5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
molecule keywords AspA
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
3FMRA 4QWQA 2QYOA 4NQWA 3F8NA 3BPVA 3U9GA 1YS6A 5BPIA 2P6SA 5LGUA 4O3MA 2K02A 3F8CA 1W7PA 3F6OA 5HVQC 1U8RA 5LEKA 2ESHA 4G94A 1QNTA 1DP7P 3WODF 3I53A 3G3ZA 2Y48A 4RS8A 4XSXF 4OU0A 3WG9A 3WTTC 2L01A 4P5OA 1T0FA 4KMFA 5D5UB 2H6CA 1SD7A 1B9NA 1HQCA 4EJWA 2OZUA 5JR3A 3CO6C 3K9TA 1HXDA 2COMA 2JPCA 4EM0B 2P5KA 2H6BA 3RPQA 1P2FA 3TDUC 2FMLA 1R22A 2L3DA 3CUQB 5D6FA 3RYPA 4Q5SF 5D8LB 2J5PA 4KA4A 4KICA 4UXNA 5E8IA 4GGGA 4KIFA 4U0YA 2EFNA 1XGMA 1D3YA 3IC7A 2ZMEA 4ENMA 3T5XA 4IPAA 5D8KB 3TKYA 1ONVA 5D4RA 1D5VA 4L5IA 4ZZDA 3JTGA 3IWFA 1I1SA 2QUFA 5FO5A 3K0LA 4ENKA 2O3FA 4DQ2A 1HSJA 2G7UA 1SFUA 2RN7A 4HAMA 3MAJA 3ZMVA 2HQNA 2ADUA 4IRIA 1O57A 4P55A 4HW0A 4RAZA 1KQ9A 3GLXA 3RKXA 3L2CA 1BI0A 2W85A 2MA3A 2UXXA 2IA1A 1XMKA 3ZQ7A 5BPDA 1KU3A 1K78B 1R1TA 1FWZA 2WWYA 1ZYRF 1IXSB 2RQPA 5FFXA 2L02A 1RI7A 5D5WB 1ZG1A 2K27A 5L3GA 1UB9A 2AXLA 2LKPA 4ZYHA 3KEQA 5JHUA 1SD4A 1TBXA 4D0PA 1YIOA 1ZH5A 4PZJA 1I5ZA 1W4MA 4A5MA 4LK0F 2BBYA 5H6QA 3HRUA 1BN5A 3ZN0A 2OU2A 1X3UA 4I09A 1G3WA 2NNYA 3GF2A 1PDNC 3V7RA 4RGSA 4G7HF 4L5JA 1T2KA 1IRFA 3K1PA 2H09A 4HDUA 1BOAA 2XRNA 1KU2A 3E5QA 4ESBA 4H0EA 3ROUA 1QQIA 4L9VA 2YX4A 2QQAA 3HSRA 4BXUA 4I0BA 3DKWA 2JRTA 2K4BA 3NRVA 2ZNYA 3B02A 3N4MA 1L0OC 1TNSA 4ZH4F 1OYWA 1TQPA 5K5RA 3K69A 3V4GA 3QOPA 3WU1B 4DNCA 1KA8A 2Q0OA 1O3SA 1U2WA 2VBXA 2LF7A 1BC7C 1BM9A 5DEQA 4K2EA 3RIRA 3R4KA 2L4MA 5TJJA 1Y0UA 3WTZA 1WRJA 3F21A 3LAJA 1FP2A 4WCGA 5BOXA 1F9NA 4CXFA 2DTRA 2LDUA 2PMHA 2VC1A 2KJCA 3PQKA 2HYFA 1J9IA 2UWMA 4B09A 1OKRA 1A04A 3QP6A 2HTSA 1IN7A 4G7ZF 4JBAA 5H20A 5CLSA 5CVIA 2BYVE 1W7PD 5LRRA 2WTEA 1ZRCA 3DXJF 3LAPA 1YO5C 3HOTA 3RTRA 4ESFA 5FD6A 3IRQA 1XGOA 3HTUA 3HHHA 3KZZA 5CJ9A 3VEPA 4I7HA 4F7ZA 1FLIA 2XAQA 3KLOA 4KYWA 2MH2A 1SFEA 5K5QA 2VE9A 5DD4A 1USTA 1K79A 1JXSA 3DEUA 1FZPB 3KEOA 4EVIA 3BDDA 3I71A 4PDKA 1B59A 3G73A 4M73A 3J80Z 3GZ6A 1L3LA 2KRFA 1EH6A 4PGGA 3PQJA 2XROA 5ICGA 4S04A 2ISZA 2V79A 3SHFA 1EH8A 3RPUA 3Q9SA 2PLYA 2O0YA 3ZMSA 2HYGD 4EGYA 3CUQA 3E6MA 3L00A 4O6JA 5ILSA 2ZFWA 4HF2A 2FF4A 4UVCA 4MEYF 1WKMA 1S29A 2OZ6A 5HLIA 5D6EA 5FGMA 3J7AO 1I6XA 4G7OF 4BNCA 4U7BA 3QU3A 2E7WA 2FBKA 4RGUA 3GYHX 2QENA 4HZFA 2W25A 3LA3A 1T38A 2PG4A 2W84A 3DPTA 1ZG3A 2K7LA 5E1ZB 3QRFF 4LG0A 3HSFA 2DT5A 1DPRA 3QU6A 1YLFA 1YFHA 4LLLA 3ZP5A 1NHAA 2EFQA 2JT1A 3T8TA 3KLNA 3I58A 5HDKA 1QZZA 1BI2A 4CO8A 1W5SA 3H3ZA 3GFIA 2D2WA 1YW9A 3KP2A 2ETHA 1ON1A 3TO9A 1MKMA 2KJBA 4UHTA 5BMZA 2BEOA 2XUBA 4WF2A 4Q47A 3GXOA 4PCQA 4LG0B 3TGNA 5E1XA 4IRGA 2STWA 2EV0A 1FT9A 3LA2A 2NS0A 4LJZF 4HV5A 4R79A 1H9TA 3ISPA 2FQ3A 2E7XA 4A0XA 3BROA 2PEXA 3KETA 3COAC 2WV0A 4MQ9F 4UVAA 4M6YA 5LGTA 5HOOA 1T39A 2EFOA 1BJAA 3JAMZ 1BI3A 2HQRA 3O6BB 2W24A 1FNNA 4UUVA 3VB2A 1DDNA 3ABUA 3RI4A 3ELKA 2GIVA 2DI3A 2V1XA 2P7CB 3MEXA 2YU3A 3MWMA 1R58A 1P4XA 3DPLC 4KUMA 4OINF 4HLXA 5CVJA 5FLXK 3I54A 2M30A 2A68F 2O61A 1R23A 4HDVA 2DBBA 3MZHA 3KFWX 4MHGA 1W7PB 4WXDA 4YG2F 1GHCA 3R6SA 3KP6A 2V1DA 2L4AA 1B6AA 4CHUA 2DW4A 1IXCA 4Y15A 5JI6A 1KYZA 1ZGJA 4ZZLA 1HW2A 4HQMA 2NYXA 4L9JA 3ULQB 3T1BA 1LQ1A 1H9GA 1P6RA 5ILUA 1S7OA 4YIFA 1CF7B 3FWEA 3JAMK 5E18F 2KIUA 3BJOA 4L9NA 2FOKA 4P9UA 5LEJA 2DK8A 4MQVA 2JZYA 2ZJ2A 1S3JA 1E2XA 1WSUA 4M74A 2XHKA 1XN7A 2HKXA 1P4AA 1Z7UA 2NNNA 1Z05A 2ZXJA 2RGVA 3REOA 3TDZC 4EJVA 3E5XA 4CYDA 2EJRA 4OMZA 4UV8A 4P9FA 2Q2EA 3GUDA 2Z3YA 4HA8A 2OD5A 2GA2A 3LQRA 1XD7A 3C7JA 3ZMUA 4IJAA 3CDHA 4M9SA 1MDMB 2K4JA 3IHUA 1YW7A 3RKYA 4Q4ZF 1XCVA 3KP4A 3CO7C 4MTDA 2HKOA 3LWFA 3HYIA 1SMTA 2FU4A 2KIFA 2Y0MA 2YX7A 5LHIA 2MLKA 3M8FA 3F8MA 3MZYA 1F4KA 1J2XA 2Z5UA 2M8EA 4OIQF 4LB6B 2A69F 4MEXF 3F8FA 1QGPA 1USSA 2DFIA 4CDGA 1FPQA 1QZYA 2A61A 4ENJA 1B1BA 2HGCA 3GZ5A 5J8FA 3FXUA 2CO5A 3DFGA 1WWXA 1ZRDA 1Z1DA 5CYVA 4BHBA 4HLYA 3BJ6A 4G6DA 4KFCA 1S7AA 1P92A 3E6DA 1YTYA 3JSOA 1ZRFA 5FFZA 1FYKA 1FBSA 3V8JA 1DPUA 2GQQA 1KGSA 3V8KA 3C1DA 3HRMA 2RNJA 2IA2A 2ISYA 2ESNA 1G4DA 2H27A 1H0MA 2H94A 2IJLA 2WC2A 2XAJA 3F3XA 1ZGAA 1HW5A 5ICFA 1BI1A 5HLHA 1K7AA 2UZKA 2A5YB 1U6GA 3N97A 3D5LA 2OBPA 3AAFA 4FT8A 1YQAA 2MD5A 2HS5A 2P5VA 2EWNA 4G6QA 2F5DA 2RC4A 1RIOH 1HSTA 4M9XA 3IWZA 4OMYA 4IRHA 3SFZA 4A0ZA 5K1YA 2EV5A 4I0AA 3M7GA 3H92A 1IN8A 2RKHA 4EV0A 2XKPA 3FXRA 1LDDA 4ZYGA 5L3CA 5J6XA 5JFRA 4M72A 1TW3A 2YPRA 2VT2A 2Q8KA 4L9TA 4YFKF 1K6OA 3ML6A 5ERIA 1XDUA 1CF7A 4G8XA 5ED4A 1IN6A 3S2WA 4ZYEA 4UV9A 2CWEA 4O5VA 4FHTA 4NHJA 1IRGA 4BAYA 1SD6A 1ZAOA 4I01A 2JPBA 4I02A 1YS7A 3R0AA 4UVBA 1DUXC 2FMYA 2VC0A 4A0YA 2HFHA 1IF1A 1LVAA 1KU9A 3TOAA 2VONA 3ZMTA 3CUQC 2C6YA 4GYIA 5BQTA 1OMIA 2D1VA 2P4WA 1KYWA 5L3EA 1U3EM 1EH7A 4KT5C 4EGZA 1S6LA 1QO0D 4LD5A 1XB4A 1ON2A 2PFBA 2QBYA 1LDKB 3FMQA 1MDMA 1ZN2A 4JK1X 1HBXG 3Q5FA 2XASA 4OOIA 4KIBA 1D8KA 1I27A 1C0WA 2P7VB 3NQOA 1OYYA 1JGSA 3M1EA 5IT3A 1O3RA 2V9VA 2IRFG 4BHCA 3JSPA 4HV6A 3SZPA 4HBLA 4HX8A 4U88A 2IW5A 1FOKA 2M5WA 1VTNC 1KU7A 2ZBKA 3JW4A 2DQRA 3IL2A 3TQNA 3SZTA 1HKQA 4A2UA 5HDNA 2DPDA 2RV8A 1ODDA 5AIQA 2QVOA 2DPUA 3HIFA 1LNWA 1O7FA 3BP8A 5F64A 1F1ZA 1XSVA 3SQNA 1SMYF 1LEAA 3HHGA 1CGPA 1F5TA 4YIIA 2Z33A 1GVJA 2CFXA 3KZYA 2M87A 3R61A 3KE2A 2P8TA 2HTJA 2F2EA 2JSCA 5ICEA 1KQ0A 1UHMA 2VOOA 3O2PE 5ICCA 4RAYA 2TDXA 4LMYA 3HRSA 3ZMDA 4LGWA 3GFMA 5E17F 2FRHA 2D45A 1JHFA 4OIRF 3RDIA 4RGXA 1V4RA 3FZVA 3CJNA 3L9FA 5IT9K 5LHHA 3F23A 1HKTA 2K86A 4HX4A 3I5UA 4YFXF 3F72A 4G9YA 4MTEA 1LDJA 1U78A 4WXHA 2YR2A 3WGHA 4MGRA 3PFIA 2GWRA 2DU9A 3W6KB 1U5TB 3I0TA 2A6EF 1IAWA 3F22A 3GO5A 2M45A 5DUKA 2LSOA 3K1NA 3GWZA 4E70A 4FX0A 1OYIA 2CW0F 3CLOA 3T0YA 3TO6A 4L0ZB 1TLHB 4Y17A 3EYIA 4WK8F 3J80K 4ON0A 2EK5A 1J7KA 4NB5A 4RB0A 3B73A 1YW8A 4GCVA 1ZREA 2FE3A 3DV8A 2IT0A 4U0VA 1O3TA 4EJOA 3QPHA 4HX7A 2GZWA 4CGZA 1TNTA 5LRSA 4WWCA 3R0JA 3TOBA 1XDSA 3ERED 2G9WA 3OOPA 3CTAA 2Z99A 3WGIA 3I59B 3LQQA 5FD5A 1FY7A 4IF4A 1B9MA 3J81K 4P96A 4M71A 1I1GA 3BPXA 3VFZA 5DCMA 2UXNA 4ZYDA 2VXZA 5HS8A 2E1CA 3KP7A 3E5UA 3QPTA 4IHSA 1FSHA 5LBQA 4HOBA 3FM3A 4IHTA 1R36A 4KMUX 3E97A 2ZO4A 1ULYA 3IRRA 1QBJA 2EA4A 4B8XA 4L18B 2PMUA 2QBYB 1QPMA 5K5OA 4MNUA 3HOSA 3OV8A 2VBYA 2VN2A 1Z6RA 2BE5F 1JE8A 2FSWA 3CUOA 1BC8C 3BOQA 4I2OA 2R7DA 2FEZA 4KN4X 3V7SA 3EDPA 3GEZA 1Q1HA 2PI0A 3W6JB 3WTYC 1ZLJA 3C3WA 2CQKA 4AWXB 5D5XB 1IW7F 1HW1A 1JHHA 1MZBA 4HF0A 2YSRA 2VOPA 5DCFA 1FYLA 5TRDA 1FSEA 3HSEA 1GXQA 1Z91A 4EJUA 4KNYA 3ZPLA 3E3VA 2A3SA 4KN7X 3ECOA 2KKOA 1HKSA 1XSDA 2GAUA 1REPC 3RJPA 2FNAA 2GXGA 4CZZA 5FLXZ 3KP5A 5AIPA 3VODA 2OA4A 1Z9CA 3EUHA 2HEOA 1J0RA 2MLGA 3R60A 2KIMA 3K1MA 5L3BA 2VBWA 2VE8A 3GVAA 5D4SA 3WTXC 1YYVA 2PJPA 2LF8A 1TQMA 3WE2A 2E1NA 3U2RA 2STTA 5IT9Z 2G7HA 3L7WA 3DP7A 4OIPF 1G3YA 1UHWA 2XAGA 4TV7A 3F6VA 2XAFA 4ETSA 4Q48A 1UCRA 1K78A 2CYYA 3E6CC 3U1DA 5HLGA 3WTSC 1XCBA 5E20A 4AIHA 2O8XA 1KQ8A 2D1HA 3RYRA 4A5NA 1R1VA 4RB1A 3EYYA 2MH9A 3VOEA 5KVRA 1WI9A 2FBHA 2ACJA 1MGTA 3HTSB 5HDGA 2LNBA 3RKWA 3KP3A 1OR7A 1OPCA 3GFLA 4U0WA 2XGXA 2VT3A 4EMSA 4LB5A 4I98B 2OAZA 1LB2A 1B4AA 2R3SA 2NRAC 3F8BA 1G3TA 5LGNA 4LLNA 4A6DA 1E17A 4BYYA 4N0BA 2V1UA 2F5EA 2AS5F 4AVPA 2DK5A 4RB2C 2XAHA 4RGRA 3WTUC 1RZ4A 1T98A 1LJ9A 2XVCA 3BJAA 5D5VB 5EEHA 2XV4S 2O6GE 4U7DA 4PGHA 2ZKZA 2FXAA 1RNLA 4R8HA 2GXBA 3C18A 4OIOF 4L0YB 3GX4X 2EFPA 2XIGA 1R7JA 1BIBA 3ECHA 5KK1A 3P7NA 2ELHA 2HWVA 1BBYA 5EEGA 1J59A 5DV5A 4JQFA 1J75A 5DYMA 1FC3A 2QLZA 2QQBA 4M9ZA 2IPQX 4BQAA 1IZ1A 4CICA 5A2QZ 3I59A 2F5FA 1R5HA 3KCCA 3H3UA 3ZN1A 3BY6A 3MQ0A 2X4HA 5DCMB 3D0SA 4EQQA 2HZTA 2PQ8A 1R00A 5CVRA 1ZG5A 1EV7A 3WE3A 1GXPA 1FBQA 2X0LA 4LFUA 3FMSA 1PP7U 3FM5A 2Y75A 2GA1A 2EA2A 4EJTA 5CVVA 4LK1F 1R1UA 2ZCWA 3P9IA 2DAOA 2Z9OA 2F5CA 1PUEE 1W5TA 1IUYA 1D8JA 1T6SA 3ABTA 3L09A 5L3FA 3E6BA 3V7CA 4ESJA 1O7LA 2R7FA 1V3FA 5ILVA 2L54A 1FX7A 3JTHA 1TQIA 5E8GA 5A2QK 1XGNA 2BGCA 3GW2A 4Z2YA 3WGGA 2QM3A 4A6EA 1XMAA 1Z6TA 1TW2A 5J8CA 1AWCA 3M8EA 3FF5A 2DQLA 2QWWA 2W57A 4HYEA 1BIAA 2V6CA 3O3KA 5LHGA 4BHPA 2NAZA 1S8NA 4N9IA 2M1BA 2IA0A 1TTYA 1J5YA 1FP1D 4RB3C 3WU0A 4LLGF 1MJBA 3I64A 1XSXA 2A6HF 1U5TA 1YG2A 1MJAA 2HDCA 5DUIA 1XGSA 2CGPA 2IP2A 4ASNA 1IN4A 1AOYA 3FHZA 4S05A 6PAXA 1LEBA 4YFNF 5HS9A 2A07F 2MBFA 2IVMA 3EQLF 5E1WA 3P9CA 3TO7A 2VBZA 4XLPF 2DO7A 3J81Z 3GFJA 5AONA 3LFKA 4XSZF 4WX9A 4HQEA 4WXCA 2O03A 1RUNA 5DD8A 3LSTA 1IXRC 4UNOA 3BWGA 2MC3A 2QZ8A 1P4WA 1SD5A 2FBIA 2OQGA 4GXOA 4M6XA 3MCZA 4N9HA 2VODA 4AIKA 3NEUA 3LA7A 3DF8A 1RUOA 3IKVA 5F1RA 2QQ9A 4BH9A 5F6FA 3QP5A 5FB2A 5L3DA 2OQRA 4ENNA 3HUGA 5HS7A 1G6NA 2HR3A 1SFXA 1WQ2A 1ZLKA 3FXQA 2P6TA 2P5LC 3ZMZA 2RDPA 3K2ZA 3EETA 4HF1A 4IVNA 4EM1A 4EM2A 1R5GA 2FA5A 5JVTA 2RVCA 4XLNF 1U5TC 2ZMEB 4FX4A 5CVUA 4KIGA 4XBFA 3WTVC 3MFKA 1G3SA 4XRFA 3V8LA 2HOEA 3T8RA 3HRTA 1MJ9A 3SXYA 4IXAA 3FX3A 1SAXA 2PBIA 2PN6A 2EB7A 1STZA 5LLQA 3DQVC 3WTWC 1ZHFA 2BV6A 3Q9VA 2B0LA 1ZARA 4A12A 1FBUA 5DDGA 2XKOA 3I4PA 2CG4A 1IN5A 3BZ6A 3IKTA 4Y13A 4R1HA 1MD0A 3QAHA 1UFMA 2J5OA 4AIJA 2EV6A 4QLCU 2EFWA 3P9KA 5H6RA 4KDPA 4AD9A 3M9AA 2DLLA 4GYGA 2JTVA 4GO1A 2CSOA 2FNPA 5BS6A 2ZNZA 1O3QA 1PP8F 1FYMA
chains in the Genus database with same CATH superfamily
3FMRA 4QWQA 2QYOA 4NQWA 3LOCA 2M8GX 1Z7LA 3F8NA 3PIOF 3BPVA 3U9GA 4BKXA 1YS6A 5BPIA 2P6SA 5LGUA 4O3MA 3L2WA 2IS2A 2K02A 3F8CA 4D1QA 3QQAA 2BVLA 2HU9A 4DBRA 1W7PA 3F6OA 1U8BA 2VIXA 5HVQC 2IGKA 1VQ9I 1U8RA 2QCOA 5LEKA 2ESHA 4G94A 1QNTA 1DP7P 2XGEA 5F0HA 4Y7NJ 3WODF 3I53A 3G3ZA 2Y48A 1WJBA 3K7AJ 4RS8A 2AQEA 4XSXF 4OU0A 2DDBA 3WG9A 3WTTC 2L01A 4P5OA 1T0FA 4KMFA 5D5UB 3HOWJ 2H6CA 1SD7A 3AG1H 1ZR4A 3CF5F 4RAGA 1B9NA 1HQCA 4EJWA 2OZUA 3OSGA 1UAAA 5DM6F 5JR3A 4XK4A 3CO6C 3JRIA 1YOVB 5JVGF 3K9TA 1HXDA 4RA2A 2COMA 2JPCA 4EM0B 1F43A 2ECCA 2P5KA 4FISA 1WVRA 2H6BA 3RPQA 3K4JA 2BVMA 1P2FA 3TDUC 2FMLA 2KP6A 1R22A 2L3DA 3K4KA 3CUQB 2L9VA 5D6FA 3RYPA 2LFBA 4JP0A 1VQLI 5D8LB 2J5PA 2G0EA 3JRDA 4KA4A 4KICA 4UXNA 4Q5SF 5E8IA 4GGGA 4KIFA 4U0YA 2EFNA 4IOAF 4XKVA 1XGMA 2W82A 1D3YA 2BW3B 3IC7A 1Y6IA 2ZMEA 3U21A 4ENMA 3BG7A 3BG5A 3T5XA 3FDYA 2K85A 4XM3A 2LY1A 2QF7A 4IPAA 3RPUD 2ZB9A 3TKYA 5D8KB 1ONVA 5D4RA 1D5VA 2R4GA 4L5IA 4ZZDA 2HVSA 4IHXA 1PUFB 5CQGA 3LSPA 3JTGA 2R7WA 5B3SH 1G59A 2DMTA 3IWFA 3KZIC 4HSTA 1I1SA 2XRLA 2EH3A 2QUFA 5FO5A 3K0LA 4ENKA 2CH0A 1RR8C 2O3FA 5B66C 3OY9A 2VASA 4DQ2A 3OIQA 2DA2A 1HSJA 2DA3A 2G7UA 1SFUA 4RBOA 2DFEA 2RN7A 4HAMA 3MAJA 3ZMVA 2HQNA 1UHSA 4RAFA 4CA0A 2KRCA 1OCZH 4FCYA 3PM1A 3HKZN 3DLAA 2H8RA 2ADUA 2MYSA 4IRIA 1O57A 1YHQI 4P55A 4HW0A 4RAZA 4GDFA 1KQ9A 3GLXA 1POGA 2WA0A 3DBRB 3RKXA 5HNFA 3L2CA 3S93A 1BI0A 2A5WA 2A6TA 5FKNA 1GDTA 2W85A 3FKIJ 3CC4I 2MA3A 1XG1A 2UXXA 1LVKA 2IA1A 5GP9A 2HZDA 1XMKA 2H1KA 3ZQHA 3ZQ7A 5BPDA 2F4MB 1KU3A 2R7TA 3OYJA 1P9QC 3H36A 2OTJI 1X58A 2Q2EB 2XGCA 1K78B 1R1TA 1FWZA 2DFFA 2WWYA 1ZYRF 1IXSB 2RQPA 5FJ8J 5FFXA 2L02A 4C2UA 3OS1A 1ZQ3P 3PNYA 1RI7A 5F1JA 2LD5A 5D5WB 1ZG1A 2K27A 5L3GA 1QVUA 1PUFA 1K83J 1YJ9I 2FX0A 1UB9A 2AXLA 1OCRH 3FISA 1MBHA 5CKTA 2LKPA 1VQ7I 4ZYHA 4V2FA 5EG0A 3KEQA 3OR1C 3E0JB 3ZXSA 3S3NA 1AHDP 3BR3A 5JHUA 1TL8A 1SD4A 1TBXA 3DTEA 2QSFX 4D0PA 1X3WB 1ITYA 4KITB 1YIOA 3BG3A 1IJWC 1ZH5A 4PZJA 2JSPA 1I5ZA 1W4MA 4A5MA 4LK0F 2BBYA 3I4NJ 5H6QA 3W2AA 3HRUA 2Y0SA 3RSNA 1BN5A 3ZN0A 4A3FJ 1JT0A 2OU2A 3IP4B 3B6CA 1X3UA 4I09A 2JN6A 1G3WA 5GTHC 2NNYA 1E0EA 4IQJA 2IAIA 3GF2A 3GTGJ 1A35A 3N05A 1PDNC 3LMMA 3V7RA 4RGSA 2GM4A 2X51A 4G7HF 3K4MA 4L5JA 5J4VA 1T2KA 1IRFA 3IH2A 3K1PA 2CW7A 4XN0A 3BT9A 2H09A 4HDUA 1Z3XA 5IPAA 1BOAA 2DA6A 1KU2A 2AHQA 2XRNA 3E5QA 3K2AA 4CCMA 4ESBA 2IS4A 4GRIA 4H0EA 3ROUA 1MNMC 3BR2A 1QQIA 1SVOA 4L9VA 3HSRA 2QQAA 2YX4A 3TL4X 1HA8A 4BXUA 1GVDA 4I0BA 3DKWA 1S5LC 3E7LA 2JRTA 2K4BA 3NRVA 5FKMA 2ZNYA 4A3EJ 2R7OA 3B02A 3N4MA 1L0OC 4CCNA 2JA5J 1TNSA 4ZH4F 1OYWA 1TQPA 4W97A 1LE8B 3I56I 3QOEA 5K5RA 3I9V2 3HDDA 3K69A 3V4GA 3VYRB 2EZKA 3QOPA 3WU1B 4DNCA 1KA8A 2X6YA 2Q0OA 1O3SA 1D0ZA 1Z0XA 1U2WA 2IBDA 2LH9A 3L1PA 2VBXA 2LF7A 5IYBJ 1BC7C 1BM9A 5DEQA 2M7BA 3H5AA 3UKGA 4K2EA 1W5CC 4PJJA 3RIRA 5DS9A 3R4KA 2BZTA 2L4MA 3K70D 2NS7A 1A6QA 5TJJA 3DTIA 3OWTA 1Y0UA 3WTZA 5GPCA 1WRJA 2M4GA 3F21A 3LAJA 2OCCH 3ZRGA 1FP2A 4WCGA 5BOXA 2PJRA 1F9NA 2DTRA 4CXFA 2K9NA 2LDUA 2PMHA 2VC1A 2KJCA 3S3MA 3PQKA 2BY0A 2HYFA 2K9QA 1J9IA 2P81A 4BQQA 2UWMA 2UV1A 3KYDB 3LSKA 4B09A 1OKRA 1A04A 2O9LA 2MG4A 3S1NJ 3QP6A 2HTSA 4A3JJ 1IN7A 4G7ZF 4JBAA 3F9KA 5CLSA 5H20A 5CVIA 2BYVE 3EUKL 1W7PD 5LRRA 2VB6A 2WTEA 1ZRCA 3DXJF 3LAPA 1YO5C 3HOTA 3RTRA 4ESFA 5FD6A 3A4CA 3IRQA 1XGOA 1TWHJ 3HTUA 4UUSB 3HHHA 3KZZA 5CJ9A 3VEPA 3IH4A 5IP7J 3AG3H 5LD2C 4DGWB 4OAZA 1QZEA 4I7HA 4F7ZA 3LSJA 3SYTA 2OUMA 3BTIA 1FLIA 2XAQA 3KLOA 2HYJA 3OL3A 4KYWA 2MH2A 1SFEA 2NVYJ 5K5QA 5CQEA 3CCVI 2VE9A 3BC8A 1T08B 5DD4A 4PJLA 1USTA 5IYDJ 1K79A 1JXSA 1H89C 5JLWA 3DKXA 2VXDA 3DEUA 3DWLE 1FZPB 3KEOA 4EVIA 4NC8A 2F48A 3BDDA 2VKDA 2WAEA 3I71A 4XKWA 2LP0A 2DMQA 4M3FA 1RRJA 1H8AC 4PDKA 1B59A 3G73A 4M73A 3J80Z 2QSGX 3QPLA 3GZ6A 1VQ4I 1L3LA 2MGQA 2DODA 3K4BA 2KRFA 1A36A 1I6HJ 3PSFA 1EH6A 4PGGA 2DA5A 1SANA 3CCEI 1MBFA 2W4SA 3CCUI 3PQJA 1SAUA 2XROA 2E2IJ 5ICGA 1YJNI 4S04A 1P7JA 1X1DA 2ISZA 2XSDC 3B6AA 2V79A 3SHFA 1EH8A 3RPUA 3HOXJ 3Q9SA 2PLYA 1R4NB 2O0YA 2UUZA 3ZMSA 4AUXA 5C4XJ 4M6VA 2HYGD 4EGYA 1AU7A 3CUQA 4V19K 3E6MA 4RLFA 5IOZA 5E3LA 1UMQA 3L00A 2EIJH 4O6JA 5ILSA 5EYRA 2ZFWA 4HF2A 2FF4A 2LYCA 2VQHA 2O7OA 4UVCA 3A1YA 1WZ2A 1MBJA 4MEYF 1YRNA 2PX9A 1WKMA 1IRXA 4DJAA 4A3GJ 1S29A 3OS2A 2R93J 2FOWA 2OZ6A 5HLIA 5D6EA 5FGMA 2ZJQF 3K4NA 2R7UA 1MNDA 1ZR2A 3J7AO 1I6XA 2VPLA 3SEQA 4G7OF 2R5ZB 4JOMA 4BNCA 3QU3A 4U7BA 2E7WA 2FBKA 4RGUA 3CJTB 1ETOA 2DJNA 4XONA 3GYHX 2QENA 4HZFA 2W25A 4MFDA 1WPKA 3PIPF 2BHYA 3LA3A 3S2DJ 1T38A 2PG4A 4NUBA 2W84A 3DPTA 4ABZA 2ICWG 3U1KA 3S8PA 1ZG3A 5KNLA 2JUCA 2K7LA 5E1ZB 5E79C 2XPWA 3QRFF 3AG4H 5E3OA 4LG0A 1A5JA 4BY1J 3HSFA 4XORA 1IDZA 2DT5A 2R7XA 3BQZA 1DPRA 3QU6A 2XB5A 3BQYA 5M3MJ 2ZSIB 1YLFA 2COBA 4YIRX 1YFHA 2X1EA 1NG7A 4LLLA 3ZP5A 4LG3A 2R5YA 1NHAA 1PYVA 2EFQA 2JT1A 5J1RA 1ENHA 3T8TA 3BTJA 1ORKA 3DU5A 2JVGA 3KLNA 3I58A 5HDKA 1QZZA 1BI2A 4CO8A 1W5SA 3C2GA 3H3ZA 3ZR8X 3GFIA 2D2WA 2MABA 3QYEA 1X1PA 1YW9A 1MMNA 2KZVA 3KP2A 4JX4A 4PJNA 2HDWA 4B48A 1WHUA 3CC2I 3TP0A 2ETHA 1ON1A 1XPXA 4L5EA 3TO9A 1IO2A 3VYSB 1MKMA 2KJBA 3HPHA 2LREA 4UHTA 4IHYA 1GUUA 5BMZA 2BEOA 2HVQA 4C3HJ 4MIMA 2OTLI 1OJLA 2K5CA 3ASNH 2EPFA 2XUBA 4WF2A 4Q47A 1JUSA 3GXOA 4PCQA 4CCKA 4LG0B 3BZKA 3TGNA 5E1XA 4IRGA 2STWA 3S15J 2DA1A 2CMPA 2EV0A 3KPHA 1FT9A 2VJJA 4DZJA 1E3OC 1TP4A 3HB9A 4LOCA 1LE8A 4A3KJ 2QSHX 3LA2A 2NS0A 4LJZF 4HV5A 3VSLA 4R79A 1H9TA 3ISPA 4F3QA 3TBIA 2FQ3A 1OQYA 2E7XA 3CJQB 5IOYA 4A0XA 3BROA 3ZQGA 2PEXA 2KDZA 3KETA 2DT6A 2VKVA 3COAC 1R49A 2WV0A 1Z77A 3BR5A 4MQ9F 4UVAA 4M6YA 5LGTA 5HOOA 1FIPA 1W36D 2FJ1A 1MH3A 1R71A 1T8IA 1T39A 1ACIA 2EFOA 5FLVA 1BJAA 1RESA 3JAMZ 2JA8J 1BI3A 2HQRA 4KISA 4G6TB 1WJDA 3O6BB 2GBYA 1LFBA 2W24A 2Y9ZA 1FNNA 4BE1A 4UUVA 2LG4A 3VB2A 1DDNA 2XGDA 3G1OA 5B5EC 1ETYA 3ABUA 5FKKA 3RI4A 2X1CA 5J1UA 1X3ZB 3ELKA 2DYSH 2GIVA 2DI3A 1W36C 2V1XA 4HEA2 2P7CB 2V26A 3GTOJ 3MEXA 2YU3A 1LFUP 1ETXA 3MWMA 1R58A 4RM3A 3CLQA 1P4XA 4RDUA 4DIQA 3DPLC 3HEFA 2VQLA 4JYKA 4KUMA 4OINF 4HLXA 5CVJA 1ZK8A 2XAUA 4XKBA 5FLXK 3I54A 4F55A 1YITI 2M30A 2A68F 2O61A 1BOBA 1R23A 3CCSI 4KJZA 4HDVA 2DBBA 3MZHA 3KFWX 3I3LA 1Y39A 4MHGA 2QKMB 1W7PB 4WXDA 4YG2F 5C4JJ 1GHCA 3R6SA 3KP6A 4HSRA 1MIJA 2TCTA 1XTAA 1B72A 2V1DA 3CDLA 4J00A 3CESA 1MBKA 2L4AA 4CSWA 1ZGWA 2DMUA 1MMSA 1B6AA 4CHUA 2DW4A 2KRHA 4ZDOA 1IXCA 5J3LA 4M3DA 4Y15A 5JI6A 3MKZA 3GTQJ 1KYZA 1ZGJA 4ZZLA 5A2QK 1HW2A 1V5GA 4HQMA 1UJ8A 2NYXA 4OWRB 2L5QA 3DU6A 4L9JA 3ULQB 3T1BA 1LQ1A 5HODA 1X19A 3CP2A 2OCEA 3S16J 3MZ8A 2JA6J 1H9GA 1ZTRA 1P6RA 5ILUA 4II3A 1S7OA 3D5RC 4YIFA 1CF7B 3FWEA 2BOLA 3OR2C 3JAMK 2Y9YA 3JRAA 4DYQA 1QHGA 3BZCA 5E18F 1JUPA 2KIUA 2DOFA 4QSHA 1AKHA 3BJOA 2VJ5A 3CCJI 1F36A 4L9NA 2FOKA 4XRMA 1UG0A 4P9UA 2NOGA 3H9JA 1SFKA 5LEJA 2DK8A 1JTXA 4MQVA 4FE4A 2JZYA 2H1LA 3S1MJ 2ZJ2A 4X0GA 3FK7A 2WY8Q 1S3JA 3HL2A 1E2XA 1WSUA 4XKCA 4M74A 2XHKA 1XN7A 2HKXA 3OSFA 1P4AA 1Z7UA 2WV1A 1QU3A 2NNNA 2BY2A 1Z05A 2ZXJA 2RGVA 1QPIA 3REOA 3F0CA 3TDZC 4B43A 4EJVA 4Z6YA 1Y8RB 3E5XA 4CYDA 2EJRA 2Y30A 4OMZA 4UV8A 3FXOA 4P9FA 4BGDA 1N78A 5HLTA 2Q2EA 3DTKA 3GUDA 2Z3YA 2JA7J 4HA8A 2OD5A 5C3EJ 2GA2A 3LQRA 5IP9J 1XD7A 2MC4A 3C7JA 4FQGA 1YX3A 3ZMUA 4IJAA 2DA4A 3CDHA 5B1BH 2ID6A 2L7ZA 4M9SA 1WJAA 2DMPA 1MDMB 2K4JA 3IHUA 1YW7A 3RKYA 4Q4ZF 3ZQFA 1IRZA 2DJIA 3A01A 1XCVA 3KP4A 3CO7C 2JA2A 4MTDA 3D1NI 2HKOA 5H2FC 4IHVA 3LWFA 1S72I 2Z1DA 4ZYAA 4DZPA 2M0CA 3HYIA 1SMTA 2VKHA 2FU4A 1SVMA 2M9HA 4A3IJ 4PJMA 2KIFA 2Y0MA 3RZDJ 1JKQC 2HDDA 2YX7A 2DFHA 5LHIA 5EZHA 2MLKA 3M8FA 3F8MA 2TRTA 3NARA 3MZYA 1NTCA 1F4KA 1J2XA 5GADJ 2Z5UA 2M8EA 4OIQF 4LB6B 1MW7A 2A69F 4MEXF 2KIQA 3F8FA 4XOTA 4D5FA 2LBFB 1BA5A 5J47A 1MNEA 2Y69H 4RMNA 5EG0B 1QGPA 5J4YA 3OYLA 2VKEA 1USSA 2DFIA 3MKYB 1LUJB 4IL6C 4N4NB 4CDGA 5GPAA 1FPQA 1QZYA 4A69C 2L9NA 2A61A 2L9SA 1B1BA 4ENJA 3PFYA 2HGCA 3GZ5A 3ZOBA 5J8FA 3FXUA 2JJ7A 2DCEA 1VI0A 1WH5A 3RKQA 2CO5A 4Y33A 3DFGA 2KZGA 1WWXA 3HPGA 3QODA 2L7KA 1ZRDA 3W3CA 3PO3J 3PJRA 1Z1DA 3OYEA 9ANTA 3MN2A 5CYVA 2LC2A 4BHBA 3DEEA 4PSWA 2KT0A 2F6CA 4C3IJ 4HLYA 3BJ6A 4G6DA 5CPRB 4KFCA 1S7AA 1P92A 1T95A 1EA3A 1P7IA 3E6DA 1YTYA 3JSOA 2VQGA 1ZRFA 5FFZA 1FYKA 4AYBA 1FBSA 2F4OB 3RZOJ 3V8JA 1NG6A 1DPUA 2GQQA 1Y1WJ 3E1SA 1KGSA 3V8KA 2BY3A 2LK2A 3C1DA 3HRMA 2RNJA 1W1WE 2IA2A 2ISYA 2ESNA 1G4DA 2O8KA 3HKZA 5B1AH 2H27A 3TEDA 2X48A 2DYRH 1Y1VJ 3F3XA 2XAJA 2H94A 2IJLA 2WC2A 1H0MA 1TWAJ 1Z3YA 1ZGAA 3OS0A 3A0BC 1HW5A 3G1MA 5ICFA 1RR7A 1D0YA 1JKRC 3WHCA 1BI1A 5HLHA 1K7AA 2IGOA 3IAM2 2UZKA 2GOXB 2A5YB 3OL4A 1I39A 1U6GA 3N97A 2RREA 3D5LA 1HOMA 4IKFA 1EKEA 2JQ7A 2EIMH 4BXXJ 2OBPA 3HUGB 4FE7A 5M5WJ 1Y8QB 3AAFA 2JWTA 4FT8A 1YQAA 4X1EA 2MD5A 2HS5A 3LL7A 2P5VA 5FRMA 2EWNA 5E3MA 4G6QA 2F5DA 1U0JA 2RC4A 3PUBA 1RIOH 3HG9A 1HSTA 3QYBA 3IWZA 4M9XA 2HVRA 4OMYA 2CJJA 4IRHA 1R6RA 3SFZA 2CUFA 4A0ZA 5K1YA 2EV5A 3HOYJ 2W48A 2R5YB 4I0AA 3M7GA 2A05A 2I8DA 3H92A 1IN8A 2V1NA 5TGTA 2RKHA 4EV0A 2XKPA 3FXRA 2JMWA 1LDDA 2WY7Q 2CW8A 4W1UA 4ZYGA 5L3CA 2E34A 1NK3P 3CMEI 5J6XA 5JFRA 5LFAA 4M72A 1TW3A 2YPRA 4PUSA 2VT2A 2Q8KA 4L9TA 4YFKF 4YRVA 1X2NA 1DU0A 3FXJA 1XS9A 1K6OA 1N25A 3FXMA 3M8JA 3ML6A 5ERIA 3I55I 1K61A 1ETQA 2V7FA 1EJ9A 1XDUA 1CF7A 4G8XA 5ED4A 3I4MJ 1IN6A 4FASD 3S2WA 2M0MA 1I3QJ 4ZYEA 3ASOH 4UV9A 1I50J 2CWEA 1AA7A 1YRNB 4O5VA 4FHTA 5IY5H 4NHJA 1IRGA 4BAYA 2XB0X 4RLQA 1SD6A 1ZAOA 3JRHA 2LMDA 1V5FA 4BE2A 4I6ZA 4I01A 2HPIA 3G4SI 2JPBA 4I02A 3CMMA 2LKSA 3S1RJ 1YS7A 3GMEA 3R0AA 4UVBA 2V4JC 2WB1A 2KMUA 2E1OA 2FMYA 1DUXC 2VC0A 1ETWA 4A0YA 2HFHA 4AU7A 3O8GA 1LVAA 1IF1A 1KU9A 1MMDA 2H8WA 3TOAA 2R5ZA 3GZNB 2VONA 4KT6A 3ZMTA 3CUQC 2C6YA 2Z16A 4GYIA 1DU6A 5BQTA 1SC7A 1OMIA 1WJEA 2QEXI 2D1VA 2P4WA 3Q0VA 3LSGA 1KYWA 4E6KG 5L3EA 1U3EM 1EH7A 5EGOB 4KT5C 2M2EA 2IGNA 4EGZA 1S6LA 3CP8A 4BDYA 1QO0D 4UB8C 4LD5A 2M7AA 2Y2ZA 3HBLA 4MLOA 1XB4A 1FIAA 4NNJA 2B9SA 1ON2A 2XF6A 2PFBA 2QBYA 1LDKB 3RCOA 2ME6A 2NVUB 3FMQA 1MDMA 1ZN2A 4YEJA 4MO7A 1WFXA 4JK1X 1HBXG 3Q5FA 2XASA 4OOIA 4C2TA 3HJEA 4C3JJ 3CC7I 4KIBA 1BL0A 1D8KA 1I27A 1C0WA 3M1CA 1IUFA 2P7VB 3NQOA 1OYYA 3ERMA 3FBNB 1JGSA 3M1EA 5IT3A 1O3RA 2V9VA 2IRFG 4HPQA 2MFZA 3OYGA 3RQIA 4E4HA 4BHCA 3SDGA 3JSPA 3A02A 2JUGA 2JRMA 4HV6A 3SZPA 2LLKA 4MFEA 3V42A 4UY8I 1GLNA 4HBLA 4HX8A 3NWTA 4U88A 2IW5A 3JRGA 1Z67A 1FOKA 4XLCA 4LIVA 2M5WA 3HZJA 2VI6A 1VTNC 1KU7A 2OJED 3BR6A 2ZBKA 3JW4A 1EF4A 2DQRA 4NC7A 4B3XA 3IL2A 3TQNA 2M3AA 3SZTA 1HKQA 2XPVA 4A2UA 5HDNA 2RV8A 5AIQA 1ODDA 2DPDA 3S14J 2QVOA 2DXIA 2ZMEC 3QWLA 4F52A 1WCMJ 2DPUA 3WG7H 1RKTA 3HIFA 1LNWA 1O7FA 3BP8A 3CQZJ 4V2GA 5F64A 1JKOC 3J7AY 2E36A 1F1ZA 3SZGA 1OCPA 4XR6A 1XSVA 3SQNA 2LOOA 3OIOA 1GT0C 1SMYF 4ANJA 1LEAA 1FEXA 3HHGA 1CGPA 1F5TA 2K9LA 3LSMA 5F0CA 3OYMA 2YS9A 1HLVA 4YIIA 1H88C 2Z33A 1VFCA 1GVJA 3AL0B 2CFXA 3KZYA 2M87A 2E71A 3R61A 1IV8A 3LSRA 4HRIA 3DEWA 4E7ZA 3KE2A 2P8TA 5J40A 1X1BA 1B72B 4CUGA 3GBGA 2HTJA 1B8IB 2F2EA 2JSCA 3O8HA 5GAHJ 5ICEA 1K4TA 1KQ0A 1UHMA 2VOOA 3O2PE 2M4KA 5ICCA 4RAYA 1Z21A 4NBQA 2TDXA 4LMYA 3G6EI 3HRSA 3ZMDA 4DYRA 1W0TA 1BR2A 1FTZA 4LGWA 3GFMA 4B4CA 3D5SC 3FK6A 2CRGA 3ABMH 5E17F 2FRHA 2D45A 2ECBA 1JHFA 4OIRF 3VYTB 3RDIA 1IG7A 4RGXA 1V4RA 1IC8A 3FZVA 1ETVA 3CJNA 1MH4A 3L9FA 5EDNA 4ZTFA 5IT9K 4E7KA 5LHHA 3F23A 1HKTA 2K86A 2EQRA 4HX4A 4E7LA 3I5UA 4A3CJ 2CQNA 4YFXF 3S32A 3F72A 2XF5A 3PL8A 4G9YA 4MTEA 1LDJA 1U78A 5M5YJ 4WXHA 3S2HJ 2HOAA 2YR2A 3WGHA 4MGRA 3PFIA 3OYFA 2GWRA 3TW7A 1MBGA 2DU9A 2PMZA 4BQOA 3W6KB 3JREA 1VQ8I 3ZQQA 1U5TB 2IGMA 3I0TA 1ZKGA 2A6EF 1MSFC 1IAWA 3F22A 3GO5A 2XC7A 2M45A 5DUKA 1A6IA 2LSOA 3K1NA 3GWZA 4E70A 4FX0A 4XICA 1JT6A 1OYIA 2ZJRF 2CW0F 2LY9A 3CLOA 3T0YA 3TO6A 3VPRA 4L0ZB 1WJFA 2X9DA 3VDXA 4IEJA 2HPMA 1TLHB 2GOMA 3GLLA 2WAQN 4Y17A 3EYIA 2DN0A 4WK8F 3J80K 4ON0A 3S1QJ 2EK5A 4X6AJ 1J7KA 3A01B 3OYCA 4NB5A 4RB0A 3B73A 1YW8A 3BR1A 1FOXA 4GCVA 2WAQA 2GXAA 1ZREA 2FE3A 3TW6A 2OF7A 3DV8A 2IT0A 4U0VA 3BTCA 4UUTA 1O3TA 3MKLA 4EJOA 2RAEA 1X1AA 3QPHA 4HX7A 4JX5A 2GZWA 4CGZA 2R92J 4A3LJ 1RPWA 1TNTA 2B63J 5LRSA 4WWCA 3R0JA 3TOBA 1U9NA 1XDSA 4Y3OA 3ERED 4F92B 2G9WA 3OOPA 3CTAA 4CZCA 2WBMA 2Z99A 3WGIA 2WB1N 4M3BA 3ABKH 4BS9A 3I59B 3LQQA 5FD5A 1FY7A 2W00A 4JX6A 4IF4A 1B9MA 1NH3A 3J81K 4BBRJ 3ZQIA 3A2KA 3J7ZI 3C2BA 1FOWA 4P96A 4M71A 1I1GA 1QRYA 1OLTA 3BPXA 1U9OA 3VFZA 5DCMA 1AKHB 2UXNA 4ZYDA 2R0QC 2E1MC 2ZSHB 2VXZA 5HS8A 2E1CA 1WH7A 3KP7A 2XDVA 1OCCH 3E5UA 3QPTA 4IHSA 5GTIC 2EZLA 3PSIA 3PNTA 1FSHA 3Q0WA 5LBQA 4HOBA 3FM3A 4IHTA 3AKZA 5EGOA 2NVQJ 1R36A 4KMUX 3PO2J 2VPRA 3E97A 1UELB 2HXOA 1T33A 2ZO4A 1ULYA 3IRRA 2DDAA 2OV7A 2EA4A 2QA4I 1QBJA 5GAEJ 4B8XA 4C30A 4L18B 4QTRA 3LSHA 2L7MP 2PMUA 5TISC 2QBYB 1QPMA 5K5OA 3GTMJ 4MNUA 3HOSA 2K9SA 3H5NA 2ELJA 1YIJI 2Y31A 4E7HA 3TMOA 3H35A 3Q0UA 4XLEA 4D7NA 4XMYA 3OV8A 2VBYA 2E2JJ 1XC5A 2VN2A 4ZTJA 1Z6RA 2BE5F 5GAGJ 1JE8A 2FSWA 3CUOA 4HNUA 1BC8C 2D5VA 3BOQA 4I2OA 2R7DA 4BJ5C 2X6WA 1V5EA 2FEZA 2VQCA 3DLLF 4HG2A 4N4OB 2B7EA 5FRNA 2GIZA 3L2VA 3BCAA 2X6OA 4AC0A 4KN4X 5EZGA 3J7YJ 2V6EA 2LY2A 3V7SA 3EDPA 3GEZA 2LTPA 1Q1HA 2R7QA 2PI0A 3W6JB 3WTYC 1MMAA 1ZLJA 2JK3A 3RQ4A 4BBSJ 3C3WA 4AVZA 4GFBA 2CQKA 4AWXB 5D5XB 1IW7F 2GLOA 1HW1A 3FBIB 1JHHA 1MZBA 1YE9A 1B8IA 4HF0A 2YSRA 3MKWB 2VOPA 4PFPA 4AYBN 5DCFA 1VQPI 2E1MB 4D9JA 1FYLA 1S7EA 3WHBA 5TRDA 2MW8A 3IUOA 5JHFA 1YI2I 2CV0A 1FSEA 3HSEA 1IDYA 1GXQA 4BJ6C 1Z91A 4B3AA 4EJUA 2YU9J 4KNYA 3DPUA 5FKOA 2NS8A 3ZPLA 4U87A 3VWBA 1UG2A 3HOVJ 3E3VA 2IEKA 2A3SA 4KN7X 3ECOA 2KKOA 5M3FJ 1HKSA 5HNHA 1LFPA 1MBEA 1JTYA 1XSDA 3IV5A 2GAUA 1REPC 3JRFA 3RJPA 2FNAA 2CFOA 2LBFA 1D1BA 2GXGA 4CZZA 5FLXZ 3SJMA 3KP5A 5AIPA 3VODA 5KAIC 3OYHA 1DGRM 4HNVA 2DTZA 3KIOA 3WU2C 2OA4A 4XIDA 3DBHB 1Z9CA 3EUHA 2HEOA 5EF6A 2P0WA 2I5UA 2Y0SN 1J0RA 2MLGA 3R60A 1WJ5A 2KIMA 4D5CA 3OYDA 1R9TJ 2E60A 1RKWA 1GV2A 3K1MA 5L3BA 4IX7A 1OCOH 3CCQI 2RNGA 3K4CA 2VBWA 2VE8A 2XF7A 3GVAA 5D4SA 1N75A 2EBIA 3WTXC 4E7SA 2CUJA 1YYVA 2PJPA 2LF8A 1TQMA 3WE2A 4XOPA 2BY1A 2E1NA 2YUSA 1T0FC 3U2RA 2STTA 2RQQA 2MSYA 4ZDLA 3SDBA 3OOUA 1ZELA 3SEZA 5IT9Z 2G7HA 3L7WA 3DP7A 2CUZA 3CMYA 2LKXA 4OIPF 1G3YA 1UHWA 2V9KA 2XAGA 4TV7A 2DT7B 3F6VA 4BL0B 1N77A 2XAFA 4ETSA 5E3NA 4Q48A 1WGXA 1TC3C 4AM3A 1UCRA 2V9PA 2CYYA 3E6CC 1K78A 3NAUA 2ZJPF 3U1DA 5HLGA 3WTSC 1XCBA 2L2OA 5DM7F 5E20A 4AIHA 3HXLA 2O8XA 1KQ8A 3FXKA 1X2MA 5EJCA 2D1HA 3RYRA 4A3DJ 3CCRI 4A5NA 1R1VA 4RB1A 4HNTA 2NVXJ 3EYYA 5JLXA 2MH9A 3VOEA 1MMGA 3IAS2 5KVRA 4BEHA 1WI9A 2FBHA 3DCFA 2ACJA 1MGTA 3LNQA 1D1CA 3JRCA 2BW3A 3HTSB 5HDGA 5FLMJ 3CF2A 2LNBA 3RKWA 1E3PA 4XNFA 4XLAA 3KP3A 1OR7A 1OPCA 2FD5A 4IOCF 3GFLA 1VQ6I 2CQXA 4U0WA 2XGXA 2R7RA 2VT3A 2E2HJ 4EMSA 1VQNI 1FMWA 1W0UA 1RC9A 4LB5A 4IZZA 4I98B 2OAZA 1LB2A 1B4AA 2R3SA 1IGNA 1M1EB 2KLOA 1VZ0A 2NRAC 3MVPA 3F8BA 1BR1A 1G3TA 3CZ6A 5LGNA 3W2WA 2R7SA 4H4KC 4AIDA 2VJIA 1TWGJ 4LLNA 1BW6A 4A6DA 4Y4RA 1E17A 4BYYA 4C2MJ 1QA6A 2QKLB 4N0BA 1A31A 3FHNA 2V1UA 2BXZA 3OYBA 1I3AA 4CYCA 1G8XA 1X4OA 2F5EA 4XN3A 2AS5F 3BTLA 4AVPA 4ZC3A 3EPZA 2DK5A 2K3FA 4RB2C 2XAHA 3GTKJ 5K7HA 1BR4A 4I76A 4RGRA 5KAFC 2VL8A 3WTUC 2Z2SB 1D1AA 1RZ4A 2CU7A 3ESWB 4BJTA 1JI8A 1T98A 3K4LA 2R7ZJ 1LJ9A 2XVCA 3BJAA 5D5VB 4F93B 4NDLA 3CJRB 2HXIA 1BJZA 5EEHA 2FQ4A 1VQ5I 2XV4S 2O6GE 4U7DA 4FTHA 4G12A 4PGHA 5IP6A 2ZKZA 1R4MB 2FXAA 3M4OJ 1RNLA 4R8HA 3G1LA 3L2RA 2KQRA 2DA7A 4PJ0C 3L2UA 4II2A 2GXBA 3C18A 3JCUC 4OIOF 2R7VA 2AO9A 4BEHB 4L0YB 2EFPA 3GX4X 4XRSG 1PJRA 2XIGA 1QHHD 1R7JA 1JJ8C 1HDDC 1BIBA 2LVSA 2Q1ZB 3H0DA 3CCLI 3ECHA 5KK1A 3AFHA 3P7NA 2ELHA 2HWVA 4XQFA 4XL9A 1BBYA 5EEGA 1V54H 1J59A 5DV5A 4CCLA 3AL0C 2HQAA 4JQFA 4CCJA 3JRBA 1J75A 4RM2A 4CH7A 4C9YA 2K3PA 1KZHA 4E7JA 1Y56A 5DYMA 1FC3A 1HCRA 1JUMA 1JJ6C 2QLZA 2QQBA 2VUMJ 1FJLA 1D5YA 4M9ZA 5C44J 2F5VA 5EEAA 1XMXA 2IPQX 1PVEA 4BQAA 2E35A 4UUSA 1IZ1A 4CICA 5A2QZ 3QYFA 3I59A 5M5XJ 3H5RA 1VNDA 3MMYB 2F5FA 3EUAA 1R5HA 3ZGKA 3KCCA 1OCTC 1SFOJ 4IHWA 3H3UA 3UNGC 4QPOA 3ZN1A 3BY6A 2DOEA 1HF0A 3HGGA 3M07A 3MQ0A 2X4HA 5DCMB 2NOJB 3D0SA 1E3HA 4EQQA 2KDOA 2HZTA 2PQ8A 1OISA 1R00A 5CVRA 1ZG5A 3HOUJ 1BW5A 1EV7A 2LR8A 2CV2A 3WE3A 4DBQA 1GXPA 1FBQA 2KHMA 4IQ4A 2X0LA 4LFUA 4BY7J 2QGUA 3FMSA 3CCMI 1PP7U 3FM5A 2Y75A 3BCBA 1VQMI 2GA1A 1TWCJ 2QQ8A 2EA2A 4B47A 1R5ID 4EJTA 2L0KA 3K6GA 5CVVA 3VYUB 4LK1F 1R1UA 2KL4A 2ZCWA 3P9IA 1HC8A 2DAOA 1OFCX 2Z9OA 2F5CA 5F0FA 4NC6A 1PUEE 1W5TA 1IUYA 1D8JA 3TP3A 1DQUA 4YELA 1T6SA 3ABTA 3AG2H 3L09A 5KCMA 5L3FA 2ME0A 3E6BA 5F27A 3V7CA 4CYCB 1FTTA 3NWSA 4ESJA 5K7FA 1O7LA 3OYIA 2R7FA 1LPQA 4B44A 1ERDA 1V3FA 4ZDPA 4D7MA 5ILVA 2L54A 2OPTA 1FX7A 2FUG2 3PUFA 3JTHA 1TQIA 2DOAA 5E8GA 1XGNA 2BGCA 3H9QA 3GW2A 1QVTA 4Z2YA 3WGGA 1Y0NA 2ZXIA 3DKYA 3GCMA 1Q1VA 3H3VK 4A93J 1S9HA 2QM3A 4A6EA 2EILH 1XMAA 1Z6TA 2XPUA 4M3EA 1TW2A 2KISA 4P1WA 1D0XA 5J8CA 4OAYA 4PFOA 1AWCA 4ZJZA 3A03A 3M8EA 3FF5A 1J09A 3OYKA 2DQLA 4BDZA 3MD2A 2M34A 2QWWA 2W57A 2XSJC 4HYEA 1BIAA 2V6CA 3A0HC 3O3KA 5LHGA 4BHPA 2NAZA 1S8NA 4N9IA 2E19A 2M1BA 1KONA 1TTYA 2IA0A 2NXNB 1J5YA 2BXYA 5BNGA 1FP1D 3HM5A 4DOZA 2EINH 4RB3C 3WU0A 4LLGF 1MJBA 3I64A 1XSXA 2A6HF 1U5TA 1YG2A 2ZXWH 5J1YA 1MJAA 2HDCA 3VSKA 3KYLA 1DP3A 3JR9A 2O5RA 3ABLH 2EIKH 5DUIA 2X6XA 1DGWY 3H0GJ 1XGSA 4BQNA 3LFUA 2CGPA 3CMAI 4PSXA 1HDPA 2IP2A 4ASNA 3M3YJ 1IN4A 1AOYA 3FHZA 3G2BA 2E5NA 4BACA 2EZIA 2IS1A 4S05A 2EZHA 6PAXA 3FXLA 3EUHC 3DBLB 5K7ZA 2W7NA 1LEBA 4YFNF 5HS9A 2MBFA 2A07F 5IYCJ 4BXFA 2IVMA 2CS3A 4CCOA 4F91B 3EQLF 5E1WA 4A3MJ 3KEYA 3P9CA 3H9GA 2KFDA 3TO7A 2VBZA 4XLPF 1X4PA 4A3BJ 2DO7A 4BU2A 3J81Z 1YJWI 3GFJA 5AONA 3UR3C 3LFKA 3FIWA 4EEFG 4XSZF 2BHZA 4WX9A 4HQEA 4WXCA 1T56A 4PK4A 2O03A 2LRDA 5DD8A 4QIWN 1RUNA 3LSTA 3QPSA 5F08A 1IXRC 3BWGA 2MC3A 2QZ8A 2IXSA 4UNOA 3S17J 1P4WA 1G2HA 1SD5A 3P5JA 1FMVA 2FBIA 2OQGA 1RETA 2AXTC 4GXOA 4IO9F 4M6XA 3MCZA 4N9HA 4BUPA 2VODA 3BG9A 3ZQCA 4AIKA 3NEUA 3LA7A 3DF8A 2ZC2A 1RUOA 3IKVA 1JKPC 2PMZN 3H1CA 5F1RA 1TT0A 2QQ9A 2IS6A 1LKXA 1X1CA 5F6FA 4BH9A 3OYNA 4XRSA 3QP5A 2I10A 5FB2A 2PJRB 1UZCA 5L3DA 2OQRA 4ENNA 3HUGA 4DW6A 3W2VA 4XLHA 2VLAA 5HS7A 3HOZJ 3HGYA 1K6YA 1G6NA 2HR3A 3GTJJ 4M3GA 1SFXA 1WQ2A 3GTLJ 2K9MA 2AQFA 1ZLKA 4LIUA 4QPQA 4ITVA 3FXQA 1TWFJ 2DMNA 2E5ZA 2P6TA 2P5LC 4I99C 3ZMZA 2ELKA 1XX5A 2ZFUA 1GV5A 2RDPA 2HQ5A 1V55H 3K2ZA 1MSEC 3EETA 4HF1A 4IVNA 4EM1A 1WJCA 4EM2A 1FOYA 1R5GA 2FA5A 3ONQA 2JVHA 3BLYA 5FKLA 5JVTA 2N8GA 3ZCOA 2RVCA 4XLNF 3IH3A 5F04A 1U5TC 2ZMEB 4FX4A 1VQKI 1ETKA 2OC6A 4KIGA 5CVUA 2NVTJ 4XBFA 3GTPJ 3WTVC 4DYCA 2HI3A 1TZLA 3MFKA 1G3SA 4XRFA 2MD0A 3OIPA 3V8LA 2HOEA 5DTDA 1IV6A 2ZXHA 2CQ7A 2HNHA 1SVLA 3T8RA 3CD6I 3Q3SA 2ID3A 3FKJA 2F4IA 3BG6A 3KX2A 1NK2P 3LSIA 3SFIA 3HRTA 1MJ9A 3SXYA 3ZQLA 5FROA 2HOTA 4S0HB 3OYAA 1TT5B 3CDIA 4IXAA 2L9RA 1VQOI 3FX3A 1YX5A 4J01A 2K40A 4UB6C 3PNVA 1SAXA 3KYCB 2PBIA 2PN6A 2EB7A 1STZA 3K10A 5LLQA 3OMYA 2VJ4A 4E7IA 2X85A 3DQVC 3WTWC 4FETA 1ZHFA 1O4XA 2BV6A 3Q9VA 1WI3A 2B0LA 1VF9A 1ZARA 2WADA 4A12A 4EATA 1CQTA 1FBUA 2KPMA 3CCYA 3G71I 4B1RA 5DDGA 3S3OA 2XKOA 1SEUA 3I4PA 3X2QH 1APLC 3W6VA 2CG4A 2CUEA 2CV1A 1IN5A 3BZ6A 2HOSA 4LITA 3IKTA 4Y13A 4R1HA 1MD0A 3QAHA 1UFMA 2J5OA 4AIJA 2EV6A 4QLCU 2X1DA 2EFWA 1JGGA 4XLFA 3P9KA 4Y52J 2WAFA 5H6RA 4KDPA 3C2HA 4AD9A 3HC7A 3M9AA 2DLLA 4GYGA 3L2QA 2JTVA 4J19A 4GO1A 4BE0A 2CQQA 2CSOA 2L7FP 2FNPA 5KHDA 5BS6A 2ZNZA 4NQWB 1O3QA 1K4SA 3BR0A 1PP8F 1FYMA 1OR7C 3K70C 2W1OA
chains in the Genus database with same CATH topology
3FMRA 4QWQA 2QYOA 4NQWA 3F8NA 3BPVA 3U9GA 1YS6A 5BPIA 2P6SA 5LGUA 4O3MA 2K02A 3F8CA 1W7PA 3F6OA 5HVQC 1U8RA 5LEKA 2ESHA 4G94A 1QNTA 1DP7P 3WODF 3I53A 3G3ZA 2Y48A 4RS8A 4XSXF 4OU0A 3WG9A 3WTTC 2L01A 4P5OA 1T0FA 4KMFA 5D5UB 2H6CA 1SD7A 1B9NA 1HQCA 4EJWA 2OZUA 5JR3A 3CO6C 3K9TA 1HXDA 2COMA 2JPCA 4EM0B 2P5KA 2H6BA 3RPQA 1P2FA 3TDUC 2FMLA 1R22A 2L3DA 3CUQB 5D6FA 3RYPA 4Q5SF 5D8LB 2J5PA 4KA4A 4KICA 4UXNA 5E8IA 4GGGA 4KIFA 4U0YA 2EFNA 1XGMA 1D3YA 3IC7A 2ZMEA 4ENMA 3T5XA 4IPAA 5D8KB 3TKYA 1ONVA 5D4RA 1D5VA 4L5IA 4ZZDA 3JTGA 3IWFA 1I1SA 2QUFA 5FO5A 3K0LA 4ENKA 2O3FA 4DQ2A 1HSJA 2G7UA 1SFUA 2RN7A 4HAMA 3MAJA 3ZMVA 2HQNA 2ADUA 4IRIA 1O57A 4P55A 4HW0A 4RAZA 1KQ9A 3GLXA 3RKXA 3L2CA 1BI0A 2W85A 2MA3A 2UXXA 2IA1A 1XMKA 3ZQ7A 5BPDA 1KU3A 1K78B 1R1TA 1FWZA 2WWYA 1ZYRF 1IXSB 2RQPA 5FFXA 2L02A 1RI7A 5D5WB 1ZG1A 2K27A 5L3GA 1UB9A 2AXLA 2LKPA 4ZYHA 3KEQA 5JHUA 1SD4A 1TBXA 4D0PA 1YIOA 1ZH5A 4PZJA 1I5ZA 1W4MA 4A5MA 4LK0F 2BBYA 5H6QA 3HRUA 1BN5A 3ZN0A 2OU2A 1X3UA 4I09A 1G3WA 2NNYA 3GF2A 1PDNC 3V7RA 4RGSA 4G7HF 4L5JA 1T2KA 1IRFA 3K1PA 2H09A 4HDUA 1BOAA 2XRNA 1KU2A 3E5QA 4ESBA 4H0EA 3ROUA 1QQIA 4L9VA 2YX4A 2QQAA 3HSRA 4BXUA 4I0BA 3DKWA 2JRTA 2K4BA 3NRVA 2ZNYA 3B02A 3N4MA 1L0OC 1TNSA 4ZH4F 1OYWA 1TQPA 5K5RA 3K69A 3V4GA 3QOPA 3WU1B 4DNCA 1KA8A 2Q0OA 1O3SA 1U2WA 2VBXA 2LF7A 1BC7C 1BM9A 5DEQA 4K2EA 3RIRA 3R4KA 2L4MA 5TJJA 1Y0UA 3WTZA 1WRJA 3F21A 3LAJA 1FP2A 4WCGA 5BOXA 1F9NA 4CXFA 2DTRA 2LDUA 2PMHA 2VC1A 2KJCA 3PQKA 2HYFA 1J9IA 2UWMA 4B09A 1OKRA 1A04A 3QP6A 2HTSA 1IN7A 4G7ZF 4JBAA 5H20A 5CLSA 5CVIA 2BYVE 1W7PD 5LRRA 2WTEA 1ZRCA 3DXJF 3LAPA 1YO5C 3HOTA 3RTRA 4ESFA 5FD6A 3IRQA 1XGOA 3HTUA 3HHHA 3KZZA 5CJ9A 3VEPA 4I7HA 4F7ZA 1FLIA 2XAQA 3KLOA 4KYWA 2MH2A 1SFEA 5K5QA 2VE9A 5DD4A 1USTA 1K79A 1JXSA 3DEUA 1FZPB 3KEOA 4EVIA 3BDDA 3I71A 4PDKA 1B59A 3G73A 4M73A 3J80Z 3GZ6A 1L3LA 2KRFA 1EH6A 4PGGA 3PQJA 2XROA 5ICGA 4S04A 2ISZA 2V79A 3SHFA 1EH8A 3RPUA 3Q9SA 2PLYA 2O0YA 3ZMSA 2HYGD 4EGYA 3CUQA 3E6MA 3L00A 4O6JA 5ILSA 2ZFWA 4HF2A 2FF4A 4UVCA 4MEYF 1WKMA 1S29A 2OZ6A 5HLIA 5D6EA 5FGMA 3J7AO 1I6XA 4G7OF 4BNCA 4U7BA 3QU3A 2E7WA 2FBKA 4RGUA 3GYHX 2QENA 4HZFA 2W25A 3LA3A 1T38A 2PG4A 2W84A 3DPTA 1ZG3A 2K7LA 5E1ZB 3QRFF 4LG0A 3HSFA 2DT5A 1DPRA 3QU6A 1YLFA 1YFHA 4LLLA 3ZP5A 1NHAA 2EFQA 2JT1A 3T8TA 3KLNA 3I58A 5HDKA 1QZZA 1BI2A 4CO8A 1W5SA 3H3ZA 3GFIA 2D2WA 1YW9A 3KP2A 2ETHA 1ON1A 3TO9A 1MKMA 2KJBA 4UHTA 5BMZA 2BEOA 2XUBA 4WF2A 4Q47A 3GXOA 4PCQA 4LG0B 3TGNA 5E1XA 4IRGA 2STWA 2EV0A 1FT9A 3LA2A 2NS0A 4LJZF 4HV5A 4R79A 1H9TA 3ISPA 2FQ3A 2E7XA 4A0XA 3BROA 2PEXA 3KETA 3COAC 2WV0A 4MQ9F 4UVAA 4M6YA 5LGTA 5HOOA 1T39A 2EFOA 1BJAA 3JAMZ 1BI3A 2HQRA 3O6BB 2W24A 1FNNA 4UUVA 3VB2A 1DDNA 3ABUA 3RI4A 3ELKA 2GIVA 2DI3A 2V1XA 2P7CB 3MEXA 2YU3A 3MWMA 1R58A 1P4XA 3DPLC 4KUMA 4OINF 4HLXA 5CVJA 5FLXK 3I54A 2M30A 2A68F 2O61A 1R23A 4HDVA 2DBBA 3MZHA 3KFWX 4MHGA 1W7PB 4WXDA 4YG2F 1GHCA 3R6SA 3KP6A 2V1DA 2L4AA 1B6AA 4CHUA 2DW4A 1IXCA 4Y15A 5JI6A 1KYZA 1ZGJA 4ZZLA 1HW2A 4HQMA 2NYXA 4L9JA 3ULQB 3T1BA 1LQ1A 1H9GA 1P6RA 5ILUA 1S7OA 4YIFA 1CF7B 3FWEA 3JAMK 5E18F 2KIUA 3BJOA 4L9NA 2FOKA 4P9UA 5LEJA 2DK8A 4MQVA 2JZYA 2ZJ2A 1S3JA 1E2XA 1WSUA 4M74A 2XHKA 1XN7A 2HKXA 1P4AA 1Z7UA 2NNNA 1Z05A 2ZXJA 2RGVA 3REOA 3TDZC 4EJVA 3E5XA 4CYDA 2EJRA 4OMZA 4UV8A 4P9FA 2Q2EA 3GUDA 2Z3YA 4HA8A 2OD5A 2GA2A 3LQRA 1XD7A 3C7JA 3ZMUA 4IJAA 3CDHA 4M9SA 1MDMB 2K4JA 3IHUA 1YW7A 3RKYA 4Q4ZF 1XCVA 3KP4A 3CO7C 4MTDA 2HKOA 3LWFA 3HYIA 1SMTA 2FU4A 2KIFA 2Y0MA 2YX7A 5LHIA 2MLKA 3M8FA 3F8MA 3MZYA 1F4KA 1J2XA 2Z5UA 2M8EA 4OIQF 4LB6B 2A69F 4MEXF 3F8FA 1QGPA 1USSA 2DFIA 4CDGA 1FPQA 1QZYA 2A61A 4ENJA 1B1BA 2HGCA 3GZ5A 5J8FA 3FXUA 2CO5A 3DFGA 1WWXA 1ZRDA 1Z1DA 5CYVA 4BHBA 4HLYA 3BJ6A 4G6DA 4KFCA 1S7AA 1P92A 3E6DA 1YTYA 3JSOA 1ZRFA 5FFZA 1FYKA 1FBSA 3V8JA 1DPUA 2GQQA 1KGSA 3V8KA 3C1DA 3HRMA 2RNJA 2IA2A 2ISYA 2ESNA 1G4DA 2H27A 1H0MA 2H94A 2IJLA 2WC2A 2XAJA 3F3XA 1ZGAA 1HW5A 5ICFA 1BI1A 5HLHA 1K7AA 2UZKA 2A5YB 1U6GA 3N97A 3D5LA 2OBPA 3AAFA 4FT8A 1YQAA 2MD5A 2HS5A 2P5VA 2EWNA 4G6QA 2F5DA 2RC4A 1RIOH 1HSTA 4M9XA 3IWZA 4OMYA 4IRHA 3SFZA 4A0ZA 5K1YA 2EV5A 4I0AA 3M7GA 3H92A 1IN8A 2RKHA 4EV0A 2XKPA 3FXRA 1LDDA 4ZYGA 5L3CA 5J6XA 5JFRA 4M72A 1TW3A 2YPRA 2VT2A 2Q8KA 4L9TA 4YFKF 1K6OA 3ML6A 5ERIA 1XDUA 1CF7A 4G8XA 5ED4A 1IN6A 3S2WA 4ZYEA 4UV9A 2CWEA 4O5VA 4FHTA 4NHJA 1IRGA 4BAYA 1SD6A 1ZAOA 4I01A 2JPBA 4I02A 1YS7A 3R0AA 4UVBA 1DUXC 2FMYA 2VC0A 4A0YA 2HFHA 1IF1A 1LVAA 1KU9A 3TOAA 2VONA 3ZMTA 3CUQC 2C6YA 4GYIA 5BQTA 1OMIA 2D1VA 2P4WA 1KYWA 5L3EA 1U3EM 1EH7A 4KT5C 4EGZA 1S6LA 1QO0D 4LD5A 1XB4A 1ON2A 2PFBA 2QBYA 1LDKB 3FMQA 1MDMA 1ZN2A 4JK1X 1HBXG 3Q5FA 2XASA 4OOIA 4KIBA 1D8KA 1I27A 1C0WA 2P7VB 3NQOA 1OYYA 1JGSA 3M1EA 5IT3A 1O3RA 2V9VA 2IRFG 4BHCA 3JSPA 4HV6A 3SZPA 4HBLA 4HX8A 4U88A 2IW5A 1FOKA 2M5WA 1VTNC 1KU7A 2ZBKA 3JW4A 2DQRA 3IL2A 3TQNA 3SZTA 1HKQA 4A2UA 5HDNA 2DPDA 2RV8A 1ODDA 5AIQA 2QVOA 2DPUA 3HIFA 1LNWA 1O7FA 3BP8A 5F64A 1F1ZA 1XSVA 3SQNA 1SMYF 1LEAA 3HHGA 1CGPA 1F5TA 4YIIA 2Z33A 1GVJA 2CFXA 3KZYA 2M87A 3R61A 3KE2A 2P8TA 2HTJA 2F2EA 2JSCA 5ICEA 1KQ0A 1UHMA 2VOOA 3O2PE 5ICCA 4RAYA 2TDXA 4LMYA 3HRSA 3ZMDA 4LGWA 3GFMA 5E17F 2FRHA 2D45A 1JHFA 4OIRF 3RDIA 4RGXA 1V4RA 3FZVA 3CJNA 3L9FA 5IT9K 5LHHA 3F23A 1HKTA 2K86A 4HX4A 3I5UA 4YFXF 3F72A 4G9YA 4MTEA 1LDJA 1U78A 4WXHA 2YR2A 3WGHA 4MGRA 3PFIA 2GWRA 2DU9A 3W6KB 1U5TB 3I0TA 2A6EF 1IAWA 3F22A 3GO5A 2M45A 5DUKA 2LSOA 3K1NA 3GWZA 4E70A 4FX0A 1OYIA 2CW0F 3CLOA 3T0YA 3TO6A 4L0ZB 1TLHB 4Y17A 3EYIA 4WK8F 3J80K 4ON0A 2EK5A 1J7KA 4NB5A 4RB0A 3B73A 1YW8A 4GCVA 1ZREA 2FE3A 3DV8A 2IT0A 4U0VA 1O3TA 4EJOA 3QPHA 4HX7A 2GZWA 4CGZA 1TNTA 5LRSA 4WWCA 3R0JA 3TOBA 1XDSA 3ERED 2G9WA 3OOPA 3CTAA 2Z99A 3WGIA 3I59B 3LQQA 5FD5A 1FY7A 4IF4A 1B9MA 3J81K 4P96A 4M71A 1I1GA 3BPXA 3VFZA 5DCMA 2UXNA 4ZYDA 2VXZA 5HS8A 2E1CA 3KP7A 3E5UA 3QPTA 4IHSA 1FSHA 5LBQA 4HOBA 3FM3A 4IHTA 1R36A 4KMUX 3E97A 2ZO4A 1ULYA 3IRRA 1QBJA 2EA4A 4B8XA 4L18B 2PMUA 2QBYB 1QPMA 5K5OA 4MNUA 3HOSA 3OV8A 2VBYA 2VN2A 1Z6RA 2BE5F 1JE8A 2FSWA 3CUOA 1BC8C 3BOQA 4I2OA 2R7DA 2FEZA 4KN4X 3V7SA 3EDPA 3GEZA 1Q1HA 2PI0A 3W6JB 3WTYC 1ZLJA 3C3WA 2CQKA 4AWXB 5D5XB 1IW7F 1HW1A 1JHHA 1MZBA 4HF0A 2YSRA 2VOPA 5DCFA 1FYLA 5TRDA 1FSEA 3HSEA 1GXQA 1Z91A 4EJUA 4KNYA 3ZPLA 3E3VA 2A3SA 4KN7X 3ECOA 2KKOA 1HKSA 1XSDA 2GAUA 1REPC 3RJPA 2FNAA 2GXGA 4CZZA 5FLXZ 3KP5A 5AIPA 3VODA 2OA4A 1Z9CA 3EUHA 2HEOA 1J0RA 2MLGA 3R60A 2KIMA 3K1MA 5L3BA 2VBWA 2VE8A 3GVAA 5D4SA 3WTXC 1YYVA 2PJPA 2LF8A 1TQMA 3WE2A 2E1NA 3U2RA 2STTA 5IT9Z 2G7HA 3L7WA 3DP7A 4OIPF 1G3YA 1UHWA 2XAGA 4TV7A 3F6VA 2XAFA 4ETSA 4Q48A 1UCRA 1K78A 2CYYA 3E6CC 3U1DA 5HLGA 3WTSC 1XCBA 5E20A 4AIHA 2O8XA 1KQ8A 2D1HA 3RYRA 4A5NA 1R1VA 4RB1A 3EYYA 2MH9A 3VOEA 5KVRA 1WI9A 2FBHA 2ACJA 1MGTA 3HTSB 5HDGA 2LNBA 3RKWA 3KP3A 1OR7A 1OPCA 3GFLA 4U0WA 2XGXA 2VT3A 4EMSA 4LB5A 4I98B 2OAZA 1LB2A 1B4AA 2R3SA 2NRAC 3F8BA 1G3TA 5LGNA 4LLNA 4A6DA 1E17A 4BYYA 4N0BA 2V1UA 2F5EA 2AS5F 4AVPA 2DK5A 4RB2C 2XAHA 4RGRA 3WTUC 1RZ4A 1T98A 1LJ9A 2XVCA 3BJAA 5D5VB 5EEHA 2XV4S 2O6GE 4U7DA 4PGHA 2ZKZA 2FXAA 1RNLA 4R8HA 2GXBA 3C18A 4OIOF 4L0YB 3GX4X 2EFPA 2XIGA 1R7JA 1BIBA 3ECHA 5KK1A 3P7NA 2ELHA 2HWVA 1BBYA 5EEGA 1J59A 5DV5A 4JQFA 1J75A 5DYMA 1FC3A 2QLZA 2QQBA 4M9ZA 2IPQX 4BQAA 1IZ1A 4CICA 5A2QZ 3I59A 2F5FA 1R5HA 3KCCA 3H3UA 3ZN1A 3BY6A 3MQ0A 2X4HA 5DCMB 3D0SA 4EQQA 2HZTA 2PQ8A 1R00A 5CVRA 1ZG5A 1EV7A 3WE3A 1GXPA 1FBQA 2X0LA 4LFUA 3FMSA 1PP7U 3FM5A 2Y75A 2GA1A 2EA2A 4EJTA 5CVVA 4LK1F 1R1UA 2ZCWA 3P9IA 2DAOA 2Z9OA 2F5CA 1PUEE 1W5TA 1IUYA 1D8JA 1T6SA 3ABTA 3L09A 5L3FA 3E6BA 3V7CA 4ESJA 1O7LA 2R7FA 1V3FA 5ILVA 2L54A 1FX7A 3JTHA 1TQIA 5E8GA 5A2QK 1XGNA 2BGCA 3GW2A 4Z2YA 3WGGA 2QM3A 4A6EA 1XMAA 1Z6TA 1TW2A 5J8CA 1AWCA 3M8EA 3FF5A 2DQLA 2QWWA 2W57A 4HYEA 1BIAA 2V6CA 3O3KA 5LHGA 4BHPA 2NAZA 1S8NA 4N9IA 2M1BA 2IA0A 1TTYA 1J5YA 1FP1D 4RB3C 3WU0A 4LLGF 1MJBA 3I64A 1XSXA 2A6HF 1U5TA 1YG2A 1MJAA 2HDCA 5DUIA 1XGSA 2CGPA 2IP2A 4ASNA 1IN4A 1AOYA 3FHZA 4S05A 6PAXA 1LEBA 4YFNF 5HS9A 2A07F 2MBFA 2IVMA 3EQLF 5E1WA 3P9CA 3TO7A 2VBZA 4XLPF 2DO7A 3J81Z 3GFJA 5AONA 3LFKA 4XSZF 4WX9A 4HQEA 4WXCA 2O03A 1RUNA 5DD8A 3LSTA 1IXRC 4UNOA 3BWGA 2MC3A 2QZ8A 1P4WA 1SD5A 2FBIA 2OQGA 4GXOA 4M6XA 3MCZA 4N9HA 2VODA 4AIKA 3NEUA 3LA7A 3DF8A 1RUOA 3IKVA 5F1RA 2QQ9A 4BH9A 5F6FA 3QP5A 5FB2A 5L3DA 2OQRA 4ENNA 3HUGA 5HS7A 1G6NA 2HR3A 1SFXA 1WQ2A 1ZLKA 3FXQA 2P6TA 2P5LC 3ZMZA 2RDPA 3K2ZA 3EETA 4HF1A 4IVNA 4EM1A 4EM2A 1R5GA 2FA5A 5JVTA 2RVCA 4XLNF 1U5TC 2ZMEB 4FX4A 5CVUA 4KIGA 4XBFA 3WTVC 3MFKA 1G3SA 4XRFA 3V8LA 2HOEA 3T8RA 3HRTA 1MJ9A 3SXYA 4IXAA 3FX3A 1SAXA 2PBIA 2PN6A 2EB7A 1STZA 5LLQA 3DQVC 3WTWC 1ZHFA 2BV6A 3Q9VA 2B0LA 1ZARA 4A12A 1FBUA 5DDGA 2XKOA 3I4PA 2CG4A 1IN5A 3BZ6A 3IKTA 4Y13A 4R1HA 1MD0A 3QAHA 1UFMA 2J5OA 4AIJA 2EV6A 4QLCU 2EFWA 3P9KA 5H6RA 4KDPA 4AD9A 3M9AA 2DLLA 4GYGA 2JTVA 4GO1A 2CSOA 2FNPA 5BS6A 2ZNZA 1O3QA 1PP8F 1FYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  4QWQ A;  2QYO A;  4NQW A;  3F8N A;  3BPV A;  3U9G A;  1YS6 A;  5BPI A;  2P6S A;  5LGU A;  4O3M A;  2K02 A;  3F8C A;  1W7P A;  3F6O A;  5HVQ C;  1U8R A;  5LEK A;  2ESH A;  4G94 A;  1QNT A;  1DP7 P;  3WOD F;  3I53 A;  3G3Z A;  2Y48 A;  4RS8 A;  4XSX F;  4OU0 A;  3WG9 A;  3WTT C;  2L01 A;  4P5O A;  1T0F A;  4KMF A;  5D5U B;  2H6C A;  1SD7 A;  1B9N A;  1HQC A;  4EJW A;  2OZU A;  5JR3 A;  3CO6 C;  3K9T A;  1HXD A;  2COM A;  2JPC A;  4EM0 B;  2P5K A;  2H6B A;  3RPQ A;  1P2F A;  3TDU C;  2FML A;  1R22 A;  2L3D A;  3CUQ B;  5D6F A;  3RYP A;  4Q5S F;  5D8L B;  2J5P A;  4KA4 A;  4KIC A;  4UXN A;  5E8I A;  4GGG A;  4KIF A;  4U0Y A;  2EFN A;  1XGM A;  1D3Y A;  3IC7 A;  2ZME A;  4ENM A;  3T5X A;  4IPA A;  5D8K B;  3TKY A;  1ONV A;  5D4R A;  1D5V A;  4L5I A;  4ZZD A;  3JTG A;  3IWF A;  1I1S A;  2QUF A;  5FO5 A;  3K0L A;  4ENK A;  2O3F A;  4DQ2 A;  1HSJ A;  2G7U A;  1SFU A;  2RN7 A;  4HAM A;  3MAJ A;  3ZMV A;  2HQN A;  2ADU A;  4IRI A;  1O57 A;  4P55 A;  4HW0 A;  4RAZ A;  1KQ9 A;  3GLX A;  3RKX A;  3L2C A;  1BI0 A;  2W85 A;  2MA3 A;  2UXX A;  2IA1 A;  1XMK A;  3ZQ7 A;  5BPD A;  1KU3 A;  1K78 B;  1R1T A;  1FWZ A;  2WWY A;  1ZYR F;  1IXS B;  2RQP A;  5FFX A;  2L02 A;  1RI7 A;  5D5W B;  1ZG1 A;  2K27 A;  5L3G A;  1UB9 A;  2AXL A;  2LKP A;  4ZYH A;  3KEQ A;  5JHU A;  1SD4 A;  1TBX A;  4D0P A;  1YIO A;  1ZH5 A;  4PZJ A;  1I5Z A;  1W4M A;  4A5M A;  4LK0 F;  2BBY A;  5H6Q A;  3HRU A;  1BN5 A;  3ZN0 A;  2OU2 A;  1X3U A;  4I09 A;  1G3W A;  2NNY A;  3GF2 A;  1PDN C;  3V7R A;  4RGS A;  4G7H F;  4L5J A;  1T2K A;  1IRF A;  3K1P A;  2H09 A;  4HDU A;  1BOA A;  2XRN A;  1KU2 A;  3E5Q A;  4ESB A;  4H0E A;  3ROU A;  1QQI A;  4L9V A;  2YX4 A;  2QQA A;  3HSR A;  4BXU A;  4I0B A;  3DKW A;  2JRT A;  2K4B A;  3NRV A;  2ZNY A;  3B02 A;  3N4M A;  1L0O C;  1TNS A;  4ZH4 F;  1OYW A;  1TQP A;  5K5R A;  3K69 A;  3V4G A;  3QOP A;  3WU1 B;  4DNC A;  1KA8 A;  2Q0O A;  1O3S A;  1U2W A;  2VBX A;  2LF7 A;  1BC7 C;  1BM9 A;  5DEQ A;  4K2E A;  3RIR A;  3R4K A;  2L4M A;  5TJJ A;  1Y0U A;  3WTZ A;  1WRJ A;  3F21 A;  3LAJ A;  1FP2 A;  4WCG A;  5BOX A;  1F9N A;  4CXF A;  2DTR A;  2LDU A;  2PMH A;  2VC1 A;  2KJC A;  3PQK A;  2HYF A;  1J9I A;  2UWM A;  4B09 A;  1OKR A;  1A04 A;  3QP6 A;  2HTS A;  1IN7 A;  4G7Z F;  4JBA A;  5H20 A;  5CLS A;  5CVI A;  2BYV E;  1W7P D;  5LRR A;  2WTE A;  1ZRC A;  3DXJ F;  3LAP A;  1YO5 C;  3HOT A;  3RTR A;  4ESF A;  5FD6 A;  3IRQ A;  1XGO A;  3HTU A;  3HHH A;  3KZZ A;  5CJ9 A;  3VEP A;  4I7H A;  4F7Z A;  1FLI A;  2XAQ A;  3KLO A;  4KYW A;  2MH2 A;  1SFE A;  5K5Q A;  2VE9 A;  5DD4 A;  1UST A;  1K79 A;  1JXS A;  3DEU A;  1FZP B;  3KEO A;  4EVI A;  3BDD A;  3I71 A;  4PDK A;  1B59 A;  3G73 A;  4M73 A;  3J80 Z;  3GZ6 A;  1L3L A;  2KRF A;  1EH6 A;  4PGG A;  3PQJ A;  2XRO A;  5ICG A;  4S04 A;  2ISZ A;  2V79 A;  3SHF A;  1EH8 A;  3RPU A;  3Q9S A;  2PLY A;  2O0Y A;  3ZMS A;  2HYG D;  4EGY A;  3CUQ A;  3E6M A;  3L00 A;  4O6J A;  5ILS A;  2ZFW A;  4HF2 A;  2FF4 A;  4UVC A;  4MEY F;  1WKM A;  1S29 A;  2OZ6 A;  5HLI A;  5D6E A;  5FGM A;  3J7A O;  1I6X A;  4G7O F;  4BNC A;  4U7B A;  3QU3 A;  2E7W A;  2FBK A;  4RGU A;  3GYH X;  2QEN A;  4HZF A;  2W25 A;  3LA3 A;  1T38 A;  2PG4 A;  2W84 A;  3DPT A;  1ZG3 A;  2K7L A;  5E1Z B;  3QRF F;  4LG0 A;  3HSF A;  2DT5 A;  1DPR A;  3QU6 A;  1YLF A;  1YFH A;  4LLL A;  3ZP5 A;  1NHA A;  2EFQ A;  2JT1 A;  3T8T A;  3KLN A;  3I58 A;  5HDK A;  1QZZ A;  1BI2 A;  4CO8 A;  1W5S A;  3H3Z A;  3GFI A;  2D2W A;  1YW9 A;  3KP2 A;  2ETH A;  1ON1 A;  3TO9 A;  1MKM A;  2KJB A;  4UHT A;  5BMZ A;  2BEO A;  2XUB A;  4WF2 A;  4Q47 A;  3GXO A;  4PCQ A;  4LG0 B;  3TGN A;  5E1X A;  4IRG A;  2STW A;  2EV0 A;  1FT9 A;  3LA2 A;  2NS0 A;  4LJZ F;  4HV5 A;  4R79 A;  1H9T A;  3ISP A;  2FQ3 A;  2E7X A;  4A0X A;  3BRO A;  2PEX A;  3KET A;  3COA C;  2WV0 A;  4MQ9 F;  4UVA A;  4M6Y A;  5LGT A;  5HOO A;  1T39 A;  2EFO A;  1BJA A;  3JAM Z;  1BI3 A;  2HQR A;  3O6B B;  2W24 A;  1FNN A;  4UUV A;  3VB2 A;  1DDN A;  3ABU A;  3RI4 A;  3ELK A;  2GIV A;  2DI3 A;  2V1X A;  2P7C B;  3MEX A;  2YU3 A;  3MWM A;  1R58 A;  1P4X A;  3DPL C;  4KUM A;  4OIN F;  4HLX A;  5CVJ A;  5FLX K;  3I54 A;  2M30 A;  2A68 F;  2O61 A;  1R23 A;  4HDV A;  2DBB A;  3MZH A;  3KFW X;  4MHG A;  1W7P B;  4WXD A;  4YG2 F;  1GHC A;  3R6S A;  3KP6 A;  2V1D A;  2L4A A;  1B6A A;  4CHU A;  2DW4 A;  1IXC A;  4Y15 A;  5JI6 A;  1KYZ A;  1ZGJ A;  4ZZL A;  1HW2 A;  4HQM A;  2NYX A;  4L9J A;  3ULQ B;  3T1B A;  1LQ1 A;  1H9G A;  1P6R A;  5ILU A;  1S7O A;  4YIF A;  1CF7 B;  3FWE A;  3JAM K;  5E18 F;  2KIU A;  3BJO A;  4L9N A;  2FOK A;  4P9U A;  5LEJ A;  2DK8 A;  4MQV A;  2JZY A;  2ZJ2 A;  1S3J A;  1E2X A;  1WSU A;  4M74 A;  2XHK A;  1XN7 A;  2HKX A;  1P4A A;  1Z7U A;  2NNN A;  1Z05 A;  2ZXJ A;  2RGV A;  3REO A;  3TDZ C;  4EJV A;  3E5X A;  4CYD A;  2EJR A;  4OMZ A;  4UV8 A;  4P9F A;  2Q2E A;  3GUD A;  2Z3Y A;  4HA8 A;  2OD5 A;  2GA2 A;  3LQR A;  1XD7 A;  3C7J A;  3ZMU A;  4IJA A;  3CDH A;  4M9S A;  1MDM B;  2K4J A;  3IHU A;  1YW7 A;  3RKY A;  4Q4Z F;  1XCV A;  3KP4 A;  3CO7 C;  4MTD A;  2HKO A;  3LWF A;  3HYI A;  1SMT A;  2FU4 A;  2KIF A;  2Y0M A;  2YX7 A;  5LHI A;  2MLK A;  3M8F A;  3F8M A;  3MZY A;  1F4K A;  1J2X A;  2Z5U A;  2M8E A;  4OIQ F;  4LB6 B;  2A69 F;  4MEX F;  3F8F A;  1QGP A;  1USS A;  2DFI A;  4CDG A;  1FPQ A;  1QZY A;  2A61 A;  4ENJ A;  1B1B A;  2HGC A;  3GZ5 A;  5J8F A;  3FXU A;  2CO5 A;  3DFG A;  1WWX A;  1ZRD A;  1Z1D A;  5CYV A;  4BHB A;  4HLY A;  3BJ6 A;  4G6D A;  4KFC A;  1S7A A;  1P92 A;  3E6D A;  1YTY A;  3JSO A;  1ZRF A;  5FFZ A;  1FYK A;  1FBS A;  3V8J A;  1DPU A;  2GQQ A;  1KGS A;  3V8K A;  3C1D A;  3HRM A;  2RNJ A;  2IA2 A;  2ISY A;  2ESN A;  1G4D A;  2H27 A;  1H0M A;  2H94 A;  2IJL A;  2WC2 A;  2XAJ A;  3F3X A;  1ZGA A;  1HW5 A;  5ICF A;  1BI1 A;  5HLH A;  1K7A A;  2UZK A;  2A5Y B;  1U6G A;  3N97 A;  3D5L A;  2OBP A;  3AAF A;  4FT8 A;  1YQA A;  2MD5 A;  2HS5 A;  2P5V A;  2EWN A;  4G6Q A;  2F5D A;  2RC4 A;  1RIO H;  1HST A;  4M9X A;  3IWZ A;  4OMY A;  4IRH A;  3SFZ A;  4A0Z A;  5K1Y A;  2EV5 A;  4I0A A;  3M7G A;  3H92 A;  1IN8 A;  2RKH A;  4EV0 A;  2XKP A;  3FXR A;  1LDD A;  4ZYG A;  5L3C A;  5J6X A;  5JFR A;  4M72 A;  1TW3 A;  2YPR A;  2VT2 A;  2Q8K A;  4L9T A;  4YFK F;  1K6O A;  3ML6 A;  5ERI A;  1XDU A;  1CF7 A;  4G8X A;  5ED4 A;  1IN6 A;  3S2W A;  4ZYE A;  4UV9 A;  2CWE A;  4O5V A;  4FHT A;  4NHJ A;  1IRG A;  4BAY A;  1SD6 A;  1ZAO A;  4I01 A;  2JPB A;  4I02 A;  1YS7 A;  3R0A A;  4UVB A;  1DUX C;  2FMY A;  2VC0 A;  4A0Y A;  2HFH A;  1IF1 A;  1LVA A;  1KU9 A;  3TOA A;  2VON A;  3ZMT A;  3CUQ C;  2C6Y A;  4GYI A;  5BQT A;  1OMI A;  2D1V A;  2P4W A;  1KYW A;  5L3E A;  1U3E M;  1EH7 A;  4KT5 C;  4EGZ A;  1S6L A;  1QO0 D;  4LD5 A;  1XB4 A;  1ON2 A;  2PFB A;  2QBY A;  1LDK B;  3FMQ A;  1MDM A;  1ZN2 A;  4JK1 X;  1HBX G;  3Q5F A;  2XAS A;  4OOI A;  4KIB A;  1D8K A;  1I27 A;  1C0W A;  2P7V B;  3NQO A;  1OYY A;  1JGS A;  3M1E A;  5IT3 A;  1O3R A;  2V9V A;  2IRF G;  4BHC A;  3JSP A;  4HV6 A;  3SZP A;  4HBL A;  4HX8 A;  4U88 A;  2IW5 A;  1FOK A;  2M5W A;  1VTN C;  1KU7 A;  2ZBK A;  3JW4 A;  2DQR A;  3IL2 A;  3TQN A;  3SZT A;  1HKQ A;  4A2U A;  5HDN A;  2DPD A;  2RV8 A;  1ODD A;  5AIQ A;  2QVO A;  2DPU A;  3HIF A;  1LNW A;  1O7F A;  3BP8 A;  5F64 A;  1F1Z A;  1XSV A;  3SQN A;  1SMY F;  1LEA A;  3HHG A;  1CGP A;  1F5T A;  4YII A;  2Z33 A;  1GVJ A;  2CFX A;  3KZY A;  2M87 A;  3R61 A;  3KE2 A;  2P8T A;  2HTJ A;  2F2E A;  2JSC A;  5ICE A;  1KQ0 A;  1UHM A;  2VOO A;  3O2P E;  5ICC A;  4RAY A;  2TDX A;  4LMY A;  3HRS A;  3ZMD A;  4LGW A;  3GFM A;  5E17 F;  2FRH A;  2D45 A;  1JHF A;  4OIR F;  3RDI A;  4RGX A;  1V4R A;  3FZV A;  3CJN A;  3L9F A;  5IT9 K;  5LHH A;  3F23 A;  1HKT A;  2K86 A;  4HX4 A;  3I5U A;  4YFX F;  3F72 A;  4G9Y A;  4MTE A;  1LDJ A;  1U78 A;  4WXH A;  2YR2 A;  3WGH A;  4MGR A;  3PFI A;  2GWR A;  2DU9 A;  3W6K B;  1U5T B;  3I0T A;  2A6E F;  1IAW A;  3F22 A;  3GO5 A;  2M45 A;  5DUK A;  2LSO A;  3K1N A;  3GWZ A;  4E70 A;  4FX0 A;  1OYI A;  2CW0 F;  3CLO A;  3T0Y A;  3TO6 A;  4L0Z B;  1TLH B;  4Y17 A;  3EYI A;  4WK8 F;  3J80 K;  4ON0 A;  2EK5 A;  1J7K A;  4NB5 A;  4RB0 A;  3B73 A;  1YW8 A;  4GCV A;  1ZRE A;  2FE3 A;  3DV8 A;  2IT0 A;  4U0V A;  1O3T A;  4EJO A;  3QPH A;  4HX7 A;  2GZW A;  4CGZ A;  1TNT A;  5LRS A;  4WWC A;  3R0J A;  3TOB A;  1XDS A;  3ERE D;  2G9W A;  3OOP A;  3CTA A;  2Z99 A;  3WGI A;  3I59 B;  3LQQ A;  5FD5 A;  1FY7 A;  4IF4 A;  1B9M A;  3J81 K;  4P96 A;  4M71 A;  1I1G A;  3BPX A;  3VFZ A;  5DCM A;  2UXN A;  4ZYD A;  2VXZ A;  5HS8 A;  2E1C A;  3KP7 A;  3E5U A;  3QPT A;  4IHS A;  1FSH A;  5LBQ A;  4HOB A;  3FM3 A;  4IHT A;  1R36 A;  4KMU X;  3E97 A;  2ZO4 A;  1ULY A;  3IRR A;  1QBJ A;  2EA4 A;  4B8X A;  4L18 B;  2PMU A;  2QBY B;  1QPM A;  5K5O A;  4MNU A;  3HOS A;  3OV8 A;  2VBY A;  2VN2 A;  1Z6R A;  2BE5 F;  1JE8 A;  2FSW A;  3CUO A;  1BC8 C;  3BOQ A;  4I2O A;  2R7D A;  2FEZ A;  4KN4 X;  3V7S A;  3EDP A;  3GEZ A;  1Q1H A;  2PI0 A;  3W6J B;  3WTY C;  1ZLJ A;  3C3W A;  2CQK A;  4AWX B;  5D5X B;  1IW7 F;  1HW1 A;  1JHH A;  1MZB A;  4HF0 A;  2YSR A;  2VOP A;  5DCF A;  1FYL A;  5TRD A;  1FSE A;  3HSE A;  1GXQ A;  1Z91 A;  4EJU A;  4KNY A;  3ZPL A;  3E3V A;  2A3S A;  4KN7 X;  3ECO A;  2KKO A;  1HKS A;  1XSD A;  2GAU A;  1REP C;  3RJP A;  2FNA A;  2GXG A;  4CZZ A;  5FLX Z;  3KP5 A;  5AIP A;  3VOD A;  2OA4 A;  1Z9C A;  3EUH A;  2HEO A;  1J0R A;  2MLG A;  3R60 A;  2KIM A;  3K1M A;  5L3B A;  2VBW A;  2VE8 A;  3GVA A;  5D4S A;  3WTX C;  1YYV A;  2PJP A;  2LF8 A;  1TQM A;  3WE2 A;  2E1N A;  3U2R A;  2STT A;  5IT9 Z;  2G7H A;  3L7W A;  3DP7 A;  4OIP F;  1G3Y A;  1UHW A;  2XAG A;  4TV7 A;  3F6V A;  2XAF A;  4ETS A;  4Q48 A;  1UCR A;  1K78 A;  2CYY A;  3E6C C;  3U1D A;  5HLG A;  3WTS C;  1XCB A;  5E20 A;  4AIH A;  2O8X A;  1KQ8 A;  2D1H A;  3RYR A;  4A5N A;  1R1V A;  4RB1 A;  3EYY A;  2MH9 A;  3VOE A;  5KVR A;  1WI9 A;  2FBH A;  2ACJ A;  1MGT A;  3HTS B;  5HDG A;  2LNB A;  3RKW A;  3KP3 A;  1OR7 A;  1OPC A;  3GFL A;  4U0W A;  2XGX A;  2VT3 A;  4EMS A;  4LB5 A;  4I98 B;  2OAZ A;  1LB2 A;  1B4A A;  2R3S A;  2NRA C;  3F8B A;  1G3T A;  5LGN A;  4LLN A;  4A6D A;  1E17 A;  4BYY A;  4N0B A;  2V1U A;  2F5E A;  2AS5 F;  4AVP A;  2DK5 A;  4RB2 C;  2XAH A;  4RGR A;  3WTU C;  1RZ4 A;  1T98 A;  1LJ9 A;  2XVC A;  3BJA A;  5D5V B;  5EEH A;  2XV4 S;  2O6G E;  4U7D A;  4PGH A;  2ZKZ A;  2FXA A;  1RNL A;  4R8H A;  2GXB A;  3C18 A;  4OIO F;  4L0Y B;  3GX4 X;  2EFP A;  2XIG A;  1R7J A;  1BIB A;  3ECH A;  5KK1 A;  3P7N A;  2ELH A;  2HWV A;  1BBY A;  5EEG A;  1J59 A;  5DV5 A;  4JQF A;  1J75 A;  5DYM A;  1FC3 A;  2QLZ A;  2QQB A;  4M9Z A;  2IPQ X;  4BQA A;  1IZ1 A;  4CIC A;  5A2Q Z;  3I59 A;  2F5F A;  1R5H A;  3KCC A;  3H3U A;  3ZN1 A;  3BY6 A;  3MQ0 A;  2X4H A;  5DCM B;  3D0S A;  4EQQ A;  2HZT A;  2PQ8 A;  1R00 A;  5CVR A;  1ZG5 A;  1EV7 A;  3WE3 A;  1GXP A;  1FBQ A;  2X0L A;  4LFU A;  3FMS A;  1PP7 U;  3FM5 A;  2Y75 A;  2GA1 A;  2EA2 A;  4EJT A;  5CVV A;  4LK1 F;  1R1U A;  2ZCW A;  3P9I A;  2DAO A;  2Z9O A;  2F5C A;  1PUE E;  1W5T A;  1IUY A;  1D8J A;  1T6S A;  3ABT A;  3L09 A;  5L3F A;  3E6B A;  3V7C A;  4ESJ A;  1O7L A;  2R7F A;  1V3F A;  5ILV A;  2L54 A;  1FX7 A;  3JTH A;  1TQI A;  5E8G A;  5A2Q K;  1XGN A;  2BGC A;  3GW2 A;  4Z2Y A;  3WGG A;  2QM3 A;  4A6E A;  1XMA A;  1Z6T A;  1TW2 A;  5J8C A;  1AWC A;  3M8E A;  3FF5 A;  2DQL A;  2QWW A;  2W57 A;  4HYE A;  1BIA A;  2V6C A;  3O3K A;  5LHG A;  4BHP A;  2NAZ A;  1S8N A;  4N9I A;  2M1B A;  2IA0 A;  1TTY A;  1J5Y A;  1FP1 D;  4RB3 C;  3WU0 A;  4LLG F;  1MJB A;  3I64 A;  1XSX A;  2A6H F;  1U5T A;  1YG2 A;  1MJA A;  2HDC A;  5DUI A;  1XGS A;  2CGP A;  2IP2 A;  4ASN A;  1IN4 A;  1AOY A;  3FHZ A;  4S05 A;  6PAX A;  1LEB A;  4YFN F;  5HS9 A;  2A07 F;  2MBF A;  2IVM A;  3EQL F;  5E1W A;  3P9C A;  3TO7 A;  2VBZ A;  4XLP F;  2DO7 A;  3J81 Z;  3GFJ A;  5AON A;  3LFK A;  4XSZ F;  4WX9 A;  4HQE A;  4WXC A;  2O03 A;  1RUN A;  5DD8 A;  3LST A;  1IXR C;  4UNO A;  3BWG A;  2MC3 A;  2QZ8 A;  1P4W A;  1SD5 A;  2FBI A;  2OQG A;  4GXO A;  4M6X A;  3MCZ A;  4N9H A;  2VOD A;  4AIK A;  3NEU A;  3LA7 A;  3DF8 A;  1RUO A;  3IKV A;  5F1R A;  2QQ9 A;  4BH9 A;  5F6F A;  3QP5 A;  5FB2 A;  5L3D A;  2OQR A;  4ENN A;  3HUG A;  5HS7 A;  1G6N A;  2HR3 A;  1SFX A;  1WQ2 A;  1ZLK A;  3FXQ A;  2P6T A;  2P5L C;  3ZMZ A;  2RDP A;  3K2Z A;  3EET A;  4HF1 A;  4IVN A;  4EM1 A;  4EM2 A;  1R5G A;  2FA5 A;  5JVT A;  2RVC A;  4XLN F;  1U5T C;  2ZME B;  4FX4 A;  5CVU A;  4KIG A;  4XBF A;  3WTV C;  3MFK A;  1G3S A;  4XRF A;  3V8L A;  2HOE A;  3T8R A;  3HRT A;  1MJ9 A;  3SXY A;  4IXA A;  3FX3 A;  1SAX A;  2PBI A;  2PN6 A;  2EB7 A;  1STZ A;  5LLQ A;  3DQV C;  3WTW C;  1ZHF A;  2BV6 A;  3Q9V A;  2B0L A;  1ZAR A;  4A12 A;  1FBU A;  5DDG A;  2XKO A;  3I4P A;  2CG4 A;  1IN5 A;  3BZ6 A;  3IKT A;  4Y13 A;  4R1H A;  1MD0 A;  3QAH A;  1UFM A;  2J5O A;  4AIJ A;  2EV6 A;  4QLC U;  2EFW A;  3P9K A;  5H6R A;  4KDP A;  4AD9 A;  3M9A A;  2DLL A;  4GYG A;  2JTV A;  4GO1 A;  2CSO A;  2FNP A;  5BS6 A;  2ZNZ A;  1O3Q A;  1PP8 F;  1FYM A; 
#chains in the Genus database with same CATH topology
 3FMR A;  4QWQ A;  2QYO A;  4NQW A;  3LOC A;  2M8G X;  1Z7L A;  3F8N A;  3PIO F;  3BPV A;  3U9G A;  4BKX A;  1YS6 A;  5BPI A;  2P6S A;  5LGU A;  4O3M A;  3L2W A;  2IS2 A;  2K02 A;  3F8C A;  4D1Q A;  3QQA A;  2BVL A;  2HU9 A;  4DBR A;  1W7P A;  3F6O A;  1U8B A;  2VIX A;  5HVQ C;  2IGK A;  1VQ9 I;  1U8R A;  2QCO A;  5LEK A;  2ESH A;  4G94 A;  1QNT A;  1DP7 P;  2XGE A;  5F0H A;  4Y7N J;  3WOD F;  3I53 A;  3G3Z A;  2Y48 A;  1WJB A;  3K7A J;  4RS8 A;  2AQE A;  4XSX F;  4OU0 A;  2DDB A;  3WG9 A;  3WTT C;  2L01 A;  4P5O A;  1T0F A;  4KMF A;  5D5U B;  3HOW J;  2H6C A;  1SD7 A;  3AG1 H;  1ZR4 A;  3CF5 F;  4RAG A;  1B9N A;  1HQC A;  4EJW A;  2OZU A;  3OSG A;  1UAA A;  5DM6 F;  5JR3 A;  4XK4 A;  3CO6 C;  3JRI A;  1YOV B;  5JVG F;  3K9T A;  1HXD A;  4RA2 A;  2COM A;  2JPC A;  4EM0 B;  1F43 A;  2ECC A;  2P5K A;  4FIS A;  1WVR A;  2H6B A;  3RPQ A;  3K4J A;  2BVM A;  1P2F A;  3TDU C;  2FML A;  2KP6 A;  1R22 A;  2L3D A;  3K4K A;  3CUQ B;  2L9V A;  5D6F A;  3RYP A;  2LFB A;  4JP0 A;  1VQL I;  5D8L B;  2J5P A;  2G0E A;  3JRD A;  4KA4 A;  4KIC A;  4UXN A;  4Q5S F;  5E8I A;  4GGG A;  4KIF A;  4U0Y A;  2EFN A;  4IOA F;  4XKV A;  1XGM A;  2W82 A;  1D3Y A;  2BW3 B;  3IC7 A;  1Y6I A;  2ZME A;  3U21 A;  4ENM A;  3BG7 A;  3BG5 A;  3T5X A;  3FDY A;  2K85 A;  4XM3 A;  2LY1 A;  2QF7 A;  4IPA A;  3RPU D;  2ZB9 A;  3TKY A;  5D8K B;  1ONV A;  5D4R A;  1D5V A;  2R4G A;  4L5I A;  4ZZD A;  2HVS A;  4IHX A;  1PUF B;  5CQG A;  3LSP A;  3JTG A;  2R7W A;  5B3S H;  1G59 A;  2DMT A;  3IWF A;  3KZI C;  4HST A;  1I1S A;  2XRL A;  2EH3 A;  2QUF A;  5FO5 A;  3K0L A;  4ENK A;  2CH0 A;  1RR8 C;  2O3F A;  5B66 C;  3OY9 A;  2VAS A;  4DQ2 A;  3OIQ A;  2DA2 A;  1HSJ A;  2DA3 A;  2G7U A;  1SFU A;  4RBO A;  2DFE A;  2RN7 A;  4HAM A;  3MAJ A;  3ZMV A;  2HQN A;  1UHS A;  4RAF A;  4CA0 A;  2KRC A;  1OCZ H;  4FCY A;  3PM1 A;  3HKZ N;  3DLA A;  2H8R A;  2ADU A;  2MYS A;  4IRI A;  1O57 A;  1YHQ I;  4P55 A;  4HW0 A;  4RAZ A;  4GDF A;  1KQ9 A;  3GLX A;  1POG A;  2WA0 A;  3DBR B;  3RKX A;  5HNF A;  3L2C A;  3S93 A;  1BI0 A;  2A5W A;  2A6T A;  5FKN A;  1GDT A;  2W85 A;  3FKI J;  3CC4 I;  2MA3 A;  1XG1 A;  2UXX A;  1LVK A;  2IA1 A;  5GP9 A;  2HZD A;  1XMK A;  2H1K A;  3ZQH A;  3ZQ7 A;  5BPD A;  2F4M B;  1KU3 A;  2R7T A;  3OYJ A;  1P9Q C;  3H36 A;  2OTJ I;  1X58 A;  2Q2E B;  2XGC A;  1K78 B;  1R1T A;  1FWZ A;  2DFF A;  2WWY A;  1ZYR F;  1IXS B;  2RQP A;  5FJ8 J;  5FFX A;  2L02 A;  4C2U A;  3OS1 A;  1ZQ3 P;  3PNY A;  1RI7 A;  5F1J A;  2LD5 A;  5D5W B;  1ZG1 A;  2K27 A;  5L3G A;  1QVU A;  1PUF A;  1K83 J;  1YJ9 I;  2FX0 A;  1UB9 A;  2AXL A;  1OCR H;  3FIS A;  1MBH A;  5CKT A;  2LKP A;  1VQ7 I;  4ZYH A;  4V2F A;  5EG0 A;  3KEQ A;  3OR1 C;  3E0J B;  3ZXS A;  3S3N A;  1AHD P;  3BR3 A;  5JHU A;  1TL8 A;  1SD4 A;  1TBX A;  3DTE A;  2QSF X;  4D0P A;  1X3W B;  1ITY A;  4KIT B;  1YIO A;  3BG3 A;  1IJW C;  1ZH5 A;  4PZJ A;  2JSP A;  1I5Z A;  1W4M A;  4A5M A;  4LK0 F;  2BBY A;  3I4N J;  5H6Q A;  3W2A A;  3HRU A;  2Y0S A;  3RSN A;  1BN5 A;  3ZN0 A;  4A3F J;  1JT0 A;  2OU2 A;  3IP4 B;  3B6C A;  1X3U A;  4I09 A;  2JN6 A;  1G3W A;  5GTH C;  2NNY A;  1E0E A;  4IQJ A;  2IAI A;  3GF2 A;  3GTG J;  1A35 A;  3N05 A;  1PDN C;  3LMM A;  3V7R A;  4RGS A;  2GM4 A;  2X51 A;  4G7H F;  3K4M A;  4L5J A;  5J4V A;  1T2K A;  1IRF A;  3IH2 A;  3K1P A;  2CW7 A;  4XN0 A;  3BT9 A;  2H09 A;  4HDU A;  1Z3X A;  5IPA A;  1BOA A;  2DA6 A;  1KU2 A;  2AHQ A;  2XRN A;  3E5Q A;  3K2A A;  4CCM A;  4ESB A;  2IS4 A;  4GRI A;  4H0E A;  3ROU A;  1MNM C;  3BR2 A;  1QQI A;  1SVO A;  4L9V A;  3HSR A;  2QQA A;  2YX4 A;  3TL4 X;  1HA8 A;  4BXU A;  1GVD A;  4I0B A;  3DKW A;  1S5L C;  3E7L A;  2JRT A;  2K4B A;  3NRV A;  5FKM A;  2ZNY A;  4A3E J;  2R7O A;  3B02 A;  3N4M A;  1L0O C;  4CCN A;  2JA5 J;  1TNS A;  4ZH4 F;  1OYW A;  1TQP A;  4W97 A;  1LE8 B;  3I56 I;  3QOE A;  5K5R A;  3I9V 2;  3HDD A;  3K69 A;  3V4G A;  3VYR B;  2EZK A;  3QOP A;  3WU1 B;  4DNC A;  1KA8 A;  2X6Y A;  2Q0O A;  1O3S A;  1D0Z A;  1Z0X A;  1U2W A;  2IBD A;  2LH9 A;  3L1P A;  2VBX A;  2LF7 A;  5IYB J;  1BC7 C;  1BM9 A;  5DEQ A;  2M7B A;  3H5A A;  3UKG A;  4K2E A;  1W5C C;  4PJJ A;  3RIR A;  5DS9 A;  3R4K A;  2BZT A;  2L4M A;  3K70 D;  2NS7 A;  1A6Q A;  5TJJ A;  3DTI A;  3OWT A;  1Y0U A;  3WTZ A;  5GPC A;  1WRJ A;  2M4G A;  3F21 A;  3LAJ A;  2OCC H;  3ZRG A;  1FP2 A;  4WCG A;  5BOX A;  2PJR A;  1F9N A;  2DTR A;  4CXF A;  2K9N A;  2LDU A;  2PMH A;  2VC1 A;  2KJC A;  3S3M A;  3PQK A;  2BY0 A;  2HYF A;  2K9Q A;  1J9I A;  2P81 A;  4BQQ A;  2UWM A;  2UV1 A;  3KYD B;  3LSK A;  4B09 A;  1OKR A;  1A04 A;  2O9L A;  2MG4 A;  3S1N J;  3QP6 A;  2HTS A;  4A3J J;  1IN7 A;  4G7Z F;  4JBA A;  3F9K A;  5CLS A;  5H20 A;  5CVI A;  2BYV E;  3EUK L;  1W7P D;  5LRR A;  2VB6 A;  2WTE A;  1ZRC A;  3DXJ F;  3LAP A;  1YO5 C;  3HOT A;  3RTR A;  4ESF A;  5FD6 A;  3A4C A;  3IRQ A;  1XGO A;  1TWH J;  3HTU A;  4UUS B;  3HHH A;  3KZZ A;  5CJ9 A;  3VEP A;  3IH4 A;  5IP7 J;  3AG3 H;  5LD2 C;  4DGW B;  4OAZ A;  1QZE A;  4I7H A;  4F7Z A;  3LSJ A;  3SYT A;  2OUM A;  3BTI A;  1FLI A;  2XAQ A;  3KLO A;  2HYJ A;  3OL3 A;  4KYW A;  2MH2 A;  1SFE A;  2NVY J;  5K5Q A;  5CQE A;  3CCV I;  2VE9 A;  3BC8 A;  1T08 B;  5DD4 A;  4PJL A;  1UST A;  5IYD J;  1K79 A;  1JXS A;  1H89 C;  5JLW A;  3DKX A;  2VXD A;  3DEU A;  3DWL E;  1FZP B;  3KEO A;  4EVI A;  4NC8 A;  2F48 A;  3BDD A;  2VKD A;  2WAE A;  3I71 A;  4XKW A;  2LP0 A;  2DMQ A;  4M3F A;  1RRJ A;  1H8A C;  4PDK A;  1B59 A;  3G73 A;  4M73 A;  3J80 Z;  2QSG X;  3QPL A;  3GZ6 A;  1VQ4 I;  1L3L A;  2MGQ A;  2DOD A;  3K4B A;  2KRF A;  1A36 A;  1I6H J;  3PSF A;  1EH6 A;  4PGG A;  2DA5 A;  1SAN A;  3CCE I;  1MBF A;  2W4S A;  3CCU I;  3PQJ A;  1SAU A;  2XRO A;  2E2I J;  5ICG A;  1YJN I;  4S04 A;  1P7J A;  1X1D A;  2ISZ A;  2XSD C;  3B6A A;  2V79 A;  3SHF A;  1EH8 A;  3RPU A;  3HOX J;  3Q9S A;  2PLY A;  1R4N B;  2O0Y A;  2UUZ A;  3ZMS A;  4AUX A;  5C4X J;  4M6V A;  2HYG D;  4EGY A;  1AU7 A;  3CUQ A;  4V19 K;  3E6M A;  4RLF A;  5IOZ A;  5E3L A;  1UMQ A;  3L00 A;  2EIJ H;  4O6J A;  5ILS A;  5EYR A;  2ZFW A;  4HF2 A;  2FF4 A;  2LYC A;  2VQH A;  2O7O A;  4UVC A;  3A1Y A;  1WZ2 A;  1MBJ A;  4MEY F;  1YRN A;  2PX9 A;  1WKM A;  1IRX A;  4DJA A;  4A3G J;  1S29 A;  3OS2 A;  2R93 J;  2FOW A;  2OZ6 A;  5HLI A;  5D6E A;  5FGM A;  2ZJQ F;  3K4N A;  2R7U A;  1MND A;  1ZR2 A;  3J7A O;  1I6X A;  2VPL A;  3SEQ A;  4G7O F;  2R5Z B;  4JOM A;  4BNC A;  3QU3 A;  4U7B A;  2E7W A;  2FBK A;  4RGU A;  3CJT B;  1ETO A;  2DJN A;  4XON A;  3GYH X;  2QEN A;  4HZF A;  2W25 A;  4MFD A;  1WPK A;  3PIP F;  2BHY A;  3LA3 A;  3S2D J;  1T38 A;  2PG4 A;  4NUB A;  2W84 A;  3DPT A;  4ABZ A;  2ICW G;  3U1K A;  3S8P A;  1ZG3 A;  5KNL A;  2JUC A;  2K7L A;  5E1Z B;  5E79 C;  2XPW A;  3QRF F;  3AG4 H;  5E3O A;  4LG0 A;  1A5J A;  4BY1 J;  3HSF A;  4XOR A;  1IDZ A;  2DT5 A;  2R7X A;  3BQZ A;  1DPR A;  3QU6 A;  2XB5 A;  3BQY A;  5M3M J;  2ZSI B;  1YLF A;  2COB A;  4YIR X;  1YFH A;  2X1E A;  1NG7 A;  4LLL A;  3ZP5 A;  4LG3 A;  2R5Y A;  1NHA A;  1PYV A;  2EFQ A;  2JT1 A;  5J1R A;  1ENH A;  3T8T A;  3BTJ A;  1ORK A;  3DU5 A;  2JVG A;  3KLN A;  3I58 A;  5HDK A;  1QZZ A;  1BI2 A;  4CO8 A;  1W5S A;  3C2G A;  3H3Z A;  3ZR8 X;  3GFI A;  2D2W A;  2MAB A;  3QYE A;  1X1P A;  1YW9 A;  1MMN A;  2KZV A;  3KP2 A;  4JX4 A;  4PJN A;  2HDW A;  4B48 A;  1WHU A;  3CC2 I;  3TP0 A;  2ETH A;  1ON1 A;  1XPX A;  4L5E A;  3TO9 A;  1IO2 A;  3VYS B;  1MKM A;  2KJB A;  3HPH A;  2LRE A;  4UHT A;  4IHY A;  1GUU A;  5BMZ A;  2BEO A;  2HVQ A;  4C3H J;  4MIM A;  2OTL I;  1OJL A;  2K5C A;  3ASN H;  2EPF A;  2XUB A;  4WF2 A;  4Q47 A;  1JUS A;  3GXO A;  4PCQ A;  4CCK A;  4LG0 B;  3BZK A;  3TGN A;  5E1X A;  4IRG A;  2STW A;  3S15 J;  2DA1 A;  2CMP A;  2EV0 A;  3KPH A;  1FT9 A;  2VJJ A;  4DZJ A;  1E3O C;  1TP4 A;  3HB9 A;  4LOC A;  1LE8 A;  4A3K J;  2QSH X;  3LA2 A;  2NS0 A;  4LJZ F;  4HV5 A;  3VSL A;  4R79 A;  1H9T A;  3ISP A;  4F3Q A;  3TBI A;  2FQ3 A;  1OQY A;  2E7X A;  3CJQ B;  5IOY A;  4A0X A;  3BRO A;  3ZQG A;  2PEX A;  2KDZ A;  3KET A;  2DT6 A;  2VKV A;  3COA C;  1R49 A;  2WV0 A;  1Z77 A;  3BR5 A;  4MQ9 F;  4UVA A;  4M6Y A;  5LGT A;  5HOO A;  1FIP A;  1W36 D;  2FJ1 A;  1MH3 A;  1R71 A;  1T8I A;  1T39 A;  1ACI A;  2EFO A;  5FLV A;  1BJA A;  1RES A;  3JAM Z;  2JA8 J;  1BI3 A;  2HQR A;  4KIS A;  4G6T B;  1WJD A;  3O6B B;  2GBY A;  1LFB A;  2W24 A;  2Y9Z A;  1FNN A;  4BE1 A;  4UUV A;  2LG4 A;  3VB2 A;  1DDN A;  2XGD A;  3G1O A;  5B5E C;  1ETY A;  3ABU A;  5FKK A;  3RI4 A;  2X1C A;  5J1U A;  1X3Z B;  3ELK A;  2DYS H;  2GIV A;  2DI3 A;  1W36 C;  2V1X A;  4HEA 2;  2P7C B;  2V26 A;  3GTO J;  3MEX A;  2YU3 A;  1LFU P;  1ETX A;  3MWM A;  1R58 A;  4RM3 A;  3CLQ A;  1P4X A;  4RDU A;  4DIQ A;  3DPL C;  3HEF A;  2VQL A;  4JYK A;  4KUM A;  4OIN F;  4HLX A;  5CVJ A;  1ZK8 A;  2XAU A;  4XKB A;  5FLX K;  3I54 A;  4F55 A;  1YIT I;  2M30 A;  2A68 F;  2O61 A;  1BOB A;  1R23 A;  3CCS I;  4KJZ A;  4HDV A;  2DBB A;  3MZH A;  3KFW X;  3I3L A;  1Y39 A;  4MHG A;  2QKM B;  1W7P B;  4WXD A;  4YG2 F;  5C4J J;  1GHC A;  3R6S A;  3KP6 A;  4HSR A;  1MIJ A;  2TCT A;  1XTA A;  1B72 A;  2V1D A;  3CDL A;  4J00 A;  3CES A;  1MBK A;  2L4A A;  4CSW A;  1ZGW A;  2DMU A;  1MMS A;  1B6A A;  4CHU A;  2DW4 A;  2KRH A;  4ZDO A;  1IXC A;  5J3L A;  4M3D A;  4Y15 A;  5JI6 A;  3MKZ A;  3GTQ J;  1KYZ A;  1ZGJ A;  4ZZL A;  5A2Q K;  1HW2 A;  1V5G A;  4HQM A;  1UJ8 A;  2NYX A;  4OWR B;  2L5Q A;  3DU6 A;  4L9J A;  3ULQ B;  3T1B A;  1LQ1 A;  5HOD A;  1X19 A;  3CP2 A;  2OCE A;  3S16 J;  3MZ8 A;  2JA6 J;  1H9G A;  1ZTR A;  1P6R A;  5ILU A;  4II3 A;  1S7O A;  3D5R C;  4YIF A;  1CF7 B;  3FWE A;  2BOL A;  3OR2 C;  3JAM K;  2Y9Y A;  3JRA A;  4DYQ A;  1QHG A;  3BZC A;  5E18 F;  1JUP A;  2KIU A;  2DOF A;  4QSH A;  1AKH A;  3BJO A;  2VJ5 A;  3CCJ I;  1F36 A;  4L9N A;  2FOK A;  4XRM A;  1UG0 A;  4P9U A;  2NOG A;  3H9J A;  1SFK A;  5LEJ A;  2DK8 A;  1JTX A;  4MQV A;  4FE4 A;  2JZY A;  2H1L A;  3S1M J;  2ZJ2 A;  4X0G A;  3FK7 A;  2WY8 Q;  1S3J A;  3HL2 A;  1E2X A;  1WSU A;  4XKC A;  4M74 A;  2XHK A;  1XN7 A;  2HKX A;  3OSF A;  1P4A A;  1Z7U A;  2WV1 A;  1QU3 A;  2NNN A;  2BY2 A;  1Z05 A;  2ZXJ A;  2RGV A;  1QPI A;  3REO A;  3F0C A;  3TDZ C;  4B43 A;  4EJV A;  4Z6Y A;  1Y8R B;  3E5X A;  4CYD A;  2EJR A;  2Y30 A;  4OMZ A;  4UV8 A;  3FXO A;  4P9F A;  4BGD A;  1N78 A;  5HLT A;  2Q2E A;  3DTK A;  3GUD A;  2Z3Y A;  2JA7 J;  4HA8 A;  2OD5 A;  5C3E J;  2GA2 A;  3LQR A;  5IP9 J;  1XD7 A;  2MC4 A;  3C7J A;  4FQG A;  1YX3 A;  3ZMU A;  4IJA A;  2DA4 A;  3CDH A;  5B1B H;  2ID6 A;  2L7Z A;  4M9S A;  1WJA A;  2DMP A;  1MDM B;  2K4J A;  3IHU A;  1YW7 A;  3RKY A;  4Q4Z F;  3ZQF A;  1IRZ A;  2DJI A;  3A01 A;  1XCV A;  3KP4 A;  3CO7 C;  2JA2 A;  4MTD A;  3D1N I;  2HKO A;  5H2F C;  4IHV A;  3LWF A;  1S72 I;  2Z1D A;  4ZYA A;  4DZP A;  2M0C A;  3HYI A;  1SMT A;  2VKH A;  2FU4 A;  1SVM A;  2M9H A;  4A3I J;  4PJM A;  2KIF A;  2Y0M A;  3RZD J;  1JKQ C;  2HDD A;  2YX7 A;  2DFH A;  5LHI A;  5EZH A;  2MLK A;  3M8F A;  3F8M A;  2TRT A;  3NAR A;  3MZY A;  1NTC A;  1F4K A;  1J2X A;  5GAD J;  2Z5U A;  2M8E A;  4OIQ F;  4LB6 B;  1MW7 A;  2A69 F;  4MEX F;  2KIQ A;  3F8F A;  4XOT A;  4D5F A;  2LBF B;  1BA5 A;  5J47 A;  1MNE A;  2Y69 H;  4RMN A;  5EG0 B;  1QGP A;  5J4Y A;  3OYL A;  2VKE A;  1USS A;  2DFI A;  3MKY B;  1LUJ B;  4IL6 C;  4N4N B;  4CDG A;  5GPA A;  1FPQ A;  1QZY A;  4A69 C;  2L9N A;  2A61 A;  2L9S A;  1B1B A;  4ENJ A;  3PFY A;  2HGC A;  3GZ5 A;  3ZOB A;  5J8F A;  3FXU A;  2JJ7 A;  2DCE A;  1VI0 A;  1WH5 A;  3RKQ A;  2CO5 A;  4Y33 A;  3DFG A;  2KZG A;  1WWX A;  3HPG A;  3QOD A;  2L7K A;  1ZRD A;  3W3C A;  3PO3 J;  3PJR A;  1Z1D A;  3OYE A;  9ANT A;  3MN2 A;  5CYV A;  2LC2 A;  4BHB A;  3DEE A;  4PSW A;  2KT0 A;  2F6C A;  4C3I J;  4HLY A;  3BJ6 A;  4G6D A;  5CPR B;  4KFC A;  1S7A A;  1P92 A;  1T95 A;  1EA3 A;  1P7I A;  3E6D A;  1YTY A;  3JSO A;  2VQG A;  1ZRF A;  5FFZ A;  1FYK A;  4AYB A;  1FBS A;  2F4O B;  3RZO J;  3V8J A;  1NG6 A;  1DPU A;  2GQQ A;  1Y1W J;  3E1S A;  1KGS A;  3V8K A;  2BY3 A;  2LK2 A;  3C1D A;  3HRM A;  2RNJ A;  1W1W E;  2IA2 A;  2ISY A;  2ESN A;  1G4D A;  2O8K A;  3HKZ A;  5B1A H;  2H27 A;  3TED A;  2X48 A;  2DYR H;  1Y1V J;  3F3X A;  2XAJ A;  2H94 A;  2IJL A;  2WC2 A;  1H0M A;  1TWA J;  1Z3Y A;  1ZGA A;  3OS0 A;  3A0B C;  1HW5 A;  3G1M A;  5ICF A;  1RR7 A;  1D0Y A;  1JKR C;  3WHC A;  1BI1 A;  5HLH A;  1K7A A;  2IGO A;  3IAM 2;  2UZK A;  2GOX B;  2A5Y B;  3OL4 A;  1I39 A;  1U6G A;  3N97 A;  2RRE A;  3D5L A;  1HOM A;  4IKF A;  1EKE A;  2JQ7 A;  2EIM H;  4BXX J;  2OBP A;  3HUG B;  4FE7 A;  5M5W J;  1Y8Q B;  3AAF A;  2JWT A;  4FT8 A;  1YQA A;  4X1E A;  2MD5 A;  2HS5 A;  3LL7 A;  2P5V A;  5FRM A;  2EWN A;  5E3M A;  4G6Q A;  2F5D A;  1U0J A;  2RC4 A;  3PUB A;  1RIO H;  3HG9 A;  1HST A;  3QYB A;  3IWZ A;  4M9X A;  2HVR A;  4OMY A;  2CJJ A;  4IRH A;  1R6R A;  3SFZ A;  2CUF A;  4A0Z A;  5K1Y A;  2EV5 A;  3HOY J;  2W48 A;  2R5Y B;  4I0A A;  3M7G A;  2A05 A;  2I8D A;  3H92 A;  1IN8 A;  2V1N A;  5TGT A;  2RKH A;  4EV0 A;  2XKP A;  3FXR A;  2JMW A;  1LDD A;  2WY7 Q;  2CW8 A;  4W1U A;  4ZYG A;  5L3C A;  2E34 A;  1NK3 P;  3CME I;  5J6X A;  5JFR A;  5LFA A;  4M72 A;  1TW3 A;  2YPR A;  4PUS A;  2VT2 A;  2Q8K A;  4L9T A;  4YFK F;  4YRV A;  1X2N A;  1DU0 A;  3FXJ A;  1XS9 A;  1K6O A;  1N25 A;  3FXM A;  3M8J A;  3ML6 A;  5ERI A;  3I55 I;  1K61 A;  1ETQ A;  2V7F A;  1EJ9 A;  1XDU A;  1CF7 A;  4G8X A;  5ED4 A;  3I4M J;  1IN6 A;  4FAS D;  3S2W A;  2M0M A;  1I3Q J;  4ZYE A;  3ASO H;  4UV9 A;  1I50 J;  2CWE A;  1AA7 A;  1YRN B;  4O5V A;  4FHT A;  5IY5 H;  4NHJ A;  1IRG A;  4BAY A;  2XB0 X;  4RLQ A;  1SD6 A;  1ZAO A;  3JRH A;  2LMD A;  1V5F A;  4BE2 A;  4I6Z A;  4I01 A;  2HPI A;  3G4S I;  2JPB A;  4I02 A;  3CMM A;  2LKS A;  3S1R J;  1YS7 A;  3GME A;  3R0A A;  4UVB A;  2V4J C;  2WB1 A;  2KMU A;  2E1O A;  2FMY A;  1DUX C;  2VC0 A;  1ETW A;  4A0Y A;  2HFH A;  4AU7 A;  3O8G A;  1LVA A;  1IF1 A;  1KU9 A;  1MMD A;  2H8W A;  3TOA A;  2R5Z A;  3GZN B;  2VON A;  4KT6 A;  3ZMT A;  3CUQ C;  2C6Y A;  2Z16 A;  4GYI A;  1DU6 A;  5BQT A;  1SC7 A;  1OMI A;  1WJE A;  2QEX I;  2D1V A;  2P4W A;  3Q0V A;  3LSG A;  1KYW A;  4E6K G;  5L3E A;  1U3E M;  1EH7 A;  5EGO B;  4KT5 C;  2M2E A;  2IGN A;  4EGZ A;  1S6L A;  3CP8 A;  4BDY A;  1QO0 D;  4UB8 C;  4LD5 A;  2M7A A;  2Y2Z A;  3HBL A;  4MLO A;  1XB4 A;  1FIA A;  4NNJ A;  2B9S A;  1ON2 A;  2XF6 A;  2PFB A;  2QBY A;  1LDK B;  3RCO A;  2ME6 A;  2NVU B;  3FMQ A;  1MDM A;  1ZN2 A;  4YEJ A;  4MO7 A;  1WFX A;  4JK1 X;  1HBX G;  3Q5F A;  2XAS A;  4OOI A;  4C2T A;  3HJE A;  4C3J J;  3CC7 I;  4KIB A;  1BL0 A;  1D8K A;  1I27 A;  1C0W A;  3M1C A;  1IUF A;  2P7V B;  3NQO A;  1OYY A;  3ERM A;  3FBN B;  1JGS A;  3M1E A;  5IT3 A;  1O3R A;  2V9V A;  2IRF G;  4HPQ A;  2MFZ A;  3OYG A;  3RQI A;  4E4H A;  4BHC A;  3SDG A;  3JSP A;  3A02 A;  2JUG A;  2JRM A;  4HV6 A;  3SZP A;  2LLK A;  4MFE A;  3V42 A;  4UY8 I;  1GLN A;  4HBL A;  4HX8 A;  3NWT A;  4U88 A;  2IW5 A;  3JRG A;  1Z67 A;  1FOK A;  4XLC A;  4LIV A;  2M5W A;  3HZJ A;  2VI6 A;  1VTN C;  1KU7 A;  2OJE D;  3BR6 A;  2ZBK A;  3JW4 A;  1EF4 A;  2DQR A;  4NC7 A;  4B3X A;  3IL2 A;  3TQN A;  2M3A A;  3SZT A;  1HKQ A;  2XPV A;  4A2U A;  5HDN A;  2RV8 A;  5AIQ A;  1ODD A;  2DPD A;  3S14 J;  2QVO A;  2DXI A;  2ZME C;  3QWL A;  4F52 A;  1WCM J;  2DPU A;  3WG7 H;  1RKT A;  3HIF A;  1LNW A;  1O7F A;  3BP8 A;  3CQZ J;  4V2G A;  5F64 A;  1JKO C;  3J7A Y;  2E36 A;  1F1Z A;  3SZG A;  1OCP A;  4XR6 A;  1XSV A;  3SQN A;  2LOO A;  3OIO A;  1GT0 C;  1SMY F;  4ANJ A;  1LEA A;  1FEX A;  3HHG A;  1CGP A;  1F5T A;  2K9L A;  3LSM A;  5F0C A;  3OYM A;  2YS9 A;  1HLV A;  4YII A;  1H88 C;  2Z33 A;  1VFC A;  1GVJ A;  3AL0 B;  2CFX A;  3KZY A;  2M87 A;  2E71 A;  3R61 A;  1IV8 A;  3LSR A;  4HRI A;  3DEW A;  4E7Z A;  3KE2 A;  2P8T A;  5J40 A;  1X1B A;  1B72 B;  4CUG A;  3GBG A;  2HTJ A;  1B8I B;  2F2E A;  2JSC A;  3O8H A;  5GAH J;  5ICE A;  1K4T A;  1KQ0 A;  1UHM A;  2VOO A;  3O2P E;  2M4K A;  5ICC A;  4RAY A;  1Z21 A;  4NBQ A;  2TDX A;  4LMY A;  3G6E I;  3HRS A;  3ZMD A;  4DYR A;  1W0T A;  1BR2 A;  1FTZ A;  4LGW A;  3GFM A;  4B4C A;  3D5S C;  3FK6 A;  2CRG A;  3ABM H;  5E17 F;  2FRH A;  2D45 A;  2ECB A;  1JHF A;  4OIR F;  3VYT B;  3RDI A;  1IG7 A;  4RGX A;  1V4R A;  1IC8 A;  3FZV A;  1ETV A;  3CJN A;  1MH4 A;  3L9F A;  5EDN A;  4ZTF A;  5IT9 K;  4E7K A;  5LHH A;  3F23 A;  1HKT A;  2K86 A;  2EQR A;  4HX4 A;  4E7L A;  3I5U A;  4A3C J;  2CQN A;  4YFX F;  3S32 A;  3F72 A;  2XF5 A;  3PL8 A;  4G9Y A;  4MTE A;  1LDJ A;  1U78 A;  5M5Y J;  4WXH A;  3S2H J;  2HOA A;  2YR2 A;  3WGH A;  4MGR A;  3PFI A;  3OYF A;  2GWR A;  3TW7 A;  1MBG A;  2DU9 A;  2PMZ A;  4BQO A;  3W6K B;  3JRE A;  1VQ8 I;  3ZQQ A;  1U5T B;  2IGM A;  3I0T A;  1ZKG A;  2A6E F;  1MSF C;  1IAW A;  3F22 A;  3GO5 A;  2XC7 A;  2M45 A;  5DUK A;  1A6I A;  2LSO A;  3K1N A;  3GWZ A;  4E70 A;  4FX0 A;  4XIC A;  1JT6 A;  1OYI A;  2ZJR F;  2CW0 F;  2LY9 A;  3CLO A;  3T0Y A;  3TO6 A;  3VPR A;  4L0Z B;  1WJF A;  2X9D A;  3VDX A;  4IEJ A;  2HPM A;  1TLH B;  2GOM A;  3GLL A;  2WAQ N;  4Y17 A;  3EYI A;  2DN0 A;  4WK8 F;  3J80 K;  4ON0 A;  3S1Q J;  2EK5 A;  4X6A J;  1J7K A;  3A01 B;  3OYC A;  4NB5 A;  4RB0 A;  3B73 A;  1YW8 A;  3BR1 A;  1FOX A;  4GCV A;  2WAQ A;  2GXA A;  1ZRE A;  2FE3 A;  3TW6 A;  2OF7 A;  3DV8 A;  2IT0 A;  4U0V A;  3BTC A;  4UUT A;  1O3T A;  3MKL A;  4EJO A;  2RAE A;  1X1A A;  3QPH A;  4HX7 A;  4JX5 A;  2GZW A;  4CGZ A;  2R92 J;  4A3L J;  1RPW A;  1TNT A;  2B63 J;  5LRS A;  4WWC A;  3R0J A;  3TOB A;  1U9N A;  1XDS A;  4Y3O A;  3ERE D;  4F92 B;  2G9W A;  3OOP A;  3CTA A;  4CZC A;  2WBM A;  2Z99 A;  3WGI A;  2WB1 N;  4M3B A;  3ABK H;  4BS9 A;  3I59 B;  3LQQ A;  5FD5 A;  1FY7 A;  2W00 A;  4JX6 A;  4IF4 A;  1B9M A;  1NH3 A;  3J81 K;  4BBR J;  3ZQI A;  3A2K A;  3J7Z I;  3C2B A;  1FOW A;  4P96 A;  4M71 A;  1I1G A;  1QRY A;  1OLT A;  3BPX A;  1U9O A;  3VFZ A;  5DCM A;  1AKH B;  2UXN A;  4ZYD A;  2R0Q C;  2E1M C;  2ZSH B;  2VXZ A;  5HS8 A;  2E1C A;  1WH7 A;  3KP7 A;  2XDV A;  1OCC H;  3E5U A;  3QPT A;  4IHS A;  5GTI C;  2EZL A;  3PSI A;  3PNT A;  1FSH A;  3Q0W A;  5LBQ A;  4HOB A;  3FM3 A;  4IHT A;  3AKZ A;  5EGO A;  2NVQ J;  1R36 A;  4KMU X;  3PO2 J;  2VPR A;  3E97 A;  1UEL B;  2HXO A;  1T33 A;  2ZO4 A;  1ULY A;  3IRR A;  2DDA A;  2OV7 A;  2EA4 A;  2QA4 I;  1QBJ A;  5GAE J;  4B8X A;  4C30 A;  4L18 B;  4QTR A;  3LSH A;  2L7M P;  2PMU A;  5TIS C;  2QBY B;  1QPM A;  5K5O A;  3GTM J;  4MNU A;  3HOS A;  2K9S A;  3H5N A;  2ELJ A;  1YIJ I;  2Y31 A;  4E7H A;  3TMO A;  3H35 A;  3Q0U A;  4XLE A;  4D7N A;  4XMY A;  3OV8 A;  2VBY A;  2E2J J;  1XC5 A;  2VN2 A;  4ZTJ A;  1Z6R A;  2BE5 F;  5GAG J;  1JE8 A;  2FSW A;  3CUO A;  4HNU A;  1BC8 C;  2D5V A;  3BOQ A;  4I2O A;  2R7D A;  4BJ5 C;  2X6W A;  1V5E A;  2FEZ A;  2VQC A;  3DLL F;  4HG2 A;  4N4O B;  2B7E A;  5FRN A;  2GIZ A;  3L2V A;  3BCA A;  2X6O A;  4AC0 A;  4KN4 X;  5EZG A;  3J7Y J;  2V6E A;  2LY2 A;  3V7S A;  3EDP A;  3GEZ A;  2LTP A;  1Q1H A;  2R7Q A;  2PI0 A;  3W6J B;  3WTY C;  1MMA A;  1ZLJ A;  2JK3 A;  3RQ4 A;  4BBS J;  3C3W A;  4AVZ A;  4GFB A;  2CQK A;  4AWX B;  5D5X B;  1IW7 F;  2GLO A;  1HW1 A;  3FBI B;  1JHH A;  1MZB A;  1YE9 A;  1B8I A;  4HF0 A;  2YSR A;  3MKW B;  2VOP A;  4PFP A;  4AYB N;  5DCF A;  1VQP I;  2E1M B;  4D9J A;  1FYL A;  1S7E A;  3WHB A;  5TRD A;  2MW8 A;  3IUO A;  5JHF A;  1YI2 I;  2CV0 A;  1FSE A;  3HSE A;  1IDY A;  1GXQ A;  4BJ6 C;  1Z91 A;  4B3A A;  4EJU A;  2YU9 J;  4KNY A;  3DPU A;  5FKO A;  2NS8 A;  3ZPL A;  4U87 A;  3VWB A;  1UG2 A;  3HOV J;  3E3V A;  2IEK A;  2A3S A;  4KN7 X;  3ECO A;  2KKO A;  5M3F J;  1HKS A;  5HNH A;  1LFP A;  1MBE A;  1JTY A;  1XSD A;  3IV5 A;  2GAU A;  1REP C;  3JRF A;  3RJP A;  2FNA A;  2CFO A;  2LBF A;  1D1B A;  2GXG A;  4CZZ A;  5FLX Z;  3SJM A;  3KP5 A;  5AIP A;  3VOD A;  5KAI C;  3OYH A;  1DGR M;  4HNV A;  2DTZ A;  3KIO A;  3WU2 C;  2OA4 A;  4XID A;  3DBH B;  1Z9C A;  3EUH A;  2HEO A;  5EF6 A;  2P0W A;  2I5U A;  2Y0S N;  1J0R A;  2MLG A;  3R60 A;  1WJ5 A;  2KIM A;  4D5C A;  3OYD A;  1R9T J;  2E60 A;  1RKW A;  1GV2 A;  3K1M A;  5L3B A;  4IX7 A;  1OCO H;  3CCQ I;  2RNG A;  3K4C A;  2VBW A;  2VE8 A;  2XF7 A;  3GVA A;  5D4S A;  1N75 A;  2EBI A;  3WTX C;  4E7S A;  2CUJ A;  1YYV A;  2PJP A;  2LF8 A;  1TQM A;  3WE2 A;  4XOP A;  2BY1 A;  2E1N A;  2YUS A;  1T0F C;  3U2R A;  2STT A;  2RQQ A;  2MSY A;  4ZDL A;  3SDB A;  3OOU A;  1ZEL A;  3SEZ A;  5IT9 Z;  2G7H A;  3L7W A;  3DP7 A;  2CUZ A;  3CMY A;  2LKX A;  4OIP F;  1G3Y A;  1UHW A;  2V9K A;  2XAG A;  4TV7 A;  2DT7 B;  3F6V A;  4BL0 B;  1N77 A;  2XAF A;  4ETS A;  5E3N A;  4Q48 A;  1WGX A;  1TC3 C;  4AM3 A;  1UCR A;  2V9P A;  2CYY A;  3E6C C;  1K78 A;  3NAU A;  2ZJP F;  3U1D A;  5HLG A;  3WTS C;  1XCB A;  2L2O A;  5DM7 F;  5E20 A;  4AIH A;  3HXL A;  2O8X A;  1KQ8 A;  3FXK A;  1X2M A;  5EJC A;  2D1H A;  3RYR A;  4A3D J;  3CCR I;  4A5N A;  1R1V A;  4RB1 A;  4HNT A;  2NVX J;  3EYY A;  5JLX A;  2MH9 A;  3VOE A;  1MMG A;  3IAS 2;  5KVR A;  4BEH A;  1WI9 A;  2FBH A;  3DCF A;  2ACJ A;  1MGT A;  3LNQ A;  1D1C A;  3JRC A;  2BW3 A;  3HTS B;  5HDG A;  5FLM J;  3CF2 A;  2LNB A;  3RKW A;  1E3P A;  4XNF A;  4XLA A;  3KP3 A;  1OR7 A;  1OPC A;  2FD5 A;  4IOC F;  3GFL A;  1VQ6 I;  2CQX A;  4U0W A;  2XGX A;  2R7R A;  2VT3 A;  2E2H J;  4EMS A;  1VQN I;  1FMW A;  1W0U A;  1RC9 A;  4LB5 A;  4IZZ A;  4I98 B;  2OAZ A;  1LB2 A;  1B4A A;  2R3S A;  1IGN A;  1M1E B;  2KLO A;  1VZ0 A;  2NRA C;  3MVP A;  3F8B A;  1BR1 A;  1G3T A;  3CZ6 A;  5LGN A;  3W2W A;  2R7S A;  4H4K C;  4AID A;  2VJI A;  1TWG J;  4LLN A;  1BW6 A;  4A6D A;  4Y4R A;  1E17 A;  4BYY A;  4C2M J;  1QA6 A;  2QKL B;  4N0B A;  1A31 A;  3FHN A;  2V1U A;  2BXZ A;  3OYB A;  1I3A A;  4CYC A;  1G8X A;  1X4O A;  2F5E A;  4XN3 A;  2AS5 F;  3BTL A;  4AVP A;  4ZC3 A;  3EPZ A;  2DK5 A;  2K3F A;  4RB2 C;  2XAH A;  3GTK J;  5K7H A;  1BR4 A;  4I76 A;  4RGR A;  5KAF C;  2VL8 A;  3WTU C;  2Z2S B;  1D1A A;  1RZ4 A;  2CU7 A;  3ESW B;  4BJT A;  1JI8 A;  1T98 A;  3K4L A;  2R7Z J;  1LJ9 A;  2XVC A;  3BJA A;  5D5V B;  4F93 B;  4NDL A;  3CJR B;  2HXI A;  1BJZ A;  5EEH A;  2FQ4 A;  1VQ5 I;  2XV4 S;  2O6G E;  4U7D A;  4FTH A;  4G12 A;  4PGH A;  5IP6 A;  2ZKZ A;  1R4M B;  2FXA A;  3M4O J;  1RNL A;  4R8H A;  3G1L A;  3L2R A;  2KQR A;  2DA7 A;  4PJ0 C;  3L2U A;  4II2 A;  2GXB A;  3C18 A;  3JCU C;  4OIO F;  2R7V A;  2AO9 A;  4BEH B;  4L0Y B;  2EFP A;  3GX4 X;  4XRS G;  1PJR A;  2XIG A;  1QHH D;  1R7J A;  1JJ8 C;  1HDD C;  1BIB A;  2LVS A;  2Q1Z B;  3H0D A;  3CCL I;  3ECH A;  5KK1 A;  3AFH A;  3P7N A;  2ELH A;  2HWV A;  4XQF A;  4XL9 A;  1BBY A;  5EEG A;  1V54 H;  1J59 A;  5DV5 A;  4CCL A;  3AL0 C;  2HQA A;  4JQF A;  4CCJ A;  3JRB A;  1J75 A;  4RM2 A;  4CH7 A;  4C9Y A;  2K3P A;  1KZH A;  4E7J A;  1Y56 A;  5DYM A;  1FC3 A;  1HCR A;  1JUM A;  1JJ6 C;  2QLZ A;  2QQB A;  2VUM J;  1FJL A;  1D5Y A;  4M9Z A;  5C44 J;  2F5V A;  5EEA A;  1XMX A;  2IPQ X;  1PVE A;  4BQA A;  2E35 A;  4UUS A;  1IZ1 A;  4CIC A;  5A2Q Z;  3QYF A;  3I59 A;  5M5X J;  3H5R A;  1VND A;  3MMY B;  2F5F A;  3EUA A;  1R5H A;  3ZGK A;  3KCC A;  1OCT C;  1SFO J;  4IHW A;  3H3U A;  3UNG C;  4QPO A;  3ZN1 A;  3BY6 A;  2DOE A;  1HF0 A;  3HGG A;  3M07 A;  3MQ0 A;  2X4H A;  5DCM B;  2NOJ B;  3D0S A;  1E3H A;  4EQQ A;  2KDO A;  2HZT A;  2PQ8 A;  1OIS A;  1R00 A;  5CVR A;  1ZG5 A;  3HOU J;  1BW5 A;  1EV7 A;  2LR8 A;  2CV2 A;  3WE3 A;  4DBQ A;  1GXP A;  1FBQ A;  2KHM A;  4IQ4 A;  2X0L A;  4LFU A;  4BY7 J;  2QGU A;  3FMS A;  3CCM I;  1PP7 U;  3FM5 A;  2Y75 A;  3BCB A;  1VQM I;  2GA1 A;  1TWC J;  2QQ8 A;  2EA2 A;  4B47 A;  1R5I D;  4EJT A;  2L0K A;  3K6G A;  5CVV A;  3VYU B;  4LK1 F;  1R1U A;  2KL4 A;  2ZCW A;  3P9I A;  1HC8 A;  2DAO A;  1OFC X;  2Z9O A;  2F5C A;  5F0F A;  4NC6 A;  1PUE E;  1W5T A;  1IUY A;  1D8J A;  3TP3 A;  1DQU A;  4YEL A;  1T6S A;  3ABT A;  3AG2 H;  3L09 A;  5KCM A;  5L3F A;  2ME0 A;  3E6B A;  5F27 A;  3V7C A;  4CYC B;  1FTT A;  3NWS A;  4ESJ A;  5K7F A;  1O7L A;  3OYI A;  2R7F A;  1LPQ A;  4B44 A;  1ERD A;  1V3F A;  4ZDP A;  4D7M A;  5ILV A;  2L54 A;  2OPT A;  1FX7 A;  2FUG 2;  3PUF A;  3JTH A;  1TQI A;  2DOA A;  5E8G A;  1XGN A;  2BGC A;  3H9Q A;  3GW2 A;  1QVT A;  4Z2Y A;  3WGG A;  1Y0N A;  2ZXI A;  3DKY A;  3GCM A;  1Q1V A;  3H3V K;  4A93 J;  1S9H A;  2QM3 A;  4A6E A;  2EIL H;  1XMA A;  1Z6T A;  2XPU A;  4M3E A;  1TW2 A;  2KIS A;  4P1W A;  1D0X A;  5J8C A;  4OAY A;  4PFO A;  1AWC A;  4ZJZ A;  3A03 A;  3M8E A;  3FF5 A;  1J09 A;  3OYK A;  2DQL A;  4BDZ A;  3MD2 A;  2M34 A;  2QWW A;  2W57 A;  2XSJ C;  4HYE A;  1BIA A;  2V6C A;  3A0H C;  3O3K A;  5LHG A;  4BHP A;  2NAZ A;  1S8N A;  4N9I A;  2E19 A;  2M1B A;  1KON A;  1TTY A;  2IA0 A;  2NXN B;  1J5Y A;  2BXY A;  5BNG A;  1FP1 D;  3HM5 A;  4DOZ A;  2EIN H;  4RB3 C;  3WU0 A;  4LLG F;  1MJB A;  3I64 A;  1XSX A;  2A6H F;  1U5T A;  1YG2 A;  2ZXW H;  5J1Y A;  1MJA A;  2HDC A;  3VSK A;  3KYL A;  1DP3 A;  3JR9 A;  2O5R A;  3ABL H;  2EIK H;  5DUI A;  2X6X A;  1DGW Y;  3H0G J;  1XGS A;  4BQN A;  3LFU A;  2CGP A;  3CMA I;  4PSX A;  1HDP A;  2IP2 A;  4ASN A;  3M3Y J;  1IN4 A;  1AOY A;  3FHZ A;  3G2B A;  2E5N A;  4BAC A;  2EZI A;  2IS1 A;  4S05 A;  2EZH A;  6PAX A;  3FXL A;  3EUH C;  3DBL B;  5K7Z A;  2W7N A;  1LEB A;  4YFN F;  5HS9 A;  2MBF A;  2A07 F;  5IYC J;  4BXF A;  2IVM A;  2CS3 A;  4CCO A;  4F91 B;  3EQL F;  5E1W A;  4A3M J;  3KEY A;  3P9C A;  3H9G A;  2KFD A;  3TO7 A;  2VBZ A;  4XLP F;  1X4P A;  4A3B J;  2DO7 A;  4BU2 A;  3J81 Z;  1YJW I;  3GFJ A;  5AON A;  3UR3 C;  3LFK A;  3FIW A;  4EEF G;  4XSZ F;  2BHZ A;  4WX9 A;  4HQE A;  4WXC A;  1T56 A;  4PK4 A;  2O03 A;  2LRD A;  5DD8 A;  4QIW N;  1RUN A;  3LST A;  3QPS A;  5F08 A;  1IXR C;  3BWG A;  2MC3 A;  2QZ8 A;  2IXS A;  4UNO A;  3S17 J;  1P4W A;  1G2H A;  1SD5 A;  3P5J A;  1FMV A;  2FBI A;  2OQG A;  1RET A;  2AXT C;  4GXO A;  4IO9 F;  4M6X A;  3MCZ A;  4N9H A;  4BUP A;  2VOD A;  3BG9 A;  3ZQC A;  4AIK A;  3NEU A;  3LA7 A;  3DF8 A;  2ZC2 A;  1RUO A;  3IKV A;  1JKP C;  2PMZ N;  3H1C A;  5F1R A;  1TT0 A;  2QQ9 A;  2IS6 A;  1LKX A;  1X1C A;  5F6F A;  4BH9 A;  3OYN A;  4XRS A;  3QP5 A;  2I10 A;  5FB2 A;  2PJR B;  1UZC A;  5L3D A;  2OQR A;  4ENN A;  3HUG A;  4DW6 A;  3W2V A;  4XLH A;  2VLA A;  5HS7 A;  3HOZ J;  3HGY A;  1K6Y A;  1G6N A;  2HR3 A;  3GTJ J;  4M3G A;  1SFX A;  1WQ2 A;  3GTL J;  2K9M A;  2AQF A;  1ZLK A;  4LIU A;  4QPQ A;  4ITV A;  3FXQ A;  1TWF J;  2DMN A;  2E5Z A;  2P6T A;  2P5L C;  4I99 C;  3ZMZ A;  2ELK A;  1XX5 A;  2ZFU A;  1GV5 A;  2RDP A;  2HQ5 A;  1V55 H;  3K2Z A;  1MSE C;  3EET A;  4HF1 A;  4IVN A;  4EM1 A;  1WJC A;  4EM2 A;  1FOY A;  1R5G A;  2FA5 A;  3ONQ A;  2JVH A;  3BLY A;  5FKL A;  5JVT A;  2N8G A;  3ZCO A;  2RVC A;  4XLN F;  3IH3 A;  5F04 A;  1U5T C;  2ZME B;  4FX4 A;  1VQK I;  1ETK A;  2OC6 A;  4KIG A;  5CVU A;  2NVT J;  4XBF A;  3GTP J;  3WTV C;  4DYC A;  2HI3 A;  1TZL A;  3MFK A;  1G3S A;  4XRF A;  2MD0 A;  3OIP A;  3V8L A;  2HOE A;  5DTD A;  1IV6 A;  2ZXH A;  2CQ7 A;  2HNH A;  1SVL A;  3T8R A;  3CD6 I;  3Q3S A;  2ID3 A;  3FKJ A;  2F4I A;  3BG6 A;  3KX2 A;  1NK2 P;  3LSI A;  3SFI A;  3HRT A;  1MJ9 A;  3SXY A;  3ZQL A;  5FRO A;  2HOT A;  4S0H B;  3OYA A;  1TT5 B;  3CDI A;  4IXA A;  2L9R A;  1VQO I;  3FX3 A;  1YX5 A;  4J01 A;  2K40 A;  4UB6 C;  3PNV A;  1SAX A;  3KYC B;  2PBI A;  2PN6 A;  2EB7 A;  1STZ A;  3K10 A;  5LLQ A;  3OMY A;  2VJ4 A;  4E7I A;  2X85 A;  3DQV C;  3WTW C;  4FET A;  1ZHF A;  1O4X A;  2BV6 A;  3Q9V A;  1WI3 A;  2B0L A;  1VF9 A;  1ZAR A;  2WAD A;  4A12 A;  4EAT A;  1CQT A;  1FBU A;  2KPM A;  3CCY A;  3G71 I;  4B1R A;  5DDG A;  3S3O A;  2XKO A;  1SEU A;  3I4P A;  3X2Q H;  1APL C;  3W6V A;  2CG4 A;  2CUE A;  2CV1 A;  1IN5 A;  3BZ6 A;  2HOS A;  4LIT A;  3IKT A;  4Y13 A;  4R1H A;  1MD0 A;  3QAH A;  1UFM A;  2J5O A;  4AIJ A;  2EV6 A;  4QLC U;  2X1D A;  2EFW A;  1JGG A;  4XLF A;  3P9K A;  4Y52 J;  2WAF A;  5H6R A;  4KDP A;  3C2H A;  4AD9 A;  3HC7 A;  3M9A A;  2DLL A;  4GYG A;  3L2Q A;  2JTV A;  4J19 A;  4GO1 A;  4BE0 A;  2CQQ A;  2CSO A;  2L7F P;  2FNP A;  5KHD A;  5BS6 A;  2ZNZ A;  4NQW B;  1O3Q A;  1K4S A;  3BR0 A;  1PP8 F;  1FYM A;  1OR7 C;  3K70 C;  2W1O A; 
#chains in the Genus database with same CATH homology
 3FMR A;  4QWQ A;  2QYO A;  4NQW A;  3F8N A;  3BPV A;  3U9G A;  1YS6 A;  5BPI A;  2P6S A;  5LGU A;  4O3M A;  2K02 A;  3F8C A;  1W7P A;  3F6O A;  5HVQ C;  1U8R A;  5LEK A;  2ESH A;  4G94 A;  1QNT A;  1DP7 P;  3WOD F;  3I53 A;  3G3Z A;  2Y48 A;  4RS8 A;  4XSX F;  4OU0 A;  3WG9 A;  3WTT C;  2L01 A;  4P5O A;  1T0F A;  4KMF A;  5D5U B;  2H6C A;  1SD7 A;  1B9N A;  1HQC A;  4EJW A;  2OZU A;  5JR3 A;  3CO6 C;  3K9T A;  1HXD A;  2COM A;  2JPC A;  4EM0 B;  2P5K A;  2H6B A;  3RPQ A;  1P2F A;  3TDU C;  2FML A;  1R22 A;  2L3D A;  3CUQ B;  5D6F A;  3RYP A;  4Q5S F;  5D8L B;  2J5P A;  4KA4 A;  4KIC A;  4UXN A;  5E8I A;  4GGG A;  4KIF A;  4U0Y A;  2EFN A;  1XGM A;  1D3Y A;  3IC7 A;  2ZME A;  4ENM A;  3T5X A;  4IPA A;  5D8K B;  3TKY A;  1ONV A;  5D4R A;  1D5V A;  4L5I A;  4ZZD A;  3JTG A;  3IWF A;  1I1S A;  2QUF A;  5FO5 A;  3K0L A;  4ENK A;  2O3F A;  4DQ2 A;  1HSJ A;  2G7U A;  1SFU A;  2RN7 A;  4HAM A;  3MAJ A;  3ZMV A;  2HQN A;  2ADU A;  4IRI A;  1O57 A;  4P55 A;  4HW0 A;  4RAZ A;  1KQ9 A;  3GLX A;  3RKX A;  3L2C A;  1BI0 A;  2W85 A;  2MA3 A;  2UXX A;  2IA1 A;  1XMK A;  3ZQ7 A;  5BPD A;  1KU3 A;  1K78 B;  1R1T A;  1FWZ A;  2WWY A;  1ZYR F;  1IXS B;  2RQP A;  5FFX A;  2L02 A;  1RI7 A;  5D5W B;  1ZG1 A;  2K27 A;  5L3G A;  1UB9 A;  2AXL A;  2LKP A;  4ZYH A;  3KEQ A;  5JHU A;  1SD4 A;  1TBX A;  4D0P A;  1YIO A;  1ZH5 A;  4PZJ A;  1I5Z A;  1W4M A;  4A5M A;  4LK0 F;  2BBY A;  5H6Q A;  3HRU A;  1BN5 A;  3ZN0 A;  2OU2 A;  1X3U A;  4I09 A;  1G3W A;  2NNY A;  3GF2 A;  1PDN C;  3V7R A;  4RGS A;  4G7H F;  4L5J A;  1T2K A;  1IRF A;  3K1P A;  2H09 A;  4HDU A;  1BOA A;  2XRN A;  1KU2 A;  3E5Q A;  4ESB A;  4H0E A;  3ROU A;  1QQI A;  4L9V A;  2YX4 A;  2QQA A;  3HSR A;  4BXU A;  4I0B A;  3DKW A;  2JRT A;  2K4B A;  3NRV A;  2ZNY A;  3B02 A;  3N4M A;  1L0O C;  1TNS A;  4ZH4 F;  1OYW A;  1TQP A;  5K5R A;  3K69 A;  3V4G A;  3QOP A;  3WU1 B;  4DNC A;  1KA8 A;  2Q0O A;  1O3S A;  1U2W A;  2VBX A;  2LF7 A;  1BC7 C;  1BM9 A;  5DEQ A;  4K2E A;  3RIR A;  3R4K A;  2L4M A;  5TJJ A;  1Y0U A;  3WTZ A;  1WRJ A;  3F21 A;  3LAJ A;  1FP2 A;  4WCG A;  5BOX A;  1F9N A;  4CXF A;  2DTR A;  2LDU A;  2PMH A;  2VC1 A;  2KJC A;  3PQK A;  2HYF A;  1J9I A;  2UWM A;  4B09 A;  1OKR A;  1A04 A;  3QP6 A;  2HTS A;  1IN7 A;  4G7Z F;  4JBA A;  5H20 A;  5CLS A;  5CVI A;  2BYV E;  1W7P D;  5LRR A;  2WTE A;  1ZRC A;  3DXJ F;  3LAP A;  1YO5 C;  3HOT A;  3RTR A;  4ESF A;  5FD6 A;  3IRQ A;  1XGO A;  3HTU A;  3HHH A;  3KZZ A;  5CJ9 A;  3VEP A;  4I7H A;  4F7Z A;  1FLI A;  2XAQ A;  3KLO A;  4KYW A;  2MH2 A;  1SFE A;  5K5Q A;  2VE9 A;  5DD4 A;  1UST A;  1K79 A;  1JXS A;  3DEU A;  1FZP B;  3KEO A;  4EVI A;  3BDD A;  3I71 A;  4PDK A;  1B59 A;  3G73 A;  4M73 A;  3J80 Z;  3GZ6 A;  1L3L A;  2KRF A;  1EH6 A;  4PGG A;  3PQJ A;  2XRO A;  5ICG A;  4S04 A;  2ISZ A;  2V79 A;  3SHF A;  1EH8 A;  3RPU A;  3Q9S A;  2PLY A;  2O0Y A;  3ZMS A;  2HYG D;  4EGY A;  3CUQ A;  3E6M A;  3L00 A;  4O6J A;  5ILS A;  2ZFW A;  4HF2 A;  2FF4 A;  4UVC A;  4MEY F;  1WKM A;  1S29 A;  2OZ6 A;  5HLI A;  5D6E A;  5FGM A;  3J7A O;  1I6X A;  4G7O F;  4BNC A;  4U7B A;  3QU3 A;  2E7W A;  2FBK A;  4RGU A;  3GYH X;  2QEN A;  4HZF A;  2W25 A;  3LA3 A;  1T38 A;  2PG4 A;  2W84 A;  3DPT A;  1ZG3 A;  2K7L A;  5E1Z B;  3QRF F;  4LG0 A;  3HSF A;  2DT5 A;  1DPR A;  3QU6 A;  1YLF A;  1YFH A;  4LLL A;  3ZP5 A;  1NHA A;  2EFQ A;  2JT1 A;  3T8T A;  3KLN A;  3I58 A;  5HDK A;  1QZZ A;  1BI2 A;  4CO8 A;  1W5S A;  3H3Z A;  3GFI A;  2D2W A;  1YW9 A;  3KP2 A;  2ETH A;  1ON1 A;  3TO9 A;  1MKM A;  2KJB A;  4UHT A;  5BMZ A;  2BEO A;  2XUB A;  4WF2 A;  4Q47 A;  3GXO A;  4PCQ A;  4LG0 B;  3TGN A;  5E1X A;  4IRG A;  2STW A;  2EV0 A;  1FT9 A;  3LA2 A;  2NS0 A;  4LJZ F;  4HV5 A;  4R79 A;  1H9T A;  3ISP A;  2FQ3 A;  2E7X A;  4A0X A;  3BRO A;  2PEX A;  3KET A;  3COA C;  2WV0 A;  4MQ9 F;  4UVA A;  4M6Y A;  5LGT A;  5HOO A;  1T39 A;  2EFO A;  1BJA A;  3JAM Z;  1BI3 A;  2HQR A;  3O6B B;  2W24 A;  1FNN A;  4UUV A;  3VB2 A;  1DDN A;  3ABU A;  3RI4 A;  3ELK A;  2GIV A;  2DI3 A;  2V1X A;  2P7C B;  3MEX A;  2YU3 A;  3MWM A;  1R58 A;  1P4X A;  3DPL C;  4KUM A;  4OIN F;  4HLX A;  5CVJ A;  5FLX K;  3I54 A;  2M30 A;  2A68 F;  2O61 A;  1R23 A;  4HDV A;  2DBB A;  3MZH A;  3KFW X;  4MHG A;  1W7P B;  4WXD A;  4YG2 F;  1GHC A;  3R6S A;  3KP6 A;  2V1D A;  2L4A A;  1B6A A;  4CHU A;  2DW4 A;  1IXC A;  4Y15 A;  5JI6 A;  1KYZ A;  1ZGJ A;  4ZZL A;  1HW2 A;  4HQM A;  2NYX A;  4L9J A;  3ULQ B;  3T1B A;  1LQ1 A;  1H9G A;  1P6R A;  5ILU A;  1S7O A;  4YIF A;  1CF7 B;  3FWE A;  3JAM K;  5E18 F;  2KIU A;  3BJO A;  4L9N A;  2FOK A;  4P9U A;  5LEJ A;  2DK8 A;  4MQV A;  2JZY A;  2ZJ2 A;  1S3J A;  1E2X A;  1WSU A;  4M74 A;  2XHK A;  1XN7 A;  2HKX A;  1P4A A;  1Z7U A;  2NNN A;  1Z05 A;  2ZXJ A;  2RGV A;  3REO A;  3TDZ C;  4EJV A;  3E5X A;  4CYD A;  2EJR A;  4OMZ A;  4UV8 A;  4P9F A;  2Q2E A;  3GUD A;  2Z3Y A;  4HA8 A;  2OD5 A;  2GA2 A;  3LQR A;  1XD7 A;  3C7J A;  3ZMU A;  4IJA A;  3CDH A;  4M9S A;  1MDM B;  2K4J A;  3IHU A;  1YW7 A;  3RKY A;  4Q4Z F;  1XCV A;  3KP4 A;  3CO7 C;  4MTD A;  2HKO A;  3LWF A;  3HYI A;  1SMT A;  2FU4 A;  2KIF A;  2Y0M A;  2YX7 A;  5LHI A;  2MLK A;  3M8F A;  3F8M A;  3MZY A;  1F4K A;  1J2X A;  2Z5U A;  2M8E A;  4OIQ F;  4LB6 B;  2A69 F;  4MEX F;  3F8F A;  1QGP A;  1USS A;  2DFI A;  4CDG A;  1FPQ A;  1QZY A;  2A61 A;  4ENJ A;  1B1B A;  2HGC A;  3GZ5 A;  5J8F A;  3FXU A;  2CO5 A;  3DFG A;  1WWX A;  1ZRD A;  1Z1D A;  5CYV A;  4BHB A;  4HLY A;  3BJ6 A;  4G6D A;  4KFC A;  1S7A A;  1P92 A;  3E6D A;  1YTY A;  3JSO A;  1ZRF A;  5FFZ A;  1FYK A;  1FBS A;  3V8J A;  1DPU A;  2GQQ A;  1KGS A;  3V8K A;  3C1D A;  3HRM A;  2RNJ A;  2IA2 A;  2ISY A;  2ESN A;  1G4D A;  2H27 A;  1H0M A;  2H94 A;  2IJL A;  2WC2 A;  2XAJ A;  3F3X A;  1ZGA A;  1HW5 A;  5ICF A;  1BI1 A;  5HLH A;  1K7A A;  2UZK A;  2A5Y B;  1U6G A;  3N97 A;  3D5L A;  2OBP A;  3AAF A;  4FT8 A;  1YQA A;  2MD5 A;  2HS5 A;  2P5V A;  2EWN A;  4G6Q A;  2F5D A;  2RC4 A;  1RIO H;  1HST A;  4M9X A;  3IWZ A;  4OMY A;  4IRH A;  3SFZ A;  4A0Z A;  5K1Y A;  2EV5 A;  4I0A A;  3M7G A;  3H92 A;  1IN8 A;  2RKH A;  4EV0 A;  2XKP A;  3FXR A;  1LDD A;  4ZYG A;  5L3C A;  5J6X A;  5JFR A;  4M72 A;  1TW3 A;  2YPR A;  2VT2 A;  2Q8K A;  4L9T A;  4YFK F;  1K6O A;  3ML6 A;  5ERI A;  1XDU A;  1CF7 A;  4G8X A;  5ED4 A;  1IN6 A;  3S2W A;  4ZYE A;  4UV9 A;  2CWE A;  4O5V A;  4FHT A;  4NHJ A;  1IRG A;  4BAY A;  1SD6 A;  1ZAO A;  4I01 A;  2JPB A;  4I02 A;  1YS7 A;  3R0A A;  4UVB A;  1DUX C;  2FMY A;  2VC0 A;  4A0Y A;  2HFH A;  1IF1 A;  1LVA A;  1KU9 A;  3TOA A;  2VON A;  3ZMT A;  3CUQ C;  2C6Y A;  4GYI A;  5BQT A;  1OMI A;  2D1V A;  2P4W A;  1KYW A;  5L3E A;  1U3E M;  1EH7 A;  4KT5 C;  4EGZ A;  1S6L A;  1QO0 D;  4LD5 A;  1XB4 A;  1ON2 A;  2PFB A;  2QBY A;  1LDK B;  3FMQ A;  1MDM A;  1ZN2 A;  4JK1 X;  1HBX G;  3Q5F A;  2XAS A;  4OOI A;  4KIB A;  1D8K A;  1I27 A;  1C0W A;  2P7V B;  3NQO A;  1OYY A;  1JGS A;  3M1E A;  5IT3 A;  1O3R A;  2V9V A;  2IRF G;  4BHC A;  3JSP A;  4HV6 A;  3SZP A;  4HBL A;  4HX8 A;  4U88 A;  2IW5 A;  1FOK A;  2M5W A;  1VTN C;  1KU7 A;  2ZBK A;  3JW4 A;  2DQR A;  3IL2 A;  3TQN A;  3SZT A;  1HKQ A;  4A2U A;  5HDN A;  2DPD A;  2RV8 A;  1ODD A;  5AIQ A;  2QVO A;  2DPU A;  3HIF A;  1LNW A;  1O7F A;  3BP8 A;  5F64 A;  1F1Z A;  1XSV A;  3SQN A;  1SMY F;  1LEA A;  3HHG A;  1CGP A;  1F5T A;  4YII A;  2Z33 A;  1GVJ A;  2CFX A;  3KZY A;  2M87 A;  3R61 A;  3KE2 A;  2P8T A;  2HTJ A;  2F2E A;  2JSC A;  5ICE A;  1KQ0 A;  1UHM A;  2VOO A;  3O2P E;  5ICC A;  4RAY A;  2TDX A;  4LMY A;  3HRS A;  3ZMD A;  4LGW A;  3GFM A;  5E17 F;  2FRH A;  2D45 A;  1JHF A;  4OIR F;  3RDI A;  4RGX A;  1V4R A;  3FZV A;  3CJN A;  3L9F A;  5IT9 K;  5LHH A;  3F23 A;  1HKT A;  2K86 A;  4HX4 A;  3I5U A;  4YFX F;  3F72 A;  4G9Y A;  4MTE A;  1LDJ A;  1U78 A;  4WXH A;  2YR2 A;  3WGH A;  4MGR A;  3PFI A;  2GWR A;  2DU9 A;  3W6K B;  1U5T B;  3I0T A;  2A6E F;  1IAW A;  3F22 A;  3GO5 A;  2M45 A;  5DUK A;  2LSO A;  3K1N A;  3GWZ A;  4E70 A;  4FX0 A;  1OYI A;  2CW0 F;  3CLO A;  3T0Y A;  3TO6 A;  4L0Z B;  1TLH B;  4Y17 A;  3EYI A;  4WK8 F;  3J80 K;  4ON0 A;  2EK5 A;  1J7K A;  4NB5 A;  4RB0 A;  3B73 A;  1YW8 A;  4GCV A;  1ZRE A;  2FE3 A;  3DV8 A;  2IT0 A;  4U0V A;  1O3T A;  4EJO A;  3QPH A;  4HX7 A;  2GZW A;  4CGZ A;  1TNT A;  5LRS A;  4WWC A;  3R0J A;  3TOB A;  1XDS A;  3ERE D;  2G9W A;  3OOP A;  3CTA A;  2Z99 A;  3WGI A;  3I59 B;  3LQQ A;  5FD5 A;  1FY7 A;  4IF4 A;  1B9M A;  3J81 K;  4P96 A;  4M71 A;  1I1G A;  3BPX A;  3VFZ A;  5DCM A;  2UXN A;  4ZYD A;  2VXZ A;  5HS8 A;  2E1C A;  3KP7 A;  3E5U A;  3QPT A;  4IHS A;  1FSH A;  5LBQ A;  4HOB A;  3FM3 A;  4IHT A;  1R36 A;  4KMU X;  3E97 A;  2ZO4 A;  1ULY A;  3IRR A;  1QBJ A;  2EA4 A;  4B8X A;  4L18 B;  2PMU A;  2QBY B;  1QPM A;  5K5O A;  4MNU A;  3HOS A;  3OV8 A;  2VBY A;  2VN2 A;  1Z6R A;  2BE5 F;  1JE8 A;  2FSW A;  3CUO A;  1BC8 C;  3BOQ A;  4I2O A;  2R7D A;  2FEZ A;  4KN4 X;  3V7S A;  3EDP A;  3GEZ A;  1Q1H A;  2PI0 A;  3W6J B;  3WTY C;  1ZLJ A;  3C3W A;  2CQK A;  4AWX B;  5D5X B;  1IW7 F;  1HW1 A;  1JHH A;  1MZB A;  4HF0 A;  2YSR A;  2VOP A;  5DCF A;  1FYL A;  5TRD A;  1FSE A;  3HSE A;  1GXQ A;  1Z91 A;  4EJU A;  4KNY A;  3ZPL A;  3E3V A;  2A3S A;  4KN7 X;  3ECO A;  2KKO A;  1HKS A;  1XSD A;  2GAU A;  1REP C;  3RJP A;  2FNA A;  2GXG A;  4CZZ A;  5FLX Z;  3KP5 A;  5AIP A;  3VOD A;  2OA4 A;  1Z9C A;  3EUH A;  2HEO A;  1J0R A;  2MLG A;  3R60 A;  2KIM A;  3K1M A;  5L3B A;  2VBW A;  2VE8 A;  3GVA A;  5D4S A;  3WTX C;  1YYV A;  2PJP A;  2LF8 A;  1TQM A;  3WE2 A;  2E1N A;  3U2R A;  2STT A;  5IT9 Z;  2G7H A;  3L7W A;  3DP7 A;  4OIP F;  1G3Y A;  1UHW A;  2XAG A;  4TV7 A;  3F6V A;  2XAF A;  4ETS A;  4Q48 A;  1UCR A;  1K78 A;  2CYY A;  3E6C C;  3U1D A;  5HLG A;  3WTS C;  1XCB A;  5E20 A;  4AIH A;  2O8X A;  1KQ8 A;  2D1H A;  3RYR A;  4A5N A;  1R1V A;  4RB1 A;  3EYY A;  2MH9 A;  3VOE A;  5KVR A;  1WI9 A;  2FBH A;  2ACJ A;  1MGT A;  3HTS B;  5HDG A;  2LNB A;  3RKW A;  3KP3 A;  1OR7 A;  1OPC A;  3GFL A;  4U0W A;  2XGX A;  2VT3 A;  4EMS A;  4LB5 A;  4I98 B;  2OAZ A;  1LB2 A;  1B4A A;  2R3S A;  2NRA C;  3F8B A;  1G3T A;  5LGN A;  4LLN A;  4A6D A;  1E17 A;  4BYY A;  4N0B A;  2V1U A;  2F5E A;  2AS5 F;  4AVP A;  2DK5 A;  4RB2 C;  2XAH A;  4RGR A;  3WTU C;  1RZ4 A;  1T98 A;  1LJ9 A;  2XVC A;  3BJA A;  5D5V B;  5EEH A;  2XV4 S;  2O6G E;  4U7D A;  4PGH A;  2ZKZ A;  2FXA A;  1RNL A;  4R8H A;  2GXB A;  3C18 A;  4OIO F;  4L0Y B;  3GX4 X;  2EFP A;  2XIG A;  1R7J A;  1BIB A;  3ECH A;  5KK1 A;  3P7N A;  2ELH A;  2HWV A;  1BBY A;  5EEG A;  1J59 A;  5DV5 A;  4JQF A;  1J75 A;  5DYM A;  1FC3 A;  2QLZ A;  2QQB A;  4M9Z A;  2IPQ X;  4BQA A;  1IZ1 A;  4CIC A;  5A2Q Z;  3I59 A;  2F5F A;  1R5H A;  3KCC A;  3H3U A;  3ZN1 A;  3BY6 A;  3MQ0 A;  2X4H A;  5DCM B;  3D0S A;  4EQQ A;  2HZT A;  2PQ8 A;  1R00 A;  5CVR A;  1ZG5 A;  1EV7 A;  3WE3 A;  1GXP A;  1FBQ A;  2X0L A;  4LFU A;  3FMS A;  1PP7 U;  3FM5 A;  2Y75 A;  2GA1 A;  2EA2 A;  4EJT A;  5CVV A;  4LK1 F;  1R1U A;  2ZCW A;  3P9I A;  2DAO A;  2Z9O A;  2F5C A;  1PUE E;  1W5T A;  1IUY A;  1D8J A;  1T6S A;  3ABT A;  3L09 A;  5L3F A;  3E6B A;  3V7C A;  4ESJ A;  1O7L A;  2R7F A;  1V3F A;  5ILV A;  2L54 A;  1FX7 A;  3JTH A;  1TQI A;  5E8G A;  5A2Q K;  1XGN A;  2BGC A;  3GW2 A;  4Z2Y A;  3WGG A;  2QM3 A;  4A6E A;  1XMA A;  1Z6T A;  1TW2 A;  5J8C A;  1AWC A;  3M8E A;  3FF5 A;  2DQL A;  2QWW A;  2W57 A;  4HYE A;  1BIA A;  2V6C A;  3O3K A;  5LHG A;  4BHP A;  2NAZ A;  1S8N A;  4N9I A;  2M1B A;  2IA0 A;  1TTY A;  1J5Y A;  1FP1 D;  4RB3 C;  3WU0 A;  4LLG F;  1MJB A;  3I64 A;  1XSX A;  2A6H F;  1U5T A;  1YG2 A;  1MJA A;  2HDC A;  5DUI A;  1XGS A;  2CGP A;  2IP2 A;  4ASN A;  1IN4 A;  1AOY A;  3FHZ A;  4S05 A;  6PAX A;  1LEB A;  4YFN F;  5HS9 A;  2A07 F;  2MBF A;  2IVM A;  3EQL F;  5E1W A;  3P9C A;  3TO7 A;  2VBZ A;  4XLP F;  2DO7 A;  3J81 Z;  3GFJ A;  5AON A;  3LFK A;  4XSZ F;  4WX9 A;  4HQE A;  4WXC A;  2O03 A;  1RUN A;  5DD8 A;  3LST A;  1IXR C;  4UNO A;  3BWG A;  2MC3 A;  2QZ8 A;  1P4W A;  1SD5 A;  2FBI A;  2OQG A;  4GXO A;  4M6X A;  3MCZ A;  4N9H A;  2VOD A;  4AIK A;  3NEU A;  3LA7 A;  3DF8 A;  1RUO A;  3IKV A;  5F1R A;  2QQ9 A;  4BH9 A;  5F6F A;  3QP5 A;  5FB2 A;  5L3D A;  2OQR A;  4ENN A;  3HUG A;  5HS7 A;  1G6N A;  2HR3 A;  1SFX A;  1WQ2 A;  1ZLK A;  3FXQ A;  2P6T A;  2P5L C;  3ZMZ A;  2RDP A;  3K2Z A;  3EET A;  4HF1 A;  4IVN A;  4EM1 A;  4EM2 A;  1R5G A;  2FA5 A;  5JVT A;  2RVC A;  4XLN F;  1U5T C;  2ZME B;  4FX4 A;  5CVU A;  4KIG A;  4XBF A;  3WTV C;  3MFK A;  1G3S A;  4XRF A;  3V8L A;  2HOE A;  3T8R A;  3HRT A;  1MJ9 A;  3SXY A;  4IXA A;  3FX3 A;  1SAX A;  2PBI A;  2PN6 A;  2EB7 A;  1STZ A;  5LLQ A;  3DQV C;  3WTW C;  1ZHF A;  2BV6 A;  3Q9V A;  2B0L A;  1ZAR A;  4A12 A;  1FBU A;  5DDG A;  2XKO A;  3I4P A;  2CG4 A;  1IN5 A;  3BZ6 A;  3IKT A;  4Y13 A;  4R1H A;  1MD0 A;  3QAH A;  1UFM A;  2J5O A;  4AIJ A;  2EV6 A;  4QLC U;  2EFW A;  3P9K A;  5H6R A;  4KDP A;  4AD9 A;  3M9A A;  2DLL A;  4GYG A;  2JTV A;  4GO1 A;  2CSO A;  2FNP A;  5BS6 A;  2ZNZ A;  1O3Q A;  1PP8 F;  1FYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...