1J9IA

Structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
b'MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TERMINASE SMALL SUBUNIT
publication title Insights into specific DNA recognition during the assembly of a viral genome packaging machine.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j9iA00
2L54A 3EYYA 2K4BA 2KRFA 1NHAA 3I59B 3V8JA 4KNYA 2ZBKA 3K1NA 3QPHA 3I71A 3SHFA 1F9NA 5DV5A 4EVIA 1ZREA 2R7FA 4HZFA 3HHGA 3JSPA 1L3LA 2D2WA 5ILSA 5E8GA 3FMSA 3WTSC 2QVOA 4HDVA 3PQJA 4KIGA 2WV0A 4GYGA 4TV7A 1XSXA 4UHTA 3FF5A 4G94A 5FFZA 1TNTA 3ISPA 4L9JA 3CUOA 3TOAA 5LGNA 4YFXF 3I53A 4EJVA 2UWMA 1TQMA 2VBZA 4HV6A 4OU0A 3RPUA 4A6DA 3JAMZ 3GX4X 3F8CA 1BBYA 3E5UA 4EV0A 5LGTA 1SD5A 1U5TC 4M72A 2HS5A 4EM2A 3CO6C 2FF4A 2DLLA 2NYXA 2DQRA 2KIUA 5E8IA 3ZQ7A 2QQ9A 2HTJA 1SFEA 5BQTA 3E6BA 1USTA 1P4XA 5HS7A 4KA4A 1B1BA 4CDGA 4I09A 3P7NA 3Q9VA 2E7XA 3EQLF 5EEHA 2ISZA 3EDPA 2RGVA 5ILVA 2ISYA 1K78B 2YX7A 1RZ4A 2VBWA 2CYYA 2G9WA 3RIRA 1G3SA 5E1XA 4ASNA 4L5JA 1J2XA 2NAZA 1CGPA 1KU7A 3V7RA 1YQAA 3ZMTA 1H9TA 4M6YA 3O3KA 4Q5SF 2A3SA 1J7KA 1P4WA 3DPLC 4LLLA 3WE2A 1O7LA 3D0SA 4UNOA 3WE3A 1RUNA 4MTDA 4HX8A 2RNJA 2XIGA 1J0RA 3HTUA 2GA1A 1CF7A 4ENMA 2VN2A 3KE2A 3GLXA 5FFXA 2O8XA 3TQNA 1O57A 4LB6B 3BJ6A 1OR7A 4NHJA 2FE3A 5FB2A 1HSTA 3HRMA 2PN6A 2QENA 3G73A 1R1VA 1QO0D 4GXOA 2VOPA 2E1NA 3MQ0A 4ZYGA 2J5OA 2WTEA 4KFCA 4UVAA 1E2XA 4XLNF 2M45A 1DP7P 4RS8A 2NS0A 3C7JA 2QLZA 2UZKA 4KN7X 2RV8A 5LHHA 4MNUA 4RGXA 4XSXF 1DUXC 2VODA 5ICGA 1V3FA 4KICA 2IT0A 4L18B 3WTUC 1IRGA 2F5CA 1XDUA 1Z91A 5ICEA 2KIMA 4HF2A 1TBXA 5CVRA 2XAQA 3MFKA 2RN7A 2ZNZA 2XHKA 2ESNA 4XRFA 2HOEA 3GVAA 2A6EF 1SFUA 2EFNA 1S7AA 1U5TA 4KIBA 3DP7A 2DFIA 1JE8A 2ESHA 2STTA 1FPQA 5LEJA 3KLOA 4PZJA 3COAC 1W7PA 4ESJA 3HOSA 2F2EA 4Q4ZF 3S2WA 2KJCA 3ZMDA 3EETA 3WU0A 2IJLA 2OQRA 3REOA 4BNCA 5TRDA 3L00A 2VBXA 3CLOA 1XGMA 4EJTA 3PQKA 2K27A 2VXZA 5AONA 2FBIA 1SD4A 4IPAA 2OBPA 5K5OA 5JFRA 2V1XA 3NEUA 2OZUA 2ZXJA 1I1SA 1MGTA 4Z2YA 2Z3YA 3HUGA 4M73A 1ZGAA 4L0YB 2Y75A 2PQ8A 2VC0A 2L4MA 1ZRDA 3CTAA 4CHUA 2A68F 1SD6A 2DI3A 2LF7A 2QYOA 5CYVA 2A61A 4ZYHA 1IRFA 3HOTA 3ULQB 4BYYA 4HX7A 4PDKA 3GYHX 2XV4S 3ZMZA 3Q9SA 1FWZA 1EH6A 5LGUA 2W57A 5A2QK 5DCMB 4CO8A 1Q1HA 3KP2A 4JQFA 5KVRA 3U9GA 3GO5A 3OV8A 4P9UA 2W25A 5E18F 1PP8F 4RB1A 3J7AO 3IWZA 1YO5C 2VE8A 4LK1F 4L9NA 2M1BA 3U2RA 3KETA 4WF2A 5HVQC 2LF8A 3K1PA 1H9GA 4M71A 4BHBA 1R58A 2X0LA 1MKMA 4LMYA 4LLNA 1YW7A 1ZRCA 1W7PD 4AIHA 4I0BA 1FOKA 2ETHA 1XSVA 3WTXC 2QM3A 5A2QZ 4IRHA 3N4MA 2IA0A 1ZGJA 5L3BA 1BIBA 1IZ1A 2MC3A 1XMKA 2HR3A 2FNPA 5AIQA 1ZG3A 3WGHA 3WTVC 3GWZA 2EFWA 3B73A 1ZYRF 1HW2A 2COMA 3DF8A 5E1ZB 2DQLA 3TOBA 3LA7A 4LB5A 1D3YA 3M1EA 1XGOA 4KN4X 3CUQC 3BROA 4IRIA 4P5OA 3R60A 5HLHA 2D1HA 2ZJ2A 3ECOA 2GA2A 3KEOA 1E17A 5FD6A 4U88A 4NB5A 4HLYA 2O61A 1H0MA 2DK8A 2F5FA 4Y15A 2PLYA 1P6RA 1OMIA 3RKYA 5JHUA 2EB7A 4IRGA 2XAFA 3FHZA 2ZCWA 2DU9A 3JTHA 4EM1A 1IN4A 4PGHA 3MCZA 2VBYA 1VTNC 3F72A 3SQNA 1IXRC 2PMUA 2M5WA 2K02A 1B9MA 1T2KA 3RDIA 1LDJA 2XVCA 5F64A 4HW0A 4KYWA 4L0ZB 5DUIA 2O6GE 4A0ZA 4NQWA 5L3FA 5E20A 3E6DA 3LAJA 2DK5A 3LWFA 4M9SA 2AS5F 5F6FA 1FP1D 1QZYA 3WODF 1LB2A 2FOKA 4R1HA 5HLIA 4WWCA 1BN5A 3EUHA 3FX3A 5DD8A 4EM0B 3JAMK 5TJJA 3O2PE 5BOXA 3F8FA 1HSJA 3L09A 3V8KA 5FO5A 4H0EA 3BOQA 3V7SA 4U0VA 2HKXA 1DDNA 5JR3A 4LFUA 3P9IA 3TO6A 2HYGD 4ZZLA 3FXRA 2ACJA 2RC4A 4ENKA 1R22A 1HW5A 1KU9A 2EFQA 3HSEA 4UUVA 3G3ZA 1PDNC 3H92A 3H3UA 1XSDA 1MDMB 4AVPA 2DPDA 3VFZA 3GZ6A 3DXJF 5ICFA 4ZYEA 2Y0MA 4EJOA 2L02A 3T1BA 3I5UA 4CYDA 3IKTA 3C3WA 1HW1A 1KYZA 2ZMEA 4YIIA 3V8LA 1YW9A 1YIOA 5CVVA 4EGYA 2XROA 2ADUA 1RNLA 2YX4A 4OIOF 1YG2A 3OOPA 2VT3A 3TO7A 3I58A 5K5RA 4EJUA 1IAWA 4A6EA 5BMZA 4S05A 4I7HA 4O5VA 3CUQA 3BPXA 5AIPA 4RB0A 2B0LA 3I54A 5IT3A 3ZN1A 2WC2A 3F8MA 1QQIA 2Q2EA 2VC1A 5ILUA 1T0FA 3J81K 5CJ9A 3ERED 1K6OA 2R3SA 3QP6A 1JXSA 4ENJA 4KIFA 2Z33A 2EA4A 3GFJA 4B09A 1HKTA 2XRNA 4FX0A 1Z6RA 2G7HA 5HS8A 1KYWA 3F6OA 3KFWX 2O0YA 3C1DA 1ZH5A 2FXAA 1O3RA 2K86A 2CWEA 1WQ2A 1IN8A 2CW0F 3I4PA 4AIJA 3LAPA 2EWNA 5BS6A 4BAYA 1HQCA 2MH2A 4BXUA 2BGCA 3RYRA 4I98B 3ZMVA 2EK5A 3HRUA 4O6JA 4A0YA 4EMSA 4YFKF 3QAHA 3J81Z 2EV6A 1DPUA 4LD5A 4HBLA 1R36A 2QBYA 4G7ZF 4OIQF 1WKMA 4LGWA 2V6CA 2Z9OA 5IT9K 1YTYA 3HSFA 1U3EM 3LQRA 2VT2A 3V7CA 1OYWA 3L9FA 4F7ZA 3I0TA 3Q5FA 1L0OC 1D5VA 1FT9A 2A6HF 4GCVA 5JI6A 1XGSA 4HX4A 2Q8KA 2CSOA 2RKHA 3F3XA 3ML6A 5D8KB 2CGPA 3L7WA 4ESFA 4RB2C 1BC7C 4A5NA 2GZWA 4R79A 1ODDA 4RAZA 2Z5UA 1FYLA 2BE5F 3VB2A 3E6MA 4N9HA 1R1UA 2PMHA 5JVTA 1G3TA 5D5WB 1RIOH 3I64A 4M6XA 5H6QA 4D0PA 5FGMA 4BHCA 5IT9Z 4RGRA 5HDKA 4U7BA 2YSRA 3WGGA 5F1RA 4G6QA 2XKPA 4LG0A 3VODA 5D5UB 2IRFG 1MD0A 4E70A 1IXSB 3ELKA 3R6SA 2MD5A 2KJBA 1KU2A 3KP5A 2QUFA 1LDKB 1SMYF 1SMTA 1ULYA 3BJAA 3SZPA 5BPDA 3NRVA 2P8TA 4L9VA 2JT1A 3FXQA 4I0AA 4AD9A 2DPUA 2J5PA 1STZA 3FXUA 3V4GA 3C18A 3F6VA 2Z99A 2GXBA 2XAJA 1FSHA 2DBBA 3N97A 2JSCA 3LA3A 3KP6A 2FEZA 1W5SA 2HEOA 1IXCA 1EV7A 1IUYA 3NQOA 1CF7B 2OA4A 2V9VA 5KK1A 4L9TA 3JW4A 1FYMA 4MEXF 4WXCA 3RJPA 5LEKA 1FBSA 1P2FA 2QQAA 2UXXA 5L3EA 4BHPA 4G7OF 2PEXA 4KDPA 1ZG1A 3T8TA 1MJBA 4UV8A 5DDGA 1BC8C 3QU6A 3GFMA 2GXGA 2HQNA 1XN7A 2P5LC 3BZ6A 3AAFA 3K2ZA 4BQAA 1Z7UA 2Q0OA 1A04A 2WWYA 3IWFA 4GO1A 3M9AA 4ETSA 4PCQA 5J8FA 2QZ8A 1YS6A 3MWMA 2GIVA 2MBFA 4AWXB 2LDUA 1UCRA 1S3JA 5HDGA 1KGSA 4XLPF 2V1DA 4HAMA 3QPTA 4G7HF 3RI4A 3HRSA 1ZHFA 1FYKA 2QWWA 4OIPF 5L3DA 5D6FA 2ZNYA 2CQKA 5FLXZ 3I59A 1HKSA 3FWEA 1R23A 2GQQA 3KCCA 1U5TB 3IHUA 3IRRA 1FX7A 4U7DA 4FX4A 5D6EA 5H20A 5DYMA 2A5YB 3IC7A 3M7GA 2ELHA 4LLGF 1W7PB 4EGZA 4WCGA 2FBKA 5CVJA 2EV5A 2EFPA 1ONVA 5ERIA 4IHSA 3W6KB 2H94A 1R1TA 1KQ8A 4RAYA 4HLXA 3ZN0A 1PP7U 4KMUX 4PGGA 3LSTA 1TQPA 3KLNA 4IJAA 2FSWA 5K5QA 3MAJA 4ZZDA 1BI1A 2XGXA 1QPMA 2FU4A 2NNNA 3IL2A 4O3MA 1MZBA 2LSOA 1XDSA 4OMZA 3RPQA 2LNBA 4IF4A 4UXNA 1W4MA 1ZN2A 2JPCA 5EEGA 4R8HA 1USSA 1O3QA 4WXHA 5L3GA 2R7DA 5DCFA 1U6GA 2H6CA 4HV5A 2C6YA 4P9FA 1HBXG 1LNWA 3RKXA 2CFXA 5LHIA 3HSRA 1ON1A 4S04A 1WSUA 4KT5C 2OZ6A 1P92A 3F8NA 1K78A 4MGRA 1FP2A 1LJ9A 3J80Z 1YFHA 2ZKZA 2DW4A 5J6XA 3DV8A 1S8NA 1Y0UA 3GZ5A 1Z1DA 2HZTA 1I6XA 4RB3C 2M30A 3KZZA 2NRAC 1YW8A 2OAZA 1S7OA 1ZG5A 2OQGA 2JZYA 1G3WA 4WX9A 4A0XA 2AXLA 2YR2A 1YYVA 2MA3A 1ON2A 2EFOA 3ABUA 2PFBA 1K7AA 3GFLA 3ABTA 1I5ZA 3GUDA 4LK0F 5ED4A 1OPCA 1IN6A 3O6BB 2FMLA 1O7FA 1TLHB 2P6SA 4YIFA 4QLCU 1O3SA 1GXPA 4KMFA 3WTTC 1IN5A 3TO9A 3DQVC 4OINF 2IVMA 4WK8F 1X3UA 1FZPB 4AIKA 1GXQA 2W84A 1C0WA 3DKWA 4RGSA 2VONA 2RVCA 4MQVA 3GF2A 4HQMA 2JPBA 1BIAA 4G9YA 4YFNF 3VOEA 1R5HA 5DUKA 4ZH4F 3U1DA 3M8EA 1LDDA 2HWVA 2E1CA 2MLKA 1WI9A 1RI7A 1J9IA 1KU3A 2NNYA 2FQ3A 1UFMA 2KIFA 4IHTA 2A69F 2H27A 2FNAA 1WRJA 3H3ZA 2E7WA 1AWCA 1OKRA 1V4RA 1SFXA 1YLFA 5LLQA 1KQ0A 1I1GA 4OIRF 2MH9A 4HF0A 5HS9A 3KP4A 2RDPA 3BY6A 3T0YA 3HRTA 5ICCA 2DT5A 5CVUA 4MEYF 1XGNA 4XBFA 1TNSA 4GYIA 2QQBA 3CJNA 5H6RA 5BPIA 2FRHA 3LFKA 1DPRA 2BV6A 1QBJA 1FC3A 1GVJA 4K2EA 3P9CA 3ZP5A 2XASA 5E1WA 3KEQA 2D1VA 1TTYA 2Y48A 3E5XA 3ECHA 3TKYA 4B8XA 3FM3A 2XUBA 1WWXA 1YS7A 1G3YA 3TDZC 3BJOA 3QP5A 2L01A 3WGIA 4UVBA 4CGZA 4M9XA 1J5YA 3F23A 1TW3A 2X4HA 6PAXA 1F4KA 3ZMUA 4DQ2A 5E17F 2O03A 1B59A 2HTSA 3RYPA 1R7JA 4ZYDA 3M8FA 3WTWC 1G4DA 1BOAA 1HXDA 3GW2A 4P55A 5J8CA 1ZLJA 5CVIA 3F21A 3K1MA 2IA1A 4P96A 3CDHA 1P4AA 4EQQA 1UHMA 5LBQA 4HDUA 2G7UA 1U8RA 5L3CA 2LKPA 4XSZF 1TW2A 1ZARA 1O3TA 1GHCA 1T98A 3WU1B 4ENNA 5DCMA 3QRFF 1IW7F 2ZMEB 4HYEA 1BJAA 1U2WA 2HKOA 2RQPA 1MJ9A 1PUEE 1OYIA 3K9TA 2GAUA 4OOIA 4LJZF 4WXDA 1S6LA 1XB4A 3HTSB 5DD4A 3CO7C 1S29A 1LEAA 4ESBA 1I27A 1FBQA 3CUQB 4CXFA 2D45A 3MZYA 2F5EA 3KP3A 1T6SA 3ZMSA 2L3DA 2BBYA 3T8RA 5LHGA 3DFGA 2DO7A 2O3FA 1D8KA 4HOBA 5D4RA 4ON0A 2STWA 4G8XA 1FSEA 2DAOA 3TGNA 3KZYA 2BEOA 2P5KA 1QNTA 1T38A 3T5XA 2M8EA 2P4WA 2TDXA 2H6BA 3R0JA 1IF1A 1JHHA 1D8JA 4RGUA 3FMRA 4I2OA 4N9IA 1HKQA 2IA2A 2FMYA 4QWQA 4EJWA 3BPVA 3D5LA 4HA8A 3E5QA 2XKOA 2F5DA 3GXOA 1UB9A 1IN7A 5K1YA 3JSOA 1LEBA 3SXYA 5D5VB 2QBYB 4MHGA 3VEPA 4KUMA 2JRTA 2HYFA 1SD7A 2K4JA 5FLXK 5FD5A 3HHHA 1REPC 3LA2A 1KA8A 4HQEA 2UXNA 4I01A 4OMYA 1FLIA 1TQIA 2L4AA 2BYVE 3PFIA 2FA5A 1B4AA 2ZO4A 4UV9A 1JGSA 5HLGA 3R61A 2HDCA 4DNCA 1Z9CA 3FZVA 1W5TA 2V79A 4CZZA 2HQRA 1XCVA 3WTZA 3BWGA 1KQ9A 3EYIA 1AOYA 2P7VB 4Y13A 4FHTA 2CO5A 1B6AA 2H09A 3R0AA 4U0YA 3GEZA 2FBHA 1SAXA 1RUOA 2P7CB 4JBAA 2W85A 4CICA 1BI0A 3P9KA 2EV0A 4MTEA 3HIFA 2V1UA 4LG0B 3TDUC 1FY7A 2OD5A 2PI0A 3FMQA 4MQ9F 2ZFWA 3F22A 1G6NA 5LRSA 4A12A 3E6CC 1R5GA 2KKOA 1FNNA 2XAGA 4A2UA 1OYYA 3RTRA 5D8LB 3K0LA 2PBIA 2MLGA 2P5VA 1F5TA 4Q48A 5HDNA 3F8BA 1MDMA 3MEXA 2JTVA 1B9NA 1QGPA 2PG4A 1LVAA 3ROUA 3GFIA 3QOPA 4JK1X 2EJRA 1BM9A 2EA2A 1ZLKA 1MJAA 1XCBA 3IKVA 1J75A 1ZRFA 2K7LA 3B02A 4GGGA 4I02A 3J80K 5LRRA 5HOOA 3LQQA 4A5MA 3E97A 5D5XB 2OU2A 2P6TA 2A07F 3WG9A 3L2CA 4L5IA 1J59A 2VOOA 3QU3A 3R4KA 3BDDA 1LQ1A 1UHWA 2XAHA 1JHFA 3KP7A 1BI3A 3SFZA 4G6DA 3SZTA 3IRQA 1QZZA 4M9ZA 4M74A 2DTRA 1U78A 4BH9A 3JTGA 5CLSA 2HFHA 4N0BA 4IXAA 2HGCA 4IVNA 3ZPLA 1EH8A 2W24A 1F1ZA 3BP8A 1XMAA 2CG4A 2IP2A 1K79A 4YG2F 4FT8A 2YPRA 1XD7A 2IW5A 4HF1A 3RKWA 5D4SA 1EH7A 1ZAOA 4Q47A 2IPQX 3MZHA 1Z05A 3WTYC 4Y17A 3W6JB 3DEUA 4U0WA 3DPTA 1T39A 3FM5A 5DEQA 2GWRA 1BI2A 3K69A 3HYIA 4UVCA 2VE9A 1FBUA 1Z6TA 2PJPA 2YU3A 2M87A 3E3VA 1R00A
chains in the Genus database with same CATH superfamily
1SFKA 2L54A 3S2HJ 3C2BA 1E3OC 3EYYA 2K4BA 5DS9A 2KRFA 3V42A 1NHAA 3OSGA 3HPGA 3TMOA 1OR7C 3I59B 4AYBA 3V8JA 3ZXSA 4KNYA 1JTXA 4M6VA 2PMZA 2ZBKA 3K1NA 5J1UA 4A3EJ 3MD2A 3TL4X 2FUG2 3HKZA 3WG7H 3QPHA 3SEZA 3I71A 3SHFA 4A3MJ 1F9NA 1WGXA 5DV5A 4EVIA 2DMTA 2JVHA 2OF7A 2R7RA 2CMPA 1ZREA 2R7FA 4HZFA 3S32A 3HHGA 3JSPA 2WAEA 2HYJA 3F9KA 5EDNA 1L3LA 2D2WA 2YU9J 2Z2SB 1SVMA 3VWBA 5ILSA 5E8GA 1IUFA 3NWTA 3FMSA 3WTSC 2K9MA 2QVOA 4HDVA 3OYDA 5HNHA 2BW3A 4BACA 3PQJA 4KIGA 4AC0A 3MKYB 2WV0A 4GYGA 1JI8A 4TV7A 2XC7A 1XSXA 4E7LA 4UHTA 3FF5A 4E7KA 4G94A 2KRCA 5FFZA 1TNTA 5CQGA 4I76A 4BXFA 5C3EJ 3JRGA 1VQ4I 3ISPA 4L9JA 4QPQA 2VKEA 4PUSA 3CUOA 3TOAA 3BR0A 5LGNA 4YFXF 3TP0A 3I53A 4EJVA 3W2AA 2UWMA 1TQMA 2VBZA 4HV6A 4OU0A 3RPUA 4A6DA 5GPCA 3DWLE 4JP0A 4BJ6C 3JAMZ 1VQ9I 2Y69H 3GX4X 3F8CA 1BBYA 2WBMA 3E5UA 4J19A 3JCUC 4EV0A 1ITYA 5LGTA 1SD5A 4PJMA 3BR1A 3H0GJ 4Y4RA 2LG4A 1U5TC 4M72A 4HNTA 2ZJQF 2HS5A 3NAUA 5B1BH 2H8RA 4EM2A 3CO6C 3BR3A 2FF4A 4B3XA 2DLLA 2NYXA 3B6AA 2DQRA 3FIWA 2KIUA 1BL0A 5E8IA 3ZQ7A 2QQ9A 2HTJA 1NTCA 1SFEA 2ZSHB 3AG4H 4II3A 2HVSA 5BQTA 4V2FA 1ORKA 3E6BA 2R92J 3HOXJ 1USTA 1SANA 3DLLF 4E6KG 4XK4A 3HOYJ 1P4XA 2LC2A 3G1MA 5HS7A 4BE1A 1UJ8A 1B1BA 4KA4A 4CDGA 3OR2C 3RZDJ 2VL8A 4I09A 3P7NA 3LMMA 3Q9VA 2E7XA 3EQLF 4E7IA 4M3EA 2VQGA 5EEHA 3DEWA 2DA4A 1V5FA 2ISZA 3EDPA 4AYBN 2BOLA 2RGVA 5ILVA 2ISYA 1K78B 2YX7A 2M0CA 2PMZN 1NG7A 3FK6A 1RZ4A 1EF4A 2VBWA 1LE8B 3HKZN 3QOEA 2K5CA 5IOZA 2KT0A 1XMXA 1U8BA 1DGWY 2CYYA 3OIPA 2G9WA 3RIRA 2FOWA 1G3SA 5E1XA 4ASNA 4L5JA 4QSHA 1J2XA 4PFOA 2NAZA 1CGPA 1KU7A 2F5VA 3V7RA 3GMEA 1YQAA 4JX5A 3ZMTA 4FASD 3D5RC 1H9TA 3S2DJ 2LBFB 4M6YA 5EEAA 4DBQA 3O3KA 4Q5SF 1MMAA 5E79C 2CS3A 2A3SA 2DJIA 1J7KA 1P4WA 2MG4A 3LSHA 3DPLC 4LLLA 3WE2A 3I55I 2DFEA 4BY7J 1YX3A 3ZCOA 3SDBA 1O7LA 3VYSB 4S0HB 3D0SA 4UNOA 5IPAA 1D0XA 3FKIJ 3SZGA 2EIKH 3WE3A 2LK2A 1RUNA 3LFUA 4MTDA 4DBRA 3RZOJ 3VPRA 4HX8A 2RNJA 3UNGC 1WJFA 2XIGA 4BJ5C 1J0RA 2JN6A 3HTUA 3OL4A 4LIVA 4E7ZA 1A5JA 2DYRH 2GA1A 1CF7A 4ENMA 4ZDOA 2VN2A 4RBOA 5F04A 1A31A 3KE2A 1G59A 5GP9A 1MIJA 3GLXA 2Z16A 3M4OJ 3GLLA 5FFXA 2O8XA 4XN0A 2M34A 3QYBA 3TQNA 3J7AY 4C2TA 1O57A 1JUSA 4LB6B 3CMMA 2E60A 3BJ6A 3S17J 1OR7A 3RPUD 4NHJA 2FE3A 1WJBA 5FB2A 1HSTA 3HRMA 2PN6A 2QENA 2LKSA 3G73A 1R1VA 2KIQA 1QO0D 4GXOA 4KISA 5GPAA 5E3OA 2QSHX 2VOPA 1F43A 2E1NA 3MQ0A 4ZYGA 1S5LC 2J5OA 1S7EA 3K4BA 1RR7A 1D0ZA 2WTEA 4KFCA 4UVAA 1E2XA 3ZQHA 4XLNF 2M45A 1DP7P 4RS8A 2NS0A 3C7JA 2QLZA 2UZKA 4KN7X 1T08B 2RV8A 2D5VA 5LHHA 4MNUA 2HPIA 4RGXA 4XSXF 3FXMA 2AO9A 1DUXC 1JT0A 2EILH 2VODA 5ICGA 1V3FA 4KICA 2IT0A 4L18B 3WTUC 1IRGA 4DZJA 1NH3A 1B72A 3MN2A 2F5CA 5F27A 1D1AA 1XDUA 1VI0A 1Z91A 5ICEA 2IAIA 2KIMA 3CMEI 3OWTA 1TBXA 2B9SA 4HF2A 5CVRA 4D7MA 3WU2C 2XAQA 3ASNH 3K10A 2LREA 3MFKA 4C2MJ 1JGGA 2RN7A 2NS7A 3K4NA 2DMPA 3QODA 2ZNZA 2CFOA 2XHKA 2ESNA 2HOEA 3M8JA 3QPLA 4XRFA 5FROA 3GVAA 2A6EF 1SFUA 2GLOA 2Y2ZA 2NVYJ 2EFNA 1S7AA 3S1QJ 1GVDA 1OQYA 1QVTA 1U5TA 4KIBA 3DP7A 1N78A 4M3BA 5GTIC 3SEQA 2DFIA 1SC7A 1JE8A 1HDDC 1ETOA 2ESHA 2STTA 1FPQA 5LEJA 1E0EA 2TRTA 1OJLA 2QA4I 2R93J 4ZJZA 5KNLA 3KLOA 1PUFA 1Y8RB 3BT9A 4PZJA 3CESA 3COAC 2R5ZA 1W7PA 4ESJA 4LOCA 3ZOBA 3HOSA 2AXTC 2BZTA 2UUZA 2L9SA 2F2EA 3PSIA 1E3PA 4DW6A 4Q4ZF 1N75A 3LNQA 2E1OA 3S2WA 1LFUP 2KJCA 1MBHA 2DODA 3ZMDA 3QQAA 2R5YB 1V5EA 1UZCA 4M3FA 3EETA 3WU0A 1VQNI 2R7QA 4BL0B 2IJLA 2OQRA 1U9NA 3REOA 4BNCA 4XORA 5TRDA 3L00A 2VBXA 3CLOA 1XGMA 1VF9A 4EJTA 2ECCA 2K27A 2VXZA 3PQKA 5AONA 3AL0C 2FBIA 1SD4A 2MYSA 4IPAA 4ITVA 2OBPA 3C2GA 1ZR4A 1X3ZB 5K5OA 5K7HA 5JFRA 2V1XA 3NEUA 3GTLJ 1H88C 1V55H 2OZUA 4FETA 2LY2A 4BQNA 1WJCA 2ZXJA 1I1SA 1MGTA 3OYMA 5FKNA 4Z2YA 1VQLI 2Z3YA 2DTZA 1YRNB 1K83J 3HUGA 2XSJC 5C4XJ 3S3NA 4M73A 1ZGAA 1ACIA 4L0YB 2Y75A 5FLMJ 2PQ8A 1XPXA 2VC0A 2JA5J 2L4MA 1ZRDA 3CTAA 3WHCA 2F6CA 2Y0SN 2JUGA 4CHUA 3OYEA 2LH9A 3H1CA 2NOJB 2A68F 3W2WA 3S1NJ 1PVEA 2O8KA 1SD6A 2DI3A 4BEHB 4ABZA 2DMNA 2LF7A 2QYOA 2LYCA 5CYVA 2ZXIA 2A61A 4ZYHA 4BQOA 1IO2A 3BCAA 5HODA 3JRBA 1IRFA 3ULQB 2LY1A 3SDGA 2X6XA 4BYYA 5J4VA 3HOTA 4HX7A 4PDKA 3GYHX 3JRAA 2ZB9A 1XG1A 2XV4S 3ZMZA 4IZZA 2OCEA 3Q9SA 3H5RA 3HPHA 1FWZA 1EH6A 5LGUA 1VZ0A 2W57A 5A2QK 1YX5A 2WADA 5DCMB 4CO8A 3BC8A 2KZGA 3KIOA 1Q1HA 3O8HA 3KP2A 4JQFA 5KVRA 3U9GA 3PFYA 3GO5A 3OV8A 4P9UA 3MVPA 3CCLI 4C3JJ 2W25A 5E18F 2OTJI 1PP8F 1GV2A 4RB1A 3J7AO 2FQ4A 1TWCJ 3IWZA 3OS2A 1WJDA 1YO5C 2VE8A 4LK1F 3ONQA 2M1BA 4L9NA 2F4OB 4ZDLA 3U2RA 1ZR2A 3KETA 4PFPA 3CCSI 4WF2A 5HVQC 2QSFX 3SJMA 2BVLA 3D5SC 2LF8A 5LFAA 3K1PA 5J40A 1RRJA 1H9GA 4M71A 4BHBA 1R58A 2X0LA 3BTIA 1HLVA 1MKMA 2ID6A 3EUAA 3H9QA 4LMYA 4LLNA 1YW7A 1ZRCA 1W7PD 1X2MA 4AIHA 4RMNA 2HDDA 2VQHA 4I0BA 1FOKA 2ETHA 1ETXA 1XSVA 3WTXC 2QM3A 5A2QZ 3OYKA 3VDXA 1O4XA 3BCBA 4V19K 4IRHA 3N4MA 2IA0A 1ZGJA 5L3BA 1BIBA 1IZ1A 2MC3A 3OS1A 4XLAA 2E2HJ 1XMKA 2HR3A 4XN3A 3L2QA 2FNPA 5AIQA 2Q1ZB 2ZMEC 1ZG3A 3VYUB 3ESWB 2R7SA 1X19A 3WGHA 1JJ8C 3K4MA 3WTVC 3GWZA 2EFWA 3BZKA 3HOWJ 3CC4I 3B73A 1ZYRF 3ZQLA 2K85A 1MBFA 4D1QA 1WVRA 1HW2A 3G1LA 4AIDA 1OISA 2COMA 1HF0A 4XKVA 4UUSA 3Q0UA 3DF8A 1Y0NA 5E1ZB 2DQLA 3TOBA 3VYRB 1SVLA 3LA7A 3PUFA 4LB5A 1D3YA 3M1EA 1G8XA 1XGOA 3AFHA 2K40A 4KN4X 3CUQC 3BROA 4IRIA 4P5OA 3C2HA 2ZSIB 3R60A 2HVQA 5HLHA 3IAS2 3FISA 2D1HA 5C4JJ 2ZJ2A 1R6RA 3ECOA 4EEFG 2GA2A 3KEOA 3PIOF 1E17A 2EIJH 2Y9ZA 3LSKA 5FD6A 2XGDA 1UMQA 1OCCH 2GBYA 1TC3C 4U88A 3A4CA 4A3KJ 2JMWA 2P0WA 4NB5A 3OL3A 1T0FC 4HLYA 2O61A 1H0MA 3HBLA 2DK8A 2F5FA 4Y15A 5JLWA 2PLYA 2CH0A 2PX9A 4B47A 1P6RA 5FRMA 1OMIA 2ICWG 3RKYA 1MNMC 5JHUA 2EB7A 2XF5A 2ZFUA 1WI3A 4IRGA 2XAFA 3FHZA 4B43A 1BR4A 3GBGA 4BDYA 4F55A 2ZCWA 1VQKI 2DU9A 4NC7A 2V1NA 3JTHA 4EM1A 5GAHJ 1IN4A 4CCKA 3KYCB 2EQRA 4IL6C 1FOWA 4PGHA 5F08A 2X1EA 3MCZA 2VBYA 3ASOH 4NBQA 1VTNC 5IYDJ 3GTMJ 4CUGA 1ETVA 3F72A 1OLTA 1IXRC 2COBA 3SQNA 4XRSA 2PMUA 2LD5A 2M5WA 2K02A 2ECBA 1B9MA 1T2KA 3A01B 3RDIA 1LDJA 2XVCA 2E19A 5F64A 4HW0A 4KYWA 2RNGA 4L0ZB 3FKJA 5DUIA 1M1EB 4KJZA 2O6GE 4A0ZA 4NQWA 5L3FA 2M7BA 5E20A 2HOAA 3E6DA 3LAJA 2DK5A 3LWFA 4CYCA 3AKZA 3BR2A 1AKHA 4M9SA 1AHDP 2KP6A 3ZQQA 1TL8A 2AS5F 3DBHB 1FP1D 1QZYA 5F6FA 3WODF 1LB2A 2CW8A 2FOKA 4R1HA 4EATA 4XOTA 3G4SI 5HLIA 2M0MA 4WWCA 2CUZA 1BN5A 3L1PA 4BBRJ 3K2AA 5KAIC 3EUHA 3FX3A 2DA5A 5DD8A 4EM0B 3JAMK 5TJJA 2EBIA 4BJTA 2IS1A 1A6QA 3IH3A 3O2PE 5BOXA 1ZTRA 3F8FA 1HSJA 3L09A 4RDUA 3OYHA 3V8KA 5FO5A 4H0EA 2V9KA 3CF2A 3BOQA 2LVSA 2HXOA 1YITI 3K4CA 3V7SA 3A2KA 1N25A 4U0VA 2HKXA 3BG3A 5JR3A 4LFUA 1DDNA 3CDLA 3P9IA 3TO6A 4HRIA 3W3CA 1T33A 2VB6A 2HYGD 3MKZA 2E1MB 1ETWA 4J00A 3TEDA 3TW7A 2LR8A 4ZZLA 3FXRA 5E3NA 1BR2A 2RAEA 2RC4A 3ZR8X 3G71I 2ACJA 1MH3A 4ENKA 3TW6A 1RR8C 4W1UA 1R22A 3TP3A 1HW5A 1KU9A 1LKXA 2HI3A 2EFQA 3HSEA 2L7FP 3O8GA 4JX4A 4UUVA 1TWFJ 1Z77A 3G3ZA 1TWHJ 1PDNC 3H92A 2XAUA 3H3UA 2X6WA 1FMVA 1XSDA 1MDMB 4AVPA 2DPDA 3VFZA 5EJCA 3GZ6A 3DXJF 1QHHD 5ICFA 2E2IJ 4ZYEA 4XMYA 2LRDA 2Y0MA 2I8DA 4I99C 2WY8Q 1BOBA 3JRCA 4EJOA 2KMUA 2CJJA 2L02A 4DGWB 4FCYA 1TWGJ 1VQMI 3T1BA 3A1YA 2M4GA 4PJLA 3I5UA 2QGUA 4CYDA 3IKTA 3C3WA 1HW1A 1KYZA 1G2HA 3A0BC 1IRXA 1QRYA 3SYTA 4F92B 5KCMA 2ZMEA 4YIIA 3S93A 3V8LA 5EG0A 1YW9A 5M5YJ 1YIOA 5CVVA 2E36A 3F0CA 2KLOA 5DTDA 4EGYA 2XGCA 2XROA 2ADUA 2W00A 2L7ZA 3PNVA 1WH5A 1RNLA 2HU9A 4C3IJ 3DBLB 2YX4A 3RQ4A 4OIOF 2IGKA 4D9JA 1YG2A 3OOPA 2VT3A 3TO7A 1YHQI 2PJRB 4XLCA 3I58A 3CP8A 5K5RA 1WFXA 4EJUA 4A6EA 5IYCJ 2OV7A 4NC6A 5BMZA 1IAWA 4S05A 4I7HA 4O5VA 3L2VA 4Y7NJ 3LSMA 2GOMA 3S14J 4DJAA 1W36C 4BBSJ 2I10A 3CUQA 2R7UA 3BPXA 4AM3A 2DMUA 2LLKA 5AIPA 3J7YJ 1D5YA 3BG9A 4RB0A 3L2WA 4LITA 2B0LA 1MMSA 3I54A 1TWAJ 1IC8A 1QZEA 3OYNA 3I4MJ 3Q0VA 4C2UA 5IT3A 2X48A 3ZN1A 2WC2A 2LMDA 3BTJA 4C30A 3F8MA 3K7AJ 1QQIA 2Q2EA 2VC1A 5ILUA 2EIMH 1T0FA 3J81K 4ZDPA 2L7MP 1KZHA 4IQJA 5CJ9A 1ZQ3P 2X1CA 3ERED 1K6OA 2R3SA 3QP6A 1JXSA 4ENJA 1RKWA 4KIFA 2Z33A 2EA4A 3GFJA 3HGYA 4B09A 2XPWA 4GRIA 1HKTA 4A3IJ 4ZTJA 5F0FA 2XRNA 4FX0A 3LSRA 3GTQJ 1Z6RA 2G7HA 1UAAA 2F4IA 1OCZH 3KEYA 1NG6A 1MNDA 3A03A 2HPMA 4XNFA 5HS8A 2JA6J 3PIPF 1KYWA 3F6OA 3KFWX 1B8IB 2MSYA 2O0YA 4FE4A 3M3YJ 3MZ8A 3K4KA 3C1DA 5KAFC 4NC8A 2KQRA 1ZH5A 1OCTC 3ZQFA 2FXAA 1Z21A 3K70D 1O3RA 2K86A 2CWEA 2RQQA 3OSFA 1WQ2A 1IN8A 2CW0F 4AU7A 1X1PA 1GDTA 3I4PA 4AIJA 3LAPA 1JTYA 1MSEC 2EWNA 5BS6A 3FXJA 4BAYA 2DXIA 1HQCA 1DQUA 2MH2A 4BXUA 3CJRB 2BGCA 2VJJA 3RYRA 2B63J 1X3WB 4I98B 3ZMVA 2EK5A 3FXKA 3HRUA 4O6JA 4A0YA 1RESA 4Y33A 4EMSA 4YFKF 3QAHA 3J81Z 1Y8QB 5CPRB 3QYEA 3LSPA 2EV6A 1X58A 1DPUA 4J01A 2F4MB 4LD5A 3QYFA 2XF7A 4HBLA 1R36A 1SAUA 2QBYA 2BW3B 2H8WA 2M7AA 5EYRA 4MIMA 4G7ZF 4OIQF 1WKMA 4LGWA 2UV1A 4M3GA 1BW5A 4XKBA 3DKXA 2V6CA 1R4NB 2Z9OA 1FTZA 5IT9K 1YTYA 1X1DA 3HSFA 2OC6A 1MSFC 1W1WE 1U3EM 4PSWA 3LQRA 2VT2A 3OMYA 3V7CA 2GOXB 1VNDA 1OYWA 3L9FA 5FKLA 3PM1A 4F7ZA 3I0TA 3Q5FA 3KYDB 2KDOA 1L0OC 1FOYA 1D5VA 2JA7J 1FT9A 2A6HF 4YRVA 4GCVA 4FQGA 5JI6A 2QF7A 4Z6YA 1R49A 1WH7A 1LVKA 1XGSA 1OCOH 1LUJB 5IP6A 5M5XJ 4HX4A 3G6EI 2Q8KA 1LPQA 4CCMA 2X6OA 4M3DA 2CSOA 2RKHA 3F3XA 3ML6A 5D8KB 2Y0SA 2CGPA 5FKKA 3L7WA 4ESFA 3RQIA 4RB2C 2ZJRF 1BC7C 2BHZA 4MLOA 4A5NA 2GZWA 3DTEA 2V9PA 4CCNA 4R79A 1ODDA 4BGDA 4RAZA 3GTOJ 2Z5UA 1FYLA 2BE5F 3VB2A 3E6MA 5DM7F 4N9HA 2DJNA 1R5ID 1R1UA 3BR6A 2PMHA 5JVTA 4BUPA 3CJTB 1G3TA 3EPZA 5D5WB 1RIOH 1SEUA 5K7FA 3I64A 4M6XA 2OTLI 5H6QA 1IJWC 4D0PA 4XQFA 2X51A 3DU5A 4RLQA 5FGMA 2JWTA 4BHCA 1YJWI 2CV2A 2VKHA 5IT9Z 2BXZA 3OOUA 4RGRA 5HDKA 2JK3A 4DYCA 4U7BA 2YSRA 4IQ4A 4L5EA 4RLFA 3GCMA 3WGGA 2EINH 2R7VA 4XICA 1LFBA 3CLQA 5HNFA 3KYLA 5F1RA 2NS8A 3HZJA 5M3FJ 4G6QA 2XKPA 4LG0A 3VODA 5GAEJ 5D5UB 4PSXA 2K9LA 3LSGA 2IRFG 4IHYA 1MD0A 4UB8C 4E70A 1IXSB 3ELKA 3R6SA 2ME0A 4BE2A 1POGA 2MD5A 2KJBA 2MD0A 1KU2A 3KP5A 2QUFA 2XB0X 1YIJI 3EUKL 3TBIA 3G1OA 1VFCA 2BHYA 1LDKB 2CQXA 2WAQA 4A3CJ 1Y39A 2DN0A 1SMYF 1BW6A 1SMTA 1ULYA 3BJAA 1MBGA 3SZPA 5BPDA 1WJAA 9ANTA 3NRVA 2P8TA 2Y31A 4L9VA 2JT1A 1W0UA 2XSDC 1U9OA 3CCEI 4CCJA 2R7XA 3FXQA 4I0AA 3ZQGA 4AD9A 2DA1A 2HQAA 4H4KC 2J5PA 2DPUA 3PO3J 1STZA 3BQZA 3FXUA 5FKMA 5F0CA 3V4GA 2GIZA 2XB5A 4CSWA 3C18A 3H9JA 2VKDA 2DYSH 3F6VA 2Z99A 2GXBA 2IGOA 2XAJA 1FSHA 2DBBA 4IOCF 3N97A 2BVMA 1FEXA 1V54H 2JSCA 2VI6A 3LA3A 3E1SA 1TT5B 3KP6A 2VUMJ 1IV8A 5F1JA 2FEZA 5J47A 1W5SA 2HEOA 1IXCA 1EV7A 1ZELA 2FJ1A 1NK3P 3S1MJ 2OCCH 1IUYA 4ZC3A 3NQOA 4NNJA 1EA3A 2OJED 1IDZA 5E3MA 2L7KA 4KT6A 1CF7B 2OA4A 2V9VA 1JKQC 5KK1A 4L9TA 2E71A 1Z3XA 3JW4A 1FYMA 3DBRB 4MEXF 1YE9A 4WXCA 3RJPA 2K3PA 3CJQB 5LEKA 1FBSA 2ZJPF 3CC2I 2BY1A 2K3FA 5H2FC 1P2FA 2QQAA 2UXXA 5L3EA 4MFEA 1XX5A 4BHPA 4G7OF 4B44A 2VJ5A 2PEXA 2CV0A 1JKRC 4KDPA 1ZG1A 1T95A 4QTRA 3CD6I 1ENHA 3T8TA 3FXOA 1A36A 1MJBA 4UV8A 2MGQA 5DDGA 1UG0A 3JRDA 1BC8C 3QU6A 5FRNA 3GFMA 2GXGA 2HQNA 1XN7A 5EGOA 2CW7A 3DTIA 2P5LC 3BZ6A 4CZCA 3AAFA 3K2ZA 4BQAA 1Z7UA 2Q0OA 1IRZA 1A04A 1X1BA 4XIDA 2WWYA 5GTHC 3IWFA 4GO1A 3M9AA 4ETSA 4PCQA 5JLXA 3E0JB 5J8FA 2QZ8A 1YS6A 3MWMA 3CF5F 4X0GA 1YJ9I 2GIVA 2ZC2A 1W5CC 3H36A 2X6YA 2MBFA 2WAQN 4AWXB 2LDUA 1UCRA 1S3JA 2ID3A 2K9QA 3W2VA 1B72B 5HDGA 1KGSA 3OYFA 1HCRA 2V1DA 4XLPF 4HAMA 3QPTA 5LD2C 4G7HF 1QU3A 3RI4A 1P7JA 3HRSA 1ZHFA 1RC9A 1FYKA 2QWWA 2X9DA 4OIPF 5L3DA 5D6FA 2ZNYA 2MFZA 2CQKA 3HJEA 5FLXZ 3I59A 1HKSA 3FWEA 2DFFA 5K7ZA 2IS4A 4ZYAA 1HDPA 4OWRB 1APLC 2YUSA 1JT6A 1R23A 2GQQA 3KCCA 4E7HA 2M2EA 1WPKA 1XS9A 5FLVA 2ZXWH 1U5TB 3IHUA 3IRRA 1FX7A 4U7DA 4A3BJ 4XLFA 4FX4A 1TZLA 3ABLH 4BS9A 4HSRA 5IY5H 1W36D 5D6EA 2BY3A 5H20A 5DYMA 2A5YB 3H5NA 3IC7A 1PUFB 5JVGF 3M7GA 2ELHA 4LLGF 2R5ZB 1W7PB 4EGZA 2NVTJ 2VJIA 3BTLA 4WCGA 2DA3A 3CMYA 2FBKA 5CVJA 1IG7A 2DA2A 1SFOJ 1NK2P 2EV5A 2EFPA 1ONVA 5ERIA 4IHSA 1FIAA 3W6KB 4B1RA 2H94A 1R1TA 3MMYB 1KQ8A 3X2QH 2VIXA 4RAYA 4HLXA 2LOOA 2DOFA 3ZN0A 5M5WJ 1PP7U 2IGMA 4KMUX 3P5JA 4PGGA 3HM5A 5B3SH 3LSTA 1TQPA 3BLYA 3KLNA 4IJAA 4FTHA 2FSWA 5K5QA 3MAJA 4ZZDA 3CQZJ 2XRLA 1BI1A 2XGXA 3S15J 1QPMA 2FU4A 2NNNA 2A05A 5J4YA 3IL2A 1Y1WJ 1EJ9A 3CDIA 4O3MA 1MZBA 2LSOA 1XDSA 3RKQA 1VQOI 2X85A 1H89C 1FIPA 4XONA 1I3AA 3HUGB 3CCRI 4OMZA 3RPQA 2LNBA 4IF4A 4UXNA 2EZHA 1W4MA 1ZN2A 2K9NA 5C44J 2JPCA 3MKWB 1S72I 5EEGA 1MBJA 4R8HA 2NVQJ 1USSA 1HC8A 4F93B 2MABA 1O3QA 4WXHA 5L3GA 2R7DA 5DCFA 2XGEA 1U6GA 1GUUA 2H6CA 4HV5A 1VQ5I 2C6YA 3Q3SA 1V5GA 4P9FA 1HBXG 1LNWA 4XKWA 4B4CA 3RKXA 1VQ6I 2CFXA 3LSIA 1Y1VJ 4DZPA 5LHIA 3HSRA 4MO7A 1BR1A 3OYAA 1P7IA 1QA6A 1ON1A 4XLHA 4S04A 1A6IA 1WSUA 4FE7A 4KT5C 2OZ6A 1P92A 1HA8A 3F8NA 1K78A 1W0TA 4MGRA 2XPUA 3S1RJ 1FP2A 1LJ9A 1LE8A 1K61A 2CUEA 3UR3C 2W7NA 1Z7LA 2L0KA 3J80Z 2W82A 1YFHA 1MMNA 2ELKA 2M8GX 3ZQCA 2ZKZA 3H9GA 2DW4A 1CQTA 5J6XA 1ETQA 3DV8A 1S8NA 1X2NA 2LTPA 3K6GA 1Y0UA 3GZ5A 4A3DJ 2NVXJ 2DT6A 2DT7B 3D1NI 1PJRA 3OYJA 2LBFA 4C9YA 5J1YA 1Z1DA 2HZTA 3PNTA 1RETA 3CMAI 1I6XA 4RB3C 3PJRA 1JKPC 2M30A 2R4GA 3KZZA 3M07A 2NRAC 1YW8A 2OAZA 1S7OA 1WZ2A 2MC4A 2QEXI 1ZG5A 2OQGA 3CCQI 2QKMB 2JZYA 3K4JA 5TISC 3HEFA 1G3WA 5EZHA 4WX9A 4CCOA 4A0XA 2JUCA 4RAFA 3RCOA 2AXLA 4X1EA 3NARA 2YR2A 1YYVA 4AUXA 2MA3A 1ON2A 2EFOA 3ABUA 5EZGA 1D1CA 1IGNA 2PFBA 3JREA 1K7AA 2FX0A 3GFLA 2CV1A 3KZIC 3H3VK 3ABTA 1WJEA 1I5ZA 3GUDA 4LK0F 5ED4A 1OPCA 1IN6A 1UHSA 3CCYA 5B66C 2A5WA 1D0YA 2HQ5A 3O6BB 1R71A 4IO9F 2IS2A 2FMLA 1MMGA 3CCVI 1WJ5A 2A6TA 2KDZA 1O7FA 1TLHB 2P6SA 4YIFA 3S3MA 4QLCU 1O3SA 1GXPA 4KMFA 4Y3OA 3WTTC 4E7SA 1IN5A 1Z0XA 3TO9A 3DQVC 3I56I 2V26A 4XM3A 1Q1VA 2WA0A 4OINF 4Y52J 2HZDA 2IVMA 4WK8F 1X3UA 3VSKA 4UUSB 1FZPB 1GLNA 4AIKA 1GXQA 2G0EA 2FD5A 2XF6A 3UKGA 2W84A 1Z3YA 1C0WA 3DKWA 4RGSA 1SVOA 4IHXA 2VONA 2JVGA 3CCUI 2LFBA 3A02A 3ZGKA 2RVCA 4MQVA 3GF2A 4HQMA 2QKLB 2H1LA 2JPBA 1BIAA 4G9YA 4YFNF 3VOEA 1R5HA 3FK7A 1X1AA 5DUKA 4ZH4F 3U1DA 5GAGJ 3M8EA 1LDDA 2HWVA 4PJJA 2E1CA 2MLKA 1WI9A 2WAFA 2P81A 1RI7A 2KL4A 2VJ4A 1J9IA 1KU3A 2NNYA 2FQ3A 4F3QA 1UFMA 4A3FJ 4HNVA 2KIFA 1X4PA 4IHTA 1FJLA 4NDLA 2HXIA 2A69F 2H27A 2FNAA 3PO2J 2BY0A 3AL0B 4ANJA 1WRJA 3H3ZA 2E7WA 1AWCA 1OKRA 1V4RA 1SFXA 1YLFA 3BZCA 5LLQA 1KQ0A 1I1GA 4OIRF 2MH9A 4A93J 3VYTB 1ZGWA 5JHFA 2L5QA 3K4LA 4HF0A 3FHNA 5HS9A 3KP4A 2RDPA 2MW8A 3BY6A 1AA7A 3T0YA 1JUMA 2VPLA 4OAYA 3CC7I 3HRTA 4UB6C 4LIUA 3I3LA 1QVUA 5ICCA 2DT5A 4KITB 3KPHA 4JYKA 2HOSA 5CVUA 4MEYF 1QPIA 5BNGA 3HOVJ 1XGNA 4XBFA 1TNSA 4GYIA 2QQBA 3CJNA 5H6RA 4NQWB 5BPIA 1J09A 2FRHA 4C3HJ 3QWLA 2ELJA 3HG9A 4CYCB 1AKHB 3LFKA 2R5YA 1MH4A 3PL8A 1S9HA 3U21A 1DPRA 2V4JC 3JR9A 2BV6A 1QBJA 1FC3A 1GVJA 5J1RA 1VQPI 1K4TA 4K2EA 3P9CA 4JX6A 3ZP5A 2ME6A 4IHVA 2XASA 3DKYA 5E1WA 1RPWA 4BKXA 1P9QC 3BQYA 3KEQA 2D1VA 1N77A 1MMDA 3LL7A 1ETYA 3VSLA 1TTYA 2CUJA 2Y48A 3E5XA 3ECHA 4GDFA 3TKYA 4B8XA 3FM3A 3FBIB 1GT0C 1D1BA 2XUBA 1WWXA 2NOGA 1YS7A 3GTGJ 4A3JJ 1G3YA 3Q0WA 3TDZC 2RREA 3BJOA 3QP5A 1YRNA 3FDYA 1EKEA 2L01A 3WGIA 4GFBA 1DP3A 4N4NB 3A0HC 4UVBA 5HLTA 4M9XA 1JKOC 4CGZA 1IDYA 3ABKH 1J5YA 3F23A 2KZVA 5CKTA 1TW3A 2X4HA 6PAXA 2JSPA 2YS9A 3DPUA 1F4KA 3ZMUA 4DQ2A 2E2JJ 4E4HA 5E17F 2L9RA 3IH2A 2O03A 4F52A 1B59A 2HTSA 3IP4B 3RYPA 1DGRM 4BEHA 2W4SA 1YI2I 1XTAA 1R7JA 4A3GJ 1DU0A 4ZYDA 2EZLA 5EF6A 2DOAA 3M8FA 5B5EC 2I5UA 3WTWC 1G4DA 1VQ7I 1BOAA 1HXDA 3GW2A 4P55A 2JJ7A 1ZLJA 5J8CA 5CVIA 3F21A 2H1KA 3K1MA 4IOAF 2HOTA 2IA1A 3CCMI 4P96A 3CDHA 1P4AA 4EQQA 1XC5A 1UHMA 5LBQA 4HDUA 2DA6A 2G7UA 2VASA 5L3CA 1U8RA 2LKPA 4IX7A 4XSZF 1TW2A 1ZARA 4E7JA 3GTKJ 1ZKGA 3FXLA 1O3TA 2QSGX 1GHCA 1T98A 3DU6A 3WU1B 4ENNA 5DCMA 3QRFF 1LFPA 1IW7F 2KRHA 1HOMA 2ZMEB 2Z1DA 3IUOA 4HYEA 4HPQA 5KHDA 5EG0B 3OYBA 3HDDA 2IS6A 4HG2A 1BJAA 1U2WA 2AQEA 2HKOA 2Y9YA 2RQPA 1WHUA 2E35A 1MJ9A 1PUEE 1IV6A 1OYIA 4DYQA 3PSFA 3HB9A 3K9TA 2GAUA 3NWSA 4OOIA 4LJZF 4A69C 2KPMA 4WXDA 1FTTA 2IGNA 1S6LA 1XB4A 2E1MC 3HTSB 2KFDA 4QIWN 1I3QJ 5DD4A 4D5FA 1S29A 2LY9A 3CO7C 1LEAA 1QHGA 4W97A 4ESBA 2M9HA 3GZNB 1FBQA 1I39A 1I27A 2XPVA 1UELB 3CUQB 4CXFA 4XKCA 5TGTA 2O9LA 2D45A 4PJ0C 2X1DA 2F5EA 3MZYA 3KP3A 4UUTA 1T6SA 3ZMSA 2L3DA 2O7OA 2BBYA 1YJNI 3T8RA 2WY7Q 3BG5A 3HOUJ 3AG1H 5LHGA 4RA2A 3DFGA 2Q2EB 4YIRX 3E7LA 3QPSA 2DO7A 2O3FA 1KONA 3L2RA 1D8KA 1MW7A 2JQ7A 4HOBA 1Z67A 3OIQA 1E3HA 5D4RA 3HC7A 4ON0A 2STWA 4G8XA 2R0QC 1FSEA 2DAOA 3SFIA 3TGNA 1OFCX 1ZK8A 2L2OA 3PUBA 3KZYA 2BEOA 2P5KA 1BJZA 3OYGA 2CQNA 2R7ZJ 1QNTA 2F48A 2WV1A 2EZIA 4CH7A 1T38A 2VQLA 4B3AA 1GV5A 3T5XA 2M8EA 4PJNA 2P4WA 2TDXA 2DCEA 2H6BA 3R0JA 5J3LA 4QPOA 3OS0A 2W48A 1IF1A 1JHHA 3H35A 2HDWA 1D8JA 4RGUA 4BY1J 3FMRA 4I2OA 4N9IA 1HKQA 4BU2A 4CA0A 2IA2A 2FMYA 3IAM2 1VQ8I 4QWQA 2XDVA 4EJWA 5DM6F 4IKFA 3ZQIA 1JUPA 3BPVA 3D5LA 3HXLA 2WB1A 3AG3H 4AVZA 4HA8A 3E5QA 4D5CA 2XKOA 2F5DA 3GXOA 1K6YA 2QQ8A 1UB9A 5F0HA 5IP7J 2LKXA 1IN7A 2IXSA 5K1YA 3JSOA 1LEBA 3FBNB 3I4NJ 2BY2A 4A3LJ 1X1CA 3SXYA 2IBDA 5D5VB 2GXAA 1MNEA 3GTPJ 5CQEA 2KISA 2QBYB 4MHGA 3VEPA 3IV5A 4ZTFA 4KUMA 2JRTA 2HYFA 2L9NA 1SD7A 2HVRA 2K4JA 5FLXK 5FD5A 3HHHA 1REPC 2CU7A 2M4KA 1F36A 2OPTA 4XRMA 1ETKA 4V2GA 3LA2A 1RKTA 1KA8A 2DDAA 4HQEA 2UXNA 4I01A 4OMYA 3H0DA 5E3LA 3N05A 1FLIA 1TQIA 2L4AA 3CP2A 2BYVE 1Y56A 5FKOA 3PFIA 2R7WA 2LP0A 2R7TA 4BXXJ 2FA5A 3DCFA 3A01A 4CCLA 3EUHC 1B4AA 2ZO4A 4UV9A 1JGSA 1FMWA 5HLGA 3R61A 1AU7A 1PYVA 2HDCA 4DNCA 1Z9CA 1H8AC 3I9V2 2R7OA 3FZVA 4IEJA 1W5TA 2V79A 3DTKA 4D7NA 4RM2A 4YELA 1R4MB 2V6EA 1R9TJ 3ZRGA 4JOMA 1I50J 2JRMA 4CZZA 2HQRA 4DIQA 5IP9J 1XCVA 3RSNA 2E5ZA 3WTZA 3BWGA 3OYCA 1KQ9A 5IYBJ 3BG6A 2CRGA 1TP4A 3EYIA 1AOYA 2P7VB 4Y13A 3K70C 1A35A 3DEEA 4FHTA 2CO5A 4PK4A 1B6AA 3LOCA 2EPFA 2H09A 3R0AA 4U0YA 3GEZA 5GADJ 4IHWA 2FBHA 1SAXA 1RUOA 2P7CB 4JBAA 2W85A 4CICA 2CQ7A 4XR6A 3JRHA 1BI0A 3P9KA 2EV0A 3G2BA 4MTEA 2M3AA 1MBKA 1OCRH 3HIFA 2ZXHA 2VKVA 4F91B 2V1UA 2VPRA 4LG0B 1TT0A 3TDUC 1FY7A 2OD5A 2PI0A 3FMQA 4MQ9F 1JJ6C 2ZFWA 3U1KA 3F22A 2VXDA 2O5RA 2VLAA 1G6NA 2KHMA 1OCPA 3JRFA 5LRSA 1DU6A 2Y30A 4A12A 4BE0A 2WB1N 3E6CC 1R5GA 2IEKA 3HOZJ 3S16J 2KKOA 1FNNA 2DOEA 3IH4A 4G6TB 2HNHA 4MFDA 2XAGA 2B7EA 4A2UA 1OYYA 4B48A 4P1WA 2JA8J 2NXNB 3RTRA 5D8LB 3K0LA 4RM3A 2PBIA 1UG2A 2MLGA 2P5VA 3BG7A 4Q48A 5HDNA 2K9SA 3JRIA 3F8BA 3HL2A 1MDMA 1F5TA 3MEXA 3L2UA 2CUFA 4N4OB 4UY8I 2OUMA 2JTVA 2BXYA 4HSTA 1B9NA 1QGPA 1U0JA 2DFHA 1LVAA 2PG4A 3ROUA 3GFIA 3QOPA 3GTJJ 4JK1X 2EJRA 4OAZA 1BM9A 5B1AH 2N8GA 2EA2A 1ZLKA 1MJAA 1XCBA 2AQFA 3IKVA 1J75A 1ZRFA 2GM4A 2K7LA 2JA2A 2E5NA 3B02A 4GGGA 2W1OA 4I02A 5FJ8J 1MBEA 3J80K 5LRRA 5HOOA 3LQQA 4A5MA 3E97A 2DMQA 5D5XB 4FISA 2OU2A 2P6TA 3OYIA 3WG9A 3H5AA 5IOYA 4XRSG 3L2CA 4LG3A 2A07F 4X6AJ 4L5IA 1BA5A 1J59A 2VOOA 3CCJI 1T56A 3QU3A 5M3MJ 1X4OA 3R4KA 3BDDA 1LQ1A 3B6CA 1UHWA 2XAHA 1FOXA 1JHFA 2TCTA 3KP7A 2VQCA 1BI3A 3DLAA 3SFZA 3S8PA 4NUBA 2PJRA 1I6HJ 4G6DA 3SZTA 3IRQA 3ERMA 4XLEA 1QZZA 4M9ZA 4M74A 3MKLA 2DTRA 3WHBA 1U78A 2L9VA 4DOZA 4BH9A 3OR1C 4YEJA 5CLSA 2DDBA 3JTGA 2HFHA 4N0BA 2EZKA 4IXAA 4HNUA 2HGCA 3W6VA 4IVNA 3OIOA 4U87A 3ZPLA 1EH8A 2W24A 3PNYA 1F1ZA 3BP8A 1XMAA 4II2A 2CG4A 3BR5A 2IP2A 4BDZA 4I6ZA 4HEA2 1K79A 2CQQA 4YG2F 4FT8A 2YPRA 3OY9A 3M1CA 2E34A 1ERDA 3HGGA 1WCMJ 5EGOB 1XD7A 2IW5A 4HF1A 3BTCA 3AG2H 3LSJA 3RKWA 3CZ6A 5D4SA 1EH7A 1ZAOA 4Q47A 3OYLA 3S3OA 2IPQX 3KX2A 4G12A 2V7FA 3MZHA 2DA7A 1Z05A 2EH3A 4DYRA 3WTYC 4Y17A 3W6JB 4XL9A 3DEUA 4U0WA 1YOVB 3DPTA 1T39A 3FM5A 5DEQA 2GWRA 1BI2A 3K69A 4RAGA 2NVUB 1T8IA 4XOPA 4BQQA 2QCOA 3HYIA 4UVCA 2VE9A 1FBUA 1Z6TA 1B8IA 2PJPA 2YU3A 2M87A 3E3VA 3J7ZI 1K4SA 2AHQA 3ABMH 1Y6IA 1R00A
chains in the Genus database with same CATH topology
2L54A 3EYYA 2K4BA 2KRFA 1NHAA 3I59B 3V8JA 4KNYA 2ZBKA 3K1NA 3QPHA 3I71A 3SHFA 1F9NA 5DV5A 4EVIA 1ZREA 2R7FA 4HZFA 3HHGA 3JSPA 1L3LA 2D2WA 5ILSA 5E8GA 3FMSA 3WTSC 2QVOA 4HDVA 3PQJA 4KIGA 2WV0A 4GYGA 4TV7A 1XSXA 4UHTA 3FF5A 4G94A 5FFZA 1TNTA 3ISPA 4L9JA 3CUOA 3TOAA 5LGNA 4YFXF 3I53A 4EJVA 2UWMA 1TQMA 2VBZA 4HV6A 4OU0A 3RPUA 4A6DA 3JAMZ 3GX4X 3F8CA 1BBYA 3E5UA 4EV0A 5LGTA 1SD5A 1U5TC 4M72A 2HS5A 4EM2A 3CO6C 2FF4A 2DLLA 2NYXA 2DQRA 2KIUA 5E8IA 3ZQ7A 2QQ9A 2HTJA 1SFEA 5BQTA 3E6BA 1USTA 1P4XA 5HS7A 4KA4A 1B1BA 4CDGA 4I09A 3P7NA 3Q9VA 2E7XA 3EQLF 5EEHA 2ISZA 3EDPA 2RGVA 5ILVA 2ISYA 1K78B 2YX7A 1RZ4A 2VBWA 2CYYA 2G9WA 3RIRA 1G3SA 5E1XA 4ASNA 4L5JA 1J2XA 2NAZA 1CGPA 1KU7A 3V7RA 1YQAA 3ZMTA 1H9TA 4M6YA 3O3KA 4Q5SF 2A3SA 1J7KA 1P4WA 3DPLC 4LLLA 3WE2A 1O7LA 3D0SA 4UNOA 3WE3A 1RUNA 4MTDA 4HX8A 2RNJA 2XIGA 1J0RA 3HTUA 2GA1A 1CF7A 4ENMA 2VN2A 3KE2A 3GLXA 5FFXA 2O8XA 3TQNA 1O57A 4LB6B 3BJ6A 1OR7A 4NHJA 2FE3A 5FB2A 1HSTA 3HRMA 2PN6A 2QENA 3G73A 1R1VA 1QO0D 4GXOA 2VOPA 2E1NA 3MQ0A 4ZYGA 2J5OA 2WTEA 4KFCA 4UVAA 1E2XA 4XLNF 2M45A 1DP7P 4RS8A 2NS0A 3C7JA 2QLZA 2UZKA 4KN7X 2RV8A 5LHHA 4MNUA 4RGXA 4XSXF 1DUXC 2VODA 5ICGA 1V3FA 4KICA 2IT0A 4L18B 3WTUC 1IRGA 2F5CA 1XDUA 1Z91A 5ICEA 2KIMA 4HF2A 1TBXA 5CVRA 2XAQA 3MFKA 2RN7A 2ZNZA 2XHKA 2ESNA 4XRFA 2HOEA 3GVAA 2A6EF 1SFUA 2EFNA 1S7AA 1U5TA 4KIBA 3DP7A 2DFIA 1JE8A 2ESHA 2STTA 1FPQA 5LEJA 3KLOA 4PZJA 3COAC 1W7PA 4ESJA 3HOSA 2F2EA 4Q4ZF 3S2WA 2KJCA 3ZMDA 3EETA 3WU0A 2IJLA 2OQRA 3REOA 4BNCA 5TRDA 3L00A 2VBXA 3CLOA 1XGMA 4EJTA 3PQKA 2K27A 2VXZA 5AONA 2FBIA 1SD4A 4IPAA 2OBPA 5K5OA 5JFRA 2V1XA 3NEUA 2OZUA 2ZXJA 1I1SA 1MGTA 4Z2YA 2Z3YA 3HUGA 4M73A 1ZGAA 4L0YB 2Y75A 2PQ8A 2VC0A 2L4MA 1ZRDA 3CTAA 4CHUA 2A68F 1SD6A 2DI3A 2LF7A 2QYOA 5CYVA 2A61A 4ZYHA 1IRFA 3HOTA 3ULQB 4BYYA 4HX7A 4PDKA 3GYHX 2XV4S 3ZMZA 3Q9SA 1FWZA 1EH6A 5LGUA 2W57A 5A2QK 5DCMB 4CO8A 1Q1HA 3KP2A 4JQFA 5KVRA 3U9GA 3GO5A 3OV8A 4P9UA 2W25A 5E18F 1PP8F 4RB1A 3J7AO 3IWZA 1YO5C 2VE8A 4LK1F 4L9NA 2M1BA 3U2RA 3KETA 4WF2A 5HVQC 2LF8A 3K1PA 1H9GA 4M71A 4BHBA 1R58A 2X0LA 1MKMA 4LMYA 4LLNA 1YW7A 1ZRCA 1W7PD 4AIHA 4I0BA 1FOKA 2ETHA 1XSVA 3WTXC 2QM3A 5A2QZ 4IRHA 3N4MA 2IA0A 1ZGJA 5L3BA 1BIBA 1IZ1A 2MC3A 1XMKA 2HR3A 2FNPA 5AIQA 1ZG3A 3WGHA 3WTVC 3GWZA 2EFWA 3B73A 1ZYRF 1HW2A 2COMA 3DF8A 5E1ZB 2DQLA 3TOBA 3LA7A 4LB5A 1D3YA 3M1EA 1XGOA 4KN4X 3CUQC 3BROA 4IRIA 4P5OA 3R60A 5HLHA 2D1HA 2ZJ2A 3ECOA 2GA2A 3KEOA 1E17A 5FD6A 4U88A 4NB5A 4HLYA 2O61A 1H0MA 2DK8A 2F5FA 4Y15A 2PLYA 1P6RA 1OMIA 3RKYA 5JHUA 2EB7A 4IRGA 2XAFA 3FHZA 2ZCWA 2DU9A 3JTHA 4EM1A 1IN4A 4PGHA 3MCZA 2VBYA 1VTNC 3F72A 3SQNA 1IXRC 2PMUA 2M5WA 2K02A 1B9MA 1T2KA 3RDIA 1LDJA 2XVCA 5F64A 4HW0A 4KYWA 4L0ZB 5DUIA 2O6GE 4A0ZA 4NQWA 5L3FA 5E20A 3E6DA 3LAJA 2DK5A 3LWFA 4M9SA 2AS5F 5F6FA 1FP1D 1QZYA 3WODF 1LB2A 2FOKA 4R1HA 5HLIA 4WWCA 1BN5A 3EUHA 3FX3A 5DD8A 4EM0B 3JAMK 5TJJA 3O2PE 5BOXA 3F8FA 1HSJA 3L09A 3V8KA 5FO5A 4H0EA 3BOQA 3V7SA 4U0VA 2HKXA 1DDNA 5JR3A 4LFUA 3P9IA 3TO6A 2HYGD 4ZZLA 3FXRA 2ACJA 2RC4A 4ENKA 1R22A 1HW5A 1KU9A 2EFQA 3HSEA 4UUVA 3G3ZA 1PDNC 3H92A 3H3UA 1XSDA 1MDMB 4AVPA 2DPDA 3VFZA 3GZ6A 3DXJF 5ICFA 4ZYEA 2Y0MA 4EJOA 2L02A 3T1BA 3I5UA 4CYDA 3IKTA 3C3WA 1HW1A 1KYZA 2ZMEA 4YIIA 3V8LA 1YW9A 1YIOA 5CVVA 4EGYA 2XROA 2ADUA 1RNLA 2YX4A 4OIOF 1YG2A 3OOPA 2VT3A 3TO7A 3I58A 5K5RA 4EJUA 1IAWA 4A6EA 5BMZA 4S05A 4I7HA 4O5VA 3CUQA 3BPXA 5AIPA 4RB0A 2B0LA 3I54A 5IT3A 3ZN1A 2WC2A 3F8MA 1QQIA 2Q2EA 2VC1A 5ILUA 1T0FA 3J81K 5CJ9A 3ERED 1K6OA 2R3SA 3QP6A 1JXSA 4ENJA 4KIFA 2Z33A 2EA4A 3GFJA 4B09A 1HKTA 2XRNA 4FX0A 1Z6RA 2G7HA 5HS8A 1KYWA 3F6OA 3KFWX 2O0YA 3C1DA 1ZH5A 2FXAA 1O3RA 2K86A 2CWEA 1WQ2A 1IN8A 2CW0F 3I4PA 4AIJA 3LAPA 2EWNA 5BS6A 4BAYA 1HQCA 2MH2A 4BXUA 2BGCA 3RYRA 4I98B 3ZMVA 2EK5A 3HRUA 4O6JA 4A0YA 4EMSA 4YFKF 3QAHA 3J81Z 2EV6A 1DPUA 4LD5A 4HBLA 1R36A 2QBYA 4G7ZF 4OIQF 1WKMA 4LGWA 2V6CA 2Z9OA 5IT9K 1YTYA 3HSFA 1U3EM 3LQRA 2VT2A 3V7CA 1OYWA 3L9FA 4F7ZA 3I0TA 3Q5FA 1L0OC 1D5VA 1FT9A 2A6HF 4GCVA 5JI6A 1XGSA 4HX4A 2Q8KA 2CSOA 2RKHA 3F3XA 3ML6A 5D8KB 2CGPA 3L7WA 4ESFA 4RB2C 1BC7C 4A5NA 2GZWA 4R79A 1ODDA 4RAZA 2Z5UA 1FYLA 2BE5F 3VB2A 3E6MA 4N9HA 1R1UA 2PMHA 5JVTA 1G3TA 5D5WB 1RIOH 3I64A 4M6XA 5H6QA 4D0PA 5FGMA 4BHCA 5IT9Z 4RGRA 5HDKA 4U7BA 2YSRA 3WGGA 5F1RA 4G6QA 2XKPA 4LG0A 3VODA 5D5UB 2IRFG 1MD0A 4E70A 1IXSB 3ELKA 3R6SA 2MD5A 2KJBA 1KU2A 3KP5A 2QUFA 1LDKB 1SMYF 1SMTA 1ULYA 3BJAA 3SZPA 5BPDA 3NRVA 2P8TA 4L9VA 2JT1A 3FXQA 4I0AA 4AD9A 2DPUA 2J5PA 1STZA 3FXUA 3V4GA 3C18A 3F6VA 2Z99A 2GXBA 2XAJA 1FSHA 2DBBA 3N97A 2JSCA 3LA3A 3KP6A 2FEZA 1W5SA 2HEOA 1IXCA 1EV7A 1IUYA 3NQOA 1CF7B 2OA4A 2V9VA 5KK1A 4L9TA 3JW4A 1FYMA 4MEXF 4WXCA 3RJPA 5LEKA 1FBSA 1P2FA 2QQAA 2UXXA 5L3EA 4BHPA 4G7OF 2PEXA 4KDPA 1ZG1A 3T8TA 1MJBA 4UV8A 5DDGA 1BC8C 3QU6A 3GFMA 2GXGA 2HQNA 1XN7A 2P5LC 3BZ6A 3AAFA 3K2ZA 4BQAA 1Z7UA 2Q0OA 1A04A 2WWYA 3IWFA 4GO1A 3M9AA 4ETSA 4PCQA 5J8FA 2QZ8A 1YS6A 3MWMA 2GIVA 2MBFA 4AWXB 2LDUA 1UCRA 1S3JA 5HDGA 1KGSA 4XLPF 2V1DA 4HAMA 3QPTA 4G7HF 3RI4A 3HRSA 1ZHFA 1FYKA 2QWWA 4OIPF 5L3DA 5D6FA 2ZNYA 2CQKA 5FLXZ 3I59A 1HKSA 3FWEA 1R23A 2GQQA 3KCCA 1U5TB 3IHUA 3IRRA 1FX7A 4U7DA 4FX4A 5D6EA 5H20A 5DYMA 2A5YB 3IC7A 3M7GA 2ELHA 4LLGF 1W7PB 4EGZA 4WCGA 2FBKA 5CVJA 2EV5A 2EFPA 1ONVA 5ERIA 4IHSA 3W6KB 2H94A 1R1TA 1KQ8A 4RAYA 4HLXA 3ZN0A 1PP7U 4KMUX 4PGGA 3LSTA 1TQPA 3KLNA 4IJAA 2FSWA 5K5QA 3MAJA 4ZZDA 1BI1A 2XGXA 1QPMA 2FU4A 2NNNA 3IL2A 4O3MA 1MZBA 2LSOA 1XDSA 4OMZA 3RPQA 2LNBA 4IF4A 4UXNA 1W4MA 1ZN2A 2JPCA 5EEGA 4R8HA 1USSA 1O3QA 4WXHA 5L3GA 2R7DA 5DCFA 1U6GA 2H6CA 4HV5A 2C6YA 4P9FA 1HBXG 1LNWA 3RKXA 2CFXA 5LHIA 3HSRA 1ON1A 4S04A 1WSUA 4KT5C 2OZ6A 1P92A 3F8NA 1K78A 4MGRA 1FP2A 1LJ9A 3J80Z 1YFHA 2ZKZA 2DW4A 5J6XA 3DV8A 1S8NA 1Y0UA 3GZ5A 1Z1DA 2HZTA 1I6XA 4RB3C 2M30A 3KZZA 2NRAC 1YW8A 2OAZA 1S7OA 1ZG5A 2OQGA 2JZYA 1G3WA 4WX9A 4A0XA 2AXLA 2YR2A 1YYVA 2MA3A 1ON2A 2EFOA 3ABUA 2PFBA 1K7AA 3GFLA 3ABTA 1I5ZA 3GUDA 4LK0F 5ED4A 1OPCA 1IN6A 3O6BB 2FMLA 1O7FA 1TLHB 2P6SA 4YIFA 4QLCU 1O3SA 1GXPA 4KMFA 3WTTC 1IN5A 3TO9A 3DQVC 4OINF 2IVMA 4WK8F 1X3UA 1FZPB 4AIKA 1GXQA 2W84A 1C0WA 3DKWA 4RGSA 2VONA 2RVCA 4MQVA 3GF2A 4HQMA 2JPBA 1BIAA 4G9YA 4YFNF 3VOEA 1R5HA 5DUKA 4ZH4F 3U1DA 3M8EA 1LDDA 2HWVA 2E1CA 2MLKA 1WI9A 1RI7A 1J9IA 1KU3A 2NNYA 2FQ3A 1UFMA 2KIFA 4IHTA 2A69F 2H27A 2FNAA 1WRJA 3H3ZA 2E7WA 1AWCA 1OKRA 1V4RA 1SFXA 1YLFA 5LLQA 1KQ0A 1I1GA 4OIRF 2MH9A 4HF0A 5HS9A 3KP4A 2RDPA 3BY6A 3T0YA 3HRTA 5ICCA 2DT5A 5CVUA 4MEYF 1XGNA 4XBFA 1TNSA 4GYIA 2QQBA 3CJNA 5H6RA 5BPIA 2FRHA 3LFKA 1DPRA 2BV6A 1QBJA 1FC3A 1GVJA 4K2EA 3P9CA 3ZP5A 2XASA 5E1WA 3KEQA 2D1VA 1TTYA 2Y48A 3E5XA 3ECHA 3TKYA 4B8XA 3FM3A 2XUBA 1WWXA 1YS7A 1G3YA 3TDZC 3BJOA 3QP5A 2L01A 3WGIA 4UVBA 4CGZA 4M9XA 1J5YA 3F23A 1TW3A 2X4HA 6PAXA 1F4KA 3ZMUA 4DQ2A 5E17F 2O03A 1B59A 2HTSA 3RYPA 1R7JA 4ZYDA 3M8FA 3WTWC 1G4DA 1BOAA 1HXDA 3GW2A 4P55A 5J8CA 1ZLJA 5CVIA 3F21A 3K1MA 2IA1A 4P96A 3CDHA 1P4AA 4EQQA 1UHMA 5LBQA 4HDUA 2G7UA 1U8RA 5L3CA 2LKPA 4XSZF 1TW2A 1ZARA 1O3TA 1GHCA 1T98A 3WU1B 4ENNA 5DCMA 3QRFF 1IW7F 2ZMEB 4HYEA 1BJAA 1U2WA 2HKOA 2RQPA 1MJ9A 1PUEE 1OYIA 3K9TA 2GAUA 4OOIA 4LJZF 4WXDA 1S6LA 1XB4A 3HTSB 5DD4A 3CO7C 1S29A 1LEAA 4ESBA 1I27A 1FBQA 3CUQB 4CXFA 2D45A 3MZYA 2F5EA 3KP3A 1T6SA 3ZMSA 2L3DA 2BBYA 3T8RA 5LHGA 3DFGA 2DO7A 2O3FA 1D8KA 4HOBA 5D4RA 4ON0A 2STWA 4G8XA 1FSEA 2DAOA 3TGNA 3KZYA 2BEOA 2P5KA 1QNTA 1T38A 3T5XA 2M8EA 2P4WA 2TDXA 2H6BA 3R0JA 1IF1A 1JHHA 1D8JA 4RGUA 3FMRA 4I2OA 4N9IA 1HKQA 2IA2A 2FMYA 4QWQA 4EJWA 3BPVA 3D5LA 4HA8A 3E5QA 2XKOA 2F5DA 3GXOA 1UB9A 1IN7A 5K1YA 3JSOA 1LEBA 3SXYA 5D5VB 2QBYB 4MHGA 3VEPA 4KUMA 2JRTA 2HYFA 1SD7A 2K4JA 5FLXK 5FD5A 3HHHA 1REPC 3LA2A 1KA8A 4HQEA 2UXNA 4I01A 4OMYA 1FLIA 1TQIA 2L4AA 2BYVE 3PFIA 2FA5A 1B4AA 2ZO4A 4UV9A 1JGSA 5HLGA 3R61A 2HDCA 4DNCA 1Z9CA 3FZVA 1W5TA 2V79A 4CZZA 2HQRA 1XCVA 3WTZA 3BWGA 1KQ9A 3EYIA 1AOYA 2P7VB 4Y13A 4FHTA 2CO5A 1B6AA 2H09A 3R0AA 4U0YA 3GEZA 2FBHA 1SAXA 1RUOA 2P7CB 4JBAA 2W85A 4CICA 1BI0A 3P9KA 2EV0A 4MTEA 3HIFA 2V1UA 4LG0B 3TDUC 1FY7A 2OD5A 2PI0A 3FMQA 4MQ9F 2ZFWA 3F22A 1G6NA 5LRSA 4A12A 3E6CC 1R5GA 2KKOA 1FNNA 2XAGA 4A2UA 1OYYA 3RTRA 5D8LB 3K0LA 2PBIA 2MLGA 2P5VA 1F5TA 4Q48A 5HDNA 3F8BA 1MDMA 3MEXA 2JTVA 1B9NA 1QGPA 2PG4A 1LVAA 3ROUA 3GFIA 3QOPA 4JK1X 2EJRA 1BM9A 2EA2A 1ZLKA 1MJAA 1XCBA 3IKVA 1J75A 1ZRFA 2K7LA 3B02A 4GGGA 4I02A 3J80K 5LRRA 5HOOA 3LQQA 4A5MA 3E97A 5D5XB 2OU2A 2P6TA 2A07F 3WG9A 3L2CA 4L5IA 1J59A 2VOOA 3QU3A 3R4KA 3BDDA 1LQ1A 1UHWA 2XAHA 1JHFA 3KP7A 1BI3A 3SFZA 4G6DA 3SZTA 3IRQA 1QZZA 4M9ZA 4M74A 2DTRA 1U78A 4BH9A 3JTGA 5CLSA 2HFHA 4N0BA 4IXAA 2HGCA 4IVNA 3ZPLA 1EH8A 2W24A 1F1ZA 3BP8A 1XMAA 2CG4A 2IP2A 1K79A 4YG2F 4FT8A 2YPRA 1XD7A 2IW5A 4HF1A 3RKWA 5D4SA 1EH7A 1ZAOA 4Q47A 2IPQX 3MZHA 1Z05A 3WTYC 4Y17A 3W6JB 3DEUA 4U0WA 3DPTA 1T39A 3FM5A 5DEQA 2GWRA 1BI2A 3K69A 3HYIA 4UVCA 2VE9A 1FBUA 1Z6TA 2PJPA 2YU3A 2M87A 3E3VA 1R00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L54 A;  3EYY A;  2K4B A;  2KRF A;  1NHA A;  3I59 B;  3V8J A;  4KNY A;  2ZBK A;  3K1N A;  3QPH A;  3I71 A;  3SHF A;  1F9N A;  5DV5 A;  4EVI A;  1ZRE A;  2R7F A;  4HZF A;  3HHG A;  3JSP A;  1L3L A;  2D2W A;  5ILS A;  5E8G A;  3FMS A;  3WTS C;  2QVO A;  4HDV A;  3PQJ A;  4KIG A;  2WV0 A;  4GYG A;  4TV7 A;  1XSX A;  4UHT A;  3FF5 A;  4G94 A;  5FFZ A;  1TNT A;  3ISP A;  4L9J A;  3CUO A;  3TOA A;  5LGN A;  4YFX F;  3I53 A;  4EJV A;  2UWM A;  1TQM A;  2VBZ A;  4HV6 A;  4OU0 A;  3RPU A;  4A6D A;  3JAM Z;  3GX4 X;  3F8C A;  1BBY A;  3E5U A;  4EV0 A;  5LGT A;  1SD5 A;  1U5T C;  4M72 A;  2HS5 A;  4EM2 A;  3CO6 C;  2FF4 A;  2DLL A;  2NYX A;  2DQR A;  2KIU A;  5E8I A;  3ZQ7 A;  2QQ9 A;  2HTJ A;  1SFE A;  5BQT A;  3E6B A;  1UST A;  1P4X A;  5HS7 A;  4KA4 A;  1B1B A;  4CDG A;  4I09 A;  3P7N A;  3Q9V A;  2E7X A;  3EQL F;  5EEH A;  2ISZ A;  3EDP A;  2RGV A;  5ILV A;  2ISY A;  1K78 B;  2YX7 A;  1RZ4 A;  2VBW A;  2CYY A;  2G9W A;  3RIR A;  1G3S A;  5E1X A;  4ASN A;  4L5J A;  1J2X A;  2NAZ A;  1CGP A;  1KU7 A;  3V7R A;  1YQA A;  3ZMT A;  1H9T A;  4M6Y A;  3O3K A;  4Q5S F;  2A3S A;  1J7K A;  1P4W A;  3DPL C;  4LLL A;  3WE2 A;  1O7L A;  3D0S A;  4UNO A;  3WE3 A;  1RUN A;  4MTD A;  4HX8 A;  2RNJ A;  2XIG A;  1J0R A;  3HTU A;  2GA1 A;  1CF7 A;  4ENM A;  2VN2 A;  3KE2 A;  3GLX A;  5FFX A;  2O8X A;  3TQN A;  1O57 A;  4LB6 B;  3BJ6 A;  1OR7 A;  4NHJ A;  2FE3 A;  5FB2 A;  1HST A;  3HRM A;  2PN6 A;  2QEN A;  3G73 A;  1R1V A;  1QO0 D;  4GXO A;  2VOP A;  2E1N A;  3MQ0 A;  4ZYG A;  2J5O A;  2WTE A;  4KFC A;  4UVA A;  1E2X A;  4XLN F;  2M45 A;  1DP7 P;  4RS8 A;  2NS0 A;  3C7J A;  2QLZ A;  2UZK A;  4KN7 X;  2RV8 A;  5LHH A;  4MNU A;  4RGX A;  4XSX F;  1DUX C;  2VOD A;  5ICG A;  1V3F A;  4KIC A;  2IT0 A;  4L18 B;  3WTU C;  1IRG A;  2F5C A;  1XDU A;  1Z91 A;  5ICE A;  2KIM A;  4HF2 A;  1TBX A;  5CVR A;  2XAQ A;  3MFK A;  2RN7 A;  2ZNZ A;  2XHK A;  2ESN A;  4XRF A;  2HOE A;  3GVA A;  2A6E F;  1SFU A;  2EFN A;  1S7A A;  1U5T A;  4KIB A;  3DP7 A;  2DFI A;  1JE8 A;  2ESH A;  2STT A;  1FPQ A;  5LEJ A;  3KLO A;  4PZJ A;  3COA C;  1W7P A;  4ESJ A;  3HOS A;  2F2E A;  4Q4Z F;  3S2W A;  2KJC A;  3ZMD A;  3EET A;  3WU0 A;  2IJL A;  2OQR A;  3REO A;  4BNC A;  5TRD A;  3L00 A;  2VBX A;  3CLO A;  1XGM A;  4EJT A;  3PQK A;  2K27 A;  2VXZ A;  5AON A;  2FBI A;  1SD4 A;  4IPA A;  2OBP A;  5K5O A;  5JFR A;  2V1X A;  3NEU A;  2OZU A;  2ZXJ A;  1I1S A;  1MGT A;  4Z2Y A;  2Z3Y A;  3HUG A;  4M73 A;  1ZGA A;  4L0Y B;  2Y75 A;  2PQ8 A;  2VC0 A;  2L4M A;  1ZRD A;  3CTA A;  4CHU A;  2A68 F;  1SD6 A;  2DI3 A;  2LF7 A;  2QYO A;  5CYV A;  2A61 A;  4ZYH A;  1IRF A;  3HOT A;  3ULQ B;  4BYY A;  4HX7 A;  4PDK A;  3GYH X;  2XV4 S;  3ZMZ A;  3Q9S A;  1FWZ A;  1EH6 A;  5LGU A;  2W57 A;  5A2Q K;  5DCM B;  4CO8 A;  1Q1H A;  3KP2 A;  4JQF A;  5KVR A;  3U9G A;  3GO5 A;  3OV8 A;  4P9U A;  2W25 A;  5E18 F;  1PP8 F;  4RB1 A;  3J7A O;  3IWZ A;  1YO5 C;  2VE8 A;  4LK1 F;  4L9N A;  2M1B A;  3U2R A;  3KET A;  4WF2 A;  5HVQ C;  2LF8 A;  3K1P A;  1H9G A;  4M71 A;  4BHB A;  1R58 A;  2X0L A;  1MKM A;  4LMY A;  4LLN A;  1YW7 A;  1ZRC A;  1W7P D;  4AIH A;  4I0B A;  1FOK A;  2ETH A;  1XSV A;  3WTX C;  2QM3 A;  5A2Q Z;  4IRH A;  3N4M A;  2IA0 A;  1ZGJ A;  5L3B A;  1BIB A;  1IZ1 A;  2MC3 A;  1XMK A;  2HR3 A;  2FNP A;  5AIQ A;  1ZG3 A;  3WGH A;  3WTV C;  3GWZ A;  2EFW A;  3B73 A;  1ZYR F;  1HW2 A;  2COM A;  3DF8 A;  5E1Z B;  2DQL A;  3TOB A;  3LA7 A;  4LB5 A;  1D3Y A;  3M1E A;  1XGO A;  4KN4 X;  3CUQ C;  3BRO A;  4IRI A;  4P5O A;  3R60 A;  5HLH A;  2D1H A;  2ZJ2 A;  3ECO A;  2GA2 A;  3KEO A;  1E17 A;  5FD6 A;  4U88 A;  4NB5 A;  4HLY A;  2O61 A;  1H0M A;  2DK8 A;  2F5F A;  4Y15 A;  2PLY A;  1P6R A;  1OMI A;  3RKY A;  5JHU A;  2EB7 A;  4IRG A;  2XAF A;  3FHZ A;  2ZCW A;  2DU9 A;  3JTH A;  4EM1 A;  1IN4 A;  4PGH A;  3MCZ A;  2VBY A;  1VTN C;  3F72 A;  3SQN A;  1IXR C;  2PMU A;  2M5W A;  2K02 A;  1B9M A;  1T2K A;  3RDI A;  1LDJ A;  2XVC A;  5F64 A;  4HW0 A;  4KYW A;  4L0Z B;  5DUI A;  2O6G E;  4A0Z A;  4NQW A;  5L3F A;  5E20 A;  3E6D A;  3LAJ A;  2DK5 A;  3LWF A;  4M9S A;  2AS5 F;  5F6F A;  1FP1 D;  1QZY A;  3WOD F;  1LB2 A;  2FOK A;  4R1H A;  5HLI A;  4WWC A;  1BN5 A;  3EUH A;  3FX3 A;  5DD8 A;  4EM0 B;  3JAM K;  5TJJ A;  3O2P E;  5BOX A;  3F8F A;  1HSJ A;  3L09 A;  3V8K A;  5FO5 A;  4H0E A;  3BOQ A;  3V7S A;  4U0V A;  2HKX A;  1DDN A;  5JR3 A;  4LFU A;  3P9I A;  3TO6 A;  2HYG D;  4ZZL A;  3FXR A;  2ACJ A;  2RC4 A;  4ENK A;  1R22 A;  1HW5 A;  1KU9 A;  2EFQ A;  3HSE A;  4UUV A;  3G3Z A;  1PDN C;  3H92 A;  3H3U A;  1XSD A;  1MDM B;  4AVP A;  2DPD A;  3VFZ A;  3GZ6 A;  3DXJ F;  5ICF A;  4ZYE A;  2Y0M A;  4EJO A;  2L02 A;  3T1B A;  3I5U A;  4CYD A;  3IKT A;  3C3W A;  1HW1 A;  1KYZ A;  2ZME A;  4YII A;  3V8L A;  1YW9 A;  1YIO A;  5CVV A;  4EGY A;  2XRO A;  2ADU A;  1RNL A;  2YX4 A;  4OIO F;  1YG2 A;  3OOP A;  2VT3 A;  3TO7 A;  3I58 A;  5K5R A;  4EJU A;  1IAW A;  4A6E A;  5BMZ A;  4S05 A;  4I7H A;  4O5V A;  3CUQ A;  3BPX A;  5AIP A;  4RB0 A;  2B0L A;  3I54 A;  5IT3 A;  3ZN1 A;  2WC2 A;  3F8M A;  1QQI A;  2Q2E A;  2VC1 A;  5ILU A;  1T0F A;  3J81 K;  5CJ9 A;  3ERE D;  1K6O A;  2R3S A;  3QP6 A;  1JXS A;  4ENJ A;  4KIF A;  2Z33 A;  2EA4 A;  3GFJ A;  4B09 A;  1HKT A;  2XRN A;  4FX0 A;  1Z6R A;  2G7H A;  5HS8 A;  1KYW A;  3F6O A;  3KFW X;  2O0Y A;  3C1D A;  1ZH5 A;  2FXA A;  1O3R A;  2K86 A;  2CWE A;  1WQ2 A;  1IN8 A;  2CW0 F;  3I4P A;  4AIJ A;  3LAP A;  2EWN A;  5BS6 A;  4BAY A;  1HQC A;  2MH2 A;  4BXU A;  2BGC A;  3RYR A;  4I98 B;  3ZMV A;  2EK5 A;  3HRU A;  4O6J A;  4A0Y A;  4EMS A;  4YFK F;  3QAH A;  3J81 Z;  2EV6 A;  1DPU A;  4LD5 A;  4HBL A;  1R36 A;  2QBY A;  4G7Z F;  4OIQ F;  1WKM A;  4LGW A;  2V6C A;  2Z9O A;  5IT9 K;  1YTY A;  3HSF A;  1U3E M;  3LQR A;  2VT2 A;  3V7C A;  1OYW A;  3L9F A;  4F7Z A;  3I0T A;  3Q5F A;  1L0O C;  1D5V A;  1FT9 A;  2A6H F;  4GCV A;  5JI6 A;  1XGS A;  4HX4 A;  2Q8K A;  2CSO A;  2RKH A;  3F3X A;  3ML6 A;  5D8K B;  2CGP A;  3L7W A;  4ESF A;  4RB2 C;  1BC7 C;  4A5N A;  2GZW A;  4R79 A;  1ODD A;  4RAZ A;  2Z5U A;  1FYL A;  2BE5 F;  3VB2 A;  3E6M A;  4N9H A;  1R1U A;  2PMH A;  5JVT A;  1G3T A;  5D5W B;  1RIO H;  3I64 A;  4M6X A;  5H6Q A;  4D0P A;  5FGM A;  4BHC A;  5IT9 Z;  4RGR A;  5HDK A;  4U7B A;  2YSR A;  3WGG A;  5F1R A;  4G6Q A;  2XKP A;  4LG0 A;  3VOD A;  5D5U B;  2IRF G;  1MD0 A;  4E70 A;  1IXS B;  3ELK A;  3R6S A;  2MD5 A;  2KJB A;  1KU2 A;  3KP5 A;  2QUF A;  1LDK B;  1SMY F;  1SMT A;  1ULY A;  3BJA A;  3SZP A;  5BPD A;  3NRV A;  2P8T A;  4L9V A;  2JT1 A;  3FXQ A;  4I0A A;  4AD9 A;  2DPU A;  2J5P A;  1STZ A;  3FXU A;  3V4G A;  3C18 A;  3F6V A;  2Z99 A;  2GXB A;  2XAJ A;  1FSH A;  2DBB A;  3N97 A;  2JSC A;  3LA3 A;  3KP6 A;  2FEZ A;  1W5S A;  2HEO A;  1IXC A;  1EV7 A;  1IUY A;  3NQO A;  1CF7 B;  2OA4 A;  2V9V A;  5KK1 A;  4L9T A;  3JW4 A;  1FYM A;  4MEX F;  4WXC A;  3RJP A;  5LEK A;  1FBS A;  1P2F A;  2QQA A;  2UXX A;  5L3E A;  4BHP A;  4G7O F;  2PEX A;  4KDP A;  1ZG1 A;  3T8T A;  1MJB A;  4UV8 A;  5DDG A;  1BC8 C;  3QU6 A;  3GFM A;  2GXG A;  2HQN A;  1XN7 A;  2P5L C;  3BZ6 A;  3AAF A;  3K2Z A;  4BQA A;  1Z7U A;  2Q0O A;  1A04 A;  2WWY A;  3IWF A;  4GO1 A;  3M9A A;  4ETS A;  4PCQ A;  5J8F A;  2QZ8 A;  1YS6 A;  3MWM A;  2GIV A;  2MBF A;  4AWX B;  2LDU A;  1UCR A;  1S3J A;  5HDG A;  1KGS A;  4XLP F;  2V1D A;  4HAM A;  3QPT A;  4G7H F;  3RI4 A;  3HRS A;  1ZHF A;  1FYK A;  2QWW A;  4OIP F;  5L3D A;  5D6F A;  2ZNY A;  2CQK A;  5FLX Z;  3I59 A;  1HKS A;  3FWE A;  1R23 A;  2GQQ A;  3KCC A;  1U5T B;  3IHU A;  3IRR A;  1FX7 A;  4U7D A;  4FX4 A;  5D6E A;  5H20 A;  5DYM A;  2A5Y B;  3IC7 A;  3M7G A;  2ELH A;  4LLG F;  1W7P B;  4EGZ A;  4WCG A;  2FBK A;  5CVJ A;  2EV5 A;  2EFP A;  1ONV A;  5ERI A;  4IHS A;  3W6K B;  2H94 A;  1R1T A;  1KQ8 A;  4RAY A;  4HLX A;  3ZN0 A;  1PP7 U;  4KMU X;  4PGG A;  3LST A;  1TQP A;  3KLN A;  4IJA A;  2FSW A;  5K5Q A;  3MAJ A;  4ZZD A;  1BI1 A;  2XGX A;  1QPM A;  2FU4 A;  2NNN A;  3IL2 A;  4O3M A;  1MZB A;  2LSO A;  1XDS A;  4OMZ A;  3RPQ A;  2LNB A;  4IF4 A;  4UXN A;  1W4M A;  1ZN2 A;  2JPC A;  5EEG A;  4R8H A;  1USS A;  1O3Q A;  4WXH A;  5L3G A;  2R7D A;  5DCF A;  1U6G A;  2H6C A;  4HV5 A;  2C6Y A;  4P9F A;  1HBX G;  1LNW A;  3RKX A;  2CFX A;  5LHI A;  3HSR A;  1ON1 A;  4S04 A;  1WSU A;  4KT5 C;  2OZ6 A;  1P92 A;  3F8N A;  1K78 A;  4MGR A;  1FP2 A;  1LJ9 A;  3J80 Z;  1YFH A;  2ZKZ A;  2DW4 A;  5J6X A;  3DV8 A;  1S8N A;  1Y0U A;  3GZ5 A;  1Z1D A;  2HZT A;  1I6X A;  4RB3 C;  2M30 A;  3KZZ A;  2NRA C;  1YW8 A;  2OAZ A;  1S7O A;  1ZG5 A;  2OQG A;  2JZY A;  1G3W A;  4WX9 A;  4A0X A;  2AXL A;  2YR2 A;  1YYV A;  2MA3 A;  1ON2 A;  2EFO A;  3ABU A;  2PFB A;  1K7A A;  3GFL A;  3ABT A;  1I5Z A;  3GUD A;  4LK0 F;  5ED4 A;  1OPC A;  1IN6 A;  3O6B B;  2FML A;  1O7F A;  1TLH B;  2P6S A;  4YIF A;  4QLC U;  1O3S A;  1GXP A;  4KMF A;  3WTT C;  1IN5 A;  3TO9 A;  3DQV C;  4OIN F;  2IVM A;  4WK8 F;  1X3U A;  1FZP B;  4AIK A;  1GXQ A;  2W84 A;  1C0W A;  3DKW A;  4RGS A;  2VON A;  2RVC A;  4MQV A;  3GF2 A;  4HQM A;  2JPB A;  1BIA A;  4G9Y A;  4YFN F;  3VOE A;  1R5H A;  5DUK A;  4ZH4 F;  3U1D A;  3M8E A;  1LDD A;  2HWV A;  2E1C A;  2MLK A;  1WI9 A;  1RI7 A;  1J9I A;  1KU3 A;  2NNY A;  2FQ3 A;  1UFM A;  2KIF A;  4IHT A;  2A69 F;  2H27 A;  2FNA A;  1WRJ A;  3H3Z A;  2E7W A;  1AWC A;  1OKR A;  1V4R A;  1SFX A;  1YLF A;  5LLQ A;  1KQ0 A;  1I1G A;  4OIR F;  2MH9 A;  4HF0 A;  5HS9 A;  3KP4 A;  2RDP A;  3BY6 A;  3T0Y A;  3HRT A;  5ICC A;  2DT5 A;  5CVU A;  4MEY F;  1XGN A;  4XBF A;  1TNS A;  4GYI A;  2QQB A;  3CJN A;  5H6R A;  5BPI A;  2FRH A;  3LFK A;  1DPR A;  2BV6 A;  1QBJ A;  1FC3 A;  1GVJ A;  4K2E A;  3P9C A;  3ZP5 A;  2XAS A;  5E1W A;  3KEQ A;  2D1V A;  1TTY A;  2Y48 A;  3E5X A;  3ECH A;  3TKY A;  4B8X A;  3FM3 A;  2XUB A;  1WWX A;  1YS7 A;  1G3Y A;  3TDZ C;  3BJO A;  3QP5 A;  2L01 A;  3WGI A;  4UVB A;  4CGZ A;  4M9X A;  1J5Y A;  3F23 A;  1TW3 A;  2X4H A;  6PAX A;  1F4K A;  3ZMU A;  4DQ2 A;  5E17 F;  2O03 A;  1B59 A;  2HTS A;  3RYP A;  1R7J A;  4ZYD A;  3M8F A;  3WTW C;  1G4D A;  1BOA A;  1HXD A;  3GW2 A;  4P55 A;  5J8C A;  1ZLJ A;  5CVI A;  3F21 A;  3K1M A;  2IA1 A;  4P96 A;  3CDH A;  1P4A A;  4EQQ A;  1UHM A;  5LBQ A;  4HDU A;  2G7U A;  1U8R A;  5L3C A;  2LKP A;  4XSZ F;  1TW2 A;  1ZAR A;  1O3T A;  1GHC A;  1T98 A;  3WU1 B;  4ENN A;  5DCM A;  3QRF F;  1IW7 F;  2ZME B;  4HYE A;  1BJA A;  1U2W A;  2HKO A;  2RQP A;  1MJ9 A;  1PUE E;  1OYI A;  3K9T A;  2GAU A;  4OOI A;  4LJZ F;  4WXD A;  1S6L A;  1XB4 A;  3HTS B;  5DD4 A;  3CO7 C;  1S29 A;  1LEA A;  4ESB A;  1I27 A;  1FBQ A;  3CUQ B;  4CXF A;  2D45 A;  3MZY A;  2F5E A;  3KP3 A;  1T6S A;  3ZMS A;  2L3D A;  2BBY A;  3T8R A;  5LHG A;  3DFG A;  2DO7 A;  2O3F A;  1D8K A;  4HOB A;  5D4R A;  4ON0 A;  2STW A;  4G8X A;  1FSE A;  2DAO A;  3TGN A;  3KZY A;  2BEO A;  2P5K A;  1QNT A;  1T38 A;  3T5X A;  2M8E A;  2P4W A;  2TDX A;  2H6B A;  3R0J A;  1IF1 A;  1JHH A;  1D8J A;  4RGU A;  3FMR A;  4I2O A;  4N9I A;  1HKQ A;  2IA2 A;  2FMY A;  4QWQ A;  4EJW A;  3BPV A;  3D5L A;  4HA8 A;  3E5Q A;  2XKO A;  2F5D A;  3GXO A;  1UB9 A;  1IN7 A;  5K1Y A;  3JSO A;  1LEB A;  3SXY A;  5D5V B;  2QBY B;  4MHG A;  3VEP A;  4KUM A;  2JRT A;  2HYF A;  1SD7 A;  2K4J A;  5FLX K;  5FD5 A;  3HHH A;  1REP C;  3LA2 A;  1KA8 A;  4HQE A;  2UXN A;  4I01 A;  4OMY A;  1FLI A;  1TQI A;  2L4A A;  2BYV E;  3PFI A;  2FA5 A;  1B4A A;  2ZO4 A;  4UV9 A;  1JGS A;  5HLG A;  3R61 A;  2HDC A;  4DNC A;  1Z9C A;  3FZV A;  1W5T A;  2V79 A;  4CZZ A;  2HQR A;  1XCV A;  3WTZ A;  3BWG A;  1KQ9 A;  3EYI A;  1AOY A;  2P7V B;  4Y13 A;  4FHT A;  2CO5 A;  1B6A A;  2H09 A;  3R0A A;  4U0Y A;  3GEZ A;  2FBH A;  1SAX A;  1RUO A;  2P7C B;  4JBA A;  2W85 A;  4CIC A;  1BI0 A;  3P9K A;  2EV0 A;  4MTE A;  3HIF A;  2V1U A;  4LG0 B;  3TDU C;  1FY7 A;  2OD5 A;  2PI0 A;  3FMQ A;  4MQ9 F;  2ZFW A;  3F22 A;  1G6N A;  5LRS A;  4A12 A;  3E6C C;  1R5G A;  2KKO A;  1FNN A;  2XAG A;  4A2U A;  1OYY A;  3RTR A;  5D8L B;  3K0L A;  2PBI A;  2MLG A;  2P5V A;  1F5T A;  4Q48 A;  5HDN A;  3F8B A;  1MDM A;  3MEX A;  2JTV A;  1B9N A;  1QGP A;  2PG4 A;  1LVA A;  3ROU A;  3GFI A;  3QOP A;  4JK1 X;  2EJR A;  1BM9 A;  2EA2 A;  1ZLK A;  1MJA A;  1XCB A;  3IKV A;  1J75 A;  1ZRF A;  2K7L A;  3B02 A;  4GGG A;  4I02 A;  3J80 K;  5LRR A;  5HOO A;  3LQQ A;  4A5M A;  3E97 A;  5D5X B;  2OU2 A;  2P6T A;  2A07 F;  3WG9 A;  3L2C A;  4L5I A;  1J59 A;  2VOO A;  3QU3 A;  3R4K A;  3BDD A;  1LQ1 A;  1UHW A;  2XAH A;  1JHF A;  3KP7 A;  1BI3 A;  3SFZ A;  4G6D A;  3SZT A;  3IRQ A;  1QZZ A;  4M9Z A;  4M74 A;  2DTR A;  1U78 A;  4BH9 A;  3JTG A;  5CLS A;  2HFH A;  4N0B A;  4IXA A;  2HGC A;  4IVN A;  3ZPL A;  1EH8 A;  2W24 A;  1F1Z A;  3BP8 A;  1XMA A;  2CG4 A;  2IP2 A;  1K79 A;  4YG2 F;  4FT8 A;  2YPR A;  1XD7 A;  2IW5 A;  4HF1 A;  3RKW A;  5D4S A;  1EH7 A;  1ZAO A;  4Q47 A;  2IPQ X;  3MZH A;  1Z05 A;  3WTY C;  4Y17 A;  3W6J B;  3DEU A;  4U0W A;  3DPT A;  1T39 A;  3FM5 A;  5DEQ A;  2GWR A;  1BI2 A;  3K69 A;  3HYI A;  4UVC A;  2VE9 A;  1FBU A;  1Z6T A;  2PJP A;  2YU3 A;  2M87 A;  3E3V A;  1R00 A; 
#chains in the Genus database with same CATH topology
 1SFK A;  2L54 A;  3S2H J;  3C2B A;  1E3O C;  3EYY A;  2K4B A;  5DS9 A;  2KRF A;  3V42 A;  1NHA A;  3OSG A;  3HPG A;  3TMO A;  1OR7 C;  3I59 B;  4AYB A;  3V8J A;  3ZXS A;  4KNY A;  1JTX A;  4M6V A;  2PMZ A;  2ZBK A;  3K1N A;  5J1U A;  4A3E J;  3MD2 A;  3TL4 X;  2FUG 2;  3HKZ A;  3WG7 H;  3QPH A;  3SEZ A;  3I71 A;  3SHF A;  4A3M J;  1F9N A;  1WGX A;  5DV5 A;  4EVI A;  2DMT A;  2JVH A;  2OF7 A;  2R7R A;  2CMP A;  1ZRE A;  2R7F A;  4HZF A;  3S32 A;  3HHG A;  3JSP A;  2WAE A;  2HYJ A;  3F9K A;  5EDN A;  1L3L A;  2D2W A;  2YU9 J;  2Z2S B;  1SVM A;  3VWB A;  5ILS A;  5E8G A;  1IUF A;  3NWT A;  3FMS A;  3WTS C;  2K9M A;  2QVO A;  4HDV A;  3OYD A;  5HNH A;  2BW3 A;  4BAC A;  3PQJ A;  4KIG A;  4AC0 A;  3MKY B;  2WV0 A;  4GYG A;  1JI8 A;  4TV7 A;  2XC7 A;  1XSX A;  4E7L A;  4UHT A;  3FF5 A;  4E7K A;  4G94 A;  2KRC A;  5FFZ A;  1TNT A;  5CQG A;  4I76 A;  4BXF A;  5C3E J;  3JRG A;  1VQ4 I;  3ISP A;  4L9J A;  4QPQ A;  2VKE A;  4PUS A;  3CUO A;  3TOA A;  3BR0 A;  5LGN A;  4YFX F;  3TP0 A;  3I53 A;  4EJV A;  3W2A A;  2UWM A;  1TQM A;  2VBZ A;  4HV6 A;  4OU0 A;  3RPU A;  4A6D A;  5GPC A;  3DWL E;  4JP0 A;  4BJ6 C;  3JAM Z;  1VQ9 I;  2Y69 H;  3GX4 X;  3F8C A;  1BBY A;  2WBM A;  3E5U A;  4J19 A;  3JCU C;  4EV0 A;  1ITY A;  5LGT A;  1SD5 A;  4PJM A;  3BR1 A;  3H0G J;  4Y4R A;  2LG4 A;  1U5T C;  4M72 A;  4HNT A;  2ZJQ F;  2HS5 A;  3NAU A;  5B1B H;  2H8R A;  4EM2 A;  3CO6 C;  3BR3 A;  2FF4 A;  4B3X A;  2DLL A;  2NYX A;  3B6A A;  2DQR A;  3FIW A;  2KIU A;  1BL0 A;  5E8I A;  3ZQ7 A;  2QQ9 A;  2HTJ A;  1NTC A;  1SFE A;  2ZSH B;  3AG4 H;  4II3 A;  2HVS A;  5BQT A;  4V2F A;  1ORK A;  3E6B A;  2R92 J;  3HOX J;  1UST A;  1SAN A;  3DLL F;  4E6K G;  4XK4 A;  3HOY J;  1P4X A;  2LC2 A;  3G1M A;  5HS7 A;  4BE1 A;  1UJ8 A;  1B1B A;  4KA4 A;  4CDG A;  3OR2 C;  3RZD J;  2VL8 A;  4I09 A;  3P7N A;  3LMM A;  3Q9V A;  2E7X A;  3EQL F;  4E7I A;  4M3E A;  2VQG A;  5EEH A;  3DEW A;  2DA4 A;  1V5F A;  2ISZ A;  3EDP A;  4AYB N;  2BOL A;  2RGV A;  5ILV A;  2ISY A;  1K78 B;  2YX7 A;  2M0C A;  2PMZ N;  1NG7 A;  3FK6 A;  1RZ4 A;  1EF4 A;  2VBW A;  1LE8 B;  3HKZ N;  3QOE A;  2K5C A;  5IOZ A;  2KT0 A;  1XMX A;  1U8B A;  1DGW Y;  2CYY A;  3OIP A;  2G9W A;  3RIR A;  2FOW A;  1G3S A;  5E1X A;  4ASN A;  4L5J A;  4QSH A;  1J2X A;  4PFO A;  2NAZ A;  1CGP A;  1KU7 A;  2F5V A;  3V7R A;  3GME A;  1YQA A;  4JX5 A;  3ZMT A;  4FAS D;  3D5R C;  1H9T A;  3S2D J;  2LBF B;  4M6Y A;  5EEA A;  4DBQ A;  3O3K A;  4Q5S F;  1MMA A;  5E79 C;  2CS3 A;  2A3S A;  2DJI A;  1J7K A;  1P4W A;  2MG4 A;  3LSH A;  3DPL C;  4LLL A;  3WE2 A;  3I55 I;  2DFE A;  4BY7 J;  1YX3 A;  3ZCO A;  3SDB A;  1O7L A;  3VYS B;  4S0H B;  3D0S A;  4UNO A;  5IPA A;  1D0X A;  3FKI J;  3SZG A;  2EIK H;  3WE3 A;  2LK2 A;  1RUN A;  3LFU A;  4MTD A;  4DBR A;  3RZO J;  3VPR A;  4HX8 A;  2RNJ A;  3UNG C;  1WJF A;  2XIG A;  4BJ5 C;  1J0R A;  2JN6 A;  3HTU A;  3OL4 A;  4LIV A;  4E7Z A;  1A5J A;  2DYR H;  2GA1 A;  1CF7 A;  4ENM A;  4ZDO A;  2VN2 A;  4RBO A;  5F04 A;  1A31 A;  3KE2 A;  1G59 A;  5GP9 A;  1MIJ A;  3GLX A;  2Z16 A;  3M4O J;  3GLL A;  5FFX A;  2O8X A;  4XN0 A;  2M34 A;  3QYB A;  3TQN A;  3J7A Y;  4C2T A;  1O57 A;  1JUS A;  4LB6 B;  3CMM A;  2E60 A;  3BJ6 A;  3S17 J;  1OR7 A;  3RPU D;  4NHJ A;  2FE3 A;  1WJB A;  5FB2 A;  1HST A;  3HRM A;  2PN6 A;  2QEN A;  2LKS A;  3G73 A;  1R1V A;  2KIQ A;  1QO0 D;  4GXO A;  4KIS A;  5GPA A;  5E3O A;  2QSH X;  2VOP A;  1F43 A;  2E1N A;  3MQ0 A;  4ZYG A;  1S5L C;  2J5O A;  1S7E A;  3K4B A;  1RR7 A;  1D0Z A;  2WTE A;  4KFC A;  4UVA A;  1E2X A;  3ZQH A;  4XLN F;  2M45 A;  1DP7 P;  4RS8 A;  2NS0 A;  3C7J A;  2QLZ A;  2UZK A;  4KN7 X;  1T08 B;  2RV8 A;  2D5V A;  5LHH A;  4MNU A;  2HPI A;  4RGX A;  4XSX F;  3FXM A;  2AO9 A;  1DUX C;  1JT0 A;  2EIL H;  2VOD A;  5ICG A;  1V3F A;  4KIC A;  2IT0 A;  4L18 B;  3WTU C;  1IRG A;  4DZJ A;  1NH3 A;  1B72 A;  3MN2 A;  2F5C A;  5F27 A;  1D1A A;  1XDU A;  1VI0 A;  1Z91 A;  5ICE A;  2IAI A;  2KIM A;  3CME I;  3OWT A;  1TBX A;  2B9S A;  4HF2 A;  5CVR A;  4D7M A;  3WU2 C;  2XAQ A;  3ASN H;  3K10 A;  2LRE A;  3MFK A;  4C2M J;  1JGG A;  2RN7 A;  2NS7 A;  3K4N A;  2DMP A;  3QOD A;  2ZNZ A;  2CFO A;  2XHK A;  2ESN A;  2HOE A;  3M8J A;  3QPL A;  4XRF A;  5FRO A;  3GVA A;  2A6E F;  1SFU A;  2GLO A;  2Y2Z A;  2NVY J;  2EFN A;  1S7A A;  3S1Q J;  1GVD A;  1OQY A;  1QVT A;  1U5T A;  4KIB A;  3DP7 A;  1N78 A;  4M3B A;  5GTI C;  3SEQ A;  2DFI A;  1SC7 A;  1JE8 A;  1HDD C;  1ETO A;  2ESH A;  2STT A;  1FPQ A;  5LEJ A;  1E0E A;  2TRT A;  1OJL A;  2QA4 I;  2R93 J;  4ZJZ A;  5KNL A;  3KLO A;  1PUF A;  1Y8R B;  3BT9 A;  4PZJ A;  3CES A;  3COA C;  2R5Z A;  1W7P A;  4ESJ A;  4LOC A;  3ZOB A;  3HOS A;  2AXT C;  2BZT A;  2UUZ A;  2L9S A;  2F2E A;  3PSI A;  1E3P A;  4DW6 A;  4Q4Z F;  1N75 A;  3LNQ A;  2E1O A;  3S2W A;  1LFU P;  2KJC A;  1MBH A;  2DOD A;  3ZMD A;  3QQA A;  2R5Y B;  1V5E A;  1UZC A;  4M3F A;  3EET A;  3WU0 A;  1VQN I;  2R7Q A;  4BL0 B;  2IJL A;  2OQR A;  1U9N A;  3REO A;  4BNC A;  4XOR A;  5TRD A;  3L00 A;  2VBX A;  3CLO A;  1XGM A;  1VF9 A;  4EJT A;  2ECC A;  2K27 A;  2VXZ A;  3PQK A;  5AON A;  3AL0 C;  2FBI A;  1SD4 A;  2MYS A;  4IPA A;  4ITV A;  2OBP A;  3C2G A;  1ZR4 A;  1X3Z B;  5K5O A;  5K7H A;  5JFR A;  2V1X A;  3NEU A;  3GTL J;  1H88 C;  1V55 H;  2OZU A;  4FET A;  2LY2 A;  4BQN A;  1WJC A;  2ZXJ A;  1I1S A;  1MGT A;  3OYM A;  5FKN A;  4Z2Y A;  1VQL I;  2Z3Y A;  2DTZ A;  1YRN B;  1K83 J;  3HUG A;  2XSJ C;  5C4X J;  3S3N A;  4M73 A;  1ZGA A;  1ACI A;  4L0Y B;  2Y75 A;  5FLM J;  2PQ8 A;  1XPX A;  2VC0 A;  2JA5 J;  2L4M A;  1ZRD A;  3CTA A;  3WHC A;  2F6C A;  2Y0S N;  2JUG A;  4CHU A;  3OYE A;  2LH9 A;  3H1C A;  2NOJ B;  2A68 F;  3W2W A;  3S1N J;  1PVE A;  2O8K A;  1SD6 A;  2DI3 A;  4BEH B;  4ABZ A;  2DMN A;  2LF7 A;  2QYO A;  2LYC A;  5CYV A;  2ZXI A;  2A61 A;  4ZYH A;  4BQO A;  1IO2 A;  3BCA A;  5HOD A;  3JRB A;  1IRF A;  3ULQ B;  2LY1 A;  3SDG A;  2X6X A;  4BYY A;  5J4V A;  3HOT A;  4HX7 A;  4PDK A;  3GYH X;  3JRA A;  2ZB9 A;  1XG1 A;  2XV4 S;  3ZMZ A;  4IZZ A;  2OCE A;  3Q9S A;  3H5R A;  3HPH A;  1FWZ A;  1EH6 A;  5LGU A;  1VZ0 A;  2W57 A;  5A2Q K;  1YX5 A;  2WAD A;  5DCM B;  4CO8 A;  3BC8 A;  2KZG A;  3KIO A;  1Q1H A;  3O8H A;  3KP2 A;  4JQF A;  5KVR A;  3U9G A;  3PFY A;  3GO5 A;  3OV8 A;  4P9U A;  3MVP A;  3CCL I;  4C3J J;  2W25 A;  5E18 F;  2OTJ I;  1PP8 F;  1GV2 A;  4RB1 A;  3J7A O;  2FQ4 A;  1TWC J;  3IWZ A;  3OS2 A;  1WJD A;  1YO5 C;  2VE8 A;  4LK1 F;  3ONQ A;  2M1B A;  4L9N A;  2F4O B;  4ZDL A;  3U2R A;  1ZR2 A;  3KET A;  4PFP A;  3CCS I;  4WF2 A;  5HVQ C;  2QSF X;  3SJM A;  2BVL A;  3D5S C;  2LF8 A;  5LFA A;  3K1P A;  5J40 A;  1RRJ A;  1H9G A;  4M71 A;  4BHB A;  1R58 A;  2X0L A;  3BTI A;  1HLV A;  1MKM A;  2ID6 A;  3EUA A;  3H9Q A;  4LMY A;  4LLN A;  1YW7 A;  1ZRC A;  1W7P D;  1X2M A;  4AIH A;  4RMN A;  2HDD A;  2VQH A;  4I0B A;  1FOK A;  2ETH A;  1ETX A;  1XSV A;  3WTX C;  2QM3 A;  5A2Q Z;  3OYK A;  3VDX A;  1O4X A;  3BCB A;  4V19 K;  4IRH A;  3N4M A;  2IA0 A;  1ZGJ A;  5L3B A;  1BIB A;  1IZ1 A;  2MC3 A;  3OS1 A;  4XLA A;  2E2H J;  1XMK A;  2HR3 A;  4XN3 A;  3L2Q A;  2FNP A;  5AIQ A;  2Q1Z B;  2ZME C;  1ZG3 A;  3VYU B;  3ESW B;  2R7S A;  1X19 A;  3WGH A;  1JJ8 C;  3K4M A;  3WTV C;  3GWZ A;  2EFW A;  3BZK A;  3HOW J;  3CC4 I;  3B73 A;  1ZYR F;  3ZQL A;  2K85 A;  1MBF A;  4D1Q A;  1WVR A;  1HW2 A;  3G1L A;  4AID A;  1OIS A;  2COM A;  1HF0 A;  4XKV A;  4UUS A;  3Q0U A;  3DF8 A;  1Y0N A;  5E1Z B;  2DQL A;  3TOB A;  3VYR B;  1SVL A;  3LA7 A;  3PUF A;  4LB5 A;  1D3Y A;  3M1E A;  1G8X A;  1XGO A;  3AFH A;  2K40 A;  4KN4 X;  3CUQ C;  3BRO A;  4IRI A;  4P5O A;  3C2H A;  2ZSI B;  3R60 A;  2HVQ A;  5HLH A;  3IAS 2;  3FIS A;  2D1H A;  5C4J J;  2ZJ2 A;  1R6R A;  3ECO A;  4EEF G;  2GA2 A;  3KEO A;  3PIO F;  1E17 A;  2EIJ H;  2Y9Z A;  3LSK A;  5FD6 A;  2XGD A;  1UMQ A;  1OCC H;  2GBY A;  1TC3 C;  4U88 A;  3A4C A;  4A3K J;  2JMW A;  2P0W A;  4NB5 A;  3OL3 A;  1T0F C;  4HLY A;  2O61 A;  1H0M A;  3HBL A;  2DK8 A;  2F5F A;  4Y15 A;  5JLW A;  2PLY A;  2CH0 A;  2PX9 A;  4B47 A;  1P6R A;  5FRM A;  1OMI A;  2ICW G;  3RKY A;  1MNM C;  5JHU A;  2EB7 A;  2XF5 A;  2ZFU A;  1WI3 A;  4IRG A;  2XAF A;  3FHZ A;  4B43 A;  1BR4 A;  3GBG A;  4BDY A;  4F55 A;  2ZCW A;  1VQK I;  2DU9 A;  4NC7 A;  2V1N A;  3JTH A;  4EM1 A;  5GAH J;  1IN4 A;  4CCK A;  3KYC B;  2EQR A;  4IL6 C;  1FOW A;  4PGH A;  5F08 A;  2X1E A;  3MCZ A;  2VBY A;  3ASO H;  4NBQ A;  1VTN C;  5IYD J;  3GTM J;  4CUG A;  1ETV A;  3F72 A;  1OLT A;  1IXR C;  2COB A;  3SQN A;  4XRS A;  2PMU A;  2LD5 A;  2M5W A;  2K02 A;  2ECB A;  1B9M A;  1T2K A;  3A01 B;  3RDI A;  1LDJ A;  2XVC A;  2E19 A;  5F64 A;  4HW0 A;  4KYW A;  2RNG A;  4L0Z B;  3FKJ A;  5DUI A;  1M1E B;  4KJZ A;  2O6G E;  4A0Z A;  4NQW A;  5L3F A;  2M7B A;  5E20 A;  2HOA A;  3E6D A;  3LAJ A;  2DK5 A;  3LWF A;  4CYC A;  3AKZ A;  3BR2 A;  1AKH A;  4M9S A;  1AHD P;  2KP6 A;  3ZQQ A;  1TL8 A;  2AS5 F;  3DBH B;  1FP1 D;  1QZY A;  5F6F A;  3WOD F;  1LB2 A;  2CW8 A;  2FOK A;  4R1H A;  4EAT A;  4XOT A;  3G4S I;  5HLI A;  2M0M A;  4WWC A;  2CUZ A;  1BN5 A;  3L1P A;  4BBR J;  3K2A A;  5KAI C;  3EUH A;  3FX3 A;  2DA5 A;  5DD8 A;  4EM0 B;  3JAM K;  5TJJ A;  2EBI A;  4BJT A;  2IS1 A;  1A6Q A;  3IH3 A;  3O2P E;  5BOX A;  1ZTR A;  3F8F A;  1HSJ A;  3L09 A;  4RDU A;  3OYH A;  3V8K A;  5FO5 A;  4H0E A;  2V9K A;  3CF2 A;  3BOQ A;  2LVS A;  2HXO A;  1YIT I;  3K4C A;  3V7S A;  3A2K A;  1N25 A;  4U0V A;  2HKX A;  3BG3 A;  5JR3 A;  4LFU A;  1DDN A;  3CDL A;  3P9I A;  3TO6 A;  4HRI A;  3W3C A;  1T33 A;  2VB6 A;  2HYG D;  3MKZ A;  2E1M B;  1ETW A;  4J00 A;  3TED A;  3TW7 A;  2LR8 A;  4ZZL A;  3FXR A;  5E3N A;  1BR2 A;  2RAE A;  2RC4 A;  3ZR8 X;  3G71 I;  2ACJ A;  1MH3 A;  4ENK A;  3TW6 A;  1RR8 C;  4W1U A;  1R22 A;  3TP3 A;  1HW5 A;  1KU9 A;  1LKX A;  2HI3 A;  2EFQ A;  3HSE A;  2L7F P;  3O8G A;  4JX4 A;  4UUV A;  1TWF J;  1Z77 A;  3G3Z A;  1TWH J;  1PDN C;  3H92 A;  2XAU A;  3H3U A;  2X6W A;  1FMV A;  1XSD A;  1MDM B;  4AVP A;  2DPD A;  3VFZ A;  5EJC A;  3GZ6 A;  3DXJ F;  1QHH D;  5ICF A;  2E2I J;  4ZYE A;  4XMY A;  2LRD A;  2Y0M A;  2I8D A;  4I99 C;  2WY8 Q;  1BOB A;  3JRC A;  4EJO A;  2KMU A;  2CJJ A;  2L02 A;  4DGW B;  4FCY A;  1TWG J;  1VQM I;  3T1B A;  3A1Y A;  2M4G A;  4PJL A;  3I5U A;  2QGU A;  4CYD A;  3IKT A;  3C3W A;  1HW1 A;  1KYZ A;  1G2H A;  3A0B C;  1IRX A;  1QRY A;  3SYT A;  4F92 B;  5KCM A;  2ZME A;  4YII A;  3S93 A;  3V8L A;  5EG0 A;  1YW9 A;  5M5Y J;  1YIO A;  5CVV A;  2E36 A;  3F0C A;  2KLO A;  5DTD A;  4EGY A;  2XGC A;  2XRO A;  2ADU A;  2W00 A;  2L7Z A;  3PNV A;  1WH5 A;  1RNL A;  2HU9 A;  4C3I J;  3DBL B;  2YX4 A;  3RQ4 A;  4OIO F;  2IGK A;  4D9J A;  1YG2 A;  3OOP A;  2VT3 A;  3TO7 A;  1YHQ I;  2PJR B;  4XLC A;  3I58 A;  3CP8 A;  5K5R A;  1WFX A;  4EJU A;  4A6E A;  5IYC J;  2OV7 A;  4NC6 A;  5BMZ A;  1IAW A;  4S05 A;  4I7H A;  4O5V A;  3L2V A;  4Y7N J;  3LSM A;  2GOM A;  3S14 J;  4DJA A;  1W36 C;  4BBS J;  2I10 A;  3CUQ A;  2R7U A;  3BPX A;  4AM3 A;  2DMU A;  2LLK A;  5AIP A;  3J7Y J;  1D5Y A;  3BG9 A;  4RB0 A;  3L2W A;  4LIT A;  2B0L A;  1MMS A;  3I54 A;  1TWA J;  1IC8 A;  1QZE A;  3OYN A;  3I4M J;  3Q0V A;  4C2U A;  5IT3 A;  2X48 A;  3ZN1 A;  2WC2 A;  2LMD A;  3BTJ A;  4C30 A;  3F8M A;  3K7A J;  1QQI A;  2Q2E A;  2VC1 A;  5ILU A;  2EIM H;  1T0F A;  3J81 K;  4ZDP A;  2L7M P;  1KZH A;  4IQJ A;  5CJ9 A;  1ZQ3 P;  2X1C A;  3ERE D;  1K6O A;  2R3S A;  3QP6 A;  1JXS A;  4ENJ A;  1RKW A;  4KIF A;  2Z33 A;  2EA4 A;  3GFJ A;  3HGY A;  4B09 A;  2XPW A;  4GRI A;  1HKT A;  4A3I J;  4ZTJ A;  5F0F A;  2XRN A;  4FX0 A;  3LSR A;  3GTQ J;  1Z6R A;  2G7H A;  1UAA A;  2F4I A;  1OCZ H;  3KEY A;  1NG6 A;  1MND A;  3A03 A;  2HPM A;  4XNF A;  5HS8 A;  2JA6 J;  3PIP F;  1KYW A;  3F6O A;  3KFW X;  1B8I B;  2MSY A;  2O0Y A;  4FE4 A;  3M3Y J;  3MZ8 A;  3K4K A;  3C1D A;  5KAF C;  4NC8 A;  2KQR A;  1ZH5 A;  1OCT C;  3ZQF A;  2FXA A;  1Z21 A;  3K70 D;  1O3R A;  2K86 A;  2CWE A;  2RQQ A;  3OSF A;  1WQ2 A;  1IN8 A;  2CW0 F;  4AU7 A;  1X1P A;  1GDT A;  3I4P A;  4AIJ A;  3LAP A;  1JTY A;  1MSE C;  2EWN A;  5BS6 A;  3FXJ A;  4BAY A;  2DXI A;  1HQC A;  1DQU A;  2MH2 A;  4BXU A;  3CJR B;  2BGC A;  2VJJ A;  3RYR A;  2B63 J;  1X3W B;  4I98 B;  3ZMV A;  2EK5 A;  3FXK A;  3HRU A;  4O6J A;  4A0Y A;  1RES A;  4Y33 A;  4EMS A;  4YFK F;  3QAH A;  3J81 Z;  1Y8Q B;  5CPR B;  3QYE A;  3LSP A;  2EV6 A;  1X58 A;  1DPU A;  4J01 A;  2F4M B;  4LD5 A;  3QYF A;  2XF7 A;  4HBL A;  1R36 A;  1SAU A;  2QBY A;  2BW3 B;  2H8W A;  2M7A A;  5EYR A;  4MIM A;  4G7Z F;  4OIQ F;  1WKM A;  4LGW A;  2UV1 A;  4M3G A;  1BW5 A;  4XKB A;  3DKX A;  2V6C A;  1R4N B;  2Z9O A;  1FTZ A;  5IT9 K;  1YTY A;  1X1D A;  3HSF A;  2OC6 A;  1MSF C;  1W1W E;  1U3E M;  4PSW A;  3LQR A;  2VT2 A;  3OMY A;  3V7C A;  2GOX B;  1VND A;  1OYW A;  3L9F A;  5FKL A;  3PM1 A;  4F7Z A;  3I0T A;  3Q5F A;  3KYD B;  2KDO A;  1L0O C;  1FOY A;  1D5V A;  2JA7 J;  1FT9 A;  2A6H F;  4YRV A;  4GCV A;  4FQG A;  5JI6 A;  2QF7 A;  4Z6Y A;  1R49 A;  1WH7 A;  1LVK A;  1XGS A;  1OCO H;  1LUJ B;  5IP6 A;  5M5X J;  4HX4 A;  3G6E I;  2Q8K A;  1LPQ A;  4CCM A;  2X6O A;  4M3D A;  2CSO A;  2RKH A;  3F3X A;  3ML6 A;  5D8K B;  2Y0S A;  2CGP A;  5FKK A;  3L7W A;  4ESF A;  3RQI A;  4RB2 C;  2ZJR F;  1BC7 C;  2BHZ A;  4MLO A;  4A5N A;  2GZW A;  3DTE A;  2V9P A;  4CCN A;  4R79 A;  1ODD A;  4BGD A;  4RAZ A;  3GTO J;  2Z5U A;  1FYL A;  2BE5 F;  3VB2 A;  3E6M A;  5DM7 F;  4N9H A;  2DJN A;  1R5I D;  1R1U A;  3BR6 A;  2PMH A;  5JVT A;  4BUP A;  3CJT B;  1G3T A;  3EPZ A;  5D5W B;  1RIO H;  1SEU A;  5K7F A;  3I64 A;  4M6X A;  2OTL I;  5H6Q A;  1IJW C;  4D0P A;  4XQF A;  2X51 A;  3DU5 A;  4RLQ A;  5FGM A;  2JWT A;  4BHC A;  1YJW I;  2CV2 A;  2VKH A;  5IT9 Z;  2BXZ A;  3OOU A;  4RGR A;  5HDK A;  2JK3 A;  4DYC A;  4U7B A;  2YSR A;  4IQ4 A;  4L5E A;  4RLF A;  3GCM A;  3WGG A;  2EIN H;  2R7V A;  4XIC A;  1LFB A;  3CLQ A;  5HNF A;  3KYL A;  5F1R A;  2NS8 A;  3HZJ A;  5M3F J;  4G6Q A;  2XKP A;  4LG0 A;  3VOD A;  5GAE J;  5D5U B;  4PSX A;  2K9L A;  3LSG A;  2IRF G;  4IHY A;  1MD0 A;  4UB8 C;  4E70 A;  1IXS B;  3ELK A;  3R6S A;  2ME0 A;  4BE2 A;  1POG A;  2MD5 A;  2KJB A;  2MD0 A;  1KU2 A;  3KP5 A;  2QUF A;  2XB0 X;  1YIJ I;  3EUK L;  3TBI A;  3G1O A;  1VFC A;  2BHY A;  1LDK B;  2CQX A;  2WAQ A;  4A3C J;  1Y39 A;  2DN0 A;  1SMY F;  1BW6 A;  1SMT A;  1ULY A;  3BJA A;  1MBG A;  3SZP A;  5BPD A;  1WJA A;  9ANT A;  3NRV A;  2P8T A;  2Y31 A;  4L9V A;  2JT1 A;  1W0U A;  2XSD C;  1U9O A;  3CCE I;  4CCJ A;  2R7X A;  3FXQ A;  4I0A A;  3ZQG A;  4AD9 A;  2DA1 A;  2HQA A;  4H4K C;  2J5P A;  2DPU A;  3PO3 J;  1STZ A;  3BQZ A;  3FXU A;  5FKM A;  5F0C A;  3V4G A;  2GIZ A;  2XB5 A;  4CSW A;  3C18 A;  3H9J A;  2VKD A;  2DYS H;  3F6V A;  2Z99 A;  2GXB A;  2IGO A;  2XAJ A;  1FSH A;  2DBB A;  4IOC F;  3N97 A;  2BVM A;  1FEX A;  1V54 H;  2JSC A;  2VI6 A;  3LA3 A;  3E1S A;  1TT5 B;  3KP6 A;  2VUM J;  1IV8 A;  5F1J A;  2FEZ A;  5J47 A;  1W5S A;  2HEO A;  1IXC A;  1EV7 A;  1ZEL A;  2FJ1 A;  1NK3 P;  3S1M J;  2OCC H;  1IUY A;  4ZC3 A;  3NQO A;  4NNJ A;  1EA3 A;  2OJE D;  1IDZ A;  5E3M A;  2L7K A;  4KT6 A;  1CF7 B;  2OA4 A;  2V9V A;  1JKQ C;  5KK1 A;  4L9T A;  2E71 A;  1Z3X A;  3JW4 A;  1FYM A;  3DBR B;  4MEX F;  1YE9 A;  4WXC A;  3RJP A;  2K3P A;  3CJQ B;  5LEK A;  1FBS A;  2ZJP F;  3CC2 I;  2BY1 A;  2K3F A;  5H2F C;  1P2F A;  2QQA A;  2UXX A;  5L3E A;  4MFE A;  1XX5 A;  4BHP A;  4G7O F;  4B44 A;  2VJ5 A;  2PEX A;  2CV0 A;  1JKR C;  4KDP A;  1ZG1 A;  1T95 A;  4QTR A;  3CD6 I;  1ENH A;  3T8T A;  3FXO A;  1A36 A;  1MJB A;  4UV8 A;  2MGQ A;  5DDG A;  1UG0 A;  3JRD A;  1BC8 C;  3QU6 A;  5FRN A;  3GFM A;  2GXG A;  2HQN A;  1XN7 A;  5EGO A;  2CW7 A;  3DTI A;  2P5L C;  3BZ6 A;  4CZC A;  3AAF A;  3K2Z A;  4BQA A;  1Z7U A;  2Q0O A;  1IRZ A;  1A04 A;  1X1B A;  4XID A;  2WWY A;  5GTH C;  3IWF A;  4GO1 A;  3M9A A;  4ETS A;  4PCQ A;  5JLX A;  3E0J B;  5J8F A;  2QZ8 A;  1YS6 A;  3MWM A;  3CF5 F;  4X0G A;  1YJ9 I;  2GIV A;  2ZC2 A;  1W5C C;  3H36 A;  2X6Y A;  2MBF A;  2WAQ N;  4AWX B;  2LDU A;  1UCR A;  1S3J A;  2ID3 A;  2K9Q A;  3W2V A;  1B72 B;  5HDG A;  1KGS A;  3OYF A;  1HCR A;  2V1D A;  4XLP F;  4HAM A;  3QPT A;  5LD2 C;  4G7H F;  1QU3 A;  3RI4 A;  1P7J A;  3HRS A;  1ZHF A;  1RC9 A;  1FYK A;  2QWW A;  2X9D A;  4OIP F;  5L3D A;  5D6F A;  2ZNY A;  2MFZ A;  2CQK A;  3HJE A;  5FLX Z;  3I59 A;  1HKS A;  3FWE A;  2DFF A;  5K7Z A;  2IS4 A;  4ZYA A;  1HDP A;  4OWR B;  1APL C;  2YUS A;  1JT6 A;  1R23 A;  2GQQ A;  3KCC A;  4E7H A;  2M2E A;  1WPK A;  1XS9 A;  5FLV A;  2ZXW H;  1U5T B;  3IHU A;  3IRR A;  1FX7 A;  4U7D A;  4A3B J;  4XLF A;  4FX4 A;  1TZL A;  3ABL H;  4BS9 A;  4HSR A;  5IY5 H;  1W36 D;  5D6E A;  2BY3 A;  5H20 A;  5DYM A;  2A5Y B;  3H5N A;  3IC7 A;  1PUF B;  5JVG F;  3M7G A;  2ELH A;  4LLG F;  2R5Z B;  1W7P B;  4EGZ A;  2NVT J;  2VJI A;  3BTL A;  4WCG A;  2DA3 A;  3CMY A;  2FBK A;  5CVJ A;  1IG7 A;  2DA2 A;  1SFO J;  1NK2 P;  2EV5 A;  2EFP A;  1ONV A;  5ERI A;  4IHS A;  1FIA A;  3W6K B;  4B1R A;  2H94 A;  1R1T A;  3MMY B;  1KQ8 A;  3X2Q H;  2VIX A;  4RAY A;  4HLX A;  2LOO A;  2DOF A;  3ZN0 A;  5M5W J;  1PP7 U;  2IGM A;  4KMU X;  3P5J A;  4PGG A;  3HM5 A;  5B3S H;  3LST A;  1TQP A;  3BLY A;  3KLN A;  4IJA A;  4FTH A;  2FSW A;  5K5Q A;  3MAJ A;  4ZZD A;  3CQZ J;  2XRL A;  1BI1 A;  2XGX A;  3S15 J;  1QPM A;  2FU4 A;  2NNN A;  2A05 A;  5J4Y A;  3IL2 A;  1Y1W J;  1EJ9 A;  3CDI A;  4O3M A;  1MZB A;  2LSO A;  1XDS A;  3RKQ A;  1VQO I;  2X85 A;  1H89 C;  1FIP A;  4XON A;  1I3A A;  3HUG B;  3CCR I;  4OMZ A;  3RPQ A;  2LNB A;  4IF4 A;  4UXN A;  2EZH A;  1W4M A;  1ZN2 A;  2K9N A;  5C44 J;  2JPC A;  3MKW B;  1S72 I;  5EEG A;  1MBJ A;  4R8H A;  2NVQ J;  1USS A;  1HC8 A;  4F93 B;  2MAB A;  1O3Q A;  4WXH A;  5L3G A;  2R7D A;  5DCF A;  2XGE A;  1U6G A;  1GUU A;  2H6C A;  4HV5 A;  1VQ5 I;  2C6Y A;  3Q3S A;  1V5G A;  4P9F A;  1HBX G;  1LNW A;  4XKW A;  4B4C A;  3RKX A;  1VQ6 I;  2CFX A;  3LSI A;  1Y1V J;  4DZP A;  5LHI A;  3HSR A;  4MO7 A;  1BR1 A;  3OYA A;  1P7I A;  1QA6 A;  1ON1 A;  4XLH A;  4S04 A;  1A6I A;  1WSU A;  4FE7 A;  4KT5 C;  2OZ6 A;  1P92 A;  1HA8 A;  3F8N A;  1K78 A;  1W0T A;  4MGR A;  2XPU A;  3S1R J;  1FP2 A;  1LJ9 A;  1LE8 A;  1K61 A;  2CUE A;  3UR3 C;  2W7N A;  1Z7L A;  2L0K A;  3J80 Z;  2W82 A;  1YFH A;  1MMN A;  2ELK A;  2M8G X;  3ZQC A;  2ZKZ A;  3H9G A;  2DW4 A;  1CQT A;  5J6X A;  1ETQ A;  3DV8 A;  1S8N A;  1X2N A;  2LTP A;  3K6G A;  1Y0U A;  3GZ5 A;  4A3D J;  2NVX J;  2DT6 A;  2DT7 B;  3D1N I;  1PJR A;  3OYJ A;  2LBF A;  4C9Y A;  5J1Y A;  1Z1D A;  2HZT A;  3PNT A;  1RET A;  3CMA I;  1I6X A;  4RB3 C;  3PJR A;  1JKP C;  2M30 A;  2R4G A;  3KZZ A;  3M07 A;  2NRA C;  1YW8 A;  2OAZ A;  1S7O A;  1WZ2 A;  2MC4 A;  2QEX I;  1ZG5 A;  2OQG A;  3CCQ I;  2QKM B;  2JZY A;  3K4J A;  5TIS C;  3HEF A;  1G3W A;  5EZH A;  4WX9 A;  4CCO A;  4A0X A;  2JUC A;  4RAF A;  3RCO A;  2AXL A;  4X1E A;  3NAR A;  2YR2 A;  1YYV A;  4AUX A;  2MA3 A;  1ON2 A;  2EFO A;  3ABU A;  5EZG A;  1D1C A;  1IGN A;  2PFB A;  3JRE A;  1K7A A;  2FX0 A;  3GFL A;  2CV1 A;  3KZI C;  3H3V K;  3ABT A;  1WJE A;  1I5Z A;  3GUD A;  4LK0 F;  5ED4 A;  1OPC A;  1IN6 A;  1UHS A;  3CCY A;  5B66 C;  2A5W A;  1D0Y A;  2HQ5 A;  3O6B B;  1R71 A;  4IO9 F;  2IS2 A;  2FML A;  1MMG A;  3CCV I;  1WJ5 A;  2A6T A;  2KDZ A;  1O7F A;  1TLH B;  2P6S A;  4YIF A;  3S3M A;  4QLC U;  1O3S A;  1GXP A;  4KMF A;  4Y3O A;  3WTT C;  4E7S A;  1IN5 A;  1Z0X A;  3TO9 A;  3DQV C;  3I56 I;  2V26 A;  4XM3 A;  1Q1V A;  2WA0 A;  4OIN F;  4Y52 J;  2HZD A;  2IVM A;  4WK8 F;  1X3U A;  3VSK A;  4UUS B;  1FZP B;  1GLN A;  4AIK A;  1GXQ A;  2G0E A;  2FD5 A;  2XF6 A;  3UKG A;  2W84 A;  1Z3Y A;  1C0W A;  3DKW A;  4RGS A;  1SVO A;  4IHX A;  2VON A;  2JVG A;  3CCU I;  2LFB A;  3A02 A;  3ZGK A;  2RVC A;  4MQV A;  3GF2 A;  4HQM A;  2QKL B;  2H1L A;  2JPB A;  1BIA A;  4G9Y A;  4YFN F;  3VOE A;  1R5H A;  3FK7 A;  1X1A A;  5DUK A;  4ZH4 F;  3U1D A;  5GAG J;  3M8E A;  1LDD A;  2HWV A;  4PJJ A;  2E1C A;  2MLK A;  1WI9 A;  2WAF A;  2P81 A;  1RI7 A;  2KL4 A;  2VJ4 A;  1J9I A;  1KU3 A;  2NNY A;  2FQ3 A;  4F3Q A;  1UFM A;  4A3F J;  4HNV A;  2KIF A;  1X4P A;  4IHT A;  1FJL A;  4NDL A;  2HXI A;  2A69 F;  2H27 A;  2FNA A;  3PO2 J;  2BY0 A;  3AL0 B;  4ANJ A;  1WRJ A;  3H3Z A;  2E7W A;  1AWC A;  1OKR A;  1V4R A;  1SFX A;  1YLF A;  3BZC A;  5LLQ A;  1KQ0 A;  1I1G A;  4OIR F;  2MH9 A;  4A93 J;  3VYT B;  1ZGW A;  5JHF A;  2L5Q A;  3K4L A;  4HF0 A;  3FHN A;  5HS9 A;  3KP4 A;  2RDP A;  2MW8 A;  3BY6 A;  1AA7 A;  3T0Y A;  1JUM A;  2VPL A;  4OAY A;  3CC7 I;  3HRT A;  4UB6 C;  4LIU A;  3I3L A;  1QVU A;  5ICC A;  2DT5 A;  4KIT B;  3KPH A;  4JYK A;  2HOS A;  5CVU A;  4MEY F;  1QPI A;  5BNG A;  3HOV J;  1XGN A;  4XBF A;  1TNS A;  4GYI A;  2QQB A;  3CJN A;  5H6R A;  4NQW B;  5BPI A;  1J09 A;  2FRH A;  4C3H J;  3QWL A;  2ELJ A;  3HG9 A;  4CYC B;  1AKH B;  3LFK A;  2R5Y A;  1MH4 A;  3PL8 A;  1S9H A;  3U21 A;  1DPR A;  2V4J C;  3JR9 A;  2BV6 A;  1QBJ A;  1FC3 A;  1GVJ A;  5J1R A;  1VQP I;  1K4T A;  4K2E A;  3P9C A;  4JX6 A;  3ZP5 A;  2ME6 A;  4IHV A;  2XAS A;  3DKY A;  5E1W A;  1RPW A;  4BKX A;  1P9Q C;  3BQY A;  3KEQ A;  2D1V A;  1N77 A;  1MMD A;  3LL7 A;  1ETY A;  3VSL A;  1TTY A;  2CUJ A;  2Y48 A;  3E5X A;  3ECH A;  4GDF A;  3TKY A;  4B8X A;  3FM3 A;  3FBI B;  1GT0 C;  1D1B A;  2XUB A;  1WWX A;  2NOG A;  1YS7 A;  3GTG J;  4A3J J;  1G3Y A;  3Q0W A;  3TDZ C;  2RRE A;  3BJO A;  3QP5 A;  1YRN A;  3FDY A;  1EKE A;  2L01 A;  3WGI A;  4GFB A;  1DP3 A;  4N4N B;  3A0H C;  4UVB A;  5HLT A;  4M9X A;  1JKO C;  4CGZ A;  1IDY A;  3ABK H;  1J5Y A;  3F23 A;  2KZV A;  5CKT A;  1TW3 A;  2X4H A;  6PAX A;  2JSP A;  2YS9 A;  3DPU A;  1F4K A;  3ZMU A;  4DQ2 A;  2E2J J;  4E4H A;  5E17 F;  2L9R A;  3IH2 A;  2O03 A;  4F52 A;  1B59 A;  2HTS A;  3IP4 B;  3RYP A;  1DGR M;  4BEH A;  2W4S A;  1YI2 I;  1XTA A;  1R7J A;  4A3G J;  1DU0 A;  4ZYD A;  2EZL A;  5EF6 A;  2DOA A;  3M8F A;  5B5E C;  2I5U A;  3WTW C;  1G4D A;  1VQ7 I;  1BOA A;  1HXD A;  3GW2 A;  4P55 A;  2JJ7 A;  1ZLJ A;  5J8C A;  5CVI A;  3F21 A;  2H1K A;  3K1M A;  4IOA F;  2HOT A;  2IA1 A;  3CCM I;  4P96 A;  3CDH A;  1P4A A;  4EQQ A;  1XC5 A;  1UHM A;  5LBQ A;  4HDU A;  2DA6 A;  2G7U A;  2VAS A;  5L3C A;  1U8R A;  2LKP A;  4IX7 A;  4XSZ F;  1TW2 A;  1ZAR A;  4E7J A;  3GTK J;  1ZKG A;  3FXL A;  1O3T A;  2QSG X;  1GHC A;  1T98 A;  3DU6 A;  3WU1 B;  4ENN A;  5DCM A;  3QRF F;  1LFP A;  1IW7 F;  2KRH A;  1HOM A;  2ZME B;  2Z1D A;  3IUO A;  4HYE A;  4HPQ A;  5KHD A;  5EG0 B;  3OYB A;  3HDD A;  2IS6 A;  4HG2 A;  1BJA A;  1U2W A;  2AQE A;  2HKO A;  2Y9Y A;  2RQP A;  1WHU A;  2E35 A;  1MJ9 A;  1PUE E;  1IV6 A;  1OYI A;  4DYQ A;  3PSF A;  3HB9 A;  3K9T A;  2GAU A;  3NWS A;  4OOI A;  4LJZ F;  4A69 C;  2KPM A;  4WXD A;  1FTT A;  2IGN A;  1S6L A;  1XB4 A;  2E1M C;  3HTS B;  2KFD A;  4QIW N;  1I3Q J;  5DD4 A;  4D5F A;  1S29 A;  2LY9 A;  3CO7 C;  1LEA A;  1QHG A;  4W97 A;  4ESB A;  2M9H A;  3GZN B;  1FBQ A;  1I39 A;  1I27 A;  2XPV A;  1UEL B;  3CUQ B;  4CXF A;  4XKC A;  5TGT A;  2O9L A;  2D45 A;  4PJ0 C;  2X1D A;  2F5E A;  3MZY A;  3KP3 A;  4UUT A;  1T6S A;  3ZMS A;  2L3D A;  2O7O A;  2BBY A;  1YJN I;  3T8R A;  2WY7 Q;  3BG5 A;  3HOU J;  3AG1 H;  5LHG A;  4RA2 A;  3DFG A;  2Q2E B;  4YIR X;  3E7L A;  3QPS A;  2DO7 A;  2O3F A;  1KON A;  3L2R A;  1D8K A;  1MW7 A;  2JQ7 A;  4HOB A;  1Z67 A;  3OIQ A;  1E3H A;  5D4R A;  3HC7 A;  4ON0 A;  2STW A;  4G8X A;  2R0Q C;  1FSE A;  2DAO A;  3SFI A;  3TGN A;  1OFC X;  1ZK8 A;  2L2O A;  3PUB A;  3KZY A;  2BEO A;  2P5K A;  1BJZ A;  3OYG A;  2CQN A;  2R7Z J;  1QNT A;  2F48 A;  2WV1 A;  2EZI A;  4CH7 A;  1T38 A;  2VQL A;  4B3A A;  1GV5 A;  3T5X A;  2M8E A;  4PJN A;  2P4W A;  2TDX A;  2DCE A;  2H6B A;  3R0J A;  5J3L A;  4QPO A;  3OS0 A;  2W48 A;  1IF1 A;  1JHH A;  3H35 A;  2HDW A;  1D8J A;  4RGU A;  4BY1 J;  3FMR A;  4I2O A;  4N9I A;  1HKQ A;  4BU2 A;  4CA0 A;  2IA2 A;  2FMY A;  3IAM 2;  1VQ8 I;  4QWQ A;  2XDV A;  4EJW A;  5DM6 F;  4IKF A;  3ZQI A;  1JUP A;  3BPV A;  3D5L A;  3HXL A;  2WB1 A;  3AG3 H;  4AVZ A;  4HA8 A;  3E5Q A;  4D5C A;  2XKO A;  2F5D A;  3GXO A;  1K6Y A;  2QQ8 A;  1UB9 A;  5F0H A;  5IP7 J;  2LKX A;  1IN7 A;  2IXS A;  5K1Y A;  3JSO A;  1LEB A;  3FBN B;  3I4N J;  2BY2 A;  4A3L J;  1X1C A;  3SXY A;  2IBD A;  5D5V B;  2GXA A;  1MNE A;  3GTP J;  5CQE A;  2KIS A;  2QBY B;  4MHG A;  3VEP A;  3IV5 A;  4ZTF A;  4KUM A;  2JRT A;  2HYF A;  2L9N A;  1SD7 A;  2HVR A;  2K4J A;  5FLX K;  5FD5 A;  3HHH A;  1REP C;  2CU7 A;  2M4K A;  1F36 A;  2OPT A;  4XRM A;  1ETK A;  4V2G A;  3LA2 A;  1RKT A;  1KA8 A;  2DDA A;  4HQE A;  2UXN A;  4I01 A;  4OMY A;  3H0D A;  5E3L A;  3N05 A;  1FLI A;  1TQI A;  2L4A A;  3CP2 A;  2BYV E;  1Y56 A;  5FKO A;  3PFI A;  2R7W A;  2LP0 A;  2R7T A;  4BXX J;  2FA5 A;  3DCF A;  3A01 A;  4CCL A;  3EUH C;  1B4A A;  2ZO4 A;  4UV9 A;  1JGS A;  1FMW A;  5HLG A;  3R61 A;  1AU7 A;  1PYV A;  2HDC A;  4DNC A;  1Z9C A;  1H8A C;  3I9V 2;  2R7O A;  3FZV A;  4IEJ A;  1W5T A;  2V79 A;  3DTK A;  4D7N A;  4RM2 A;  4YEL A;  1R4M B;  2V6E A;  1R9T J;  3ZRG A;  4JOM A;  1I50 J;  2JRM A;  4CZZ A;  2HQR A;  4DIQ A;  5IP9 J;  1XCV A;  3RSN A;  2E5Z A;  3WTZ A;  3BWG A;  3OYC A;  1KQ9 A;  5IYB J;  3BG6 A;  2CRG A;  1TP4 A;  3EYI A;  1AOY A;  2P7V B;  4Y13 A;  3K70 C;  1A35 A;  3DEE A;  4FHT A;  2CO5 A;  4PK4 A;  1B6A A;  3LOC A;  2EPF A;  2H09 A;  3R0A A;  4U0Y A;  3GEZ A;  5GAD J;  4IHW A;  2FBH A;  1SAX A;  1RUO A;  2P7C B;  4JBA A;  2W85 A;  4CIC A;  2CQ7 A;  4XR6 A;  3JRH A;  1BI0 A;  3P9K A;  2EV0 A;  3G2B A;  4MTE A;  2M3A A;  1MBK A;  1OCR H;  3HIF A;  2ZXH A;  2VKV A;  4F91 B;  2V1U A;  2VPR A;  4LG0 B;  1TT0 A;  3TDU C;  1FY7 A;  2OD5 A;  2PI0 A;  3FMQ A;  4MQ9 F;  1JJ6 C;  2ZFW A;  3U1K A;  3F22 A;  2VXD A;  2O5R A;  2VLA A;  1G6N A;  2KHM A;  1OCP A;  3JRF A;  5LRS A;  1DU6 A;  2Y30 A;  4A12 A;  4BE0 A;  2WB1 N;  3E6C C;  1R5G A;  2IEK A;  3HOZ J;  3S16 J;  2KKO A;  1FNN A;  2DOE A;  3IH4 A;  4G6T B;  2HNH A;  4MFD A;  2XAG A;  2B7E A;  4A2U A;  1OYY A;  4B48 A;  4P1W A;  2JA8 J;  2NXN B;  3RTR A;  5D8L B;  3K0L A;  4RM3 A;  2PBI A;  1UG2 A;  2MLG A;  2P5V A;  3BG7 A;  4Q48 A;  5HDN A;  2K9S A;  3JRI A;  3F8B A;  3HL2 A;  1MDM A;  1F5T A;  3MEX A;  3L2U A;  2CUF A;  4N4O B;  4UY8 I;  2OUM A;  2JTV A;  2BXY A;  4HST A;  1B9N A;  1QGP A;  1U0J A;  2DFH A;  1LVA A;  2PG4 A;  3ROU A;  3GFI A;  3QOP A;  3GTJ J;  4JK1 X;  2EJR A;  4OAZ A;  1BM9 A;  5B1A H;  2N8G A;  2EA2 A;  1ZLK A;  1MJA A;  1XCB A;  2AQF A;  3IKV A;  1J75 A;  1ZRF A;  2GM4 A;  2K7L A;  2JA2 A;  2E5N A;  3B02 A;  4GGG A;  2W1O A;  4I02 A;  5FJ8 J;  1MBE A;  3J80 K;  5LRR A;  5HOO A;  3LQQ A;  4A5M A;  3E97 A;  2DMQ A;  5D5X B;  4FIS A;  2OU2 A;  2P6T A;  3OYI A;  3WG9 A;  3H5A A;  5IOY A;  4XRS G;  3L2C A;  4LG3 A;  2A07 F;  4X6A J;  4L5I A;  1BA5 A;  1J59 A;  2VOO A;  3CCJ I;  1T56 A;  3QU3 A;  5M3M J;  1X4O A;  3R4K A;  3BDD A;  1LQ1 A;  3B6C A;  1UHW A;  2XAH A;  1FOX A;  1JHF A;  2TCT A;  3KP7 A;  2VQC A;  1BI3 A;  3DLA A;  3SFZ A;  3S8P A;  4NUB A;  2PJR A;  1I6H J;  4G6D A;  3SZT A;  3IRQ A;  3ERM A;  4XLE A;  1QZZ A;  4M9Z A;  4M74 A;  3MKL A;  2DTR A;  3WHB A;  1U78 A;  2L9V A;  4DOZ A;  4BH9 A;  3OR1 C;  4YEJ A;  5CLS A;  2DDB A;  3JTG A;  2HFH A;  4N0B A;  2EZK A;  4IXA A;  4HNU A;  2HGC A;  3W6V A;  4IVN A;  3OIO A;  4U87 A;  3ZPL A;  1EH8 A;  2W24 A;  3PNY A;  1F1Z A;  3BP8 A;  1XMA A;  4II2 A;  2CG4 A;  3BR5 A;  2IP2 A;  4BDZ A;  4I6Z A;  4HEA 2;  1K79 A;  2CQQ A;  4YG2 F;  4FT8 A;  2YPR A;  3OY9 A;  3M1C A;  2E34 A;  1ERD A;  3HGG A;  1WCM J;  5EGO B;  1XD7 A;  2IW5 A;  4HF1 A;  3BTC A;  3AG2 H;  3LSJ A;  3RKW A;  3CZ6 A;  5D4S A;  1EH7 A;  1ZAO A;  4Q47 A;  3OYL A;  3S3O A;  2IPQ X;  3KX2 A;  4G12 A;  2V7F A;  3MZH A;  2DA7 A;  1Z05 A;  2EH3 A;  4DYR A;  3WTY C;  4Y17 A;  3W6J B;  4XL9 A;  3DEU A;  4U0W A;  1YOV B;  3DPT A;  1T39 A;  3FM5 A;  5DEQ A;  2GWR A;  1BI2 A;  3K69 A;  4RAG A;  2NVU B;  1T8I A;  4XOP A;  4BQQ A;  2QCO A;  3HYI A;  4UVC A;  2VE9 A;  1FBU A;  1Z6T A;  1B8I A;  2PJP A;  2YU3 A;  2M87 A;  3E3V A;  3J7Z I;  1K4S A;  2AHQ A;  3ABM H;  1Y6I A;  1R00 A; 
#chains in the Genus database with same CATH homology
 2L54 A;  3EYY A;  2K4B A;  2KRF A;  1NHA A;  3I59 B;  3V8J A;  4KNY A;  2ZBK A;  3K1N A;  3QPH A;  3I71 A;  3SHF A;  1F9N A;  5DV5 A;  4EVI A;  1ZRE A;  2R7F A;  4HZF A;  3HHG A;  3JSP A;  1L3L A;  2D2W A;  5ILS A;  5E8G A;  3FMS A;  3WTS C;  2QVO A;  4HDV A;  3PQJ A;  4KIG A;  2WV0 A;  4GYG A;  4TV7 A;  1XSX A;  4UHT A;  3FF5 A;  4G94 A;  5FFZ A;  1TNT A;  3ISP A;  4L9J A;  3CUO A;  3TOA A;  5LGN A;  4YFX F;  3I53 A;  4EJV A;  2UWM A;  1TQM A;  2VBZ A;  4HV6 A;  4OU0 A;  3RPU A;  4A6D A;  3JAM Z;  3GX4 X;  3F8C A;  1BBY A;  3E5U A;  4EV0 A;  5LGT A;  1SD5 A;  1U5T C;  4M72 A;  2HS5 A;  4EM2 A;  3CO6 C;  2FF4 A;  2DLL A;  2NYX A;  2DQR A;  2KIU A;  5E8I A;  3ZQ7 A;  2QQ9 A;  2HTJ A;  1SFE A;  5BQT A;  3E6B A;  1UST A;  1P4X A;  5HS7 A;  4KA4 A;  1B1B A;  4CDG A;  4I09 A;  3P7N A;  3Q9V A;  2E7X A;  3EQL F;  5EEH A;  2ISZ A;  3EDP A;  2RGV A;  5ILV A;  2ISY A;  1K78 B;  2YX7 A;  1RZ4 A;  2VBW A;  2CYY A;  2G9W A;  3RIR A;  1G3S A;  5E1X A;  4ASN A;  4L5J A;  1J2X A;  2NAZ A;  1CGP A;  1KU7 A;  3V7R A;  1YQA A;  3ZMT A;  1H9T A;  4M6Y A;  3O3K A;  4Q5S F;  2A3S A;  1J7K A;  1P4W A;  3DPL C;  4LLL A;  3WE2 A;  1O7L A;  3D0S A;  4UNO A;  3WE3 A;  1RUN A;  4MTD A;  4HX8 A;  2RNJ A;  2XIG A;  1J0R A;  3HTU A;  2GA1 A;  1CF7 A;  4ENM A;  2VN2 A;  3KE2 A;  3GLX A;  5FFX A;  2O8X A;  3TQN A;  1O57 A;  4LB6 B;  3BJ6 A;  1OR7 A;  4NHJ A;  2FE3 A;  5FB2 A;  1HST A;  3HRM A;  2PN6 A;  2QEN A;  3G73 A;  1R1V A;  1QO0 D;  4GXO A;  2VOP A;  2E1N A;  3MQ0 A;  4ZYG A;  2J5O A;  2WTE A;  4KFC A;  4UVA A;  1E2X A;  4XLN F;  2M45 A;  1DP7 P;  4RS8 A;  2NS0 A;  3C7J A;  2QLZ A;  2UZK A;  4KN7 X;  2RV8 A;  5LHH A;  4MNU A;  4RGX A;  4XSX F;  1DUX C;  2VOD A;  5ICG A;  1V3F A;  4KIC A;  2IT0 A;  4L18 B;  3WTU C;  1IRG A;  2F5C A;  1XDU A;  1Z91 A;  5ICE A;  2KIM A;  4HF2 A;  1TBX A;  5CVR A;  2XAQ A;  3MFK A;  2RN7 A;  2ZNZ A;  2XHK A;  2ESN A;  4XRF A;  2HOE A;  3GVA A;  2A6E F;  1SFU A;  2EFN A;  1S7A A;  1U5T A;  4KIB A;  3DP7 A;  2DFI A;  1JE8 A;  2ESH A;  2STT A;  1FPQ A;  5LEJ A;  3KLO A;  4PZJ A;  3COA C;  1W7P A;  4ESJ A;  3HOS A;  2F2E A;  4Q4Z F;  3S2W A;  2KJC A;  3ZMD A;  3EET A;  3WU0 A;  2IJL A;  2OQR A;  3REO A;  4BNC A;  5TRD A;  3L00 A;  2VBX A;  3CLO A;  1XGM A;  4EJT A;  3PQK A;  2K27 A;  2VXZ A;  5AON A;  2FBI A;  1SD4 A;  4IPA A;  2OBP A;  5K5O A;  5JFR A;  2V1X A;  3NEU A;  2OZU A;  2ZXJ A;  1I1S A;  1MGT A;  4Z2Y A;  2Z3Y A;  3HUG A;  4M73 A;  1ZGA A;  4L0Y B;  2Y75 A;  2PQ8 A;  2VC0 A;  2L4M A;  1ZRD A;  3CTA A;  4CHU A;  2A68 F;  1SD6 A;  2DI3 A;  2LF7 A;  2QYO A;  5CYV A;  2A61 A;  4ZYH A;  1IRF A;  3HOT A;  3ULQ B;  4BYY A;  4HX7 A;  4PDK A;  3GYH X;  2XV4 S;  3ZMZ A;  3Q9S A;  1FWZ A;  1EH6 A;  5LGU A;  2W57 A;  5A2Q K;  5DCM B;  4CO8 A;  1Q1H A;  3KP2 A;  4JQF A;  5KVR A;  3U9G A;  3GO5 A;  3OV8 A;  4P9U A;  2W25 A;  5E18 F;  1PP8 F;  4RB1 A;  3J7A O;  3IWZ A;  1YO5 C;  2VE8 A;  4LK1 F;  4L9N A;  2M1B A;  3U2R A;  3KET A;  4WF2 A;  5HVQ C;  2LF8 A;  3K1P A;  1H9G A;  4M71 A;  4BHB A;  1R58 A;  2X0L A;  1MKM A;  4LMY A;  4LLN A;  1YW7 A;  1ZRC A;  1W7P D;  4AIH A;  4I0B A;  1FOK A;  2ETH A;  1XSV A;  3WTX C;  2QM3 A;  5A2Q Z;  4IRH A;  3N4M A;  2IA0 A;  1ZGJ A;  5L3B A;  1BIB A;  1IZ1 A;  2MC3 A;  1XMK A;  2HR3 A;  2FNP A;  5AIQ A;  1ZG3 A;  3WGH A;  3WTV C;  3GWZ A;  2EFW A;  3B73 A;  1ZYR F;  1HW2 A;  2COM A;  3DF8 A;  5E1Z B;  2DQL A;  3TOB A;  3LA7 A;  4LB5 A;  1D3Y A;  3M1E A;  1XGO A;  4KN4 X;  3CUQ C;  3BRO A;  4IRI A;  4P5O A;  3R60 A;  5HLH A;  2D1H A;  2ZJ2 A;  3ECO A;  2GA2 A;  3KEO A;  1E17 A;  5FD6 A;  4U88 A;  4NB5 A;  4HLY A;  2O61 A;  1H0M A;  2DK8 A;  2F5F A;  4Y15 A;  2PLY A;  1P6R A;  1OMI A;  3RKY A;  5JHU A;  2EB7 A;  4IRG A;  2XAF A;  3FHZ A;  2ZCW A;  2DU9 A;  3JTH A;  4EM1 A;  1IN4 A;  4PGH A;  3MCZ A;  2VBY A;  1VTN C;  3F72 A;  3SQN A;  1IXR C;  2PMU A;  2M5W A;  2K02 A;  1B9M A;  1T2K A;  3RDI A;  1LDJ A;  2XVC A;  5F64 A;  4HW0 A;  4KYW A;  4L0Z B;  5DUI A;  2O6G E;  4A0Z A;  4NQW A;  5L3F A;  5E20 A;  3E6D A;  3LAJ A;  2DK5 A;  3LWF A;  4M9S A;  2AS5 F;  5F6F A;  1FP1 D;  1QZY A;  3WOD F;  1LB2 A;  2FOK A;  4R1H A;  5HLI A;  4WWC A;  1BN5 A;  3EUH A;  3FX3 A;  5DD8 A;  4EM0 B;  3JAM K;  5TJJ A;  3O2P E;  5BOX A;  3F8F A;  1HSJ A;  3L09 A;  3V8K A;  5FO5 A;  4H0E A;  3BOQ A;  3V7S A;  4U0V A;  2HKX A;  1DDN A;  5JR3 A;  4LFU A;  3P9I A;  3TO6 A;  2HYG D;  4ZZL A;  3FXR A;  2ACJ A;  2RC4 A;  4ENK A;  1R22 A;  1HW5 A;  1KU9 A;  2EFQ A;  3HSE A;  4UUV A;  3G3Z A;  1PDN C;  3H92 A;  3H3U A;  1XSD A;  1MDM B;  4AVP A;  2DPD A;  3VFZ A;  3GZ6 A;  3DXJ F;  5ICF A;  4ZYE A;  2Y0M A;  4EJO A;  2L02 A;  3T1B A;  3I5U A;  4CYD A;  3IKT A;  3C3W A;  1HW1 A;  1KYZ A;  2ZME A;  4YII A;  3V8L A;  1YW9 A;  1YIO A;  5CVV A;  4EGY A;  2XRO A;  2ADU A;  1RNL A;  2YX4 A;  4OIO F;  1YG2 A;  3OOP A;  2VT3 A;  3TO7 A;  3I58 A;  5K5R A;  4EJU A;  1IAW A;  4A6E A;  5BMZ A;  4S05 A;  4I7H A;  4O5V A;  3CUQ A;  3BPX A;  5AIP A;  4RB0 A;  2B0L A;  3I54 A;  5IT3 A;  3ZN1 A;  2WC2 A;  3F8M A;  1QQI A;  2Q2E A;  2VC1 A;  5ILU A;  1T0F A;  3J81 K;  5CJ9 A;  3ERE D;  1K6O A;  2R3S A;  3QP6 A;  1JXS A;  4ENJ A;  4KIF A;  2Z33 A;  2EA4 A;  3GFJ A;  4B09 A;  1HKT A;  2XRN A;  4FX0 A;  1Z6R A;  2G7H A;  5HS8 A;  1KYW A;  3F6O A;  3KFW X;  2O0Y A;  3C1D A;  1ZH5 A;  2FXA A;  1O3R A;  2K86 A;  2CWE A;  1WQ2 A;  1IN8 A;  2CW0 F;  3I4P A;  4AIJ A;  3LAP A;  2EWN A;  5BS6 A;  4BAY A;  1HQC A;  2MH2 A;  4BXU A;  2BGC A;  3RYR A;  4I98 B;  3ZMV A;  2EK5 A;  3HRU A;  4O6J A;  4A0Y A;  4EMS A;  4YFK F;  3QAH A;  3J81 Z;  2EV6 A;  1DPU A;  4LD5 A;  4HBL A;  1R36 A;  2QBY A;  4G7Z F;  4OIQ F;  1WKM A;  4LGW A;  2V6C A;  2Z9O A;  5IT9 K;  1YTY A;  3HSF A;  1U3E M;  3LQR A;  2VT2 A;  3V7C A;  1OYW A;  3L9F A;  4F7Z A;  3I0T A;  3Q5F A;  1L0O C;  1D5V A;  1FT9 A;  2A6H F;  4GCV A;  5JI6 A;  1XGS A;  4HX4 A;  2Q8K A;  2CSO A;  2RKH A;  3F3X A;  3ML6 A;  5D8K B;  2CGP A;  3L7W A;  4ESF A;  4RB2 C;  1BC7 C;  4A5N A;  2GZW A;  4R79 A;  1ODD A;  4RAZ A;  2Z5U A;  1FYL A;  2BE5 F;  3VB2 A;  3E6M A;  4N9H A;  1R1U A;  2PMH A;  5JVT A;  1G3T A;  5D5W B;  1RIO H;  3I64 A;  4M6X A;  5H6Q A;  4D0P A;  5FGM A;  4BHC A;  5IT9 Z;  4RGR A;  5HDK A;  4U7B A;  2YSR A;  3WGG A;  5F1R A;  4G6Q A;  2XKP A;  4LG0 A;  3VOD A;  5D5U B;  2IRF G;  1MD0 A;  4E70 A;  1IXS B;  3ELK A;  3R6S A;  2MD5 A;  2KJB A;  1KU2 A;  3KP5 A;  2QUF A;  1LDK B;  1SMY F;  1SMT A;  1ULY A;  3BJA A;  3SZP A;  5BPD A;  3NRV A;  2P8T A;  4L9V A;  2JT1 A;  3FXQ A;  4I0A A;  4AD9 A;  2DPU A;  2J5P A;  1STZ A;  3FXU A;  3V4G A;  3C18 A;  3F6V A;  2Z99 A;  2GXB A;  2XAJ A;  1FSH A;  2DBB A;  3N97 A;  2JSC A;  3LA3 A;  3KP6 A;  2FEZ A;  1W5S A;  2HEO A;  1IXC A;  1EV7 A;  1IUY A;  3NQO A;  1CF7 B;  2OA4 A;  2V9V A;  5KK1 A;  4L9T A;  3JW4 A;  1FYM A;  4MEX F;  4WXC A;  3RJP A;  5LEK A;  1FBS A;  1P2F A;  2QQA A;  2UXX A;  5L3E A;  4BHP A;  4G7O F;  2PEX A;  4KDP A;  1ZG1 A;  3T8T A;  1MJB A;  4UV8 A;  5DDG A;  1BC8 C;  3QU6 A;  3GFM A;  2GXG A;  2HQN A;  1XN7 A;  2P5L C;  3BZ6 A;  3AAF A;  3K2Z A;  4BQA A;  1Z7U A;  2Q0O A;  1A04 A;  2WWY A;  3IWF A;  4GO1 A;  3M9A A;  4ETS A;  4PCQ A;  5J8F A;  2QZ8 A;  1YS6 A;  3MWM A;  2GIV A;  2MBF A;  4AWX B;  2LDU A;  1UCR A;  1S3J A;  5HDG A;  1KGS A;  4XLP F;  2V1D A;  4HAM A;  3QPT A;  4G7H F;  3RI4 A;  3HRS A;  1ZHF A;  1FYK A;  2QWW A;  4OIP F;  5L3D A;  5D6F A;  2ZNY A;  2CQK A;  5FLX Z;  3I59 A;  1HKS A;  3FWE A;  1R23 A;  2GQQ A;  3KCC A;  1U5T B;  3IHU A;  3IRR A;  1FX7 A;  4U7D A;  4FX4 A;  5D6E A;  5H20 A;  5DYM A;  2A5Y B;  3IC7 A;  3M7G A;  2ELH A;  4LLG F;  1W7P B;  4EGZ A;  4WCG A;  2FBK A;  5CVJ A;  2EV5 A;  2EFP A;  1ONV A;  5ERI A;  4IHS A;  3W6K B;  2H94 A;  1R1T A;  1KQ8 A;  4RAY A;  4HLX A;  3ZN0 A;  1PP7 U;  4KMU X;  4PGG A;  3LST A;  1TQP A;  3KLN A;  4IJA A;  2FSW A;  5K5Q A;  3MAJ A;  4ZZD A;  1BI1 A;  2XGX A;  1QPM A;  2FU4 A;  2NNN A;  3IL2 A;  4O3M A;  1MZB A;  2LSO A;  1XDS A;  4OMZ A;  3RPQ A;  2LNB A;  4IF4 A;  4UXN A;  1W4M A;  1ZN2 A;  2JPC A;  5EEG A;  4R8H A;  1USS A;  1O3Q A;  4WXH A;  5L3G A;  2R7D A;  5DCF A;  1U6G A;  2H6C A;  4HV5 A;  2C6Y A;  4P9F A;  1HBX G;  1LNW A;  3RKX A;  2CFX A;  5LHI A;  3HSR A;  1ON1 A;  4S04 A;  1WSU A;  4KT5 C;  2OZ6 A;  1P92 A;  3F8N A;  1K78 A;  4MGR A;  1FP2 A;  1LJ9 A;  3J80 Z;  1YFH A;  2ZKZ A;  2DW4 A;  5J6X A;  3DV8 A;  1S8N A;  1Y0U A;  3GZ5 A;  1Z1D A;  2HZT A;  1I6X A;  4RB3 C;  2M30 A;  3KZZ A;  2NRA C;  1YW8 A;  2OAZ A;  1S7O A;  1ZG5 A;  2OQG A;  2JZY A;  1G3W A;  4WX9 A;  4A0X A;  2AXL A;  2YR2 A;  1YYV A;  2MA3 A;  1ON2 A;  2EFO A;  3ABU A;  2PFB A;  1K7A A;  3GFL A;  3ABT A;  1I5Z A;  3GUD A;  4LK0 F;  5ED4 A;  1OPC A;  1IN6 A;  3O6B B;  2FML A;  1O7F A;  1TLH B;  2P6S A;  4YIF A;  4QLC U;  1O3S A;  1GXP A;  4KMF A;  3WTT C;  1IN5 A;  3TO9 A;  3DQV C;  4OIN F;  2IVM A;  4WK8 F;  1X3U A;  1FZP B;  4AIK A;  1GXQ A;  2W84 A;  1C0W A;  3DKW A;  4RGS A;  2VON A;  2RVC A;  4MQV A;  3GF2 A;  4HQM A;  2JPB A;  1BIA A;  4G9Y A;  4YFN F;  3VOE A;  1R5H A;  5DUK A;  4ZH4 F;  3U1D A;  3M8E A;  1LDD A;  2HWV A;  2E1C A;  2MLK A;  1WI9 A;  1RI7 A;  1J9I A;  1KU3 A;  2NNY A;  2FQ3 A;  1UFM A;  2KIF A;  4IHT A;  2A69 F;  2H27 A;  2FNA A;  1WRJ A;  3H3Z A;  2E7W A;  1AWC A;  1OKR A;  1V4R A;  1SFX A;  1YLF A;  5LLQ A;  1KQ0 A;  1I1G A;  4OIR F;  2MH9 A;  4HF0 A;  5HS9 A;  3KP4 A;  2RDP A;  3BY6 A;  3T0Y A;  3HRT A;  5ICC A;  2DT5 A;  5CVU A;  4MEY F;  1XGN A;  4XBF A;  1TNS A;  4GYI A;  2QQB A;  3CJN A;  5H6R A;  5BPI A;  2FRH A;  3LFK A;  1DPR A;  2BV6 A;  1QBJ A;  1FC3 A;  1GVJ A;  4K2E A;  3P9C A;  3ZP5 A;  2XAS A;  5E1W A;  3KEQ A;  2D1V A;  1TTY A;  2Y48 A;  3E5X A;  3ECH A;  3TKY A;  4B8X A;  3FM3 A;  2XUB A;  1WWX A;  1YS7 A;  1G3Y A;  3TDZ C;  3BJO A;  3QP5 A;  2L01 A;  3WGI A;  4UVB A;  4CGZ A;  4M9X A;  1J5Y A;  3F23 A;  1TW3 A;  2X4H A;  6PAX A;  1F4K A;  3ZMU A;  4DQ2 A;  5E17 F;  2O03 A;  1B59 A;  2HTS A;  3RYP A;  1R7J A;  4ZYD A;  3M8F A;  3WTW C;  1G4D A;  1BOA A;  1HXD A;  3GW2 A;  4P55 A;  5J8C A;  1ZLJ A;  5CVI A;  3F21 A;  3K1M A;  2IA1 A;  4P96 A;  3CDH A;  1P4A A;  4EQQ A;  1UHM A;  5LBQ A;  4HDU A;  2G7U A;  1U8R A;  5L3C A;  2LKP A;  4XSZ F;  1TW2 A;  1ZAR A;  1O3T A;  1GHC A;  1T98 A;  3WU1 B;  4ENN A;  5DCM A;  3QRF F;  1IW7 F;  2ZME B;  4HYE A;  1BJA A;  1U2W A;  2HKO A;  2RQP A;  1MJ9 A;  1PUE E;  1OYI A;  3K9T A;  2GAU A;  4OOI A;  4LJZ F;  4WXD A;  1S6L A;  1XB4 A;  3HTS B;  5DD4 A;  3CO7 C;  1S29 A;  1LEA A;  4ESB A;  1I27 A;  1FBQ A;  3CUQ B;  4CXF A;  2D45 A;  3MZY A;  2F5E A;  3KP3 A;  1T6S A;  3ZMS A;  2L3D A;  2BBY A;  3T8R A;  5LHG A;  3DFG A;  2DO7 A;  2O3F A;  1D8K A;  4HOB A;  5D4R A;  4ON0 A;  2STW A;  4G8X A;  1FSE A;  2DAO A;  3TGN A;  3KZY A;  2BEO A;  2P5K A;  1QNT A;  1T38 A;  3T5X A;  2M8E A;  2P4W A;  2TDX A;  2H6B A;  3R0J A;  1IF1 A;  1JHH A;  1D8J A;  4RGU A;  3FMR A;  4I2O A;  4N9I A;  1HKQ A;  2IA2 A;  2FMY A;  4QWQ A;  4EJW A;  3BPV A;  3D5L A;  4HA8 A;  3E5Q A;  2XKO A;  2F5D A;  3GXO A;  1UB9 A;  1IN7 A;  5K1Y A;  3JSO A;  1LEB A;  3SXY A;  5D5V B;  2QBY B;  4MHG A;  3VEP A;  4KUM A;  2JRT A;  2HYF A;  1SD7 A;  2K4J A;  5FLX K;  5FD5 A;  3HHH A;  1REP C;  3LA2 A;  1KA8 A;  4HQE A;  2UXN A;  4I01 A;  4OMY A;  1FLI A;  1TQI A;  2L4A A;  2BYV E;  3PFI A;  2FA5 A;  1B4A A;  2ZO4 A;  4UV9 A;  1JGS A;  5HLG A;  3R61 A;  2HDC A;  4DNC A;  1Z9C A;  3FZV A;  1W5T A;  2V79 A;  4CZZ A;  2HQR A;  1XCV A;  3WTZ A;  3BWG A;  1KQ9 A;  3EYI A;  1AOY A;  2P7V B;  4Y13 A;  4FHT A;  2CO5 A;  1B6A A;  2H09 A;  3R0A A;  4U0Y A;  3GEZ A;  2FBH A;  1SAX A;  1RUO A;  2P7C B;  4JBA A;  2W85 A;  4CIC A;  1BI0 A;  3P9K A;  2EV0 A;  4MTE A;  3HIF A;  2V1U A;  4LG0 B;  3TDU C;  1FY7 A;  2OD5 A;  2PI0 A;  3FMQ A;  4MQ9 F;  2ZFW A;  3F22 A;  1G6N A;  5LRS A;  4A12 A;  3E6C C;  1R5G A;  2KKO A;  1FNN A;  2XAG A;  4A2U A;  1OYY A;  3RTR A;  5D8L B;  3K0L A;  2PBI A;  2MLG A;  2P5V A;  1F5T A;  4Q48 A;  5HDN A;  3F8B A;  1MDM A;  3MEX A;  2JTV A;  1B9N A;  1QGP A;  2PG4 A;  1LVA A;  3ROU A;  3GFI A;  3QOP A;  4JK1 X;  2EJR A;  1BM9 A;  2EA2 A;  1ZLK A;  1MJA A;  1XCB A;  3IKV A;  1J75 A;  1ZRF A;  2K7L A;  3B02 A;  4GGG A;  4I02 A;  3J80 K;  5LRR A;  5HOO A;  3LQQ A;  4A5M A;  3E97 A;  5D5X B;  2OU2 A;  2P6T A;  2A07 F;  3WG9 A;  3L2C A;  4L5I A;  1J59 A;  2VOO A;  3QU3 A;  3R4K A;  3BDD A;  1LQ1 A;  1UHW A;  2XAH A;  1JHF A;  3KP7 A;  1BI3 A;  3SFZ A;  4G6D A;  3SZT A;  3IRQ A;  1QZZ A;  4M9Z A;  4M74 A;  2DTR A;  1U78 A;  4BH9 A;  3JTG A;  5CLS A;  2HFH A;  4N0B A;  4IXA A;  2HGC A;  4IVN A;  3ZPL A;  1EH8 A;  2W24 A;  1F1Z A;  3BP8 A;  1XMA A;  2CG4 A;  2IP2 A;  1K79 A;  4YG2 F;  4FT8 A;  2YPR A;  1XD7 A;  2IW5 A;  4HF1 A;  3RKW A;  5D4S A;  1EH7 A;  1ZAO A;  4Q47 A;  2IPQ X;  3MZH A;  1Z05 A;  3WTY C;  4Y17 A;  3W6J B;  3DEU A;  4U0W A;  3DPT A;  1T39 A;  3FM5 A;  5DEQ A;  2GWR A;  1BI2 A;  3K69 A;  3HYI A;  4UVC A;  2VE9 A;  1FBU A;  1Z6T A;  2PJP A;  2YU3 A;  2M87 A;  3E3V A;  1R00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...