1J9IA

Structure of the dna binding domain of the gpnu1 subunit of lambda terminase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TERMINASE SMALL SUBUNIT
publication title Insights into specific DNA recognition during the assembly of a viral genome packaging machine.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1j9iA00
2R7DA 3SHFA 4EJOA 3ZN0A 3HOTA 1FPQA 3V4GA 3I59A 5DEQA 4TV7A 3KP4A 4GXOA 3KEQA 1HW1A 1ZRFA 2P5LC 3WTVC 1YW9A 3RYPA 2QQAA 4JBAA 4A0XA 3DF8A 4L9NA 3K2ZA 1BI3A 2KRFA 2PG4A 1T98A 3R61A 2Y48A 3GFIA 2KIMA 2YSRA 1USTA 1FT9A 3P9KA 2K27A 2HTJA 2PBIA 3N97A 2HS5A 2Q8KA 3VOEA 2LKPA 5A2QK 1XMAA 1STZA 4S04A 1O7LA 1MD0A 1T6SA 3MWMA 1B59A 4EV0A 3ZP5A 5DYMA 1SAXA 1Z7UA 3M9AA 3RDIA 2Q0OA 3SZTA 4EJVA 3QOPA 3B02A 3HRUA 4RAZA 3T5XA 1W7PD 3FMRA 3SFZA 1REPC 5LLQA 1YS6A 2ZJ2A 2BBYA 5E8GA 3PQJA 2IVMA 1F1ZA 5HS7A 2L4MA 5J6XA 1ON2A 4AD9A 1Z05A 1D3YA 2OZ6A 1P92A 2VOOA 3K69A 4WK8F 3V8KA 2MD5A 3FM3A 1G3WA 3GZ6A 4A5MA 3JW4A 4BHPA 1T0FA 3HRMA 1BIBA 2BGCA 1ULYA 1Z6TA 2ZNYA 2OD5A 3REOA 4A6DA 4R1HA 2H27A 2CGPA 3ZMDA 4XLPF 1O3RA 3FXQA 3I71A 3I64A 4U7BA 2RC4A 1UHWA 3BJAA 4OMYA 4EM0B 5FD6A 4L9JA 4BXUA 1NHAA 4ESJA 4L0YB 4EQQA 1KYZA 3R6SA 3KZZA 4KUMA 4UHTA 1LDDA 2VBWA 3J80K 3OV8A 1PUEE 1FYKA 3JTHA 1G3TA 1ONVA 4WF2A 3TDUC 4KMFA 4G94A 1BBYA 1RIOH 3R0AA 1LEBA 2CYYA 2ADUA 1LB2A 4G6QA 1JHHA 2L3DA 1R22A 2OA4A 3BJOA 4CDGA 2A07F 2DU9A 2XKPA 5HDGA 1FWZA 3C18A 5FB2A 2D1VA 4HLXA 3MQ0A 4ZH4F 1A04A 1E2XA 3ZMTA 4MGRA 3KEOA 2Z99A 2ESHA 2OQRA 3E6BA 3LWFA 1YO5C 1O3QA 1HBXG 1I5ZA 2E7WA 3MAJA 4RGRA 2PI0A 1OYIA 2A6HF 2NAZA 1TQPA 3U1DA 2XAJA 2W25A 3KLOA 3EDPA 3QU6A 3HHGA 1DPUA 2LSOA 1YFHA 3S2WA 1Z9CA 2YPRA 1HKTA 3LQQA 4NB5A 3WU1B 3H92A 3BY6A 4ESBA 3F21A 3MZHA 4I02A 1I1GA 3V7RA 3WGIA 2W85A 3DP7A 2QBYA 3E5UA 1IN4A 2EA2A 5ILVA 2D45A 2A68F 1QZYA 5CVRA 2ZKZA 4CGZA 3HHHA 2Q2EA 1ZLJA 2IJLA 1Y0UA 2Z5UA 4IF4A 4M74A 4YG2F 2P8TA 1R36A 3TDZC 3F6VA 1C0WA 4UVBA 4AIKA 2EV5A 1IXSB 3FXRA 4R8HA 3HTSB 4Q5SF 1P4WA 4ZYGA 3KP5A 4GO1A 4OIPF 3T8TA 1R1UA 1TNTA 4NQWA 3JTGA 3TKYA 2FEZA 4UNOA 2HDCA 2CFXA 1F5TA 4S05A 2A3SA 3T8RA 1K6OA 4CHUA 1UFMA 3RKYA 5DCFA 2COMA 2Y75A 1IUYA 4OIRF 4EMSA 2Z33A 3HSRA 3V8LA 2EV0A 4Z2YA 3DEUA 4F7ZA 1K78B 1XDUA 3KZYA 2QBYB 1LDJA 3GW2A 4U7DA 3D0SA 1TLHB 2RN7A 3E6DA 2DI3A 2PEXA 1YG2A 1LQ1A 3I4PA 2EB7A 3ZMUA 4KYWA 5LGTA 3IWFA 2YR2A 2P6TA 3BPVA 3M1EA 3WGHA 3K1PA 3FMQA 3QU3A 2P6SA 1YLFA 2ZMEA 4EGYA 3QP6A 4LB5A 1TW2A 4O3MA 2XVCA 2W57A 2VE8A 4PGHA 5KK1A 1K79A 5L3GA 1ZRDA 2XAGA 5H20A 1IN8A 2IT0A 2A69F 1S8NA 1YYVA 1R1VA 2FU4A 2MLGA 1H9GA 5J8FA 4ETSA 4M6YA 1TQIA 2Z9OA 4GYIA 2XRNA 4CZZA 1FBSA 1LNWA 4ENJA 2BV6A 2MBFA 1MGTA 1P2FA 4UV9A 3Q5FA 1EV7A 2XUBA 3BOQA 3DXJF 2NNYA 5ERIA 3RTRA 5K5OA 2GZWA 3RIRA 1R23A 2VBYA 4ON0A 4I0AA 1KQ0A 4RGXA 3HTUA 4IRIA 3KP2A 3GFLA 5LGUA 2IPQX 1KU2A 4AWXB 3WTXC 4U0VA 2HWVA 3EYYA 5LHIA 2HQRA 4RGSA 4G7OF 3BP8A 2OBPA 3J81K 2QZ8A 2LF7A 4N9IA 2HFHA 5JFRA 5JVTA 2ESNA 4EM1A 2HTSA 2AXLA 1H9TA 2DBBA 2Y0MA 3COAC 5DDGA 2CWEA 2XROA 5H6QA 1CGPA 2EJRA 2K4BA 4EVIA 2K7LA 1YIOA 3ZMVA 2VT3A 4IXAA 2CO5A 3HRTA 3Q9SA 3Q9VA 4A5NA 2V6CA 5LHGA 3D5LA 5F6FA 1XGMA 3IRQA 3E3VA 5CVIA 4KN4X 2EFOA 5LRRA 2FXAA 1KQ9A 1RZ4A 1ZAOA 3HUGA 2EFWA 1O3TA 4IPAA 5JR3A 1IN5A 3LAPA 5IT9K 2EFNA 1JXSA 3K1MA 4HF1A 2NS0A 4HA8A 4EJWA 2PJPA 2EV6A 3TOAA 3H3UA 2G9WA 4UUVA 4KICA 3SQNA 4A0YA 3QPHA 3ELKA 2R7FA 1O57A 4FX0A 4RB1A 1OMIA 1I27A 3GYHX 2L4AA 5FLXZ 1KU7A 3GWZA 2PQ8A 3EETA 3WE2A 1LDKB 1UB9A 2ZXJA 2FA5A 1ZREA 1FP1D 5ILSA 1HKSA 2EFPA 3RPQA 2ELHA 4M9ZA 4ESFA 1IZ1A 4I01A 1BOAA 4KIBA 5CYVA 1FSHA 4OINF 3WTWC 2QENA 3TO9A 1WRJA 2IA2A 4A2UA 2DLLA 2UWMA 2PMHA 3R60A 3MEXA 2RKHA 1QGPA 3ERED 1AOYA 4HQMA 4H0EA 1ZRCA 3BROA 4IHSA 3V7CA 1WWXA 2HOEA 2X0LA 1HQCA 1J0RA 1ZHFA 2XASA 2HGCA 5DUKA 4LK0F 2MC3A 1KGSA 3I59B 2IW5A 4QLCU 3RI4A 3I54A 5DCMA 1B1BA 3F8CA 5JI6A 2GAUA 4KIFA 2M1BA 3M8EA 2F5EA 2V1DA 1BIAA 3QP5A 1SMTA 3CUOA 4UXNA 3CTAA 4HOBA 5K5QA 4IVNA 2QWWA 3HRSA 1AWCA 2YU3A 4A6EA 3T0YA 5TRDA 2GQQA 1OYYA 4WWCA 3F23A 5ICGA 4I7HA 4L18B 3TQNA 2UXNA 4Q47A 5BOXA 1I1SA 1BM9A 2K02A 1GVJA 5L3EA 4KNYA 3WTTC 4CO8A 2TDXA 3DQVC 2DQLA 5ED4A 1DDNA 2OQGA 2KKOA 1QPMA 1ZG5A 3M8FA 3MFKA 1J59A 4YIIA 1LJ9A 1R7JA 5E1WA 2A61A 4PZJA 1MJ9A 1ZGJA 1SD6A 1U8RA 2H6BA 2FNPA 4XBFA 4IRGA 2OAZA 5FLXK 5L3BA 5DCMB 4GGGA 2RQPA 2RGVA 5E1ZB 3WTSC 2VBXA 1JGSA 3OOPA 3IL2A 3IKTA 3N4MA 4RB0A 1RI7A 1FLIA 4OIQF 1DPRA 5LBQA 1YQAA 1SD4A 5LGNA 2CQKA 3W6KB 1S29A 4R79A 2GXBA 2BYVE 3E5QA 3O2PE 2DPDA 3LAJA 1SFEA 5HVQC 2GA2A 2QUFA 1U3EM 1WSUA 2XKOA 3LA7A 3SZPA 2D1HA 3FXUA 4HBLA 5HLIA 2H09A 2ISZA 3V7SA 4M71A 1DP7P 2JPCA 2KIFA 5H6RA 3P7NA 2WC2A 5FFZA 1P4XA 4I2OA 3WU0A 1XGSA 4RB2C 1IRFA 1UHMA 1P6RA 2GIVA 2H6CA 3DFGA 4AIHA 1FX7A 1XSVA 3IHUA 1XGNA 2YX7A 1FP2A 4U88A 3ABUA 4KA4A 2VT2A 2QVOA 2VOPA 4M73A 6PAXA 4CXFA 1ZGAA 5HLHA 3F8MA 3CO7C 1R00A 1B6AA 2F5CA 1IF1A 2HYFA 2XV4S 3FMSA 1W7PA 3IKVA 1OPCA 5F64A 3SXYA 2HEOA 2MLKA 1EH6A 2BEOA 2FNAA 4K2EA 1YW8A 3E6MA 1U5TA 5K1YA 2VODA 3R0JA 2JPBA 1FBUA 4G8XA 2JZYA 2OZUA 2XAHA 3KLNA 1E17A 1J9IA 2P4WA 5BQTA 5BMZA 2MA3A 2FBHA 2WWYA 4CYDA 4Q48A 1K7AA 3U2RA 3J81Z 4I98B 3JAMZ 1GXQA 4MEYF 4NHJA 3ZMSA 2QQBA 5J8CA 3I58A 3K1NA 1XDSA 2NYXA 3KFWX 3I5UA 5E18F 1HSJA 4LFUA 5HOOA 3GFMA 4M6XA 1BC7C 2PLYA 2K4JA 3I0TA 2KJCA 2D2WA 1WQ2A 4B09A 4CICA 3NQOA 2JSCA 2F2EA 5E8IA 3FM5A 1Z91A 5FD5A 1IN7A 1F9NA 2J5PA 2CG4A 4MEXF 5EEGA 4LMYA 5D6FA 4RS8A 4Y15A 4D0PA 2O0YA 5IT9Z 1MDMA 2DK8A 3BPXA 4RAYA 4LG0A 1QBJA 1W7PB 1IAWA 4DNCA 5BS6A 5ICCA 2WTEA 1U5TB 1HW2A 3F72A 4LLNA 3CUQA 3L7WA 3HOSA 4LK1F 3ZQ7A 4HX8A 3MCZA 1XCBA 3QPTA 1FY7A 2L01A 4HX4A 3GF2A 1U78A 1XSDA 4N0BA 2QM3A 2HYGD 3C7JA 5HDKA 3ZN1A 5D8KB 1Z1DA 1IN6A 1HSTA 4ENMA 5K5RA 3R4KA 2O3FA 3WG9A 1G6NA 3F8BA 4JK1X 1R5HA 2JTVA 2V9VA 2O8XA 4P96A 3ZMZA 4UVCA 1BC8C 5D4SA 4PCQA 3CO6C 3FWEA 1IXCA 4OIOF 1MDMB 5LRSA 2XGXA 2AS5F 2O03A 2DPUA 4LG0B 2M30A 3G3ZA 4UV8A 2V1XA 2PFBA 2KJBA 1YW7A 1Z6RA 4P9UA 4BHCA 3CUQB 3F8NA 3GXOA 1D5VA 1OYWA 1RUOA 3RJPA 1SD7A 5E20A 4WXCA 2EK5A 5HS8A 3JAMK 3GLXA 2HKOA 2ZMEB 4HDUA 1USSA 1MJAA 1WI9A 2Z3YA 2F5FA 1S7AA 2A6EF 2ISYA 3W6JB 2L02A 5D5UB 3WE3A 4Y17A 4MNUA 1TQMA 4FHTA 1S6LA 2GXGA 4Q4ZF 4YFXF 2DO7A 3RPUA 1ZG1A 2W84A 1GHCA 4IJAA 4RB3C 5LHHA 4LD5A 5ICEA 1P4AA 1CF7A 3FF5A 3KCCA 1T38A 5HDNA 4KN7X 5DV5A 4WXHA 4N9HA 3B73A 4ZYHA 2RVCA 1R58A 5IT3A 1JHFA 4BQAA 2VBZA 4HZFA 1HKQA 2V79A 3DPTA 1KA8A 4HX7A 2VN2A 4KFCA 3GEZA 1KQ8A 3WTYC 2VC1A 4BHBA 4LB6B 2P5KA 1U6GA 2LDUA 1J75A 1FSEA 4ZZDA 2VXZA 1FBQA 2R3SA 1X3UA 4ZYEA 1T2KA 1R1TA 4LJZF 2FMLA 4EGZA 4BYYA 1XB4A 2K86A 2DAOA 2QLZA 4ENNA 2NNNA 2UZKA 2VE9A 3DV8A 3L00A 4FT8A 3T1BA 1D8KA 2CW0F 2JRTA 5D6EA 4O6JA 2DK5A 3LSTA 1WKMA 1ZLKA 3RKXA 4HW0A 1CF7B 4HYEA 4EM2A 1BI2A 4ZYDA 4HLYA 3KP3A 4B8XA 4OU0A 4QWQA 3F3XA 2X4HA 2V1UA 3WTUC 1V4RA 5KVRA 3GFJA 3DPLC 3NRVA 1O3SA 5D8LB 3VEPA 3TOBA 3JSOA 1QNTA 2ZBKA 2E1CA 3EYIA 1V3FA 3G73A 2XIGA 3CDHA 4BAYA 1XSXA 4E70A 4L9TA 4OOIA 4OMZA 1S7OA 3GZ5A 4A12A 2FSWA 3TO7A 4P5OA 2DT5A 5ILUA 5D5WB 4EJUA 1L0OC 5EEHA 4G7HF 3FHZA 2H94A 1ON1A 2O61A 4HAMA 3ABTA 2VONA 4ENKA 5LEJA 2IP2A 2LNBA 3GVAA 4HDVA 4KDPA 2NRAC 1YTYA 5FFXA 1KU3A 3KE2A 4GCVA 1XMKA 2PN6A 3P9CA 5E17F 2GA1A 3O6BB 3PFIA 1JE8A 1H0MA 1HW5A 4UVAA 5CJ9A 1PP8F 3P9IA 3LA3A 4MQ9F 1UCRA 1MKMA 4LLLA 2IA1A 3ECHA 3F6OA 1I6XA 2CSOA 3WODF 4A0ZA 1QZZA 4HF0A 4LLGF 3IWZA 3C3WA 3ISPA 2FOKA 1SD5A 3QRFF 1XCVA 1O7FA 5TJJA 2OU2A 2FBIA 3VFZA 4YIFA 1BJAA 3EUHA 2E7XA 1ZN2A 2B0LA 1ZARA 4XSZF 3TGNA 3CJNA 1SFUA 2DW4A 1KU9A 3ROUA 2HKXA 4MQVA 5HLGA 4YFNF 1QO0D 2WV0A 2HQNA 1FYMA 3FX3A 5LEKA 4LGWA 3ML6A 5D5VB 1G3SA 3KP6A 4MHGA 3DKWA 5FO5A 4JQFA 4XSXF 5BPIA 2P7VB 3HSFA 3JSPA 3M7GA 2KIUA 4U0WA 1G4DA 3VODA 2JT1A 2ACJA 2F5DA 4L5JA 3HIFA 2J5OA 4BH9A 1RUNA 1SFXA 4XLNF 3LFKA 3KETA 2C6YA 2RNJA 3I53A 2ETHA 4ASNA 3ULQB 3KP7A 1BI0A 5HS9A 4G9YA 1IXRC 5F1RA 3F22A 3WTZA 2VC0A 1W4MA 3F8FA 2ZNZA 3V8JA 3IC7A 5CLSA 1K78A 1TTYA 3K0LA 2YX4A 1XGOA 1SMYF 3MZYA 5CVJA 5BPDA 2DFIA 2DQRA 1L3LA 1MJBA 5CVUA 2FMYA 1DUXC 1BN5A 3LA2A 4M9SA 3IRRA 1FZPB 2L54A 4Y13A 3HYIA 2DTRA 1ODDA 4I09A 1U5TC 2FQ3A 1B4AA 1XD7A 3H3ZA 4ZZLA 4KT5C 2HR3A 3AAFA 4MTDA 4KIGA 3LQRA 1FYLA 2STTA 4FX4A 2EWNA 2G7HA 1S3JA 3E97A 3BWGA 5JHUA 4YFKF 4L9VA 2P5VA 1RNLA 3BZ6A 3U9GA 2ZFWA 3E5XA 2QQ9A 1HXDA 2HZTA 1TW3A 1J2XA 5AIQA 2FF4A 2BE5F 2O6GE 4I0BA 3HSEA 1EH7A 2PMUA 1OKRA 1IW7F 1KYWA 4P55A 5DD4A 1IRGA 1LEAA 2FBKA 1EH8A 3RYRA 1J5YA 3FZVA 2STWA 1D8JA 3EQLF 2P7CB 1U2WA 5D5XB 3VB2A 1G3YA 4XRFA 1OR7A 5CVVA 5DUIA 2GWRA 5AONA 1BI1A 4G6DA 1MZBA 4HV5A 1ZH5A 5ICFA 3CUQC 1LVAA 2QYOA 4DQ2A 2LF8A 5DD8A 3NEUA 2XAFA 2EFQA 1YS7A 2ZO4A 2XHKA 2IA0A 4RGUA 3O3KA 2MH2A 1B9NA 1TNSA 1ZYRF 3CLOA 3J7AO 4HQEA 5A2QZ 4P9FA 4KMUX 5L3FA 1PP7U 3WGGA 4BNCA 4L0ZB 4PGGA 4G7ZF 1XN7A 3L2CA 4WXDA 3PQKA 5FGMA 1ZG3A 1T39A 1QQIA 4WCGA 1F4KA 4AVPA 1W5TA 1Q1HA 2A5YB 2E1NA 3L09A 2FE3A 5D4RA 4M72A 4O5VA 2M8EA 1TBXA 2UXXA 3K9TA 4HV6A 4IRHA 3E6CC 3GUDA 1GXPA 4HF2A 2RDPA 2XAQA 2M87A 4IHTA 3GX4X 3L9FA 3RKWA 5AIPA 1R5GA 3BDDA 1W5SA 4PDKA 4L5IA 3TO6A 2G7UA 4GYGA 1J7KA 4EJTA 1VTNC 1FNNA 3ECOA 5L3DA 2IRFG 1FC3A 1FOKA 4U0YA 3QAHA 5E1XA 2M45A 1B9MA 2EA4A 3BJ6A 3ZPLA 4MTEA 2FRHA 4WX9A 2RV8A 2W24A 3C1DA 2ZCWA 1PDNC 3J80Z 2MH9A 4AIJA 4M9XA 2M5WA 5L3CA 3GO5A
chains in the Genus database with same CATH superfamily
2R7DA 3SHFA 4EJOA 1X19A 3ZN0A 1RETA 2MYSA 3HOTA 1A35A 1IRZA 1FPQA 3V4GA 2A05A 4J00A 2VKEA 2D5VA 1RRJA 3I59A 5DEQA 3DTKA 1W0TA 4TV7A 4CYCA 3KP4A 3CMAI 4GXOA 3KEQA 3AG4H 4E7IA 1HW1A 1ZRFA 1XS9A 1K4TA 5E3OA 2P5LC 3K70C 3SFIA 3WTVC 1YW9A 3RYPA 2QQAA 4JBAA 4V2FA 4A0XA 3GBGA 3DF8A 1OCCH 2QKMB 4L9NA 3K2ZA 4ABZA 1BI3A 2KRFA 1TWHJ 2LY2A 1NG7A 2PG4A 1K4SA 1T98A 4F3QA 1QHGA 3R61A 2Y48A 3GFIA 3PO2J 1T08B 2QSFX 3DBRB 2KIMA 3HZJA 2YSRA 2EZLA 1USTA 1FT9A 3P9KA 2K27A 1WVRA 2HTJA 3TBIA 2PBIA 1NK2P 4RLQA 3N97A 2HS5A 2Q8KA 3VOEA 5EZGA 2LKPA 5A2QK 1XMAA 2BOLA 1STZA 4S04A 3OS1A 3KIOA 1SEUA 3QYEA 4XKBA 1O7LA 1MD0A 2YS9A 3GTQJ 1T6SA 5IPAA 1ENHA 3MWMA 1MH3A 1B59A 4EV0A 3ZP5A 5DYMA 2NVTJ 1SAXA 5FJ8J 1TWAJ 1Z7UA 3M9AA 4ITVA 3RDIA 1Y56A 2Q0OA 3SZTA 4EJVA 2FQ4A 3QOPA 3B02A 2H1KA 3HRUA 3KX2A 2E1MC 4M3DA 4RAZA 1GUUA 2W48A 4C30A 3T5XA 1TT0A 1W7PD 2M4KA 3FMRA 3SFZA 2R93J 3OSFA 1REPC 5LLQA 1YS6A 2ZJ2A 2BBYA 5E8GA 3PQJA 1LFBA 2IVMA 1F1ZA 2I10A 4AUXA 1JKQC 1R4NB 1WI3A 5HS7A 2L4MA 2HOSA 3FBNB 5J6XA 1ON2A 4AD9A 2BVMA 3JRGA 2DMUA 4NC7A 3G1MA 3A2KA 1Z05A 1D3YA 2KISA 1WCMJ 2OZ6A 5GTIC 1P92A 4CYCB 2XF6A 1DP3A 1ACIA 3C2BA 1A31A 4BU2A 2VOOA 3GTKJ 3K69A 2BXYA 4HRIA 4DYQA 3K4LA 1R49A 4LIUA 4WK8F 3V8KA 1ETXA 2MD5A 3FM3A 1G3WA 3GZ6A 1A5JA 4A5MA 3JW4A 3OIOA 1X1CA 1X4OA 4BHPA 1T0FA 3HRMA 4BXFA 4CCKA 1BIBA 3OIQA 2OF7A 2VLAA 2AHQA 2BGCA 1ULYA 1Z6TA 3TEDA 4BGDA 2JUCA 1AA7A 2E1MB 4XLFA 2ZNYA 3OYCA 2OD5A 3REOA 4A6DA 4R1HA 2H27A 4QPOA 2CGPA 3B6CA 3RQ4A 3ZMDA 4XLPF 4YELA 1O3RA 3PIOF 4DBRA 3FXQA 2F5VA 4PK4A 3I71A 2EZIA 3I64A 3OR2C 4U7BA 2IS2A 2R7TA 2RC4A 1UHWA 3BJAA 4OMYA 4EM0B 5FD6A 3CF5F 5J4YA 2CV1A 4L9JA 4BXUA 1NHAA 4ESJA 4L0YB 4EQQA 2DN0A 4CZCA 5F0CA 4F91B 1KYZA 4A93J 3DWLE 4UB6C 3R6SA 3KZZA 1LKXA 3LSPA 4A3IJ 4KUMA 2K9LA 3HKZN 4XRMA 4UHTA 4BQQA 3DEEA 1LDDA 3WG7H 2VBWA 3J80K 1BR4A 3OV8A 2KIQA 1MMDA 2W00A 1PUEE 3QWLA 3OYJA 1FYKA 3JTHA 3LSJA 1G3TA 1SANA 1ONVA 4WF2A 3FXOA 3NARA 1YRNA 3TDUC 1VQPI 5IP7J 3D1NI 4KMFA 1X3WB 1K83J 1V5EA 2WAQN 3OYDA 4G94A 1P7JA 1BBYA 1YE9A 1RIOH 1WH5A 4BQOA 2CMPA 3HDDA 3R0AA 4XK4A 2GIZA 2LR8A 2LREA 3S32A 1LEBA 2CYYA 2R4GA 2ADUA 4A3FJ 1LB2A 4G6QA 1JHHA 4BY7J 1NK3P 3BLYA 3ABLH 3OIPA 4B48A 2L3DA 1R22A 4E7JA 2OA4A 4Y4RA 3BR3A 3C2GA 3BJOA 2VPLA 4CDGA 2VJIA 2A07F 2DU9A 2XKPA 3H35A 3H5AA 4ANJA 5HDGA 1FWZA 2MGQA 3EUHC 2R7UA 3C18A 4E6KG 2XSDC 2CV0A 5FB2A 1AKHA 1FJLA 2D1VA 2DOAA 4HLXA 3MQ0A 4ZH4F 1A04A 1E2XA 3CF2A 3GCMA 3ZR8X 2LC2A 3ZMTA 4AM3A 2BY3A 5DS9A 4MGRA 3KEOA 2Z99A 5IYCJ 4JX5A 2ESHA 2OQRA 3E6BA 3LWFA 1YO5C 2JVGA 2Y31A 4MLOA 3KYDB 4IQJA 4L5EA 3H1CA 1JJ8C 2XC7A 1O3QA 1HBXG 1VI0A 3S3MA 1I5ZA 1R9TJ 1HDPA 2E7WA 3MAJA 2A6TA 1LVKA 4RGRA 2ID3A 2PI0A 4II2A 1OYIA 2OCCH 3HGYA 1ORKA 2A6HF 2NAZA 2L9RA 3FKIJ 3IUOA 1TQPA 3U1DA 3KYCB 2XAJA 2W25A 3KLOA 3EDPA 3QU6A 3HHGA 3RKQA 3H3VK 1DPUA 2LSOA 4PJLA 1YFHA 3S2WA 3DBLB 4BJ6C 1Z9CA 2YPRA 3IH3A 3LQQA 5IOZA 1MSEC 1HKTA 4NB5A 3WU1B 3H92A 2N8GA 1WJAA 3BY6A 4IL6C 4ESBA 4LITA 2X1CA 2CUJA 4HNVA 1HOMA 3F21A 1MNMC 3MZHA 4I02A 1I1GA 3V7RA 3WGIA 2W85A 3DP7A 3J7YJ 2QBYA 2V7FA 2W4SA 3QODA 5E3MA 3E5UA 3C2HA 2O8KA 1J09A 3NWSA 2CUZA 1IN4A 3OS2A 3K7AJ 2EA2A 3FXMA 5ILVA 5FLVA 1OFCX 2X1DA 2D45A 2A68F 3DKYA 1QZYA 4RAFA 2ZKZA 5CVRA 4CGZA 3HHHA 3MZ8A 2Q2EA 1ZLJA 4I6ZA 3H9QA 1JUMA 2IJLA 3OYAA 1Y0UA 2Z5UA 4DW6A 4IF4A 4M74A 3L2RA 1JI8A 4YG2F 2DFFA 4DJAA 2P8TA 1T33A 2WV1A 3K2AA 1QHHD 1VQMI 1R36A 2V4JC 3TDZC 3F6VA 2L9SA 3RPUD 1C0WA 4UVBA 1QVUA 3AG2H 4AIKA 3BQZA 2EV5A 1IXSB 2Y0SN 3LMMA 3FXRA 2ZJPF 4R8HA 3HTSB 2HPIA 4Q5SF 2W7NA 1P4WA 4ZYGA 2W1OA 3KP5A 3S1NJ 2DA5A 4GO1A 4OIPF 3T8TA 3CCMI 1R1UA 1TNTA 2ME0A 4NQWA 3HGGA 5B1AH 3JTGA 3TKYA 1GT0C 2FEZA 4UNOA 5GADJ 2HDCA 2CFXA 1UMQA 1F5TA 4S05A 2A3SA 2HVRA 1FMVA 3T8RA 1K6OA 5M5WJ 4CHUA 1UFMA 2B7EA 2I5UA 4I99C 3RKYA 3WU2C 2XAUA 5DCFA 1U9OA 2COMA 2Y75A 1IUYA 3W6VA 3QYFA 4OIRF 4NDLA 4BQNA 4EMSA 2Z33A 3HSRA 3V8LA 2E60A 2EV0A 3G1LA 1IJWC 4Z2YA 2L7KA 3DEUA 4F7ZA 1K78B 2DA2A 1WJ5A 1XDUA 3KZYA 3LNQA 2QBYB 3TL4X 4IKFA 4QSHA 3G6EI 1LDJA 3GW2A 4G12A 4U7DA 1Z67A 3D0SA 1TLHB 2RN7A 1VQKI 1YX5A 5K7HA 3ERMA 3E6DA 2DI3A 2PEXA 1YG2A 4KITB 1LQ1A 2CQNA 3I4PA 2EB7A 3K4JA 3ZMUA 3U21A 2M4GA 2K85A 4QPQA 1VQLI 4KYWA 1VQ7I 4IOAF 3HJEA 2XDVA 3H5RA 2VJJA 4ZYAA 5LGTA 3IWFA 2YR2A 2P6TA 3BPVA 4BDZA 2E5NA 3QQAA 4G6TB 3CMEI 4DIQA 2XF7A 1R6RA 3M8JA 2DMQA 2CQXA 3M1EA 1YHQI 1IUFA 4MFEA 1N25A 2LMDA 1WHUA 3WGHA 1WJCA 1MBFA 3K1PA 3FMQA 3QU3A 2P6SA 1YLFA 3W3CA 2ZMEA 4EGYA 1R4MB 1XX5A 1D1CA 3QP6A 5C3EJ 4LB5A 1GV5A 2Y9YA 4XQFA 3VYSB 1I50J 1TW2A 3A0HC 3UKGA 1N75A 4O3MA 2XVCA 1XTAA 2IGOA 2W57A 2DDBA 2VE8A 3PNVA 4PGHA 3HPGA 3S3NA 5KK1A 1K79A 4UY8I 2RAEA 5L3GA 1ZRDA 2OC6A 2PMZA 4FE4A 2XAGA 4RM3A 4NQWB 5B1BH 3EUAA 5H20A 2NS7A 4UUTA 5J1UA 1IN8A 2IT0A 1UAAA 2A69F 1S8NA 1YYVA 1R1VA 2FU4A 1H89C 2MLGA 1H9GA 4RA2A 5J8FA 4ETSA 4M6YA 3OSGA 1TQIA 2Z9OA 4C9YA 4GYIA 4M3FA 2XRNA 4CZZA 3GTJJ 1FBSA 1WH7A 1LNWA 1HCRA 4ENJA 1Z7LA 3GTPJ 2BV6A 2MBFA 1MGTA 1P2FA 4UV9A 3Q5FA 1EV7A 2XUBA 3BOQA 3DXJF 2HOAA 3IAM2 5ERIA 2NNYA 2R7SA 2X1EA 3RTRA 5GAEJ 5K5OA 2GZWA 3BTCA 3A1YA 2NVQJ 3RIRA 1R23A 3CJTB 1SFOJ 2VBYA 4ON0A 4I0AA 1KQ0A 4RGXA 3HTUA 4XOPA 4IRIA 4A69C 3KP2A 3IH4A 2R5YA 1D1BA 2LY1A 3GFLA 3ZRGA 5LGUA 3E7LA 1LFUP 2IPQX 1UZCA 3OS0A 1KU2A 3RZOJ 1ETVA 1MIJA 4AWXB 3QPLA 3WTXC 4U0VA 2HWVA 2ECBA 3PM1A 3CCEI 3H0GJ 3EYYA 5LHIA 5IYBJ 3H36A 1P9QC 1AU7A 2HQRA 3BG6A 2ZB9A 4FTHA 4X0GA 2P81A 4RGSA 2ZSHB 4B1RA 3B6AA 3DEWA 5C4JJ 3TP3A 4G7OF 5LFAA 3BP8A 2OBPA 2R7VA 2IS1A 3J81K 2QZ8A 1D0ZA 2LF7A 3LSKA 2GBYA 2HPMA 4N9IA 2HFHA 4RAGA 5JFRA 2ESNA 5JVTA 1BL0A 4M6VA 2BZTA 3S15J 2KLOA 3CCJI 2DA3A 4EM1A 2HTSA 2LTPA 3JR9A 2AXLA 1H9TA 5GP9A 2DBBA 2Y0MA 5FLMJ 3COAC 3CJQB 5DDGA 2CWEA 2XROA 1XC5A 5H6QA 1CGPA 1X1AA 1X58A 2EJRA 2K4BA 4EVIA 2K7LA 2X9DA 1YIOA 1FIAA 3ZMVA 2VT3A 2IGKA 1X1DA 1HDDC 4IXAA 2CO5A 1I3AA 4U87A 3A0BC 3HRTA 1YX3A 4E7SA 2P0WA 4AVZA 3Q9SA 1S7EA 3A4CA 3S17J 4ZDPA 3Q9VA 4A5NA 2GOXB 2KHMA 2V6CA 3IH2A 5LHGA 3D5LA 3M3YJ 5F6FA 1XGMA 3IRQA 4IZZA 3E3VA 5CVIA 5HODA 1IV6A 4KN4X 2EFOA 5KCMA 5LRRA 4F55A 2FXAA 2Y9ZA 2DYSH 3S16J 1KQ9A 1RZ4A 1ZAOA 3HUGA 1O4XA 4XIDA 2DA7A 4NBQA 2EFWA 3I55I 4II3A 5M5YJ 1O3TA 4IPAA 5JR3A 1IN5A 3FKJA 5FRNA 3LAPA 5EGOA 5IT9K 4C3JJ 1E3HA 5EG0B 2JA6J 2EFNA 3MN2A 1JKOC 2FJ1A 1JXSA 3K1MA 4HF1A 2NS0A 3BC8A 4HA8A 4XLEA 4EJWA 3HBLA 2PJPA 2CFOA 2IGNA 3CP8A 3BR0A 2EV6A 3TOAA 1Y1VJ 2LRDA 2XB5A 3H3UA 2DT7B 3BR5A 4S0HB 2G9WA 4DOZA 4BACA 5K7FA 4UUVA 3QPSA 4KICA 3SQNA 4A0YA 3QPHA 3ELKA 2R7FA 1O57A 4FX0A 4RB1A 3Q3SA 1OMIA 5CQGA 2BHZA 1I27A 4FCYA 1V55H 3GYHX 1GDTA 2L4AA 2WBMA 2CJJA 5FLXZ 5FKOA 3GWZA 1KU7A 2PQ8A 3HG9A 3ZQQA 3EETA 3ASNH 4OAZA 3FDYA 1VQ4I 1W36C 2BXZA 3WE2A 1LDKB 2LVSA 1UB9A 4KT6A 1IGNA 2WB1A 2ZXJA 3FBIB 2FA5A 2WY8Q 1ZREA 5J47A 1FP1D 5ILSA 4PFPA 4JYKA 1HKSA 2EFPA 1VQNI 3RPQA 2ELHA 4M9ZA 4ESFA 4BJTA 1S9HA 1IO2A 4HPQA 3K4NA 3GTLJ 1IZ1A 4I01A 4V19K 1JTYA 1BOAA 2HU9A 3HB9A 4KIBA 5CYVA 1SVLA 1JJ6C 2VKVA 1FSHA 4OINF 3WTWC 3O8GA 2QENA 3BR1A 1JGGA 3TO9A 3WHCA 3OYKA 3BR2A 1PUFA 1WRJA 2HYJA 2IA2A 4M3GA 3HUGB 2DLLA 4A2UA 2UWMA 3CD6I 2PMHA 3R60A 2RNGA 1VQ6I 3MEXA 1N77A 2RKHA 4W97A 2E71A 5CKTA 1QGPA 3IAS2 5DM6F 3X2QH 4XN3A 5EGOB 4PSWA 3RCOA 3DU6A 4KISA 3ERED 3J7AY 1AOYA 2WADA 4HQMA 4H0EA 4PJ0C 3Q0WA 4FISA 1ZRCA 2CUFA 2XF5A 2B9SA 3BROA 2OV7A 4IHSA 1ZELA 3V7CA 1WWXA 2HOEA 2X0LA 1HQCA 1J0RA 1ZHFA 5FKKA 2XASA 2HGCA 2ZFUA 5DUKA 4LK0F 1UHSA 2JUGA 3MKYB 1WZ2A 5E3LA 2MC3A 1YOVB 2K9MA 4A3JJ 1KGSA 3I59B 4E7HA 2IW5A 1X4PA 4QLCU 1Z3YA 3I56I 1ETQA 2VJ4A 2M2EA 3I54A 4DZJA 2L7FP 3RI4A 2KP6A 5DCMA 1B1BA 3F8CA 5JI6A 2GXAA 2GAUA 2Y2ZA 4KIFA 5H2FC 4V2GA 2M1BA 4HG2A 2CU7A 3CP2A 4HSRA 1PYVA 5F04A 3M8EA 4PFOA 2F5EA 4A3EJ 1IDZA 2DJNA 2CUEA 2V1DA 2DA6A 2HOTA 1BIAA 2M7AA 3QP5A 3VSLA 3GTMJ 1SMTA 3CUOA 3OYLA 4UXNA 2CQQA 3CTAA 4HOBA 4XORA 1N78A 4B4CA 5K5QA 4IVNA 2QWWA 2JA8J 1LE8A 1QZEA 3HRSA 4D1QA 1AWCA 2YU3A 4A6EA 3T0YA 5TRDA 2GQQA 1OYYA 4WWCA 3F23A 2DOEA 1RKWA 5ICGA 1KZHA 1HLVA 1JUPA 1RPWA 4I7HA 3CCLI 1YJ9I 3BR6A 4L18B 3TQNA 2UXNA 4Q47A 1TT5B 5BOXA 1I1SA 1PUFB 1BM9A 3TMOA 2K02A 3BG7A 3E1SA 1GVJA 1T56A 2DA1A 5L3EA 4C2TA 4KNYA 3WTTC 4CO8A 2TDXA 3DQVC 1T0FC 3FK6A 3OYFA 2DQLA 5ED4A 1DDNA 2NS8A 2OQGA 2KKOA 4JX4A 1QPMA 4MFDA 3H5NA 2FD5A 2X51A 3CC4I 2Y69H 4PJJA 1ZG5A 5GPAA 3F0CA 1RR7A 3M8FA 3MFKA 2M9HA 1J59A 2CV2A 4YIIA 1YITI 1D0XA 1LJ9A 1R7JA 2VIXA 5E1WA 2A61A 3ABKH 4PZJA 1MJ9A 1ZGJA 2XRLA 4E4HA 4IO9F 9ANTA 1SD6A 2DA4A 1U8RA 4E7KA 1YJNI 4BY1J 2H6BA 2FNPA 3CMMA 4XBFA 2L9VA 4IRGA 1QA6A 1R5ID 2OAZA 5K7ZA 5FLXK 5L3BA 1A6QA 5JHFA 3BCBA 5DCMB 4GGGA 5KAFC 3F9KA 4XKWA 2AXTC 3LSHA 2RQPA 1BOBA 2RGVA 2WAEA 5E1ZB 5FROA 3WTSC 4B44A 4YIRX 2KDZA 3CESA 1DQUA 2VBXA 3TW6A 3CLQA 4DGWB 2O9LA 1JGSA 2JSPA 3OOPA 1OCZH 3IL2A 5F08A 2OPTA 1G8XA 3IKTA 2L7ZA 2KRHA 3N4MA 4RB0A 1RI7A 1FLIA 1W1WE 4OIQF 1DPRA 5LBQA 1YQAA 3BTLA 1SD4A 3MKWB 5LGNA 2CQKA 3W6KB 1RC9A 1S29A 4R79A 4A3LJ 4Y52J 1UJ8A 2XSJC 3K6GA 1SFKA 3JRDA 1VF9A 2E2IJ 2GXBA 2BYVE 1TZLA 3E5QA 3O2PE 3BCAA 2DPDA 1WFXA 3HXLA 3ASOH 3LAJA 1SFEA 5HVQC 2GA2A 2QUFA 1U3EM 1BR2A 1WSUA 3LSMA 2XKOA 3LA7A 3SZPA 2VUMJ 2D1HA 3FXUA 2M7BA 4HBLA 5HLIA 3OYGA 4JP0A 2H09A 2ISZA 5JLWA 3V7SA 4M71A 3VWBA 3CJRB 4ZTFA 1DP7P 1YIJI 2JPCA 2KIFA 3D5RC 5H6RA 3P7NA 2WC2A 5FFZA 1HA8A 2AQEA 1P4XA 4I2OA 4NNJA 3WU0A 1XGSA 2DMTA 4RB2C 1S72I 2KQRA 3GTGJ 1IRFA 2L0KA 1UHMA 3MD2A 4H4KC 1P6RA 2GIVA 2H6CA 2KMUA 2QF7A 3DFGA 1JT0A 1OCRH 4AIHA 1F36A 1FX7A 1XSVA 3ABMH 3IHUA 4F92B 3JRCA 2H8WA 1TWGJ 4C2UA 2R7OA 1XGNA 5DTDA 2YX7A 2UV1A 1FP2A 3MVPA 4U88A 2QSHX 3ABUA 1IDYA 4KA4A 2VT2A 1YRNB 2QVOA 2VASA 2VOPA 4M73A 1Y1WJ 6PAXA 4CXFA 1ZGAA 2F48A 3CC7I 5HLHA 2JA5J 3F8MA 1ETKA 3CO7C 1XG1A 1R00A 1B6AA 1XPXA 2F5CA 2LOOA 1IF1A 5J3LA 2HYFA 3S1RJ 2XV4S 4FASD 3N05A 1OCTC 1W7PA 3FMSA 3IKVA 1OPCA 5F64A 3SXYA 2KDOA 1UELB 5F27A 2HEOA 2BW3A 2MLKA 1EH6A 2BEOA 2FNAA 4K2EA 3OYEA 1YW8A 3E6MA 1U5TA 2K3FA 5K1YA 2VODA 3R0JA 2JPBA 1FBUA 2KFDA 3O8HA 4G8XA 2JZYA 2OZUA 2XAHA 3KLNA 1E17A 1J9IA 2P4WA 5BQTA 5BMZA 2MA3A 2FBHA 2WWYA 4Y33A 4CYDA 4Q48A 3CCVI 1K7AA 3A01A 3HM5A 2LG4A 2V1NA 1AKHB 2Z2SB 4FE7A 3H9JA 4IEJA 3U2RA 3BTIA 3J81Z 4I98B 2VB6A 3JAMZ 1GXQA 4MEYF 3DTIA 2OJED 4NHJA 1OJLA 3S93A 1JUSA 3ZMSA 2QQBA 5J8CA 3I58A 3K1NA 3FHNA 1XDSA 2NYXA 1I3QJ 1IC8A 3KFWX 4RLFA 3J7ZI 3I5UA 5E18F 3HOWJ 3ONQA 1HSJA 4LFUA 3CCUI 5HOOA 4J19A 1U8BA 2KRCA 2K9NA 3GFMA 1MW7A 4M6XA 3NWTA 3S14J 2L2OA 2XB0X 1BC7C 2XGCA 2JA7J 2PLYA 2K4JA 3I0TA 3AG3H 2KJCA 2D2WA 4YRVA 2NVXJ 1WQ2A 3VYTB 4B09A 4CICA 3NQOA 1ZTRA 2JSCA 1MBKA 3S2HJ 2WA0A 2F2EA 5E8IA 4NC8A 2HI3A 1Z91A 3FM5A 4A3DJ 3OYHA 1SC7A 4BEHA 3SJMA 5FD5A 3K70D 1HC8A 1IN7A 3ZQHA 1F9NA 3AFHA 2CRGA 3S3OA 2J5PA 2CG4A 1NTCA 5EEGA 4MEXF 3BG9A 5HLTA 4LMYA 5D6FA 5M3MJ 4RS8A 1ZGWA 4Y15A 3ZGKA 1LFPA 4D0PA 2O0YA 4AYBA 4E7LA 1MDMA 5IT9Z 1CQTA 2DK8A 2OUMA 3BPXA 3SDGA 4RAYA 4LG0A 3LFUA 4BDYA 1QBJA 1W7PB 5M3FJ 2F6CA 2ZSIB 1SVMA 4X1EA 4UUSA 1IAWA 4DNCA 3OYBA 3A03A 2BW3B 2PMZN 5BS6A 5ICCA 2WTEA 1U5TB 3DU5A 1HW2A 3F72A 1ERDA 4RM2A 4LLNA 2Q2EB 2ICWG 3CUQA 2V26A 3Q0UA 3L7WA 3HOSA 3W2VA 4LK1F 3ZQ7A 4KJZA 2IBDA 3BQYA 4HX8A 3MCZA 3A01B 1XCBA 3QPTA 2BY1A 1ITYA 2ELJA 1FY7A 2L01A 2VPRA 4HX4A 2QSGX 3GF2A 2MSYA 1U78A 3MKZA 1XSDA 2R7RA 4N0BA 2HQAA 3OYMA 5IYDJ 1BW6A 2QM3A 3ZCOA 5JVGF 2OCEA 4HNTA 5B66C 2HYGD 3C7JA 5HDKA 5B5EC 1Z3XA 4N4NB 3ZN1A 5D8KB 1Z1DA 3GTOJ 1IN6A 1HSTA 4ENMA 5K5RA 1JT6A 4JX6A 3R4KA 2O3FA 1OLTA 1MMGA 4A3MJ 3RZDJ 1M1EB 3WG9A 4Y7NJ 1G6NA 3F8BA 4JK1X 1R5HA 2JTVA 1Y8RB 2V9VA 3AL0B 2ZMEC 3VSKA 4Z6YA 2O8XA 4P96A 3ZMZA 1FMWA 2DJIA 4UVCA 1BC8C 4MO7A 4BEHB 1OCOH 4RMNA 5D4SA 4PCQA 1B72A 5GAHJ 3SDBA 1T95A 3CO6C 3FWEA 5EJCA 2IGMA 1H8AC 4XL9A 2E5ZA 5C44J 1I39A 5IOYA 3ZQGA 1IXCA 4QTRA 4OIOF 2RQQA 1MDMB 5LRSA 2XGXA 2AS5F 2O03A 2DPUA 5J1RA 4LG0B 2M30A 2ZJRF 2A5WA 3G3ZA 4UV8A 2V1XA 1H88C 4UUSB 2DMPA 2PFBA 2KJBA 1Q1VA 2VKDA 1YW7A 1Z6RA 4P9UA 5IP6A 2WY7Q 4BHCA 1TWFJ 3CUQB 3AG1H 1TP4A 1QPIA 3F8NA 3GXOA 1D5VA 1OYWA 2X6XA 1RUOA 3RJPA 2QA4I 1EF4A 1SD7A 5E20A 2W82A 3U1KA 4WXCA 2EK5A 1P7IA 5HS8A 5KAIC 3JAMK 2H1LA 3GLXA 2HKOA 2ZMEB 3H9GA 1USSA 3PNYA 4HDUA 4LG3A 4CA0A 5C4XJ 1OQYA 1TC3C 1MJAA 3RQIA 4CCNA 1WI9A 2VQLA 1RR8C 1GVDA 1MBHA 2F5FA 2Z3YA 1MBEA 1POGA 1S7AA 1DGWY 4F52A 2A6EF 1A36A 2ISYA 3W6JB 3EPZA 2L02A 3VPRA 3L1PA 4DZPA 2QGUA 3ZQIA 5D5UB 3FISA 2R5ZA 3LL7A 2O7OA 3WE3A 4Y17A 5HNFA 4MNUA 1TQMA 3QOEA 5B3SH 2NVUB 4FHTA 3OOUA 1S6LA 1X1BA 3FIWA 4RDUA 2GXGA 4Q4ZF 2HVSA 4YFXF 3NAUA 2DO7A 3RPUA 1ZG1A 1HF0A 2W84A 4XOTA 1GHCA 2ID6A 3OWTA 4IJAA 4RB3C 2VKHA 5LHHA 2HDDA 3A02A 3SEZA 2JMWA 3KEYA 1B72B 2VQGA 1FOXA 4LD5A 3L2UA 1ZR4A 1FTTA 1MBJA 5ICEA 2IS4A 3CCSI 1Z77A 4BS9A 1P4AA 3BG3A 3JRHA 1BA5A 4AIDA 1CF7A 3HOYJ 3FF5A 3KCCA 1T38A 1BW5A 5HDNA 4KN7X 2COBA 1WGXA 2EILH 2QQ8A 4WXHA 5DV5A 2R5YB 4N9HA 2WB1N 3HEFA 3B73A 4NUBA 4M3EA 4ZYHA 2RVCA 3HOZJ 1GLNA 1R58A 1YI2I 5IT3A 4A3GJ 1JHFA 4BQAA 2VBZA 4HZFA 1HKQA 2V79A 3DPTA 3LOCA 2LY9A 3PJRA 1KA8A 2MW8A 4HX7A 2VN2A 3VYUB 3CCRI 3D5SC 3IP4B 4KFCA 3I9V2 3GEZA 1KQ8A 4RBOA 4D5CA 2MABA 3WTYC 2VC1A 4BHBA 4IHVA 3ZOBA 4XRSG 3FK7A 4P1WA 3S1MJ 2EZKA 4LB6B 2P5KA 1U6GA 1EA3A 2IXSA 2LDUA 1J75A 4GDFA 2I8DA 1FSEA 2XGEA 4ZZDA 3CQZJ 5IP9J 2CW7A 2VXZA 4QIWN 1FBQA 2R3SA 1X3UA 4F93B 1VNDA 4ZYEA 1WJDA 1R1TA 1T2KA 3JRBA 2R5ZB 2ME6A 3UR3C 4E7ZA 2CW8A 4BBRJ 4LJZF 2FMLA 4EGZA 1Z0XA 2DDAA 1XMXA 4XKVA 1Y0NA 4BYYA 1XB4A 1WJEA 2K86A 1JKPC 5LD2C 2DAOA 2QLZA 4ENNA 5FKLA 2NNNA 1ZKGA 3VYRB 2UZKA 2EQRA 2VE9A 3DV8A 3L00A 4FT8A 3T1BA 2F4IA 4B3AA 4BL0B 1D8KA 2CW0F 4CCLA 1K61A 1ZK8A 2JRTA 5D6EA 4ZC3A 4XR6A 4O6JA 3OL3A 1T8IA 3PUBA 5J40A 2R7ZJ 2DK5A 4XM3A 3LSTA 1WKMA 1ZLKA 3RKXA 4X6AJ 4HW0A 1CF7B 2ZJQF 4HYEA 4EM2A 1BI2A 4BE0A 4ZYDA 4HLYA 4A3KJ 3KP3A 3LSIA 4CH7A 2GLOA 4BXXJ 4B8XA 4OU0A 4QWQA 3S2DJ 3F3XA 2KT0A 2JK3A 2R7XA 2X4HA 2V1UA 1PVEA 3WTUC 1V4RA 5KVRA 3ZQCA 3DLLF 3CZ6A 1IV8A 2Z16A 3GFJA 3DPLC 4DYRA 2NOJB 3K4BA 3NRVA 1O3SA 5D8LB 3VEPA 1G2HA 1X3ZB 3TOBA 3JSOA 1QNTA 2ZBKA 1UG2A 5CPRB 2E1CA 2B63J 3EYIA 1V3FA 3M07A 2ZXHA 3G73A 1RKTA 1IG7A 3BTJA 4CSWA 2XIGA 3CDHA 4BAYA 2LK2A 1SVOA 1XSXA 2NOGA 4BUPA 4E70A 3PL8A 4L9TA 5FKMA 2NVYJ 4OOIA 4Y3OA 3W2WA 3OYIA 1W5CC 2JN6A 4OMZA 1S7OA 3GZ5A 4A12A 4AC0A 4XRSA 4C3HJ 2FSWA 3TO7A 4P5OA 2IEKA 2DT5A 5ILUA 2DYRH 5D5WB 4EJUA 1VQ8I 1EJ9A 1L0OC 5EEHA 3M1CA 4G7HF 2E2HJ 2LLKA 3FHZA 2ZXWH 2H94A 3PUFA 1ON1A 2BVLA 2BY2A 2O61A 4HAMA 1UG0A 3ABTA 3ZQLA 2VONA 4OWRB 4ENKA 5LEJA 2GOMA 2IP2A 2LNBA 3GVAA 3K4KA 5FRMA 4HDVA 2IAIA 5EZHA 4KDPA 2LBFA 5E79C 2NRAC 1YTYA 5FFXA 1FOYA 1KU3A 4BE1A 4B3XA 3KE2A 5F0HA 1QU3A 3ZQFA 2VJ5A 4GCVA 1XMKA 2PN6A 3P9CA 5E17F 4ZDLA 5EYRA 4C3IJ 2GA1A 3HC7A 3O6BB 2K9QA 2QCOA 3PFIA 1JE8A 1H0MA 1HW5A 2KL4A 4UVAA 3S1QJ 5CJ9A 5GAGJ 4CCOA 2X48A 1U9NA 1PP8F 4D7NA 3P9IA 3LA3A 4MQ9F 1UCRA 1MKMA 4LLLA 3W2AA 2IA1A 3BZKA 3ECHA 1FOWA 3F6OA 1I6XA 3KPHA 2CSOA 3PNTA 3S8PA 5M5XJ 4GFBA 2L9NA 3WODF 1E0EA 4A0ZA 1QZZA 2DMNA 3LSGA 4HF0A 4JOMA 3DKXA 4LLGF 1VZ0A 3IWZA 3I4MJ 3C3WA 1G59A 1BR1A 3ISPA 5KNLA 2F4MB 2FOKA 2FOWA 1SD5A 2TCTA 1XCVA 3Q0VA 4PUSA 4DYCA 2E34A 3QRFF 1O7FA 2EZHA 5TJJA 2OU2A 2FBIA 2DCEA 3VFZA 4YIFA 3HOUJ 1BJAA 3EUHA 2E7XA 5EEAA 1ZN2A 2B0LA 1LUJB 1ZARA 3OY9A 4XSZF 2M0MA 2AO9A 3TGNA 1MMNA 3CJNA 1SFUA 1ETWA 1D5YA 3CC2I 2DW4A 1KU9A 3ROUA 2ELKA 2HKXA 4MQVA 5HLGA 4IX7A 2V6EA 1X2MA 3DTEA 4YFNF 1LE8B 1QO0D 2EINH 2L5QA 2X85A 3HKZA 2WV0A 2ECCA 2HQNA 3I3LA 3HPHA 2CH0A 1V5GA 1FYMA 3L2QA 2YU9J 3FX3A 5LEKA 4LGWA 3ML6A 3TP0A 5D5VB 1DU0A 4GRIA 1B8IA 2QKLB 3QYBA 4AU7A 2LBFB 1G3SA 5GTHC 2JQ7A 3KP6A 4MHGA 3JRIA 2E1OA 5FKNA 3DKWA 2R7WA 3FXLA 2DT6A 2VL8A 2WAQA 5FO5A 4JQFA 4XSXF 4HEA2 1SAUA 2P7VB 2DOFA 5BPIA 3BG5A 3HSFA 5EDNA 3JSPA 3M7GA 2LKXA 2KIUA 4U0WA 4B43A 1G4DA 2XPWA 3GZNB 3TW7A 1E3PA 3KZIC 3VODA 2JT1A 3WHBA 2ACJA 2F5DA 4L5JA 3HIFA 2J5OA 3L2VA 4NC6A 1A6IA 3DLAA 4EEFG 1Z21A 3JRAA 4BH9A 5DM7F 2KZVA 1RUNA 1JTXA 4I76A 1MH4A 1SFXA 2M3AA 3DPUA 3LFKA 4UB8C 4XLNF 1IRXA 3E0JB 1W0UA 4IHWA 3KETA 4C2MJ 2C6YA 2RNJA 3I53A 3P5JA 3ZXSA 2ETHA 3PSIA 4ASNA 3UNGC 3ULQB 5TGTA 2HQ5A 1D0YA 3KP7A 3HOVJ 1BI0A 3OL4A 4XLHA 5HS9A 2EIJH 2CS3A 1IXRC 2DFEA 4G9YA 5F1RA 3WTZA 3F22A 2VC0A 1W4MA 3F8FA 2ZNZA 3V8JA 3FXJA 3IC7A 2HXOA 3DBHB 5CLSA 1K78A 2L7MP 3HOXJ 1QVTA 3BT9A 3PFYA 2M0CA 1TTYA 3G2BA 3CCQI 3K0LA 2YX4A 1XGOA 1SMYF 3MMYB 3MZYA 1ETYA 5CVJA 4DBQA 2X6YA 5BPDA 2DFIA 2DQRA 1L3LA 2RREA 1MJBA 5CVUA 3OMYA 2R0QC 2FMYA 4D7MA 1DUXC 1ZQ3P 4A3BJ 1BN5A 2HDWA 3LA2A 2K3PA 4M9SA 1MNDA 2GM4A 2K40A 4LIVA 2M34A 2NXNB 3IRRA 1FZPB 1B8IB 2L54A 4Y13A 2BHYA 3HYIA 2DTRA 1ODDA 4CCJA 1V5FA 3LSRA 4I09A 2ZXIA 5HNHA 4AYBN 1U5TC 2FQ3A 1B4AA 1XD7A 1U0JA 2LP0A 2Z1DA 2OTJI 3H3ZA 4ZZLA 2DTZA 2V9KA 1LPQA 4KT5C 2HR3A 2MG4A 2H8RA 2QEXI 2Y30A 3AAFA 1GV2A 4MTDA 4KIGA 2PX9A 2TRTA 3LQRA 3V42A 1FYLA 1DU6A 1APLC 2JWTA 2STTA 1JKRC 1X2NA 3CCYA 4J01A 3FXKA 4FX4A 2EWNA 4ZJZA 2E36A 2G7HA 1S3JA 3E97A 3BWGA 4PJMA 5JHUA 2VQCA 3K10A 4L9VA 2DFHA 4YFKF 5J4VA 4B47A 1FEXA 2P5VA 1RNLA 3BZ6A 3U9GA 1KONA 2ZFWA 1Y8QB 1W36D 1TL8A 5IY5H 1EKEA 2ZC2A 3AKZA 3E5XA 2QQ9A 3K4MA 4IHXA 1HXDA 2DXIA 2HZTA 1TW3A 1J2XA 2F4OB 2YUSA 2M8GX 3JCUC 2KZGA 5AIQA 2X6WA 3G4SI 2EIKH 2FF4A 1BJZA 2BE5F 2O6GE 4I0BA 3HSEA 1EH7A 3AL0C 2PMUA 1OKRA 2Y0SA 1IW7F 1ETOA 1KYWA 4A3CJ 3H0DA 4P55A 5DD4A 2E2JJ 1IRGA 1LEAA 3IV5A 2FBKA 2AQFA 1EH8A 4XNFA 3RYRA 2R7QA 1I6HJ 2G0EA 5BNGA 1MNEA 1J5YA 3FZVA 2STWA 1NG6A 2MFZA 3CDIA 1D8JA 3EQLF 5CQEA 1S5LC 4MIMA 1VQ9I 2P7CB 5GPCA 3K4CA 4CUGA 1U2WA 5D5XB 3VB2A 3KYLA 1VFCA 2LYCA 1G3YA 4XRFA 1OR7A 5CVVA 5E3NA 1FTZA 5F1JA 5DUIA 3I4NJ 5J1YA 2DODA 2GWRA 5AONA 2EH3A 3L2WA 1BI1A 4G6DA 1MZBA 1R71A 4HV5A 3OR1C 2IS6A 1Y39A 4BKXA 1ZH5A 5ICFA 3CUQC 1Y6IA 1LVAA 5EF6A 2QYOA 3SYTA 4DQ2A 5KHDA 2LF8A 2FX0A 2R92J 4ZTJA 5DD8A 3NEUA 4HNUA 4XN0A 2XAFA 2JRMA 2EFQA 1YS7A 4D5FA 1WJBA 2PJRA 4BJ5C 2ZO4A 3BZCA 2XHKA 2IA0A 3RSNA 2MD0A 4RGUA 3O3KA 2MH2A 1B9NA 1TNSA 1ZYRF 3CLOA 3J7AO 1OR7C 2EBIA 4XLCA 2K5CA 4HQEA 2Q1ZB 5A2QZ 1OCPA 4P9FA 2O5RA 4KMUX 5L3FA 1PP7U 3JRFA 1WPKA 2MC4A 3WGGA 1WJFA 5F0FA 3CDLA 2E19A 4BNCA 3PSFA 3PIPF 4D9JA 4L0ZB 3HL2A 3M4OJ 1MMSA 4LOCA 4IHYA 4PGGA 4G7ZF 1XN7A 2VQHA 1PJRA 4WXDA 3L2CA 1X1PA 3SEQA 1FIPA 5EG0A 3PQKA 2VI6A 5FGMA 4HSTA 1DGRM 3ESWB 4PJNA 1ZG3A 1YJWI 1T39A 1QQIA 1QRYA 1VQOI 1E3OC 4WCGA 4IOCF 3GLLA 3MKLA 1OISA 2EPFA 1F4KA 3DCFA 2XPVA 4AVPA 5TISC 2HNHA 1MMAA 1W5TA 4M3BA 1Q1HA 1AHDP 2A5YB 2EIMH 2UUZA 3EUKL 2E1NA 3SZGA 2LD5A 3L09A 2FE3A 5D4RA 2LFBA 4FQGA 4N4OB 3GMEA 1ZR2A 4M72A 4O5VA 2M8EA 1TBXA 2UXXA 2HXIA 2V9PA 3K9TA 2BY0A 4HV6A 4XMYA 4IRHA 3E6CC 4OAYA 3JREA 3GUDA 1GXPA 3G71I 4IQ4A 4HF2A 2CQ7A 2HVQA 2RDPA 2XAQA 2FUG2 2M87A 4IHTA 3GX4X 3L9FA 3RKWA 1VQ5I 5AIPA 2KPMA 2HZDA 1R5GA 1V54H 1MBGA 3BDDA 2VXDA 1W5SA 4EATA 2PJRB 4PDKA 4L5IA 4ZDOA 1NH3A 2JJ7A 2G7UA 4GYGA 1J7KA 4W1UA 3TO6A 4EJTA 5JLXA 1VTNC 3G1OA 2XGDA 1FNNA 3ECOA 5L3DA 4XKCA 1MSFC 2IRFG 4YEJA 2WAFA 1FC3A 1FOKA 4U0YA 3QAHA 5E1XA 1RESA 4BE2A 2E35A 4XONA 2M45A 4FETA 1B9MA 4PSXA 2EA4A 4XICA 1F43A 3BJ6A 2JVHA 4MTEA 3VDXA 3ZPLA 2FRHA 4WX9A 2RV8A 1D1AA 1K6YA 2JA2A 2W24A 3CMYA 2K9SA 4XLAA 3C1DA 2ZCWA 4BBSJ 2LH9A 1PDNC 3OYNA 2X6OA 2LKSA 2XPUA 3J80Z 2MH9A 4AIJA 4M9XA 1TWCJ 2M5WA 2OTLI 5L3CA 3PO3J 3GO5A 4CCMA
chains in the Genus database with same CATH topology
2R7DA 3SHFA 4EJOA 3ZN0A 3HOTA 1FPQA 3V4GA 3I59A 5DEQA 4TV7A 3KP4A 4GXOA 3KEQA 1HW1A 1ZRFA 2P5LC 3WTVC 1YW9A 3RYPA 2QQAA 4JBAA 4A0XA 3DF8A 4L9NA 3K2ZA 1BI3A 2KRFA 2PG4A 1T98A 3R61A 2Y48A 3GFIA 2KIMA 2YSRA 1USTA 1FT9A 3P9KA 2K27A 2HTJA 2PBIA 3N97A 2HS5A 2Q8KA 3VOEA 2LKPA 5A2QK 1XMAA 1STZA 4S04A 1O7LA 1MD0A 1T6SA 3MWMA 1B59A 4EV0A 3ZP5A 5DYMA 1SAXA 1Z7UA 3M9AA 3RDIA 2Q0OA 3SZTA 4EJVA 3QOPA 3B02A 3HRUA 4RAZA 3T5XA 1W7PD 3FMRA 3SFZA 1REPC 5LLQA 1YS6A 2ZJ2A 2BBYA 5E8GA 3PQJA 2IVMA 1F1ZA 5HS7A 2L4MA 5J6XA 1ON2A 4AD9A 1Z05A 1D3YA 2OZ6A 1P92A 2VOOA 3K69A 4WK8F 3V8KA 2MD5A 3FM3A 1G3WA 3GZ6A 4A5MA 3JW4A 4BHPA 1T0FA 3HRMA 1BIBA 2BGCA 1ULYA 1Z6TA 2ZNYA 2OD5A 3REOA 4A6DA 4R1HA 2H27A 2CGPA 3ZMDA 4XLPF 1O3RA 3FXQA 3I71A 3I64A 4U7BA 2RC4A 1UHWA 3BJAA 4OMYA 4EM0B 5FD6A 4L9JA 4BXUA 1NHAA 4ESJA 4L0YB 4EQQA 1KYZA 3R6SA 3KZZA 4KUMA 4UHTA 1LDDA 2VBWA 3J80K 3OV8A 1PUEE 1FYKA 3JTHA 1G3TA 1ONVA 4WF2A 3TDUC 4KMFA 4G94A 1BBYA 1RIOH 3R0AA 1LEBA 2CYYA 2ADUA 1LB2A 4G6QA 1JHHA 2L3DA 1R22A 2OA4A 3BJOA 4CDGA 2A07F 2DU9A 2XKPA 5HDGA 1FWZA 3C18A 5FB2A 2D1VA 4HLXA 3MQ0A 4ZH4F 1A04A 1E2XA 3ZMTA 4MGRA 3KEOA 2Z99A 2ESHA 2OQRA 3E6BA 3LWFA 1YO5C 1O3QA 1HBXG 1I5ZA 2E7WA 3MAJA 4RGRA 2PI0A 1OYIA 2A6HF 2NAZA 1TQPA 3U1DA 2XAJA 2W25A 3KLOA 3EDPA 3QU6A 3HHGA 1DPUA 2LSOA 1YFHA 3S2WA 1Z9CA 2YPRA 1HKTA 3LQQA 4NB5A 3WU1B 3H92A 3BY6A 4ESBA 3F21A 3MZHA 4I02A 1I1GA 3V7RA 3WGIA 2W85A 3DP7A 2QBYA 3E5UA 1IN4A 2EA2A 5ILVA 2D45A 2A68F 1QZYA 5CVRA 2ZKZA 4CGZA 3HHHA 2Q2EA 1ZLJA 2IJLA 1Y0UA 2Z5UA 4IF4A 4M74A 4YG2F 2P8TA 1R36A 3TDZC 3F6VA 1C0WA 4UVBA 4AIKA 2EV5A 1IXSB 3FXRA 4R8HA 3HTSB 4Q5SF 1P4WA 4ZYGA 3KP5A 4GO1A 4OIPF 3T8TA 1R1UA 1TNTA 4NQWA 3JTGA 3TKYA 2FEZA 4UNOA 2HDCA 2CFXA 1F5TA 4S05A 2A3SA 3T8RA 1K6OA 4CHUA 1UFMA 3RKYA 5DCFA 2COMA 2Y75A 1IUYA 4OIRF 4EMSA 2Z33A 3HSRA 3V8LA 2EV0A 4Z2YA 3DEUA 4F7ZA 1K78B 1XDUA 3KZYA 2QBYB 1LDJA 3GW2A 4U7DA 3D0SA 1TLHB 2RN7A 3E6DA 2DI3A 2PEXA 1YG2A 1LQ1A 3I4PA 2EB7A 3ZMUA 4KYWA 5LGTA 3IWFA 2YR2A 2P6TA 3BPVA 3M1EA 3WGHA 3K1PA 3FMQA 3QU3A 2P6SA 1YLFA 2ZMEA 4EGYA 3QP6A 4LB5A 1TW2A 4O3MA 2XVCA 2W57A 2VE8A 4PGHA 5KK1A 1K79A 5L3GA 1ZRDA 2XAGA 5H20A 1IN8A 2IT0A 2A69F 1S8NA 1YYVA 1R1VA 2FU4A 2MLGA 1H9GA 5J8FA 4ETSA 4M6YA 1TQIA 2Z9OA 4GYIA 2XRNA 4CZZA 1FBSA 1LNWA 4ENJA 2BV6A 2MBFA 1MGTA 1P2FA 4UV9A 3Q5FA 1EV7A 2XUBA 3BOQA 3DXJF 2NNYA 5ERIA 3RTRA 5K5OA 2GZWA 3RIRA 1R23A 2VBYA 4ON0A 4I0AA 1KQ0A 4RGXA 3HTUA 4IRIA 3KP2A 3GFLA 5LGUA 2IPQX 1KU2A 4AWXB 3WTXC 4U0VA 2HWVA 3EYYA 5LHIA 2HQRA 4RGSA 4G7OF 3BP8A 2OBPA 3J81K 2QZ8A 2LF7A 4N9IA 2HFHA 5JFRA 5JVTA 2ESNA 4EM1A 2HTSA 2AXLA 1H9TA 2DBBA 2Y0MA 3COAC 5DDGA 2CWEA 2XROA 5H6QA 1CGPA 2EJRA 2K4BA 4EVIA 2K7LA 1YIOA 3ZMVA 2VT3A 4IXAA 2CO5A 3HRTA 3Q9SA 3Q9VA 4A5NA 2V6CA 5LHGA 3D5LA 5F6FA 1XGMA 3IRQA 3E3VA 5CVIA 4KN4X 2EFOA 5LRRA 2FXAA 1KQ9A 1RZ4A 1ZAOA 3HUGA 2EFWA 1O3TA 4IPAA 5JR3A 1IN5A 3LAPA 5IT9K 2EFNA 1JXSA 3K1MA 4HF1A 2NS0A 4HA8A 4EJWA 2PJPA 2EV6A 3TOAA 3H3UA 2G9WA 4UUVA 4KICA 3SQNA 4A0YA 3QPHA 3ELKA 2R7FA 1O57A 4FX0A 4RB1A 1OMIA 1I27A 3GYHX 2L4AA 5FLXZ 1KU7A 3GWZA 2PQ8A 3EETA 3WE2A 1LDKB 1UB9A 2ZXJA 2FA5A 1ZREA 1FP1D 5ILSA 1HKSA 2EFPA 3RPQA 2ELHA 4M9ZA 4ESFA 1IZ1A 4I01A 1BOAA 4KIBA 5CYVA 1FSHA 4OINF 3WTWC 2QENA 3TO9A 1WRJA 2IA2A 4A2UA 2DLLA 2UWMA 2PMHA 3R60A 3MEXA 2RKHA 1QGPA 3ERED 1AOYA 4HQMA 4H0EA 1ZRCA 3BROA 4IHSA 3V7CA 1WWXA 2HOEA 2X0LA 1HQCA 1J0RA 1ZHFA 2XASA 2HGCA 5DUKA 4LK0F 2MC3A 1KGSA 3I59B 2IW5A 4QLCU 3RI4A 3I54A 5DCMA 1B1BA 3F8CA 5JI6A 2GAUA 4KIFA 2M1BA 3M8EA 2F5EA 2V1DA 1BIAA 3QP5A 1SMTA 3CUOA 4UXNA 3CTAA 4HOBA 5K5QA 4IVNA 2QWWA 3HRSA 1AWCA 2YU3A 4A6EA 3T0YA 5TRDA 2GQQA 1OYYA 4WWCA 3F23A 5ICGA 4I7HA 4L18B 3TQNA 2UXNA 4Q47A 5BOXA 1I1SA 1BM9A 2K02A 1GVJA 5L3EA 4KNYA 3WTTC 4CO8A 2TDXA 3DQVC 2DQLA 5ED4A 1DDNA 2OQGA 2KKOA 1QPMA 1ZG5A 3M8FA 3MFKA 1J59A 4YIIA 1LJ9A 1R7JA 5E1WA 2A61A 4PZJA 1MJ9A 1ZGJA 1SD6A 1U8RA 2H6BA 2FNPA 4XBFA 4IRGA 2OAZA 5FLXK 5L3BA 5DCMB 4GGGA 2RQPA 2RGVA 5E1ZB 3WTSC 2VBXA 1JGSA 3OOPA 3IL2A 3IKTA 3N4MA 4RB0A 1RI7A 1FLIA 4OIQF 1DPRA 5LBQA 1YQAA 1SD4A 5LGNA 2CQKA 3W6KB 1S29A 4R79A 2GXBA 2BYVE 3E5QA 3O2PE 2DPDA 3LAJA 1SFEA 5HVQC 2GA2A 2QUFA 1U3EM 1WSUA 2XKOA 3LA7A 3SZPA 2D1HA 3FXUA 4HBLA 5HLIA 2H09A 2ISZA 3V7SA 4M71A 1DP7P 2JPCA 2KIFA 5H6RA 3P7NA 2WC2A 5FFZA 1P4XA 4I2OA 3WU0A 1XGSA 4RB2C 1IRFA 1UHMA 1P6RA 2GIVA 2H6CA 3DFGA 4AIHA 1FX7A 1XSVA 3IHUA 1XGNA 2YX7A 1FP2A 4U88A 3ABUA 4KA4A 2VT2A 2QVOA 2VOPA 4M73A 6PAXA 4CXFA 1ZGAA 5HLHA 3F8MA 3CO7C 1R00A 1B6AA 2F5CA 1IF1A 2HYFA 2XV4S 3FMSA 1W7PA 3IKVA 1OPCA 5F64A 3SXYA 2HEOA 2MLKA 1EH6A 2BEOA 2FNAA 4K2EA 1YW8A 3E6MA 1U5TA 5K1YA 2VODA 3R0JA 2JPBA 1FBUA 4G8XA 2JZYA 2OZUA 2XAHA 3KLNA 1E17A 1J9IA 2P4WA 5BQTA 5BMZA 2MA3A 2FBHA 2WWYA 4CYDA 4Q48A 1K7AA 3U2RA 3J81Z 4I98B 3JAMZ 1GXQA 4MEYF 4NHJA 3ZMSA 2QQBA 5J8CA 3I58A 3K1NA 1XDSA 2NYXA 3KFWX 3I5UA 5E18F 1HSJA 4LFUA 5HOOA 3GFMA 4M6XA 1BC7C 2PLYA 2K4JA 3I0TA 2KJCA 2D2WA 1WQ2A 4B09A 4CICA 3NQOA 2JSCA 2F2EA 5E8IA 3FM5A 1Z91A 5FD5A 1IN7A 1F9NA 2J5PA 2CG4A 4MEXF 5EEGA 4LMYA 5D6FA 4RS8A 4Y15A 4D0PA 2O0YA 5IT9Z 1MDMA 2DK8A 3BPXA 4RAYA 4LG0A 1QBJA 1W7PB 1IAWA 4DNCA 5BS6A 5ICCA 2WTEA 1U5TB 1HW2A 3F72A 4LLNA 3CUQA 3L7WA 3HOSA 4LK1F 3ZQ7A 4HX8A 3MCZA 1XCBA 3QPTA 1FY7A 2L01A 4HX4A 3GF2A 1U78A 1XSDA 4N0BA 2QM3A 2HYGD 3C7JA 5HDKA 3ZN1A 5D8KB 1Z1DA 1IN6A 1HSTA 4ENMA 5K5RA 3R4KA 2O3FA 3WG9A 1G6NA 3F8BA 4JK1X 1R5HA 2JTVA 2V9VA 2O8XA 4P96A 3ZMZA 4UVCA 1BC8C 5D4SA 4PCQA 3CO6C 3FWEA 1IXCA 4OIOF 1MDMB 5LRSA 2XGXA 2AS5F 2O03A 2DPUA 4LG0B 2M30A 3G3ZA 4UV8A 2V1XA 2PFBA 2KJBA 1YW7A 1Z6RA 4P9UA 4BHCA 3CUQB 3F8NA 3GXOA 1D5VA 1OYWA 1RUOA 3RJPA 1SD7A 5E20A 4WXCA 2EK5A 5HS8A 3JAMK 3GLXA 2HKOA 2ZMEB 4HDUA 1USSA 1MJAA 1WI9A 2Z3YA 2F5FA 1S7AA 2A6EF 2ISYA 3W6JB 2L02A 5D5UB 3WE3A 4Y17A 4MNUA 1TQMA 4FHTA 1S6LA 2GXGA 4Q4ZF 4YFXF 2DO7A 3RPUA 1ZG1A 2W84A 1GHCA 4IJAA 4RB3C 5LHHA 4LD5A 5ICEA 1P4AA 1CF7A 3FF5A 3KCCA 1T38A 5HDNA 4KN7X 5DV5A 4WXHA 4N9HA 3B73A 4ZYHA 2RVCA 1R58A 5IT3A 1JHFA 4BQAA 2VBZA 4HZFA 1HKQA 2V79A 3DPTA 1KA8A 4HX7A 2VN2A 4KFCA 3GEZA 1KQ8A 3WTYC 2VC1A 4BHBA 4LB6B 2P5KA 1U6GA 2LDUA 1J75A 1FSEA 4ZZDA 2VXZA 1FBQA 2R3SA 1X3UA 4ZYEA 1T2KA 1R1TA 4LJZF 2FMLA 4EGZA 4BYYA 1XB4A 2K86A 2DAOA 2QLZA 4ENNA 2NNNA 2UZKA 2VE9A 3DV8A 3L00A 4FT8A 3T1BA 1D8KA 2CW0F 2JRTA 5D6EA 4O6JA 2DK5A 3LSTA 1WKMA 1ZLKA 3RKXA 4HW0A 1CF7B 4HYEA 4EM2A 1BI2A 4ZYDA 4HLYA 3KP3A 4B8XA 4OU0A 4QWQA 3F3XA 2X4HA 2V1UA 3WTUC 1V4RA 5KVRA 3GFJA 3DPLC 3NRVA 1O3SA 5D8LB 3VEPA 3TOBA 3JSOA 1QNTA 2ZBKA 2E1CA 3EYIA 1V3FA 3G73A 2XIGA 3CDHA 4BAYA 1XSXA 4E70A 4L9TA 4OOIA 4OMZA 1S7OA 3GZ5A 4A12A 2FSWA 3TO7A 4P5OA 2DT5A 5ILUA 5D5WB 4EJUA 1L0OC 5EEHA 4G7HF 3FHZA 2H94A 1ON1A 2O61A 4HAMA 3ABTA 2VONA 4ENKA 5LEJA 2IP2A 2LNBA 3GVAA 4HDVA 4KDPA 2NRAC 1YTYA 5FFXA 1KU3A 3KE2A 4GCVA 1XMKA 2PN6A 3P9CA 5E17F 2GA1A 3O6BB 3PFIA 1JE8A 1H0MA 1HW5A 4UVAA 5CJ9A 1PP8F 3P9IA 3LA3A 4MQ9F 1UCRA 1MKMA 4LLLA 2IA1A 3ECHA 3F6OA 1I6XA 2CSOA 3WODF 4A0ZA 1QZZA 4HF0A 4LLGF 3IWZA 3C3WA 3ISPA 2FOKA 1SD5A 3QRFF 1XCVA 1O7FA 5TJJA 2OU2A 2FBIA 3VFZA 4YIFA 1BJAA 3EUHA 2E7XA 1ZN2A 2B0LA 1ZARA 4XSZF 3TGNA 3CJNA 1SFUA 2DW4A 1KU9A 3ROUA 2HKXA 4MQVA 5HLGA 4YFNF 1QO0D 2WV0A 2HQNA 1FYMA 3FX3A 5LEKA 4LGWA 3ML6A 5D5VB 1G3SA 3KP6A 4MHGA 3DKWA 5FO5A 4JQFA 4XSXF 5BPIA 2P7VB 3HSFA 3JSPA 3M7GA 2KIUA 4U0WA 1G4DA 3VODA 2JT1A 2ACJA 2F5DA 4L5JA 3HIFA 2J5OA 4BH9A 1RUNA 1SFXA 4XLNF 3LFKA 3KETA 2C6YA 2RNJA 3I53A 2ETHA 4ASNA 3ULQB 3KP7A 1BI0A 5HS9A 4G9YA 1IXRC 5F1RA 3F22A 3WTZA 2VC0A 1W4MA 3F8FA 2ZNZA 3V8JA 3IC7A 5CLSA 1K78A 1TTYA 3K0LA 2YX4A 1XGOA 1SMYF 3MZYA 5CVJA 5BPDA 2DFIA 2DQRA 1L3LA 1MJBA 5CVUA 2FMYA 1DUXC 1BN5A 3LA2A 4M9SA 3IRRA 1FZPB 2L54A 4Y13A 3HYIA 2DTRA 1ODDA 4I09A 1U5TC 2FQ3A 1B4AA 1XD7A 3H3ZA 4ZZLA 4KT5C 2HR3A 3AAFA 4MTDA 4KIGA 3LQRA 1FYLA 2STTA 4FX4A 2EWNA 2G7HA 1S3JA 3E97A 3BWGA 5JHUA 4YFKF 4L9VA 2P5VA 1RNLA 3BZ6A 3U9GA 2ZFWA 3E5XA 2QQ9A 1HXDA 2HZTA 1TW3A 1J2XA 5AIQA 2FF4A 2BE5F 2O6GE 4I0BA 3HSEA 1EH7A 2PMUA 1OKRA 1IW7F 1KYWA 4P55A 5DD4A 1IRGA 1LEAA 2FBKA 1EH8A 3RYRA 1J5YA 3FZVA 2STWA 1D8JA 3EQLF 2P7CB 1U2WA 5D5XB 3VB2A 1G3YA 4XRFA 1OR7A 5CVVA 5DUIA 2GWRA 5AONA 1BI1A 4G6DA 1MZBA 4HV5A 1ZH5A 5ICFA 3CUQC 1LVAA 2QYOA 4DQ2A 2LF8A 5DD8A 3NEUA 2XAFA 2EFQA 1YS7A 2ZO4A 2XHKA 2IA0A 4RGUA 3O3KA 2MH2A 1B9NA 1TNSA 1ZYRF 3CLOA 3J7AO 4HQEA 5A2QZ 4P9FA 4KMUX 5L3FA 1PP7U 3WGGA 4BNCA 4L0ZB 4PGGA 4G7ZF 1XN7A 3L2CA 4WXDA 3PQKA 5FGMA 1ZG3A 1T39A 1QQIA 4WCGA 1F4KA 4AVPA 1W5TA 1Q1HA 2A5YB 2E1NA 3L09A 2FE3A 5D4RA 4M72A 4O5VA 2M8EA 1TBXA 2UXXA 3K9TA 4HV6A 4IRHA 3E6CC 3GUDA 1GXPA 4HF2A 2RDPA 2XAQA 2M87A 4IHTA 3GX4X 3L9FA 3RKWA 5AIPA 1R5GA 3BDDA 1W5SA 4PDKA 4L5IA 3TO6A 2G7UA 4GYGA 1J7KA 4EJTA 1VTNC 1FNNA 3ECOA 5L3DA 2IRFG 1FC3A 1FOKA 4U0YA 3QAHA 5E1XA 2M45A 1B9MA 2EA4A 3BJ6A 3ZPLA 4MTEA 2FRHA 4WX9A 2RV8A 2W24A 3C1DA 2ZCWA 1PDNC 3J80Z 2MH9A 4AIJA 4M9XA 2M5WA 5L3CA 3GO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  3SHF A;  4EJO A;  3ZN0 A;  3HOT A;  1FPQ A;  3V4G A;  3I59 A;  5DEQ A;  4TV7 A;  3KP4 A;  4GXO A;  3KEQ A;  1HW1 A;  1ZRF A;  2P5L C;  3WTV C;  1YW9 A;  3RYP A;  2QQA A;  4JBA A;  4A0X A;  3DF8 A;  4L9N A;  3K2Z A;  1BI3 A;  2KRF A;  2PG4 A;  1T98 A;  3R61 A;  2Y48 A;  3GFI A;  2KIM A;  2YSR A;  1UST A;  1FT9 A;  3P9K A;  2K27 A;  2HTJ A;  2PBI A;  3N97 A;  2HS5 A;  2Q8K A;  3VOE A;  2LKP A;  5A2Q K;  1XMA A;  1STZ A;  4S04 A;  1O7L A;  1MD0 A;  1T6S A;  3MWM A;  1B59 A;  4EV0 A;  3ZP5 A;  5DYM A;  1SAX A;  1Z7U A;  3M9A A;  3RDI A;  2Q0O A;  3SZT A;  4EJV A;  3QOP A;  3B02 A;  3HRU A;  4RAZ A;  3T5X A;  1W7P D;  3FMR A;  3SFZ A;  1REP C;  5LLQ A;  1YS6 A;  2ZJ2 A;  2BBY A;  5E8G A;  3PQJ A;  2IVM A;  1F1Z A;  5HS7 A;  2L4M A;  5J6X A;  1ON2 A;  4AD9 A;  1Z05 A;  1D3Y A;  2OZ6 A;  1P92 A;  2VOO A;  3K69 A;  4WK8 F;  3V8K A;  2MD5 A;  3FM3 A;  1G3W A;  3GZ6 A;  4A5M A;  3JW4 A;  4BHP A;  1T0F A;  3HRM A;  1BIB A;  2BGC A;  1ULY A;  1Z6T A;  2ZNY A;  2OD5 A;  3REO A;  4A6D A;  4R1H A;  2H27 A;  2CGP A;  3ZMD A;  4XLP F;  1O3R A;  3FXQ A;  3I71 A;  3I64 A;  4U7B A;  2RC4 A;  1UHW A;  3BJA A;  4OMY A;  4EM0 B;  5FD6 A;  4L9J A;  4BXU A;  1NHA A;  4ESJ A;  4L0Y B;  4EQQ A;  1KYZ A;  3R6S A;  3KZZ A;  4KUM A;  4UHT A;  1LDD A;  2VBW A;  3J80 K;  3OV8 A;  1PUE E;  1FYK A;  3JTH A;  1G3T A;  1ONV A;  4WF2 A;  3TDU C;  4KMF A;  4G94 A;  1BBY A;  1RIO H;  3R0A A;  1LEB A;  2CYY A;  2ADU A;  1LB2 A;  4G6Q A;  1JHH A;  2L3D A;  1R22 A;  2OA4 A;  3BJO A;  4CDG A;  2A07 F;  2DU9 A;  2XKP A;  5HDG A;  1FWZ A;  3C18 A;  5FB2 A;  2D1V A;  4HLX A;  3MQ0 A;  4ZH4 F;  1A04 A;  1E2X A;  3ZMT A;  4MGR A;  3KEO A;  2Z99 A;  2ESH A;  2OQR A;  3E6B A;  3LWF A;  1YO5 C;  1O3Q A;  1HBX G;  1I5Z A;  2E7W A;  3MAJ A;  4RGR A;  2PI0 A;  1OYI A;  2A6H F;  2NAZ A;  1TQP A;  3U1D A;  2XAJ A;  2W25 A;  3KLO A;  3EDP A;  3QU6 A;  3HHG A;  1DPU A;  2LSO A;  1YFH A;  3S2W A;  1Z9C A;  2YPR A;  1HKT A;  3LQQ A;  4NB5 A;  3WU1 B;  3H92 A;  3BY6 A;  4ESB A;  3F21 A;  3MZH A;  4I02 A;  1I1G A;  3V7R A;  3WGI A;  2W85 A;  3DP7 A;  2QBY A;  3E5U A;  1IN4 A;  2EA2 A;  5ILV A;  2D45 A;  2A68 F;  1QZY A;  5CVR A;  2ZKZ A;  4CGZ A;  3HHH A;  2Q2E A;  1ZLJ A;  2IJL A;  1Y0U A;  2Z5U A;  4IF4 A;  4M74 A;  4YG2 F;  2P8T A;  1R36 A;  3TDZ C;  3F6V A;  1C0W A;  4UVB A;  4AIK A;  2EV5 A;  1IXS B;  3FXR A;  4R8H A;  3HTS B;  4Q5S F;  1P4W A;  4ZYG A;  3KP5 A;  4GO1 A;  4OIP F;  3T8T A;  1R1U A;  1TNT A;  4NQW A;  3JTG A;  3TKY A;  2FEZ A;  4UNO A;  2HDC A;  2CFX A;  1F5T A;  4S05 A;  2A3S A;  3T8R A;  1K6O A;  4CHU A;  1UFM A;  3RKY A;  5DCF A;  2COM A;  2Y75 A;  1IUY A;  4OIR F;  4EMS A;  2Z33 A;  3HSR A;  3V8L A;  2EV0 A;  4Z2Y A;  3DEU A;  4F7Z A;  1K78 B;  1XDU A;  3KZY A;  2QBY B;  1LDJ A;  3GW2 A;  4U7D A;  3D0S A;  1TLH B;  2RN7 A;  3E6D A;  2DI3 A;  2PEX A;  1YG2 A;  1LQ1 A;  3I4P A;  2EB7 A;  3ZMU A;  4KYW A;  5LGT A;  3IWF A;  2YR2 A;  2P6T A;  3BPV A;  3M1E A;  3WGH A;  3K1P A;  3FMQ A;  3QU3 A;  2P6S A;  1YLF A;  2ZME A;  4EGY A;  3QP6 A;  4LB5 A;  1TW2 A;  4O3M A;  2XVC A;  2W57 A;  2VE8 A;  4PGH A;  5KK1 A;  1K79 A;  5L3G A;  1ZRD A;  2XAG A;  5H20 A;  1IN8 A;  2IT0 A;  2A69 F;  1S8N A;  1YYV A;  1R1V A;  2FU4 A;  2MLG A;  1H9G A;  5J8F A;  4ETS A;  4M6Y A;  1TQI A;  2Z9O A;  4GYI A;  2XRN A;  4CZZ A;  1FBS A;  1LNW A;  4ENJ A;  2BV6 A;  2MBF A;  1MGT A;  1P2F A;  4UV9 A;  3Q5F A;  1EV7 A;  2XUB A;  3BOQ A;  3DXJ F;  2NNY A;  5ERI A;  3RTR A;  5K5O A;  2GZW A;  3RIR A;  1R23 A;  2VBY A;  4ON0 A;  4I0A A;  1KQ0 A;  4RGX A;  3HTU A;  4IRI A;  3KP2 A;  3GFL A;  5LGU A;  2IPQ X;  1KU2 A;  4AWX B;  3WTX C;  4U0V A;  2HWV A;  3EYY A;  5LHI A;  2HQR A;  4RGS A;  4G7O F;  3BP8 A;  2OBP A;  3J81 K;  2QZ8 A;  2LF7 A;  4N9I A;  2HFH A;  5JFR A;  5JVT A;  2ESN A;  4EM1 A;  2HTS A;  2AXL A;  1H9T A;  2DBB A;  2Y0M A;  3COA C;  5DDG A;  2CWE A;  2XRO A;  5H6Q A;  1CGP A;  2EJR A;  2K4B A;  4EVI A;  2K7L A;  1YIO A;  3ZMV A;  2VT3 A;  4IXA A;  2CO5 A;  3HRT A;  3Q9S A;  3Q9V A;  4A5N A;  2V6C A;  5LHG A;  3D5L A;  5F6F A;  1XGM A;  3IRQ A;  3E3V A;  5CVI A;  4KN4 X;  2EFO A;  5LRR A;  2FXA A;  1KQ9 A;  1RZ4 A;  1ZAO A;  3HUG A;  2EFW A;  1O3T A;  4IPA A;  5JR3 A;  1IN5 A;  3LAP A;  5IT9 K;  2EFN A;  1JXS A;  3K1M A;  4HF1 A;  2NS0 A;  4HA8 A;  4EJW A;  2PJP A;  2EV6 A;  3TOA A;  3H3U A;  2G9W A;  4UUV A;  4KIC A;  3SQN A;  4A0Y A;  3QPH A;  3ELK A;  2R7F A;  1O57 A;  4FX0 A;  4RB1 A;  1OMI A;  1I27 A;  3GYH X;  2L4A A;  5FLX Z;  1KU7 A;  3GWZ A;  2PQ8 A;  3EET A;  3WE2 A;  1LDK B;  1UB9 A;  2ZXJ A;  2FA5 A;  1ZRE A;  1FP1 D;  5ILS A;  1HKS A;  2EFP A;  3RPQ A;  2ELH A;  4M9Z A;  4ESF A;  1IZ1 A;  4I01 A;  1BOA A;  4KIB A;  5CYV A;  1FSH A;  4OIN F;  3WTW C;  2QEN A;  3TO9 A;  1WRJ A;  2IA2 A;  4A2U A;  2DLL A;  2UWM A;  2PMH A;  3R60 A;  3MEX A;  2RKH A;  1QGP A;  3ERE D;  1AOY A;  4HQM A;  4H0E A;  1ZRC A;  3BRO A;  4IHS A;  3V7C A;  1WWX A;  2HOE A;  2X0L A;  1HQC A;  1J0R A;  1ZHF A;  2XAS A;  2HGC A;  5DUK A;  4LK0 F;  2MC3 A;  1KGS A;  3I59 B;  2IW5 A;  4QLC U;  3RI4 A;  3I54 A;  5DCM A;  1B1B A;  3F8C A;  5JI6 A;  2GAU A;  4KIF A;  2M1B A;  3M8E A;  2F5E A;  2V1D A;  1BIA A;  3QP5 A;  1SMT A;  3CUO A;  4UXN A;  3CTA A;  4HOB A;  5K5Q A;  4IVN A;  2QWW A;  3HRS A;  1AWC A;  2YU3 A;  4A6E A;  3T0Y A;  5TRD A;  2GQQ A;  1OYY A;  4WWC A;  3F23 A;  5ICG A;  4I7H A;  4L18 B;  3TQN A;  2UXN A;  4Q47 A;  5BOX A;  1I1S A;  1BM9 A;  2K02 A;  1GVJ A;  5L3E A;  4KNY A;  3WTT C;  4CO8 A;  2TDX A;  3DQV C;  2DQL A;  5ED4 A;  1DDN A;  2OQG A;  2KKO A;  1QPM A;  1ZG5 A;  3M8F A;  3MFK A;  1J59 A;  4YII A;  1LJ9 A;  1R7J A;  5E1W A;  2A61 A;  4PZJ A;  1MJ9 A;  1ZGJ A;  1SD6 A;  1U8R A;  2H6B A;  2FNP A;  4XBF A;  4IRG A;  2OAZ A;  5FLX K;  5L3B A;  5DCM B;  4GGG A;  2RQP A;  2RGV A;  5E1Z B;  3WTS C;  2VBX A;  1JGS A;  3OOP A;  3IL2 A;  3IKT A;  3N4M A;  4RB0 A;  1RI7 A;  1FLI A;  4OIQ F;  1DPR A;  5LBQ A;  1YQA A;  1SD4 A;  5LGN A;  2CQK A;  3W6K B;  1S29 A;  4R79 A;  2GXB A;  2BYV E;  3E5Q A;  3O2P E;  2DPD A;  3LAJ A;  1SFE A;  5HVQ C;  2GA2 A;  2QUF A;  1U3E M;  1WSU A;  2XKO A;  3LA7 A;  3SZP A;  2D1H A;  3FXU A;  4HBL A;  5HLI A;  2H09 A;  2ISZ A;  3V7S A;  4M71 A;  1DP7 P;  2JPC A;  2KIF A;  5H6R A;  3P7N A;  2WC2 A;  5FFZ A;  1P4X A;  4I2O A;  3WU0 A;  1XGS A;  4RB2 C;  1IRF A;  1UHM A;  1P6R A;  2GIV A;  2H6C A;  3DFG A;  4AIH A;  1FX7 A;  1XSV A;  3IHU A;  1XGN A;  2YX7 A;  1FP2 A;  4U88 A;  3ABU A;  4KA4 A;  2VT2 A;  2QVO A;  2VOP A;  4M73 A;  6PAX A;  4CXF A;  1ZGA A;  5HLH A;  3F8M A;  3CO7 C;  1R00 A;  1B6A A;  2F5C A;  1IF1 A;  2HYF A;  2XV4 S;  3FMS A;  1W7P A;  3IKV A;  1OPC A;  5F64 A;  3SXY A;  2HEO A;  2MLK A;  1EH6 A;  2BEO A;  2FNA A;  4K2E A;  1YW8 A;  3E6M A;  1U5T A;  5K1Y A;  2VOD A;  3R0J A;  2JPB A;  1FBU A;  4G8X A;  2JZY A;  2OZU A;  2XAH A;  3KLN A;  1E17 A;  1J9I A;  2P4W A;  5BQT A;  5BMZ A;  2MA3 A;  2FBH A;  2WWY A;  4CYD A;  4Q48 A;  1K7A A;  3U2R A;  3J81 Z;  4I98 B;  3JAM Z;  1GXQ A;  4MEY F;  4NHJ A;  3ZMS A;  2QQB A;  5J8C A;  3I58 A;  3K1N A;  1XDS A;  2NYX A;  3KFW X;  3I5U A;  5E18 F;  1HSJ A;  4LFU A;  5HOO A;  3GFM A;  4M6X A;  1BC7 C;  2PLY A;  2K4J A;  3I0T A;  2KJC A;  2D2W A;  1WQ2 A;  4B09 A;  4CIC A;  3NQO A;  2JSC A;  2F2E A;  5E8I A;  3FM5 A;  1Z91 A;  5FD5 A;  1IN7 A;  1F9N A;  2J5P A;  2CG4 A;  4MEX F;  5EEG A;  4LMY A;  5D6F A;  4RS8 A;  4Y15 A;  4D0P A;  2O0Y A;  5IT9 Z;  1MDM A;  2DK8 A;  3BPX A;  4RAY A;  4LG0 A;  1QBJ A;  1W7P B;  1IAW A;  4DNC A;  5BS6 A;  5ICC A;  2WTE A;  1U5T B;  1HW2 A;  3F72 A;  4LLN A;  3CUQ A;  3L7W A;  3HOS A;  4LK1 F;  3ZQ7 A;  4HX8 A;  3MCZ A;  1XCB A;  3QPT A;  1FY7 A;  2L01 A;  4HX4 A;  3GF2 A;  1U78 A;  1XSD A;  4N0B A;  2QM3 A;  2HYG D;  3C7J A;  5HDK A;  3ZN1 A;  5D8K B;  1Z1D A;  1IN6 A;  1HST A;  4ENM A;  5K5R A;  3R4K A;  2O3F A;  3WG9 A;  1G6N A;  3F8B A;  4JK1 X;  1R5H A;  2JTV A;  2V9V A;  2O8X A;  4P96 A;  3ZMZ A;  4UVC A;  1BC8 C;  5D4S A;  4PCQ A;  3CO6 C;  3FWE A;  1IXC A;  4OIO F;  1MDM B;  5LRS A;  2XGX A;  2AS5 F;  2O03 A;  2DPU A;  4LG0 B;  2M30 A;  3G3Z A;  4UV8 A;  2V1X A;  2PFB A;  2KJB A;  1YW7 A;  1Z6R A;  4P9U A;  4BHC A;  3CUQ B;  3F8N A;  3GXO A;  1D5V A;  1OYW A;  1RUO A;  3RJP A;  1SD7 A;  5E20 A;  4WXC A;  2EK5 A;  5HS8 A;  3JAM K;  3GLX A;  2HKO A;  2ZME B;  4HDU A;  1USS A;  1MJA A;  1WI9 A;  2Z3Y A;  2F5F A;  1S7A A;  2A6E F;  2ISY A;  3W6J B;  2L02 A;  5D5U B;  3WE3 A;  4Y17 A;  4MNU A;  1TQM A;  4FHT A;  1S6L A;  2GXG A;  4Q4Z F;  4YFX F;  2DO7 A;  3RPU A;  1ZG1 A;  2W84 A;  1GHC A;  4IJA A;  4RB3 C;  5LHH A;  4LD5 A;  5ICE A;  1P4A A;  1CF7 A;  3FF5 A;  3KCC A;  1T38 A;  5HDN A;  4KN7 X;  5DV5 A;  4WXH A;  4N9H A;  3B73 A;  4ZYH A;  2RVC A;  1R58 A;  5IT3 A;  1JHF A;  4BQA A;  2VBZ A;  4HZF A;  1HKQ A;  2V79 A;  3DPT A;  1KA8 A;  4HX7 A;  2VN2 A;  4KFC A;  3GEZ A;  1KQ8 A;  3WTY C;  2VC1 A;  4BHB A;  4LB6 B;  2P5K A;  1U6G A;  2LDU A;  1J75 A;  1FSE A;  4ZZD A;  2VXZ A;  1FBQ A;  2R3S A;  1X3U A;  4ZYE A;  1T2K A;  1R1T A;  4LJZ F;  2FML A;  4EGZ A;  4BYY A;  1XB4 A;  2K86 A;  2DAO A;  2QLZ A;  4ENN A;  2NNN A;  2UZK A;  2VE9 A;  3DV8 A;  3L00 A;  4FT8 A;  3T1B A;  1D8K A;  2CW0 F;  2JRT A;  5D6E A;  4O6J A;  2DK5 A;  3LST A;  1WKM A;  1ZLK A;  3RKX A;  4HW0 A;  1CF7 B;  4HYE A;  4EM2 A;  1BI2 A;  4ZYD A;  4HLY A;  3KP3 A;  4B8X A;  4OU0 A;  4QWQ A;  3F3X A;  2X4H A;  2V1U A;  3WTU C;  1V4R A;  5KVR A;  3GFJ A;  3DPL C;  3NRV A;  1O3S A;  5D8L B;  3VEP A;  3TOB A;  3JSO A;  1QNT A;  2ZBK A;  2E1C A;  3EYI A;  1V3F A;  3G73 A;  2XIG A;  3CDH A;  4BAY A;  1XSX A;  4E70 A;  4L9T A;  4OOI A;  4OMZ A;  1S7O A;  3GZ5 A;  4A12 A;  2FSW A;  3TO7 A;  4P5O A;  2DT5 A;  5ILU A;  5D5W B;  4EJU A;  1L0O C;  5EEH A;  4G7H F;  3FHZ A;  2H94 A;  1ON1 A;  2O61 A;  4HAM A;  3ABT A;  2VON A;  4ENK A;  5LEJ A;  2IP2 A;  2LNB A;  3GVA A;  4HDV A;  4KDP A;  2NRA C;  1YTY A;  5FFX A;  1KU3 A;  3KE2 A;  4GCV A;  1XMK A;  2PN6 A;  3P9C A;  5E17 F;  2GA1 A;  3O6B B;  3PFI A;  1JE8 A;  1H0M A;  1HW5 A;  4UVA A;  5CJ9 A;  1PP8 F;  3P9I A;  3LA3 A;  4MQ9 F;  1UCR A;  1MKM A;  4LLL A;  2IA1 A;  3ECH A;  3F6O A;  1I6X A;  2CSO A;  3WOD F;  4A0Z A;  1QZZ A;  4HF0 A;  4LLG F;  3IWZ A;  3C3W A;  3ISP A;  2FOK A;  1SD5 A;  3QRF F;  1XCV A;  1O7F A;  5TJJ A;  2OU2 A;  2FBI A;  3VFZ A;  4YIF A;  1BJA A;  3EUH A;  2E7X A;  1ZN2 A;  2B0L A;  1ZAR A;  4XSZ F;  3TGN A;  3CJN A;  1SFU A;  2DW4 A;  1KU9 A;  3ROU A;  2HKX A;  4MQV A;  5HLG A;  4YFN F;  1QO0 D;  2WV0 A;  2HQN A;  1FYM A;  3FX3 A;  5LEK A;  4LGW A;  3ML6 A;  5D5V B;  1G3S A;  3KP6 A;  4MHG A;  3DKW A;  5FO5 A;  4JQF A;  4XSX F;  5BPI A;  2P7V B;  3HSF A;  3JSP A;  3M7G A;  2KIU A;  4U0W A;  1G4D A;  3VOD A;  2JT1 A;  2ACJ A;  2F5D A;  4L5J A;  3HIF A;  2J5O A;  4BH9 A;  1RUN A;  1SFX A;  4XLN F;  3LFK A;  3KET A;  2C6Y A;  2RNJ A;  3I53 A;  2ETH A;  4ASN A;  3ULQ B;  3KP7 A;  1BI0 A;  5HS9 A;  4G9Y A;  1IXR C;  5F1R A;  3F22 A;  3WTZ A;  2VC0 A;  1W4M A;  3F8F A;  2ZNZ A;  3V8J A;  3IC7 A;  5CLS A;  1K78 A;  1TTY A;  3K0L A;  2YX4 A;  1XGO A;  1SMY F;  3MZY A;  5CVJ A;  5BPD A;  2DFI A;  2DQR A;  1L3L A;  1MJB A;  5CVU A;  2FMY A;  1DUX C;  1BN5 A;  3LA2 A;  4M9S A;  3IRR A;  1FZP B;  2L54 A;  4Y13 A;  3HYI A;  2DTR A;  1ODD A;  4I09 A;  1U5T C;  2FQ3 A;  1B4A A;  1XD7 A;  3H3Z A;  4ZZL A;  4KT5 C;  2HR3 A;  3AAF A;  4MTD A;  4KIG A;  3LQR A;  1FYL A;  2STT A;  4FX4 A;  2EWN A;  2G7H A;  1S3J A;  3E97 A;  3BWG A;  5JHU A;  4YFK F;  4L9V A;  2P5V A;  1RNL A;  3BZ6 A;  3U9G A;  2ZFW A;  3E5X A;  2QQ9 A;  1HXD A;  2HZT A;  1TW3 A;  1J2X A;  5AIQ A;  2FF4 A;  2BE5 F;  2O6G E;  4I0B A;  3HSE A;  1EH7 A;  2PMU A;  1OKR A;  1IW7 F;  1KYW A;  4P55 A;  5DD4 A;  1IRG A;  1LEA A;  2FBK A;  1EH8 A;  3RYR A;  1J5Y A;  3FZV A;  2STW A;  1D8J A;  3EQL F;  2P7C B;  1U2W A;  5D5X B;  3VB2 A;  1G3Y A;  4XRF A;  1OR7 A;  5CVV A;  5DUI A;  2GWR A;  5AON A;  1BI1 A;  4G6D A;  1MZB A;  4HV5 A;  1ZH5 A;  5ICF A;  3CUQ C;  1LVA A;  2QYO A;  4DQ2 A;  2LF8 A;  5DD8 A;  3NEU A;  2XAF A;  2EFQ A;  1YS7 A;  2ZO4 A;  2XHK A;  2IA0 A;  4RGU A;  3O3K A;  2MH2 A;  1B9N A;  1TNS A;  1ZYR F;  3CLO A;  3J7A O;  4HQE A;  5A2Q Z;  4P9F A;  4KMU X;  5L3F A;  1PP7 U;  3WGG A;  4BNC A;  4L0Z B;  4PGG A;  4G7Z F;  1XN7 A;  3L2C A;  4WXD A;  3PQK A;  5FGM A;  1ZG3 A;  1T39 A;  1QQI A;  4WCG A;  1F4K A;  4AVP A;  1W5T A;  1Q1H A;  2A5Y B;  2E1N A;  3L09 A;  2FE3 A;  5D4R A;  4M72 A;  4O5V A;  2M8E A;  1TBX A;  2UXX A;  3K9T A;  4HV6 A;  4IRH A;  3E6C C;  3GUD A;  1GXP A;  4HF2 A;  2RDP A;  2XAQ A;  2M87 A;  4IHT A;  3GX4 X;  3L9F A;  3RKW A;  5AIP A;  1R5G A;  3BDD A;  1W5S A;  4PDK A;  4L5I A;  3TO6 A;  2G7U A;  4GYG A;  1J7K A;  4EJT A;  1VTN C;  1FNN A;  3ECO A;  5L3D A;  2IRF G;  1FC3 A;  1FOK A;  4U0Y A;  3QAH A;  5E1X A;  2M45 A;  1B9M A;  2EA4 A;  3BJ6 A;  3ZPL A;  4MTE A;  2FRH A;  4WX9 A;  2RV8 A;  2W24 A;  3C1D A;  2ZCW A;  1PDN C;  3J80 Z;  2MH9 A;  4AIJ A;  4M9X A;  2M5W A;  5L3C A;  3GO5 A; 
#chains in the Genus database with same CATH topology
 2R7D A;  3SHF A;  4EJO A;  1X19 A;  3ZN0 A;  1RET A;  2MYS A;  3HOT A;  1A35 A;  1IRZ A;  1FPQ A;  3V4G A;  2A05 A;  4J00 A;  2VKE A;  2D5V A;  1RRJ A;  3I59 A;  5DEQ A;  3DTK A;  1W0T A;  4TV7 A;  4CYC A;  3KP4 A;  3CMA I;  4GXO A;  3KEQ A;  3AG4 H;  4E7I A;  1HW1 A;  1ZRF A;  1XS9 A;  1K4T A;  5E3O A;  2P5L C;  3K70 C;  3SFI A;  3WTV C;  1YW9 A;  3RYP A;  2QQA A;  4JBA A;  4V2F A;  4A0X A;  3GBG A;  3DF8 A;  1OCC H;  2QKM B;  4L9N A;  3K2Z A;  4ABZ A;  1BI3 A;  2KRF A;  1TWH J;  2LY2 A;  1NG7 A;  2PG4 A;  1K4S A;  1T98 A;  4F3Q A;  1QHG A;  3R61 A;  2Y48 A;  3GFI A;  3PO2 J;  1T08 B;  2QSF X;  3DBR B;  2KIM A;  3HZJ A;  2YSR A;  2EZL A;  1UST A;  1FT9 A;  3P9K A;  2K27 A;  1WVR A;  2HTJ A;  3TBI A;  2PBI A;  1NK2 P;  4RLQ A;  3N97 A;  2HS5 A;  2Q8K A;  3VOE A;  5EZG A;  2LKP A;  5A2Q K;  1XMA A;  2BOL A;  1STZ A;  4S04 A;  3OS1 A;  3KIO A;  1SEU A;  3QYE A;  4XKB A;  1O7L A;  1MD0 A;  2YS9 A;  3GTQ J;  1T6S A;  5IPA A;  1ENH A;  3MWM A;  1MH3 A;  1B59 A;  4EV0 A;  3ZP5 A;  5DYM A;  2NVT J;  1SAX A;  5FJ8 J;  1TWA J;  1Z7U A;  3M9A A;  4ITV A;  3RDI A;  1Y56 A;  2Q0O A;  3SZT A;  4EJV A;  2FQ4 A;  3QOP A;  3B02 A;  2H1K A;  3HRU A;  3KX2 A;  2E1M C;  4M3D A;  4RAZ A;  1GUU A;  2W48 A;  4C30 A;  3T5X A;  1TT0 A;  1W7P D;  2M4K A;  3FMR A;  3SFZ A;  2R93 J;  3OSF A;  1REP C;  5LLQ A;  1YS6 A;  2ZJ2 A;  2BBY A;  5E8G A;  3PQJ A;  1LFB A;  2IVM A;  1F1Z A;  2I10 A;  4AUX A;  1JKQ C;  1R4N B;  1WI3 A;  5HS7 A;  2L4M A;  2HOS A;  3FBN B;  5J6X A;  1ON2 A;  4AD9 A;  2BVM A;  3JRG A;  2DMU A;  4NC7 A;  3G1M A;  3A2K A;  1Z05 A;  1D3Y A;  2KIS A;  1WCM J;  2OZ6 A;  5GTI C;  1P92 A;  4CYC B;  2XF6 A;  1DP3 A;  1ACI A;  3C2B A;  1A31 A;  4BU2 A;  2VOO A;  3GTK J;  3K69 A;  2BXY A;  4HRI A;  4DYQ A;  3K4L A;  1R49 A;  4LIU A;  4WK8 F;  3V8K A;  1ETX A;  2MD5 A;  3FM3 A;  1G3W A;  3GZ6 A;  1A5J A;  4A5M A;  3JW4 A;  3OIO A;  1X1C A;  1X4O A;  4BHP A;  1T0F A;  3HRM A;  4BXF A;  4CCK A;  1BIB A;  3OIQ A;  2OF7 A;  2VLA A;  2AHQ A;  2BGC A;  1ULY A;  1Z6T A;  3TED A;  4BGD A;  2JUC A;  1AA7 A;  2E1M B;  4XLF A;  2ZNY A;  3OYC A;  2OD5 A;  3REO A;  4A6D A;  4R1H A;  2H27 A;  4QPO A;  2CGP A;  3B6C A;  3RQ4 A;  3ZMD A;  4XLP F;  4YEL A;  1O3R A;  3PIO F;  4DBR A;  3FXQ A;  2F5V A;  4PK4 A;  3I71 A;  2EZI A;  3I64 A;  3OR2 C;  4U7B A;  2IS2 A;  2R7T A;  2RC4 A;  1UHW A;  3BJA A;  4OMY A;  4EM0 B;  5FD6 A;  3CF5 F;  5J4Y A;  2CV1 A;  4L9J A;  4BXU A;  1NHA A;  4ESJ A;  4L0Y B;  4EQQ A;  2DN0 A;  4CZC A;  5F0C A;  4F91 B;  1KYZ A;  4A93 J;  3DWL E;  4UB6 C;  3R6S A;  3KZZ A;  1LKX A;  3LSP A;  4A3I J;  4KUM A;  2K9L A;  3HKZ N;  4XRM A;  4UHT A;  4BQQ A;  3DEE A;  1LDD A;  3WG7 H;  2VBW A;  3J80 K;  1BR4 A;  3OV8 A;  2KIQ A;  1MMD A;  2W00 A;  1PUE E;  3QWL A;  3OYJ A;  1FYK A;  3JTH A;  3LSJ A;  1G3T A;  1SAN A;  1ONV A;  4WF2 A;  3FXO A;  3NAR A;  1YRN A;  3TDU C;  1VQP I;  5IP7 J;  3D1N I;  4KMF A;  1X3W B;  1K83 J;  1V5E A;  2WAQ N;  3OYD A;  4G94 A;  1P7J A;  1BBY A;  1YE9 A;  1RIO H;  1WH5 A;  4BQO A;  2CMP A;  3HDD A;  3R0A A;  4XK4 A;  2GIZ A;  2LR8 A;  2LRE A;  3S32 A;  1LEB A;  2CYY A;  2R4G A;  2ADU A;  4A3F J;  1LB2 A;  4G6Q A;  1JHH A;  4BY7 J;  1NK3 P;  3BLY A;  3ABL H;  3OIP A;  4B48 A;  2L3D A;  1R22 A;  4E7J A;  2OA4 A;  4Y4R A;  3BR3 A;  3C2G A;  3BJO A;  2VPL A;  4CDG A;  2VJI A;  2A07 F;  2DU9 A;  2XKP A;  3H35 A;  3H5A A;  4ANJ A;  5HDG A;  1FWZ A;  2MGQ A;  3EUH C;  2R7U A;  3C18 A;  4E6K G;  2XSD C;  2CV0 A;  5FB2 A;  1AKH A;  1FJL A;  2D1V A;  2DOA A;  4HLX A;  3MQ0 A;  4ZH4 F;  1A04 A;  1E2X A;  3CF2 A;  3GCM A;  3ZR8 X;  2LC2 A;  3ZMT A;  4AM3 A;  2BY3 A;  5DS9 A;  4MGR A;  3KEO A;  2Z99 A;  5IYC J;  4JX5 A;  2ESH A;  2OQR A;  3E6B A;  3LWF A;  1YO5 C;  2JVG A;  2Y31 A;  4MLO A;  3KYD B;  4IQJ A;  4L5E A;  3H1C A;  1JJ8 C;  2XC7 A;  1O3Q A;  1HBX G;  1VI0 A;  3S3M A;  1I5Z A;  1R9T J;  1HDP A;  2E7W A;  3MAJ A;  2A6T A;  1LVK A;  4RGR A;  2ID3 A;  2PI0 A;  4II2 A;  1OYI A;  2OCC H;  3HGY A;  1ORK A;  2A6H F;  2NAZ A;  2L9R A;  3FKI J;  3IUO A;  1TQP A;  3U1D A;  3KYC B;  2XAJ A;  2W25 A;  3KLO A;  3EDP A;  3QU6 A;  3HHG A;  3RKQ A;  3H3V K;  1DPU A;  2LSO A;  4PJL A;  1YFH A;  3S2W A;  3DBL B;  4BJ6 C;  1Z9C A;  2YPR A;  3IH3 A;  3LQQ A;  5IOZ A;  1MSE C;  1HKT A;  4NB5 A;  3WU1 B;  3H92 A;  2N8G A;  1WJA A;  3BY6 A;  4IL6 C;  4ESB A;  4LIT A;  2X1C A;  2CUJ A;  4HNV A;  1HOM A;  3F21 A;  1MNM C;  3MZH A;  4I02 A;  1I1G A;  3V7R A;  3WGI A;  2W85 A;  3DP7 A;  3J7Y J;  2QBY A;  2V7F A;  2W4S A;  3QOD A;  5E3M A;  3E5U A;  3C2H A;  2O8K A;  1J09 A;  3NWS A;  2CUZ A;  1IN4 A;  3OS2 A;  3K7A J;  2EA2 A;  3FXM A;  5ILV A;  5FLV A;  1OFC X;  2X1D A;  2D45 A;  2A68 F;  3DKY A;  1QZY A;  4RAF A;  2ZKZ A;  5CVR A;  4CGZ A;  3HHH A;  3MZ8 A;  2Q2E A;  1ZLJ A;  4I6Z A;  3H9Q A;  1JUM A;  2IJL A;  3OYA A;  1Y0U A;  2Z5U A;  4DW6 A;  4IF4 A;  4M74 A;  3L2R A;  1JI8 A;  4YG2 F;  2DFF A;  4DJA A;  2P8T A;  1T33 A;  2WV1 A;  3K2A A;  1QHH D;  1VQM I;  1R36 A;  2V4J C;  3TDZ C;  3F6V A;  2L9S A;  3RPU D;  1C0W A;  4UVB A;  1QVU A;  3AG2 H;  4AIK A;  3BQZ A;  2EV5 A;  1IXS B;  2Y0S N;  3LMM A;  3FXR A;  2ZJP F;  4R8H A;  3HTS B;  2HPI A;  4Q5S F;  2W7N A;  1P4W A;  4ZYG A;  2W1O A;  3KP5 A;  3S1N J;  2DA5 A;  4GO1 A;  4OIP F;  3T8T A;  3CCM I;  1R1U A;  1TNT A;  2ME0 A;  4NQW A;  3HGG A;  5B1A H;  3JTG A;  3TKY A;  1GT0 C;  2FEZ A;  4UNO A;  5GAD J;  2HDC A;  2CFX A;  1UMQ A;  1F5T A;  4S05 A;  2A3S A;  2HVR A;  1FMV A;  3T8R A;  1K6O A;  5M5W J;  4CHU A;  1UFM A;  2B7E A;  2I5U A;  4I99 C;  3RKY A;  3WU2 C;  2XAU A;  5DCF A;  1U9O A;  2COM A;  2Y75 A;  1IUY A;  3W6V A;  3QYF A;  4OIR F;  4NDL A;  4BQN A;  4EMS A;  2Z33 A;  3HSR A;  3V8L A;  2E60 A;  2EV0 A;  3G1L A;  1IJW C;  4Z2Y A;  2L7K A;  3DEU A;  4F7Z A;  1K78 B;  2DA2 A;  1WJ5 A;  1XDU A;  3KZY A;  3LNQ A;  2QBY B;  3TL4 X;  4IKF A;  4QSH A;  3G6E I;  1LDJ A;  3GW2 A;  4G12 A;  4U7D A;  1Z67 A;  3D0S A;  1TLH B;  2RN7 A;  1VQK I;  1YX5 A;  5K7H A;  3ERM A;  3E6D A;  2DI3 A;  2PEX A;  1YG2 A;  4KIT B;  1LQ1 A;  2CQN A;  3I4P A;  2EB7 A;  3K4J A;  3ZMU A;  3U21 A;  2M4G A;  2K85 A;  4QPQ A;  1VQL I;  4KYW A;  1VQ7 I;  4IOA F;  3HJE A;  2XDV A;  3H5R A;  2VJJ A;  4ZYA A;  5LGT A;  3IWF A;  2YR2 A;  2P6T A;  3BPV A;  4BDZ A;  2E5N A;  3QQA A;  4G6T B;  3CME I;  4DIQ A;  2XF7 A;  1R6R A;  3M8J A;  2DMQ A;  2CQX A;  3M1E A;  1YHQ I;  1IUF A;  4MFE A;  1N25 A;  2LMD A;  1WHU A;  3WGH A;  1WJC A;  1MBF A;  3K1P A;  3FMQ A;  3QU3 A;  2P6S A;  1YLF A;  3W3C A;  2ZME A;  4EGY A;  1R4M B;  1XX5 A;  1D1C A;  3QP6 A;  5C3E J;  4LB5 A;  1GV5 A;  2Y9Y A;  4XQF A;  3VYS B;  1I50 J;  1TW2 A;  3A0H C;  3UKG A;  1N75 A;  4O3M A;  2XVC A;  1XTA A;  2IGO A;  2W57 A;  2DDB A;  2VE8 A;  3PNV A;  4PGH A;  3HPG A;  3S3N A;  5KK1 A;  1K79 A;  4UY8 I;  2RAE A;  5L3G A;  1ZRD A;  2OC6 A;  2PMZ A;  4FE4 A;  2XAG A;  4RM3 A;  4NQW B;  5B1B H;  3EUA A;  5H20 A;  2NS7 A;  4UUT A;  5J1U A;  1IN8 A;  2IT0 A;  1UAA A;  2A69 F;  1S8N A;  1YYV A;  1R1V A;  2FU4 A;  1H89 C;  2MLG A;  1H9G A;  4RA2 A;  5J8F A;  4ETS A;  4M6Y A;  3OSG A;  1TQI A;  2Z9O A;  4C9Y A;  4GYI A;  4M3F A;  2XRN A;  4CZZ A;  3GTJ J;  1FBS A;  1WH7 A;  1LNW A;  1HCR A;  4ENJ A;  1Z7L A;  3GTP J;  2BV6 A;  2MBF A;  1MGT A;  1P2F A;  4UV9 A;  3Q5F A;  1EV7 A;  2XUB A;  3BOQ A;  3DXJ F;  2HOA A;  3IAM 2;  5ERI A;  2NNY A;  2R7S A;  2X1E A;  3RTR A;  5GAE J;  5K5O A;  2GZW A;  3BTC A;  3A1Y A;  2NVQ J;  3RIR A;  1R23 A;  3CJT B;  1SFO J;  2VBY A;  4ON0 A;  4I0A A;  1KQ0 A;  4RGX A;  3HTU A;  4XOP A;  4IRI A;  4A69 C;  3KP2 A;  3IH4 A;  2R5Y A;  1D1B A;  2LY1 A;  3GFL A;  3ZRG A;  5LGU A;  3E7L A;  1LFU P;  2IPQ X;  1UZC A;  3OS0 A;  1KU2 A;  3RZO J;  1ETV A;  1MIJ A;  4AWX B;  3QPL A;  3WTX C;  4U0V A;  2HWV A;  2ECB A;  3PM1 A;  3CCE I;  3H0G J;  3EYY A;  5LHI A;  5IYB J;  3H36 A;  1P9Q C;  1AU7 A;  2HQR A;  3BG6 A;  2ZB9 A;  4FTH A;  4X0G A;  2P81 A;  4RGS A;  2ZSH B;  4B1R A;  3B6A A;  3DEW A;  5C4J J;  3TP3 A;  4G7O F;  5LFA A;  3BP8 A;  2OBP A;  2R7V A;  2IS1 A;  3J81 K;  2QZ8 A;  1D0Z A;  2LF7 A;  3LSK A;  2GBY A;  2HPM A;  4N9I A;  2HFH A;  4RAG A;  5JFR A;  2ESN A;  5JVT A;  1BL0 A;  4M6V A;  2BZT A;  3S15 J;  2KLO A;  3CCJ I;  2DA3 A;  4EM1 A;  2HTS A;  2LTP A;  3JR9 A;  2AXL A;  1H9T A;  5GP9 A;  2DBB A;  2Y0M A;  5FLM J;  3COA C;  3CJQ B;  5DDG A;  2CWE A;  2XRO A;  1XC5 A;  5H6Q A;  1CGP A;  1X1A A;  1X58 A;  2EJR A;  2K4B A;  4EVI A;  2K7L A;  2X9D A;  1YIO A;  1FIA A;  3ZMV A;  2VT3 A;  2IGK A;  1X1D A;  1HDD C;  4IXA A;  2CO5 A;  1I3A A;  4U87 A;  3A0B C;  3HRT A;  1YX3 A;  4E7S A;  2P0W A;  4AVZ A;  3Q9S A;  1S7E A;  3A4C A;  3S17 J;  4ZDP A;  3Q9V A;  4A5N A;  2GOX B;  2KHM A;  2V6C A;  3IH2 A;  5LHG A;  3D5L A;  3M3Y J;  5F6F A;  1XGM A;  3IRQ A;  4IZZ A;  3E3V A;  5CVI A;  5HOD A;  1IV6 A;  4KN4 X;  2EFO A;  5KCM A;  5LRR A;  4F55 A;  2FXA A;  2Y9Z A;  2DYS H;  3S16 J;  1KQ9 A;  1RZ4 A;  1ZAO A;  3HUG A;  1O4X A;  4XID A;  2DA7 A;  4NBQ A;  2EFW A;  3I55 I;  4II3 A;  5M5Y J;  1O3T A;  4IPA A;  5JR3 A;  1IN5 A;  3FKJ A;  5FRN A;  3LAP A;  5EGO A;  5IT9 K;  4C3J J;  1E3H A;  5EG0 B;  2JA6 J;  2EFN A;  3MN2 A;  1JKO C;  2FJ1 A;  1JXS A;  3K1M A;  4HF1 A;  2NS0 A;  3BC8 A;  4HA8 A;  4XLE A;  4EJW A;  3HBL A;  2PJP A;  2CFO A;  2IGN A;  3CP8 A;  3BR0 A;  2EV6 A;  3TOA A;  1Y1V J;  2LRD A;  2XB5 A;  3H3U A;  2DT7 B;  3BR5 A;  4S0H B;  2G9W A;  4DOZ A;  4BAC A;  5K7F A;  4UUV A;  3QPS A;  4KIC A;  3SQN A;  4A0Y A;  3QPH A;  3ELK A;  2R7F A;  1O57 A;  4FX0 A;  4RB1 A;  3Q3S A;  1OMI A;  5CQG A;  2BHZ A;  1I27 A;  4FCY A;  1V55 H;  3GYH X;  1GDT A;  2L4A A;  2WBM A;  2CJJ A;  5FLX Z;  5FKO A;  3GWZ A;  1KU7 A;  2PQ8 A;  3HG9 A;  3ZQQ A;  3EET A;  3ASN H;  4OAZ A;  3FDY A;  1VQ4 I;  1W36 C;  2BXZ A;  3WE2 A;  1LDK B;  2LVS A;  1UB9 A;  4KT6 A;  1IGN A;  2WB1 A;  2ZXJ A;  3FBI B;  2FA5 A;  2WY8 Q;  1ZRE A;  5J47 A;  1FP1 D;  5ILS A;  4PFP A;  4JYK A;  1HKS A;  2EFP A;  1VQN I;  3RPQ A;  2ELH A;  4M9Z A;  4ESF A;  4BJT A;  1S9H A;  1IO2 A;  4HPQ A;  3K4N A;  3GTL J;  1IZ1 A;  4I01 A;  4V19 K;  1JTY A;  1BOA A;  2HU9 A;  3HB9 A;  4KIB A;  5CYV A;  1SVL A;  1JJ6 C;  2VKV A;  1FSH A;  4OIN F;  3WTW C;  3O8G A;  2QEN A;  3BR1 A;  1JGG A;  3TO9 A;  3WHC A;  3OYK A;  3BR2 A;  1PUF A;  1WRJ A;  2HYJ A;  2IA2 A;  4M3G A;  3HUG B;  2DLL A;  4A2U A;  2UWM A;  3CD6 I;  2PMH A;  3R60 A;  2RNG A;  1VQ6 I;  3MEX A;  1N77 A;  2RKH A;  4W97 A;  2E71 A;  5CKT A;  1QGP A;  3IAS 2;  5DM6 F;  3X2Q H;  4XN3 A;  5EGO B;  4PSW A;  3RCO A;  3DU6 A;  4KIS A;  3ERE D;  3J7A Y;  1AOY A;  2WAD A;  4HQM A;  4H0E A;  4PJ0 C;  3Q0W A;  4FIS A;  1ZRC A;  2CUF A;  2XF5 A;  2B9S A;  3BRO A;  2OV7 A;  4IHS A;  1ZEL A;  3V7C A;  1WWX A;  2HOE A;  2X0L A;  1HQC A;  1J0R A;  1ZHF A;  5FKK A;  2XAS A;  2HGC A;  2ZFU A;  5DUK A;  4LK0 F;  1UHS A;  2JUG A;  3MKY B;  1WZ2 A;  5E3L A;  2MC3 A;  1YOV B;  2K9M A;  4A3J J;  1KGS A;  3I59 B;  4E7H A;  2IW5 A;  1X4P A;  4QLC U;  1Z3Y A;  3I56 I;  1ETQ A;  2VJ4 A;  2M2E A;  3I54 A;  4DZJ A;  2L7F P;  3RI4 A;  2KP6 A;  5DCM A;  1B1B A;  3F8C A;  5JI6 A;  2GXA A;  2GAU A;  2Y2Z A;  4KIF A;  5H2F C;  4V2G A;  2M1B A;  4HG2 A;  2CU7 A;  3CP2 A;  4HSR A;  1PYV A;  5F04 A;  3M8E A;  4PFO A;  2F5E A;  4A3E J;  1IDZ A;  2DJN A;  2CUE A;  2V1D A;  2DA6 A;  2HOT A;  1BIA A;  2M7A A;  3QP5 A;  3VSL A;  3GTM J;  1SMT A;  3CUO A;  3OYL A;  4UXN A;  2CQQ A;  3CTA A;  4HOB A;  4XOR A;  1N78 A;  4B4C A;  5K5Q A;  4IVN A;  2QWW A;  2JA8 J;  1LE8 A;  1QZE A;  3HRS A;  4D1Q A;  1AWC A;  2YU3 A;  4A6E A;  3T0Y A;  5TRD A;  2GQQ A;  1OYY A;  4WWC A;  3F23 A;  2DOE A;  1RKW A;  5ICG A;  1KZH A;  1HLV A;  1JUP A;  1RPW A;  4I7H A;  3CCL I;  1YJ9 I;  3BR6 A;  4L18 B;  3TQN A;  2UXN A;  4Q47 A;  1TT5 B;  5BOX A;  1I1S A;  1PUF B;  1BM9 A;  3TMO A;  2K02 A;  3BG7 A;  3E1S A;  1GVJ A;  1T56 A;  2DA1 A;  5L3E A;  4C2T A;  4KNY A;  3WTT C;  4CO8 A;  2TDX A;  3DQV C;  1T0F C;  3FK6 A;  3OYF A;  2DQL A;  5ED4 A;  1DDN A;  2NS8 A;  2OQG A;  2KKO A;  4JX4 A;  1QPM A;  4MFD A;  3H5N A;  2FD5 A;  2X51 A;  3CC4 I;  2Y69 H;  4PJJ A;  1ZG5 A;  5GPA A;  3F0C A;  1RR7 A;  3M8F A;  3MFK A;  2M9H A;  1J59 A;  2CV2 A;  4YII A;  1YIT I;  1D0X A;  1LJ9 A;  1R7J A;  2VIX A;  5E1W A;  2A61 A;  3ABK H;  4PZJ A;  1MJ9 A;  1ZGJ A;  2XRL A;  4E4H A;  4IO9 F;  9ANT A;  1SD6 A;  2DA4 A;  1U8R A;  4E7K A;  1YJN I;  4BY1 J;  2H6B A;  2FNP A;  3CMM A;  4XBF A;  2L9V A;  4IRG A;  1QA6 A;  1R5I D;  2OAZ A;  5K7Z A;  5FLX K;  5L3B A;  1A6Q A;  5JHF A;  3BCB A;  5DCM B;  4GGG A;  5KAF C;  3F9K A;  4XKW A;  2AXT C;  3LSH A;  2RQP A;  1BOB A;  2RGV A;  2WAE A;  5E1Z B;  5FRO A;  3WTS C;  4B44 A;  4YIR X;  2KDZ A;  3CES A;  1DQU A;  2VBX A;  3TW6 A;  3CLQ A;  4DGW B;  2O9L A;  1JGS A;  2JSP A;  3OOP A;  1OCZ H;  3IL2 A;  5F08 A;  2OPT A;  1G8X A;  3IKT A;  2L7Z A;  2KRH A;  3N4M A;  4RB0 A;  1RI7 A;  1FLI A;  1W1W E;  4OIQ F;  1DPR A;  5LBQ A;  1YQA A;  3BTL A;  1SD4 A;  3MKW B;  5LGN A;  2CQK A;  3W6K B;  1RC9 A;  1S29 A;  4R79 A;  4A3L J;  4Y52 J;  1UJ8 A;  2XSJ C;  3K6G A;  1SFK A;  3JRD A;  1VF9 A;  2E2I J;  2GXB A;  2BYV E;  1TZL A;  3E5Q A;  3O2P E;  3BCA A;  2DPD A;  1WFX A;  3HXL A;  3ASO H;  3LAJ A;  1SFE A;  5HVQ C;  2GA2 A;  2QUF A;  1U3E M;  1BR2 A;  1WSU A;  3LSM A;  2XKO A;  3LA7 A;  3SZP A;  2VUM J;  2D1H A;  3FXU A;  2M7B A;  4HBL A;  5HLI A;  3OYG A;  4JP0 A;  2H09 A;  2ISZ A;  5JLW A;  3V7S A;  4M71 A;  3VWB A;  3CJR B;  4ZTF A;  1DP7 P;  1YIJ I;  2JPC A;  2KIF A;  3D5R C;  5H6R A;  3P7N A;  2WC2 A;  5FFZ A;  1HA8 A;  2AQE A;  1P4X A;  4I2O A;  4NNJ A;  3WU0 A;  1XGS A;  2DMT A;  4RB2 C;  1S72 I;  2KQR A;  3GTG J;  1IRF A;  2L0K A;  1UHM A;  3MD2 A;  4H4K C;  1P6R A;  2GIV A;  2H6C A;  2KMU A;  2QF7 A;  3DFG A;  1JT0 A;  1OCR H;  4AIH A;  1F36 A;  1FX7 A;  1XSV A;  3ABM H;  3IHU A;  4F92 B;  3JRC A;  2H8W A;  1TWG J;  4C2U A;  2R7O A;  1XGN A;  5DTD A;  2YX7 A;  2UV1 A;  1FP2 A;  3MVP A;  4U88 A;  2QSH X;  3ABU A;  1IDY A;  4KA4 A;  2VT2 A;  1YRN B;  2QVO A;  2VAS A;  2VOP A;  4M73 A;  1Y1W J;  6PAX A;  4CXF A;  1ZGA A;  2F48 A;  3CC7 I;  5HLH A;  2JA5 J;  3F8M A;  1ETK A;  3CO7 C;  1XG1 A;  1R00 A;  1B6A A;  1XPX A;  2F5C A;  2LOO A;  1IF1 A;  5J3L A;  2HYF A;  3S1R J;  2XV4 S;  4FAS D;  3N05 A;  1OCT C;  1W7P A;  3FMS A;  3IKV A;  1OPC A;  5F64 A;  3SXY A;  2KDO A;  1UEL B;  5F27 A;  2HEO A;  2BW3 A;  2MLK A;  1EH6 A;  2BEO A;  2FNA A;  4K2E A;  3OYE A;  1YW8 A;  3E6M A;  1U5T A;  2K3F A;  5K1Y A;  2VOD A;  3R0J A;  2JPB A;  1FBU A;  2KFD A;  3O8H A;  4G8X A;  2JZY A;  2OZU A;  2XAH A;  3KLN A;  1E17 A;  1J9I A;  2P4W A;  5BQT A;  5BMZ A;  2MA3 A;  2FBH A;  2WWY A;  4Y33 A;  4CYD A;  4Q48 A;  3CCV I;  1K7A A;  3A01 A;  3HM5 A;  2LG4 A;  2V1N A;  1AKH B;  2Z2S B;  4FE7 A;  3H9J A;  4IEJ A;  3U2R A;  3BTI A;  3J81 Z;  4I98 B;  2VB6 A;  3JAM Z;  1GXQ A;  4MEY F;  3DTI A;  2OJE D;  4NHJ A;  1OJL A;  3S93 A;  1JUS A;  3ZMS A;  2QQB A;  5J8C A;  3I58 A;  3K1N A;  3FHN A;  1XDS A;  2NYX A;  1I3Q J;  1IC8 A;  3KFW X;  4RLF A;  3J7Z I;  3I5U A;  5E18 F;  3HOW J;  3ONQ A;  1HSJ A;  4LFU A;  3CCU I;  5HOO A;  4J19 A;  1U8B A;  2KRC A;  2K9N A;  3GFM A;  1MW7 A;  4M6X A;  3NWT A;  3S14 J;  2L2O A;  2XB0 X;  1BC7 C;  2XGC A;  2JA7 J;  2PLY A;  2K4J A;  3I0T A;  3AG3 H;  2KJC A;  2D2W A;  4YRV A;  2NVX J;  1WQ2 A;  3VYT B;  4B09 A;  4CIC A;  3NQO A;  1ZTR A;  2JSC A;  1MBK A;  3S2H J;  2WA0 A;  2F2E A;  5E8I A;  4NC8 A;  2HI3 A;  1Z91 A;  3FM5 A;  4A3D J;  3OYH A;  1SC7 A;  4BEH A;  3SJM A;  5FD5 A;  3K70 D;  1HC8 A;  1IN7 A;  3ZQH A;  1F9N A;  3AFH A;  2CRG A;  3S3O A;  2J5P A;  2CG4 A;  1NTC A;  5EEG A;  4MEX F;  3BG9 A;  5HLT A;  4LMY A;  5D6F A;  5M3M J;  4RS8 A;  1ZGW A;  4Y15 A;  3ZGK A;  1LFP A;  4D0P A;  2O0Y A;  4AYB A;  4E7L A;  1MDM A;  5IT9 Z;  1CQT A;  2DK8 A;  2OUM A;  3BPX A;  3SDG A;  4RAY A;  4LG0 A;  3LFU A;  4BDY A;  1QBJ A;  1W7P B;  5M3F J;  2F6C A;  2ZSI B;  1SVM A;  4X1E A;  4UUS A;  1IAW A;  4DNC A;  3OYB A;  3A03 A;  2BW3 B;  2PMZ N;  5BS6 A;  5ICC A;  2WTE A;  1U5T B;  3DU5 A;  1HW2 A;  3F72 A;  1ERD A;  4RM2 A;  4LLN A;  2Q2E B;  2ICW G;  3CUQ A;  2V26 A;  3Q0U A;  3L7W A;  3HOS A;  3W2V A;  4LK1 F;  3ZQ7 A;  4KJZ A;  2IBD A;  3BQY A;  4HX8 A;  3MCZ A;  3A01 B;  1XCB A;  3QPT A;  2BY1 A;  1ITY A;  2ELJ A;  1FY7 A;  2L01 A;  2VPR A;  4HX4 A;  2QSG X;  3GF2 A;  2MSY A;  1U78 A;  3MKZ A;  1XSD A;  2R7R A;  4N0B A;  2HQA A;  3OYM A;  5IYD J;  1BW6 A;  2QM3 A;  3ZCO A;  5JVG F;  2OCE A;  4HNT A;  5B66 C;  2HYG D;  3C7J A;  5HDK A;  5B5E C;  1Z3X A;  4N4N B;  3ZN1 A;  5D8K B;  1Z1D A;  3GTO J;  1IN6 A;  1HST A;  4ENM A;  5K5R A;  1JT6 A;  4JX6 A;  3R4K A;  2O3F A;  1OLT A;  1MMG A;  4A3M J;  3RZD J;  1M1E B;  3WG9 A;  4Y7N J;  1G6N A;  3F8B A;  4JK1 X;  1R5H A;  2JTV A;  1Y8R B;  2V9V A;  3AL0 B;  2ZME C;  3VSK A;  4Z6Y A;  2O8X A;  4P96 A;  3ZMZ A;  1FMW A;  2DJI A;  4UVC A;  1BC8 C;  4MO7 A;  4BEH B;  1OCO H;  4RMN A;  5D4S A;  4PCQ A;  1B72 A;  5GAH J;  3SDB A;  1T95 A;  3CO6 C;  3FWE A;  5EJC A;  2IGM A;  1H8A C;  4XL9 A;  2E5Z A;  5C44 J;  1I39 A;  5IOY A;  3ZQG A;  1IXC A;  4QTR A;  4OIO F;  2RQQ A;  1MDM B;  5LRS A;  2XGX A;  2AS5 F;  2O03 A;  2DPU A;  5J1R A;  4LG0 B;  2M30 A;  2ZJR F;  2A5W A;  3G3Z A;  4UV8 A;  2V1X A;  1H88 C;  4UUS B;  2DMP A;  2PFB A;  2KJB A;  1Q1V A;  2VKD A;  1YW7 A;  1Z6R A;  4P9U A;  5IP6 A;  2WY7 Q;  4BHC A;  1TWF J;  3CUQ B;  3AG1 H;  1TP4 A;  1QPI A;  3F8N A;  3GXO A;  1D5V A;  1OYW A;  2X6X A;  1RUO A;  3RJP A;  2QA4 I;  1EF4 A;  1SD7 A;  5E20 A;  2W82 A;  3U1K A;  4WXC A;  2EK5 A;  1P7I A;  5HS8 A;  5KAI C;  3JAM K;  2H1L A;  3GLX A;  2HKO A;  2ZME B;  3H9G A;  1USS A;  3PNY A;  4HDU A;  4LG3 A;  4CA0 A;  5C4X J;  1OQY A;  1TC3 C;  1MJA A;  3RQI A;  4CCN A;  1WI9 A;  2VQL A;  1RR8 C;  1GVD A;  1MBH A;  2F5F A;  2Z3Y A;  1MBE A;  1POG A;  1S7A A;  1DGW Y;  4F52 A;  2A6E F;  1A36 A;  2ISY A;  3W6J B;  3EPZ A;  2L02 A;  3VPR A;  3L1P A;  4DZP A;  2QGU A;  3ZQI A;  5D5U B;  3FIS A;  2R5Z A;  3LL7 A;  2O7O A;  3WE3 A;  4Y17 A;  5HNF A;  4MNU A;  1TQM A;  3QOE A;  5B3S H;  2NVU B;  4FHT A;  3OOU A;  1S6L A;  1X1B A;  3FIW A;  4RDU A;  2GXG A;  4Q4Z F;  2HVS A;  4YFX F;  3NAU A;  2DO7 A;  3RPU A;  1ZG1 A;  1HF0 A;  2W84 A;  4XOT A;  1GHC A;  2ID6 A;  3OWT A;  4IJA A;  4RB3 C;  2VKH A;  5LHH A;  2HDD A;  3A02 A;  3SEZ A;  2JMW A;  3KEY A;  1B72 B;  2VQG A;  1FOX A;  4LD5 A;  3L2U A;  1ZR4 A;  1FTT A;  1MBJ A;  5ICE A;  2IS4 A;  3CCS I;  1Z77 A;  4BS9 A;  1P4A A;  3BG3 A;  3JRH A;  1BA5 A;  4AID A;  1CF7 A;  3HOY J;  3FF5 A;  3KCC A;  1T38 A;  1BW5 A;  5HDN A;  4KN7 X;  2COB A;  1WGX A;  2EIL H;  2QQ8 A;  4WXH A;  5DV5 A;  2R5Y B;  4N9H A;  2WB1 N;  3HEF A;  3B73 A;  4NUB A;  4M3E A;  4ZYH A;  2RVC A;  3HOZ J;  1GLN A;  1R58 A;  1YI2 I;  5IT3 A;  4A3G J;  1JHF A;  4BQA A;  2VBZ A;  4HZF A;  1HKQ A;  2V79 A;  3DPT A;  3LOC A;  2LY9 A;  3PJR A;  1KA8 A;  2MW8 A;  4HX7 A;  2VN2 A;  3VYU B;  3CCR I;  3D5S C;  3IP4 B;  4KFC A;  3I9V 2;  3GEZ A;  1KQ8 A;  4RBO A;  4D5C A;  2MAB A;  3WTY C;  2VC1 A;  4BHB A;  4IHV A;  3ZOB A;  4XRS G;  3FK7 A;  4P1W A;  3S1M J;  2EZK A;  4LB6 B;  2P5K A;  1U6G A;  1EA3 A;  2IXS A;  2LDU A;  1J75 A;  4GDF A;  2I8D A;  1FSE A;  2XGE A;  4ZZD A;  3CQZ J;  5IP9 J;  2CW7 A;  2VXZ A;  4QIW N;  1FBQ A;  2R3S A;  1X3U A;  4F93 B;  1VND A;  4ZYE A;  1WJD A;  1R1T A;  1T2K A;  3JRB A;  2R5Z B;  2ME6 A;  3UR3 C;  4E7Z A;  2CW8 A;  4BBR J;  4LJZ F;  2FML A;  4EGZ A;  1Z0X A;  2DDA A;  1XMX A;  4XKV A;  1Y0N A;  4BYY A;  1XB4 A;  1WJE A;  2K86 A;  1JKP C;  5LD2 C;  2DAO A;  2QLZ A;  4ENN A;  5FKL A;  2NNN A;  1ZKG A;  3VYR B;  2UZK A;  2EQR A;  2VE9 A;  3DV8 A;  3L00 A;  4FT8 A;  3T1B A;  2F4I A;  4B3A A;  4BL0 B;  1D8K A;  2CW0 F;  4CCL A;  1K61 A;  1ZK8 A;  2JRT A;  5D6E A;  4ZC3 A;  4XR6 A;  4O6J A;  3OL3 A;  1T8I A;  3PUB A;  5J40 A;  2R7Z J;  2DK5 A;  4XM3 A;  3LST A;  1WKM A;  1ZLK A;  3RKX A;  4X6A J;  4HW0 A;  1CF7 B;  2ZJQ F;  4HYE A;  4EM2 A;  1BI2 A;  4BE0 A;  4ZYD A;  4HLY A;  4A3K J;  3KP3 A;  3LSI A;  4CH7 A;  2GLO A;  4BXX J;  4B8X A;  4OU0 A;  4QWQ A;  3S2D J;  3F3X A;  2KT0 A;  2JK3 A;  2R7X A;  2X4H A;  2V1U A;  1PVE A;  3WTU C;  1V4R A;  5KVR A;  3ZQC A;  3DLL F;  3CZ6 A;  1IV8 A;  2Z16 A;  3GFJ A;  3DPL C;  4DYR A;  2NOJ B;  3K4B A;  3NRV A;  1O3S A;  5D8L B;  3VEP A;  1G2H A;  1X3Z B;  3TOB A;  3JSO A;  1QNT A;  2ZBK A;  1UG2 A;  5CPR B;  2E1C A;  2B63 J;  3EYI A;  1V3F A;  3M07 A;  2ZXH A;  3G73 A;  1RKT A;  1IG7 A;  3BTJ A;  4CSW A;  2XIG A;  3CDH A;  4BAY A;  2LK2 A;  1SVO A;  1XSX A;  2NOG A;  4BUP A;  4E70 A;  3PL8 A;  4L9T A;  5FKM A;  2NVY J;  4OOI A;  4Y3O A;  3W2W A;  3OYI A;  1W5C C;  2JN6 A;  4OMZ A;  1S7O A;  3GZ5 A;  4A12 A;  4AC0 A;  4XRS A;  4C3H J;  2FSW A;  3TO7 A;  4P5O A;  2IEK A;  2DT5 A;  5ILU A;  2DYR H;  5D5W B;  4EJU A;  1VQ8 I;  1EJ9 A;  1L0O C;  5EEH A;  3M1C A;  4G7H F;  2E2H J;  2LLK A;  3FHZ A;  2ZXW H;  2H94 A;  3PUF A;  1ON1 A;  2BVL A;  2BY2 A;  2O61 A;  4HAM A;  1UG0 A;  3ABT A;  3ZQL A;  2VON A;  4OWR B;  4ENK A;  5LEJ A;  2GOM A;  2IP2 A;  2LNB A;  3GVA A;  3K4K A;  5FRM A;  4HDV A;  2IAI A;  5EZH A;  4KDP A;  2LBF A;  5E79 C;  2NRA C;  1YTY A;  5FFX A;  1FOY A;  1KU3 A;  4BE1 A;  4B3X A;  3KE2 A;  5F0H A;  1QU3 A;  3ZQF A;  2VJ5 A;  4GCV A;  1XMK A;  2PN6 A;  3P9C A;  5E17 F;  4ZDL A;  5EYR A;  4C3I J;  2GA1 A;  3HC7 A;  3O6B B;  2K9Q A;  2QCO A;  3PFI A;  1JE8 A;  1H0M A;  1HW5 A;  2KL4 A;  4UVA A;  3S1Q J;  5CJ9 A;  5GAG J;  4CCO A;  2X48 A;  1U9N A;  1PP8 F;  4D7N A;  3P9I A;  3LA3 A;  4MQ9 F;  1UCR A;  1MKM A;  4LLL A;  3W2A A;  2IA1 A;  3BZK A;  3ECH A;  1FOW A;  3F6O A;  1I6X A;  3KPH A;  2CSO A;  3PNT A;  3S8P A;  5M5X J;  4GFB A;  2L9N A;  3WOD F;  1E0E A;  4A0Z A;  1QZZ A;  2DMN A;  3LSG A;  4HF0 A;  4JOM A;  3DKX A;  4LLG F;  1VZ0 A;  3IWZ A;  3I4M J;  3C3W A;  1G59 A;  1BR1 A;  3ISP A;  5KNL A;  2F4M B;  2FOK A;  2FOW A;  1SD5 A;  2TCT A;  1XCV A;  3Q0V A;  4PUS A;  4DYC A;  2E34 A;  3QRF F;  1O7F A;  2EZH A;  5TJJ A;  2OU2 A;  2FBI A;  2DCE A;  3VFZ A;  4YIF A;  3HOU J;  1BJA A;  3EUH A;  2E7X A;  5EEA A;  1ZN2 A;  2B0L A;  1LUJ B;  1ZAR A;  3OY9 A;  4XSZ F;  2M0M A;  2AO9 A;  3TGN A;  1MMN A;  3CJN A;  1SFU A;  1ETW A;  1D5Y A;  3CC2 I;  2DW4 A;  1KU9 A;  3ROU A;  2ELK A;  2HKX A;  4MQV A;  5HLG A;  4IX7 A;  2V6E A;  1X2M A;  3DTE A;  4YFN F;  1LE8 B;  1QO0 D;  2EIN H;  2L5Q A;  2X85 A;  3HKZ A;  2WV0 A;  2ECC A;  2HQN A;  3I3L A;  3HPH A;  2CH0 A;  1V5G A;  1FYM A;  3L2Q A;  2YU9 J;  3FX3 A;  5LEK A;  4LGW A;  3ML6 A;  3TP0 A;  5D5V B;  1DU0 A;  4GRI A;  1B8I A;  2QKL B;  3QYB A;  4AU7 A;  2LBF B;  1G3S A;  5GTH C;  2JQ7 A;  3KP6 A;  4MHG A;  3JRI A;  2E1O A;  5FKN A;  3DKW A;  2R7W A;  3FXL A;  2DT6 A;  2VL8 A;  2WAQ A;  5FO5 A;  4JQF A;  4XSX F;  4HEA 2;  1SAU A;  2P7V B;  2DOF A;  5BPI A;  3BG5 A;  3HSF A;  5EDN A;  3JSP A;  3M7G A;  2LKX A;  2KIU A;  4U0W A;  4B43 A;  1G4D A;  2XPW A;  3GZN B;  3TW7 A;  1E3P A;  3KZI C;  3VOD A;  2JT1 A;  3WHB A;  2ACJ A;  2F5D A;  4L5J A;  3HIF A;  2J5O A;  3L2V A;  4NC6 A;  1A6I A;  3DLA A;  4EEF G;  1Z21 A;  3JRA A;  4BH9 A;  5DM7 F;  2KZV A;  1RUN A;  1JTX A;  4I76 A;  1MH4 A;  1SFX A;  2M3A A;  3DPU A;  3LFK A;  4UB8 C;  4XLN F;  1IRX A;  3E0J B;  1W0U A;  4IHW A;  3KET A;  4C2M J;  2C6Y A;  2RNJ A;  3I53 A;  3P5J A;  3ZXS A;  2ETH A;  3PSI A;  4ASN A;  3UNG C;  3ULQ B;  5TGT A;  2HQ5 A;  1D0Y A;  3KP7 A;  3HOV J;  1BI0 A;  3OL4 A;  4XLH A;  5HS9 A;  2EIJ H;  2CS3 A;  1IXR C;  2DFE A;  4G9Y A;  5F1R A;  3WTZ A;  3F22 A;  2VC0 A;  1W4M A;  3F8F A;  2ZNZ A;  3V8J A;  3FXJ A;  3IC7 A;  2HXO A;  3DBH B;  5CLS A;  1K78 A;  2L7M P;  3HOX J;  1QVT A;  3BT9 A;  3PFY A;  2M0C A;  1TTY A;  3G2B A;  3CCQ I;  3K0L A;  2YX4 A;  1XGO A;  1SMY F;  3MMY B;  3MZY A;  1ETY A;  5CVJ A;  4DBQ A;  2X6Y A;  5BPD A;  2DFI A;  2DQR A;  1L3L A;  2RRE A;  1MJB A;  5CVU A;  3OMY A;  2R0Q C;  2FMY A;  4D7M A;  1DUX C;  1ZQ3 P;  4A3B J;  1BN5 A;  2HDW A;  3LA2 A;  2K3P A;  4M9S A;  1MND A;  2GM4 A;  2K40 A;  4LIV A;  2M34 A;  2NXN B;  3IRR A;  1FZP B;  1B8I B;  2L54 A;  4Y13 A;  2BHY A;  3HYI A;  2DTR A;  1ODD A;  4CCJ A;  1V5F A;  3LSR A;  4I09 A;  2ZXI A;  5HNH A;  4AYB N;  1U5T C;  2FQ3 A;  1B4A A;  1XD7 A;  1U0J A;  2LP0 A;  2Z1D A;  2OTJ I;  3H3Z A;  4ZZL A;  2DTZ A;  2V9K A;  1LPQ A;  4KT5 C;  2HR3 A;  2MG4 A;  2H8R A;  2QEX I;  2Y30 A;  3AAF A;  1GV2 A;  4MTD A;  4KIG A;  2PX9 A;  2TRT A;  3LQR A;  3V42 A;  1FYL A;  1DU6 A;  1APL C;  2JWT A;  2STT A;  1JKR C;  1X2N A;  3CCY A;  4J01 A;  3FXK A;  4FX4 A;  2EWN A;  4ZJZ A;  2E36 A;  2G7H A;  1S3J A;  3E97 A;  3BWG A;  4PJM A;  5JHU A;  2VQC A;  3K10 A;  4L9V A;  2DFH A;  4YFK F;  5J4V A;  4B47 A;  1FEX A;  2P5V A;  1RNL A;  3BZ6 A;  3U9G A;  1KON A;  2ZFW A;  1Y8Q B;  1W36 D;  1TL8 A;  5IY5 H;  1EKE A;  2ZC2 A;  3AKZ A;  3E5X A;  2QQ9 A;  3K4M A;  4IHX A;  1HXD A;  2DXI A;  2HZT A;  1TW3 A;  1J2X A;  2F4O B;  2YUS A;  2M8G X;  3JCU C;  2KZG A;  5AIQ A;  2X6W A;  3G4S I;  2EIK H;  2FF4 A;  1BJZ A;  2BE5 F;  2O6G E;  4I0B A;  3HSE A;  1EH7 A;  3AL0 C;  2PMU A;  1OKR A;  2Y0S A;  1IW7 F;  1ETO A;  1KYW A;  4A3C J;  3H0D A;  4P55 A;  5DD4 A;  2E2J J;  1IRG A;  1LEA A;  3IV5 A;  2FBK A;  2AQF A;  1EH8 A;  4XNF A;  3RYR A;  2R7Q A;  1I6H J;  2G0E A;  5BNG A;  1MNE A;  1J5Y A;  3FZV A;  2STW A;  1NG6 A;  2MFZ A;  3CDI A;  1D8J A;  3EQL F;  5CQE A;  1S5L C;  4MIM A;  1VQ9 I;  2P7C B;  5GPC A;  3K4C A;  4CUG A;  1U2W A;  5D5X B;  3VB2 A;  3KYL A;  1VFC A;  2LYC A;  1G3Y A;  4XRF A;  1OR7 A;  5CVV A;  5E3N A;  1FTZ A;  5F1J A;  5DUI A;  3I4N J;  5J1Y A;  2DOD A;  2GWR A;  5AON A;  2EH3 A;  3L2W A;  1BI1 A;  4G6D A;  1MZB A;  1R71 A;  4HV5 A;  3OR1 C;  2IS6 A;  1Y39 A;  4BKX A;  1ZH5 A;  5ICF A;  3CUQ C;  1Y6I A;  1LVA A;  5EF6 A;  2QYO A;  3SYT A;  4DQ2 A;  5KHD A;  2LF8 A;  2FX0 A;  2R92 J;  4ZTJ A;  5DD8 A;  3NEU A;  4HNU A;  4XN0 A;  2XAF A;  2JRM A;  2EFQ A;  1YS7 A;  4D5F A;  1WJB A;  2PJR A;  4BJ5 C;  2ZO4 A;  3BZC A;  2XHK A;  2IA0 A;  3RSN A;  2MD0 A;  4RGU A;  3O3K A;  2MH2 A;  1B9N A;  1TNS A;  1ZYR F;  3CLO A;  3J7A O;  1OR7 C;  2EBI A;  4XLC A;  2K5C A;  4HQE A;  2Q1Z B;  5A2Q Z;  1OCP A;  4P9F A;  2O5R A;  4KMU X;  5L3F A;  1PP7 U;  3JRF A;  1WPK A;  2MC4 A;  3WGG A;  1WJF A;  5F0F A;  3CDL A;  2E19 A;  4BNC A;  3PSF A;  3PIP F;  4D9J A;  4L0Z B;  3HL2 A;  3M4O J;  1MMS A;  4LOC A;  4IHY A;  4PGG A;  4G7Z F;  1XN7 A;  2VQH A;  1PJR A;  4WXD A;  3L2C A;  1X1P A;  3SEQ A;  1FIP A;  5EG0 A;  3PQK A;  2VI6 A;  5FGM A;  4HST A;  1DGR M;  3ESW B;  4PJN A;  1ZG3 A;  1YJW I;  1T39 A;  1QQI A;  1QRY A;  1VQO I;  1E3O C;  4WCG A;  4IOC F;  3GLL A;  3MKL A;  1OIS A;  2EPF A;  1F4K A;  3DCF A;  2XPV A;  4AVP A;  5TIS C;  2HNH A;  1MMA A;  1W5T A;  4M3B A;  1Q1H A;  1AHD P;  2A5Y B;  2EIM H;  2UUZ A;  3EUK L;  2E1N A;  3SZG A;  2LD5 A;  3L09 A;  2FE3 A;  5D4R A;  2LFB A;  4FQG A;  4N4O B;  3GME A;  1ZR2 A;  4M72 A;  4O5V A;  2M8E A;  1TBX A;  2UXX A;  2HXI A;  2V9P A;  3K9T A;  2BY0 A;  4HV6 A;  4XMY A;  4IRH A;  3E6C C;  4OAY A;  3JRE A;  3GUD A;  1GXP A;  3G71 I;  4IQ4 A;  4HF2 A;  2CQ7 A;  2HVQ A;  2RDP A;  2XAQ A;  2FUG 2;  2M87 A;  4IHT A;  3GX4 X;  3L9F A;  3RKW A;  1VQ5 I;  5AIP A;  2KPM A;  2HZD A;  1R5G A;  1V54 H;  1MBG A;  3BDD A;  2VXD A;  1W5S A;  4EAT A;  2PJR B;  4PDK A;  4L5I A;  4ZDO A;  1NH3 A;  2JJ7 A;  2G7U A;  4GYG A;  1J7K A;  4W1U A;  3TO6 A;  4EJT A;  5JLX A;  1VTN C;  3G1O A;  2XGD A;  1FNN A;  3ECO A;  5L3D A;  4XKC A;  1MSF C;  2IRF G;  4YEJ A;  2WAF A;  1FC3 A;  1FOK A;  4U0Y A;  3QAH A;  5E1X A;  1RES A;  4BE2 A;  2E35 A;  4XON A;  2M45 A;  4FET A;  1B9M A;  4PSX A;  2EA4 A;  4XIC A;  1F43 A;  3BJ6 A;  2JVH A;  4MTE A;  3VDX A;  3ZPL A;  2FRH A;  4WX9 A;  2RV8 A;  1D1A A;  1K6Y A;  2JA2 A;  2W24 A;  3CMY A;  2K9S A;  4XLA A;  3C1D A;  2ZCW A;  4BBS J;  2LH9 A;  1PDN C;  3OYN A;  2X6O A;  2LKS A;  2XPU A;  3J80 Z;  2MH9 A;  4AIJ A;  4M9X A;  1TWC J;  2M5W A;  2OTL I;  5L3C A;  3PO3 J;  3GO5 A;  4CCM A; 
#chains in the Genus database with same CATH homology
 2R7D A;  3SHF A;  4EJO A;  3ZN0 A;  3HOT A;  1FPQ A;  3V4G A;  3I59 A;  5DEQ A;  4TV7 A;  3KP4 A;  4GXO A;  3KEQ A;  1HW1 A;  1ZRF A;  2P5L C;  3WTV C;  1YW9 A;  3RYP A;  2QQA A;  4JBA A;  4A0X A;  3DF8 A;  4L9N A;  3K2Z A;  1BI3 A;  2KRF A;  2PG4 A;  1T98 A;  3R61 A;  2Y48 A;  3GFI A;  2KIM A;  2YSR A;  1UST A;  1FT9 A;  3P9K A;  2K27 A;  2HTJ A;  2PBI A;  3N97 A;  2HS5 A;  2Q8K A;  3VOE A;  2LKP A;  5A2Q K;  1XMA A;  1STZ A;  4S04 A;  1O7L A;  1MD0 A;  1T6S A;  3MWM A;  1B59 A;  4EV0 A;  3ZP5 A;  5DYM A;  1SAX A;  1Z7U A;  3M9A A;  3RDI A;  2Q0O A;  3SZT A;  4EJV A;  3QOP A;  3B02 A;  3HRU A;  4RAZ A;  3T5X A;  1W7P D;  3FMR A;  3SFZ A;  1REP C;  5LLQ A;  1YS6 A;  2ZJ2 A;  2BBY A;  5E8G A;  3PQJ A;  2IVM A;  1F1Z A;  5HS7 A;  2L4M A;  5J6X A;  1ON2 A;  4AD9 A;  1Z05 A;  1D3Y A;  2OZ6 A;  1P92 A;  2VOO A;  3K69 A;  4WK8 F;  3V8K A;  2MD5 A;  3FM3 A;  1G3W A;  3GZ6 A;  4A5M A;  3JW4 A;  4BHP A;  1T0F A;  3HRM A;  1BIB A;  2BGC A;  1ULY A;  1Z6T A;  2ZNY A;  2OD5 A;  3REO A;  4A6D A;  4R1H A;  2H27 A;  2CGP A;  3ZMD A;  4XLP F;  1O3R A;  3FXQ A;  3I71 A;  3I64 A;  4U7B A;  2RC4 A;  1UHW A;  3BJA A;  4OMY A;  4EM0 B;  5FD6 A;  4L9J A;  4BXU A;  1NHA A;  4ESJ A;  4L0Y B;  4EQQ A;  1KYZ A;  3R6S A;  3KZZ A;  4KUM A;  4UHT A;  1LDD A;  2VBW A;  3J80 K;  3OV8 A;  1PUE E;  1FYK A;  3JTH A;  1G3T A;  1ONV A;  4WF2 A;  3TDU C;  4KMF A;  4G94 A;  1BBY A;  1RIO H;  3R0A A;  1LEB A;  2CYY A;  2ADU A;  1LB2 A;  4G6Q A;  1JHH A;  2L3D A;  1R22 A;  2OA4 A;  3BJO A;  4CDG A;  2A07 F;  2DU9 A;  2XKP A;  5HDG A;  1FWZ A;  3C18 A;  5FB2 A;  2D1V A;  4HLX A;  3MQ0 A;  4ZH4 F;  1A04 A;  1E2X A;  3ZMT A;  4MGR A;  3KEO A;  2Z99 A;  2ESH A;  2OQR A;  3E6B A;  3LWF A;  1YO5 C;  1O3Q A;  1HBX G;  1I5Z A;  2E7W A;  3MAJ A;  4RGR A;  2PI0 A;  1OYI A;  2A6H F;  2NAZ A;  1TQP A;  3U1D A;  2XAJ A;  2W25 A;  3KLO A;  3EDP A;  3QU6 A;  3HHG A;  1DPU A;  2LSO A;  1YFH A;  3S2W A;  1Z9C A;  2YPR A;  1HKT A;  3LQQ A;  4NB5 A;  3WU1 B;  3H92 A;  3BY6 A;  4ESB A;  3F21 A;  3MZH A;  4I02 A;  1I1G A;  3V7R A;  3WGI A;  2W85 A;  3DP7 A;  2QBY A;  3E5U A;  1IN4 A;  2EA2 A;  5ILV A;  2D45 A;  2A68 F;  1QZY A;  5CVR A;  2ZKZ A;  4CGZ A;  3HHH A;  2Q2E A;  1ZLJ A;  2IJL A;  1Y0U A;  2Z5U A;  4IF4 A;  4M74 A;  4YG2 F;  2P8T A;  1R36 A;  3TDZ C;  3F6V A;  1C0W A;  4UVB A;  4AIK A;  2EV5 A;  1IXS B;  3FXR A;  4R8H A;  3HTS B;  4Q5S F;  1P4W A;  4ZYG A;  3KP5 A;  4GO1 A;  4OIP F;  3T8T A;  1R1U A;  1TNT A;  4NQW A;  3JTG A;  3TKY A;  2FEZ A;  4UNO A;  2HDC A;  2CFX A;  1F5T A;  4S05 A;  2A3S A;  3T8R A;  1K6O A;  4CHU A;  1UFM A;  3RKY A;  5DCF A;  2COM A;  2Y75 A;  1IUY A;  4OIR F;  4EMS A;  2Z33 A;  3HSR A;  3V8L A;  2EV0 A;  4Z2Y A;  3DEU A;  4F7Z A;  1K78 B;  1XDU A;  3KZY A;  2QBY B;  1LDJ A;  3GW2 A;  4U7D A;  3D0S A;  1TLH B;  2RN7 A;  3E6D A;  2DI3 A;  2PEX A;  1YG2 A;  1LQ1 A;  3I4P A;  2EB7 A;  3ZMU A;  4KYW A;  5LGT A;  3IWF A;  2YR2 A;  2P6T A;  3BPV A;  3M1E A;  3WGH A;  3K1P A;  3FMQ A;  3QU3 A;  2P6S A;  1YLF A;  2ZME A;  4EGY A;  3QP6 A;  4LB5 A;  1TW2 A;  4O3M A;  2XVC A;  2W57 A;  2VE8 A;  4PGH A;  5KK1 A;  1K79 A;  5L3G A;  1ZRD A;  2XAG A;  5H20 A;  1IN8 A;  2IT0 A;  2A69 F;  1S8N A;  1YYV A;  1R1V A;  2FU4 A;  2MLG A;  1H9G A;  5J8F A;  4ETS A;  4M6Y A;  1TQI A;  2Z9O A;  4GYI A;  2XRN A;  4CZZ A;  1FBS A;  1LNW A;  4ENJ A;  2BV6 A;  2MBF A;  1MGT A;  1P2F A;  4UV9 A;  3Q5F A;  1EV7 A;  2XUB A;  3BOQ A;  3DXJ F;  2NNY A;  5ERI A;  3RTR A;  5K5O A;  2GZW A;  3RIR A;  1R23 A;  2VBY A;  4ON0 A;  4I0A A;  1KQ0 A;  4RGX A;  3HTU A;  4IRI A;  3KP2 A;  3GFL A;  5LGU A;  2IPQ X;  1KU2 A;  4AWX B;  3WTX C;  4U0V A;  2HWV A;  3EYY A;  5LHI A;  2HQR A;  4RGS A;  4G7O F;  3BP8 A;  2OBP A;  3J81 K;  2QZ8 A;  2LF7 A;  4N9I A;  2HFH A;  5JFR A;  5JVT A;  2ESN A;  4EM1 A;  2HTS A;  2AXL A;  1H9T A;  2DBB A;  2Y0M A;  3COA C;  5DDG A;  2CWE A;  2XRO A;  5H6Q A;  1CGP A;  2EJR A;  2K4B A;  4EVI A;  2K7L A;  1YIO A;  3ZMV A;  2VT3 A;  4IXA A;  2CO5 A;  3HRT A;  3Q9S A;  3Q9V A;  4A5N A;  2V6C A;  5LHG A;  3D5L A;  5F6F A;  1XGM A;  3IRQ A;  3E3V A;  5CVI A;  4KN4 X;  2EFO A;  5LRR A;  2FXA A;  1KQ9 A;  1RZ4 A;  1ZAO A;  3HUG A;  2EFW A;  1O3T A;  4IPA A;  5JR3 A;  1IN5 A;  3LAP A;  5IT9 K;  2EFN A;  1JXS A;  3K1M A;  4HF1 A;  2NS0 A;  4HA8 A;  4EJW A;  2PJP A;  2EV6 A;  3TOA A;  3H3U A;  2G9W A;  4UUV A;  4KIC A;  3SQN A;  4A0Y A;  3QPH A;  3ELK A;  2R7F A;  1O57 A;  4FX0 A;  4RB1 A;  1OMI A;  1I27 A;  3GYH X;  2L4A A;  5FLX Z;  1KU7 A;  3GWZ A;  2PQ8 A;  3EET A;  3WE2 A;  1LDK B;  1UB9 A;  2ZXJ A;  2FA5 A;  1ZRE A;  1FP1 D;  5ILS A;  1HKS A;  2EFP A;  3RPQ A;  2ELH A;  4M9Z A;  4ESF A;  1IZ1 A;  4I01 A;  1BOA A;  4KIB A;  5CYV A;  1FSH A;  4OIN F;  3WTW C;  2QEN A;  3TO9 A;  1WRJ A;  2IA2 A;  4A2U A;  2DLL A;  2UWM A;  2PMH A;  3R60 A;  3MEX A;  2RKH A;  1QGP A;  3ERE D;  1AOY A;  4HQM A;  4H0E A;  1ZRC A;  3BRO A;  4IHS A;  3V7C A;  1WWX A;  2HOE A;  2X0L A;  1HQC A;  1J0R A;  1ZHF A;  2XAS A;  2HGC A;  5DUK A;  4LK0 F;  2MC3 A;  1KGS A;  3I59 B;  2IW5 A;  4QLC U;  3RI4 A;  3I54 A;  5DCM A;  1B1B A;  3F8C A;  5JI6 A;  2GAU A;  4KIF A;  2M1B A;  3M8E A;  2F5E A;  2V1D A;  1BIA A;  3QP5 A;  1SMT A;  3CUO A;  4UXN A;  3CTA A;  4HOB A;  5K5Q A;  4IVN A;  2QWW A;  3HRS A;  1AWC A;  2YU3 A;  4A6E A;  3T0Y A;  5TRD A;  2GQQ A;  1OYY A;  4WWC A;  3F23 A;  5ICG A;  4I7H A;  4L18 B;  3TQN A;  2UXN A;  4Q47 A;  5BOX A;  1I1S A;  1BM9 A;  2K02 A;  1GVJ A;  5L3E A;  4KNY A;  3WTT C;  4CO8 A;  2TDX A;  3DQV C;  2DQL A;  5ED4 A;  1DDN A;  2OQG A;  2KKO A;  1QPM A;  1ZG5 A;  3M8F A;  3MFK A;  1J59 A;  4YII A;  1LJ9 A;  1R7J A;  5E1W A;  2A61 A;  4PZJ A;  1MJ9 A;  1ZGJ A;  1SD6 A;  1U8R A;  2H6B A;  2FNP A;  4XBF A;  4IRG A;  2OAZ A;  5FLX K;  5L3B A;  5DCM B;  4GGG A;  2RQP A;  2RGV A;  5E1Z B;  3WTS C;  2VBX A;  1JGS A;  3OOP A;  3IL2 A;  3IKT A;  3N4M A;  4RB0 A;  1RI7 A;  1FLI A;  4OIQ F;  1DPR A;  5LBQ A;  1YQA A;  1SD4 A;  5LGN A;  2CQK A;  3W6K B;  1S29 A;  4R79 A;  2GXB A;  2BYV E;  3E5Q A;  3O2P E;  2DPD A;  3LAJ A;  1SFE A;  5HVQ C;  2GA2 A;  2QUF A;  1U3E M;  1WSU A;  2XKO A;  3LA7 A;  3SZP A;  2D1H A;  3FXU A;  4HBL A;  5HLI A;  2H09 A;  2ISZ A;  3V7S A;  4M71 A;  1DP7 P;  2JPC A;  2KIF A;  5H6R A;  3P7N A;  2WC2 A;  5FFZ A;  1P4X A;  4I2O A;  3WU0 A;  1XGS A;  4RB2 C;  1IRF A;  1UHM A;  1P6R A;  2GIV A;  2H6C A;  3DFG A;  4AIH A;  1FX7 A;  1XSV A;  3IHU A;  1XGN A;  2YX7 A;  1FP2 A;  4U88 A;  3ABU A;  4KA4 A;  2VT2 A;  2QVO A;  2VOP A;  4M73 A;  6PAX A;  4CXF A;  1ZGA A;  5HLH A;  3F8M A;  3CO7 C;  1R00 A;  1B6A A;  2F5C A;  1IF1 A;  2HYF A;  2XV4 S;  3FMS A;  1W7P A;  3IKV A;  1OPC A;  5F64 A;  3SXY A;  2HEO A;  2MLK A;  1EH6 A;  2BEO A;  2FNA A;  4K2E A;  1YW8 A;  3E6M A;  1U5T A;  5K1Y A;  2VOD A;  3R0J A;  2JPB A;  1FBU A;  4G8X A;  2JZY A;  2OZU A;  2XAH A;  3KLN A;  1E17 A;  1J9I A;  2P4W A;  5BQT A;  5BMZ A;  2MA3 A;  2FBH A;  2WWY A;  4CYD A;  4Q48 A;  1K7A A;  3U2R A;  3J81 Z;  4I98 B;  3JAM Z;  1GXQ A;  4MEY F;  4NHJ A;  3ZMS A;  2QQB A;  5J8C A;  3I58 A;  3K1N A;  1XDS A;  2NYX A;  3KFW X;  3I5U A;  5E18 F;  1HSJ A;  4LFU A;  5HOO A;  3GFM A;  4M6X A;  1BC7 C;  2PLY A;  2K4J A;  3I0T A;  2KJC A;  2D2W A;  1WQ2 A;  4B09 A;  4CIC A;  3NQO A;  2JSC A;  2F2E A;  5E8I A;  3FM5 A;  1Z91 A;  5FD5 A;  1IN7 A;  1F9N A;  2J5P A;  2CG4 A;  4MEX F;  5EEG A;  4LMY A;  5D6F A;  4RS8 A;  4Y15 A;  4D0P A;  2O0Y A;  5IT9 Z;  1MDM A;  2DK8 A;  3BPX A;  4RAY A;  4LG0 A;  1QBJ A;  1W7P B;  1IAW A;  4DNC A;  5BS6 A;  5ICC A;  2WTE A;  1U5T B;  1HW2 A;  3F72 A;  4LLN A;  3CUQ A;  3L7W A;  3HOS A;  4LK1 F;  3ZQ7 A;  4HX8 A;  3MCZ A;  1XCB A;  3QPT A;  1FY7 A;  2L01 A;  4HX4 A;  3GF2 A;  1U78 A;  1XSD A;  4N0B A;  2QM3 A;  2HYG D;  3C7J A;  5HDK A;  3ZN1 A;  5D8K B;  1Z1D A;  1IN6 A;  1HST A;  4ENM A;  5K5R A;  3R4K A;  2O3F A;  3WG9 A;  1G6N A;  3F8B A;  4JK1 X;  1R5H A;  2JTV A;  2V9V A;  2O8X A;  4P96 A;  3ZMZ A;  4UVC A;  1BC8 C;  5D4S A;  4PCQ A;  3CO6 C;  3FWE A;  1IXC A;  4OIO F;  1MDM B;  5LRS A;  2XGX A;  2AS5 F;  2O03 A;  2DPU A;  4LG0 B;  2M30 A;  3G3Z A;  4UV8 A;  2V1X A;  2PFB A;  2KJB A;  1YW7 A;  1Z6R A;  4P9U A;  4BHC A;  3CUQ B;  3F8N A;  3GXO A;  1D5V A;  1OYW A;  1RUO A;  3RJP A;  1SD7 A;  5E20 A;  4WXC A;  2EK5 A;  5HS8 A;  3JAM K;  3GLX A;  2HKO A;  2ZME B;  4HDU A;  1USS A;  1MJA A;  1WI9 A;  2Z3Y A;  2F5F A;  1S7A A;  2A6E F;  2ISY A;  3W6J B;  2L02 A;  5D5U B;  3WE3 A;  4Y17 A;  4MNU A;  1TQM A;  4FHT A;  1S6L A;  2GXG A;  4Q4Z F;  4YFX F;  2DO7 A;  3RPU A;  1ZG1 A;  2W84 A;  1GHC A;  4IJA A;  4RB3 C;  5LHH A;  4LD5 A;  5ICE A;  1P4A A;  1CF7 A;  3FF5 A;  3KCC A;  1T38 A;  5HDN A;  4KN7 X;  5DV5 A;  4WXH A;  4N9H A;  3B73 A;  4ZYH A;  2RVC A;  1R58 A;  5IT3 A;  1JHF A;  4BQA A;  2VBZ A;  4HZF A;  1HKQ A;  2V79 A;  3DPT A;  1KA8 A;  4HX7 A;  2VN2 A;  4KFC A;  3GEZ A;  1KQ8 A;  3WTY C;  2VC1 A;  4BHB A;  4LB6 B;  2P5K A;  1U6G A;  2LDU A;  1J75 A;  1FSE A;  4ZZD A;  2VXZ A;  1FBQ A;  2R3S A;  1X3U A;  4ZYE A;  1T2K A;  1R1T A;  4LJZ F;  2FML A;  4EGZ A;  4BYY A;  1XB4 A;  2K86 A;  2DAO A;  2QLZ A;  4ENN A;  2NNN A;  2UZK A;  2VE9 A;  3DV8 A;  3L00 A;  4FT8 A;  3T1B A;  1D8K A;  2CW0 F;  2JRT A;  5D6E A;  4O6J A;  2DK5 A;  3LST A;  1WKM A;  1ZLK A;  3RKX A;  4HW0 A;  1CF7 B;  4HYE A;  4EM2 A;  1BI2 A;  4ZYD A;  4HLY A;  3KP3 A;  4B8X A;  4OU0 A;  4QWQ A;  3F3X A;  2X4H A;  2V1U A;  3WTU C;  1V4R A;  5KVR A;  3GFJ A;  3DPL C;  3NRV A;  1O3S A;  5D8L B;  3VEP A;  3TOB A;  3JSO A;  1QNT A;  2ZBK A;  2E1C A;  3EYI A;  1V3F A;  3G73 A;  2XIG A;  3CDH A;  4BAY A;  1XSX A;  4E70 A;  4L9T A;  4OOI A;  4OMZ A;  1S7O A;  3GZ5 A;  4A12 A;  2FSW A;  3TO7 A;  4P5O A;  2DT5 A;  5ILU A;  5D5W B;  4EJU A;  1L0O C;  5EEH A;  4G7H F;  3FHZ A;  2H94 A;  1ON1 A;  2O61 A;  4HAM A;  3ABT A;  2VON A;  4ENK A;  5LEJ A;  2IP2 A;  2LNB A;  3GVA A;  4HDV A;  4KDP A;  2NRA C;  1YTY A;  5FFX A;  1KU3 A;  3KE2 A;  4GCV A;  1XMK A;  2PN6 A;  3P9C A;  5E17 F;  2GA1 A;  3O6B B;  3PFI A;  1JE8 A;  1H0M A;  1HW5 A;  4UVA A;  5CJ9 A;  1PP8 F;  3P9I A;  3LA3 A;  4MQ9 F;  1UCR A;  1MKM A;  4LLL A;  2IA1 A;  3ECH A;  3F6O A;  1I6X A;  2CSO A;  3WOD F;  4A0Z A;  1QZZ A;  4HF0 A;  4LLG F;  3IWZ A;  3C3W A;  3ISP A;  2FOK A;  1SD5 A;  3QRF F;  1XCV A;  1O7F A;  5TJJ A;  2OU2 A;  2FBI A;  3VFZ A;  4YIF A;  1BJA A;  3EUH A;  2E7X A;  1ZN2 A;  2B0L A;  1ZAR A;  4XSZ F;  3TGN A;  3CJN A;  1SFU A;  2DW4 A;  1KU9 A;  3ROU A;  2HKX A;  4MQV A;  5HLG A;  4YFN F;  1QO0 D;  2WV0 A;  2HQN A;  1FYM A;  3FX3 A;  5LEK A;  4LGW A;  3ML6 A;  5D5V B;  1G3S A;  3KP6 A;  4MHG A;  3DKW A;  5FO5 A;  4JQF A;  4XSX F;  5BPI A;  2P7V B;  3HSF A;  3JSP A;  3M7G A;  2KIU A;  4U0W A;  1G4D A;  3VOD A;  2JT1 A;  2ACJ A;  2F5D A;  4L5J A;  3HIF A;  2J5O A;  4BH9 A;  1RUN A;  1SFX A;  4XLN F;  3LFK A;  3KET A;  2C6Y A;  2RNJ A;  3I53 A;  2ETH A;  4ASN A;  3ULQ B;  3KP7 A;  1BI0 A;  5HS9 A;  4G9Y A;  1IXR C;  5F1R A;  3F22 A;  3WTZ A;  2VC0 A;  1W4M A;  3F8F A;  2ZNZ A;  3V8J A;  3IC7 A;  5CLS A;  1K78 A;  1TTY A;  3K0L A;  2YX4 A;  1XGO A;  1SMY F;  3MZY A;  5CVJ A;  5BPD A;  2DFI A;  2DQR A;  1L3L A;  1MJB A;  5CVU A;  2FMY A;  1DUX C;  1BN5 A;  3LA2 A;  4M9S A;  3IRR A;  1FZP B;  2L54 A;  4Y13 A;  3HYI A;  2DTR A;  1ODD A;  4I09 A;  1U5T C;  2FQ3 A;  1B4A A;  1XD7 A;  3H3Z A;  4ZZL A;  4KT5 C;  2HR3 A;  3AAF A;  4MTD A;  4KIG A;  3LQR A;  1FYL A;  2STT A;  4FX4 A;  2EWN A;  2G7H A;  1S3J A;  3E97 A;  3BWG A;  5JHU A;  4YFK F;  4L9V A;  2P5V A;  1RNL A;  3BZ6 A;  3U9G A;  2ZFW A;  3E5X A;  2QQ9 A;  1HXD A;  2HZT A;  1TW3 A;  1J2X A;  5AIQ A;  2FF4 A;  2BE5 F;  2O6G E;  4I0B A;  3HSE A;  1EH7 A;  2PMU A;  1OKR A;  1IW7 F;  1KYW A;  4P55 A;  5DD4 A;  1IRG A;  1LEA A;  2FBK A;  1EH8 A;  3RYR A;  1J5Y A;  3FZV A;  2STW A;  1D8J A;  3EQL F;  2P7C B;  1U2W A;  5D5X B;  3VB2 A;  1G3Y A;  4XRF A;  1OR7 A;  5CVV A;  5DUI A;  2GWR A;  5AON A;  1BI1 A;  4G6D A;  1MZB A;  4HV5 A;  1ZH5 A;  5ICF A;  3CUQ C;  1LVA A;  2QYO A;  4DQ2 A;  2LF8 A;  5DD8 A;  3NEU A;  2XAF A;  2EFQ A;  1YS7 A;  2ZO4 A;  2XHK A;  2IA0 A;  4RGU A;  3O3K A;  2MH2 A;  1B9N A;  1TNS A;  1ZYR F;  3CLO A;  3J7A O;  4HQE A;  5A2Q Z;  4P9F A;  4KMU X;  5L3F A;  1PP7 U;  3WGG A;  4BNC A;  4L0Z B;  4PGG A;  4G7Z F;  1XN7 A;  3L2C A;  4WXD A;  3PQK A;  5FGM A;  1ZG3 A;  1T39 A;  1QQI A;  4WCG A;  1F4K A;  4AVP A;  1W5T A;  1Q1H A;  2A5Y B;  2E1N A;  3L09 A;  2FE3 A;  5D4R A;  4M72 A;  4O5V A;  2M8E A;  1TBX A;  2UXX A;  3K9T A;  4HV6 A;  4IRH A;  3E6C C;  3GUD A;  1GXP A;  4HF2 A;  2RDP A;  2XAQ A;  2M87 A;  4IHT A;  3GX4 X;  3L9F A;  3RKW A;  5AIP A;  1R5G A;  3BDD A;  1W5S A;  4PDK A;  4L5I A;  3TO6 A;  2G7U A;  4GYG A;  1J7K A;  4EJT A;  1VTN C;  1FNN A;  3ECO A;  5L3D A;  2IRF G;  1FC3 A;  1FOK A;  4U0Y A;  3QAH A;  5E1X A;  2M45 A;  1B9M A;  2EA4 A;  3BJ6 A;  3ZPL A;  4MTE A;  2FRH A;  4WX9 A;  2RV8 A;  2W24 A;  3C1D A;  2ZCW A;  1PDN C;  3J80 Z;  2MH9 A;  4AIJ A;  4M9X A;  2M5W A;  5L3C A;  3GO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...