1R71A

Crystal structure of the dna binding domain of korb in complex with the operator dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
EADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*(BRU)P*TP*TP*TP*AP*GP*CP*GP*GP*CP*TP*AP*AP*AP*AP*G)
publication title Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 41
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08535 KorB KorB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A KorB DNA-binding domain 1r71A01
1R71A
chains in the Genus database with same CATH superfamily
5M5WJ 1VQ4I 2ADUA 3KZYA 4Q4ZF 2HS5A 1PJRA 2CUJA 1N78A 5HS8A 5JI6A 1ZG1A 4M6VA 5LHHA 1R1TA 4G9YA 2DJIA 1LFUP 5ILSA 3CUOA 3S15J 1J09A 2M87A 2E1MB 2BZTA 2DOEA 3HRMA 3HYIA 2PMHA 2LKSA 4I0BA 4LIUA 2H6CA 1XC5A 3HOUJ 4HPQA 2DOAA 4NHJA 3K4MA 3G1LA 2DA5A 3CCUI 1DU6A 1BIAA 3S3OA 4UUSA 3BPVA 1FSEA 3S8PA 3BR5A 3H3VK 2OUMA 4Y15A 1MBHA 3GXOA 5HS9A 3LSHA 1Y1VJ 1CF7B 3BCBA 2O3FA 1TQMA 3EUHA 4IHTA 3R61A 3I4NJ 5BOXA 2BY2A 3LSPA 1MDMB 2IT0A 3K1NA 2Y2ZA 4ZTJA 3GVAA 4AYBN 3G6EI 2R5YA 1MBGA 2XAJA 1RESA 3BR1A 5J8CA 4B8XA 4I0AA 1I3QJ 2F4IA 2R3SA 1NK2P 2NOJB 4ZZLA 2GZWA 4BY7J 5J4VA 3RZOJ 3OS1A 1SAXA 2DK5A 5JHUA 2HZDA 1QPMA 3HTSB 4BQAA 2AS5F 4Y3OA 2O8KA 1FT9A 3V7CA 2PLYA 4BE2A 3A1YA 4EV0A 1AU7A 4C2TA 4N0BA 1ETXA 1VI0A 1UFMA 3ABLH 3PNYA 4QLCU 5J1UA 4ZDPA 2HQAA 4D1QA 3S1NJ 2E2IJ 1L3LA 1FSHA 4AIHA 1OYIA 5LHGA 3BOQA 4CYCA 5GPCA 1R36A 3QYEA 4PSWA 2V1NA 1HF0A 1U8RA 2ZJQF 3E6BA 1XB4A 2YX4A 3QWLA 3H5RA 4YIFA 4KYWA 4UNOA 1OYWA 1ZRFA 2GXBA 5EZGA 1ZR2A 5LGNA 1OCCH 1TTYA 9ANTA 3BG7A 2IGKA 2JUGA 2TCTA 5DD4A 4FQGA 4CUGA 3J7YJ 2ZJ2A 2QBYB 3GZ5A 4HA8A 4UUSB 1Q1HA 2WA0A 3D5SC 5E1ZB 3FF5A 4QIWN 2CW7A 1I6HJ 3KZIC 3M8FA 4M74A 2MA3A 4PJLA 2LP0A 5HLTA 2NS0A 1MNDA 3OYCA 2KZGA 1V5EA 2VPRA 1IN5A 2HKOA 1E2XA 2VLAA 5DDGA 2A5YB 1Z67A 4D5CA 3NARA 3MVPA 4IZZA 1IV8A 2XAHA 4U0WA 4LLNA 1WJBA 3F3XA 1E3OC 2XAFA 2CW0F 3S1QJ 1KZHA 2K85A 3CO6C 1OFCX 2K27A 4RAYA 4XOTA 3ZQIA 5EF6A 3KZZA 3KYDB 5J3LA 1KQ0A 1BC7C 3PFIA 3FWEA 2LR8A 1YIJI 2R5ZA 2LYCA 4BEHA 1W36C 2PJRA 1I6XA 5DTDA 2DODA 4OIRF 2ISYA 3ECOA 5ERIA 2KDZA 3C1DA 2F5FA 3VYRB 1PYVA 3FHNA 3A01A 1V5GA 5ILVA 4AC0A 5GADJ 3DPUA 4CYCB 1K79A 2CJJA 3LSIA 4KIBA 4XRSG 4YRVA 4K2EA 3AFHA 3LSRA 2X48A 5A2QZ 1LFPA 3D1NI 4TV7A 3JRDA 5HODA 3HHHA 1JKOC 5F64A 4M9XA 4EGYA 1D8JA 3OYFA 3E5QA 1J9IA 2WTEA 4E7JA 1AA7A 4XRMA 1K78A 3QOPA 1ZGWA 3TOAA 2FXAA 3Q5FA 5FRNA 4L5JA 2PN6A 3BTCA 2ECBA 4HDUA 1GUUA 3H9JA 2UXNA 3HPHA 4C3JJ 1P92A 2KIQA 3OYKA 1H9TA 1WHUA 2HVRA 2H09A 3DKWA 5D5WB 1QZEA 4RB3C 2JN6A 2KL4A 3S17J 1G3WA 2L02A 1FYLA 2KKOA 2NYXA 2PMZN 3HOZJ 1G3SA 4CXFA 2XGDA 2EILH 4S0HB 1T98A 3G73A 2UZKA 2KT0A 4BJTA 2GM4A 2DCEA 4ABZA 1WH7A 2ZXWH 1S7OA 4KICA 1X2NA 3VYUB 1HDPA 3BP8A 1R5ID 2HXOA 4RB1A 2VXZA 2WY7Q 1RPWA 1R4NB 4KT5C 1I5ZA 4U87A 1W1WE 4DZJA 5FKKA 1OPCA 1SFEA 2HXIA 3OMYA 2JA7J 1W7PD 4RM2A 4CH7A 3OIQA 1K4TA 2JVHA 2BW3A 2NVYJ 1JHFA 4CA0A 2E1CA 3ULQB 1FTTA 1J7KA 4N4NB 3A4CA 3PQJA 1HDDC 4UV9A 5EGOB 3Q0VA 4GGGA 2HYJA 3OSGA 3CMYA 1XN7A 3VWBA 4Z6YA 4UUVA 5D4SA 1XGMA 1TLHB 4J01A 3ZGKA 3HGGA 1PP7U 1D0ZA 3CJNA 1GVDA 2EFNA 2W4SA 2VN2A 2XSDC 3ML6A 4B43A 1XG1A 2V9PA 3BWGA 1VQ5I 1E0EA 1MBKA 3B02A 1K4SA 5HNFA 3M1CA 2HQNA 1R5HA 4OWRB 3ROUA 2QKMB 3ZN0A 4RGUA 3X2QH 1F5TA 3EYYA 5F6FA 2MSYA 3JRBA 2Y9YA 3QU6A 3L7WA 3O8GA 2RNGA 2VQLA 3DWLE 3HB9A 4A69C 5HVQC 3QYFA 3OSFA 3LMMA 4EGZA 3BG9A 2RN7A 2FBKA 1ITYA 1DGRM 3K4LA 3E0JB 3N05A 2P6SA 5BMZA 5CKTA 1ZREA 1Y39A 2W84A 1T38A 2VKVA 5EJCA 2ACJA 3OL4A 3E97A 5JVGF 2ECCA 5FLMJ 4RBOA 5D4RA 4C3HJ 3HUGA 5DD8A 3RQIA 5LHIA 1SFUA 4BS9A 2E5ZA 3DPLC 2ESHA 3CDLA 1LJ9A 2Y9ZA 1OJLA 5TISC 4B47A 3N97A 1WSUA 3O8HA 2DQRA 3TGNA 3K70D 4BYYA 4BACA 3CZ6A 1TNTA 1MNMC 4J19A 2VODA 1X1BA 2F5EA 1HKSA 1ETYA 4CHUA 1HKTA 1KONA 4A3BJ 3I64A 2ZCWA 3ASOH 3DU5A 3KCCA 3PSIA 4BNCA 5E8IA 5FD6A 2DO7A 1BI1A 1YW8A 4M3GA 1J59A 3LA7A 2O7OA 1X1AA 1KGSA 2EV0A 2FEZA 5KAIC 5D8LB 5E3MA 1EA3A 3P7NA 4P55A 4XK4A 3HOWJ 4A5NA 5LGTA 2EFWA 4PGGA 3R4KA 4OINF 4G12A 4WCGA 5D8KB 3H3UA 1EH6A 2AQFA 4WF2A 4F3QA 4BBSJ 4AU7A 3BQZA 2LY1A 5ICFA 4KIGA 1TNSA 2K9MA 1QHGA 1FX7A 2PQ8A 4LMYA 4MHGA 4UB8C 3CCYA 2OAZA 1QZYA 2LF7A 2DA1A 3B6AA 3PSFA 2L2OA 3ASNH 2EB7A 5LFAA 1DU0A 1N25A 5F04A 3FK6A 3KP7A 1ZHFA 2K4JA 3DEEA 4XMYA 4JOMA 3ONQA 2BY1A 1HXDA 2M8EA 4JK1X 2M7AA 4IJAA 1ULYA 1YRNA 2MW8A 2HTJA 3GUDA 3M1EA 3LL7A 3U2RA 3CO7C 1YX5A 3HUGB 1LFBA 4UUTA 2QCOA 2V6CA 5KAFC 3PUFA 3V8JA 3IWFA 4KNYA 2R7SA 2JRTA 5C44J 4Q48A 2K02A 2Y48A 3ABUA 1W0UA 2STTA 1R58A 1XTAA 4FX4A 2ZJRF 1VQ7I 3HHGA 2COMA 1IDZA 2MH2A 2XVCA 2KHMA 3WU0A 1UCRA 1WJ5A 2KJCA 5J1YA 5HDNA 5FKOA 2HR3A 2XGXA 3NEUA 4H4KC 3WTTC 3HRSA 2QWWA 4XLCA 3I58A 2NVUB 3FMQA 2UXXA 3FBNB 3GZNB 4FHTA 2WAEA 4ZC3A 1U9NA 3BC8A 3FIWA 4XQFA 1ACIA 1SD6A 1U0JA 3KLNA 4B48A 4E6KG 5BQTA 2NOGA 3SZGA 1MNEA 4ASNA 4MEXF 3F72A 3I3LA 3QODA 3GTKJ 1GHCA 5FROA 1Z0XA 4LB6B 4ZH4F 1TL8A 4GFBA 2B7EA 2DFEA 2KP6A 4M3DA 1YS7A 4R1HA 3KEYA 4DYRA 4ZJZA 3WGGA 5IP7J 3J81K 4G7ZF 2IPQX 4G6TB 2LTPA 1DQUA 1KU2A 1QRYA 2IRFG 3GCMA 3V4GA 1YO5C 2M4GA 4O6JA 4J00A 2ZXHA 2VQCA 1VZ0A 2LMDA 1OMIA 1U9OA 4ANJA 1ETOA 3S3NA 1VQ8I 2L9RA 1S9HA 4BUPA 3JSPA 3VYSB 2PMZA 2IJLA 4II2A 1SC7A 4CYDA 1FMWA 3JRHA 4HF0A 3K1MA 1P4AA 1P4WA 2EJRA 2KIUA 4LJZF 4M9ZA 1QPIA 2DTZA 3JAMK 1Y8RB 3KIOA 4KMUX 2WB1N 3TBIA 2M3AA 1YITI 4XOPA 3GTLJ 2GIVA 3P9KA 2RVCA 3OL3A 2O03A 3CJTB 3H36A 1R00A 4A3IJ 3RJPA 2XF7A 3B6CA 1D8KA 1TBXA 3VSLA 1X3WB 1TQIA 4G7HF 1MJAA 2B9SA 5CVUA 1USTA 3WU1B 2BGCA 3DCFA 2CW8A 2XC7A 3L9FA 2DN0A 3I5UA 4XONA 3W3CA 3CD6I 3M7GA 2ICWG 4BJ6C 3DBRB 5DCFA 1EH8A 2FF4A 2HTSA 3IHUA 2CFOA 2DQLA 1ETQA 2BHYA 4ESBA 2Y31A 3I56I 3GW2A 5E1XA 4OOIA 2E60A 1LB2A 1GDTA 3HSRA 3OIOA 1EV7A 3JTHA 3O2PE 2F4MB 1F4KA 1JGSA 1SMYF 1MW7A 3TOBA 4CZZA 4CSWA 3G1MA 2Q1ZB 2XAUA 2Y69H 3N4MA 4M9SA 2LC2A 4EQQA 3K2AA 2DFIA 3DKYA 2KLOA 2W25A 2KRFA 5LBQA 4W1UA 2KIMA 5J1RA 3DTIA 3IRRA 5IYDJ 4YEJA 3QPTA 1Z91A 4QSHA 2FSWA 2H8WA 5BNGA 4ESFA 1YFHA 2OV7A 2MH9A 3J7ZI 4BU2A 1MSFC 4PGHA 5EEGA 1BM9A 2OPTA 1JKRC 3NAUA 3C2GA 3CESA 1Z21A 2CV1A 2EIMH 3PL8A 5F1RA 3LSTA 1G4DA 1O7LA 2DW4A 2LVSA 4JYKA 1FBQA 2NVQJ 2E1NA 2GA2A 5J4YA 4PCQA 2V26A 2FOWA 5FFZA 2CGPA 2JQ7A 2GLOA 3H1CA 1F9NA 1DUXC 3KLOA 5CVJA 4EJWA 5CVVA 2OBPA 4CCJA 4JP0A 5IP9J 1B72A 4WX9A 5E79C 3WTVC 1X4PA 2BVMA 2WAQA 1IXCA 3K70C 1GT0C 1D3YA 3OWTA 1W7PA 3RI4A 4I76A 2C6YA 3BR3A 2J5OA 4XLPF 1NTCA 4ZYEA 5GAHJ 1ERDA 3W6JB 3ZOBA 2BHZA 4BHBA 1Y56A 5FO5A 3KYCB 1QA6A 3EQLF 3LSKA 4S04A 5H6QA 1T56A 1XX5A 5F0CA 2ESNA 3HSFA 1ZH5A 2OC6A 2DMTA 3DP7A 3K10A 3B73A 3EPZA 1POGA 2QF7A 3GO5A 2H8RA 4OMZA 4JX5A 2YUSA 1CF7A 2IS2A 3E5XA 3R6SA 1WI9A 1ETKA 3MKYB 3CC2I 1FPQA 4PJ0C 4IX7A 1N75A 3PIOF 3CMAI 1YS6A 4XLHA 2R0QC 2WV0A 1KU7A 3WGIA 3L1PA 1B6AA 4KT6A 5EYRA 1O3QA 1B9MA 4ON0A 4EJTA 2KPMA 1WWXA 4CICA 1JUPA 1VQMI 2VT3A 1WRJA 1E17A 2XAQA 3JRIA 2IGOA 4CCKA 4L0ZB 5B1AH 4RDUA 1T95A 4MGRA 2EFOA 4D7MA 4DNCA 5K1YA 4EM2A 3W6KB 3F8CA 3RYRA 3K2ZA 2ZBKA 3RYPA 4R79A 4A0XA 3ZQCA 2GQQA 2XGCA 1NG7A 2IBDA 2EFPA 4LLLA 2QSFX 2CSOA 1OCZH 5DYMA 2UWMA 3LSJA 4XL9A 5HS7A 5GTHC 2GOMA 1EH7A 4RMNA 4WXHA 2ZNZA 3F8BA 1IW7F 2AO9A 4GXOA 5K7HA 1JHHA 5B5EC 1Z7LA 1B72B 4FETA 1JGGA 1SD5A 2JSPA 2EZIA 5LEKA 1W7PB 2MFZA 3M9AA 1MBJA 2V9KA 3BJAA 4I09A 1ZELA 4RS8A 2CQ7A 3K0LA 3LWFA 1D1AA 4B3AA 4CCLA 4AD9A 3ZQGA 4KISA 2IS1A 1ZYRF 3OYIA 3J7AY 2QBYA 2Y75A 5EEHA 1V55H 1VNDA 1BJAA 3S32A 1IGNA 3MZHA 2KQRA 4ENJA 2LRDA 1QNTA 5CLSA 5LGUA 1ZKGA 2LREA 1LEAA 4KUMA 1B1BA 1VQKI 2NRAC 4BQQA 1I1SA 3S2WA 3BPXA 4L9JA 1YW9A 2BV6A 2R92J 2VBXA 4LIVA 1WGXA 1UZCA 4A3CJ 4EM1A 1RNLA 4HX8A 3ZMUA 2QQBA 3IP4B 3FMSA 4I6ZA 2YSRA 3E6CC 2P7CB 3VFZA 1OLTA 2I8DA 2OJED 2QLZA 3VODA 3BTJA 3CMEI 2VOOA 2BY0A 1BN5A 1XGOA 3WTSC 1F43A 2MD0A 3GZ6A 1WVRA 3QAHA 5IT9Z 1GLNA 4I7HA 3OYHA 4BXXJ 1BL0A 1FYMA 2HI3A 3P9CA 4O5VA 3T5XA 1IG7A 5FJ8J 5KNLA 3TW7A 4LB5A 5EEAA 4DGWB 2HVSA 1I50J 1Q1VA 2XKPA 6PAXA 4KJZA 2XGEA 3WGHA 3FXUA 3F9KA 3SHFA 4GO1A 4XIDA 3AG3H 3FKJA 4LK0F 4NQWA 2EV5A 1IUYA 3HOXJ 4HNVA 1WCMJ 4N9IA 3Q9VA 1R5GA 2TDXA 5DV5A 3CQZJ 4BQNA 3OS2A 4UV8A 5E8GA 2CYYA 2JWTA 3T8RA 1BIBA 1SVLA 2B0LA 4E7HA 1DGWY 1W4MA 2QQ9A 2VE8A 2CUZA 1ODDA 1BI3A 4UY8I 2KZVA 2L9VA 1FOWA 1FY7A 2R4GA 1WKMA 1ETVA 1W5SA 2XIGA 3GTMJ 3CDIA 4OAYA 3SYTA 2HPIA 1J75A 3FMRA 1X4OA 4XRSA 2FQ4A 2HVQA 3I59B 3CP2A 3BZCA 5K5OA 2XROA 3OOUA 5EZHA 2BXYA 4C3IJ 1BJZA 2HPMA 2IW5A 3HKZN 3OYMA 1O3RA 2J5PA 3AKZA 1QBJA 4G7OF 1YQAA 4A3MJ 2B63J 3BY6A 3CF2A 1ZARA 3MKZA 3KP5A 2VUMJ 4RA2A 2GXAA 2FQ3A 3M4OJ 1JJ6C 4Y7NJ 4Y13A 2EIJH 3BQYA 3GLLA 2FRHA 4M73A 2ZFUA 1HSTA 4DQ2A 2LOOA 4ENKA 3MKWB 2X0LA 3BJ6A 4OIQF 4XKVA 2ELKA 2IGMA 5CVIA 5EGOA 3WE3A 2VC1A 2VJ4A 3MN2A 2XV4S 5M3MJ 3ZQLA 5M3FJ 2Z16A 4XN0A 4ZDLA 1Z6RA 2JPCA 3LQRA 2R7OA 1X1DA 1Z3YA 4AIKA 1CGPA 4A3LJ 4NQWB 4RM3A 4RAFA 5AIQA 5TGTA 1ZGJA 2M0MA 1SFOJ 2PJPA 2O9LA 4KIFA 3JTGA 2BVLA 4OIOF 2XF6A 1OR7C 1QVTA 1W5TA 3HTUA 1JKQC 3BTLA 3NWTA 4MTEA 3ZQHA 5IT3A 3GFLA 5H2FC 1BBYA 2R7WA 4JX6A 2KRCA 3BLYA 5ILUA 3DEWA 2E71A 2VQHA 5FKLA 4MIMA 1H8AC 4S05A 1W5CC 4IXAA 2OF7A 1IRFA 2M9HA 2E5NA 1BC8C 1QGPA 1S6LA 4A6DA 4HEA2 1PUEE 1T08B 1IN7A 2GAUA 2YS9A 3FHZA 3ZMVA 3RSNA 3HRTA 2ZMEC 4IO9F 2VOPA 1O7FA 1ZG5A 4PUSA 4I02A 2DI3A 2FNPA 3G2BA 2Z33A 3ELKA 1PP8F 1Y0UA 5E20A 5H20A 5BS6A 4XSXF 2VONA 4CDGA 3Q0UA 4B09A 1UG0A 2VKHA 2X6WA 2ZC2A 2A6EF 2LSOA 2PG4A 1FBUA 1IRGA 3ERMA 3IH4A 2OCCH 3TMOA 1D1CA 3E3VA 3OYLA 1AOYA 3WU2C 1FIAA 1GXPA 3JCUC 2LD5A 2LKXA 3HXLA 2HDDA 1HA8A 2UV1A 1LPQA 5D5XB 3CCRI 3L2UA 3SQNA 2Z99A 2MG4A 5LLQA 1ZGAA 1ZTRA 4Y17A 5D6FA 4M6YA 3WTYC 1OYYA 1C0WA 1BW5A 1Z3XA 2VJJA 4ENMA 2A61A 1OKRA 1G3TA 2WADA 3JW4A 2M5WA 1QU3A 4Q5SF 1Z1DA 1MH3A 2DOFA 5JVTA 3NRVA 2HOTA 1WFXA 1QHHD 4HBLA 4I98B 3ZMSA 1OISA 3K7AJ 4HZFA 2QSGX 1ZRCA 1YJ9I 3Q3SA 3A02A 1TW3A 2BEOA 3WTZA 4EM0B 2L0KA 1I1GA 2V6EA 3BROA 3GBGA 1A5JA 1XDUA 1Y0NA 2M34A 4FX0A 3MZ8A 1JXSA 3PQKA 3TO6A 3QQAA 2NVXJ 3M3YJ 4EJUA 5E1WA 2ZNYA 3ZMDA 2KRHA 3UNGC 3ERED 1U6GA 2V1XA 2EQRA 2WY8Q 3QU3A 1WJCA 4M72A 1DDNA 2W00A 4WWCA 2MBFA 4A3DJ 3MD2A 2CV0A 1NG6A 4AYBA 1BW6A 1Y6IA 5HNHA 2CUEA 3HOSA 4DYQA 4MLOA 1G6NA 3PNTA 3I0TA 3KEQA 3BCAA 2JJ7A 5DS9A 1QO0D 2Z5UA 1XMKA 1RR7A 1P9QC 3DQVC 3FDYA 3R60A 1MGTA 4HQEA 4IRIA 1TWGJ 2PI0A 2MABA 3ZQ7A 1MIJA 1V3FA 2O0YA 2DA4A 4F92B 5IYCJ 1A31A 1T0FC 1TQPA 2O61A 4QPQA 1OCRH 4E7IA 4LD5A 3T0YA 5LD2C 2XAGA 3ECHA 3IAM2 4BHCA 4L5IA 3OYAA 5C3EJ 2VBYA 3TDUC 4EJVA 2W48A 2OZUA 3WODF 2DYSH 1DP3A 1S7EA 2CS3A 2ZXJA 5IPAA 3KP3A 3J80K 1VQOI 5FLXK 4AM3A 2RNJA 4E4HA 1IN4A 1PUFA 3QP5A 4IKFA 1B4AA 2F48A 1NK3P 2CQXA 5JLXA 4EMSA 1U5TC 4RAZA 4HW0A 1A36A 3FX3A 1DPRA 2FE3A 4WXDA 2NS7A 2XPUA 1LDKB 1ZLJA 2H6BA 2LDUA 4X0GA 3E6MA 1MKMA 3SXYA 3KX2A 1ZRDA 3HDDA 2X9DA 1FEXA 1T6SA 2LG4A 2FU4A 1YI2I 4LG3A 4IHVA 4MTDA 1TC3C 3PNVA 5DEQA 2EZKA 4ZTFA 4Z2YA 2QQ8A 3HRUA 3SFIA 2ZMEB 1BR4A 3ZRGA 2OA4A 3MQ0A 3HL2A 4YFXF 4XNFA 3H92A 3G4SI 3G1OA 5C4XJ 1WJDA 1D0YA 1KYZA 2HOAA 4XLFA 5DM6F 4NC6A 2LBFA 3IH2A 3BZKA 3ZP5A 3S16J 2OCEA 3F6OA 4MNUA 4IRGA 2P6TA 3CTAA 2W82A 4HNTA 3PIPF 2GIZA 3C2BA 4G8XA 4UB6C 5KCMA 2HZTA 1LDJA 4M3FA 5GPAA 3GWZA 2R7XA 4ZYHA 1J2XA 1JJ8C 2OZ6A 2Q0OA 1JTYA 3QOEA 3RKWA 2Z2SB 4HYEA 4U7DA 4AIJA 1K61A 5DM7F 2HQRA 2XF5A 4HSTA 2VL8A 4RAGA 2O5RA 3OR2C 3ZXSA 3JR9A 4JQFA 1CQTA 1X3ZB 4LLGF 1KU9A 4XSZF 1M1EB 3RZDJ 2JUCA 4II3A 4U0YA 4Y4RA 1UELB 5LRSA 1U5TA 1PUFB 4CZCA 4IF4A 4E7KA 3AG1H 3O6BB 2R7VA 4AWXB 4DBQA 4L9NA 2CUFA 3FBIB 3VB2A 3AAFA 4RGRA 1R23A 3I54A 4IHSA 2WC2A 5HDKA 3OYJA 1GV2A 2JZYA 2YR2A 2IVMA 1HCRA 2V79A 2Z9OA 5F0HA 4N4OB 5K5QA 3BR2A 3RPQA 3ZCOA 5J47A 3F22A 4B1RA 2HKXA 3SFZA 4CCMA 2XUBA 3S3MA 3MFKA 1TWCJ 4MFDA 2Y0SN 4IVNA 4BE1A 2EK5A 1YW7A 2M0CA 2EBIA 4ENNA 1A6QA 1UHMA 2TRTA 1D5VA 2LBFB 4P96A 2IA0A 2DMPA 1EKEA 2GXGA 1PDNC 3CUQB 4AIDA 3PFYA 2HEOA 3BZ6A 3FZVA 3TP0A 3LNQA 5BPIA 4YFKF 3U1KA 4BAYA 1JKPC 2IS4A 4KITB 1QQIA 3C3WA 3GMEA 1YOVB 4HOBA 3CCQI 4UVCA 3IRQA 3VEPA 2ETHA 3LFUA 2MYSA 3K1PA 3K4JA 3U9GA 3HG9A 2JTVA 2L9NA 3QPLA 1IXSB 5L3GA 1JT6A 3K4NA 1HW5A 1STZA 2ID6A 4NC8A 4E70A 3JRGA 1VFCA 3L00A 2A05A 3VPRA 2JA8J 1S72I 2A6TA 4V2FA 2DA7A 2E19A 4V19K 3UR3C 1U5TB 2HYFA 3MEXA 4OU0A 1OQYA 4FTHA 1K7AA 2HYGD 1MMNA 1XMAA 3CMMA 4EEFG 2QYOA 1LVAA 4I01A 4UVAA 3CF5F 1FYKA 2XSJC 1LE8A 2A68F 3FM5A 2XHKA 3H3ZA 4ETSA 2ZSHB 4H0EA 2L54A 1YHQI 4F93B 3I55I 2DDAA 4L18B 3D5RC 3SZTA 4BXUA 1WPKA 1DPUA 2KISA 4IPAA 2VJIA 4HRIA 4ZZDA 3CLQA 2OU2A 1GV5A 2ELJA 3WTUC 3S1RJ 1VQLI 5J40A 2Z1DA 4B3XA 5JHFA 1YJNI 4Q47A 2WWYA 4HSRA 1TWHJ 1FNNA 5H6RA 1IJWC 3GTGJ 4PSXA 3HM5A 2P5VA 4GDFA 3DXJF 4CO8A 1T39A 5A2QK 1KQ9A 3FISA 4D0PA 4LITA 4IL6C 1IF1A 2NVTJ 2DMNA 2DMQA 3VOEA 3KPHA 2R7TA 2VC0A 3DKXA 3I9V2 2M2EA 3D0SA 2WAFA 1HW1A 1ON1A 3V7RA 2X1CA 2Z3YA 1FC3A 4RLFA 1VQ9I 3PO3J 4YFNF 4DW6A 4FE7A 3HBLA 4EJOA 3BJOA 2PX9A 2O6GE 3K6GA 2H1KA 3OYBA 3KEOA 3HSEA 2L5QA 1IV6A 2W7NA 5J6XA 2L4MA 2LY9A 2ZSIB 5E18F 3JRCA 3CP8A 3TO9A 1MBEA 4A3EJ 4A0YA 5KVRA 4L5EA 1H0MA 4ZYAA 3KE2A 2CV2A 1S5LC 3ZQQA 3E1SA 2LKPA 2K3FA 3M07A 4LGWA 4L0YB 2GA1A 3BDDA 3HGYA 2JMWA 1QZZA 1S29A 2LF8A 4XLNF 2M7BA 3GFIA 3H5AA 1R1VA 1WH5A 2X1DA 3RQ4A 1D5YA 1WJAA 1MMGA 3MCZA 1R9TJ 1QVUA 1VF9A 3ZQFA 1K83J 1JUSA 3DLAA 1LE8B 4M3BA 1K6YA 2N8GA 2KIFA 4BE0A 1H89C 1UB9A 2HDCA 3GYHX 2RC4A 1ZQ3P 1BA5A 2A07F 4LFUA 5FKNA 3C18A 2VBWA 4BY1J 1LEBA 1RC9A 2QSHX 3RKQA 1A04A 1UAAA 4GRIA 3CDHA 1FP2A 2FX0A 1MD0A 2FMLA 1FOXA 3A0HC 4BXFA 3V8LA 5DUKA 3HOTA 1D1BA 1IAWA 2WV1A 2XB0X 2DPUA 3MZYA 5L3EA 5HOOA 1UMQA 3U21A 4PK4A 1P6RA 1W0TA 4LOCA 1RUOA 2I5UA 4XM3A 3DLLF 2R7FA 2V1DA 4NB5A 5LEJA 4RGSA 1R49A 3RDIA 3ZN1A 3BG3A 3CCVI 4XR6A 3IL2A 2W24A 4QPOA 2IGNA 3I59A 2L7ZA 4RB0A 2BE5F 3RTRA 3JRFA 1OCTC 2E36A 3MWMA 3AG4H 1TWAJ 3HJEA 3DPTA 1SEUA 2CMPA 3H5NA 3MKLA 1S7AA 4GCVA 2OQGA 4PJJA 2EA4A 2F6CA 3LFKA 1A6IA 3JRAA 2DAOA 5L3FA 4I2OA 3KP4A 1I3AA 2JVGA 4G94A 5IYBJ 2EZHA 2M8GX 1J5YA 2F5CA 5K7ZA 1AWCA 2D1HA 3S2DJ 4F52A 5EG0B 1UG2A 1SANA 4U0VA 3JREA 1LQ1A 5F08A 3LA3A 2VE9A 4D9JA 4BJ5C 2I10A 2LK2A 2XKOA 3J81Z 4IOCF 3KFWX 3PJRA 2EIKH 2M1BA 2DJNA 2XRNA 4X6AJ 2PMUA 1IZ1A 3NQOA 3SDBA 2VASA 4LG0B 2P81A 3K4BA 3RKYA 2XDVA 4RLQA 3O3KA 3TQNA 5TJJA 3SDGA 2WB1A 3AL0B 2Y0SA 4ZYGA 5HLIA 1UHSA 3SEQA 1LDDA 2V9VA 3RPUD 1G3YA 2P5LC 4R8HA 3TDZC 2IA1A 4BH9A 3GTJJ 4KDPA 4E7SA 2DDBA 5ICGA 1IUFA 3DTKA 1P7JA 2RGVA 3JAMZ 3S2HJ 2L3DA 2VXDA 2BBYA 4BGDA 3JSOA 3IKTA 2NNNA 3FXMA 1O57A 3H35A 3FM3A 2K40A 1Z9CA 3GEZA 2PEXA 1TW2A 2F5DA 2VQGA 4IQJA 1TP4A 3R0JA 3RIRA 2ZJPF 1AKHA 5TRDA 5FFXA 2AXTC 1KA8A 4W97A 3V7SA 1X19A 2CFXA 5M5XJ 2NAZA 1FOYA 1H9GA 2K4BA 4ITVA 1GVJA 4A6EA 4HNUA 2R7ZJ 3L09A 3GLXA 3IH3A 5JFRA 4HX7A 3E6DA 3CJQB 2VPLA 2AHQA 2E7WA 3T1BA 2OD5A 1XS9A 1XDSA 2XPWA 1E3PA 1LKXA 1B8IA 2RKHA 5GP9A 1MJBA 2QUFA 3WTXC 5IY5H 4A0ZA 1G8XA 2LY2A 4C30A 2CO5A 2EZLA 4FCYA 1X2MA 2IEKA 3WHCA 1XCVA 5KK1A 2OQRA 2QA4I 2R5YB 2E7XA 3HPGA 1J0RA 3GX4X 2YU3A 2KMUA 5CYVA 4BBRJ 1YJWI 1HSJA 3I71A 5CPRB 2PFBA 4NBQA 5CVRA 5E3NA 4FE4A 3TKYA 2IXSA 1ZK8A 1SVOA 1RUNA 1XGNA 3OR1C 4KN7X 2KFDA 1YYVA 4G6QA 4OIPF 1A35A 2K5CA 3FXJA 1YG2A 1U2WA 2VIXA 4OAZA 2FD5A 2X6YA 3GTOJ 1IRZA 5K7FA 3BG5A 2X6XA 5FRMA 2EH3A 5HLGA 1U3EM 1NH3A 4KN4X 3NWSA 5D5VB 3KETA 1LNWA 2FUG2 4U88A 2MD5A 1AKHB 1I27A 3OOPA 4ZYDA 1O4XA 3HZJA 2JSCA 1ON2A 2RAEA 1T33A 2R7QA 3LOCA 2R7DA 3LAPA 1Y8QB 4F55A 2A6HF 4HF2A 2JPBA 2RREA 1O3TA 1IN6A 2EA2A 1F36A 2Q8KA 2IA2A 1BR2A 4D7NA 3OIPA 3EUAA 4XLEA 2AXLA 3I4PA 1B8IB 2GWRA 4AVPA 3W2AA 4DYCA 4XKCA 3PO2J 3LSMA 2CQKA 3PUBA 4BDZA 5J8FA 4IRHA 3OY9A 4C2MJ 3M8EA 4BQOA 4G6DA 2D45A 2HFHA 1SAUA 1FLIA 2X6OA 1FBSA 3RCOA 2Y30A 2X51A 5B3SH 1R22A 3MAJA 2ME6A 3TEDA 3LA2A 3F6VA 4NC7A 5ICEA 2M4KA 4DZPA 2JK3A 3EETA 2ZB9A 5F1JA 1YTYA 3CC7I 1Z7UA 5L3DA 1X1PA 1DP7P 2G7UA 5IOYA 1OR7A 4HG2A 4P9FA 2VBZA 4HDVA 2L01A 1ONVA 2V7FA 4RGXA 5B66C 4JBAA 2R5ZB 4BEHB 4A12A 2L4AA 1XGSA 2HDWA 5JR3A 5CJ9A 2PJRB 3DBLB 1T8IA 3CLOA 5D5UB 1IC8A 4PJNA 3S14J 1RR8C 3WG7H 4U7BA 3A01B 4IHXA 1P2FA 3EDPA 4XKBA 4DOZA 1TT0A 5E17F 3W2WA 1PVEA 2W57A 3HOYJ 3BR0A 4AVZA 3H0DA 2HU9A 4UHTA 2ZKZA 3A03A 2E1OA 3Q0WA 5FGMA 2P5KA 2ZO4A 1N77A 2MLKA 1FTZA 2D5VA 1K78B 3J7AO 2ZMEA 4DIQA 1XSVA 3HC7A 4HQMA 2WBMA 4YG2F 3DU6A 4IOAF 4ZDOA 4ESJA 4HV6A 3OYDA 3F8NA 4CCNA 4D5FA 1X1CA 3IC7A 4DBRA 1H88C 1BR1A 1R1UA 2BOLA 3BG6A 1S3JA 3FXOA 3D5LA 4B44A 4I99C 5FLVA 1OCPA 5CQGA 3CUQC 4HX4A 2ISZA 3F21A 2DT5A 3GTPJ 3FXRA 1XSXA 3G71I 1TZLA 4A2UA 1SD7A 2R93J 1Z05A 1OCOH 3S93A 3KP2A 1SD4A 2A5WA 3GFJA 2LLKA 2WAQN 2DT6A 2L7FP 3TL4X 1JTXA 3F23A 5GAEJ 1GXQA 2G9WA 5CQEA 3I4MJ 1ZG3A 2XASA 2BW3B 2A69F 2DK8A 2UUZA 3AG2H 2P7VB 1Y1WJ 1BOAA 2X85A 3ABKH 3KP6A 3ISPA 2CG4A 4C2UA 3HIFA 1X3UA 3SEZA 3E7LA 2D1VA 4C9YA 3CC4I 2STWA 3K4KA 3GFMA 3W6VA 1FOKA 4A3FJ 3SZPA 1RETA 2K9LA 4MO7A 4NNJA 3LAJA 2L7MP 2DA2A 4A93J 3A0BC 1HC8A 1MH4A 3LQQA 3VDXA 3LSGA 5FD5A 1SFKA 2QZ8A 4MQ9F 2RDPA 2PBIA 4M6XA 1VQPI 1USSA 4LK1F 1EF4A 1RRJA 4XORA 2DBBA 2DFHA 3FXKA 3COAC 2MC4A 4PJMA 2BY3A 1XPXA 5L3BA 2QVOA 2RQQA 3HKZA 3EUKL 2ME0A 5AONA 5L3CA 3HOVJ 1P7IA 1MBFA 1S8NA 2D2WA 5JLWA 2JA6J 3TP3A 2RQPA 1RI7A 4FISA 1FIPA 5ED4A 3DBHB 1IRXA 3CUQA 1IN8A 1L0OC 2JRMA 3G3ZA 3CCJI 1B9NA 1Z6TA 3L2VA 2HOSA 3F8MA 1T2KA 1T0FA 5DUIA 4YELA 2ID3A 3BR6A 5GTIC 5M5YJ 1APLC 4BKXA 4IHYA 4MQVA 3CCMI 3DF8A 1UJ8A 2VT2A 2L7KA 4FASD 1R6RA 2W85A 1K6OA 4BL0B 2QQAA 4F91B 1KU3A 3WE2A 1VTNC 3T8TA 4QWQA 3DTEA 1FWZA 1ETWA 5E3LA 2VJ5A 1WJFA 2P0WA 3GTQJ 4UVBA 3ABTA 3RPUA 3WHBA 2E2HJ 3IV5A 4WXCA 2P4WA 1KQ8A 1SMTA 3H9GA 1HQCA 1RKTA 1XMXA 4DJAA 3KYLA 2OTJI 5E3OA 3K9TA 2V4JC 3ZR8X 2MLGA 1AHDP 2K7LA 4PZJA 1MSEC 1ZAOA 3PM1A 1WQ2A 1Z77A 3V42A 3C7JA 3ZMTA 4E7ZA 3P5JA 5IT9K 3C2HA 2HWVA 1ORKA 1WI3A 1R71A 2DTRA 1NHAA 1UHWA 2X4HA 1FP1D 3DV8A 2ELHA 2FOKA 1TWFJ 3REOA 2O8XA 1HKQA 2XB5A 3BTIA 2QM3A 2A3SA 2M30A 4FT8A 2OTLI 2LNBA 5F0FA 5FKMA 1YE9A 1IXRC 3OV8A 1KYWA 3H9QA 2GBYA 4XLAA 2JA5J 2FA5A 4BDYA 2EINH 1MJ9A 2G0EA 2HOEA 3R0AA 3OYEA 1LVKA 4YIRX 1YRNB 2VI6A 3W2VA 3FXQA 2MGQA 3TO7A 4HLYA 3CJRB 1EJ9A 4PFPA 4PDKA 2DYRH 4AUXA 4HV5A 2YX7A 1U8BA 3VSKA 1V5FA 3RKXA 1IO2A 2IAIA 2R7RA 1MMAA 3SJMA 1WJEA 1LUJB 2YPRA 5B1BH 2KJBA 2LH9A 2NS8A 2CU7A 4JX4A 5DCMA 1O3SA 2E35A 1I39A 2M45A 3QRFF 2DFFA 4BHPA 1R7JA 1TT5B 1RKWA 2F2EA 2JA2A 2LFBA 2R7UA 1HBXG 4V2GA 1VQ6I 4B4CA 1G59A 1REPC 3CCEI 2FJ1A 1IDYA 2DA6A 5IOZA 2DLLA 2CQNA 3IWZA 3E5UA 3TW6A 4IEJA 2E1MC 4P1WA 5KHDA 1HLVA 2EPFA 3QPHA 1SFXA 4XRFA 3L2CA 2HGCA 2X1EA 3K69A 2FNAA 4HLXA 1RZ4A 3U1DA 4KA4A 5EDNA 2NNYA 4YIIA 4EATA 1ZR4A 1JI8A 2ZFWA 3S1MJ 4HAMA 3WG9A 4EVIA 3QP6A 3FK7A 4A3GJ 2H1LA 2W1OA 2GOXB 1JUMA 3L2WA 2FBIA 3DEUA 3OYNA 2VKDA 5K5RA 2K3PA 5BPDA 3DFGA 4M3EA 2HNHA 4L9TA 5FB2A 3IAS2 3M8JA 2QGUA 4X1EA 3ESWB 2ZXIA 1P4XA 1FJLA 1XCBA 1MMSA 2DXIA 2KDOA 4XKWA 1YIOA 1X58A 2CRGA 3FXLA 3K4CA 3AL0C 1W36D 5GAGJ 2DMUA 2AQEA 2DU9A 2P8TA 2IP2A 3V8KA 2XPVA 1SVMA 1V54H 1YLFA 3HEFA 4XN3A 3QYBA 3BT9A 2DT7B 2Q2EA 4IQ4A 2Y0MA 1XD7A 2K86A 4NUBA 4QTRA 3UKGA 1RIOH 2V1UA 5F27A 3WTWC 2G7HA 5DCMB 1G2HA 4KFCA 3OYGA 4L9VA 1BOBA 5IP6A 1F1ZA 1BI0A 1XSDA 5LRRA 2QKLB 4UXNA 3A2KA 4A5MA 4IHWA 3OS0A 5AIPA 4F7ZA 3L2RA 3F0CA 2EV6A 2IS6A 2EWNA 3FKIJ 2FMYA 1ZN2A 2K9QA 3ZMZA 3L2QA 1E3HA 2BXZA 4CCOA 3I53A 3ZPLA 2H94A 4O3MA 3F8FA 4P9UA 1V4RA 5EG0A 4A3JJ 1U78A 2NXNB 5HLHA 1FMVA 2XRLA 1ZLKA 3QPSA 1ENHA 2HQ5A 4MFEA 2VB6A 3CCLI 2DPDA 4E7LA 2QENA 4Y52J 2L9SA 2F4OB 4P5OA 4M71A 1R4MB 3H0GJ 3CCSI 3J80Z 4PFOA 1YX3A 5FLXZ 4A3KJ 5C4JJ 1MDMA 3EUHC 4N9HA 1BI2A 5D6EA 2COBA 3IUOA 2JT1A 4XICA 2EFQA 3GF2A 2DA3A 4CGZA 4LG0A 2CQQA 4GYIA 1VQNI 1MZBA 4OMYA 4KMFA 5ICCA 2YU9J 4HF1A 1B59A 1MMDA 2FBHA 4NDLA 3VYTB 1HW2A 4RB2C 4XBFA 5HDGA 3P9IA 2QEXI 1D0XA 2K9SA 4MEYF 3MMYB 2MC3A 1WZ2A 3ABMH 4WK8F 4Y33A 1HOMA 2E34A 4GYGA 1JE8A 3EYIA 2VKEA 2CWEA 3IKVA 1JT0A 1FZPB 2H27A 2F5VA 2E2JJ 2RV8A 2K9NA 3Q9SA 2CH0A 2BYVE 2Q2EB
chains in the Genus database with same CATH topology
1R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R71 A; 
#chains in the Genus database with same CATH topology
 5M5W J;  1VQ4 I;  2ADU A;  3KZY A;  4Q4Z F;  2HS5 A;  1PJR A;  2CUJ A;  1N78 A;  5HS8 A;  5JI6 A;  1ZG1 A;  4M6V A;  5LHH A;  1R1T A;  4G9Y A;  2DJI A;  1LFU P;  5ILS A;  3CUO A;  3S15 J;  1J09 A;  2M87 A;  2E1M B;  2BZT A;  2DOE A;  3HRM A;  3HYI A;  2PMH A;  2LKS A;  4I0B A;  4LIU A;  2H6C A;  1XC5 A;  3HOU J;  4HPQ A;  2DOA A;  4NHJ A;  3K4M A;  3G1L A;  2DA5 A;  3CCU I;  1DU6 A;  1BIA A;  3S3O A;  4UUS A;  3BPV A;  1FSE A;  3S8P A;  3BR5 A;  3H3V K;  2OUM A;  4Y15 A;  1MBH A;  3GXO A;  5HS9 A;  3LSH A;  1Y1V J;  1CF7 B;  3BCB A;  2O3F A;  1TQM A;  3EUH A;  4IHT A;  3R61 A;  3I4N J;  5BOX A;  2BY2 A;  3LSP A;  1MDM B;  2IT0 A;  3K1N A;  2Y2Z A;  4ZTJ A;  3GVA A;  4AYB N;  3G6E I;  2R5Y A;  1MBG A;  2XAJ A;  1RES A;  3BR1 A;  5J8C A;  4B8X A;  4I0A A;  1I3Q J;  2F4I A;  2R3S A;  1NK2 P;  2NOJ B;  4ZZL A;  2GZW A;  4BY7 J;  5J4V A;  3RZO J;  3OS1 A;  1SAX A;  2DK5 A;  5JHU A;  2HZD A;  1QPM A;  3HTS B;  4BQA A;  2AS5 F;  4Y3O A;  2O8K A;  1FT9 A;  3V7C A;  2PLY A;  4BE2 A;  3A1Y A;  4EV0 A;  1AU7 A;  4C2T A;  4N0B A;  1ETX A;  1VI0 A;  1UFM A;  3ABL H;  3PNY A;  4QLC U;  5J1U A;  4ZDP A;  2HQA A;  4D1Q A;  3S1N J;  2E2I J;  1L3L A;  1FSH A;  4AIH A;  1OYI A;  5LHG A;  3BOQ A;  4CYC A;  5GPC A;  1R36 A;  3QYE A;  4PSW A;  2V1N A;  1HF0 A;  1U8R A;  2ZJQ F;  3E6B A;  1XB4 A;  2YX4 A;  3QWL A;  3H5R A;  4YIF A;  4KYW A;  4UNO A;  1OYW A;  1ZRF A;  2GXB A;  5EZG A;  1ZR2 A;  5LGN A;  1OCC H;  1TTY A;  9ANT A;  3BG7 A;  2IGK A;  2JUG A;  2TCT A;  5DD4 A;  4FQG A;  4CUG A;  3J7Y J;  2ZJ2 A;  2QBY B;  3GZ5 A;  4HA8 A;  4UUS B;  1Q1H A;  2WA0 A;  3D5S C;  5E1Z B;  3FF5 A;  4QIW N;  2CW7 A;  1I6H J;  3KZI C;  3M8F A;  4M74 A;  2MA3 A;  4PJL A;  2LP0 A;  5HLT A;  2NS0 A;  1MND A;  3OYC A;  2KZG A;  1V5E A;  2VPR A;  1IN5 A;  2HKO A;  1E2X A;  2VLA A;  5DDG A;  2A5Y B;  1Z67 A;  4D5C A;  3NAR A;  3MVP A;  4IZZ A;  1IV8 A;  2XAH A;  4U0W A;  4LLN A;  1WJB A;  3F3X A;  1E3O C;  2XAF A;  2CW0 F;  3S1Q J;  1KZH A;  2K85 A;  3CO6 C;  1OFC X;  2K27 A;  4RAY A;  4XOT A;  3ZQI A;  5EF6 A;  3KZZ A;  3KYD B;  5J3L A;  1KQ0 A;  1BC7 C;  3PFI A;  3FWE A;  2LR8 A;  1YIJ I;  2R5Z A;  2LYC A;  4BEH A;  1W36 C;  2PJR A;  1I6X A;  5DTD A;  2DOD A;  4OIR F;  2ISY A;  3ECO A;  5ERI A;  2KDZ A;  3C1D A;  2F5F A;  3VYR B;  1PYV A;  3FHN A;  3A01 A;  1V5G A;  5ILV A;  4AC0 A;  5GAD J;  3DPU A;  4CYC B;  1K79 A;  2CJJ A;  3LSI A;  4KIB A;  4XRS G;  4YRV A;  4K2E A;  3AFH A;  3LSR A;  2X48 A;  5A2Q Z;  1LFP A;  3D1N I;  4TV7 A;  3JRD A;  5HOD A;  3HHH A;  1JKO C;  5F64 A;  4M9X A;  4EGY A;  1D8J A;  3OYF A;  3E5Q A;  1J9I A;  2WTE A;  4E7J A;  1AA7 A;  4XRM A;  1K78 A;  3QOP A;  1ZGW A;  3TOA A;  2FXA A;  3Q5F A;  5FRN A;  4L5J A;  2PN6 A;  3BTC A;  2ECB A;  4HDU A;  1GUU A;  3H9J A;  2UXN A;  3HPH A;  4C3J J;  1P92 A;  2KIQ A;  3OYK A;  1H9T A;  1WHU A;  2HVR A;  2H09 A;  3DKW A;  5D5W B;  1QZE A;  4RB3 C;  2JN6 A;  2KL4 A;  3S17 J;  1G3W A;  2L02 A;  1FYL A;  2KKO A;  2NYX A;  2PMZ N;  3HOZ J;  1G3S A;  4CXF A;  2XGD A;  2EIL H;  4S0H B;  1T98 A;  3G73 A;  2UZK A;  2KT0 A;  4BJT A;  2GM4 A;  2DCE A;  4ABZ A;  1WH7 A;  2ZXW H;  1S7O A;  4KIC A;  1X2N A;  3VYU B;  1HDP A;  3BP8 A;  1R5I D;  2HXO A;  4RB1 A;  2VXZ A;  2WY7 Q;  1RPW A;  1R4N B;  4KT5 C;  1I5Z A;  4U87 A;  1W1W E;  4DZJ A;  5FKK A;  1OPC A;  1SFE A;  2HXI A;  3OMY A;  2JA7 J;  1W7P D;  4RM2 A;  4CH7 A;  3OIQ A;  1K4T A;  2JVH A;  2BW3 A;  2NVY J;  1JHF A;  4CA0 A;  2E1C A;  3ULQ B;  1FTT A;  1J7K A;  4N4N B;  3A4C A;  3PQJ A;  1HDD C;  4UV9 A;  5EGO B;  3Q0V A;  4GGG A;  2HYJ A;  3OSG A;  3CMY A;  1XN7 A;  3VWB A;  4Z6Y A;  4UUV A;  5D4S A;  1XGM A;  1TLH B;  4J01 A;  3ZGK A;  3HGG A;  1PP7 U;  1D0Z A;  3CJN A;  1GVD A;  2EFN A;  2W4S A;  2VN2 A;  2XSD C;  3ML6 A;  4B43 A;  1XG1 A;  2V9P A;  3BWG A;  1VQ5 I;  1E0E A;  1MBK A;  3B02 A;  1K4S A;  5HNF A;  3M1C A;  2HQN A;  1R5H A;  4OWR B;  3ROU A;  2QKM B;  3ZN0 A;  4RGU A;  3X2Q H;  1F5T A;  3EYY A;  5F6F A;  2MSY A;  3JRB A;  2Y9Y A;  3QU6 A;  3L7W A;  3O8G A;  2RNG A;  2VQL A;  3DWL E;  3HB9 A;  4A69 C;  5HVQ C;  3QYF A;  3OSF A;  3LMM A;  4EGZ A;  3BG9 A;  2RN7 A;  2FBK A;  1ITY A;  1DGR M;  3K4L A;  3E0J B;  3N05 A;  2P6S A;  5BMZ A;  5CKT A;  1ZRE A;  1Y39 A;  2W84 A;  1T38 A;  2VKV A;  5EJC A;  2ACJ A;  3OL4 A;  3E97 A;  5JVG F;  2ECC A;  5FLM J;  4RBO A;  5D4R A;  4C3H J;  3HUG A;  5DD8 A;  3RQI A;  5LHI A;  1SFU A;  4BS9 A;  2E5Z A;  3DPL C;  2ESH A;  3CDL A;  1LJ9 A;  2Y9Z A;  1OJL A;  5TIS C;  4B47 A;  3N97 A;  1WSU A;  3O8H A;  2DQR A;  3TGN A;  3K70 D;  4BYY A;  4BAC A;  3CZ6 A;  1TNT A;  1MNM C;  4J19 A;  2VOD A;  1X1B A;  2F5E A;  1HKS A;  1ETY A;  4CHU A;  1HKT A;  1KON A;  4A3B J;  3I64 A;  2ZCW A;  3ASO H;  3DU5 A;  3KCC A;  3PSI A;  4BNC A;  5E8I A;  5FD6 A;  2DO7 A;  1BI1 A;  1YW8 A;  4M3G A;  1J59 A;  3LA7 A;  2O7O A;  1X1A A;  1KGS A;  2EV0 A;  2FEZ A;  5KAI C;  5D8L B;  5E3M A;  1EA3 A;  3P7N A;  4P55 A;  4XK4 A;  3HOW J;  4A5N A;  5LGT A;  2EFW A;  4PGG A;  3R4K A;  4OIN F;  4G12 A;  4WCG A;  5D8K B;  3H3U A;  1EH6 A;  2AQF A;  4WF2 A;  4F3Q A;  4BBS J;  4AU7 A;  3BQZ A;  2LY1 A;  5ICF A;  4KIG A;  1TNS A;  2K9M A;  1QHG A;  1FX7 A;  2PQ8 A;  4LMY A;  4MHG A;  4UB8 C;  3CCY A;  2OAZ A;  1QZY A;  2LF7 A;  2DA1 A;  3B6A A;  3PSF A;  2L2O A;  3ASN H;  2EB7 A;  5LFA A;  1DU0 A;  1N25 A;  5F04 A;  3FK6 A;  3KP7 A;  1ZHF A;  2K4J A;  3DEE A;  4XMY A;  4JOM A;  3ONQ A;  2BY1 A;  1HXD A;  2M8E A;  4JK1 X;  2M7A A;  4IJA A;  1ULY A;  1YRN A;  2MW8 A;  2HTJ A;  3GUD A;  3M1E A;  3LL7 A;  3U2R A;  3CO7 C;  1YX5 A;  3HUG B;  1LFB A;  4UUT A;  2QCO A;  2V6C A;  5KAF C;  3PUF A;  3V8J A;  3IWF A;  4KNY A;  2R7S A;  2JRT A;  5C44 J;  4Q48 A;  2K02 A;  2Y48 A;  3ABU A;  1W0U A;  2STT A;  1R58 A;  1XTA A;  4FX4 A;  2ZJR F;  1VQ7 I;  3HHG A;  2COM A;  1IDZ A;  2MH2 A;  2XVC A;  2KHM A;  3WU0 A;  1UCR A;  1WJ5 A;  2KJC A;  5J1Y A;  5HDN A;  5FKO A;  2HR3 A;  2XGX A;  3NEU A;  4H4K C;  3WTT C;  3HRS A;  2QWW A;  4XLC A;  3I58 A;  2NVU B;  3FMQ A;  2UXX A;  3FBN B;  3GZN B;  4FHT A;  2WAE A;  4ZC3 A;  1U9N A;  3BC8 A;  3FIW A;  4XQF A;  1ACI A;  1SD6 A;  1U0J A;  3KLN A;  4B48 A;  4E6K G;  5BQT A;  2NOG A;  3SZG A;  1MNE A;  4ASN A;  4MEX F;  3F72 A;  3I3L A;  3QOD A;  3GTK J;  1GHC A;  5FRO A;  1Z0X A;  4LB6 B;  4ZH4 F;  1TL8 A;  4GFB A;  2B7E A;  2DFE A;  2KP6 A;  4M3D A;  1YS7 A;  4R1H A;  3KEY A;  4DYR A;  4ZJZ A;  3WGG A;  5IP7 J;  3J81 K;  4G7Z F;  2IPQ X;  4G6T B;  2LTP A;  1DQU A;  1KU2 A;  1QRY A;  2IRF G;  3GCM A;  3V4G A;  1YO5 C;  2M4G A;  4O6J A;  4J00 A;  2ZXH A;  2VQC A;  1VZ0 A;  2LMD A;  1OMI A;  1U9O A;  4ANJ A;  1ETO A;  3S3N A;  1VQ8 I;  2L9R A;  1S9H A;  4BUP A;  3JSP A;  3VYS B;  2PMZ A;  2IJL A;  4II2 A;  1SC7 A;  4CYD A;  1FMW A;  3JRH A;  4HF0 A;  3K1M A;  1P4A A;  1P4W A;  2EJR A;  2KIU A;  4LJZ F;  4M9Z A;  1QPI A;  2DTZ A;  3JAM K;  1Y8R B;  3KIO A;  4KMU X;  2WB1 N;  3TBI A;  2M3A A;  1YIT I;  4XOP A;  3GTL J;  2GIV A;  3P9K A;  2RVC A;  3OL3 A;  2O03 A;  3CJT B;  3H36 A;  1R00 A;  4A3I J;  3RJP A;  2XF7 A;  3B6C A;  1D8K A;  1TBX A;  3VSL A;  1X3W B;  1TQI A;  4G7H F;  1MJA A;  2B9S A;  5CVU A;  1UST A;  3WU1 B;  2BGC A;  3DCF A;  2CW8 A;  2XC7 A;  3L9F A;  2DN0 A;  3I5U A;  4XON A;  3W3C A;  3CD6 I;  3M7G A;  2ICW G;  4BJ6 C;  3DBR B;  5DCF A;  1EH8 A;  2FF4 A;  2HTS A;  3IHU A;  2CFO A;  2DQL A;  1ETQ A;  2BHY A;  4ESB A;  2Y31 A;  3I56 I;  3GW2 A;  5E1X A;  4OOI A;  2E60 A;  1LB2 A;  1GDT A;  3HSR A;  3OIO A;  1EV7 A;  3JTH A;  3O2P E;  2F4M B;  1F4K A;  1JGS A;  1SMY F;  1MW7 A;  3TOB A;  4CZZ A;  4CSW A;  3G1M A;  2Q1Z B;  2XAU A;  2Y69 H;  3N4M A;  4M9S A;  2LC2 A;  4EQQ A;  3K2A A;  2DFI A;  3DKY A;  2KLO A;  2W25 A;  2KRF A;  5LBQ A;  4W1U A;  2KIM A;  5J1R A;  3DTI A;  3IRR A;  5IYD J;  4YEJ A;  3QPT A;  1Z91 A;  4QSH A;  2FSW A;  2H8W A;  5BNG A;  4ESF A;  1YFH A;  2OV7 A;  2MH9 A;  3J7Z I;  4BU2 A;  1MSF C;  4PGH A;  5EEG A;  1BM9 A;  2OPT A;  1JKR C;  3NAU A;  3C2G A;  3CES A;  1Z21 A;  2CV1 A;  2EIM H;  3PL8 A;  5F1R A;  3LST A;  1G4D A;  1O7L A;  2DW4 A;  2LVS A;  4JYK A;  1FBQ A;  2NVQ J;  2E1N A;  2GA2 A;  5J4Y A;  4PCQ A;  2V26 A;  2FOW A;  5FFZ A;  2CGP A;  2JQ7 A;  2GLO A;  3H1C A;  1F9N A;  1DUX C;  3KLO A;  5CVJ A;  4EJW A;  5CVV A;  2OBP A;  4CCJ A;  4JP0 A;  5IP9 J;  1B72 A;  4WX9 A;  5E79 C;  3WTV C;  1X4P A;  2BVM A;  2WAQ A;  1IXC A;  3K70 C;  1GT0 C;  1D3Y A;  3OWT A;  1W7P A;  3RI4 A;  4I76 A;  2C6Y A;  3BR3 A;  2J5O A;  4XLP F;  1NTC A;  4ZYE A;  5GAH J;  1ERD A;  3W6J B;  3ZOB A;  2BHZ A;  4BHB A;  1Y56 A;  5FO5 A;  3KYC B;  1QA6 A;  3EQL F;  3LSK A;  4S04 A;  5H6Q A;  1T56 A;  1XX5 A;  5F0C A;  2ESN A;  3HSF A;  1ZH5 A;  2OC6 A;  2DMT A;  3DP7 A;  3K10 A;  3B73 A;  3EPZ A;  1POG A;  2QF7 A;  3GO5 A;  2H8R A;  4OMZ A;  4JX5 A;  2YUS A;  1CF7 A;  2IS2 A;  3E5X A;  3R6S A;  1WI9 A;  1ETK A;  3MKY B;  3CC2 I;  1FPQ A;  4PJ0 C;  4IX7 A;  1N75 A;  3PIO F;  3CMA I;  1YS6 A;  4XLH A;  2R0Q C;  2WV0 A;  1KU7 A;  3WGI A;  3L1P A;  1B6A A;  4KT6 A;  5EYR A;  1O3Q A;  1B9M A;  4ON0 A;  4EJT A;  2KPM A;  1WWX A;  4CIC A;  1JUP A;  1VQM I;  2VT3 A;  1WRJ A;  1E17 A;  2XAQ A;  3JRI A;  2IGO A;  4CCK A;  4L0Z B;  5B1A H;  4RDU A;  1T95 A;  4MGR A;  2EFO A;  4D7M A;  4DNC A;  5K1Y A;  4EM2 A;  3W6K B;  3F8C A;  3RYR A;  3K2Z A;  2ZBK A;  3RYP A;  4R79 A;  4A0X A;  3ZQC A;  2GQQ A;  2XGC A;  1NG7 A;  2IBD A;  2EFP A;  4LLL A;  2QSF X;  2CSO A;  1OCZ H;  5DYM A;  2UWM A;  3LSJ A;  4XL9 A;  5HS7 A;  5GTH C;  2GOM A;  1EH7 A;  4RMN A;  4WXH A;  2ZNZ A;  3F8B A;  1IW7 F;  2AO9 A;  4GXO A;  5K7H A;  1JHH A;  5B5E C;  1Z7L A;  1B72 B;  4FET A;  1JGG A;  1SD5 A;  2JSP A;  2EZI A;  5LEK A;  1W7P B;  2MFZ A;  3M9A A;  1MBJ A;  2V9K A;  3BJA A;  4I09 A;  1ZEL A;  4RS8 A;  2CQ7 A;  3K0L A;  3LWF A;  1D1A A;  4B3A A;  4CCL A;  4AD9 A;  3ZQG A;  4KIS A;  2IS1 A;  1ZYR F;  3OYI A;  3J7A Y;  2QBY A;  2Y75 A;  5EEH A;  1V55 H;  1VND A;  1BJA A;  3S32 A;  1IGN A;  3MZH A;  2KQR A;  4ENJ A;  2LRD A;  1QNT A;  5CLS A;  5LGU A;  1ZKG A;  2LRE A;  1LEA A;  4KUM A;  1B1B A;  1VQK I;  2NRA C;  4BQQ A;  1I1S A;  3S2W A;  3BPX A;  4L9J A;  1YW9 A;  2BV6 A;  2R92 J;  2VBX A;  4LIV A;  1WGX A;  1UZC A;  4A3C J;  4EM1 A;  1RNL A;  4HX8 A;  3ZMU A;  2QQB A;  3IP4 B;  3FMS A;  4I6Z A;  2YSR A;  3E6C C;  2P7C B;  3VFZ A;  1OLT A;  2I8D A;  2OJE D;  2QLZ A;  3VOD A;  3BTJ A;  3CME I;  2VOO A;  2BY0 A;  1BN5 A;  1XGO A;  3WTS C;  1F43 A;  2MD0 A;  3GZ6 A;  1WVR A;  3QAH A;  5IT9 Z;  1GLN A;  4I7H A;  3OYH A;  4BXX J;  1BL0 A;  1FYM A;  2HI3 A;  3P9C A;  4O5V A;  3T5X A;  1IG7 A;  5FJ8 J;  5KNL A;  3TW7 A;  4LB5 A;  5EEA A;  4DGW B;  2HVS A;  1I50 J;  1Q1V A;  2XKP A;  6PAX A;  4KJZ A;  2XGE A;  3WGH A;  3FXU A;  3F9K A;  3SHF A;  4GO1 A;  4XID A;  3AG3 H;  3FKJ A;  4LK0 F;  4NQW A;  2EV5 A;  1IUY A;  3HOX J;  4HNV A;  1WCM J;  4N9I A;  3Q9V A;  1R5G A;  2TDX A;  5DV5 A;  3CQZ J;  4BQN A;  3OS2 A;  4UV8 A;  5E8G A;  2CYY A;  2JWT A;  3T8R A;  1BIB A;  1SVL A;  2B0L A;  4E7H A;  1DGW Y;  1W4M A;  2QQ9 A;  2VE8 A;  2CUZ A;  1ODD A;  1BI3 A;  4UY8 I;  2KZV A;  2L9V A;  1FOW A;  1FY7 A;  2R4G A;  1WKM A;  1ETV A;  1W5S A;  2XIG A;  3GTM J;  3CDI A;  4OAY A;  3SYT A;  2HPI A;  1J75 A;  3FMR A;  1X4O A;  4XRS A;  2FQ4 A;  2HVQ A;  3I59 B;  3CP2 A;  3BZC A;  5K5O A;  2XRO A;  3OOU A;  5EZH A;  2BXY A;  4C3I J;  1BJZ A;  2HPM A;  2IW5 A;  3HKZ N;  3OYM A;  1O3R A;  2J5P A;  3AKZ A;  1QBJ A;  4G7O F;  1YQA A;  4A3M J;  2B63 J;  3BY6 A;  3CF2 A;  1ZAR A;  3MKZ A;  3KP5 A;  2VUM J;  4RA2 A;  2GXA A;  2FQ3 A;  3M4O J;  1JJ6 C;  4Y7N J;  4Y13 A;  2EIJ H;  3BQY A;  3GLL A;  2FRH A;  4M73 A;  2ZFU A;  1HST A;  4DQ2 A;  2LOO A;  4ENK A;  3MKW B;  2X0L A;  3BJ6 A;  4OIQ F;  4XKV A;  2ELK A;  2IGM A;  5CVI A;  5EGO A;  3WE3 A;  2VC1 A;  2VJ4 A;  3MN2 A;  2XV4 S;  5M3M J;  3ZQL A;  5M3F J;  2Z16 A;  4XN0 A;  4ZDL A;  1Z6R A;  2JPC A;  3LQR A;  2R7O A;  1X1D A;  1Z3Y A;  4AIK A;  1CGP A;  4A3L J;  4NQW B;  4RM3 A;  4RAF A;  5AIQ A;  5TGT A;  1ZGJ A;  2M0M A;  1SFO J;  2PJP A;  2O9L A;  4KIF A;  3JTG A;  2BVL A;  4OIO F;  2XF6 A;  1OR7 C;  1QVT A;  1W5T A;  3HTU A;  1JKQ C;  3BTL A;  3NWT A;  4MTE A;  3ZQH A;  5IT3 A;  3GFL A;  5H2F C;  1BBY A;  2R7W A;  4JX6 A;  2KRC A;  3BLY A;  5ILU A;  3DEW A;  2E71 A;  2VQH A;  5FKL A;  4MIM A;  1H8A C;  4S05 A;  1W5C C;  4IXA A;  2OF7 A;  1IRF A;  2M9H A;  2E5N A;  1BC8 C;  1QGP A;  1S6L A;  4A6D A;  4HEA 2;  1PUE E;  1T08 B;  1IN7 A;  2GAU A;  2YS9 A;  3FHZ A;  3ZMV A;  3RSN A;  3HRT A;  2ZME C;  4IO9 F;  2VOP A;  1O7F A;  1ZG5 A;  4PUS A;  4I02 A;  2DI3 A;  2FNP A;  3G2B A;  2Z33 A;  3ELK A;  1PP8 F;  1Y0U A;  5E20 A;  5H20 A;  5BS6 A;  4XSX F;  2VON A;  4CDG A;  3Q0U A;  4B09 A;  1UG0 A;  2VKH A;  2X6W A;  2ZC2 A;  2A6E F;  2LSO A;  2PG4 A;  1FBU A;  1IRG A;  3ERM A;  3IH4 A;  2OCC H;  3TMO A;  1D1C A;  3E3V A;  3OYL A;  1AOY A;  3WU2 C;  1FIA A;  1GXP A;  3JCU C;  2LD5 A;  2LKX A;  3HXL A;  2HDD A;  1HA8 A;  2UV1 A;  1LPQ A;  5D5X B;  3CCR I;  3L2U A;  3SQN A;  2Z99 A;  2MG4 A;  5LLQ A;  1ZGA A;  1ZTR A;  4Y17 A;  5D6F A;  4M6Y A;  3WTY C;  1OYY A;  1C0W A;  1BW5 A;  1Z3X A;  2VJJ A;  4ENM A;  2A61 A;  1OKR A;  1G3T A;  2WAD A;  3JW4 A;  2M5W A;  1QU3 A;  4Q5S F;  1Z1D A;  1MH3 A;  2DOF A;  5JVT A;  3NRV A;  2HOT A;  1WFX A;  1QHH D;  4HBL A;  4I98 B;  3ZMS A;  1OIS A;  3K7A J;  4HZF A;  2QSG X;  1ZRC A;  1YJ9 I;  3Q3S A;  3A02 A;  1TW3 A;  2BEO A;  3WTZ A;  4EM0 B;  2L0K A;  1I1G A;  2V6E A;  3BRO A;  3GBG A;  1A5J A;  1XDU A;  1Y0N A;  2M34 A;  4FX0 A;  3MZ8 A;  1JXS A;  3PQK A;  3TO6 A;  3QQA A;  2NVX J;  3M3Y J;  4EJU A;  5E1W A;  2ZNY A;  3ZMD A;  2KRH A;  3UNG C;  3ERE D;  1U6G A;  2V1X A;  2EQR A;  2WY8 Q;  3QU3 A;  1WJC A;  4M72 A;  1DDN A;  2W00 A;  4WWC A;  2MBF A;  4A3D J;  3MD2 A;  2CV0 A;  1NG6 A;  4AYB A;  1BW6 A;  1Y6I A;  5HNH A;  2CUE A;  3HOS A;  4DYQ A;  4MLO A;  1G6N A;  3PNT A;  3I0T A;  3KEQ A;  3BCA A;  2JJ7 A;  5DS9 A;  1QO0 D;  2Z5U A;  1XMK A;  1RR7 A;  1P9Q C;  3DQV C;  3FDY A;  3R60 A;  1MGT A;  4HQE A;  4IRI A;  1TWG J;  2PI0 A;  2MAB A;  3ZQ7 A;  1MIJ A;  1V3F A;  2O0Y A;  2DA4 A;  4F92 B;  5IYC J;  1A31 A;  1T0F C;  1TQP A;  2O61 A;  4QPQ A;  1OCR H;  4E7I A;  4LD5 A;  3T0Y A;  5LD2 C;  2XAG A;  3ECH A;  3IAM 2;  4BHC A;  4L5I A;  3OYA A;  5C3E J;  2VBY A;  3TDU C;  4EJV A;  2W48 A;  2OZU A;  3WOD F;  2DYS H;  1DP3 A;  1S7E A;  2CS3 A;  2ZXJ A;  5IPA A;  3KP3 A;  3J80 K;  1VQO I;  5FLX K;  4AM3 A;  2RNJ A;  4E4H A;  1IN4 A;  1PUF A;  3QP5 A;  4IKF A;  1B4A A;  2F48 A;  1NK3 P;  2CQX A;  5JLX A;  4EMS A;  1U5T C;  4RAZ A;  4HW0 A;  1A36 A;  3FX3 A;  1DPR A;  2FE3 A;  4WXD A;  2NS7 A;  2XPU A;  1LDK B;  1ZLJ A;  2H6B A;  2LDU A;  4X0G A;  3E6M A;  1MKM A;  3SXY A;  3KX2 A;  1ZRD A;  3HDD A;  2X9D A;  1FEX A;  1T6S A;  2LG4 A;  2FU4 A;  1YI2 I;  4LG3 A;  4IHV A;  4MTD A;  1TC3 C;  3PNV A;  5DEQ A;  2EZK A;  4ZTF A;  4Z2Y A;  2QQ8 A;  3HRU A;  3SFI A;  2ZME B;  1BR4 A;  3ZRG A;  2OA4 A;  3MQ0 A;  3HL2 A;  4YFX F;  4XNF A;  3H92 A;  3G4S I;  3G1O A;  5C4X J;  1WJD A;  1D0Y A;  1KYZ A;  2HOA A;  4XLF A;  5DM6 F;  4NC6 A;  2LBF A;  3IH2 A;  3BZK A;  3ZP5 A;  3S16 J;  2OCE A;  3F6O A;  4MNU A;  4IRG A;  2P6T A;  3CTA A;  2W82 A;  4HNT A;  3PIP F;  2GIZ A;  3C2B A;  4G8X A;  4UB6 C;  5KCM A;  2HZT A;  1LDJ A;  4M3F A;  5GPA A;  3GWZ A;  2R7X A;  4ZYH A;  1J2X A;  1JJ8 C;  2OZ6 A;  2Q0O A;  1JTY A;  3QOE A;  3RKW A;  2Z2S B;  4HYE A;  4U7D A;  4AIJ A;  1K61 A;  5DM7 F;  2HQR A;  2XF5 A;  4HST A;  2VL8 A;  4RAG A;  2O5R A;  3OR2 C;  3ZXS A;  3JR9 A;  4JQF A;  1CQT A;  1X3Z B;  4LLG F;  1KU9 A;  4XSZ F;  1M1E B;  3RZD J;  2JUC A;  4II3 A;  4U0Y A;  4Y4R A;  1UEL B;  5LRS A;  1U5T A;  1PUF B;  4CZC A;  4IF4 A;  4E7K A;  3AG1 H;  3O6B B;  2R7V A;  4AWX B;  4DBQ A;  4L9N A;  2CUF A;  3FBI B;  3VB2 A;  3AAF A;  4RGR A;  1R23 A;  3I54 A;  4IHS A;  2WC2 A;  5HDK A;  3OYJ A;  1GV2 A;  2JZY A;  2YR2 A;  2IVM A;  1HCR A;  2V79 A;  2Z9O A;  5F0H A;  4N4O B;  5K5Q A;  3BR2 A;  3RPQ A;  3ZCO A;  5J47 A;  3F22 A;  4B1R A;  2HKX A;  3SFZ A;  4CCM A;  2XUB A;  3S3M A;  3MFK A;  1TWC J;  4MFD A;  2Y0S N;  4IVN A;  4BE1 A;  2EK5 A;  1YW7 A;  2M0C A;  2EBI A;  4ENN A;  1A6Q A;  1UHM A;  2TRT A;  1D5V A;  2LBF B;  4P96 A;  2IA0 A;  2DMP A;  1EKE A;  2GXG A;  1PDN C;  3CUQ B;  4AID A;  3PFY A;  2HEO A;  3BZ6 A;  3FZV A;  3TP0 A;  3LNQ A;  5BPI A;  4YFK F;  3U1K A;  4BAY A;  1JKP C;  2IS4 A;  4KIT B;  1QQI A;  3C3W A;  3GME A;  1YOV B;  4HOB A;  3CCQ I;  4UVC A;  3IRQ A;  3VEP A;  2ETH A;  3LFU A;  2MYS A;  3K1P A;  3K4J A;  3U9G A;  3HG9 A;  2JTV A;  2L9N A;  3QPL A;  1IXS B;  5L3G A;  1JT6 A;  3K4N A;  1HW5 A;  1STZ A;  2ID6 A;  4NC8 A;  4E70 A;  3JRG A;  1VFC A;  3L00 A;  2A05 A;  3VPR A;  2JA8 J;  1S72 I;  2A6T A;  4V2F A;  2DA7 A;  2E19 A;  4V19 K;  3UR3 C;  1U5T B;  2HYF A;  3MEX A;  4OU0 A;  1OQY A;  4FTH A;  1K7A A;  2HYG D;  1MMN A;  1XMA A;  3CMM A;  4EEF G;  2QYO A;  1LVA A;  4I01 A;  4UVA A;  3CF5 F;  1FYK A;  2XSJ C;  1LE8 A;  2A68 F;  3FM5 A;  2XHK A;  3H3Z A;  4ETS A;  2ZSH B;  4H0E A;  2L54 A;  1YHQ I;  4F93 B;  3I55 I;  2DDA A;  4L18 B;  3D5R C;  3SZT A;  4BXU A;  1WPK A;  1DPU A;  2KIS A;  4IPA A;  2VJI A;  4HRI A;  4ZZD A;  3CLQ A;  2OU2 A;  1GV5 A;  2ELJ A;  3WTU C;  3S1R J;  1VQL I;  5J40 A;  2Z1D A;  4B3X A;  5JHF A;  1YJN I;  4Q47 A;  2WWY A;  4HSR A;  1TWH J;  1FNN A;  5H6R A;  1IJW C;  3GTG J;  4PSX A;  3HM5 A;  2P5V A;  4GDF A;  3DXJ F;  4CO8 A;  1T39 A;  5A2Q K;  1KQ9 A;  3FIS A;  4D0P A;  4LIT A;  4IL6 C;  1IF1 A;  2NVT J;  2DMN A;  2DMQ A;  3VOE A;  3KPH A;  2R7T A;  2VC0 A;  3DKX A;  3I9V 2;  2M2E A;  3D0S A;  2WAF A;  1HW1 A;  1ON1 A;  3V7R A;  2X1C A;  2Z3Y A;  1FC3 A;  4RLF A;  1VQ9 I;  3PO3 J;  4YFN F;  4DW6 A;  4FE7 A;  3HBL A;  4EJO A;  3BJO A;  2PX9 A;  2O6G E;  3K6G A;  2H1K A;  3OYB A;  3KEO A;  3HSE A;  2L5Q A;  1IV6 A;  2W7N A;  5J6X A;  2L4M A;  2LY9 A;  2ZSI B;  5E18 F;  3JRC A;  3CP8 A;  3TO9 A;  1MBE A;  4A3E J;  4A0Y A;  5KVR A;  4L5E A;  1H0M A;  4ZYA A;  3KE2 A;  2CV2 A;  1S5L C;  3ZQQ A;  3E1S A;  2LKP A;  2K3F A;  3M07 A;  4LGW A;  4L0Y B;  2GA1 A;  3BDD A;  3HGY A;  2JMW A;  1QZZ A;  1S29 A;  2LF8 A;  4XLN F;  2M7B A;  3GFI A;  3H5A A;  1R1V A;  1WH5 A;  2X1D A;  3RQ4 A;  1D5Y A;  1WJA A;  1MMG A;  3MCZ A;  1R9T J;  1QVU A;  1VF9 A;  3ZQF A;  1K83 J;  1JUS A;  3DLA A;  1LE8 B;  4M3B A;  1K6Y A;  2N8G A;  2KIF A;  4BE0 A;  1H89 C;  1UB9 A;  2HDC A;  3GYH X;  2RC4 A;  1ZQ3 P;  1BA5 A;  2A07 F;  4LFU A;  5FKN A;  3C18 A;  2VBW A;  4BY1 J;  1LEB A;  1RC9 A;  2QSH X;  3RKQ A;  1A04 A;  1UAA A;  4GRI A;  3CDH A;  1FP2 A;  2FX0 A;  1MD0 A;  2FML A;  1FOX A;  3A0H C;  4BXF A;  3V8L A;  5DUK A;  3HOT A;  1D1B A;  1IAW A;  2WV1 A;  2XB0 X;  2DPU A;  3MZY A;  5L3E A;  5HOO A;  1UMQ A;  3U21 A;  4PK4 A;  1P6R A;  1W0T A;  4LOC A;  1RUO A;  2I5U A;  4XM3 A;  3DLL F;  2R7F A;  2V1D A;  4NB5 A;  5LEJ A;  4RGS A;  1R49 A;  3RDI A;  3ZN1 A;  3BG3 A;  3CCV I;  4XR6 A;  3IL2 A;  2W24 A;  4QPO A;  2IGN A;  3I59 A;  2L7Z A;  4RB0 A;  2BE5 F;  3RTR A;  3JRF A;  1OCT C;  2E36 A;  3MWM A;  3AG4 H;  1TWA J;  3HJE A;  3DPT A;  1SEU A;  2CMP A;  3H5N A;  3MKL A;  1S7A A;  4GCV A;  2OQG A;  4PJJ A;  2EA4 A;  2F6C A;  3LFK A;  1A6I A;  3JRA A;  2DAO A;  5L3F A;  4I2O A;  3KP4 A;  1I3A A;  2JVG A;  4G94 A;  5IYB J;  2EZH A;  2M8G X;  1J5Y A;  2F5C A;  5K7Z A;  1AWC A;  2D1H A;  3S2D J;  4F52 A;  5EG0 B;  1UG2 A;  1SAN A;  4U0V A;  3JRE A;  1LQ1 A;  5F08 A;  3LA3 A;  2VE9 A;  4D9J A;  4BJ5 C;  2I10 A;  2LK2 A;  2XKO A;  3J81 Z;  4IOC F;  3KFW X;  3PJR A;  2EIK H;  2M1B A;  2DJN A;  2XRN A;  4X6A J;  2PMU A;  1IZ1 A;  3NQO A;  3SDB A;  2VAS A;  4LG0 B;  2P81 A;  3K4B A;  3RKY A;  2XDV A;  4RLQ A;  3O3K A;  3TQN A;  5TJJ A;  3SDG A;  2WB1 A;  3AL0 B;  2Y0S A;  4ZYG A;  5HLI A;  1UHS A;  3SEQ A;  1LDD A;  2V9V A;  3RPU D;  1G3Y A;  2P5L C;  4R8H A;  3TDZ C;  2IA1 A;  4BH9 A;  3GTJ J;  4KDP A;  4E7S A;  2DDB A;  5ICG A;  1IUF A;  3DTK A;  1P7J A;  2RGV A;  3JAM Z;  3S2H J;  2L3D A;  2VXD A;  2BBY A;  4BGD A;  3JSO A;  3IKT A;  2NNN A;  3FXM A;  1O57 A;  3H35 A;  3FM3 A;  2K40 A;  1Z9C A;  3GEZ A;  2PEX A;  1TW2 A;  2F5D A;  2VQG A;  4IQJ A;  1TP4 A;  3R0J A;  3RIR A;  2ZJP F;  1AKH A;  5TRD A;  5FFX A;  2AXT C;  1KA8 A;  4W97 A;  3V7S A;  1X19 A;  2CFX A;  5M5X J;  2NAZ A;  1FOY A;  1H9G A;  2K4B A;  4ITV A;  1GVJ A;  4A6E A;  4HNU A;  2R7Z J;  3L09 A;  3GLX A;  3IH3 A;  5JFR A;  4HX7 A;  3E6D A;  3CJQ B;  2VPL A;  2AHQ A;  2E7W A;  3T1B A;  2OD5 A;  1XS9 A;  1XDS A;  2XPW A;  1E3P A;  1LKX A;  1B8I A;  2RKH A;  5GP9 A;  1MJB A;  2QUF A;  3WTX C;  5IY5 H;  4A0Z A;  1G8X A;  2LY2 A;  4C30 A;  2CO5 A;  2EZL A;  4FCY A;  1X2M A;  2IEK A;  3WHC A;  1XCV A;  5KK1 A;  2OQR A;  2QA4 I;  2R5Y B;  2E7X A;  3HPG A;  1J0R A;  3GX4 X;  2YU3 A;  2KMU A;  5CYV A;  4BBR J;  1YJW I;  1HSJ A;  3I71 A;  5CPR B;  2PFB A;  4NBQ A;  5CVR A;  5E3N A;  4FE4 A;  3TKY A;  2IXS A;  1ZK8 A;  1SVO A;  1RUN A;  1XGN A;  3OR1 C;  4KN7 X;  2KFD A;  1YYV A;  4G6Q A;  4OIP F;  1A35 A;  2K5C A;  3FXJ A;  1YG2 A;  1U2W A;  2VIX A;  4OAZ A;  2FD5 A;  2X6Y A;  3GTO J;  1IRZ A;  5K7F A;  3BG5 A;  2X6X A;  5FRM A;  2EH3 A;  5HLG A;  1U3E M;  1NH3 A;  4KN4 X;  3NWS A;  5D5V B;  3KET A;  1LNW A;  2FUG 2;  4U88 A;  2MD5 A;  1AKH B;  1I27 A;  3OOP A;  4ZYD A;  1O4X A;  3HZJ A;  2JSC A;  1ON2 A;  2RAE A;  1T33 A;  2R7Q A;  3LOC A;  2R7D A;  3LAP A;  1Y8Q B;  4F55 A;  2A6H F;  4HF2 A;  2JPB A;  2RRE A;  1O3T A;  1IN6 A;  2EA2 A;  1F36 A;  2Q8K A;  2IA2 A;  1BR2 A;  4D7N A;  3OIP A;  3EUA A;  4XLE A;  2AXL A;  3I4P A;  1B8I B;  2GWR A;  4AVP A;  3W2A A;  4DYC A;  4XKC A;  3PO2 J;  3LSM A;  2CQK A;  3PUB A;  4BDZ A;  5J8F A;  4IRH A;  3OY9 A;  4C2M J;  3M8E A;  4BQO A;  4G6D A;  2D45 A;  2HFH A;  1SAU A;  1FLI A;  2X6O A;  1FBS A;  3RCO A;  2Y30 A;  2X51 A;  5B3S H;  1R22 A;  3MAJ A;  2ME6 A;  3TED A;  3LA2 A;  3F6V A;  4NC7 A;  5ICE A;  2M4K A;  4DZP A;  2JK3 A;  3EET A;  2ZB9 A;  5F1J A;  1YTY A;  3CC7 I;  1Z7U A;  5L3D A;  1X1P A;  1DP7 P;  2G7U A;  5IOY A;  1OR7 A;  4HG2 A;  4P9F A;  2VBZ A;  4HDV A;  2L01 A;  1ONV A;  2V7F A;  4RGX A;  5B66 C;  4JBA A;  2R5Z B;  4BEH B;  4A12 A;  2L4A A;  1XGS A;  2HDW A;  5JR3 A;  5CJ9 A;  2PJR B;  3DBL B;  1T8I A;  3CLO A;  5D5U B;  1IC8 A;  4PJN A;  3S14 J;  1RR8 C;  3WG7 H;  4U7B A;  3A01 B;  4IHX A;  1P2F A;  3EDP A;  4XKB A;  4DOZ A;  1TT0 A;  5E17 F;  3W2W A;  1PVE A;  2W57 A;  3HOY J;  3BR0 A;  4AVZ A;  3H0D A;  2HU9 A;  4UHT A;  2ZKZ A;  3A03 A;  2E1O A;  3Q0W A;  5FGM A;  2P5K A;  2ZO4 A;  1N77 A;  2MLK A;  1FTZ A;  2D5V A;  1K78 B;  3J7A O;  2ZME A;  4DIQ A;  1XSV A;  3HC7 A;  4HQM A;  2WBM A;  4YG2 F;  3DU6 A;  4IOA F;  4ZDO A;  4ESJ A;  4HV6 A;  3OYD A;  3F8N A;  4CCN A;  4D5F A;  1X1C A;  3IC7 A;  4DBR A;  1H88 C;  1BR1 A;  1R1U A;  2BOL A;  3BG6 A;  1S3J A;  3FXO A;  3D5L A;  4B44 A;  4I99 C;  5FLV A;  1OCP A;  5CQG A;  3CUQ C;  4HX4 A;  2ISZ A;  3F21 A;  2DT5 A;  3GTP J;  3FXR A;  1XSX A;  3G71 I;  1TZL A;  4A2U A;  1SD7 A;  2R93 J;  1Z05 A;  1OCO H;  3S93 A;  3KP2 A;  1SD4 A;  2A5W A;  3GFJ A;  2LLK A;  2WAQ N;  2DT6 A;  2L7F P;  3TL4 X;  1JTX A;  3F23 A;  5GAE J;  1GXQ A;  2G9W A;  5CQE A;  3I4M J;  1ZG3 A;  2XAS A;  2BW3 B;  2A69 F;  2DK8 A;  2UUZ A;  3AG2 H;  2P7V B;  1Y1W J;  1BOA A;  2X85 A;  3ABK H;  3KP6 A;  3ISP A;  2CG4 A;  4C2U A;  3HIF A;  1X3U A;  3SEZ A;  3E7L A;  2D1V A;  4C9Y A;  3CC4 I;  2STW A;  3K4K A;  3GFM A;  3W6V A;  1FOK A;  4A3F J;  3SZP A;  1RET A;  2K9L A;  4MO7 A;  4NNJ A;  3LAJ A;  2L7M P;  2DA2 A;  4A93 J;  3A0B C;  1HC8 A;  1MH4 A;  3LQQ A;  3VDX A;  3LSG A;  5FD5 A;  1SFK A;  2QZ8 A;  4MQ9 F;  2RDP A;  2PBI A;  4M6X A;  1VQP I;  1USS A;  4LK1 F;  1EF4 A;  1RRJ A;  4XOR A;  2DBB A;  2DFH A;  3FXK A;  3COA C;  2MC4 A;  4PJM A;  2BY3 A;  1XPX A;  5L3B A;  2QVO A;  2RQQ A;  3HKZ A;  3EUK L;  2ME0 A;  5AON A;  5L3C A;  3HOV J;  1P7I A;  1MBF A;  1S8N A;  2D2W A;  5JLW A;  2JA6 J;  3TP3 A;  2RQP A;  1RI7 A;  4FIS A;  1FIP A;  5ED4 A;  3DBH B;  1IRX A;  3CUQ A;  1IN8 A;  1L0O C;  2JRM A;  3G3Z A;  3CCJ I;  1B9N A;  1Z6T A;  3L2V A;  2HOS A;  3F8M A;  1T2K A;  1T0F A;  5DUI A;  4YEL A;  2ID3 A;  3BR6 A;  5GTI C;  5M5Y J;  1APL C;  4BKX A;  4IHY A;  4MQV A;  3CCM I;  3DF8 A;  1UJ8 A;  2VT2 A;  2L7K A;  4FAS D;  1R6R A;  2W85 A;  1K6O A;  4BL0 B;  2QQA A;  4F91 B;  1KU3 A;  3WE2 A;  1VTN C;  3T8T A;  4QWQ A;  3DTE A;  1FWZ A;  1ETW A;  5E3L A;  2VJ5 A;  1WJF A;  2P0W A;  3GTQ J;  4UVB A;  3ABT A;  3RPU A;  3WHB A;  2E2H J;  3IV5 A;  4WXC A;  2P4W A;  1KQ8 A;  1SMT A;  3H9G A;  1HQC A;  1RKT A;  1XMX A;  4DJA A;  3KYL A;  2OTJ I;  5E3O A;  3K9T A;  2V4J C;  3ZR8 X;  2MLG A;  1AHD P;  2K7L A;  4PZJ A;  1MSE C;  1ZAO A;  3PM1 A;  1WQ2 A;  1Z77 A;  3V42 A;  3C7J A;  3ZMT A;  4E7Z A;  3P5J A;  5IT9 K;  3C2H A;  2HWV A;  1ORK A;  1WI3 A;  1R71 A;  2DTR A;  1NHA A;  1UHW A;  2X4H A;  1FP1 D;  3DV8 A;  2ELH A;  2FOK A;  1TWF J;  3REO A;  2O8X A;  1HKQ A;  2XB5 A;  3BTI A;  2QM3 A;  2A3S A;  2M30 A;  4FT8 A;  2OTL I;  2LNB A;  5F0F A;  5FKM A;  1YE9 A;  1IXR C;  3OV8 A;  1KYW A;  3H9Q A;  2GBY A;  4XLA A;  2JA5 J;  2FA5 A;  4BDY A;  2EIN H;  1MJ9 A;  2G0E A;  2HOE A;  3R0A A;  3OYE A;  1LVK A;  4YIR X;  1YRN B;  2VI6 A;  3W2V A;  3FXQ A;  2MGQ A;  3TO7 A;  4HLY A;  3CJR B;  1EJ9 A;  4PFP A;  4PDK A;  2DYR H;  4AUX A;  4HV5 A;  2YX7 A;  1U8B A;  3VSK A;  1V5F A;  3RKX A;  1IO2 A;  2IAI A;  2R7R A;  1MMA A;  3SJM A;  1WJE A;  1LUJ B;  2YPR A;  5B1B H;  2KJB A;  2LH9 A;  2NS8 A;  2CU7 A;  4JX4 A;  5DCM A;  1O3S A;  2E35 A;  1I39 A;  2M45 A;  3QRF F;  2DFF A;  4BHP A;  1R7J A;  1TT5 B;  1RKW A;  2F2E A;  2JA2 A;  2LFB A;  2R7U A;  1HBX G;  4V2G A;  1VQ6 I;  4B4C A;  1G59 A;  1REP C;  3CCE I;  2FJ1 A;  1IDY A;  2DA6 A;  5IOZ A;  2DLL A;  2CQN A;  3IWZ A;  3E5U A;  3TW6 A;  4IEJ A;  2E1M C;  4P1W A;  5KHD A;  1HLV A;  2EPF A;  3QPH A;  1SFX A;  4XRF A;  3L2C A;  2HGC A;  2X1E A;  3K69 A;  2FNA A;  4HLX A;  1RZ4 A;  3U1D A;  4KA4 A;  5EDN A;  2NNY A;  4YII A;  4EAT A;  1ZR4 A;  1JI8 A;  2ZFW A;  3S1M J;  4HAM A;  3WG9 A;  4EVI A;  3QP6 A;  3FK7 A;  4A3G J;  2H1L A;  2W1O A;  2GOX B;  1JUM A;  3L2W A;  2FBI A;  3DEU A;  3OYN A;  2VKD A;  5K5R A;  2K3P A;  5BPD A;  3DFG A;  4M3E A;  2HNH A;  4L9T A;  5FB2 A;  3IAS 2;  3M8J A;  2QGU A;  4X1E A;  3ESW B;  2ZXI A;  1P4X A;  1FJL A;  1XCB A;  1MMS A;  2DXI A;  2KDO A;  4XKW A;  1YIO A;  1X58 A;  2CRG A;  3FXL A;  3K4C A;  3AL0 C;  1W36 D;  5GAG J;  2DMU A;  2AQE A;  2DU9 A;  2P8T A;  2IP2 A;  3V8K A;  2XPV A;  1SVM A;  1V54 H;  1YLF A;  3HEF A;  4XN3 A;  3QYB A;  3BT9 A;  2DT7 B;  2Q2E A;  4IQ4 A;  2Y0M A;  1XD7 A;  2K86 A;  4NUB A;  4QTR A;  3UKG A;  1RIO H;  2V1U A;  5F27 A;  3WTW C;  2G7H A;  5DCM B;  1G2H A;  4KFC A;  3OYG A;  4L9V A;  1BOB A;  5IP6 A;  1F1Z A;  1BI0 A;  1XSD A;  5LRR A;  2QKL B;  4UXN A;  3A2K A;  4A5M A;  4IHW A;  3OS0 A;  5AIP A;  4F7Z A;  3L2R A;  3F0C A;  2EV6 A;  2IS6 A;  2EWN A;  3FKI J;  2FMY A;  1ZN2 A;  2K9Q A;  3ZMZ A;  3L2Q A;  1E3H A;  2BXZ A;  4CCO A;  3I53 A;  3ZPL A;  2H94 A;  4O3M A;  3F8F A;  4P9U A;  1V4R A;  5EG0 A;  4A3J J;  1U78 A;  2NXN B;  5HLH A;  1FMV A;  2XRL A;  1ZLK A;  3QPS A;  1ENH A;  2HQ5 A;  4MFE A;  2VB6 A;  3CCL I;  2DPD A;  4E7L A;  2QEN A;  4Y52 J;  2L9S A;  2F4O B;  4P5O A;  4M71 A;  1R4M B;  3H0G J;  3CCS I;  3J80 Z;  4PFO A;  1YX3 A;  5FLX Z;  4A3K J;  5C4J J;  1MDM A;  3EUH C;  4N9H A;  1BI2 A;  5D6E A;  2COB A;  3IUO A;  2JT1 A;  4XIC A;  2EFQ A;  3GF2 A;  2DA3 A;  4CGZ A;  4LG0 A;  2CQQ A;  4GYI A;  1VQN I;  1MZB A;  4OMY A;  4KMF A;  5ICC A;  2YU9 J;  4HF1 A;  1B59 A;  1MMD A;  2FBH A;  4NDL A;  3VYT B;  1HW2 A;  4RB2 C;  4XBF A;  5HDG A;  3P9I A;  2QEX I;  1D0X A;  2K9S A;  4MEY F;  3MMY B;  2MC3 A;  1WZ2 A;  3ABM H;  4WK8 F;  4Y33 A;  1HOM A;  2E34 A;  4GYG A;  1JE8 A;  3EYI A;  2VKE A;  2CWE A;  3IKV A;  1JT0 A;  1FZP B;  2H27 A;  2F5V A;  2E2J J;  2RV8 A;  2K9N A;  3Q9S A;  2CH0 A;  2BYV E;  2Q2E B; 
#chains in the Genus database with same CATH homology
 1R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...