5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
2Z3YA 4ZZDA 1P4AA 4S05A 2XASA 3HHHA 2UXXA 1IN7A 1ONVA 2XROA 1F4KA 3FXUA 4R79A 3KLOA 5K5OA 2V6CA 3C1DA 1QNTA 5TJJA 4IVNA 3LAJA 3TKYA 4Y17A 5TRDA 3PQKA 4NHJA 2Z5UA 2HGCA 1GXQA 1E2XA 2FBKA 1ZARA 1LB2A 5JVTA 4KYWA 2M8EA 1ZRFA 1S3JA 1QZYA 4UXNA 2LNBA 1K78A 3VFZA 2OAZA 3ABUA 2VC1A 4HAMA 1WRJA 2F5EA 2B0LA 2JTVA 3BZ6A 1BI0A 3R0AA 4L18B 4A2UA 2D1HA 4EQQA 5D8KB 3GFLA 3I64A 3ZMZA 5D6EA 4G7ZF 3TO6A 3GX4X 3ZMDA 1BIBA 3IKTA 3V8KA 1O3RA 4LB6B 3E3VA 4RB0A 3Q9VA 4G6QA 3TQNA 3I59B 5FD5A 1XN7A 4E70A 1U5TA 4B09A 2K7LA 1TW2A 4KIGA 2K27A 4XRFA 4A12A 2LSOA 3ZMTA 4CZZA 3CDHA 4ZYGA 1BBYA 1SFUA 1QGPA 5FLXK 4CGZA 5JI6A 1KYZA 3MZYA 4PZJA 3EETA 5DUKA 5H6QA 1MDMA 4PDKA 3RKXA 2UZKA 2E1NA 1I1GA 2M5WA 3JW4A 3K69A 2VOOA 1RI7A 3N4MA 3REOA 2EFOA 2DBBA 1YQAA 1YS7A 2F2EA 2PFBA 3CUQB 4FX4A 4KDPA 3KETA 1S6LA 2GXGA 1FPQA 3ELKA 3D5LA 3W6KB 3QPTA 1Z6RA 2MH9A 2GQQA 2KRFA 1W4MA 1TQIA 4HQEA 3ERED 2MLGA 4NB5A 4ESFA 2BV6A 3WG9A 4HA8A 1TQMA 2QBYB 5AIQA 3BY6A 1USSA 4Z2YA 2IRFG 3WGGA 2O6GE 2BE5F 3ROUA 2RN7A 3FMSA 1ZGAA 1U78A 2YSRA 2EFNA 5H6RA 3R6SA 2MH2A 5HVQC 1Z7UA 5EEGA 1HKSA 3WTYC 4L5IA 2DAOA 3QU3A 1ON1A 3I0TA 2TDXA 5K5QA 2VN2A 2DU9A 3BROA 1MJBA 2A5YB 4P55A 3I4PA 4U0YA 4MHGA 1R1UA 1ON2A 2NYXA 1UFMA 3JAMZ 4IXAA 5H20A 4LB5A 5FB2A 4BH9A 2STWA 2A6HF 4YIIA 1XGNA 4XLNF 2RV8A 1FYKA 2PMHA 3BPXA 3GFMA 1XSXA 3F23A 2GWRA 4HQMA 2K02A 4KUMA 1FBSA 1LQ1A 4N9IA 1Q1HA 4CICA 2QLZA 4L9NA 1KQ8A 2HWVA 3KE2A 4FT8A 2X4HA 2D2WA 3DXJF 5ICEA 1H9TA 4RB3C 3E6CC 4O6JA 3GYHX 2RQPA 3HSRA 3LA7A 1HKTA 2M87A 2CW0F 3BJOA 3I53A 3P9CA 5LGUA 4HZFA 4G7OF 2DO7A 1Z1DA 4RGUA 3DKWA 2K4JA 5ICGA 1BC8C 4UHTA 3WTTC 3I5UA 1ZRCA 1X3UA 2XVCA 2FBHA 2OBPA 2VODA 2V79A 1IN6A 2D1VA 4MTEA 4L0YB 3GUDA 1F5TA 3HOSA 1O57A 3WTUC 1K6OA 2WC2A 4WWCA 4M9ZA 4IJAA 1FC3A 1YG2A 1UHWA 3KP3A 3T8TA 3EYYA 4P5OA 1GVJA 2MD5A 4JQFA 4RGSA 4D0PA 3C3WA 1R23A 4RGRA 2CWEA 3CUOA 2BGCA 2KIUA 5DCMA 4U7DA 4YG2F 4Q5SF 1T0FA 4CXFA 2W85A 2PI0A 3KZZA 3CTAA 3ML6A 4I0BA 2VE9A 1MKMA 1FZPB 3T0YA 3WU0A 2M45A 3MWMA 1W5SA 2H94A 1LNWA 3EDPA 1FNNA 4BXUA 1P4XA 1XCVA 2FMLA 1B9MA 2MC3A 2K86A 1G4DA 1DP7P 5E1ZB 3I54A 2R7FA 4OIRF 5FD6A 1MD0A 4PCQA 1O3QA 3VODA 1IXCA 2ZNZA 2VONA 2JT1A 3NQOA 1UB9A 5HS8A 2H09A 1IN8A 2F5CA 3GFJA 3FM5A 1I27A 4RB2C 5BQTA 3J80Z 3QPHA 4JK1X 2P6SA 5K1YA 3HSEA 3QOPA 1WKMA 1R1TA 3DF8A 1JHHA 3GVAA 1PP7U 5IT9K 1ZLJA 5D8LB 1CF7A 4I98B 1WWXA 1HW2A 1B1BA 3KP5A 1BOAA 1U2WA 3V4GA 1OPCA 3ISPA 3TO9A 3BPVA 2A3SA 3TDUC 2DLLA 3SZTA 1MZBA 2IA0A 4AIJA 3RKYA 2DQRA 2YPRA 3VOEA 2AXLA 5LRRA 3R60A 2EA2A 4EM0B 1FYMA 5LEKA 4EJWA 2Z33A 2XKPA 1B59A 5DV5A 3WODF 2G9WA 3QU6A 1R7JA 2HYFA 3JSPA 3I58A 2LDUA 3P9KA 5A2QK 1YS6A 2W57A 3DPLC 2V1XA 1TLHB 3E97A 2KIMA 3DP7A 2Z9OA 4WX9A 3T1BA 3ZMVA 2Q2EA 2NS0A 2FU4A 3GZ6A 4HDUA 5F1RA 5IT3A 5HDNA 5BS6A 2IP2A 4U0WA 3FMQA 1ZHFA 3F21A 5ERIA 3M9AA 2A69F 2WV0A 1D5VA 3KP4A 2HTJA 3BDDA 5HS9A 1LJ9A 1JGSA 1XD7A 3H3ZA 3J81K 4FX0A 1FLIA 4P9FA 1IUYA 1SMYF 2ISYA 4KN7X 2WTEA 1YW9A 4A0XA 1D8KA 1GXPA 1YW8A 3COAC 4GYGA 4QWQA 4GYIA 3ZMUA 3HIFA 1FX7A 3V7CA 3OV8A 3MEXA 2G7UA 5J8CA 4IRIA 3EQLF 3KP6A 3WE3A 1F1ZA 1J75A 1GHCA 2W24A 4HW0A 3ULQB 5F6FA 4RB1A 5HLHA 2ZO4A 4AIKA 2ESNA 3ZPLA 5L3FA 4G9YA 1IN4A 2OQGA 1G3SA 2ETHA 2P8TA 3LWFA 5D5XB 4ESBA 4HV6A 4EJTA 2DK5A 5E8GA 4AD9A 1C0WA 3HRTA 2CO5A 5KK1A 2HZTA 1XMAA 5CVVA 2F5FA 2QM3A 3RKWA 3HOTA 3CJNA 2K4BA 2PG4A 4YFNF 2DQLA 5J6XA 1EH6A 2VBYA 3H92A 3N97A 2XAFA 1OYIA 5EEHA 1R22A 3NEUA 3SZPA 1JXSA 3CUQC 3KZYA 4L9TA 1TTYA 2E7WA 5BPIA 3EYIA 3H3UA 3I59A 4BHPA 1Z9CA 5D5VB 2RNJA 2HYGD 3T5XA 1LDKB 5JR3A 3QAHA 1ZG5A 1T6SA 2XKOA 2RKHA 3WTWC 2P7VB 1U6GA 3F8NA 5D5UB 2EFWA 2FSWA 1ZG3A 1HW5A 1Y0UA 4LFUA 5FLXZ 3O3KA 4M6YA 1HSJA 3F8FA 4A0ZA 1V3FA 3U1DA 4EGYA 4OU0A 3M1EA 3BJAA 1J2XA 3E6DA 1ZREA 5HDGA 4ZYDA 3CUQA 1RIOH 3F3XA 3ZN0A 2DPUA 2FRHA 1PUEE 2W84A 3K2ZA 3KEOA 4YFKF 5D4RA 1FBUA 2GIVA 3LA2A 2QBYA 1DPUA 5D5WB 1W5TA 2F5DA 3VB2A 4O5VA 1U8RA 1Z6TA 3F6VA 1P4WA 1QZZA 4KFCA 3K0LA 1WSUA 5L3EA 2O61A 3HSFA 5LEJA 2QQBA 4MQVA 1T38A 1CGPA 2OU2A 2FOKA 3L9FA 1IXSB 1FY7A 1O3SA 2DW4A 2QQ9A 2IW5A 3HRSA 3IL2A 3L2CA 4WXDA 3ZQ7A 2HEOA 1DDNA 3I71A 3FZVA 1R5GA 5L3CA 2RDPA 2HQRA 1KGSA 3BJ6A 2FNPA 4XBFA 4OIQF 1IXRC 1LDDA 4ZH4F 2CYYA 5F64A 3R0JA 2E1CA 3KP7A 1P2FA 2RC4A 4BQAA 3GW2A 2ZJ2A 4ENKA 1D8JA 2FF4A 3U9GA 4R1HA 1B9NA 2OD5A 4F7ZA 4LMYA 3WTSC 3IRRA 4M74A 1S7OA 2Q0OA 1I6XA 2MLKA 1DPRA 1U3EM 4RAZA 5E1WA 1TQPA 4HBLA 5CVJA 3G73A 1NHAA 1IF1A 2DTRA 2HR3A 4HDVA 4GCVA 3E5QA 1EH7A 4PGHA 4I2OA 2KKOA 5ILVA 3J7AO 5DCFA 1FBQA 3CO6C 4S04A 5E18F 2QUFA 1TBXA 2Y48A 2O03A 5E20A 2G7HA 2EV5A 1OKRA 1FSEA 1KU2A 2IVMA 3M8FA 3FM3A 2J5PA 2L4AA 3G3ZA 3DQVC 3JSOA 2UXNA 1BJAA 3DEUA 4UVCA 4EJVA 3B73A 1XDSA 1KQ0A 2ZKZA 2VE8A 2JZYA 1RZ4A 3RPUA 5HDKA 1MJ9A 2IA2A 2JPCA 3IKVA 4MQ9F 3FHZA 2O3FA 2YX7A 3VEPA 1P6RA 4AIHA 2VBZA 1RUOA 3AAFA 3KLNA 1ULYA 2GAUA 3SFZA 2VBWA 2ADUA 1BIAA 3RYPA 3HRMA 1ZYRF 1XMKA 2EA4A 1G3TA 2L3DA 2HKOA 4MGRA 4KA4A 2HTSA 4HX8A 6PAXA 1XSVA 5DYMA 2P4WA 1ODDA 1BI2A 1EH8A 4M9SA 3S2WA 2P7CB 3FMRA 3K1NA 4P96A 4P9UA 4EGZA 2A6EF 1KU9A 2FE3A 2EK5A 2EV6A 4LLLA 1EV7A 3O2PE 2LKPA 4XSZF 2WWYA 3MFKA 4A6EA 1D3YA 2O0YA 1V4RA 4BNCA 2BBYA 5AIPA 1W7PB 3LFKA 2RGVA 5IT9Z 1SD6A 4GO1A 2ACJA 2J5OA 2Z99A 4WF2A 2EFPA 2HDCA 1IZ1A 3GWZA 3LQQA 1E17A 4JBAA 3TO7A 3LQRA 3MCZA 5HLIA 3LAPA 1LEBA 4GGGA 2CFXA 4BAYA 4HLYA 5ED4A 4HF2A 4LD5A 4LK0F 3WU1B 4B8XA 3V8JA 3HHGA 3F8CA 3GXOA 1I5ZA 4RAYA 2MBFA 1WI9A 1YW7A 2VT2A 3E6BA 3HYIA 1IW7F 3RPQA 2GXBA 1J9IA 2DT5A 3OOPA 2PQ8A 4UV8A 1SD5A 1YLFA 4FHTA 5A2QZ 3L09A 1YTYA 4HV5A 1DUXC 1FYLA 3TDZC 2L01A 4Q4ZF 3MZHA 4XSXF 4R8HA 4BYYA 1OYYA 4EV0A 1PDNC 4UUVA 2ELHA 4UVAA 5DEQA 2A68F 1LDJA 3TGNA 3V7RA 3KP2A 5K5RA 4BHBA 4MNUA 2EWNA 3BOQA 2XIGA 1UCRA 3T8RA 3JTGA 5CVRA 2XGXA 1QBJA 2IPQX 1L3LA 1O7LA 2XAHA 5HLGA 1SFEA 1UHMA 2V1UA 3J81Z 2HS5A 4EJOA 3DV8A 5ILUA 3SHFA 2GZWA 2P5KA 4G7HF 3GFIA 2DFIA 4WXHA 2A61A 3BWGA 1FOKA 2XRNA 5ICCA 4KNYA 2FNAA 2QZ8A 5CYVA 1XB4A 4L5JA 2XAJA 1HBXG 1A04A 4G94A 2ISZA 2DK8A 2DI3A 3M8EA 4ZZLA 3QRFF 3IWFA 1O7FA 3WTXC 1BC7C 1TNTA 5LHHA 4YFXF 2XAGA 5DD4A 5LHGA 2STTA 3L00A 2R7DA 4MEYF 1IN5A 2ZBKA 4CYDA 2EV0A 1ZH5A 1MGTA 3CLOA 3MAJA 4EVIA 4IPAA 4HYEA 1U5TC 1H0MA 3RI4A 2HQNA 3IHUA 1XGSA 2VBXA 4M71A 4IHTA 4OMYA 4UVBA 3D0SA 2PJPA 1OR7A 1KU7A 1K78B 1HSTA 1H9GA 4HOBA 4L9VA 2JSCA 2Y75A 2VXZA 1SD4A 1HW1A 4EM1A 1HKQA 3HTUA 3JTHA 3L7WA 5LGNA 4A0YA 2W25A 4ENJA 4UNOA 1KU3A 1S29A 3QP5A 5CVIA 4M9XA 1ZAOA 4WXCA 1YYVA 2ZCWA 1T39A 2VOPA 3GZ5A 4U7BA 4OINF 3FF5A 1QO0D 1BI3A 4EJUA 4HLXA 1IRGA 4OIOF 3ZMSA 2HFHA 3GF2A 4NQWA 1U5TB 2M1BA 4ZYEA 2FQ3A 5FFZA 1SMTA 2NNNA 5KVRA 5L3DA 2HKXA 4OOIA 2PN6A 4LG0A 2FEZA 1R58A 5ICFA 4TV7A 4LG0B 1Z05A 4RS8A 1P92A 1O3TA 1MJAA 4HX4A 5L3GA 5E8IA 1MDMB 4ON0A 5D4SA 3V7SA 4OIPF 1ZGJA 2BEOA 4M6XA 5FGMA 2VT3A 1SD7A 4LLNA 3WTZA 2QYOA 4XLPF 1T2KA 2ZXJA 1AWCA 3DFGA 5L3BA 3RYRA 5CLSA 4KIBA 4ESJA 1FP1D 1YIOA 3MQ0A 2P5VA 1AOYA 3WTVC 2Q8KA 3RJPA 3LA3A 5DUIA 2QENA 2ZFWA 2PBIA 2HOEA 3LSTA 2EB7A 3FXRA 1J5YA 2L54A 4MTDA 2MA3A 3E5UA 3TOBA 5LHIA 2RVCA 4M72A 5JFRA 3K1MA 1OYWA 3C18A 3QP6A 4KMUX 5JHUA 3R4KA 1W7PD 2XV4S 3FX3A 3K1PA 4IHSA 3HRUA 3GEZA 2R3SA 4ENNA 4DNCA 2GA2A 3M7GA 4AWXB 2E7XA 1FSHA 1J7KA 3WE2A 4Y15A 1K7AA 5LLQA 2FMYA 2NNYA 3JAMK 1R36A 4N9HA 4KICA 3F6OA 4QLCU 3FXQA 1PP8F 4EM2A 3HTSB 1KYWA 2FBIA 2EFQA 3K9TA 3Q5FA 1KQ9A 1T98A 3SQNA 5HOOA 3ECHA 2H6CA 2P6TA 5LBQA 2OZUA 2NAZA 2GA1A 1IRFA 4A5MA 1KA8A 1TNSA 4LK1F 4Q47A 4ETSA 3HUGA 2EJRA 1R1VA 5BPDA 1YO5C 2O8XA 2L02A 1R00A 2Y0MA 1F9NA 4ENMA 3ABTA 4O3MA 2KIFA 5BOXA 1HQCA 3Q9SA 2C6YA 3P9IA 1QPMA 4HF0A 2H27A 5BMZA 2M30A 2IT0A 3E6MA 4HX7A 1G3WA 2LF7A 4G6DA 1ZG1A 1TW3A 2QWWA 4ZYHA 1QQIA 1ZLKA 3V8LA 3IC7A 1RNLA 3IRQA 4AVPA 1B6AA 2JRTA 3R61A 5DDGA 1J59A 4UV9A 4IRGA 3NRVA 1ZN2A 2YR2A 1R5HA 3RTRA 3PQJA 2LF8A 2JPBA 5DD8A 3ZN1A 2KJCA 2D45A 1FP2A 4PGGA 1BM9A 5D6FA 5DCMB 2PLYA 4MEXF 4A5NA 3U2RA 1J0RA 5E17F 1STZA 2FXAA 2V1DA 2KJBA 4RGXA 2COMA 5FO5A 3CO7C 3RDIA 4KN4X 3F72A 4KT5C 2IJLA 1JHFA 3F22A 1K79A 1HXDA 4WCGA 1XGMA 1BN5A 3O6BB 2DPDA 4BHCA 3KEQA 1S7AA 4N0BA 4I7HA 4HF1A 4DQ2A 1Z91A 5E1XA 4LLGF 2YU3A 3KCCA 3ZP5A 2AS5F 2VC0A 1OMIA 2BYVE 4GXOA 1L0OC 2OA4A 3BP8A 2CSOA 2QVOA 2L4MA 2ZMEA 1W7PA 2FA5A 1S8NA 4I02A 3WGHA 2ZMEB 5LRSA 3RIRA 2YX4A 1FT9A 5LGTA 5AONA 2OZ6A 3J80K 1B4AA 2XUBA 3F8BA 1G3YA 2X0LA 3KFWX 3E5XA 4L9JA 4K2EA 5FFXA 2PMUA 3PFIA 5CVUA 1REPC 5J8FA 2CQKA 4U0VA 1FWZA 4OMZA 4A6DA 4Y13A 1CF7B 2ZNYA 5ILSA 4G8XA 4L0ZB 4H0EA 2OQRA 2P5LC 1XSDA 2V9VA 1LEAA 1YFHA 2XHKA 4ASNA 5HS7A 2IA1A 4I01A 2H6BA 3B02A 5CJ9A 4LJZF 1BI1A 2A07F 3DPTA 3TOAA 4I09A 3GLXA 4WK8F 4KMFA 4I0AA 4CHUA 3WGIA 2ESHA 4CDGA 4Q48A 2QQAA 3C7JA 1I1SA 1SAXA 4LGWA 3EUHA 3GO5A 3P7NA 1IAWA 4U88A 1XGOA 3F8MA 1LVAA 4EMSA 4YIFA 1JE8A 2CG4A 3W6JB 1VTNC 4KIFA 1WQ2A 2PEXA 1RUNA 2UWMA 1USTA 1XDUA 1SFXA 1G6NA 2CGPA 4M73A 2NRAC 3ECOA 4CO8A 3FWEA 1ZRDA 2XAQA 4IF4A 3IWZA 4IRHA 1XCBA 3SXYA
chains in the Genus database with same CATH superfamily
1MMDA 2UUZA 2Z3YA 1NG7A 4ZZDA 4JX6A 2O8KA 1P4AA 3BQZA 4G6TB 4AYBN 4S05A 3DTEA 2XASA 3HHHA 4XLEA 2UXXA 1IN7A 1ONVA 3DEEA 1LFUP 2FOWA 2XROA 1F4KA 3FXUA 4R79A 3KYDB 3KLOA 5K5OA 2V6CA 4DGWB 4ZDLA 3C1DA 1QNTA 5TJJA 2HPIA 4IVNA 3LAJA 3TKYA 4Y17A 5TRDA 2BHZA 3PQKA 2E1MC 4NHJA 3PUBA 2EILH 2KRHA 2Z5UA 2MW8A 5FJ8J 2LVSA 2EH3A 3L2VA 2HGCA 1GXQA 3M4OJ 1E2XA 1VQ8I 4FQGA 2FBKA 2VJ4A 2K5CA 1ZARA 1LB2A 5IP6A 1RR8C 5JVTA 4KYWA 2M8EA 3OYJA 3LOCA 1G2HA 1MNMC 1ZRFA 1S3JA 4ANJA 1G8XA 2HXOA 2VQGA 1QZYA 4UXNA 2LNBA 1K78A 2XF5A 3VFZA 2OAZA 1DGWY 1MBFA 2WBMA 1IG7A 1JI8A 3G1OA 3ABUA 2VL8A 2VC1A 4HAMA 1WRJA 2F5EA 2KZGA 2B0LA 2JTVA 3BZ6A 4U87A 2XF6A 3CCRI 1QPIA 3SZGA 2W48A 4B43A 4FTHA 1ETKA 1V55H 1BI0A 3R0AA 4L18B 3ONQA 1YJWI 4A2UA 4BKXA 1LE8A 2D1HA 4EQQA 2KIQA 5D8KB 3GFLA 3I64A 3UKGA 2D5VA 1R4NB 5GTIC 3ZMZA 2XC7A 1OCZH 5D6EA 5M5YJ 1HDDC 4G7ZF 2F4MB 4QPOA 3TO6A 3ZMDA 3GX4X 1BIBA 4FCYA 3A2KA 2QF7A 4XRMA 2E1MB 3IKTA 3V8KA 1O3RA 2W4SA 4LB6B 2COBA 4DYQA 2YU9J 3E3VA 1MMSA 3ESWB 1MNDA 1BOBA 3ABKH 3Q9VA 4G6QA 4RB0A 4DW6A 1R71A 3TQNA 3I4NJ 3I59B 5FD5A 1XN7A 1PYVA 4E70A 3QQAA 1U5TA 4B09A 2K7LA 2Y0SA 1TW2A 3AG1H 2K27A 4KIGA 4M6VA 4XRFA 4A12A 2XSJC 3E1SA 1SVMA 2L9RA 4BACA 4XRSG 2JK3A 2LSOA 3ZMTA 4CZZA 3CDHA 4ZYGA 4J00A 2I10A 4XN0A 2FJ1A 1BBYA 1SFUA 1QGPA 3UR3C 5FLXK 4CGZA 5JI6A 1KYZA 1PJRA 3MZYA 4PZJA 3EETA 1RESA 3FXOA 2Q1ZB 2HZDA 5DUKA 5H6QA 5KAIC 1MDMA 1FTTA 5EF6A 4PDKA 3RKXA 2L5QA 3PIPF 3BG6A 2UZKA 2E1NA 2LR8A 1WH5A 3LSMA 1I1GA 2H1LA 2M5WA 1IC8A 1JT6A 3JW4A 2WAQN 3K69A 2VOOA 2OV7A 1RI7A 2R7UA 1OJLA 2F48A 3N4MA 4BE2A 3REOA 2EFOA 2DBBA 4KISA 1O4XA 1WI3A 1YS7A 2F2EA 2PFBA 3CUQB 4FX4A 4KDPA 3LL7A 3KETA 1S6LA 3DTKA 3VDXA 2GXGA 1JTXA 4A3EJ 1FPQA 3ELKA 5BNGA 1YOVB 3D5LA 3W6KB 3QPTA 1Z6RA 2MH9A 4JX4A 1TC3C 2GQQA 3K4KA 3ZGKA 2KRFA 1W4MA 1T95A 1TQIA 3QWLA 4HQEA 3ERED 5DM7F 4BY1J 3EUAA 2MLGA 3S15J 1Y0NA 4NB5A 4ESFA 2BV6A 2F6CA 3A1YA 5KAFC 3WG9A 3CCSI 4HA8A 1TQMA 2K9SA 2X6XA 2QBYB 5AIQA 3BY6A 4E6KG 3HKZN 1A36A 1USSA 4Z2YA 5J4YA 3CCUI 1TZLA 3WGGA 2IRFG 2O6GE 3QOEA 3LFUA 1YJ9I 2GM4A 2BE5F 3ROUA 1MBEA 2RN7A 3FMSA 1ZGAA 1U78A 2YSRA 5FROA 1EJ9A 3SEQA 3WHBA 2EFNA 5H6RA 1MBHA 4XM3A 1X1AA 3DWLE 3G4SI 2PMZA 2BVLA 2DFEA 2KMUA 2KZVA 2XB0X 3R6SA 2R5YA 1LKXA 2MH2A 2R5YB 1B8IA 5HVQC 3CLQA 2R7VA 1Z7UA 3B6CA 1HKSA 5EEGA 3WTYC 3AKZA 2FD5A 1B8IB 4L5IA 2DAOA 3QU3A 1RC9A 1ON1A 2ZJQF 1APLC 4ZDPA 3I0TA 2OCCH 4X1EA 2TDXA 5K5QA 4BE0A 4RM3A 2VN2A 2DU9A 3BROA 3OYMA 1MJBA 2A5YB 2E5ZA 3A0HC 4P55A 4CSWA 1AU7A 3I4PA 4XIDA 4MHGA 1V5FA 4PK4A 4U0YA 1R1UA 1ON2A 5GPAA 4BXXJ 2VPLA 2NYXA 3CD6I 1MIJA 1UFMA 3JAMZ 1JJ8C 2VASA 4IXAA 5H20A 4ZYAA 4LB5A 2Y30A 5FB2A 3K2AA 3HC7A 4BH9A 1I6HJ 2STWA 3KIOA 2A6HF 3OIQA 4YIIA 1K4TA 2TCTA 1XGNA 4XLNF 2RV8A 1FYKA 4I99C 2PMHA 3JRDA 2KHMA 3BPXA 3GFMA 1XSXA 3K4MA 3F23A 4Y7NJ 2GWRA 4HQMA 4E7HA 2JA8J 2K02A 2FUG2 3HJEA 2HYJA 4KUMA 3OYFA 1FBSA 4EATA 1LQ1A 4N9IA 1Q1HA 4CICA 2QLZA 5GAHJ 5LD2C 2RQQA 3GTLJ 1JT0A 4L9NA 1KQ8A 2HWVA 3KE2A 4BE1A 2VUMJ 2ICWG 1MSEC 4FT8A 2X4HA 1G59A 3VYUB 2D2WA 3DXJF 5ICEA 3S2HJ 1TT5B 1H9TA 3LSHA 4RB3C 3E6CC 4O6JA 1VI0A 3GYHX 2RQPA 3HPGA 3HSRA 3LA7A 4HG2A 1HKTA 2M87A 2CW0F 2Y31A 1RPWA 3K10A 3BJOA 2B7EA 3I53A 5J1RA 3P9CA 3IH3A 5LGUA 3TBIA 3J7YJ 4IHYA 2IS1A 4HZFA 3DBLB 3L2WA 3S2DJ 4G7OF 2DO7A 1Z1DA 4RGUA 3DKWA 3CF2A 1Z67A 4V2FA 2K4JA 5ICGA 2LKXA 1BC8C 4UHTA 3WTTC 3I5UA 3H9QA 1ZRCA 1X3UA 2XVCA 2FBHA 2OBPA 4FE7A 1VZ0A 4JX5A 1MMAA 4CYCA 1X1BA 2VODA 2V79A 3IH2A 4HSRA 3UNGC 1IN6A 2D1VA 4MTEA 4MO7A 1IUFA 2DA3A 1XS9A 4L0YB 3GUDA 1TWFJ 1YE9A 3ZCOA 4BGDA 3BR2A 1F5TA 3HOSA 3LSIA 3CJQB 3MKWB 2CU7A 3H5RA 1O57A 3WTUC 1K6OA 1W36C 2WC2A 4WWCA 1WJFA 3DCFA 5H2FC 2JQ7A 4XKWA 1POGA 1BR4A 4UUTA 2JMWA 4E7KA 4M9ZA 4IJAA 1R5ID 1TWAJ 3GTKJ 1FC3A 1OQYA 3BR3A 4A93J 1YG2A 1WJAA 4F3QA 5DM6F 4A3LJ 1UHWA 3KP3A 5EZGA 2A5WA 3T8TA 3EYYA 4IOCF 3FHNA 4P5OA 1MMNA 3FISA 1GVJA 2MD5A 4JQFA 4RGSA 4D0PA 2R92J 1OCCH 4BJ5C 3C3WA 1RRJA 1R23A 3PL8A 4RGRA 2CWEA 3CUOA 2BGCA 2ECBA 2KIUA 5DCMA 4YG2F 4U7DA 1VQNI 4Q5SF 2DT7B 3K4JA 1T0FA 4ITVA 2R0QC 5F0HA 4CXFA 2W85A 5J40A 3U1KA 1WHUA 1S5LC 2PI0A 3KZZA 2KPMA 3CTAA 3ML6A 4I0BA 2VE9A 1VQKI 1MKMA 5HODA 1Z7LA 1W1WE 2LG4A 3T0YA 3WU0A 1FZPB 1RKWA 1SVOA 1FOYA 3JRGA 2M45A 2NS8A 2EBIA 3K4BA 1R6RA 3HOZJ 3RQIA 3MWMA 3BT9A 1W5SA 2H94A 3FDYA 2E1OA 1LNWA 3EDPA 1FNNA 5J1YA 2MG4A 3I56I 3KX2A 4BXUA 1V5EA 1P4XA 4IQJA 1XCVA 2FMLA 1HA8A 2ELJA 2KQRA 2R7OA 1B9MA 2MC3A 1Z21A 4B4CA 2K86A 1V5GA 4DYRA 3IAS2 1F43A 1G4DA 5EEAA 1EKEA 4XLAA 1DP7P 1VQPI 5E1ZB 2EZLA 3HZJA 3I54A 2LY1A 1QRYA 2R7FA 4OIRF 5FD6A 1MD0A 2Z2SB 4PCQA 2V26A 2P81A 3VODA 5DTDA 4D1QA 1O3QA 3PNYA 4AM3A 1VQMI 4HNVA 3M3YJ 2KL4A 1K61A 1IXCA 2ZNZA 3K70C 2VONA 3S3MA 2VXDA 1JUMA 2JT1A 1UB9A 3NQOA 2JUCA 5HS8A 2H09A 2LD5A 1IN8A 2F5CA 3GFJA 2IXSA 3FM5A 1I27A 4RB2C 5BQTA 1KONA 3J80Z 4DIQA 3QPHA 2QSFX 4JK1X 2P6SA 2WADA 5K1YA 3HSEA 3QOPA 5HNHA 4QTRA 1I50J 2MABA 4IHXA 1WKMA 1R1TA 3DF8A 1JHHA 3GVAA 3GTJJ 2V1NA 1F36A 1BJZA 1PP7U 5IT9K 1ZLJA 3IP4B 5D8LB 3CCVI 1Y6IA 1X3WB 1CF7A 1VQ6I 4JYKA 1T8IA 4I98B 1WWXA 2DMPA 1HW2A 1B1BA 1ZQ3P 5M5WJ 4PJ0C 3W2VA 3KP5A 1IGNA 2Y0SN 1RETA 3FBIB 1BOAA 2L9VA 1U2WA 3V4GA 2ZJPF 1OPCA 3ISPA 3TO9A 3BPVA 4C2TA 2A3SA 3TDUC 2DLLA 3SZTA 3JRFA 1MZBA 2IA0A 4AIJA 3RKYA 1D1AA 2EZIA 2DQRA 2YPRA 3JRHA 2OTJI 3VOEA 2AXLA 2MD0A 2PX9A 5C3EJ 5LRRA 3HG9A 3R60A 1X1CA 2EA2A 2IGOA 2JJ7A 9ANTA 3TW6A 4EM0B 1FYMA 3OIPA 2M3AA 2CQ7A 5LEKA 4EJWA 2Z33A 3W2WA 2XKPA 1B59A 5DV5A 2GBYA 2OF7A 2BW3A 3WODF 2G9WA 2XDVA 3QU6A 2OC6A 2XAUA 3I9V2 4BDZA 3FXMA 1WJEA 1FTZA 1R7JA 1WH7A 2CV0A 3VWBA 2HYFA 5J4VA 3JSPA 3I4MJ 1FOXA 2B63J 3I58A 2LDUA 3P9KA 3H36A 3G2BA 5A2QK 5FLMJ 1YS6A 2W57A 3DPLC 3BZKA 4E7LA 2V1XA 3JR9A 2CV1A 1VNDA 4CCLA 3CCQI 1TLHB 1Z77A 3E97A 2KIMA 2QCOA 3DP7A 2Z9OA 1YRNB 4WX9A 1Y1WJ 1T56A 3T1BA 2V6EA 2ECCA 1H88C 3CC7I 3DBRB 1LFPA 3E7LA 2Q2EA 3K7AJ 3ZMVA 1IRZA 1H89C 2NS0A 2FU4A 3GZ6A 3W3CA 1YIJI 2Q2EB 2LH9A 4HDUA 2M7BA 5F1RA 5IT3A 2HOAA 5BS6A 2IP2A 5HDNA 3TEDA 4U0WA 5IOYA 3FMQA 5K7FA 1ZHFA 4EEFG 3F21A 3OY9A 4CA0A 3TP3A 5ERIA 3M9AA 2A69F 2WV0A 1D5VA 2VKVA 3KP4A 2E71A 2HTJA 3BDDA 5HS9A 1LJ9A 1JGSA 1XD7A 3H3ZA 3J81K 4FX0A 2PMZN 4G12A 1FLIA 1FJLA 4P9FA 1LPQA 1IUYA 4A3CJ 1SMYF 4LIVA 5M5XJ 4BBSJ 2ZJRF 4AIDA 2ISYA 4KN7X 2WTEA 1XX5A 1YW9A 2HQAA 2JVHA 1D8KA 4A0XA 1OCPA 4X0GA 1GXPA 2JWTA 1YW8A 3COAC 4GYGA 4QWQA 4GYIA 3ZMUA 3HIFA 1FX7A 3V7CA 3OV8A 3MEXA 2G7UA 5J8CA 4IRIA 3EQLF 3H0GJ 3KP6A 3PSIA 2L2OA 2AXTC 3WHCA 4A3JJ 5GAGJ 1FEXA 1HOMA 1M1EB 3WE3A 1A35A 2DA1A 1TWGJ 1F1ZA 1J75A 1GHCA 2XF7A 2W24A 1QVTA 4HW0A 5IYBJ 3ULQB 5F6FA 4DBQA 4RB1A 3HGYA 5HLHA 2V9PA 2ZO4A 4AIKA 2ESNA 1FMVA 3PNVA 3ZPLA 2E19A 5L3FA 4M3EA 3K4CA 3BR0A 4G9YA 2H1KA 2BY3A 2DOAA 1IN4A 2OQGA 4MFDA 1NH3A 1G3SA 2ETHA 2P8TA 3LWFA 5D5XB 3JCUC 1S9HA 1R4MB 4ESBA 4HV6A 2NOJB 4EJTA 2DK5A 5E8GA 1MBJA 1VQ5I 3DEWA 2ZXHA 3TMOA 3OSFA 4C3IJ 2XGEA 1YITI 3P5JA 4AD9A 1C0WA 2OPTA 2HVSA 3HRTA 3QODA 2CO5A 2JUGA 2HZTA 5KK1A 1ENHA 1XMAA 5CVVA 3NWTA 4HSTA 2VIXA 1E3PA 2F5FA 2JSPA 1EA3A 2QM3A 1D0XA 3RKWA 3HOTA 2G0EA 1YX5A 2XRLA 3CJNA 2K4BA 2PG4A 4YFNF 4E7ZA 2DQLA 5J6XA 1EH6A 1UHSA 3G1LA 3HGGA 2QEXI 2VBYA 3H3VK 3H92A 3HM5A 2XAFA 3N97A 4F93B 1OYIA 5EEHA 1R22A 1QVUA 3NEUA 3SZPA 3HDDA 1JXSA 4XOPA 3CUQC 3KZYA 4L9TA 2CV2A 3RZDJ 1TTYA 3L2UA 3RCOA 5IP9J 2E7WA 5BPIA 2DYRH 4DYCA 3EYIA 3H3UA 3I59A 3G71I 4BHPA 1Z9CA 2K9MA 5D5VB 3BCAA 2RNJA 3ZQIA 2IGMA 2L7MP 1X3ZB 2WAFA 3KZIC 4IO9F 4GFBA 2HYGD 3T5XA 1U0JA 1JUPA 4X6AJ 1LDKB 5JR3A 3QAHA 3PO2J 4Y4RA 1ZG5A 2HOSA 3E0JB 3MKZA 1UG0A 1T6SA 2XKOA 1D0ZA 4CZCA 2TRTA 3RZOJ 2LP0A 4RLFA 1UELB 2RKHA 4CH7A 3WTWC 3S3OA 2P7VB 2CS3A 1U6GA 3F8NA 5D5UB 2EFWA 3WU2C 3HB9A 2FSWA 1EF4A 1ZG3A 1D0YA 1HW5A 1Y0UA 4LFUA 2VI6A 4NC6A 2LYCA 3S1MJ 5HLTA 1K6YA 2Y9ZA 3FXLA 2QSGX 5FLXZ 3O3KA 4M6YA 1HSJA 4BEHA 3KEYA 3F8FA 4A0ZA 1V3FA 1S72I 3U1DA 4EGYA 3V42A 4OU0A 4BEHB 3M1EA 3BJAA 4N4NB 3BTIA 1SFOJ 3BZCA 3OIOA 1J2XA 2LY2A 5EGOA 1N77A 4IQ4A 3K4LA 3E6DA 5EGOB 1ZREA 5HDGA 3RPUD 4ZYDA 1GLNA 3CUQA 1RIOH 2ZFUA 2HVRA 5M3FJ 5E3MA 4XN3A 3F3XA 2X51A 1MH4A 1N25A 2XPWA 3ZN0A 2DPUA 2FRHA 3PO3J 1PUEE 2W84A 3K2ZA 4F55A 2EINH 1MMGA 1W36D 3KEOA 4YFKF 5D4RA 1FBUA 2GIVA 3TP0A 2L7FP 1X19A 2WB1A 3HOUJ 2K3PA 2KRCA 3LA2A 4XLFA 3RQ4A 2R7TA 2QBYA 1DPUA 2QA4I 5D5WB 1W5TA 4MLOA 2F5DA 3VB2A 2WV1A 4O5VA 1U8RA 2RNGA 2NS7A 1IDZA 1CQTA 2F4OB 1Z6TA 3F6VA 5K7ZA 4B3XA 2ZSIB 3CQZJ 1P4WA 1QZZA 4KFCA 3K0LA 1YI2I 1WSUA 1LUJB 2IS6A 3SJMA 5L3EA 2O61A 3HSFA 5LEJA 3LSPA 3BG9A 3GLLA 2QQBA 1A6QA 3CCLI 4MQVA 1T38A 1CGPA 3X2QH 2OU2A 2FOKA 3SEZA 3L9FA 4A3KJ 1IXSB 4LG3A 3JRIA 2MFZA 3N05A 1JKQC 1FY7A 1RKTA 1O3SA 2DW4A 1TWCJ 1T33A 4ZJZA 2QQ9A 2IW5A 4S0HB 1ETWA 3U21A 3MZ8A 4XMYA 3HRSA 2NVXJ 2NXNB 5C44J 3IL2A 3L2CA 2GIZA 4WXDA 3ZQ7A 2HEOA 1K83J 1IDYA 1DDNA 3I71A 1GVDA 4IKFA 3MMYB 4A3DJ 1ETXA 3FZVA 3GCMA 1R5GA 1ETVA 2L7KA 2K9NA 5L3CA 2RDPA 2HQRA 5GAEJ 5FKOA 3D1NI 1KGSA 1TWHJ 3BJ6A 4NC8A 2A6TA 2FNPA 4XBFA 4D7MA 4OIQF 2K9LA 1IXRC 3OYAA 1LDDA 4ZH4F 4IOAF 1HF0A 4A3FJ 3S1QJ 4M3GA 1U9NA 4DBRA 2CYYA 1UJ8A 5F64A 4NUBA 2NVTJ 4C2MJ 3R0JA 1ERDA 5GADJ 3ZQLA 3B6AA 2E1CA 3KP7A 1P2FA 2PJRB 2BY0A 2EIMH 2RC4A 1E3OC 4NBQA 2M7AA 4BQAA 5FLVA 3VYTB 3K70D 3GW2A 2ZJ2A 4XNFA 4ENKA 1D8JA 5B66C 2FF4A 3U9GA 4J19A 4R1HA 1B9NA 1WJBA 2OD5A 4F7ZA 3PJRA 3MN2A 3QPLA 3QPSA 4LMYA 3WTSC 2VJIA 2JA5J 4C3JJ 3IRRA 3FKJA 4F91B 4M74A 4P1WA 1S7OA 2Q0OA 4XKVA 1I6XA 2MLKA 1ZR4A 1DPRA 2HQ5A 1I3AA 1U3EM 1ETOA 3HUGB 4RAZA 5E1WA 1TQPA 4HBLA 5CVJA 2VB6A 3G73A 4L5EA 4BY7J 3HXLA 1NHAA 2QGUA 1IF1A 2DTRA 1U9OA 1WJDA 2L0KA 2HR3A 4PSWA 3K6GA 4HDVA 5FRNA 2VQCA 4GCVA 3PM1A 3LSRA 1UZCA 3E5QA 1EH7A 4PGHA 4I2OA 2LOOA 4PFOA 1WZ2A 2KKOA 5ILVA 3J7AO 5DCFA 2P0WA 2FX0A 5LFAA 1FBQA 3HBLA 4HPQA 3CO6C 2R7RA 3IAM2 4S04A 3H9JA 5E18F 2QUFA 1QHHD 1TBXA 2EZKA 2O03A 2Y48A 5E20A 2G7HA 2EV5A 1OKRA 2VKDA 1FSEA 2E2IJ 2Y2ZA 1KU2A 1NTCA 2IVMA 3M8FA 3FM3A 3JRCA 3A01B 2J5PA 1Z0XA 4RA2A 5KHDA 1VQ7I 1XCBA 2WAEA 2L4AA 3G3ZA 4B47A 3BC8A 4UB8C 1AKHA 3DQVC 5C4XJ 4W1UA 3JSOA 3G6EI 2UXNA 1BJAA 3DEUA 4PUSA 4UVCA 1AKHB 4EJVA 3ZQQA 3B73A 3HOWJ 4PSXA 2GLOA 3OR1C 5FKLA 2E2JJ 1UG2A 3HL2A 1XDSA 1KQ0A 2ZKZA 2VE8A 2JZYA 2AQEA 2K85A 1OCTC 2DTZA 4CCOA 1RZ4A 4FE4A 2MYSA 4ABZA 3RPUA 4BJ6C 1ITYA 5HDKA 4E7IA 3QYEA 2EIJH 3OYHA 1D1BA 1MJ9A 2R5ZA 2IA2A 2JPCA 1DU6A 1WVRA 4XL9A 3IKVA 4I6ZA 4MQ9F 1OLTA 2LMDA 2O3FA 3FHZA 2R5ZB 1X2NA 2YX7A 3VEPA 1P6RA 4AIHA 2VBZA 1RUOA 2IBDA 3CMMA 3AAFA 3KLNA 4IHWA 3FBNB 1ULYA 1IV8A 2IEKA 4AUXA 2NVUB 1DQUA 2DA6A 1A31A 4D5FA 1AHDP 2GAUA 3SFZA 2VBWA 1Y1VJ 4XOTA 3F0CA 2M4GA 2ADUA 2DA5A 1BIAA 3RYPA 3HRMA 1ZYRF 1XMKA 3NAUA 2JRMA 4E4HA 2XSDC 1Q1VA 2EA4A 1G3TA 2X9DA 3I55I 2CH0A 2L3DA 1WPKA 2HKOA 3H1CA 4MGRA 4KA4A 2DDAA 1MSFC 2HTSA 4E7SA 4HX8A 4CCMA 6PAXA 1GDTA 1XSVA 3M1CA 4Y33A 3VSKA 5DYMA 5FKNA 2LLKA 2JA7J 2P4WA 3VPRA 2H8WA 1BW5A 1ODDA 1BI2A 4F52A 1EH8A 1ETQA 4M9SA 3S2WA 3OYGA 2P7CB 3FMRA 3K1NA 1QZEA 4P96A 3CCEI 1WCMJ 2M34A 4P9UA 4EGZA 4V2GA 2A6EF 1VQOI 4N4OB 4RDUA 2MGQA 1KU9A 2FE3A 2EK5A 2EV6A 4LLLA 2X6OA 3OYNA 1WJ5A 3OYDA 3J7AY 1EV7A 2RAEA 3O2PE 3K4NA 2LKPA 4XSZF 4Z6YA 2WWYA 3MFKA 4A6EA 2CUZA 3BTJA 3CC4I 1NK2P 1D3YA 2X48A 2O0YA 1V4RA 3DLLF 3ZXSA 4BNCA 1JKPC 1A6IA 2BBYA 3CMEI 5AIPA 1W7PB 3VYRB 3LFKA 2RGVA 2AHQA 1TP4A 3OL4A 3OYCA 1NK3P 5IT9Z 2DDBA 1SD6A 4GO1A 1XG1A 2ACJA 2J5OA 2Z99A 3EUHC 4WF2A 2EFPA 3ZQCA 2BOLA 2HDCA 1IZ1A 3GWZA 3LQQA 1D5YA 4JBAA 1E17A 2NVYJ 1JGGA 3TO7A 3LQRA 3MCZA 5HLIA 3LAPA 1LEBA 4GGGA 1MBKA 2CFXA 5J47A 4E7JA 1AA7A 4BAYA 2CQXA 4HLYA 3H5AA 5ED4A 3Q0WA 4HF2A 3O8HA 4LD5A 4LK0F 3WU1B 4B8XA 3V8JA 3HHGA 3ZOBA 2KISA 3D5SC 3F8CA 5EG0B 4BUPA 3GTQJ 5IOZA 3GXOA 1QA6A 1I5ZA 4RAYA 5JLXA 3CP2A 2MBFA 1WI9A 1YW7A 2VT2A 2LBFA 3E6BA 3IH4A 3HYIA 1SFKA 1IW7F 4MIMA 3RPQA 2GXBA 1J9IA 2LBFB 2DMQA 4GDFA 2DT5A 2KT0A 2R7SA 3OOPA 3S1RJ 5GTHC 2K3FA 3I3LA 3BQYA 5F08A 1Y8RB 1OCRH 2PQ8A 4UV8A 3PSFA 1SD5A 2FQ4A 1YLFA 4C9YA 4FHTA 2XGCA 1YRNA 5A2QZ 3L09A 1YTYA 4HV5A 4YIRX 1DUXC 1FYLA 3TDZC 2L01A 1W0TA 1RR7A 4Q4ZF 3MZHA 4RBOA 4XSXF 1NG6A 4R8HA 4BYYA 1OYYA 4EV0A 3CCJI 3JREA 1PDNC 2ME0A 2ELHA 4UUVA 4UVAA 4PJLA 2LREA 5DEQA 2A68F 3A0BC 3GMEA 4BXFA 3S1NJ 1LDJA 2WB1N 2F5VA 4A3GJ 2OTLI 1GV5A 3TGNA 3V7RA 2ZXIA 3KP2A 2DMTA 3GZNB 5K5RA 4BHBA 3HOYJ 4MNUA 1R9TJ 2EWNA 3KYCB 3BOQA 2XIGA 1UCRA 4NC7A 3T8RA 2M4KA 3JTGA 3L2QA 5CVRA 4H4KC 2X1CA 2XGXA 3FXJA 1BW6A 2OCEA 1QBJA 2IPQX 1L3LA 2JA6J 1O7LA 2V4JC 2XAHA 2DODA 2O7OA 5HLGA 1SFEA 1UHMA 2OUMA 2QQ8A 2AO9A 3SDBA 1UMQA 2HU9A 2V1UA 3J81Z 1OISA 2VQLA 2HS5A 4XKCA 4EJOA 3DKYA 2WY7Q 2M0MA 2M2EA 4PJNA 4PJMA 1HC8A 3DV8A 5ILUA 3SHFA 1VFCA 3BR1A 2GZWA 2P5KA 5CQEA 3CC2I 3OYLA 4G7HF 4A3IJ 2R7XA 3GFIA 1X4PA 2DFIA 1IJWC 1OR7C 1XTAA 4WXHA 2HXIA 2A61A 1W5CC 3MVPA 2MSYA 3BWGA 3MKYB 4UUSB 1FOKA 3S14J 2DA2A 2VPRA 2XRNA 5ICCA 2R7QA 1GUUA 5J1UA 4KNYA 2FNAA 2QZ8A 3DTIA 3ZR8X 5CYVA 1XB4A 4L5JA 4XK4A 2XAJA 4B1RA 1HBXG 4FASD 1A04A 3IUOA 4G94A 2ISZA 2LC2A 3O8GA 2DK8A 2DI3A 2X85A 3M8EA 4ZZLA 4RAGA 3IWFA 3QRFF 2VKHA 4B48A 1O7FA 3WTXC 1BC7C 1TNTA 1YX3A 5LHHA 1DP3A 4BQQA 4YFXF 2XAGA 3H35A 5DD4A 5LHGA 2STTA 3L00A 3MD2A 2KLOA 2R7DA 3HOXJ 4MEYF 4FISA 2W7NA 1IN5A 2ZBKA 4CYDA 2QKLB 5GPCA 2EV0A 2NVQJ 3LSJA 1ZH5A 1Z3XA 1MGTA 3CLOA 2ZSHB 3MAJA 4EVIA 4IPAA 4HYEA 4BU2A 1U5TC 3OYBA 1H0MA 5FKKA 2IGNA 4HRIA 2LTPA 3RI4A 2HQNA 3IHUA 1XGSA 2E5NA 2VBXA 3BTCA 4HEA2 4M71A 2VQHA 3KYLA 2ZB9A 1XPXA 4IHTA 4OMYA 4UVBA 1SVLA 3D0SA 2PJPA 2DOEA 1OR7A 1KU7A 1K78B 2HI3A 1HSTA 1Y8QB 1H9GA 4HOBA 4L9VA 4LOCA 1Y56A 2JSCA 2Y75A 4II2A 2ELKA 2VXZA 1SD4A 1HW1A 5M3MJ 3HEFA 3Q0VA 4RAFA 2V9KA 2CRGA 4EM1A 1HKQA 3HTUA 2GOXB 2VKEA 3JTHA 1ZR2A 2OJED 3L7WA 3EUKL 4KT6A 4M3BA 5LGNA 1I3QJ 3BG3A 2E60A 4A0YA 2W25A 4ENJA 1LE8B 3Q0UA 5IYCJ 2JA2A 4XONA 4UNOA 1KU3A 1S29A 3QP5A 5CVIA 4M9XA 1ZAOA 4PFPA 4WXCA 1YYVA 3OS2A 2ZCWA 5E3OA 2EQRA 1T39A 5FKMA 2VOPA 3PIOF 2UV1A 3GZ5A 4U7BA 2KDZA 4OINF 3FF5A 4IX7A 1QO0D 2KP6A 3RKQA 2R7ZJ 1VQ9I 1N75A 1BI3A 4EJUA 2MC4A 4HLXA 4D9JA 1IRGA 2X6YA 3NWSA 4OIOF 3ZMSA 2HFHA 3GF2A 3M8JA 5CKTA 4NQWA 1U5TB 2M1BA 3SDGA 2I8DA 4ZYEA 2FQ3A 4OAYA 4NQWB 5FFZA 1SMTA 3OS0A 2BY1A 4B44A 2NNNA 5KVRA 1MNEA 3DKXA 5E3LA 3DPUA 5L3DA 2HKXA 3M07A 2PN6A 4OOIA 4LG0A 3DBHB 1LVKA 2FEZA 3ABLH 1R58A 4AU7A 5ICFA 4TV7A 4LG0B 1Z05A 4RS8A 1P92A 1O3TA 3OYKA 1HCRA 4V19K 1MJAA 4IEJA 1KZHA 4I76A 4HX4A 3LNQA 2KFDA 2BHYA 1MH3A 3OYEA 1IO2A 5E8IA 5L3GA 2KDOA 1MDMB 4ON0A 1GV2A 5D4SA 4KITB 3V7SA 1HDPA 4HNUA 4OIPF 1ZGJA 2BEOA 4M6XA 5IPAA 1TL8A 4M3FA 4C2UA 5FGMA 2IS2A 2VT3A 1SD7A 4LLNA 3WTZA 2QYOA 4XLPF 1T2KA 3S32A 1E3HA 2ZXJA 2L9SA 3CCMI 5IP7J 5F27A 2HVQA 1AWCA 4UY8I 1SAUA 3DFGA 5L3BA 2DJNA 2R93J 3RYRA 5CLSA 2W1OA 4KIBA 4ESJA 1FP1D 1YIOA 1R49A 2H8RA 3MQ0A 2P5VA 4CCNA 2HDWA 4DZPA 3QYFA 1BR1A 5B1AH 1AOYA 3WTVC 5C4JJ 2Q8KA 3RJPA 1FOWA 3Q3SA 3LA3A 5DUIA 2QENA 4LITA 2DN0A 2ZFWA 2L9NA 1YJNI 3PNTA 2K40A 2PBIA 2HOEA 3ZQGA 1SC7A 3LSTA 2EB7A 3FXRA 2DYSH 1JUSA 5FRMA 2N8GA 2VJ5A 1J5YA 1ZKGA 2L54A 4XLCA 4MTDA 2MA3A 2GXAA 3E5UA 4DOZA 2B9SA 3TOBA 3BCBA 3H0DA 2O9LA 5LHIA 2RVCA 4M72A 1QHGA 5JFRA 3K1MA 2M9HA 5HNFA 1OYWA 2DFFA 2I5UA 4B3AA 3C18A 4JOMA 1E0EA 4KJZA 3QP6A 5KNLA 3LSKA 4KMUX 5JHUA 2NOGA 3R4KA 1W7PD 2XV4S 5EDNA 3ZRGA 3OYIA 5DS9A 3FX3A 4RLQA 3K1PA 4IHSA 3HRUA 3GEZA 2R3SA 4ENNA 4DNCA 4AYBA 2GA2A 3M7GA 3CMYA 4AWXB 2E7XA 4XRSA 1FSHA 1J7KA 2XPVA 3CJTB 2BY2A 2DA7A 3WE2A 1WFXA 4Y15A 4BBRJ 2HNHA 1K7AA 5LLQA 3OOUA 3A4CA 4AVZA 1ORKA 5TGTA 1X58A 2FMYA 2WA0A 2NNYA 3JAMK 1R36A 2E2HJ 4N9HA 4NNJA 5E3NA 1GT0C 2IS4A 2PJRA 2W00A 4OWRB 1MW7A 4KICA 3F6OA 1LFBA 5CQGA 4RM2A 4QLCU 1I39A 3FXQA 3AL0C 3OMYA 1PP8F 3AG2H 2BVMA 3FXKA 4EM2A 1A5JA 3HTSB 1JJ6C 1KYWA 2FBIA 3CP8A 4BS9A 3S3NA 2EFQA 4XICA 5B5EC 4MFEA 3K9TA 3Q5FA 1KQ9A 1T98A 2M8GX 3SQNA 5HOOA 3ECHA 2H6CA 2P6TA 5LBQA 2OZUA 2NAZA 3S93A 2GA1A 1WGXA 1IRFA 3AG3H 4A5MA 2GOMA 1KA8A 1X1DA 5EZHA 1TNSA 1V54H 4LK1F 4YRVA 4Q47A 4ETSA 3CF5F 2XGDA 1UAAA 4BL0B 2BXZA 1JTYA 1VF9A 3HUGA 2HDDA 1BR2A 2VLAA 1ZELA 2EJRA 1R1VA 3NARA 5BPDA 1YO5C 2DCEA 2WY8Q 2O8XA 3HOVJ 2L02A 1Y39A 4BQOA 1R00A 2Y0MA 3C2BA 1F9NA 5TISC 2EPFA 4ENMA 3OSGA 2DOFA 2LKSA 3ASOH 4XR6A 3ABTA 1P7IA 2O5RA 1ZGWA 2A05A 3AG4H 4O3MA 2KIFA 4RMNA 5BOXA 3CCYA 4XKBA 1HQCA 3Q9SA 5B1BH 2C6YA 3P9IA 1MBGA 1B72A 5IYDJ 1QPMA 4HF0A 4LIUA 2R7WA 5F0FA 1T0FC 3CMAI 1B72B 2H27A 4D5CA 3BLYA 5BMZA 3GTOJ 2M30A 3ZQFA 2IT0A 3E6MA 3HPHA 4HX7A 1G3WA 4OAZA 2ID3A 4JP0A 4BJTA 3JRAA 4C30A 2LF7A 3BTLA 4G6DA 4IL6C 1ZG1A 1TW3A 3W2AA 3GTMJ 2QWWA 4ZYHA 3A01A 1QQIA 2CUFA 4CCKA 4DJAA 4CYCB 4Y3OA 3W6VA 3AL0B 1ZLKA 3V8LA 3IC7A 1FMWA 2XPUA 2DT6A 1RNLA 3IRQA 4AVPA 5J3LA 3AFHA 3L2RA 1B6AA 2JRTA 1FIAA 1SEUA 4C3HJ 4YEJA 3R61A 3SYTA 5DDGA 1J59A 1X1PA 4UV9A 4IRGA 3NRVA 2QSHX 2DFHA 5F1JA 4J01A 1ZN2A 2YR2A 1R5HA 3RTRA 3PQJA 2LF8A 5JLWA 2YUSA 2EIKH 1H8AC 2JN6A 2JPBA 5DD8A 3H5NA 3ZN1A 2KJCA 2D45A 2M0CA 1JKOC 1QU3A 4DZJA 1TT0A 5JHFA 1FP2A 2ID6A 2R4GA 2X1EA 4PGGA 1BM9A 5D6FA 2ZMEC 4F92B 2WAQA 1DU0A 5DCMB 2PLYA 4HNTA 4MEXF 4UB6C 4XORA 4A5NA 3U2RA 3A03A 1J0RA 4A69C 3D5RC 5EJCA 1STZA 2FXAA 2V1DA 5E17F 2CJJA 2KJBA 4RGXA 5F0CA 2V7FA 5IY5H 2COMA 5FO5A 3CO7C 3VYSB 3RDIA 3PFYA 4KN4X 3F72A 3TL4X 4KT5C 2IJLA 2W82A 1JHFA 3J7ZI 3F22A 2IAIA 1K79A 1HXDA 4WCGA 1PUFA 1XGMA 4ZTFA 4M3DA 1BN5A 3O6BB 2QKMB 1PUFB 4BHCA 1U8BA 3TW7A 3KEQA 2DPDA 1S7AA 1IV6A 4N0BA 1YHQI 3A02A 2E36A 4I7HA 4W97A 4HF1A 3OR2C 5JVGF 1ZK8A 4DQ2A 1Z91A 5E1XA 3HKZA 5B3SH 1P7JA 4LLGF 2YU3A 3WG7H 3KCCA 3ZP5A 2AS5F 3EPZA 2VC0A 1OMIA 3KPHA 3QYBA 1IRXA 2CQQA 2BYVE 4XQFA 3C2GA 1D1CA 3ASNH 4IZZA 5CPRB 3H9GA 4GXOA 1ZTRA 4A3BJ 4XLHA 1L0OC 3LMMA 4Y52J 2OA4A 1Z3YA 3BP8A 1HLVA 4A3MJ 1OFCX 2YS9A 2CFOA 2E35A 3IV5A 2CSOA 2QVOA 2ME6A 4YELA 2Y69H 5F04A 3FIWA 2CW8A 2LRDA 5KCMA 2L4MA 2ZMEA 3DU6A 1W7PA 2FA5A 3SFIA 3GBGA 1S8NA 4I02A 3WGHA 2ZMEB 5LRSA 3FKIJ 3JRBA 3RIRA 1T08B 4FETA 2YX4A 2X1DA 2XB5A 3OWTA 1SANA 1FT9A 5LGTA 2CUEA 5AONA 3S16J 2OZ6A 1X4OA 3J80K 1JKRC 3CDIA 3ABMH 1B4AA 2XUBA 3F8BA 3LSGA 1G3YA 5GP9A 2DJIA 2X0LA 3KFWX 2HPMA 1VQ4I 3E5XA 1S7EA 3BR6A 3F9KA 4L9JA 1WJCA 4K2EA 5FFXA 3GTGJ 2PMUA 3PFIA 5CVUA 1REPC 1N78A 5J8FA 1PVEA 2CQKA 4U0VA 1FWZA 1ETYA 4OMZA 2BZTA 4A6DA 2CQNA 5EG0A 2LK2A 4Y13A 1CF7B 4NDLA 2ZNYA 5ILSA 4ZC3A 2DA4A 2Z16A 2CMPA 4G8XA 2CUJA 2HOTA 4L0ZB 2EZHA 4H0EA 4ZDOA 3CJRB 2OQRA 2P5LC 1XSDA 2RREA 2V9VA 1LEAA 1YFHA 4QIWN 1BL0A 2XHKA 2CW7A 5K7HA 4ASNA 5HS7A 2IA1A 1P9QC 4I01A 1XMXA 2H6BA 3B02A 5CJ9A 4LJZF 1BI1A 2A07F 3DPTA 2X6WA 4I09A 3TOAA 3GLXA 4WK8F 4KMFA 4I0AA 4CHUA 1K4SA 3WGIA 2ESHA 3PUFA 4CDGA 3ERMA 3DLAA 4Q48A 2BW3B 1X2MA 1XC5A 2QQAA 1BA5A 2LFBA 1OCOH 3C7JA 2BXYA 3OL3A 4II3A 1I1SA 1SAXA 3C2HA 3S17J 2VJJA 4LGWA 2AQFA 3EUHA 3GO5A 3P7NA 5EYRA 4PJJA 5E79C 1IAWA 1J09A 2K9QA 2ZXWH 3BG5A 3BR5A 4QSHA 3OS1A 3DU5A 3GTPJ 1W0UA 3BG7A 1VQLI 4U88A 4BDYA 1XGOA 1DGRM 2ZC2A 3CESA 3FK6A 3F8MA 1LVAA 4EMSA 4D7NA 1ACIA 2DXIA 2E34A 3FK7A 4YIFA 1JE8A 2DMUA 4IHVA 4BQNA 4GRIA 4QPQA 2CG4A 3W6JB 2DMNA 2Z1DA 3MKLA 3CDLA 1VTNC 4KIFA 1WQ2A 2PEXA 1RUNA 2UWMA 2L7ZA 3G1MA 3RSNA 2LY9A 3L1PA 1USTA 1XDUA 1SFXA 1G6NA 1FIPA 4AC0A 2CGPA 3VSLA 4M73A 2NRAC 3ECOA 2JVGA 3S8PA 4CO8A 2Y9YA 3FWEA 4CUGA 4ZTJA 1ZRDA 2XAQA 3ZQHA 4IF4A 2F4IA 4CCJA 3CZ6A 3IWZA 4UUSA 4IRHA 2IGKA 1YQAA 3SXYA
chains in the Genus database with same CATH topology
2Z3YA 4ZZDA 1P4AA 4S05A 2XASA 3HHHA 2UXXA 1IN7A 1ONVA 2XROA 1F4KA 3FXUA 4R79A 3KLOA 5K5OA 2V6CA 3C1DA 1QNTA 5TJJA 4IVNA 3LAJA 3TKYA 4Y17A 5TRDA 3PQKA 4NHJA 2Z5UA 2HGCA 1GXQA 1E2XA 2FBKA 1ZARA 1LB2A 5JVTA 4KYWA 2M8EA 1ZRFA 1S3JA 1QZYA 4UXNA 2LNBA 1K78A 3VFZA 2OAZA 3ABUA 2VC1A 4HAMA 1WRJA 2F5EA 2B0LA 2JTVA 3BZ6A 1BI0A 3R0AA 4L18B 4A2UA 2D1HA 4EQQA 5D8KB 3GFLA 3I64A 3ZMZA 5D6EA 4G7ZF 3TO6A 3GX4X 3ZMDA 1BIBA 3IKTA 3V8KA 1O3RA 4LB6B 3E3VA 4RB0A 3Q9VA 4G6QA 3TQNA 3I59B 5FD5A 1XN7A 4E70A 1U5TA 4B09A 2K7LA 1TW2A 4KIGA 2K27A 4XRFA 4A12A 2LSOA 3ZMTA 4CZZA 3CDHA 4ZYGA 1BBYA 1SFUA 1QGPA 5FLXK 4CGZA 5JI6A 1KYZA 3MZYA 4PZJA 3EETA 5DUKA 5H6QA 1MDMA 4PDKA 3RKXA 2UZKA 2E1NA 1I1GA 2M5WA 3JW4A 3K69A 2VOOA 1RI7A 3N4MA 3REOA 2EFOA 2DBBA 1YQAA 1YS7A 2F2EA 2PFBA 3CUQB 4FX4A 4KDPA 3KETA 1S6LA 2GXGA 1FPQA 3ELKA 3D5LA 3W6KB 3QPTA 1Z6RA 2MH9A 2GQQA 2KRFA 1W4MA 1TQIA 4HQEA 3ERED 2MLGA 4NB5A 4ESFA 2BV6A 3WG9A 4HA8A 1TQMA 2QBYB 5AIQA 3BY6A 1USSA 4Z2YA 2IRFG 3WGGA 2O6GE 2BE5F 3ROUA 2RN7A 3FMSA 1ZGAA 1U78A 2YSRA 2EFNA 5H6RA 3R6SA 2MH2A 5HVQC 1Z7UA 5EEGA 1HKSA 3WTYC 4L5IA 2DAOA 3QU3A 1ON1A 3I0TA 2TDXA 5K5QA 2VN2A 2DU9A 3BROA 1MJBA 2A5YB 4P55A 3I4PA 4U0YA 4MHGA 1R1UA 1ON2A 2NYXA 1UFMA 3JAMZ 4IXAA 5H20A 4LB5A 5FB2A 4BH9A 2STWA 2A6HF 4YIIA 1XGNA 4XLNF 2RV8A 1FYKA 2PMHA 3BPXA 3GFMA 1XSXA 3F23A 2GWRA 4HQMA 2K02A 4KUMA 1FBSA 1LQ1A 4N9IA 1Q1HA 4CICA 2QLZA 4L9NA 1KQ8A 2HWVA 3KE2A 4FT8A 2X4HA 2D2WA 3DXJF 5ICEA 1H9TA 4RB3C 3E6CC 4O6JA 3GYHX 2RQPA 3HSRA 3LA7A 1HKTA 2M87A 2CW0F 3BJOA 3I53A 3P9CA 5LGUA 4HZFA 4G7OF 2DO7A 1Z1DA 4RGUA 3DKWA 2K4JA 5ICGA 1BC8C 4UHTA 3WTTC 3I5UA 1ZRCA 1X3UA 2XVCA 2FBHA 2OBPA 2VODA 2V79A 1IN6A 2D1VA 4MTEA 4L0YB 3GUDA 1F5TA 3HOSA 1O57A 3WTUC 1K6OA 2WC2A 4WWCA 4M9ZA 4IJAA 1FC3A 1YG2A 1UHWA 3KP3A 3T8TA 3EYYA 4P5OA 1GVJA 2MD5A 4JQFA 4RGSA 4D0PA 3C3WA 1R23A 4RGRA 2CWEA 3CUOA 2BGCA 2KIUA 5DCMA 4U7DA 4YG2F 4Q5SF 1T0FA 4CXFA 2W85A 2PI0A 3KZZA 3CTAA 3ML6A 4I0BA 2VE9A 1MKMA 1FZPB 3T0YA 3WU0A 2M45A 3MWMA 1W5SA 2H94A 1LNWA 3EDPA 1FNNA 4BXUA 1P4XA 1XCVA 2FMLA 1B9MA 2MC3A 2K86A 1G4DA 1DP7P 5E1ZB 3I54A 2R7FA 4OIRF 5FD6A 1MD0A 4PCQA 1O3QA 3VODA 1IXCA 2ZNZA 2VONA 2JT1A 3NQOA 1UB9A 5HS8A 2H09A 1IN8A 2F5CA 3GFJA 3FM5A 1I27A 4RB2C 5BQTA 3J80Z 3QPHA 4JK1X 2P6SA 5K1YA 3HSEA 3QOPA 1WKMA 1R1TA 3DF8A 1JHHA 3GVAA 1PP7U 5IT9K 1ZLJA 5D8LB 1CF7A 4I98B 1WWXA 1HW2A 1B1BA 3KP5A 1BOAA 1U2WA 3V4GA 1OPCA 3ISPA 3TO9A 3BPVA 2A3SA 3TDUC 2DLLA 3SZTA 1MZBA 2IA0A 4AIJA 3RKYA 2DQRA 2YPRA 3VOEA 2AXLA 5LRRA 3R60A 2EA2A 4EM0B 1FYMA 5LEKA 4EJWA 2Z33A 2XKPA 1B59A 5DV5A 3WODF 2G9WA 3QU6A 1R7JA 2HYFA 3JSPA 3I58A 2LDUA 3P9KA 5A2QK 1YS6A 2W57A 3DPLC 2V1XA 1TLHB 3E97A 2KIMA 3DP7A 2Z9OA 4WX9A 3T1BA 3ZMVA 2Q2EA 2NS0A 2FU4A 3GZ6A 4HDUA 5F1RA 5IT3A 5HDNA 5BS6A 2IP2A 4U0WA 3FMQA 1ZHFA 3F21A 5ERIA 3M9AA 2A69F 2WV0A 1D5VA 3KP4A 2HTJA 3BDDA 5HS9A 1LJ9A 1JGSA 1XD7A 3H3ZA 3J81K 4FX0A 1FLIA 4P9FA 1IUYA 1SMYF 2ISYA 4KN7X 2WTEA 1YW9A 4A0XA 1D8KA 1GXPA 1YW8A 3COAC 4GYGA 4QWQA 4GYIA 3ZMUA 3HIFA 1FX7A 3V7CA 3OV8A 3MEXA 2G7UA 5J8CA 4IRIA 3EQLF 3KP6A 3WE3A 1F1ZA 1J75A 1GHCA 2W24A 4HW0A 3ULQB 5F6FA 4RB1A 5HLHA 2ZO4A 4AIKA 2ESNA 3ZPLA 5L3FA 4G9YA 1IN4A 2OQGA 1G3SA 2ETHA 2P8TA 3LWFA 5D5XB 4ESBA 4HV6A 4EJTA 2DK5A 5E8GA 4AD9A 1C0WA 3HRTA 2CO5A 5KK1A 2HZTA 1XMAA 5CVVA 2F5FA 2QM3A 3RKWA 3HOTA 3CJNA 2K4BA 2PG4A 4YFNF 2DQLA 5J6XA 1EH6A 2VBYA 3H92A 3N97A 2XAFA 1OYIA 5EEHA 1R22A 3NEUA 3SZPA 1JXSA 3CUQC 3KZYA 4L9TA 1TTYA 2E7WA 5BPIA 3EYIA 3H3UA 3I59A 4BHPA 1Z9CA 5D5VB 2RNJA 2HYGD 3T5XA 1LDKB 5JR3A 3QAHA 1ZG5A 1T6SA 2XKOA 2RKHA 3WTWC 2P7VB 1U6GA 3F8NA 5D5UB 2EFWA 2FSWA 1ZG3A 1HW5A 1Y0UA 4LFUA 5FLXZ 3O3KA 4M6YA 1HSJA 3F8FA 4A0ZA 1V3FA 3U1DA 4EGYA 4OU0A 3M1EA 3BJAA 1J2XA 3E6DA 1ZREA 5HDGA 4ZYDA 3CUQA 1RIOH 3F3XA 3ZN0A 2DPUA 2FRHA 1PUEE 2W84A 3K2ZA 3KEOA 4YFKF 5D4RA 1FBUA 2GIVA 3LA2A 2QBYA 1DPUA 5D5WB 1W5TA 2F5DA 3VB2A 4O5VA 1U8RA 1Z6TA 3F6VA 1P4WA 1QZZA 4KFCA 3K0LA 1WSUA 5L3EA 2O61A 3HSFA 5LEJA 2QQBA 4MQVA 1T38A 1CGPA 2OU2A 2FOKA 3L9FA 1IXSB 1FY7A 1O3SA 2DW4A 2QQ9A 2IW5A 3HRSA 3IL2A 3L2CA 4WXDA 3ZQ7A 2HEOA 1DDNA 3I71A 3FZVA 1R5GA 5L3CA 2RDPA 2HQRA 1KGSA 3BJ6A 2FNPA 4XBFA 4OIQF 1IXRC 1LDDA 4ZH4F 2CYYA 5F64A 3R0JA 2E1CA 3KP7A 1P2FA 2RC4A 4BQAA 3GW2A 2ZJ2A 4ENKA 1D8JA 2FF4A 3U9GA 4R1HA 1B9NA 2OD5A 4F7ZA 4LMYA 3WTSC 3IRRA 4M74A 1S7OA 2Q0OA 1I6XA 2MLKA 1DPRA 1U3EM 4RAZA 5E1WA 1TQPA 4HBLA 5CVJA 3G73A 1NHAA 1IF1A 2DTRA 2HR3A 4HDVA 4GCVA 3E5QA 1EH7A 4PGHA 4I2OA 2KKOA 5ILVA 3J7AO 5DCFA 1FBQA 3CO6C 4S04A 5E18F 2QUFA 1TBXA 2Y48A 2O03A 5E20A 2G7HA 2EV5A 1OKRA 1FSEA 1KU2A 2IVMA 3M8FA 3FM3A 2J5PA 2L4AA 3G3ZA 3DQVC 3JSOA 2UXNA 1BJAA 3DEUA 4UVCA 4EJVA 3B73A 1XDSA 1KQ0A 2ZKZA 2VE8A 2JZYA 1RZ4A 3RPUA 5HDKA 1MJ9A 2IA2A 2JPCA 3IKVA 4MQ9F 3FHZA 2O3FA 2YX7A 3VEPA 1P6RA 4AIHA 2VBZA 1RUOA 3AAFA 3KLNA 1ULYA 2GAUA 3SFZA 2VBWA 2ADUA 1BIAA 3RYPA 3HRMA 1ZYRF 1XMKA 2EA4A 1G3TA 2L3DA 2HKOA 4MGRA 4KA4A 2HTSA 4HX8A 6PAXA 1XSVA 5DYMA 2P4WA 1ODDA 1BI2A 1EH8A 4M9SA 3S2WA 2P7CB 3FMRA 3K1NA 4P96A 4P9UA 4EGZA 2A6EF 1KU9A 2FE3A 2EK5A 2EV6A 4LLLA 1EV7A 3O2PE 2LKPA 4XSZF 2WWYA 3MFKA 4A6EA 1D3YA 2O0YA 1V4RA 4BNCA 2BBYA 5AIPA 1W7PB 3LFKA 2RGVA 5IT9Z 1SD6A 4GO1A 2ACJA 2J5OA 2Z99A 4WF2A 2EFPA 2HDCA 1IZ1A 3GWZA 3LQQA 1E17A 4JBAA 3TO7A 3LQRA 3MCZA 5HLIA 3LAPA 1LEBA 4GGGA 2CFXA 4BAYA 4HLYA 5ED4A 4HF2A 4LD5A 4LK0F 3WU1B 4B8XA 3V8JA 3HHGA 3F8CA 3GXOA 1I5ZA 4RAYA 2MBFA 1WI9A 1YW7A 2VT2A 3E6BA 3HYIA 1IW7F 3RPQA 2GXBA 1J9IA 2DT5A 3OOPA 2PQ8A 4UV8A 1SD5A 1YLFA 4FHTA 5A2QZ 3L09A 1YTYA 4HV5A 1DUXC 1FYLA 3TDZC 2L01A 4Q4ZF 3MZHA 4XSXF 4R8HA 4BYYA 1OYYA 4EV0A 1PDNC 4UUVA 2ELHA 4UVAA 5DEQA 2A68F 1LDJA 3TGNA 3V7RA 3KP2A 5K5RA 4BHBA 4MNUA 2EWNA 3BOQA 2XIGA 1UCRA 3T8RA 3JTGA 5CVRA 2XGXA 1QBJA 2IPQX 1L3LA 1O7LA 2XAHA 5HLGA 1SFEA 1UHMA 2V1UA 3J81Z 2HS5A 4EJOA 3DV8A 5ILUA 3SHFA 2GZWA 2P5KA 4G7HF 3GFIA 2DFIA 4WXHA 2A61A 3BWGA 1FOKA 2XRNA 5ICCA 4KNYA 2FNAA 2QZ8A 5CYVA 1XB4A 4L5JA 2XAJA 1HBXG 1A04A 4G94A 2ISZA 2DK8A 2DI3A 3M8EA 4ZZLA 3QRFF 3IWFA 1O7FA 3WTXC 1BC7C 1TNTA 5LHHA 4YFXF 2XAGA 5DD4A 5LHGA 2STTA 3L00A 2R7DA 4MEYF 1IN5A 2ZBKA 4CYDA 2EV0A 1ZH5A 1MGTA 3CLOA 3MAJA 4EVIA 4IPAA 4HYEA 1U5TC 1H0MA 3RI4A 2HQNA 3IHUA 1XGSA 2VBXA 4M71A 4IHTA 4OMYA 4UVBA 3D0SA 2PJPA 1OR7A 1KU7A 1K78B 1HSTA 1H9GA 4HOBA 4L9VA 2JSCA 2Y75A 2VXZA 1SD4A 1HW1A 4EM1A 1HKQA 3HTUA 3JTHA 3L7WA 5LGNA 4A0YA 2W25A 4ENJA 4UNOA 1KU3A 1S29A 3QP5A 5CVIA 4M9XA 1ZAOA 4WXCA 1YYVA 2ZCWA 1T39A 2VOPA 3GZ5A 4U7BA 4OINF 3FF5A 1QO0D 1BI3A 4EJUA 4HLXA 1IRGA 4OIOF 3ZMSA 2HFHA 3GF2A 4NQWA 1U5TB 2M1BA 4ZYEA 2FQ3A 5FFZA 1SMTA 2NNNA 5KVRA 5L3DA 2HKXA 4OOIA 2PN6A 4LG0A 2FEZA 1R58A 5ICFA 4TV7A 4LG0B 1Z05A 4RS8A 1P92A 1O3TA 1MJAA 4HX4A 5L3GA 5E8IA 1MDMB 4ON0A 5D4SA 3V7SA 4OIPF 1ZGJA 2BEOA 4M6XA 5FGMA 2VT3A 1SD7A 4LLNA 3WTZA 2QYOA 4XLPF 1T2KA 2ZXJA 1AWCA 3DFGA 5L3BA 3RYRA 5CLSA 4KIBA 4ESJA 1FP1D 1YIOA 3MQ0A 2P5VA 1AOYA 3WTVC 2Q8KA 3RJPA 3LA3A 5DUIA 2QENA 2ZFWA 2PBIA 2HOEA 3LSTA 2EB7A 3FXRA 1J5YA 2L54A 4MTDA 2MA3A 3E5UA 3TOBA 5LHIA 2RVCA 4M72A 5JFRA 3K1MA 1OYWA 3C18A 3QP6A 4KMUX 5JHUA 3R4KA 1W7PD 2XV4S 3FX3A 3K1PA 4IHSA 3HRUA 3GEZA 2R3SA 4ENNA 4DNCA 2GA2A 3M7GA 4AWXB 2E7XA 1FSHA 1J7KA 3WE2A 4Y15A 1K7AA 5LLQA 2FMYA 2NNYA 3JAMK 1R36A 4N9HA 4KICA 3F6OA 4QLCU 3FXQA 1PP8F 4EM2A 3HTSB 1KYWA 2FBIA 2EFQA 3K9TA 3Q5FA 1KQ9A 1T98A 3SQNA 5HOOA 3ECHA 2H6CA 2P6TA 5LBQA 2OZUA 2NAZA 2GA1A 1IRFA 4A5MA 1KA8A 1TNSA 4LK1F 4Q47A 4ETSA 3HUGA 2EJRA 1R1VA 5BPDA 1YO5C 2O8XA 2L02A 1R00A 2Y0MA 1F9NA 4ENMA 3ABTA 4O3MA 2KIFA 5BOXA 1HQCA 3Q9SA 2C6YA 3P9IA 1QPMA 4HF0A 2H27A 5BMZA 2M30A 2IT0A 3E6MA 4HX7A 1G3WA 2LF7A 4G6DA 1ZG1A 1TW3A 2QWWA 4ZYHA 1QQIA 1ZLKA 3V8LA 3IC7A 1RNLA 3IRQA 4AVPA 1B6AA 2JRTA 3R61A 5DDGA 1J59A 4UV9A 4IRGA 3NRVA 1ZN2A 2YR2A 1R5HA 3RTRA 3PQJA 2LF8A 2JPBA 5DD8A 3ZN1A 2KJCA 2D45A 1FP2A 4PGGA 1BM9A 5D6FA 5DCMB 2PLYA 4MEXF 4A5NA 3U2RA 1J0RA 5E17F 1STZA 2FXAA 2V1DA 2KJBA 4RGXA 2COMA 5FO5A 3CO7C 3RDIA 4KN4X 3F72A 4KT5C 2IJLA 1JHFA 3F22A 1K79A 1HXDA 4WCGA 1XGMA 1BN5A 3O6BB 2DPDA 4BHCA 3KEQA 1S7AA 4N0BA 4I7HA 4HF1A 4DQ2A 1Z91A 5E1XA 4LLGF 2YU3A 3KCCA 3ZP5A 2AS5F 2VC0A 1OMIA 2BYVE 4GXOA 1L0OC 2OA4A 3BP8A 2CSOA 2QVOA 2L4MA 2ZMEA 1W7PA 2FA5A 1S8NA 4I02A 3WGHA 2ZMEB 5LRSA 3RIRA 2YX4A 1FT9A 5LGTA 5AONA 2OZ6A 3J80K 1B4AA 2XUBA 3F8BA 1G3YA 2X0LA 3KFWX 3E5XA 4L9JA 4K2EA 5FFXA 2PMUA 3PFIA 5CVUA 1REPC 5J8FA 2CQKA 4U0VA 1FWZA 4OMZA 4A6DA 4Y13A 1CF7B 2ZNYA 5ILSA 4G8XA 4L0ZB 4H0EA 2OQRA 2P5LC 1XSDA 2V9VA 1LEAA 1YFHA 2XHKA 4ASNA 5HS7A 2IA1A 4I01A 2H6BA 3B02A 5CJ9A 4LJZF 1BI1A 2A07F 3DPTA 3TOAA 4I09A 3GLXA 4WK8F 4KMFA 4I0AA 4CHUA 3WGIA 2ESHA 4CDGA 4Q48A 2QQAA 3C7JA 1I1SA 1SAXA 4LGWA 3EUHA 3GO5A 3P7NA 1IAWA 4U88A 1XGOA 3F8MA 1LVAA 4EMSA 4YIFA 1JE8A 2CG4A 3W6JB 1VTNC 4KIFA 1WQ2A 2PEXA 1RUNA 2UWMA 1USTA 1XDUA 1SFXA 1G6NA 2CGPA 4M73A 2NRAC 3ECOA 4CO8A 3FWEA 1ZRDA 2XAQA 4IF4A 3IWZA 4IRHA 1XCBA 3SXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z3Y A;  4ZZD A;  1P4A A;  4S05 A;  2XAS A;  3HHH A;  2UXX A;  1IN7 A;  1ONV A;  2XRO A;  1F4K A;  3FXU A;  4R79 A;  3KLO A;  5K5O A;  2V6C A;  3C1D A;  1QNT A;  5TJJ A;  4IVN A;  3LAJ A;  3TKY A;  4Y17 A;  5TRD A;  3PQK A;  4NHJ A;  2Z5U A;  2HGC A;  1GXQ A;  1E2X A;  2FBK A;  1ZAR A;  1LB2 A;  5JVT A;  4KYW A;  2M8E A;  1ZRF A;  1S3J A;  1QZY A;  4UXN A;  2LNB A;  1K78 A;  3VFZ A;  2OAZ A;  3ABU A;  2VC1 A;  4HAM A;  1WRJ A;  2F5E A;  2B0L A;  2JTV A;  3BZ6 A;  1BI0 A;  3R0A A;  4L18 B;  4A2U A;  2D1H A;  4EQQ A;  5D8K B;  3GFL A;  3I64 A;  3ZMZ A;  5D6E A;  4G7Z F;  3TO6 A;  3GX4 X;  3ZMD A;  1BIB A;  3IKT A;  3V8K A;  1O3R A;  4LB6 B;  3E3V A;  4RB0 A;  3Q9V A;  4G6Q A;  3TQN A;  3I59 B;  5FD5 A;  1XN7 A;  4E70 A;  1U5T A;  4B09 A;  2K7L A;  1TW2 A;  4KIG A;  2K27 A;  4XRF A;  4A12 A;  2LSO A;  3ZMT A;  4CZZ A;  3CDH A;  4ZYG A;  1BBY A;  1SFU A;  1QGP A;  5FLX K;  4CGZ A;  5JI6 A;  1KYZ A;  3MZY A;  4PZJ A;  3EET A;  5DUK A;  5H6Q A;  1MDM A;  4PDK A;  3RKX A;  2UZK A;  2E1N A;  1I1G A;  2M5W A;  3JW4 A;  3K69 A;  2VOO A;  1RI7 A;  3N4M A;  3REO A;  2EFO A;  2DBB A;  1YQA A;  1YS7 A;  2F2E A;  2PFB A;  3CUQ B;  4FX4 A;  4KDP A;  3KET A;  1S6L A;  2GXG A;  1FPQ A;  3ELK A;  3D5L A;  3W6K B;  3QPT A;  1Z6R A;  2MH9 A;  2GQQ A;  2KRF A;  1W4M A;  1TQI A;  4HQE A;  3ERE D;  2MLG A;  4NB5 A;  4ESF A;  2BV6 A;  3WG9 A;  4HA8 A;  1TQM A;  2QBY B;  5AIQ A;  3BY6 A;  1USS A;  4Z2Y A;  2IRF G;  3WGG A;  2O6G E;  2BE5 F;  3ROU A;  2RN7 A;  3FMS A;  1ZGA A;  1U78 A;  2YSR A;  2EFN A;  5H6R A;  3R6S A;  2MH2 A;  5HVQ C;  1Z7U A;  5EEG A;  1HKS A;  3WTY C;  4L5I A;  2DAO A;  3QU3 A;  1ON1 A;  3I0T A;  2TDX A;  5K5Q A;  2VN2 A;  2DU9 A;  3BRO A;  1MJB A;  2A5Y B;  4P55 A;  3I4P A;  4U0Y A;  4MHG A;  1R1U A;  1ON2 A;  2NYX A;  1UFM A;  3JAM Z;  4IXA A;  5H20 A;  4LB5 A;  5FB2 A;  4BH9 A;  2STW A;  2A6H F;  4YII A;  1XGN A;  4XLN F;  2RV8 A;  1FYK A;  2PMH A;  3BPX A;  3GFM A;  1XSX A;  3F23 A;  2GWR A;  4HQM A;  2K02 A;  4KUM A;  1FBS A;  1LQ1 A;  4N9I A;  1Q1H A;  4CIC A;  2QLZ A;  4L9N A;  1KQ8 A;  2HWV A;  3KE2 A;  4FT8 A;  2X4H A;  2D2W A;  3DXJ F;  5ICE A;  1H9T A;  4RB3 C;  3E6C C;  4O6J A;  3GYH X;  2RQP A;  3HSR A;  3LA7 A;  1HKT A;  2M87 A;  2CW0 F;  3BJO A;  3I53 A;  3P9C A;  5LGU A;  4HZF A;  4G7O F;  2DO7 A;  1Z1D A;  4RGU A;  3DKW A;  2K4J A;  5ICG A;  1BC8 C;  4UHT A;  3WTT C;  3I5U A;  1ZRC A;  1X3U A;  2XVC A;  2FBH A;  2OBP A;  2VOD A;  2V79 A;  1IN6 A;  2D1V A;  4MTE A;  4L0Y B;  3GUD A;  1F5T A;  3HOS A;  1O57 A;  3WTU C;  1K6O A;  2WC2 A;  4WWC A;  4M9Z A;  4IJA A;  1FC3 A;  1YG2 A;  1UHW A;  3KP3 A;  3T8T A;  3EYY A;  4P5O A;  1GVJ A;  2MD5 A;  4JQF A;  4RGS A;  4D0P A;  3C3W A;  1R23 A;  4RGR A;  2CWE A;  3CUO A;  2BGC A;  2KIU A;  5DCM A;  4U7D A;  4YG2 F;  4Q5S F;  1T0F A;  4CXF A;  2W85 A;  2PI0 A;  3KZZ A;  3CTA A;  3ML6 A;  4I0B A;  2VE9 A;  1MKM A;  1FZP B;  3T0Y A;  3WU0 A;  2M45 A;  3MWM A;  1W5S A;  2H94 A;  1LNW A;  3EDP A;  1FNN A;  4BXU A;  1P4X A;  1XCV A;  2FML A;  1B9M A;  2MC3 A;  2K86 A;  1G4D A;  1DP7 P;  5E1Z B;  3I54 A;  2R7F A;  4OIR F;  5FD6 A;  1MD0 A;  4PCQ A;  1O3Q A;  3VOD A;  1IXC A;  2ZNZ A;  2VON A;  2JT1 A;  3NQO A;  1UB9 A;  5HS8 A;  2H09 A;  1IN8 A;  2F5C A;  3GFJ A;  3FM5 A;  1I27 A;  4RB2 C;  5BQT A;  3J80 Z;  3QPH A;  4JK1 X;  2P6S A;  5K1Y A;  3HSE A;  3QOP A;  1WKM A;  1R1T A;  3DF8 A;  1JHH A;  3GVA A;  1PP7 U;  5IT9 K;  1ZLJ A;  5D8L B;  1CF7 A;  4I98 B;  1WWX A;  1HW2 A;  1B1B A;  3KP5 A;  1BOA A;  1U2W A;  3V4G A;  1OPC A;  3ISP A;  3TO9 A;  3BPV A;  2A3S A;  3TDU C;  2DLL A;  3SZT A;  1MZB A;  2IA0 A;  4AIJ A;  3RKY A;  2DQR A;  2YPR A;  3VOE A;  2AXL A;  5LRR A;  3R60 A;  2EA2 A;  4EM0 B;  1FYM A;  5LEK A;  4EJW A;  2Z33 A;  2XKP A;  1B59 A;  5DV5 A;  3WOD F;  2G9W A;  3QU6 A;  1R7J A;  2HYF A;  3JSP A;  3I58 A;  2LDU A;  3P9K A;  5A2Q K;  1YS6 A;  2W57 A;  3DPL C;  2V1X A;  1TLH B;  3E97 A;  2KIM A;  3DP7 A;  2Z9O A;  4WX9 A;  3T1B A;  3ZMV A;  2Q2E A;  2NS0 A;  2FU4 A;  3GZ6 A;  4HDU A;  5F1R A;  5IT3 A;  5HDN A;  5BS6 A;  2IP2 A;  4U0W A;  3FMQ A;  1ZHF A;  3F21 A;  5ERI A;  3M9A A;  2A69 F;  2WV0 A;  1D5V A;  3KP4 A;  2HTJ A;  3BDD A;  5HS9 A;  1LJ9 A;  1JGS A;  1XD7 A;  3H3Z A;  3J81 K;  4FX0 A;  1FLI A;  4P9F A;  1IUY A;  1SMY F;  2ISY A;  4KN7 X;  2WTE A;  1YW9 A;  4A0X A;  1D8K A;  1GXP A;  1YW8 A;  3COA C;  4GYG A;  4QWQ A;  4GYI A;  3ZMU A;  3HIF A;  1FX7 A;  3V7C A;  3OV8 A;  3MEX A;  2G7U A;  5J8C A;  4IRI A;  3EQL F;  3KP6 A;  3WE3 A;  1F1Z A;  1J75 A;  1GHC A;  2W24 A;  4HW0 A;  3ULQ B;  5F6F A;  4RB1 A;  5HLH A;  2ZO4 A;  4AIK A;  2ESN A;  3ZPL A;  5L3F A;  4G9Y A;  1IN4 A;  2OQG A;  1G3S A;  2ETH A;  2P8T A;  3LWF A;  5D5X B;  4ESB A;  4HV6 A;  4EJT A;  2DK5 A;  5E8G A;  4AD9 A;  1C0W A;  3HRT A;  2CO5 A;  5KK1 A;  2HZT A;  1XMA A;  5CVV A;  2F5F A;  2QM3 A;  3RKW A;  3HOT A;  3CJN A;  2K4B A;  2PG4 A;  4YFN F;  2DQL A;  5J6X A;  1EH6 A;  2VBY A;  3H92 A;  3N97 A;  2XAF A;  1OYI A;  5EEH A;  1R22 A;  3NEU A;  3SZP A;  1JXS A;  3CUQ C;  3KZY A;  4L9T A;  1TTY A;  2E7W A;  5BPI A;  3EYI A;  3H3U A;  3I59 A;  4BHP A;  1Z9C A;  5D5V B;  2RNJ A;  2HYG D;  3T5X A;  1LDK B;  5JR3 A;  3QAH A;  1ZG5 A;  1T6S A;  2XKO A;  2RKH A;  3WTW C;  2P7V B;  1U6G A;  3F8N A;  5D5U B;  2EFW A;  2FSW A;  1ZG3 A;  1HW5 A;  1Y0U A;  4LFU A;  5FLX Z;  3O3K A;  4M6Y A;  1HSJ A;  3F8F A;  4A0Z A;  1V3F A;  3U1D A;  4EGY A;  4OU0 A;  3M1E A;  3BJA A;  1J2X A;  3E6D A;  1ZRE A;  5HDG A;  4ZYD A;  3CUQ A;  1RIO H;  3F3X A;  3ZN0 A;  2DPU A;  2FRH A;  1PUE E;  2W84 A;  3K2Z A;  3KEO A;  4YFK F;  5D4R A;  1FBU A;  2GIV A;  3LA2 A;  2QBY A;  1DPU A;  5D5W B;  1W5T A;  2F5D A;  3VB2 A;  4O5V A;  1U8R A;  1Z6T A;  3F6V A;  1P4W A;  1QZZ A;  4KFC A;  3K0L A;  1WSU A;  5L3E A;  2O61 A;  3HSF A;  5LEJ A;  2QQB A;  4MQV A;  1T38 A;  1CGP A;  2OU2 A;  2FOK A;  3L9F A;  1IXS B;  1FY7 A;  1O3S A;  2DW4 A;  2QQ9 A;  2IW5 A;  3HRS A;  3IL2 A;  3L2C A;  4WXD A;  3ZQ7 A;  2HEO A;  1DDN A;  3I71 A;  3FZV A;  1R5G A;  5L3C A;  2RDP A;  2HQR A;  1KGS A;  3BJ6 A;  2FNP A;  4XBF A;  4OIQ F;  1IXR C;  1LDD A;  4ZH4 F;  2CYY A;  5F64 A;  3R0J A;  2E1C A;  3KP7 A;  1P2F A;  2RC4 A;  4BQA A;  3GW2 A;  2ZJ2 A;  4ENK A;  1D8J A;  2FF4 A;  3U9G A;  4R1H A;  1B9N A;  2OD5 A;  4F7Z A;  4LMY A;  3WTS C;  3IRR A;  4M74 A;  1S7O A;  2Q0O A;  1I6X A;  2MLK A;  1DPR A;  1U3E M;  4RAZ A;  5E1W A;  1TQP A;  4HBL A;  5CVJ A;  3G73 A;  1NHA A;  1IF1 A;  2DTR A;  2HR3 A;  4HDV A;  4GCV A;  3E5Q A;  1EH7 A;  4PGH A;  4I2O A;  2KKO A;  5ILV A;  3J7A O;  5DCF A;  1FBQ A;  3CO6 C;  4S04 A;  5E18 F;  2QUF A;  1TBX A;  2Y48 A;  2O03 A;  5E20 A;  2G7H A;  2EV5 A;  1OKR A;  1FSE A;  1KU2 A;  2IVM A;  3M8F A;  3FM3 A;  2J5P A;  2L4A A;  3G3Z A;  3DQV C;  3JSO A;  2UXN A;  1BJA A;  3DEU A;  4UVC A;  4EJV A;  3B73 A;  1XDS A;  1KQ0 A;  2ZKZ A;  2VE8 A;  2JZY A;  1RZ4 A;  3RPU A;  5HDK A;  1MJ9 A;  2IA2 A;  2JPC A;  3IKV A;  4MQ9 F;  3FHZ A;  2O3F A;  2YX7 A;  3VEP A;  1P6R A;  4AIH A;  2VBZ A;  1RUO A;  3AAF A;  3KLN A;  1ULY A;  2GAU A;  3SFZ A;  2VBW A;  2ADU A;  1BIA A;  3RYP A;  3HRM A;  1ZYR F;  1XMK A;  2EA4 A;  1G3T A;  2L3D A;  2HKO A;  4MGR A;  4KA4 A;  2HTS A;  4HX8 A;  6PAX A;  1XSV A;  5DYM A;  2P4W A;  1ODD A;  1BI2 A;  1EH8 A;  4M9S A;  3S2W A;  2P7C B;  3FMR A;  3K1N A;  4P96 A;  4P9U A;  4EGZ A;  2A6E F;  1KU9 A;  2FE3 A;  2EK5 A;  2EV6 A;  4LLL A;  1EV7 A;  3O2P E;  2LKP A;  4XSZ F;  2WWY A;  3MFK A;  4A6E A;  1D3Y A;  2O0Y A;  1V4R A;  4BNC A;  2BBY A;  5AIP A;  1W7P B;  3LFK A;  2RGV A;  5IT9 Z;  1SD6 A;  4GO1 A;  2ACJ A;  2J5O A;  2Z99 A;  4WF2 A;  2EFP A;  2HDC A;  1IZ1 A;  3GWZ A;  3LQQ A;  1E17 A;  4JBA A;  3TO7 A;  3LQR A;  3MCZ A;  5HLI A;  3LAP A;  1LEB A;  4GGG A;  2CFX A;  4BAY A;  4HLY A;  5ED4 A;  4HF2 A;  4LD5 A;  4LK0 F;  3WU1 B;  4B8X A;  3V8J A;  3HHG A;  3F8C A;  3GXO A;  1I5Z A;  4RAY A;  2MBF A;  1WI9 A;  1YW7 A;  2VT2 A;  3E6B A;  3HYI A;  1IW7 F;  3RPQ A;  2GXB A;  1J9I A;  2DT5 A;  3OOP A;  2PQ8 A;  4UV8 A;  1SD5 A;  1YLF A;  4FHT A;  5A2Q Z;  3L09 A;  1YTY A;  4HV5 A;  1DUX C;  1FYL A;  3TDZ C;  2L01 A;  4Q4Z F;  3MZH A;  4XSX F;  4R8H A;  4BYY A;  1OYY A;  4EV0 A;  1PDN C;  4UUV A;  2ELH A;  4UVA A;  5DEQ A;  2A68 F;  1LDJ A;  3TGN A;  3V7R A;  3KP2 A;  5K5R A;  4BHB A;  4MNU A;  2EWN A;  3BOQ A;  2XIG A;  1UCR A;  3T8R A;  3JTG A;  5CVR A;  2XGX A;  1QBJ A;  2IPQ X;  1L3L A;  1O7L A;  2XAH A;  5HLG A;  1SFE A;  1UHM A;  2V1U A;  3J81 Z;  2HS5 A;  4EJO A;  3DV8 A;  5ILU A;  3SHF A;  2GZW A;  2P5K A;  4G7H F;  3GFI A;  2DFI A;  4WXH A;  2A61 A;  3BWG A;  1FOK A;  2XRN A;  5ICC A;  4KNY A;  2FNA A;  2QZ8 A;  5CYV A;  1XB4 A;  4L5J A;  2XAJ A;  1HBX G;  1A04 A;  4G94 A;  2ISZ A;  2DK8 A;  2DI3 A;  3M8E A;  4ZZL A;  3QRF F;  3IWF A;  1O7F A;  3WTX C;  1BC7 C;  1TNT A;  5LHH A;  4YFX F;  2XAG A;  5DD4 A;  5LHG A;  2STT A;  3L00 A;  2R7D A;  4MEY F;  1IN5 A;  2ZBK A;  4CYD A;  2EV0 A;  1ZH5 A;  1MGT A;  3CLO A;  3MAJ A;  4EVI A;  4IPA A;  4HYE A;  1U5T C;  1H0M A;  3RI4 A;  2HQN A;  3IHU A;  1XGS A;  2VBX A;  4M71 A;  4IHT A;  4OMY A;  4UVB A;  3D0S A;  2PJP A;  1OR7 A;  1KU7 A;  1K78 B;  1HST A;  1H9G A;  4HOB A;  4L9V A;  2JSC A;  2Y75 A;  2VXZ A;  1SD4 A;  1HW1 A;  4EM1 A;  1HKQ A;  3HTU A;  3JTH A;  3L7W A;  5LGN A;  4A0Y A;  2W25 A;  4ENJ A;  4UNO A;  1KU3 A;  1S29 A;  3QP5 A;  5CVI A;  4M9X A;  1ZAO A;  4WXC A;  1YYV A;  2ZCW A;  1T39 A;  2VOP A;  3GZ5 A;  4U7B A;  4OIN F;  3FF5 A;  1QO0 D;  1BI3 A;  4EJU A;  4HLX A;  1IRG A;  4OIO F;  3ZMS A;  2HFH A;  3GF2 A;  4NQW A;  1U5T B;  2M1B A;  4ZYE A;  2FQ3 A;  5FFZ A;  1SMT A;  2NNN A;  5KVR A;  5L3D A;  2HKX A;  4OOI A;  2PN6 A;  4LG0 A;  2FEZ A;  1R58 A;  5ICF A;  4TV7 A;  4LG0 B;  1Z05 A;  4RS8 A;  1P92 A;  1O3T A;  1MJA A;  4HX4 A;  5L3G A;  5E8I A;  1MDM B;  4ON0 A;  5D4S A;  3V7S A;  4OIP F;  1ZGJ A;  2BEO A;  4M6X A;  5FGM A;  2VT3 A;  1SD7 A;  4LLN A;  3WTZ A;  2QYO A;  4XLP F;  1T2K A;  2ZXJ A;  1AWC A;  3DFG A;  5L3B A;  3RYR A;  5CLS A;  4KIB A;  4ESJ A;  1FP1 D;  1YIO A;  3MQ0 A;  2P5V A;  1AOY A;  3WTV C;  2Q8K A;  3RJP A;  3LA3 A;  5DUI A;  2QEN A;  2ZFW A;  2PBI A;  2HOE A;  3LST A;  2EB7 A;  3FXR A;  1J5Y A;  2L54 A;  4MTD A;  2MA3 A;  3E5U A;  3TOB A;  5LHI A;  2RVC A;  4M72 A;  5JFR A;  3K1M A;  1OYW A;  3C18 A;  3QP6 A;  4KMU X;  5JHU A;  3R4K A;  1W7P D;  2XV4 S;  3FX3 A;  3K1P A;  4IHS A;  3HRU A;  3GEZ A;  2R3S A;  4ENN A;  4DNC A;  2GA2 A;  3M7G A;  4AWX B;  2E7X A;  1FSH A;  1J7K A;  3WE2 A;  4Y15 A;  1K7A A;  5LLQ A;  2FMY A;  2NNY A;  3JAM K;  1R36 A;  4N9H A;  4KIC A;  3F6O A;  4QLC U;  3FXQ A;  1PP8 F;  4EM2 A;  3HTS B;  1KYW A;  2FBI A;  2EFQ A;  3K9T A;  3Q5F A;  1KQ9 A;  1T98 A;  3SQN A;  5HOO A;  3ECH A;  2H6C A;  2P6T A;  5LBQ A;  2OZU A;  2NAZ A;  2GA1 A;  1IRF A;  4A5M A;  1KA8 A;  1TNS A;  4LK1 F;  4Q47 A;  4ETS A;  3HUG A;  2EJR A;  1R1V A;  5BPD A;  1YO5 C;  2O8X A;  2L02 A;  1R00 A;  2Y0M A;  1F9N A;  4ENM A;  3ABT A;  4O3M A;  2KIF A;  5BOX A;  1HQC A;  3Q9S A;  2C6Y A;  3P9I A;  1QPM A;  4HF0 A;  2H27 A;  5BMZ A;  2M30 A;  2IT0 A;  3E6M A;  4HX7 A;  1G3W A;  2LF7 A;  4G6D A;  1ZG1 A;  1TW3 A;  2QWW A;  4ZYH A;  1QQI A;  1ZLK A;  3V8L A;  3IC7 A;  1RNL A;  3IRQ A;  4AVP A;  1B6A A;  2JRT A;  3R61 A;  5DDG A;  1J59 A;  4UV9 A;  4IRG A;  3NRV A;  1ZN2 A;  2YR2 A;  1R5H A;  3RTR A;  3PQJ A;  2LF8 A;  2JPB A;  5DD8 A;  3ZN1 A;  2KJC A;  2D45 A;  1FP2 A;  4PGG A;  1BM9 A;  5D6F A;  5DCM B;  2PLY A;  4MEX F;  4A5N A;  3U2R A;  1J0R A;  5E17 F;  1STZ A;  2FXA A;  2V1D A;  2KJB A;  4RGX A;  2COM A;  5FO5 A;  3CO7 C;  3RDI A;  4KN4 X;  3F72 A;  4KT5 C;  2IJL A;  1JHF A;  3F22 A;  1K79 A;  1HXD A;  4WCG A;  1XGM A;  1BN5 A;  3O6B B;  2DPD A;  4BHC A;  3KEQ A;  1S7A A;  4N0B A;  4I7H A;  4HF1 A;  4DQ2 A;  1Z91 A;  5E1X A;  4LLG F;  2YU3 A;  3KCC A;  3ZP5 A;  2AS5 F;  2VC0 A;  1OMI A;  2BYV E;  4GXO A;  1L0O C;  2OA4 A;  3BP8 A;  2CSO A;  2QVO A;  2L4M A;  2ZME A;  1W7P A;  2FA5 A;  1S8N A;  4I02 A;  3WGH A;  2ZME B;  5LRS A;  3RIR A;  2YX4 A;  1FT9 A;  5LGT A;  5AON A;  2OZ6 A;  3J80 K;  1B4A A;  2XUB A;  3F8B A;  1G3Y A;  2X0L A;  3KFW X;  3E5X A;  4L9J A;  4K2E A;  5FFX A;  2PMU A;  3PFI A;  5CVU A;  1REP C;  5J8F A;  2CQK A;  4U0V A;  1FWZ A;  4OMZ A;  4A6D A;  4Y13 A;  1CF7 B;  2ZNY A;  5ILS A;  4G8X A;  4L0Z B;  4H0E A;  2OQR A;  2P5L C;  1XSD A;  2V9V A;  1LEA A;  1YFH A;  2XHK A;  4ASN A;  5HS7 A;  2IA1 A;  4I01 A;  2H6B A;  3B02 A;  5CJ9 A;  4LJZ F;  1BI1 A;  2A07 F;  3DPT A;  3TOA A;  4I09 A;  3GLX A;  4WK8 F;  4KMF A;  4I0A A;  4CHU A;  3WGI A;  2ESH A;  4CDG A;  4Q48 A;  2QQA A;  3C7J A;  1I1S A;  1SAX A;  4LGW A;  3EUH A;  3GO5 A;  3P7N A;  1IAW A;  4U88 A;  1XGO A;  3F8M A;  1LVA A;  4EMS A;  4YIF A;  1JE8 A;  2CG4 A;  3W6J B;  1VTN C;  4KIF A;  1WQ2 A;  2PEX A;  1RUN A;  2UWM A;  1UST A;  1XDU A;  1SFX A;  1G6N A;  2CGP A;  4M73 A;  2NRA C;  3ECO A;  4CO8 A;  3FWE A;  1ZRD A;  2XAQ A;  4IF4 A;  3IWZ A;  4IRH A;  1XCB A;  3SXY A; 
#chains in the Genus database with same CATH topology
 1MMD A;  2UUZ A;  2Z3Y A;  1NG7 A;  4ZZD A;  4JX6 A;  2O8K A;  1P4A A;  3BQZ A;  4G6T B;  4AYB N;  4S05 A;  3DTE A;  2XAS A;  3HHH A;  4XLE A;  2UXX A;  1IN7 A;  1ONV A;  3DEE A;  1LFU P;  2FOW A;  2XRO A;  1F4K A;  3FXU A;  4R79 A;  3KYD B;  3KLO A;  5K5O A;  2V6C A;  4DGW B;  4ZDL A;  3C1D A;  1QNT A;  5TJJ A;  2HPI A;  4IVN A;  3LAJ A;  3TKY A;  4Y17 A;  5TRD A;  2BHZ A;  3PQK A;  2E1M C;  4NHJ A;  3PUB A;  2EIL H;  2KRH A;  2Z5U A;  2MW8 A;  5FJ8 J;  2LVS A;  2EH3 A;  3L2V A;  2HGC A;  1GXQ A;  3M4O J;  1E2X A;  1VQ8 I;  4FQG A;  2FBK A;  2VJ4 A;  2K5C A;  1ZAR A;  1LB2 A;  5IP6 A;  1RR8 C;  5JVT A;  4KYW A;  2M8E A;  3OYJ A;  3LOC A;  1G2H A;  1MNM C;  1ZRF A;  1S3J A;  4ANJ A;  1G8X A;  2HXO A;  2VQG A;  1QZY A;  4UXN A;  2LNB A;  1K78 A;  2XF5 A;  3VFZ A;  2OAZ A;  1DGW Y;  1MBF A;  2WBM A;  1IG7 A;  1JI8 A;  3G1O A;  3ABU A;  2VL8 A;  2VC1 A;  4HAM A;  1WRJ A;  2F5E A;  2KZG A;  2B0L A;  2JTV A;  3BZ6 A;  4U87 A;  2XF6 A;  3CCR I;  1QPI A;  3SZG A;  2W48 A;  4B43 A;  4FTH A;  1ETK A;  1V55 H;  1BI0 A;  3R0A A;  4L18 B;  3ONQ A;  1YJW I;  4A2U A;  4BKX A;  1LE8 A;  2D1H A;  4EQQ A;  2KIQ A;  5D8K B;  3GFL A;  3I64 A;  3UKG A;  2D5V A;  1R4N B;  5GTI C;  3ZMZ A;  2XC7 A;  1OCZ H;  5D6E A;  5M5Y J;  1HDD C;  4G7Z F;  2F4M B;  4QPO A;  3TO6 A;  3ZMD A;  3GX4 X;  1BIB A;  4FCY A;  3A2K A;  2QF7 A;  4XRM A;  2E1M B;  3IKT A;  3V8K A;  1O3R A;  2W4S A;  4LB6 B;  2COB A;  4DYQ A;  2YU9 J;  3E3V A;  1MMS A;  3ESW B;  1MND A;  1BOB A;  3ABK H;  3Q9V A;  4G6Q A;  4RB0 A;  4DW6 A;  1R71 A;  3TQN A;  3I4N J;  3I59 B;  5FD5 A;  1XN7 A;  1PYV A;  4E70 A;  3QQA A;  1U5T A;  4B09 A;  2K7L A;  2Y0S A;  1TW2 A;  3AG1 H;  2K27 A;  4KIG A;  4M6V A;  4XRF A;  4A12 A;  2XSJ C;  3E1S A;  1SVM A;  2L9R A;  4BAC A;  4XRS G;  2JK3 A;  2LSO A;  3ZMT A;  4CZZ A;  3CDH A;  4ZYG A;  4J00 A;  2I10 A;  4XN0 A;  2FJ1 A;  1BBY A;  1SFU A;  1QGP A;  3UR3 C;  5FLX K;  4CGZ A;  5JI6 A;  1KYZ A;  1PJR A;  3MZY A;  4PZJ A;  3EET A;  1RES A;  3FXO A;  2Q1Z B;  2HZD A;  5DUK A;  5H6Q A;  5KAI C;  1MDM A;  1FTT A;  5EF6 A;  4PDK A;  3RKX A;  2L5Q A;  3PIP F;  3BG6 A;  2UZK A;  2E1N A;  2LR8 A;  1WH5 A;  3LSM A;  1I1G A;  2H1L A;  2M5W A;  1IC8 A;  1JT6 A;  3JW4 A;  2WAQ N;  3K69 A;  2VOO A;  2OV7 A;  1RI7 A;  2R7U A;  1OJL A;  2F48 A;  3N4M A;  4BE2 A;  3REO A;  2EFO A;  2DBB A;  4KIS A;  1O4X A;  1WI3 A;  1YS7 A;  2F2E A;  2PFB A;  3CUQ B;  4FX4 A;  4KDP A;  3LL7 A;  3KET A;  1S6L A;  3DTK A;  3VDX A;  2GXG A;  1JTX A;  4A3E J;  1FPQ A;  3ELK A;  5BNG A;  1YOV B;  3D5L A;  3W6K B;  3QPT A;  1Z6R A;  2MH9 A;  4JX4 A;  1TC3 C;  2GQQ A;  3K4K A;  3ZGK A;  2KRF A;  1W4M A;  1T95 A;  1TQI A;  3QWL A;  4HQE A;  3ERE D;  5DM7 F;  4BY1 J;  3EUA A;  2MLG A;  3S15 J;  1Y0N A;  4NB5 A;  4ESF A;  2BV6 A;  2F6C A;  3A1Y A;  5KAF C;  3WG9 A;  3CCS I;  4HA8 A;  1TQM A;  2K9S A;  2X6X A;  2QBY B;  5AIQ A;  3BY6 A;  4E6K G;  3HKZ N;  1A36 A;  1USS A;  4Z2Y A;  5J4Y A;  3CCU I;  1TZL A;  3WGG A;  2IRF G;  2O6G E;  3QOE A;  3LFU A;  1YJ9 I;  2GM4 A;  2BE5 F;  3ROU A;  1MBE A;  2RN7 A;  3FMS A;  1ZGA A;  1U78 A;  2YSR A;  5FRO A;  1EJ9 A;  3SEQ A;  3WHB A;  2EFN A;  5H6R A;  1MBH A;  4XM3 A;  1X1A A;  3DWL E;  3G4S I;  2PMZ A;  2BVL A;  2DFE A;  2KMU A;  2KZV A;  2XB0 X;  3R6S A;  2R5Y A;  1LKX A;  2MH2 A;  2R5Y B;  1B8I A;  5HVQ C;  3CLQ A;  2R7V A;  1Z7U A;  3B6C A;  1HKS A;  5EEG A;  3WTY C;  3AKZ A;  2FD5 A;  1B8I B;  4L5I A;  2DAO A;  3QU3 A;  1RC9 A;  1ON1 A;  2ZJQ F;  1APL C;  4ZDP A;  3I0T A;  2OCC H;  4X1E A;  2TDX A;  5K5Q A;  4BE0 A;  4RM3 A;  2VN2 A;  2DU9 A;  3BRO A;  3OYM A;  1MJB A;  2A5Y B;  2E5Z A;  3A0H C;  4P55 A;  4CSW A;  1AU7 A;  3I4P A;  4XID A;  4MHG A;  1V5F A;  4PK4 A;  4U0Y A;  1R1U A;  1ON2 A;  5GPA A;  4BXX J;  2VPL A;  2NYX A;  3CD6 I;  1MIJ A;  1UFM A;  3JAM Z;  1JJ8 C;  2VAS A;  4IXA A;  5H20 A;  4ZYA A;  4LB5 A;  2Y30 A;  5FB2 A;  3K2A A;  3HC7 A;  4BH9 A;  1I6H J;  2STW A;  3KIO A;  2A6H F;  3OIQ A;  4YII A;  1K4T A;  2TCT A;  1XGN A;  4XLN F;  2RV8 A;  1FYK A;  4I99 C;  2PMH A;  3JRD A;  2KHM A;  3BPX A;  3GFM A;  1XSX A;  3K4M A;  3F23 A;  4Y7N J;  2GWR A;  4HQM A;  4E7H A;  2JA8 J;  2K02 A;  2FUG 2;  3HJE A;  2HYJ A;  4KUM A;  3OYF A;  1FBS A;  4EAT A;  1LQ1 A;  4N9I A;  1Q1H A;  4CIC A;  2QLZ A;  5GAH J;  5LD2 C;  2RQQ A;  3GTL J;  1JT0 A;  4L9N A;  1KQ8 A;  2HWV A;  3KE2 A;  4BE1 A;  2VUM J;  2ICW G;  1MSE C;  4FT8 A;  2X4H A;  1G59 A;  3VYU B;  2D2W A;  3DXJ F;  5ICE A;  3S2H J;  1TT5 B;  1H9T A;  3LSH A;  4RB3 C;  3E6C C;  4O6J A;  1VI0 A;  3GYH X;  2RQP A;  3HPG A;  3HSR A;  3LA7 A;  4HG2 A;  1HKT A;  2M87 A;  2CW0 F;  2Y31 A;  1RPW A;  3K10 A;  3BJO A;  2B7E A;  3I53 A;  5J1R A;  3P9C A;  3IH3 A;  5LGU A;  3TBI A;  3J7Y J;  4IHY A;  2IS1 A;  4HZF A;  3DBL B;  3L2W A;  3S2D J;  4G7O F;  2DO7 A;  1Z1D A;  4RGU A;  3DKW A;  3CF2 A;  1Z67 A;  4V2F A;  2K4J A;  5ICG A;  2LKX A;  1BC8 C;  4UHT A;  3WTT C;  3I5U A;  3H9Q A;  1ZRC A;  1X3U A;  2XVC A;  2FBH A;  2OBP A;  4FE7 A;  1VZ0 A;  4JX5 A;  1MMA A;  4CYC A;  1X1B A;  2VOD A;  2V79 A;  3IH2 A;  4HSR A;  3UNG C;  1IN6 A;  2D1V A;  4MTE A;  4MO7 A;  1IUF A;  2DA3 A;  1XS9 A;  4L0Y B;  3GUD A;  1TWF J;  1YE9 A;  3ZCO A;  4BGD A;  3BR2 A;  1F5T A;  3HOS A;  3LSI A;  3CJQ B;  3MKW B;  2CU7 A;  3H5R A;  1O57 A;  3WTU C;  1K6O A;  1W36 C;  2WC2 A;  4WWC A;  1WJF A;  3DCF A;  5H2F C;  2JQ7 A;  4XKW A;  1POG A;  1BR4 A;  4UUT A;  2JMW A;  4E7K A;  4M9Z A;  4IJA A;  1R5I D;  1TWA J;  3GTK J;  1FC3 A;  1OQY A;  3BR3 A;  4A93 J;  1YG2 A;  1WJA A;  4F3Q A;  5DM6 F;  4A3L J;  1UHW A;  3KP3 A;  5EZG A;  2A5W A;  3T8T A;  3EYY A;  4IOC F;  3FHN A;  4P5O A;  1MMN A;  3FIS A;  1GVJ A;  2MD5 A;  4JQF A;  4RGS A;  4D0P A;  2R92 J;  1OCC H;  4BJ5 C;  3C3W A;  1RRJ A;  1R23 A;  3PL8 A;  4RGR A;  2CWE A;  3CUO A;  2BGC A;  2ECB A;  2KIU A;  5DCM A;  4YG2 F;  4U7D A;  1VQN I;  4Q5S F;  2DT7 B;  3K4J A;  1T0F A;  4ITV A;  2R0Q C;  5F0H A;  4CXF A;  2W85 A;  5J40 A;  3U1K A;  1WHU A;  1S5L C;  2PI0 A;  3KZZ A;  2KPM A;  3CTA A;  3ML6 A;  4I0B A;  2VE9 A;  1VQK I;  1MKM A;  5HOD A;  1Z7L A;  1W1W E;  2LG4 A;  3T0Y A;  3WU0 A;  1FZP B;  1RKW A;  1SVO A;  1FOY A;  3JRG A;  2M45 A;  2NS8 A;  2EBI A;  3K4B A;  1R6R A;  3HOZ J;  3RQI A;  3MWM A;  3BT9 A;  1W5S A;  2H94 A;  3FDY A;  2E1O A;  1LNW A;  3EDP A;  1FNN A;  5J1Y A;  2MG4 A;  3I56 I;  3KX2 A;  4BXU A;  1V5E A;  1P4X A;  4IQJ A;  1XCV A;  2FML A;  1HA8 A;  2ELJ A;  2KQR A;  2R7O A;  1B9M A;  2MC3 A;  1Z21 A;  4B4C A;  2K86 A;  1V5G A;  4DYR A;  3IAS 2;  1F43 A;  1G4D A;  5EEA A;  1EKE A;  4XLA A;  1DP7 P;  1VQP I;  5E1Z B;  2EZL A;  3HZJ A;  3I54 A;  2LY1 A;  1QRY A;  2R7F A;  4OIR F;  5FD6 A;  1MD0 A;  2Z2S B;  4PCQ A;  2V26 A;  2P81 A;  3VOD A;  5DTD A;  4D1Q A;  1O3Q A;  3PNY A;  4AM3 A;  1VQM I;  4HNV A;  3M3Y J;  2KL4 A;  1K61 A;  1IXC A;  2ZNZ A;  3K70 C;  2VON A;  3S3M A;  2VXD A;  1JUM A;  2JT1 A;  1UB9 A;  3NQO A;  2JUC A;  5HS8 A;  2H09 A;  2LD5 A;  1IN8 A;  2F5C A;  3GFJ A;  2IXS A;  3FM5 A;  1I27 A;  4RB2 C;  5BQT A;  1KON A;  3J80 Z;  4DIQ A;  3QPH A;  2QSF X;  4JK1 X;  2P6S A;  2WAD A;  5K1Y A;  3HSE A;  3QOP A;  5HNH A;  4QTR A;  1I50 J;  2MAB A;  4IHX A;  1WKM A;  1R1T A;  3DF8 A;  1JHH A;  3GVA A;  3GTJ J;  2V1N A;  1F36 A;  1BJZ A;  1PP7 U;  5IT9 K;  1ZLJ A;  3IP4 B;  5D8L B;  3CCV I;  1Y6I A;  1X3W B;  1CF7 A;  1VQ6 I;  4JYK A;  1T8I A;  4I98 B;  1WWX A;  2DMP A;  1HW2 A;  1B1B A;  1ZQ3 P;  5M5W J;  4PJ0 C;  3W2V A;  3KP5 A;  1IGN A;  2Y0S N;  1RET A;  3FBI B;  1BOA A;  2L9V A;  1U2W A;  3V4G A;  2ZJP F;  1OPC A;  3ISP A;  3TO9 A;  3BPV A;  4C2T A;  2A3S A;  3TDU C;  2DLL A;  3SZT A;  3JRF A;  1MZB A;  2IA0 A;  4AIJ A;  3RKY A;  1D1A A;  2EZI A;  2DQR A;  2YPR A;  3JRH A;  2OTJ I;  3VOE A;  2AXL A;  2MD0 A;  2PX9 A;  5C3E J;  5LRR A;  3HG9 A;  3R60 A;  1X1C A;  2EA2 A;  2IGO A;  2JJ7 A;  9ANT A;  3TW6 A;  4EM0 B;  1FYM A;  3OIP A;  2M3A A;  2CQ7 A;  5LEK A;  4EJW A;  2Z33 A;  3W2W A;  2XKP A;  1B59 A;  5DV5 A;  2GBY A;  2OF7 A;  2BW3 A;  3WOD F;  2G9W A;  2XDV A;  3QU6 A;  2OC6 A;  2XAU A;  3I9V 2;  4BDZ A;  3FXM A;  1WJE A;  1FTZ A;  1R7J A;  1WH7 A;  2CV0 A;  3VWB A;  2HYF A;  5J4V A;  3JSP A;  3I4M J;  1FOX A;  2B63 J;  3I58 A;  2LDU A;  3P9K A;  3H36 A;  3G2B A;  5A2Q K;  5FLM J;  1YS6 A;  2W57 A;  3DPL C;  3BZK A;  4E7L A;  2V1X A;  3JR9 A;  2CV1 A;  1VND A;  4CCL A;  3CCQ I;  1TLH B;  1Z77 A;  3E97 A;  2KIM A;  2QCO A;  3DP7 A;  2Z9O A;  1YRN B;  4WX9 A;  1Y1W J;  1T56 A;  3T1B A;  2V6E A;  2ECC A;  1H88 C;  3CC7 I;  3DBR B;  1LFP A;  3E7L A;  2Q2E A;  3K7A J;  3ZMV A;  1IRZ A;  1H89 C;  2NS0 A;  2FU4 A;  3GZ6 A;  3W3C A;  1YIJ I;  2Q2E B;  2LH9 A;  4HDU A;  2M7B A;  5F1R A;  5IT3 A;  2HOA A;  5BS6 A;  2IP2 A;  5HDN A;  3TED A;  4U0W A;  5IOY A;  3FMQ A;  5K7F A;  1ZHF A;  4EEF G;  3F21 A;  3OY9 A;  4CA0 A;  3TP3 A;  5ERI A;  3M9A A;  2A69 F;  2WV0 A;  1D5V A;  2VKV A;  3KP4 A;  2E71 A;  2HTJ A;  3BDD A;  5HS9 A;  1LJ9 A;  1JGS A;  1XD7 A;  3H3Z A;  3J81 K;  4FX0 A;  2PMZ N;  4G12 A;  1FLI A;  1FJL A;  4P9F A;  1LPQ A;  1IUY A;  4A3C J;  1SMY F;  4LIV A;  5M5X J;  4BBS J;  2ZJR F;  4AID A;  2ISY A;  4KN7 X;  2WTE A;  1XX5 A;  1YW9 A;  2HQA A;  2JVH A;  1D8K A;  4A0X A;  1OCP A;  4X0G A;  1GXP A;  2JWT A;  1YW8 A;  3COA C;  4GYG A;  4QWQ A;  4GYI A;  3ZMU A;  3HIF A;  1FX7 A;  3V7C A;  3OV8 A;  3MEX A;  2G7U A;  5J8C A;  4IRI A;  3EQL F;  3H0G J;  3KP6 A;  3PSI A;  2L2O A;  2AXT C;  3WHC A;  4A3J J;  5GAG J;  1FEX A;  1HOM A;  1M1E B;  3WE3 A;  1A35 A;  2DA1 A;  1TWG J;  1F1Z A;  1J75 A;  1GHC A;  2XF7 A;  2W24 A;  1QVT A;  4HW0 A;  5IYB J;  3ULQ B;  5F6F A;  4DBQ A;  4RB1 A;  3HGY A;  5HLH A;  2V9P A;  2ZO4 A;  4AIK A;  2ESN A;  1FMV A;  3PNV A;  3ZPL A;  2E19 A;  5L3F A;  4M3E A;  3K4C A;  3BR0 A;  4G9Y A;  2H1K A;  2BY3 A;  2DOA A;  1IN4 A;  2OQG A;  4MFD A;  1NH3 A;  1G3S A;  2ETH A;  2P8T A;  3LWF A;  5D5X B;  3JCU C;  1S9H A;  1R4M B;  4ESB A;  4HV6 A;  2NOJ B;  4EJT A;  2DK5 A;  5E8G A;  1MBJ A;  1VQ5 I;  3DEW A;  2ZXH A;  3TMO A;  3OSF A;  4C3I J;  2XGE A;  1YIT I;  3P5J A;  4AD9 A;  1C0W A;  2OPT A;  2HVS A;  3HRT A;  3QOD A;  2CO5 A;  2JUG A;  2HZT A;  5KK1 A;  1ENH A;  1XMA A;  5CVV A;  3NWT A;  4HST A;  2VIX A;  1E3P A;  2F5F A;  2JSP A;  1EA3 A;  2QM3 A;  1D0X A;  3RKW A;  3HOT A;  2G0E A;  1YX5 A;  2XRL A;  3CJN A;  2K4B A;  2PG4 A;  4YFN F;  4E7Z A;  2DQL A;  5J6X A;  1EH6 A;  1UHS A;  3G1L A;  3HGG A;  2QEX I;  2VBY A;  3H3V K;  3H92 A;  3HM5 A;  2XAF A;  3N97 A;  4F93 B;  1OYI A;  5EEH A;  1R22 A;  1QVU A;  3NEU A;  3SZP A;  3HDD A;  1JXS A;  4XOP A;  3CUQ C;  3KZY A;  4L9T A;  2CV2 A;  3RZD J;  1TTY A;  3L2U A;  3RCO A;  5IP9 J;  2E7W A;  5BPI A;  2DYR H;  4DYC A;  3EYI A;  3H3U A;  3I59 A;  3G71 I;  4BHP A;  1Z9C A;  2K9M A;  5D5V B;  3BCA A;  2RNJ A;  3ZQI A;  2IGM A;  2L7M P;  1X3Z B;  2WAF A;  3KZI C;  4IO9 F;  4GFB A;  2HYG D;  3T5X A;  1U0J A;  1JUP A;  4X6A J;  1LDK B;  5JR3 A;  3QAH A;  3PO2 J;  4Y4R A;  1ZG5 A;  2HOS A;  3E0J B;  3MKZ A;  1UG0 A;  1T6S A;  2XKO A;  1D0Z A;  4CZC A;  2TRT A;  3RZO J;  2LP0 A;  4RLF A;  1UEL B;  2RKH A;  4CH7 A;  3WTW C;  3S3O A;  2P7V B;  2CS3 A;  1U6G A;  3F8N A;  5D5U B;  2EFW A;  3WU2 C;  3HB9 A;  2FSW A;  1EF4 A;  1ZG3 A;  1D0Y A;  1HW5 A;  1Y0U A;  4LFU A;  2VI6 A;  4NC6 A;  2LYC A;  3S1M J;  5HLT A;  1K6Y A;  2Y9Z A;  3FXL A;  2QSG X;  5FLX Z;  3O3K A;  4M6Y A;  1HSJ A;  4BEH A;  3KEY A;  3F8F A;  4A0Z A;  1V3F A;  1S72 I;  3U1D A;  4EGY A;  3V42 A;  4OU0 A;  4BEH B;  3M1E A;  3BJA A;  4N4N B;  3BTI A;  1SFO J;  3BZC A;  3OIO A;  1J2X A;  2LY2 A;  5EGO A;  1N77 A;  4IQ4 A;  3K4L A;  3E6D A;  5EGO B;  1ZRE A;  5HDG A;  3RPU D;  4ZYD A;  1GLN A;  3CUQ A;  1RIO H;  2ZFU A;  2HVR A;  5M3F J;  5E3M A;  4XN3 A;  3F3X A;  2X51 A;  1MH4 A;  1N25 A;  2XPW A;  3ZN0 A;  2DPU A;  2FRH A;  3PO3 J;  1PUE E;  2W84 A;  3K2Z A;  4F55 A;  2EIN H;  1MMG A;  1W36 D;  3KEO A;  4YFK F;  5D4R A;  1FBU A;  2GIV A;  3TP0 A;  2L7F P;  1X19 A;  2WB1 A;  3HOU J;  2K3P A;  2KRC A;  3LA2 A;  4XLF A;  3RQ4 A;  2R7T A;  2QBY A;  1DPU A;  2QA4 I;  5D5W B;  1W5T A;  4MLO A;  2F5D A;  3VB2 A;  2WV1 A;  4O5V A;  1U8R A;  2RNG A;  2NS7 A;  1IDZ A;  1CQT A;  2F4O B;  1Z6T A;  3F6V A;  5K7Z A;  4B3X A;  2ZSI B;  3CQZ J;  1P4W A;  1QZZ A;  4KFC A;  3K0L A;  1YI2 I;  1WSU A;  1LUJ B;  2IS6 A;  3SJM A;  5L3E A;  2O61 A;  3HSF A;  5LEJ A;  3LSP A;  3BG9 A;  3GLL A;  2QQB A;  1A6Q A;  3CCL I;  4MQV A;  1T38 A;  1CGP A;  3X2Q H;  2OU2 A;  2FOK A;  3SEZ A;  3L9F A;  4A3K J;  1IXS B;  4LG3 A;  3JRI A;  2MFZ A;  3N05 A;  1JKQ C;  1FY7 A;  1RKT A;  1O3S A;  2DW4 A;  1TWC J;  1T33 A;  4ZJZ A;  2QQ9 A;  2IW5 A;  4S0H B;  1ETW A;  3U21 A;  3MZ8 A;  4XMY A;  3HRS A;  2NVX J;  2NXN B;  5C44 J;  3IL2 A;  3L2C A;  2GIZ A;  4WXD A;  3ZQ7 A;  2HEO A;  1K83 J;  1IDY A;  1DDN A;  3I71 A;  1GVD A;  4IKF A;  3MMY B;  4A3D J;  1ETX A;  3FZV A;  3GCM A;  1R5G A;  1ETV A;  2L7K A;  2K9N A;  5L3C A;  2RDP A;  2HQR A;  5GAE J;  5FKO A;  3D1N I;  1KGS A;  1TWH J;  3BJ6 A;  4NC8 A;  2A6T A;  2FNP A;  4XBF A;  4D7M A;  4OIQ F;  2K9L A;  1IXR C;  3OYA A;  1LDD A;  4ZH4 F;  4IOA F;  1HF0 A;  4A3F J;  3S1Q J;  4M3G A;  1U9N A;  4DBR A;  2CYY A;  1UJ8 A;  5F64 A;  4NUB A;  2NVT J;  4C2M J;  3R0J A;  1ERD A;  5GAD J;  3ZQL A;  3B6A A;  2E1C A;  3KP7 A;  1P2F A;  2PJR B;  2BY0 A;  2EIM H;  2RC4 A;  1E3O C;  4NBQ A;  2M7A A;  4BQA A;  5FLV A;  3VYT B;  3K70 D;  3GW2 A;  2ZJ2 A;  4XNF A;  4ENK A;  1D8J A;  5B66 C;  2FF4 A;  3U9G A;  4J19 A;  4R1H A;  1B9N A;  1WJB A;  2OD5 A;  4F7Z A;  3PJR A;  3MN2 A;  3QPL A;  3QPS A;  4LMY A;  3WTS C;  2VJI A;  2JA5 J;  4C3J J;  3IRR A;  3FKJ A;  4F91 B;  4M74 A;  4P1W A;  1S7O A;  2Q0O A;  4XKV A;  1I6X A;  2MLK A;  1ZR4 A;  1DPR A;  2HQ5 A;  1I3A A;  1U3E M;  1ETO A;  3HUG B;  4RAZ A;  5E1W A;  1TQP A;  4HBL A;  5CVJ A;  2VB6 A;  3G73 A;  4L5E A;  4BY7 J;  3HXL A;  1NHA A;  2QGU A;  1IF1 A;  2DTR A;  1U9O A;  1WJD A;  2L0K A;  2HR3 A;  4PSW A;  3K6G A;  4HDV A;  5FRN A;  2VQC A;  4GCV A;  3PM1 A;  3LSR A;  1UZC A;  3E5Q A;  1EH7 A;  4PGH A;  4I2O A;  2LOO A;  4PFO A;  1WZ2 A;  2KKO A;  5ILV A;  3J7A O;  5DCF A;  2P0W A;  2FX0 A;  5LFA A;  1FBQ A;  3HBL A;  4HPQ A;  3CO6 C;  2R7R A;  3IAM 2;  4S04 A;  3H9J A;  5E18 F;  2QUF A;  1QHH D;  1TBX A;  2EZK A;  2O03 A;  2Y48 A;  5E20 A;  2G7H A;  2EV5 A;  1OKR A;  2VKD A;  1FSE A;  2E2I J;  2Y2Z A;  1KU2 A;  1NTC A;  2IVM A;  3M8F A;  3FM3 A;  3JRC A;  3A01 B;  2J5P A;  1Z0X A;  4RA2 A;  5KHD A;  1VQ7 I;  1XCB A;  2WAE A;  2L4A A;  3G3Z A;  4B47 A;  3BC8 A;  4UB8 C;  1AKH A;  3DQV C;  5C4X J;  4W1U A;  3JSO A;  3G6E I;  2UXN A;  1BJA A;  3DEU A;  4PUS A;  4UVC A;  1AKH B;  4EJV A;  3ZQQ A;  3B73 A;  3HOW J;  4PSX A;  2GLO A;  3OR1 C;  5FKL A;  2E2J J;  1UG2 A;  3HL2 A;  1XDS A;  1KQ0 A;  2ZKZ A;  2VE8 A;  2JZY A;  2AQE A;  2K85 A;  1OCT C;  2DTZ A;  4CCO A;  1RZ4 A;  4FE4 A;  2MYS A;  4ABZ A;  3RPU A;  4BJ6 C;  1ITY A;  5HDK A;  4E7I A;  3QYE A;  2EIJ H;  3OYH A;  1D1B A;  1MJ9 A;  2R5Z A;  2IA2 A;  2JPC A;  1DU6 A;  1WVR A;  4XL9 A;  3IKV A;  4I6Z A;  4MQ9 F;  1OLT A;  2LMD A;  2O3F A;  3FHZ A;  2R5Z B;  1X2N A;  2YX7 A;  3VEP A;  1P6R A;  4AIH A;  2VBZ A;  1RUO A;  2IBD A;  3CMM A;  3AAF A;  3KLN A;  4IHW A;  3FBN B;  1ULY A;  1IV8 A;  2IEK A;  4AUX A;  2NVU B;  1DQU A;  2DA6 A;  1A31 A;  4D5F A;  1AHD P;  2GAU A;  3SFZ A;  2VBW A;  1Y1V J;  4XOT A;  3F0C A;  2M4G A;  2ADU A;  2DA5 A;  1BIA A;  3RYP A;  3HRM A;  1ZYR F;  1XMK A;  3NAU A;  2JRM A;  4E4H A;  2XSD C;  1Q1V A;  2EA4 A;  1G3T A;  2X9D A;  3I55 I;  2CH0 A;  2L3D A;  1WPK A;  2HKO A;  3H1C A;  4MGR A;  4KA4 A;  2DDA A;  1MSF C;  2HTS A;  4E7S A;  4HX8 A;  4CCM A;  6PAX A;  1GDT A;  1XSV A;  3M1C A;  4Y33 A;  3VSK A;  5DYM A;  5FKN A;  2LLK A;  2JA7 J;  2P4W A;  3VPR A;  2H8W A;  1BW5 A;  1ODD A;  1BI2 A;  4F52 A;  1EH8 A;  1ETQ A;  4M9S A;  3S2W A;  3OYG A;  2P7C B;  3FMR A;  3K1N A;  1QZE A;  4P96 A;  3CCE I;  1WCM J;  2M34 A;  4P9U A;  4EGZ A;  4V2G A;  2A6E F;  1VQO I;  4N4O B;  4RDU A;  2MGQ A;  1KU9 A;  2FE3 A;  2EK5 A;  2EV6 A;  4LLL A;  2X6O A;  3OYN A;  1WJ5 A;  3OYD A;  3J7A Y;  1EV7 A;  2RAE A;  3O2P E;  3K4N A;  2LKP A;  4XSZ F;  4Z6Y A;  2WWY A;  3MFK A;  4A6E A;  2CUZ A;  3BTJ A;  3CC4 I;  1NK2 P;  1D3Y A;  2X48 A;  2O0Y A;  1V4R A;  3DLL F;  3ZXS A;  4BNC A;  1JKP C;  1A6I A;  2BBY A;  3CME I;  5AIP A;  1W7P B;  3VYR B;  3LFK A;  2RGV A;  2AHQ A;  1TP4 A;  3OL4 A;  3OYC A;  1NK3 P;  5IT9 Z;  2DDB A;  1SD6 A;  4GO1 A;  1XG1 A;  2ACJ A;  2J5O A;  2Z99 A;  3EUH C;  4WF2 A;  2EFP A;  3ZQC A;  2BOL A;  2HDC A;  1IZ1 A;  3GWZ A;  3LQQ A;  1D5Y A;  4JBA A;  1E17 A;  2NVY J;  1JGG A;  3TO7 A;  3LQR A;  3MCZ A;  5HLI A;  3LAP A;  1LEB A;  4GGG A;  1MBK A;  2CFX A;  5J47 A;  4E7J A;  1AA7 A;  4BAY A;  2CQX A;  4HLY A;  3H5A A;  5ED4 A;  3Q0W A;  4HF2 A;  3O8H A;  4LD5 A;  4LK0 F;  3WU1 B;  4B8X A;  3V8J A;  3HHG A;  3ZOB A;  2KIS A;  3D5S C;  3F8C A;  5EG0 B;  4BUP A;  3GTQ J;  5IOZ A;  3GXO A;  1QA6 A;  1I5Z A;  4RAY A;  5JLX A;  3CP2 A;  2MBF A;  1WI9 A;  1YW7 A;  2VT2 A;  2LBF A;  3E6B A;  3IH4 A;  3HYI A;  1SFK A;  1IW7 F;  4MIM A;  3RPQ A;  2GXB A;  1J9I A;  2LBF B;  2DMQ A;  4GDF A;  2DT5 A;  2KT0 A;  2R7S A;  3OOP A;  3S1R J;  5GTH C;  2K3F A;  3I3L A;  3BQY A;  5F08 A;  1Y8R B;  1OCR H;  2PQ8 A;  4UV8 A;  3PSF A;  1SD5 A;  2FQ4 A;  1YLF A;  4C9Y A;  4FHT A;  2XGC A;  1YRN A;  5A2Q Z;  3L09 A;  1YTY A;  4HV5 A;  4YIR X;  1DUX C;  1FYL A;  3TDZ C;  2L01 A;  1W0T A;  1RR7 A;  4Q4Z F;  3MZH A;  4RBO A;  4XSX F;  1NG6 A;  4R8H A;  4BYY A;  1OYY A;  4EV0 A;  3CCJ I;  3JRE A;  1PDN C;  2ME0 A;  2ELH A;  4UUV A;  4UVA A;  4PJL A;  2LRE A;  5DEQ A;  2A68 F;  3A0B C;  3GME A;  4BXF A;  3S1N J;  1LDJ A;  2WB1 N;  2F5V A;  4A3G J;  2OTL I;  1GV5 A;  3TGN A;  3V7R A;  2ZXI A;  3KP2 A;  2DMT A;  3GZN B;  5K5R A;  4BHB A;  3HOY J;  4MNU A;  1R9T J;  2EWN A;  3KYC B;  3BOQ A;  2XIG A;  1UCR A;  4NC7 A;  3T8R A;  2M4K A;  3JTG A;  3L2Q A;  5CVR A;  4H4K C;  2X1C A;  2XGX A;  3FXJ A;  1BW6 A;  2OCE A;  1QBJ A;  2IPQ X;  1L3L A;  2JA6 J;  1O7L A;  2V4J C;  2XAH A;  2DOD A;  2O7O A;  5HLG A;  1SFE A;  1UHM A;  2OUM A;  2QQ8 A;  2AO9 A;  3SDB A;  1UMQ A;  2HU9 A;  2V1U A;  3J81 Z;  1OIS A;  2VQL A;  2HS5 A;  4XKC A;  4EJO A;  3DKY A;  2WY7 Q;  2M0M A;  2M2E A;  4PJN A;  4PJM A;  1HC8 A;  3DV8 A;  5ILU A;  3SHF A;  1VFC A;  3BR1 A;  2GZW A;  2P5K A;  5CQE A;  3CC2 I;  3OYL A;  4G7H F;  4A3I J;  2R7X A;  3GFI A;  1X4P A;  2DFI A;  1IJW C;  1OR7 C;  1XTA A;  4WXH A;  2HXI A;  2A61 A;  1W5C C;  3MVP A;  2MSY A;  3BWG A;  3MKY B;  4UUS B;  1FOK A;  3S14 J;  2DA2 A;  2VPR A;  2XRN A;  5ICC A;  2R7Q A;  1GUU A;  5J1U A;  4KNY A;  2FNA A;  2QZ8 A;  3DTI A;  3ZR8 X;  5CYV A;  1XB4 A;  4L5J A;  4XK4 A;  2XAJ A;  4B1R A;  1HBX G;  4FAS D;  1A04 A;  3IUO A;  4G94 A;  2ISZ A;  2LC2 A;  3O8G A;  2DK8 A;  2DI3 A;  2X85 A;  3M8E A;  4ZZL A;  4RAG A;  3IWF A;  3QRF F;  2VKH A;  4B48 A;  1O7F A;  3WTX C;  1BC7 C;  1TNT A;  1YX3 A;  5LHH A;  1DP3 A;  4BQQ A;  4YFX F;  2XAG A;  3H35 A;  5DD4 A;  5LHG A;  2STT A;  3L00 A;  3MD2 A;  2KLO A;  2R7D A;  3HOX J;  4MEY F;  4FIS A;  2W7N A;  1IN5 A;  2ZBK A;  4CYD A;  2QKL B;  5GPC A;  2EV0 A;  2NVQ J;  3LSJ A;  1ZH5 A;  1Z3X A;  1MGT A;  3CLO A;  2ZSH B;  3MAJ A;  4EVI A;  4IPA A;  4HYE A;  4BU2 A;  1U5T C;  3OYB A;  1H0M A;  5FKK A;  2IGN A;  4HRI A;  2LTP A;  3RI4 A;  2HQN A;  3IHU A;  1XGS A;  2E5N A;  2VBX A;  3BTC A;  4HEA 2;  4M71 A;  2VQH A;  3KYL A;  2ZB9 A;  1XPX A;  4IHT A;  4OMY A;  4UVB A;  1SVL A;  3D0S A;  2PJP A;  2DOE A;  1OR7 A;  1KU7 A;  1K78 B;  2HI3 A;  1HST A;  1Y8Q B;  1H9G A;  4HOB A;  4L9V A;  4LOC A;  1Y56 A;  2JSC A;  2Y75 A;  4II2 A;  2ELK A;  2VXZ A;  1SD4 A;  1HW1 A;  5M3M J;  3HEF A;  3Q0V A;  4RAF A;  2V9K A;  2CRG A;  4EM1 A;  1HKQ A;  3HTU A;  2GOX B;  2VKE A;  3JTH A;  1ZR2 A;  2OJE D;  3L7W A;  3EUK L;  4KT6 A;  4M3B A;  5LGN A;  1I3Q J;  3BG3 A;  2E60 A;  4A0Y A;  2W25 A;  4ENJ A;  1LE8 B;  3Q0U A;  5IYC J;  2JA2 A;  4XON A;  4UNO A;  1KU3 A;  1S29 A;  3QP5 A;  5CVI A;  4M9X A;  1ZAO A;  4PFP A;  4WXC A;  1YYV A;  3OS2 A;  2ZCW A;  5E3O A;  2EQR A;  1T39 A;  5FKM A;  2VOP A;  3PIO F;  2UV1 A;  3GZ5 A;  4U7B A;  2KDZ A;  4OIN F;  3FF5 A;  4IX7 A;  1QO0 D;  2KP6 A;  3RKQ A;  2R7Z J;  1VQ9 I;  1N75 A;  1BI3 A;  4EJU A;  2MC4 A;  4HLX A;  4D9J A;  1IRG A;  2X6Y A;  3NWS A;  4OIO F;  3ZMS A;  2HFH A;  3GF2 A;  3M8J A;  5CKT A;  4NQW A;  1U5T B;  2M1B A;  3SDG A;  2I8D A;  4ZYE A;  2FQ3 A;  4OAY A;  4NQW B;  5FFZ A;  1SMT A;  3OS0 A;  2BY1 A;  4B44 A;  2NNN A;  5KVR A;  1MNE A;  3DKX A;  5E3L A;  3DPU A;  5L3D A;  2HKX A;  3M07 A;  2PN6 A;  4OOI A;  4LG0 A;  3DBH B;  1LVK A;  2FEZ A;  3ABL H;  1R58 A;  4AU7 A;  5ICF A;  4TV7 A;  4LG0 B;  1Z05 A;  4RS8 A;  1P92 A;  1O3T A;  3OYK A;  1HCR A;  4V19 K;  1MJA A;  4IEJ A;  1KZH A;  4I76 A;  4HX4 A;  3LNQ A;  2KFD A;  2BHY A;  1MH3 A;  3OYE A;  1IO2 A;  5E8I A;  5L3G A;  2KDO A;  1MDM B;  4ON0 A;  1GV2 A;  5D4S A;  4KIT B;  3V7S A;  1HDP A;  4HNU A;  4OIP F;  1ZGJ A;  2BEO A;  4M6X A;  5IPA A;  1TL8 A;  4M3F A;  4C2U A;  5FGM A;  2IS2 A;  2VT3 A;  1SD7 A;  4LLN A;  3WTZ A;  2QYO A;  4XLP F;  1T2K A;  3S32 A;  1E3H A;  2ZXJ A;  2L9S A;  3CCM I;  5IP7 J;  5F27 A;  2HVQ A;  1AWC A;  4UY8 I;  1SAU A;  3DFG A;  5L3B A;  2DJN A;  2R93 J;  3RYR A;  5CLS A;  2W1O A;  4KIB A;  4ESJ A;  1FP1 D;  1YIO A;  1R49 A;  2H8R A;  3MQ0 A;  2P5V A;  4CCN A;  2HDW A;  4DZP A;  3QYF A;  1BR1 A;  5B1A H;  1AOY A;  3WTV C;  5C4J J;  2Q8K A;  3RJP A;  1FOW A;  3Q3S A;  3LA3 A;  5DUI A;  2QEN A;  4LIT A;  2DN0 A;  2ZFW A;  2L9N A;  1YJN I;  3PNT A;  2K40 A;  2PBI A;  2HOE A;  3ZQG A;  1SC7 A;  3LST A;  2EB7 A;  3FXR A;  2DYS H;  1JUS A;  5FRM A;  2N8G A;  2VJ5 A;  1J5Y A;  1ZKG A;  2L54 A;  4XLC A;  4MTD A;  2MA3 A;  2GXA A;  3E5U A;  4DOZ A;  2B9S A;  3TOB A;  3BCB A;  3H0D A;  2O9L A;  5LHI A;  2RVC A;  4M72 A;  1QHG A;  5JFR A;  3K1M A;  2M9H A;  5HNF A;  1OYW A;  2DFF A;  2I5U A;  4B3A A;  3C18 A;  4JOM A;  1E0E A;  4KJZ A;  3QP6 A;  5KNL A;  3LSK A;  4KMU X;  5JHU A;  2NOG A;  3R4K A;  1W7P D;  2XV4 S;  5EDN A;  3ZRG A;  3OYI A;  5DS9 A;  3FX3 A;  4RLQ A;  3K1P A;  4IHS A;  3HRU A;  3GEZ A;  2R3S A;  4ENN A;  4DNC A;  4AYB A;  2GA2 A;  3M7G A;  3CMY A;  4AWX B;  2E7X A;  4XRS A;  1FSH A;  1J7K A;  2XPV A;  3CJT B;  2BY2 A;  2DA7 A;  3WE2 A;  1WFX A;  4Y15 A;  4BBR J;  2HNH A;  1K7A A;  5LLQ A;  3OOU A;  3A4C A;  4AVZ A;  1ORK A;  5TGT A;  1X58 A;  2FMY A;  2WA0 A;  2NNY A;  3JAM K;  1R36 A;  2E2H J;  4N9H A;  4NNJ A;  5E3N A;  1GT0 C;  2IS4 A;  2PJR A;  2W00 A;  4OWR B;  1MW7 A;  4KIC A;  3F6O A;  1LFB A;  5CQG A;  4RM2 A;  4QLC U;  1I39 A;  3FXQ A;  3AL0 C;  3OMY A;  1PP8 F;  3AG2 H;  2BVM A;  3FXK A;  4EM2 A;  1A5J A;  3HTS B;  1JJ6 C;  1KYW A;  2FBI A;  3CP8 A;  4BS9 A;  3S3N A;  2EFQ A;  4XIC A;  5B5E C;  4MFE A;  3K9T A;  3Q5F A;  1KQ9 A;  1T98 A;  2M8G X;  3SQN A;  5HOO A;  3ECH A;  2H6C A;  2P6T A;  5LBQ A;  2OZU A;  2NAZ A;  3S93 A;  2GA1 A;  1WGX A;  1IRF A;  3AG3 H;  4A5M A;  2GOM A;  1KA8 A;  1X1D A;  5EZH A;  1TNS A;  1V54 H;  4LK1 F;  4YRV A;  4Q47 A;  4ETS A;  3CF5 F;  2XGD A;  1UAA A;  4BL0 B;  2BXZ A;  1JTY A;  1VF9 A;  3HUG A;  2HDD A;  1BR2 A;  2VLA A;  1ZEL A;  2EJR A;  1R1V A;  3NAR A;  5BPD A;  1YO5 C;  2DCE A;  2WY8 Q;  2O8X A;  3HOV J;  2L02 A;  1Y39 A;  4BQO A;  1R00 A;  2Y0M A;  3C2B A;  1F9N A;  5TIS C;  2EPF A;  4ENM A;  3OSG A;  2DOF A;  2LKS A;  3ASO H;  4XR6 A;  3ABT A;  1P7I A;  2O5R A;  1ZGW A;  2A05 A;  3AG4 H;  4O3M A;  2KIF A;  4RMN A;  5BOX A;  3CCY A;  4XKB A;  1HQC A;  3Q9S A;  5B1B H;  2C6Y A;  3P9I A;  1MBG A;  1B72 A;  5IYD J;  1QPM A;  4HF0 A;  4LIU A;  2R7W A;  5F0F A;  1T0F C;  3CMA I;  1B72 B;  2H27 A;  4D5C A;  3BLY A;  5BMZ A;  3GTO J;  2M30 A;  3ZQF A;  2IT0 A;  3E6M A;  3HPH A;  4HX7 A;  1G3W A;  4OAZ A;  2ID3 A;  4JP0 A;  4BJT A;  3JRA A;  4C30 A;  2LF7 A;  3BTL A;  4G6D A;  4IL6 C;  1ZG1 A;  1TW3 A;  3W2A A;  3GTM J;  2QWW A;  4ZYH A;  3A01 A;  1QQI A;  2CUF A;  4CCK A;  4DJA A;  4CYC B;  4Y3O A;  3W6V A;  3AL0 B;  1ZLK A;  3V8L A;  3IC7 A;  1FMW A;  2XPU A;  2DT6 A;  1RNL A;  3IRQ A;  4AVP A;  5J3L A;  3AFH A;  3L2R A;  1B6A A;  2JRT A;  1FIA A;  1SEU A;  4C3H J;  4YEJ A;  3R61 A;  3SYT A;  5DDG A;  1J59 A;  1X1P A;  4UV9 A;  4IRG A;  3NRV A;  2QSH X;  2DFH A;  5F1J A;  4J01 A;  1ZN2 A;  2YR2 A;  1R5H A;  3RTR A;  3PQJ A;  2LF8 A;  5JLW A;  2YUS A;  2EIK H;  1H8A C;  2JN6 A;  2JPB A;  5DD8 A;  3H5N A;  3ZN1 A;  2KJC A;  2D45 A;  2M0C A;  1JKO C;  1QU3 A;  4DZJ A;  1TT0 A;  5JHF A;  1FP2 A;  2ID6 A;  2R4G A;  2X1E A;  4PGG A;  1BM9 A;  5D6F A;  2ZME C;  4F92 B;  2WAQ A;  1DU0 A;  5DCM B;  2PLY A;  4HNT A;  4MEX F;  4UB6 C;  4XOR A;  4A5N A;  3U2R A;  3A03 A;  1J0R A;  4A69 C;  3D5R C;  5EJC A;  1STZ A;  2FXA A;  2V1D A;  5E17 F;  2CJJ A;  2KJB A;  4RGX A;  5F0C A;  2V7F A;  5IY5 H;  2COM A;  5FO5 A;  3CO7 C;  3VYS B;  3RDI A;  3PFY A;  4KN4 X;  3F72 A;  3TL4 X;  4KT5 C;  2IJL A;  2W82 A;  1JHF A;  3J7Z I;  3F22 A;  2IAI A;  1K79 A;  1HXD A;  4WCG A;  1PUF A;  1XGM A;  4ZTF A;  4M3D A;  1BN5 A;  3O6B B;  2QKM B;  1PUF B;  4BHC A;  1U8B A;  3TW7 A;  3KEQ A;  2DPD A;  1S7A A;  1IV6 A;  4N0B A;  1YHQ I;  3A02 A;  2E36 A;  4I7H A;  4W97 A;  4HF1 A;  3OR2 C;  5JVG F;  1ZK8 A;  4DQ2 A;  1Z91 A;  5E1X A;  3HKZ A;  5B3S H;  1P7J A;  4LLG F;  2YU3 A;  3WG7 H;  3KCC A;  3ZP5 A;  2AS5 F;  3EPZ A;  2VC0 A;  1OMI A;  3KPH A;  3QYB A;  1IRX A;  2CQQ A;  2BYV E;  4XQF A;  3C2G A;  1D1C A;  3ASN H;  4IZZ A;  5CPR B;  3H9G A;  4GXO A;  1ZTR A;  4A3B J;  4XLH A;  1L0O C;  3LMM A;  4Y52 J;  2OA4 A;  1Z3Y A;  3BP8 A;  1HLV A;  4A3M J;  1OFC X;  2YS9 A;  2CFO A;  2E35 A;  3IV5 A;  2CSO A;  2QVO A;  2ME6 A;  4YEL A;  2Y69 H;  5F04 A;  3FIW A;  2CW8 A;  2LRD A;  5KCM A;  2L4M A;  2ZME A;  3DU6 A;  1W7P A;  2FA5 A;  3SFI A;  3GBG A;  1S8N A;  4I02 A;  3WGH A;  2ZME B;  5LRS A;  3FKI J;  3JRB A;  3RIR A;  1T08 B;  4FET A;  2YX4 A;  2X1D A;  2XB5 A;  3OWT A;  1SAN A;  1FT9 A;  5LGT A;  2CUE A;  5AON A;  3S16 J;  2OZ6 A;  1X4O A;  3J80 K;  1JKR C;  3CDI A;  3ABM H;  1B4A A;  2XUB A;  3F8B A;  3LSG A;  1G3Y A;  5GP9 A;  2DJI A;  2X0L A;  3KFW X;  2HPM A;  1VQ4 I;  3E5X A;  1S7E A;  3BR6 A;  3F9K A;  4L9J A;  1WJC A;  4K2E A;  5FFX A;  3GTG J;  2PMU A;  3PFI A;  5CVU A;  1REP C;  1N78 A;  5J8F A;  1PVE A;  2CQK A;  4U0V A;  1FWZ A;  1ETY A;  4OMZ A;  2BZT A;  4A6D A;  2CQN A;  5EG0 A;  2LK2 A;  4Y13 A;  1CF7 B;  4NDL A;  2ZNY A;  5ILS A;  4ZC3 A;  2DA4 A;  2Z16 A;  2CMP A;  4G8X A;  2CUJ A;  2HOT A;  4L0Z B;  2EZH A;  4H0E A;  4ZDO A;  3CJR B;  2OQR A;  2P5L C;  1XSD A;  2RRE A;  2V9V A;  1LEA A;  1YFH A;  4QIW N;  1BL0 A;  2XHK A;  2CW7 A;  5K7H A;  4ASN A;  5HS7 A;  2IA1 A;  1P9Q C;  4I01 A;  1XMX A;  2H6B A;  3B02 A;  5CJ9 A;  4LJZ F;  1BI1 A;  2A07 F;  3DPT A;  2X6W A;  4I09 A;  3TOA A;  3GLX A;  4WK8 F;  4KMF A;  4I0A A;  4CHU A;  1K4S A;  3WGI A;  2ESH A;  3PUF A;  4CDG A;  3ERM A;  3DLA A;  4Q48 A;  2BW3 B;  1X2M A;  1XC5 A;  2QQA A;  1BA5 A;  2LFB A;  1OCO H;  3C7J A;  2BXY A;  3OL3 A;  4II3 A;  1I1S A;  1SAX A;  3C2H A;  3S17 J;  2VJJ A;  4LGW A;  2AQF A;  3EUH A;  3GO5 A;  3P7N A;  5EYR A;  4PJJ A;  5E79 C;  1IAW A;  1J09 A;  2K9Q A;  2ZXW H;  3BG5 A;  3BR5 A;  4QSH A;  3OS1 A;  3DU5 A;  3GTP J;  1W0U A;  3BG7 A;  1VQL I;  4U88 A;  4BDY A;  1XGO A;  1DGR M;  2ZC2 A;  3CES A;  3FK6 A;  3F8M A;  1LVA A;  4EMS A;  4D7N A;  1ACI A;  2DXI A;  2E34 A;  3FK7 A;  4YIF A;  1JE8 A;  2DMU A;  4IHV A;  4BQN A;  4GRI A;  4QPQ A;  2CG4 A;  3W6J B;  2DMN A;  2Z1D A;  3MKL A;  3CDL A;  1VTN C;  4KIF A;  1WQ2 A;  2PEX A;  1RUN A;  2UWM A;  2L7Z A;  3G1M A;  3RSN A;  2LY9 A;  3L1P A;  1UST A;  1XDU A;  1SFX A;  1G6N A;  1FIP A;  4AC0 A;  2CGP A;  3VSL A;  4M73 A;  2NRA C;  3ECO A;  2JVG A;  3S8P A;  4CO8 A;  2Y9Y A;  3FWE A;  4CUG A;  4ZTJ A;  1ZRD A;  2XAQ A;  3ZQH A;  4IF4 A;  2F4I A;  4CCJ A;  3CZ6 A;  3IWZ A;  4UUS A;  4IRH A;  2IGK A;  1YQA A;  3SXY A; 
#chains in the Genus database with same CATH homology
 2Z3Y A;  4ZZD A;  1P4A A;  4S05 A;  2XAS A;  3HHH A;  2UXX A;  1IN7 A;  1ONV A;  2XRO A;  1F4K A;  3FXU A;  4R79 A;  3KLO A;  5K5O A;  2V6C A;  3C1D A;  1QNT A;  5TJJ A;  4IVN A;  3LAJ A;  3TKY A;  4Y17 A;  5TRD A;  3PQK A;  4NHJ A;  2Z5U A;  2HGC A;  1GXQ A;  1E2X A;  2FBK A;  1ZAR A;  1LB2 A;  5JVT A;  4KYW A;  2M8E A;  1ZRF A;  1S3J A;  1QZY A;  4UXN A;  2LNB A;  1K78 A;  3VFZ A;  2OAZ A;  3ABU A;  2VC1 A;  4HAM A;  1WRJ A;  2F5E A;  2B0L A;  2JTV A;  3BZ6 A;  1BI0 A;  3R0A A;  4L18 B;  4A2U A;  2D1H A;  4EQQ A;  5D8K B;  3GFL A;  3I64 A;  3ZMZ A;  5D6E A;  4G7Z F;  3TO6 A;  3GX4 X;  3ZMD A;  1BIB A;  3IKT A;  3V8K A;  1O3R A;  4LB6 B;  3E3V A;  4RB0 A;  3Q9V A;  4G6Q A;  3TQN A;  3I59 B;  5FD5 A;  1XN7 A;  4E70 A;  1U5T A;  4B09 A;  2K7L A;  1TW2 A;  4KIG A;  2K27 A;  4XRF A;  4A12 A;  2LSO A;  3ZMT A;  4CZZ A;  3CDH A;  4ZYG A;  1BBY A;  1SFU A;  1QGP A;  5FLX K;  4CGZ A;  5JI6 A;  1KYZ A;  3MZY A;  4PZJ A;  3EET A;  5DUK A;  5H6Q A;  1MDM A;  4PDK A;  3RKX A;  2UZK A;  2E1N A;  1I1G A;  2M5W A;  3JW4 A;  3K69 A;  2VOO A;  1RI7 A;  3N4M A;  3REO A;  2EFO A;  2DBB A;  1YQA A;  1YS7 A;  2F2E A;  2PFB A;  3CUQ B;  4FX4 A;  4KDP A;  3KET A;  1S6L A;  2GXG A;  1FPQ A;  3ELK A;  3D5L A;  3W6K B;  3QPT A;  1Z6R A;  2MH9 A;  2GQQ A;  2KRF A;  1W4M A;  1TQI A;  4HQE A;  3ERE D;  2MLG A;  4NB5 A;  4ESF A;  2BV6 A;  3WG9 A;  4HA8 A;  1TQM A;  2QBY B;  5AIQ A;  3BY6 A;  1USS A;  4Z2Y A;  2IRF G;  3WGG A;  2O6G E;  2BE5 F;  3ROU A;  2RN7 A;  3FMS A;  1ZGA A;  1U78 A;  2YSR A;  2EFN A;  5H6R A;  3R6S A;  2MH2 A;  5HVQ C;  1Z7U A;  5EEG A;  1HKS A;  3WTY C;  4L5I A;  2DAO A;  3QU3 A;  1ON1 A;  3I0T A;  2TDX A;  5K5Q A;  2VN2 A;  2DU9 A;  3BRO A;  1MJB A;  2A5Y B;  4P55 A;  3I4P A;  4U0Y A;  4MHG A;  1R1U A;  1ON2 A;  2NYX A;  1UFM A;  3JAM Z;  4IXA A;  5H20 A;  4LB5 A;  5FB2 A;  4BH9 A;  2STW A;  2A6H F;  4YII A;  1XGN A;  4XLN F;  2RV8 A;  1FYK A;  2PMH A;  3BPX A;  3GFM A;  1XSX A;  3F23 A;  2GWR A;  4HQM A;  2K02 A;  4KUM A;  1FBS A;  1LQ1 A;  4N9I A;  1Q1H A;  4CIC A;  2QLZ A;  4L9N A;  1KQ8 A;  2HWV A;  3KE2 A;  4FT8 A;  2X4H A;  2D2W A;  3DXJ F;  5ICE A;  1H9T A;  4RB3 C;  3E6C C;  4O6J A;  3GYH X;  2RQP A;  3HSR A;  3LA7 A;  1HKT A;  2M87 A;  2CW0 F;  3BJO A;  3I53 A;  3P9C A;  5LGU A;  4HZF A;  4G7O F;  2DO7 A;  1Z1D A;  4RGU A;  3DKW A;  2K4J A;  5ICG A;  1BC8 C;  4UHT A;  3WTT C;  3I5U A;  1ZRC A;  1X3U A;  2XVC A;  2FBH A;  2OBP A;  2VOD A;  2V79 A;  1IN6 A;  2D1V A;  4MTE A;  4L0Y B;  3GUD A;  1F5T A;  3HOS A;  1O57 A;  3WTU C;  1K6O A;  2WC2 A;  4WWC A;  4M9Z A;  4IJA A;  1FC3 A;  1YG2 A;  1UHW A;  3KP3 A;  3T8T A;  3EYY A;  4P5O A;  1GVJ A;  2MD5 A;  4JQF A;  4RGS A;  4D0P A;  3C3W A;  1R23 A;  4RGR A;  2CWE A;  3CUO A;  2BGC A;  2KIU A;  5DCM A;  4U7D A;  4YG2 F;  4Q5S F;  1T0F A;  4CXF A;  2W85 A;  2PI0 A;  3KZZ A;  3CTA A;  3ML6 A;  4I0B A;  2VE9 A;  1MKM A;  1FZP B;  3T0Y A;  3WU0 A;  2M45 A;  3MWM A;  1W5S A;  2H94 A;  1LNW A;  3EDP A;  1FNN A;  4BXU A;  1P4X A;  1XCV A;  2FML A;  1B9M A;  2MC3 A;  2K86 A;  1G4D A;  1DP7 P;  5E1Z B;  3I54 A;  2R7F A;  4OIR F;  5FD6 A;  1MD0 A;  4PCQ A;  1O3Q A;  3VOD A;  1IXC A;  2ZNZ A;  2VON A;  2JT1 A;  3NQO A;  1UB9 A;  5HS8 A;  2H09 A;  1IN8 A;  2F5C A;  3GFJ A;  3FM5 A;  1I27 A;  4RB2 C;  5BQT A;  3J80 Z;  3QPH A;  4JK1 X;  2P6S A;  5K1Y A;  3HSE A;  3QOP A;  1WKM A;  1R1T A;  3DF8 A;  1JHH A;  3GVA A;  1PP7 U;  5IT9 K;  1ZLJ A;  5D8L B;  1CF7 A;  4I98 B;  1WWX A;  1HW2 A;  1B1B A;  3KP5 A;  1BOA A;  1U2W A;  3V4G A;  1OPC A;  3ISP A;  3TO9 A;  3BPV A;  2A3S A;  3TDU C;  2DLL A;  3SZT A;  1MZB A;  2IA0 A;  4AIJ A;  3RKY A;  2DQR A;  2YPR A;  3VOE A;  2AXL A;  5LRR A;  3R60 A;  2EA2 A;  4EM0 B;  1FYM A;  5LEK A;  4EJW A;  2Z33 A;  2XKP A;  1B59 A;  5DV5 A;  3WOD F;  2G9W A;  3QU6 A;  1R7J A;  2HYF A;  3JSP A;  3I58 A;  2LDU A;  3P9K A;  5A2Q K;  1YS6 A;  2W57 A;  3DPL C;  2V1X A;  1TLH B;  3E97 A;  2KIM A;  3DP7 A;  2Z9O A;  4WX9 A;  3T1B A;  3ZMV A;  2Q2E A;  2NS0 A;  2FU4 A;  3GZ6 A;  4HDU A;  5F1R A;  5IT3 A;  5HDN A;  5BS6 A;  2IP2 A;  4U0W A;  3FMQ A;  1ZHF A;  3F21 A;  5ERI A;  3M9A A;  2A69 F;  2WV0 A;  1D5V A;  3KP4 A;  2HTJ A;  3BDD A;  5HS9 A;  1LJ9 A;  1JGS A;  1XD7 A;  3H3Z A;  3J81 K;  4FX0 A;  1FLI A;  4P9F A;  1IUY A;  1SMY F;  2ISY A;  4KN7 X;  2WTE A;  1YW9 A;  4A0X A;  1D8K A;  1GXP A;  1YW8 A;  3COA C;  4GYG A;  4QWQ A;  4GYI A;  3ZMU A;  3HIF A;  1FX7 A;  3V7C A;  3OV8 A;  3MEX A;  2G7U A;  5J8C A;  4IRI A;  3EQL F;  3KP6 A;  3WE3 A;  1F1Z A;  1J75 A;  1GHC A;  2W24 A;  4HW0 A;  3ULQ B;  5F6F A;  4RB1 A;  5HLH A;  2ZO4 A;  4AIK A;  2ESN A;  3ZPL A;  5L3F A;  4G9Y A;  1IN4 A;  2OQG A;  1G3S A;  2ETH A;  2P8T A;  3LWF A;  5D5X B;  4ESB A;  4HV6 A;  4EJT A;  2DK5 A;  5E8G A;  4AD9 A;  1C0W A;  3HRT A;  2CO5 A;  5KK1 A;  2HZT A;  1XMA A;  5CVV A;  2F5F A;  2QM3 A;  3RKW A;  3HOT A;  3CJN A;  2K4B A;  2PG4 A;  4YFN F;  2DQL A;  5J6X A;  1EH6 A;  2VBY A;  3H92 A;  3N97 A;  2XAF A;  1OYI A;  5EEH A;  1R22 A;  3NEU A;  3SZP A;  1JXS A;  3CUQ C;  3KZY A;  4L9T A;  1TTY A;  2E7W A;  5BPI A;  3EYI A;  3H3U A;  3I59 A;  4BHP A;  1Z9C A;  5D5V B;  2RNJ A;  2HYG D;  3T5X A;  1LDK B;  5JR3 A;  3QAH A;  1ZG5 A;  1T6S A;  2XKO A;  2RKH A;  3WTW C;  2P7V B;  1U6G A;  3F8N A;  5D5U B;  2EFW A;  2FSW A;  1ZG3 A;  1HW5 A;  1Y0U A;  4LFU A;  5FLX Z;  3O3K A;  4M6Y A;  1HSJ A;  3F8F A;  4A0Z A;  1V3F A;  3U1D A;  4EGY A;  4OU0 A;  3M1E A;  3BJA A;  1J2X A;  3E6D A;  1ZRE A;  5HDG A;  4ZYD A;  3CUQ A;  1RIO H;  3F3X A;  3ZN0 A;  2DPU A;  2FRH A;  1PUE E;  2W84 A;  3K2Z A;  3KEO A;  4YFK F;  5D4R A;  1FBU A;  2GIV A;  3LA2 A;  2QBY A;  1DPU A;  5D5W B;  1W5T A;  2F5D A;  3VB2 A;  4O5V A;  1U8R A;  1Z6T A;  3F6V A;  1P4W A;  1QZZ A;  4KFC A;  3K0L A;  1WSU A;  5L3E A;  2O61 A;  3HSF A;  5LEJ A;  2QQB A;  4MQV A;  1T38 A;  1CGP A;  2OU2 A;  2FOK A;  3L9F A;  1IXS B;  1FY7 A;  1O3S A;  2DW4 A;  2QQ9 A;  2IW5 A;  3HRS A;  3IL2 A;  3L2C A;  4WXD A;  3ZQ7 A;  2HEO A;  1DDN A;  3I71 A;  3FZV A;  1R5G A;  5L3C A;  2RDP A;  2HQR A;  1KGS A;  3BJ6 A;  2FNP A;  4XBF A;  4OIQ F;  1IXR C;  1LDD A;  4ZH4 F;  2CYY A;  5F64 A;  3R0J A;  2E1C A;  3KP7 A;  1P2F A;  2RC4 A;  4BQA A;  3GW2 A;  2ZJ2 A;  4ENK A;  1D8J A;  2FF4 A;  3U9G A;  4R1H A;  1B9N A;  2OD5 A;  4F7Z A;  4LMY A;  3WTS C;  3IRR A;  4M74 A;  1S7O A;  2Q0O A;  1I6X A;  2MLK A;  1DPR A;  1U3E M;  4RAZ A;  5E1W A;  1TQP A;  4HBL A;  5CVJ A;  3G73 A;  1NHA A;  1IF1 A;  2DTR A;  2HR3 A;  4HDV A;  4GCV A;  3E5Q A;  1EH7 A;  4PGH A;  4I2O A;  2KKO A;  5ILV A;  3J7A O;  5DCF A;  1FBQ A;  3CO6 C;  4S04 A;  5E18 F;  2QUF A;  1TBX A;  2Y48 A;  2O03 A;  5E20 A;  2G7H A;  2EV5 A;  1OKR A;  1FSE A;  1KU2 A;  2IVM A;  3M8F A;  3FM3 A;  2J5P A;  2L4A A;  3G3Z A;  3DQV C;  3JSO A;  2UXN A;  1BJA A;  3DEU A;  4UVC A;  4EJV A;  3B73 A;  1XDS A;  1KQ0 A;  2ZKZ A;  2VE8 A;  2JZY A;  1RZ4 A;  3RPU A;  5HDK A;  1MJ9 A;  2IA2 A;  2JPC A;  3IKV A;  4MQ9 F;  3FHZ A;  2O3F A;  2YX7 A;  3VEP A;  1P6R A;  4AIH A;  2VBZ A;  1RUO A;  3AAF A;  3KLN A;  1ULY A;  2GAU A;  3SFZ A;  2VBW A;  2ADU A;  1BIA A;  3RYP A;  3HRM A;  1ZYR F;  1XMK A;  2EA4 A;  1G3T A;  2L3D A;  2HKO A;  4MGR A;  4KA4 A;  2HTS A;  4HX8 A;  6PAX A;  1XSV A;  5DYM A;  2P4W A;  1ODD A;  1BI2 A;  1EH8 A;  4M9S A;  3S2W A;  2P7C B;  3FMR A;  3K1N A;  4P96 A;  4P9U A;  4EGZ A;  2A6E F;  1KU9 A;  2FE3 A;  2EK5 A;  2EV6 A;  4LLL A;  1EV7 A;  3O2P E;  2LKP A;  4XSZ F;  2WWY A;  3MFK A;  4A6E A;  1D3Y A;  2O0Y A;  1V4R A;  4BNC A;  2BBY A;  5AIP A;  1W7P B;  3LFK A;  2RGV A;  5IT9 Z;  1SD6 A;  4GO1 A;  2ACJ A;  2J5O A;  2Z99 A;  4WF2 A;  2EFP A;  2HDC A;  1IZ1 A;  3GWZ A;  3LQQ A;  1E17 A;  4JBA A;  3TO7 A;  3LQR A;  3MCZ A;  5HLI A;  3LAP A;  1LEB A;  4GGG A;  2CFX A;  4BAY A;  4HLY A;  5ED4 A;  4HF2 A;  4LD5 A;  4LK0 F;  3WU1 B;  4B8X A;  3V8J A;  3HHG A;  3F8C A;  3GXO A;  1I5Z A;  4RAY A;  2MBF A;  1WI9 A;  1YW7 A;  2VT2 A;  3E6B A;  3HYI A;  1IW7 F;  3RPQ A;  2GXB A;  1J9I A;  2DT5 A;  3OOP A;  2PQ8 A;  4UV8 A;  1SD5 A;  1YLF A;  4FHT A;  5A2Q Z;  3L09 A;  1YTY A;  4HV5 A;  1DUX C;  1FYL A;  3TDZ C;  2L01 A;  4Q4Z F;  3MZH A;  4XSX F;  4R8H A;  4BYY A;  1OYY A;  4EV0 A;  1PDN C;  4UUV A;  2ELH A;  4UVA A;  5DEQ A;  2A68 F;  1LDJ A;  3TGN A;  3V7R A;  3KP2 A;  5K5R A;  4BHB A;  4MNU A;  2EWN A;  3BOQ A;  2XIG A;  1UCR A;  3T8R A;  3JTG A;  5CVR A;  2XGX A;  1QBJ A;  2IPQ X;  1L3L A;  1O7L A;  2XAH A;  5HLG A;  1SFE A;  1UHM A;  2V1U A;  3J81 Z;  2HS5 A;  4EJO A;  3DV8 A;  5ILU A;  3SHF A;  2GZW A;  2P5K A;  4G7H F;  3GFI A;  2DFI A;  4WXH A;  2A61 A;  3BWG A;  1FOK A;  2XRN A;  5ICC A;  4KNY A;  2FNA A;  2QZ8 A;  5CYV A;  1XB4 A;  4L5J A;  2XAJ A;  1HBX G;  1A04 A;  4G94 A;  2ISZ A;  2DK8 A;  2DI3 A;  3M8E A;  4ZZL A;  3QRF F;  3IWF A;  1O7F A;  3WTX C;  1BC7 C;  1TNT A;  5LHH A;  4YFX F;  2XAG A;  5DD4 A;  5LHG A;  2STT A;  3L00 A;  2R7D A;  4MEY F;  1IN5 A;  2ZBK A;  4CYD A;  2EV0 A;  1ZH5 A;  1MGT A;  3CLO A;  3MAJ A;  4EVI A;  4IPA A;  4HYE A;  1U5T C;  1H0M A;  3RI4 A;  2HQN A;  3IHU A;  1XGS A;  2VBX A;  4M71 A;  4IHT A;  4OMY A;  4UVB A;  3D0S A;  2PJP A;  1OR7 A;  1KU7 A;  1K78 B;  1HST A;  1H9G A;  4HOB A;  4L9V A;  2JSC A;  2Y75 A;  2VXZ A;  1SD4 A;  1HW1 A;  4EM1 A;  1HKQ A;  3HTU A;  3JTH A;  3L7W A;  5LGN A;  4A0Y A;  2W25 A;  4ENJ A;  4UNO A;  1KU3 A;  1S29 A;  3QP5 A;  5CVI A;  4M9X A;  1ZAO A;  4WXC A;  1YYV A;  2ZCW A;  1T39 A;  2VOP A;  3GZ5 A;  4U7B A;  4OIN F;  3FF5 A;  1QO0 D;  1BI3 A;  4EJU A;  4HLX A;  1IRG A;  4OIO F;  3ZMS A;  2HFH A;  3GF2 A;  4NQW A;  1U5T B;  2M1B A;  4ZYE A;  2FQ3 A;  5FFZ A;  1SMT A;  2NNN A;  5KVR A;  5L3D A;  2HKX A;  4OOI A;  2PN6 A;  4LG0 A;  2FEZ A;  1R58 A;  5ICF A;  4TV7 A;  4LG0 B;  1Z05 A;  4RS8 A;  1P92 A;  1O3T A;  1MJA A;  4HX4 A;  5L3G A;  5E8I A;  1MDM B;  4ON0 A;  5D4S A;  3V7S A;  4OIP F;  1ZGJ A;  2BEO A;  4M6X A;  5FGM A;  2VT3 A;  1SD7 A;  4LLN A;  3WTZ A;  2QYO A;  4XLP F;  1T2K A;  2ZXJ A;  1AWC A;  3DFG A;  5L3B A;  3RYR A;  5CLS A;  4KIB A;  4ESJ A;  1FP1 D;  1YIO A;  3MQ0 A;  2P5V A;  1AOY A;  3WTV C;  2Q8K A;  3RJP A;  3LA3 A;  5DUI A;  2QEN A;  2ZFW A;  2PBI A;  2HOE A;  3LST A;  2EB7 A;  3FXR A;  1J5Y A;  2L54 A;  4MTD A;  2MA3 A;  3E5U A;  3TOB A;  5LHI A;  2RVC A;  4M72 A;  5JFR A;  3K1M A;  1OYW A;  3C18 A;  3QP6 A;  4KMU X;  5JHU A;  3R4K A;  1W7P D;  2XV4 S;  3FX3 A;  3K1P A;  4IHS A;  3HRU A;  3GEZ A;  2R3S A;  4ENN A;  4DNC A;  2GA2 A;  3M7G A;  4AWX B;  2E7X A;  1FSH A;  1J7K A;  3WE2 A;  4Y15 A;  1K7A A;  5LLQ A;  2FMY A;  2NNY A;  3JAM K;  1R36 A;  4N9H A;  4KIC A;  3F6O A;  4QLC U;  3FXQ A;  1PP8 F;  4EM2 A;  3HTS B;  1KYW A;  2FBI A;  2EFQ A;  3K9T A;  3Q5F A;  1KQ9 A;  1T98 A;  3SQN A;  5HOO A;  3ECH A;  2H6C A;  2P6T A;  5LBQ A;  2OZU A;  2NAZ A;  2GA1 A;  1IRF A;  4A5M A;  1KA8 A;  1TNS A;  4LK1 F;  4Q47 A;  4ETS A;  3HUG A;  2EJR A;  1R1V A;  5BPD A;  1YO5 C;  2O8X A;  2L02 A;  1R00 A;  2Y0M A;  1F9N A;  4ENM A;  3ABT A;  4O3M A;  2KIF A;  5BOX A;  1HQC A;  3Q9S A;  2C6Y A;  3P9I A;  1QPM A;  4HF0 A;  2H27 A;  5BMZ A;  2M30 A;  2IT0 A;  3E6M A;  4HX7 A;  1G3W A;  2LF7 A;  4G6D A;  1ZG1 A;  1TW3 A;  2QWW A;  4ZYH A;  1QQI A;  1ZLK A;  3V8L A;  3IC7 A;  1RNL A;  3IRQ A;  4AVP A;  1B6A A;  2JRT A;  3R61 A;  5DDG A;  1J59 A;  4UV9 A;  4IRG A;  3NRV A;  1ZN2 A;  2YR2 A;  1R5H A;  3RTR A;  3PQJ A;  2LF8 A;  2JPB A;  5DD8 A;  3ZN1 A;  2KJC A;  2D45 A;  1FP2 A;  4PGG A;  1BM9 A;  5D6F A;  5DCM B;  2PLY A;  4MEX F;  4A5N A;  3U2R A;  1J0R A;  5E17 F;  1STZ A;  2FXA A;  2V1D A;  2KJB A;  4RGX A;  2COM A;  5FO5 A;  3CO7 C;  3RDI A;  4KN4 X;  3F72 A;  4KT5 C;  2IJL A;  1JHF A;  3F22 A;  1K79 A;  1HXD A;  4WCG A;  1XGM A;  1BN5 A;  3O6B B;  2DPD A;  4BHC A;  3KEQ A;  1S7A A;  4N0B A;  4I7H A;  4HF1 A;  4DQ2 A;  1Z91 A;  5E1X A;  4LLG F;  2YU3 A;  3KCC A;  3ZP5 A;  2AS5 F;  2VC0 A;  1OMI A;  2BYV E;  4GXO A;  1L0O C;  2OA4 A;  3BP8 A;  2CSO A;  2QVO A;  2L4M A;  2ZME A;  1W7P A;  2FA5 A;  1S8N A;  4I02 A;  3WGH A;  2ZME B;  5LRS A;  3RIR A;  2YX4 A;  1FT9 A;  5LGT A;  5AON A;  2OZ6 A;  3J80 K;  1B4A A;  2XUB A;  3F8B A;  1G3Y A;  2X0L A;  3KFW X;  3E5X A;  4L9J A;  4K2E A;  5FFX A;  2PMU A;  3PFI A;  5CVU A;  1REP C;  5J8F A;  2CQK A;  4U0V A;  1FWZ A;  4OMZ A;  4A6D A;  4Y13 A;  1CF7 B;  2ZNY A;  5ILS A;  4G8X A;  4L0Z B;  4H0E A;  2OQR A;  2P5L C;  1XSD A;  2V9V A;  1LEA A;  1YFH A;  2XHK A;  4ASN A;  5HS7 A;  2IA1 A;  4I01 A;  2H6B A;  3B02 A;  5CJ9 A;  4LJZ F;  1BI1 A;  2A07 F;  3DPT A;  3TOA A;  4I09 A;  3GLX A;  4WK8 F;  4KMF A;  4I0A A;  4CHU A;  3WGI A;  2ESH A;  4CDG A;  4Q48 A;  2QQA A;  3C7J A;  1I1S A;  1SAX A;  4LGW A;  3EUH A;  3GO5 A;  3P7N A;  1IAW A;  4U88 A;  1XGO A;  3F8M A;  1LVA A;  4EMS A;  4YIF A;  1JE8 A;  2CG4 A;  3W6J B;  1VTN C;  4KIF A;  1WQ2 A;  2PEX A;  1RUN A;  2UWM A;  1UST A;  1XDU A;  1SFX A;  1G6N A;  2CGP A;  4M73 A;  2NRA C;  3ECO A;  4CO8 A;  3FWE A;  1ZRD A;  2XAQ A;  4IF4 A;  3IWZ A;  4IRH A;  1XCB A;  3SXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...