1R71A

Crystal structure of the dna binding domain of korb in complex with the operator dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
EADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*(BRU)P*TP*TP*TP*AP*GP*CP*GP*GP*CP*TP*AP*AP*AP*AP*G)
publication title Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 41
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08535 KorB KorB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A KorB DNA-binding domain 1r71A01
1R71A
chains in the Genus database with same CATH superfamily
3V7SA 4M3BA 2XAJA 1JTYA 3E6DA 1XB4A 3HJEA 3HDDA 3FXMA 1TT5B 4II3A 4L9NA 3V8KA 3CLOA 3OYHA 2HZDA 3RQIA 1MSEC 4A3KJ 1MH4A 3GTGJ 5JHUA 1BJAA 4HF0A 1JUPA 2KIUA 3ZMSA 1ZTRA 3IL2A 4XL9A 1Z7LA 2JSCA 1A31A 2VC0A 3C2BA 2AQFA 3DKYA 4A0XA 4E7IA 2CV2A 1JXSA 1IGNA 4HLXA 1A6QA 1FBUA 2FBKA 1VQPI 3RPUA 3HYIA 2CW7A 2Z1DA 4A3IJ 2EINH 1X2NA 3ZRGA 2PJRB 4RB1A 5EDNA 5CVIA 3SFIA 2KIQA 1DU0A 5IY5H 3BJ6A 5DYMA 5IYDJ 2W24A 3FXKA 3PNYA 4RGUA 4RB3C 4Z2YA 2J5OA 3IAS2 3SHFA 2HTJA 2VQHA 2CRGA 4A3MJ 1UHWA 2IS2A 3DTEA 2CFOA 2R5ZA 3OMYA 5LHIA 2EILH 2STWA 3L9FA 3JTGA 2OCEA 3KPHA 1J0RA 1CF7B 2XAGA 2DK8A 2VBWA 5GTHC 1MZBA 4E7LA 2MC3A 3DLLF 4XKCA 1H8AC 2QSFX 3WG7H 1FX7A 3TW7A 4RS8A 2FE3A 5CLSA 2ZMEA 3BZCA 4BY1J 3FWEA 1TW2A 3DPTA 1JKPC 4MTDA 3DBHB 3S17J 3M1EA 2CQNA 1WJEA 2MLKA 3BJOA 4NQWA 1ZH5A 3OR2C 2Z99A 4I99C 3GO5A 4FQGA 5TISC 3HHHA 3PFIA 1IAWA 3KEYA 4XRFA 3K10A 3AFHA 5L3EA 2BVLA 1QHHD 3AG4H 2QZ8A 3HSFA 3K7AJ 4CCNA 4AVZA 2M8GX 3OS1A 3OSFA 4XKBA 2HR3A 3P9IA 4EJOA 4G8XA 1QZEA 2VBXA 2QSHX 1QPIA 3LQRA 4AIDA 2JTVA 2ME6A 2EFOA 2FF4A 3JRCA 5JVGF 3G1OA 1T6SA 4YFKF 4AYBN 2XGXA 1SC7A 2PJPA 3GLLA 3R4KA 1FEXA 1MBKA 3I4MJ 5F08A 2OU2A 4II2A 3TO6A 3CO6C 3LSIA 3CTAA 1QBJA 3KX2A 4UV8A 4BNCA 4BHCA 1JKOC 1X1DA 2OUMA 4HYEA 1RPWA 1L0OC 4WXHA 1X1CA 3CCSI 1VNDA 2Y48A 3MZHA 3N97A 2X1DA 1B8IA 5F0CA 2OPTA 3RDIA 4IOAF 1ON2A 2L54A 4A0ZA 4NBQA 2EQRA 4IRGA 3MMYB 3GVAA 3IKTA 3I58A 2FSWA 2E7WA 4GXOA 2DMUA 2QLZA 5DTDA 3BR2A 4CYCB 1GXQA 1Z7UA 1GVJA 2XVCA 3SDBA 4A12A 4A93J 3BWGA 1YX5A 3FKIJ 4CDGA 3RKXA 5D5XB 1P92A 2L0KA 4G9YA 2V1XA 3OOUA 3J81K 2QEXI 1GT0C 1JUSA 3NEUA 3NAUA 3LNQA 2VKDA 3S3OA 4DZPA 1LDKB 1OFCX 3HRSA 1FC3A 5DCMA 3FXUA 5D6FA 2ZJQF 2VL8A 2AQEA 1OYIA 3HM5A 1F9NA 4YRVA 3A0BC 2OTJI 2EA4A 1YW8A 2HQNA 4CZCA 2ZFUA 1SFOJ 4UVAA 4U0VA 2KDOA 2XB5A 1RI7A 2XAFA 2GIZA 3BC8A 3BR6A 2R7OA 2R4GA 3ZPLA 1NG7A 3LSJA 4V2GA 3ZMZA 4PJLA 2L9NA 1YQAA 3WTSC 3T8RA 3ABKH 2ZCWA 3CP8A 4AIJA 5H6RA 2VI6A 3O6BB 1BR1A 1Z3YA 2IAIA 2ZO4A 4N9HA 1HDDC 1TLHB 5AIQA 1EA3A 1KGSA 5HDNA 3RCOA 2LY2A 3MAJA 3HOUJ 4OMYA 4MQVA 4FE7A 4IJAA 1ZR2A 3COAC 1SAUA 2DW4A 4AU7A 5FLMJ 1FY7A 2LD5A 2M0CA 2LVSA 2WY8Q 2ZFWA 4L9TA 3OY9A 3CLQA 3MZ8A 1Y39A 2IXSA 1FOYA 1Y6IA 2LH9A 1XDUA 2M2EA 4HNTA 2O9LA 3R6SA 3DV8A 1LDDA 3NWTA 4C2UA 3W2AA 4OAZA 4NC8A 4CSWA 2H6BA 3F23A 1A36A 4XLAA 3OYGA 3K4MA 5F0FA 4NHJA 1TNSA 1IN5A 3ZQQA 4GYGA 1ZREA 3KP3A 4ANJA 1X3WB 3HGYA 4A3BJ 2ECBA 4CZZA 4Y33A 3A4CA 4IL6C 5J4VA 3OL4A 2PJRA 2ZB9A 5EZHA 5HLHA 4PJMA 2EJRA 2MFZA 2M0MA 4IPAA 1SD7A 1BR4A 4V19K 4EV0A 1WFXA 2XF5A 4RGXA 1DP7P 1YOVB 5LFAA 5E1WA 3TEDA 3L2CA 2QCOA 2UWMA 1W7PD 1HW1A 3HOVJ 5D4SA 1YI2I 1HSTA 3SEZA 2WAQN 1CF7A 3TQNA 2DT5A 1WPKA 3SYTA 1RR7A 3FM5A 4GRIA 3OYCA 4LIUA 4A6EA 2LR8A 3IWFA 4HW0A 1FBQA 1AOYA 2M34A 4EGYA 3WHCA 3UR3C 4ESJA 3N4MA 3HOXJ 1I1SA 5EEHA 3C1DA 1R00A 1R5HA 2M1BA 2V1NA 3FXRA 5GTIC 3WTXC 1RUNA 4E7SA 3ZMUA 1OMIA 3M9AA 1ERDA 3OOPA 1H9TA 1R4NB 1VI0A 3BG3A 1MMGA 1K78A 1D8JA 3BG9A 3LFUA 2VODA 1KU9A 4ON0A 3BY6A 1LFPA 4W1UA 4BBRJ 2BY0A 2TCTA 4BYYA 1E0EA 1MBJA 4LK0F 1T8IA 3GFMA 3O8HA 4XN0A 1Z6TA 1R4MB 2QKMB 3LAJA 4AUXA 5D5WB 2HXOA 3BDDA 4Y17A 4IOCF 2EV6A 1UJ8A 3WGIA 1FIAA 3BLYA 4C3HJ 2OTLI 1GXPA 4ENKA 1AU7A 1MJBA 1QRYA 2G0EA 3JTHA 4KMUX 1N75A 2ESNA 5B3SH 5B66C 2HQRA 1IW7F 1SANA 4JBAA 1D3YA 1YYVA 2VN2A 4XLHA 4U88A 1K4TA 1WVRA 4BUPA 1FPQA 1WI9A 2BEOA 3K0LA 1Q1VA 1XMXA 1CQTA 1WKMA 4JOMA 2CQXA 5A2QZ 2DJNA 3BTLA 4CXFA 1IXSB 1TWCJ 1JT0A 3BCBA 1ZGWA 2OBPA 4WF2A 1LB2A 1WCMJ 5E8GA 1PJRA 2GOXB 2CQ7A 3DXJF 4ENJA 4RB0A 1W7PB 1H88C 2PFBA 2IGKA 1ENHA 4OIRF 3GFLA 2MLGA 2XKOA 4CYCA 2EFWA 3DLAA 2M45A 4G6TB 3ASOH 4XOPA 2OQRA 3CF5F 2HYFA 2XGDA 2I10A 3LSKA 2COMA 4PJ0C 4B3AA 5BMZA 5TJJA 1D0XA 4MLOA 2R7DA 2JVGA 2EIJH 1YHQI 4MFDA 5F64A 4Q4ZF 1NG6A 5J8CA 4U7DA 1QHGA 3E6BA 2ACJA 3V7RA 2R5YA 1YG2A 3Q9SA 1SMYF 3B73A 1W4MA 3OWTA 4RB2C 3HEFA 2P4WA 1IZ1A 3OYIA 2A61A 2ZJPF 3VYTB 4BGDA 1TP4A 5FKLA 5HDKA 1R1TA 1YIOA 1POGA 2LBFB 5TGTA 2D1VA 3GYHX 4FISA 4HG2A 3G6EI 2IP2A 1WH5A 1YW7A 1BA5A 2V6CA 1R6RA 2Y2ZA 4M6VA 4G7ZF 4DYRA 3V7CA 2ADUA 2DTRA 2E7XA 1FSEA 1LUJB 2R7WA 1LFUP 2M9HA 3W6JB 2NS0A 1R36A 2KHMA 2QBYB 2ISYA 1WJCA 1X1BA 1KYWA 3RPQA 3PNTA 3OSGA 5HS8A 2NS8A 1LPQA 5LEJA 2KL4A 1A04A 4QLCU 4A0YA 3AG2H 2HYJA 2IA0A 3CCEI 4BU2A 2YSRA 2HVRA 3FBNB 4HPQA 2NS7A 4XN3A 5CVRA 5ICCA 2XV4S 2LKSA 2O3FA 5D5VB 2XSJC 4CGZA 2CQQA 3WODF 3EETA 3ZN1A 5FLVA 1E3HA 2XF6A 1S9HA 3PSIA 4V2FA 3MKWB 2ZXHA 3C2HA 2UXNA 5K5RA 1MNEA 2RV8A 1YRNA 2DK5A 4BJ6C 3EUAA 5LRSA 1W1WE 3F8BA 1ON1A 1IXRC 4MIMA 5K7ZA 4HAMA 1K7AA 2BW3A 5KAFC 3TDUC 2RDPA 4CYDA 3H5AA 2WY7Q 4NDLA 2DDBA 2D45A 3GCMA 4LMYA 5E79C 3T1BA 5LBQA 3M8FA 3W2WA 1D5VA 1IF1A 3CP2A 2HI3A 1O4XA 1WJBA 3M8JA 4U0YA 5E20A 3ERED 3KEQA 1TWGJ 2F4OB 4GFBA 4KMFA 2FEZA 3SQNA 2DXIA 1V4RA 2DI3A 4QSHA 2ID6A 2HQ5A 2DA6A 4L0YB 3HIFA 1ETKA 1P7JA 3HOSA 2O03A 1D1CA 2VBYA 2LK2A 3DFGA 3PNVA 1LEBA 1GV2A 2R7QA 5FLXZ 4M6YA 4CHUA 3E7LA 4D7MA 2QA4I 4A5MA 2WA0A 3RIRA 4CUGA 1U9NA 5JLXA 2GM4A 2E19A 1RNLA 5B5EC 3ASNH 5ICFA 2XAHA 1XS9A 2E1OA 1B59A 3IHUA 1JKQC 3CCMI 2PLYA 4GCVA 1DGRM 2DYSH 2LFBA 3D5SC 1ZN2A 3GTQJ 1IRXA 1OQYA 4MTEA 4B48A 3IKVA 5LGTA 2GXGA 1J09A 1WWXA 2XPWA 2BXZA 3TBIA 1ZLJA 1S6LA 5FO5A 2GWRA 4L9JA 4ZYDA 4LG0B 3UKGA 3ECHA 1QVTA 2A6HF 3JRGA 2BE5F 3C2GA 2HZTA 3O8GA 3BQZA 4PK4A 2W84A 4RAFA 4Y13A 4IEJA 1EJ9A 2DA3A 1EH6A 3HBLA 2B7EA 2E1MB 1FYKA 3HSRA 5H20A 2FOWA 4Y4RA 4UNOA 1MJAA 2DTZA 2V79A 4RMNA 2Y9ZA 1Y1VJ 2OD5A 1JGGA 4UXNA 3HTSB 4CH7A 2P5KA 1MBFA 2DQLA 1D0YA 4PGHA 3K4NA 2P6SA 2Q0OA 1TNTA 2B0LA 5F6FA 1BL0A 3KFWX 5FFXA 3GFJA 1R49A 2K9LA 4L5IA 5K5OA 1BI0A 2MD0A 1JTXA 5EGOA 2NRAC 2IGOA 2RNJA 2ZXJA 1PP7U 3IH2A 1W7PA 2OZ6A 2WAEA 3H3UA 2M8EA 2IS6A 2NOGA 3HB9A 1W5TA 2CUEA 3DWLE 2MA3A 5J1YA 2Q2EA 3ZQLA 2ZXIA 4F3QA 3KEOA 3WE2A 3BG6A 1MBHA 1OCCH 2M87A 2KRHA 3QYEA 1G2HA 5HODA 2IW5A 2VBZA 3H9GA 4JK1X 1TQPA 2Q8KA 4ABZA 5B1BH 4EJWA 5E18F 4WXDA 2VT2A 1A5JA 4E7KA 4XSZF 3J80K 3ABUA 1R7JA 3ISPA 1N77A 4YFNF 5BPIA 1UELB 4XRSG 4BDYA 4KUMA 3RKYA 5IOZA 2BGCA 3K69A 2QYOA 3GX4X 3BJAA 3PO2J 2AS5F 4XKVA 3VSKA 2IRFG 4IHVA 5E3LA 3S14J 2YS9A 2R7XA 2QENA 4BAYA 2XGCA 4E7ZA 2EWNA 4XONA 4KIGA 2FX0A 4BACA 2DFFA 2IJLA 1ZRCA 2FMYA 2JA8J 1ZHFA 4UHTA 2QBYA 3SZPA 2HNHA 5E3MA 2LTPA 4AIHA 4BQOA 2K86A 5JVTA 2ZNYA 2VKVA 2F5VA 3FZVA 4ITVA 4FCYA 4ZYGA 1O3TA 1IN7A 1P9QC 3G1LA 1MKMA 3GTPJ 4X6AJ 4ZYHA 2X51A 1QO0D 1U5TB 4ESBA 4G7HF 2KLOA 1WHUA 4KT5C 3L00A 2VB6A 4D5FA 1XGMA 4F92B 3IRQA 1T39A 1BBYA 1YO5C 2RAEA 5FKOA 3BTCA 2EZIA 3JRDA 1JHFA 2O6GE 3NRVA 2VJIA 1VQ6I 2HXIA 3A03A 4ZH4F 2K9SA 2X0LA 3PIPF 4C3JJ 3FM3A 3GXOA 3HGGA 3I9V2 3PUFA 2ZJ2A 1XX5A 4P5OA 1ZQ3P 4LG3A 2A6EF 1SAXA 5D5UB 4JX6A 3I3LA 3E5QA 3RYPA 2RKHA 5DCFA 4XKWA 1F4KA 1Y0UA 1R71A 3QQAA 1MMSA 5JI6A 5LHHA 1I6XA 2YPRA 1K4SA 5IP6A 4KNYA 3S8PA 4OWRB 3JREA 2JRMA 3ZOBA 2KQRA 2VPLA 2L7ZA 2O7OA 1PDNC 2QSGX 3ZXSA 2FA5A 4Q5SF 1FMVA 3RZOJ 1S8NA 1P2FA 4PCQA 3K4KA 5EZGA 1X4PA 4G6DA 4Y15A 4D5CA 5IT9Z 2AO9A 1HKQA 4B1RA 1NK3P 4PJNA 1IO2A 4PGGA 2CWEA 4HLYA 2G7UA 3H92A 3HUGB 1MDMB 2DA1A 3H5RA 4LK1F 1U0JA 2H94A 2B63J 1NK2P 2CW8A 4MNUA 4ENNA 2D1HA 2ISZA 5F04A 2DU9A 2K85A 1Z6RA 2GIVA 1XPXA 4J19A 4F52A 2VQLA 4CCMA 3IAM2 1RZ4A 3BCAA 4XOTA 4PJJA 2KT0A 1BJZA 2BOLA 2WADA 1BC8C 2JT1A 1IDYA 3DQVC 1P4AA 1ZARA 1WJAA 3F6VA 3KYCB 3S1RJ 1PP8F 2FNPA 2LY1A 3G71I 1U78A 1YE9A 2E35A 1HW2A 3CJQB 3CUQB 3CMMA 2KRFA 1FZPB 3VFZA 2L3DA 2CUJA 1VF9A 3QAHA 4JYKA 1TTYA 2ELKA 4ZC3A 3KZZA 4C2MJ 1FOXA 2LMDA 5BS6A 4BQQA 2HOEA 1ULYA 2DA7A 1WH7A 1TWAJ 2WV0A 3M8EA 3F21A 2LC2A 3EQLF 2LY9A 1MMDA 3PQKA 3LMMA 3R0JA 4L5EA 4O5VA 3DP7A 3K70C 2F5EA 3H9JA 2R0QC 3KYLA 4ZZLA 3CCQI 2JPCA 1L3LA 1G3TA 2JUGA 2X1CA 1B72B 1ACIA 2H1LA 4BDZA 3HOTA 1BN5A 4IZZA 3LQQA 2ME0A 3RTRA 5C44J 3MKYB 2VASA 3M4OJ 3P9CA 3CC4I 3GFIA 1DGWY 3JAMZ 4FE4A 2W85A 5DEQA 1RKWA 2IPQX 4RM3A 3Q0WA 5HOOA 3PM1A 2Y9YA 5DV5A 3S2DJ 2UUZA 2HEOA 3OYJA 3E0JB 5J1RA 2MYSA 1FP1D 4ZDPA 4A69C 2Z3YA 4YIIA 4HV6A 4L18B 3ZMVA 3DEEA 4BY7J 5EF6A 1O7FA 3H9QA 4HRIA 2O8KA 2NVTJ 3TKYA 3R61A 2DFIA 3D0SA 1TQMA 5DUIA 5HVQC 2EIMH 2Y30A 2XB0X 2VT3A 3H3VK 1I50J 1QQIA 3BG5A 3HXLA 4N4OB 3FXOA 4MFEA 1S5LC 5CVUA 2KJBA 1MBEA 2VJ4A 5GAHJ 3DEUA 2BYVE 5D4RA 5BPDA 2TDXA 2JN6A 2D5VA 1S7EA 2JA2A 4X0GA 3CJRB 4B3XA 1IUYA 4Y52J 2GZWA 3ECOA 4UVBA 4M3EA 2DYRH 4PSWA 1X1PA 4KIFA 4BH9A 1X2MA 3JRAA 1O3SA 1ETOA 2P81A 3RKQA 4A3LJ 3BZ6A 2BHYA 1OYWA 3QP6A 1VFCA 1J75A 2M4KA 1T0FC 5J47A 2I8DA 1G8XA 1KONA 3JRHA 2JSPA 4FTHA 2A3SA 4AIKA 2RQQA 5EEGA 2V6EA 5EYRA 1V55H 1Z91A 2HPMA 1TT0A 1XN7A 2HDWA 2PMUA 2PMZA 3FIWA 2A6TA 4BE2A 3HOYJ 1KYZA 4CCOA 1LE8B 3F0CA 4YELA 3EPZA 4HQMA 1S3JA 5HNFA 3H0DA 1RRJA 1V54H 1W0TA 2VC1A 5M5XJ 4H4KC 1EV7A 3KZYA 1B9NA 2GAUA 3P5JA 2G7HA 1NHAA 4HOBA 4Y3OA 3K70D 1G6NA 1NH3A 5IYCJ 1LQ1A 3EYIA 2ZXWH 1T56A 5HLGA 2Z2SB 1X3ZB 4AWXB 1YITI 4K2EA 5CPRB 1E3PA 3U1KA 2XF7A 3T8TA 3DPUA 4EVIA 4EATA 1K6OA 1WI3A 3ROUA 3OYMA 3S3NA 3C7JA 3HPGA 4XLEA 3I64A 3K1PA 4S0HB 2GBYA 4JP0A 2EZLA 4B44A 2E34A 2HTSA 3CO7C 2EPFA 3VEPA 3CDLA 3BR0A 1VZ0A 1K83J 4I76A 5ERIA 4U0WA 2H27A 1X4OA 2NVUB 2K9MA 2WWYA 4F7ZA 1O7LA 4I01A 4I09A 1BI2A 1SD5A 2CO5A 3C3WA 3WU1B 3IP4B 3CCLI 4QWQA 2MC4A 1IRFA 4BXFA 3VB2A 4ZDLA 4AD9A 3WTWC 3OR1C 1MDMA 3VPRA 5K5QA 3DKXA 4IX7A 3SDGA 1ETXA 2JUCA 3U9GA 2HVSA 3HTUA 3BP8A 3CZ6A 4U7BA 1DDNA 1GV5A 2W82A 2UZKA 5EEAA 2D2WA 1R5ID 3KETA 5IPAA 1JT6A 2KISA 3FISA 3H35A 3BOQA 3S32A 3Q0UA 3CCUI 3ONQA 1QZYA 5FGMA 2VIXA 4C2TA 3QRFF 1D1AA 2NVXJ 1EH7A 2RC4A 3OYFA 2JA7J 3K4LA 4M9ZA 2IT0A 1UHSA 2VPRA 3BR5A 4PSXA 5E1XA 2W4SA 2FBHA 2ZKZA 1XD7A 2VXDA 1YW9A 3HPHA 3DF8A 1HQCA 1J9IA 5KHDA 2Y0SA 1IRGA 4BS9A 4GDFA 1Z3XA 3MD2A 3HRUA 2E1MC 2KIMA 1DPUA 3QPTA 2V1UA 3CMYA 3TL4X 3M07A 4OIPF 5CVJA 3K2AA 3JW4A 3WU2C 5LRRA 4A3JJ 2X4HA 5CQEA 3J81Z 1T98A 5EG0B 4S04A 5IP7J 3BR1A 5B1AH 2NVYJ 4I2OA 2QVOA 2DMNA 2FD5A 1U9OA 2HFHA 4UB6C 3B02A 3BROA 4UUSB 3CCYA 2R93J 2K7LA 2VJJA 2A5WA 4E7JA 1NTCA 2I5UA 2E5NA 1H9GA 2K02A 1V5FA 1LKXA 2L9SA 2UXXA 4ZTFA 1V5GA 3FXQA 2FQ4A 4YG2F 2VLAA 3FK6A 2NNNA 1B1BA 4AM3A 1BIBA 1BW6A 2RVCA 2LKXA 2HKOA 4KITB 4BL0B 2R7TA 2QF7A 2A5YB 1UAAA 3MWMA 4LFUA 1W5CC 3HRMA 4G7OF 4IHSA 4UV9A 4UVCA 4IHWA 3RQ4A 1UG2A 5L3DA 2K27A 3DCFA 1U3EM 1XC5A 2L02A 4CICA 1FIPA 1RESA 1TC3C 1RR8C 3H1CA 3RYRA 3LSRA 3MKLA 4LJZF 3WHBA 1P4WA 2HOAA 2AHQA 3ZQCA 3C18A 2OZUA 3FK7A 1KA8A 2HKXA 1ETQA 3M3YJ 4XK4A 3KP5A 5JR3A 4O6JA 4O3MA 3K6GA 3LA7A 4D9JA 3TP0A 4IHTA 1XSDA 5ICGA 1T38A 1U5TC 1G3WA 4W97A 2MGQA 2MBFA 2GOMA 2X6WA 2E1NA 3L2UA 2FBIA 2ZJRF 2JA5J 3OYEA 1HKSA 3G2BA 1ZRFA 2A07F 2HOTA 3FF5A 3J7AY 2LNBA 4NUBA 4DBQA 1ETYA 3VOEA 1BI3A 5JFRA 2QKLB 3GZ6A 3FXJA 4KIBA 2MH2A 4IVNA 1OR7C 1FMWA 4CCKA 2HOSA 3I4PA 2X6YA 2OA4A 3ZN0A 3F22A 1TWFJ 2KMUA 5E3OA 2W7NA 3AAFA 6PAXA 3IUOA 1SVOA 3CQZJ 2YU3A 2E71A 2LYCA 2E2JJ 1VQMI 2Z33A 1RUOA 1VQ5I 5KCMA 3GBGA 3HG9A 4N0BA 5BNGA 2Y69H 1KQ9A 2KZGA 2JMWA 3EUHC 2ZBKA 1B9MA 1I3QJ 4Q48A 1Z05A 4E7HA 3H0GJ 4KT6A 5K7FA 1AKHB 4B4CA 2QWWA 3W6KB 4P9UA 3CC7I 1B4AA 3MQ0A 1I3AA 5F1JA 4KN7X 1OLTA 5GADJ 5LHGA 3QPLA 1VTNC 2M7BA 2CH0A 3MFKA 3KE2A 2VOOA 4HX4A 5AONA 1HLVA 2WC2A 5F0HA 5FKMA 2WAFA 3HL2A 1IDZA 4ASNA 1SD4A 1XTAA 2ZMEB 1STZA 2PMZN 2KFDA 2L4AA 3A0HC 2EBIA 1ZELA 4Q47A 3F72A 3FHZA 4HV5A 4HSTA 5L3GA 2R7SA 2CS3A 3DU6A 1K6YA 2BVMA 5ILVA 3VODA 3CCRI 4NQWB 1H0MA 2DDAA 1BR2A 2EV5A 3LSHA 3PUBA 5FKNA 4J01A 4IXAA 4RBOA 3S3MA 1F36A 4RGSA 3QOPA 3S15J 2K5CA 4EM0B 3CUQC 1HDPA 2CU7A 3LL7A 4A3CJ 3E6MA 2LRDA 4NNJA 2F5DA 5CQGA 4PZJA 2CSOA 3GTJJ 4M72A 4RGRA 1ODDA 4HF1A 2IS1A 5ED4A 3BTJA 4A5NA 1IN6A 2EFPA 3IV5A 2X6XA 3ZQIA 3CD6I 3W2VA 4G6QA 4P1WA 4DZJA 1ZR4A 1T95A 3BPXA 1U8BA 3T5XA 2EK5A 1V3FA 1Q1HA 3FMRA 4B8XA 2PQ8A 1FLIA 2KJCA 2DT6A 4CO8A 1IG7A 1VQ8I 4XLNF 3LAPA 2K4BA 5BQTA 2HVQA 2PI0A 2EIKH 3F8NA 3ABLH 1ZAOA 1IXCA 2M4GA 3TO9A 2DA2A 4FASD 4P9FA 3U21A 2K40A 1N25A 4BQAA 4M71A 3MKZA 1E3OC 2QQ9A 4YEJA 3QYBA 3UNGC 2F5FA 5D8LB 1OYYA 2DQRA 3I0TA 5FD5A 2VE9A 1B8IB 1QA6A 2CGPA 1E2XA 3GUDA 3WE3A 1TBXA 4IQ4A 3CC2I 2IGMA 3S1MJ 3PSFA 2K3FA 4UUTA 4HX8A 5JHFA 5LGNA 3A2KA 4E70A 1J7KA 4Y7NJ 1XMAA 1HKTA 5LGUA 3BTIA 4WK8F 3GTLJ 5FRMA 4DNCA 2IVMA 3I59B 3SEQA 4I7HA 2IS4A 2X6OA 2XASA 5DD4A 4ENMA 1C0WA 3PQJA 2LF7A 2LOOA 4RAGA 3S2HJ 4OIQF 4RAYA 3CJTB 4H0EA 2JRTA 2JK3A 4RAZA 3RKWA 2NYXA 5HS7A 3ZR8X 1EH8A 1AA7A 4ZTJA 2L01A 4A3GJ 2LBFA 1ZGJA 4RDUA 3WTVC 4OINF 1BIAA 2DMQA 3BT9A 3I4NJ 2E2IJ 2JZYA 1T0FA 2HPIA 3JSPA 1Z0XA 1XSXA 4TV7A 3T0YA 1WJ5A 2DOAA 4HX7A 5DS9A 2MABA 4B47A 3O2PE 1SFEA 4UUVA 4WCGA 3H3ZA 5J4YA 1FYMA 2VUMJ 2ECCA 3BR3A 2QM3A 2XROA 4U87A 2BZTA 2KPMA 3FMQA 3PIOF 3OYDA 2C6YA 2LP0A 3K1NA 2V4JC 2Y0SN 4XLCA 1ITYA 2F4IA 2E5ZA 4LLGF 3GMEA 2IBDA 4N4NB 1A6IA 4MQ9F 4FT8A 1YFHA 5LD2C 4LIVA 4R79A 4L9VA 3ABTA 5LLQA 1JJ6C 4ZYAA 1K79A 3WGGA 1OCOH 4DIQA 2FQ3A 5AIPA 2RQPA 4LITA 1MJ9A 1JJ8C 3VYSB 3WTZA 4DGWB 3Q0VA 1O3QA 2P7CB 2HQAA 5ILUA 1G3SA 1AHDP 3DKWA 2DPUA 3KP7A 4YIRX 3WTYC 4QIWN 2DJIA 2R7FA 3LWFA 5E8IA 3SZTA 3ML6A 3HRTA 1JHHA 2BY3A 5DM7F 4M3FA 4UY8I 2XHKA 3V8JA 3KLOA 4B43A 3AG3H 2Y75A 1YX3A 5K1YA 1JKRC 4BXUA 2QUFA 3G3ZA 3K1MA 2RN7A 3D5RC 1WRJA 4HZFA 4XQFA 2X1EA 2GA2A 1T08B 2DA4A 2CMPA 5HLTA 2FJ1A 4X1EA 3TDZC 1IV8A 2CW0F 4DYQA 2V9VA 4MEYF 3TOAA 5J8FA 1AKHA 4IQJA 3MVPA 2DBBA 3HKZA 2ID3A 1QPMA 2PN6A 4F93B 3E1SA 3L2RA 3LA3A 2B9SA 3W6VA 4PFOA 1MNDA 1UG0A 2X48A 3FHNA 1J2XA 4DOZA 2RGVA 2FNAA 3F8FA 2HYGD 2MD5A 2XIGA 2L7KA 1BM9A 4P96A 5IOYA 5KK1A 2W57A 2GQQA 2FU4A 4M3DA 1REPC 3G73A 4ESFA 2M3AA 3AG1H 4HSRA 5CYVA 2W48A 2GXAA 4FHTA 4EM2A 1D1BA 5DDGA 2P5LC 3GTMJ 2W00A 4BBSJ 1IRZA 2O5RA 1OCTC 1S7OA 2YUSA 3G1MA 3OS0A 1I39A 4BE0A 3BQYA 4C9YA 5BOXA 4LG0A 5FKKA 2JPBA 1K78B 2CQKA 4I6ZA 1P7IA 4I98B 1SFKA 1LDJA 2H8WA 4HF2A 5HNHA 4Z6YA 1UHMA 2EA2A 1KU7A 4D0PA 1WJDA 2W25A 1K61A 3FKJA 4XIDA 2ICWG 2L7MP 2NAZA 2H6CA 2DOFA 4YIFA 2R92J 3GTKJ 3J7AO 1E17A 1MNMC 1I1GA 3IH4A 3JRIA 3BZKA 1GLNA 1FNNA 3TO7A 2F2EA 1JI8A 2IGNA 2H8RA 3WG9A 4IHYA 4RM2A 1APLC 4IKFA 4BXXJ 2Z9OA 2F6CA 1YS6A 2JWTA 4N9IA 2M5WA 1Z1DA 2KIFA 4KICA 1H89C 4EJVA 2DAOA 4BHBA 3J80Z 2P0WA 3ERMA 2MG4A 2LF8A 2OV7A 3P7NA 3AL0B 3R60A 3VWBA 3KIOA 5DM6F 2XSDC 3MEXA 3P9KA 3F6OA 4LLNA 1VQNI 2R7ZJ 1HC8A 4XBFA 1R58A 1YJWI 2P6TA 1ZG5A 1F43A 4P55A 2YR2A 2XPVA 3JSOA 3IRRA 2ELJA 3TW6A 2DODA 3I59A 2FOKA 3VSLA 3CCJI 4OU0A 3DU5A 4LLLA 2JA6J 2NXNB 4I0AA 4F55A 2V26A 2P8TA 3DTIA 1FTTA 4BEHB 1MSFC 1DP3A 2F48A 3D5LA 5D8KB 2FMLA 3LA2A 1D5YA 3U2RA 5A2QK 2CJJA 3TP3A 4LB6B 3Q9VA 4L5JA 3ZQ7A 4PUSA 1XCBA 3GEZA 2L9RA 2XRNA 2XAUA 2R5YB 2OQGA 1XSVA 4S05A 4HNVA 1XG1A 2CV1A 2DA5A 2ETHA 3I5UA 2COBA 1ZLKA 2LLKA 3HOZJ 4G12A 2BY2A 2XDVA 3ZQFA 4XICA 4KDPA 1BOAA 4A2UA 3E5XA 2O61A 1LNWA 1JUMA 5IP9J 3AKZA 1VQ4I 1U5TA 3J7YJ 3QU6A 5KAIC 2YX4A 5DD8A 3W3CA 1OKRA 2WB1A 5M5YJ 4ZJZA 1S7AA 1MMNA 3HHGA 2F4MB 3EUKL 3M7GA 4I02A 1X19A 4QPQA 4GGGA 2E2HJ 2G9WA 3FDYA 1X58A 5FFZA 4ZZDA 1WZ2A 2MW8A 2P7VB 3GZNB 4C3IJ 2VQCA 1S29A 4XNFA 1USTA 4R8HA 1JE8A 1PYVA 3U1DA 5GAEJ 1QU3A 2GA1A 2E36A 1OR7A 1GHCA 2V9PA 3QYFA 1P4XA 3IC7A 1YLFA 1LFBA 3V42A 2QQBA 2O8XA 1LVKA 2DLLA 2LKPA 5J1UA 1I6HJ 4XORA 2BY1A 2L9VA 4M9XA 1SEUA 3HZJA 4DYCA 1IN8A 2K3PA 2RNGA 4MGRA 3SFZA 1S72I 4WWCA 3ABMH 3DEWA 2E60A 1VQ7I 5HLIA 1YRNB 2DCEA 2Z5UA 3EUHA 4BHPA 1LEAA 4XRSA 3LSGA 4E6KG 2P5VA 3NWSA 2QQAA 2BV6A 2XPUA 1SMTA 1OJLA 1XDSA 2V7FA 3ELKA 1SFXA 5GAGJ 2BW3B 2JJ7A 4I0BA 2EFNA 4M6XA 1VQ9I 1HSJA 2OAZA 2DO7A 2R7VA 3QP5A 3ZCOA 3OS2A 2OJED 2CUFA 4G94A 3L09A 4LOCA 3VDXA 4M3GA 3PJRA 3I55I 3HSEA 3HUGA 4DQ2A 5GPCA 3DPLC 3PL8A 3NQOA 5CJ9A 4XM3A 3L1PA 5H6QA 1YJNI 3OYAA 5C4XJ 4KYWA 5F27A 2VQGA 3B6AA 3LOCA 2HGCA 1G59A 3HC7A 5TRDA 4XMYA 2GXBA 3PO3J 3A01B 3FXLA 3S93A 3H5NA 3V8LA 3CESA 5L3FA 1G4DA 2N8GA 4CCLA 1YJ9I 2ZMEC 5LEKA 5GP9A 3CUQA 1OCPA 4NC6A 5HS9A 4OMZA 3ULQB 3Q5FA 1FSHA 2PG4A 1OPCA 1HOMA 5FJ8J 3O3KA 1W36C 3E3VA 1SFUA 2J5PA 1Y1WJ 3CUOA 1ORKA 1RETA 2DOEA 2K9NA 1BOBA 2WTEA 1G3YA 2X85A 1FT9A 2CFXA 1PUFB 5FLXK 1ONVA 2O0YA 2H1KA 4HNUA 2NOJB 3KP2A 4J00A 1TL8A 2Y0MA 1SVMA 1HW5A 2PBIA 3A1YA 4FX4A 3PFYA 2BHZA 1J5YA 5J6XA 2FRHA 3M1CA 5D6EA 1B72A 2HDDA 2K4JA 3I53A 3SXYA 4KJZA 1Z9CA 4OIOF 4CA0A 2Q1ZB 2V1DA 1QNTA 3D1NI 1R1VA 2PEXA 2EZKA 1DPRA 1MMAA 3JCUC 5ICEA 2EFQA 2R3SA 9ANTA 3KCCA 2DN0A 2F5CA 1EF4A 2XUBA 4OOIA 1AWCA 1U8RA 4D7NA 3HKZN 3ZP5A 4E4HA 3A02A 3OL3A 4PFPA 3KYDB 5EGOB 1M1EB 1B6AA 3RPUD 1JGSA 2YX7A 1O57A 2X9DA 3GZ5A 4EMSA 1UFMA 2CUZA 1DQUA 2BBYA 3LSPA 1A35A 4LB5A 1N78A 4DW6A 2Q2EB 3S1QJ 3I71A 5IT3A 4M9SA 3QODA 1R1UA 4BEHA 2MH9A 5M3FJ 2LSOA 3DBLB 2L5QA 2NVQJ 1ZG3A 3F3XA 4FX0A 1QZZA 2LREA 2NNYA 4BKXA 3K2ZA 2QQ8A 2VJ5A 1QVUA 5DUKA 1ZRDA 2YU9J 1X3UA 4WX9A 3OYKA 4A6DA 2V9KA 4MHGA 1R5GA 1SD6A 1BI1A 2DMTA 1MGTA 3OYLA 2OCCH 3QPHA 4AC0A 3QU3A 1HF0A 2KRCA 2XAQA 3OYBA 3OIPA 3S16J 4A3DJ 3KLNA 2VONA 1LE8A 1W36D 1Y8QB 4LGWA 1IV6A 2AXTC 1ZYRF 4EEFG 2PX9A 3MZYA 3RJPA 1FTZA 1UMQA 3X2QH 4AVPA 1W5SA 1RIOH 1FOKA 1WQ2A 4KN4X 2IA1A 1CGPA 1IC8A 1PUEE 4GYIA 3BG7A 3GWZA 3EDPA 4IF4A 3J7ZI 3DBRB 1U2WA 1VQOI 1YS7A 3F8CA 5K7HA 4NC7A 4UB8C 1WJFA 4IO9F 3N05A 2OF7A 1XCVA 5F1RA 3QWLA 4XLPF 3G4SI 2CYYA 4HBLA 3OYNA 3Q3SA 5J40A 3CCVI 2WBMA 4AYBA 5CKTA 4LD5A 4QTRA 2CV0A 1RKTA 1BW5A 1R9TJ 2AXLA 1OCZH 1TZLA 5EJCA 2OC6A 3MCZA 2A69F 3FBIB 1Y0NA 3S2WA 2Z16A 2VKEA 1V5EA 1HXDA 1LJ9A 2RREA 4GO1A 1GUUA 1I5ZA 2EV0A 2KP6A 1ETVA 1FOWA 3ZQHA 2VE8A 1KQ0A 3I56I 1LVAA 1KU3A 1OCRH 1DUXC 3E6CC 2EZHA 2M7AA 1ZGAA 2JVHA 3DTKA 3WU0A 3LSTA 2R5ZB 2IA2A 2XKPA 5HDGA 1XMKA 3REOA 2STTA 4NB5A 1W0UA 2BXYA 4WXCA 3F8MA 4MO7A 1YIJI 3K4JA 4EQQA 2DFEA 4RLQA 2QGUA 3ZMTA 1IUFA 3KZIC 4BJTA 3GLXA 3TMOA 3GTOJ 1R23A 1O3RA 3ZMDA 1Y56A 4IHXA 3RSNA 4XR6A 1EKEA 1KQ8A 1VQLI 2HS5A 3A01A 1GDTA 1TQIA 2JQ7A 2ESHA 3KP6A 3F9KA 2KDZA 1UZCA 4ZYEA 2A05A 1Z21A 3R0AA 4BE1A 4DBRA 2DFHA 5C3EJ 2WB1N 4EM1A 1D8KA 5H2FC 5GPAA 1XGNA 2K9QA 1MW7A 1HCRA 4RA2A 3NARA 1IJWC 5E1ZB 5FD6A 3IH3A 5IT9K 5ILSA 2L4MA 3K4CA 3GW2A 4PDKA 5FROA 4EJTA 2EH3A 3CDHA 5C4JJ 4HQEA 1WGXA 3WGHA 1Y8RB 1PUFA 3ZQGA 4HDVA 1U6GA 3OIQA 3LSMA 2CG4A 3QOEA 2E1CA 1YTYA 2R7UA 3K4BA 1FBSA 3JRFA 4HDUA 1GVDA 2XC7A 1FJLA 4ZDOA 3SJMA 3WTTC 1FYLA 2ZSIB 2PMHA 4KFCA 4YFXF 3JR9A 1VQKI 2KZVA 1T33A 5JLWA 1IN4A 3L2QA 2DT7B 2EB7A 1OISA 3GF2A 5CVVA 4KA4A 3MN2A 3V4GA 3BPVA 2KKOA 3CJNA 5KNLA 4EGZA 5L3BA 5EG0A 5FB2A 3VYRB 2L7FP 3K9TA 4IRHA 4DJAA 3SZGA 2FUG2 1WSUA 5KVRA 5J3LA 5L3CA 1XGSA 1MH3A 2MSYA 4UUSA 3L2WA 1KZHA 3HOWJ 1FWZA 4A3EJ 4HA8A 1Z77A 3WTUC 4RLFA 3CMEI 2ZNZA 5E17F 4M74A 5IYBJ 3OIOA 2R7RA 1USSA 4XLFA 4MEXF 3AL0C 1HA8A 4R1HA 3TOBA 4D1QA 4XRMA 4M73A 3CF2A 4L0ZB 3QPSA 4CCJA 5FRNA 2DPDA 1DU6A 4FETA 3FX3A 1BC7C 4A3FJ 4BQNA 3ESWB 1T2KA 5M5WJ 2W1OA 2A68F 1MIJA 2XGEA 1ZG1A 4BJ5C 1ETWA 3KP4A 1MBGA 3CDIA 3E97A 4F91B 2HDCA 2LG4A 1TW3A 2ZC2A 1P6RA 1F5TA 4ETSA 3JRBA 1HBXG 1Z67A 1I27A 3LFKA 2GLOA 1RC9A 1R22A 2M30A 2Y31A 4OAYA 4XSXF 1J59A 3CMAI 5DCMB 3JAMK 3EYYA 2HWVA 2L2OA 3L7WA 4QPOA 2WAQA 1X1AA 4JQFA 1ZK8A 3I54A 3TGNA 4B09A 1XGOA 2VKHA 1SVLA 3IWZA 3E5UA 3S1NJ 1TWHJ 1F1ZA 2ZSHB 3FMSA 3VYUB 1FP2A 2XRLA 2VOPA 1MD0A 2ELHA 4KISA 3H36A 1PVEA 2H09A 1QGPA 4HEA2 4IRIA 5M3MJ 4C30A 2LDUA 3ZGKA 5E3NA 2DMPA 1D0ZA 1UCRA 3RI4A 2WV1A 2TRTA 4JX5A 3OV8A 1ZKGA 4JX4A 3RZDJ 2FXAA 2UV1A 1UB9A 3L2VA 1KU2A 2IEKA 4EJUA 3B6CA 2VXZA 2HU9A
chains in the Genus database with same CATH topology
1R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R71 A; 
#chains in the Genus database with same CATH topology
 3V7S A;  4M3B A;  2XAJ A;  1JTY A;  3E6D A;  1XB4 A;  3HJE A;  3HDD A;  3FXM A;  1TT5 B;  4II3 A;  4L9N A;  3V8K A;  3CLO A;  3OYH A;  2HZD A;  3RQI A;  1MSE C;  4A3K J;  1MH4 A;  3GTG J;  5JHU A;  1BJA A;  4HF0 A;  1JUP A;  2KIU A;  3ZMS A;  1ZTR A;  3IL2 A;  4XL9 A;  1Z7L A;  2JSC A;  1A31 A;  2VC0 A;  3C2B A;  2AQF A;  3DKY A;  4A0X A;  4E7I A;  2CV2 A;  1JXS A;  1IGN A;  4HLX A;  1A6Q A;  1FBU A;  2FBK A;  1VQP I;  3RPU A;  3HYI A;  2CW7 A;  2Z1D A;  4A3I J;  2EIN H;  1X2N A;  3ZRG A;  2PJR B;  4RB1 A;  5EDN A;  5CVI A;  3SFI A;  2KIQ A;  1DU0 A;  5IY5 H;  3BJ6 A;  5DYM A;  5IYD J;  2W24 A;  3FXK A;  3PNY A;  4RGU A;  4RB3 C;  4Z2Y A;  2J5O A;  3IAS 2;  3SHF A;  2HTJ A;  2VQH A;  2CRG A;  4A3M J;  1UHW A;  2IS2 A;  3DTE A;  2CFO A;  2R5Z A;  3OMY A;  5LHI A;  2EIL H;  2STW A;  3L9F A;  3JTG A;  2OCE A;  3KPH A;  1J0R A;  1CF7 B;  2XAG A;  2DK8 A;  2VBW A;  5GTH C;  1MZB A;  4E7L A;  2MC3 A;  3DLL F;  4XKC A;  1H8A C;  2QSF X;  3WG7 H;  1FX7 A;  3TW7 A;  4RS8 A;  2FE3 A;  5CLS A;  2ZME A;  3BZC A;  4BY1 J;  3FWE A;  1TW2 A;  3DPT A;  1JKP C;  4MTD A;  3DBH B;  3S17 J;  3M1E A;  2CQN A;  1WJE A;  2MLK A;  3BJO A;  4NQW A;  1ZH5 A;  3OR2 C;  2Z99 A;  4I99 C;  3GO5 A;  4FQG A;  5TIS C;  3HHH A;  3PFI A;  1IAW A;  3KEY A;  4XRF A;  3K10 A;  3AFH A;  5L3E A;  2BVL A;  1QHH D;  3AG4 H;  2QZ8 A;  3HSF A;  3K7A J;  4CCN A;  4AVZ A;  2M8G X;  3OS1 A;  3OSF A;  4XKB A;  2HR3 A;  3P9I A;  4EJO A;  4G8X A;  1QZE A;  2VBX A;  2QSH X;  1QPI A;  3LQR A;  4AID A;  2JTV A;  2ME6 A;  2EFO A;  2FF4 A;  3JRC A;  5JVG F;  3G1O A;  1T6S A;  4YFK F;  4AYB N;  2XGX A;  1SC7 A;  2PJP A;  3GLL A;  3R4K A;  1FEX A;  1MBK A;  3I4M J;  5F08 A;  2OU2 A;  4II2 A;  3TO6 A;  3CO6 C;  3LSI A;  3CTA A;  1QBJ A;  3KX2 A;  4UV8 A;  4BNC A;  4BHC A;  1JKO C;  1X1D A;  2OUM A;  4HYE A;  1RPW A;  1L0O C;  4WXH A;  1X1C A;  3CCS I;  1VND A;  2Y48 A;  3MZH A;  3N97 A;  2X1D A;  1B8I A;  5F0C A;  2OPT A;  3RDI A;  4IOA F;  1ON2 A;  2L54 A;  4A0Z A;  4NBQ A;  2EQR A;  4IRG A;  3MMY B;  3GVA A;  3IKT A;  3I58 A;  2FSW A;  2E7W A;  4GXO A;  2DMU A;  2QLZ A;  5DTD A;  3BR2 A;  4CYC B;  1GXQ A;  1Z7U A;  1GVJ A;  2XVC A;  3SDB A;  4A12 A;  4A93 J;  3BWG A;  1YX5 A;  3FKI J;  4CDG A;  3RKX A;  5D5X B;  1P92 A;  2L0K A;  4G9Y A;  2V1X A;  3OOU A;  3J81 K;  2QEX I;  1GT0 C;  1JUS A;  3NEU A;  3NAU A;  3LNQ A;  2VKD A;  3S3O A;  4DZP A;  1LDK B;  1OFC X;  3HRS A;  1FC3 A;  5DCM A;  3FXU A;  5D6F A;  2ZJQ F;  2VL8 A;  2AQE A;  1OYI A;  3HM5 A;  1F9N A;  4YRV A;  3A0B C;  2OTJ I;  2EA4 A;  1YW8 A;  2HQN A;  4CZC A;  2ZFU A;  1SFO J;  4UVA A;  4U0V A;  2KDO A;  2XB5 A;  1RI7 A;  2XAF A;  2GIZ A;  3BC8 A;  3BR6 A;  2R7O A;  2R4G A;  3ZPL A;  1NG7 A;  3LSJ A;  4V2G A;  3ZMZ A;  4PJL A;  2L9N A;  1YQA A;  3WTS C;  3T8R A;  3ABK H;  2ZCW A;  3CP8 A;  4AIJ A;  5H6R A;  2VI6 A;  3O6B B;  1BR1 A;  1Z3Y A;  2IAI A;  2ZO4 A;  4N9H A;  1HDD C;  1TLH B;  5AIQ A;  1EA3 A;  1KGS A;  5HDN A;  3RCO A;  2LY2 A;  3MAJ A;  3HOU J;  4OMY A;  4MQV A;  4FE7 A;  4IJA A;  1ZR2 A;  3COA C;  1SAU A;  2DW4 A;  4AU7 A;  5FLM J;  1FY7 A;  2LD5 A;  2M0C A;  2LVS A;  2WY8 Q;  2ZFW A;  4L9T A;  3OY9 A;  3CLQ A;  3MZ8 A;  1Y39 A;  2IXS A;  1FOY A;  1Y6I A;  2LH9 A;  1XDU A;  2M2E A;  4HNT A;  2O9L A;  3R6S A;  3DV8 A;  1LDD A;  3NWT A;  4C2U A;  3W2A A;  4OAZ A;  4NC8 A;  4CSW A;  2H6B A;  3F23 A;  1A36 A;  4XLA A;  3OYG A;  3K4M A;  5F0F A;  4NHJ A;  1TNS A;  1IN5 A;  3ZQQ A;  4GYG A;  1ZRE A;  3KP3 A;  4ANJ A;  1X3W B;  3HGY A;  4A3B J;  2ECB A;  4CZZ A;  4Y33 A;  3A4C A;  4IL6 C;  5J4V A;  3OL4 A;  2PJR A;  2ZB9 A;  5EZH A;  5HLH A;  4PJM A;  2EJR A;  2MFZ A;  2M0M A;  4IPA A;  1SD7 A;  1BR4 A;  4V19 K;  4EV0 A;  1WFX A;  2XF5 A;  4RGX A;  1DP7 P;  1YOV B;  5LFA A;  5E1W A;  3TED A;  3L2C A;  2QCO A;  2UWM A;  1W7P D;  1HW1 A;  3HOV J;  5D4S A;  1YI2 I;  1HST A;  3SEZ A;  2WAQ N;  1CF7 A;  3TQN A;  2DT5 A;  1WPK A;  3SYT A;  1RR7 A;  3FM5 A;  4GRI A;  3OYC A;  4LIU A;  4A6E A;  2LR8 A;  3IWF A;  4HW0 A;  1FBQ A;  1AOY A;  2M34 A;  4EGY A;  3WHC A;  3UR3 C;  4ESJ A;  3N4M A;  3HOX J;  1I1S A;  5EEH A;  3C1D A;  1R00 A;  1R5H A;  2M1B A;  2V1N A;  3FXR A;  5GTI C;  3WTX C;  1RUN A;  4E7S A;  3ZMU A;  1OMI A;  3M9A A;  1ERD A;  3OOP A;  1H9T A;  1R4N B;  1VI0 A;  3BG3 A;  1MMG A;  1K78 A;  1D8J A;  3BG9 A;  3LFU A;  2VOD A;  1KU9 A;  4ON0 A;  3BY6 A;  1LFP A;  4W1U A;  4BBR J;  2BY0 A;  2TCT A;  4BYY A;  1E0E A;  1MBJ A;  4LK0 F;  1T8I A;  3GFM A;  3O8H A;  4XN0 A;  1Z6T A;  1R4M B;  2QKM B;  3LAJ A;  4AUX A;  5D5W B;  2HXO A;  3BDD A;  4Y17 A;  4IOC F;  2EV6 A;  1UJ8 A;  3WGI A;  1FIA A;  3BLY A;  4C3H J;  2OTL I;  1GXP A;  4ENK A;  1AU7 A;  1MJB A;  1QRY A;  2G0E A;  3JTH A;  4KMU X;  1N75 A;  2ESN A;  5B3S H;  5B66 C;  2HQR A;  1IW7 F;  1SAN A;  4JBA A;  1D3Y A;  1YYV A;  2VN2 A;  4XLH A;  4U88 A;  1K4T A;  1WVR A;  4BUP A;  1FPQ A;  1WI9 A;  2BEO A;  3K0L A;  1Q1V A;  1XMX A;  1CQT A;  1WKM A;  4JOM A;  2CQX A;  5A2Q Z;  2DJN A;  3BTL A;  4CXF A;  1IXS B;  1TWC J;  1JT0 A;  3BCB A;  1ZGW A;  2OBP A;  4WF2 A;  1LB2 A;  1WCM J;  5E8G A;  1PJR A;  2GOX B;  2CQ7 A;  3DXJ F;  4ENJ A;  4RB0 A;  1W7P B;  1H88 C;  2PFB A;  2IGK A;  1ENH A;  4OIR F;  3GFL A;  2MLG A;  2XKO A;  4CYC A;  2EFW A;  3DLA A;  2M45 A;  4G6T B;  3ASO H;  4XOP A;  2OQR A;  3CF5 F;  2HYF A;  2XGD A;  2I10 A;  3LSK A;  2COM A;  4PJ0 C;  4B3A A;  5BMZ A;  5TJJ A;  1D0X A;  4MLO A;  2R7D A;  2JVG A;  2EIJ H;  1YHQ I;  4MFD A;  5F64 A;  4Q4Z F;  1NG6 A;  5J8C A;  4U7D A;  1QHG A;  3E6B A;  2ACJ A;  3V7R A;  2R5Y A;  1YG2 A;  3Q9S A;  1SMY F;  3B73 A;  1W4M A;  3OWT A;  4RB2 C;  3HEF A;  2P4W A;  1IZ1 A;  3OYI A;  2A61 A;  2ZJP F;  3VYT B;  4BGD A;  1TP4 A;  5FKL A;  5HDK A;  1R1T A;  1YIO A;  1POG A;  2LBF B;  5TGT A;  2D1V A;  3GYH X;  4FIS A;  4HG2 A;  3G6E I;  2IP2 A;  1WH5 A;  1YW7 A;  1BA5 A;  2V6C A;  1R6R A;  2Y2Z A;  4M6V A;  4G7Z F;  4DYR A;  3V7C A;  2ADU A;  2DTR A;  2E7X A;  1FSE A;  1LUJ B;  2R7W A;  1LFU P;  2M9H A;  3W6J B;  2NS0 A;  1R36 A;  2KHM A;  2QBY B;  2ISY A;  1WJC A;  1X1B A;  1KYW A;  3RPQ A;  3PNT A;  3OSG A;  5HS8 A;  2NS8 A;  1LPQ A;  5LEJ A;  2KL4 A;  1A04 A;  4QLC U;  4A0Y A;  3AG2 H;  2HYJ A;  2IA0 A;  3CCE I;  4BU2 A;  2YSR A;  2HVR A;  3FBN B;  4HPQ A;  2NS7 A;  4XN3 A;  5CVR A;  5ICC A;  2XV4 S;  2LKS A;  2O3F A;  5D5V B;  2XSJ C;  4CGZ A;  2CQQ A;  3WOD F;  3EET A;  3ZN1 A;  5FLV A;  1E3H A;  2XF6 A;  1S9H A;  3PSI A;  4V2F A;  3MKW B;  2ZXH A;  3C2H A;  2UXN A;  5K5R A;  1MNE A;  2RV8 A;  1YRN A;  2DK5 A;  4BJ6 C;  3EUA A;  5LRS A;  1W1W E;  3F8B A;  1ON1 A;  1IXR C;  4MIM A;  5K7Z A;  4HAM A;  1K7A A;  2BW3 A;  5KAF C;  3TDU C;  2RDP A;  4CYD A;  3H5A A;  2WY7 Q;  4NDL A;  2DDB A;  2D45 A;  3GCM A;  4LMY A;  5E79 C;  3T1B A;  5LBQ A;  3M8F A;  3W2W A;  1D5V A;  1IF1 A;  3CP2 A;  2HI3 A;  1O4X A;  1WJB A;  3M8J A;  4U0Y A;  5E20 A;  3ERE D;  3KEQ A;  1TWG J;  2F4O B;  4GFB A;  4KMF A;  2FEZ A;  3SQN A;  2DXI A;  1V4R A;  2DI3 A;  4QSH A;  2ID6 A;  2HQ5 A;  2DA6 A;  4L0Y B;  3HIF A;  1ETK A;  1P7J A;  3HOS A;  2O03 A;  1D1C A;  2VBY A;  2LK2 A;  3DFG A;  3PNV A;  1LEB A;  1GV2 A;  2R7Q A;  5FLX Z;  4M6Y A;  4CHU A;  3E7L A;  4D7M A;  2QA4 I;  4A5M A;  2WA0 A;  3RIR A;  4CUG A;  1U9N A;  5JLX A;  2GM4 A;  2E19 A;  1RNL A;  5B5E C;  3ASN H;  5ICF A;  2XAH A;  1XS9 A;  2E1O A;  1B59 A;  3IHU A;  1JKQ C;  3CCM I;  2PLY A;  4GCV A;  1DGR M;  2DYS H;  2LFB A;  3D5S C;  1ZN2 A;  3GTQ J;  1IRX A;  1OQY A;  4MTE A;  4B48 A;  3IKV A;  5LGT A;  2GXG A;  1J09 A;  1WWX A;  2XPW A;  2BXZ A;  3TBI A;  1ZLJ A;  1S6L A;  5FO5 A;  2GWR A;  4L9J A;  4ZYD A;  4LG0 B;  3UKG A;  3ECH A;  1QVT A;  2A6H F;  3JRG A;  2BE5 F;  3C2G A;  2HZT A;  3O8G A;  3BQZ A;  4PK4 A;  2W84 A;  4RAF A;  4Y13 A;  4IEJ A;  1EJ9 A;  2DA3 A;  1EH6 A;  3HBL A;  2B7E A;  2E1M B;  1FYK A;  3HSR A;  5H20 A;  2FOW A;  4Y4R A;  4UNO A;  1MJA A;  2DTZ A;  2V79 A;  4RMN A;  2Y9Z A;  1Y1V J;  2OD5 A;  1JGG A;  4UXN A;  3HTS B;  4CH7 A;  2P5K A;  1MBF A;  2DQL A;  1D0Y A;  4PGH A;  3K4N A;  2P6S A;  2Q0O A;  1TNT A;  2B0L A;  5F6F A;  1BL0 A;  3KFW X;  5FFX A;  3GFJ A;  1R49 A;  2K9L A;  4L5I A;  5K5O A;  1BI0 A;  2MD0 A;  1JTX A;  5EGO A;  2NRA C;  2IGO A;  2RNJ A;  2ZXJ A;  1PP7 U;  3IH2 A;  1W7P A;  2OZ6 A;  2WAE A;  3H3U A;  2M8E A;  2IS6 A;  2NOG A;  3HB9 A;  1W5T A;  2CUE A;  3DWL E;  2MA3 A;  5J1Y A;  2Q2E A;  3ZQL A;  2ZXI A;  4F3Q A;  3KEO A;  3WE2 A;  3BG6 A;  1MBH A;  1OCC H;  2M87 A;  2KRH A;  3QYE A;  1G2H A;  5HOD A;  2IW5 A;  2VBZ A;  3H9G A;  4JK1 X;  1TQP A;  2Q8K A;  4ABZ A;  5B1B H;  4EJW A;  5E18 F;  4WXD A;  2VT2 A;  1A5J A;  4E7K A;  4XSZ F;  3J80 K;  3ABU A;  1R7J A;  3ISP A;  1N77 A;  4YFN F;  5BPI A;  1UEL B;  4XRS G;  4BDY A;  4KUM A;  3RKY A;  5IOZ A;  2BGC A;  3K69 A;  2QYO A;  3GX4 X;  3BJA A;  3PO2 J;  2AS5 F;  4XKV A;  3VSK A;  2IRF G;  4IHV A;  5E3L A;  3S14 J;  2YS9 A;  2R7X A;  2QEN A;  4BAY A;  2XGC A;  4E7Z A;  2EWN A;  4XON A;  4KIG A;  2FX0 A;  4BAC A;  2DFF A;  2IJL A;  1ZRC A;  2FMY A;  2JA8 J;  1ZHF A;  4UHT A;  2QBY A;  3SZP A;  2HNH A;  5E3M A;  2LTP A;  4AIH A;  4BQO A;  2K86 A;  5JVT A;  2ZNY A;  2VKV A;  2F5V A;  3FZV A;  4ITV A;  4FCY A;  4ZYG A;  1O3T A;  1IN7 A;  1P9Q C;  3G1L A;  1MKM A;  3GTP J;  4X6A J;  4ZYH A;  2X51 A;  1QO0 D;  1U5T B;  4ESB A;  4G7H F;  2KLO A;  1WHU A;  4KT5 C;  3L00 A;  2VB6 A;  4D5F A;  1XGM A;  4F92 B;  3IRQ A;  1T39 A;  1BBY A;  1YO5 C;  2RAE A;  5FKO A;  3BTC A;  2EZI A;  3JRD A;  1JHF A;  2O6G E;  3NRV A;  2VJI A;  1VQ6 I;  2HXI A;  3A03 A;  4ZH4 F;  2K9S A;  2X0L A;  3PIP F;  4C3J J;  3FM3 A;  3GXO A;  3HGG A;  3I9V 2;  3PUF A;  2ZJ2 A;  1XX5 A;  4P5O A;  1ZQ3 P;  4LG3 A;  2A6E F;  1SAX A;  5D5U B;  4JX6 A;  3I3L A;  3E5Q A;  3RYP A;  2RKH A;  5DCF A;  4XKW A;  1F4K A;  1Y0U A;  1R71 A;  3QQA A;  1MMS A;  5JI6 A;  5LHH A;  1I6X A;  2YPR A;  1K4S A;  5IP6 A;  4KNY A;  3S8P A;  4OWR B;  3JRE A;  2JRM A;  3ZOB A;  2KQR A;  2VPL A;  2L7Z A;  2O7O A;  1PDN C;  2QSG X;  3ZXS A;  2FA5 A;  4Q5S F;  1FMV A;  3RZO J;  1S8N A;  1P2F A;  4PCQ A;  3K4K A;  5EZG A;  1X4P A;  4G6D A;  4Y15 A;  4D5C A;  5IT9 Z;  2AO9 A;  1HKQ A;  4B1R A;  1NK3 P;  4PJN A;  1IO2 A;  4PGG A;  2CWE A;  4HLY A;  2G7U A;  3H92 A;  3HUG B;  1MDM B;  2DA1 A;  3H5R A;  4LK1 F;  1U0J A;  2H94 A;  2B63 J;  1NK2 P;  2CW8 A;  4MNU A;  4ENN A;  2D1H A;  2ISZ A;  5F04 A;  2DU9 A;  2K85 A;  1Z6R A;  2GIV A;  1XPX A;  4J19 A;  4F52 A;  2VQL A;  4CCM A;  3IAM 2;  1RZ4 A;  3BCA A;  4XOT A;  4PJJ A;  2KT0 A;  1BJZ A;  2BOL A;  2WAD A;  1BC8 C;  2JT1 A;  1IDY A;  3DQV C;  1P4A A;  1ZAR A;  1WJA A;  3F6V A;  3KYC B;  3S1R J;  1PP8 F;  2FNP A;  2LY1 A;  3G71 I;  1U78 A;  1YE9 A;  2E35 A;  1HW2 A;  3CJQ B;  3CUQ B;  3CMM A;  2KRF A;  1FZP B;  3VFZ A;  2L3D A;  2CUJ A;  1VF9 A;  3QAH A;  4JYK A;  1TTY A;  2ELK A;  4ZC3 A;  3KZZ A;  4C2M J;  1FOX A;  2LMD A;  5BS6 A;  4BQQ A;  2HOE A;  1ULY A;  2DA7 A;  1WH7 A;  1TWA J;  2WV0 A;  3M8E A;  3F21 A;  2LC2 A;  3EQL F;  2LY9 A;  1MMD A;  3PQK A;  3LMM A;  3R0J A;  4L5E A;  4O5V A;  3DP7 A;  3K70 C;  2F5E A;  3H9J A;  2R0Q C;  3KYL A;  4ZZL A;  3CCQ I;  2JPC A;  1L3L A;  1G3T A;  2JUG A;  2X1C A;  1B72 B;  1ACI A;  2H1L A;  4BDZ A;  3HOT A;  1BN5 A;  4IZZ A;  3LQQ A;  2ME0 A;  3RTR A;  5C44 J;  3MKY B;  2VAS A;  3M4O J;  3P9C A;  3CC4 I;  3GFI A;  1DGW Y;  3JAM Z;  4FE4 A;  2W85 A;  5DEQ A;  1RKW A;  2IPQ X;  4RM3 A;  3Q0W A;  5HOO A;  3PM1 A;  2Y9Y A;  5DV5 A;  3S2D J;  2UUZ A;  2HEO A;  3OYJ A;  3E0J B;  5J1R A;  2MYS A;  1FP1 D;  4ZDP A;  4A69 C;  2Z3Y A;  4YII A;  4HV6 A;  4L18 B;  3ZMV A;  3DEE A;  4BY7 J;  5EF6 A;  1O7F A;  3H9Q A;  4HRI A;  2O8K A;  2NVT J;  3TKY A;  3R61 A;  2DFI A;  3D0S A;  1TQM A;  5DUI A;  5HVQ C;  2EIM H;  2Y30 A;  2XB0 X;  2VT3 A;  3H3V K;  1I50 J;  1QQI A;  3BG5 A;  3HXL A;  4N4O B;  3FXO A;  4MFE A;  1S5L C;  5CVU A;  2KJB A;  1MBE A;  2VJ4 A;  5GAH J;  3DEU A;  2BYV E;  5D4R A;  5BPD A;  2TDX A;  2JN6 A;  2D5V A;  1S7E A;  2JA2 A;  4X0G A;  3CJR B;  4B3X A;  1IUY A;  4Y52 J;  2GZW A;  3ECO A;  4UVB A;  4M3E A;  2DYR H;  4PSW A;  1X1P A;  4KIF A;  4BH9 A;  1X2M A;  3JRA A;  1O3S A;  1ETO A;  2P81 A;  3RKQ A;  4A3L J;  3BZ6 A;  2BHY A;  1OYW A;  3QP6 A;  1VFC A;  1J75 A;  2M4K A;  1T0F C;  5J47 A;  2I8D A;  1G8X A;  1KON A;  3JRH A;  2JSP A;  4FTH A;  2A3S A;  4AIK A;  2RQQ A;  5EEG A;  2V6E A;  5EYR A;  1V55 H;  1Z91 A;  2HPM A;  1TT0 A;  1XN7 A;  2HDW A;  2PMU A;  2PMZ A;  3FIW A;  2A6T A;  4BE2 A;  3HOY J;  1KYZ A;  4CCO A;  1LE8 B;  3F0C A;  4YEL A;  3EPZ A;  4HQM A;  1S3J A;  5HNF A;  3H0D A;  1RRJ A;  1V54 H;  1W0T A;  2VC1 A;  5M5X J;  4H4K C;  1EV7 A;  3KZY A;  1B9N A;  2GAU A;  3P5J A;  2G7H A;  1NHA A;  4HOB A;  4Y3O A;  3K70 D;  1G6N A;  1NH3 A;  5IYC J;  1LQ1 A;  3EYI A;  2ZXW H;  1T56 A;  5HLG A;  2Z2S B;  1X3Z B;  4AWX B;  1YIT I;  4K2E A;  5CPR B;  1E3P A;  3U1K A;  2XF7 A;  3T8T A;  3DPU A;  4EVI A;  4EAT A;  1K6O A;  1WI3 A;  3ROU A;  3OYM A;  3S3N A;  3C7J A;  3HPG A;  4XLE A;  3I64 A;  3K1P A;  4S0H B;  2GBY A;  4JP0 A;  2EZL A;  4B44 A;  2E34 A;  2HTS A;  3CO7 C;  2EPF A;  3VEP A;  3CDL A;  3BR0 A;  1VZ0 A;  1K83 J;  4I76 A;  5ERI A;  4U0W A;  2H27 A;  1X4O A;  2NVU B;  2K9M A;  2WWY A;  4F7Z A;  1O7L A;  4I01 A;  4I09 A;  1BI2 A;  1SD5 A;  2CO5 A;  3C3W A;  3WU1 B;  3IP4 B;  3CCL I;  4QWQ A;  2MC4 A;  1IRF A;  4BXF A;  3VB2 A;  4ZDL A;  4AD9 A;  3WTW C;  3OR1 C;  1MDM A;  3VPR A;  5K5Q A;  3DKX A;  4IX7 A;  3SDG A;  1ETX A;  2JUC A;  3U9G A;  2HVS A;  3HTU A;  3BP8 A;  3CZ6 A;  4U7B A;  1DDN A;  1GV5 A;  2W82 A;  2UZK A;  5EEA A;  2D2W A;  1R5I D;  3KET A;  5IPA A;  1JT6 A;  2KIS A;  3FIS A;  3H35 A;  3BOQ A;  3S32 A;  3Q0U A;  3CCU I;  3ONQ A;  1QZY A;  5FGM A;  2VIX A;  4C2T A;  3QRF F;  1D1A A;  2NVX J;  1EH7 A;  2RC4 A;  3OYF A;  2JA7 J;  3K4L A;  4M9Z A;  2IT0 A;  1UHS A;  2VPR A;  3BR5 A;  4PSX A;  5E1X A;  2W4S A;  2FBH A;  2ZKZ A;  1XD7 A;  2VXD A;  1YW9 A;  3HPH A;  3DF8 A;  1HQC A;  1J9I A;  5KHD A;  2Y0S A;  1IRG A;  4BS9 A;  4GDF A;  1Z3X A;  3MD2 A;  3HRU A;  2E1M C;  2KIM A;  1DPU A;  3QPT A;  2V1U A;  3CMY A;  3TL4 X;  3M07 A;  4OIP F;  5CVJ A;  3K2A A;  3JW4 A;  3WU2 C;  5LRR A;  4A3J J;  2X4H A;  5CQE A;  3J81 Z;  1T98 A;  5EG0 B;  4S04 A;  5IP7 J;  3BR1 A;  5B1A H;  2NVY J;  4I2O A;  2QVO A;  2DMN A;  2FD5 A;  1U9O A;  2HFH A;  4UB6 C;  3B02 A;  3BRO A;  4UUS B;  3CCY A;  2R93 J;  2K7L A;  2VJJ A;  2A5W A;  4E7J A;  1NTC A;  2I5U A;  2E5N A;  1H9G A;  2K02 A;  1V5F A;  1LKX A;  2L9S A;  2UXX A;  4ZTF A;  1V5G A;  3FXQ A;  2FQ4 A;  4YG2 F;  2VLA A;  3FK6 A;  2NNN A;  1B1B A;  4AM3 A;  1BIB A;  1BW6 A;  2RVC A;  2LKX A;  2HKO A;  4KIT B;  4BL0 B;  2R7T A;  2QF7 A;  2A5Y B;  1UAA A;  3MWM A;  4LFU A;  1W5C C;  3HRM A;  4G7O F;  4IHS A;  4UV9 A;  4UVC A;  4IHW A;  3RQ4 A;  1UG2 A;  5L3D A;  2K27 A;  3DCF A;  1U3E M;  1XC5 A;  2L02 A;  4CIC A;  1FIP A;  1RES A;  1TC3 C;  1RR8 C;  3H1C A;  3RYR A;  3LSR A;  3MKL A;  4LJZ F;  3WHB A;  1P4W A;  2HOA A;  2AHQ A;  3ZQC A;  3C18 A;  2OZU A;  3FK7 A;  1KA8 A;  2HKX A;  1ETQ A;  3M3Y J;  4XK4 A;  3KP5 A;  5JR3 A;  4O6J A;  4O3M A;  3K6G A;  3LA7 A;  4D9J A;  3TP0 A;  4IHT A;  1XSD A;  5ICG A;  1T38 A;  1U5T C;  1G3W A;  4W97 A;  2MGQ A;  2MBF A;  2GOM A;  2X6W A;  2E1N A;  3L2U A;  2FBI A;  2ZJR F;  2JA5 J;  3OYE A;  1HKS A;  3G2B A;  1ZRF A;  2A07 F;  2HOT A;  3FF5 A;  3J7A Y;  2LNB A;  4NUB A;  4DBQ A;  1ETY A;  3VOE A;  1BI3 A;  5JFR A;  2QKL B;  3GZ6 A;  3FXJ A;  4KIB A;  2MH2 A;  4IVN A;  1OR7 C;  1FMW A;  4CCK A;  2HOS A;  3I4P A;  2X6Y A;  2OA4 A;  3ZN0 A;  3F22 A;  1TWF J;  2KMU A;  5E3O A;  2W7N A;  3AAF A;  6PAX A;  3IUO A;  1SVO A;  3CQZ J;  2YU3 A;  2E71 A;  2LYC A;  2E2J J;  1VQM I;  2Z33 A;  1RUO A;  1VQ5 I;  5KCM A;  3GBG A;  3HG9 A;  4N0B A;  5BNG A;  2Y69 H;  1KQ9 A;  2KZG A;  2JMW A;  3EUH C;  2ZBK A;  1B9M A;  1I3Q J;  4Q48 A;  1Z05 A;  4E7H A;  3H0G J;  4KT6 A;  5K7F A;  1AKH B;  4B4C A;  2QWW A;  3W6K B;  4P9U A;  3CC7 I;  1B4A A;  3MQ0 A;  1I3A A;  5F1J A;  4KN7 X;  1OLT A;  5GAD J;  5LHG A;  3QPL A;  1VTN C;  2M7B A;  2CH0 A;  3MFK A;  3KE2 A;  2VOO A;  4HX4 A;  5AON A;  1HLV A;  2WC2 A;  5F0H A;  5FKM A;  2WAF A;  3HL2 A;  1IDZ A;  4ASN A;  1SD4 A;  1XTA A;  2ZME B;  1STZ A;  2PMZ N;  2KFD A;  2L4A A;  3A0H C;  2EBI A;  1ZEL A;  4Q47 A;  3F72 A;  3FHZ A;  4HV5 A;  4HST A;  5L3G A;  2R7S A;  2CS3 A;  3DU6 A;  1K6Y A;  2BVM A;  5ILV A;  3VOD A;  3CCR I;  4NQW B;  1H0M A;  2DDA A;  1BR2 A;  2EV5 A;  3LSH A;  3PUB A;  5FKN A;  4J01 A;  4IXA A;  4RBO A;  3S3M A;  1F36 A;  4RGS A;  3QOP A;  3S15 J;  2K5C A;  4EM0 B;  3CUQ C;  1HDP A;  2CU7 A;  3LL7 A;  4A3C J;  3E6M A;  2LRD A;  4NNJ A;  2F5D A;  5CQG A;  4PZJ A;  2CSO A;  3GTJ J;  4M72 A;  4RGR A;  1ODD A;  4HF1 A;  2IS1 A;  5ED4 A;  3BTJ A;  4A5N A;  1IN6 A;  2EFP A;  3IV5 A;  2X6X A;  3ZQI A;  3CD6 I;  3W2V A;  4G6Q A;  4P1W A;  4DZJ A;  1ZR4 A;  1T95 A;  3BPX A;  1U8B A;  3T5X A;  2EK5 A;  1V3F A;  1Q1H A;  3FMR A;  4B8X A;  2PQ8 A;  1FLI A;  2KJC A;  2DT6 A;  4CO8 A;  1IG7 A;  1VQ8 I;  4XLN F;  3LAP A;  2K4B A;  5BQT A;  2HVQ A;  2PI0 A;  2EIK H;  3F8N A;  3ABL H;  1ZAO A;  1IXC A;  2M4G A;  3TO9 A;  2DA2 A;  4FAS D;  4P9F A;  3U21 A;  2K40 A;  1N25 A;  4BQA A;  4M71 A;  3MKZ A;  1E3O C;  2QQ9 A;  4YEJ A;  3QYB A;  3UNG C;  2F5F A;  5D8L B;  1OYY A;  2DQR A;  3I0T A;  5FD5 A;  2VE9 A;  1B8I B;  1QA6 A;  2CGP A;  1E2X A;  3GUD A;  3WE3 A;  1TBX A;  4IQ4 A;  3CC2 I;  2IGM A;  3S1M J;  3PSF A;  2K3F A;  4UUT A;  4HX8 A;  5JHF A;  5LGN A;  3A2K A;  4E70 A;  1J7K A;  4Y7N J;  1XMA A;  1HKT A;  5LGU A;  3BTI A;  4WK8 F;  3GTL J;  5FRM A;  4DNC A;  2IVM A;  3I59 B;  3SEQ A;  4I7H A;  2IS4 A;  2X6O A;  2XAS A;  5DD4 A;  4ENM A;  1C0W A;  3PQJ A;  2LF7 A;  2LOO A;  4RAG A;  3S2H J;  4OIQ F;  4RAY A;  3CJT B;  4H0E A;  2JRT A;  2JK3 A;  4RAZ A;  3RKW A;  2NYX A;  5HS7 A;  3ZR8 X;  1EH8 A;  1AA7 A;  4ZTJ A;  2L01 A;  4A3G J;  2LBF A;  1ZGJ A;  4RDU A;  3WTV C;  4OIN F;  1BIA A;  2DMQ A;  3BT9 A;  3I4N J;  2E2I J;  2JZY A;  1T0F A;  2HPI A;  3JSP A;  1Z0X A;  1XSX A;  4TV7 A;  3T0Y A;  1WJ5 A;  2DOA A;  4HX7 A;  5DS9 A;  2MAB A;  4B47 A;  3O2P E;  1SFE A;  4UUV A;  4WCG A;  3H3Z A;  5J4Y A;  1FYM A;  2VUM J;  2ECC A;  3BR3 A;  2QM3 A;  2XRO A;  4U87 A;  2BZT A;  2KPM A;  3FMQ A;  3PIO F;  3OYD A;  2C6Y A;  2LP0 A;  3K1N A;  2V4J C;  2Y0S N;  4XLC A;  1ITY A;  2F4I A;  2E5Z A;  4LLG F;  3GME A;  2IBD A;  4N4N B;  1A6I A;  4MQ9 F;  4FT8 A;  1YFH A;  5LD2 C;  4LIV A;  4R79 A;  4L9V A;  3ABT A;  5LLQ A;  1JJ6 C;  4ZYA A;  1K79 A;  3WGG A;  1OCO H;  4DIQ A;  2FQ3 A;  5AIP A;  2RQP A;  4LIT A;  1MJ9 A;  1JJ8 C;  3VYS B;  3WTZ A;  4DGW B;  3Q0V A;  1O3Q A;  2P7C B;  2HQA A;  5ILU A;  1G3S A;  1AHD P;  3DKW A;  2DPU A;  3KP7 A;  4YIR X;  3WTY C;  4QIW N;  2DJI A;  2R7F A;  3LWF A;  5E8I A;  3SZT A;  3ML6 A;  3HRT A;  1JHH A;  2BY3 A;  5DM7 F;  4M3F A;  4UY8 I;  2XHK A;  3V8J A;  3KLO A;  4B43 A;  3AG3 H;  2Y75 A;  1YX3 A;  5K1Y A;  1JKR C;  4BXU A;  2QUF A;  3G3Z A;  3K1M A;  2RN7 A;  3D5R C;  1WRJ A;  4HZF A;  4XQF A;  2X1E A;  2GA2 A;  1T08 B;  2DA4 A;  2CMP A;  5HLT A;  2FJ1 A;  4X1E A;  3TDZ C;  1IV8 A;  2CW0 F;  4DYQ A;  2V9V A;  4MEY F;  3TOA A;  5J8F A;  1AKH A;  4IQJ A;  3MVP A;  2DBB A;  3HKZ A;  2ID3 A;  1QPM A;  2PN6 A;  4F93 B;  3E1S A;  3L2R A;  3LA3 A;  2B9S A;  3W6V A;  4PFO A;  1MND A;  1UG0 A;  2X48 A;  3FHN A;  1J2X A;  4DOZ A;  2RGV A;  2FNA A;  3F8F A;  2HYG D;  2MD5 A;  2XIG A;  2L7K A;  1BM9 A;  4P96 A;  5IOY A;  5KK1 A;  2W57 A;  2GQQ A;  2FU4 A;  4M3D A;  1REP C;  3G73 A;  4ESF A;  2M3A A;  3AG1 H;  4HSR A;  5CYV A;  2W48 A;  2GXA A;  4FHT A;  4EM2 A;  1D1B A;  5DDG A;  2P5L C;  3GTM J;  2W00 A;  4BBS J;  1IRZ A;  2O5R A;  1OCT C;  1S7O A;  2YUS A;  3G1M A;  3OS0 A;  1I39 A;  4BE0 A;  3BQY A;  4C9Y A;  5BOX A;  4LG0 A;  5FKK A;  2JPB A;  1K78 B;  2CQK A;  4I6Z A;  1P7I A;  4I98 B;  1SFK A;  1LDJ A;  2H8W A;  4HF2 A;  5HNH A;  4Z6Y A;  1UHM A;  2EA2 A;  1KU7 A;  4D0P A;  1WJD A;  2W25 A;  1K61 A;  3FKJ A;  4XID A;  2ICW G;  2L7M P;  2NAZ A;  2H6C A;  2DOF A;  4YIF A;  2R92 J;  3GTK J;  3J7A O;  1E17 A;  1MNM C;  1I1G A;  3IH4 A;  3JRI A;  3BZK A;  1GLN A;  1FNN A;  3TO7 A;  2F2E A;  1JI8 A;  2IGN A;  2H8R A;  3WG9 A;  4IHY A;  4RM2 A;  1APL C;  4IKF A;  4BXX J;  2Z9O A;  2F6C A;  1YS6 A;  2JWT A;  4N9I A;  2M5W A;  1Z1D A;  2KIF A;  4KIC A;  1H89 C;  4EJV A;  2DAO A;  4BHB A;  3J80 Z;  2P0W A;  3ERM A;  2MG4 A;  2LF8 A;  2OV7 A;  3P7N A;  3AL0 B;  3R60 A;  3VWB A;  3KIO A;  5DM6 F;  2XSD C;  3MEX A;  3P9K A;  3F6O A;  4LLN A;  1VQN I;  2R7Z J;  1HC8 A;  4XBF A;  1R58 A;  1YJW I;  2P6T A;  1ZG5 A;  1F43 A;  4P55 A;  2YR2 A;  2XPV A;  3JSO A;  3IRR A;  2ELJ A;  3TW6 A;  2DOD A;  3I59 A;  2FOK A;  3VSL A;  3CCJ I;  4OU0 A;  3DU5 A;  4LLL A;  2JA6 J;  2NXN B;  4I0A A;  4F55 A;  2V26 A;  2P8T A;  3DTI A;  1FTT A;  4BEH B;  1MSF C;  1DP3 A;  2F48 A;  3D5L A;  5D8K B;  2FML A;  3LA2 A;  1D5Y A;  3U2R A;  5A2Q K;  2CJJ A;  3TP3 A;  4LB6 B;  3Q9V A;  4L5J A;  3ZQ7 A;  4PUS A;  1XCB A;  3GEZ A;  2L9R A;  2XRN A;  2XAU A;  2R5Y B;  2OQG A;  1XSV A;  4S05 A;  4HNV A;  1XG1 A;  2CV1 A;  2DA5 A;  2ETH A;  3I5U A;  2COB A;  1ZLK A;  2LLK A;  3HOZ J;  4G12 A;  2BY2 A;  2XDV A;  3ZQF A;  4XIC A;  4KDP A;  1BOA A;  4A2U A;  3E5X A;  2O61 A;  1LNW A;  1JUM A;  5IP9 J;  3AKZ A;  1VQ4 I;  1U5T A;  3J7Y J;  3QU6 A;  5KAI C;  2YX4 A;  5DD8 A;  3W3C A;  1OKR A;  2WB1 A;  5M5Y J;  4ZJZ A;  1S7A A;  1MMN A;  3HHG A;  2F4M B;  3EUK L;  3M7G A;  4I02 A;  1X19 A;  4QPQ A;  4GGG A;  2E2H J;  2G9W A;  3FDY A;  1X58 A;  5FFZ A;  4ZZD A;  1WZ2 A;  2MW8 A;  2P7V B;  3GZN B;  4C3I J;  2VQC A;  1S29 A;  4XNF A;  1UST A;  4R8H A;  1JE8 A;  1PYV A;  3U1D A;  5GAE J;  1QU3 A;  2GA1 A;  2E36 A;  1OR7 A;  1GHC A;  2V9P A;  3QYF A;  1P4X A;  3IC7 A;  1YLF A;  1LFB A;  3V42 A;  2QQB A;  2O8X A;  1LVK A;  2DLL A;  2LKP A;  5J1U A;  1I6H J;  4XOR A;  2BY1 A;  2L9V A;  4M9X A;  1SEU A;  3HZJ A;  4DYC A;  1IN8 A;  2K3P A;  2RNG A;  4MGR A;  3SFZ A;  1S72 I;  4WWC A;  3ABM H;  3DEW A;  2E60 A;  1VQ7 I;  5HLI A;  1YRN B;  2DCE A;  2Z5U A;  3EUH A;  4BHP A;  1LEA A;  4XRS A;  3LSG A;  4E6K G;  2P5V A;  3NWS A;  2QQA A;  2BV6 A;  2XPU A;  1SMT A;  1OJL A;  1XDS A;  2V7F A;  3ELK A;  1SFX A;  5GAG J;  2BW3 B;  2JJ7 A;  4I0B A;  2EFN A;  4M6X A;  1VQ9 I;  1HSJ A;  2OAZ A;  2DO7 A;  2R7V A;  3QP5 A;  3ZCO A;  3OS2 A;  2OJE D;  2CUF A;  4G94 A;  3L09 A;  4LOC A;  3VDX A;  4M3G A;  3PJR A;  3I55 I;  3HSE A;  3HUG A;  4DQ2 A;  5GPC A;  3DPL C;  3PL8 A;  3NQO A;  5CJ9 A;  4XM3 A;  3L1P A;  5H6Q A;  1YJN I;  3OYA A;  5C4X J;  4KYW A;  5F27 A;  2VQG A;  3B6A A;  3LOC A;  2HGC A;  1G59 A;  3HC7 A;  5TRD A;  4XMY A;  2GXB A;  3PO3 J;  3A01 B;  3FXL A;  3S93 A;  3H5N A;  3V8L A;  3CES A;  5L3F A;  1G4D A;  2N8G A;  4CCL A;  1YJ9 I;  2ZME C;  5LEK A;  5GP9 A;  3CUQ A;  1OCP A;  4NC6 A;  5HS9 A;  4OMZ A;  3ULQ B;  3Q5F A;  1FSH A;  2PG4 A;  1OPC A;  1HOM A;  5FJ8 J;  3O3K A;  1W36 C;  3E3V A;  1SFU A;  2J5P A;  1Y1W J;  3CUO A;  1ORK A;  1RET A;  2DOE A;  2K9N A;  1BOB A;  2WTE A;  1G3Y A;  2X85 A;  1FT9 A;  2CFX A;  1PUF B;  5FLX K;  1ONV A;  2O0Y A;  2H1K A;  4HNU A;  2NOJ B;  3KP2 A;  4J00 A;  1TL8 A;  2Y0M A;  1SVM A;  1HW5 A;  2PBI A;  3A1Y A;  4FX4 A;  3PFY A;  2BHZ A;  1J5Y A;  5J6X A;  2FRH A;  3M1C A;  5D6E A;  1B72 A;  2HDD A;  2K4J A;  3I53 A;  3SXY A;  4KJZ A;  1Z9C A;  4OIO F;  4CA0 A;  2Q1Z B;  2V1D A;  1QNT A;  3D1N I;  1R1V A;  2PEX A;  2EZK A;  1DPR A;  1MMA A;  3JCU C;  5ICE A;  2EFQ A;  2R3S A;  9ANT A;  3KCC A;  2DN0 A;  2F5C A;  1EF4 A;  2XUB A;  4OOI A;  1AWC A;  1U8R A;  4D7N A;  3HKZ N;  3ZP5 A;  4E4H A;  3A02 A;  3OL3 A;  4PFP A;  3KYD B;  5EGO B;  1M1E B;  1B6A A;  3RPU D;  1JGS A;  2YX7 A;  1O57 A;  2X9D A;  3GZ5 A;  4EMS A;  1UFM A;  2CUZ A;  1DQU A;  2BBY A;  3LSP A;  1A35 A;  4LB5 A;  1N78 A;  4DW6 A;  2Q2E B;  3S1Q J;  3I71 A;  5IT3 A;  4M9S A;  3QOD A;  1R1U A;  4BEH A;  2MH9 A;  5M3F J;  2LSO A;  3DBL B;  2L5Q A;  2NVQ J;  1ZG3 A;  3F3X A;  4FX0 A;  1QZZ A;  2LRE A;  2NNY A;  4BKX A;  3K2Z A;  2QQ8 A;  2VJ5 A;  1QVU A;  5DUK A;  1ZRD A;  2YU9 J;  1X3U A;  4WX9 A;  3OYK A;  4A6D A;  2V9K A;  4MHG A;  1R5G A;  1SD6 A;  1BI1 A;  2DMT A;  1MGT A;  3OYL A;  2OCC H;  3QPH A;  4AC0 A;  3QU3 A;  1HF0 A;  2KRC A;  2XAQ A;  3OYB A;  3OIP A;  3S16 J;  4A3D J;  3KLN A;  2VON A;  1LE8 A;  1W36 D;  1Y8Q B;  4LGW A;  1IV6 A;  2AXT C;  1ZYR F;  4EEF G;  2PX9 A;  3MZY A;  3RJP A;  1FTZ A;  1UMQ A;  3X2Q H;  4AVP A;  1W5S A;  1RIO H;  1FOK A;  1WQ2 A;  4KN4 X;  2IA1 A;  1CGP A;  1IC8 A;  1PUE E;  4GYI A;  3BG7 A;  3GWZ A;  3EDP A;  4IF4 A;  3J7Z I;  3DBR B;  1U2W A;  1VQO I;  1YS7 A;  3F8C A;  5K7H A;  4NC7 A;  4UB8 C;  1WJF A;  4IO9 F;  3N05 A;  2OF7 A;  1XCV A;  5F1R A;  3QWL A;  4XLP F;  3G4S I;  2CYY A;  4HBL A;  3OYN A;  3Q3S A;  5J40 A;  3CCV I;  2WBM A;  4AYB A;  5CKT A;  4LD5 A;  4QTR A;  2CV0 A;  1RKT A;  1BW5 A;  1R9T J;  2AXL A;  1OCZ H;  1TZL A;  5EJC A;  2OC6 A;  3MCZ A;  2A69 F;  3FBI B;  1Y0N A;  3S2W A;  2Z16 A;  2VKE A;  1V5E A;  1HXD A;  1LJ9 A;  2RRE A;  4GO1 A;  1GUU A;  1I5Z A;  2EV0 A;  2KP6 A;  1ETV A;  1FOW A;  3ZQH A;  2VE8 A;  1KQ0 A;  3I56 I;  1LVA A;  1KU3 A;  1OCR H;  1DUX C;  3E6C C;  2EZH A;  2M7A A;  1ZGA A;  2JVH A;  3DTK A;  3WU0 A;  3LST A;  2R5Z B;  2IA2 A;  2XKP A;  5HDG A;  1XMK A;  3REO A;  2STT A;  4NB5 A;  1W0U A;  2BXY A;  4WXC A;  3F8M A;  4MO7 A;  1YIJ I;  3K4J A;  4EQQ A;  2DFE A;  4RLQ A;  2QGU A;  3ZMT A;  1IUF A;  3KZI C;  4BJT A;  3GLX A;  3TMO A;  3GTO J;  1R23 A;  1O3R A;  3ZMD A;  1Y56 A;  4IHX A;  3RSN A;  4XR6 A;  1EKE A;  1KQ8 A;  1VQL I;  2HS5 A;  3A01 A;  1GDT A;  1TQI A;  2JQ7 A;  2ESH A;  3KP6 A;  3F9K A;  2KDZ A;  1UZC A;  4ZYE A;  2A05 A;  1Z21 A;  3R0A A;  4BE1 A;  4DBR A;  2DFH A;  5C3E J;  2WB1 N;  4EM1 A;  1D8K A;  5H2F C;  5GPA A;  1XGN A;  2K9Q A;  1MW7 A;  1HCR A;  4RA2 A;  3NAR A;  1IJW C;  5E1Z B;  5FD6 A;  3IH3 A;  5IT9 K;  5ILS A;  2L4M A;  3K4C A;  3GW2 A;  4PDK A;  5FRO A;  4EJT A;  2EH3 A;  3CDH A;  5C4J J;  4HQE A;  1WGX A;  3WGH A;  1Y8R B;  1PUF A;  3ZQG A;  4HDV A;  1U6G A;  3OIQ A;  3LSM A;  2CG4 A;  3QOE A;  2E1C A;  1YTY A;  2R7U A;  3K4B A;  1FBS A;  3JRF A;  4HDU A;  1GVD A;  2XC7 A;  1FJL A;  4ZDO A;  3SJM A;  3WTT C;  1FYL A;  2ZSI B;  2PMH A;  4KFC A;  4YFX F;  3JR9 A;  1VQK I;  2KZV A;  1T33 A;  5JLW A;  1IN4 A;  3L2Q A;  2DT7 B;  2EB7 A;  1OIS A;  3GF2 A;  5CVV A;  4KA4 A;  3MN2 A;  3V4G A;  3BPV A;  2KKO A;  3CJN A;  5KNL A;  4EGZ A;  5L3B A;  5EG0 A;  5FB2 A;  3VYR B;  2L7F P;  3K9T A;  4IRH A;  4DJA A;  3SZG A;  2FUG 2;  1WSU A;  5KVR A;  5J3L A;  5L3C A;  1XGS A;  1MH3 A;  2MSY A;  4UUS A;  3L2W A;  1KZH A;  3HOW J;  1FWZ A;  4A3E J;  4HA8 A;  1Z77 A;  3WTU C;  4RLF A;  3CME I;  2ZNZ A;  5E17 F;  4M74 A;  5IYB J;  3OIO A;  2R7R A;  1USS A;  4XLF A;  4MEX F;  3AL0 C;  1HA8 A;  4R1H A;  3TOB A;  4D1Q A;  4XRM A;  4M73 A;  3CF2 A;  4L0Z B;  3QPS A;  4CCJ A;  5FRN A;  2DPD A;  1DU6 A;  4FET A;  3FX3 A;  1BC7 C;  4A3F J;  4BQN A;  3ESW B;  1T2K A;  5M5W J;  2W1O A;  2A68 F;  1MIJ A;  2XGE A;  1ZG1 A;  4BJ5 C;  1ETW A;  3KP4 A;  1MBG A;  3CDI A;  3E97 A;  4F91 B;  2HDC A;  2LG4 A;  1TW3 A;  2ZC2 A;  1P6R A;  1F5T A;  4ETS A;  3JRB A;  1HBX G;  1Z67 A;  1I27 A;  3LFK A;  2GLO A;  1RC9 A;  1R22 A;  2M30 A;  2Y31 A;  4OAY A;  4XSX F;  1J59 A;  3CMA I;  5DCM B;  3JAM K;  3EYY A;  2HWV A;  2L2O A;  3L7W A;  4QPO A;  2WAQ A;  1X1A A;  4JQF A;  1ZK8 A;  3I54 A;  3TGN A;  4B09 A;  1XGO A;  2VKH A;  1SVL A;  3IWZ A;  3E5U A;  3S1N J;  1TWH J;  1F1Z A;  2ZSH B;  3FMS A;  3VYU B;  1FP2 A;  2XRL A;  2VOP A;  1MD0 A;  2ELH A;  4KIS A;  3H36 A;  1PVE A;  2H09 A;  1QGP A;  4HEA 2;  4IRI A;  5M3M J;  4C30 A;  2LDU A;  3ZGK A;  5E3N A;  2DMP A;  1D0Z A;  1UCR A;  3RI4 A;  2WV1 A;  2TRT A;  4JX5 A;  3OV8 A;  1ZKG A;  4JX4 A;  3RZD J;  2FXA A;  2UV1 A;  1UB9 A;  3L2V A;  1KU2 A;  2IEK A;  4EJU A;  3B6C A;  2VXZ A;  2HU9 A; 
#chains in the Genus database with same CATH homology
 1R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...