1J9IA

Structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords TERMINASE SMALL SUBUNIT
publication title Insights into specific DNA recognition during the assembly of a viral genome packaging machine.
pubmed doi rcsb
source organism Enterobacteria phage lambda
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j9iA00
2O3FA 4CGZA 1YLFA 1J0RA 1F4KA 3WTVC 2G7HA 2HGCA 3C18A 4RS8A 4ETSA 1FNNA 2ZNZA 3TDZC 3BROA 4L9TA 1JXSA 5L3DA 1IUYA 4N0BA 2RVCA 1SMTA 1G3YA 2LNBA 3GFIA 2VBXA 4AWXB 2WWYA 1WKMA 3KCCA 3EYIA 4XLNF 1IRFA 4QWQA 3V4GA 1HSJA 3ISPA 3I58A 1RNLA 2BYVE 2HR3A 1DPUA 3QPHA 4A5NA 3EETA 1TTYA 2H6BA 1IAWA 5ILSA 1ZLJA 5E1ZB 3WGIA 2XASA 4UVAA 2O61A 1QZZA 2GIVA 2CFXA 2XROA 3QP6A 5D5XB 3MQ0A 4OIOF 1SAXA 2FMYA 2QLZA 3BDDA 4ENKA 3EQLF 4RB0A 3FX3A 5E20A 4LMYA 3QU3A 4HDVA 2QWWA 3VB2A 1ZN2A 3IRQA 2FNAA 4ASNA 3BZ6A 3J81Z 4XBFA 2KIUA 1LEBA 3F72A 3DXJF 2GXBA 1SFEA 2HYFA 3W6KB 3RKWA 1BI0A 4M74A 4AD9A 3ZMSA 3F8CA 4BHBA 2P4WA 1ONVA 3PQKA 2FRHA 3GZ5A 3CUOA 2XV4S 3WTTC 4LB5A 2VBYA 3G3ZA 4OU0A 4Y15A 3RYPA 1YW7A 2ACJA 2IRFG 2P5LC 2EFQA 2EFWA 3GLXA 3V8KA 1O3SA 1QQIA 2XVCA 3GWZA 4M9ZA 1ZRFA 3ABUA 2VBWA 3LSTA 2UZKA 2STTA 1BOAA 1W5SA 1X3UA 4G6DA 4MTDA 1LDJA 3TDUC 3FXQA 2P5KA 2DPDA 5TRDA 3FMQA 3FMRA 1LJ9A 1HKQA 1VTNC 4RGUA 3B02A 1HQCA 4L0ZB 4HX4A 4EGZA 5EEHA 2X4HA 3CDHA 3OOPA 3LQRA 1DUXC 2RKHA 1IRGA 4EQQA 4A6EA 3PFIA 3TOAA 3CLOA 1ZG5A 1B6AA 4RB3C 5K5OA 1YS6A 2E1CA 3IWZA 2FXAA 3QRFF 4IHSA 1KA8A 4EJUA 2XHKA 3NRVA 2DBBA 3HUGA 1ZG1A 4L9NA 3P9IA 3LA7A 1YO5C 4QLCU 2MD5A 5H6RA 1S29A 5TJJA 3E5QA 3L2CA 4LB6B 1YTYA 4ZYDA 4IPAA 5AONA 2VONA 1MDMA 1V4RA 1H0MA 1ZRDA 4D0PA 4U88A 3CO7C 2EFPA 5D6EA 4RGXA 1V3FA 3T5XA 3GX4X 2RV8A 1G4DA 2RQPA 1O3TA 3F6OA 3VEPA 5LEJA 5KVRA 4M71A 4MEYF 1PDNC 4N9IA 2VE8A 4KMUX 1FLIA 2MH9A 3I0TA 3KLNA 3F23A 2VN2A 5JI6A 2BGCA 2PI0A 2KKOA 1SMYF 5D4SA 1FBQA 3SXYA 1FYLA 1K6OA 2MH2A 3TGNA 3LA2A 5IT3A 5FFZA 1K78A 3I64A 3Q9VA 5BMZA 3CUQC 4TV7A 3M8EA 4HQMA 1OPCA 2NYXA 3EUHA 3U9GA 2HOEA 4UV9A 5FLXZ 1SFUA 1HXDA 4LD5A 4FX4A 4XSXF 4G7OF 4O3MA 5D4RA 4UV8A 2Z3YA 2Y75A 3ELKA 2YU3A 1TNSA 2IJLA 5BPDA 2RGVA 4BH9A 1U5TC 3R4KA 3Q5FA 2LDUA 2NNNA 4HQEA 3ECHA 1CF7A 1DDNA 2H09A 2XKOA 4JQFA 2PN6A 1JHHA 4K2EA 3FM3A 2HWVA 1ODDA 1IN8A 2EWNA 3WTSC 2YX7A 1UCRA 2OU2A 2PQ8A 3BWGA 2DFIA 5IT9K 2YPRA 1P6RA 1R58A 1BBYA 5LRSA 4A6DA 4F7ZA 2HKOA 5F6FA 4HF0A 2CSOA 3M9AA 2MBFA 3U2RA 1MJAA 1J59A 2J5PA 2BBYA 1P92A 2JPBA 1MDMB 1R7JA 1GHCA 3T1BA 3H3ZA 3HSRA 4HX7A 2F5EA 3WGHA 2CG4A 1I5ZA 2RC4A 3WG9A 2L4MA 4P9FA 5K5QA 4LLGF 3RPUA 1BJAA 4KMFA 4U7DA 5LHIA 4L5IA 1YG2A 3T0YA 2P6TA 5L3CA 2HTSA 5A2QK 2V1XA 1USTA 1C0WA 1R5HA 2IPQX 3V7CA 4HLYA 3IRRA 2M5WA 2W24A 3R0JA 3E3VA 3WTZA 1XN7A 1LDDA 2BE5F 1KU9A 1U78A 3MCZA 2LF8A 2DT5A 3ZQ7A 4OMZA 4IF4A 4WCGA 2ISZA 4ZZDA 4L9VA 3IWFA 4IRHA 3ECOA 3GYHX 4H0EA 2W85A 4CHUA 4Y17A 2Z99A 3K69A 1FBUA 1O3QA 5JVTA 3KP3A 3HIFA 5HLIA 3JSPA 4Y13A 5E17F 2OZ6A 3BPXA 5ERIA 5ILUA 2JSCA 2CYYA 4S04A 4PDKA 2A07F 3R6SA 3CJNA 1RI7A 4U0YA 5K1YA 2DQLA 2QBYA 3IKVA 2GWRA 2ESHA 3WTXC 4KNYA 4ON0A 1IZ1A 2R3SA 3DKWA 2FNPA 2JPCA 4O6JA 3RJPA 4KICA 5ED4A 4JBAA 4BHCA 3WU1B 4CYDA 1U3EM 4IXAA 1IXRC 1G3WA 3FXRA 3BY6A 2Y48A 2Z9OA 2OZUA 1ZAOA 2XUBA 3AAFA 4ENJA 3WGGA 3SZPA 4UVCA 2UWMA 4M6XA 4YIIA 1GXPA 1KQ0A 1XSVA 3IKTA 4Q5SF 4UUVA 4RB2C 2FBHA 2WC2A 1H9GA 2LF7A 3KP4A 2DPUA 4RAZA 3TO6A 4YG2F 1LNWA 5E1WA 4A2UA 3I54A 4E70A 2NNYA 2RDPA 1B59A 3L09A 5H20A 2E7WA 2Q8KA 3B73A 1W4MA 1F1ZA 5CVVA 4KDPA 3K1NA 2NAZA 2VOOA 1KQ8A 4BXUA 5CLSA 4M73A 4HF1A 4MEXF 3RKXA 2A5YB 2M8EA 2H6CA 3JSOA 4CZZA 1FSHA 3E6BA 1O7LA 4UXNA 3K1MA 3R61A 4HAMA 4YFKF 4BNCA 3COAC 2QZ8A 3KP2A 4KFCA 3SQNA 3ULQB 2ZJ2A 2B0LA 1IF1A 1BM9A 3ZMUA 2VBZA 2PEXA 1MJBA 1TW3A 3I53A 3K1PA 5FD6A 4AIKA 2H27A 1W7PD 4IVNA 2JRTA 3HRTA 1R22A 1JE8A 4WXCA 1R5GA 1Y0UA 2PJPA 2EK5A 4ENMA 2ZO4A 1FZPB 2V9VA 2MLKA 2ZBKA 3ROUA 2HKXA 5DDGA 2OQRA 5CVUA 4ESBA 3HRMA 1S7AA 1TBXA 3QAHA 3HTSB 2DK5A 1T38A 4AIHA 5BS6A 4LG0A 1BC7C 4OIPF 1HKTA 3C1DA 1RZ4A 2HQNA 1I1SA 3E5XA 1BIBA 2XAJA 2QBYB 2V79A 3O2PE 2BV6A 2ZMEA 4OMYA 1D3YA 2O03A 1XDUA 2ZKZA 5HDNA 4UVBA 4B09A 3EYYA 1XCBA 4GYIA 3ZN0A 4Q4ZF 2PMUA 1OYWA 2A6HF 2EV0A 1UB9A 5CVRA 2F2EA 2A6EF 3RI4A 1CGPA 4YIFA 3LAJA 5DEQA 2M87A 4RGRA 4ZYEA 1H9TA 4I01A 4KUMA 4HA8A 1B9MA 1UHMA 1R00A 1S7OA 2H94A 4PZJA 3F6VA 3DPLC 3QU6A 1E2XA 4WX9A 1J2XA 1WRJA 2EFOA 1Z05A 3REOA 1GXQA 1ZREA 1IN7A 3HRUA 4NHJA 1YW9A 4IRGA 3D5LA 3WODF 2XAFA 3GO5A 3ML6A 2FA5A 3QPTA 1NHAA 1TW2A 2W25A 1KU3A 2O0YA 2W57A 3D0SA 5D5VB 1QZYA 1P4AA 4G7ZF 4AVPA 2XIGA 1FY7A 1XSXA 2DK8A 4KT5C 5IT9Z 1IN6A 5HS7A 2DW4A 4RB1A 1EH7A 2K7LA 2BEOA 3IHUA 4G8XA 2EJRA 3KP5A 2L02A 2P7VB 1D8JA 4A0XA 3ZP5A 3HSEA 4L18B 3J81K 2CWEA 1XMAA 2L54A 5HDGA 3KZYA 2AS5F 3JTHA 4LLNA 4ESFA 1Z6TA 1ON1A 5ICCA 3K2ZA 4LG0B 3KZZA 3ZMVA 5A2QZ 1W7PA 1B4AA 3R0AA 1HBXG 4A5MA 4HYEA 5LEKA 4I7HA 4GCVA 1PP8F 4IHTA 4JK1X 3C3WA 2ZMEB 4OINF 5ILVA 1UHWA 1WWXA 2J5OA 4G6QA 1KQ9A 1MZBA 2XKPA 1XDSA 2FE3A 3VOEA 3FXUA 3M1EA 4A0ZA 2JZYA 3CO6C 5J8FA 2ISYA 3GFMA 4CICA 1W5TA 3R60A 4HLXA 3TOBA 2K02A 5AIPA 2WTEA 3C7JA 1U2WA 4KA4A 1ZHFA 5L3EA 2CGPA 1Z9CA 3RTRA 3T8TA 3E5UA 1RUNA 4MNUA 1ZGJA 4PGHA 5ICFA 1SD6A 2Y0MA 5JHUA 2OD5A 1B1BA 5D8LB 1Z1DA 1L3LA 1PP7U 3MZHA 4KIFA 2Z33A 4UHTA 3WE2A 2QVOA 3KEQA 3LA3A 4BYYA 5LHGA 3V8JA 1P4XA 1ZH5A 5DD8A 1AWCA 4LFUA 2F5DA 4WWCA 3U1DA 2GAUA 2QQ9A 2EV5A 2OBPA 4L5JA 4BHPA 1IW7F 3W6JB 5J8CA 1YW8A 3V8LA 3BOQA 1D8KA 2IVMA 1DPRA 2NRAC 3S2WA 2QM3A 5EEGA 3LAPA 3GUDA 3LQQA 1FWZA 4M9XA 2HEOA 3Q9SA 1OMIA 3G73A 3P9CA 1YYVA 4EV0A 1G3SA 1MKMA 3L00A 4HW0A 1OKRA 4LK1F 1XB4A 4P5OA 2IA1A 4WK8F 4GYGA 5DV5A 1S3JA 2DO7A 4HDUA 3FWEA 3F21A 1FP2A 2PBIA 3BP8A 3DF8A 3RKYA 2VXZA 3RIRA 4R8HA 4A0YA 1W7PB 1K79A 1REPC 1I6XA 4ESJA 2TDXA 1BIAA 2P5VA 4DQ2A 1S6LA 4GXOA 5J6XA 4BAYA 1QBJA 4CO8A 1FC3A 3SHFA 1ZYRF 2ZXJA 1OYYA 4A12A 1B9NA 2KIMA 2FSWA 1T2KA 3GVAA 1BI1A 4G7HF 3F8FA 1IXSB 2HYGD 3F8BA 2D2WA 4OIRF 2DLLA 2M45A 4EM2A 4FHTA 4HF2A 5HS8A 2GA2A 4NQWA 1DP7P 4U0VA 2V1DA 4WXHA 3SZTA 2R7DA 3GXOA 3F22A 3LFKA 1WI9A 4OIQF 1U5TB 3L9FA 2G9WA 1KYWA 4EM1A 2V6CA 1Q1HA 3MAJA 1FYKA 1QNTA 1LB2A 3WTWC 5FD5A 1AOYA 3LWFA 2FBIA 3RPQA 1G6NA 2RNJA 2CQKA 2MA3A 3HOSA 1BI3A 4YFXF 1ULYA 2YX4A 3ZPLA 5F1RA 4ZH4F 2E1NA 3KEOA 1OYIA 5BPIA 2MC3A 3E97A 3HTUA 3VODA 3F3XA 4KIGA 3K9TA 1FT9A 3O6BB 5DUKA 3MFKA 1PUEE 1U8RA 2CW0F 2L3DA 1ZG3A 1USSA 2STWA 4GGGA 5CJ9A 1T0FA 2FU4A 3BJAA 2Q0OA 1XGSA 1TQMA 4G94A 3JW4A 2P7CB 1D5VA 4IRIA 1G3TA 5E1XA 2A68F 4YFNF 3H3UA 3HYIA 2GA1A 1A04A 1SFXA 2AXLA 4Q48A 1HW1A 3JAMK 4HX8A 4FT8A 1OR7A 3K0LA 2A69F 1QPMA 4RAYA 5LGUA 3QP5A 1YQAA 2ELHA 5CVJA 2RN7A 2K86A 3GFJA 3DEUA 1T6SA 1HSTA 1FBSA 4XRFA 4MGRA 2ADUA 2CO5A 3E6DA 4EM0B 3GF2A 4WF2A 1T98A 1R1UA 5E18F 1JHFA 2VT2A 1IN5A 2X0LA 3KFWX 1BI2A 5FFXA 5DD4A 1ZGAA 3KP7A 2K27A 2EB7A 1E17A 2FBKA 1SD5A 4HOBA 5HLGA 4MQ9F 2IA0A 3HSFA 2HZTA 3M7GA 3TO7A 5HOOA 4P55A 5CVIA 1XSDA 3I59B 4I02A 1XD7A 1ZARA 4O5VA 2PFBA 2QQAA 2UXNA 1TQIA 1O57A 4KYWA 3WU0A 5E8GA 3J80K 2DAOA 2LSOA 4P96A 1I1GA 2XAGA 4HV6A 4PCQA 3MZYA 2HQRA 5DYMA 4CDGA 2MLGA 4EJOA 4IJAA 5JFRA 3TKYA 5HLHA 3WE3A 3L7WA 5ICEA 5LHHA 1MJ9A 1BC8C 4M9SA 2VE9A 1UFMA 3ABTA 4N9HA 3FF5A 2IP2A 3N97A 2HFHA 1SD4A 3GW2A 4I0BA 1FYMA 4I0AA 5D8KB 1Z91A 4I2OA 4KIBA 4LK0F 3TO9A 1P4WA 2A61A 2F5FA 4RGSA 3FHZA 2D45A 1STZA 5E8IA 4MHGA 3I71A 2OAZA 1XCVA 2LKPA 3F8MA 1QGPA 6PAXA 4HZFA 1JGSA 3ZMZA 2D1VA 4EJVA 4CXFA 3FZVA 3ZN1A 5D6FA 3BJ6A 4EGYA 1XGMA 1ZLKA 1YFHA 1R36A 4ZYHA 3DFGA 2ZFWA 2QQBA 3E6MA 5HS9A 4XSZF 4EMSA 5BQTA 1F5TA 2VODA 3BPVA 1Z7UA 1LDKB 5H6QA 4HBLA 3NEUA 2COMA 1F9NA 5LGTA 3MWMA 3MEXA 3WTYC 4ZZLA 1HW5A 3FMSA 4AIJA 3T8RA 2QENA 2IA2A 3F8NA 4GO1A 2FQ3A 2OQGA 5DUIA 1Z6RA 2A3SA 2L01A 2ETHA 2KJBA 3DQVC 2V1UA 5LLQA 1R1TA 2G7UA 1R1VA 3P9KA 2KRFA 1R23A 4NB5A 2PLYA 3ZMDA 2XAQA 4G9YA 2VT3A 1RIOH 1HW2A 1EH8A 3KP6A 3KETA 2ZNYA 1EH6A 4PGGA 1P2FA 3WTUC 2JTVA 1KU2A 1TLHB 2PMHA 2EV6A 5DCMA 3CUQA 2YR2A 4MQVA 4I09A 4MTEA 2OA4A 2GQQA 3FM5A 2C6YA 1YIOA 1IXCA 4XLPF 3SFZA 1XGOA 2WV0A 4Z2YA 4U0WA 2E7XA 4EJWA 1I27A 4DNCA 4EJTA 2XAHA 3ERED 5L3GA 1FX7A 2VC0A 3PQJA 1IN4A 4HV5A 1TQPA 1J9IA 1U5TA 2VOPA 3GZ6A 1QO0D 3V7SA 3H92A 1XGNA 2IW5A 3TQNA 2EA4A 2DTRA 1EV7A 4R1HA 5FGMA 2GXGA 4I98B 1XMKA 5BOXA 4LJZF 2W84A 1FP1D 2DI3A 5FO5A 2M1BA 4KN4X 4S05A 5JR3A 2Z5UA 2R7FA 5HVQC 1FSEA 2F5CA 3DP7A 2DU9A 4M6YA 2P6SA 4U7BA 3RDIA 2QYOA 2ZCWA 5KK1A 1KU7A 1HKSA 1T39A 2HDCA 1BN5A 2DQRA 4EVIA 1RUOA 2P8TA 1WSUA 2K4JA 1J7KA 5AIQA 3HRSA 3GEZA 4UNOA 1ON2A 2NS0A 2FEZA 4LGWA 4L9JA 3I5UA 1SD7A 5D5WB 2Q2EA 3BJOA 3HHHA 3JTGA 2KJCA 3CTAA 1U6GA 3N4MA 4M72A 5D5UB 2HTJA 3HHGA 1WQ2A 5F64A 1J5YA 5LGNA 3IC7A 3I4PA 2L4AA 4LLLA 2XRNA 4R79A 3HOTA 3KLOA 5DCFA 3VFZA 4B8XA 4FX0A 1O7FA 3ZMTA 3JAMZ 5L3FA 4L0YB 1K7AA 3IL2A 1FOKA 4P9UA 2O6GE 5FB2A 3O3KA 2PG4A 3E6CC 2FOKA 2JT1A 1K78B 4WXDA 5DCMB 1KGSA 3CUQB 5FLXK 1LEAA 2FF4A 1GVJA 1FPQA 2ESNA 4ZYGA 1YS7A 1J75A 2K4BA 2EFNA 2KIFA 4OOIA 5L3BA 2D1HA 2QUFA 1LQ1A 1MD0A 3I59A 1S8NA 1TNTA 3DV8A 1MGTA 2VC1A 5HDKA 3GFLA 2M30A 3EDPA 2HS5A 5ICGA 3M8FA 1L0OC 1KYZA 4Q47A 3V7RA 5LRRA 2GZWA 3P7NA 2EA2A 2UXXA 5LBQA 2FMLA 2O8XA 1CF7B 3J80Z 5CYVA 2IT0A 3KE2A 3QOPA 3NQOA 2YSRA 3DPTA 3J7AO 1LVAA 4ENNA 4KN7X 4BQAA 1O3RA 1ZRCA 3OV8A 2XGXA 5K5RA 3RYRA
chains in the Genus database with same CATH superfamily
2DA4A 2O3FA 3OYAA 4CGZA 1YLFA 2ZXIA 4XN3A 3VWBA 3CCMI 4X6AJ 1J0RA 4B1RA 1F4KA 4BJ6C 1DQUA 3WTVC 2HOTA 2G7HA 2HGCA 1UG2A 3C18A 4RS8A 1GLNA 1FNNA 1OCZH 2ZNZA 3BTCA 4ETSA 4FTHA 1CQTA 3TDZC 2ECBA 2X51A 3BROA 4L9TA 1JXSA 2L7KA 3J7ZI 5L3DA 1IUYA 4N0BA 2LD5A 2RVCA 1HC8A 1SMTA 3E7LA 2K3FA 1G3YA 2LNBA 3GFIA 2DTZA 2VBXA 3K70C 4AWXB 2WWYA 3Q0WA 3CLQA 1WKMA 3KCCA 3SEQA 3EUKL 3HKZN 1T0FC 3EYIA 4BDZA 4XLNF 1TL8A 2L0KA 1IRFA 4QWQA 1F36A 3MKWB 1K83J 3MVPA 3V4GA 1HSJA 1YE9A 3JRAA 1DU0A 3MN2A 5B1AH 3ISPA 5KNLA 3MKLA 3GTLJ 3I58A 1RNLA 2BYVE 1MW7A 2HR3A 4QTRA 3S17J 2LFBA 3QPHA 4FISA 4F91B 3DPUA 2ZJQF 4GFBA 1DPUA 2E35A 4BBSJ 3W3CA 4A5NA 1IV8A 1OR7C 3HOVJ 3EETA 4BEHB 3S1QJ 1TTYA 2H6BA 1IAWA 1A5JA 5ILSA 1ZLJA 1A31A 1DP3A 4ZJZA 5E1ZB 3HOZJ 3WGIA 2PJRA 2VKVA 2XASA 1XC5A 4UVAA 5EYRA 2O61A 4H4KC 3KZIC 1UAAA 1QZZA 2GIVA 1WCMJ 2CFXA 2XROA 3BZCA 3QP6A 5D5XB 3Q3SA 4A3CJ 5EEAA 3MQ0A 4OIOF 1SAXA 2FMYA 1LVKA 2BZTA 3BR5A 3LL7A 1LFBA 3LSMA 2QLZA 4NUBA 5J3LA 5JLWA 3BDDA 3KYLA 3SJMA 3CQZJ 4ENKA 3EQLF 4RB0A 1AKHB 3FX3A 5E20A 4F92B 4LMYA 3QU3A 4HDVA 2PMZA 2QWWA 3FKIJ 2M3AA 3VB2A 1ZN2A 2Z2SB 3IRQA 4NC8A 2FNAA 1SC7A 3AG3H 4ASNA 3JRCA 3GTOJ 3BZ6A 3KX2A 3J81Z 4XBFA 2KIUA 1LEBA 1MMDA 3F72A 3DXJF 5EZGA 2GXBA 1SFEA 2HYFA 3W6KB 1N78A 3RKWA 1BI0A 4IHXA 4M74A 4AD9A 3PNYA 5CQEA 3ZMSA 3F8CA 4BHBA 3QYFA 2P4WA 1ONVA 2KQRA 2DFEA 3DU5A 2GOXB 3PQKA 3S15J 2FRHA 3GZ5A 3CUOA 2DT7B 3CJQB 2XV4S 3PUBA 3WTTC 4LB5A 1LE8B 4C3JJ 2VBYA 3G3ZA 1Y8RB 1X4OA 4OU0A 4HRIA 4Y15A 3RYPA 1YW7A 2ACJA 2IRFG 2M0CA 2P5LC 2EFQA 2HDWA 2EFWA 3GLXA 2BY0A 3V8KA 4J01A 1O3SA 1QQIA 2XVCA 3GWZA 1IV6A 2X9DA 3RZOJ 4M9ZA 5IP7J 1ZRFA 3ABUA 1N75A 2DFFA 2VBWA 3LSTA 1WJBA 2UZKA 2STTA 1BOAA 1W5SA 1X3UA 4G6DA 4CSWA 4MTDA 3EPZA 5FJ8J 2DOFA 4D9JA 3N05A 2DA2A 1LDJA 3TDUC 3TW7A 3FXQA 2P5KA 5DS9A 1OISA 1WJAA 2VJ5A 4ZTJA 2DPDA 5TRDA 3FMQA 4D1QA 3H5RA 3H0GJ 4E7JA 3BR6A 1FOWA 3TBIA 2HVQA 1LJ9A 1R6RA 3FMRA 1HKQA 1B72B 1VTNC 4RGUA 2X1CA 3B02A 1HQCA 1HDDC 4L0ZB 2DOAA 4HX4A 3E0JB 4EGZA 1Y39A 4XLAA 4G12A 3FBNB 1YI2I 5EEHA 2L9RA 2VJIA 1YJ9I 2FJ1A 2X4HA 3CDHA 3OOPA 3LQRA 2R5YA 1B8IA 2ZB9A 2VKHA 1DUXC 2V9PA 2JA5J 1WVRA 2L9SA 2RKHA 1IRGA 4CH7A 3CP2A 3LSRA 1JUPA 4EQQA 4A6EA 1WJCA 3PFIA 3FBIB 3TOAA 3ZOBA 3CLOA 1Z3XA 1ZG5A 1B6AA 4RB3C 5K5OA 4C9YA 1MNEA 3DTEA 1YS6A 2E1CA 1VQ7I 3FK6A 5F08A 3S1MJ 2CUJA 1ZK8A 3IWZA 2FXAA 2HU9A 3QRFF 3Q0UA 4IHSA 1KA8A 2KP6A 2O7OA 4XN0A 4EJUA 2VI6A 2XHKA 2WAQA 3DLLF 5KCMA 5IYBJ 4HPQA 3NRVA 5FRNA 2DBBA 1R71A 3CESA 3HUGA 1ZG1A 5FKMA 4L9NA 1I50J 3P9IA 5B5EC 3OYIA 3LA7A 4RLFA 1YO5C 4QLCU 5IYDJ 2JN6A 2MD5A 5H6RA 1S29A 5JVGF 5TJJA 2CS3A 1X3ZB 3E5QA 3CCQI 3L2CA 2PJRB 4LB6B 2DJIA 1YTYA 4ZYDA 2LLKA 4IPAA 5AONA 4A3KJ 2VONA 2AQFA 1JUSA 3CCEI 3TP3A 1MDMA 2NVTJ 1U0JA 1KZHA 2HXOA 4NNJA 5GP9A 2K40A 1V4RA 3G1MA 1H0MA 1UELB 1ZRDA 4D0PA 4RM3A 4U88A 1VQ9I 2MC4A 3CO7C 2EFPA 5D6EA 4RGXA 1V3FA 1P9QC 3T5XA 1J09A 1ZELA 2K9LA 3GX4X 4C3HJ 2RV8A 1G4DA 2RQPA 1X19A 3F6OA 3VEPA 1O3TA 5LEJA 5KVRA 4BS9A 1GV2A 4A3GJ 4M71A 4MEYF 3TEDA 1W0TA 1IRXA 1PDNC 4IHVA 3IV5A 1X3WB 4XRSG 2E1OA 4N9IA 2PX9A 1X2NA 2VE8A 3PFYA 4KMUX 5E3MA 4GDFA 4YEJA 2WV1A 2IS4A 1FLIA 2MH9A 3I0TA 2HVRA 4PFPA 3KLNA 1TZLA 3F23A 1MMAA 2CRGA 2ELJA 2VN2A 5JI6A 2BGCA 4CCMA 2PI0A 4AYBA 1Z3YA 5EGOA 2KKOA 1SMYF 5D4SA 1FBQA 3SXYA 2IS1A 4AIDA 5B1BH 1FYLA 1K6OA 2MH2A 3TGNA 3LA2A 3M3YJ 5IT3A 5FFZA 1K78A 3I64A 1MNDA 3Q9VA 5BMZA 3CUQC 2BVLA 3P5JA 4TV7A 3M8EA 4HQMA 4CA0A 1OPCA 2R7VA 4Y3OA 3KYDB 4P1WA 5E79C 3GTPJ 2NYXA 3PL8A 3EUHA 2DA6A 3U9GA 2HOEA 4UV9A 3OS2A 3F0CA 5FLXZ 1SFUA 1HXDA 4LD5A 4FX4A 1G8XA 4XSXF 2XF7A 4G7OF 4O3MA 1EKEA 3PUFA 5D4RA 4YIRX 1X1PA 4UV8A 2Z3YA 2Y75A 1ACIA 3ELKA 3KPHA 2YU3A 2CFOA 2COBA 4XRSA 2K5CA 1TNSA 2IJLA 5BPDA 2RGVA 4BH9A 2R5YB 1B8IB 4IX7A 1U5TC 1W1WE 3BQYA 3R4KA 3H9JA 5GTHC 3OYDA 1X2MA 3Q5FA 2LDUA 2NNNA 4HQEA 3ECHA 4JYKA 2R4GA 1W36C 2PMZN 3JREA 1CF7A 5GAGJ 4XKCA 4KJZA 1DDNA 2H09A 2XKOA 2Z1DA 4NDLA 4MFEA 4M3GA 3OYLA 3CC4I 3BG5A 4JQFA 3RQIA 2PN6A 1APLC 1WI3A 4K2EA 3GBGA 3BTLA 2NVXJ 3FM3A 3FIWA 3FKJA 2HWVA 3K4MA 3VYTB 4LITA 1I3QJ 3HL2A 2BY2A 2QEXI 1RR7A 4CCJA 3SZGA 1ODDA 1IC8A 1XPXA 1IN8A 2EWNA 1VQ5I 3WTSC 1N77A 2YX7A 3ZQLA 1UCRA 4FE4A 2OU2A 2GIZA 2X6XA 2PQ8A 3BWGA 3PIPF 3CMYA 2DFIA 3ZQIA 3NARA 5IT9K 2YPRA 1P6RA 3HB9A 1R58A 4UUTA 5M5XJ 1BBYA 3OWTA 4CCKA 5LRSA 1JGGA 5FKNA 4RLQA 4A6DA 5FKOA 4F7ZA 1JI8A 2HKOA 3H9GA 5F6FA 2HXIA 4HF0A 1T33A 2CSOA 3M9AA 2MBFA 1V54H 1VNDA 3U2RA 1MJAA 1J59A 4XLCA 2J5PA 1E3HA 2BBYA 2XPWA 1P92A 3Q0VA 2JPBA 5C3EJ 1MDMB 2MG4A 4XR6A 3TP0A 1R7JA 5GPAA 3G71I 3H5NA 3T1BA 1GHCA 3H3ZA 3HSRA 3CDIA 3S3NA 4HX7A 2F5EA 3ZRGA 3WGHA 2CG4A 4BACA 1I5ZA 2DMPA 2RC4A 1VZ0A 3WG9A 2L4MA 4P9FA 5K5QA 2KT0A 4LLGF 2XPUA 2W48A 3RPUA 3G1OA 1SEUA 1BJAA 3VSLA 3MKYB 4A3JJ 4KMFA 5M5YJ 2ICWG 4KT6A 4U7DA 5LHIA 4JOMA 4L5IA 2DJNA 2M4GA 1YG2A 2M0MA 4BEHA 3T0YA 1V5FA 2P6TA 2ME0A 5L3CA 4CYCB 2HTSA 2VKDA 5A2QK 4UUSA 2V1XA 4JX5A 5KAIC 1USTA 4LG3A 3G2BA 1AHDP 1C0WA 1R5HA 2IPQX 3V7CA 1MBGA 4HLYA 2M7AA 5EGOB 2DA5A 3AG2H 3IRRA 4B3AA 2M5WA 2W24A 3R0JA 3E3VA 1GT0C 1NH3A 3WTZA 1XN7A 1PJRA 1LDDA 2BXYA 1POGA 2BE5F 3AG4H 2B7EA 1KU9A 1U78A 3MCZA 1G2HA 2LF8A 2DT5A 3ZQ7A 5F0FA 4OMZA 4IF4A 4WCGA 3S93A 2KZGA 2ISZA 1HDPA 4ZZDA 4L9VA 3IWFA 2XRLA 3W6VA 4IRHA 1HLVA 3ECOA 3GYHX 4NC6A 4H0EA 1D1AA 1U8BA 2WAQN 2W85A 2H8RA 3BG7A 3OS1A 3PIOF 2LMDA 1ENHA 1XTAA 1WHUA 4Y17A 2Z99A 4CHUA 1X1BA 2RNGA 2JA7J 4C30A 3OYCA 3K69A 1FBUA 1O3QA 5JVTA 3DBHB 3LNQA 1VQNI 2EH3A 1XMXA 4V2FA 1LE8A 3KP3A 3HIFA 1IGNA 3MMYB 3HOWJ 5HLIA 3GLLA 2FOWA 3JSPA 2V6EA 4Y13A 2I5UA 4XK4A 5E17F 3D1NI 2OZ6A 3BPXA 5ERIA 2JA6J 5ILUA 2JSCA 2CYYA 4S04A 4PDKA 2A07F 3R6SA 3CJNA 3W2WA 2RAEA 1RI7A 1NG6A 1XS9A 4U0YA 2R7RA 5K1YA 2DQLA 2QBYA 3IKVA 2GWRA 2ESHA 3WTXC 4KNYA 2IGMA 2JA8J 3LSHA 5C44J 4PJ0C 4ON0A 1IZ1A 2R3SA 3FDYA 3DKWA 4ZDPA 2OCCH 2FNPA 2JPCA 4O6JA 2DCEA 5F04A 2XSJC 2IGOA 3CD6I 3RJPA 2DDBA 4KICA 1BJZA 4JBAA 2KZVA 4FETA 5ED4A 4BHCA 3CC2I 3WU1B 1Z67A 3NWSA 2VIXA 3FISA 4CYDA 1U3EM 4IXAA 1IXRC 1GV5A 1G3WA 3FXRA 1ETWA 3BY6A 2Y48A 2Z9OA 2OZUA 3HC7A 1ZKGA 1ZAOA 4PJNA 5DM6F 2XUBA 3GZNB 2NS8A 2LYCA 3AAFA 2DYRH 4AYBN 4ENJA 3WGGA 2V4JC 3SZPA 3HG9A 4UVCA 3QPLA 3TL4X 2UWMA 1IRZA 5F1JA 4M6XA 2QKMB 4YIIA 1GXPA 1KQ0A 1XSVA 3IKTA 1G59A 4CUGA 4Q5SF 2NS7A 2XGDA 3BR0A 1MSFC 3HDDA 4UUVA 4RB2C 2FBHA 5GAHJ 3BQZA 1H88C 1A35A 1WGXA 2HNHA 2WC2A 5M3MJ 1H9GA 2LF7A 3KP4A 2DPUA 4IHYA 1K4SA 4RAZA 3TO6A 4YG2F 1LNWA 5E1WA 2TRTA 3K4CA 5FKKA 3K2AA 4A2UA 4XM3A 1S72I 2IEKA 3I54A 4E70A 1NTCA 1A36A 3SFIA 3A0BC 2NNYA 4ZYAA 2XAUA 2RDPA 1B59A 2ID3A 3BCBA 2ZJPF 3L09A 5H20A 5F0CA 2E7WA 2VQLA 2Q8KA 3B73A 1W4MA 2LTPA 1F1ZA 5CVVA 1HF0A 2XF5A 4KISA 4KDPA 2WY7Q 3FXOA 3K1NA 2NAZA 2VOOA 4YELA 3CMAI 1KQ8A 4RA2A 4BXUA 1MH3A 5CLSA 4M73A 4HF1A 3M8JA 2XB5A 3HPGA 4AVZA 4MEXF 2QSGX 3QYBA 3I9V2 4HG2A 3RKXA 3H5AA 1K61A 2A5YB 2M8EA 1ETOA 4DJAA 2H6CA 2CV0A 4NBQA 4UUSB 5IPAA 3JSOA 4CZZA 1FSHA 3E6BA 2XDVA 1O7LA 4UXNA 3K1MA 3R61A 2LKSA 5C4XJ 4HAMA 1ETVA 4YFKF 4BNCA 1FTTA 3COAC 3RZDJ 2QZ8A 4XQFA 3KP2A 4KFCA 2CJJA 3SQNA 3ULQB 2Z16A 2ZJ2A 4DGWB 1S9HA 2B0LA 4JX6A 4JX4A 1IF1A 1BM9A 3ZMUA 2VBZA 4BE0A 2PEXA 1Y56A 4II3A 1MJBA 1TW3A 3I53A 3K1PA 5FD6A 4AIKA 3S14J 3OMYA 2JK3A 1IJWC 4C2MJ 2H27A 1W7PD 2VJJA 1D1CA 4IVNA 2JRTA 2MW8A 3I3LA 2OCEA 1SFOJ 3HRTA 2B9SA 1R22A 1JE8A 3OYKA 2VPLA 4WXCA 4PSXA 1ETYA 1R5GA 1Y0UA 4BXFA 4X0GA 2PJPA 2EK5A 3ASNH 3MD2A 1FMVA 3ZQQA 3I4MJ 4ENMA 2ZO4A 4RAGA 3EUAA 2V9VA 1FZPB 5LFAA 3KEYA 2MLKA 2ZBKA 3ROUA 1ITYA 2WAEA 2HKXA 2QSFX 5DDGA 2OQRA 1IO2A 1TWFJ 5CVUA 4ESBA 3HRMA 1S7AA 1WJDA 1TBXA 3QAHA 2AQEA 2VASA 3H3VK 1ZTRA 3D5RC 2DK5A 3HTSB 1VQKI 1T38A 4AIHA 4I76A 5BS6A 4CZCA 2CQQA 2QGUA 4LG0A 4BKXA 1BC7C 3BC8A 4OIPF 1HA8A 4NQWB 1HKTA 3C1DA 3DWLE 3LSJA 1U9NA 3BR1A 4W1UA 1RZ4A 4F3QA 2HQNA 1I1SA 2KDOA 3E5XA 2BXZA 1R4NB 1BIBA 2X1EA 2XAJA 2QBYB 1FEXA 1VQPI 1BR4A 2V79A 3O2PE 3E1SA 3VSKA 2BV6A 2ZMEA 1VI0A 1D3YA 5J4VA 2O03A 4OMYA 4L5EA 1SANA 4S0HB 1WFXA 1XDUA 2LP0A 2ZKZA 5HDNA 2L2OA 4UVBA 4B09A 1JJ6C 5GPCA 3EYYA 1W36D 1XCBA 1EJ9A 2X6WA 4GYIA 3ZN0A 1LUJB 1PUFA 4Q4ZF 1SFKA 1R5ID 2PMUA 1OYWA 2A6HF 2E60A 2R7UA 2EV0A 2A05A 3VPRA 1UB9A 2XB0X 5CVRA 3AG1H 2VLAA 2F2EA 3ZQHA 2A6EF 3RI4A 1CGPA 3DBLB 4YIFA 5DEQA 3LAJA 3RYRA 2DYSH 2M87A 3CP8A 3CF5F 4RGRA 2OUMA 4XONA 3OR1C 2ME6A 4ZYEA 1H9TA 4I01A 2EZKA 2QKLB 4HNVA 2E2JJ 4KUMA 4HA8A 1B9MA 3H9QA 1UHMA 1R00A 1S7OA 2H94A 4PZJA 1VQOI 4BUPA 3OYMA 3F6VA 3DPLC 3QU6A 1E2XA 4WX9A 5IYCJ 4J19A 1J2XA 1WRJA 2EFOA 4XLFA 2W00A 2LR8A 5IP9J 2B63J 4D5FA 1Z05A 4Y52J 3REOA 1MBKA 1GXQA 1ZREA 1IN7A 2R5ZA 3HRUA 2RREA 4U87A 4NHJA 1YW9A 1TWGJ 4IRGA 3D5LA 3WODF 2VB6A 3GTQJ 2R7ZJ 4PJJA 1FTZA 2XAFA 2WY8Q 3VDXA 3GO5A 3ML6A 2FA5A 3QPTA 1NHAA 1TW2A 2W25A 4BBRJ 1KU3A 2O0YA 1SVOA 2W57A 3D0SA 5D5VB 3OY9A 1QZYA 1ERDA 1P4AA 4G7ZF 4FCYA 3L2WA 2EZIA 3F9KA 3DTIA 1FJLA 4AVPA 3UNGC 3IUOA 1Y1WJ 2XIGA 3HGYA 2CUZA 1T95A 3DKXA 4LIUA 2DMNA 1FY7A 3X2QH 1RPWA 1XSXA 1MIJA 3OSFA 2DK8A 2KDZA 2R0QC 1WH7A 2G0EA 4KT5C 5IT9Z 1IN6A 5HS7A 2ID6A 2AXTC 2DW4A 4RB1A 1EH7A 2K7LA 3IH2A 2BEOA 3DTKA 3IHUA 3IAS2 3CZ6A 3SYTA 2R7QA 4G8XA 2EJRA 1ZGWA 3KP5A 2L02A 2P7VB 4IQ4A 4BJTA 2QA4I 1D8JA 4A0XA 3ZP5A 2NVYJ 2HZDA 3HSEA 4L18B 3J81K 2CWEA 2WB1A 1XMAA 3AL0C 3QPSA 2L54A 4E7HA 1A6IA 3BG3A 5HDGA 2E36A 1TP4A 3JR9A 4XOPA 2IS6A 3KZYA 3DCFA 1MBJA 2AS5F 3JTHA 4CYCA 2UUZA 4MLOA 3LSGA 1YIJI 4LLNA 3QOEA 2M8GX 4ESFA 1R4MB 1OCRH 2XF6A 1Z6TA 2NXNB 1ON1A 1NG7A 5ICCA 3K2ZA 3SDBA 2LBFB 2VKEA 2BHZA 4XLEA 4V19K 4Z6YA 1D0XA 4A3BJ 3W2VA 2DA7A 2NOGA 4LG0B 5C4JJ 3KZZA 3ZMVA 2X85A 5A2QZ 3JRDA 1W7PA 1B4AA 4XKBA 3R0AA 1HBXG 2W4SA 1OCPA 2KRHA 5EJCA 2FQ4A 4A5MA 2H8WA 3JRFA 5FROA 5E3OA 4HYEA 5LEKA 5LD2C 4I7HA 3LFUA 3CDLA 2LH9A 4GCVA 5J47A 1PP8F 4IHTA 4JK1X 3CCLI 3C3WA 3H36A 2ZMEB 1Z77A 3ZQCA 3G1LA 4OINF 5J40A 4DZJA 1WPKA 1QZEA 1OJLA 5J1UA 5ILVA 1UHWA 1WWXA 2J5OA 4G6QA 3EUHC 3FHNA 1KQ9A 1MZBA 1TT0A 2XKPA 3I56I 1BL0A 3M1CA 2EBIA 1M1EB 1LPQA 1XDSA 1N25A 2FE3A 3VOEA 3OYFA 4UY8I 3A0HC 1MBEA 1PUFB 2BOLA 3FXUA 4A3DJ 2BY3A 3M1EA 2V26A 5E3LA 4A0ZA 2JZYA 2GXAA 1TWHJ 1QVUA 3LSIA 3CO6C 5J8FA 3LSKA 4HSTA 4PJMA 2R7WA 2DMUA 2ISYA 4AC0A 5EF6A 3GFMA 4CICA 4XKWA 3MKZA 3AFHA 1FMWA 4B48A 1W5TA 2L9VA 2OV7A 1FOYA 3S2DJ 2EZHA 3R60A 4HLXA 3TOBA 1HOMA 2JVHA 2K02A 5AIPA 4A3LJ 2E1MB 2WTEA 3IAM2 2CU7A 3C7JA 1U2WA 4KA4A 1ZHFA 5L3EA 1SAUA 3GTKJ 2CGPA 1Z9CA 3B6CA 3RTRA 1YX5A 3T8TA 2KRCA 3J7AY 3E5UA 3WU2C 1RUNA 4MNUA 1ZGJA 1Y8QB 3A4CA 4PGHA 5ICFA 1SD6A 1ZR4A 2Y0MA 5JHUA 1Z7LA 2R5ZB 2OD5A 1B1BA 5D8LB 3L2UA 1EF4A 1Z1DA 1VQ8I 2Q1ZB 3UKGA 1L3LA 3G4SI 1PP7U 3MZHA 3LSPA 2DDAA 4IL6C 4KIFA 2Z33A 3K70D 4UHTA 3WE2A 2QVOA 2LY2A 3KEQA 3LA3A 3A01A 3PNVA 4NC7A 4MFDA 2HPIA 3QYEA 3PNTA 1JKOC 4BYYA 3DBRB 1RR8C 5LHGA 3V8JA 2IGNA 1P4XA 1JTXA 1TC3C 3O8GA 4XLHA 1OQYA 3DEWA 1TWAJ 1ZH5A 3NWTA 2JWTA 5DD8A 3SDGA 1AWCA 4C2TA 4LFUA 3K4LA 1NK3P 2F5DA 4WWCA 3U1DA 2CUFA 1Y6IA 2JJ7A 4F52A 3ERMA 2GAUA 2QQ9A 4PSWA 2EV5A 2XGEA 2OBPA 4L5JA 2E2IJ 4BHPA 1IW7F 3W6JB 5J8CA 1YW8A 3V8LA 4HSRA 2M9HA 2ZSHB 5IOYA 3BOQA 1D8KA 2IVMA 4ANJA 1DPRA 2NRAC 3GMEA 2CQXA 2LG4A 3S2WA 2QM3A 3UR3C 5EEGA 4DZPA 2CQ7A 2F4IA 2KLOA 3LAPA 3GUDA 3LQQA 3ONQA 3PO2J 1FWZA 4M9XA 2HEOA 2F4OB 3WHCA 2R7SA 3Q9SA 1OMIA 3JRIA 3G73A 3P9CA 4UB8C 1YYVA 4XORA 1PYVA 4ZC3A 3OOUA 4EV0A 1G3SA 1MKMA 3S1NJ 3L00A 4HW0A 1OKRA 4LK1F 1XB4A 1RKTA 2HVSA 4P5OA 2IA1A 1QPIA 4WK8F 2R7OA 2WADA 5IY5H 3ABMH 3K4BA 4GYGA 5DV5A 1S3JA 2DO7A 4HDUA 3FWEA 5H2FC 3F21A 5J4YA 1FP2A 2PBIA 4BGDA 3BP8A 1ZQ3P 3DF8A 1K6YA 3L2QA 1O4XA 3RKYA 2VXZA 1E3PA 3RIRA 4RDUA 3CJTB 4R8HA 2Y69H 3BR2A 4OWRB 1YRNB 4A0YA 1W7PB 2HOSA 3OIPA 3JRBA 1K79A 1TT5B 1REPC 1I6XA 2KPMA 2CQNA 2DMTA 4A69C 4ESJA 2M2EA 1Y0NA 2TDXA 1BIAA 2P5VA 2JA2A 1R49A 4DQ2A 1S6LA 1X1CA 2QCOA 4GXOA 3DLAA 5J6XA 4BAYA 3I4NJ 1QBJA 4CO8A 2A6TA 2VXDA 1FC3A 2V7FA 3BTIA 5M3FJ 3SHFA 1ZYRF 2ZXJA 4DBRA 1MMGA 1OYYA 4A12A 1B9NA 3QWLA 2KIMA 4OAYA 2FSWA 4F55A 1T2KA 3GVAA 1BI1A 4G7HF 3FXJA 4E7IA 4BQNA 5IP6A 4BJ5C 2BW3A 3F8FA 1H89C 1IXSB 2HYGD 3F8BA 2E19A 2OJED 2D2WA 4B43A 4OIRF 2OF7A 5FKLA 2BY1A 2DLLA 1OCTC 1WJFA 2NVUB 2M45A 4EM2A 2R93J 4FHTA 4HF2A 5HS8A 2GA2A 1A6QA 4NQWA 2FUG2 4PJLA 1DP7P 4U0VA 1ORKA 3G6EI 4M3BA 3OYGA 2V1DA 2CH0A 4WXHA 3SZTA 2R7DA 2DOEA 1WJ5A 4EATA 1ZR2A 1QU3A 3GXOA 3F22A 2ECCA 3LFKA 1WI9A 4X1EA 1LFUP 4OIQF 2OPTA 2YS9A 2WB1N 1U5TB 3L9FA 2G9WA 1KYWA 5GAEJ 2VL8A 4IQJA 4BDYA 1VQLI 4EM1A 2V6CA 1Q1HA 4PK4A 2R92J 3MAJA 3PJRA 3AKZA 2GM4A 1FYKA 1QNTA 1LB2A 3WTWC 5FD5A 3MZ8A 1AOYA 3LWFA 2FBIA 3DEEA 4XICA 3OIOA 3RPQA 2BHYA 1G6NA 2XSDC 2RNJA 2QQ8A 2CQKA 3S8PA 5EG0B 1VQ4I 2MA3A 3HOSA 1BI3A 4YFXF 1ULYA 2YX4A 3A01B 2QSHX 3FXKA 1SVLA 3ZPLA 5F1RA 3HBLA 3TW6A 1U9OA 4ZH4F 1S7EA 2E1NA 2YUSA 3KEOA 1OYIA 5BPIA 2MC3A 9ANTA 4E7LA 3E97A 3HTUA 3HZJA 2ZFUA 2N8GA 3C2HA 3VODA 4RAFA 4DIQA 3F3XA 1UG0A 4KIGA 1FIPA 3K9TA 1FT9A 2L9NA 4ZTFA 1MSEC 1Z0XA 2HOAA 1UZCA 4F93B 2DT6A 2H1LA 3O6BB 5DUKA 3QQAA 3MFKA 1NK2P 1Q1VA 1PUEE 4RM2A 3LOCA 2CW0F 1U8RA 2L3DA 4XL9A 4IOCF 4E7KA 1ZG3A 1XG1A 1USSA 3HEFA 1VQMI 4GGGA 2STWA 2Q2EB 1P7IA 3KYCB 5CJ9A 3W2AA 2WAFA 1T0FA 1VQ6I 3K4JA 2LVSA 1AA7A 3H1CA 4XNFA 2FU4A 3BJAA 2Q0OA 4XOTA 1XGSA 1X58A 3BZKA 5J1RA 1TQMA 4G94A 4UB6C 4PFOA 4C2UA 3JW4A 4IO9F 1IUFA 2P7CB 1D5VA 4IRIA 1G3TA 5E1XA 2A68F 4YFNF 2E34A 2UV1A 3H3UA 3HYIA 2GA1A 1A04A 3K6GA 1SFXA 2AXLA 4Q48A 1HW1A 4DOZA 1GVDA 1IDYA 3M07A 3JAMK 2E2HJ 4HX8A 4FT8A 1OR7A 3K0LA 2A69F 5EZHA 5FLVA 2IGKA 2QF7A 3WHBA 1K4TA 1QPMA 2JMWA 4RAYA 3U1KA 3BCAA 3BR3A 3QP5A 1YQAA 5LGUA 3VYUB 3A03A 2ELHA 2KISA 4CCNA 2ZXHA 5JLXA 4Y7NJ 5CVJA 5FLMJ 2RN7A 1R9TJ 3WG7H 2K86A 3GFJA 3L2VA 1IDZA 4BY1J 1WJEA 3DEUA 2EINH 2HDDA 1T6SA 3S32A 2Y30A 3BT9A 1HSTA 1FBSA 4XRFA 4MGRA 2ADUA 1V5GA 1LFPA 1VFCA 2CO5A 2H1KA 2E71A 3E6DA 4EM0B 3GF2A 3FXMA 4WF2A 3OYHA 1T98A 1R1UA 3C2BA 4YRVA 4N4OB 5E18F 1JHFA 3PO3J 2VT2A 1IN5A 2X0LA 2EIJH 1OCCH 1RETA 4RBOA 1BW6A 3A1YA 3KFWX 1BI2A 5FFXA 5DD4A 2Y0SA 1EA3A 2OTJI 1ZGAA 3KP7A 2K27A 2EB7A 1E17A 2M34A 2DA1A 2BW3B 5CKTA 1V5EA 2FBKA 1QHGA 2RQQA 1WZ2A 1SD5A 2HYJA 4IZZA 4HOBA 5HLGA 4MQ9F 2LBFA 2IA0A 2E5NA 2FX0A 3HSFA 4HNUA 1BR1A 2HZTA 3M4OJ 2CV1A 3M7GA 3TO7A 5HOOA 4P55A 5CVIA 5GADJ 1XSDA 3I59B 4I02A 3K4NA 4CCOA 5E3NA 2M7BA 3DKYA 1I6HJ 1D0ZA 1XD7A 1ZARA 4DYRA 4O5VA 2I8DA 2PFBA 3CC7I 2QQAA 2UXNA 3BLYA 2JUGA 1TQIA 1D0YA 3CMMA 1OFCX 1MBFA 1O57A 4KYWA 1DGRM 3WU0A 3OIQA 5E8GA 3B6AA 3J80K 2DAOA 2LSOA 1GDTA 1I3AA 2YU9J 4P96A 1I1GA 2LK2A 2XAGA 2FD5A 4HV6A 4PCQA 4PUSA 1T56A 1ETXA 3CCSI 1X1AA 2ZMEC 3MZYA 3GTMJ 2HQRA 2GBYA 5DYMA 4CDGA 1X4PA 4XIDA 1V55H 4A3FJ 1MH4A 2MLGA 4EJOA 4A3IJ 4M3EA 3OYNA 4IJAA 5JFRA 5M5WJ 2K9SA 3TKYA 5HLHA 2LKXA 3ASOH 3WE3A 3L7WA 3HPHA 2DXIA 5ICEA 4ZDLA 4AU7A 5LHHA 1MJ9A 2VQGA 5TGTA 1MBHA 3J7YJ 1BC8C 4M9SA 2Y2ZA 2VE9A 2W82A 1UFMA 2CV2A 3ABTA 4N9HA 2R7TA 3FF5A 1YITI 2IP2A 3N97A 4E6KG 3QODA 4J00A 2HFHA 1SD4A 3GW2A 4I0BA 1FYMA 4D5CA 2E1MC 2K3PA 4I0AA 5D8KB 4A3EJ 4ZDOA 1Z91A 4IKFA 4I2OA 4KIBA 3RSNA 4LK0F 1OCOH 3TO9A 1JKQC 1P4WA 2A61A 1RESA 2F5FA 3BTJA 2F5VA 3H35A 4RGSA 3FHZA 2D45A 1STZA 3LMMA 5E8IA 4MHGA 5KHDA 1ETQA 3I71A 2OAZA 1XCVA 3S3MA 2I10A 1TWCJ 4B4CA 1GUUA 5F0HA 2LKPA 3F8MA 1QGPA 2L7FP 4DYCA 2NVQJ 6PAXA 4HZFA 1JGSA 1OLTA 3ZMZA 4JP0A 2D1VA 1SVMA 1JT0A 4EJVA 2ZC2A 4BL0B 4CXFA 3FZVA 3ZN1A 5D6FA 3BJ6A 5FRMA 4EGYA 1XGMA 3O8HA 2LOOA 2TCTA 2Y31A 1UHSA 1ZLKA 4RMNA 3S16J 3CCJI 3IH4A 1YFHA 1DU6A 4IEJA 3JCUC 3IP4B 1R36A 1E3OC 3RPUD 2X6YA 4ZYHA 3DFGA 2ZFWA 5HODA 1UJ8A 2A5WA 2CMPA 1Y1VJ 5IOZA 2QQBA 2LY9A 4W97A 3E6MA 5HS9A 4XSZF 4B3XA 4EMSA 2E5ZA 3OYEA 4GRIA 5BQTA 4D7NA 1F5TA 2VODA 2K9NA 1YX3A 5B66C 3BPVA 4M3FA 4V2GA 1Z7UA 1Z21A 3CMEI 1LDKB 2DODA 3ZXSA 5H6QA 5DM7F 4HBLA 1MNMC 3NEUA 2COMA 3RCOA 3V42A 5K7ZA 1F9NA 5LGTA 3CCVI 1S5LC 3MWMA 3MEXA 3WTYC 4KITB 2JQ7A 4ZZLA 1WH5A 1HW5A 4BU2A 1YOVB 2W1OA 2M4KA 3NAUA 4AUXA 3FMSA 4DBQA 4AIJA 3HGGA 4LIVA 3T8RA 2QENA 2EPFA 2IAIA 5F27A 2IA2A 4QPOA 3F8NA 3HOYJ 4GO1A 2FQ3A 2MFZA 3PSFA 2OQGA 2ZJRF 5DUIA 1YJWI 1BW5A 1Z6RA 1H8AC 4XKVA 4BY7J 2A3SA 2L01A 3RQ4A 1LKXA 2IBDA 2ETHA 2KJBA 2WA0A 3DQVC 2L5QA 3IH3A 2V1UA 2HI3A 5LLQA 1R1TA 2G7UA 1R1VA 3P9KA 1AU7A 4M3DA 3HOUJ 1PVEA 3HXLA 1YRNA 3S3OA 2KRFA 1E0EA 4II2A 1R23A 3VYRB 4NB5A 2PLYA 5JHFA 3ZMDA 4DW6A 2CW8A 2XAQA 4G9YA 2O5RA 2VT3A 1RIOH 5CQGA 1HW2A 2OTLI 1EH8A 3KP6A 3KETA 3ABKH 2ZNYA 1EH6A 2IXSA 4PGGA 5GTIC 1P2FA 1D1BA 3OR2C 3WTUC 2JTVA 3CJRB 1KU2A 1JUMA 1TLHB 1W5CC 3CCRI 2PMHA 2EV6A 5DCMA 3GTJJ 2X48A 3CUQA 2GLOA 1MMSA 4FASD 2YR2A 4MQVA 1JT6A 4I09A 4MTEA 1UMQA 3D5SC 4E4HA 2OA4A 4BQOA 1YJNI 1I39A 2GQQA 3FM5A 2C6YA 1YIOA 1IXCA 3HKZA 3DU6A 3BG9A 4XLPF 3OS0A 1QRYA 2XGCA 3SFZA 3VYSB 2JUCA 4BXXJ 2EZLA 4MIMA 2BVMA 3FXLA 1VF9A 1XGOA 2WV0A 4Z2YA 4XRMA 4U0WA 4HEA2 2E7XA 2ZXWH 4EJWA 1I27A 4DNCA 4EJTA 3K7AJ 2XAHA 3ERED 5L3GA 1FX7A 5K7FA 3ZGKA 2MGQA 2VC0A 3PQJA 1BR2A 1IN4A 4HV5A 2ELKA 1TQPA 1J9IA 1U5TA 2VOPA 1RRJA 3GZ6A 1QO0D 2DN0A 3H92A 1XGNA 3V7SA 4B44A 1X1DA 2IW5A 3JRHA 2IS2A 2LRDA 3K4KA 3TQNA 2EA4A 2DTRA 3U21A 1EV7A 4R1HA 2JSPA 5FGMA 2GXGA 2Y0SN 4I98B 1XMKA 4XMYA 1F43A 4ABZA 5CPRB 5EDNA 5BOXA 4LJZF 5EG0A 2W84A 2L7ZA 1FP1D 3CCYA 2AO9A 2DI3A 5FO5A 2M1BA 4KN4X 4S05A 2VQHA 5JR3A 2Z5UA 2R7FA 4DYQA 5HVQC 2DFHA 3A02A 1FSEA 2F5CA 3DP7A 2DU9A 4M6YA 2P6SA 4U7BA 3RDIA 2QYOA 1JTYA 1KONA 2ZCWA 5KK1A 1KU7A 1QHHD 2K9MA 1HKSA 1T39A 3KIOA 2HDCA 1BN5A 2DQRA 4EVIA 1RKWA 5DTDA 3HUGB 4BE2A 1QVTA 1RUOA 2P8TA 3S1RJ 1WSUA 4QPQA 2VUMJ 2K4JA 1J7KA 5AIQA 2HQ5A 3HRSA 2V9KA 3H0DA 3GEZA 2MABA 4UNOA 5HNHA 2CUEA 1ON2A 2K85A 2NS0A 2FEZA 3HOXJ 4LGWA 1D5YA 4L9JA 2L7MP 3I5UA 1SD7A 2NOJB 5D5WB 5J1YA 2Q2EA 3BJOA 3HHHA 3JTGA 2KJCA 3CTAA 1U6GA 1FOXA 1MMNA 3N4MA 4M72A 4E7ZA 3C2GA 5D5UB 2HTJA 2XPVA 4ITVA 2F6CA 2MSYA 3ABLH 2DA3A 3BG6A 2XC7A 3ZCOA 3HHGA 4G6TB 1WQ2A 5F64A 1J5YA 5LGNA 3ESWB 3IC7A 2KMUA 3L1PA 3PSIA 3OYBA 3I4PA 4IHWA 3HJEA 2L4AA 2MD0A 3AL0B 2EIMH 1W0UA 3ZQFA 4LLLA 2XRNA 4I99C 2O9LA 2JVGA 1BA5A 4R79A 2AHQA 3HOTA 4B47A 1P7JA 2JRMA 3KLOA 5DCFA 2OC6A 3K10A 3VFZA 4B8XA 2VPRA 4FX0A 3CF2A 4AM3A 1O7FA 2DMQA 5TISC 3ZMTA 3JAMZ 3FK7A 4BQQA 5L3FA 2LY1A 2WBMA 4L0YB 2EQRA 1K7AA 3ZQGA 3RKQA 3IL2A 3CCUI 2F4MB 1FOKA 3TMOA 4P9UA 4CCLA 2HQAA 2O6GE 2VQCA 2X6OA 1JJ8C 5FB2A 2EILH 3O3KA 2PG4A 4BE1A 3E6CC 2K9QA 1AKHA 4FE7A 2FOKA 3PM1A 2JT1A 5HLTA 1K78B 1IG7A 4WXDA 5DCMB 1KGSA 3CUQB 5FLXK 1LEAA 3OL4A 2FF4A 1GVJA 4IOAF 2EIKH 2HPMA 1FPQA 4Y33A 4A3MJ 2ESNA 4ZYGA 4M6VA 1YS7A 1J75A 2K4BA 2EFNA 2KIFA 4OOIA 2X1DA 4I6ZA 2R7XA 5L3BA 2D1HA 2QUFA 1LQ1A 2KHMA 2VJ4A 2W7NA 3S2HJ 1MD0A 2CW7A 3I59A 2O8KA 1XX5A 1S8NA 3OL3A 4EEFG 1TNTA 3DV8A 1MGTA 2VC1A 4LOCA 1JKRC 5HDKA 3GFLA 2M30A 4D7MA 1T08B 3EDPA 5HNFA 3L2RA 2HS5A 3OSGA 5ICGA 2LC2A 2P81A 2GOMA 3M8FA 5BNGA 4C3IJ 1BOBA 4QIWN 1L0OC 1KYZA 4Q47A 3V7RA 1RC9A 5LRRA 5K7HA 4E7SA 2GZWA 3P7NA 2EA2A 2UXXA 2V1NA 1YHQI 3GCMA 2KIQA 3A2KA 1QA6A 5LBQA 1HCRA 2P0WA 2FMLA 2O8XA 1CF7B 3J80Z 4Y4RA 3I55I 5CYVA 2IT0A 3KE2A 3SEZA 3QOPA 4HNTA 3NQOA 2LREA 2YSRA 1JKPC 4A93J 3ZR8X 4QSHA 2F48A 3DPTA 3J7AO 1DGWY 5B3SH 1LVAA 4MO7A 3GTGJ 2MYSA 4ENNA 3HM5A 1T8IA 4KN7X 2Y9ZA 4FQGA 1ETKA 4BQAA 5KAFC 3OYJA 1O3RA 1ZRCA 3OV8A 1B72A 2Y9YA 2KL4A 2XGXA 2ZSIB 3JRGA 2D5VA 4OAZA 5K5RA 2KFDA 1FIAA 1JHHA 4N4NB
chains in the Genus database with same CATH topology
2O3FA 4CGZA 1YLFA 1J0RA 1F4KA 3WTVC 2G7HA 2HGCA 3C18A 4RS8A 4ETSA 1FNNA 2ZNZA 3TDZC 3BROA 4L9TA 1JXSA 5L3DA 1IUYA 4N0BA 2RVCA 1SMTA 1G3YA 2LNBA 3GFIA 2VBXA 4AWXB 2WWYA 1WKMA 3KCCA 3EYIA 4XLNF 1IRFA 4QWQA 3V4GA 1HSJA 3ISPA 3I58A 1RNLA 2BYVE 2HR3A 1DPUA 3QPHA 4A5NA 3EETA 1TTYA 2H6BA 1IAWA 5ILSA 1ZLJA 5E1ZB 3WGIA 2XASA 4UVAA 2O61A 1QZZA 2GIVA 2CFXA 2XROA 3QP6A 5D5XB 3MQ0A 4OIOF 1SAXA 2FMYA 2QLZA 3BDDA 4ENKA 3EQLF 4RB0A 3FX3A 5E20A 4LMYA 3QU3A 4HDVA 2QWWA 3VB2A 1ZN2A 3IRQA 2FNAA 4ASNA 3BZ6A 3J81Z 4XBFA 2KIUA 1LEBA 3F72A 3DXJF 2GXBA 1SFEA 2HYFA 3W6KB 3RKWA 1BI0A 4M74A 4AD9A 3ZMSA 3F8CA 4BHBA 2P4WA 1ONVA 3PQKA 2FRHA 3GZ5A 3CUOA 2XV4S 3WTTC 4LB5A 2VBYA 3G3ZA 4OU0A 4Y15A 3RYPA 1YW7A 2ACJA 2IRFG 2P5LC 2EFQA 2EFWA 3GLXA 3V8KA 1O3SA 1QQIA 2XVCA 3GWZA 4M9ZA 1ZRFA 3ABUA 2VBWA 3LSTA 2UZKA 2STTA 1BOAA 1W5SA 1X3UA 4G6DA 4MTDA 1LDJA 3TDUC 3FXQA 2P5KA 2DPDA 5TRDA 3FMQA 3FMRA 1LJ9A 1HKQA 1VTNC 4RGUA 3B02A 1HQCA 4L0ZB 4HX4A 4EGZA 5EEHA 2X4HA 3CDHA 3OOPA 3LQRA 1DUXC 2RKHA 1IRGA 4EQQA 4A6EA 3PFIA 3TOAA 3CLOA 1ZG5A 1B6AA 4RB3C 5K5OA 1YS6A 2E1CA 3IWZA 2FXAA 3QRFF 4IHSA 1KA8A 4EJUA 2XHKA 3NRVA 2DBBA 3HUGA 1ZG1A 4L9NA 3P9IA 3LA7A 1YO5C 4QLCU 2MD5A 5H6RA 1S29A 5TJJA 3E5QA 3L2CA 4LB6B 1YTYA 4ZYDA 4IPAA 5AONA 2VONA 1MDMA 1V4RA 1H0MA 1ZRDA 4D0PA 4U88A 3CO7C 2EFPA 5D6EA 4RGXA 1V3FA 3T5XA 3GX4X 2RV8A 1G4DA 2RQPA 1O3TA 3F6OA 3VEPA 5LEJA 5KVRA 4M71A 4MEYF 1PDNC 4N9IA 2VE8A 4KMUX 1FLIA 2MH9A 3I0TA 3KLNA 3F23A 2VN2A 5JI6A 2BGCA 2PI0A 2KKOA 1SMYF 5D4SA 1FBQA 3SXYA 1FYLA 1K6OA 2MH2A 3TGNA 3LA2A 5IT3A 5FFZA 1K78A 3I64A 3Q9VA 5BMZA 3CUQC 4TV7A 3M8EA 4HQMA 1OPCA 2NYXA 3EUHA 3U9GA 2HOEA 4UV9A 5FLXZ 1SFUA 1HXDA 4LD5A 4FX4A 4XSXF 4G7OF 4O3MA 5D4RA 4UV8A 2Z3YA 2Y75A 3ELKA 2YU3A 1TNSA 2IJLA 5BPDA 2RGVA 4BH9A 1U5TC 3R4KA 3Q5FA 2LDUA 2NNNA 4HQEA 3ECHA 1CF7A 1DDNA 2H09A 2XKOA 4JQFA 2PN6A 1JHHA 4K2EA 3FM3A 2HWVA 1ODDA 1IN8A 2EWNA 3WTSC 2YX7A 1UCRA 2OU2A 2PQ8A 3BWGA 2DFIA 5IT9K 2YPRA 1P6RA 1R58A 1BBYA 5LRSA 4A6DA 4F7ZA 2HKOA 5F6FA 4HF0A 2CSOA 3M9AA 2MBFA 3U2RA 1MJAA 1J59A 2J5PA 2BBYA 1P92A 2JPBA 1MDMB 1R7JA 1GHCA 3T1BA 3H3ZA 3HSRA 4HX7A 2F5EA 3WGHA 2CG4A 1I5ZA 2RC4A 3WG9A 2L4MA 4P9FA 5K5QA 4LLGF 3RPUA 1BJAA 4KMFA 4U7DA 5LHIA 4L5IA 1YG2A 3T0YA 2P6TA 5L3CA 2HTSA 5A2QK 2V1XA 1USTA 1C0WA 1R5HA 2IPQX 3V7CA 4HLYA 3IRRA 2M5WA 2W24A 3R0JA 3E3VA 3WTZA 1XN7A 1LDDA 2BE5F 1KU9A 1U78A 3MCZA 2LF8A 2DT5A 3ZQ7A 4OMZA 4IF4A 4WCGA 2ISZA 4ZZDA 4L9VA 3IWFA 4IRHA 3ECOA 3GYHX 4H0EA 2W85A 4CHUA 4Y17A 2Z99A 3K69A 1FBUA 1O3QA 5JVTA 3KP3A 3HIFA 5HLIA 3JSPA 4Y13A 5E17F 2OZ6A 3BPXA 5ERIA 5ILUA 2JSCA 2CYYA 4S04A 4PDKA 2A07F 3R6SA 3CJNA 1RI7A 4U0YA 5K1YA 2DQLA 2QBYA 3IKVA 2GWRA 2ESHA 3WTXC 4KNYA 4ON0A 1IZ1A 2R3SA 3DKWA 2FNPA 2JPCA 4O6JA 3RJPA 4KICA 5ED4A 4JBAA 4BHCA 3WU1B 4CYDA 1U3EM 4IXAA 1IXRC 1G3WA 3FXRA 3BY6A 2Y48A 2Z9OA 2OZUA 1ZAOA 2XUBA 3AAFA 4ENJA 3WGGA 3SZPA 4UVCA 2UWMA 4M6XA 4YIIA 1GXPA 1KQ0A 1XSVA 3IKTA 4Q5SF 4UUVA 4RB2C 2FBHA 2WC2A 1H9GA 2LF7A 3KP4A 2DPUA 4RAZA 3TO6A 4YG2F 1LNWA 5E1WA 4A2UA 3I54A 4E70A 2NNYA 2RDPA 1B59A 3L09A 5H20A 2E7WA 2Q8KA 3B73A 1W4MA 1F1ZA 5CVVA 4KDPA 3K1NA 2NAZA 2VOOA 1KQ8A 4BXUA 5CLSA 4M73A 4HF1A 4MEXF 3RKXA 2A5YB 2M8EA 2H6CA 3JSOA 4CZZA 1FSHA 3E6BA 1O7LA 4UXNA 3K1MA 3R61A 4HAMA 4YFKF 4BNCA 3COAC 2QZ8A 3KP2A 4KFCA 3SQNA 3ULQB 2ZJ2A 2B0LA 1IF1A 1BM9A 3ZMUA 2VBZA 2PEXA 1MJBA 1TW3A 3I53A 3K1PA 5FD6A 4AIKA 2H27A 1W7PD 4IVNA 2JRTA 3HRTA 1R22A 1JE8A 4WXCA 1R5GA 1Y0UA 2PJPA 2EK5A 4ENMA 2ZO4A 1FZPB 2V9VA 2MLKA 2ZBKA 3ROUA 2HKXA 5DDGA 2OQRA 5CVUA 4ESBA 3HRMA 1S7AA 1TBXA 3QAHA 3HTSB 2DK5A 1T38A 4AIHA 5BS6A 4LG0A 1BC7C 4OIPF 1HKTA 3C1DA 1RZ4A 2HQNA 1I1SA 3E5XA 1BIBA 2XAJA 2QBYB 2V79A 3O2PE 2BV6A 2ZMEA 4OMYA 1D3YA 2O03A 1XDUA 2ZKZA 5HDNA 4UVBA 4B09A 3EYYA 1XCBA 4GYIA 3ZN0A 4Q4ZF 2PMUA 1OYWA 2A6HF 2EV0A 1UB9A 5CVRA 2F2EA 2A6EF 3RI4A 1CGPA 4YIFA 3LAJA 5DEQA 2M87A 4RGRA 4ZYEA 1H9TA 4I01A 4KUMA 4HA8A 1B9MA 1UHMA 1R00A 1S7OA 2H94A 4PZJA 3F6VA 3DPLC 3QU6A 1E2XA 4WX9A 1J2XA 1WRJA 2EFOA 1Z05A 3REOA 1GXQA 1ZREA 1IN7A 3HRUA 4NHJA 1YW9A 4IRGA 3D5LA 3WODF 2XAFA 3GO5A 3ML6A 2FA5A 3QPTA 1NHAA 1TW2A 2W25A 1KU3A 2O0YA 2W57A 3D0SA 5D5VB 1QZYA 1P4AA 4G7ZF 4AVPA 2XIGA 1FY7A 1XSXA 2DK8A 4KT5C 5IT9Z 1IN6A 5HS7A 2DW4A 4RB1A 1EH7A 2K7LA 2BEOA 3IHUA 4G8XA 2EJRA 3KP5A 2L02A 2P7VB 1D8JA 4A0XA 3ZP5A 3HSEA 4L18B 3J81K 2CWEA 1XMAA 2L54A 5HDGA 3KZYA 2AS5F 3JTHA 4LLNA 4ESFA 1Z6TA 1ON1A 5ICCA 3K2ZA 4LG0B 3KZZA 3ZMVA 5A2QZ 1W7PA 1B4AA 3R0AA 1HBXG 4A5MA 4HYEA 5LEKA 4I7HA 4GCVA 1PP8F 4IHTA 4JK1X 3C3WA 2ZMEB 4OINF 5ILVA 1UHWA 1WWXA 2J5OA 4G6QA 1KQ9A 1MZBA 2XKPA 1XDSA 2FE3A 3VOEA 3FXUA 3M1EA 4A0ZA 2JZYA 3CO6C 5J8FA 2ISYA 3GFMA 4CICA 1W5TA 3R60A 4HLXA 3TOBA 2K02A 5AIPA 2WTEA 3C7JA 1U2WA 4KA4A 1ZHFA 5L3EA 2CGPA 1Z9CA 3RTRA 3T8TA 3E5UA 1RUNA 4MNUA 1ZGJA 4PGHA 5ICFA 1SD6A 2Y0MA 5JHUA 2OD5A 1B1BA 5D8LB 1Z1DA 1L3LA 1PP7U 3MZHA 4KIFA 2Z33A 4UHTA 3WE2A 2QVOA 3KEQA 3LA3A 4BYYA 5LHGA 3V8JA 1P4XA 1ZH5A 5DD8A 1AWCA 4LFUA 2F5DA 4WWCA 3U1DA 2GAUA 2QQ9A 2EV5A 2OBPA 4L5JA 4BHPA 1IW7F 3W6JB 5J8CA 1YW8A 3V8LA 3BOQA 1D8KA 2IVMA 1DPRA 2NRAC 3S2WA 2QM3A 5EEGA 3LAPA 3GUDA 3LQQA 1FWZA 4M9XA 2HEOA 3Q9SA 1OMIA 3G73A 3P9CA 1YYVA 4EV0A 1G3SA 1MKMA 3L00A 4HW0A 1OKRA 4LK1F 1XB4A 4P5OA 2IA1A 4WK8F 4GYGA 5DV5A 1S3JA 2DO7A 4HDUA 3FWEA 3F21A 1FP2A 2PBIA 3BP8A 3DF8A 3RKYA 2VXZA 3RIRA 4R8HA 4A0YA 1W7PB 1K79A 1REPC 1I6XA 4ESJA 2TDXA 1BIAA 2P5VA 4DQ2A 1S6LA 4GXOA 5J6XA 4BAYA 1QBJA 4CO8A 1FC3A 3SHFA 1ZYRF 2ZXJA 1OYYA 4A12A 1B9NA 2KIMA 2FSWA 1T2KA 3GVAA 1BI1A 4G7HF 3F8FA 1IXSB 2HYGD 3F8BA 2D2WA 4OIRF 2DLLA 2M45A 4EM2A 4FHTA 4HF2A 5HS8A 2GA2A 4NQWA 1DP7P 4U0VA 2V1DA 4WXHA 3SZTA 2R7DA 3GXOA 3F22A 3LFKA 1WI9A 4OIQF 1U5TB 3L9FA 2G9WA 1KYWA 4EM1A 2V6CA 1Q1HA 3MAJA 1FYKA 1QNTA 1LB2A 3WTWC 5FD5A 1AOYA 3LWFA 2FBIA 3RPQA 1G6NA 2RNJA 2CQKA 2MA3A 3HOSA 1BI3A 4YFXF 1ULYA 2YX4A 3ZPLA 5F1RA 4ZH4F 2E1NA 3KEOA 1OYIA 5BPIA 2MC3A 3E97A 3HTUA 3VODA 3F3XA 4KIGA 3K9TA 1FT9A 3O6BB 5DUKA 3MFKA 1PUEE 1U8RA 2CW0F 2L3DA 1ZG3A 1USSA 2STWA 4GGGA 5CJ9A 1T0FA 2FU4A 3BJAA 2Q0OA 1XGSA 1TQMA 4G94A 3JW4A 2P7CB 1D5VA 4IRIA 1G3TA 5E1XA 2A68F 4YFNF 3H3UA 3HYIA 2GA1A 1A04A 1SFXA 2AXLA 4Q48A 1HW1A 3JAMK 4HX8A 4FT8A 1OR7A 3K0LA 2A69F 1QPMA 4RAYA 5LGUA 3QP5A 1YQAA 2ELHA 5CVJA 2RN7A 2K86A 3GFJA 3DEUA 1T6SA 1HSTA 1FBSA 4XRFA 4MGRA 2ADUA 2CO5A 3E6DA 4EM0B 3GF2A 4WF2A 1T98A 1R1UA 5E18F 1JHFA 2VT2A 1IN5A 2X0LA 3KFWX 1BI2A 5FFXA 5DD4A 1ZGAA 3KP7A 2K27A 2EB7A 1E17A 2FBKA 1SD5A 4HOBA 5HLGA 4MQ9F 2IA0A 3HSFA 2HZTA 3M7GA 3TO7A 5HOOA 4P55A 5CVIA 1XSDA 3I59B 4I02A 1XD7A 1ZARA 4O5VA 2PFBA 2QQAA 2UXNA 1TQIA 1O57A 4KYWA 3WU0A 5E8GA 3J80K 2DAOA 2LSOA 4P96A 1I1GA 2XAGA 4HV6A 4PCQA 3MZYA 2HQRA 5DYMA 4CDGA 2MLGA 4EJOA 4IJAA 5JFRA 3TKYA 5HLHA 3WE3A 3L7WA 5ICEA 5LHHA 1MJ9A 1BC8C 4M9SA 2VE9A 1UFMA 3ABTA 4N9HA 3FF5A 2IP2A 3N97A 2HFHA 1SD4A 3GW2A 4I0BA 1FYMA 4I0AA 5D8KB 1Z91A 4I2OA 4KIBA 4LK0F 3TO9A 1P4WA 2A61A 2F5FA 4RGSA 3FHZA 2D45A 1STZA 5E8IA 4MHGA 3I71A 2OAZA 1XCVA 2LKPA 3F8MA 1QGPA 6PAXA 4HZFA 1JGSA 3ZMZA 2D1VA 4EJVA 4CXFA 3FZVA 3ZN1A 5D6FA 3BJ6A 4EGYA 1XGMA 1ZLKA 1YFHA 1R36A 4ZYHA 3DFGA 2ZFWA 2QQBA 3E6MA 5HS9A 4XSZF 4EMSA 5BQTA 1F5TA 2VODA 3BPVA 1Z7UA 1LDKB 5H6QA 4HBLA 3NEUA 2COMA 1F9NA 5LGTA 3MWMA 3MEXA 3WTYC 4ZZLA 1HW5A 3FMSA 4AIJA 3T8RA 2QENA 2IA2A 3F8NA 4GO1A 2FQ3A 2OQGA 5DUIA 1Z6RA 2A3SA 2L01A 2ETHA 2KJBA 3DQVC 2V1UA 5LLQA 1R1TA 2G7UA 1R1VA 3P9KA 2KRFA 1R23A 4NB5A 2PLYA 3ZMDA 2XAQA 4G9YA 2VT3A 1RIOH 1HW2A 1EH8A 3KP6A 3KETA 2ZNYA 1EH6A 4PGGA 1P2FA 3WTUC 2JTVA 1KU2A 1TLHB 2PMHA 2EV6A 5DCMA 3CUQA 2YR2A 4MQVA 4I09A 4MTEA 2OA4A 2GQQA 3FM5A 2C6YA 1YIOA 1IXCA 4XLPF 3SFZA 1XGOA 2WV0A 4Z2YA 4U0WA 2E7XA 4EJWA 1I27A 4DNCA 4EJTA 2XAHA 3ERED 5L3GA 1FX7A 2VC0A 3PQJA 1IN4A 4HV5A 1TQPA 1J9IA 1U5TA 2VOPA 3GZ6A 1QO0D 3V7SA 3H92A 1XGNA 2IW5A 3TQNA 2EA4A 2DTRA 1EV7A 4R1HA 5FGMA 2GXGA 4I98B 1XMKA 5BOXA 4LJZF 2W84A 1FP1D 2DI3A 5FO5A 2M1BA 4KN4X 4S05A 5JR3A 2Z5UA 2R7FA 5HVQC 1FSEA 2F5CA 3DP7A 2DU9A 4M6YA 2P6SA 4U7BA 3RDIA 2QYOA 2ZCWA 5KK1A 1KU7A 1HKSA 1T39A 2HDCA 1BN5A 2DQRA 4EVIA 1RUOA 2P8TA 1WSUA 2K4JA 1J7KA 5AIQA 3HRSA 3GEZA 4UNOA 1ON2A 2NS0A 2FEZA 4LGWA 4L9JA 3I5UA 1SD7A 5D5WB 2Q2EA 3BJOA 3HHHA 3JTGA 2KJCA 3CTAA 1U6GA 3N4MA 4M72A 5D5UB 2HTJA 3HHGA 1WQ2A 5F64A 1J5YA 5LGNA 3IC7A 3I4PA 2L4AA 4LLLA 2XRNA 4R79A 3HOTA 3KLOA 5DCFA 3VFZA 4B8XA 4FX0A 1O7FA 3ZMTA 3JAMZ 5L3FA 4L0YB 1K7AA 3IL2A 1FOKA 4P9UA 2O6GE 5FB2A 3O3KA 2PG4A 3E6CC 2FOKA 2JT1A 1K78B 4WXDA 5DCMB 1KGSA 3CUQB 5FLXK 1LEAA 2FF4A 1GVJA 1FPQA 2ESNA 4ZYGA 1YS7A 1J75A 2K4BA 2EFNA 2KIFA 4OOIA 5L3BA 2D1HA 2QUFA 1LQ1A 1MD0A 3I59A 1S8NA 1TNTA 3DV8A 1MGTA 2VC1A 5HDKA 3GFLA 2M30A 3EDPA 2HS5A 5ICGA 3M8FA 1L0OC 1KYZA 4Q47A 3V7RA 5LRRA 2GZWA 3P7NA 2EA2A 2UXXA 5LBQA 2FMLA 2O8XA 1CF7B 3J80Z 5CYVA 2IT0A 3KE2A 3QOPA 3NQOA 2YSRA 3DPTA 3J7AO 1LVAA 4ENNA 4KN7X 4BQAA 1O3RA 1ZRCA 3OV8A 2XGXA 5K5RA 3RYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O3F A;  4CGZ A;  1YLF A;  1J0R A;  1F4K A;  3WTV C;  2G7H A;  2HGC A;  3C18 A;  4RS8 A;  4ETS A;  1FNN A;  2ZNZ A;  3TDZ C;  3BRO A;  4L9T A;  1JXS A;  5L3D A;  1IUY A;  4N0B A;  2RVC A;  1SMT A;  1G3Y A;  2LNB A;  3GFI A;  2VBX A;  4AWX B;  2WWY A;  1WKM A;  3KCC A;  3EYI A;  4XLN F;  1IRF A;  4QWQ A;  3V4G A;  1HSJ A;  3ISP A;  3I58 A;  1RNL A;  2BYV E;  2HR3 A;  1DPU A;  3QPH A;  4A5N A;  3EET A;  1TTY A;  2H6B A;  1IAW A;  5ILS A;  1ZLJ A;  5E1Z B;  3WGI A;  2XAS A;  4UVA A;  2O61 A;  1QZZ A;  2GIV A;  2CFX A;  2XRO A;  3QP6 A;  5D5X B;  3MQ0 A;  4OIO F;  1SAX A;  2FMY A;  2QLZ A;  3BDD A;  4ENK A;  3EQL F;  4RB0 A;  3FX3 A;  5E20 A;  4LMY A;  3QU3 A;  4HDV A;  2QWW A;  3VB2 A;  1ZN2 A;  3IRQ A;  2FNA A;  4ASN A;  3BZ6 A;  3J81 Z;  4XBF A;  2KIU A;  1LEB A;  3F72 A;  3DXJ F;  2GXB A;  1SFE A;  2HYF A;  3W6K B;  3RKW A;  1BI0 A;  4M74 A;  4AD9 A;  3ZMS A;  3F8C A;  4BHB A;  2P4W A;  1ONV A;  3PQK A;  2FRH A;  3GZ5 A;  3CUO A;  2XV4 S;  3WTT C;  4LB5 A;  2VBY A;  3G3Z A;  4OU0 A;  4Y15 A;  3RYP A;  1YW7 A;  2ACJ A;  2IRF G;  2P5L C;  2EFQ A;  2EFW A;  3GLX A;  3V8K A;  1O3S A;  1QQI A;  2XVC A;  3GWZ A;  4M9Z A;  1ZRF A;  3ABU A;  2VBW A;  3LST A;  2UZK A;  2STT A;  1BOA A;  1W5S A;  1X3U A;  4G6D A;  4MTD A;  1LDJ A;  3TDU C;  3FXQ A;  2P5K A;  2DPD A;  5TRD A;  3FMQ A;  3FMR A;  1LJ9 A;  1HKQ A;  1VTN C;  4RGU A;  3B02 A;  1HQC A;  4L0Z B;  4HX4 A;  4EGZ A;  5EEH A;  2X4H A;  3CDH A;  3OOP A;  3LQR A;  1DUX C;  2RKH A;  1IRG A;  4EQQ A;  4A6E A;  3PFI A;  3TOA A;  3CLO A;  1ZG5 A;  1B6A A;  4RB3 C;  5K5O A;  1YS6 A;  2E1C A;  3IWZ A;  2FXA A;  3QRF F;  4IHS A;  1KA8 A;  4EJU A;  2XHK A;  3NRV A;  2DBB A;  3HUG A;  1ZG1 A;  4L9N A;  3P9I A;  3LA7 A;  1YO5 C;  4QLC U;  2MD5 A;  5H6R A;  1S29 A;  5TJJ A;  3E5Q A;  3L2C A;  4LB6 B;  1YTY A;  4ZYD A;  4IPA A;  5AON A;  2VON A;  1MDM A;  1V4R A;  1H0M A;  1ZRD A;  4D0P A;  4U88 A;  3CO7 C;  2EFP A;  5D6E A;  4RGX A;  1V3F A;  3T5X A;  3GX4 X;  2RV8 A;  1G4D A;  2RQP A;  1O3T A;  3F6O A;  3VEP A;  5LEJ A;  5KVR A;  4M71 A;  4MEY F;  1PDN C;  4N9I A;  2VE8 A;  4KMU X;  1FLI A;  2MH9 A;  3I0T A;  3KLN A;  3F23 A;  2VN2 A;  5JI6 A;  2BGC A;  2PI0 A;  2KKO A;  1SMY F;  5D4S A;  1FBQ A;  3SXY A;  1FYL A;  1K6O A;  2MH2 A;  3TGN A;  3LA2 A;  5IT3 A;  5FFZ A;  1K78 A;  3I64 A;  3Q9V A;  5BMZ A;  3CUQ C;  4TV7 A;  3M8E A;  4HQM A;  1OPC A;  2NYX A;  3EUH A;  3U9G A;  2HOE A;  4UV9 A;  5FLX Z;  1SFU A;  1HXD A;  4LD5 A;  4FX4 A;  4XSX F;  4G7O F;  4O3M A;  5D4R A;  4UV8 A;  2Z3Y A;  2Y75 A;  3ELK A;  2YU3 A;  1TNS A;  2IJL A;  5BPD A;  2RGV A;  4BH9 A;  1U5T C;  3R4K A;  3Q5F A;  2LDU A;  2NNN A;  4HQE A;  3ECH A;  1CF7 A;  1DDN A;  2H09 A;  2XKO A;  4JQF A;  2PN6 A;  1JHH A;  4K2E A;  3FM3 A;  2HWV A;  1ODD A;  1IN8 A;  2EWN A;  3WTS C;  2YX7 A;  1UCR A;  2OU2 A;  2PQ8 A;  3BWG A;  2DFI A;  5IT9 K;  2YPR A;  1P6R A;  1R58 A;  1BBY A;  5LRS A;  4A6D A;  4F7Z A;  2HKO A;  5F6F A;  4HF0 A;  2CSO A;  3M9A A;  2MBF A;  3U2R A;  1MJA A;  1J59 A;  2J5P A;  2BBY A;  1P92 A;  2JPB A;  1MDM B;  1R7J A;  1GHC A;  3T1B A;  3H3Z A;  3HSR A;  4HX7 A;  2F5E A;  3WGH A;  2CG4 A;  1I5Z A;  2RC4 A;  3WG9 A;  2L4M A;  4P9F A;  5K5Q A;  4LLG F;  3RPU A;  1BJA A;  4KMF A;  4U7D A;  5LHI A;  4L5I A;  1YG2 A;  3T0Y A;  2P6T A;  5L3C A;  2HTS A;  5A2Q K;  2V1X A;  1UST A;  1C0W A;  1R5H A;  2IPQ X;  3V7C A;  4HLY A;  3IRR A;  2M5W A;  2W24 A;  3R0J A;  3E3V A;  3WTZ A;  1XN7 A;  1LDD A;  2BE5 F;  1KU9 A;  1U78 A;  3MCZ A;  2LF8 A;  2DT5 A;  3ZQ7 A;  4OMZ A;  4IF4 A;  4WCG A;  2ISZ A;  4ZZD A;  4L9V A;  3IWF A;  4IRH A;  3ECO A;  3GYH X;  4H0E A;  2W85 A;  4CHU A;  4Y17 A;  2Z99 A;  3K69 A;  1FBU A;  1O3Q A;  5JVT A;  3KP3 A;  3HIF A;  5HLI A;  3JSP A;  4Y13 A;  5E17 F;  2OZ6 A;  3BPX A;  5ERI A;  5ILU A;  2JSC A;  2CYY A;  4S04 A;  4PDK A;  2A07 F;  3R6S A;  3CJN A;  1RI7 A;  4U0Y A;  5K1Y A;  2DQL A;  2QBY A;  3IKV A;  2GWR A;  2ESH A;  3WTX C;  4KNY A;  4ON0 A;  1IZ1 A;  2R3S A;  3DKW A;  2FNP A;  2JPC A;  4O6J A;  3RJP A;  4KIC A;  5ED4 A;  4JBA A;  4BHC A;  3WU1 B;  4CYD A;  1U3E M;  4IXA A;  1IXR C;  1G3W A;  3FXR A;  3BY6 A;  2Y48 A;  2Z9O A;  2OZU A;  1ZAO A;  2XUB A;  3AAF A;  4ENJ A;  3WGG A;  3SZP A;  4UVC A;  2UWM A;  4M6X A;  4YII A;  1GXP A;  1KQ0 A;  1XSV A;  3IKT A;  4Q5S F;  4UUV A;  4RB2 C;  2FBH A;  2WC2 A;  1H9G A;  2LF7 A;  3KP4 A;  2DPU A;  4RAZ A;  3TO6 A;  4YG2 F;  1LNW A;  5E1W A;  4A2U A;  3I54 A;  4E70 A;  2NNY A;  2RDP A;  1B59 A;  3L09 A;  5H20 A;  2E7W A;  2Q8K A;  3B73 A;  1W4M A;  1F1Z A;  5CVV A;  4KDP A;  3K1N A;  2NAZ A;  2VOO A;  1KQ8 A;  4BXU A;  5CLS A;  4M73 A;  4HF1 A;  4MEX F;  3RKX A;  2A5Y B;  2M8E A;  2H6C A;  3JSO A;  4CZZ A;  1FSH A;  3E6B A;  1O7L A;  4UXN A;  3K1M A;  3R61 A;  4HAM A;  4YFK F;  4BNC A;  3COA C;  2QZ8 A;  3KP2 A;  4KFC A;  3SQN A;  3ULQ B;  2ZJ2 A;  2B0L A;  1IF1 A;  1BM9 A;  3ZMU A;  2VBZ A;  2PEX A;  1MJB A;  1TW3 A;  3I53 A;  3K1P A;  5FD6 A;  4AIK A;  2H27 A;  1W7P D;  4IVN A;  2JRT A;  3HRT A;  1R22 A;  1JE8 A;  4WXC A;  1R5G A;  1Y0U A;  2PJP A;  2EK5 A;  4ENM A;  2ZO4 A;  1FZP B;  2V9V A;  2MLK A;  2ZBK A;  3ROU A;  2HKX A;  5DDG A;  2OQR A;  5CVU A;  4ESB A;  3HRM A;  1S7A A;  1TBX A;  3QAH A;  3HTS B;  2DK5 A;  1T38 A;  4AIH A;  5BS6 A;  4LG0 A;  1BC7 C;  4OIP F;  1HKT A;  3C1D A;  1RZ4 A;  2HQN A;  1I1S A;  3E5X A;  1BIB A;  2XAJ A;  2QBY B;  2V79 A;  3O2P E;  2BV6 A;  2ZME A;  4OMY A;  1D3Y A;  2O03 A;  1XDU A;  2ZKZ A;  5HDN A;  4UVB A;  4B09 A;  3EYY A;  1XCB A;  4GYI A;  3ZN0 A;  4Q4Z F;  2PMU A;  1OYW A;  2A6H F;  2EV0 A;  1UB9 A;  5CVR A;  2F2E A;  2A6E F;  3RI4 A;  1CGP A;  4YIF A;  3LAJ A;  5DEQ A;  2M87 A;  4RGR A;  4ZYE A;  1H9T A;  4I01 A;  4KUM A;  4HA8 A;  1B9M A;  1UHM A;  1R00 A;  1S7O A;  2H94 A;  4PZJ A;  3F6V A;  3DPL C;  3QU6 A;  1E2X A;  4WX9 A;  1J2X A;  1WRJ A;  2EFO A;  1Z05 A;  3REO A;  1GXQ A;  1ZRE A;  1IN7 A;  3HRU A;  4NHJ A;  1YW9 A;  4IRG A;  3D5L A;  3WOD F;  2XAF A;  3GO5 A;  3ML6 A;  2FA5 A;  3QPT A;  1NHA A;  1TW2 A;  2W25 A;  1KU3 A;  2O0Y A;  2W57 A;  3D0S A;  5D5V B;  1QZY A;  1P4A A;  4G7Z F;  4AVP A;  2XIG A;  1FY7 A;  1XSX A;  2DK8 A;  4KT5 C;  5IT9 Z;  1IN6 A;  5HS7 A;  2DW4 A;  4RB1 A;  1EH7 A;  2K7L A;  2BEO A;  3IHU A;  4G8X A;  2EJR A;  3KP5 A;  2L02 A;  2P7V B;  1D8J A;  4A0X A;  3ZP5 A;  3HSE A;  4L18 B;  3J81 K;  2CWE A;  1XMA A;  2L54 A;  5HDG A;  3KZY A;  2AS5 F;  3JTH A;  4LLN A;  4ESF A;  1Z6T A;  1ON1 A;  5ICC A;  3K2Z A;  4LG0 B;  3KZZ A;  3ZMV A;  5A2Q Z;  1W7P A;  1B4A A;  3R0A A;  1HBX G;  4A5M A;  4HYE A;  5LEK A;  4I7H A;  4GCV A;  1PP8 F;  4IHT A;  4JK1 X;  3C3W A;  2ZME B;  4OIN F;  5ILV A;  1UHW A;  1WWX A;  2J5O A;  4G6Q A;  1KQ9 A;  1MZB A;  2XKP A;  1XDS A;  2FE3 A;  3VOE A;  3FXU A;  3M1E A;  4A0Z A;  2JZY A;  3CO6 C;  5J8F A;  2ISY A;  3GFM A;  4CIC A;  1W5T A;  3R60 A;  4HLX A;  3TOB A;  2K02 A;  5AIP A;  2WTE A;  3C7J A;  1U2W A;  4KA4 A;  1ZHF A;  5L3E A;  2CGP A;  1Z9C A;  3RTR A;  3T8T A;  3E5U A;  1RUN A;  4MNU A;  1ZGJ A;  4PGH A;  5ICF A;  1SD6 A;  2Y0M A;  5JHU A;  2OD5 A;  1B1B A;  5D8L B;  1Z1D A;  1L3L A;  1PP7 U;  3MZH A;  4KIF A;  2Z33 A;  4UHT A;  3WE2 A;  2QVO A;  3KEQ A;  3LA3 A;  4BYY A;  5LHG A;  3V8J A;  1P4X A;  1ZH5 A;  5DD8 A;  1AWC A;  4LFU A;  2F5D A;  4WWC A;  3U1D A;  2GAU A;  2QQ9 A;  2EV5 A;  2OBP A;  4L5J A;  4BHP A;  1IW7 F;  3W6J B;  5J8C A;  1YW8 A;  3V8L A;  3BOQ A;  1D8K A;  2IVM A;  1DPR A;  2NRA C;  3S2W A;  2QM3 A;  5EEG A;  3LAP A;  3GUD A;  3LQQ A;  1FWZ A;  4M9X A;  2HEO A;  3Q9S A;  1OMI A;  3G73 A;  3P9C A;  1YYV A;  4EV0 A;  1G3S A;  1MKM A;  3L00 A;  4HW0 A;  1OKR A;  4LK1 F;  1XB4 A;  4P5O A;  2IA1 A;  4WK8 F;  4GYG A;  5DV5 A;  1S3J A;  2DO7 A;  4HDU A;  3FWE A;  3F21 A;  1FP2 A;  2PBI A;  3BP8 A;  3DF8 A;  3RKY A;  2VXZ A;  3RIR A;  4R8H A;  4A0Y A;  1W7P B;  1K79 A;  1REP C;  1I6X A;  4ESJ A;  2TDX A;  1BIA A;  2P5V A;  4DQ2 A;  1S6L A;  4GXO A;  5J6X A;  4BAY A;  1QBJ A;  4CO8 A;  1FC3 A;  3SHF A;  1ZYR F;  2ZXJ A;  1OYY A;  4A12 A;  1B9N A;  2KIM A;  2FSW A;  1T2K A;  3GVA A;  1BI1 A;  4G7H F;  3F8F A;  1IXS B;  2HYG D;  3F8B A;  2D2W A;  4OIR F;  2DLL A;  2M45 A;  4EM2 A;  4FHT A;  4HF2 A;  5HS8 A;  2GA2 A;  4NQW A;  1DP7 P;  4U0V A;  2V1D A;  4WXH A;  3SZT A;  2R7D A;  3GXO A;  3F22 A;  3LFK A;  1WI9 A;  4OIQ F;  1U5T B;  3L9F A;  2G9W A;  1KYW A;  4EM1 A;  2V6C A;  1Q1H A;  3MAJ A;  1FYK A;  1QNT A;  1LB2 A;  3WTW C;  5FD5 A;  1AOY A;  3LWF A;  2FBI A;  3RPQ A;  1G6N A;  2RNJ A;  2CQK A;  2MA3 A;  3HOS A;  1BI3 A;  4YFX F;  1ULY A;  2YX4 A;  3ZPL A;  5F1R A;  4ZH4 F;  2E1N A;  3KEO A;  1OYI A;  5BPI A;  2MC3 A;  3E97 A;  3HTU A;  3VOD A;  3F3X A;  4KIG A;  3K9T A;  1FT9 A;  3O6B B;  5DUK A;  3MFK A;  1PUE E;  1U8R A;  2CW0 F;  2L3D A;  1ZG3 A;  1USS A;  2STW A;  4GGG A;  5CJ9 A;  1T0F A;  2FU4 A;  3BJA A;  2Q0O A;  1XGS A;  1TQM A;  4G94 A;  3JW4 A;  2P7C B;  1D5V A;  4IRI A;  1G3T A;  5E1X A;  2A68 F;  4YFN F;  3H3U A;  3HYI A;  2GA1 A;  1A04 A;  1SFX A;  2AXL A;  4Q48 A;  1HW1 A;  3JAM K;  4HX8 A;  4FT8 A;  1OR7 A;  3K0L A;  2A69 F;  1QPM A;  4RAY A;  5LGU A;  3QP5 A;  1YQA A;  2ELH A;  5CVJ A;  2RN7 A;  2K86 A;  3GFJ A;  3DEU A;  1T6S A;  1HST A;  1FBS A;  4XRF A;  4MGR A;  2ADU A;  2CO5 A;  3E6D A;  4EM0 B;  3GF2 A;  4WF2 A;  1T98 A;  1R1U A;  5E18 F;  1JHF A;  2VT2 A;  1IN5 A;  2X0L A;  3KFW X;  1BI2 A;  5FFX A;  5DD4 A;  1ZGA A;  3KP7 A;  2K27 A;  2EB7 A;  1E17 A;  2FBK A;  1SD5 A;  4HOB A;  5HLG A;  4MQ9 F;  2IA0 A;  3HSF A;  2HZT A;  3M7G A;  3TO7 A;  5HOO A;  4P55 A;  5CVI A;  1XSD A;  3I59 B;  4I02 A;  1XD7 A;  1ZAR A;  4O5V A;  2PFB A;  2QQA A;  2UXN A;  1TQI A;  1O57 A;  4KYW A;  3WU0 A;  5E8G A;  3J80 K;  2DAO A;  2LSO A;  4P96 A;  1I1G A;  2XAG A;  4HV6 A;  4PCQ A;  3MZY A;  2HQR A;  5DYM A;  4CDG A;  2MLG A;  4EJO A;  4IJA A;  5JFR A;  3TKY A;  5HLH A;  3WE3 A;  3L7W A;  5ICE A;  5LHH A;  1MJ9 A;  1BC8 C;  4M9S A;  2VE9 A;  1UFM A;  3ABT A;  4N9H A;  3FF5 A;  2IP2 A;  3N97 A;  2HFH A;  1SD4 A;  3GW2 A;  4I0B A;  1FYM A;  4I0A A;  5D8K B;  1Z91 A;  4I2O A;  4KIB A;  4LK0 F;  3TO9 A;  1P4W A;  2A61 A;  2F5F A;  4RGS A;  3FHZ A;  2D45 A;  1STZ A;  5E8I A;  4MHG A;  3I71 A;  2OAZ A;  1XCV A;  2LKP A;  3F8M A;  1QGP A;  6PAX A;  4HZF A;  1JGS A;  3ZMZ A;  2D1V A;  4EJV A;  4CXF A;  3FZV A;  3ZN1 A;  5D6F A;  3BJ6 A;  4EGY A;  1XGM A;  1ZLK A;  1YFH A;  1R36 A;  4ZYH A;  3DFG A;  2ZFW A;  2QQB A;  3E6M A;  5HS9 A;  4XSZ F;  4EMS A;  5BQT A;  1F5T A;  2VOD A;  3BPV A;  1Z7U A;  1LDK B;  5H6Q A;  4HBL A;  3NEU A;  2COM A;  1F9N A;  5LGT A;  3MWM A;  3MEX A;  3WTY C;  4ZZL A;  1HW5 A;  3FMS A;  4AIJ A;  3T8R A;  2QEN A;  2IA2 A;  3F8N A;  4GO1 A;  2FQ3 A;  2OQG A;  5DUI A;  1Z6R A;  2A3S A;  2L01 A;  2ETH A;  2KJB A;  3DQV C;  2V1U A;  5LLQ A;  1R1T A;  2G7U A;  1R1V A;  3P9K A;  2KRF A;  1R23 A;  4NB5 A;  2PLY A;  3ZMD A;  2XAQ A;  4G9Y A;  2VT3 A;  1RIO H;  1HW2 A;  1EH8 A;  3KP6 A;  3KET A;  2ZNY A;  1EH6 A;  4PGG A;  1P2F A;  3WTU C;  2JTV A;  1KU2 A;  1TLH B;  2PMH A;  2EV6 A;  5DCM A;  3CUQ A;  2YR2 A;  4MQV A;  4I09 A;  4MTE A;  2OA4 A;  2GQQ A;  3FM5 A;  2C6Y A;  1YIO A;  1IXC A;  4XLP F;  3SFZ A;  1XGO A;  2WV0 A;  4Z2Y A;  4U0W A;  2E7X A;  4EJW A;  1I27 A;  4DNC A;  4EJT A;  2XAH A;  3ERE D;  5L3G A;  1FX7 A;  2VC0 A;  3PQJ A;  1IN4 A;  4HV5 A;  1TQP A;  1J9I A;  1U5T A;  2VOP A;  3GZ6 A;  1QO0 D;  3V7S A;  3H92 A;  1XGN A;  2IW5 A;  3TQN A;  2EA4 A;  2DTR A;  1EV7 A;  4R1H A;  5FGM A;  2GXG A;  4I98 B;  1XMK A;  5BOX A;  4LJZ F;  2W84 A;  1FP1 D;  2DI3 A;  5FO5 A;  2M1B A;  4KN4 X;  4S05 A;  5JR3 A;  2Z5U A;  2R7F A;  5HVQ C;  1FSE A;  2F5C A;  3DP7 A;  2DU9 A;  4M6Y A;  2P6S A;  4U7B A;  3RDI A;  2QYO A;  2ZCW A;  5KK1 A;  1KU7 A;  1HKS A;  1T39 A;  2HDC A;  1BN5 A;  2DQR A;  4EVI A;  1RUO A;  2P8T A;  1WSU A;  2K4J A;  1J7K A;  5AIQ A;  3HRS A;  3GEZ A;  4UNO A;  1ON2 A;  2NS0 A;  2FEZ A;  4LGW A;  4L9J A;  3I5U A;  1SD7 A;  5D5W B;  2Q2E A;  3BJO A;  3HHH A;  3JTG A;  2KJC A;  3CTA A;  1U6G A;  3N4M A;  4M72 A;  5D5U B;  2HTJ A;  3HHG A;  1WQ2 A;  5F64 A;  1J5Y A;  5LGN A;  3IC7 A;  3I4P A;  2L4A A;  4LLL A;  2XRN A;  4R79 A;  3HOT A;  3KLO A;  5DCF A;  3VFZ A;  4B8X A;  4FX0 A;  1O7F A;  3ZMT A;  3JAM Z;  5L3F A;  4L0Y B;  1K7A A;  3IL2 A;  1FOK A;  4P9U A;  2O6G E;  5FB2 A;  3O3K A;  2PG4 A;  3E6C C;  2FOK A;  2JT1 A;  1K78 B;  4WXD A;  5DCM B;  1KGS A;  3CUQ B;  5FLX K;  1LEA A;  2FF4 A;  1GVJ A;  1FPQ A;  2ESN A;  4ZYG A;  1YS7 A;  1J75 A;  2K4B A;  2EFN A;  2KIF A;  4OOI A;  5L3B A;  2D1H A;  2QUF A;  1LQ1 A;  1MD0 A;  3I59 A;  1S8N A;  1TNT A;  3DV8 A;  1MGT A;  2VC1 A;  5HDK A;  3GFL A;  2M30 A;  3EDP A;  2HS5 A;  5ICG A;  3M8F A;  1L0O C;  1KYZ A;  4Q47 A;  3V7R A;  5LRR A;  2GZW A;  3P7N A;  2EA2 A;  2UXX A;  5LBQ A;  2FML A;  2O8X A;  1CF7 B;  3J80 Z;  5CYV A;  2IT0 A;  3KE2 A;  3QOP A;  3NQO A;  2YSR A;  3DPT A;  3J7A O;  1LVA A;  4ENN A;  4KN7 X;  4BQA A;  1O3R A;  1ZRC A;  3OV8 A;  2XGX A;  5K5R A;  3RYR A; 
#chains in the Genus database with same CATH topology
 2DA4 A;  2O3F A;  3OYA A;  4CGZ A;  1YLF A;  2ZXI A;  4XN3 A;  3VWB A;  3CCM I;  4X6A J;  1J0R A;  4B1R A;  1F4K A;  4BJ6 C;  1DQU A;  3WTV C;  2HOT A;  2G7H A;  2HGC A;  1UG2 A;  3C18 A;  4RS8 A;  1GLN A;  1FNN A;  1OCZ H;  2ZNZ A;  3BTC A;  4ETS A;  4FTH A;  1CQT A;  3TDZ C;  2ECB A;  2X51 A;  3BRO A;  4L9T A;  1JXS A;  2L7K A;  3J7Z I;  5L3D A;  1IUY A;  4N0B A;  2LD5 A;  2RVC A;  1HC8 A;  1SMT A;  3E7L A;  2K3F A;  1G3Y A;  2LNB A;  3GFI A;  2DTZ A;  2VBX A;  3K70 C;  4AWX B;  2WWY A;  3Q0W A;  3CLQ A;  1WKM A;  3KCC A;  3SEQ A;  3EUK L;  3HKZ N;  1T0F C;  3EYI A;  4BDZ A;  4XLN F;  1TL8 A;  2L0K A;  1IRF A;  4QWQ A;  1F36 A;  3MKW B;  1K83 J;  3MVP A;  3V4G A;  1HSJ A;  1YE9 A;  3JRA A;  1DU0 A;  3MN2 A;  5B1A H;  3ISP A;  5KNL A;  3MKL A;  3GTL J;  3I58 A;  1RNL A;  2BYV E;  1MW7 A;  2HR3 A;  4QTR A;  3S17 J;  2LFB A;  3QPH A;  4FIS A;  4F91 B;  3DPU A;  2ZJQ F;  4GFB A;  1DPU A;  2E35 A;  4BBS J;  3W3C A;  4A5N A;  1IV8 A;  1OR7 C;  3HOV J;  3EET A;  4BEH B;  3S1Q J;  1TTY A;  2H6B A;  1IAW A;  1A5J A;  5ILS A;  1ZLJ A;  1A31 A;  1DP3 A;  4ZJZ A;  5E1Z B;  3HOZ J;  3WGI A;  2PJR A;  2VKV A;  2XAS A;  1XC5 A;  4UVA A;  5EYR A;  2O61 A;  4H4K C;  3KZI C;  1UAA A;  1QZZ A;  2GIV A;  1WCM J;  2CFX A;  2XRO A;  3BZC A;  3QP6 A;  5D5X B;  3Q3S A;  4A3C J;  5EEA A;  3MQ0 A;  4OIO F;  1SAX A;  2FMY A;  1LVK A;  2BZT A;  3BR5 A;  3LL7 A;  1LFB A;  3LSM A;  2QLZ A;  4NUB A;  5J3L A;  5JLW A;  3BDD A;  3KYL A;  3SJM A;  3CQZ J;  4ENK A;  3EQL F;  4RB0 A;  1AKH B;  3FX3 A;  5E20 A;  4F92 B;  4LMY A;  3QU3 A;  4HDV A;  2PMZ A;  2QWW A;  3FKI J;  2M3A A;  3VB2 A;  1ZN2 A;  2Z2S B;  3IRQ A;  4NC8 A;  2FNA A;  1SC7 A;  3AG3 H;  4ASN A;  3JRC A;  3GTO J;  3BZ6 A;  3KX2 A;  3J81 Z;  4XBF A;  2KIU A;  1LEB A;  1MMD A;  3F72 A;  3DXJ F;  5EZG A;  2GXB A;  1SFE A;  2HYF A;  3W6K B;  1N78 A;  3RKW A;  1BI0 A;  4IHX A;  4M74 A;  4AD9 A;  3PNY A;  5CQE A;  3ZMS A;  3F8C A;  4BHB A;  3QYF A;  2P4W A;  1ONV A;  2KQR A;  2DFE A;  3DU5 A;  2GOX B;  3PQK A;  3S15 J;  2FRH A;  3GZ5 A;  3CUO A;  2DT7 B;  3CJQ B;  2XV4 S;  3PUB A;  3WTT C;  4LB5 A;  1LE8 B;  4C3J J;  2VBY A;  3G3Z A;  1Y8R B;  1X4O A;  4OU0 A;  4HRI A;  4Y15 A;  3RYP A;  1YW7 A;  2ACJ A;  2IRF G;  2M0C A;  2P5L C;  2EFQ A;  2HDW A;  2EFW A;  3GLX A;  2BY0 A;  3V8K A;  4J01 A;  1O3S A;  1QQI A;  2XVC A;  3GWZ A;  1IV6 A;  2X9D A;  3RZO J;  4M9Z A;  5IP7 J;  1ZRF A;  3ABU A;  1N75 A;  2DFF A;  2VBW A;  3LST A;  1WJB A;  2UZK A;  2STT A;  1BOA A;  1W5S A;  1X3U A;  4G6D A;  4CSW A;  4MTD A;  3EPZ A;  5FJ8 J;  2DOF A;  4D9J A;  3N05 A;  2DA2 A;  1LDJ A;  3TDU C;  3TW7 A;  3FXQ A;  2P5K A;  5DS9 A;  1OIS A;  1WJA A;  2VJ5 A;  4ZTJ A;  2DPD A;  5TRD A;  3FMQ A;  4D1Q A;  3H5R A;  3H0G J;  4E7J A;  3BR6 A;  1FOW A;  3TBI A;  2HVQ A;  1LJ9 A;  1R6R A;  3FMR A;  1HKQ A;  1B72 B;  1VTN C;  4RGU A;  2X1C A;  3B02 A;  1HQC A;  1HDD C;  4L0Z B;  2DOA A;  4HX4 A;  3E0J B;  4EGZ A;  1Y39 A;  4XLA A;  4G12 A;  3FBN B;  1YI2 I;  5EEH A;  2L9R A;  2VJI A;  1YJ9 I;  2FJ1 A;  2X4H A;  3CDH A;  3OOP A;  3LQR A;  2R5Y A;  1B8I A;  2ZB9 A;  2VKH A;  1DUX C;  2V9P A;  2JA5 J;  1WVR A;  2L9S A;  2RKH A;  1IRG A;  4CH7 A;  3CP2 A;  3LSR A;  1JUP A;  4EQQ A;  4A6E A;  1WJC A;  3PFI A;  3FBI B;  3TOA A;  3ZOB A;  3CLO A;  1Z3X A;  1ZG5 A;  1B6A A;  4RB3 C;  5K5O A;  4C9Y A;  1MNE A;  3DTE A;  1YS6 A;  2E1C A;  1VQ7 I;  3FK6 A;  5F08 A;  3S1M J;  2CUJ A;  1ZK8 A;  3IWZ A;  2FXA A;  2HU9 A;  3QRF F;  3Q0U A;  4IHS A;  1KA8 A;  2KP6 A;  2O7O A;  4XN0 A;  4EJU A;  2VI6 A;  2XHK A;  2WAQ A;  3DLL F;  5KCM A;  5IYB J;  4HPQ A;  3NRV A;  5FRN A;  2DBB A;  1R71 A;  3CES A;  3HUG A;  1ZG1 A;  5FKM A;  4L9N A;  1I50 J;  3P9I A;  5B5E C;  3OYI A;  3LA7 A;  4RLF A;  1YO5 C;  4QLC U;  5IYD J;  2JN6 A;  2MD5 A;  5H6R A;  1S29 A;  5JVG F;  5TJJ A;  2CS3 A;  1X3Z B;  3E5Q A;  3CCQ I;  3L2C A;  2PJR B;  4LB6 B;  2DJI A;  1YTY A;  4ZYD A;  2LLK A;  4IPA A;  5AON A;  4A3K J;  2VON A;  2AQF A;  1JUS A;  3CCE I;  3TP3 A;  1MDM A;  2NVT J;  1U0J A;  1KZH A;  2HXO A;  4NNJ A;  5GP9 A;  2K40 A;  1V4R A;  3G1M A;  1H0M A;  1UEL B;  1ZRD A;  4D0P A;  4RM3 A;  4U88 A;  1VQ9 I;  2MC4 A;  3CO7 C;  2EFP A;  5D6E A;  4RGX A;  1V3F A;  1P9Q C;  3T5X A;  1J09 A;  1ZEL A;  2K9L A;  3GX4 X;  4C3H J;  2RV8 A;  1G4D A;  2RQP A;  1X19 A;  3F6O A;  3VEP A;  1O3T A;  5LEJ A;  5KVR A;  4BS9 A;  1GV2 A;  4A3G J;  4M71 A;  4MEY F;  3TED A;  1W0T A;  1IRX A;  1PDN C;  4IHV A;  3IV5 A;  1X3W B;  4XRS G;  2E1O A;  4N9I A;  2PX9 A;  1X2N A;  2VE8 A;  3PFY A;  4KMU X;  5E3M A;  4GDF A;  4YEJ A;  2WV1 A;  2IS4 A;  1FLI A;  2MH9 A;  3I0T A;  2HVR A;  4PFP A;  3KLN A;  1TZL A;  3F23 A;  1MMA A;  2CRG A;  2ELJ A;  2VN2 A;  5JI6 A;  2BGC A;  4CCM A;  2PI0 A;  4AYB A;  1Z3Y A;  5EGO A;  2KKO A;  1SMY F;  5D4S A;  1FBQ A;  3SXY A;  2IS1 A;  4AID A;  5B1B H;  1FYL A;  1K6O A;  2MH2 A;  3TGN A;  3LA2 A;  3M3Y J;  5IT3 A;  5FFZ A;  1K78 A;  3I64 A;  1MND A;  3Q9V A;  5BMZ A;  3CUQ C;  2BVL A;  3P5J A;  4TV7 A;  3M8E A;  4HQM A;  4CA0 A;  1OPC A;  2R7V A;  4Y3O A;  3KYD B;  4P1W A;  5E79 C;  3GTP J;  2NYX A;  3PL8 A;  3EUH A;  2DA6 A;  3U9G A;  2HOE A;  4UV9 A;  3OS2 A;  3F0C A;  5FLX Z;  1SFU A;  1HXD A;  4LD5 A;  4FX4 A;  1G8X A;  4XSX F;  2XF7 A;  4G7O F;  4O3M A;  1EKE A;  3PUF A;  5D4R A;  4YIR X;  1X1P A;  4UV8 A;  2Z3Y A;  2Y75 A;  1ACI A;  3ELK A;  3KPH A;  2YU3 A;  2CFO A;  2COB A;  4XRS A;  2K5C A;  1TNS A;  2IJL A;  5BPD A;  2RGV A;  4BH9 A;  2R5Y B;  1B8I B;  4IX7 A;  1U5T C;  1W1W E;  3BQY A;  3R4K A;  3H9J A;  5GTH C;  3OYD A;  1X2M A;  3Q5F A;  2LDU A;  2NNN A;  4HQE A;  3ECH A;  4JYK A;  2R4G A;  1W36 C;  2PMZ N;  3JRE A;  1CF7 A;  5GAG J;  4XKC A;  4KJZ A;  1DDN A;  2H09 A;  2XKO A;  2Z1D A;  4NDL A;  4MFE A;  4M3G A;  3OYL A;  3CC4 I;  3BG5 A;  4JQF A;  3RQI A;  2PN6 A;  1APL C;  1WI3 A;  4K2E A;  3GBG A;  3BTL A;  2NVX J;  3FM3 A;  3FIW A;  3FKJ A;  2HWV A;  3K4M A;  3VYT B;  4LIT A;  1I3Q J;  3HL2 A;  2BY2 A;  2QEX I;  1RR7 A;  4CCJ A;  3SZG A;  1ODD A;  1IC8 A;  1XPX A;  1IN8 A;  2EWN A;  1VQ5 I;  3WTS C;  1N77 A;  2YX7 A;  3ZQL A;  1UCR A;  4FE4 A;  2OU2 A;  2GIZ A;  2X6X A;  2PQ8 A;  3BWG A;  3PIP F;  3CMY A;  2DFI A;  3ZQI A;  3NAR A;  5IT9 K;  2YPR A;  1P6R A;  3HB9 A;  1R58 A;  4UUT A;  5M5X J;  1BBY A;  3OWT A;  4CCK A;  5LRS A;  1JGG A;  5FKN A;  4RLQ A;  4A6D A;  5FKO A;  4F7Z A;  1JI8 A;  2HKO A;  3H9G A;  5F6F A;  2HXI A;  4HF0 A;  1T33 A;  2CSO A;  3M9A A;  2MBF A;  1V54 H;  1VND A;  3U2R A;  1MJA A;  1J59 A;  4XLC A;  2J5P A;  1E3H A;  2BBY A;  2XPW A;  1P92 A;  3Q0V A;  2JPB A;  5C3E J;  1MDM B;  2MG4 A;  4XR6 A;  3TP0 A;  1R7J A;  5GPA A;  3G71 I;  3H5N A;  3T1B A;  1GHC A;  3H3Z A;  3HSR A;  3CDI A;  3S3N A;  4HX7 A;  2F5E A;  3ZRG A;  3WGH A;  2CG4 A;  4BAC A;  1I5Z A;  2DMP A;  2RC4 A;  1VZ0 A;  3WG9 A;  2L4M A;  4P9F A;  5K5Q A;  2KT0 A;  4LLG F;  2XPU A;  2W48 A;  3RPU A;  3G1O A;  1SEU A;  1BJA A;  3VSL A;  3MKY B;  4A3J J;  4KMF A;  5M5Y J;  2ICW G;  4KT6 A;  4U7D A;  5LHI A;  4JOM A;  4L5I A;  2DJN A;  2M4G A;  1YG2 A;  2M0M A;  4BEH A;  3T0Y A;  1V5F A;  2P6T A;  2ME0 A;  5L3C A;  4CYC B;  2HTS A;  2VKD A;  5A2Q K;  4UUS A;  2V1X A;  4JX5 A;  5KAI C;  1UST A;  4LG3 A;  3G2B A;  1AHD P;  1C0W A;  1R5H A;  2IPQ X;  3V7C A;  1MBG A;  4HLY A;  2M7A A;  5EGO B;  2DA5 A;  3AG2 H;  3IRR A;  4B3A A;  2M5W A;  2W24 A;  3R0J A;  3E3V A;  1GT0 C;  1NH3 A;  3WTZ A;  1XN7 A;  1PJR A;  1LDD A;  2BXY A;  1POG A;  2BE5 F;  3AG4 H;  2B7E A;  1KU9 A;  1U78 A;  3MCZ A;  1G2H A;  2LF8 A;  2DT5 A;  3ZQ7 A;  5F0F A;  4OMZ A;  4IF4 A;  4WCG A;  3S93 A;  2KZG A;  2ISZ A;  1HDP A;  4ZZD A;  4L9V A;  3IWF A;  2XRL A;  3W6V A;  4IRH A;  1HLV A;  3ECO A;  3GYH X;  4NC6 A;  4H0E A;  1D1A A;  1U8B A;  2WAQ N;  2W85 A;  2H8R A;  3BG7 A;  3OS1 A;  3PIO F;  2LMD A;  1ENH A;  1XTA A;  1WHU A;  4Y17 A;  2Z99 A;  4CHU A;  1X1B A;  2RNG A;  2JA7 J;  4C30 A;  3OYC A;  3K69 A;  1FBU A;  1O3Q A;  5JVT A;  3DBH B;  3LNQ A;  1VQN I;  2EH3 A;  1XMX A;  4V2F A;  1LE8 A;  3KP3 A;  3HIF A;  1IGN A;  3MMY B;  3HOW J;  5HLI A;  3GLL A;  2FOW A;  3JSP A;  2V6E A;  4Y13 A;  2I5U A;  4XK4 A;  5E17 F;  3D1N I;  2OZ6 A;  3BPX A;  5ERI A;  2JA6 J;  5ILU A;  2JSC A;  2CYY A;  4S04 A;  4PDK A;  2A07 F;  3R6S A;  3CJN A;  3W2W A;  2RAE A;  1RI7 A;  1NG6 A;  1XS9 A;  4U0Y A;  2R7R A;  5K1Y A;  2DQL A;  2QBY A;  3IKV A;  2GWR A;  2ESH A;  3WTX C;  4KNY A;  2IGM A;  2JA8 J;  3LSH A;  5C44 J;  4PJ0 C;  4ON0 A;  1IZ1 A;  2R3S A;  3FDY A;  3DKW A;  4ZDP A;  2OCC H;  2FNP A;  2JPC A;  4O6J A;  2DCE A;  5F04 A;  2XSJ C;  2IGO A;  3CD6 I;  3RJP A;  2DDB A;  4KIC A;  1BJZ A;  4JBA A;  2KZV A;  4FET A;  5ED4 A;  4BHC A;  3CC2 I;  3WU1 B;  1Z67 A;  3NWS A;  2VIX A;  3FIS A;  4CYD A;  1U3E M;  4IXA A;  1IXR C;  1GV5 A;  1G3W A;  3FXR A;  1ETW A;  3BY6 A;  2Y48 A;  2Z9O A;  2OZU A;  3HC7 A;  1ZKG A;  1ZAO A;  4PJN A;  5DM6 F;  2XUB A;  3GZN B;  2NS8 A;  2LYC A;  3AAF A;  2DYR H;  4AYB N;  4ENJ A;  3WGG A;  2V4J C;  3SZP A;  3HG9 A;  4UVC A;  3QPL A;  3TL4 X;  2UWM A;  1IRZ A;  5F1J A;  4M6X A;  2QKM B;  4YII A;  1GXP A;  1KQ0 A;  1XSV A;  3IKT A;  1G59 A;  4CUG A;  4Q5S F;  2NS7 A;  2XGD A;  3BR0 A;  1MSF C;  3HDD A;  4UUV A;  4RB2 C;  2FBH A;  5GAH J;  3BQZ A;  1H88 C;  1A35 A;  1WGX A;  2HNH A;  2WC2 A;  5M3M J;  1H9G A;  2LF7 A;  3KP4 A;  2DPU A;  4IHY A;  1K4S A;  4RAZ A;  3TO6 A;  4YG2 F;  1LNW A;  5E1W A;  2TRT A;  3K4C A;  5FKK A;  3K2A A;  4A2U A;  4XM3 A;  1S72 I;  2IEK A;  3I54 A;  4E70 A;  1NTC A;  1A36 A;  3SFI A;  3A0B C;  2NNY A;  4ZYA A;  2XAU A;  2RDP A;  1B59 A;  2ID3 A;  3BCB A;  2ZJP F;  3L09 A;  5H20 A;  5F0C A;  2E7W A;  2VQL A;  2Q8K A;  3B73 A;  1W4M A;  2LTP A;  1F1Z A;  5CVV A;  1HF0 A;  2XF5 A;  4KIS A;  4KDP A;  2WY7 Q;  3FXO A;  3K1N A;  2NAZ A;  2VOO A;  4YEL A;  3CMA I;  1KQ8 A;  4RA2 A;  4BXU A;  1MH3 A;  5CLS A;  4M73 A;  4HF1 A;  3M8J A;  2XB5 A;  3HPG A;  4AVZ A;  4MEX F;  2QSG X;  3QYB A;  3I9V 2;  4HG2 A;  3RKX A;  3H5A A;  1K61 A;  2A5Y B;  2M8E A;  1ETO A;  4DJA A;  2H6C A;  2CV0 A;  4NBQ A;  4UUS B;  5IPA A;  3JSO A;  4CZZ A;  1FSH A;  3E6B A;  2XDV A;  1O7L A;  4UXN A;  3K1M A;  3R61 A;  2LKS A;  5C4X J;  4HAM A;  1ETV A;  4YFK F;  4BNC A;  1FTT A;  3COA C;  3RZD J;  2QZ8 A;  4XQF A;  3KP2 A;  4KFC A;  2CJJ A;  3SQN A;  3ULQ B;  2Z16 A;  2ZJ2 A;  4DGW B;  1S9H A;  2B0L A;  4JX6 A;  4JX4 A;  1IF1 A;  1BM9 A;  3ZMU A;  2VBZ A;  4BE0 A;  2PEX A;  1Y56 A;  4II3 A;  1MJB A;  1TW3 A;  3I53 A;  3K1P A;  5FD6 A;  4AIK A;  3S14 J;  3OMY A;  2JK3 A;  1IJW C;  4C2M J;  2H27 A;  1W7P D;  2VJJ A;  1D1C A;  4IVN A;  2JRT A;  2MW8 A;  3I3L A;  2OCE A;  1SFO J;  3HRT A;  2B9S A;  1R22 A;  1JE8 A;  3OYK A;  2VPL A;  4WXC A;  4PSX A;  1ETY A;  1R5G A;  1Y0U A;  4BXF A;  4X0G A;  2PJP A;  2EK5 A;  3ASN H;  3MD2 A;  1FMV A;  3ZQQ A;  3I4M J;  4ENM A;  2ZO4 A;  4RAG A;  3EUA A;  2V9V A;  1FZP B;  5LFA A;  3KEY A;  2MLK A;  2ZBK A;  3ROU A;  1ITY A;  2WAE A;  2HKX A;  2QSF X;  5DDG A;  2OQR A;  1IO2 A;  1TWF J;  5CVU A;  4ESB A;  3HRM A;  1S7A A;  1WJD A;  1TBX A;  3QAH A;  2AQE A;  2VAS A;  3H3V K;  1ZTR A;  3D5R C;  2DK5 A;  3HTS B;  1VQK I;  1T38 A;  4AIH A;  4I76 A;  5BS6 A;  4CZC A;  2CQQ A;  2QGU A;  4LG0 A;  4BKX A;  1BC7 C;  3BC8 A;  4OIP F;  1HA8 A;  4NQW B;  1HKT A;  3C1D A;  3DWL E;  3LSJ A;  1U9N A;  3BR1 A;  4W1U A;  1RZ4 A;  4F3Q A;  2HQN A;  1I1S A;  2KDO A;  3E5X A;  2BXZ A;  1R4N B;  1BIB A;  2X1E A;  2XAJ A;  2QBY B;  1FEX A;  1VQP I;  1BR4 A;  2V79 A;  3O2P E;  3E1S A;  3VSK A;  2BV6 A;  2ZME A;  1VI0 A;  1D3Y A;  5J4V A;  2O03 A;  4OMY A;  4L5E A;  1SAN A;  4S0H B;  1WFX A;  1XDU A;  2LP0 A;  2ZKZ A;  5HDN A;  2L2O A;  4UVB A;  4B09 A;  1JJ6 C;  5GPC A;  3EYY A;  1W36 D;  1XCB A;  1EJ9 A;  2X6W A;  4GYI A;  3ZN0 A;  1LUJ B;  1PUF A;  4Q4Z F;  1SFK A;  1R5I D;  2PMU A;  1OYW A;  2A6H F;  2E60 A;  2R7U A;  2EV0 A;  2A05 A;  3VPR A;  1UB9 A;  2XB0 X;  5CVR A;  3AG1 H;  2VLA A;  2F2E A;  3ZQH A;  2A6E F;  3RI4 A;  1CGP A;  3DBL B;  4YIF A;  5DEQ A;  3LAJ A;  3RYR A;  2DYS H;  2M87 A;  3CP8 A;  3CF5 F;  4RGR A;  2OUM A;  4XON A;  3OR1 C;  2ME6 A;  4ZYE A;  1H9T A;  4I01 A;  2EZK A;  2QKL B;  4HNV A;  2E2J J;  4KUM A;  4HA8 A;  1B9M A;  3H9Q A;  1UHM A;  1R00 A;  1S7O A;  2H94 A;  4PZJ A;  1VQO I;  4BUP A;  3OYM A;  3F6V A;  3DPL C;  3QU6 A;  1E2X A;  4WX9 A;  5IYC J;  4J19 A;  1J2X A;  1WRJ A;  2EFO A;  4XLF A;  2W00 A;  2LR8 A;  5IP9 J;  2B63 J;  4D5F A;  1Z05 A;  4Y52 J;  3REO A;  1MBK A;  1GXQ A;  1ZRE A;  1IN7 A;  2R5Z A;  3HRU A;  2RRE A;  4U87 A;  4NHJ A;  1YW9 A;  1TWG J;  4IRG A;  3D5L A;  3WOD F;  2VB6 A;  3GTQ J;  2R7Z J;  4PJJ A;  1FTZ A;  2XAF A;  2WY8 Q;  3VDX A;  3GO5 A;  3ML6 A;  2FA5 A;  3QPT A;  1NHA A;  1TW2 A;  2W25 A;  4BBR J;  1KU3 A;  2O0Y A;  1SVO A;  2W57 A;  3D0S A;  5D5V B;  3OY9 A;  1QZY A;  1ERD A;  1P4A A;  4G7Z F;  4FCY A;  3L2W A;  2EZI A;  3F9K A;  3DTI A;  1FJL A;  4AVP A;  3UNG C;  3IUO A;  1Y1W J;  2XIG A;  3HGY A;  2CUZ A;  1T95 A;  3DKX A;  4LIU A;  2DMN A;  1FY7 A;  3X2Q H;  1RPW A;  1XSX A;  1MIJ A;  3OSF A;  2DK8 A;  2KDZ A;  2R0Q C;  1WH7 A;  2G0E A;  4KT5 C;  5IT9 Z;  1IN6 A;  5HS7 A;  2ID6 A;  2AXT C;  2DW4 A;  4RB1 A;  1EH7 A;  2K7L A;  3IH2 A;  2BEO A;  3DTK A;  3IHU A;  3IAS 2;  3CZ6 A;  3SYT A;  2R7Q A;  4G8X A;  2EJR A;  1ZGW A;  3KP5 A;  2L02 A;  2P7V B;  4IQ4 A;  4BJT A;  2QA4 I;  1D8J A;  4A0X A;  3ZP5 A;  2NVY J;  2HZD A;  3HSE A;  4L18 B;  3J81 K;  2CWE A;  2WB1 A;  1XMA A;  3AL0 C;  3QPS A;  2L54 A;  4E7H A;  1A6I A;  3BG3 A;  5HDG A;  2E36 A;  1TP4 A;  3JR9 A;  4XOP A;  2IS6 A;  3KZY A;  3DCF A;  1MBJ A;  2AS5 F;  3JTH A;  4CYC A;  2UUZ A;  4MLO A;  3LSG A;  1YIJ I;  4LLN A;  3QOE A;  2M8G X;  4ESF A;  1R4M B;  1OCR H;  2XF6 A;  1Z6T A;  2NXN B;  1ON1 A;  1NG7 A;  5ICC A;  3K2Z A;  3SDB A;  2LBF B;  2VKE A;  2BHZ A;  4XLE A;  4V19 K;  4Z6Y A;  1D0X A;  4A3B J;  3W2V A;  2DA7 A;  2NOG A;  4LG0 B;  5C4J J;  3KZZ A;  3ZMV A;  2X85 A;  5A2Q Z;  3JRD A;  1W7P A;  1B4A A;  4XKB A;  3R0A A;  1HBX G;  2W4S A;  1OCP A;  2KRH A;  5EJC A;  2FQ4 A;  4A5M A;  2H8W A;  3JRF A;  5FRO A;  5E3O A;  4HYE A;  5LEK A;  5LD2 C;  4I7H A;  3LFU A;  3CDL A;  2LH9 A;  4GCV A;  5J47 A;  1PP8 F;  4IHT A;  4JK1 X;  3CCL I;  3C3W A;  3H36 A;  2ZME B;  1Z77 A;  3ZQC A;  3G1L A;  4OIN F;  5J40 A;  4DZJ A;  1WPK A;  1QZE A;  1OJL A;  5J1U A;  5ILV A;  1UHW A;  1WWX A;  2J5O A;  4G6Q A;  3EUH C;  3FHN A;  1KQ9 A;  1MZB A;  1TT0 A;  2XKP A;  3I56 I;  1BL0 A;  3M1C A;  2EBI A;  1M1E B;  1LPQ A;  1XDS A;  1N25 A;  2FE3 A;  3VOE A;  3OYF A;  4UY8 I;  3A0H C;  1MBE A;  1PUF B;  2BOL A;  3FXU A;  4A3D J;  2BY3 A;  3M1E A;  2V26 A;  5E3L A;  4A0Z A;  2JZY A;  2GXA A;  1TWH J;  1QVU A;  3LSI A;  3CO6 C;  5J8F A;  3LSK A;  4HST A;  4PJM A;  2R7W A;  2DMU A;  2ISY A;  4AC0 A;  5EF6 A;  3GFM A;  4CIC A;  4XKW A;  3MKZ A;  3AFH A;  1FMW A;  4B48 A;  1W5T A;  2L9V A;  2OV7 A;  1FOY A;  3S2D J;  2EZH A;  3R60 A;  4HLX A;  3TOB A;  1HOM A;  2JVH A;  2K02 A;  5AIP A;  4A3L J;  2E1M B;  2WTE A;  3IAM 2;  2CU7 A;  3C7J A;  1U2W A;  4KA4 A;  1ZHF A;  5L3E A;  1SAU A;  3GTK J;  2CGP A;  1Z9C A;  3B6C A;  3RTR A;  1YX5 A;  3T8T A;  2KRC A;  3J7A Y;  3E5U A;  3WU2 C;  1RUN A;  4MNU A;  1ZGJ A;  1Y8Q B;  3A4C A;  4PGH A;  5ICF A;  1SD6 A;  1ZR4 A;  2Y0M A;  5JHU A;  1Z7L A;  2R5Z B;  2OD5 A;  1B1B A;  5D8L B;  3L2U A;  1EF4 A;  1Z1D A;  1VQ8 I;  2Q1Z B;  3UKG A;  1L3L A;  3G4S I;  1PP7 U;  3MZH A;  3LSP A;  2DDA A;  4IL6 C;  4KIF A;  2Z33 A;  3K70 D;  4UHT A;  3WE2 A;  2QVO A;  2LY2 A;  3KEQ A;  3LA3 A;  3A01 A;  3PNV A;  4NC7 A;  4MFD A;  2HPI A;  3QYE A;  3PNT A;  1JKO C;  4BYY A;  3DBR B;  1RR8 C;  5LHG A;  3V8J A;  2IGN A;  1P4X A;  1JTX A;  1TC3 C;  3O8G A;  4XLH A;  1OQY A;  3DEW A;  1TWA J;  1ZH5 A;  3NWT A;  2JWT A;  5DD8 A;  3SDG A;  1AWC A;  4C2T A;  4LFU A;  3K4L A;  1NK3 P;  2F5D A;  4WWC A;  3U1D A;  2CUF A;  1Y6I A;  2JJ7 A;  4F52 A;  3ERM A;  2GAU A;  2QQ9 A;  4PSW A;  2EV5 A;  2XGE A;  2OBP A;  4L5J A;  2E2I J;  4BHP A;  1IW7 F;  3W6J B;  5J8C A;  1YW8 A;  3V8L A;  4HSR A;  2M9H A;  2ZSH B;  5IOY A;  3BOQ A;  1D8K A;  2IVM A;  4ANJ A;  1DPR A;  2NRA C;  3GME A;  2CQX A;  2LG4 A;  3S2W A;  2QM3 A;  3UR3 C;  5EEG A;  4DZP A;  2CQ7 A;  2F4I A;  2KLO A;  3LAP A;  3GUD A;  3LQQ A;  3ONQ A;  3PO2 J;  1FWZ A;  4M9X A;  2HEO A;  2F4O B;  3WHC A;  2R7S A;  3Q9S A;  1OMI A;  3JRI A;  3G73 A;  3P9C A;  4UB8 C;  1YYV A;  4XOR A;  1PYV A;  4ZC3 A;  3OOU A;  4EV0 A;  1G3S A;  1MKM A;  3S1N J;  3L00 A;  4HW0 A;  1OKR A;  4LK1 F;  1XB4 A;  1RKT A;  2HVS A;  4P5O A;  2IA1 A;  1QPI A;  4WK8 F;  2R7O A;  2WAD A;  5IY5 H;  3ABM H;  3K4B A;  4GYG A;  5DV5 A;  1S3J A;  2DO7 A;  4HDU A;  3FWE A;  5H2F C;  3F21 A;  5J4Y A;  1FP2 A;  2PBI A;  4BGD A;  3BP8 A;  1ZQ3 P;  3DF8 A;  1K6Y A;  3L2Q A;  1O4X A;  3RKY A;  2VXZ A;  1E3P A;  3RIR A;  4RDU A;  3CJT B;  4R8H A;  2Y69 H;  3BR2 A;  4OWR B;  1YRN B;  4A0Y A;  1W7P B;  2HOS A;  3OIP A;  3JRB A;  1K79 A;  1TT5 B;  1REP C;  1I6X A;  2KPM A;  2CQN A;  2DMT A;  4A69 C;  4ESJ A;  2M2E A;  1Y0N A;  2TDX A;  1BIA A;  2P5V A;  2JA2 A;  1R49 A;  4DQ2 A;  1S6L A;  1X1C A;  2QCO A;  4GXO A;  3DLA A;  5J6X A;  4BAY A;  3I4N J;  1QBJ A;  4CO8 A;  2A6T A;  2VXD A;  1FC3 A;  2V7F A;  3BTI A;  5M3F J;  3SHF A;  1ZYR F;  2ZXJ A;  4DBR A;  1MMG A;  1OYY A;  4A12 A;  1B9N A;  3QWL A;  2KIM A;  4OAY A;  2FSW A;  4F55 A;  1T2K A;  3GVA A;  1BI1 A;  4G7H F;  3FXJ A;  4E7I A;  4BQN A;  5IP6 A;  4BJ5 C;  2BW3 A;  3F8F A;  1H89 C;  1IXS B;  2HYG D;  3F8B A;  2E19 A;  2OJE D;  2D2W A;  4B43 A;  4OIR F;  2OF7 A;  5FKL A;  2BY1 A;  2DLL A;  1OCT C;  1WJF A;  2NVU B;  2M45 A;  4EM2 A;  2R93 J;  4FHT A;  4HF2 A;  5HS8 A;  2GA2 A;  1A6Q A;  4NQW A;  2FUG 2;  4PJL A;  1DP7 P;  4U0V A;  1ORK A;  3G6E I;  4M3B A;  3OYG A;  2V1D A;  2CH0 A;  4WXH A;  3SZT A;  2R7D A;  2DOE A;  1WJ5 A;  4EAT A;  1ZR2 A;  1QU3 A;  3GXO A;  3F22 A;  2ECC A;  3LFK A;  1WI9 A;  4X1E A;  1LFU P;  4OIQ F;  2OPT A;  2YS9 A;  2WB1 N;  1U5T B;  3L9F A;  2G9W A;  1KYW A;  5GAE J;  2VL8 A;  4IQJ A;  4BDY A;  1VQL I;  4EM1 A;  2V6C A;  1Q1H A;  4PK4 A;  2R92 J;  3MAJ A;  3PJR A;  3AKZ A;  2GM4 A;  1FYK A;  1QNT A;  1LB2 A;  3WTW C;  5FD5 A;  3MZ8 A;  1AOY A;  3LWF A;  2FBI A;  3DEE A;  4XIC A;  3OIO A;  3RPQ A;  2BHY A;  1G6N A;  2XSD C;  2RNJ A;  2QQ8 A;  2CQK A;  3S8P A;  5EG0 B;  1VQ4 I;  2MA3 A;  3HOS A;  1BI3 A;  4YFX F;  1ULY A;  2YX4 A;  3A01 B;  2QSH X;  3FXK A;  1SVL A;  3ZPL A;  5F1R A;  3HBL A;  3TW6 A;  1U9O A;  4ZH4 F;  1S7E A;  2E1N A;  2YUS A;  3KEO A;  1OYI A;  5BPI A;  2MC3 A;  9ANT A;  4E7L A;  3E97 A;  3HTU A;  3HZJ A;  2ZFU A;  2N8G A;  3C2H A;  3VOD A;  4RAF A;  4DIQ A;  3F3X A;  1UG0 A;  4KIG A;  1FIP A;  3K9T A;  1FT9 A;  2L9N A;  4ZTF A;  1MSE C;  1Z0X A;  2HOA A;  1UZC A;  4F93 B;  2DT6 A;  2H1L A;  3O6B B;  5DUK A;  3QQA A;  3MFK A;  1NK2 P;  1Q1V A;  1PUE E;  4RM2 A;  3LOC A;  2CW0 F;  1U8R A;  2L3D A;  4XL9 A;  4IOC F;  4E7K A;  1ZG3 A;  1XG1 A;  1USS A;  3HEF A;  1VQM I;  4GGG A;  2STW A;  2Q2E B;  1P7I A;  3KYC B;  5CJ9 A;  3W2A A;  2WAF A;  1T0F A;  1VQ6 I;  3K4J A;  2LVS A;  1AA7 A;  3H1C A;  4XNF A;  2FU4 A;  3BJA A;  2Q0O A;  4XOT A;  1XGS A;  1X58 A;  3BZK A;  5J1R A;  1TQM A;  4G94 A;  4UB6 C;  4PFO A;  4C2U A;  3JW4 A;  4IO9 F;  1IUF A;  2P7C B;  1D5V A;  4IRI A;  1G3T A;  5E1X A;  2A68 F;  4YFN F;  2E34 A;  2UV1 A;  3H3U A;  3HYI A;  2GA1 A;  1A04 A;  3K6G A;  1SFX A;  2AXL A;  4Q48 A;  1HW1 A;  4DOZ A;  1GVD A;  1IDY A;  3M07 A;  3JAM K;  2E2H J;  4HX8 A;  4FT8 A;  1OR7 A;  3K0L A;  2A69 F;  5EZH A;  5FLV A;  2IGK A;  2QF7 A;  3WHB A;  1K4T A;  1QPM A;  2JMW A;  4RAY A;  3U1K A;  3BCA A;  3BR3 A;  3QP5 A;  1YQA A;  5LGU A;  3VYU B;  3A03 A;  2ELH A;  2KIS A;  4CCN A;  2ZXH A;  5JLX A;  4Y7N J;  5CVJ A;  5FLM J;  2RN7 A;  1R9T J;  3WG7 H;  2K86 A;  3GFJ A;  3L2V A;  1IDZ A;  4BY1 J;  1WJE A;  3DEU A;  2EIN H;  2HDD A;  1T6S A;  3S32 A;  2Y30 A;  3BT9 A;  1HST A;  1FBS A;  4XRF A;  4MGR A;  2ADU A;  1V5G A;  1LFP A;  1VFC A;  2CO5 A;  2H1K A;  2E71 A;  3E6D A;  4EM0 B;  3GF2 A;  3FXM A;  4WF2 A;  3OYH A;  1T98 A;  1R1U A;  3C2B A;  4YRV A;  4N4O B;  5E18 F;  1JHF A;  3PO3 J;  2VT2 A;  1IN5 A;  2X0L A;  2EIJ H;  1OCC H;  1RET A;  4RBO A;  1BW6 A;  3A1Y A;  3KFW X;  1BI2 A;  5FFX A;  5DD4 A;  2Y0S A;  1EA3 A;  2OTJ I;  1ZGA A;  3KP7 A;  2K27 A;  2EB7 A;  1E17 A;  2M34 A;  2DA1 A;  2BW3 B;  5CKT A;  1V5E A;  2FBK A;  1QHG A;  2RQQ A;  1WZ2 A;  1SD5 A;  2HYJ A;  4IZZ A;  4HOB A;  5HLG A;  4MQ9 F;  2LBF A;  2IA0 A;  2E5N A;  2FX0 A;  3HSF A;  4HNU A;  1BR1 A;  2HZT A;  3M4O J;  2CV1 A;  3M7G A;  3TO7 A;  5HOO A;  4P55 A;  5CVI A;  5GAD J;  1XSD A;  3I59 B;  4I02 A;  3K4N A;  4CCO A;  5E3N A;  2M7B A;  3DKY A;  1I6H J;  1D0Z A;  1XD7 A;  1ZAR A;  4DYR A;  4O5V A;  2I8D A;  2PFB A;  3CC7 I;  2QQA A;  2UXN A;  3BLY A;  2JUG A;  1TQI A;  1D0Y A;  3CMM A;  1OFC X;  1MBF A;  1O57 A;  4KYW A;  1DGR M;  3WU0 A;  3OIQ A;  5E8G A;  3B6A A;  3J80 K;  2DAO A;  2LSO A;  1GDT A;  1I3A A;  2YU9 J;  4P96 A;  1I1G A;  2LK2 A;  2XAG A;  2FD5 A;  4HV6 A;  4PCQ A;  4PUS A;  1T56 A;  1ETX A;  3CCS I;  1X1A A;  2ZME C;  3MZY A;  3GTM J;  2HQR A;  2GBY A;  5DYM A;  4CDG A;  1X4P A;  4XID A;  1V55 H;  4A3F J;  1MH4 A;  2MLG A;  4EJO A;  4A3I J;  4M3E A;  3OYN A;  4IJA A;  5JFR A;  5M5W J;  2K9S A;  3TKY A;  5HLH A;  2LKX A;  3ASO H;  3WE3 A;  3L7W A;  3HPH A;  2DXI A;  5ICE A;  4ZDL A;  4AU7 A;  5LHH A;  1MJ9 A;  2VQG A;  5TGT A;  1MBH A;  3J7Y J;  1BC8 C;  4M9S A;  2Y2Z A;  2VE9 A;  2W82 A;  1UFM A;  2CV2 A;  3ABT A;  4N9H A;  2R7T A;  3FF5 A;  1YIT I;  2IP2 A;  3N97 A;  4E6K G;  3QOD A;  4J00 A;  2HFH A;  1SD4 A;  3GW2 A;  4I0B A;  1FYM A;  4D5C A;  2E1M C;  2K3P A;  4I0A A;  5D8K B;  4A3E J;  4ZDO A;  1Z91 A;  4IKF A;  4I2O A;  4KIB A;  3RSN A;  4LK0 F;  1OCO H;  3TO9 A;  1JKQ C;  1P4W A;  2A61 A;  1RES A;  2F5F A;  3BTJ A;  2F5V A;  3H35 A;  4RGS A;  3FHZ A;  2D45 A;  1STZ A;  3LMM A;  5E8I A;  4MHG A;  5KHD A;  1ETQ A;  3I71 A;  2OAZ A;  1XCV A;  3S3M A;  2I10 A;  1TWC J;  4B4C A;  1GUU A;  5F0H A;  2LKP A;  3F8M A;  1QGP A;  2L7F P;  4DYC A;  2NVQ J;  6PAX A;  4HZF A;  1JGS A;  1OLT A;  3ZMZ A;  4JP0 A;  2D1V A;  1SVM A;  1JT0 A;  4EJV A;  2ZC2 A;  4BL0 B;  4CXF A;  3FZV A;  3ZN1 A;  5D6F A;  3BJ6 A;  5FRM A;  4EGY A;  1XGM A;  3O8H A;  2LOO A;  2TCT A;  2Y31 A;  1UHS A;  1ZLK A;  4RMN A;  3S16 J;  3CCJ I;  3IH4 A;  1YFH A;  1DU6 A;  4IEJ A;  3JCU C;  3IP4 B;  1R36 A;  1E3O C;  3RPU D;  2X6Y A;  4ZYH A;  3DFG A;  2ZFW A;  5HOD A;  1UJ8 A;  2A5W A;  2CMP A;  1Y1V J;  5IOZ A;  2QQB A;  2LY9 A;  4W97 A;  3E6M A;  5HS9 A;  4XSZ F;  4B3X A;  4EMS A;  2E5Z A;  3OYE A;  4GRI A;  5BQT A;  4D7N A;  1F5T A;  2VOD A;  2K9N A;  1YX3 A;  5B66 C;  3BPV A;  4M3F A;  4V2G A;  1Z7U A;  1Z21 A;  3CME I;  1LDK B;  2DOD A;  3ZXS A;  5H6Q A;  5DM7 F;  4HBL A;  1MNM C;  3NEU A;  2COM A;  3RCO A;  3V42 A;  5K7Z A;  1F9N A;  5LGT A;  3CCV I;  1S5L C;  3MWM A;  3MEX A;  3WTY C;  4KIT B;  2JQ7 A;  4ZZL A;  1WH5 A;  1HW5 A;  4BU2 A;  1YOV B;  2W1O A;  2M4K A;  3NAU A;  4AUX A;  3FMS A;  4DBQ A;  4AIJ A;  3HGG A;  4LIV A;  3T8R A;  2QEN A;  2EPF A;  2IAI A;  5F27 A;  2IA2 A;  4QPO A;  3F8N A;  3HOY J;  4GO1 A;  2FQ3 A;  2MFZ A;  3PSF A;  2OQG A;  2ZJR F;  5DUI A;  1YJW I;  1BW5 A;  1Z6R A;  1H8A C;  4XKV A;  4BY7 J;  2A3S A;  2L01 A;  3RQ4 A;  1LKX A;  2IBD A;  2ETH A;  2KJB A;  2WA0 A;  3DQV C;  2L5Q A;  3IH3 A;  2V1U A;  2HI3 A;  5LLQ A;  1R1T A;  2G7U A;  1R1V A;  3P9K A;  1AU7 A;  4M3D A;  3HOU J;  1PVE A;  3HXL A;  1YRN A;  3S3O A;  2KRF A;  1E0E A;  4II2 A;  1R23 A;  3VYR B;  4NB5 A;  2PLY A;  5JHF A;  3ZMD A;  4DW6 A;  2CW8 A;  2XAQ A;  4G9Y A;  2O5R A;  2VT3 A;  1RIO H;  5CQG A;  1HW2 A;  2OTL I;  1EH8 A;  3KP6 A;  3KET A;  3ABK H;  2ZNY A;  1EH6 A;  2IXS A;  4PGG A;  5GTI C;  1P2F A;  1D1B A;  3OR2 C;  3WTU C;  2JTV A;  3CJR B;  1KU2 A;  1JUM A;  1TLH B;  1W5C C;  3CCR I;  2PMH A;  2EV6 A;  5DCM A;  3GTJ J;  2X48 A;  3CUQ A;  2GLO A;  1MMS A;  4FAS D;  2YR2 A;  4MQV A;  1JT6 A;  4I09 A;  4MTE A;  1UMQ A;  3D5S C;  4E4H A;  2OA4 A;  4BQO A;  1YJN I;  1I39 A;  2GQQ A;  3FM5 A;  2C6Y A;  1YIO A;  1IXC A;  3HKZ A;  3DU6 A;  3BG9 A;  4XLP F;  3OS0 A;  1QRY A;  2XGC A;  3SFZ A;  3VYS B;  2JUC A;  4BXX J;  2EZL A;  4MIM A;  2BVM A;  3FXL A;  1VF9 A;  1XGO A;  2WV0 A;  4Z2Y A;  4XRM A;  4U0W A;  4HEA 2;  2E7X A;  2ZXW H;  4EJW A;  1I27 A;  4DNC A;  4EJT A;  3K7A J;  2XAH A;  3ERE D;  5L3G A;  1FX7 A;  5K7F A;  3ZGK A;  2MGQ A;  2VC0 A;  3PQJ A;  1BR2 A;  1IN4 A;  4HV5 A;  2ELK A;  1TQP A;  1J9I A;  1U5T A;  2VOP A;  1RRJ A;  3GZ6 A;  1QO0 D;  2DN0 A;  3H92 A;  1XGN A;  3V7S A;  4B44 A;  1X1D A;  2IW5 A;  3JRH A;  2IS2 A;  2LRD A;  3K4K A;  3TQN A;  2EA4 A;  2DTR A;  3U21 A;  1EV7 A;  4R1H A;  2JSP A;  5FGM A;  2GXG A;  2Y0S N;  4I98 B;  1XMK A;  4XMY A;  1F43 A;  4ABZ A;  5CPR B;  5EDN A;  5BOX A;  4LJZ F;  5EG0 A;  2W84 A;  2L7Z A;  1FP1 D;  3CCY A;  2AO9 A;  2DI3 A;  5FO5 A;  2M1B A;  4KN4 X;  4S05 A;  2VQH A;  5JR3 A;  2Z5U A;  2R7F A;  4DYQ A;  5HVQ C;  2DFH A;  3A02 A;  1FSE A;  2F5C A;  3DP7 A;  2DU9 A;  4M6Y A;  2P6S A;  4U7B A;  3RDI A;  2QYO A;  1JTY A;  1KON A;  2ZCW A;  5KK1 A;  1KU7 A;  1QHH D;  2K9M A;  1HKS A;  1T39 A;  3KIO A;  2HDC A;  1BN5 A;  2DQR A;  4EVI A;  1RKW A;  5DTD A;  3HUG B;  4BE2 A;  1QVT A;  1RUO A;  2P8T A;  3S1R J;  1WSU A;  4QPQ A;  2VUM J;  2K4J A;  1J7K A;  5AIQ A;  2HQ5 A;  3HRS A;  2V9K A;  3H0D A;  3GEZ A;  2MAB A;  4UNO A;  5HNH A;  2CUE A;  1ON2 A;  2K85 A;  2NS0 A;  2FEZ A;  3HOX J;  4LGW A;  1D5Y A;  4L9J A;  2L7M P;  3I5U A;  1SD7 A;  2NOJ B;  5D5W B;  5J1Y A;  2Q2E A;  3BJO A;  3HHH A;  3JTG A;  2KJC A;  3CTA A;  1U6G A;  1FOX A;  1MMN A;  3N4M A;  4M72 A;  4E7Z A;  3C2G A;  5D5U B;  2HTJ A;  2XPV A;  4ITV A;  2F6C A;  2MSY A;  3ABL H;  2DA3 A;  3BG6 A;  2XC7 A;  3ZCO A;  3HHG A;  4G6T B;  1WQ2 A;  5F64 A;  1J5Y A;  5LGN A;  3ESW B;  3IC7 A;  2KMU A;  3L1P A;  3PSI A;  3OYB A;  3I4P A;  4IHW A;  3HJE A;  2L4A A;  2MD0 A;  3AL0 B;  2EIM H;  1W0U A;  3ZQF A;  4LLL A;  2XRN A;  4I99 C;  2O9L A;  2JVG A;  1BA5 A;  4R79 A;  2AHQ A;  3HOT A;  4B47 A;  1P7J A;  2JRM A;  3KLO A;  5DCF A;  2OC6 A;  3K10 A;  3VFZ A;  4B8X A;  2VPR A;  4FX0 A;  3CF2 A;  4AM3 A;  1O7F A;  2DMQ A;  5TIS C;  3ZMT A;  3JAM Z;  3FK7 A;  4BQQ A;  5L3F A;  2LY1 A;  2WBM A;  4L0Y B;  2EQR A;  1K7A A;  3ZQG A;  3RKQ A;  3IL2 A;  3CCU I;  2F4M B;  1FOK A;  3TMO A;  4P9U A;  4CCL A;  2HQA A;  2O6G E;  2VQC A;  2X6O A;  1JJ8 C;  5FB2 A;  2EIL H;  3O3K A;  2PG4 A;  4BE1 A;  3E6C C;  2K9Q A;  1AKH A;  4FE7 A;  2FOK A;  3PM1 A;  2JT1 A;  5HLT A;  1K78 B;  1IG7 A;  4WXD A;  5DCM B;  1KGS A;  3CUQ B;  5FLX K;  1LEA A;  3OL4 A;  2FF4 A;  1GVJ A;  4IOA F;  2EIK H;  2HPM A;  1FPQ A;  4Y33 A;  4A3M J;  2ESN A;  4ZYG A;  4M6V A;  1YS7 A;  1J75 A;  2K4B A;  2EFN A;  2KIF A;  4OOI A;  2X1D A;  4I6Z A;  2R7X A;  5L3B A;  2D1H A;  2QUF A;  1LQ1 A;  2KHM A;  2VJ4 A;  2W7N A;  3S2H J;  1MD0 A;  2CW7 A;  3I59 A;  2O8K A;  1XX5 A;  1S8N A;  3OL3 A;  4EEF G;  1TNT A;  3DV8 A;  1MGT A;  2VC1 A;  4LOC A;  1JKR C;  5HDK A;  3GFL A;  2M30 A;  4D7M A;  1T08 B;  3EDP A;  5HNF A;  3L2R A;  2HS5 A;  3OSG A;  5ICG A;  2LC2 A;  2P81 A;  2GOM A;  3M8F A;  5BNG A;  4C3I J;  1BOB A;  4QIW N;  1L0O C;  1KYZ A;  4Q47 A;  3V7R A;  1RC9 A;  5LRR A;  5K7H A;  4E7S A;  2GZW A;  3P7N A;  2EA2 A;  2UXX A;  2V1N A;  1YHQ I;  3GCM A;  2KIQ A;  3A2K A;  1QA6 A;  5LBQ A;  1HCR A;  2P0W A;  2FML A;  2O8X A;  1CF7 B;  3J80 Z;  4Y4R A;  3I55 I;  5CYV A;  2IT0 A;  3KE2 A;  3SEZ A;  3QOP A;  4HNT A;  3NQO A;  2LRE A;  2YSR A;  1JKP C;  4A93 J;  3ZR8 X;  4QSH A;  2F48 A;  3DPT A;  3J7A O;  1DGW Y;  5B3S H;  1LVA A;  4MO7 A;  3GTG J;  2MYS A;  4ENN A;  3HM5 A;  1T8I A;  4KN7 X;  2Y9Z A;  4FQG A;  1ETK A;  4BQA A;  5KAF C;  3OYJ A;  1O3R A;  1ZRC A;  3OV8 A;  1B72 A;  2Y9Y A;  2KL4 A;  2XGX A;  2ZSI B;  3JRG A;  2D5V A;  4OAZ A;  5K5R A;  2KFD A;  1FIA A;  1JHH A;  4N4N B; 
#chains in the Genus database with same CATH homology
 2O3F A;  4CGZ A;  1YLF A;  1J0R A;  1F4K A;  3WTV C;  2G7H A;  2HGC A;  3C18 A;  4RS8 A;  4ETS A;  1FNN A;  2ZNZ A;  3TDZ C;  3BRO A;  4L9T A;  1JXS A;  5L3D A;  1IUY A;  4N0B A;  2RVC A;  1SMT A;  1G3Y A;  2LNB A;  3GFI A;  2VBX A;  4AWX B;  2WWY A;  1WKM A;  3KCC A;  3EYI A;  4XLN F;  1IRF A;  4QWQ A;  3V4G A;  1HSJ A;  3ISP A;  3I58 A;  1RNL A;  2BYV E;  2HR3 A;  1DPU A;  3QPH A;  4A5N A;  3EET A;  1TTY A;  2H6B A;  1IAW A;  5ILS A;  1ZLJ A;  5E1Z B;  3WGI A;  2XAS A;  4UVA A;  2O61 A;  1QZZ A;  2GIV A;  2CFX A;  2XRO A;  3QP6 A;  5D5X B;  3MQ0 A;  4OIO F;  1SAX A;  2FMY A;  2QLZ A;  3BDD A;  4ENK A;  3EQL F;  4RB0 A;  3FX3 A;  5E20 A;  4LMY A;  3QU3 A;  4HDV A;  2QWW A;  3VB2 A;  1ZN2 A;  3IRQ A;  2FNA A;  4ASN A;  3BZ6 A;  3J81 Z;  4XBF A;  2KIU A;  1LEB A;  3F72 A;  3DXJ F;  2GXB A;  1SFE A;  2HYF A;  3W6K B;  3RKW A;  1BI0 A;  4M74 A;  4AD9 A;  3ZMS A;  3F8C A;  4BHB A;  2P4W A;  1ONV A;  3PQK A;  2FRH A;  3GZ5 A;  3CUO A;  2XV4 S;  3WTT C;  4LB5 A;  2VBY A;  3G3Z A;  4OU0 A;  4Y15 A;  3RYP A;  1YW7 A;  2ACJ A;  2IRF G;  2P5L C;  2EFQ A;  2EFW A;  3GLX A;  3V8K A;  1O3S A;  1QQI A;  2XVC A;  3GWZ A;  4M9Z A;  1ZRF A;  3ABU A;  2VBW A;  3LST A;  2UZK A;  2STT A;  1BOA A;  1W5S A;  1X3U A;  4G6D A;  4MTD A;  1LDJ A;  3TDU C;  3FXQ A;  2P5K A;  2DPD A;  5TRD A;  3FMQ A;  3FMR A;  1LJ9 A;  1HKQ A;  1VTN C;  4RGU A;  3B02 A;  1HQC A;  4L0Z B;  4HX4 A;  4EGZ A;  5EEH A;  2X4H A;  3CDH A;  3OOP A;  3LQR A;  1DUX C;  2RKH A;  1IRG A;  4EQQ A;  4A6E A;  3PFI A;  3TOA A;  3CLO A;  1ZG5 A;  1B6A A;  4RB3 C;  5K5O A;  1YS6 A;  2E1C A;  3IWZ A;  2FXA A;  3QRF F;  4IHS A;  1KA8 A;  4EJU A;  2XHK A;  3NRV A;  2DBB A;  3HUG A;  1ZG1 A;  4L9N A;  3P9I A;  3LA7 A;  1YO5 C;  4QLC U;  2MD5 A;  5H6R A;  1S29 A;  5TJJ A;  3E5Q A;  3L2C A;  4LB6 B;  1YTY A;  4ZYD A;  4IPA A;  5AON A;  2VON A;  1MDM A;  1V4R A;  1H0M A;  1ZRD A;  4D0P A;  4U88 A;  3CO7 C;  2EFP A;  5D6E A;  4RGX A;  1V3F A;  3T5X A;  3GX4 X;  2RV8 A;  1G4D A;  2RQP A;  1O3T A;  3F6O A;  3VEP A;  5LEJ A;  5KVR A;  4M71 A;  4MEY F;  1PDN C;  4N9I A;  2VE8 A;  4KMU X;  1FLI A;  2MH9 A;  3I0T A;  3KLN A;  3F23 A;  2VN2 A;  5JI6 A;  2BGC A;  2PI0 A;  2KKO A;  1SMY F;  5D4S A;  1FBQ A;  3SXY A;  1FYL A;  1K6O A;  2MH2 A;  3TGN A;  3LA2 A;  5IT3 A;  5FFZ A;  1K78 A;  3I64 A;  3Q9V A;  5BMZ A;  3CUQ C;  4TV7 A;  3M8E A;  4HQM A;  1OPC A;  2NYX A;  3EUH A;  3U9G A;  2HOE A;  4UV9 A;  5FLX Z;  1SFU A;  1HXD A;  4LD5 A;  4FX4 A;  4XSX F;  4G7O F;  4O3M A;  5D4R A;  4UV8 A;  2Z3Y A;  2Y75 A;  3ELK A;  2YU3 A;  1TNS A;  2IJL A;  5BPD A;  2RGV A;  4BH9 A;  1U5T C;  3R4K A;  3Q5F A;  2LDU A;  2NNN A;  4HQE A;  3ECH A;  1CF7 A;  1DDN A;  2H09 A;  2XKO A;  4JQF A;  2PN6 A;  1JHH A;  4K2E A;  3FM3 A;  2HWV A;  1ODD A;  1IN8 A;  2EWN A;  3WTS C;  2YX7 A;  1UCR A;  2OU2 A;  2PQ8 A;  3BWG A;  2DFI A;  5IT9 K;  2YPR A;  1P6R A;  1R58 A;  1BBY A;  5LRS A;  4A6D A;  4F7Z A;  2HKO A;  5F6F A;  4HF0 A;  2CSO A;  3M9A A;  2MBF A;  3U2R A;  1MJA A;  1J59 A;  2J5P A;  2BBY A;  1P92 A;  2JPB A;  1MDM B;  1R7J A;  1GHC A;  3T1B A;  3H3Z A;  3HSR A;  4HX7 A;  2F5E A;  3WGH A;  2CG4 A;  1I5Z A;  2RC4 A;  3WG9 A;  2L4M A;  4P9F A;  5K5Q A;  4LLG F;  3RPU A;  1BJA A;  4KMF A;  4U7D A;  5LHI A;  4L5I A;  1YG2 A;  3T0Y A;  2P6T A;  5L3C A;  2HTS A;  5A2Q K;  2V1X A;  1UST A;  1C0W A;  1R5H A;  2IPQ X;  3V7C A;  4HLY A;  3IRR A;  2M5W A;  2W24 A;  3R0J A;  3E3V A;  3WTZ A;  1XN7 A;  1LDD A;  2BE5 F;  1KU9 A;  1U78 A;  3MCZ A;  2LF8 A;  2DT5 A;  3ZQ7 A;  4OMZ A;  4IF4 A;  4WCG A;  2ISZ A;  4ZZD A;  4L9V A;  3IWF A;  4IRH A;  3ECO A;  3GYH X;  4H0E A;  2W85 A;  4CHU A;  4Y17 A;  2Z99 A;  3K69 A;  1FBU A;  1O3Q A;  5JVT A;  3KP3 A;  3HIF A;  5HLI A;  3JSP A;  4Y13 A;  5E17 F;  2OZ6 A;  3BPX A;  5ERI A;  5ILU A;  2JSC A;  2CYY A;  4S04 A;  4PDK A;  2A07 F;  3R6S A;  3CJN A;  1RI7 A;  4U0Y A;  5K1Y A;  2DQL A;  2QBY A;  3IKV A;  2GWR A;  2ESH A;  3WTX C;  4KNY A;  4ON0 A;  1IZ1 A;  2R3S A;  3DKW A;  2FNP A;  2JPC A;  4O6J A;  3RJP A;  4KIC A;  5ED4 A;  4JBA A;  4BHC A;  3WU1 B;  4CYD A;  1U3E M;  4IXA A;  1IXR C;  1G3W A;  3FXR A;  3BY6 A;  2Y48 A;  2Z9O A;  2OZU A;  1ZAO A;  2XUB A;  3AAF A;  4ENJ A;  3WGG A;  3SZP A;  4UVC A;  2UWM A;  4M6X A;  4YII A;  1GXP A;  1KQ0 A;  1XSV A;  3IKT A;  4Q5S F;  4UUV A;  4RB2 C;  2FBH A;  2WC2 A;  1H9G A;  2LF7 A;  3KP4 A;  2DPU A;  4RAZ A;  3TO6 A;  4YG2 F;  1LNW A;  5E1W A;  4A2U A;  3I54 A;  4E70 A;  2NNY A;  2RDP A;  1B59 A;  3L09 A;  5H20 A;  2E7W A;  2Q8K A;  3B73 A;  1W4M A;  1F1Z A;  5CVV A;  4KDP A;  3K1N A;  2NAZ A;  2VOO A;  1KQ8 A;  4BXU A;  5CLS A;  4M73 A;  4HF1 A;  4MEX F;  3RKX A;  2A5Y B;  2M8E A;  2H6C A;  3JSO A;  4CZZ A;  1FSH A;  3E6B A;  1O7L A;  4UXN A;  3K1M A;  3R61 A;  4HAM A;  4YFK F;  4BNC A;  3COA C;  2QZ8 A;  3KP2 A;  4KFC A;  3SQN A;  3ULQ B;  2ZJ2 A;  2B0L A;  1IF1 A;  1BM9 A;  3ZMU A;  2VBZ A;  2PEX A;  1MJB A;  1TW3 A;  3I53 A;  3K1P A;  5FD6 A;  4AIK A;  2H27 A;  1W7P D;  4IVN A;  2JRT A;  3HRT A;  1R22 A;  1JE8 A;  4WXC A;  1R5G A;  1Y0U A;  2PJP A;  2EK5 A;  4ENM A;  2ZO4 A;  1FZP B;  2V9V A;  2MLK A;  2ZBK A;  3ROU A;  2HKX A;  5DDG A;  2OQR A;  5CVU A;  4ESB A;  3HRM A;  1S7A A;  1TBX A;  3QAH A;  3HTS B;  2DK5 A;  1T38 A;  4AIH A;  5BS6 A;  4LG0 A;  1BC7 C;  4OIP F;  1HKT A;  3C1D A;  1RZ4 A;  2HQN A;  1I1S A;  3E5X A;  1BIB A;  2XAJ A;  2QBY B;  2V79 A;  3O2P E;  2BV6 A;  2ZME A;  4OMY A;  1D3Y A;  2O03 A;  1XDU A;  2ZKZ A;  5HDN A;  4UVB A;  4B09 A;  3EYY A;  1XCB A;  4GYI A;  3ZN0 A;  4Q4Z F;  2PMU A;  1OYW A;  2A6H F;  2EV0 A;  1UB9 A;  5CVR A;  2F2E A;  2A6E F;  3RI4 A;  1CGP A;  4YIF A;  3LAJ A;  5DEQ A;  2M87 A;  4RGR A;  4ZYE A;  1H9T A;  4I01 A;  4KUM A;  4HA8 A;  1B9M A;  1UHM A;  1R00 A;  1S7O A;  2H94 A;  4PZJ A;  3F6V A;  3DPL C;  3QU6 A;  1E2X A;  4WX9 A;  1J2X A;  1WRJ A;  2EFO A;  1Z05 A;  3REO A;  1GXQ A;  1ZRE A;  1IN7 A;  3HRU A;  4NHJ A;  1YW9 A;  4IRG A;  3D5L A;  3WOD F;  2XAF A;  3GO5 A;  3ML6 A;  2FA5 A;  3QPT A;  1NHA A;  1TW2 A;  2W25 A;  1KU3 A;  2O0Y A;  2W57 A;  3D0S A;  5D5V B;  1QZY A;  1P4A A;  4G7Z F;  4AVP A;  2XIG A;  1FY7 A;  1XSX A;  2DK8 A;  4KT5 C;  5IT9 Z;  1IN6 A;  5HS7 A;  2DW4 A;  4RB1 A;  1EH7 A;  2K7L A;  2BEO A;  3IHU A;  4G8X A;  2EJR A;  3KP5 A;  2L02 A;  2P7V B;  1D8J A;  4A0X A;  3ZP5 A;  3HSE A;  4L18 B;  3J81 K;  2CWE A;  1XMA A;  2L54 A;  5HDG A;  3KZY A;  2AS5 F;  3JTH A;  4LLN A;  4ESF A;  1Z6T A;  1ON1 A;  5ICC A;  3K2Z A;  4LG0 B;  3KZZ A;  3ZMV A;  5A2Q Z;  1W7P A;  1B4A A;  3R0A A;  1HBX G;  4A5M A;  4HYE A;  5LEK A;  4I7H A;  4GCV A;  1PP8 F;  4IHT A;  4JK1 X;  3C3W A;  2ZME B;  4OIN F;  5ILV A;  1UHW A;  1WWX A;  2J5O A;  4G6Q A;  1KQ9 A;  1MZB A;  2XKP A;  1XDS A;  2FE3 A;  3VOE A;  3FXU A;  3M1E A;  4A0Z A;  2JZY A;  3CO6 C;  5J8F A;  2ISY A;  3GFM A;  4CIC A;  1W5T A;  3R60 A;  4HLX A;  3TOB A;  2K02 A;  5AIP A;  2WTE A;  3C7J A;  1U2W A;  4KA4 A;  1ZHF A;  5L3E A;  2CGP A;  1Z9C A;  3RTR A;  3T8T A;  3E5U A;  1RUN A;  4MNU A;  1ZGJ A;  4PGH A;  5ICF A;  1SD6 A;  2Y0M A;  5JHU A;  2OD5 A;  1B1B A;  5D8L B;  1Z1D A;  1L3L A;  1PP7 U;  3MZH A;  4KIF A;  2Z33 A;  4UHT A;  3WE2 A;  2QVO A;  3KEQ A;  3LA3 A;  4BYY A;  5LHG A;  3V8J A;  1P4X A;  1ZH5 A;  5DD8 A;  1AWC A;  4LFU A;  2F5D A;  4WWC A;  3U1D A;  2GAU A;  2QQ9 A;  2EV5 A;  2OBP A;  4L5J A;  4BHP A;  1IW7 F;  3W6J B;  5J8C A;  1YW8 A;  3V8L A;  3BOQ A;  1D8K A;  2IVM A;  1DPR A;  2NRA C;  3S2W A;  2QM3 A;  5EEG A;  3LAP A;  3GUD A;  3LQQ A;  1FWZ A;  4M9X A;  2HEO A;  3Q9S A;  1OMI A;  3G73 A;  3P9C A;  1YYV A;  4EV0 A;  1G3S A;  1MKM A;  3L00 A;  4HW0 A;  1OKR A;  4LK1 F;  1XB4 A;  4P5O A;  2IA1 A;  4WK8 F;  4GYG A;  5DV5 A;  1S3J A;  2DO7 A;  4HDU A;  3FWE A;  3F21 A;  1FP2 A;  2PBI A;  3BP8 A;  3DF8 A;  3RKY A;  2VXZ A;  3RIR A;  4R8H A;  4A0Y A;  1W7P B;  1K79 A;  1REP C;  1I6X A;  4ESJ A;  2TDX A;  1BIA A;  2P5V A;  4DQ2 A;  1S6L A;  4GXO A;  5J6X A;  4BAY A;  1QBJ A;  4CO8 A;  1FC3 A;  3SHF A;  1ZYR F;  2ZXJ A;  1OYY A;  4A12 A;  1B9N A;  2KIM A;  2FSW A;  1T2K A;  3GVA A;  1BI1 A;  4G7H F;  3F8F A;  1IXS B;  2HYG D;  3F8B A;  2D2W A;  4OIR F;  2DLL A;  2M45 A;  4EM2 A;  4FHT A;  4HF2 A;  5HS8 A;  2GA2 A;  4NQW A;  1DP7 P;  4U0V A;  2V1D A;  4WXH A;  3SZT A;  2R7D A;  3GXO A;  3F22 A;  3LFK A;  1WI9 A;  4OIQ F;  1U5T B;  3L9F A;  2G9W A;  1KYW A;  4EM1 A;  2V6C A;  1Q1H A;  3MAJ A;  1FYK A;  1QNT A;  1LB2 A;  3WTW C;  5FD5 A;  1AOY A;  3LWF A;  2FBI A;  3RPQ A;  1G6N A;  2RNJ A;  2CQK A;  2MA3 A;  3HOS A;  1BI3 A;  4YFX F;  1ULY A;  2YX4 A;  3ZPL A;  5F1R A;  4ZH4 F;  2E1N A;  3KEO A;  1OYI A;  5BPI A;  2MC3 A;  3E97 A;  3HTU A;  3VOD A;  3F3X A;  4KIG A;  3K9T A;  1FT9 A;  3O6B B;  5DUK A;  3MFK A;  1PUE E;  1U8R A;  2CW0 F;  2L3D A;  1ZG3 A;  1USS A;  2STW A;  4GGG A;  5CJ9 A;  1T0F A;  2FU4 A;  3BJA A;  2Q0O A;  1XGS A;  1TQM A;  4G94 A;  3JW4 A;  2P7C B;  1D5V A;  4IRI A;  1G3T A;  5E1X A;  2A68 F;  4YFN F;  3H3U A;  3HYI A;  2GA1 A;  1A04 A;  1SFX A;  2AXL A;  4Q48 A;  1HW1 A;  3JAM K;  4HX8 A;  4FT8 A;  1OR7 A;  3K0L A;  2A69 F;  1QPM A;  4RAY A;  5LGU A;  3QP5 A;  1YQA A;  2ELH A;  5CVJ A;  2RN7 A;  2K86 A;  3GFJ A;  3DEU A;  1T6S A;  1HST A;  1FBS A;  4XRF A;  4MGR A;  2ADU A;  2CO5 A;  3E6D A;  4EM0 B;  3GF2 A;  4WF2 A;  1T98 A;  1R1U A;  5E18 F;  1JHF A;  2VT2 A;  1IN5 A;  2X0L A;  3KFW X;  1BI2 A;  5FFX A;  5DD4 A;  1ZGA A;  3KP7 A;  2K27 A;  2EB7 A;  1E17 A;  2FBK A;  1SD5 A;  4HOB A;  5HLG A;  4MQ9 F;  2IA0 A;  3HSF A;  2HZT A;  3M7G A;  3TO7 A;  5HOO A;  4P55 A;  5CVI A;  1XSD A;  3I59 B;  4I02 A;  1XD7 A;  1ZAR A;  4O5V A;  2PFB A;  2QQA A;  2UXN A;  1TQI A;  1O57 A;  4KYW A;  3WU0 A;  5E8G A;  3J80 K;  2DAO A;  2LSO A;  4P96 A;  1I1G A;  2XAG A;  4HV6 A;  4PCQ A;  3MZY A;  2HQR A;  5DYM A;  4CDG A;  2MLG A;  4EJO A;  4IJA A;  5JFR A;  3TKY A;  5HLH A;  3WE3 A;  3L7W A;  5ICE A;  5LHH A;  1MJ9 A;  1BC8 C;  4M9S A;  2VE9 A;  1UFM A;  3ABT A;  4N9H A;  3FF5 A;  2IP2 A;  3N97 A;  2HFH A;  1SD4 A;  3GW2 A;  4I0B A;  1FYM A;  4I0A A;  5D8K B;  1Z91 A;  4I2O A;  4KIB A;  4LK0 F;  3TO9 A;  1P4W A;  2A61 A;  2F5F A;  4RGS A;  3FHZ A;  2D45 A;  1STZ A;  5E8I A;  4MHG A;  3I71 A;  2OAZ A;  1XCV A;  2LKP A;  3F8M A;  1QGP A;  6PAX A;  4HZF A;  1JGS A;  3ZMZ A;  2D1V A;  4EJV A;  4CXF A;  3FZV A;  3ZN1 A;  5D6F A;  3BJ6 A;  4EGY A;  1XGM A;  1ZLK A;  1YFH A;  1R36 A;  4ZYH A;  3DFG A;  2ZFW A;  2QQB A;  3E6M A;  5HS9 A;  4XSZ F;  4EMS A;  5BQT A;  1F5T A;  2VOD A;  3BPV A;  1Z7U A;  1LDK B;  5H6Q A;  4HBL A;  3NEU A;  2COM A;  1F9N A;  5LGT A;  3MWM A;  3MEX A;  3WTY C;  4ZZL A;  1HW5 A;  3FMS A;  4AIJ A;  3T8R A;  2QEN A;  2IA2 A;  3F8N A;  4GO1 A;  2FQ3 A;  2OQG A;  5DUI A;  1Z6R A;  2A3S A;  2L01 A;  2ETH A;  2KJB A;  3DQV C;  2V1U A;  5LLQ A;  1R1T A;  2G7U A;  1R1V A;  3P9K A;  2KRF A;  1R23 A;  4NB5 A;  2PLY A;  3ZMD A;  2XAQ A;  4G9Y A;  2VT3 A;  1RIO H;  1HW2 A;  1EH8 A;  3KP6 A;  3KET A;  2ZNY A;  1EH6 A;  4PGG A;  1P2F A;  3WTU C;  2JTV A;  1KU2 A;  1TLH B;  2PMH A;  2EV6 A;  5DCM A;  3CUQ A;  2YR2 A;  4MQV A;  4I09 A;  4MTE A;  2OA4 A;  2GQQ A;  3FM5 A;  2C6Y A;  1YIO A;  1IXC A;  4XLP F;  3SFZ A;  1XGO A;  2WV0 A;  4Z2Y A;  4U0W A;  2E7X A;  4EJW A;  1I27 A;  4DNC A;  4EJT A;  2XAH A;  3ERE D;  5L3G A;  1FX7 A;  2VC0 A;  3PQJ A;  1IN4 A;  4HV5 A;  1TQP A;  1J9I A;  1U5T A;  2VOP A;  3GZ6 A;  1QO0 D;  3V7S A;  3H92 A;  1XGN A;  2IW5 A;  3TQN A;  2EA4 A;  2DTR A;  1EV7 A;  4R1H A;  5FGM A;  2GXG A;  4I98 B;  1XMK A;  5BOX A;  4LJZ F;  2W84 A;  1FP1 D;  2DI3 A;  5FO5 A;  2M1B A;  4KN4 X;  4S05 A;  5JR3 A;  2Z5U A;  2R7F A;  5HVQ C;  1FSE A;  2F5C A;  3DP7 A;  2DU9 A;  4M6Y A;  2P6S A;  4U7B A;  3RDI A;  2QYO A;  2ZCW A;  5KK1 A;  1KU7 A;  1HKS A;  1T39 A;  2HDC A;  1BN5 A;  2DQR A;  4EVI A;  1RUO A;  2P8T A;  1WSU A;  2K4J A;  1J7K A;  5AIQ A;  3HRS A;  3GEZ A;  4UNO A;  1ON2 A;  2NS0 A;  2FEZ A;  4LGW A;  4L9J A;  3I5U A;  1SD7 A;  5D5W B;  2Q2E A;  3BJO A;  3HHH A;  3JTG A;  2KJC A;  3CTA A;  1U6G A;  3N4M A;  4M72 A;  5D5U B;  2HTJ A;  3HHG A;  1WQ2 A;  5F64 A;  1J5Y A;  5LGN A;  3IC7 A;  3I4P A;  2L4A A;  4LLL A;  2XRN A;  4R79 A;  3HOT A;  3KLO A;  5DCF A;  3VFZ A;  4B8X A;  4FX0 A;  1O7F A;  3ZMT A;  3JAM Z;  5L3F A;  4L0Y B;  1K7A A;  3IL2 A;  1FOK A;  4P9U A;  2O6G E;  5FB2 A;  3O3K A;  2PG4 A;  3E6C C;  2FOK A;  2JT1 A;  1K78 B;  4WXD A;  5DCM B;  1KGS A;  3CUQ B;  5FLX K;  1LEA A;  2FF4 A;  1GVJ A;  1FPQ A;  2ESN A;  4ZYG A;  1YS7 A;  1J75 A;  2K4B A;  2EFN A;  2KIF A;  4OOI A;  5L3B A;  2D1H A;  2QUF A;  1LQ1 A;  1MD0 A;  3I59 A;  1S8N A;  1TNT A;  3DV8 A;  1MGT A;  2VC1 A;  5HDK A;  3GFL A;  2M30 A;  3EDP A;  2HS5 A;  5ICG A;  3M8F A;  1L0O C;  1KYZ A;  4Q47 A;  3V7R A;  5LRR A;  2GZW A;  3P7N A;  2EA2 A;  2UXX A;  5LBQ A;  2FML A;  2O8X A;  1CF7 B;  3J80 Z;  5CYV A;  2IT0 A;  3KE2 A;  3QOP A;  3NQO A;  2YSR A;  3DPT A;  3J7A O;  1LVA A;  4ENN A;  4KN7 X;  4BQA A;  1O3R A;  1ZRC A;  3OV8 A;  2XGX A;  5K5R A;  3RYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...