4NDLA

Computational design and experimental verification of a symmetric homodimer
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
44
structure length
44
Chain Sequence
b'FSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENH-c2b, computational designed homodimer
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo protein
total genus 9
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4ndlA00
1B8IA 3O8GA 5BNGA 1JTXA 5E3OA 4DZJA 2XSDC 1FEXA 5E3MA 4JP0A 3LOCA 4M3EA 3ZQIA 3MKLA 1ETKA 1XS9A 2HYJA 2LR8A 2OF7A 2NS8A 2X6OA 1BW6A 2JK3A 3HOYJ 1ETXA 5F0FA 1VFCA 1JJ6C 3FK6A 5FKKA 3GTMJ 2Y2ZA 3S1MJ 1WH7A 3SDGA 2VI6A 2B63J 2M2EA 4GFBA 3JRCA 4QIWN 3JREA 1LFBA 3H0GJ 5FKNA 3PM1A 2JA6J 1IG7A 5C4JJ 4W97A 4G12A 3S1RJ 5E3NA 3HOVJ 2KDZA 1WI3A 2JN6A 3BG5A 5E3LA 3CCYA 3DCFA 5IOZA 3S14J 5IYDJ 2EZIA 4LOCA 3JRDA 3HGYA 4M6VA 1EF4A 1B72A 1FJLA 2GBYA 4QTRA 1H8AC 3ZQHA 2XPWA 1JUPA 2MW8A 3SJMA 1QPIA 2JWTA 3H3VK 3GBGA 3ZQCA 3SFIA 5EG0B 2HOSA 1ZQ3P 3GTKJ 4BBSJ 1MBGA 2Y9ZA 1IDZA 2Y0SN 1NTCA 1MBEA 5F1JA 2HI3A 3HGGA 3LSRA 1GT0C 2LY9A 4CYCB 3GTGJ 1U78A 2FD5A 1JUMA 4M3BA 1HF0A 1T56A 3LNQA 3L1PA 5IP6A 5K7HA 3CMYA 2CQQA 1BL0A 1MH3A 3NARA 2CU7A 3DEWA 1VF9A 2G0EA 1JUSA 5F08A 2LTPA 2KT0A 1K83J 2DMPA 2O8KA 1OCTC 4A3FJ 3JRGA 2DJNA 5DS9A 2YU9J 2ME6A 1WH5A 4I76A 3HOUJ 1X2NA 1GV2A 3QPSA 3VPRA 4W1UA 2MGQA 5DTDA 5IYBJ 1JKQC 4BY7J 2QCOA 3I4MJ 3MVPA 2XPUA 2EBIA 3UKGA 1IJWC 2JA8J 3RQIA 5EG0A 1H89C 1HCRA 1UG2A 3FK7A 1APLC 1NK3P 1CQTA 3S17J 4BBRJ 2DMTA 2QF7A 3IH3A 3BTIA 2E2JJ 1BA5A 1Z0XA 2FJ1A 3S15J 1MBHA 2L0KA 1I3QJ 4A3BJ 3A03A 1JTYA 2DA2A 3BT9A 4Y7NJ 1MSFC 3CDLA 4MLOA 5IP7J 4XK4A 4A93J 3Q3SA 5J1YA 1NK2P 3JRIA 2M9HA 5EZHA 5M3MJ 3BR0A 1P7JA 2LFBA 5M5WJ 5F04A 4X6AJ 2DA6A 4IHXA 2MG4A 4XICA 1U8BA 5C44J 4DYQA 2COBA 2LLKA 3B6CA 2W48A 3G1OA 5M5XJ 3TEDA 5J1UA 1G2HA 2XGCA 1TWCJ 2R5YA 1TWGJ 1GDTA 3HOXJ 1RKWA 2I10A 5JLXA 3BTJA 4FISA 1SFOJ 1R9TJ 3OIOA 1A6IA 1ETQA 3TP3A 2LKXA 1D5YA 2EZLA 2M0CA 3G1MA 2GLOA 1ETOA 1JT6A 2DA5A 4J19A 3F0CA 1JJ8C 2NVXJ 1QVUA 1ZR4A 4XRSG 5EDNA 1HLVA 4D7NA 2O9LA 1ETYA 2K40A 3MN2A 3LSPA 5J3LA 2R7ZJ 1ITYA 5GP9A 1GVDA 1X2MA 1AKHB 3S16J 3TW7A 1YRNA 2XPVA 2NS7A 5GPCA 1JKRC 1WCMJ 2XRLA 4HNVA 2X9DA 4EEFG 3PO2J 2AO9A 1ETWA 2LK2A 2Y31A 3A01A 3IV5A 3LSJA 1IGNA 4BY1J 4MO7A 3HOWJ 2CUEA 1OFCX 3OSGA 2JMWA 4A3MJ 2HXOA 1MBFA 2NOGA 5FJ8J 4XRMA 4Y52J 1MBKA 2H8RA 1IUFA 1TWHJ 3BTLA 1HOMA 5EZGA 1XG1A 2CUFA 1QRYA 4UUSB 4V2GA 4C3IJ 3BQYA 4BXXJ 2DMUA 1I50J 1RPWA 2GM4A 1F43A 4JX4A 2EZHA 3Q0VA 4M3GA 5FKLA 5FLMJ 5IOYA 3BQZA 2R5YB 2HOAA 4JYKA 5C3EJ 3BG3A 3HB9A 2M8GX 2XB0X 2H1KA 1AKHA 1ETVA 5FLVA 2DA1A 1IRZA 1MH4A 3JRAA 2ID6A 4V2FA 3WHCA 1UHSA 2R0QC 3Q0UA 1TWAJ 1PUFB 4RBOA 2PMZN 2DTZA 1ZR2A 2Y30A 5FKOA 1POGA 4I6ZA 2MSYA 5F0CA 3RZDJ 2CJJA 1VNDA 1VI0A 3BR6A 2TCTA 1FTZA 1ENHA 3HOZJ 2R93J 1TWFJ 3HKZN 3JRBA 3QQAA 3GTQJ 2WAQN 1ZGWA 1JKOC 2CQXA 4C3JJ 3M3YJ 2EQRA 4UUSA 4X1EA 2TRTA 2E2HJ 1X58A 3HEFA 1AHDP 3ZQFA 3BR2A 4B4CA 3B6AA 4A3LJ 5EF6A 1U9OA 2CRGA 5F27A 2XGEA 2WB1N 5EEAA 1YRNB 1Z77A 4M3DA 1LE8B 2M34A 2E2IJ 1U9NA 4DYCA 2NVYJ 4AUXA 2IBDA 4A3JJ 4A3CJ 3OOUA 1UMQA 2VPRA 3IH4A 3WHBA 2HOTA 3A01B 4A69C 5K7FA 2P81A 1WPKA 1BW5A 3G1LA 4A3EJ 4A3KJ 3W6VA 3FKIJ 1XC5A 2YUSA 3HM5A 5K7ZA 3TP0A 2R92J 1ZK8A 2OPTA 1H88C 1Y1VJ 1ZTRA 1PUFA 4FE7A 3BR3A 4DW6A 2JA7J 2K9QA 2Y9YA 3BR5A 4D5FA 1IDYA 4M3FA 4UUTA 3ZOBA 3JRFA 1OJLA 1RR7A 2YS9A 5F0HA 2JJ7A 3K7AJ 2R5ZB 2NVQJ 2IEKA 4FCYA 3CQZJ 4NDLA 1W0TA 2L7ZA 1BJZA 4IHYA 1MSEC 1DU6A 1LFUP 4A3GJ 1IC8A 1RETA 1WGXA 2HDDA 3E7LA 4DYRA 2WV1A 2D5VA 2E1OA 3JRHA 2LVSA 1LE8A 9ANTA 4FE4A 4B3AA 2VKVA 4A3DJ 1Y1WJ 2XGDA 1I6HJ 3HBLA 2X48A 4C3HJ 2IAIA 4D7MA 1S7EA 5C4XJ 5EYRA 3PO3J 4XIDA 2LP0A 2VKEA 2L7FP 3GTLJ 4MIMA 2K9SA 2EZKA 3K2AA 5EGOB 1FIPA 2DA3A 2ME0A 4FTHA 1QVTA 5IP9J 1MBJA 5HODA 1GUUA 4AYBN 1TC3C 4C2MJ 1RESA 2HQ5A 1E3OC 4QSHA 4MFDA 2L9RA 4BKXA 3GTPJ 2DA4A 4JX6A 1JT0A 3GTOJ 2R5ZA 3RKQA 2VUMJ 1W0UA 4ABZA 2DN0A 3ZQGA 3A02A 2LD5A 2N8GA 3S2DJ 4B1RA 5IYCJ 3LSGA 1ORKA 1RKTA 1SANA 4XRSA 3S1QJ 1JKPC 5IPAA 1B8IB 2XB5A 3FISA 1K61A 2JA5J 1FIAA 2DMQA 4A3IJ 1A5JA 1FTTA 3C2BA 3IH2A 1GV5A 2DMNA 2O7OA 4JX5A 5JLWA 3Q0WA 5J1RA 1IV6A 3HDDA 3S1NJ 1Q1VA 3ZQLA 2DA7A 2L7MP 3BTCA 3NAUA 1AU7A 4D5CA 2ECCA 3S2HJ 4RDUA 4IEJA 1P7IA 4IHWA 2HXIA 4L5EA 5EGOA 2FX0A 3FIWA 2K9NA 3M4OJ 3GTJJ 3RZOJ 4CYCA 4DZPA 4AC0A 2AHQA 1O4XA 3BG9A 5M3FJ 1DU0A 5GPAA 2ECBA 3TW6A 2ZB9A 1T33A 3BR1A 1JGGA 2ID3A 2E19A 4S0HB 4IHVA 3O8HA 1HDDC 3D1NI 3JR9A 3OSFA 1ZKGA 4MFEA 5FKMA 2EH3A 5M5YJ 2ELKA 1OCPA 2NVTJ 3QPLA 1B72B 3I4NJ 2FQ4A 2RAEA 1MNMC 1HDPA 1F36A
chains in the Genus database with same CATH superfamily
1VQNI 2DQRA 1E0EA 2EIJH 2CUZA 4LB6B 1J59A 2HYJA 2LR8A 4WXCA 1TZLA 4KIFA 2HPIA 5J8CA 4OMZA 2NS8A 4B43A 4BXFA 1HXDA 3CMEI 3H0DA 3HOYJ 2JK3A 2YX7A 3U2RA 3WTTC 2X51A 1VFCA 2HKOA 5HLGA 1HC8A 1T39A 1YS6A 1JJ6C 3FK6A 3CCEI 4N9IA 2Y2ZA 4L9TA 1RNLA 3CF5F 2B63J 4E6KG 2FBHA 2M2EA 1FYKA 1HW2A 3CO6C 1LUJB 2EB7A 2FOKA 1L0OC 4I99C 1YJNI 4ENNA 4HSTA 3E6BA 3WG7H 3CCYA 3S14J 3IL2A 4I2OA 1NHAA 4M6VA 1FT9A 3K1MA 1TW3A 3ZQHA 5DUIA 1VQ9I 2XPWA 1JUPA 2B7EA 4BJ6C 3SJMA 3H3VK 3RIRA 4EGYA 2H27A 1ZQ3P 3DV8A 1W7PA 2R7OA 3JSPA 1J7KA 5JHFA 1TT5B 4BE0A 3U9GA 4KJZA 4EVIA 3FZVA 1RRJA 1KZHA 1MBEA 1T8IA 1E3PA 3M1CA 5LLQA 1YFHA 1FBUA 2LY9A 1JHFA 2FD5A 4M3BA 2L9VA 3NEUA 3MFKA 1WQ2A 2KDOA 1T56A 1D1AA 2VB6A 1SVLA 1V5EA 3FXQA 2IA0A 3HRTA 1MD0A 1SMTA 3DEUA 2DAOA 2KT0A 3CCRI 3NWSA 1MGTA 1LEAA 3KETA 2ZKZA 2VE9A 2YU9J 3K1NA 1WH5A 2FNPA 2BYVE 4CUGA 3QOPA 2EK5A 3A0HC 4W1UA 1BR2A 1JKQC 2QCOA 3C7JA 3MVPA 4ESFA 5EEHA 2XPUA 2JA8J 2OBPA 1HW5A 3ONQA 1H89C 5DCMB 1MZBA 2DPDA 2XGXA 3DTEA 1CQTA 3OWTA 4II2A 4LJZF 4ZZDA 2R7RA 3ZGKA 3OYLA 2DMTA 2E2JJ 1WRJA 2OZ6A 2NXNB 3Q5FA 3S15J 1I3QJ 1OCRH 1JTYA 3A03A 3ZP5A 1WJAA 4NUBA 1HA8A 3CMMA 2A5WA 3CDLA 1FY7A 3HL2A 5IP7J 2DJIA 1ONVA 2RV8A 1LEBA 4CA0A 1KU7A 4A93J 1LB2A 1FSHA 2O03A 1PYVA 3JW4A 3HOTA 2H09A 5GAHJ 2HVSA 2DFEA 3TO7A 2M9HA 3DXJF 5EZHA 4TV7A 1A36A 3P9IA 2JT1A 2WWYA 1UJ8A 4P9FA 1VQPI 1BC8C 1OCCH 2O8XA 5BPIA 3QRFF 4RGXA 5B3SH 2KKOA 3LFUA 4DYQA 2OC6A 1AWCA 1G3YA 1DP7P 1BOAA 2CV1A 1MJ9A 3G1OA 3H3UA 4JOMA 2QBYB 2ZJRF 2KZVA 4ANJA 1S7AA 2IA1A 2HVRA 4YFNF 2CQ7A 3RJPA 3HPHA 4OIOF 4KICA 2TDXA 4WXDA 2MA3A 3ERED 5B1BH 2NNNA 1JE8A 1MNDA 2A68F 1RKWA 1OYIA 3SQNA 2CGPA 2KHMA 4AU7A 4CXFA 5H2FC 5DM7F 1ETQA 1UELB 1T38A 2VIXA 1D5YA 2HZDA 2L4MA 4RA2A 3ZCOA 1TL8A 2PBIA 1ETOA 4BQNA 3KYCB 1R5HA 2DA5A 1R1TA 1VQLI 2LH9A 3V8KA 5ICFA 2ZMEC 5K5QA 1QVUA 5E8IA 5EDNA 2E34A 3QP6A 1YS7A 3MN2A 3I5UA 3OYIA 4L0ZB 2MABA 2FE3A 5J3LA 3I71A 2A61A 1MMSA 2DT5A 4BUPA 5GP9A 1X2MA 2R7QA 4EGZA 3CZ6A 1I6XA 3F23A 1X1BA 3F8MA 4ITVA 2FBIA 1EH8A 2RKHA 2NS7A 5GPCA 3R6SA 3WE2A 1WFXA 4FX4A 1B1BA 3D5SC 2V9KA 4EEFG 4BEHA 2LK2A 3VODA 1TNTA 5DD8A 4A12A 2V9VA 2VC0A 1OPCA 2QQ8A 2GQQA 2QQBA 2CUEA 4PGGA 2RC4A 2XVCA 3K69A 3KEOA 1AA7A 5E1XA 3LFKA 3AL0C 4FASD 4LD5A 1MBFA 2VQGA 3CDIA 2ZJ2A 2M7BA 3BCBA 4Y52J 4O5VA 1TWHJ 2H8RA 4JK1X 2MBFA 2CUFA 1KQ9A 4OAYA 4XN0A 2WAFA 1XTAA 2LG4A 4LMYA 5KVRA 4G7ZF 2DMUA 4Z6YA 2BXYA 4A5NA 3AL0B 1I50J 2GM4A 2O61A 2FBKA 1UG0A 3Q0VA 3G4SI 5FKLA 3ZPLA 5FD5A 3SDBA 2ESNA 3LWFA 2LBFB 5IOYA 3SEQA 1FP2A 3AG2H 1KA8A 3BLYA 3FXKA 3S32A 4JBAA 2EILH 1OQYA 2R5YB 4JYKA 2OCCH 2BY1A 2KPMA 1DGWY 2E1MC 3PFYA 4IRGA 1O7LA 1ZG1A 1Z6RA 2DA1A 1MH4A 4YIRX 2ID6A 1MMNA 2ETHA 3K4JA 4BS9A 2FSWA 1ZRFA 2E1MB 2DTZA 1FYMA 4I6ZA 3PNYA 1XGMA 5F0CA 3RZDJ 1B59A 3KP5A 1IF1A 2JUCA 3R0AA 4U0YA 2XHKA 3OL3A 2OU2A 4MTEA 3OYAA 1D5VA 4DBQA 3QYEA 4OMYA 1T98A 2AXLA 2WAQN 3DTKA 3ZMDA 1JKOC 1J75A 2QENA 2RREA 2EQRA 3E5UA 3KIOA 2BZTA 3WTZA 2F5DA 2FRHA 5DCFA 4B4CA 2ISZA 1U6GA 4A3LJ 1CF7B 2I8DA 2UV1A 4HOBA 3EUKL 1QO0D 4ZTJA 1VZ0A 5EEAA 3QOEA 2EV0A 2WC2A 1U9NA 2XUBA 4AUXA 2B0LA 2JVHA 2IBDA 4ZDOA 3WHBA 1O3QA 3H92A 2P81A 2AXTC 1IV8A 3LA3A 3G1LA 2ZSHB 2WAEA 2O3FA 3FKIJ 3QPHA 5K7ZA 3JSOA 2VLAA 1EJ9A 2R92J 5K5RA 2UXXA 2XAHA 3JTGA 1Y1VJ 1Y0UA 1ZTRA 2V1NA 4NB5A 4NNJA 3RSNA 4FE7A 4AIKA 3BR3A 2ZFUA 1FBSA 2JA7J 2BVMA 3TDUC 1Y39A 2XRNA 1HSJA 1MJBA 3CESA 2QQAA 2COMA 2RNJA 1IDYA 2F6CA 1WWXA 2IPQX 4M3FA 3LA7A 2IA2A 4UUTA 3L2VA 1OJLA 3M1EA 3ISPA 5DV5A 2JJ7A 4HQMA 2Z1DA 3K7AJ 1NH3A 1QHGA 1KONA 2R5ZB 3L09A 3IRRA 2DTRA 5GAEJ 2P6TA 2IEKA 3IP4B 1XGOA 2LF7A 4E7ZA 3H35A 3C1DA 2L7ZA 3RDIA 3GX4X 2K4JA 5LD2C 2EPFA 4M9ZA 2BW3B 2WY7Q 4A3GJ 1J2XA 5F1RA 2H6CA 3E7LA 2JSPA 3WGHA 2D5VA 1B6AA 3U21A 4DQ2A 3EQLF 5IT3A 2DFIA 4FE4A 4B3AA 3K1PA 4BQAA 2RN7A 4Q5SF 1LNWA 3G73A 4AWXB 2KIFA 4XKWA 5CVVA 3HBLA 2X48A 1SFEA 2Z99A 4C3HJ 4PGHA 2IAIA 2X6XA 1Y0NA 2CUJA 4D7MA 5C4XJ 2LP0A 3EUHA 4UVAA 2EZKA 3MZYA 4PJLA 4UV9A 1FIPA 3U1KA 1BI1A 4IZZA 1IO2A 2ME0A 4YIFA 4CZZA 5CLSA 3F21A 3IWZA 1G8XA 4F92B 4BDYA 4HBLA 2XKPA 1PDNC 1YW7A 2L3DA 1RI7A 4BKXA 4MFDA 2L9RA 3GTPJ 4GGGA 1XMAA 2DA4A 1JT0A 2R5ZA 3RKQA 2LY2A 1I39A 4ABZA 2PQ8A 4U0VA 1U2WA 1Z7LA 2LOOA 4XL9A 3KP7A 2BW3A 2YSRA 5IYCJ 3RCOA 4XRSA 3E3VA 5F6FA 3K6GA 4E7SA 3HG9A 2CSOA 1FWZA 3G71I 1SFUA 4U88A 2DMQA 2XIGA 5H6RA 2PLYA 5EEGA 5JR3A 1FTTA 3C2BA 2DMNA 5JLWA 4MGRA 4CH7A 3H9QA 2R7VA 3TDZC 1YX5A 5L3CA 2L7MP 2R7WA 3DPUA 2KRFA 4ENMA 2ECCA 1IZ1A 4IHWA 3DWLE 2HXIA 3DKWA 1TNSA 4L5EA 1LDKB 1XDSA 2VXDA 3T1BA 2O5RA 4I0AA 4LIVA 5D6EA 4CYCA 5AONA 3K4KA 5CJ9A 3P5JA 3P9CA 1S8NA 1SVMA 4G8XA 4L9VA 1T33A 4HAMA 3GMEA 1JGGA 4S0HB 3RPUD 3OIPA 3SHFA 4IHVA 3O8HA 3CP8A 1HDDC 2HTSA 2EH3A 4QWQA 3HSFA 1Z91A 1TT0A 3DTIA 1YOVB 1OCPA 4YFXF 4OINF 1B72B 4HW0A 4XOPA 4IL6C 5CQEA 2ZXHA 4P96A 2NVUB 4OIPF 1S5LC 3VEPA 1JTXA 5D5UB 2DLLA 2L02A 3VYRB 4BXXJ 3DU6A 2P8TA 2WBMA 3AG1H 2OF7A 3VYSB 2XF7A 3COAC 1BM9A 4A0ZA 1X4PA 2VT3A 4EJTA 1VQOI 1X4OA 1BW6A 1TTYA 1YQAA 1OCZH 3OYMA 3OYNA 1CGPA 3LQQA 4P1WA 3S1MJ 5DUKA 3SDGA 3VYUB 2NRAC 4RB0A 5CVIA 3ZMZA 4CCMA 4Y13A 5CVRA 2OAZA 4QIWN 1K78B 1TQIA 2FEZA 3LAPA 1U0JA 3F9KA 3PM1A 1Z67A 4RAGA 4ESBA 4UXNA 5C4JJ 3BG6A 3S1RJ 3DQVC 5E3NA 3HOVJ 2KDZA 1ZAOA 4P55A 2JN6A 5DD4A 3BG5A 3I54A 4H0EA 5IYDJ 3QWLA 5IT9Z 5L3EA 2EZIA 1QQIA 2VKDA 2FQ3A 2RNGA 2GBYA 3ABLH 3BZCA 1OISA 1B72A 1MMDA 1R4MB 2DDBA 3GUDA 3SFZA 2CH0A 3ZN0A 2G7UA 3B73A 2J5OA 1MIJA 5DEQA 2KISA 2ZC2A 1BI2A 3GTKJ 2FXAA 4UB6C 2HKXA 3HHGA 3CJTB 3Q9SA 1GLNA 2Z9OA 5IT9K 1U78A 1B4AA 4F3QA 3CLQA 2Y69H 2VONA 1T95A 1UHWA 1HF0A 3M9AA 1E17A 2KIMA 2OA4A 4ESJA 1OLTA 5K7HA 4E7IA 3CMYA 2CQQA 4P5OA 1BL0A 1MH3A 2EFQA 3NARA 2Z16A 1V5FA 3HSEA 5DDGA 1VF9A 2G0EA 1HW1A 1K78A 1JUSA 4BHPA 5F08A 2KQRA 1W1WE 1JGSA 1LPQA 2O8KA 3J80K 2DOEA 2GOXB 2I5UA 1WZ2A 1XMXA 1D8JA 2ME6A 5BQTA 3HOUJ 3CCQI 3SXYA 4DNCA 1GV2A 2E60A 3VPRA 2ZSIB 4DBRA 2CV2A 5DTDA 2E7WA 2X85A 3OYCA 2K9MA 3H5NA 4ON0A 3SEZA 5L3GA 5ILSA 3OMYA 4LFUA 1UG2A 2DT7B 2A5YB 2L2OA 5GTIC 2K85A 5JVTA 2QSGX 3FXJA 3S17J 4BBRJ 3FWEA 4RM3A 3NRVA 2Q2EB 4PJJA 4G7HF 2FJ1A 2M8EA 2L0KA 2VQLA 4A3BJ 5FLXZ 4C30A 4KA4A 4WX9A 1G6NA 2IS6A 4CZCA 4CCJA 4PSXA 3OYHA 1LVAA 4PFOA 3M8EA 3FHNA 1TQMA 5J1YA 2PFBA 3L7WA 1NK2P 1GVJA 5BS6A 2WAQA 5HDGA 1W36D 2YR2A 4PZJA 1QPMA 3VDXA 3L00A 3BR0A 2A3SA 3BDDA 4LLLA 5M5WJ 3LSTA 6PAXA 4HNTA 2P5KA 1K4SA 2CFXA 1IRXA 3U1DA 4KFCA 4XICA 4IHXA 4X6AJ 1R49A 1W7PB 2LLKA 3QODA 2GA2A 3IAM2 1OKRA 2BE5F 4KN4X 3TEDA 1OYWA 3ABMH 2JA2A 4Y3OA 2CQKA 3QYBA 2HS5A 5K1YA 4YRVA 3K4CA 4BH9A 4IQJA 1YE9A 3KFWX 2Q2EA 1FBQA 1ON1A 4FISA 3GZ5A 1A6IA 2QWWA 3V4GA 5HVQC 2EZLA 3G1MA 2KJBA 4PJNA 4G6DA 1Y6IA 5LRSA 5TRDA 2F48A 1JT6A 1R22A 1XCBA 2V6CA 5E17F 5DYMA 4LIUA 2NVXJ 4AVZA 4G94A 1HLVA 1ODDA 5HDKA 2M0MA 5D5VB 2WA0A 2CW7A 1PP7U 2LYCA 2BEOA 3FM3A 3FXOA 4OAZA 4II3A 4BYYA 4MTDA 3K2ZA 1ITYA 1YYVA 4LB5A 1T0FC 3A4CA 1ZLJA 1IN7A 2FMYA 4UV8A 4GYIA 3IUOA 2R7SA 3S16J 3IAS2 3ASOH 3QPTA 2DK8A 1KU9A 3TW7A 4LK0F 1FMVA 1ZYRF 1D0ZA 1FOYA 3PUBA 1IRGA 2Y31A 1SC7A 2IGKA 3GVAA 4FT8A 3PSIA 2R7XA 3LSHA 1D1BA 1ZG5A 2PMUA 5J40A 2HXOA 3E5XA 3EPZA 2NOGA 4J01A 3MAJA 4XRMA 1HSTA 5CYVA 1MBKA 1IUFA 3BTLA 3QAHA 1REPC 4ZYDA 4C3IJ 3BQYA 3S8PA 4OU0A 4KT5C 3EYIA 2HDWA 5FD6A 2WADA 2EZHA 2ISYA 1T2KA 4BNCA 4M3GA 4E70A 5FLMJ 4RS8A 1FNNA 1UB9A 5LBQA 3CC4I 2HOAA 3BG3A 1G3TA 3LA2A 1LJ9A 3HB9A 2M8GX 1FSEA 1YIJI 3WTWC 2XB0X 2MD0A 3H36A 3WTSC 2H1KA 4HPQA 3HZJA 1QNTA 5FLVA 3KYDB 2VASA 4FETA 3JRAA 4CCNA 4V2FA 4HG2A 3H9JA 3WHCA 3N4MA 3CDHA 3MMYB 1T0FA 2K4BA 4XN3A 3KP4A 5HS9A 1ZR2A 1P92A 5LHIA 2JPCA 2MSYA 1D0YA 2YPRA 2IGOA 3K4MA 3T0YA 2OCEA 1E3HA 2JSCA 1VNDA 1VI0A 3BR6A 3I55I 3KP6A 4NBQA 1S3JA 1W5TA 3CMAI 2EFPA 2QM3A 2Y0MA 3K0LA 3ZMUA 2XC7A 3IKVA 4EMSA 3J81K 3JRBA 4XLPF 3QQAA 4YEJA 3HJEA 5FRNA 1Z6TA 2NS0A 1P4XA 2XAFA 1MMAA 2BGCA 2E2HJ 2TRTA 3AG4H 1X58A 1XN7A 2OQGA 3B6AA 2VJIA 5D4RA 3G6EI 4Y33A 1I27A 2DODA 5EF6A 2E7XA 3DLLF 2RGVA 2EIMH 3H3ZA 1FP1D 2M34A 4ZJZA 1K7AA 2NVYJ 1R36A 2DPUA 4A3JJ 4BEHB 1K6YA 1KYWA 4A69C 5K7FA 5K5OA 3TO6A 3HOSA 4CCKA 1D3YA 4A3EJ 4I7HA 3W6VA 5LHHA 2YUSA 3HM5A 3TP0A 2KRCA 2GOMA 2OPTA 1LDDA 3BJAA 1BC7C 1R1VA 3FXMA 4DW6A 4BE1A 4E7LA 3EETA 1XSDA 3ZMVA 3BR5A 2E5ZA 1BI0A 2IVMA 1F4KA 1WJDA 3FX3A 2LDUA 3CD6I 2VBYA 3JRFA 1RR7A 5LGNA 2ELJA 3KPHA 4M71A 1ACIA 4M74A 4HDUA 4FQGA 1F5TA 1W0TA 2VE8A 2L01A 2AS5F 1VTNC 3FF5A 4PUSA 2ZMEB 4C9YA 2PJRB 4EJVA 3PNVA 1WGXA 2A69F 2HYGD 4DYRA 2E1OA 2W57A 2HVQA 3JRHA 2LVSA 1RUNA 3GFMA 2C6YA 4K2EA 4ZYHA 2VKVA 2HR3A 2GIVA 1UHMA 4A3DJ 1Y1WJ 2CW0F 2KLOA 2VODA 3DPLC 2QGUA 5HLIA 3R0JA 3MZ8A 1S7EA 1XCVA 3PO3J 3GTLJ 3WGIA 4MIMA 3ASNH 1V5GA 3I59B 4RGRA 2DA3A 4P9UA 1QVTA 2HQAA 5HDNA 1MBJA 5HODA 1GUUA 1TP4A 3RQ4A 1TC3C 3OYJA 1ZG3A 3FMQA 1ZRDA 4Q48A 3CJQB 1QU3A 1R6RA 2NOJB 2HQ5A 1E3OC 4QLCU 5J6XA 3GTOJ 2BY2A 3MCZA 4IKFA 1USSA 3BY6A 3K70D 1SEUA 1X3WB 3R61A 3OYBA 4G6TB 1HQCA 2DN0A 2GXGA 4IF4A 1I1GA 1WVRA 2D2WA 3A02A 3TO9A 3CC2I 2ZMEA 4HSRA 2LD5A 3S2DJ 2PJRA 3S1QJ 2XAQA 1RKTA 1JKPC 1LDJA 1B8IB 1BBYA 1RC9A 5D4SA 2DCEA 3A2KA 4UB8C 3IH2A 1D8KA 4Y15A 5F64A 1IV6A 3H5RA 2QKLB 1Q1VA 3S1NJ 1FOXA 4BQQA 3ZQLA 1O7FA 3FXUA 2HZTA 3WTYC 5LGTA 4RDUA 3VWBA 2VL8A 1P7IA 3V7SA 3DKYA 3I59A 2FX0A 4GO1A 2A6EF 3E6CC 4BAYA 2IS1A 4S05A 4AC0A 3BG9A 5ICCA 2ZB9A 2EA2A 3BR1A 3GYHX 3IHUA 2LREA 2DFFA 1D0XA 2K27A 5ILVA 3LSMA 2QSFX 3JR9A 5ILUA 3ML6A 5M5YJ 4OIRF 2ELKA 4Y4RA 3CJRB 4XSXF 4PJ0C 1MNEA 2F2EA 3I4NJ 2V1UA 1MNMC 4ZH4F 2JQ7A 1F36A 5IY5H 1B8IA 3O8GA 3D0SA 4EJUA 5BNGA 5E3OA 4OOIA 4DZJA 2XSDC 4PCQA 4DOZA 1FEXA 5E3MA 3LOCA 4HRIA 3MKLA 2W25A 3J7ZI 4LITA 2QUFA 2JRTA 4XKVA 2X6OA 5F0FA 1S29A 2ZBKA 3T8TA 2IS2A 2YU3A 1ZGAA 2Y48A 1B9MA 2W84A 1WKMA 1X1AA 1M1EB 1EA3A 1GXQA 1WH7A 4IRIA 2OV7A 3IRQA 1F9NA 4XLEA 5TISC 3JREA 3DU5A 3HRMA 1IG7A 3SZPA 2W24A 4W97A 3S3NA 3GFIA 4MNUA 3BOQA 2Z2SB 3P7NA 1WI3A 1SFXA 2QYOA 2ZNZA 1V54H 3DCFA 2A07F 2VBWA 4I09A 1PVEA 2L9SA 3JRDA 1VQMI 5GAGJ 1YLFA 5FO5A 1Y8RB 3HYIA 1S72I 4UUVA 3GBGA 5EG0B 2HOSA 4L18B 3M7GA 4AM3A 1MBGA 2XAJA 5LRRA 1X1DA 2P4WA 2Y9ZA 5JI6A 2Y0SN 1MKMA 1TLHB 2HTJA 2QQ9A 4IRHA 5E1WA 5F1JA 2ICWG 3HGGA 2K7LA 4CYCB 1JUMA 3E97A 4XKBA 4H4KC 1WJ5A 1R71A 1U5TC 3L1PA 4A0XA 4KYWA 2UWMA 2V79A 1YG2A 2CU7A 1GHCA 5E18F 1SMYF 1XSVA 4BQOA 2AQEA 4RM2A 1GXPA 2DMPA 3J7AO 2KIQA 2KRHA 4XMYA 3JRGA 4A3FJ 1AOYA 3UNGC 1HKSA 2LRDA 2ZXWH 5BMZA 4I76A 3TKYA 3K4LA 4E4HA 5E20A 1UAAA 3ZR8X 4BGDA 4MQVA 4J00A 2STTA 2MGQA 3KP3A 4R1HA 3TL4X 2B9SA 3I4MJ 2NNYA 1IJWC 2EBIA 3UKGA 5L3DA 3RQIA 5EG0A 3ULQB 2ZFWA 3BZKA 2Y75A 3GXOA 5D5WB 2IXSA 2ZJQF 3TOAA 1IN4A 1P4AA 3GLLA 1O57A 3IH3A 3NQOA 1H9GA 4KITB 2F4MB 1Z0XA 4L5IA 1BA5A 3TOBA 2ZO4A 2DA2A 2EINH 4O3MA 4CYDA 5D8LB 3BT9A 3DFGA 3GO5A 2BHZA 3V7CA 1G59A 1EV7A 2DOFA 4HX4A 1IN8A 3VFZA 1YIOA 4Y7NJ 1YHQI 4MLOA 5LGUA 3PFIA 4UY8I 5HOOA 2W85A 3Q3SA 4HX8A 1J5YA 1YX3A 2W82A 4XNFA 1L3LA 4IQ4A 2JUGA 2P7CB 2OUMA 3DBHB 2MC4A 1P7JA 1YTYA 2LFBA 4KMUX 2IW5A 4ZDLA 2CW8A 5LHGA 5F04A 4HLYA 2DA6A 2X1DA 2STWA 2MG4A 1QA6A 3VYTB 1U8BA 4MEXF 2GXBA 1EH6A 2COBA 4NQWA 3B6CA 1YW8A 4DJAA 2W48A 4ZDPA 2QA4I 4WF2A 3RI4A 2HWVA 4LK1F 1MDMB 4UVBA 1G2HA 2XGCA 2BY3A 2RQQA 2DFHA 1PJRA 2D1VA 2DYRH 4Y17A 3OR2C 2XV4S 4IXAA 5D6FA 1WI9A 3OYDA 1U3EM 3KZIC 3HOXJ 4N4OB 2IGMA 4BXUA 2I10A 5JLXA 4RB2C 2GXAA 3BTJA 3ELKA 3OIOA 3BPVA 4S04A 2LY1A 1WJBA 2EIKH 2LKXA 3TGNA 1K79A 2M0CA 3KLNA 2KFDA 1FYLA 3CUQC 4BL0B 1WSUA 4J19A 2EV5A 3F0CA 5CVUA 1SD5A 3BC8A 4ZYGA 4YG2F 2MYSA 1W5SA 2VJ5A 1QZZA 4XRSG 2E71A 4D7NA 3WTVC 1ETYA 3PL8A 2OTLI 2WV0A 2DK5A 3LSPA 4BJTA 1U8RA 2DQLA 4MEYF 4ASNA 4F7ZA 2R7ZJ 2RQPA 4EM2A 1OYYA 2QKMB 1QZYA 2R7DA 1GVDA 5CVJA 1AKHB 3GFJA 4IVNA 3WU1B 2DDAA 1MDMA 1YRNA 2XPVA 4N0BA 2L9NA 2W00A 5LEJA 1WCMJ 2XRLA 4HNVA 3J7YJ 4MQ9F 4QPQA 2M3AA 3L9FA 1XGSA 3TQNA 1EKEA 2Q8KA 2CWEA 1XD7A 2AO9A 1ETWA 3ESWB 3FKJA 4KNYA 5FRMA 3A01A 4KIBA 2OQRA 3LSJA 5D8KB 3I3LA 4MO7A 1LQ1A 2JVGA 3WTXC 3HPGA 4XLFA 4IPAA 3AKZA 4BY1J 3HUGA 2FUG2 1OFCX 2CO5A 3RKWA 1XPXA 4LGWA 3PIOF 3I56I 1KU2A 1R23A 5BOXA 5FJ8J 4BACA 3ECHA 4Q4ZF 3BZ6A 4B47A 3HSRA 5FB2A 4ENJA 2P6SA 1DPRA 4BHBA 1H0MA 5EZGA 1XG1A 2XAUA 2W4SA 3FBIB 2ESHA 4V2GA 2JTVA 4Q47A 3J80Z 1RPWA 4IHSA 1F43A 4JX4A 4U7BA 4WK8F 4B09A 2WY8Q 4XONA 3OOPA 3BQZA 1BR4A 5HLTA 3DKXA 1LVKA 1Z3XA 2IGNA 3CUQA 3PJRA 2DI3A 3F8BA 5TJJA 3L2UA 2ZJPF 4CGZA 1Y8QB 3F6VA 4M73A 1AKHA 3W2VA 4M6XA 4KIGA 3OV8A 4HF0A 2EFWA 2BXZA 1IRZA 3V42A 3A0BC 3I4PA 4XLCA 4XORA 2CV0A 2R0QC 3ABTA 1G3WA 2V7FA 1BIBA 2PMZN 2Y30A 1POGA 2G7HA 4RAFA 2BY0A 2E5NA 1KYZA 4U87A 1FTZA 2VT2A 1JI8A 1ENHA 3HOZJ 2ZXJA 3RYPA 1TWFJ 1RUOA 3GTQJ 1X1CA 3LAJA 3S3OA 3DP7A 4WXHA 2CQXA 5LEKA 3M3YJ 1A35A 2Z5UA 4X1EA 1AHDP 3E6MA 3BR2A 4ZZLA 3SYTA 2VOPA 4B48A 1UFMA 3ROUA 3K9TA 2EJRA 2CRGA 2XGEA 4CCLA 2F5VA 4M3DA 4BE2A 3KCCA 2NAZA 2HOEA 2X6WA 3IH4A 5J4YA 3CCUI 3GF2A 1YITI 1BW5A 3AG3H 2F4OB 3BP8A 3M8JA 1XC5A 5EJCA 4EATA 2FMLA 4PFPA 4KISA 1XSXA 2PX9A 3W6KB 4F91B 1ZK8A 1N75A 1LFPA 3BJOA 2F5FA 4RB1A 2VQHA 1USTA 5ERIA 1FPQA 2Y9YA 3OY9A 3L2CA 3CC7I 2LKSA 1EH7A 1HKQA 3FM5A 3LSKA 1Y56A 3RKYA 4RB3C 4KMFA 1DDNA 1FLIA 1SAXA 1Z05A 2CQNA 2BHYA 5F0HA 2YS9A 3JCUC 4XKCA 1J0RA 4AIDA 4EV0A 5TGTA 3ERMA 4CSWA 4FCYA 3CQZJ 4NDLA 3KX2A 2JPBA 3GZNB 1IW7F 1P4WA 4CHUA 2QEXI 1MSEC 2DYSH 3BG7A 3M07A 1LFUP 1KU3A 2M1BA 3KEYA 3R60A 4N9HA 4QPOA 3PSFA 2HDDA 2HYFA 5J4VA 3ZQQA 2IT0A 4I01A 4HV5A 1TBXA 2DO7A 2OTJI 4M9SA 3HXLA 9ANTA 1K6OA 2H94A 5FFZA 2MFZA 5B5EC 4U7DA 2BOLA 2Y0SA 1ZELA 4I98B 5CQGA 5EYRA 2D45A 2ADUA 4XIDA 3I64A 4RGUA 2VKEA 2ZNYA 4AIHA 2K9SA 3VSKA 1DQUA 3K2AA 1WJFA 1V4RA 2P5VA 3N97A 1XGNA 1SFKA 2F5EA 4FTHA 3RKXA 3WGGA 2F5CA 4AYBN 1F1ZA 5B66C 5ICEA 2UXNA 1IRFA 5FGMA 3FXLA 4QSHA 5L3FA 2VUMJ 1WHUA 5E79C 1W0UA 2J5PA 2LF8A 3RPUA 3F3XA 2PJPA 3ZQGA 3PQJA 2N8GA 2PEXA 2PMHA 1ORKA 2DXIA 3OL4A 2L5QA 3WG9A 1VQ6I 1WJEA 2CFOA 4HX7A 5IPAA 2XB5A 2VC1A 3HIFA 1K4TA 4B8XA 1P2FA 2L54A 3F72A 3ECOA 1FIAA 2EV6A 3F22A 1I5ZA 3Q9VA 1RIOH 2VPLA 4A3IJ 2K3PA 4KN7X 3F8FA 5JFRA 4WWCA 4HLXA 2O7OA 2FOWA 3UR3C 3PQKA 3Q0WA 5J1RA 3KE2A 2GA1A 5KK1A 3HTUA 3BTCA 3KLOA 1AU7A 3S2HJ 1IXCA 3CUOA 4U0WA 1QGPA 3OYKA 5HNFA 3RPQA 1D1CA 4ZYEA 1I3AA 4NC6A 3M4OJ 2K9NA 2X1CA 1OR7C 3HRUA 2UUZA 4DZPA 5M3FJ 1VQ4I 1XX5A 5E8GA 1DU0A 3J81Z 2ECBA 1VQ5I 4L9NA 4IOAF 4B3XA 2X1EA 5D5XB 3D1NI 3OSFA 1ZKGA 2PG4A 3OIQA 4MFEA 1ERDA 2XKOA 4XOTA 3HKZA 3MWMA 3LSIA 1ON2A 4IX7A 4C2TA 3TMOA 3K10A 1O3TA 4HV6A 3QPLA 1ZARA 2GAUA 2FQ4A 4E7HA 2RAEA 1IAWA 1FOWA 2X6YA 5AIPA 4CCOA 4RGSA 1SVOA 3P9KA 1R58A 2IP2A 2M4GA 5HLHA 2WB1A 3VOEA 3L2RA 3CCJI 4KDPA 4RLFA 4D9JA 4JP0A 1C0WA 4M3EA 3ZQIA 1ETKA 3S2WA 1XS9A 4R8HA 3B02A 4XQFA 4HQEA 5JHUA 5DCMA 1ETXA 3FDYA 2IRFG 2XSJC 1S7OA 2RDPA 5FKKA 5HS8A 3GTMJ 1W36C 2VI6A 1P9QC 1QHHD 4GFBA 3JRCA 3AFHA 2QZ8A 1LFBA 1BIAA 3D5LA 3H0GJ 3FBNB 5FKNA 3O2PE 2V1XA 1BI3A 1H9TA 2JA6J 3MEXA 3CJNA 4AD9A 3C18A 3LMMA 4G12A 1R4NB 5BPDA 1OR7A 1YI2I 3F6OA 5E3LA 1S9HA 4DGWB 5IOZA 2A6HF 2XAGA 3EYYA 3HGYA 3ABKH 4L5JA 4LOCA 2R4GA 4LG0B 1EF4A 1FJLA 2R7TA 4QTRA 1H8AC 5AIQA 2FNAA 2MW8A 3ZXSA 2M45A 4GXOA 3OYFA 2JWTA 3HRSA 2FF4A 1QPIA 2VKHA 5KHDA 3ZQCA 1ZN2A 3K4NA 3SFIA 1SD6A 4A2UA 4BBSJ 4IOCF 1R1UA 3AAFA 1IDZA 1WJCA 3MKZA 1NTCA 3FXRA 4M9XA 4X0GA 2HI3A 3LSRA 1PP8F 1GT0C 2QBYA 2Z33A 3GTGJ 1BN5A 2R7UA 1STZA 3WU2C 1A6QA 3ABUA 2M87A 2X4HA 2MC3A 3V7RA 2EFOA 3LNQA 5IP6A 4OIQF 2OD5A 1O3RA 2QSHX 2KIUA 2R3SA 3DEWA 4EJWA 2BBYA 2LKPA 2CMPA 2KP6A 3OYEA 2HDCA 2ZXIA 2LTPA 1N78A 1K83J 5KAFC 1HBXG 4PK4A 1OCTC 3F8NA 2DJNA 3GCMA 4RAYA 5DS9A 3SZTA 2FA5A 4O6JA 1X2NA 1J09A 2L4AA 3QPSA 1ULYA 3BPXA 5IYBJ 4LG0A 3T5XA 4BY7J 1IN6A 1FX7A 4FHTA 3L2WA 4UVCA 2O6GE 3K4BA 4RLQA 4BU2A 4XSZF 2E1NA 3GW2A 5H6QA 1HCRA 3FK7A 5GADJ 1APLC 1NK3P 2K02A 5CPRB 4YFKF 2QF7A 4IJAA 3BTIA 1ZRCA 2PMZA 1MBHA 5FFXA 2F4IA 2H1LA 3HHHA 5KAIC 4A0YA 4XRFA 2KL4A 3D5RC 5KCMA 1MSFC 2M7AA 3NWTA 2GWRA 5HS7A 4XK4A 3OS0A 4NC8A 3JRIA 4D1QA 2E35A 4BJ5C 2O0YA 5M3MJ 4IHTA 4EQQA 4YELA 3CCMI 1J9IA 1R00A 3OR1C 3PIPF 5DM6F 3R4KA 1R5ID 5C44J 3G3ZA 3KEQA 2DW4A 3DEEA 2KZGA 4XR6A 4HF1A 4RAZA 2LBFA 5M5XJ 5J1UA 1LKXA 1TWCJ 2QLZA 3GWZA 1FC3A 4PDKA 2R5YA 1TWGJ 4PJMA 3EUHC 4L9JA 1Q1HA 1GDTA 1XB4A 1YJ9I 1I1SA 5B1AH 1P6RA 1N77A 1ZREA 1SFOJ 1R9TJ 2W1OA 4I02A 2KMUA 2YX4A 3BCAA 1Z9CA 3CLOA 3W3CA 3TP3A 3LL7A 1MMGA 1E2XA 2ACJA 3EDPA 4GCVA 2GLOA 4ZTFA 3S93A 3ZQ7A 3I53A 4I0BA 2UZKA 2JZYA 1JJ8C 2AQFA 3MQ0A 3TBIA 1ZR4A 2O9LA 2XF6A 3E0JB 2K40A 4GDFA 2D1HA 3L2QA 4G9YA 4GRIA 2CG4A 3ZMTA 1TW2A 1S6LA 3FHZA 1NG7A 1UZCA 4A6DA 1CF7A 2EFNA 2RVCA 4LG3A 1IXRC 2V6EA 4AVPA 1JKRC 3H9GA 3GFLA 2VBZA 4G7OF 2X9DA 2MH9A 3W2AA 3PO2J 2JRMA 2XASA 3C2GA 3RTRA 4B44A 3IV5A 2VXZA 2LSOA 3CP2A 2EA4A 3PNTA 1IGNA 2E1CA 3HOWJ 1DGRM 1FOKA 4WCGA 2K3FA 3C2HA 3OSGA 3IKTA 3OYGA 2JMWA 4GYGA 3QYFA 3SZGA 4A3MJ 1U5TB 1KQ8A 3QP5A 4XLAA 4AYBA 2K9LA 5ICGA 1HOMA 2DBBA 1X1PA 4EM1A 1VQKI 1YJWI 4UUSB 1QRYA 2HPMA 3PUFA 4NQWB 1B9NA 5A2QK 5J47A 3W6JB 1MW7A 2P5LC 4R79A 5HNHA 2Q0OA 1IN5A 2WTEA 2P7VB 3HC7A 1W7PD 3N05A 3ZMSA 4XBFA 4HZFA 5A2QZ 5C3EJ 2HNHA 4HEA2 2V1DA 3O3KA 4BDZA 2NYXA 3BWGA 3DBLB 3E5QA 2L7KA 2VJJA 3MD2A 3V8LA 1ETVA 3O6BB 3QU6A 2XROA 1SD4A 1KGSA 1HKTA 5H20A 1UHSA 1SAUA 1TWAJ 2MD5A 3Q0UA 4RBOA 1PUFB 3MKWB 2OZUA 5FKOA 1A04A 2HEOA 2H6BA 1QZEA 2LMDA 4CO8A 2CJJA 4M6YA 5KNLA 3CCVI 4E7KA 1ZH5A 2TCTA 4V19K 1X19A 3WTUC 2Q1ZB 1MJAA 2A6TA 3JAMK 2OJED 2CYYA 3K70C 4IO9F 1U5TA 4A5MA 4N4NB 3HKZN 1ZGWA 1Z3YA 4RMNA 3H1CA 1RZ4A 1QBJA 3F8CA 3IWFA 2ZCWA 4C3JJ 3JAMZ 1ZHFA 4UUSA 3HEFA 2GZWA 2LC2A 2PN6A 3ZQFA 3ZRGA 3I9V2 3J7AY 2G9WA 2HQNA 2VBXA 1W4MA 1U9OA 5F27A 3WU0A 1YRNB 2WB1N 1Z77A 1LE8B 2E36A 2E2IJ 1SD7A 5ED4A 4DYCA 1ZLKA 2HQRA 4E7JA 1YW9A 4A3CJ 3OOUA 1UMQA 2VPRA 1R5GA 3BJ6A 1BR1A 4BHCA 3A01B 3KYLA 2HOTA 4L0YB 3EUAA 1T6SA 1WPKA 4XLHA 4A3KJ 3HUGB 4HF2A 1Z21A 1DUXC 3CCSI 3WODF 1T08B 1H88C 3MKYB 1PUFA 1JHHA 1PUEE 4HNUA 4LLGF 2HU9A 1A31A 4LLNA 3FMRA 3H5AA 2BVLA 2K9QA 4A6EA 1FMWA 4HA8A 3I0TA 2VQCA 4D5FA 1KQ0A 4FX0A 1VQ8I 3ZOBA 4M72A 2VN2A 3RYRA 4UNOA 1TQPA 2NVQJ 1W5CC 1V3FA 1DP3A 3CUQB 2ELHA 2MLGA 3BROA 4C2UA 1BJZA 4IHYA 4ZYAA 5JVGF 3GZ6A 1DU6A 4DIQA 3W2WA 5CKTA 1IC8A 1OMIA 2P0WA 3E1SA 4EM0B 1RETA 2IS4A 4CICA 1Z1DA 1BOBA 2WV1A 2DT6A 4NC7A 4F52A 3LQRA 4JQFA 4AIJA 5E1ZB 4F93B 2QVOA 1LE8A 2XF5A 1X3ZB 1JXSA 2XGDA 1I6HJ 3GLXA 3KP2A 5FROA 3DF8A 2HFHA 3KZZA 3C3WA 3JTHA 4ETSA 1G3SA 2L7FP 3VSLA 3HTSB 4D0PA 2DU9A 5EGOB 5L3BA 3OS1A 1UCRA 5IP9J 4CDGA 4C2MJ 1RESA 3DLAA 2A05A 2EWNA 4Z2YA 3MZHA 1ZGJA 3REOA 2FU4A 2HGCA 2W7NA 4JX6A 2K86A 2V4JC 1XDUA 1V55H 1R7JA 4OWRB 5LFAA 2CS3A 2KJCA 4ENKA 4B1RA 3LSGA 1SANA 3GEZA 3CO7C 1VQ7I 1IUYA 4PSWA 3A1YA 3VB2A 3FISA 4KT6A 4XM3A 5J8FA 1O3SA 1K61A 1Z7UA 3CF2A 3FMSA 2X0LA 2JA5J 3ZN1A 4NHJA 3CTAA 3V8JA 1A5JA 2M4KA 2R7FA 3DBRB 1GV5A 3KZYA 4JX5A 3I58A 1YO5C 3HDDA 4UHTA 2LNBA 1IXSB 2DA7A 2M30A 3NAUA 3S3MA 4D5CA 1G4DA 4IEJA 4G6QA 4MHGA 4XLNF 3IC7A 1X3UA 5FLXK 2MH2A 5GTHC 2H8WA 5EGOA 2VJ4A 3G2BA 3FIWA 4YIIA 2V26A 3CCLI 4HDVA 1N25A 3E6DA 3GTJJ 2PI0A 3RZOJ 2BV6A 1NG6A 1DPUA 2VOOA 1XMKA 2DOAA 2AHQA 1O4XA 5GPAA 3TW6A 2ID3A 2E19A 2MLKA 1FZPB 2GIZA 3M8FA 3T8RA 3OS2A 4EJOA 2V9PA 5FKMA 2M5WA 2XDVA 2K5CA 4F55A 4HYEA 3X2QH 3DPTA 2NVTJ 3WE3A 2IJLA 4ZC3A 4KUMA 1OCOH 2Z3YA 1HDPA 1RR8C 1BJAA 3QU3A 2R93J
chains in the Genus database with same CATH topology
1B8IA 3O8GA 5BNGA 1JTXA 5E3OA 4DZJA 2XSDC 1FEXA 5E3MA 4JP0A 3LOCA 4M3EA 3ZQIA 3MKLA 1ETKA 1XS9A 2HYJA 2LR8A 2OF7A 2NS8A 2X6OA 1BW6A 2JK3A 3HOYJ 1ETXA 5F0FA 1VFCA 1JJ6C 3FK6A 5FKKA 3GTMJ 2Y2ZA 3S1MJ 1WH7A 3SDGA 2VI6A 2B63J 2M2EA 4GFBA 3JRCA 4QIWN 3JREA 1LFBA 3H0GJ 5FKNA 3PM1A 2JA6J 1IG7A 5C4JJ 4W97A 4G12A 3S1RJ 5E3NA 3HOVJ 2KDZA 1WI3A 2JN6A 3BG5A 5E3LA 3CCYA 3DCFA 5IOZA 3S14J 5IYDJ 2EZIA 4LOCA 3JRDA 3HGYA 4M6VA 1EF4A 1B72A 1FJLA 2GBYA 4QTRA 1H8AC 3ZQHA 2XPWA 1JUPA 2MW8A 3SJMA 1QPIA 2JWTA 3H3VK 3GBGA 3ZQCA 3SFIA 5EG0B 2HOSA 1ZQ3P 3GTKJ 4BBSJ 1MBGA 2Y9ZA 1IDZA 2Y0SN 1NTCA 1MBEA 5F1JA 2HI3A 3HGGA 3LSRA 1GT0C 2LY9A 4CYCB 3GTGJ 1U78A 2FD5A 1JUMA 4M3BA 1HF0A 1T56A 3LNQA 3L1PA 5IP6A 5K7HA 3CMYA 2CQQA 1BL0A 1MH3A 3NARA 2CU7A 3DEWA 1VF9A 2G0EA 1JUSA 5F08A 2LTPA 2KT0A 1K83J 2DMPA 2O8KA 1OCTC 4A3FJ 3JRGA 2DJNA 5DS9A 2YU9J 2ME6A 1WH5A 4I76A 3HOUJ 1X2NA 1GV2A 3QPSA 3VPRA 4W1UA 2MGQA 5DTDA 5IYBJ 1JKQC 4BY7J 2QCOA 3I4MJ 3MVPA 2XPUA 2EBIA 3UKGA 1IJWC 2JA8J 3RQIA 5EG0A 1H89C 1HCRA 1UG2A 3FK7A 1APLC 1NK3P 1CQTA 3S17J 4BBRJ 2DMTA 2QF7A 3IH3A 3BTIA 2E2JJ 1BA5A 1Z0XA 2FJ1A 3S15J 1MBHA 2L0KA 1I3QJ 4A3BJ 3A03A 1JTYA 2DA2A 3BT9A 4Y7NJ 1MSFC 3CDLA 4MLOA 5IP7J 4XK4A 4A93J 3Q3SA 5J1YA 1NK2P 3JRIA 2M9HA 5EZHA 5M3MJ 3BR0A 1P7JA 2LFBA 5M5WJ 5F04A 4X6AJ 2DA6A 4IHXA 2MG4A 4XICA 1U8BA 5C44J 4DYQA 2COBA 2LLKA 3B6CA 2W48A 3G1OA 5M5XJ 3TEDA 5J1UA 1G2HA 2XGCA 1TWCJ 2R5YA 1TWGJ 1GDTA 3HOXJ 1RKWA 2I10A 5JLXA 3BTJA 4FISA 1SFOJ 1R9TJ 3OIOA 1A6IA 1ETQA 3TP3A 2LKXA 1D5YA 2EZLA 2M0CA 3G1MA 2GLOA 1ETOA 1JT6A 2DA5A 4J19A 3F0CA 1JJ8C 2NVXJ 1QVUA 1ZR4A 4XRSG 5EDNA 1HLVA 4D7NA 2O9LA 1ETYA 2K40A 3MN2A 3LSPA 5J3LA 2R7ZJ 1ITYA 5GP9A 1GVDA 1X2MA 1AKHB 3S16J 3TW7A 1YRNA 2XPVA 2NS7A 5GPCA 1JKRC 1WCMJ 2XRLA 4HNVA 2X9DA 4EEFG 3PO2J 2AO9A 1ETWA 2LK2A 2Y31A 3A01A 3IV5A 3LSJA 1IGNA 4BY1J 4MO7A 3HOWJ 2CUEA 1OFCX 3OSGA 2JMWA 4A3MJ 2HXOA 1MBFA 2NOGA 5FJ8J 4XRMA 4Y52J 1MBKA 2H8RA 1IUFA 1TWHJ 3BTLA 1HOMA 5EZGA 1XG1A 2CUFA 1QRYA 4UUSB 4V2GA 4C3IJ 3BQYA 4BXXJ 2DMUA 1I50J 1RPWA 2GM4A 1F43A 4JX4A 2EZHA 3Q0VA 4M3GA 5FKLA 5FLMJ 5IOYA 3BQZA 2R5YB 2HOAA 4JYKA 5C3EJ 3BG3A 3HB9A 2M8GX 2XB0X 2H1KA 1AKHA 1ETVA 5FLVA 2DA1A 1IRZA 1MH4A 3JRAA 2ID6A 4V2FA 3WHCA 1UHSA 2R0QC 3Q0UA 1TWAJ 1PUFB 4RBOA 2PMZN 2DTZA 1ZR2A 2Y30A 5FKOA 1POGA 4I6ZA 2MSYA 5F0CA 3RZDJ 2CJJA 1VNDA 1VI0A 3BR6A 2TCTA 1FTZA 1ENHA 3HOZJ 2R93J 1TWFJ 3HKZN 3JRBA 3QQAA 3GTQJ 2WAQN 1ZGWA 1JKOC 2CQXA 4C3JJ 3M3YJ 2EQRA 4UUSA 4X1EA 2TRTA 2E2HJ 1X58A 3HEFA 1AHDP 3ZQFA 3BR2A 4B4CA 3B6AA 4A3LJ 5EF6A 1U9OA 2CRGA 5F27A 2XGEA 2WB1N 5EEAA 1YRNB 1Z77A 4M3DA 1LE8B 2M34A 2E2IJ 1U9NA 4DYCA 2NVYJ 4AUXA 2IBDA 4A3JJ 4A3CJ 3OOUA 1UMQA 2VPRA 3IH4A 3WHBA 2HOTA 3A01B 4A69C 5K7FA 2P81A 1WPKA 1BW5A 3G1LA 4A3EJ 4A3KJ 3W6VA 3FKIJ 1XC5A 2YUSA 3HM5A 5K7ZA 3TP0A 2R92J 1ZK8A 2OPTA 1H88C 1Y1VJ 1ZTRA 1PUFA 4FE7A 3BR3A 4DW6A 2JA7J 2K9QA 2Y9YA 3BR5A 4D5FA 1IDYA 4M3FA 4UUTA 3ZOBA 3JRFA 1OJLA 1RR7A 2YS9A 5F0HA 2JJ7A 3K7AJ 2R5ZB 2NVQJ 2IEKA 4FCYA 3CQZJ 4NDLA 1W0TA 2L7ZA 1BJZA 4IHYA 1MSEC 1DU6A 1LFUP 4A3GJ 1IC8A 1RETA 1WGXA 2HDDA 3E7LA 4DYRA 2WV1A 2D5VA 2E1OA 3JRHA 2LVSA 1LE8A 9ANTA 4FE4A 4B3AA 2VKVA 4A3DJ 1Y1WJ 2XGDA 1I6HJ 3HBLA 2X48A 4C3HJ 2IAIA 4D7MA 1S7EA 5C4XJ 5EYRA 3PO3J 4XIDA 2LP0A 2VKEA 2L7FP 3GTLJ 4MIMA 2K9SA 2EZKA 3K2AA 5EGOB 1FIPA 2DA3A 2ME0A 4FTHA 1QVTA 5IP9J 1MBJA 5HODA 1GUUA 4AYBN 1TC3C 4C2MJ 1RESA 2HQ5A 1E3OC 4QSHA 4MFDA 2L9RA 4BKXA 3GTPJ 2DA4A 4JX6A 1JT0A 3GTOJ 2R5ZA 3RKQA 2VUMJ 1W0UA 4ABZA 2DN0A 3ZQGA 3A02A 2LD5A 2N8GA 3S2DJ 4B1RA 5IYCJ 3LSGA 1ORKA 1RKTA 1SANA 4XRSA 3S1QJ 1JKPC 5IPAA 1B8IB 2XB5A 3FISA 1K61A 2JA5J 1FIAA 2DMQA 4A3IJ 1A5JA 1FTTA 3C2BA 3IH2A 1GV5A 2DMNA 2O7OA 4JX5A 5JLWA 3Q0WA 5J1RA 1IV6A 3HDDA 3S1NJ 1Q1VA 3ZQLA 2DA7A 2L7MP 3BTCA 3NAUA 1AU7A 4D5CA 2ECCA 3S2HJ 4RDUA 4IEJA 1P7IA 4IHWA 2HXIA 4L5EA 5EGOA 2FX0A 3FIWA 2K9NA 3M4OJ 3GTJJ 3RZOJ 4CYCA 4DZPA 4AC0A 2AHQA 1O4XA 3BG9A 5M3FJ 1DU0A 5GPAA 2ECBA 3TW6A 2ZB9A 1T33A 3BR1A 1JGGA 2ID3A 2E19A 4S0HB 4IHVA 3O8HA 1HDDC 3D1NI 3JR9A 3OSFA 1ZKGA 4MFEA 5FKMA 2EH3A 5M5YJ 2ELKA 1OCPA 2NVTJ 3QPLA 1B72B 3I4NJ 2FQ4A 2RAEA 1MNMC 1HDPA 1F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8I A;  3O8G A;  5BNG A;  1JTX A;  5E3O A;  4DZJ A;  2XSD C;  1FEX A;  5E3M A;  4JP0 A;  3LOC A;  4M3E A;  3ZQI A;  3MKL A;  1ETK A;  1XS9 A;  2HYJ A;  2LR8 A;  2OF7 A;  2NS8 A;  2X6O A;  1BW6 A;  2JK3 A;  3HOY J;  1ETX A;  5F0F A;  1VFC A;  1JJ6 C;  3FK6 A;  5FKK A;  3GTM J;  2Y2Z A;  3S1M J;  1WH7 A;  3SDG A;  2VI6 A;  2B63 J;  2M2E A;  4GFB A;  3JRC A;  4QIW N;  3JRE A;  1LFB A;  3H0G J;  5FKN A;  3PM1 A;  2JA6 J;  1IG7 A;  5C4J J;  4W97 A;  4G12 A;  3S1R J;  5E3N A;  3HOV J;  2KDZ A;  1WI3 A;  2JN6 A;  3BG5 A;  5E3L A;  3CCY A;  3DCF A;  5IOZ A;  3S14 J;  5IYD J;  2EZI A;  4LOC A;  3JRD A;  3HGY A;  4M6V A;  1EF4 A;  1B72 A;  1FJL A;  2GBY A;  4QTR A;  1H8A C;  3ZQH A;  2XPW A;  1JUP A;  2MW8 A;  3SJM A;  1QPI A;  2JWT A;  3H3V K;  3GBG A;  3ZQC A;  3SFI A;  5EG0 B;  2HOS A;  1ZQ3 P;  3GTK J;  4BBS J;  1MBG A;  2Y9Z A;  1IDZ A;  2Y0S N;  1NTC A;  1MBE A;  5F1J A;  2HI3 A;  3HGG A;  3LSR A;  1GT0 C;  2LY9 A;  4CYC B;  3GTG J;  1U78 A;  2FD5 A;  1JUM A;  4M3B A;  1HF0 A;  1T56 A;  3LNQ A;  3L1P A;  5IP6 A;  5K7H A;  3CMY A;  2CQQ A;  1BL0 A;  1MH3 A;  3NAR A;  2CU7 A;  3DEW A;  1VF9 A;  2G0E A;  1JUS A;  5F08 A;  2LTP A;  2KT0 A;  1K83 J;  2DMP A;  2O8K A;  1OCT C;  4A3F J;  3JRG A;  2DJN A;  5DS9 A;  2YU9 J;  2ME6 A;  1WH5 A;  4I76 A;  3HOU J;  1X2N A;  1GV2 A;  3QPS A;  3VPR A;  4W1U A;  2MGQ A;  5DTD A;  5IYB J;  1JKQ C;  4BY7 J;  2QCO A;  3I4M J;  3MVP A;  2XPU A;  2EBI A;  3UKG A;  1IJW C;  2JA8 J;  3RQI A;  5EG0 A;  1H89 C;  1HCR A;  1UG2 A;  3FK7 A;  1APL C;  1NK3 P;  1CQT A;  3S17 J;  4BBR J;  2DMT A;  2QF7 A;  3IH3 A;  3BTI A;  2E2J J;  1BA5 A;  1Z0X A;  2FJ1 A;  3S15 J;  1MBH A;  2L0K A;  1I3Q J;  4A3B J;  3A03 A;  1JTY A;  2DA2 A;  3BT9 A;  4Y7N J;  1MSF C;  3CDL A;  4MLO A;  5IP7 J;  4XK4 A;  4A93 J;  3Q3S A;  5J1Y A;  1NK2 P;  3JRI A;  2M9H A;  5EZH A;  5M3M J;  3BR0 A;  1P7J A;  2LFB A;  5M5W J;  5F04 A;  4X6A J;  2DA6 A;  4IHX A;  2MG4 A;  4XIC A;  1U8B A;  5C44 J;  4DYQ A;  2COB A;  2LLK A;  3B6C A;  2W48 A;  3G1O A;  5M5X J;  3TED A;  5J1U A;  1G2H A;  2XGC A;  1TWC J;  2R5Y A;  1TWG J;  1GDT A;  3HOX J;  1RKW A;  2I10 A;  5JLX A;  3BTJ A;  4FIS A;  1SFO J;  1R9T J;  3OIO A;  1A6I A;  1ETQ A;  3TP3 A;  2LKX A;  1D5Y A;  2EZL A;  2M0C A;  3G1M A;  2GLO A;  1ETO A;  1JT6 A;  2DA5 A;  4J19 A;  3F0C A;  1JJ8 C;  2NVX J;  1QVU A;  1ZR4 A;  4XRS G;  5EDN A;  1HLV A;  4D7N A;  2O9L A;  1ETY A;  2K40 A;  3MN2 A;  3LSP A;  5J3L A;  2R7Z J;  1ITY A;  5GP9 A;  1GVD A;  1X2M A;  1AKH B;  3S16 J;  3TW7 A;  1YRN A;  2XPV A;  2NS7 A;  5GPC A;  1JKR C;  1WCM J;  2XRL A;  4HNV A;  2X9D A;  4EEF G;  3PO2 J;  2AO9 A;  1ETW A;  2LK2 A;  2Y31 A;  3A01 A;  3IV5 A;  3LSJ A;  1IGN A;  4BY1 J;  4MO7 A;  3HOW J;  2CUE A;  1OFC X;  3OSG A;  2JMW A;  4A3M J;  2HXO A;  1MBF A;  2NOG A;  5FJ8 J;  4XRM A;  4Y52 J;  1MBK A;  2H8R A;  1IUF A;  1TWH J;  3BTL A;  1HOM A;  5EZG A;  1XG1 A;  2CUF A;  1QRY A;  4UUS B;  4V2G A;  4C3I J;  3BQY A;  4BXX J;  2DMU A;  1I50 J;  1RPW A;  2GM4 A;  1F43 A;  4JX4 A;  2EZH A;  3Q0V A;  4M3G A;  5FKL A;  5FLM J;  5IOY A;  3BQZ A;  2R5Y B;  2HOA A;  4JYK A;  5C3E J;  3BG3 A;  3HB9 A;  2M8G X;  2XB0 X;  2H1K A;  1AKH A;  1ETV A;  5FLV A;  2DA1 A;  1IRZ A;  1MH4 A;  3JRA A;  2ID6 A;  4V2F A;  3WHC A;  1UHS A;  2R0Q C;  3Q0U A;  1TWA J;  1PUF B;  4RBO A;  2PMZ N;  2DTZ A;  1ZR2 A;  2Y30 A;  5FKO A;  1POG A;  4I6Z A;  2MSY A;  5F0C A;  3RZD J;  2CJJ A;  1VND A;  1VI0 A;  3BR6 A;  2TCT A;  1FTZ A;  1ENH A;  3HOZ J;  2R93 J;  1TWF J;  3HKZ N;  3JRB A;  3QQA A;  3GTQ J;  2WAQ N;  1ZGW A;  1JKO C;  2CQX A;  4C3J J;  3M3Y J;  2EQR A;  4UUS A;  4X1E A;  2TRT A;  2E2H J;  1X58 A;  3HEF A;  1AHD P;  3ZQF A;  3BR2 A;  4B4C A;  3B6A A;  4A3L J;  5EF6 A;  1U9O A;  2CRG A;  5F27 A;  2XGE A;  2WB1 N;  5EEA A;  1YRN B;  1Z77 A;  4M3D A;  1LE8 B;  2M34 A;  2E2I J;  1U9N A;  4DYC A;  2NVY J;  4AUX A;  2IBD A;  4A3J J;  4A3C J;  3OOU A;  1UMQ A;  2VPR A;  3IH4 A;  3WHB A;  2HOT A;  3A01 B;  4A69 C;  5K7F A;  2P81 A;  1WPK A;  1BW5 A;  3G1L A;  4A3E J;  4A3K J;  3W6V A;  3FKI J;  1XC5 A;  2YUS A;  3HM5 A;  5K7Z A;  3TP0 A;  2R92 J;  1ZK8 A;  2OPT A;  1H88 C;  1Y1V J;  1ZTR A;  1PUF A;  4FE7 A;  3BR3 A;  4DW6 A;  2JA7 J;  2K9Q A;  2Y9Y A;  3BR5 A;  4D5F A;  1IDY A;  4M3F A;  4UUT A;  3ZOB A;  3JRF A;  1OJL A;  1RR7 A;  2YS9 A;  5F0H A;  2JJ7 A;  3K7A J;  2R5Z B;  2NVQ J;  2IEK A;  4FCY A;  3CQZ J;  4NDL A;  1W0T A;  2L7Z A;  1BJZ A;  4IHY A;  1MSE C;  1DU6 A;  1LFU P;  4A3G J;  1IC8 A;  1RET A;  1WGX A;  2HDD A;  3E7L A;  4DYR A;  2WV1 A;  2D5V A;  2E1O A;  3JRH A;  2LVS A;  1LE8 A;  9ANT A;  4FE4 A;  4B3A A;  2VKV A;  4A3D J;  1Y1W J;  2XGD A;  1I6H J;  3HBL A;  2X48 A;  4C3H J;  2IAI A;  4D7M A;  1S7E A;  5C4X J;  5EYR A;  3PO3 J;  4XID A;  2LP0 A;  2VKE A;  2L7F P;  3GTL J;  4MIM A;  2K9S A;  2EZK A;  3K2A A;  5EGO B;  1FIP A;  2DA3 A;  2ME0 A;  4FTH A;  1QVT A;  5IP9 J;  1MBJ A;  5HOD A;  1GUU A;  4AYB N;  1TC3 C;  4C2M J;  1RES A;  2HQ5 A;  1E3O C;  4QSH A;  4MFD A;  2L9R A;  4BKX A;  3GTP J;  2DA4 A;  4JX6 A;  1JT0 A;  3GTO J;  2R5Z A;  3RKQ A;  2VUM J;  1W0U A;  4ABZ A;  2DN0 A;  3ZQG A;  3A02 A;  2LD5 A;  2N8G A;  3S2D J;  4B1R A;  5IYC J;  3LSG A;  1ORK A;  1RKT A;  1SAN A;  4XRS A;  3S1Q J;  1JKP C;  5IPA A;  1B8I B;  2XB5 A;  3FIS A;  1K61 A;  2JA5 J;  1FIA A;  2DMQ A;  4A3I J;  1A5J A;  1FTT A;  3C2B A;  3IH2 A;  1GV5 A;  2DMN A;  2O7O A;  4JX5 A;  5JLW A;  3Q0W A;  5J1R A;  1IV6 A;  3HDD A;  3S1N J;  1Q1V A;  3ZQL A;  2DA7 A;  2L7M P;  3BTC A;  3NAU A;  1AU7 A;  4D5C A;  2ECC A;  3S2H J;  4RDU A;  4IEJ A;  1P7I A;  4IHW A;  2HXI A;  4L5E A;  5EGO A;  2FX0 A;  3FIW A;  2K9N A;  3M4O J;  3GTJ J;  3RZO J;  4CYC A;  4DZP A;  4AC0 A;  2AHQ A;  1O4X A;  3BG9 A;  5M3F J;  1DU0 A;  5GPA A;  2ECB A;  3TW6 A;  2ZB9 A;  1T33 A;  3BR1 A;  1JGG A;  2ID3 A;  2E19 A;  4S0H B;  4IHV A;  3O8H A;  1HDD C;  3D1N I;  3JR9 A;  3OSF A;  1ZKG A;  4MFE A;  5FKM A;  2EH3 A;  5M5Y J;  2ELK A;  1OCP A;  2NVT J;  3QPL A;  1B72 B;  3I4N J;  2FQ4 A;  2RAE A;  1MNM C;  1HDP A;  1F36 A; 
#chains in the Genus database with same CATH topology
 1VQN I;  2DQR A;  1E0E A;  2EIJ H;  2CUZ A;  4LB6 B;  1J59 A;  2HYJ A;  2LR8 A;  4WXC A;  1TZL A;  4KIF A;  2HPI A;  5J8C A;  4OMZ A;  2NS8 A;  4B43 A;  4BXF A;  1HXD A;  3CME I;  3H0D A;  3HOY J;  2JK3 A;  2YX7 A;  3U2R A;  3WTT C;  2X51 A;  1VFC A;  2HKO A;  5HLG A;  1HC8 A;  1T39 A;  1YS6 A;  1JJ6 C;  3FK6 A;  3CCE I;  4N9I A;  2Y2Z A;  4L9T A;  1RNL A;  3CF5 F;  2B63 J;  4E6K G;  2FBH A;  2M2E A;  1FYK A;  1HW2 A;  3CO6 C;  1LUJ B;  2EB7 A;  2FOK A;  1L0O C;  4I99 C;  1YJN I;  4ENN A;  4HST A;  3E6B A;  3WG7 H;  3CCY A;  3S14 J;  3IL2 A;  4I2O A;  1NHA A;  4M6V A;  1FT9 A;  3K1M A;  1TW3 A;  3ZQH A;  5DUI A;  1VQ9 I;  2XPW A;  1JUP A;  2B7E A;  4BJ6 C;  3SJM A;  3H3V K;  3RIR A;  4EGY A;  2H27 A;  1ZQ3 P;  3DV8 A;  1W7P A;  2R7O A;  3JSP A;  1J7K A;  5JHF A;  1TT5 B;  4BE0 A;  3U9G A;  4KJZ A;  4EVI A;  3FZV A;  1RRJ A;  1KZH A;  1MBE A;  1T8I A;  1E3P A;  3M1C A;  5LLQ A;  1YFH A;  1FBU A;  2LY9 A;  1JHF A;  2FD5 A;  4M3B A;  2L9V A;  3NEU A;  3MFK A;  1WQ2 A;  2KDO A;  1T56 A;  1D1A A;  2VB6 A;  1SVL A;  1V5E A;  3FXQ A;  2IA0 A;  3HRT A;  1MD0 A;  1SMT A;  3DEU A;  2DAO A;  2KT0 A;  3CCR I;  3NWS A;  1MGT A;  1LEA A;  3KET A;  2ZKZ A;  2VE9 A;  2YU9 J;  3K1N A;  1WH5 A;  2FNP A;  2BYV E;  4CUG A;  3QOP A;  2EK5 A;  3A0H C;  4W1U A;  1BR2 A;  1JKQ C;  2QCO A;  3C7J A;  3MVP A;  4ESF A;  5EEH A;  2XPU A;  2JA8 J;  2OBP A;  1HW5 A;  3ONQ A;  1H89 C;  5DCM B;  1MZB A;  2DPD A;  2XGX A;  3DTE A;  1CQT A;  3OWT A;  4II2 A;  4LJZ F;  4ZZD A;  2R7R A;  3ZGK A;  3OYL A;  2DMT A;  2E2J J;  1WRJ A;  2OZ6 A;  2NXN B;  3Q5F A;  3S15 J;  1I3Q J;  1OCR H;  1JTY A;  3A03 A;  3ZP5 A;  1WJA A;  4NUB A;  1HA8 A;  3CMM A;  2A5W A;  3CDL A;  1FY7 A;  3HL2 A;  5IP7 J;  2DJI A;  1ONV A;  2RV8 A;  1LEB A;  4CA0 A;  1KU7 A;  4A93 J;  1LB2 A;  1FSH A;  2O03 A;  1PYV A;  3JW4 A;  3HOT A;  2H09 A;  5GAH J;  2HVS A;  2DFE A;  3TO7 A;  2M9H A;  3DXJ F;  5EZH A;  4TV7 A;  1A36 A;  3P9I A;  2JT1 A;  2WWY A;  1UJ8 A;  4P9F A;  1VQP I;  1BC8 C;  1OCC H;  2O8X A;  5BPI A;  3QRF F;  4RGX A;  5B3S H;  2KKO A;  3LFU A;  4DYQ A;  2OC6 A;  1AWC A;  1G3Y A;  1DP7 P;  1BOA A;  2CV1 A;  1MJ9 A;  3G1O A;  3H3U A;  4JOM A;  2QBY B;  2ZJR F;  2KZV A;  4ANJ A;  1S7A A;  2IA1 A;  2HVR A;  4YFN F;  2CQ7 A;  3RJP A;  3HPH A;  4OIO F;  4KIC A;  2TDX A;  4WXD A;  2MA3 A;  3ERE D;  5B1B H;  2NNN A;  1JE8 A;  1MND A;  2A68 F;  1RKW A;  1OYI A;  3SQN A;  2CGP A;  2KHM A;  4AU7 A;  4CXF A;  5H2F C;  5DM7 F;  1ETQ A;  1UEL B;  1T38 A;  2VIX A;  1D5Y A;  2HZD A;  2L4M A;  4RA2 A;  3ZCO A;  1TL8 A;  2PBI A;  1ETO A;  4BQN A;  3KYC B;  1R5H A;  2DA5 A;  1R1T A;  1VQL I;  2LH9 A;  3V8K A;  5ICF A;  2ZME C;  5K5Q A;  1QVU A;  5E8I A;  5EDN A;  2E34 A;  3QP6 A;  1YS7 A;  3MN2 A;  3I5U A;  3OYI A;  4L0Z B;  2MAB A;  2FE3 A;  5J3L A;  3I71 A;  2A61 A;  1MMS A;  2DT5 A;  4BUP A;  5GP9 A;  1X2M A;  2R7Q A;  4EGZ A;  3CZ6 A;  1I6X A;  3F23 A;  1X1B A;  3F8M A;  4ITV A;  2FBI A;  1EH8 A;  2RKH A;  2NS7 A;  5GPC A;  3R6S A;  3WE2 A;  1WFX A;  4FX4 A;  1B1B A;  3D5S C;  2V9K A;  4EEF G;  4BEH A;  2LK2 A;  3VOD A;  1TNT A;  5DD8 A;  4A12 A;  2V9V A;  2VC0 A;  1OPC A;  2QQ8 A;  2GQQ A;  2QQB A;  2CUE A;  4PGG A;  2RC4 A;  2XVC A;  3K69 A;  3KEO A;  1AA7 A;  5E1X A;  3LFK A;  3AL0 C;  4FAS D;  4LD5 A;  1MBF A;  2VQG A;  3CDI A;  2ZJ2 A;  2M7B A;  3BCB A;  4Y52 J;  4O5V A;  1TWH J;  2H8R A;  4JK1 X;  2MBF A;  2CUF A;  1KQ9 A;  4OAY A;  4XN0 A;  2WAF A;  1XTA A;  2LG4 A;  4LMY A;  5KVR A;  4G7Z F;  2DMU A;  4Z6Y A;  2BXY A;  4A5N A;  3AL0 B;  1I50 J;  2GM4 A;  2O61 A;  2FBK A;  1UG0 A;  3Q0V A;  3G4S I;  5FKL A;  3ZPL A;  5FD5 A;  3SDB A;  2ESN A;  3LWF A;  2LBF B;  5IOY A;  3SEQ A;  1FP2 A;  3AG2 H;  1KA8 A;  3BLY A;  3FXK A;  3S32 A;  4JBA A;  2EIL H;  1OQY A;  2R5Y B;  4JYK A;  2OCC H;  2BY1 A;  2KPM A;  1DGW Y;  2E1M C;  3PFY A;  4IRG A;  1O7L A;  1ZG1 A;  1Z6R A;  2DA1 A;  1MH4 A;  4YIR X;  2ID6 A;  1MMN A;  2ETH A;  3K4J A;  4BS9 A;  2FSW A;  1ZRF A;  2E1M B;  2DTZ A;  1FYM A;  4I6Z A;  3PNY A;  1XGM A;  5F0C A;  3RZD J;  1B59 A;  3KP5 A;  1IF1 A;  2JUC A;  3R0A A;  4U0Y A;  2XHK A;  3OL3 A;  2OU2 A;  4MTE A;  3OYA A;  1D5V A;  4DBQ A;  3QYE A;  4OMY A;  1T98 A;  2AXL A;  2WAQ N;  3DTK A;  3ZMD A;  1JKO C;  1J75 A;  2QEN A;  2RRE A;  2EQR A;  3E5U A;  3KIO A;  2BZT A;  3WTZ A;  2F5D A;  2FRH A;  5DCF A;  4B4C A;  2ISZ A;  1U6G A;  4A3L J;  1CF7 B;  2I8D A;  2UV1 A;  4HOB A;  3EUK L;  1QO0 D;  4ZTJ A;  1VZ0 A;  5EEA A;  3QOE A;  2EV0 A;  2WC2 A;  1U9N A;  2XUB A;  4AUX A;  2B0L A;  2JVH A;  2IBD A;  4ZDO A;  3WHB A;  1O3Q A;  3H92 A;  2P81 A;  2AXT C;  1IV8 A;  3LA3 A;  3G1L A;  2ZSH B;  2WAE A;  2O3F A;  3FKI J;  3QPH A;  5K7Z A;  3JSO A;  2VLA A;  1EJ9 A;  2R92 J;  5K5R A;  2UXX A;  2XAH A;  3JTG A;  1Y1V J;  1Y0U A;  1ZTR A;  2V1N A;  4NB5 A;  4NNJ A;  3RSN A;  4FE7 A;  4AIK A;  3BR3 A;  2ZFU A;  1FBS A;  2JA7 J;  2BVM A;  3TDU C;  1Y39 A;  2XRN A;  1HSJ A;  1MJB A;  3CES A;  2QQA A;  2COM A;  2RNJ A;  1IDY A;  2F6C A;  1WWX A;  2IPQ X;  4M3F A;  3LA7 A;  2IA2 A;  4UUT A;  3L2V A;  1OJL A;  3M1E A;  3ISP A;  5DV5 A;  2JJ7 A;  4HQM A;  2Z1D A;  3K7A J;  1NH3 A;  1QHG A;  1KON A;  2R5Z B;  3L09 A;  3IRR A;  2DTR A;  5GAE J;  2P6T A;  2IEK A;  3IP4 B;  1XGO A;  2LF7 A;  4E7Z A;  3H35 A;  3C1D A;  2L7Z A;  3RDI A;  3GX4 X;  2K4J A;  5LD2 C;  2EPF A;  4M9Z A;  2BW3 B;  2WY7 Q;  4A3G J;  1J2X A;  5F1R A;  2H6C A;  3E7L A;  2JSP A;  3WGH A;  2D5V A;  1B6A A;  3U21 A;  4DQ2 A;  3EQL F;  5IT3 A;  2DFI A;  4FE4 A;  4B3A A;  3K1P A;  4BQA A;  2RN7 A;  4Q5S F;  1LNW A;  3G73 A;  4AWX B;  2KIF A;  4XKW A;  5CVV A;  3HBL A;  2X48 A;  1SFE A;  2Z99 A;  4C3H J;  4PGH A;  2IAI A;  2X6X A;  1Y0N A;  2CUJ A;  4D7M A;  5C4X J;  2LP0 A;  3EUH A;  4UVA A;  2EZK A;  3MZY A;  4PJL A;  4UV9 A;  1FIP A;  3U1K A;  1BI1 A;  4IZZ A;  1IO2 A;  2ME0 A;  4YIF A;  4CZZ A;  5CLS A;  3F21 A;  3IWZ A;  1G8X A;  4F92 B;  4BDY A;  4HBL A;  2XKP A;  1PDN C;  1YW7 A;  2L3D A;  1RI7 A;  4BKX A;  4MFD A;  2L9R A;  3GTP J;  4GGG A;  1XMA A;  2DA4 A;  1JT0 A;  2R5Z A;  3RKQ A;  2LY2 A;  1I39 A;  4ABZ A;  2PQ8 A;  4U0V A;  1U2W A;  1Z7L A;  2LOO A;  4XL9 A;  3KP7 A;  2BW3 A;  2YSR A;  5IYC J;  3RCO A;  4XRS A;  3E3V A;  5F6F A;  3K6G A;  4E7S A;  3HG9 A;  2CSO A;  1FWZ A;  3G71 I;  1SFU A;  4U88 A;  2DMQ A;  2XIG A;  5H6R A;  2PLY A;  5EEG A;  5JR3 A;  1FTT A;  3C2B A;  2DMN A;  5JLW A;  4MGR A;  4CH7 A;  3H9Q A;  2R7V A;  3TDZ C;  1YX5 A;  5L3C A;  2L7M P;  2R7W A;  3DPU A;  2KRF A;  4ENM A;  2ECC A;  1IZ1 A;  4IHW A;  3DWL E;  2HXI A;  3DKW A;  1TNS A;  4L5E A;  1LDK B;  1XDS A;  2VXD A;  3T1B A;  2O5R A;  4I0A A;  4LIV A;  5D6E A;  4CYC A;  5AON A;  3K4K A;  5CJ9 A;  3P5J A;  3P9C A;  1S8N A;  1SVM A;  4G8X A;  4L9V A;  1T33 A;  4HAM A;  3GME A;  1JGG A;  4S0H B;  3RPU D;  3OIP A;  3SHF A;  4IHV A;  3O8H A;  3CP8 A;  1HDD C;  2HTS A;  2EH3 A;  4QWQ A;  3HSF A;  1Z91 A;  1TT0 A;  3DTI A;  1YOV B;  1OCP A;  4YFX F;  4OIN F;  1B72 B;  4HW0 A;  4XOP A;  4IL6 C;  5CQE A;  2ZXH A;  4P96 A;  2NVU B;  4OIP F;  1S5L C;  3VEP A;  1JTX A;  5D5U B;  2DLL A;  2L02 A;  3VYR B;  4BXX J;  3DU6 A;  2P8T A;  2WBM A;  3AG1 H;  2OF7 A;  3VYS B;  2XF7 A;  3COA C;  1BM9 A;  4A0Z A;  1X4P A;  2VT3 A;  4EJT A;  1VQO I;  1X4O A;  1BW6 A;  1TTY A;  1YQA A;  1OCZ H;  3OYM A;  3OYN A;  1CGP A;  3LQQ A;  4P1W A;  3S1M J;  5DUK A;  3SDG A;  3VYU B;  2NRA C;  4RB0 A;  5CVI A;  3ZMZ A;  4CCM A;  4Y13 A;  5CVR A;  2OAZ A;  4QIW N;  1K78 B;  1TQI A;  2FEZ A;  3LAP A;  1U0J A;  3F9K A;  3PM1 A;  1Z67 A;  4RAG A;  4ESB A;  4UXN A;  5C4J J;  3BG6 A;  3S1R J;  3DQV C;  5E3N A;  3HOV J;  2KDZ A;  1ZAO A;  4P55 A;  2JN6 A;  5DD4 A;  3BG5 A;  3I54 A;  4H0E A;  5IYD J;  3QWL A;  5IT9 Z;  5L3E A;  2EZI A;  1QQI A;  2VKD A;  2FQ3 A;  2RNG A;  2GBY A;  3ABL H;  3BZC A;  1OIS A;  1B72 A;  1MMD A;  1R4M B;  2DDB A;  3GUD A;  3SFZ A;  2CH0 A;  3ZN0 A;  2G7U A;  3B73 A;  2J5O A;  1MIJ A;  5DEQ A;  2KIS A;  2ZC2 A;  1BI2 A;  3GTK J;  2FXA A;  4UB6 C;  2HKX A;  3HHG A;  3CJT B;  3Q9S A;  1GLN A;  2Z9O A;  5IT9 K;  1U78 A;  1B4A A;  4F3Q A;  3CLQ A;  2Y69 H;  2VON A;  1T95 A;  1UHW A;  1HF0 A;  3M9A A;  1E17 A;  2KIM A;  2OA4 A;  4ESJ A;  1OLT A;  5K7H A;  4E7I A;  3CMY A;  2CQQ A;  4P5O A;  1BL0 A;  1MH3 A;  2EFQ A;  3NAR A;  2Z16 A;  1V5F A;  3HSE A;  5DDG A;  1VF9 A;  2G0E A;  1HW1 A;  1K78 A;  1JUS A;  4BHP A;  5F08 A;  2KQR A;  1W1W E;  1JGS A;  1LPQ A;  2O8K A;  3J80 K;  2DOE A;  2GOX B;  2I5U A;  1WZ2 A;  1XMX A;  1D8J A;  2ME6 A;  5BQT A;  3HOU J;  3CCQ I;  3SXY A;  4DNC A;  1GV2 A;  2E60 A;  3VPR A;  2ZSI B;  4DBR A;  2CV2 A;  5DTD A;  2E7W A;  2X85 A;  3OYC A;  2K9M A;  3H5N A;  4ON0 A;  3SEZ A;  5L3G A;  5ILS A;  3OMY A;  4LFU A;  1UG2 A;  2DT7 B;  2A5Y B;  2L2O A;  5GTI C;  2K85 A;  5JVT A;  2QSG X;  3FXJ A;  3S17 J;  4BBR J;  3FWE A;  4RM3 A;  3NRV A;  2Q2E B;  4PJJ A;  4G7H F;  2FJ1 A;  2M8E A;  2L0K A;  2VQL A;  4A3B J;  5FLX Z;  4C30 A;  4KA4 A;  4WX9 A;  1G6N A;  2IS6 A;  4CZC A;  4CCJ A;  4PSX A;  3OYH A;  1LVA A;  4PFO A;  3M8E A;  3FHN A;  1TQM A;  5J1Y A;  2PFB A;  3L7W A;  1NK2 P;  1GVJ A;  5BS6 A;  2WAQ A;  5HDG A;  1W36 D;  2YR2 A;  4PZJ A;  1QPM A;  3VDX A;  3L00 A;  3BR0 A;  2A3S A;  3BDD A;  4LLL A;  5M5W J;  3LST A;  6PAX A;  4HNT A;  2P5K A;  1K4S A;  2CFX A;  1IRX A;  3U1D A;  4KFC A;  4XIC A;  4IHX A;  4X6A J;  1R49 A;  1W7P B;  2LLK A;  3QOD A;  2GA2 A;  3IAM 2;  1OKR A;  2BE5 F;  4KN4 X;  3TED A;  1OYW A;  3ABM H;  2JA2 A;  4Y3O A;  2CQK A;  3QYB A;  2HS5 A;  5K1Y A;  4YRV A;  3K4C A;  4BH9 A;  4IQJ A;  1YE9 A;  3KFW X;  2Q2E A;  1FBQ A;  1ON1 A;  4FIS A;  3GZ5 A;  1A6I A;  2QWW A;  3V4G A;  5HVQ C;  2EZL A;  3G1M A;  2KJB A;  4PJN A;  4G6D A;  1Y6I A;  5LRS A;  5TRD A;  2F48 A;  1JT6 A;  1R22 A;  1XCB A;  2V6C A;  5E17 F;  5DYM A;  4LIU A;  2NVX J;  4AVZ A;  4G94 A;  1HLV A;  1ODD A;  5HDK A;  2M0M A;  5D5V B;  2WA0 A;  2CW7 A;  1PP7 U;  2LYC A;  2BEO A;  3FM3 A;  3FXO A;  4OAZ A;  4II3 A;  4BYY A;  4MTD A;  3K2Z A;  1ITY A;  1YYV A;  4LB5 A;  1T0F C;  3A4C A;  1ZLJ A;  1IN7 A;  2FMY A;  4UV8 A;  4GYI A;  3IUO A;  2R7S A;  3S16 J;  3IAS 2;  3ASO H;  3QPT A;  2DK8 A;  1KU9 A;  3TW7 A;  4LK0 F;  1FMV A;  1ZYR F;  1D0Z A;  1FOY A;  3PUB A;  1IRG A;  2Y31 A;  1SC7 A;  2IGK A;  3GVA A;  4FT8 A;  3PSI A;  2R7X A;  3LSH A;  1D1B A;  1ZG5 A;  2PMU A;  5J40 A;  2HXO A;  3E5X A;  3EPZ A;  2NOG A;  4J01 A;  3MAJ A;  4XRM A;  1HST A;  5CYV A;  1MBK A;  1IUF A;  3BTL A;  3QAH A;  1REP C;  4ZYD A;  4C3I J;  3BQY A;  3S8P A;  4OU0 A;  4KT5 C;  3EYI A;  2HDW A;  5FD6 A;  2WAD A;  2EZH A;  2ISY A;  1T2K A;  4BNC A;  4M3G A;  4E70 A;  5FLM J;  4RS8 A;  1FNN A;  1UB9 A;  5LBQ A;  3CC4 I;  2HOA A;  3BG3 A;  1G3T A;  3LA2 A;  1LJ9 A;  3HB9 A;  2M8G X;  1FSE A;  1YIJ I;  3WTW C;  2XB0 X;  2MD0 A;  3H36 A;  3WTS C;  2H1K A;  4HPQ A;  3HZJ A;  1QNT A;  5FLV A;  3KYD B;  2VAS A;  4FET A;  3JRA A;  4CCN A;  4V2F A;  4HG2 A;  3H9J A;  3WHC A;  3N4M A;  3CDH A;  3MMY B;  1T0F A;  2K4B A;  4XN3 A;  3KP4 A;  5HS9 A;  1ZR2 A;  1P92 A;  5LHI A;  2JPC A;  2MSY A;  1D0Y A;  2YPR A;  2IGO A;  3K4M A;  3T0Y A;  2OCE A;  1E3H A;  2JSC A;  1VND A;  1VI0 A;  3BR6 A;  3I55 I;  3KP6 A;  4NBQ A;  1S3J A;  1W5T A;  3CMA I;  2EFP A;  2QM3 A;  2Y0M A;  3K0L A;  3ZMU A;  2XC7 A;  3IKV A;  4EMS A;  3J81 K;  3JRB A;  4XLP F;  3QQA A;  4YEJ A;  3HJE A;  5FRN A;  1Z6T A;  2NS0 A;  1P4X A;  2XAF A;  1MMA A;  2BGC A;  2E2H J;  2TRT A;  3AG4 H;  1X58 A;  1XN7 A;  2OQG A;  3B6A A;  2VJI A;  5D4R A;  3G6E I;  4Y33 A;  1I27 A;  2DOD A;  5EF6 A;  2E7X A;  3DLL F;  2RGV A;  2EIM H;  3H3Z A;  1FP1 D;  2M34 A;  4ZJZ A;  1K7A A;  2NVY J;  1R36 A;  2DPU A;  4A3J J;  4BEH B;  1K6Y A;  1KYW A;  4A69 C;  5K7F A;  5K5O A;  3TO6 A;  3HOS A;  4CCK A;  1D3Y A;  4A3E J;  4I7H A;  3W6V A;  5LHH A;  2YUS A;  3HM5 A;  3TP0 A;  2KRC A;  2GOM A;  2OPT A;  1LDD A;  3BJA A;  1BC7 C;  1R1V A;  3FXM A;  4DW6 A;  4BE1 A;  4E7L A;  3EET A;  1XSD A;  3ZMV A;  3BR5 A;  2E5Z A;  1BI0 A;  2IVM A;  1F4K A;  1WJD A;  3FX3 A;  2LDU A;  3CD6 I;  2VBY A;  3JRF A;  1RR7 A;  5LGN A;  2ELJ A;  3KPH A;  4M71 A;  1ACI A;  4M74 A;  4HDU A;  4FQG A;  1F5T A;  1W0T A;  2VE8 A;  2L01 A;  2AS5 F;  1VTN C;  3FF5 A;  4PUS A;  2ZME B;  4C9Y A;  2PJR B;  4EJV A;  3PNV A;  1WGX A;  2A69 F;  2HYG D;  4DYR A;  2E1O A;  2W57 A;  2HVQ A;  3JRH A;  2LVS A;  1RUN A;  3GFM A;  2C6Y A;  4K2E A;  4ZYH A;  2VKV A;  2HR3 A;  2GIV A;  1UHM A;  4A3D J;  1Y1W J;  2CW0 F;  2KLO A;  2VOD A;  3DPL C;  2QGU A;  5HLI A;  3R0J A;  3MZ8 A;  1S7E A;  1XCV A;  3PO3 J;  3GTL J;  3WGI A;  4MIM A;  3ASN H;  1V5G A;  3I59 B;  4RGR A;  2DA3 A;  4P9U A;  1QVT A;  2HQA A;  5HDN A;  1MBJ A;  5HOD A;  1GUU A;  1TP4 A;  3RQ4 A;  1TC3 C;  3OYJ A;  1ZG3 A;  3FMQ A;  1ZRD A;  4Q48 A;  3CJQ B;  1QU3 A;  1R6R A;  2NOJ B;  2HQ5 A;  1E3O C;  4QLC U;  5J6X A;  3GTO J;  2BY2 A;  3MCZ A;  4IKF A;  1USS A;  3BY6 A;  3K70 D;  1SEU A;  1X3W B;  3R61 A;  3OYB A;  4G6T B;  1HQC A;  2DN0 A;  2GXG A;  4IF4 A;  1I1G A;  1WVR A;  2D2W A;  3A02 A;  3TO9 A;  3CC2 I;  2ZME A;  4HSR A;  2LD5 A;  3S2D J;  2PJR A;  3S1Q J;  2XAQ A;  1RKT A;  1JKP C;  1LDJ A;  1B8I B;  1BBY A;  1RC9 A;  5D4S A;  2DCE A;  3A2K A;  4UB8 C;  3IH2 A;  1D8K A;  4Y15 A;  5F64 A;  1IV6 A;  3H5R A;  2QKL B;  1Q1V A;  3S1N J;  1FOX A;  4BQQ A;  3ZQL A;  1O7F A;  3FXU A;  2HZT A;  3WTY C;  5LGT A;  4RDU A;  3VWB A;  2VL8 A;  1P7I A;  3V7S A;  3DKY A;  3I59 A;  2FX0 A;  4GO1 A;  2A6E F;  3E6C C;  4BAY A;  2IS1 A;  4S05 A;  4AC0 A;  3BG9 A;  5ICC A;  2ZB9 A;  2EA2 A;  3BR1 A;  3GYH X;  3IHU A;  2LRE A;  2DFF A;  1D0X A;  2K27 A;  5ILV A;  3LSM A;  2QSF X;  3JR9 A;  5ILU A;  3ML6 A;  5M5Y J;  4OIR F;  2ELK A;  4Y4R A;  3CJR B;  4XSX F;  4PJ0 C;  1MNE A;  2F2E A;  3I4N J;  2V1U A;  1MNM C;  4ZH4 F;  2JQ7 A;  1F36 A;  5IY5 H;  1B8I A;  3O8G A;  3D0S A;  4EJU A;  5BNG A;  5E3O A;  4OOI A;  4DZJ A;  2XSD C;  4PCQ A;  4DOZ A;  1FEX A;  5E3M A;  3LOC A;  4HRI A;  3MKL A;  2W25 A;  3J7Z I;  4LIT A;  2QUF A;  2JRT A;  4XKV A;  2X6O A;  5F0F A;  1S29 A;  2ZBK A;  3T8T A;  2IS2 A;  2YU3 A;  1ZGA A;  2Y48 A;  1B9M A;  2W84 A;  1WKM A;  1X1A A;  1M1E B;  1EA3 A;  1GXQ A;  1WH7 A;  4IRI A;  2OV7 A;  3IRQ A;  1F9N A;  4XLE A;  5TIS C;  3JRE A;  3DU5 A;  3HRM A;  1IG7 A;  3SZP A;  2W24 A;  4W97 A;  3S3N A;  3GFI A;  4MNU A;  3BOQ A;  2Z2S B;  3P7N A;  1WI3 A;  1SFX A;  2QYO A;  2ZNZ A;  1V54 H;  3DCF A;  2A07 F;  2VBW A;  4I09 A;  1PVE A;  2L9S A;  3JRD A;  1VQM I;  5GAG J;  1YLF A;  5FO5 A;  1Y8R B;  3HYI A;  1S72 I;  4UUV A;  3GBG A;  5EG0 B;  2HOS A;  4L18 B;  3M7G A;  4AM3 A;  1MBG A;  2XAJ A;  5LRR A;  1X1D A;  2P4W A;  2Y9Z A;  5JI6 A;  2Y0S N;  1MKM A;  1TLH B;  2HTJ A;  2QQ9 A;  4IRH A;  5E1W A;  5F1J A;  2ICW G;  3HGG A;  2K7L A;  4CYC B;  1JUM A;  3E97 A;  4XKB A;  4H4K C;  1WJ5 A;  1R71 A;  1U5T C;  3L1P A;  4A0X A;  4KYW A;  2UWM A;  2V79 A;  1YG2 A;  2CU7 A;  1GHC A;  5E18 F;  1SMY F;  1XSV A;  4BQO A;  2AQE A;  4RM2 A;  1GXP A;  2DMP A;  3J7A O;  2KIQ A;  2KRH A;  4XMY A;  3JRG A;  4A3F J;  1AOY A;  3UNG C;  1HKS A;  2LRD A;  2ZXW H;  5BMZ A;  4I76 A;  3TKY A;  3K4L A;  4E4H A;  5E20 A;  1UAA A;  3ZR8 X;  4BGD A;  4MQV A;  4J00 A;  2STT A;  2MGQ A;  3KP3 A;  4R1H A;  3TL4 X;  2B9S A;  3I4M J;  2NNY A;  1IJW C;  2EBI A;  3UKG A;  5L3D A;  3RQI A;  5EG0 A;  3ULQ B;  2ZFW A;  3BZK A;  2Y75 A;  3GXO A;  5D5W B;  2IXS A;  2ZJQ F;  3TOA A;  1IN4 A;  1P4A A;  3GLL A;  1O57 A;  3IH3 A;  3NQO A;  1H9G A;  4KIT B;  2F4M B;  1Z0X A;  4L5I A;  1BA5 A;  3TOB A;  2ZO4 A;  2DA2 A;  2EIN H;  4O3M A;  4CYD A;  5D8L B;  3BT9 A;  3DFG A;  3GO5 A;  2BHZ A;  3V7C A;  1G59 A;  1EV7 A;  2DOF A;  4HX4 A;  1IN8 A;  3VFZ A;  1YIO A;  4Y7N J;  1YHQ I;  4MLO A;  5LGU A;  3PFI A;  4UY8 I;  5HOO A;  2W85 A;  3Q3S A;  4HX8 A;  1J5Y A;  1YX3 A;  2W82 A;  4XNF A;  1L3L A;  4IQ4 A;  2JUG A;  2P7C B;  2OUM A;  3DBH B;  2MC4 A;  1P7J A;  1YTY A;  2LFB A;  4KMU X;  2IW5 A;  4ZDL A;  2CW8 A;  5LHG A;  5F04 A;  4HLY A;  2DA6 A;  2X1D A;  2STW A;  2MG4 A;  1QA6 A;  3VYT B;  1U8B A;  4MEX F;  2GXB A;  1EH6 A;  2COB A;  4NQW A;  3B6C A;  1YW8 A;  4DJA A;  2W48 A;  4ZDP A;  2QA4 I;  4WF2 A;  3RI4 A;  2HWV A;  4LK1 F;  1MDM B;  4UVB A;  1G2H A;  2XGC A;  2BY3 A;  2RQQ A;  2DFH A;  1PJR A;  2D1V A;  2DYR H;  4Y17 A;  3OR2 C;  2XV4 S;  4IXA A;  5D6F A;  1WI9 A;  3OYD A;  1U3E M;  3KZI C;  3HOX J;  4N4O B;  2IGM A;  4BXU A;  2I10 A;  5JLX A;  4RB2 C;  2GXA A;  3BTJ A;  3ELK A;  3OIO A;  3BPV A;  4S04 A;  2LY1 A;  1WJB A;  2EIK H;  2LKX A;  3TGN A;  1K79 A;  2M0C A;  3KLN A;  2KFD A;  1FYL A;  3CUQ C;  4BL0 B;  1WSU A;  4J19 A;  2EV5 A;  3F0C A;  5CVU A;  1SD5 A;  3BC8 A;  4ZYG A;  4YG2 F;  2MYS A;  1W5S A;  2VJ5 A;  1QZZ A;  4XRS G;  2E71 A;  4D7N A;  3WTV C;  1ETY A;  3PL8 A;  2OTL I;  2WV0 A;  2DK5 A;  3LSP A;  4BJT A;  1U8R A;  2DQL A;  4MEY F;  4ASN A;  4F7Z A;  2R7Z J;  2RQP A;  4EM2 A;  1OYY A;  2QKM B;  1QZY A;  2R7D A;  1GVD A;  5CVJ A;  1AKH B;  3GFJ A;  4IVN A;  3WU1 B;  2DDA A;  1MDM A;  1YRN A;  2XPV A;  4N0B A;  2L9N A;  2W00 A;  5LEJ A;  1WCM J;  2XRL A;  4HNV A;  3J7Y J;  4MQ9 F;  4QPQ A;  2M3A A;  3L9F A;  1XGS A;  3TQN A;  1EKE A;  2Q8K A;  2CWE A;  1XD7 A;  2AO9 A;  1ETW A;  3ESW B;  3FKJ A;  4KNY A;  5FRM A;  3A01 A;  4KIB A;  2OQR A;  3LSJ A;  5D8K B;  3I3L A;  4MO7 A;  1LQ1 A;  2JVG A;  3WTX C;  3HPG A;  4XLF A;  4IPA A;  3AKZ A;  4BY1 J;  3HUG A;  2FUG 2;  1OFC X;  2CO5 A;  3RKW A;  1XPX A;  4LGW A;  3PIO F;  3I56 I;  1KU2 A;  1R23 A;  5BOX A;  5FJ8 J;  4BAC A;  3ECH A;  4Q4Z F;  3BZ6 A;  4B47 A;  3HSR A;  5FB2 A;  4ENJ A;  2P6S A;  1DPR A;  4BHB A;  1H0M A;  5EZG A;  1XG1 A;  2XAU A;  2W4S A;  3FBI B;  2ESH A;  4V2G A;  2JTV A;  4Q47 A;  3J80 Z;  1RPW A;  4IHS A;  1F43 A;  4JX4 A;  4U7B A;  4WK8 F;  4B09 A;  2WY8 Q;  4XON A;  3OOP A;  3BQZ A;  1BR4 A;  5HLT A;  3DKX A;  1LVK A;  1Z3X A;  2IGN A;  3CUQ A;  3PJR A;  2DI3 A;  3F8B A;  5TJJ A;  3L2U A;  2ZJP F;  4CGZ A;  1Y8Q B;  3F6V A;  4M73 A;  1AKH A;  3W2V A;  4M6X A;  4KIG A;  3OV8 A;  4HF0 A;  2EFW A;  2BXZ A;  1IRZ A;  3V42 A;  3A0B C;  3I4P A;  4XLC A;  4XOR A;  2CV0 A;  2R0Q C;  3ABT A;  1G3W A;  2V7F A;  1BIB A;  2PMZ N;  2Y30 A;  1POG A;  2G7H A;  4RAF A;  2BY0 A;  2E5N A;  1KYZ A;  4U87 A;  1FTZ A;  2VT2 A;  1JI8 A;  1ENH A;  3HOZ J;  2ZXJ A;  3RYP A;  1TWF J;  1RUO A;  3GTQ J;  1X1C A;  3LAJ A;  3S3O A;  3DP7 A;  4WXH A;  2CQX A;  5LEK A;  3M3Y J;  1A35 A;  2Z5U A;  4X1E A;  1AHD P;  3E6M A;  3BR2 A;  4ZZL A;  3SYT A;  2VOP A;  4B48 A;  1UFM A;  3ROU A;  3K9T A;  2EJR A;  2CRG A;  2XGE A;  4CCL A;  2F5V A;  4M3D A;  4BE2 A;  3KCC A;  2NAZ A;  2HOE A;  2X6W A;  3IH4 A;  5J4Y A;  3CCU I;  3GF2 A;  1YIT I;  1BW5 A;  3AG3 H;  2F4O B;  3BP8 A;  3M8J A;  1XC5 A;  5EJC A;  4EAT A;  2FML A;  4PFP A;  4KIS A;  1XSX A;  2PX9 A;  3W6K B;  4F91 B;  1ZK8 A;  1N75 A;  1LFP A;  3BJO A;  2F5F A;  4RB1 A;  2VQH A;  1UST A;  5ERI A;  1FPQ A;  2Y9Y A;  3OY9 A;  3L2C A;  3CC7 I;  2LKS A;  1EH7 A;  1HKQ A;  3FM5 A;  3LSK A;  1Y56 A;  3RKY A;  4RB3 C;  4KMF A;  1DDN A;  1FLI A;  1SAX A;  1Z05 A;  2CQN A;  2BHY A;  5F0H A;  2YS9 A;  3JCU C;  4XKC A;  1J0R A;  4AID A;  4EV0 A;  5TGT A;  3ERM A;  4CSW A;  4FCY A;  3CQZ J;  4NDL A;  3KX2 A;  2JPB A;  3GZN B;  1IW7 F;  1P4W A;  4CHU A;  2QEX I;  1MSE C;  2DYS H;  3BG7 A;  3M07 A;  1LFU P;  1KU3 A;  2M1B A;  3KEY A;  3R60 A;  4N9H A;  4QPO A;  3PSF A;  2HDD A;  2HYF A;  5J4V A;  3ZQQ A;  2IT0 A;  4I01 A;  4HV5 A;  1TBX A;  2DO7 A;  2OTJ I;  4M9S A;  3HXL A;  9ANT A;  1K6O A;  2H94 A;  5FFZ A;  2MFZ A;  5B5E C;  4U7D A;  2BOL A;  2Y0S A;  1ZEL A;  4I98 B;  5CQG A;  5EYR A;  2D45 A;  2ADU A;  4XID A;  3I64 A;  4RGU A;  2VKE A;  2ZNY A;  4AIH A;  2K9S A;  3VSK A;  1DQU A;  3K2A A;  1WJF A;  1V4R A;  2P5V A;  3N97 A;  1XGN A;  1SFK A;  2F5E A;  4FTH A;  3RKX A;  3WGG A;  2F5C A;  4AYB N;  1F1Z A;  5B66 C;  5ICE A;  2UXN A;  1IRF A;  5FGM A;  3FXL A;  4QSH A;  5L3F A;  2VUM J;  1WHU A;  5E79 C;  1W0U A;  2J5P A;  2LF8 A;  3RPU A;  3F3X A;  2PJP A;  3ZQG A;  3PQJ A;  2N8G A;  2PEX A;  2PMH A;  1ORK A;  2DXI A;  3OL4 A;  2L5Q A;  3WG9 A;  1VQ6 I;  1WJE A;  2CFO A;  4HX7 A;  5IPA A;  2XB5 A;  2VC1 A;  3HIF A;  1K4T A;  4B8X A;  1P2F A;  2L54 A;  3F72 A;  3ECO A;  1FIA A;  2EV6 A;  3F22 A;  1I5Z A;  3Q9V A;  1RIO H;  2VPL A;  4A3I J;  2K3P A;  4KN7 X;  3F8F A;  5JFR A;  4WWC A;  4HLX A;  2O7O A;  2FOW A;  3UR3 C;  3PQK A;  3Q0W A;  5J1R A;  3KE2 A;  2GA1 A;  5KK1 A;  3HTU A;  3BTC A;  3KLO A;  1AU7 A;  3S2H J;  1IXC A;  3CUO A;  4U0W A;  1QGP A;  3OYK A;  5HNF A;  3RPQ A;  1D1C A;  4ZYE A;  1I3A A;  4NC6 A;  3M4O J;  2K9N A;  2X1C A;  1OR7 C;  3HRU A;  2UUZ A;  4DZP A;  5M3F J;  1VQ4 I;  1XX5 A;  5E8G A;  1DU0 A;  3J81 Z;  2ECB A;  1VQ5 I;  4L9N A;  4IOA F;  4B3X A;  2X1E A;  5D5X B;  3D1N I;  3OSF A;  1ZKG A;  2PG4 A;  3OIQ A;  4MFE A;  1ERD A;  2XKO A;  4XOT A;  3HKZ A;  3MWM A;  3LSI A;  1ON2 A;  4IX7 A;  4C2T A;  3TMO A;  3K10 A;  1O3T A;  4HV6 A;  3QPL A;  1ZAR A;  2GAU A;  2FQ4 A;  4E7H A;  2RAE A;  1IAW A;  1FOW A;  2X6Y A;  5AIP A;  4CCO A;  4RGS A;  1SVO A;  3P9K A;  1R58 A;  2IP2 A;  2M4G A;  5HLH A;  2WB1 A;  3VOE A;  3L2R A;  3CCJ I;  4KDP A;  4RLF A;  4D9J A;  4JP0 A;  1C0W A;  4M3E A;  3ZQI A;  1ETK A;  3S2W A;  1XS9 A;  4R8H A;  3B02 A;  4XQF A;  4HQE A;  5JHU A;  5DCM A;  1ETX A;  3FDY A;  2IRF G;  2XSJ C;  1S7O A;  2RDP A;  5FKK A;  5HS8 A;  3GTM J;  1W36 C;  2VI6 A;  1P9Q C;  1QHH D;  4GFB A;  3JRC A;  3AFH A;  2QZ8 A;  1LFB A;  1BIA A;  3D5L A;  3H0G J;  3FBN B;  5FKN A;  3O2P E;  2V1X A;  1BI3 A;  1H9T A;  2JA6 J;  3MEX A;  3CJN A;  4AD9 A;  3C18 A;  3LMM A;  4G12 A;  1R4N B;  5BPD A;  1OR7 A;  1YI2 I;  3F6O A;  5E3L A;  1S9H A;  4DGW B;  5IOZ A;  2A6H F;  2XAG A;  3EYY A;  3HGY A;  3ABK H;  4L5J A;  4LOC A;  2R4G A;  4LG0 B;  1EF4 A;  1FJL A;  2R7T A;  4QTR A;  1H8A C;  5AIQ A;  2FNA A;  2MW8 A;  3ZXS A;  2M45 A;  4GXO A;  3OYF A;  2JWT A;  3HRS A;  2FF4 A;  1QPI A;  2VKH A;  5KHD A;  3ZQC A;  1ZN2 A;  3K4N A;  3SFI A;  1SD6 A;  4A2U A;  4BBS J;  4IOC F;  1R1U A;  3AAF A;  1IDZ A;  1WJC A;  3MKZ A;  1NTC A;  3FXR A;  4M9X A;  4X0G A;  2HI3 A;  3LSR A;  1PP8 F;  1GT0 C;  2QBY A;  2Z33 A;  3GTG J;  1BN5 A;  2R7U A;  1STZ A;  3WU2 C;  1A6Q A;  3ABU A;  2M87 A;  2X4H A;  2MC3 A;  3V7R A;  2EFO A;  3LNQ A;  5IP6 A;  4OIQ F;  2OD5 A;  1O3R A;  2QSH X;  2KIU A;  2R3S A;  3DEW A;  4EJW A;  2BBY A;  2LKP A;  2CMP A;  2KP6 A;  3OYE A;  2HDC A;  2ZXI A;  2LTP A;  1N78 A;  1K83 J;  5KAF C;  1HBX G;  4PK4 A;  1OCT C;  3F8N A;  2DJN A;  3GCM A;  4RAY A;  5DS9 A;  3SZT A;  2FA5 A;  4O6J A;  1X2N A;  1J09 A;  2L4A A;  3QPS A;  1ULY A;  3BPX A;  5IYB J;  4LG0 A;  3T5X A;  4BY7 J;  1IN6 A;  1FX7 A;  4FHT A;  3L2W A;  4UVC A;  2O6G E;  3K4B A;  4RLQ A;  4BU2 A;  4XSZ F;  2E1N A;  3GW2 A;  5H6Q A;  1HCR A;  3FK7 A;  5GAD J;  1APL C;  1NK3 P;  2K02 A;  5CPR B;  4YFK F;  2QF7 A;  4IJA A;  3BTI A;  1ZRC A;  2PMZ A;  1MBH A;  5FFX A;  2F4I A;  2H1L A;  3HHH A;  5KAI C;  4A0Y A;  4XRF A;  2KL4 A;  3D5R C;  5KCM A;  1MSF C;  2M7A A;  3NWT A;  2GWR A;  5HS7 A;  4XK4 A;  3OS0 A;  4NC8 A;  3JRI A;  4D1Q A;  2E35 A;  4BJ5 C;  2O0Y A;  5M3M J;  4IHT A;  4EQQ A;  4YEL A;  3CCM I;  1J9I A;  1R00 A;  3OR1 C;  3PIP F;  5DM6 F;  3R4K A;  1R5I D;  5C44 J;  3G3Z A;  3KEQ A;  2DW4 A;  3DEE A;  2KZG A;  4XR6 A;  4HF1 A;  4RAZ A;  2LBF A;  5M5X J;  5J1U A;  1LKX A;  1TWC J;  2QLZ A;  3GWZ A;  1FC3 A;  4PDK A;  2R5Y A;  1TWG J;  4PJM A;  3EUH C;  4L9J A;  1Q1H A;  1GDT A;  1XB4 A;  1YJ9 I;  1I1S A;  5B1A H;  1P6R A;  1N77 A;  1ZRE A;  1SFO J;  1R9T J;  2W1O A;  4I02 A;  2KMU A;  2YX4 A;  3BCA A;  1Z9C A;  3CLO A;  3W3C A;  3TP3 A;  3LL7 A;  1MMG A;  1E2X A;  2ACJ A;  3EDP A;  4GCV A;  2GLO A;  4ZTF A;  3S93 A;  3ZQ7 A;  3I53 A;  4I0B A;  2UZK A;  2JZY A;  1JJ8 C;  2AQF A;  3MQ0 A;  3TBI A;  1ZR4 A;  2O9L A;  2XF6 A;  3E0J B;  2K40 A;  4GDF A;  2D1H A;  3L2Q A;  4G9Y A;  4GRI A;  2CG4 A;  3ZMT A;  1TW2 A;  1S6L A;  3FHZ A;  1NG7 A;  1UZC A;  4A6D A;  1CF7 A;  2EFN A;  2RVC A;  4LG3 A;  1IXR C;  2V6E A;  4AVP A;  1JKR C;  3H9G A;  3GFL A;  2VBZ A;  4G7O F;  2X9D A;  2MH9 A;  3W2A A;  3PO2 J;  2JRM A;  2XAS A;  3C2G A;  3RTR A;  4B44 A;  3IV5 A;  2VXZ A;  2LSO A;  3CP2 A;  2EA4 A;  3PNT A;  1IGN A;  2E1C A;  3HOW J;  1DGR M;  1FOK A;  4WCG A;  2K3F A;  3C2H A;  3OSG A;  3IKT A;  3OYG A;  2JMW A;  4GYG A;  3QYF A;  3SZG A;  4A3M J;  1U5T B;  1KQ8 A;  3QP5 A;  4XLA A;  4AYB A;  2K9L A;  5ICG A;  1HOM A;  2DBB A;  1X1P A;  4EM1 A;  1VQK I;  1YJW I;  4UUS B;  1QRY A;  2HPM A;  3PUF A;  4NQW B;  1B9N A;  5A2Q K;  5J47 A;  3W6J B;  1MW7 A;  2P5L C;  4R79 A;  5HNH A;  2Q0O A;  1IN5 A;  2WTE A;  2P7V B;  3HC7 A;  1W7P D;  3N05 A;  3ZMS A;  4XBF A;  4HZF A;  5A2Q Z;  5C3E J;  2HNH A;  4HEA 2;  2V1D A;  3O3K A;  4BDZ A;  2NYX A;  3BWG A;  3DBL B;  3E5Q A;  2L7K A;  2VJJ A;  3MD2 A;  3V8L A;  1ETV A;  3O6B B;  3QU6 A;  2XRO A;  1SD4 A;  1KGS A;  1HKT A;  5H20 A;  1UHS A;  1SAU A;  1TWA J;  2MD5 A;  3Q0U A;  4RBO A;  1PUF B;  3MKW B;  2OZU A;  5FKO A;  1A04 A;  2HEO A;  2H6B A;  1QZE A;  2LMD A;  4CO8 A;  2CJJ A;  4M6Y A;  5KNL A;  3CCV I;  4E7K A;  1ZH5 A;  2TCT A;  4V19 K;  1X19 A;  3WTU C;  2Q1Z B;  1MJA A;  2A6T A;  3JAM K;  2OJE D;  2CYY A;  3K70 C;  4IO9 F;  1U5T A;  4A5M A;  4N4N B;  3HKZ N;  1ZGW A;  1Z3Y A;  4RMN A;  3H1C A;  1RZ4 A;  1QBJ A;  3F8C A;  3IWF A;  2ZCW A;  4C3J J;  3JAM Z;  1ZHF A;  4UUS A;  3HEF A;  2GZW A;  2LC2 A;  2PN6 A;  3ZQF A;  3ZRG A;  3I9V 2;  3J7A Y;  2G9W A;  2HQN A;  2VBX A;  1W4M A;  1U9O A;  5F27 A;  3WU0 A;  1YRN B;  2WB1 N;  1Z77 A;  1LE8 B;  2E36 A;  2E2I J;  1SD7 A;  5ED4 A;  4DYC A;  1ZLK A;  2HQR A;  4E7J A;  1YW9 A;  4A3C J;  3OOU A;  1UMQ A;  2VPR A;  1R5G A;  3BJ6 A;  1BR1 A;  4BHC A;  3A01 B;  3KYL A;  2HOT A;  4L0Y B;  3EUA A;  1T6S A;  1WPK A;  4XLH A;  4A3K J;  3HUG B;  4HF2 A;  1Z21 A;  1DUX C;  3CCS I;  3WOD F;  1T08 B;  1H88 C;  3MKY B;  1PUF A;  1JHH A;  1PUE E;  4HNU A;  4LLG F;  2HU9 A;  1A31 A;  4LLN A;  3FMR A;  3H5A A;  2BVL A;  2K9Q A;  4A6E A;  1FMW A;  4HA8 A;  3I0T A;  2VQC A;  4D5F A;  1KQ0 A;  4FX0 A;  1VQ8 I;  3ZOB A;  4M72 A;  2VN2 A;  3RYR A;  4UNO A;  1TQP A;  2NVQ J;  1W5C C;  1V3F A;  1DP3 A;  3CUQ B;  2ELH A;  2MLG A;  3BRO A;  4C2U A;  1BJZ A;  4IHY A;  4ZYA A;  5JVG F;  3GZ6 A;  1DU6 A;  4DIQ A;  3W2W A;  5CKT A;  1IC8 A;  1OMI A;  2P0W A;  3E1S A;  4EM0 B;  1RET A;  2IS4 A;  4CIC A;  1Z1D A;  1BOB A;  2WV1 A;  2DT6 A;  4NC7 A;  4F52 A;  3LQR A;  4JQF A;  4AIJ A;  5E1Z B;  4F93 B;  2QVO A;  1LE8 A;  2XF5 A;  1X3Z B;  1JXS A;  2XGD A;  1I6H J;  3GLX A;  3KP2 A;  5FRO A;  3DF8 A;  2HFH A;  3KZZ A;  3C3W A;  3JTH A;  4ETS A;  1G3S A;  2L7F P;  3VSL A;  3HTS B;  4D0P A;  2DU9 A;  5EGO B;  5L3B A;  3OS1 A;  1UCR A;  5IP9 J;  4CDG A;  4C2M J;  1RES A;  3DLA A;  2A05 A;  2EWN A;  4Z2Y A;  3MZH A;  1ZGJ A;  3REO A;  2FU4 A;  2HGC A;  2W7N A;  4JX6 A;  2K86 A;  2V4J C;  1XDU A;  1V55 H;  1R7J A;  4OWR B;  5LFA A;  2CS3 A;  2KJC A;  4ENK A;  4B1R A;  3LSG A;  1SAN A;  3GEZ A;  3CO7 C;  1VQ7 I;  1IUY A;  4PSW A;  3A1Y A;  3VB2 A;  3FIS A;  4KT6 A;  4XM3 A;  5J8F A;  1O3S A;  1K61 A;  1Z7U A;  3CF2 A;  3FMS A;  2X0L A;  2JA5 J;  3ZN1 A;  4NHJ A;  3CTA A;  3V8J A;  1A5J A;  2M4K A;  2R7F A;  3DBR B;  1GV5 A;  3KZY A;  4JX5 A;  3I58 A;  1YO5 C;  3HDD A;  4UHT A;  2LNB A;  1IXS B;  2DA7 A;  2M30 A;  3NAU A;  3S3M A;  4D5C A;  1G4D A;  4IEJ A;  4G6Q A;  4MHG A;  4XLN F;  3IC7 A;  1X3U A;  5FLX K;  2MH2 A;  5GTH C;  2H8W A;  5EGO A;  2VJ4 A;  3G2B A;  3FIW A;  4YII A;  2V26 A;  3CCL I;  4HDV A;  1N25 A;  3E6D A;  3GTJ J;  2PI0 A;  3RZO J;  2BV6 A;  1NG6 A;  1DPU A;  2VOO A;  1XMK A;  2DOA A;  2AHQ A;  1O4X A;  5GPA A;  3TW6 A;  2ID3 A;  2E19 A;  2MLK A;  1FZP B;  2GIZ A;  3M8F A;  3T8R A;  3OS2 A;  4EJO A;  2V9P A;  5FKM A;  2M5W A;  2XDV A;  2K5C A;  4F55 A;  4HYE A;  3X2Q H;  3DPT A;  2NVT J;  3WE3 A;  2IJL A;  4ZC3 A;  4KUM A;  1OCO H;  2Z3Y A;  1HDP A;  1RR8 C;  1BJA A;  3QU3 A;  2R93 J; 
#chains in the Genus database with same CATH homology
 1B8I A;  3O8G A;  5BNG A;  1JTX A;  5E3O A;  4DZJ A;  2XSD C;  1FEX A;  5E3M A;  4JP0 A;  3LOC A;  4M3E A;  3ZQI A;  3MKL A;  1ETK A;  1XS9 A;  2HYJ A;  2LR8 A;  2OF7 A;  2NS8 A;  2X6O A;  1BW6 A;  2JK3 A;  3HOY J;  1ETX A;  5F0F A;  1VFC A;  1JJ6 C;  3FK6 A;  5FKK A;  3GTM J;  2Y2Z A;  3S1M J;  1WH7 A;  3SDG A;  2VI6 A;  2B63 J;  2M2E A;  4GFB A;  3JRC A;  4QIW N;  3JRE A;  1LFB A;  3H0G J;  5FKN A;  3PM1 A;  2JA6 J;  1IG7 A;  5C4J J;  4W97 A;  4G12 A;  3S1R J;  5E3N A;  3HOV J;  2KDZ A;  1WI3 A;  2JN6 A;  3BG5 A;  5E3L A;  3CCY A;  3DCF A;  5IOZ A;  3S14 J;  5IYD J;  2EZI A;  4LOC A;  3JRD A;  3HGY A;  4M6V A;  1EF4 A;  1B72 A;  1FJL A;  2GBY A;  4QTR A;  1H8A C;  3ZQH A;  2XPW A;  1JUP A;  2MW8 A;  3SJM A;  1QPI A;  2JWT A;  3H3V K;  3GBG A;  3ZQC A;  3SFI A;  5EG0 B;  2HOS A;  1ZQ3 P;  3GTK J;  4BBS J;  1MBG A;  2Y9Z A;  1IDZ A;  2Y0S N;  1NTC A;  1MBE A;  5F1J A;  2HI3 A;  3HGG A;  3LSR A;  1GT0 C;  2LY9 A;  4CYC B;  3GTG J;  1U78 A;  2FD5 A;  1JUM A;  4M3B A;  1HF0 A;  1T56 A;  3LNQ A;  3L1P A;  5IP6 A;  5K7H A;  3CMY A;  2CQQ A;  1BL0 A;  1MH3 A;  3NAR A;  2CU7 A;  3DEW A;  1VF9 A;  2G0E A;  1JUS A;  5F08 A;  2LTP A;  2KT0 A;  1K83 J;  2DMP A;  2O8K A;  1OCT C;  4A3F J;  3JRG A;  2DJN A;  5DS9 A;  2YU9 J;  2ME6 A;  1WH5 A;  4I76 A;  3HOU J;  1X2N A;  1GV2 A;  3QPS A;  3VPR A;  4W1U A;  2MGQ A;  5DTD A;  5IYB J;  1JKQ C;  4BY7 J;  2QCO A;  3I4M J;  3MVP A;  2XPU A;  2EBI A;  3UKG A;  1IJW C;  2JA8 J;  3RQI A;  5EG0 A;  1H89 C;  1HCR A;  1UG2 A;  3FK7 A;  1APL C;  1NK3 P;  1CQT A;  3S17 J;  4BBR J;  2DMT A;  2QF7 A;  3IH3 A;  3BTI A;  2E2J J;  1BA5 A;  1Z0X A;  2FJ1 A;  3S15 J;  1MBH A;  2L0K A;  1I3Q J;  4A3B J;  3A03 A;  1JTY A;  2DA2 A;  3BT9 A;  4Y7N J;  1MSF C;  3CDL A;  4MLO A;  5IP7 J;  4XK4 A;  4A93 J;  3Q3S A;  5J1Y A;  1NK2 P;  3JRI A;  2M9H A;  5EZH A;  5M3M J;  3BR0 A;  1P7J A;  2LFB A;  5M5W J;  5F04 A;  4X6A J;  2DA6 A;  4IHX A;  2MG4 A;  4XIC A;  1U8B A;  5C44 J;  4DYQ A;  2COB A;  2LLK A;  3B6C A;  2W48 A;  3G1O A;  5M5X J;  3TED A;  5J1U A;  1G2H A;  2XGC A;  1TWC J;  2R5Y A;  1TWG J;  1GDT A;  3HOX J;  1RKW A;  2I10 A;  5JLX A;  3BTJ A;  4FIS A;  1SFO J;  1R9T J;  3OIO A;  1A6I A;  1ETQ A;  3TP3 A;  2LKX A;  1D5Y A;  2EZL A;  2M0C A;  3G1M A;  2GLO A;  1ETO A;  1JT6 A;  2DA5 A;  4J19 A;  3F0C A;  1JJ8 C;  2NVX J;  1QVU A;  1ZR4 A;  4XRS G;  5EDN A;  1HLV A;  4D7N A;  2O9L A;  1ETY A;  2K40 A;  3MN2 A;  3LSP A;  5J3L A;  2R7Z J;  1ITY A;  5GP9 A;  1GVD A;  1X2M A;  1AKH B;  3S16 J;  3TW7 A;  1YRN A;  2XPV A;  2NS7 A;  5GPC A;  1JKR C;  1WCM J;  2XRL A;  4HNV A;  2X9D A;  4EEF G;  3PO2 J;  2AO9 A;  1ETW A;  2LK2 A;  2Y31 A;  3A01 A;  3IV5 A;  3LSJ A;  1IGN A;  4BY1 J;  4MO7 A;  3HOW J;  2CUE A;  1OFC X;  3OSG A;  2JMW A;  4A3M J;  2HXO A;  1MBF A;  2NOG A;  5FJ8 J;  4XRM A;  4Y52 J;  1MBK A;  2H8R A;  1IUF A;  1TWH J;  3BTL A;  1HOM A;  5EZG A;  1XG1 A;  2CUF A;  1QRY A;  4UUS B;  4V2G A;  4C3I J;  3BQY A;  4BXX J;  2DMU A;  1I50 J;  1RPW A;  2GM4 A;  1F43 A;  4JX4 A;  2EZH A;  3Q0V A;  4M3G A;  5FKL A;  5FLM J;  5IOY A;  3BQZ A;  2R5Y B;  2HOA A;  4JYK A;  5C3E J;  3BG3 A;  3HB9 A;  2M8G X;  2XB0 X;  2H1K A;  1AKH A;  1ETV A;  5FLV A;  2DA1 A;  1IRZ A;  1MH4 A;  3JRA A;  2ID6 A;  4V2F A;  3WHC A;  1UHS A;  2R0Q C;  3Q0U A;  1TWA J;  1PUF B;  4RBO A;  2PMZ N;  2DTZ A;  1ZR2 A;  2Y30 A;  5FKO A;  1POG A;  4I6Z A;  2MSY A;  5F0C A;  3RZD J;  2CJJ A;  1VND A;  1VI0 A;  3BR6 A;  2TCT A;  1FTZ A;  1ENH A;  3HOZ J;  2R93 J;  1TWF J;  3HKZ N;  3JRB A;  3QQA A;  3GTQ J;  2WAQ N;  1ZGW A;  1JKO C;  2CQX A;  4C3J J;  3M3Y J;  2EQR A;  4UUS A;  4X1E A;  2TRT A;  2E2H J;  1X58 A;  3HEF A;  1AHD P;  3ZQF A;  3BR2 A;  4B4C A;  3B6A A;  4A3L J;  5EF6 A;  1U9O A;  2CRG A;  5F27 A;  2XGE A;  2WB1 N;  5EEA A;  1YRN B;  1Z77 A;  4M3D A;  1LE8 B;  2M34 A;  2E2I J;  1U9N A;  4DYC A;  2NVY J;  4AUX A;  2IBD A;  4A3J J;  4A3C J;  3OOU A;  1UMQ A;  2VPR A;  3IH4 A;  3WHB A;  2HOT A;  3A01 B;  4A69 C;  5K7F A;  2P81 A;  1WPK A;  1BW5 A;  3G1L A;  4A3E J;  4A3K J;  3W6V A;  3FKI J;  1XC5 A;  2YUS A;  3HM5 A;  5K7Z A;  3TP0 A;  2R92 J;  1ZK8 A;  2OPT A;  1H88 C;  1Y1V J;  1ZTR A;  1PUF A;  4FE7 A;  3BR3 A;  4DW6 A;  2JA7 J;  2K9Q A;  2Y9Y A;  3BR5 A;  4D5F A;  1IDY A;  4M3F A;  4UUT A;  3ZOB A;  3JRF A;  1OJL A;  1RR7 A;  2YS9 A;  5F0H A;  2JJ7 A;  3K7A J;  2R5Z B;  2NVQ J;  2IEK A;  4FCY A;  3CQZ J;  4NDL A;  1W0T A;  2L7Z A;  1BJZ A;  4IHY A;  1MSE C;  1DU6 A;  1LFU P;  4A3G J;  1IC8 A;  1RET A;  1WGX A;  2HDD A;  3E7L A;  4DYR A;  2WV1 A;  2D5V A;  2E1O A;  3JRH A;  2LVS A;  1LE8 A;  9ANT A;  4FE4 A;  4B3A A;  2VKV A;  4A3D J;  1Y1W J;  2XGD A;  1I6H J;  3HBL A;  2X48 A;  4C3H J;  2IAI A;  4D7M A;  1S7E A;  5C4X J;  5EYR A;  3PO3 J;  4XID A;  2LP0 A;  2VKE A;  2L7F P;  3GTL J;  4MIM A;  2K9S A;  2EZK A;  3K2A A;  5EGO B;  1FIP A;  2DA3 A;  2ME0 A;  4FTH A;  1QVT A;  5IP9 J;  1MBJ A;  5HOD A;  1GUU A;  4AYB N;  1TC3 C;  4C2M J;  1RES A;  2HQ5 A;  1E3O C;  4QSH A;  4MFD A;  2L9R A;  4BKX A;  3GTP J;  2DA4 A;  4JX6 A;  1JT0 A;  3GTO J;  2R5Z A;  3RKQ A;  2VUM J;  1W0U A;  4ABZ A;  2DN0 A;  3ZQG A;  3A02 A;  2LD5 A;  2N8G A;  3S2D J;  4B1R A;  5IYC J;  3LSG A;  1ORK A;  1RKT A;  1SAN A;  4XRS A;  3S1Q J;  1JKP C;  5IPA A;  1B8I B;  2XB5 A;  3FIS A;  1K61 A;  2JA5 J;  1FIA A;  2DMQ A;  4A3I J;  1A5J A;  1FTT A;  3C2B A;  3IH2 A;  1GV5 A;  2DMN A;  2O7O A;  4JX5 A;  5JLW A;  3Q0W A;  5J1R A;  1IV6 A;  3HDD A;  3S1N J;  1Q1V A;  3ZQL A;  2DA7 A;  2L7M P;  3BTC A;  3NAU A;  1AU7 A;  4D5C A;  2ECC A;  3S2H J;  4RDU A;  4IEJ A;  1P7I A;  4IHW A;  2HXI A;  4L5E A;  5EGO A;  2FX0 A;  3FIW A;  2K9N A;  3M4O J;  3GTJ J;  3RZO J;  4CYC A;  4DZP A;  4AC0 A;  2AHQ A;  1O4X A;  3BG9 A;  5M3F J;  1DU0 A;  5GPA A;  2ECB A;  3TW6 A;  2ZB9 A;  1T33 A;  3BR1 A;  1JGG A;  2ID3 A;  2E19 A;  4S0H B;  4IHV A;  3O8H A;  1HDD C;  3D1N I;  3JR9 A;  3OSF A;  1ZKG A;  4MFE A;  5FKM A;  2EH3 A;  5M5Y J;  2ELK A;  1OCP A;  2NVT J;  3QPL A;  1B72 B;  3I4N J;  2FQ4 A;  2RAE A;  1MNM C;  1HDP A;  1F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...