5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords AspA
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
2HQNA 1HQCA 4LK0F 3FM3A 3WG9A 1IXSB 5HOOA 2QUFA 1HSTA 3CUQB 5FB2A 2MLGA 1R36A 1RUNA 3D5LA 2VBYA 1WRJA 4UUVA 4ESJA 2HZTA 1FC3A 1T2KA 3J80K 4KDPA 1LDKB 3NQOA 1E17A 3TO9A 1T0FA 3KEQA 4RB2C 1S29A 2R7DA 2ZO4A 2LNBA 3WGIA 2DK5A 3LSTA 1XCBA 4CDGA 4M6YA 3QU6A 1WI9A 3IHUA 2IPQX 2HR3A 3GXOA 4KMUX 1FYKA 3GLXA 4A12A 2JT1A 2HYFA 3SXYA 4A2UA 4AVPA 2W25A 4HV6A 4FHTA 4N9HA 4P9UA 3ULQB 4KFCA 2FMYA 4AWXB 1HW2A 1YS6A 3FMSA 3DPLC 4HF1A 3LA3A 1BM9A 5D8LB 2ZXJA 2ISYA 4M9XA 4U0YA 4OOIA 1I5ZA 3WGGA 1QZZA 2LF7A 4G6QA 3G73A 1KU7A 1FBUA 5HS8A 4OU0A 5F6FA 1F4KA 2FBHA 3GFMA 4TV7A 3RI4A 5CLSA 1UHWA 2K7LA 2MC3A 4D0PA 2M1BA 4L0ZB 5D8KB 3ZP5A 3ERED 2A5YB 2D2WA 4OMZA 3QP5A 4NB5A 4NHJA 3SQNA 4P5OA 2D1HA 3ZPLA 3F21A 3HTSB 4IHSA 3JAMZ 1H9TA 4OMYA 1YW8A 4N0BA 5J8FA 1IN4A 4RGRA 2VOOA 4L9TA 4OIPF 2FE3A 2FBKA 4O6JA 2RVCA 1O57A 3DEUA 1XGNA 1Z91A 1B9NA 2XV4S 1P6RA 1U6GA 3L09A 2UZKA 2YX4A 5HDNA 1ZG3A 4OIOF 1DUXC 3R6SA 2PEXA 4LB6B 4MQVA 4UHTA 1HW5A 2EFOA 5FD6A 4KICA 2XGXA 4WF2A 1SD7A 3E5QA 4A0YA 3WU1B 4EMSA 2O8XA 3I4PA 2BV6A 1D8JA 3WTWC 1ZHFA 3WTVC 4R8HA 4M71A 1OYYA 1V3FA 3F6OA 1F5TA 3RKXA 1Z1DA 4A5MA 1MKMA 3CLOA 1FP2A 1T6SA 3ZN1A 1TQMA 1V4RA 3ECOA 3F8BA 5LRRA 4CYDA 1YIOA 4CXFA 2YR2A 3IL2A 4ETSA 2K27A 4PGHA 3E3VA 1U2WA 1LNWA 5D5VB 3RTRA 1Z05A 1J59A 3JTHA 2Y75A 3F6VA 1IRFA 3DKWA 1QO0D 4WCGA 4RB1A 5L3CA 5CVVA 2AXLA 4L18B 1EV7A 2M45A 2VONA 2P5VA 3WTTC 4G7ZF 3WGHA 1KYZA 5LHIA 4Q4ZF 4MGRA 4B8XA 4G94A 1W7PA 2HGCA 3QRFF 1YFHA 4ENNA 3N97A 2ELHA 3I59B 2PN6A 1XSDA 1P92A 5CYVA 1FNNA 3NEUA 3WTZA 1FP1D 3J80Z 1S7AA 4U0VA 2E7WA 1J5YA 2PJPA 4ESFA 2CYYA 1ZRCA 2OU2A 1KA8A 3HSRA 5AIQA 3H92A 1O3TA 2XROA 1U78A 3FXRA 3E6DA 1YQAA 4IRIA 1JGSA 2Z33A 1W7PB 1XDSA 4Q48A 2DLLA 3GO5A 5ICCA 4EJUA 2P6SA 3FXUA 3JW4A 3REOA 4CZZA 1YW9A 3K9TA 4XLPF 1K79A 1SAXA 1IN8A 2RGVA 2IA2A 2PMHA 2H09A 2G7UA 1PDNC 1IN5A 3N4MA 2FEZA 4G8XA 2FRHA 4KUMA 3NRVA 5E8IA 2CSOA 4WXDA 2LDUA 1LDJA 1WQ2A 1QBJA 3BJ6A 3HRUA 4Z2YA 1R5GA 2DO7A 1YG2A 5DV5A 2P7CB 2STWA 2A69F 4Y15A 1DPUA 2DW4A 3GUDA 2IA1A 2OAZA 3M8EA 3O3KA 3IWFA 3TO7A 5BOXA 3KP3A 1PUEE 4U7BA 1FPQA 2ZMEA 4ON0A 1H9GA 5L3EA 4RB3C 4KN4X 2K02A 1HSJA 4H0EA 4KIGA 4YIIA 4YIFA 4M9SA 4HX8A 1F1ZA 1S6LA 1ZRDA 2OQGA 4GYIA 5K1YA 1O7LA 4MTEA 4YG2F 1ZRFA 3E6MA 1EH7A 1RNLA 2E1CA 3LWFA 1BN5A 3PFIA 3COAC 3BZ6A 2XVCA 3KP5A 1J75A 1BJAA 3ISPA 4QWQA 5LEJA 4CO8A 4UNOA 5KK1A 1IXRC 2GWRA 4O3MA 5D5WB 3TQNA 1KQ0A 5DYMA 3T5XA 2YU3A 5IT9K 5ILVA 1BBYA 2YPRA 5CVRA 2ZMEB 2UXNA 2IA0A 3RJPA 5LGTA 5D5UB 4LLNA 2RNJA 5BMZA 2HQRA 3V8KA 5ICGA 2L4AA 4E70A 3KETA 2ADUA 3U1DA 1IRGA 3IWZA 1G3TA 2STTA 2CW0F 1D3YA 1G3SA 1KU3A 4KYWA 1HBXG 2MA3A 1LQ1A 3QP6A 1U5TA 5ICEA 3GW2A 4M74A 2XASA 5HLIA 2G9WA 4XSXF 4ZZDA 1ONVA 5DUIA 1YO5C 2QQ9A 2OZUA 1B6AA 1YTYA 3HRMA 2BBYA 2ACJA 5AONA 4HDVA 1NHAA 2PBIA 1U5TC 1IN7A 1IZ1A 4Y17A 2QYOA 3OOPA 3J81K 2QLZA 1SD5A 1SFEA 1ZGJA 4HF0A 4S05A 4XRFA 2HWVA 1EH8A 2UXXA 2A6EF 2FXAA 2XAHA 1QGPA 1U5TB 4QLCU 1BI2A 4LFUA 4BYYA 4MEXF 4G7OF 1O3RA 3C7JA 3LA7A 2WV0A 4HQEA 2V1XA 2JRTA 3EUHA 5E17F 3F8CA 1OMIA 4WXHA 1HKSA 2V9VA 3CJNA 5BPIA 3ZMZA 5LHGA 4IRHA 3LA2A 1I27A 1HW1A 3C3WA 5K5QA 1IUYA 3BJAA 1JHFA 2KJCA 3HRSA 2Q8KA 2IRFG 2EB7A 4EJWA 3O2PE 1TNTA 3V4GA 2V1UA 4IJAA 2DPUA 4LLLA 1FYMA 2KIUA 2EV0A 1XSXA 1W5SA 3I64A 1J9IA 3E97A 3PQJA 2QQAA 2DI3A 5TJJA 1T98A 1TW2A 3IC7A 1R1UA 2EA4A 2GAUA 1W4MA 1T38A 5D4RA 2KIMA 2Y0MA 2DFIA 1Y0UA 1BI1A 3RDIA 3K1NA 4GCVA 4XLNF 2P7VB 5HVQC 4EJTA 3BPXA 3K1PA 1QZYA 4XBFA 3F8FA 3HRTA 1YW7A 2CO5A 3GWZA 4CHUA 1J7KA 4PZJA 1H0MA 2L01A 4FT8A 2JPCA 4UXNA 2JTVA 5JFRA 4LLGF 2BYVE 2IJLA 3VODA 1DP7P 4I0AA 3I5UA 2ETHA 3VFZA 2PQ8A 3JSOA 3GFLA 2M30A 4LK1F 1FOKA 3V7CA 4CGZA 3U9GA 4K2EA 4IHTA 4ESBA 2GZWA 3F22A 4OIRF 2XHKA 4M9ZA 2VBWA 3FM5A 1MD0A 2R3SA 1ZG1A 2NS0A 1STZA 3I58A 4EV0A 2ZBKA 2XRNA 4KN7X 4R1HA 4HZFA 1FX7A 5HDKA 3FWEA 2GIVA 2HKOA 3MZYA 2DT5A 4A0ZA 4B09A 4U0WA 3F3XA 2AS5F 1BI0A 1B9MA 2EFPA 5CVIA 3TDZC 3QPTA 1QPMA 5DUKA 2K4JA 2EV6A 3CDHA 2G7HA 2ZKZA 2K86A 2MLKA 3PQKA 3I53A 1Z6RA 2W57A 2VE8A 4ENKA 2DTRA 3WODF 1SFUA 2XKPA 2M8EA 2O3FA 4A0XA 3WTUC 1S8NA 4UVAA 5ILSA 2GXGA 2XIGA 1L0OC 3Q5FA 5FLXZ 3GVAA 4KT5C 4HDUA 4HYEA 5ERIA 3RYRA 1AOYA 3FMQA 4HF2A 3T8TA 1I1SA 5A2QK 4HV5A 1LVAA 4AIKA 4G9YA 4GGGA 1WSUA 2O03A 3E6CC 2PLYA 4L5JA 3J81Z 3ML6A 2RV8A 2DQLA 2ESHA 5CVJA 4BH9A 2F5EA 5F64A 1P4XA 3HOSA 2F5DA 4GO1A 2RDPA 4BNCA 3M9AA 1D8KA 2P6TA 1ZN2A 2EK5A 5DCFA 5LGNA 2FMLA 1ZREA 2H6BA 3ZMTA 1ZLJA 4DNCA 3DF8A 3QPHA 1O3SA 1YLFA 3HHHA 1W7PD 3FHZA 2ESNA 4EM2A 4MHGA 3KCCA 2ZNZA 3SHFA 1L3LA 2YX7A 1UFMA 3VEPA 2VE9A 4RAYA 2Q0OA 5D6FA 4P55A 4AD9A 3SZPA 4EGYA 2WC2A 1ULYA 4O5VA 5LHHA 1XB4A 1XCVA 2FA5A 2H94A 2QM3A 1K7AA 1KQ9A 3CTAA 4OINF 3E6BA 5TRDA 2FBIA 2ZFWA 2QWWA 4I7HA 5DD8A 2QZ8A 2H6CA 2V79A 1OYWA 1FLIA 2HS5A 2HDCA 3T8RA 1ZLKA 3P9IA 4L9NA 4ZZLA 3DXJF 3ZMDA 3BROA 3I54A 3MFKA 1R1TA 5L3DA 3K2ZA 4IVNA 2F5CA 2OA4A 2EFWA 5AIPA 2J5OA 3ABTA 2PG4A 2HKXA 4EQQA 4RGXA 4ENMA 2CG4A 3BOQA 3ABUA 5FD5A 1FY7A 3TO6A 4EVIA 3FX3A 2MD5A 3LFKA 4RAZA 4A6DA 3M8FA 1YYVA 2Z9OA 4G6DA 3FMRA 1BC7C 1WKMA 4MEYF 1X3UA 4LJZF 1JHHA 2L54A 4U88A 3R0JA 1TQIA 5E1ZB 2LSOA 2QENA 2W24A 4CICA 1R7JA 3HSFA 2X0LA 3J7AO 1MJAA 5H6RA 1MZBA 2DBBA 3H3ZA 2Y48A 1ZG5A 3IKVA 1TLHB 1Z6TA 4L5IA 1HXDA 2XAGA 3MWMA 2HTSA 4HQMA 4LGWA 2VBXA 3FF5A 3CUOA 3S2WA 5DCMA 2A61A 3GYHX 2H27A 5LRSA 3JAMK 4A5NA 3E5UA 3Q9VA 1J0RA 3DV8A 1D5VA 4WWCA 1R22A 4R79A 3JSPA 2FNAA 3F72A 2GXBA 4EM1A 2EJRA 3MCZA 4GXOA 1USTA 4KIBA 2ZJ2A 4RB0A 2A07F 5J8CA 1OR7A 1UCRA 1LEAA 4HLXA 2NAZA 2V6CA 3KP2A 2PFBA 5HLHA 5HS9A 2FF4A 4KMFA 3TDUC 5D5XB 2KJBA 1RI7A 2CQKA 1YS7A 4HX7A 4LG0A 5DCMB 5CJ9A 3P7NA 2XKOA 4G7HF 3HUGA 2VBZA 1QNTA 1GXQA 4HOBA 2L02A 3EETA 4EJOA 1BOAA 3R4KA 1DDNA 1CF7A 1T39A 2QVOA 3BDDA 4EM0B 3ZMSA 3AAFA 1S7OA 3L00A 2Q2EA 4GYGA 1G3WA 4BXUA 1AWCA 3KEOA 2IW5A 2P5KA 3L2CA 2EWNA 4JQFA 1IW7F 4UV9A 3I0TA 2LKPA 2BEOA 4LD5A 3B02A 3G3ZA 2HOEA 1U8RA 3F23A 1FYLA 2CFXA 4LG0B 2GA1A 3TKYA 2OD5A 5E8GA 3W6KB 1XMKA 1ZYRF 4UV8A 3F8NA 5BS6A 1JXSA 2M5WA 5HLGA 2O0YA 4RGUA 2J5PA 1FSEA 2KRFA 2L4MA 2YSRA 4JBAA 4PGGA 4HA8A 3RKYA 3L9FA 1CF7B 4L9JA 2Z3YA 6PAXA 2W85A 2GQQA 2ZCWA 1Z9CA 5H20A 2JZYA 2VT2A 5JR3A 5LBQA 4AIHA 1ZGAA 3KP7A 3TOBA 2OBPA 2VN2A 5FO5A 3E5XA 2GA2A 3V8LA 2JSCA 3KE2A 4I0BA 1ON1A 3V7SA 2P8TA 2MH9A 2D45A 3V7RA 1MJ9A 5FFXA 2HFHA 1IXCA 3BY6A 1BIAA 2DPDA 3IRQA 3BWGA 2O61A 2BGCA 4Q47A 3B73A 3GZ6A 3C18A 4PCQA 4YFXF 5K5OA 3R61A 1ZARA 4KNYA 4ZYEA 1FSHA 4I98B 4L0YB 4ZYHA 5D4SA 5FFZA 3HOTA 1CGPA 2HEOA 1K6OA 4MTDA 4KIFA 3WE3A 4M6XA 1KYWA 1S3JA 3OV8A 1VTNC 2OZ6A 3K69A 2PI0A 5LGUA 2A3SA 3LQRA 1P2FA 5LLQA 1O3QA 5BPDA 1FWZA 1K78A 4I09A 2IT0A 3R60A 3QAHA 4BHCA 3HSEA 2IP2A 1JE8A 2F5FA 1GHCA 3KFWX 3ZN0A 4EJVA 3LQQA 3HYIA 4S04A 3C1DA 4HX4A 5IT9Z 4I2OA 3HIFA 1RZ4A 3RPQA 3BP8A 2A68F 2RC4A 1P4AA 1SFXA 2M87A 2XAQA 3T1BA 4JK1X 1KQ8A 2R7FA 4BHBA 3IKTA 1KGSA 3QU3A 5CVUA 4F7ZA 1TQPA 2VXZA 2EFNA 3DFGA 4HAMA 4Q5SF 3FXQA 5L3FA 5DEQA 2IVMA 2VT3A 1XN7A 1K78B 4N9IA 4HLYA 3V8JA 4LB5A 5K5RA 1QQIA 5DDGA 4I01A 5JVTA 1RUOA 5H6QA 2BE5F 1OKRA 1PP8F 2EFQA 1UHMA 5L3GA 3M7GA 4MQ9F 1Z7UA 4IRGA 4KA4A 1SMTA 3LAJA 1B59A 2B0LA 1G6NA 3SFZA 2X4HA 3RPUA 5ILUA 5IT3A 2NYXA 2P4WA 3I59A 2XAFA 1IN6A 2VC0A 1MDMA 1DPRA 1Q1HA 5LEKA 3TOAA 3SZTA 1ZH5A 1XD7A 2W84A 5L3BA 3EDPA 3K1MA 1XSVA 2FOKA 3GFJA 4XSZF 1R58A 3TGNA 4ZH4F 5JI6A 2O6GE 3MEXA 3EYIA 2NRAC 1LB2A 3HHGA 5E18F 4ZYDA 2RN7A 2DK8A 3D0SA 3VOEA 2RKHA 2DQRA 4HBLA 1ON2A 1U3EM 4AIJA 3MQ0A 4HW0A 2WWYA 4M73A 2VOPA 4P96A 1WWXA 2TDXA 3QOPA 3O6BB 5DD4A 3JTGA 2QBYA 4BAYA 4IPAA 5EEHA 1MDMB 1E2XA 2P5LC 5D6EA 3GF2A 4BHPA 1MJBA 5E20A 1C0WA 2XAJA 3EQLF 2FSWA 3ELKA 3L7WA 1GXPA 1G4DA 3ZQ7A 3M1EA 4IF4A 3KLNA 1SMYF 1OPCA 1IAWA 2E1NA 5E1XA 3U2RA 3ROUA 1KU2A 2ISZA 2K4BA 4P9FA 1SD6A 1HKQA 4U7DA 5EEGA 3LAPA 2C6YA 1B4AA 1R5HA 3DP7A 2QBYB 3ECHA 3VB2A 4WX9A 1LDDA 4EGZA 1XGMA 4Y13A 5FGMA 1B1BA 1PP7U 1F9NA 5E1WA 3ZMUA 2KIFA 2FU4A 2UWMA 2DU9A 1MGTA 3W6JB 3H3UA 3ZMVA 2HYGD 2E7XA 2A6HF 4WXCA 1HKTA 3Q9SA 1R1VA 1RIOH 5BQTA 1P4WA 2RQPA 1R00A 2L3DA 4M72A 1I1GA 3BJOA 3KZZA 1R23A 4RS8A 1GVJA 1FT9A 5ED4A 3R0AA 3MAJA 2PMUA 3RKWA 3KLOA 3FZVA 2XUBA 1BC8C 1KU9A 2VC1A 3F8MA 5ICFA 2Z5UA 2F2EA 4FX0A 2JPBA 4BQAA 1BI3A 4MNUA 1EH6A 3KZYA 1BIBA 3WU0A 4LMYA 2WTEA 2NNYA 2VODA 1J2XA 3GX4X 2KKOA 3WTYC 4ZYGA 2HTJA 1USSA 4I02A 3GZ5A 1FBQA 1TTYA 2CGPA 1UB9A 3RIRA 4NQWA 2EA2A 5KVRA 4RGSA 1XMAA 1XGOA 3GFIA 4A6EA 5F1RA 3T0YA 1ODDA 3EYYA 2OQRA 4YFNF 4L9VA 2DAOA 2Z99A 3KP6A 4ENJA 2CWEA 1G3YA 3P9CA 2ZNYA 2FNPA 3HTUA 5A2QZ 1SD4A 1OYIA 3RYPA 5HS7A 3DQVC 3GEZA 3WTXC 4UVBA 1FZPB 1LJ9A 1REPC 4PDKA 1TW3A 4FX4A 4UVCA 5JHUA 4ASNA 2LF8A 2EV5A 1O7FA 4IXAA 3P9KA 4OIQF 1IF1A 2QQBA 3K0LA 3IRRA 3CUQA 5FLXK 1XGSA 1XDUA 2MBFA 3WE2A 1TBXA 3BPVA 3CO7C 4WK8F 3I71A 3WTSC 1W5TA 3CO6C 2NNNA 2D1VA 1TNSA 3MZHA 1I6XA 1A04A 4YFKF 3DPTA 3KP4A 3CUQC 1FBSA 5HDGA 2FQ3A 2MH2A 5J6XA 2COMA 2V1DA 4DQ2A 1ZAOA 1LEBA
chains in the Genus database with same CATH superfamily
1DGWY 2HQNA 1HQCA 4HPQA 3K4CA 4AYBN 4LK0F 4E7JA 3FM3A 2NS8A 3WG9A 1IXSB 5HOOA 1H89C 2QUFA 1HSTA 3CUQB 4XN3A 2KRCA 4NC8A 5FB2A 5CKTA 2MLGA 1TT0A 1R36A 1FEXA 1RUNA 3D5LA 5B1BH 2BHZA 2VBYA 1YOVB 2E5NA 1WRJA 4UUVA 2BXZA 1MSEC 4ESJA 1H8AC 2HZTA 2Q2EB 1FC3A 1T2KA 3J80K 4KDPA 3GTPJ 2XB5A 1LDKB 3J7YJ 4Y4RA 2A6TA 4B47A 3NQOA 3OR2C 1E17A 5BNGA 5GAGJ 4G6TB 3FKJA 3TO9A 1T0FA 2MYSA 1MNEA 1QHGA 3KEQA 3PNYA 4RB2C 1S29A 2VLAA 4ZJZA 1WJEA 3CMMA 2R7DA 4PJLA 2ZO4A 1ZR4A 2LNBA 3WGIA 2DK5A 5M5YJ 1LUJB 3LSTA 1XCBA 3VDXA 4CDGA 4M6YA 2IGKA 3QU6A 1WI9A 3DBRB 3IHUA 1B72A 2EH3A 2IPQX 2BOLA 4BBRJ 2HR3A 3GXOA 2V1NA 2Y2ZA 4KMUX 1FYKA 4U87A 3GLXA 4A12A 1G2HA 3MKLA 1WJ5A 2JT1A 2VI6A 2MG4A 2HYFA 3SXYA 4A2UA 4AVPA 5GPAA 2W25A 1T0FC 2DOFA 4HV6A 4FHTA 2XF5A 4N9HA 2MW8A 4P9UA 3ULQB 4KFCA 3EPZA 1TWGJ 2FMYA 4AWXB 2WAQA 2P81A 1HW2A 1YS6A 3FMSA 3DPLC 4HF1A 3LA3A 1BM9A 5D8LB 4XICA 2ZXJA 2ISYA 3HB9A 4M9XA 3WG7H 3JRAA 4U0YA 4OOIA 1I5ZA 2K9SA 4IZZA 2VQCA 4OAZA 3WGGA 1FIAA 2JQ7A 1HOMA 4D7MA 1QZZA 2KDOA 1N75A 1SVMA 2LF7A 2JA6J 2XGEA 3FXOA 1Z21A 3KX2A 4G6QA 3G73A 4V2FA 1X3WB 4XKCA 3I4MJ 1KU7A 3IH4A 1FBUA 5HS8A 2ZFUA 4OU0A 5F6FA 3LSKA 2XPWA 1F4KA 4A3CJ 2FBHA 3ASOH 3GFMA 4TV7A 3RI4A 5CLSA 1UHWA 2K7LA 2CQ7A 2LC2A 2VASA 4CH7A 2MC3A 3GMEA 2M1BA 4Y33A 1OCRH 1VNDA 4D0PA 4L0ZB 3ABMH 5D8KB 3ZP5A 3OL3A 2HQ5A 3CCMI 1ZKGA 3ERED 1V54H 2A5YB 2D2WA 1ZGWA 2E2JJ 4OMZA 3H9QA 3QP5A 2CV0A 4W1UA 5E3MA 4NB5A 2L5QA 2QA4I 4NHJA 1VQ5I 4BXXJ 1X58A 1V5GA 3SQNA 3CF5F 2FQ4A 2D1HA 4P5OA 4XLAA 2WB1A 1JKOC 3ZPLA 3F21A 1JI8A 2PMZN 3HDDA 3HTSB 4IHSA 2KZVA 2VQLA 2XGDA 3JAMZ 4A3EJ 2R7VA 1H9TA 5IP9J 1YW8A 4OMYA 4N0BA 5J8FA 1IN4A 3VSKA 2KHMA 5C3EJ 4RGRA 2VOOA 4L9TA 4XKVA 2QSHX 2M34A 4XIDA 4OIPF 2FUG2 2EPFA 2FE3A 4AYBA 2FBKA 4O6JA 2RVCA 1O57A 2TRTA 3DEUA 1XGNA 1Z91A 1B9NA 3LSRA 2XV4S 1P6RA 1U6GA 3L09A 2JUCA 2WADA 2UZKA 1N77A 2YX4A 5HDNA 2NOGA 2F4IA 1ZG3A 4OIOF 2F48A 2KQRA 2LOOA 3CESA 1DUXC 3R6SA 2PEXA 4II2A 3KYLA 4LB6B 4MQVA 4UHTA 1HW5A 2EFOA 5FD6A 1M1EB 2V7FA 3S14J 4KICA 2XGXA 4WF2A 1SD7A 3E5QA 4A0YA 2Z1DA 3WU1B 4EMSA 1QRYA 3OIPA 2GXAA 3KZIC 2O8XA 3I4PA 4BEHA 2BV6A 1D8JA 1U9OA 3WTWC 1ZHFA 3M8JA 2Y0SN 3OSFA 4CCLA 4XR6A 3WTVC 4R8HA 5J4YA 2K9LA 5F08A 4M71A 1OYYA 3S3NA 1V3FA 3F6OA 1F5TA 3LFUA 3RKXA 5KAIC 4YELA 2VPRA 1Z1DA 4A5MA 3BR1A 1MKMA 3CLOA 4D5FA 1UG0A 2XPVA 1LKXA 3E7LA 1FP2A 2HVRA 1ETXA 1X1PA 1T6SA 4BQNA 3ZN1A 3HGYA 1TQMA 5M5XJ 1V4RA 3ECOA 3F8BA 3K6GA 5LRRA 1YIOA 4CYDA 2L9VA 4CXFA 1VQ7I 2YR2A 3S2HJ 3IL2A 4S0HB 4ETSA 5J47A 2K27A 1MBGA 1HDDC 1LFPA 4PGHA 4BDYA 3E3VA 2R5YA 1U2WA 5E3NA 1LNWA 3LSMA 2VJ5A 4MO7A 3OWTA 5D5VB 3HOWJ 3RTRA 1Z05A 3IP4B 2QSGX 3SZGA 1J59A 4YIRX 3H5NA 3JTHA 3A2KA 3D5SC 1NTCA 2Y75A 4HG2A 2BVMA 1POGA 2HDDA 3F6VA 1IRFA 5KAFC 4BEHB 5IYCJ 3DKWA 3F0CA 3S1MJ 2IS4A 2XPUA 1QO0D 4WCGA 4RB1A 5L3CA 2DMTA 2IGOA 5CVVA 2AXLA 2CS3A 4L18B 1EV7A 2M45A 1XTAA 2VONA 3I9V2 4XLCA 5E79C 2P5VA 5GAHJ 3WTTC 4G7ZF 3WGHA 2KZGA 1KYZA 5LHIA 4Q4ZF 4MGRA 4B8XA 1VI0A 4G94A 4UY8I 1W7PA 3HM5A 2HGCA 3QRFF 1YFHA 4FTHA 4ENNA 3N97A 2ELHA 3FXLA 3I59B 4BACA 2PN6A 1HC8A 4XKBA 1XSDA 3OYGA 1P92A 5CYVA 3W2VA 4PJJA 1FNNA 1DQUA 3NEUA 3WTZA 4DGWB 2LK2A 3HOZJ 1FP1D 2R5YB 4D1QA 3J80Z 1WFXA 4IHWA 4IKFA 2LY1A 1NH3A 1S7AA 4U0VA 1Y0NA 3NAUA 2E7WA 1J5YA 3GTLJ 2PJPA 4ESFA 2CYYA 1ZRCA 1AHDP 2L2OA 1UJ8A 1JTYA 1ETKA 2OU2A 1KA8A 1X3ZB 1T8IA 3BTCA 2NVYJ 2VKDA 3HSRA 5AIQA 3H92A 1O3TA 2XROA 4UB6C 5HLTA 2DA3A 1U78A 1ZTRA 1X2MA 3FXRA 3E6DA 1YQAA 2K9MA 3WHCA 2NOJB 4IRIA 2HXOA 1JGSA 5GPCA 3CD6I 3AG4H 1MSFC 2Z33A 1W7PB 2EZIA 1XDSA 4Q48A 2KP6A 1VQOI 4B1RA 2DLLA 3CCQI 3GO5A 5ICCA 1TT5B 1JKPC 3HEFA 3BR2A 2JUGA 2P6SA 4EJUA 3OY9A 2KDZA 3FXUA 3JW4A 3TP3A 3D5RC 3REOA 4CZZA 4I99C 3CCUI 3PO2J 3DWLE 3A0BC 2M4GA 1K83J 1YW9A 3K9TA 3CCSI 2DMPA 4XLPF 1K79A 1SAXA 1SFOJ 1IN8A 2RGVA 2IA2A 2JMWA 2L7KA 5EG0A 3JRCA 4DYRA 1EF4A 3DPUA 2PMHA 2H09A 2G7UA 1K61A 2DA6A 1PDNC 5M3MJ 3JRHA 1IN5A 3N4MA 5FKLA 3CCVI 2O7OA 2FEZA 4C3IJ 4G8XA 4HSTA 2FRHA 4KUMA 5HNHA 2BXYA 3NRVA 2OPTA 5E8IA 3S32A 2CSOA 2IEKA 3I56I 4WXDA 4CA0A 2LDUA 3K70D 1LDJA 2I5UA 1WQ2A 4PUSA 1QBJA 1WH5A 3BJ6A 1MNMC 3HRUA 4Z2YA 1R5GA 1BL0A 2DO7A 1YG2A 4C2TA 4PSWA 5DV5A 2P7CB 2STWA 1MMNA 2A69F 4Y15A 2DT7B 1DPUA 3ZXSA 2DW4A 3GUDA 2IA1A 2OAZA 3M8EA 3O3KA 5H2FC 2DXIA 3DU5A 3IWFA 1LPQA 1OCTC 3TO7A 5BOXA 4Y3OA 3KP3A 1WCMJ 1PUEE 4U7BA 1FPQA 5J1YA 2ZMEA 3ZQCA 4NNJA 2MABA 4ON0A 1H9GA 1IRZA 5L3EA 4RB3C 4KN4X 3ERMA 5F1JA 2ZSIB 2K02A 4RLFA 2O9LA 2L7FP 2H8RA 4MIMA 1HSJA 4GRIA 4QPOA 5EG0B 2LH9A 2ZJQF 3AL0C 3G71I 2CUJA 4H0EA 4KIGA 4YIIA 4YIFA 3OYCA 4M9SA 4HX8A 1F1ZA 1S6LA 2DA4A 2HZDA 2R0QC 3OYAA 2W82A 1ZRDA 2OQGA 3MKYB 1UG2A 4BE1A 3ZQIA 4GYIA 1U8BA 1O7LA 4MTEA 5K1YA 4YG2F 2LLKA 1ZRFA 3E6MA 3CZ6A 1GVDA 4AC0A 1EH7A 1RNLA 1P7IA 2DYSH 2E1CA 3LWFA 2ELKA 1BN5A 3KIOA 1I3AA 2DYRH 2ICWG 3AL0B 3PFIA 2V9KA 4PSXA 3COAC 2ZMEC 3BZ6A 2XVCA 2ZC2A 3KP5A 3Q0UA 3H9JA 1J75A 2CQQA 1BJAA 1R4MB 2LG4A 3ISPA 4QWQA 3BG9A 3ZQHA 5LEJA 4CO8A 5JLWA 4UNOA 5KK1A 1IXRC 2BW3A 2GWRA 4O3MA 4Y52J 1DP3A 2W48A 3G6EI 4MFEA 3HOVJ 5D5WB 4A69C 3TQNA 3GTMJ 1KQ0A 2TCTA 1P9QC 5DYMA 3T5XA 3ZGKA 2YU3A 3H0DA 2VXDA 2EINH 5IT9K 5ILVA 1BBYA 2YPRA 4IX7A 5FKNA 5CVRA 2JK3A 2ZMEB 2XC7A 3Q0WA 2LKXA 1KONA 2UXNA 4NDLA 2IA0A 1X4OA 3RJPA 2NVTJ 2WY8Q 5LGTA 5D5UB 4LLNA 2RNJA 2Z2SB 2NVQJ 1OQYA 5BMZA 2HQRA 4II3A 3BG6A 3V8KA 5ICGA 3QPLA 3L2RA 2L4AA 3DBLB 3QWLA 5EYRA 4E70A 1E0EA 3KETA 2HVSA 2ADUA 3U1DA 1IRGA 3IWZA 1G3TA 2STTA 1BR2A 2CW0F 4J19A 1D3YA 1G3SA 2CQNA 3OYKA 1KU3A 2MC4A 1FIPA 4B44A 3F9KA 1HBXG 4KYWA 2VJIA 4DYQA 2LP0A 2MA3A 4PJNA 1LQ1A 2Y31A 3QP6A 4L5EA 1D0ZA 1HDPA 1U5TA 3G1LA 5ICEA 3GW2A 4M74A 2HOTA 1EKEA 1UMQA 2XASA 2BW3B 4KT6A 5HLIA 2G9WA 5F0FA 3DBHB 5IYDJ 3FKIJ 4B3AA 2EILH 4XSXF 2YUSA 4ZZDA 1QPIA 1ONVA 2OTJI 2WV1A 2CV1A 4IEJA 5DUIA 5J3LA 1YO5C 2QQ9A 2OZUA 1B6AA 1YTYA 3DKXA 1BR4A 3HRMA 4XLEA 2BBYA 4D5CA 5B66C 3VPRA 3L1PA 3CP2A 2ACJA 5AONA 2D5VA 4IQ4A 3JRGA 3H5AA 1DU6A 3HKZN 2CFOA 4HDVA 1NHAA 2PBIA 4JOMA 1PVEA 1U5TC 3H5RA 1IN7A 1IZ1A 1ZK8A 4Y17A 4OAYA 3WHBA 4GFBA 3DTKA 1VF9A 2QYOA 1D0XA 3OOPA 3QYBA 4XRSG 3J81K 2QLZA 1SD5A 1SFEA 1ZGJA 2L9SA 4HF0A 3K4LA 4XRFA 4S05A 2UV1A 2ZSHB 2HWVA 3H3VK 1Z3XA 1EH8A 5FKKA 5CQEA 2UXXA 2A6EF 2FXAA 2XAHA 3I55I 1QGPA 1U5TB 4QLCU 1BI2A 3BLYA 4LFUA 5F27A 4BYYA 3RKQA 2EZKA 4ZDLA 1O3RA 3S93A 3C7JA 1S72I 1YJWI 2CV2A 3LA7A 1WJDA 2WV0A 2M4KA 1GT0C 3OOUA 4XOTA 4HQEA 4XRMA 2V1XA 4JP0A 2JRTA 3EUHA 5IPAA 5E17F 3F8CA 1OMIA 2M7BA 4WXHA 3RSNA 4EATA 5EGOA 1HKSA 5GP9A 2LR8A 2V9VA 3CJNA 3G2BA 5BPIA 3VWBA 3ZMZA 5LHGA 4IRHA 3LA2A 1I27A 1HW1A 3C3WA 1QU3A 1W36C 5K5QA 1IUYA 3BJAA 2LBFA 1JHFA 4FE7A 3GTKJ 1IJWC 2VJJA 2KJCA 4HRIA 1ETVA 1MW7A 3HRSA 2Q8KA 1W1WE 4D7NA 2IRFG 3SEZA 4J00A 1RPWA 5HNFA 3GTQJ 2EB7A 1WJFA 4EJWA 2DOEA 2XAUA 5C4XJ 1Y1WJ 3HC7A 3RZOJ 3O2PE 1TNTA 3V4GA 3EUHC 2V1UA 4CCNA 4IJAA 3K4NA 2DPUA 1GV2A 3O8HA 2LFBA 5GTIC 2VKEA 1ETWA 4LLLA 1FYMA 2KIUA 3NWSA 2EV0A 1XSXA 2K3FA 1T33A 2OCEA 5K7FA 2LYCA 1JJ6C 1W5SA 3I64A 1J9IA 1YITI 9ANTA 3E97A 3PQJA 2QQAA 2MFZA 2DI3A 5TJJA 1T98A 4BU2A 1GV5A 1TW2A 3IC7A 5C4JJ 1R1UA 2EA4A 3DU6A 2Q1ZB 3OSGA 5EGOB 2GAUA 1W4MA 1T38A 5D4RA 2KIMA 2Y0MA 2AQFA 4AM3A 2DFIA 4LIVA 2X6YA 1Y0UA 2IS6A 1BI1A 4XLFA 3RDIA 3OYLA 4XK4A 4E7KA 4PJMA 3H9GA 2DJIA 2R7UA 3K1NA 4GCVA 4XLNF 2P7VB 5HVQC 2LTPA 5FRMA 4EJTA 3BPXA 3K1PA 3B6AA 2HU9A 2B9SA 1MMAA 2R7OA 1OCOH 1QZYA 4XBFA 3F8FA 3BQYA 4FCYA 2B7EA 1F36A 2COBA 3HRTA 1R5ID 1YW7A 4N4NB 2CO5A 3GWZA 4CHUA 1J7KA 5J1RA 4PZJA 1H0MA 2L01A 4FT8A 1WHUA 2JPCA 4UXNA 4QTRA 3K2AA 1YX3A 2LRDA 1B72B 2R7TA 2E5ZA 1MH3A 2JTVA 3ONQA 1KZHA 5JFRA 4LLGF 2BYVE 2IJLA 1T08B 3VODA 1DP7P 4DJAA 4I0AA 2ME6A 3I5UA 2ETHA 1TWCJ 2CUEA 1MBJA 3VFZA 1JUSA 5C44J 2PQ8A 3L2UA 2B63J 3JSOA 4XQFA 2YU9J 3HKZA 3GFLA 2M30A 1ETOA 4LK1F 5IOYA 1D1AA 2EZLA 3QYFA 3VSLA 1IDYA 2QQ8A 3KYDB 1FOKA 3V7CA 3VYSB 4CGZA 3U9GA 1A35A 2V6EA 1IO2A 4K2EA 4IHTA 4ESBA 2L9RA 2JN6A 5EF6A 2GZWA 3F22A 5KCMA 4OIRF 2XHKA 3BG7A 3A0HC 2JA2A 4M9ZA 3IAS2 4HEA2 2VBWA 3FM5A 1R6RA 1MD0A 4CUGA 2R3SA 4JX4A 1ZG1A 2NS0A 4AVZA 1STZA 3S1RJ 3I58A 2O8KA 2X6OA 4EV0A 2ZBKA 3FBNB 3BR0A 5EDNA 2XRNA 2V26A 1JGGA 1OISA 2O5RA 4KN7X 1Z67A 2X51A 3LNQA 2ZJRF 4R1HA 4HZFA 5DM7F 1BW6A 3BCBA 1FX7A 4DZJA 5HDKA 5TISC 3FWEA 3H35A 2OF7A 2GIVA 3CDLA 2R93J 2HKOA 3CJTB 2DT5A 3MZYA 4A0ZA 4B09A 3H36A 4U0WA 3F3XA 2AS5F 1R9TJ 1BI0A 5J1UA 3FIWA 1NK2P 1B9MA 2EFPA 4JYKA 5CVIA 3TDZC 3QPTA 4KITB 1QPMA 5DUKA 1V5FA 2K4JA 2EV6A 3CDHA 2G7HA 2E35A 2ZKZA 1G59A 1ERDA 3PO3J 2K86A 3WU2C 2R5ZA 2MLKA 1AKHA 4B3XA 4XONA 3PQKA 3I53A 1OJLA 1Z6RA 2W57A 2VE8A 2A05A 3EUAA 4BE2A 4ENKA 4IQJA 4MEXF 3HZJA 2DTRA 3A03A 3H0GJ 4M3GA 5GTHC 3WODF 2DMUA 3RZDJ 1V5EA 2DFHA 1SFUA 2XKPA 3C2BA 2M8EA 5KNLA 4BDZA 2O3FA 4A0XA 3HOXJ 1S7EA 4DZPA 1OCCH 4E7SA 3WTUC 1S8NA 1QVUA 4UVAA 1VQLI 5ILSA 2IS1A 2HQAA 2VPLA 1H88C 3Q0VA 2GXGA 2QF7A 2X1DA 3RQ4A 2DMQA 2CW7A 1UZCA 2XIGA 1L0OC 2RAEA 3Q5FA 2ELJA 3BTIA 5FLXZ 4RM3A 3OYEA 3GVAA 4FQGA 4KT5C 1A31A 3S1QJ 1A6IA 4HDUA 4HYEA 5ERIA 3ZQQA 2AQEA 3RYRA 1JKQC 3A01A 2GLOA 4CCKA 1AOYA 5K7ZA 5FLMJ 1U0JA 3FMQA 2BY1A 2H1LA 2M8GX 3E0JB 3M4OJ 1TZLA 3W2AA 4HF2A 3T8TA 5EZGA 4LITA 1I1SA 3BG3A 5A2QK 2EBIA 2K3PA 3HJEA 4BGDA 3L2VA 3AKZA 2QCOA 4HV5A 4X0GA 2QKLB 5FRNA 2KL4A 1YI2I 4FE4A 1LVAA 2R5ZB 4I76A 4G9YA 3ASNH 4AIKA 1AKHB 4GGGA 1WSUA 2O03A 1BA5A 3G1MA 2NXNB 3E6CC 2PLYA 4L5JA 3MZ8A 3FK6A 3J81Z 3ML6A 2RV8A 4A93J 2DQLA 2ESHA 5JLXA 4RAGA 2VJ4A 5CVJA 3S17J 1J09A 4BH9A 1R49A 2F5EA 2JVGA 3E1SA 3CMYA 5F64A 1JT6A 1P4XA 3HOSA 3CJQB 2F5DA 4GO1A 1FOXA 1K6YA 2RDPA 4BNCA 3M9AA 5F0HA 4V19K 1D1BA 1D8KA 2ID6A 3G4SI 2P6TA 1ZN2A 2R7SA 1PYVA 4V2GA 2KLOA 1GUUA 2OC6A 4XNFA 2EK5A 4DIQA 2W7NA 4LIUA 5DCFA 5LGNA 1OCPA 2FMLA 1ZREA 2H6BA 3ZMTA 1ZLJA 4DNCA 3A01B 3DF8A 1FJLA 3QPHA 2X9DA 1AA7A 1ORKA 3BZKA 5F0CA 1YLFA 3HHHA 1O3SA 1W7PD 2PMZA 3BR5A 3FHZA 2ECBA 3HG9A 4BQOA 2ESNA 3L2WA 3DCFA 4EM2A 1JT0A 4MHGA 4RAFA 3KCCA 2ZNZA 3I4NJ 2VUMJ 1Z7LA 1Y56A 1WJCA 2YX7A 1Y8QB 3SHFA 4F52A 1L3LA 3SFIA 1UFMA 3LL7A 1PUFA 3VEPA 2VE9A 3U21A 5B3SH 4PFPA 2Q0OA 4RAYA 5D6FA 1D0YA 3PUFA 4P55A 1RR7A 4AD9A 2KPMA 3SZPA 4EGYA 1Q1VA 2WC2A 1ULYA 4M3FA 2LY2A 1VQ4I 4O5VA 5LHHA 1XB4A 1XCVA 2FA5A 2H94A 1S9HA 4QPQA 2OV7A 2QM3A 1K7AA 1KQ9A 1OFCX 4X6AJ 2L7MP 4NUBA 2BY3A 3CTAA 4OINF 4QSHA 4A3DJ 3E6BA 3QQAA 4F3QA 5J4VA 5TRDA 2FBIA 2ZFWA 2QWWA 2BZTA 4I7HA 2R92J 5DD8A 2Y0SA 2QZ8A 3DKYA 4DBQA 2ECCA 1TL8A 2H6CA 5FROA 2V79A 4X1EA 1OYWA 1FLIA 2HS5A 2HDCA 3T8RA 3PIPF 1ZLKA 2LKSA 3P9IA 5B1AH 4L9NA 4ZZLA 2OJED 3DXJF 3ZMDA 1IRXA 3BROA 3I54A 1PUFB 4I6ZA 2HDWA 3SEQA 2KT0A 3MFKA 1R1TA 5L3DA 3K2ZA 4IVNA 3OR1C 1OCZH 2F5CA 1NG6A 1VQNI 2OA4A 4F91B 2E1MC 2EFWA 2JVHA 2DA7A 2J5OA 5AIPA 3ABTA 2PG4A 2HKXA 4A3KJ 4EQQA 4RGXA 5J40A 4ENMA 2CG4A 3BOQA 3ABUA 5FD5A 3BC8A 1FY7A 3TW6A 3TO6A 4EVIA 3FX3A 5LD2C 2MD5A 1VQ8I 2A5WA 3LFKA 4RAZA 2E60A 3PSFA 4A6DA 3W6VA 3M8FA 1YYVA 4NBQA 2Z9OA 4G6DA 3FMRA 1JUMA 3M3YJ 2FX0A 1BC7C 2E1MB 4AU7A 1P7JA 1WKMA 2H1KA 4PJ0C 1W0TA 2WBMA 4MEYF 3OYNA 1X1AA 1X3UA 2OTLI 4LJZF 1JHHA 2L54A 3DTIA 4U88A 4E7LA 3R0JA 1TQIA 4CSWA 3MKZA 1VQPI 5E1ZB 2FD5A 2LSOA 2QENA 1JKRC 2E1OA 1VQ6I 3N05A 4FISA 2W24A 4CICA 2ZXHA 1R7JA 3HSFA 2X0LA 3J7AO 1MJAA 1MMDA 2KISA 4A3LJ 1JJ8C 5H6RA 1MZBA 1A36A 1RKTA 2DBBA 4RM2A 3H3ZA 1WZ2A 1X4PA 2Y48A 1ZG5A 4A3GJ 2MD0A 3IKVA 2JA5J 1BOBA 1TLHB 1IV8A 1I6HJ 1Z6TA 2VIXA 4L5IA 1HXDA 2XAGA 4JX5A 2DOAA 1N78A 3MWMA 2DA5A 2HTSA 4HQMA 1IDZA 4LGWA 2VBXA 1FTZA 3K4BA 3FF5A 3CUOA 3S2WA 2JA7J 5DCMA 2A61A 3K4KA 3OL4A 3SYTA 3GYHX 1TP4A 4H4KC 2F6CA 2H27A 1FMWA 3CCJI 1RC9A 5LRSA 5F04A 3JAMK 4IHVA 4A5NA 4XMYA 1PJRA 3E5UA 3Q9VA 4A3IJ 3IH3A 4BJTA 1J0RA 1SEUA 5JVGF 3DV8A 1D5VA 4WWCA 1HLVA 2HPMA 1R22A 2CJJA 4R79A 1E3HA 1DGRM 2F4OB 3JSPA 2FNAA 3F72A 2GXBA 4EM1A 1B8IA 4F93B 3I3LA 2EJRA 1LFUP 1E3OC 3MCZA 4GXOA 3J7ZI 1USTA 2ZXIA 4KIBA 2ZJ2A 4RB0A 2A07F 1WGXA 5J8CA 1OR7A 1UCRA 3BTLA 2HYJA 4G12A 1LEAA 4HLXA 2NAZA 2V6CA 3KP2A 1WH7A 2E2HJ 3CC4I 2N8GA 2PFBA 3J7AY 4B4CA 5HLHA 5HS9A 2VKHA 2FF4A 3OIOA 2F4MB 1IC8A 4NC7A 4KMFA 2WAQN 1XC5A 1XPXA 3TDUC 5D5XB 2KJBA 1RI7A 2CQKA 3S16J 1XS9A 1YS7A 4C2MJ 1EA3A 4HX7A 4LG0A 2DDAA 2L0KA 5DCMB 5CJ9A 3P7NA 2XKOA 1I39A 5B5EC 4G7HF 2R7WA 3HUGA 2KIQA 2IAIA 5LFAA 2VBZA 1QNTA 3K7AJ 3TMOA 5TGTA 1GXQA 1OR7C 4HOBA 4UUSA 3CCRI 4DYCA 3ZOBA 2L02A 3MD2A 3EETA 4EJOA 1BOAA 2DFEA 3GBGA 2M3AA 3R4KA 1DDNA 1CF7A 1T39A 2LREA 2QVOA 4A3FJ 1S5LC 1SVLA 3AG1H 2WAEA 3GZNB 3HL2A 4C3JJ 3BDDA 4EM0B 2XB0X 3PNVA 5DS9A 3ZMSA 3S8PA 3CC7I 5E3OA 3AAFA 1S7OA 3L00A 2Q2EA 3GCMA 4GYGA 1G3WA 2RREA 4BXUA 1AWCA 3KEOA 3FXJA 2IW5A 2P5KA 1N25A 3L2CA 1GLNA 2EWNA 1NG7A 4E4HA 4JQFA 1XX5A 4FASD 1IW7F 4UV9A 3I0TA 3FXKA 4G7OF 2LKPA 2WB1N 2BEOA 4LD5A 3B02A 4HNUA 3G3ZA 2HOEA 4RDUA 1U8RA 3RCOA 3F23A 3HOUJ 1FYLA 3VYRB 2CFXA 1W36D 2IBDA 4LG0B 2GA1A 2X6XA 4IOCF 2EIJH 3GTOJ 3TKYA 2OD5A 5E8GA 3W6KB 1XMKA 1ZYRF 2W1OA 3HUGB 3DLLF 2JA8J 3S2DJ 2CRGA 4UV8A 1YIJI 3F8NA 1IG7A 5BS6A 4M3DA 1JXSA 1MBFA 2M5WA 5HLGA 2O0YA 4UUSB 4RGUA 2J5PA 1FSEA 2KRFA 4PK4A 2L4MA 2YSRA 4JBAA 4PGGA 4HA8A 4PFOA 3L9FA 3RKYA 3JRDA 4ZTJA 1CF7B 4RA2A 1SANA 4L9JA 4XLHA 2R4GA 1Z0XA 2Z3YA 1JUPA 3C2GA 6PAXA 2W85A 4E7HA 4BJ6C 2XF6A 1HA8A 2GQQA 2ZCWA 1Z9CA 2LY9A 5H20A 2JZYA 2VT2A 1XG1A 5JR3A 5EEAA 3OYBA 4YEJA 3CCEI 3ESWB 2VQHA 3PNTA 5KHDA 4AIHA 4C9YA 1ZGAA 5LBQA 1QA6A 3KP7A 3TOBA 2OBPA 2VN2A 3TEDA 5FO5A 3FBIB 3E5XA 3IAM2 2NS7A 3SDGA 4XKWA 2GA2A 3CF2A 2DCEA 3V8LA 1X19A 2JSCA 3KE2A 3D1NI 1R71A 4I0BA 2FOWA 2UUZA 1ON1A 3V7SA 2P8TA 2HNHA 2MH9A 2D45A 2DTZA 2DA2A 3HOYJ 3V7RA 2RNGA 1MJ9A 5FFXA 2HFHA 2AHQA 1IXCA 3BY6A 1BIAA 2V4JC 2DPDA 4DBRA 1K4TA 5DM6F 3IRQA 3BWGA 2JWTA 2DMNA 2LD5A 2BGCA 2O61A 4Q47A 2WA0A 2HI3A 3B73A 2LBFB 3GZ6A 3C18A 4UUTA 4PCQA 3A1YA 1APLC 4YFXF 5K5OA 2M0MA 3AG2H 4CYCA 3R61A 2GBYA 1CQTA 1ZARA 4KNYA 4IOAF 4ZYEA 1FSHA 2GOMA 3KEYA 4I98B 3UR3C 2HVQA 4L0YB 3OYIA 3BQZA 3CDIA 4ZYHA 1SAUA 5D4SA 3AG3H 1LVKA 2XGCA 5FFZA 3HOTA 4ZYAA 1CGPA 2HEOA 1K6OA 1Z3YA 4MTDA 1ENHA 2AO9A 4LOCA 4KIFA 3WE3A 3CCLI 1YJNI 4KISA 1ZQ3P 3LSJA 1IUFA 4M6XA 3JRBA 1X1BA 4XN0A 1Y39A 1YE9A 1KYWA 1D1CA 1V55H 1S3JA 3OV8A 1QHHD 1R4NB 3VYUB 1VTNC 2OZ6A 3K69A 4M3BA 2PI0A 2MGQA 5LGUA 2K85A 2A3SA 3LQRA 1P2FA 5LLQA 4BJ5C 1O3QA 5BPDA 1Z77A 1FWZA 1K78A 2BY0A 2QGUA 3S15J 2Y9ZA 4I09A 2IT0A 2MSYA 3OYDA 4XRSA 3R60A 3QAHA 2CW8A 4BHCA 3CMEI 4CYCB 3HSEA 3W3CA 2IP2A 2ZXWH 1JE8A 2F5FA 4F55A 1GHCA 3KFWX 3ZN0A 5EZHA 4EJVA 3LQQA 2L7ZA 2E71A 3HYIA 2E2IJ 4S04A 4IO9F 3C1DA 2OCCH 4HX4A 1Y8RB 5IT9Z 1ITYA 4I2OA 3KYCB 3GTJJ 1LE8A 3HIFA 2NVUB 1RZ4A 3OYFA 3PL8A 3RPQA 2KMUA 1SC7A 3BP8A 2A68F 4CCJA 3BZCA 2RC4A 1P4AA 3ZCOA 4CCMA 2LVSA 1SFXA 2CUZA 2M87A 2XAQA 2CU7A 3T1BA 4J01A 4JK1X 1HF0A 1KQ8A 1ACIA 5E3LA 4ANJA 2R7FA 4BHBA 1X1CA 3IKTA 4NC6A 2JSPA 1MBEA 1KGSA 3QU3A 2EQRA 1MBKA 5CVUA 4F7ZA 1TQPA 2VXZA 2DFFA 2EFNA 3DFGA 4HAMA 4Q5SF 3FXQA 5L3FA 3ABLH 3A02A 5DEQA 3VYTB 2IVMA 2VT3A 1XN7A 4AIDA 1K78B 2ZB9A 4N9IA 1MIJA 3ZR8X 3CJRB 4HLYA 2P0WA 1ETQA 3SJMA 3V8JA 4LB5A 5K5RA 1QQIA 5DDGA 4I01A 2M7AA 5JVTA 2XRLA 1RUOA 3BR6A 4FETA 3TW7A 4XM3A 1RETA 3FDYA 1YX5A 2BE5F 2JRMA 5H6QA 1OKRA 3BCAA 3DEWA 2EZHA 1PP8F 2EFQA 1UHMA 5L3GA 3M7GA 1O4XA 4MQ9F 5IYBJ 1Z7UA 3ZQGA 3MKWB 4IRGA 4MFDA 4ZC3A 2HPIA 4A3JJ 1MMGA 1VZ0A 4KA4A 1SMTA 2VQGA 5FKMA 5GAEJ 3LAJA 2M9HA 3V42A 3BG5A 3P5JA 1X2NA 1LE8B 1B59A 2B0LA 1G6NA 3SFZA 4AUXA 1IGNA 2F5VA 3S3OA 2VL8A 2X4HA 3RPUA 5ILUA 5FJ8J 3LSPA 3DEEA 3HBLA 5IT3A 2NYXA 1K4SA 1GDTA 3PJRA 2XF7A 2P4WA 3I59A 2XAFA 2X6WA 4XOPA 1IN6A 2DDBA 3ZRGA 2VC0A 5FKOA 1MDMA 1DPRA 1Q1HA 3GLLA 3HGGA 5LEKA 3TOAA 3W2WA 2GM4A 1QZEA 3QPSA 3SZTA 5GADJ 1ZH5A 1XD7A 1LFBA 2AXTC 2W84A 3KPHA 5L3BA 3EUKL 4XL9A 2GOXB 3EDPA 4BXFA 1UAAA 1T56A 3C2HA 2FJ1A 3PFYA 3RPUD 1XMXA 4Z6YA 4UB8C 3K1MA 1XSVA 2HOSA 1WJBA 2FOKA 3GFJA 4XSZF 5IP7J 4JX6A 3S1NJ 1R58A 3PSIA 4HSRA 3QOEA 3TGNA 4ZH4F 5JI6A 2O6GE 3MEXA 2IGMA 3EYIA 4HNTA 2NRAC 1LB2A 3HHGA 5E18F 1MNDA 4ZYDA 2RN7A 2DK8A 3D0SA 3VOEA 1JTXA 2QSFX 4CZCA 1BR1A 1F43A 2K5CA 1FTTA 2RKHA 1IV6A 3CC2I 2L9NA 2R7ZJ 2DQRA 4HBLA 2Y9YA 1OLTA 1ON2A 1U3EM 1RRJA 3MMYB 1VQMI 4AIJA 2X1CA 3MQ0A 4HW0A 4M6VA 3CLQA 2RQQA 4B48A 2WWYA 4M73A 2ME0A 4P96A 1TWFJ 2VOPA 1WWXA 2TDXA 3QOPA 3O6BB 3QODA 5DD4A 5K7HA 3O8GA 3H1CA 3JTGA 4KJZA 2QBYA 4BAYA 4IPAA 2QKMB 2HOAA 3UNGC 5EEHA 1MDMB 1E2XA 2P5LC 3MN2A 4CCOA 5D6EA 2CUFA 3GF2A 4BHPA 1MJBA 4RBOA 5EJCA 2Y69H 5E20A 1C0WA 2XAJA 3EQLF 2E34A 4W97A 2FSWA 3ELKA 3L7WA 3MVPA 5FLVA 1GXPA 1G4DA 4M3EA 3ZQ7A 2Z16A 1WVRA 3BTJA 3DTEA 3M1EA 1X1DA 3FXMA 3RQIA 4DOZA 4IF4A 1YJ9I 3KLNA 1SMYF 1OPCA 4LG3A 1IAWA 2E1NA 3K10A 2E36A 3PUBA 1WJAA 5E1XA 2VB6A 3TL4X 1W0UA 2DJNA 3U2RA 4IHXA 3ABKH 3ROUA 1KU2A 2ISZA 2EIMH 4Y7NJ 1TWHJ 3NARA 2K4BA 1D5YA 5CPRB 4P9FA 1SD6A 1HKQA 4U7DA 5EEGA 3JR9A 2DODA 3B6CA 3LAPA 2C6YA 1B4AA 1R5HA 2KRHA 3DP7A 2QBYB 3ECHA 3VB2A 4WX9A 1LDDA 4BL0B 4EGZA 2XDVA 1XGMA 4Y13A 2IGNA 5FGMA 1B1BA 4HNVA 1PP7U 3JRIA 1F9NA 1EJ9A 4E7IA 5E1WA 2Y30A 3ZMUA 2R7QA 2KIFA 2FU4A 2IXSA 2IS2A 2K40A 2UWMA 3LSGA 2DU9A 3NWTA 1MGTA 2JJ7A 3W6JB 1QVTA 3H3UA 3ZMVA 1MMSA 2HYGD 2E7XA 2A6HF 5IOZA 4WXCA 3DLAA 1HKTA 3PIOF 3Q9SA 2LMDA 1R1VA 5IY5H 1RIOH 3HXLA 5BQTA 1P4WA 1I3QJ 2RQPA 1R00A 2L3DA 4M72A 1I1GA 3BJOA 3QYEA 3KZZA 4BUPA 1R23A 2I10A 1ZR2A 1W5CC 3UKGA 5HODA 4RS8A 2XSDC 1GVJA 1FT9A 5ED4A 1SVOA 3MAJA 3R0AA 2PMUA 5M5WJ 1TC3C 2H8WA 1Y6IA 3BT9A 4RMNA 4YRVA 3AFHA 3RKWA 1VQ9I 3K70C 1DU0A 4C3HJ 1T95A 3KLOA 4E7ZA 3FZVA 2XUBA 2GIZA 1BC8C 1KU9A 2PJRA 2VC1A 3F8MA 5ICFA 2BVLA 2Z5UA 2F2EA 4FX0A 1FMVA 2JPBA 3HPGA 3CP8A 4C2UA 5CQGA 3OS2A 3CQZJ 1A6QA 2I8DA 4RLQA 3IUOA 3ZQLA 4BQAA 1BI3A 2W4SA 4C30A 4MNUA 1EH6A 3BR3A 3K4JA 3KZYA 2CH0A 3G1OA 5DTDA 1BW5A 1BIBA 2E19A 3WU0A 4LMYA 4QIWN 2WTEA 2NNYA 2HXIA 3Q3SA 1HCRA 2VODA 1J2XA 1YHQI 3OS0A 3GX4X 2KKOA 4ABZA 3WTYC 1NK3P 4ZYGA 2HTJA 3CCYA 1USSA 4XORA 4I02A 1WI3A 3GZ5A 4D9JA 1FBQA 2BY2A 1TTYA 3TBIA 3LSIA 1E3PA 3LSHA 3OYJA 2CGPA 1UB9A 3FK7A 3RIRA 1RKWA 3HPHA 3A4CA 4E6KG 4NQWA 2EA2A 5KVRA 2BHYA 4RGSA 1XMAA 2V9PA 3JCUC 1XGOA 3GFIA 4A6EA 2KFDA 5F1RA 3T0YA 2EIKH 4BY7J 2PJRB 4ITVA 3LMMA 1G8XA 1ODDA 4GDFA 3EYYA 3FHNA 1VFCA 2OQRA 4YFNF 4L9VA 2DAOA 1RR8C 1A5JA 3OYHA 2CMPA 2ID3A 1Y1VJ 2DA1A 2M0CA 4EEFG 2Z99A 2QEXI 3KP6A 2ZJPF 4ENJA 3IH2A 2X85A 2CWEA 1G3YA 4ZDPA 3P9CA 3CMAI 2ZNYA 2FNPA 3HTUA 5A2QZ 1VQKI 2R7XA 1SD4A 1YRNA 4N4OB 1OYIA 3RYPA 5HS7A 5M3FJ 3U1KA 3DQVC 2K9QA 3PM1A 4A3BJ 2DT6A 1BJZA 3M07A 3GEZA 3WTXC 4UVBA 1FZPB 1LJ9A 1U9NA 1REPC 4PDKA 1WPKA 1TW3A 4FX4A 4UVCA 1FOYA 3JREA 5JHUA 4ASNA 1MH4A 2LF8A 4A3MJ 1FOWA 2EV5A 2K9NA 1O7FA 2PX9A 5IP6A 3LOCA 4IXAA 3K4MA 1SFKA 3P9KA 4NQWB 4OIQF 3GTGJ 2XSJC 4BE0A 1IF1A 3OMYA 2QQBA 3K0LA 4B43A 3L2QA 3TP0A 2X1EA 2NVXJ 4P1WA 1TWAJ 4OWRB 4BBSJ 2X48A 3IRRA 3CUQA 1AU7A 2M2EA 4MLOA 1I50J 5FLXK 3JRFA 2VKVA 4BY1J 1XGSA 1XDUA 2MBFA 3WE2A 4DW6A 1B8IB 4ZTFA 1TBXA 3BPVA 3CO7C 4BKXA 4WK8F 1UELB 3I71A 4F92B 3WTSC 1ZELA 1W5TA 4IHYA 3SDBA 3S3MA 1UHSA 4BQQA 2R7RA 2CQXA 3CO6C 2NNNA 2D1VA 5JHFA 4IL6C 1TNSA 3OYMA 3MZHA 2WY7Q 3ZQFA 4ZDOA 2W00A 2DN0A 1I6XA 3M1CA 1A04A 1RESA 2WAFA 1YRNB 1ETYA 1MBHA 4YFKF 3FISA 3DPTA 3OS1A 3KP4A 3CUQC 2G0EA 1FBSA 4BS9A 5HDGA 3OIQA 2FQ3A 2MH2A 3X2QH 3IV5A 5J6XA 2COMA 2OUMA 2YS9A 2V1DA 4DQ2A 1ZAOA 1LEBA
chains in the Genus database with same CATH topology
2HQNA 1HQCA 4LK0F 3FM3A 3WG9A 1IXSB 5HOOA 2QUFA 1HSTA 3CUQB 5FB2A 2MLGA 1R36A 1RUNA 3D5LA 2VBYA 1WRJA 4UUVA 4ESJA 2HZTA 1FC3A 1T2KA 3J80K 4KDPA 1LDKB 3NQOA 1E17A 3TO9A 1T0FA 3KEQA 4RB2C 1S29A 2R7DA 2ZO4A 2LNBA 3WGIA 2DK5A 3LSTA 1XCBA 4CDGA 4M6YA 3QU6A 1WI9A 3IHUA 2IPQX 2HR3A 3GXOA 4KMUX 1FYKA 3GLXA 4A12A 2JT1A 2HYFA 3SXYA 4A2UA 4AVPA 2W25A 4HV6A 4FHTA 4N9HA 4P9UA 3ULQB 4KFCA 2FMYA 4AWXB 1HW2A 1YS6A 3FMSA 3DPLC 4HF1A 3LA3A 1BM9A 5D8LB 2ZXJA 2ISYA 4M9XA 4U0YA 4OOIA 1I5ZA 3WGGA 1QZZA 2LF7A 4G6QA 3G73A 1KU7A 1FBUA 5HS8A 4OU0A 5F6FA 1F4KA 2FBHA 3GFMA 4TV7A 3RI4A 5CLSA 1UHWA 2K7LA 2MC3A 4D0PA 2M1BA 4L0ZB 5D8KB 3ZP5A 3ERED 2A5YB 2D2WA 4OMZA 3QP5A 4NB5A 4NHJA 3SQNA 4P5OA 2D1HA 3ZPLA 3F21A 3HTSB 4IHSA 3JAMZ 1H9TA 4OMYA 1YW8A 4N0BA 5J8FA 1IN4A 4RGRA 2VOOA 4L9TA 4OIPF 2FE3A 2FBKA 4O6JA 2RVCA 1O57A 3DEUA 1XGNA 1Z91A 1B9NA 2XV4S 1P6RA 1U6GA 3L09A 2UZKA 2YX4A 5HDNA 1ZG3A 4OIOF 1DUXC 3R6SA 2PEXA 4LB6B 4MQVA 4UHTA 1HW5A 2EFOA 5FD6A 4KICA 2XGXA 4WF2A 1SD7A 3E5QA 4A0YA 3WU1B 4EMSA 2O8XA 3I4PA 2BV6A 1D8JA 3WTWC 1ZHFA 3WTVC 4R8HA 4M71A 1OYYA 1V3FA 3F6OA 1F5TA 3RKXA 1Z1DA 4A5MA 1MKMA 3CLOA 1FP2A 1T6SA 3ZN1A 1TQMA 1V4RA 3ECOA 3F8BA 5LRRA 4CYDA 1YIOA 4CXFA 2YR2A 3IL2A 4ETSA 2K27A 4PGHA 3E3VA 1U2WA 1LNWA 5D5VB 3RTRA 1Z05A 1J59A 3JTHA 2Y75A 3F6VA 1IRFA 3DKWA 1QO0D 4WCGA 4RB1A 5L3CA 5CVVA 2AXLA 4L18B 1EV7A 2M45A 2VONA 2P5VA 3WTTC 4G7ZF 3WGHA 1KYZA 5LHIA 4Q4ZF 4MGRA 4B8XA 4G94A 1W7PA 2HGCA 3QRFF 1YFHA 4ENNA 3N97A 2ELHA 3I59B 2PN6A 1XSDA 1P92A 5CYVA 1FNNA 3NEUA 3WTZA 1FP1D 3J80Z 1S7AA 4U0VA 2E7WA 1J5YA 2PJPA 4ESFA 2CYYA 1ZRCA 2OU2A 1KA8A 3HSRA 5AIQA 3H92A 1O3TA 2XROA 1U78A 3FXRA 3E6DA 1YQAA 4IRIA 1JGSA 2Z33A 1W7PB 1XDSA 4Q48A 2DLLA 3GO5A 5ICCA 4EJUA 2P6SA 3FXUA 3JW4A 3REOA 4CZZA 1YW9A 3K9TA 4XLPF 1K79A 1SAXA 1IN8A 2RGVA 2IA2A 2PMHA 2H09A 2G7UA 1PDNC 1IN5A 3N4MA 2FEZA 4G8XA 2FRHA 4KUMA 3NRVA 5E8IA 2CSOA 4WXDA 2LDUA 1LDJA 1WQ2A 1QBJA 3BJ6A 3HRUA 4Z2YA 1R5GA 2DO7A 1YG2A 5DV5A 2P7CB 2STWA 2A69F 4Y15A 1DPUA 2DW4A 3GUDA 2IA1A 2OAZA 3M8EA 3O3KA 3IWFA 3TO7A 5BOXA 3KP3A 1PUEE 4U7BA 1FPQA 2ZMEA 4ON0A 1H9GA 5L3EA 4RB3C 4KN4X 2K02A 1HSJA 4H0EA 4KIGA 4YIIA 4YIFA 4M9SA 4HX8A 1F1ZA 1S6LA 1ZRDA 2OQGA 4GYIA 5K1YA 1O7LA 4MTEA 4YG2F 1ZRFA 3E6MA 1EH7A 1RNLA 2E1CA 3LWFA 1BN5A 3PFIA 3COAC 3BZ6A 2XVCA 3KP5A 1J75A 1BJAA 3ISPA 4QWQA 5LEJA 4CO8A 4UNOA 5KK1A 1IXRC 2GWRA 4O3MA 5D5WB 3TQNA 1KQ0A 5DYMA 3T5XA 2YU3A 5IT9K 5ILVA 1BBYA 2YPRA 5CVRA 2ZMEB 2UXNA 2IA0A 3RJPA 5LGTA 5D5UB 4LLNA 2RNJA 5BMZA 2HQRA 3V8KA 5ICGA 2L4AA 4E70A 3KETA 2ADUA 3U1DA 1IRGA 3IWZA 1G3TA 2STTA 2CW0F 1D3YA 1G3SA 1KU3A 4KYWA 1HBXG 2MA3A 1LQ1A 3QP6A 1U5TA 5ICEA 3GW2A 4M74A 2XASA 5HLIA 2G9WA 4XSXF 4ZZDA 1ONVA 5DUIA 1YO5C 2QQ9A 2OZUA 1B6AA 1YTYA 3HRMA 2BBYA 2ACJA 5AONA 4HDVA 1NHAA 2PBIA 1U5TC 1IN7A 1IZ1A 4Y17A 2QYOA 3OOPA 3J81K 2QLZA 1SD5A 1SFEA 1ZGJA 4HF0A 4S05A 4XRFA 2HWVA 1EH8A 2UXXA 2A6EF 2FXAA 2XAHA 1QGPA 1U5TB 4QLCU 1BI2A 4LFUA 4BYYA 4MEXF 4G7OF 1O3RA 3C7JA 3LA7A 2WV0A 4HQEA 2V1XA 2JRTA 3EUHA 5E17F 3F8CA 1OMIA 4WXHA 1HKSA 2V9VA 3CJNA 5BPIA 3ZMZA 5LHGA 4IRHA 3LA2A 1I27A 1HW1A 3C3WA 5K5QA 1IUYA 3BJAA 1JHFA 2KJCA 3HRSA 2Q8KA 2IRFG 2EB7A 4EJWA 3O2PE 1TNTA 3V4GA 2V1UA 4IJAA 2DPUA 4LLLA 1FYMA 2KIUA 2EV0A 1XSXA 1W5SA 3I64A 1J9IA 3E97A 3PQJA 2QQAA 2DI3A 5TJJA 1T98A 1TW2A 3IC7A 1R1UA 2EA4A 2GAUA 1W4MA 1T38A 5D4RA 2KIMA 2Y0MA 2DFIA 1Y0UA 1BI1A 3RDIA 3K1NA 4GCVA 4XLNF 2P7VB 5HVQC 4EJTA 3BPXA 3K1PA 1QZYA 4XBFA 3F8FA 3HRTA 1YW7A 2CO5A 3GWZA 4CHUA 1J7KA 4PZJA 1H0MA 2L01A 4FT8A 2JPCA 4UXNA 2JTVA 5JFRA 4LLGF 2BYVE 2IJLA 3VODA 1DP7P 4I0AA 3I5UA 2ETHA 3VFZA 2PQ8A 3JSOA 3GFLA 2M30A 4LK1F 1FOKA 3V7CA 4CGZA 3U9GA 4K2EA 4IHTA 4ESBA 2GZWA 3F22A 4OIRF 2XHKA 4M9ZA 2VBWA 3FM5A 1MD0A 2R3SA 1ZG1A 2NS0A 1STZA 3I58A 4EV0A 2ZBKA 2XRNA 4KN7X 4R1HA 4HZFA 1FX7A 5HDKA 3FWEA 2GIVA 2HKOA 3MZYA 2DT5A 4A0ZA 4B09A 4U0WA 3F3XA 2AS5F 1BI0A 1B9MA 2EFPA 5CVIA 3TDZC 3QPTA 1QPMA 5DUKA 2K4JA 2EV6A 3CDHA 2G7HA 2ZKZA 2K86A 2MLKA 3PQKA 3I53A 1Z6RA 2W57A 2VE8A 4ENKA 2DTRA 3WODF 1SFUA 2XKPA 2M8EA 2O3FA 4A0XA 3WTUC 1S8NA 4UVAA 5ILSA 2GXGA 2XIGA 1L0OC 3Q5FA 5FLXZ 3GVAA 4KT5C 4HDUA 4HYEA 5ERIA 3RYRA 1AOYA 3FMQA 4HF2A 3T8TA 1I1SA 5A2QK 4HV5A 1LVAA 4AIKA 4G9YA 4GGGA 1WSUA 2O03A 3E6CC 2PLYA 4L5JA 3J81Z 3ML6A 2RV8A 2DQLA 2ESHA 5CVJA 4BH9A 2F5EA 5F64A 1P4XA 3HOSA 2F5DA 4GO1A 2RDPA 4BNCA 3M9AA 1D8KA 2P6TA 1ZN2A 2EK5A 5DCFA 5LGNA 2FMLA 1ZREA 2H6BA 3ZMTA 1ZLJA 4DNCA 3DF8A 3QPHA 1O3SA 1YLFA 3HHHA 1W7PD 3FHZA 2ESNA 4EM2A 4MHGA 3KCCA 2ZNZA 3SHFA 1L3LA 2YX7A 1UFMA 3VEPA 2VE9A 4RAYA 2Q0OA 5D6FA 4P55A 4AD9A 3SZPA 4EGYA 2WC2A 1ULYA 4O5VA 5LHHA 1XB4A 1XCVA 2FA5A 2H94A 2QM3A 1K7AA 1KQ9A 3CTAA 4OINF 3E6BA 5TRDA 2FBIA 2ZFWA 2QWWA 4I7HA 5DD8A 2QZ8A 2H6CA 2V79A 1OYWA 1FLIA 2HS5A 2HDCA 3T8RA 1ZLKA 3P9IA 4L9NA 4ZZLA 3DXJF 3ZMDA 3BROA 3I54A 3MFKA 1R1TA 5L3DA 3K2ZA 4IVNA 2F5CA 2OA4A 2EFWA 5AIPA 2J5OA 3ABTA 2PG4A 2HKXA 4EQQA 4RGXA 4ENMA 2CG4A 3BOQA 3ABUA 5FD5A 1FY7A 3TO6A 4EVIA 3FX3A 2MD5A 3LFKA 4RAZA 4A6DA 3M8FA 1YYVA 2Z9OA 4G6DA 3FMRA 1BC7C 1WKMA 4MEYF 1X3UA 4LJZF 1JHHA 2L54A 4U88A 3R0JA 1TQIA 5E1ZB 2LSOA 2QENA 2W24A 4CICA 1R7JA 3HSFA 2X0LA 3J7AO 1MJAA 5H6RA 1MZBA 2DBBA 3H3ZA 2Y48A 1ZG5A 3IKVA 1TLHB 1Z6TA 4L5IA 1HXDA 2XAGA 3MWMA 2HTSA 4HQMA 4LGWA 2VBXA 3FF5A 3CUOA 3S2WA 5DCMA 2A61A 3GYHX 2H27A 5LRSA 3JAMK 4A5NA 3E5UA 3Q9VA 1J0RA 3DV8A 1D5VA 4WWCA 1R22A 4R79A 3JSPA 2FNAA 3F72A 2GXBA 4EM1A 2EJRA 3MCZA 4GXOA 1USTA 4KIBA 2ZJ2A 4RB0A 2A07F 5J8CA 1OR7A 1UCRA 1LEAA 4HLXA 2NAZA 2V6CA 3KP2A 2PFBA 5HLHA 5HS9A 2FF4A 4KMFA 3TDUC 5D5XB 2KJBA 1RI7A 2CQKA 1YS7A 4HX7A 4LG0A 5DCMB 5CJ9A 3P7NA 2XKOA 4G7HF 3HUGA 2VBZA 1QNTA 1GXQA 4HOBA 2L02A 3EETA 4EJOA 1BOAA 3R4KA 1DDNA 1CF7A 1T39A 2QVOA 3BDDA 4EM0B 3ZMSA 3AAFA 1S7OA 3L00A 2Q2EA 4GYGA 1G3WA 4BXUA 1AWCA 3KEOA 2IW5A 2P5KA 3L2CA 2EWNA 4JQFA 1IW7F 4UV9A 3I0TA 2LKPA 2BEOA 4LD5A 3B02A 3G3ZA 2HOEA 1U8RA 3F23A 1FYLA 2CFXA 4LG0B 2GA1A 3TKYA 2OD5A 5E8GA 3W6KB 1XMKA 1ZYRF 4UV8A 3F8NA 5BS6A 1JXSA 2M5WA 5HLGA 2O0YA 4RGUA 2J5PA 1FSEA 2KRFA 2L4MA 2YSRA 4JBAA 4PGGA 4HA8A 3RKYA 3L9FA 1CF7B 4L9JA 2Z3YA 6PAXA 2W85A 2GQQA 2ZCWA 1Z9CA 5H20A 2JZYA 2VT2A 5JR3A 5LBQA 4AIHA 1ZGAA 3KP7A 3TOBA 2OBPA 2VN2A 5FO5A 3E5XA 2GA2A 3V8LA 2JSCA 3KE2A 4I0BA 1ON1A 3V7SA 2P8TA 2MH9A 2D45A 3V7RA 1MJ9A 5FFXA 2HFHA 1IXCA 3BY6A 1BIAA 2DPDA 3IRQA 3BWGA 2O61A 2BGCA 4Q47A 3B73A 3GZ6A 3C18A 4PCQA 4YFXF 5K5OA 3R61A 1ZARA 4KNYA 4ZYEA 1FSHA 4I98B 4L0YB 4ZYHA 5D4SA 5FFZA 3HOTA 1CGPA 2HEOA 1K6OA 4MTDA 4KIFA 3WE3A 4M6XA 1KYWA 1S3JA 3OV8A 1VTNC 2OZ6A 3K69A 2PI0A 5LGUA 2A3SA 3LQRA 1P2FA 5LLQA 1O3QA 5BPDA 1FWZA 1K78A 4I09A 2IT0A 3R60A 3QAHA 4BHCA 3HSEA 2IP2A 1JE8A 2F5FA 1GHCA 3KFWX 3ZN0A 4EJVA 3LQQA 3HYIA 4S04A 3C1DA 4HX4A 5IT9Z 4I2OA 3HIFA 1RZ4A 3RPQA 3BP8A 2A68F 2RC4A 1P4AA 1SFXA 2M87A 2XAQA 3T1BA 4JK1X 1KQ8A 2R7FA 4BHBA 3IKTA 1KGSA 3QU3A 5CVUA 4F7ZA 1TQPA 2VXZA 2EFNA 3DFGA 4HAMA 4Q5SF 3FXQA 5L3FA 5DEQA 2IVMA 2VT3A 1XN7A 1K78B 4N9IA 4HLYA 3V8JA 4LB5A 5K5RA 1QQIA 5DDGA 4I01A 5JVTA 1RUOA 5H6QA 2BE5F 1OKRA 1PP8F 2EFQA 1UHMA 5L3GA 3M7GA 4MQ9F 1Z7UA 4IRGA 4KA4A 1SMTA 3LAJA 1B59A 2B0LA 1G6NA 3SFZA 2X4HA 3RPUA 5ILUA 5IT3A 2NYXA 2P4WA 3I59A 2XAFA 1IN6A 2VC0A 1MDMA 1DPRA 1Q1HA 5LEKA 3TOAA 3SZTA 1ZH5A 1XD7A 2W84A 5L3BA 3EDPA 3K1MA 1XSVA 2FOKA 3GFJA 4XSZF 1R58A 3TGNA 4ZH4F 5JI6A 2O6GE 3MEXA 3EYIA 2NRAC 1LB2A 3HHGA 5E18F 4ZYDA 2RN7A 2DK8A 3D0SA 3VOEA 2RKHA 2DQRA 4HBLA 1ON2A 1U3EM 4AIJA 3MQ0A 4HW0A 2WWYA 4M73A 2VOPA 4P96A 1WWXA 2TDXA 3QOPA 3O6BB 5DD4A 3JTGA 2QBYA 4BAYA 4IPAA 5EEHA 1MDMB 1E2XA 2P5LC 5D6EA 3GF2A 4BHPA 1MJBA 5E20A 1C0WA 2XAJA 3EQLF 2FSWA 3ELKA 3L7WA 1GXPA 1G4DA 3ZQ7A 3M1EA 4IF4A 3KLNA 1SMYF 1OPCA 1IAWA 2E1NA 5E1XA 3U2RA 3ROUA 1KU2A 2ISZA 2K4BA 4P9FA 1SD6A 1HKQA 4U7DA 5EEGA 3LAPA 2C6YA 1B4AA 1R5HA 3DP7A 2QBYB 3ECHA 3VB2A 4WX9A 1LDDA 4EGZA 1XGMA 4Y13A 5FGMA 1B1BA 1PP7U 1F9NA 5E1WA 3ZMUA 2KIFA 2FU4A 2UWMA 2DU9A 1MGTA 3W6JB 3H3UA 3ZMVA 2HYGD 2E7XA 2A6HF 4WXCA 1HKTA 3Q9SA 1R1VA 1RIOH 5BQTA 1P4WA 2RQPA 1R00A 2L3DA 4M72A 1I1GA 3BJOA 3KZZA 1R23A 4RS8A 1GVJA 1FT9A 5ED4A 3R0AA 3MAJA 2PMUA 3RKWA 3KLOA 3FZVA 2XUBA 1BC8C 1KU9A 2VC1A 3F8MA 5ICFA 2Z5UA 2F2EA 4FX0A 2JPBA 4BQAA 1BI3A 4MNUA 1EH6A 3KZYA 1BIBA 3WU0A 4LMYA 2WTEA 2NNYA 2VODA 1J2XA 3GX4X 2KKOA 3WTYC 4ZYGA 2HTJA 1USSA 4I02A 3GZ5A 1FBQA 1TTYA 2CGPA 1UB9A 3RIRA 4NQWA 2EA2A 5KVRA 4RGSA 1XMAA 1XGOA 3GFIA 4A6EA 5F1RA 3T0YA 1ODDA 3EYYA 2OQRA 4YFNF 4L9VA 2DAOA 2Z99A 3KP6A 4ENJA 2CWEA 1G3YA 3P9CA 2ZNYA 2FNPA 3HTUA 5A2QZ 1SD4A 1OYIA 3RYPA 5HS7A 3DQVC 3GEZA 3WTXC 4UVBA 1FZPB 1LJ9A 1REPC 4PDKA 1TW3A 4FX4A 4UVCA 5JHUA 4ASNA 2LF8A 2EV5A 1O7FA 4IXAA 3P9KA 4OIQF 1IF1A 2QQBA 3K0LA 3IRRA 3CUQA 5FLXK 1XGSA 1XDUA 2MBFA 3WE2A 1TBXA 3BPVA 3CO7C 4WK8F 3I71A 3WTSC 1W5TA 3CO6C 2NNNA 2D1VA 1TNSA 3MZHA 1I6XA 1A04A 4YFKF 3DPTA 3KP4A 3CUQC 1FBSA 5HDGA 2FQ3A 2MH2A 5J6XA 2COMA 2V1DA 4DQ2A 1ZAOA 1LEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQN A;  1HQC A;  4LK0 F;  3FM3 A;  3WG9 A;  1IXS B;  5HOO A;  2QUF A;  1HST A;  3CUQ B;  5FB2 A;  2MLG A;  1R36 A;  1RUN A;  3D5L A;  2VBY A;  1WRJ A;  4UUV A;  4ESJ A;  2HZT A;  1FC3 A;  1T2K A;  3J80 K;  4KDP A;  1LDK B;  3NQO A;  1E17 A;  3TO9 A;  1T0F A;  3KEQ A;  4RB2 C;  1S29 A;  2R7D A;  2ZO4 A;  2LNB A;  3WGI A;  2DK5 A;  3LST A;  1XCB A;  4CDG A;  4M6Y A;  3QU6 A;  1WI9 A;  3IHU A;  2IPQ X;  2HR3 A;  3GXO A;  4KMU X;  1FYK A;  3GLX A;  4A12 A;  2JT1 A;  2HYF A;  3SXY A;  4A2U A;  4AVP A;  2W25 A;  4HV6 A;  4FHT A;  4N9H A;  4P9U A;  3ULQ B;  4KFC A;  2FMY A;  4AWX B;  1HW2 A;  1YS6 A;  3FMS A;  3DPL C;  4HF1 A;  3LA3 A;  1BM9 A;  5D8L B;  2ZXJ A;  2ISY A;  4M9X A;  4U0Y A;  4OOI A;  1I5Z A;  3WGG A;  1QZZ A;  2LF7 A;  4G6Q A;  3G73 A;  1KU7 A;  1FBU A;  5HS8 A;  4OU0 A;  5F6F A;  1F4K A;  2FBH A;  3GFM A;  4TV7 A;  3RI4 A;  5CLS A;  1UHW A;  2K7L A;  2MC3 A;  4D0P A;  2M1B A;  4L0Z B;  5D8K B;  3ZP5 A;  3ERE D;  2A5Y B;  2D2W A;  4OMZ A;  3QP5 A;  4NB5 A;  4NHJ A;  3SQN A;  4P5O A;  2D1H A;  3ZPL A;  3F21 A;  3HTS B;  4IHS A;  3JAM Z;  1H9T A;  4OMY A;  1YW8 A;  4N0B A;  5J8F A;  1IN4 A;  4RGR A;  2VOO A;  4L9T A;  4OIP F;  2FE3 A;  2FBK A;  4O6J A;  2RVC A;  1O57 A;  3DEU A;  1XGN A;  1Z91 A;  1B9N A;  2XV4 S;  1P6R A;  1U6G A;  3L09 A;  2UZK A;  2YX4 A;  5HDN A;  1ZG3 A;  4OIO F;  1DUX C;  3R6S A;  2PEX A;  4LB6 B;  4MQV A;  4UHT A;  1HW5 A;  2EFO A;  5FD6 A;  4KIC A;  2XGX A;  4WF2 A;  1SD7 A;  3E5Q A;  4A0Y A;  3WU1 B;  4EMS A;  2O8X A;  3I4P A;  2BV6 A;  1D8J A;  3WTW C;  1ZHF A;  3WTV C;  4R8H A;  4M71 A;  1OYY A;  1V3F A;  3F6O A;  1F5T A;  3RKX A;  1Z1D A;  4A5M A;  1MKM A;  3CLO A;  1FP2 A;  1T6S A;  3ZN1 A;  1TQM A;  1V4R A;  3ECO A;  3F8B A;  5LRR A;  4CYD A;  1YIO A;  4CXF A;  2YR2 A;  3IL2 A;  4ETS A;  2K27 A;  4PGH A;  3E3V A;  1U2W A;  1LNW A;  5D5V B;  3RTR A;  1Z05 A;  1J59 A;  3JTH A;  2Y75 A;  3F6V A;  1IRF A;  3DKW A;  1QO0 D;  4WCG A;  4RB1 A;  5L3C A;  5CVV A;  2AXL A;  4L18 B;  1EV7 A;  2M45 A;  2VON A;  2P5V A;  3WTT C;  4G7Z F;  3WGH A;  1KYZ A;  5LHI A;  4Q4Z F;  4MGR A;  4B8X A;  4G94 A;  1W7P A;  2HGC A;  3QRF F;  1YFH A;  4ENN A;  3N97 A;  2ELH A;  3I59 B;  2PN6 A;  1XSD A;  1P92 A;  5CYV A;  1FNN A;  3NEU A;  3WTZ A;  1FP1 D;  3J80 Z;  1S7A A;  4U0V A;  2E7W A;  1J5Y A;  2PJP A;  4ESF A;  2CYY A;  1ZRC A;  2OU2 A;  1KA8 A;  3HSR A;  5AIQ A;  3H92 A;  1O3T A;  2XRO A;  1U78 A;  3FXR A;  3E6D A;  1YQA A;  4IRI A;  1JGS A;  2Z33 A;  1W7P B;  1XDS A;  4Q48 A;  2DLL A;  3GO5 A;  5ICC A;  4EJU A;  2P6S A;  3FXU A;  3JW4 A;  3REO A;  4CZZ A;  1YW9 A;  3K9T A;  4XLP F;  1K79 A;  1SAX A;  1IN8 A;  2RGV A;  2IA2 A;  2PMH A;  2H09 A;  2G7U A;  1PDN C;  1IN5 A;  3N4M A;  2FEZ A;  4G8X A;  2FRH A;  4KUM A;  3NRV A;  5E8I A;  2CSO A;  4WXD A;  2LDU A;  1LDJ A;  1WQ2 A;  1QBJ A;  3BJ6 A;  3HRU A;  4Z2Y A;  1R5G A;  2DO7 A;  1YG2 A;  5DV5 A;  2P7C B;  2STW A;  2A69 F;  4Y15 A;  1DPU A;  2DW4 A;  3GUD A;  2IA1 A;  2OAZ A;  3M8E A;  3O3K A;  3IWF A;  3TO7 A;  5BOX A;  3KP3 A;  1PUE E;  4U7B A;  1FPQ A;  2ZME A;  4ON0 A;  1H9G A;  5L3E A;  4RB3 C;  4KN4 X;  2K02 A;  1HSJ A;  4H0E A;  4KIG A;  4YII A;  4YIF A;  4M9S A;  4HX8 A;  1F1Z A;  1S6L A;  1ZRD A;  2OQG A;  4GYI A;  5K1Y A;  1O7L A;  4MTE A;  4YG2 F;  1ZRF A;  3E6M A;  1EH7 A;  1RNL A;  2E1C A;  3LWF A;  1BN5 A;  3PFI A;  3COA C;  3BZ6 A;  2XVC A;  3KP5 A;  1J75 A;  1BJA A;  3ISP A;  4QWQ A;  5LEJ A;  4CO8 A;  4UNO A;  5KK1 A;  1IXR C;  2GWR A;  4O3M A;  5D5W B;  3TQN A;  1KQ0 A;  5DYM A;  3T5X A;  2YU3 A;  5IT9 K;  5ILV A;  1BBY A;  2YPR A;  5CVR A;  2ZME B;  2UXN A;  2IA0 A;  3RJP A;  5LGT A;  5D5U B;  4LLN A;  2RNJ A;  5BMZ A;  2HQR A;  3V8K A;  5ICG A;  2L4A A;  4E70 A;  3KET A;  2ADU A;  3U1D A;  1IRG A;  3IWZ A;  1G3T A;  2STT A;  2CW0 F;  1D3Y A;  1G3S A;  1KU3 A;  4KYW A;  1HBX G;  2MA3 A;  1LQ1 A;  3QP6 A;  1U5T A;  5ICE A;  3GW2 A;  4M74 A;  2XAS A;  5HLI A;  2G9W A;  4XSX F;  4ZZD A;  1ONV A;  5DUI A;  1YO5 C;  2QQ9 A;  2OZU A;  1B6A A;  1YTY A;  3HRM A;  2BBY A;  2ACJ A;  5AON A;  4HDV A;  1NHA A;  2PBI A;  1U5T C;  1IN7 A;  1IZ1 A;  4Y17 A;  2QYO A;  3OOP A;  3J81 K;  2QLZ A;  1SD5 A;  1SFE A;  1ZGJ A;  4HF0 A;  4S05 A;  4XRF A;  2HWV A;  1EH8 A;  2UXX A;  2A6E F;  2FXA A;  2XAH A;  1QGP A;  1U5T B;  4QLC U;  1BI2 A;  4LFU A;  4BYY A;  4MEX F;  4G7O F;  1O3R A;  3C7J A;  3LA7 A;  2WV0 A;  4HQE A;  2V1X A;  2JRT A;  3EUH A;  5E17 F;  3F8C A;  1OMI A;  4WXH A;  1HKS A;  2V9V A;  3CJN A;  5BPI A;  3ZMZ A;  5LHG A;  4IRH A;  3LA2 A;  1I27 A;  1HW1 A;  3C3W A;  5K5Q A;  1IUY A;  3BJA A;  1JHF A;  2KJC A;  3HRS A;  2Q8K A;  2IRF G;  2EB7 A;  4EJW A;  3O2P E;  1TNT A;  3V4G A;  2V1U A;  4IJA A;  2DPU A;  4LLL A;  1FYM A;  2KIU A;  2EV0 A;  1XSX A;  1W5S A;  3I64 A;  1J9I A;  3E97 A;  3PQJ A;  2QQA A;  2DI3 A;  5TJJ A;  1T98 A;  1TW2 A;  3IC7 A;  1R1U A;  2EA4 A;  2GAU A;  1W4M A;  1T38 A;  5D4R A;  2KIM A;  2Y0M A;  2DFI A;  1Y0U A;  1BI1 A;  3RDI A;  3K1N A;  4GCV A;  4XLN F;  2P7V B;  5HVQ C;  4EJT A;  3BPX A;  3K1P A;  1QZY A;  4XBF A;  3F8F A;  3HRT A;  1YW7 A;  2CO5 A;  3GWZ A;  4CHU A;  1J7K A;  4PZJ A;  1H0M A;  2L01 A;  4FT8 A;  2JPC A;  4UXN A;  2JTV A;  5JFR A;  4LLG F;  2BYV E;  2IJL A;  3VOD A;  1DP7 P;  4I0A A;  3I5U A;  2ETH A;  3VFZ A;  2PQ8 A;  3JSO A;  3GFL A;  2M30 A;  4LK1 F;  1FOK A;  3V7C A;  4CGZ A;  3U9G A;  4K2E A;  4IHT A;  4ESB A;  2GZW A;  3F22 A;  4OIR F;  2XHK A;  4M9Z A;  2VBW A;  3FM5 A;  1MD0 A;  2R3S A;  1ZG1 A;  2NS0 A;  1STZ A;  3I58 A;  4EV0 A;  2ZBK A;  2XRN A;  4KN7 X;  4R1H A;  4HZF A;  1FX7 A;  5HDK A;  3FWE A;  2GIV A;  2HKO A;  3MZY A;  2DT5 A;  4A0Z A;  4B09 A;  4U0W A;  3F3X A;  2AS5 F;  1BI0 A;  1B9M A;  2EFP A;  5CVI A;  3TDZ C;  3QPT A;  1QPM A;  5DUK A;  2K4J A;  2EV6 A;  3CDH A;  2G7H A;  2ZKZ A;  2K86 A;  2MLK A;  3PQK A;  3I53 A;  1Z6R A;  2W57 A;  2VE8 A;  4ENK A;  2DTR A;  3WOD F;  1SFU A;  2XKP A;  2M8E A;  2O3F A;  4A0X A;  3WTU C;  1S8N A;  4UVA A;  5ILS A;  2GXG A;  2XIG A;  1L0O C;  3Q5F A;  5FLX Z;  3GVA A;  4KT5 C;  4HDU A;  4HYE A;  5ERI A;  3RYR A;  1AOY A;  3FMQ A;  4HF2 A;  3T8T A;  1I1S A;  5A2Q K;  4HV5 A;  1LVA A;  4AIK A;  4G9Y A;  4GGG A;  1WSU A;  2O03 A;  3E6C C;  2PLY A;  4L5J A;  3J81 Z;  3ML6 A;  2RV8 A;  2DQL A;  2ESH A;  5CVJ A;  4BH9 A;  2F5E A;  5F64 A;  1P4X A;  3HOS A;  2F5D A;  4GO1 A;  2RDP A;  4BNC A;  3M9A A;  1D8K A;  2P6T A;  1ZN2 A;  2EK5 A;  5DCF A;  5LGN A;  2FML A;  1ZRE A;  2H6B A;  3ZMT A;  1ZLJ A;  4DNC A;  3DF8 A;  3QPH A;  1O3S A;  1YLF A;  3HHH A;  1W7P D;  3FHZ A;  2ESN A;  4EM2 A;  4MHG A;  3KCC A;  2ZNZ A;  3SHF A;  1L3L A;  2YX7 A;  1UFM A;  3VEP A;  2VE9 A;  4RAY A;  2Q0O A;  5D6F A;  4P55 A;  4AD9 A;  3SZP A;  4EGY A;  2WC2 A;  1ULY A;  4O5V A;  5LHH A;  1XB4 A;  1XCV A;  2FA5 A;  2H94 A;  2QM3 A;  1K7A A;  1KQ9 A;  3CTA A;  4OIN F;  3E6B A;  5TRD A;  2FBI A;  2ZFW A;  2QWW A;  4I7H A;  5DD8 A;  2QZ8 A;  2H6C A;  2V79 A;  1OYW A;  1FLI A;  2HS5 A;  2HDC A;  3T8R A;  1ZLK A;  3P9I A;  4L9N A;  4ZZL A;  3DXJ F;  3ZMD A;  3BRO A;  3I54 A;  3MFK A;  1R1T A;  5L3D A;  3K2Z A;  4IVN A;  2F5C A;  2OA4 A;  2EFW A;  5AIP A;  2J5O A;  3ABT A;  2PG4 A;  2HKX A;  4EQQ A;  4RGX A;  4ENM A;  2CG4 A;  3BOQ A;  3ABU A;  5FD5 A;  1FY7 A;  3TO6 A;  4EVI A;  3FX3 A;  2MD5 A;  3LFK A;  4RAZ A;  4A6D A;  3M8F A;  1YYV A;  2Z9O A;  4G6D A;  3FMR A;  1BC7 C;  1WKM A;  4MEY F;  1X3U A;  4LJZ F;  1JHH A;  2L54 A;  4U88 A;  3R0J A;  1TQI A;  5E1Z B;  2LSO A;  2QEN A;  2W24 A;  4CIC A;  1R7J A;  3HSF A;  2X0L A;  3J7A O;  1MJA A;  5H6R A;  1MZB A;  2DBB A;  3H3Z A;  2Y48 A;  1ZG5 A;  3IKV A;  1TLH B;  1Z6T A;  4L5I A;  1HXD A;  2XAG A;  3MWM A;  2HTS A;  4HQM A;  4LGW A;  2VBX A;  3FF5 A;  3CUO A;  3S2W A;  5DCM A;  2A61 A;  3GYH X;  2H27 A;  5LRS A;  3JAM K;  4A5N A;  3E5U A;  3Q9V A;  1J0R A;  3DV8 A;  1D5V A;  4WWC A;  1R22 A;  4R79 A;  3JSP A;  2FNA A;  3F72 A;  2GXB A;  4EM1 A;  2EJR A;  3MCZ A;  4GXO A;  1UST A;  4KIB A;  2ZJ2 A;  4RB0 A;  2A07 F;  5J8C A;  1OR7 A;  1UCR A;  1LEA A;  4HLX A;  2NAZ A;  2V6C A;  3KP2 A;  2PFB A;  5HLH A;  5HS9 A;  2FF4 A;  4KMF A;  3TDU C;  5D5X B;  2KJB A;  1RI7 A;  2CQK A;  1YS7 A;  4HX7 A;  4LG0 A;  5DCM B;  5CJ9 A;  3P7N A;  2XKO A;  4G7H F;  3HUG A;  2VBZ A;  1QNT A;  1GXQ A;  4HOB A;  2L02 A;  3EET A;  4EJO A;  1BOA A;  3R4K A;  1DDN A;  1CF7 A;  1T39 A;  2QVO A;  3BDD A;  4EM0 B;  3ZMS A;  3AAF A;  1S7O A;  3L00 A;  2Q2E A;  4GYG A;  1G3W A;  4BXU A;  1AWC A;  3KEO A;  2IW5 A;  2P5K A;  3L2C A;  2EWN A;  4JQF A;  1IW7 F;  4UV9 A;  3I0T A;  2LKP A;  2BEO A;  4LD5 A;  3B02 A;  3G3Z A;  2HOE A;  1U8R A;  3F23 A;  1FYL A;  2CFX A;  4LG0 B;  2GA1 A;  3TKY A;  2OD5 A;  5E8G A;  3W6K B;  1XMK A;  1ZYR F;  4UV8 A;  3F8N A;  5BS6 A;  1JXS A;  2M5W A;  5HLG A;  2O0Y A;  4RGU A;  2J5P A;  1FSE A;  2KRF A;  2L4M A;  2YSR A;  4JBA A;  4PGG A;  4HA8 A;  3RKY A;  3L9F A;  1CF7 B;  4L9J A;  2Z3Y A;  6PAX A;  2W85 A;  2GQQ A;  2ZCW A;  1Z9C A;  5H20 A;  2JZY A;  2VT2 A;  5JR3 A;  5LBQ A;  4AIH A;  1ZGA A;  3KP7 A;  3TOB A;  2OBP A;  2VN2 A;  5FO5 A;  3E5X A;  2GA2 A;  3V8L A;  2JSC A;  3KE2 A;  4I0B A;  1ON1 A;  3V7S A;  2P8T A;  2MH9 A;  2D45 A;  3V7R A;  1MJ9 A;  5FFX A;  2HFH A;  1IXC A;  3BY6 A;  1BIA A;  2DPD A;  3IRQ A;  3BWG A;  2O61 A;  2BGC A;  4Q47 A;  3B73 A;  3GZ6 A;  3C18 A;  4PCQ A;  4YFX F;  5K5O A;  3R61 A;  1ZAR A;  4KNY A;  4ZYE A;  1FSH A;  4I98 B;  4L0Y B;  4ZYH A;  5D4S A;  5FFZ A;  3HOT A;  1CGP A;  2HEO A;  1K6O A;  4MTD A;  4KIF A;  3WE3 A;  4M6X A;  1KYW A;  1S3J A;  3OV8 A;  1VTN C;  2OZ6 A;  3K69 A;  2PI0 A;  5LGU A;  2A3S A;  3LQR A;  1P2F A;  5LLQ A;  1O3Q A;  5BPD A;  1FWZ A;  1K78 A;  4I09 A;  2IT0 A;  3R60 A;  3QAH A;  4BHC A;  3HSE A;  2IP2 A;  1JE8 A;  2F5F A;  1GHC A;  3KFW X;  3ZN0 A;  4EJV A;  3LQQ A;  3HYI A;  4S04 A;  3C1D A;  4HX4 A;  5IT9 Z;  4I2O A;  3HIF A;  1RZ4 A;  3RPQ A;  3BP8 A;  2A68 F;  2RC4 A;  1P4A A;  1SFX A;  2M87 A;  2XAQ A;  3T1B A;  4JK1 X;  1KQ8 A;  2R7F A;  4BHB A;  3IKT A;  1KGS A;  3QU3 A;  5CVU A;  4F7Z A;  1TQP A;  2VXZ A;  2EFN A;  3DFG A;  4HAM A;  4Q5S F;  3FXQ A;  5L3F A;  5DEQ A;  2IVM A;  2VT3 A;  1XN7 A;  1K78 B;  4N9I A;  4HLY A;  3V8J A;  4LB5 A;  5K5R A;  1QQI A;  5DDG A;  4I01 A;  5JVT A;  1RUO A;  5H6Q A;  2BE5 F;  1OKR A;  1PP8 F;  2EFQ A;  1UHM A;  5L3G A;  3M7G A;  4MQ9 F;  1Z7U A;  4IRG A;  4KA4 A;  1SMT A;  3LAJ A;  1B59 A;  2B0L A;  1G6N A;  3SFZ A;  2X4H A;  3RPU A;  5ILU A;  5IT3 A;  2NYX A;  2P4W A;  3I59 A;  2XAF A;  1IN6 A;  2VC0 A;  1MDM A;  1DPR A;  1Q1H A;  5LEK A;  3TOA A;  3SZT A;  1ZH5 A;  1XD7 A;  2W84 A;  5L3B A;  3EDP A;  3K1M A;  1XSV A;  2FOK A;  3GFJ A;  4XSZ F;  1R58 A;  3TGN A;  4ZH4 F;  5JI6 A;  2O6G E;  3MEX A;  3EYI A;  2NRA C;  1LB2 A;  3HHG A;  5E18 F;  4ZYD A;  2RN7 A;  2DK8 A;  3D0S A;  3VOE A;  2RKH A;  2DQR A;  4HBL A;  1ON2 A;  1U3E M;  4AIJ A;  3MQ0 A;  4HW0 A;  2WWY A;  4M73 A;  2VOP A;  4P96 A;  1WWX A;  2TDX A;  3QOP A;  3O6B B;  5DD4 A;  3JTG A;  2QBY A;  4BAY A;  4IPA A;  5EEH A;  1MDM B;  1E2X A;  2P5L C;  5D6E A;  3GF2 A;  4BHP A;  1MJB A;  5E20 A;  1C0W A;  2XAJ A;  3EQL F;  2FSW A;  3ELK A;  3L7W A;  1GXP A;  1G4D A;  3ZQ7 A;  3M1E A;  4IF4 A;  3KLN A;  1SMY F;  1OPC A;  1IAW A;  2E1N A;  5E1X A;  3U2R A;  3ROU A;  1KU2 A;  2ISZ A;  2K4B A;  4P9F A;  1SD6 A;  1HKQ A;  4U7D A;  5EEG A;  3LAP A;  2C6Y A;  1B4A A;  1R5H A;  3DP7 A;  2QBY B;  3ECH A;  3VB2 A;  4WX9 A;  1LDD A;  4EGZ A;  1XGM A;  4Y13 A;  5FGM A;  1B1B A;  1PP7 U;  1F9N A;  5E1W A;  3ZMU A;  2KIF A;  2FU4 A;  2UWM A;  2DU9 A;  1MGT A;  3W6J B;  3H3U A;  3ZMV A;  2HYG D;  2E7X A;  2A6H F;  4WXC A;  1HKT A;  3Q9S A;  1R1V A;  1RIO H;  5BQT A;  1P4W A;  2RQP A;  1R00 A;  2L3D A;  4M72 A;  1I1G A;  3BJO A;  3KZZ A;  1R23 A;  4RS8 A;  1GVJ A;  1FT9 A;  5ED4 A;  3R0A A;  3MAJ A;  2PMU A;  3RKW A;  3KLO A;  3FZV A;  2XUB A;  1BC8 C;  1KU9 A;  2VC1 A;  3F8M A;  5ICF A;  2Z5U A;  2F2E A;  4FX0 A;  2JPB A;  4BQA A;  1BI3 A;  4MNU A;  1EH6 A;  3KZY A;  1BIB A;  3WU0 A;  4LMY A;  2WTE A;  2NNY A;  2VOD A;  1J2X A;  3GX4 X;  2KKO A;  3WTY C;  4ZYG A;  2HTJ A;  1USS A;  4I02 A;  3GZ5 A;  1FBQ A;  1TTY A;  2CGP A;  1UB9 A;  3RIR A;  4NQW A;  2EA2 A;  5KVR A;  4RGS A;  1XMA A;  1XGO A;  3GFI A;  4A6E A;  5F1R A;  3T0Y A;  1ODD A;  3EYY A;  2OQR A;  4YFN F;  4L9V A;  2DAO A;  2Z99 A;  3KP6 A;  4ENJ A;  2CWE A;  1G3Y A;  3P9C A;  2ZNY A;  2FNP A;  3HTU A;  5A2Q Z;  1SD4 A;  1OYI A;  3RYP A;  5HS7 A;  3DQV C;  3GEZ A;  3WTX C;  4UVB A;  1FZP B;  1LJ9 A;  1REP C;  4PDK A;  1TW3 A;  4FX4 A;  4UVC A;  5JHU A;  4ASN A;  2LF8 A;  2EV5 A;  1O7F A;  4IXA A;  3P9K A;  4OIQ F;  1IF1 A;  2QQB A;  3K0L A;  3IRR A;  3CUQ A;  5FLX K;  1XGS A;  1XDU A;  2MBF A;  3WE2 A;  1TBX A;  3BPV A;  3CO7 C;  4WK8 F;  3I71 A;  3WTS C;  1W5T A;  3CO6 C;  2NNN A;  2D1V A;  1TNS A;  3MZH A;  1I6X A;  1A04 A;  4YFK F;  3DPT A;  3KP4 A;  3CUQ C;  1FBS A;  5HDG A;  2FQ3 A;  2MH2 A;  5J6X A;  2COM A;  2V1D A;  4DQ2 A;  1ZAO A;  1LEB A; 
#chains in the Genus database with same CATH topology
 1DGW Y;  2HQN A;  1HQC A;  4HPQ A;  3K4C A;  4AYB N;  4LK0 F;  4E7J A;  3FM3 A;  2NS8 A;  3WG9 A;  1IXS B;  5HOO A;  1H89 C;  2QUF A;  1HST A;  3CUQ B;  4XN3 A;  2KRC A;  4NC8 A;  5FB2 A;  5CKT A;  2MLG A;  1TT0 A;  1R36 A;  1FEX A;  1RUN A;  3D5L A;  5B1B H;  2BHZ A;  2VBY A;  1YOV B;  2E5N A;  1WRJ A;  4UUV A;  2BXZ A;  1MSE C;  4ESJ A;  1H8A C;  2HZT A;  2Q2E B;  1FC3 A;  1T2K A;  3J80 K;  4KDP A;  3GTP J;  2XB5 A;  1LDK B;  3J7Y J;  4Y4R A;  2A6T A;  4B47 A;  3NQO A;  3OR2 C;  1E17 A;  5BNG A;  5GAG J;  4G6T B;  3FKJ A;  3TO9 A;  1T0F A;  2MYS A;  1MNE A;  1QHG A;  3KEQ A;  3PNY A;  4RB2 C;  1S29 A;  2VLA A;  4ZJZ A;  1WJE A;  3CMM A;  2R7D A;  4PJL A;  2ZO4 A;  1ZR4 A;  2LNB A;  3WGI A;  2DK5 A;  5M5Y J;  1LUJ B;  3LST A;  1XCB A;  3VDX A;  4CDG A;  4M6Y A;  2IGK A;  3QU6 A;  1WI9 A;  3DBR B;  3IHU A;  1B72 A;  2EH3 A;  2IPQ X;  2BOL A;  4BBR J;  2HR3 A;  3GXO A;  2V1N A;  2Y2Z A;  4KMU X;  1FYK A;  4U87 A;  3GLX A;  4A12 A;  1G2H A;  3MKL A;  1WJ5 A;  2JT1 A;  2VI6 A;  2MG4 A;  2HYF A;  3SXY A;  4A2U A;  4AVP A;  5GPA A;  2W25 A;  1T0F C;  2DOF A;  4HV6 A;  4FHT A;  2XF5 A;  4N9H A;  2MW8 A;  4P9U A;  3ULQ B;  4KFC A;  3EPZ A;  1TWG J;  2FMY A;  4AWX B;  2WAQ A;  2P81 A;  1HW2 A;  1YS6 A;  3FMS A;  3DPL C;  4HF1 A;  3LA3 A;  1BM9 A;  5D8L B;  4XIC A;  2ZXJ A;  2ISY A;  3HB9 A;  4M9X A;  3WG7 H;  3JRA A;  4U0Y A;  4OOI A;  1I5Z A;  2K9S A;  4IZZ A;  2VQC A;  4OAZ A;  3WGG A;  1FIA A;  2JQ7 A;  1HOM A;  4D7M A;  1QZZ A;  2KDO A;  1N75 A;  1SVM A;  2LF7 A;  2JA6 J;  2XGE A;  3FXO A;  1Z21 A;  3KX2 A;  4G6Q A;  3G73 A;  4V2F A;  1X3W B;  4XKC A;  3I4M J;  1KU7 A;  3IH4 A;  1FBU A;  5HS8 A;  2ZFU A;  4OU0 A;  5F6F A;  3LSK A;  2XPW A;  1F4K A;  4A3C J;  2FBH A;  3ASO H;  3GFM A;  4TV7 A;  3RI4 A;  5CLS A;  1UHW A;  2K7L A;  2CQ7 A;  2LC2 A;  2VAS A;  4CH7 A;  2MC3 A;  3GME A;  2M1B A;  4Y33 A;  1OCR H;  1VND A;  4D0P A;  4L0Z B;  3ABM H;  5D8K B;  3ZP5 A;  3OL3 A;  2HQ5 A;  3CCM I;  1ZKG A;  3ERE D;  1V54 H;  2A5Y B;  2D2W A;  1ZGW A;  2E2J J;  4OMZ A;  3H9Q A;  3QP5 A;  2CV0 A;  4W1U A;  5E3M A;  4NB5 A;  2L5Q A;  2QA4 I;  4NHJ A;  1VQ5 I;  4BXX J;  1X58 A;  1V5G A;  3SQN A;  3CF5 F;  2FQ4 A;  2D1H A;  4P5O A;  4XLA A;  2WB1 A;  1JKO C;  3ZPL A;  3F21 A;  1JI8 A;  2PMZ N;  3HDD A;  3HTS B;  4IHS A;  2KZV A;  2VQL A;  2XGD A;  3JAM Z;  4A3E J;  2R7V A;  1H9T A;  5IP9 J;  1YW8 A;  4OMY A;  4N0B A;  5J8F A;  1IN4 A;  3VSK A;  2KHM A;  5C3E J;  4RGR A;  2VOO A;  4L9T A;  4XKV A;  2QSH X;  2M34 A;  4XID A;  4OIP F;  2FUG 2;  2EPF A;  2FE3 A;  4AYB A;  2FBK A;  4O6J A;  2RVC A;  1O57 A;  2TRT A;  3DEU A;  1XGN A;  1Z91 A;  1B9N A;  3LSR A;  2XV4 S;  1P6R A;  1U6G A;  3L09 A;  2JUC A;  2WAD A;  2UZK A;  1N77 A;  2YX4 A;  5HDN A;  2NOG A;  2F4I A;  1ZG3 A;  4OIO F;  2F48 A;  2KQR A;  2LOO A;  3CES A;  1DUX C;  3R6S A;  2PEX A;  4II2 A;  3KYL A;  4LB6 B;  4MQV A;  4UHT A;  1HW5 A;  2EFO A;  5FD6 A;  1M1E B;  2V7F A;  3S14 J;  4KIC A;  2XGX A;  4WF2 A;  1SD7 A;  3E5Q A;  4A0Y A;  2Z1D A;  3WU1 B;  4EMS A;  1QRY A;  3OIP A;  2GXA A;  3KZI C;  2O8X A;  3I4P A;  4BEH A;  2BV6 A;  1D8J A;  1U9O A;  3WTW C;  1ZHF A;  3M8J A;  2Y0S N;  3OSF A;  4CCL A;  4XR6 A;  3WTV C;  4R8H A;  5J4Y A;  2K9L A;  5F08 A;  4M71 A;  1OYY A;  3S3N A;  1V3F A;  3F6O A;  1F5T A;  3LFU A;  3RKX A;  5KAI C;  4YEL A;  2VPR A;  1Z1D A;  4A5M A;  3BR1 A;  1MKM A;  3CLO A;  4D5F A;  1UG0 A;  2XPV A;  1LKX A;  3E7L A;  1FP2 A;  2HVR A;  1ETX A;  1X1P A;  1T6S A;  4BQN A;  3ZN1 A;  3HGY A;  1TQM A;  5M5X J;  1V4R A;  3ECO A;  3F8B A;  3K6G A;  5LRR A;  1YIO A;  4CYD A;  2L9V A;  4CXF A;  1VQ7 I;  2YR2 A;  3S2H J;  3IL2 A;  4S0H B;  4ETS A;  5J47 A;  2K27 A;  1MBG A;  1HDD C;  1LFP A;  4PGH A;  4BDY A;  3E3V A;  2R5Y A;  1U2W A;  5E3N A;  1LNW A;  3LSM A;  2VJ5 A;  4MO7 A;  3OWT A;  5D5V B;  3HOW J;  3RTR A;  1Z05 A;  3IP4 B;  2QSG X;  3SZG A;  1J59 A;  4YIR X;  3H5N A;  3JTH A;  3A2K A;  3D5S C;  1NTC A;  2Y75 A;  4HG2 A;  2BVM A;  1POG A;  2HDD A;  3F6V A;  1IRF A;  5KAF C;  4BEH B;  5IYC J;  3DKW A;  3F0C A;  3S1M J;  2IS4 A;  2XPU A;  1QO0 D;  4WCG A;  4RB1 A;  5L3C A;  2DMT A;  2IGO A;  5CVV A;  2AXL A;  2CS3 A;  4L18 B;  1EV7 A;  2M45 A;  1XTA A;  2VON A;  3I9V 2;  4XLC A;  5E79 C;  2P5V A;  5GAH J;  3WTT C;  4G7Z F;  3WGH A;  2KZG A;  1KYZ A;  5LHI A;  4Q4Z F;  4MGR A;  4B8X A;  1VI0 A;  4G94 A;  4UY8 I;  1W7P A;  3HM5 A;  2HGC A;  3QRF F;  1YFH A;  4FTH A;  4ENN A;  3N97 A;  2ELH A;  3FXL A;  3I59 B;  4BAC A;  2PN6 A;  1HC8 A;  4XKB A;  1XSD A;  3OYG A;  1P92 A;  5CYV A;  3W2V A;  4PJJ A;  1FNN A;  1DQU A;  3NEU A;  3WTZ A;  4DGW B;  2LK2 A;  3HOZ J;  1FP1 D;  2R5Y B;  4D1Q A;  3J80 Z;  1WFX A;  4IHW A;  4IKF A;  2LY1 A;  1NH3 A;  1S7A A;  4U0V A;  1Y0N A;  3NAU A;  2E7W A;  1J5Y A;  3GTL J;  2PJP A;  4ESF A;  2CYY A;  1ZRC A;  1AHD P;  2L2O A;  1UJ8 A;  1JTY A;  1ETK A;  2OU2 A;  1KA8 A;  1X3Z B;  1T8I A;  3BTC A;  2NVY J;  2VKD A;  3HSR A;  5AIQ A;  3H92 A;  1O3T A;  2XRO A;  4UB6 C;  5HLT A;  2DA3 A;  1U78 A;  1ZTR A;  1X2M A;  3FXR A;  3E6D A;  1YQA A;  2K9M A;  3WHC A;  2NOJ B;  4IRI A;  2HXO A;  1JGS A;  5GPC A;  3CD6 I;  3AG4 H;  1MSF C;  2Z33 A;  1W7P B;  2EZI A;  1XDS A;  4Q48 A;  2KP6 A;  1VQO I;  4B1R A;  2DLL A;  3CCQ I;  3GO5 A;  5ICC A;  1TT5 B;  1JKP C;  3HEF A;  3BR2 A;  2JUG A;  2P6S A;  4EJU A;  3OY9 A;  2KDZ A;  3FXU A;  3JW4 A;  3TP3 A;  3D5R C;  3REO A;  4CZZ A;  4I99 C;  3CCU I;  3PO2 J;  3DWL E;  3A0B C;  2M4G A;  1K83 J;  1YW9 A;  3K9T A;  3CCS I;  2DMP A;  4XLP F;  1K79 A;  1SAX A;  1SFO J;  1IN8 A;  2RGV A;  2IA2 A;  2JMW A;  2L7K A;  5EG0 A;  3JRC A;  4DYR A;  1EF4 A;  3DPU A;  2PMH A;  2H09 A;  2G7U A;  1K61 A;  2DA6 A;  1PDN C;  5M3M J;  3JRH A;  1IN5 A;  3N4M A;  5FKL A;  3CCV I;  2O7O A;  2FEZ A;  4C3I J;  4G8X A;  4HST A;  2FRH A;  4KUM A;  5HNH A;  2BXY A;  3NRV A;  2OPT A;  5E8I A;  3S32 A;  2CSO A;  2IEK A;  3I56 I;  4WXD A;  4CA0 A;  2LDU A;  3K70 D;  1LDJ A;  2I5U A;  1WQ2 A;  4PUS A;  1QBJ A;  1WH5 A;  3BJ6 A;  1MNM C;  3HRU A;  4Z2Y A;  1R5G A;  1BL0 A;  2DO7 A;  1YG2 A;  4C2T A;  4PSW A;  5DV5 A;  2P7C B;  2STW A;  1MMN A;  2A69 F;  4Y15 A;  2DT7 B;  1DPU A;  3ZXS A;  2DW4 A;  3GUD A;  2IA1 A;  2OAZ A;  3M8E A;  3O3K A;  5H2F C;  2DXI A;  3DU5 A;  3IWF A;  1LPQ A;  1OCT C;  3TO7 A;  5BOX A;  4Y3O A;  3KP3 A;  1WCM J;  1PUE E;  4U7B A;  1FPQ A;  5J1Y A;  2ZME A;  3ZQC A;  4NNJ A;  2MAB A;  4ON0 A;  1H9G A;  1IRZ A;  5L3E A;  4RB3 C;  4KN4 X;  3ERM A;  5F1J A;  2ZSI B;  2K02 A;  4RLF A;  2O9L A;  2L7F P;  2H8R A;  4MIM A;  1HSJ A;  4GRI A;  4QPO A;  5EG0 B;  2LH9 A;  2ZJQ F;  3AL0 C;  3G71 I;  2CUJ A;  4H0E A;  4KIG A;  4YII A;  4YIF A;  3OYC A;  4M9S A;  4HX8 A;  1F1Z A;  1S6L A;  2DA4 A;  2HZD A;  2R0Q C;  3OYA A;  2W82 A;  1ZRD A;  2OQG A;  3MKY B;  1UG2 A;  4BE1 A;  3ZQI A;  4GYI A;  1U8B A;  1O7L A;  4MTE A;  5K1Y A;  4YG2 F;  2LLK A;  1ZRF A;  3E6M A;  3CZ6 A;  1GVD A;  4AC0 A;  1EH7 A;  1RNL A;  1P7I A;  2DYS H;  2E1C A;  3LWF A;  2ELK A;  1BN5 A;  3KIO A;  1I3A A;  2DYR H;  2ICW G;  3AL0 B;  3PFI A;  2V9K A;  4PSX A;  3COA C;  2ZME C;  3BZ6 A;  2XVC A;  2ZC2 A;  3KP5 A;  3Q0U A;  3H9J A;  1J75 A;  2CQQ A;  1BJA A;  1R4M B;  2LG4 A;  3ISP A;  4QWQ A;  3BG9 A;  3ZQH A;  5LEJ A;  4CO8 A;  5JLW A;  4UNO A;  5KK1 A;  1IXR C;  2BW3 A;  2GWR A;  4O3M A;  4Y52 J;  1DP3 A;  2W48 A;  3G6E I;  4MFE A;  3HOV J;  5D5W B;  4A69 C;  3TQN A;  3GTM J;  1KQ0 A;  2TCT A;  1P9Q C;  5DYM A;  3T5X A;  3ZGK A;  2YU3 A;  3H0D A;  2VXD A;  2EIN H;  5IT9 K;  5ILV A;  1BBY A;  2YPR A;  4IX7 A;  5FKN A;  5CVR A;  2JK3 A;  2ZME B;  2XC7 A;  3Q0W A;  2LKX A;  1KON A;  2UXN A;  4NDL A;  2IA0 A;  1X4O A;  3RJP A;  2NVT J;  2WY8 Q;  5LGT A;  5D5U B;  4LLN A;  2RNJ A;  2Z2S B;  2NVQ J;  1OQY A;  5BMZ A;  2HQR A;  4II3 A;  3BG6 A;  3V8K A;  5ICG A;  3QPL A;  3L2R A;  2L4A A;  3DBL B;  3QWL A;  5EYR A;  4E70 A;  1E0E A;  3KET A;  2HVS A;  2ADU A;  3U1D A;  1IRG A;  3IWZ A;  1G3T A;  2STT A;  1BR2 A;  2CW0 F;  4J19 A;  1D3Y A;  1G3S A;  2CQN A;  3OYK A;  1KU3 A;  2MC4 A;  1FIP A;  4B44 A;  3F9K A;  1HBX G;  4KYW A;  2VJI A;  4DYQ A;  2LP0 A;  2MA3 A;  4PJN A;  1LQ1 A;  2Y31 A;  3QP6 A;  4L5E A;  1D0Z A;  1HDP A;  1U5T A;  3G1L A;  5ICE A;  3GW2 A;  4M74 A;  2HOT A;  1EKE A;  1UMQ A;  2XAS A;  2BW3 B;  4KT6 A;  5HLI A;  2G9W A;  5F0F A;  3DBH B;  5IYD J;  3FKI J;  4B3A A;  2EIL H;  4XSX F;  2YUS A;  4ZZD A;  1QPI A;  1ONV A;  2OTJ I;  2WV1 A;  2CV1 A;  4IEJ A;  5DUI A;  5J3L A;  1YO5 C;  2QQ9 A;  2OZU A;  1B6A A;  1YTY A;  3DKX A;  1BR4 A;  3HRM A;  4XLE A;  2BBY A;  4D5C A;  5B66 C;  3VPR A;  3L1P A;  3CP2 A;  2ACJ A;  5AON A;  2D5V A;  4IQ4 A;  3JRG A;  3H5A A;  1DU6 A;  3HKZ N;  2CFO A;  4HDV A;  1NHA A;  2PBI A;  4JOM A;  1PVE A;  1U5T C;  3H5R A;  1IN7 A;  1IZ1 A;  1ZK8 A;  4Y17 A;  4OAY A;  3WHB A;  4GFB A;  3DTK A;  1VF9 A;  2QYO A;  1D0X A;  3OOP A;  3QYB A;  4XRS G;  3J81 K;  2QLZ A;  1SD5 A;  1SFE A;  1ZGJ A;  2L9S A;  4HF0 A;  3K4L A;  4XRF A;  4S05 A;  2UV1 A;  2ZSH B;  2HWV A;  3H3V K;  1Z3X A;  1EH8 A;  5FKK A;  5CQE A;  2UXX A;  2A6E F;  2FXA A;  2XAH A;  3I55 I;  1QGP A;  1U5T B;  4QLC U;  1BI2 A;  3BLY A;  4LFU A;  5F27 A;  4BYY A;  3RKQ A;  2EZK A;  4ZDL A;  1O3R A;  3S93 A;  3C7J A;  1S72 I;  1YJW I;  2CV2 A;  3LA7 A;  1WJD A;  2WV0 A;  2M4K A;  1GT0 C;  3OOU A;  4XOT A;  4HQE A;  4XRM A;  2V1X A;  4JP0 A;  2JRT A;  3EUH A;  5IPA A;  5E17 F;  3F8C A;  1OMI A;  2M7B A;  4WXH A;  3RSN A;  4EAT A;  5EGO A;  1HKS A;  5GP9 A;  2LR8 A;  2V9V A;  3CJN A;  3G2B A;  5BPI A;  3VWB A;  3ZMZ A;  5LHG A;  4IRH A;  3LA2 A;  1I27 A;  1HW1 A;  3C3W A;  1QU3 A;  1W36 C;  5K5Q A;  1IUY A;  3BJA A;  2LBF A;  1JHF A;  4FE7 A;  3GTK J;  1IJW C;  2VJJ A;  2KJC A;  4HRI A;  1ETV A;  1MW7 A;  3HRS A;  2Q8K A;  1W1W E;  4D7N A;  2IRF G;  3SEZ A;  4J00 A;  1RPW A;  5HNF A;  3GTQ J;  2EB7 A;  1WJF A;  4EJW A;  2DOE A;  2XAU A;  5C4X J;  1Y1W J;  3HC7 A;  3RZO J;  3O2P E;  1TNT A;  3V4G A;  3EUH C;  2V1U A;  4CCN A;  4IJA A;  3K4N A;  2DPU A;  1GV2 A;  3O8H A;  2LFB A;  5GTI C;  2VKE A;  1ETW A;  4LLL A;  1FYM A;  2KIU A;  3NWS A;  2EV0 A;  1XSX A;  2K3F A;  1T33 A;  2OCE A;  5K7F A;  2LYC A;  1JJ6 C;  1W5S A;  3I64 A;  1J9I A;  1YIT I;  9ANT A;  3E97 A;  3PQJ A;  2QQA A;  2MFZ A;  2DI3 A;  5TJJ A;  1T98 A;  4BU2 A;  1GV5 A;  1TW2 A;  3IC7 A;  5C4J J;  1R1U A;  2EA4 A;  3DU6 A;  2Q1Z B;  3OSG A;  5EGO B;  2GAU A;  1W4M A;  1T38 A;  5D4R A;  2KIM A;  2Y0M A;  2AQF A;  4AM3 A;  2DFI A;  4LIV A;  2X6Y A;  1Y0U A;  2IS6 A;  1BI1 A;  4XLF A;  3RDI A;  3OYL A;  4XK4 A;  4E7K A;  4PJM A;  3H9G A;  2DJI A;  2R7U A;  3K1N A;  4GCV A;  4XLN F;  2P7V B;  5HVQ C;  2LTP A;  5FRM A;  4EJT A;  3BPX A;  3K1P A;  3B6A A;  2HU9 A;  2B9S A;  1MMA A;  2R7O A;  1OCO H;  1QZY A;  4XBF A;  3F8F A;  3BQY A;  4FCY A;  2B7E A;  1F36 A;  2COB A;  3HRT A;  1R5I D;  1YW7 A;  4N4N B;  2CO5 A;  3GWZ A;  4CHU A;  1J7K A;  5J1R A;  4PZJ A;  1H0M A;  2L01 A;  4FT8 A;  1WHU A;  2JPC A;  4UXN A;  4QTR A;  3K2A A;  1YX3 A;  2LRD A;  1B72 B;  2R7T A;  2E5Z A;  1MH3 A;  2JTV A;  3ONQ A;  1KZH A;  5JFR A;  4LLG F;  2BYV E;  2IJL A;  1T08 B;  3VOD A;  1DP7 P;  4DJA A;  4I0A A;  2ME6 A;  3I5U A;  2ETH A;  1TWC J;  2CUE A;  1MBJ A;  3VFZ A;  1JUS A;  5C44 J;  2PQ8 A;  3L2U A;  2B63 J;  3JSO A;  4XQF A;  2YU9 J;  3HKZ A;  3GFL A;  2M30 A;  1ETO A;  4LK1 F;  5IOY A;  1D1A A;  2EZL A;  3QYF A;  3VSL A;  1IDY A;  2QQ8 A;  3KYD B;  1FOK A;  3V7C A;  3VYS B;  4CGZ A;  3U9G A;  1A35 A;  2V6E A;  1IO2 A;  4K2E A;  4IHT A;  4ESB A;  2L9R A;  2JN6 A;  5EF6 A;  2GZW A;  3F22 A;  5KCM A;  4OIR F;  2XHK A;  3BG7 A;  3A0H C;  2JA2 A;  4M9Z A;  3IAS 2;  4HEA 2;  2VBW A;  3FM5 A;  1R6R A;  1MD0 A;  4CUG A;  2R3S A;  4JX4 A;  1ZG1 A;  2NS0 A;  4AVZ A;  1STZ A;  3S1R J;  3I58 A;  2O8K A;  2X6O A;  4EV0 A;  2ZBK A;  3FBN B;  3BR0 A;  5EDN A;  2XRN A;  2V26 A;  1JGG A;  1OIS A;  2O5R A;  4KN7 X;  1Z67 A;  2X51 A;  3LNQ A;  2ZJR F;  4R1H A;  4HZF A;  5DM7 F;  1BW6 A;  3BCB A;  1FX7 A;  4DZJ A;  5HDK A;  5TIS C;  3FWE A;  3H35 A;  2OF7 A;  2GIV A;  3CDL A;  2R93 J;  2HKO A;  3CJT B;  2DT5 A;  3MZY A;  4A0Z A;  4B09 A;  3H36 A;  4U0W A;  3F3X A;  2AS5 F;  1R9T J;  1BI0 A;  5J1U A;  3FIW A;  1NK2 P;  1B9M A;  2EFP A;  4JYK A;  5CVI A;  3TDZ C;  3QPT A;  4KIT B;  1QPM A;  5DUK A;  1V5F A;  2K4J A;  2EV6 A;  3CDH A;  2G7H A;  2E35 A;  2ZKZ A;  1G59 A;  1ERD A;  3PO3 J;  2K86 A;  3WU2 C;  2R5Z A;  2MLK A;  1AKH A;  4B3X A;  4XON A;  3PQK A;  3I53 A;  1OJL A;  1Z6R A;  2W57 A;  2VE8 A;  2A05 A;  3EUA A;  4BE2 A;  4ENK A;  4IQJ A;  4MEX F;  3HZJ A;  2DTR A;  3A03 A;  3H0G J;  4M3G A;  5GTH C;  3WOD F;  2DMU A;  3RZD J;  1V5E A;  2DFH A;  1SFU A;  2XKP A;  3C2B A;  2M8E A;  5KNL A;  4BDZ A;  2O3F A;  4A0X A;  3HOX J;  1S7E A;  4DZP A;  1OCC H;  4E7S A;  3WTU C;  1S8N A;  1QVU A;  4UVA A;  1VQL I;  5ILS A;  2IS1 A;  2HQA A;  2VPL A;  1H88 C;  3Q0V A;  2GXG A;  2QF7 A;  2X1D A;  3RQ4 A;  2DMQ A;  2CW7 A;  1UZC A;  2XIG A;  1L0O C;  2RAE A;  3Q5F A;  2ELJ A;  3BTI A;  5FLX Z;  4RM3 A;  3OYE A;  3GVA A;  4FQG A;  4KT5 C;  1A31 A;  3S1Q J;  1A6I A;  4HDU A;  4HYE A;  5ERI A;  3ZQQ A;  2AQE A;  3RYR A;  1JKQ C;  3A01 A;  2GLO A;  4CCK A;  1AOY A;  5K7Z A;  5FLM J;  1U0J A;  3FMQ A;  2BY1 A;  2H1L A;  2M8G X;  3E0J B;  3M4O J;  1TZL A;  3W2A A;  4HF2 A;  3T8T A;  5EZG A;  4LIT A;  1I1S A;  3BG3 A;  5A2Q K;  2EBI A;  2K3P A;  3HJE A;  4BGD A;  3L2V A;  3AKZ A;  2QCO A;  4HV5 A;  4X0G A;  2QKL B;  5FRN A;  2KL4 A;  1YI2 I;  4FE4 A;  1LVA A;  2R5Z B;  4I76 A;  4G9Y A;  3ASN H;  4AIK A;  1AKH B;  4GGG A;  1WSU A;  2O03 A;  1BA5 A;  3G1M A;  2NXN B;  3E6C C;  2PLY A;  4L5J A;  3MZ8 A;  3FK6 A;  3J81 Z;  3ML6 A;  2RV8 A;  4A93 J;  2DQL A;  2ESH A;  5JLX A;  4RAG A;  2VJ4 A;  5CVJ A;  3S17 J;  1J09 A;  4BH9 A;  1R49 A;  2F5E A;  2JVG A;  3E1S A;  3CMY A;  5F64 A;  1JT6 A;  1P4X A;  3HOS A;  3CJQ B;  2F5D A;  4GO1 A;  1FOX A;  1K6Y A;  2RDP A;  4BNC A;  3M9A A;  5F0H A;  4V19 K;  1D1B A;  1D8K A;  2ID6 A;  3G4S I;  2P6T A;  1ZN2 A;  2R7S A;  1PYV A;  4V2G A;  2KLO A;  1GUU A;  2OC6 A;  4XNF A;  2EK5 A;  4DIQ A;  2W7N A;  4LIU A;  5DCF A;  5LGN A;  1OCP A;  2FML A;  1ZRE A;  2H6B A;  3ZMT A;  1ZLJ A;  4DNC A;  3A01 B;  3DF8 A;  1FJL A;  3QPH A;  2X9D A;  1AA7 A;  1ORK A;  3BZK A;  5F0C A;  1YLF A;  3HHH A;  1O3S A;  1W7P D;  2PMZ A;  3BR5 A;  3FHZ A;  2ECB A;  3HG9 A;  4BQO A;  2ESN A;  3L2W A;  3DCF A;  4EM2 A;  1JT0 A;  4MHG A;  4RAF A;  3KCC A;  2ZNZ A;  3I4N J;  2VUM J;  1Z7L A;  1Y56 A;  1WJC A;  2YX7 A;  1Y8Q B;  3SHF A;  4F52 A;  1L3L A;  3SFI A;  1UFM A;  3LL7 A;  1PUF A;  3VEP A;  2VE9 A;  3U21 A;  5B3S H;  4PFP A;  2Q0O A;  4RAY A;  5D6F A;  1D0Y A;  3PUF A;  4P55 A;  1RR7 A;  4AD9 A;  2KPM A;  3SZP A;  4EGY A;  1Q1V A;  2WC2 A;  1ULY A;  4M3F A;  2LY2 A;  1VQ4 I;  4O5V A;  5LHH A;  1XB4 A;  1XCV A;  2FA5 A;  2H94 A;  1S9H A;  4QPQ A;  2OV7 A;  2QM3 A;  1K7A A;  1KQ9 A;  1OFC X;  4X6A J;  2L7M P;  4NUB A;  2BY3 A;  3CTA A;  4OIN F;  4QSH A;  4A3D J;  3E6B A;  3QQA A;  4F3Q A;  5J4V A;  5TRD A;  2FBI A;  2ZFW A;  2QWW A;  2BZT A;  4I7H A;  2R92 J;  5DD8 A;  2Y0S A;  2QZ8 A;  3DKY A;  4DBQ A;  2ECC A;  1TL8 A;  2H6C A;  5FRO A;  2V79 A;  4X1E A;  1OYW A;  1FLI A;  2HS5 A;  2HDC A;  3T8R A;  3PIP F;  1ZLK A;  2LKS A;  3P9I A;  5B1A H;  4L9N A;  4ZZL A;  2OJE D;  3DXJ F;  3ZMD A;  1IRX A;  3BRO A;  3I54 A;  1PUF B;  4I6Z A;  2HDW A;  3SEQ A;  2KT0 A;  3MFK A;  1R1T A;  5L3D A;  3K2Z A;  4IVN A;  3OR1 C;  1OCZ H;  2F5C A;  1NG6 A;  1VQN I;  2OA4 A;  4F91 B;  2E1M C;  2EFW A;  2JVH A;  2DA7 A;  2J5O A;  5AIP A;  3ABT A;  2PG4 A;  2HKX A;  4A3K J;  4EQQ A;  4RGX A;  5J40 A;  4ENM A;  2CG4 A;  3BOQ A;  3ABU A;  5FD5 A;  3BC8 A;  1FY7 A;  3TW6 A;  3TO6 A;  4EVI A;  3FX3 A;  5LD2 C;  2MD5 A;  1VQ8 I;  2A5W A;  3LFK A;  4RAZ A;  2E60 A;  3PSF A;  4A6D A;  3W6V A;  3M8F A;  1YYV A;  4NBQ A;  2Z9O A;  4G6D A;  3FMR A;  1JUM A;  3M3Y J;  2FX0 A;  1BC7 C;  2E1M B;  4AU7 A;  1P7J A;  1WKM A;  2H1K A;  4PJ0 C;  1W0T A;  2WBM A;  4MEY F;  3OYN A;  1X1A A;  1X3U A;  2OTL I;  4LJZ F;  1JHH A;  2L54 A;  3DTI A;  4U88 A;  4E7L A;  3R0J A;  1TQI A;  4CSW A;  3MKZ A;  1VQP I;  5E1Z B;  2FD5 A;  2LSO A;  2QEN A;  1JKR C;  2E1O A;  1VQ6 I;  3N05 A;  4FIS A;  2W24 A;  4CIC A;  2ZXH A;  1R7J A;  3HSF A;  2X0L A;  3J7A O;  1MJA A;  1MMD A;  2KIS A;  4A3L J;  1JJ8 C;  5H6R A;  1MZB A;  1A36 A;  1RKT A;  2DBB A;  4RM2 A;  3H3Z A;  1WZ2 A;  1X4P A;  2Y48 A;  1ZG5 A;  4A3G J;  2MD0 A;  3IKV A;  2JA5 J;  1BOB A;  1TLH B;  1IV8 A;  1I6H J;  1Z6T A;  2VIX A;  4L5I A;  1HXD A;  2XAG A;  4JX5 A;  2DOA A;  1N78 A;  3MWM A;  2DA5 A;  2HTS A;  4HQM A;  1IDZ A;  4LGW A;  2VBX A;  1FTZ A;  3K4B A;  3FF5 A;  3CUO A;  3S2W A;  2JA7 J;  5DCM A;  2A61 A;  3K4K A;  3OL4 A;  3SYT A;  3GYH X;  1TP4 A;  4H4K C;  2F6C A;  2H27 A;  1FMW A;  3CCJ I;  1RC9 A;  5LRS A;  5F04 A;  3JAM K;  4IHV A;  4A5N A;  4XMY A;  1PJR A;  3E5U A;  3Q9V A;  4A3I J;  3IH3 A;  4BJT A;  1J0R A;  1SEU A;  5JVG F;  3DV8 A;  1D5V A;  4WWC A;  1HLV A;  2HPM A;  1R22 A;  2CJJ A;  4R79 A;  1E3H A;  1DGR M;  2F4O B;  3JSP A;  2FNA A;  3F72 A;  2GXB A;  4EM1 A;  1B8I A;  4F93 B;  3I3L A;  2EJR A;  1LFU P;  1E3O C;  3MCZ A;  4GXO A;  3J7Z I;  1UST A;  2ZXI A;  4KIB A;  2ZJ2 A;  4RB0 A;  2A07 F;  1WGX A;  5J8C A;  1OR7 A;  1UCR A;  3BTL A;  2HYJ A;  4G12 A;  1LEA A;  4HLX A;  2NAZ A;  2V6C A;  3KP2 A;  1WH7 A;  2E2H J;  3CC4 I;  2N8G A;  2PFB A;  3J7A Y;  4B4C A;  5HLH A;  5HS9 A;  2VKH A;  2FF4 A;  3OIO A;  2F4M B;  1IC8 A;  4NC7 A;  4KMF A;  2WAQ N;  1XC5 A;  1XPX A;  3TDU C;  5D5X B;  2KJB A;  1RI7 A;  2CQK A;  3S16 J;  1XS9 A;  1YS7 A;  4C2M J;  1EA3 A;  4HX7 A;  4LG0 A;  2DDA A;  2L0K A;  5DCM B;  5CJ9 A;  3P7N A;  2XKO A;  1I39 A;  5B5E C;  4G7H F;  2R7W A;  3HUG A;  2KIQ A;  2IAI A;  5LFA A;  2VBZ A;  1QNT A;  3K7A J;  3TMO A;  5TGT A;  1GXQ A;  1OR7 C;  4HOB A;  4UUS A;  3CCR I;  4DYC A;  3ZOB A;  2L02 A;  3MD2 A;  3EET A;  4EJO A;  1BOA A;  2DFE A;  3GBG A;  2M3A A;  3R4K A;  1DDN A;  1CF7 A;  1T39 A;  2LRE A;  2QVO A;  4A3F J;  1S5L C;  1SVL A;  3AG1 H;  2WAE A;  3GZN B;  3HL2 A;  4C3J J;  3BDD A;  4EM0 B;  2XB0 X;  3PNV A;  5DS9 A;  3ZMS A;  3S8P A;  3CC7 I;  5E3O A;  3AAF A;  1S7O A;  3L00 A;  2Q2E A;  3GCM A;  4GYG A;  1G3W A;  2RRE A;  4BXU A;  1AWC A;  3KEO A;  3FXJ A;  2IW5 A;  2P5K A;  1N25 A;  3L2C A;  1GLN A;  2EWN A;  1NG7 A;  4E4H A;  4JQF A;  1XX5 A;  4FAS D;  1IW7 F;  4UV9 A;  3I0T A;  3FXK A;  4G7O F;  2LKP A;  2WB1 N;  2BEO A;  4LD5 A;  3B02 A;  4HNU A;  3G3Z A;  2HOE A;  4RDU A;  1U8R A;  3RCO A;  3F23 A;  3HOU J;  1FYL A;  3VYR B;  2CFX A;  1W36 D;  2IBD A;  4LG0 B;  2GA1 A;  2X6X A;  4IOC F;  2EIJ H;  3GTO J;  3TKY A;  2OD5 A;  5E8G A;  3W6K B;  1XMK A;  1ZYR F;  2W1O A;  3HUG B;  3DLL F;  2JA8 J;  3S2D J;  2CRG A;  4UV8 A;  1YIJ I;  3F8N A;  1IG7 A;  5BS6 A;  4M3D A;  1JXS A;  1MBF A;  2M5W A;  5HLG A;  2O0Y A;  4UUS B;  4RGU A;  2J5P A;  1FSE A;  2KRF A;  4PK4 A;  2L4M A;  2YSR A;  4JBA A;  4PGG A;  4HA8 A;  4PFO A;  3L9F A;  3RKY A;  3JRD A;  4ZTJ A;  1CF7 B;  4RA2 A;  1SAN A;  4L9J A;  4XLH A;  2R4G A;  1Z0X A;  2Z3Y A;  1JUP A;  3C2G A;  6PAX A;  2W85 A;  4E7H A;  4BJ6 C;  2XF6 A;  1HA8 A;  2GQQ A;  2ZCW A;  1Z9C A;  2LY9 A;  5H20 A;  2JZY A;  2VT2 A;  1XG1 A;  5JR3 A;  5EEA A;  3OYB A;  4YEJ A;  3CCE I;  3ESW B;  2VQH A;  3PNT A;  5KHD A;  4AIH A;  4C9Y A;  1ZGA A;  5LBQ A;  1QA6 A;  3KP7 A;  3TOB A;  2OBP A;  2VN2 A;  3TED A;  5FO5 A;  3FBI B;  3E5X A;  3IAM 2;  2NS7 A;  3SDG A;  4XKW A;  2GA2 A;  3CF2 A;  2DCE A;  3V8L A;  1X19 A;  2JSC A;  3KE2 A;  3D1N I;  1R71 A;  4I0B A;  2FOW A;  2UUZ A;  1ON1 A;  3V7S A;  2P8T A;  2HNH A;  2MH9 A;  2D45 A;  2DTZ A;  2DA2 A;  3HOY J;  3V7R A;  2RNG A;  1MJ9 A;  5FFX A;  2HFH A;  2AHQ A;  1IXC A;  3BY6 A;  1BIA A;  2V4J C;  2DPD A;  4DBR A;  1K4T A;  5DM6 F;  3IRQ A;  3BWG A;  2JWT A;  2DMN A;  2LD5 A;  2BGC A;  2O61 A;  4Q47 A;  2WA0 A;  2HI3 A;  3B73 A;  2LBF B;  3GZ6 A;  3C18 A;  4UUT A;  4PCQ A;  3A1Y A;  1APL C;  4YFX F;  5K5O A;  2M0M A;  3AG2 H;  4CYC A;  3R61 A;  2GBY A;  1CQT A;  1ZAR A;  4KNY A;  4IOA F;  4ZYE A;  1FSH A;  2GOM A;  3KEY A;  4I98 B;  3UR3 C;  2HVQ A;  4L0Y B;  3OYI A;  3BQZ A;  3CDI A;  4ZYH A;  1SAU A;  5D4S A;  3AG3 H;  1LVK A;  2XGC A;  5FFZ A;  3HOT A;  4ZYA A;  1CGP A;  2HEO A;  1K6O A;  1Z3Y A;  4MTD A;  1ENH A;  2AO9 A;  4LOC A;  4KIF A;  3WE3 A;  3CCL I;  1YJN I;  4KIS A;  1ZQ3 P;  3LSJ A;  1IUF A;  4M6X A;  3JRB A;  1X1B A;  4XN0 A;  1Y39 A;  1YE9 A;  1KYW A;  1D1C A;  1V55 H;  1S3J A;  3OV8 A;  1QHH D;  1R4N B;  3VYU B;  1VTN C;  2OZ6 A;  3K69 A;  4M3B A;  2PI0 A;  2MGQ A;  5LGU A;  2K85 A;  2A3S A;  3LQR A;  1P2F A;  5LLQ A;  4BJ5 C;  1O3Q A;  5BPD A;  1Z77 A;  1FWZ A;  1K78 A;  2BY0 A;  2QGU A;  3S15 J;  2Y9Z A;  4I09 A;  2IT0 A;  2MSY A;  3OYD A;  4XRS A;  3R60 A;  3QAH A;  2CW8 A;  4BHC A;  3CME I;  4CYC B;  3HSE A;  3W3C A;  2IP2 A;  2ZXW H;  1JE8 A;  2F5F A;  4F55 A;  1GHC A;  3KFW X;  3ZN0 A;  5EZH A;  4EJV A;  3LQQ A;  2L7Z A;  2E71 A;  3HYI A;  2E2I J;  4S04 A;  4IO9 F;  3C1D A;  2OCC H;  4HX4 A;  1Y8R B;  5IT9 Z;  1ITY A;  4I2O A;  3KYC B;  3GTJ J;  1LE8 A;  3HIF A;  2NVU B;  1RZ4 A;  3OYF A;  3PL8 A;  3RPQ A;  2KMU A;  1SC7 A;  3BP8 A;  2A68 F;  4CCJ A;  3BZC A;  2RC4 A;  1P4A A;  3ZCO A;  4CCM A;  2LVS A;  1SFX A;  2CUZ A;  2M87 A;  2XAQ A;  2CU7 A;  3T1B A;  4J01 A;  4JK1 X;  1HF0 A;  1KQ8 A;  1ACI A;  5E3L A;  4ANJ A;  2R7F A;  4BHB A;  1X1C A;  3IKT A;  4NC6 A;  2JSP A;  1MBE A;  1KGS A;  3QU3 A;  2EQR A;  1MBK A;  5CVU A;  4F7Z A;  1TQP A;  2VXZ A;  2DFF A;  2EFN A;  3DFG A;  4HAM A;  4Q5S F;  3FXQ A;  5L3F A;  3ABL H;  3A02 A;  5DEQ A;  3VYT B;  2IVM A;  2VT3 A;  1XN7 A;  4AID A;  1K78 B;  2ZB9 A;  4N9I A;  1MIJ A;  3ZR8 X;  3CJR B;  4HLY A;  2P0W A;  1ETQ A;  3SJM A;  3V8J A;  4LB5 A;  5K5R A;  1QQI A;  5DDG A;  4I01 A;  2M7A A;  5JVT A;  2XRL A;  1RUO A;  3BR6 A;  4FET A;  3TW7 A;  4XM3 A;  1RET A;  3FDY A;  1YX5 A;  2BE5 F;  2JRM A;  5H6Q A;  1OKR A;  3BCA A;  3DEW A;  2EZH A;  1PP8 F;  2EFQ A;  1UHM A;  5L3G A;  3M7G A;  1O4X A;  4MQ9 F;  5IYB J;  1Z7U A;  3ZQG A;  3MKW B;  4IRG A;  4MFD A;  4ZC3 A;  2HPI A;  4A3J J;  1MMG A;  1VZ0 A;  4KA4 A;  1SMT A;  2VQG A;  5FKM A;  5GAE J;  3LAJ A;  2M9H A;  3V42 A;  3BG5 A;  3P5J A;  1X2N A;  1LE8 B;  1B59 A;  2B0L A;  1G6N A;  3SFZ A;  4AUX A;  1IGN A;  2F5V A;  3S3O A;  2VL8 A;  2X4H A;  3RPU A;  5ILU A;  5FJ8 J;  3LSP A;  3DEE A;  3HBL A;  5IT3 A;  2NYX A;  1K4S A;  1GDT A;  3PJR A;  2XF7 A;  2P4W A;  3I59 A;  2XAF A;  2X6W A;  4XOP A;  1IN6 A;  2DDB A;  3ZRG A;  2VC0 A;  5FKO A;  1MDM A;  1DPR A;  1Q1H A;  3GLL A;  3HGG A;  5LEK A;  3TOA A;  3W2W A;  2GM4 A;  1QZE A;  3QPS A;  3SZT A;  5GAD J;  1ZH5 A;  1XD7 A;  1LFB A;  2AXT C;  2W84 A;  3KPH A;  5L3B A;  3EUK L;  4XL9 A;  2GOX B;  3EDP A;  4BXF A;  1UAA A;  1T56 A;  3C2H A;  2FJ1 A;  3PFY A;  3RPU D;  1XMX A;  4Z6Y A;  4UB8 C;  3K1M A;  1XSV A;  2HOS A;  1WJB A;  2FOK A;  3GFJ A;  4XSZ F;  5IP7 J;  4JX6 A;  3S1N J;  1R58 A;  3PSI A;  4HSR A;  3QOE A;  3TGN A;  4ZH4 F;  5JI6 A;  2O6G E;  3MEX A;  2IGM A;  3EYI A;  4HNT A;  2NRA C;  1LB2 A;  3HHG A;  5E18 F;  1MND A;  4ZYD A;  2RN7 A;  2DK8 A;  3D0S A;  3VOE A;  1JTX A;  2QSF X;  4CZC A;  1BR1 A;  1F43 A;  2K5C A;  1FTT A;  2RKH A;  1IV6 A;  3CC2 I;  2L9N A;  2R7Z J;  2DQR A;  4HBL A;  2Y9Y A;  1OLT A;  1ON2 A;  1U3E M;  1RRJ A;  3MMY B;  1VQM I;  4AIJ A;  2X1C A;  3MQ0 A;  4HW0 A;  4M6V A;  3CLQ A;  2RQQ A;  4B48 A;  2WWY A;  4M73 A;  2ME0 A;  4P96 A;  1TWF J;  2VOP A;  1WWX A;  2TDX A;  3QOP A;  3O6B B;  3QOD A;  5DD4 A;  5K7H A;  3O8G A;  3H1C A;  3JTG A;  4KJZ A;  2QBY A;  4BAY A;  4IPA A;  2QKM B;  2HOA A;  3UNG C;  5EEH A;  1MDM B;  1E2X A;  2P5L C;  3MN2 A;  4CCO A;  5D6E A;  2CUF A;  3GF2 A;  4BHP A;  1MJB A;  4RBO A;  5EJC A;  2Y69 H;  5E20 A;  1C0W A;  2XAJ A;  3EQL F;  2E34 A;  4W97 A;  2FSW A;  3ELK A;  3L7W A;  3MVP A;  5FLV A;  1GXP A;  1G4D A;  4M3E A;  3ZQ7 A;  2Z16 A;  1WVR A;  3BTJ A;  3DTE A;  3M1E A;  1X1D A;  3FXM A;  3RQI A;  4DOZ A;  4IF4 A;  1YJ9 I;  3KLN A;  1SMY F;  1OPC A;  4LG3 A;  1IAW A;  2E1N A;  3K10 A;  2E36 A;  3PUB A;  1WJA A;  5E1X A;  2VB6 A;  3TL4 X;  1W0U A;  2DJN A;  3U2R A;  4IHX A;  3ABK H;  3ROU A;  1KU2 A;  2ISZ A;  2EIM H;  4Y7N J;  1TWH J;  3NAR A;  2K4B A;  1D5Y A;  5CPR B;  4P9F A;  1SD6 A;  1HKQ A;  4U7D A;  5EEG A;  3JR9 A;  2DOD A;  3B6C A;  3LAP A;  2C6Y A;  1B4A A;  1R5H A;  2KRH A;  3DP7 A;  2QBY B;  3ECH A;  3VB2 A;  4WX9 A;  1LDD A;  4BL0 B;  4EGZ A;  2XDV A;  1XGM A;  4Y13 A;  2IGN A;  5FGM A;  1B1B A;  4HNV A;  1PP7 U;  3JRI A;  1F9N A;  1EJ9 A;  4E7I A;  5E1W A;  2Y30 A;  3ZMU A;  2R7Q A;  2KIF A;  2FU4 A;  2IXS A;  2IS2 A;  2K40 A;  2UWM A;  3LSG A;  2DU9 A;  3NWT A;  1MGT A;  2JJ7 A;  3W6J B;  1QVT A;  3H3U A;  3ZMV A;  1MMS A;  2HYG D;  2E7X A;  2A6H F;  5IOZ A;  4WXC A;  3DLA A;  1HKT A;  3PIO F;  3Q9S A;  2LMD A;  1R1V A;  5IY5 H;  1RIO H;  3HXL A;  5BQT A;  1P4W A;  1I3Q J;  2RQP A;  1R00 A;  2L3D A;  4M72 A;  1I1G A;  3BJO A;  3QYE A;  3KZZ A;  4BUP A;  1R23 A;  2I10 A;  1ZR2 A;  1W5C C;  3UKG A;  5HOD A;  4RS8 A;  2XSD C;  1GVJ A;  1FT9 A;  5ED4 A;  1SVO A;  3MAJ A;  3R0A A;  2PMU A;  5M5W J;  1TC3 C;  2H8W A;  1Y6I A;  3BT9 A;  4RMN A;  4YRV A;  3AFH A;  3RKW A;  1VQ9 I;  3K70 C;  1DU0 A;  4C3H J;  1T95 A;  3KLO A;  4E7Z A;  3FZV A;  2XUB A;  2GIZ A;  1BC8 C;  1KU9 A;  2PJR A;  2VC1 A;  3F8M A;  5ICF A;  2BVL A;  2Z5U A;  2F2E A;  4FX0 A;  1FMV A;  2JPB A;  3HPG A;  3CP8 A;  4C2U A;  5CQG A;  3OS2 A;  3CQZ J;  1A6Q A;  2I8D A;  4RLQ A;  3IUO A;  3ZQL A;  4BQA A;  1BI3 A;  2W4S A;  4C30 A;  4MNU A;  1EH6 A;  3BR3 A;  3K4J A;  3KZY A;  2CH0 A;  3G1O A;  5DTD A;  1BW5 A;  1BIB A;  2E19 A;  3WU0 A;  4LMY A;  4QIW N;  2WTE A;  2NNY A;  2HXI A;  3Q3S A;  1HCR A;  2VOD A;  1J2X A;  1YHQ I;  3OS0 A;  3GX4 X;  2KKO A;  4ABZ A;  3WTY C;  1NK3 P;  4ZYG A;  2HTJ A;  3CCY A;  1USS A;  4XOR A;  4I02 A;  1WI3 A;  3GZ5 A;  4D9J A;  1FBQ A;  2BY2 A;  1TTY A;  3TBI A;  3LSI A;  1E3P A;  3LSH A;  3OYJ A;  2CGP A;  1UB9 A;  3FK7 A;  3RIR A;  1RKW A;  3HPH A;  3A4C A;  4E6K G;  4NQW A;  2EA2 A;  5KVR A;  2BHY A;  4RGS A;  1XMA A;  2V9P A;  3JCU C;  1XGO A;  3GFI A;  4A6E A;  2KFD A;  5F1R A;  3T0Y A;  2EIK H;  4BY7 J;  2PJR B;  4ITV A;  3LMM A;  1G8X A;  1ODD A;  4GDF A;  3EYY A;  3FHN A;  1VFC A;  2OQR A;  4YFN F;  4L9V A;  2DAO A;  1RR8 C;  1A5J A;  3OYH A;  2CMP A;  2ID3 A;  1Y1V J;  2DA1 A;  2M0C A;  4EEF G;  2Z99 A;  2QEX I;  3KP6 A;  2ZJP F;  4ENJ A;  3IH2 A;  2X85 A;  2CWE A;  1G3Y A;  4ZDP A;  3P9C A;  3CMA I;  2ZNY A;  2FNP A;  3HTU A;  5A2Q Z;  1VQK I;  2R7X A;  1SD4 A;  1YRN A;  4N4O B;  1OYI A;  3RYP A;  5HS7 A;  5M3F J;  3U1K A;  3DQV C;  2K9Q A;  3PM1 A;  4A3B J;  2DT6 A;  1BJZ A;  3M07 A;  3GEZ A;  3WTX C;  4UVB A;  1FZP B;  1LJ9 A;  1U9N A;  1REP C;  4PDK A;  1WPK A;  1TW3 A;  4FX4 A;  4UVC A;  1FOY A;  3JRE A;  5JHU A;  4ASN A;  1MH4 A;  2LF8 A;  4A3M J;  1FOW A;  2EV5 A;  2K9N A;  1O7F A;  2PX9 A;  5IP6 A;  3LOC A;  4IXA A;  3K4M A;  1SFK A;  3P9K A;  4NQW B;  4OIQ F;  3GTG J;  2XSJ C;  4BE0 A;  1IF1 A;  3OMY A;  2QQB A;  3K0L A;  4B43 A;  3L2Q A;  3TP0 A;  2X1E A;  2NVX J;  4P1W A;  1TWA J;  4OWR B;  4BBS J;  2X48 A;  3IRR A;  3CUQ A;  1AU7 A;  2M2E A;  4MLO A;  1I50 J;  5FLX K;  3JRF A;  2VKV A;  4BY1 J;  1XGS A;  1XDU A;  2MBF A;  3WE2 A;  4DW6 A;  1B8I B;  4ZTF A;  1TBX A;  3BPV A;  3CO7 C;  4BKX A;  4WK8 F;  1UEL B;  3I71 A;  4F92 B;  3WTS C;  1ZEL A;  1W5T A;  4IHY A;  3SDB A;  3S3M A;  1UHS A;  4BQQ A;  2R7R A;  2CQX A;  3CO6 C;  2NNN A;  2D1V A;  5JHF A;  4IL6 C;  1TNS A;  3OYM A;  3MZH A;  2WY7 Q;  3ZQF A;  4ZDO A;  2W00 A;  2DN0 A;  1I6X A;  3M1C A;  1A04 A;  1RES A;  2WAF A;  1YRN B;  1ETY A;  1MBH A;  4YFK F;  3FIS A;  3DPT A;  3OS1 A;  3KP4 A;  3CUQ C;  2G0E A;  1FBS A;  4BS9 A;  5HDG A;  3OIQ A;  2FQ3 A;  2MH2 A;  3X2Q H;  3IV5 A;  5J6X A;  2COM A;  2OUM A;  2YS9 A;  2V1D A;  4DQ2 A;  1ZAO A;  1LEB A; 
#chains in the Genus database with same CATH homology
 2HQN A;  1HQC A;  4LK0 F;  3FM3 A;  3WG9 A;  1IXS B;  5HOO A;  2QUF A;  1HST A;  3CUQ B;  5FB2 A;  2MLG A;  1R36 A;  1RUN A;  3D5L A;  2VBY A;  1WRJ A;  4UUV A;  4ESJ A;  2HZT A;  1FC3 A;  1T2K A;  3J80 K;  4KDP A;  1LDK B;  3NQO A;  1E17 A;  3TO9 A;  1T0F A;  3KEQ A;  4RB2 C;  1S29 A;  2R7D A;  2ZO4 A;  2LNB A;  3WGI A;  2DK5 A;  3LST A;  1XCB A;  4CDG A;  4M6Y A;  3QU6 A;  1WI9 A;  3IHU A;  2IPQ X;  2HR3 A;  3GXO A;  4KMU X;  1FYK A;  3GLX A;  4A12 A;  2JT1 A;  2HYF A;  3SXY A;  4A2U A;  4AVP A;  2W25 A;  4HV6 A;  4FHT A;  4N9H A;  4P9U A;  3ULQ B;  4KFC A;  2FMY A;  4AWX B;  1HW2 A;  1YS6 A;  3FMS A;  3DPL C;  4HF1 A;  3LA3 A;  1BM9 A;  5D8L B;  2ZXJ A;  2ISY A;  4M9X A;  4U0Y A;  4OOI A;  1I5Z A;  3WGG A;  1QZZ A;  2LF7 A;  4G6Q A;  3G73 A;  1KU7 A;  1FBU A;  5HS8 A;  4OU0 A;  5F6F A;  1F4K A;  2FBH A;  3GFM A;  4TV7 A;  3RI4 A;  5CLS A;  1UHW A;  2K7L A;  2MC3 A;  4D0P A;  2M1B A;  4L0Z B;  5D8K B;  3ZP5 A;  3ERE D;  2A5Y B;  2D2W A;  4OMZ A;  3QP5 A;  4NB5 A;  4NHJ A;  3SQN A;  4P5O A;  2D1H A;  3ZPL A;  3F21 A;  3HTS B;  4IHS A;  3JAM Z;  1H9T A;  4OMY A;  1YW8 A;  4N0B A;  5J8F A;  1IN4 A;  4RGR A;  2VOO A;  4L9T A;  4OIP F;  2FE3 A;  2FBK A;  4O6J A;  2RVC A;  1O57 A;  3DEU A;  1XGN A;  1Z91 A;  1B9N A;  2XV4 S;  1P6R A;  1U6G A;  3L09 A;  2UZK A;  2YX4 A;  5HDN A;  1ZG3 A;  4OIO F;  1DUX C;  3R6S A;  2PEX A;  4LB6 B;  4MQV A;  4UHT A;  1HW5 A;  2EFO A;  5FD6 A;  4KIC A;  2XGX A;  4WF2 A;  1SD7 A;  3E5Q A;  4A0Y A;  3WU1 B;  4EMS A;  2O8X A;  3I4P A;  2BV6 A;  1D8J A;  3WTW C;  1ZHF A;  3WTV C;  4R8H A;  4M71 A;  1OYY A;  1V3F A;  3F6O A;  1F5T A;  3RKX A;  1Z1D A;  4A5M A;  1MKM A;  3CLO A;  1FP2 A;  1T6S A;  3ZN1 A;  1TQM A;  1V4R A;  3ECO A;  3F8B A;  5LRR A;  4CYD A;  1YIO A;  4CXF A;  2YR2 A;  3IL2 A;  4ETS A;  2K27 A;  4PGH A;  3E3V A;  1U2W A;  1LNW A;  5D5V B;  3RTR A;  1Z05 A;  1J59 A;  3JTH A;  2Y75 A;  3F6V A;  1IRF A;  3DKW A;  1QO0 D;  4WCG A;  4RB1 A;  5L3C A;  5CVV A;  2AXL A;  4L18 B;  1EV7 A;  2M45 A;  2VON A;  2P5V A;  3WTT C;  4G7Z F;  3WGH A;  1KYZ A;  5LHI A;  4Q4Z F;  4MGR A;  4B8X A;  4G94 A;  1W7P A;  2HGC A;  3QRF F;  1YFH A;  4ENN A;  3N97 A;  2ELH A;  3I59 B;  2PN6 A;  1XSD A;  1P92 A;  5CYV A;  1FNN A;  3NEU A;  3WTZ A;  1FP1 D;  3J80 Z;  1S7A A;  4U0V A;  2E7W A;  1J5Y A;  2PJP A;  4ESF A;  2CYY A;  1ZRC A;  2OU2 A;  1KA8 A;  3HSR A;  5AIQ A;  3H92 A;  1O3T A;  2XRO A;  1U78 A;  3FXR A;  3E6D A;  1YQA A;  4IRI A;  1JGS A;  2Z33 A;  1W7P B;  1XDS A;  4Q48 A;  2DLL A;  3GO5 A;  5ICC A;  4EJU A;  2P6S A;  3FXU A;  3JW4 A;  3REO A;  4CZZ A;  1YW9 A;  3K9T A;  4XLP F;  1K79 A;  1SAX A;  1IN8 A;  2RGV A;  2IA2 A;  2PMH A;  2H09 A;  2G7U A;  1PDN C;  1IN5 A;  3N4M A;  2FEZ A;  4G8X A;  2FRH A;  4KUM A;  3NRV A;  5E8I A;  2CSO A;  4WXD A;  2LDU A;  1LDJ A;  1WQ2 A;  1QBJ A;  3BJ6 A;  3HRU A;  4Z2Y A;  1R5G A;  2DO7 A;  1YG2 A;  5DV5 A;  2P7C B;  2STW A;  2A69 F;  4Y15 A;  1DPU A;  2DW4 A;  3GUD A;  2IA1 A;  2OAZ A;  3M8E A;  3O3K A;  3IWF A;  3TO7 A;  5BOX A;  3KP3 A;  1PUE E;  4U7B A;  1FPQ A;  2ZME A;  4ON0 A;  1H9G A;  5L3E A;  4RB3 C;  4KN4 X;  2K02 A;  1HSJ A;  4H0E A;  4KIG A;  4YII A;  4YIF A;  4M9S A;  4HX8 A;  1F1Z A;  1S6L A;  1ZRD A;  2OQG A;  4GYI A;  5K1Y A;  1O7L A;  4MTE A;  4YG2 F;  1ZRF A;  3E6M A;  1EH7 A;  1RNL A;  2E1C A;  3LWF A;  1BN5 A;  3PFI A;  3COA C;  3BZ6 A;  2XVC A;  3KP5 A;  1J75 A;  1BJA A;  3ISP A;  4QWQ A;  5LEJ A;  4CO8 A;  4UNO A;  5KK1 A;  1IXR C;  2GWR A;  4O3M A;  5D5W B;  3TQN A;  1KQ0 A;  5DYM A;  3T5X A;  2YU3 A;  5IT9 K;  5ILV A;  1BBY A;  2YPR A;  5CVR A;  2ZME B;  2UXN A;  2IA0 A;  3RJP A;  5LGT A;  5D5U B;  4LLN A;  2RNJ A;  5BMZ A;  2HQR A;  3V8K A;  5ICG A;  2L4A A;  4E70 A;  3KET A;  2ADU A;  3U1D A;  1IRG A;  3IWZ A;  1G3T A;  2STT A;  2CW0 F;  1D3Y A;  1G3S A;  1KU3 A;  4KYW A;  1HBX G;  2MA3 A;  1LQ1 A;  3QP6 A;  1U5T A;  5ICE A;  3GW2 A;  4M74 A;  2XAS A;  5HLI A;  2G9W A;  4XSX F;  4ZZD A;  1ONV A;  5DUI A;  1YO5 C;  2QQ9 A;  2OZU A;  1B6A A;  1YTY A;  3HRM A;  2BBY A;  2ACJ A;  5AON A;  4HDV A;  1NHA A;  2PBI A;  1U5T C;  1IN7 A;  1IZ1 A;  4Y17 A;  2QYO A;  3OOP A;  3J81 K;  2QLZ A;  1SD5 A;  1SFE A;  1ZGJ A;  4HF0 A;  4S05 A;  4XRF A;  2HWV A;  1EH8 A;  2UXX A;  2A6E F;  2FXA A;  2XAH A;  1QGP A;  1U5T B;  4QLC U;  1BI2 A;  4LFU A;  4BYY A;  4MEX F;  4G7O F;  1O3R A;  3C7J A;  3LA7 A;  2WV0 A;  4HQE A;  2V1X A;  2JRT A;  3EUH A;  5E17 F;  3F8C A;  1OMI A;  4WXH A;  1HKS A;  2V9V A;  3CJN A;  5BPI A;  3ZMZ A;  5LHG A;  4IRH A;  3LA2 A;  1I27 A;  1HW1 A;  3C3W A;  5K5Q A;  1IUY A;  3BJA A;  1JHF A;  2KJC A;  3HRS A;  2Q8K A;  2IRF G;  2EB7 A;  4EJW A;  3O2P E;  1TNT A;  3V4G A;  2V1U A;  4IJA A;  2DPU A;  4LLL A;  1FYM A;  2KIU A;  2EV0 A;  1XSX A;  1W5S A;  3I64 A;  1J9I A;  3E97 A;  3PQJ A;  2QQA A;  2DI3 A;  5TJJ A;  1T98 A;  1TW2 A;  3IC7 A;  1R1U A;  2EA4 A;  2GAU A;  1W4M A;  1T38 A;  5D4R A;  2KIM A;  2Y0M A;  2DFI A;  1Y0U A;  1BI1 A;  3RDI A;  3K1N A;  4GCV A;  4XLN F;  2P7V B;  5HVQ C;  4EJT A;  3BPX A;  3K1P A;  1QZY A;  4XBF A;  3F8F A;  3HRT A;  1YW7 A;  2CO5 A;  3GWZ A;  4CHU A;  1J7K A;  4PZJ A;  1H0M A;  2L01 A;  4FT8 A;  2JPC A;  4UXN A;  2JTV A;  5JFR A;  4LLG F;  2BYV E;  2IJL A;  3VOD A;  1DP7 P;  4I0A A;  3I5U A;  2ETH A;  3VFZ A;  2PQ8 A;  3JSO A;  3GFL A;  2M30 A;  4LK1 F;  1FOK A;  3V7C A;  4CGZ A;  3U9G A;  4K2E A;  4IHT A;  4ESB A;  2GZW A;  3F22 A;  4OIR F;  2XHK A;  4M9Z A;  2VBW A;  3FM5 A;  1MD0 A;  2R3S A;  1ZG1 A;  2NS0 A;  1STZ A;  3I58 A;  4EV0 A;  2ZBK A;  2XRN A;  4KN7 X;  4R1H A;  4HZF A;  1FX7 A;  5HDK A;  3FWE A;  2GIV A;  2HKO A;  3MZY A;  2DT5 A;  4A0Z A;  4B09 A;  4U0W A;  3F3X A;  2AS5 F;  1BI0 A;  1B9M A;  2EFP A;  5CVI A;  3TDZ C;  3QPT A;  1QPM A;  5DUK A;  2K4J A;  2EV6 A;  3CDH A;  2G7H A;  2ZKZ A;  2K86 A;  2MLK A;  3PQK A;  3I53 A;  1Z6R A;  2W57 A;  2VE8 A;  4ENK A;  2DTR A;  3WOD F;  1SFU A;  2XKP A;  2M8E A;  2O3F A;  4A0X A;  3WTU C;  1S8N A;  4UVA A;  5ILS A;  2GXG A;  2XIG A;  1L0O C;  3Q5F A;  5FLX Z;  3GVA A;  4KT5 C;  4HDU A;  4HYE A;  5ERI A;  3RYR A;  1AOY A;  3FMQ A;  4HF2 A;  3T8T A;  1I1S A;  5A2Q K;  4HV5 A;  1LVA A;  4AIK A;  4G9Y A;  4GGG A;  1WSU A;  2O03 A;  3E6C C;  2PLY A;  4L5J A;  3J81 Z;  3ML6 A;  2RV8 A;  2DQL A;  2ESH A;  5CVJ A;  4BH9 A;  2F5E A;  5F64 A;  1P4X A;  3HOS A;  2F5D A;  4GO1 A;  2RDP A;  4BNC A;  3M9A A;  1D8K A;  2P6T A;  1ZN2 A;  2EK5 A;  5DCF A;  5LGN A;  2FML A;  1ZRE A;  2H6B A;  3ZMT A;  1ZLJ A;  4DNC A;  3DF8 A;  3QPH A;  1O3S A;  1YLF A;  3HHH A;  1W7P D;  3FHZ A;  2ESN A;  4EM2 A;  4MHG A;  3KCC A;  2ZNZ A;  3SHF A;  1L3L A;  2YX7 A;  1UFM A;  3VEP A;  2VE9 A;  4RAY A;  2Q0O A;  5D6F A;  4P55 A;  4AD9 A;  3SZP A;  4EGY A;  2WC2 A;  1ULY A;  4O5V A;  5LHH A;  1XB4 A;  1XCV A;  2FA5 A;  2H94 A;  2QM3 A;  1K7A A;  1KQ9 A;  3CTA A;  4OIN F;  3E6B A;  5TRD A;  2FBI A;  2ZFW A;  2QWW A;  4I7H A;  5DD8 A;  2QZ8 A;  2H6C A;  2V79 A;  1OYW A;  1FLI A;  2HS5 A;  2HDC A;  3T8R A;  1ZLK A;  3P9I A;  4L9N A;  4ZZL A;  3DXJ F;  3ZMD A;  3BRO A;  3I54 A;  3MFK A;  1R1T A;  5L3D A;  3K2Z A;  4IVN A;  2F5C A;  2OA4 A;  2EFW A;  5AIP A;  2J5O A;  3ABT A;  2PG4 A;  2HKX A;  4EQQ A;  4RGX A;  4ENM A;  2CG4 A;  3BOQ A;  3ABU A;  5FD5 A;  1FY7 A;  3TO6 A;  4EVI A;  3FX3 A;  2MD5 A;  3LFK A;  4RAZ A;  4A6D A;  3M8F A;  1YYV A;  2Z9O A;  4G6D A;  3FMR A;  1BC7 C;  1WKM A;  4MEY F;  1X3U A;  4LJZ F;  1JHH A;  2L54 A;  4U88 A;  3R0J A;  1TQI A;  5E1Z B;  2LSO A;  2QEN A;  2W24 A;  4CIC A;  1R7J A;  3HSF A;  2X0L A;  3J7A O;  1MJA A;  5H6R A;  1MZB A;  2DBB A;  3H3Z A;  2Y48 A;  1ZG5 A;  3IKV A;  1TLH B;  1Z6T A;  4L5I A;  1HXD A;  2XAG A;  3MWM A;  2HTS A;  4HQM A;  4LGW A;  2VBX A;  3FF5 A;  3CUO A;  3S2W A;  5DCM A;  2A61 A;  3GYH X;  2H27 A;  5LRS A;  3JAM K;  4A5N A;  3E5U A;  3Q9V A;  1J0R A;  3DV8 A;  1D5V A;  4WWC A;  1R22 A;  4R79 A;  3JSP A;  2FNA A;  3F72 A;  2GXB A;  4EM1 A;  2EJR A;  3MCZ A;  4GXO A;  1UST A;  4KIB A;  2ZJ2 A;  4RB0 A;  2A07 F;  5J8C A;  1OR7 A;  1UCR A;  1LEA A;  4HLX A;  2NAZ A;  2V6C A;  3KP2 A;  2PFB A;  5HLH A;  5HS9 A;  2FF4 A;  4KMF A;  3TDU C;  5D5X B;  2KJB A;  1RI7 A;  2CQK A;  1YS7 A;  4HX7 A;  4LG0 A;  5DCM B;  5CJ9 A;  3P7N A;  2XKO A;  4G7H F;  3HUG A;  2VBZ A;  1QNT A;  1GXQ A;  4HOB A;  2L02 A;  3EET A;  4EJO A;  1BOA A;  3R4K A;  1DDN A;  1CF7 A;  1T39 A;  2QVO A;  3BDD A;  4EM0 B;  3ZMS A;  3AAF A;  1S7O A;  3L00 A;  2Q2E A;  4GYG A;  1G3W A;  4BXU A;  1AWC A;  3KEO A;  2IW5 A;  2P5K A;  3L2C A;  2EWN A;  4JQF A;  1IW7 F;  4UV9 A;  3I0T A;  2LKP A;  2BEO A;  4LD5 A;  3B02 A;  3G3Z A;  2HOE A;  1U8R A;  3F23 A;  1FYL A;  2CFX A;  4LG0 B;  2GA1 A;  3TKY A;  2OD5 A;  5E8G A;  3W6K B;  1XMK A;  1ZYR F;  4UV8 A;  3F8N A;  5BS6 A;  1JXS A;  2M5W A;  5HLG A;  2O0Y A;  4RGU A;  2J5P A;  1FSE A;  2KRF A;  2L4M A;  2YSR A;  4JBA A;  4PGG A;  4HA8 A;  3RKY A;  3L9F A;  1CF7 B;  4L9J A;  2Z3Y A;  6PAX A;  2W85 A;  2GQQ A;  2ZCW A;  1Z9C A;  5H20 A;  2JZY A;  2VT2 A;  5JR3 A;  5LBQ A;  4AIH A;  1ZGA A;  3KP7 A;  3TOB A;  2OBP A;  2VN2 A;  5FO5 A;  3E5X A;  2GA2 A;  3V8L A;  2JSC A;  3KE2 A;  4I0B A;  1ON1 A;  3V7S A;  2P8T A;  2MH9 A;  2D45 A;  3V7R A;  1MJ9 A;  5FFX A;  2HFH A;  1IXC A;  3BY6 A;  1BIA A;  2DPD A;  3IRQ A;  3BWG A;  2O61 A;  2BGC A;  4Q47 A;  3B73 A;  3GZ6 A;  3C18 A;  4PCQ A;  4YFX F;  5K5O A;  3R61 A;  1ZAR A;  4KNY A;  4ZYE A;  1FSH A;  4I98 B;  4L0Y B;  4ZYH A;  5D4S A;  5FFZ A;  3HOT A;  1CGP A;  2HEO A;  1K6O A;  4MTD A;  4KIF A;  3WE3 A;  4M6X A;  1KYW A;  1S3J A;  3OV8 A;  1VTN C;  2OZ6 A;  3K69 A;  2PI0 A;  5LGU A;  2A3S A;  3LQR A;  1P2F A;  5LLQ A;  1O3Q A;  5BPD A;  1FWZ A;  1K78 A;  4I09 A;  2IT0 A;  3R60 A;  3QAH A;  4BHC A;  3HSE A;  2IP2 A;  1JE8 A;  2F5F A;  1GHC A;  3KFW X;  3ZN0 A;  4EJV A;  3LQQ A;  3HYI A;  4S04 A;  3C1D A;  4HX4 A;  5IT9 Z;  4I2O A;  3HIF A;  1RZ4 A;  3RPQ A;  3BP8 A;  2A68 F;  2RC4 A;  1P4A A;  1SFX A;  2M87 A;  2XAQ A;  3T1B A;  4JK1 X;  1KQ8 A;  2R7F A;  4BHB A;  3IKT A;  1KGS A;  3QU3 A;  5CVU A;  4F7Z A;  1TQP A;  2VXZ A;  2EFN A;  3DFG A;  4HAM A;  4Q5S F;  3FXQ A;  5L3F A;  5DEQ A;  2IVM A;  2VT3 A;  1XN7 A;  1K78 B;  4N9I A;  4HLY A;  3V8J A;  4LB5 A;  5K5R A;  1QQI A;  5DDG A;  4I01 A;  5JVT A;  1RUO A;  5H6Q A;  2BE5 F;  1OKR A;  1PP8 F;  2EFQ A;  1UHM A;  5L3G A;  3M7G A;  4MQ9 F;  1Z7U A;  4IRG A;  4KA4 A;  1SMT A;  3LAJ A;  1B59 A;  2B0L A;  1G6N A;  3SFZ A;  2X4H A;  3RPU A;  5ILU A;  5IT3 A;  2NYX A;  2P4W A;  3I59 A;  2XAF A;  1IN6 A;  2VC0 A;  1MDM A;  1DPR A;  1Q1H A;  5LEK A;  3TOA A;  3SZT A;  1ZH5 A;  1XD7 A;  2W84 A;  5L3B A;  3EDP A;  3K1M A;  1XSV A;  2FOK A;  3GFJ A;  4XSZ F;  1R58 A;  3TGN A;  4ZH4 F;  5JI6 A;  2O6G E;  3MEX A;  3EYI A;  2NRA C;  1LB2 A;  3HHG A;  5E18 F;  4ZYD A;  2RN7 A;  2DK8 A;  3D0S A;  3VOE A;  2RKH A;  2DQR A;  4HBL A;  1ON2 A;  1U3E M;  4AIJ A;  3MQ0 A;  4HW0 A;  2WWY A;  4M73 A;  2VOP A;  4P96 A;  1WWX A;  2TDX A;  3QOP A;  3O6B B;  5DD4 A;  3JTG A;  2QBY A;  4BAY A;  4IPA A;  5EEH A;  1MDM B;  1E2X A;  2P5L C;  5D6E A;  3GF2 A;  4BHP A;  1MJB A;  5E20 A;  1C0W A;  2XAJ A;  3EQL F;  2FSW A;  3ELK A;  3L7W A;  1GXP A;  1G4D A;  3ZQ7 A;  3M1E A;  4IF4 A;  3KLN A;  1SMY F;  1OPC A;  1IAW A;  2E1N A;  5E1X A;  3U2R A;  3ROU A;  1KU2 A;  2ISZ A;  2K4B A;  4P9F A;  1SD6 A;  1HKQ A;  4U7D A;  5EEG A;  3LAP A;  2C6Y A;  1B4A A;  1R5H A;  3DP7 A;  2QBY B;  3ECH A;  3VB2 A;  4WX9 A;  1LDD A;  4EGZ A;  1XGM A;  4Y13 A;  5FGM A;  1B1B A;  1PP7 U;  1F9N A;  5E1W A;  3ZMU A;  2KIF A;  2FU4 A;  2UWM A;  2DU9 A;  1MGT A;  3W6J B;  3H3U A;  3ZMV A;  2HYG D;  2E7X A;  2A6H F;  4WXC A;  1HKT A;  3Q9S A;  1R1V A;  1RIO H;  5BQT A;  1P4W A;  2RQP A;  1R00 A;  2L3D A;  4M72 A;  1I1G A;  3BJO A;  3KZZ A;  1R23 A;  4RS8 A;  1GVJ A;  1FT9 A;  5ED4 A;  3R0A A;  3MAJ A;  2PMU A;  3RKW A;  3KLO A;  3FZV A;  2XUB A;  1BC8 C;  1KU9 A;  2VC1 A;  3F8M A;  5ICF A;  2Z5U A;  2F2E A;  4FX0 A;  2JPB A;  4BQA A;  1BI3 A;  4MNU A;  1EH6 A;  3KZY A;  1BIB A;  3WU0 A;  4LMY A;  2WTE A;  2NNY A;  2VOD A;  1J2X A;  3GX4 X;  2KKO A;  3WTY C;  4ZYG A;  2HTJ A;  1USS A;  4I02 A;  3GZ5 A;  1FBQ A;  1TTY A;  2CGP A;  1UB9 A;  3RIR A;  4NQW A;  2EA2 A;  5KVR A;  4RGS A;  1XMA A;  1XGO A;  3GFI A;  4A6E A;  5F1R A;  3T0Y A;  1ODD A;  3EYY A;  2OQR A;  4YFN F;  4L9V A;  2DAO A;  2Z99 A;  3KP6 A;  4ENJ A;  2CWE A;  1G3Y A;  3P9C A;  2ZNY A;  2FNP A;  3HTU A;  5A2Q Z;  1SD4 A;  1OYI A;  3RYP A;  5HS7 A;  3DQV C;  3GEZ A;  3WTX C;  4UVB A;  1FZP B;  1LJ9 A;  1REP C;  4PDK A;  1TW3 A;  4FX4 A;  4UVC A;  5JHU A;  4ASN A;  2LF8 A;  2EV5 A;  1O7F A;  4IXA A;  3P9K A;  4OIQ F;  1IF1 A;  2QQB A;  3K0L A;  3IRR A;  3CUQ A;  5FLX K;  1XGS A;  1XDU A;  2MBF A;  3WE2 A;  1TBX A;  3BPV A;  3CO7 C;  4WK8 F;  3I71 A;  3WTS C;  1W5T A;  3CO6 C;  2NNN A;  2D1V A;  1TNS A;  3MZH A;  1I6X A;  1A04 A;  4YFK F;  3DPT A;  3KP4 A;  3CUQ C;  1FBS A;  5HDG A;  2FQ3 A;  2MH2 A;  5J6X A;  2COM A;  2V1D A;  4DQ2 A;  1ZAO A;  1LEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...