1R71A

Crystal structure of the dna binding domain of korb in complex with the operator dna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
EADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*(BRU)P*TP*TP*TP*AP*GP*CP*GP*GP*CP*TP*AP*AP*AP*AP*G)
publication title Sequence-specific DNA binding determined by contacts outside the helix-turn-helix motif of the ParB homolog KorB.
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08535 KorB KorB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.730 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A KorB DNA-binding domain 1r71A01
1R71A
chains in the Genus database with same CATH superfamily
2UXXA 1KQ0A 3DU6A 1CF7B 1ETWA 2QKLB 1OYWA 3PIPF 2K3FA 3A01A 3F23A 1R71A 1J75A 1O3RA 4WF2A 1ORKA 1QPMA 1HKQA 3KETA 1JHHA 2VJ5A 3HOTA 1Z0XA 2D5VA 3ZQHA 4WXHA 2XB0X 2Z5UA 1XC5A 4WWCA 2L0KA 1R36A 4AYBA 1QQIA 4YELA 3RJPA 2FQ3A 4UUSA 1U8RA 2UUZA 4IRIA 1KA8A 2DK5A 2PMHA 3H35A 3P5JA 3OIPA 3G73A 3GO5A 1FIAA 2PJPA 2H6BA 2R7DA 5JHFA 4RGXA 1TQIA 4X1EA 3BR3A 5DM7F 3MFKA 5E3NA 3E6MA 2FE3A 2KZGA 3HSFA 4B43A 1BOAA 3RKWA 4YIRX 3KP6A 3IWFA 1ZRCA 1IV8A 3RQ4A 1D1CA 5FKNA 3LSHA 4AIHA 2UZKA 1KU2A 5J6XA 3FXRA 4BXXJ 2VT3A 1RESA 5GPAA 4O5VA 1G6NA 3S1NJ 4BQAA 3L2VA 5GPCA 3I0TA 3P9KA 5K1YA 3E5XA 1NK3P 1DDNA 3IKTA 2A69F 2B7EA 1WJEA 4H4KC 3KP2A 3MZYA 1F4KA 1FSEA 3HPGA 2ZKZA 2ZCWA 2DFHA 4BNCA 4P9FA 5EEGA 4YIIA 3GEZA 1MGTA 1WSUA 1FOWA 1J0RA 1MDMA 4KNYA 4G7OF 2DT6A 1SD6A 2XUBA 2K27A 1R5GA 2W48A 1MBEA 4RAZA 4II3A 1U5TB 3WGIA 2JA2A 2MA3A 2VIXA 2ISZA 4WXDA 3HKZA 2K9LA 1H88C 1X3WB 1F5TA 3AL0C 4A6DA 1RETA 1GXQA 1ZGWA 2XSJC 3MWMA 1K78A 5EYRA 3EUHC 3CJNA 2CW8A 4XIDA 2DA7A 3BJOA 3HOWJ 2I8DA 2V6CA 3H5NA 2IPQX 4NQWA 1STZA 2EWNA 4UVCA 4A3JJ 4GGGA 2CV1A 2EINH 2CUFA 3FXKA 3ABTA 3M1EA 3FM3A 3HIFA 3E0JB 3RPUD 3BG6A 3PQKA 2FJ1A 2ISYA 3CMMA 3VSLA 1SANA 5BNGA 1R6RA 2DQRA 4YIFA 1QU3A 2KJBA 1T98A 1XDSA 3GFMA 1ONVA 2FEZA 3BC8A 2HI3A 3JCUC 2GIVA 2X51A 3Q0VA 1WZ2A 1SVOA 5EZHA 2NS7A 4EV0A 5JVGF 3A1YA 2VJJA 1YITI 1N77A 2VB6A 1OCCH 2ECCA 1Y0NA 2XASA 3O3KA 4RM3A 4UV9A 1WWXA 1RZ4A 3M8FA 5FKLA 3V8JA 3MEXA 1R1UA 4UB8C 2EFOA 4U87A 2FU4A 2ZNZA 5JVTA 1WH7A 1ETQA 1B72A 4MHGA 4F91B 2MYSA 5TISC 2ZJQF 4A3BJ 2BHYA 3F8NA 4M3DA 2HDCA 4XN3A 3HKZN 1G8XA 2CW0F 3V7CA 4LIVA 2FUG2 1WJAA 2DYRH 2L7KA 3BG3A 4O3MA 1OYYA 4B8XA 1MMGA 2I5UA 1ZGAA 2TDXA 3LAPA 1T0FA 2BV6A 2KJCA 2DT7B 2VKDA 3WU2C 3KP3A 2KRCA 5DUIA 3UNGC 1B59A 3GUDA 4CCMA 3FKJA 2ZNYA 1FTZA 2PLYA 3D5SC 3HEFA 2ZMEA 1VQLI 3KEOA 1QPIA 4N9IA 1EJ9A 2ZSIB 2KT0A 1XGOA 4MFDA 5EDNA 3T5XA 1Y0UA 3IH4A 4BACA 3CCJI 1YW8A 4XOPA 4HA8A 1ZR4A 4OMZA 2EFPA 4CYCA 2JPBA 3VOEA 1ACIA 2EB7A 3G3ZA 3OYMA 4BXUA 5CQGA 5BQTA 3ZQGA 4ABZA 2OTLI 2JUGA 3VYSB 1FZPB 4MEYF 4FHTA 2E34A 2FOKA 2D45A 4XSXF 2LVSA 2LBFA 3A01B 1BC7C 2GA1A 4BHBA 2H6CA 2HVRA 4XR6A 1UHSA 4L0ZB 4CUGA 2ZJPF 2N8GA 3DF8A 4IRGA 2M4GA 2BXZA 3ERED 2O7OA 3F21A 2X6WA 4UUTA 1LDJA 1FT9A 5CVVA 3HHGA 3HRMA 2L4MA 3WODF 1UG2A 2P5LC 4N4OB 2XROA 4IHSA 3HJEA 3FMSA 4PDKA 4XK4A 3H9GA 4N4NB 1QA6A 1IZ1A 5H20A 3L09A 4I09A 4IHVA 2ELJA 2WAFA 2K9SA 5E20A 1SFUA 3RZOJ 1PVEA 3WTXC 1H9GA 2R93J 2ME0A 3BTJA 2E7XA 4QPOA 2Q2EA 2XDVA 4HQMA 2HQRA 2Y75A 2LNBA 4L5IA 4RAGA 5C4XJ 1RUOA 1JUMA 2MGQA 4CZCA 4KICA 5KAIC 4IXAA 4Y3OA 5EJCA 1LDDA 1FMWA 1X3ZB 1V5FA 3BR2A 2BBYA 1K83J 3D0SA 1FX7A 3U2RA 4DZJA 5CJ9A 5K5OA 3GZ6A 1GLNA 4E6KG 1I5ZA 1OISA 5J1YA 2K40A 3G4SI 3REOA 5FJ8J 5CYVA 1G2HA 3E5QA 2V1DA 2GXBA 5CVJA 1FC3A 4IPAA 4C3JJ 1TWCJ 3WG9A 3BWGA 1R49A 3C2BA 2L4AA 4LGWA 4LITA 4EJTA 2P5KA 3HRUA 3BDDA 3R4KA 4EQQA 3GLLA 1ZQ3P 2DA2A 2Y0MA 3ABLH 4B3XA 2XAHA 4HNUA 3D1NI 4J01A 1A36A 1YG2A 5CVIA 1XN7A 1S29A 2HTJA 3TW7A 1W5SA 5HOOA 4NUBA 2RAEA 1HQCA 4WCGA 4IRHA 3BR5A 1S5LC 2GXGA 3QODA 3F6OA 1TWHJ 2DOEA 3JAMZ 4B4CA 2DDBA 3B6CA 3IH3A 2L9NA 2EV0A 2LY9A 4I01A 2M34A 2LF7A 3BG9A 1CGPA 1QGPA 1ZG3A 3DV8A 2L7FP 2WA0A 4QSHA 1H8AC 1YS7A 5GAHJ 4XONA 2FSWA 4C3IJ 3K4KA 5HNHA 3K4JA 3HGGA 1B9NA 1P92A 2HR3A 3F9KA 5F0HA 1UJ8A 3VEPA 1MNDA 3M7GA 1GV5A 2Y0SA 3H1CA 4U0VA 2VLAA 2MW8A 3P7NA 3QRFF 3E6DA 1XMXA 5FKKA 3SFIA 2HQNA 3CF2A 1AKHB 1SD7A 5HS7A 3HC7A 1S7AA 3EUHA 4HNVA 5LGUA 3K70C 1P7JA 3WGHA 3TP3A 5D8KB 2KHMA 2V79A 1IN6A 1QBJA 2HYGD 3S3MA 1H0MA 2R7RA 1U2WA 2ZFWA 3KEQA 2M2EA 1ERDA 1VTNC 9ANTA 2K4JA 3S3NA 2CFXA 4LK1F 3OYLA 1O7FA 5DCMA 4E7ZA 4S05A 4IVNA 3GTOJ 4AWXB 1HOMA 3VODA 1QRYA 5FRMA 3E3VA 2XGDA 2ZB9A 3ASOH 4LG0A 2IS2A 5D4SA 2VODA 2RNJA 4GYIA 3CF5F 2F5CA 1XSXA 3AFHA 3FHNA 3S32A 1IDYA 3HB9A 5L3DA 5IT3A 4ENNA 3ZN1A 2JK3A 2YR2A 3JRCA 4KN7X 1I1GA 2A6EF 4DBQA 4BJ6C 2R7XA 5F0FA 2AO9A 1SFOJ 4AIJA 3ASNH 2HOEA 2P8TA 1BN5A 2VQCA 3CDLA 1O4XA 4P5OA 2DI3A 2BW3A 5HS9A 4EM0B 2KL4A 4ENJA 1OCTC 3VDXA 1AA7A 2QM3A 4FT8A 1VQMI 1S3JA 5F6FA 1W36C 3HOUJ 3LWFA 4BJ5C 4IZZA 2M8GX 5DEQA 2GOXB 4E70A 2XGXA 1E3OC 4H0EA 2HDWA 3ZXSA 1IW7F 3BCBA 3KZYA 1SC7A 4XLNF 2VBZA 1S9HA 5ILVA 1JHFA 2M30A 2Y0SN 2DPUA 5ILSA 1XMAA 3GCMA 1ZLKA 4I99C 2NNYA 1PP7U 2DW4A 3C3WA 1PUFA 4FE7A 1FLIA 4XQFA 1OMIA 1ZREA 3EETA 1VNDA 4NDLA 5GAEJ 5CVUA 1LVKA 1HC8A 5EF6A 4F3QA 3FWEA 5LFAA 1GUUA 2R4GA 4LB6B 4OIOF 4NC6A 2OAZA 1E2XA 2DDAA 2OA4A 4PCQA 3VYTB 3CCVI 1B6AA 3GWZA 2DTZA 5DYMA 3FX3A 4CGZA 2RN7A 1YX5A 2K9QA 1IDZA 2W25A 3BG7A 3SXYA 1HW1A 4A5MA 1D8JA 4ZTFA 3U9GA 3J7ZI 5HDKA 1IXSB 2WAEA 2DMUA 1QVUA 2DMPA 4RM2A 6PAXA 3ZQIA 2VQHA 2R5ZB 2DT5A 3SZGA 1HLVA 1T95A 4RGRA 2KIUA 1REPC 4XLHA 1JT6A 2FMYA 1XGSA 3DWLE 2PN6A 3ZQCA 2XV4S 4BUPA 2FBKA 1HSTA 1U8BA 3TW6A 3W6KB 1X2NA 3J81Z 2OQRA 1BI2A 5AONA 2NVQJ 2DPDA 3IWZA 1F1ZA 4LB5A 4CCJA 4R8HA 5IT9Z 4ASNA 4ZJZA 3E5UA 4A3DJ 1FYKA 5D5VB 1U6GA 5LEKA 2L02A 2A07F 3E7LA 3B6AA 4XM3A 4BEHA 2K02A 3LNQA 2G0EA 2O9LA 3X2QH 5LLQA 3D5RC 3AG3H 3O8GA 2ETHA 4AC0A 1SD4A 2QQ9A 2ZXWH 2DCEA 3A03A 1ETYA 3RIRA 1Y56A 4HSRA 3T8TA 4EGYA 4RB2C 2V9PA 2EJRA 4AD9A 4Y7NJ 5A2QZ 1Z91A 3BQYA 1ZGJA 1J7KA 2GIZA 1R00A 2IVMA 2OC6A 4XKCA 1VQOI 1SMTA 3GTQJ 2MD5A 1B4AA 2QGUA 2X48A 4KISA 3FF5A 5BPDA 2H1LA 2HQ5A 3FXUA 1WJBA 3DBRB 1IJWC 1ZG5A 2LY1A 3H9QA 3KP5A 1G3TA 3CDIA 1SFXA 1BW6A 3ISPA 3CD6I 1HDDC 3DXJF 2IS4A 3H9JA 1RC9A 2DO7A 3KX2A 3LQRA 2O03A 2VBXA 2TCTA 2BYVE 2PJRB 2VC0A 2STTA 1LJ9A 3S2HJ 1FPQA 2K5CA 4EATA 4N9HA 2E2HJ 1D0ZA 1MMDA 2H1KA 4CH7A 3L7WA 1HBXG 1Z7LA 1W1WE 5F27A 3OS1A 2M0CA 3GZNB 4CHUA 1W4MA 3CMYA 4KA4A 2DA1A 3G71I 2JN6A 1MNEA 4HV5A 2XGCA 1OR7C 1T6SA 4Y4RA 4HYEA 2V1NA 3M4OJ 3OS0A 3NWSA 2A61A 5DCMB 1TT0A 1XG1A 1K4SA 4EEFG 1HW5A 3NRVA 5FLXK 4HQEA 3RYRA 2QKMB 3TEDA 2ZXJA 1GT0C 2FQ4A 4ESFA 3S17J 4HDVA 4MNUA 2CGPA 2W4SA 2E7WA 4RB3C 2ELKA 2IJLA 1HKTA 2DJIA 3TO9A 2HOSA 1DU0A 1JKQC 2VOPA 4KN4X 2LR8A 3RPQA 3TQNA 1IUYA 3I4MJ 4C2MJ 5M3MJ 1MJ9A 2EIJH 5DM6F 3EYYA 2VUMJ 1DUXC 2NVXJ 3TO6A 3CUQA 2BW3B 3IUOA 4BQOA 5ICCA 2ZXHA 4OAZA 3S93A 5LRSA 3KZIC 3W6JB 3ZPLA 2QA4I 2E1MC 3L9FA 3OYHA 1KU7A 1OPCA 1D5YA 3K4MA 1RPWA 4EJWA 1Q1VA 2XRLA 1ZARA 5K5QA 3PUBA 4L9TA 1KZHA 4ZYDA 2QBYA 3C2GA 3F8CA 2KDOA 3F72A 2YUSA 3JR9A 5E1ZB 4IQ4A 1FJLA 4Q48A 3JRHA 2HXIA 1WHUA 5DD4A 3ZMTA 2OPTA 5J47A 2PX9A 4AIKA 1XB4A 2STWA 4LLLA 4DQ2A 3WG7H 1PUFB 1X3UA 4LMYA 4JP0A 4NNJA 4BE1A 4GO1A 5TJJA 2DA6A 2VKHA 3TMOA 5IYBJ 5FLMJ 5GADJ 1YO5C 2F48A 4HRIA 4BDZA 2Z16A 2M7BA 5HLIA 4HDUA 2R7VA 3RSNA 3ZMSA 3LSIA 4OU0A 1LB2A 3K0LA 3DCFA 4YRVA 4MQVA 2EFNA 1ZELA 1IO2A 3VYRB 2W7NA 5J4YA 2HZDA 4CXFA 4RLFA 2HOTA 4IO9F 4FX0A 3RYPA 3W2VA 2O6GE 1ENHA 2O8XA 3KYCB 2B63J 2K3PA 2H8WA 4U88A 2JQ7A 2KIQA 2ID3A 3BG5A 2BOLA 1UG0A 2LOOA 2HYFA 2VJ4A 1AOYA 4W1UA 2EZLA 2V7FA 5D5WB 2R5YB 1R9TJ 2V1XA 4FASD 1JUSA 2AXTC 2K9NA 5LGNA 1UMQA 1XSDA 1YJNI 2OBPA 2DN0A 2LYCA 4QIWN 1JKOC 1X2MA 1RRJA 2OZ6A 1T39A 3HUGA 3WGGA 1ZAOA 3CMAI 3MAJA 1A6IA 1N75A 2NS0A 1DU6A 1GXPA 4YEJA 1KQ9A 2L01A 2OCCH 4BS9A 1ZTRA 2C6YA 3DTKA 4IHXA 1I3AA 1WI9A 3LFUA 1O7LA 1MKMA 2EV5A 5J1UA 2X9DA 1YX3A 3E6CC 1W7PA 2AQFA 1FOKA 3J7AO 4BEHB 4C3HJ 4BE2A 3HDDA 3ELKA 2HDDA 1IN7A 4PFOA 3M8JA 1A04A 3OSFA 3S2DJ 2IA1A 1YI2I 3B02A 1VQ4I 4UNOA 3RDIA 4G6DA 2JVGA 2YX7A 5J8CA 4DOZA 1XPXA 1IV6A 1GDTA 1IF1A 3IAS2 3VFZA 2G9WA 4NC8A 1YE9A 3COAC 3G2BA 2KISA 3K2AA 3A0HC 2VASA 3JTHA 2KIFA 2KDZA 1TQMA 1YIOA 4U0WA 1TP4A 3BZKA 1KU3A 2JJ7A 4XMYA 1G59A 3MZ8A 2NAZA 3J80Z 3SEZA 1H9TA 2H09A 3H92A 2Q8KA 4GRIA 3ZN0A 2CV2A 3Q9VA 1R1TA 2H94A 3RQIA 3OMYA 4FETA 4ZYGA 1IN4A 1D3YA 1YW9A 5H6QA 2L7ZA 3KYDB 3RCOA 1YOVB 4C9YA 1WFXA 1QHHD 4A0ZA 4BHPA 4L18B 2MD0A 1EH7A 2XB5A 4C2UA 4ETSA 2KKOA 2HS5A 2KQRA 5FD5A 1DPUA 1BIBA 4G6QA 4XLPF 5E18F 3DBLB 4RA2A 4Y13A 1S72I 4KYWA 1SVMA 4B47A 3O6BB 2QSHX 4JQFA 2EZIA 4FTHA 4E7KA 2R7SA 2DYSH 3IRQA 5F1RA 1Y1WJ 4BAYA 3MKZA 1OQYA 5C4JJ 2L9SA 4KIGA 4ON0A 2CU7A 2TRTA 4CSWA 3Q0WA 3MKWB 2X1EA 2JRMA 2IBDA 1FP2A 3CJTB 1SFKA 4WX9A 5LHHA 2E1OA 3C2HA 5EG0A 1JGGA 1MBJA 2VE9A 4DW6A 4M9ZA 3IL2A 1MBHA 5JHUA 3HYIA 2VQLA 1A5JA 3J7AY 1OR7A 4FISA 4HEA2 1RNLA 4A3MJ 4C2TA 3IV5A 3HSRA 1XD7A 4DYCA 5C3EJ 3CO7C 1ZKGA 2EFWA 1NH3A 3P9CA 2WBMA 3CUQB 3I9V2 1T2KA 2LRDA 2BHZA 2NOGA 4BDYA 5LRRA 2XVCA 4BQQA 4ZTJA 1O3TA 5IOZA 4PJLA 3ZR8X 1BM9A 4PJ0C 1I39A 5DCFA 5D5UB 4M3FA 3WTVC 2IS1A 3DKWA 4MGRA 2M1BA 3QP5A 3KCCA 1V54H 4AU7A 1LPQA 2EA2A 2QBYB 2Z2SB 4MTDA 2AXLA 3A02A 2R3SA 3OR2C 1YS6A 2DMNA 1BR4A 3FXQA 3H0GJ 4LD5A 1TLHB 2RDPA 3FXJA 4ZYEA 2LSOA 5IP9J 4HF2A 3EUKL 2MSYA 1Y39A 2CG4A 5D5XB 4IHTA 3CC2I 2MH2A 2QQ8A 3KP4A 3K1NA 3JRFA 4GDFA 1S8NA 4Y33A 1W36D 3BR6A 2QCOA 3FK6A 1WH5A 3MQ0A 1APLC 4M6XA 2EA4A 4UV8A 4UUSB 4M74A 1P9QC 3ZGKA 2LREA 2HOAA 3BJAA 3TDZC 2CQXA 3DLLF 1VQKI 2ZC2A 1LVAA 4OAYA 1A31A 2RGVA 2VC1A 1TNSA 2VPLA 1MJBA 2Y48A 3S16J 3HTSB 2RNGA 3PJRA 2KFDA 2H8RA 1B1BA 2FRHA 4RAYA 3SDGA 3F22A 2M8EA 3E1SA 2IT0A 4PUSA 2BXYA 4RB0A 4E7IA 4ANJA 1I50J 2K9MA 4HBLA 2JSCA 4XN0A 4HSTA 4HOBA 3RI4A 1TWAJ 2HPIA 3ZMZA 5HODA 3ZP5A 1WJ5A 4ENKA 1ETVA 2GA2A 2IEKA 3R0AA 2OF7A 4DNCA 5B1AH 3OYKA 1MNMC 4PSWA 2HVQA 1DP7P 4ZZDA 2MFZA 3AG4H 4XSZF 3TGNA 1X1DA 1R4MB 1WJCA 1JXSA 1HA8A 1JJ6C 1V5EA 1Z7UA 2LKPA 3S8PA 4J19A 2ID6A 2RQQA 2W1OA 2X6XA 1OJLA 4RGSA 1LE8A 4KMUX 4HF1A 1K4TA 3HHHA 1QZEA 4A3IJ 1MDMB 1QZZA 5JLWA 4JX5A 1W7PB 3IKVA 3K2ZA 1U5TC 2LD5A 4UUVA 3ONQA 3FM5A 3VYUB 2W82A 5D6FA 2ESNA 2L9VA 4HG2A 4RGUA 3CMEI 4A3LJ 3PIOF 1W7PD 2KZVA 4IF4A 2Y30A 2VONA 1IGNA 2VT2A 4FX4A 4A3CJ 1BJAA 1S7OA 1JKRC 2WC2A 1K78B 1FTTA 5GTIC 1V4RA 1MMSA 1W5TA 3PUFA 4KFCA 3F8MA 1FOXA 3LA2A 3QPSA 2CUZA 5J40A 4GCVA 4NQWB 1OCPA 1Z67A 2BY1A 3G1LA 3DP7A 4A0XA 2L54A 2IAIA 2NOJB 3NQOA 2M4KA 4HZFA 3BCAA 5ICGA 3HRTA 2P5VA 1HSJA 1D1AA 4IHYA 1P4WA 2Q0OA 3AG2H 2J5OA 1I3QJ 2CO5A 3Q3SA 3SZTA 4X0GA 2AQEA 4G6TB 1ODDA 2PG4A 2EILH 2XPVA 1JTYA 3FHZA 1CQTA 5EEHA 5IPAA 5FB2A 2EIMH 3KZZA 3LSGA 4BYYA 5EGOA 2EPFA 3C7JA 4NHJA 2A5WA 1QNTA 2CUJA 2XAFA 4MLOA 1BR1A 5E3MA 3WTUC 1MW7A 4YG2F 1WJFA 5E3OA 3ZCOA 4A3EJ 1ZYRF 4J00A 4DYRA 3CCRI 4QWQA 3R0JA 3I54A 2KLOA 3DPUA 5DS9A 1N78A 2PMUA 2Z99A 4O6JA 3IH2A 3OR1C 3ULQB 3BLYA 4B48A 1YFHA 1E0EA 5KHDA 2JA7J 2L3DA 1U0JA 4KT6A 1T33A 1WQ2A 3FMQA 5FKMA 2EH3A 3L00A 3F3XA 2ZO4A 3H0DA 2PQ8A 1I27A 2ZJRF 1B72B 1X1BA 4L5EA 1V3FA 4TV7A 2VN2A 1JI8A 5B3SH 1FP1D 2R7FA 3ABKH 2MH9A 4IOCF 4ZDLA 2DU9A 3AG1H 1P6RA 2LY2A 1ZRDA 1SAUA 3LFKA 2CUEA 3JTGA 3BR1A 3BQZA 5FFXA 4B3AA 3FXLA 4RDUA 2MC4A 5TRDA 3QWLA 5DUKA 2ZMEB 1D0YA 1F9NA 1USSA 4D7MA 3NARA 1TWGJ 4HV6A 2GQQA 1T08B 2NS8A 3ABMH 4PGGA 1HCRA 3IC7A 2XAQA 2V6EA 1X19A 4CYCB 1R58A 3WU0A 4M6VA 2X4HA 1UHWA 5HLHA 1FYLA 3LSKA 3D5LA 4RLQA 4M72A 2D2WA 2UXNA 2W00A 1E17A 3K1MA 2PFBA 1OCZH 2K7LA 2LFBA 4M6YA 4A12A 2D1VA 4YFXF 3CC4I 2K4BA 3DTIA 1FIPA 2VJIA 1TTYA 4HAMA 2LMDA 4HX7A 2LBFB 1K6YA 1IAWA 3QP6A 1JJ8C 2OZUA 2KPMA 4RS8A 2BY0A 4BHCA 1D5VA 2X85A 4UY8I 4ESJA 1U78A 1AHDP 4M9XA 3L2CA 2CSOA 1CF7A 4Z6YA 3I55I 2XAGA 4M73A 4AIDA 2IA2A 1FSHA 1EH8A 2F4OB 3EUAA 3CCUI 5IT9K 1HKSA 2NXNB 2OUMA 2EFQA 3DQVC 1F43A 2O0YA 4L9JA 4DZPA 2A3SA 4I0BA 5HLTA 1YLFA 3GFJA 1IRGA 2EQRA 2Z9OA 1W0TA 1WJDA 1Y1VJ 2HXOA 5FFZA 2IP2A 3HG9A 2Q2EB 5GP9A 3TP0A 2OD5A 1BIAA 4A5NA 4B44A 4A6EA 1ETOA 2JUCA 3I5UA 5E8GA 3WTZA 3QU6A 3NAUA 2DXIA 2L2OA 4V2FA 5L3CA 4XRSA 4S0HB 3I58A 3KPHA 3VWBA 5F08A 1R7JA 1TT5B 3W2AA 4QPQA 1Z9CA 1UB9A 1OCOH 3GYHX 2VBYA 4KITB 1VQ9I 5IY5H 4ZDOA 4E4HA 4K2EA 2YX4A 4F52A 2XIGA 4RBOA 2XHKA 4XNFA 1GV2A 5FD6A 4F93B 3GLXA 1RUNA 2HPMA 2QZ8A 2GLOA 2LF8A 2DTRA 4E7LA 2VL8A 2L5QA 2NRAC 3R61A 5L3FA 2K85A 2WWYA 2FOWA 2R7UA 2QVOA 3OL3A 1VQ7I 4HPQA 3LSMA 3S1MJ 1C0WA 3Q0UA 1XX5A 2X1DA 3IRRA 3BPVA 4Q5SF 1U5TA 3ESWB 1OLTA 3K1PA 4HNTA 1YJ9I 4CICA 5FKOA 5E17F 1MBKA 2B9SA 2ZBKA 4KMFA 3PNTA 3MCZA 2F5DA 1DGRM 5L3EA 2XKOA 2R0QC 2FBHA 1Z77A 2DOFA 3E6BA 2HQAA 5H6RA 3AL0B 3I64A 4Y15A 4F55A 4EM1A 4YFNF 3W2WA 3FK7A 2M87A 4M3EA 3RZDJ 4MQ9F 2RREA 2WAQA 3OYNA 1JTXA 3HTUA 1FBUA 1MBFA 1O3QA 2IS6A 3T8RA 3OYBA 5EGOB 3GMEA 1X1CA 2V4JC 3TL4X 3H36A 4X6AJ 4HX8A 2EZHA 1R23A 3ZQ7A 2WV0A 2OQGA 1PYVA 3IAM2 3CLOA 1IXCA 4A69C 4ESBA 3I59A 4CA0A 4IX7A 4DIQA 2PI0A 5F1JA 4IJAA 3SQNA 1VQ8I 2W84A 1LQ1A 4LG0B 2K86A 5IYCJ 2JWTA 4UXNA 3OSGA 3CTAA 3CJRB 3Q5FA 1SAXA 3F8FA 2W85A 1ITYA 3OYFA 1X4OA 1TW3A 4KJZA 3W3CA 1ULYA 4I7HA 2O61A 2P7VB 3MKYB 2ZJ2A 5K7ZA 4BJTA 2HEOA 2KRFA 4JOMA 1T0FC 4KIFA 3GBGA 4JX4A 4EMSA 1USTA 2VXZA 1RI7A 2JPCA 4EJOA 2LTPA 3DKYA 4XICA 1FEXA 2P6SA 1X58A 2ZMEC 4D9JA 1ON1A 2F5VA 4PSXA 5KVRA 3FDYA 4OOIA 1UELB 1R22A 2IXSA 3MVPA 3ZOBA 4Y17A 4U7DA 4RB1A 3GX4X 3OOPA 1QZYA 4XLFA 4P55A 1T56A 5D8LB 4U7BA 4IL6C 2QQBA 2JT1A 4CCOA 3V42A 1V5GA 2OJED 1K6OA 5CLSA 1D8KA 2R7WA 4FE4A 1XCBA 2LP0A 4XKBA 2BZTA 5L3BA 4EGZA 3N97A 1BI3A 3SZPA 2DFFA 2LK2A 3QPLA 4LOCA 2WAQN 3GXOA 4BE0A 1VI0A 1Z3YA 4E7JA 1IN5A 2JA6J 4Q47A 4N0BA 4EM2A 1XCVA 5K5RA 3AAFA 2BEOA 2HZTA 4QTRA 2LKSA 3MD2A 3HOYJ 3CP8A 4Y52J 3CZ6A 2Y2ZA 4MTEA 4UVAA 2VKVA 3LAJA 4L5JA 4CCKA 3OL4A 1MH4A 2QENA 2E60A 2VKEA 3HOSA 2QQAA 3HL2A 1BI1A 1RR8C 4IOAF 4JYKA 2IW5A 3T0YA 2J5PA 3FISA 3U1KA 2Y9YA 3CJQB 1TNTA 2F5FA 4ZYHA 2XGEA 2XF5A 4E7SA 2DFIA 5HVQC 2P7CB 1X4PA 4P9UA 1A35A 2HGCA 2UWMA 3V8LA 2COBA 4HF0A 3PO3J 5ED4A 5M3FJ 4G94A 1QVTA 3WE3A 1JE8A 5HS8A 2JA8J 4UHTA 4A3GJ 2Q1ZB 3OYEA 2QSFX 2HWVA 2FXAA 3SJMA 1XGNA 2ACJA 3FBNB 4AVZA 1IRFA 1VQ5I 3BP8A 5H2FC 1BW5A 5F04A 2HYJA 4UB6C 4PK4A 2DA3A 1Y8RB 3F8BA 4AVPA 4CO8A 3JREA 1TC3C 3JRDA 1AU7A 1ETXA 2I10A 2E2JJ 2ZSHB 2ZXIA 1J09A 4BGDA 5M5WJ 1O57A 1WVRA 2VI6A 2IA0A 3J80K 1K7AA 4UVBA 1XMKA 2GZWA 1HXDA 4FCYA 2V1UA 2LLKA 1ZHFA 3BY6A 5LHGA 2D1HA 4YFKF 5C44J 3L2WA 4XRFA 3KYLA 1QHGA 4OMYA 2CW7A 3EPZA 3T1BA 4D5FA 3B73A 2ESHA 1AWCA 1VZ0A 1XTAA 3OV8A 2OCEA 4BY7J 2A05A 4II2A 2W24A 3VPRA 3BTLA 3RTRA 2HTSA 4XLCA 1EH6A 1UZCA 4FQGA 3OY9A 1K61A 3LA3A 2EV6A 3QOPA 2EK5A 2HKOA 4JBAA 4L0YB 1P2FA 3QOEA 3HRSA 2JRTA 3HOZJ 1PJRA 1KYZA 2CFOA 4XLEA 3SEQA 1BL0A 1J5YA 2W57A 4XKWA 3OYAA 2YU9J 1A6QA 3RKYA 3U1DA 2BY2A 2PEXA 1VQ6I 2BVMA 2R92J 3HXLA 2DBBA 2HU9A 2DA4A 1VQPI 4AUXA 3O2PE 4AYBN 3K4NA 3WHCA 1TBXA 1Z1DA 5FRNA 2LDUA 1EF4A 4ZC3A 3BROA 4M3BA 2E1CA 4CYDA 3TOAA 1MSEC 1P4AA 2JZYA 1WI3A 3HSEA 2L7MP 3SYTA 3CP2A 1IXRC 3O8HA 3BZ6A 3M9AA 2GBYA 1VFCA 2FNPA 2BE5F 2O5RA 2ZFUA 1AKHA 4LK0F 1TW2A 3LQQA 4LLNA 3CDHA 4G7ZF 2WB1A 4I6ZA 2NVTJ 4PFPA 1TWFJ 3I4NJ 3JRIA 3I59B 3L2QA 1VF9A 2GWRA 3GW2A 5GTHC 3PSFA 4CZZA 3TOBA 3GTKJ 3K4BA 4M9SA 1EV7A 4L9NA 5FROA 1DGWY 2F4MB 3K70D 2KRHA 1EKEA 2GAUA 4V2GA 2GOMA 5FO5A 2XPUA 3M3YJ 2Z33A 2A6TA 1MSFC 3G1MA 4MIMA 5FGMA 2P6TA 4KIBA 5E1WA 2DQLA 3ZQFA 1YYVA 3ZMVA 3TBIA 5CQEA 4HX4A 3GVAA 1KGSA 1OKRA 4BU2A 3QYFA 3GTGJ 2VPRA 5F64A 2Z3YA 3ZRGA 3S15J 2MABA 2CQQA 2WY8Q 3BPXA 2LH9A 5BPIA 4M3GA 4PJNA 5DTDA 3JSOA 3K7AJ 1JT0A 2JSPA 2IRFG 2BVLA 5KCMA 2X6OA 2E5NA 5IOYA 1B9MA 4AM3A 1KYWA 4I76A 1T8IA 3DEEA 4A2UA 3I71A 2YU3A 2VBWA 2MBFA 1XSVA 5BS6A 2WY7Q 2CQKA 5LHIA 2E36A 2V9KA 2RKHA 1UHMA 1LFPA 1YHQI 4KUMA 4LLGF 2A5YB 2MC3A 5L3GA 3TKYA 1I6HJ 4ZYAA 1BI0A 1RR7A 2ADUA 2CQNA 3FBIB 2QUFA 1JGSA 1DPRA 3K4LA 2WB1N 3BTCA 1Y6IA 5IYDJ 2M5WA 3DLAA 4ITVA 1FYMA 4MFEA 1JUPA 3JSPA 1LFUP 3M07A 1NG6A 4C30A 1KONA 2F5EA 2AS5F 5LD2C 4CDGA 3TO7A 4B1RA 3EYIA 1R5ID 3G1OA 3ABUA 2EIKH 5CKTA 3KE2A 2DODA 5E3LA 2MLGA 3DTEA 2P0WA 2CV0A 1MH3A 1J59A 4RAFA 2O8KA 3FMRA 3OOUA 1O3SA 1G3SA 4PGHA 4GYGA 1GHCA 2WTEA 3HUGB 3KEYA 5E79C 5JLXA 1ZG1A 4PZJA 1YW7A 1IN8A 3CCEI 3JAMK 2R5ZA 2O3FA 2IGMA 1YQAA 3H3VK 4OIQF 4NC7A 5JI6A 3PNYA 2BGCA 2COMA 3FKIJ 2L9RA 2IGNA 1KQ8A 2E2IJ 2KIMA 2HVSA 3AKZA 3CC7I 3HOXJ 4I02A 4ZZLA 3L2UA 1HW2A 4XRMA 3LL7A 2XF7A 2FD5A 1YIJI 2P4WA 1E3PA 4ZDPA 2X6YA 2OU2A 4DYQA 4XBFA 3K69A 2FBIA 1B8IA 3H5RA 5ICEA 4A3FJ 3PFIA 5K7FA 2LKXA 1MD0A 3PSIA 2M0MA 2E19A 4NB5A 2E1NA 1FBQA 4A3KJ 2NVYJ 2A6HF 1FOYA 2R7OA 5M5XJ 5ERIA 1LKXA 4BH9A 3KIOA 3JRAA 1YRNA 4IKFA 1ZH5A 3MMYB 2M3AA 3GFIA 3PFYA 2RVCA 2XPWA 1T38A 3UR3C 2NVUB 2VXDA 4PJJA 3A4CA 3OYCA 1K79A 5DDGA 2QF7A 3TDUC 1PUEE 3OIOA 1ETKA 3DKXA 1Y8QB 3DPTA 3K6GA 1ZRFA 4HLXA 5HLGA 1WCMJ 3NWTA 4OINF 2MG4A 3I4PA 4R79A 1P4XA 1MBGA 3R6SA 1U9NA 2QEXI 3F0CA 3VSKA 4BBSJ 5BMZA 3N05A 5FLVA 3VB2A 2PJRA 2HFHA 2FA5A 5HDGA 1OYIA 3ECOA 1BR2A 2VE8A 3DEWA 3QYBA 1P7IA 2P81A 2QYOA 3ML6A 2R7QA 3FZVA 3L2RA 3GTMJ 1OCRH 5DV5A 3G6EI 3CCLI 1R4NB 4XKVA 3CESA 5EZGA 2DOAA 1D0XA 2CQ7A 2DK8A 1GVDA 3LOCA 2F6CA 3M8EA 4W97A 4WXCA 1PDNC 2VQGA 1IRXA 3LSPA 5EG0B 1UAAA 5IP6A 5LGTA 3ERMA 4MO7A 3DEUA 3KP7A 3ECHA 3PNVA 4XORA 5D6EA 2WADA 1E3HA 1DP3A 1IC8A 2V9VA 3PQJA 4I2OA 4R1HA 3PO2J 1GVJA 2DMTA 4M71A 1LEBA 4BKXA 3CUQC 2QWWA 4CCLA 3RKXA 4DGWB 3OYDA 1WRJA 1MMAA 3K4CA 4LIUA 3HOVJ 3MKLA 5J8FA 4L9VA 1QO0D 5J3LA 1UCRA 3MN2A 5KK1A 3I53A 1WKMA 2MLKA 1WGXA 3PL8A 2FMLA 2FF4A 4IEJA 1S7EA 4V19K 2XSDC 4A93J 3LSRA 2JTVA 3C1DA 1HF0A 2XRNA 4EJVA 4I98B 3I3LA 2A68F 3WHBA 1IG7A 3W6VA 1Z21A 3CQZJ 3K9TA 3Q9SA 2ELHA 1XGMA 1D1BA 3QYEA 1NHAA 2R7TA 3RKQA 2E1MB 2M45A 4XOTA 3A0BC 3SDBA 2AHQA 4S04A 5KAFC 5M5YJ 5JFRA 2H27A 4HW0A 4F92B 3DFGA 5F0CA 3GTPJ 4G8XA 3QQAA 1N25A 2HNHA 2X0LA 3EDPA 2HKXA 2DJNA 3LMMA 1ZN2A 3OS2A 4JX6A 3J81K 4XL9A 1HDPA 3CCYA 2G7HA 3FIWA 5TGTA 4DBRA 3S1QJ 3CLQA 1VQNI 3E97A 4LFUA 3OYJA 2JA5J 3P9IA 1Z6RA 1YTYA 4OIPF 1MZBA 1J2XA 1ZK8A 5E1XA 3H5AA 2M9HA 4MEXF 4G9YA 3ROUA 5BOXA 1LNWA 3JW4A 5KNLA 4QLCU 4EVIA 2CMPA 2YPRA 3S1RJ 3I56I 3CO6C 2NYXA 2YS9A 1POGA 2IGKA 1W0UA 5AIQA 3ZQQA 3LA7A 4BL0B 3SFZA 1X1AA 5K7HA 4P96A 5EEAA 3F6VA 4P1WA 4A0YA 5A2QK 4U0YA 3MZHA 1WPKA 4F7ZA 2QLZA 3BZCA 4E7HA 1V55H 2R5YA 3EQLF 1JKPC 4KDPA 4DJAA 3J7YJ 3H3UA 1U9OA 2M7AA 1FY7A 2YSRA 1LE8B 3V8KA 2Y31A 2FX0A 2QSGX 1FNNA 1BC8C 1IRZA 3KFWX 3S2WA 3QPTA 2E71A 3DPLC 3BJ6A 4I0AA 5ICFA 2R7ZJ 2XAJA 4BBRJ 3JRGA 4D7NA 5LEJA 1NG7A 3GZ5A 3OWTA 2UV1A 1Z3XA 1B8IB 2X1CA 3UKGA 1KU9A 3CCMI 2CH0A 1LUJB 3FXOA 5CVRA 4RMNA 2PBIA 3QU3A 5GAGJ 4D5CA 1X1PA 3S3OA 1TL8A 4ZH4F 1XS9A 1Z6TA 2DMQA 1YRNB 2DA5A 1L3LA 2F4IA 1YJWI 1MMNA 5D4RA 1PP8F 3H3ZA 1SD5A 1MJAA 2E5ZA 2CYYA 2RQPA 5IP7J 4D0PA 5B5EC 5J1RA 2DFEA 2ICWG 3SHFA 2Y9ZA 2VOOA 1NK2P 1I6XA 2PMZA 2ME6A 1I1SA 1Q1HA 3JRBA 1FMVA 2FNAA 3RPUA 5HDNA 1XDUA 4NBQA 1G3YA 3LSJA 1R5HA 2OTJI 3WU1B 2F2EA 3GTJJ 4BQNA 4Q4ZF 3HM5A 4XRSG 1IUFA 3IHUA 1LDKB 4PJMA 2RC4A 2NNNA 3WTYC 5DD8A 3IP4B 1BJZA 3NEUA 4GXOA 2Y69H 2CS3A 3QAHA 3HZJA 3K10A 3GFLA 3ZMDA 1LEAA 3DU5A 5E8IA 5B66C 1BA5A 3GF2A 2JMWA 5CPRB 2GXAA 5HNFA 3WTTC 2XC7A 2BY3A 3S14J 3V4GA 3OYIA 3V7RA 1G4DA 3KLNA 4OWRB 5J4VA 2B0LA 3HPHA 3WE2A 1NTCA 2LC2A 4G12A 3WTWC 3BOQA 1ZR2A 3L1PA 2LG4A 5LBQA 3GTLJ 3M1CA 3V7SA 1MIJA 4CCNA 2DLLA 3A2KA 2EBIA 4B09A 3FXMA 3HBLA 5JR3A 1OFCX 4D1QA 1M1EB 2EZKA 1RKTA 4GFBA 2IGOA 3DBHB 1R1VA 3N4MA 1TQPA 2XKPA 2DAOA 4OIRF 2XF6A 2Z1DA 2RV8A 3CCSI 1SVLA 1BBYA 1G3WA 3ZMUA 3QPHA 3LSTA 4G7HF 1LFBA 2JVHA 1TZLA 1Z05A 2CWEA 1RIOH 2KP6A 3PM1A 1F36A 1SFEA 1DQUA 5AIPA 1ON2A 1BOBA 1S6LA 3C18A 3BR0A 3CUOA 4BXFA 3U21A 2G7UA 2V26A 4HLYA 2CJJA 5FLXZ 3OYGA 2PMZN 1FWZA 5ILUA 4JK1X 1ZLJA 2OV7A 4EJUA 1UFMA 3OIQA 4IHWA 1SEUA 2E35A 3KLOA 1EA3A 4LJZF 5B1BH 4ENMA 1L0OC 2KMUA 1RKWA 4LG3A 3CCQI 4IQJA 3HGYA 3ZQLA 1W5CC 3R60A 1U3EM 1FBSA 3BTIA 2GM4A 2XAUA 4Z2YA 1J9IA 2WV1A 3WTSC 4KT5C 4XLAA 2ECBA 1H89C 4BY1J 4WK8F 2CRGA 1SMYF 3BT9A
chains in the Genus database with same CATH topology
1R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R71 A; 
#chains in the Genus database with same CATH topology
 2UXX A;  1KQ0 A;  3DU6 A;  1CF7 B;  1ETW A;  2QKL B;  1OYW A;  3PIP F;  2K3F A;  3A01 A;  3F23 A;  1R71 A;  1J75 A;  1O3R A;  4WF2 A;  1ORK A;  1QPM A;  1HKQ A;  3KET A;  1JHH A;  2VJ5 A;  3HOT A;  1Z0X A;  2D5V A;  3ZQH A;  4WXH A;  2XB0 X;  2Z5U A;  1XC5 A;  4WWC A;  2L0K A;  1R36 A;  4AYB A;  1QQI A;  4YEL A;  3RJP A;  2FQ3 A;  4UUS A;  1U8R A;  2UUZ A;  4IRI A;  1KA8 A;  2DK5 A;  2PMH A;  3H35 A;  3P5J A;  3OIP A;  3G73 A;  3GO5 A;  1FIA A;  2PJP A;  2H6B A;  2R7D A;  5JHF A;  4RGX A;  1TQI A;  4X1E A;  3BR3 A;  5DM7 F;  3MFK A;  5E3N A;  3E6M A;  2FE3 A;  2KZG A;  3HSF A;  4B43 A;  1BOA A;  3RKW A;  4YIR X;  3KP6 A;  3IWF A;  1ZRC A;  1IV8 A;  3RQ4 A;  1D1C A;  5FKN A;  3LSH A;  4AIH A;  2UZK A;  1KU2 A;  5J6X A;  3FXR A;  4BXX J;  2VT3 A;  1RES A;  5GPA A;  4O5V A;  1G6N A;  3S1N J;  4BQA A;  3L2V A;  5GPC A;  3I0T A;  3P9K A;  5K1Y A;  3E5X A;  1NK3 P;  1DDN A;  3IKT A;  2A69 F;  2B7E A;  1WJE A;  4H4K C;  3KP2 A;  3MZY A;  1F4K A;  1FSE A;  3HPG A;  2ZKZ A;  2ZCW A;  2DFH A;  4BNC A;  4P9F A;  5EEG A;  4YII A;  3GEZ A;  1MGT A;  1WSU A;  1FOW A;  1J0R A;  1MDM A;  4KNY A;  4G7O F;  2DT6 A;  1SD6 A;  2XUB A;  2K27 A;  1R5G A;  2W48 A;  1MBE A;  4RAZ A;  4II3 A;  1U5T B;  3WGI A;  2JA2 A;  2MA3 A;  2VIX A;  2ISZ A;  4WXD A;  3HKZ A;  2K9L A;  1H88 C;  1X3W B;  1F5T A;  3AL0 C;  4A6D A;  1RET A;  1GXQ A;  1ZGW A;  2XSJ C;  3MWM A;  1K78 A;  5EYR A;  3EUH C;  3CJN A;  2CW8 A;  4XID A;  2DA7 A;  3BJO A;  3HOW J;  2I8D A;  2V6C A;  3H5N A;  2IPQ X;  4NQW A;  1STZ A;  2EWN A;  4UVC A;  4A3J J;  4GGG A;  2CV1 A;  2EIN H;  2CUF A;  3FXK A;  3ABT A;  3M1E A;  3FM3 A;  3HIF A;  3E0J B;  3RPU D;  3BG6 A;  3PQK A;  2FJ1 A;  2ISY A;  3CMM A;  3VSL A;  1SAN A;  5BNG A;  1R6R A;  2DQR A;  4YIF A;  1QU3 A;  2KJB A;  1T98 A;  1XDS A;  3GFM A;  1ONV A;  2FEZ A;  3BC8 A;  2HI3 A;  3JCU C;  2GIV A;  2X51 A;  3Q0V A;  1WZ2 A;  1SVO A;  5EZH A;  2NS7 A;  4EV0 A;  5JVG F;  3A1Y A;  2VJJ A;  1YIT I;  1N77 A;  2VB6 A;  1OCC H;  2ECC A;  1Y0N A;  2XAS A;  3O3K A;  4RM3 A;  4UV9 A;  1WWX A;  1RZ4 A;  3M8F A;  5FKL A;  3V8J A;  3MEX A;  1R1U A;  4UB8 C;  2EFO A;  4U87 A;  2FU4 A;  2ZNZ A;  5JVT A;  1WH7 A;  1ETQ A;  1B72 A;  4MHG A;  4F91 B;  2MYS A;  5TIS C;  2ZJQ F;  4A3B J;  2BHY A;  3F8N A;  4M3D A;  2HDC A;  4XN3 A;  3HKZ N;  1G8X A;  2CW0 F;  3V7C A;  4LIV A;  2FUG 2;  1WJA A;  2DYR H;  2L7K A;  3BG3 A;  4O3M A;  1OYY A;  4B8X A;  1MMG A;  2I5U A;  1ZGA A;  2TDX A;  3LAP A;  1T0F A;  2BV6 A;  2KJC A;  2DT7 B;  2VKD A;  3WU2 C;  3KP3 A;  2KRC A;  5DUI A;  3UNG C;  1B59 A;  3GUD A;  4CCM A;  3FKJ A;  2ZNY A;  1FTZ A;  2PLY A;  3D5S C;  3HEF A;  2ZME A;  1VQL I;  3KEO A;  1QPI A;  4N9I A;  1EJ9 A;  2ZSI B;  2KT0 A;  1XGO A;  4MFD A;  5EDN A;  3T5X A;  1Y0U A;  3IH4 A;  4BAC A;  3CCJ I;  1YW8 A;  4XOP A;  4HA8 A;  1ZR4 A;  4OMZ A;  2EFP A;  4CYC A;  2JPB A;  3VOE A;  1ACI A;  2EB7 A;  3G3Z A;  3OYM A;  4BXU A;  5CQG A;  5BQT A;  3ZQG A;  4ABZ A;  2OTL I;  2JUG A;  3VYS B;  1FZP B;  4MEY F;  4FHT A;  2E34 A;  2FOK A;  2D45 A;  4XSX F;  2LVS A;  2LBF A;  3A01 B;  1BC7 C;  2GA1 A;  4BHB A;  2H6C A;  2HVR A;  4XR6 A;  1UHS A;  4L0Z B;  4CUG A;  2ZJP F;  2N8G A;  3DF8 A;  4IRG A;  2M4G A;  2BXZ A;  3ERE D;  2O7O A;  3F21 A;  2X6W A;  4UUT A;  1LDJ A;  1FT9 A;  5CVV A;  3HHG A;  3HRM A;  2L4M A;  3WOD F;  1UG2 A;  2P5L C;  4N4O B;  2XRO A;  4IHS A;  3HJE A;  3FMS A;  4PDK A;  4XK4 A;  3H9G A;  4N4N B;  1QA6 A;  1IZ1 A;  5H20 A;  3L09 A;  4I09 A;  4IHV A;  2ELJ A;  2WAF A;  2K9S A;  5E20 A;  1SFU A;  3RZO J;  1PVE A;  3WTX C;  1H9G A;  2R93 J;  2ME0 A;  3BTJ A;  2E7X A;  4QPO A;  2Q2E A;  2XDV A;  4HQM A;  2HQR A;  2Y75 A;  2LNB A;  4L5I A;  4RAG A;  5C4X J;  1RUO A;  1JUM A;  2MGQ A;  4CZC A;  4KIC A;  5KAI C;  4IXA A;  4Y3O A;  5EJC A;  1LDD A;  1FMW A;  1X3Z B;  1V5F A;  3BR2 A;  2BBY A;  1K83 J;  3D0S A;  1FX7 A;  3U2R A;  4DZJ A;  5CJ9 A;  5K5O A;  3GZ6 A;  1GLN A;  4E6K G;  1I5Z A;  1OIS A;  5J1Y A;  2K40 A;  3G4S I;  3REO A;  5FJ8 J;  5CYV A;  1G2H A;  3E5Q A;  2V1D A;  2GXB A;  5CVJ A;  1FC3 A;  4IPA A;  4C3J J;  1TWC J;  3WG9 A;  3BWG A;  1R49 A;  3C2B A;  2L4A A;  4LGW A;  4LIT A;  4EJT A;  2P5K A;  3HRU A;  3BDD A;  3R4K A;  4EQQ A;  3GLL A;  1ZQ3 P;  2DA2 A;  2Y0M A;  3ABL H;  4B3X A;  2XAH A;  4HNU A;  3D1N I;  4J01 A;  1A36 A;  1YG2 A;  5CVI A;  1XN7 A;  1S29 A;  2HTJ A;  3TW7 A;  1W5S A;  5HOO A;  4NUB A;  2RAE A;  1HQC A;  4WCG A;  4IRH A;  3BR5 A;  1S5L C;  2GXG A;  3QOD A;  3F6O A;  1TWH J;  2DOE A;  3JAM Z;  4B4C A;  2DDB A;  3B6C A;  3IH3 A;  2L9N A;  2EV0 A;  2LY9 A;  4I01 A;  2M34 A;  2LF7 A;  3BG9 A;  1CGP A;  1QGP A;  1ZG3 A;  3DV8 A;  2L7F P;  2WA0 A;  4QSH A;  1H8A C;  1YS7 A;  5GAH J;  4XON A;  2FSW A;  4C3I J;  3K4K A;  5HNH A;  3K4J A;  3HGG A;  1B9N A;  1P92 A;  2HR3 A;  3F9K A;  5F0H A;  1UJ8 A;  3VEP A;  1MND A;  3M7G A;  1GV5 A;  2Y0S A;  3H1C A;  4U0V A;  2VLA A;  2MW8 A;  3P7N A;  3QRF F;  3E6D A;  1XMX A;  5FKK A;  3SFI A;  2HQN A;  3CF2 A;  1AKH B;  1SD7 A;  5HS7 A;  3HC7 A;  1S7A A;  3EUH A;  4HNV A;  5LGU A;  3K70 C;  1P7J A;  3WGH A;  3TP3 A;  5D8K B;  2KHM A;  2V79 A;  1IN6 A;  1QBJ A;  2HYG D;  3S3M A;  1H0M A;  2R7R A;  1U2W A;  2ZFW A;  3KEQ A;  2M2E A;  1ERD A;  1VTN C;  9ANT A;  2K4J A;  3S3N A;  2CFX A;  4LK1 F;  3OYL A;  1O7F A;  5DCM A;  4E7Z A;  4S05 A;  4IVN A;  3GTO J;  4AWX B;  1HOM A;  3VOD A;  1QRY A;  5FRM A;  3E3V A;  2XGD A;  2ZB9 A;  3ASO H;  4LG0 A;  2IS2 A;  5D4S A;  2VOD A;  2RNJ A;  4GYI A;  3CF5 F;  2F5C A;  1XSX A;  3AFH A;  3FHN A;  3S32 A;  1IDY A;  3HB9 A;  5L3D A;  5IT3 A;  4ENN A;  3ZN1 A;  2JK3 A;  2YR2 A;  3JRC A;  4KN7 X;  1I1G A;  2A6E F;  4DBQ A;  4BJ6 C;  2R7X A;  5F0F A;  2AO9 A;  1SFO J;  4AIJ A;  3ASN H;  2HOE A;  2P8T A;  1BN5 A;  2VQC A;  3CDL A;  1O4X A;  4P5O A;  2DI3 A;  2BW3 A;  5HS9 A;  4EM0 B;  2KL4 A;  4ENJ A;  1OCT C;  3VDX A;  1AA7 A;  2QM3 A;  4FT8 A;  1VQM I;  1S3J A;  5F6F A;  1W36 C;  3HOU J;  3LWF A;  4BJ5 C;  4IZZ A;  2M8G X;  5DEQ A;  2GOX B;  4E70 A;  2XGX A;  1E3O C;  4H0E A;  2HDW A;  3ZXS A;  1IW7 F;  3BCB A;  3KZY A;  1SC7 A;  4XLN F;  2VBZ A;  1S9H A;  5ILV A;  1JHF A;  2M30 A;  2Y0S N;  2DPU A;  5ILS A;  1XMA A;  3GCM A;  1ZLK A;  4I99 C;  2NNY A;  1PP7 U;  2DW4 A;  3C3W A;  1PUF A;  4FE7 A;  1FLI A;  4XQF A;  1OMI A;  1ZRE A;  3EET A;  1VND A;  4NDL A;  5GAE J;  5CVU A;  1LVK A;  1HC8 A;  5EF6 A;  4F3Q A;  3FWE A;  5LFA A;  1GUU A;  2R4G A;  4LB6 B;  4OIO F;  4NC6 A;  2OAZ A;  1E2X A;  2DDA A;  2OA4 A;  4PCQ A;  3VYT B;  3CCV I;  1B6A A;  3GWZ A;  2DTZ A;  5DYM A;  3FX3 A;  4CGZ A;  2RN7 A;  1YX5 A;  2K9Q A;  1IDZ A;  2W25 A;  3BG7 A;  3SXY A;  1HW1 A;  4A5M A;  1D8J A;  4ZTF A;  3U9G A;  3J7Z I;  5HDK A;  1IXS B;  2WAE A;  2DMU A;  1QVU A;  2DMP A;  4RM2 A;  6PAX A;  3ZQI A;  2VQH A;  2R5Z B;  2DT5 A;  3SZG A;  1HLV A;  1T95 A;  4RGR A;  2KIU A;  1REP C;  4XLH A;  1JT6 A;  2FMY A;  1XGS A;  3DWL E;  2PN6 A;  3ZQC A;  2XV4 S;  4BUP A;  2FBK A;  1HST A;  1U8B A;  3TW6 A;  3W6K B;  1X2N A;  3J81 Z;  2OQR A;  1BI2 A;  5AON A;  2NVQ J;  2DPD A;  3IWZ A;  1F1Z A;  4LB5 A;  4CCJ A;  4R8H A;  5IT9 Z;  4ASN A;  4ZJZ A;  3E5U A;  4A3D J;  1FYK A;  5D5V B;  1U6G A;  5LEK A;  2L02 A;  2A07 F;  3E7L A;  3B6A A;  4XM3 A;  4BEH A;  2K02 A;  3LNQ A;  2G0E A;  2O9L A;  3X2Q H;  5LLQ A;  3D5R C;  3AG3 H;  3O8G A;  2ETH A;  4AC0 A;  1SD4 A;  2QQ9 A;  2ZXW H;  2DCE A;  3A03 A;  1ETY A;  3RIR A;  1Y56 A;  4HSR A;  3T8T A;  4EGY A;  4RB2 C;  2V9P A;  2EJR A;  4AD9 A;  4Y7N J;  5A2Q Z;  1Z91 A;  3BQY A;  1ZGJ A;  1J7K A;  2GIZ A;  1R00 A;  2IVM A;  2OC6 A;  4XKC A;  1VQO I;  1SMT A;  3GTQ J;  2MD5 A;  1B4A A;  2QGU A;  2X48 A;  4KIS A;  3FF5 A;  5BPD A;  2H1L A;  2HQ5 A;  3FXU A;  1WJB A;  3DBR B;  1IJW C;  1ZG5 A;  2LY1 A;  3H9Q A;  3KP5 A;  1G3T A;  3CDI A;  1SFX A;  1BW6 A;  3ISP A;  3CD6 I;  1HDD C;  3DXJ F;  2IS4 A;  3H9J A;  1RC9 A;  2DO7 A;  3KX2 A;  3LQR A;  2O03 A;  2VBX A;  2TCT A;  2BYV E;  2PJR B;  2VC0 A;  2STT A;  1LJ9 A;  3S2H J;  1FPQ A;  2K5C A;  4EAT A;  4N9H A;  2E2H J;  1D0Z A;  1MMD A;  2H1K A;  4CH7 A;  3L7W A;  1HBX G;  1Z7L A;  1W1W E;  5F27 A;  3OS1 A;  2M0C A;  3GZN B;  4CHU A;  1W4M A;  3CMY A;  4KA4 A;  2DA1 A;  3G71 I;  2JN6 A;  1MNE A;  4HV5 A;  2XGC A;  1OR7 C;  1T6S A;  4Y4R A;  4HYE A;  2V1N A;  3M4O J;  3OS0 A;  3NWS A;  2A61 A;  5DCM B;  1TT0 A;  1XG1 A;  1K4S A;  4EEF G;  1HW5 A;  3NRV A;  5FLX K;  4HQE A;  3RYR A;  2QKM B;  3TED A;  2ZXJ A;  1GT0 C;  2FQ4 A;  4ESF A;  3S17 J;  4HDV A;  4MNU A;  2CGP A;  2W4S A;  2E7W A;  4RB3 C;  2ELK A;  2IJL A;  1HKT A;  2DJI A;  3TO9 A;  2HOS A;  1DU0 A;  1JKQ C;  2VOP A;  4KN4 X;  2LR8 A;  3RPQ A;  3TQN A;  1IUY A;  3I4M J;  4C2M J;  5M3M J;  1MJ9 A;  2EIJ H;  5DM6 F;  3EYY A;  2VUM J;  1DUX C;  2NVX J;  3TO6 A;  3CUQ A;  2BW3 B;  3IUO A;  4BQO A;  5ICC A;  2ZXH A;  4OAZ A;  3S93 A;  5LRS A;  3KZI C;  3W6J B;  3ZPL A;  2QA4 I;  2E1M C;  3L9F A;  3OYH A;  1KU7 A;  1OPC A;  1D5Y A;  3K4M A;  1RPW A;  4EJW A;  1Q1V A;  2XRL A;  1ZAR A;  5K5Q A;  3PUB A;  4L9T A;  1KZH A;  4ZYD A;  2QBY A;  3C2G A;  3F8C A;  2KDO A;  3F72 A;  2YUS A;  3JR9 A;  5E1Z B;  4IQ4 A;  1FJL A;  4Q48 A;  3JRH A;  2HXI A;  1WHU A;  5DD4 A;  3ZMT A;  2OPT A;  5J47 A;  2PX9 A;  4AIK A;  1XB4 A;  2STW A;  4LLL A;  4DQ2 A;  3WG7 H;  1PUF B;  1X3U A;  4LMY A;  4JP0 A;  4NNJ A;  4BE1 A;  4GO1 A;  5TJJ A;  2DA6 A;  2VKH A;  3TMO A;  5IYB J;  5FLM J;  5GAD J;  1YO5 C;  2F48 A;  4HRI A;  4BDZ A;  2Z16 A;  2M7B A;  5HLI A;  4HDU A;  2R7V A;  3RSN A;  3ZMS A;  3LSI A;  4OU0 A;  1LB2 A;  3K0L A;  3DCF A;  4YRV A;  4MQV A;  2EFN A;  1ZEL A;  1IO2 A;  3VYR B;  2W7N A;  5J4Y A;  2HZD A;  4CXF A;  4RLF A;  2HOT A;  4IO9 F;  4FX0 A;  3RYP A;  3W2V A;  2O6G E;  1ENH A;  2O8X A;  3KYC B;  2B63 J;  2K3P A;  2H8W A;  4U88 A;  2JQ7 A;  2KIQ A;  2ID3 A;  3BG5 A;  2BOL A;  1UG0 A;  2LOO A;  2HYF A;  2VJ4 A;  1AOY A;  4W1U A;  2EZL A;  2V7F A;  5D5W B;  2R5Y B;  1R9T J;  2V1X A;  4FAS D;  1JUS A;  2AXT C;  2K9N A;  5LGN A;  1UMQ A;  1XSD A;  1YJN I;  2OBP A;  2DN0 A;  2LYC A;  4QIW N;  1JKO C;  1X2M A;  1RRJ A;  2OZ6 A;  1T39 A;  3HUG A;  3WGG A;  1ZAO A;  3CMA I;  3MAJ A;  1A6I A;  1N75 A;  2NS0 A;  1DU6 A;  1GXP A;  4YEJ A;  1KQ9 A;  2L01 A;  2OCC H;  4BS9 A;  1ZTR A;  2C6Y A;  3DTK A;  4IHX A;  1I3A A;  1WI9 A;  3LFU A;  1O7L A;  1MKM A;  2EV5 A;  5J1U A;  2X9D A;  1YX3 A;  3E6C C;  1W7P A;  2AQF A;  1FOK A;  3J7A O;  4BEH B;  4C3H J;  4BE2 A;  3HDD A;  3ELK A;  2HDD A;  1IN7 A;  4PFO A;  3M8J A;  1A04 A;  3OSF A;  3S2D J;  2IA1 A;  1YI2 I;  3B02 A;  1VQ4 I;  4UNO A;  3RDI A;  4G6D A;  2JVG A;  2YX7 A;  5J8C A;  4DOZ A;  1XPX A;  1IV6 A;  1GDT A;  1IF1 A;  3IAS 2;  3VFZ A;  2G9W A;  4NC8 A;  1YE9 A;  3COA C;  3G2B A;  2KIS A;  3K2A A;  3A0H C;  2VAS A;  3JTH A;  2KIF A;  2KDZ A;  1TQM A;  1YIO A;  4U0W A;  1TP4 A;  3BZK A;  1KU3 A;  2JJ7 A;  4XMY A;  1G59 A;  3MZ8 A;  2NAZ A;  3J80 Z;  3SEZ A;  1H9T A;  2H09 A;  3H92 A;  2Q8K A;  4GRI A;  3ZN0 A;  2CV2 A;  3Q9V A;  1R1T A;  2H94 A;  3RQI A;  3OMY A;  4FET A;  4ZYG A;  1IN4 A;  1D3Y A;  1YW9 A;  5H6Q A;  2L7Z A;  3KYD B;  3RCO A;  1YOV B;  4C9Y A;  1WFX A;  1QHH D;  4A0Z A;  4BHP A;  4L18 B;  2MD0 A;  1EH7 A;  2XB5 A;  4C2U A;  4ETS A;  2KKO A;  2HS5 A;  2KQR A;  5FD5 A;  1DPU A;  1BIB A;  4G6Q A;  4XLP F;  5E18 F;  3DBL B;  4RA2 A;  4Y13 A;  1S72 I;  4KYW A;  1SVM A;  4B47 A;  3O6B B;  2QSH X;  4JQF A;  2EZI A;  4FTH A;  4E7K A;  2R7S A;  2DYS H;  3IRQ A;  5F1R A;  1Y1W J;  4BAY A;  3MKZ A;  1OQY A;  5C4J J;  2L9S A;  4KIG A;  4ON0 A;  2CU7 A;  2TRT A;  4CSW A;  3Q0W A;  3MKW B;  2X1E A;  2JRM A;  2IBD A;  1FP2 A;  3CJT B;  1SFK A;  4WX9 A;  5LHH A;  2E1O A;  3C2H A;  5EG0 A;  1JGG A;  1MBJ A;  2VE9 A;  4DW6 A;  4M9Z A;  3IL2 A;  1MBH A;  5JHU A;  3HYI A;  2VQL A;  1A5J A;  3J7A Y;  1OR7 A;  4FIS A;  4HEA 2;  1RNL A;  4A3M J;  4C2T A;  3IV5 A;  3HSR A;  1XD7 A;  4DYC A;  5C3E J;  3CO7 C;  1ZKG A;  2EFW A;  1NH3 A;  3P9C A;  2WBM A;  3CUQ B;  3I9V 2;  1T2K A;  2LRD A;  2BHZ A;  2NOG A;  4BDY A;  5LRR A;  2XVC A;  4BQQ A;  4ZTJ A;  1O3T A;  5IOZ A;  4PJL A;  3ZR8 X;  1BM9 A;  4PJ0 C;  1I39 A;  5DCF A;  5D5U B;  4M3F A;  3WTV C;  2IS1 A;  3DKW A;  4MGR A;  2M1B A;  3QP5 A;  3KCC A;  1V54 H;  4AU7 A;  1LPQ A;  2EA2 A;  2QBY B;  2Z2S B;  4MTD A;  2AXL A;  3A02 A;  2R3S A;  3OR2 C;  1YS6 A;  2DMN A;  1BR4 A;  3FXQ A;  3H0G J;  4LD5 A;  1TLH B;  2RDP A;  3FXJ A;  4ZYE A;  2LSO A;  5IP9 J;  4HF2 A;  3EUK L;  2MSY A;  1Y39 A;  2CG4 A;  5D5X B;  4IHT A;  3CC2 I;  2MH2 A;  2QQ8 A;  3KP4 A;  3K1N A;  3JRF A;  4GDF A;  1S8N A;  4Y33 A;  1W36 D;  3BR6 A;  2QCO A;  3FK6 A;  1WH5 A;  3MQ0 A;  1APL C;  4M6X A;  2EA4 A;  4UV8 A;  4UUS B;  4M74 A;  1P9Q C;  3ZGK A;  2LRE A;  2HOA A;  3BJA A;  3TDZ C;  2CQX A;  3DLL F;  1VQK I;  2ZC2 A;  1LVA A;  4OAY A;  1A31 A;  2RGV A;  2VC1 A;  1TNS A;  2VPL A;  1MJB A;  2Y48 A;  3S16 J;  3HTS B;  2RNG A;  3PJR A;  2KFD A;  2H8R A;  1B1B A;  2FRH A;  4RAY A;  3SDG A;  3F22 A;  2M8E A;  3E1S A;  2IT0 A;  4PUS A;  2BXY A;  4RB0 A;  4E7I A;  4ANJ A;  1I50 J;  2K9M A;  4HBL A;  2JSC A;  4XN0 A;  4HST A;  4HOB A;  3RI4 A;  1TWA J;  2HPI A;  3ZMZ A;  5HOD A;  3ZP5 A;  1WJ5 A;  4ENK A;  1ETV A;  2GA2 A;  2IEK A;  3R0A A;  2OF7 A;  4DNC A;  5B1A H;  3OYK A;  1MNM C;  4PSW A;  2HVQ A;  1DP7 P;  4ZZD A;  2MFZ A;  3AG4 H;  4XSZ F;  3TGN A;  1X1D A;  1R4M B;  1WJC A;  1JXS A;  1HA8 A;  1JJ6 C;  1V5E A;  1Z7U A;  2LKP A;  3S8P A;  4J19 A;  2ID6 A;  2RQQ A;  2W1O A;  2X6X A;  1OJL A;  4RGS A;  1LE8 A;  4KMU X;  4HF1 A;  1K4T A;  3HHH A;  1QZE A;  4A3I J;  1MDM B;  1QZZ A;  5JLW A;  4JX5 A;  1W7P B;  3IKV A;  3K2Z A;  1U5T C;  2LD5 A;  4UUV A;  3ONQ A;  3FM5 A;  3VYU B;  2W82 A;  5D6F A;  2ESN A;  2L9V A;  4HG2 A;  4RGU A;  3CME I;  4A3L J;  3PIO F;  1W7P D;  2KZV A;  4IF4 A;  2Y30 A;  2VON A;  1IGN A;  2VT2 A;  4FX4 A;  4A3C J;  1BJA A;  1S7O A;  1JKR C;  2WC2 A;  1K78 B;  1FTT A;  5GTI C;  1V4R A;  1MMS A;  1W5T A;  3PUF A;  4KFC A;  3F8M A;  1FOX A;  3LA2 A;  3QPS A;  2CUZ A;  5J40 A;  4GCV A;  4NQW B;  1OCP A;  1Z67 A;  2BY1 A;  3G1L A;  3DP7 A;  4A0X A;  2L54 A;  2IAI A;  2NOJ B;  3NQO A;  2M4K A;  4HZF A;  3BCA A;  5ICG A;  3HRT A;  2P5V A;  1HSJ A;  1D1A A;  4IHY A;  1P4W A;  2Q0O A;  3AG2 H;  2J5O A;  1I3Q J;  2CO5 A;  3Q3S A;  3SZT A;  4X0G A;  2AQE A;  4G6T B;  1ODD A;  2PG4 A;  2EIL H;  2XPV A;  1JTY A;  3FHZ A;  1CQT A;  5EEH A;  5IPA A;  5FB2 A;  2EIM H;  3KZZ A;  3LSG A;  4BYY A;  5EGO A;  2EPF A;  3C7J A;  4NHJ A;  2A5W A;  1QNT A;  2CUJ A;  2XAF A;  4MLO A;  1BR1 A;  5E3M A;  3WTU C;  1MW7 A;  4YG2 F;  1WJF A;  5E3O A;  3ZCO A;  4A3E J;  1ZYR F;  4J00 A;  4DYR A;  3CCR I;  4QWQ A;  3R0J A;  3I54 A;  2KLO A;  3DPU A;  5DS9 A;  1N78 A;  2PMU A;  2Z99 A;  4O6J A;  3IH2 A;  3OR1 C;  3ULQ B;  3BLY A;  4B48 A;  1YFH A;  1E0E A;  5KHD A;  2JA7 J;  2L3D A;  1U0J A;  4KT6 A;  1T33 A;  1WQ2 A;  3FMQ A;  5FKM A;  2EH3 A;  3L00 A;  3F3X A;  2ZO4 A;  3H0D A;  2PQ8 A;  1I27 A;  2ZJR F;  1B72 B;  1X1B A;  4L5E A;  1V3F A;  4TV7 A;  2VN2 A;  1JI8 A;  5B3S H;  1FP1 D;  2R7F A;  3ABK H;  2MH9 A;  4IOC F;  4ZDL A;  2DU9 A;  3AG1 H;  1P6R A;  2LY2 A;  1ZRD A;  1SAU A;  3LFK A;  2CUE A;  3JTG A;  3BR1 A;  3BQZ A;  5FFX A;  4B3A A;  3FXL A;  4RDU A;  2MC4 A;  5TRD A;  3QWL A;  5DUK A;  2ZME B;  1D0Y A;  1F9N A;  1USS A;  4D7M A;  3NAR A;  1TWG J;  4HV6 A;  2GQQ A;  1T08 B;  2NS8 A;  3ABM H;  4PGG A;  1HCR A;  3IC7 A;  2XAQ A;  2V6E A;  1X19 A;  4CYC B;  1R58 A;  3WU0 A;  4M6V A;  2X4H A;  1UHW A;  5HLH A;  1FYL A;  3LSK A;  3D5L A;  4RLQ A;  4M72 A;  2D2W A;  2UXN A;  2W00 A;  1E17 A;  3K1M A;  2PFB A;  1OCZ H;  2K7L A;  2LFB A;  4M6Y A;  4A12 A;  2D1V A;  4YFX F;  3CC4 I;  2K4B A;  3DTI A;  1FIP A;  2VJI A;  1TTY A;  4HAM A;  2LMD A;  4HX7 A;  2LBF B;  1K6Y A;  1IAW A;  3QP6 A;  1JJ8 C;  2OZU A;  2KPM A;  4RS8 A;  2BY0 A;  4BHC A;  1D5V A;  2X85 A;  4UY8 I;  4ESJ A;  1U78 A;  1AHD P;  4M9X A;  3L2C A;  2CSO A;  1CF7 A;  4Z6Y A;  3I55 I;  2XAG A;  4M73 A;  4AID A;  2IA2 A;  1FSH A;  1EH8 A;  2F4O B;  3EUA A;  3CCU I;  5IT9 K;  1HKS A;  2NXN B;  2OUM A;  2EFQ A;  3DQV C;  1F43 A;  2O0Y A;  4L9J A;  4DZP A;  2A3S A;  4I0B A;  5HLT A;  1YLF A;  3GFJ A;  1IRG A;  2EQR A;  2Z9O A;  1W0T A;  1WJD A;  1Y1V J;  2HXO A;  5FFZ A;  2IP2 A;  3HG9 A;  2Q2E B;  5GP9 A;  3TP0 A;  2OD5 A;  1BIA A;  4A5N A;  4B44 A;  4A6E A;  1ETO A;  2JUC A;  3I5U A;  5E8G A;  3WTZ A;  3QU6 A;  3NAU A;  2DXI A;  2L2O A;  4V2F A;  5L3C A;  4XRS A;  4S0H B;  3I58 A;  3KPH A;  3VWB A;  5F08 A;  1R7J A;  1TT5 B;  3W2A A;  4QPQ A;  1Z9C A;  1UB9 A;  1OCO H;  3GYH X;  2VBY A;  4KIT B;  1VQ9 I;  5IY5 H;  4ZDO A;  4E4H A;  4K2E A;  2YX4 A;  4F52 A;  2XIG A;  4RBO A;  2XHK A;  4XNF A;  1GV2 A;  5FD6 A;  4F93 B;  3GLX A;  1RUN A;  2HPM A;  2QZ8 A;  2GLO A;  2LF8 A;  2DTR A;  4E7L A;  2VL8 A;  2L5Q A;  2NRA C;  3R61 A;  5L3F A;  2K85 A;  2WWY A;  2FOW A;  2R7U A;  2QVO A;  3OL3 A;  1VQ7 I;  4HPQ A;  3LSM A;  3S1M J;  1C0W A;  3Q0U A;  1XX5 A;  2X1D A;  3IRR A;  3BPV A;  4Q5S F;  1U5T A;  3ESW B;  1OLT A;  3K1P A;  4HNT A;  1YJ9 I;  4CIC A;  5FKO A;  5E17 F;  1MBK A;  2B9S A;  2ZBK A;  4KMF A;  3PNT A;  3MCZ A;  2F5D A;  1DGR M;  5L3E A;  2XKO A;  2R0Q C;  2FBH A;  1Z77 A;  2DOF A;  3E6B A;  2HQA A;  5H6R A;  3AL0 B;  3I64 A;  4Y15 A;  4F55 A;  4EM1 A;  4YFN F;  3W2W A;  3FK7 A;  2M87 A;  4M3E A;  3RZD J;  4MQ9 F;  2RRE A;  2WAQ A;  3OYN A;  1JTX A;  3HTU A;  1FBU A;  1MBF A;  1O3Q A;  2IS6 A;  3T8R A;  3OYB A;  5EGO B;  3GME A;  1X1C A;  2V4J C;  3TL4 X;  3H36 A;  4X6A J;  4HX8 A;  2EZH A;  1R23 A;  3ZQ7 A;  2WV0 A;  2OQG A;  1PYV A;  3IAM 2;  3CLO A;  1IXC A;  4A69 C;  4ESB A;  3I59 A;  4CA0 A;  4IX7 A;  4DIQ A;  2PI0 A;  5F1J A;  4IJA A;  3SQN A;  1VQ8 I;  2W84 A;  1LQ1 A;  4LG0 B;  2K86 A;  5IYC J;  2JWT A;  4UXN A;  3OSG A;  3CTA A;  3CJR B;  3Q5F A;  1SAX A;  3F8F A;  2W85 A;  1ITY A;  3OYF A;  1X4O A;  1TW3 A;  4KJZ A;  3W3C A;  1ULY A;  4I7H A;  2O61 A;  2P7V B;  3MKY B;  2ZJ2 A;  5K7Z A;  4BJT A;  2HEO A;  2KRF A;  4JOM A;  1T0F C;  4KIF A;  3GBG A;  4JX4 A;  4EMS A;  1UST A;  2VXZ A;  1RI7 A;  2JPC A;  4EJO A;  2LTP A;  3DKY A;  4XIC A;  1FEX A;  2P6S A;  1X58 A;  2ZME C;  4D9J A;  1ON1 A;  2F5V A;  4PSX A;  5KVR A;  3FDY A;  4OOI A;  1UEL B;  1R22 A;  2IXS A;  3MVP A;  3ZOB A;  4Y17 A;  4U7D A;  4RB1 A;  3GX4 X;  3OOP A;  1QZY A;  4XLF A;  4P55 A;  1T56 A;  5D8L B;  4U7B A;  4IL6 C;  2QQB A;  2JT1 A;  4CCO A;  3V42 A;  1V5G A;  2OJE D;  1K6O A;  5CLS A;  1D8K A;  2R7W A;  4FE4 A;  1XCB A;  2LP0 A;  4XKB A;  2BZT A;  5L3B A;  4EGZ A;  3N97 A;  1BI3 A;  3SZP A;  2DFF A;  2LK2 A;  3QPL A;  4LOC A;  2WAQ N;  3GXO A;  4BE0 A;  1VI0 A;  1Z3Y A;  4E7J A;  1IN5 A;  2JA6 J;  4Q47 A;  4N0B A;  4EM2 A;  1XCV A;  5K5R A;  3AAF A;  2BEO A;  2HZT A;  4QTR A;  2LKS A;  3MD2 A;  3HOY J;  3CP8 A;  4Y52 J;  3CZ6 A;  2Y2Z A;  4MTE A;  4UVA A;  2VKV A;  3LAJ A;  4L5J A;  4CCK A;  3OL4 A;  1MH4 A;  2QEN A;  2E60 A;  2VKE A;  3HOS A;  2QQA A;  3HL2 A;  1BI1 A;  1RR8 C;  4IOA F;  4JYK A;  2IW5 A;  3T0Y A;  2J5P A;  3FIS A;  3U1K A;  2Y9Y A;  3CJQ B;  1TNT A;  2F5F A;  4ZYH A;  2XGE A;  2XF5 A;  4E7S A;  2DFI A;  5HVQ C;  2P7C B;  1X4P A;  4P9U A;  1A35 A;  2HGC A;  2UWM A;  3V8L A;  2COB A;  4HF0 A;  3PO3 J;  5ED4 A;  5M3F J;  4G94 A;  1QVT A;  3WE3 A;  1JE8 A;  5HS8 A;  2JA8 J;  4UHT A;  4A3G J;  2Q1Z B;  3OYE A;  2QSF X;  2HWV A;  2FXA A;  3SJM A;  1XGN A;  2ACJ A;  3FBN B;  4AVZ A;  1IRF A;  1VQ5 I;  3BP8 A;  5H2F C;  1BW5 A;  5F04 A;  2HYJ A;  4UB6 C;  4PK4 A;  2DA3 A;  1Y8R B;  3F8B A;  4AVP A;  4CO8 A;  3JRE A;  1TC3 C;  3JRD A;  1AU7 A;  1ETX A;  2I10 A;  2E2J J;  2ZSH B;  2ZXI A;  1J09 A;  4BGD A;  5M5W J;  1O57 A;  1WVR A;  2VI6 A;  2IA0 A;  3J80 K;  1K7A A;  4UVB A;  1XMK A;  2GZW A;  1HXD A;  4FCY A;  2V1U A;  2LLK A;  1ZHF A;  3BY6 A;  5LHG A;  2D1H A;  4YFK F;  5C44 J;  3L2W A;  4XRF A;  3KYL A;  1QHG A;  4OMY A;  2CW7 A;  3EPZ A;  3T1B A;  4D5F A;  3B73 A;  2ESH A;  1AWC A;  1VZ0 A;  1XTA A;  3OV8 A;  2OCE A;  4BY7 J;  2A05 A;  4II2 A;  2W24 A;  3VPR A;  3BTL A;  3RTR A;  2HTS A;  4XLC A;  1EH6 A;  1UZC A;  4FQG A;  3OY9 A;  1K61 A;  3LA3 A;  2EV6 A;  3QOP A;  2EK5 A;  2HKO A;  4JBA A;  4L0Y B;  1P2F A;  3QOE A;  3HRS A;  2JRT A;  3HOZ J;  1PJR A;  1KYZ A;  2CFO A;  4XLE A;  3SEQ A;  1BL0 A;  1J5Y A;  2W57 A;  4XKW A;  3OYA A;  2YU9 J;  1A6Q A;  3RKY A;  3U1D A;  2BY2 A;  2PEX A;  1VQ6 I;  2BVM A;  2R92 J;  3HXL A;  2DBB A;  2HU9 A;  2DA4 A;  1VQP I;  4AUX A;  3O2P E;  4AYB N;  3K4N A;  3WHC A;  1TBX A;  1Z1D A;  5FRN A;  2LDU A;  1EF4 A;  4ZC3 A;  3BRO A;  4M3B A;  2E1C A;  4CYD A;  3TOA A;  1MSE C;  1P4A A;  2JZY A;  1WI3 A;  3HSE A;  2L7M P;  3SYT A;  3CP2 A;  1IXR C;  3O8H A;  3BZ6 A;  3M9A A;  2GBY A;  1VFC A;  2FNP A;  2BE5 F;  2O5R A;  2ZFU A;  1AKH A;  4LK0 F;  1TW2 A;  3LQQ A;  4LLN A;  3CDH A;  4G7Z F;  2WB1 A;  4I6Z A;  2NVT J;  4PFP A;  1TWF J;  3I4N J;  3JRI A;  3I59 B;  3L2Q A;  1VF9 A;  2GWR A;  3GW2 A;  5GTH C;  3PSF A;  4CZZ A;  3TOB A;  3GTK J;  3K4B A;  4M9S A;  1EV7 A;  4L9N A;  5FRO A;  1DGW Y;  2F4M B;  3K70 D;  2KRH A;  1EKE A;  2GAU A;  4V2G A;  2GOM A;  5FO5 A;  2XPU A;  3M3Y J;  2Z33 A;  2A6T A;  1MSF C;  3G1M A;  4MIM A;  5FGM A;  2P6T A;  4KIB A;  5E1W A;  2DQL A;  3ZQF A;  1YYV A;  3ZMV A;  3TBI A;  5CQE A;  4HX4 A;  3GVA A;  1KGS A;  1OKR A;  4BU2 A;  3QYF A;  3GTG J;  2VPR A;  5F64 A;  2Z3Y A;  3ZRG A;  3S15 J;  2MAB A;  2CQQ A;  2WY8 Q;  3BPX A;  2LH9 A;  5BPI A;  4M3G A;  4PJN A;  5DTD A;  3JSO A;  3K7A J;  1JT0 A;  2JSP A;  2IRF G;  2BVL A;  5KCM A;  2X6O A;  2E5N A;  5IOY A;  1B9M A;  4AM3 A;  1KYW A;  4I76 A;  1T8I A;  3DEE A;  4A2U A;  3I71 A;  2YU3 A;  2VBW A;  2MBF A;  1XSV A;  5BS6 A;  2WY7 Q;  2CQK A;  5LHI A;  2E36 A;  2V9K A;  2RKH A;  1UHM A;  1LFP A;  1YHQ I;  4KUM A;  4LLG F;  2A5Y B;  2MC3 A;  5L3G A;  3TKY A;  1I6H J;  4ZYA A;  1BI0 A;  1RR7 A;  2ADU A;  2CQN A;  3FBI B;  2QUF A;  1JGS A;  1DPR A;  3K4L A;  2WB1 N;  3BTC A;  1Y6I A;  5IYD J;  2M5W A;  3DLA A;  4ITV A;  1FYM A;  4MFE A;  1JUP A;  3JSP A;  1LFU P;  3M07 A;  1NG6 A;  4C30 A;  1KON A;  2F5E A;  2AS5 F;  5LD2 C;  4CDG A;  3TO7 A;  4B1R A;  3EYI A;  1R5I D;  3G1O A;  3ABU A;  2EIK H;  5CKT A;  3KE2 A;  2DOD A;  5E3L A;  2MLG A;  3DTE A;  2P0W A;  2CV0 A;  1MH3 A;  1J59 A;  4RAF A;  2O8K A;  3FMR A;  3OOU A;  1O3S A;  1G3S A;  4PGH A;  4GYG A;  1GHC A;  2WTE A;  3HUG B;  3KEY A;  5E79 C;  5JLX A;  1ZG1 A;  4PZJ A;  1YW7 A;  1IN8 A;  3CCE I;  3JAM K;  2R5Z A;  2O3F A;  2IGM A;  1YQA A;  3H3V K;  4OIQ F;  4NC7 A;  5JI6 A;  3PNY A;  2BGC A;  2COM A;  3FKI J;  2L9R A;  2IGN A;  1KQ8 A;  2E2I J;  2KIM A;  2HVS A;  3AKZ A;  3CC7 I;  3HOX J;  4I02 A;  4ZZL A;  3L2U A;  1HW2 A;  4XRM A;  3LL7 A;  2XF7 A;  2FD5 A;  1YIJ I;  2P4W A;  1E3P A;  4ZDP A;  2X6Y A;  2OU2 A;  4DYQ A;  4XBF A;  3K69 A;  2FBI A;  1B8I A;  3H5R A;  5ICE A;  4A3F J;  3PFI A;  5K7F A;  2LKX A;  1MD0 A;  3PSI A;  2M0M A;  2E19 A;  4NB5 A;  2E1N A;  1FBQ A;  4A3K J;  2NVY J;  2A6H F;  1FOY A;  2R7O A;  5M5X J;  5ERI A;  1LKX A;  4BH9 A;  3KIO A;  3JRA A;  1YRN A;  4IKF A;  1ZH5 A;  3MMY B;  2M3A A;  3GFI A;  3PFY A;  2RVC A;  2XPW A;  1T38 A;  3UR3 C;  2NVU B;  2VXD A;  4PJJ A;  3A4C A;  3OYC A;  1K79 A;  5DDG A;  2QF7 A;  3TDU C;  1PUE E;  3OIO A;  1ETK A;  3DKX A;  1Y8Q B;  3DPT A;  3K6G A;  1ZRF A;  4HLX A;  5HLG A;  1WCM J;  3NWT A;  4OIN F;  2MG4 A;  3I4P A;  4R79 A;  1P4X A;  1MBG A;  3R6S A;  1U9N A;  2QEX I;  3F0C A;  3VSK A;  4BBS J;  5BMZ A;  3N05 A;  5FLV A;  3VB2 A;  2PJR A;  2HFH A;  2FA5 A;  5HDG A;  1OYI A;  3ECO A;  1BR2 A;  2VE8 A;  3DEW A;  3QYB A;  1P7I A;  2P81 A;  2QYO A;  3ML6 A;  2R7Q A;  3FZV A;  3L2R A;  3GTM J;  1OCR H;  5DV5 A;  3G6E I;  3CCL I;  1R4N B;  4XKV A;  3CES A;  5EZG A;  2DOA A;  1D0X A;  2CQ7 A;  2DK8 A;  1GVD A;  3LOC A;  2F6C A;  3M8E A;  4W97 A;  4WXC A;  1PDN C;  2VQG A;  1IRX A;  3LSP A;  5EG0 B;  1UAA A;  5IP6 A;  5LGT A;  3ERM A;  4MO7 A;  3DEU A;  3KP7 A;  3ECH A;  3PNV A;  4XOR A;  5D6E A;  2WAD A;  1E3H A;  1DP3 A;  1IC8 A;  2V9V A;  3PQJ A;  4I2O A;  4R1H A;  3PO2 J;  1GVJ A;  2DMT A;  4M71 A;  1LEB A;  4BKX A;  3CUQ C;  2QWW A;  4CCL A;  3RKX A;  4DGW B;  3OYD A;  1WRJ A;  1MMA A;  3K4C A;  4LIU A;  3HOV J;  3MKL A;  5J8F A;  4L9V A;  1QO0 D;  5J3L A;  1UCR A;  3MN2 A;  5KK1 A;  3I53 A;  1WKM A;  2MLK A;  1WGX A;  3PL8 A;  2FML A;  2FF4 A;  4IEJ A;  1S7E A;  4V19 K;  2XSD C;  4A93 J;  3LSR A;  2JTV A;  3C1D A;  1HF0 A;  2XRN A;  4EJV A;  4I98 B;  3I3L A;  2A68 F;  3WHB A;  1IG7 A;  3W6V A;  1Z21 A;  3CQZ J;  3K9T A;  3Q9S A;  2ELH A;  1XGM A;  1D1B A;  3QYE A;  1NHA A;  2R7T A;  3RKQ A;  2E1M B;  2M45 A;  4XOT A;  3A0B C;  3SDB A;  2AHQ A;  4S04 A;  5KAF C;  5M5Y J;  5JFR A;  2H27 A;  4HW0 A;  4F92 B;  3DFG A;  5F0C A;  3GTP J;  4G8X A;  3QQA A;  1N25 A;  2HNH A;  2X0L A;  3EDP A;  2HKX A;  2DJN A;  3LMM A;  1ZN2 A;  3OS2 A;  4JX6 A;  3J81 K;  4XL9 A;  1HDP A;  3CCY A;  2G7H A;  3FIW A;  5TGT A;  4DBR A;  3S1Q J;  3CLQ A;  1VQN I;  3E97 A;  4LFU A;  3OYJ A;  2JA5 J;  3P9I A;  1Z6R A;  1YTY A;  4OIP F;  1MZB A;  1J2X A;  1ZK8 A;  5E1X A;  3H5A A;  2M9H A;  4MEX F;  4G9Y A;  3ROU A;  5BOX A;  1LNW A;  3JW4 A;  5KNL A;  4QLC U;  4EVI A;  2CMP A;  2YPR A;  3S1R J;  3I56 I;  3CO6 C;  2NYX A;  2YS9 A;  1POG A;  2IGK A;  1W0U A;  5AIQ A;  3ZQQ A;  3LA7 A;  4BL0 B;  3SFZ A;  1X1A A;  5K7H A;  4P96 A;  5EEA A;  3F6V A;  4P1W A;  4A0Y A;  5A2Q K;  4U0Y A;  3MZH A;  1WPK A;  4F7Z A;  2QLZ A;  3BZC A;  4E7H A;  1V55 H;  2R5Y A;  3EQL F;  1JKP C;  4KDP A;  4DJA A;  3J7Y J;  3H3U A;  1U9O A;  2M7A A;  1FY7 A;  2YSR A;  1LE8 B;  3V8K A;  2Y31 A;  2FX0 A;  2QSG X;  1FNN A;  1BC8 C;  1IRZ A;  3KFW X;  3S2W A;  3QPT A;  2E71 A;  3DPL C;  3BJ6 A;  4I0A A;  5ICF A;  2R7Z J;  2XAJ A;  4BBR J;  3JRG A;  4D7N A;  5LEJ A;  1NG7 A;  3GZ5 A;  3OWT A;  2UV1 A;  1Z3X A;  1B8I B;  2X1C A;  3UKG A;  1KU9 A;  3CCM I;  2CH0 A;  1LUJ B;  3FXO A;  5CVR A;  4RMN A;  2PBI A;  3QU3 A;  5GAG J;  4D5C A;  1X1P A;  3S3O A;  1TL8 A;  4ZH4 F;  1XS9 A;  1Z6T A;  2DMQ A;  1YRN B;  2DA5 A;  1L3L A;  2F4I A;  1YJW I;  1MMN A;  5D4R A;  1PP8 F;  3H3Z A;  1SD5 A;  1MJA A;  2E5Z A;  2CYY A;  2RQP A;  5IP7 J;  4D0P A;  5B5E C;  5J1R A;  2DFE A;  2ICW G;  3SHF A;  2Y9Z A;  2VOO A;  1NK2 P;  1I6X A;  2PMZ A;  2ME6 A;  1I1S A;  1Q1H A;  3JRB A;  1FMV A;  2FNA A;  3RPU A;  5HDN A;  1XDU A;  4NBQ A;  1G3Y A;  3LSJ A;  1R5H A;  2OTJ I;  3WU1 B;  2F2E A;  3GTJ J;  4BQN A;  4Q4Z F;  3HM5 A;  4XRS G;  1IUF A;  3IHU A;  1LDK B;  4PJM A;  2RC4 A;  2NNN A;  3WTY C;  5DD8 A;  3IP4 B;  1BJZ A;  3NEU A;  4GXO A;  2Y69 H;  2CS3 A;  3QAH A;  3HZJ A;  3K10 A;  3GFL A;  3ZMD A;  1LEA A;  3DU5 A;  5E8I A;  5B66 C;  1BA5 A;  3GF2 A;  2JMW A;  5CPR B;  2GXA A;  5HNF A;  3WTT C;  2XC7 A;  2BY3 A;  3S14 J;  3V4G A;  3OYI A;  3V7R A;  1G4D A;  3KLN A;  4OWR B;  5J4V A;  2B0L A;  3HPH A;  3WE2 A;  1NTC A;  2LC2 A;  4G12 A;  3WTW C;  3BOQ A;  1ZR2 A;  3L1P A;  2LG4 A;  5LBQ A;  3GTL J;  3M1C A;  3V7S A;  1MIJ A;  4CCN A;  2DLL A;  3A2K A;  2EBI A;  4B09 A;  3FXM A;  3HBL A;  5JR3 A;  1OFC X;  4D1Q A;  1M1E B;  2EZK A;  1RKT A;  4GFB A;  2IGO A;  3DBH B;  1R1V A;  3N4M A;  1TQP A;  2XKP A;  2DAO A;  4OIR F;  2XF6 A;  2Z1D A;  2RV8 A;  3CCS I;  1SVL A;  1BBY A;  1G3W A;  3ZMU A;  3QPH A;  3LST A;  4G7H F;  1LFB A;  2JVH A;  1TZL A;  1Z05 A;  2CWE A;  1RIO H;  2KP6 A;  3PM1 A;  1F36 A;  1SFE A;  1DQU A;  5AIP A;  1ON2 A;  1BOB A;  1S6L A;  3C18 A;  3BR0 A;  3CUO A;  4BXF A;  3U21 A;  2G7U A;  2V26 A;  4HLY A;  2CJJ A;  5FLX Z;  3OYG A;  2PMZ N;  1FWZ A;  5ILU A;  4JK1 X;  1ZLJ A;  2OV7 A;  4EJU A;  1UFM A;  3OIQ A;  4IHW A;  1SEU A;  2E35 A;  3KLO A;  1EA3 A;  4LJZ F;  5B1B H;  4ENM A;  1L0O C;  2KMU A;  1RKW A;  4LG3 A;  3CCQ I;  4IQJ A;  3HGY A;  3ZQL A;  1W5C C;  3R60 A;  1U3E M;  1FBS A;  3BTI A;  2GM4 A;  2XAU A;  4Z2Y A;  1J9I A;  2WV1 A;  3WTS C;  4KT5 C;  4XLA A;  2ECB A;  1H89 C;  4BY1 J;  4WK8 F;  2CRG A;  1SMY F;  3BT9 A; 
#chains in the Genus database with same CATH homology
 1R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...