5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
molecule keywords AspA
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
1P2FA 3PQKA 3QOPA 1R58A 1JHHA 5LBQA 1MJ9A 1ZG3A 3CLOA 3WG9A 2BGCA 4MEYF 5TRDA 2L4MA 3I5UA 2KIFA 4HDUA 3M7GA 2YSRA 2DBBA 3TOAA 4GXOA 3EETA 1FY7A 4GCVA 5BQTA 3DPTA 3S2WA 4G94A 3HTUA 4ESJA 3RJPA 3VB2A 3V7RA 3HYIA 2IVMA 1EH8A 2IT0A 1FPQA 2HQNA 3E3VA 2DPDA 1USTA 3L09A 4N9IA 2RKHA 1HKQA 1U2WA 2W24A 1SAXA 1ZRCA 4QLCU 2O3FA 2M8EA 2OD5A 3JSPA 4HA8A 1BI2A 4A2UA 4KIGA 3FZVA 3RIRA 1XGNA 3LQRA 1R5HA 5DV5A 2MBFA 1K7AA 1S7AA 3RDIA 5D4RA 3TO6A 1REPC 1A04A 4UV8A 3TDZC 1QPMA 3CUQC 5KK1A 3KE2A 3MFKA 3J80K 3I59A 4E70A 2LF8A 1W4MA 3KFWX 2YR2A 1KU3A 4HX8A 1BI3A 2HYGD 1I6XA 1TLHB 1OMIA 3L00A 1T39A 5FB2A 4GYGA 3GWZA 4L9JA 1T0FA 1HKTA 1XMKA 5JR3A 2FQ3A 1BJAA 5LRRA 1YFHA 2HKOA 2PJPA 1STZA 3HUGA 3K1MA 2IPQX 4CICA 1FBSA 3MWMA 2K4BA 4LLLA 2P5LC 3P9KA 4F7ZA 3HTSB 4YG2F 3CUOA 2E1NA 2HS5A 4YFNF 5ERIA 2YPRA 3V8LA 1R1TA 5FFZA 4A0YA 4L9TA 5LRSA 1T6SA 5AONA 3GVAA 2STWA 1W5SA 1P4WA 5LHHA 2FRHA 5CYVA 1W7PB 2ISYA 3REOA 1QZZA 1BIAA 5LGTA 5D5VB 4WWCA 2V1XA 2H6CA 2QQ9A 3BWGA 1QQIA 3KCCA 2EV0A 1SD4A 3R60A 2A6EF 3I64A 4IXAA 3QU3A 4L0ZB 5L3DA 3RYPA 2F5CA 4BNCA 4UVAA 3K1PA 1O3RA 1BC8C 1FT9A 4U7BA 3LAJA 2BE5F 2H94A 2HEOA 5E17F 3BPXA 1J0RA 2P8TA 2RC4A 3JTGA 1Z1DA 2O61A 3ELKA 1W7PA 2FA5A 3MEXA 4LG0A 3P7NA 2RQPA 1MZBA 3U2RA 3O3KA 2FF4A 4M71A 1JHFA 1Z7UA 4L9VA 1H9TA 1FBUA 3K2ZA 2Q0OA 5ICFA 1YIOA 2VODA 1SD7A 3GUDA 4A12A 1P4AA 4YIFA 5IT9Z 4XRFA 2MH2A 1OKRA 2XAFA 2Y0MA 2A61A 3KLOA 3EUHA 2ZNYA 4ZYHA 1WQ2A 2COMA 4NB5A 1E17A 2GA2A 5LHGA 4LJZF 4LB5A 3N97A 1D3YA 1ZRDA 4GGGA 1MDMB 1BBYA 3GZ5A 4BQAA 1IUYA 2X0LA 4MNUA 2QENA 1FSEA 5F64A 1D8JA 3KP6A 5CVIA 1HBXG 3CO6C 5JVTA 2EJRA 3F72A 4P55A 3KEQA 4LLGF 3LSTA 5CVVA 1Z6RA 2FMLA 2ZFWA 2PI0A 3C7JA 4KIBA 4LFUA 5AIQA 1BI1A 3GFJA 2CFXA 4Q48A 5L3CA 1MGTA 3QP6A 4OOIA 4OMZA 2YU3A 1Z91A 2EFQA 4I2OA 2HWVA 5DEQA 3IWZA 2HTSA 2LSOA 2L4AA 2OU2A 2DLLA 5L3BA 1IZ1A 3E6BA 1G4DA 3OV8A 4KMFA 5BOXA 4BHBA 3U9GA 3L9FA 2P6TA 4XBFA 2VC1A 5HS8A 3BZ6A 3ECHA 5AIPA 1AWCA 4HZFA 2HQRA 4G7ZF 1ZGAA 4IRHA 4R79A 1EH6A 2VT3A 4IHTA 1J9IA 1SMTA 3T5XA 1YS6A 2F2EA 4RAYA 5CVRA 1XSXA 4MTEA 5L3FA 3F8FA 1ZG5A 1SD5A 2MLKA 2Z33A 4JQFA 4Q4ZF 2PQ8A 1EV7A 1XGOA 2FBIA 3LFKA 1SFXA 3ZMUA 3J81K 1HSJA 2VT2A 3F3XA 3FM3A 1K78A 5DD4A 2CSOA 1RNLA 1TQMA 5DCFA 1QZYA 4EJUA 1Y0UA 2XGXA 4XSZF 3E6MA 1F1ZA 4ENJA 4G8XA 3WTVC 2XASA 1V3FA 3VFZA 1Z9CA 4ON0A 2EFNA 1KQ0A 5D8LB 4M9XA 2OZ6A 1QNTA 2GWRA 1ZHFA 4KMUX 2CGPA 1FLIA 3WODF 5ICCA 4A6DA 2DW4A 1G3SA 4P96A 1I1GA 4IHSA 4NQWA 3KZYA 3FM5A 1E2XA 2HKXA 4Q47A 2QQAA 2JPBA 4AIHA 3AAFA 2DU9A 5D5UB 3L2CA 1BM9A 3CJNA 1XN7A 1RI7A 5HDGA 4HV5A 3W6KB 1YW7A 1BIBA 2NNYA 4I09A 2Y48A 1G3TA 2IA1A 4MEXF 2FOKA 2LKPA 1UFMA 2DTRA 4AWXB 3JTHA 1IXCA 5J8FA 2VE9A 4RB3C 1ZG1A 1KU7A 4PZJA 2QWWA 2Z5UA 2XKPA 1YW8A 4CZZA 1O7LA 2O6GE 1X3UA 3NRVA 1IAWA 4FX4A 5JI6A 1WKMA 2IP2A 1ZYRF 3GZ6A 4MTDA 1H9GA 5DCMA 1T98A 2L02A 2FBKA 1QBJA 3R4KA 4L0YB 1YYVA 1B9NA 1O7FA 3BDDA 4OU0A 2MH9A 2EV6A 4EM2A 2C6YA 4ENMA 2NNNA 3D5LA 1FP1D 3WU1B 1YG2A 2V1DA 5DDGA 4U0WA 3P9CA 1R1UA 4HAMA 3RPUA 1LVAA 5D6FA 2JRTA 1KQ9A 1YTYA 1U5TA 2ZO4A 3QP5A 2Q2EA 1HKSA 1L3LA 4IRIA 1VTNC 3DEUA 3Q9SA 4RAZA 5KVRA 5A2QZ 3E6DA 1OR7A 3J80Z 2KJBA 1WSUA 1PUEE 4UXNA 1P4XA 1J75A 2RVCA 2FXAA 1DPRA 2VN2A 4O3MA 1TBXA 4KT5C 2OQRA 3JAMZ 2ELHA 3HHHA 4OIQF 2KRFA 3EYIA 2H6BA 2FE3A 3BROA 1GXQA 2ISZA 2RV8A 4N9HA 1RIOH 5LEJA 2P5VA 2LF7A 1J7KA 2XVCA 2ZMEB 1TNSA 1LDJA 4KDPA 4DNCA 3GFLA 4KN4X 5K5QA 2XROA 4FT8A 1R23A 2E1CA 3KP4A 4GYIA 3K0LA 4AD9A 4WCGA 3M9AA 4LLNA 1KU2A 2VBYA 1D8KA 3I4PA 1L0OC 4WK8F 4M74A 1UHMA 3I58A 3DPLC 3F8MA 3I0TA 2TDXA 2M1BA 1FNNA 4ZH4F 3HRTA 3CO7C 3QU6A 2L54A 2KKOA 1LB2A 2FNPA 3GFIA 3K69A 1S3JA 5E1XA 5D8KB 5HDKA 2STTA 3RI4A 3JW4A 4M6YA 4HDVA 3IC7A 3EDPA 2AXLA 1YS7A 1JE8A 2NYXA 1TQIA 2XHKA 2DFIA 2IJLA 2VC0A 2DQRA 3LA3A 3DFGA 4PCQA 1HW2A 5FLXZ 3J7AO 2PMHA 5DD8A 4HLXA 4O6JA 3HOSA 1OYYA 1NHAA 4M6XA 3CTAA 4RB0A 1U78A 4BAYA 2BEOA 3MCZA 4MHGA 3GO5A 1GHCA 1U8RA 3ZMVA 3M1EA 2H09A 1T2KA 5FLXK 4LB6B 3EYYA 3TO9A 1J59A 3WU0A 1HQCA 3GFMA 1H0MA 3DV8A 3F8CA 3TO7A 1ON1A 3F23A 2G9WA 4G7HF 4BHPA 3DKWA 2CG4A 1FZPB 3K1NA 2Q8KA 5L3GA 1YQAA 4ZYDA 1S7OA 4IF4A 3IRQA 5H6RA 2MLGA 4G6DA 2ETHA 3TDUC 3B02A 1K6OA 4HYEA 2M30A 3T0YA 4PGGA 3SXYA 3G3ZA 2XIGA 5FD6A 1WRJA 3SZPA 4L18B 3WGGA 3VOEA 4CYDA 1FSHA 4MQVA 3QPHA 5K1YA 1XDUA 4I0BA 1R7JA 3C18A 2DAOA 4MQ9F 4ASNA 1XDSA 1FYLA 1JGSA 2CO5A 2J5PA 2F5FA 2D45A 3MQ0A 2AS5F 3KP7A 5HOOA 4N0BA 4ZZLA 2J5OA 5DYMA 1AOYA 3GXOA 1R00A 5E20A 2XUBA 1PP7U 2EK5A 5H6QA 5CLSA 1XSVA 2K27A 2OBPA 2LNBA 4WXCA 3KP3A 3RKXA 2EA4A 3ECOA 1KU9A 4EGYA 1ONVA 2RNJA 3K9TA 3C1DA 1UCRA 2ADUA 3CDHA 1GVJA 3L7WA 4HX7A 5LEKA 1MJAA 1SFUA 4UV9A 2HGCA 2FSWA 4FHTA 1KYWA 4KNYA 1U5TC 1G3WA 4Y13A 1KGSA 5LGNA 1SD6A 5BPDA 3MZYA 1K78B 4KFCA 3SHFA 3TKYA 2WC2A 5ILUA 4BYYA 2LDUA 2E7WA 3V4GA 4U0VA 5LLQA 4ESBA 4CHUA 3NQOA 2HR3A 3FX3A 1IXSB 4I02A 2XAQA 3CUQB 5FD5A 1QO0D 4UNOA 5D5XB 3T1BA 3RKYA 2GAUA 4JBAA 2GA1A 2DO7A 5HS9A 2XAJA 2GZWA 3G73A 4HF0A 1ZLKA 3FHZA 1S6LA 2MC3A 4G6QA 1LEBA 2ACJA 5ILSA 1XD7A 2ZBKA 2QUFA 3R0JA 1XB4A 2CYYA 2GXGA 5K5OA 1XSDA 4RGSA 3ROUA 5FGMA 2DK8A 1ZN2A 2R7DA 2JSCA 3FXQA 3I53A 3LAPA 3ISPA 4EV0A 3HOTA 1IN4A 3FMRA 4RGXA 2XAHA 3QRFF 1U6GA 2VONA 4CO8A 1IF1A 2OAZA 2OA4A 3P9IA 2EB7A 5K5RA 2QYOA 3EQLF 2FNAA 3FXRA 4HQEA 3SZTA 2M45A 2W57A 2EA2A 4KICA 2YX4A 5IT9K 3Q9VA 1XGMA 1TW2A 3ZP5A 3F8BA 5E1ZB 3BOQA 1LNWA 2V6CA 3HRSA 1XGSA 2Z99A 4L5JA 4U7DA 2FMYA 1OYWA 2HYFA 1T38A 4EJTA 2V79A 4DQ2A 4LGWA 4AIKA 1UHWA 1FYMA 1P6RA 3V8JA 2M5WA 2XAGA 2VBWA 3FMSA 2Y75A 1R1VA 3NEUA 3BP8A 1MD0A 5EEGA 3ABUA 4HLYA 4P9FA 4CXFA 4RB1A 1DP7P 2F5EA 1QGPA 2IA2A 1CGPA 3KLNA 4RGRA 1FC3A 1W7PD 3MZHA 4EJVA 1LDDA 4TV7A 3IHUA 5HDNA 3BJ6A 1MJBA 2CW0F 2WWYA 4Y17A 1S29A 2ESHA 1FBQA 2HZTA 3FMQA 4A0XA 2D1HA 4EM1A 2BV6A 4LK0F 5BMZA 2VBZA 4RS8A 2P5KA 1I5ZA 3TGNA 1EH7A 4K2EA 4LMYA 4OMYA 5E18F 2A5YB 2PEXA 4L9NA 3KETA 3BPVA 1HW5A 4WXDA 3WTZA 2MA3A 2CWEA 4CDGA 1F4KA 5A2QK 1TTYA 2KIUA 4OIRF 5J6XA 1BOAA 2H27A 3GEZA 5ILVA 3ERED 3V7CA 3H92A 3I54A 3TQNA 1U3EM 1Q1HA 2JZYA 3ZPLA 1UB9A 3LQQA 1HSTA 2EFWA 3IL2A 1O57A 4H0EA 4HF2A 2ZCWA 3GX4X 4LD5A 1LJ9A 3WE3A 4XLNF 3DXJF 5EEHA 3SFZA 1OPCA 4UHTA 1RUNA 2BBYA 1I27A 2NRAC 4L5IA 3GF2A 1W5TA 2QBYB 4U0YA 3ABTA 4D0PA 1BI0A 5H20A 2V9VA 1IXRC 1MKMA 3F6VA 2K4JA 4A6EA 5HLGA 3W6JB 2FU4A 1CF7A 2JT1A 1IN8A 3ULQB 4ZYGA 4Z2YA 1O3TA 2NAZA 2EFPA 2R3SA 2D1VA 1B59A 4AIJA 2KJCA 3KP5A 2XV4S 3R0AA 2HOEA 4P9UA 1PDNC 1XCVA 4IJAA 5F6FA 5JHUA 1HXDA 3F21A 4B09A 4WXHA 2RDPA 2QBYA 4EJOA 4A5MA 4LG0B 3O2PE 2XRNA 4KA4A 5E1WA 2P7CB 3F6OA 3PQJA 2Z3YA 5HVQC 5F1RA 4M9SA 1CF7B 5DUIA 3WTSC 3F22A 1B4AA 1LQ1A 2VOPA 3FWEA 3IKTA 2NS0A 4PDKA 4OIOF 2K02A 3KP2A 2P4WA 3MAJA 4M73A 4YFXF 5FO5A 3QPTA 2UXXA 4S04A 2GQQA 3V8KA 4BH9A 2MD5A 3VODA 2B0LA 1DUXC 4ZZDA 4A0ZA 2O03A 2QM3A 2UXNA 2A6HF 2DQLA 1WWXA 4G9YA 2DT5A 5E8IA 2EWNA 1HW1A 4HBLA 4BXUA 4LK1F 2PBIA 2VOOA 4KUMA 4Y15A 3SQNA 4ENNA 3ZMSA 1G6NA 1YO5C 4GO1A 3WTXC 2IRFG 4B8XA 1USSA 3M8EA 1XCBA 2QZ8A 2HTJA 4WF2A 4MGRA 3CUQA 2F5DA 5ED4A 1KA8A 1ZH5A 5HLHA 5CVJA 3RKWA 4NHJA 5J8CA 1LEAA 5DUKA 1R5GA 1WI9A 2RN7A 5ICGA 1IN5A 4UUVA 1YW9A 6PAXA 3ZMTA 4HF1A 1S8NA 1ZGJA 4S05A 3KZZA 4Q5SF 4HX4A 2FEZA 3IWFA 2W25A 2DPUA 2P7VB 3GLXA 1B1BA 1ON2A 3HSFA 3E5XA 2UZKA 5LHIA 2ZMEA 3H3ZA 1ZREA 2BYVE 3E5QA 3ZN0A 3WGIA 5BS6A 1ZARA 2EV5A 2ZNZA 3E97A 2XKOA 2OQGA 3WE2A 3J81Z 4KIFA 3ZMZA 1JXSA 4JK1X 3D0SA 1D5VA 1Z05A 3WTYC 4OIPF 1ULYA 4KYWA 2WV0A 2OZUA 3QAHA 1IN7A 2X4HA 1C0WA 2QVOA 4EQQA 3ZMDA 3JSOA 1FX7A 1V4RA 5D6EA 2VE8A 2WTEA 3I71A 2DI3A 2ZKZA 2QLZA 5CVUA 1R22A 2R7FA 5E8GA 2W84A 3BY6A 3WTUC 4ZYEA 3HRUA 1R36A 1GXPA 3Q5FA 2PMUA 4PGHA 4AVPA 2CQKA 4EM0B 4IPAA 2EFOA 2D2WA 1TNTA 1F9NA 4CGZA 2A3SA 5TJJA 4ESFA 1FP2A 4R8HA 2PG4A 1TQPA 5ICEA 4UVBA 3T8RA 5HS7A 2PN6A 3WTTC 1SFEA 2V1UA 3KEOA 3DQVC 4EGZA 5BPIA 3WGHA 5JFRA 3HIFA 4EVIA 3F8NA 1KYZA 1I1SA 1ZAOA 3I59B 4RGUA 3C3WA 4U88A 3GW2A 1IN6A 4BHCA 2JPCA 2W85A 2ESNA 1IW7F 2PFBA 3HHGA 4M72A 4EJWA 1DPUA 4I01A 1FOKA 5FFXA 1ZLJA 3O6BB 1BC7C 1Z6TA 1OYIA 3E6CC 4EMSA 4HW0A 1ODDA 3ML6A 2P6SA 2K7LA 1BN5A 4R1HA 5LGUA 3RYRA 3DP7A 4G7OF 4ETSA 3HSRA 2A07F 3RPQA 3LA2A 2RGVA 2M87A 2L3DA 4XSXF 2G7UA 3TOBA 4P5OA 3COAC 2JTVA 4O5VA 1IRFA 5CJ9A 4IVNA 3IRRA 4KN7X 4YIIA 2FBHA 2Z9OA 2HDCA 3LA7A 4M9ZA 2YX7A 2ZXJA 3T8TA 1J2XA 1SMYF 1O3SA 4I0AA 3BJOA 2GXBA 1IRGA 2K86A 3WTWC 4IRGA 1J5YA 3U1DA 4QWQA 2L01A 4A5NA 2UWMA 3LWFA 5IT3A 1G3YA 3OOPA 2VXZA 5L3EA 3HRMA 5DCMB 4YFKF 1TW3A 4HQMA 3ZQ7A 3ZN1A 1RZ4A 1F5TA 4UVCA 5HLIA 3IKVA 2DK5A 2VBXA 1K79A 3R6SA 3H3UA 4WX9A 4I98B 2O8XA 3BJAA 4OINF 1YLFA 2HFHA 2KIMA 2GIVA 1MDMA 1FYKA 1O3QA 2E7XA 2ZJ2A 1P92A 3FXUA 3VEPA 1DDNA 1RUOA 2PLYA 3GYHX 3PFIA 4I7HA 4RB2C 5D4SA 1FWZA 1U5TB 1PP8F 3V7SA 3E5UA 3RTRA 3N4MA 1B6AA 1XMAA 3HSEA 3DF8A 2O0YA 1ZRFA 3JAMK 2IA0A 4HOBA 4ENKA 2IW5A 3B73A 4HV6A 3M8FA 2G7HA 2QQBA 1B9MA 1LDKB 4FX0A 1KQ8A 5D5WB 4XLPF 3FF5A 3R61A 2A68F 2A69F
chains in the Genus database with same CATH superfamily
2HQAA 1P2FA 3ZQGA 2ZJRF 3PQKA 3DU6A 3QOPA 4BDYA 3CC7I 1R58A 5F27A 1JHHA 5LBQA 1VQOI 1MJ9A 1ZG3A 3CLOA 3WG9A 3HM5A 3OL3A 4UUTA 2BGCA 4MEYF 2JJ7A 3TMOA 5TRDA 4PK4A 3BQYA 3CCEI 2L4MA 3QPLA 3I5UA 2KIFA 4HDUA 3M7GA 2YU9J 4PJMA 2YSRA 2DBBA 3TOAA 2F6CA 4PSXA 4GXOA 2R7XA 2IEKA 3EETA 2JA5J 1FY7A 4GCVA 2EZKA 2E5NA 5BQTA 5DM7F 2W00A 4XRSA 1Y6IA 3OIQA 3DPTA 3S2WA 4G94A 3HTUA 4CCOA 4ESJA 2L0KA 5F1JA 3RJPA 2VI6A 3VB2A 3V7RA 2DN0A 3S93A 5J40A 5FKKA 1HCRA 3HYIA 4M6VA 3F9KA 2H1LA 2IVMA 4BJTA 1EH8A 2IT0A 1FPQA 2DMQA 2EINH 4XN0A 4JOMA 4ZYAA 4IZZA 4A3DJ 2HQNA 3IAS2 3E3VA 4C30A 2DPDA 1USTA 2DOFA 3L09A 4N9IA 3NWSA 2M8GX 2RKHA 3JCUC 3EUKL 3LNQA 1HKQA 4CCKA 1YRNA 1VNDA 2DDAA 5KCMA 1U2WA 5C4JJ 4BJ6C 2W24A 2JVHA 1SAXA 1ZRCA 4QLCU 4HNVA 2O3FA 2M8EA 3L2VA 2W1OA 2OD5A 1T8IA 3JSPA 4HA8A 1BI2A 1UG2A 4A2UA 4KIGA 4XQFA 3FZVA 4MO7A 3RIRA 1XGNA 3LQRA 3JRGA 1R5HA 2DOEA 2HI3A 5IOYA 5DV5A 3BZKA 1JJ6C 2MBFA 2UV1A 1K7AA 1S7AA 4MFDA 3RDIA 3AL0C 5D4RA 1LE8B 3TO6A 1REPC 2X6XA 4LITA 1A04A 4UV8A 3TDZC 3J7AY 1QPMA 3CUQC 5KK1A 3MVPA 3KE2A 3MFKA 3J80K 2QGUA 3I59A 4E70A 5B66C 4E7HA 1B8IA 2LF8A 2GLOA 2R7VA 2O8KA 4M3BA 1W4MA 2E1OA 3KFWX 4ZDPA 2YR2A 3ZRGA 2X1EA 2XDVA 1KU3A 4HX8A 1BI3A 1NG6A 2HYGD 2LBFA 1I6XA 1BOBA 1TLHB 4G12A 1YRNB 1OMIA 3L00A 3ZQFA 1T39A 3CJQB 5F0HA 5FB2A 4GYGA 3GWZA 4L9JA 1T0FA 1F43A 1HKTA 2VUMJ 1LKXA 1XMKA 5JR3A 2FQ3A 2DA6A 3DLAA 1BJAA 2DA7A 5LRRA 1YFHA 2HKOA 2PJPA 1V5GA 1STZA 3HUGA 3K1MA 3TL4X 3MKLA 1ACIA 2DA1A 2XPWA 2IPQX 4CICA 4XM3A 1FBSA 3MWMA 3PM1A 2K4BA 4LLLA 4A3JJ 1PUFA 3S3OA 4BUPA 2P5LC 4KT6A 3BR3A 4AVZA 3BCAA 3P9KA 3VYRB 4F7ZA 4A3IJ 3HTSB 2XGCA 3I56I 1XX5A 3OIPA 2K3FA 2FD5A 4YG2F 3G4SI 4DZPA 3CUOA 1RETA 2E1NA 3EUAA 2HS5A 4YFNF 3K70C 5ERIA 2YPRA 2IAIA 4MLOA 1Y8QB 1R1TA 3V8LA 4C3HJ 5FFZA 4A0YA 4L9TA 1MBHA 5LRSA 3RZDJ 1T6SA 1FJLA 3FBIB 2ELJA 5AONA 3CDIA 3GVAA 2STWA 1W5SA 5GTIC 1P4WA 3S1NJ 4XOPA 5LHHA 2KP6A 2FRHA 5KHDA 5E3OA 2K5CA 1W7PB 2ISYA 5CYVA 3REOA 1AHDP 1QPIA 1QZZA 2ZSIB 2HU9A 1BIAA 2OPTA 1AKHB 5LGTA 1IG7A 4ZDLA 5D5VB 4WWCA 5BNGA 4B43A 2V1XA 4FQGA 2H6CA 2QQ9A 4Y4RA 3SEZA 5EGOA 2WY8Q 1Y8RB 3BWGA 3OYAA 1QQIA 2XPVA 1TC3C 3CMMA 5HNFA 3KCCA 4BE2A 1D0YA 4DJAA 2EV0A 1SD4A 2QKMB 3R60A 4MIMA 4FCYA 3ABMH 3VYUB 1WJEA 2A6EF 3I64A 4BBRJ 4IXAA 3QU3A 4L0ZB 4CH7A 1NTCA 2LVSA 5L3DA 3RYPA 4IX7A 2F5CA 3HKZN 2VJ4A 4E7IA 4BNCA 4UVAA 3K1PA 1VQKI 5M5WJ 5DS9A 1O3RA 1BC8C 1FT9A 4U7BA 3LAJA 5FLVA 3HJEA 3D1NI 3RZOJ 1OCZH 2JQ7A 2BE5F 2H94A 3M8JA 2HEOA 5E17F 2DMUA 2XF5A 3BPXA 1J0RA 3HXLA 3QYFA 2P8TA 3KYDB 1OCOH 3JREA 1O4XA 2RC4A 3OYNA 3JTGA 4RM3A 3DKYA 1Z1DA 2O61A 3ELKA 3VSKA 4X0GA 1W7PA 2HXOA 2FA5A 3MEXA 4LG0A 3P7NA 2RQPA 1MZBA 3BTJA 3U2RA 3BR1A 3O3KA 2FF4A 4M71A 1JHFA 1Z7UA 2Z16A 1MBEA 1D1CA 5C3EJ 2FJ1A 4L9VA 5FKMA 1H9TA 3W6VA 3E0JB 3P5JA 1FBUA 3K2ZA 1IGNA 2Q0OA 5ICFA 1TWGJ 1P7IA 1YIOA 2E71A 2VODA 5B1AH 1SD7A 3GUDA 4A12A 1S7EA 2B63J 1P4AA 3D5SC 1SVLA 4YIFA 5IT9Z 4XRFA 2MH2A 1Q1VA 3BLYA 5DTDA 1RPWA 1OKRA 2XAFA 2Y0MA 2OTJI 3OWTA 3HKZA 2A61A 1BL0A 3KLOA 3EUHA 2P0WA 2ZNYA 4ZYHA 4Y33A 1WQ2A 2COMA 1T33A 3Q0UA 4DOZA 4NB5A 3L2QA 1E17A 2GA2A 5LHGA 2EIMH 4LJZF 1ZGWA 4LB5A 3N97A 2JSPA 1D3YA 1ZRDA 4BGDA 4GGGA 4CYCA 1MDMB 4C2TA 1BBYA 3GZ5A 1JTYA 2V9KA 3LMMA 3RQ4A 4BQAA 2LR8A 1IUYA 4YEJA 2MGQA 2QSFX 2HOTA 2X0LA 4MNUA 2QENA 1D0ZA 1FSEA 2OF7A 5F64A 1A5JA 1D8JA 3KP6A 2AQFA 4CCNA 2TRTA 5CVIA 1HBXG 2NVUB 1MMDA 3CO6C 3PIOF 5JVTA 2EJRA 3F72A 4P55A 1N78A 3AG4H 3KEQA 4AIDA 1Z21A 4LLGF 4YELA 2Y2ZA 3LSTA 5CVVA 1OR7C 3S1MJ 1Z6RA 2R92J 2FMLA 3G71I 2ZFWA 2GOXB 4FE4A 3C7JA 2PI0A 1JI8A 4KIBA 4LFUA 5AIQA 2GBYA 2LP0A 2R5ZB 3H9GA 2R7QA 2X1CA 1BI1A 3GFJA 3KPHA 2X6WA 2CFXA 5IYDJ 3HGGA 4Q48A 5L3CA 1MGTA 3QP6A 4OOIA 4OMZA 2YU3A 1Z91A 4B4CA 2EFQA 4I2OA 2ME0A 3GTOJ 5LD2C 2VQLA 2HWVA 1HA8A 1K83J 5F04A 2L9RA 3IWZA 5DEQA 2HTSA 2LSOA 2L4AA 2OU2A 2KDZA 4DBRA 2DLLA 5L3BA 1IZ1A 1WJCA 5J1UA 3TW6A 2XB5A 4A3EJ 3E6BA 1G4DA 4M3EA 3OV8A 2FQ4A 4KMFA 5BOXA 1B8IB 4Z6YA 1SAUA 1YHQI 4BHBA 2KISA 3U9GA 3CF2A 3K4CA 3L9FA 1K6YA 1ZQ3P 1VZ0A 1FIPA 2P6TA 3PNTA 4XBFA 2VC1A 5C44J 5HS8A 3BZ6A 4DZJA 3ECHA 5AIPA 2HDDA 1AWCA 3OYEA 4XN3A 4HZFA 2HQRA 2M0CA 2ZXIA 4G7ZF 1ZGAA 1X2NA 2W48A 2Y0SN 4A3LJ 2DOAA 4IRHA 2Q2EB 4R79A 4NC7A 1EH6A 1WI3A 2VT3A 4IHTA 2VL8A 1SMTA 1X1CA 4EEFG 1J9IA 1Y0NA 2DCEA 3DEWA 3T5XA 1YS6A 1WH5A 2F2EA 4RAYA 1AKHA 4C2UA 2CQ7A 5CVRA 2P81A 3GTQJ 2FX0A 1XSXA 4MTEA 5L3FA 3F8FA 2KZVA 3OR1C 1WHUA 5FLMJ 1D0XA 3J7YJ 3FXJA 1ZG5A 1SD5A 1UELB 2MLKA 3N05A 1GUUA 2WY7Q 3DTIA 4JQFA 4Q4ZF 2Z33A 1E3HA 1MNDA 2HVQA 2PQ8A 4II2A 4DGWB 1EV7A 3H0GJ 1XGOA 1BR1A 1QVUA 3HZJA 4ZTFA 3JRBA 2NXNB 2BY0A 2KRCA 2EPFA 4D7MA 2FBIA 3B6CA 1OLTA 3LFKA 4ZDOA 1SFXA 3ZMUA 4IKFA 4E7SA 3J81K 1HSJA 2VT2A 3F3XA 1T08B 3FM3A 1K78A 2LKSA 5DD4A 2CSOA 1RNLA 1TQMA 5DCFA 1QZYA 4XKCA 3VYSB 4E7JA 4EJUA 5GAGJ 4RMNA 1Y0UA 2XGXA 1S5LC 4XSZF 4B44A 3E6MA 1F1ZA 4ENJA 1RRJA 4JP0A 4G8XA 3WTVC 2XASA 1V3FA 2MD0A 3VFZA 1Z9CA 2JA6J 1J09A 3LSHA 4ON0A 2EFNA 1KQ0A 5D8LB 4M9XA 2OZ6A 1RR8C 1QNTA 3CCJI 2GWRA 1ZHFA 1IRXA 4KMUX 2HQ5A 3BCBA 2CGPA 1FLIA 3WODF 1FTTA 5ICCA 4A6DA 2F4MB 2DW4A 4A3BJ 1G3SA 2HDWA 4P96A 1I1GA 4IHSA 3KZYA 4NQWA 4KJZA 3FM5A 1N75A 3TP0A 1E2XA 2HKXA 2DJIA 4Q47A 2QQAA 4W97A 2JPBA 1K4TA 3E7LA 3EPZA 1RKWA 3VWBA 4AIHA 2ZXWH 3FKIJ 5EZGA 3FK7A 3AAFA 2DU9A 5D5UB 3L2CA 3GTMJ 1BM9A 3D5RC 3M3YJ 3CJNA 2HPIA 1XN7A 4NC8A 1RI7A 5M3MJ 2KZGA 3K2AA 5HDGA 3AG1H 3HPHA 4HV5A 3W6KB 2HZDA 1YW7A 2WADA 2LH9A 1BIBA 2IGMA 2NNYA 1V54H 1FOYA 2EIKH 4I09A 2RQQA 4DW6A 2X6OA 2Y48A 1G3TA 2IA1A 4ZJZA 4MEXF 2XGDA 5HLTA 2FOKA 2M7AA 1JUSA 2LKPA 1BJZA 2VQCA 1ITYA 2CU7A 3JRHA 2Q1ZB 1KONA 1UFMA 2DTRA 3BQZA 4AWXB 3JTHA 1IXCA 4BS9A 4HEA2 5J8FA 4I99C 2FUG2 3VYTB 2VE9A 4RB3C 4UUSA 4F55A 1K61A 5KNLA 1D1AA 1ZG1A 2ZC2A 1KU7A 1VI0A 1NK3P 4PZJA 1XS9A 5J47A 2QWWA 2X85A 2Z5UA 4V2FA 3S32A 2XKPA 2Z2SB 1YW8A 4CZZA 1O7LA 2LY1A 4B1RA 1DGWY 2R5YB 2O6GE 1X3UA 1HOMA 3NRVA 1IAWA 3ZOBA 4FX4A 3SJMA 5JI6A 4BQQA 2L9SA 1JKPC 1WKMA 2IP2A 2RNGA 2CUEA 3C2GA 4YRVA 1ZYRF 1R6RA 3GZ6A 4MTDA 1H9GA 5DCMA 1NG7A 3GTJJ 2X9DA 1T98A 2L02A 2FBKA 1QBJA 2MC4A 3R4KA 3VSLA 4L0YB 1YYVA 5J4VA 1B9NA 1O7FA 3BDDA 1JKRC 4OU0A 2VJ5A 2MH9A 4CCJA 1YE9A 2EV6A 4EM2A 2C6YA 2VIXA 3AG3H 4ENMA 1ETWA 2NNNA 3D5LA 3LSMA 2CQXA 2F5VA 1FP1D 3WU1B 1YG2A 4PJJA 2V1DA 2IS1A 5DDGA 1OCRH 1MMNA 2M4KA 4U0WA 1M1EB 3BG6A 3P9CA 2QCOA 2D5VA 3OS1A 3S1RJ 1XC5A 3QOEA 1R1UA 4HAMA 3RPUA 1LVAA 2KL4A 5D6FA 4RBOA 2JRTA 3CCMI 4BY1J 2GIZA 1GV2A 1KQ9A 1PYVA 5GPAA 3DTKA 1YTYA 2E2HJ 2EBIA 2JVGA 2XSDC 1U5TA 2ZO4A 3QP5A 2Q2EA 1HKSA 3IAM2 3CCYA 3X2QH 1L3LA 3RKQA 1YITI 4IOAF 4BEHA 4IRIA 4NC6A 1VTNC 4Y3OA 3DEUA 3Q9SA 4PUSA 1GDTA 3BZCA 2OJED 4J00A 4RAZA 5KVRA 5A2QZ 3E6DA 1OR7A 3CP2A 3J80Z 1WFXA 2X6YA 1N25A 2KJBA 4NDLA 1WSUA 2L9VA 2K85A 4NBQA 4XKBA 4MFEA 1PUEE 4UXNA 1BR4A 1P4XA 3QPSA 4RM2A 1G2HA 1J75A 2RVCA 2FXAA 1DPRA 2VN2A 4O3MA 1TBXA 4KT5C 2OQRA 1X19A 3JAMZ 2VKHA 3RSNA 2ELHA 3HHHA 4A93J 4RDUA 4OIQF 2KRFA 2WAEA 3Q0WA 3EYIA 2H6BA 2FE3A 3BROA 1GXQA 2JRMA 2RV8A 4N9HA 2ISZA 1RIOH 5IP9J 2DYSH 3OIOA 1I50J 4XOTA 1X1PA 1KZHA 5LEJA 4B3XA 2P5VA 2LF7A 1J7KA 2XVCA 3O8GA 1ETYA 2CV2A 4HSRA 3CLQA 2I8DA 2VKVA 5C4XJ 3ZQCA 1X4OA 2CRGA 1MSEC 2ZMEB 4C9YA 2K40A 1TNSA 3OYBA 1LDJA 4KDPA 1GLNA 4DNCA 1MW7A 4BEHB 5LFAA 1E0EA 3GFLA 4KN4X 5K5QA 4E4HA 1SEUA 2A6TA 2XROA 4GDFA 4FT8A 1R23A 4IHWA 1XTAA 2E1CA 3KP4A 4GYIA 3BTCA 3K0LA 4AD9A 4WCGA 3M9AA 4LLNA 1KU2A 3FXKA 2DA4A 3ZCOA 1SFOJ 5M5YJ 3S16J 2VBYA 4CZCA 5EG0B 1D8KA 2BZTA 2LTPA 3DEEA 3I4PA 1L0OC 4J19A 1VQ4I 3V42A 4WK8F 4M74A 3OYMA 1UHMA 3I58A 3DPLC 3F8MA 3BR5A 3OR2C 3ERMA 3QQAA 3I0TA 4AU7A 1IDYA 1UZCA 2TDXA 2M1BA 1JUMA 1FNNA 4ZH4F 3HRTA 3CO7C 4DIQA 3QU6A 2L54A 2KKOA 1LB2A 4ITVA 2FNPA 3GFIA 3K69A 4HNTA 4BU2A 3JRIA 1S3JA 3HOXJ 1FIAA 5E1XA 5D8KB 5HDKA 2DXIA 2STTA 3WU2C 3RI4A 3JW4A 3H3VK 5KAIC 5JVGF 4M6YA 3C2BA 4KITB 3NAUA 4HDVA 3LSKA 4IEJA 1K4SA 3IC7A 5JLXA 1W36D 2IS4A 3EDPA 3CD6I 2AXLA 1YS7A 1A35A 1JE8A 3FHNA 2NYXA 1TQIA 5IP7J 3DPUA 4IQ4A 5B3SH 3PFYA 1LE8A 4LG3A 2XHKA 4PFPA 2DFIA 2IJLA 1MSFC 2VC0A 2DQRA 1ETXA 3LA3A 4HRIA 3DFGA 4PCQA 1HW2A 2KPMA 5FLXZ 3OYDA 2ME6A 3BG3A 5HNHA 4XKWA 3J7AO 2PMHA 1UAAA 3PO2J 5DD8A 4HLXA 4O6JA 3HOSA 2LLKA 1OYYA 1NHAA 4A3MJ 3FKJA 4M6XA 3CTAA 4RB0A 3CCUI 1U78A 2UUZA 4BAYA 3S17J 4QPOA 3DLLF 2BEOA 3DKXA 2DDBA 3BTIA 5IYCJ 3MCZA 1YOVB 3ABKH 4MHGA 3GO5A 1GHCA 3W2AA 2KMUA 2Y31A 1DGRM 2AO9A 1U8RA 3ZMVA 3M1EA 2H09A 1T2KA 5FLXK 4BL0B 4JYKA 4LB6B 3EYYA 3TO9A 2LBFB 4YIRX 4LIVA 5GAHJ 1J59A 3UNGC 3L1PA 3WU0A 1X1BA 1HQCA 2LY9A 3GFMA 1ORKA 1OCCH 1H0MA 2COBA 2MFZA 4XLCA 4DBQA 1WGXA 3DV8A 5M3FJ 3PJRA 3F8CA 3TO7A 2BXZA 3FXLA 1ON1A 3F23A 2G9WA 4G7HF 3ZXSA 4BHPA 3DKWA 2CG4A 3MD2A 1FZPB 2R93J 3K1NA 4OAYA 2Q8KA 2JA7J 5L3GA 1YQAA 2E34A 2QF7A 4ZYDA 1SFKA 4HSTA 3B6AA 2JA2A 4PSWA 2O5RA 4F92B 1S7OA 1WJBA 3H9QA 4NNJA 3FXOA 4IF4A 2IGKA 3A0BC 4F3QA 2R5ZA 3IRQA 5H6RA 2MLGA 2XF7A 1X4PA 2IS2A 4G6DA 2ETHA 3TDUC 2G0EA 2CH0A 5E79C 1ZELA 1UG0A 3B02A 1K6OA 3IH2A 3L2UA 3LSGA 4HYEA 1ETOA 3KYCB 2DFFA 1FMWA 1RR7A 2M30A 3T0YA 3WHBA 1G8XA 4PGGA 3SXYA 1WZ2A 2L7ZA 3G3ZA 1IDZA 2Y9YA 4XORA 3L2WA 1EKEA 1R71A 2XIGA 5FD6A 1WRJA 3SZPA 3OYIA 4L18B 3WGGA 2WAQN 3HOYJ 3VOEA 4CYDA 3ABLH 1MMSA 1FSHA 4QSHA 4MQVA 3W2WA 2IGNA 4HNUA 3QPHA 2Y9ZA 5K1YA 2QA4I 3S15J 1XDUA 2XPUA 4I0BA 1R9TJ 1ETVA 1OCPA 1R7JA 5IP6A 3C18A 2DAOA 4MQ9F 4ASNA 1XDSA 1FYLA 3H1CA 1JGSA 1VQ7I 2CO5A 1H89C 2M0MA 3K10A 1YJ9I 4F91B 2J5PA 3AL0B 3HBLA 2F5FA 2D45A 3MQ0A 2OTLI 2AS5F 3KP7A 4E6KG 3C2HA 5HOOA 3J7ZI 2F4OB 1Z7LA 4N0BA 2EZLA 4ZZLA 1IJWC 2J5OA 2V4JC 2CV0A 5DYMA 1AOYA 1MNEA 3GXOA 1E3PA 2EIJH 2X48A 3OYCA 1R00A 3OYJA 1WVRA 5E20A 2XUBA 1V5FA 1PP7U 2MYSA 2EK5A 5H6QA 1BR2A 5CLSA 1TWCJ 1XSVA 1S9HA 2K27A 4IL6C 2OBPA 4I76A 1R4NB 2OC6A 1YIJI 2LNBA 4WXCA 4M3FA 1RC9A 3KP3A 1TWAJ 3RKXA 1SVMA 4OAZA 2EA4A 3ECOA 2LRDA 2QQ8A 2HOAA 4ZC3A 1KU9A 1MBJA 4XR6A 3GMEA 4EGYA 1ONVA 2RNJA 3K9TA 3C1DA 2DODA 1UCRA 2ADUA 1XG1A 3CDHA 1GVJA 3L7WA 1X3ZB 2DTZA 3PNYA 4HX7A 4X6AJ 1YX3A 5LEKA 1MJAA 1RESA 1SFUA 3JRAA 1FMVA 3M1CA 4UV9A 3K4NA 2HGCA 2K9LA 2E35A 2FSWA 4FHTA 1KYWA 4KNYA 1U5TC 1G3WA 4Y13A 2R7RA 1KGSA 4CSWA 5LGNA 1SD6A 4UY8I 5BPDA 3MZYA 1K78B 4KFCA 2QEXI 3SHFA 3TKYA 2HYJA 2EILH 2WC2A 5ILUA 4BYYA 3LSPA 2M4GA 1POGA 2LDUA 2E7WA 4A3CJ 3MZ8A 3DTEA 3V4GA 4U0VA 2NS7A 5LLQA 3GTKJ 2IGOA 2Z1DA 4ESBA 3K70D 4CHUA 3NQOA 2HR3A 3FX3A 3DBLB 1IXSB 4I02A 2OCCH 1HDPA 2XAQA 3CUQB 2R7SA 5FD5A 1QO0D 4UNOA 5D5XB 5M5XJ 3JR9A 3K4JA 3T1BA 3RKYA 5F0FA 2GAUA 4JBAA 2GA1A 2DO7A 3CJTB 2ECBA 5HS9A 5HODA 4QTRA 4BDZA 2XAJA 2PJRB 1TWHJ 2GZWA 2PX9A 2DMPA 3G73A 4HF0A 2JA8J 2E5ZA 1ZLKA 1WPKA 3ASNH 3FHZA 1S6LA 2AXTC 2EH3A 2MC3A 4G6QA 3FBNB 1LEBA 2ACJA 5ILSA 2A05A 4B48A 3MKZA 3TP3A 1XD7A 2ZBKA 2QUFA 3R0JA 1XB4A 2CYYA 4HPQA 1SC7A 3S1QJ 2GOMA 2GXGA 1GVDA 5K5OA 1XSDA 2R4GA 4RGSA 3HUGB 4XNFA 3ROUA 2DT6A 5FGMA 2DK8A 1ZN2A 2PMZA 2R7DA 3IH4A 2JSCA 3FXQA 3I53A 4LOCA 3ISPA 3LAPA 4EV0A 3HOTA 3SYTA 3PSIA 1IN4A 3FMRA 5IY5H 4XRSG 3OL4A 4RGXA 2XAHA 3RQIA 3QRFF 1U6GA 2VONA 4IHYA 4CO8A 3SZGA 1IF1A 1LFPA 3HC7A 2OAZA 2OA4A 3GTLJ 3P9IA 2EB7A 5K5RA 1MH3A 3A4CA 5JLWA 2HVRA 2QYOA 2DYRH 4BXXJ 1QHHD 2FNAA 3EQLF 4LIUA 2HXIA 4N4OB 2R7ZJ 1BW5A 3G1LA 3FXRA 4AYBN 4HQEA 3SZTA 3AKZA 3HG9A 2M45A 2W57A 5F0CA 2EA2A 4KICA 2YX4A 5IT9K 2CQNA 1ZTRA 5E3MA 3Q9VA 1XGMA 1TW2A 1YJWI 4C2MJ 3ZP5A 4FASD 3F8BA 5E1ZB 3BOQA 4ZTJA 1LNWA 5FROA 2CJJA 4FISA 1NK2P 2V6CA 3GCMA 3HRSA 1XGSA 3W3CA 2KFDA 2Z99A 4B47A 1SVOA 3DBRB 2XSJC 4L5JA 4U7DA 2E36A 2FMYA 2CV1A 3CCVI 1OYWA 1VQPI 2HYFA 1A6IA 1GV5A 1T38A 4EJTA 2BVLA 2V79A 4DQ2A 1VQ9I 4M3DA 4LGWA 5J4YA 4AIKA 1PVEA 1UHWA 2M3AA 1FYMA 1EA3A 2L7FP 1P6RA 4I6ZA 3PNVA 2VQHA 3A03A 1TT0A 3S14J 3V8JA 3LL7A 2VQGA 2M5WA 2I10A 3BR2A 2XAGA 2VBWA 3FMSA 2Y75A 1R1VA 3NEUA 1ENHA 3BP8A 1MD0A 5EEGA 3BG9A 3LSJA 3ABUA 3HPGA 4HLYA 1ZR2A 5CKTA 4P9FA 3PUFA 4CXFA 4RB1A 1DP7P 2F5EA 1WH7A 4XL9A 1D5YA 2PMZN 4QIWN 1QGPA 2IA2A 1CGPA 9ANTA 3KLNA 4RGRA 3CCRI 1FC3A 4G6TB 1ERDA 2HVSA 3HOUJ 1A36A 2LFBA 1W7PD 3MZHA 4D1QA 3IV5A 2VKEA 3FDYA 4EJVA 1LDDA 4TV7A 3I4NJ 3IHUA 5HDNA 3ASOH 3BJ6A 2L5QA 1MJBA 2CW0F 3LFUA 2WWYA 4BE1A 4Y17A 3BC8A 1S29A 3HL2A 2ESHA 5B1BH 5DM6F 2Y0SA 5E3NA 1VQ6I 1FOWA 3AFHA 1FBQA 2HZTA 2LMDA 5FJ8J 3FMQA 4A0XA 2D1HA 4EM1A 3CESA 2BV6A 1MIJA 2LOOA 4LK0F 5BMZA 3IH3A 2VBZA 5GPCA 1I39A 5E3LA 3CCQI 2NVTJ 4RS8A 3TEDA 2P5KA 4BE0A 3CF5F 1I5ZA 3OMYA 3TGNA 2CFOA 5FKOA 1EH7A 1YJNI 1AU7A 4K2EA 2WB1A 1WCMJ 4LMYA 3PIPF 1LVKA 4OMYA 5E18F 2BHYA 1UHSA 3GLLA 2E1MB 2A5YB 2PEXA 2DT7B 3G1MA 5EF6A 2R5YA 4L9NA 3KETA 3BPVA 2BW3A 3CP8A 3BG5A 3H5AA 2O7OA 3F0CA 1HW5A 2ZSHB 4WXDA 3WTZA 4PJNA 2MA3A 2CWEA 4RAGA 4CDGA 1F4KA 3A02A 4A3GJ 5A2QK 4M3GA 2IS6A 1TTYA 1MMGA 5J3LA 2KIUA 1X3WB 2OUMA 4OIRF 1MBFA 1I3QJ 2K9SA 5J6XA 1W0UA 1BOAA 4V2GA 2VASA 2H27A 3JRDA 2BOLA 3GEZA 5ILVA 3ERED 3V7CA 3RCOA 3H92A 3I54A 4BQNA 3Q0VA 1Y39A 5FRNA 3OOUA 2PJRA 1B72A 4D7NA 3TQNA 2K3PA 2RREA 1X2MA 1ETQA 1Q1HA 2BW3B 2BY3A 2JZYA 3CQZJ 1U3EM 2WB1N 2E2IJ 1UB9A 3FIWA 3ZPLA 4Y52J 2DMTA 3LQQA 1HSTA 3TBIA 1OFCX 2R0QC 4A3KJ 2V26A 2EFWA 2JMWA 2LYCA 1P7JA 3IL2A 1JGGA 2VB6A 1O57A 3ZQHA 4H0EA 3A1YA 4HF2A 1BW6A 2ZCWA 3UR3C 3WG7H 3CMEI 3GX4X 1QA6A 1JUPA 4LD5A 1LJ9A 3WE3A 3PSFA 4XLNF 3DXJF 1NH3A 5EEHA 3SFZA 2VXDA 1OPCA 2KQRA 4UHTA 1RUNA 1P9QC 4CCLA 1BA5A 1JJ8C 3QWLA 2BBYA 1I27A 2NRAC 1IO2A 4L5IA 3GF2A 1W5TA 3KEYA 2QBYB 3AG2H 3OY9A 4U0YA 3ABTA 3DWLE 1MMAA 4QPQA 1QRYA 1ZKGA 4D0PA 3VPRA 3U21A 1BI0A 3FK6A 5H20A 2V9VA 3EUHC 1APLC 1IXRC 1MKMA 3F6VA 3ONQA 2K4JA 4A6EA 3NWTA 4RA2A 1T56A 5HLGA 1LFBA 2CS3A 3W6JB 2ZMEC 1CQTA 2K9NA 1DU0A 1XMXA 1Z3XA 1WJFA 3ZQQA 2FU4A 1CF7A 2JT1A 1IN8A 3ULQB 4ABZA 4ZYGA 4Z2YA 3JRCA 4RLQA 1O3TA 3GTPJ 2M7BA 2M9HA 2NAZA 3IUOA 2CUZA 4JX5A 4XONA 3HB9A 5FRMA 2EFPA 4F93B 1FOXA 2R3SA 2D1VA 1B59A 2AQEA 4AM3A 1WJ5A 3HGYA 1ZR4A 3CDLA 4AIJA 2GM4A 2KJCA 2K9MA 3KP5A 4U87A 2XV4S 3R0AA 2HOEA 2YS9A 4B3AA 1JKOC 4P9UA 3TW7A 3CZ6A 1PDNC 2ECCA 1XCVA 4IJAA 4PJLA 2V9PA 4UB8C 4XKVA 3SFIA 1JT0A 5F6FA 1PJRA 3HOWJ 5JHUA 1HXDA 3F21A 1YX5A 2ZB9A 4B09A 4WXHA 2RDPA 2QBYA 2EZIA 2L2OA 4EJOA 4A5MA 1I6HJ 3ZQLA 4LG0B 3O2PE 1HLVA 2XRNA 4XLEA 4KA4A 5E1WA 3K4KA 4V19K 2P7CB 5J1YA 3F6OA 4C3JJ 3PQJA 2K9QA 2Z3YA 5HVQC 3BTLA 5CQGA 1W1WE 1QU3A 5F1RA 4M9SA 1CF7B 5DUIA 3WTSC 3F22A 2DJNA 1B4AA 3OYFA 1LQ1A 3PL8A 2VOPA 3FWEA 3BG7A 3IKTA 2NS0A 4XMYA 2R7UA 2F48A 4PDKA 4OIOF 2LKXA 5EYRA 3S2DJ 4CA0A 1U9NA 2K02A 2WAQA 4CUGA 2ZXHA 3KP2A 3A2KA 2P4WA 3MAJA 3Q3SA 3GTGJ 4M73A 4F52A 4YFXF 4XK4A 5FO5A 1JKQC 3H5NA 3QPTA 1TL8A 1W0TA 1QZEA 2UXXA 1EF4A 4L5EA 4S04A 1T95A 4PJ0C 2GQQA 2NS8A 4AYBA 3OYHA 3L2RA 2BY2A 3V8KA 4BH9A 1W36C 2MD5A 2ELKA 3VODA 2B0LA 1DUXC 4RLFA 4ZZDA 5K7HA 1TT5B 1ETKA 4A0ZA 2QSHX 2O03A 2QM3A 2UXNA 2A6HF 3K4BA 1LFUP 2DQLA 1WWXA 4G9YA 2DT5A 2B7EA 2E1MC 5E8IA 1Z0XA 3QYBA 2EWNA 1HW1A 4X1EA 4HBLA 4BXUA 3ZR8X 4LK1F 2PBIA 2VOOA 2WBMA 1VQ5I 2DFEA 3OYKA 2KDOA 2H1KA 2DA2A 2JN6A 3OS0A 4KUMA 5FKLA 1VQLI 5EZHA 1IUFA 4Y15A 3PO3J 2E2JJ 3SQNA 4ENNA 3ZMSA 4BKXA 1G6NA 2NVXJ 2VLAA 1YO5C 2ZFUA 1ZK8A 4GO1A 3WTXC 3DU5A 2IRFG 4B8XA 1USSA 3A0HC 3M8EA 1XCBA 1Z67A 4PFOA 3K6GA 3KX2A 2A5WA 4H4KC 2QZ8A 4II3A 1WJDA 2FOWA 2HTJA 2VKDA 3I3LA 4WF2A 4MGRA 3HEFA 3CUQA 2F5DA 2DFHA 5ED4A 1KA8A 3QYEA 1ZH5A 1OJLA 2V6EA 1WJAA 5HLHA 1RKTA 5CVJA 3RKWA 4NHJA 5J8CA 2W4SA 3E1SA 1LEAA 5DUKA 1R5GA 1X58A 1A31A 1WI9A 2RN7A 5ICGA 2BVMA 1IN5A 4UUVA 2NVQJ 1YW9A 2NVYJ 6PAXA 1U8BA 2JWTA 4HG2A 3OSFA 3ZMTA 3OYLA 2DA3A 4E7KA 4HF1A 1S8NA 1ZGJA 2KHMA 1I3AA 1JT6A 1TWFJ 4S05A 3OS2A 3HOVJ 3KZZA 1YI2I 5K7FA 4Q5SF 4HX4A 2FEZA 1H88C 4FE7A 3IWFA 2W25A 2HOSA 5EGOB 3GZNB 2N8GA 2CQQA 2DPUA 2P7VB 3GLXA 1B1BA 1FEXA 4XIDA 1ON2A 3HSFA 3E5XA 2UZKA 5LHIA 1PUFB 2WA0A 2ZMEA 2WAFA 3H3ZA 2V7FA 3ZGKA 1X1AA 1ZREA 2BYVE 2KT0A 3E5QA 2CUJA 4A3FJ 3ZN0A 2V1NA 4E7LA 3WGIA 1LUJB 5BS6A 4KISA 2EQRA 4GRIA 4OWRB 1ZARA 2EV5A 2ZNZA 3E97A 2XKOA 3BR6A 2OQGA 3LOCA 3WE2A 2GXAA 3J81Z 3LSIA 4KIFA 4NUBA 2LK2A 3ZMZA 2Y30A 1JXSA 2H8WA 2KLOA 4JK1X 3D0SA 1N77A 2MABA 1VQMI 2NOGA 4JX4A 1D5VA 1VQ8I 5H2FC 5EDNA 2DA5A 1Z05A 1F36A 3I4MJ 3WTYC 1Z3YA 2XAUA 3S8PA 4OIPF 2BHZA 1S72I 1ULYA 4KYWA 2WV0A 2OZUA 3QAHA 3BT9A 1IN7A 2LD5A 1FTZA 1U9OA 2X4HA 5B5EC 1C0WA 2IBDA 1QHGA 2QVOA 3UKGA 4EQQA 4CCMA 3ZMDA 3JSOA 3H35A 1FX7A 5EEAA 1V4RA 5D6EA 3S2HJ 4BJ5C 3I9V2 3K4LA 2VE8A 2WTEA 2VPRA 3I71A 2DI3A 2ZKZA 2QLZA 5CVUA 1R22A 3DBHB 3HDDA 2R7FA 3CC2I 4A69C 5E8GA 2W84A 1OISA 1MBGA 3G2BA 4FTHA 2ICWG 3BY6A 5EJCA 3O8HA 3WTUC 4XLAA 4ZYEA 4IHXA 3HRUA 3A01B 2OCEA 4RAFA 2LG4A 1R36A 2ID3A 1GXPA 3Q5FA 2PMUA 4PGHA 4AVPA 2BY1A 1G59A 2CQKA 4EM0B 2W82A 2QSGX 2DMNA 4IPAA 3OSGA 2EFOA 2JK3A 2D2WA 1TNTA 1F9NA 4CGZA 2A3SA 4DYRA 1HC8A 5TJJA 4ESFA 1T0FC 3NARA 5J1RA 1FP2A 2MW8A 4R8HA 1VF9A 2PG4A 1TQPA 5ICEA 4UVBA 2IXSA 3T8RA 3U1KA 5HS7A 2PN6A 3H36A 1V5EA 3WTTC 3S3NA 1SFEA 4IQJA 2V1UA 3KEOA 5CPRB 3PUBA 3DQVC 4EGZA 5BPIA 1R49A 4DYQA 3WGHA 3KZIC 3GBGA 5GAEJ 4S0HB 5JFRA 2KIQA 3HIFA 3VDXA 4EVIA 2AHQA 3F8NA 1KYZA 3QODA 1I1SA 1UJ8A 1ZAOA 2E19A 3I59B 1XPXA 2VPLA 4C3IJ 4RGUA 4CYCB 3C3WA 4U88A 5FKNA 1QVTA 3GW2A 4D5CA 1IN6A 4BHCA 5IOZA 4DYCA 2F4IA 2JPCA 3DCFA 2W85A 2ESNA 1IW7F 2L9NA 5F08A 2PFBA 1HF0A 3CCLI 4FETA 1Y1WJ 2VJJA 3HHGA 4AUXA 4XLFA 1H8AC 4M72A 2CUFA 4EJWA 5TISC 1HDDC 1DPUA 4I01A 2ZJPF 1FOKA 3ESWB 5FFXA 1ZLJA 2JUGA 3SDGA 3O6BB 1BC7C 1Z6TA 3KIOA 1DU6A 4E7ZA 1OYIA 3H5RA 1OCTC 5CQEA 3E6CC 3H9JA 3LSRA 4BBSJ 4D9JA 4EMSA 4HW0A 1ODDA 3ML6A 2P6SA 2K7LA 1IC8A 4IO9F 1Y1VJ 1BN5A 3SDBA 4R1HA 1OQYA 1MBKA 5LGUA 4IOCF 3RYRA 2XGEA 2CW7A 1V55H 3DP7A 3W2VA 4G7OF 2XC7A 4ETSA 3IP4B 1VFCA 3HSRA 2A07F 3RPQA 3LA2A 2RGVA 2M87A 2L3DA 4XSXF 2XB0X 2R7OA 4UUSB 2R7TA 2G7UA 3TOBA 1DQUA 4P5OA 3COAC 2JTVA 4O5VA 3S3MA 1IRFA 5CJ9A 3MMYB 4IVNA 3IRRA 4KN7X 1IV8A 2L7KA 3K4MA 2KRHA 4YIIA 3FISA 2FBHA 2L7MP 2Z9OA 1W5CC 1MNMC 3HOZJ 2ID6A 2B9SA 3BR0A 3H0DA 2JUCA 2W7NA 3LA7A 4BXFA 2HDCA 3SEQA 4N4NB 4M9ZA 1SANA 2YX7A 2ZXJA 3T8TA 1J2XA 1SMYF 3K7AJ 2RAEA 3CC4I 1O3SA 5GP9A 2M2EA 1Y56A 2BXYA 1EJ9A 4I0AA 3BJOA 2O9LA 4JX6A 1B72B 2GXBA 4W1UA 1IRGA 2R7WA 1AA7A 2OV7A 5IYBJ 2K86A 1LPQA 3WTWC 5JHFA 2HNHA 4GFBA 1JTXA 4IRGA 1J5YA 2Y69H 2MG4A 3U1DA 4QWQA 4XICA 2L01A 2LREA 2MSYA 4A5NA 2UWMA 3LWFA 2H8RA 4IHVA 4XLHA 5IT3A 1G3YA 3OOPA 1DP3A 5GTHC 2VXZA 5L3EA 3HRMA 5DCMB 4YFKF 1TW3A 2X51A 4D5FA 1TP4A 4Y7NJ 3CCSI 3ZQIA 3M07A 4BQOA 4BACA 4HQMA 2EZHA 1VQNI 3CMAI 3ZQ7A 4P1WA 1D1BA 3MN2A 3ZN1A 2TCTA 1RZ4A 1F5TA 4UVCA 5HLIA 5IPAA 3IKVA 2DK5A 3A01A 2XF6A 2VBXA 1TZLA 1K79A 3R6SA 3H3UA 4WX9A 4I98B 3OYGA 2O8XA 2E60A 3BJAA 2VJIA 4OINF 2WV1A 1YLFA 3G1OA 4ANJA 2HFHA 2KIMA 2GIVA 2YUSA 1MDMA 1FYKA 1O3QA 2E7XA 2ZJ2A 5TGTA 4EATA 2LY2A 1P92A 2QKLB 1R4MB 3FXUA 3VEPA 1DDNA 3CMYA 1RUOA 2I5UA 2PLYA 3GYHX 1E3OC 3PFIA 4I7HA 4BY7J 3MKWB 3M4OJ 5EG0A 4RB2C 4UB6C 2X1DA 5D4SA 1GT0C 5K7ZA 1FWZA 3KYLA 1U5TB 1PP8F 3V7SA 3E5UA 2M34A 3RTRA 1IRZA 1U0JA 1MH4A 1UMQA 2LC2A 3N4MA 1B6AA 1XMAA 3HSEA 2CMPA 1R5ID 3MKYB 3DF8A 2O0YA 1ZRFA 3JAMK 2IA0A 1IV6A 4HOBA 4ENKA 2IW5A 3B73A 1X1DA 4XRMA 3G6EI 4HV6A 3M8FA 2HPMA 4J01A 2G7HA 4NQWB 4AC0A 2QQBA 3FXMA 1B9MA 1LDKB 3CJRB 3WHCA 4FX0A 2CW8A 5GADJ 5KAFC 2ZJQF 2NOJB 3RPUD 1KQ8A 1A6QA 5D5WB 4XLPF 1Z77A 3FF5A 2XRLA 3R61A 2A68F 2A69F 3I55I 3JRFA
chains in the Genus database with same CATH topology
1P2FA 3PQKA 3QOPA 1R58A 1JHHA 5LBQA 1MJ9A 1ZG3A 3CLOA 3WG9A 2BGCA 4MEYF 5TRDA 2L4MA 3I5UA 2KIFA 4HDUA 3M7GA 2YSRA 2DBBA 3TOAA 4GXOA 3EETA 1FY7A 4GCVA 5BQTA 3DPTA 3S2WA 4G94A 3HTUA 4ESJA 3RJPA 3VB2A 3V7RA 3HYIA 2IVMA 1EH8A 2IT0A 1FPQA 2HQNA 3E3VA 2DPDA 1USTA 3L09A 4N9IA 2RKHA 1HKQA 1U2WA 2W24A 1SAXA 1ZRCA 4QLCU 2O3FA 2M8EA 2OD5A 3JSPA 4HA8A 1BI2A 4A2UA 4KIGA 3FZVA 3RIRA 1XGNA 3LQRA 1R5HA 5DV5A 2MBFA 1K7AA 1S7AA 3RDIA 5D4RA 3TO6A 1REPC 1A04A 4UV8A 3TDZC 1QPMA 3CUQC 5KK1A 3KE2A 3MFKA 3J80K 3I59A 4E70A 2LF8A 1W4MA 3KFWX 2YR2A 1KU3A 4HX8A 1BI3A 2HYGD 1I6XA 1TLHB 1OMIA 3L00A 1T39A 5FB2A 4GYGA 3GWZA 4L9JA 1T0FA 1HKTA 1XMKA 5JR3A 2FQ3A 1BJAA 5LRRA 1YFHA 2HKOA 2PJPA 1STZA 3HUGA 3K1MA 2IPQX 4CICA 1FBSA 3MWMA 2K4BA 4LLLA 2P5LC 3P9KA 4F7ZA 3HTSB 4YG2F 3CUOA 2E1NA 2HS5A 4YFNF 5ERIA 2YPRA 3V8LA 1R1TA 5FFZA 4A0YA 4L9TA 5LRSA 1T6SA 5AONA 3GVAA 2STWA 1W5SA 1P4WA 5LHHA 2FRHA 5CYVA 1W7PB 2ISYA 3REOA 1QZZA 1BIAA 5LGTA 5D5VB 4WWCA 2V1XA 2H6CA 2QQ9A 3BWGA 1QQIA 3KCCA 2EV0A 1SD4A 3R60A 2A6EF 3I64A 4IXAA 3QU3A 4L0ZB 5L3DA 3RYPA 2F5CA 4BNCA 4UVAA 3K1PA 1O3RA 1BC8C 1FT9A 4U7BA 3LAJA 2BE5F 2H94A 2HEOA 5E17F 3BPXA 1J0RA 2P8TA 2RC4A 3JTGA 1Z1DA 2O61A 3ELKA 1W7PA 2FA5A 3MEXA 4LG0A 3P7NA 2RQPA 1MZBA 3U2RA 3O3KA 2FF4A 4M71A 1JHFA 1Z7UA 4L9VA 1H9TA 1FBUA 3K2ZA 2Q0OA 5ICFA 1YIOA 2VODA 1SD7A 3GUDA 4A12A 1P4AA 4YIFA 5IT9Z 4XRFA 2MH2A 1OKRA 2XAFA 2Y0MA 2A61A 3KLOA 3EUHA 2ZNYA 4ZYHA 1WQ2A 2COMA 4NB5A 1E17A 2GA2A 5LHGA 4LJZF 4LB5A 3N97A 1D3YA 1ZRDA 4GGGA 1MDMB 1BBYA 3GZ5A 4BQAA 1IUYA 2X0LA 4MNUA 2QENA 1FSEA 5F64A 1D8JA 3KP6A 5CVIA 1HBXG 3CO6C 5JVTA 2EJRA 3F72A 4P55A 3KEQA 4LLGF 3LSTA 5CVVA 1Z6RA 2FMLA 2ZFWA 2PI0A 3C7JA 4KIBA 4LFUA 5AIQA 1BI1A 3GFJA 2CFXA 4Q48A 5L3CA 1MGTA 3QP6A 4OOIA 4OMZA 2YU3A 1Z91A 2EFQA 4I2OA 2HWVA 5DEQA 3IWZA 2HTSA 2LSOA 2L4AA 2OU2A 2DLLA 5L3BA 1IZ1A 3E6BA 1G4DA 3OV8A 4KMFA 5BOXA 4BHBA 3U9GA 3L9FA 2P6TA 4XBFA 2VC1A 5HS8A 3BZ6A 3ECHA 5AIPA 1AWCA 4HZFA 2HQRA 4G7ZF 1ZGAA 4IRHA 4R79A 1EH6A 2VT3A 4IHTA 1J9IA 1SMTA 3T5XA 1YS6A 2F2EA 4RAYA 5CVRA 1XSXA 4MTEA 5L3FA 3F8FA 1ZG5A 1SD5A 2MLKA 2Z33A 4JQFA 4Q4ZF 2PQ8A 1EV7A 1XGOA 2FBIA 3LFKA 1SFXA 3ZMUA 3J81K 1HSJA 2VT2A 3F3XA 3FM3A 1K78A 5DD4A 2CSOA 1RNLA 1TQMA 5DCFA 1QZYA 4EJUA 1Y0UA 2XGXA 4XSZF 3E6MA 1F1ZA 4ENJA 4G8XA 3WTVC 2XASA 1V3FA 3VFZA 1Z9CA 4ON0A 2EFNA 1KQ0A 5D8LB 4M9XA 2OZ6A 1QNTA 2GWRA 1ZHFA 4KMUX 2CGPA 1FLIA 3WODF 5ICCA 4A6DA 2DW4A 1G3SA 4P96A 1I1GA 4IHSA 4NQWA 3KZYA 3FM5A 1E2XA 2HKXA 4Q47A 2QQAA 2JPBA 4AIHA 3AAFA 2DU9A 5D5UB 3L2CA 1BM9A 3CJNA 1XN7A 1RI7A 5HDGA 4HV5A 3W6KB 1YW7A 1BIBA 2NNYA 4I09A 2Y48A 1G3TA 2IA1A 4MEXF 2FOKA 2LKPA 1UFMA 2DTRA 4AWXB 3JTHA 1IXCA 5J8FA 2VE9A 4RB3C 1ZG1A 1KU7A 4PZJA 2QWWA 2Z5UA 2XKPA 1YW8A 4CZZA 1O7LA 2O6GE 1X3UA 3NRVA 1IAWA 4FX4A 5JI6A 1WKMA 2IP2A 1ZYRF 3GZ6A 4MTDA 1H9GA 5DCMA 1T98A 2L02A 2FBKA 1QBJA 3R4KA 4L0YB 1YYVA 1B9NA 1O7FA 3BDDA 4OU0A 2MH9A 2EV6A 4EM2A 2C6YA 4ENMA 2NNNA 3D5LA 1FP1D 3WU1B 1YG2A 2V1DA 5DDGA 4U0WA 3P9CA 1R1UA 4HAMA 3RPUA 1LVAA 5D6FA 2JRTA 1KQ9A 1YTYA 1U5TA 2ZO4A 3QP5A 2Q2EA 1HKSA 1L3LA 4IRIA 1VTNC 3DEUA 3Q9SA 4RAZA 5KVRA 5A2QZ 3E6DA 1OR7A 3J80Z 2KJBA 1WSUA 1PUEE 4UXNA 1P4XA 1J75A 2RVCA 2FXAA 1DPRA 2VN2A 4O3MA 1TBXA 4KT5C 2OQRA 3JAMZ 2ELHA 3HHHA 4OIQF 2KRFA 3EYIA 2H6BA 2FE3A 3BROA 1GXQA 2ISZA 2RV8A 4N9HA 1RIOH 5LEJA 2P5VA 2LF7A 1J7KA 2XVCA 2ZMEB 1TNSA 1LDJA 4KDPA 4DNCA 3GFLA 4KN4X 5K5QA 2XROA 4FT8A 1R23A 2E1CA 3KP4A 4GYIA 3K0LA 4AD9A 4WCGA 3M9AA 4LLNA 1KU2A 2VBYA 1D8KA 3I4PA 1L0OC 4WK8F 4M74A 1UHMA 3I58A 3DPLC 3F8MA 3I0TA 2TDXA 2M1BA 1FNNA 4ZH4F 3HRTA 3CO7C 3QU6A 2L54A 2KKOA 1LB2A 2FNPA 3GFIA 3K69A 1S3JA 5E1XA 5D8KB 5HDKA 2STTA 3RI4A 3JW4A 4M6YA 4HDVA 3IC7A 3EDPA 2AXLA 1YS7A 1JE8A 2NYXA 1TQIA 2XHKA 2DFIA 2IJLA 2VC0A 2DQRA 3LA3A 3DFGA 4PCQA 1HW2A 5FLXZ 3J7AO 2PMHA 5DD8A 4HLXA 4O6JA 3HOSA 1OYYA 1NHAA 4M6XA 3CTAA 4RB0A 1U78A 4BAYA 2BEOA 3MCZA 4MHGA 3GO5A 1GHCA 1U8RA 3ZMVA 3M1EA 2H09A 1T2KA 5FLXK 4LB6B 3EYYA 3TO9A 1J59A 3WU0A 1HQCA 3GFMA 1H0MA 3DV8A 3F8CA 3TO7A 1ON1A 3F23A 2G9WA 4G7HF 4BHPA 3DKWA 2CG4A 1FZPB 3K1NA 2Q8KA 5L3GA 1YQAA 4ZYDA 1S7OA 4IF4A 3IRQA 5H6RA 2MLGA 4G6DA 2ETHA 3TDUC 3B02A 1K6OA 4HYEA 2M30A 3T0YA 4PGGA 3SXYA 3G3ZA 2XIGA 5FD6A 1WRJA 3SZPA 4L18B 3WGGA 3VOEA 4CYDA 1FSHA 4MQVA 3QPHA 5K1YA 1XDUA 4I0BA 1R7JA 3C18A 2DAOA 4MQ9F 4ASNA 1XDSA 1FYLA 1JGSA 2CO5A 2J5PA 2F5FA 2D45A 3MQ0A 2AS5F 3KP7A 5HOOA 4N0BA 4ZZLA 2J5OA 5DYMA 1AOYA 3GXOA 1R00A 5E20A 2XUBA 1PP7U 2EK5A 5H6QA 5CLSA 1XSVA 2K27A 2OBPA 2LNBA 4WXCA 3KP3A 3RKXA 2EA4A 3ECOA 1KU9A 4EGYA 1ONVA 2RNJA 3K9TA 3C1DA 1UCRA 2ADUA 3CDHA 1GVJA 3L7WA 4HX7A 5LEKA 1MJAA 1SFUA 4UV9A 2HGCA 2FSWA 4FHTA 1KYWA 4KNYA 1U5TC 1G3WA 4Y13A 1KGSA 5LGNA 1SD6A 5BPDA 3MZYA 1K78B 4KFCA 3SHFA 3TKYA 2WC2A 5ILUA 4BYYA 2LDUA 2E7WA 3V4GA 4U0VA 5LLQA 4ESBA 4CHUA 3NQOA 2HR3A 3FX3A 1IXSB 4I02A 2XAQA 3CUQB 5FD5A 1QO0D 4UNOA 5D5XB 3T1BA 3RKYA 2GAUA 4JBAA 2GA1A 2DO7A 5HS9A 2XAJA 2GZWA 3G73A 4HF0A 1ZLKA 3FHZA 1S6LA 2MC3A 4G6QA 1LEBA 2ACJA 5ILSA 1XD7A 2ZBKA 2QUFA 3R0JA 1XB4A 2CYYA 2GXGA 5K5OA 1XSDA 4RGSA 3ROUA 5FGMA 2DK8A 1ZN2A 2R7DA 2JSCA 3FXQA 3I53A 3LAPA 3ISPA 4EV0A 3HOTA 1IN4A 3FMRA 4RGXA 2XAHA 3QRFF 1U6GA 2VONA 4CO8A 1IF1A 2OAZA 2OA4A 3P9IA 2EB7A 5K5RA 2QYOA 3EQLF 2FNAA 3FXRA 4HQEA 3SZTA 2M45A 2W57A 2EA2A 4KICA 2YX4A 5IT9K 3Q9VA 1XGMA 1TW2A 3ZP5A 3F8BA 5E1ZB 3BOQA 1LNWA 2V6CA 3HRSA 1XGSA 2Z99A 4L5JA 4U7DA 2FMYA 1OYWA 2HYFA 1T38A 4EJTA 2V79A 4DQ2A 4LGWA 4AIKA 1UHWA 1FYMA 1P6RA 3V8JA 2M5WA 2XAGA 2VBWA 3FMSA 2Y75A 1R1VA 3NEUA 3BP8A 1MD0A 5EEGA 3ABUA 4HLYA 4P9FA 4CXFA 4RB1A 1DP7P 2F5EA 1QGPA 2IA2A 1CGPA 3KLNA 4RGRA 1FC3A 1W7PD 3MZHA 4EJVA 1LDDA 4TV7A 3IHUA 5HDNA 3BJ6A 1MJBA 2CW0F 2WWYA 4Y17A 1S29A 2ESHA 1FBQA 2HZTA 3FMQA 4A0XA 2D1HA 4EM1A 2BV6A 4LK0F 5BMZA 2VBZA 4RS8A 2P5KA 1I5ZA 3TGNA 1EH7A 4K2EA 4LMYA 4OMYA 5E18F 2A5YB 2PEXA 4L9NA 3KETA 3BPVA 1HW5A 4WXDA 3WTZA 2MA3A 2CWEA 4CDGA 1F4KA 5A2QK 1TTYA 2KIUA 4OIRF 5J6XA 1BOAA 2H27A 3GEZA 5ILVA 3ERED 3V7CA 3H92A 3I54A 3TQNA 1U3EM 1Q1HA 2JZYA 3ZPLA 1UB9A 3LQQA 1HSTA 2EFWA 3IL2A 1O57A 4H0EA 4HF2A 2ZCWA 3GX4X 4LD5A 1LJ9A 3WE3A 4XLNF 3DXJF 5EEHA 3SFZA 1OPCA 4UHTA 1RUNA 2BBYA 1I27A 2NRAC 4L5IA 3GF2A 1W5TA 2QBYB 4U0YA 3ABTA 4D0PA 1BI0A 5H20A 2V9VA 1IXRC 1MKMA 3F6VA 2K4JA 4A6EA 5HLGA 3W6JB 2FU4A 1CF7A 2JT1A 1IN8A 3ULQB 4ZYGA 4Z2YA 1O3TA 2NAZA 2EFPA 2R3SA 2D1VA 1B59A 4AIJA 2KJCA 3KP5A 2XV4S 3R0AA 2HOEA 4P9UA 1PDNC 1XCVA 4IJAA 5F6FA 5JHUA 1HXDA 3F21A 4B09A 4WXHA 2RDPA 2QBYA 4EJOA 4A5MA 4LG0B 3O2PE 2XRNA 4KA4A 5E1WA 2P7CB 3F6OA 3PQJA 2Z3YA 5HVQC 5F1RA 4M9SA 1CF7B 5DUIA 3WTSC 3F22A 1B4AA 1LQ1A 2VOPA 3FWEA 3IKTA 2NS0A 4PDKA 4OIOF 2K02A 3KP2A 2P4WA 3MAJA 4M73A 4YFXF 5FO5A 3QPTA 2UXXA 4S04A 2GQQA 3V8KA 4BH9A 2MD5A 3VODA 2B0LA 1DUXC 4ZZDA 4A0ZA 2O03A 2QM3A 2UXNA 2A6HF 2DQLA 1WWXA 4G9YA 2DT5A 5E8IA 2EWNA 1HW1A 4HBLA 4BXUA 4LK1F 2PBIA 2VOOA 4KUMA 4Y15A 3SQNA 4ENNA 3ZMSA 1G6NA 1YO5C 4GO1A 3WTXC 2IRFG 4B8XA 1USSA 3M8EA 1XCBA 2QZ8A 2HTJA 4WF2A 4MGRA 3CUQA 2F5DA 5ED4A 1KA8A 1ZH5A 5HLHA 5CVJA 3RKWA 4NHJA 5J8CA 1LEAA 5DUKA 1R5GA 1WI9A 2RN7A 5ICGA 1IN5A 4UUVA 1YW9A 6PAXA 3ZMTA 4HF1A 1S8NA 1ZGJA 4S05A 3KZZA 4Q5SF 4HX4A 2FEZA 3IWFA 2W25A 2DPUA 2P7VB 3GLXA 1B1BA 1ON2A 3HSFA 3E5XA 2UZKA 5LHIA 2ZMEA 3H3ZA 1ZREA 2BYVE 3E5QA 3ZN0A 3WGIA 5BS6A 1ZARA 2EV5A 2ZNZA 3E97A 2XKOA 2OQGA 3WE2A 3J81Z 4KIFA 3ZMZA 1JXSA 4JK1X 3D0SA 1D5VA 1Z05A 3WTYC 4OIPF 1ULYA 4KYWA 2WV0A 2OZUA 3QAHA 1IN7A 2X4HA 1C0WA 2QVOA 4EQQA 3ZMDA 3JSOA 1FX7A 1V4RA 5D6EA 2VE8A 2WTEA 3I71A 2DI3A 2ZKZA 2QLZA 5CVUA 1R22A 2R7FA 5E8GA 2W84A 3BY6A 3WTUC 4ZYEA 3HRUA 1R36A 1GXPA 3Q5FA 2PMUA 4PGHA 4AVPA 2CQKA 4EM0B 4IPAA 2EFOA 2D2WA 1TNTA 1F9NA 4CGZA 2A3SA 5TJJA 4ESFA 1FP2A 4R8HA 2PG4A 1TQPA 5ICEA 4UVBA 3T8RA 5HS7A 2PN6A 3WTTC 1SFEA 2V1UA 3KEOA 3DQVC 4EGZA 5BPIA 3WGHA 5JFRA 3HIFA 4EVIA 3F8NA 1KYZA 1I1SA 1ZAOA 3I59B 4RGUA 3C3WA 4U88A 3GW2A 1IN6A 4BHCA 2JPCA 2W85A 2ESNA 1IW7F 2PFBA 3HHGA 4M72A 4EJWA 1DPUA 4I01A 1FOKA 5FFXA 1ZLJA 3O6BB 1BC7C 1Z6TA 1OYIA 3E6CC 4EMSA 4HW0A 1ODDA 3ML6A 2P6SA 2K7LA 1BN5A 4R1HA 5LGUA 3RYRA 3DP7A 4G7OF 4ETSA 3HSRA 2A07F 3RPQA 3LA2A 2RGVA 2M87A 2L3DA 4XSXF 2G7UA 3TOBA 4P5OA 3COAC 2JTVA 4O5VA 1IRFA 5CJ9A 4IVNA 3IRRA 4KN7X 4YIIA 2FBHA 2Z9OA 2HDCA 3LA7A 4M9ZA 2YX7A 2ZXJA 3T8TA 1J2XA 1SMYF 1O3SA 4I0AA 3BJOA 2GXBA 1IRGA 2K86A 3WTWC 4IRGA 1J5YA 3U1DA 4QWQA 2L01A 4A5NA 2UWMA 3LWFA 5IT3A 1G3YA 3OOPA 2VXZA 5L3EA 3HRMA 5DCMB 4YFKF 1TW3A 4HQMA 3ZQ7A 3ZN1A 1RZ4A 1F5TA 4UVCA 5HLIA 3IKVA 2DK5A 2VBXA 1K79A 3R6SA 3H3UA 4WX9A 4I98B 2O8XA 3BJAA 4OINF 1YLFA 2HFHA 2KIMA 2GIVA 1MDMA 1FYKA 1O3QA 2E7XA 2ZJ2A 1P92A 3FXUA 3VEPA 1DDNA 1RUOA 2PLYA 3GYHX 3PFIA 4I7HA 4RB2C 5D4SA 1FWZA 1U5TB 1PP8F 3V7SA 3E5UA 3RTRA 3N4MA 1B6AA 1XMAA 3HSEA 3DF8A 2O0YA 1ZRFA 3JAMK 2IA0A 4HOBA 4ENKA 2IW5A 3B73A 4HV6A 3M8FA 2G7HA 2QQBA 1B9MA 1LDKB 4FX0A 1KQ8A 5D5WB 4XLPF 3FF5A 3R61A 2A68F 2A69F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2F A;  3PQK A;  3QOP A;  1R58 A;  1JHH A;  5LBQ A;  1MJ9 A;  1ZG3 A;  3CLO A;  3WG9 A;  2BGC A;  4MEY F;  5TRD A;  2L4M A;  3I5U A;  2KIF A;  4HDU A;  3M7G A;  2YSR A;  2DBB A;  3TOA A;  4GXO A;  3EET A;  1FY7 A;  4GCV A;  5BQT A;  3DPT A;  3S2W A;  4G94 A;  3HTU A;  4ESJ A;  3RJP A;  3VB2 A;  3V7R A;  3HYI A;  2IVM A;  1EH8 A;  2IT0 A;  1FPQ A;  2HQN A;  3E3V A;  2DPD A;  1UST A;  3L09 A;  4N9I A;  2RKH A;  1HKQ A;  1U2W A;  2W24 A;  1SAX A;  1ZRC A;  4QLC U;  2O3F A;  2M8E A;  2OD5 A;  3JSP A;  4HA8 A;  1BI2 A;  4A2U A;  4KIG A;  3FZV A;  3RIR A;  1XGN A;  3LQR A;  1R5H A;  5DV5 A;  2MBF A;  1K7A A;  1S7A A;  3RDI A;  5D4R A;  3TO6 A;  1REP C;  1A04 A;  4UV8 A;  3TDZ C;  1QPM A;  3CUQ C;  5KK1 A;  3KE2 A;  3MFK A;  3J80 K;  3I59 A;  4E70 A;  2LF8 A;  1W4M A;  3KFW X;  2YR2 A;  1KU3 A;  4HX8 A;  1BI3 A;  2HYG D;  1I6X A;  1TLH B;  1OMI A;  3L00 A;  1T39 A;  5FB2 A;  4GYG A;  3GWZ A;  4L9J A;  1T0F A;  1HKT A;  1XMK A;  5JR3 A;  2FQ3 A;  1BJA A;  5LRR A;  1YFH A;  2HKO A;  2PJP A;  1STZ A;  3HUG A;  3K1M A;  2IPQ X;  4CIC A;  1FBS A;  3MWM A;  2K4B A;  4LLL A;  2P5L C;  3P9K A;  4F7Z A;  3HTS B;  4YG2 F;  3CUO A;  2E1N A;  2HS5 A;  4YFN F;  5ERI A;  2YPR A;  3V8L A;  1R1T A;  5FFZ A;  4A0Y A;  4L9T A;  5LRS A;  1T6S A;  5AON A;  3GVA A;  2STW A;  1W5S A;  1P4W A;  5LHH A;  2FRH A;  5CYV A;  1W7P B;  2ISY A;  3REO A;  1QZZ A;  1BIA A;  5LGT A;  5D5V B;  4WWC A;  2V1X A;  2H6C A;  2QQ9 A;  3BWG A;  1QQI A;  3KCC A;  2EV0 A;  1SD4 A;  3R60 A;  2A6E F;  3I64 A;  4IXA A;  3QU3 A;  4L0Z B;  5L3D A;  3RYP A;  2F5C A;  4BNC A;  4UVA A;  3K1P A;  1O3R A;  1BC8 C;  1FT9 A;  4U7B A;  3LAJ A;  2BE5 F;  2H94 A;  2HEO A;  5E17 F;  3BPX A;  1J0R A;  2P8T A;  2RC4 A;  3JTG A;  1Z1D A;  2O61 A;  3ELK A;  1W7P A;  2FA5 A;  3MEX A;  4LG0 A;  3P7N A;  2RQP A;  1MZB A;  3U2R A;  3O3K A;  2FF4 A;  4M71 A;  1JHF A;  1Z7U A;  4L9V A;  1H9T A;  1FBU A;  3K2Z A;  2Q0O A;  5ICF A;  1YIO A;  2VOD A;  1SD7 A;  3GUD A;  4A12 A;  1P4A A;  4YIF A;  5IT9 Z;  4XRF A;  2MH2 A;  1OKR A;  2XAF A;  2Y0M A;  2A61 A;  3KLO A;  3EUH A;  2ZNY A;  4ZYH A;  1WQ2 A;  2COM A;  4NB5 A;  1E17 A;  2GA2 A;  5LHG A;  4LJZ F;  4LB5 A;  3N97 A;  1D3Y A;  1ZRD A;  4GGG A;  1MDM B;  1BBY A;  3GZ5 A;  4BQA A;  1IUY A;  2X0L A;  4MNU A;  2QEN A;  1FSE A;  5F64 A;  1D8J A;  3KP6 A;  5CVI A;  1HBX G;  3CO6 C;  5JVT A;  2EJR A;  3F72 A;  4P55 A;  3KEQ A;  4LLG F;  3LST A;  5CVV A;  1Z6R A;  2FML A;  2ZFW A;  2PI0 A;  3C7J A;  4KIB A;  4LFU A;  5AIQ A;  1BI1 A;  3GFJ A;  2CFX A;  4Q48 A;  5L3C A;  1MGT A;  3QP6 A;  4OOI A;  4OMZ A;  2YU3 A;  1Z91 A;  2EFQ A;  4I2O A;  2HWV A;  5DEQ A;  3IWZ A;  2HTS A;  2LSO A;  2L4A A;  2OU2 A;  2DLL A;  5L3B A;  1IZ1 A;  3E6B A;  1G4D A;  3OV8 A;  4KMF A;  5BOX A;  4BHB A;  3U9G A;  3L9F A;  2P6T A;  4XBF A;  2VC1 A;  5HS8 A;  3BZ6 A;  3ECH A;  5AIP A;  1AWC A;  4HZF A;  2HQR A;  4G7Z F;  1ZGA A;  4IRH A;  4R79 A;  1EH6 A;  2VT3 A;  4IHT A;  1J9I A;  1SMT A;  3T5X A;  1YS6 A;  2F2E A;  4RAY A;  5CVR A;  1XSX A;  4MTE A;  5L3F A;  3F8F A;  1ZG5 A;  1SD5 A;  2MLK A;  2Z33 A;  4JQF A;  4Q4Z F;  2PQ8 A;  1EV7 A;  1XGO A;  2FBI A;  3LFK A;  1SFX A;  3ZMU A;  3J81 K;  1HSJ A;  2VT2 A;  3F3X A;  3FM3 A;  1K78 A;  5DD4 A;  2CSO A;  1RNL A;  1TQM A;  5DCF A;  1QZY A;  4EJU A;  1Y0U A;  2XGX A;  4XSZ F;  3E6M A;  1F1Z A;  4ENJ A;  4G8X A;  3WTV C;  2XAS A;  1V3F A;  3VFZ A;  1Z9C A;  4ON0 A;  2EFN A;  1KQ0 A;  5D8L B;  4M9X A;  2OZ6 A;  1QNT A;  2GWR A;  1ZHF A;  4KMU X;  2CGP A;  1FLI A;  3WOD F;  5ICC A;  4A6D A;  2DW4 A;  1G3S A;  4P96 A;  1I1G A;  4IHS A;  4NQW A;  3KZY A;  3FM5 A;  1E2X A;  2HKX A;  4Q47 A;  2QQA A;  2JPB A;  4AIH A;  3AAF A;  2DU9 A;  5D5U B;  3L2C A;  1BM9 A;  3CJN A;  1XN7 A;  1RI7 A;  5HDG A;  4HV5 A;  3W6K B;  1YW7 A;  1BIB A;  2NNY A;  4I09 A;  2Y48 A;  1G3T A;  2IA1 A;  4MEX F;  2FOK A;  2LKP A;  1UFM A;  2DTR A;  4AWX B;  3JTH A;  1IXC A;  5J8F A;  2VE9 A;  4RB3 C;  1ZG1 A;  1KU7 A;  4PZJ A;  2QWW A;  2Z5U A;  2XKP A;  1YW8 A;  4CZZ A;  1O7L A;  2O6G E;  1X3U A;  3NRV A;  1IAW A;  4FX4 A;  5JI6 A;  1WKM A;  2IP2 A;  1ZYR F;  3GZ6 A;  4MTD A;  1H9G A;  5DCM A;  1T98 A;  2L02 A;  2FBK A;  1QBJ A;  3R4K A;  4L0Y B;  1YYV A;  1B9N A;  1O7F A;  3BDD A;  4OU0 A;  2MH9 A;  2EV6 A;  4EM2 A;  2C6Y A;  4ENM A;  2NNN A;  3D5L A;  1FP1 D;  3WU1 B;  1YG2 A;  2V1D A;  5DDG A;  4U0W A;  3P9C A;  1R1U A;  4HAM A;  3RPU A;  1LVA A;  5D6F A;  2JRT A;  1KQ9 A;  1YTY A;  1U5T A;  2ZO4 A;  3QP5 A;  2Q2E A;  1HKS A;  1L3L A;  4IRI A;  1VTN C;  3DEU A;  3Q9S A;  4RAZ A;  5KVR A;  5A2Q Z;  3E6D A;  1OR7 A;  3J80 Z;  2KJB A;  1WSU A;  1PUE E;  4UXN A;  1P4X A;  1J75 A;  2RVC A;  2FXA A;  1DPR A;  2VN2 A;  4O3M A;  1TBX A;  4KT5 C;  2OQR A;  3JAM Z;  2ELH A;  3HHH A;  4OIQ F;  2KRF A;  3EYI A;  2H6B A;  2FE3 A;  3BRO A;  1GXQ A;  2ISZ A;  2RV8 A;  4N9H A;  1RIO H;  5LEJ A;  2P5V A;  2LF7 A;  1J7K A;  2XVC A;  2ZME B;  1TNS A;  1LDJ A;  4KDP A;  4DNC A;  3GFL A;  4KN4 X;  5K5Q A;  2XRO A;  4FT8 A;  1R23 A;  2E1C A;  3KP4 A;  4GYI A;  3K0L A;  4AD9 A;  4WCG A;  3M9A A;  4LLN A;  1KU2 A;  2VBY A;  1D8K A;  3I4P A;  1L0O C;  4WK8 F;  4M74 A;  1UHM A;  3I58 A;  3DPL C;  3F8M A;  3I0T A;  2TDX A;  2M1B A;  1FNN A;  4ZH4 F;  3HRT A;  3CO7 C;  3QU6 A;  2L54 A;  2KKO A;  1LB2 A;  2FNP A;  3GFI A;  3K69 A;  1S3J A;  5E1X A;  5D8K B;  5HDK A;  2STT A;  3RI4 A;  3JW4 A;  4M6Y A;  4HDV A;  3IC7 A;  3EDP A;  2AXL A;  1YS7 A;  1JE8 A;  2NYX A;  1TQI A;  2XHK A;  2DFI A;  2IJL A;  2VC0 A;  2DQR A;  3LA3 A;  3DFG A;  4PCQ A;  1HW2 A;  5FLX Z;  3J7A O;  2PMH A;  5DD8 A;  4HLX A;  4O6J A;  3HOS A;  1OYY A;  1NHA A;  4M6X A;  3CTA A;  4RB0 A;  1U78 A;  4BAY A;  2BEO A;  3MCZ A;  4MHG A;  3GO5 A;  1GHC A;  1U8R A;  3ZMV A;  3M1E A;  2H09 A;  1T2K A;  5FLX K;  4LB6 B;  3EYY A;  3TO9 A;  1J59 A;  3WU0 A;  1HQC A;  3GFM A;  1H0M A;  3DV8 A;  3F8C A;  3TO7 A;  1ON1 A;  3F23 A;  2G9W A;  4G7H F;  4BHP A;  3DKW A;  2CG4 A;  1FZP B;  3K1N A;  2Q8K A;  5L3G A;  1YQA A;  4ZYD A;  1S7O A;  4IF4 A;  3IRQ A;  5H6R A;  2MLG A;  4G6D A;  2ETH A;  3TDU C;  3B02 A;  1K6O A;  4HYE A;  2M30 A;  3T0Y A;  4PGG A;  3SXY A;  3G3Z A;  2XIG A;  5FD6 A;  1WRJ A;  3SZP A;  4L18 B;  3WGG A;  3VOE A;  4CYD A;  1FSH A;  4MQV A;  3QPH A;  5K1Y A;  1XDU A;  4I0B A;  1R7J A;  3C18 A;  2DAO A;  4MQ9 F;  4ASN A;  1XDS A;  1FYL A;  1JGS A;  2CO5 A;  2J5P A;  2F5F A;  2D45 A;  3MQ0 A;  2AS5 F;  3KP7 A;  5HOO A;  4N0B A;  4ZZL A;  2J5O A;  5DYM A;  1AOY A;  3GXO A;  1R00 A;  5E20 A;  2XUB A;  1PP7 U;  2EK5 A;  5H6Q A;  5CLS A;  1XSV A;  2K27 A;  2OBP A;  2LNB A;  4WXC A;  3KP3 A;  3RKX A;  2EA4 A;  3ECO A;  1KU9 A;  4EGY A;  1ONV A;  2RNJ A;  3K9T A;  3C1D A;  1UCR A;  2ADU A;  3CDH A;  1GVJ A;  3L7W A;  4HX7 A;  5LEK A;  1MJA A;  1SFU A;  4UV9 A;  2HGC A;  2FSW A;  4FHT A;  1KYW A;  4KNY A;  1U5T C;  1G3W A;  4Y13 A;  1KGS A;  5LGN A;  1SD6 A;  5BPD A;  3MZY A;  1K78 B;  4KFC A;  3SHF A;  3TKY A;  2WC2 A;  5ILU A;  4BYY A;  2LDU A;  2E7W A;  3V4G A;  4U0V A;  5LLQ A;  4ESB A;  4CHU A;  3NQO A;  2HR3 A;  3FX3 A;  1IXS B;  4I02 A;  2XAQ A;  3CUQ B;  5FD5 A;  1QO0 D;  4UNO A;  5D5X B;  3T1B A;  3RKY A;  2GAU A;  4JBA A;  2GA1 A;  2DO7 A;  5HS9 A;  2XAJ A;  2GZW A;  3G73 A;  4HF0 A;  1ZLK A;  3FHZ A;  1S6L A;  2MC3 A;  4G6Q A;  1LEB A;  2ACJ A;  5ILS A;  1XD7 A;  2ZBK A;  2QUF A;  3R0J A;  1XB4 A;  2CYY A;  2GXG A;  5K5O A;  1XSD A;  4RGS A;  3ROU A;  5FGM A;  2DK8 A;  1ZN2 A;  2R7D A;  2JSC A;  3FXQ A;  3I53 A;  3LAP A;  3ISP A;  4EV0 A;  3HOT A;  1IN4 A;  3FMR A;  4RGX A;  2XAH A;  3QRF F;  1U6G A;  2VON A;  4CO8 A;  1IF1 A;  2OAZ A;  2OA4 A;  3P9I A;  2EB7 A;  5K5R A;  2QYO A;  3EQL F;  2FNA A;  3FXR A;  4HQE A;  3SZT A;  2M45 A;  2W57 A;  2EA2 A;  4KIC A;  2YX4 A;  5IT9 K;  3Q9V A;  1XGM A;  1TW2 A;  3ZP5 A;  3F8B A;  5E1Z B;  3BOQ A;  1LNW A;  2V6C A;  3HRS A;  1XGS A;  2Z99 A;  4L5J A;  4U7D A;  2FMY A;  1OYW A;  2HYF A;  1T38 A;  4EJT A;  2V79 A;  4DQ2 A;  4LGW A;  4AIK A;  1UHW A;  1FYM A;  1P6R A;  3V8J A;  2M5W A;  2XAG A;  2VBW A;  3FMS A;  2Y75 A;  1R1V A;  3NEU A;  3BP8 A;  1MD0 A;  5EEG A;  3ABU A;  4HLY A;  4P9F A;  4CXF A;  4RB1 A;  1DP7 P;  2F5E A;  1QGP A;  2IA2 A;  1CGP A;  3KLN A;  4RGR A;  1FC3 A;  1W7P D;  3MZH A;  4EJV A;  1LDD A;  4TV7 A;  3IHU A;  5HDN A;  3BJ6 A;  1MJB A;  2CW0 F;  2WWY A;  4Y17 A;  1S29 A;  2ESH A;  1FBQ A;  2HZT A;  3FMQ A;  4A0X A;  2D1H A;  4EM1 A;  2BV6 A;  4LK0 F;  5BMZ A;  2VBZ A;  4RS8 A;  2P5K A;  1I5Z A;  3TGN A;  1EH7 A;  4K2E A;  4LMY A;  4OMY A;  5E18 F;  2A5Y B;  2PEX A;  4L9N A;  3KET A;  3BPV A;  1HW5 A;  4WXD A;  3WTZ A;  2MA3 A;  2CWE A;  4CDG A;  1F4K A;  5A2Q K;  1TTY A;  2KIU A;  4OIR F;  5J6X A;  1BOA A;  2H27 A;  3GEZ A;  5ILV A;  3ERE D;  3V7C A;  3H92 A;  3I54 A;  3TQN A;  1U3E M;  1Q1H A;  2JZY A;  3ZPL A;  1UB9 A;  3LQQ A;  1HST A;  2EFW A;  3IL2 A;  1O57 A;  4H0E A;  4HF2 A;  2ZCW A;  3GX4 X;  4LD5 A;  1LJ9 A;  3WE3 A;  4XLN F;  3DXJ F;  5EEH A;  3SFZ A;  1OPC A;  4UHT A;  1RUN A;  2BBY A;  1I27 A;  2NRA C;  4L5I A;  3GF2 A;  1W5T A;  2QBY B;  4U0Y A;  3ABT A;  4D0P A;  1BI0 A;  5H20 A;  2V9V A;  1IXR C;  1MKM A;  3F6V A;  2K4J A;  4A6E A;  5HLG A;  3W6J B;  2FU4 A;  1CF7 A;  2JT1 A;  1IN8 A;  3ULQ B;  4ZYG A;  4Z2Y A;  1O3T A;  2NAZ A;  2EFP A;  2R3S A;  2D1V A;  1B59 A;  4AIJ A;  2KJC A;  3KP5 A;  2XV4 S;  3R0A A;  2HOE A;  4P9U A;  1PDN C;  1XCV A;  4IJA A;  5F6F A;  5JHU A;  1HXD A;  3F21 A;  4B09 A;  4WXH A;  2RDP A;  2QBY A;  4EJO A;  4A5M A;  4LG0 B;  3O2P E;  2XRN A;  4KA4 A;  5E1W A;  2P7C B;  3F6O A;  3PQJ A;  2Z3Y A;  5HVQ C;  5F1R A;  4M9S A;  1CF7 B;  5DUI A;  3WTS C;  3F22 A;  1B4A A;  1LQ1 A;  2VOP A;  3FWE A;  3IKT A;  2NS0 A;  4PDK A;  4OIO F;  2K02 A;  3KP2 A;  2P4W A;  3MAJ A;  4M73 A;  4YFX F;  5FO5 A;  3QPT A;  2UXX A;  4S04 A;  2GQQ A;  3V8K A;  4BH9 A;  2MD5 A;  3VOD A;  2B0L A;  1DUX C;  4ZZD A;  4A0Z A;  2O03 A;  2QM3 A;  2UXN A;  2A6H F;  2DQL A;  1WWX A;  4G9Y A;  2DT5 A;  5E8I A;  2EWN A;  1HW1 A;  4HBL A;  4BXU A;  4LK1 F;  2PBI A;  2VOO A;  4KUM A;  4Y15 A;  3SQN A;  4ENN A;  3ZMS A;  1G6N A;  1YO5 C;  4GO1 A;  3WTX C;  2IRF G;  4B8X A;  1USS A;  3M8E A;  1XCB A;  2QZ8 A;  2HTJ A;  4WF2 A;  4MGR A;  3CUQ A;  2F5D A;  5ED4 A;  1KA8 A;  1ZH5 A;  5HLH A;  5CVJ A;  3RKW A;  4NHJ A;  5J8C A;  1LEA A;  5DUK A;  1R5G A;  1WI9 A;  2RN7 A;  5ICG A;  1IN5 A;  4UUV A;  1YW9 A;  6PAX A;  3ZMT A;  4HF1 A;  1S8N A;  1ZGJ A;  4S05 A;  3KZZ A;  4Q5S F;  4HX4 A;  2FEZ A;  3IWF A;  2W25 A;  2DPU A;  2P7V B;  3GLX A;  1B1B A;  1ON2 A;  3HSF A;  3E5X A;  2UZK A;  5LHI A;  2ZME A;  3H3Z A;  1ZRE A;  2BYV E;  3E5Q A;  3ZN0 A;  3WGI A;  5BS6 A;  1ZAR A;  2EV5 A;  2ZNZ A;  3E97 A;  2XKO A;  2OQG A;  3WE2 A;  3J81 Z;  4KIF A;  3ZMZ A;  1JXS A;  4JK1 X;  3D0S A;  1D5V A;  1Z05 A;  3WTY C;  4OIP F;  1ULY A;  4KYW A;  2WV0 A;  2OZU A;  3QAH A;  1IN7 A;  2X4H A;  1C0W A;  2QVO A;  4EQQ A;  3ZMD A;  3JSO A;  1FX7 A;  1V4R A;  5D6E A;  2VE8 A;  2WTE A;  3I71 A;  2DI3 A;  2ZKZ A;  2QLZ A;  5CVU A;  1R22 A;  2R7F A;  5E8G A;  2W84 A;  3BY6 A;  3WTU C;  4ZYE A;  3HRU A;  1R36 A;  1GXP A;  3Q5F A;  2PMU A;  4PGH A;  4AVP A;  2CQK A;  4EM0 B;  4IPA A;  2EFO A;  2D2W A;  1TNT A;  1F9N A;  4CGZ A;  2A3S A;  5TJJ A;  4ESF A;  1FP2 A;  4R8H A;  2PG4 A;  1TQP A;  5ICE A;  4UVB A;  3T8R A;  5HS7 A;  2PN6 A;  3WTT C;  1SFE A;  2V1U A;  3KEO A;  3DQV C;  4EGZ A;  5BPI A;  3WGH A;  5JFR A;  3HIF A;  4EVI A;  3F8N A;  1KYZ A;  1I1S A;  1ZAO A;  3I59 B;  4RGU A;  3C3W A;  4U88 A;  3GW2 A;  1IN6 A;  4BHC A;  2JPC A;  2W85 A;  2ESN A;  1IW7 F;  2PFB A;  3HHG A;  4M72 A;  4EJW A;  1DPU A;  4I01 A;  1FOK A;  5FFX A;  1ZLJ A;  3O6B B;  1BC7 C;  1Z6T A;  1OYI A;  3E6C C;  4EMS A;  4HW0 A;  1ODD A;  3ML6 A;  2P6S A;  2K7L A;  1BN5 A;  4R1H A;  5LGU A;  3RYR A;  3DP7 A;  4G7O F;  4ETS A;  3HSR A;  2A07 F;  3RPQ A;  3LA2 A;  2RGV A;  2M87 A;  2L3D A;  4XSX F;  2G7U A;  3TOB A;  4P5O A;  3COA C;  2JTV A;  4O5V A;  1IRF A;  5CJ9 A;  4IVN A;  3IRR A;  4KN7 X;  4YII A;  2FBH A;  2Z9O A;  2HDC A;  3LA7 A;  4M9Z A;  2YX7 A;  2ZXJ A;  3T8T A;  1J2X A;  1SMY F;  1O3S A;  4I0A A;  3BJO A;  2GXB A;  1IRG A;  2K86 A;  3WTW C;  4IRG A;  1J5Y A;  3U1D A;  4QWQ A;  2L01 A;  4A5N A;  2UWM A;  3LWF A;  5IT3 A;  1G3Y A;  3OOP A;  2VXZ A;  5L3E A;  3HRM A;  5DCM B;  4YFK F;  1TW3 A;  4HQM A;  3ZQ7 A;  3ZN1 A;  1RZ4 A;  1F5T A;  4UVC A;  5HLI A;  3IKV A;  2DK5 A;  2VBX A;  1K79 A;  3R6S A;  3H3U A;  4WX9 A;  4I98 B;  2O8X A;  3BJA A;  4OIN F;  1YLF A;  2HFH A;  2KIM A;  2GIV A;  1MDM A;  1FYK A;  1O3Q A;  2E7X A;  2ZJ2 A;  1P92 A;  3FXU A;  3VEP A;  1DDN A;  1RUO A;  2PLY A;  3GYH X;  3PFI A;  4I7H A;  4RB2 C;  5D4S A;  1FWZ A;  1U5T B;  1PP8 F;  3V7S A;  3E5U A;  3RTR A;  3N4M A;  1B6A A;  1XMA A;  3HSE A;  3DF8 A;  2O0Y A;  1ZRF A;  3JAM K;  2IA0 A;  4HOB A;  4ENK A;  2IW5 A;  3B73 A;  4HV6 A;  3M8F A;  2G7H A;  2QQB A;  1B9M A;  1LDK B;  4FX0 A;  1KQ8 A;  5D5W B;  4XLP F;  3FF5 A;  3R61 A;  2A68 F;  2A69 F; 
#chains in the Genus database with same CATH topology
 2HQA A;  1P2F A;  3ZQG A;  2ZJR F;  3PQK A;  3DU6 A;  3QOP A;  4BDY A;  3CC7 I;  1R58 A;  5F27 A;  1JHH A;  5LBQ A;  1VQO I;  1MJ9 A;  1ZG3 A;  3CLO A;  3WG9 A;  3HM5 A;  3OL3 A;  4UUT A;  2BGC A;  4MEY F;  2JJ7 A;  3TMO A;  5TRD A;  4PK4 A;  3BQY A;  3CCE I;  2L4M A;  3QPL A;  3I5U A;  2KIF A;  4HDU A;  3M7G A;  2YU9 J;  4PJM A;  2YSR A;  2DBB A;  3TOA A;  2F6C A;  4PSX A;  4GXO A;  2R7X A;  2IEK A;  3EET A;  2JA5 J;  1FY7 A;  4GCV A;  2EZK A;  2E5N A;  5BQT A;  5DM7 F;  2W00 A;  4XRS A;  1Y6I A;  3OIQ A;  3DPT A;  3S2W A;  4G94 A;  3HTU A;  4CCO A;  4ESJ A;  2L0K A;  5F1J A;  3RJP A;  2VI6 A;  3VB2 A;  3V7R A;  2DN0 A;  3S93 A;  5J40 A;  5FKK A;  1HCR A;  3HYI A;  4M6V A;  3F9K A;  2H1L A;  2IVM A;  4BJT A;  1EH8 A;  2IT0 A;  1FPQ A;  2DMQ A;  2EIN H;  4XN0 A;  4JOM A;  4ZYA A;  4IZZ A;  4A3D J;  2HQN A;  3IAS 2;  3E3V A;  4C30 A;  2DPD A;  1UST A;  2DOF A;  3L09 A;  4N9I A;  3NWS A;  2M8G X;  2RKH A;  3JCU C;  3EUK L;  3LNQ A;  1HKQ A;  4CCK A;  1YRN A;  1VND A;  2DDA A;  5KCM A;  1U2W A;  5C4J J;  4BJ6 C;  2W24 A;  2JVH A;  1SAX A;  1ZRC A;  4QLC U;  4HNV A;  2O3F A;  2M8E A;  3L2V A;  2W1O A;  2OD5 A;  1T8I A;  3JSP A;  4HA8 A;  1BI2 A;  1UG2 A;  4A2U A;  4KIG A;  4XQF A;  3FZV A;  4MO7 A;  3RIR A;  1XGN A;  3LQR A;  3JRG A;  1R5H A;  2DOE A;  2HI3 A;  5IOY A;  5DV5 A;  3BZK A;  1JJ6 C;  2MBF A;  2UV1 A;  1K7A A;  1S7A A;  4MFD A;  3RDI A;  3AL0 C;  5D4R A;  1LE8 B;  3TO6 A;  1REP C;  2X6X A;  4LIT A;  1A04 A;  4UV8 A;  3TDZ C;  3J7A Y;  1QPM A;  3CUQ C;  5KK1 A;  3MVP A;  3KE2 A;  3MFK A;  3J80 K;  2QGU A;  3I59 A;  4E70 A;  5B66 C;  4E7H A;  1B8I A;  2LF8 A;  2GLO A;  2R7V A;  2O8K A;  4M3B A;  1W4M A;  2E1O A;  3KFW X;  4ZDP A;  2YR2 A;  3ZRG A;  2X1E A;  2XDV A;  1KU3 A;  4HX8 A;  1BI3 A;  1NG6 A;  2HYG D;  2LBF A;  1I6X A;  1BOB A;  1TLH B;  4G12 A;  1YRN B;  1OMI A;  3L00 A;  3ZQF A;  1T39 A;  3CJQ B;  5F0H A;  5FB2 A;  4GYG A;  3GWZ A;  4L9J A;  1T0F A;  1F43 A;  1HKT A;  2VUM J;  1LKX A;  1XMK A;  5JR3 A;  2FQ3 A;  2DA6 A;  3DLA A;  1BJA A;  2DA7 A;  5LRR A;  1YFH A;  2HKO A;  2PJP A;  1V5G A;  1STZ A;  3HUG A;  3K1M A;  3TL4 X;  3MKL A;  1ACI A;  2DA1 A;  2XPW A;  2IPQ X;  4CIC A;  4XM3 A;  1FBS A;  3MWM A;  3PM1 A;  2K4B A;  4LLL A;  4A3J J;  1PUF A;  3S3O A;  4BUP A;  2P5L C;  4KT6 A;  3BR3 A;  4AVZ A;  3BCA A;  3P9K A;  3VYR B;  4F7Z A;  4A3I J;  3HTS B;  2XGC A;  3I56 I;  1XX5 A;  3OIP A;  2K3F A;  2FD5 A;  4YG2 F;  3G4S I;  4DZP A;  3CUO A;  1RET A;  2E1N A;  3EUA A;  2HS5 A;  4YFN F;  3K70 C;  5ERI A;  2YPR A;  2IAI A;  4MLO A;  1Y8Q B;  1R1T A;  3V8L A;  4C3H J;  5FFZ A;  4A0Y A;  4L9T A;  1MBH A;  5LRS A;  3RZD J;  1T6S A;  1FJL A;  3FBI B;  2ELJ A;  5AON A;  3CDI A;  3GVA A;  2STW A;  1W5S A;  5GTI C;  1P4W A;  3S1N J;  4XOP A;  5LHH A;  2KP6 A;  2FRH A;  5KHD A;  5E3O A;  2K5C A;  1W7P B;  2ISY A;  5CYV A;  3REO A;  1AHD P;  1QPI A;  1QZZ A;  2ZSI B;  2HU9 A;  1BIA A;  2OPT A;  1AKH B;  5LGT A;  1IG7 A;  4ZDL A;  5D5V B;  4WWC A;  5BNG A;  4B43 A;  2V1X A;  4FQG A;  2H6C A;  2QQ9 A;  4Y4R A;  3SEZ A;  5EGO A;  2WY8 Q;  1Y8R B;  3BWG A;  3OYA A;  1QQI A;  2XPV A;  1TC3 C;  3CMM A;  5HNF A;  3KCC A;  4BE2 A;  1D0Y A;  4DJA A;  2EV0 A;  1SD4 A;  2QKM B;  3R60 A;  4MIM A;  4FCY A;  3ABM H;  3VYU B;  1WJE A;  2A6E F;  3I64 A;  4BBR J;  4IXA A;  3QU3 A;  4L0Z B;  4CH7 A;  1NTC A;  2LVS A;  5L3D A;  3RYP A;  4IX7 A;  2F5C A;  3HKZ N;  2VJ4 A;  4E7I A;  4BNC A;  4UVA A;  3K1P A;  1VQK I;  5M5W J;  5DS9 A;  1O3R A;  1BC8 C;  1FT9 A;  4U7B A;  3LAJ A;  5FLV A;  3HJE A;  3D1N I;  3RZO J;  1OCZ H;  2JQ7 A;  2BE5 F;  2H94 A;  3M8J A;  2HEO A;  5E17 F;  2DMU A;  2XF5 A;  3BPX A;  1J0R A;  3HXL A;  3QYF A;  2P8T A;  3KYD B;  1OCO H;  3JRE A;  1O4X A;  2RC4 A;  3OYN A;  3JTG A;  4RM3 A;  3DKY A;  1Z1D A;  2O61 A;  3ELK A;  3VSK A;  4X0G A;  1W7P A;  2HXO A;  2FA5 A;  3MEX A;  4LG0 A;  3P7N A;  2RQP A;  1MZB A;  3BTJ A;  3U2R A;  3BR1 A;  3O3K A;  2FF4 A;  4M71 A;  1JHF A;  1Z7U A;  2Z16 A;  1MBE A;  1D1C A;  5C3E J;  2FJ1 A;  4L9V A;  5FKM A;  1H9T A;  3W6V A;  3E0J B;  3P5J A;  1FBU A;  3K2Z A;  1IGN A;  2Q0O A;  5ICF A;  1TWG J;  1P7I A;  1YIO A;  2E71 A;  2VOD A;  5B1A H;  1SD7 A;  3GUD A;  4A12 A;  1S7E A;  2B63 J;  1P4A A;  3D5S C;  1SVL A;  4YIF A;  5IT9 Z;  4XRF A;  2MH2 A;  1Q1V A;  3BLY A;  5DTD A;  1RPW A;  1OKR A;  2XAF A;  2Y0M A;  2OTJ I;  3OWT A;  3HKZ A;  2A61 A;  1BL0 A;  3KLO A;  3EUH A;  2P0W A;  2ZNY A;  4ZYH A;  4Y33 A;  1WQ2 A;  2COM A;  1T33 A;  3Q0U A;  4DOZ A;  4NB5 A;  3L2Q A;  1E17 A;  2GA2 A;  5LHG A;  2EIM H;  4LJZ F;  1ZGW A;  4LB5 A;  3N97 A;  2JSP A;  1D3Y A;  1ZRD A;  4BGD A;  4GGG A;  4CYC A;  1MDM B;  4C2T A;  1BBY A;  3GZ5 A;  1JTY A;  2V9K A;  3LMM A;  3RQ4 A;  4BQA A;  2LR8 A;  1IUY A;  4YEJ A;  2MGQ A;  2QSF X;  2HOT A;  2X0L A;  4MNU A;  2QEN A;  1D0Z A;  1FSE A;  2OF7 A;  5F64 A;  1A5J A;  1D8J A;  3KP6 A;  2AQF A;  4CCN A;  2TRT A;  5CVI A;  1HBX G;  2NVU B;  1MMD A;  3CO6 C;  3PIO F;  5JVT A;  2EJR A;  3F72 A;  4P55 A;  1N78 A;  3AG4 H;  3KEQ A;  4AID A;  1Z21 A;  4LLG F;  4YEL A;  2Y2Z A;  3LST A;  5CVV A;  1OR7 C;  3S1M J;  1Z6R A;  2R92 J;  2FML A;  3G71 I;  2ZFW A;  2GOX B;  4FE4 A;  3C7J A;  2PI0 A;  1JI8 A;  4KIB A;  4LFU A;  5AIQ A;  2GBY A;  2LP0 A;  2R5Z B;  3H9G A;  2R7Q A;  2X1C A;  1BI1 A;  3GFJ A;  3KPH A;  2X6W A;  2CFX A;  5IYD J;  3HGG A;  4Q48 A;  5L3C A;  1MGT A;  3QP6 A;  4OOI A;  4OMZ A;  2YU3 A;  1Z91 A;  4B4C A;  2EFQ A;  4I2O A;  2ME0 A;  3GTO J;  5LD2 C;  2VQL A;  2HWV A;  1HA8 A;  1K83 J;  5F04 A;  2L9R A;  3IWZ A;  5DEQ A;  2HTS A;  2LSO A;  2L4A A;  2OU2 A;  2KDZ A;  4DBR A;  2DLL A;  5L3B A;  1IZ1 A;  1WJC A;  5J1U A;  3TW6 A;  2XB5 A;  4A3E J;  3E6B A;  1G4D A;  4M3E A;  3OV8 A;  2FQ4 A;  4KMF A;  5BOX A;  1B8I B;  4Z6Y A;  1SAU A;  1YHQ I;  4BHB A;  2KIS A;  3U9G A;  3CF2 A;  3K4C A;  3L9F A;  1K6Y A;  1ZQ3 P;  1VZ0 A;  1FIP A;  2P6T A;  3PNT A;  4XBF A;  2VC1 A;  5C44 J;  5HS8 A;  3BZ6 A;  4DZJ A;  3ECH A;  5AIP A;  2HDD A;  1AWC A;  3OYE A;  4XN3 A;  4HZF A;  2HQR A;  2M0C A;  2ZXI A;  4G7Z F;  1ZGA A;  1X2N A;  2W48 A;  2Y0S N;  4A3L J;  2DOA A;  4IRH A;  2Q2E B;  4R79 A;  4NC7 A;  1EH6 A;  1WI3 A;  2VT3 A;  4IHT A;  2VL8 A;  1SMT A;  1X1C A;  4EEF G;  1J9I A;  1Y0N A;  2DCE A;  3DEW A;  3T5X A;  1YS6 A;  1WH5 A;  2F2E A;  4RAY A;  1AKH A;  4C2U A;  2CQ7 A;  5CVR A;  2P81 A;  3GTQ J;  2FX0 A;  1XSX A;  4MTE A;  5L3F A;  3F8F A;  2KZV A;  3OR1 C;  1WHU A;  5FLM J;  1D0X A;  3J7Y J;  3FXJ A;  1ZG5 A;  1SD5 A;  1UEL B;  2MLK A;  3N05 A;  1GUU A;  2WY7 Q;  3DTI A;  4JQF A;  4Q4Z F;  2Z33 A;  1E3H A;  1MND A;  2HVQ A;  2PQ8 A;  4II2 A;  4DGW B;  1EV7 A;  3H0G J;  1XGO A;  1BR1 A;  1QVU A;  3HZJ A;  4ZTF A;  3JRB A;  2NXN B;  2BY0 A;  2KRC A;  2EPF A;  4D7M A;  2FBI A;  3B6C A;  1OLT A;  3LFK A;  4ZDO A;  1SFX A;  3ZMU A;  4IKF A;  4E7S A;  3J81 K;  1HSJ A;  2VT2 A;  3F3X A;  1T08 B;  3FM3 A;  1K78 A;  2LKS A;  5DD4 A;  2CSO A;  1RNL A;  1TQM A;  5DCF A;  1QZY A;  4XKC A;  3VYS B;  4E7J A;  4EJU A;  5GAG J;  4RMN A;  1Y0U A;  2XGX A;  1S5L C;  4XSZ F;  4B44 A;  3E6M A;  1F1Z A;  4ENJ A;  1RRJ A;  4JP0 A;  4G8X A;  3WTV C;  2XAS A;  1V3F A;  2MD0 A;  3VFZ A;  1Z9C A;  2JA6 J;  1J09 A;  3LSH A;  4ON0 A;  2EFN A;  1KQ0 A;  5D8L B;  4M9X A;  2OZ6 A;  1RR8 C;  1QNT A;  3CCJ I;  2GWR A;  1ZHF A;  1IRX A;  4KMU X;  2HQ5 A;  3BCB A;  2CGP A;  1FLI A;  3WOD F;  1FTT A;  5ICC A;  4A6D A;  2F4M B;  2DW4 A;  4A3B J;  1G3S A;  2HDW A;  4P96 A;  1I1G A;  4IHS A;  3KZY A;  4NQW A;  4KJZ A;  3FM5 A;  1N75 A;  3TP0 A;  1E2X A;  2HKX A;  2DJI A;  4Q47 A;  2QQA A;  4W97 A;  2JPB A;  1K4T A;  3E7L A;  3EPZ A;  1RKW A;  3VWB A;  4AIH A;  2ZXW H;  3FKI J;  5EZG A;  3FK7 A;  3AAF A;  2DU9 A;  5D5U B;  3L2C A;  3GTM J;  1BM9 A;  3D5R C;  3M3Y J;  3CJN A;  2HPI A;  1XN7 A;  4NC8 A;  1RI7 A;  5M3M J;  2KZG A;  3K2A A;  5HDG A;  3AG1 H;  3HPH A;  4HV5 A;  3W6K B;  2HZD A;  1YW7 A;  2WAD A;  2LH9 A;  1BIB A;  2IGM A;  2NNY A;  1V54 H;  1FOY A;  2EIK H;  4I09 A;  2RQQ A;  4DW6 A;  2X6O A;  2Y48 A;  1G3T A;  2IA1 A;  4ZJZ A;  4MEX F;  2XGD A;  5HLT A;  2FOK A;  2M7A A;  1JUS A;  2LKP A;  1BJZ A;  2VQC A;  1ITY A;  2CU7 A;  3JRH A;  2Q1Z B;  1KON A;  1UFM A;  2DTR A;  3BQZ A;  4AWX B;  3JTH A;  1IXC A;  4BS9 A;  4HEA 2;  5J8F A;  4I99 C;  2FUG 2;  3VYT B;  2VE9 A;  4RB3 C;  4UUS A;  4F55 A;  1K61 A;  5KNL A;  1D1A A;  1ZG1 A;  2ZC2 A;  1KU7 A;  1VI0 A;  1NK3 P;  4PZJ A;  1XS9 A;  5J47 A;  2QWW A;  2X85 A;  2Z5U A;  4V2F A;  3S32 A;  2XKP A;  2Z2S B;  1YW8 A;  4CZZ A;  1O7L A;  2LY1 A;  4B1R A;  1DGW Y;  2R5Y B;  2O6G E;  1X3U A;  1HOM A;  3NRV A;  1IAW A;  3ZOB A;  4FX4 A;  3SJM A;  5JI6 A;  4BQQ A;  2L9S A;  1JKP C;  1WKM A;  2IP2 A;  2RNG A;  2CUE A;  3C2G A;  4YRV A;  1ZYR F;  1R6R A;  3GZ6 A;  4MTD A;  1H9G A;  5DCM A;  1NG7 A;  3GTJ J;  2X9D A;  1T98 A;  2L02 A;  2FBK A;  1QBJ A;  2MC4 A;  3R4K A;  3VSL A;  4L0Y B;  1YYV A;  5J4V A;  1B9N A;  1O7F A;  3BDD A;  1JKR C;  4OU0 A;  2VJ5 A;  2MH9 A;  4CCJ A;  1YE9 A;  2EV6 A;  4EM2 A;  2C6Y A;  2VIX A;  3AG3 H;  4ENM A;  1ETW A;  2NNN A;  3D5L A;  3LSM A;  2CQX A;  2F5V A;  1FP1 D;  3WU1 B;  1YG2 A;  4PJJ A;  2V1D A;  2IS1 A;  5DDG A;  1OCR H;  1MMN A;  2M4K A;  4U0W A;  1M1E B;  3BG6 A;  3P9C A;  2QCO A;  2D5V A;  3OS1 A;  3S1R J;  1XC5 A;  3QOE A;  1R1U A;  4HAM A;  3RPU A;  1LVA A;  2KL4 A;  5D6F A;  4RBO A;  2JRT A;  3CCM I;  4BY1 J;  2GIZ A;  1GV2 A;  1KQ9 A;  1PYV A;  5GPA A;  3DTK A;  1YTY A;  2E2H J;  2EBI A;  2JVG A;  2XSD C;  1U5T A;  2ZO4 A;  3QP5 A;  2Q2E A;  1HKS A;  3IAM 2;  3CCY A;  3X2Q H;  1L3L A;  3RKQ A;  1YIT I;  4IOA F;  4BEH A;  4IRI A;  4NC6 A;  1VTN C;  4Y3O A;  3DEU A;  3Q9S A;  4PUS A;  1GDT A;  3BZC A;  2OJE D;  4J00 A;  4RAZ A;  5KVR A;  5A2Q Z;  3E6D A;  1OR7 A;  3CP2 A;  3J80 Z;  1WFX A;  2X6Y A;  1N25 A;  2KJB A;  4NDL A;  1WSU A;  2L9V A;  2K85 A;  4NBQ A;  4XKB A;  4MFE A;  1PUE E;  4UXN A;  1BR4 A;  1P4X A;  3QPS A;  4RM2 A;  1G2H A;  1J75 A;  2RVC A;  2FXA A;  1DPR A;  2VN2 A;  4O3M A;  1TBX A;  4KT5 C;  2OQR A;  1X19 A;  3JAM Z;  2VKH A;  3RSN A;  2ELH A;  3HHH A;  4A93 J;  4RDU A;  4OIQ F;  2KRF A;  2WAE A;  3Q0W A;  3EYI A;  2H6B A;  2FE3 A;  3BRO A;  1GXQ A;  2JRM A;  2RV8 A;  4N9H A;  2ISZ A;  1RIO H;  5IP9 J;  2DYS H;  3OIO A;  1I50 J;  4XOT A;  1X1P A;  1KZH A;  5LEJ A;  4B3X A;  2P5V A;  2LF7 A;  1J7K A;  2XVC A;  3O8G A;  1ETY A;  2CV2 A;  4HSR A;  3CLQ A;  2I8D A;  2VKV A;  5C4X J;  3ZQC A;  1X4O A;  2CRG A;  1MSE C;  2ZME B;  4C9Y A;  2K40 A;  1TNS A;  3OYB A;  1LDJ A;  4KDP A;  1GLN A;  4DNC A;  1MW7 A;  4BEH B;  5LFA A;  1E0E A;  3GFL A;  4KN4 X;  5K5Q A;  4E4H A;  1SEU A;  2A6T A;  2XRO A;  4GDF A;  4FT8 A;  1R23 A;  4IHW A;  1XTA A;  2E1C A;  3KP4 A;  4GYI A;  3BTC A;  3K0L A;  4AD9 A;  4WCG A;  3M9A A;  4LLN A;  1KU2 A;  3FXK A;  2DA4 A;  3ZCO A;  1SFO J;  5M5Y J;  3S16 J;  2VBY A;  4CZC A;  5EG0 B;  1D8K A;  2BZT A;  2LTP A;  3DEE A;  3I4P A;  1L0O C;  4J19 A;  1VQ4 I;  3V42 A;  4WK8 F;  4M74 A;  3OYM A;  1UHM A;  3I58 A;  3DPL C;  3F8M A;  3BR5 A;  3OR2 C;  3ERM A;  3QQA A;  3I0T A;  4AU7 A;  1IDY A;  1UZC A;  2TDX A;  2M1B A;  1JUM A;  1FNN A;  4ZH4 F;  3HRT A;  3CO7 C;  4DIQ A;  3QU6 A;  2L54 A;  2KKO A;  1LB2 A;  4ITV A;  2FNP A;  3GFI A;  3K69 A;  4HNT A;  4BU2 A;  3JRI A;  1S3J A;  3HOX J;  1FIA A;  5E1X A;  5D8K B;  5HDK A;  2DXI A;  2STT A;  3WU2 C;  3RI4 A;  3JW4 A;  3H3V K;  5KAI C;  5JVG F;  4M6Y A;  3C2B A;  4KIT B;  3NAU A;  4HDV A;  3LSK A;  4IEJ A;  1K4S A;  3IC7 A;  5JLX A;  1W36 D;  2IS4 A;  3EDP A;  3CD6 I;  2AXL A;  1YS7 A;  1A35 A;  1JE8 A;  3FHN A;  2NYX A;  1TQI A;  5IP7 J;  3DPU A;  4IQ4 A;  5B3S H;  3PFY A;  1LE8 A;  4LG3 A;  2XHK A;  4PFP A;  2DFI A;  2IJL A;  1MSF C;  2VC0 A;  2DQR A;  1ETX A;  3LA3 A;  4HRI A;  3DFG A;  4PCQ A;  1HW2 A;  2KPM A;  5FLX Z;  3OYD A;  2ME6 A;  3BG3 A;  5HNH A;  4XKW A;  3J7A O;  2PMH A;  1UAA A;  3PO2 J;  5DD8 A;  4HLX A;  4O6J A;  3HOS A;  2LLK A;  1OYY A;  1NHA A;  4A3M J;  3FKJ A;  4M6X A;  3CTA A;  4RB0 A;  3CCU I;  1U78 A;  2UUZ A;  4BAY A;  3S17 J;  4QPO A;  3DLL F;  2BEO A;  3DKX A;  2DDB A;  3BTI A;  5IYC J;  3MCZ A;  1YOV B;  3ABK H;  4MHG A;  3GO5 A;  1GHC A;  3W2A A;  2KMU A;  2Y31 A;  1DGR M;  2AO9 A;  1U8R A;  3ZMV A;  3M1E A;  2H09 A;  1T2K A;  5FLX K;  4BL0 B;  4JYK A;  4LB6 B;  3EYY A;  3TO9 A;  2LBF B;  4YIR X;  4LIV A;  5GAH J;  1J59 A;  3UNG C;  3L1P A;  3WU0 A;  1X1B A;  1HQC A;  2LY9 A;  3GFM A;  1ORK A;  1OCC H;  1H0M A;  2COB A;  2MFZ A;  4XLC A;  4DBQ A;  1WGX A;  3DV8 A;  5M3F J;  3PJR A;  3F8C A;  3TO7 A;  2BXZ A;  3FXL A;  1ON1 A;  3F23 A;  2G9W A;  4G7H F;  3ZXS A;  4BHP A;  3DKW A;  2CG4 A;  3MD2 A;  1FZP B;  2R93 J;  3K1N A;  4OAY A;  2Q8K A;  2JA7 J;  5L3G A;  1YQA A;  2E34 A;  2QF7 A;  4ZYD A;  1SFK A;  4HST A;  3B6A A;  2JA2 A;  4PSW A;  2O5R A;  4F92 B;  1S7O A;  1WJB A;  3H9Q A;  4NNJ A;  3FXO A;  4IF4 A;  2IGK A;  3A0B C;  4F3Q A;  2R5Z A;  3IRQ A;  5H6R A;  2MLG A;  2XF7 A;  1X4P A;  2IS2 A;  4G6D A;  2ETH A;  3TDU C;  2G0E A;  2CH0 A;  5E79 C;  1ZEL A;  1UG0 A;  3B02 A;  1K6O A;  3IH2 A;  3L2U A;  3LSG A;  4HYE A;  1ETO A;  3KYC B;  2DFF A;  1FMW A;  1RR7 A;  2M30 A;  3T0Y A;  3WHB A;  1G8X A;  4PGG A;  3SXY A;  1WZ2 A;  2L7Z A;  3G3Z A;  1IDZ A;  2Y9Y A;  4XOR A;  3L2W A;  1EKE A;  1R71 A;  2XIG A;  5FD6 A;  1WRJ A;  3SZP A;  3OYI A;  4L18 B;  3WGG A;  2WAQ N;  3HOY J;  3VOE A;  4CYD A;  3ABL H;  1MMS A;  1FSH A;  4QSH A;  4MQV A;  3W2W A;  2IGN A;  4HNU A;  3QPH A;  2Y9Z A;  5K1Y A;  2QA4 I;  3S15 J;  1XDU A;  2XPU A;  4I0B A;  1R9T J;  1ETV A;  1OCP A;  1R7J A;  5IP6 A;  3C18 A;  2DAO A;  4MQ9 F;  4ASN A;  1XDS A;  1FYL A;  3H1C A;  1JGS A;  1VQ7 I;  2CO5 A;  1H89 C;  2M0M A;  3K10 A;  1YJ9 I;  4F91 B;  2J5P A;  3AL0 B;  3HBL A;  2F5F A;  2D45 A;  3MQ0 A;  2OTL I;  2AS5 F;  3KP7 A;  4E6K G;  3C2H A;  5HOO A;  3J7Z I;  2F4O B;  1Z7L A;  4N0B A;  2EZL A;  4ZZL A;  1IJW C;  2J5O A;  2V4J C;  2CV0 A;  5DYM A;  1AOY A;  1MNE A;  3GXO A;  1E3P A;  2EIJ H;  2X48 A;  3OYC A;  1R00 A;  3OYJ A;  1WVR A;  5E20 A;  2XUB A;  1V5F A;  1PP7 U;  2MYS A;  2EK5 A;  5H6Q A;  1BR2 A;  5CLS A;  1TWC J;  1XSV A;  1S9H A;  2K27 A;  4IL6 C;  2OBP A;  4I76 A;  1R4N B;  2OC6 A;  1YIJ I;  2LNB A;  4WXC A;  4M3F A;  1RC9 A;  3KP3 A;  1TWA J;  3RKX A;  1SVM A;  4OAZ A;  2EA4 A;  3ECO A;  2LRD A;  2QQ8 A;  2HOA A;  4ZC3 A;  1KU9 A;  1MBJ A;  4XR6 A;  3GME A;  4EGY A;  1ONV A;  2RNJ A;  3K9T A;  3C1D A;  2DOD A;  1UCR A;  2ADU A;  1XG1 A;  3CDH A;  1GVJ A;  3L7W A;  1X3Z B;  2DTZ A;  3PNY A;  4HX7 A;  4X6A J;  1YX3 A;  5LEK A;  1MJA A;  1RES A;  1SFU A;  3JRA A;  1FMV A;  3M1C A;  4UV9 A;  3K4N A;  2HGC A;  2K9L A;  2E35 A;  2FSW A;  4FHT A;  1KYW A;  4KNY A;  1U5T C;  1G3W A;  4Y13 A;  2R7R A;  1KGS A;  4CSW A;  5LGN A;  1SD6 A;  4UY8 I;  5BPD A;  3MZY A;  1K78 B;  4KFC A;  2QEX I;  3SHF A;  3TKY A;  2HYJ A;  2EIL H;  2WC2 A;  5ILU A;  4BYY A;  3LSP A;  2M4G A;  1POG A;  2LDU A;  2E7W A;  4A3C J;  3MZ8 A;  3DTE A;  3V4G A;  4U0V A;  2NS7 A;  5LLQ A;  3GTK J;  2IGO A;  2Z1D A;  4ESB A;  3K70 D;  4CHU A;  3NQO A;  2HR3 A;  3FX3 A;  3DBL B;  1IXS B;  4I02 A;  2OCC H;  1HDP A;  2XAQ A;  3CUQ B;  2R7S A;  5FD5 A;  1QO0 D;  4UNO A;  5D5X B;  5M5X J;  3JR9 A;  3K4J A;  3T1B A;  3RKY A;  5F0F A;  2GAU A;  4JBA A;  2GA1 A;  2DO7 A;  3CJT B;  2ECB A;  5HS9 A;  5HOD A;  4QTR A;  4BDZ A;  2XAJ A;  2PJR B;  1TWH J;  2GZW A;  2PX9 A;  2DMP A;  3G73 A;  4HF0 A;  2JA8 J;  2E5Z A;  1ZLK A;  1WPK A;  3ASN H;  3FHZ A;  1S6L A;  2AXT C;  2EH3 A;  2MC3 A;  4G6Q A;  3FBN B;  1LEB A;  2ACJ A;  5ILS A;  2A05 A;  4B48 A;  3MKZ A;  3TP3 A;  1XD7 A;  2ZBK A;  2QUF A;  3R0J A;  1XB4 A;  2CYY A;  4HPQ A;  1SC7 A;  3S1Q J;  2GOM A;  2GXG A;  1GVD A;  5K5O A;  1XSD A;  2R4G A;  4RGS A;  3HUG B;  4XNF A;  3ROU A;  2DT6 A;  5FGM A;  2DK8 A;  1ZN2 A;  2PMZ A;  2R7D A;  3IH4 A;  2JSC A;  3FXQ A;  3I53 A;  4LOC A;  3ISP A;  3LAP A;  4EV0 A;  3HOT A;  3SYT A;  3PSI A;  1IN4 A;  3FMR A;  5IY5 H;  4XRS G;  3OL4 A;  4RGX A;  2XAH A;  3RQI A;  3QRF F;  1U6G A;  2VON A;  4IHY A;  4CO8 A;  3SZG A;  1IF1 A;  1LFP A;  3HC7 A;  2OAZ A;  2OA4 A;  3GTL J;  3P9I A;  2EB7 A;  5K5R A;  1MH3 A;  3A4C A;  5JLW A;  2HVR A;  2QYO A;  2DYR H;  4BXX J;  1QHH D;  2FNA A;  3EQL F;  4LIU A;  2HXI A;  4N4O B;  2R7Z J;  1BW5 A;  3G1L A;  3FXR A;  4AYB N;  4HQE A;  3SZT A;  3AKZ A;  3HG9 A;  2M45 A;  2W57 A;  5F0C A;  2EA2 A;  4KIC A;  2YX4 A;  5IT9 K;  2CQN A;  1ZTR A;  5E3M A;  3Q9V A;  1XGM A;  1TW2 A;  1YJW I;  4C2M J;  3ZP5 A;  4FAS D;  3F8B A;  5E1Z B;  3BOQ A;  4ZTJ A;  1LNW A;  5FRO A;  2CJJ A;  4FIS A;  1NK2 P;  2V6C A;  3GCM A;  3HRS A;  1XGS A;  3W3C A;  2KFD A;  2Z99 A;  4B47 A;  1SVO A;  3DBR B;  2XSJ C;  4L5J A;  4U7D A;  2E36 A;  2FMY A;  2CV1 A;  3CCV I;  1OYW A;  1VQP I;  2HYF A;  1A6I A;  1GV5 A;  1T38 A;  4EJT A;  2BVL A;  2V79 A;  4DQ2 A;  1VQ9 I;  4M3D A;  4LGW A;  5J4Y A;  4AIK A;  1PVE A;  1UHW A;  2M3A A;  1FYM A;  1EA3 A;  2L7F P;  1P6R A;  4I6Z A;  3PNV A;  2VQH A;  3A03 A;  1TT0 A;  3S14 J;  3V8J A;  3LL7 A;  2VQG A;  2M5W A;  2I10 A;  3BR2 A;  2XAG A;  2VBW A;  3FMS A;  2Y75 A;  1R1V A;  3NEU A;  1ENH A;  3BP8 A;  1MD0 A;  5EEG A;  3BG9 A;  3LSJ A;  3ABU A;  3HPG A;  4HLY A;  1ZR2 A;  5CKT A;  4P9F A;  3PUF A;  4CXF A;  4RB1 A;  1DP7 P;  2F5E A;  1WH7 A;  4XL9 A;  1D5Y A;  2PMZ N;  4QIW N;  1QGP A;  2IA2 A;  1CGP A;  9ANT A;  3KLN A;  4RGR A;  3CCR I;  1FC3 A;  4G6T B;  1ERD A;  2HVS A;  3HOU J;  1A36 A;  2LFB A;  1W7P D;  3MZH A;  4D1Q A;  3IV5 A;  2VKE A;  3FDY A;  4EJV A;  1LDD A;  4TV7 A;  3I4N J;  3IHU A;  5HDN A;  3ASO H;  3BJ6 A;  2L5Q A;  1MJB A;  2CW0 F;  3LFU A;  2WWY A;  4BE1 A;  4Y17 A;  3BC8 A;  1S29 A;  3HL2 A;  2ESH A;  5B1B H;  5DM6 F;  2Y0S A;  5E3N A;  1VQ6 I;  1FOW A;  3AFH A;  1FBQ A;  2HZT A;  2LMD A;  5FJ8 J;  3FMQ A;  4A0X A;  2D1H A;  4EM1 A;  3CES A;  2BV6 A;  1MIJ A;  2LOO A;  4LK0 F;  5BMZ A;  3IH3 A;  2VBZ A;  5GPC A;  1I39 A;  5E3L A;  3CCQ I;  2NVT J;  4RS8 A;  3TED A;  2P5K A;  4BE0 A;  3CF5 F;  1I5Z A;  3OMY A;  3TGN A;  2CFO A;  5FKO A;  1EH7 A;  1YJN I;  1AU7 A;  4K2E A;  2WB1 A;  1WCM J;  4LMY A;  3PIP F;  1LVK A;  4OMY A;  5E18 F;  2BHY A;  1UHS A;  3GLL A;  2E1M B;  2A5Y B;  2PEX A;  2DT7 B;  3G1M A;  5EF6 A;  2R5Y A;  4L9N A;  3KET A;  3BPV A;  2BW3 A;  3CP8 A;  3BG5 A;  3H5A A;  2O7O A;  3F0C A;  1HW5 A;  2ZSH B;  4WXD A;  3WTZ A;  4PJN A;  2MA3 A;  2CWE A;  4RAG A;  4CDG A;  1F4K A;  3A02 A;  4A3G J;  5A2Q K;  4M3G A;  2IS6 A;  1TTY A;  1MMG A;  5J3L A;  2KIU A;  1X3W B;  2OUM A;  4OIR F;  1MBF A;  1I3Q J;  2K9S A;  5J6X A;  1W0U A;  1BOA A;  4V2G A;  2VAS A;  2H27 A;  3JRD A;  2BOL A;  3GEZ A;  5ILV A;  3ERE D;  3V7C A;  3RCO A;  3H92 A;  3I54 A;  4BQN A;  3Q0V A;  1Y39 A;  5FRN A;  3OOU A;  2PJR A;  1B72 A;  4D7N A;  3TQN A;  2K3P A;  2RRE A;  1X2M A;  1ETQ A;  1Q1H A;  2BW3 B;  2BY3 A;  2JZY A;  3CQZ J;  1U3E M;  2WB1 N;  2E2I J;  1UB9 A;  3FIW A;  3ZPL A;  4Y52 J;  2DMT A;  3LQQ A;  1HST A;  3TBI A;  1OFC X;  2R0Q C;  4A3K J;  2V26 A;  2EFW A;  2JMW A;  2LYC A;  1P7J A;  3IL2 A;  1JGG A;  2VB6 A;  1O57 A;  3ZQH A;  4H0E A;  3A1Y A;  4HF2 A;  1BW6 A;  2ZCW A;  3UR3 C;  3WG7 H;  3CME I;  3GX4 X;  1QA6 A;  1JUP A;  4LD5 A;  1LJ9 A;  3WE3 A;  3PSF A;  4XLN F;  3DXJ F;  1NH3 A;  5EEH A;  3SFZ A;  2VXD A;  1OPC A;  2KQR A;  4UHT A;  1RUN A;  1P9Q C;  4CCL A;  1BA5 A;  1JJ8 C;  3QWL A;  2BBY A;  1I27 A;  2NRA C;  1IO2 A;  4L5I A;  3GF2 A;  1W5T A;  3KEY A;  2QBY B;  3AG2 H;  3OY9 A;  4U0Y A;  3ABT A;  3DWL E;  1MMA A;  4QPQ A;  1QRY A;  1ZKG A;  4D0P A;  3VPR A;  3U21 A;  1BI0 A;  3FK6 A;  5H20 A;  2V9V A;  3EUH C;  1APL C;  1IXR C;  1MKM A;  3F6V A;  3ONQ A;  2K4J A;  4A6E A;  3NWT A;  4RA2 A;  1T56 A;  5HLG A;  1LFB A;  2CS3 A;  3W6J B;  2ZME C;  1CQT A;  2K9N A;  1DU0 A;  1XMX A;  1Z3X A;  1WJF A;  3ZQQ A;  2FU4 A;  1CF7 A;  2JT1 A;  1IN8 A;  3ULQ B;  4ABZ A;  4ZYG A;  4Z2Y A;  3JRC A;  4RLQ A;  1O3T A;  3GTP J;  2M7B A;  2M9H A;  2NAZ A;  3IUO A;  2CUZ A;  4JX5 A;  4XON A;  3HB9 A;  5FRM A;  2EFP A;  4F93 B;  1FOX A;  2R3S A;  2D1V A;  1B59 A;  2AQE A;  4AM3 A;  1WJ5 A;  3HGY A;  1ZR4 A;  3CDL A;  4AIJ A;  2GM4 A;  2KJC A;  2K9M A;  3KP5 A;  4U87 A;  2XV4 S;  3R0A A;  2HOE A;  2YS9 A;  4B3A A;  1JKO C;  4P9U A;  3TW7 A;  3CZ6 A;  1PDN C;  2ECC A;  1XCV A;  4IJA A;  4PJL A;  2V9P A;  4UB8 C;  4XKV A;  3SFI A;  1JT0 A;  5F6F A;  1PJR A;  3HOW J;  5JHU A;  1HXD A;  3F21 A;  1YX5 A;  2ZB9 A;  4B09 A;  4WXH A;  2RDP A;  2QBY A;  2EZI A;  2L2O A;  4EJO A;  4A5M A;  1I6H J;  3ZQL A;  4LG0 B;  3O2P E;  1HLV A;  2XRN A;  4XLE A;  4KA4 A;  5E1W A;  3K4K A;  4V19 K;  2P7C B;  5J1Y A;  3F6O A;  4C3J J;  3PQJ A;  2K9Q A;  2Z3Y A;  5HVQ C;  3BTL A;  5CQG A;  1W1W E;  1QU3 A;  5F1R A;  4M9S A;  1CF7 B;  5DUI A;  3WTS C;  3F22 A;  2DJN A;  1B4A A;  3OYF A;  1LQ1 A;  3PL8 A;  2VOP A;  3FWE A;  3BG7 A;  3IKT A;  2NS0 A;  4XMY A;  2R7U A;  2F48 A;  4PDK A;  4OIO F;  2LKX A;  5EYR A;  3S2D J;  4CA0 A;  1U9N A;  2K02 A;  2WAQ A;  4CUG A;  2ZXH A;  3KP2 A;  3A2K A;  2P4W A;  3MAJ A;  3Q3S A;  3GTG J;  4M73 A;  4F52 A;  4YFX F;  4XK4 A;  5FO5 A;  1JKQ C;  3H5N A;  3QPT A;  1TL8 A;  1W0T A;  1QZE A;  2UXX A;  1EF4 A;  4L5E A;  4S04 A;  1T95 A;  4PJ0 C;  2GQQ A;  2NS8 A;  4AYB A;  3OYH A;  3L2R A;  2BY2 A;  3V8K A;  4BH9 A;  1W36 C;  2MD5 A;  2ELK A;  3VOD A;  2B0L A;  1DUX C;  4RLF A;  4ZZD A;  5K7H A;  1TT5 B;  1ETK A;  4A0Z A;  2QSH X;  2O03 A;  2QM3 A;  2UXN A;  2A6H F;  3K4B A;  1LFU P;  2DQL A;  1WWX A;  4G9Y A;  2DT5 A;  2B7E A;  2E1M C;  5E8I A;  1Z0X A;  3QYB A;  2EWN A;  1HW1 A;  4X1E A;  4HBL A;  4BXU A;  3ZR8 X;  4LK1 F;  2PBI A;  2VOO A;  2WBM A;  1VQ5 I;  2DFE A;  3OYK A;  2KDO A;  2H1K A;  2DA2 A;  2JN6 A;  3OS0 A;  4KUM A;  5FKL A;  1VQL I;  5EZH A;  1IUF A;  4Y15 A;  3PO3 J;  2E2J J;  3SQN A;  4ENN A;  3ZMS A;  4BKX A;  1G6N A;  2NVX J;  2VLA A;  1YO5 C;  2ZFU A;  1ZK8 A;  4GO1 A;  3WTX C;  3DU5 A;  2IRF G;  4B8X A;  1USS A;  3A0H C;  3M8E A;  1XCB A;  1Z67 A;  4PFO A;  3K6G A;  3KX2 A;  2A5W A;  4H4K C;  2QZ8 A;  4II3 A;  1WJD A;  2FOW A;  2HTJ A;  2VKD A;  3I3L A;  4WF2 A;  4MGR A;  3HEF A;  3CUQ A;  2F5D A;  2DFH A;  5ED4 A;  1KA8 A;  3QYE A;  1ZH5 A;  1OJL A;  2V6E A;  1WJA A;  5HLH A;  1RKT A;  5CVJ A;  3RKW A;  4NHJ A;  5J8C A;  2W4S A;  3E1S A;  1LEA A;  5DUK A;  1R5G A;  1X58 A;  1A31 A;  1WI9 A;  2RN7 A;  5ICG A;  2BVM A;  1IN5 A;  4UUV A;  2NVQ J;  1YW9 A;  2NVY J;  6PAX A;  1U8B A;  2JWT A;  4HG2 A;  3OSF A;  3ZMT A;  3OYL A;  2DA3 A;  4E7K A;  4HF1 A;  1S8N A;  1ZGJ A;  2KHM A;  1I3A A;  1JT6 A;  1TWF J;  4S05 A;  3OS2 A;  3HOV J;  3KZZ A;  1YI2 I;  5K7F A;  4Q5S F;  4HX4 A;  2FEZ A;  1H88 C;  4FE7 A;  3IWF A;  2W25 A;  2HOS A;  5EGO B;  3GZN B;  2N8G A;  2CQQ A;  2DPU A;  2P7V B;  3GLX A;  1B1B A;  1FEX A;  4XID A;  1ON2 A;  3HSF A;  3E5X A;  2UZK A;  5LHI A;  1PUF B;  2WA0 A;  2ZME A;  2WAF A;  3H3Z A;  2V7F A;  3ZGK A;  1X1A A;  1ZRE A;  2BYV E;  2KT0 A;  3E5Q A;  2CUJ A;  4A3F J;  3ZN0 A;  2V1N A;  4E7L A;  3WGI A;  1LUJ B;  5BS6 A;  4KIS A;  2EQR A;  4GRI A;  4OWR B;  1ZAR A;  2EV5 A;  2ZNZ A;  3E97 A;  2XKO A;  3BR6 A;  2OQG A;  3LOC A;  3WE2 A;  2GXA A;  3J81 Z;  3LSI A;  4KIF A;  4NUB A;  2LK2 A;  3ZMZ A;  2Y30 A;  1JXS A;  2H8W A;  2KLO A;  4JK1 X;  3D0S A;  1N77 A;  2MAB A;  1VQM I;  2NOG A;  4JX4 A;  1D5V A;  1VQ8 I;  5H2F C;  5EDN A;  2DA5 A;  1Z05 A;  1F36 A;  3I4M J;  3WTY C;  1Z3Y A;  2XAU A;  3S8P A;  4OIP F;  2BHZ A;  1S72 I;  1ULY A;  4KYW A;  2WV0 A;  2OZU A;  3QAH A;  3BT9 A;  1IN7 A;  2LD5 A;  1FTZ A;  1U9O A;  2X4H A;  5B5E C;  1C0W A;  2IBD A;  1QHG A;  2QVO A;  3UKG A;  4EQQ A;  4CCM A;  3ZMD A;  3JSO A;  3H35 A;  1FX7 A;  5EEA A;  1V4R A;  5D6E A;  3S2H J;  4BJ5 C;  3I9V 2;  3K4L A;  2VE8 A;  2WTE A;  2VPR A;  3I71 A;  2DI3 A;  2ZKZ A;  2QLZ A;  5CVU A;  1R22 A;  3DBH B;  3HDD A;  2R7F A;  3CC2 I;  4A69 C;  5E8G A;  2W84 A;  1OIS A;  1MBG A;  3G2B A;  4FTH A;  2ICW G;  3BY6 A;  5EJC A;  3O8H A;  3WTU C;  4XLA A;  4ZYE A;  4IHX A;  3HRU A;  3A01 B;  2OCE A;  4RAF A;  2LG4 A;  1R36 A;  2ID3 A;  1GXP A;  3Q5F A;  2PMU A;  4PGH A;  4AVP A;  2BY1 A;  1G59 A;  2CQK A;  4EM0 B;  2W82 A;  2QSG X;  2DMN A;  4IPA A;  3OSG A;  2EFO A;  2JK3 A;  2D2W A;  1TNT A;  1F9N A;  4CGZ A;  2A3S A;  4DYR A;  1HC8 A;  5TJJ A;  4ESF A;  1T0F C;  3NAR A;  5J1R A;  1FP2 A;  2MW8 A;  4R8H A;  1VF9 A;  2PG4 A;  1TQP A;  5ICE A;  4UVB A;  2IXS A;  3T8R A;  3U1K A;  5HS7 A;  2PN6 A;  3H36 A;  1V5E A;  3WTT C;  3S3N A;  1SFE A;  4IQJ A;  2V1U A;  3KEO A;  5CPR B;  3PUB A;  3DQV C;  4EGZ A;  5BPI A;  1R49 A;  4DYQ A;  3WGH A;  3KZI C;  3GBG A;  5GAE J;  4S0H B;  5JFR A;  2KIQ A;  3HIF A;  3VDX A;  4EVI A;  2AHQ A;  3F8N A;  1KYZ A;  3QOD A;  1I1S A;  1UJ8 A;  1ZAO A;  2E19 A;  3I59 B;  1XPX A;  2VPL A;  4C3I J;  4RGU A;  4CYC B;  3C3W A;  4U88 A;  5FKN A;  1QVT A;  3GW2 A;  4D5C A;  1IN6 A;  4BHC A;  5IOZ A;  4DYC A;  2F4I A;  2JPC A;  3DCF A;  2W85 A;  2ESN A;  1IW7 F;  2L9N A;  5F08 A;  2PFB A;  1HF0 A;  3CCL I;  4FET A;  1Y1W J;  2VJJ A;  3HHG A;  4AUX A;  4XLF A;  1H8A C;  4M72 A;  2CUF A;  4EJW A;  5TIS C;  1HDD C;  1DPU A;  4I01 A;  2ZJP F;  1FOK A;  3ESW B;  5FFX A;  1ZLJ A;  2JUG A;  3SDG A;  3O6B B;  1BC7 C;  1Z6T A;  3KIO A;  1DU6 A;  4E7Z A;  1OYI A;  3H5R A;  1OCT C;  5CQE A;  3E6C C;  3H9J A;  3LSR A;  4BBS J;  4D9J A;  4EMS A;  4HW0 A;  1ODD A;  3ML6 A;  2P6S A;  2K7L A;  1IC8 A;  4IO9 F;  1Y1V J;  1BN5 A;  3SDB A;  4R1H A;  1OQY A;  1MBK A;  5LGU A;  4IOC F;  3RYR A;  2XGE A;  2CW7 A;  1V55 H;  3DP7 A;  3W2V A;  4G7O F;  2XC7 A;  4ETS A;  3IP4 B;  1VFC A;  3HSR A;  2A07 F;  3RPQ A;  3LA2 A;  2RGV A;  2M87 A;  2L3D A;  4XSX F;  2XB0 X;  2R7O A;  4UUS B;  2R7T A;  2G7U A;  3TOB A;  1DQU A;  4P5O A;  3COA C;  2JTV A;  4O5V A;  3S3M A;  1IRF A;  5CJ9 A;  3MMY B;  4IVN A;  3IRR A;  4KN7 X;  1IV8 A;  2L7K A;  3K4M A;  2KRH A;  4YII A;  3FIS A;  2FBH A;  2L7M P;  2Z9O A;  1W5C C;  1MNM C;  3HOZ J;  2ID6 A;  2B9S A;  3BR0 A;  3H0D A;  2JUC A;  2W7N A;  3LA7 A;  4BXF A;  2HDC A;  3SEQ A;  4N4N B;  4M9Z A;  1SAN A;  2YX7 A;  2ZXJ A;  3T8T A;  1J2X A;  1SMY F;  3K7A J;  2RAE A;  3CC4 I;  1O3S A;  5GP9 A;  2M2E A;  1Y56 A;  2BXY A;  1EJ9 A;  4I0A A;  3BJO A;  2O9L A;  4JX6 A;  1B72 B;  2GXB A;  4W1U A;  1IRG A;  2R7W A;  1AA7 A;  2OV7 A;  5IYB J;  2K86 A;  1LPQ A;  3WTW C;  5JHF A;  2HNH A;  4GFB A;  1JTX A;  4IRG A;  1J5Y A;  2Y69 H;  2MG4 A;  3U1D A;  4QWQ A;  4XIC A;  2L01 A;  2LRE A;  2MSY A;  4A5N A;  2UWM A;  3LWF A;  2H8R A;  4IHV A;  4XLH A;  5IT3 A;  1G3Y A;  3OOP A;  1DP3 A;  5GTH C;  2VXZ A;  5L3E A;  3HRM A;  5DCM B;  4YFK F;  1TW3 A;  2X51 A;  4D5F A;  1TP4 A;  4Y7N J;  3CCS I;  3ZQI A;  3M07 A;  4BQO A;  4BAC A;  4HQM A;  2EZH A;  1VQN I;  3CMA I;  3ZQ7 A;  4P1W A;  1D1B A;  3MN2 A;  3ZN1 A;  2TCT A;  1RZ4 A;  1F5T A;  4UVC A;  5HLI A;  5IPA A;  3IKV A;  2DK5 A;  3A01 A;  2XF6 A;  2VBX A;  1TZL A;  1K79 A;  3R6S A;  3H3U A;  4WX9 A;  4I98 B;  3OYG A;  2O8X A;  2E60 A;  3BJA A;  2VJI A;  4OIN F;  2WV1 A;  1YLF A;  3G1O A;  4ANJ A;  2HFH A;  2KIM A;  2GIV A;  2YUS A;  1MDM A;  1FYK A;  1O3Q A;  2E7X A;  2ZJ2 A;  5TGT A;  4EAT A;  2LY2 A;  1P92 A;  2QKL B;  1R4M B;  3FXU A;  3VEP A;  1DDN A;  3CMY A;  1RUO A;  2I5U A;  2PLY A;  3GYH X;  1E3O C;  3PFI A;  4I7H A;  4BY7 J;  3MKW B;  3M4O J;  5EG0 A;  4RB2 C;  4UB6 C;  2X1D A;  5D4S A;  1GT0 C;  5K7Z A;  1FWZ A;  3KYL A;  1U5T B;  1PP8 F;  3V7S A;  3E5U A;  2M34 A;  3RTR A;  1IRZ A;  1U0J A;  1MH4 A;  1UMQ A;  2LC2 A;  3N4M A;  1B6A A;  1XMA A;  3HSE A;  2CMP A;  1R5I D;  3MKY B;  3DF8 A;  2O0Y A;  1ZRF A;  3JAM K;  2IA0 A;  1IV6 A;  4HOB A;  4ENK A;  2IW5 A;  3B73 A;  1X1D A;  4XRM A;  3G6E I;  4HV6 A;  3M8F A;  2HPM A;  4J01 A;  2G7H A;  4NQW B;  4AC0 A;  2QQB A;  3FXM A;  1B9M A;  1LDK B;  3CJR B;  3WHC A;  4FX0 A;  2CW8 A;  5GAD J;  5KAF C;  2ZJQ F;  2NOJ B;  3RPU D;  1KQ8 A;  1A6Q A;  5D5W B;  4XLP F;  1Z77 A;  3FF5 A;  2XRL A;  3R61 A;  2A68 F;  2A69 F;  3I55 I;  3JRF A; 
#chains in the Genus database with same CATH homology
 1P2F A;  3PQK A;  3QOP A;  1R58 A;  1JHH A;  5LBQ A;  1MJ9 A;  1ZG3 A;  3CLO A;  3WG9 A;  2BGC A;  4MEY F;  5TRD A;  2L4M A;  3I5U A;  2KIF A;  4HDU A;  3M7G A;  2YSR A;  2DBB A;  3TOA A;  4GXO A;  3EET A;  1FY7 A;  4GCV A;  5BQT A;  3DPT A;  3S2W A;  4G94 A;  3HTU A;  4ESJ A;  3RJP A;  3VB2 A;  3V7R A;  3HYI A;  2IVM A;  1EH8 A;  2IT0 A;  1FPQ A;  2HQN A;  3E3V A;  2DPD A;  1UST A;  3L09 A;  4N9I A;  2RKH A;  1HKQ A;  1U2W A;  2W24 A;  1SAX A;  1ZRC A;  4QLC U;  2O3F A;  2M8E A;  2OD5 A;  3JSP A;  4HA8 A;  1BI2 A;  4A2U A;  4KIG A;  3FZV A;  3RIR A;  1XGN A;  3LQR A;  1R5H A;  5DV5 A;  2MBF A;  1K7A A;  1S7A A;  3RDI A;  5D4R A;  3TO6 A;  1REP C;  1A04 A;  4UV8 A;  3TDZ C;  1QPM A;  3CUQ C;  5KK1 A;  3KE2 A;  3MFK A;  3J80 K;  3I59 A;  4E70 A;  2LF8 A;  1W4M A;  3KFW X;  2YR2 A;  1KU3 A;  4HX8 A;  1BI3 A;  2HYG D;  1I6X A;  1TLH B;  1OMI A;  3L00 A;  1T39 A;  5FB2 A;  4GYG A;  3GWZ A;  4L9J A;  1T0F A;  1HKT A;  1XMK A;  5JR3 A;  2FQ3 A;  1BJA A;  5LRR A;  1YFH A;  2HKO A;  2PJP A;  1STZ A;  3HUG A;  3K1M A;  2IPQ X;  4CIC A;  1FBS A;  3MWM A;  2K4B A;  4LLL A;  2P5L C;  3P9K A;  4F7Z A;  3HTS B;  4YG2 F;  3CUO A;  2E1N A;  2HS5 A;  4YFN F;  5ERI A;  2YPR A;  3V8L A;  1R1T A;  5FFZ A;  4A0Y A;  4L9T A;  5LRS A;  1T6S A;  5AON A;  3GVA A;  2STW A;  1W5S A;  1P4W A;  5LHH A;  2FRH A;  5CYV A;  1W7P B;  2ISY A;  3REO A;  1QZZ A;  1BIA A;  5LGT A;  5D5V B;  4WWC A;  2V1X A;  2H6C A;  2QQ9 A;  3BWG A;  1QQI A;  3KCC A;  2EV0 A;  1SD4 A;  3R60 A;  2A6E F;  3I64 A;  4IXA A;  3QU3 A;  4L0Z B;  5L3D A;  3RYP A;  2F5C A;  4BNC A;  4UVA A;  3K1P A;  1O3R A;  1BC8 C;  1FT9 A;  4U7B A;  3LAJ A;  2BE5 F;  2H94 A;  2HEO A;  5E17 F;  3BPX A;  1J0R A;  2P8T A;  2RC4 A;  3JTG A;  1Z1D A;  2O61 A;  3ELK A;  1W7P A;  2FA5 A;  3MEX A;  4LG0 A;  3P7N A;  2RQP A;  1MZB A;  3U2R A;  3O3K A;  2FF4 A;  4M71 A;  1JHF A;  1Z7U A;  4L9V A;  1H9T A;  1FBU A;  3K2Z A;  2Q0O A;  5ICF A;  1YIO A;  2VOD A;  1SD7 A;  3GUD A;  4A12 A;  1P4A A;  4YIF A;  5IT9 Z;  4XRF A;  2MH2 A;  1OKR A;  2XAF A;  2Y0M A;  2A61 A;  3KLO A;  3EUH A;  2ZNY A;  4ZYH A;  1WQ2 A;  2COM A;  4NB5 A;  1E17 A;  2GA2 A;  5LHG A;  4LJZ F;  4LB5 A;  3N97 A;  1D3Y A;  1ZRD A;  4GGG A;  1MDM B;  1BBY A;  3GZ5 A;  4BQA A;  1IUY A;  2X0L A;  4MNU A;  2QEN A;  1FSE A;  5F64 A;  1D8J A;  3KP6 A;  5CVI A;  1HBX G;  3CO6 C;  5JVT A;  2EJR A;  3F72 A;  4P55 A;  3KEQ A;  4LLG F;  3LST A;  5CVV A;  1Z6R A;  2FML A;  2ZFW A;  2PI0 A;  3C7J A;  4KIB A;  4LFU A;  5AIQ A;  1BI1 A;  3GFJ A;  2CFX A;  4Q48 A;  5L3C A;  1MGT A;  3QP6 A;  4OOI A;  4OMZ A;  2YU3 A;  1Z91 A;  2EFQ A;  4I2O A;  2HWV A;  5DEQ A;  3IWZ A;  2HTS A;  2LSO A;  2L4A A;  2OU2 A;  2DLL A;  5L3B A;  1IZ1 A;  3E6B A;  1G4D A;  3OV8 A;  4KMF A;  5BOX A;  4BHB A;  3U9G A;  3L9F A;  2P6T A;  4XBF A;  2VC1 A;  5HS8 A;  3BZ6 A;  3ECH A;  5AIP A;  1AWC A;  4HZF A;  2HQR A;  4G7Z F;  1ZGA A;  4IRH A;  4R79 A;  1EH6 A;  2VT3 A;  4IHT A;  1J9I A;  1SMT A;  3T5X A;  1YS6 A;  2F2E A;  4RAY A;  5CVR A;  1XSX A;  4MTE A;  5L3F A;  3F8F A;  1ZG5 A;  1SD5 A;  2MLK A;  2Z33 A;  4JQF A;  4Q4Z F;  2PQ8 A;  1EV7 A;  1XGO A;  2FBI A;  3LFK A;  1SFX A;  3ZMU A;  3J81 K;  1HSJ A;  2VT2 A;  3F3X A;  3FM3 A;  1K78 A;  5DD4 A;  2CSO A;  1RNL A;  1TQM A;  5DCF A;  1QZY A;  4EJU A;  1Y0U A;  2XGX A;  4XSZ F;  3E6M A;  1F1Z A;  4ENJ A;  4G8X A;  3WTV C;  2XAS A;  1V3F A;  3VFZ A;  1Z9C A;  4ON0 A;  2EFN A;  1KQ0 A;  5D8L B;  4M9X A;  2OZ6 A;  1QNT A;  2GWR A;  1ZHF A;  4KMU X;  2CGP A;  1FLI A;  3WOD F;  5ICC A;  4A6D A;  2DW4 A;  1G3S A;  4P96 A;  1I1G A;  4IHS A;  4NQW A;  3KZY A;  3FM5 A;  1E2X A;  2HKX A;  4Q47 A;  2QQA A;  2JPB A;  4AIH A;  3AAF A;  2DU9 A;  5D5U B;  3L2C A;  1BM9 A;  3CJN A;  1XN7 A;  1RI7 A;  5HDG A;  4HV5 A;  3W6K B;  1YW7 A;  1BIB A;  2NNY A;  4I09 A;  2Y48 A;  1G3T A;  2IA1 A;  4MEX F;  2FOK A;  2LKP A;  1UFM A;  2DTR A;  4AWX B;  3JTH A;  1IXC A;  5J8F A;  2VE9 A;  4RB3 C;  1ZG1 A;  1KU7 A;  4PZJ A;  2QWW A;  2Z5U A;  2XKP A;  1YW8 A;  4CZZ A;  1O7L A;  2O6G E;  1X3U A;  3NRV A;  1IAW A;  4FX4 A;  5JI6 A;  1WKM A;  2IP2 A;  1ZYR F;  3GZ6 A;  4MTD A;  1H9G A;  5DCM A;  1T98 A;  2L02 A;  2FBK A;  1QBJ A;  3R4K A;  4L0Y B;  1YYV A;  1B9N A;  1O7F A;  3BDD A;  4OU0 A;  2MH9 A;  2EV6 A;  4EM2 A;  2C6Y A;  4ENM A;  2NNN A;  3D5L A;  1FP1 D;  3WU1 B;  1YG2 A;  2V1D A;  5DDG A;  4U0W A;  3P9C A;  1R1U A;  4HAM A;  3RPU A;  1LVA A;  5D6F A;  2JRT A;  1KQ9 A;  1YTY A;  1U5T A;  2ZO4 A;  3QP5 A;  2Q2E A;  1HKS A;  1L3L A;  4IRI A;  1VTN C;  3DEU A;  3Q9S A;  4RAZ A;  5KVR A;  5A2Q Z;  3E6D A;  1OR7 A;  3J80 Z;  2KJB A;  1WSU A;  1PUE E;  4UXN A;  1P4X A;  1J75 A;  2RVC A;  2FXA A;  1DPR A;  2VN2 A;  4O3M A;  1TBX A;  4KT5 C;  2OQR A;  3JAM Z;  2ELH A;  3HHH A;  4OIQ F;  2KRF A;  3EYI A;  2H6B A;  2FE3 A;  3BRO A;  1GXQ A;  2ISZ A;  2RV8 A;  4N9H A;  1RIO H;  5LEJ A;  2P5V A;  2LF7 A;  1J7K A;  2XVC A;  2ZME B;  1TNS A;  1LDJ A;  4KDP A;  4DNC A;  3GFL A;  4KN4 X;  5K5Q A;  2XRO A;  4FT8 A;  1R23 A;  2E1C A;  3KP4 A;  4GYI A;  3K0L A;  4AD9 A;  4WCG A;  3M9A A;  4LLN A;  1KU2 A;  2VBY A;  1D8K A;  3I4P A;  1L0O C;  4WK8 F;  4M74 A;  1UHM A;  3I58 A;  3DPL C;  3F8M A;  3I0T A;  2TDX A;  2M1B A;  1FNN A;  4ZH4 F;  3HRT A;  3CO7 C;  3QU6 A;  2L54 A;  2KKO A;  1LB2 A;  2FNP A;  3GFI A;  3K69 A;  1S3J A;  5E1X A;  5D8K B;  5HDK A;  2STT A;  3RI4 A;  3JW4 A;  4M6Y A;  4HDV A;  3IC7 A;  3EDP A;  2AXL A;  1YS7 A;  1JE8 A;  2NYX A;  1TQI A;  2XHK A;  2DFI A;  2IJL A;  2VC0 A;  2DQR A;  3LA3 A;  3DFG A;  4PCQ A;  1HW2 A;  5FLX Z;  3J7A O;  2PMH A;  5DD8 A;  4HLX A;  4O6J A;  3HOS A;  1OYY A;  1NHA A;  4M6X A;  3CTA A;  4RB0 A;  1U78 A;  4BAY A;  2BEO A;  3MCZ A;  4MHG A;  3GO5 A;  1GHC A;  1U8R A;  3ZMV A;  3M1E A;  2H09 A;  1T2K A;  5FLX K;  4LB6 B;  3EYY A;  3TO9 A;  1J59 A;  3WU0 A;  1HQC A;  3GFM A;  1H0M A;  3DV8 A;  3F8C A;  3TO7 A;  1ON1 A;  3F23 A;  2G9W A;  4G7H F;  4BHP A;  3DKW A;  2CG4 A;  1FZP B;  3K1N A;  2Q8K A;  5L3G A;  1YQA A;  4ZYD A;  1S7O A;  4IF4 A;  3IRQ A;  5H6R A;  2MLG A;  4G6D A;  2ETH A;  3TDU C;  3B02 A;  1K6O A;  4HYE A;  2M30 A;  3T0Y A;  4PGG A;  3SXY A;  3G3Z A;  2XIG A;  5FD6 A;  1WRJ A;  3SZP A;  4L18 B;  3WGG A;  3VOE A;  4CYD A;  1FSH A;  4MQV A;  3QPH A;  5K1Y A;  1XDU A;  4I0B A;  1R7J A;  3C18 A;  2DAO A;  4MQ9 F;  4ASN A;  1XDS A;  1FYL A;  1JGS A;  2CO5 A;  2J5P A;  2F5F A;  2D45 A;  3MQ0 A;  2AS5 F;  3KP7 A;  5HOO A;  4N0B A;  4ZZL A;  2J5O A;  5DYM A;  1AOY A;  3GXO A;  1R00 A;  5E20 A;  2XUB A;  1PP7 U;  2EK5 A;  5H6Q A;  5CLS A;  1XSV A;  2K27 A;  2OBP A;  2LNB A;  4WXC A;  3KP3 A;  3RKX A;  2EA4 A;  3ECO A;  1KU9 A;  4EGY A;  1ONV A;  2RNJ A;  3K9T A;  3C1D A;  1UCR A;  2ADU A;  3CDH A;  1GVJ A;  3L7W A;  4HX7 A;  5LEK A;  1MJA A;  1SFU A;  4UV9 A;  2HGC A;  2FSW A;  4FHT A;  1KYW A;  4KNY A;  1U5T C;  1G3W A;  4Y13 A;  1KGS A;  5LGN A;  1SD6 A;  5BPD A;  3MZY A;  1K78 B;  4KFC A;  3SHF A;  3TKY A;  2WC2 A;  5ILU A;  4BYY A;  2LDU A;  2E7W A;  3V4G A;  4U0V A;  5LLQ A;  4ESB A;  4CHU A;  3NQO A;  2HR3 A;  3FX3 A;  1IXS B;  4I02 A;  2XAQ A;  3CUQ B;  5FD5 A;  1QO0 D;  4UNO A;  5D5X B;  3T1B A;  3RKY A;  2GAU A;  4JBA A;  2GA1 A;  2DO7 A;  5HS9 A;  2XAJ A;  2GZW A;  3G73 A;  4HF0 A;  1ZLK A;  3FHZ A;  1S6L A;  2MC3 A;  4G6Q A;  1LEB A;  2ACJ A;  5ILS A;  1XD7 A;  2ZBK A;  2QUF A;  3R0J A;  1XB4 A;  2CYY A;  2GXG A;  5K5O A;  1XSD A;  4RGS A;  3ROU A;  5FGM A;  2DK8 A;  1ZN2 A;  2R7D A;  2JSC A;  3FXQ A;  3I53 A;  3LAP A;  3ISP A;  4EV0 A;  3HOT A;  1IN4 A;  3FMR A;  4RGX A;  2XAH A;  3QRF F;  1U6G A;  2VON A;  4CO8 A;  1IF1 A;  2OAZ A;  2OA4 A;  3P9I A;  2EB7 A;  5K5R A;  2QYO A;  3EQL F;  2FNA A;  3FXR A;  4HQE A;  3SZT A;  2M45 A;  2W57 A;  2EA2 A;  4KIC A;  2YX4 A;  5IT9 K;  3Q9V A;  1XGM A;  1TW2 A;  3ZP5 A;  3F8B A;  5E1Z B;  3BOQ A;  1LNW A;  2V6C A;  3HRS A;  1XGS A;  2Z99 A;  4L5J A;  4U7D A;  2FMY A;  1OYW A;  2HYF A;  1T38 A;  4EJT A;  2V79 A;  4DQ2 A;  4LGW A;  4AIK A;  1UHW A;  1FYM A;  1P6R A;  3V8J A;  2M5W A;  2XAG A;  2VBW A;  3FMS A;  2Y75 A;  1R1V A;  3NEU A;  3BP8 A;  1MD0 A;  5EEG A;  3ABU A;  4HLY A;  4P9F A;  4CXF A;  4RB1 A;  1DP7 P;  2F5E A;  1QGP A;  2IA2 A;  1CGP A;  3KLN A;  4RGR A;  1FC3 A;  1W7P D;  3MZH A;  4EJV A;  1LDD A;  4TV7 A;  3IHU A;  5HDN A;  3BJ6 A;  1MJB A;  2CW0 F;  2WWY A;  4Y17 A;  1S29 A;  2ESH A;  1FBQ A;  2HZT A;  3FMQ A;  4A0X A;  2D1H A;  4EM1 A;  2BV6 A;  4LK0 F;  5BMZ A;  2VBZ A;  4RS8 A;  2P5K A;  1I5Z A;  3TGN A;  1EH7 A;  4K2E A;  4LMY A;  4OMY A;  5E18 F;  2A5Y B;  2PEX A;  4L9N A;  3KET A;  3BPV A;  1HW5 A;  4WXD A;  3WTZ A;  2MA3 A;  2CWE A;  4CDG A;  1F4K A;  5A2Q K;  1TTY A;  2KIU A;  4OIR F;  5J6X A;  1BOA A;  2H27 A;  3GEZ A;  5ILV A;  3ERE D;  3V7C A;  3H92 A;  3I54 A;  3TQN A;  1U3E M;  1Q1H A;  2JZY A;  3ZPL A;  1UB9 A;  3LQQ A;  1HST A;  2EFW A;  3IL2 A;  1O57 A;  4H0E A;  4HF2 A;  2ZCW A;  3GX4 X;  4LD5 A;  1LJ9 A;  3WE3 A;  4XLN F;  3DXJ F;  5EEH A;  3SFZ A;  1OPC A;  4UHT A;  1RUN A;  2BBY A;  1I27 A;  2NRA C;  4L5I A;  3GF2 A;  1W5T A;  2QBY B;  4U0Y A;  3ABT A;  4D0P A;  1BI0 A;  5H20 A;  2V9V A;  1IXR C;  1MKM A;  3F6V A;  2K4J A;  4A6E A;  5HLG A;  3W6J B;  2FU4 A;  1CF7 A;  2JT1 A;  1IN8 A;  3ULQ B;  4ZYG A;  4Z2Y A;  1O3T A;  2NAZ A;  2EFP A;  2R3S A;  2D1V A;  1B59 A;  4AIJ A;  2KJC A;  3KP5 A;  2XV4 S;  3R0A A;  2HOE A;  4P9U A;  1PDN C;  1XCV A;  4IJA A;  5F6F A;  5JHU A;  1HXD A;  3F21 A;  4B09 A;  4WXH A;  2RDP A;  2QBY A;  4EJO A;  4A5M A;  4LG0 B;  3O2P E;  2XRN A;  4KA4 A;  5E1W A;  2P7C B;  3F6O A;  3PQJ A;  2Z3Y A;  5HVQ C;  5F1R A;  4M9S A;  1CF7 B;  5DUI A;  3WTS C;  3F22 A;  1B4A A;  1LQ1 A;  2VOP A;  3FWE A;  3IKT A;  2NS0 A;  4PDK A;  4OIO F;  2K02 A;  3KP2 A;  2P4W A;  3MAJ A;  4M73 A;  4YFX F;  5FO5 A;  3QPT A;  2UXX A;  4S04 A;  2GQQ A;  3V8K A;  4BH9 A;  2MD5 A;  3VOD A;  2B0L A;  1DUX C;  4ZZD A;  4A0Z A;  2O03 A;  2QM3 A;  2UXN A;  2A6H F;  2DQL A;  1WWX A;  4G9Y A;  2DT5 A;  5E8I A;  2EWN A;  1HW1 A;  4HBL A;  4BXU A;  4LK1 F;  2PBI A;  2VOO A;  4KUM A;  4Y15 A;  3SQN A;  4ENN A;  3ZMS A;  1G6N A;  1YO5 C;  4GO1 A;  3WTX C;  2IRF G;  4B8X A;  1USS A;  3M8E A;  1XCB A;  2QZ8 A;  2HTJ A;  4WF2 A;  4MGR A;  3CUQ A;  2F5D A;  5ED4 A;  1KA8 A;  1ZH5 A;  5HLH A;  5CVJ A;  3RKW A;  4NHJ A;  5J8C A;  1LEA A;  5DUK A;  1R5G A;  1WI9 A;  2RN7 A;  5ICG A;  1IN5 A;  4UUV A;  1YW9 A;  6PAX A;  3ZMT A;  4HF1 A;  1S8N A;  1ZGJ A;  4S05 A;  3KZZ A;  4Q5S F;  4HX4 A;  2FEZ A;  3IWF A;  2W25 A;  2DPU A;  2P7V B;  3GLX A;  1B1B A;  1ON2 A;  3HSF A;  3E5X A;  2UZK A;  5LHI A;  2ZME A;  3H3Z A;  1ZRE A;  2BYV E;  3E5Q A;  3ZN0 A;  3WGI A;  5BS6 A;  1ZAR A;  2EV5 A;  2ZNZ A;  3E97 A;  2XKO A;  2OQG A;  3WE2 A;  3J81 Z;  4KIF A;  3ZMZ A;  1JXS A;  4JK1 X;  3D0S A;  1D5V A;  1Z05 A;  3WTY C;  4OIP F;  1ULY A;  4KYW A;  2WV0 A;  2OZU A;  3QAH A;  1IN7 A;  2X4H A;  1C0W A;  2QVO A;  4EQQ A;  3ZMD A;  3JSO A;  1FX7 A;  1V4R A;  5D6E A;  2VE8 A;  2WTE A;  3I71 A;  2DI3 A;  2ZKZ A;  2QLZ A;  5CVU A;  1R22 A;  2R7F A;  5E8G A;  2W84 A;  3BY6 A;  3WTU C;  4ZYE A;  3HRU A;  1R36 A;  1GXP A;  3Q5F A;  2PMU A;  4PGH A;  4AVP A;  2CQK A;  4EM0 B;  4IPA A;  2EFO A;  2D2W A;  1TNT A;  1F9N A;  4CGZ A;  2A3S A;  5TJJ A;  4ESF A;  1FP2 A;  4R8H A;  2PG4 A;  1TQP A;  5ICE A;  4UVB A;  3T8R A;  5HS7 A;  2PN6 A;  3WTT C;  1SFE A;  2V1U A;  3KEO A;  3DQV C;  4EGZ A;  5BPI A;  3WGH A;  5JFR A;  3HIF A;  4EVI A;  3F8N A;  1KYZ A;  1I1S A;  1ZAO A;  3I59 B;  4RGU A;  3C3W A;  4U88 A;  3GW2 A;  1IN6 A;  4BHC A;  2JPC A;  2W85 A;  2ESN A;  1IW7 F;  2PFB A;  3HHG A;  4M72 A;  4EJW A;  1DPU A;  4I01 A;  1FOK A;  5FFX A;  1ZLJ A;  3O6B B;  1BC7 C;  1Z6T A;  1OYI A;  3E6C C;  4EMS A;  4HW0 A;  1ODD A;  3ML6 A;  2P6S A;  2K7L A;  1BN5 A;  4R1H A;  5LGU A;  3RYR A;  3DP7 A;  4G7O F;  4ETS A;  3HSR A;  2A07 F;  3RPQ A;  3LA2 A;  2RGV A;  2M87 A;  2L3D A;  4XSX F;  2G7U A;  3TOB A;  4P5O A;  3COA C;  2JTV A;  4O5V A;  1IRF A;  5CJ9 A;  4IVN A;  3IRR A;  4KN7 X;  4YII A;  2FBH A;  2Z9O A;  2HDC A;  3LA7 A;  4M9Z A;  2YX7 A;  2ZXJ A;  3T8T A;  1J2X A;  1SMY F;  1O3S A;  4I0A A;  3BJO A;  2GXB A;  1IRG A;  2K86 A;  3WTW C;  4IRG A;  1J5Y A;  3U1D A;  4QWQ A;  2L01 A;  4A5N A;  2UWM A;  3LWF A;  5IT3 A;  1G3Y A;  3OOP A;  2VXZ A;  5L3E A;  3HRM A;  5DCM B;  4YFK F;  1TW3 A;  4HQM A;  3ZQ7 A;  3ZN1 A;  1RZ4 A;  1F5T A;  4UVC A;  5HLI A;  3IKV A;  2DK5 A;  2VBX A;  1K79 A;  3R6S A;  3H3U A;  4WX9 A;  4I98 B;  2O8X A;  3BJA A;  4OIN F;  1YLF A;  2HFH A;  2KIM A;  2GIV A;  1MDM A;  1FYK A;  1O3Q A;  2E7X A;  2ZJ2 A;  1P92 A;  3FXU A;  3VEP A;  1DDN A;  1RUO A;  2PLY A;  3GYH X;  3PFI A;  4I7H A;  4RB2 C;  5D4S A;  1FWZ A;  1U5T B;  1PP8 F;  3V7S A;  3E5U A;  3RTR A;  3N4M A;  1B6A A;  1XMA A;  3HSE A;  3DF8 A;  2O0Y A;  1ZRF A;  3JAM K;  2IA0 A;  4HOB A;  4ENK A;  2IW5 A;  3B73 A;  4HV6 A;  3M8F A;  2G7H A;  2QQB A;  1B9M A;  1LDK B;  4FX0 A;  1KQ8 A;  5D5W B;  4XLP F;  3FF5 A;  3R61 A;  2A68 F;  2A69 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...