1J9IA

Structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TERMINASE SMALL SUBUNIT
publication title Insights into specific DNA recognition during the assembly of a viral genome packaging machine.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j9iA00
3WTZA 2HZTA 4LB5A 4KFCA 2YR2A 1RUOA 3FHZA 4LLLA 1FYKA 3HRTA 1EH8A 1MJ9A 3M7GA 4KIBA 5F1RA 4S04A 2HOEA 4BNCA 5F6FA 2XGXA 1U5TB 2KIFA 4G6DA 2A69F 2DK8A 2ZCWA 3KEOA 5BS6A 4WWCA 4LLNA 5LHGA 1QO0D 1BN5A 1DPUA 4HW0A 2ESHA 1ZGAA 1XB4A 4EGYA 4O6JA 4G9YA 4G6QA 5EEHA 2J5OA 2QYOA 1LB2A 5ICFA 3TO6A 4HAMA 1R1VA 4Q5SF 3GF2A 2OQGA 3HYIA 2XROA 2VC1A 1YIOA 3HOTA 1HKTA 1R1TA 3ABTA 4LG0A 2L3DA 3ECHA 1ZLKA 1P4WA 4ESFA 4ZH4F 1J9IA 5DDGA 3S2WA 4AIKA 3ULQB 3SXYA 2H27A 2CSOA 4DNCA 4WCGA 3I64A 2EFWA 1ZGJA 3V7CA 2ZFWA 4HA8A 2NRAC 2PG4A 1PP7U 3LAPA 5K5RA 2PEXA 3QPHA 1BJAA 4YFNF 1ON2A 2EB7A 4I01A 3K0LA 1HKQA 3U9GA 3HUGA 1TBXA 2XVCA 3V7SA 2BV6A 2GQQA 1OMIA 2Y48A 4AVPA 4EQQA 2F5CA 1S29A 3WODF 2DQLA 3E5XA 4CO8A 1Z9CA 5HOOA 2P7CB 1HW5A 2UZKA 3KFWX 3ISPA 4UHTA 3I58A 1B4AA 2MBFA 5FO5A 2STWA 4ZYHA 5FFXA 1LDKB 5ED4A 1R36A 2QVOA 4KMFA 3LWFA 2XHKA 2FA5A 2VOOA 2DTRA 5D4RA 1QNTA 1P4AA 4M9XA 3AAFA 3L2CA 4I09A 5LGTA 1FY7A 3F72A 4G94A 4GYGA 3MEXA 2O03A 2NNYA 4ETSA 3VEPA 1YO5C 2Q8KA 1GVJA 2FE3A 4HLXA 3TOBA 2ZBKA 5LGNA 4M6YA 3I4PA 1I27A 2FNAA 2J5PA 5FD5A 4ENJA 4Y13A 4JK1X 5HDGA 1K7AA 5D6EA 4HX4A 2F5EA 4L0YB 3KLNA 2OBPA 1XDUA 2VE8A 1XSXA 1UHWA 3W6JB 1UFMA 2A6EF 5ICCA 1B6AA 4ESJA 2CFXA 4NHJA 5D5XB 4PZJA 1L0OC 4L9VA 2VC0A 1HW2A 5LGUA 3T0YA 2GA2A 3J81Z 2Z33A 2HGCA 4UVBA 4L9JA 4MTEA 3ABUA 3HRUA 2H6BA 1B9NA 1J75A 4IHSA 1R5GA 4JBAA 3P9IA 3TGNA 3GWZA 3ERED 1KYZA 2ACJA 1T0FA 2W85A 4BXUA 1MJAA 2WWYA 5CYVA 2MH2A 5L3DA 2PMHA 4OINF 3G73A 4FX0A 1GXPA 2YSRA 4EV0A 5FLXZ 3BPVA 3ZPLA 1LEAA 1TQMA 2CW0F 3BJ6A 1LDJA 1K79A 1IN8A 1Z1DA 3PQJA 4FT8A 2BBYA 3FXQA 3KP6A 1KU9A 2RQPA 4L9TA 1K78A 1G4DA 2PJPA 2ETHA 2MA3A 1B1BA 4RGSA 2PBIA 3WGIA 1S7OA 1SMYF 4MEXF 1WKMA 4S05A 1BBYA 3HTUA 3F8MA 5L3GA 4WXDA 4I0BA 4U88A 2GXBA 1HSJA 1R00A 2QZ8A 3EYYA 2VBYA 2XAFA 2HYGD 1J2XA 3LQRA 4LMYA 2ZKZA 1MJBA 4A6DA 1P4XA 1J5YA 4MQVA 4ZZLA 4G8XA 1IAWA 3BJAA 3QPTA 5TRDA 1KA8A 3TO7A 1YYVA 1R1UA 4UXNA 1PP8F 2P7VB 1ZLJA 3GYHX 3HSRA 3LQQA 2QLZA 1FT9A 4UVAA 4A6EA 2PN6A 1OR7A 2KIMA 2IPQX 2TDXA 4XSZF 2K02A 2VBWA 4HOBA 1ZHFA 1BI0A 3QU3A 4YIIA 3FM5A 1QZZA 1K78B 3EETA 4PDKA 3F6OA 3V8JA 1Z05A 4WXCA 4LGWA 1D3YA 1WWXA 2A68F 3B73A 4HV6A 4RAZA 1ZG1A 1IN6A 4I7HA 1C0WA 3R61A 1XGNA 4D0PA 3LFKA 5L3BA 3RKWA 2OQRA 2IA1A 2K7LA 4O5VA 4MNUA 5BPIA 2M30A 4WX9A 1ON1A 3EQLF 2VT2A 3KLOA 1JE8A 1QQIA 2A6HF 2W84A 3D0SA 4HF1A 1FP2A 4ZZDA 5D5WB 2XAHA 1DP7P 3HSFA 1REPC 2FF4A 5D5VB 4R79A 3KP2A 1UCRA 1UHMA 3JAMK 4A5NA 1YFHA 1YW9A 4NQWA 1MDMA 4WF2A 2MC3A 2RKHA 4UVCA 1ZARA 4BHCA 3M8EA 2XRNA 2QBYB 1G6NA 1TW3A 5ICGA 3ML6A 4F7ZA 4LK0F 1FBUA 1O7FA 1U8RA 2ELHA 4XRFA 2QWWA 3GZ5A 4EGZA 4HX8A 3ZN0A 2VBXA 3FXRA 3SQNA 3CUQC 3C18A 2JT1A 1E17A 3L09A 4G7ZF 4U0YA 3QOPA 2C6YA 1QZYA 2HQRA 1CGPA 2HFHA 3KE2A 3CUOA 3E3VA 2KIUA 4A0ZA 2IA0A 5IT9Z 3RDIA 3C1DA 3GFLA 2F5DA 4L9NA 3HHHA 3RYPA 1PUEE 1ZYRF 1R58A 1PDNC 1W7PA 3RJPA 4YIFA 3MFKA 4ENKA 2STTA 2HQNA 5HS8A 1BI1A 5CJ9A 2WTEA 2W24A 1DDNA 3E6MA 2UXXA 3BP8A 3IWZA 4RGRA 2ZMEA 1MDMB 5E8GA 3KZZA 3N4MA 4AIJA 2VT3A 2XAGA 5AONA 1OKRA 1WQ2A 2COMA 2ADUA 4XLNF 2Y0MA 2PLYA 3Q9VA 5E1XA 1LEBA 3RIRA 4UUVA 4I0AA 1DUXC 5FLXK 2W57A 3GFJA 5DD4A 1MKMA 2HS5A 4Q48A 1YQAA 2XAJA 5AIPA 4WK8F 1FBQA 3J80K 4RB2C 3RYRA 3FZVA 6PAXA 1MGTA 3DPTA 3QRFF 3V8KA 3WGGA 4AWXB 4EJOA 2H94A 3BOQA 4B09A 4EJUA 1FYMA 1ZAOA 4M71A 2DBBA 1W7PB 1SFUA 1QGPA 2ISZA 5J6XA 3F21A 5K5OA 4A0XA 2EV6A 2M45A 4UNOA 2FSWA 2ZMEB 4XLPF 2V1UA 2R3SA 3K1PA 3M8FA 2HEOA 1TNTA 3GVAA 1U3EM 3ECOA 3I0TA 1BI2A 5BMZA 2F2EA 3M9AA 2M5WA 1S6LA 2JTVA 1V3FA 2XV4S 1T39A 4HDUA 2IT0A 2X0LA 4OIQF 2O61A 1BI3A 3T5XA 2E7XA 4RGUA 3B02A 4G7OF 2DU9A 4FHTA 4BAYA 3O3KA 2V9VA 5ICEA 4ZYGA 2GA1A 2RGVA 3U1DA 1RIOH 2DT5A 5LHIA 3NEUA 4EJWA 5ERIA 2E7WA 4YG2F 1IW7F 1V4RA 2VXZA 4MGRA 2XIGA 5A2QZ 4HF0A 3QP5A 4CGZA 4E70A 4CXFA 2D45A 1RNLA 3JSOA 1B59A 4L0ZB 2HYFA 1KQ9A 5JHUA 1TTYA 2VODA 3R4KA 4A12A 2HTJA 1O7LA 1IF1A 5HLHA 4U7BA 2IVMA 4HLYA 2VE9A 2YX4A 1FPQA 5E1WA 4B8XA 1OPCA 4RB1A 3ZMSA 5LLQA 4RAYA 3COAC 1IXSB 5E20A 4KYWA 1SFXA 5E18F 2DPDA 2P8TA 1Z91A 3GUDA 5H6QA 4I98B 3GZ6A 1OYYA 1QPMA 3K69A 5DV5A 3VODA 3DXJF 4N9HA 1SMTA 1LVAA 5DCMB 1Z6RA 3HSEA 3KZYA 2VBZA 4EM0B 3WTTC 4LD5A 2QQ9A 1XCVA 2Z9OA 3DV8A 3I59B 4RB3C 3T8TA 4IRGA 2ESNA 4HV5A 1U2WA 3F8CA 1U5TC 1TLHB 5JVTA 1WRJA 2RN7A 3MZYA 2DFIA 3I5UA 2M87A 1LDDA 1OYWA 4U0VA 5ILUA 2A61A 2H6CA 2B0LA 4HQMA 4L18B 3F3XA 5KK1A 2LDUA 2CO5A 1AWCA 1STZA 2BYVE 1SD6A 1F9NA 2JRTA 3R0JA 2NNNA 3IKVA 5D4SA 2L01A 1F5TA 3KCCA 5LHHA 2FMLA 3U2RA 1ODDA 4IJAA 3V4GA 2BE5F 3F6VA 4HDVA 3IHUA 1CF7A 2DO7A 2EFNA 5LBQA 3I54A 4P55A 1ULYA 3ZMUA 3K2ZA 2HKOA 2HWVA 4Q4ZF 3WU1B 5EEGA 2UXNA 3ZMVA 2FNPA 2KKOA 5JI6A 1USSA 1Q1HA 3CJNA 1IN7A 3P7NA 1XSVA 4KUMA 3E97A 3LA2A 3WU0A 4WXHA 1G3WA 4N9IA 1YG2A 3KP5A 4AIHA 3C3WA 3H92A 2M1BA 3R0AA 1KU7A 1HQCA 3N97A 1FYLA 1KQ0A 2NAZA 5JFRA 4HQEA 4A5MA 1IUYA 4IPAA 3EDPA 3BDDA 1NHAA 3H3ZA 1J0RA 4IRIA 3E6BA 2YX7A 1LQ1A 4MTDA 1CF7B 1T98A 3EUHA 2VOPA 2QBYA 4ENNA 4CHUA 1FOKA 1QBJA 3C7JA 2MH9A 2LSOA 5BOXA 1FP1D 3K1MA 3GEZA 2OA4A 3MQ0A 1O3QA 3G3ZA 2LKPA 1YS7A 3R6SA 2VONA 4OOIA 1FZPB 5CLSA 2KJCA 4IRHA 4QLCU 3DFGA 2FOKA 4KICA 2ZO4A 3LSTA 3MWMA 4AD9A 3RI4A 5HS9A 1WSUA 3CO6C 1YLFA 2EFQA 1UB9A 2BGCA 4RGXA 1A04A 1L3LA 3WTSC 5DUKA 2FQ3A 3M1EA 3GO5A 2AS5F 4HBLA 2OD5A 1RZ4A 4LB6B 4CZZA 2DLLA 3P9CA 3VOEA 4M9ZA 2V1XA 2EV0A 5D8KB 4M73A 1SFEA 1Y0UA 5HDKA 2K86A 4HYEA 2E1CA 2P5VA 4CYDA 1XGOA 2UWMA 2OAZA 2NS0A 1JGSA 1EH7A 1XD7A 2IA2A 4LJZF 2EJRA 2XKPA 2OZUA 5BPDA 4H0EA 1H0MA 3JW4A 1IXCA 4ASNA 4YFKF 2DPUA 3KP4A 2D1HA 3F8NA 2O0YA 1I6XA 2O6GE 5J8FA 4GO1A 1D8JA 3OV8A 4ZYDA 4P9FA 4HF2A 2JPCA 2MLKA 2Z3YA 1Z7UA 1FC3A 2OU2A 4Y15A 1G3SA 1FSHA 3J81K 3F8FA 4MQ9F 2X4HA 3KP7A 2ZNZA 2W25A 4XSXF 2CG4A 4XBFA 4QWQA 3TO9A 5HS7A 4U0WA 1YTYA 1R5HA 4O3MA 3GX4X 3ELKA 4M6XA 4OMZA 4HZFA 2EK5A 4N0BA 1O57A 4PGHA 1BC7C 1P92A 1Z6TA 4PCQA 2F5FA 2Q2EA 1AOYA 2QQBA 3BY6A 1ZRFA 5ILSA 1R22A 4BH9A 3ZN1A 1E2XA 4ENMA 3E5UA 4R8HA 4OMYA 3IWFA 1TW2A 2L02A 5FGMA 1HW1A 3T8RA 2HDCA 4RB0A 3Q9SA 1EV7A 2GAUA 4BHPA 4IVNA 4MEYF 1K6OA 1MD0A 3T1BA 4FX4A 5JR3A 2P5LC 1XDSA 3P9KA 1SD7A 5LEJA 3WTVC 5DYMA 1IRGA 5E17F 1XSDA 3WTUC 1G3YA 2CQKA 2FEZA 2WV0A 3O6BB 3R60A 5D8LB 4M72A 4L5IA 2JPBA 2IJLA 3JSPA 2EA4A 3ZMZA 4A0YA 2LNBA 2YPRA 3FM3A 1R7JA 1J7KA 3K9TA 3CLOA 3E6DA 3GFMA 4KDPA 3VFZA 2D2WA 4LK1F 1F4KA 1W5TA 3HTSB 4LLGF 4A2UA 1XN7A 2L4MA 3DF8A 5E1ZB 1T38A 2HR3A 4GYIA 2RDPA 2FXAA 3QAHA 4K2EA 4PGGA 3DP7A 4EMSA 1S3JA 4Z2YA 3BJOA 3ZQ7A 3IL2A 3PQKA 3WG9A 5E8IA 1FNNA 1HXDA 1D8KA 1TNSA 1T6SA 3L7WA 1FWZA 2HKXA 2A5YB 2P5KA 2QQAA 4LFUA 3VB2A 4DQ2A 3RKYA 4ESBA 1FSEA 1XMAA 1J59A 3BROA 2DI3A 3V7RA 3WGHA 1RI7A 4EM1A 3TKYA 2ZXJA 4CDGA 4I2OA 2RNJA 3K1NA 4KIFA 5HDNA 1SD4A 1I1GA 5DCMA 5LRRA 5TJJA 3MCZA 2H09A 3DQVC 4EM2A 5KVRA 5DD8A 3WE3A 3I59A 2E1NA 4LG0B 1O3SA 3DPLC 3GXOA 3GLXA 2FRHA 1SD5A 4TV7A 2Y75A 4EVIA 1OYIA 1LJ9A 2FBKA 1BOAA 2WC2A 5F64A 5K1YA 1EH6A 5HLGA 1I5ZA 3ZMDA 1SAXA 3REOA 3JTGA 3V8LA 3Q5FA 2EWNA 3ROUA 4BHBA 4GXOA 3E6CC 2P6SA 4KA4A 3FWEA 2EFOA 2DK5A 3F22A 1U6GA 1ONVA 3TDZC 3F8BA 4OIRF 3JAMZ 2A3SA 4BYYA 4KT5C 3CUQA 4Q47A 2OZ6A 5HLIA 1ZRCA 2ZNYA 1ZRDA 1B9MA 1IZ1A 1XCBA 5LRSA 3WTWC 4OIOF 4IXAA 1HBXG 1WI9A 3PFIA 5FD6A 2L4AA 2MLGA 1JXSA 3SZPA 3H3UA 4CICA 3KEQA 2M8EA 1MZBA 1FLIA 3KETA 2JSCA 3WTYC 2KJBA 2PQ8A 2VN2A 1KYWA 5IT9K 1ZH5A 3BZ6A 2IP2A 3GW2A 3O2PE 1IN5A 5L3EA 1XMKA 1R23A 1KU3A 4P96A 3CO7C 1YW7A 1W5SA 2QM3A 2CYYA 4G7HF 5D6FA 5FFZA 2YU3A 4MHGA 4OIPF 4ON0A 1JHFA 3IKTA 3F23A 4M74A 3IRRA 1P2FA 3SZTA 2FU4A 1BC8C 1W4MA 2FBHA 4KN7X 5DEQA 3D5LA 4KNYA 2QENA 4GGGA 4YFXF 2BEOA 1LNWA 3L00A 1S7AA 3HOSA 3CUQB 1BM9A 3CTAA 3BPXA 2PFBA 1H9GA 2IW5A 2RVCA 3L9FA 3QU6A 2LF8A 2PI0A 2K4BA 1X3UA 3DEUA 1USTA 1W7PD 2O3FA 4EJTA 2XUBA 3TOAA 3J80Z 2RV8A 4L5JA 4ZYEA 2G7HA 1KQ8A 1ZN2A 2D1VA 2QUFA 4NB5A 1XGSA 2AXLA 3MZHA 3FMQA 5CVRA 3BWGA 2PMUA 3RTRA 3WE2A 2K27A 5FB2A 4UV9A 2ZJ2A 3WTXC 3NQOA 5CVJA 5L3FA 1YS6A 2R7FA 1ZG5A 3FF5A 4RS8A 4IHTA 3IC7A 2LF7A 4OU0A 4BQAA 2K4JA 1D5VA 2GWRA 1YW8A 2ISYA 3W6KB 2G9WA 1FX7A 3EYIA 2Q0OA 2XAQA 5CVIA 2V6CA 5J8CA 3I53A 1HSTA 3J7AO 2DW4A 4JQFA 2O8XA 2HTSA 4I02A 4P9UA 2P6TA 1BIBA 2GXGA 5CVVA 1DPRA 3RPUA 3MAJA 2XKOA 5DCFA 3FMSA 1F1ZA 2EA2A 2V79A 1GXQA 3HRSA 3FXUA 1G3TA 5L3CA 1ZG3A 3QP6A 3RPQA 2EV5A 2V1DA 2Z99A 2A07F 3TDUC 5A2QK 5IT3A 2JZYA 2GIVA 1S8NA 1O3RA 3OOPA 5H6RA 1ZREA 3SFZA 3I71A 2GZWA 5BQTA 3NRVA 4EJVA 4GCVA 3ZP5A 2RC4A 5H20A 2FBIA 3FMRA 3E5QA 4HX7A 1T2KA 4Y17A 5CVUA 4P5OA 4KMUX 1TQPA 2DQRA 4KIGA 1JHHA 3RKXA 1RUNA 1VTNC 2DAOA 3CDHA 3IRQA 1BIAA 5D5UB 3LA7A 3KP3A 1KU2A 2EFPA 1IXRC 4U7DA 2L54A 1FBSA 5HVQC 1U5TA 5LEKA 2KRFA 2MD5A 4UV8A 3ZMTA 3FX3A 1IRFA 3GFIA 5AIQA 5K5QA 3LA3A 3TQNA 3HIFA 2NYXA 1H9TA 2CGPA 2FMYA 5DUIA 2R7DA 1I1SA 3LAJA 2Z5UA 3HHGA 1GHCA 3JTHA 4KN4X 1IN4A 1XGMA 2CWEA 3HRMA 2IRFG 1KGSA 1P6RA 4IF4A 2XASA 1U78A 5ILVA 4M9SA 4R1HA 2G7UA 1TQIA 1O3TA 2P4WA 1HKSA 3SHFA 3DKWA
chains in the Genus database with same CATH superfamily
3WTZA 4B44A 2V9PA 5FROA 3CMYA 4LITA 2HZTA 2EILH 3HPGA 4X6AJ 4LB5A 2IBDA 4KFCA 2YR2A 2DA3A 1RUOA 4RMNA 3FHZA 4LLLA 1OCPA 1FYKA 3HRTA 3ONQA 3ZGKA 3ZR8X 5FKLA 1EH8A 1MJ9A 3M7GA 3UKGA 3GTLJ 3ASNH 4KIBA 5F1RA 4S04A 4C30A 2HOEA 3U21A 3S1QJ 1MBJA 4BNCA 5F6FA 3VYUB 1R4NB 2XGXA 1U5TB 2KIFA 2K9MA 4G6DA 2CRGA 2A69F 3GLLA 2DK8A 2ZCWA 1Y8QB 4D5FA 3AFHA 2CUFA 3KEOA 5BS6A 3BG7A 4WWCA 4LLNA 5LHGA 4UB6C 1QO0D 1X58A 1BN5A 4II2A 1DPUA 3L2UA 4HW0A 2ESHA 4M6VA 5EJCA 1ZGAA 1XB4A 5E3NA 4EGYA 4O6JA 1FEXA 4G9YA 3S8PA 3CD6I 3K7AJ 4G6QA 2DMPA 4FASD 5EEHA 2J5OA 2QYOA 1LB2A 3OYEA 2EPFA 3BTIA 2KQRA 1WJFA 1APLC 5ICFA 3FXOA 1TC3C 2K9SA 1IC8A 3TO6A 4HAMA 1SFOJ 1R1VA 1XTAA 2V4JC 4Q5SF 2L9RA 5EDNA 3GF2A 2OQGA 2A05A 2BY0A 3HYIA 2V26A 2XROA 3GMEA 2VJJA 2VC1A 1YIOA 3HOTA 3M3YJ 3ZQCA 1HKTA 1R1TA 2E1OA 3ABTA 1X1BA 3QPSA 4LG0A 2L3DA 3ECHA 2JVHA 1ZLKA 3S14J 1P4WA 2QKMB 4UY8I 3MKYB 4ESFA 5EGOB 1ZK8A 4BEHB 2V9KA 4ZH4F 1A5JA 1X2MA 4HSRA 1J9IA 3CC4I 5DDGA 4A3DJ 3S2WA 4AIKA 1UZCA 3WU2C 3ULQB 2XPWA 3SXYA 4C3JJ 3PSFA 1TWCJ 2KDOA 2E35A 2MYSA 2CSOA 4XRSA 2H27A 4DNCA 5K7HA 4WCGA 3LSJA 2M2EA 3I64A 2EFWA 1VI0A 2E60A 3IH4A 2WA0A 1ZGJA 3BR5A 2ZFWA 4HA8A 3V7CA 2NRAC 2PG4A 5CQEA 3A4CA 3TP0A 2H8WA 3CCYA 3LAPA 3L2QA 5K5RA 1M1EB 1PP7U 2DFFA 2PEXA 2RNGA 1Y1VJ 3QPHA 5EZHA 1BJAA 3HKZA 4DIQA 3IAS2 4OAYA 4YFNF 1ON2A 2EB7A 2HOAA 3Q0UA 4I01A 4BJTA 3K0LA 1HKQA 3U9GA 2JVGA 3HUGA 2Z16A 1TBXA 2XVCA 2HZDA 2NVTJ 3V7SA 2BV6A 3M07A 1WHUA 2CQNA 2GQQA 1OMIA 1A6IA 2ID6A 2Y48A 2BHZA 4LIUA 4AVPA 3CC7I 4EQQA 2VB6A 2F5CA 1S29A 3WODF 3CCUI 5GAHJ 2DDBA 2NVXJ 2DQLA 3E5XA 1YI2I 2IGKA 2DCEA 4XK4A 4KITB 1VQPI 3AG1H 2X6OA 3OYIA 4CO8A 1Z9CA 5HOOA 2P7CB 4CUGA 3DTKA 1HW5A 2UZKA 3KFWX 2LY2A 3ISPA 4UHTA 3I58A 4N4NB 1B4AA 2MBFA 2KFDA 4XKCA 5FO5A 2STWA 4ZYHA 5FFXA 1LDKB 1W5CC 5IOZA 5ED4A 2E2IJ 1R36A 3EUHC 4PFOA 1K83J 2QVOA 2DT6A 4KMFA 3LWFA 1I3QJ 2XHKA 2FA5A 4C3IJ 3AL0C 1OCRH 2VOOA 2DA6A 2DTRA 5D4RA 4W97A 2DYSH 3FBIB 1QNTA 1P4AA 4M9XA 3AAFA 3L2CA 3HOVJ 2X48A 4I09A 5LGTA 1FY7A 3F72A 4G94A 4GYGA 3K6GA 1QHHD 1VNDA 3MEXA 2O03A 1D0YA 2WY7Q 1VZ0A 2L2OA 2HI3A 2NNYA 4ETSA 3VEPA 1YO5C 2Q8KA 1GVJA 2R7VA 2FE3A 4HLXA 3TOBA 3RPUD 4BS9A 2ZBKA 5LGNA 4M6YA 3I4PA 1I27A 2FNAA 1BR2A 4EATA 2ECCA 2J5PA 1JKQC 1WH7A 3HUGB 1HC8A 5FD5A 4ENJA 4RLFA 4CCOA 4Y13A 4JK1X 5B3SH 5HDGA 2A6TA 1K7AA 5D6EA 2BW3A 3OYJA 2IS6A 4HX4A 2OTLI 2F5EA 1FIPA 4L0YB 4XR6A 3KLNA 2B7EA 2OBPA 1K4SA 1XDUA 2CW7A 2VE8A 1XSXA 1UHWA 3W6JB 1IRZA 1TWHJ 1UFMA 1VQ9I 2HXOA 4XIDA 4XLAA 4IQJA 5TISC 1QRYA 2A6EF 4F93B 3BG6A 1B6AA 5ICCA 2LKSA 2VJ4A 4ESJA 2CFXA 1MH4A 2HQAA 3ZQFA 3NAUA 2K85A 4G12A 4IZZA 1X3WB 4NHJA 2VXDA 5D5XB 1D5YA 1NG6A 4PZJA 1L0OC 4L9VA 2VC0A 1HW2A 2VJIA 3OSGA 3H0GJ 5LGUA 3T0YA 1X2NA 4HEA2 2GA2A 4FE4A 3J81Z 2Z33A 2HGCA 1LFPA 2IEKA 4QIWN 1LUJB 4UVBA 1PVEA 3RZOJ 4L9JA 1MW7A 1UJ8A 4MTEA 3ABUA 2X9DA 3HRUA 4BQOA 3RQIA 2H6BA 4CYCA 1B9NA 1GUUA 1J75A 4IHSA 2XAUA 3CQZJ 1R5GA 4JBAA 3B6AA 3P9IA 3TGNA 3ASOH 4BJ5C 3GWZA 4MFEA 3ERED 4BL0B 4CCKA 3BG5A 4XQFA 1KYZA 2ACJA 1T0FA 2W85A 1RC9A 4BXUA 1MJAA 3TMOA 2WWYA 1K6YA 1Y6IA 1F43A 4J19A 4XLHA 3BR6A 5CYVA 5JHFA 1IRXA 1SVOA 2MH2A 5L3DA 3BCAA 2BW3B 2WBMA 3SDBA 3AG4H 2PMHA 4OINF 3BR1A 3G73A 2VUMJ 4FX0A 3H5NA 4LG3A 3ZOBA 1GXPA 2YSRA 3ZCOA 3IH3A 4CZCA 2DMQA 2R7RA 3KYDB 1U8BA 2CQ7A 2XB5A 4ABZA 4EV0A 5TGTA 5FLXZ 1HOMA 3BPVA 3ZPLA 1LEAA 2JUCA 1V5GA 1TQMA 1X1PA 2CW0F 3BJ6A 2KDZA 2V6EA 1LDJA 1K79A 1IN8A 1F36A 1RETA 1Z1DA 5GPCA 3PQJA 4FT8A 2BBYA 3FXQA 3KP6A 2LFBA 1KU9A 2OF7A 3OYBA 2RQPA 1WJAA 4L9TA 1K78A 2HVRA 1AOYA 2R7UA 3S17J 1ACIA 1UMQA 5E3MA 1G4DA 2PJPA 2ETHA 4IEJA 2FUG2 2MA3A 3HKZN 1B1BA 1LE8A 3DTEA 4RGSA 2PBIA 2R7OA 1Z7LA 1VQOI 3WGIA 2VKHA 1S7OA 2R7QA 1SMYF 3CCMI 3G1LA 4MEXF 4CYCB 1WKMA 5FRNA 1ITYA 1WPKA 4S05A 1BBYA 3HTUA 3F8MA 5L3GA 4WXDA 1EKEA 4I0BA 4U88A 1ETWA 2GXBA 1HSJA 1R00A 2QZ8A 3EYYA 1ZQ3P 2L5QA 2VBYA 2XAFA 2HYGD 3VYRB 1J2XA 3LQRA 4LMYA 3K4BA 2ZKZA 1MJBA 4A6DA 1P4XA 1U9NA 2WB1A 5GADJ 1J5YA 4MQVA 3GCMA 4BACA 2MSYA 4ZZLA 4G8XA 1IAWA 3BJAA 1OFCX 3QPTA 5TRDA 1KA8A 3TO7A 3ZRGA 5EG0A 1YX5A 4XOPA 2R4GA 4GRIA 1TL8A 1YYVA 1R1UA 4UXNA 1PP8F 1NTCA 4Y33A 2P7VB 1ZLJA 3GYHX 3LSPA 3HSRA 3LQQA 2QKLB 2QLZA 2BXZA 2MW8A 1FT9A 4UVAA 3DBRB 4A6EA 1TT0A 2PN6A 2ZJQF 1OR7A 3FK6A 2KIMA 2IPQX 5J1YA 3ESWB 2TDXA 2E2JJ 4XSZF 2K02A 2VBWA 1X1DA 4HOBA 4RM3A 1ZHFA 1BI0A 3QU3A 4YIIA 2XF5A 3FM5A 1QZZA 3MKZA 5C4JJ 1JUSA 3KYLA 1K78B 3EETA 4PDKA 3F6OA 3V8JA 2A5WA 2QCOA 1Z05A 1LE8B 2WADA 4WXCA 1B8IB 4QPQA 1E0EA 5HNFA 4LGWA 3E7LA 1D3YA 1X3ZB 1WWXA 2A68F 3G6EI 3B73A 3GTPJ 4CH7A 3HBLA 4HV6A 4A69C 4RAZA 2OUMA 1ZG1A 2HXIA 1IN6A 4I7HA 1D1CA 1I3AA 1C0WA 3R61A 1XGNA 4D0PA 4YIRX 3LFKA 5L3BA 3RKWA 2OQRA 1AHDP 2IA1A 2K7LA 2QA4I 4O5VA 2P0WA 2VIXA 4MNUA 2BXYA 5BPIA 2M30A 2L9NA 3A01B 4WX9A 1ENHA 1ON1A 2W82A 3EQLF 2VT2A 2CS3A 3KLOA 2E1MC 1JE8A 1QQIA 1SAUA 2A6HF 2XGEA 5EG0B 2OCCH 2W84A 3D0SA 3AKZA 4HF1A 1WI3A 1FP2A 4ZZDA 2MFZA 4UUSB 5D5WB 2XAHA 1DP7P 3S2HJ 3HSFA 1REPC 1V55H 1GDTA 2FF4A 1D1AA 5D5VB 4R79A 3KP2A 1N75A 3BG9A 3M1CA 1UCRA 1UHMA 3CCSI 3JAMK 4A5NA 1ZR4A 1YFHA 1YW9A 4NQWA 1MDMA 4WF2A 2CH0A 2MC3A 2RKHA 4W1UA 4BDYA 4UVCA 1ZARA 4BHCA 4BY7J 4ZYAA 4D1QA 4CA0A 1VQKI 3M8EA 2XRNA 2F4MB 3GTGJ 1FTTA 2QBYB 3AL0B 1VQ6I 5FKKA 2EH3A 1G6NA 1TW3A 2K9LA 3ZQGA 5ICGA 2R92J 3ML6A 2MD0A 4F7ZA 4LK0F 2K9NA 1FBUA 1O7FA 1U8RA 2ELHA 4XRFA 4DGWB 1GLNA 4OWRB 3CCJI 2XSDC 4E7LA 1IV6A 2QWWA 3GZ5A 2VPRA 1HCRA 4EGZA 4HX8A 1LKXA 2OC6A 3K10A 3ZN0A 2VBXA 3FXRA 3UR3C 3JRBA 2Z1DA 3SQNA 3O8GA 3CUQC 3LSMA 5F0CA 3C18A 2JT1A 1E17A 3GZNB 3L09A 4G7ZF 2HVQA 3QOPA 4U0YA 3KEYA 3OS0A 1QZYA 2HQRA 1CGPA 2C6YA 2HFHA 2QGUA 2HU9A 3CUOA 3E3VA 3KE2A 4U87A 4XLFA 2KIUA 2DYRH 2DDAA 1QU3A 4A0ZA 3D5SC 4ZC3A 2IA0A 5IT9Z 2IGNA 3BR2A 3RDIA 3C1DA 3GFLA 1Z67A 2F5DA 4BQNA 4L9NA 3HHHA 3H9QA 3RYPA 1PUEE 1ZYRF 1R58A 1PDNC 1W7PA 3RJPA 4YIFA 3IAM2 1LFUP 3MFKA 4ENKA 1JJ8C 5CQGA 2STTA 2HQNA 3GTKJ 5HS8A 2AQEA 5IY5H 2EZKA 5DTDA 1BI1A 5CJ9A 3MMYB 5B1BH 2WTEA 2W24A 1DDNA 2XF6A 3E6MA 5K7FA 2UXXA 3AG2H 3BP8A 3IWZA 5FLVA 4M3DA 3PO2J 4RGRA 1P9QC 2ZMEA 4NQWB 1MDMB 2LLKA 2CQQA 2M8GX 2EIMH 5E8GA 3KZZA 1Y8RB 3N4MA 2H8RA 4AIJA 2CUZA 4C2TA 4DOZA 1ZTRA 2UV1A 2VT3A 2XAGA 4PUSA 5AONA 5IP9J 1ETXA 4BY1J 1OKRA 1WQ2A 4QSHA 2R7TA 2EZLA 2COMA 2WAQN 2ADUA 4QPOA 5FLMJ 1JKRC 4XLNF 4F3QA 1QVUA 2Y0MA 2PLYA 3OIPA 3IV5A 4XKWA 3Q9VA 2L9VA 2IS1A 1UHSA 5H2FC 5HODA 5E1XA 1LEBA 3RIRA 4UUVA 2P81A 4I0AA 4C9YA 1DUXC 5FLXK 5E79C 2W57A 2WB1N 3GFJA 1MMGA 3CESA 1MKMA 2DN0A 2HS5A 5DD4A 5HNHA 1MMNA 4Q48A 1YQAA 2XAJA 5AIPA 2WAEA 3EPZA 4WK8F 1FBQA 3J80K 4RB2C 3RYRA 2QF7A 5F08A 2OTJI 3OYKA 1G8XA 3FZVA 2IAIA 3GBGA 2DODA 1ETQA 6PAXA 1JI8A 1MGTA 2E36A 3DPTA 3QRFF 2KL4A 2LD5A 3V8KA 3WGGA 1Z3YA 2TCTA 4AWXB 3BCBA 1W0UA 4EJOA 2H94A 3BOQA 3QYBA 3SZGA 4B09A 2CJJA 4EJUA 1ZAOA 4M71A 1MH3A 3SFIA 1FYMA 3SDGA 2DBBA 1T8IA 1W7PB 1LVKA 3PNVA 1MIJA 4PJMA 4EEFG 1SFUA 1QGPA 1UELB 2ISZA 1HA8A 2O7OA 3I56I 2M7BA 1UG0A 5J6XA 3F21A 5K5OA 4A0XA 1X1AA 2EV6A 2M45A 3JRCA 4UNOA 3DPUA 5B5EC 2QSFX 2R7WA 1WJDA 1PUFA 2FSWA 1MBEA 3HGGA 2ZMEB 3K70C 1IDZA 4XLPF 3TEDA 2V1UA 3JCUC 2WAFA 2R3SA 4D7MA 3K1PA 3M8FA 2HEOA 2GM4A 1TNTA 3GVAA 2KT0A 4B3AA 1U3EM 4HNVA 3CLQA 4PSWA 2R7ZJ 5FKNA 3ECOA 4BU2A 3I55I 3OL3A 2Q2EB 2HOTA 3HOUJ 3CF5F 4DZPA 1T33A 4XLCA 3I0TA 2V7FA 1BI2A 3K70D 3D1NI 5BMZA 2MC4A 2VI6A 2F2EA 3M9AA 1VQ7I 1NH3A 1WJBA 2M5WA 4A3MJ 4JP0A 4E7JA 1S6LA 2JTVA 1V3FA 2XGCA 2XV4S 3H36A 1T39A 4HDUA 2IT0A 1DP3A 2X0LA 2JWTA 4ANJA 4OIQF 1GV2A 2BY1A 3VYTB 3DEWA 3LL7A 2O61A 1BI3A 1HDDC 2KMUA 3MKWB 4PSXA 3T5XA 2KISA 5M5WJ 1H89C 4B43A 3ZQIA 2H1LA 2E7XA 2NVYJ 3VSLA 4RGUA 3B02A 4G7OF 2DU9A 2JUGA 3JREA 1R71A 4D5CA 4FHTA 2GIZA 4BAYA 3O3KA 2V9VA 5ICEA 4ZYGA 2L7KA 2GA1A 2RGVA 2K3FA 3JRIA 3U1DA 2NXNB 1RIOH 2DT5A 2M4GA 4H4KC 5LHIA 3NEUA 4EJWA 1SEUA 1QPIA 5J4VA 5ERIA 2E7WA 4YG2F 3F9KA 1IW7F 1UG2A 1V4RA 4IX7A 4UB8C 1EA3A 3KZIC 1FOYA 1PYVA 2VXZA 4MGRA 5F0FA 5C44J 2XIGA 3S1RJ 5A2QZ 2YS9A 2PX9A 3TW6A 3E1SA 3H9GA 2K3PA 2YUSA 4HF0A 3QP5A 4CGZA 3HG9A 3OS2A 1PUFB 1FOXA 4E70A 4CXFA 3LSHA 2ZFUA 3KYCB 3L2VA 2D45A 2KHMA 1RNLA 4AUXA 3JSOA 3VSKA 4F52A 1B59A 4L0ZB 3HDDA 3PNTA 3S32A 1A35A 3JRDA 2HYFA 1KQ9A 5JHUA 1TTYA 2VODA 3R4KA 3M4OJ 4A12A 2HTJA 1O7LA 3TP3A 1IF1A 1YHQI 4BBRJ 5HLHA 4U7BA 2IVMA 4HLYA 3WHBA 2M7AA 3VYSB 1OISA 3OR1C 4DJAA 2VE9A 1A36A 1MMSA 2YX4A 1FPQA 2VKDA 4NUBA 5E1WA 3CMEI 3A0BC 4B8XA 1OPCA 2KPMA 4RB1A 3ZMSA 2PJRA 5LLQA 4RAYA 3H5AA 3COAC 3PO3J 1IXSB 5E20A 4KYWA 1SFXA 5E18F 2GXAA 3MKLA 1SANA 2DPDA 1JTYA 2HDDA 2P8TA 3BR3A 4IOCF 1JKOC 1Z91A 3GUDA 3H0DA 5H6QA 2VKEA 3JRAA 1FOWA 1YE9A 2G0EA 4I98B 5JVGF 3CDIA 4CCLA 3H35A 3GZ6A 2NS8A 1OYYA 3SYTA 2AQFA 5EF6A 1QPMA 3K69A 4XL9A 5DV5A 4BJ6C 4HRIA 4HNUA 1ZGWA 1Y39A 2OJED 3SEZA 3VODA 2JJ7A 4N4OB 4F55A 3PUBA 3BG3A 3ZXSA 3DXJF 3RCOA 4N9HA 3K4JA 3MN2A 1OCZH 3LMMA 3M8JA 2DXIA 1SMTA 1LVAA 5DCMB 1BOBA 1Z6RA 1OLTA 4PJNA 4XNFA 3HSEA 3KZYA 2XRLA 3TBIA 1LPQA 3MD2A 2VBZA 4V2GA 4EM0B 3WTTC 2QSHX 3ABKH 2XSJC 4LD5A 2JA5J 2QQ9A 2E71A 3U1KA 1RRJA 4DBQA 1QVTA 1XCVA 2Z9OA 3DV8A 3I59B 4RB3C 4BBSJ 3PL8A 4IHWA 3T8TA 4IRGA 2ESNA 4HV5A 2CV1A 1U2WA 3F8CA 1U5TC 3DLLF 2LC2A 5B1AH 3QWLA 1IDYA 1TLHB 5JVTA 1BW5A 4FETA 1WRJA 2Y31A 2RN7A 3MZYA 2DFIA 3I5UA 3HOYJ 2M87A 1LDDA 1OYWA 1MBGA 2W1OA 3C2HA 3OL4A 3LOCA 4E6KG 4HSTA 1TZLA 4U0VA 2JK3A 4HG2A 4II3A 5ILUA 2EBIA 2A61A 1BA5A 2Y0SA 2R7SA 3J7AY 2H6CA 3O8HA 3ZQHA 2B0LA 1XC5A 4HQMA 4L18B 2PJRB 2JA6J 3F3XA 5KK1A 2LDUA 2CO5A 4A3JJ 1STZA 1AWCA 5GAGJ 2BYVE 1SD6A 1F9NA 2JRTA 2ZC2A 2R5ZA 2BY2A 3R0JA 2NNNA 2B9SA 3IKVA 5D4SA 1YJWI 2L01A 3TW7A 1F5TA 3VWBA 3KCCA 3NARA 5JLXA 4CSWA 1VQNI 5LHHA 4UUTA 2FMLA 4YEJA 3U2RA 1ODDA 1QA6A 4FISA 2HQ5A 2Q1ZB 5J4YA 2VLAA 1IJWC 4IJAA 3V4GA 3QYFA 2BE5F 4D9JA 3F6VA 4RBOA 4HDVA 3ZQQA 4RAFA 4XLEA 3IHUA 3QPLA 1CF7A 3OYDA 1MMAA 2DO7A 2EFNA 1OCTC 1JUMA 3CJRB 5LBQA 1IUFA 4B3XA 1G59A 3I4MJ 3GTMJ 4HNTA 3I54A 3CC2I 2ZSIB 4P55A 5CPRB 4ITVA 1ULYA 1Q1VA 3ZMUA 3K2ZA 2HKOA 3DBHB 4IL6C 2HWVA 2F5VA 2HYJA 2LBFA 1P7JA 3WU1B 4Q4ZF 4JOMA 5EEGA 2UXNA 2Y30A 3ZMVA 5KAFC 1B8IA 2FNPA 1MBFA 2E19A 2KKOA 5JI6A 1USSA 2E34A 2OCEA 4BQQA 2VQLA 2VL8A 2XC7A 1Q1HA 1VF9A 1R49A 1E3HA 3CJNA 1IN7A 3P7NA 1XSVA 4KUMA 2WAQA 5GPAA 5LD2C 1ZELA 3E97A 1ZR2A 3LA2A 2ICWG 4JYKA 5E3LA 3OMYA 3WU0A 4A3IJ 4A3KJ 4WXHA 1G3WA 2DA7A 1TWFJ 3A01A 4N9IA 1YG2A 3KP5A 3PFYA 4AIHA 4C3HJ 4ZDOA 3C3WA 3H92A 2M1BA 2X6YA 3R0AA 1KU7A 2R5ZB 1HQCA 4ZJZA 3N97A 3HEFA 5KAIC 4Z6YA 4UUSA 2IS2A 4NC7A 1FYLA 1KQ0A 1YRNA 2NAZA 5FKOA 2CV0A 3FKIJ 1MNDA 3OOUA 2B63J 4IHYA 2M9HA 5JFRA 5IYDJ 4HQEA 4A5MA 1IUYA 4IPAA 3EDPA 2R0QC 1I6HJ 3BDDA 1NHAA 3H3ZA 1J0RA 1WJ5A 3LNQA 3E6BA 4IRIA 2YX7A 2ELJA 1FJLA 2I8DA 2VASA 1ORKA 1LQ1A 4MTDA 1CF7B 2O9LA 1T98A 3EUHA 2VOPA 2QBYA 2X51A 5GAEJ 4ENNA 4CHUA 5GTIC 4XOTA 1FOKA 1V54H 3MZ8A 1QBJA 3K4MA 3C7JA 4BXXJ 3DCFA 3HPHA 1FIAA 2MH9A 3P5JA 2VPLA 2LSOA 2BHYA 2HNHA 4NNJA 4IOAF 2JA2A 5BOXA 1HLVA 2LBFB 3OYLA 1FP1D 3K1MA 3GEZA 2H1KA 2OA4A 3MQ0A 1O3QA 3G3ZA 4Y4RA 4IO9F 3OY9A 2LKPA 1YS7A 2CQXA 3R6SA 3EUAA 2VONA 4OOIA 2HOSA 3DU5A 2M4KA 3H9JA 1FZPB 3HGYA 4X1EA 2E5ZA 5CLSA 2UUZA 4BDZA 2KJCA 4IRHA 4QLCU 5IPAA 4PK4A 3CZ6A 3DFGA 2FOKA 1NG7A 1I39A 3I3LA 4KICA 2ZO4A 3LSTA 4E7HA 3MWMA 2W00A 1OCCH 2LYCA 4AD9A 4NC8A 3RI4A 2BVLA 2CUJA 5HS9A 1WSUA 2NVQJ 3G1OA 3BZCA 1JJ6C 3CO6C 1YLFA 2EFQA 1UB9A 3N05A 2BGCA 2HPMA 4RGXA 1A04A 3GTOJ 1G2HA 1L3LA 3WTSC 1YRNB 3FISA 5DUKA 3BZKA 1H8AC 2FQ3A 3M1EA 3OS1A 4PJ0C 4XM3A 3GO5A 4XN0A 2AS5F 4HBLA 2F6CA 2OD5A 1RZ4A 2ECBA 4LB6B 4CZZA 3W2VA 2DLLA 3P9CA 4BE1A 1RPWA 1ZKGA 4XMYA 3VOEA 1V5EA 4M9ZA 3OYGA 3S3MA 1POGA 3WG7H 3FKJA 3X2QH 2V1XA 3CCVI 4CCMA 1SFKA 2Y9YA 2EV0A 5D8KB 1MNEA 4M73A 1SFEA 1Y0UA 5HDKA 2FD5A 2K9QA 3Q0VA 4GDFA 2Y2ZA 2K86A 3BQZA 3KIOA 4HYEA 2E1CA 3QOEA 4A3GJ 2BY3A 1SC7A 5F1JA 2JA7J 2P5VA 4CYDA 1XGOA 2UWMA 2OAZA 3CDLA 1Y56A 3CMMA 2NS0A 3D5RC 2OV7A 1JGSA 1EH7A 4Y7NJ 2Y0SN 3SJMA 1XD7A 2IA2A 4LJZF 2EJRA 1MSEC 2XKPA 1U9OA 1FTZA 4AYBN 5KCMA 1X1CA 1N78A 2OZUA 5BPDA 4H0EA 1H0MA 3PIPF 3JW4A 1IXCA 4ASNA 3BTLA 4YFKF 2DPUA 3A03A 3KP4A 1DU0A 2YU9J 2D1HA 1MBKA 3F8NA 5LFAA 2O0YA 2R93J 1I6XA 2QEXI 2O6GE 5J8FA 4GO1A 1D8JA 3OV8A 1W0TA 4ZYDA 2LKXA 4P9FA 4HF2A 2JPCA 2N8GA 2MLKA 2Z3YA 1Z7UA 3FK7A 3OIOA 1FC3A 2OU2A 4Y15A 1G3SA 3PUFA 1FSHA 3J81K 3B6CA 3F8FA 1LFBA 3QODA 4YRVA 1FMWA 1SVMA 2QQ8A 4MQ9F 1Y1WJ 2X4HA 2DMNA 2DOFA 3KP7A 3HXLA 2QSGX 3SEQA 2KZGA 3S93A 2ZNZA 2R5YA 2W25A 2EINH 4BUPA 4XSXF 4IHVA 2CG4A 2FX0A 4XBFA 4QWQA 3TO9A 5HS7A 4U0WA 1YTYA 1R5HA 3A02A 4O3MA 3GX4X 2CMPA 3ELKA 4FCYA 3CP8A 4M6XA 3W2AA 1WCMJ 4OMZA 2MG4A 4HZFA 2EK5A 5FKMA 1HDPA 3OYCA 4N0BA 1O57A 4PGHA 1BC7C 1P92A 1Z6TA 4PCQA 1GT0C 4B48A 2ZB9A 2DMUA 2F5FA 2Q2EA 1YX3A 1D0XA 2QQBA 3BY6A 2CFOA 3FXMA 4S0HB 4BE0A 1ZRFA 5ILSA 1R22A 4BH9A 4XRMA 3ZN1A 4FTHA 2LREA 1E2XA 2W48A 4ENMA 5C3EJ 3E5UA 4R8HA 2R7XA 4OMYA 4E7ZA 3IWFA 2Y69H 1TW2A 2L02A 4I99C 5FGMA 3DWLE 1HW1A 4AU7A 4OAZA 1Z77A 3DKXA 3T8RA 2XF7A 2O8KA 1E3PA 2HDCA 4RB0A 3Q9SA 1EV7A 2GAUA 4BHPA 4IVNA 4MEYF 5GP9A 2DFHA 2BZTA 3G2BA 1MD0A 5IYCJ 1K6OA 3T1BA 4FX4A 5JR3A 2P5LC 1XDSA 3P9KA 1SD7A 5LEJA 3WTVC 3PJRA 1T0FC 5DYMA 3VDXA 1IRGA 5E17F 2EQRA 1N77A 1XSDA 5IP6A 1YJNI 1UAAA 4KISA 3CMAI 3BLYA 3J7ZI 2HVSA 3WTUC 1G3YA 2CQKA 3UNGC 4G6TB 2FEZA 1B72A 5IP7J 2WV0A 3LSKA 3RSNA 3K4LA 2DJNA 5DS9A 1R4MB 3O6BB 3R60A 1Z3XA 4A93J 5D8LB 4M72A 3DLAA 4NBQA 1JT6A 3K4NA 4L5IA 2JPBA 4A3CJ 2NOJB 1S9HA 2KIQA 2IJLA 4JX5A 3JSPA 3HB9A 1T95A 2EA4A 5KNLA 3HOXJ 5GTHC 3ZMZA 3HZJA 4A0YA 3G1MA 3FHNA 5DM7F 3HOWJ 2LNBA 1VQLI 2YPRA 3FM3A 2MGQA 3HL2A 3QQAA 1TWAJ 2R5YB 1R7JA 1J7KA 3K9TA 2JQ7A 2XPVA 3CLOA 2JMWA 2LG4A 3E6DA 3GFMA 4D7NA 4KDPA 3VFZA 2D2WA 1DU6A 4LK1F 1F4KA 1X4OA 1W5TA 2RQQA 5J1UA 3HTSB 2K5CA 2VQHA 4LLGF 1ETVA 4JX4A 4A2UA 1ETYA 1WFXA 1XN7A 2L4MA 1EF4A 3DF8A 5E1ZB 1T38A 2X6XA 2HR3A 2L7FP 4GYIA 2RDPA 2FXAA 3QAHA 4K2EA 2KLOA 4PGGA 1VFCA 3DP7A 1S3JA 4EMSA 4Z2YA 1WVRA 2X1DA 3BJOA 1XX5A 3FXKA 3LSGA 3ZQ7A 3OWTA 3Q0WA 3IL2A 4MLOA 3PQKA 3WG9A 4BGDA 4A3FJ 2O5RA 1ETOA 1RKTA 5E8IA 1FNNA 1HXDA 1D8KA 1TNSA 3WHCA 1XPXA 1T6SA 2GOMA 3L7WA 5EEAA 1FWZA 4XKVA 2HKXA 1H88C 2A5YB 2P5KA 5F04A 2NS7A 2FQ4A 2QQAA 4LFUA 3VB2A 4DQ2A 3K4KA 4LOCA 3RKYA 4ESBA 4QTRA 2K40A 3W6VA 4A3BJ 1FSEA 3NWTA 4C2UA 2WV1A 1XMAA 2GOXB 4XRSG 3OYFA 1J59A 3JRFA 3BROA 1B72B 2KRCA 2DI3A 3V7RA 3OYHA 4RA2A 3WGHA 1WGXA 1RI7A 2CV2A 4EM1A 3TKYA 1EJ9A 4I76A 2ZXJA 1OJLA 4CDGA 4I2OA 2RNJA 3K1NA 4KIFA 5HDNA 3ZQLA 3LSRA 2VQGA 2LMDA 4ZTJA 1SD4A 3BR0A 1I1GA 5DCMA 2AHQA 5LRRA 5BNGA 2ZSHB 5TJJA 3MCZA 4JX6A 1X19A 2H09A 1K61A 2X6WA 3DQVC 4EM2A 3J7YJ 1IO2A 5KVRA 1MSFC 4MO7A 3DU6A 5DD8A 1OR7C 3WE3A 3I59A 2E1NA 4LG0B 3KPHA 5E3OA 1O3SA 3DPLC 3GXOA 1E3OC 1R9TJ 1JGGA 3GLXA 2FRHA 1SD5A 4TV7A 4IKFA 2LK2A 2M0MA 2IS4A 4GFBA 3S1NJ 2Y75A 4EVIA 1OYIA 2M34A 2LH9A 2HPIA 1LJ9A 5CKTA 2FBKA 1GVDA 1BOAA 2WC2A 5F64A 4XORA 5K1YA 1EH6A 2FJ1A 1NK3P 3IUOA 5HLGA 1I5ZA 3ZMDA 1SAXA 3REOA 3JTGA 3L2RA 2DA4A 3V8LA 3Q5FA 2EWNA 3ROUA 4BHBA 1SVLA 2GLOA 4GXOA 3E6CC 4V19K 1V5FA 2P6SA 4KA4A 4XKBA 2W7NA 3JR9A 3FWEA 2EFOA 2DK5A 3F22A 1N25A 1U6GA 4ZDPA 1ONVA 5K7ZA 3TDZC 3F8BA 1WJCA 4OIRF 1BL0A 4RAGA 3JAMZ 4FQGA 3ABLH 1JT0A 2ME0A 1S5LC 2A3SA 5J47A 4HPQA 4KT5C 4BYYA 4C2MJ 1W36C 3CUQA 4Y52J 1TP4A 4Q47A 1K4TA 5FJ8J 3HJEA 3V42A 2X1CA 4B1RA 2D5VA 4P1WA 2OZ6A 2DJIA 5HLIA 1ZRCA 3L2WA 2ZNYA 2NOGA 1ZRDA 2VJ5A 1B9MA 1DQUA 2Z2SB 1IZ1A 2LY1A 3C2GA 4B4CA 1J09A 1IG7A 3LSIA 1W36D 1XCBA 5LRSA 2ZJPF 3MVPA 2E1MB 3IP4B 2M0CA 4IXAA 1WI9A 4LIVA 3WTWC 1HBXG 4OIOF 1AU7A 1WZ2A 5C4XJ 2LP0A 3PFIA 5FD6A 2L4AA 2L7ZA 2MLGA 3FXJA 1JXSA 3JRGA 3SZPA 3H3UA 4CICA 3KEQA 2M8EA 1MZBA 1XG1A 3TL4X 1FLIA 2I5UA 3KETA 2JSCA 2M3AA 2BOLA 4XONA 2DTZA 2L9SA 3WTYC 3OSFA 2F48A 2ZXHA 2DT7B 2KJBA 4A3LJ 2PQ8A 3E0JB 3K2AA 4RM2A 1R5ID 3FIWA 5HLTA 2XB0X 2VN2A 3DEEA 1KYWA 5IT9K 2CU7A 4M3EA 1S72I 1ZH5A 4DBRA 1P7IA 3BZ6A 3Q3SA 2IP2A 4YELA 1O4XA 9ANTA 3GW2A 3O2PE 1IV8A 5B66C 1IN5A 1JKPC 5L3EA 3CJTB 1XMKA 1R23A 1KU3A 4P96A 3CO7C 1YW7A 2COBA 1MMDA 2XGDA 2CUEA 1W5SA 4XICA 3S15J 2QM3A 1Z0XA 1RESA 1W1WE 2CYYA 4G7HF 3FXLA 5D6FA 5FFZA 4DYRA 2TRTA 2YU3A 4F91B 2PMZA 4MHGA 5J40A 4X0GA 4OIPF 3BQYA 4ON0A 1JHFA 3IKTA 3F23A 4M74A 1JTXA 4AYBA 3IRRA 1P2FA 3SZTA 3H3VK 2FU4A 3HC7A 1BC8C 4AIDA 1W4MA 3LFUA 2DFEA 2FBHA 1T56A 3S1MJ 1MBHA 4KN7X 5DEQA 3D5LA 4KNYA 5KHDA 3A1YA 1YOVB 2QENA 2L7MP 4GGGA 4NC6A 4YFXF 2BEOA 1LNWA 3A0HC 1S7AA 3L00A 5J1RA 3HOSA 3CUQB 3CCQI 3S16J 4BE2A 5J3LA 3ERMA 2L0KA 1BM9A 3CTAA 2RAEA 3BPXA 2EZIA 2PFBA 5M3MJ 1I50J 1H9GA 2DA5A 2HDWA 2IW5A 1R6RA 2RVCA 4CCNA 1U0JA 3F0CA 3L9FA 3QU6A 1X4PA 4PJLA 1AKHA 1IGNA 2LF8A 3S2DJ 2EZHA 2PI0A 5F27A 4DW6A 2K4BA 1X3UA 3CJQB 2F4OB 1USTA 1W7PD 3DEUA 3FDYA 2O3FA 2ZMEC 4FE7A 4EJTA 1ERDA 2XUBA 3TOAA 3DBLB 3J80Z 5IOYA 1BJZA 2RV8A 2VQCA 1A6QA 2JA8J 4L5JA 4ZYEA 2G7HA 1KQ8A 1YJ9I 1ZN2A 2D1VA 2QUFA 4NB5A 3BTJA 1XGSA 3HOZJ 2KP6A 1GV5A 5M3FJ 1CQTA 3RKQA 2AXLA 2DOEA 1A31A 3K4CA 3MZHA 4J00A 3FMQA 3I4NJ 5CVRA 3BWGA 1D0ZA 5F0HA 4A3EJ 3PM1A 4I6ZA 2PMUA 4DYCA 3RTRA 3WE2A 2KRHA 5M5XJ 2K27A 5FB2A 3W2WA 2LOOA 4UV9A 2OPTA 3I9V2 1TWGJ 2ZJ2A 3WTXC 2CW8A 2FOWA 4MIMA 3OIQA 2MABA 3NQOA 5CVJA 3GTQJ 5L3FA 1YS6A 2R7FA 4XN3A 4AM3A 3RZDJ 2E5NA 1YIJI 1ZG5A 3FF5A 4PFPA 4RS8A 4IHTA 3IC7A 2LF7A 4OU0A 4BQAA 2K4JA 2WY8Q 4M3FA 1Y0NA 1D5VA 2GWRA 1WH5A 1YW8A 2ISYA 1AKHB 2LRDA 3W6KB 1VQ4I 2G9WA 1NK2P 2ZXWH 1FX7A 2EIJH 2IXSA 3CCEI 3EYIA 2Q0OA 3RQ4A 2XAQA 1S7EA 5CVIA 2V6CA 3CCRI 4L5EA 2X85A 5J8CA 3I53A 1HSTA 3J7AO 2DW4A 4E4HA 4JQFA 2O8XA 2HTSA 4I02A 4P9UA 2P6TA 2LVSA 2JRMA 5JLWA 1BIBA 2GXGA 5CVVA 1DPRA 3HM5A 1DGRM 3CP2A 3RPUA 3MAJA 2XKOA 5DCFA 4KJZA 4E7KA 2ELKA 3FMSA 2V1NA 1F1ZA 2EA2A 2V79A 3BTCA 1GXQA 4PJJA 3HRSA 3FXUA 1G3TA 4CCJA 4MFDA 4ZDLA 5L3CA 3OYNA 1ZG3A 3QP6A 1KZHA 2JN6A 3RPQA 2EV5A 2V1DA 2Z99A 2A07F 3TDUC 5A2QK 5IT3A 2AO9A 3PSIA 4AVZA 2JZYA 3A2KA 2GIVA 2Y9ZA 3ABMH 1S8NA 5M5YJ 2NVUB 3EUKL 3S3NA 3W3CA 1O3RA 2IGMA 2LR8A 3OOPA 2ID3A 5H6RA 2XDVA 4IQ4A 1ZREA 1OCOH 2GBYA 3SFZA 3I71A 4RLQA 2GZWA 3PNYA 5BQTA 3NRVA 4EJVA 4GCVA 3ZP5A 2RC4A 1OQYA 5H20A 2FBIA 4V2FA 1RKWA 3IH2A 3FMRA 2EIKH 5DM6F 4IHXA 3QYEA 4DYQA 1PJRA 3DKYA 3S3OA 2BVMA 1FMVA 2LTPA 1VQ8I 3E5QA 2LY9A 1QHGA 4HX7A 4ZTFA 2JSPA 1T2KA 4M3BA 4Y17A 2VKVA 1AA7A 5CVUA 5FRMA 4P5OA 1RR7A 4KMUX 1TQPA 3OYAA 2DQRA 3AG3H 5IYBJ 4KIGA 1JHHA 4B47A 4J01A 2DOAA 1VQ5I 4NDLA 1HF0A 3RKXA 1RUNA 4AC0A 1VTNC 2DAOA 4M3GA 4BXFA 3CDHA 1RR8C 2KZVA 1BR4A 3IRQA 1BIAA 4RDUA 5D5UB 1TT5B 3LA7A 2PMZN 3KP3A 1ETKA 2IGOA 3BC8A 1KU2A 3CF2A 2EFPA 1IXRC 2ZXIA 1YITI 1BW6A 3GTJJ 3OYMA 3C2BA 2L54A 4Y3OA 4U7DA 1XS9A 1FBSA 5HVQC 1U5TA 3H5RA 2ZJRF 3CCLI 3JRHA 5LEKA 2KRFA 2MD5A 5EYRA 4UV8A 3ZMTA 3DTIA 2I10A 1T08B 3FX3A 1DGWY 1IRFA 3KX2A 3GFIA 1KONA 3L1PA 2F4IA 4BKXA 5AIQA 4DZJA 5K5QA 1QZEA 2W4SA 3LA3A 3G71I 2DA2A 3TQNA 3HIFA 3H1CA 1D1BA 2NYXA 3NWSA 1H9TA 2CGPA 2FMYA 5DUIA 2R7DA 1MNMC 1I1SA 3HHGA 2Z5UA 3LAJA 1GHCA 3FBNB 3JTHA 4KN4X 3BT9A 5EZGA 1IN4A 1XGMA 2CWEA 3PIOF 3HRMA 1Z21A 1KGSA 3OR2C 2IRFG 4E7SA 1P6RA 2X1EA 3VPRA 2E2HJ 2DA1A 1WJEA 4IF4A 2XASA 1XMXA 1U78A 1JUPA 3G4SI 1BR1A 5ILVA 2ME6A 4M9SA 4R1HA 2G7UA 1TQIA 1O3TA 4F92B 2AXTC 2P4WA 1HKSA 3SHFA 1VQMI 3DKWA 4E7IA 2DMTA 4KT6A 5EGOA 4BEHA 2XPUA 2RREA
chains in the Genus database with same CATH topology
3WTZA 2HZTA 4LB5A 4KFCA 2YR2A 1RUOA 3FHZA 4LLLA 1FYKA 3HRTA 1EH8A 1MJ9A 3M7GA 4KIBA 5F1RA 4S04A 2HOEA 4BNCA 5F6FA 2XGXA 1U5TB 2KIFA 4G6DA 2A69F 2DK8A 2ZCWA 3KEOA 5BS6A 4WWCA 4LLNA 5LHGA 1QO0D 1BN5A 1DPUA 4HW0A 2ESHA 1ZGAA 1XB4A 4EGYA 4O6JA 4G9YA 4G6QA 5EEHA 2J5OA 2QYOA 1LB2A 5ICFA 3TO6A 4HAMA 1R1VA 4Q5SF 3GF2A 2OQGA 3HYIA 2XROA 2VC1A 1YIOA 3HOTA 1HKTA 1R1TA 3ABTA 4LG0A 2L3DA 3ECHA 1ZLKA 1P4WA 4ESFA 4ZH4F 1J9IA 5DDGA 3S2WA 4AIKA 3ULQB 3SXYA 2H27A 2CSOA 4DNCA 4WCGA 3I64A 2EFWA 1ZGJA 3V7CA 2ZFWA 4HA8A 2NRAC 2PG4A 1PP7U 3LAPA 5K5RA 2PEXA 3QPHA 1BJAA 4YFNF 1ON2A 2EB7A 4I01A 3K0LA 1HKQA 3U9GA 3HUGA 1TBXA 2XVCA 3V7SA 2BV6A 2GQQA 1OMIA 2Y48A 4AVPA 4EQQA 2F5CA 1S29A 3WODF 2DQLA 3E5XA 4CO8A 1Z9CA 5HOOA 2P7CB 1HW5A 2UZKA 3KFWX 3ISPA 4UHTA 3I58A 1B4AA 2MBFA 5FO5A 2STWA 4ZYHA 5FFXA 1LDKB 5ED4A 1R36A 2QVOA 4KMFA 3LWFA 2XHKA 2FA5A 2VOOA 2DTRA 5D4RA 1QNTA 1P4AA 4M9XA 3AAFA 3L2CA 4I09A 5LGTA 1FY7A 3F72A 4G94A 4GYGA 3MEXA 2O03A 2NNYA 4ETSA 3VEPA 1YO5C 2Q8KA 1GVJA 2FE3A 4HLXA 3TOBA 2ZBKA 5LGNA 4M6YA 3I4PA 1I27A 2FNAA 2J5PA 5FD5A 4ENJA 4Y13A 4JK1X 5HDGA 1K7AA 5D6EA 4HX4A 2F5EA 4L0YB 3KLNA 2OBPA 1XDUA 2VE8A 1XSXA 1UHWA 3W6JB 1UFMA 2A6EF 5ICCA 1B6AA 4ESJA 2CFXA 4NHJA 5D5XB 4PZJA 1L0OC 4L9VA 2VC0A 1HW2A 5LGUA 3T0YA 2GA2A 3J81Z 2Z33A 2HGCA 4UVBA 4L9JA 4MTEA 3ABUA 3HRUA 2H6BA 1B9NA 1J75A 4IHSA 1R5GA 4JBAA 3P9IA 3TGNA 3GWZA 3ERED 1KYZA 2ACJA 1T0FA 2W85A 4BXUA 1MJAA 2WWYA 5CYVA 2MH2A 5L3DA 2PMHA 4OINF 3G73A 4FX0A 1GXPA 2YSRA 4EV0A 5FLXZ 3BPVA 3ZPLA 1LEAA 1TQMA 2CW0F 3BJ6A 1LDJA 1K79A 1IN8A 1Z1DA 3PQJA 4FT8A 2BBYA 3FXQA 3KP6A 1KU9A 2RQPA 4L9TA 1K78A 1G4DA 2PJPA 2ETHA 2MA3A 1B1BA 4RGSA 2PBIA 3WGIA 1S7OA 1SMYF 4MEXF 1WKMA 4S05A 1BBYA 3HTUA 3F8MA 5L3GA 4WXDA 4I0BA 4U88A 2GXBA 1HSJA 1R00A 2QZ8A 3EYYA 2VBYA 2XAFA 2HYGD 1J2XA 3LQRA 4LMYA 2ZKZA 1MJBA 4A6DA 1P4XA 1J5YA 4MQVA 4ZZLA 4G8XA 1IAWA 3BJAA 3QPTA 5TRDA 1KA8A 3TO7A 1YYVA 1R1UA 4UXNA 1PP8F 2P7VB 1ZLJA 3GYHX 3HSRA 3LQQA 2QLZA 1FT9A 4UVAA 4A6EA 2PN6A 1OR7A 2KIMA 2IPQX 2TDXA 4XSZF 2K02A 2VBWA 4HOBA 1ZHFA 1BI0A 3QU3A 4YIIA 3FM5A 1QZZA 1K78B 3EETA 4PDKA 3F6OA 3V8JA 1Z05A 4WXCA 4LGWA 1D3YA 1WWXA 2A68F 3B73A 4HV6A 4RAZA 1ZG1A 1IN6A 4I7HA 1C0WA 3R61A 1XGNA 4D0PA 3LFKA 5L3BA 3RKWA 2OQRA 2IA1A 2K7LA 4O5VA 4MNUA 5BPIA 2M30A 4WX9A 1ON1A 3EQLF 2VT2A 3KLOA 1JE8A 1QQIA 2A6HF 2W84A 3D0SA 4HF1A 1FP2A 4ZZDA 5D5WB 2XAHA 1DP7P 3HSFA 1REPC 2FF4A 5D5VB 4R79A 3KP2A 1UCRA 1UHMA 3JAMK 4A5NA 1YFHA 1YW9A 4NQWA 1MDMA 4WF2A 2MC3A 2RKHA 4UVCA 1ZARA 4BHCA 3M8EA 2XRNA 2QBYB 1G6NA 1TW3A 5ICGA 3ML6A 4F7ZA 4LK0F 1FBUA 1O7FA 1U8RA 2ELHA 4XRFA 2QWWA 3GZ5A 4EGZA 4HX8A 3ZN0A 2VBXA 3FXRA 3SQNA 3CUQC 3C18A 2JT1A 1E17A 3L09A 4G7ZF 4U0YA 3QOPA 2C6YA 1QZYA 2HQRA 1CGPA 2HFHA 3KE2A 3CUOA 3E3VA 2KIUA 4A0ZA 2IA0A 5IT9Z 3RDIA 3C1DA 3GFLA 2F5DA 4L9NA 3HHHA 3RYPA 1PUEE 1ZYRF 1R58A 1PDNC 1W7PA 3RJPA 4YIFA 3MFKA 4ENKA 2STTA 2HQNA 5HS8A 1BI1A 5CJ9A 2WTEA 2W24A 1DDNA 3E6MA 2UXXA 3BP8A 3IWZA 4RGRA 2ZMEA 1MDMB 5E8GA 3KZZA 3N4MA 4AIJA 2VT3A 2XAGA 5AONA 1OKRA 1WQ2A 2COMA 2ADUA 4XLNF 2Y0MA 2PLYA 3Q9VA 5E1XA 1LEBA 3RIRA 4UUVA 4I0AA 1DUXC 5FLXK 2W57A 3GFJA 5DD4A 1MKMA 2HS5A 4Q48A 1YQAA 2XAJA 5AIPA 4WK8F 1FBQA 3J80K 4RB2C 3RYRA 3FZVA 6PAXA 1MGTA 3DPTA 3QRFF 3V8KA 3WGGA 4AWXB 4EJOA 2H94A 3BOQA 4B09A 4EJUA 1FYMA 1ZAOA 4M71A 2DBBA 1W7PB 1SFUA 1QGPA 2ISZA 5J6XA 3F21A 5K5OA 4A0XA 2EV6A 2M45A 4UNOA 2FSWA 2ZMEB 4XLPF 2V1UA 2R3SA 3K1PA 3M8FA 2HEOA 1TNTA 3GVAA 1U3EM 3ECOA 3I0TA 1BI2A 5BMZA 2F2EA 3M9AA 2M5WA 1S6LA 2JTVA 1V3FA 2XV4S 1T39A 4HDUA 2IT0A 2X0LA 4OIQF 2O61A 1BI3A 3T5XA 2E7XA 4RGUA 3B02A 4G7OF 2DU9A 4FHTA 4BAYA 3O3KA 2V9VA 5ICEA 4ZYGA 2GA1A 2RGVA 3U1DA 1RIOH 2DT5A 5LHIA 3NEUA 4EJWA 5ERIA 2E7WA 4YG2F 1IW7F 1V4RA 2VXZA 4MGRA 2XIGA 5A2QZ 4HF0A 3QP5A 4CGZA 4E70A 4CXFA 2D45A 1RNLA 3JSOA 1B59A 4L0ZB 2HYFA 1KQ9A 5JHUA 1TTYA 2VODA 3R4KA 4A12A 2HTJA 1O7LA 1IF1A 5HLHA 4U7BA 2IVMA 4HLYA 2VE9A 2YX4A 1FPQA 5E1WA 4B8XA 1OPCA 4RB1A 3ZMSA 5LLQA 4RAYA 3COAC 1IXSB 5E20A 4KYWA 1SFXA 5E18F 2DPDA 2P8TA 1Z91A 3GUDA 5H6QA 4I98B 3GZ6A 1OYYA 1QPMA 3K69A 5DV5A 3VODA 3DXJF 4N9HA 1SMTA 1LVAA 5DCMB 1Z6RA 3HSEA 3KZYA 2VBZA 4EM0B 3WTTC 4LD5A 2QQ9A 1XCVA 2Z9OA 3DV8A 3I59B 4RB3C 3T8TA 4IRGA 2ESNA 4HV5A 1U2WA 3F8CA 1U5TC 1TLHB 5JVTA 1WRJA 2RN7A 3MZYA 2DFIA 3I5UA 2M87A 1LDDA 1OYWA 4U0VA 5ILUA 2A61A 2H6CA 2B0LA 4HQMA 4L18B 3F3XA 5KK1A 2LDUA 2CO5A 1AWCA 1STZA 2BYVE 1SD6A 1F9NA 2JRTA 3R0JA 2NNNA 3IKVA 5D4SA 2L01A 1F5TA 3KCCA 5LHHA 2FMLA 3U2RA 1ODDA 4IJAA 3V4GA 2BE5F 3F6VA 4HDVA 3IHUA 1CF7A 2DO7A 2EFNA 5LBQA 3I54A 4P55A 1ULYA 3ZMUA 3K2ZA 2HKOA 2HWVA 4Q4ZF 3WU1B 5EEGA 2UXNA 3ZMVA 2FNPA 2KKOA 5JI6A 1USSA 1Q1HA 3CJNA 1IN7A 3P7NA 1XSVA 4KUMA 3E97A 3LA2A 3WU0A 4WXHA 1G3WA 4N9IA 1YG2A 3KP5A 4AIHA 3C3WA 3H92A 2M1BA 3R0AA 1KU7A 1HQCA 3N97A 1FYLA 1KQ0A 2NAZA 5JFRA 4HQEA 4A5MA 1IUYA 4IPAA 3EDPA 3BDDA 1NHAA 3H3ZA 1J0RA 4IRIA 3E6BA 2YX7A 1LQ1A 4MTDA 1CF7B 1T98A 3EUHA 2VOPA 2QBYA 4ENNA 4CHUA 1FOKA 1QBJA 3C7JA 2MH9A 2LSOA 5BOXA 1FP1D 3K1MA 3GEZA 2OA4A 3MQ0A 1O3QA 3G3ZA 2LKPA 1YS7A 3R6SA 2VONA 4OOIA 1FZPB 5CLSA 2KJCA 4IRHA 4QLCU 3DFGA 2FOKA 4KICA 2ZO4A 3LSTA 3MWMA 4AD9A 3RI4A 5HS9A 1WSUA 3CO6C 1YLFA 2EFQA 1UB9A 2BGCA 4RGXA 1A04A 1L3LA 3WTSC 5DUKA 2FQ3A 3M1EA 3GO5A 2AS5F 4HBLA 2OD5A 1RZ4A 4LB6B 4CZZA 2DLLA 3P9CA 3VOEA 4M9ZA 2V1XA 2EV0A 5D8KB 4M73A 1SFEA 1Y0UA 5HDKA 2K86A 4HYEA 2E1CA 2P5VA 4CYDA 1XGOA 2UWMA 2OAZA 2NS0A 1JGSA 1EH7A 1XD7A 2IA2A 4LJZF 2EJRA 2XKPA 2OZUA 5BPDA 4H0EA 1H0MA 3JW4A 1IXCA 4ASNA 4YFKF 2DPUA 3KP4A 2D1HA 3F8NA 2O0YA 1I6XA 2O6GE 5J8FA 4GO1A 1D8JA 3OV8A 4ZYDA 4P9FA 4HF2A 2JPCA 2MLKA 2Z3YA 1Z7UA 1FC3A 2OU2A 4Y15A 1G3SA 1FSHA 3J81K 3F8FA 4MQ9F 2X4HA 3KP7A 2ZNZA 2W25A 4XSXF 2CG4A 4XBFA 4QWQA 3TO9A 5HS7A 4U0WA 1YTYA 1R5HA 4O3MA 3GX4X 3ELKA 4M6XA 4OMZA 4HZFA 2EK5A 4N0BA 1O57A 4PGHA 1BC7C 1P92A 1Z6TA 4PCQA 2F5FA 2Q2EA 1AOYA 2QQBA 3BY6A 1ZRFA 5ILSA 1R22A 4BH9A 3ZN1A 1E2XA 4ENMA 3E5UA 4R8HA 4OMYA 3IWFA 1TW2A 2L02A 5FGMA 1HW1A 3T8RA 2HDCA 4RB0A 3Q9SA 1EV7A 2GAUA 4BHPA 4IVNA 4MEYF 1K6OA 1MD0A 3T1BA 4FX4A 5JR3A 2P5LC 1XDSA 3P9KA 1SD7A 5LEJA 3WTVC 5DYMA 1IRGA 5E17F 1XSDA 3WTUC 1G3YA 2CQKA 2FEZA 2WV0A 3O6BB 3R60A 5D8LB 4M72A 4L5IA 2JPBA 2IJLA 3JSPA 2EA4A 3ZMZA 4A0YA 2LNBA 2YPRA 3FM3A 1R7JA 1J7KA 3K9TA 3CLOA 3E6DA 3GFMA 4KDPA 3VFZA 2D2WA 4LK1F 1F4KA 1W5TA 3HTSB 4LLGF 4A2UA 1XN7A 2L4MA 3DF8A 5E1ZB 1T38A 2HR3A 4GYIA 2RDPA 2FXAA 3QAHA 4K2EA 4PGGA 3DP7A 4EMSA 1S3JA 4Z2YA 3BJOA 3ZQ7A 3IL2A 3PQKA 3WG9A 5E8IA 1FNNA 1HXDA 1D8KA 1TNSA 1T6SA 3L7WA 1FWZA 2HKXA 2A5YB 2P5KA 2QQAA 4LFUA 3VB2A 4DQ2A 3RKYA 4ESBA 1FSEA 1XMAA 1J59A 3BROA 2DI3A 3V7RA 3WGHA 1RI7A 4EM1A 3TKYA 2ZXJA 4CDGA 4I2OA 2RNJA 3K1NA 4KIFA 5HDNA 1SD4A 1I1GA 5DCMA 5LRRA 5TJJA 3MCZA 2H09A 3DQVC 4EM2A 5KVRA 5DD8A 3WE3A 3I59A 2E1NA 4LG0B 1O3SA 3DPLC 3GXOA 3GLXA 2FRHA 1SD5A 4TV7A 2Y75A 4EVIA 1OYIA 1LJ9A 2FBKA 1BOAA 2WC2A 5F64A 5K1YA 1EH6A 5HLGA 1I5ZA 3ZMDA 1SAXA 3REOA 3JTGA 3V8LA 3Q5FA 2EWNA 3ROUA 4BHBA 4GXOA 3E6CC 2P6SA 4KA4A 3FWEA 2EFOA 2DK5A 3F22A 1U6GA 1ONVA 3TDZC 3F8BA 4OIRF 3JAMZ 2A3SA 4BYYA 4KT5C 3CUQA 4Q47A 2OZ6A 5HLIA 1ZRCA 2ZNYA 1ZRDA 1B9MA 1IZ1A 1XCBA 5LRSA 3WTWC 4OIOF 4IXAA 1HBXG 1WI9A 3PFIA 5FD6A 2L4AA 2MLGA 1JXSA 3SZPA 3H3UA 4CICA 3KEQA 2M8EA 1MZBA 1FLIA 3KETA 2JSCA 3WTYC 2KJBA 2PQ8A 2VN2A 1KYWA 5IT9K 1ZH5A 3BZ6A 2IP2A 3GW2A 3O2PE 1IN5A 5L3EA 1XMKA 1R23A 1KU3A 4P96A 3CO7C 1YW7A 1W5SA 2QM3A 2CYYA 4G7HF 5D6FA 5FFZA 2YU3A 4MHGA 4OIPF 4ON0A 1JHFA 3IKTA 3F23A 4M74A 3IRRA 1P2FA 3SZTA 2FU4A 1BC8C 1W4MA 2FBHA 4KN7X 5DEQA 3D5LA 4KNYA 2QENA 4GGGA 4YFXF 2BEOA 1LNWA 3L00A 1S7AA 3HOSA 3CUQB 1BM9A 3CTAA 3BPXA 2PFBA 1H9GA 2IW5A 2RVCA 3L9FA 3QU6A 2LF8A 2PI0A 2K4BA 1X3UA 3DEUA 1USTA 1W7PD 2O3FA 4EJTA 2XUBA 3TOAA 3J80Z 2RV8A 4L5JA 4ZYEA 2G7HA 1KQ8A 1ZN2A 2D1VA 2QUFA 4NB5A 1XGSA 2AXLA 3MZHA 3FMQA 5CVRA 3BWGA 2PMUA 3RTRA 3WE2A 2K27A 5FB2A 4UV9A 2ZJ2A 3WTXC 3NQOA 5CVJA 5L3FA 1YS6A 2R7FA 1ZG5A 3FF5A 4RS8A 4IHTA 3IC7A 2LF7A 4OU0A 4BQAA 2K4JA 1D5VA 2GWRA 1YW8A 2ISYA 3W6KB 2G9WA 1FX7A 3EYIA 2Q0OA 2XAQA 5CVIA 2V6CA 5J8CA 3I53A 1HSTA 3J7AO 2DW4A 4JQFA 2O8XA 2HTSA 4I02A 4P9UA 2P6TA 1BIBA 2GXGA 5CVVA 1DPRA 3RPUA 3MAJA 2XKOA 5DCFA 3FMSA 1F1ZA 2EA2A 2V79A 1GXQA 3HRSA 3FXUA 1G3TA 5L3CA 1ZG3A 3QP6A 3RPQA 2EV5A 2V1DA 2Z99A 2A07F 3TDUC 5A2QK 5IT3A 2JZYA 2GIVA 1S8NA 1O3RA 3OOPA 5H6RA 1ZREA 3SFZA 3I71A 2GZWA 5BQTA 3NRVA 4EJVA 4GCVA 3ZP5A 2RC4A 5H20A 2FBIA 3FMRA 3E5QA 4HX7A 1T2KA 4Y17A 5CVUA 4P5OA 4KMUX 1TQPA 2DQRA 4KIGA 1JHHA 3RKXA 1RUNA 1VTNC 2DAOA 3CDHA 3IRQA 1BIAA 5D5UB 3LA7A 3KP3A 1KU2A 2EFPA 1IXRC 4U7DA 2L54A 1FBSA 5HVQC 1U5TA 5LEKA 2KRFA 2MD5A 4UV8A 3ZMTA 3FX3A 1IRFA 3GFIA 5AIQA 5K5QA 3LA3A 3TQNA 3HIFA 2NYXA 1H9TA 2CGPA 2FMYA 5DUIA 2R7DA 1I1SA 3LAJA 2Z5UA 3HHGA 1GHCA 3JTHA 4KN4X 1IN4A 1XGMA 2CWEA 3HRMA 2IRFG 1KGSA 1P6RA 4IF4A 2XASA 1U78A 5ILVA 4M9SA 4R1HA 2G7UA 1TQIA 1O3TA 2P4WA 1HKSA 3SHFA 3DKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTZ A;  2HZT A;  4LB5 A;  4KFC A;  2YR2 A;  1RUO A;  3FHZ A;  4LLL A;  1FYK A;  3HRT A;  1EH8 A;  1MJ9 A;  3M7G A;  4KIB A;  5F1R A;  4S04 A;  2HOE A;  4BNC A;  5F6F A;  2XGX A;  1U5T B;  2KIF A;  4G6D A;  2A69 F;  2DK8 A;  2ZCW A;  3KEO A;  5BS6 A;  4WWC A;  4LLN A;  5LHG A;  1QO0 D;  1BN5 A;  1DPU A;  4HW0 A;  2ESH A;  1ZGA A;  1XB4 A;  4EGY A;  4O6J A;  4G9Y A;  4G6Q A;  5EEH A;  2J5O A;  2QYO A;  1LB2 A;  5ICF A;  3TO6 A;  4HAM A;  1R1V A;  4Q5S F;  3GF2 A;  2OQG A;  3HYI A;  2XRO A;  2VC1 A;  1YIO A;  3HOT A;  1HKT A;  1R1T A;  3ABT A;  4LG0 A;  2L3D A;  3ECH A;  1ZLK A;  1P4W A;  4ESF A;  4ZH4 F;  1J9I A;  5DDG A;  3S2W A;  4AIK A;  3ULQ B;  3SXY A;  2H27 A;  2CSO A;  4DNC A;  4WCG A;  3I64 A;  2EFW A;  1ZGJ A;  3V7C A;  2ZFW A;  4HA8 A;  2NRA C;  2PG4 A;  1PP7 U;  3LAP A;  5K5R A;  2PEX A;  3QPH A;  1BJA A;  4YFN F;  1ON2 A;  2EB7 A;  4I01 A;  3K0L A;  1HKQ A;  3U9G A;  3HUG A;  1TBX A;  2XVC A;  3V7S A;  2BV6 A;  2GQQ A;  1OMI A;  2Y48 A;  4AVP A;  4EQQ A;  2F5C A;  1S29 A;  3WOD F;  2DQL A;  3E5X A;  4CO8 A;  1Z9C A;  5HOO A;  2P7C B;  1HW5 A;  2UZK A;  3KFW X;  3ISP A;  4UHT A;  3I58 A;  1B4A A;  2MBF A;  5FO5 A;  2STW A;  4ZYH A;  5FFX A;  1LDK B;  5ED4 A;  1R36 A;  2QVO A;  4KMF A;  3LWF A;  2XHK A;  2FA5 A;  2VOO A;  2DTR A;  5D4R A;  1QNT A;  1P4A A;  4M9X A;  3AAF A;  3L2C A;  4I09 A;  5LGT A;  1FY7 A;  3F72 A;  4G94 A;  4GYG A;  3MEX A;  2O03 A;  2NNY A;  4ETS A;  3VEP A;  1YO5 C;  2Q8K A;  1GVJ A;  2FE3 A;  4HLX A;  3TOB A;  2ZBK A;  5LGN A;  4M6Y A;  3I4P A;  1I27 A;  2FNA A;  2J5P A;  5FD5 A;  4ENJ A;  4Y13 A;  4JK1 X;  5HDG A;  1K7A A;  5D6E A;  4HX4 A;  2F5E A;  4L0Y B;  3KLN A;  2OBP A;  1XDU A;  2VE8 A;  1XSX A;  1UHW A;  3W6J B;  1UFM A;  2A6E F;  5ICC A;  1B6A A;  4ESJ A;  2CFX A;  4NHJ A;  5D5X B;  4PZJ A;  1L0O C;  4L9V A;  2VC0 A;  1HW2 A;  5LGU A;  3T0Y A;  2GA2 A;  3J81 Z;  2Z33 A;  2HGC A;  4UVB A;  4L9J A;  4MTE A;  3ABU A;  3HRU A;  2H6B A;  1B9N A;  1J75 A;  4IHS A;  1R5G A;  4JBA A;  3P9I A;  3TGN A;  3GWZ A;  3ERE D;  1KYZ A;  2ACJ A;  1T0F A;  2W85 A;  4BXU A;  1MJA A;  2WWY A;  5CYV A;  2MH2 A;  5L3D A;  2PMH A;  4OIN F;  3G73 A;  4FX0 A;  1GXP A;  2YSR A;  4EV0 A;  5FLX Z;  3BPV A;  3ZPL A;  1LEA A;  1TQM A;  2CW0 F;  3BJ6 A;  1LDJ A;  1K79 A;  1IN8 A;  1Z1D A;  3PQJ A;  4FT8 A;  2BBY A;  3FXQ A;  3KP6 A;  1KU9 A;  2RQP A;  4L9T A;  1K78 A;  1G4D A;  2PJP A;  2ETH A;  2MA3 A;  1B1B A;  4RGS A;  2PBI A;  3WGI A;  1S7O A;  1SMY F;  4MEX F;  1WKM A;  4S05 A;  1BBY A;  3HTU A;  3F8M A;  5L3G A;  4WXD A;  4I0B A;  4U88 A;  2GXB A;  1HSJ A;  1R00 A;  2QZ8 A;  3EYY A;  2VBY A;  2XAF A;  2HYG D;  1J2X A;  3LQR A;  4LMY A;  2ZKZ A;  1MJB A;  4A6D A;  1P4X A;  1J5Y A;  4MQV A;  4ZZL A;  4G8X A;  1IAW A;  3BJA A;  3QPT A;  5TRD A;  1KA8 A;  3TO7 A;  1YYV A;  1R1U A;  4UXN A;  1PP8 F;  2P7V B;  1ZLJ A;  3GYH X;  3HSR A;  3LQQ A;  2QLZ A;  1FT9 A;  4UVA A;  4A6E A;  2PN6 A;  1OR7 A;  2KIM A;  2IPQ X;  2TDX A;  4XSZ F;  2K02 A;  2VBW A;  4HOB A;  1ZHF A;  1BI0 A;  3QU3 A;  4YII A;  3FM5 A;  1QZZ A;  1K78 B;  3EET A;  4PDK A;  3F6O A;  3V8J A;  1Z05 A;  4WXC A;  4LGW A;  1D3Y A;  1WWX A;  2A68 F;  3B73 A;  4HV6 A;  4RAZ A;  1ZG1 A;  1IN6 A;  4I7H A;  1C0W A;  3R61 A;  1XGN A;  4D0P A;  3LFK A;  5L3B A;  3RKW A;  2OQR A;  2IA1 A;  2K7L A;  4O5V A;  4MNU A;  5BPI A;  2M30 A;  4WX9 A;  1ON1 A;  3EQL F;  2VT2 A;  3KLO A;  1JE8 A;  1QQI A;  2A6H F;  2W84 A;  3D0S A;  4HF1 A;  1FP2 A;  4ZZD A;  5D5W B;  2XAH A;  1DP7 P;  3HSF A;  1REP C;  2FF4 A;  5D5V B;  4R79 A;  3KP2 A;  1UCR A;  1UHM A;  3JAM K;  4A5N A;  1YFH A;  1YW9 A;  4NQW A;  1MDM A;  4WF2 A;  2MC3 A;  2RKH A;  4UVC A;  1ZAR A;  4BHC A;  3M8E A;  2XRN A;  2QBY B;  1G6N A;  1TW3 A;  5ICG A;  3ML6 A;  4F7Z A;  4LK0 F;  1FBU A;  1O7F A;  1U8R A;  2ELH A;  4XRF A;  2QWW A;  3GZ5 A;  4EGZ A;  4HX8 A;  3ZN0 A;  2VBX A;  3FXR A;  3SQN A;  3CUQ C;  3C18 A;  2JT1 A;  1E17 A;  3L09 A;  4G7Z F;  4U0Y A;  3QOP A;  2C6Y A;  1QZY A;  2HQR A;  1CGP A;  2HFH A;  3KE2 A;  3CUO A;  3E3V A;  2KIU A;  4A0Z A;  2IA0 A;  5IT9 Z;  3RDI A;  3C1D A;  3GFL A;  2F5D A;  4L9N A;  3HHH A;  3RYP A;  1PUE E;  1ZYR F;  1R58 A;  1PDN C;  1W7P A;  3RJP A;  4YIF A;  3MFK A;  4ENK A;  2STT A;  2HQN A;  5HS8 A;  1BI1 A;  5CJ9 A;  2WTE A;  2W24 A;  1DDN A;  3E6M A;  2UXX A;  3BP8 A;  3IWZ A;  4RGR A;  2ZME A;  1MDM B;  5E8G A;  3KZZ A;  3N4M A;  4AIJ A;  2VT3 A;  2XAG A;  5AON A;  1OKR A;  1WQ2 A;  2COM A;  2ADU A;  4XLN F;  2Y0M A;  2PLY A;  3Q9V A;  5E1X A;  1LEB A;  3RIR A;  4UUV A;  4I0A A;  1DUX C;  5FLX K;  2W57 A;  3GFJ A;  5DD4 A;  1MKM A;  2HS5 A;  4Q48 A;  1YQA A;  2XAJ A;  5AIP A;  4WK8 F;  1FBQ A;  3J80 K;  4RB2 C;  3RYR A;  3FZV A;  6PAX A;  1MGT A;  3DPT A;  3QRF F;  3V8K A;  3WGG A;  4AWX B;  4EJO A;  2H94 A;  3BOQ A;  4B09 A;  4EJU A;  1FYM A;  1ZAO A;  4M71 A;  2DBB A;  1W7P B;  1SFU A;  1QGP A;  2ISZ A;  5J6X A;  3F21 A;  5K5O A;  4A0X A;  2EV6 A;  2M45 A;  4UNO A;  2FSW A;  2ZME B;  4XLP F;  2V1U A;  2R3S A;  3K1P A;  3M8F A;  2HEO A;  1TNT A;  3GVA A;  1U3E M;  3ECO A;  3I0T A;  1BI2 A;  5BMZ A;  2F2E A;  3M9A A;  2M5W A;  1S6L A;  2JTV A;  1V3F A;  2XV4 S;  1T39 A;  4HDU A;  2IT0 A;  2X0L A;  4OIQ F;  2O61 A;  1BI3 A;  3T5X A;  2E7X A;  4RGU A;  3B02 A;  4G7O F;  2DU9 A;  4FHT A;  4BAY A;  3O3K A;  2V9V A;  5ICE A;  4ZYG A;  2GA1 A;  2RGV A;  3U1D A;  1RIO H;  2DT5 A;  5LHI A;  3NEU A;  4EJW A;  5ERI A;  2E7W A;  4YG2 F;  1IW7 F;  1V4R A;  2VXZ A;  4MGR A;  2XIG A;  5A2Q Z;  4HF0 A;  3QP5 A;  4CGZ A;  4E70 A;  4CXF A;  2D45 A;  1RNL A;  3JSO A;  1B59 A;  4L0Z B;  2HYF A;  1KQ9 A;  5JHU A;  1TTY A;  2VOD A;  3R4K A;  4A12 A;  2HTJ A;  1O7L A;  1IF1 A;  5HLH A;  4U7B A;  2IVM A;  4HLY A;  2VE9 A;  2YX4 A;  1FPQ A;  5E1W A;  4B8X A;  1OPC A;  4RB1 A;  3ZMS A;  5LLQ A;  4RAY A;  3COA C;  1IXS B;  5E20 A;  4KYW A;  1SFX A;  5E18 F;  2DPD A;  2P8T A;  1Z91 A;  3GUD A;  5H6Q A;  4I98 B;  3GZ6 A;  1OYY A;  1QPM A;  3K69 A;  5DV5 A;  3VOD A;  3DXJ F;  4N9H A;  1SMT A;  1LVA A;  5DCM B;  1Z6R A;  3HSE A;  3KZY A;  2VBZ A;  4EM0 B;  3WTT C;  4LD5 A;  2QQ9 A;  1XCV A;  2Z9O A;  3DV8 A;  3I59 B;  4RB3 C;  3T8T A;  4IRG A;  2ESN A;  4HV5 A;  1U2W A;  3F8C A;  1U5T C;  1TLH B;  5JVT A;  1WRJ A;  2RN7 A;  3MZY A;  2DFI A;  3I5U A;  2M87 A;  1LDD A;  1OYW A;  4U0V A;  5ILU A;  2A61 A;  2H6C A;  2B0L A;  4HQM A;  4L18 B;  3F3X A;  5KK1 A;  2LDU A;  2CO5 A;  1AWC A;  1STZ A;  2BYV E;  1SD6 A;  1F9N A;  2JRT A;  3R0J A;  2NNN A;  3IKV A;  5D4S A;  2L01 A;  1F5T A;  3KCC A;  5LHH A;  2FML A;  3U2R A;  1ODD A;  4IJA A;  3V4G A;  2BE5 F;  3F6V A;  4HDV A;  3IHU A;  1CF7 A;  2DO7 A;  2EFN A;  5LBQ A;  3I54 A;  4P55 A;  1ULY A;  3ZMU A;  3K2Z A;  2HKO A;  2HWV A;  4Q4Z F;  3WU1 B;  5EEG A;  2UXN A;  3ZMV A;  2FNP A;  2KKO A;  5JI6 A;  1USS A;  1Q1H A;  3CJN A;  1IN7 A;  3P7N A;  1XSV A;  4KUM A;  3E97 A;  3LA2 A;  3WU0 A;  4WXH A;  1G3W A;  4N9I A;  1YG2 A;  3KP5 A;  4AIH A;  3C3W A;  3H92 A;  2M1B A;  3R0A A;  1KU7 A;  1HQC A;  3N97 A;  1FYL A;  1KQ0 A;  2NAZ A;  5JFR A;  4HQE A;  4A5M A;  1IUY A;  4IPA A;  3EDP A;  3BDD A;  1NHA A;  3H3Z A;  1J0R A;  4IRI A;  3E6B A;  2YX7 A;  1LQ1 A;  4MTD A;  1CF7 B;  1T98 A;  3EUH A;  2VOP A;  2QBY A;  4ENN A;  4CHU A;  1FOK A;  1QBJ A;  3C7J A;  2MH9 A;  2LSO A;  5BOX A;  1FP1 D;  3K1M A;  3GEZ A;  2OA4 A;  3MQ0 A;  1O3Q A;  3G3Z A;  2LKP A;  1YS7 A;  3R6S A;  2VON A;  4OOI A;  1FZP B;  5CLS A;  2KJC A;  4IRH A;  4QLC U;  3DFG A;  2FOK A;  4KIC A;  2ZO4 A;  3LST A;  3MWM A;  4AD9 A;  3RI4 A;  5HS9 A;  1WSU A;  3CO6 C;  1YLF A;  2EFQ A;  1UB9 A;  2BGC A;  4RGX A;  1A04 A;  1L3L A;  3WTS C;  5DUK A;  2FQ3 A;  3M1E A;  3GO5 A;  2AS5 F;  4HBL A;  2OD5 A;  1RZ4 A;  4LB6 B;  4CZZ A;  2DLL A;  3P9C A;  3VOE A;  4M9Z A;  2V1X A;  2EV0 A;  5D8K B;  4M73 A;  1SFE A;  1Y0U A;  5HDK A;  2K86 A;  4HYE A;  2E1C A;  2P5V A;  4CYD A;  1XGO A;  2UWM A;  2OAZ A;  2NS0 A;  1JGS A;  1EH7 A;  1XD7 A;  2IA2 A;  4LJZ F;  2EJR A;  2XKP A;  2OZU A;  5BPD A;  4H0E A;  1H0M A;  3JW4 A;  1IXC A;  4ASN A;  4YFK F;  2DPU A;  3KP4 A;  2D1H A;  3F8N A;  2O0Y A;  1I6X A;  2O6G E;  5J8F A;  4GO1 A;  1D8J A;  3OV8 A;  4ZYD A;  4P9F A;  4HF2 A;  2JPC A;  2MLK A;  2Z3Y A;  1Z7U A;  1FC3 A;  2OU2 A;  4Y15 A;  1G3S A;  1FSH A;  3J81 K;  3F8F A;  4MQ9 F;  2X4H A;  3KP7 A;  2ZNZ A;  2W25 A;  4XSX F;  2CG4 A;  4XBF A;  4QWQ A;  3TO9 A;  5HS7 A;  4U0W A;  1YTY A;  1R5H A;  4O3M A;  3GX4 X;  3ELK A;  4M6X A;  4OMZ A;  4HZF A;  2EK5 A;  4N0B A;  1O57 A;  4PGH A;  1BC7 C;  1P92 A;  1Z6T A;  4PCQ A;  2F5F A;  2Q2E A;  1AOY A;  2QQB A;  3BY6 A;  1ZRF A;  5ILS A;  1R22 A;  4BH9 A;  3ZN1 A;  1E2X A;  4ENM A;  3E5U A;  4R8H A;  4OMY A;  3IWF A;  1TW2 A;  2L02 A;  5FGM A;  1HW1 A;  3T8R A;  2HDC A;  4RB0 A;  3Q9S A;  1EV7 A;  2GAU A;  4BHP A;  4IVN A;  4MEY F;  1K6O A;  1MD0 A;  3T1B A;  4FX4 A;  5JR3 A;  2P5L C;  1XDS A;  3P9K A;  1SD7 A;  5LEJ A;  3WTV C;  5DYM A;  1IRG A;  5E17 F;  1XSD A;  3WTU C;  1G3Y A;  2CQK A;  2FEZ A;  2WV0 A;  3O6B B;  3R60 A;  5D8L B;  4M72 A;  4L5I A;  2JPB A;  2IJL A;  3JSP A;  2EA4 A;  3ZMZ A;  4A0Y A;  2LNB A;  2YPR A;  3FM3 A;  1R7J A;  1J7K A;  3K9T A;  3CLO A;  3E6D A;  3GFM A;  4KDP A;  3VFZ A;  2D2W A;  4LK1 F;  1F4K A;  1W5T A;  3HTS B;  4LLG F;  4A2U A;  1XN7 A;  2L4M A;  3DF8 A;  5E1Z B;  1T38 A;  2HR3 A;  4GYI A;  2RDP A;  2FXA A;  3QAH A;  4K2E A;  4PGG A;  3DP7 A;  4EMS A;  1S3J A;  4Z2Y A;  3BJO A;  3ZQ7 A;  3IL2 A;  3PQK A;  3WG9 A;  5E8I A;  1FNN A;  1HXD A;  1D8K A;  1TNS A;  1T6S A;  3L7W A;  1FWZ A;  2HKX A;  2A5Y B;  2P5K A;  2QQA A;  4LFU A;  3VB2 A;  4DQ2 A;  3RKY A;  4ESB A;  1FSE A;  1XMA A;  1J59 A;  3BRO A;  2DI3 A;  3V7R A;  3WGH A;  1RI7 A;  4EM1 A;  3TKY A;  2ZXJ A;  4CDG A;  4I2O A;  2RNJ A;  3K1N A;  4KIF A;  5HDN A;  1SD4 A;  1I1G A;  5DCM A;  5LRR A;  5TJJ A;  3MCZ A;  2H09 A;  3DQV C;  4EM2 A;  5KVR A;  5DD8 A;  3WE3 A;  3I59 A;  2E1N A;  4LG0 B;  1O3S A;  3DPL C;  3GXO A;  3GLX A;  2FRH A;  1SD5 A;  4TV7 A;  2Y75 A;  4EVI A;  1OYI A;  1LJ9 A;  2FBK A;  1BOA A;  2WC2 A;  5F64 A;  5K1Y A;  1EH6 A;  5HLG A;  1I5Z A;  3ZMD A;  1SAX A;  3REO A;  3JTG A;  3V8L A;  3Q5F A;  2EWN A;  3ROU A;  4BHB A;  4GXO A;  3E6C C;  2P6S A;  4KA4 A;  3FWE A;  2EFO A;  2DK5 A;  3F22 A;  1U6G A;  1ONV A;  3TDZ C;  3F8B A;  4OIR F;  3JAM Z;  2A3S A;  4BYY A;  4KT5 C;  3CUQ A;  4Q47 A;  2OZ6 A;  5HLI A;  1ZRC A;  2ZNY A;  1ZRD A;  1B9M A;  1IZ1 A;  1XCB A;  5LRS A;  3WTW C;  4OIO F;  4IXA A;  1HBX G;  1WI9 A;  3PFI A;  5FD6 A;  2L4A A;  2MLG A;  1JXS A;  3SZP A;  3H3U A;  4CIC A;  3KEQ A;  2M8E A;  1MZB A;  1FLI A;  3KET A;  2JSC A;  3WTY C;  2KJB A;  2PQ8 A;  2VN2 A;  1KYW A;  5IT9 K;  1ZH5 A;  3BZ6 A;  2IP2 A;  3GW2 A;  3O2P E;  1IN5 A;  5L3E A;  1XMK A;  1R23 A;  1KU3 A;  4P96 A;  3CO7 C;  1YW7 A;  1W5S A;  2QM3 A;  2CYY A;  4G7H F;  5D6F A;  5FFZ A;  2YU3 A;  4MHG A;  4OIP F;  4ON0 A;  1JHF A;  3IKT A;  3F23 A;  4M74 A;  3IRR A;  1P2F A;  3SZT A;  2FU4 A;  1BC8 C;  1W4M A;  2FBH A;  4KN7 X;  5DEQ A;  3D5L A;  4KNY A;  2QEN A;  4GGG A;  4YFX F;  2BEO A;  1LNW A;  3L00 A;  1S7A A;  3HOS A;  3CUQ B;  1BM9 A;  3CTA A;  3BPX A;  2PFB A;  1H9G A;  2IW5 A;  2RVC A;  3L9F A;  3QU6 A;  2LF8 A;  2PI0 A;  2K4B A;  1X3U A;  3DEU A;  1UST A;  1W7P D;  2O3F A;  4EJT A;  2XUB A;  3TOA A;  3J80 Z;  2RV8 A;  4L5J A;  4ZYE A;  2G7H A;  1KQ8 A;  1ZN2 A;  2D1V A;  2QUF A;  4NB5 A;  1XGS A;  2AXL A;  3MZH A;  3FMQ A;  5CVR A;  3BWG A;  2PMU A;  3RTR A;  3WE2 A;  2K27 A;  5FB2 A;  4UV9 A;  2ZJ2 A;  3WTX C;  3NQO A;  5CVJ A;  5L3F A;  1YS6 A;  2R7F A;  1ZG5 A;  3FF5 A;  4RS8 A;  4IHT A;  3IC7 A;  2LF7 A;  4OU0 A;  4BQA A;  2K4J A;  1D5V A;  2GWR A;  1YW8 A;  2ISY A;  3W6K B;  2G9W A;  1FX7 A;  3EYI A;  2Q0O A;  2XAQ A;  5CVI A;  2V6C A;  5J8C A;  3I53 A;  1HST A;  3J7A O;  2DW4 A;  4JQF A;  2O8X A;  2HTS A;  4I02 A;  4P9U A;  2P6T A;  1BIB A;  2GXG A;  5CVV A;  1DPR A;  3RPU A;  3MAJ A;  2XKO A;  5DCF A;  3FMS A;  1F1Z A;  2EA2 A;  2V79 A;  1GXQ A;  3HRS A;  3FXU A;  1G3T A;  5L3C A;  1ZG3 A;  3QP6 A;  3RPQ A;  2EV5 A;  2V1D A;  2Z99 A;  2A07 F;  3TDU C;  5A2Q K;  5IT3 A;  2JZY A;  2GIV A;  1S8N A;  1O3R A;  3OOP A;  5H6R A;  1ZRE A;  3SFZ A;  3I71 A;  2GZW A;  5BQT A;  3NRV A;  4EJV A;  4GCV A;  3ZP5 A;  2RC4 A;  5H20 A;  2FBI A;  3FMR A;  3E5Q A;  4HX7 A;  1T2K A;  4Y17 A;  5CVU A;  4P5O A;  4KMU X;  1TQP A;  2DQR A;  4KIG A;  1JHH A;  3RKX A;  1RUN A;  1VTN C;  2DAO A;  3CDH A;  3IRQ A;  1BIA A;  5D5U B;  3LA7 A;  3KP3 A;  1KU2 A;  2EFP A;  1IXR C;  4U7D A;  2L54 A;  1FBS A;  5HVQ C;  1U5T A;  5LEK A;  2KRF A;  2MD5 A;  4UV8 A;  3ZMT A;  3FX3 A;  1IRF A;  3GFI A;  5AIQ A;  5K5Q A;  3LA3 A;  3TQN A;  3HIF A;  2NYX A;  1H9T A;  2CGP A;  2FMY A;  5DUI A;  2R7D A;  1I1S A;  3LAJ A;  2Z5U A;  3HHG A;  1GHC A;  3JTH A;  4KN4 X;  1IN4 A;  1XGM A;  2CWE A;  3HRM A;  2IRF G;  1KGS A;  1P6R A;  4IF4 A;  2XAS A;  1U78 A;  5ILV A;  4M9S A;  4R1H A;  2G7U A;  1TQI A;  1O3T A;  2P4W A;  1HKS A;  3SHF A;  3DKW A; 
#chains in the Genus database with same CATH topology
 3WTZ A;  4B44 A;  2V9P A;  5FRO A;  3CMY A;  4LIT A;  2HZT A;  2EIL H;  3HPG A;  4X6A J;  4LB5 A;  2IBD A;  4KFC A;  2YR2 A;  2DA3 A;  1RUO A;  4RMN A;  3FHZ A;  4LLL A;  1OCP A;  1FYK A;  3HRT A;  3ONQ A;  3ZGK A;  3ZR8 X;  5FKL A;  1EH8 A;  1MJ9 A;  3M7G A;  3UKG A;  3GTL J;  3ASN H;  4KIB A;  5F1R A;  4S04 A;  4C30 A;  2HOE A;  3U21 A;  3S1Q J;  1MBJ A;  4BNC A;  5F6F A;  3VYU B;  1R4N B;  2XGX A;  1U5T B;  2KIF A;  2K9M A;  4G6D A;  2CRG A;  2A69 F;  3GLL A;  2DK8 A;  2ZCW A;  1Y8Q B;  4D5F A;  3AFH A;  2CUF A;  3KEO A;  5BS6 A;  3BG7 A;  4WWC A;  4LLN A;  5LHG A;  4UB6 C;  1QO0 D;  1X58 A;  1BN5 A;  4II2 A;  1DPU A;  3L2U A;  4HW0 A;  2ESH A;  4M6V A;  5EJC A;  1ZGA A;  1XB4 A;  5E3N A;  4EGY A;  4O6J A;  1FEX A;  4G9Y A;  3S8P A;  3CD6 I;  3K7A J;  4G6Q A;  2DMP A;  4FAS D;  5EEH A;  2J5O A;  2QYO A;  1LB2 A;  3OYE A;  2EPF A;  3BTI A;  2KQR A;  1WJF A;  1APL C;  5ICF A;  3FXO A;  1TC3 C;  2K9S A;  1IC8 A;  3TO6 A;  4HAM A;  1SFO J;  1R1V A;  1XTA A;  2V4J C;  4Q5S F;  2L9R A;  5EDN A;  3GF2 A;  2OQG A;  2A05 A;  2BY0 A;  3HYI A;  2V26 A;  2XRO A;  3GME A;  2VJJ A;  2VC1 A;  1YIO A;  3HOT A;  3M3Y J;  3ZQC A;  1HKT A;  1R1T A;  2E1O A;  3ABT A;  1X1B A;  3QPS A;  4LG0 A;  2L3D A;  3ECH A;  2JVH A;  1ZLK A;  3S14 J;  1P4W A;  2QKM B;  4UY8 I;  3MKY B;  4ESF A;  5EGO B;  1ZK8 A;  4BEH B;  2V9K A;  4ZH4 F;  1A5J A;  1X2M A;  4HSR A;  1J9I A;  3CC4 I;  5DDG A;  4A3D J;  3S2W A;  4AIK A;  1UZC A;  3WU2 C;  3ULQ B;  2XPW A;  3SXY A;  4C3J J;  3PSF A;  1TWC J;  2KDO A;  2E35 A;  2MYS A;  2CSO A;  4XRS A;  2H27 A;  4DNC A;  5K7H A;  4WCG A;  3LSJ A;  2M2E A;  3I64 A;  2EFW A;  1VI0 A;  2E60 A;  3IH4 A;  2WA0 A;  1ZGJ A;  3BR5 A;  2ZFW A;  4HA8 A;  3V7C A;  2NRA C;  2PG4 A;  5CQE A;  3A4C A;  3TP0 A;  2H8W A;  3CCY A;  3LAP A;  3L2Q A;  5K5R A;  1M1E B;  1PP7 U;  2DFF A;  2PEX A;  2RNG A;  1Y1V J;  3QPH A;  5EZH A;  1BJA A;  3HKZ A;  4DIQ A;  3IAS 2;  4OAY A;  4YFN F;  1ON2 A;  2EB7 A;  2HOA A;  3Q0U A;  4I01 A;  4BJT A;  3K0L A;  1HKQ A;  3U9G A;  2JVG A;  3HUG A;  2Z16 A;  1TBX A;  2XVC A;  2HZD A;  2NVT J;  3V7S A;  2BV6 A;  3M07 A;  1WHU A;  2CQN A;  2GQQ A;  1OMI A;  1A6I A;  2ID6 A;  2Y48 A;  2BHZ A;  4LIU A;  4AVP A;  3CC7 I;  4EQQ A;  2VB6 A;  2F5C A;  1S29 A;  3WOD F;  3CCU I;  5GAH J;  2DDB A;  2NVX J;  2DQL A;  3E5X A;  1YI2 I;  2IGK A;  2DCE A;  4XK4 A;  4KIT B;  1VQP I;  3AG1 H;  2X6O A;  3OYI A;  4CO8 A;  1Z9C A;  5HOO A;  2P7C B;  4CUG A;  3DTK A;  1HW5 A;  2UZK A;  3KFW X;  2LY2 A;  3ISP A;  4UHT A;  3I58 A;  4N4N B;  1B4A A;  2MBF A;  2KFD A;  4XKC A;  5FO5 A;  2STW A;  4ZYH A;  5FFX A;  1LDK B;  1W5C C;  5IOZ A;  5ED4 A;  2E2I J;  1R36 A;  3EUH C;  4PFO A;  1K83 J;  2QVO A;  2DT6 A;  4KMF A;  3LWF A;  1I3Q J;  2XHK A;  2FA5 A;  4C3I J;  3AL0 C;  1OCR H;  2VOO A;  2DA6 A;  2DTR A;  5D4R A;  4W97 A;  2DYS H;  3FBI B;  1QNT A;  1P4A A;  4M9X A;  3AAF A;  3L2C A;  3HOV J;  2X48 A;  4I09 A;  5LGT A;  1FY7 A;  3F72 A;  4G94 A;  4GYG A;  3K6G A;  1QHH D;  1VND A;  3MEX A;  2O03 A;  1D0Y A;  2WY7 Q;  1VZ0 A;  2L2O A;  2HI3 A;  2NNY A;  4ETS A;  3VEP A;  1YO5 C;  2Q8K A;  1GVJ A;  2R7V A;  2FE3 A;  4HLX A;  3TOB A;  3RPU D;  4BS9 A;  2ZBK A;  5LGN A;  4M6Y A;  3I4P A;  1I27 A;  2FNA A;  1BR2 A;  4EAT A;  2ECC A;  2J5P A;  1JKQ C;  1WH7 A;  3HUG B;  1HC8 A;  5FD5 A;  4ENJ A;  4RLF A;  4CCO A;  4Y13 A;  4JK1 X;  5B3S H;  5HDG A;  2A6T A;  1K7A A;  5D6E A;  2BW3 A;  3OYJ A;  2IS6 A;  4HX4 A;  2OTL I;  2F5E A;  1FIP A;  4L0Y B;  4XR6 A;  3KLN A;  2B7E A;  2OBP A;  1K4S A;  1XDU A;  2CW7 A;  2VE8 A;  1XSX A;  1UHW A;  3W6J B;  1IRZ A;  1TWH J;  1UFM A;  1VQ9 I;  2HXO A;  4XID A;  4XLA A;  4IQJ A;  5TIS C;  1QRY A;  2A6E F;  4F93 B;  3BG6 A;  1B6A A;  5ICC A;  2LKS A;  2VJ4 A;  4ESJ A;  2CFX A;  1MH4 A;  2HQA A;  3ZQF A;  3NAU A;  2K85 A;  4G12 A;  4IZZ A;  1X3W B;  4NHJ A;  2VXD A;  5D5X B;  1D5Y A;  1NG6 A;  4PZJ A;  1L0O C;  4L9V A;  2VC0 A;  1HW2 A;  2VJI A;  3OSG A;  3H0G J;  5LGU A;  3T0Y A;  1X2N A;  4HEA 2;  2GA2 A;  4FE4 A;  3J81 Z;  2Z33 A;  2HGC A;  1LFP A;  2IEK A;  4QIW N;  1LUJ B;  4UVB A;  1PVE A;  3RZO J;  4L9J A;  1MW7 A;  1UJ8 A;  4MTE A;  3ABU A;  2X9D A;  3HRU A;  4BQO A;  3RQI A;  2H6B A;  4CYC A;  1B9N A;  1GUU A;  1J75 A;  4IHS A;  2XAU A;  3CQZ J;  1R5G A;  4JBA A;  3B6A A;  3P9I A;  3TGN A;  3ASO H;  4BJ5 C;  3GWZ A;  4MFE A;  3ERE D;  4BL0 B;  4CCK A;  3BG5 A;  4XQF A;  1KYZ A;  2ACJ A;  1T0F A;  2W85 A;  1RC9 A;  4BXU A;  1MJA A;  3TMO A;  2WWY A;  1K6Y A;  1Y6I A;  1F43 A;  4J19 A;  4XLH A;  3BR6 A;  5CYV A;  5JHF A;  1IRX A;  1SVO A;  2MH2 A;  5L3D A;  3BCA A;  2BW3 B;  2WBM A;  3SDB A;  3AG4 H;  2PMH A;  4OIN F;  3BR1 A;  3G73 A;  2VUM J;  4FX0 A;  3H5N A;  4LG3 A;  3ZOB A;  1GXP A;  2YSR A;  3ZCO A;  3IH3 A;  4CZC A;  2DMQ A;  2R7R A;  3KYD B;  1U8B A;  2CQ7 A;  2XB5 A;  4ABZ A;  4EV0 A;  5TGT A;  5FLX Z;  1HOM A;  3BPV A;  3ZPL A;  1LEA A;  2JUC A;  1V5G A;  1TQM A;  1X1P A;  2CW0 F;  3BJ6 A;  2KDZ A;  2V6E A;  1LDJ A;  1K79 A;  1IN8 A;  1F36 A;  1RET A;  1Z1D A;  5GPC A;  3PQJ A;  4FT8 A;  2BBY A;  3FXQ A;  3KP6 A;  2LFB A;  1KU9 A;  2OF7 A;  3OYB A;  2RQP A;  1WJA A;  4L9T A;  1K78 A;  2HVR A;  1AOY A;  2R7U A;  3S17 J;  1ACI A;  1UMQ A;  5E3M A;  1G4D A;  2PJP A;  2ETH A;  4IEJ A;  2FUG 2;  2MA3 A;  3HKZ N;  1B1B A;  1LE8 A;  3DTE A;  4RGS A;  2PBI A;  2R7O A;  1Z7L A;  1VQO I;  3WGI A;  2VKH A;  1S7O A;  2R7Q A;  1SMY F;  3CCM I;  3G1L A;  4MEX F;  4CYC B;  1WKM A;  5FRN A;  1ITY A;  1WPK A;  4S05 A;  1BBY A;  3HTU A;  3F8M A;  5L3G A;  4WXD A;  1EKE A;  4I0B A;  4U88 A;  1ETW A;  2GXB A;  1HSJ A;  1R00 A;  2QZ8 A;  3EYY A;  1ZQ3 P;  2L5Q A;  2VBY A;  2XAF A;  2HYG D;  3VYR B;  1J2X A;  3LQR A;  4LMY A;  3K4B A;  2ZKZ A;  1MJB A;  4A6D A;  1P4X A;  1U9N A;  2WB1 A;  5GAD J;  1J5Y A;  4MQV A;  3GCM A;  4BAC A;  2MSY A;  4ZZL A;  4G8X A;  1IAW A;  3BJA A;  1OFC X;  3QPT A;  5TRD A;  1KA8 A;  3TO7 A;  3ZRG A;  5EG0 A;  1YX5 A;  4XOP A;  2R4G A;  4GRI A;  1TL8 A;  1YYV A;  1R1U A;  4UXN A;  1PP8 F;  1NTC A;  4Y33 A;  2P7V B;  1ZLJ A;  3GYH X;  3LSP A;  3HSR A;  3LQQ A;  2QKL B;  2QLZ A;  2BXZ A;  2MW8 A;  1FT9 A;  4UVA A;  3DBR B;  4A6E A;  1TT0 A;  2PN6 A;  2ZJQ F;  1OR7 A;  3FK6 A;  2KIM A;  2IPQ X;  5J1Y A;  3ESW B;  2TDX A;  2E2J J;  4XSZ F;  2K02 A;  2VBW A;  1X1D A;  4HOB A;  4RM3 A;  1ZHF A;  1BI0 A;  3QU3 A;  4YII A;  2XF5 A;  3FM5 A;  1QZZ A;  3MKZ A;  5C4J J;  1JUS A;  3KYL A;  1K78 B;  3EET A;  4PDK A;  3F6O A;  3V8J A;  2A5W A;  2QCO A;  1Z05 A;  1LE8 B;  2WAD A;  4WXC A;  1B8I B;  4QPQ A;  1E0E A;  5HNF A;  4LGW A;  3E7L A;  1D3Y A;  1X3Z B;  1WWX A;  2A68 F;  3G6E I;  3B73 A;  3GTP J;  4CH7 A;  3HBL A;  4HV6 A;  4A69 C;  4RAZ A;  2OUM A;  1ZG1 A;  2HXI A;  1IN6 A;  4I7H A;  1D1C A;  1I3A A;  1C0W A;  3R61 A;  1XGN A;  4D0P A;  4YIR X;  3LFK A;  5L3B A;  3RKW A;  2OQR A;  1AHD P;  2IA1 A;  2K7L A;  2QA4 I;  4O5V A;  2P0W A;  2VIX A;  4MNU A;  2BXY A;  5BPI A;  2M30 A;  2L9N A;  3A01 B;  4WX9 A;  1ENH A;  1ON1 A;  2W82 A;  3EQL F;  2VT2 A;  2CS3 A;  3KLO A;  2E1M C;  1JE8 A;  1QQI A;  1SAU A;  2A6H F;  2XGE A;  5EG0 B;  2OCC H;  2W84 A;  3D0S A;  3AKZ A;  4HF1 A;  1WI3 A;  1FP2 A;  4ZZD A;  2MFZ A;  4UUS B;  5D5W B;  2XAH A;  1DP7 P;  3S2H J;  3HSF A;  1REP C;  1V55 H;  1GDT A;  2FF4 A;  1D1A A;  5D5V B;  4R79 A;  3KP2 A;  1N75 A;  3BG9 A;  3M1C A;  1UCR A;  1UHM A;  3CCS I;  3JAM K;  4A5N A;  1ZR4 A;  1YFH A;  1YW9 A;  4NQW A;  1MDM A;  4WF2 A;  2CH0 A;  2MC3 A;  2RKH A;  4W1U A;  4BDY A;  4UVC A;  1ZAR A;  4BHC A;  4BY7 J;  4ZYA A;  4D1Q A;  4CA0 A;  1VQK I;  3M8E A;  2XRN A;  2F4M B;  3GTG J;  1FTT A;  2QBY B;  3AL0 B;  1VQ6 I;  5FKK A;  2EH3 A;  1G6N A;  1TW3 A;  2K9L A;  3ZQG A;  5ICG A;  2R92 J;  3ML6 A;  2MD0 A;  4F7Z A;  4LK0 F;  2K9N A;  1FBU A;  1O7F A;  1U8R A;  2ELH A;  4XRF A;  4DGW B;  1GLN A;  4OWR B;  3CCJ I;  2XSD C;  4E7L A;  1IV6 A;  2QWW A;  3GZ5 A;  2VPR A;  1HCR A;  4EGZ A;  4HX8 A;  1LKX A;  2OC6 A;  3K10 A;  3ZN0 A;  2VBX A;  3FXR A;  3UR3 C;  3JRB A;  2Z1D A;  3SQN A;  3O8G A;  3CUQ C;  3LSM A;  5F0C A;  3C18 A;  2JT1 A;  1E17 A;  3GZN B;  3L09 A;  4G7Z F;  2HVQ A;  3QOP A;  4U0Y A;  3KEY A;  3OS0 A;  1QZY A;  2HQR A;  1CGP A;  2C6Y A;  2HFH A;  2QGU A;  2HU9 A;  3CUO A;  3E3V A;  3KE2 A;  4U87 A;  4XLF A;  2KIU A;  2DYR H;  2DDA A;  1QU3 A;  4A0Z A;  3D5S C;  4ZC3 A;  2IA0 A;  5IT9 Z;  2IGN A;  3BR2 A;  3RDI A;  3C1D A;  3GFL A;  1Z67 A;  2F5D A;  4BQN A;  4L9N A;  3HHH A;  3H9Q A;  3RYP A;  1PUE E;  1ZYR F;  1R58 A;  1PDN C;  1W7P A;  3RJP A;  4YIF A;  3IAM 2;  1LFU P;  3MFK A;  4ENK A;  1JJ8 C;  5CQG A;  2STT A;  2HQN A;  3GTK J;  5HS8 A;  2AQE A;  5IY5 H;  2EZK A;  5DTD A;  1BI1 A;  5CJ9 A;  3MMY B;  5B1B H;  2WTE A;  2W24 A;  1DDN A;  2XF6 A;  3E6M A;  5K7F A;  2UXX A;  3AG2 H;  3BP8 A;  3IWZ A;  5FLV A;  4M3D A;  3PO2 J;  4RGR A;  1P9Q C;  2ZME A;  4NQW B;  1MDM B;  2LLK A;  2CQQ A;  2M8G X;  2EIM H;  5E8G A;  3KZZ A;  1Y8R B;  3N4M A;  2H8R A;  4AIJ A;  2CUZ A;  4C2T A;  4DOZ A;  1ZTR A;  2UV1 A;  2VT3 A;  2XAG A;  4PUS A;  5AON A;  5IP9 J;  1ETX A;  4BY1 J;  1OKR A;  1WQ2 A;  4QSH A;  2R7T A;  2EZL A;  2COM A;  2WAQ N;  2ADU A;  4QPO A;  5FLM J;  1JKR C;  4XLN F;  4F3Q A;  1QVU A;  2Y0M A;  2PLY A;  3OIP A;  3IV5 A;  4XKW A;  3Q9V A;  2L9V A;  2IS1 A;  1UHS A;  5H2F C;  5HOD A;  5E1X A;  1LEB A;  3RIR A;  4UUV A;  2P81 A;  4I0A A;  4C9Y A;  1DUX C;  5FLX K;  5E79 C;  2W57 A;  2WB1 N;  3GFJ A;  1MMG A;  3CES A;  1MKM A;  2DN0 A;  2HS5 A;  5DD4 A;  5HNH A;  1MMN A;  4Q48 A;  1YQA A;  2XAJ A;  5AIP A;  2WAE A;  3EPZ A;  4WK8 F;  1FBQ A;  3J80 K;  4RB2 C;  3RYR A;  2QF7 A;  5F08 A;  2OTJ I;  3OYK A;  1G8X A;  3FZV A;  2IAI A;  3GBG A;  2DOD A;  1ETQ A;  6PAX A;  1JI8 A;  1MGT A;  2E36 A;  3DPT A;  3QRF F;  2KL4 A;  2LD5 A;  3V8K A;  3WGG A;  1Z3Y A;  2TCT A;  4AWX B;  3BCB A;  1W0U A;  4EJO A;  2H94 A;  3BOQ A;  3QYB A;  3SZG A;  4B09 A;  2CJJ A;  4EJU A;  1ZAO A;  4M71 A;  1MH3 A;  3SFI A;  1FYM A;  3SDG A;  2DBB A;  1T8I A;  1W7P B;  1LVK A;  3PNV A;  1MIJ A;  4PJM A;  4EEF G;  1SFU A;  1QGP A;  1UEL B;  2ISZ A;  1HA8 A;  2O7O A;  3I56 I;  2M7B A;  1UG0 A;  5J6X A;  3F21 A;  5K5O A;  4A0X A;  1X1A A;  2EV6 A;  2M45 A;  3JRC A;  4UNO A;  3DPU A;  5B5E C;  2QSF X;  2R7W A;  1WJD A;  1PUF A;  2FSW A;  1MBE A;  3HGG A;  2ZME B;  3K70 C;  1IDZ A;  4XLP F;  3TED A;  2V1U A;  3JCU C;  2WAF A;  2R3S A;  4D7M A;  3K1P A;  3M8F A;  2HEO A;  2GM4 A;  1TNT A;  3GVA A;  2KT0 A;  4B3A A;  1U3E M;  4HNV A;  3CLQ A;  4PSW A;  2R7Z J;  5FKN A;  3ECO A;  4BU2 A;  3I55 I;  3OL3 A;  2Q2E B;  2HOT A;  3HOU J;  3CF5 F;  4DZP A;  1T33 A;  4XLC A;  3I0T A;  2V7F A;  1BI2 A;  3K70 D;  3D1N I;  5BMZ A;  2MC4 A;  2VI6 A;  2F2E A;  3M9A A;  1VQ7 I;  1NH3 A;  1WJB A;  2M5W A;  4A3M J;  4JP0 A;  4E7J A;  1S6L A;  2JTV A;  1V3F A;  2XGC A;  2XV4 S;  3H36 A;  1T39 A;  4HDU A;  2IT0 A;  1DP3 A;  2X0L A;  2JWT A;  4ANJ A;  4OIQ F;  1GV2 A;  2BY1 A;  3VYT B;  3DEW A;  3LL7 A;  2O61 A;  1BI3 A;  1HDD C;  2KMU A;  3MKW B;  4PSX A;  3T5X A;  2KIS A;  5M5W J;  1H89 C;  4B43 A;  3ZQI A;  2H1L A;  2E7X A;  2NVY J;  3VSL A;  4RGU A;  3B02 A;  4G7O F;  2DU9 A;  2JUG A;  3JRE A;  1R71 A;  4D5C A;  4FHT A;  2GIZ A;  4BAY A;  3O3K A;  2V9V A;  5ICE A;  4ZYG A;  2L7K A;  2GA1 A;  2RGV A;  2K3F A;  3JRI A;  3U1D A;  2NXN B;  1RIO H;  2DT5 A;  2M4G A;  4H4K C;  5LHI A;  3NEU A;  4EJW A;  1SEU A;  1QPI A;  5J4V A;  5ERI A;  2E7W A;  4YG2 F;  3F9K A;  1IW7 F;  1UG2 A;  1V4R A;  4IX7 A;  4UB8 C;  1EA3 A;  3KZI C;  1FOY A;  1PYV A;  2VXZ A;  4MGR A;  5F0F A;  5C44 J;  2XIG A;  3S1R J;  5A2Q Z;  2YS9 A;  2PX9 A;  3TW6 A;  3E1S A;  3H9G A;  2K3P A;  2YUS A;  4HF0 A;  3QP5 A;  4CGZ A;  3HG9 A;  3OS2 A;  1PUF B;  1FOX A;  4E70 A;  4CXF A;  3LSH A;  2ZFU A;  3KYC B;  3L2V A;  2D45 A;  2KHM A;  1RNL A;  4AUX A;  3JSO A;  3VSK A;  4F52 A;  1B59 A;  4L0Z B;  3HDD A;  3PNT A;  3S32 A;  1A35 A;  3JRD A;  2HYF A;  1KQ9 A;  5JHU A;  1TTY A;  2VOD A;  3R4K A;  3M4O J;  4A12 A;  2HTJ A;  1O7L A;  3TP3 A;  1IF1 A;  1YHQ I;  4BBR J;  5HLH A;  4U7B A;  2IVM A;  4HLY A;  3WHB A;  2M7A A;  3VYS B;  1OIS A;  3OR1 C;  4DJA A;  2VE9 A;  1A36 A;  1MMS A;  2YX4 A;  1FPQ A;  2VKD A;  4NUB A;  5E1W A;  3CME I;  3A0B C;  4B8X A;  1OPC A;  2KPM A;  4RB1 A;  3ZMS A;  2PJR A;  5LLQ A;  4RAY A;  3H5A A;  3COA C;  3PO3 J;  1IXS B;  5E20 A;  4KYW A;  1SFX A;  5E18 F;  2GXA A;  3MKL A;  1SAN A;  2DPD A;  1JTY A;  2HDD A;  2P8T A;  3BR3 A;  4IOC F;  1JKO C;  1Z91 A;  3GUD A;  3H0D A;  5H6Q A;  2VKE A;  3JRA A;  1FOW A;  1YE9 A;  2G0E A;  4I98 B;  5JVG F;  3CDI A;  4CCL A;  3H35 A;  3GZ6 A;  2NS8 A;  1OYY A;  3SYT A;  2AQF A;  5EF6 A;  1QPM A;  3K69 A;  4XL9 A;  5DV5 A;  4BJ6 C;  4HRI A;  4HNU A;  1ZGW A;  1Y39 A;  2OJE D;  3SEZ A;  3VOD A;  2JJ7 A;  4N4O B;  4F55 A;  3PUB A;  3BG3 A;  3ZXS A;  3DXJ F;  3RCO A;  4N9H A;  3K4J A;  3MN2 A;  1OCZ H;  3LMM A;  3M8J A;  2DXI A;  1SMT A;  1LVA A;  5DCM B;  1BOB A;  1Z6R A;  1OLT A;  4PJN A;  4XNF A;  3HSE A;  3KZY A;  2XRL A;  3TBI A;  1LPQ A;  3MD2 A;  2VBZ A;  4V2G A;  4EM0 B;  3WTT C;  2QSH X;  3ABK H;  2XSJ C;  4LD5 A;  2JA5 J;  2QQ9 A;  2E71 A;  3U1K A;  1RRJ A;  4DBQ A;  1QVT A;  1XCV A;  2Z9O A;  3DV8 A;  3I59 B;  4RB3 C;  4BBS J;  3PL8 A;  4IHW A;  3T8T A;  4IRG A;  2ESN A;  4HV5 A;  2CV1 A;  1U2W A;  3F8C A;  1U5T C;  3DLL F;  2LC2 A;  5B1A H;  3QWL A;  1IDY A;  1TLH B;  5JVT A;  1BW5 A;  4FET A;  1WRJ A;  2Y31 A;  2RN7 A;  3MZY A;  2DFI A;  3I5U A;  3HOY J;  2M87 A;  1LDD A;  1OYW A;  1MBG A;  2W1O A;  3C2H A;  3OL4 A;  3LOC A;  4E6K G;  4HST A;  1TZL A;  4U0V A;  2JK3 A;  4HG2 A;  4II3 A;  5ILU A;  2EBI A;  2A61 A;  1BA5 A;  2Y0S A;  2R7S A;  3J7A Y;  2H6C A;  3O8H A;  3ZQH A;  2B0L A;  1XC5 A;  4HQM A;  4L18 B;  2PJR B;  2JA6 J;  3F3X A;  5KK1 A;  2LDU A;  2CO5 A;  4A3J J;  1STZ A;  1AWC A;  5GAG J;  2BYV E;  1SD6 A;  1F9N A;  2JRT A;  2ZC2 A;  2R5Z A;  2BY2 A;  3R0J A;  2NNN A;  2B9S A;  3IKV A;  5D4S A;  1YJW I;  2L01 A;  3TW7 A;  1F5T A;  3VWB A;  3KCC A;  3NAR A;  5JLX A;  4CSW A;  1VQN I;  5LHH A;  4UUT A;  2FML A;  4YEJ A;  3U2R A;  1ODD A;  1QA6 A;  4FIS A;  2HQ5 A;  2Q1Z B;  5J4Y A;  2VLA A;  1IJW C;  4IJA A;  3V4G A;  3QYF A;  2BE5 F;  4D9J A;  3F6V A;  4RBO A;  4HDV A;  3ZQQ A;  4RAF A;  4XLE A;  3IHU A;  3QPL A;  1CF7 A;  3OYD A;  1MMA A;  2DO7 A;  2EFN A;  1OCT C;  1JUM A;  3CJR B;  5LBQ A;  1IUF A;  4B3X A;  1G59 A;  3I4M J;  3GTM J;  4HNT A;  3I54 A;  3CC2 I;  2ZSI B;  4P55 A;  5CPR B;  4ITV A;  1ULY A;  1Q1V A;  3ZMU A;  3K2Z A;  2HKO A;  3DBH B;  4IL6 C;  2HWV A;  2F5V A;  2HYJ A;  2LBF A;  1P7J A;  3WU1 B;  4Q4Z F;  4JOM A;  5EEG A;  2UXN A;  2Y30 A;  3ZMV A;  5KAF C;  1B8I A;  2FNP A;  1MBF A;  2E19 A;  2KKO A;  5JI6 A;  1USS A;  2E34 A;  2OCE A;  4BQQ A;  2VQL A;  2VL8 A;  2XC7 A;  1Q1H A;  1VF9 A;  1R49 A;  1E3H A;  3CJN A;  1IN7 A;  3P7N A;  1XSV A;  4KUM A;  2WAQ A;  5GPA A;  5LD2 C;  1ZEL A;  3E97 A;  1ZR2 A;  3LA2 A;  2ICW G;  4JYK A;  5E3L A;  3OMY A;  3WU0 A;  4A3I J;  4A3K J;  4WXH A;  1G3W A;  2DA7 A;  1TWF J;  3A01 A;  4N9I A;  1YG2 A;  3KP5 A;  3PFY A;  4AIH A;  4C3H J;  4ZDO A;  3C3W A;  3H92 A;  2M1B A;  2X6Y A;  3R0A A;  1KU7 A;  2R5Z B;  1HQC A;  4ZJZ A;  3N97 A;  3HEF A;  5KAI C;  4Z6Y A;  4UUS A;  2IS2 A;  4NC7 A;  1FYL A;  1KQ0 A;  1YRN A;  2NAZ A;  5FKO A;  2CV0 A;  3FKI J;  1MND A;  3OOU A;  2B63 J;  4IHY A;  2M9H A;  5JFR A;  5IYD J;  4HQE A;  4A5M A;  1IUY A;  4IPA A;  3EDP A;  2R0Q C;  1I6H J;  3BDD A;  1NHA A;  3H3Z A;  1J0R A;  1WJ5 A;  3LNQ A;  3E6B A;  4IRI A;  2YX7 A;  2ELJ A;  1FJL A;  2I8D A;  2VAS A;  1ORK A;  1LQ1 A;  4MTD A;  1CF7 B;  2O9L A;  1T98 A;  3EUH A;  2VOP A;  2QBY A;  2X51 A;  5GAE J;  4ENN A;  4CHU A;  5GTI C;  4XOT A;  1FOK A;  1V54 H;  3MZ8 A;  1QBJ A;  3K4M A;  3C7J A;  4BXX J;  3DCF A;  3HPH A;  1FIA A;  2MH9 A;  3P5J A;  2VPL A;  2LSO A;  2BHY A;  2HNH A;  4NNJ A;  4IOA F;  2JA2 A;  5BOX A;  1HLV A;  2LBF B;  3OYL A;  1FP1 D;  3K1M A;  3GEZ A;  2H1K A;  2OA4 A;  3MQ0 A;  1O3Q A;  3G3Z A;  4Y4R A;  4IO9 F;  3OY9 A;  2LKP A;  1YS7 A;  2CQX A;  3R6S A;  3EUA A;  2VON A;  4OOI A;  2HOS A;  3DU5 A;  2M4K A;  3H9J A;  1FZP B;  3HGY A;  4X1E A;  2E5Z A;  5CLS A;  2UUZ A;  4BDZ A;  2KJC A;  4IRH A;  4QLC U;  5IPA A;  4PK4 A;  3CZ6 A;  3DFG A;  2FOK A;  1NG7 A;  1I39 A;  3I3L A;  4KIC A;  2ZO4 A;  3LST A;  4E7H A;  3MWM A;  2W00 A;  1OCC H;  2LYC A;  4AD9 A;  4NC8 A;  3RI4 A;  2BVL A;  2CUJ A;  5HS9 A;  1WSU A;  2NVQ J;  3G1O A;  3BZC A;  1JJ6 C;  3CO6 C;  1YLF A;  2EFQ A;  1UB9 A;  3N05 A;  2BGC A;  2HPM A;  4RGX A;  1A04 A;  3GTO J;  1G2H A;  1L3L A;  3WTS C;  1YRN B;  3FIS A;  5DUK A;  3BZK A;  1H8A C;  2FQ3 A;  3M1E A;  3OS1 A;  4PJ0 C;  4XM3 A;  3GO5 A;  4XN0 A;  2AS5 F;  4HBL A;  2F6C A;  2OD5 A;  1RZ4 A;  2ECB A;  4LB6 B;  4CZZ A;  3W2V A;  2DLL A;  3P9C A;  4BE1 A;  1RPW A;  1ZKG A;  4XMY A;  3VOE A;  1V5E A;  4M9Z A;  3OYG A;  3S3M A;  1POG A;  3WG7 H;  3FKJ A;  3X2Q H;  2V1X A;  3CCV I;  4CCM A;  1SFK A;  2Y9Y A;  2EV0 A;  5D8K B;  1MNE A;  4M73 A;  1SFE A;  1Y0U A;  5HDK A;  2FD5 A;  2K9Q A;  3Q0V A;  4GDF A;  2Y2Z A;  2K86 A;  3BQZ A;  3KIO A;  4HYE A;  2E1C A;  3QOE A;  4A3G J;  2BY3 A;  1SC7 A;  5F1J A;  2JA7 J;  2P5V A;  4CYD A;  1XGO A;  2UWM A;  2OAZ A;  3CDL A;  1Y56 A;  3CMM A;  2NS0 A;  3D5R C;  2OV7 A;  1JGS A;  1EH7 A;  4Y7N J;  2Y0S N;  3SJM A;  1XD7 A;  2IA2 A;  4LJZ F;  2EJR A;  1MSE C;  2XKP A;  1U9O A;  1FTZ A;  4AYB N;  5KCM A;  1X1C A;  1N78 A;  2OZU A;  5BPD A;  4H0E A;  1H0M A;  3PIP F;  3JW4 A;  1IXC A;  4ASN A;  3BTL A;  4YFK F;  2DPU A;  3A03 A;  3KP4 A;  1DU0 A;  2YU9 J;  2D1H A;  1MBK A;  3F8N A;  5LFA A;  2O0Y A;  2R93 J;  1I6X A;  2QEX I;  2O6G E;  5J8F A;  4GO1 A;  1D8J A;  3OV8 A;  1W0T A;  4ZYD A;  2LKX A;  4P9F A;  4HF2 A;  2JPC A;  2N8G A;  2MLK A;  2Z3Y A;  1Z7U A;  3FK7 A;  3OIO A;  1FC3 A;  2OU2 A;  4Y15 A;  1G3S A;  3PUF A;  1FSH A;  3J81 K;  3B6C A;  3F8F A;  1LFB A;  3QOD A;  4YRV A;  1FMW A;  1SVM A;  2QQ8 A;  4MQ9 F;  1Y1W J;  2X4H A;  2DMN A;  2DOF A;  3KP7 A;  3HXL A;  2QSG X;  3SEQ A;  2KZG A;  3S93 A;  2ZNZ A;  2R5Y A;  2W25 A;  2EIN H;  4BUP A;  4XSX F;  4IHV A;  2CG4 A;  2FX0 A;  4XBF A;  4QWQ A;  3TO9 A;  5HS7 A;  4U0W A;  1YTY A;  1R5H A;  3A02 A;  4O3M A;  3GX4 X;  2CMP A;  3ELK A;  4FCY A;  3CP8 A;  4M6X A;  3W2A A;  1WCM J;  4OMZ A;  2MG4 A;  4HZF A;  2EK5 A;  5FKM A;  1HDP A;  3OYC A;  4N0B A;  1O57 A;  4PGH A;  1BC7 C;  1P92 A;  1Z6T A;  4PCQ A;  1GT0 C;  4B48 A;  2ZB9 A;  2DMU A;  2F5F A;  2Q2E A;  1YX3 A;  1D0X A;  2QQB A;  3BY6 A;  2CFO A;  3FXM A;  4S0H B;  4BE0 A;  1ZRF A;  5ILS A;  1R22 A;  4BH9 A;  4XRM A;  3ZN1 A;  4FTH A;  2LRE A;  1E2X A;  2W48 A;  4ENM A;  5C3E J;  3E5U A;  4R8H A;  2R7X A;  4OMY A;  4E7Z A;  3IWF A;  2Y69 H;  1TW2 A;  2L02 A;  4I99 C;  5FGM A;  3DWL E;  1HW1 A;  4AU7 A;  4OAZ A;  1Z77 A;  3DKX A;  3T8R A;  2XF7 A;  2O8K A;  1E3P A;  2HDC A;  4RB0 A;  3Q9S A;  1EV7 A;  2GAU A;  4BHP A;  4IVN A;  4MEY F;  5GP9 A;  2DFH A;  2BZT A;  3G2B A;  1MD0 A;  5IYC J;  1K6O A;  3T1B A;  4FX4 A;  5JR3 A;  2P5L C;  1XDS A;  3P9K A;  1SD7 A;  5LEJ A;  3WTV C;  3PJR A;  1T0F C;  5DYM A;  3VDX A;  1IRG A;  5E17 F;  2EQR A;  1N77 A;  1XSD A;  5IP6 A;  1YJN I;  1UAA A;  4KIS A;  3CMA I;  3BLY A;  3J7Z I;  2HVS A;  3WTU C;  1G3Y A;  2CQK A;  3UNG C;  4G6T B;  2FEZ A;  1B72 A;  5IP7 J;  2WV0 A;  3LSK A;  3RSN A;  3K4L A;  2DJN A;  5DS9 A;  1R4M B;  3O6B B;  3R60 A;  1Z3X A;  4A93 J;  5D8L B;  4M72 A;  3DLA A;  4NBQ A;  1JT6 A;  3K4N A;  4L5I A;  2JPB A;  4A3C J;  2NOJ B;  1S9H A;  2KIQ A;  2IJL A;  4JX5 A;  3JSP A;  3HB9 A;  1T95 A;  2EA4 A;  5KNL A;  3HOX J;  5GTH C;  3ZMZ A;  3HZJ A;  4A0Y A;  3G1M A;  3FHN A;  5DM7 F;  3HOW J;  2LNB A;  1VQL I;  2YPR A;  3FM3 A;  2MGQ A;  3HL2 A;  3QQA A;  1TWA J;  2R5Y B;  1R7J A;  1J7K A;  3K9T A;  2JQ7 A;  2XPV A;  3CLO A;  2JMW A;  2LG4 A;  3E6D A;  3GFM A;  4D7N A;  4KDP A;  3VFZ A;  2D2W A;  1DU6 A;  4LK1 F;  1F4K A;  1X4O A;  1W5T A;  2RQQ A;  5J1U A;  3HTS B;  2K5C A;  2VQH A;  4LLG F;  1ETV A;  4JX4 A;  4A2U A;  1ETY A;  1WFX A;  1XN7 A;  2L4M A;  1EF4 A;  3DF8 A;  5E1Z B;  1T38 A;  2X6X A;  2HR3 A;  2L7F P;  4GYI A;  2RDP A;  2FXA A;  3QAH A;  4K2E A;  2KLO A;  4PGG A;  1VFC A;  3DP7 A;  1S3J A;  4EMS A;  4Z2Y A;  1WVR A;  2X1D A;  3BJO A;  1XX5 A;  3FXK A;  3LSG A;  3ZQ7 A;  3OWT A;  3Q0W A;  3IL2 A;  4MLO A;  3PQK A;  3WG9 A;  4BGD A;  4A3F J;  2O5R A;  1ETO A;  1RKT A;  5E8I A;  1FNN A;  1HXD A;  1D8K A;  1TNS A;  3WHC A;  1XPX A;  1T6S A;  2GOM A;  3L7W A;  5EEA A;  1FWZ A;  4XKV A;  2HKX A;  1H88 C;  2A5Y B;  2P5K A;  5F04 A;  2NS7 A;  2FQ4 A;  2QQA A;  4LFU A;  3VB2 A;  4DQ2 A;  3K4K A;  4LOC A;  3RKY A;  4ESB A;  4QTR A;  2K40 A;  3W6V A;  4A3B J;  1FSE A;  3NWT A;  4C2U A;  2WV1 A;  1XMA A;  2GOX B;  4XRS G;  3OYF A;  1J59 A;  3JRF A;  3BRO A;  1B72 B;  2KRC A;  2DI3 A;  3V7R A;  3OYH A;  4RA2 A;  3WGH A;  1WGX A;  1RI7 A;  2CV2 A;  4EM1 A;  3TKY A;  1EJ9 A;  4I76 A;  2ZXJ A;  1OJL A;  4CDG A;  4I2O A;  2RNJ A;  3K1N A;  4KIF A;  5HDN A;  3ZQL A;  3LSR A;  2VQG A;  2LMD A;  4ZTJ A;  1SD4 A;  3BR0 A;  1I1G A;  5DCM A;  2AHQ A;  5LRR A;  5BNG A;  2ZSH B;  5TJJ A;  3MCZ A;  4JX6 A;  1X19 A;  2H09 A;  1K61 A;  2X6W A;  3DQV C;  4EM2 A;  3J7Y J;  1IO2 A;  5KVR A;  1MSF C;  4MO7 A;  3DU6 A;  5DD8 A;  1OR7 C;  3WE3 A;  3I59 A;  2E1N A;  4LG0 B;  3KPH A;  5E3O A;  1O3S A;  3DPL C;  3GXO A;  1E3O C;  1R9T J;  1JGG A;  3GLX A;  2FRH A;  1SD5 A;  4TV7 A;  4IKF A;  2LK2 A;  2M0M A;  2IS4 A;  4GFB A;  3S1N J;  2Y75 A;  4EVI A;  1OYI A;  2M34 A;  2LH9 A;  2HPI A;  1LJ9 A;  5CKT A;  2FBK A;  1GVD A;  1BOA A;  2WC2 A;  5F64 A;  4XOR A;  5K1Y A;  1EH6 A;  2FJ1 A;  1NK3 P;  3IUO A;  5HLG A;  1I5Z A;  3ZMD A;  1SAX A;  3REO A;  3JTG A;  3L2R A;  2DA4 A;  3V8L A;  3Q5F A;  2EWN A;  3ROU A;  4BHB A;  1SVL A;  2GLO A;  4GXO A;  3E6C C;  4V19 K;  1V5F A;  2P6S A;  4KA4 A;  4XKB A;  2W7N A;  3JR9 A;  3FWE A;  2EFO A;  2DK5 A;  3F22 A;  1N25 A;  1U6G A;  4ZDP A;  1ONV A;  5K7Z A;  3TDZ C;  3F8B A;  1WJC A;  4OIR F;  1BL0 A;  4RAG A;  3JAM Z;  4FQG A;  3ABL H;  1JT0 A;  2ME0 A;  1S5L C;  2A3S A;  5J47 A;  4HPQ A;  4KT5 C;  4BYY A;  4C2M J;  1W36 C;  3CUQ A;  4Y52 J;  1TP4 A;  4Q47 A;  1K4T A;  5FJ8 J;  3HJE A;  3V42 A;  2X1C A;  4B1R A;  2D5V A;  4P1W A;  2OZ6 A;  2DJI A;  5HLI A;  1ZRC A;  3L2W A;  2ZNY A;  2NOG A;  1ZRD A;  2VJ5 A;  1B9M A;  1DQU A;  2Z2S B;  1IZ1 A;  2LY1 A;  3C2G A;  4B4C A;  1J09 A;  1IG7 A;  3LSI A;  1W36 D;  1XCB A;  5LRS A;  2ZJP F;  3MVP A;  2E1M B;  3IP4 B;  2M0C A;  4IXA A;  1WI9 A;  4LIV A;  3WTW C;  1HBX G;  4OIO F;  1AU7 A;  1WZ2 A;  5C4X J;  2LP0 A;  3PFI A;  5FD6 A;  2L4A A;  2L7Z A;  2MLG A;  3FXJ A;  1JXS A;  3JRG A;  3SZP A;  3H3U A;  4CIC A;  3KEQ A;  2M8E A;  1MZB A;  1XG1 A;  3TL4 X;  1FLI A;  2I5U A;  3KET A;  2JSC A;  2M3A A;  2BOL A;  4XON A;  2DTZ A;  2L9S A;  3WTY C;  3OSF A;  2F48 A;  2ZXH A;  2DT7 B;  2KJB A;  4A3L J;  2PQ8 A;  3E0J B;  3K2A A;  4RM2 A;  1R5I D;  3FIW A;  5HLT A;  2XB0 X;  2VN2 A;  3DEE A;  1KYW A;  5IT9 K;  2CU7 A;  4M3E A;  1S72 I;  1ZH5 A;  4DBR A;  1P7I A;  3BZ6 A;  3Q3S A;  2IP2 A;  4YEL A;  1O4X A;  9ANT A;  3GW2 A;  3O2P E;  1IV8 A;  5B66 C;  1IN5 A;  1JKP C;  5L3E A;  3CJT B;  1XMK A;  1R23 A;  1KU3 A;  4P96 A;  3CO7 C;  1YW7 A;  2COB A;  1MMD A;  2XGD A;  2CUE A;  1W5S A;  4XIC A;  3S15 J;  2QM3 A;  1Z0X A;  1RES A;  1W1W E;  2CYY A;  4G7H F;  3FXL A;  5D6F A;  5FFZ A;  4DYR A;  2TRT A;  2YU3 A;  4F91 B;  2PMZ A;  4MHG A;  5J40 A;  4X0G A;  4OIP F;  3BQY A;  4ON0 A;  1JHF A;  3IKT A;  3F23 A;  4M74 A;  1JTX A;  4AYB A;  3IRR A;  1P2F A;  3SZT A;  3H3V K;  2FU4 A;  3HC7 A;  1BC8 C;  4AID A;  1W4M A;  3LFU A;  2DFE A;  2FBH A;  1T56 A;  3S1M J;  1MBH A;  4KN7 X;  5DEQ A;  3D5L A;  4KNY A;  5KHD A;  3A1Y A;  1YOV B;  2QEN A;  2L7M P;  4GGG A;  4NC6 A;  4YFX F;  2BEO A;  1LNW A;  3A0H C;  1S7A A;  3L00 A;  5J1R A;  3HOS A;  3CUQ B;  3CCQ I;  3S16 J;  4BE2 A;  5J3L A;  3ERM A;  2L0K A;  1BM9 A;  3CTA A;  2RAE A;  3BPX A;  2EZI A;  2PFB A;  5M3M J;  1I50 J;  1H9G A;  2DA5 A;  2HDW A;  2IW5 A;  1R6R A;  2RVC A;  4CCN A;  1U0J A;  3F0C A;  3L9F A;  3QU6 A;  1X4P A;  4PJL A;  1AKH A;  1IGN A;  2LF8 A;  3S2D J;  2EZH A;  2PI0 A;  5F27 A;  4DW6 A;  2K4B A;  1X3U A;  3CJQ B;  2F4O B;  1UST A;  1W7P D;  3DEU A;  3FDY A;  2O3F A;  2ZME C;  4FE7 A;  4EJT A;  1ERD A;  2XUB A;  3TOA A;  3DBL B;  3J80 Z;  5IOY A;  1BJZ A;  2RV8 A;  2VQC A;  1A6Q A;  2JA8 J;  4L5J A;  4ZYE A;  2G7H A;  1KQ8 A;  1YJ9 I;  1ZN2 A;  2D1V A;  2QUF A;  4NB5 A;  3BTJ A;  1XGS A;  3HOZ J;  2KP6 A;  1GV5 A;  5M3F J;  1CQT A;  3RKQ A;  2AXL A;  2DOE A;  1A31 A;  3K4C A;  3MZH A;  4J00 A;  3FMQ A;  3I4N J;  5CVR A;  3BWG A;  1D0Z A;  5F0H A;  4A3E J;  3PM1 A;  4I6Z A;  2PMU A;  4DYC A;  3RTR A;  3WE2 A;  2KRH A;  5M5X J;  2K27 A;  5FB2 A;  3W2W A;  2LOO A;  4UV9 A;  2OPT A;  3I9V 2;  1TWG J;  2ZJ2 A;  3WTX C;  2CW8 A;  2FOW A;  4MIM A;  3OIQ A;  2MAB A;  3NQO A;  5CVJ A;  3GTQ J;  5L3F A;  1YS6 A;  2R7F A;  4XN3 A;  4AM3 A;  3RZD J;  2E5N A;  1YIJ I;  1ZG5 A;  3FF5 A;  4PFP A;  4RS8 A;  4IHT A;  3IC7 A;  2LF7 A;  4OU0 A;  4BQA A;  2K4J A;  2WY8 Q;  4M3F A;  1Y0N A;  1D5V A;  2GWR A;  1WH5 A;  1YW8 A;  2ISY A;  1AKH B;  2LRD A;  3W6K B;  1VQ4 I;  2G9W A;  1NK2 P;  2ZXW H;  1FX7 A;  2EIJ H;  2IXS A;  3CCE I;  3EYI A;  2Q0O A;  3RQ4 A;  2XAQ A;  1S7E A;  5CVI A;  2V6C A;  3CCR I;  4L5E A;  2X85 A;  5J8C A;  3I53 A;  1HST A;  3J7A O;  2DW4 A;  4E4H A;  4JQF A;  2O8X A;  2HTS A;  4I02 A;  4P9U A;  2P6T A;  2LVS A;  2JRM A;  5JLW A;  1BIB A;  2GXG A;  5CVV A;  1DPR A;  3HM5 A;  1DGR M;  3CP2 A;  3RPU A;  3MAJ A;  2XKO A;  5DCF A;  4KJZ A;  4E7K A;  2ELK A;  3FMS A;  2V1N A;  1F1Z A;  2EA2 A;  2V79 A;  3BTC A;  1GXQ A;  4PJJ A;  3HRS A;  3FXU A;  1G3T A;  4CCJ A;  4MFD A;  4ZDL A;  5L3C A;  3OYN A;  1ZG3 A;  3QP6 A;  1KZH A;  2JN6 A;  3RPQ A;  2EV5 A;  2V1D A;  2Z99 A;  2A07 F;  3TDU C;  5A2Q K;  5IT3 A;  2AO9 A;  3PSI A;  4AVZ A;  2JZY A;  3A2K A;  2GIV A;  2Y9Z A;  3ABM H;  1S8N A;  5M5Y J;  2NVU B;  3EUK L;  3S3N A;  3W3C A;  1O3R A;  2IGM A;  2LR8 A;  3OOP A;  2ID3 A;  5H6R A;  2XDV A;  4IQ4 A;  1ZRE A;  1OCO H;  2GBY A;  3SFZ A;  3I71 A;  4RLQ A;  2GZW A;  3PNY A;  5BQT A;  3NRV A;  4EJV A;  4GCV A;  3ZP5 A;  2RC4 A;  1OQY A;  5H20 A;  2FBI A;  4V2F A;  1RKW A;  3IH2 A;  3FMR A;  2EIK H;  5DM6 F;  4IHX A;  3QYE A;  4DYQ A;  1PJR A;  3DKY A;  3S3O A;  2BVM A;  1FMV A;  2LTP A;  1VQ8 I;  3E5Q A;  2LY9 A;  1QHG A;  4HX7 A;  4ZTF A;  2JSP A;  1T2K A;  4M3B A;  4Y17 A;  2VKV A;  1AA7 A;  5CVU A;  5FRM A;  4P5O A;  1RR7 A;  4KMU X;  1TQP A;  3OYA A;  2DQR A;  3AG3 H;  5IYB J;  4KIG A;  1JHH A;  4B47 A;  4J01 A;  2DOA A;  1VQ5 I;  4NDL A;  1HF0 A;  3RKX A;  1RUN A;  4AC0 A;  1VTN C;  2DAO A;  4M3G A;  4BXF A;  3CDH A;  1RR8 C;  2KZV A;  1BR4 A;  3IRQ A;  1BIA A;  4RDU A;  5D5U B;  1TT5 B;  3LA7 A;  2PMZ N;  3KP3 A;  1ETK A;  2IGO A;  3BC8 A;  1KU2 A;  3CF2 A;  2EFP A;  1IXR C;  2ZXI A;  1YIT I;  1BW6 A;  3GTJ J;  3OYM A;  3C2B A;  2L54 A;  4Y3O A;  4U7D A;  1XS9 A;  1FBS A;  5HVQ C;  1U5T A;  3H5R A;  2ZJR F;  3CCL I;  3JRH A;  5LEK A;  2KRF A;  2MD5 A;  5EYR A;  4UV8 A;  3ZMT A;  3DTI A;  2I10 A;  1T08 B;  3FX3 A;  1DGW Y;  1IRF A;  3KX2 A;  3GFI A;  1KON A;  3L1P A;  2F4I A;  4BKX A;  5AIQ A;  4DZJ A;  5K5Q A;  1QZE A;  2W4S A;  3LA3 A;  3G71 I;  2DA2 A;  3TQN A;  3HIF A;  3H1C A;  1D1B A;  2NYX A;  3NWS A;  1H9T A;  2CGP A;  2FMY A;  5DUI A;  2R7D A;  1MNM C;  1I1S A;  3HHG A;  2Z5U A;  3LAJ A;  1GHC A;  3FBN B;  3JTH A;  4KN4 X;  3BT9 A;  5EZG A;  1IN4 A;  1XGM A;  2CWE A;  3PIO F;  3HRM A;  1Z21 A;  1KGS A;  3OR2 C;  2IRF G;  4E7S A;  1P6R A;  2X1E A;  3VPR A;  2E2H J;  2DA1 A;  1WJE A;  4IF4 A;  2XAS A;  1XMX A;  1U78 A;  1JUP A;  3G4S I;  1BR1 A;  5ILV A;  2ME6 A;  4M9S A;  4R1H A;  2G7U A;  1TQI A;  1O3T A;  4F92 B;  2AXT C;  2P4W A;  1HKS A;  3SHF A;  1VQM I;  3DKW A;  4E7I A;  2DMT A;  4KT6 A;  5EGO A;  4BEH A;  2XPU A;  2RRE A; 
#chains in the Genus database with same CATH homology
 3WTZ A;  2HZT A;  4LB5 A;  4KFC A;  2YR2 A;  1RUO A;  3FHZ A;  4LLL A;  1FYK A;  3HRT A;  1EH8 A;  1MJ9 A;  3M7G A;  4KIB A;  5F1R A;  4S04 A;  2HOE A;  4BNC A;  5F6F A;  2XGX A;  1U5T B;  2KIF A;  4G6D A;  2A69 F;  2DK8 A;  2ZCW A;  3KEO A;  5BS6 A;  4WWC A;  4LLN A;  5LHG A;  1QO0 D;  1BN5 A;  1DPU A;  4HW0 A;  2ESH A;  1ZGA A;  1XB4 A;  4EGY A;  4O6J A;  4G9Y A;  4G6Q A;  5EEH A;  2J5O A;  2QYO A;  1LB2 A;  5ICF A;  3TO6 A;  4HAM A;  1R1V A;  4Q5S F;  3GF2 A;  2OQG A;  3HYI A;  2XRO A;  2VC1 A;  1YIO A;  3HOT A;  1HKT A;  1R1T A;  3ABT A;  4LG0 A;  2L3D A;  3ECH A;  1ZLK A;  1P4W A;  4ESF A;  4ZH4 F;  1J9I A;  5DDG A;  3S2W A;  4AIK A;  3ULQ B;  3SXY A;  2H27 A;  2CSO A;  4DNC A;  4WCG A;  3I64 A;  2EFW A;  1ZGJ A;  3V7C A;  2ZFW A;  4HA8 A;  2NRA C;  2PG4 A;  1PP7 U;  3LAP A;  5K5R A;  2PEX A;  3QPH A;  1BJA A;  4YFN F;  1ON2 A;  2EB7 A;  4I01 A;  3K0L A;  1HKQ A;  3U9G A;  3HUG A;  1TBX A;  2XVC A;  3V7S A;  2BV6 A;  2GQQ A;  1OMI A;  2Y48 A;  4AVP A;  4EQQ A;  2F5C A;  1S29 A;  3WOD F;  2DQL A;  3E5X A;  4CO8 A;  1Z9C A;  5HOO A;  2P7C B;  1HW5 A;  2UZK A;  3KFW X;  3ISP A;  4UHT A;  3I58 A;  1B4A A;  2MBF A;  5FO5 A;  2STW A;  4ZYH A;  5FFX A;  1LDK B;  5ED4 A;  1R36 A;  2QVO A;  4KMF A;  3LWF A;  2XHK A;  2FA5 A;  2VOO A;  2DTR A;  5D4R A;  1QNT A;  1P4A A;  4M9X A;  3AAF A;  3L2C A;  4I09 A;  5LGT A;  1FY7 A;  3F72 A;  4G94 A;  4GYG A;  3MEX A;  2O03 A;  2NNY A;  4ETS A;  3VEP A;  1YO5 C;  2Q8K A;  1GVJ A;  2FE3 A;  4HLX A;  3TOB A;  2ZBK A;  5LGN A;  4M6Y A;  3I4P A;  1I27 A;  2FNA A;  2J5P A;  5FD5 A;  4ENJ A;  4Y13 A;  4JK1 X;  5HDG A;  1K7A A;  5D6E A;  4HX4 A;  2F5E A;  4L0Y B;  3KLN A;  2OBP A;  1XDU A;  2VE8 A;  1XSX A;  1UHW A;  3W6J B;  1UFM A;  2A6E F;  5ICC A;  1B6A A;  4ESJ A;  2CFX A;  4NHJ A;  5D5X B;  4PZJ A;  1L0O C;  4L9V A;  2VC0 A;  1HW2 A;  5LGU A;  3T0Y A;  2GA2 A;  3J81 Z;  2Z33 A;  2HGC A;  4UVB A;  4L9J A;  4MTE A;  3ABU A;  3HRU A;  2H6B A;  1B9N A;  1J75 A;  4IHS A;  1R5G A;  4JBA A;  3P9I A;  3TGN A;  3GWZ A;  3ERE D;  1KYZ A;  2ACJ A;  1T0F A;  2W85 A;  4BXU A;  1MJA A;  2WWY A;  5CYV A;  2MH2 A;  5L3D A;  2PMH A;  4OIN F;  3G73 A;  4FX0 A;  1GXP A;  2YSR A;  4EV0 A;  5FLX Z;  3BPV A;  3ZPL A;  1LEA A;  1TQM A;  2CW0 F;  3BJ6 A;  1LDJ A;  1K79 A;  1IN8 A;  1Z1D A;  3PQJ A;  4FT8 A;  2BBY A;  3FXQ A;  3KP6 A;  1KU9 A;  2RQP A;  4L9T A;  1K78 A;  1G4D A;  2PJP A;  2ETH A;  2MA3 A;  1B1B A;  4RGS A;  2PBI A;  3WGI A;  1S7O A;  1SMY F;  4MEX F;  1WKM A;  4S05 A;  1BBY A;  3HTU A;  3F8M A;  5L3G A;  4WXD A;  4I0B A;  4U88 A;  2GXB A;  1HSJ A;  1R00 A;  2QZ8 A;  3EYY A;  2VBY A;  2XAF A;  2HYG D;  1J2X A;  3LQR A;  4LMY A;  2ZKZ A;  1MJB A;  4A6D A;  1P4X A;  1J5Y A;  4MQV A;  4ZZL A;  4G8X A;  1IAW A;  3BJA A;  3QPT A;  5TRD A;  1KA8 A;  3TO7 A;  1YYV A;  1R1U A;  4UXN A;  1PP8 F;  2P7V B;  1ZLJ A;  3GYH X;  3HSR A;  3LQQ A;  2QLZ A;  1FT9 A;  4UVA A;  4A6E A;  2PN6 A;  1OR7 A;  2KIM A;  2IPQ X;  2TDX A;  4XSZ F;  2K02 A;  2VBW A;  4HOB A;  1ZHF A;  1BI0 A;  3QU3 A;  4YII A;  3FM5 A;  1QZZ A;  1K78 B;  3EET A;  4PDK A;  3F6O A;  3V8J A;  1Z05 A;  4WXC A;  4LGW A;  1D3Y A;  1WWX A;  2A68 F;  3B73 A;  4HV6 A;  4RAZ A;  1ZG1 A;  1IN6 A;  4I7H A;  1C0W A;  3R61 A;  1XGN A;  4D0P A;  3LFK A;  5L3B A;  3RKW A;  2OQR A;  2IA1 A;  2K7L A;  4O5V A;  4MNU A;  5BPI A;  2M30 A;  4WX9 A;  1ON1 A;  3EQL F;  2VT2 A;  3KLO A;  1JE8 A;  1QQI A;  2A6H F;  2W84 A;  3D0S A;  4HF1 A;  1FP2 A;  4ZZD A;  5D5W B;  2XAH A;  1DP7 P;  3HSF A;  1REP C;  2FF4 A;  5D5V B;  4R79 A;  3KP2 A;  1UCR A;  1UHM A;  3JAM K;  4A5N A;  1YFH A;  1YW9 A;  4NQW A;  1MDM A;  4WF2 A;  2MC3 A;  2RKH A;  4UVC A;  1ZAR A;  4BHC A;  3M8E A;  2XRN A;  2QBY B;  1G6N A;  1TW3 A;  5ICG A;  3ML6 A;  4F7Z A;  4LK0 F;  1FBU A;  1O7F A;  1U8R A;  2ELH A;  4XRF A;  2QWW A;  3GZ5 A;  4EGZ A;  4HX8 A;  3ZN0 A;  2VBX A;  3FXR A;  3SQN A;  3CUQ C;  3C18 A;  2JT1 A;  1E17 A;  3L09 A;  4G7Z F;  4U0Y A;  3QOP A;  2C6Y A;  1QZY A;  2HQR A;  1CGP A;  2HFH A;  3KE2 A;  3CUO A;  3E3V A;  2KIU A;  4A0Z A;  2IA0 A;  5IT9 Z;  3RDI A;  3C1D A;  3GFL A;  2F5D A;  4L9N A;  3HHH A;  3RYP A;  1PUE E;  1ZYR F;  1R58 A;  1PDN C;  1W7P A;  3RJP A;  4YIF A;  3MFK A;  4ENK A;  2STT A;  2HQN A;  5HS8 A;  1BI1 A;  5CJ9 A;  2WTE A;  2W24 A;  1DDN A;  3E6M A;  2UXX A;  3BP8 A;  3IWZ A;  4RGR A;  2ZME A;  1MDM B;  5E8G A;  3KZZ A;  3N4M A;  4AIJ A;  2VT3 A;  2XAG A;  5AON A;  1OKR A;  1WQ2 A;  2COM A;  2ADU A;  4XLN F;  2Y0M A;  2PLY A;  3Q9V A;  5E1X A;  1LEB A;  3RIR A;  4UUV A;  4I0A A;  1DUX C;  5FLX K;  2W57 A;  3GFJ A;  5DD4 A;  1MKM A;  2HS5 A;  4Q48 A;  1YQA A;  2XAJ A;  5AIP A;  4WK8 F;  1FBQ A;  3J80 K;  4RB2 C;  3RYR A;  3FZV A;  6PAX A;  1MGT A;  3DPT A;  3QRF F;  3V8K A;  3WGG A;  4AWX B;  4EJO A;  2H94 A;  3BOQ A;  4B09 A;  4EJU A;  1FYM A;  1ZAO A;  4M71 A;  2DBB A;  1W7P B;  1SFU A;  1QGP A;  2ISZ A;  5J6X A;  3F21 A;  5K5O A;  4A0X A;  2EV6 A;  2M45 A;  4UNO A;  2FSW A;  2ZME B;  4XLP F;  2V1U A;  2R3S A;  3K1P A;  3M8F A;  2HEO A;  1TNT A;  3GVA A;  1U3E M;  3ECO A;  3I0T A;  1BI2 A;  5BMZ A;  2F2E A;  3M9A A;  2M5W A;  1S6L A;  2JTV A;  1V3F A;  2XV4 S;  1T39 A;  4HDU A;  2IT0 A;  2X0L A;  4OIQ F;  2O61 A;  1BI3 A;  3T5X A;  2E7X A;  4RGU A;  3B02 A;  4G7O F;  2DU9 A;  4FHT A;  4BAY A;  3O3K A;  2V9V A;  5ICE A;  4ZYG A;  2GA1 A;  2RGV A;  3U1D A;  1RIO H;  2DT5 A;  5LHI A;  3NEU A;  4EJW A;  5ERI A;  2E7W A;  4YG2 F;  1IW7 F;  1V4R A;  2VXZ A;  4MGR A;  2XIG A;  5A2Q Z;  4HF0 A;  3QP5 A;  4CGZ A;  4E70 A;  4CXF A;  2D45 A;  1RNL A;  3JSO A;  1B59 A;  4L0Z B;  2HYF A;  1KQ9 A;  5JHU A;  1TTY A;  2VOD A;  3R4K A;  4A12 A;  2HTJ A;  1O7L A;  1IF1 A;  5HLH A;  4U7B A;  2IVM A;  4HLY A;  2VE9 A;  2YX4 A;  1FPQ A;  5E1W A;  4B8X A;  1OPC A;  4RB1 A;  3ZMS A;  5LLQ A;  4RAY A;  3COA C;  1IXS B;  5E20 A;  4KYW A;  1SFX A;  5E18 F;  2DPD A;  2P8T A;  1Z91 A;  3GUD A;  5H6Q A;  4I98 B;  3GZ6 A;  1OYY A;  1QPM A;  3K69 A;  5DV5 A;  3VOD A;  3DXJ F;  4N9H A;  1SMT A;  1LVA A;  5DCM B;  1Z6R A;  3HSE A;  3KZY A;  2VBZ A;  4EM0 B;  3WTT C;  4LD5 A;  2QQ9 A;  1XCV A;  2Z9O A;  3DV8 A;  3I59 B;  4RB3 C;  3T8T A;  4IRG A;  2ESN A;  4HV5 A;  1U2W A;  3F8C A;  1U5T C;  1TLH B;  5JVT A;  1WRJ A;  2RN7 A;  3MZY A;  2DFI A;  3I5U A;  2M87 A;  1LDD A;  1OYW A;  4U0V A;  5ILU A;  2A61 A;  2H6C A;  2B0L A;  4HQM A;  4L18 B;  3F3X A;  5KK1 A;  2LDU A;  2CO5 A;  1AWC A;  1STZ A;  2BYV E;  1SD6 A;  1F9N A;  2JRT A;  3R0J A;  2NNN A;  3IKV A;  5D4S A;  2L01 A;  1F5T A;  3KCC A;  5LHH A;  2FML A;  3U2R A;  1ODD A;  4IJA A;  3V4G A;  2BE5 F;  3F6V A;  4HDV A;  3IHU A;  1CF7 A;  2DO7 A;  2EFN A;  5LBQ A;  3I54 A;  4P55 A;  1ULY A;  3ZMU A;  3K2Z A;  2HKO A;  2HWV A;  4Q4Z F;  3WU1 B;  5EEG A;  2UXN A;  3ZMV A;  2FNP A;  2KKO A;  5JI6 A;  1USS A;  1Q1H A;  3CJN A;  1IN7 A;  3P7N A;  1XSV A;  4KUM A;  3E97 A;  3LA2 A;  3WU0 A;  4WXH A;  1G3W A;  4N9I A;  1YG2 A;  3KP5 A;  4AIH A;  3C3W A;  3H92 A;  2M1B A;  3R0A A;  1KU7 A;  1HQC A;  3N97 A;  1FYL A;  1KQ0 A;  2NAZ A;  5JFR A;  4HQE A;  4A5M A;  1IUY A;  4IPA A;  3EDP A;  3BDD A;  1NHA A;  3H3Z A;  1J0R A;  4IRI A;  3E6B A;  2YX7 A;  1LQ1 A;  4MTD A;  1CF7 B;  1T98 A;  3EUH A;  2VOP A;  2QBY A;  4ENN A;  4CHU A;  1FOK A;  1QBJ A;  3C7J A;  2MH9 A;  2LSO A;  5BOX A;  1FP1 D;  3K1M A;  3GEZ A;  2OA4 A;  3MQ0 A;  1O3Q A;  3G3Z A;  2LKP A;  1YS7 A;  3R6S A;  2VON A;  4OOI A;  1FZP B;  5CLS A;  2KJC A;  4IRH A;  4QLC U;  3DFG A;  2FOK A;  4KIC A;  2ZO4 A;  3LST A;  3MWM A;  4AD9 A;  3RI4 A;  5HS9 A;  1WSU A;  3CO6 C;  1YLF A;  2EFQ A;  1UB9 A;  2BGC A;  4RGX A;  1A04 A;  1L3L A;  3WTS C;  5DUK A;  2FQ3 A;  3M1E A;  3GO5 A;  2AS5 F;  4HBL A;  2OD5 A;  1RZ4 A;  4LB6 B;  4CZZ A;  2DLL A;  3P9C A;  3VOE A;  4M9Z A;  2V1X A;  2EV0 A;  5D8K B;  4M73 A;  1SFE A;  1Y0U A;  5HDK A;  2K86 A;  4HYE A;  2E1C A;  2P5V A;  4CYD A;  1XGO A;  2UWM A;  2OAZ A;  2NS0 A;  1JGS A;  1EH7 A;  1XD7 A;  2IA2 A;  4LJZ F;  2EJR A;  2XKP A;  2OZU A;  5BPD A;  4H0E A;  1H0M A;  3JW4 A;  1IXC A;  4ASN A;  4YFK F;  2DPU A;  3KP4 A;  2D1H A;  3F8N A;  2O0Y A;  1I6X A;  2O6G E;  5J8F A;  4GO1 A;  1D8J A;  3OV8 A;  4ZYD A;  4P9F A;  4HF2 A;  2JPC A;  2MLK A;  2Z3Y A;  1Z7U A;  1FC3 A;  2OU2 A;  4Y15 A;  1G3S A;  1FSH A;  3J81 K;  3F8F A;  4MQ9 F;  2X4H A;  3KP7 A;  2ZNZ A;  2W25 A;  4XSX F;  2CG4 A;  4XBF A;  4QWQ A;  3TO9 A;  5HS7 A;  4U0W A;  1YTY A;  1R5H A;  4O3M A;  3GX4 X;  3ELK A;  4M6X A;  4OMZ A;  4HZF A;  2EK5 A;  4N0B A;  1O57 A;  4PGH A;  1BC7 C;  1P92 A;  1Z6T A;  4PCQ A;  2F5F A;  2Q2E A;  1AOY A;  2QQB A;  3BY6 A;  1ZRF A;  5ILS A;  1R22 A;  4BH9 A;  3ZN1 A;  1E2X A;  4ENM A;  3E5U A;  4R8H A;  4OMY A;  3IWF A;  1TW2 A;  2L02 A;  5FGM A;  1HW1 A;  3T8R A;  2HDC A;  4RB0 A;  3Q9S A;  1EV7 A;  2GAU A;  4BHP A;  4IVN A;  4MEY F;  1K6O A;  1MD0 A;  3T1B A;  4FX4 A;  5JR3 A;  2P5L C;  1XDS A;  3P9K A;  1SD7 A;  5LEJ A;  3WTV C;  5DYM A;  1IRG A;  5E17 F;  1XSD A;  3WTU C;  1G3Y A;  2CQK A;  2FEZ A;  2WV0 A;  3O6B B;  3R60 A;  5D8L B;  4M72 A;  4L5I A;  2JPB A;  2IJL A;  3JSP A;  2EA4 A;  3ZMZ A;  4A0Y A;  2LNB A;  2YPR A;  3FM3 A;  1R7J A;  1J7K A;  3K9T A;  3CLO A;  3E6D A;  3GFM A;  4KDP A;  3VFZ A;  2D2W A;  4LK1 F;  1F4K A;  1W5T A;  3HTS B;  4LLG F;  4A2U A;  1XN7 A;  2L4M A;  3DF8 A;  5E1Z B;  1T38 A;  2HR3 A;  4GYI A;  2RDP A;  2FXA A;  3QAH A;  4K2E A;  4PGG A;  3DP7 A;  4EMS A;  1S3J A;  4Z2Y A;  3BJO A;  3ZQ7 A;  3IL2 A;  3PQK A;  3WG9 A;  5E8I A;  1FNN A;  1HXD A;  1D8K A;  1TNS A;  1T6S A;  3L7W A;  1FWZ A;  2HKX A;  2A5Y B;  2P5K A;  2QQA A;  4LFU A;  3VB2 A;  4DQ2 A;  3RKY A;  4ESB A;  1FSE A;  1XMA A;  1J59 A;  3BRO A;  2DI3 A;  3V7R A;  3WGH A;  1RI7 A;  4EM1 A;  3TKY A;  2ZXJ A;  4CDG A;  4I2O A;  2RNJ A;  3K1N A;  4KIF A;  5HDN A;  1SD4 A;  1I1G A;  5DCM A;  5LRR A;  5TJJ A;  3MCZ A;  2H09 A;  3DQV C;  4EM2 A;  5KVR A;  5DD8 A;  3WE3 A;  3I59 A;  2E1N A;  4LG0 B;  1O3S A;  3DPL C;  3GXO A;  3GLX A;  2FRH A;  1SD5 A;  4TV7 A;  2Y75 A;  4EVI A;  1OYI A;  1LJ9 A;  2FBK A;  1BOA A;  2WC2 A;  5F64 A;  5K1Y A;  1EH6 A;  5HLG A;  1I5Z A;  3ZMD A;  1SAX A;  3REO A;  3JTG A;  3V8L A;  3Q5F A;  2EWN A;  3ROU A;  4BHB A;  4GXO A;  3E6C C;  2P6S A;  4KA4 A;  3FWE A;  2EFO A;  2DK5 A;  3F22 A;  1U6G A;  1ONV A;  3TDZ C;  3F8B A;  4OIR F;  3JAM Z;  2A3S A;  4BYY A;  4KT5 C;  3CUQ A;  4Q47 A;  2OZ6 A;  5HLI A;  1ZRC A;  2ZNY A;  1ZRD A;  1B9M A;  1IZ1 A;  1XCB A;  5LRS A;  3WTW C;  4OIO F;  4IXA A;  1HBX G;  1WI9 A;  3PFI A;  5FD6 A;  2L4A A;  2MLG A;  1JXS A;  3SZP A;  3H3U A;  4CIC A;  3KEQ A;  2M8E A;  1MZB A;  1FLI A;  3KET A;  2JSC A;  3WTY C;  2KJB A;  2PQ8 A;  2VN2 A;  1KYW A;  5IT9 K;  1ZH5 A;  3BZ6 A;  2IP2 A;  3GW2 A;  3O2P E;  1IN5 A;  5L3E A;  1XMK A;  1R23 A;  1KU3 A;  4P96 A;  3CO7 C;  1YW7 A;  1W5S A;  2QM3 A;  2CYY A;  4G7H F;  5D6F A;  5FFZ A;  2YU3 A;  4MHG A;  4OIP F;  4ON0 A;  1JHF A;  3IKT A;  3F23 A;  4M74 A;  3IRR A;  1P2F A;  3SZT A;  2FU4 A;  1BC8 C;  1W4M A;  2FBH A;  4KN7 X;  5DEQ A;  3D5L A;  4KNY A;  2QEN A;  4GGG A;  4YFX F;  2BEO A;  1LNW A;  3L00 A;  1S7A A;  3HOS A;  3CUQ B;  1BM9 A;  3CTA A;  3BPX A;  2PFB A;  1H9G A;  2IW5 A;  2RVC A;  3L9F A;  3QU6 A;  2LF8 A;  2PI0 A;  2K4B A;  1X3U A;  3DEU A;  1UST A;  1W7P D;  2O3F A;  4EJT A;  2XUB A;  3TOA A;  3J80 Z;  2RV8 A;  4L5J A;  4ZYE A;  2G7H A;  1KQ8 A;  1ZN2 A;  2D1V A;  2QUF A;  4NB5 A;  1XGS A;  2AXL A;  3MZH A;  3FMQ A;  5CVR A;  3BWG A;  2PMU A;  3RTR A;  3WE2 A;  2K27 A;  5FB2 A;  4UV9 A;  2ZJ2 A;  3WTX C;  3NQO A;  5CVJ A;  5L3F A;  1YS6 A;  2R7F A;  1ZG5 A;  3FF5 A;  4RS8 A;  4IHT A;  3IC7 A;  2LF7 A;  4OU0 A;  4BQA A;  2K4J A;  1D5V A;  2GWR A;  1YW8 A;  2ISY A;  3W6K B;  2G9W A;  1FX7 A;  3EYI A;  2Q0O A;  2XAQ A;  5CVI A;  2V6C A;  5J8C A;  3I53 A;  1HST A;  3J7A O;  2DW4 A;  4JQF A;  2O8X A;  2HTS A;  4I02 A;  4P9U A;  2P6T A;  1BIB A;  2GXG A;  5CVV A;  1DPR A;  3RPU A;  3MAJ A;  2XKO A;  5DCF A;  3FMS A;  1F1Z A;  2EA2 A;  2V79 A;  1GXQ A;  3HRS A;  3FXU A;  1G3T A;  5L3C A;  1ZG3 A;  3QP6 A;  3RPQ A;  2EV5 A;  2V1D A;  2Z99 A;  2A07 F;  3TDU C;  5A2Q K;  5IT3 A;  2JZY A;  2GIV A;  1S8N A;  1O3R A;  3OOP A;  5H6R A;  1ZRE A;  3SFZ A;  3I71 A;  2GZW A;  5BQT A;  3NRV A;  4EJV A;  4GCV A;  3ZP5 A;  2RC4 A;  5H20 A;  2FBI A;  3FMR A;  3E5Q A;  4HX7 A;  1T2K A;  4Y17 A;  5CVU A;  4P5O A;  4KMU X;  1TQP A;  2DQR A;  4KIG A;  1JHH A;  3RKX A;  1RUN A;  1VTN C;  2DAO A;  3CDH A;  3IRQ A;  1BIA A;  5D5U B;  3LA7 A;  3KP3 A;  1KU2 A;  2EFP A;  1IXR C;  4U7D A;  2L54 A;  1FBS A;  5HVQ C;  1U5T A;  5LEK A;  2KRF A;  2MD5 A;  4UV8 A;  3ZMT A;  3FX3 A;  1IRF A;  3GFI A;  5AIQ A;  5K5Q A;  3LA3 A;  3TQN A;  3HIF A;  2NYX A;  1H9T A;  2CGP A;  2FMY A;  5DUI A;  2R7D A;  1I1S A;  3LAJ A;  2Z5U A;  3HHG A;  1GHC A;  3JTH A;  4KN4 X;  1IN4 A;  1XGM A;  2CWE A;  3HRM A;  2IRF G;  1KGS A;  1P6R A;  4IF4 A;  2XAS A;  1U78 A;  5ILV A;  4M9S A;  4R1H A;  2G7U A;  1TQI A;  1O3T A;  2P4W A;  1HKS A;  3SHF A;  3DKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...