1R71A

Crystal structure of the dna binding domain of korb in complex with the operator dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
EADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*(BRU)P*TP*TP*TP*AP*GP*CP*GP*GP*CP*TP*AP*AP*AP*AP*G)
total genus 41
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08535 KorB KorB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A KorB DNA-binding domain 1r71A01
1R71A
chains in the Genus database with same CATH superfamily
2DN0A 3K70C 3S1NJ 5LD2C 4FT8A 3WGHA 3WODF 4EJUA 2LD5A 1DGRM 3BP8A 4A0YA 2VBXA 5EF6A 2HQRA 1MZBA 3VYTB 2CW0F 3ZQCA 4A0XA 2X1CA 2V6CA 5M3FJ 1YIJI 2CQKA 2KZVA 2X1DA 3M07A 3S93A 2EA4A 1ZYRF 1I1GA 3PNYA 5EZGA 5TGTA 5J4YA 1XGOA 1HSTA 1OR7A 5ICEA 4CXFA 3L2WA 1BIBA 2VKEA 1SFUA 2PFBA 3FK7A 4HLYA 2QBYA 4KMFA 2DMNA 4GO1A 2DPDA 1L0OC 4I01A 4M3EA 2CWEA 1V5EA 5D8KB 2HS5A 5EGOB 3CJNA 4ZTJA 2GBYA 4M9XA 2ME6A 5KNLA 3S2HJ 2VB6A 4GYGA 2QZ8A 4M3GA 3FWEA 4NQWA 4RGUA 2DA4A 4X0GA 2X9DA 3V8LA 3VPRA 3NAUA 2P0WA 3GW2A 4QWQA 1A5JA 3U1DA 3ZMUA 1IXSB 1MNDA 2CJJA 2IGNA 3ERMA 3ONQA 3N05A 4XLCA 3D0SA 1JE8A 1VQOI 2CUJA 4UV9A 3QWLA 2ZXHA 4A3LJ 4LG0B 2JK3A 1IRGA 1N77A 1XSVA 4CHUA 4KIFA 1WJFA 1H88C 2X6WA 1TT5B 4QIWN 1P4XA 5DCFA 1IV8A 3WTWC 4KISA 1ODDA 1SEUA 5BNGA 2LFBA 4BEHA 3V42A 5HNFA 4RAGA 1Y1WJ 2L9SA 3BZ6A 4WWCA 1NG7A 1QRYA 4M71A 4WK8F 2HDWA 1ZLJA 4B3AA 4H0EA 2ICWG 3TDUC 1YI2I 3K9TA 1JT0A 1RETA 4XM3A 3KX2A 1EJ9A 2PMHA 1H9GA 1A35A 3KE2A 2R7RA 1MBHA 4MGRA 3KIOA 3JRBA 1TWCJ 1T2KA 2HKOA 2P7CB 3K1NA 3BQYA 3DPTA 5L3FA 2GIZA 2X6YA 1MJAA 3LMMA 2E1CA 2YSRA 1VZ0A 3CJQB 5CLSA 5K7FA 3GZ6A 1SC7A 1JKPC 4BJ6C 1ACIA 3ZMZA 1EF4A 1EH6A 2HNHA 1K7AA 3S3MA 3ABTA 2VT2A 4D0PA 2DLLA 2LBFB 1E0EA 4Y15A 3RQ4A 2K3PA 1X1BA 1U78A 3NRVA 2R92J 5FLMJ 4RLQA 3VOEA 3LL7A 1NK2P 2B0LA 1MBJA 2KJCA 3CCEI 3KZIC 5F1RA 1ZGWA 2LY9A 4R1HA 3FXUA 3L2VA 2XROA 2P81A 2IAIA 1I3QJ 3F8NA 3CD6I 1Q1HA 1F1ZA 3MKWB 3DLAA 3IWZA 5K5QA 1FYMA 1G3SA 1YQAA 5ICGA 2WTEA 1OPCA 2XRNA 3N97A 1MW7A 2ZB9A 3I4NJ 2QENA 1XC5A 2HQNA 1F9NA 4I0BA 2K9SA 2QVOA 2L7MP 4MQVA 4XKWA 2OZUA 2PJPA 4IO9F 2DDBA 4IHXA 1G3TA 2UXNA 3E3VA 4YIRX 1S72I 3PUFA 1TP4A 3I0TA 3TL4X 2CQQA 2RQQA 4XOPA 1JKQC 2MYSA 1J75A 2V6EA 1R4MB 3HYIA 2KRCA 3LFKA 3DWLE 2DJNA 2DOAA 1IGNA 4KYWA 3WTVC 1TWHJ 4EJOA 2KRFA 1R49A 4D7MA 4ON0A 3KEOA 2CV2A 1PJRA 2IGMA 4PUSA 2DTZA 2E5NA 3JRDA 2XDVA 1K6OA 4W1UA 4GFBA 4HQMA 5FKKA 2X48A 3OMYA 4M73A 1J5YA 3FZVA 2DK5A 2WB1N 1T0FA 2Y31A 5JI6A 3OYMA 2FX0A 2IPQX 3IV5A 1ULYA 2QKMB 3OR2C 1LNWA 5C4JJ 1ZRFA 3GTQJ 3Q0UA 3AAFA 4A3JJ 3LAJA 1JXSA 3PUBA 3Q3SA 4PJ0C 5AIPA 4HF0A 2D5VA 1YYVA 5BPDA 4IRGA 3LA2A 1MSEC 2RNJA 1F4KA 5HOOA 3OYKA 3I53A 2VASA 4L9VA 3F6VA 1HW1A 4XOTA 4CCKA 5HDNA 3J81K 2H27A 4IHYA 3RPQA 2AO9A 2FRHA 3NARA 1S5LC 4K2EA 3PO2J 1FOXA 2Y0SA 2BVMA 2GOXB 4M72A 5CYVA 1RNLA 3GCMA 2ELKA 2BW3B 2L9RA 3S16J 5HS9A 1R4NB 5J8CA 1T33A 5CQEA 2WB1A 1JJ8C 2HDCA 3ZQGA 3FISA 2P5VA 2KDZA 4HDUA 1GVJA 2VUMJ 4NC7A 1MMSA 1EKEA 1WJ5A 2ZXJA 3A01A 2VPRA 1JT6A 1BM9A 4GCVA 2K7LA 3BPXA 3RJPA 4G9YA 2HI3A 4HNVA 4KIGA 2K5CA 4XKCA 5FLXZ 2OD5A 2YS9A 2XASA 3FXQA 1VQ5I 3ZQLA 3E1SA 2WAFA 4BS9A 5FFXA 3IKVA 4W97A 4O5VA 2LSOA 3E97A 2D1VA 2ISYA 2L01A 3D1NI 1UCRA 5FO5A 5ERIA 1TQPA 3Q5FA 1O3QA 4KN4X 4XK4A 1LE8B 3HTSB 3WG7H 2HTJA 3VSLA 3RKQA 2QEXI 1ETXA 4NB5A 3V8JA 2L9VA 3F8MA 3RKWA 4UUSA 4IVNA 4IEJA 1BC8C 4EM0B 2VQGA 2V4JC 3BY6A 4MO7A 4OMYA 2XV4S 5E1XA 1QHHD 1GLNA 2VKVA 2JSCA 2KKOA 4AYBN 5IP7J 2ZO4A 3GZNB 3H1CA 3S3NA 2K9MA 3F72A 1ETVA 4D7NA 1LDKB 1KU7A 1HDDC 1T0FC 1MBFA 2VN2A 4OAZA 1R5GA 2LK2A 3JAMK 3H36A 3HOSA 1BA5A 3I55I 3HRUA 5FJ8J 2COMA 3R0JA 4O3MA 1F43A 2JJ7A 2DQRA 2XGXA 2W7NA 1SAXA 4A2UA 5B1BH 1CF7A 2DTRA 3GTKJ 4AC0A 1BR4A 4CYCA 1PVEA 3PFIA 4N9HA 2OJED 1HSJA 2LDUA 4HRIA 4L9JA 2K9QA 5C44J 3I4MJ 1GV2A 2H1KA 1X1PA 3QPLA 4YIFA 1KA8A 2HXOA 3AFHA 3K4CA 5J3LA 3OYFA 5E20A 2IBDA 5DYMA 3SXYA 2JA7J 5C3EJ 1FSHA 2B9SA 2TRTA 3SZTA 2K40A 1BOBA 1B6AA 1XTAA 5HDGA 2I5UA 5F08A 5J4VA 2GQQA 2GXGA 5K7HA 2EFQA 4C3JJ 4GGGA 2DO7A 3MWMA 3RQIA 4ESJA 1Z3YA 2LMDA 2W57A 1FBUA 1QZZA 3S32A 5M5XJ 1YTYA 1K78A 2E5ZA 3RPUA 2JPCA 2MLKA 2XB0X 2EJRA 1R71A 2QSHX 3WGIA 4LGWA 5AIQA 3I64A 1ZG1A 5D5UB 5E3MA 3DV8A 5IT9K 1ZR4A 4DZJA 3KP7A 3M8FA 5F0HA 2EQRA 4G7OF 3GTPJ 3CTAA 1ZR2A 1YITI 2CQXA 1A6IA 3IH3A 3KYLA 3SFZA 2C6YA 2CG4A 3AL0C 3G71I 3FKIJ 4LK1F 1K6YA 3QYEA 4ZYDA 2O8KA 4HDVA 4BE1A 4GDFA 1OCTC 4ENMA 2CFOA 2O7OA 1OR7C 5FKOA 2P5LC 1ETQA 1QVUA 1GXQA 1OQYA 2XC7A 1VFCA 1FTZA 4ZDPA 3JAMZ 2VC0A 5FROA 4UVAA 2OQRA 1Y56A 2VE8A 2EFOA 1B72A 4KFCA 4U0VA 5J6XA 4DIQA 1KQ9A 3IRRA 2LR8A 2IS1A 3MCZA 4B3XA 3ZMVA 2Z16A 1JHHA 3QU6A 3ZR8X 2G7UA 4DQ2A 3CMMA 1DUXC 1K61A 5BOXA 1E3OC 1IC8A 1B72B 1IJWC 4M6YA 4UXNA 2CMPA 3RCOA 3D5RC 2R7DA 3ZMSA 4A3MJ 1X3WB 3DBLB 2E35A 4AIJA 4A5MA 3GF2A 2STTA 1S3JA 4HF2A 1GV5A 3EUHC 2XPVA 2Y30A 3U2RA 1EV7A 4EQQA 3VYUB 2JVHA 3FX3A 3TW7A 3TKYA 5CVRA 3FF5A 4KNYA 1XDUA 2BGCA 5FLXK 3FXOA 4HV6A 3EQLF 3L2UA 2R7ZJ 3A02A 4BNCA 5EDNA 4IRHA 1STZA 4BE0A 2MC3A 5K7ZA 2D1HA 1VTNC 1WHUA 3OIOA 3WHCA 4G7HF 1TT0A 1Z7UA 2LY2A 5D5WB 3PFYA 2ZC2A 1QU3A 4PJJA 4F91B 2O9LA 4CZCA 1FTTA 5HS7A 4HX7A 3BTCA 4AU7A 2HTSA 4IPAA 3BG9A 4LITA 3QPHA 4B4CA 1XDSA 3HTUA 4Y33A 1U0JA 4L5EA 2HQ5A 1USTA 3W6VA 2F4MB 3H0GJ 1R22A 4P96A 2LP0A 5E3LA 2VE9A 2RN7A 2EILH 2DAOA 3RYPA 1WJAA 1CQTA 4C30A 3UR3C 4FCYA 3LSGA 2FNPA 1TTYA 4V2GA 2BHZA 3FK6A 1KQ0A 2ZBKA 3T1BA 1T39A 2HPMA 2O6GE 1FY7A 3AKZA 2V9VA 1B9NA 1U3EM 1IXRC 3J7YJ 3OYHA 1RR8C 1B9MA 3KLOA 5F27A 1ETYA 1X4PA 2DFHA 4Y4RA 3D5SC 2VBZA 4UHTA 3MN2A 2X6OA 3FXKA 3HIFA 3O2PE 4QSHA 4WF2A 2R5YA 2BEOA 2KIQA 3E6CC 1MH4A 1U5TB 2VODA 3SYTA 2BYVE 3EETA 3LSPA 5L3GA 2E1MC 2PN6A 1WRJA 2A3SA 1QPIA 2DA2A 2ECBA 1BBYA 2XB5A 1WZ2A 2IVMA 2CO5A 1TC3C 4A3GJ 2UUZA 1OJLA 3GEZA 4TV7A 3TP3A 3ULQB 3K7AJ 2XUBA 2O03A 4DYCA 1D0YA 2R4GA 3X2QH 3K10A 3VEPA 4UVCA 2W4SA 2QA4I 2XHKA 2QCOA 3GO5A 2ESNA 1FPQA 3OS0A 3EUHA 4XLNF 3LSHA 4BL0B 1X4OA 1LJ9A 1MMAA 1EA3A 1TNTA 4IZZA 1XGSA 5E1ZB 3OS1A 4PCQA 5FGMA 3CO7C 2RDPA 2KMUA 1IV6A 1D0ZA 1T8IA 3TO7A 1MBKA 3HB9A 2JRTA 2DA1A 3GZ5A 2BE5F 2HZDA 3ZOBA 2QQ8A 2EIJH 2TDXA 2LVSA 4ETSA 1I50J 2HOTA 1KYWA 1P4WA 4CCLA 1R36A 4RAFA 2ZCWA 2A05A 3DU6A 2GA2A 4UB8C 1ERDA 1HF0A 2Q0OA 2UWMA 2FF4A 1JTYA 2ZMEA 3WTYC 3DBRB 3CCQI 3FHZA 4JX5A 2M87A 2NS0A 2H94A 2QUFA 3KFWX 2HOSA 1A36A 5DD8A 4IJAA 3L9FA 1S9HA 2E1OA 2OU2A 3HHGA 4L0YB 1MNEA 2L54A 2P8TA 2BXYA 4ZYGA 3CUQA 4F3QA 3IL2A 3O8GA 4CCMA 2RNGA 1U9NA 1SMYF 4Q47A 5CJ9A 2IT0A 3ZQ7A 1XD7A 1Z21A 3TBIA 3PIPF 2QKLB 2M4KA 4D9JA 3BR5A 3EYYA 3ISPA 2VKDA 2DMUA 1IG7A 4YRVA 1WH5A 2XKOA 1VQMI 3M7GA 4M9ZA 1XSDA 4L9TA 4IHWA 3P5JA 2ID6A 3MFKA 1ZELA 1ON1A 1P7IA 2E71A 3ERED 3HZJA 1G6NA 2O0YA 1MJBA 5H20A 1XS9A 4M6XA 3BPVA 3GLXA 3I59B 4J19A 1KQ8A 1TW2A 1TZLA 3FXJA 5C4XJ 4H4KC 1UZCA 3GLLA 3W6JB 1W36C 2NYXA 2EPFA 4RB0A 4OMZA 4Y13A 1W5TA 4BQNA 3G2BA 5ILUA 2EZHA 1D3YA 5J8FA 3A01B 3CC7I 5DM7F 1BI0A 2E7WA 3V7RA 1JGGA 2W48A 1ZG3A 5DTDA 2EH3A 1ZRDA 2MFZA 2GXBA 2CSOA 5HVQC 4AVZA 4EMSA 2RC4A 3HRTA 1O57A 3GX4X 3V7SA 3MKZA 1OISA 3Q0VA 1RPWA 3QOEA 4ZYEA 4P55A 4QTRA 1O3SA 3AG3H 3B6AA 4XLEA 1YS7A 2Z3YA 5D4SA 5LEKA 4XLPF 4PGHA 1H8AC 2M4GA 3CLQA 2CU7A 2A5YB 3HSEA 3A4CA 1AKHA 4WX9A 1UHSA 2FBKA 4B48A 1POGA 4HNTA 4AD9A 1ZGAA 4EGZA 2R5YB 1VQLI 2M7BA 2F4IA 2DFEA 2FNAA 3G6EI 4S05A 1ZK8A 3JRFA 5K5RA 4BQQA 1XMKA 5LLQA 2M8EA 3F21A 1FC3A 4F52A 1D5YA 2M34A 3LA7A 3HOWJ 3U21A 1U5TC 3F8FA 2UXXA 4A5NA 1WQ2A 2A68F 1B8IB 3OWTA 2LH9A 2EFNA 3DFGA 3TO6A 1ZN2A 4LLLA 1XSXA 3OIPA 1ONVA 4YFKF 1MBGA 3K4KA 2AQFA 1ETOA 3KEQA 3MD2A 3ZQFA 3GFLA 4I7HA 2HKXA 4DBRA 4EGYA 2XGDA 5F6FA 2ZMEC 5HNHA 1K4TA 3BOQA 4S04A 3CJTB 5LBQA 3OYNA 1K79A 2LKPA 3CUOA 4XN0A 3GYHX 4ZDOA 4Q4ZF 2DOFA 3H5NA 1R00A 1YO5C 1XMXA 2XRLA 1ZGJA 2NNYA 3DPLC 2LREA 3E6DA 1O7LA 1K4SA 4QLCU 4M74A 3A2KA 3HRSA 4U0WA 3BDDA 3C1DA 4HG2A 1QQIA 1YX5A 3KPHA 2LRDA 1OKRA 3TP0A 4HPQA 2OV7A 2VIXA 1LEBA 1V54H 3F8CA 4RM3A 3I54A 4XRFA 4Z6YA 2GA1A 4HSTA 4A6EA 2NVUB 2ZJPF 2XVCA 3CDIA 2QM3A 1X1AA 3BR3A 1FYLA 4C3HJ 4IF4A 1ZHFA 3U9GA 1IN7A 4B09A 3WHBA 5TRDA 3OYIA 2HYJA 3K1PA 4LIUA 3IHUA 1WKMA 4XSXF 3T5XA 3DEWA 1W5CC 1KU3A 2CW8A 5D8LB 1R9TJ 4IL6C 4AIKA 1FP2A 3CCSI 2OZ6A 1WH7A 2EIMH 4II2A 3M4OJ 1XCVA 1RKTA 2O5RA 2A6EF 3JREA 4JYKA 5IT9Z 3WTSC 2PMUA 3CDHA 1G3WA 3K4JA 1AHDP 1S7AA 1ZTRA 4JK1X 2CGPA 2GZWA 1J2XA 1X2NA 4MEXF 3GTOJ 3WU2C 3ZMTA 3ZQIA 2WAQA 4ZDLA 3COAC 2A6HF 2VJ4A 2HU9A 3CESA 5J1UA 4CDGA 2NXNB 4PSXA 5FLVA 4N4OB 1UG2A 2Y0SN 3ZGKA 4A3IJ 3BG5A 4NC6A 3Q9VA 1FP1D 3MZHA 1V4RA 1D1BA 1SMTA 2ME0A 3QQAA 4ZH4F 4OIPF 2X1EA 2OA4A 4ASNA 3ROUA 3D5LA 2MH9A 1WWXA 3K1MA 2M45A 4XQFA 4CICA 2NVYJ 1Y0UA 1HOMA 1U9OA 4E70A 1HKTA 2HXIA 3JTHA 1U5TA 1T95A 2F5FA 4P9UA 3CCMI 3DCFA 3GUDA 1QZYA 4PZJA 3TOBA 1A6QA 1K83J 2M8GX 1WJCA 1T98A 4IQJA 1NK3P 3MEXA 1BI3A 5M5YJ 4KITB 2HFHA 5KCMA 1ENHA 2RKHA 1LVKA 2XSDC 2FU4A 3TW6A 2OTLI 1Y1VJ 2K4BA 2RGVA 1IO2A 4M3BA 3C2GA 3R61A 1R6RA 2FBIA 2ZFUA 1IN8A 4NC8A 5IT3A 1G4DA 2P7VB 3VWBA 5ICCA 2BZTA 2KZGA 5HLIA 2NAZA 1IXCA 3A1YA 3H0DA 2VPLA 5H6RA 1FX7A 1IF1A 2LNBA 1MMGA 1YJWI 1LFUP 5JVTA 3ELKA 3BJ6A 3SFIA 1SD6A 1JUPA 4KDPA 2JTVA 3JSPA 1XCBA 3JR9A 3F23A 3MKLA 3W2VA 3KYDB 1R5ID 2DCEA 3DKYA 2LKXA 3ABMH 1APLC 4CYDA 1HKQA 2CUFA 2IA2A 2EINH 2LOOA 1VQNI 2DK8A 2IP2A 2Y75A 3M8JA 1AWCA 3RI4A 3K69A 3G3ZA 2JUCA 4EM1A 2YU9J 2A5WA 1SVMA 5ED4A 3KP2A 1TWAJ 1W5SA 5E1WA 3LSRA 2Z33A 3ECHA 4LJZF 3CUQB 3BTIA 1VQ6I 3PSIA 1S29A 3K4MA 2DFFA 3A0HC 3M9AA 1P6RA 1ZQ3P 1Z6TA 3SZGA 3VDXA 1R1UA 3REOA 1VNDA 4RBOA 2I10A 3IH4A 3I56I 1ETKA 3GVAA 3SZPA 3TOAA 4BBRJ 1QA6A 3O6BB 1WI3A 1BOAA 2DDAA 4MLOA 5GPAA 1HBXG 1Y0NA 1BI2A 2ELHA 1VQ9I 4I02A 3J81Z 3CZ6A 3L2QA 2HGCA 1ZG5A 1BW5A 1VI0A 1MGTA 3H5RA 2L4MA 5JR3A 3LWFA 2O3FA 3IUOA 4UUTA 2EZIA 4KT5C 1N25A 2FQ4A 3PNVA 2MGQA 3LQRA 4DZPA 2F48A 1P2FA 4LOCA 1PDNC 1JKRC 3HGGA 1B59A 2VI6A 3HHHA 4II3A 3SEZA 1X3ZB 2JRMA 4G6TB 1QZEA 3OV8A 1IDYA 2J5OA 1R5HA 4CGZA 2IA1A 3FXRA 3NWTA 1D5VA 1WJEA 2M0CA 1W7PD 3CUQC 1OCZH 4CCJA 1JGSA 2VT3A 4XNFA 2EV5A 4IQ4A 5CVIA 3NQOA 4A93J 3S1RJ 2ECCA 1J9IA 4PSWA 1UG0A 1ZAOA 1OCRH 2PG4A 1JHFA 4F93B 4UNOA 4BDYA 2HVQA 4ZZDA 2F4OB 5F64A 2EB7A 3ESWB 2EBIA 2OCCH 3JRHA 1RI7A 4YG2F 1MMNA 3CCLI 3WU1B 2K02A 4JX4A 1BR2A 4I76A 3GTMJ 4OAYA 3LAPA 3PL8A 2R3SA 1R23A 1RRJA 1FWZA 2DMTA 2HOEA 4BXXJ 4AVPA 1RKWA 2E60A 2JN6A 3H9JA 2LLKA 2IS6A 2W24A 3L09A 2VONA 4BY1J 1FOYA 5CPRB 3FBNB 4HOBA 1NH3A 1VQ4I 4LLGF 4HSRA 3AG2H 4DGWB 2Q1ZB 1P7JA 4XIDA 2QSFX 1DPRA 4AIHA 4ZTFA 4RDUA 2VKHA 3G1OA 3BCAA 3QP5A 5DCMB 2E19A 1PUEE 1DP7P 2HVSA 2KFDA 5DV5A 1WI9A 4CO8A 2GAUA 4B8XA 3H3VK 3S14J 3LSMA 1ETWA 3GFJA 1RZ4A 3KP6A 4EATA 2F5VA 4L0ZB 1U6GA 2L7KA 3BT9A 2A6TA 2DYRH 2RREA 4HV5A 4MTEA 1BJZA 1GVDA 1RESA 1TWFJ 2FMLA 5CKTA 4E7IA 4A3KJ 3L2RA 3C7JA 1BL0A 1XPXA 1A31A 4YELA 1G8XA 4OIQF 3A0BC 2XIGA 3F3XA 4NQWB 2FD5A 1GDTA 5DEQA 3SQNA 3UKGA 4DYQA 2CW7A 1W7PA 3I71A 1YRNB 1UELB 3MZ8A 1BW6A 4BJTA 4ESBA 3IH2A 2ETHA 4YEJA 3WTZA 4LG0A 4JP0A 1DDNA 2PMZN 5TISC 4A69C 1HA8A 2JA2A 4IX7A 3BROA 3CCYA 3H3ZA 1YHQI 2IGOA 3CCRI 4Y52J 1IN4A 3ZN1A 2ZFWA 2R7WA 2CH0A 3S17J 3MZYA 5E3NA 3FDYA 2D45A 4XN3A 2XAJA 1R7JA 3OSFA 3OL3A 3OYAA 1Z05A 5IOZA 3FMSA 3MAJA 1G3YA 5J47A 4HX8A 2Y9YA 5D5XB 2IXSA 3KP4A 1LEAA 2HZTA 1O3RA 4IHTA 4RA2A 3LOCA 2V7FA 3I4PA 1VQKI 2W1OA 1IRFA 2M7AA 4IOAF 1I6HJ 3BG3A 2CQ7A 3HRMA 1WPKA 4JOMA 2R7VA 2EWNA 1IRXA 5EJCA 2X51A 4NUBA 4AYBA 1MD0A 2L02A 3B6CA 4XKVA 1WJBA 1PUFB 2MLGA 1Y8QB 3QPSA 4FX0A 2J5PA 2K86A 4HAMA 2W82A 3M8EA 4C2MJ 4MNUA 2ZSHB 2KHMA 3ZP5A 2R7OA 4PK4A 2PQ8A 3E0JB 3CP8A 2V79A 4BJ5C 2Y9ZA 2DT6A 3CC2I 3CF2A 2KQRA 3BCBA 3W6KB 2UZKA 1SAUA 1HQCA 1HXDA 4JQFA 2YR2A 4IXAA 1HKSA 4ITVA 3S3OA 2R7TA 5L3BA 2TCTA 1TWGJ 4KMUX 4Z2YA 3RYRA 2WBMA 4D1QA 1G59A 1P9QC 3E6MA 3NEUA 2X4HA 1QNTA 3GXOA 3HOTA 3OY9A 5GAGJ 3F0CA 1GHCA 2KJBA 3OYCA 2YPRA 1FIPA 2KISA 1I39A 1BJAA 2VBWA 2XAGA 2XPUA 4E7LA 4XLHA 2FOKA 1U2WA 2K27A 3K70D 4FX4A 3AG4H 5CVUA 2MD0A 4EEFG 2H6CA 3CP2A 3MQ0A 1DQUA 3SEQA 2H6BA 2RV8A 5B5EC 1MIJA 1X3UA 4M9SA 2LKSA 5DUKA 5FB2A 1LB2A 2FOWA 3HEFA 2W85A 3IWFA 1YX3A 2OUMA 1S7EA 3U1KA 1QHGA 4FQGA 1V5FA 5DM6F 2V26A 5EEAA 2E36A 4QPQA 4A3DJ 2HEOA 4S0HB 3T0YA 1UB9A 1UHMA 3WE3A 2MH2A 4RMNA 1JKOC 3E5XA 2L4AA 4WXHA 4N9IA 4FTHA 1Q1VA 3C2HA 1YW8A 1USSA 3HOVJ 3C2BA 2DXIA 4KIBA 4BH9A 4RB3C 4P5OA 1OCCH 1I3AA 3OYEA 2MBFA 3L1PA 1YOVB 3CF5F 4BE2A 1WSUA 4R79A 1D8KA 4UUSB 2V1DA 4ESFA 2DODA 4HX4A 2MC4A 4BXUA 5E8GA 3TEDA 5DCMA 1TNSA 2IW5A 3VFZA 4B47A 2V1UA 1X1DA 2K3FA 2XPWA 3A03A 2EK5A 5FKLA 2A69F 3RTRA 1JUSA 5H6QA 3WE2A 1ZRCA 3H3UA 2LY1A 3M3YJ 2KDOA 4C9YA 1GXPA 2AHQA 4ZYHA 1VQ7I 2MABA 5DUIA 1LKXA 3C3WA 2VXDA 2JA5J 5B3SH 5AONA 1LE8A 3ABKH 1T38A 4X1EA 4XLAA 1DP3A 2YUSA 3L7WA 5HDKA 2R7QA 2PLYA 2PMZA 3ML6A 3ZMDA 2JA6J 2VOOA 3SJMA 2NS7A 4I99C 2WAQN 2CQNA 3AG1H 4WXCA 1TBXA 3BR6A 5J1RA 1Z7LA 1HC8A 1SD5A 2E34A 1O3TA 4GYIA 4P1WA 3FMRA 3HL2A 3IAM2 4A3EJ 5IYBJ 4BHCA 1T08B 3DKXA 5FKMA 1XX5A 5HLGA 1GUUA 4KT6A 4U88A 3E5QA 1TQIA 2ZJ2A 1WGXA 2EV0A 2ELJA 2QF7A 2FE3A 2DJIA 1KU2A 2G0EA 2EZLA 2HR3A 3PQKA 1AOYA 3KP3A 3LFUA 2Y69H 4DJAA 2NS8A 4MTDA 2QQBA 2KT0A 4EV0A 2R7XA 5GP9A 1Z1DA 2BY0A 1RUNA 1IW7F 1J09A 1MBEA 2K9LA 4FASD 4BU2A 5DS9A 1D1AA 1QO0D 1IN5A 1FBQA 4OWRB 2P6TA 4PJLA 5CQGA 3ZQHA 1FZPB 4F92B 2STWA 3LA3A 2PJRA 4UVBA 1LUJB 4A3BJ 5HLHA 2LBFA 1KGSA 4O6JA 3VSKA 1FYKA 2H8WA 4N0BA 2PI0A 3T8RA 2QYOA 5LEJA 3RIRA 2WV1A 1QBJA 3P9IA 5H2FC 1V3FA 3L2CA 1C0WA 4M3DA 4U87A 1WFXA 4AIDA 4EJTA 5EG0A 2CV0A 2ZSIB 2R5ZB 4G6QA 4BYYA 2JA8J 3CCVI 3ECOA 1O7FA 2BHYA 4HNUA 4E4HA 4JX6A 3IKTA 3HSRA 2VJ5A 2V9PA 3OOUA 4CSWA 3FMQA 1Z6RA 1RUOA 3C18A 3H5AA 2OC6A 2CS3A 4L9NA 4LFUA 1HCRA 5LHGA 1D0XA 5KVRA 4IOCF 4IHVA 3OYGA 4B43A 2DA6A 1HLVA 4HZFA 2F5EA 2Y2ZA 4XORA 3ZQQA 2E2HJ 1W1WE 1ZKGA 3TO9A 4AWXB 3JTGA 2DFIA 2JSPA 5IY5H 1YE9A 2WAEA 2CUZA 2WA0A 4RB1A 4E7KA 3WU0A 4HYEA 1OYYA 4ABZA 4BY7J 2VC1A 1F36A 2IGKA 3DEEA 3TMOA 4R8HA 4E7ZA 2EFWA 2G7HA 3K6GA 4Y7NJ 2VOPA 5EEGA 2F5DA 5CVVA 1VQPI 3ZN0A 2ZJRF 3QP6A 2K9NA 3QYFA 3CCUI 1FLIA 1LQ1A 5L3DA 1SVOA 5JVGF 4HF1A 2E7XA 5E8IA 3F9KA 3BWGA 4A12A 1A04A 4E7SA 2M9HA 2VL8A 2FQ3A 4CYCB 3H35A 3QODA 3CQZJ 2QBYB 1TW3A 4RB2C 5A2QK 1OYIA 3KLNA 3R0AA 1YFHA 4WXDA 4NHJA 3KYCB 1E3HA 2DT5A 2RQPA 3K2AA 3LSJA 2CV1A 3ZPLA 2HOAA 3JSOA 4XRSG 2BV6A 3G1LA 1E3PA 2H1LA 2ZXIA 3Q0WA 3R4KA 4G8XA 4JBAA 5F1JA 4FETA 5BMZA 3BQZA 3J80K 1SFOJ 4BBSJ 3SHFA 3QRFF 4OINF 4V2FA 3RSNA 5ICFA 4HW0A 2AXTC 1RC9A 3GWZA 2DI3A 1YLFA 2Q2EB 2DA5A 1P92A 1T6SA 2QLZA 2QQAA 2W25A 3LSIA 4BKXA 1YS6A 3BTLA 1AKHB 3GTJJ 3M1CA 3CC4I 2A07F 4RAYA 3GFIA 1DU6A 1FOWA 3GFMA 3ZRGA 1H89C 2KIUA 4BUPA 1OCPA 4EJWA 4LK0F 2M3AA 4GRIA 2M0MA 1ITYA 2YX4A 3HSFA 5GAHJ 4FE4A 3HJEA 4V19K 3ZCOA 1I27A 2JPBA 3HKZA 1XB4A 1YIOA 5IPAA 4HA8A 5E79C 3CDLA 4CH7A 3AL0B 1WJDA 5JLWA 4I6ZA 2ISZA 4XONA 5JLXA 4C2UA 2HYGD 3Q9SA 5LHIA 1P4AA 5TJJA 1QVTA 1FSEA 2DBBA 4J00A 2BW3A 3GTLJ 4DOZA 3JRGA 3S1MJ 3CCJI 3RZOJ 2X0LA 1FBSA 3JCUC 5ILSA 5IP6A 1S6LA 5J40A 5IOYA 1OFCX 5IYCJ 3I5UA 4E7JA 2HPIA 4PGGA 2LF8A 1E2XA 1QPMA 3J7AO 5JFRA 3V7CA 2ZKZA 1NTCA 2BOLA 3R6SA 4D5FA 4ENJA 1RIOH 3PNTA 4CZZA 1JTXA 1EH8A 3P9CA 2XSJC 2K4JA 1FEXA 4YFNF 1QGPA 2FSWA 4MIMA 3HOZJ 3JRAA 2FUG2 2JWTA 3FXMA 2P4WA 2R0QC 2HYFA 4RGRA 5GTIC 2Z99A 3UNGC 3L00A 5LRRA 1LDDA 1GT0C 4BHPA 1VQ8I 2E1NA 4DBQA 2XF6A 1H0MA 4M6VA 2BXZA 5HLTA 2LYCA 1SD4A 2OAZA 2E2IJ 2WC2A 4AM3A 1DPUA 2VXZA 2CYYA 4AUXA 1FMVA 4XBFA 1MKMA 4BDZA 4XICA 3DU5A 4UUVA 2XF5A 2PEXA 1SFKA 2KIMA 2JZYA 9ANTA 1KYZA 3DQVC 4XMYA 4CA0A 2XAFA 2ACJA 2XKPA 2IJLA 1IZ1A 3PSFA 2HDDA 3E7LA 4QPOA 2VQHA 3HOXJ 4UV8A 3S1QJ 3VODA 2D2WA 2XGEA 1D8JA 3FHNA 4NDLA 2VLAA 3HOYJ 2L7FP 2LTPA 3FBIB 2NNNA 2R93J 1Z77A 3NWSA 1YW7A 2NOGA 5F0FA 1FMWA 5GAEJ 5CVJA 2QQ9A 4BHBA 3S15J 3DBHB 4RS8A 2EFPA 2XAQA 3HKZN 1BN5A 1FT9A 4XSZF 4Y17A 3F8BA 2R7UA 1J7KA 2JVGA 2O61A 4LMYA 5KAFC 1N78A 1BR1A 3DTKA 2VJIA 2FMYA 2L5QA 1XN7A 2QWWA 2KL4A 2DPUA 4E7HA 2OBPA 1PUFA 3K0LA 2FJ1A 2L0KA 5EYRA 5D6EA 5D6FA 1HW5A 5LRSA 5D4RA 2AQEA 4NBQA 3HBLA 2H8RA 2B63J 2M1BA 1JI8A 2VQCA 3H9GA 3WGGA 2HVRA 1R1VA 3JW4A 3PQJA 2M30A 1W4MA 1ZREA 3HUGA 2V1NA 3DF8A 4BAYA 2DMQA 4BQOA 4RM2A 2CUEA 4HEA2 2WV0A 2XF7A 1XMAA 1E17A 1YJ9I 2O8XA 2WY7Q 2FA5A 6PAXA 4F7ZA 1IUYA 3QPTA 4MFEA 3DKWA 2NVQJ 1UFMA 1XGMA 1LVAA 2LF7A 3I3LA 3FIWA 4DYRA 1FJLA 3DTIA 3H92A 3O3KA 3J7ZI 2F6CA 5BS6A 2GXAA 4RAZA 1ORKA 1FNNA 4FE7A 5GADJ 2HWVA 1OYWA 2Y48A 2P5KA 1SFXA 4BEHB 1UHWA 1YW9A 1Y6IA 3BG6A 4BQAA 1YG2A 2DU9A 1KZHA 2PX9A 1VF9A 4FHTA 3JRCA 3LQQA 2AS5F 5FRMA 4IHSA 1K78B 2NVTJ 1SD7A 2OF7A 3OS2A 5JHFA 3OSGA 5LFAA 3TDZC 3E6BA 3EDPA 2MG4A 3RZDJ 3OYBA 1TLHB 1V55H 1YJNI 3SDBA 3CMEI 3OIQA 5B66C 3K4BA 1MMDA 3WTUC 3IC7A 2VQLA 4XL9A 3S2DJ 2FXAA 3DXJF 4LLNA 2VJJA 4KA4A 3F22A 3VYSB 1LFBA 2JT1A 1WCMJ 5JHUA 3JRIA 2RAEA 2NRAC 1HDPA 5FKNA 1BC7C 5EGOA 1OLTA 4ENKA 1ZARA 2YU3A 4XR6A 1B4AA 3J80Z 3DPUA 5GPCA 4P9FA 3EPZA 1L3LA 4MEYF 2M5WA 3HUGB 1F5TA 3EUAA 4B1RA 1MDMB 2JUGA 1V5GA 3E5UA 1DU0A 2HQAA 5E3OA 4B44A 2MW8A 3PJRA 2K85A 3G1MA 4LIVA 4E6KG 2PJRB 2YX7A 2Z2SB 4EJVA 1LFPA 2H09A 2ZXWH 2DMPA 5FD6A 5M3MJ 5A2QZ 3WTTC 5GTHC 3WTXC 4NNJA 2V9KA 3BLYA 4RGSA 4ZYAA 4A0ZA 3LSKA 3IAS2 3K2ZA 2G9WA 2QSGX 3FXLA 3BZKA 4L5JA 5IP9J 2OCEA 3J7AY 4A3FJ 1NHAA 2F2EA 4J01A 3WG9A 3PO3J 4WCGA 3KZYA 3O8HA 4ENNA 4U7DA 1I6XA 1D1CA 3IRQA 4BACA 5ILVA 4A3CJ 3BJAA 2R5ZA 4OIOF 4PDKA 3MKYB 2QGUA 1Y8RB 4RGXA 4HBLA 1AA7A 3BC8A 2VBYA 1W36D 5EEHA 1G2HA 5KAIC 3BG7A 3M1EA 3OYJA 1YRNA 3T8TA 3KETA 3HPHA 1J0RA 3PM1A 2X6XA 3BTJA 1B1BA 2KIFA 3BJOA 3VYRB 2ESHA 2W00A 3HXLA 1Z0XA 4Y3OA 2L9NA 1KONA 3KCCA 2EIKH 4U7BA 1ZLKA 4FISA 5LHHA 4MQ9F 3I58A 3LSTA 1XGNA 2BVLA 2GIVA 1Z9CA 2DQLA 2IEKA 1I5ZA 3CLOA 1BIAA 4XLFA 3RKYA 2JMWA 1B8IA 1OCOH 3OYLA 3EUKL 4UB6C 4L5IA 3KEYA 3V4GA 4I2OA 2XAHA 4G6DA 3HG9A 4KUMA 5EZHA 3DEUA 4LB6B 3N4MA 1R58A 3I59A 1J59A 3I9V2 1CGPA 3RDIA 2P6SA 1MH3A 3BZCA 3PIOF 3S8PA 3BR1A 3IP4B 1MDMA 2DA7A 3TGNA 3QU3A 5HODA 1TL8A 1XG1A 3B02A 2IS2A 1M1EB 2GLOA 3CMYA 1X58A 2FBHA 2Q2EA 2CFXA 1IDZA 2RVCA 4I0AA 5FFZA 5E18F 1KU9A 4EM2A 3W2AA 4Q5SF 4GXOA 3SDGA 2DW4A 4PFPA 5D5VB 1Y39A 4IRIA 1CF7B 3K4NA 3P9KA 3DLLF 1X2MA 1U8RA 4KN7X 1T56A 2OPTA 4X6AJ 1AU7A 1Z3XA 3OYDA 3W2WA 2NVXJ 1OMIA 5DD4A 1WVRA 4ZC3A 1O4XA 4C3IJ 5E17F 4G12A 2NOJB 1H9TA 1MNMC 4XKBA 1I1SA 3S2WA 4LG3A 4F55A 2B7EA 4OIRF 3CO6C 2IA0A 3FKJA 3OOPA 5F0CA 4HLXA 2Z5UA 2F5CA 2I8DA 4CUGA 5L3EA 3HC7A 3QYBA 4C2TA 3DP7A 2DA3A 3HOUJ 2V1XA 2XAUA 4RLFA 3OL4A 2L2OA 2L3DA 1MJ9A 4N4NB 3GTGJ 3HM5A 2R7FA 3RKXA 4XRMA 3G73A 2COBA 3HPGA 3KZZA 2KPMA 2DYSH 2W84A 4L18B 3ASOH 1RR7A 1SFEA 1W0UA 4UY8I 3FM5A 1IUFA 2Z1DA 2MA3A 3QAHA 1REPC 2ADUA 1N75A 1ON2A 3VB2A 2UV1A 2BY2A 4G94A 1S7OA 5LGTA 1MSFC 1W0TA 2IS4A 3GMEA 3ASNH 3K4LA 5L3CA 2GWRA 4ZZLA 2ZNYA 2EZKA 2FEZA 3P7NA 1FOKA 1BI1A 3GBGA 3LNQA 5KHDA 2MSYA 2LG4A 5KK1A 2LC2A 5BQTA 4LD5A 1Z91A 4HQEA 2Q8KA 4OU0A 1PP8F 1SANA 2PBIA 2WADA 1FIAA 5F04A 2Z9OA 2XGCA 1IN6A 1ZH5A 2KRHA 2ZMEB 5IYDJ 3G4SI 3ZXSA 4PJNA 2GM4A 2N8GA 2JQ7A 3MMYB 2KP6A 3ABLH 5LGNA 4PFOA 4YIIA 4U0YA 2WWYA 4MHGA 2BY1A 4LB5A 2L7ZA 2DOEA 3MVPA 4KICA 4BXFA 4YFXF 5FD5A 2BBYA 1X1CA 5LGUA 1W7PB 2GOMA 4BGDA 5FRNA 2OTJI 2Y0MA 4XRSA 2A61A 5M5WJ 4M3FA 3BR0A 4IKFA 3F6OA 3BR2A 1SVLA 3ABUA 3FM3A 1EH7A 1UJ8A 1R1TA 1LPQA 3HDDA 4I98B 3V8KA 3DTEA 2ID3A 3KP5A 5BPIA 2E1MB 5EG0B 3OR1C 3B73A 3QOPA 1UMQA 1LDJA 4Q48A 1IAWA 2EA2A 1DGWY 4MFDA 2M2EA 4D5CA 2ZJQF 2ZNZA 3RPUD 1PYVA 5HS8A 3H9QA 1IRZA 3CMAI 2CRGA 2MD5A 4G7ZF 4A6DA 2EV6A 4EVIA 3CJRB 3TQNA 5K1YA 2DT7B 5K5OA 2E2JJ 3HGYA 4ZJZA 1NG6A 2KLOA 4DW6A 1JUMA 1TQMA 5J1YA 2AXLA 1PP7U 5B1AH 4CCOA 1X19A 2R7SA 1HW2A 2IRFG 1JJ6C 4KJZA 2X85A 4DNCA 5DDGA 3W3CA 4I09A 4OOIA 4ANJA 1S8NA 1U8BA 3EYIA 2WY8Q 1UAAA 2BY3A 3R60A 1Z67A 4CCNA 2OQGA 4PJMA
chains in the Genus database with same CATH topology
1R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R71 A; 
#chains in the Genus database with same CATH topology
 2DN0 A;  3K70 C;  3S1N J;  5LD2 C;  4FT8 A;  3WGH A;  3WOD F;  4EJU A;  2LD5 A;  1DGR M;  3BP8 A;  4A0Y A;  2VBX A;  5EF6 A;  2HQR A;  1MZB A;  3VYT B;  2CW0 F;  3ZQC A;  4A0X A;  2X1C A;  2V6C A;  5M3F J;  1YIJ I;  2CQK A;  2KZV A;  2X1D A;  3M07 A;  3S93 A;  2EA4 A;  1ZYR F;  1I1G A;  3PNY A;  5EZG A;  5TGT A;  5J4Y A;  1XGO A;  1HST A;  1OR7 A;  5ICE A;  4CXF A;  3L2W A;  1BIB A;  2VKE A;  1SFU A;  2PFB A;  3FK7 A;  4HLY A;  2QBY A;  4KMF A;  2DMN A;  4GO1 A;  2DPD A;  1L0O C;  4I01 A;  4M3E A;  2CWE A;  1V5E A;  5D8K B;  2HS5 A;  5EGO B;  3CJN A;  4ZTJ A;  2GBY A;  4M9X A;  2ME6 A;  5KNL A;  3S2H J;  2VB6 A;  4GYG A;  2QZ8 A;  4M3G A;  3FWE A;  4NQW A;  4RGU A;  2DA4 A;  4X0G A;  2X9D A;  3V8L A;  3VPR A;  3NAU A;  2P0W A;  3GW2 A;  4QWQ A;  1A5J A;  3U1D A;  3ZMU A;  1IXS B;  1MND A;  2CJJ A;  2IGN A;  3ERM A;  3ONQ A;  3N05 A;  4XLC A;  3D0S A;  1JE8 A;  1VQO I;  2CUJ A;  4UV9 A;  3QWL A;  2ZXH A;  4A3L J;  4LG0 B;  2JK3 A;  1IRG A;  1N77 A;  1XSV A;  4CHU A;  4KIF A;  1WJF A;  1H88 C;  2X6W A;  1TT5 B;  4QIW N;  1P4X A;  5DCF A;  1IV8 A;  3WTW C;  4KIS A;  1ODD A;  1SEU A;  5BNG A;  2LFB A;  4BEH A;  3V42 A;  5HNF A;  4RAG A;  1Y1W J;  2L9S A;  3BZ6 A;  4WWC A;  1NG7 A;  1QRY A;  4M71 A;  4WK8 F;  2HDW A;  1ZLJ A;  4B3A A;  4H0E A;  2ICW G;  3TDU C;  1YI2 I;  3K9T A;  1JT0 A;  1RET A;  4XM3 A;  3KX2 A;  1EJ9 A;  2PMH A;  1H9G A;  1A35 A;  3KE2 A;  2R7R A;  1MBH A;  4MGR A;  3KIO A;  3JRB A;  1TWC J;  1T2K A;  2HKO A;  2P7C B;  3K1N A;  3BQY A;  3DPT A;  5L3F A;  2GIZ A;  2X6Y A;  1MJA A;  3LMM A;  2E1C A;  2YSR A;  1VZ0 A;  3CJQ B;  5CLS A;  5K7F A;  3GZ6 A;  1SC7 A;  1JKP C;  4BJ6 C;  1ACI A;  3ZMZ A;  1EF4 A;  1EH6 A;  2HNH A;  1K7A A;  3S3M A;  3ABT A;  2VT2 A;  4D0P A;  2DLL A;  2LBF B;  1E0E A;  4Y15 A;  3RQ4 A;  2K3P A;  1X1B A;  1U78 A;  3NRV A;  2R92 J;  5FLM J;  4RLQ A;  3VOE A;  3LL7 A;  1NK2 P;  2B0L A;  1MBJ A;  2KJC A;  3CCE I;  3KZI C;  5F1R A;  1ZGW A;  2LY9 A;  4R1H A;  3FXU A;  3L2V A;  2XRO A;  2P81 A;  2IAI A;  1I3Q J;  3F8N A;  3CD6 I;  1Q1H A;  1F1Z A;  3MKW B;  3DLA A;  3IWZ A;  5K5Q A;  1FYM A;  1G3S A;  1YQA A;  5ICG A;  2WTE A;  1OPC A;  2XRN A;  3N97 A;  1MW7 A;  2ZB9 A;  3I4N J;  2QEN A;  1XC5 A;  2HQN A;  1F9N A;  4I0B A;  2K9S A;  2QVO A;  2L7M P;  4MQV A;  4XKW A;  2OZU A;  2PJP A;  4IO9 F;  2DDB A;  4IHX A;  1G3T A;  2UXN A;  3E3V A;  4YIR X;  1S72 I;  3PUF A;  1TP4 A;  3I0T A;  3TL4 X;  2CQQ A;  2RQQ A;  4XOP A;  1JKQ C;  2MYS A;  1J75 A;  2V6E A;  1R4M B;  3HYI A;  2KRC A;  3LFK A;  3DWL E;  2DJN A;  2DOA A;  1IGN A;  4KYW A;  3WTV C;  1TWH J;  4EJO A;  2KRF A;  1R49 A;  4D7M A;  4ON0 A;  3KEO A;  2CV2 A;  1PJR A;  2IGM A;  4PUS A;  2DTZ A;  2E5N A;  3JRD A;  2XDV A;  1K6O A;  4W1U A;  4GFB A;  4HQM A;  5FKK A;  2X48 A;  3OMY A;  4M73 A;  1J5Y A;  3FZV A;  2DK5 A;  2WB1 N;  1T0F A;  2Y31 A;  5JI6 A;  3OYM A;  2FX0 A;  2IPQ X;  3IV5 A;  1ULY A;  2QKM B;  3OR2 C;  1LNW A;  5C4J J;  1ZRF A;  3GTQ J;  3Q0U A;  3AAF A;  4A3J J;  3LAJ A;  1JXS A;  3PUB A;  3Q3S A;  4PJ0 C;  5AIP A;  4HF0 A;  2D5V A;  1YYV A;  5BPD A;  4IRG A;  3LA2 A;  1MSE C;  2RNJ A;  1F4K A;  5HOO A;  3OYK A;  3I53 A;  2VAS A;  4L9V A;  3F6V A;  1HW1 A;  4XOT A;  4CCK A;  5HDN A;  3J81 K;  2H27 A;  4IHY A;  3RPQ A;  2AO9 A;  2FRH A;  3NAR A;  1S5L C;  4K2E A;  3PO2 J;  1FOX A;  2Y0S A;  2BVM A;  2GOX B;  4M72 A;  5CYV A;  1RNL A;  3GCM A;  2ELK A;  2BW3 B;  2L9R A;  3S16 J;  5HS9 A;  1R4N B;  5J8C A;  1T33 A;  5CQE A;  2WB1 A;  1JJ8 C;  2HDC A;  3ZQG A;  3FIS A;  2P5V A;  2KDZ A;  4HDU A;  1GVJ A;  2VUM J;  4NC7 A;  1MMS A;  1EKE A;  1WJ5 A;  2ZXJ A;  3A01 A;  2VPR A;  1JT6 A;  1BM9 A;  4GCV A;  2K7L A;  3BPX A;  3RJP A;  4G9Y A;  2HI3 A;  4HNV A;  4KIG A;  2K5C A;  4XKC A;  5FLX Z;  2OD5 A;  2YS9 A;  2XAS A;  3FXQ A;  1VQ5 I;  3ZQL A;  3E1S A;  2WAF A;  4BS9 A;  5FFX A;  3IKV A;  4W97 A;  4O5V A;  2LSO A;  3E97 A;  2D1V A;  2ISY A;  2L01 A;  3D1N I;  1UCR A;  5FO5 A;  5ERI A;  1TQP A;  3Q5F A;  1O3Q A;  4KN4 X;  4XK4 A;  1LE8 B;  3HTS B;  3WG7 H;  2HTJ A;  3VSL A;  3RKQ A;  2QEX I;  1ETX A;  4NB5 A;  3V8J A;  2L9V A;  3F8M A;  3RKW A;  4UUS A;  4IVN A;  4IEJ A;  1BC8 C;  4EM0 B;  2VQG A;  2V4J C;  3BY6 A;  4MO7 A;  4OMY A;  2XV4 S;  5E1X A;  1QHH D;  1GLN A;  2VKV A;  2JSC A;  2KKO A;  4AYB N;  5IP7 J;  2ZO4 A;  3GZN B;  3H1C A;  3S3N A;  2K9M A;  3F72 A;  1ETV A;  4D7N A;  1LDK B;  1KU7 A;  1HDD C;  1T0F C;  1MBF A;  2VN2 A;  4OAZ A;  1R5G A;  2LK2 A;  3JAM K;  3H36 A;  3HOS A;  1BA5 A;  3I55 I;  3HRU A;  5FJ8 J;  2COM A;  3R0J A;  4O3M A;  1F43 A;  2JJ7 A;  2DQR A;  2XGX A;  2W7N A;  1SAX A;  4A2U A;  5B1B H;  1CF7 A;  2DTR A;  3GTK J;  4AC0 A;  1BR4 A;  4CYC A;  1PVE A;  3PFI A;  4N9H A;  2OJE D;  1HSJ A;  2LDU A;  4HRI A;  4L9J A;  2K9Q A;  5C44 J;  3I4M J;  1GV2 A;  2H1K A;  1X1P A;  3QPL A;  4YIF A;  1KA8 A;  2HXO A;  3AFH A;  3K4C A;  5J3L A;  3OYF A;  5E20 A;  2IBD A;  5DYM A;  3SXY A;  2JA7 J;  5C3E J;  1FSH A;  2B9S A;  2TRT A;  3SZT A;  2K40 A;  1BOB A;  1B6A A;  1XTA A;  5HDG A;  2I5U A;  5F08 A;  5J4V A;  2GQQ A;  2GXG A;  5K7H A;  2EFQ A;  4C3J J;  4GGG A;  2DO7 A;  3MWM A;  3RQI A;  4ESJ A;  1Z3Y A;  2LMD A;  2W57 A;  1FBU A;  1QZZ A;  3S32 A;  5M5X J;  1YTY A;  1K78 A;  2E5Z A;  3RPU A;  2JPC A;  2MLK A;  2XB0 X;  2EJR A;  1R71 A;  2QSH X;  3WGI A;  4LGW A;  5AIQ A;  3I64 A;  1ZG1 A;  5D5U B;  5E3M A;  3DV8 A;  5IT9 K;  1ZR4 A;  4DZJ A;  3KP7 A;  3M8F A;  5F0H A;  2EQR A;  4G7O F;  3GTP J;  3CTA A;  1ZR2 A;  1YIT I;  2CQX A;  1A6I A;  3IH3 A;  3KYL A;  3SFZ A;  2C6Y A;  2CG4 A;  3AL0 C;  3G71 I;  3FKI J;  4LK1 F;  1K6Y A;  3QYE A;  4ZYD A;  2O8K A;  4HDV A;  4BE1 A;  4GDF A;  1OCT C;  4ENM A;  2CFO A;  2O7O A;  1OR7 C;  5FKO A;  2P5L C;  1ETQ A;  1QVU A;  1GXQ A;  1OQY A;  2XC7 A;  1VFC A;  1FTZ A;  4ZDP A;  3JAM Z;  2VC0 A;  5FRO A;  4UVA A;  2OQR A;  1Y56 A;  2VE8 A;  2EFO A;  1B72 A;  4KFC A;  4U0V A;  5J6X A;  4DIQ A;  1KQ9 A;  3IRR A;  2LR8 A;  2IS1 A;  3MCZ A;  4B3X A;  3ZMV A;  2Z16 A;  1JHH A;  3QU6 A;  3ZR8 X;  2G7U A;  4DQ2 A;  3CMM A;  1DUX C;  1K61 A;  5BOX A;  1E3O C;  1IC8 A;  1B72 B;  1IJW C;  4M6Y A;  4UXN A;  2CMP A;  3RCO A;  3D5R C;  2R7D A;  3ZMS A;  4A3M J;  1X3W B;  3DBL B;  2E35 A;  4AIJ A;  4A5M A;  3GF2 A;  2STT A;  1S3J A;  4HF2 A;  1GV5 A;  3EUH C;  2XPV A;  2Y30 A;  3U2R A;  1EV7 A;  4EQQ A;  3VYU B;  2JVH A;  3FX3 A;  3TW7 A;  3TKY A;  5CVR A;  3FF5 A;  4KNY A;  1XDU A;  2BGC A;  5FLX K;  3FXO A;  4HV6 A;  3EQL F;  3L2U A;  2R7Z J;  3A02 A;  4BNC A;  5EDN A;  4IRH A;  1STZ A;  4BE0 A;  2MC3 A;  5K7Z A;  2D1H A;  1VTN C;  1WHU A;  3OIO A;  3WHC A;  4G7H F;  1TT0 A;  1Z7U A;  2LY2 A;  5D5W B;  3PFY A;  2ZC2 A;  1QU3 A;  4PJJ A;  4F91 B;  2O9L A;  4CZC A;  1FTT A;  5HS7 A;  4HX7 A;  3BTC A;  4AU7 A;  2HTS A;  4IPA A;  3BG9 A;  4LIT A;  3QPH A;  4B4C A;  1XDS A;  3HTU A;  4Y33 A;  1U0J A;  4L5E A;  2HQ5 A;  1UST A;  3W6V A;  2F4M B;  3H0G J;  1R22 A;  4P96 A;  2LP0 A;  5E3L A;  2VE9 A;  2RN7 A;  2EIL H;  2DAO A;  3RYP A;  1WJA A;  1CQT A;  4C30 A;  3UR3 C;  4FCY A;  3LSG A;  2FNP A;  1TTY A;  4V2G A;  2BHZ A;  3FK6 A;  1KQ0 A;  2ZBK A;  3T1B A;  1T39 A;  2HPM A;  2O6G E;  1FY7 A;  3AKZ A;  2V9V A;  1B9N A;  1U3E M;  1IXR C;  3J7Y J;  3OYH A;  1RR8 C;  1B9M A;  3KLO A;  5F27 A;  1ETY A;  1X4P A;  2DFH A;  4Y4R A;  3D5S C;  2VBZ A;  4UHT A;  3MN2 A;  2X6O A;  3FXK A;  3HIF A;  3O2P E;  4QSH A;  4WF2 A;  2R5Y A;  2BEO A;  2KIQ A;  3E6C C;  1MH4 A;  1U5T B;  2VOD A;  3SYT A;  2BYV E;  3EET A;  3LSP A;  5L3G A;  2E1M C;  2PN6 A;  1WRJ A;  2A3S A;  1QPI A;  2DA2 A;  2ECB A;  1BBY A;  2XB5 A;  1WZ2 A;  2IVM A;  2CO5 A;  1TC3 C;  4A3G J;  2UUZ A;  1OJL A;  3GEZ A;  4TV7 A;  3TP3 A;  3ULQ B;  3K7A J;  2XUB A;  2O03 A;  4DYC A;  1D0Y A;  2R4G A;  3X2Q H;  3K10 A;  3VEP A;  4UVC A;  2W4S A;  2QA4 I;  2XHK A;  2QCO A;  3GO5 A;  2ESN A;  1FPQ A;  3OS0 A;  3EUH A;  4XLN F;  3LSH A;  4BL0 B;  1X4O A;  1LJ9 A;  1MMA A;  1EA3 A;  1TNT A;  4IZZ A;  1XGS A;  5E1Z B;  3OS1 A;  4PCQ A;  5FGM A;  3CO7 C;  2RDP A;  2KMU A;  1IV6 A;  1D0Z A;  1T8I A;  3TO7 A;  1MBK A;  3HB9 A;  2JRT A;  2DA1 A;  3GZ5 A;  2BE5 F;  2HZD A;  3ZOB A;  2QQ8 A;  2EIJ H;  2TDX A;  2LVS A;  4ETS A;  1I50 J;  2HOT A;  1KYW A;  1P4W A;  4CCL A;  1R36 A;  4RAF A;  2ZCW A;  2A05 A;  3DU6 A;  2GA2 A;  4UB8 C;  1ERD A;  1HF0 A;  2Q0O A;  2UWM A;  2FF4 A;  1JTY A;  2ZME A;  3WTY C;  3DBR B;  3CCQ I;  3FHZ A;  4JX5 A;  2M87 A;  2NS0 A;  2H94 A;  2QUF A;  3KFW X;  2HOS A;  1A36 A;  5DD8 A;  4IJA A;  3L9F A;  1S9H A;  2E1O A;  2OU2 A;  3HHG A;  4L0Y B;  1MNE A;  2L54 A;  2P8T A;  2BXY A;  4ZYG A;  3CUQ A;  4F3Q A;  3IL2 A;  3O8G A;  4CCM A;  2RNG A;  1U9N A;  1SMY F;  4Q47 A;  5CJ9 A;  2IT0 A;  3ZQ7 A;  1XD7 A;  1Z21 A;  3TBI A;  3PIP F;  2QKL B;  2M4K A;  4D9J A;  3BR5 A;  3EYY A;  3ISP A;  2VKD A;  2DMU A;  1IG7 A;  4YRV A;  1WH5 A;  2XKO A;  1VQM I;  3M7G A;  4M9Z A;  1XSD A;  4L9T A;  4IHW A;  3P5J A;  2ID6 A;  3MFK A;  1ZEL A;  1ON1 A;  1P7I A;  2E71 A;  3ERE D;  3HZJ A;  1G6N A;  2O0Y A;  1MJB A;  5H20 A;  1XS9 A;  4M6X A;  3BPV A;  3GLX A;  3I59 B;  4J19 A;  1KQ8 A;  1TW2 A;  1TZL A;  3FXJ A;  5C4X J;  4H4K C;  1UZC A;  3GLL A;  3W6J B;  1W36 C;  2NYX A;  2EPF A;  4RB0 A;  4OMZ A;  4Y13 A;  1W5T A;  4BQN A;  3G2B A;  5ILU A;  2EZH A;  1D3Y A;  5J8F A;  3A01 B;  3CC7 I;  5DM7 F;  1BI0 A;  2E7W A;  3V7R A;  1JGG A;  2W48 A;  1ZG3 A;  5DTD A;  2EH3 A;  1ZRD A;  2MFZ A;  2GXB A;  2CSO A;  5HVQ C;  4AVZ A;  4EMS A;  2RC4 A;  3HRT A;  1O57 A;  3GX4 X;  3V7S A;  3MKZ A;  1OIS A;  3Q0V A;  1RPW A;  3QOE A;  4ZYE A;  4P55 A;  4QTR A;  1O3S A;  3AG3 H;  3B6A A;  4XLE A;  1YS7 A;  2Z3Y A;  5D4S A;  5LEK A;  4XLP F;  4PGH A;  1H8A C;  2M4G A;  3CLQ A;  2CU7 A;  2A5Y B;  3HSE A;  3A4C A;  1AKH A;  4WX9 A;  1UHS A;  2FBK A;  4B48 A;  1POG A;  4HNT A;  4AD9 A;  1ZGA A;  4EGZ A;  2R5Y B;  1VQL I;  2M7B A;  2F4I A;  2DFE A;  2FNA A;  3G6E I;  4S05 A;  1ZK8 A;  3JRF A;  5K5R A;  4BQQ A;  1XMK A;  5LLQ A;  2M8E A;  3F21 A;  1FC3 A;  4F52 A;  1D5Y A;  2M34 A;  3LA7 A;  3HOW J;  3U21 A;  1U5T C;  3F8F A;  2UXX A;  4A5N A;  1WQ2 A;  2A68 F;  1B8I B;  3OWT A;  2LH9 A;  2EFN A;  3DFG A;  3TO6 A;  1ZN2 A;  4LLL A;  1XSX A;  3OIP A;  1ONV A;  4YFK F;  1MBG A;  3K4K A;  2AQF A;  1ETO A;  3KEQ A;  3MD2 A;  3ZQF A;  3GFL A;  4I7H A;  2HKX A;  4DBR A;  4EGY A;  2XGD A;  5F6F A;  2ZME C;  5HNH A;  1K4T A;  3BOQ A;  4S04 A;  3CJT B;  5LBQ A;  3OYN A;  1K79 A;  2LKP A;  3CUO A;  4XN0 A;  3GYH X;  4ZDO A;  4Q4Z F;  2DOF A;  3H5N A;  1R00 A;  1YO5 C;  1XMX A;  2XRL A;  1ZGJ A;  2NNY A;  3DPL C;  2LRE A;  3E6D A;  1O7L A;  1K4S A;  4QLC U;  4M74 A;  3A2K A;  3HRS A;  4U0W A;  3BDD A;  3C1D A;  4HG2 A;  1QQI A;  1YX5 A;  3KPH A;  2LRD A;  1OKR A;  3TP0 A;  4HPQ A;  2OV7 A;  2VIX A;  1LEB A;  1V54 H;  3F8C A;  4RM3 A;  3I54 A;  4XRF A;  4Z6Y A;  2GA1 A;  4HST A;  4A6E A;  2NVU B;  2ZJP F;  2XVC A;  3CDI A;  2QM3 A;  1X1A A;  3BR3 A;  1FYL A;  4C3H J;  4IF4 A;  1ZHF A;  3U9G A;  1IN7 A;  4B09 A;  3WHB A;  5TRD A;  3OYI A;  2HYJ A;  3K1P A;  4LIU A;  3IHU A;  1WKM A;  4XSX F;  3T5X A;  3DEW A;  1W5C C;  1KU3 A;  2CW8 A;  5D8L B;  1R9T J;  4IL6 C;  4AIK A;  1FP2 A;  3CCS I;  2OZ6 A;  1WH7 A;  2EIM H;  4II2 A;  3M4O J;  1XCV A;  1RKT A;  2O5R A;  2A6E F;  3JRE A;  4JYK A;  5IT9 Z;  3WTS C;  2PMU A;  3CDH A;  1G3W A;  3K4J A;  1AHD P;  1S7A A;  1ZTR A;  4JK1 X;  2CGP A;  2GZW A;  1J2X A;  1X2N A;  4MEX F;  3GTO J;  3WU2 C;  3ZMT A;  3ZQI A;  2WAQ A;  4ZDL A;  3COA C;  2A6H F;  2VJ4 A;  2HU9 A;  3CES A;  5J1U A;  4CDG A;  2NXN B;  4PSX A;  5FLV A;  4N4O B;  1UG2 A;  2Y0S N;  3ZGK A;  4A3I J;  3BG5 A;  4NC6 A;  3Q9V A;  1FP1 D;  3MZH A;  1V4R A;  1D1B A;  1SMT A;  2ME0 A;  3QQA A;  4ZH4 F;  4OIP F;  2X1E A;  2OA4 A;  4ASN A;  3ROU A;  3D5L A;  2MH9 A;  1WWX A;  3K1M A;  2M45 A;  4XQF A;  4CIC A;  2NVY J;  1Y0U A;  1HOM A;  1U9O A;  4E70 A;  1HKT A;  2HXI A;  3JTH A;  1U5T A;  1T95 A;  2F5F A;  4P9U A;  3CCM I;  3DCF A;  3GUD A;  1QZY A;  4PZJ A;  3TOB A;  1A6Q A;  1K83 J;  2M8G X;  1WJC A;  1T98 A;  4IQJ A;  1NK3 P;  3MEX A;  1BI3 A;  5M5Y J;  4KIT B;  2HFH A;  5KCM A;  1ENH A;  2RKH A;  1LVK A;  2XSD C;  2FU4 A;  3TW6 A;  2OTL I;  1Y1V J;  2K4B A;  2RGV A;  1IO2 A;  4M3B A;  3C2G A;  3R61 A;  1R6R A;  2FBI A;  2ZFU A;  1IN8 A;  4NC8 A;  5IT3 A;  1G4D A;  2P7V B;  3VWB A;  5ICC A;  2BZT A;  2KZG A;  5HLI A;  2NAZ A;  1IXC A;  3A1Y A;  3H0D A;  2VPL A;  5H6R A;  1FX7 A;  1IF1 A;  2LNB A;  1MMG A;  1YJW I;  1LFU P;  5JVT A;  3ELK A;  3BJ6 A;  3SFI A;  1SD6 A;  1JUP A;  4KDP A;  2JTV A;  3JSP A;  1XCB A;  3JR9 A;  3F23 A;  3MKL A;  3W2V A;  3KYD B;  1R5I D;  2DCE A;  3DKY A;  2LKX A;  3ABM H;  1APL C;  4CYD A;  1HKQ A;  2CUF A;  2IA2 A;  2EIN H;  2LOO A;  1VQN I;  2DK8 A;  2IP2 A;  2Y75 A;  3M8J A;  1AWC A;  3RI4 A;  3K69 A;  3G3Z A;  2JUC A;  4EM1 A;  2YU9 J;  2A5W A;  1SVM A;  5ED4 A;  3KP2 A;  1TWA J;  1W5S A;  5E1W A;  3LSR A;  2Z33 A;  3ECH A;  4LJZ F;  3CUQ B;  3BTI A;  1VQ6 I;  3PSI A;  1S29 A;  3K4M A;  2DFF A;  3A0H C;  3M9A A;  1P6R A;  1ZQ3 P;  1Z6T A;  3SZG A;  3VDX A;  1R1U A;  3REO A;  1VND A;  4RBO A;  2I10 A;  3IH4 A;  3I56 I;  1ETK A;  3GVA A;  3SZP A;  3TOA A;  4BBR J;  1QA6 A;  3O6B B;  1WI3 A;  1BOA A;  2DDA A;  4MLO A;  5GPA A;  1HBX G;  1Y0N A;  1BI2 A;  2ELH A;  1VQ9 I;  4I02 A;  3J81 Z;  3CZ6 A;  3L2Q A;  2HGC A;  1ZG5 A;  1BW5 A;  1VI0 A;  1MGT A;  3H5R A;  2L4M A;  5JR3 A;  3LWF A;  2O3F A;  3IUO A;  4UUT A;  2EZI A;  4KT5 C;  1N25 A;  2FQ4 A;  3PNV A;  2MGQ A;  3LQR A;  4DZP A;  2F48 A;  1P2F A;  4LOC A;  1PDN C;  1JKR C;  3HGG A;  1B59 A;  2VI6 A;  3HHH A;  4II3 A;  3SEZ A;  1X3Z B;  2JRM A;  4G6T B;  1QZE A;  3OV8 A;  1IDY A;  2J5O A;  1R5H A;  4CGZ A;  2IA1 A;  3FXR A;  3NWT A;  1D5V A;  1WJE A;  2M0C A;  1W7P D;  3CUQ C;  1OCZ H;  4CCJ A;  1JGS A;  2VT3 A;  4XNF A;  2EV5 A;  4IQ4 A;  5CVI A;  3NQO A;  4A93 J;  3S1R J;  2ECC A;  1J9I A;  4PSW A;  1UG0 A;  1ZAO A;  1OCR H;  2PG4 A;  1JHF A;  4F93 B;  4UNO A;  4BDY A;  2HVQ A;  4ZZD A;  2F4O B;  5F64 A;  2EB7 A;  3ESW B;  2EBI A;  2OCC H;  3JRH A;  1RI7 A;  4YG2 F;  1MMN A;  3CCL I;  3WU1 B;  2K02 A;  4JX4 A;  1BR2 A;  4I76 A;  3GTM J;  4OAY A;  3LAP A;  3PL8 A;  2R3S A;  1R23 A;  1RRJ A;  1FWZ A;  2DMT A;  2HOE A;  4BXX J;  4AVP A;  1RKW A;  2E60 A;  2JN6 A;  3H9J A;  2LLK A;  2IS6 A;  2W24 A;  3L09 A;  2VON A;  4BY1 J;  1FOY A;  5CPR B;  3FBN B;  4HOB A;  1NH3 A;  1VQ4 I;  4LLG F;  4HSR A;  3AG2 H;  4DGW B;  2Q1Z B;  1P7J A;  4XID A;  2QSF X;  1DPR A;  4AIH A;  4ZTF A;  4RDU A;  2VKH A;  3G1O A;  3BCA A;  3QP5 A;  5DCM B;  2E19 A;  1PUE E;  1DP7 P;  2HVS A;  2KFD A;  5DV5 A;  1WI9 A;  4CO8 A;  2GAU A;  4B8X A;  3H3V K;  3S14 J;  3LSM A;  1ETW A;  3GFJ A;  1RZ4 A;  3KP6 A;  4EAT A;  2F5V A;  4L0Z B;  1U6G A;  2L7K A;  3BT9 A;  2A6T A;  2DYR H;  2RRE A;  4HV5 A;  4MTE A;  1BJZ A;  1GVD A;  1RES A;  1TWF J;  2FML A;  5CKT A;  4E7I A;  4A3K J;  3L2R A;  3C7J A;  1BL0 A;  1XPX A;  1A31 A;  4YEL A;  1G8X A;  4OIQ F;  3A0B C;  2XIG A;  3F3X A;  4NQW B;  2FD5 A;  1GDT A;  5DEQ A;  3SQN A;  3UKG A;  4DYQ A;  2CW7 A;  1W7P A;  3I71 A;  1YRN B;  1UEL B;  3MZ8 A;  1BW6 A;  4BJT A;  4ESB A;  3IH2 A;  2ETH A;  4YEJ A;  3WTZ A;  4LG0 A;  4JP0 A;  1DDN A;  2PMZ N;  5TIS C;  4A69 C;  1HA8 A;  2JA2 A;  4IX7 A;  3BRO A;  3CCY A;  3H3Z A;  1YHQ I;  2IGO A;  3CCR I;  4Y52 J;  1IN4 A;  3ZN1 A;  2ZFW A;  2R7W A;  2CH0 A;  3S17 J;  3MZY A;  5E3N A;  3FDY A;  2D45 A;  4XN3 A;  2XAJ A;  1R7J A;  3OSF A;  3OL3 A;  3OYA A;  1Z05 A;  5IOZ A;  3FMS A;  3MAJ A;  1G3Y A;  5J47 A;  4HX8 A;  2Y9Y A;  5D5X B;  2IXS A;  3KP4 A;  1LEA A;  2HZT A;  1O3R A;  4IHT A;  4RA2 A;  3LOC A;  2V7F A;  3I4P A;  1VQK I;  2W1O A;  1IRF A;  2M7A A;  4IOA F;  1I6H J;  3BG3 A;  2CQ7 A;  3HRM A;  1WPK A;  4JOM A;  2R7V A;  2EWN A;  1IRX A;  5EJC A;  2X51 A;  4NUB A;  4AYB A;  1MD0 A;  2L02 A;  3B6C A;  4XKV A;  1WJB A;  1PUF B;  2MLG A;  1Y8Q B;  3QPS A;  4FX0 A;  2J5P A;  2K86 A;  4HAM A;  2W82 A;  3M8E A;  4C2M J;  4MNU A;  2ZSH B;  2KHM A;  3ZP5 A;  2R7O A;  4PK4 A;  2PQ8 A;  3E0J B;  3CP8 A;  2V79 A;  4BJ5 C;  2Y9Z A;  2DT6 A;  3CC2 I;  3CF2 A;  2KQR A;  3BCB A;  3W6K B;  2UZK A;  1SAU A;  1HQC A;  1HXD A;  4JQF A;  2YR2 A;  4IXA A;  1HKS A;  4ITV A;  3S3O A;  2R7T A;  5L3B A;  2TCT A;  1TWG J;  4KMU X;  4Z2Y A;  3RYR A;  2WBM A;  4D1Q A;  1G59 A;  1P9Q C;  3E6M A;  3NEU A;  2X4H A;  1QNT A;  3GXO A;  3HOT A;  3OY9 A;  5GAG J;  3F0C A;  1GHC A;  2KJB A;  3OYC A;  2YPR A;  1FIP A;  2KIS A;  1I39 A;  1BJA A;  2VBW A;  2XAG A;  2XPU A;  4E7L A;  4XLH A;  2FOK A;  1U2W A;  2K27 A;  3K70 D;  4FX4 A;  3AG4 H;  5CVU A;  2MD0 A;  4EEF G;  2H6C A;  3CP2 A;  3MQ0 A;  1DQU A;  3SEQ A;  2H6B A;  2RV8 A;  5B5E C;  1MIJ A;  1X3U A;  4M9S A;  2LKS A;  5DUK A;  5FB2 A;  1LB2 A;  2FOW A;  3HEF A;  2W85 A;  3IWF A;  1YX3 A;  2OUM A;  1S7E A;  3U1K A;  1QHG A;  4FQG A;  1V5F A;  5DM6 F;  2V26 A;  5EEA A;  2E36 A;  4QPQ A;  4A3D J;  2HEO A;  4S0H B;  3T0Y A;  1UB9 A;  1UHM A;  3WE3 A;  2MH2 A;  4RMN A;  1JKO C;  3E5X A;  2L4A A;  4WXH A;  4N9I A;  4FTH A;  1Q1V A;  3C2H A;  1YW8 A;  1USS A;  3HOV J;  3C2B A;  2DXI A;  4KIB A;  4BH9 A;  4RB3 C;  4P5O A;  1OCC H;  1I3A A;  3OYE A;  2MBF A;  3L1P A;  1YOV B;  3CF5 F;  4BE2 A;  1WSU A;  4R79 A;  1D8K A;  4UUS B;  2V1D A;  4ESF A;  2DOD A;  4HX4 A;  2MC4 A;  4BXU A;  5E8G A;  3TED A;  5DCM A;  1TNS A;  2IW5 A;  3VFZ A;  4B47 A;  2V1U A;  1X1D A;  2K3F A;  2XPW A;  3A03 A;  2EK5 A;  5FKL A;  2A69 F;  3RTR A;  1JUS A;  5H6Q A;  3WE2 A;  1ZRC A;  3H3U A;  2LY1 A;  3M3Y J;  2KDO A;  4C9Y A;  1GXP A;  2AHQ A;  4ZYH A;  1VQ7 I;  2MAB A;  5DUI A;  1LKX A;  3C3W A;  2VXD A;  2JA5 J;  5B3S H;  5AON A;  1LE8 A;  3ABK H;  1T38 A;  4X1E A;  4XLA A;  1DP3 A;  2YUS A;  3L7W A;  5HDK A;  2R7Q A;  2PLY A;  2PMZ A;  3ML6 A;  3ZMD A;  2JA6 J;  2VOO A;  3SJM A;  2NS7 A;  4I99 C;  2WAQ N;  2CQN A;  3AG1 H;  4WXC A;  1TBX A;  3BR6 A;  5J1R A;  1Z7L A;  1HC8 A;  1SD5 A;  2E34 A;  1O3T A;  4GYI A;  4P1W A;  3FMR A;  3HL2 A;  3IAM 2;  4A3E J;  5IYB J;  4BHC A;  1T08 B;  3DKX A;  5FKM A;  1XX5 A;  5HLG A;  1GUU A;  4KT6 A;  4U88 A;  3E5Q A;  1TQI A;  2ZJ2 A;  1WGX A;  2EV0 A;  2ELJ A;  2QF7 A;  2FE3 A;  2DJI A;  1KU2 A;  2G0E A;  2EZL A;  2HR3 A;  3PQK A;  1AOY A;  3KP3 A;  3LFU A;  2Y69 H;  4DJA A;  2NS8 A;  4MTD A;  2QQB A;  2KT0 A;  4EV0 A;  2R7X A;  5GP9 A;  1Z1D A;  2BY0 A;  1RUN A;  1IW7 F;  1J09 A;  1MBE A;  2K9L A;  4FAS D;  4BU2 A;  5DS9 A;  1D1A A;  1QO0 D;  1IN5 A;  1FBQ A;  4OWR B;  2P6T A;  4PJL A;  5CQG A;  3ZQH A;  1FZP B;  4F92 B;  2STW A;  3LA3 A;  2PJR A;  4UVB A;  1LUJ B;  4A3B J;  5HLH A;  2LBF A;  1KGS A;  4O6J A;  3VSK A;  1FYK A;  2H8W A;  4N0B A;  2PI0 A;  3T8R A;  2QYO A;  5LEJ A;  3RIR A;  2WV1 A;  1QBJ A;  3P9I A;  5H2F C;  1V3F A;  3L2C A;  1C0W A;  4M3D A;  4U87 A;  1WFX A;  4AID A;  4EJT A;  5EG0 A;  2CV0 A;  2ZSI B;  2R5Z B;  4G6Q A;  4BYY A;  2JA8 J;  3CCV I;  3ECO A;  1O7F A;  2BHY A;  4HNU A;  4E4H A;  4JX6 A;  3IKT A;  3HSR A;  2VJ5 A;  2V9P A;  3OOU A;  4CSW A;  3FMQ A;  1Z6R A;  1RUO A;  3C18 A;  3H5A A;  2OC6 A;  2CS3 A;  4L9N A;  4LFU A;  1HCR A;  5LHG A;  1D0X A;  5KVR A;  4IOC F;  4IHV A;  3OYG A;  4B43 A;  2DA6 A;  1HLV A;  4HZF A;  2F5E A;  2Y2Z A;  4XOR A;  3ZQQ A;  2E2H J;  1W1W E;  1ZKG A;  3TO9 A;  4AWX B;  3JTG A;  2DFI A;  2JSP A;  5IY5 H;  1YE9 A;  2WAE A;  2CUZ A;  2WA0 A;  4RB1 A;  4E7K A;  3WU0 A;  4HYE A;  1OYY A;  4ABZ A;  4BY7 J;  2VC1 A;  1F36 A;  2IGK A;  3DEE A;  3TMO A;  4R8H A;  4E7Z A;  2EFW A;  2G7H A;  3K6G A;  4Y7N J;  2VOP A;  5EEG A;  2F5D A;  5CVV A;  1VQP I;  3ZN0 A;  2ZJR F;  3QP6 A;  2K9N A;  3QYF A;  3CCU I;  1FLI A;  1LQ1 A;  5L3D A;  1SVO A;  5JVG F;  4HF1 A;  2E7X A;  5E8I A;  3F9K A;  3BWG A;  4A12 A;  1A04 A;  4E7S A;  2M9H A;  2VL8 A;  2FQ3 A;  4CYC B;  3H35 A;  3QOD A;  3CQZ J;  2QBY B;  1TW3 A;  4RB2 C;  5A2Q K;  1OYI A;  3KLN A;  3R0A A;  1YFH A;  4WXD A;  4NHJ A;  3KYC B;  1E3H A;  2DT5 A;  2RQP A;  3K2A A;  3LSJ A;  2CV1 A;  3ZPL A;  2HOA A;  3JSO A;  4XRS G;  2BV6 A;  3G1L A;  1E3P A;  2H1L A;  2ZXI A;  3Q0W A;  3R4K A;  4G8X A;  4JBA A;  5F1J A;  4FET A;  5BMZ A;  3BQZ A;  3J80 K;  1SFO J;  4BBS J;  3SHF A;  3QRF F;  4OIN F;  4V2F A;  3RSN A;  5ICF A;  4HW0 A;  2AXT C;  1RC9 A;  3GWZ A;  2DI3 A;  1YLF A;  2Q2E B;  2DA5 A;  1P92 A;  1T6S A;  2QLZ A;  2QQA A;  2W25 A;  3LSI A;  4BKX A;  1YS6 A;  3BTL A;  1AKH B;  3GTJ J;  3M1C A;  3CC4 I;  2A07 F;  4RAY A;  3GFI A;  1DU6 A;  1FOW A;  3GFM A;  3ZRG A;  1H89 C;  2KIU A;  4BUP A;  1OCP A;  4EJW A;  4LK0 F;  2M3A A;  4GRI A;  2M0M A;  1ITY A;  2YX4 A;  3HSF A;  5GAH J;  4FE4 A;  3HJE A;  4V19 K;  3ZCO A;  1I27 A;  2JPB A;  3HKZ A;  1XB4 A;  1YIO A;  5IPA A;  4HA8 A;  5E79 C;  3CDL A;  4CH7 A;  3AL0 B;  1WJD A;  5JLW A;  4I6Z A;  2ISZ A;  4XON A;  5JLX A;  4C2U A;  2HYG D;  3Q9S A;  5LHI A;  1P4A A;  5TJJ A;  1QVT A;  1FSE A;  2DBB A;  4J00 A;  2BW3 A;  3GTL J;  4DOZ A;  3JRG A;  3S1M J;  3CCJ I;  3RZO J;  2X0L A;  1FBS A;  3JCU C;  5ILS A;  5IP6 A;  1S6L A;  5J40 A;  5IOY A;  1OFC X;  5IYC J;  3I5U A;  4E7J A;  2HPI A;  4PGG A;  2LF8 A;  1E2X A;  1QPM A;  3J7A O;  5JFR A;  3V7C A;  2ZKZ A;  1NTC A;  2BOL A;  3R6S A;  4D5F A;  4ENJ A;  1RIO H;  3PNT A;  4CZZ A;  1JTX A;  1EH8 A;  3P9C A;  2XSJ C;  2K4J A;  1FEX A;  4YFN F;  1QGP A;  2FSW A;  4MIM A;  3HOZ J;  3JRA A;  2FUG 2;  2JWT A;  3FXM A;  2P4W A;  2R0Q C;  2HYF A;  4RGR A;  5GTI C;  2Z99 A;  3UNG C;  3L00 A;  5LRR A;  1LDD A;  1GT0 C;  4BHP A;  1VQ8 I;  2E1N A;  4DBQ A;  2XF6 A;  1H0M A;  4M6V A;  2BXZ A;  5HLT A;  2LYC A;  1SD4 A;  2OAZ A;  2E2I J;  2WC2 A;  4AM3 A;  1DPU A;  2VXZ A;  2CYY A;  4AUX A;  1FMV A;  4XBF A;  1MKM A;  4BDZ A;  4XIC A;  3DU5 A;  4UUV A;  2XF5 A;  2PEX A;  1SFK A;  2KIM A;  2JZY A;  9ANT A;  1KYZ A;  3DQV C;  4XMY A;  4CA0 A;  2XAF A;  2ACJ A;  2XKP A;  2IJL A;  1IZ1 A;  3PSF A;  2HDD A;  3E7L A;  4QPO A;  2VQH A;  3HOX J;  4UV8 A;  3S1Q J;  3VOD A;  2D2W A;  2XGE A;  1D8J A;  3FHN A;  4NDL A;  2VLA A;  3HOY J;  2L7F P;  2LTP A;  3FBI B;  2NNN A;  2R93 J;  1Z77 A;  3NWS A;  1YW7 A;  2NOG A;  5F0F A;  1FMW A;  5GAE J;  5CVJ A;  2QQ9 A;  4BHB A;  3S15 J;  3DBH B;  4RS8 A;  2EFP A;  2XAQ A;  3HKZ N;  1BN5 A;  1FT9 A;  4XSZ F;  4Y17 A;  3F8B A;  2R7U A;  1J7K A;  2JVG A;  2O61 A;  4LMY A;  5KAF C;  1N78 A;  1BR1 A;  3DTK A;  2VJI A;  2FMY A;  2L5Q A;  1XN7 A;  2QWW A;  2KL4 A;  2DPU A;  4E7H A;  2OBP A;  1PUF A;  3K0L A;  2FJ1 A;  2L0K A;  5EYR A;  5D6E A;  5D6F A;  1HW5 A;  5LRS A;  5D4R A;  2AQE A;  4NBQ A;  3HBL A;  2H8R A;  2B63 J;  2M1B A;  1JI8 A;  2VQC A;  3H9G A;  3WGG A;  2HVR A;  1R1V A;  3JW4 A;  3PQJ A;  2M30 A;  1W4M A;  1ZRE A;  3HUG A;  2V1N A;  3DF8 A;  4BAY A;  2DMQ A;  4BQO A;  4RM2 A;  2CUE A;  4HEA 2;  2WV0 A;  2XF7 A;  1XMA A;  1E17 A;  1YJ9 I;  2O8X A;  2WY7 Q;  2FA5 A;  6PAX A;  4F7Z A;  1IUY A;  3QPT A;  4MFE A;  3DKW A;  2NVQ J;  1UFM A;  1XGM A;  1LVA A;  2LF7 A;  3I3L A;  3FIW A;  4DYR A;  1FJL A;  3DTI A;  3H92 A;  3O3K A;  3J7Z I;  2F6C A;  5BS6 A;  2GXA A;  4RAZ A;  1ORK A;  1FNN A;  4FE7 A;  5GAD J;  2HWV A;  1OYW A;  2Y48 A;  2P5K A;  1SFX A;  4BEH B;  1UHW A;  1YW9 A;  1Y6I A;  3BG6 A;  4BQA A;  1YG2 A;  2DU9 A;  1KZH A;  2PX9 A;  1VF9 A;  4FHT A;  3JRC A;  3LQQ A;  2AS5 F;  5FRM A;  4IHS A;  1K78 B;  2NVT J;  1SD7 A;  2OF7 A;  3OS2 A;  5JHF A;  3OSG A;  5LFA A;  3TDZ C;  3E6B A;  3EDP A;  2MG4 A;  3RZD J;  3OYB A;  1TLH B;  1V55 H;  1YJN I;  3SDB A;  3CME I;  3OIQ A;  5B66 C;  3K4B A;  1MMD A;  3WTU C;  3IC7 A;  2VQL A;  4XL9 A;  3S2D J;  2FXA A;  3DXJ F;  4LLN A;  2VJJ A;  4KA4 A;  3F22 A;  3VYS B;  1LFB A;  2JT1 A;  1WCM J;  5JHU A;  3JRI A;  2RAE A;  2NRA C;  1HDP A;  5FKN A;  1BC7 C;  5EGO A;  1OLT A;  4ENK A;  1ZAR A;  2YU3 A;  4XR6 A;  1B4A A;  3J80 Z;  3DPU A;  5GPC A;  4P9F A;  3EPZ A;  1L3L A;  4MEY F;  2M5W A;  3HUG B;  1F5T A;  3EUA A;  4B1R A;  1MDM B;  2JUG A;  1V5G A;  3E5U A;  1DU0 A;  2HQA A;  5E3O A;  4B44 A;  2MW8 A;  3PJR A;  2K85 A;  3G1M A;  4LIV A;  4E6K G;  2PJR B;  2YX7 A;  2Z2S B;  4EJV A;  1LFP A;  2H09 A;  2ZXW H;  2DMP A;  5FD6 A;  5M3M J;  5A2Q Z;  3WTT C;  5GTH C;  3WTX C;  4NNJ A;  2V9K A;  3BLY A;  4RGS A;  4ZYA A;  4A0Z A;  3LSK A;  3IAS 2;  3K2Z A;  2G9W A;  2QSG X;  3FXL A;  3BZK A;  4L5J A;  5IP9 J;  2OCE A;  3J7A Y;  4A3F J;  1NHA A;  2F2E A;  4J01 A;  3WG9 A;  3PO3 J;  4WCG A;  3KZY A;  3O8H A;  4ENN A;  4U7D A;  1I6X A;  1D1C A;  3IRQ A;  4BAC A;  5ILV A;  4A3C J;  3BJA A;  2R5Z A;  4OIO F;  4PDK A;  3MKY B;  2QGU A;  1Y8R B;  4RGX A;  4HBL A;  1AA7 A;  3BC8 A;  2VBY A;  1W36 D;  5EEH A;  1G2H A;  5KAI C;  3BG7 A;  3M1E A;  3OYJ A;  1YRN A;  3T8T A;  3KET A;  3HPH A;  1J0R A;  3PM1 A;  2X6X A;  3BTJ A;  1B1B A;  2KIF A;  3BJO A;  3VYR B;  2ESH A;  2W00 A;  3HXL A;  1Z0X A;  4Y3O A;  2L9N A;  1KON A;  3KCC A;  2EIK H;  4U7B A;  1ZLK A;  4FIS A;  5LHH A;  4MQ9 F;  3I58 A;  3LST A;  1XGN A;  2BVL A;  2GIV A;  1Z9C A;  2DQL A;  2IEK A;  1I5Z A;  3CLO A;  1BIA A;  4XLF A;  3RKY A;  2JMW A;  1B8I A;  1OCO H;  3OYL A;  3EUK L;  4UB6 C;  4L5I A;  3KEY A;  3V4G A;  4I2O A;  2XAH A;  4G6D A;  3HG9 A;  4KUM A;  5EZH A;  3DEU A;  4LB6 B;  3N4M A;  1R58 A;  3I59 A;  1J59 A;  3I9V 2;  1CGP A;  3RDI A;  2P6S A;  1MH3 A;  3BZC A;  3PIO F;  3S8P A;  3BR1 A;  3IP4 B;  1MDM A;  2DA7 A;  3TGN A;  3QU3 A;  5HOD A;  1TL8 A;  1XG1 A;  3B02 A;  2IS2 A;  1M1E B;  2GLO A;  3CMY A;  1X58 A;  2FBH A;  2Q2E A;  2CFX A;  1IDZ A;  2RVC A;  4I0A A;  5FFZ A;  5E18 F;  1KU9 A;  4EM2 A;  3W2A A;  4Q5S F;  4GXO A;  3SDG A;  2DW4 A;  4PFP A;  5D5V B;  1Y39 A;  4IRI A;  1CF7 B;  3K4N A;  3P9K A;  3DLL F;  1X2M A;  1U8R A;  4KN7 X;  1T56 A;  2OPT A;  4X6A J;  1AU7 A;  1Z3X A;  3OYD A;  3W2W A;  2NVX J;  1OMI A;  5DD4 A;  1WVR A;  4ZC3 A;  1O4X A;  4C3I J;  5E17 F;  4G12 A;  2NOJ B;  1H9T A;  1MNM C;  4XKB A;  1I1S A;  3S2W A;  4LG3 A;  4F55 A;  2B7E A;  4OIR F;  3CO6 C;  2IA0 A;  3FKJ A;  3OOP A;  5F0C A;  4HLX A;  2Z5U A;  2F5C A;  2I8D A;  4CUG A;  5L3E A;  3HC7 A;  3QYB A;  4C2T A;  3DP7 A;  2DA3 A;  3HOU J;  2V1X A;  2XAU A;  4RLF A;  3OL4 A;  2L2O A;  2L3D A;  1MJ9 A;  4N4N B;  3GTG J;  3HM5 A;  2R7F A;  3RKX A;  4XRM A;  3G73 A;  2COB A;  3HPG A;  3KZZ A;  2KPM A;  2DYS H;  2W84 A;  4L18 B;  3ASO H;  1RR7 A;  1SFE A;  1W0U A;  4UY8 I;  3FM5 A;  1IUF A;  2Z1D A;  2MA3 A;  3QAH A;  1REP C;  2ADU A;  1N75 A;  1ON2 A;  3VB2 A;  2UV1 A;  2BY2 A;  4G94 A;  1S7O A;  5LGT A;  1MSF C;  1W0T A;  2IS4 A;  3GME A;  3ASN H;  3K4L A;  5L3C A;  2GWR A;  4ZZL A;  2ZNY A;  2EZK A;  2FEZ A;  3P7N A;  1FOK A;  1BI1 A;  3GBG A;  3LNQ A;  5KHD A;  2MSY A;  2LG4 A;  5KK1 A;  2LC2 A;  5BQT A;  4LD5 A;  1Z91 A;  4HQE A;  2Q8K A;  4OU0 A;  1PP8 F;  1SAN A;  2PBI A;  2WAD A;  1FIA A;  5F04 A;  2Z9O A;  2XGC A;  1IN6 A;  1ZH5 A;  2KRH A;  2ZME B;  5IYD J;  3G4S I;  3ZXS A;  4PJN A;  2GM4 A;  2N8G A;  2JQ7 A;  3MMY B;  2KP6 A;  3ABL H;  5LGN A;  4PFO A;  4YII A;  4U0Y A;  2WWY A;  4MHG A;  2BY1 A;  4LB5 A;  2L7Z A;  2DOE A;  3MVP A;  4KIC A;  4BXF A;  4YFX F;  5FD5 A;  2BBY A;  1X1C A;  5LGU A;  1W7P B;  2GOM A;  4BGD A;  5FRN A;  2OTJ I;  2Y0M A;  4XRS A;  2A61 A;  5M5W J;  4M3F A;  3BR0 A;  4IKF A;  3F6O A;  3BR2 A;  1SVL A;  3ABU A;  3FM3 A;  1EH7 A;  1UJ8 A;  1R1T A;  1LPQ A;  3HDD A;  4I98 B;  3V8K A;  3DTE A;  2ID3 A;  3KP5 A;  5BPI A;  2E1M B;  5EG0 B;  3OR1 C;  3B73 A;  3QOP A;  1UMQ A;  1LDJ A;  4Q48 A;  1IAW A;  2EA2 A;  1DGW Y;  4MFD A;  2M2E A;  4D5C A;  2ZJQ F;  2ZNZ A;  3RPU D;  1PYV A;  5HS8 A;  3H9Q A;  1IRZ A;  3CMA I;  2CRG A;  2MD5 A;  4G7Z F;  4A6D A;  2EV6 A;  4EVI A;  3CJR B;  3TQN A;  5K1Y A;  2DT7 B;  5K5O A;  2E2J J;  3HGY A;  4ZJZ A;  1NG6 A;  2KLO A;  4DW6 A;  1JUM A;  1TQM A;  5J1Y A;  2AXL A;  1PP7 U;  5B1A H;  4CCO A;  1X19 A;  2R7S A;  1HW2 A;  2IRF G;  1JJ6 C;  4KJZ A;  2X85 A;  4DNC A;  5DDG A;  3W3C A;  4I09 A;  4OOI A;  4ANJ A;  1S8N A;  1U8B A;  3EYI A;  2WY8 Q;  1UAA A;  2BY3 A;  3R60 A;  1Z67 A;  4CCN A;  2OQG A;  4PJM A; 
#chains in the Genus database with same CATH homology
 1R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...