5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
molecule keywords AspA
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
3I54A 1LDDA 2YU3A 3BPXA 4FT8A 4HOBA 1ZAOA 3BZ6A 4IRHA 1ZGJA 3CUOA 2Z33A 3RKWA 1MJAA 2QYOA 2MD5A 2RGVA 1HKQA 3GVAA 2DT5A 3DP7A 3KETA 2EV5A 2LF7A 3HTUA 2O6GE 2JT1A 3ELKA 3FMRA 2A61A 3KEQA 4M9XA 2BV6A 3GW2A 1YFHA 4XBFA 4HF1A 3FF5A 4OMYA 2HQNA 1IN5A 1F1ZA 4OIQF 5E8GA 3V4GA 3K1NA 3U2RA 4L9TA 3KEOA 2QLZA 1J2XA 1L0OC 5ICFA 4UVAA 2F5FA 4EJWA 3BJAA 3U1DA 1SMYF 1FX7A 2DTRA 4UV9A 2ZNZA 4HZFA 5AIQA 3I64A 5HS9A 1TBXA 2VN2A 1HW5A 1K78A 4S04A 3RTRA 1T38A 5BPDA 3M8FA 4YFNF 1LEAA 1D3YA 3LWFA 3R61A 4G7HF 1A04A 2VOPA 2OQGA 3ABUA 1S29A 4YFXF 4HYEA 4GXOA 3KE2A 4RGRA 3ZPLA 3ZQ7A 5HOOA 3L9FA 2GWRA 5E20A 3FM3A 2M1BA 2IPQX 4EVIA 2YR2A 3IRQA 5CYVA 2BEOA 2OZ6A 3Q5FA 1L3LA 5LEKA 4AWXB 1F9NA 5DCMB 2KRFA 3HRMA 2DU9A 3VOEA 3IC7A 2M5WA 1T2KA 5L3EA 4GYIA 2CFXA 3HYIA 1ZG1A 2PQ8A 4IHSA 3CTAA 3KLNA 4OOIA 2FBIA 3NRVA 4HLXA 1SFEA 5HS7A 4LG0B 2DO7A 4JBAA 2PMHA 3I59A 5CVVA 1O3SA 2PN6A 1ON2A 3BWGA 3V7SA 4ZZDA 3H3UA 2P4WA 2RC4A 1XMKA 3F8FA 1RUNA 5CVIA 1SFUA 5FLXZ 4B09A 4WX9A 4UV8A 4ESBA 5CLSA 2HS5A 3WODF 4HX8A 5BQTA 4ZH4F 2FNPA 2W24A 2QQAA 2RV8A 4QLCU 2PMUA 3GFLA 2VC1A 4KNYA 3QPHA 3T0YA 3EUHA 4BH9A 1LJ9A 2KJCA 4L0YB 4I09A 2RQPA 3JSPA 3EYIA 2A6HF 4I02A 4M9SA 5LHHA 3HSEA 3TDZC 4ZZLA 3F8MA 1H9GA 3CUQA 2HOEA 1B9MA 1J7KA 3WTTC 1SFXA 3ZMUA 3QAHA 2LNBA 1FSHA 1GVJA 1U2WA 2HWVA 2FF4A 4O3MA 5DV5A 1P4WA 2VOOA 2BGCA 3AAFA 2LSOA 4XSXF 3WTXC 2L02A 4LD5A 1ZRCA 1YLFA 1DPRA 2NS0A 1E17A 3BPVA 3R0AA 2Y0MA 6PAXA 5FFZA 3F23A 2F5DA 2FOKA 4H0EA 5AIPA 1Q1HA 1OYYA 2MH2A 3ECHA 1D8KA 1NHAA 3LA7A 2KKOA 3WGHA 1R7JA 1MZBA 1LDJA 2OBPA 4U7BA 3U9GA 2HYGD 4I7HA 4YIIA 3HHGA 1BOAA 3FHZA 2A68F 1GXPA 2JPCA 5F1RA 4FHTA 3ZMDA 5BOXA 4U0YA 2CO5A 2O8XA 3I58A 4KIFA 5F6FA 3HSFA 2YSRA 2C6YA 2VBYA 2PFBA 2BE5F 4BQAA 1XSDA 2BBYA 3KP5A 4ENMA 3FM5A 3QOPA 1FOKA 4OMZA 4KFCA 4PZJA 4R1HA 3E97A 3DV8A 3ISPA 4KUMA 4LK1F 3C3WA 4KA4A 2FMYA 4UUVA 4L5JA 2STTA 3TQNA 3LSTA 2DK5A 1G6NA 1Z7UA 5CVJA 2DQRA 1F5TA 3R0JA 3BOQA 4FX0A 1IXRC 2CSOA 3RI4A 5LGTA 2QBYA 3H92A 3OOPA 2V1UA 4HV5A 5D8LB 1USSA 3TOAA 3HTSB 1W7PB 4RGUA 4LG0A 2CQKA 3VODA 3MZHA 3MAJA 4KIBA 3MWMA 5DCFA 4PCQA 1KGSA 1BI1A 2V79A 2E7WA 3TOBA 1FT9A 1U5TB 1CF7A 1MDMB 2E1CA 2JZYA 1HSTA 2HQRA 3J80Z 1RUOA 1D5VA 1WWXA 1SD6A 3EETA 4PDKA 4YIFA 1O3TA 1K7AA 2UXNA 2FE3A 5IT9Z 2GAUA 1BJAA 3WTVC 3SZTA 4LGWA 3TKYA 4OIPF 3CLOA 1OMIA 1FSEA 5ILSA 1R22A 2OQRA 5D8KB 1KU7A 2G9WA 3ECOA 2QVOA 1HXDA 4CYDA 2XVCA 1G3SA 3RKYA 1LB2A 2EA4A 1XDUA 1W7PD 3B02A 3GX4X 4BNCA 3IWFA 5E8IA 4KN4X 3M8EA 4L9VA 2H6BA 2P8TA 2K02A 4F7ZA 2DW4A 2A6EF 4ENKA 1E2XA 4IPAA 2DPUA 1ONVA 1FC3A 4BHBA 3JTHA 2ELHA 2BYVE 1YG2A 2HGCA 2ZMEA 4Y17A 1BN5A 1XGSA 1PP7U 2P6TA 2VT3A 4MEYF 4LB5A 4BXUA 5KVRA 1SAXA 5L3DA 3GFMA 4L18B 3WE2A 3WTZA 1J75A 3J81K 1Z9CA 1HW2A 5LGNA 2GA1A 4A6DA 3BJ6A 1T6SA 4ESJA 3LAPA 1IN4A 2OAZA 2XGXA 1EH7A 3WTWC 4MHGA 1OPCA 1J0RA 2D1VA 2DK8A 2OZUA 4AIHA 5LLQA 3ZMTA 3HHHA 2E7XA 2PLYA 2PI0A 1FBUA 1T0FA 4RB3C 3FXRA 2QQ9A 1QBJA 1W4MA 1XB4A 4EQQA 3CUQC 2PG4A 3LQRA 3IHUA 2ACJA 4ZYEA 4Z2YA 2DAOA 3K69A 4IVNA 5D5VB 3T8TA 4I2OA 2ZMEB 2ZCWA 4FX4A 4CO8A 2M87A 1TW2A 4I98B 3SZPA 3L09A 3SFZA 5DUKA 1G4DA 4Q5SF 3RYPA 1YIOA 2YPRA 1XGOA 1EV7A 3VEPA 4UNOA 3RKXA 2XRNA 4MQVA 2W25A 3JSOA 3ZN1A 2J5PA 2DPDA 5EEHA 3W6JB 5H6RA 2TDXA 5DD8A 3FMSA 1AOYA 4Y15A 2DLLA 2EV6A 5JI6A 4ZYHA 4JK1X 1PDNC 1HKTA 3LA2A 2M30A 2NNYA 1I1GA 2EV0A 2X4HA 1R23A 3MCZA 4HV6A 3L2CA 1FP2A 1O7LA 5DUIA 1IRFA 3T5XA 5L3BA 2VT2A 4EGZA 2O0YA 4P55A 4I0BA 3SXYA 4RB0A 4YFKF 1QGPA 5LEJA 5KK1A 2HEOA 1DDNA 3HOSA 2L4AA 2AXLA 2LKPA 4I01A 1W7PA 3I4PA 2HTSA 1ZRDA 2GXGA 2IA2A 4MEXF 3QU3A 2H94A 3CUQB 1TQIA 3G3ZA 4BAYA 2W84A 2GIVA 5D6EA 2P6SA 2Y75A 3V8JA 1S6LA 1LDKB 1FPQA 3F22A 1O3QA 2CG4A 4HA8A 3HUGA 1XGMA 1KU2A 5FD5A 5CJ9A 2NRAC 2FBKA 1I5ZA 5JFRA 2P5LC 2ETHA 1HW1A 3GXOA 2VBWA 4A5NA 3GZ5A 4R8HA 2ESHA 4UVBA 1ON1A 2EFPA 4A6EA 3WGIA 2IA1A 1FY7A 4HDUA 2ZJ2A 4MTDA 2VBXA 2P5KA 3IRRA 1ZYRF 5ICCA 4ZYGA 3ZMSA 2FEZA 3ML6A 3P9KA 3V7CA 4ASNA 3F8CA 1YS7A 3E6BA 3J80K 1PUEE 1H9TA 2FQ3A 3GO5A 1QZYA 2AS5F 4LLLA 1B4AA 4N9HA 4DQ2A 1B9NA 1YW7A 3GF2A 2DQLA 4KN7X 4EM1A 3RPUA 3QP6A 3TO6A 4B8XA 1KU9A 1TNSA 3I59B 3PQJA 5EEGA 3P9IA 2KIMA 2F5EA 1P2FA 2MLKA 3V8LA 2L54A 1BC7C 4M73A 2JTVA 3I71A 2HFHA 2WV0A 2D45A 4L9JA 5FB2A 2RNJA 1KYZA 4CHUA 3VFZA 1ZH5A 1UCRA 1XCBA 2ZNYA 5HDGA 3LQQA 3TDUC 5ICEA 3IWZA 5ILUA 4KMUX 3KLOA 2QBYB 4M9ZA 3H3ZA 2K86A 1JHFA 3MZYA 1ULYA 4RB1A 4LJZF 4P96A 2HKOA 3F72A 1HQCA 1VTNC 4G7ZF 4KIGA 1J59A 3K0LA 4WXHA 4PGHA 2FRHA 1I27A 1K79A 1DUXC 2OD5A 2XASA 4BHPA 1HBXG 1MDMA 4CXFA 4JQFA 4A0YA 1F4KA 2RDPA 5D4RA 4ETSA 3QPTA 2V1XA 4U7DA 5ERIA 3BJOA 5L3CA 1DPUA 2ZBKA 1IXCA 2GA2A 5DD4A 1MJ9A 3ABTA 4PGGA 3TO9A 3FZVA 5E1XA 3KP4A 2XIGA 1PP8F 1BM9A 1LQ1A 2EFNA 3HRSA 3DPLC 2PEXA 2IRFG 3DEUA 4WWCA 3O6BB 3WGGA 1B6AA 1WRJA 3DQVC 2L01A 2Z9OA 1R5GA 1Z1DA 2CWEA 2XAGA 3COAC 1XGNA 1LEBA 2EFOA 5L3FA 1R1UA 3E5UA 2EFWA 5BPIA 1FBSA 5D5WB 3M1EA 2V9VA 1QNTA 1UFMA 5D4SA 2D2WA 1U3EM 2COMA 1FYKA 1TW3A 4RGXA 4O6JA 1IN8A 4CICA 1CGPA 1KQ8A 1S7OA 4NHJA 1XDSA 1P6RA 1R1VA 4MNUA 4OIOF 1OYIA 1Z6RA 2Q0OA 5FGMA 2ZKZA 4Q4ZF 3M9AA 2CW0F 1G3TA 3F3XA 3L7WA 3WU1B 2HR3A 3KCCA 2Q2EA 3QP5A 5D5UB 2GQQA 4D0PA 2M45A 4XLNF 1TNTA 3GFIA 3I53A 4HF2A 4WK8F 2ZFWA 3OV8A 5K5OA 1ZLJA 1IUYA 1BI0A 4A5MA 4EV0A 1UHMA 1U5TA 2H27A 3Q9VA 2LF8A 1I6XA 5JR3A 3K2ZA 2Z99A 3N97A 4ENJA 2FNAA 4AD9A 5FFXA 2MBFA 2MH9A 1Z91A 3SHFA 1YW8A 4LMYA 1X3UA 2FXAA 4KYWA 1FNNA 1S3JA 3JAMZ 5E18F 3E6CC 3ULQB 4CDGA 4G8XA 5H6QA 4KDPA 1JHHA 5FD6A 3IL2A 3V8KA 2Q8KA 1D8JA 2VBZA 1O7FA 4U0VA 5DCMA 2HTJA 1XSXA 3ZP5A 2IA0A 3GYHX 5CVRA 4DNCA 4HAMA 5A2QK 4M74A 4LLGF 1R58A 2NYXA 4U88A 2G7HA 3KFWX 2UWMA 1ZARA 5HS8A 3ZN0A 4G9YA 3FXUA 2O3FA 1GXQA 3K1PA 4OU0A 3I0TA 3R4KA 4N0BA 3KZYA 1R00A 3P7NA 2Z5UA 3PQKA 3RYRA 3CO6C 5HDNA 4EJUA 5E1ZB 5BS6A 2GZWA 1BC8C 4O5VA 3M7GA 3K9TA 4ESFA 3PFIA 4M6YA 4EM0B 2G7UA 1KYWA 1XSVA 1Y0UA 5IT3A 4HLYA 3TGNA 1USTA 2F5CA 3LFKA 4P9FA 5HLGA 3FWEA 2PBIA 4M71A 1BIAA 3QU6A 2HYFA 1IRGA 1RI7A 5DYMA 1J5YA 5TRDA 5J6XA 2R3SA 3C1DA 1ZHFA 1XN7A 1W5SA 2XROA 3W6KB 2XKOA 2CGPA 1V3FA 3WTUC 3MFKA 2DFIA 2P7VB 1ZG5A 2NAZA 5DEQA 1B59A 1QPMA 1QQIA 1FZPB 1SD5A 1XCVA 3J7AO 4HBLA 5JVTA 4KMFA 3F6VA 1BBYA 3ZMVA 3ERED 1BI2A 4E70A 3CO7C 1DP7P 2L4MA 1WI9A 4XSZF 1FWZA 1Z05A 2IJLA 5HDKA 2KIFA 4EJTA 1U78A 1ZN2A 2B0LA 2DI3A 2XKPA 1TQPA 2JPBA 3B73A 5K5RA 3LA3A 2IVMA 3GUDA 1IN6A 2W57A 3BDDA 5H20A 4ENNA 3E6DA 4OIRF 3N4MA 5E1WA 4A0XA 1FYLA 4G7OF 4HW0A 4KT5C 1K78B 3GFJA 4Y13A 4A0ZA 2HKXA 5LHIA 4HF0A 3E5XA 3FMQA 5F64A 1YQAA 4U0WA 1ZRFA 3IKVA 1STZA 3ROUA 5JHUA 3ZMZA 3RPQA 2EB7A 2GXBA 4A12A 2VC0A 4ZYDA 3REOA 1IZ1A 1HKSA 3DKWA 4S05A 2E1NA 2ZO4A 3F21A 3GZ6A 3CDHA 3HRUA 2IP2A 2VE8A 1K6OA 1OYWA 2ZXJA 4HX7A 3FX3A 1KU3A 1ODDA 5IT9K 2UXXA 2K7LA 4Q47A 3HRTA 2WWYA 3RIRA 4LFUA 4QWQA 4EMSA 2UZKA 4M6XA 5FO5A 3DFGA 1R1TA 3RDIA 3GLXA 3KZZA 5ILVA 1H0MA 1J9IA 2YX7A 1ZREA 3MQ0A 5L3GA 1O57A 4Q48A 4CZZA 1S7AA 4IJAA 3S2WA 1KA8A 1SD4A 4G6QA 4RB2C 2Z3YA 3G73A 1XMAA 4XRFA 1B1BA 5HVQC 1U6GA 2CYYA 2FMLA 4IRIA 2HZTA 4GCVA 3HIFA 5TJJA 1I1SA 1YS6A 1MGTA 3CJNA 1EH6A 2LDUA 3F8BA 3FXQA 4NQWA 1YTYA 1JGSA 1V4RA 2XHKA 4WXDA 4IXAA 3WTSC 1Z6TA 1ZLKA 4GYGA 3P9CA 4HX4A 2W85A 1KQ9A 4MGRA 2ESNA 3C18A 5D5XB 3WTYC 4UXNA 4G94A 4LB6B 1MKMA 4TV7A 2QM3A 5J8CA 3C7JA 4WCGA 2MLGA 2IW5A 2EA2A 4IF4A 1UB9A 5LGUA 4P9UA 1SD7A 2XAJA 4WF2A 2R7DA 4RAZA 3E6MA 1WSUA 3BY6A 2J5OA 2EWNA 4KICA 4K2EA 1WQ2A 5K5QA 4LLNA 2A07F 1S8NA 2RKHA 3BROA 3K1MA 2P5VA 3V7RA 1OKRA 3NQOA 1RZ4A 3E3VA 2FBHA 3KP6A 4BYYA 2XAHA 4G6DA 2ISZA 4UHTA 1UHWA 3T8RA 3WU0A 3DXJF 4WXCA 4GO1A 4XLPF 4LK0F 2XUBA 2QZ8A 2XAQA 1BIBA 3KP7A 2XAFA 4GGGA 2VODA 1T98A 1T39A 1G3YA 4NB5A 1IAWA 4AIJA 4EJVA 2PJPA 2QUFA 2V1DA 4N9IA 4P5OA 3JAMK 3T1BA 1P4AA 2NNNA 5LRSA 3F8NA 2V6CA 2QWWA 3HSRA 1IW7F 2QQBA 1XD7A 1GHCA 3D5LA 5FLXK 5LBQA 3I5UA 3KP3A 1ZG3A 4I0AA 2H6CA 2P7CB 3DPTA 2R7FA 1REPC 5HLIA 2A69F 2KJBA 2IT0A 1FP1D 4L0ZB 1G3WA 2EFQA 5CVUA 2L3DA 3R6SA 5ED4A 1AWCA 1FBQA 1P92A 2F2EA 2VE9A 5D6FA 2JRTA 1U5TC 4L5IA 1EH8A 3GWZA 3HOTA 4EM2A 3EYYA 4AVPA 2KIUA 2D1HA 3Q9SA 1JE8A 4RGSA 5E17F 1QZZA 5DDGA 4L9NA 1P4XA 3RJPA 2X0LA 5LRRA 2M8EA 3SQNA 2MC3A 2HDCA 2XV4S 2JSCA 3TO7A 1R5HA 2RN7A 2OA4A 1QO0D 1MD0A 2YX4A 1TQMA 5BMZA 2K4JA 2H09A 1IF1A 4YG2F 2ISYA 3LAJA 2VONA 4IHTA 5J8FA 1IN7A 1C0WA 4RS8A 1SMTA 1OR7A 2WTEA 5K1YA 2FU4A 4EJOA 2RVCA 3O3KA 3F6OA 3J81Z 2EK5A 2WC2A 1YYVA 1KQ0A 4HDVA 3E5QA 4A2UA 2DBBA 1RIOH 5ICGA 3DF8A 2MA3A 1R36A 1LVAA 3JW4A 4UVCA 2OU2A 4RAYA 2Y48A 1FLIA 1JXSA 1YO5C 2A5YB 4CGZA 4IRGA 5LHGA 1FYMA 2FA5A 1YW9A 1O3RA 2VXZA 1RNLA 3VB2A 3JTGA 1TLHB 3EQLF 2O03A 2QENA 3R60A 1LNWA 2STWA 3BP8A 3WE3A 3QRFF 1HSJA 2EJRA 1W5TA 3KP2A 4HQEA 3EDPA 3L00A 1MJBA 1TTYA 3O2PE 3NEUA 5HLHA 4AIKA 4OINF 4MQ9F 2K4BA 2A3SA 4HQMA 4EGYA 1BI3A 4R79A 1ZGAA 2K27A 3MEXA 1WKMA 1IXSB 3D0SA 5AONA 3IKTA 4BHCA 4M72A 1U8RA 3GEZA 3WG9A 2O61A 2ADUA 2FSWA 1CF7B 4ON0A 4MTEA 5A2QZ
chains in the Genus database with same CATH superfamily
3I54A 2A6TA 2K3PA 4XR6A 4CYCA 1LDDA 2YU3A 1TC3C 4UUTA 2DDBA 3BPXA 4FT8A 2MSYA 4HOBA 1ZAOA 1MMDA 3I55I 5M3MJ 4A3JJ 4C3HJ 5FKMA 2QCOA 3BZ6A 1Y39A 3K7AJ 4IRHA 3K4MA 3KEYA 1ZGJA 2TCTA 3CUOA 2Z33A 1W0UA 2KQRA 3GTPJ 3RKWA 1IV6A 1MJAA 2QYOA 3O8GA 1PUFA 2MD5A 3H0DA 3BTJA 2RGVA 1JKPC 1HKQA 3GVAA 2VB6A 2DT5A 3DP7A 3KETA 2M2EA 2EV5A 2LF7A 3HTUA 1B8IB 2UV1A 1Z7LA 2O6GE 4BQOA 2JT1A 3ELKA 3FMRA 2A61A 3KEQA 4M9XA 2BV6A 1IG7A 3GW2A 1TWGJ 2NVYJ 2XRLA 4V19K 1YFHA 2VJIA 4XBFA 4HF1A 3FF5A 5KCMA 3ZQLA 4OMYA 1ZQ3P 2HQNA 1IN5A 1F1ZA 1LUJB 2FJ1A 4OIQF 2DFEA 5E8GA 4ZYAA 3V4GA 3D5RC 2K9MA 3VSKA 3S1NJ 3K1NA 3U2RA 4L9TA 3KEOA 3LSJA 2LKSA 2QLZA 1J2XA 1VQOI 1MNDA 3DBHB 1L0OC 1TWFJ 3CCYA 5ICFA 1A6QA 3HXLA 4UVAA 2F5FA 4XNFA 3BQYA 3CF2A 5J1YA 5M5WJ 2JSPA 2XF5A 2HYJA 4EJWA 1TWHJ 3V42A 3BJAA 3U1DA 1VQPI 1VQ4I 1SMYF 1RKTA 1FX7A 2DTRA 1K61A 1FOYA 4UV9A 2ZNZA 1B72A 1W36C 2GXAA 4HZFA 5AIQA 4IEJA 3I64A 1WJDA 2KP6A 2CV0A 1NG7A 4NC8A 5HS9A 1TBXA 1OR7C 3D1NI 3DPUA 2VN2A 3OL4A 3EUAA 4E4HA 3OWTA 3RQ4A 4A3EJ 3HOYJ 4E7ZA 1HW5A 5KAFC 1Y56A 2BVLA 4E6KG 2FD5A 1D5YA 3JREA 1K78A 2VKVA 2Z1DA 2ZXIA 4S04A 3RTRA 1T38A 4NC7A 5BPDA 3M8FA 4YFNF 1LVKA 1LEAA 4XLFA 2EINH 1AHDP 3GTKJ 1D3YA 3LWFA 3R61A 2R5YB 4G7HF 1A04A 3CCJI 2GOMA 3CJTB 5GTIC 4QIWN 2PX9A 2CJJA 2VOPA 1FOXA 2OQGA 3ABUA 1S29A 2KL4A 2ZSHB 4YFXF 4HYEA 3TBIA 2K40A 3C2GA 4GXOA 1FEXA 2EZLA 3KE2A 4RGRA 3ZPLA 3ZQ7A 5FLMJ 5EGOB 3QPLA 4CUGA 5HOOA 2H8RA 3L9FA 4BBRJ 4A3IJ 4A3BJ 2VLAA 2VKHA 4F52A 4DOZA 5E3MA 3I4MJ 5BNGA 2GWRA 2KT0A 5E20A 3FM3A 4LG3A 2NXNB 2M1BA 2R7VA 2IPQX 1WVRA 1PJRA 2YR2A 4EVIA 3IRQA 1VQ8I 2K9SA 5CYVA 4Y4RA 2BEOA 2OZ6A 3Q5FA 1L3LA 3SFIA 3I56I 1O4XA 5LEKA 3JRCA 2P81A 4AWXB 1F9NA 1JGGA 2BXZA 2KRFA 5DCMB 3NWTA 3L2QA 3HRMA 2OPTA 4S0HB 2DU9A 2O7OA 2BZTA 2LVSA 3JCUC 3VOEA 3GCMA 3IC7A 2M5WA 1T2KA 1ZR2A 1GVDA 5L3EA 4ZDOA 2M7BA 4GYIA 2CRGA 2CFXA 3HYIA 5GAHJ 1ZG1A 3ZRGA 2BHZA 2ICWG 1SFOJ 2PQ8A 4IHSA 3CTAA 3KLNA 3J7ZI 4OOIA 3JRAA 4DBQA 1R49A 2FBIA 3NRVA 1HOMA 2IS2A 4HLXA 1TP4A 1SFEA 5HS7A 4LG0B 1DP3A 2DO7A 4JBAA 1X1BA 2PMHA 2BY3A 2IGKA 3I59A 2L7KA 2OF7A 5CVVA 1O3SA 1D1AA 1ON2A 2PN6A 3BWGA 1G59A 5J4YA 3V7SA 5EYRA 1BL0A 2VJ4A 4ZZDA 2XPVA 4DYQA 2A5WA 1JUMA 3H3UA 3LMMA 2P4WA 3SZGA 5F04A 4QTRA 2RC4A 2XSJC 1XMKA 3F8FA 1R9TJ 3OYMA 1RUNA 5CVIA 1SFUA 5FLXZ 4UY8I 4B09A 3GTLJ 3FBNB 2QKLB 3Q0UA 4UV8A 4ESBA 4WX9A 4D7MA 5CLSA 3K6GA 1X58A 4J01A 2HS5A 3WODF 3CMYA 4HX8A 2K85A 5BQTA 4ZH4F 3LSIA 2FNPA 2W24A 5B5EC 2QQAA 2RV8A 4IQ4A 5B66C 4QLCU 3M4OJ 2PMUA 3GFLA 1VQ5I 2VC1A 4KNYA 3QPHA 3T0YA 4AU7A 3J7YJ 4CCLA 2QEXI 3EUHA 2ZXWH 3OYKA 4BH9A 1GDTA 1LJ9A 2KJCA 4L0YB 2NVQJ 4I09A 1FTTA 4Y33A 1ZKGA 2RQPA 4X1EA 3JSPA 3EYIA 2A6HF 4I02A 4M9SA 3HSEA 3CJRB 5LHHA 2CUZA 3TDZC 3K70D 1OQYA 4ZZLA 4A3MJ 1RR7A 2DFFA 4IO9F 3FIWA 3F8MA 2MGQA 1H9GA 3CUQA 2HOEA 4LIVA 1B9MA 1J7KA 3WTTC 2KFDA 1SFXA 3ZMUA 2M3AA 2WAEA 3I9V2 3SEQA 2LNBA 1FSHA 1GVJA 1U2WA 2HWVA 2FF4A 2Y30A 4O3MA 3S1MJ 5DV5A 4MIMA 1P4WA 2VOOA 2HVQA 1UG2A 4KITB 1OLTA 4BJ5C 2BGCA 3L1PA 1JUSA 2LSOA 3AAFA 3LSPA 2H8WA 4XSXF 3WTXC 1BR1A 2ME6A 2L02A 5EF6A 4LD5A 1ZRCA 1YLFA 2JMWA 1DPRA 2NS0A 4GRIA 3LSRA 3M1CA 1CQTA 3G71I 1E17A 5HODA 3BPVA 2EBIA 3R0AA 2Y0MA 2QSFX 6PAXA 2XGDA 5FFZA 5B1AH 3F23A 1K4TA 1F43A 4CH7A 1V54H 3DBRB 2F5DA 2FOKA 4H0EA 1A31A 5AIPA 5EJCA 1Q1HA 3CCVI 3Q0WA 4BY7J 1WI3A 1OYYA 1Z0XA 2MH2A 3ECHA 4XLHA 1D8KA 2K9QA 2L9NA 1MBGA 3VYUB 1NHAA 4PJMA 1K83J 3LA7A 1KZHA 3SDBA 4B3XA 2KKOA 1UG0A 1WJBA 3WGHA 1HDDC 4U87A 3VYRB 1R7JA 4FE7A 2MFZA 1MZBA 2E34A 5K7FA 4X0GA 1LDJA 2OBPA 2QGUA 4U7BA 1IGNA 5B1BH 3CP8A 3U9GA 2DA3A 3OY9A 2E2HJ 3ZQFA 2HYGD 3RPUD 1XS9A 4I7HA 4YIIA 3CCUI 3HHGA 2WB1N 4FE4A 3HG9A 3HPHA 1BOAA 3FHZA 4E7HA 2XPUA 3G1OA 2A68F 3CC4I 1YIJI 1GXPA 2JPCA 5F1RA 1MBHA 4FHTA 2JVGA 3DKXA 3ZMDA 3JRBA 5BOXA 4AYBN 2VQGA 4U0YA 2CO5A 2O8XA 4PSWA 1MMNA 3I58A 4KIFA 5F6FA 1N75A 3PO2J 5K7HA 3H9QA 2G0EA 1VQ6I 3HSFA 1TL8A 2YSRA 2C6YA 5J1RA 2VBYA 2PFBA 1R4NB 2EZIA 2BE5F 1T56A 4BQAA 3AFHA 2DMQA 1DGWY 3U1KA 3IV5A 1XSDA 3EPZA 3OYLA 2BBYA 1VF9A 3LSMA 2LG4A 3ABKH 3KP5A 1WJCA 1UAAA 4ENMA 3H9JA 3FM5A 1NK3P 3QOPA 1FOKA 1FMWA 2KZVA 4OMZA 4KFCA 4PZJA 4R1HA 2HXOA 3E97A 3FXMA 4C3IJ 3DV8A 3OR1C 3GTGJ 2HPMA 3ISPA 1RRJA 4KUMA 1VQLI 2VPLA 3BTCA 4LK1F 3C3WA 5IY5H 4QSHA 4KA4A 4XQFA 2FMYA 4UUVA 4L5JA 3AG1H 2STTA 3TQNA 2HPIA 2E5ZA 4UB6C 5C4JJ 3LSTA 2L7FP 2DK5A 1G6NA 1Z7UA 2KRHA 3GMEA 1ACIA 1U9OA 5CVJA 4P1WA 2DQRA 1E3PA 1F5TA 1X19A 3R0JA 3BOQA 4AM3A 4FETA 4FX0A 3PM1A 5EGOA 1IXRC 2CSOA 3RI4A 5LGTA 2QBYA 3H92A 2F5VA 3SYTA 1ORKA 3KYDB 3OOPA 2V1UA 4BY1J 2F6CA 1GV5A 2V7FA 4HV5A 4BGDA 3M07A 2LC2A 5D8LB 1USSA 3TOAA 3QPSA 4B3AA 2WAQN 1MH4A 3MN2A 2LY1A 3HTSB 2LOOA 4C30A 3CCRI 2ZJPF 1W7PB 4RGUA 2LK2A 2M4KA 2XSDC 1VQMI 4LG0A 2VKDA 5IOZA 3QQAA 2ZC2A 2CQKA 2E71A 3FXKA 3VODA 2XAUA 4IHYA 3OSGA 3K4BA 3MZHA 1ITYA 3CD6I 3MAJA 2ECBA 3B6CA 1JJ6C 4KIBA 4RLFA 1OCPA 3MWMA 5DCFA 4PCQA 4DIQA 3HC7A 1KGSA 1BI1A 2FX0A 3FHNA 2V79A 4F92B 2E7WA 3TOBA 1FT9A 1U5TB 3DCFA 1CF7A 1MDMB 4IHWA 2E1CA 2JZYA 1HSTA 3CCSI 3EUHC 1W1WE 3OR2C 1P7JA 2HQRA 3J80Z 1RUOA 1D5VA 1WWXA 2XGEA 1SD6A 2R7ZJ 3EETA 4PDKA 4YIFA 1O3TA 2HVSA 1MH3A 1W5CC 3CCQI 1K6YA 3KPHA 3ZOBA 1K7AA 2UXNA 2AQEA 1EJ9A 1XMXA 2FE3A 5IT9Z 3OIOA 3TP3A 2GAUA 2HXIA 4FTHA 1BJAA 3WTVC 1A35A 1IDZA 2MYSA 3SZTA 4LGWA 2VASA 3TKYA 2NOGA 3CLOA 4OIPF 1OMIA 1FSEA 4HSRA 5ILSA 1YI2I 2X6YA 1R22A 2OQRA 4HNTA 1VFCA 5D8KB 1KU7A 2G9WA 3ECOA 2QVOA 4XKBA 1HXDA 4CYDA 2R7WA 1MMGA 2XVCA 3OS2A 1G3SA 1IO2A 3RKYA 1LB2A 5DTDA 3MKZA 2EA4A 3ZQCA 1XDUA 3SJMA 4NBQA 1BA5A 1W7PD 2NVUB 3B02A 3GX4X 4BNCA 2EQRA 2Y0SA 3IWFA 4XICA 5E8IA 1SVOA 4KN4X 3M8EA 4L9VA 2H6BA 2P8TA 2K02A 4F7ZA 2DW4A 2A6EF 4IX7A 4BQNA 4ENKA 1E2XA 3HDDA 4IPAA 2DPUA 1ONVA 3OYEA 1FC3A 2VJ5A 2LFBA 4XN3A 5M5XJ 4ABZA 4BHBA 3JTHA 2BYVE 2ELHA 4XLCA 3TW6A 1YG2A 2HGCA 2ZMEA 4Y17A 1I6HJ 2EH3A 2LH9A 1BN5A 1XGSA 3AKZA 1PP7U 2P6TA 4QPQA 2VT3A 2XGCA 3K4JA 4MEYF 5EZHA 4MO7A 5C3EJ 4LB5A 4BXUA 5KVRA 1SAXA 5L3DA 3GFMA 5M5YJ 1MBEA 4BE0A 4BU2A 1POGA 4L18B 3WE2A 3WTZA 4PJJA 1J75A 4PJ0C 3FK7A 3GZNB 3J81K 1Z9CA 2PJRA 1EF4A 1HW2A 5LGNA 1U0JA 4OAZA 2GA1A 1D0XA 2IGNA 1SVLA 4A6DA 1APLC 2CU7A 3BJ6A 1T6SA 4ESJA 3LAPA 2R92J 1IN4A 3G1LA 3FXLA 1S5LC 2A05A 2OAZA 2NVTJ 2YU9J 2XGXA 1EH7A 3WTWC 4MHGA 1OPCA 1J0RA 1NTCA 2ZFUA 4BL0B 3H3VK 2D1VA 4FQGA 5H2FC 2DK8A 3G6EI 2OZUA 4AIHA 4D5FA 5LLQA 2L2OA 1V5GA 3ZMTA 3PIPF 1JUPA 1BJZA 3BR1A 3HHHA 2E7XA 2PLYA 1VQKI 4RMNA 2PI0A 1FBUA 1T0FA 3PNVA 2BHYA 4RB3C 3FXRA 2QQ9A 3BQZA 1QBJA 1W4MA 1XB4A 3BG6A 5CQGA 3BLYA 4EQQA 1K4SA 3CUQC 4HEA2 4PJLA 2PG4A 3LQRA 3K2AA 1X4OA 3IHUA 2ACJA 1ZR4A 4ZYEA 4Z2YA 2X1CA 2X1DA 4G6TB 2R5ZB 4BACA 3HZJA 5GAGJ 1E0EA 2DAOA 1LE8A 1LPQA 1FIPA 3K69A 1IC8A 3G4SI 4IVNA 5D5VB 4AIDA 5HNFA 3T8TA 4I2OA 2ZMEB 2ZCWA 3OYCA 4FX4A 3DBLB 2X6OA 4CO8A 2M87A 1TW2A 4I98B 2M9HA 4HG2A 3SZPA 3L09A 2I10A 3SFZA 5DUKA 3PIOF 2O5RA 1G4DA 3BR0A 4CCNA 3JRFA 2X85A 3G2BA 3NAUA 2AO9A 2HOAA 1WZ2A 4QPOA 4Q5SF 2W00A 2TRTA 4XOTA 3O8HA 1YIOA 5GPAA 3RYPA 2YPRA 2MABA 4DYCA 4MFDA 1DGRM 1XGOA 1EV7A 2HQ5A 3VEPA 4UNOA 3RKXA 2XRNA 3DU6A 4MQVA 3OYDA 2CMPA 2W25A 3JSOA 3ZN1A 2J5PA 1N77A 2DPDA 5EEHA 2LY9A 3W6JB 5H6RA 5E3OA 4BQQA 2OV7A 2TDXA 4C3JJ 5DD8A 2MW8A 3FMSA 1MNMC 4Y15A 5JLXA 4IOCF 1W36D 1AOYA 2DLLA 3TL4X 3GTJJ 3PSIA 2EV6A 1ETXA 4PK4A 5JI6A 2OUMA 4IKFA 4ZYHA 4JK1X 3WU2C 2P0WA 1PDNC 2QQ8A 1HKTA 3FBIB 3LA2A 1LKXA 2M30A 2NNYA 2L9RA 1I1GA 2EV0A 1JI8A 2X4HA 1RR8C 3H0GJ 1R23A 3MCZA 4V2FA 4HV6A 2R5ZA 2AXTC 3L2CA 2NVXJ 1FP2A 1O7LA 4C9YA 5DUIA 1IRFA 3T5XA 1MMAA 5L3BA 2VT2A 4EGZA 2O0YA 4P55A 4I0BA 3SXYA 5EG0B 2OJED 3L2VA 3D5SC 4RB0A 2E35A 4YFKF 1QGPA 4DBRA 2KRCA 5LEJA 2CUFA 1FIAA 5KK1A 2HEOA 1DDNA 3HOSA 2L4AA 2IS1A 3L2UA 4E7KA 2AXLA 1Y1WJ 2LKPA 2LRDA 2LYCA 4A3FJ 2JA8J 4I01A 1W7PA 3HGGA 3I4PA 1JT0A 2JA6J 2HTSA 2Y2ZA 5EEAA 1ZRDA 2GXGA 1RESA 3HOVJ 2IA2A 1BW6A 1IDYA 1YOVB 4MEXF 3QU3A 2H94A 3CUQB 2GBYA 5M3FJ 1TQIA 3G3ZA 2W84A 2GIVA 5D6EA 4BAYA 1ZELA 1OJLA 2Y75A 2P6SA 2IEKA 3V8JA 1S6LA 3HKZA 1LDKB 1FPQA 3F22A 1O3QA 2CG4A 4HA8A 3HUGA 3AL0C 1R5ID 1XGMA 2LY2A 5IP9J 4V2GA 1I3QJ 1KU2A 3NWSA 1I39A 5FD5A 2Y31A 5CJ9A 3HPGA 3Q3SA 4AUXA 2XC7A 2NRAC 2B7EA 2FBKA 1I5ZA 3OYAA 5JFRA 4XN0A 1V5FA 2P5LC 2ETHA 1HW1A 3GXOA 2VBWA 4A5NA 3GZ5A 1MBJA 4R8HA 2ESHA 4UVBA 5F08A 3OOUA 1ON1A 1WPKA 4RDUA 2M0CA 2EFPA 2EIJH 2WV1A 4ZC3A 2K5CA 2VUMJ 4A6EA 3WGIA 2IA1A 1FY7A 4J19A 1ZGWA 4G12A 4PJNA 4HDUA 2WB1A 2ZJ2A 1VQNI 4LITA 4MTDA 3U21A 2VBXA 5F27A 2P5KA 2XB5A 3IRRA 2DOEA 1ZYRF 4OWRB 5ICCA 2H1LA 3PL8A 4ZYGA 2QKMB 3RZDJ 2R7UA 2FEZA 3ZMSA 3ML6A 1WJAA 3MZ8A 3P9KA 2V1NA 5GTHC 2IBDA 3V7CA 3ESWB 3F8CA 4ASNA 1YS7A 3E6BA 1MIJA 3H5RA 5E3NA 3J80K 1PUEE 1D0YA 1MMSA 1H9TA 2FQ3A 3LOCA 2JWTA 2X6XA 2KMUA 3GO5A 1QZYA 2AS5F 2KDOA 4LLLA 1B4AA 4N9HA 4DQ2A 2DCEA 1B9NA 5DM7F 4XONA 2I8DA 1YW7A 3PNYA 2HI3A 3EUKL 3GF2A 2DQLA 4XOPA 4KN7X 4EM1A 3KYLA 3RPUA 3QP6A 3FKJA 3BCAA 3TO6A 4B8XA 1KU9A 3B6AA 1TNSA 4BDYA 1G8XA 2DDAA 2L9VA 3I59B 3PQJA 5EEGA 5J1UA 3SEZA 3A4CA 3P9IA 2DA5A 2L7ZA 2ZXHA 4BXFA 2F4OB 3BG3A 3A01A 2PJRB 4I76A 2KIMA 2F5EA 3MVPA 4YELA 3DLLF 1P2FA 2MLKA 5JLWA 3V8LA 2L54A 1BC7C 4A3KJ 2YUSA 4M73A 4A3GJ 1P9QC 2JTVA 4NDLA 4ZTFA 2F48A 3I71A 5F0HA 3ZCOA 2HFHA 2WV0A 3AG3H 1GV2A 1Z21A 4YEJA 1GUUA 1IV8A 3HBLA 2D45A 5CQEA 4L9JA 1RC9A 2RNJA 2HQAA 5FB2A 1KYZA 3UKGA 2CFOA 4CHUA 3VFZA 1ZH5A 3E0JB 1UCRA 1B8IA 1XCBA 2ZNYA 5HDGA 1WHUA 1A6IA 3LQQA 4RM2A 1PVEA 4AVZA 3TDUC 5ICEA 3IWZA 5F0FA 1T8IA 5ILUA 2L7MP 4KMUX 4JOMA 2LR8A 2E1OA 3KLOA 2QBYB 2V4JC 4M9ZA 3S2HJ 3H3ZA 2K86A 1HC8A 4CCJA 1JHFA 2AHQA 3MZYA 3QYEA 1ULYA 3OYHA 4RB1A 3AG2H 2WADA 4LJZF 1X2NA 1MSFC 1R71A 5GAEJ 4P96A 5EZGA 2HKOA 3F72A 4DYRA 1HQCA 1YRNB 4JX6A 1QRYA 2JRMA 2LREA 4M3DA 4B43A 4G7ZF 1VTNC 4KIGA 1J59A 1UZCA 9ANTA 1AKHB 4DZPA 5HLTA 3K0LA 4RA2A 4WXHA 5JVGF 3DU5A 4PGHA 3A0HC 2M0MA 2FRHA 1EA3A 1I27A 1K79A 1DUXC 1I3AA 2OD5A 3MMYB 2XASA 2DJIA 4BHPA 2W1OA 1HBXG 2KLOA 1TWAJ 3PNTA 4CXFA 1MDMA 3J7AY 4JQFA 4A0YA 1F4KA 3MKYB 2RDPA 2ZJQF 2E1MC 5D4RA 4ETSA 4E7JA 2ELJA 3QPTA 2ZB9A 2V1XA 2JUCA 3K4CA 1JKQC 4U7DA 3HB9A 1MSEC 5ERIA 2RAEA 4B4CA 1VQ9I 3BJOA 1LFBA 5L3CA 1DPUA 2ZBKA 3ABMH 1IXCA 3QODA 2GA2A 5DD4A 1MJ9A 5KAIC 3ABTA 3OS1A 4PGGA 3TO9A 2IGMA 3FZVA 3CCEI 5E1XA 3KP4A 2XIGA 1PP8F 1ETWA 4BEHA 1BM9A 1LQ1A 2EFNA 3HRSA 3S1RJ 3DPLC 2PEXA 2IRFG 3FXOA 3PJRA 1ETKA 3DEUA 4WWCA 3O6BB 3M8JA 4HPQA 1GT0C 2M7AA 3WGGA 1B6AA 1WRJA 3DQVC 2L01A 5FROA 1R5GA 2Z9OA 1Z1DA 3BR6A 3CQZJ 5F0CA 2CWEA 1DU6A 3CMAI 3S17J 4F55A 2XAGA 3COAC 1ENHA 4C2TA 1XGNA 2JJ7A 1LEBA 2EFOA 3FISA 1YJWI 5L3FA 1R1UA 2ZJRF 3E5UA 3TEDA 2K9LA 2H1KA 2EFWA 3HOZJ 5BPIA 1FBSA 2W82A 5D5WB 5CKTA 1ETOA 2V9VA 3M1EA 1QNTA 1UFMA 5D4SA 1EKEA 2R7TA 2D2WA 1U3EM 5J3LA 2COMA 1FYKA 1TW3A 2WA0A 2V9KA 3ZQGA 4RGXA 3BTLA 2W4SA 4O6JA 3WG7H 5EG0A 1IN8A 4CICA 3QOEA 1CGPA 1KQ8A 4XLAA 1SC7A 4HNUA 4DZJA 1S7OA 1OCTC 1E3HA 4NHJA 4M6VA 1XDSA 1P6RA 1R1VA 4MNUA 1WJFA 1YJNI 4OIOF 1OYIA 1Z6RA 2Q0OA 5FGMA 2ZKZA 4Q4ZF 3M9AA 4MFEA 2CW0F 4Y7NJ 1VI0A 1X1DA 4XM3A 1G3TA 3CCMI 3F3XA 4IL6C 3L7WA 2WAQA 3WU1B 1X3ZB 4LOCA 2HR3A 3KCCA 3F0CA 2Q2EA 3BR2A 3QP5A 1QVUA 5D5UB 1FMVA 1RPWA 2LMDA 2YS9A 1SEUA 3UNGC 2DMPA 2GQQA 4D0PA 4GFBA 2R93J 2V26A 3I4NJ 3VPRA 2M45A 1MNEA 2ID3A 2DOAA 3AL0B 4XLNF 2FOWA 2XF7A 1TNTA 3RZOJ 3GFIA 4JX4A 3I53A 3C2HA 4HF2A 3HUGB 4WK8F 1U9NA 2ZFWA 5LD2C 3MD2A 3OV8A 5K5OA 1ZLJA 3HKZN 4BDZA 1IUYA 1HCRA 3BCBA 1BI0A 4A5MA 4EV0A 1UHMA 1U5TA 3Q0VA 2H27A 4ITVA 3Q9VA 2Y69H 2LF8A 4DJAA 1I6XA 3TMOA 2X6WA 5JR3A 3K2ZA 2Z99A 2X1EA 3N97A 4ENJA 2FNAA 5IP7J 2EZKA 4MLOA 4AD9A 3K70C 5FFXA 2MBFA 2MH9A 1Z91A 3H35A 3SHFA 1YW8A 4LMYA 3ABLH 2Q2EB 1X3UA 2FXAA 2X48A 4KYWA 2FUG2 1FNNA 1S3JA 1PYVA 4NNJA 3JAMZ 5E18F 1KONA 3E6CC 3ULQB 4CDGA 4PFPA 2WBMA 4M3GA 3WHCA 4J00A 2R7XA 4G8XA 5H6QA 4KDPA 1JHHA 5FD6A 3IL2A 3H1CA 3TW7A 3DKYA 4L5EA 2Q8KA 3V8KA 2HU9A 4ZJZA 1D8JA 2EIKH 2WAFA 2VBZA 3OYIA 1O7FA 4U0VA 1XTAA 4BJ6C 5DCMA 2HTJA 2MG4A 1XSXA 1IRZA 1ETQA 2IS4A 3ZP5A 2IA0A 3JR9A 3GYHX 5CVRA 1QU3A 4NC6A 2RNGA 4PFOA 5GP9A 4DNCA 4HAMA 5A2QK 5J4VA 4M74A 4LLGF 1R58A 2DFHA 2NYXA 4U88A 2G7HA 3S3OA 2M8GX 2DYRH 3KFWX 5C44J 5FKLA 2DT6A 4H4KC 3ZR8X 3S16J 2UWMA 1ZARA 4XKCA 4B44A 2DA2A 2JVHA 1Z3YA 5HS8A 1YX5A 3ZN0A 2HOSA 4GDFA 1Z77A 4G9YA 3FXUA 1QHHD 2OCCH 2O3FA 1GXQA 2K9NA 1IRXA 3DEWA 3K1PA 2VXDA 3W2WA 3DLAA 2DXIA 2PMZA 4OU0A 2L0KA 3I0TA 5FLVA 5FRNA 4ZDLA 3R4KA 4B48A 2JA2A 2XDVA 5IP6A 4N0BA 3MKLA 3CF5F 3KZYA 1R00A 3OIPA 3P7NA 2O9LA 2Z5UA 3PQKA 3RYRA 3CO6C 3ERMA 5HDNA 3S3MA 3PUFA 4AC0A 4IHVA 4EJUA 4XORA 4AYBA 4FISA 5E1ZB 3LNQA 5BS6A 1X3WB 5K7ZA 5GADJ 4A3LJ 2GZWA 2I5UA 1BC8C 3K4KA 1QVTA 3QWLA 4O5VA 3M7GA 3IH3A 4KJZA 1HLVA 1ZK8A 1Z67A 2VIXA 3K9TA 4CCMA 4ESFA 3PFIA 4M6YA 4EM0B 2G7UA 2PMZN 2Z2SB 1KYWA 1XSVA 1Y0UA 4F93B 5IT3A 4CYCB 4HLYA 2NS7A 2OC6A 5HNHA 3TGNA 1USTA 2F5CA 3QYBA 3MKWB 3LFKA 3CLQA 4FASD 4P9FA 3W2VA 5HLGA 3FWEA 2PBIA 1Y0NA 4M71A 3L2WA 1BIAA 3QU6A 2CS3A 2HYFA 3IH2A 4D7NA 2DN0A 1IRGA 1RI7A 3S2DJ 3OIQA 5DYMA 1ETVA 4FCYA 1J5YA 3L2RA 5TRDA 1W0TA 3S93A 5F1JA 5J6XA 1IJWC 2R3SA 3C1DA 2GOXB 1HDPA 1ZHFA 1XN7A 2FQ4A 1W5SA 3HJEA 2KHMA 2XROA 3FK6A 3W6KB 5FKNA 2XKOA 2CGPA 4BBSJ 1V3FA 3WTUC 4YIRX 3MFKA 2BOLA 2DFIA 2VKEA 1DQUA 3JRGA 2P7VB 4BE2A 1ZG5A 2COBA 3HOUJ 1XC5A 1JTYA 2LP0A 1S7EA 4D5CA 3JRIA 4IOAF 2NAZA 3UR3C 3HGYA 2WY7Q 1UELB 1JKRC 5KNLA 3RQIA 5DEQA 1T95A 1D1BA 1B59A 1QPMA 1QQIA 1FZPB 4A3CJ 1SD5A 1XCVA 3J7AO 1N25A 2DTZA 4HBLA 5JVTA 1VQ7I 4E7SA 3F9KA 3W3CA 4KMFA 3F6VA 1BBYA 3ZMVA 2DA7A 5JHFA 3ERED 1BI2A 2N8GA 3OSFA 4E70A 3CO7C 1DP7P 3OS0A 4UB8C 4XMYA 2L4MA 4B47A 1WI9A 4XSZF 1FWZA 1Z05A 2IJLA 5HDKA 2BY2A 1QHGA 2KPMA 2KIFA 3NARA 1U78A 4EJTA 3DWLE 4A3DJ 1T0FC 2DOFA 3FKIJ 1ZN2A 4CCKA 1J09A 2B0LA 2DI3A 1OCZH 1JT6A 2XKPA 1TQPA 2JPBA 3B73A 3S1QJ 5K5RA 3LA3A 4BXXJ 2IVMA 3GUDA 1IN6A 2W57A 3KIOA 2CV2A 5IPAA 2EZHA 3BDDA 1RETA 2ZSIB 5H20A 4C2MJ 4ENNA 1WH7A 4BJTA 3E6DA 4OIRF 1S72I 1SAUA 3N4MA 5E1WA 5DM6F 2E2JJ 1UMQA 4A0XA 3PUBA 1FYLA 1G2HA 2CQ7A 4G7OF 4HW0A 4KT5C 1P7IA 1K78B 3GFJA 4RLQA 2DJNA 4Y13A 4A0ZA 2HKXA 1Y6IA 5LHIA 3PFYA 3OYGA 4HF0A 4F91B 1VZ0A 3E5XA 2W7NA 3FMQA 2HDWA 4XLEA 5F64A 1XPXA 1YQAA 4U0WA 1ZRFA 5E3LA 4DW6A 3IH4A 3IKVA 3ASOH 1STZA 2CW7A 2UUZA 3ROUA 1QA6A 5JHUA 2L5QA 2VI6A 3ZMZA 1LFUP 3RPQA 2EB7A 2GXBA 4XKWA 4A12A 3OMYA 2VC0A 1BOBA 4ZYDA 2JUGA 3REOA 1IZ1A 2W48A 4E7IA 4XIDA 1HKSA 3OYFA 3DKWA 1JJ8C 4S05A 3H9GA 2V6EA 2E1NA 3IAM2 2IGOA 1F36A 2BXYA 2ZO4A 3F21A 4HSTA 3ONQA 3GZ6A 3CDHA 1WCMJ 3HRUA 2IP2A 2VE8A 3CDIA 1OYWA 2ZXJA 4HX7A 2KZGA 1K6OA 3FX3A 5J47A 1KU3A 1ODDA 5IT9K 2UXXA 3VYSB 1E3OC 3CZ6A 2EIMH 3IP4B 3ZQHA 3VSLA 2K7LA 3HRTA 4Q47A 1A5JA 2WWYA 2IS6A 3RIRA 4CSWA 2JQ7A 4LFUA 2JN6A 4QWQA 1HA8A 4EMSA 2UZKA 4M6XA 5FO5A 2R4GA 3DFGA 3GTQJ 1R1TA 3RDIA 5EDNA 3GLXA 2HZDA 3LL7A 3S8PA 4B1RA 4A93J 2ECCA 2E5NA 3KZZA 2CW8A 5ILVA 1ERDA 4XRMA 1H0MA 1BR2A 1J9IA 2YX7A 3HEFA 1ZREA 4ZDPA 3LSGA 1X2MA 3MQ0A 5L3GA 1O57A 3BG5A 4Q48A 2EPFA 2MC4A 2BW3A 2ID6A 1S7AA 4IJAA 1BR4A 3BZKA 3OL3A 3S2WA 4CZZA 1KA8A 1SD4A 3CC7I 4G6QA 4RB2C 2LD5A 2Z3YA 3QYFA 3G73A 1XMAA 2LKXA 4XRFA 4Y52J 1B1BA 1A36A 3ASNH 2XB0X 1Q1VA 2QSGX 5HVQC 2Q1ZB 2XPWA 1MBFA 1U6GA 2CYYA 1X1AA 2FMLA 4IRIA 2HZTA 4GCVA 3TP0A 2CUJA 3OYNA 3H36A 3HIFA 5TJJA 1V55H 3DTEA 2F4IA 1I1SA 4M3EA 1YS6A 1MW7A 1MGTA 2LBFA 3CJNA 1EH6A 2R7QA 5GPCA 2LDUA 3F8BA 3FXQA 4NQWA 1IUFA 1YTYA 2AQFA 4LIUA 1YE9A 1JGSA 1TWCJ 5IYBJ 3HOWJ 1AA7A 1V4RA 2XHKA 1WH5A 1N78A 4WXDA 2KIQA 2RQQA 4I6ZA 4IXAA 4ZTJA 4D9JA 1HF0A 5IYCJ 3WTSC 1Z6TA 2GLOA 1ZLKA 2HVRA 4GYGA 3P9CA 4HX4A 1D0ZA 2NS8A 3KZIC 2W85A 1KQ9A 2IXSA 4MGRA 2BY0A 2ESNA 3C18A 4Z6YA 5D5XB 4N4NB 3WTYC 4UXNA 4G94A 4E7LA 4LB6B 1XX5A 1MKMA 4TV7A 2QM3A 5J8CA 2K3FA 3C7JA 4WCGA 3CESA 1SVMA 2MLGA 2DT7B 2IW5A 2EA2A 4IF4A 1UB9A 5LGUA 5FRMA 2VQLA 4P9UA 2Y9YA 2WY8Q 3JRHA 3A01B 1SD7A 5J40A 2BW3B 2XAJA 4WF2A 2VPRA 5FKKA 2R7DA 3H5AA 4A69C 1OCCH 4RAZA 1LE8B 3E6MA 3BR3A 2R0QC 1WSUA 3VWBA 4XRSG 2DYSH 3BY6A 2J5OA 2EWNA 4KICA 4K2EA 5E79C 1WQ2A 2DA4A 3RSNA 3PSFA 5K5QA 3E1SA 4LLNA 2A07F 3BZCA 1S8NA 2BY1A 2RKHA 3BROA 2DA6A 3K1MA 4I99C 4KT6A 2P5VA 3VDXA 1Y1VJ 2IAIA 3V7RA 1OKRA 3NQOA 4F3QA 1NH3A 2HDDA 1RZ4A 4Y3OA 3S14J 3E3VA 2FBHA 1JKOC 1RKWA 3KP6A 4N4OB 3S32A 4XRSA 4BYYA 1X1PA 2DMUA 3BG9A 3K4LA 2XAHA 1OCRH 3HL2A 4G6DA 2ISZA 1R4MB 2JA7J 4UHTA 1UHWA 4NQWB 3T8RA 4IZZA 4BE1A 3WU0A 3DXJF 3FDYA 4WXCA 1AKHA 2CH0A 2ELKA 4GO1A 4XLPF 4HNVA 1Y8RB 3X2QH 4BUPA 1YRNA 4LK0F 1QPIA 2F4MB 4XKVA 2XUBA 1S9HA 2QZ8A 2OCEA 2XAQA 1BIBA 5LFAA 4XL9A 3KP7A 2XAFA 4GGGA 2DMNA 2VODA 3CDLA 3N05A 4W1UA 1T98A 1M1EB 1T39A 1G3YA 4NB5A 1IAWA 4AIJA 4EJVA 4C2UA 3A0BC 2PJPA 4M3BA 1Y8QB 2QUFA 2E60A 3A02A 2V1DA 1WGXA 1TT5B 4N9IA 1I50J 4II3A 3KX2A 4P5OA 3JAMK 3GTOJ 3T1BA 5KHDA 1P4AA 2NNNA 5LRSA 2VL8A 1V5EA 3OYJA 3F8NA 2V6CA 1GLNA 2QWWA 3HSRA 1PUFB 1IW7F 2QQBA 1XD7A 1GHCA 1TT0A 3D5LA 5FLXK 5LBQA 3IAS2 3I5UA 2CUEA 4PUSA 2VJJA 3KP3A 1ZG3A 4BEHB 1SFKA 2E1MB 3BT9A 4I0AA 4PSXA 1NK2P 5FJ8J 2H6CA 3LFUA 1OFCX 2CQQA 4RM3A 1H8AC 2P7CB 3A03A 3DPTA 2R7FA 1REPC 5HLIA 2A69F 3JRDA 1H89C 2QA4I 2EILH 2KJBA 2XF6A 5IYDJ 2IT0A 3ZQQA 3GTMJ 2VQCA 3FXJA 1B72B 3SDGA 1FP1D 3CC2I 1G3WA 4L0ZB 2EFQA 5CVUA 4KISA 2M4GA 3S15J 2L3DA 2GIZA 3R6SA 3CJQB 5ED4A 1OISA 1ZTRA 2LLKA 4BKXA 4DGWB 2Y0SN 1AWCA 1FBQA 4IQJA 1P92A 3HM5A 1U8BA 2F2EA 2VE9A 5C4XJ 3ZQIA 1LFPA 5D6FA 2B63J 1XG1A 2CV1A 2JRTA 1X1CA 1U5TC 1OCOH 4EATA 4L5IA 1EH8A 1NG6A 3GWZA 3HOTA 3PO3J 4EM2A 3EYYA 1WFXA 4AVPA 4JX5A 2KIUA 3BG7A 3K4NA 4D1QA 4YRVA 2D1HA 3Q9SA 1JE8A 2NOJB 4RGSA 5E17F 1QZZA 2DODA 2R7SA 5DDGA 3LSHA 2V9PA 2JA5J 4L9NA 1P4XA 3RJPA 3BC8A 3CP2A 2X0LA 5LRRA 2M8EA 3SQNA 2MC3A 2HDCA 4OAYA 2XV4S 2JSCA 1BW5A 1R5HA 2CQNA 1JTXA 2RN7A 3TO7A 2O8KA 2OA4A 1QO0D 1T08B 1MD0A 2YX4A 2R5YA 1YX3A 1TQMA 2E19A 5BMZA 2K4JA 4CA0A 2RREA 1D1CA 3A1YA 2H09A 4IHXA 3DEEA 1IF1A 4YG2F 1ETYA 2ISYA 5DS9A 1X4PA 4UUSA 5CPRB 3LAJA 3GLLA 2VONA 4CCOA 4W97A 2LBFB 4IHTA 4XK4A 5J8FA 1IN7A 2E36A 1C0WA 4RS8A 1SMTA 2MD0A 1OR7A 2WTEA 3AG4H 5K1YA 2R7RA 2FU4A 2X9DA 2GM4A 4EJOA 1FTZA 2RVCA 3O3KA 3F6OA 2BVMA 3J81Z 1WJ5A 1Z3XA 2EK5A 2WC2A 1YYVA 4II2A 1KQ0A 4HDVA 3E5QA 3G1MA 4M3FA 3DTKA 4A2UA 3IUOA 3BTIA 1WJEA 2DBBA 2L9SA 1RIOH 3P5JA 3HOXJ 2JK3A 3I3LA 5ICGA 3DF8A 4RAFA 5TISC 2MA3A 2OTLI 3W2AA 1R36A 1MBKA 1LVAA 3W6VA 4ANJA 3JW4A 4UVCA 2OU2A 3KYCB 4RAYA 2Y48A 1FLIA 1JXSA 2D5VA 1YO5C 2A5YB 4CZCA 4CGZA 4IRGA 5LHGA 1FYMA 2FA5A 2M34A 1YW9A 1YHQI 1O3RA 1H88C 2HNHA 3K10A 2VXZA 3ZGKA 4JP0A 2R7OA 1RNLA 3M3YJ 1FJLA 3VB2A 3JTGA 3RKQA 1TLHB 4X6AJ 3DTIA 3EQLF 2O03A 2QENA 1TZLA 1YITI 3R60A 5TGTA 1DU0A 1LNWA 2STWA 1SANA 3BP8A 3C2BA 3WE3A 1QZEA 4EEFG 2ME0A 3QRFF 1HSJA 2EJRA 1W5TA 2DMTA 5A2QZ 3KP2A 3CMEI 4NUBA 3ZXSA 2KDZA 3S3NA 3LSKA 4HQEA 3EDPA 2QSHX 3RCOA 4BS9A 2B9SA 3L00A 2Z16A 2LTPA 1MJBA 1TTYA 3A2KA 3O2PE 3NEUA 5FKOA 1FOWA 5HLHA 4UUSB 4AIKA 5B3SH 4OINF 1YJ9I 2HOTA 2CQXA 1T33A 5IOYA 1AU7A 4MQ9F 2K4BA 2A3SA 2X51A 4HQMA 3BR5A 4EGYA 2Y9ZA 1UHSA 3WHBA 1BI3A 4R79A 1ZGAA 2VQHA 2K27A 3VYTB 1VNDA 3MEXA 3GBGA 1WKMA 3OYBA 2KISA 1IXSB 4RBOA 2QF7A 3D0SA 4RAGA 3E7LA 2DA1A 5AONA 3IKTA 4HRIA 2OTJI 4BHCA 1UJ8A 4M72A 1U8RA 3CCLI 3GEZA 3WG9A 2O61A 2ADUA 2E2IJ 2FSWA 3H5NA 1CF7B 4ON0A 3CMMA 4JYKA 4MTEA 2ZMEC 1R6RA 3QAHA
chains in the Genus database with same CATH topology
3I54A 1LDDA 2YU3A 3BPXA 4FT8A 4HOBA 1ZAOA 3BZ6A 4IRHA 1ZGJA 3CUOA 2Z33A 3RKWA 1MJAA 2QYOA 2MD5A 2RGVA 1HKQA 3GVAA 2DT5A 3DP7A 3KETA 2EV5A 2LF7A 3HTUA 2O6GE 2JT1A 3ELKA 3FMRA 2A61A 3KEQA 4M9XA 2BV6A 3GW2A 1YFHA 4XBFA 4HF1A 3FF5A 4OMYA 2HQNA 1IN5A 1F1ZA 4OIQF 5E8GA 3V4GA 3K1NA 3U2RA 4L9TA 3KEOA 2QLZA 1J2XA 1L0OC 5ICFA 4UVAA 2F5FA 4EJWA 3BJAA 3U1DA 1SMYF 1FX7A 2DTRA 4UV9A 2ZNZA 4HZFA 5AIQA 3I64A 5HS9A 1TBXA 2VN2A 1HW5A 1K78A 4S04A 3RTRA 1T38A 5BPDA 3M8FA 4YFNF 1LEAA 1D3YA 3LWFA 3R61A 4G7HF 1A04A 2VOPA 2OQGA 3ABUA 1S29A 4YFXF 4HYEA 4GXOA 3KE2A 4RGRA 3ZPLA 3ZQ7A 5HOOA 3L9FA 2GWRA 5E20A 3FM3A 2M1BA 2IPQX 4EVIA 2YR2A 3IRQA 5CYVA 2BEOA 2OZ6A 3Q5FA 1L3LA 5LEKA 4AWXB 1F9NA 5DCMB 2KRFA 3HRMA 2DU9A 3VOEA 3IC7A 2M5WA 1T2KA 5L3EA 4GYIA 2CFXA 3HYIA 1ZG1A 2PQ8A 4IHSA 3CTAA 3KLNA 4OOIA 2FBIA 3NRVA 4HLXA 1SFEA 5HS7A 4LG0B 2DO7A 4JBAA 2PMHA 3I59A 5CVVA 1O3SA 2PN6A 1ON2A 3BWGA 3V7SA 4ZZDA 3H3UA 2P4WA 2RC4A 1XMKA 3F8FA 1RUNA 5CVIA 1SFUA 5FLXZ 4B09A 4WX9A 4UV8A 4ESBA 5CLSA 2HS5A 3WODF 4HX8A 5BQTA 4ZH4F 2FNPA 2W24A 2QQAA 2RV8A 4QLCU 2PMUA 3GFLA 2VC1A 4KNYA 3QPHA 3T0YA 3EUHA 4BH9A 1LJ9A 2KJCA 4L0YB 4I09A 2RQPA 3JSPA 3EYIA 2A6HF 4I02A 4M9SA 5LHHA 3HSEA 3TDZC 4ZZLA 3F8MA 1H9GA 3CUQA 2HOEA 1B9MA 1J7KA 3WTTC 1SFXA 3ZMUA 3QAHA 2LNBA 1FSHA 1GVJA 1U2WA 2HWVA 2FF4A 4O3MA 5DV5A 1P4WA 2VOOA 2BGCA 3AAFA 2LSOA 4XSXF 3WTXC 2L02A 4LD5A 1ZRCA 1YLFA 1DPRA 2NS0A 1E17A 3BPVA 3R0AA 2Y0MA 6PAXA 5FFZA 3F23A 2F5DA 2FOKA 4H0EA 5AIPA 1Q1HA 1OYYA 2MH2A 3ECHA 1D8KA 1NHAA 3LA7A 2KKOA 3WGHA 1R7JA 1MZBA 1LDJA 2OBPA 4U7BA 3U9GA 2HYGD 4I7HA 4YIIA 3HHGA 1BOAA 3FHZA 2A68F 1GXPA 2JPCA 5F1RA 4FHTA 3ZMDA 5BOXA 4U0YA 2CO5A 2O8XA 3I58A 4KIFA 5F6FA 3HSFA 2YSRA 2C6YA 2VBYA 2PFBA 2BE5F 4BQAA 1XSDA 2BBYA 3KP5A 4ENMA 3FM5A 3QOPA 1FOKA 4OMZA 4KFCA 4PZJA 4R1HA 3E97A 3DV8A 3ISPA 4KUMA 4LK1F 3C3WA 4KA4A 2FMYA 4UUVA 4L5JA 2STTA 3TQNA 3LSTA 2DK5A 1G6NA 1Z7UA 5CVJA 2DQRA 1F5TA 3R0JA 3BOQA 4FX0A 1IXRC 2CSOA 3RI4A 5LGTA 2QBYA 3H92A 3OOPA 2V1UA 4HV5A 5D8LB 1USSA 3TOAA 3HTSB 1W7PB 4RGUA 4LG0A 2CQKA 3VODA 3MZHA 3MAJA 4KIBA 3MWMA 5DCFA 4PCQA 1KGSA 1BI1A 2V79A 2E7WA 3TOBA 1FT9A 1U5TB 1CF7A 1MDMB 2E1CA 2JZYA 1HSTA 2HQRA 3J80Z 1RUOA 1D5VA 1WWXA 1SD6A 3EETA 4PDKA 4YIFA 1O3TA 1K7AA 2UXNA 2FE3A 5IT9Z 2GAUA 1BJAA 3WTVC 3SZTA 4LGWA 3TKYA 4OIPF 3CLOA 1OMIA 1FSEA 5ILSA 1R22A 2OQRA 5D8KB 1KU7A 2G9WA 3ECOA 2QVOA 1HXDA 4CYDA 2XVCA 1G3SA 3RKYA 1LB2A 2EA4A 1XDUA 1W7PD 3B02A 3GX4X 4BNCA 3IWFA 5E8IA 4KN4X 3M8EA 4L9VA 2H6BA 2P8TA 2K02A 4F7ZA 2DW4A 2A6EF 4ENKA 1E2XA 4IPAA 2DPUA 1ONVA 1FC3A 4BHBA 3JTHA 2ELHA 2BYVE 1YG2A 2HGCA 2ZMEA 4Y17A 1BN5A 1XGSA 1PP7U 2P6TA 2VT3A 4MEYF 4LB5A 4BXUA 5KVRA 1SAXA 5L3DA 3GFMA 4L18B 3WE2A 3WTZA 1J75A 3J81K 1Z9CA 1HW2A 5LGNA 2GA1A 4A6DA 3BJ6A 1T6SA 4ESJA 3LAPA 1IN4A 2OAZA 2XGXA 1EH7A 3WTWC 4MHGA 1OPCA 1J0RA 2D1VA 2DK8A 2OZUA 4AIHA 5LLQA 3ZMTA 3HHHA 2E7XA 2PLYA 2PI0A 1FBUA 1T0FA 4RB3C 3FXRA 2QQ9A 1QBJA 1W4MA 1XB4A 4EQQA 3CUQC 2PG4A 3LQRA 3IHUA 2ACJA 4ZYEA 4Z2YA 2DAOA 3K69A 4IVNA 5D5VB 3T8TA 4I2OA 2ZMEB 2ZCWA 4FX4A 4CO8A 2M87A 1TW2A 4I98B 3SZPA 3L09A 3SFZA 5DUKA 1G4DA 4Q5SF 3RYPA 1YIOA 2YPRA 1XGOA 1EV7A 3VEPA 4UNOA 3RKXA 2XRNA 4MQVA 2W25A 3JSOA 3ZN1A 2J5PA 2DPDA 5EEHA 3W6JB 5H6RA 2TDXA 5DD8A 3FMSA 1AOYA 4Y15A 2DLLA 2EV6A 5JI6A 4ZYHA 4JK1X 1PDNC 1HKTA 3LA2A 2M30A 2NNYA 1I1GA 2EV0A 2X4HA 1R23A 3MCZA 4HV6A 3L2CA 1FP2A 1O7LA 5DUIA 1IRFA 3T5XA 5L3BA 2VT2A 4EGZA 2O0YA 4P55A 4I0BA 3SXYA 4RB0A 4YFKF 1QGPA 5LEJA 5KK1A 2HEOA 1DDNA 3HOSA 2L4AA 2AXLA 2LKPA 4I01A 1W7PA 3I4PA 2HTSA 1ZRDA 2GXGA 2IA2A 4MEXF 3QU3A 2H94A 3CUQB 1TQIA 3G3ZA 4BAYA 2W84A 2GIVA 5D6EA 2P6SA 2Y75A 3V8JA 1S6LA 1LDKB 1FPQA 3F22A 1O3QA 2CG4A 4HA8A 3HUGA 1XGMA 1KU2A 5FD5A 5CJ9A 2NRAC 2FBKA 1I5ZA 5JFRA 2P5LC 2ETHA 1HW1A 3GXOA 2VBWA 4A5NA 3GZ5A 4R8HA 2ESHA 4UVBA 1ON1A 2EFPA 4A6EA 3WGIA 2IA1A 1FY7A 4HDUA 2ZJ2A 4MTDA 2VBXA 2P5KA 3IRRA 1ZYRF 5ICCA 4ZYGA 3ZMSA 2FEZA 3ML6A 3P9KA 3V7CA 4ASNA 3F8CA 1YS7A 3E6BA 3J80K 1PUEE 1H9TA 2FQ3A 3GO5A 1QZYA 2AS5F 4LLLA 1B4AA 4N9HA 4DQ2A 1B9NA 1YW7A 3GF2A 2DQLA 4KN7X 4EM1A 3RPUA 3QP6A 3TO6A 4B8XA 1KU9A 1TNSA 3I59B 3PQJA 5EEGA 3P9IA 2KIMA 2F5EA 1P2FA 2MLKA 3V8LA 2L54A 1BC7C 4M73A 2JTVA 3I71A 2HFHA 2WV0A 2D45A 4L9JA 5FB2A 2RNJA 1KYZA 4CHUA 3VFZA 1ZH5A 1UCRA 1XCBA 2ZNYA 5HDGA 3LQQA 3TDUC 5ICEA 3IWZA 5ILUA 4KMUX 3KLOA 2QBYB 4M9ZA 3H3ZA 2K86A 1JHFA 3MZYA 1ULYA 4RB1A 4LJZF 4P96A 2HKOA 3F72A 1HQCA 1VTNC 4G7ZF 4KIGA 1J59A 3K0LA 4WXHA 4PGHA 2FRHA 1I27A 1K79A 1DUXC 2OD5A 2XASA 4BHPA 1HBXG 1MDMA 4CXFA 4JQFA 4A0YA 1F4KA 2RDPA 5D4RA 4ETSA 3QPTA 2V1XA 4U7DA 5ERIA 3BJOA 5L3CA 1DPUA 2ZBKA 1IXCA 2GA2A 5DD4A 1MJ9A 3ABTA 4PGGA 3TO9A 3FZVA 5E1XA 3KP4A 2XIGA 1PP8F 1BM9A 1LQ1A 2EFNA 3HRSA 3DPLC 2PEXA 2IRFG 3DEUA 4WWCA 3O6BB 3WGGA 1B6AA 1WRJA 3DQVC 2L01A 2Z9OA 1R5GA 1Z1DA 2CWEA 2XAGA 3COAC 1XGNA 1LEBA 2EFOA 5L3FA 1R1UA 3E5UA 2EFWA 5BPIA 1FBSA 5D5WB 3M1EA 2V9VA 1QNTA 1UFMA 5D4SA 2D2WA 1U3EM 2COMA 1FYKA 1TW3A 4RGXA 4O6JA 1IN8A 4CICA 1CGPA 1KQ8A 1S7OA 4NHJA 1XDSA 1P6RA 1R1VA 4MNUA 4OIOF 1OYIA 1Z6RA 2Q0OA 5FGMA 2ZKZA 4Q4ZF 3M9AA 2CW0F 1G3TA 3F3XA 3L7WA 3WU1B 2HR3A 3KCCA 2Q2EA 3QP5A 5D5UB 2GQQA 4D0PA 2M45A 4XLNF 1TNTA 3GFIA 3I53A 4HF2A 4WK8F 2ZFWA 3OV8A 5K5OA 1ZLJA 1IUYA 1BI0A 4A5MA 4EV0A 1UHMA 1U5TA 2H27A 3Q9VA 2LF8A 1I6XA 5JR3A 3K2ZA 2Z99A 3N97A 4ENJA 2FNAA 4AD9A 5FFXA 2MBFA 2MH9A 1Z91A 3SHFA 1YW8A 4LMYA 1X3UA 2FXAA 4KYWA 1FNNA 1S3JA 3JAMZ 5E18F 3E6CC 3ULQB 4CDGA 4G8XA 5H6QA 4KDPA 1JHHA 5FD6A 3IL2A 3V8KA 2Q8KA 1D8JA 2VBZA 1O7FA 4U0VA 5DCMA 2HTJA 1XSXA 3ZP5A 2IA0A 3GYHX 5CVRA 4DNCA 4HAMA 5A2QK 4M74A 4LLGF 1R58A 2NYXA 4U88A 2G7HA 3KFWX 2UWMA 1ZARA 5HS8A 3ZN0A 4G9YA 3FXUA 2O3FA 1GXQA 3K1PA 4OU0A 3I0TA 3R4KA 4N0BA 3KZYA 1R00A 3P7NA 2Z5UA 3PQKA 3RYRA 3CO6C 5HDNA 4EJUA 5E1ZB 5BS6A 2GZWA 1BC8C 4O5VA 3M7GA 3K9TA 4ESFA 3PFIA 4M6YA 4EM0B 2G7UA 1KYWA 1XSVA 1Y0UA 5IT3A 4HLYA 3TGNA 1USTA 2F5CA 3LFKA 4P9FA 5HLGA 3FWEA 2PBIA 4M71A 1BIAA 3QU6A 2HYFA 1IRGA 1RI7A 5DYMA 1J5YA 5TRDA 5J6XA 2R3SA 3C1DA 1ZHFA 1XN7A 1W5SA 2XROA 3W6KB 2XKOA 2CGPA 1V3FA 3WTUC 3MFKA 2DFIA 2P7VB 1ZG5A 2NAZA 5DEQA 1B59A 1QPMA 1QQIA 1FZPB 1SD5A 1XCVA 3J7AO 4HBLA 5JVTA 4KMFA 3F6VA 1BBYA 3ZMVA 3ERED 1BI2A 4E70A 3CO7C 1DP7P 2L4MA 1WI9A 4XSZF 1FWZA 1Z05A 2IJLA 5HDKA 2KIFA 4EJTA 1U78A 1ZN2A 2B0LA 2DI3A 2XKPA 1TQPA 2JPBA 3B73A 5K5RA 3LA3A 2IVMA 3GUDA 1IN6A 2W57A 3BDDA 5H20A 4ENNA 3E6DA 4OIRF 3N4MA 5E1WA 4A0XA 1FYLA 4G7OF 4HW0A 4KT5C 1K78B 3GFJA 4Y13A 4A0ZA 2HKXA 5LHIA 4HF0A 3E5XA 3FMQA 5F64A 1YQAA 4U0WA 1ZRFA 3IKVA 1STZA 3ROUA 5JHUA 3ZMZA 3RPQA 2EB7A 2GXBA 4A12A 2VC0A 4ZYDA 3REOA 1IZ1A 1HKSA 3DKWA 4S05A 2E1NA 2ZO4A 3F21A 3GZ6A 3CDHA 3HRUA 2IP2A 2VE8A 1K6OA 1OYWA 2ZXJA 4HX7A 3FX3A 1KU3A 1ODDA 5IT9K 2UXXA 2K7LA 4Q47A 3HRTA 2WWYA 3RIRA 4LFUA 4QWQA 4EMSA 2UZKA 4M6XA 5FO5A 3DFGA 1R1TA 3RDIA 3GLXA 3KZZA 5ILVA 1H0MA 1J9IA 2YX7A 1ZREA 3MQ0A 5L3GA 1O57A 4Q48A 4CZZA 1S7AA 4IJAA 3S2WA 1KA8A 1SD4A 4G6QA 4RB2C 2Z3YA 3G73A 1XMAA 4XRFA 1B1BA 5HVQC 1U6GA 2CYYA 2FMLA 4IRIA 2HZTA 4GCVA 3HIFA 5TJJA 1I1SA 1YS6A 1MGTA 3CJNA 1EH6A 2LDUA 3F8BA 3FXQA 4NQWA 1YTYA 1JGSA 1V4RA 2XHKA 4WXDA 4IXAA 3WTSC 1Z6TA 1ZLKA 4GYGA 3P9CA 4HX4A 2W85A 1KQ9A 4MGRA 2ESNA 3C18A 5D5XB 3WTYC 4UXNA 4G94A 4LB6B 1MKMA 4TV7A 2QM3A 5J8CA 3C7JA 4WCGA 2MLGA 2IW5A 2EA2A 4IF4A 1UB9A 5LGUA 4P9UA 1SD7A 2XAJA 4WF2A 2R7DA 4RAZA 3E6MA 1WSUA 3BY6A 2J5OA 2EWNA 4KICA 4K2EA 1WQ2A 5K5QA 4LLNA 2A07F 1S8NA 2RKHA 3BROA 3K1MA 2P5VA 3V7RA 1OKRA 3NQOA 1RZ4A 3E3VA 2FBHA 3KP6A 4BYYA 2XAHA 4G6DA 2ISZA 4UHTA 1UHWA 3T8RA 3WU0A 3DXJF 4WXCA 4GO1A 4XLPF 4LK0F 2XUBA 2QZ8A 2XAQA 1BIBA 3KP7A 2XAFA 4GGGA 2VODA 1T98A 1T39A 1G3YA 4NB5A 1IAWA 4AIJA 4EJVA 2PJPA 2QUFA 2V1DA 4N9IA 4P5OA 3JAMK 3T1BA 1P4AA 2NNNA 5LRSA 3F8NA 2V6CA 2QWWA 3HSRA 1IW7F 2QQBA 1XD7A 1GHCA 3D5LA 5FLXK 5LBQA 3I5UA 3KP3A 1ZG3A 4I0AA 2H6CA 2P7CB 3DPTA 2R7FA 1REPC 5HLIA 2A69F 2KJBA 2IT0A 1FP1D 4L0ZB 1G3WA 2EFQA 5CVUA 2L3DA 3R6SA 5ED4A 1AWCA 1FBQA 1P92A 2F2EA 2VE9A 5D6FA 2JRTA 1U5TC 4L5IA 1EH8A 3GWZA 3HOTA 4EM2A 3EYYA 4AVPA 2KIUA 2D1HA 3Q9SA 1JE8A 4RGSA 5E17F 1QZZA 5DDGA 4L9NA 1P4XA 3RJPA 2X0LA 5LRRA 2M8EA 3SQNA 2MC3A 2HDCA 2XV4S 2JSCA 3TO7A 1R5HA 2RN7A 2OA4A 1QO0D 1MD0A 2YX4A 1TQMA 5BMZA 2K4JA 2H09A 1IF1A 4YG2F 2ISYA 3LAJA 2VONA 4IHTA 5J8FA 1IN7A 1C0WA 4RS8A 1SMTA 1OR7A 2WTEA 5K1YA 2FU4A 4EJOA 2RVCA 3O3KA 3F6OA 3J81Z 2EK5A 2WC2A 1YYVA 1KQ0A 4HDVA 3E5QA 4A2UA 2DBBA 1RIOH 5ICGA 3DF8A 2MA3A 1R36A 1LVAA 3JW4A 4UVCA 2OU2A 4RAYA 2Y48A 1FLIA 1JXSA 1YO5C 2A5YB 4CGZA 4IRGA 5LHGA 1FYMA 2FA5A 1YW9A 1O3RA 2VXZA 1RNLA 3VB2A 3JTGA 1TLHB 3EQLF 2O03A 2QENA 3R60A 1LNWA 2STWA 3BP8A 3WE3A 3QRFF 1HSJA 2EJRA 1W5TA 3KP2A 4HQEA 3EDPA 3L00A 1MJBA 1TTYA 3O2PE 3NEUA 5HLHA 4AIKA 4OINF 4MQ9F 2K4BA 2A3SA 4HQMA 4EGYA 1BI3A 4R79A 1ZGAA 2K27A 3MEXA 1WKMA 1IXSB 3D0SA 5AONA 3IKTA 4BHCA 4M72A 1U8RA 3GEZA 3WG9A 2O61A 2ADUA 2FSWA 1CF7B 4ON0A 4MTEA 5A2QZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I54 A;  1LDD A;  2YU3 A;  3BPX A;  4FT8 A;  4HOB A;  1ZAO A;  3BZ6 A;  4IRH A;  1ZGJ A;  3CUO A;  2Z33 A;  3RKW A;  1MJA A;  2QYO A;  2MD5 A;  2RGV A;  1HKQ A;  3GVA A;  2DT5 A;  3DP7 A;  3KET A;  2EV5 A;  2LF7 A;  3HTU A;  2O6G E;  2JT1 A;  3ELK A;  3FMR A;  2A61 A;  3KEQ A;  4M9X A;  2BV6 A;  3GW2 A;  1YFH A;  4XBF A;  4HF1 A;  3FF5 A;  4OMY A;  2HQN A;  1IN5 A;  1F1Z A;  4OIQ F;  5E8G A;  3V4G A;  3K1N A;  3U2R A;  4L9T A;  3KEO A;  2QLZ A;  1J2X A;  1L0O C;  5ICF A;  4UVA A;  2F5F A;  4EJW A;  3BJA A;  3U1D A;  1SMY F;  1FX7 A;  2DTR A;  4UV9 A;  2ZNZ A;  4HZF A;  5AIQ A;  3I64 A;  5HS9 A;  1TBX A;  2VN2 A;  1HW5 A;  1K78 A;  4S04 A;  3RTR A;  1T38 A;  5BPD A;  3M8F A;  4YFN F;  1LEA A;  1D3Y A;  3LWF A;  3R61 A;  4G7H F;  1A04 A;  2VOP A;  2OQG A;  3ABU A;  1S29 A;  4YFX F;  4HYE A;  4GXO A;  3KE2 A;  4RGR A;  3ZPL A;  3ZQ7 A;  5HOO A;  3L9F A;  2GWR A;  5E20 A;  3FM3 A;  2M1B A;  2IPQ X;  4EVI A;  2YR2 A;  3IRQ A;  5CYV A;  2BEO A;  2OZ6 A;  3Q5F A;  1L3L A;  5LEK A;  4AWX B;  1F9N A;  5DCM B;  2KRF A;  3HRM A;  2DU9 A;  3VOE A;  3IC7 A;  2M5W A;  1T2K A;  5L3E A;  4GYI A;  2CFX A;  3HYI A;  1ZG1 A;  2PQ8 A;  4IHS A;  3CTA A;  3KLN A;  4OOI A;  2FBI A;  3NRV A;  4HLX A;  1SFE A;  5HS7 A;  4LG0 B;  2DO7 A;  4JBA A;  2PMH A;  3I59 A;  5CVV A;  1O3S A;  2PN6 A;  1ON2 A;  3BWG A;  3V7S A;  4ZZD A;  3H3U A;  2P4W A;  2RC4 A;  1XMK A;  3F8F A;  1RUN A;  5CVI A;  1SFU A;  5FLX Z;  4B09 A;  4WX9 A;  4UV8 A;  4ESB A;  5CLS A;  2HS5 A;  3WOD F;  4HX8 A;  5BQT A;  4ZH4 F;  2FNP A;  2W24 A;  2QQA A;  2RV8 A;  4QLC U;  2PMU A;  3GFL A;  2VC1 A;  4KNY A;  3QPH A;  3T0Y A;  3EUH A;  4BH9 A;  1LJ9 A;  2KJC A;  4L0Y B;  4I09 A;  2RQP A;  3JSP A;  3EYI A;  2A6H F;  4I02 A;  4M9S A;  5LHH A;  3HSE A;  3TDZ C;  4ZZL A;  3F8M A;  1H9G A;  3CUQ A;  2HOE A;  1B9M A;  1J7K A;  3WTT C;  1SFX A;  3ZMU A;  3QAH A;  2LNB A;  1FSH A;  1GVJ A;  1U2W A;  2HWV A;  2FF4 A;  4O3M A;  5DV5 A;  1P4W A;  2VOO A;  2BGC A;  3AAF A;  2LSO A;  4XSX F;  3WTX C;  2L02 A;  4LD5 A;  1ZRC A;  1YLF A;  1DPR A;  2NS0 A;  1E17 A;  3BPV A;  3R0A A;  2Y0M A;  6PAX A;  5FFZ A;  3F23 A;  2F5D A;  2FOK A;  4H0E A;  5AIP A;  1Q1H A;  1OYY A;  2MH2 A;  3ECH A;  1D8K A;  1NHA A;  3LA7 A;  2KKO A;  3WGH A;  1R7J A;  1MZB A;  1LDJ A;  2OBP A;  4U7B A;  3U9G A;  2HYG D;  4I7H A;  4YII A;  3HHG A;  1BOA A;  3FHZ A;  2A68 F;  1GXP A;  2JPC A;  5F1R A;  4FHT A;  3ZMD A;  5BOX A;  4U0Y A;  2CO5 A;  2O8X A;  3I58 A;  4KIF A;  5F6F A;  3HSF A;  2YSR A;  2C6Y A;  2VBY A;  2PFB A;  2BE5 F;  4BQA A;  1XSD A;  2BBY A;  3KP5 A;  4ENM A;  3FM5 A;  3QOP A;  1FOK A;  4OMZ A;  4KFC A;  4PZJ A;  4R1H A;  3E97 A;  3DV8 A;  3ISP A;  4KUM A;  4LK1 F;  3C3W A;  4KA4 A;  2FMY A;  4UUV A;  4L5J A;  2STT A;  3TQN A;  3LST A;  2DK5 A;  1G6N A;  1Z7U A;  5CVJ A;  2DQR A;  1F5T A;  3R0J A;  3BOQ A;  4FX0 A;  1IXR C;  2CSO A;  3RI4 A;  5LGT A;  2QBY A;  3H92 A;  3OOP A;  2V1U A;  4HV5 A;  5D8L B;  1USS A;  3TOA A;  3HTS B;  1W7P B;  4RGU A;  4LG0 A;  2CQK A;  3VOD A;  3MZH A;  3MAJ A;  4KIB A;  3MWM A;  5DCF A;  4PCQ A;  1KGS A;  1BI1 A;  2V79 A;  2E7W A;  3TOB A;  1FT9 A;  1U5T B;  1CF7 A;  1MDM B;  2E1C A;  2JZY A;  1HST A;  2HQR A;  3J80 Z;  1RUO A;  1D5V A;  1WWX A;  1SD6 A;  3EET A;  4PDK A;  4YIF A;  1O3T A;  1K7A A;  2UXN A;  2FE3 A;  5IT9 Z;  2GAU A;  1BJA A;  3WTV C;  3SZT A;  4LGW A;  3TKY A;  4OIP F;  3CLO A;  1OMI A;  1FSE A;  5ILS A;  1R22 A;  2OQR A;  5D8K B;  1KU7 A;  2G9W A;  3ECO A;  2QVO A;  1HXD A;  4CYD A;  2XVC A;  1G3S A;  3RKY A;  1LB2 A;  2EA4 A;  1XDU A;  1W7P D;  3B02 A;  3GX4 X;  4BNC A;  3IWF A;  5E8I A;  4KN4 X;  3M8E A;  4L9V A;  2H6B A;  2P8T A;  2K02 A;  4F7Z A;  2DW4 A;  2A6E F;  4ENK A;  1E2X A;  4IPA A;  2DPU A;  1ONV A;  1FC3 A;  4BHB A;  3JTH A;  2ELH A;  2BYV E;  1YG2 A;  2HGC A;  2ZME A;  4Y17 A;  1BN5 A;  1XGS A;  1PP7 U;  2P6T A;  2VT3 A;  4MEY F;  4LB5 A;  4BXU A;  5KVR A;  1SAX A;  5L3D A;  3GFM A;  4L18 B;  3WE2 A;  3WTZ A;  1J75 A;  3J81 K;  1Z9C A;  1HW2 A;  5LGN A;  2GA1 A;  4A6D A;  3BJ6 A;  1T6S A;  4ESJ A;  3LAP A;  1IN4 A;  2OAZ A;  2XGX A;  1EH7 A;  3WTW C;  4MHG A;  1OPC A;  1J0R A;  2D1V A;  2DK8 A;  2OZU A;  4AIH A;  5LLQ A;  3ZMT A;  3HHH A;  2E7X A;  2PLY A;  2PI0 A;  1FBU A;  1T0F A;  4RB3 C;  3FXR A;  2QQ9 A;  1QBJ A;  1W4M A;  1XB4 A;  4EQQ A;  3CUQ C;  2PG4 A;  3LQR A;  3IHU A;  2ACJ A;  4ZYE A;  4Z2Y A;  2DAO A;  3K69 A;  4IVN A;  5D5V B;  3T8T A;  4I2O A;  2ZME B;  2ZCW A;  4FX4 A;  4CO8 A;  2M87 A;  1TW2 A;  4I98 B;  3SZP A;  3L09 A;  3SFZ A;  5DUK A;  1G4D A;  4Q5S F;  3RYP A;  1YIO A;  2YPR A;  1XGO A;  1EV7 A;  3VEP A;  4UNO A;  3RKX A;  2XRN A;  4MQV A;  2W25 A;  3JSO A;  3ZN1 A;  2J5P A;  2DPD A;  5EEH A;  3W6J B;  5H6R A;  2TDX A;  5DD8 A;  3FMS A;  1AOY A;  4Y15 A;  2DLL A;  2EV6 A;  5JI6 A;  4ZYH A;  4JK1 X;  1PDN C;  1HKT A;  3LA2 A;  2M30 A;  2NNY A;  1I1G A;  2EV0 A;  2X4H A;  1R23 A;  3MCZ A;  4HV6 A;  3L2C A;  1FP2 A;  1O7L A;  5DUI A;  1IRF A;  3T5X A;  5L3B A;  2VT2 A;  4EGZ A;  2O0Y A;  4P55 A;  4I0B A;  3SXY A;  4RB0 A;  4YFK F;  1QGP A;  5LEJ A;  5KK1 A;  2HEO A;  1DDN A;  3HOS A;  2L4A A;  2AXL A;  2LKP A;  4I01 A;  1W7P A;  3I4P A;  2HTS A;  1ZRD A;  2GXG A;  2IA2 A;  4MEX F;  3QU3 A;  2H94 A;  3CUQ B;  1TQI A;  3G3Z A;  4BAY A;  2W84 A;  2GIV A;  5D6E A;  2P6S A;  2Y75 A;  3V8J A;  1S6L A;  1LDK B;  1FPQ A;  3F22 A;  1O3Q A;  2CG4 A;  4HA8 A;  3HUG A;  1XGM A;  1KU2 A;  5FD5 A;  5CJ9 A;  2NRA C;  2FBK A;  1I5Z A;  5JFR A;  2P5L C;  2ETH A;  1HW1 A;  3GXO A;  2VBW A;  4A5N A;  3GZ5 A;  4R8H A;  2ESH A;  4UVB A;  1ON1 A;  2EFP A;  4A6E A;  3WGI A;  2IA1 A;  1FY7 A;  4HDU A;  2ZJ2 A;  4MTD A;  2VBX A;  2P5K A;  3IRR A;  1ZYR F;  5ICC A;  4ZYG A;  3ZMS A;  2FEZ A;  3ML6 A;  3P9K A;  3V7C A;  4ASN A;  3F8C A;  1YS7 A;  3E6B A;  3J80 K;  1PUE E;  1H9T A;  2FQ3 A;  3GO5 A;  1QZY A;  2AS5 F;  4LLL A;  1B4A A;  4N9H A;  4DQ2 A;  1B9N A;  1YW7 A;  3GF2 A;  2DQL A;  4KN7 X;  4EM1 A;  3RPU A;  3QP6 A;  3TO6 A;  4B8X A;  1KU9 A;  1TNS A;  3I59 B;  3PQJ A;  5EEG A;  3P9I A;  2KIM A;  2F5E A;  1P2F A;  2MLK A;  3V8L A;  2L54 A;  1BC7 C;  4M73 A;  2JTV A;  3I71 A;  2HFH A;  2WV0 A;  2D45 A;  4L9J A;  5FB2 A;  2RNJ A;  1KYZ A;  4CHU A;  3VFZ A;  1ZH5 A;  1UCR A;  1XCB A;  2ZNY A;  5HDG A;  3LQQ A;  3TDU C;  5ICE A;  3IWZ A;  5ILU A;  4KMU X;  3KLO A;  2QBY B;  4M9Z A;  3H3Z A;  2K86 A;  1JHF A;  3MZY A;  1ULY A;  4RB1 A;  4LJZ F;  4P96 A;  2HKO A;  3F72 A;  1HQC A;  1VTN C;  4G7Z F;  4KIG A;  1J59 A;  3K0L A;  4WXH A;  4PGH A;  2FRH A;  1I27 A;  1K79 A;  1DUX C;  2OD5 A;  2XAS A;  4BHP A;  1HBX G;  1MDM A;  4CXF A;  4JQF A;  4A0Y A;  1F4K A;  2RDP A;  5D4R A;  4ETS A;  3QPT A;  2V1X A;  4U7D A;  5ERI A;  3BJO A;  5L3C A;  1DPU A;  2ZBK A;  1IXC A;  2GA2 A;  5DD4 A;  1MJ9 A;  3ABT A;  4PGG A;  3TO9 A;  3FZV A;  5E1X A;  3KP4 A;  2XIG A;  1PP8 F;  1BM9 A;  1LQ1 A;  2EFN A;  3HRS A;  3DPL C;  2PEX A;  2IRF G;  3DEU A;  4WWC A;  3O6B B;  3WGG A;  1B6A A;  1WRJ A;  3DQV C;  2L01 A;  2Z9O A;  1R5G A;  1Z1D A;  2CWE A;  2XAG A;  3COA C;  1XGN A;  1LEB A;  2EFO A;  5L3F A;  1R1U A;  3E5U A;  2EFW A;  5BPI A;  1FBS A;  5D5W B;  3M1E A;  2V9V A;  1QNT A;  1UFM A;  5D4S A;  2D2W A;  1U3E M;  2COM A;  1FYK A;  1TW3 A;  4RGX A;  4O6J A;  1IN8 A;  4CIC A;  1CGP A;  1KQ8 A;  1S7O A;  4NHJ A;  1XDS A;  1P6R A;  1R1V A;  4MNU A;  4OIO F;  1OYI A;  1Z6R A;  2Q0O A;  5FGM A;  2ZKZ A;  4Q4Z F;  3M9A A;  2CW0 F;  1G3T A;  3F3X A;  3L7W A;  3WU1 B;  2HR3 A;  3KCC A;  2Q2E A;  3QP5 A;  5D5U B;  2GQQ A;  4D0P A;  2M45 A;  4XLN F;  1TNT A;  3GFI A;  3I53 A;  4HF2 A;  4WK8 F;  2ZFW A;  3OV8 A;  5K5O A;  1ZLJ A;  1IUY A;  1BI0 A;  4A5M A;  4EV0 A;  1UHM A;  1U5T A;  2H27 A;  3Q9V A;  2LF8 A;  1I6X A;  5JR3 A;  3K2Z A;  2Z99 A;  3N97 A;  4ENJ A;  2FNA A;  4AD9 A;  5FFX A;  2MBF A;  2MH9 A;  1Z91 A;  3SHF A;  1YW8 A;  4LMY A;  1X3U A;  2FXA A;  4KYW A;  1FNN A;  1S3J A;  3JAM Z;  5E18 F;  3E6C C;  3ULQ B;  4CDG A;  4G8X A;  5H6Q A;  4KDP A;  1JHH A;  5FD6 A;  3IL2 A;  3V8K A;  2Q8K A;  1D8J A;  2VBZ A;  1O7F A;  4U0V A;  5DCM A;  2HTJ A;  1XSX A;  3ZP5 A;  2IA0 A;  3GYH X;  5CVR A;  4DNC A;  4HAM A;  5A2Q K;  4M74 A;  4LLG F;  1R58 A;  2NYX A;  4U88 A;  2G7H A;  3KFW X;  2UWM A;  1ZAR A;  5HS8 A;  3ZN0 A;  4G9Y A;  3FXU A;  2O3F A;  1GXQ A;  3K1P A;  4OU0 A;  3I0T A;  3R4K A;  4N0B A;  3KZY A;  1R00 A;  3P7N A;  2Z5U A;  3PQK A;  3RYR A;  3CO6 C;  5HDN A;  4EJU A;  5E1Z B;  5BS6 A;  2GZW A;  1BC8 C;  4O5V A;  3M7G A;  3K9T A;  4ESF A;  3PFI A;  4M6Y A;  4EM0 B;  2G7U A;  1KYW A;  1XSV A;  1Y0U A;  5IT3 A;  4HLY A;  3TGN A;  1UST A;  2F5C A;  3LFK A;  4P9F A;  5HLG A;  3FWE A;  2PBI A;  4M71 A;  1BIA A;  3QU6 A;  2HYF A;  1IRG A;  1RI7 A;  5DYM A;  1J5Y A;  5TRD A;  5J6X A;  2R3S A;  3C1D A;  1ZHF A;  1XN7 A;  1W5S A;  2XRO A;  3W6K B;  2XKO A;  2CGP A;  1V3F A;  3WTU C;  3MFK A;  2DFI A;  2P7V B;  1ZG5 A;  2NAZ A;  5DEQ A;  1B59 A;  1QPM A;  1QQI A;  1FZP B;  1SD5 A;  1XCV A;  3J7A O;  4HBL A;  5JVT A;  4KMF A;  3F6V A;  1BBY A;  3ZMV A;  3ERE D;  1BI2 A;  4E70 A;  3CO7 C;  1DP7 P;  2L4M A;  1WI9 A;  4XSZ F;  1FWZ A;  1Z05 A;  2IJL A;  5HDK A;  2KIF A;  4EJT A;  1U78 A;  1ZN2 A;  2B0L A;  2DI3 A;  2XKP A;  1TQP A;  2JPB A;  3B73 A;  5K5R A;  3LA3 A;  2IVM A;  3GUD A;  1IN6 A;  2W57 A;  3BDD A;  5H20 A;  4ENN A;  3E6D A;  4OIR F;  3N4M A;  5E1W A;  4A0X A;  1FYL A;  4G7O F;  4HW0 A;  4KT5 C;  1K78 B;  3GFJ A;  4Y13 A;  4A0Z A;  2HKX A;  5LHI A;  4HF0 A;  3E5X A;  3FMQ A;  5F64 A;  1YQA A;  4U0W A;  1ZRF A;  3IKV A;  1STZ A;  3ROU A;  5JHU A;  3ZMZ A;  3RPQ A;  2EB7 A;  2GXB A;  4A12 A;  2VC0 A;  4ZYD A;  3REO A;  1IZ1 A;  1HKS A;  3DKW A;  4S05 A;  2E1N A;  2ZO4 A;  3F21 A;  3GZ6 A;  3CDH A;  3HRU A;  2IP2 A;  2VE8 A;  1K6O A;  1OYW A;  2ZXJ A;  4HX7 A;  3FX3 A;  1KU3 A;  1ODD A;  5IT9 K;  2UXX A;  2K7L A;  4Q47 A;  3HRT A;  2WWY A;  3RIR A;  4LFU A;  4QWQ A;  4EMS A;  2UZK A;  4M6X A;  5FO5 A;  3DFG A;  1R1T A;  3RDI A;  3GLX A;  3KZZ A;  5ILV A;  1H0M A;  1J9I A;  2YX7 A;  1ZRE A;  3MQ0 A;  5L3G A;  1O57 A;  4Q48 A;  4CZZ A;  1S7A A;  4IJA A;  3S2W A;  1KA8 A;  1SD4 A;  4G6Q A;  4RB2 C;  2Z3Y A;  3G73 A;  1XMA A;  4XRF A;  1B1B A;  5HVQ C;  1U6G A;  2CYY A;  2FML A;  4IRI A;  2HZT A;  4GCV A;  3HIF A;  5TJJ A;  1I1S A;  1YS6 A;  1MGT A;  3CJN A;  1EH6 A;  2LDU A;  3F8B A;  3FXQ A;  4NQW A;  1YTY A;  1JGS A;  1V4R A;  2XHK A;  4WXD A;  4IXA A;  3WTS C;  1Z6T A;  1ZLK A;  4GYG A;  3P9C A;  4HX4 A;  2W85 A;  1KQ9 A;  4MGR A;  2ESN A;  3C18 A;  5D5X B;  3WTY C;  4UXN A;  4G94 A;  4LB6 B;  1MKM A;  4TV7 A;  2QM3 A;  5J8C A;  3C7J A;  4WCG A;  2MLG A;  2IW5 A;  2EA2 A;  4IF4 A;  1UB9 A;  5LGU A;  4P9U A;  1SD7 A;  2XAJ A;  4WF2 A;  2R7D A;  4RAZ A;  3E6M A;  1WSU A;  3BY6 A;  2J5O A;  2EWN A;  4KIC A;  4K2E A;  1WQ2 A;  5K5Q A;  4LLN A;  2A07 F;  1S8N A;  2RKH A;  3BRO A;  3K1M A;  2P5V A;  3V7R A;  1OKR A;  3NQO A;  1RZ4 A;  3E3V A;  2FBH A;  3KP6 A;  4BYY A;  2XAH A;  4G6D A;  2ISZ A;  4UHT A;  1UHW A;  3T8R A;  3WU0 A;  3DXJ F;  4WXC A;  4GO1 A;  4XLP F;  4LK0 F;  2XUB A;  2QZ8 A;  2XAQ A;  1BIB A;  3KP7 A;  2XAF A;  4GGG A;  2VOD A;  1T98 A;  1T39 A;  1G3Y A;  4NB5 A;  1IAW A;  4AIJ A;  4EJV A;  2PJP A;  2QUF A;  2V1D A;  4N9I A;  4P5O A;  3JAM K;  3T1B A;  1P4A A;  2NNN A;  5LRS A;  3F8N A;  2V6C A;  2QWW A;  3HSR A;  1IW7 F;  2QQB A;  1XD7 A;  1GHC A;  3D5L A;  5FLX K;  5LBQ A;  3I5U A;  3KP3 A;  1ZG3 A;  4I0A A;  2H6C A;  2P7C B;  3DPT A;  2R7F A;  1REP C;  5HLI A;  2A69 F;  2KJB A;  2IT0 A;  1FP1 D;  4L0Z B;  1G3W A;  2EFQ A;  5CVU A;  2L3D A;  3R6S A;  5ED4 A;  1AWC A;  1FBQ A;  1P92 A;  2F2E A;  2VE9 A;  5D6F A;  2JRT A;  1U5T C;  4L5I A;  1EH8 A;  3GWZ A;  3HOT A;  4EM2 A;  3EYY A;  4AVP A;  2KIU A;  2D1H A;  3Q9S A;  1JE8 A;  4RGS A;  5E17 F;  1QZZ A;  5DDG A;  4L9N A;  1P4X A;  3RJP A;  2X0L A;  5LRR A;  2M8E A;  3SQN A;  2MC3 A;  2HDC A;  2XV4 S;  2JSC A;  3TO7 A;  1R5H A;  2RN7 A;  2OA4 A;  1QO0 D;  1MD0 A;  2YX4 A;  1TQM A;  5BMZ A;  2K4J A;  2H09 A;  1IF1 A;  4YG2 F;  2ISY A;  3LAJ A;  2VON A;  4IHT A;  5J8F A;  1IN7 A;  1C0W A;  4RS8 A;  1SMT A;  1OR7 A;  2WTE A;  5K1Y A;  2FU4 A;  4EJO A;  2RVC A;  3O3K A;  3F6O A;  3J81 Z;  2EK5 A;  2WC2 A;  1YYV A;  1KQ0 A;  4HDV A;  3E5Q A;  4A2U A;  2DBB A;  1RIO H;  5ICG A;  3DF8 A;  2MA3 A;  1R36 A;  1LVA A;  3JW4 A;  4UVC A;  2OU2 A;  4RAY A;  2Y48 A;  1FLI A;  1JXS A;  1YO5 C;  2A5Y B;  4CGZ A;  4IRG A;  5LHG A;  1FYM A;  2FA5 A;  1YW9 A;  1O3R A;  2VXZ A;  1RNL A;  3VB2 A;  3JTG A;  1TLH B;  3EQL F;  2O03 A;  2QEN A;  3R60 A;  1LNW A;  2STW A;  3BP8 A;  3WE3 A;  3QRF F;  1HSJ A;  2EJR A;  1W5T A;  3KP2 A;  4HQE A;  3EDP A;  3L00 A;  1MJB A;  1TTY A;  3O2P E;  3NEU A;  5HLH A;  4AIK A;  4OIN F;  4MQ9 F;  2K4B A;  2A3S A;  4HQM A;  4EGY A;  1BI3 A;  4R79 A;  1ZGA A;  2K27 A;  3MEX A;  1WKM A;  1IXS B;  3D0S A;  5AON A;  3IKT A;  4BHC A;  4M72 A;  1U8R A;  3GEZ A;  3WG9 A;  2O61 A;  2ADU A;  2FSW A;  1CF7 B;  4ON0 A;  4MTE A;  5A2Q Z; 
#chains in the Genus database with same CATH topology
 3I54 A;  2A6T A;  2K3P A;  4XR6 A;  4CYC A;  1LDD A;  2YU3 A;  1TC3 C;  4UUT A;  2DDB A;  3BPX A;  4FT8 A;  2MSY A;  4HOB A;  1ZAO A;  1MMD A;  3I55 I;  5M3M J;  4A3J J;  4C3H J;  5FKM A;  2QCO A;  3BZ6 A;  1Y39 A;  3K7A J;  4IRH A;  3K4M A;  3KEY A;  1ZGJ A;  2TCT A;  3CUO A;  2Z33 A;  1W0U A;  2KQR A;  3GTP J;  3RKW A;  1IV6 A;  1MJA A;  2QYO A;  3O8G A;  1PUF A;  2MD5 A;  3H0D A;  3BTJ A;  2RGV A;  1JKP C;  1HKQ A;  3GVA A;  2VB6 A;  2DT5 A;  3DP7 A;  3KET A;  2M2E A;  2EV5 A;  2LF7 A;  3HTU A;  1B8I B;  2UV1 A;  1Z7L A;  2O6G E;  4BQO A;  2JT1 A;  3ELK A;  3FMR A;  2A61 A;  3KEQ A;  4M9X A;  2BV6 A;  1IG7 A;  3GW2 A;  1TWG J;  2NVY J;  2XRL A;  4V19 K;  1YFH A;  2VJI A;  4XBF A;  4HF1 A;  3FF5 A;  5KCM A;  3ZQL A;  4OMY A;  1ZQ3 P;  2HQN A;  1IN5 A;  1F1Z A;  1LUJ B;  2FJ1 A;  4OIQ F;  2DFE A;  5E8G A;  4ZYA A;  3V4G A;  3D5R C;  2K9M A;  3VSK A;  3S1N J;  3K1N A;  3U2R A;  4L9T A;  3KEO A;  3LSJ A;  2LKS A;  2QLZ A;  1J2X A;  1VQO I;  1MND A;  3DBH B;  1L0O C;  1TWF J;  3CCY A;  5ICF A;  1A6Q A;  3HXL A;  4UVA A;  2F5F A;  4XNF A;  3BQY A;  3CF2 A;  5J1Y A;  5M5W J;  2JSP A;  2XF5 A;  2HYJ A;  4EJW A;  1TWH J;  3V42 A;  3BJA A;  3U1D A;  1VQP I;  1VQ4 I;  1SMY F;  1RKT A;  1FX7 A;  2DTR A;  1K61 A;  1FOY A;  4UV9 A;  2ZNZ A;  1B72 A;  1W36 C;  2GXA A;  4HZF A;  5AIQ A;  4IEJ A;  3I64 A;  1WJD A;  2KP6 A;  2CV0 A;  1NG7 A;  4NC8 A;  5HS9 A;  1TBX A;  1OR7 C;  3D1N I;  3DPU A;  2VN2 A;  3OL4 A;  3EUA A;  4E4H A;  3OWT A;  3RQ4 A;  4A3E J;  3HOY J;  4E7Z A;  1HW5 A;  5KAF C;  1Y56 A;  2BVL A;  4E6K G;  2FD5 A;  1D5Y A;  3JRE A;  1K78 A;  2VKV A;  2Z1D A;  2ZXI A;  4S04 A;  3RTR A;  1T38 A;  4NC7 A;  5BPD A;  3M8F A;  4YFN F;  1LVK A;  1LEA A;  4XLF A;  2EIN H;  1AHD P;  3GTK J;  1D3Y A;  3LWF A;  3R61 A;  2R5Y B;  4G7H F;  1A04 A;  3CCJ I;  2GOM A;  3CJT B;  5GTI C;  4QIW N;  2PX9 A;  2CJJ A;  2VOP A;  1FOX A;  2OQG A;  3ABU A;  1S29 A;  2KL4 A;  2ZSH B;  4YFX F;  4HYE A;  3TBI A;  2K40 A;  3C2G A;  4GXO A;  1FEX A;  2EZL A;  3KE2 A;  4RGR A;  3ZPL A;  3ZQ7 A;  5FLM J;  5EGO B;  3QPL A;  4CUG A;  5HOO A;  2H8R A;  3L9F A;  4BBR J;  4A3I J;  4A3B J;  2VLA A;  2VKH A;  4F52 A;  4DOZ A;  5E3M A;  3I4M J;  5BNG A;  2GWR A;  2KT0 A;  5E20 A;  3FM3 A;  4LG3 A;  2NXN B;  2M1B A;  2R7V A;  2IPQ X;  1WVR A;  1PJR A;  2YR2 A;  4EVI A;  3IRQ A;  1VQ8 I;  2K9S A;  5CYV A;  4Y4R A;  2BEO A;  2OZ6 A;  3Q5F A;  1L3L A;  3SFI A;  3I56 I;  1O4X A;  5LEK A;  3JRC A;  2P81 A;  4AWX B;  1F9N A;  1JGG A;  2BXZ A;  2KRF A;  5DCM B;  3NWT A;  3L2Q A;  3HRM A;  2OPT A;  4S0H B;  2DU9 A;  2O7O A;  2BZT A;  2LVS A;  3JCU C;  3VOE A;  3GCM A;  3IC7 A;  2M5W A;  1T2K A;  1ZR2 A;  1GVD A;  5L3E A;  4ZDO A;  2M7B A;  4GYI A;  2CRG A;  2CFX A;  3HYI A;  5GAH J;  1ZG1 A;  3ZRG A;  2BHZ A;  2ICW G;  1SFO J;  2PQ8 A;  4IHS A;  3CTA A;  3KLN A;  3J7Z I;  4OOI A;  3JRA A;  4DBQ A;  1R49 A;  2FBI A;  3NRV A;  1HOM A;  2IS2 A;  4HLX A;  1TP4 A;  1SFE A;  5HS7 A;  4LG0 B;  1DP3 A;  2DO7 A;  4JBA A;  1X1B A;  2PMH A;  2BY3 A;  2IGK A;  3I59 A;  2L7K A;  2OF7 A;  5CVV A;  1O3S A;  1D1A A;  1ON2 A;  2PN6 A;  3BWG A;  1G59 A;  5J4Y A;  3V7S A;  5EYR A;  1BL0 A;  2VJ4 A;  4ZZD A;  2XPV A;  4DYQ A;  2A5W A;  1JUM A;  3H3U A;  3LMM A;  2P4W A;  3SZG A;  5F04 A;  4QTR A;  2RC4 A;  2XSJ C;  1XMK A;  3F8F A;  1R9T J;  3OYM A;  1RUN A;  5CVI A;  1SFU A;  5FLX Z;  4UY8 I;  4B09 A;  3GTL J;  3FBN B;  2QKL B;  3Q0U A;  4UV8 A;  4ESB A;  4WX9 A;  4D7M A;  5CLS A;  3K6G A;  1X58 A;  4J01 A;  2HS5 A;  3WOD F;  3CMY A;  4HX8 A;  2K85 A;  5BQT A;  4ZH4 F;  3LSI A;  2FNP A;  2W24 A;  5B5E C;  2QQA A;  2RV8 A;  4IQ4 A;  5B66 C;  4QLC U;  3M4O J;  2PMU A;  3GFL A;  1VQ5 I;  2VC1 A;  4KNY A;  3QPH A;  3T0Y A;  4AU7 A;  3J7Y J;  4CCL A;  2QEX I;  3EUH A;  2ZXW H;  3OYK A;  4BH9 A;  1GDT A;  1LJ9 A;  2KJC A;  4L0Y B;  2NVQ J;  4I09 A;  1FTT A;  4Y33 A;  1ZKG A;  2RQP A;  4X1E A;  3JSP A;  3EYI A;  2A6H F;  4I02 A;  4M9S A;  3HSE A;  3CJR B;  5LHH A;  2CUZ A;  3TDZ C;  3K70 D;  1OQY A;  4ZZL A;  4A3M J;  1RR7 A;  2DFF A;  4IO9 F;  3FIW A;  3F8M A;  2MGQ A;  1H9G A;  3CUQ A;  2HOE A;  4LIV A;  1B9M A;  1J7K A;  3WTT C;  2KFD A;  1SFX A;  3ZMU A;  2M3A A;  2WAE A;  3I9V 2;  3SEQ A;  2LNB A;  1FSH A;  1GVJ A;  1U2W A;  2HWV A;  2FF4 A;  2Y30 A;  4O3M A;  3S1M J;  5DV5 A;  4MIM A;  1P4W A;  2VOO A;  2HVQ A;  1UG2 A;  4KIT B;  1OLT A;  4BJ5 C;  2BGC A;  3L1P A;  1JUS A;  2LSO A;  3AAF A;  3LSP A;  2H8W A;  4XSX F;  3WTX C;  1BR1 A;  2ME6 A;  2L02 A;  5EF6 A;  4LD5 A;  1ZRC A;  1YLF A;  2JMW A;  1DPR A;  2NS0 A;  4GRI A;  3LSR A;  3M1C A;  1CQT A;  3G71 I;  1E17 A;  5HOD A;  3BPV A;  2EBI A;  3R0A A;  2Y0M A;  2QSF X;  6PAX A;  2XGD A;  5FFZ A;  5B1A H;  3F23 A;  1K4T A;  1F43 A;  4CH7 A;  1V54 H;  3DBR B;  2F5D A;  2FOK A;  4H0E A;  1A31 A;  5AIP A;  5EJC A;  1Q1H A;  3CCV I;  3Q0W A;  4BY7 J;  1WI3 A;  1OYY A;  1Z0X A;  2MH2 A;  3ECH A;  4XLH A;  1D8K A;  2K9Q A;  2L9N A;  1MBG A;  3VYU B;  1NHA A;  4PJM A;  1K83 J;  3LA7 A;  1KZH A;  3SDB A;  4B3X A;  2KKO A;  1UG0 A;  1WJB A;  3WGH A;  1HDD C;  4U87 A;  3VYR B;  1R7J A;  4FE7 A;  2MFZ A;  1MZB A;  2E34 A;  5K7F A;  4X0G A;  1LDJ A;  2OBP A;  2QGU A;  4U7B A;  1IGN A;  5B1B H;  3CP8 A;  3U9G A;  2DA3 A;  3OY9 A;  2E2H J;  3ZQF A;  2HYG D;  3RPU D;  1XS9 A;  4I7H A;  4YII A;  3CCU I;  3HHG A;  2WB1 N;  4FE4 A;  3HG9 A;  3HPH A;  1BOA A;  3FHZ A;  4E7H A;  2XPU A;  3G1O A;  2A68 F;  3CC4 I;  1YIJ I;  1GXP A;  2JPC A;  5F1R A;  1MBH A;  4FHT A;  2JVG A;  3DKX A;  3ZMD A;  3JRB A;  5BOX A;  4AYB N;  2VQG A;  4U0Y A;  2CO5 A;  2O8X A;  4PSW A;  1MMN A;  3I58 A;  4KIF A;  5F6F A;  1N75 A;  3PO2 J;  5K7H A;  3H9Q A;  2G0E A;  1VQ6 I;  3HSF A;  1TL8 A;  2YSR A;  2C6Y A;  5J1R A;  2VBY A;  2PFB A;  1R4N B;  2EZI A;  2BE5 F;  1T56 A;  4BQA A;  3AFH A;  2DMQ A;  1DGW Y;  3U1K A;  3IV5 A;  1XSD A;  3EPZ A;  3OYL A;  2BBY A;  1VF9 A;  3LSM A;  2LG4 A;  3ABK H;  3KP5 A;  1WJC A;  1UAA A;  4ENM A;  3H9J A;  3FM5 A;  1NK3 P;  3QOP A;  1FOK A;  1FMW A;  2KZV A;  4OMZ A;  4KFC A;  4PZJ A;  4R1H A;  2HXO A;  3E97 A;  3FXM A;  4C3I J;  3DV8 A;  3OR1 C;  3GTG J;  2HPM A;  3ISP A;  1RRJ A;  4KUM A;  1VQL I;  2VPL A;  3BTC A;  4LK1 F;  3C3W A;  5IY5 H;  4QSH A;  4KA4 A;  4XQF A;  2FMY A;  4UUV A;  4L5J A;  3AG1 H;  2STT A;  3TQN A;  2HPI A;  2E5Z A;  4UB6 C;  5C4J J;  3LST A;  2L7F P;  2DK5 A;  1G6N A;  1Z7U A;  2KRH A;  3GME A;  1ACI A;  1U9O A;  5CVJ A;  4P1W A;  2DQR A;  1E3P A;  1F5T A;  1X19 A;  3R0J A;  3BOQ A;  4AM3 A;  4FET A;  4FX0 A;  3PM1 A;  5EGO A;  1IXR C;  2CSO A;  3RI4 A;  5LGT A;  2QBY A;  3H92 A;  2F5V A;  3SYT A;  1ORK A;  3KYD B;  3OOP A;  2V1U A;  4BY1 J;  2F6C A;  1GV5 A;  2V7F A;  4HV5 A;  4BGD A;  3M07 A;  2LC2 A;  5D8L B;  1USS A;  3TOA A;  3QPS A;  4B3A A;  2WAQ N;  1MH4 A;  3MN2 A;  2LY1 A;  3HTS B;  2LOO A;  4C30 A;  3CCR I;  2ZJP F;  1W7P B;  4RGU A;  2LK2 A;  2M4K A;  2XSD C;  1VQM I;  4LG0 A;  2VKD A;  5IOZ A;  3QQA A;  2ZC2 A;  2CQK A;  2E71 A;  3FXK A;  3VOD A;  2XAU A;  4IHY A;  3OSG A;  3K4B A;  3MZH A;  1ITY A;  3CD6 I;  3MAJ A;  2ECB A;  3B6C A;  1JJ6 C;  4KIB A;  4RLF A;  1OCP A;  3MWM A;  5DCF A;  4PCQ A;  4DIQ A;  3HC7 A;  1KGS A;  1BI1 A;  2FX0 A;  3FHN A;  2V79 A;  4F92 B;  2E7W A;  3TOB A;  1FT9 A;  1U5T B;  3DCF A;  1CF7 A;  1MDM B;  4IHW A;  2E1C A;  2JZY A;  1HST A;  3CCS I;  3EUH C;  1W1W E;  3OR2 C;  1P7J A;  2HQR A;  3J80 Z;  1RUO A;  1D5V A;  1WWX A;  2XGE A;  1SD6 A;  2R7Z J;  3EET A;  4PDK A;  4YIF A;  1O3T A;  2HVS A;  1MH3 A;  1W5C C;  3CCQ I;  1K6Y A;  3KPH A;  3ZOB A;  1K7A A;  2UXN A;  2AQE A;  1EJ9 A;  1XMX A;  2FE3 A;  5IT9 Z;  3OIO A;  3TP3 A;  2GAU A;  2HXI A;  4FTH A;  1BJA A;  3WTV C;  1A35 A;  1IDZ A;  2MYS A;  3SZT A;  4LGW A;  2VAS A;  3TKY A;  2NOG A;  3CLO A;  4OIP F;  1OMI A;  1FSE A;  4HSR A;  5ILS A;  1YI2 I;  2X6Y A;  1R22 A;  2OQR A;  4HNT A;  1VFC A;  5D8K B;  1KU7 A;  2G9W A;  3ECO A;  2QVO A;  4XKB A;  1HXD A;  4CYD A;  2R7W A;  1MMG A;  2XVC A;  3OS2 A;  1G3S A;  1IO2 A;  3RKY A;  1LB2 A;  5DTD A;  3MKZ A;  2EA4 A;  3ZQC A;  1XDU A;  3SJM A;  4NBQ A;  1BA5 A;  1W7P D;  2NVU B;  3B02 A;  3GX4 X;  4BNC A;  2EQR A;  2Y0S A;  3IWF A;  4XIC A;  5E8I A;  1SVO A;  4KN4 X;  3M8E A;  4L9V A;  2H6B A;  2P8T A;  2K02 A;  4F7Z A;  2DW4 A;  2A6E F;  4IX7 A;  4BQN A;  4ENK A;  1E2X A;  3HDD A;  4IPA A;  2DPU A;  1ONV A;  3OYE A;  1FC3 A;  2VJ5 A;  2LFB A;  4XN3 A;  5M5X J;  4ABZ A;  4BHB A;  3JTH A;  2BYV E;  2ELH A;  4XLC A;  3TW6 A;  1YG2 A;  2HGC A;  2ZME A;  4Y17 A;  1I6H J;  2EH3 A;  2LH9 A;  1BN5 A;  1XGS A;  3AKZ A;  1PP7 U;  2P6T A;  4QPQ A;  2VT3 A;  2XGC A;  3K4J A;  4MEY F;  5EZH A;  4MO7 A;  5C3E J;  4LB5 A;  4BXU A;  5KVR A;  1SAX A;  5L3D A;  3GFM A;  5M5Y J;  1MBE A;  4BE0 A;  4BU2 A;  1POG A;  4L18 B;  3WE2 A;  3WTZ A;  4PJJ A;  1J75 A;  4PJ0 C;  3FK7 A;  3GZN B;  3J81 K;  1Z9C A;  2PJR A;  1EF4 A;  1HW2 A;  5LGN A;  1U0J A;  4OAZ A;  2GA1 A;  1D0X A;  2IGN A;  1SVL A;  4A6D A;  1APL C;  2CU7 A;  3BJ6 A;  1T6S A;  4ESJ A;  3LAP A;  2R92 J;  1IN4 A;  3G1L A;  3FXL A;  1S5L C;  2A05 A;  2OAZ A;  2NVT J;  2YU9 J;  2XGX A;  1EH7 A;  3WTW C;  4MHG A;  1OPC A;  1J0R A;  1NTC A;  2ZFU A;  4BL0 B;  3H3V K;  2D1V A;  4FQG A;  5H2F C;  2DK8 A;  3G6E I;  2OZU A;  4AIH A;  4D5F A;  5LLQ A;  2L2O A;  1V5G A;  3ZMT A;  3PIP F;  1JUP A;  1BJZ A;  3BR1 A;  3HHH A;  2E7X A;  2PLY A;  1VQK I;  4RMN A;  2PI0 A;  1FBU A;  1T0F A;  3PNV A;  2BHY A;  4RB3 C;  3FXR A;  2QQ9 A;  3BQZ A;  1QBJ A;  1W4M A;  1XB4 A;  3BG6 A;  5CQG A;  3BLY A;  4EQQ A;  1K4S A;  3CUQ C;  4HEA 2;  4PJL A;  2PG4 A;  3LQR A;  3K2A A;  1X4O A;  3IHU A;  2ACJ A;  1ZR4 A;  4ZYE A;  4Z2Y A;  2X1C A;  2X1D A;  4G6T B;  2R5Z B;  4BAC A;  3HZJ A;  5GAG J;  1E0E A;  2DAO A;  1LE8 A;  1LPQ A;  1FIP A;  3K69 A;  1IC8 A;  3G4S I;  4IVN A;  5D5V B;  4AID A;  5HNF A;  3T8T A;  4I2O A;  2ZME B;  2ZCW A;  3OYC A;  4FX4 A;  3DBL B;  2X6O A;  4CO8 A;  2M87 A;  1TW2 A;  4I98 B;  2M9H A;  4HG2 A;  3SZP A;  3L09 A;  2I10 A;  3SFZ A;  5DUK A;  3PIO F;  2O5R A;  1G4D A;  3BR0 A;  4CCN A;  3JRF A;  2X85 A;  3G2B A;  3NAU A;  2AO9 A;  2HOA A;  1WZ2 A;  4QPO A;  4Q5S F;  2W00 A;  2TRT A;  4XOT A;  3O8H A;  1YIO A;  5GPA A;  3RYP A;  2YPR A;  2MAB A;  4DYC A;  4MFD A;  1DGR M;  1XGO A;  1EV7 A;  2HQ5 A;  3VEP A;  4UNO A;  3RKX A;  2XRN A;  3DU6 A;  4MQV A;  3OYD A;  2CMP A;  2W25 A;  3JSO A;  3ZN1 A;  2J5P A;  1N77 A;  2DPD A;  5EEH A;  2LY9 A;  3W6J B;  5H6R A;  5E3O A;  4BQQ A;  2OV7 A;  2TDX A;  4C3J J;  5DD8 A;  2MW8 A;  3FMS A;  1MNM C;  4Y15 A;  5JLX A;  4IOC F;  1W36 D;  1AOY A;  2DLL A;  3TL4 X;  3GTJ J;  3PSI A;  2EV6 A;  1ETX A;  4PK4 A;  5JI6 A;  2OUM A;  4IKF A;  4ZYH A;  4JK1 X;  3WU2 C;  2P0W A;  1PDN C;  2QQ8 A;  1HKT A;  3FBI B;  3LA2 A;  1LKX A;  2M30 A;  2NNY A;  2L9R A;  1I1G A;  2EV0 A;  1JI8 A;  2X4H A;  1RR8 C;  3H0G J;  1R23 A;  3MCZ A;  4V2F A;  4HV6 A;  2R5Z A;  2AXT C;  3L2C A;  2NVX J;  1FP2 A;  1O7L A;  4C9Y A;  5DUI A;  1IRF A;  3T5X A;  1MMA A;  5L3B A;  2VT2 A;  4EGZ A;  2O0Y A;  4P55 A;  4I0B A;  3SXY A;  5EG0 B;  2OJE D;  3L2V A;  3D5S C;  4RB0 A;  2E35 A;  4YFK F;  1QGP A;  4DBR A;  2KRC A;  5LEJ A;  2CUF A;  1FIA A;  5KK1 A;  2HEO A;  1DDN A;  3HOS A;  2L4A A;  2IS1 A;  3L2U A;  4E7K A;  2AXL A;  1Y1W J;  2LKP A;  2LRD A;  2LYC A;  4A3F J;  2JA8 J;  4I01 A;  1W7P A;  3HGG A;  3I4P A;  1JT0 A;  2JA6 J;  2HTS A;  2Y2Z A;  5EEA A;  1ZRD A;  2GXG A;  1RES A;  3HOV J;  2IA2 A;  1BW6 A;  1IDY A;  1YOV B;  4MEX F;  3QU3 A;  2H94 A;  3CUQ B;  2GBY A;  5M3F J;  1TQI A;  3G3Z A;  2W84 A;  2GIV A;  5D6E A;  4BAY A;  1ZEL A;  1OJL A;  2Y75 A;  2P6S A;  2IEK A;  3V8J A;  1S6L A;  3HKZ A;  1LDK B;  1FPQ A;  3F22 A;  1O3Q A;  2CG4 A;  4HA8 A;  3HUG A;  3AL0 C;  1R5I D;  1XGM A;  2LY2 A;  5IP9 J;  4V2G A;  1I3Q J;  1KU2 A;  3NWS A;  1I39 A;  5FD5 A;  2Y31 A;  5CJ9 A;  3HPG A;  3Q3S A;  4AUX A;  2XC7 A;  2NRA C;  2B7E A;  2FBK A;  1I5Z A;  3OYA A;  5JFR A;  4XN0 A;  1V5F A;  2P5L C;  2ETH A;  1HW1 A;  3GXO A;  2VBW A;  4A5N A;  3GZ5 A;  1MBJ A;  4R8H A;  2ESH A;  4UVB A;  5F08 A;  3OOU A;  1ON1 A;  1WPK A;  4RDU A;  2M0C A;  2EFP A;  2EIJ H;  2WV1 A;  4ZC3 A;  2K5C A;  2VUM J;  4A6E A;  3WGI A;  2IA1 A;  1FY7 A;  4J19 A;  1ZGW A;  4G12 A;  4PJN A;  4HDU A;  2WB1 A;  2ZJ2 A;  1VQN I;  4LIT A;  4MTD A;  3U21 A;  2VBX A;  5F27 A;  2P5K A;  2XB5 A;  3IRR A;  2DOE A;  1ZYR F;  4OWR B;  5ICC A;  2H1L A;  3PL8 A;  4ZYG A;  2QKM B;  3RZD J;  2R7U A;  2FEZ A;  3ZMS A;  3ML6 A;  1WJA A;  3MZ8 A;  3P9K A;  2V1N A;  5GTH C;  2IBD A;  3V7C A;  3ESW B;  3F8C A;  4ASN A;  1YS7 A;  3E6B A;  1MIJ A;  3H5R A;  5E3N A;  3J80 K;  1PUE E;  1D0Y A;  1MMS A;  1H9T A;  2FQ3 A;  3LOC A;  2JWT A;  2X6X A;  2KMU A;  3GO5 A;  1QZY A;  2AS5 F;  2KDO A;  4LLL A;  1B4A A;  4N9H A;  4DQ2 A;  2DCE A;  1B9N A;  5DM7 F;  4XON A;  2I8D A;  1YW7 A;  3PNY A;  2HI3 A;  3EUK L;  3GF2 A;  2DQL A;  4XOP A;  4KN7 X;  4EM1 A;  3KYL A;  3RPU A;  3QP6 A;  3FKJ A;  3BCA A;  3TO6 A;  4B8X A;  1KU9 A;  3B6A A;  1TNS A;  4BDY A;  1G8X A;  2DDA A;  2L9V A;  3I59 B;  3PQJ A;  5EEG A;  5J1U A;  3SEZ A;  3A4C A;  3P9I A;  2DA5 A;  2L7Z A;  2ZXH A;  4BXF A;  2F4O B;  3BG3 A;  3A01 A;  2PJR B;  4I76 A;  2KIM A;  2F5E A;  3MVP A;  4YEL A;  3DLL F;  1P2F A;  2MLK A;  5JLW A;  3V8L A;  2L54 A;  1BC7 C;  4A3K J;  2YUS A;  4M73 A;  4A3G J;  1P9Q C;  2JTV A;  4NDL A;  4ZTF A;  2F48 A;  3I71 A;  5F0H A;  3ZCO A;  2HFH A;  2WV0 A;  3AG3 H;  1GV2 A;  1Z21 A;  4YEJ A;  1GUU A;  1IV8 A;  3HBL A;  2D45 A;  5CQE A;  4L9J A;  1RC9 A;  2RNJ A;  2HQA A;  5FB2 A;  1KYZ A;  3UKG A;  2CFO A;  4CHU A;  3VFZ A;  1ZH5 A;  3E0J B;  1UCR A;  1B8I A;  1XCB A;  2ZNY A;  5HDG A;  1WHU A;  1A6I A;  3LQQ A;  4RM2 A;  1PVE A;  4AVZ A;  3TDU C;  5ICE A;  3IWZ A;  5F0F A;  1T8I A;  5ILU A;  2L7M P;  4KMU X;  4JOM A;  2LR8 A;  2E1O A;  3KLO A;  2QBY B;  2V4J C;  4M9Z A;  3S2H J;  3H3Z A;  2K86 A;  1HC8 A;  4CCJ A;  1JHF A;  2AHQ A;  3MZY A;  3QYE A;  1ULY A;  3OYH A;  4RB1 A;  3AG2 H;  2WAD A;  4LJZ F;  1X2N A;  1MSF C;  1R71 A;  5GAE J;  4P96 A;  5EZG A;  2HKO A;  3F72 A;  4DYR A;  1HQC A;  1YRN B;  4JX6 A;  1QRY A;  2JRM A;  2LRE A;  4M3D A;  4B43 A;  4G7Z F;  1VTN C;  4KIG A;  1J59 A;  1UZC A;  9ANT A;  1AKH B;  4DZP A;  5HLT A;  3K0L A;  4RA2 A;  4WXH A;  5JVG F;  3DU5 A;  4PGH A;  3A0H C;  2M0M A;  2FRH A;  1EA3 A;  1I27 A;  1K79 A;  1DUX C;  1I3A A;  2OD5 A;  3MMY B;  2XAS A;  2DJI A;  4BHP A;  2W1O A;  1HBX G;  2KLO A;  1TWA J;  3PNT A;  4CXF A;  1MDM A;  3J7A Y;  4JQF A;  4A0Y A;  1F4K A;  3MKY B;  2RDP A;  2ZJQ F;  2E1M C;  5D4R A;  4ETS A;  4E7J A;  2ELJ A;  3QPT A;  2ZB9 A;  2V1X A;  2JUC A;  3K4C A;  1JKQ C;  4U7D A;  3HB9 A;  1MSE C;  5ERI A;  2RAE A;  4B4C A;  1VQ9 I;  3BJO A;  1LFB A;  5L3C A;  1DPU A;  2ZBK A;  3ABM H;  1IXC A;  3QOD A;  2GA2 A;  5DD4 A;  1MJ9 A;  5KAI C;  3ABT A;  3OS1 A;  4PGG A;  3TO9 A;  2IGM A;  3FZV A;  3CCE I;  5E1X A;  3KP4 A;  2XIG A;  1PP8 F;  1ETW A;  4BEH A;  1BM9 A;  1LQ1 A;  2EFN A;  3HRS A;  3S1R J;  3DPL C;  2PEX A;  2IRF G;  3FXO A;  3PJR A;  1ETK A;  3DEU A;  4WWC A;  3O6B B;  3M8J A;  4HPQ A;  1GT0 C;  2M7A A;  3WGG A;  1B6A A;  1WRJ A;  3DQV C;  2L01 A;  5FRO A;  1R5G A;  2Z9O A;  1Z1D A;  3BR6 A;  3CQZ J;  5F0C A;  2CWE A;  1DU6 A;  3CMA I;  3S17 J;  4F55 A;  2XAG A;  3COA C;  1ENH A;  4C2T A;  1XGN A;  2JJ7 A;  1LEB A;  2EFO A;  3FIS A;  1YJW I;  5L3F A;  1R1U A;  2ZJR F;  3E5U A;  3TED A;  2K9L A;  2H1K A;  2EFW A;  3HOZ J;  5BPI A;  1FBS A;  2W82 A;  5D5W B;  5CKT A;  1ETO A;  2V9V A;  3M1E A;  1QNT A;  1UFM A;  5D4S A;  1EKE A;  2R7T A;  2D2W A;  1U3E M;  5J3L A;  2COM A;  1FYK A;  1TW3 A;  2WA0 A;  2V9K A;  3ZQG A;  4RGX A;  3BTL A;  2W4S A;  4O6J A;  3WG7 H;  5EG0 A;  1IN8 A;  4CIC A;  3QOE A;  1CGP A;  1KQ8 A;  4XLA A;  1SC7 A;  4HNU A;  4DZJ A;  1S7O A;  1OCT C;  1E3H A;  4NHJ A;  4M6V A;  1XDS A;  1P6R A;  1R1V A;  4MNU A;  1WJF A;  1YJN I;  4OIO F;  1OYI A;  1Z6R A;  2Q0O A;  5FGM A;  2ZKZ A;  4Q4Z F;  3M9A A;  4MFE A;  2CW0 F;  4Y7N J;  1VI0 A;  1X1D A;  4XM3 A;  1G3T A;  3CCM I;  3F3X A;  4IL6 C;  3L7W A;  2WAQ A;  3WU1 B;  1X3Z B;  4LOC A;  2HR3 A;  3KCC A;  3F0C A;  2Q2E A;  3BR2 A;  3QP5 A;  1QVU A;  5D5U B;  1FMV A;  1RPW A;  2LMD A;  2YS9 A;  1SEU A;  3UNG C;  2DMP A;  2GQQ A;  4D0P A;  4GFB A;  2R93 J;  2V26 A;  3I4N J;  3VPR A;  2M45 A;  1MNE A;  2ID3 A;  2DOA A;  3AL0 B;  4XLN F;  2FOW A;  2XF7 A;  1TNT A;  3RZO J;  3GFI A;  4JX4 A;  3I53 A;  3C2H A;  4HF2 A;  3HUG B;  4WK8 F;  1U9N A;  2ZFW A;  5LD2 C;  3MD2 A;  3OV8 A;  5K5O A;  1ZLJ A;  3HKZ N;  4BDZ A;  1IUY A;  1HCR A;  3BCB A;  1BI0 A;  4A5M A;  4EV0 A;  1UHM A;  1U5T A;  3Q0V A;  2H27 A;  4ITV A;  3Q9V A;  2Y69 H;  2LF8 A;  4DJA A;  1I6X A;  3TMO A;  2X6W A;  5JR3 A;  3K2Z A;  2Z99 A;  2X1E A;  3N97 A;  4ENJ A;  2FNA A;  5IP7 J;  2EZK A;  4MLO A;  4AD9 A;  3K70 C;  5FFX A;  2MBF A;  2MH9 A;  1Z91 A;  3H35 A;  3SHF A;  1YW8 A;  4LMY A;  3ABL H;  2Q2E B;  1X3U A;  2FXA A;  2X48 A;  4KYW A;  2FUG 2;  1FNN A;  1S3J A;  1PYV A;  4NNJ A;  3JAM Z;  5E18 F;  1KON A;  3E6C C;  3ULQ B;  4CDG A;  4PFP A;  2WBM A;  4M3G A;  3WHC A;  4J00 A;  2R7X A;  4G8X A;  5H6Q A;  4KDP A;  1JHH A;  5FD6 A;  3IL2 A;  3H1C A;  3TW7 A;  3DKY A;  4L5E A;  2Q8K A;  3V8K A;  2HU9 A;  4ZJZ A;  1D8J A;  2EIK H;  2WAF A;  2VBZ A;  3OYI A;  1O7F A;  4U0V A;  1XTA A;  4BJ6 C;  5DCM A;  2HTJ A;  2MG4 A;  1XSX A;  1IRZ A;  1ETQ A;  2IS4 A;  3ZP5 A;  2IA0 A;  3JR9 A;  3GYH X;  5CVR A;  1QU3 A;  4NC6 A;  2RNG A;  4PFO A;  5GP9 A;  4DNC A;  4HAM A;  5A2Q K;  5J4V A;  4M74 A;  4LLG F;  1R58 A;  2DFH A;  2NYX A;  4U88 A;  2G7H A;  3S3O A;  2M8G X;  2DYR H;  3KFW X;  5C44 J;  5FKL A;  2DT6 A;  4H4K C;  3ZR8 X;  3S16 J;  2UWM A;  1ZAR A;  4XKC A;  4B44 A;  2DA2 A;  2JVH A;  1Z3Y A;  5HS8 A;  1YX5 A;  3ZN0 A;  2HOS A;  4GDF A;  1Z77 A;  4G9Y A;  3FXU A;  1QHH D;  2OCC H;  2O3F A;  1GXQ A;  2K9N A;  1IRX A;  3DEW A;  3K1P A;  2VXD A;  3W2W A;  3DLA A;  2DXI A;  2PMZ A;  4OU0 A;  2L0K A;  3I0T A;  5FLV A;  5FRN A;  4ZDL A;  3R4K A;  4B48 A;  2JA2 A;  2XDV A;  5IP6 A;  4N0B A;  3MKL A;  3CF5 F;  3KZY A;  1R00 A;  3OIP A;  3P7N A;  2O9L A;  2Z5U A;  3PQK A;  3RYR A;  3CO6 C;  3ERM A;  5HDN A;  3S3M A;  3PUF A;  4AC0 A;  4IHV A;  4EJU A;  4XOR A;  4AYB A;  4FIS A;  5E1Z B;  3LNQ A;  5BS6 A;  1X3W B;  5K7Z A;  5GAD J;  4A3L J;  2GZW A;  2I5U A;  1BC8 C;  3K4K A;  1QVT A;  3QWL A;  4O5V A;  3M7G A;  3IH3 A;  4KJZ A;  1HLV A;  1ZK8 A;  1Z67 A;  2VIX A;  3K9T A;  4CCM A;  4ESF A;  3PFI A;  4M6Y A;  4EM0 B;  2G7U A;  2PMZ N;  2Z2S B;  1KYW A;  1XSV A;  1Y0U A;  4F93 B;  5IT3 A;  4CYC B;  4HLY A;  2NS7 A;  2OC6 A;  5HNH A;  3TGN A;  1UST A;  2F5C A;  3QYB A;  3MKW B;  3LFK A;  3CLQ A;  4FAS D;  4P9F A;  3W2V A;  5HLG A;  3FWE A;  2PBI A;  1Y0N A;  4M71 A;  3L2W A;  1BIA A;  3QU6 A;  2CS3 A;  2HYF A;  3IH2 A;  4D7N A;  2DN0 A;  1IRG A;  1RI7 A;  3S2D J;  3OIQ A;  5DYM A;  1ETV A;  4FCY A;  1J5Y A;  3L2R A;  5TRD A;  1W0T A;  3S93 A;  5F1J A;  5J6X A;  1IJW C;  2R3S A;  3C1D A;  2GOX B;  1HDP A;  1ZHF A;  1XN7 A;  2FQ4 A;  1W5S A;  3HJE A;  2KHM A;  2XRO A;  3FK6 A;  3W6K B;  5FKN A;  2XKO A;  2CGP A;  4BBS J;  1V3F A;  3WTU C;  4YIR X;  3MFK A;  2BOL A;  2DFI A;  2VKE A;  1DQU A;  3JRG A;  2P7V B;  4BE2 A;  1ZG5 A;  2COB A;  3HOU J;  1XC5 A;  1JTY A;  2LP0 A;  1S7E A;  4D5C A;  3JRI A;  4IOA F;  2NAZ A;  3UR3 C;  3HGY A;  2WY7 Q;  1UEL B;  1JKR C;  5KNL A;  3RQI A;  5DEQ A;  1T95 A;  1D1B A;  1B59 A;  1QPM A;  1QQI A;  1FZP B;  4A3C J;  1SD5 A;  1XCV A;  3J7A O;  1N25 A;  2DTZ A;  4HBL A;  5JVT A;  1VQ7 I;  4E7S A;  3F9K A;  3W3C A;  4KMF A;  3F6V A;  1BBY A;  3ZMV A;  2DA7 A;  5JHF A;  3ERE D;  1BI2 A;  2N8G A;  3OSF A;  4E70 A;  3CO7 C;  1DP7 P;  3OS0 A;  4UB8 C;  4XMY A;  2L4M A;  4B47 A;  1WI9 A;  4XSZ F;  1FWZ A;  1Z05 A;  2IJL A;  5HDK A;  2BY2 A;  1QHG A;  2KPM A;  2KIF A;  3NAR A;  1U78 A;  4EJT A;  3DWL E;  4A3D J;  1T0F C;  2DOF A;  3FKI J;  1ZN2 A;  4CCK A;  1J09 A;  2B0L A;  2DI3 A;  1OCZ H;  1JT6 A;  2XKP A;  1TQP A;  2JPB A;  3B73 A;  3S1Q J;  5K5R A;  3LA3 A;  4BXX J;  2IVM A;  3GUD A;  1IN6 A;  2W57 A;  3KIO A;  2CV2 A;  5IPA A;  2EZH A;  3BDD A;  1RET A;  2ZSI B;  5H20 A;  4C2M J;  4ENN A;  1WH7 A;  4BJT A;  3E6D A;  4OIR F;  1S72 I;  1SAU A;  3N4M A;  5E1W A;  5DM6 F;  2E2J J;  1UMQ A;  4A0X A;  3PUB A;  1FYL A;  1G2H A;  2CQ7 A;  4G7O F;  4HW0 A;  4KT5 C;  1P7I A;  1K78 B;  3GFJ A;  4RLQ A;  2DJN A;  4Y13 A;  4A0Z A;  2HKX A;  1Y6I A;  5LHI A;  3PFY A;  3OYG A;  4HF0 A;  4F91 B;  1VZ0 A;  3E5X A;  2W7N A;  3FMQ A;  2HDW A;  4XLE A;  5F64 A;  1XPX A;  1YQA A;  4U0W A;  1ZRF A;  5E3L A;  4DW6 A;  3IH4 A;  3IKV A;  3ASO H;  1STZ A;  2CW7 A;  2UUZ A;  3ROU A;  1QA6 A;  5JHU A;  2L5Q A;  2VI6 A;  3ZMZ A;  1LFU P;  3RPQ A;  2EB7 A;  2GXB A;  4XKW A;  4A12 A;  3OMY A;  2VC0 A;  1BOB A;  4ZYD A;  2JUG A;  3REO A;  1IZ1 A;  2W48 A;  4E7I A;  4XID A;  1HKS A;  3OYF A;  3DKW A;  1JJ8 C;  4S05 A;  3H9G A;  2V6E A;  2E1N A;  3IAM 2;  2IGO A;  1F36 A;  2BXY A;  2ZO4 A;  3F21 A;  4HST A;  3ONQ A;  3GZ6 A;  3CDH A;  1WCM J;  3HRU A;  2IP2 A;  2VE8 A;  3CDI A;  1OYW A;  2ZXJ A;  4HX7 A;  2KZG A;  1K6O A;  3FX3 A;  5J47 A;  1KU3 A;  1ODD A;  5IT9 K;  2UXX A;  3VYS B;  1E3O C;  3CZ6 A;  2EIM H;  3IP4 B;  3ZQH A;  3VSL A;  2K7L A;  3HRT A;  4Q47 A;  1A5J A;  2WWY A;  2IS6 A;  3RIR A;  4CSW A;  2JQ7 A;  4LFU A;  2JN6 A;  4QWQ A;  1HA8 A;  4EMS A;  2UZK A;  4M6X A;  5FO5 A;  2R4G A;  3DFG A;  3GTQ J;  1R1T A;  3RDI A;  5EDN A;  3GLX A;  2HZD A;  3LL7 A;  3S8P A;  4B1R A;  4A93 J;  2ECC A;  2E5N A;  3KZZ A;  2CW8 A;  5ILV A;  1ERD A;  4XRM A;  1H0M A;  1BR2 A;  1J9I A;  2YX7 A;  3HEF A;  1ZRE A;  4ZDP A;  3LSG A;  1X2M A;  3MQ0 A;  5L3G A;  1O57 A;  3BG5 A;  4Q48 A;  2EPF A;  2MC4 A;  2BW3 A;  2ID6 A;  1S7A A;  4IJA A;  1BR4 A;  3BZK A;  3OL3 A;  3S2W A;  4CZZ A;  1KA8 A;  1SD4 A;  3CC7 I;  4G6Q A;  4RB2 C;  2LD5 A;  2Z3Y A;  3QYF A;  3G73 A;  1XMA A;  2LKX A;  4XRF A;  4Y52 J;  1B1B A;  1A36 A;  3ASN H;  2XB0 X;  1Q1V A;  2QSG X;  5HVQ C;  2Q1Z B;  2XPW A;  1MBF A;  1U6G A;  2CYY A;  1X1A A;  2FML A;  4IRI A;  2HZT A;  4GCV A;  3TP0 A;  2CUJ A;  3OYN A;  3H36 A;  3HIF A;  5TJJ A;  1V55 H;  3DTE A;  2F4I A;  1I1S A;  4M3E A;  1YS6 A;  1MW7 A;  1MGT A;  2LBF A;  3CJN A;  1EH6 A;  2R7Q A;  5GPC A;  2LDU A;  3F8B A;  3FXQ A;  4NQW A;  1IUF A;  1YTY A;  2AQF A;  4LIU A;  1YE9 A;  1JGS A;  1TWC J;  5IYB J;  3HOW J;  1AA7 A;  1V4R A;  2XHK A;  1WH5 A;  1N78 A;  4WXD A;  2KIQ A;  2RQQ A;  4I6Z A;  4IXA A;  4ZTJ A;  4D9J A;  1HF0 A;  5IYC J;  3WTS C;  1Z6T A;  2GLO A;  1ZLK A;  2HVR A;  4GYG A;  3P9C A;  4HX4 A;  1D0Z A;  2NS8 A;  3KZI C;  2W85 A;  1KQ9 A;  2IXS A;  4MGR A;  2BY0 A;  2ESN A;  3C18 A;  4Z6Y A;  5D5X B;  4N4N B;  3WTY C;  4UXN A;  4G94 A;  4E7L A;  4LB6 B;  1XX5 A;  1MKM A;  4TV7 A;  2QM3 A;  5J8C A;  2K3F A;  3C7J A;  4WCG A;  3CES A;  1SVM A;  2MLG A;  2DT7 B;  2IW5 A;  2EA2 A;  4IF4 A;  1UB9 A;  5LGU A;  5FRM A;  2VQL A;  4P9U A;  2Y9Y A;  2WY8 Q;  3JRH A;  3A01 B;  1SD7 A;  5J40 A;  2BW3 B;  2XAJ A;  4WF2 A;  2VPR A;  5FKK A;  2R7D A;  3H5A A;  4A69 C;  1OCC H;  4RAZ A;  1LE8 B;  3E6M A;  3BR3 A;  2R0Q C;  1WSU A;  3VWB A;  4XRS G;  2DYS H;  3BY6 A;  2J5O A;  2EWN A;  4KIC A;  4K2E A;  5E79 C;  1WQ2 A;  2DA4 A;  3RSN A;  3PSF A;  5K5Q A;  3E1S A;  4LLN A;  2A07 F;  3BZC A;  1S8N A;  2BY1 A;  2RKH A;  3BRO A;  2DA6 A;  3K1M A;  4I99 C;  4KT6 A;  2P5V A;  3VDX A;  1Y1V J;  2IAI A;  3V7R A;  1OKR A;  3NQO A;  4F3Q A;  1NH3 A;  2HDD A;  1RZ4 A;  4Y3O A;  3S14 J;  3E3V A;  2FBH A;  1JKO C;  1RKW A;  3KP6 A;  4N4O B;  3S32 A;  4XRS A;  4BYY A;  1X1P A;  2DMU A;  3BG9 A;  3K4L A;  2XAH A;  1OCR H;  3HL2 A;  4G6D A;  2ISZ A;  1R4M B;  2JA7 J;  4UHT A;  1UHW A;  4NQW B;  3T8R A;  4IZZ A;  4BE1 A;  3WU0 A;  3DXJ F;  3FDY A;  4WXC A;  1AKH A;  2CH0 A;  2ELK A;  4GO1 A;  4XLP F;  4HNV A;  1Y8R B;  3X2Q H;  4BUP A;  1YRN A;  4LK0 F;  1QPI A;  2F4M B;  4XKV A;  2XUB A;  1S9H A;  2QZ8 A;  2OCE A;  2XAQ A;  1BIB A;  5LFA A;  4XL9 A;  3KP7 A;  2XAF A;  4GGG A;  2DMN A;  2VOD A;  3CDL A;  3N05 A;  4W1U A;  1T98 A;  1M1E B;  1T39 A;  1G3Y A;  4NB5 A;  1IAW A;  4AIJ A;  4EJV A;  4C2U A;  3A0B C;  2PJP A;  4M3B A;  1Y8Q B;  2QUF A;  2E60 A;  3A02 A;  2V1D A;  1WGX A;  1TT5 B;  4N9I A;  1I50 J;  4II3 A;  3KX2 A;  4P5O A;  3JAM K;  3GTO J;  3T1B A;  5KHD A;  1P4A A;  2NNN A;  5LRS A;  2VL8 A;  1V5E A;  3OYJ A;  3F8N A;  2V6C A;  1GLN A;  2QWW A;  3HSR A;  1PUF B;  1IW7 F;  2QQB A;  1XD7 A;  1GHC A;  1TT0 A;  3D5L A;  5FLX K;  5LBQ A;  3IAS 2;  3I5U A;  2CUE A;  4PUS A;  2VJJ A;  3KP3 A;  1ZG3 A;  4BEH B;  1SFK A;  2E1M B;  3BT9 A;  4I0A A;  4PSX A;  1NK2 P;  5FJ8 J;  2H6C A;  3LFU A;  1OFC X;  2CQQ A;  4RM3 A;  1H8A C;  2P7C B;  3A03 A;  3DPT A;  2R7F A;  1REP C;  5HLI A;  2A69 F;  3JRD A;  1H89 C;  2QA4 I;  2EIL H;  2KJB A;  2XF6 A;  5IYD J;  2IT0 A;  3ZQQ A;  3GTM J;  2VQC A;  3FXJ A;  1B72 B;  3SDG A;  1FP1 D;  3CC2 I;  1G3W A;  4L0Z B;  2EFQ A;  5CVU A;  4KIS A;  2M4G A;  3S15 J;  2L3D A;  2GIZ A;  3R6S A;  3CJQ B;  5ED4 A;  1OIS A;  1ZTR A;  2LLK A;  4BKX A;  4DGW B;  2Y0S N;  1AWC A;  1FBQ A;  4IQJ A;  1P92 A;  3HM5 A;  1U8B A;  2F2E A;  2VE9 A;  5C4X J;  3ZQI A;  1LFP A;  5D6F A;  2B63 J;  1XG1 A;  2CV1 A;  2JRT A;  1X1C A;  1U5T C;  1OCO H;  4EAT A;  4L5I A;  1EH8 A;  1NG6 A;  3GWZ A;  3HOT A;  3PO3 J;  4EM2 A;  3EYY A;  1WFX A;  4AVP A;  4JX5 A;  2KIU A;  3BG7 A;  3K4N A;  4D1Q A;  4YRV A;  2D1H A;  3Q9S A;  1JE8 A;  2NOJ B;  4RGS A;  5E17 F;  1QZZ A;  2DOD A;  2R7S A;  5DDG A;  3LSH A;  2V9P A;  2JA5 J;  4L9N A;  1P4X A;  3RJP A;  3BC8 A;  3CP2 A;  2X0L A;  5LRR A;  2M8E A;  3SQN A;  2MC3 A;  2HDC A;  4OAY A;  2XV4 S;  2JSC A;  1BW5 A;  1R5H A;  2CQN A;  1JTX A;  2RN7 A;  3TO7 A;  2O8K A;  2OA4 A;  1QO0 D;  1T08 B;  1MD0 A;  2YX4 A;  2R5Y A;  1YX3 A;  1TQM A;  2E19 A;  5BMZ A;  2K4J A;  4CA0 A;  2RRE A;  1D1C A;  3A1Y A;  2H09 A;  4IHX A;  3DEE A;  1IF1 A;  4YG2 F;  1ETY A;  2ISY A;  5DS9 A;  1X4P A;  4UUS A;  5CPR B;  3LAJ A;  3GLL A;  2VON A;  4CCO A;  4W97 A;  2LBF B;  4IHT A;  4XK4 A;  5J8F A;  1IN7 A;  2E36 A;  1C0W A;  4RS8 A;  1SMT A;  2MD0 A;  1OR7 A;  2WTE A;  3AG4 H;  5K1Y A;  2R7R A;  2FU4 A;  2X9D A;  2GM4 A;  4EJO A;  1FTZ A;  2RVC A;  3O3K A;  3F6O A;  2BVM A;  3J81 Z;  1WJ5 A;  1Z3X A;  2EK5 A;  2WC2 A;  1YYV A;  4II2 A;  1KQ0 A;  4HDV A;  3E5Q A;  3G1M A;  4M3F A;  3DTK A;  4A2U A;  3IUO A;  3BTI A;  1WJE A;  2DBB A;  2L9S A;  1RIO H;  3P5J A;  3HOX J;  2JK3 A;  3I3L A;  5ICG A;  3DF8 A;  4RAF A;  5TIS C;  2MA3 A;  2OTL I;  3W2A A;  1R36 A;  1MBK A;  1LVA A;  3W6V A;  4ANJ A;  3JW4 A;  4UVC A;  2OU2 A;  3KYC B;  4RAY A;  2Y48 A;  1FLI A;  1JXS A;  2D5V A;  1YO5 C;  2A5Y B;  4CZC A;  4CGZ A;  4IRG A;  5LHG A;  1FYM A;  2FA5 A;  2M34 A;  1YW9 A;  1YHQ I;  1O3R A;  1H88 C;  2HNH A;  3K10 A;  2VXZ A;  3ZGK A;  4JP0 A;  2R7O A;  1RNL A;  3M3Y J;  1FJL A;  3VB2 A;  3JTG A;  3RKQ A;  1TLH B;  4X6A J;  3DTI A;  3EQL F;  2O03 A;  2QEN A;  1TZL A;  1YIT I;  3R60 A;  5TGT A;  1DU0 A;  1LNW A;  2STW A;  1SAN A;  3BP8 A;  3C2B A;  3WE3 A;  1QZE A;  4EEF G;  2ME0 A;  3QRF F;  1HSJ A;  2EJR A;  1W5T A;  2DMT A;  5A2Q Z;  3KP2 A;  3CME I;  4NUB A;  3ZXS A;  2KDZ A;  3S3N A;  3LSK A;  4HQE A;  3EDP A;  2QSH X;  3RCO A;  4BS9 A;  2B9S A;  3L00 A;  2Z16 A;  2LTP A;  1MJB A;  1TTY A;  3A2K A;  3O2P E;  3NEU A;  5FKO A;  1FOW A;  5HLH A;  4UUS B;  4AIK A;  5B3S H;  4OIN F;  1YJ9 I;  2HOT A;  2CQX A;  1T33 A;  5IOY A;  1AU7 A;  4MQ9 F;  2K4B A;  2A3S A;  2X51 A;  4HQM A;  3BR5 A;  4EGY A;  2Y9Z A;  1UHS A;  3WHB A;  1BI3 A;  4R79 A;  1ZGA A;  2VQH A;  2K27 A;  3VYT B;  1VND A;  3MEX A;  3GBG A;  1WKM A;  3OYB A;  2KIS A;  1IXS B;  4RBO A;  2QF7 A;  3D0S A;  4RAG A;  3E7L A;  2DA1 A;  5AON A;  3IKT A;  4HRI A;  2OTJ I;  4BHC A;  1UJ8 A;  4M72 A;  1U8R A;  3CCL I;  3GEZ A;  3WG9 A;  2O61 A;  2ADU A;  2E2I J;  2FSW A;  3H5N A;  1CF7 B;  4ON0 A;  3CMM A;  4JYK A;  4MTE A;  2ZME C;  1R6R A;  3QAH A; 
#chains in the Genus database with same CATH homology
 3I54 A;  1LDD A;  2YU3 A;  3BPX A;  4FT8 A;  4HOB A;  1ZAO A;  3BZ6 A;  4IRH A;  1ZGJ A;  3CUO A;  2Z33 A;  3RKW A;  1MJA A;  2QYO A;  2MD5 A;  2RGV A;  1HKQ A;  3GVA A;  2DT5 A;  3DP7 A;  3KET A;  2EV5 A;  2LF7 A;  3HTU A;  2O6G E;  2JT1 A;  3ELK A;  3FMR A;  2A61 A;  3KEQ A;  4M9X A;  2BV6 A;  3GW2 A;  1YFH A;  4XBF A;  4HF1 A;  3FF5 A;  4OMY A;  2HQN A;  1IN5 A;  1F1Z A;  4OIQ F;  5E8G A;  3V4G A;  3K1N A;  3U2R A;  4L9T A;  3KEO A;  2QLZ A;  1J2X A;  1L0O C;  5ICF A;  4UVA A;  2F5F A;  4EJW A;  3BJA A;  3U1D A;  1SMY F;  1FX7 A;  2DTR A;  4UV9 A;  2ZNZ A;  4HZF A;  5AIQ A;  3I64 A;  5HS9 A;  1TBX A;  2VN2 A;  1HW5 A;  1K78 A;  4S04 A;  3RTR A;  1T38 A;  5BPD A;  3M8F A;  4YFN F;  1LEA A;  1D3Y A;  3LWF A;  3R61 A;  4G7H F;  1A04 A;  2VOP A;  2OQG A;  3ABU A;  1S29 A;  4YFX F;  4HYE A;  4GXO A;  3KE2 A;  4RGR A;  3ZPL A;  3ZQ7 A;  5HOO A;  3L9F A;  2GWR A;  5E20 A;  3FM3 A;  2M1B A;  2IPQ X;  4EVI A;  2YR2 A;  3IRQ A;  5CYV A;  2BEO A;  2OZ6 A;  3Q5F A;  1L3L A;  5LEK A;  4AWX B;  1F9N A;  5DCM B;  2KRF A;  3HRM A;  2DU9 A;  3VOE A;  3IC7 A;  2M5W A;  1T2K A;  5L3E A;  4GYI A;  2CFX A;  3HYI A;  1ZG1 A;  2PQ8 A;  4IHS A;  3CTA A;  3KLN A;  4OOI A;  2FBI A;  3NRV A;  4HLX A;  1SFE A;  5HS7 A;  4LG0 B;  2DO7 A;  4JBA A;  2PMH A;  3I59 A;  5CVV A;  1O3S A;  2PN6 A;  1ON2 A;  3BWG A;  3V7S A;  4ZZD A;  3H3U A;  2P4W A;  2RC4 A;  1XMK A;  3F8F A;  1RUN A;  5CVI A;  1SFU A;  5FLX Z;  4B09 A;  4WX9 A;  4UV8 A;  4ESB A;  5CLS A;  2HS5 A;  3WOD F;  4HX8 A;  5BQT A;  4ZH4 F;  2FNP A;  2W24 A;  2QQA A;  2RV8 A;  4QLC U;  2PMU A;  3GFL A;  2VC1 A;  4KNY A;  3QPH A;  3T0Y A;  3EUH A;  4BH9 A;  1LJ9 A;  2KJC A;  4L0Y B;  4I09 A;  2RQP A;  3JSP A;  3EYI A;  2A6H F;  4I02 A;  4M9S A;  5LHH A;  3HSE A;  3TDZ C;  4ZZL A;  3F8M A;  1H9G A;  3CUQ A;  2HOE A;  1B9M A;  1J7K A;  3WTT C;  1SFX A;  3ZMU A;  3QAH A;  2LNB A;  1FSH A;  1GVJ A;  1U2W A;  2HWV A;  2FF4 A;  4O3M A;  5DV5 A;  1P4W A;  2VOO A;  2BGC A;  3AAF A;  2LSO A;  4XSX F;  3WTX C;  2L02 A;  4LD5 A;  1ZRC A;  1YLF A;  1DPR A;  2NS0 A;  1E17 A;  3BPV A;  3R0A A;  2Y0M A;  6PAX A;  5FFZ A;  3F23 A;  2F5D A;  2FOK A;  4H0E A;  5AIP A;  1Q1H A;  1OYY A;  2MH2 A;  3ECH A;  1D8K A;  1NHA A;  3LA7 A;  2KKO A;  3WGH A;  1R7J A;  1MZB A;  1LDJ A;  2OBP A;  4U7B A;  3U9G A;  2HYG D;  4I7H A;  4YII A;  3HHG A;  1BOA A;  3FHZ A;  2A68 F;  1GXP A;  2JPC A;  5F1R A;  4FHT A;  3ZMD A;  5BOX A;  4U0Y A;  2CO5 A;  2O8X A;  3I58 A;  4KIF A;  5F6F A;  3HSF A;  2YSR A;  2C6Y A;  2VBY A;  2PFB A;  2BE5 F;  4BQA A;  1XSD A;  2BBY A;  3KP5 A;  4ENM A;  3FM5 A;  3QOP A;  1FOK A;  4OMZ A;  4KFC A;  4PZJ A;  4R1H A;  3E97 A;  3DV8 A;  3ISP A;  4KUM A;  4LK1 F;  3C3W A;  4KA4 A;  2FMY A;  4UUV A;  4L5J A;  2STT A;  3TQN A;  3LST A;  2DK5 A;  1G6N A;  1Z7U A;  5CVJ A;  2DQR A;  1F5T A;  3R0J A;  3BOQ A;  4FX0 A;  1IXR C;  2CSO A;  3RI4 A;  5LGT A;  2QBY A;  3H92 A;  3OOP A;  2V1U A;  4HV5 A;  5D8L B;  1USS A;  3TOA A;  3HTS B;  1W7P B;  4RGU A;  4LG0 A;  2CQK A;  3VOD A;  3MZH A;  3MAJ A;  4KIB A;  3MWM A;  5DCF A;  4PCQ A;  1KGS A;  1BI1 A;  2V79 A;  2E7W A;  3TOB A;  1FT9 A;  1U5T B;  1CF7 A;  1MDM B;  2E1C A;  2JZY A;  1HST A;  2HQR A;  3J80 Z;  1RUO A;  1D5V A;  1WWX A;  1SD6 A;  3EET A;  4PDK A;  4YIF A;  1O3T A;  1K7A A;  2UXN A;  2FE3 A;  5IT9 Z;  2GAU A;  1BJA A;  3WTV C;  3SZT A;  4LGW A;  3TKY A;  4OIP F;  3CLO A;  1OMI A;  1FSE A;  5ILS A;  1R22 A;  2OQR A;  5D8K B;  1KU7 A;  2G9W A;  3ECO A;  2QVO A;  1HXD A;  4CYD A;  2XVC A;  1G3S A;  3RKY A;  1LB2 A;  2EA4 A;  1XDU A;  1W7P D;  3B02 A;  3GX4 X;  4BNC A;  3IWF A;  5E8I A;  4KN4 X;  3M8E A;  4L9V A;  2H6B A;  2P8T A;  2K02 A;  4F7Z A;  2DW4 A;  2A6E F;  4ENK A;  1E2X A;  4IPA A;  2DPU A;  1ONV A;  1FC3 A;  4BHB A;  3JTH A;  2ELH A;  2BYV E;  1YG2 A;  2HGC A;  2ZME A;  4Y17 A;  1BN5 A;  1XGS A;  1PP7 U;  2P6T A;  2VT3 A;  4MEY F;  4LB5 A;  4BXU A;  5KVR A;  1SAX A;  5L3D A;  3GFM A;  4L18 B;  3WE2 A;  3WTZ A;  1J75 A;  3J81 K;  1Z9C A;  1HW2 A;  5LGN A;  2GA1 A;  4A6D A;  3BJ6 A;  1T6S A;  4ESJ A;  3LAP A;  1IN4 A;  2OAZ A;  2XGX A;  1EH7 A;  3WTW C;  4MHG A;  1OPC A;  1J0R A;  2D1V A;  2DK8 A;  2OZU A;  4AIH A;  5LLQ A;  3ZMT A;  3HHH A;  2E7X A;  2PLY A;  2PI0 A;  1FBU A;  1T0F A;  4RB3 C;  3FXR A;  2QQ9 A;  1QBJ A;  1W4M A;  1XB4 A;  4EQQ A;  3CUQ C;  2PG4 A;  3LQR A;  3IHU A;  2ACJ A;  4ZYE A;  4Z2Y A;  2DAO A;  3K69 A;  4IVN A;  5D5V B;  3T8T A;  4I2O A;  2ZME B;  2ZCW A;  4FX4 A;  4CO8 A;  2M87 A;  1TW2 A;  4I98 B;  3SZP A;  3L09 A;  3SFZ A;  5DUK A;  1G4D A;  4Q5S F;  3RYP A;  1YIO A;  2YPR A;  1XGO A;  1EV7 A;  3VEP A;  4UNO A;  3RKX A;  2XRN A;  4MQV A;  2W25 A;  3JSO A;  3ZN1 A;  2J5P A;  2DPD A;  5EEH A;  3W6J B;  5H6R A;  2TDX A;  5DD8 A;  3FMS A;  1AOY A;  4Y15 A;  2DLL A;  2EV6 A;  5JI6 A;  4ZYH A;  4JK1 X;  1PDN C;  1HKT A;  3LA2 A;  2M30 A;  2NNY A;  1I1G A;  2EV0 A;  2X4H A;  1R23 A;  3MCZ A;  4HV6 A;  3L2C A;  1FP2 A;  1O7L A;  5DUI A;  1IRF A;  3T5X A;  5L3B A;  2VT2 A;  4EGZ A;  2O0Y A;  4P55 A;  4I0B A;  3SXY A;  4RB0 A;  4YFK F;  1QGP A;  5LEJ A;  5KK1 A;  2HEO A;  1DDN A;  3HOS A;  2L4A A;  2AXL A;  2LKP A;  4I01 A;  1W7P A;  3I4P A;  2HTS A;  1ZRD A;  2GXG A;  2IA2 A;  4MEX F;  3QU3 A;  2H94 A;  3CUQ B;  1TQI A;  3G3Z A;  4BAY A;  2W84 A;  2GIV A;  5D6E A;  2P6S A;  2Y75 A;  3V8J A;  1S6L A;  1LDK B;  1FPQ A;  3F22 A;  1O3Q A;  2CG4 A;  4HA8 A;  3HUG A;  1XGM A;  1KU2 A;  5FD5 A;  5CJ9 A;  2NRA C;  2FBK A;  1I5Z A;  5JFR A;  2P5L C;  2ETH A;  1HW1 A;  3GXO A;  2VBW A;  4A5N A;  3GZ5 A;  4R8H A;  2ESH A;  4UVB A;  1ON1 A;  2EFP A;  4A6E A;  3WGI A;  2IA1 A;  1FY7 A;  4HDU A;  2ZJ2 A;  4MTD A;  2VBX A;  2P5K A;  3IRR A;  1ZYR F;  5ICC A;  4ZYG A;  3ZMS A;  2FEZ A;  3ML6 A;  3P9K A;  3V7C A;  4ASN A;  3F8C A;  1YS7 A;  3E6B A;  3J80 K;  1PUE E;  1H9T A;  2FQ3 A;  3GO5 A;  1QZY A;  2AS5 F;  4LLL A;  1B4A A;  4N9H A;  4DQ2 A;  1B9N A;  1YW7 A;  3GF2 A;  2DQL A;  4KN7 X;  4EM1 A;  3RPU A;  3QP6 A;  3TO6 A;  4B8X A;  1KU9 A;  1TNS A;  3I59 B;  3PQJ A;  5EEG A;  3P9I A;  2KIM A;  2F5E A;  1P2F A;  2MLK A;  3V8L A;  2L54 A;  1BC7 C;  4M73 A;  2JTV A;  3I71 A;  2HFH A;  2WV0 A;  2D45 A;  4L9J A;  5FB2 A;  2RNJ A;  1KYZ A;  4CHU A;  3VFZ A;  1ZH5 A;  1UCR A;  1XCB A;  2ZNY A;  5HDG A;  3LQQ A;  3TDU C;  5ICE A;  3IWZ A;  5ILU A;  4KMU X;  3KLO A;  2QBY B;  4M9Z A;  3H3Z A;  2K86 A;  1JHF A;  3MZY A;  1ULY A;  4RB1 A;  4LJZ F;  4P96 A;  2HKO A;  3F72 A;  1HQC A;  1VTN C;  4G7Z F;  4KIG A;  1J59 A;  3K0L A;  4WXH A;  4PGH A;  2FRH A;  1I27 A;  1K79 A;  1DUX C;  2OD5 A;  2XAS A;  4BHP A;  1HBX G;  1MDM A;  4CXF A;  4JQF A;  4A0Y A;  1F4K A;  2RDP A;  5D4R A;  4ETS A;  3QPT A;  2V1X A;  4U7D A;  5ERI A;  3BJO A;  5L3C A;  1DPU A;  2ZBK A;  1IXC A;  2GA2 A;  5DD4 A;  1MJ9 A;  3ABT A;  4PGG A;  3TO9 A;  3FZV A;  5E1X A;  3KP4 A;  2XIG A;  1PP8 F;  1BM9 A;  1LQ1 A;  2EFN A;  3HRS A;  3DPL C;  2PEX A;  2IRF G;  3DEU A;  4WWC A;  3O6B B;  3WGG A;  1B6A A;  1WRJ A;  3DQV C;  2L01 A;  2Z9O A;  1R5G A;  1Z1D A;  2CWE A;  2XAG A;  3COA C;  1XGN A;  1LEB A;  2EFO A;  5L3F A;  1R1U A;  3E5U A;  2EFW A;  5BPI A;  1FBS A;  5D5W B;  3M1E A;  2V9V A;  1QNT A;  1UFM A;  5D4S A;  2D2W A;  1U3E M;  2COM A;  1FYK A;  1TW3 A;  4RGX A;  4O6J A;  1IN8 A;  4CIC A;  1CGP A;  1KQ8 A;  1S7O A;  4NHJ A;  1XDS A;  1P6R A;  1R1V A;  4MNU A;  4OIO F;  1OYI A;  1Z6R A;  2Q0O A;  5FGM A;  2ZKZ A;  4Q4Z F;  3M9A A;  2CW0 F;  1G3T A;  3F3X A;  3L7W A;  3WU1 B;  2HR3 A;  3KCC A;  2Q2E A;  3QP5 A;  5D5U B;  2GQQ A;  4D0P A;  2M45 A;  4XLN F;  1TNT A;  3GFI A;  3I53 A;  4HF2 A;  4WK8 F;  2ZFW A;  3OV8 A;  5K5O A;  1ZLJ A;  1IUY A;  1BI0 A;  4A5M A;  4EV0 A;  1UHM A;  1U5T A;  2H27 A;  3Q9V A;  2LF8 A;  1I6X A;  5JR3 A;  3K2Z A;  2Z99 A;  3N97 A;  4ENJ A;  2FNA A;  4AD9 A;  5FFX A;  2MBF A;  2MH9 A;  1Z91 A;  3SHF A;  1YW8 A;  4LMY A;  1X3U A;  2FXA A;  4KYW A;  1FNN A;  1S3J A;  3JAM Z;  5E18 F;  3E6C C;  3ULQ B;  4CDG A;  4G8X A;  5H6Q A;  4KDP A;  1JHH A;  5FD6 A;  3IL2 A;  3V8K A;  2Q8K A;  1D8J A;  2VBZ A;  1O7F A;  4U0V A;  5DCM A;  2HTJ A;  1XSX A;  3ZP5 A;  2IA0 A;  3GYH X;  5CVR A;  4DNC A;  4HAM A;  5A2Q K;  4M74 A;  4LLG F;  1R58 A;  2NYX A;  4U88 A;  2G7H A;  3KFW X;  2UWM A;  1ZAR A;  5HS8 A;  3ZN0 A;  4G9Y A;  3FXU A;  2O3F A;  1GXQ A;  3K1P A;  4OU0 A;  3I0T A;  3R4K A;  4N0B A;  3KZY A;  1R00 A;  3P7N A;  2Z5U A;  3PQK A;  3RYR A;  3CO6 C;  5HDN A;  4EJU A;  5E1Z B;  5BS6 A;  2GZW A;  1BC8 C;  4O5V A;  3M7G A;  3K9T A;  4ESF A;  3PFI A;  4M6Y A;  4EM0 B;  2G7U A;  1KYW A;  1XSV A;  1Y0U A;  5IT3 A;  4HLY A;  3TGN A;  1UST A;  2F5C A;  3LFK A;  4P9F A;  5HLG A;  3FWE A;  2PBI A;  4M71 A;  1BIA A;  3QU6 A;  2HYF A;  1IRG A;  1RI7 A;  5DYM A;  1J5Y A;  5TRD A;  5J6X A;  2R3S A;  3C1D A;  1ZHF A;  1XN7 A;  1W5S A;  2XRO A;  3W6K B;  2XKO A;  2CGP A;  1V3F A;  3WTU C;  3MFK A;  2DFI A;  2P7V B;  1ZG5 A;  2NAZ A;  5DEQ A;  1B59 A;  1QPM A;  1QQI A;  1FZP B;  1SD5 A;  1XCV A;  3J7A O;  4HBL A;  5JVT A;  4KMF A;  3F6V A;  1BBY A;  3ZMV A;  3ERE D;  1BI2 A;  4E70 A;  3CO7 C;  1DP7 P;  2L4M A;  1WI9 A;  4XSZ F;  1FWZ A;  1Z05 A;  2IJL A;  5HDK A;  2KIF A;  4EJT A;  1U78 A;  1ZN2 A;  2B0L A;  2DI3 A;  2XKP A;  1TQP A;  2JPB A;  3B73 A;  5K5R A;  3LA3 A;  2IVM A;  3GUD A;  1IN6 A;  2W57 A;  3BDD A;  5H20 A;  4ENN A;  3E6D A;  4OIR F;  3N4M A;  5E1W A;  4A0X A;  1FYL A;  4G7O F;  4HW0 A;  4KT5 C;  1K78 B;  3GFJ A;  4Y13 A;  4A0Z A;  2HKX A;  5LHI A;  4HF0 A;  3E5X A;  3FMQ A;  5F64 A;  1YQA A;  4U0W A;  1ZRF A;  3IKV A;  1STZ A;  3ROU A;  5JHU A;  3ZMZ A;  3RPQ A;  2EB7 A;  2GXB A;  4A12 A;  2VC0 A;  4ZYD A;  3REO A;  1IZ1 A;  1HKS A;  3DKW A;  4S05 A;  2E1N A;  2ZO4 A;  3F21 A;  3GZ6 A;  3CDH A;  3HRU A;  2IP2 A;  2VE8 A;  1K6O A;  1OYW A;  2ZXJ A;  4HX7 A;  3FX3 A;  1KU3 A;  1ODD A;  5IT9 K;  2UXX A;  2K7L A;  4Q47 A;  3HRT A;  2WWY A;  3RIR A;  4LFU A;  4QWQ A;  4EMS A;  2UZK A;  4M6X A;  5FO5 A;  3DFG A;  1R1T A;  3RDI A;  3GLX A;  3KZZ A;  5ILV A;  1H0M A;  1J9I A;  2YX7 A;  1ZRE A;  3MQ0 A;  5L3G A;  1O57 A;  4Q48 A;  4CZZ A;  1S7A A;  4IJA A;  3S2W A;  1KA8 A;  1SD4 A;  4G6Q A;  4RB2 C;  2Z3Y A;  3G73 A;  1XMA A;  4XRF A;  1B1B A;  5HVQ C;  1U6G A;  2CYY A;  2FML A;  4IRI A;  2HZT A;  4GCV A;  3HIF A;  5TJJ A;  1I1S A;  1YS6 A;  1MGT A;  3CJN A;  1EH6 A;  2LDU A;  3F8B A;  3FXQ A;  4NQW A;  1YTY A;  1JGS A;  1V4R A;  2XHK A;  4WXD A;  4IXA A;  3WTS C;  1Z6T A;  1ZLK A;  4GYG A;  3P9C A;  4HX4 A;  2W85 A;  1KQ9 A;  4MGR A;  2ESN A;  3C18 A;  5D5X B;  3WTY C;  4UXN A;  4G94 A;  4LB6 B;  1MKM A;  4TV7 A;  2QM3 A;  5J8C A;  3C7J A;  4WCG A;  2MLG A;  2IW5 A;  2EA2 A;  4IF4 A;  1UB9 A;  5LGU A;  4P9U A;  1SD7 A;  2XAJ A;  4WF2 A;  2R7D A;  4RAZ A;  3E6M A;  1WSU A;  3BY6 A;  2J5O A;  2EWN A;  4KIC A;  4K2E A;  1WQ2 A;  5K5Q A;  4LLN A;  2A07 F;  1S8N A;  2RKH A;  3BRO A;  3K1M A;  2P5V A;  3V7R A;  1OKR A;  3NQO A;  1RZ4 A;  3E3V A;  2FBH A;  3KP6 A;  4BYY A;  2XAH A;  4G6D A;  2ISZ A;  4UHT A;  1UHW A;  3T8R A;  3WU0 A;  3DXJ F;  4WXC A;  4GO1 A;  4XLP F;  4LK0 F;  2XUB A;  2QZ8 A;  2XAQ A;  1BIB A;  3KP7 A;  2XAF A;  4GGG A;  2VOD A;  1T98 A;  1T39 A;  1G3Y A;  4NB5 A;  1IAW A;  4AIJ A;  4EJV A;  2PJP A;  2QUF A;  2V1D A;  4N9I A;  4P5O A;  3JAM K;  3T1B A;  1P4A A;  2NNN A;  5LRS A;  3F8N A;  2V6C A;  2QWW A;  3HSR A;  1IW7 F;  2QQB A;  1XD7 A;  1GHC A;  3D5L A;  5FLX K;  5LBQ A;  3I5U A;  3KP3 A;  1ZG3 A;  4I0A A;  2H6C A;  2P7C B;  3DPT A;  2R7F A;  1REP C;  5HLI A;  2A69 F;  2KJB A;  2IT0 A;  1FP1 D;  4L0Z B;  1G3W A;  2EFQ A;  5CVU A;  2L3D A;  3R6S A;  5ED4 A;  1AWC A;  1FBQ A;  1P92 A;  2F2E A;  2VE9 A;  5D6F A;  2JRT A;  1U5T C;  4L5I A;  1EH8 A;  3GWZ A;  3HOT A;  4EM2 A;  3EYY A;  4AVP A;  2KIU A;  2D1H A;  3Q9S A;  1JE8 A;  4RGS A;  5E17 F;  1QZZ A;  5DDG A;  4L9N A;  1P4X A;  3RJP A;  2X0L A;  5LRR A;  2M8E A;  3SQN A;  2MC3 A;  2HDC A;  2XV4 S;  2JSC A;  3TO7 A;  1R5H A;  2RN7 A;  2OA4 A;  1QO0 D;  1MD0 A;  2YX4 A;  1TQM A;  5BMZ A;  2K4J A;  2H09 A;  1IF1 A;  4YG2 F;  2ISY A;  3LAJ A;  2VON A;  4IHT A;  5J8F A;  1IN7 A;  1C0W A;  4RS8 A;  1SMT A;  1OR7 A;  2WTE A;  5K1Y A;  2FU4 A;  4EJO A;  2RVC A;  3O3K A;  3F6O A;  3J81 Z;  2EK5 A;  2WC2 A;  1YYV A;  1KQ0 A;  4HDV A;  3E5Q A;  4A2U A;  2DBB A;  1RIO H;  5ICG A;  3DF8 A;  2MA3 A;  1R36 A;  1LVA A;  3JW4 A;  4UVC A;  2OU2 A;  4RAY A;  2Y48 A;  1FLI A;  1JXS A;  1YO5 C;  2A5Y B;  4CGZ A;  4IRG A;  5LHG A;  1FYM A;  2FA5 A;  1YW9 A;  1O3R A;  2VXZ A;  1RNL A;  3VB2 A;  3JTG A;  1TLH B;  3EQL F;  2O03 A;  2QEN A;  3R60 A;  1LNW A;  2STW A;  3BP8 A;  3WE3 A;  3QRF F;  1HSJ A;  2EJR A;  1W5T A;  3KP2 A;  4HQE A;  3EDP A;  3L00 A;  1MJB A;  1TTY A;  3O2P E;  3NEU A;  5HLH A;  4AIK A;  4OIN F;  4MQ9 F;  2K4B A;  2A3S A;  4HQM A;  4EGY A;  1BI3 A;  4R79 A;  1ZGA A;  2K27 A;  3MEX A;  1WKM A;  1IXS B;  3D0S A;  5AON A;  3IKT A;  4BHC A;  4M72 A;  1U8R A;  3GEZ A;  3WG9 A;  2O61 A;  2ADU A;  2FSW A;  1CF7 B;  4ON0 A;  4MTE A;  5A2Q Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...