A;  2FSW A;  2L9S A;  3DPT A;  5GAD J;  1MBH A;  3H3Z A;  3U9G A;  5IT9 K;  4N9H A;  3PNV A;  1WJF A;  2Z5U A;  1OMI A;  4HW0 A;  2CUE A;  2IA0 A;  2FE3 A;  2OJE D;  3I5U A;  1FMW A;  1ZR2 A;  2QEN A;  3BR3 A;  2A69 F;  3CMA I;  3ASO H;  2DPU A;  2IS4 A;  4IHX A;  2IA2 A;  3LA7 A;  3SZG A;  2LG4 A;  4KT6 A;  3ZMU A;  1X4O A;  3QPL A;  4AIK A;  2L4M A;  2NOG A;  5LBQ A;  3TL4 X;  2YR2 A;  1FT9 A;  2R5Z A;  1RZ4 A;  1V5E A;  4RGX A;  1QGP A;  1U2W A;  5CVJ A;  2G7H A;  3F21 A;  3KET A;  4IO9 F;  2MLK A;  3OY9 A;  1UEL B;  3CC4 I;  2R7F A;  3A0B C;  5HLG A;  3L00 A;  4AD9 A;  2DA4 A;  3ECO A;  2VQG A;  4PJ0 C;  4NB5 A;  2PMH A;  4PCQ A;  2VN2 A;  1DPR A;  4IOC F;  1UAA A;  3BWG A;  5ILS A;  3BJO A;  1FBU A;  1WH7 A;  2M30 A;  1LEB A;  4P55 A;  1XN7 A;  2PJR B;  2CQ7 A;  2X85 A;  2HNH A;  3FBN B;  1JKP C;  1R1V A;  3VYU B;  4FE7 A;  1SVM A;  2JN6 A;  3K0L A;  4RB1 A;  3IAM 2;  5LEJ A;  2DYS H;  4Z2Y A;  1IRG A;  1BR4 A;  4RA2 A;  4OIN F;  2ADU A;  2GOX B;  2M4K A;  3C3W A;  4X0G A;  2FF4 A;  2W4S A;  2OUM A;  2R7U A;  1MIJ A;  3BG5 A;  3RQ4 A;  2WV0 A;  2L01 A;  3P9K A;  4QLC U;  3I3L A;  3H0G J;  2RC4 A;  2HKO A;  1Y8Q B;  3EPZ A;  2Y2Z A;  1X2N A;  4A3I J;  2IGK A;  2FD5 A;  1J59 A;  2VBY A;  4KUM A;  3MKW B;  4GFB A;  1FIP A;  5FLX K;  1ACI A;  1YW9 A;  1P92 A;  2NVQ J;  1IF1 A;  1S7O A;  2MH9 A;  4FHT A;  2IRF G;  3KX2 A;  2XRO A;  4ZZD A;  2BW3 B;  2ELH A;  3TBI A;  4RM2 A;  2STW A;  2M4G A;  1NG7 A;  1XMX A;  1FSE A;  1BC8 C;  3F8F A;  2FA5 A;  5D5X B;  2Y0S A;  2J5P A;  5FKL A;  3V8K A;  5BS6 A;  5E20 A;  2ZBK A;  2IGN A;  1V54 H;  2K3P A;  2ELJ A;  1IN8 A;  3C2B A;  3LST A;  3ZMT A;  1MND A;  1KU7 A;  1Z77 A;  5FRN A;  4HAM A;  4CUG A;  3GLL A;  3E6D A;  2OPT A;  4AU7 A;  5FLM J;  1BBY A;  1ETV A;  2VQC A;  3SEZ A;  3JRF A;  3LMM A;  3CCV I;  4N0B A;  3AG4 H;  2QA4 I;  1G2H A;  1K4S A;  1SD6 A;  3H3U A;  2HTJ A;  3GTJ J;  1QZZ A;  3CP2 A;  3EQL F;  4HA8 A;  1G4D A;  2CGP A;  3I4M J;  2GOM A;  3JRD A;  2O8K A;  4HF2 A;  5EGO B;  1KZH A;  5EG0 A;  1BM9 A;  3JRG A;  2XAU A;  4IRG A;  1ETW A;  1QHG A;  2DFI A;  3V7C A;  1PDN C;  3IH2 A;  5J6X A;  5C4X J;  3AFH A;  2OZ6 A;  2DA6 A;  4RMN A;  4LB5 A;  3RYP A;  4KFC A;  5F0H A;  9ANT A;  4IHW A;  3EDP A;  3ASN H;  2XVC A;  5EZG A;  5EGO A;  3DPL C;  3HHH A;  1ZK8 A;  5EEH A;  1ZRD A;  3PSI A;  3IKT A;  1IJW C;  3K4N A;  3H1C A;  4KT5 C;  1Q1V A;  4NBQ A;  1QO0 D;  3KP5 A;  1G3T A;  3BG3 A;  2WBM A;  1A5J A;  4PGG A;  3MMY B;  3DP7 A;  2F48 A;  3ZQF A;  5D4S A;  4WF2 A;  2G7U A;  1G3Y A;  2ME0 A;  5IPA A;  2DOE A;  4HQM A;  4Y3O A;  2WA0 A;  3OL4 A;  1PUF B;  1W4M A;  4NC8 A;  2R92 J;  1ZGA A;  2R4G A;  5GPC A;  4IX7 A;  2H1K A;  2PQ8 A;  3LWF A;  2GZW A;  3PQK A;  5LRR A;  3NEU A;  2NVX J;  4LK1 F;  3Q9S A;  5B1A H;  2VBW A;  4U0Y A;  1IGN A;  1NK2 P;  3TQN A;  4BE2 A;  1MMN A;  3F8C A;  3U21 A;  3L2U A;  4XLP F;  5BQT A;  2E1C A;  1JT6 A;  3J80 Z;  1E0E A;  1P4A A;  2ICW G;  4JBA A;  2VT3 A;  3I4N J;  5GTI C;  4P9U A;  1CQT A;  4PFP A;  5JFR A;  2M34 A;  3DTK A;  1LE8 A;  3H5A A;  3BCB A;  2KT0 A;  1DU6 A;  1F9N A;  2XF6 A;  1OCO H;  1VF9 A;  3O6B B;  2HZT A;  4JX5 A;  4KIC A;  3I56 I;  1QVT A;  2DU9 A;  4BJ6 C;  2CO5 A;  2IW5 A;  2P6S A;  1XSV A;  4NQW A;  1U5T A;  2L7K A;  2PN6 A;  5D5V B;  4V19 K;  3SZP A;  2OCC H;  4E7J A;  2VB6 A;  2BY0 A;  2QBY A;  2HDW A;  2Y69 H;  2E60 A;  4M6Y A;  3ZR8 X;  2M87 A;  1NH3 A;  4ZJZ A;  2E7W A;  4HX8 A;  3IH3 A;  5FLV A;  3EYY A;  3ZMZ A;  2LVS A;  4NHJ A;  3F72 A;  5IYB J;  1XX5 A;  5A2Q K;  3CO6 C;  3BR2 A;  3LSK A;  3KEY A;  1F4K A;  1MMA A;  1IV8 A;  2LBF B;  3JTH A;  1A35 A;  1IC8 A;  2BYV E;  4MFE A;  2ECC A;  3QOD A;  4DYQ A;  4Q4Z F;  2DA3 A;  4LIV A;  5BMZ A;  2KDO A;  3AG2 H;  1DUX C;  1SFK A;  3WU0 A;  1S5L C;  3SYT A;  4B3A A;  4J00 A;  5IP9 J;  3IRR A;  2C6Y A;  1REP C;  3FHN A;  2EV0 A;  3KP3 A;  3WTY C;  1MZB A;  3LFK A;  5B1B H;  2DT6 A;  2UZK A;  2E2J J;  2DOD A;  4HF0 A;  2VI6 A;  4CH7 A;  3Q3S A;  2K9N A;  2ZXW H;  4M73 A;  3WGI A;  1STZ A;  1BL0 A;  4ZTF A;  4BDY A;  1QPM A;  2Z1D A;  3CJQ B;  5E8I A;  3BP8 A;  1Z91 A;  4A69 C;  1VND A;  3IHU A;  2YX4 A;  3MQ0 A;  1FSH A;  4DOZ A;  4NC7 A;  2GIZ A;  3OYE A;  2CW0 F;  1YJW I;  4UUV A;  2W7N A;  1G6N A;  1YE9 A;  2F4I A;  2L9R A;  4F7Z A;  4Y13 A;  2JRM A;  4ZYH A;  1RPW A;  1ODD A;  2PMU A;  1F43 A;  1W1W E;  3KP4 A;  1D1B A;  3DWL E;  3G2B A;  5J8F A;  2JK3 A;  1VQM I;  1O3Q A;  2CUF A;  2ZXH A;  5F64 A;  1IN4 A;  4CCK A;  1VQL I;  4UY8 I;  2AS5 F;  4BQA A;  2OTJ I;  1Z1D A;  4FT8 A;  2A5W A;  4BY1 J;  4L5E A;  4EM2 A;  4LG0 A;  4CYD A;  4AYB N;  1J0R A;  4BJT A;  3LAP A;  3MFK A;  4J19 A;  2CS3 A;  1IN6 A;  1FMV A;  3TGN A;  3RZO J;  1R1T A;  3S1R J;  1MD0 A;  2KJC A;  2BY1 A;  4G7Z F;  2LF8 A;  1LJ9 A;  1TWF J;  2GBY A;  4JOM A;  1B59 A;  1P4X A;  1MBE A;  1R36 A;  3PL8 A;  2DA2 A;  2VKD A;  3NWT A;  3L2R A;  3SQN A;  2EQR A;  1KON A;  1X19 A;  2B7E A;  3FWE A;  4C3I J;  2DMU A;  2TCT A;  3IV5 A;  1JKR C;  2XKO A;  1PUF A;  1A04 A;  2DMP A;  3M4O J;  5J1U A;  1WJD A;  1FOY A;  3GZ5 A;  2VXZ A;  1UZC A;  2QSG X;  3CZ6 A;  1X1D A;  2P5V A;  5J47 A;  2M8E A;  5E3N A;  4OOI A;  5DCF A;  3QPS A;  2QF7 A;  2XF5 A;  4MO7 A;  1LVK A;  2I5U A;  2XB0 X;  3KLN A;  3I4P A;  4DIQ A;  5M5W J;  1HF0 A;  5E1Z B;  4I98 B;  1YS7 A;  4MQV A;  1W7P A;  3RPQ A;  1EH7 A;  4RAZ A;  3U2R A;  4RAG A;  4OWR B;  4EV0 A;  1SAN A;  2WAQ N;  3QQA A;  3IL2 A;  1Z05 A;  4G7H F;  1I3Q J;  3DCF A;  2BVM A;  2W25 A;  4L9T A;  5BOX A;  1IXC A;  4UVA A;  1J9I A;  1X3W B;  2QYO A;  3WTV C;  2WB1 N;  1WJC A;  3H35 A;  2XKP A;  3CLO A;  1YO5 C;  1YW8 A;  1QNT A;  2JQ7 A;  2BHY A;  2M7B A;  3FMR A;  1YIO A;  4M6X A;  2PLY A;  1R5I D;  4BY7 J;  3TP3 A;  2ZXJ A;  1SVL A;  2V4J C;  1I1G A;  2XF7 A;  1S72 I;  4MLO A;  1GHC A;  4GO1 A;  2Q8K A;  1MKM A;  2EIK H;  3DF8 A;  3ZPL A;  4XSZ F;  5E1W A;  3ONQ A;  3EUK L;  2AQE A;  3HSF A;  2CQX A;  3ELK A;  2Y31 A;  3IUO A;  1ZR4 A;  3HTU A;  1WWX A;  2KP6 A;  1R6R A;  3ZQI A;  2HVQ A;  3RDI A;  1IDY A;  1XGN A;  2O8X A;  2F5D A;  2WY7 Q;  2DTZ A;  2ZSI B;  2D1H A;  1UG0 A;  4EAT A;  2XRL A;  1B9M A;  2LF7 A;  5IP7 J;  3OYC A;  3FXM A;  4FTH A;  5HOD A;  4HPQ A;  2D45 A;  2CG4 A;  2P5K A;  1MNE A;  4BE0 A;  3B02 A;  5DCM B;  1YJN I;  2H1L A;  1MBF A;  3WGH A;  1D5V A;  3OR1 C;  3OYK A;  2X51 A;  3LAJ A;  4BBS J;  3CDH A;  1TP4 A;  3LSR A;  3ECH A;  3CUO A;  3WHB A;  3OS0 A;  5M5X J;  4F55 A;  2YS9 A;  1CF7 A;  3HSR A;  1POG A;  2VPR A;  4ZDP A;  1L3L A;  1TWA J;  3S2D J;  3GX4 X;  4G94 A;  3OOU A;  4G12 A;  4NQW B;  2XUB A;  3ERM A;  2KZV A;  3UNG C;  4A3J J;  3OIO A;  2OZU A;  4D1Q A;  4P9F A;  4YFK F;  3HKZ N;  2KIQ A;  5F1J A;  3M3Y J;  2XAF A;  3C2H A;  3KZI C;  3R0J A;  2LR8 A;  1WVR A;  1FJL A;  4EJW A;  3GTP J;  1K4T A;  2FNP A;  3KFW X;  4WCG A;  3B6C A;  1ZYR F;  1F36 A;  4WXH A;  5HLT A;  3OIP A;  3QPT A;  4RBO A;  4F91 B;  3RSN A;  1YLF A;  4CCM A;  2CV0 A;  4EGY A;  2DYR H;  3RJP A;  3OIQ A;  3DTI A;  2HOS A;  5HS8 A;  1NTC A;  3DBL B;  2K40 A;  2CSO A;  4E7L A;  4B09 A;  2XAJ A;  3NAR A;  4WWC A;  1FOK A;  1W5S A;  4NDL A;  5FKO A;  4BHB A;  2GXB A;  2M3A A;  2CV1 A;  2ZFW A;  3JSP A;  5E1X A;  4MFD A;  3M1C A;  4LGW A;  3JAM K;  3HRS A;  2RQQ A;  4AIJ A;  2B0L A;  4I6Z A;  4XOR A;  3OYI A;  4DJA A;  5F08 A;  4CCO A;  4E7H A;  2UWM A;  2BXY A;  2A05 A;  1VQ9 I;  3LA3 A;  2FBH A;  4JK1 X;  3FBI B;  2BXZ A;  2P5L C;  3OSG A;  5CVU A;  4U0W A;  1R7J A;  1W36 D;  1PP8 F;  5CVR A;  5ILU A;  4FAS D;  1X1C A;  1AKH B;  1WI9 A;  1KU3 A;  1BJA A;  4HX7 A;  3CTA A;  4R1H A;  3OYD A;  4W1U A;  1ZKG A;  3KYC B;  1KQ8 A;  4XON A;  1R71 A;  1IN5 A;  3GVA A;  1ON2 A;  2W1O A;  3BQZ A;  1B1B A;  1T2K A;  3BTJ A;  4LD5 A;  4RGU A;  3VDX A;  2O3F A;  2HPI A;  3BC8 A;  3G4S I;  2VQH A;  1YQA A;  3D5L A;  3HTS B;  2Q2E B;  1Z7U A;  2HI3 A;  1J75 A;  2FX0 A;  1UST A;  4C2U A;  2A6E F;  3ULQ B;  4X1E A;  1RES A;  2IEK A;  4BHC A;  3JRA A;  3HXL A;  2XAQ A;  1W0U A;  1T95 A;  2NNY A;  3VOE A;  1RET A;  4KMF A;  1I39 A;  3I58 A;  2ZME B;  1R5G A;  3T8T A;  4F52 A;  2NVY J;  2AO9 A;  3CUQ A;  2DA5 A;  4QSH A;  1Z6R A;  3CO7 C;  1VQ6 I;  2ELK A;  2KQR A;  1VTN C;  4XOP A;  1JJ8 C;  1FY7 A;  3CUQ C;  3L7W A;  3GZ6 A;  2PBI A;  1XGM A;  4EQQ A;  1JHF A;  5FJ8 J;  4KIG A;  1R5H A;  1TTY A;  3E7L A;  5AON A;  4S0H B;  5FKM A;  4LMY A;  2LKX A;  3BR6 A;  3K4B A;  4L18 B;  3ZQG A;  2L7F P;  2OBP A;  3A4C A;  4QWQ A;  3BJ6 A;  1VI0 A;  1MH3 A;  1FBQ A;  4LK0 F;  1YG2 A;  5B3S H;  1YHQ I;  4UV9 A;  2JA6 J;  2CQK A;  4KJZ A;  4XKW A;  2KJB A;  2V1X A;  1X1B A;  4BGD A;  2HOT A;  2NS0 A;  3SXY A;  1KQ0 A;  2EA4 A;  2HEO A;  2KRH A;  1SFU A;  2Z99 A;  4UXN A;  1WCM J;  3M8F A;  3HPG A;  1I27 A;  2HXI A;  1Q1H A;  5EF6 A;  2V6E A;  2LY9 A;  2OC6 A;  1OYI A;  2JVG A;  2L4A A;  4NUB A;  4B43 A;  2HQA A;  3GZN B;  2W85 A;  1JXS A;  1WSU A;  4IEJ A;  3BTC A;  5FRO A;  1MBK A;  2BEO A;  2W57 A;  2Y75 A;  4XR6 A;  2H6C A;  4ESF A;  1USS A;  5EYR A;  3CC7 I;  1ETQ A;  2QUF A;  2E1O A;  2EIJ H;  3FMS A;  4A3F J;  4XID A;  3LSP A;  4P96 A;  3X2Q H;  5CVI A;  3ABU A;  3BRO A;  4QPO A;  5IYD J;  2CUJ A;  4PK4 A;  1VQ7 I;  3ROU A;  1VQ8 I;  4BAC A;  2L2O A;  2X6W A;  4ABZ A;  1BI1 A;  2V9V A;  1IRF A;  1X2M A;  4M6V A;  4C9Y A;  3H3V K;  1BC7 C;  1TWG J;  4B48 A;  2FBK A;  2FJ1 A;  3BR1 A;  4KN7 X;  1HSJ A;  5CLS A;  5M5Y J;  5GPA A;  2ECB A;  2GQQ A;  3H0D A;  4ENK A;  2ISY A;  3EET A;  3RI4 A;  1FBS A;  4N4O B;  1TLH B;  1MMD A;  2IJL A;  1WJE A;  4D5C A;  3QRF F;  3FXK A;  3G73 A;  1K6O A;  4DGW B;  2XPW A;  1RNL A;  3WGG A;  4IQJ A;  2X0L A;  1OPC A;  2K7L A;  2XGX A;  3FXL A;  4M74 A;  4C2M J;  1BW6 A;  2AQF A;  2FML A;  2M2E A;  3WHC A;  4BS9 A;  2WWY A;  3C18 A;  3R6S A;  5K5O A;  1FYK A;  3HOZ J;  3COA C;  3BPV A;  3TOB A;  3F23 A;  3D1N I;  3FIS A;  4XRS A;  2DJN A;  1A31 A;  3KE2 A;  5TGT A;  3KZY A;  3CF5 F;  1X4P A;  1UG2 A;  1Y8R B;  2X6X A;  3LSI A;  4ZYD A;  1FC3 A;  4F93 B;  3UR3 C;  3ABM H;  3N97 A;  3PNY A;  2HU9 A;  4A3B J;  2ZJP F;  1UCR A;  3AAF A;  3A01 B;  5KCM A;  4RGS A;  1QPI A;  1MBJ A;  3V7S A;  2JSP A;  1K78 B;  1IAW A;  2V1N A;  4IHY A;  3FXQ A;  3MD2 A;  3FXU A;  3GTM J;  1FTT A;  2JJ7 A;  1E3H A;  3M8E A;  1OYW A;  2QBY B;  3BLY A;  2V6C A;  2W48 A;  2X4H A;  1XDU A;  1P4W A;  4C2T A;  5LD2 C;  2E35 A;  4DW6 A;  3L2C A;  3HDD A;  2YPR A;  5E79 C;  5KAF C;  4A93 J;  3H5R A;  5GAE J;  2E19 A;  1G59 A;  3KCC A;  2DMT A;  1V55 H;  5TIS C;  4OU0 A;  4KIS A;  2DXI A;  1HC8 A;  3SDG A;  1LDJ A;  2MLG A;  1ORK A;  1EV7 A;  2WB1 A;  4GGG A;  4H0E A;  4D0P A;  2LSO A;  5H20 A;  4RB3 C;  5L3F A;  1SFO J;  4Y33 A;  1O57 A;  1LUJ B;  1BIA A;  5H6Q A;  2HR3 A;  2MW8 A;  2K86 A;  1SMT A;  1IUY A;  3KLO A;  2MAB A;  2XSJ C;  2D2W A;  5CQE A;  2IGO A;  1H89 C;  3P9C A;  3WOD F;  3F6V A;  2KIS A;  3SFZ A;  3NWS A;  1GXQ A;  3CCS I;  1RRJ A;  2R7R A;  3W6K B;  2FOW A;  3F22 A;  1V3F A;  4I7H A;  1HW1 A;  1FLI A;  2J5O A;  3K4L A;  1JUS A;  2Z16 A;  4PJJ A;  4ZDL A;  3J7A O;  2HYF A;  3SZT A;  4FX0 A;  4C3H J;  5GP9 A;  2A6T A;  4L9J A;  3K4M A;  1LFB A;  3M07 A;  3DKX A;  4JX6 A;  2HS5 A;  3JTG A;  3IH4 A;  4ZZL A;  4JYK A;  1J5Y A;  3QU3 A;  5DS9 A;  2KPM A;  2EZH A;  3HOV J;  5F6F A;  3WU2 C;  3CCJ I;  1ZHF A;  5D6F A;  4WXC A;  4RS8 A;  2RRE A;  2IS6 A;  5L3C A;  4G6T B;  1W7P B;  3BTI A;  1TZL A;  3R0A A;  2O5R A;  4M9Z A;  4PJN A;  1MSE C;  1MMG A;  3ABL H;  2EFP A;  4A3G J;  2ZJQ F;  2VBX A;  2IVM A;  3HOS A;  2RVC A;  2O7O A;  1TWH J;  4EGZ A;  3EUH C;  4QTR A;  3VYT B;  2Z9O A;  3IKV A;  1GVJ A;  4O5V A;  1Y39 A;  2EFQ A;  1FX7 A;  1ZLJ A;  2ZNY A;  4ZH4 F;  3PSF A;  5CKT A;  3S3M A;  4I01 A;  1LKX A;  1S3J A;  4IF4 A;  4EM1 A;  1RKW A;  3QWL A;  1JKQ C;  1MSF C;  4P1W A;  1OCP A;  5DCM A;  3O8G A;  4FQG A;  1KU2 A;  1TQM A;  1MBG A;  2MD0 A;  4A3E J;  1EKE A;  2XRN A;  5B5E C;  5TRD A;  4QPQ A;  3TO6 A;  5E3M A;  1DDN A;  4CYC A;  2M45 A;  2LKS A;  1O7L A;  3HZJ A;  2UXX A;  2VQL A;  3HRT A;  2STT A;  4JQF A;  4L5J A;  2RV8 A;  1KU9 A;  3E6M A;  1Z3Y A;  1UFM A;  2H94 A;  3HBL A;  3IWZ A;  5CJ9 A;  1U9O A;  4K2E A;  1S9H A;  4YRV A;  2R5Y B;  2PJP A;  3HC7 A;  2OV7 A;  2ZFU A;  4BDZ A;  3JRE A;  5K7Z A;  1YIJ I;  2A5Y B;  2W84 A;  4XRF A;  4IRI A;  4OMZ A;  3E0J B;  1M1E B;  2I8D A;  2ZXI A;  1AWC A;  3VPR A;  2H6B A;  2M0M A;  4RB0 A;  1JGS A;  4FE4 A;  4YEL A;  5JHF A;  4ENJ A;  1EJ9 A;  4FET A;  2QM3 A;  3GFI A;  2EZL A;  2K02 A;  4AID A;  2XGC A;  4E4H A;  2LMD A;  3I54 A;  2HKX A;  2P0W A;  4XQF A;  2CYY A;  3IAS 2;  1S29 A;  2IS1 A;  4MEX F;  4E7S A;  1P7J A;  4UVC A;  5DD4 A;  4CZC A;  1PJR A;  4Q47 A;  1KQ9 A;  5C44 J;  4XLN F;  4LLL A;  5HDK A;  1T0F A;  1B72 B;  2VOD A;  5AIP A;  4N9I A;  4IHV A;  2B63 J;  2LY2 A;  3V8L A;  2RQP A;  3WTU C;  1VZ0 A;  3ZXS A;  2VJ4 A;  3UKG A;  4IPA A;  1VQO I;  3S2H J;  3P7N A;  4D7N A;  2FU4 A;  4DZJ A;  2O61 A;  3HUG A;  2VBZ A;  1HKQ A;  4OMY A;  3BZK A;  3IWF A;  4YIR X;  1QZE A;  1IRZ A;  3U1K A;  1D0Y A;  1BJZ A;  2LDU A;  3QAH A;  4MTE A;  2RDP A;  3A0H C;  1OCR H;  1JKO C;  3FM3 A;  3VSL A;  5A2Q Z;  4XMY A;  1K79 A;  5K7H A;  2WY8 Q;  3CMM A;  2UV1 A;  3S1Q J;  1S6L A;  3BG7 A;  3J7A Y;  2QLZ A;  1QBJ A;  2Y0S N;  2GXG A;  3N05 A;  1E3P A;  1S7A A;  1SD7 A;  4A5M A;  2EIL H;  4UUS A;  2XC7 A;  2W82 A;  4IZZ A;  1SAX A;  3KP6 A;  3CQZ J;  3G3Z A;  1E3O C;  1T8I A;  4RB2 C;  1APL C;  1FYM A;  2ZB9 A;  2L9N A;  4AVZ A;  4EEF G;  1OCC H;  3S14 J;  1JTX A;  1JGG A;  1O3R A;  3QP6 A;  3ZMS A;  3RKX A;  1Y6I A;  1MDM B;  2E2I J;  1NHA A;  3SEQ A;  2R7S A;  4B4C A;  4R8H A;  3DPU A;  2OTL I;  3L1P A;  4CSW A;  5FRM A;  2ZSH B;  1FTZ A;  1R23 A;  3W2W A;  1ONV A;  1VQN I;  1ZAO A;  4MTD A;  4XKC A;  3OYH A;  4LLG F;  1V4R A;  4GYG A;  1TL8 A;  3MAJ A;  1MW7 A;  4KN4 X;  2IXS A;  1PUE E;  3Q0U A;  3K1M A;  3ZQ7 A;  1UHM A;  4ETS A;  1WKM A;  4M3D A;  5B66 C;  5LRS A;  4RLF A;  3S32 A;  1HKS A;  2Y9Y A;  4Y17 A;  5CVV A;  1W36 C;  2VLA A;  2VKV A;  1U5T C;  1HDP A;  2RGV A;  5FFX A;  4CCN A;  2E5N A;  4A5N A;  2XPU A;  3V4G A;  2MYS A;  2K27 A;  2LLK A;  2GXA A;  2L3D A;  5IY5 H;  1SD4 A;  3GWZ A;  3GO5 A;  4OAZ A;  4M3F A;  4YEJ A;  3HKZ A;  4WK8 F;  2BHZ A;  2F4O B;  2EV6 A;  3RCO A;  4BXU A;  4CYC B;  3GFM A;  1TQI A;  1E2X A;  3PIO F;  2TRT A;  4KIB A;  4II2 A;  5CQG A;  4G7O F;  2OD5 A;  4QIW N;  2ZNZ A;  4BEH B;  2R7W A;  5E3O A;  3GLX A;  5LEK A;  1MJA A;  4BUP A;  2HDD A;  3F8M A;  1B9N A;  4ZYE A;  2JVH A;  1AHD P;  4XKB A;  4XBF A;  1C0W A;  2XV4 S;  1T98 A;  3CMY A;  2YU3 A;  2Z33 A;  5HLI A;  3FK7 A;  1FYL A;  3AL0 C;  5DM6 F;  2RAE A;  2WAE A;  5F0F A;  1ZG1 A;  1KYW A;  2V9P A;  1D8K A;  1YW7 A;  4UNO A;  3GF2 A;  5C4J J;  4L0Y B;  4A3C J;  3S2W A;  4LIU A;  4MHG A;  2F2E A;  3EUA A;  3L09 A;  4XLA A;  5KVR A;  4DQ2 A;  2L7Z A;  1RUN A;  4P5O A;  2YU9 J;  3BZ6 A;  2DJI A;  1IG7 A;  1WI3 A;  2EFN A;  2JZY A;  5FLX Z;  1Y0U A;  3M9A A;  4HNV A;  1TNT A;  3ZQH A;  3I0T A;  3MEX A;  1MMS A;  2BBY A;  3LSH A;  2M5W A;  3ML6 A;  2G9W A;  2L0K A;  2XAG A;  3S15 J;  2A61 A;  3FK6 A;  3Q9V A;  4RAY A;  4CO8 A;  2CQQ A;  4UB6 C;  2Y9Z A;  1BR1 A;  1ZLK A;  3SJM A;  2VPL A;  5FKK A;  2XSD C;  2KFD A;  2ZKZ A;  1FIA A;  2LYC A;  4UB8 C;  1WQ2 A;  1IO2 A;  2CFX A;  1IZ1 A;  2DTR A;  2MSY A;  2VKH A;  1QZY A;  1OCT C;  3R60 A;  1RI7 A;  3HOU J;  2XAS A;  4UUT A;  1TNS A;  4PFO A;  3V42 A;  3O8H A;  3LSG A;  2QGU A;  2X9D A;  2E71 A;  2X1E A;  3DEU A;  3A2K A;  3GFJ A;  2M0C A;  4JX4 A;  1HLV A;  1FOW A;  5ICE A;  2LNB A;  2LRD A;  2NOJ B;  1WJA A;  3K2A A;  1SVO A;  3HYI A;  3QU6 A;  3WTX C;  1H8A C;  1W0T A;  2E34 A;  2LBF A;  3GFL A;  1ZG5 A;  2JSC A;  1BOB A;  3MN2 A;  2DW4 A;  2EK5 A;  4XLE A;  3S8P A;  2B9S A;  2KRF A;  3Q5F A;  2LH9 A;  2DBB A;  2LKP A;  1T6S A;  3KYL A;  4ESJ A;  3GTK J;  1ZGW A;  1MJ9 A;  2KZG A;  4L9N A;  3BT9 A;  2DAO A;  1VQ5 I;  2V1U A;  4A0X A;  1I3A A;  2R3S A;  3ERE D;  2KIU A;  3J81 K;  2AXL A;  1ETK A;  5L3G A;  2QKM B;  2IBD A;  3F6O A;  2FQ3 A;  3G1M A;  2IA1 A;  5DDG A;  3B6A A;  1X1A A;  1LVA A;  1WGX A;  1ZN2 A;  2DDA A;  2GA1 A;  1FZP B;  2JUG A;  2PMZ A;  2NRA C;  1HQC A;  1P9Q C;  4RLQ A;  5LFA A;  5HNF A;  2WAD A;  3OS1 A;  5K7F A;  1T08 B;  4YFX F;  2R0Q C;  1K78 A;  1QA6 A;  3VOD A;  3LSM A;  1PYV A;  3JCU C;  6PAX A;  3LNQ A;  2VUM J;  3WTZ A;  1D5Y A;  1EH6 A;  4KIT B;  3OYN A;  3GTQ J;  3R61 A;  1XCB A;  5GAG J;  4A3K J;  1U3E M;  4W97 A;  2DFF A;  4HEA 2;  4LLN A;  2L7M P;  3IP4 B;  3G1L A;  1GLN A;  2A6H F;  2MD5 A;  3KP7 A;  1O7F A;  1UHS A;  1X58 A;  2GA2 A;  2VAS A;  3K6G A;  3CC2 I;  1GUU A;  2FRH A;  2L54 A;  3M7G A;  3RIR A;  3FHZ A;  3TO9 A;  3K1N A;  3WE2 A;  3REO A;  2F6C A;  1I6X A;  5EEG A;  2PMZ N;  1OIS A;  2Q0O A;  3D5S C;  3TDZ C;  3TMO A;  5IT3 A;  2JWT A;  3T0Y A;  2F4M B;  4Y15 A;  2QVO A;  3OV8 A;  5IYC J;  2VIX A;  1LDD A;  3E5Q A;  1HW2 A;  1TBX A;  2CFO A;  3WTW C;  3F3X A;  1EH8 A;  3TP0 A;  3T5X A;  2HFH A;  3K9T A;  2R7V A;  2LC2 A;  2UUZ A;  3FXJ A;  4LIT A;  4YIF A;  3QP5 A;  1LNW A;  2PG4 A;  3H5N A;  3CME I;  4E7K A;  4E7I A;  4LG3 A;  2WAQ A;  5FKN A;  4BBR J;  2A68 F;  2VJI A;  1WHU A;  2BW3 A;  2DFH A;  3RQI A;  4XRM A;  2BOL A;  1IV6 A;  3R4K A;  1XB4 A;  3FXO A;  3CCU I;  4DBR A;  2EH3 A;  3PNT A;  2NVU B;  3BPX A;  1N77 A;  5KHD A;  3KPH A;  3L2Q A;  3GEZ A;  5EZH A;  1S8N A;  2CJJ A;  3C7J A;  5F04 A;  2EJR A;  1R22 A;  3HHG A;  3BQY A;  5J40 A;  1FNN A;  1JHH A;  1HW5 A;  2DK5 A;  3CES A;  3G1O A;  3H9G A;  1PP7 U;  5IOZ A;  4EMS A;  1Y1V J;  3HSE A;  4IL6 C;  1OFC X;  2ZME C;  3BZC A;  3OS2 A;  1ETY A;  3ZQC A;  1S7E A;  2M9H A;  2QQB A;  2D1V A;  3JRH A;  4IHS A;  3T1B A;  5HOO A;  1RR8 C;  3ZQL A;  3JR9 A;  1NG6 A;  4G6D A;  4A0Z A;  5HVQ C;  4N4N B;  3OYB A;  3WE3 A;  3I59 B;  4YFN F;  2K85 A;  1OQY A;  2ZCW A;  4PJM A;  3PQJ A;  3QYE A;  1MDM A;  3K2Z A;  3VSK A;  2RKH A;  5JHU A;  1TQP A;  4RM3 A;  1I1S A;  4B8X A;  4Y4R A;  4BQO A;  3E3V A;  3DV8 A;  3J7Y J;  5LGN A;  3S3O A;  3E6C C;  3L2W A;  4L0Z B;  2E5Z A;  3DKW A;  3LQQ A;  3CP8 A;  2WAF A;  3FXR A;  3VFZ A;  5JR3 A;  5F27 A;  1F5T A;  2QQ9 A;  2L9V A;  2LRE A;  4EJV A;  3U1D A;  2NS7 A;  1YX3 A;  4KIF A;  3RZD J;  3ZN0 A;  4Y7N J;  4IOA F;  1XCV A;  1LQ1 A;  4C3J J;  2ISZ A;  5F1R A;  4A3M J;  4I2O A;  3GW2 A;  2R7Z J;  4WX9 A;  2HYG D;  4A0Y A;  3K69 A;  3OOP A;  2DT7 B;  3VYR B;  3OYG A;  3HOT A;  1D3Y A;  3CJT B;  1SFE A;  4LOC A;  2DO7 A;  2XIG A;  4LG0 B;  2JPC A;  3QYF A;  4HNU A;  4IRH A;  2JTV A;  5CYV A;  5EJC A;  2H09 A;  2MH2 A;  2VL8 A;  5BPD A;  2GLO A;  1QU3 A;  1MGT A;  4HZF A;  1N75 A;  1HXD A;  3H92 A;  1ETX A;  5JVT A;  1Y1W J;  2BVL A;  4HSR A;  2WTE A;  3S3N A;  4AWX B;  2Y0M A;  2DPD A;  1BW5 A;  1GV5 A;  4H4K C;  1N78 A;  1D1C A;  2ID6 A;  3HRU A;  2EB7 A;  4HV5 A;  2O0Y A;  4Q5S F;  3CLQ A;  2EV5 A;  3I9V 2;  4GCV A;  2ZO4 A;  3K1P A;  2BY3 A;  3CCY A;  3PFY A;  4PGH A;  2EWN A;  3ZQQ A;  1BI3 A;  2P8T A;  1U78 A;  5J4Y A;  2RNJ A;  3S16 J;  2P4W A;  1KGS A;  2QWW A;  1WH5 A;  5JI6 A;  1HOM A;  5ILV A;  1IN7 A;  1RR7 A;  2BZT A;  1FP2 A;  5E17 F;  2I10 A;  3F8B A;  1YFH A;  3V8J A;  5HS7 A;  3K70 D;  3PUB A;  2HOE A;  3TO7 A;  1UHW A;  1FWZ A;  2YSR A;  3HPH A;  5KNL A;  4I0A A;  1Z9C A;  3V7R A;  2X1D A;  2V26 A;  1ETO A;  3RTR A;  1DGW Y;  3L9F A;  1IUF A;  4IQ4 A;  2FEZ A;  3KYD B;  2GIV A;  2CW7 A;  2Z2S B;  2KIM A;  5FD5 A;  5EEA A;  2R5Z B;  1UB9 A;  2EFW A;  1PVE A;  2PFB A;  2YUS A;  2CRG A;  1U0J A;  3WTT C;  3G71 I;  1EF4 A;  4PSW A;  1XMK A;  2XHK A;  4U88 A;  1BN5 A;  1I50 J;  1RC9 A;  2Q1Z B;  3ESW B;  2XGE A;  4HDV A;  2KDZ A;  1ZQ3 P;  2ZC2 A;  4FIS A;  1QHH D;  3HB9 A;  4GXO A;  1TT5 B;  1B6A A;  4HLY A;  1VFC A;  3CD6 I;  1B72 A;  2F5F A;  1XD7 A;  2CUZ A;  3K4C A;  2CV2 A;  4U7D A;  2WC2 A;  2KRC A;  2XAH A;  1Z7L A;  1FEX A;  3HJE A;  2QSF X;  1R58 A;  4ANJ A;  2GAU A;  5HDG A;  4U7B A;  3BG9 A;  1NK3 P;  1RUO A;  1XMA A;  1O3S A;  4MIM A;  4XN3 A;  3TW7 A;  4BAY A;  3DEW A;  3AG1 H;  1W5T A;  2ME6 A;  4PDK A;  3WU1 B;  3CCL I;  2H8R A;  3OYF A;  3BDD A;  4RGR A;  3AG3 H;  4UUS B;  1Z3X A;  2IPQ X;  3OR2 C;  4ON0 A;  5HS9 A;  3HGY A;  2LFB A;  3A1Y A;  3JAM Z;  4YII A;  3WG9 A;  1DP7 P;  4IVN A;  3HRM A;  2FXA A;  3VEP A;  5LGU A;  4XOT A;  5H2F C;  1BI0 A;  1LFU P;  2DCE A;  2OQR A;  2HPM A;  4BYY A;  2O9L A;  3HOY J;  3F9K A;  2NS8 A;  1R4N B;  1ZRC A;  4KDP A;  2N8G A;  5DUI A;  2A07 F;  1YX5 A;  1YYV A;  4HLX A;  5HLH A;  3GYH X;  1H9T A;  4OIP F;  2DDB A;  5M3F J;  1TT0 A;  2COM A;  4CIC A;  1P2F A;  2P81 A;  1ENH A;  2VXD A;  1T33 A;  3GTO J;  3J7Z I;  2K4B A;  3DLL F;  1EA3 A;  1LDK B;  1T56 A;  5FD6 A;  2HYJ A;  3HEF A;  3RKQ A;  1D0Z A;  3QPH A;  5DYM A;  4AYB A;  5BPI A;  1DU0 A;  4WXD A;  3K7A J;  5M3M J;  3W6V A;  1Z0X A;  4BH9 A;  5LHG A;  1VQP I;  3GUD A;  3HG9 A;  2FBI A;  3LFU A;  4PJL A;  2EIN H;  1K6Y A;  1IXR C;  2E1N A;  2FOK A;  3JW4 A;  1ULY A;  3P9I A;  1U6G A;  4BU2 A;  4LFU A;  4KYW A;  2F5E A;  4OAY A;  3PO3 J;  2OF7 A;  3F0C A;  2VE9 A;  1SAU A;  3J80 K;  5JVG F;  4I09 A;  3S93 A;  2BY2 A;  3KZZ A;  5DUK A;  3BOQ A;  2V7F A;  2YX7 A;  2L02 A;  2IGM A;  3WG7 H;  2XB5 A;  3PFI A;  3E6B A;  2X48 A;  2LY1 A;  3DXJ F;  3OSF A;  3NAU A;  3W2V A;  4XRS G;  4J01 A;  4I76 A;  1U9N A;  3A01 A;  2ID3 A;  3LOC A;  2VKE A;  5LHH A;  1ON1 A;  2K5C A;  4HV6 A;  1D1A A;  1WFX A;  5D4R A;  3FKJ A;  2H27 A;  3OWT A;  1J2X A;  1GV2 A;  3CCM I;  4BE1 A;  4DYC A;  4CGZ A;  1IXS B;  4V2G A;  4U87 A;  2E1M B;  2P7V B;  3LA2 A;  4BQN A;  1RKT A;  2VJ5 A;  3FF5 A;  4ASN A;  4XM3 A;  3BG6 A;  4ESB A;  2LD5 A;  2JA8 J;  4Z6Y A;  1QVU A;  2HQN A;  1R1U A;  3D5R C;  3M8J A;  3NRV A;  2O03 A;  3BR5 A;  4NC6 A;  5CPR B;  2BGC A;  2MC4 A;  4DBQ A;  2HWV A;  4UV8 A;  1SD5 A;  4AIH A;  5J8C A;  1MH4 A;  1Y56 A;  2HVR A;  5L3E A;  4HQE A;  3W2A A;  1SC7 A;  4ZC3 A;  1ZGJ A;  3W3C A;  4AM3 A;  3CJR B;  5J1Y A;  1QQI A;  4NNJ A;  2K4J A;  5FFZ A;  4EJT A;  4M9X A;  1BR2 A;  1LPQ A;  1B8I A;  1GVD A;  3HM5 A;  4A6E A;  1ZAR A;  2CH0 A;  1GDT A;  3TDU C;  2G0E A; 
#chains in the Genus database with same CATH homology
 5LLQ A;  1HKT A;  4ENM A;  1U8R A;  4YG2 F;  2P6T A;  2VC0 A;  4IJA A;  5IT9 Z;  2HGC A;  2DI3 A;  4HF1 A;  1TW2 A;  2E7X A;  5L3D A;  1XSX A;  1F1Z A;  4EJU A;  1RIO H;  5ED4 A;  3CJN A;  2P7C B;  3KP2 A;  3WTS C;  4PZJ A;  1YS6 A;  1JE8 A;  3EUH A;  3JSO A;  4MEY F;  3VB2 A;  3HIF A;  1FPQ A;  4A2U A;  3M1E A;  2ZME A;  3RKW A;  3IC7 A;  1OR7 A;  3W6J B;  2OU2 A;  4XSX F;  3LQR A;  5K5Q A;  2V1D A;  1H9G A;  2ACJ A;  1HST A;  2IP2 A;  2PEX A;  3RPU A;  3ZN1 A;  3ZP5 A;  4EVI A;  4IXA A;  5K5R A;  4EJO A;  4O6J A;  3E5X A;  4G6Q A;  4UHT A;  2EFO A;  3O2P E;  5DEQ A;  5D8L B;  2O6G E;  4O3M A;  1B4A A;  4HDU A;  2M1B A;  5ERI A;  4DNC A;  4OIQ F;  1I5Z A;  5H6R A;  3BY6 A;  2Z3Y A;  3I64 A;  3I71 A;  4FX4 A;  1BOA A;  2KIF A;  1H0M A;  5K1Y A;  3F8N A;  3KEO A;  4CXF A;  1E17 A;  1GXP A;  3NQO A;  4KA4 A;  5DD8 A;  3C1D A;  3E5U A;  1T38 A;  3RYR A;  2VT2 A;  3B73 A;  3MZH A;  3SHF A;  2NYX A;  4KMU X;  3FX3 A;  2MA3 A;  4M71 A;  4ENN A;  3CUQ B;  3ABT A;  4A6D A;  3DQV C;  4S05 A;  4HBL A;  2ZJ2 A;  1MJB A;  1AOY A;  3MZY A;  1ZH5 A;  2BV6 A;  2NAZ A;  2Q2E A;  5ICF A;  2CWE A;  1ZRF A;  1OKR A;  1BI2 A;  2DQR A;  1XSD A;  4HYE A;  2RN7 A;  5AIQ A;  1Z6T A;  2OQG A;  2F5C A;  2MBF A;  3T8R A;  3FMQ A;  2Y48 A;  4ZYG A;  1J7K A;  5D6E A;  3ISP A;  2A3S A;  2KKO A;  3FM5 A;  2JRT A;  3MCZ A;  1XDS A;  4U0V A;  2NNN A;  1ZG3 A;  5HDN A;  1SMY F;  4R79 A;  2DK8 A;  3EYI A;  1IW7 F;  2HQR A;  1W7P D;  5FGM A;  4KNY A;  2VC1 A;  2VOO A;  3O3K A;  3J81 Z;  4L9V A;  1U5T B;  5ICC A;  4CHU A;  3GXO A;  5FB2 A;  2JPB A;  2V79 A;  1G3S A;  2W24 A;  5E8G A;  1G3W A;  1D8J A;  3ZMV A;  1FP1 D;  5L3B A;  1HBX G;  2HDC A;  4S04 A;  4AVP A;  5TJJ A;  2ESN A;  2QZ8 A;  4HX4 A;  3BJA A;  2FNA A;  2DQL A;  3FZV A;  2QQA A;  4IHT A;  2OAZ A;  5ICG A;  1L0O C;  3N4M A;  2VOP A;  2PI0 A;  2EA2 A;  2TDX A;  5LGT A;  1R00 A;  3QOP A;  4OIR F;  3ZMD A;  4LB6 B;  1LB2 A;  3DFG A;  2FMY A;  4E70 A;  2VON A;  4HOB A;  1X3U A;  2HTS A;  2JT1 A;  3KEQ A;  5LHI A;  4TV7 A;  5KK1 A;  4BHP A;  3TKY A;  5D5W B;  4GYI A;  2R7D A;  1DPU A;  4BNC A;  4MQ9 F;  1CF7 B;  2IT0 A;  2UXN A;  4I0B A;  1ZRE A;  1T39 A;  2OA4 A;  2ETH A;  5FO5 A;  1LEA A;  2MC3 A;  1CGP A;  2VE8 A;  1OYY A;  3IRQ A;  3D0S A;  4G9Y A;  4G8X A;  4CDG A;  3TOA A;  1P6R A;  2DLL A;  1K7A A;  4MGR A;  3MWM A;  4M9S A;  2BE5 F;  1BIB A;  5E18 F;  4OIO F;  4L5I A;  4UVB A;  1KA8 A;  3I59 A;  5D5U B;  2ESH A;  4LJZ F;  2GWR A;  4CZZ A;  4I02 A;  4MNU A;  3I53 A;  1TW3 A;  5DV5 A;  3E97 A;  1O3T A;  1SFX A;  1WRJ A;  1XGS A;  4M72 A;  1KYZ A;  4Q48 A;  1YTY A;  5D8K B;  4EM0 B;  3RKY A;  1XGO A;  4A12 A;  2DT5 A;  2FSW A;  3DPT A;  3H3Z A;  3U9G A;  5IT9 K;  4N9H A;  2Z5U A;  1OMI A;  4HW0 A;  2IA0 A;  2FE3 A;  3I5U A;  2QEN A;  2A69 F;  2DPU A;  2IA2 A;  3LA7 A;  3ZMU A;  4AIK A;  2L4M A;  5LBQ A;  2YR2 A;  1FT9 A;  1RZ4 A;  4RGX A;  1QGP A;  1U2W A;  5CVJ A;  2G7H A;  3F21 A;  3KET A;  2MLK A;  2R7F A;  5HLG A;  3L00 A;  4AD9 A;  3ECO A;  4NB5 A;  2PMH A;  4PCQ A;  2VN2 A;  1DPR A;  3BWG A;  5ILS A;  3BJO A;  1FBU A;  2M30 A;  1LEB A;  4P55 A;  1XN7 A;  1R1V A;  3K0L A;  4RB1 A;  5LEJ A;  4Z2Y A;  1IRG A;  4OIN F;  2ADU A;  3C3W A;  2FF4 A;  2WV0 A;  2L01 A;  3P9K A;  4QLC U;  2RC4 A;  2HKO A;  1J59 A;  2VBY A;  4KUM A;  5FLX K;  1YW9 A;  1P92 A;  1IF1 A;  1S7O A;  2MH9 A;  4FHT A;  2IRF G;  2XRO A;  4ZZD A;  2ELH A;  2STW A;  1FSE A;  1BC8 C;  3F8F A;  2FA5 A;  5D5X B;  2J5P A;  3V8K A;  5BS6 A;  5E20 A;  2ZBK A;  1IN8 A;  3LST A;  3ZMT A;  1KU7 A;  4HAM A;  3E6D A;  1BBY A;  4N0B A;  1SD6 A;  3H3U A;  2HTJ A;  1QZZ A;  3EQL F;  4HA8 A;  1G4D A;  2CGP A;  4HF2 A;  1BM9 A;  4IRG A;  2DFI A;  3V7C A;  1PDN C;  5J6X A;  2OZ6 A;  4LB5 A;  3RYP A;  4KFC A;  3EDP A;  2XVC A;  3DPL C;  3HHH A;  5EEH A;  1ZRD A;  3IKT A;  4KT5 C;  1QO0 D;  3KP5 A;  1G3T A;  4PGG A;  3DP7 A;  5D4S A;  4WF2 A;  2G7U A;  1G3Y A;  4HQM A;  1W4M A;  1ZGA A;  2PQ8 A;  3LWF A;  2GZW A;  5LRR A;  3PQK A;  3NEU A;  4LK1 F;  3Q9S A;  4U0Y A;  2VBW A;  3TQN A;  3F8C A;  4XLP F;  5BQT A;  2E1C A;  3J80 Z;  1P4A A;  4JBA A;  2VT3 A;  4P9U A;  5JFR A;  1F9N A;  3O6B B;  2HZT A;  4KIC A;  2DU9 A;  2CO5 A;  2IW5 A;  2P6S A;  1XSV A;  4NQW A;  1U5T A;  2PN6 A;  5D5V B;  3SZP A;  2QBY A;  4M6Y A;  2M87 A;  2E7W A;  4HX8 A;  3EYY A;  3ZMZ A;  4NHJ A;  3F72 A;  5A2Q K;  3CO6 C;  1F4K A;  3JTH A;  2BYV E;  4Q4Z F;  5BMZ A;  1DUX C;  3WU0 A;  3IRR A;  2C6Y A;  1REP C;  2EV0 A;  3KP3 A;  3WTY C;  1MZB A;  3LFK A;  2UZK A;  4HF0 A;  4M73 A;  3WGI A;  1STZ A;  1QPM A;  5E8I A;  3BP8 A;  1Z91 A;  3IHU A;  2YX4 A;  3MQ0 A;  1FSH A;  2CW0 F;  4UUV A;  1G6N A;  4F7Z A;  4Y13 A;  4ZYH A;  1ODD A;  2PMU A;  3KP4 A;  5J8F A;  1O3Q A;  5F64 A;  1IN4 A;  2AS5 F;  4BQA A;  1Z1D A;  4FT8 A;  4EM2 A;  4LG0 A;  4CYD A;  1J0R A;  3LAP A;  3MFK A;  1IN6 A;  3TGN A;  1R1T A;  1MD0 A;  2KJC A;  4G7Z F;  2LF8 A;  1LJ9 A;  1B59 A;  1P4X A;  1R36 A;  3SQN A;  3FWE A;  2XKO A;  1A04 A;  3GZ5 A;  2VXZ A;  2P5V A;  2M8E A;  4OOI A;  5DCF A;  3KLN A;  3I4P A;  5E1Z B;  4I98 B;  1YS7 A;  4MQV A;  1W7P A;  3RPQ A;  1EH7 A;  4RAZ A;  3U2R A;  4EV0 A;  3IL2 A;  1Z05 A;  4G7H F;  2W25 A;  4L9T A;  5BOX A;  1IXC A;  4UVA A;  1J9I A;  2QYO A;  3WTV C;  2XKP A;  3CLO A;  1YO5 C;  1YW8 A;  1QNT A;  3FMR A;  1YIO A;  4M6X A;  2PLY A;  2ZXJ A;  1I1G A;  1GHC A;  4GO1 A;  2Q8K A;  1MKM A;  3DF8 A;  3ZPL A;  4XSZ F;  5E1W A;  3HSF A;  3ELK A;  3HTU A;  1WWX A;  3RDI A;  1XGN A;  2O8X A;  2F5D A;  2D1H A;  1B9M A;  2LF7 A;  2D45 A;  2CG4 A;  2P5K A;  3B02 A;  5DCM B;  3WGH A;  1D5V A;  3LAJ A;  3CDH A;  3ECH A;  3CUO A;  1CF7 A;  3HSR A;  1L3L A;  3GX4 X;  4G94 A;  2XUB A;  2OZU A;  4P9F A;  4YFK F;  2XAF A;  3R0J A;  4EJW A;  2FNP A;  3KFW X;  4WCG A;  1ZYR F;  4WXH A;  3QPT A;  1YLF A;  4EGY A;  3RJP A;  5HS8 A;  2CSO A;  1FOK A;  4B09 A;  2XAJ A;  4WWC A;  1W5S A;  4BHB A;  2GXB A;  2ZFW A;  3JSP A;  5E1X A;  4LGW A;  3JAM K;  3HRS A;  4AIJ A;  2B0L A;  2UWM A;  3LA3 A;  2FBH A;  4JK1 X;  2P5L C;  5CVU A;  4U0W A;  1R7J A;  1PP8 F;  5CVR A;  5ILU A;  1WI9 A;  1KU3 A;  1BJA A;  4HX7 A;  3CTA A;  4R1H A;  1KQ8 A;  1IN5 A;  3GVA A;  1ON2 A;  1T2K A;  1B1B A;  4LD5 A;  4RGU A;  2O3F A;  1YQA A;  3D5L A;  3HTS B;  1J75 A;  1Z7U A;  1UST A;  2A6E F;  3ULQ B;  4BHC A;  2XAQ A;  2NNY A;  3VOE A;  4KMF A;  3I58 A;  2ZME B;  1R5G A;  3T8T A;  3CUQ A;  1Z6R A;  3CO7 C;  1VTN C;  1FY7 A;  3CUQ C;  3L7W A;  3GZ6 A;  2PBI A;  1XGM A;  4EQQ A;  1JHF A;  4KIG A;  1R5H A;  1TTY A;  5AON A;  4LMY A;  4L18 B;  2OBP A;  4QWQ A;  3BJ6 A;  1FBQ A;  4LK0 F;  1YG2 A;  4UV9 A;  2CQK A;  2KJB A;  2V1X A;  2NS0 A;  3SXY A;  1KQ0 A;  2EA4 A;  2HEO A;  1SFU A;  2Z99 A;  4UXN A;  3M8F A;  1I27 A;  1Q1H A;  1OYI A;  2L4A A;  2W85 A;  1JXS A;  1WSU A;  2BEO A;  2W57 A;  2Y75 A;  2H6C A;  4ESF A;  1USS A;  2QUF A;  3FMS A;  4P96 A;  5CVI A;  3ABU A;  3BRO A;  3ROU A;  1BI1 A;  2V9V A;  1IRF A;  1BC7 C;  2FBK A;  4KN7 X;  1HSJ A;  5CLS A;  2GQQ A;  4ENK A;  2ISY A;  3EET A;  3RI4 A;  1FBS A;  1TLH B;  2IJL A;  3QRF F;  1K6O A;  3G73 A;  1RNL A;  3WGG A;  2X0L A;  1OPC A;  2K7L A;  2XGX A;  4M74 A;  2FML A;  2WWY A;  3C18 A;  3R6S A;  5K5O A;  1FYK A;  3COA C;  3BPV A;  3TOB A;  3F23 A;  3KE2 A;  3KZY A;  4ZYD A;  1FC3 A;  3N97 A;  1UCR A;  3AAF A;  4RGS A;  3V7S A;  1K78 B;  1IAW A;  3FXQ A;  3FXU A;  3M8E A;  1OYW A;  2QBY B;  2V6C A;  2X4H A;  1XDU A;  1P4W A;  3L2C A;  2YPR A;  3KCC A;  4OU0 A;  1LDJ A;  2MLG A;  1EV7 A;  4GGG A;  4H0E A;  4D0P A;  2LSO A;  5H20 A;  4RB3 C;  5L3F A;  1O57 A;  1BIA A;  5H6Q A;  2HR3 A;  2K86 A;  1SMT A;  1IUY A;  3KLO A;  2D2W A;  3P9C A;  3WOD F;  3F6V A;  3SFZ A;  1GXQ A;  3W6K B;  3F22 A;  1V3F A;  4I7H A;  1HW1 A;  1FLI A;  2J5O A;  3J7A O;  2HYF A;  3SZT A;  4FX0 A;  4L9J A;  2HS5 A;  3JTG A;  4ZZL A;  1J5Y A;  3QU3 A;  5F6F A;  1ZHF A;  5D6F A;  4WXC A;  4RS8 A;  5L3C A;  1W7P B;  3R0A A;  4M9Z A;  2EFP A;  2VBX A;  2IVM A;  3HOS A;  2RVC A;  4EGZ A;  2Z9O A;  3IKV A;  1GVJ A;  4O5V A;  2EFQ A;  1FX7 A;  1ZLJ A;  2ZNY A;  4ZH4 F;  4I01 A;  1S3J A;  4IF4 A;  4EM1 A;  5DCM A;  1KU2 A;  1TQM A;  2XRN A;  5TRD A;  3TO6 A;  1DDN A;  2M45 A;  1O7L A;  2UXX A;  3HRT A;  2STT A;  4JQF A;  4L5J A;  2RV8 A;  1KU9 A;  3E6M A;  1UFM A;  2H94 A;  3IWZ A;  5CJ9 A;  4K2E A;  2PJP A;  2A5Y B;  2W84 A;  4XRF A;  4IRI A;  4OMZ A;  1AWC A;  2H6B A;  4RB0 A;  1JGS A;  4ENJ A;  2QM3 A;  3GFI A;  2K02 A;  3I54 A;  2HKX A;  2CYY A;  1S29 A;  4MEX F;  4UVC A;  5DD4 A;  4Q47 A;  1KQ9 A;  4XLN F;  4LLL A;  5HDK A;  1T0F A;  2VOD A;  5AIP A;  4N9I A;  3V8L A;  2RQP A;  3WTU C;  4IPA A;  3P7N A;  2FU4 A;  2O61 A;  3HUG A;  2VBZ A;  1HKQ A;  4OMY A;  3IWF A;  2LDU A;  3QAH A;  4MTE A;  2RDP A;  3FM3 A;  5A2Q Z;  1K79 A;  1S6L A;  2QLZ A;  1QBJ A;  2GXG A;  1S7A A;  1SD7 A;  4A5M A;  1SAX A;  3KP6 A;  3G3Z A;  4RB2 C;  1FYM A;  1O3R A;  3QP6 A;  3ZMS A;  1MDM B;  3RKX A;  1NHA A;  4R8H A;  1R23 A;  1ONV A;  1ZAO A;  4MTD A;  4LLG F;  1V4R A;  4GYG A;  3MAJ A;  4KN4 X;  1PUE E;  3K1M A;  3ZQ7 A;  1UHM A;  4ETS A;  1WKM A;  5LRS A;  1HKS A;  4Y17 A;  5CVV A;  1U5T C;  2RGV A;  5FFX A;  4A5N A;  3V4G A;  2K27 A;  2L3D A;  1SD4 A;  3GWZ A;  3GO5 A;  4WK8 F;  2EV6 A;  4BXU A;  3GFM A;  1TQI A;  1E2X A;  4KIB A;  4G7O F;  2OD5 A;  2ZNZ A;  3GLX A;  5LEK A;  1MJA A;  3F8M A;  1B9N A;  4ZYE A;  4XBF A;  1C0W A;  2XV4 S;  1T98 A;  2Z33 A;  2YU3 A;  5HLI A;  1FYL A;  1ZG1 A;  1KYW A;  1D8K A;  1YW7 A;  4UNO A;  3GF2 A;  4L0Y B;  3S2W A;  4MHG A;  2F2E A;  5KVR A;  3L09 A;  4DQ2 A;  1RUN A;  4P5O A;  3BZ6 A;  2EFN A;  2JZY A;  5FLX Z;  1Y0U A;  3M9A A;  1TNT A;  3I0T A;  3MEX A;  2BBY A;  2M5W A;  3ML6 A;  2G9W A;  2XAG A;  2A61 A;  3Q9V A;  4RAY A;  4CO8 A;  1ZLK A;  2ZKZ A;  1WQ2 A;  2CFX A;  1IZ1 A;  2DTR A;  1QZY A;  3R60 A;  1RI7 A;  2XAS A;  1TNS A;  3DEU A;  3GFJ A;  5ICE A;  2LNB A;  3HYI A;  3QU6 A;  3WTX C;  3GFL A;  1ZG5 A;  2JSC A;  2DW4 A;  2EK5 A;  2KRF A;  3Q5F A;  2DBB A;  2LKP A;  1T6S A;  4ESJ A;  1MJ9 A;  4L9N A;  2DAO A;  2V1U A;  4A0X A;  2R3S A;  3ERE D;  2KIU A;  3J81 K;  2AXL A;  5L3G A;  3F6O A;  2FQ3 A;  2IA1 A;  5DDG A;  1LVA A;  1ZN2 A;  1FZP B;  2GA1 A;  2NRA C;  1HQC A;  4YFX F;  1K78 A;  3VOD A;  6PAX A;  3WTZ A;  1EH6 A;  3R61 A;  1XCB A;  1U3E M;  4LLN A;  2A6H F;  2MD5 A;  3KP7 A;  1O7F A;  2GA2 A;  2FRH A;  3M7G A;  2L54 A;  3RIR A;  3FHZ A;  3TO9 A;  3K1N A;  3WE2 A;  3REO A;  1I6X A;  5EEG A;  3TDZ C;  2Q0O A;  5IT3 A;  3T0Y A;  4Y15 A;  2QVO A;  3OV8 A;  1LDD A;  3E5Q A;  1HW2 A;  1TBX A;  3WTW C;  3F3X A;  1EH8 A;  3T5X A;  2HFH A;  3K9T A;  4YIF A;  3QP5 A;  1LNW A;  2PG4 A;  2A68 F;  3R4K A;  1XB4 A;  3BPX A;  3GEZ A;  1S8N A;  3C7J A;  2EJR A;  1R22 A;  3HHG A;  1FNN A;  1JHH A;  1HW5 A;  2DK5 A;  1PP7 U;  4EMS A;  3HSE A;  2QQB A;  2D1V A;  4IHS A;  3T1B A;  5HOO A;  4G6D A;  4A0Z A;  5HVQ C;  3WE3 A;  3I59 B;  4YFN F;  2ZCW A;  3PQJ A;  1MDM A;  3K2Z A;  2RKH A;  5JHU A;  1TQP A;  1I1S A;  4B8X A;  3E3V A;  3DV8 A;  5LGN A;  3E6C C;  4L0Z B;  3DKW A;  3LQQ A;  3FXR A;  3VFZ A;  5JR3 A;  1F5T A;  2QQ9 A;  4EJV A;  3U1D A;  4KIF A;  3ZN0 A;  1XCV A;  1LQ1 A;  2ISZ A;  5F1R A;  4I2O A;  3GW2 A;  4WX9 A;  2HYG D;  4A0Y A;  3K69 A;  3OOP A;  3HOT A;  1D3Y A;  1SFE A;  2DO7 A;  2XIG A;  4LG0 B;  2JPC A;  4IRH A;  2JTV A;  5CYV A;  2H09 A;  2MH2 A;  5BPD A;  1MGT A;  4HZF A;  1HXD A;  3H92 A;  5JVT A;  2WTE A;  4AWX B;  2Y0M A;  2DPD A;  3HRU A;  2EB7 A;  4HV5 A;  2O0Y A;  4Q5S F;  2EV5 A;  4GCV A;  2ZO4 A;  3K1P A;  4PGH A;  2EWN A;  1BI3 A;  2P8T A;  1U78 A;  2RNJ A;  2P4W A;  1KGS A;  2QWW A;  5JI6 A;  5ILV A;  1IN7 A;  1FP2 A;  5E17 F;  3F8B A;  1YFH A;  3V8J A;  5HS7 A;  2HOE A;  3TO7 A;  1UHW A;  1FWZ A;  2YSR A;  4I0A A;  1Z9C A;  3V7R A;  3RTR A;  3L9F A;  2FEZ A;  2GIV A;  2KIM A;  5FD5 A;  1UB9 A;  2EFW A;  2PFB A;  3WTT C;  1XMK A;  2XHK A;  4U88 A;  1BN5 A;  4HDV A;  4GXO A;  1B6A A;  4HLY A;  2F5F A;  1XD7 A;  4U7D A;  2WC2 A;  2XAH A;  1R58 A;  2GAU A;  5HDG A;  4U7B A;  1RUO A;  1XMA A;  1O3S A;  4BAY A;  1W5T A;  4PDK A;  3WU1 B;  3BDD A;  4RGR A;  2IPQ X;  4ON0 A;  5HS9 A;  3JAM Z;  4YII A;  3WG9 A;  1DP7 P;  4IVN A;  3HRM A;  2FXA A;  3VEP A;  5LGU A;  1BI0 A;  2OQR A;  4BYY A;  1ZRC A;  4KDP A;  5DUI A;  2A07 F;  4HLX A;  1YYV A;  5HLH A;  3GYH X;  1H9T A;  4OIP F;  4CIC A;  2COM A;  1P2F A;  2K4B A;  1LDK B;  5FD6 A;  3QPH A;  5DYM A;  5BPI A;  4WXD A;  4BH9 A;  5LHG A;  3GUD A;  2FBI A;  1IXR C;  2E1N A;  2FOK A;  3JW4 A;  1ULY A;  3P9I A;  1U6G A;  4LFU A;  4KYW A;  2F5E A;  2VE9 A;  3J80 K;  4I09 A;  3KZZ A;  5DUK A;  3BOQ A;  2YX7 A;  2L02 A;  3PFI A;  3E6B A;  3DXJ F;  5LHH A;  1ON1 A;  4HV6 A;  5D4R A;  2H27 A;  1J2X A;  4CGZ A;  1IXS B;  2P7V B;  3LA2 A;  3FF5 A;  4ASN A;  4ESB A;  2HQN A;  1R1U A;  3NRV A;  2O03 A;  2BGC A;  2HWV A;  4UV8 A;  1SD5 A;  4AIH A;  5J8C A;  5L3E A;  4HQE A;  1ZGJ A;  1QQI A;  2K4J A;  5FFZ A;  4EJT A;  4M9X A;  4A6E A;  1ZAR A;  3TDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...