5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
4I09A 5IT9Z 5EEGA 5J8CA 2ZNYA 4L9VA 2XVCA 4PDKA 3QP6A 5ICGA 4RGRA 1FC3A 5FGMA 4N9IA 2QVOA 2Z99A 1YTYA 2EFNA 3F21A 2STWA 3HRSA 3TGNA 4G9YA 3T8TA 4ZH4F 4RB2C 4OIRF 3C7JA 2XUBA 2Z9OA 3HSRA 2R3SA 2HR3A 2VBXA 3ECOA 3DP7A 1MJBA 2EFPA 1WI9A 2ZFWA 2FRHA 4IF4A 1L0OC 1IZ1A 4G6DA 3WU1B 1TQIA 1P4XA 4M6YA 4YIFA 1ZLKA 2KKOA 1HW1A 1YS7A 2MH2A 1Q1HA 1FYLA 2NAZA 4Z2YA 1IXCA 5LHGA 3V8LA 3KP3A 1JHHA 4HX8A 3QU3A 4G7ZF 2HOEA 4F7ZA 3DV8A 2HTSA 3ZMTA 3R4KA 1I1GA 3E5UA 1FX7A 4YFXF 2TDXA 1D3YA 4MGRA 5HS9A 5HLHA 2CG4A 4OIOF 3MQ0A 3QOPA 4BHBA 1XSVA 4ENKA 4AWXB 1V3FA 1IN6A 1IAWA 3IWZA 2Y75A 4I0AA 1TLHB 3EUHA 4Q48A 2HQNA 1YLFA 2QQ9A 3IKVA 3HYIA 2UWMA 2DI3A 4KMUX 3WG9A 2DTRA 1ZRDA 4KN4X 2NS0A 4WXHA 5E1ZB 4PGHA 4GYIA 1NHAA 4M74A 2FMLA 4B8XA 3DF8A 2FBHA 2XRNA 1B4AA 5DUIA 4KT5C 2PN6A 4NHJA 4ASNA 1SMYF 4E70A 3JAMK 4PZJA 1P2FA 2XGXA 1R22A 5EEHA 5D5XB 4LFUA 4I2OA 1FT9A 2F2EA 2HZTA 1P92A 3ZMVA 5LGUA 2F5FA 2OZ6A 4YFKF 2GAUA 3I71A 2FF4A 5D4SA 5HOOA 1F9NA 2CW0F 4S04A 3ABUA 1JXSA 3MAJA 3WTXC 3I54A 2YX4A 3F8NA 5H20A 3TKYA 1G3YA 5LRRA 4UV9A 4UVCA 3V8KA 3U1DA 3TDZC 3KP2A 4A12A 5BMZA 4KIBA 3V7SA 1S7OA 3B73A 5LHHA 2D45A 1O7FA 3MWMA 2XAFA 2EV0A 4HAMA 3JTHA 1R1VA 1UHMA 3RI4A 4QWQA 3LA3A 1ZHFA 2EV5A 2Q8KA 2V1XA 2DK8A 4MEXF 4XLNF 3DQVC 2XIGA 1LDJA 1LNWA 4JQFA 2E1CA 5F6FA 4KIFA 2VOPA 4ZZDA 4L0ZB 2QZ8A 4BHPA 2IA2A 3F6OA 3WODF 1O57A 1ZRCA 5E8IA 1D5VA 1RIOH 2RVCA 2H94A 5KVRA 5E1WA 1UFMA 1XB4A 2W85A 2W57A 4GGGA 3P9KA 2Z5UA 3N97A 1MGTA 1R23A 3QAHA 3ZPLA 3EETA 3PQJA 2PMHA 2DU9A 5D5UB 1J59A 1W7PD 4M9SA 5D4RA 4HOBA 3JSOA 3V7RA 2EV6A 2WWYA 5L3EA 3BJAA 2LDUA 1K78B 3CUQA 3C1DA 4Q47A 1TBXA 2H6CA 3CO7C 3SXYA 2OD5A 1WQ2A 4UVAA 4M73A 2P5LC 1GVJA 5LGTA 5K1YA 4KUMA 1KGSA 1WKMA 2FEZA 1YQAA 1O3TA 4EJUA 1T39A 4HYEA 2PMUA 4A0ZA 1ZGJA 1SFEA 3QPTA 1FPQA 3TO9A 2GA2A 4U0VA 1FP1D 3FXRA 3I0TA 2XHKA 1UB9A 3BOQA 3VEPA 4ZYHA 2OQRA 4M6XA 2IT0A 1Z91A 1Z1DA 4HQEA 3QPHA 1KQ9A 1XDUA 1W7PB 3K0LA 3HOTA 4OMZA 5JFRA 3IKTA 1PP8F 3KZYA 4L9NA 1SAXA 1KYZA 1Z05A 3F8BA 4ESJA 1FBUA 2FXAA 3ROUA 4OIQF 2CSOA 1HSTA 3CTAA 4LG0B 1KQ0A 1E17A 3E97A 5BQTA 3F72A 2A3SA 1YG2A 1J9IA 2HQRA 3H3UA 3HTUA 2ZKZA 1LDKB 1DDNA 4O3MA 2VODA 5LRSA 1U5TA 3LQQA 3JSPA 4A2UA 3J7AO 1AWCA 3BPXA 2EB7A 3LA2A 3VOEA 1MKMA 4HX7A 5BOXA 3FHZA 5LEJA 4EJWA 4Y15A 5A2QZ 4MNUA 1FBSA 2FBKA 4JBAA 2O8XA 5FFXA 1ZGAA 3BWGA 3C3WA 2BGCA 4FHTA 4EV0A 4IXAA 1BIAA 5ILSA 3JW4A 3COAC 2EFWA 4P55A 4HDVA 2ETHA 5TJJA 4I01A 3GF2A 2FNAA 4EQQA 2M45A 4R79A 3ZMDA 4BXUA 5CJ9A 1U78A 1RUNA 2IJLA 1KU9A 3QRFF 4M9ZA 2VOOA 1F1ZA 2L54A 1XSXA 1FBQA 5ED4A 1LVAA 1AOYA 5CLSA 2VBZA 3KE2A 1QBJA 1PDNC 2CYYA 1ONVA 5D8LB 5HVQC 4EM2A 1I27A 2DAOA 3HOSA 3ABTA 1G3SA 1XCBA 1G3WA 1FLIA 3I59A 2R7DA 4KICA 2QWWA 1LEAA 3D0SA 3HHHA 3MZHA 1BI2A 4FX4A 2STTA 4HF2A 1ODDA 3WGIA 1TQPA 3ML6A 4EM1A 2C6YA 1A04A 3F3XA 5E20A 1R1TA 3NRVA 5E17F 5DCMB 5LLQA 4G94A 2RV8A 1MJAA 1YW8A 2QENA 3M7GA 2M8EA 3SQNA 3B02A 2E7WA 1HKTA 3IWFA 3J80K 1XMKA 4BAYA 3P7NA 4H0EA 5L3FA 3KP6A 3I4PA 4HBLA 4S05A 1XGNA 3F6VA 3AAFA 1KQ8A 2DW4A 1LDDA 4LGWA 2UZKA 5AIQA 1XCVA 4L5JA 4WXCA 1HKSA 2IPQX 5JI6A 4I02A 2Z33A 3L00A 2L4MA 3GW2A 2PBIA 3TDUC 5F64A 3CLOA 2V9VA 2Q0OA 3CUOA 2RGVA 2MLKA 2NNNA 3F8FA 4B09A 3ZMZA 3E5QA 3HSFA 2NRAC 2XAGA 4L0YB 2QYOA 3LAJA 3J80Z 3CJNA 2ZMEB 2JT1A 4WF2A 1YIOA 2QQAA 2XAJA 1WSUA 5CVUA 4KNYA 1P4WA 4IJAA 1IXRC 1FNNA 2QQBA 1XSDA 4LK0F 1DPRA 3I53A 3BP8A 2O6GE 2HFHA 2RN7A 1KU3A 4P5OA 3V8JA 1LJ9A 1QPMA 3H92A 5HDNA 4RB0A 2VXZA 4LK1F 2M87A 1QQIA 1W4MA 2ZMEA 2UXXA 3LAPA 2PJPA 1IUYA 2XKPA 3SHFA 3MCZA 5DCFA 2YSRA 5DD8A 1KU2A 4KYWA 4HDUA 2GXGA 3TQNA 3FZVA 2DK5A 2XROA 4HX4A 1D8KA 2GIVA 2L4AA 3M1EA 3V4GA 1TQMA 1OPCA 2ZJ2A 5ICFA 1ON2A 3RDIA 2XKOA 2XV4S 5HS8A 1O3SA 2ZXJA 3IRRA 1MD0A 1RZ4A 3KP5A 2YR2A 1G6NA 5AIPA 3MFKA 3P9CA 3GFIA 4MTEA 5ILUA 2UXNA 3S2WA 1ZH5A 1K79A 5LHIA 2JPBA 5H6QA 1LQ1A 3M9AA 5DUKA 2OQGA 1GXPA 3GZ5A 4HZFA 3JAMZ 2L01A 1W5SA 3R61A 4XLPF 3K9TA 2IP2A 5F1RA 1IN4A 4ENMA 4L9JA 1ZG1A 5BPIA 3KFWX 2ZCWA 2PFBA 4AIHA 1BI0A 2PQ8A 2J5PA 4CICA 3HIFA 1U6GA 2LF8A 1QZZA 4ESBA 4IRGA 3LQRA 1R5HA 1JHFA 1Z6TA 2LSOA 5HLGA 3VFZA 1OYIA 5FO5A 5CVJA 2EJRA 1SD6A 1HXDA 4HF0A 3EYIA 3LFKA 2JPCA 1OYWA 2EK5A 5D8KB 5FB2A 2OAZA 4L5IA 2PEXA 4LLNA 4G7HF 1CF7B 2HKOA 2XASA 3T1BA 3I58A 2H27A 1DP7P 3O6BB 2A61A 4DNCA 4P9UA 4EJOA 1WRJA 3Q9VA 1I1SA 4R1HA 2ESNA 2O03A 3RPUA 4IRIA 3KP4A 2ZO4A 4YG2F 2IW5A 1MDMB 2VBYA 3FMQA 2K4JA 3Q5FA 2AS5F 3WTZA 1UCRA 1K7AA 2RC4A 1U8RA 1S3JA 2E7XA 3K1NA 1T0FA 4HQMA 2RQPA 5E8GA 3VB2A 1FWZA 2GA1A 2R7FA 1ZLJA 1Z7UA 3KZZA 3F8CA 3ZN0A 3G73A 3T0YA 5BPDA 3EYYA 1K78A 3BPVA 4UXNA 4XSZF 1B59A 1FYMA 3RKYA 1BOAA 3GUDA 1FYKA 1Z6RA 5HDGA 1EH8A 3SFZA 2DQRA 2HGCA 2K27A 3ZMUA 2BV6A 3WTYC 2LKPA 3Q9SA 5FLXK 5J6XA 2MD5A 2EWNA 2MC3A 2MH9A 3E6DA 3RTRA 1SMTA 1S6LA 1PP7U 3U2RA 2F5DA 6PAXA 2MLGA 1K6OA 2VE9A 1R7JA 1V4RA 4KMFA 2KIMA 1W7PA 4HLXA 2QM3A 4IPAA 1C0WA 2L3DA 4HF1A 3CO6C 5LEKA 2PLYA 5HLIA 4Q5SF 4HW0A 2GXBA 3KCCA 4IHTA 5HDKA 4MHGA 2G9WA 3JTGA 3BJ6A 5ICEA 2ZNZA 4LG0A 1STZA 2GQQA 4A6DA 1BJAA 3GLXA 2WTEA 3LSTA 5AONA 4RGUA 1YFHA 2DFIA 5LGNA 5IT3A 3DXJF 5D6FA 2EA4A 3KEOA 1Z9CA 3IC7A 4XSXF 1USTA 5KK1A 4M72A 3FMSA 4ZYGA 2K4BA 2E1NA 2P6SA 4GO1A 3NQOA 3J81K 3WTUC 2FQ3A 2XAQA 3KEQA 1IRGA 4HLYA 1FSHA 2ZBKA 3TOAA 3ERED 3RIRA 2M1BA 1T98A 3U9GA 2QBYB 3H3ZA 3DPTA 1BBYA 3V7CA 3W6JB 3EQLF 2LF7A 3T5XA 4XRFA 1IRFA 1HW5A 1R36A 4U0YA 1EH7A 4G8XA 2OZUA 2ACJA 3ZMSA 5IT9K 3T8RA 3DKWA 3HRUA 1YYVA 2VE8A 3L9FA 5BS6A 1SD5A 3R0JA 4OU0A 3GFJA 3SZTA 4U88A 3QU6A 2PI0A 4CGZA 2A07F 4EMSA 2V1UA 1U5TC 1RNLA 4ESFA 1QNTA 3PQKA 3GXOA 1X3UA 5DYMA 4XBFA 2RDPA 4BHCA 3O2PE 4O6JA 3GZ6A 3REOA 2A69F 2P5VA 2MBFA 4LLLA 2YX7A 3HHGA 2CO5A 4Q4ZF 3FF5A 2A6EF 3GO5A 3GWZA 1J75A 2L02A 1S29A 1ZAOA 1QO0D 2EA2A 3GEZA 4PCQA 4WXDA 4EGZA 2HKXA 4UNOA 1T38A 2FU4A 4OINF 4WX9A 3GYHX 2DO7A 3ZN1A 1U2WA 1XGMA 3R6SA 5DCMA 1QGPA 1TNTA 3PFIA 3F8MA 4M9XA 1E2XA 4BYYA 3FM5A 4BH9A 3HRTA 2B0LA 4LMYA 1EV7A 2HS5A 1BI3A 1O3RA 2FNPA 4A0XA 4WWCA 2P4WA 1MZBA 1XGSA 5CVRA 2J5OA 4DQ2A 4P9FA 1XDSA 4A6EA 3O3KA 1FY7A 1G3TA 5D5VB 1P6RA 5E1XA 3I64A 1XD7A 2Q2EA 2OA4A 5CVVA 4TV7A 1FP2A 1VTNC 4UUVA 3HTSB 2YPRA 3WU0A 3E5XA 4R8HA 2DPUA 2Y48A 5L3CA 4M71A 3RPQA 3RYPA 4UV8A 1GXQA 2KRFA 4CZZA 1J0RA 1ZN2A 3RKWA 1JE8A 1I6XA 2COMA 2BEOA 4WK8F 1LEBA 3OV8A 4GXOA 5L3DA 1RUOA 3K69A 3E3VA 1R00A 2P7CB 3W6KB 2HWVA 3DFGA 3ECHA 5FD6A 3NEUA 2AXLA 2D2WA 2W24A 3L09A 4Y13A 2VN2A 2JTVA 3N4MA 4A5NA 2M30A 2CQKA 1ZG5A 3GVAA 5DV5A 4L9TA 2K86A 3ULQB 4CXFA 3WTTC 2KJBA 1YW7A 2Z3YA 3K1MA 3WTWC 1HQCA 4QLCU 3HSEA 1BI1A 1J2XA 3GFMA 2VONA 4GYGA 2IVMA 4LJZF 4LB5A 5FFZA 3G3ZA 4CO8A 3L2CA 4O5VA 3F23A 2H6BA 3WGGA 2VC0A 5DD4A 3E6BA 2FOKA 4N9HA 2HTJA 2W25A 2G7HA 1OMIA 4A5MA 2GZWA 5CVIA 1QZYA 1GHCA 1HBXG 1MJ9A 4U7BA 2PG4A 1B1BA 3LWFA 4N0BA 5CYVA 4L18B 3KLOA 4EJVA 3ISPA 1I5ZA 1WWXA 3FXUA 4RB1A 3RYRA 1PUEE 2CGPA 1FSEA 2K02A 1SFUA 3K2ZA 3WE2A 2BBYA 5ILVA 1FOKA 2OU2A 4YFNF 4ENNA 1H9TA 1ZARA 2ISYA 3WTSC 4Y17A 2JRTA 5HS7A 3WTVC 2G7UA 4RGSA 5E18F 4ENJA 4IVNA 1T2KA 1IXSB 3IHUA 1REPC 1TNSA 2A5YB 1IW7F 1H0MA 1H9GA 1B9NA 2WC2A 1BM9A 3HUGA 4MQVA 1F4KA 3CDHA 3R0AA 1SD4A 3EDPA 1YS6A 3ZP5A 4MTDA 2X4HA 1TW3A 2P5KA 1L3LA 4UHTA 4K2EA 1CGPA 3BDDA 4CHUA 1S7AA 2F5EA 1D8JA 4UVBA 1P4AA 2BYVE 3RKXA 4WCGA 2IA0A 5JHUA 2OBPA 2ADUA 4FT8A 3CUQB 5JR3A 3LA7A 3MEXA 2KIFA 2FE3A 1O7LA 1LB2A 5K5QA 5K5OA 3MZYA 2HYGD 1O3QA 1XGOA 2M5WA 2V1DA 3QP5A 1FZPB 2NNYA 2VBWA 3F22A 5TRDA 1BC7C 2K7LA 1ZG3A 3M8EA 2D1VA 2P8TA 1CF7A 2V6CA 4LD5A 2QLZA 3C18A 4LB6B 2VT3A 4KIGA 4EM0B 2H09A 2X0LA 1ZYRF 3TO7A 1DUXC 1KU7A 2EFOA 5L3BA 3L7WA 2O61A 1JGSA 3P9IA 2XAHA 4AVPA 1EH6A 3GFLA 1YW9A 3BJOA 3WE3A 5J8FA 3KLNA 4OMYA 1MDMA 1KYWA 3RJPA 5H6RA 2BE5F 4JK1X 2Y0MA 2P7VB 2RNJA 3M8FA 2O3FA 1UHWA 1KA8A 2F5CA 4EVIA 3FMRA 5ICCA 1ULYA 1IN7A 1IN8A 3DEUA 2DPDA 4RAZA 1R5GA 1ON1A 2A6HF 4MEYF 1OKRA 3I5UA 4A0YA 2O0YA 4BNCA 1U5TB 2FA5A 2V79A 4NB5A 1IN5A 1Y0UA 5A2QK 1IF1A 3IRQA 2D1HA 3E6MA 4ON0A 4RGXA 4KA4A 1OR7A 5L3GA 2EFQA 2FBIA 2FMYA 4FX0A 2IA1A 2YU3A 4IHSA 2DBBA 1R58A 4RAYA 4MQ9F 4AD9A 3FWEA 4I0BA 3KETA 4G7OF 4HV6A 2VT2A 4U0WA 5DDGA 5JVTA 5FD5A 3FX3A 3ELKA 1B9MA 2CFXA 3CUQC 5FLXZ 2NYXA 3ZQ7A 4CYDA 5D6EA 3GX4X 2HDCA 2W84A 1TTYA 2RKHA 2QUFA 3SZPA 1USSA 2P6TA 4PGGA 3WGHA 1T6SA 3OOPA 1XN7A 1S8NA 4P96A 1J7KA 4U7DA 1SD7A 1HKQA 2FSWA 1J5YA 1HSJA 1TW2A 2GWRA 1B6AA 4HV5A 4GCVA 1BC8C 5DEQA 2ESHA 1HW2A 3BZ6A 1YO5C 4I98B 4OIPF 4OOIA 2DQLA 3VODA 4ZYEA 2KIUA 4ZZLA 2WV0A 4ETSA 4EJTA 4AIJA 1G4DA 4AIKA 2ELHA 1ZREA 4HA8A 5ERIA 2HEOA 3HRMA 4I7HA 2A68F 1OYYA 3BROA 3I59B 1W5TA 2DT5A 3E6CC 2KJCA 4IRHA 3IL2A 2QBYA 1BIBA 3TOBA 3K1PA 2ISZA 1ZRFA 3TO6A 4CDGA 3J81Z 1U3EM 4YIIA 1BN5A 4G6QA 2MA3A 5LBQA 4KDPA 3BY6A 2LNBA 4LLGF 4BQAA 2CWEA 4EGYA 2JSCA 5D5WB 1DPUA 2DLLA 3KP7A 1F5TA 3D5LA 4D0PA 2JZYA 5K5RA 4RS8A 2IRFG 3FXQA 1XMAA 1RI7A 2VC1A 4NQWA 4RB3C 1R1UA 4KN7X 4KFCA 2HYFA 3R60A 1SFXA 4ZYDA 3DPLC 3FM3A
chains in the Genus database with same CATH superfamily
1TT5B 4I09A 5IT9Z 5EEGA 2YUSA 2VKHA 3KYDB 2X1EA 5J8CA 1RC9A 2ZNYA 4L9VA 2XVCA 4PDKA 3QP6A 4PSWA 5ICGA 4RGRA 1WCMJ 1FC3A 2NVXJ 4GDFA 5FGMA 2ECCA 4N9IA 2QVOA 2Z99A 1YTYA 2EFNA 3G1OA 2ZC2A 3F21A 3HOXJ 2STWA 2KZVA 3HRSA 4PSXA 3DKYA 3TGNA 1TZLA 3ASNH 3F0CA 4G9YA 3T8TA 4ZH4F 1ZTRA 5F0FA 1WH7A 2EH3A 4RB2C 4OIRF 2R7TA 2LD5A 1K6YA 3C7JA 2XUBA 4FETA 4XKCA 4F52A 5B1AH 2Z9OA 3HSRA 2R3SA 2HR3A 2FUG2 4ZDPA 2VBXA 1WJAA 3ECOA 3DP7A 3CZ6A 1MJBA 2EFPA 5EEAA 1WI9A 4B1RA 5LD2C 1QHGA 2ZFWA 2FRHA 4IF4A 1L0OC 2GXAA 1WPKA 1IZ1A 1MNMC 4G6DA 3WU1B 1AU7A 3BTCA 1TQIA 1P4XA 4M6YA 4YIFA 5FRMA 2B63J 1ZLKA 4CA0A 3RSNA 2KKOA 4XRSA 1HW1A 3KYCB 2JRMA 3OS2A 1YS7A 3IUOA 2MH2A 1Q1HA 1WVRA 1FYLA 2NAZA 2LY1A 4Z2YA 1IXCA 5LHGA 5FROA 2O5RA 3V8LA 3KP3A 1JHHA 4HX8A 3QU3A 4G7ZF 1SC7A 1LFUP 1JKRC 5HODA 2HOEA 4F7ZA 3DV8A 3MKWB 2HTSA 3ZMTA 3R4KA 1I1GA 3E5UA 1FX7A 3G71I 4M6VA 4YFXF 4F92B 2TDXA 2VJ5A 1D3YA 2W82A 1MW7A 3K4JA 4MGRA 5HS9A 5HLHA 2BHZA 2CG4A 3GBGA 4OIOF 1GT0C 4DYRA 3MQ0A 3QOPA 3MMYB 4BHBA 1DGRM 3LSPA 2NOJB 1XSVA 4ENKA 1D0XA 4IQJA 3K4CA 2E19A 3A2KA 3S1MJ 4AWXB 1V3FA 3DLLF 1IN6A 2FOWA 1IAWA 2Y31A 3BQYA 2V9KA 2Y75A 3IWZA 4I0AA 3GTJJ 3VWBA 1TLHB 2WAEA 3EUHA 4Q48A 2HVQA 2HQNA 1YLFA 2QQ9A 4XK4A 3IKVA 3HYIA 2UWMA 2DI3A 3H9JA 1VQMI 3SEQA 4BUPA 2LTPA 4KMUX 3CJRB 3WG9A 3H9QA 5IP7J 1WJEA 2DTRA 1VQOI 4KN4X 1ZRDA 2CJJA 1R4NB 2VKEA 3CJTB 4E7ZA 1DQUA 2R93J 2CQXA 2NS0A 4WXHA 5E1ZB 3H5AA 2JUCA 4IEJA 4PGHA 1XC5A 4BXXJ 4GYIA 3A01B 3V42A 1NHAA 4M74A 2ZSHB 2FMLA 3G1MA 4B8XA 2ECBA 3DF8A 1G2HA 2FBHA 4QPQA 2XRNA 4XICA 1B4AA 4XLCA 4KT5C 5DUIA 2DMUA 2PN6A 1IRZA 4NHJA 2M4KA 1I6HJ 1E3HA 3ZQLA 4ASNA 1SMYF 2OF7A 4E70A 2LKXA 1UZCA 4B3XA 3JAMK 4PZJA 3CQZJ 5DM6F 5IP9J 2Q1ZB 1P2FA 1JKPC 3CMEI 2W1OA 1W36D 1AKHB 3QPLA 3PUFA 3ZQFA 2R7RA 2XGXA 5EF6A 3BT9A 1R22A 5EEHA 4ZC3A 4LOCA 3KZIC 3H0DA 2JVHA 5D5XB 4LFUA 4XLFA 4I2OA 3SDBA 1NK3P 1UELB 1FT9A 2DTZA 1Z3XA 2F2EA 2HZTA 1P92A 3CLQA 5CQGA 3ZMVA 1VQ9I 5IYDJ 1WI3A 1V5GA 5LGUA 4XIDA 2F5FA 2OZ6A 2X6WA 3TBIA 2IS6A 2CUFA 5FJ8J 4YFKF 3M07A 3W2WA 1M1EB 2GAUA 3HPHA 3VYRB 4LIUA 2VI6A 3I71A 2FF4A 3S17J 1TWAJ 5D4SA 5HOOA 4XORA 1F9NA 2CW0F 4S04A 1YJWI 1SAUA 1PVEA 3ABUA 1JXSA 3MAJA 3WTXC 3I54A 1XS9A 2YX4A 3F8NA 5M3FJ 5EDNA 5H20A 2EZIA 1FOYA 2L9VA 3TKYA 2R5ZB 2CV1A 1G3YA 1GUUA 1MBKA 2DMPA 2ZSIB 4UV9A 5LRRA 4YRVA 1ETYA 4XL9A 1IDZA 1MSEC 4UVCA 3RPUD 3V8KA 4NC6A 3U1DA 3TDZC 2QSFX 3KP2A 4A12A 4IZZA 4XNFA 5BMZA 1QVTA 4BBSJ 3PO3J 3UR3C 4KIBA 3V7SA 2H8RA 1N78A 3QWLA 1S7OA 1XMXA 2IGNA 3B73A 1D0ZA 2XGCA 1YI2I 1BR1A 1UMQA 5LHHA 2H1LA 2EIKH 2LRDA 4N4OB 1O7FA 5JHFA 2D45A 1VQ5I 3MWMA 4QIWN 2XAFA 1SFKA 1N75A 2EV0A 4HAMA 3JTHA 1R1VA 2LOOA 2AXTC 1OISA 1E0EA 1UHMA 3K70D 2TCTA 3RI4A 5B66C 4QWQA 1GV2A 2WV1A 3BC8A 3LA3A 3QYEA 3OOUA 3QQAA 2ZMEC 5KAIC 1I3AA 1V54H 1ZHFA 2EV5A 1WJDA 2Q8KA 2V1XA 2KDOA 3K4MA 2K3FA 5HLTA 4PJMA 2DK8A 2H8WA 2L7MP 4MEXF 1QU3A 4QSHA 4XLNF 3DQVC 1V55H 4B4CA 4C2UA 3ZQQA 5KCMA 2XIGA 1LDJA 1POGA 2KL4A 1LNWA 4JQFA 2E1CA 5F6FA 4P1WA 2JA8J 4KIFA 2WA0A 5M5XJ 4ZZDA 2R7QA 1T08B 2VOPA 4A3JJ 1HF0A 4L0ZB 2QZ8A 4BHPA 1OCCH 2IA2A 3F6OA 1X19A 1O57A 3WODF 1ZRCA 1K83J 5E8IA 1ZQ3P 1D5VA 3MKZA 9ANTA 3Q0WA 1RIOH 2RVCA 2H94A 3CC2I 1OQYA 3B6CA 5KVRA 2XB0X 5E1WA 1UFMA 1MBEA 1XB4A 2W85A 5EGOB 2W57A 1E3PA 2ID6A 3ZQCA 4PFPA 1OLTA 3DU6A 4GGGA 3P9KA 2Z5UA 3BCAA 3HL2A 3SDGA 3EPZA 1NG7A 4DGWB 3N97A 2QSGX 1X1PA 1MGTA 1R23A 5J1UA 3QAHA 3ZPLA 3PO2J 2HVSA 3EETA 3PQJA 2PMHA 1I3QJ 2DU9A 5D5UB 1R4MB 4ZDLA 1ENHA 1J59A 2CW7A 2CV0A 1W7PD 3JRFA 4M9SA 5D4RA 4HOBA 3JSOA 3V7RA 2EV6A 3OIOA 2O9LA 1XPXA 4Y4RA 4V2GA 1X1DA 3FXLA 2M7BA 2WWYA 1ETOA 3A0HC 4A3IJ 5L3EA 3BJAA 2LDUA 1K78B 3CUQA 1GLNA 3C1DA 5J40A 2RAEA 4Q47A 4ZYAA 1LVKA 1TBXA 1X4OA 1BOBA 2H6CA 3CO7C 3SXYA 3BG7A 4DYCA 1YX3A 2OD5A 1WQ2A 4UVAA 4Y52J 4J19A 3I3LA 1OCPA 4M73A 2P5LC 3DTKA 3IH4A 3DBHB 4HNTA 1GVJA 5LGTA 1SVMA 1DU6A 3FXJA 2VKVA 4A3KJ 5K1YA 4KUMA 1KGSA 1WKMA 1OJLA 3NWSA 2FEZA 2K85A 1YQAA 1O3TA 2WY7Q 2UUZA 4EJUA 2HU9A 1RKTA 1T39A 3TP3A 4HYEA 2PMUA 4OAZA 5FKLA 1PUFA 2V6EA 1TP4A 4A0ZA 1ZGJA 4FASD 1U0JA 4RLFA 5J3LA 2KQRA 1SFEA 5DM7F 3QPTA 1FPQA 3TO9A 3S1NJ 2XF5A 2DA1A 2GA2A 4U0VA 3OYKA 3H3VK 3L2RA 2B7EA 1FP1D 3FXRA 3I0TA 2XHKA 1UB9A 3BOQA 3VEPA 4ZYHA 1VQ4I 2OQRA 4CCOA 3A02A 4M6XA 2MG4A 1HCRA 1IRXA 2DT7B 3OR1C 4BEHB 5FKOA 2IT0A 4LG3A 5B1BH 2CS3A 5K7FA 2K3PA 1Z91A 2Y9YA 1Z1DA 2XRLA 4HQEA 2JA6J 5E3NA 3QPHA 1KQ9A 1XDUA 4E7IA 2X1CA 1W7PB 3K0LA 3I56I 1GV5A 3HOTA 4OMZA 1W36C 5JFRA 3IKTA 1PP8F 3AL0C 3KZYA 4L9NA 4NNJA 1KYZA 1SAXA 1BR2A 1Z05A 2P81A 3F8BA 1MMSA 5C3EJ 4ESJA 3M1CA 1FBUA 2VASA 3DTEA 1JT0A 1E3OC 2FXAA 3DKXA 3ROUA 4OIQF 2CSOA 1HSTA 3CTAA 4LG0B 2OTLI 1KQ0A 1E17A 1MMDA 3E97A 1VQKI 5BQTA 2HI3A 4BEHA 2LLKA 4RM2A 5K7ZA 3F72A 1B72A 2A3SA 1YG2A 1J9IA 2HQRA 3H3UA 3HTUA 3O8HA 4XM3A 5IY5H 2ZKZA 1LDKB 2GOMA 3NAUA 1Q1VA 2K9SA 1JTXA 1DDNA 2XB5A 1Y8RB 4O3MA 3LSRA 2VODA 5LRSA 1U5TA 3LQQA 2IS2A 4BS9A 2QEXI 3QYFA 3JSPA 5IP6A 4OWRB 4A2UA 5KAFC 3J7AO 3K7AJ 3M8JA 2LKSA 2OV7A 1AWCA 2CRGA 5C4XJ 1W5CC 2LH9A 2H1KA 1YRNB 3BPXA 2OUMA 1I39A 3MVPA 2EB7A 3LA2A 4QPOA 3VOEA 4BJTA 2A6TA 1MKMA 1G59A 2V1NA 1QHHD 4HX7A 4N4NB 5BOXA 3FHZA 5LEJA 1D0YA 1I50J 1VQPI 4EJWA 1TL8A 4Y15A 5A2QZ 4MNUA 1T0FC 1X1CA 1FBSA 2FBKA 4JBAA 2FX0A 5GP9A 2O8XA 2BY2A 4HSRA 5FFXA 1ZGAA 1AHDP 4LITA 3HC7A 2HQ5A 2DOEA 4MIMA 5DTDA 3PUBA 3BWGA 3C3WA 1VZ0A 5KHDA 2BGCA 4FHTA 4EV0A 4IXAA 1BIAA 3FK6A 4UUSB 3FXKA 5ILSA 3JW4A 3COAC 5EG0A 5EJCA 1DP3A 3PIOF 2EFWA 2R7ZJ 4P55A 1P9QC 3J7YJ 4HDVA 3L2UA 2ETHA 4I6ZA 2L7FP 5TJJA 3A0BC 3TMOA 2LK2A 4I01A 2L7KA 3GF2A 2FNAA 4EQQA 2M45A 4R79A 3G1LA 3ZMDA 1X2MA 4BXUA 5CJ9A 4AYBA 1U78A 2EPFA 1RUNA 4CYCA 2IJLA 3C2HA 3CCQI 1KU9A 1FMVA 3BR3A 2E35A 3H35A 4XLHA 3QRFF 4HPQA 4M9ZA 5CPRB 1MIJA 1N25A 2VOOA 1F1ZA 2L54A 1XSXA 3VYSB 1X3ZB 4FQGA 1FBQA 1WGXA 5ED4A 1LVAA 2V4JC 2R5YB 4BGDA 1AOYA 5CLSA 2EZHA 2VBZA 3KE2A 1QBJA 2MC4A 4X6AJ 1QVUA 1PDNC 3E1SA 2CYYA 3OMYA 1JUSA 4YIRX 1ONVA 5D8LB 4JX5A 5HVQC 2WY8Q 4EM2A 1I27A 3O8GA 2DAOA 5FKMA 4HG2A 4E4HA 1YJ9I 3CC4I 3HOSA 1F36A 3ABTA 2R92J 1G3SA 3OIPA 1XCBA 4E7KA 2K9QA 1G3WA 4JYKA 2PJRB 3I59A 1FLIA 1HC8A 3CJQB 1QPIA 2LG4A 2R7DA 3VDXA 3I55I 4IX7A 4KICA 1ETQA 2QWWA 1LEAA 3D0SA 2XPVA 3HHHA 1LE8A 2LYCA 3MZHA 1TC3C 1BI2A 4FX4A 2JA5J 2STTA 4HF2A 1SFOJ 3QODA 1ODDA 3WGIA 1TQPA 2DMTA 3ML6A 4HRIA 4EM1A 1XX5A 2C6YA 1A04A 3F3XA 5E20A 1R1TA 1UG0A 2BW3B 3NRVA 5E17F 5DCMB 5LLQA 4G94A 2RV8A 1MJAA 4DW6A 2CQNA 1OCTC 1YW8A 2QENA 4I76A 3M7GA 1MNEA 2M8EA 3SQNA 2WB1A 3B02A 4BE1A 1X58A 2E7WA 4A3MJ 1HKTA 3IWFA 3J80K 4FCYA 5F04A 1XMKA 4BAYA 2KDZA 3M3YJ 2BVMA 2RREA 3H1CA 4S0HB 3P7NA 4H0EA 1FJLA 4IKFA 5L3FA 3KP6A 3PIPF 3I4PA 4HBLA 4S05A 1MBFA 1XGNA 2DYRH 3F6VA 1SANA 1Y56A 3AAFA 1KQ8A 2DW4A 2IGMA 1LDDA 4LGWA 2UZKA 5AIQA 1XCVA 2W48A 4L5JA 4WXCA 3ZQHA 2BW3A 1X1AA 4C3JJ 1HKSA 4DZJA 1U9OA 4G6TB 3OYFA 2IPQX 1FEXA 4CUGA 5JI6A 2W7NA 3HKZA 1RPWA 1JI8A 4I02A 2Z33A 4IHXA 3L00A 2X51A 3LSJA 2L4MA 3GW2A 2Q2EB 3A4CA 2PBIA 3VYUB 3GZNB 1HOMA 3TDUC 4AYBN 5F64A 5F08A 3HOVJ 1TWHJ 1QRYA 3HB9A 2ME0A 3CLOA 2V9VA 5E3OA 2Q0OA 3CUOA 2RGVA 2ZB9A 4CCKA 2MLKA 3S3MA 2NNNA 3F8FA 4B09A 2WAFA 3ZMZA 3E5QA 3HSFA 2COBA 4BQOA 3OL4A 3AFHA 2NRAC 2XAGA 2BVLA 2CUJA 1UHSA 4DOZA 1OCOH 4L0YB 1A5JA 2QYOA 1MBHA 3LAJA 3HZJA 1RKWA 4B47A 3J80Z 3CJNA 2L5QA 2ZMEB 1CQTA 3BR1A 2BY0A 3RKQA 2JT1A 2E2JJ 3ABLH 4L5EA 4WF2A 5E3LA 4XLEA 3FBNB 3P5JA 1YIOA 3H36A 2QQAA 3OYLA 4RBOA 2XAJA 1WSUA 5CVUA 4KNYA 1P4WA 4IJAA 2XC7A 1IXRC 4II3A 1FNNA 3L2VA 2QQBA 1XSDA 2NVUB 4LK0F 1DPRA 3I53A 3BP8A 1VNDA 3FK7A 2O6GE 2TRTA 2HFHA 2RN7A 1KU3A 1MMNA 4P5OA 3V8JA 1LJ9A 2ICWG 4DZPA 1QPMA 3H92A 1VQNI 5HDNA 4RB0A 2VXZA 4LK1F 2M87A 2G0EA 1QQIA 3ZRGA 1W4MA 2ZMEA 2UXXA 3LAPA 2PJPA 1IUYA 2XKPA 3SHFA 3MCZA 5DCFA 2YSRA 5DD8A 3OYEA 3MKYB 2WB1N 1KU2A 2BY3A 2K40A 4KYWA 4HDUA 1BL0A 3B6AA 2GXGA 2WAQA 1X1BA 3I9V2 2W4SA 3TQNA 1Z0XA 3FZVA 3M4OJ 2DK5A 4JOMA 4BXFA 2XROA 1EA3A 3S93A 2IS1A 4M3EA 3H5NA 4HX4A 4KT6A 1D8KA 2M8GX 3CD6I 4BQQA 3LFUA 2GIVA 2L4AA 3TW7A 2KLOA 3A01A 1KONA 3CCUI 3ABMH 3WHBA 4X0GA 2LBFB 3HKZN 5J47A 4RAFA 3M1EA 3ZGKA 3JRIA 3CMMA 1KZHA 3SJMA 4PUSA 3V4GA 1TQMA 1S7EA 5IPAA 2A05A 1OPCA 2ZJ2A 1YJNI 3LSIA 2JA7J 2I5UA 5ICFA 1ON2A 1H88C 2HVRA 3JCUC 2BXZA 3RDIA 3HG9A 3RQIA 1ZKGA 3HM5A 3ESWB 2XKOA 4BDYA 2XV4S 1MBGA 2HZDA 5HS8A 1O3SA 1ETKA 1YIJI 1AKHA 2ZXJA 5K7HA 4XN3A 3PL8A 3IRRA 4A69C 1MD0A 2ZXIA 1RZ4A 1XG1A 3KP5A 3ERMA 2YR2A 1G6NA 1D1CA 4M3FA 5AIPA 2XPWA 4XMYA 3MFKA 3HGGA 3P9CA 3GCMA 3GFIA 4MTEA 5ILUA 2F4MB 2UXNA 3S2WA 2LBFA 1Z67A 1ZH5A 1MMAA 5LHIA 1JJ6C 1K79A 2JPBA 5H6QA 1VI0A 1FTZA 1T8IA 3H9GA 1LQ1A 1S9HA 4XR6A 3M9AA 4A3GJ 5DUKA 2OQGA 3OYBA 4ZTFA 2E5ZA 3GZ5A 4HZFA 1GXPA 3JAMZ 2AO9A 4BY1J 2L01A 1W5SA 2KZGA 3R61A 3HPGA 4XLPF 4PJJA 3E7LA 3K9TA 2JJ7A 2F4OB 2IP2A 3PSFA 2QSHX 1U9NA 2QQ8A 5F1RA 2JK3A 5KNLA 4W97A 3AL0B 1IN4A 3IH2A 4ENMA 4L9JA 1IDYA 1ZG1A 5BPIA 2R5ZA 3KFWX 2ZCWA 2OPTA 4XOPA 5IYCJ 2PFBA 4AIHA 1BI0A 2IAIA 2PQ8A 2J5PA 4CICA 2KRCA 3HIFA 1U6GA 2LF8A 1QZZA 4ESBA 4IRGA 4BY7J 4C3HJ 3LQRA 1R5HA 1IO2A 1JHFA 1Z6TA 2E1MB 5CKTA 2LSOA 3F9KA 2OTJI 2WAQN 5HLGA 2F48A 3J7ZI 3VFZA 2VXDA 3LSHA 4QTRA 4MFEA 1ETVA 2JUGA 2Y69H 2VQHA 4J00A 2OJED 1OYIA 2CFOA 5FO5A 5CVJA 2EJRA 2LY9A 2VLAA 1SD6A 1HXDA 5M5YJ 4HF0A 4CCLA 3EYIA 3LFKA 2JPCA 2BHYA 3OIQA 3GMEA 3HJEA 1OYWA 3VPRA 2EK5A 4AVZA 5D8KB 2JN6A 5FB2A 2JWTA 2OAZA 1BR4A 2V26A 4BDZA 4L5IA 2PEXA 2MGQA 1WFXA 4LLNA 4G7HF 1CF7B 2HKOA 2XASA 4HNVA 3T1BA 3I58A 2H27A 4UB6C 1DP7P 3HXLA 3O6BB 2A61A 4F93B 4XOTA 2IGOA 4DNCA 2VKDA 1TWFJ 4P9UA 2DXIA 4EJOA 1WRJA 4U87A 1WJBA 2JSPA 3Q9VA 3BZKA 1I1SA 1R6RA 3BQZA 3G4SI 4R1HA 1R9TJ 4NC8A 2ME6A 2LP0A 2E36A 2ESNA 2QGUA 3DEEA 4BJ6C 2O03A 2L9SA 3RPUA 4IRIA 5EGOA 3L2WA 4XONA 3KP4A 3PNYA 2KRHA 2ZO4A 2HXOA 2ZJPF 4YG2F 2IW5A 3OYGA 3JR9A 1W0UA 1MDMB 2VBYA 3FMQA 5FLMJ 2K4JA 3Q5FA 2EBIA 3EUAA 2AS5F 3WTZA 4BL0B 1UCRA 2DCEA 1K7AA 1DGWY 2RC4A 1U8RA 2Y30A 1S3JA 1HDPA 2E7XA 5GAHJ 3K1NA 1ZK8A 1T0FA 1FOXA 2HOAA 3BCBA 4HQMA 3K10A 5JVGF 3H5RA 2RQPA 5E8GA 3VB2A 1FWZA 2GA1A 2R7FA 1S72I 1ZLJA 1RR7A 1Z7UA 3IP4B 3KZZA 3F8CA 3ZN0A 3G73A 3T0YA 1WH5A 5BPDA 3EYYA 1EF4A 1K78A 3FKIJ 1Y39A 3BPVA 4UXNA 3X2QH 4XSZF 2N8GA 3CMYA 1B59A 3QYBA 4ITVA 4HSTA 1FYMA 1BJZA 3RKYA 4BJ5C 2XAUA 1BOAA 3GUDA 4IHYA 1FYKA 3ZQIA 2BOLA 1Z6RA 3ABKH 5HDGA 2NOGA 3GTQJ 5IOZA 1FTTA 2BZTA 1EH8A 2K9MA 3SFZA 2DQRA 5E79C 2HGCA 2K27A 3ZMUA 2DFHA 4XN0A 2BV6A 2L2OA 3WTYC 5J4YA 5EYRA 4BQNA 2LKPA 3CP8A 3CCJI 3CCVI 2HOSA 2DFEA 4Y3OA 3Q9SA 1BW6A 5FLXK 5J6XA 2MD5A 2EWNA 2WADA 3OS0A 4C3IJ 2MC3A 4XKVA 2MH9A 2M3AA 3E6DA 2V7FA 3RTRA 1SMTA 2M34A 1S6LA 2HXIA 2X6XA 1PP7U 2E1MC 2VQGA 3U2RA 2F5DA 3PSIA 6PAXA 2MLGA 3GTGJ 1K6OA 3TL4X 2VE9A 1R7JA 3HGYA 2GBYA 3K4KA 2E71A 5C4JJ 2ELKA 3U21A 1V4RA 3CDIA 4KMFA 2KIMA 2JVGA 1W7PA 3QOEA 4HLXA 2CUEA 4JX4A 2I10A 2QM3A 4IPAA 3S32A 1D1AA 3S16J 3OYJA 1C0WA 2L3DA 3DCFA 4HF1A 3CO6C 5LEKA 4MO7A 4RLQA 2PLYA 5HLIA 4Q5SF 4JX6A 2LVSA 5GTIC 4HW0A 2GXBA 2DJNA 3KCCA 2DODA 1SVOA 4IHTA 5HDKA 4MHGA 3FDYA 2G9WA 3JTGA 3BJ6A 5ICEA 2ZNZA 4LG0A 1STZA 1ACIA 2VJ4A 2GQQA 4A6DA 1BJAA 3GLXA 3UNGC 1DU0A 2WTEA 2CQQA 2M7AA 3LSTA 5AONA 4RGUA 1YFHA 2DFIA 5LGNA 5IT3A 3DXJF 3DU5A 5D6FA 1JT6A 2EA4A 3KEOA 5E3MA 4B48A 1Z9CA 3CCMI 1G8XA 3IC7A 4XQFA 4XSXF 4EEFG 1USTA 1YHQI 5KK1A 4M72A 3PNTA 3FMSA 4ZYGA 4UY8I 2DA4A 2K4BA 2E1NA 2GM4A 4AIDA 5M3MJ 4NDLA 3WU2C 2P6SA 1TWGJ 4GO1A 1D5YA 1V5FA 3IAM2 2XSDC 2JMWA 3WHCA 1VQ6I 1A6QA 3NQOA 3LSKA 3J81K 1Z7LA 3WTUC 4IO9F 1NH3A 1YRNA 2DT6A 2FQ3A 2XAQA 3GLLA 3KEQA 1RETA 1IRGA 4HLYA 1FSHA 2GOXB 2ZBKA 3K4NA 3TOAA 2IGKA 3ERED 3Q0VA 3RIRA 4BU2A 3GTLJ 4V19K 2DA5A 2M1BA 2RNGA 1T98A 3U9GA 2QBYB 3H3ZA 3DPTA 1BBYA 3V7CA 1OFCX 3W6JB 3EQLF 1IV8A 2LF7A 4HEA2 2HOTA 2HDDA 5JLWA 2FD5A 3T5XA 1D1BA 4XRFA 1IRFA 1HW5A 2AQFA 1R36A 4U0YA 2QF7A 1EH7A 4G8XA 2ID3A 2X85A 3RCOA 1JGGA 2ZFUA 2OZUA 2ACJA 2NXNB 3ZMSA 5IT9K 1YOVB 3T8RA 4UUSA 3JRBA 2HPIA 3DKWA 3CESA 2MYSA 3HRUA 1GDTA 3OSFA 1YYVA 2VE8A 3BR5A 1P7JA 1JUPA 3L9FA 2KPMA 3MN2A 1ORKA 4IOCF 1P7IA 3FIWA 3HOYJ 5TGTA 2MFZA 3K4LA 5BS6A 1OCZH 4D7NA 3OWTA 3SZGA 3FXMA 2W00A 1A36A 5DS9A 1SD5A 1OR7C 3R0JA 4OU0A 4ABZA 1BA5A 3BTIA 3GFJA 1ZGWA 5IYBJ 3SZTA 4NC7A 3AG3H 4U88A 2K9NA 3QU6A 2VPLA 2XF7A 2PI0A 3BR6A 2XSJC 4A3FJ 4CGZA 1Z3YA 2A07F 4E7SA 1MMGA 4EMSA 2V1UA 1U5TC 1RNLA 2JA2A 4ESFA 1QNTA 3LNQA 3PQKA 3GXOA 1X3UA 5DYMA 4XBFA 3OYDA 2EIMH 2Y9ZA 4RMNA 3D5SC 2R5YA 1UG2A 2RDPA 4BHCA 1UAAA 1K4SA 3H0GJ 3O2PE 4O6JA 3GZ6A 4PJLA 1O4XA 4C2TA 3REOA 1ZELA 2A69F 2P5VA 1ZR2A 1NG6A 3JRAA 1A31A 3FISA 2MBFA 4LLLA 4GRIA 2YX7A 1QA6A 2IBDA 3BG9A 3CCSI 3BTLA 3SYTA 3HHGA 2CO5A 1YE9A 3JRGA 4GFBA 4EATA 4Q4ZF 2PJRA 3FF5A 1RRJA 3D1NI 1WZ2A 1ETWA 4M3DA 2A6EF 3GO5A 3DEWA 3GWZA 1J75A 2L02A 4F91B 1S29A 3G6EI 3S2HJ 1X4PA 3JRCA 4C30A 5FLVA 2X1DA 1ZAOA 5CQEA 2EINH 3DTIA 3HDDA 1F43A 1QO0D 2EA2A 4IQ4A 3GEZA 2NVTJ 4PCQA 4WXDA 4EGZA 2HKXA 4UNOA 2VJJA 1EKEA 2FU4A 3D5RC 1MNDA 4OINF 4D5FA 1T38A 4WX9A 4D1QA 4RA2A 2DO7A 2DJIA 1U2WA 3ZN1A 1XGMA 3OS1A 3GYHX 3DPUA 3R6SA 4DBRA 5DCMA 1QGPA 1TNTA 4CH7A 3PFIA 2OC6A 3F8MA 4M9XA 1E2XA 4BYYA 4BE2A 3FM5A 3RQ4A 4BH9A 2VQCA 2DMQA 2HYJA 3HRTA 4AU7A 1YX5A 5TISC 2B0LA 4LMYA 1EV7A 2HS5A 1BI3A 3FHNA 1O3RA 2FNPA 1JUMA 4A0XA 4WWCA 1ERDA 2P4WA 2EZKA 3BG5A 3RZOJ 1MZBA 1XGSA 3DBRB 2M0CA 3OYHA 2O8KA 1B8IB 3S3OA 2A5WA 4IOAF 5CVRA 2J5OA 4DQ2A 4P9FA 1MBJA 4D5CA 4IL6C 3UKGA 2Y0SN 1XDSA 4A6EA 3O3KA 2RQQA 1FY7A 3S2DJ 2DYSH 1G3TA 5D5VB 2CQ7A 1P6RA 5E1XA 3I64A 3LSGA 4F55A 4PFOA 1X2NA 2CU7A 1MH4A 1MSFC 1XD7A 4B44A 3KX2A 2Q2EA 2OA4A 5CVVA 1V5EA 3CCLI 1SEUA 4TV7A 3C2GA 1FP2A 4XLAA 1VTNC 4UUVA 3HTSB 2YPRA 3WU0A 4M3BA 5B3SH 3E5XA 1B8IA 5JLXA 3KYLA 4R8HA 4A3CJ 2DPUA 4J01A 1IV6A 2Y48A 3BR2A 4M71A 5L3CA 3RPQA 3RYPA 4DBQA 1WHUA 3JRHA 4UV8A 2NS7A 1GXQA 2KRFA 3K4BA 4CZZA 1J0RA 1ZN2A 3LL7A 3RKWA 3JRDA 1JE8A 1I6XA 1HDDC 3A1YA 1X3WB 3HOWJ 2COMA 1APLC 2BEOA 2M4GA 4WK8F 2Z16A 1LEBA 3OV8A 4GXOA 5L3DA 1RUOA 3K69A 3E3VA 4DJAA 1R00A 2P7CB 3W6KB 2XGEA 2EILH 2HWVA 3DFGA 2X6OA 3ECHA 5FD6A 3NEUA 2AXLA 2D2WA 2W24A 4AC0A 4E7JA 3S8PA 2R7VA 3S1RJ 3L09A 4LIVA 4Y13A 2PX9A 4DIQA 1OCRH 2VN2A 3CCRI 2JTVA 1ZR4A 3N4MA 4A5NA 2M30A 2D5VA 2CQKA 2ZJRF 1ZG5A 3GVAA 5DV5A 4UB8C 4L9TA 2R7SA 2K86A 3ULQB 4CXFA 3WTTC 2KJBA 1YW7A 4XKWA 2Z3YA 3K1MA 3WTWC 2QA4I 1HQCA 1K4TA 4QLCU 3HSEA 3AG2H 1BI1A 1J2XA 3HOUJ 3GFMA 2EQRA 2VONA 3FKJA 4GYGA 2IVMA 1HA8A 4LJZF 4LB5A 3HOZJ 3IH3A 5FFZA 3G3ZA 1MH3A 4G12A 4CO8A 3L2CA 4O5VA 3F23A 2BY1A 3MZ8A 1K61A 2H6BA 3WGGA 2VC0A 5J1RA 1VQLI 3MD2A 5DD4A 2DMNA 4F3QA 3S3NA 1N77A 3E6BA 2FOKA 3A03A 2KFDA 4AM3A 4N9HA 2HTJA 3CF2A 1JTYA 2K9LA 2G7HA 2W25A 1BW5A 1OMIA 4A5MA 2GZWA 2XDVA 5CVIA 4OAYA 1QZYA 2M0MA 1GHCA 1HBXG 1MJ9A 5F0CA 4RDUA 1WJFA 2KMUA 2DOAA 3W3CA 2PG4A 4U7BA 2EZLA 4E7HA 1R71A 1B1BA 3KEYA 3GTMJ 2VJIA 3LWFA 4A3LJ 2FJ1A 2KISA 2M9HA 2R7OA 4N0BA 2L0KA 5CYVA 3PJRA 4L18B 3KLOA 2F4IA 1Z21A 2O7OA 4EJVA 3ISPA 1I5ZA 3SFIA 2LREA 1WWXA 3FXUA 3E0JB 4RB1A 3RYRA 1PUEE 3CMAI 2CGPA 2VL8A 2XPUA 1FSEA 5LFAA 1A35A 2K02A 2IEKA 3AG4H 4FE7A 3ZXSA 1SFUA 2ZXWH 3W2AA 1T33A 3K2ZA 3WE2A 1A6IA 4KISA 2BBYA 3ZOBA 5ILVA 1FOKA 5GPCA 2OU2A 4YFNF 3OYIA 4ENNA 3HUGB 3JREA 3EUHC 1H9TA 2P0WA 4DYQA 1ZARA 5EZHA 2ISYA 2Y2ZA 3WTSC 4Y17A 2QKMB 2JRTA 1LFBA 1J09A 1TT0A 4II2A 5HS7A 3WTVC 4NUBA 4RM3A 3VYTB 2G7UA 2QKLB 2NVQJ 1Y0NA 4RAGA 4RGSA 5E18F 4ENJA 1NTCA 4IVNA 1IXSB 2QCOA 1T2KA 3IHUA 3L2QA 1REPC 2IXSA 1TNSA 2VQLA 3C2BA 2EIJH 1Y6IA 1JKOC 2L9NA 2A5YB 1IW7F 4A3EJ 3BR0A 1H0MA 1T95A 3OSGA 4ANJA 1H9GA 1H8AC 4A93J 1B9NA 1IG7A 2WC2A 1BM9A 3PFYA 3HUGA 4MQVA 5GPAA 1F4KA 3CDHA 3SEZA 3R0AA 2JQ7A 1SD4A 2DDBA 3EDPA 1YS6A 3ZP5A 3W6VA 4MTDA 1SVLA 2X4HA 3ASOH 2DA6A 1TW3A 2P5KA 1L3LA 3TW6A 4UHTA 4K2EA 1NK2P 1CGPA 3BDDA 4CHUA 1S7AA 2F5EA 2HQAA 3Q3SA 1T56A 1D8JA 4UVBA 1P4AA 2BYVE 2KP6A 3RKXA 4IHVA 2FQ4A 4WCGA 5M5WJ 2IA0A 5JHUA 2OBPA 2ADUA 4FT8A 3CUQB 5JR3A 3OYMA 1LFPA 3LA7A 3MEXA 5F0HA 3OY9A 3DLAA 2KIFA 2Z1DA 2YU9J 4BE0A 2FE3A 4E6KG 3U1KA 1O7LA 3LOCA 1LB2A 5K5QA 5K5OA 3MZYA 2HYGD 1O3QA 1XGOA 2M5WA 4PJ0C 2DA7A 2V1DA 3CC7I 3QP5A 1FZPB 2NNYA 5B5EC 2VBWA 3F22A 3ONQA 2GLOA 5F1JA 5TRDA 1BC7C 1EJ9A 2K7LA 1ZG3A 5H2FC 1PJRA 3M8EA 3J7AY 2D1VA 4FISA 2P8TA 3BG6A 1XTAA 1CF7A 2V6CA 3OR2C 4LD5A 1PUFB 3I4NJ 4AUXA 3PNVA 4D7MA 2QLZA 3C18A 1HLVA 4LB6B 2LC2A 2VT3A 3GTKJ 4NBQA 2VIXA 3DBLB 4KIGA 4EM0B 2H09A 4KITB 3BTJA 2DDAA 2X0LA 2DOFA 1JKQC 1ZYRF 3TO7A 1DUXC 1KU7A 2EFOA 5L3BA 3L7WA 2O61A 2ELJA 3OL3A 2MABA 1JGSA 1FOWA 2XAHA 3P9IA 4AVPA 3CCEI 1EH6A 3GFLA 1YW9A 3BJOA 3LSMA 2GIZA 3WE3A 2F6CA 3DWLE 4CSWA 5J8FA 1RR8C 4UUTA 3KLNA 3ZQGA 4OMYA 1UJ8A 1U8BA 1MDMA 1KYWA 4W1UA 2R7XA 3OYAA 3RJPA 3IV5A 2CH0A 5H6RA 2BE5F 4JK1X 1S5LC 2LMDA 3KIOA 5GADJ 1Y8QB 3BG3A 2Y0MA 2HDWA 3K2AA 4MFDA 2P7VB 2RNJA 3CDLA 3M8FA 2O3FA 1W0TA 1UHWA 2R7WA 1VFCA 2F5VA 3NARA 4CZCA 4D9JA 1FMWA 1TWCJ 1KA8A 2KT0A 2R7UA 2F5CA 4EVIA 2X6YA 3FMRA 5ICCA 1ULYA 1IN7A 1B72B 4XKBA 1IN8A 3DEUA 1R49A 2DPDA 2AHQA 4RAZA 1R5GA 4BACA 1ON1A 2A6HF 2PMZA 4MEYF 2ZXHA 3S14J 1OKRA 3I5UA 2M2EA 3LMMA 2O0YA 4A0YA 1U5TB 4BNCA 3GTOJ 2FA5A 2V79A 4NB5A 1IN5A 3TEDA 1Y0UA 4Y33A 5A2QK 3S15J 3N05A 1IF1A 1FIAA 3IRQA 2D1HA 1VF9A 5FKKA 2LR8A 1FIPA 3E6MA 4ON0A 2L7ZA 3ZCOA 4BBRJ 4RGXA 4PK4A 4KA4A 1OR7A 3HBLA 2V9PA 5L3GA 2EFQA 2FBIA 2FMYA 4FX0A 2IA1A 2YU3A 4IHSA 2DBBA 3L1PA 1R5ID 3WG7H 2MW8A 2DA3A 1R58A 2YS9A 2X48A 3EUKL 3K6GA 4RAYA 4MLOA 3NWTA 4MQ9F 4AD9A 3BZCA 3FWEA 4I0BA 3KETA 4G7OF 4HV6A 2VT2A 1LPQA 4U0WA 5DDGA 5JVTA 3CCYA 4Z6YA 5FD5A 1RESA 4ZJZA 3FX3A 3ELKA 5J4VA 1B9MA 2CFXA 4JP0A 3CUQC 4BKXA 2NVYJ 5FLXZ 2Z2SB 2NYXA 1G4DA 3HEFA 2I8DA 3FBIB 4YEJA 3ZQ7A 4CYDA 3S1QJ 5D6EA 3GX4X 5EG0B 4E7LA 1GVDA 5F27A 1W1WE 4XRSG 2DN0A 2E60A 2HDCA 4FE4A 4XRMA 2IS4A 1WJCA 3FXOA 1YITI 2W84A 5C44J 1TTYA 2RKHA 2ZJQF 5HNFA 4KJZA 2QUFA 3SZPA 3W2VA 3MKLA 1USSA 2P6TA 4PGGA 3WGHA 3K70C 2VPRA 1T6SA 5GAGJ 3OOPA 1XN7A 2XGDA 1VQ7I 1S8NA 4P96A 1J7KA 3VSKA 4U7DA 1SD7A 2CW8A 1HKQA 1IUFA 2FSWA 3CP2A 3QPSA 1J5YA 2R4GA 2VUMJ 1HSJA 2WBMA 5FKNA 1TW2A 4CYCB 2GWRA 4Y7NJ 1B6AA 4HV5A 3Q0UA 4GCVA 1BC8C 5DEQA 1QZEA 2ESHA 1HW2A 2DFFA 4CCNA 3BZ6A 3G2BA 1YO5C 1LKXA 4I98B 3OYNA 3TP0A 4OIPF 4OOIA 2CV2A 2DQLA 3VODA 4ZYEA 2KIUA 3IAS2 2E5NA 4ZZLA 2AQEA 2WV0A 4C9YA 2OCCH 4ETSA 4ZTJA 4EJTA 4AIJA 2K5CA 4YELA 2KIQA 1Y1VJ 2CUZA 2HNHA 2KHMA 2PMZN 5GAEJ 2ELHA 2R0QC 4AIKA 1ZREA 4IHWA 5IOYA 4HA8A 2L9RA 5ERIA 3CF5F 4A3DJ 3VSLA 4HNUA 3PM1A 2HEOA 1AA7A 3HRMA 1ITYA 4I7HA 4FTHA 2Y0SA 1IC8A 1LUJB 2A68F 1OYYA 3BROA 3I59B 2MD0A 5GTHC 2B9SA 1W5TA 2DT5A 4M3GA 4CCMA 4CCJA 3E6CC 2KJCA 4IRHA 4V2FA 3IL2A 1JJ8C 2QBYA 1LE8B 1BIBA 3TOBA 3K1PA 4NQWB 2MSYA 1H89C 2BXYA 1Y1WJ 5FRNA 2UV1A 2ISZA 3I4MJ 4B43A 1ZRFA 3TO6A 4CDGA 2LY2A 3J81Z 1Z77A 1U3EM 4YIIA 1BN5A 4G6QA 3KPHA 1PYVA 2MA3A 5LBQA 4KDPA 3BY6A 3OYCA 2LNBA 4LLGF 3ZR8X 4BQAA 4A3BJ 2OCEA 2CWEA 4EGYA 4X1EA 2JSCA 2VB6A 5D5WB 1DPUA 2DA2A 2DLLA 3KP7A 3GTPJ 1F5TA 1IJWC 2NS8A 3D5LA 4D0PA 4B3AA 2E34A 2JZYA 2LFBA 2E2IJ 4H4KC 2HPMA 5K5RA 4I99C 4PJNA 3BLYA 3AKZA 2CMPA 4RS8A 2IRFG 1WJ5A 2E2HJ 5J1YA 2XF6A 3FXQA 4C2MJ 1ETXA 1XMAA 5HNHA 1RI7A 2VC1A 2E1OA 4ZDOA 4NQWA 4RB3C 3RZDJ 3AG1H 1R1UA 2X9DA 4KN7X 4KFCA 2HYFA 3R60A 1SFXA 4ZYDA 5BNGA 1IGNA 3DPLC 5EZGA 1VQ8I 3FM3A
chains in the Genus database with same CATH topology
4I09A 5IT9Z 5EEGA 5J8CA 2ZNYA 4L9VA 2XVCA 4PDKA 3QP6A 5ICGA 4RGRA 1FC3A 5FGMA 4N9IA 2QVOA 2Z99A 1YTYA 2EFNA 3F21A 2STWA 3HRSA 3TGNA 4G9YA 3T8TA 4ZH4F 4RB2C 4OIRF 3C7JA 2XUBA 2Z9OA 3HSRA 2R3SA 2HR3A 2VBXA 3ECOA 3DP7A 1MJBA 2EFPA 1WI9A 2ZFWA 2FRHA 4IF4A 1L0OC 1IZ1A 4G6DA 3WU1B 1TQIA 1P4XA 4M6YA 4YIFA 1ZLKA 2KKOA 1HW1A 1YS7A 2MH2A 1Q1HA 1FYLA 2NAZA 4Z2YA 1IXCA 5LHGA 3V8LA 3KP3A 1JHHA 4HX8A 3QU3A 4G7ZF 2HOEA 4F7ZA 3DV8A 2HTSA 3ZMTA 3R4KA 1I1GA 3E5UA 1FX7A 4YFXF 2TDXA 1D3YA 4MGRA 5HS9A 5HLHA 2CG4A 4OIOF 3MQ0A 3QOPA 4BHBA 1XSVA 4ENKA 4AWXB 1V3FA 1IN6A 1IAWA 3IWZA 2Y75A 4I0AA 1TLHB 3EUHA 4Q48A 2HQNA 1YLFA 2QQ9A 3IKVA 3HYIA 2UWMA 2DI3A 4KMUX 3WG9A 2DTRA 1ZRDA 4KN4X 2NS0A 4WXHA 5E1ZB 4PGHA 4GYIA 1NHAA 4M74A 2FMLA 4B8XA 3DF8A 2FBHA 2XRNA 1B4AA 5DUIA 4KT5C 2PN6A 4NHJA 4ASNA 1SMYF 4E70A 3JAMK 4PZJA 1P2FA 2XGXA 1R22A 5EEHA 5D5XB 4LFUA 4I2OA 1FT9A 2F2EA 2HZTA 1P92A 3ZMVA 5LGUA 2F5FA 2OZ6A 4YFKF 2GAUA 3I71A 2FF4A 5D4SA 5HOOA 1F9NA 2CW0F 4S04A 3ABUA 1JXSA 3MAJA 3WTXC 3I54A 2YX4A 3F8NA 5H20A 3TKYA 1G3YA 5LRRA 4UV9A 4UVCA 3V8KA 3U1DA 3TDZC 3KP2A 4A12A 5BMZA 4KIBA 3V7SA 1S7OA 3B73A 5LHHA 2D45A 1O7FA 3MWMA 2XAFA 2EV0A 4HAMA 3JTHA 1R1VA 1UHMA 3RI4A 4QWQA 3LA3A 1ZHFA 2EV5A 2Q8KA 2V1XA 2DK8A 4MEXF 4XLNF 3DQVC 2XIGA 1LDJA 1LNWA 4JQFA 2E1CA 5F6FA 4KIFA 2VOPA 4ZZDA 4L0ZB 2QZ8A 4BHPA 2IA2A 3F6OA 3WODF 1O57A 1ZRCA 5E8IA 1D5VA 1RIOH 2RVCA 2H94A 5KVRA 5E1WA 1UFMA 1XB4A 2W85A 2W57A 4GGGA 3P9KA 2Z5UA 3N97A 1MGTA 1R23A 3QAHA 3ZPLA 3EETA 3PQJA 2PMHA 2DU9A 5D5UB 1J59A 1W7PD 4M9SA 5D4RA 4HOBA 3JSOA 3V7RA 2EV6A 2WWYA 5L3EA 3BJAA 2LDUA 1K78B 3CUQA 3C1DA 4Q47A 1TBXA 2H6CA 3CO7C 3SXYA 2OD5A 1WQ2A 4UVAA 4M73A 2P5LC 1GVJA 5LGTA 5K1YA 4KUMA 1KGSA 1WKMA 2FEZA 1YQAA 1O3TA 4EJUA 1T39A 4HYEA 2PMUA 4A0ZA 1ZGJA 1SFEA 3QPTA 1FPQA 3TO9A 2GA2A 4U0VA 1FP1D 3FXRA 3I0TA 2XHKA 1UB9A 3BOQA 3VEPA 4ZYHA 2OQRA 4M6XA 2IT0A 1Z91A 1Z1DA 4HQEA 3QPHA 1KQ9A 1XDUA 1W7PB 3K0LA 3HOTA 4OMZA 5JFRA 3IKTA 1PP8F 3KZYA 4L9NA 1SAXA 1KYZA 1Z05A 3F8BA 4ESJA 1FBUA 2FXAA 3ROUA 4OIQF 2CSOA 1HSTA 3CTAA 4LG0B 1KQ0A 1E17A 3E97A 5BQTA 3F72A 2A3SA 1YG2A 1J9IA 2HQRA 3H3UA 3HTUA 2ZKZA 1LDKB 1DDNA 4O3MA 2VODA 5LRSA 1U5TA 3LQQA 3JSPA 4A2UA 3J7AO 1AWCA 3BPXA 2EB7A 3LA2A 3VOEA 1MKMA 4HX7A 5BOXA 3FHZA 5LEJA 4EJWA 4Y15A 5A2QZ 4MNUA 1FBSA 2FBKA 4JBAA 2O8XA 5FFXA 1ZGAA 3BWGA 3C3WA 2BGCA 4FHTA 4EV0A 4IXAA 1BIAA 5ILSA 3JW4A 3COAC 2EFWA 4P55A 4HDVA 2ETHA 5TJJA 4I01A 3GF2A 2FNAA 4EQQA 2M45A 4R79A 3ZMDA 4BXUA 5CJ9A 1U78A 1RUNA 2IJLA 1KU9A 3QRFF 4M9ZA 2VOOA 1F1ZA 2L54A 1XSXA 1FBQA 5ED4A 1LVAA 1AOYA 5CLSA 2VBZA 3KE2A 1QBJA 1PDNC 2CYYA 1ONVA 5D8LB 5HVQC 4EM2A 1I27A 2DAOA 3HOSA 3ABTA 1G3SA 1XCBA 1G3WA 1FLIA 3I59A 2R7DA 4KICA 2QWWA 1LEAA 3D0SA 3HHHA 3MZHA 1BI2A 4FX4A 2STTA 4HF2A 1ODDA 3WGIA 1TQPA 3ML6A 4EM1A 2C6YA 1A04A 3F3XA 5E20A 1R1TA 3NRVA 5E17F 5DCMB 5LLQA 4G94A 2RV8A 1MJAA 1YW8A 2QENA 3M7GA 2M8EA 3SQNA 3B02A 2E7WA 1HKTA 3IWFA 3J80K 1XMKA 4BAYA 3P7NA 4H0EA 5L3FA 3KP6A 3I4PA 4HBLA 4S05A 1XGNA 3F6VA 3AAFA 1KQ8A 2DW4A 1LDDA 4LGWA 2UZKA 5AIQA 1XCVA 4L5JA 4WXCA 1HKSA 2IPQX 5JI6A 4I02A 2Z33A 3L00A 2L4MA 3GW2A 2PBIA 3TDUC 5F64A 3CLOA 2V9VA 2Q0OA 3CUOA 2RGVA 2MLKA 2NNNA 3F8FA 4B09A 3ZMZA 3E5QA 3HSFA 2NRAC 2XAGA 4L0YB 2QYOA 3LAJA 3J80Z 3CJNA 2ZMEB 2JT1A 4WF2A 1YIOA 2QQAA 2XAJA 1WSUA 5CVUA 4KNYA 1P4WA 4IJAA 1IXRC 1FNNA 2QQBA 1XSDA 4LK0F 1DPRA 3I53A 3BP8A 2O6GE 2HFHA 2RN7A 1KU3A 4P5OA 3V8JA 1LJ9A 1QPMA 3H92A 5HDNA 4RB0A 2VXZA 4LK1F 2M87A 1QQIA 1W4MA 2ZMEA 2UXXA 3LAPA 2PJPA 1IUYA 2XKPA 3SHFA 3MCZA 5DCFA 2YSRA 5DD8A 1KU2A 4KYWA 4HDUA 2GXGA 3TQNA 3FZVA 2DK5A 2XROA 4HX4A 1D8KA 2GIVA 2L4AA 3M1EA 3V4GA 1TQMA 1OPCA 2ZJ2A 5ICFA 1ON2A 3RDIA 2XKOA 2XV4S 5HS8A 1O3SA 2ZXJA 3IRRA 1MD0A 1RZ4A 3KP5A 2YR2A 1G6NA 5AIPA 3MFKA 3P9CA 3GFIA 4MTEA 5ILUA 2UXNA 3S2WA 1ZH5A 1K79A 5LHIA 2JPBA 5H6QA 1LQ1A 3M9AA 5DUKA 2OQGA 1GXPA 3GZ5A 4HZFA 3JAMZ 2L01A 1W5SA 3R61A 4XLPF 3K9TA 2IP2A 5F1RA 1IN4A 4ENMA 4L9JA 1ZG1A 5BPIA 3KFWX 2ZCWA 2PFBA 4AIHA 1BI0A 2PQ8A 2J5PA 4CICA 3HIFA 1U6GA 2LF8A 1QZZA 4ESBA 4IRGA 3LQRA 1R5HA 1JHFA 1Z6TA 2LSOA 5HLGA 3VFZA 1OYIA 5FO5A 5CVJA 2EJRA 1SD6A 1HXDA 4HF0A 3EYIA 3LFKA 2JPCA 1OYWA 2EK5A 5D8KB 5FB2A 2OAZA 4L5IA 2PEXA 4LLNA 4G7HF 1CF7B 2HKOA 2XASA 3T1BA 3I58A 2H27A 1DP7P 3O6BB 2A61A 4DNCA 4P9UA 4EJOA 1WRJA 3Q9VA 1I1SA 4R1HA 2ESNA 2O03A 3RPUA 4IRIA 3KP4A 2ZO4A 4YG2F 2IW5A 1MDMB 2VBYA 3FMQA 2K4JA 3Q5FA 2AS5F 3WTZA 1UCRA 1K7AA 2RC4A 1U8RA 1S3JA 2E7XA 3K1NA 1T0FA 4HQMA 2RQPA 5E8GA 3VB2A 1FWZA 2GA1A 2R7FA 1ZLJA 1Z7UA 3KZZA 3F8CA 3ZN0A 3G73A 3T0YA 5BPDA 3EYYA 1K78A 3BPVA 4UXNA 4XSZF 1B59A 1FYMA 3RKYA 1BOAA 3GUDA 1FYKA 1Z6RA 5HDGA 1EH8A 3SFZA 2DQRA 2HGCA 2K27A 3ZMUA 2BV6A 3WTYC 2LKPA 3Q9SA 5FLXK 5J6XA 2MD5A 2EWNA 2MC3A 2MH9A 3E6DA 3RTRA 1SMTA 1S6LA 1PP7U 3U2RA 2F5DA 6PAXA 2MLGA 1K6OA 2VE9A 1R7JA 1V4RA 4KMFA 2KIMA 1W7PA 4HLXA 2QM3A 4IPAA 1C0WA 2L3DA 4HF1A 3CO6C 5LEKA 2PLYA 5HLIA 4Q5SF 4HW0A 2GXBA 3KCCA 4IHTA 5HDKA 4MHGA 2G9WA 3JTGA 3BJ6A 5ICEA 2ZNZA 4LG0A 1STZA 2GQQA 4A6DA 1BJAA 3GLXA 2WTEA 3LSTA 5AONA 4RGUA 1YFHA 2DFIA 5LGNA 5IT3A 3DXJF 5D6FA 2EA4A 3KEOA 1Z9CA 3IC7A 4XSXF 1USTA 5KK1A 4M72A 3FMSA 4ZYGA 2K4BA 2E1NA 2P6SA 4GO1A 3NQOA 3J81K 3WTUC 2FQ3A 2XAQA 3KEQA 1IRGA 4HLYA 1FSHA 2ZBKA 3TOAA 3ERED 3RIRA 2M1BA 1T98A 3U9GA 2QBYB 3H3ZA 3DPTA 1BBYA 3V7CA 3W6JB 3EQLF 2LF7A 3T5XA 4XRFA 1IRFA 1HW5A 1R36A 4U0YA 1EH7A 4G8XA 2OZUA 2ACJA 3ZMSA 5IT9K 3T8RA 3DKWA 3HRUA 1YYVA 2VE8A 3L9FA 5BS6A 1SD5A 3R0JA 4OU0A 3GFJA 3SZTA 4U88A 3QU6A 2PI0A 4CGZA 2A07F 4EMSA 2V1UA 1U5TC 1RNLA 4ESFA 1QNTA 3PQKA 3GXOA 1X3UA 5DYMA 4XBFA 2RDPA 4BHCA 3O2PE 4O6JA 3GZ6A 3REOA 2A69F 2P5VA 2MBFA 4LLLA 2YX7A 3HHGA 2CO5A 4Q4ZF 3FF5A 2A6EF 3GO5A 3GWZA 1J75A 2L02A 1S29A 1ZAOA 1QO0D 2EA2A 3GEZA 4PCQA 4WXDA 4EGZA 2HKXA 4UNOA 1T38A 2FU4A 4OINF 4WX9A 3GYHX 2DO7A 3ZN1A 1U2WA 1XGMA 3R6SA 5DCMA 1QGPA 1TNTA 3PFIA 3F8MA 4M9XA 1E2XA 4BYYA 3FM5A 4BH9A 3HRTA 2B0LA 4LMYA 1EV7A 2HS5A 1BI3A 1O3RA 2FNPA 4A0XA 4WWCA 2P4WA 1MZBA 1XGSA 5CVRA 2J5OA 4DQ2A 4P9FA 1XDSA 4A6EA 3O3KA 1FY7A 1G3TA 5D5VB 1P6RA 5E1XA 3I64A 1XD7A 2Q2EA 2OA4A 5CVVA 4TV7A 1FP2A 1VTNC 4UUVA 3HTSB 2YPRA 3WU0A 3E5XA 4R8HA 2DPUA 2Y48A 5L3CA 4M71A 3RPQA 3RYPA 4UV8A 1GXQA 2KRFA 4CZZA 1J0RA 1ZN2A 3RKWA 1JE8A 1I6XA 2COMA 2BEOA 4WK8F 1LEBA 3OV8A 4GXOA 5L3DA 1RUOA 3K69A 3E3VA 1R00A 2P7CB 3W6KB 2HWVA 3DFGA 3ECHA 5FD6A 3NEUA 2AXLA 2D2WA 2W24A 3L09A 4Y13A 2VN2A 2JTVA 3N4MA 4A5NA 2M30A 2CQKA 1ZG5A 3GVAA 5DV5A 4L9TA 2K86A 3ULQB 4CXFA 3WTTC 2KJBA 1YW7A 2Z3YA 3K1MA 3WTWC 1HQCA 4QLCU 3HSEA 1BI1A 1J2XA 3GFMA 2VONA 4GYGA 2IVMA 4LJZF 4LB5A 5FFZA 3G3ZA 4CO8A 3L2CA 4O5VA 3F23A 2H6BA 3WGGA 2VC0A 5DD4A 3E6BA 2FOKA 4N9HA 2HTJA 2W25A 2G7HA 1OMIA 4A5MA 2GZWA 5CVIA 1QZYA 1GHCA 1HBXG 1MJ9A 4U7BA 2PG4A 1B1BA 3LWFA 4N0BA 5CYVA 4L18B 3KLOA 4EJVA 3ISPA 1I5ZA 1WWXA 3FXUA 4RB1A 3RYRA 1PUEE 2CGPA 1FSEA 2K02A 1SFUA 3K2ZA 3WE2A 2BBYA 5ILVA 1FOKA 2OU2A 4YFNF 4ENNA 1H9TA 1ZARA 2ISYA 3WTSC 4Y17A 2JRTA 5HS7A 3WTVC 2G7UA 4RGSA 5E18F 4ENJA 4IVNA 1T2KA 1IXSB 3IHUA 1REPC 1TNSA 2A5YB 1IW7F 1H0MA 1H9GA 1B9NA 2WC2A 1BM9A 3HUGA 4MQVA 1F4KA 3CDHA 3R0AA 1SD4A 3EDPA 1YS6A 3ZP5A 4MTDA 2X4HA 1TW3A 2P5KA 1L3LA 4UHTA 4K2EA 1CGPA 3BDDA 4CHUA 1S7AA 2F5EA 1D8JA 4UVBA 1P4AA 2BYVE 3RKXA 4WCGA 2IA0A 5JHUA 2OBPA 2ADUA 4FT8A 3CUQB 5JR3A 3LA7A 3MEXA 2KIFA 2FE3A 1O7LA 1LB2A 5K5QA 5K5OA 3MZYA 2HYGD 1O3QA 1XGOA 2M5WA 2V1DA 3QP5A 1FZPB 2NNYA 2VBWA 3F22A 5TRDA 1BC7C 2K7LA 1ZG3A 3M8EA 2D1VA 2P8TA 1CF7A 2V6CA 4LD5A 2QLZA 3C18A 4LB6B 2VT3A 4KIGA 4EM0B 2H09A 2X0LA 1ZYRF 3TO7A 1DUXC 1KU7A 2EFOA 5L3BA 3L7WA 2O61A 1JGSA 3P9IA 2XAHA 4AVPA 1EH6A 3GFLA 1YW9A 3BJOA 3WE3A 5J8FA 3KLNA 4OMYA 1MDMA 1KYWA 3RJPA 5H6RA 2BE5F 4JK1X 2Y0MA 2P7VB 2RNJA 3M8FA 2O3FA 1UHWA 1KA8A 2F5CA 4EVIA 3FMRA 5ICCA 1ULYA 1IN7A 1IN8A 3DEUA 2DPDA 4RAZA 1R5GA 1ON1A 2A6HF 4MEYF 1OKRA 3I5UA 4A0YA 2O0YA 4BNCA 1U5TB 2FA5A 2V79A 4NB5A 1IN5A 1Y0UA 5A2QK 1IF1A 3IRQA 2D1HA 3E6MA 4ON0A 4RGXA 4KA4A 1OR7A 5L3GA 2EFQA 2FBIA 2FMYA 4FX0A 2IA1A 2YU3A 4IHSA 2DBBA 1R58A 4RAYA 4MQ9F 4AD9A 3FWEA 4I0BA 3KETA 4G7OF 4HV6A 2VT2A 4U0WA 5DDGA 5JVTA 5FD5A 3FX3A 3ELKA 1B9MA 2CFXA 3CUQC 5FLXZ 2NYXA 3ZQ7A 4CYDA 5D6EA 3GX4X 2HDCA 2W84A 1TTYA 2RKHA 2QUFA 3SZPA 1USSA 2P6TA 4PGGA 3WGHA 1T6SA 3OOPA 1XN7A 1S8NA 4P96A 1J7KA 4U7DA 1SD7A 1HKQA 2FSWA 1J5YA 1HSJA 1TW2A 2GWRA 1B6AA 4HV5A 4GCVA 1BC8C 5DEQA 2ESHA 1HW2A 3BZ6A 1YO5C 4I98B 4OIPF 4OOIA 2DQLA 3VODA 4ZYEA 2KIUA 4ZZLA 2WV0A 4ETSA 4EJTA 4AIJA 1G4DA 4AIKA 2ELHA 1ZREA 4HA8A 5ERIA 2HEOA 3HRMA 4I7HA 2A68F 1OYYA 3BROA 3I59B 1W5TA 2DT5A 3E6CC 2KJCA 4IRHA 3IL2A 2QBYA 1BIBA 3TOBA 3K1PA 2ISZA 1ZRFA 3TO6A 4CDGA 3J81Z 1U3EM 4YIIA 1BN5A 4G6QA 2MA3A 5LBQA 4KDPA 3BY6A 2LNBA 4LLGF 4BQAA 2CWEA 4EGYA 2JSCA 5D5WB 1DPUA 2DLLA 3KP7A 1F5TA 3D5LA 4D0PA 2JZYA 5K5RA 4RS8A 2IRFG 3FXQA 1XMAA 1RI7A 2VC1A 4NQWA 4RB3C 1R1UA 4KN7X 4KFCA 2HYFA 3R60A 1SFXA 4ZYDA 3DPLC 3FM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I09 A;  5IT9 Z;  5EEG A;  5J8C A;  2ZNY A;  4L9V A;  2XVC A;  4PDK A;  3QP6 A;  5ICG A;  4RGR A;  1FC3 A;  5FGM A;  4N9I A;  2QVO A;  2Z99 A;  1YTY A;  2EFN A;  3F21 A;  2STW A;  3HRS A;  3TGN A;  4G9Y A;  3T8T A;  4ZH4 F;  4RB2 C;  4OIR F;  3C7J A;  2XUB A;  2Z9O A;  3HSR A;  2R3S A;  2HR3 A;  2VBX A;  3ECO A;  3DP7 A;  1MJB A;  2EFP A;  1WI9 A;  2ZFW A;  2FRH A;  4IF4 A;  1L0O C;  1IZ1 A;  4G6D A;  3WU1 B;  1TQI A;  1P4X A;  4M6Y A;  4YIF A;  1ZLK A;  2KKO A;  1HW1 A;  1YS7 A;  2MH2 A;  1Q1H A;  1FYL A;  2NAZ A;  4Z2Y A;  1IXC A;  5LHG A;  3V8L A;  3KP3 A;  1JHH A;  4HX8 A;  3QU3 A;  4G7Z F;  2HOE A;  4F7Z A;  3DV8 A;  2HTS A;  3ZMT A;  3R4K A;  1I1G A;  3E5U A;  1FX7 A;  4YFX F;  2TDX A;  1D3Y A;  4MGR A;  5HS9 A;  5HLH A;  2CG4 A;  4OIO F;  3MQ0 A;  3QOP A;  4BHB A;  1XSV A;  4ENK A;  4AWX B;  1V3F A;  1IN6 A;  1IAW A;  3IWZ A;  2Y75 A;  4I0A A;  1TLH B;  3EUH A;  4Q48 A;  2HQN A;  1YLF A;  2QQ9 A;  3IKV A;  3HYI A;  2UWM A;  2DI3 A;  4KMU X;  3WG9 A;  2DTR A;  1ZRD A;  4KN4 X;  2NS0 A;  4WXH A;  5E1Z B;  4PGH A;  4GYI A;  1NHA A;  4M74 A;  2FML A;  4B8X A;  3DF8 A;  2FBH A;  2XRN A;  1B4A A;  5DUI A;  4KT5 C;  2PN6 A;  4NHJ A;  4ASN A;  1SMY F;  4E70 A;  3JAM K;  4PZJ A;  1P2F A;  2XGX A;  1R22 A;  5EEH A;  5D5X B;  4LFU A;  4I2O A;  1FT9 A;  2F2E A;  2HZT A;  1P92 A;  3ZMV A;  5LGU A;  2F5F A;  2OZ6 A;  4YFK F;  2GAU A;  3I71 A;  2FF4 A;  5D4S A;  5HOO A;  1F9N A;  2CW0 F;  4S04 A;  3ABU A;  1JXS A;  3MAJ A;  3WTX C;  3I54 A;  2YX4 A;  3F8N A;  5H20 A;  3TKY A;  1G3Y A;  5LRR A;  4UV9 A;  4UVC A;  3V8K A;  3U1D A;  3TDZ C;  3KP2 A;  4A12 A;  5BMZ A;  4KIB A;  3V7S A;  1S7O A;  3B73 A;  5LHH A;  2D45 A;  1O7F A;  3MWM A;  2XAF A;  2EV0 A;  4HAM A;  3JTH A;  1R1V A;  1UHM A;  3RI4 A;  4QWQ A;  3LA3 A;  1ZHF A;  2EV5 A;  2Q8K A;  2V1X A;  2DK8 A;  4MEX F;  4XLN F;  3DQV C;  2XIG A;  1LDJ A;  1LNW A;  4JQF A;  2E1C A;  5F6F A;  4KIF A;  2VOP A;  4ZZD A;  4L0Z B;  2QZ8 A;  4BHP A;  2IA2 A;  3F6O A;  3WOD F;  1O57 A;  1ZRC A;  5E8I A;  1D5V A;  1RIO H;  2RVC A;  2H94 A;  5KVR A;  5E1W A;  1UFM A;  1XB4 A;  2W85 A;  2W57 A;  4GGG A;  3P9K A;  2Z5U A;  3N97 A;  1MGT A;  1R23 A;  3QAH A;  3ZPL A;  3EET A;  3PQJ A;  2PMH A;  2DU9 A;  5D5U B;  1J59 A;  1W7P D;  4M9S A;  5D4R A;  4HOB A;  3JSO A;  3V7R A;  2EV6 A;  2WWY A;  5L3E A;  3BJA A;  2LDU A;  1K78 B;  3CUQ A;  3C1D A;  4Q47 A;  1TBX A;  2H6C A;  3CO7 C;  3SXY A;  2OD5 A;  1WQ2 A;  4UVA A;  4M73 A;  2P5L C;  1GVJ A;  5LGT A;  5K1Y A;  4KUM A;  1KGS A;  1WKM A;  2FEZ A;  1YQA A;  1O3T A;  4EJU A;  1T39 A;  4HYE A;  2PMU A;  4A0Z A;  1ZGJ A;  1SFE A;  3QPT A;  1FPQ A;  3TO9 A;  2GA2 A;  4U0V A;  1FP1 D;  3FXR A;  3I0T A;  2XHK A;  1UB9 A;  3BOQ A;  3VEP A;  4ZYH A;  2OQR A;  4M6X A;  2IT0 A;  1Z91 A;  1Z1D A;  4HQE A;  3QPH A;  1KQ9 A;  1XDU A;  1W7P B;  3K0L A;  3HOT A;  4OMZ A;  5JFR A;  3IKT A;  1PP8 F;  3KZY A;  4L9N A;  1SAX A;  1KYZ A;  1Z05 A;  3F8B A;  4ESJ A;  1FBU A;  2FXA A;  3ROU A;  4OIQ F;  2CSO A;  1HST A;  3CTA A;  4LG0 B;  1KQ0 A;  1E17 A;  3E97 A;  5BQT A;  3F72 A;  2A3S A;  1YG2 A;  1J9I A;  2HQR A;  3H3U A;  3HTU A;  2ZKZ A;  1LDK B;  1DDN A;  4O3M A;  2VOD A;  5LRS A;  1U5T A;  3LQQ A;  3JSP A;  4A2U A;  3J7A O;  1AWC A;  3BPX A;  2EB7 A;  3LA2 A;  3VOE A;  1MKM A;  4HX7 A;  5BOX A;  3FHZ A;  5LEJ A;  4EJW A;  4Y15 A;  5A2Q Z;  4MNU A;  1FBS A;  2FBK A;  4JBA A;  2O8X A;  5FFX A;  1ZGA A;  3BWG A;  3C3W A;  2BGC A;  4FHT A;  4EV0 A;  4IXA A;  1BIA A;  5ILS A;  3JW4 A;  3COA C;  2EFW A;  4P55 A;  4HDV A;  2ETH A;  5TJJ A;  4I01 A;  3GF2 A;  2FNA A;  4EQQ A;  2M45 A;  4R79 A;  3ZMD A;  4BXU A;  5CJ9 A;  1U78 A;  1RUN A;  2IJL A;  1KU9 A;  3QRF F;  4M9Z A;  2VOO A;  1F1Z A;  2L54 A;  1XSX A;  1FBQ A;  5ED4 A;  1LVA A;  1AOY A;  5CLS A;  2VBZ A;  3KE2 A;  1QBJ A;  1PDN C;  2CYY A;  1ONV A;  5D8L B;  5HVQ C;  4EM2 A;  1I27 A;  2DAO A;  3HOS A;  3ABT A;  1G3S A;  1XCB A;  1G3W A;  1FLI A;  3I59 A;  2R7D A;  4KIC A;  2QWW A;  1LEA A;  3D0S A;  3HHH A;  3MZH A;  1BI2 A;  4FX4 A;  2STT A;  4HF2 A;  1ODD A;  3WGI A;  1TQP A;  3ML6 A;  4EM1 A;  2C6Y A;  1A04 A;  3F3X A;  5E20 A;  1R1T A;  3NRV A;  5E17 F;  5DCM B;  5LLQ A;  4G94 A;  2RV8 A;  1MJA A;  1YW8 A;  2QEN A;  3M7G A;  2M8E A;  3SQN A;  3B02 A;  2E7W A;  1HKT A;  3IWF A;  3J80 K;  1XMK A;  4BAY A;  3P7N A;  4H0E A;  5L3F A;  3KP6 A;  3I4P A;  4HBL A;  4S05 A;  1XGN A;  3F6V A;  3AAF A;  1KQ8 A;  2DW4 A;  1LDD A;  4LGW A;  2UZK A;  5AIQ A;  1XCV A;  4L5J A;  4WXC A;  1HKS A;  2IPQ X;  5JI6 A;  4I02 A;  2Z33 A;  3L00 A;  2L4M A;  3GW2 A;  2PBI A;  3TDU C;  5F64 A;  3CLO A;  2V9V A;  2Q0O A;  3CUO A;  2RGV A;  2MLK A;  2NNN A;  3F8F A;  4B09 A;  3ZMZ A;  3E5Q A;  3HSF A;  2NRA C;  2XAG A;  4L0Y B;  2QYO A;  3LAJ A;  3J80 Z;  3CJN A;  2ZME B;  2JT1 A;  4WF2 A;  1YIO A;  2QQA A;  2XAJ A;  1WSU A;  5CVU A;  4KNY A;  1P4W A;  4IJA A;  1IXR C;  1FNN A;  2QQB A;  1XSD A;  4LK0 F;  1DPR A;  3I53 A;  3BP8 A;  2O6G E;  2HFH A;  2RN7 A;  1KU3 A;  4P5O A;  3V8J A;  1LJ9 A;  1QPM A;  3H92 A;  5HDN A;  4RB0 A;  2VXZ A;  4LK1 F;  2M87 A;  1QQI A;  1W4M A;  2ZME A;  2UXX A;  3LAP A;  2PJP A;  1IUY A;  2XKP A;  3SHF A;  3MCZ A;  5DCF A;  2YSR A;  5DD8 A;  1KU2 A;  4KYW A;  4HDU A;  2GXG A;  3TQN A;  3FZV A;  2DK5 A;  2XRO A;  4HX4 A;  1D8K A;  2GIV A;  2L4A A;  3M1E A;  3V4G A;  1TQM A;  1OPC A;  2ZJ2 A;  5ICF A;  1ON2 A;  3RDI A;  2XKO A;  2XV4 S;  5HS8 A;  1O3S A;  2ZXJ A;  3IRR A;  1MD0 A;  1RZ4 A;  3KP5 A;  2YR2 A;  1G6N A;  5AIP A;  3MFK A;  3P9C A;  3GFI A;  4MTE A;  5ILU A;  2UXN A;  3S2W A;  1ZH5 A;  1K79 A;  5LHI A;  2JPB A;  5H6Q A;  1LQ1 A;  3M9A A;  5DUK A;  2OQG A;  1GXP A;  3GZ5 A;  4HZF A;  3JAM Z;  2L01 A;  1W5S A;  3R61 A;  4XLP F;  3K9T A;  2IP2 A;  5F1R A;  1IN4 A;  4ENM A;  4L9J A;  1ZG1 A;  5BPI A;  3KFW X;  2ZCW A;  2PFB A;  4AIH A;  1BI0 A;  2PQ8 A;  2J5P A;  4CIC A;  3HIF A;  1U6G A;  2LF8 A;  1QZZ A;  4ESB A;  4IRG A;  3LQR A;  1R5H A;  1JHF A;  1Z6T A;  2LSO A;  5HLG A;  3VFZ A;  1OYI A;  5FO5 A;  5CVJ A;  2EJR A;  1SD6 A;  1HXD A;  4HF0 A;  3EYI A;  3LFK A;  2JPC A;  1OYW A;  2EK5 A;  5D8K B;  5FB2 A;  2OAZ A;  4L5I A;  2PEX A;  4LLN A;  4G7H F;  1CF7 B;  2HKO A;  2XAS A;  3T1B A;  3I58 A;  2H27 A;  1DP7 P;  3O6B B;  2A61 A;  4DNC A;  4P9U A;  4EJO A;  1WRJ A;  3Q9V A;  1I1S A;  4R1H A;  2ESN A;  2O03 A;  3RPU A;  4IRI A;  3KP4 A;  2ZO4 A;  4YG2 F;  2IW5 A;  1MDM B;  2VBY A;  3FMQ A;  2K4J A;  3Q5F A;  2AS5 F;  3WTZ A;  1UCR A;  1K7A A;  2RC4 A;  1U8R A;  1S3J A;  2E7X A;  3K1N A;  1T0F A;  4HQM A;  2RQP A;  5E8G A;  3VB2 A;  1FWZ A;  2GA1 A;  2R7F A;  1ZLJ A;  1Z7U A;  3KZZ A;  3F8C A;  3ZN0 A;  3G73 A;  3T0Y A;  5BPD A;  3EYY A;  1K78 A;  3BPV A;  4UXN A;  4XSZ F;  1B59 A;  1FYM A;  3RKY A;  1BOA A;  3GUD A;  1FYK A;  1Z6R A;  5HDG A;  1EH8 A;  3SFZ A;  2DQR A;  2HGC A;  2K27 A;  3ZMU A;  2BV6 A;  3WTY C;  2LKP A;  3Q9S A;  5FLX K;  5J6X A;  2MD5 A;  2EWN A;  2MC3 A;  2MH9 A;  3E6D A;  3RTR A;  1SMT A;  1S6L A;  1PP7 U;  3U2R A;  2F5D A;  6PAX A;  2MLG A;  1K6O A;  2VE9 A;  1R7J A;  1V4R A;  4KMF A;  2KIM A;  1W7P A;  4HLX A;  2QM3 A;  4IPA A;  1C0W A;  2L3D A;  4HF1 A;  3CO6 C;  5LEK A;  2PLY A;  5HLI A;  4Q5S F;  4HW0 A;  2GXB A;  3KCC A;  4IHT A;  5HDK A;  4MHG A;  2G9W A;  3JTG A;  3BJ6 A;  5ICE A;  2ZNZ A;  4LG0 A;  1STZ A;  2GQQ A;  4A6D A;  1BJA A;  3GLX A;  2WTE A;  3LST A;  5AON A;  4RGU A;  1YFH A;  2DFI A;  5LGN A;  5IT3 A;  3DXJ F;  5D6F A;  2EA4 A;  3KEO A;  1Z9C A;  3IC7 A;  4XSX F;  1UST A;  5KK1 A;  4M72 A;  3FMS A;  4ZYG A;  2K4B A;  2E1N A;  2P6S A;  4GO1 A;  3NQO A;  3J81 K;  3WTU C;  2FQ3 A;  2XAQ A;  3KEQ A;  1IRG A;  4HLY A;  1FSH A;  2ZBK A;  3TOA A;  3ERE D;  3RIR A;  2M1B A;  1T98 A;  3U9G A;  2QBY B;  3H3Z A;  3DPT A;  1BBY A;  3V7C A;  3W6J B;  3EQL F;  2LF7 A;  3T5X A;  4XRF A;  1IRF A;  1HW5 A;  1R36 A;  4U0Y A;  1EH7 A;  4G8X A;  2OZU A;  2ACJ A;  3ZMS A;  5IT9 K;  3T8R A;  3DKW A;  3HRU A;  1YYV A;  2VE8 A;  3L9F A;  5BS6 A;  1SD5 A;  3R0J A;  4OU0 A;  3GFJ A;  3SZT A;  4U88 A;  3QU6 A;  2PI0 A;  4CGZ A;  2A07 F;  4EMS A;  2V1U A;  1U5T C;  1RNL A;  4ESF A;  1QNT A;  3PQK A;  3GXO A;  1X3U A;  5DYM A;  4XBF A;  2RDP A;  4BHC A;  3O2P E;  4O6J A;  3GZ6 A;  3REO A;  2A69 F;  2P5V A;  2MBF A;  4LLL A;  2YX7 A;  3HHG A;  2CO5 A;  4Q4Z F;  3FF5 A;  2A6E F;  3GO5 A;  3GWZ A;  1J75 A;  2L02 A;  1S29 A;  1ZAO A;  1QO0 D;  2EA2 A;  3GEZ A;  4PCQ A;  4WXD A;  4EGZ A;  2HKX A;  4UNO A;  1T38 A;  2FU4 A;  4OIN F;  4WX9 A;  3GYH X;  2DO7 A;  3ZN1 A;  1U2W A;  1XGM A;  3R6S A;  5DCM A;  1QGP A;  1TNT A;  3PFI A;  3F8M A;  4M9X A;  1E2X A;  4BYY A;  3FM5 A;  4BH9 A;  3HRT A;  2B0L A;  4LMY A;  1EV7 A;  2HS5 A;  1BI3 A;  1O3R A;  2FNP A;  4A0X A;  4WWC A;  2P4W A;  1MZB A;  1XGS A;  5CVR A;  2J5O A;  4DQ2 A;  4P9F A;  1XDS A;  4A6E A;  3O3K A;  1FY7 A;  1G3T A;  5D5V B;  1P6R A;  5E1X A;  3I64 A;  1XD7 A;  2Q2E A;  2OA4 A;  5CVV A;  4TV7 A;  1FP2 A;  1VTN C;  4UUV A;  3HTS B;  2YPR A;  3WU0 A;  3E5X A;  4R8H A;  2DPU A;  2Y48 A;  5L3C A;  4M71 A;  3RPQ A;  3RYP A;  4UV8 A;  1GXQ A;  2KRF A;  4CZZ A;  1J0R A;  1ZN2 A;  3RKW A;  1JE8 A;  1I6X A;  2COM A;  2BEO A;  4WK8 F;  1LEB A;  3OV8 A;  4GXO A;  5L3D A;  1RUO A;  3K69 A;  3E3V A;  1R00 A;  2P7C B;  3W6K B;  2HWV A;  3DFG A;  3ECH A;  5FD6 A;  3NEU A;  2AXL A;  2D2W A;  2W24 A;  3L09 A;  4Y13 A;  2VN2 A;  2JTV A;  3N4M A;  4A5N A;  2M30 A;  2CQK A;  1ZG5 A;  3GVA A;  5DV5 A;  4L9T A;  2K86 A;  3ULQ B;  4CXF A;  3WTT C;  2KJB A;  1YW7 A;  2Z3Y A;  3K1M A;  3WTW C;  1HQC A;  4QLC U;  3HSE A;  1BI1 A;  1J2X A;  3GFM A;  2VON A;  4GYG A;  2IVM A;  4LJZ F;  4LB5 A;  5FFZ A;  3G3Z A;  4CO8 A;  3L2C A;  4O5V A;  3F23 A;  2H6B A;  3WGG A;  2VC0 A;  5DD4 A;  3E6B A;  2FOK A;  4N9H A;  2HTJ A;  2W25 A;  2G7H A;  1OMI A;  4A5M A;  2GZW A;  5CVI A;  1QZY A;  1GHC A;  1HBX G;  1MJ9 A;  4U7B A;  2PG4 A;  1B1B A;  3LWF A;  4N0B A;  5CYV A;  4L18 B;  3KLO A;  4EJV A;  3ISP A;  1I5Z A;  1WWX A;  3FXU A;  4RB1 A;  3RYR A;  1PUE E;  2CGP A;  1FSE A;  2K02 A;  1SFU A;  3K2Z A;  3WE2 A;  2BBY A;  5ILV A;  1FOK A;  2OU2 A;  4YFN F;  4ENN A;  1H9T A;  1ZAR A;  2ISY A;  3WTS C;  4Y17 A;  2JRT A;  5HS7 A;  3WTV C;  2G7U A;  4RGS A;  5E18 F;  4ENJ A;  4IVN A;  1T2K A;  1IXS B;  3IHU A;  1REP C;  1TNS A;  2A5Y B;  1IW7 F;  1H0M A;  1H9G A;  1B9N A;  2WC2 A;  1BM9 A;  3HUG A;  4MQV A;  1F4K A;  3CDH A;  3R0A A;  1SD4 A;  3EDP A;  1YS6 A;  3ZP5 A;  4MTD A;  2X4H A;  1TW3 A;  2P5K A;  1L3L A;  4UHT A;  4K2E A;  1CGP A;  3BDD A;  4CHU A;  1S7A A;  2F5E A;  1D8J A;  4UVB A;  1P4A A;  2BYV E;  3RKX A;  4WCG A;  2IA0 A;  5JHU A;  2OBP A;  2ADU A;  4FT8 A;  3CUQ B;  5JR3 A;  3LA7 A;  3MEX A;  2KIF A;  2FE3 A;  1O7L A;  1LB2 A;  5K5Q A;  5K5O A;  3MZY A;  2HYG D;  1O3Q A;  1XGO A;  2M5W A;  2V1D A;  3QP5 A;  1FZP B;  2NNY A;  2VBW A;  3F22 A;  5TRD A;  1BC7 C;  2K7L A;  1ZG3 A;  3M8E A;  2D1V A;  2P8T A;  1CF7 A;  2V6C A;  4LD5 A;  2QLZ A;  3C18 A;  4LB6 B;  2VT3 A;  4KIG A;  4EM0 B;  2H09 A;  2X0L A;  1ZYR F;  3TO7 A;  1DUX C;  1KU7 A;  2EFO A;  5L3B A;  3L7W A;  2O61 A;  1JGS A;  3P9I A;  2XAH A;  4AVP A;  1EH6 A;  3GFL A;  1YW9 A;  3BJO A;  3WE3 A;  5J8F A;  3KLN A;  4OMY A;  1MDM A;  1KYW A;  3RJP A;  5H6R A;  2BE5 F;  4JK1 X;  2Y0M A;  2P7V B;  2RNJ A;  3M8F A;  2O3F A;  1UHW A;  1KA8 A;  2F5C A;  4EVI A;  3FMR A;  5ICC A;  1ULY A;  1IN7 A;  1IN8 A;  3DEU A;  2DPD A;  4RAZ A;  1R5G A;  1ON1 A;  2A6H F;  4MEY F;  1OKR A;  3I5U A;  4A0Y A;  2O0Y A;  4BNC A;  1U5T B;  2FA5 A;  2V79 A;  4NB5 A;  1IN5 A;  1Y0U A;  5A2Q K;  1IF1 A;  3IRQ A;  2D1H A;  3E6M A;  4ON0 A;  4RGX A;  4KA4 A;  1OR7 A;  5L3G A;  2EFQ A;  2FBI A;  2FMY A;  4FX0 A;  2IA1 A;  2YU3 A;  4IHS A;  2DBB A;  1R58 A;  4RAY A;  4MQ9 F;  4AD9 A;  3FWE A;  4I0B A;  3KET A;  4G7O F;  4HV6 A;  2VT2 A;  4U0W A;  5DDG A;  5JVT A;  5FD5 A;  3FX3 A;  3ELK A;  1B9M A;  2CFX A;  3CUQ C;  5FLX Z;  2NYX A;  3ZQ7 A;  4CYD A;  5D6E A;  3GX4 X;  2HDC A;  2W84 A;  1TTY A;  2RKH A;  2QUF A;  3SZP A;  1USS A;  2P6T A;  4PGG A;  3WGH A;  1T6S A;  3OOP A;  1XN7 A;  1S8N A;  4P96 A;  1J7K A;  4U7D A;  1SD7 A;  1HKQ A;  2FSW A;  1J5Y A;  1HSJ A;  1TW2 A;  2GWR A;  1B6A A;  4HV5 A;  4GCV A;  1BC8 C;  5DEQ A;  2ESH A;  1HW2 A;  3BZ6 A;  1YO5 C;  4I98 B;  4OIP F;  4OOI A;  2DQL A;  3VOD A;  4ZYE A;  2KIU A;  4ZZL A;  2WV0 A;  4ETS A;  4EJT A;  4AIJ A;  1G4D A;  4AIK A;  2ELH A;  1ZRE A;  4HA8 A;  5ERI A;  2HEO A;  3HRM A;  4I7H A;  2A68 F;  1OYY A;  3BRO A;  3I59 B;  1W5T A;  2DT5 A;  3E6C C;  2KJC A;  4IRH A;  3IL2 A;  2QBY A;  1BIB A;  3TOB A;  3K1P A;  2ISZ A;  1ZRF A;  3TO6 A;  4CDG A;  3J81 Z;  1U3E M;  4YII A;  1BN5 A;  4G6Q A;  2MA3 A;  5LBQ A;  4KDP A;  3BY6 A;  2LNB A;  4LLG F;  4BQA A;  2CWE A;  4EGY A;  2JSC A;  5D5W B;  1DPU A;  2DLL A;  3KP7 A;  1F5T A;  3D5L A;  4D0P A;  2JZY A;  5K5R A;  4RS8 A;  2IRF G;  3FXQ A;  1XMA A;  1RI7 A;  2VC1 A;  4NQW A;  4RB3 C;  1R1U A;  4KN7 X;  4KFC A;  2HYF A;  3R60 A;  1SFX A;  4ZYD A;  3DPL C;  3FM3 A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  4I09 A;  5IT9 Z;  5EEG A;  2YUS A;  2VKH A;  3KYD B;  2X1E A;  5J8C A;  1RC9 A;  2ZNY A;  4L9V A;  2XVC A;  4PDK A;  3QP6 A;  4PSW A;  5ICG A;  4RGR A;  1WCM J;  1FC3 A;  2NVX J;  4GDF A;  5FGM A;  2ECC A;  4N9I A;  2QVO A;  2Z99 A;  1YTY A;  2EFN A;  3G1O A;  2ZC2 A;  3F21 A;  3HOX J;  2STW A;  2KZV A;  3HRS A;  4PSX A;  3DKY A;  3TGN A;  1TZL A;  3ASN H;  3F0C A;  4G9Y A;  3T8T A;  4ZH4 F;  1ZTR A;  5F0F A;  1WH7 A;  2EH3 A;  4RB2 C;  4OIR F;  2R7T A;  2LD5 A;  1K6Y A;  3C7J A;  2XUB A;  4FET A;  4XKC A;  4F52 A;  5B1A H;  2Z9O A;  3HSR A;  2R3S A;  2HR3 A;  2FUG 2;  4ZDP A;  2VBX A;  1WJA A;  3ECO A;  3DP7 A;  3CZ6 A;  1MJB A;  2EFP A;  5EEA A;  1WI9 A;  4B1R A;  5LD2 C;  1QHG A;  2ZFW A;  2FRH A;  4IF4 A;  1L0O C;  2GXA A;  1WPK A;  1IZ1 A;  1MNM C;  4G6D A;  3WU1 B;  1AU7 A;  3BTC A;  1TQI A;  1P4X A;  4M6Y A;  4YIF A;  5FRM A;  2B63 J;  1ZLK A;  4CA0 A;  3RSN A;  2KKO A;  4XRS A;  1HW1 A;  3KYC B;  2JRM A;  3OS2 A;  1YS7 A;  3IUO A;  2MH2 A;  1Q1H A;  1WVR A;  1FYL A;  2NAZ A;  2LY1 A;  4Z2Y A;  1IXC A;  5LHG A;  5FRO A;  2O5R A;  3V8L A;  3KP3 A;  1JHH A;  4HX8 A;  3QU3 A;  4G7Z F;  1SC7 A;  1LFU P;  1JKR C;  5HOD A;  2HOE A;  4F7Z A;  3DV8 A;  3MKW B;  2HTS A;  3ZMT A;  3R4K A;  1I1G A;  3E5U A;  1FX7 A;  3G71 I;  4M6V A;  4YFX F;  4F92 B;  2TDX A;  2VJ5 A;  1D3Y A;  2W82 A;  1MW7 A;  3K4J A;  4MGR A;  5HS9 A;  5HLH A;  2BHZ A;  2CG4 A;  3GBG A;  4OIO F;  1GT0 C;  4DYR A;  3MQ0 A;  3QOP A;  3MMY B;  4BHB A;  1DGR M;  3LSP A;  2NOJ B;  1XSV A;  4ENK A;  1D0X A;  4IQJ A;  3K4C A;  2E19 A;  3A2K A;  3S1M J;  4AWX B;  1V3F A;  3DLL F;  1IN6 A;  2FOW A;  1IAW A;  2Y31 A;  3BQY A;  2V9K A;  2Y75 A;  3IWZ A;  4I0A A;  3GTJ J;  3VWB A;  1TLH B;  2WAE A;  3EUH A;  4Q48 A;  2HVQ A;  2HQN A;  1YLF A;  2QQ9 A;  4XK4 A;  3IKV A;  3HYI A;  2UWM A;  2DI3 A;  3H9J A;  1VQM I;  3SEQ A;  4BUP A;  2LTP A;  4KMU X;  3CJR B;  3WG9 A;  3H9Q A;  5IP7 J;  1WJE A;  2DTR A;  1VQO I;  4KN4 X;  1ZRD A;  2CJJ A;  1R4N B;  2VKE A;  3CJT B;  4E7Z A;  1DQU A;  2R93 J;  2CQX A;  2NS0 A;  4WXH A;  5E1Z B;  3H5A A;  2JUC A;  4IEJ A;  4PGH A;  1XC5 A;  4BXX J;  4GYI A;  3A01 B;  3V42 A;  1NHA A;  4M74 A;  2ZSH B;  2FML A;  3G1M A;  4B8X A;  2ECB A;  3DF8 A;  1G2H A;  2FBH A;  4QPQ A;  2XRN A;  4XIC A;  1B4A A;  4XLC A;  4KT5 C;  5DUI A;  2DMU A;  2PN6 A;  1IRZ A;  4NHJ A;  2M4K A;  1I6H J;  1E3H A;  3ZQL A;  4ASN A;  1SMY F;  2OF7 A;  4E70 A;  2LKX A;  1UZC A;  4B3X A;  3JAM K;  4PZJ A;  3CQZ J;  5DM6 F;  5IP9 J;  2Q1Z B;  1P2F A;  1JKP C;  3CME I;  2W1O A;  1W36 D;  1AKH B;  3QPL A;  3PUF A;  3ZQF A;  2R7R A;  2XGX A;  5EF6 A;  3BT9 A;  1R22 A;  5EEH A;  4ZC3 A;  4LOC A;  3KZI C;  3H0D A;  2JVH A;  5D5X B;  4LFU A;  4XLF A;  4I2O A;  3SDB A;  1NK3 P;  1UEL B;  1FT9 A;  2DTZ A;  1Z3X A;  2F2E A;  2HZT A;  1P92 A;  3CLQ A;  5CQG A;  3ZMV A;  1VQ9 I;  5IYD J;  1WI3 A;  1V5G A;  5LGU A;  4XID A;  2F5F A;  2OZ6 A;  2X6W A;  3TBI A;  2IS6 A;  2CUF A;  5FJ8 J;  4YFK F;  3M07 A;  3W2W A;  1M1E B;  2GAU A;  3HPH A;  3VYR B;  4LIU A;  2VI6 A;  3I71 A;  2FF4 A;  3S17 J;  1TWA J;  5D4S A;  5HOO A;  4XOR A;  1F9N A;  2CW0 F;  4S04 A;  1YJW I;  1SAU A;  1PVE A;  3ABU A;  1JXS A;  3MAJ A;  3WTX C;  3I54 A;  1XS9 A;  2YX4 A;  3F8N A;  5M3F J;  5EDN A;  5H20 A;  2EZI A;  1FOY A;  2L9V A;  3TKY A;  2R5Z B;  2CV1 A;  1G3Y A;  1GUU A;  1MBK A;  2DMP A;  2ZSI B;  4UV9 A;  5LRR A;  4YRV A;  1ETY A;  4XL9 A;  1IDZ A;  1MSE C;  4UVC A;  3RPU D;  3V8K A;  4NC6 A;  3U1D A;  3TDZ C;  2QSF X;  3KP2 A;  4A12 A;  4IZZ A;  4XNF A;  5BMZ A;  1QVT A;  4BBS J;  3PO3 J;  3UR3 C;  4KIB A;  3V7S A;  2H8R A;  1N78 A;  3QWL A;  1S7O A;  1XMX A;  2IGN A;  3B73 A;  1D0Z A;  2XGC A;  1YI2 I;  1BR1 A;  1UMQ A;  5LHH A;  2H1L A;  2EIK H;  2LRD A;  4N4O B;  1O7F A;  5JHF A;  2D45 A;  1VQ5 I;  3MWM A;  4QIW N;  2XAF A;  1SFK A;  1N75 A;  2EV0 A;  4HAM A;  3JTH A;  1R1V A;  2LOO A;  2AXT C;  1OIS A;  1E0E A;  1UHM A;  3K70 D;  2TCT A;  3RI4 A;  5B66 C;  4QWQ A;  1GV2 A;  2WV1 A;  3BC8 A;  3LA3 A;  3QYE A;  3OOU A;  3QQA A;  2ZME C;  5KAI C;  1I3A A;  1V54 H;  1ZHF A;  2EV5 A;  1WJD A;  2Q8K A;  2V1X A;  2KDO A;  3K4M A;  2K3F A;  5HLT A;  4PJM A;  2DK8 A;  2H8W A;  2L7M P;  4MEX F;  1QU3 A;  4QSH A;  4XLN F;  3DQV C;  1V55 H;  4B4C A;  4C2U A;  3ZQQ A;  5KCM A;  2XIG A;  1LDJ A;  1POG A;  2KL4 A;  1LNW A;  4JQF A;  2E1C A;  5F6F A;  4P1W A;  2JA8 J;  4KIF A;  2WA0 A;  5M5X J;  4ZZD A;  2R7Q A;  1T08 B;  2VOP A;  4A3J J;  1HF0 A;  4L0Z B;  2QZ8 A;  4BHP A;  1OCC H;  2IA2 A;  3F6O A;  1X19 A;  1O57 A;  3WOD F;  1ZRC A;  1K83 J;  5E8I A;  1ZQ3 P;  1D5V A;  3MKZ A;  9ANT A;  3Q0W A;  1RIO H;  2RVC A;  2H94 A;  3CC2 I;  1OQY A;  3B6C A;  5KVR A;  2XB0 X;  5E1W A;  1UFM A;  1MBE A;  1XB4 A;  2W85 A;  5EGO B;  2W57 A;  1E3P A;  2ID6 A;  3ZQC A;  4PFP A;  1OLT A;  3DU6 A;  4GGG A;  3P9K A;  2Z5U A;  3BCA A;  3HL2 A;  3SDG A;  3EPZ A;  1NG7 A;  4DGW B;  3N97 A;  2QSG X;  1X1P A;  1MGT A;  1R23 A;  5J1U A;  3QAH A;  3ZPL A;  3PO2 J;  2HVS A;  3EET A;  3PQJ A;  2PMH A;  1I3Q J;  2DU9 A;  5D5U B;  1R4M B;  4ZDL A;  1ENH A;  1J59 A;  2CW7 A;  2CV0 A;  1W7P D;  3JRF A;  4M9S A;  5D4R A;  4HOB A;  3JSO A;  3V7R A;  2EV6 A;  3OIO A;  2O9L A;  1XPX A;  4Y4R A;  4V2G A;  1X1D A;  3FXL A;  2M7B A;  2WWY A;  1ETO A;  3A0H C;  4A3I J;  5L3E A;  3BJA A;  2LDU A;  1K78 B;  3CUQ A;  1GLN A;  3C1D A;  5J40 A;  2RAE A;  4Q47 A;  4ZYA A;  1LVK A;  1TBX A;  1X4O A;  1BOB A;  2H6C A;  3CO7 C;  3SXY A;  3BG7 A;  4DYC A;  1YX3 A;  2OD5 A;  1WQ2 A;  4UVA A;  4Y52 J;  4J19 A;  3I3L A;  1OCP A;  4M73 A;  2P5L C;  3DTK A;  3IH4 A;  3DBH B;  4HNT A;  1GVJ A;  5LGT A;  1SVM A;  1DU6 A;  3FXJ A;  2VKV A;  4A3K J;  5K1Y A;  4KUM A;  1KGS A;  1WKM A;  1OJL A;  3NWS A;  2FEZ A;  2K85 A;  1YQA A;  1O3T A;  2WY7 Q;  2UUZ A;  4EJU A;  2HU9 A;  1RKT A;  1T39 A;  3TP3 A;  4HYE A;  2PMU A;  4OAZ A;  5FKL A;  1PUF A;  2V6E A;  1TP4 A;  4A0Z A;  1ZGJ A;  4FAS D;  1U0J A;  4RLF A;  5J3L A;  2KQR A;  1SFE A;  5DM7 F;  3QPT A;  1FPQ A;  3TO9 A;  3S1N J;  2XF5 A;  2DA1 A;  2GA2 A;  4U0V A;  3OYK A;  3H3V K;  3L2R A;  2B7E A;  1FP1 D;  3FXR A;  3I0T A;  2XHK A;  1UB9 A;  3BOQ A;  3VEP A;  4ZYH A;  1VQ4 I;  2OQR A;  4CCO A;  3A02 A;  4M6X A;  2MG4 A;  1HCR A;  1IRX A;  2DT7 B;  3OR1 C;  4BEH B;  5FKO A;  2IT0 A;  4LG3 A;  5B1B H;  2CS3 A;  5K7F A;  2K3P A;  1Z91 A;  2Y9Y A;  1Z1D A;  2XRL A;  4HQE A;  2JA6 J;  5E3N A;  3QPH A;  1KQ9 A;  1XDU A;  4E7I A;  2X1C A;  1W7P B;  3K0L A;  3I56 I;  1GV5 A;  3HOT A;  4OMZ A;  1W36 C;  5JFR A;  3IKT A;  1PP8 F;  3AL0 C;  3KZY A;  4L9N A;  4NNJ A;  1KYZ A;  1SAX A;  1BR2 A;  1Z05 A;  2P81 A;  3F8B A;  1MMS A;  5C3E J;  4ESJ A;  3M1C A;  1FBU A;  2VAS A;  3DTE A;  1JT0 A;  1E3O C;  2FXA A;  3DKX A;  3ROU A;  4OIQ F;  2CSO A;  1HST A;  3CTA A;  4LG0 B;  2OTL I;  1KQ0 A;  1E17 A;  1MMD A;  3E97 A;  1VQK I;  5BQT A;  2HI3 A;  4BEH A;  2LLK A;  4RM2 A;  5K7Z A;  3F72 A;  1B72 A;  2A3S A;  1YG2 A;  1J9I A;  2HQR A;  3H3U A;  3HTU A;  3O8H A;  4XM3 A;  5IY5 H;  2ZKZ A;  1LDK B;  2GOM A;  3NAU A;  1Q1V A;  2K9S A;  1JTX A;  1DDN A;  2XB5 A;  1Y8R B;  4O3M A;  3LSR A;  2VOD A;  5LRS A;  1U5T A;  3LQQ A;  2IS2 A;  4BS9 A;  2QEX I;  3QYF A;  3JSP A;  5IP6 A;  4OWR B;  4A2U A;  5KAF C;  3J7A O;  3K7A J;  3M8J A;  2LKS A;  2OV7 A;  1AWC A;  2CRG A;  5C4X J;  1W5C C;  2LH9 A;  2H1K A;  1YRN B;  3BPX A;  2OUM A;  1I39 A;  3MVP A;  2EB7 A;  3LA2 A;  4QPO A;  3VOE A;  4BJT A;  2A6T A;  1MKM A;  1G59 A;  2V1N A;  1QHH D;  4HX7 A;  4N4N B;  5BOX A;  3FHZ A;  5LEJ A;  1D0Y A;  1I50 J;  1VQP I;  4EJW A;  1TL8 A;  4Y15 A;  5A2Q Z;  4MNU A;  1T0F C;  1X1C A;  1FBS A;  2FBK A;  4JBA A;  2FX0 A;  5GP9 A;  2O8X A;  2BY2 A;  4HSR A;  5FFX A;  1ZGA A;  1AHD P;  4LIT A;  3HC7 A;  2HQ5 A;  2DOE A;  4MIM A;  5DTD A;  3PUB A;  3BWG A;  3C3W A;  1VZ0 A;  5KHD A;  2BGC A;  4FHT A;  4EV0 A;  4IXA A;  1BIA A;  3FK6 A;  4UUS B;  3FXK A;  5ILS A;  3JW4 A;  3COA C;  5EG0 A;  5EJC A;  1DP3 A;  3PIO F;  2EFW A;  2R7Z J;  4P55 A;  1P9Q C;  3J7Y J;  4HDV A;  3L2U A;  2ETH A;  4I6Z A;  2L7F P;  5TJJ A;  3A0B C;  3TMO A;  2LK2 A;  4I01 A;  2L7K A;  3GF2 A;  2FNA A;  4EQQ A;  2M45 A;  4R79 A;  3G1L A;  3ZMD A;  1X2M A;  4BXU A;  5CJ9 A;  4AYB A;  1U78 A;  2EPF A;  1RUN A;  4CYC A;  2IJL A;  3C2H A;  3CCQ I;  1KU9 A;  1FMV A;  3BR3 A;  2E35 A;  3H35 A;  4XLH A;  3QRF F;  4HPQ A;  4M9Z A;  5CPR B;  1MIJ A;  1N25 A;  2VOO A;  1F1Z A;  2L54 A;  1XSX A;  3VYS B;  1X3Z B;  4FQG A;  1FBQ A;  1WGX A;  5ED4 A;  1LVA A;  2V4J C;  2R5Y B;  4BGD A;  1AOY A;  5CLS A;  2EZH A;  2VBZ A;  3KE2 A;  1QBJ A;  2MC4 A;  4X6A J;  1QVU A;  1PDN C;  3E1S A;  2CYY A;  3OMY A;  1JUS A;  4YIR X;  1ONV A;  5D8L B;  4JX5 A;  5HVQ C;  2WY8 Q;  4EM2 A;  1I27 A;  3O8G A;  2DAO A;  5FKM A;  4HG2 A;  4E4H A;  1YJ9 I;  3CC4 I;  3HOS A;  1F36 A;  3ABT A;  2R92 J;  1G3S A;  3OIP A;  1XCB A;  4E7K A;  2K9Q A;  1G3W A;  4JYK A;  2PJR B;  3I59 A;  1FLI A;  1HC8 A;  3CJQ B;  1QPI A;  2LG4 A;  2R7D A;  3VDX A;  3I55 I;  4IX7 A;  4KIC A;  1ETQ A;  2QWW A;  1LEA A;  3D0S A;  2XPV A;  3HHH A;  1LE8 A;  2LYC A;  3MZH A;  1TC3 C;  1BI2 A;  4FX4 A;  2JA5 J;  2STT A;  4HF2 A;  1SFO J;  3QOD A;  1ODD A;  3WGI A;  1TQP A;  2DMT A;  3ML6 A;  4HRI A;  4EM1 A;  1XX5 A;  2C6Y A;  1A04 A;  3F3X A;  5E20 A;  1R1T A;  1UG0 A;  2BW3 B;  3NRV A;  5E17 F;  5DCM B;  5LLQ A;  4G94 A;  2RV8 A;  1MJA A;  4DW6 A;  2CQN A;  1OCT C;  1YW8 A;  2QEN A;  4I76 A;  3M7G A;  1MNE A;  2M8E A;  3SQN A;  2WB1 A;  3B02 A;  4BE1 A;  1X58 A;  2E7W A;  4A3M J;  1HKT A;  3IWF A;  3J80 K;  4FCY A;  5F04 A;  1XMK A;  4BAY A;  2KDZ A;  3M3Y J;  2BVM A;  2RRE A;  3H1C A;  4S0H B;  3P7N A;  4H0E A;  1FJL A;  4IKF A;  5L3F A;  3KP6 A;  3PIP F;  3I4P A;  4HBL A;  4S05 A;  1MBF A;  1XGN A;  2DYR H;  3F6V A;  1SAN A;  1Y56 A;  3AAF A;  1KQ8 A;  2DW4 A;  2IGM A;  1LDD A;  4LGW A;  2UZK A;  5AIQ A;  1XCV A;  2W48 A;  4L5J A;  4WXC A;  3ZQH A;  2BW3 A;  1X1A A;  4C3J J;  1HKS A;  4DZJ A;  1U9O A;  4G6T B;  3OYF A;  2IPQ X;  1FEX A;  4CUG A;  5JI6 A;  2W7N A;  3HKZ A;  1RPW A;  1JI8 A;  4I02 A;  2Z33 A;  4IHX A;  3L00 A;  2X51 A;  3LSJ A;  2L4M A;  3GW2 A;  2Q2E B;  3A4C A;  2PBI A;  3VYU B;  3GZN B;  1HOM A;  3TDU C;  4AYB N;  5F64 A;  5F08 A;  3HOV J;  1TWH J;  1QRY A;  3HB9 A;  2ME0 A;  3CLO A;  2V9V A;  5E3O A;  2Q0O A;  3CUO A;  2RGV A;  2ZB9 A;  4CCK A;  2MLK A;  3S3M A;  2NNN A;  3F8F A;  4B09 A;  2WAF A;  3ZMZ A;  3E5Q A;  3HSF A;  2COB A;  4BQO A;  3OL4 A;  3AFH A;  2NRA C;  2XAG A;  2BVL A;  2CUJ A;  1UHS A;  4DOZ A;  1OCO H;  4L0Y B;  1A5J A;  2QYO A;  1MBH A;  3LAJ A;  3HZJ A;  1RKW A;  4B47 A;  3J80 Z;  3CJN A;  2L5Q A;  2ZME B;  1CQT A;  3BR1 A;  2BY0 A;  3RKQ A;  2JT1 A;  2E2J J;  3ABL H;  4L5E A;  4WF2 A;  5E3L A;  4XLE A;  3FBN B;  3P5J A;  1YIO A;  3H36 A;  2QQA A;  3OYL A;  4RBO A;  2XAJ A;  1WSU A;  5CVU A;  4KNY A;  1P4W A;  4IJA A;  2XC7 A;  1IXR C;  4II3 A;  1FNN A;  3L2V A;  2QQB A;  1XSD A;  2NVU B;  4LK0 F;  1DPR A;  3I53 A;  3BP8 A;  1VND A;  3FK7 A;  2O6G E;  2TRT A;  2HFH A;  2RN7 A;  1KU3 A;  1MMN A;  4P5O A;  3V8J A;  1LJ9 A;  2ICW G;  4DZP A;  1QPM A;  3H92 A;  1VQN I;  5HDN A;  4RB0 A;  2VXZ A;  4LK1 F;  2M87 A;  2G0E A;  1QQI A;  3ZRG A;  1W4M A;  2ZME A;  2UXX A;  3LAP A;  2PJP A;  1IUY A;  2XKP A;  3SHF A;  3MCZ A;  5DCF A;  2YSR A;  5DD8 A;  3OYE A;  3MKY B;  2WB1 N;  1KU2 A;  2BY3 A;  2K40 A;  4KYW A;  4HDU A;  1BL0 A;  3B6A A;  2GXG A;  2WAQ A;  1X1B A;  3I9V 2;  2W4S A;  3TQN A;  1Z0X A;  3FZV A;  3M4O J;  2DK5 A;  4JOM A;  4BXF A;  2XRO A;  1EA3 A;  3S93 A;  2IS1 A;  4M3E A;  3H5N A;  4HX4 A;  4KT6 A;  1D8K A;  2M8G X;  3CD6 I;  4BQQ A;  3LFU A;  2GIV A;  2L4A A;  3TW7 A;  2KLO A;  3A01 A;  1KON A;  3CCU I;  3ABM H;  3WHB A;  4X0G A;  2LBF B;  3HKZ N;  5J47 A;  4RAF A;  3M1E A;  3ZGK A;  3JRI A;  3CMM A;  1KZH A;  3SJM A;  4PUS A;  3V4G A;  1TQM A;  1S7E A;  5IPA A;  2A05 A;  1OPC A;  2ZJ2 A;  1YJN I;  3LSI A;  2JA7 J;  2I5U A;  5ICF A;  1ON2 A;  1H88 C;  2HVR A;  3JCU C;  2BXZ A;  3RDI A;  3HG9 A;  3RQI A;  1ZKG A;  3HM5 A;  3ESW B;  2XKO A;  4BDY A;  2XV4 S;  1MBG A;  2HZD A;  5HS8 A;  1O3S A;  1ETK A;  1YIJ I;  1AKH A;  2ZXJ A;  5K7H A;  4XN3 A;  3PL8 A;  3IRR A;  4A69 C;  1MD0 A;  2ZXI A;  1RZ4 A;  1XG1 A;  3KP5 A;  3ERM A;  2YR2 A;  1G6N A;  1D1C A;  4M3F A;  5AIP A;  2XPW A;  4XMY A;  3MFK A;  3HGG A;  3P9C A;  3GCM A;  3GFI A;  4MTE A;  5ILU A;  2F4M B;  2UXN A;  3S2W A;  2LBF A;  1Z67 A;  1ZH5 A;  1MMA A;  5LHI A;  1JJ6 C;  1K79 A;  2JPB A;  5H6Q A;  1VI0 A;  1FTZ A;  1T8I A;  3H9G A;  1LQ1 A;  1S9H A;  4XR6 A;  3M9A A;  4A3G J;  5DUK A;  2OQG A;  3OYB A;  4ZTF A;  2E5Z A;  3GZ5 A;  4HZF A;  1GXP A;  3JAM Z;  2AO9 A;  4BY1 J;  2L01 A;  1W5S A;  2KZG A;  3R61 A;  3HPG A;  4XLP F;  4PJJ A;  3E7L A;  3K9T A;  2JJ7 A;  2F4O B;  2IP2 A;  3PSF A;  2QSH X;  1U9N A;  2QQ8 A;  5F1R A;  2JK3 A;  5KNL A;  4W97 A;  3AL0 B;  1IN4 A;  3IH2 A;  4ENM A;  4L9J A;  1IDY A;  1ZG1 A;  5BPI A;  2R5Z A;  3KFW X;  2ZCW A;  2OPT A;  4XOP A;  5IYC J;  2PFB A;  4AIH A;  1BI0 A;  2IAI A;  2PQ8 A;  2J5P A;  4CIC A;  2KRC A;  3HIF A;  1U6G A;  2LF8 A;  1QZZ A;  4ESB A;  4IRG A;  4BY7 J;  4C3H J;  3LQR A;  1R5H A;  1IO2 A;  1JHF A;  1Z6T A;  2E1M B;  5CKT A;  2LSO A;  3F9K A;  2OTJ I;  2WAQ N;  5HLG A;  2F48 A;  3J7Z I;  3VFZ A;  2VXD A;  3LSH A;  4QTR A;  4MFE A;  1ETV A;  2JUG A;  2Y69 H;  2VQH A;  4J00 A;  2OJE D;  1OYI A;  2CFO A;  5FO5 A;  5CVJ A;  2EJR A;  2LY9 A;  2VLA A;  1SD6 A;  1HXD A;  5M5Y J;  4HF0 A;  4CCL A;  3EYI A;  3LFK A;  2JPC A;  2BHY A;  3OIQ A;  3GME A;  3HJE A;  1OYW A;  3VPR A;  2EK5 A;  4AVZ A;  5D8K B;  2JN6 A;  5FB2 A;  2JWT A;  2OAZ A;  1BR4 A;  2V26 A;  4BDZ A;  4L5I A;  2PEX A;  2MGQ A;  1WFX A;  4LLN A;  4G7H F;  1CF7 B;  2HKO A;  2XAS A;  4HNV A;  3T1B A;  3I58 A;  2H27 A;  4UB6 C;  1DP7 P;  3HXL A;  3O6B B;  2A61 A;  4F93 B;  4XOT A;  2IGO A;  4DNC A;  2VKD A;  1TWF J;  4P9U A;  2DXI A;  4EJO A;  1WRJ A;  4U87 A;  1WJB A;  2JSP A;  3Q9V A;  3BZK A;  1I1S A;  1R6R A;  3BQZ A;  3G4S I;  4R1H A;  1R9T J;  4NC8 A;  2ME6 A;  2LP0 A;  2E36 A;  2ESN A;  2QGU A;  3DEE A;  4BJ6 C;  2O03 A;  2L9S A;  3RPU A;  4IRI A;  5EGO A;  3L2W A;  4XON A;  3KP4 A;  3PNY A;  2KRH A;  2ZO4 A;  2HXO A;  2ZJP F;  4YG2 F;  2IW5 A;  3OYG A;  3JR9 A;  1W0U A;  1MDM B;  2VBY A;  3FMQ A;  5FLM J;  2K4J A;  3Q5F A;  2EBI A;  3EUA A;  2AS5 F;  3WTZ A;  4BL0 B;  1UCR A;  2DCE A;  1K7A A;  1DGW Y;  2RC4 A;  1U8R A;  2Y30 A;  1S3J A;  1HDP A;  2E7X A;  5GAH J;  3K1N A;  1ZK8 A;  1T0F A;  1FOX A;  2HOA A;  3BCB A;  4HQM A;  3K10 A;  5JVG F;  3H5R A;  2RQP A;  5E8G A;  3VB2 A;  1FWZ A;  2GA1 A;  2R7F A;  1S72 I;  1ZLJ A;  1RR7 A;  1Z7U A;  3IP4 B;  3KZZ A;  3F8C A;  3ZN0 A;  3G73 A;  3T0Y A;  1WH5 A;  5BPD A;  3EYY A;  1EF4 A;  1K78 A;  3FKI J;  1Y39 A;  3BPV A;  4UXN A;  3X2Q H;  4XSZ F;  2N8G A;  3CMY A;  1B59 A;  3QYB A;  4ITV A;  4HST A;  1FYM A;  1BJZ A;  3RKY A;  4BJ5 C;  2XAU A;  1BOA A;  3GUD A;  4IHY A;  1FYK A;  3ZQI A;  2BOL A;  1Z6R A;  3ABK H;  5HDG A;  2NOG A;  3GTQ J;  5IOZ A;  1FTT A;  2BZT A;  1EH8 A;  2K9M A;  3SFZ A;  2DQR A;  5E79 C;  2HGC A;  2K27 A;  3ZMU A;  2DFH A;  4XN0 A;  2BV6 A;  2L2O A;  3WTY C;  5J4Y A;  5EYR A;  4BQN A;  2LKP A;  3CP8 A;  3CCJ I;  3CCV I;  2HOS A;  2DFE A;  4Y3O A;  3Q9S A;  1BW6 A;  5FLX K;  5J6X A;  2MD5 A;  2EWN A;  2WAD A;  3OS0 A;  4C3I J;  2MC3 A;  4XKV A;  2MH9 A;  2M3A A;  3E6D A;  2V7F A;  3RTR A;  1SMT A;  2M34 A;  1S6L A;  2HXI A;  2X6X A;  1PP7 U;  2E1M C;  2VQG A;  3U2R A;  2F5D A;  3PSI A;  6PAX A;  2MLG A;  3GTG J;  1K6O A;  3TL4 X;  2VE9 A;  1R7J A;  3HGY A;  2GBY A;  3K4K A;  2E71 A;  5C4J J;  2ELK A;  3U21 A;  1V4R A;  3CDI A;  4KMF A;  2KIM A;  2JVG A;  1W7P A;  3QOE A;  4HLX A;  2CUE A;  4JX4 A;  2I10 A;  2QM3 A;  4IPA A;  3S32 A;  1D1A A;  3S16 J;  3OYJ A;  1C0W A;  2L3D A;  3DCF A;  4HF1 A;  3CO6 C;  5LEK A;  4MO7 A;  4RLQ A;  2PLY A;  5HLI A;  4Q5S F;  4JX6 A;  2LVS A;  5GTI C;  4HW0 A;  2GXB A;  2DJN A;  3KCC A;  2DOD A;  1SVO A;  4IHT A;  5HDK A;  4MHG A;  3FDY A;  2G9W A;  3JTG A;  3BJ6 A;  5ICE A;  2ZNZ A;  4LG0 A;  1STZ A;  1ACI A;  2VJ4 A;  2GQQ A;  4A6D A;  1BJA A;  3GLX A;  3UNG C;  1DU0 A;  2WTE A;  2CQQ A;  2M7A A;  3LST A;  5AON A;  4RGU A;  1YFH A;  2DFI A;  5LGN A;  5IT3 A;  3DXJ F;  3DU5 A;  5D6F A;  1JT6 A;  2EA4 A;  3KEO A;  5E3M A;  4B48 A;  1Z9C A;  3CCM I;  1G8X A;  3IC7 A;  4XQF A;  4XSX F;  4EEF G;  1UST A;  1YHQ I;  5KK1 A;  4M72 A;  3PNT A;  3FMS A;  4ZYG A;  4UY8 I;  2DA4 A;  2K4B A;  2E1N A;  2GM4 A;  4AID A;  5M3M J;  4NDL A;  3WU2 C;  2P6S A;  1TWG J;  4GO1 A;  1D5Y A;  1V5F A;  3IAM 2;  2XSD C;  2JMW A;  3WHC A;  1VQ6 I;  1A6Q A;  3NQO A;  3LSK A;  3J81 K;  1Z7L A;  3WTU C;  4IO9 F;  1NH3 A;  1YRN A;  2DT6 A;  2FQ3 A;  2XAQ A;  3GLL A;  3KEQ A;  1RET A;  1IRG A;  4HLY A;  1FSH A;  2GOX B;  2ZBK A;  3K4N A;  3TOA A;  2IGK A;  3ERE D;  3Q0V A;  3RIR A;  4BU2 A;  3GTL J;  4V19 K;  2DA5 A;  2M1B A;  2RNG A;  1T98 A;  3U9G A;  2QBY B;  3H3Z A;  3DPT A;  1BBY A;  3V7C A;  1OFC X;  3W6J B;  3EQL F;  1IV8 A;  2LF7 A;  4HEA 2;  2HOT A;  2HDD A;  5JLW A;  2FD5 A;  3T5X A;  1D1B A;  4XRF A;  1IRF A;  1HW5 A;  2AQF A;  1R36 A;  4U0Y A;  2QF7 A;  1EH7 A;  4G8X A;  2ID3 A;  2X85 A;  3RCO A;  1JGG A;  2ZFU A;  2OZU A;  2ACJ A;  2NXN B;  3ZMS A;  5IT9 K;  1YOV B;  3T8R A;  4UUS A;  3JRB A;  2HPI A;  3DKW A;  3CES A;  2MYS A;  3HRU A;  1GDT A;  3OSF A;  1YYV A;  2VE8 A;  3BR5 A;  1P7J A;  1JUP A;  3L9F A;  2KPM A;  3MN2 A;  1ORK A;  4IOC F;  1P7I A;  3FIW A;  3HOY J;  5TGT A;  2MFZ A;  3K4L A;  5BS6 A;  1OCZ H;  4D7N A;  3OWT A;  3SZG A;  3FXM A;  2W00 A;  1A36 A;  5DS9 A;  1SD5 A;  1OR7 C;  3R0J A;  4OU0 A;  4ABZ A;  1BA5 A;  3BTI A;  3GFJ A;  1ZGW A;  5IYB J;  3SZT A;  4NC7 A;  3AG3 H;  4U88 A;  2K9N A;  3QU6 A;  2VPL A;  2XF7 A;  2PI0 A;  3BR6 A;  2XSJ C;  4A3F J;  4CGZ A;  1Z3Y A;  2A07 F;  4E7S A;  1MMG A;  4EMS A;  2V1U A;  1U5T C;  1RNL A;  2JA2 A;  4ESF A;  1QNT A;  3LNQ A;  3PQK A;  3GXO A;  1X3U A;  5DYM A;  4XBF A;  3OYD A;  2EIM H;  2Y9Z A;  4RMN A;  3D5S C;  2R5Y A;  1UG2 A;  2RDP A;  4BHC A;  1UAA A;  1K4S A;  3H0G J;  3O2P E;  4O6J A;  3GZ6 A;  4PJL A;  1O4X A;  4C2T A;  3REO A;  1ZEL A;  2A69 F;  2P5V A;  1ZR2 A;  1NG6 A;  3JRA A;  1A31 A;  3FIS A;  2MBF A;  4LLL A;  4GRI A;  2YX7 A;  1QA6 A;  2IBD A;  3BG9 A;  3CCS I;  3BTL A;  3SYT A;  3HHG A;  2CO5 A;  1YE9 A;  3JRG A;  4GFB A;  4EAT A;  4Q4Z F;  2PJR A;  3FF5 A;  1RRJ A;  3D1N I;  1WZ2 A;  1ETW A;  4M3D A;  2A6E F;  3GO5 A;  3DEW A;  3GWZ A;  1J75 A;  2L02 A;  4F91 B;  1S29 A;  3G6E I;  3S2H J;  1X4P A;  3JRC A;  4C30 A;  5FLV A;  2X1D A;  1ZAO A;  5CQE A;  2EIN H;  3DTI A;  3HDD A;  1F43 A;  1QO0 D;  2EA2 A;  4IQ4 A;  3GEZ A;  2NVT J;  4PCQ A;  4WXD A;  4EGZ A;  2HKX A;  4UNO A;  2VJJ A;  1EKE A;  2FU4 A;  3D5R C;  1MND A;  4OIN F;  4D5F A;  1T38 A;  4WX9 A;  4D1Q A;  4RA2 A;  2DO7 A;  2DJI A;  1U2W A;  3ZN1 A;  1XGM A;  3OS1 A;  3GYH X;  3DPU A;  3R6S A;  4DBR A;  5DCM A;  1QGP A;  1TNT A;  4CH7 A;  3PFI A;  2OC6 A;  3F8M A;  4M9X A;  1E2X A;  4BYY A;  4BE2 A;  3FM5 A;  3RQ4 A;  4BH9 A;  2VQC A;  2DMQ A;  2HYJ A;  3HRT A;  4AU7 A;  1YX5 A;  5TIS C;  2B0L A;  4LMY A;  1EV7 A;  2HS5 A;  1BI3 A;  3FHN A;  1O3R A;  2FNP A;  1JUM A;  4A0X A;  4WWC A;  1ERD A;  2P4W A;  2EZK A;  3BG5 A;  3RZO J;  1MZB A;  1XGS A;  3DBR B;  2M0C A;  3OYH A;  2O8K A;  1B8I B;  3S3O A;  2A5W A;  4IOA F;  5CVR A;  2J5O A;  4DQ2 A;  4P9F A;  1MBJ A;  4D5C A;  4IL6 C;  3UKG A;  2Y0S N;  1XDS A;  4A6E A;  3O3K A;  2RQQ A;  1FY7 A;  3S2D J;  2DYS H;  1G3T A;  5D5V B;  2CQ7 A;  1P6R A;  5E1X A;  3I64 A;  3LSG A;  4F55 A;  4PFO A;  1X2N A;  2CU7 A;  1MH4 A;  1MSF C;  1XD7 A;  4B44 A;  3KX2 A;  2Q2E A;  2OA4 A;  5CVV A;  1V5E A;  3CCL I;  1SEU A;  4TV7 A;  3C2G A;  1FP2 A;  4XLA A;  1VTN C;  4UUV A;  3HTS B;  2YPR A;  3WU0 A;  4M3B A;  5B3S H;  3E5X A;  1B8I A;  5JLX A;  3KYL A;  4R8H A;  4A3C J;  2DPU A;  4J01 A;  1IV6 A;  2Y48 A;  3BR2 A;  4M71 A;  5L3C A;  3RPQ A;  3RYP A;  4DBQ A;  1WHU A;  3JRH A;  4UV8 A;  2NS7 A;  1GXQ A;  2KRF A;  3K4B A;  4CZZ A;  1J0R A;  1ZN2 A;  3LL7 A;  3RKW A;  3JRD A;  1JE8 A;  1I6X A;  1HDD C;  3A1Y A;  1X3W B;  3HOW J;  2COM A;  1APL C;  2BEO A;  2M4G A;  4WK8 F;  2Z16 A;  1LEB A;  3OV8 A;  4GXO A;  5L3D A;  1RUO A;  3K69 A;  3E3V A;  4DJA A;  1R00 A;  2P7C B;  3W6K B;  2XGE A;  2EIL H;  2HWV A;  3DFG A;  2X6O A;  3ECH A;  5FD6 A;  3NEU A;  2AXL A;  2D2W A;  2W24 A;  4AC0 A;  4E7J A;  3S8P A;  2R7V A;  3S1R J;  3L09 A;  4LIV A;  4Y13 A;  2PX9 A;  4DIQ A;  1OCR H;  2VN2 A;  3CCR I;  2JTV A;  1ZR4 A;  3N4M A;  4A5N A;  2M30 A;  2D5V A;  2CQK A;  2ZJR F;  1ZG5 A;  3GVA A;  5DV5 A;  4UB8 C;  4L9T A;  2R7S A;  2K86 A;  3ULQ B;  4CXF A;  3WTT C;  2KJB A;  1YW7 A;  4XKW A;  2Z3Y A;  3K1M A;  3WTW C;  2QA4 I;  1HQC A;  1K4T A;  4QLC U;  3HSE A;  3AG2 H;  1BI1 A;  1J2X A;  3HOU J;  3GFM A;  2EQR A;  2VON A;  3FKJ A;  4GYG A;  2IVM A;  1HA8 A;  4LJZ F;  4LB5 A;  3HOZ J;  3IH3 A;  5FFZ A;  3G3Z A;  1MH3 A;  4G12 A;  4CO8 A;  3L2C A;  4O5V A;  3F23 A;  2BY1 A;  3MZ8 A;  1K61 A;  2H6B A;  3WGG A;  2VC0 A;  5J1R A;  1VQL I;  3MD2 A;  5DD4 A;  2DMN A;  4F3Q A;  3S3N A;  1N77 A;  3E6B A;  2FOK A;  3A03 A;  2KFD A;  4AM3 A;  4N9H A;  2HTJ A;  3CF2 A;  1JTY A;  2K9L A;  2G7H A;  2W25 A;  1BW5 A;  1OMI A;  4A5M A;  2GZW A;  2XDV A;  5CVI A;  4OAY A;  1QZY A;  2M0M A;  1GHC A;  1HBX G;  1MJ9 A;  5F0C A;  4RDU A;  1WJF A;  2KMU A;  2DOA A;  3W3C A;  2PG4 A;  4U7B A;  2EZL A;  4E7H A;  1R71 A;  1B1B A;  3KEY A;  3GTM J;  2VJI A;  3LWF A;  4A3L J;  2FJ1 A;  2KIS A;  2M9H A;  2R7O A;  4N0B A;  2L0K A;  5CYV A;  3PJR A;  4L18 B;  3KLO A;  2F4I A;  1Z21 A;  2O7O A;  4EJV A;  3ISP A;  1I5Z A;  3SFI A;  2LRE A;  1WWX A;  3FXU A;  3E0J B;  4RB1 A;  3RYR A;  1PUE E;  3CMA I;  2CGP A;  2VL8 A;  2XPU A;  1FSE A;  5LFA A;  1A35 A;  2K02 A;  2IEK A;  3AG4 H;  4FE7 A;  3ZXS A;  1SFU A;  2ZXW H;  3W2A A;  1T33 A;  3K2Z A;  3WE2 A;  1A6I A;  4KIS A;  2BBY A;  3ZOB A;  5ILV A;  1FOK A;  5GPC A;  2OU2 A;  4YFN F;  3OYI A;  4ENN A;  3HUG B;  3JRE A;  3EUH C;  1H9T A;  2P0W A;  4DYQ A;  1ZAR A;  5EZH A;  2ISY A;  2Y2Z A;  3WTS C;  4Y17 A;  2QKM B;  2JRT A;  1LFB A;  1J09 A;  1TT0 A;  4II2 A;  5HS7 A;  3WTV C;  4NUB A;  4RM3 A;  3VYT B;  2G7U A;  2QKL B;  2NVQ J;  1Y0N A;  4RAG A;  4RGS A;  5E18 F;  4ENJ A;  1NTC A;  4IVN A;  1IXS B;  2QCO A;  1T2K A;  3IHU A;  3L2Q A;  1REP C;  2IXS A;  1TNS A;  2VQL A;  3C2B A;  2EIJ H;  1Y6I A;  1JKO C;  2L9N A;  2A5Y B;  1IW7 F;  4A3E J;  3BR0 A;  1H0M A;  1T95 A;  3OSG A;  4ANJ A;  1H9G A;  1H8A C;  4A93 J;  1B9N A;  1IG7 A;  2WC2 A;  1BM9 A;  3PFY A;  3HUG A;  4MQV A;  5GPA A;  1F4K A;  3CDH A;  3SEZ A;  3R0A A;  2JQ7 A;  1SD4 A;  2DDB A;  3EDP A;  1YS6 A;  3ZP5 A;  3W6V A;  4MTD A;  1SVL A;  2X4H A;  3ASO H;  2DA6 A;  1TW3 A;  2P5K A;  1L3L A;  3TW6 A;  4UHT A;  4K2E A;  1NK2 P;  1CGP A;  3BDD A;  4CHU A;  1S7A A;  2F5E A;  2HQA A;  3Q3S A;  1T56 A;  1D8J A;  4UVB A;  1P4A A;  2BYV E;  2KP6 A;  3RKX A;  4IHV A;  2FQ4 A;  4WCG A;  5M5W J;  2IA0 A;  5JHU A;  2OBP A;  2ADU A;  4FT8 A;  3CUQ B;  5JR3 A;  3OYM A;  1LFP A;  3LA7 A;  3MEX A;  5F0H A;  3OY9 A;  3DLA A;  2KIF A;  2Z1D A;  2YU9 J;  4BE0 A;  2FE3 A;  4E6K G;  3U1K A;  1O7L A;  3LOC A;  1LB2 A;  5K5Q A;  5K5O A;  3MZY A;  2HYG D;  1O3Q A;  1XGO A;  2M5W A;  4PJ0 C;  2DA7 A;  2V1D A;  3CC7 I;  3QP5 A;  1FZP B;  2NNY A;  5B5E C;  2VBW A;  3F22 A;  3ONQ A;  2GLO A;  5F1J A;  5TRD A;  1BC7 C;  1EJ9 A;  2K7L A;  1ZG3 A;  5H2F C;  1PJR A;  3M8E A;  3J7A Y;  2D1V A;  4FIS A;  2P8T A;  3BG6 A;  1XTA A;  1CF7 A;  2V6C A;  3OR2 C;  4LD5 A;  1PUF B;  3I4N J;  4AUX A;  3PNV A;  4D7M A;  2QLZ A;  3C18 A;  1HLV A;  4LB6 B;  2LC2 A;  2VT3 A;  3GTK J;  4NBQ A;  2VIX A;  3DBL B;  4KIG A;  4EM0 B;  2H09 A;  4KIT B;  3BTJ A;  2DDA A;  2X0L A;  2DOF A;  1JKQ C;  1ZYR F;  3TO7 A;  1DUX C;  1KU7 A;  2EFO A;  5L3B A;  3L7W A;  2O61 A;  2ELJ A;  3OL3 A;  2MAB A;  1JGS A;  1FOW A;  2XAH A;  3P9I A;  4AVP A;  3CCE I;  1EH6 A;  3GFL A;  1YW9 A;  3BJO A;  3LSM A;  2GIZ A;  3WE3 A;  2F6C A;  3DWL E;  4CSW A;  5J8F A;  1RR8 C;  4UUT A;  3KLN A;  3ZQG A;  4OMY A;  1UJ8 A;  1U8B A;  1MDM A;  1KYW A;  4W1U A;  2R7X A;  3OYA A;  3RJP A;  3IV5 A;  2CH0 A;  5H6R A;  2BE5 F;  4JK1 X;  1S5L C;  2LMD A;  3KIO A;  5GAD J;  1Y8Q B;  3BG3 A;  2Y0M A;  2HDW A;  3K2A A;  4MFD A;  2P7V B;  2RNJ A;  3CDL A;  3M8F A;  2O3F A;  1W0T A;  1UHW A;  2R7W A;  1VFC A;  2F5V A;  3NAR A;  4CZC A;  4D9J A;  1FMW A;  1TWC J;  1KA8 A;  2KT0 A;  2R7U A;  2F5C A;  4EVI A;  2X6Y A;  3FMR A;  5ICC A;  1ULY A;  1IN7 A;  1B72 B;  4XKB A;  1IN8 A;  3DEU A;  1R49 A;  2DPD A;  2AHQ A;  4RAZ A;  1R5G A;  4BAC A;  1ON1 A;  2A6H F;  2PMZ A;  4MEY F;  2ZXH A;  3S14 J;  1OKR A;  3I5U A;  2M2E A;  3LMM A;  2O0Y A;  4A0Y A;  1U5T B;  4BNC A;  3GTO J;  2FA5 A;  2V79 A;  4NB5 A;  1IN5 A;  3TED A;  1Y0U A;  4Y33 A;  5A2Q K;  3S15 J;  3N05 A;  1IF1 A;  1FIA A;  3IRQ A;  2D1H A;  1VF9 A;  5FKK A;  2LR8 A;  1FIP A;  3E6M A;  4ON0 A;  2L7Z A;  3ZCO A;  4BBR J;  4RGX A;  4PK4 A;  4KA4 A;  1OR7 A;  3HBL A;  2V9P A;  5L3G A;  2EFQ A;  2FBI A;  2FMY A;  4FX0 A;  2IA1 A;  2YU3 A;  4IHS A;  2DBB A;  3L1P A;  1R5I D;  3WG7 H;  2MW8 A;  2DA3 A;  1R58 A;  2YS9 A;  2X48 A;  3EUK L;  3K6G A;  4RAY A;  4MLO A;  3NWT A;  4MQ9 F;  4AD9 A;  3BZC A;  3FWE A;  4I0B A;  3KET A;  4G7O F;  4HV6 A;  2VT2 A;  1LPQ A;  4U0W A;  5DDG A;  5JVT A;  3CCY A;  4Z6Y A;  5FD5 A;  1RES A;  4ZJZ A;  3FX3 A;  3ELK A;  5J4V A;  1B9M A;  2CFX A;  4JP0 A;  3CUQ C;  4BKX A;  2NVY J;  5FLX Z;  2Z2S B;  2NYX A;  1G4D A;  3HEF A;  2I8D A;  3FBI B;  4YEJ A;  3ZQ7 A;  4CYD A;  3S1Q J;  5D6E A;  3GX4 X;  5EG0 B;  4E7L A;  1GVD A;  5F27 A;  1W1W E;  4XRS G;  2DN0 A;  2E60 A;  2HDC A;  4FE4 A;  4XRM A;  2IS4 A;  1WJC A;  3FXO A;  1YIT I;  2W84 A;  5C44 J;  1TTY A;  2RKH A;  2ZJQ F;  5HNF A;  4KJZ A;  2QUF A;  3SZP A;  3W2V A;  3MKL A;  1USS A;  2P6T A;  4PGG A;  3WGH A;  3K70 C;  2VPR A;  1T6S A;  5GAG J;  3OOP A;  1XN7 A;  2XGD A;  1VQ7 I;  1S8N A;  4P96 A;  1J7K A;  3VSK A;  4U7D A;  1SD7 A;  2CW8 A;  1HKQ A;  1IUF A;  2FSW A;  3CP2 A;  3QPS A;  1J5Y A;  2R4G A;  2VUM J;  1HSJ A;  2WBM A;  5FKN A;  1TW2 A;  4CYC B;  2GWR A;  4Y7N J;  1B6A A;  4HV5 A;  3Q0U A;  4GCV A;  1BC8 C;  5DEQ A;  1QZE A;  2ESH A;  1HW2 A;  2DFF A;  4CCN A;  3BZ6 A;  3G2B A;  1YO5 C;  1LKX A;  4I98 B;  3OYN A;  3TP0 A;  4OIP F;  4OOI A;  2CV2 A;  2DQL A;  3VOD A;  4ZYE A;  2KIU A;  3IAS 2;  2E5N A;  4ZZL A;  2AQE A;  2WV0 A;  4C9Y A;  2OCC H;  4ETS A;  4ZTJ A;  4EJT A;  4AIJ A;  2K5C A;  4YEL A;  2KIQ A;  1Y1V J;  2CUZ A;  2HNH A;  2KHM A;  2PMZ N;  5GAE J;  2ELH A;  2R0Q C;  4AIK A;  1ZRE A;  4IHW A;  5IOY A;  4HA8 A;  2L9R A;  5ERI A;  3CF5 F;  4A3D J;  3VSL A;  4HNU A;  3PM1 A;  2HEO A;  1AA7 A;  3HRM A;  1ITY A;  4I7H A;  4FTH A;  2Y0S A;  1IC8 A;  1LUJ B;  2A68 F;  1OYY A;  3BRO A;  3I59 B;  2MD0 A;  5GTH C;  2B9S A;  1W5T A;  2DT5 A;  4M3G A;  4CCM A;  4CCJ A;  3E6C C;  2KJC A;  4IRH A;  4V2F A;  3IL2 A;  1JJ8 C;  2QBY A;  1LE8 B;  1BIB A;  3TOB A;  3K1P A;  4NQW B;  2MSY A;  1H89 C;  2BXY A;  1Y1W J;  5FRN A;  2UV1 A;  2ISZ A;  3I4M J;  4B43 A;  1ZRF A;  3TO6 A;  4CDG A;  2LY2 A;  3J81 Z;  1Z77 A;  1U3E M;  4YII A;  1BN5 A;  4G6Q A;  3KPH A;  1PYV A;  2MA3 A;  5LBQ A;  4KDP A;  3BY6 A;  3OYC A;  2LNB A;  4LLG F;  3ZR8 X;  4BQA A;  4A3B J;  2OCE A;  2CWE A;  4EGY A;  4X1E A;  2JSC A;  2VB6 A;  5D5W B;  1DPU A;  2DA2 A;  2DLL A;  3KP7 A;  3GTP J;  1F5T A;  1IJW C;  2NS8 A;  3D5L A;  4D0P A;  4B3A A;  2E34 A;  2JZY A;  2LFB A;  2E2I J;  4H4K C;  2HPM A;  5K5R A;  4I99 C;  4PJN A;  3BLY A;  3AKZ A;  2CMP A;  4RS8 A;  2IRF G;  1WJ5 A;  2E2H J;  5J1Y A;  2XF6 A;  3FXQ A;  4C2M J;  1ETX A;  1XMA A;  5HNH A;  1RI7 A;  2VC1 A;  2E1O A;  4ZDO A;  4NQW A;  4RB3 C;  3RZD J;  3AG1 H;  1R1U A;  2X9D A;  4KN7 X;  4KFC A;  2HYF A;  3R60 A;  1SFX A;  4ZYD A;  5BNG A;  1IGN A;  3DPL C;  5EZG A;  1VQ8 I;  3FM3 A; 
#chains in the Genus database with same CATH homology
 4I09 A;  5IT9 Z;  5EEG A;  5J8C A;  2ZNY A;  4L9V A;  2XVC A;  4PDK A;  3QP6 A;  5ICG A;  4RGR A;  1FC3 A;  5FGM A;  4N9I A;  2QVO A;  2Z99 A;  1YTY A;  2EFN A;  3F21 A;  2STW A;  3HRS A;  3TGN A;  4G9Y A;  3T8T A;  4ZH4 F;  4RB2 C;  4OIR F;  3C7J A;  2XUB A;  2Z9O A;  3HSR A;  2R3S A;  2HR3 A;  2VBX A;  3ECO A;  3DP7 A;  1MJB A;  2EFP A;  1WI9 A;  2ZFW A;  2FRH A;  4IF4 A;  1L0O C;  1IZ1 A;  4G6D A;  3WU1 B;  1TQI A;  1P4X A;  4M6Y A;  4YIF A;  1ZLK A;  2KKO A;  1HW1 A;  1YS7 A;  2MH2 A;  1Q1H A;  1FYL A;  2NAZ A;  4Z2Y A;  1IXC A;  5LHG A;  3V8L A;  3KP3 A;  1JHH A;  4HX8 A;  3QU3 A;  4G7Z F;  2HOE A;  4F7Z A;  3DV8 A;  2HTS A;  3ZMT A;  3R4K A;  1I1G A;  3E5U A;  1FX7 A;  4YFX F;  2TDX A;  1D3Y A;  4MGR A;  5HS9 A;  5HLH A;  2CG4 A;  4OIO F;  3MQ0 A;  3QOP A;  4BHB A;  1XSV A;  4ENK A;  4AWX B;  1V3F A;  1IN6 A;  1IAW A;  3IWZ A;  2Y75 A;  4I0A A;  1TLH B;  3EUH A;  4Q48 A;  2HQN A;  1YLF A;  2QQ9 A;  3IKV A;  3HYI A;  2UWM A;  2DI3 A;  4KMU X;  3WG9 A;  2DTR A;  1ZRD A;  4KN4 X;  2NS0 A;  4WXH A;  5E1Z B;  4PGH A;  4GYI A;  1NHA A;  4M74 A;  2FML A;  4B8X A;  3DF8 A;  2FBH A;  2XRN A;  1B4A A;  5DUI A;  4KT5 C;  2PN6 A;  4NHJ A;  4ASN A;  1SMY F;  4E70 A;  3JAM K;  4PZJ A;  1P2F A;  2XGX A;  1R22 A;  5EEH A;  5D5X B;  4LFU A;  4I2O A;  1FT9 A;  2F2E A;  2HZT A;  1P92 A;  3ZMV A;  5LGU A;  2F5F A;  2OZ6 A;  4YFK F;  2GAU A;  3I71 A;  2FF4 A;  5D4S A;  5HOO A;  1F9N A;  2CW0 F;  4S04 A;  3ABU A;  1JXS A;  3MAJ A;  3WTX C;  3I54 A;  2YX4 A;  3F8N A;  5H20 A;  3TKY A;  1G3Y A;  5LRR A;  4UV9 A;  4UVC A;  3V8K A;  3U1D A;  3TDZ C;  3KP2 A;  4A12 A;  5BMZ A;  4KIB A;  3V7S A;  1S7O A;  3B73 A;  5LHH A;  2D45 A;  1O7F A;  3MWM A;  2XAF A;  2EV0 A;  4HAM A;  3JTH A;  1R1V A;  1UHM A;  3RI4 A;  4QWQ A;  3LA3 A;  1ZHF A;  2EV5 A;  2Q8K A;  2V1X A;  2DK8 A;  4MEX F;  4XLN F;  3DQV C;  2XIG A;  1LDJ A;  1LNW A;  4JQF A;  2E1C A;  5F6F A;  4KIF A;  2VOP A;  4ZZD A;  4L0Z B;  2QZ8 A;  4BHP A;  2IA2 A;  3F6O A;  3WOD F;  1O57 A;  1ZRC A;  5E8I A;  1D5V A;  1RIO H;  2RVC A;  2H94 A;  5KVR A;  5E1W A;  1UFM A;  1XB4 A;  2W85 A;  2W57 A;  4GGG A;  3P9K A;  2Z5U A;  3N97 A;  1MGT A;  1R23 A;  3QAH A;  3ZPL A;  3EET A;  3PQJ A;  2PMH A;  2DU9 A;  5D5U B;  1J59 A;  1W7P D;  4M9S A;  5D4R A;  4HOB A;  3JSO A;  3V7R A;  2EV6 A;  2WWY A;  5L3E A;  3BJA A;  2LDU A;  1K78 B;  3CUQ A;  3C1D A;  4Q47 A;  1TBX A;  2H6C A;  3CO7 C;  3SXY A;  2OD5 A;  1WQ2 A;  4UVA A;  4M73 A;  2P5L C;  1GVJ A;  5LGT A;  5K1Y A;  4KUM A;  1KGS A;  1WKM A;  2FEZ A;  1YQA A;  1O3T A;  4EJU A;  1T39 A;  4HYE A;  2PMU A;  4A0Z A;  1ZGJ A;  1SFE A;  3QPT A;  1FPQ A;  3TO9 A;  2GA2 A;  4U0V A;  1FP1 D;  3FXR A;  3I0T A;  2XHK A;  1UB9 A;  3BOQ A;  3VEP A;  4ZYH A;  2OQR A;  4M6X A;  2IT0 A;  1Z91 A;  1Z1D A;  4HQE A;  3QPH A;  1KQ9 A;  1XDU A;  1W7P B;  3K0L A;  3HOT A;  4OMZ A;  5JFR A;  3IKT A;  1PP8 F;  3KZY A;  4L9N A;  1SAX A;  1KYZ A;  1Z05 A;  3F8B A;  4ESJ A;  1FBU A;  2FXA A;  3ROU A;  4OIQ F;  2CSO A;  1HST A;  3CTA A;  4LG0 B;  1KQ0 A;  1E17 A;  3E97 A;  5BQT A;  3F72 A;  2A3S A;  1YG2 A;  1J9I A;  2HQR A;  3H3U A;  3HTU A;  2ZKZ A;  1LDK B;  1DDN A;  4O3M A;  2VOD A;  5LRS A;  1U5T A;  3LQQ A;  3JSP A;  4A2U A;  3J7A O;  1AWC A;  3BPX A;  2EB7 A;  3LA2 A;  3VOE A;  1MKM A;  4HX7 A;  5BOX A;  3FHZ A;  5LEJ A;  4EJW A;  4Y15 A;  5A2Q Z;  4MNU A;  1FBS A;  2FBK A;  4JBA A;  2O8X A;  5FFX A;  1ZGA A;  3BWG A;  3C3W A;  2BGC A;  4FHT A;  4EV0 A;  4IXA A;  1BIA A;  5ILS A;  3JW4 A;  3COA C;  2EFW A;  4P55 A;  4HDV A;  2ETH A;  5TJJ A;  4I01 A;  3GF2 A;  2FNA A;  4EQQ A;  2M45 A;  4R79 A;  3ZMD A;  4BXU A;  5CJ9 A;  1U78 A;  1RUN A;  2IJL A;  1KU9 A;  3QRF F;  4M9Z A;  2VOO A;  1F1Z A;  2L54 A;  1XSX A;  1FBQ A;  5ED4 A;  1LVA A;  1AOY A;  5CLS A;  2VBZ A;  3KE2 A;  1QBJ A;  1PDN C;  2CYY A;  1ONV A;  5D8L B;  5HVQ C;  4EM2 A;  1I27 A;  2DAO A;  3HOS A;  3ABT A;  1G3S A;  1XCB A;  1G3W A;  1FLI A;  3I59 A;  2R7D A;  4KIC A;  2QWW A;  1LEA A;  3D0S A;  3HHH A;  3MZH A;  1BI2 A;  4FX4 A;  2STT A;  4HF2 A;  1ODD A;  3WGI A;  1TQP A;  3ML6 A;  4EM1 A;  2C6Y A;  1A04 A;  3F3X A;  5E20 A;  1R1T A;  3NRV A;  5E17 F;  5DCM B;  5LLQ A;  4G94 A;  2RV8 A;  1MJA A;  1YW8 A;  2QEN A;  3M7G A;  2M8E A;  3SQN A;  3B02 A;  2E7W A;  1HKT A;  3IWF A;  3J80 K;  1XMK A;  4BAY A;  3P7N A;  4H0E A;  5L3F A;  3KP6 A;  3I4P A;  4HBL A;  4S05 A;  1XGN A;  3F6V A;  3AAF A;  1KQ8 A;  2DW4 A;  1LDD A;  4LGW A;  2UZK A;  5AIQ A;  1XCV A;  4L5J A;  4WXC A;  1HKS A;  2IPQ X;  5JI6 A;  4I02 A;  2Z33 A;  3L00 A;  2L4M A;  3GW2 A;  2PBI A;  3TDU C;  5F64 A;  3CLO A;  2V9V A;  2Q0O A;  3CUO A;  2RGV A;  2MLK A;  2NNN A;  3F8F A;  4B09 A;  3ZMZ A;  3E5Q A;  3HSF A;  2NRA C;  2XAG A;  4L0Y B;  2QYO A;  3LAJ A;  3J80 Z;  3CJN A;  2ZME B;  2JT1 A;  4WF2 A;  1YIO A;  2QQA A;  2XAJ A;  1WSU A;  5CVU A;  4KNY A;  1P4W A;  4IJA A;  1IXR C;  1FNN A;  2QQB A;  1XSD A;  4LK0 F;  1DPR A;  3I53 A;  3BP8 A;  2O6G E;  2HFH A;  2RN7 A;  1KU3 A;  4P5O A;  3V8J A;  1LJ9 A;  1QPM A;  3H92 A;  5HDN A;  4RB0 A;  2VXZ A;  4LK1 F;  2M87 A;  1QQI A;  1W4M A;  2ZME A;  2UXX A;  3LAP A;  2PJP A;  1IUY A;  2XKP A;  3SHF A;  3MCZ A;  5DCF A;  2YSR A;  5DD8 A;  1KU2 A;  4KYW A;  4HDU A;  2GXG A;  3TQN A;  3FZV A;  2DK5 A;  2XRO A;  4HX4 A;  1D8K A;  2GIV A;  2L4A A;  3M1E A;  3V4G A;  1TQM A;  1OPC A;  2ZJ2 A;  5ICF A;  1ON2 A;  3RDI A;  2XKO A;  2XV4 S;  5HS8 A;  1O3S A;  2ZXJ A;  3IRR A;  1MD0 A;  1RZ4 A;  3KP5 A;  2YR2 A;  1G6N A;  5AIP A;  3MFK A;  3P9C A;  3GFI A;  4MTE A;  5ILU A;  2UXN A;  3S2W A;  1ZH5 A;  1K79 A;  5LHI A;  2JPB A;  5H6Q A;  1LQ1 A;  3M9A A;  5DUK A;  2OQG A;  1GXP A;  3GZ5 A;  4HZF A;  3JAM Z;  2L01 A;  1W5S A;  3R61 A;  4XLP F;  3K9T A;  2IP2 A;  5F1R A;  1IN4 A;  4ENM A;  4L9J A;  1ZG1 A;  5BPI A;  3KFW X;  2ZCW A;  2PFB A;  4AIH A;  1BI0 A;  2PQ8 A;  2J5P A;  4CIC A;  3HIF A;  1U6G A;  2LF8 A;  1QZZ A;  4ESB A;  4IRG A;  3LQR A;  1R5H A;  1JHF A;  1Z6T A;  2LSO A;  5HLG A;  3VFZ A;  1OYI A;  5FO5 A;  5CVJ A;  2EJR A;  1SD6 A;  1HXD A;  4HF0 A;  3EYI A;  3LFK A;  2JPC A;  1OYW A;  2EK5 A;  5D8K B;  5FB2 A;  2OAZ A;  4L5I A;  2PEX A;  4LLN A;  4G7H F;  1CF7 B;  2HKO A;  2XAS A;  3T1B A;  3I58 A;  2H27 A;  1DP7 P;  3O6B B;  2A61 A;  4DNC A;  4P9U A;  4EJO A;  1WRJ A;  3Q9V A;  1I1S A;  4R1H A;  2ESN A;  2O03 A;  3RPU A;  4IRI A;  3KP4 A;  2ZO4 A;  4YG2 F;  2IW5 A;  1MDM B;  2VBY A;  3FMQ A;  2K4J A;  3Q5F A;  2AS5 F;  3WTZ A;  1UCR A;  1K7A A;  2RC4 A;  1U8R A;  1S3J A;  2E7X A;  3K1N A;  1T0F A;  4HQM A;  2RQP A;  5E8G A;  3VB2 A;  1FWZ A;  2GA1 A;  2R7F A;  1ZLJ A;  1Z7U A;  3KZZ A;  3F8C A;  3ZN0 A;  3G73 A;  3T0Y A;  5BPD A;  3EYY A;  1K78 A;  3BPV A;  4UXN A;  4XSZ F;  1B59 A;  1FYM A;  3RKY A;  1BOA A;  3GUD A;  1FYK A;  1Z6R A;  5HDG A;  1EH8 A;  3SFZ A;  2DQR A;  2HGC A;  2K27 A;  3ZMU A;  2BV6 A;  3WTY C;  2LKP A;  3Q9S A;  5FLX K;  5J6X A;  2MD5 A;  2EWN A;  2MC3 A;  2MH9 A;  3E6D A;  3RTR A;  1SMT A;  1S6L A;  1PP7 U;  3U2R A;  2F5D A;  6PAX A;  2MLG A;  1K6O A;  2VE9 A;  1R7J A;  1V4R A;  4KMF A;  2KIM A;  1W7P A;  4HLX A;  2QM3 A;  4IPA A;  1C0W A;  2L3D A;  4HF1 A;  3CO6 C;  5LEK A;  2PLY A;  5HLI A;  4Q5S F;  4HW0 A;  2GXB A;  3KCC A;  4IHT A;  5HDK A;  4MHG A;  2G9W A;  3JTG A;  3BJ6 A;  5ICE A;  2ZNZ A;  4LG0 A;  1STZ A;  2GQQ A;  4A6D A;  1BJA A;  3GLX A;  2WTE A;  3LST A;  5AON A;  4RGU A;  1YFH A;  2DFI A;  5LGN A;  5IT3 A;  3DXJ F;  5D6F A;  2EA4 A;  3KEO A;  1Z9C A;  3IC7 A;  4XSX F;  1UST A;  5KK1 A;  4M72 A;  3FMS A;  4ZYG A;  2K4B A;  2E1N A;  2P6S A;  4GO1 A;  3NQO A;  3J81 K;  3WTU C;  2FQ3 A;  2XAQ A;  3KEQ A;  1IRG A;  4HLY A;  1FSH A;  2ZBK A;  3TOA A;  3ERE D;  3RIR A;  2M1B A;  1T98 A;  3U9G A;  2QBY B;  3H3Z A;  3DPT A;  1BBY A;  3V7C A;  3W6J B;  3EQL F;  2LF7 A;  3T5X A;  4XRF A;  1IRF A;  1HW5 A;  1R36 A;  4U0Y A;  1EH7 A;  4G8X A;  2OZU A;  2ACJ A;  3ZMS A;  5IT9 K;  3T8R A;  3DKW A;  3HRU A;  1YYV A;  2VE8 A;  3L9F A;  5BS6 A;  1SD5 A;  3R0J A;  4OU0 A;  3GFJ A;  3SZT A;  4U88 A;  3QU6 A;  2PI0 A;  4CGZ A;  2A07 F;  4EMS A;  2V1U A;  1U5T C;  1RNL A;  4ESF A;  1QNT A;  3PQK A;  3GXO A;  1X3U A;  5DYM A;  4XBF A;  2RDP A;  4BHC A;  3O2P E;  4O6J A;  3GZ6 A;  3REO A;  2A69 F;  2P5V A;  2MBF A;  4LLL A;  2YX7 A;  3HHG A;  2CO5 A;  4Q4Z F;  3FF5 A;  2A6E F;  3GO5 A;  3GWZ A;  1J75 A;  2L02 A;  1S29 A;  1ZAO A;  1QO0 D;  2EA2 A;  3GEZ A;  4PCQ A;  4WXD A;  4EGZ A;  2HKX A;  4UNO A;  1T38 A;  2FU4 A;  4OIN F;  4WX9 A;  3GYH X;  2DO7 A;  3ZN1 A;  1U2W A;  1XGM A;  3R6S A;  5DCM A;  1QGP A;  1TNT A;  3PFI A;  3F8M A;  4M9X A;  1E2X A;  4BYY A;  3FM5 A;  4BH9 A;  3HRT A;  2B0L A;  4LMY A;  1EV7 A;  2HS5 A;  1BI3 A;  1O3R A;  2FNP A;  4A0X A;  4WWC A;  2P4W A;  1MZB A;  1XGS A;  5CVR A;  2J5O A;  4DQ2 A;  4P9F A;  1XDS A;  4A6E A;  3O3K A;  1FY7 A;  1G3T A;  5D5V B;  1P6R A;  5E1X A;  3I64 A;  1XD7 A;  2Q2E A;  2OA4 A;  5CVV A;  4TV7 A;  1FP2 A;  1VTN C;  4UUV A;  3HTS B;  2YPR A;  3WU0 A;  3E5X A;  4R8H A;  2DPU A;  2Y48 A;  5L3C A;  4M71 A;  3RPQ A;  3RYP A;  4UV8 A;  1GXQ A;  2KRF A;  4CZZ A;  1J0R A;  1ZN2 A;  3RKW A;  1JE8 A;  1I6X A;  2COM A;  2BEO A;  4WK8 F;  1LEB A;  3OV8 A;  4GXO A;  5L3D A;  1RUO A;  3K69 A;  3E3V A;  1R00 A;  2P7C B;  3W6K B;  2HWV A;  3DFG A;  3ECH A;  5FD6 A;  3NEU A;  2AXL A;  2D2W A;  2W24 A;  3L09 A;  4Y13 A;  2VN2 A;  2JTV A;  3N4M A;  4A5N A;  2M30 A;  2CQK A;  1ZG5 A;  3GVA A;  5DV5 A;  4L9T A;  2K86 A;  3ULQ B;  4CXF A;  3WTT C;  2KJB A;  1YW7 A;  2Z3Y A;  3K1M A;  3WTW C;  1HQC A;  4QLC U;  3HSE A;  1BI1 A;  1J2X A;  3GFM A;  2VON A;  4GYG A;  2IVM A;  4LJZ F;  4LB5 A;  5FFZ A;  3G3Z A;  4CO8 A;  3L2C A;  4O5V A;  3F23 A;  2H6B A;  3WGG A;  2VC0 A;  5DD4 A;  3E6B A;  2FOK A;  4N9H A;  2HTJ A;  2W25 A;  2G7H A;  1OMI A;  4A5M A;  2GZW A;  5CVI A;  1QZY A;  1GHC A;  1HBX G;  1MJ9 A;  4U7B A;  2PG4 A;  1B1B A;  3LWF A;  4N0B A;  5CYV A;  4L18 B;  3KLO A;  4EJV A;  3ISP A;  1I5Z A;  1WWX A;  3FXU A;  4RB1 A;  3RYR A;  1PUE E;  2CGP A;  1FSE A;  2K02 A;  1SFU A;  3K2Z A;  3WE2 A;  2BBY A;  5ILV A;  1FOK A;  2OU2 A;  4YFN F;  4ENN A;  1H9T A;  1ZAR A;  2ISY A;  3WTS C;  4Y17 A;  2JRT A;  5HS7 A;  3WTV C;  2G7U A;  4RGS A;  5E18 F;  4ENJ A;  4IVN A;  1T2K A;  1IXS B;  3IHU A;  1REP C;  1TNS A;  2A5Y B;  1IW7 F;  1H0M A;  1H9G A;  1B9N A;  2WC2 A;  1BM9 A;  3HUG A;  4MQV A;  1F4K A;  3CDH A;  3R0A A;  1SD4 A;  3EDP A;  1YS6 A;  3ZP5 A;  4MTD A;  2X4H A;  1TW3 A;  2P5K A;  1L3L A;  4UHT A;  4K2E A;  1CGP A;  3BDD A;  4CHU A;  1S7A A;  2F5E A;  1D8J A;  4UVB A;  1P4A A;  2BYV E;  3RKX A;  4WCG A;  2IA0 A;  5JHU A;  2OBP A;  2ADU A;  4FT8 A;  3CUQ B;  5JR3 A;  3LA7 A;  3MEX A;  2KIF A;  2FE3 A;  1O7L A;  1LB2 A;  5K5Q A;  5K5O A;  3MZY A;  2HYG D;  1O3Q A;  1XGO A;  2M5W A;  2V1D A;  3QP5 A;  1FZP B;  2NNY A;  2VBW A;  3F22 A;  5TRD A;  1BC7 C;  2K7L A;  1ZG3 A;  3M8E A;  2D1V A;  2P8T A;  1CF7 A;  2V6C A;  4LD5 A;  2QLZ A;  3C18 A;  4LB6 B;  2VT3 A;  4KIG A;  4EM0 B;  2H09 A;  2X0L A;  1ZYR F;  3TO7 A;  1DUX C;  1KU7 A;  2EFO A;  5L3B A;  3L7W A;  2O61 A;  1JGS A;  3P9I A;  2XAH A;  4AVP A;  1EH6 A;  3GFL A;  1YW9 A;  3BJO A;  3WE3 A;  5J8F A;  3KLN A;  4OMY A;  1MDM A;  1KYW A;  3RJP A;  5H6R A;  2BE5 F;  4JK1 X;  2Y0M A;  2P7V B;  2RNJ A;  3M8F A;  2O3F A;  1UHW A;  1KA8 A;  2F5C A;  4EVI A;  3FMR A;  5ICC A;  1ULY A;  1IN7 A;  1IN8 A;  3DEU A;  2DPD A;  4RAZ A;  1R5G A;  1ON1 A;  2A6H F;  4MEY F;  1OKR A;  3I5U A;  4A0Y A;  2O0Y A;  4BNC A;  1U5T B;  2FA5 A;  2V79 A;  4NB5 A;  1IN5 A;  1Y0U A;  5A2Q K;  1IF1 A;  3IRQ A;  2D1H A;  3E6M A;  4ON0 A;  4RGX A;  4KA4 A;  1OR7 A;  5L3G A;  2EFQ A;  2FBI A;  2FMY A;  4FX0 A;  2IA1 A;  2YU3 A;  4IHS A;  2DBB A;  1R58 A;  4RAY A;  4MQ9 F;  4AD9 A;  3FWE A;  4I0B A;  3KET A;  4G7O F;  4HV6 A;  2VT2 A;  4U0W A;  5DDG A;  5JVT A;  5FD5 A;  3FX3 A;  3ELK A;  1B9M A;  2CFX A;  3CUQ C;  5FLX Z;  2NYX A;  3ZQ7 A;  4CYD A;  5D6E A;  3GX4 X;  2HDC A;  2W84 A;  1TTY A;  2RKH A;  2QUF A;  3SZP A;  1USS A;  2P6T A;  4PGG A;  3WGH A;  1T6S A;  3OOP A;  1XN7 A;  1S8N A;  4P96 A;  1J7K A;  4U7D A;  1SD7 A;  1HKQ A;  2FSW A;  1J5Y A;  1HSJ A;  1TW2 A;  2GWR A;  1B6A A;  4HV5 A;  4GCV A;  1BC8 C;  5DEQ A;  2ESH A;  1HW2 A;  3BZ6 A;  1YO5 C;  4I98 B;  4OIP F;  4OOI A;  2DQL A;  3VOD A;  4ZYE A;  2KIU A;  4ZZL A;  2WV0 A;  4ETS A;  4EJT A;  4AIJ A;  1G4D A;  4AIK A;  2ELH A;  1ZRE A;  4HA8 A;  5ERI A;  2HEO A;  3HRM A;  4I7H A;  2A68 F;  1OYY A;  3BRO A;  3I59 B;  1W5T A;  2DT5 A;  3E6C C;  2KJC A;  4IRH A;  3IL2 A;  2QBY A;  1BIB A;  3TOB A;  3K1P A;  2ISZ A;  1ZRF A;  3TO6 A;  4CDG A;  3J81 Z;  1U3E M;  4YII A;  1BN5 A;  4G6Q A;  2MA3 A;  5LBQ A;  4KDP A;  3BY6 A;  2LNB A;  4LLG F;  4BQA A;  2CWE A;  4EGY A;  2JSC A;  5D5W B;  1DPU A;  2DLL A;  3KP7 A;  1F5T A;  3D5L A;  4D0P A;  2JZY A;  5K5R A;  4RS8 A;  2IRF G;  3FXQ A;  1XMA A;  1RI7 A;  2VC1 A;  4NQW A;  4RB3 C;  1R1U A;  4KN7 X;  4KFC A;  2HYF A;  3R60 A;  1SFX A;  4ZYD A;  3DPL C;  3FM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...