5K1YA

P2(1) structure of pnob8 aspa-dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
b'TDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKIRKLVEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AspA
publication title Detailed structural analysis of AspA-DNA contacts
rcsb
source organism Sulfolobus sp. nob8h2
molecule tags Transcription/dna
total genus 22
structure length 87
sequence length 87
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5k1yA00
3K69A 1DDNA 3CTAA 4XSXF 3TGNA 2XAQA 4BQAA 3R61A 1IZ1A 4KMUX 5CVUA 1GVJA 5LHIA 3WTTC 3HYIA 1T98A 1B6AA 2XV4S 2HQNA 2IRFG 2P5LC 2VE9A 3WTWC 1K6OA 1SAXA 4KICA 3F72A 3GX4X 5KK1A 2B0LA 1GXPA 4LK1F 5CVVA 3CUOA 3ZMSA 1U8RA 1J0RA 2DLLA 2ZNYA 2FE3A 4BHCA 3DQVC 3N4MA 3E5QA 5DEQA 4I01A 2EFWA 1FBQA 2P5VA 2QWWA 5E20A 4IRHA 2ISYA 2K02A 3BOQA 3M1EA 4HF0A 4LK0F 3I59B 4EJUA 1JE8A 1ZHFA 2V1DA 4R1HA 5E17F 5LEJA 1SMYF 1R36A 4HYEA 2V1UA 4P55A 3WE2A 4UVCA 3ABTA 3RYPA 4AIKA 3QU6A 2BE5F 2PJPA 1STZA 3RYRA 3ML6A 2DU9A 3J80K 2FBKA 3K2ZA 2H09A 1G3WA 4OMYA 3C7JA 2IA1A 3M7GA 3V7SA 4RGXA 2XIGA 2G7UA 2FEZA 4KDPA 1F5TA 1LEAA 3HSFA 2O0YA 1NHAA 1ZAOA 3CUQC 5F1RA 2QLZA 4MEXF 5DCMA 1WI9A 4XSZF 2FF4A 2ISZA 1BIAA 3GLXA 1L0OC 3HSRA 4ENJA 3HHGA 3NRVA 1HKTA 2RQPA 4I0BA 2O03A 4LGWA 2F5DA 3ISPA 3F6OA 1U3EM 1FC3A 4HW0A 1G3TA 5DUIA 2DQRA 3T8RA 2BV6A 3I0TA 3HOTA 1E17A 4CXFA 2YX7A 3B73A 4YG2F 5K5RA 4A0ZA 2GA1A 3FM3A 1I27A 1XGOA 4KIGA 4G94A 2FMLA 4QLCU 1IXCA 1D8JA 5BPIA 4EJWA 2P6SA 4WXHA 1CGPA 5DUKA 2VOPA 1B9MA 2QYOA 1U5TB 2M45A 3Q5FA 4P96A 1QNTA 1IRFA 1Z05A 2JSCA 3C3WA 2YPRA 1MDMA 3F6VA 1KU7A 2XKOA 3CUQB 2RN7A 2FRHA 2OU2A 1YLFA 3DV8A 5DYMA 2FBIA 3BY6A 3VB2A 2VN2A 2MD5A 2P5KA 4FX4A 3WGGA 1FSHA 1WQ2A 3GO5A 3WE3A 2IJLA 3HSEA 1FOKA 2VXZA 4R79A 2QVOA 1V3FA 4OOIA 5CVJA 1ON2A 2KJBA 3F8MA 2XKPA 1R5GA 4I09A 2VODA 1Q1HA 2A6HF 3J80Z 3FMQA 5D4RA 5J8FA 2E7WA 2GQQA 2GAUA 2D1VA 1SFEA 2PMUA 3KCCA 4WXCA 1ZLKA 4EJOA 4WCGA 1RUNA 1O3SA 5FLXK 5BS6A 1JHFA 1FY7A 4QWQA 1G3SA 2DBBA 3L09A 3D0SA 3VEPA 4AD9A 1R22A 1G3YA 4U7DA 1J59A 5D5VB 3KZZA 1K79A 1EH8A 1W7PB 4M73A 4U0WA 2EK5A 4RGSA 2UXNA 3R0AA 3JAMZ 2CGPA 2HYFA 1XMKA 4N9HA 4ENMA 3Q9SA 3GEZA 3FF5A 3ELKA 5AIPA 5HLGA 4XLPF 2M5WA 2FQ3A 1YIOA 5E1ZB 3ABUA 5EEGA 1SFUA 4L18B 2W57A 4MHGA 3W6KB 4OIOF 2RKHA 3E6DA 4MNUA 1O3TA 4YIFA 2VT2A 5LGNA 3ERED 2ADUA 2HFHA 3KP7A 3ZMUA 3GFIA 4P9FA 4UVBA 3WTXC 4RGUA 2ZMEB 1SFXA 1D3YA 5K5OA 2VONA 1FBUA 2VC1A 1RZ4A 2PMHA 4KA4A 2LDUA 1B1BA 1H9GA 4M6YA 2AXLA 3K0LA 3EUHA 3CO7C 4OINF 2KJCA 3V7RA 4R8HA 2WTEA 1FZPB 2CWEA 2Q0OA 3SXYA 3KLNA 2Z5UA 4U88A 1IF1A 1B9NA 4Q47A 5H20A 4BNCA 1G6NA 4OIQF 4IJAA 3IWFA 1H0MA 2WC2A 2QQBA 5CVRA 5ICGA 2EFNA 1HKSA 4LD5A 1O7LA 4HDUA 1BI1A 5AIQA 1IN8A 3LSTA 3RKWA 1QQIA 1JXSA 4JQFA 2FBHA 3I64A 2WV0A 3RKYA 2QM3A 1EH6A 1TNTA 1OMIA 4O3MA 4A5NA 2QBYA 3ZP5A 1XB4A 3WGIA 1QZZA 2OZUA 4PZJA 4ZZLA 1HSJA 4G8XA 5D5WB 1R7JA 2O6GE 1HQCA 2NYXA 1ZG5A 2EWNA 5LRRA 3NQOA 4G6DA 5FFZA 4ZYEA 1R1UA 3VFZA 1XN7A 2HR3A 2ACJA 3D5LA 2Q2EA 3QU3A 5D5UB 2VBZA 2OQRA 3ZMTA 4HQEA 4ESJA 2VT3A 1S7OA 3V8KA 2M1BA 3M8EA 3FMSA 3GYHX 2F2EA 4MEYF 2YU3A 2D1HA 2NAZA 3I58A 5LLQA 2DK8A 4L0ZB 1IN6A 2KRFA 1YW8A 1T0FA 1KA8A 1LDJA 4AVPA 1TLHB 4Y15A 4RB1A 2M87A 1IRGA 4UUVA 3IC7A 2J5PA 2KIFA 4UHTA 4WXDA 3ECHA 5E18F 4UXNA 4A0XA 2HQRA 2M8EA 2FU4A 4U7BA 2COMA 3W6JB 2DI3A 4ENKA 3H3UA 4Y13A 3ZMDA 2XAFA 4LG0B 2QQ9A 5F6FA 1R58A 3EQLF 1W5TA 1DPRA 1XCBA 4CDGA 1YFHA 5LGUA 1WWXA 1LQ1A 4IPAA 1SD5A 4S04A 3L9FA 3ZMZA 4N0BA 1J5YA 3HIFA 1QBJA 5F64A 2HOEA 3TDZC 3P9CA 2PLYA 1HW1A 2W25A 2OBPA 4KT5C 3CLOA 5BOXA 2STTA 1FX7A 1XCVA 4LLGF 3TOBA 4A12A 3BWGA 5FGMA 1WRJA 4M74A 1Z9CA 1PP8F 1FYMA 1S8NA 3MCZA 4GYGA 5ICFA 1K78A 3GWZA 2A07F 2PFBA 1XDSA 5FD5A 4M9SA 3P9KA 5D8LB 1P92A 5IT9Z 3J81K 3F22A 5FO5A 6PAXA 1HSTA 3PFIA 3GXOA 2YR2A 2A61A 3HRSA 1IAWA 2Z33A 1R5HA 3FXQA 3KP5A 4ZZDA 3U2RA 1S29A 1YQAA 3LA3A 2V79A 3FMRA 3F21A 3WTVC 3V7CA 2X0LA 4B8XA 4I98B 3AAFA 4HAMA 1MKMA 1BM9A 5CVIA 5A2QZ 2FNPA 1KQ0A 2STWA 4EGYA 4Y17A 1YS7A 1ZGAA 5HLHA 4L0YB 1S6LA 3QAHA 5DDGA 3TO7A 4AIJA 3MAJA 1OPCA 4I0AA 5ICEA 4ZYGA 5H6RA 4A6EA 1FP1D 2JZYA 1FPQA 1LVAA 4IHTA 4L9NA 1BI2A 2MH9A 3WODF 4HX4A 4JK1X 4AWXB 4TV7A 1SD6A 2XUBA 1J2XA 1LNWA 2GA2A 2XAHA 4IVNA 2RV8A 1OYYA 1Z7UA 5ERIA 2HYGD 2XHKA 3E5XA 4A0YA 2PEXA 2Z9OA 5E8IA 2EA4A 2EFPA 2K27A 4RGRA 4YFKF 5KVRA 1YO5C 5E1WA 1BIBA 4OIRF 1BC7C 2W85A 5D8KB 4CYDA 1P4XA 1EV7A 3B02A 4EMSA 1YTYA 2BEOA 5IT3A 4UV8A 3EETA 2NS0A 1UCRA 1ZG3A 1J75A 3HRMA 4ENNA 1WKMA 3IWZA 1MGTA 1ZRFA 4H0EA 4OIPF 1I1SA 1XGSA 2W84A 1W7PD 1USSA 3QP6A 3J81Z 3E6BA 4BH9A 3RIRA 4EM2A 3HRTA 2XRNA 1ZARA 1J9IA 5J8CA 3IKVA 3GVAA 2A3SA 5L3DA 4UVAA 5LGTA 4S05A 2R7FA 3V4GA 3IKTA 4G7ZF 2YSRA 1QO0D 1OYWA 1Y0UA 1IN5A 2P4WA 4B09A 3RJPA 2OZ6A 1KU2A 5D4SA 3ZMVA 3M8FA 4EGZA 2G9WA 2RC4A 2F5EA 5L3CA 5JVTA 3HOSA 4GXOA 2H6CA 4HLXA 1P6RA 4LMYA 5J6XA 3FZVA 1USTA 2JTVA 5D6FA 4YFXF 1RNLA 3LAPA 4IRGA 1TW2A 3P7NA 3E97A 2JPCA 3QOPA 1VTNC 2EB7A 4BXUA 2GXGA 3OOPA 1GXQA 2RGVA 1ZRCA 4HF1A 4HF2A 4KFCA 1Z91A 3LQQA 1KYZA 4XLNF 1BBYA 2R7DA 2DQLA 1K7AA 1CF7B 5FB2A 4RB2C 3NEUA 1YW7A 1QGPA 5HLIA 2VOOA 1R1VA 1YG2A 3EYYA 2JPBA 5CYVA 1KGSA 3T1BA 4YFNF 5ILVA 2K4BA 4IXAA 4KIBA 1P4WA 3KE2A 4EVIA 3F23A 4LB6B 1XSXA 1Z6RA 2HWVA 3EDPA 5D5XB 2MC3A 3FWEA 1FYLA 2HEOA 2K86A 1FNNA 3BROA 3ZQ7A 3O3KA 3VOEA 2ESNA 1DP7P 5HDNA 2UWMA 1OR7A 1U5TA 2ELHA 5FD6A 4XBFA 2RNJA 1RUOA 1QPMA 3LA2A 3DPLC 2VBXA 2V6CA 3CUQA 3OV8A 1MZBA 4G9YA 3BPXA 5HS8A 4G7OF 4K2EA 3BJOA 3MQ0A 3IRQA 4IHSA 4G7HF 2QQAA 4RS8A 4KN7X 3R4KA 3PQKA 1XSVA 2OQGA 2ZO4A 5LRSA 1OYIA 2LKPA 2MLGA 1YW9A 3QPTA 1J7KA 2YX4A 2PG4A 4LLLA 3I4PA 3F8NA 4RAYA 3FHZA 2CYYA 4EJTA 2O3FA 2DAOA 3K1MA 3K1PA 1BI3A 3WU0A 3GZ6A 1PDNC 1UFMA 2BYVE 3LQRA 4RB3C 1O7FA 2Y0MA 4M71A 2GWRA 4CGZA 1BJAA 3RDIA 1RIOH 4E70A 3BZ6A 1ZREA 3DXJF 2Q8KA 1KYWA 2GXBA 1AWCA 1Z1DA 2UXXA 2HDCA 4HA8A 4L9TA 4IRIA 5FLXZ 2L54A 4MTDA 2XAGA 1O3RA 3PQJA 3IRRA 2WWYA 3WU1B 1W7PA 1XSDA 4HZFA 3HTUA 2L4MA 1T38A 4M72A 3KP4A 2M30A 2DO7A 4LJZF 2ZJ2A 3CDHA 4GCVA 2EA2A 1RI7A 3SHFA 4WX9A 2QUFA 1TW3A 2IVMA 4MQ9F 3R60A 2XASA 3L2CA 1UB9A 3DP7A 3LA7A 4L5IA 1O3QA 1SD7A 3LWFA 2DPUA 4ZH4F 4LFUA 3R0JA 5FFXA 2ZBKA 3I5UA 2FOKA 2IA2A 3MZHA 2P8TA 5EEHA 3RKXA 2JRTA 1T39A 2KKOA 2RVCA 1D5VA 3BP8A 3SZTA 3RPQA 2Y48A 2EV6A 3TDUC 5JFRA 3DKWA 3I71A 3T8TA 2ZMEA 4OMZA 4EV0A 5BMZA 5DCMB 3JSOA 4Q48A 1IN4A 2E7XA 3QRFF 4P5OA 3TO6A 1Z6TA 4WWCA 2D2WA 3IHUA 1BOAA 2F5CA 1HXDA 2DT5A 1IUYA 2ZXJA 4GYIA 5DV5A 1DUXC 1S3JA 1TTYA 1ZYRF 5L3GA 2MLKA 1OKRA 2KIUA 2IT0A 1T6SA 2J5OA 5ICCA 5BPDA 2AS5F 2LF8A 2EJRA 1R1TA 2HKXA 5L3FA 2CW0F 3GFJA 1S7AA 3L00A 1XDUA 4ESBA 3H92A 1TQIA 4Q5SF 1YYVA 1F9NA 4KN4X 2FA5A 2HGCA 3GF2A 2HTJA 2IA0A 2Y75A 3E3VA 2LNBA 3GW2A 3H3ZA 5ED4A 3JTHA 5E8GA 4ASNA 1LB2A 2L4AA 1LDKB 1IXSB 1MDMB 2PQ8A 1ZRDA 2ETHA 4EQQA 4FT8A 3TO9A 4F7ZA 4I2OA 3RTRA 1TQPA 4A5MA 4GGGA 1R00A 3IL2A 1ON1A 2Z99A 1FSEA 1ZH5A 1REPC 5ILUA 2HZTA 2KIMA 2NNNA 2LF7A 1KU9A 3TQNA 2MBFA 2EFQA 5K5QA 4KUMA 5DD4A 5DD8A 5ILSA 1HKQA 1MJ9A 4LLNA 1ONVA 1W4MA 3C1DA 1B59A 4EM0B 4HBLA 1LEBA 4L9JA 2DFIA 3ULQB 4OU0A 3G3ZA 4JBAA 1E2XA 2HKOA 4M9XA 1U5TC 1I6XA 1I5ZA 2EV0A 2JT1A 2PBIA 3E6MA 2A68F 4YIIA 4Q4ZF 2E1NA 2H6BA 4LG0A 5BQTA 4UNOA 3KETA 4BAYA 3QP5A 3FXUA 1FLIA 5HS9A 1SD4A 2X4HA 3F3XA 2K7LA 2IW5A 3L7WA 4WF2A 3JAMK 2L02A 4ETSA 4KMFA 3REOA 1JGSA 2IP2A 5HDKA 4FX0A 3S2WA 4AIHA 2CFXA 3O2PE 3K9TA 1FWZA 2DTRA 3ZN1A 3I54A 3KP2A 4LB5A 1L3LA 4M6XA 5HVQC 2DW4A 3ECOA 1PUEE 3VODA 3K1NA 5D6EA 3KLOA 1EH7A 5LEKA 1FP2A 1IXRC 2W24A 1F1ZA 3KEQA 3TKYA 4EM1A 1P2FA 4M9ZA 1F4KA 1TNSA 4GO1A 1TBXA 1KU3A 3GUDA 3WG9A 3KEOA 4RAZA 1DPUA 3I59A 5CJ9A 3WGHA 4NQWA 1ZN2A 2V9VA 4XRFA 1R23A 4KIFA 3BJAA 2BGCA 2K4JA 3R6SA 3RI4A 3O6BB 1FYKA 2ZKZA 2XGXA 1XGMA 3ZN0A 3P9IA 3FX3A 5L3BA 1PP7U 2P6TA 4P9UA 2IPQX 2BBYA 3BJ6A 2PI0A 2P7CB 3U9GA 3KP6A 4NHJA 5TRDA 3ROUA 3MZYA 4IF4A 2NRAC 1U6GA 3JTGA 5HOOA 3DF8A 3KFWX 3WTUC 3MWMA 3N97A 2A69F 1KQ8A 2RDPA 2H27A 2TDXA 1D8KA 2HTSA 3LFKA 1HBXG 2QBYB 2A5YB 3E5UA 5TJJA 3V8JA 2ZFWA 2V1XA 1GHCA 2EFOA 4G6QA 4L9VA 4U0VA 1MJBA 2F5FA 3SZPA 2QZ8A 2VE8A 3DFGA 2HS5A 1X3UA 2H94A 3KZYA 4MTEA 1ULYA 1FBSA 2O8XA 2CSOA 2ZCWA 1G4DA 2E1CA 3BPVA 4U0YA 1I1GA 3EYIA 4CZZA 3WTZA 2QENA 4PGHA 5LBQA 2MA3A 2ESHA 4BHBA 4CO8A 3CJNA 2L3DA 3GFLA 3CO6C 3U1DA 4FHTA 5E1XA 5JHUA 5DCFA 5K1YA 2CO5A 4HV6A 4MQVA 4PCQA 1XMAA 4HOBA 4CHUA 2A6EF 4MGRA 2FMYA 4DNCA 3COAC 4HX7A 5JI6A 4CICA 1JHHA 3DEUA 3SFZA 3BDDA 1U2WA 3LAJA 4KNYA 1TQMA 4BYYA 2D45A 1WSUA 2C6YA 3V8LA 1V4RA 2OD5A 3HHHA 5L3EA 3F8FA 3I53A 4O6JA 3RPUA 2Z3YA 4HQMA 3F8CA 4ZYHA 4PGGA 3FM5A 5JR3A 3ZPLA 1XD7A 2XAJA 2P7VB 3HTSB 1U78A 3DPTA 2XROA 4DQ2A 1XGNA 1IW7F 4UV9A 1LDDA 3MFKA 3F8BA 2GZWA 1K78B 1HW5A 4I7HA 2XVCA 5IT9K 2VC0A 1A04A 2G7HA 4A6DA 1UHWA 4A2UA 3T0YA 3Q9VA 1LJ9A 4ESFA 3SQNA 1B4AA 3GFMA 3G73A 5HDGA 5CLSA 2LSOA 2CG4A 3J7AO 5H6QA 1ZG1A 4BHPA 1P4AA 2DK5A 4N9IA 1YS6A 1BC8C 2PN6A 1C0WA 1SMTA 1CF7A 1HW2A 2DPDA 2ZNZA 4EJVA 5A2QK 3M9AA 1O57A 2EV5A 2L01A 4ON0A 2CQKA 1ODDA 3WTSC 3MEXA 3FXRA 4HX8A 2O61A 1H9TA 2OA4A 3WTYC 4Z2YA 3E6CC 5LHGA 2UZKA 4HLYA 1BN5A 1KQ9A 3HRUA 4I02A 4NB5A 5AONA 3QPHA 4WK8F 2FSWA 3TOAA 4KYWA 5LHHA 5HS7A 1AOYA 4PDKA 2FNAA 2NNYA 2VBWA 2FXAA 1FT9A 3HUGA 2R3SA 4HDVA 1ZLJA 1T2KA 1QZYA 1MJAA 1UHMA 3JSPA 1MD0A 2OAZA 2GIVA 1IN7A 4HV5A 4D0PA 3JW4A 1W5SA 4L5JA 1ZGJA 4O5VA 4ZYDA 2VBYA 3T5XA 3C18A 3GZ5A 4RB0A 2MH2A 3KP3A 1BI0A
chains in the Genus database with same CATH superfamily
1WH7A 3K69A 5K7ZA 3PM1A 1DDNA 2K9LA 3CTAA 5FKOA 3I56I 4A93J 2MABA 2KL4A 1YIJI 1YE9A 4XSXF 3TGNA 1JJ8C 1B72A 5KCMA 2XAQA 4BQAA 3QPLA 3SEQA 3R61A 1W36D 1IZ1A 4KMUX 1RESA 5CVUA 1GVJA 5LHIA 3WTTC 3S1NJ 3HYIA 5EYRA 1UAAA 1T98A 1B6AA 2XV4S 1ETVA 2R0QC 2HQNA 4FQGA 2IRFG 2P5LC 2E2IJ 2VE9A 1MMSA 1FIAA 2JN6A 2VQHA 3WTWC 4HPQA 4PFOA 2VUMJ 2F4MB 2HYJA 1K6OA 1SAXA 4KICA 4IQ4A 1ERDA 1BR2A 3F72A 3BR5A 3B6AA 1GUUA 3GX4X 5KK1A 2B0LA 2AHQA 2LG4A 4HEA2 3FK7A 1GXPA 2W82A 4LK1F 2RNGA 3DPUA 5CVVA 1M1EB 2R7OA 3KPHA 2DA7A 1N75A 2MGQA 4DZJA 3CUOA 3ZMSA 1U8RA 1IC8A 2VQLA 5J1RA 1J0RA 4G12A 2DLLA 2ZNYA 1B8IA 2FE3A 2VPLA 4BE0A 4X6AJ 4MFEA 2DJNA 1OCZH 3CJQB 4B48A 2G0EA 2KIQA 2V26A 2L5QA 3KYCB 5F04A 2VQCA 4BHCA 3DBRB 1VFCA 3MVPA 3DQVC 3SEZA 1QHGA 3N4MA 3E5QA 5DEQA 3ESWB 4I01A 3HGYA 2EFWA 2W7NA 1FBQA 3Q0WA 2P5VA 2QWWA 2VQGA 5E20A 4IRHA 2ISYA 2K02A 4PSWA 3FISA 3BOQA 1E3OC 3BLYA 3M1EA 1UG0A 4B47A 2DMPA 4HF0A 1Z0XA 4LK0F 3I59B 4EJUA 1Z7LA 4A3IJ 1ZHFA 2V1DA 1JE8A 4R1HA 5E17F 5LEJA 5KAIC 1SMYF 2BHYA 1APLC 1R36A 3AG2H 4M3EA 4HYEA 2V1UA 5FLMJ 2QGUA 3IH2A 4E7SA 2WAQA 4P55A 1IG7A 3WE2A 4UVCA 2F6CA 4BY1J 3ABTA 3RYPA 4AIKA 3QU6A 2K9SA 2BE5F 2PJPA 1STZA 3RYRA 3MKLA 1JKQC 3ML6A 3E0JB 2R92J 2DU9A 3J80K 2YU9J 3VDXA 2FBKA 3FXOA 2M3AA 3K2ZA 3H5RA 2H09A 1G3WA 4BE2A 1X3WB 4OMYA 3C7JA 4QPQA 5K7FA 2IA1A 3M7GA 1AKHB 3V7SA 1Y6IA 4S0HB 2H1LA 2X85A 4CH7A 4RGXA 1WJBA 3PIOF 2XIGA 1ENHA 2G7UA 3A0BC 3EUKL 2FEZA 3OR1C 4KDPA 1F5TA 4ZTFA 1LEAA 4D9JA 1WGXA 3HSFA 2O0YA 1NHAA 2ME0A 1ZAOA 3CUQC 3NWSA 5F1RA 2QLZA 2EINH 3KX2A 4BDZA 2YUSA 4MEXF 5DCMA 1WI9A 4XSZF 2FF4A 1P7IA 1X1BA 2ISZA 1BIAA 1K4TA 3GLXA 2R5YA 1L0OC 2DMUA 1JJ6C 4A69C 3HSRA 4ENJA 4XLAA 3HHGA 3NRVA 1HKTA 2RQPA 4I0BA 4CCOA 2O03A 1OFCX 4LGWA 2F5DA 3ISPA 2IS1A 3F6OA 1U3EM 1FC3A 3K70C 4HW0A 1G3TA 5DUIA 2DQRA 3T8RA 3H0DA 2BV6A 4DBRA 1JKRC 3A4CA 3I0TA 3HOTA 1YRNB 4B44A 2R5ZB 3S14J 1ETYA 3PIPF 2CUJA 1E17A 2BY1A 4CXFA 2CW8A 3OYHA 2KPMA 2H8WA 2YX7A 1IJWC 3B73A 1E0EA 2GLOA 2VPRA 4YG2F 4AM3A 5K5RA 4A0ZA 1R49A 1ETXA 3FK6A 2NOJB 2GA1A 2IS6A 3FM3A 1I27A 1XGOA 3OIQA 4KIGA 5EZGA 4G94A 5HNHA 2FMLA 1RPWA 1WJCA 1IXCA 4QLCU 3OSGA 3CCQI 5FKKA 2DT6A 1F43A 1ETOA 1D8JA 5BPIA 4EJWA 2P6SA 4WXHA 1CGPA 1U0JA 5DUKA 2VOPA 1LFPA 1JKPC 1B9MA 2QYOA 3GCMA 1U5TB 3OYDA 2R7VA 2M45A 3Q5FA 4P96A 1QNTA 3ZQHA 5E3OA 1FTTA 1IRFA 1Z05A 4FTHA 4A3FJ 2WB1A 3CMAI 1TWGJ 2FJ1A 2JSCA 3C3WA 2YPRA 1MDMA 3F6VA 2OC6A 1KU7A 2XKOA 2R7ZJ 3CUQB 1MMAA 5TGTA 3FBIB 4ABZA 2RN7A 2FRHA 1VQ8I 2OU2A 2NVUB 4Y3OA 3D5RC 1YJWI 1YLFA 2HXIA 3DV8A 5DYMA 2FBIA 2R7SA 5IP6A 2VKDA 5F0HA 2DFFA 3BY6A 4H4KC 5C4JJ 3VB2A 4F91B 4XONA 2VN2A 2YS9A 2MD5A 2P5KA 4FX4A 1I3AA 3WGGA 1HF0A 1FSHA 2HNHA 3CQZJ 3BZCA 1WQ2A 4IL6C 3O8HA 2K9QA 2CQ7A 3HOZJ 1RRJA 4CZCA 3GO5A 3JRBA 3WE3A 4XMYA 2IJLA 3HSEA 1J09A 2HDDA 2L7FP 1FOKA 3K7AJ 1SC7A 1HDPA 2VXZA 3K4CA 4OAYA 4R79A 2QVOA 1V3FA 4OOIA 5CVJA 1TWHJ 1ON2A 3OYKA 2KJBA 2IS4A 3F8MA 1JUMA 2XKPA 1R5GA 4E7HA 4I09A 1MBEA 1RKTA 1Q1HA 2VODA 2A6HF 3J80Z 3JRAA 3FMQA 1FOYA 4UUTA 5D4RA 5J8FA 2EZLA 2E7WA 2GQQA 1ZK8A 2GAUA 1VQ9I 2D1VA 1SFEA 2VB6A 2ID6A 2PMUA 3KCCA 4WXCA 1ZLKA 3KEYA 5J40A 4EJOA 3I3LA 5IP7J 2ZMEC 4WCGA 2E60A 3OYEA 1RUNA 1Z21A 1O3SA 1OCPA 1T95A 3L2QA 2QSFX 5FLXK 5BS6A 3V42A 1N25A 1JHFA 4IHYA 3H1CA 2XC7A 3KYLA 1FY7A 3S3NA 3M1CA 2ZB9A 2VL8A 4QWQA 3ONQA 1ZGWA 1G3SA 2DBBA 3L09A 2JUCA 2L9SA 3D0SA 4BQQA 4JX4A 3VEPA 3IAM2 3OWTA 2IAIA 4AD9A 1R22A 1G3YA 2HOAA 4U7DA 3DEWA 2EZIA 3JREA 1J59A 5D5VB 3KZZA 1K79A 1EH8A 2R7TA 5EF6A 2Y0SA 1W7PB 4M73A 3HKZA 4U0WA 2EK5A 4RGSA 2UXNA 3R0AA 4QPOA 1Y0NA 3JAMZ 2Z1DA 2BY2A 3BQYA 2CGPA 2HYFA 2IGKA 4L5EA 4PJJA 5FKNA 1V5FA 3UKGA 3D5SC 1XMKA 4N9HA 1XTAA 4ENMA 3Q9SA 3LOCA 2GXAA 3GEZA 4E6KG 3FF5A 3GTKJ 4V19K 1IO2A 1GLNA 3ELKA 4DW6A 5AIPA 4BKXA 5HLGA 4XLPF 2M5WA 4MLOA 2FQ3A 1YIOA 5E1ZB 3ABUA 2R7UA 5EEGA 3H0GJ 4HG2A 4BQOA 3HG9A 1SFUA 2PMZA 2X48A 3J7AY 4L18B 2W57A 2OCCH 5BNGA 4NBQA 2XPWA 5IP9J 3OIPA 4MHGA 1WFXA 2L9NA 2FOWA 3W6KB 1UG2A 3CCJI 4OIOF 1AA7A 2RKHA 3E6DA 4XLHA 4B3XA 4EATA 4MNUA 4B4CA 2V9KA 4YIFA 1O3TA 2VT2A 5LGNA 3ERED 3HZJA 1PYVA 3G71I 3LSPA 2K85A 4BEHB 1ORKA 2ADUA 1U9OA 2HFHA 4F92B 2LKXA 1PUFB 3KP7A 3ZMUA 3GFIA 1S5LC 2DCEA 2VJ4A 2BW3B 3OYGA 4P9FA 4UVBA 3WTXC 4RGUA 1MNMC 2ZMEB 2B9SA 1SFXA 2KRHA 2NS8A 3DWLE 3M8JA 1D3YA 5K5OA 1W0TA 1QVTA 2VONA 1FBUA 3FXMA 2VC1A 2PMHA 1RZ4A 4KA4A 2LDUA 1B1BA 4XNFA 3PNTA 1H9GA 2MW8A 1OCOH 4M6YA 4FASD 2AXLA 1IRZA 3K0LA 1RR8C 3EUHA 4I6ZA 3CO7C 3Q0UA 4OINF 1BR1A 4ZTJA 2KJCA 4MO7A 3S2HJ 5GP9A 3V7RA 4R8HA 2WTEA 3DU5A 1G8XA 1FZPB 3PFYA 2CWEA 2Q0OA 3SXYA 2DFHA 2Z5UA 1UZCA 3KLNA 1T08B 1HLVA 1NTCA 4U88A 1IF1A 1B9NA 4Q47A 5H20A 3BQZA 4BNCA 3ABMH 1G6NA 2ZXIA 1K61A 1POGA 2HPMA 2HDWA 4Y33A 4IJAA 3X2QH 4OIQF 3IWFA 4AYBN 5IYCJ 1H0MA 2WC2A 4A3JJ 2LOOA 2QQBA 5CVRA 5ICGA 2XSDC 5GPAA 2EFNA 5F0CA 2VJIA 4P1WA 1HKSA 4LD5A 1O7LA 4HDUA 1BI1A 5AIQA 1IN8A 1A6QA 3LSTA 3RKWA 5GAGJ 1SANA 2VASA 3WHCA 3PJRA 2DYSH 5GAEJ 1QQIA 1JTXA 1JXSA 1A5JA 4JQFA 2LY2A 2FBHA 3I64A 2WV0A 3RKYA 1EA3A 2QM3A 3ZRGA 1EH6A 5LFAA 4UUSA 4YEJA 1TNTA 3G1MA 1OMIA 4O3MA 4A5NA 2QBYA 3ZP5A 1JKOC 1XB4A 1B8IB 2XSJC 3WGIA 2KRCA 1I50J 1QZZA 2OZUA 4PZJA 4ZZLA 2GBYA 5GPCA 1HSJA 3FDYA 4G8XA 5D5WB 3OYNA 1R7JA 3GTQJ 2O6GE 1LE8A 5DTDA 4M3DA 1HQCA 2NYXA 4IOAF 1ZG5A 2EWNA 5LRRA 2K3PA 3NQOA 1V54H 4G6DA 5FFZA 4ZYEA 1R1UA 3FIWA 3VFZA 1XN7A 2HR3A 1V55H 2ACJA 3LSMA 3D5LA 2JSPA 2HVQA 2Q2EA 2NS7A 3QU3A 3CD6I 5J1UA 3AL0C 5D5UB 2VBZA 2DDBA 2OQRA 1D5YA 3CCVI 3ZMTA 3ZGKA 5EEAA 1TWFJ 3LL7A 3JRCA 3NARA 2VT3A 4HQEA 4ESJA 1S7OA 1V5EA 4BU2A 3V8KA 4D7MA 4XLEA 2M1BA 3M8EA 1VQKI 3FMSA 2WAFA 2X6XA 3GYHX 2F2EA 4MEYF 2YU3A 2D1HA 1XMXA 2OPTA 3KYDB 2QCOA 2NAZA 4BJ6C 5IYBJ 3I58A 5LLQA 2DK8A 4L0ZB 1IN6A 1IV8A 2TCTA 2KRFA 3S93A 3DU6A 1YW8A 3NAUA 4BJ5C 3OYBA 2XGCA 1T0FA 1KA8A 1ETWA 1OCCH 2DT7B 1LDJA 3S15J 4AVPA 1TLHB 4Y15A 4RB1A 2M87A 1IRGA 4ZDOA 5GADJ 4UUVA 3IC7A 3BTIA 2J5PA 2KIFA 2M0CA 4UHTA 4WXDA 2DA3A 3ECHA 5DS9A 5E18F 3OYMA 4UXNA 2HZDA 4A0XA 2HQRA 2M8EA 1XC5A 3OIOA 2XB0X 2FU4A 3H9QA 4U7BA 1OCRH 2COMA 3W6JB 2DI3A 3UR3C 1MMDA 3H3UA 4Y13A 4ENKA 3ZMDA 2LYCA 1MSEC 3HOUJ 3CLQA 2ZFUA 1G2HA 1HOMA 2XAFA 1TC3C 4LG0B 2QQ9A 4A3DJ 4LOCA 5GTHC 4XKVA 5F6FA 1R58A 2JA5J 3OYCA 3EQLF 2MC4A 2WAQN 5H2FC 1TT0A 1DPRA 1W5TA 1XCBA 1OLTA 3AG4H 4G6TB 4CDGA 2ZJPF 1YFHA 2FD5A 1MSFC 3GTGJ 3H3VK 5LGUA 3E1SA 2V9PA 1WWXA 3HJEA 3U1KA 1LQ1A 4IPAA 1SD5A 1MMNA 4S04A 2EQRA 3OOUA 3L9FA 1X1CA 3ZMZA 4BL0B 4N0BA 1J5YA 3JRFA 2HU9A 3HIFA 2JMWA 4FE7A 2E1OA 4RLFA 1QBJA 5F64A 3AL0B 2HOEA 3TP3A 3TDZC 3P9CA 2PLYA 2EIJH 1HW1A 2W25A 5M5XJ 2OBPA 4KT5C 3CLOA 5KAFC 5BOXA 2STTA 1FX7A 1XCVA 4LLGF 2VI6A 3TOBA 2Y2ZA 4A12A 3BWGA 5JHFA 2CW7A 2IGNA 5FGMA 2LRDA 2A6TA 3B6CA 1WRJA 3I4NJ 4M74A 1Z9CA 2R7RA 1FOXA 1PP8F 1FYMA 3BG7A 1S8NA 3MCZA 4GYGA 5ICFA 4C3HJ 1K78A 4X1EA 1HC8A 4IQJA 3GWZA 4Y7NJ 1X1PA 2VKVA 2A07F 2PFBA 2E1MC 1XDSA 3OYAA 1GDTA 4F52A 5FD5A 3DEEA 3EUAA 2DFEA 4M9SA 3P9KA 1OJLA 5D8LB 2COBA 2KISA 1P92A 4A3BJ 2DODA 5IT9Z 3RQ4A 3J81K 1YX5A 2CFOA 3QODA 3QYBA 3F22A 5FO5A 2LMDA 6PAXA 4XRSG 3QPSA 4HNUA 1HSTA 3L2RA 2XGEA 2OTJI 1IDZA 3PFIA 4AC0A 3GXOA 4HNVA 3A0HC 2YR2A 2A61A 3HRSA 1IAWA 2HVRA 1LFUP 2Z33A 1R5HA 3WU2C 3KZIC 3FXQA 3KP5A 4II2A 4ZZDA 4JP0A 1X2NA 3U2RA 2N8GA 3LNQA 1DP3A 2CS3A 1S29A 4V2GA 4NQWB 5CQGA 1YQAA 1NG6A 3LA3A 2V79A 3C2HA 3FMRA 1WHUA 3JR9A 5EZHA 3CCLI 3PO2J 3F21A 4XOTA 3WTVC 3SZGA 3V7CA 3CC7I 1JUSA 4CCJA 2X0LA 4B8XA 2ZXWH 4I98B 1GV5A 3MZ8A 2HOTA 1WVRA 3AAFA 2P0WA 2GIZA 4UY8I 4HAMA 1MKMA 3CP2A 1BM9A 1FIPA 5CVIA 3MMYB 5A2QZ 2Y69H 2DA2A 2FNPA 1KQ0A 3CJTB 2STWA 4M3BA 4EGYA 1X1AA 1JUPA 4Y17A 1YS7A 1ZGAA 3BZKA 3LMMA 5HLHA 4L0YB 2K40A 4CCMA 2DYRH 2K3FA 1VQNI 1S6LA 1XX5A 3QAHA 5DDGA 3TO7A 2Y30A 4AIJA 3MAJA 1OPCA 4PUSA 4I0AA 5ICEA 3W2AA 3ZXSA 4PFPA 1JI8A 4ZYGA 4NC7A 5H6RA 4UB6C 3GMEA 1FEXA 2F4OB 2OCEA 3G1OA 1K6YA 2B7EA 4A6EA 1FP1D 2WB1N 2JZYA 1FPQA 1LVAA 2LBFB 4IHTA 1WPKA 4L9NA 5JLXA 1BI2A 2E1MB 2MH9A 2DMNA 3WODF 4E7KA 1XPXA 3ABLH 1UHSA 4HX4A 4C2TA 4JK1X 4AWXB 4XOPA 2VXDA 1MBGA 2M4GA 4TV7A 1SD6A 1VQPI 2XUBA 4C3IJ 1J2XA 1LNWA 3VSKA 2GA2A 2XAHA 4IVNA 3RZOJ 2AQEA 3LSIA 2RV8A 2PJRA 4RLQA 1OYYA 1Z7UA 5ERIA 2HYGD 1T56A 5EG0A 4MFDA 3H5AA 2XHKA 3E5XA 4A0YA 1YI2I 3LFUA 1RETA 2IXSA 1H89C 2PEXA 3K10A 3K70D 2Z9OA 2CQNA 3Q3SA 4XLFA 1WJAA 5FLVA 3L2UA 1MBFA 5C44J 3RPUD 2OV7A 5E8IA 3HL2A 3J7YJ 2EA4A 2EFPA 2K27A 4RGRA 4HRIA 4YFKF 2EPFA 5KVRA 4XICA 1E3HA 3RQIA 3J7ZI 1YO5C 2EIKH 5E1WA 1BIBA 3O8GA 4OIRF 2VIXA 1BC7C 2W85A 5D8KB 3ZQCA 4CYDA 5J47A 1YJ9I 1P4XA 4IHVA 2VKEA 1EV7A 2WADA 4M3FA 2M34A 1Y39A 2I5UA 3BG6A 3OYFA 2A5WA 2OTLI 3B02A 4EMSA 2NVTJ 1YTYA 2BEOA 1WZ2A 4D5CA 5IT3A 4UV8A 1LPQA 3CC4I 2K5CA 3EETA 2NS0A 1MNDA 1UCRA 4D1QA 1ZG3A 1J75A 3FHNA 3H36A 2X1EA 3HRMA 3S32A 3A2KA 2E2HJ 4ENNA 4RA2A 1TZLA 1WKMA 3AG1H 3VYRB 2XPVA 2RREA 3IWZA 3CMMA 5JLWA 5E3MA 1MGTA 1ZRFA 4H0EA 4OIPF 3DTIA 1I1SA 1ZR2A 3OS0A 1XGSA 4CA0A 2W84A 2X1DA 1W7PD 2UUZA 4DZPA 1FTZA 1YOVB 3VYSB 4J19A 3RKQA 1USSA 1Y8QB 2DJIA 3QP6A 3J81Z 2LKSA 3E6BA 3RIRA 4BH9A 4EM2A 3HRTA 5HLTA 2XRNA 1ZARA 1UELB 1J9IA 5FRMA 2Q1ZB 5J8CA 2NVXJ 3IKVA 1KONA 1ZELA 1R5ID 3GVAA 2LK2A 2A3SA 4C30A 5L3DA 4UVAA 1GT0C 4BGDA 5LGTA 4S05A 3ZOBA 2WY7Q 2W48A 2R7FA 3V4GA 3IKTA 4G7ZF 3GTOJ 2JA2A 2BOLA 2W4SA 2YSRA 3BTJA 1QO0D 1OYWA 1HDDC 1Y0UA 5M5WJ 1IN5A 3CDLA 2P4WA 4B09A 4AIDA 3RJPA 2OZ6A 1KU2A 2VLAA 3G1LA 2E19A 5D4SA 3ZMVA 3M8FA 2PMZN 3A01B 4EGZA 2G9WA 5TISC 3LSHA 4E4HA 2RC4A 4RM3A 3U21A 2F5EA 5L3CA 5JVTA 3HOSA 1IDYA 4XLCA 4GXOA 2ICWG 2H6CA 4HLXA 4FETA 1P6RA 2GOXB 4LMYA 5J6XA 1VQ6I 3FZVA 3H5NA 2ZXHA 3TW6A 1USTA 2JTVA 1Z3YA 1PVEA 1YX3A 3WG7H 5D6FA 4YFXF 1RNLA 4E7ZA 1EKEA 1AKHA 1WJDA 1A36A 2LREA 2KT0A 4IRGA 3LAPA 2CU7A 2QQ8A 3AKZA 1TW2A 3P7NA 3E97A 2QSGX 2JPCA 4IEJA 1BR4A 2FQ4A 3VPRA 2QKLB 1K83J 3QOPA 4PK4A 3CESA 4D7NA 2XPUA 1VTNC 2EB7A 3CZ6A 4BXUA 1UJ8A 2GXGA 4EEFG 2JUGA 3OOPA 2CV0A 2IGMA 1GXQA 3BC8A 2LR8A 2RGVA 3SDGA 1ZRCA 4HF1A 3S1MJ 5B1AH 4HF2A 3I4MJ 4BE1A 5EGOB 2QF7A 2E5NA 2X9DA 4KFCA 1P7JA 1Z91A 3LQQA 2XAUA 1KYZA 3LSGA 1Y1WJ 4XLNF 1BBYA 2R7DA 3ASOH 4B1RA 3BR3A 1LE8B 4BBSJ 2DQLA 2R7QA 3A03A 2M9HA 1K7AA 1CF7B 5FB2A 3TP0A 1SAUA 4RB2C 3HC7A 3NEUA 1ETQA 1XG1A 1YW7A 3AG3H 1QGPA 2JVHA 3OMYA 1ZR4A 5HLIA 4A3EJ 2VOOA 4RM2A 3BTCA 1R1VA 1YG2A 3EYYA 2JPBA 5CYVA 1KGSA 3T1BA 4BJTA 4YFNF 1YRNA 1KZHA 4FE4A 5ILVA 2K4BA 2R5ZA 4IXAA 4KIBA 3S3MA 3N05A 1VQMI 1P4WA 3KE2A 4XM3A 4EVIA 3F23A 3IH4A 3P5JA 2CH0A 4LB6B 1XSXA 1Z6RA 2JA7J 2HWVA 4XRMA 3EDPA 5D5XB 2ECCA 2MC3A 3FWEA 1FYLA 2HEOA 2K86A 3SFIA 4QSHA 3RSNA 1FNNA 3BROA 3ZQ7A 3O3KA 3EPZA 3VOEA 2WV1A 1X4PA 2JQ7A 1TP4A 2ESNA 5FKMA 1RR7A 2DA6A 2P81A 3HUGB 1DP7P 2F48A 4XN0A 4CCKA 1X58A 2ELKA 3BG3A 5HDNA 3OR2C 2UWMA 1OR7A 1U5TA 1X4OA 1HA8A 4IHWA 2ELHA 2QA4I 5FD6A 1T33A 1DU6A 4XBFA 2M0MA 1AHDP 2RNJA 2VKHA 1RUOA 1QPMA 1CQTA 4ZDPA 3LA2A 2JK3A 3DPLC 2FUG2 4CYCB 2VBXA 1SFOJ 2V6CA 1WI3A 3CUQA 2E35A 5KNLA 3OV8A 1FMVA 1JT0A 1MZBA 4G9YA 3BPXA 3ZQIA 5HS8A 4G7OF 4K2EA 1WJFA 2DOAA 3BJOA 1P9QC 3MQ0A 3FXKA 3IRQA 4IHSA 4G7HF 2QQAA 4RS8A 3M3YJ 1MBJA 1ZKGA 4KN7X 1OCTC 2NXNB 1R4MB 3R4KA 2DXIA 5J4VA 1NH3A 3OS1A 3PQKA 1XSVA 2OQGA 2ZO4A 5LRSA 1OYIA 1B72B 2LKPA 2MLGA 3FBNB 1T8IA 1MBKA 4XN3A 1YW9A 3QPTA 2TRTA 4BY7J 1Z77A 2E5ZA 3LSJA 4NDLA 1J7KA 1A6IA 3OYLA 3ZQLA 4E7LA 2YX4A 2PG4A 4LLLA 3NWTA 3I4PA 3F8NA 5DM6F 4RAYA 3FHZA 2CYYA 1D1CA 2ZJQF 4W1UA 3CCEI 3H9JA 3K4BA 3K4NA 4EJTA 2M4KA 2O3FA 1SEUA 2DAOA 4Z6YA 3K1MA 3K1PA 1BI3A 3WU0A 3GZ6A 1PDNC 5IOYA 3JCUC 1UFMA 2BYVE 1F36A 3LQRA 4RB3C 3S1QJ 1U8BA 1O7FA 2Y0MA 5EJCA 4M71A 1ETKA 2GWRA 4CGZA 1BJAA 3RDIA 1RIOH 4E70A 4ZC3A 3S3OA 5KHDA 1SVOA 5B5EC 3DLLF 3BZ6A 1ZREA 4C2UA 1Q1VA 3DXJF 3HB9A 4YIRX 2K9NA 2Q8KA 3JRGA 1KYWA 3WHBA 2NVQJ 2E36A 2JJ7A 2GXBA 1AWCA 4RMNA 2L7KA 2FX0A 1Z1DA 3JRIA 1ACIA 2O8KA 2F5VA 3DBHB 2UXXA 2HDCA 4HA8A 2X6OA 4L9TA 4IRIA 4LIVA 3K4LA 3G6EI 3TL4X 3QWLA 2DDAA 5FLXZ 4J01A 1VQLI 1MW7A 2L54A 3HPGA 4MTDA 4UB8C 2XAGA 5K7HA 3F9KA 1O3RA 3PQJA 1Z67A 3IRRA 1Y8RB 2WWYA 1QPIA 2M7BA 2KHMA 3WU1B 1W7PA 1XSDA 1K4SA 2LC2A 4HZFA 3HTUA 2L4MA 1T38A 2ELJA 2LH9A 4M72A 3KP4A 5J3LA 2AO9A 2M30A 2DO7A 2ECBA 2JA8J 4LJZF 2ZJ2A 2DMTA 3CDHA 4A3CJ 1A31A 5E3LA 1HCRA 4GCVA 2EA2A 1RI7A 3SHFA 2BXYA 4F93B 1AU7A 3PNYA 1LKXA 4WX9A 5JVGF 1R71A 2NVYJ 2QUFA 1TW3A 1MBHA 4KT6A 4M6VA 4AUXA 3FXLA 2IVMA 4DIQA 2QKMB 4MQ9F 3F0CA 3R60A 2XASA 4X0GA 3L2CA 1UB9A 3DP7A 2BZTA 3LA7A 4L5IA 1O3QA 1SD7A 4RAFA 3LSRA 3LWFA 2DPUA 5E3NA 4ZH4F 1D1AA 4LFUA 3R0JA 5FFXA 3IUOA 2ZBKA 3I5UA 2FOKA 5J4YA 5FROA 2A05A 1QRYA 2IA2A 3MZHA 3LSKA 1VQ7I 2V6EA 2P8TA 5EEHA 4YELA 3RKXA 2JWTA 2JRTA 3I9V2 1T39A 2KKOA 2RVCA 4KITB 1QVUA 1UMQA 3BP8A 3QOEA 3SZTA 1D5VA 4BEHA 4DYRA 3RPQA 1PUFA 2Y48A 2EV6A 2BW3A 3TDUC 5JFRA 5FRNA 3DKWA 3I71A 3T8TA 4F55A 2ZMEA 4OMZA 4EV0A 2E2JJ 4OAZA 5BMZA 5DCMB 1DQUA 3JSOA 4Q48A 5IPAA 1IN4A 1GVDA 2R5YB 3RZDJ 2E7XA 3QRFF 4P5OA 5CQEA 1Z3XA 2AXTC 3TO6A 1Z6TA 4WWCA 2D2WA 2KZVA 3IHUA 4A3MJ 2ID3A 3W6VA 1BOAA 1D0ZA 2F5CA 4IHXA 1HXDA 1RKWA 2JA6J 2DT5A 3QYFA 5FKLA 1IUYA 2ZXJA 4FCYA 3CMEI 2HVSA 1NG7A 4GYIA 5DV5A 4C9YA 1DUXC 2QSHX 4E7JA 1S3JA 1TTYA 1ZYRF 5L3GA 4DGWB 2IEKA 2MLKA 5M5YJ 1OKRA 2F4IA 1O4XA 1W36C 2KIUA 2IT0A 1T6SA 2L0KA 2J5OA 3PUBA 3S8PA 5ICCA 3MN2A 1R4NB 4ZJZA 5BPDA 2AS5F 2LF8A 2R7XA 4RDUA 3ZR8X 2EJRA 1R1TA 1YHQI 2DN0A 5B66C 2IS2A 2HKXA 5L3FA 1W0UA 2CW0F 3GFJA 1S7AA 3L00A 1XDUA 2DA4A 1X3ZB 4ESBA 3H92A 1TQIA 4N4NB 2V7FA 1NK3P 3QYEA 4Q5SF 1YYVA 1F9NA 4KN4X 4ANJA 2FA5A 3BCAA 2L7MP 2XRLA 4GDFA 2HGCA 3GF2A 2HTJA 2IA0A 2Y75A 3E3VA 2R93J 3DLAA 4F3QA 2H8RA 2LNBA 3GW2A 3H3ZA 1QU3A 5ED4A 4QTRA 1VQ4I 3JTHA 1PJRA 5E8GA 3BR6A 4IO9F 4ASNA 1LB2A 2L4AA 1MH4A 1WCMJ 1LDKB 2CV2A 1IXSB 1WJEA 4XL9A 1MDMB 2PQ8A 1ZRDA 3PSIA 2ETHA 4EQQA 5F1JA 4XIDA 1IUFA 4FT8A 3TO9A 4F7ZA 4I2OA 3RTRA 2LTPA 1EF4A 1TQPA 4A5MA 4GGGA 4C3JJ 1R00A 3IL2A 1ON1A 2Z99A 1FSEA 1ZH5A 3S2DJ 1REPC 3DKXA 5EDNA 5ILUA 2HZTA 2KIMA 4PJNA 1S9HA 2NNNA 1TWCJ 2KFDA 2LF7A 1KU9A 3D1NI 3TQNA 2MYSA 2KP6A 3IH3A 4J00A 2MBFA 2WY8Q 2V1NA 2MG4A 4NUBA 3IV5A 2EFQA 5K5QA 4KUMA 1FMWA 3OYIA 5DD4A 3E7LA 5DD8A 1VQOI 5ILSA 2WBMA 3UNGC 3L1PA 4BBRJ 3ABKH 3GZNB 1HKQA 1MJ9A 4DYQA 4DYCA 2K9MA 4LLNA 1DGWY 1D1BA 1ONVA 1W4MA 3BR1A 3C1DA 3IAS2 4FISA 1B59A 4XORA 4EM0B 2X1CA 3C2BA 4HBLA 1LEBA 4L9JA 2DFIA 3ULQB 4LIUA 2Z2SB 4OU0A 4JOMA 3TEDA 5M3FJ 3G3ZA 2EZHA 4JBAA 1E2XA 2NOGA 1BA5A 3RCOA 5IYDJ 2LLKA 2HKOA 4M9XA 1OR7C 1U5TC 1I6XA 1I5ZA 5FJ8J 3JRDA 4A3KJ 2EV0A 2JT1A 2PBIA 2H1KA 3E6MA 2A68F 3SYTA 2RQQA 4YIIA 4Q4ZF 2E1NA 2H6BA 4LG0A 4V2FA 5BQTA 4UNOA 1LFBA 3CC2I 3HGGA 3KETA 3OS2A 4BAYA 3QP5A 3FXUA 5F0FA 2BVMA 1FLIA 2EILH 4KISA 3BTLA 5HS9A 3ERMA 2XGDA 2CQXA 3W2WA 2AQFA 4PJ0C 1R9TJ 1SD4A 5LD2C 4PSXA 3EUHC 2X4HA 3F3XA 2K7LA 2IW5A 3L7WA 1SFKA 2L9RA 4WF2A 3JAMK 5CKTA 2L02A 4ETSA 3S1RJ 2R4GA 4KMFA 3REOA 1JGSA 2IP2A 5HDKA 4A3LJ 3CF2A 3DBLB 4FX0A 3S2WA 5F08A 1IRXA 4AIHA 4XK4A 2CFXA 2IGOA 3O2PE 1VNDA 3H35A 3K9TA 4I99C 4W97A 2R7WA 1DU0A 1FWZA 2DTRA 4E7IA 3ZN1A 3DCFA 3FKJA 3H9GA 3I54A 3KP2A 1TL8A 4LB5A 1SVMA 1L3LA 4M6XA 1R6RA 1BL0A 2ZJRF 5HVQC 2M8GX 3K4MA 2DW4A 3ECOA 3DKYA 1S72I 4ZDLA 1PUEE 3S17J 1A35A 4OWRB 3VODA 3K1NA 3MKWB 4CUGA 5D6EA 2WA0A 3BR0A 3KLOA 1EH7A 2ZSIB 5LEKA 2Y0SN 3IP4B 2LP0A 4HSTA 4AVZA 3HKZN 1XS9A 1FP2A 1IXRC 2W24A 1F1ZA 5F27A 3KEQA 1Y56A 3TKYA 3PNVA 4EM1A 1MH3A 1P2FA 2HI3A 3AFHA 3PSFA 4M9ZA 5IOZA 3CMYA 1F4KA 3DTEA 1TNSA 4XRSA 1MIJA 4GO1A 1BOBA 1TBXA 1KU3A 3GUDA 3WG9A 3CCSI 3KEOA 3QQAA 2L2OA 2CJJA 4RAZA 2D5VA 3VYUB 1DPUA 3I59A 4II3A 5CJ9A 3CCYA 4U87A 4NQWA 2CMPA 3WGHA 1ZN2A 2V9VA 4XRFA 1R23A 4KIFA 3VYTB 3BJAA 4IKFA 2HQ5A 2BGCA 2K4JA 3SJMA 2VJ5A 3R6SA 3RI4A 3O6BB 3HPHA 1FYKA 2KDZA 3BCBA 1WJ5A 2ZKZA 3PO3J 4BUPA 1VQ5I 2XGXA 1XGMA 4ZYAA 1VF9A 3ZN0A 2OUMA 3P9IA 4XQFA 2BXZA 3FX3A 3OL4A 1ZQ3P 5L3BA 1PP7U 2P6TA 3K2AA 2LD5A 4P9UA 5C3EJ 1T0FC 4D5FA 1QZEA 2IPQX 2BBYA 3ZCOA 3BJ6A 2PI0A 2P7CB 4NNJA 4YRVA 2XF5A 3U9GA 3KP6A 4C2MJ 4NHJA 2O5RA 4HNTA 3ROUA 3MZYA 5TRDA 4IF4A 3CP8A 4RAGA 4XKCA 2NRAC 1U6GA 1X2MA 3JTGA 5HOOA 3G2BA 3A02A 3DF8A 3KFWX 4PJLA 3WTUC 2MSYA 3MWMA 4GFBA 3N97A 2XDVA 2LBFA 2A69F 3CCRI 1KQ8A 2LY9A 2RDPA 2H27A 2TDXA 4UUSB 1D8KA 2HTSA 3LFKA 3CF5F 1HBXG 1JGGA 1G59A 2QBYB 2A5YB 5HNFA 2XF7A 2Z16A 3E5UA 5TJJA 3V8JA 4I76A 2ZFWA 2V1XA 2BY3A 1GHCA 2EFOA 3HBLA 4A3GJ 4G6QA 4L9VA 4BS9A 4U0VA 1MJBA 2F5FA 2L9VA 3SZPA 2QZ8A 2VE8A 2Y9YA 3DFGA 4HSRA 1H88C 2HS5A 1X3UA 2XB5A 2Q2EB 2H94A 2KLOA 2PX9A 3KZYA 4GRIA 3GBGA 3BG9A 4XKWA 4MTEA 1ULYA 1FBSA 2O8XA 3FKIJ 4N4OB 2CSOA 2ZCWA 1G4DA 3GTJJ 2E1CA 2X6YA 3BPVA 1TWAJ 3L2WA 1I6HJ 4U0YA 1I1GA 3EYIA 1DGRM 2V4JC 2CUZA 4CZZA 1IGNA 1I3QJ 3WTZA 2MD0A 2QENA 4PGHA 3GTLJ 4BDYA 3W3CA 5LBQA 3GLLA 4LITA 2MA3A 3TMOA 4JYKA 1X1DA 2ESHA 3A1YA 4BHBA 4CO8A 3CJNA 2L3DA 3DTKA 3GFLA 3CO6C 3VWBA 3HOVJ 3M4OJ 1X19A 3U1DA 4FHTA 4BQNA 2GOMA 1BW5A 5E1XA 5JHUA 3HOYJ 5B1BH 4BXXJ 5DCFA 5K1YA 4BXFA 2CO5A 4HV6A 2VJJA 1H8AC 3Q0VA 4B3AA 2CV1A 4MQVA 1N77A 2E34A 3BG5A 2DMQA 3HDDA 1QA6A 3HXLA 4PCQA 4IOCF 3L2VA 1TT5B 1XMAA 3CCUI 2JRMA 4HOBA 4CHUA 2BHZA 2HQAA 1JT6A 2KZGA 2A6EF 4LG3A 4B43A 4MGRA 4DJAA 2JVGA 2CUEA 3ZQGA 2FMYA 4DNCA 3COAC 1I39A 4HX7A 5JI6A 4CICA 1JHHA 2BY0A 5J1YA 1SVLA 3DEUA 3SFZA 4Y52J 2CRGA 4XR6A 3TW7A 3BDDA 1FJLA 1U2WA 3OSFA 4RBOA 5DM7F 4IZZA 3LAJA 2DA5A 5M3MJ 4KNYA 2I10A 1BW6A 1TQMA 4BYYA 1ZTRA 4Y4RA 2OF7A 2D45A 1Y1VJ 1WSUA 2C6YA 3V8LA 2DTZA 1V4RA 5GTIC 2OD5A 3HHHA 2E71A 5L3EA 3F8FA 3I53A 4O6JA 1OQYA 3RPUA 2Z3YA 4HQMA 3F8CA 2DOEA 2GM4A 1D0XA 3A01A 4ZYHA 4PGGA 2W1OA 3FM5A 5JR3A 3PUFA 3ZPLA 1XD7A 2XAJA 2KMUA 2P7VB 4CCLA 5GAHJ 1WH5A 3I55I 3OL3A 3HTSB 1U78A 3DPTA 3K4JA 2XROA 4DQ2A 2EZKA 2QEXI 3S16J 1XGNA 1IW7F 2EIMH 1MNEA 3PL8A 4UV9A 1LDDA 3MFKA 3F8BA 4XKBA 2GZWA 5E79C 1VZ0A 5HODA 3BR2A 3ZQQA 1K78B 1HW5A 3ZQFA 4I7HA 2XVCA 5IT9K 2VC0A 3FXJA 1A04A 2G7HA 4CSWA 4DBQA 3JRHA 4A6DA 1UHWA 2EBIA 4MIMA 1VI0A 4A2UA 3T0YA 3Q9VA 1LJ9A 4ESFA 4PJMA 1YITI 3SQNA 1B4AA 1QHHD 3BT9A 3GFMA 2HOSA 3G73A 5HDGA 5CLSA 2LSOA 1NK2P 2CG4A 3J7AO 5H6QA 2X6WA 1ZG1A 4BHPA 5EGOA 2O9LA 1ITYA 2DA1A 2DOFA 2I8DA 4ITVA 2B63J 1BJZA 1P4AA 4NC8A 2DK5A 2EH3A 5B3SH 3OY9A 4DOZA 2LVSA 1EJ9A 3OYJA 4N9IA 1YS6A 1BC8C 2ZSHB 2LFBA 2PN6A 1C0WA 1SMTA 1CF7A 1HW2A 3GTPJ 2DPDA 2ZNZA 4EJVA 5A2QK 1OISA 3M9AA 2CUFA 2LY1A 1O57A 2M2EA 2EV5A 2L01A 2OJED 4ON0A 2KDOA 2CQKA 4QIWN 1ODDA 3WTSC 3SDBA 3MEXA 3CDIA 1U9NA 2ZC2A 3FXRA 3HM5A 4HX8A 2O61A 1H9TA 1JTYA 2WAEA 2OA4A 1S7EA 5IY5H 3WTYC 4Z2YA 3E6CC 5LHGA 3CCMI 4JX6A 4BACA 2UZKA 2ME6A 4HLYA 1BN5A 1KQ9A 3HRUA 4I02A 4NB5A 3CJRB 2M7AA 5AONA 3K6GA 3QPHA 1IV6A 9ANTA 4WK8F 2FSWA 3TOAA 4KYWA 5LHHA 2BVLA 5HS7A 1AOYA 1MMGA 4PDKA 2FNAA 4M3GA 2NNYA 2VBWA 2CQQA 4AU7A 2FXAA 3MKZA 3ASNH 1N78A 2Y9ZA 3W2VA 1D0YA 1FT9A 3HEFA 3MKYB 3MD2A 3HUGA 2R3SA 2L7ZA 1ZLJA 4CCNA 1RC9A 4HDVA 1T2KA 3TBIA 3VSLA 1QZYA 1MJAA 1UHMA 3JSPA 5C4XJ 1MD0A 2OAZA 2GIVA 1IN7A 4AYBA 3HOXJ 3GTMJ 1LVKA 1GV2A 1W5CC 2Y31A 2HPIA 2KQRA 3M07A 4HV5A 3HOWJ 3G4SI 4D0PA 1W1WE 3JW4A 1W5SA 3K4KA 2W00A 2XF6A 4L5JA 1ZGJA 2RAEA 4O5VA 4ZYDA 4IX7A 4CYCA 4NC6A 2VBYA 3T5XA 3C18A 1E3PA 1V5GA 2UV1A 2PJRB 2IBDA 1LUJB 3GZ5A 2X51A 5EG0B 4RB0A 2MH2A 3KP3A 5CPRB 1BI0A 4KJZA 1YJNI 1FOWA 4JX5A 3C2GA 2HXOA 3KIOA 2MFZA 2O7OA
chains in the Genus database with same CATH topology
3K69A 1DDNA 3CTAA 4XSXF 3TGNA 2XAQA 4BQAA 3R61A 1IZ1A 4KMUX 5CVUA 1GVJA 5LHIA 3WTTC 3HYIA 1T98A 1B6AA 2XV4S 2HQNA 2IRFG 2P5LC 2VE9A 3WTWC 1K6OA 1SAXA 4KICA 3F72A 3GX4X 5KK1A 2B0LA 1GXPA 4LK1F 5CVVA 3CUOA 3ZMSA 1U8RA 1J0RA 2DLLA 2ZNYA 2FE3A 4BHCA 3DQVC 3N4MA 3E5QA 5DEQA 4I01A 2EFWA 1FBQA 2P5VA 2QWWA 5E20A 4IRHA 2ISYA 2K02A 3BOQA 3M1EA 4HF0A 4LK0F 3I59B 4EJUA 1JE8A 1ZHFA 2V1DA 4R1HA 5E17F 5LEJA 1SMYF 1R36A 4HYEA 2V1UA 4P55A 3WE2A 4UVCA 3ABTA 3RYPA 4AIKA 3QU6A 2BE5F 2PJPA 1STZA 3RYRA 3ML6A 2DU9A 3J80K 2FBKA 3K2ZA 2H09A 1G3WA 4OMYA 3C7JA 2IA1A 3M7GA 3V7SA 4RGXA 2XIGA 2G7UA 2FEZA 4KDPA 1F5TA 1LEAA 3HSFA 2O0YA 1NHAA 1ZAOA 3CUQC 5F1RA 2QLZA 4MEXF 5DCMA 1WI9A 4XSZF 2FF4A 2ISZA 1BIAA 3GLXA 1L0OC 3HSRA 4ENJA 3HHGA 3NRVA 1HKTA 2RQPA 4I0BA 2O03A 4LGWA 2F5DA 3ISPA 3F6OA 1U3EM 1FC3A 4HW0A 1G3TA 5DUIA 2DQRA 3T8RA 2BV6A 3I0TA 3HOTA 1E17A 4CXFA 2YX7A 3B73A 4YG2F 5K5RA 4A0ZA 2GA1A 3FM3A 1I27A 1XGOA 4KIGA 4G94A 2FMLA 4QLCU 1IXCA 1D8JA 5BPIA 4EJWA 2P6SA 4WXHA 1CGPA 5DUKA 2VOPA 1B9MA 2QYOA 1U5TB 2M45A 3Q5FA 4P96A 1QNTA 1IRFA 1Z05A 2JSCA 3C3WA 2YPRA 1MDMA 3F6VA 1KU7A 2XKOA 3CUQB 2RN7A 2FRHA 2OU2A 1YLFA 3DV8A 5DYMA 2FBIA 3BY6A 3VB2A 2VN2A 2MD5A 2P5KA 4FX4A 3WGGA 1FSHA 1WQ2A 3GO5A 3WE3A 2IJLA 3HSEA 1FOKA 2VXZA 4R79A 2QVOA 1V3FA 4OOIA 5CVJA 1ON2A 2KJBA 3F8MA 2XKPA 1R5GA 4I09A 2VODA 1Q1HA 2A6HF 3J80Z 3FMQA 5D4RA 5J8FA 2E7WA 2GQQA 2GAUA 2D1VA 1SFEA 2PMUA 3KCCA 4WXCA 1ZLKA 4EJOA 4WCGA 1RUNA 1O3SA 5FLXK 5BS6A 1JHFA 1FY7A 4QWQA 1G3SA 2DBBA 3L09A 3D0SA 3VEPA 4AD9A 1R22A 1G3YA 4U7DA 1J59A 5D5VB 3KZZA 1K79A 1EH8A 1W7PB 4M73A 4U0WA 2EK5A 4RGSA 2UXNA 3R0AA 3JAMZ 2CGPA 2HYFA 1XMKA 4N9HA 4ENMA 3Q9SA 3GEZA 3FF5A 3ELKA 5AIPA 5HLGA 4XLPF 2M5WA 2FQ3A 1YIOA 5E1ZB 3ABUA 5EEGA 1SFUA 4L18B 2W57A 4MHGA 3W6KB 4OIOF 2RKHA 3E6DA 4MNUA 1O3TA 4YIFA 2VT2A 5LGNA 3ERED 2ADUA 2HFHA 3KP7A 3ZMUA 3GFIA 4P9FA 4UVBA 3WTXC 4RGUA 2ZMEB 1SFXA 1D3YA 5K5OA 2VONA 1FBUA 2VC1A 1RZ4A 2PMHA 4KA4A 2LDUA 1B1BA 1H9GA 4M6YA 2AXLA 3K0LA 3EUHA 3CO7C 4OINF 2KJCA 3V7RA 4R8HA 2WTEA 1FZPB 2CWEA 2Q0OA 3SXYA 3KLNA 2Z5UA 4U88A 1IF1A 1B9NA 4Q47A 5H20A 4BNCA 1G6NA 4OIQF 4IJAA 3IWFA 1H0MA 2WC2A 2QQBA 5CVRA 5ICGA 2EFNA 1HKSA 4LD5A 1O7LA 4HDUA 1BI1A 5AIQA 1IN8A 3LSTA 3RKWA 1QQIA 1JXSA 4JQFA 2FBHA 3I64A 2WV0A 3RKYA 2QM3A 1EH6A 1TNTA 1OMIA 4O3MA 4A5NA 2QBYA 3ZP5A 1XB4A 3WGIA 1QZZA 2OZUA 4PZJA 4ZZLA 1HSJA 4G8XA 5D5WB 1R7JA 2O6GE 1HQCA 2NYXA 1ZG5A 2EWNA 5LRRA 3NQOA 4G6DA 5FFZA 4ZYEA 1R1UA 3VFZA 1XN7A 2HR3A 2ACJA 3D5LA 2Q2EA 3QU3A 5D5UB 2VBZA 2OQRA 3ZMTA 4HQEA 4ESJA 2VT3A 1S7OA 3V8KA 2M1BA 3M8EA 3FMSA 3GYHX 2F2EA 4MEYF 2YU3A 2D1HA 2NAZA 3I58A 5LLQA 2DK8A 4L0ZB 1IN6A 2KRFA 1YW8A 1T0FA 1KA8A 1LDJA 4AVPA 1TLHB 4Y15A 4RB1A 2M87A 1IRGA 4UUVA 3IC7A 2J5PA 2KIFA 4UHTA 4WXDA 3ECHA 5E18F 4UXNA 4A0XA 2HQRA 2M8EA 2FU4A 4U7BA 2COMA 3W6JB 2DI3A 4ENKA 3H3UA 4Y13A 3ZMDA 2XAFA 4LG0B 2QQ9A 5F6FA 1R58A 3EQLF 1W5TA 1DPRA 1XCBA 4CDGA 1YFHA 5LGUA 1WWXA 1LQ1A 4IPAA 1SD5A 4S04A 3L9FA 3ZMZA 4N0BA 1J5YA 3HIFA 1QBJA 5F64A 2HOEA 3TDZC 3P9CA 2PLYA 1HW1A 2W25A 2OBPA 4KT5C 3CLOA 5BOXA 2STTA 1FX7A 1XCVA 4LLGF 3TOBA 4A12A 3BWGA 5FGMA 1WRJA 4M74A 1Z9CA 1PP8F 1FYMA 1S8NA 3MCZA 4GYGA 5ICFA 1K78A 3GWZA 2A07F 2PFBA 1XDSA 5FD5A 4M9SA 3P9KA 5D8LB 1P92A 5IT9Z 3J81K 3F22A 5FO5A 6PAXA 1HSTA 3PFIA 3GXOA 2YR2A 2A61A 3HRSA 1IAWA 2Z33A 1R5HA 3FXQA 3KP5A 4ZZDA 3U2RA 1S29A 1YQAA 3LA3A 2V79A 3FMRA 3F21A 3WTVC 3V7CA 2X0LA 4B8XA 4I98B 3AAFA 4HAMA 1MKMA 1BM9A 5CVIA 5A2QZ 2FNPA 1KQ0A 2STWA 4EGYA 4Y17A 1YS7A 1ZGAA 5HLHA 4L0YB 1S6LA 3QAHA 5DDGA 3TO7A 4AIJA 3MAJA 1OPCA 4I0AA 5ICEA 4ZYGA 5H6RA 4A6EA 1FP1D 2JZYA 1FPQA 1LVAA 4IHTA 4L9NA 1BI2A 2MH9A 3WODF 4HX4A 4JK1X 4AWXB 4TV7A 1SD6A 2XUBA 1J2XA 1LNWA 2GA2A 2XAHA 4IVNA 2RV8A 1OYYA 1Z7UA 5ERIA 2HYGD 2XHKA 3E5XA 4A0YA 2PEXA 2Z9OA 5E8IA 2EA4A 2EFPA 2K27A 4RGRA 4YFKF 5KVRA 1YO5C 5E1WA 1BIBA 4OIRF 1BC7C 2W85A 5D8KB 4CYDA 1P4XA 1EV7A 3B02A 4EMSA 1YTYA 2BEOA 5IT3A 4UV8A 3EETA 2NS0A 1UCRA 1ZG3A 1J75A 3HRMA 4ENNA 1WKMA 3IWZA 1MGTA 1ZRFA 4H0EA 4OIPF 1I1SA 1XGSA 2W84A 1W7PD 1USSA 3QP6A 3J81Z 3E6BA 4BH9A 3RIRA 4EM2A 3HRTA 2XRNA 1ZARA 1J9IA 5J8CA 3IKVA 3GVAA 2A3SA 5L3DA 4UVAA 5LGTA 4S05A 2R7FA 3V4GA 3IKTA 4G7ZF 2YSRA 1QO0D 1OYWA 1Y0UA 1IN5A 2P4WA 4B09A 3RJPA 2OZ6A 1KU2A 5D4SA 3ZMVA 3M8FA 4EGZA 2G9WA 2RC4A 2F5EA 5L3CA 5JVTA 3HOSA 4GXOA 2H6CA 4HLXA 1P6RA 4LMYA 5J6XA 3FZVA 1USTA 2JTVA 5D6FA 4YFXF 1RNLA 3LAPA 4IRGA 1TW2A 3P7NA 3E97A 2JPCA 3QOPA 1VTNC 2EB7A 4BXUA 2GXGA 3OOPA 1GXQA 2RGVA 1ZRCA 4HF1A 4HF2A 4KFCA 1Z91A 3LQQA 1KYZA 4XLNF 1BBYA 2R7DA 2DQLA 1K7AA 1CF7B 5FB2A 4RB2C 3NEUA 1YW7A 1QGPA 5HLIA 2VOOA 1R1VA 1YG2A 3EYYA 2JPBA 5CYVA 1KGSA 3T1BA 4YFNF 5ILVA 2K4BA 4IXAA 4KIBA 1P4WA 3KE2A 4EVIA 3F23A 4LB6B 1XSXA 1Z6RA 2HWVA 3EDPA 5D5XB 2MC3A 3FWEA 1FYLA 2HEOA 2K86A 1FNNA 3BROA 3ZQ7A 3O3KA 3VOEA 2ESNA 1DP7P 5HDNA 2UWMA 1OR7A 1U5TA 2ELHA 5FD6A 4XBFA 2RNJA 1RUOA 1QPMA 3LA2A 3DPLC 2VBXA 2V6CA 3CUQA 3OV8A 1MZBA 4G9YA 3BPXA 5HS8A 4G7OF 4K2EA 3BJOA 3MQ0A 3IRQA 4IHSA 4G7HF 2QQAA 4RS8A 4KN7X 3R4KA 3PQKA 1XSVA 2OQGA 2ZO4A 5LRSA 1OYIA 2LKPA 2MLGA 1YW9A 3QPTA 1J7KA 2YX4A 2PG4A 4LLLA 3I4PA 3F8NA 4RAYA 3FHZA 2CYYA 4EJTA 2O3FA 2DAOA 3K1MA 3K1PA 1BI3A 3WU0A 3GZ6A 1PDNC 1UFMA 2BYVE 3LQRA 4RB3C 1O7FA 2Y0MA 4M71A 2GWRA 4CGZA 1BJAA 3RDIA 1RIOH 4E70A 3BZ6A 1ZREA 3DXJF 2Q8KA 1KYWA 2GXBA 1AWCA 1Z1DA 2UXXA 2HDCA 4HA8A 4L9TA 4IRIA 5FLXZ 2L54A 4MTDA 2XAGA 1O3RA 3PQJA 3IRRA 2WWYA 3WU1B 1W7PA 1XSDA 4HZFA 3HTUA 2L4MA 1T38A 4M72A 3KP4A 2M30A 2DO7A 4LJZF 2ZJ2A 3CDHA 4GCVA 2EA2A 1RI7A 3SHFA 4WX9A 2QUFA 1TW3A 2IVMA 4MQ9F 3R60A 2XASA 3L2CA 1UB9A 3DP7A 3LA7A 4L5IA 1O3QA 1SD7A 3LWFA 2DPUA 4ZH4F 4LFUA 3R0JA 5FFXA 2ZBKA 3I5UA 2FOKA 2IA2A 3MZHA 2P8TA 5EEHA 3RKXA 2JRTA 1T39A 2KKOA 2RVCA 1D5VA 3BP8A 3SZTA 3RPQA 2Y48A 2EV6A 3TDUC 5JFRA 3DKWA 3I71A 3T8TA 2ZMEA 4OMZA 4EV0A 5BMZA 5DCMB 3JSOA 4Q48A 1IN4A 2E7XA 3QRFF 4P5OA 3TO6A 1Z6TA 4WWCA 2D2WA 3IHUA 1BOAA 2F5CA 1HXDA 2DT5A 1IUYA 2ZXJA 4GYIA 5DV5A 1DUXC 1S3JA 1TTYA 1ZYRF 5L3GA 2MLKA 1OKRA 2KIUA 2IT0A 1T6SA 2J5OA 5ICCA 5BPDA 2AS5F 2LF8A 2EJRA 1R1TA 2HKXA 5L3FA 2CW0F 3GFJA 1S7AA 3L00A 1XDUA 4ESBA 3H92A 1TQIA 4Q5SF 1YYVA 1F9NA 4KN4X 2FA5A 2HGCA 3GF2A 2HTJA 2IA0A 2Y75A 3E3VA 2LNBA 3GW2A 3H3ZA 5ED4A 3JTHA 5E8GA 4ASNA 1LB2A 2L4AA 1LDKB 1IXSB 1MDMB 2PQ8A 1ZRDA 2ETHA 4EQQA 4FT8A 3TO9A 4F7ZA 4I2OA 3RTRA 1TQPA 4A5MA 4GGGA 1R00A 3IL2A 1ON1A 2Z99A 1FSEA 1ZH5A 1REPC 5ILUA 2HZTA 2KIMA 2NNNA 2LF7A 1KU9A 3TQNA 2MBFA 2EFQA 5K5QA 4KUMA 5DD4A 5DD8A 5ILSA 1HKQA 1MJ9A 4LLNA 1ONVA 1W4MA 3C1DA 1B59A 4EM0B 4HBLA 1LEBA 4L9JA 2DFIA 3ULQB 4OU0A 3G3ZA 4JBAA 1E2XA 2HKOA 4M9XA 1U5TC 1I6XA 1I5ZA 2EV0A 2JT1A 2PBIA 3E6MA 2A68F 4YIIA 4Q4ZF 2E1NA 2H6BA 4LG0A 5BQTA 4UNOA 3KETA 4BAYA 3QP5A 3FXUA 1FLIA 5HS9A 1SD4A 2X4HA 3F3XA 2K7LA 2IW5A 3L7WA 4WF2A 3JAMK 2L02A 4ETSA 4KMFA 3REOA 1JGSA 2IP2A 5HDKA 4FX0A 3S2WA 4AIHA 2CFXA 3O2PE 3K9TA 1FWZA 2DTRA 3ZN1A 3I54A 3KP2A 4LB5A 1L3LA 4M6XA 5HVQC 2DW4A 3ECOA 1PUEE 3VODA 3K1NA 5D6EA 3KLOA 1EH7A 5LEKA 1FP2A 1IXRC 2W24A 1F1ZA 3KEQA 3TKYA 4EM1A 1P2FA 4M9ZA 1F4KA 1TNSA 4GO1A 1TBXA 1KU3A 3GUDA 3WG9A 3KEOA 4RAZA 1DPUA 3I59A 5CJ9A 3WGHA 4NQWA 1ZN2A 2V9VA 4XRFA 1R23A 4KIFA 3BJAA 2BGCA 2K4JA 3R6SA 3RI4A 3O6BB 1FYKA 2ZKZA 2XGXA 1XGMA 3ZN0A 3P9IA 3FX3A 5L3BA 1PP7U 2P6TA 4P9UA 2IPQX 2BBYA 3BJ6A 2PI0A 2P7CB 3U9GA 3KP6A 4NHJA 5TRDA 3ROUA 3MZYA 4IF4A 2NRAC 1U6GA 3JTGA 5HOOA 3DF8A 3KFWX 3WTUC 3MWMA 3N97A 2A69F 1KQ8A 2RDPA 2H27A 2TDXA 1D8KA 2HTSA 3LFKA 1HBXG 2QBYB 2A5YB 3E5UA 5TJJA 3V8JA 2ZFWA 2V1XA 1GHCA 2EFOA 4G6QA 4L9VA 4U0VA 1MJBA 2F5FA 3SZPA 2QZ8A 2VE8A 3DFGA 2HS5A 1X3UA 2H94A 3KZYA 4MTEA 1ULYA 1FBSA 2O8XA 2CSOA 2ZCWA 1G4DA 2E1CA 3BPVA 4U0YA 1I1GA 3EYIA 4CZZA 3WTZA 2QENA 4PGHA 5LBQA 2MA3A 2ESHA 4BHBA 4CO8A 3CJNA 2L3DA 3GFLA 3CO6C 3U1DA 4FHTA 5E1XA 5JHUA 5DCFA 5K1YA 2CO5A 4HV6A 4MQVA 4PCQA 1XMAA 4HOBA 4CHUA 2A6EF 4MGRA 2FMYA 4DNCA 3COAC 4HX7A 5JI6A 4CICA 1JHHA 3DEUA 3SFZA 3BDDA 1U2WA 3LAJA 4KNYA 1TQMA 4BYYA 2D45A 1WSUA 2C6YA 3V8LA 1V4RA 2OD5A 3HHHA 5L3EA 3F8FA 3I53A 4O6JA 3RPUA 2Z3YA 4HQMA 3F8CA 4ZYHA 4PGGA 3FM5A 5JR3A 3ZPLA 1XD7A 2XAJA 2P7VB 3HTSB 1U78A 3DPTA 2XROA 4DQ2A 1XGNA 1IW7F 4UV9A 1LDDA 3MFKA 3F8BA 2GZWA 1K78B 1HW5A 4I7HA 2XVCA 5IT9K 2VC0A 1A04A 2G7HA 4A6DA 1UHWA 4A2UA 3T0YA 3Q9VA 1LJ9A 4ESFA 3SQNA 1B4AA 3GFMA 3G73A 5HDGA 5CLSA 2LSOA 2CG4A 3J7AO 5H6QA 1ZG1A 4BHPA 1P4AA 2DK5A 4N9IA 1YS6A 1BC8C 2PN6A 1C0WA 1SMTA 1CF7A 1HW2A 2DPDA 2ZNZA 4EJVA 5A2QK 3M9AA 1O57A 2EV5A 2L01A 4ON0A 2CQKA 1ODDA 3WTSC 3MEXA 3FXRA 4HX8A 2O61A 1H9TA 2OA4A 3WTYC 4Z2YA 3E6CC 5LHGA 2UZKA 4HLYA 1BN5A 1KQ9A 3HRUA 4I02A 4NB5A 5AONA 3QPHA 4WK8F 2FSWA 3TOAA 4KYWA 5LHHA 5HS7A 1AOYA 4PDKA 2FNAA 2NNYA 2VBWA 2FXAA 1FT9A 3HUGA 2R3SA 4HDVA 1ZLJA 1T2KA 1QZYA 1MJAA 1UHMA 3JSPA 1MD0A 2OAZA 2GIVA 1IN7A 4HV5A 4D0PA 3JW4A 1W5SA 4L5JA 1ZGJA 4O5VA 4ZYDA 2VBYA 3T5XA 3C18A 3GZ5A 4RB0A 2MH2A 3KP3A 1BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K69 A;  1DDN A;  3CTA A;  4XSX F;  3TGN A;  2XAQ A;  4BQA A;  3R61 A;  1IZ1 A;  4KMU X;  5CVU A;  1GVJ A;  5LHI A;  3WTT C;  3HYI A;  1T98 A;  1B6A A;  2XV4 S;  2HQN A;  2IRF G;  2P5L C;  2VE9 A;  3WTW C;  1K6O A;  1SAX A;  4KIC A;  3F72 A;  3GX4 X;  5KK1 A;  2B0L A;  1GXP A;  4LK1 F;  5CVV A;  3CUO A;  3ZMS A;  1U8R A;  1J0R A;  2DLL A;  2ZNY A;  2FE3 A;  4BHC A;  3DQV C;  3N4M A;  3E5Q A;  5DEQ A;  4I01 A;  2EFW A;  1FBQ A;  2P5V A;  2QWW A;  5E20 A;  4IRH A;  2ISY A;  2K02 A;  3BOQ A;  3M1E A;  4HF0 A;  4LK0 F;  3I59 B;  4EJU A;  1JE8 A;  1ZHF A;  2V1D A;  4R1H A;  5E17 F;  5LEJ A;  1SMY F;  1R36 A;  4HYE A;  2V1U A;  4P55 A;  3WE2 A;  4UVC A;  3ABT A;  3RYP A;  4AIK A;  3QU6 A;  2BE5 F;  2PJP A;  1STZ A;  3RYR A;  3ML6 A;  2DU9 A;  3J80 K;  2FBK A;  3K2Z A;  2H09 A;  1G3W A;  4OMY A;  3C7J A;  2IA1 A;  3M7G A;  3V7S A;  4RGX A;  2XIG A;  2G7U A;  2FEZ A;  4KDP A;  1F5T A;  1LEA A;  3HSF A;  2O0Y A;  1NHA A;  1ZAO A;  3CUQ C;  5F1R A;  2QLZ A;  4MEX F;  5DCM A;  1WI9 A;  4XSZ F;  2FF4 A;  2ISZ A;  1BIA A;  3GLX A;  1L0O C;  3HSR A;  4ENJ A;  3HHG A;  3NRV A;  1HKT A;  2RQP A;  4I0B A;  2O03 A;  4LGW A;  2F5D A;  3ISP A;  3F6O A;  1U3E M;  1FC3 A;  4HW0 A;  1G3T A;  5DUI A;  2DQR A;  3T8R A;  2BV6 A;  3I0T A;  3HOT A;  1E17 A;  4CXF A;  2YX7 A;  3B73 A;  4YG2 F;  5K5R A;  4A0Z A;  2GA1 A;  3FM3 A;  1I27 A;  1XGO A;  4KIG A;  4G94 A;  2FML A;  4QLC U;  1IXC A;  1D8J A;  5BPI A;  4EJW A;  2P6S A;  4WXH A;  1CGP A;  5DUK A;  2VOP A;  1B9M A;  2QYO A;  1U5T B;  2M45 A;  3Q5F A;  4P96 A;  1QNT A;  1IRF A;  1Z05 A;  2JSC A;  3C3W A;  2YPR A;  1MDM A;  3F6V A;  1KU7 A;  2XKO A;  3CUQ B;  2RN7 A;  2FRH A;  2OU2 A;  1YLF A;  3DV8 A;  5DYM A;  2FBI A;  3BY6 A;  3VB2 A;  2VN2 A;  2MD5 A;  2P5K A;  4FX4 A;  3WGG A;  1FSH A;  1WQ2 A;  3GO5 A;  3WE3 A;  2IJL A;  3HSE A;  1FOK A;  2VXZ A;  4R79 A;  2QVO A;  1V3F A;  4OOI A;  5CVJ A;  1ON2 A;  2KJB A;  3F8M A;  2XKP A;  1R5G A;  4I09 A;  2VOD A;  1Q1H A;  2A6H F;  3J80 Z;  3FMQ A;  5D4R A;  5J8F A;  2E7W A;  2GQQ A;  2GAU A;  2D1V A;  1SFE A;  2PMU A;  3KCC A;  4WXC A;  1ZLK A;  4EJO A;  4WCG A;  1RUN A;  1O3S A;  5FLX K;  5BS6 A;  1JHF A;  1FY7 A;  4QWQ A;  1G3S A;  2DBB A;  3L09 A;  3D0S A;  3VEP A;  4AD9 A;  1R22 A;  1G3Y A;  4U7D A;  1J59 A;  5D5V B;  3KZZ A;  1K79 A;  1EH8 A;  1W7P B;  4M73 A;  4U0W A;  2EK5 A;  4RGS A;  2UXN A;  3R0A A;  3JAM Z;  2CGP A;  2HYF A;  1XMK A;  4N9H A;  4ENM A;  3Q9S A;  3GEZ A;  3FF5 A;  3ELK A;  5AIP A;  5HLG A;  4XLP F;  2M5W A;  2FQ3 A;  1YIO A;  5E1Z B;  3ABU A;  5EEG A;  1SFU A;  4L18 B;  2W57 A;  4MHG A;  3W6K B;  4OIO F;  2RKH A;  3E6D A;  4MNU A;  1O3T A;  4YIF A;  2VT2 A;  5LGN A;  3ERE D;  2ADU A;  2HFH A;  3KP7 A;  3ZMU A;  3GFI A;  4P9F A;  4UVB A;  3WTX C;  4RGU A;  2ZME B;  1SFX A;  1D3Y A;  5K5O A;  2VON A;  1FBU A;  2VC1 A;  1RZ4 A;  2PMH A;  4KA4 A;  2LDU A;  1B1B A;  1H9G A;  4M6Y A;  2AXL A;  3K0L A;  3EUH A;  3CO7 C;  4OIN F;  2KJC A;  3V7R A;  4R8H A;  2WTE A;  1FZP B;  2CWE A;  2Q0O A;  3SXY A;  3KLN A;  2Z5U A;  4U88 A;  1IF1 A;  1B9N A;  4Q47 A;  5H20 A;  4BNC A;  1G6N A;  4OIQ F;  4IJA A;  3IWF A;  1H0M A;  2WC2 A;  2QQB A;  5CVR A;  5ICG A;  2EFN A;  1HKS A;  4LD5 A;  1O7L A;  4HDU A;  1BI1 A;  5AIQ A;  1IN8 A;  3LST A;  3RKW A;  1QQI A;  1JXS A;  4JQF A;  2FBH A;  3I64 A;  2WV0 A;  3RKY A;  2QM3 A;  1EH6 A;  1TNT A;  1OMI A;  4O3M A;  4A5N A;  2QBY A;  3ZP5 A;  1XB4 A;  3WGI A;  1QZZ A;  2OZU A;  4PZJ A;  4ZZL A;  1HSJ A;  4G8X A;  5D5W B;  1R7J A;  2O6G E;  1HQC A;  2NYX A;  1ZG5 A;  2EWN A;  5LRR A;  3NQO A;  4G6D A;  5FFZ A;  4ZYE A;  1R1U A;  3VFZ A;  1XN7 A;  2HR3 A;  2ACJ A;  3D5L A;  2Q2E A;  3QU3 A;  5D5U B;  2VBZ A;  2OQR A;  3ZMT A;  4HQE A;  4ESJ A;  2VT3 A;  1S7O A;  3V8K A;  2M1B A;  3M8E A;  3FMS A;  3GYH X;  2F2E A;  4MEY F;  2YU3 A;  2D1H A;  2NAZ A;  3I58 A;  5LLQ A;  2DK8 A;  4L0Z B;  1IN6 A;  2KRF A;  1YW8 A;  1T0F A;  1KA8 A;  1LDJ A;  4AVP A;  1TLH B;  4Y15 A;  4RB1 A;  2M87 A;  1IRG A;  4UUV A;  3IC7 A;  2J5P A;  2KIF A;  4UHT A;  4WXD A;  3ECH A;  5E18 F;  4UXN A;  4A0X A;  2HQR A;  2M8E A;  2FU4 A;  4U7B A;  2COM A;  3W6J B;  2DI3 A;  4ENK A;  3H3U A;  4Y13 A;  3ZMD A;  2XAF A;  4LG0 B;  2QQ9 A;  5F6F A;  1R58 A;  3EQL F;  1W5T A;  1DPR A;  1XCB A;  4CDG A;  1YFH A;  5LGU A;  1WWX A;  1LQ1 A;  4IPA A;  1SD5 A;  4S04 A;  3L9F A;  3ZMZ A;  4N0B A;  1J5Y A;  3HIF A;  1QBJ A;  5F64 A;  2HOE A;  3TDZ C;  3P9C A;  2PLY A;  1HW1 A;  2W25 A;  2OBP A;  4KT5 C;  3CLO A;  5BOX A;  2STT A;  1FX7 A;  1XCV A;  4LLG F;  3TOB A;  4A12 A;  3BWG A;  5FGM A;  1WRJ A;  4M74 A;  1Z9C A;  1PP8 F;  1FYM A;  1S8N A;  3MCZ A;  4GYG A;  5ICF A;  1K78 A;  3GWZ A;  2A07 F;  2PFB A;  1XDS A;  5FD5 A;  4M9S A;  3P9K A;  5D8L B;  1P92 A;  5IT9 Z;  3J81 K;  3F22 A;  5FO5 A;  6PAX A;  1HST A;  3PFI A;  3GXO A;  2YR2 A;  2A61 A;  3HRS A;  1IAW A;  2Z33 A;  1R5H A;  3FXQ A;  3KP5 A;  4ZZD A;  3U2R A;  1S29 A;  1YQA A;  3LA3 A;  2V79 A;  3FMR A;  3F21 A;  3WTV C;  3V7C A;  2X0L A;  4B8X A;  4I98 B;  3AAF A;  4HAM A;  1MKM A;  1BM9 A;  5CVI A;  5A2Q Z;  2FNP A;  1KQ0 A;  2STW A;  4EGY A;  4Y17 A;  1YS7 A;  1ZGA A;  5HLH A;  4L0Y B;  1S6L A;  3QAH A;  5DDG A;  3TO7 A;  4AIJ A;  3MAJ A;  1OPC A;  4I0A A;  5ICE A;  4ZYG A;  5H6R A;  4A6E A;  1FP1 D;  2JZY A;  1FPQ A;  1LVA A;  4IHT A;  4L9N A;  1BI2 A;  2MH9 A;  3WOD F;  4HX4 A;  4JK1 X;  4AWX B;  4TV7 A;  1SD6 A;  2XUB A;  1J2X A;  1LNW A;  2GA2 A;  2XAH A;  4IVN A;  2RV8 A;  1OYY A;  1Z7U A;  5ERI A;  2HYG D;  2XHK A;  3E5X A;  4A0Y A;  2PEX A;  2Z9O A;  5E8I A;  2EA4 A;  2EFP A;  2K27 A;  4RGR A;  4YFK F;  5KVR A;  1YO5 C;  5E1W A;  1BIB A;  4OIR F;  1BC7 C;  2W85 A;  5D8K B;  4CYD A;  1P4X A;  1EV7 A;  3B02 A;  4EMS A;  1YTY A;  2BEO A;  5IT3 A;  4UV8 A;  3EET A;  2NS0 A;  1UCR A;  1ZG3 A;  1J75 A;  3HRM A;  4ENN A;  1WKM A;  3IWZ A;  1MGT A;  1ZRF A;  4H0E A;  4OIP F;  1I1S A;  1XGS A;  2W84 A;  1W7P D;  1USS A;  3QP6 A;  3J81 Z;  3E6B A;  4BH9 A;  3RIR A;  4EM2 A;  3HRT A;  2XRN A;  1ZAR A;  1J9I A;  5J8C A;  3IKV A;  3GVA A;  2A3S A;  5L3D A;  4UVA A;  5LGT A;  4S05 A;  2R7F A;  3V4G A;  3IKT A;  4G7Z F;  2YSR A;  1QO0 D;  1OYW A;  1Y0U A;  1IN5 A;  2P4W A;  4B09 A;  3RJP A;  2OZ6 A;  1KU2 A;  5D4S A;  3ZMV A;  3M8F A;  4EGZ A;  2G9W A;  2RC4 A;  2F5E A;  5L3C A;  5JVT A;  3HOS A;  4GXO A;  2H6C A;  4HLX A;  1P6R A;  4LMY A;  5J6X A;  3FZV A;  1UST A;  2JTV A;  5D6F A;  4YFX F;  1RNL A;  3LAP A;  4IRG A;  1TW2 A;  3P7N A;  3E97 A;  2JPC A;  3QOP A;  1VTN C;  2EB7 A;  4BXU A;  2GXG A;  3OOP A;  1GXQ A;  2RGV A;  1ZRC A;  4HF1 A;  4HF2 A;  4KFC A;  1Z91 A;  3LQQ A;  1KYZ A;  4XLN F;  1BBY A;  2R7D A;  2DQL A;  1K7A A;  1CF7 B;  5FB2 A;  4RB2 C;  3NEU A;  1YW7 A;  1QGP A;  5HLI A;  2VOO A;  1R1V A;  1YG2 A;  3EYY A;  2JPB A;  5CYV A;  1KGS A;  3T1B A;  4YFN F;  5ILV A;  2K4B A;  4IXA A;  4KIB A;  1P4W A;  3KE2 A;  4EVI A;  3F23 A;  4LB6 B;  1XSX A;  1Z6R A;  2HWV A;  3EDP A;  5D5X B;  2MC3 A;  3FWE A;  1FYL A;  2HEO A;  2K86 A;  1FNN A;  3BRO A;  3ZQ7 A;  3O3K A;  3VOE A;  2ESN A;  1DP7 P;  5HDN A;  2UWM A;  1OR7 A;  1U5T A;  2ELH A;  5FD6 A;  4XBF A;  2RNJ A;  1RUO A;  1QPM A;  3LA2 A;  3DPL C;  2VBX A;  2V6C A;  3CUQ A;  3OV8 A;  1MZB A;  4G9Y A;  3BPX A;  5HS8 A;  4G7O F;  4K2E A;  3BJO A;  3MQ0 A;  3IRQ A;  4IHS A;  4G7H F;  2QQA A;  4RS8 A;  4KN7 X;  3R4K A;  3PQK A;  1XSV A;  2OQG A;  2ZO4 A;  5LRS A;  1OYI A;  2LKP A;  2MLG A;  1YW9 A;  3QPT A;  1J7K A;  2YX4 A;  2PG4 A;  4LLL A;  3I4P A;  3F8N A;  4RAY A;  3FHZ A;  2CYY A;  4EJT A;  2O3F A;  2DAO A;  3K1M A;  3K1P A;  1BI3 A;  3WU0 A;  3GZ6 A;  1PDN C;  1UFM A;  2BYV E;  3LQR A;  4RB3 C;  1O7F A;  2Y0M A;  4M71 A;  2GWR A;  4CGZ A;  1BJA A;  3RDI A;  1RIO H;  4E70 A;  3BZ6 A;  1ZRE A;  3DXJ F;  2Q8K A;  1KYW A;  2GXB A;  1AWC A;  1Z1D A;  2UXX A;  2HDC A;  4HA8 A;  4L9T A;  4IRI A;  5FLX Z;  2L54 A;  4MTD A;  2XAG A;  1O3R A;  3PQJ A;  3IRR A;  2WWY A;  3WU1 B;  1W7P A;  1XSD A;  4HZF A;  3HTU A;  2L4M A;  1T38 A;  4M72 A;  3KP4 A;  2M30 A;  2DO7 A;  4LJZ F;  2ZJ2 A;  3CDH A;  4GCV A;  2EA2 A;  1RI7 A;  3SHF A;  4WX9 A;  2QUF A;  1TW3 A;  2IVM A;  4MQ9 F;  3R60 A;  2XAS A;  3L2C A;  1UB9 A;  3DP7 A;  3LA7 A;  4L5I A;  1O3Q A;  1SD7 A;  3LWF A;  2DPU A;  4ZH4 F;  4LFU A;  3R0J A;  5FFX A;  2ZBK A;  3I5U A;  2FOK A;  2IA2 A;  3MZH A;  2P8T A;  5EEH A;  3RKX A;  2JRT A;  1T39 A;  2KKO A;  2RVC A;  1D5V A;  3BP8 A;  3SZT A;  3RPQ A;  2Y48 A;  2EV6 A;  3TDU C;  5JFR A;  3DKW A;  3I71 A;  3T8T A;  2ZME A;  4OMZ A;  4EV0 A;  5BMZ A;  5DCM B;  3JSO A;  4Q48 A;  1IN4 A;  2E7X A;  3QRF F;  4P5O A;  3TO6 A;  1Z6T A;  4WWC A;  2D2W A;  3IHU A;  1BOA A;  2F5C A;  1HXD A;  2DT5 A;  1IUY A;  2ZXJ A;  4GYI A;  5DV5 A;  1DUX C;  1S3J A;  1TTY A;  1ZYR F;  5L3G A;  2MLK A;  1OKR A;  2KIU A;  2IT0 A;  1T6S A;  2J5O A;  5ICC A;  5BPD A;  2AS5 F;  2LF8 A;  2EJR A;  1R1T A;  2HKX A;  5L3F A;  2CW0 F;  3GFJ A;  1S7A A;  3L00 A;  1XDU A;  4ESB A;  3H92 A;  1TQI A;  4Q5S F;  1YYV A;  1F9N A;  4KN4 X;  2FA5 A;  2HGC A;  3GF2 A;  2HTJ A;  2IA0 A;  2Y75 A;  3E3V A;  2LNB A;  3GW2 A;  3H3Z A;  5ED4 A;  3JTH A;  5E8G A;  4ASN A;  1LB2 A;  2L4A A;  1LDK B;  1IXS B;  1MDM B;  2PQ8 A;  1ZRD A;  2ETH A;  4EQQ A;  4FT8 A;  3TO9 A;  4F7Z A;  4I2O A;  3RTR A;  1TQP A;  4A5M A;  4GGG A;  1R00 A;  3IL2 A;  1ON1 A;  2Z99 A;  1FSE A;  1ZH5 A;  1REP C;  5ILU A;  2HZT A;  2KIM A;  2NNN A;  2LF7 A;  1KU9 A;  3TQN A;  2MBF A;  2EFQ A;  5K5Q A;  4KUM A;  5DD4 A;  5DD8 A;  5ILS A;  1HKQ A;  1MJ9 A;  4LLN A;  1ONV A;  1W4M A;  3C1D A;  1B59 A;  4EM0 B;  4HBL A;  1LEB A;  4L9J A;  2DFI A;  3ULQ B;  4OU0 A;  3G3Z A;  4JBA A;  1E2X A;  2HKO A;  4M9X A;  1U5T C;  1I6X A;  1I5Z A;  2EV0 A;  2JT1 A;  2PBI A;  3E6M A;  2A68 F;  4YII A;  4Q4Z F;  2E1N A;  2H6B A;  4LG0 A;  5BQT A;  4UNO A;  3KET A;  4BAY A;  3QP5 A;  3FXU A;  1FLI A;  5HS9 A;  1SD4 A;  2X4H A;  3F3X A;  2K7L A;  2IW5 A;  3L7W A;  4WF2 A;  3JAM K;  2L02 A;  4ETS A;  4KMF A;  3REO A;  1JGS A;  2IP2 A;  5HDK A;  4FX0 A;  3S2W A;  4AIH A;  2CFX A;  3O2P E;  3K9T A;  1FWZ A;  2DTR A;  3ZN1 A;  3I54 A;  3KP2 A;  4LB5 A;  1L3L A;  4M6X A;  5HVQ C;  2DW4 A;  3ECO A;  1PUE E;  3VOD A;  3K1N A;  5D6E A;  3KLO A;  1EH7 A;  5LEK A;  1FP2 A;  1IXR C;  2W24 A;  1F1Z A;  3KEQ A;  3TKY A;  4EM1 A;  1P2F A;  4M9Z A;  1F4K A;  1TNS A;  4GO1 A;  1TBX A;  1KU3 A;  3GUD A;  3WG9 A;  3KEO A;  4RAZ A;  1DPU A;  3I59 A;  5CJ9 A;  3WGH A;  4NQW A;  1ZN2 A;  2V9V A;  4XRF A;  1R23 A;  4KIF A;  3BJA A;  2BGC A;  2K4J A;  3R6S A;  3RI4 A;  3O6B B;  1FYK A;  2ZKZ A;  2XGX A;  1XGM A;  3ZN0 A;  3P9I A;  3FX3 A;  5L3B A;  1PP7 U;  2P6T A;  4P9U A;  2IPQ X;  2BBY A;  3BJ6 A;  2PI0 A;  2P7C B;  3U9G A;  3KP6 A;  4NHJ A;  5TRD A;  3ROU A;  3MZY A;  4IF4 A;  2NRA C;  1U6G A;  3JTG A;  5HOO A;  3DF8 A;  3KFW X;  3WTU C;  3MWM A;  3N97 A;  2A69 F;  1KQ8 A;  2RDP A;  2H27 A;  2TDX A;  1D8K A;  2HTS A;  3LFK A;  1HBX G;  2QBY B;  2A5Y B;  3E5U A;  5TJJ A;  3V8J A;  2ZFW A;  2V1X A;  1GHC A;  2EFO A;  4G6Q A;  4L9V A;  4U0V A;  1MJB A;  2F5F A;  3SZP A;  2QZ8 A;  2VE8 A;  3DFG A;  2HS5 A;  1X3U A;  2H94 A;  3KZY A;  4MTE A;  1ULY A;  1FBS A;  2O8X A;  2CSO A;  2ZCW A;  1G4D A;  2E1C A;  3BPV A;  4U0Y A;  1I1G A;  3EYI A;  4CZZ A;  3WTZ A;  2QEN A;  4PGH A;  5LBQ A;  2MA3 A;  2ESH A;  4BHB A;  4CO8 A;  3CJN A;  2L3D A;  3GFL A;  3CO6 C;  3U1D A;  4FHT A;  5E1X A;  5JHU A;  5DCF A;  5K1Y A;  2CO5 A;  4HV6 A;  4MQV A;  4PCQ A;  1XMA A;  4HOB A;  4CHU A;  2A6E F;  4MGR A;  2FMY A;  4DNC A;  3COA C;  4HX7 A;  5JI6 A;  4CIC A;  1JHH A;  3DEU A;  3SFZ A;  3BDD A;  1U2W A;  3LAJ A;  4KNY A;  1TQM A;  4BYY A;  2D45 A;  1WSU A;  2C6Y A;  3V8L A;  1V4R A;  2OD5 A;  3HHH A;  5L3E A;  3F8F A;  3I53 A;  4O6J A;  3RPU A;  2Z3Y A;  4HQM A;  3F8C A;  4ZYH A;  4PGG A;  3FM5 A;  5JR3 A;  3ZPL A;  1XD7 A;  2XAJ A;  2P7V B;  3HTS B;  1U78 A;  3DPT A;  2XRO A;  4DQ2 A;  1XGN A;  1IW7 F;  4UV9 A;  1LDD A;  3MFK A;  3F8B A;  2GZW A;  1K78 B;  1HW5 A;  4I7H A;  2XVC A;  5IT9 K;  2VC0 A;  1A04 A;  2G7H A;  4A6D A;  1UHW A;  4A2U A;  3T0Y A;  3Q9V A;  1LJ9 A;  4ESF A;  3SQN A;  1B4A A;  3GFM A;  3G73 A;  5HDG A;  5CLS A;  2LSO A;  2CG4 A;  3J7A O;  5H6Q A;  1ZG1 A;  4BHP A;  1P4A A;  2DK5 A;  4N9I A;  1YS6 A;  1BC8 C;  2PN6 A;  1C0W A;  1SMT A;  1CF7 A;  1HW2 A;  2DPD A;  2ZNZ A;  4EJV A;  5A2Q K;  3M9A A;  1O57 A;  2EV5 A;  2L01 A;  4ON0 A;  2CQK A;  1ODD A;  3WTS C;  3MEX A;  3FXR A;  4HX8 A;  2O61 A;  1H9T A;  2OA4 A;  3WTY C;  4Z2Y A;  3E6C C;  5LHG A;  2UZK A;  4HLY A;  1BN5 A;  1KQ9 A;  3HRU A;  4I02 A;  4NB5 A;  5AON A;  3QPH A;  4WK8 F;  2FSW A;  3TOA A;  4KYW A;  5LHH A;  5HS7 A;  1AOY A;  4PDK A;  2FNA A;  2NNY A;  2VBW A;  2FXA A;  1FT9 A;  3HUG A;  2R3S A;  4HDV A;  1ZLJ A;  1T2K A;  1QZY A;  1MJA A;  1UHM A;  3JSP A;  1MD0 A;  2OAZ A;  2GIV A;  1IN7 A;  4HV5 A;  4D0P A;  3JW4 A;  1W5S A;  4L5J A;  1ZGJ A;  4O5V A;  4ZYD A;  2VBY A;  3T5X A;  3C18 A;  3GZ5 A;  4RB0 A;  2MH2 A;  3KP3 A;  1BI0 A; 
#chains in the Genus database with same CATH topology
 1WH7 A;  3K69 A;  5K7Z A;  3PM1 A;  1DDN A;  2K9L A;  3CTA A;  5FKO A;  3I56 I;  4A93 J;  2MAB A;  2KL4 A;  1YIJ I;  1YE9 A;  4XSX F;  3TGN A;  1JJ8 C;  1B72 A;  5KCM A;  2XAQ A;  4BQA A;  3QPL A;  3SEQ A;  3R61 A;  1W36 D;  1IZ1 A;  4KMU X;  1RES A;  5CVU A;  1GVJ A;  5LHI A;  3WTT C;  3S1N J;  3HYI A;  5EYR A;  1UAA A;  1T98 A;  1B6A A;  2XV4 S;  1ETV A;  2R0Q C;  2HQN A;  4FQG A;  2IRF G;  2P5L C;  2E2I J;  2VE9 A;  1MMS A;  1FIA A;  2JN6 A;  2VQH A;  3WTW C;  4HPQ A;  4PFO A;  2VUM J;  2F4M B;  2HYJ A;  1K6O A;  1SAX A;  4KIC A;  4IQ4 A;  1ERD A;  1BR2 A;  3F72 A;  3BR5 A;  3B6A A;  1GUU A;  3GX4 X;  5KK1 A;  2B0L A;  2AHQ A;  2LG4 A;  4HEA 2;  3FK7 A;  1GXP A;  2W82 A;  4LK1 F;  2RNG A;  3DPU A;  5CVV A;  1M1E B;  2R7O A;  3KPH A;  2DA7 A;  1N75 A;  2MGQ A;  4DZJ A;  3CUO A;  3ZMS A;  1U8R A;  1IC8 A;  2VQL A;  5J1R A;  1J0R A;  4G12 A;  2DLL A;  2ZNY A;  1B8I A;  2FE3 A;  2VPL A;  4BE0 A;  4X6A J;  4MFE A;  2DJN A;  1OCZ H;  3CJQ B;  4B48 A;  2G0E A;  2KIQ A;  2V26 A;  2L5Q A;  3KYC B;  5F04 A;  2VQC A;  4BHC A;  3DBR B;  1VFC A;  3MVP A;  3DQV C;  3SEZ A;  1QHG A;  3N4M A;  3E5Q A;  5DEQ A;  3ESW B;  4I01 A;  3HGY A;  2EFW A;  2W7N A;  1FBQ A;  3Q0W A;  2P5V A;  2QWW A;  2VQG A;  5E20 A;  4IRH A;  2ISY A;  2K02 A;  4PSW A;  3FIS A;  3BOQ A;  1E3O C;  3BLY A;  3M1E A;  1UG0 A;  4B47 A;  2DMP A;  4HF0 A;  1Z0X A;  4LK0 F;  3I59 B;  4EJU A;  1Z7L A;  4A3I J;  1ZHF A;  2V1D A;  1JE8 A;  4R1H A;  5E17 F;  5LEJ A;  5KAI C;  1SMY F;  2BHY A;  1APL C;  1R36 A;  3AG2 H;  4M3E A;  4HYE A;  2V1U A;  5FLM J;  2QGU A;  3IH2 A;  4E7S A;  2WAQ A;  4P55 A;  1IG7 A;  3WE2 A;  4UVC A;  2F6C A;  4BY1 J;  3ABT A;  3RYP A;  4AIK A;  3QU6 A;  2K9S A;  2BE5 F;  2PJP A;  1STZ A;  3RYR A;  3MKL A;  1JKQ C;  3ML6 A;  3E0J B;  2R92 J;  2DU9 A;  3J80 K;  2YU9 J;  3VDX A;  2FBK A;  3FXO A;  2M3A A;  3K2Z A;  3H5R A;  2H09 A;  1G3W A;  4BE2 A;  1X3W B;  4OMY A;  3C7J A;  4QPQ A;  5K7F A;  2IA1 A;  3M7G A;  1AKH B;  3V7S A;  1Y6I A;  4S0H B;  2H1L A;  2X85 A;  4CH7 A;  4RGX A;  1WJB A;  3PIO F;  2XIG A;  1ENH A;  2G7U A;  3A0B C;  3EUK L;  2FEZ A;  3OR1 C;  4KDP A;  1F5T A;  4ZTF A;  1LEA A;  4D9J A;  1WGX A;  3HSF A;  2O0Y A;  1NHA A;  2ME0 A;  1ZAO A;  3CUQ C;  3NWS A;  5F1R A;  2QLZ A;  2EIN H;  3KX2 A;  4BDZ A;  2YUS A;  4MEX F;  5DCM A;  1WI9 A;  4XSZ F;  2FF4 A;  1P7I A;  1X1B A;  2ISZ A;  1BIA A;  1K4T A;  3GLX A;  2R5Y A;  1L0O C;  2DMU A;  1JJ6 C;  4A69 C;  3HSR A;  4ENJ A;  4XLA A;  3HHG A;  3NRV A;  1HKT A;  2RQP A;  4I0B A;  4CCO A;  2O03 A;  1OFC X;  4LGW A;  2F5D A;  3ISP A;  2IS1 A;  3F6O A;  1U3E M;  1FC3 A;  3K70 C;  4HW0 A;  1G3T A;  5DUI A;  2DQR A;  3T8R A;  3H0D A;  2BV6 A;  4DBR A;  1JKR C;  3A4C A;  3I0T A;  3HOT A;  1YRN B;  4B44 A;  2R5Z B;  3S14 J;  1ETY A;  3PIP F;  2CUJ A;  1E17 A;  2BY1 A;  4CXF A;  2CW8 A;  3OYH A;  2KPM A;  2H8W A;  2YX7 A;  1IJW C;  3B73 A;  1E0E A;  2GLO A;  2VPR A;  4YG2 F;  4AM3 A;  5K5R A;  4A0Z A;  1R49 A;  1ETX A;  3FK6 A;  2NOJ B;  2GA1 A;  2IS6 A;  3FM3 A;  1I27 A;  1XGO A;  3OIQ A;  4KIG A;  5EZG A;  4G94 A;  5HNH A;  2FML A;  1RPW A;  1WJC A;  1IXC A;  4QLC U;  3OSG A;  3CCQ I;  5FKK A;  2DT6 A;  1F43 A;  1ETO A;  1D8J A;  5BPI A;  4EJW A;  2P6S A;  4WXH A;  1CGP A;  1U0J A;  5DUK A;  2VOP A;  1LFP A;  1JKP C;  1B9M A;  2QYO A;  3GCM A;  1U5T B;  3OYD A;  2R7V A;  2M45 A;  3Q5F A;  4P96 A;  1QNT A;  3ZQH A;  5E3O A;  1FTT A;  1IRF A;  1Z05 A;  4FTH A;  4A3F J;  2WB1 A;  3CMA I;  1TWG J;  2FJ1 A;  2JSC A;  3C3W A;  2YPR A;  1MDM A;  3F6V A;  2OC6 A;  1KU7 A;  2XKO A;  2R7Z J;  3CUQ B;  1MMA A;  5TGT A;  3FBI B;  4ABZ A;  2RN7 A;  2FRH A;  1VQ8 I;  2OU2 A;  2NVU B;  4Y3O A;  3D5R C;  1YJW I;  1YLF A;  2HXI A;  3DV8 A;  5DYM A;  2FBI A;  2R7S A;  5IP6 A;  2VKD A;  5F0H A;  2DFF A;  3BY6 A;  4H4K C;  5C4J J;  3VB2 A;  4F91 B;  4XON A;  2VN2 A;  2YS9 A;  2MD5 A;  2P5K A;  4FX4 A;  1I3A A;  3WGG A;  1HF0 A;  1FSH A;  2HNH A;  3CQZ J;  3BZC A;  1WQ2 A;  4IL6 C;  3O8H A;  2K9Q A;  2CQ7 A;  3HOZ J;  1RRJ A;  4CZC A;  3GO5 A;  3JRB A;  3WE3 A;  4XMY A;  2IJL A;  3HSE A;  1J09 A;  2HDD A;  2L7F P;  1FOK A;  3K7A J;  1SC7 A;  1HDP A;  2VXZ A;  3K4C A;  4OAY A;  4R79 A;  2QVO A;  1V3F A;  4OOI A;  5CVJ A;  1TWH J;  1ON2 A;  3OYK A;  2KJB A;  2IS4 A;  3F8M A;  1JUM A;  2XKP A;  1R5G A;  4E7H A;  4I09 A;  1MBE A;  1RKT A;  1Q1H A;  2VOD A;  2A6H F;  3J80 Z;  3JRA A;  3FMQ A;  1FOY A;  4UUT A;  5D4R A;  5J8F A;  2EZL A;  2E7W A;  2GQQ A;  1ZK8 A;  2GAU A;  1VQ9 I;  2D1V A;  1SFE A;  2VB6 A;  2ID6 A;  2PMU A;  3KCC A;  4WXC A;  1ZLK A;  3KEY A;  5J40 A;  4EJO A;  3I3L A;  5IP7 J;  2ZME C;  4WCG A;  2E60 A;  3OYE A;  1RUN A;  1Z21 A;  1O3S A;  1OCP A;  1T95 A;  3L2Q A;  2QSF X;  5FLX K;  5BS6 A;  3V42 A;  1N25 A;  1JHF A;  4IHY A;  3H1C A;  2XC7 A;  3KYL A;  1FY7 A;  3S3N A;  3M1C A;  2ZB9 A;  2VL8 A;  4QWQ A;  3ONQ A;  1ZGW A;  1G3S A;  2DBB A;  3L09 A;  2JUC A;  2L9S A;  3D0S A;  4BQQ A;  4JX4 A;  3VEP A;  3IAM 2;  3OWT A;  2IAI A;  4AD9 A;  1R22 A;  1G3Y A;  2HOA A;  4U7D A;  3DEW A;  2EZI A;  3JRE A;  1J59 A;  5D5V B;  3KZZ A;  1K79 A;  1EH8 A;  2R7T A;  5EF6 A;  2Y0S A;  1W7P B;  4M73 A;  3HKZ A;  4U0W A;  2EK5 A;  4RGS A;  2UXN A;  3R0A A;  4QPO A;  1Y0N A;  3JAM Z;  2Z1D A;  2BY2 A;  3BQY A;  2CGP A;  2HYF A;  2IGK A;  4L5E A;  4PJJ A;  5FKN A;  1V5F A;  3UKG A;  3D5S C;  1XMK A;  4N9H A;  1XTA A;  4ENM A;  3Q9S A;  3LOC A;  2GXA A;  3GEZ A;  4E6K G;  3FF5 A;  3GTK J;  4V19 K;  1IO2 A;  1GLN A;  3ELK A;  4DW6 A;  5AIP A;  4BKX A;  5HLG A;  4XLP F;  2M5W A;  4MLO A;  2FQ3 A;  1YIO A;  5E1Z B;  3ABU A;  2R7U A;  5EEG A;  3H0G J;  4HG2 A;  4BQO A;  3HG9 A;  1SFU A;  2PMZ A;  2X48 A;  3J7A Y;  4L18 B;  2W57 A;  2OCC H;  5BNG A;  4NBQ A;  2XPW A;  5IP9 J;  3OIP A;  4MHG A;  1WFX A;  2L9N A;  2FOW A;  3W6K B;  1UG2 A;  3CCJ I;  4OIO F;  1AA7 A;  2RKH A;  3E6D A;  4XLH A;  4B3X A;  4EAT A;  4MNU A;  4B4C A;  2V9K A;  4YIF A;  1O3T A;  2VT2 A;  5LGN A;  3ERE D;  3HZJ A;  1PYV A;  3G71 I;  3LSP A;  2K85 A;  4BEH B;  1ORK A;  2ADU A;  1U9O A;  2HFH A;  4F92 B;  2LKX A;  1PUF B;  3KP7 A;  3ZMU A;  3GFI A;  1S5L C;  2DCE A;  2VJ4 A;  2BW3 B;  3OYG A;  4P9F A;  4UVB A;  3WTX C;  4RGU A;  1MNM C;  2ZME B;  2B9S A;  1SFX A;  2KRH A;  2NS8 A;  3DWL E;  3M8J A;  1D3Y A;  5K5O A;  1W0T A;  1QVT A;  2VON A;  1FBU A;  3FXM A;  2VC1 A;  2PMH A;  1RZ4 A;  4KA4 A;  2LDU A;  1B1B A;  4XNF A;  3PNT A;  1H9G A;  2MW8 A;  1OCO H;  4M6Y A;  4FAS D;  2AXL A;  1IRZ A;  3K0L A;  1RR8 C;  3EUH A;  4I6Z A;  3CO7 C;  3Q0U A;  4OIN F;  1BR1 A;  4ZTJ A;  2KJC A;  4MO7 A;  3S2H J;  5GP9 A;  3V7R A;  4R8H A;  2WTE A;  3DU5 A;  1G8X A;  1FZP B;  3PFY A;  2CWE A;  2Q0O A;  3SXY A;  2DFH A;  2Z5U A;  1UZC A;  3KLN A;  1T08 B;  1HLV A;  1NTC A;  4U88 A;  1IF1 A;  1B9N A;  4Q47 A;  5H20 A;  3BQZ A;  4BNC A;  3ABM H;  1G6N A;  2ZXI A;  1K61 A;  1POG A;  2HPM A;  2HDW A;  4Y33 A;  4IJA A;  3X2Q H;  4OIQ F;  3IWF A;  4AYB N;  5IYC J;  1H0M A;  2WC2 A;  4A3J J;  2LOO A;  2QQB A;  5CVR A;  5ICG A;  2XSD C;  5GPA A;  2EFN A;  5F0C A;  2VJI A;  4P1W A;  1HKS A;  4LD5 A;  1O7L A;  4HDU A;  1BI1 A;  5AIQ A;  1IN8 A;  1A6Q A;  3LST A;  3RKW A;  5GAG J;  1SAN A;  2VAS A;  3WHC A;  3PJR A;  2DYS H;  5GAE J;  1QQI A;  1JTX A;  1JXS A;  1A5J A;  4JQF A;  2LY2 A;  2FBH A;  3I64 A;  2WV0 A;  3RKY A;  1EA3 A;  2QM3 A;  3ZRG A;  1EH6 A;  5LFA A;  4UUS A;  4YEJ A;  1TNT A;  3G1M A;  1OMI A;  4O3M A;  4A5N A;  2QBY A;  3ZP5 A;  1JKO C;  1XB4 A;  1B8I B;  2XSJ C;  3WGI A;  2KRC A;  1I50 J;  1QZZ A;  2OZU A;  4PZJ A;  4ZZL A;  2GBY A;  5GPC A;  1HSJ A;  3FDY A;  4G8X A;  5D5W B;  3OYN A;  1R7J A;  3GTQ J;  2O6G E;  1LE8 A;  5DTD A;  4M3D A;  1HQC A;  2NYX A;  4IOA F;  1ZG5 A;  2EWN A;  5LRR A;  2K3P A;  3NQO A;  1V54 H;  4G6D A;  5FFZ A;  4ZYE A;  1R1U A;  3FIW A;  3VFZ A;  1XN7 A;  2HR3 A;  1V55 H;  2ACJ A;  3LSM A;  3D5L A;  2JSP A;  2HVQ A;  2Q2E A;  2NS7 A;  3QU3 A;  3CD6 I;  5J1U A;  3AL0 C;  5D5U B;  2VBZ A;  2DDB A;  2OQR A;  1D5Y A;  3CCV I;  3ZMT A;  3ZGK A;  5EEA A;  1TWF J;  3LL7 A;  3JRC A;  3NAR A;  2VT3 A;  4HQE A;  4ESJ A;  1S7O A;  1V5E A;  4BU2 A;  3V8K A;  4D7M A;  4XLE A;  2M1B A;  3M8E A;  1VQK I;  3FMS A;  2WAF A;  2X6X A;  3GYH X;  2F2E A;  4MEY F;  2YU3 A;  2D1H A;  1XMX A;  2OPT A;  3KYD B;  2QCO A;  2NAZ A;  4BJ6 C;  5IYB J;  3I58 A;  5LLQ A;  2DK8 A;  4L0Z B;  1IN6 A;  1IV8 A;  2TCT A;  2KRF A;  3S93 A;  3DU6 A;  1YW8 A;  3NAU A;  4BJ5 C;  3OYB A;  2XGC A;  1T0F A;  1KA8 A;  1ETW A;  1OCC H;  2DT7 B;  1LDJ A;  3S15 J;  4AVP A;  1TLH B;  4Y15 A;  4RB1 A;  2M87 A;  1IRG A;  4ZDO A;  5GAD J;  4UUV A;  3IC7 A;  3BTI A;  2J5P A;  2KIF A;  2M0C A;  4UHT A;  4WXD A;  2DA3 A;  3ECH A;  5DS9 A;  5E18 F;  3OYM A;  4UXN A;  2HZD A;  4A0X A;  2HQR A;  2M8E A;  1XC5 A;  3OIO A;  2XB0 X;  2FU4 A;  3H9Q A;  4U7B A;  1OCR H;  2COM A;  3W6J B;  2DI3 A;  3UR3 C;  1MMD A;  3H3U A;  4Y13 A;  4ENK A;  3ZMD A;  2LYC A;  1MSE C;  3HOU J;  3CLQ A;  2ZFU A;  1G2H A;  1HOM A;  2XAF A;  1TC3 C;  4LG0 B;  2QQ9 A;  4A3D J;  4LOC A;  5GTH C;  4XKV A;  5F6F A;  1R58 A;  2JA5 J;  3OYC A;  3EQL F;  2MC4 A;  2WAQ N;  5H2F C;  1TT0 A;  1DPR A;  1W5T A;  1XCB A;  1OLT A;  3AG4 H;  4G6T B;  4CDG A;  2ZJP F;  1YFH A;  2FD5 A;  1MSF C;  3GTG J;  3H3V K;  5LGU A;  3E1S A;  2V9P A;  1WWX A;  3HJE A;  3U1K A;  1LQ1 A;  4IPA A;  1SD5 A;  1MMN A;  4S04 A;  2EQR A;  3OOU A;  3L9F A;  1X1C A;  3ZMZ A;  4BL0 B;  4N0B A;  1J5Y A;  3JRF A;  2HU9 A;  3HIF A;  2JMW A;  4FE7 A;  2E1O A;  4RLF A;  1QBJ A;  5F64 A;  3AL0 B;  2HOE A;  3TP3 A;  3TDZ C;  3P9C A;  2PLY A;  2EIJ H;  1HW1 A;  2W25 A;  5M5X J;  2OBP A;  4KT5 C;  3CLO A;  5KAF C;  5BOX A;  2STT A;  1FX7 A;  1XCV A;  4LLG F;  2VI6 A;  3TOB A;  2Y2Z A;  4A12 A;  3BWG A;  5JHF A;  2CW7 A;  2IGN A;  5FGM A;  2LRD A;  2A6T A;  3B6C A;  1WRJ A;  3I4N J;  4M74 A;  1Z9C A;  2R7R A;  1FOX A;  1PP8 F;  1FYM A;  3BG7 A;  1S8N A;  3MCZ A;  4GYG A;  5ICF A;  4C3H J;  1K78 A;  4X1E A;  1HC8 A;  4IQJ A;  3GWZ A;  4Y7N J;  1X1P A;  2VKV A;  2A07 F;  2PFB A;  2E1M C;  1XDS A;  3OYA A;  1GDT A;  4F52 A;  5FD5 A;  3DEE A;  3EUA A;  2DFE A;  4M9S A;  3P9K A;  1OJL A;  5D8L B;  2COB A;  2KIS A;  1P92 A;  4A3B J;  2DOD A;  5IT9 Z;  3RQ4 A;  3J81 K;  1YX5 A;  2CFO A;  3QOD A;  3QYB A;  3F22 A;  5FO5 A;  2LMD A;  6PAX A;  4XRS G;  3QPS A;  4HNU A;  1HST A;  3L2R A;  2XGE A;  2OTJ I;  1IDZ A;  3PFI A;  4AC0 A;  3GXO A;  4HNV A;  3A0H C;  2YR2 A;  2A61 A;  3HRS A;  1IAW A;  2HVR A;  1LFU P;  2Z33 A;  1R5H A;  3WU2 C;  3KZI C;  3FXQ A;  3KP5 A;  4II2 A;  4ZZD A;  4JP0 A;  1X2N A;  3U2R A;  2N8G A;  3LNQ A;  1DP3 A;  2CS3 A;  1S29 A;  4V2G A;  4NQW B;  5CQG A;  1YQA A;  1NG6 A;  3LA3 A;  2V79 A;  3C2H A;  3FMR A;  1WHU A;  3JR9 A;  5EZH A;  3CCL I;  3PO2 J;  3F21 A;  4XOT A;  3WTV C;  3SZG A;  3V7C A;  3CC7 I;  1JUS A;  4CCJ A;  2X0L A;  4B8X A;  2ZXW H;  4I98 B;  1GV5 A;  3MZ8 A;  2HOT A;  1WVR A;  3AAF A;  2P0W A;  2GIZ A;  4UY8 I;  4HAM A;  1MKM A;  3CP2 A;  1BM9 A;  1FIP A;  5CVI A;  3MMY B;  5A2Q Z;  2Y69 H;  2DA2 A;  2FNP A;  1KQ0 A;  3CJT B;  2STW A;  4M3B A;  4EGY A;  1X1A A;  1JUP A;  4Y17 A;  1YS7 A;  1ZGA A;  3BZK A;  3LMM A;  5HLH A;  4L0Y B;  2K40 A;  4CCM A;  2DYR H;  2K3F A;  1VQN I;  1S6L A;  1XX5 A;  3QAH A;  5DDG A;  3TO7 A;  2Y30 A;  4AIJ A;  3MAJ A;  1OPC A;  4PUS A;  4I0A A;  5ICE A;  3W2A A;  3ZXS A;  4PFP A;  1JI8 A;  4ZYG A;  4NC7 A;  5H6R A;  4UB6 C;  3GME A;  1FEX A;  2F4O B;  2OCE A;  3G1O A;  1K6Y A;  2B7E A;  4A6E A;  1FP1 D;  2WB1 N;  2JZY A;  1FPQ A;  1LVA A;  2LBF B;  4IHT A;  1WPK A;  4L9N A;  5JLX A;  1BI2 A;  2E1M B;  2MH9 A;  2DMN A;  3WOD F;  4E7K A;  1XPX A;  3ABL H;  1UHS A;  4HX4 A;  4C2T A;  4JK1 X;  4AWX B;  4XOP A;  2VXD A;  1MBG A;  2M4G A;  4TV7 A;  1SD6 A;  1VQP I;  2XUB A;  4C3I J;  1J2X A;  1LNW A;  3VSK A;  2GA2 A;  2XAH A;  4IVN A;  3RZO J;  2AQE A;  3LSI A;  2RV8 A;  2PJR A;  4RLQ A;  1OYY A;  1Z7U A;  5ERI A;  2HYG D;  1T56 A;  5EG0 A;  4MFD A;  3H5A A;  2XHK A;  3E5X A;  4A0Y A;  1YI2 I;  3LFU A;  1RET A;  2IXS A;  1H89 C;  2PEX A;  3K10 A;  3K70 D;  2Z9O A;  2CQN A;  3Q3S A;  4XLF A;  1WJA A;  5FLV A;  3L2U A;  1MBF A;  5C44 J;  3RPU D;  2OV7 A;  5E8I A;  3HL2 A;  3J7Y J;  2EA4 A;  2EFP A;  2K27 A;  4RGR A;  4HRI A;  4YFK F;  2EPF A;  5KVR A;  4XIC A;  1E3H A;  3RQI A;  3J7Z I;  1YO5 C;  2EIK H;  5E1W A;  1BIB A;  3O8G A;  4OIR F;  2VIX A;  1BC7 C;  2W85 A;  5D8K B;  3ZQC A;  4CYD A;  5J47 A;  1YJ9 I;  1P4X A;  4IHV A;  2VKE A;  1EV7 A;  2WAD A;  4M3F A;  2M34 A;  1Y39 A;  2I5U A;  3BG6 A;  3OYF A;  2A5W A;  2OTL I;  3B02 A;  4EMS A;  2NVT J;  1YTY A;  2BEO A;  1WZ2 A;  4D5C A;  5IT3 A;  4UV8 A;  1LPQ A;  3CC4 I;  2K5C A;  3EET A;  2NS0 A;  1MND A;  1UCR A;  4D1Q A;  1ZG3 A;  1J75 A;  3FHN A;  3H36 A;  2X1E A;  3HRM A;  3S32 A;  3A2K A;  2E2H J;  4ENN A;  4RA2 A;  1TZL A;  1WKM A;  3AG1 H;  3VYR B;  2XPV A;  2RRE A;  3IWZ A;  3CMM A;  5JLW A;  5E3M A;  1MGT A;  1ZRF A;  4H0E A;  4OIP F;  3DTI A;  1I1S A;  1ZR2 A;  3OS0 A;  1XGS A;  4CA0 A;  2W84 A;  2X1D A;  1W7P D;  2UUZ A;  4DZP A;  1FTZ A;  1YOV B;  3VYS B;  4J19 A;  3RKQ A;  1USS A;  1Y8Q B;  2DJI A;  3QP6 A;  3J81 Z;  2LKS A;  3E6B A;  3RIR A;  4BH9 A;  4EM2 A;  3HRT A;  5HLT A;  2XRN A;  1ZAR A;  1UEL B;  1J9I A;  5FRM A;  2Q1Z B;  5J8C A;  2NVX J;  3IKV A;  1KON A;  1ZEL A;  1R5I D;  3GVA A;  2LK2 A;  2A3S A;  4C30 A;  5L3D A;  4UVA A;  1GT0 C;  4BGD A;  5LGT A;  4S05 A;  3ZOB A;  2WY7 Q;  2W48 A;  2R7F A;  3V4G A;  3IKT A;  4G7Z F;  3GTO J;  2JA2 A;  2BOL A;  2W4S A;  2YSR A;  3BTJ A;  1QO0 D;  1OYW A;  1HDD C;  1Y0U A;  5M5W J;  1IN5 A;  3CDL A;  2P4W A;  4B09 A;  4AID A;  3RJP A;  2OZ6 A;  1KU2 A;  2VLA A;  3G1L A;  2E19 A;  5D4S A;  3ZMV A;  3M8F A;  2PMZ N;  3A01 B;  4EGZ A;  2G9W A;  5TIS C;  3LSH A;  4E4H A;  2RC4 A;  4RM3 A;  3U21 A;  2F5E A;  5L3C A;  5JVT A;  3HOS A;  1IDY A;  4XLC A;  4GXO A;  2ICW G;  2H6C A;  4HLX A;  4FET A;  1P6R A;  2GOX B;  4LMY A;  5J6X A;  1VQ6 I;  3FZV A;  3H5N A;  2ZXH A;  3TW6 A;  1UST A;  2JTV A;  1Z3Y A;  1PVE A;  1YX3 A;  3WG7 H;  5D6F A;  4YFX F;  1RNL A;  4E7Z A;  1EKE A;  1AKH A;  1WJD A;  1A36 A;  2LRE A;  2KT0 A;  4IRG A;  3LAP A;  2CU7 A;  2QQ8 A;  3AKZ A;  1TW2 A;  3P7N A;  3E97 A;  2QSG X;  2JPC A;  4IEJ A;  1BR4 A;  2FQ4 A;  3VPR A;  2QKL B;  1K83 J;  3QOP A;  4PK4 A;  3CES A;  4D7N A;  2XPU A;  1VTN C;  2EB7 A;  3CZ6 A;  4BXU A;  1UJ8 A;  2GXG A;  4EEF G;  2JUG A;  3OOP A;  2CV0 A;  2IGM A;  1GXQ A;  3BC8 A;  2LR8 A;  2RGV A;  3SDG A;  1ZRC A;  4HF1 A;  3S1M J;  5B1A H;  4HF2 A;  3I4M J;  4BE1 A;  5EGO B;  2QF7 A;  2E5N A;  2X9D A;  4KFC A;  1P7J A;  1Z91 A;  3LQQ A;  2XAU A;  1KYZ A;  3LSG A;  1Y1W J;  4XLN F;  1BBY A;  2R7D A;  3ASO H;  4B1R A;  3BR3 A;  1LE8 B;  4BBS J;  2DQL A;  2R7Q A;  3A03 A;  2M9H A;  1K7A A;  1CF7 B;  5FB2 A;  3TP0 A;  1SAU A;  4RB2 C;  3HC7 A;  3NEU A;  1ETQ A;  1XG1 A;  1YW7 A;  3AG3 H;  1QGP A;  2JVH A;  3OMY A;  1ZR4 A;  5HLI A;  4A3E J;  2VOO A;  4RM2 A;  3BTC A;  1R1V A;  1YG2 A;  3EYY A;  2JPB A;  5CYV A;  1KGS A;  3T1B A;  4BJT A;  4YFN F;  1YRN A;  1KZH A;  4FE4 A;  5ILV A;  2K4B A;  2R5Z A;  4IXA A;  4KIB A;  3S3M A;  3N05 A;  1VQM I;  1P4W A;  3KE2 A;  4XM3 A;  4EVI A;  3F23 A;  3IH4 A;  3P5J A;  2CH0 A;  4LB6 B;  1XSX A;  1Z6R A;  2JA7 J;  2HWV A;  4XRM A;  3EDP A;  5D5X B;  2ECC A;  2MC3 A;  3FWE A;  1FYL A;  2HEO A;  2K86 A;  3SFI A;  4QSH A;  3RSN A;  1FNN A;  3BRO A;  3ZQ7 A;  3O3K A;  3EPZ A;  3VOE A;  2WV1 A;  1X4P A;  2JQ7 A;  1TP4 A;  2ESN A;  5FKM A;  1RR7 A;  2DA6 A;  2P81 A;  3HUG B;  1DP7 P;  2F48 A;  4XN0 A;  4CCK A;  1X58 A;  2ELK A;  3BG3 A;  5HDN A;  3OR2 C;  2UWM A;  1OR7 A;  1U5T A;  1X4O A;  1HA8 A;  4IHW A;  2ELH A;  2QA4 I;  5FD6 A;  1T33 A;  1DU6 A;  4XBF A;  2M0M A;  1AHD P;  2RNJ A;  2VKH A;  1RUO A;  1QPM A;  1CQT A;  4ZDP A;  3LA2 A;  2JK3 A;  3DPL C;  2FUG 2;  4CYC B;  2VBX A;  1SFO J;  2V6C A;  1WI3 A;  3CUQ A;  2E35 A;  5KNL A;  3OV8 A;  1FMV A;  1JT0 A;  1MZB A;  4G9Y A;  3BPX A;  3ZQI A;  5HS8 A;  4G7O F;  4K2E A;  1WJF A;  2DOA A;  3BJO A;  1P9Q C;  3MQ0 A;  3FXK A;  3IRQ A;  4IHS A;  4G7H F;  2QQA A;  4RS8 A;  3M3Y J;  1MBJ A;  1ZKG A;  4KN7 X;  1OCT C;  2NXN B;  1R4M B;  3R4K A;  2DXI A;  5J4V A;  1NH3 A;  3OS1 A;  3PQK A;  1XSV A;  2OQG A;  2ZO4 A;  5LRS A;  1OYI A;  1B72 B;  2LKP A;  2MLG A;  3FBN B;  1T8I A;  1MBK A;  4XN3 A;  1YW9 A;  3QPT A;  2TRT A;  4BY7 J;  1Z77 A;  2E5Z A;  3LSJ A;  4NDL A;  1J7K A;  1A6I A;  3OYL A;  3ZQL A;  4E7L A;  2YX4 A;  2PG4 A;  4LLL A;  3NWT A;  3I4P A;  3F8N A;  5DM6 F;  4RAY A;  3FHZ A;  2CYY A;  1D1C A;  2ZJQ F;  4W1U A;  3CCE I;  3H9J A;  3K4B A;  3K4N A;  4EJT A;  2M4K A;  2O3F A;  1SEU A;  2DAO A;  4Z6Y A;  3K1M A;  3K1P A;  1BI3 A;  3WU0 A;  3GZ6 A;  1PDN C;  5IOY A;  3JCU C;  1UFM A;  2BYV E;  1F36 A;  3LQR A;  4RB3 C;  3S1Q J;  1U8B A;  1O7F A;  2Y0M A;  5EJC A;  4M71 A;  1ETK A;  2GWR A;  4CGZ A;  1BJA A;  3RDI A;  1RIO H;  4E70 A;  4ZC3 A;  3S3O A;  5KHD A;  1SVO A;  5B5E C;  3DLL F;  3BZ6 A;  1ZRE A;  4C2U A;  1Q1V A;  3DXJ F;  3HB9 A;  4YIR X;  2K9N A;  2Q8K A;  3JRG A;  1KYW A;  3WHB A;  2NVQ J;  2E36 A;  2JJ7 A;  2GXB A;  1AWC A;  4RMN A;  2L7K A;  2FX0 A;  1Z1D A;  3JRI A;  1ACI A;  2O8K A;  2F5V A;  3DBH B;  2UXX A;  2HDC A;  4HA8 A;  2X6O A;  4L9T A;  4IRI A;  4LIV A;  3K4L A;  3G6E I;  3TL4 X;  3QWL A;  2DDA A;  5FLX Z;  4J01 A;  1VQL I;  1MW7 A;  2L54 A;  3HPG A;  4MTD A;  4UB8 C;  2XAG A;  5K7H A;  3F9K A;  1O3R A;  3PQJ A;  1Z67 A;  3IRR A;  1Y8R B;  2WWY A;  1QPI A;  2M7B A;  2KHM A;  3WU1 B;  1W7P A;  1XSD A;  1K4S A;  2LC2 A;  4HZF A;  3HTU A;  2L4M A;  1T38 A;  2ELJ A;  2LH9 A;  4M72 A;  3KP4 A;  5J3L A;  2AO9 A;  2M30 A;  2DO7 A;  2ECB A;  2JA8 J;  4LJZ F;  2ZJ2 A;  2DMT A;  3CDH A;  4A3C J;  1A31 A;  5E3L A;  1HCR A;  4GCV A;  2EA2 A;  1RI7 A;  3SHF A;  2BXY A;  4F93 B;  1AU7 A;  3PNY A;  1LKX A;  4WX9 A;  5JVG F;  1R71 A;  2NVY J;  2QUF A;  1TW3 A;  1MBH A;  4KT6 A;  4M6V A;  4AUX A;  3FXL A;  2IVM A;  4DIQ A;  2QKM B;  4MQ9 F;  3F0C A;  3R60 A;  2XAS A;  4X0G A;  3L2C A;  1UB9 A;  3DP7 A;  2BZT A;  3LA7 A;  4L5I A;  1O3Q A;  1SD7 A;  4RAF A;  3LSR A;  3LWF A;  2DPU A;  5E3N A;  4ZH4 F;  1D1A A;  4LFU A;  3R0J A;  5FFX A;  3IUO A;  2ZBK A;  3I5U A;  2FOK A;  5J4Y A;  5FRO A;  2A05 A;  1QRY A;  2IA2 A;  3MZH A;  3LSK A;  1VQ7 I;  2V6E A;  2P8T A;  5EEH A;  4YEL A;  3RKX A;  2JWT A;  2JRT A;  3I9V 2;  1T39 A;  2KKO A;  2RVC A;  4KIT B;  1QVU A;  1UMQ A;  3BP8 A;  3QOE A;  3SZT A;  1D5V A;  4BEH A;  4DYR A;  3RPQ A;  1PUF A;  2Y48 A;  2EV6 A;  2BW3 A;  3TDU C;  5JFR A;  5FRN A;  3DKW A;  3I71 A;  3T8T A;  4F55 A;  2ZME A;  4OMZ A;  4EV0 A;  2E2J J;  4OAZ A;  5BMZ A;  5DCM B;  1DQU A;  3JSO A;  4Q48 A;  5IPA A;  1IN4 A;  1GVD A;  2R5Y B;  3RZD J;  2E7X A;  3QRF F;  4P5O A;  5CQE A;  1Z3X A;  2AXT C;  3TO6 A;  1Z6T A;  4WWC A;  2D2W A;  2KZV A;  3IHU A;  4A3M J;  2ID3 A;  3W6V A;  1BOA A;  1D0Z A;  2F5C A;  4IHX A;  1HXD A;  1RKW A;  2JA6 J;  2DT5 A;  3QYF A;  5FKL A;  1IUY A;  2ZXJ A;  4FCY A;  3CME I;  2HVS A;  1NG7 A;  4GYI A;  5DV5 A;  4C9Y A;  1DUX C;  2QSH X;  4E7J A;  1S3J A;  1TTY A;  1ZYR F;  5L3G A;  4DGW B;  2IEK A;  2MLK A;  5M5Y J;  1OKR A;  2F4I A;  1O4X A;  1W36 C;  2KIU A;  2IT0 A;  1T6S A;  2L0K A;  2J5O A;  3PUB A;  3S8P A;  5ICC A;  3MN2 A;  1R4N B;  4ZJZ A;  5BPD A;  2AS5 F;  2LF8 A;  2R7X A;  4RDU A;  3ZR8 X;  2EJR A;  1R1T A;  1YHQ I;  2DN0 A;  5B66 C;  2IS2 A;  2HKX A;  5L3F A;  1W0U A;  2CW0 F;  3GFJ A;  1S7A A;  3L00 A;  1XDU A;  2DA4 A;  1X3Z B;  4ESB A;  3H92 A;  1TQI A;  4N4N B;  2V7F A;  1NK3 P;  3QYE A;  4Q5S F;  1YYV A;  1F9N A;  4KN4 X;  4ANJ A;  2FA5 A;  3BCA A;  2L7M P;  2XRL A;  4GDF A;  2HGC A;  3GF2 A;  2HTJ A;  2IA0 A;  2Y75 A;  3E3V A;  2R93 J;  3DLA A;  4F3Q A;  2H8R A;  2LNB A;  3GW2 A;  3H3Z A;  1QU3 A;  5ED4 A;  4QTR A;  1VQ4 I;  3JTH A;  1PJR A;  5E8G A;  3BR6 A;  4IO9 F;  4ASN A;  1LB2 A;  2L4A A;  1MH4 A;  1WCM J;  1LDK B;  2CV2 A;  1IXS B;  1WJE A;  4XL9 A;  1MDM B;  2PQ8 A;  1ZRD A;  3PSI A;  2ETH A;  4EQQ A;  5F1J A;  4XID A;  1IUF A;  4FT8 A;  3TO9 A;  4F7Z A;  4I2O A;  3RTR A;  2LTP A;  1EF4 A;  1TQP A;  4A5M A;  4GGG A;  4C3J J;  1R00 A;  3IL2 A;  1ON1 A;  2Z99 A;  1FSE A;  1ZH5 A;  3S2D J;  1REP C;  3DKX A;  5EDN A;  5ILU A;  2HZT A;  2KIM A;  4PJN A;  1S9H A;  2NNN A;  1TWC J;  2KFD A;  2LF7 A;  1KU9 A;  3D1N I;  3TQN A;  2MYS A;  2KP6 A;  3IH3 A;  4J00 A;  2MBF A;  2WY8 Q;  2V1N A;  2MG4 A;  4NUB A;  3IV5 A;  2EFQ A;  5K5Q A;  4KUM A;  1FMW A;  3OYI A;  5DD4 A;  3E7L A;  5DD8 A;  1VQO I;  5ILS A;  2WBM A;  3UNG C;  3L1P A;  4BBR J;  3ABK H;  3GZN B;  1HKQ A;  1MJ9 A;  4DYQ A;  4DYC A;  2K9M A;  4LLN A;  1DGW Y;  1D1B A;  1ONV A;  1W4M A;  3BR1 A;  3C1D A;  3IAS 2;  4FIS A;  1B59 A;  4XOR A;  4EM0 B;  2X1C A;  3C2B A;  4HBL A;  1LEB A;  4L9J A;  2DFI A;  3ULQ B;  4LIU A;  2Z2S B;  4OU0 A;  4JOM A;  3TED A;  5M3F J;  3G3Z A;  2EZH A;  4JBA A;  1E2X A;  2NOG A;  1BA5 A;  3RCO A;  5IYD J;  2LLK A;  2HKO A;  4M9X A;  1OR7 C;  1U5T C;  1I6X A;  1I5Z A;  5FJ8 J;  3JRD A;  4A3K J;  2EV0 A;  2JT1 A;  2PBI A;  2H1K A;  3E6M A;  2A68 F;  3SYT A;  2RQQ A;  4YII A;  4Q4Z F;  2E1N A;  2H6B A;  4LG0 A;  4V2F A;  5BQT A;  4UNO A;  1LFB A;  3CC2 I;  3HGG A;  3KET A;  3OS2 A;  4BAY A;  3QP5 A;  3FXU A;  5F0F A;  2BVM A;  1FLI A;  2EIL H;  4KIS A;  3BTL A;  5HS9 A;  3ERM A;  2XGD A;  2CQX A;  3W2W A;  2AQF A;  4PJ0 C;  1R9T J;  1SD4 A;  5LD2 C;  4PSX A;  3EUH C;  2X4H A;  3F3X A;  2K7L A;  2IW5 A;  3L7W A;  1SFK A;  2L9R A;  4WF2 A;  3JAM K;  5CKT A;  2L02 A;  4ETS A;  3S1R J;  2R4G A;  4KMF A;  3REO A;  1JGS A;  2IP2 A;  5HDK A;  4A3L J;  3CF2 A;  3DBL B;  4FX0 A;  3S2W A;  5F08 A;  1IRX A;  4AIH A;  4XK4 A;  2CFX A;  2IGO A;  3O2P E;  1VND A;  3H35 A;  3K9T A;  4I99 C;  4W97 A;  2R7W A;  1DU0 A;  1FWZ A;  2DTR A;  4E7I A;  3ZN1 A;  3DCF A;  3FKJ A;  3H9G A;  3I54 A;  3KP2 A;  1TL8 A;  4LB5 A;  1SVM A;  1L3L A;  4M6X A;  1R6R A;  1BL0 A;  2ZJR F;  5HVQ C;  2M8G X;  3K4M A;  2DW4 A;  3ECO A;  3DKY A;  1S72 I;  4ZDL A;  1PUE E;  3S17 J;  1A35 A;  4OWR B;  3VOD A;  3K1N A;  3MKW B;  4CUG A;  5D6E A;  2WA0 A;  3BR0 A;  3KLO A;  1EH7 A;  2ZSI B;  5LEK A;  2Y0S N;  3IP4 B;  2LP0 A;  4HST A;  4AVZ A;  3HKZ N;  1XS9 A;  1FP2 A;  1IXR C;  2W24 A;  1F1Z A;  5F27 A;  3KEQ A;  1Y56 A;  3TKY A;  3PNV A;  4EM1 A;  1MH3 A;  1P2F A;  2HI3 A;  3AFH A;  3PSF A;  4M9Z A;  5IOZ A;  3CMY A;  1F4K A;  3DTE A;  1TNS A;  4XRS A;  1MIJ A;  4GO1 A;  1BOB A;  1TBX A;  1KU3 A;  3GUD A;  3WG9 A;  3CCS I;  3KEO A;  3QQA A;  2L2O A;  2CJJ A;  4RAZ A;  2D5V A;  3VYU B;  1DPU A;  3I59 A;  4II3 A;  5CJ9 A;  3CCY A;  4U87 A;  4NQW A;  2CMP A;  3WGH A;  1ZN2 A;  2V9V A;  4XRF A;  1R23 A;  4KIF A;  3VYT B;  3BJA A;  4IKF A;  2HQ5 A;  2BGC A;  2K4J A;  3SJM A;  2VJ5 A;  3R6S A;  3RI4 A;  3O6B B;  3HPH A;  1FYK A;  2KDZ A;  3BCB A;  1WJ5 A;  2ZKZ A;  3PO3 J;  4BUP A;  1VQ5 I;  2XGX A;  1XGM A;  4ZYA A;  1VF9 A;  3ZN0 A;  2OUM A;  3P9I A;  4XQF A;  2BXZ A;  3FX3 A;  3OL4 A;  1ZQ3 P;  5L3B A;  1PP7 U;  2P6T A;  3K2A A;  2LD5 A;  4P9U A;  5C3E J;  1T0F C;  4D5F A;  1QZE A;  2IPQ X;  2BBY A;  3ZCO A;  3BJ6 A;  2PI0 A;  2P7C B;  4NNJ A;  4YRV A;  2XF5 A;  3U9G A;  3KP6 A;  4C2M J;  4NHJ A;  2O5R A;  4HNT A;  3ROU A;  3MZY A;  5TRD A;  4IF4 A;  3CP8 A;  4RAG A;  4XKC A;  2NRA C;  1U6G A;  1X2M A;  3JTG A;  5HOO A;  3G2B A;  3A02 A;  3DF8 A;  3KFW X;  4PJL A;  3WTU C;  2MSY A;  3MWM A;  4GFB A;  3N97 A;  2XDV A;  2LBF A;  2A69 F;  3CCR I;  1KQ8 A;  2LY9 A;  2RDP A;  2H27 A;  2TDX A;  4UUS B;  1D8K A;  2HTS A;  3LFK A;  3CF5 F;  1HBX G;  1JGG A;  1G59 A;  2QBY B;  2A5Y B;  5HNF A;  2XF7 A;  2Z16 A;  3E5U A;  5TJJ A;  3V8J A;  4I76 A;  2ZFW A;  2V1X A;  2BY3 A;  1GHC A;  2EFO A;  3HBL A;  4A3G J;  4G6Q A;  4L9V A;  4BS9 A;  4U0V A;  1MJB A;  2F5F A;  2L9V A;  3SZP A;  2QZ8 A;  2VE8 A;  2Y9Y A;  3DFG A;  4HSR A;  1H88 C;  2HS5 A;  1X3U A;  2XB5 A;  2Q2E B;  2H94 A;  2KLO A;  2PX9 A;  3KZY A;  4GRI A;  3GBG A;  3BG9 A;  4XKW A;  4MTE A;  1ULY A;  1FBS A;  2O8X A;  3FKI J;  4N4O B;  2CSO A;  2ZCW A;  1G4D A;  3GTJ J;  2E1C A;  2X6Y A;  3BPV A;  1TWA J;  3L2W A;  1I6H J;  4U0Y A;  1I1G A;  3EYI A;  1DGR M;  2V4J C;  2CUZ A;  4CZZ A;  1IGN A;  1I3Q J;  3WTZ A;  2MD0 A;  2QEN A;  4PGH A;  3GTL J;  4BDY A;  3W3C A;  5LBQ A;  3GLL A;  4LIT A;  2MA3 A;  3TMO A;  4JYK A;  1X1D A;  2ESH A;  3A1Y A;  4BHB A;  4CO8 A;  3CJN A;  2L3D A;  3DTK A;  3GFL A;  3CO6 C;  3VWB A;  3HOV J;  3M4O J;  1X19 A;  3U1D A;  4FHT A;  4BQN A;  2GOM A;  1BW5 A;  5E1X A;  5JHU A;  3HOY J;  5B1B H;  4BXX J;  5DCF A;  5K1Y A;  4BXF A;  2CO5 A;  4HV6 A;  2VJJ A;  1H8A C;  3Q0V A;  4B3A A;  2CV1 A;  4MQV A;  1N77 A;  2E34 A;  3BG5 A;  2DMQ A;  3HDD A;  1QA6 A;  3HXL A;  4PCQ A;  4IOC F;  3L2V A;  1TT5 B;  1XMA A;  3CCU I;  2JRM A;  4HOB A;  4CHU A;  2BHZ A;  2HQA A;  1JT6 A;  2KZG A;  2A6E F;  4LG3 A;  4B43 A;  4MGR A;  4DJA A;  2JVG A;  2CUE A;  3ZQG A;  2FMY A;  4DNC A;  3COA C;  1I39 A;  4HX7 A;  5JI6 A;  4CIC A;  1JHH A;  2BY0 A;  5J1Y A;  1SVL A;  3DEU A;  3SFZ A;  4Y52 J;  2CRG A;  4XR6 A;  3TW7 A;  3BDD A;  1FJL A;  1U2W A;  3OSF A;  4RBO A;  5DM7 F;  4IZZ A;  3LAJ A;  2DA5 A;  5M3M J;  4KNY A;  2I10 A;  1BW6 A;  1TQM A;  4BYY A;  1ZTR A;  4Y4R A;  2OF7 A;  2D45 A;  1Y1V J;  1WSU A;  2C6Y A;  3V8L A;  2DTZ A;  1V4R A;  5GTI C;  2OD5 A;  3HHH A;  2E71 A;  5L3E A;  3F8F A;  3I53 A;  4O6J A;  1OQY A;  3RPU A;  2Z3Y A;  4HQM A;  3F8C A;  2DOE A;  2GM4 A;  1D0X A;  3A01 A;  4ZYH A;  4PGG A;  2W1O A;  3FM5 A;  5JR3 A;  3PUF A;  3ZPL A;  1XD7 A;  2XAJ A;  2KMU A;  2P7V B;  4CCL A;  5GAH J;  1WH5 A;  3I55 I;  3OL3 A;  3HTS B;  1U78 A;  3DPT A;  3K4J A;  2XRO A;  4DQ2 A;  2EZK A;  2QEX I;  3S16 J;  1XGN A;  1IW7 F;  2EIM H;  1MNE A;  3PL8 A;  4UV9 A;  1LDD A;  3MFK A;  3F8B A;  4XKB A;  2GZW A;  5E79 C;  1VZ0 A;  5HOD A;  3BR2 A;  3ZQQ A;  1K78 B;  1HW5 A;  3ZQF A;  4I7H A;  2XVC A;  5IT9 K;  2VC0 A;  3FXJ A;  1A04 A;  2G7H A;  4CSW A;  4DBQ A;  3JRH A;  4A6D A;  1UHW A;  2EBI A;  4MIM A;  1VI0 A;  4A2U A;  3T0Y A;  3Q9V A;  1LJ9 A;  4ESF A;  4PJM A;  1YIT I;  3SQN A;  1B4A A;  1QHH D;  3BT9 A;  3GFM A;  2HOS A;  3G73 A;  5HDG A;  5CLS A;  2LSO A;  1NK2 P;  2CG4 A;  3J7A O;  5H6Q A;  2X6W A;  1ZG1 A;  4BHP A;  5EGO A;  2O9L A;  1ITY A;  2DA1 A;  2DOF A;  2I8D A;  4ITV A;  2B63 J;  1BJZ A;  1P4A A;  4NC8 A;  2DK5 A;  2EH3 A;  5B3S H;  3OY9 A;  4DOZ A;  2LVS A;  1EJ9 A;  3OYJ A;  4N9I A;  1YS6 A;  1BC8 C;  2ZSH B;  2LFB A;  2PN6 A;  1C0W A;  1SMT A;  1CF7 A;  1HW2 A;  3GTP J;  2DPD A;  2ZNZ A;  4EJV A;  5A2Q K;  1OIS A;  3M9A A;  2CUF A;  2LY1 A;  1O57 A;  2M2E A;  2EV5 A;  2L01 A;  2OJE D;  4ON0 A;  2KDO A;  2CQK A;  4QIW N;  1ODD A;  3WTS C;  3SDB A;  3MEX A;  3CDI A;  1U9N A;  2ZC2 A;  3FXR A;  3HM5 A;  4HX8 A;  2O61 A;  1H9T A;  1JTY A;  2WAE A;  2OA4 A;  1S7E A;  5IY5 H;  3WTY C;  4Z2Y A;  3E6C C;  5LHG A;  3CCM I;  4JX6 A;  4BAC A;  2UZK A;  2ME6 A;  4HLY A;  1BN5 A;  1KQ9 A;  3HRU A;  4I02 A;  4NB5 A;  3CJR B;  2M7A A;  5AON A;  3K6G A;  3QPH A;  1IV6 A;  9ANT A;  4WK8 F;  2FSW A;  3TOA A;  4KYW A;  5LHH A;  2BVL A;  5HS7 A;  1AOY A;  1MMG A;  4PDK A;  2FNA A;  4M3G A;  2NNY A;  2VBW A;  2CQQ A;  4AU7 A;  2FXA A;  3MKZ A;  3ASN H;  1N78 A;  2Y9Z A;  3W2V A;  1D0Y A;  1FT9 A;  3HEF A;  3MKY B;  3MD2 A;  3HUG A;  2R3S A;  2L7Z A;  1ZLJ A;  4CCN A;  1RC9 A;  4HDV A;  1T2K A;  3TBI A;  3VSL A;  1QZY A;  1MJA A;  1UHM A;  3JSP A;  5C4X J;  1MD0 A;  2OAZ A;  2GIV A;  1IN7 A;  4AYB A;  3HOX J;  3GTM J;  1LVK A;  1GV2 A;  1W5C C;  2Y31 A;  2HPI A;  2KQR A;  3M07 A;  4HV5 A;  3HOW J;  3G4S I;  4D0P A;  1W1W E;  3JW4 A;  1W5S A;  3K4K A;  2W00 A;  2XF6 A;  4L5J A;  1ZGJ A;  2RAE A;  4O5V A;  4ZYD A;  4IX7 A;  4CYC A;  4NC6 A;  2VBY A;  3T5X A;  3C18 A;  1E3P A;  1V5G A;  2UV1 A;  2PJR B;  2IBD A;  1LUJ B;  3GZ5 A;  2X51 A;  5EG0 B;  4RB0 A;  2MH2 A;  3KP3 A;  5CPR B;  1BI0 A;  4KJZ A;  1YJN I;  1FOW A;  4JX5 A;  3C2G A;  2HXO A;  3KIO A;  2MFZ A;  2O7O A; 
#chains in the Genus database with same CATH homology
 3K69 A;  1DDN A;  3CTA A;  4XSX F;  3TGN A;  2XAQ A;  4BQA A;  3R61 A;  1IZ1 A;  4KMU X;  5CVU A;  1GVJ A;  5LHI A;  3WTT C;  3HYI A;  1T98 A;  1B6A A;  2XV4 S;  2HQN A;  2IRF G;  2P5L C;  2VE9 A;  3WTW C;  1K6O A;  1SAX A;  4KIC A;  3F72 A;  3GX4 X;  5KK1 A;  2B0L A;  1GXP A;  4LK1 F;  5CVV A;  3CUO A;  3ZMS A;  1U8R A;  1J0R A;  2DLL A;  2ZNY A;  2FE3 A;  4BHC A;  3DQV C;  3N4M A;  3E5Q A;  5DEQ A;  4I01 A;  2EFW A;  1FBQ A;  2P5V A;  2QWW A;  5E20 A;  4IRH A;  2ISY A;  2K02 A;  3BOQ A;  3M1E A;  4HF0 A;  4LK0 F;  3I59 B;  4EJU A;  1JE8 A;  1ZHF A;  2V1D A;  4R1H A;  5E17 F;  5LEJ A;  1SMY F;  1R36 A;  4HYE A;  2V1U A;  4P55 A;  3WE2 A;  4UVC A;  3ABT A;  3RYP A;  4AIK A;  3QU6 A;  2BE5 F;  2PJP A;  1STZ A;  3RYR A;  3ML6 A;  2DU9 A;  3J80 K;  2FBK A;  3K2Z A;  2H09 A;  1G3W A;  4OMY A;  3C7J A;  2IA1 A;  3M7G A;  3V7S A;  4RGX A;  2XIG A;  2G7U A;  2FEZ A;  4KDP A;  1F5T A;  1LEA A;  3HSF A;  2O0Y A;  1NHA A;  1ZAO A;  3CUQ C;  5F1R A;  2QLZ A;  4MEX F;  5DCM A;  1WI9 A;  4XSZ F;  2FF4 A;  2ISZ A;  1BIA A;  3GLX A;  1L0O C;  3HSR A;  4ENJ A;  3HHG A;  3NRV A;  1HKT A;  2RQP A;  4I0B A;  2O03 A;  4LGW A;  2F5D A;  3ISP A;  3F6O A;  1U3E M;  1FC3 A;  4HW0 A;  1G3T A;  5DUI A;  2DQR A;  3T8R A;  2BV6 A;  3I0T A;  3HOT A;  1E17 A;  4CXF A;  2YX7 A;  3B73 A;  4YG2 F;  5K5R A;  4A0Z A;  2GA1 A;  3FM3 A;  1I27 A;  1XGO A;  4KIG A;  4G94 A;  2FML A;  4QLC U;  1IXC A;  1D8J A;  5BPI A;  4EJW A;  2P6S A;  4WXH A;  1CGP A;  5DUK A;  2VOP A;  1B9M A;  2QYO A;  1U5T B;  2M45 A;  3Q5F A;  4P96 A;  1QNT A;  1IRF A;  1Z05 A;  2JSC A;  3C3W A;  2YPR A;  1MDM A;  3F6V A;  1KU7 A;  2XKO A;  3CUQ B;  2RN7 A;  2FRH A;  2OU2 A;  1YLF A;  3DV8 A;  5DYM A;  2FBI A;  3BY6 A;  3VB2 A;  2VN2 A;  2MD5 A;  2P5K A;  4FX4 A;  3WGG A;  1FSH A;  1WQ2 A;  3GO5 A;  3WE3 A;  2IJL A;  3HSE A;  1FOK A;  2VXZ A;  4R79 A;  2QVO A;  1V3F A;  4OOI A;  5CVJ A;  1ON2 A;  2KJB A;  3F8M A;  2XKP A;  1R5G A;  4I09 A;  2VOD A;  1Q1H A;  2A6H F;  3J80 Z;  3FMQ A;  5D4R A;  5J8F A;  2E7W A;  2GQQ A;  2GAU A;  2D1V A;  1SFE A;  2PMU A;  3KCC A;  4WXC A;  1ZLK A;  4EJO A;  4WCG A;  1RUN A;  1O3S A;  5FLX K;  5BS6 A;  1JHF A;  1FY7 A;  4QWQ A;  1G3S A;  2DBB A;  3L09 A;  3D0S A;  3VEP A;  4AD9 A;  1R22 A;  1G3Y A;  4U7D A;  1J59 A;  5D5V B;  3KZZ A;  1K79 A;  1EH8 A;  1W7P B;  4M73 A;  4U0W A;  2EK5 A;  4RGS A;  2UXN A;  3R0A A;  3JAM Z;  2CGP A;  2HYF A;  1XMK A;  4N9H A;  4ENM A;  3Q9S A;  3GEZ A;  3FF5 A;  3ELK A;  5AIP A;  5HLG A;  4XLP F;  2M5W A;  2FQ3 A;  1YIO A;  5E1Z B;  3ABU A;  5EEG A;  1SFU A;  4L18 B;  2W57 A;  4MHG A;  3W6K B;  4OIO F;  2RKH A;  3E6D A;  4MNU A;  1O3T A;  4YIF A;  2VT2 A;  5LGN A;  3ERE D;  2ADU A;  2HFH A;  3KP7 A;  3ZMU A;  3GFI A;  4P9F A;  4UVB A;  3WTX C;  4RGU A;  2ZME B;  1SFX A;  1D3Y A;  5K5O A;  2VON A;  1FBU A;  2VC1 A;  1RZ4 A;  2PMH A;  4KA4 A;  2LDU A;  1B1B A;  1H9G A;  4M6Y A;  2AXL A;  3K0L A;  3EUH A;  3CO7 C;  4OIN F;  2KJC A;  3V7R A;  4R8H A;  2WTE A;  1FZP B;  2CWE A;  2Q0O A;  3SXY A;  3KLN A;  2Z5U A;  4U88 A;  1IF1 A;  1B9N A;  4Q47 A;  5H20 A;  4BNC A;  1G6N A;  4OIQ F;  4IJA A;  3IWF A;  1H0M A;  2WC2 A;  2QQB A;  5CVR A;  5ICG A;  2EFN A;  1HKS A;  4LD5 A;  1O7L A;  4HDU A;  1BI1 A;  5AIQ A;  1IN8 A;  3LST A;  3RKW A;  1QQI A;  1JXS A;  4JQF A;  2FBH A;  3I64 A;  2WV0 A;  3RKY A;  2QM3 A;  1EH6 A;  1TNT A;  1OMI A;  4O3M A;  4A5N A;  2QBY A;  3ZP5 A;  1XB4 A;  3WGI A;  1QZZ A;  2OZU A;  4PZJ A;  4ZZL A;  1HSJ A;  4G8X A;  5D5W B;  1R7J A;  2O6G E;  1HQC A;  2NYX A;  1ZG5 A;  2EWN A;  5LRR A;  3NQO A;  4G6D A;  5FFZ A;  4ZYE A;  1R1U A;  3VFZ A;  1XN7 A;  2HR3 A;  2ACJ A;  3D5L A;  2Q2E A;  3QU3 A;  5D5U B;  2VBZ A;  2OQR A;  3ZMT A;  4HQE A;  4ESJ A;  2VT3 A;  1S7O A;  3V8K A;  2M1B A;  3M8E A;  3FMS A;  3GYH X;  2F2E A;  4MEY F;  2YU3 A;  2D1H A;  2NAZ A;  3I58 A;  5LLQ A;  2DK8 A;  4L0Z B;  1IN6 A;  2KRF A;  1YW8 A;  1T0F A;  1KA8 A;  1LDJ A;  4AVP A;  1TLH B;  4Y15 A;  4RB1 A;  2M87 A;  1IRG A;  4UUV A;  3IC7 A;  2J5P A;  2KIF A;  4UHT A;  4WXD A;  3ECH A;  5E18 F;  4UXN A;  4A0X A;  2HQR A;  2M8E A;  2FU4 A;  4U7B A;  2COM A;  3W6J B;  2DI3 A;  4ENK A;  3H3U A;  4Y13 A;  3ZMD A;  2XAF A;  4LG0 B;  2QQ9 A;  5F6F A;  1R58 A;  3EQL F;  1W5T A;  1DPR A;  1XCB A;  4CDG A;  1YFH A;  5LGU A;  1WWX A;  1LQ1 A;  4IPA A;  1SD5 A;  4S04 A;  3L9F A;  3ZMZ A;  4N0B A;  1J5Y A;  3HIF A;  1QBJ A;  5F64 A;  2HOE A;  3TDZ C;  3P9C A;  2PLY A;  1HW1 A;  2W25 A;  2OBP A;  4KT5 C;  3CLO A;  5BOX A;  2STT A;  1FX7 A;  1XCV A;  4LLG F;  3TOB A;  4A12 A;  3BWG A;  5FGM A;  1WRJ A;  4M74 A;  1Z9C A;  1PP8 F;  1FYM A;  1S8N A;  3MCZ A;  4GYG A;  5ICF A;  1K78 A;  3GWZ A;  2A07 F;  2PFB A;  1XDS A;  5FD5 A;  4M9S A;  3P9K A;  5D8L B;  1P92 A;  5IT9 Z;  3J81 K;  3F22 A;  5FO5 A;  6PAX A;  1HST A;  3PFI A;  3GXO A;  2YR2 A;  2A61 A;  3HRS A;  1IAW A;  2Z33 A;  1R5H A;  3FXQ A;  3KP5 A;  4ZZD A;  3U2R A;  1S29 A;  1YQA A;  3LA3 A;  2V79 A;  3FMR A;  3F21 A;  3WTV C;  3V7C A;  2X0L A;  4B8X A;  4I98 B;  3AAF A;  4HAM A;  1MKM A;  1BM9 A;  5CVI A;  5A2Q Z;  2FNP A;  1KQ0 A;  2STW A;  4EGY A;  4Y17 A;  1YS7 A;  1ZGA A;  5HLH A;  4L0Y B;  1S6L A;  3QAH A;  5DDG A;  3TO7 A;  4AIJ A;  3MAJ A;  1OPC A;  4I0A A;  5ICE A;  4ZYG A;  5H6R A;  4A6E A;  1FP1 D;  2JZY A;  1FPQ A;  1LVA A;  4IHT A;  4L9N A;  1BI2 A;  2MH9 A;  3WOD F;  4HX4 A;  4JK1 X;  4AWX B;  4TV7 A;  1SD6 A;  2XUB A;  1J2X A;  1LNW A;  2GA2 A;  2XAH A;  4IVN A;  2RV8 A;  1OYY A;  1Z7U A;  5ERI A;  2HYG D;  2XHK A;  3E5X A;  4A0Y A;  2PEX A;  2Z9O A;  5E8I A;  2EA4 A;  2EFP A;  2K27 A;  4RGR A;  4YFK F;  5KVR A;  1YO5 C;  5E1W A;  1BIB A;  4OIR F;  1BC7 C;  2W85 A;  5D8K B;  4CYD A;  1P4X A;  1EV7 A;  3B02 A;  4EMS A;  1YTY A;  2BEO A;  5IT3 A;  4UV8 A;  3EET A;  2NS0 A;  1UCR A;  1ZG3 A;  1J75 A;  3HRM A;  4ENN A;  1WKM A;  3IWZ A;  1MGT A;  1ZRF A;  4H0E A;  4OIP F;  1I1S A;  1XGS A;  2W84 A;  1W7P D;  1USS A;  3QP6 A;  3J81 Z;  3E6B A;  4BH9 A;  3RIR A;  4EM2 A;  3HRT A;  2XRN A;  1ZAR A;  1J9I A;  5J8C A;  3IKV A;  3GVA A;  2A3S A;  5L3D A;  4UVA A;  5LGT A;  4S05 A;  2R7F A;  3V4G A;  3IKT A;  4G7Z F;  2YSR A;  1QO0 D;  1OYW A;  1Y0U A;  1IN5 A;  2P4W A;  4B09 A;  3RJP A;  2OZ6 A;  1KU2 A;  5D4S A;  3ZMV A;  3M8F A;  4EGZ A;  2G9W A;  2RC4 A;  2F5E A;  5L3C A;  5JVT A;  3HOS A;  4GXO A;  2H6C A;  4HLX A;  1P6R A;  4LMY A;  5J6X A;  3FZV A;  1UST A;  2JTV A;  5D6F A;  4YFX F;  1RNL A;  3LAP A;  4IRG A;  1TW2 A;  3P7N A;  3E97 A;  2JPC A;  3QOP A;  1VTN C;  2EB7 A;  4BXU A;  2GXG A;  3OOP A;  1GXQ A;  2RGV A;  1ZRC A;  4HF1 A;  4HF2 A;  4KFC A;  1Z91 A;  3LQQ A;  1KYZ A;  4XLN F;  1BBY A;  2R7D A;  2DQL A;  1K7A A;  1CF7 B;  5FB2 A;  4RB2 C;  3NEU A;  1YW7 A;  1QGP A;  5HLI A;  2VOO A;  1R1V A;  1YG2 A;  3EYY A;  2JPB A;  5CYV A;  1KGS A;  3T1B A;  4YFN F;  5ILV A;  2K4B A;  4IXA A;  4KIB A;  1P4W A;  3KE2 A;  4EVI A;  3F23 A;  4LB6 B;  1XSX A;  1Z6R A;  2HWV A;  3EDP A;  5D5X B;  2MC3 A;  3FWE A;  1FYL A;  2HEO A;  2K86 A;  1FNN A;  3BRO A;  3ZQ7 A;  3O3K A;  3VOE A;  2ESN A;  1DP7 P;  5HDN A;  2UWM A;  1OR7 A;  1U5T A;  2ELH A;  5FD6 A;  4XBF A;  2RNJ A;  1RUO A;  1QPM A;  3LA2 A;  3DPL C;  2VBX A;  2V6C A;  3CUQ A;  3OV8 A;  1MZB A;  4G9Y A;  3BPX A;  5HS8 A;  4G7O F;  4K2E A;  3BJO A;  3MQ0 A;  3IRQ A;  4IHS A;  4G7H F;  2QQA A;  4RS8 A;  4KN7 X;  3R4K A;  3PQK A;  1XSV A;  2OQG A;  2ZO4 A;  5LRS A;  1OYI A;  2LKP A;  2MLG A;  1YW9 A;  3QPT A;  1J7K A;  2YX4 A;  2PG4 A;  4LLL A;  3I4P A;  3F8N A;  4RAY A;  3FHZ A;  2CYY A;  4EJT A;  2O3F A;  2DAO A;  3K1M A;  3K1P A;  1BI3 A;  3WU0 A;  3GZ6 A;  1PDN C;  1UFM A;  2BYV E;  3LQR A;  4RB3 C;  1O7F A;  2Y0M A;  4M71 A;  2GWR A;  4CGZ A;  1BJA A;  3RDI A;  1RIO H;  4E70 A;  3BZ6 A;  1ZRE A;  3DXJ F;  2Q8K A;  1KYW A;  2GXB A;  1AWC A;  1Z1D A;  2UXX A;  2HDC A;  4HA8 A;  4L9T A;  4IRI A;  5FLX Z;  2L54 A;  4MTD A;  2XAG A;  1O3R A;  3PQJ A;  3IRR A;  2WWY A;  3WU1 B;  1W7P A;  1XSD A;  4HZF A;  3HTU A;  2L4M A;  1T38 A;  4M72 A;  3KP4 A;  2M30 A;  2DO7 A;  4LJZ F;  2ZJ2 A;  3CDH A;  4GCV A;  2EA2 A;  1RI7 A;  3SHF A;  4WX9 A;  2QUF A;  1TW3 A;  2IVM A;  4MQ9 F;  3R60 A;  2XAS A;  3L2C A;  1UB9 A;  3DP7 A;  3LA7 A;  4L5I A;  1O3Q A;  1SD7 A;  3LWF A;  2DPU A;  4ZH4 F;  4LFU A;  3R0J A;  5FFX A;  2ZBK A;  3I5U A;  2FOK A;  2IA2 A;  3MZH A;  2P8T A;  5EEH A;  3RKX A;  2JRT A;  1T39 A;  2KKO A;  2RVC A;  1D5V A;  3BP8 A;  3SZT A;  3RPQ A;  2Y48 A;  2EV6 A;  3TDU C;  5JFR A;  3DKW A;  3I71 A;  3T8T A;  2ZME A;  4OMZ A;  4EV0 A;  5BMZ A;  5DCM B;  3JSO A;  4Q48 A;  1IN4 A;  2E7X A;  3QRF F;  4P5O A;  3TO6 A;  1Z6T A;  4WWC A;  2D2W A;  3IHU A;  1BOA A;  2F5C A;  1HXD A;  2DT5 A;  1IUY A;  2ZXJ A;  4GYI A;  5DV5 A;  1DUX C;  1S3J A;  1TTY A;  1ZYR F;  5L3G A;  2MLK A;  1OKR A;  2KIU A;  2IT0 A;  1T6S A;  2J5O A;  5ICC A;  5BPD A;  2AS5 F;  2LF8 A;  2EJR A;  1R1T A;  2HKX A;  5L3F A;  2CW0 F;  3GFJ A;  1S7A A;  3L00 A;  1XDU A;  4ESB A;  3H92 A;  1TQI A;  4Q5S F;  1YYV A;  1F9N A;  4KN4 X;  2FA5 A;  2HGC A;  3GF2 A;  2HTJ A;  2IA0 A;  2Y75 A;  3E3V A;  2LNB A;  3GW2 A;  3H3Z A;  5ED4 A;  3JTH A;  5E8G A;  4ASN A;  1LB2 A;  2L4A A;  1LDK B;  1IXS B;  1MDM B;  2PQ8 A;  1ZRD A;  2ETH A;  4EQQ A;  4FT8 A;  3TO9 A;  4F7Z A;  4I2O A;  3RTR A;  1TQP A;  4A5M A;  4GGG A;  1R00 A;  3IL2 A;  1ON1 A;  2Z99 A;  1FSE A;  1ZH5 A;  1REP C;  5ILU A;  2HZT A;  2KIM A;  2NNN A;  2LF7 A;  1KU9 A;  3TQN A;  2MBF A;  2EFQ A;  5K5Q A;  4KUM A;  5DD4 A;  5DD8 A;  5ILS A;  1HKQ A;  1MJ9 A;  4LLN A;  1ONV A;  1W4M A;  3C1D A;  1B59 A;  4EM0 B;  4HBL A;  1LEB A;  4L9J A;  2DFI A;  3ULQ B;  4OU0 A;  3G3Z A;  4JBA A;  1E2X A;  2HKO A;  4M9X A;  1U5T C;  1I6X A;  1I5Z A;  2EV0 A;  2JT1 A;  2PBI A;  3E6M A;  2A68 F;  4YII A;  4Q4Z F;  2E1N A;  2H6B A;  4LG0 A;  5BQT A;  4UNO A;  3KET A;  4BAY A;  3QP5 A;  3FXU A;  1FLI A;  5HS9 A;  1SD4 A;  2X4H A;  3F3X A;  2K7L A;  2IW5 A;  3L7W A;  4WF2 A;  3JAM K;  2L02 A;  4ETS A;  4KMF A;  3REO A;  1JGS A;  2IP2 A;  5HDK A;  4FX0 A;  3S2W A;  4AIH A;  2CFX A;  3O2P E;  3K9T A;  1FWZ A;  2DTR A;  3ZN1 A;  3I54 A;  3KP2 A;  4LB5 A;  1L3L A;  4M6X A;  5HVQ C;  2DW4 A;  3ECO A;  1PUE E;  3VOD A;  3K1N A;  5D6E A;  3KLO A;  1EH7 A;  5LEK A;  1FP2 A;  1IXR C;  2W24 A;  1F1Z A;  3KEQ A;  3TKY A;  4EM1 A;  1P2F A;  4M9Z A;  1F4K A;  1TNS A;  4GO1 A;  1TBX A;  1KU3 A;  3GUD A;  3WG9 A;  3KEO A;  4RAZ A;  1DPU A;  3I59 A;  5CJ9 A;  3WGH A;  4NQW A;  1ZN2 A;  2V9V A;  4XRF A;  1R23 A;  4KIF A;  3BJA A;  2BGC A;  2K4J A;  3R6S A;  3RI4 A;  3O6B B;  1FYK A;  2ZKZ A;  2XGX A;  1XGM A;  3ZN0 A;  3P9I A;  3FX3 A;  5L3B A;  1PP7 U;  2P6T A;  4P9U A;  2IPQ X;  2BBY A;  3BJ6 A;  2PI0 A;  2P7C B;  3U9G A;  3KP6 A;  4NHJ A;  5TRD A;  3ROU A;  3MZY A;  4IF4 A;  2NRA C;  1U6G A;  3JTG A;  5HOO A;  3DF8 A;  3KFW X;  3WTU C;  3MWM A;  3N97 A;  2A69 F;  1KQ8 A;  2RDP A;  2H27 A;  2TDX A;  1D8K A;  2HTS A;  3LFK A;  1HBX G;  2QBY B;  2A5Y B;  3E5U A;  5TJJ A;  3V8J A;  2ZFW A;  2V1X A;  1GHC A;  2EFO A;  4G6Q A;  4L9V A;  4U0V A;  1MJB A;  2F5F A;  3SZP A;  2QZ8 A;  2VE8 A;  3DFG A;  2HS5 A;  1X3U A;  2H94 A;  3KZY A;  4MTE A;  1ULY A;  1FBS A;  2O8X A;  2CSO A;  2ZCW A;  1G4D A;  2E1C A;  3BPV A;  4U0Y A;  1I1G A;  3EYI A;  4CZZ A;  3WTZ A;  2QEN A;  4PGH A;  5LBQ A;  2MA3 A;  2ESH A;  4BHB A;  4CO8 A;  3CJN A;  2L3D A;  3GFL A;  3CO6 C;  3U1D A;  4FHT A;  5E1X A;  5JHU A;  5DCF A;  5K1Y A;  2CO5 A;  4HV6 A;  4MQV A;  4PCQ A;  1XMA A;  4HOB A;  4CHU A;  2A6E F;  4MGR A;  2FMY A;  4DNC A;  3COA C;  4HX7 A;  5JI6 A;  4CIC A;  1JHH A;  3DEU A;  3SFZ A;  3BDD A;  1U2W A;  3LAJ A;  4KNY A;  1TQM A;  4BYY A;  2D45 A;  1WSU A;  2C6Y A;  3V8L A;  1V4R A;  2OD5 A;  3HHH A;  5L3E A;  3F8F A;  3I53 A;  4O6J A;  3RPU A;  2Z3Y A;  4HQM A;  3F8C A;  4ZYH A;  4PGG A;  3FM5 A;  5JR3 A;  3ZPL A;  1XD7 A;  2XAJ A;  2P7V B;  3HTS B;  1U78 A;  3DPT A;  2XRO A;  4DQ2 A;  1XGN A;  1IW7 F;  4UV9 A;  1LDD A;  3MFK A;  3F8B A;  2GZW A;  1K78 B;  1HW5 A;  4I7H A;  2XVC A;  5IT9 K;  2VC0 A;  1A04 A;  2G7H A;  4A6D A;  1UHW A;  4A2U A;  3T0Y A;  3Q9V A;  1LJ9 A;  4ESF A;  3SQN A;  1B4A A;  3GFM A;  3G73 A;  5HDG A;  5CLS A;  2LSO A;  2CG4 A;  3J7A O;  5H6Q A;  1ZG1 A;  4BHP A;  1P4A A;  2DK5 A;  4N9I A;  1YS6 A;  1BC8 C;  2PN6 A;  1C0W A;  1SMT A;  1CF7 A;  1HW2 A;  2DPD A;  2ZNZ A;  4EJV A;  5A2Q K;  3M9A A;  1O57 A;  2EV5 A;  2L01 A;  4ON0 A;  2CQK A;  1ODD A;  3WTS C;  3MEX A;  3FXR A;  4HX8 A;  2O61 A;  1H9T A;  2OA4 A;  3WTY C;  4Z2Y A;  3E6C C;  5LHG A;  2UZK A;  4HLY A;  1BN5 A;  1KQ9 A;  3HRU A;  4I02 A;  4NB5 A;  5AON A;  3QPH A;  4WK8 F;  2FSW A;  3TOA A;  4KYW A;  5LHH A;  5HS7 A;  1AOY A;  4PDK A;  2FNA A;  2NNY A;  2VBW A;  2FXA A;  1FT9 A;  3HUG A;  2R3S A;  4HDV A;  1ZLJ A;  1T2K A;  1QZY A;  1MJA A;  1UHM A;  3JSP A;  1MD0 A;  2OAZ A;  2GIV A;  1IN7 A;  4HV5 A;  4D0P A;  3JW4 A;  1W5S A;  4L5J A;  1ZGJ A;  4O5V A;  4ZYD A;  2VBY A;  3T5X A;  3C18 A;  3GZ5 A;  4RB0 A;  2MH2 A;  3KP3 A;  1BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...