4NDLA

Computational design and experimental verification of a symmetric homodimer
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
44
structure length
44
Chain Sequence
FSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords ENH-c2b, computational designed homodimer
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 9
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4ndlA00
1NK3P 4I76A 4L5EA 1K61A 5BNGA 2EZHA 4XK4A 2GM4A 2L7FP 3QQAA 2CJJA 3MKLA 3HGGA 3BTIA 1JUMA 2GLOA 4A93J 3C2BA 4UUTA 2TRTA 4EEFG 2K40A 4DYCA 3FKIJ 2R7ZJ 1I3QJ 2IEKA 2NS8A 2E2JJ 3HOWJ 2LR8A 4D7MA 3A02A 5E3NA 3WHBA 2MGQA 5M5YJ 1IUFA 4MFDA 1TWHJ 3FK6A 4A3BJ 1K83J 1RPWA 3I4MJ 5EZHA 3M4OJ 2LVSA 2L7ZA 4BY1J 2DMPA 2CUFA 1GT0C 1MSEC 3GTOJ 4JP0A 2DA5A 1OFCX 3BG5A 1JKQC 1TC3C 3S2HJ 1ENHA 1XC5A 2DMTA 1IC8A 1JGGA 2LKXA 2TCTA 1OCPA 2O7OA 1ETXA 5DTDA 2X9DA 2NVQJ 2HOSA 2RAEA 1JJ8C 4IHXA 3NARA 1ETVA 2Y9ZA 2YU9J 1SFOJ 4GFBA 1HLVA 1F36A 1I50J 4A3JJ 4RDUA 5IYBJ 2R92J 1GDTA 1MH4A 2M9HA 2LD5A 3RZOJ 1OCTC 4JX4A 5IP6A 4C2MJ 4CYCA 3BTCA 3F0CA 3PO3J 1ORKA 2E19A 4B3AA 5IOYA 1BL0A 1IGNA 3D1NI 1GVDA 3JREA 1FEXA 5F0FA 1HF0A 5FLMJ 1ETQA 4IHYA 4MLOA 2JWTA 1Z0XA 4CYCB 5C4JJ 3S2DJ 1TWCJ 5EZGA 1DU6A 2R93J 3A03A 1ZR2A 4A3KJ 1JUPA 3HEFA 4QSHA 1GV5A 3LSGA 2B63J 5J3LA 4I6ZA 3M3YJ 1WI3A 3S1QJ 2HI3A 4UUSA 5C44J 2R5YA 3JRIA 4XRSG 2XB0X 1ZKGA 4M3EA 3TP3A 3H0GJ 5EG0A 1QPIA 4FCYA 5K7HA 1H89C 1WPKA 3JRDA 1AHDP 5IP9J 2JJ7A 3GTMJ 2HXIA 5IYDJ 2XGCA 3LNQA 2M34A 3B6CA 4UUSB 2VKEA 1U78A 2Y31A 2R5YB 2W48A 2VUMJ 3SFIA 2VI6A 4AUXA 5K7FA 2R0QC 3VPRA 5F1JA 5EG0B 2L7MP 2DN0A 1U9NA 3LOCA 4XICA 3O8HA 1W0TA 1H88C 1A6IA 1WGXA 1P7IA 2VKVA 1XS9A 1R9TJ 3DCFA 3HOZJ 1A5JA 4X1EA 4RBOA 4A3IJ 1X58A 3G1OA 4W97A 1PUFA 4AC0A 2JA8J 3BQYA 1ETWA 2D5VA 1MBGA 1HCRA 1BJZA 4Y7NJ 3OIOA 1YRNA 1JJ6C 1ETKA 1Z77A 4DYRA 3FISA 2KT0A 2G0EA 1WCMJ 2OPTA 1JKPC 3S1MJ 4FE7A 3BR5A 2FX0A 1PUFB 3JRGA 3IH3A 5HODA 2H8RA 2HYJA 1WH7A 1B8IA 3HM5A 3E7LA 5E3LA 4XRSA 4FE4A 1UMQA 1YRNB 1RKTA 4XRMA 1BW5A 4M6VA 5DS9A 3H3VK 1LFUP 4M3FA 2L9RA 1MBJA 4J19A 5IPAA 2COBA 3TW7A 2K9NA 4MO7A 3IV5A 5IYCJ 2XRLA 3BTJA 1B8IB 4M3BA 1B72A 3Q3SA 2JK3A 5GPAA 1MNMC 1E3OC 3ZQIA 2LLKA 1IDZA 3G1MA 3L1PA 2HOTA 4MFEA 4D7NA 2MSYA 2X6OA 4BBRJ 3GTLJ 4A3DJ 2OF7A 2AO9A 1S7EA 1B72B 2X48A 1JTXA 4Y52J 4JYKA 1RKWA 4M3GA 5GP9A 2I10A 1BW6A 2XPVA 3HB9A 3OOUA 3BTLA 5F04A 5IP7J 4QTRA 3BR1A 4QIWN 1RR7A 1MBKA 4D5CA 3ZQHA 3DEWA 3CDLA 2DA4A 3S14J 4FISA 2M8GX 1T33A 3TEDA 3HBLA 2GBYA 3SDGA 2LFBA 2E1OA 2E2HJ 2O8KA 3RQIA 1U8BA 4BXXJ 1APLC 1FIAA 2NVTJ 5M3MJ 1F43A 3BG3A 1RETA 3K7AJ 4IHWA 1FIPA 2Y0SN 1BA5A 3JRCA 1SANA 3S15J 2XPWA 4C3IJ 1MBEA 1TWFJ 4FTHA 2LTPA 1TWGJ 1I6HJ 1UHSA 3A01A 5C3EJ 2JA5J 3MVPA 2DA1A 5IOZA 3S16J 3LSPA 1MBHA 2JMWA 1MH3A 3S1NJ 3G1LA 2XSDC 4W1UA 4A3MJ 2QF7A 3Q0UA 2M0CA 4A69C 2NVXJ 2ELKA 3I4NJ 5FKLA 2DTZA 3A01B 2R5ZA 4V2GA 3SJMA 1VFCA 3HKZN 1LFBA 1LE8A 3O8GA 1JT0A 3HOUJ 3HOXJ 3MN2A 2K9SA 1W0UA 2YUSA 1JKRC 1X2NA 3ZQLA 3GTGJ 4A3EJ 4IEJA 4X6AJ 1AKHA 1O4XA 2R5ZB 2EZKA 5M3FJ 2ID6A 3NAUA 1LE8B 4XIDA 2XPUA 3BR3A 3ZOBA 4BBSJ 5EEAA 5E3OA 2MG4A 2JA7J 5FLVA 4M3DA 5F08A 3JRBA 1AKHB 2QCOA 3Q0WA 4BKXA 2CRGA 3WHCA 1MSFC 3S17J 2ME0A 4DYQA 5EYRA 1DU0A 4JX5A 2EQRA 1JKOC 1VI0A 3BR6A 2EZIA 2N8GA 1D5YA 4B1RA 3CMYA 3BR0A 3HOYJ 3LSJA 1QVTA 2L0KA 1IRZA 2XB5A 4A3FJ 4LOCA 2CU7A 3QPLA 2DA6A 1RESA 3FIWA 4DW6A 1IV6A 1VNDA 1QVUA 2IAIA 1MBFA 1T56A 3CCYA 2Y30A 3ZQGA 2ME6A 1GUUA 1NTCA 2YS9A 3FK7A 1OJLA 5C4XJ 3GTQJ 1JUSA 4A3LJ 3LSRA 2VPRA 1JT6A 1ZTRA 3HGYA 1GV2A 1HOMA 3JRHA 3RKQA 1ZQ3P 3GBGA 4G12A 2M2EA 3QPSA 2E2IJ 2Y9YA 2FD5A 4BY7J 3BQZA 2DA3A 2DA2A 5GPCA 1IJWC 3TW6A 2H1KA 3HDDA 2MW8A 5E3MA 1P7JA 1VF9A 2CUEA 1FTZA 5EGOA 2DMNA 2PMZN 2Y2ZA 4B4CA 3OSGA 1H8AC 1TWAJ 3HOVJ 4D5FA 5F27A 2WB1N 2AHQA 2JA6J 5K7ZA 3GTPJ 5J1RA 3PM1A 3JR9A 1FJLA 1Y1WJ 3IH2A 2NVYJ 2LY9A 3TP0A 1WH5A 2WV1A 5M5XJ 5EGOB 2CQXA 2HOAA 1POGA 1ZR4A 2IBDA 3PO2J 2KDZA 1XG1A 2FJ1A 5FKKA 1IG7A 3ZQFA 4S0HB 2JN6A 4DZJA 2EBIA 2XGDA 3CQZJ 1NK2P 3BR2A 1ZGWA 3W6VA 3Q0VA 1ETYA 2DMQA 1AU7A 4HNVA 5JLXA 1CQTA 3GTKJ 4C3HJ 2ID3A 4ABZA 3RZDJ 1Q1VA 1QRYA 2ECCA 4C3JJ 1EF4A 2XGEA 3ZQCA 2EZLA 1HDDC 3S1RJ 1ZK8A 3JRFA 5J1YA 9ANTA 4DZPA 5M5WJ 5EF6A 2HXOA 2FQ4A 1UG2A 1Y1VJ 3BG9A 1FTTA 5J1UA 5FKNA 2DA7A 2WAQN 4A3CJ 2NS7A 3OSFA 1U9OA 4A3GJ 2HDDA 5F0HA 2LP0A 2DMUA 3BT9A 1X2MA 1G2HA 4IHVA 2K9QA 1ITYA 3UKGA 1ETOA 2O9LA 1JTYA 2DJNA 5F0CA 2ECBA 4MIMA 5FKMA 2HQ5A 4V2FA 3B6AA 1IDYA 4AYBN 5FJ8J 3GTJJ 2EH3A 5FKOA 1HDPA 2CQQA 2ZB9A 5EDNA 3JRAA 4NDLA 2NOGA 2P81A 3IH4A 5JLWA 2LK2A 4JX6A 3K2AA
chains in the Genus database with same CATH superfamily
3MCZA 3C1DA 5KAIC 1P4XA 2WB1A 3FMSA 4XK4A 2L7FP 2CJJA 3ONQA 2UXXA 3QYBA 2LREA 2WY7Q 1MDMA 2GLOA 2QSHX 3C2BA 4Q47A 1EH6A 2VASA 5FLXK 2DI3A 4DYCA 4G7OF 2R7ZJ 3ECOA 2ADUA 2IEKA 3GZ5A 2QA4I 3FXRA 2DOEA 1D8JA 3WHBA 2KRHA 1IUFA 2Z3YA 3E0JB 4MFDA 3WGGA 4IF4A 1RPWA 2WADA 3UR3C 1MDMB 3DKWA 2LKPA 1XGOA 2KISA 4KIBA 2CUFA 1IZ1A 4IL6C 4JP0A 1JKQC 1AOYA 2IS6A 3EUAA 3BZKA 4B48A 1IV8A 3T0YA 4BDZA 1T38A 1XPXA 4CDGA 2X51A 1R71A 2TCTA 4LG0A 3O3KA 2A05A 2X1CA 5DTDA 3H9GA 4NUBA 2JPCA 2OU2A 2XRNA 4U0VA 3DKYA 1T0FA 3NARA 4HAMA 4ZYHA 1JGSA 2GAUA 1S3JA 4HLYA 2LSOA 2EA2A 1F36A 3HL2A 1WSUA 4KDPA 4A3JJ 4LK0F 2M9HA 1OCTC 4LG0B 2PBIA 4CYCA 3BTCA 1PDNC 4U7DA 2E19A 2KIFA 5IOYA 3CCEI 4G7HF 2O03A 4DGWB 5CVIA 1Z6RA 1A31A 2R7UA 5F0FA 3K4NA 3QRFF 3HG9A 2XHKA 4HZFA 4IOCF 4CYCB 1REPC 5H20A 3ULQB 3FX3A 2P6SA 1G3SA 5GADJ 1ZR2A 1KQ8A 3HEFA 2K4JA 3R4KA 3L2WA 2K3PA 4F93B 3ZXSA 2F5EA 3CMMA 3K1PA 2VBZA 4PJNA 4CCOA 2R5YA 2L02A 3ABTA 3ZN0A 3H0GJ 1SD7A 2JA2A 1MMAA 3JRDA 1J2XA 3NWTA 3W3CA 2M34A 4D9JA 3B6CA 4JOMA 3F22A 3S2WA 2DODA 5GTHC 2R5YB 3QPHA 3H3UA 4L9VA 2LC2A 4OU0A 2R7TA 1P4AA 3VPRA 2L7MP 3T1BA 3DQVC 4BYYA 1U9NA 4UUVA 3WE2A 1YO5C 1H88C 4I02A 1W7PD 3PQJA 1WGXA 2CW0F 2K3FA 3OYJA 3CC7I 1V55H 1P7IA 1KU2A 3RDIA 3C2GA 4E7KA 4HDVA 3TO6A 2F6CA 4YFXF 3LQQA 2XAGA 2P4WA 3DCFA 3HOZJ 2IGNA 3V7SA 5L3FA 3DF8A 4W97A 1YIOA 2XV4S 1SFUA 3N05A 3BQYA 3CO6C 4RS8A 2D5VA 5IT9K 2HYGD 4NHJA 1X1BA 2BXZA 2CQKA 4CCMA 3O6BB 2Z99A 4Y7NJ 4I0AA 3QYEA 5B1AH 1ETKA 3K2ZA 4EM0B 4ZYDA 1U5TA 5L3DA 2QUFA 3BR5A 3VODA 3OWTA 2H8RA 5AIPA 3JRGA 1B8IA 2KJBA 1NH3A 2JRTA 4OINF 1GVJA 3U2RA 5DD8A 4XRMA 5LBQA 1T98A 3H3VK 1U5TB 2L9RA 4HF1A 2ELJA 5IPAA 4NNJA 3BLYA 5DCFA 4BE0A 3T8RA 4CH7A 3BTJA 1B8IB 3Q3SA 3TBIA 3DXJF 2F4IA 2JK3A 3K1MA 1Z3XA 5GPAA 1R23A 1OR7A 2WBMA 3ZQIA 4OMZA 2JVGA 1IDZA 1WRJA 2RV8A 3ZMSA 4LIUA 2MSYA 3SHFA 5J6XA 1E3HA 3IWFA 4A3DJ 3DU6A 2AO9A 2KKOA 4Y52J 3AG3H 2WY8Q 2HKOA 5GP9A 5H2FC 2Y75A 3U1DA 1LKXA 2IXSA 2I10A 2KIUA 2KJCA 1U3EM 4FX4A 6PAXA 1YG2A 3HB9A 4M6XA 3M1CA 2FU4A 3BR1A 2QEXI 4I0BA 1XSVA 1Z05A 3DTEA 2BVLA 2DOAA 1LQ1A 4FISA 2M8GX 3K4CA 1T33A 3HBLA 4BNCA 5HLTA 2JQ7A 1G4DA 4L5IA 3RQIA 1XMXA 4G94A 3JW4A 3W6KB 4O5VA 2ZXWH 1BA5A 2ZXIA 2OC6A 4DJAA 3G6EI 3GEZA 4ZC3A 1WQ2A 4EJOA 1MKMA 1VQ9I 1UELB 1TWFJ 3V8LA 4V19K 1I39A 3MD2A 3P9CA 2DQRA 2EK5A 3MAJA 3A01A 2EFNA 3NEUA 2DA1A 2ZFUA 5IOZA 5GAHJ 2K4BA 2MFZA 2JMWA 2CV2A 1T6SA 5JVGF 3S1NJ 2BHYA 5H6RA 3LSMA 3LAJA 1T0FC 1YS6A 3BCBA 4A0XA 2DTZA 3A01B 2FSWA 2YR2A 3SJMA 1ZH5A 1VFCA 3M07A 3OOPA 3HSEA 4LGWA 1O7LA 2XUBA 4IRGA 3K6GA 3OYEA 2LRDA 3DKXA 2M4GA 3AG2H 2F5FA 4LLLA 1MW7A 4BQNA 2W7NA 3IKTA 3OL4A 2H94A 5GTIC 1E0EA 5AIQA 3JSPA 1R36A 2IA0A 2W57A 1AKHA 1O4XA 3GCMA 2A3SA 4GO1A 3CCQI 1O7FA 1SMYF 4WX9A 5M3FJ 2EV6A 1XGNA 3WG7H 3L00A 3L2RA 1IN5A 1VQMI 2B0LA 2GZWA 4XONA 2JA7J 3K4MA 1WWXA 1E2XA 5LFAA 4H4KC 1VTNC 1E17A 4YFKF 3A2KA 3HOSA 1QBJA 3VYTB 1AKHB 3LA7A 3KEYA 1RNLA 3HHHA 1B6AA 4A12A 2HTSA 3LSTA 4GDFA 4C30A 4JX5A 2VXZA 2HKXA 2F4MB 1QU3A 2EQRA 5D4SA 1VI0A 2OTJI 1X1AA 2N8GA 2RC4A 4Z2YA 3KX2A 3KP5A 3SZTA 3BR0A 3M7GA 2K9MA 1T2KA 1QVTA 3DBHB 2ISYA 4LOCA 2CU7A 4AU7A 3R0JA 3LSKA 2M45A 1RESA 1IV6A 3ZR8X 1VNDA 2IAIA 5B66C 1T56A 2XROA 4ZYGA 1OCRH 2PQ8A 2BY1A 1LDKB 1OJLA 2VE8A 4A3LJ 3CD6I 3LSRA 2CH0A 2L9NA 3HGYA 3JRHA 3RKQA 3K4KA 4B47A 4ESJA 1UFMA 5JHUA 5ED4A 3F8BA 4PK4A 3LAPA 2ZJ2A 2X6WA 2UV1A 4F91B 2E2IJ 2QVOA 1YOVB 3BQZA 2DTRA 1Z91A 4KT5C 2VB6A 4XOPA 1O3TA 1OKRA 1D5VA 3GO5A 5EEGA 3FXLA 5CJ9A 3IP4B 3FM3A 3EYYA 1YW8A 2VODA 1FTZA 5JR3A 3D5RC 2DMNA 4B4CA 5D5VB 1OCZH 3OYAA 1H8AC 2K5CA 1XMKA 1RRJA 4LFUA 4E4HA 3KP2A 4PSWA 4H0EA 2HQNA 4BS9A 3OV8A 1RIOH 1ZREA 1IN4A 3TO7A 1K6OA 3GTPJ 5J1RA 1YX3A 2ZNYA 3HUGA 1FJLA 1Y1WJ 2CV1A 2DK8A 1WH5A 2XKPA 4N4NB 1K7AA 2K85A 1D1BA 2FJ1A 3IAS2 1RI7A 4XLNF 1RZ4A 4R8HA 5AONA 4Y4RA 4BHCA 4E7ZA 5KAFC 4DZJA 2EBIA 3CQZJ 1R5GA 5L3CA 1FP2A 4ZYEA 3BR2A 4ETSA 3HUGB 3IKVA 2HS5A 1OR7C 4HA8A 3S3OA 2IT0A 3Q0VA 4L9TA 4HNVA 3OR2C 3MEXA 1CQTA 1G3TA 3GTKJ 4ABZA 3R6SA 3RZDJ 3IHUA 1QGPA 1HW2A 2VOOA 1EF4A 2VBWA 4XSXF 3HIFA 3CCLI 2VBXA 1HDDC 1Z7UA 3CUOA 5FFXA 3ISPA 2D45A 2L3DA 1TBXA 4LB6B 3K70C 3HYIA 2K86A 3OIQA 9ANTA 4HEA2 1ZELA 1AA7A 2DAOA 1BR4A 2E36A 3HZJA 1MJBA 2I5UA 1ZLJA 4BAYA 1AWCA 3FBIB 2MYSA 3HTSB 4KISA 1BI2A 1FYLA 2NS7A 3OSFA 1S6LA 2HQAA 4IO9F 2LP0A 3S93A 1S8NA 4EJTA 1G2HA 2K9QA 4HNTA 3R61A 4UNOA 2IVMA 1JE8A 1UCRA 3ZQ7A 4E7LA 1ZLKA 5FKMA 2VLAA 1PP7U 5LGNA 2IGOA 4V2FA 4HSRA 2P5VA 5FJ8J 2VJJA 4KICA 2CQQA 1R58A 2IA1A 3FHNA 4NDLA 2P81A 3IH4A 3VSKA 1H9GA 2LK2A 3F8FA 2VT2A 1RR8C 2VQHA 2MW8A 3TDUC 1DGRM 2HQRA 2VC1A 2PJPA 1K61A 5BNGA 3E5QA 2EZHA 2OZUA 2E34A 2KRCA 4HPQA 1G59A 4XKBA 3CJNA 3UNGC 1EJ9A 3HGGA 3OL3A 1DP3A 3BTIA 1JUMA 2GOMA 1UHWA 3S32A 2GA2A 2TRTA 3GZNB 1FOWA 3G2BA 3DTIA 2L4MA 3A4CA 4EEFG 5A2QZ 3RSNA 2IJLA 3G4SI 3HOWJ 4XN0A 3A02A 4F92B 4J01A 3LMMA 5BMZA 1O3RA 4KIFA 5M5YJ 3TKYA 3CCMI 3EYIA 1VQLI 1PVEA 3ZMVA 1K83J 2V6CA 1VQKI 3M4OJ 1YIJI 2L7ZA 1VQ7I 4KN7X 2OA4A 1ZYRF 4ZTFA 1IN8A 4EM2A 2DMPA 4A5NA 2BBYA 4U87A 1S7AA 1OFCX 1MZBA 1ENHA 1XC5A 1SVOA 3E1SA 2ELHA 2LKXA 4NB5A 1TNSA 1ETXA 2ZBKA 1Z67A 4RB0A 2HOSA 5DV5A 3ASNH 2RAEA 3PIOF 3IUOA 2R7QA 1JJ8C 1FZPB 3V7RA 4IHXA 1ETVA 2Y9ZA 2YU9J 3WGIA 1UZCA 2RQPA 2PI0A 3PIPF 2DT7B 4GFBA 4Q5SF 2R92J 5IYBJ 2F48A 2KHMA 3FBNB 2ZKZA 3KYCB 1LFPA 1GDTA 2W00A 5IP6A 3CDHA 4C2MJ 2ZJRF 2KMUA 1VQ8I 1SEUA 3OYGA 2RKHA 3E97A 1LEAA 3GMEA 3DBRB 4B3AA 1BL0A 3RCOA 1WI9A 3D1NI 2CGPA 4LD5A 5FLMJ 3PNVA 1ETQA 1YYVA 4IHYA 4FHTA 1NG6A 5J8CA 4AVPA 5C4JJ 1TWCJ 1KYWA 2DPUA 1ZRFA 4A6EA 1ZGJA 2STTA 4M74A 1DGWY 4UVAA 3BROA 4QSHA 2WA0A 4EM1A 2X0LA 2VXDA 4PJ0C 2XC7A 1Z1DA 1TLHB 1BIAA 2KDOA 1J75A 3BDDA 3L09A 3X2QH 4AIKA 2BEOA 3TL4X 1N77A 4EJUA 4MNUA 2Y0MA 3JRIA 4G6DA 2F5CA 5ICCA 3KEQA 3CMEI 1OPCA 2MBFA 2XAUA 4M3EA 3TP3A 1K4SA 2FE3A 4XRFA 1HA8A 1QPIA 4CZZA 4ZZLA 2DDAA 1H89C 1FWZA 1WPKA 2R7SA 1AHDP 4BL0B 2MH2A 1XDUA 2XGCA 1ERDA 1KONA 3ZMDA 1USSA 2KZVA 4L5JA 2W48A 3L2QA 2P7CB 1K4TA 4N9IA 2OTLI 3I54A 4Y33A 2VUMJ 2VL8A 1OCOH 2GA1A 5K7FA 3IC7A 1R4NB 3BCAA 1QZEA 3CJRB 2XASA 3U1KA 1MMDA 3LOCA 1FBQA 1WHUA 3V4GA 3EUHA 4KJZA 5JFRA 4EATA 3OYBA 2BE5F 5LHGA 4XSZF 2VPLA 5HNFA 2R7FA 5LEJA 3H9QA 2FMLA 4DBRA 1WJ5A 2CWEA 3I3LA 1R9TJ 1A5JA 5D8LB 5GAGJ 4UV9A 4A3IJ 4KMFA 1YI2I 4XL9A 4I98B 3F8NA 1ZHFA 1VQ5I 1QQIA 2H6BA 3ZP5A 1D0YA 2MABA 1NHAA 1WFXA 3VEPA 4CUGA 1F5TA 1FP1D 2A69F 1BJZA 3OIOA 1YRNA 2GXAA 2FF4A 4BUPA 3CUQC 3FXQA 2A6TA 1MIJA 1WCMJ 1JKPC 2HOEA 4FE7A 2FX0A 4XN3A 4LK1F 4M9SA 4MTDA 2WWYA 1SFKA 4IKFA 2VOPA 3E7LA 4OAYA 1MNDA 5E3LA 2HFHA 3FWEA 4P5OA 1FPQA 2E71A 1UMQA 2WAFA 1ODDA 2O5RA 2DJIA 3E5UA 4IVNA 1YRNB 1BW5A 2E60A 3KP4A 4M3FA 2HVSA 5E17F 4J19A 1ZG3A 2HDCA 2COBA 2WC2A 3H5RA 1KQ9A 1TQMA 2ZC2A 4MO7A 2XAQA 4RMNA 1B72A 3R0AA 1MNMC 1OYWA 2CQ7A 2W25A 2EFQA 2EWNA 3MKZA 1XSDA 3GTLJ 1SVMA 4KT6A 1UHMA 2OF7A 1FX7A 1S7EA 1B72B 4M73A 1H9TA 4Z6YA 1CGPA 3ZQQA 1RKWA 5D8KB 4ZTJA 1HC8A 1BW6A 1V5GA 5FD6A 3CJTB 1OQYA 2BYVE 2CSOA 4QTRA 3EQLF 4QIWN 4XNFA 3RKWA 4AVZA 1Y8QB 2PMUA 3ZQHA 4L0ZB 4PDKA 5CLSA 1O57A 3S14J 2DA4A 2QZ8A 3RPUA 4OIOF 2FQ3A 5DM6F 3JSOA 2YPRA 3H5NA 3OS1A 1GXPA 2E2HJ 4GXOA 1XCVA 1BIBA 2OAZA 3OR1C 1U8BA 1APLC 5CYVA 2EA4A 1F43A 3BG3A 3K7AJ 4IHWA 2E7XA 4UXNA 1JHHA 3JRCA 3S15J 2JTVA 2AS5F 2R4GA 3QP6A 4QLCU 3COAC 2V1NA 3KEOA 2JSPA 4C3IJ 1E3PA 4RA2A 1HBXG 3MKWB 5HDGA 3GFLA 1IXRC 2Z9OA 1TWGJ 3OYLA 1UHSA 3H3ZA 1Y56A 3RTRA 2J5PA 5FD5A 3E6DA 1P9QC 3VYUB 2M1BA 3DLAA 3BJ6A 1ZAOA 3KLOA 1MH3A 4I7HA 2XSDC 5EEHA 2KP6A 1R22A 5LGUA 3L9FA 3Q0UA 5LHIA 2XIGA 5TRDA 2VE9A 2FNPA 4LLGF 2KL4A 3WTVC 4KIGA 1YS7A 3O8GA 1JT0A 3PFYA 2LBFA 2BY3A 4DOZA 1ZGAA 5F6FA 2RDPA 1X2NA 3HOTA 3GTGJ 4X6AJ 4KNYA 4UY8I 1RUOA 1S29A 3OMYA 1BC8C 1C0WA 4MGRA 2ID6A 3NAUA 2LDUA 4XIDA 3EETA 1X1CA 2XPUA 2EV0A 5FRMA 2WTEA 4LMYA 4BBSJ 1I3AA 3QPTA 2P6TA 2XAFA 3B73A 2LBFB 5FLVA 3MMYB 5F08A 5TJJA 2J5OA 4BH9A 4BKXA 4S05A 1J9IA 1YTYA 3W2AA 1KQ0A 1MSFC 4MHGA 2DW4A 2V1DA 3CO7C 3BPVA 1Z3YA 2DDBA 2Q0OA 2P7VB 3ELKA 3K69A 1JKOC 4C2UA 3BR6A 3E6CC 3HC7A 2B7EA 1D5YA 1VQ4I 2GWRA 2IA2A 4ZDPA 2RN7A 3W2VA 3CMYA 3L2UA 3VDXA 2MLGA 2ZSHB 2EB7A 2QKMB 3V8JA 3ML6A 3H9JA 3HJEA 4IPAA 1OMIA 3I5UA 4B43A 3OS0A 4A3FJ 1XTAA 2AQEA 1D0ZA 2CS3A 1MMNA 2HZTA 4PGGA 3AKZA 3FIWA 1FC3A 3FDYA 2QWWA 5E1WA 2FEZA 1DP7P 2MD5A 2Z2SB 2XF5A 3OYKA 2GQQA 3KE2A 3EUHC 3DEEA 3VB2A 4CXFA 3FK7A 5C4XJ 4XKWA 1GXQA 3C18A 2UUZA 2BY2A 4B09A 4XKVA 3HRSA 1ZQ3P 3GBGA 3VSLA 2LY1A 2X6XA 4IRHA 2LF7A 2DU9A 5CVJA 1PJRA 2A6EF 2L2OA 3GW2A 3H92A 3BOQA 2VT3A 1M1EB 1YW7A 4J00A 1FT9A 1IJWC 3VYSB 1BI1A 3G73A 5E3MA 1P7JA 3MZYA 4FETA 1EH7A 1PP8F 5EGOA 2PMZN 3FMQA 1TWAJ 4CA0A 4CCJA 3OYNA 5K5OA 2ZJPF 4PJLA 1R6RA 5F27A 4G9YA 2HNHA 2HEOA 1BI3A 2ZXHA 2FOKA 4A0ZA 1I6XA 4PUSA 3JR9A 4L0YB 5HS9A 4U7BA 3M8FA 5M5XJ 5EGOB 1TP4A 4OWRB 1ZR4A 3ERMA 4M9ZA 3F72A 2R7WA 4ITVA 2CO5A 4GGGA 4YIFA 1UB9A 3ZQFA 3G71I 4S0HB 2JN6A 1ZG5A 5HNHA 4G8XA 4GCVA 4YEJA 4BEHA 2NXNB 2UZKA 5LLQA 2PLYA 2KZGA 2DMQA 4PFPA 5E20A 2H8WA 2EFWA 4IXAA 3SZPA 3TO9A 4C3HJ 2ID3A 3AG1H 1EV7A 1I5ZA 1QRYA 3FKJA 3GUDA 3NWSA 4HDUA 2FUG2 3DV8A 2LMDA 1XSXA 3L7WA 3Q9VA 3WG9A 1YW9A 3S1RJ 4M71A 4BEHB 4NBQA 2PMHA 4RB1A 3JRFA 3L2VA 5J1YA 1B1BA 2YU3A 2L4AA 3K0LA 4DZPA 4BGDA 5EF6A 3EDPA 1SMTA 1WJBA 2FQ4A 1UG2A 1Y1VJ 3BG9A 2HYFA 3J7ZI 3H5AA 1XN7A 5J1UA 3KYLA 2W24A 5D4RA 2V1XA 4JQFA 4BXUA 4KFCA 5F0HA 4ZJZA 2PN6A 2DFEA 3BT9A 4M6YA 2M8EA 1NG7A 1X2MA 2W4SA 4IHVA 5FRNA 4Q48A 3CP2A 5HVQC 2O9LA 4HX4A 2HPMA 2ECBA 2QM3A 5D5UB 2DFFA 3B6AA 4AYBN 3GTJJ 2EH3A 1Y8RB 5FKOA 2ZB9A 5EDNA 3JRAA 3HSFA 1XX5A 1O3QA 3K10A 5JLWA 2PMZA 1Z9CA 2V1UA 4ENMA 1HSTA 1I1SA 3JTGA 2JRMA 1K6YA 4I76A 3OYDA 4PCQA 4I2OA 3LQRA 3KETA 5J40A 4UB6C 2GM4A 4CO8A 3MKLA 1TT0A 4A93J 4II3A 4UUTA 2K40A 5LRRA 2O0YA 4MEYF 3FKIJ 1RUNA 2NS8A 2E2JJ 3E5XA 4UB8C 2LR8A 5KCMA 5E3NA 1LB2A 2YX4A 3PUBA 3ZMTA 1G6NA 1W5SA 4AIDA 4P9UA 1TWHJ 3FK6A 3H35A 3V42A 3L2CA 4QPQA 2QYOA 2DYRH 3P9KA 3WGHA 4CGZA 4BY1J 2LH9A 3HSRA 3QOPA 3MZ8A 1GT0C 4EGZA 1MSEC 2MC4A 3GTOJ 3E3VA 2UXNA 3BG5A 4Q4ZF 4UVCA 4EV0A 2VJ4A 2W82A 1TT5B 1OCPA 2O7OA 4XLAA 5J8FA 4P96A 4PFOA 2G7UA 4NC7A 1N78A 2ZFWA 3DEUA 2DK5A 3PUFA 4XLCA 1X3ZB 2OV7A 5DD4A 1SFOJ 4IZZA 4L18B 3PSFA 1HLVA 2E1MC 2FMYA 3BY6A 2DXIA 4RDUA 1FNNA 1I27A 2W85A 1MH4A 2LD5A 3RZOJ 2FBIA 3HTUA 3S3NA 1KA8A 1SAXA 4RLFA 3KP3A 1FYMA 3PO3J 3SEZA 4JK1X 4HQMA 1YFHA 4ZDLA 1LJ9A 3WTTC 2IS4A 3JREA 3SYTA 2FA5A 1FEXA 4K2EA 1HF0A 3HXLA 2DCEA 5ERIA 3IRQA 4MLOA 2JWTA 3JAMZ 1TZLA 1Z0XA 4ASNA 1DU6A 3S2DJ 2D2WA 3QU3A 2RQQA 4AYBA 3DWLE 3KP7A 2K7LA 4AIHA 1JUPA 1GLNA 3BZ6A 4CCNA 3LSGA 3VOEA 3VWBA 3GFJA 5J3LA 4I6ZA 3M3YJ 3I59A 3J7YJ 1UG0A 3S1QJ 2HI3A 3CUQA 1XDSA 3WTZA 2VC0A 4G6TB 4XRSG 3I9V2 1ZKGA 2L5QA 1TL8A 3P7NA 2CFXA 5EG0A 4KUMA 2FXAA 3BP8A 2QSFX 5IP9J 4LLNA 3GTMJ 2XVCA 2X6YA 4AM3A 1BC7C 1B9NA 3I59B 3QAHA 3J80Z 4U0WA 2MA3A 2VKEA 1K79A 3CUQB 3FXMA 1U78A 5BQTA 2Y31A 4YFNF 3AL0B 4E7JA 3CC4I 4XOTA 1QPMA 2ISZA 1IXSB 3SFIA 4AUXA 4XORA 1ON1A 5LGTA 2IGKA 2R0QC 4O3MA 2VBYA 5F1JA 5EG0B 3JCUC 5LRSA 3ASOH 3GFIA 1HKQA 2CMPA 3IL2A 1J09A 2V26A 4XICA 1W0TA 2QQBA 5B1BH 2M4KA 1A6IA 5LEKA 5K1YA 4TV7A 2FBHA 2ZSIB 5B5EC 4KN4X 1R4MB 1FOYA 1KGSA 4N4OB 1JHFA 1YJNI 1W7PA 3GWZA 5ILVA 3BG6A 1PUFA 1V4RA 4AC0A 2JA8J 2XGXA 4O6JA 1DQUA 1ETWA 1FOKA 2M30A 1HCRA 1HKSA 2MD0A 2O6GE 4PGHA 4BE1A 1WZ2A 4C9YA 5JHFA 2H6CA 2ACJA 2LG4A 2OPTA 2M3AA 3J81Z 4ENNA 4BXFA 3S1MJ 1W7PB 4CSWA 4OMYA 3GLLA 1PUFB 3IH3A 3RPQA 3CLQA 2HYJA 1WH7A 2COMA 2XDVA 4FE4A 3QOEA 2KIQA 3DPLC 1R1VA 1SAUA 2VIXA 1MJ9A 1LFUP 2QENA 1MBJA 4GYIA 4UHTA 3TOAA 2G7HA 3JTHA 3TW7A 2K9NA 2G9WA 3IV5A 5IYCJ 4XLFA 2IPQX 2XRLA 2LY2A 4CICA 3CCVI 1R5ID 4CZCA 2ZJQF 1E3OC 3K4LA 2LLKA 4M9XA 4E7SA 5F64A 4FASD 2HOTA 4D7NA 2X6OA 2VKHA 2IRFG 1QA6A 1F1ZA 3NQOA 1Z6TA 2K9LA 3EPZA 3KP6A 2DFHA 2GIVA 2X48A 2RGVA 3FHZA 2EIKH 4M3GA 5HS8A 4RM3A 4B3XA 4HNUA 3OOUA 5F04A 1FSHA 5IP7J 2HR3A 4U0YA 1MBKA 4D5CA 1ON2A 3KLNA 2F5VA 3E6MA 3W6JB 3ABLH 3D5LA 3I0TA 4OIRF 3DTKA 1R1TA 4PJMA 2E1OA 2CUZA 3KIOA 2M7BA 4L9JA 5M3MJ 5A2QK 1QO0D 1RETA 2Y0SN 4WCGA 1SVLA 4BJTA 4JBAA 3VYRB 1SANA 3RKXA 1W36D 4IQJA 1BJAA 5J47A 2XPWA 1HW1A 1MD0A 1R5HA 4LB5A 2ESNA 3SXYA 2LTPA 1OLTA 4BHPA 2QGUA 2DPDA 3F8MA 2FRHA 5C3EJ 2DOFA 4BACA 2QQAA 1KU9A 3OS2A 1YLFA 3LSPA 1MBHA 5IT3A 3MWMA 5FFZA 4A3MJ 1Q1HA 1QNTA 5HLIA 2R7RA 4BHBA 3HHGA 4D0PA 1OYYA 2OBPA 4A69C 5E8GA 2NVXJ 2ELKA 4FT8A 2VKDA 2R5ZA 1ONVA 2GIZA 2A61A 3BPXA 1XGSA 3HKZN 2E1CA 5FLXZ 2E35A 3DBLB 3I56I 3HOUJ 3HOXJ 3MN2A 3LFKA 3T5XA 1W0UA 1HSJA 1JKRC 1Z21A 4IEJA 1HQCA 4EJVA 1LPQA 2R5ZB 2EZKA 2BHZA 3OIPA 3CJQB 1YJWI 1XD7A 3V8KA 1BOAA 4B8XA 5ILUA 2XAHA 4HBLA 5EEAA 2MG4A 4HYEA 2R7VA 4PZJA 2F5DA 3JRBA 4CHUA 2DYSH 1DUXC 3Q0WA 2HVRA 5L3GA 2CRGA 4LG3A 2NS0A 3ROUA 2OJED 4RGRA 3S17J 5D6FA 5E1XA 4OAZA 5EYRA 5E8IA 1DU0A 3AL0C 5DCMA 3SEQA 5K5QA 4M72A 5IY5H 2EZIA 4G7ZF 2VJIA 4HRIA 2V9VA 4XLHA 5BPDA 4RAFA 1VQPI 3J7AY 1T8IA 3A0BC 2OQRA 3WTWC 2Y0SA 1EKEA 1BR2A 2X1DA 3QPLA 5DCMB 2DA6A 5E79C 1BM9A 2Z33A 1OISA 1QVUA 3PQKA 4BQOA 5LHHA 3WODF 3CCYA 2EV5A 1U2WA 4OOIA 2BOLA 2GXGA 2ME6A 1GUUA 1NTCA 4LITA 1P2FA 2PEXA 3PL8A 3G3ZA 5ICGA 2BY0A 2NAZA 3GTQJ 3CCSI 2VPRA 4Y15A 3LA2A 3DPTA 4GRIA 1A35A 2RNGA 4P1WA 3FXUA 4G6QA 3C7JA 1R00A 1L0OC 1WJCA 2EIMH 4G12A 5CQEA 5ILSA 1W5CC 2M2EA 2STWA 1ZRCA 1Z7LA 2Y9YA 2FD5A 4I09A 5GPCA 2DA3A 3MFKA 1LDJA 4GYGA 3TW6A 2H1KA 1XMAA 3HKZA 4E7HA 4ENJA 4P55A 2PFBA 3DP7A 2EFOA 1BR1A 3KZZA 1SC7A 4DBQA 4BJ5C 3RI4A 2Y2ZA 3OSGA 1FLIA 1T08B 3WU1B 1N75A 3BWGA 3CF2A 1SD4A 5HDNA 5CKTA 4HOBA 2XF6A 3P5JA 3LL7A 4MEXF 2MH9A 2L01A 1R49A 5CVUA 1Y0UA 2V9PA 2XAJA 2GOXB 5CVVA 3IH2A 4F55A 1LDDA 3O2PE 3S3MA 1POGA 4CCKA 5DUIA 2LYCA 2W1OA 1QZYA 2IBDA 3FXOA 2O61A 3PO2J 2KDZA 1ZRDA 2V7FA 2OQGA 2V6EA 1T39A 3GVAA 3CZ6A 1YITI 4HQEA 5CPRB 3F9KA 4ZZDA 1LEBA 1S5LC 1ETYA 2X1EA 5IT9Z 1AU7A 1G3WA 2JVHA 2NOJB 2RNJA 4MQ9F 3GX4X 2Y69H 1Q1VA 2ECCA 3TOBA 4C3JJ 3QODA 5E1ZB 1O3SA 2XGEA 4R1HA 4RGSA 3ZQCA 2DQLA 3GFMA 2LOOA 1D0XA 3I4PA 5L3EA 1U8RA 2NRAC 2BXYA 4YG2F 3FZVA 4HF0A 1TTYA 1USTA 3PSIA 2VN2A 3W2WA 5EJCA 5M5WJ 2QQ9A 2HXOA 5FO5A 2Z5UA 2WAEA 2MLKA 1RC9A 2E5ZA 1W1WE 3LWFA 5FKNA 1IAWA 2WAQN 2EILH 4EVIA 2A5WA 4ESBA 2CQNA 5HS7A 2PX9A 3BG7A 1LUJB 1PUEE 2Z16A 1PYVA 4E70A 1ETOA 3UKGA 1JTYA 1IUYA 4PJJA 1YE9A 2ZO4A 2Q1ZB 4MIMA 2HQ5A 3P9IA 4I99C 3DLLF 4S04A 5B3SH 2A68F 3A1YA 2Z1DA 3LA3A 4Y3OA 4BJ6C 3CP8A 2NOGA 3R60A 4WXDA 2TDXA 2HZDA 1CF7A 4P9FA 3K2AA 1Y39A 1NK3P 5LD2C 4L5EA 4WWCA 4ZDOA 1J7KA 3CDIA 2KFDA 1QZZA 1KU3A 3I71A 3QQAA 4F3QA 2E1MB 2A07F 1LNWA 3WE3A 3U9GA 4BQAA 1L3LA 1CF7B 4CCLA 1UAAA 1I3QJ 1ZN2A 4FX0A 2ZMEA 2VQGA 1S7OA 4D7MA 2MGQA 3FXJA 3WU2C 4AIJA 3OYFA 4A3BJ 3I4MJ 5EZHA 3F21A 2LVSA 2DT6A 2Y48A 1D8KA 1A6QA 2HTJA 3FF5A 2JZYA 1P92A 4R79A 1TQPA 2DA5A 3B02A 1TC3C 3GZ6A 3S2HJ 4BQQA 2DMTA 2O3FA 2ZMEB 1IC8A 1G8XA 5TGTA 5F1RA 1JGGA 1V54H 2BZTA 2IS2A 5D5WB 2C6YA 3K1NA 2X9DA 2NVQJ 1D1AA 2QKLB 3RQ4A 2EINH 3FM5A 1V5EA 1STZA 2FNAA 3E6BA 4IHTA 1I50J 1FYKA 3V7CA 2BV6A 2IW5A 4ON0A 2R3SA 4HG2A 4JX4A 3WU0A 2E5NA 2R7OA 3F0CA 4ENKA 2WAQA 1ORKA 1W4MA 3HPHA 2DLLA 3H1CA 1IGNA 1GVDA 1MJAA 2P0WA 1BBYA 1FOXA 3F23A 3N97A 5D5XB 2MC3A 1N25A 3K4BA 2VONA 3KZIC 2AXTC 2DT5A 1IRXA 5EZGA 5DEQA 1VQNI 2R93J 3A03A 3F6OA 4N0BA 2A6HF 4FQGA 3DFGA 4A3KJ 1X3WB 1WJFA 4YIIA 2P5LC 2Q2EA 2NYXA 1TNTA 1GV5A 1V5FA 1SFXA 2B63J 1WI3A 4UUSA 1SD5A 5C44J 3RJPA 2XB0X 1QHHD 1WJDA 1JXSA 1WJEA 2NNNA 3VFZA 2L7KA 1FY7A 2DFIA 5K7HA 4FCYA 5DDGA 4HV6A 3FXKA 4UV8A 2Q2EB 2JJ7A 5IYDJ 2HXIA 5FB2A 3OYIA 3LNQA 5D6EA 4IX7A 1P4WA 3BC8A 4UUSB 5ICEA 2CW8A 1B4AA 2VI6A 2V9KA 1MGTA 2AQFA 4HX8A 3OY9A 3GLXA 2CFOA 3OYMA 2DN0A 3QYFA 1HW5A 1K78A 3AAFA 1S9HA 1XCBA 3RKYA 4HLXA 3O8HA 4C2TA 4A5MA 4IHSA 3HRTA 2AXLA 2VKVA 3AFHA 4XQFA 2P8TA 4U88A 5HOOA 3HPGA 1XS9A 1K78B 3AG4H 3PJRA 4X1EA 4RBOA 2K02A 1X58A 1A04A 1IN7A 3G1OA 2M5WA 1OCCH 1EA3A 4IJAA 3Q5FA 1MBGA 3TGNA 3LSIA 4L9NA 3CCJI 1IW7F 2EFPA 1JJ6C 1HKTA 2YX7A 1Z77A 3F3XA 3FISA 3PFIA 4DYRA 2KT0A 2G0EA 2HWVA 1YHQI 1BOBA 2IP2A 4A2UA 5FROA 4YRVA 2PJRA 1YX5A 5HODA 3IRRA 4NC8A 4RB3C 2IS1A 3CCRI 4RAGA 3HM5A 2DO7A 4XRSA 4DIQA 4EJWA 2VQCA 5DYMA 1IXCA 1RKTA 1WJAA 4M6VA 2XF7A 1X1PA 4YELA 3ZMZA 3KCCA 3REOA 5DS9A 2R7DA 1FSEA 3M9AA 2KIMA 4OIQF 2IGMA 3TDZC 2ESHA 3MKYB 2PJRB 2LNBA 1KZHA 3MZHA 4MTEA 4M3BA 3WTYC 2CYYA 4KMUX 2HPIA 4X0GA 1X4OA 1LVAA 1UJ8A 2HGCA 2KLOA 3G1MA 3L1PA 3N4MA 4MFEA 4RGUA 1FBSA 4BBRJ 4F52A 1JTXA 3RPUD 2NNYA 2F4OB 4JYKA 3HRUA 3QU6A 2E7WA 1EH8A 2O8XA 2XPVA 3BTLA 1ULYA 1JI8A 1SFEA 3K9TA 1RR7A 1S72I 3SQNA 4EGYA 3DEWA 3PNTA 3KPHA 4HX7A 1TQIA 3CC2I 3CDLA 3EUKL 3D5SC 3KYDB 3K4JA 3TEDA 2GBYA 3CESA 1QHGA 2M0MA 4RGXA 3SDGA 1IRGA 1BI0A 2LFBA 3ZPLA 1U5TC 2FOWA 4BE2A 2O8KA 3C2HA 4BXXJ 1W5TA 5CQGA 2RREA 1FIAA 2H1LA 2NVTJ 2ZMEC 2JUCA 2X85A 1DPRA 1X4PA 1FIPA 1DPUA 4E7IA 3DU5A 2JSCA 3M8EA 1D1CA 5BPIA 4F7ZA 4BDYA 4YIRX 2XKOA 3S8PA 2B9SA 2KQRA 1MBEA 1Y0NA 2M87A 3WTXC 3H0DA 4NC6A 4FTHA 4B44A 1I6HJ 4A0YA 2JA5J 3MVPA 4WK8F 2H09A 1ZG1A 3S16J 3H36A 3G1LA 4W1UA 3F6VA 3WTUC 4ZYAA 3OYHA 1TW3A 1Y6IA 2QF7A 2H27A 1V3FA 3SFZA 2M0CA 3PNYA 3J7AO 3BZCA 3CTAA 2Q8KA 3I4NJ 5FKLA 3D0SA 2QLZA 2HU9A 4V2GA 2E1NA 1LFBA 1SD6A 1P6RA 3T8TA 1KYZA 5HDKA 1LE8A 2ICWG 1T95A 3F8CA 4AD9A 3CCUI 4DQ2A 4EQQA 2K9SA 2YUSA 3ZCOA 2ZCWA 1D3YA 3ZQLA 4A3EJ 1XGMA 5HLGA 5DUKA 4HSTA 1F4KA 3CLOA 2BGCA 3QWLA 4RLQA 3ZN1A 3IAM2 3NRVA 5K5RA 3I64A 2W84A 4BU2A 2D1HA 3OYCA 1LE8B 1MMSA 3BR3A 3ZOBA 3JAMK 5E3OA 1FMVA 2OUMA 5GAEJ 2HVQA 4M3DA 5JI6A 3M8JA 4EMSA 1XB4A 2QCOA 1X3UA 1ZARA 1J59A 1MMGA 4RAYA 3WHCA 2JPBA 2ME0A 1FBUA 4DYQA 2R7XA 1B9MA 1LVKA 3ECHA 3DPUA 4WXCA 4B1RA 4KA4A 2PG4A 2RVCA 1W36C 3KZYA 3HOYJ 4KITB 5TISC 3LSJA 1HXDA 4LJZF 3ABMH 2L0KA 2QQ8A 3KFWX 1IRZA 2XB5A 5J4VA 5FGMA 3J80K 1I1GA 1WVRA 4XR6A 4Y17A 4DW6A 2EJRA 2GXBA 1MBFA 1YQAA 3RYRA 2Y30A 3ZQGA 3ZRGA 2CUJA 2EPFA 2OCCH 4QPOA 2HDWA 2YS9A 4QWQA 2V79A 3ABKH 1JUSA 1JT6A 3C3WA 1U0JA 1ZTRA 2WV0A 1GV2A 4A6DA 1HOMA 3A0HC 3K70D 1G3YA 5KVRA 2QBYA 1X1DA 2BW3A 3QPSA 4OIPF 3RIRA 3HRMA 2FBKA 4BY7J 2OZ6A 2M7AA 2DA2A 4XBFA 1MNEA 4ZH4F 3ABUA 3HDDA 2V4JC 1IO2A 1VF9A 1R1UA 3ESWB 1FMWA 2CUEA 2QBYB 2VJ5A 5H6QA 4IRIA 3HOVJ 2BW3B 1DDNA 5KK1A 3QP5A 5BS6A 2D1VA 3SZGA 4D5FA 5HLHA 3J81K 4I01A 4HV5A 2NVUB 3TMOA 2WB1N 2P5KA 2DBBA 2AHQA 1BN5A 4KYWA 4II2A 3ERED 2JA6J 2ETHA 5K7ZA 2OD5A 3CMAI 1IF1A 4RAZA 1VZ0A 3PM1A 4AWXB 5BOXA 2XSJC 4HF2A 2L54A 4ESFA 2NVYJ 2LY9A 3TP0A 2WV1A 4LIVA 2CQXA 2HOAA 2LKSA 5KHDA 1XG1A 1J0RA 2CW7A 4IOAF 3I53A 4WF2A 2JT1A 5FKKA 1IG7A 1GHCA 3ZGKA 1IN6A 5ICFA 3LFUA 5DM7F 2XGDA 3BJOA 1NK2P 4RM2A 4ANJA 1ZGWA 3W6VA 1B59A 2OCEA 3SDBA 2QSGX 5L3BA 2LF8A 4XKCA 5JLXA 4E6KG 5JVTA 1WKMA 3WTSC 3CF5F 2F2EA 2KRFA 4NQWA 1TW2A 2BVMA 3LSHA 3Q9SA 2A5YB 5E18F 1IRFA 1J5YA 1A36A 2EZLA 4MQVA 4CYDA 3GF2A 2X4HA 4UVBA 3I58A 1ZK8A 2L9SA 4DNCA 2UWMA 3U21A 4PSXA 4RB2C 2EIJH 4NQWB 1KU7A 4N9HA 2CG4A 4Y13A 1FTTA 1OYIA 3TQNA 1VQ6I 3I55I 2DA7A 3ZMUA 4A3CJ 4XM3A 2I8DA 1U9OA 2KPMA 2HDDA 4A3GJ 1U6GA 2L9VA 3FMRA 2DMUA 3GXOA 3M1EA 2JUGA 3MQ0A 1H0MA 1X19A 2K27A 3IWZA 1ITYA 2DJNA 5F0CA 5J4YA 4D1QA 5CVRA 4XMYA 1ACIA 2CV0A 2ZXJA 1F9NA 4IQ4A 4HW0A 2ZNZA 3RYPA 1IDYA 1R7JA 2VQLA 4WXHA 5KNLA 1HDPA 3BJAA 1VQOI 1YJ9I 4XLEA 3GYHX 4JX6A 2YSRA 4XLPF
chains in the Genus database with same CATH topology
1NK3P 4I76A 4L5EA 1K61A 5BNGA 2EZHA 4XK4A 2GM4A 2L7FP 3QQAA 2CJJA 3MKLA 3HGGA 3BTIA 1JUMA 2GLOA 4A93J 3C2BA 4UUTA 2TRTA 4EEFG 2K40A 4DYCA 3FKIJ 2R7ZJ 1I3QJ 2IEKA 2NS8A 2E2JJ 3HOWJ 2LR8A 4D7MA 3A02A 5E3NA 3WHBA 2MGQA 5M5YJ 1IUFA 4MFDA 1TWHJ 3FK6A 4A3BJ 1K83J 1RPWA 3I4MJ 5EZHA 3M4OJ 2LVSA 2L7ZA 4BY1J 2DMPA 2CUFA 1GT0C 1MSEC 3GTOJ 4JP0A 2DA5A 1OFCX 3BG5A 1JKQC 1TC3C 3S2HJ 1ENHA 1XC5A 2DMTA 1IC8A 1JGGA 2LKXA 2TCTA 1OCPA 2O7OA 1ETXA 5DTDA 2X9DA 2NVQJ 2HOSA 2RAEA 1JJ8C 4IHXA 3NARA 1ETVA 2Y9ZA 2YU9J 1SFOJ 4GFBA 1HLVA 1F36A 1I50J 4A3JJ 4RDUA 5IYBJ 2R92J 1GDTA 1MH4A 2M9HA 2LD5A 3RZOJ 1OCTC 4JX4A 5IP6A 4C2MJ 4CYCA 3BTCA 3F0CA 3PO3J 1ORKA 2E19A 4B3AA 5IOYA 1BL0A 1IGNA 3D1NI 1GVDA 3JREA 1FEXA 5F0FA 1HF0A 5FLMJ 1ETQA 4IHYA 4MLOA 2JWTA 1Z0XA 4CYCB 5C4JJ 3S2DJ 1TWCJ 5EZGA 1DU6A 2R93J 3A03A 1ZR2A 4A3KJ 1JUPA 3HEFA 4QSHA 1GV5A 3LSGA 2B63J 5J3LA 4I6ZA 3M3YJ 1WI3A 3S1QJ 2HI3A 4UUSA 5C44J 2R5YA 3JRIA 4XRSG 2XB0X 1ZKGA 4M3EA 3TP3A 3H0GJ 5EG0A 1QPIA 4FCYA 5K7HA 1H89C 1WPKA 3JRDA 1AHDP 5IP9J 2JJ7A 3GTMJ 2HXIA 5IYDJ 2XGCA 3LNQA 2M34A 3B6CA 4UUSB 2VKEA 1U78A 2Y31A 2R5YB 2W48A 2VUMJ 3SFIA 2VI6A 4AUXA 5K7FA 2R0QC 3VPRA 5F1JA 5EG0B 2L7MP 2DN0A 1U9NA 3LOCA 4XICA 3O8HA 1W0TA 1H88C 1A6IA 1WGXA 1P7IA 2VKVA 1XS9A 1R9TJ 3DCFA 3HOZJ 1A5JA 4X1EA 4RBOA 4A3IJ 1X58A 3G1OA 4W97A 1PUFA 4AC0A 2JA8J 3BQYA 1ETWA 2D5VA 1MBGA 1HCRA 1BJZA 4Y7NJ 3OIOA 1YRNA 1JJ6C 1ETKA 1Z77A 4DYRA 3FISA 2KT0A 2G0EA 1WCMJ 2OPTA 1JKPC 3S1MJ 4FE7A 3BR5A 2FX0A 1PUFB 3JRGA 3IH3A 5HODA 2H8RA 2HYJA 1WH7A 1B8IA 3HM5A 3E7LA 5E3LA 4XRSA 4FE4A 1UMQA 1YRNB 1RKTA 4XRMA 1BW5A 4M6VA 5DS9A 3H3VK 1LFUP 4M3FA 2L9RA 1MBJA 4J19A 5IPAA 2COBA 3TW7A 2K9NA 4MO7A 3IV5A 5IYCJ 2XRLA 3BTJA 1B8IB 4M3BA 1B72A 3Q3SA 2JK3A 5GPAA 1MNMC 1E3OC 3ZQIA 2LLKA 1IDZA 3G1MA 3L1PA 2HOTA 4MFEA 4D7NA 2MSYA 2X6OA 4BBRJ 3GTLJ 4A3DJ 2OF7A 2AO9A 1S7EA 1B72B 2X48A 1JTXA 4Y52J 4JYKA 1RKWA 4M3GA 5GP9A 2I10A 1BW6A 2XPVA 3HB9A 3OOUA 3BTLA 5F04A 5IP7J 4QTRA 3BR1A 4QIWN 1RR7A 1MBKA 4D5CA 3ZQHA 3DEWA 3CDLA 2DA4A 3S14J 4FISA 2M8GX 1T33A 3TEDA 3HBLA 2GBYA 3SDGA 2LFBA 2E1OA 2E2HJ 2O8KA 3RQIA 1U8BA 4BXXJ 1APLC 1FIAA 2NVTJ 5M3MJ 1F43A 3BG3A 1RETA 3K7AJ 4IHWA 1FIPA 2Y0SN 1BA5A 3JRCA 1SANA 3S15J 2XPWA 4C3IJ 1MBEA 1TWFJ 4FTHA 2LTPA 1TWGJ 1I6HJ 1UHSA 3A01A 5C3EJ 2JA5J 3MVPA 2DA1A 5IOZA 3S16J 3LSPA 1MBHA 2JMWA 1MH3A 3S1NJ 3G1LA 2XSDC 4W1UA 4A3MJ 2QF7A 3Q0UA 2M0CA 4A69C 2NVXJ 2ELKA 3I4NJ 5FKLA 2DTZA 3A01B 2R5ZA 4V2GA 3SJMA 1VFCA 3HKZN 1LFBA 1LE8A 3O8GA 1JT0A 3HOUJ 3HOXJ 3MN2A 2K9SA 1W0UA 2YUSA 1JKRC 1X2NA 3ZQLA 3GTGJ 4A3EJ 4IEJA 4X6AJ 1AKHA 1O4XA 2R5ZB 2EZKA 5M3FJ 2ID6A 3NAUA 1LE8B 4XIDA 2XPUA 3BR3A 3ZOBA 4BBSJ 5EEAA 5E3OA 2MG4A 2JA7J 5FLVA 4M3DA 5F08A 3JRBA 1AKHB 2QCOA 3Q0WA 4BKXA 2CRGA 3WHCA 1MSFC 3S17J 2ME0A 4DYQA 5EYRA 1DU0A 4JX5A 2EQRA 1JKOC 1VI0A 3BR6A 2EZIA 2N8GA 1D5YA 4B1RA 3CMYA 3BR0A 3HOYJ 3LSJA 1QVTA 2L0KA 1IRZA 2XB5A 4A3FJ 4LOCA 2CU7A 3QPLA 2DA6A 1RESA 3FIWA 4DW6A 1IV6A 1VNDA 1QVUA 2IAIA 1MBFA 1T56A 3CCYA 2Y30A 3ZQGA 2ME6A 1GUUA 1NTCA 2YS9A 3FK7A 1OJLA 5C4XJ 3GTQJ 1JUSA 4A3LJ 3LSRA 2VPRA 1JT6A 1ZTRA 3HGYA 1GV2A 1HOMA 3JRHA 3RKQA 1ZQ3P 3GBGA 4G12A 2M2EA 3QPSA 2E2IJ 2Y9YA 2FD5A 4BY7J 3BQZA 2DA3A 2DA2A 5GPCA 1IJWC 3TW6A 2H1KA 3HDDA 2MW8A 5E3MA 1P7JA 1VF9A 2CUEA 1FTZA 5EGOA 2DMNA 2PMZN 2Y2ZA 4B4CA 3OSGA 1H8AC 1TWAJ 3HOVJ 4D5FA 5F27A 2WB1N 2AHQA 2JA6J 5K7ZA 3GTPJ 5J1RA 3PM1A 3JR9A 1FJLA 1Y1WJ 3IH2A 2NVYJ 2LY9A 3TP0A 1WH5A 2WV1A 5M5XJ 5EGOB 2CQXA 2HOAA 1POGA 1ZR4A 2IBDA 3PO2J 2KDZA 1XG1A 2FJ1A 5FKKA 1IG7A 3ZQFA 4S0HB 2JN6A 4DZJA 2EBIA 2XGDA 3CQZJ 1NK2P 3BR2A 1ZGWA 3W6VA 3Q0VA 1ETYA 2DMQA 1AU7A 4HNVA 5JLXA 1CQTA 3GTKJ 4C3HJ 2ID3A 4ABZA 3RZDJ 1Q1VA 1QRYA 2ECCA 4C3JJ 1EF4A 2XGEA 3ZQCA 2EZLA 1HDDC 3S1RJ 1ZK8A 3JRFA 5J1YA 9ANTA 4DZPA 5M5WJ 5EF6A 2HXOA 2FQ4A 1UG2A 1Y1VJ 3BG9A 1FTTA 5J1UA 5FKNA 2DA7A 2WAQN 4A3CJ 2NS7A 3OSFA 1U9OA 4A3GJ 2HDDA 5F0HA 2LP0A 2DMUA 3BT9A 1X2MA 1G2HA 4IHVA 2K9QA 1ITYA 3UKGA 1ETOA 2O9LA 1JTYA 2DJNA 5F0CA 2ECBA 4MIMA 5FKMA 2HQ5A 4V2FA 3B6AA 1IDYA 4AYBN 5FJ8J 3GTJJ 2EH3A 5FKOA 1HDPA 2CQQA 2ZB9A 5EDNA 3JRAA 4NDLA 2NOGA 2P81A 3IH4A 5JLWA 2LK2A 4JX6A 3K2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK3 P;  4I76 A;  4L5E A;  1K61 A;  5BNG A;  2EZH A;  4XK4 A;  2GM4 A;  2L7F P;  3QQA A;  2CJJ A;  3MKL A;  3HGG A;  3BTI A;  1JUM A;  2GLO A;  4A93 J;  3C2B A;  4UUT A;  2TRT A;  4EEF G;  2K40 A;  4DYC A;  3FKI J;  2R7Z J;  1I3Q J;  2IEK A;  2NS8 A;  2E2J J;  3HOW J;  2LR8 A;  4D7M A;  3A02 A;  5E3N A;  3WHB A;  2MGQ A;  5M5Y J;  1IUF A;  4MFD A;  1TWH J;  3FK6 A;  4A3B J;  1K83 J;  1RPW A;  3I4M J;  5EZH A;  3M4O J;  2LVS A;  2L7Z A;  4BY1 J;  2DMP A;  2CUF A;  1GT0 C;  1MSE C;  3GTO J;  4JP0 A;  2DA5 A;  1OFC X;  3BG5 A;  1JKQ C;  1TC3 C;  3S2H J;  1ENH A;  1XC5 A;  2DMT A;  1IC8 A;  1JGG A;  2LKX A;  2TCT A;  1OCP A;  2O7O A;  1ETX A;  5DTD A;  2X9D A;  2NVQ J;  2HOS A;  2RAE A;  1JJ8 C;  4IHX A;  3NAR A;  1ETV A;  2Y9Z A;  2YU9 J;  1SFO J;  4GFB A;  1HLV A;  1F36 A;  1I50 J;  4A3J J;  4RDU A;  5IYB J;  2R92 J;  1GDT A;  1MH4 A;  2M9H A;  2LD5 A;  3RZO J;  1OCT C;  4JX4 A;  5IP6 A;  4C2M J;  4CYC A;  3BTC A;  3F0C A;  3PO3 J;  1ORK A;  2E19 A;  4B3A A;  5IOY A;  1BL0 A;  1IGN A;  3D1N I;  1GVD A;  3JRE A;  1FEX A;  5F0F A;  1HF0 A;  5FLM J;  1ETQ A;  4IHY A;  4MLO A;  2JWT A;  1Z0X A;  4CYC B;  5C4J J;  3S2D J;  1TWC J;  5EZG A;  1DU6 A;  2R93 J;  3A03 A;  1ZR2 A;  4A3K J;  1JUP A;  3HEF A;  4QSH A;  1GV5 A;  3LSG A;  2B63 J;  5J3L A;  4I6Z A;  3M3Y J;  1WI3 A;  3S1Q J;  2HI3 A;  4UUS A;  5C44 J;  2R5Y A;  3JRI A;  4XRS G;  2XB0 X;  1ZKG A;  4M3E A;  3TP3 A;  3H0G J;  5EG0 A;  1QPI A;  4FCY A;  5K7H A;  1H89 C;  1WPK A;  3JRD A;  1AHD P;  5IP9 J;  2JJ7 A;  3GTM J;  2HXI A;  5IYD J;  2XGC A;  3LNQ A;  2M34 A;  3B6C A;  4UUS B;  2VKE A;  1U78 A;  2Y31 A;  2R5Y B;  2W48 A;  2VUM J;  3SFI A;  2VI6 A;  4AUX A;  5K7F A;  2R0Q C;  3VPR A;  5F1J A;  5EG0 B;  2L7M P;  2DN0 A;  1U9N A;  3LOC A;  4XIC A;  3O8H A;  1W0T A;  1H88 C;  1A6I A;  1WGX A;  1P7I A;  2VKV A;  1XS9 A;  1R9T J;  3DCF A;  3HOZ J;  1A5J A;  4X1E A;  4RBO A;  4A3I J;  1X58 A;  3G1O A;  4W97 A;  1PUF A;  4AC0 A;  2JA8 J;  3BQY A;  1ETW A;  2D5V A;  1MBG A;  1HCR A;  1BJZ A;  4Y7N J;  3OIO A;  1YRN A;  1JJ6 C;  1ETK A;  1Z77 A;  4DYR A;  3FIS A;  2KT0 A;  2G0E A;  1WCM J;  2OPT A;  1JKP C;  3S1M J;  4FE7 A;  3BR5 A;  2FX0 A;  1PUF B;  3JRG A;  3IH3 A;  5HOD A;  2H8R A;  2HYJ A;  1WH7 A;  1B8I A;  3HM5 A;  3E7L A;  5E3L A;  4XRS A;  4FE4 A;  1UMQ A;  1YRN B;  1RKT A;  4XRM A;  1BW5 A;  4M6V A;  5DS9 A;  3H3V K;  1LFU P;  4M3F A;  2L9R A;  1MBJ A;  4J19 A;  5IPA A;  2COB A;  3TW7 A;  2K9N A;  4MO7 A;  3IV5 A;  5IYC J;  2XRL A;  3BTJ A;  1B8I B;  4M3B A;  1B72 A;  3Q3S A;  2JK3 A;  5GPA A;  1MNM C;  1E3O C;  3ZQI A;  2LLK A;  1IDZ A;  3G1M A;  3L1P A;  2HOT A;  4MFE A;  4D7N A;  2MSY A;  2X6O A;  4BBR J;  3GTL J;  4A3D J;  2OF7 A;  2AO9 A;  1S7E A;  1B72 B;  2X48 A;  1JTX A;  4Y52 J;  4JYK A;  1RKW A;  4M3G A;  5GP9 A;  2I10 A;  1BW6 A;  2XPV A;  3HB9 A;  3OOU A;  3BTL A;  5F04 A;  5IP7 J;  4QTR A;  3BR1 A;  4QIW N;  1RR7 A;  1MBK A;  4D5C A;  3ZQH A;  3DEW A;  3CDL A;  2DA4 A;  3S14 J;  4FIS A;  2M8G X;  1T33 A;  3TED A;  3HBL A;  2GBY A;  3SDG A;  2LFB A;  2E1O A;  2E2H J;  2O8K A;  3RQI A;  1U8B A;  4BXX J;  1APL C;  1FIA A;  2NVT J;  5M3M J;  1F43 A;  3BG3 A;  1RET A;  3K7A J;  4IHW A;  1FIP A;  2Y0S N;  1BA5 A;  3JRC A;  1SAN A;  3S15 J;  2XPW A;  4C3I J;  1MBE A;  1TWF J;  4FTH A;  2LTP A;  1TWG J;  1I6H J;  1UHS A;  3A01 A;  5C3E J;  2JA5 J;  3MVP A;  2DA1 A;  5IOZ A;  3S16 J;  3LSP A;  1MBH A;  2JMW A;  1MH3 A;  3S1N J;  3G1L A;  2XSD C;  4W1U A;  4A3M J;  2QF7 A;  3Q0U A;  2M0C A;  4A69 C;  2NVX J;  2ELK A;  3I4N J;  5FKL A;  2DTZ A;  3A01 B;  2R5Z A;  4V2G A;  3SJM A;  1VFC A;  3HKZ N;  1LFB A;  1LE8 A;  3O8G A;  1JT0 A;  3HOU J;  3HOX J;  3MN2 A;  2K9S A;  1W0U A;  2YUS A;  1JKR C;  1X2N A;  3ZQL A;  3GTG J;  4A3E J;  4IEJ A;  4X6A J;  1AKH A;  1O4X A;  2R5Z B;  2EZK A;  5M3F J;  2ID6 A;  3NAU A;  1LE8 B;  4XID A;  2XPU A;  3BR3 A;  3ZOB A;  4BBS J;  5EEA A;  5E3O A;  2MG4 A;  2JA7 J;  5FLV A;  4M3D A;  5F08 A;  3JRB A;  1AKH B;  2QCO A;  3Q0W A;  4BKX A;  2CRG A;  3WHC A;  1MSF C;  3S17 J;  2ME0 A;  4DYQ A;  5EYR A;  1DU0 A;  4JX5 A;  2EQR A;  1JKO C;  1VI0 A;  3BR6 A;  2EZI A;  2N8G A;  1D5Y A;  4B1R A;  3CMY A;  3BR0 A;  3HOY J;  3LSJ A;  1QVT A;  2L0K A;  1IRZ A;  2XB5 A;  4A3F J;  4LOC A;  2CU7 A;  3QPL A;  2DA6 A;  1RES A;  3FIW A;  4DW6 A;  1IV6 A;  1VND A;  1QVU A;  2IAI A;  1MBF A;  1T56 A;  3CCY A;  2Y30 A;  3ZQG A;  2ME6 A;  1GUU A;  1NTC A;  2YS9 A;  3FK7 A;  1OJL A;  5C4X J;  3GTQ J;  1JUS A;  4A3L J;  3LSR A;  2VPR A;  1JT6 A;  1ZTR A;  3HGY A;  1GV2 A;  1HOM A;  3JRH A;  3RKQ A;  1ZQ3 P;  3GBG A;  4G12 A;  2M2E A;  3QPS A;  2E2I J;  2Y9Y A;  2FD5 A;  4BY7 J;  3BQZ A;  2DA3 A;  2DA2 A;  5GPC A;  1IJW C;  3TW6 A;  2H1K A;  3HDD A;  2MW8 A;  5E3M A;  1P7J A;  1VF9 A;  2CUE A;  1FTZ A;  5EGO A;  2DMN A;  2PMZ N;  2Y2Z A;  4B4C A;  3OSG A;  1H8A C;  1TWA J;  3HOV J;  4D5F A;  5F27 A;  2WB1 N;  2AHQ A;  2JA6 J;  5K7Z A;  3GTP J;  5J1R A;  3PM1 A;  3JR9 A;  1FJL A;  1Y1W J;  3IH2 A;  2NVY J;  2LY9 A;  3TP0 A;  1WH5 A;  2WV1 A;  5M5X J;  5EGO B;  2CQX A;  2HOA A;  1POG A;  1ZR4 A;  2IBD A;  3PO2 J;  2KDZ A;  1XG1 A;  2FJ1 A;  5FKK A;  1IG7 A;  3ZQF A;  4S0H B;  2JN6 A;  4DZJ A;  2EBI A;  2XGD A;  3CQZ J;  1NK2 P;  3BR2 A;  1ZGW A;  3W6V A;  3Q0V A;  1ETY A;  2DMQ A;  1AU7 A;  4HNV A;  5JLX A;  1CQT A;  3GTK J;  4C3H J;  2ID3 A;  4ABZ A;  3RZD J;  1Q1V A;  1QRY A;  2ECC A;  4C3J J;  1EF4 A;  2XGE A;  3ZQC A;  2EZL A;  1HDD C;  3S1R J;  1ZK8 A;  3JRF A;  5J1Y A;  9ANT A;  4DZP A;  5M5W J;  5EF6 A;  2HXO A;  2FQ4 A;  1UG2 A;  1Y1V J;  3BG9 A;  1FTT A;  5J1U A;  5FKN A;  2DA7 A;  2WAQ N;  4A3C J;  2NS7 A;  3OSF A;  1U9O A;  4A3G J;  2HDD A;  5F0H A;  2LP0 A;  2DMU A;  3BT9 A;  1X2M A;  1G2H A;  4IHV A;  2K9Q A;  1ITY A;  3UKG A;  1ETO A;  2O9L A;  1JTY A;  2DJN A;  5F0C A;  2ECB A;  4MIM A;  5FKM A;  2HQ5 A;  4V2F A;  3B6A A;  1IDY A;  4AYB N;  5FJ8 J;  3GTJ J;  2EH3 A;  5FKO A;  1HDP A;  2CQQ A;  2ZB9 A;  5EDN A;  3JRA A;  4NDL A;  2NOG A;  2P81 A;  3IH4 A;  5JLW A;  2LK2 A;  4JX6 A;  3K2A A; 
#chains in the Genus database with same CATH topology
 3MCZ A;  3C1D A;  5KAI C;  1P4X A;  2WB1 A;  3FMS A;  4XK4 A;  2L7F P;  2CJJ A;  3ONQ A;  2UXX A;  3QYB A;  2LRE A;  2WY7 Q;  1MDM A;  2GLO A;  2QSH X;  3C2B A;  4Q47 A;  1EH6 A;  2VAS A;  5FLX K;  2DI3 A;  4DYC A;  4G7O F;  2R7Z J;  3ECO A;  2ADU A;  2IEK A;  3GZ5 A;  2QA4 I;  3FXR A;  2DOE A;  1D8J A;  3WHB A;  2KRH A;  1IUF A;  2Z3Y A;  3E0J B;  4MFD A;  3WGG A;  4IF4 A;  1RPW A;  2WAD A;  3UR3 C;  1MDM B;  3DKW A;  2LKP A;  1XGO A;  2KIS A;  4KIB A;  2CUF A;  1IZ1 A;  4IL6 C;  4JP0 A;  1JKQ C;  1AOY A;  2IS6 A;  3EUA A;  3BZK A;  4B48 A;  1IV8 A;  3T0Y A;  4BDZ A;  1T38 A;  1XPX A;  4CDG A;  2X51 A;  1R71 A;  2TCT A;  4LG0 A;  3O3K A;  2A05 A;  2X1C A;  5DTD A;  3H9G A;  4NUB A;  2JPC A;  2OU2 A;  2XRN A;  4U0V A;  3DKY A;  1T0F A;  3NAR A;  4HAM A;  4ZYH A;  1JGS A;  2GAU A;  1S3J A;  4HLY A;  2LSO A;  2EA2 A;  1F36 A;  3HL2 A;  1WSU A;  4KDP A;  4A3J J;  4LK0 F;  2M9H A;  1OCT C;  4LG0 B;  2PBI A;  4CYC A;  3BTC A;  1PDN C;  4U7D A;  2E19 A;  2KIF A;  5IOY A;  3CCE I;  4G7H F;  2O03 A;  4DGW B;  5CVI A;  1Z6R A;  1A31 A;  2R7U A;  5F0F A;  3K4N A;  3QRF F;  3HG9 A;  2XHK A;  4HZF A;  4IOC F;  4CYC B;  1REP C;  5H20 A;  3ULQ B;  3FX3 A;  2P6S A;  1G3S A;  5GAD J;  1ZR2 A;  1KQ8 A;  3HEF A;  2K4J A;  3R4K A;  3L2W A;  2K3P A;  4F93 B;  3ZXS A;  2F5E A;  3CMM A;  3K1P A;  2VBZ A;  4PJN A;  4CCO A;  2R5Y A;  2L02 A;  3ABT A;  3ZN0 A;  3H0G J;  1SD7 A;  2JA2 A;  1MMA A;  3JRD A;  1J2X A;  3NWT A;  3W3C A;  2M34 A;  4D9J A;  3B6C A;  4JOM A;  3F22 A;  3S2W A;  2DOD A;  5GTH C;  2R5Y B;  3QPH A;  3H3U A;  4L9V A;  2LC2 A;  4OU0 A;  2R7T A;  1P4A A;  3VPR A;  2L7M P;  3T1B A;  3DQV C;  4BYY A;  1U9N A;  4UUV A;  3WE2 A;  1YO5 C;  1H88 C;  4I02 A;  1W7P D;  3PQJ A;  1WGX A;  2CW0 F;  2K3F A;  3OYJ A;  3CC7 I;  1V55 H;  1P7I A;  1KU2 A;  3RDI A;  3C2G A;  4E7K A;  4HDV A;  3TO6 A;  2F6C A;  4YFX F;  3LQQ A;  2XAG A;  2P4W A;  3DCF A;  3HOZ J;  2IGN A;  3V7S A;  5L3F A;  3DF8 A;  4W97 A;  1YIO A;  2XV4 S;  1SFU A;  3N05 A;  3BQY A;  3CO6 C;  4RS8 A;  2D5V A;  5IT9 K;  2HYG D;  4NHJ A;  1X1B A;  2BXZ A;  2CQK A;  4CCM A;  3O6B B;  2Z99 A;  4Y7N J;  4I0A A;  3QYE A;  5B1A H;  1ETK A;  3K2Z A;  4EM0 B;  4ZYD A;  1U5T A;  5L3D A;  2QUF A;  3BR5 A;  3VOD A;  3OWT A;  2H8R A;  5AIP A;  3JRG A;  1B8I A;  2KJB A;  1NH3 A;  2JRT A;  4OIN F;  1GVJ A;  3U2R A;  5DD8 A;  4XRM A;  5LBQ A;  1T98 A;  3H3V K;  1U5T B;  2L9R A;  4HF1 A;  2ELJ A;  5IPA A;  4NNJ A;  3BLY A;  5DCF A;  4BE0 A;  3T8R A;  4CH7 A;  3BTJ A;  1B8I B;  3Q3S A;  3TBI A;  3DXJ F;  2F4I A;  2JK3 A;  3K1M A;  1Z3X A;  5GPA A;  1R23 A;  1OR7 A;  2WBM A;  3ZQI A;  4OMZ A;  2JVG A;  1IDZ A;  1WRJ A;  2RV8 A;  3ZMS A;  4LIU A;  2MSY A;  3SHF A;  5J6X A;  1E3H A;  3IWF A;  4A3D J;  3DU6 A;  2AO9 A;  2KKO A;  4Y52 J;  3AG3 H;  2WY8 Q;  2HKO A;  5GP9 A;  5H2F C;  2Y75 A;  3U1D A;  1LKX A;  2IXS A;  2I10 A;  2KIU A;  2KJC A;  1U3E M;  4FX4 A;  6PAX A;  1YG2 A;  3HB9 A;  4M6X A;  3M1C A;  2FU4 A;  3BR1 A;  2QEX I;  4I0B A;  1XSV A;  1Z05 A;  3DTE A;  2BVL A;  2DOA A;  1LQ1 A;  4FIS A;  2M8G X;  3K4C A;  1T33 A;  3HBL A;  4BNC A;  5HLT A;  2JQ7 A;  1G4D A;  4L5I A;  3RQI A;  1XMX A;  4G94 A;  3JW4 A;  3W6K B;  4O5V A;  2ZXW H;  1BA5 A;  2ZXI A;  2OC6 A;  4DJA A;  3G6E I;  3GEZ A;  4ZC3 A;  1WQ2 A;  4EJO A;  1MKM A;  1VQ9 I;  1UEL B;  1TWF J;  3V8L A;  4V19 K;  1I39 A;  3MD2 A;  3P9C A;  2DQR A;  2EK5 A;  3MAJ A;  3A01 A;  2EFN A;  3NEU A;  2DA1 A;  2ZFU A;  5IOZ A;  5GAH J;  2K4B A;  2MFZ A;  2JMW A;  2CV2 A;  1T6S A;  5JVG F;  3S1N J;  2BHY A;  5H6R A;  3LSM A;  3LAJ A;  1T0F C;  1YS6 A;  3BCB A;  4A0X A;  2DTZ A;  3A01 B;  2FSW A;  2YR2 A;  3SJM A;  1ZH5 A;  1VFC A;  3M07 A;  3OOP A;  3HSE A;  4LGW A;  1O7L A;  2XUB A;  4IRG A;  3K6G A;  3OYE A;  2LRD A;  3DKX A;  2M4G A;  3AG2 H;  2F5F A;  4LLL A;  1MW7 A;  4BQN A;  2W7N A;  3IKT A;  3OL4 A;  2H94 A;  5GTI C;  1E0E A;  5AIQ A;  3JSP A;  1R36 A;  2IA0 A;  2W57 A;  1AKH A;  1O4X A;  3GCM A;  2A3S A;  4GO1 A;  3CCQ I;  1O7F A;  1SMY F;  4WX9 A;  5M3F J;  2EV6 A;  1XGN A;  3WG7 H;  3L00 A;  3L2R A;  1IN5 A;  1VQM I;  2B0L A;  2GZW A;  4XON A;  2JA7 J;  3K4M A;  1WWX A;  1E2X A;  5LFA A;  4H4K C;  1VTN C;  1E17 A;  4YFK F;  3A2K A;  3HOS A;  1QBJ A;  3VYT B;  1AKH B;  3LA7 A;  3KEY A;  1RNL A;  3HHH A;  1B6A A;  4A12 A;  2HTS A;  3LST A;  4GDF A;  4C30 A;  4JX5 A;  2VXZ A;  2HKX A;  2F4M B;  1QU3 A;  2EQR A;  5D4S A;  1VI0 A;  2OTJ I;  1X1A A;  2N8G A;  2RC4 A;  4Z2Y A;  3KX2 A;  3KP5 A;  3SZT A;  3BR0 A;  3M7G A;  2K9M A;  1T2K A;  1QVT A;  3DBH B;  2ISY A;  4LOC A;  2CU7 A;  4AU7 A;  3R0J A;  3LSK A;  2M45 A;  1RES A;  1IV6 A;  3ZR8 X;  1VND A;  2IAI A;  5B66 C;  1T56 A;  2XRO A;  4ZYG A;  1OCR H;  2PQ8 A;  2BY1 A;  1LDK B;  1OJL A;  2VE8 A;  4A3L J;  3CD6 I;  3LSR A;  2CH0 A;  2L9N A;  3HGY A;  3JRH A;  3RKQ A;  3K4K A;  4B47 A;  4ESJ A;  1UFM A;  5JHU A;  5ED4 A;  3F8B A;  4PK4 A;  3LAP A;  2ZJ2 A;  2X6W A;  2UV1 A;  4F91 B;  2E2I J;  2QVO A;  1YOV B;  3BQZ A;  2DTR A;  1Z91 A;  4KT5 C;  2VB6 A;  4XOP A;  1O3T A;  1OKR A;  1D5V A;  3GO5 A;  5EEG A;  3FXL A;  5CJ9 A;  3IP4 B;  3FM3 A;  3EYY A;  1YW8 A;  2VOD A;  1FTZ A;  5JR3 A;  3D5R C;  2DMN A;  4B4C A;  5D5V B;  1OCZ H;  3OYA A;  1H8A C;  2K5C A;  1XMK A;  1RRJ A;  4LFU A;  4E4H A;  3KP2 A;  4PSW A;  4H0E A;  2HQN A;  4BS9 A;  3OV8 A;  1RIO H;  1ZRE A;  1IN4 A;  3TO7 A;  1K6O A;  3GTP J;  5J1R A;  1YX3 A;  2ZNY A;  3HUG A;  1FJL A;  1Y1W J;  2CV1 A;  2DK8 A;  1WH5 A;  2XKP A;  4N4N B;  1K7A A;  2K85 A;  1D1B A;  2FJ1 A;  3IAS 2;  1RI7 A;  4XLN F;  1RZ4 A;  4R8H A;  5AON A;  4Y4R A;  4BHC A;  4E7Z A;  5KAF C;  4DZJ A;  2EBI A;  3CQZ J;  1R5G A;  5L3C A;  1FP2 A;  4ZYE A;  3BR2 A;  4ETS A;  3HUG B;  3IKV A;  2HS5 A;  1OR7 C;  4HA8 A;  3S3O A;  2IT0 A;  3Q0V A;  4L9T A;  4HNV A;  3OR2 C;  3MEX A;  1CQT A;  1G3T A;  3GTK J;  4ABZ A;  3R6S A;  3RZD J;  3IHU A;  1QGP A;  1HW2 A;  2VOO A;  1EF4 A;  2VBW A;  4XSX F;  3HIF A;  3CCL I;  2VBX A;  1HDD C;  1Z7U A;  3CUO A;  5FFX A;  3ISP A;  2D45 A;  2L3D A;  1TBX A;  4LB6 B;  3K70 C;  3HYI A;  2K86 A;  3OIQ A;  9ANT A;  4HEA 2;  1ZEL A;  1AA7 A;  2DAO A;  1BR4 A;  2E36 A;  3HZJ A;  1MJB A;  2I5U A;  1ZLJ A;  4BAY A;  1AWC A;  3FBI B;  2MYS A;  3HTS B;  4KIS A;  1BI2 A;  1FYL A;  2NS7 A;  3OSF A;  1S6L A;  2HQA A;  4IO9 F;  2LP0 A;  3S93 A;  1S8N A;  4EJT A;  1G2H A;  2K9Q A;  4HNT A;  3R61 A;  4UNO A;  2IVM A;  1JE8 A;  1UCR A;  3ZQ7 A;  4E7L A;  1ZLK A;  5FKM A;  2VLA A;  1PP7 U;  5LGN A;  2IGO A;  4V2F A;  4HSR A;  2P5V A;  5FJ8 J;  2VJJ A;  4KIC A;  2CQQ A;  1R58 A;  2IA1 A;  3FHN A;  4NDL A;  2P81 A;  3IH4 A;  3VSK A;  1H9G A;  2LK2 A;  3F8F A;  2VT2 A;  1RR8 C;  2VQH A;  2MW8 A;  3TDU C;  1DGR M;  2HQR A;  2VC1 A;  2PJP A;  1K61 A;  5BNG A;  3E5Q A;  2EZH A;  2OZU A;  2E34 A;  2KRC A;  4HPQ A;  1G59 A;  4XKB A;  3CJN A;  3UNG C;  1EJ9 A;  3HGG A;  3OL3 A;  1DP3 A;  3BTI A;  1JUM A;  2GOM A;  1UHW A;  3S32 A;  2GA2 A;  2TRT A;  3GZN B;  1FOW A;  3G2B A;  3DTI A;  2L4M A;  3A4C A;  4EEF G;  5A2Q Z;  3RSN A;  2IJL A;  3G4S I;  3HOW J;  4XN0 A;  3A02 A;  4F92 B;  4J01 A;  3LMM A;  5BMZ A;  1O3R A;  4KIF A;  5M5Y J;  3TKY A;  3CCM I;  3EYI A;  1VQL I;  1PVE A;  3ZMV A;  1K83 J;  2V6C A;  1VQK I;  3M4O J;  1YIJ I;  2L7Z A;  1VQ7 I;  4KN7 X;  2OA4 A;  1ZYR F;  4ZTF A;  1IN8 A;  4EM2 A;  2DMP A;  4A5N A;  2BBY A;  4U87 A;  1S7A A;  1OFC X;  1MZB A;  1ENH A;  1XC5 A;  1SVO A;  3E1S A;  2ELH A;  2LKX A;  4NB5 A;  1TNS A;  1ETX A;  2ZBK A;  1Z67 A;  4RB0 A;  2HOS A;  5DV5 A;  3ASN H;  2RAE A;  3PIO F;  3IUO A;  2R7Q A;  1JJ8 C;  1FZP B;  3V7R A;  4IHX A;  1ETV A;  2Y9Z A;  2YU9 J;  3WGI A;  1UZC A;  2RQP A;  2PI0 A;  3PIP F;  2DT7 B;  4GFB A;  4Q5S F;  2R92 J;  5IYB J;  2F48 A;  2KHM A;  3FBN B;  2ZKZ A;  3KYC B;  1LFP A;  1GDT A;  2W00 A;  5IP6 A;  3CDH A;  4C2M J;  2ZJR F;  2KMU A;  1VQ8 I;  1SEU A;  3OYG A;  2RKH A;  3E97 A;  1LEA A;  3GME A;  3DBR B;  4B3A A;  1BL0 A;  3RCO A;  1WI9 A;  3D1N I;  2CGP A;  4LD5 A;  5FLM J;  3PNV A;  1ETQ A;  1YYV A;  4IHY A;  4FHT A;  1NG6 A;  5J8C A;  4AVP A;  5C4J J;  1TWC J;  1KYW A;  2DPU A;  1ZRF A;  4A6E A;  1ZGJ A;  2STT A;  4M74 A;  1DGW Y;  4UVA A;  3BRO A;  4QSH A;  2WA0 A;  4EM1 A;  2X0L A;  2VXD A;  4PJ0 C;  2XC7 A;  1Z1D A;  1TLH B;  1BIA A;  2KDO A;  1J75 A;  3BDD A;  3L09 A;  3X2Q H;  4AIK A;  2BEO A;  3TL4 X;  1N77 A;  4EJU A;  4MNU A;  2Y0M A;  3JRI A;  4G6D A;  2F5C A;  5ICC A;  3KEQ A;  3CME I;  1OPC A;  2MBF A;  2XAU A;  4M3E A;  3TP3 A;  1K4S A;  2FE3 A;  4XRF A;  1HA8 A;  1QPI A;  4CZZ A;  4ZZL A;  2DDA A;  1H89 C;  1FWZ A;  1WPK A;  2R7S A;  1AHD P;  4BL0 B;  2MH2 A;  1XDU A;  2XGC A;  1ERD A;  1KON A;  3ZMD A;  1USS A;  2KZV A;  4L5J A;  2W48 A;  3L2Q A;  2P7C B;  1K4T A;  4N9I A;  2OTL I;  3I54 A;  4Y33 A;  2VUM J;  2VL8 A;  1OCO H;  2GA1 A;  5K7F A;  3IC7 A;  1R4N B;  3BCA A;  1QZE A;  3CJR B;  2XAS A;  3U1K A;  1MMD A;  3LOC A;  1FBQ A;  1WHU A;  3V4G A;  3EUH A;  4KJZ A;  5JFR A;  4EAT A;  3OYB A;  2BE5 F;  5LHG A;  4XSZ F;  2VPL A;  5HNF A;  2R7F A;  5LEJ A;  3H9Q A;  2FML A;  4DBR A;  1WJ5 A;  2CWE A;  3I3L A;  1R9T J;  1A5J A;  5D8L B;  5GAG J;  4UV9 A;  4A3I J;  4KMF A;  1YI2 I;  4XL9 A;  4I98 B;  3F8N A;  1ZHF A;  1VQ5 I;  1QQI A;  2H6B A;  3ZP5 A;  1D0Y A;  2MAB A;  1NHA A;  1WFX A;  3VEP A;  4CUG A;  1F5T A;  1FP1 D;  2A69 F;  1BJZ A;  3OIO A;  1YRN A;  2GXA A;  2FF4 A;  4BUP A;  3CUQ C;  3FXQ A;  2A6T A;  1MIJ A;  1WCM J;  1JKP C;  2HOE A;  4FE7 A;  2FX0 A;  4XN3 A;  4LK1 F;  4M9S A;  4MTD A;  2WWY A;  1SFK A;  4IKF A;  2VOP A;  3E7L A;  4OAY A;  1MND A;  5E3L A;  2HFH A;  3FWE A;  4P5O A;  1FPQ A;  2E71 A;  1UMQ A;  2WAF A;  1ODD A;  2O5R A;  2DJI A;  3E5U A;  4IVN A;  1YRN B;  1BW5 A;  2E60 A;  3KP4 A;  4M3F A;  2HVS A;  5E17 F;  4J19 A;  1ZG3 A;  2HDC A;  2COB A;  2WC2 A;  3H5R A;  1KQ9 A;  1TQM A;  2ZC2 A;  4MO7 A;  2XAQ A;  4RMN A;  1B72 A;  3R0A A;  1MNM C;  1OYW A;  2CQ7 A;  2W25 A;  2EFQ A;  2EWN A;  3MKZ A;  1XSD A;  3GTL J;  1SVM A;  4KT6 A;  1UHM A;  2OF7 A;  1FX7 A;  1S7E A;  1B72 B;  4M73 A;  1H9T A;  4Z6Y A;  1CGP A;  3ZQQ A;  1RKW A;  5D8K B;  4ZTJ A;  1HC8 A;  1BW6 A;  1V5G A;  5FD6 A;  3CJT B;  1OQY A;  2BYV E;  2CSO A;  4QTR A;  3EQL F;  4QIW N;  4XNF A;  3RKW A;  4AVZ A;  1Y8Q B;  2PMU A;  3ZQH A;  4L0Z B;  4PDK A;  5CLS A;  1O57 A;  3S14 J;  2DA4 A;  2QZ8 A;  3RPU A;  4OIO F;  2FQ3 A;  5DM6 F;  3JSO A;  2YPR A;  3H5N A;  3OS1 A;  1GXP A;  2E2H J;  4GXO A;  1XCV A;  1BIB A;  2OAZ A;  3OR1 C;  1U8B A;  1APL C;  5CYV A;  2EA4 A;  1F43 A;  3BG3 A;  3K7A J;  4IHW A;  2E7X A;  4UXN A;  1JHH A;  3JRC A;  3S15 J;  2JTV A;  2AS5 F;  2R4G A;  3QP6 A;  4QLC U;  3COA C;  2V1N A;  3KEO A;  2JSP A;  4C3I J;  1E3P A;  4RA2 A;  1HBX G;  3MKW B;  5HDG A;  3GFL A;  1IXR C;  2Z9O A;  1TWG J;  3OYL A;  1UHS A;  3H3Z A;  1Y56 A;  3RTR A;  2J5P A;  5FD5 A;  3E6D A;  1P9Q C;  3VYU B;  2M1B A;  3DLA A;  3BJ6 A;  1ZAO A;  3KLO A;  1MH3 A;  4I7H A;  2XSD C;  5EEH A;  2KP6 A;  1R22 A;  5LGU A;  3L9F A;  3Q0U A;  5LHI A;  2XIG A;  5TRD A;  2VE9 A;  2FNP A;  4LLG F;  2KL4 A;  3WTV C;  4KIG A;  1YS7 A;  3O8G A;  1JT0 A;  3PFY A;  2LBF A;  2BY3 A;  4DOZ A;  1ZGA A;  5F6F A;  2RDP A;  1X2N A;  3HOT A;  3GTG J;  4X6A J;  4KNY A;  4UY8 I;  1RUO A;  1S29 A;  3OMY A;  1BC8 C;  1C0W A;  4MGR A;  2ID6 A;  3NAU A;  2LDU A;  4XID A;  3EET A;  1X1C A;  2XPU A;  2EV0 A;  5FRM A;  2WTE A;  4LMY A;  4BBS J;  1I3A A;  3QPT A;  2P6T A;  2XAF A;  3B73 A;  2LBF B;  5FLV A;  3MMY B;  5F08 A;  5TJJ A;  2J5O A;  4BH9 A;  4BKX A;  4S05 A;  1J9I A;  1YTY A;  3W2A A;  1KQ0 A;  1MSF C;  4MHG A;  2DW4 A;  2V1D A;  3CO7 C;  3BPV A;  1Z3Y A;  2DDB A;  2Q0O A;  2P7V B;  3ELK A;  3K69 A;  1JKO C;  4C2U A;  3BR6 A;  3E6C C;  3HC7 A;  2B7E A;  1D5Y A;  1VQ4 I;  2GWR A;  2IA2 A;  4ZDP A;  2RN7 A;  3W2V A;  3CMY A;  3L2U A;  3VDX A;  2MLG A;  2ZSH B;  2EB7 A;  2QKM B;  3V8J A;  3ML6 A;  3H9J A;  3HJE A;  4IPA A;  1OMI A;  3I5U A;  4B43 A;  3OS0 A;  4A3F J;  1XTA A;  2AQE A;  1D0Z A;  2CS3 A;  1MMN A;  2HZT A;  4PGG A;  3AKZ A;  3FIW A;  1FC3 A;  3FDY A;  2QWW A;  5E1W A;  2FEZ A;  1DP7 P;  2MD5 A;  2Z2S B;  2XF5 A;  3OYK A;  2GQQ A;  3KE2 A;  3EUH C;  3DEE A;  3VB2 A;  4CXF A;  3FK7 A;  5C4X J;  4XKW A;  1GXQ A;  3C18 A;  2UUZ A;  2BY2 A;  4B09 A;  4XKV A;  3HRS A;  1ZQ3 P;  3GBG A;  3VSL A;  2LY1 A;  2X6X A;  4IRH A;  2LF7 A;  2DU9 A;  5CVJ A;  1PJR A;  2A6E F;  2L2O A;  3GW2 A;  3H92 A;  3BOQ A;  2VT3 A;  1M1E B;  1YW7 A;  4J00 A;  1FT9 A;  1IJW C;  3VYS B;  1BI1 A;  3G73 A;  5E3M A;  1P7J A;  3MZY A;  4FET A;  1EH7 A;  1PP8 F;  5EGO A;  2PMZ N;  3FMQ A;  1TWA J;  4CA0 A;  4CCJ A;  3OYN A;  5K5O A;  2ZJP F;  4PJL A;  1R6R A;  5F27 A;  4G9Y A;  2HNH A;  2HEO A;  1BI3 A;  2ZXH A;  2FOK A;  4A0Z A;  1I6X A;  4PUS A;  3JR9 A;  4L0Y B;  5HS9 A;  4U7B A;  3M8F A;  5M5X J;  5EGO B;  1TP4 A;  4OWR B;  1ZR4 A;  3ERM A;  4M9Z A;  3F72 A;  2R7W A;  4ITV A;  2CO5 A;  4GGG A;  4YIF A;  1UB9 A;  3ZQF A;  3G71 I;  4S0H B;  2JN6 A;  1ZG5 A;  5HNH A;  4G8X A;  4GCV A;  4YEJ A;  4BEH A;  2NXN B;  2UZK A;  5LLQ A;  2PLY A;  2KZG A;  2DMQ A;  4PFP A;  5E20 A;  2H8W A;  2EFW A;  4IXA A;  3SZP A;  3TO9 A;  4C3H J;  2ID3 A;  3AG1 H;  1EV7 A;  1I5Z A;  1QRY A;  3FKJ A;  3GUD A;  3NWS A;  4HDU A;  2FUG 2;  3DV8 A;  2LMD A;  1XSX A;  3L7W A;  3Q9V A;  3WG9 A;  1YW9 A;  3S1R J;  4M71 A;  4BEH B;  4NBQ A;  2PMH A;  4RB1 A;  3JRF A;  3L2V A;  5J1Y A;  1B1B A;  2YU3 A;  2L4A A;  3K0L A;  4DZP A;  4BGD A;  5EF6 A;  3EDP A;  1SMT A;  1WJB A;  2FQ4 A;  1UG2 A;  1Y1V J;  3BG9 A;  2HYF A;  3J7Z I;  3H5A A;  1XN7 A;  5J1U A;  3KYL A;  2W24 A;  5D4R A;  2V1X A;  4JQF A;  4BXU A;  4KFC A;  5F0H A;  4ZJZ A;  2PN6 A;  2DFE A;  3BT9 A;  4M6Y A;  2M8E A;  1NG7 A;  1X2M A;  2W4S A;  4IHV A;  5FRN A;  4Q48 A;  3CP2 A;  5HVQ C;  2O9L A;  4HX4 A;  2HPM A;  2ECB A;  2QM3 A;  5D5U B;  2DFF A;  3B6A A;  4AYB N;  3GTJ J;  2EH3 A;  1Y8R B;  5FKO A;  2ZB9 A;  5EDN A;  3JRA A;  3HSF A;  1XX5 A;  1O3Q A;  3K10 A;  5JLW A;  2PMZ A;  1Z9C A;  2V1U A;  4ENM A;  1HST A;  1I1S A;  3JTG A;  2JRM A;  1K6Y A;  4I76 A;  3OYD A;  4PCQ A;  4I2O A;  3LQR A;  3KET A;  5J40 A;  4UB6 C;  2GM4 A;  4CO8 A;  3MKL A;  1TT0 A;  4A93 J;  4II3 A;  4UUT A;  2K40 A;  5LRR A;  2O0Y A;  4MEY F;  3FKI J;  1RUN A;  2NS8 A;  2E2J J;  3E5X A;  4UB8 C;  2LR8 A;  5KCM A;  5E3N A;  1LB2 A;  2YX4 A;  3PUB A;  3ZMT A;  1G6N A;  1W5S A;  4AID A;  4P9U A;  1TWH J;  3FK6 A;  3H35 A;  3V42 A;  3L2C A;  4QPQ A;  2QYO A;  2DYR H;  3P9K A;  3WGH A;  4CGZ A;  4BY1 J;  2LH9 A;  3HSR A;  3QOP A;  3MZ8 A;  1GT0 C;  4EGZ A;  1MSE C;  2MC4 A;  3GTO J;  3E3V A;  2UXN A;  3BG5 A;  4Q4Z F;  4UVC A;  4EV0 A;  2VJ4 A;  2W82 A;  1TT5 B;  1OCP A;  2O7O A;  4XLA A;  5J8F A;  4P96 A;  4PFO A;  2G7U A;  4NC7 A;  1N78 A;  2ZFW A;  3DEU A;  2DK5 A;  3PUF A;  4XLC A;  1X3Z B;  2OV7 A;  5DD4 A;  1SFO J;  4IZZ A;  4L18 B;  3PSF A;  1HLV A;  2E1M C;  2FMY A;  3BY6 A;  2DXI A;  4RDU A;  1FNN A;  1I27 A;  2W85 A;  1MH4 A;  2LD5 A;  3RZO J;  2FBI A;  3HTU A;  3S3N A;  1KA8 A;  1SAX A;  4RLF A;  3KP3 A;  1FYM A;  3PO3 J;  3SEZ A;  4JK1 X;  4HQM A;  1YFH A;  4ZDL A;  1LJ9 A;  3WTT C;  2IS4 A;  3JRE A;  3SYT A;  2FA5 A;  1FEX A;  4K2E A;  1HF0 A;  3HXL A;  2DCE A;  5ERI A;  3IRQ A;  4MLO A;  2JWT A;  3JAM Z;  1TZL A;  1Z0X A;  4ASN A;  1DU6 A;  3S2D J;  2D2W A;  3QU3 A;  2RQQ A;  4AYB A;  3DWL E;  3KP7 A;  2K7L A;  4AIH A;  1JUP A;  1GLN A;  3BZ6 A;  4CCN A;  3LSG A;  3VOE A;  3VWB A;  3GFJ A;  5J3L A;  4I6Z A;  3M3Y J;  3I59 A;  3J7Y J;  1UG0 A;  3S1Q J;  2HI3 A;  3CUQ A;  1XDS A;  3WTZ A;  2VC0 A;  4G6T B;  4XRS G;  3I9V 2;  1ZKG A;  2L5Q A;  1TL8 A;  3P7N A;  2CFX A;  5EG0 A;  4KUM A;  2FXA A;  3BP8 A;  2QSF X;  5IP9 J;  4LLN A;  3GTM J;  2XVC A;  2X6Y A;  4AM3 A;  1BC7 C;  1B9N A;  3I59 B;  3QAH A;  3J80 Z;  4U0W A;  2MA3 A;  2VKE A;  1K79 A;  3CUQ B;  3FXM A;  1U78 A;  5BQT A;  2Y31 A;  4YFN F;  3AL0 B;  4E7J A;  3CC4 I;  4XOT A;  1QPM A;  2ISZ A;  1IXS B;  3SFI A;  4AUX A;  4XOR A;  1ON1 A;  5LGT A;  2IGK A;  2R0Q C;  4O3M A;  2VBY A;  5F1J A;  5EG0 B;  3JCU C;  5LRS A;  3ASO H;  3GFI A;  1HKQ A;  2CMP A;  3IL2 A;  1J09 A;  2V26 A;  4XIC A;  1W0T A;  2QQB A;  5B1B H;  2M4K A;  1A6I A;  5LEK A;  5K1Y A;  4TV7 A;  2FBH A;  2ZSI B;  5B5E C;  4KN4 X;  1R4M B;  1FOY A;  1KGS A;  4N4O B;  1JHF A;  1YJN I;  1W7P A;  3GWZ A;  5ILV A;  3BG6 A;  1PUF A;  1V4R A;  4AC0 A;  2JA8 J;  2XGX A;  4O6J A;  1DQU A;  1ETW A;  1FOK A;  2M30 A;  1HCR A;  1HKS A;  2MD0 A;  2O6G E;  4PGH A;  4BE1 A;  1WZ2 A;  4C9Y A;  5JHF A;  2H6C A;  2ACJ A;  2LG4 A;  2OPT A;  2M3A A;  3J81 Z;  4ENN A;  4BXF A;  3S1M J;  1W7P B;  4CSW A;  4OMY A;  3GLL A;  1PUF B;  3IH3 A;  3RPQ A;  3CLQ A;  2HYJ A;  1WH7 A;  2COM A;  2XDV A;  4FE4 A;  3QOE A;  2KIQ A;  3DPL C;  1R1V A;  1SAU A;  2VIX A;  1MJ9 A;  1LFU P;  2QEN A;  1MBJ A;  4GYI A;  4UHT A;  3TOA A;  2G7H A;  3JTH A;  3TW7 A;  2K9N A;  2G9W A;  3IV5 A;  5IYC J;  4XLF A;  2IPQ X;  2XRL A;  2LY2 A;  4CIC A;  3CCV I;  1R5I D;  4CZC A;  2ZJQ F;  1E3O C;  3K4L A;  2LLK A;  4M9X A;  4E7S A;  5F64 A;  4FAS D;  2HOT A;  4D7N A;  2X6O A;  2VKH A;  2IRF G;  1QA6 A;  1F1Z A;  3NQO A;  1Z6T A;  2K9L A;  3EPZ A;  3KP6 A;  2DFH A;  2GIV A;  2X48 A;  2RGV A;  3FHZ A;  2EIK H;  4M3G A;  5HS8 A;  4RM3 A;  4B3X A;  4HNU A;  3OOU A;  5F04 A;  1FSH A;  5IP7 J;  2HR3 A;  4U0Y A;  1MBK A;  4D5C A;  1ON2 A;  3KLN A;  2F5V A;  3E6M A;  3W6J B;  3ABL H;  3D5L A;  3I0T A;  4OIR F;  3DTK A;  1R1T A;  4PJM A;  2E1O A;  2CUZ A;  3KIO A;  2M7B A;  4L9J A;  5M3M J;  5A2Q K;  1QO0 D;  1RET A;  2Y0S N;  4WCG A;  1SVL A;  4BJT A;  4JBA A;  3VYR B;  1SAN A;  3RKX A;  1W36 D;  4IQJ A;  1BJA A;  5J47 A;  2XPW A;  1HW1 A;  1MD0 A;  1R5H A;  4LB5 A;  2ESN A;  3SXY A;  2LTP A;  1OLT A;  4BHP A;  2QGU A;  2DPD A;  3F8M A;  2FRH A;  5C3E J;  2DOF A;  4BAC A;  2QQA A;  1KU9 A;  3OS2 A;  1YLF A;  3LSP A;  1MBH A;  5IT3 A;  3MWM A;  5FFZ A;  4A3M J;  1Q1H A;  1QNT A;  5HLI A;  2R7R A;  4BHB A;  3HHG A;  4D0P A;  1OYY A;  2OBP A;  4A69 C;  5E8G A;  2NVX J;  2ELK A;  4FT8 A;  2VKD A;  2R5Z A;  1ONV A;  2GIZ A;  2A61 A;  3BPX A;  1XGS A;  3HKZ N;  2E1C A;  5FLX Z;  2E35 A;  3DBL B;  3I56 I;  3HOU J;  3HOX J;  3MN2 A;  3LFK A;  3T5X A;  1W0U A;  1HSJ A;  1JKR C;  1Z21 A;  4IEJ A;  1HQC A;  4EJV A;  1LPQ A;  2R5Z B;  2EZK A;  2BHZ A;  3OIP A;  3CJQ B;  1YJW I;  1XD7 A;  3V8K A;  1BOA A;  4B8X A;  5ILU A;  2XAH A;  4HBL A;  5EEA A;  2MG4 A;  4HYE A;  2R7V A;  4PZJ A;  2F5D A;  3JRB A;  4CHU A;  2DYS H;  1DUX C;  3Q0W A;  2HVR A;  5L3G A;  2CRG A;  4LG3 A;  2NS0 A;  3ROU A;  2OJE D;  4RGR A;  3S17 J;  5D6F A;  5E1X A;  4OAZ A;  5EYR A;  5E8I A;  1DU0 A;  3AL0 C;  5DCM A;  3SEQ A;  5K5Q A;  4M72 A;  5IY5 H;  2EZI A;  4G7Z F;  2VJI A;  4HRI A;  2V9V A;  4XLH A;  5BPD A;  4RAF A;  1VQP I;  3J7A Y;  1T8I A;  3A0B C;  2OQR A;  3WTW C;  2Y0S A;  1EKE A;  1BR2 A;  2X1D A;  3QPL A;  5DCM B;  2DA6 A;  5E79 C;  1BM9 A;  2Z33 A;  1OIS A;  1QVU A;  3PQK A;  4BQO A;  5LHH A;  3WOD F;  3CCY A;  2EV5 A;  1U2W A;  4OOI A;  2BOL A;  2GXG A;  2ME6 A;  1GUU A;  1NTC A;  4LIT A;  1P2F A;  2PEX A;  3PL8 A;  3G3Z A;  5ICG A;  2BY0 A;  2NAZ A;  3GTQ J;  3CCS I;  2VPR A;  4Y15 A;  3LA2 A;  3DPT A;  4GRI A;  1A35 A;  2RNG A;  4P1W A;  3FXU A;  4G6Q A;  3C7J A;  1R00 A;  1L0O C;  1WJC A;  2EIM H;  4G12 A;  5CQE A;  5ILS A;  1W5C C;  2M2E A;  2STW A;  1ZRC A;  1Z7L A;  2Y9Y A;  2FD5 A;  4I09 A;  5GPC A;  2DA3 A;  3MFK A;  1LDJ A;  4GYG A;  3TW6 A;  2H1K A;  1XMA A;  3HKZ A;  4E7H A;  4ENJ A;  4P55 A;  2PFB A;  3DP7 A;  2EFO A;  1BR1 A;  3KZZ A;  1SC7 A;  4DBQ A;  4BJ5 C;  3RI4 A;  2Y2Z A;  3OSG A;  1FLI A;  1T08 B;  3WU1 B;  1N75 A;  3BWG A;  3CF2 A;  1SD4 A;  5HDN A;  5CKT A;  4HOB A;  2XF6 A;  3P5J A;  3LL7 A;  4MEX F;  2MH9 A;  2L01 A;  1R49 A;  5CVU A;  1Y0U A;  2V9P A;  2XAJ A;  2GOX B;  5CVV A;  3IH2 A;  4F55 A;  1LDD A;  3O2P E;  3S3M A;  1POG A;  4CCK A;  5DUI A;  2LYC A;  2W1O A;  1QZY A;  2IBD A;  3FXO A;  2O61 A;  3PO2 J;  2KDZ A;  1ZRD A;  2V7F A;  2OQG A;  2V6E A;  1T39 A;  3GVA A;  3CZ6 A;  1YIT I;  4HQE A;  5CPR B;  3F9K A;  4ZZD A;  1LEB A;  1S5L C;  1ETY A;  2X1E A;  5IT9 Z;  1AU7 A;  1G3W A;  2JVH A;  2NOJ B;  2RNJ A;  4MQ9 F;  3GX4 X;  2Y69 H;  1Q1V A;  2ECC A;  3TOB A;  4C3J J;  3QOD A;  5E1Z B;  1O3S A;  2XGE A;  4R1H A;  4RGS A;  3ZQC A;  2DQL A;  3GFM A;  2LOO A;  1D0X A;  3I4P A;  5L3E A;  1U8R A;  2NRA C;  2BXY A;  4YG2 F;  3FZV A;  4HF0 A;  1TTY A;  1UST A;  3PSI A;  2VN2 A;  3W2W A;  5EJC A;  5M5W J;  2QQ9 A;  2HXO A;  5FO5 A;  2Z5U A;  2WAE A;  2MLK A;  1RC9 A;  2E5Z A;  1W1W E;  3LWF A;  5FKN A;  1IAW A;  2WAQ N;  2EIL H;  4EVI A;  2A5W A;  4ESB A;  2CQN A;  5HS7 A;  2PX9 A;  3BG7 A;  1LUJ B;  1PUE E;  2Z16 A;  1PYV A;  4E70 A;  1ETO A;  3UKG A;  1JTY A;  1IUY A;  4PJJ A;  1YE9 A;  2ZO4 A;  2Q1Z B;  4MIM A;  2HQ5 A;  3P9I A;  4I99 C;  3DLL F;  4S04 A;  5B3S H;  2A68 F;  3A1Y A;  2Z1D A;  3LA3 A;  4Y3O A;  4BJ6 C;  3CP8 A;  2NOG A;  3R60 A;  4WXD A;  2TDX A;  2HZD A;  1CF7 A;  4P9F A;  3K2A A;  1Y39 A;  1NK3 P;  5LD2 C;  4L5E A;  4WWC A;  4ZDO A;  1J7K A;  3CDI A;  2KFD A;  1QZZ A;  1KU3 A;  3I71 A;  3QQA A;  4F3Q A;  2E1M B;  2A07 F;  1LNW A;  3WE3 A;  3U9G A;  4BQA A;  1L3L A;  1CF7 B;  4CCL A;  1UAA A;  1I3Q J;  1ZN2 A;  4FX0 A;  2ZME A;  2VQG A;  1S7O A;  4D7M A;  2MGQ A;  3FXJ A;  3WU2 C;  4AIJ A;  3OYF A;  4A3B J;  3I4M J;  5EZH A;  3F21 A;  2LVS A;  2DT6 A;  2Y48 A;  1D8K A;  1A6Q A;  2HTJ A;  3FF5 A;  2JZY A;  1P92 A;  4R79 A;  1TQP A;  2DA5 A;  3B02 A;  1TC3 C;  3GZ6 A;  3S2H J;  4BQQ A;  2DMT A;  2O3F A;  2ZME B;  1IC8 A;  1G8X A;  5TGT A;  5F1R A;  1JGG A;  1V54 H;  2BZT A;  2IS2 A;  5D5W B;  2C6Y A;  3K1N A;  2X9D A;  2NVQ J;  1D1A A;  2QKL B;  3RQ4 A;  2EIN H;  3FM5 A;  1V5E A;  1STZ A;  2FNA A;  3E6B A;  4IHT A;  1I50 J;  1FYK A;  3V7C A;  2BV6 A;  2IW5 A;  4ON0 A;  2R3S A;  4HG2 A;  4JX4 A;  3WU0 A;  2E5N A;  2R7O A;  3F0C A;  4ENK A;  2WAQ A;  1ORK A;  1W4M A;  3HPH A;  2DLL A;  3H1C A;  1IGN A;  1GVD A;  1MJA A;  2P0W A;  1BBY A;  1FOX A;  3F23 A;  3N97 A;  5D5X B;  2MC3 A;  1N25 A;  3K4B A;  2VON A;  3KZI C;  2AXT C;  2DT5 A;  1IRX A;  5EZG A;  5DEQ A;  1VQN I;  2R93 J;  3A03 A;  3F6O A;  4N0B A;  2A6H F;  4FQG A;  3DFG A;  4A3K J;  1X3W B;  1WJF A;  4YII A;  2P5L C;  2Q2E A;  2NYX A;  1TNT A;  1GV5 A;  1V5F A;  1SFX A;  2B63 J;  1WI3 A;  4UUS A;  1SD5 A;  5C44 J;  3RJP A;  2XB0 X;  1QHH D;  1WJD A;  1JXS A;  1WJE A;  2NNN A;  3VFZ A;  2L7K A;  1FY7 A;  2DFI A;  5K7H A;  4FCY A;  5DDG A;  4HV6 A;  3FXK A;  4UV8 A;  2Q2E B;  2JJ7 A;  5IYD J;  2HXI A;  5FB2 A;  3OYI A;  3LNQ A;  5D6E A;  4IX7 A;  1P4W A;  3BC8 A;  4UUS B;  5ICE A;  2CW8 A;  1B4A A;  2VI6 A;  2V9K A;  1MGT A;  2AQF A;  4HX8 A;  3OY9 A;  3GLX A;  2CFO A;  3OYM A;  2DN0 A;  3QYF A;  1HW5 A;  1K78 A;  3AAF A;  1S9H A;  1XCB A;  3RKY A;  4HLX A;  3O8H A;  4C2T A;  4A5M A;  4IHS A;  3HRT A;  2AXL A;  2VKV A;  3AFH A;  4XQF A;  2P8T A;  4U88 A;  5HOO A;  3HPG A;  1XS9 A;  1K78 B;  3AG4 H;  3PJR A;  4X1E A;  4RBO A;  2K02 A;  1X58 A;  1A04 A;  1IN7 A;  3G1O A;  2M5W A;  1OCC H;  1EA3 A;  4IJA A;  3Q5F A;  1MBG A;  3TGN A;  3LSI A;  4L9N A;  3CCJ I;  1IW7 F;  2EFP A;  1JJ6 C;  1HKT A;  2YX7 A;  1Z77 A;  3F3X A;  3FIS A;  3PFI A;  4DYR A;  2KT0 A;  2G0E A;  2HWV A;  1YHQ I;  1BOB A;  2IP2 A;  4A2U A;  5FRO A;  4YRV A;  2PJR A;  1YX5 A;  5HOD A;  3IRR A;  4NC8 A;  4RB3 C;  2IS1 A;  3CCR I;  4RAG A;  3HM5 A;  2DO7 A;  4XRS A;  4DIQ A;  4EJW A;  2VQC A;  5DYM A;  1IXC A;  1RKT A;  1WJA A;  4M6V A;  2XF7 A;  1X1P A;  4YEL A;  3ZMZ A;  3KCC A;  3REO A;  5DS9 A;  2R7D A;  1FSE A;  3M9A A;  2KIM A;  4OIQ F;  2IGM A;  3TDZ C;  2ESH A;  3MKY B;  2PJR B;  2LNB A;  1KZH A;  3MZH A;  4MTE A;  4M3B A;  3WTY C;  2CYY A;  4KMU X;  2HPI A;  4X0G A;  1X4O A;  1LVA A;  1UJ8 A;  2HGC A;  2KLO A;  3G1M A;  3L1P A;  3N4M A;  4MFE A;  4RGU A;  1FBS A;  4BBR J;  4F52 A;  1JTX A;  3RPU D;  2NNY A;  2F4O B;  4JYK A;  3HRU A;  3QU6 A;  2E7W A;  1EH8 A;  2O8X A;  2XPV A;  3BTL A;  1ULY A;  1JI8 A;  1SFE A;  3K9T A;  1RR7 A;  1S72 I;  3SQN A;  4EGY A;  3DEW A;  3PNT A;  3KPH A;  4HX7 A;  1TQI A;  3CC2 I;  3CDL A;  3EUK L;  3D5S C;  3KYD B;  3K4J A;  3TED A;  2GBY A;  3CES A;  1QHG A;  2M0M A;  4RGX A;  3SDG A;  1IRG A;  1BI0 A;  2LFB A;  3ZPL A;  1U5T C;  2FOW A;  4BE2 A;  2O8K A;  3C2H A;  4BXX J;  1W5T A;  5CQG A;  2RRE A;  1FIA A;  2H1L A;  2NVT J;  2ZME C;  2JUC A;  2X85 A;  1DPR A;  1X4P A;  1FIP A;  1DPU A;  4E7I A;  3DU5 A;  2JSC A;  3M8E A;  1D1C A;  5BPI A;  4F7Z A;  4BDY A;  4YIR X;  2XKO A;  3S8P A;  2B9S A;  2KQR A;  1MBE A;  1Y0N A;  2M87 A;  3WTX C;  3H0D A;  4NC6 A;  4FTH A;  4B44 A;  1I6H J;  4A0Y A;  2JA5 J;  3MVP A;  4WK8 F;  2H09 A;  1ZG1 A;  3S16 J;  3H36 A;  3G1L A;  4W1U A;  3F6V A;  3WTU C;  4ZYA A;  3OYH A;  1TW3 A;  1Y6I A;  2QF7 A;  2H27 A;  1V3F A;  3SFZ A;  2M0C A;  3PNY A;  3J7A O;  3BZC A;  3CTA A;  2Q8K A;  3I4N J;  5FKL A;  3D0S A;  2QLZ A;  2HU9 A;  4V2G A;  2E1N A;  1LFB A;  1SD6 A;  1P6R A;  3T8T A;  1KYZ A;  5HDK A;  1LE8 A;  2ICW G;  1T95 A;  3F8C A;  4AD9 A;  3CCU I;  4DQ2 A;  4EQQ A;  2K9S A;  2YUS A;  3ZCO A;  2ZCW A;  1D3Y A;  3ZQL A;  4A3E J;  1XGM A;  5HLG A;  5DUK A;  4HST A;  1F4K A;  3CLO A;  2BGC A;  3QWL A;  4RLQ A;  3ZN1 A;  3IAM 2;  3NRV A;  5K5R A;  3I64 A;  2W84 A;  4BU2 A;  2D1H A;  3OYC A;  1LE8 B;  1MMS A;  3BR3 A;  3ZOB A;  3JAM K;  5E3O A;  1FMV A;  2OUM A;  5GAE J;  2HVQ A;  4M3D A;  5JI6 A;  3M8J A;  4EMS A;  1XB4 A;  2QCO A;  1X3U A;  1ZAR A;  1J59 A;  1MMG A;  4RAY A;  3WHC A;  2JPB A;  2ME0 A;  1FBU A;  4DYQ A;  2R7X A;  1B9M A;  1LVK A;  3ECH A;  3DPU A;  4WXC A;  4B1R A;  4KA4 A;  2PG4 A;  2RVC A;  1W36 C;  3KZY A;  3HOY J;  4KIT B;  5TIS C;  3LSJ A;  1HXD A;  4LJZ F;  3ABM H;  2L0K A;  2QQ8 A;  3KFW X;  1IRZ A;  2XB5 A;  5J4V A;  5FGM A;  3J80 K;  1I1G A;  1WVR A;  4XR6 A;  4Y17 A;  4DW6 A;  2EJR A;  2GXB A;  1MBF A;  1YQA A;  3RYR A;  2Y30 A;  3ZQG A;  3ZRG A;  2CUJ A;  2EPF A;  2OCC H;  4QPO A;  2HDW A;  2YS9 A;  4QWQ A;  2V79 A;  3ABK H;  1JUS A;  1JT6 A;  3C3W A;  1U0J A;  1ZTR A;  2WV0 A;  1GV2 A;  4A6D A;  1HOM A;  3A0H C;  3K70 D;  1G3Y A;  5KVR A;  2QBY A;  1X1D A;  2BW3 A;  3QPS A;  4OIP F;  3RIR A;  3HRM A;  2FBK A;  4BY7 J;  2OZ6 A;  2M7A A;  2DA2 A;  4XBF A;  1MNE A;  4ZH4 F;  3ABU A;  3HDD A;  2V4J C;  1IO2 A;  1VF9 A;  1R1U A;  3ESW B;  1FMW A;  2CUE A;  2QBY B;  2VJ5 A;  5H6Q A;  4IRI A;  3HOV J;  2BW3 B;  1DDN A;  5KK1 A;  3QP5 A;  5BS6 A;  2D1V A;  3SZG A;  4D5F A;  5HLH A;  3J81 K;  4I01 A;  4HV5 A;  2NVU B;  3TMO A;  2WB1 N;  2P5K A;  2DBB A;  2AHQ A;  1BN5 A;  4KYW A;  4II2 A;  3ERE D;  2JA6 J;  2ETH A;  5K7Z A;  2OD5 A;  3CMA I;  1IF1 A;  4RAZ A;  1VZ0 A;  3PM1 A;  4AWX B;  5BOX A;  2XSJ C;  4HF2 A;  2L54 A;  4ESF A;  2NVY J;  2LY9 A;  3TP0 A;  2WV1 A;  4LIV A;  2CQX A;  2HOA A;  2LKS A;  5KHD A;  1XG1 A;  1J0R A;  2CW7 A;  4IOA F;  3I53 A;  4WF2 A;  2JT1 A;  5FKK A;  1IG7 A;  1GHC A;  3ZGK A;  1IN6 A;  5ICF A;  3LFU A;  5DM7 F;  2XGD A;  3BJO A;  1NK2 P;  4RM2 A;  4ANJ A;  1ZGW A;  3W6V A;  1B59 A;  2OCE A;  3SDB A;  2QSG X;  5L3B A;  2LF8 A;  4XKC A;  5JLX A;  4E6K G;  5JVT A;  1WKM A;  3WTS C;  3CF5 F;  2F2E A;  2KRF A;  4NQW A;  1TW2 A;  2BVM A;  3LSH A;  3Q9S A;  2A5Y B;  5E18 F;  1IRF A;  1J5Y A;  1A36 A;  2EZL A;  4MQV A;  4CYD A;  3GF2 A;  2X4H A;  4UVB A;  3I58 A;  1ZK8 A;  2L9S A;  4DNC A;  2UWM A;  3U21 A;  4PSX A;  4RB2 C;  2EIJ H;  4NQW B;  1KU7 A;  4N9H A;  2CG4 A;  4Y13 A;  1FTT A;  1OYI A;  3TQN A;  1VQ6 I;  3I55 I;  2DA7 A;  3ZMU A;  4A3C J;  4XM3 A;  2I8D A;  1U9O A;  2KPM A;  2HDD A;  4A3G J;  1U6G A;  2L9V A;  3FMR A;  2DMU A;  3GXO A;  3M1E A;  2JUG A;  3MQ0 A;  1H0M A;  1X19 A;  2K27 A;  3IWZ A;  1ITY A;  2DJN A;  5F0C A;  5J4Y A;  4D1Q A;  5CVR A;  4XMY A;  1ACI A;  2CV0 A;  2ZXJ A;  1F9N A;  4IQ4 A;  4HW0 A;  2ZNZ A;  3RYP A;  1IDY A;  1R7J A;  2VQL A;  4WXH A;  5KNL A;  1HDP A;  3BJA A;  1VQO I;  1YJ9 I;  4XLE A;  3GYH X;  4JX6 A;  2YSR A;  4XLP F; 
#chains in the Genus database with same CATH homology
 1NK3 P;  4I76 A;  4L5E A;  1K61 A;  5BNG A;  2EZH A;  4XK4 A;  2GM4 A;  2L7F P;  3QQA A;  2CJJ A;  3MKL A;  3HGG A;  3BTI A;  1JUM A;  2GLO A;  4A93 J;  3C2B A;  4UUT A;  2TRT A;  4EEF G;  2K40 A;  4DYC A;  3FKI J;  2R7Z J;  1I3Q J;  2IEK A;  2NS8 A;  2E2J J;  3HOW J;  2LR8 A;  4D7M A;  3A02 A;  5E3N A;  3WHB A;  2MGQ A;  5M5Y J;  1IUF A;  4MFD A;  1TWH J;  3FK6 A;  4A3B J;  1K83 J;  1RPW A;  3I4M J;  5EZH A;  3M4O J;  2LVS A;  2L7Z A;  4BY1 J;  2DMP A;  2CUF A;  1GT0 C;  1MSE C;  3GTO J;  4JP0 A;  2DA5 A;  1OFC X;  3BG5 A;  1JKQ C;  1TC3 C;  3S2H J;  1ENH A;  1XC5 A;  2DMT A;  1IC8 A;  1JGG A;  2LKX A;  2TCT A;  1OCP A;  2O7O A;  1ETX A;  5DTD A;  2X9D A;  2NVQ J;  2HOS A;  2RAE A;  1JJ8 C;  4IHX A;  3NAR A;  1ETV A;  2Y9Z A;  2YU9 J;  1SFO J;  4GFB A;  1HLV A;  1F36 A;  1I50 J;  4A3J J;  4RDU A;  5IYB J;  2R92 J;  1GDT A;  1MH4 A;  2M9H A;  2LD5 A;  3RZO J;  1OCT C;  4JX4 A;  5IP6 A;  4C2M J;  4CYC A;  3BTC A;  3F0C A;  3PO3 J;  1ORK A;  2E19 A;  4B3A A;  5IOY A;  1BL0 A;  1IGN A;  3D1N I;  1GVD A;  3JRE A;  1FEX A;  5F0F A;  1HF0 A;  5FLM J;  1ETQ A;  4IHY A;  4MLO A;  2JWT A;  1Z0X A;  4CYC B;  5C4J J;  3S2D J;  1TWC J;  5EZG A;  1DU6 A;  2R93 J;  3A03 A;  1ZR2 A;  4A3K J;  1JUP A;  3HEF A;  4QSH A;  1GV5 A;  3LSG A;  2B63 J;  5J3L A;  4I6Z A;  3M3Y J;  1WI3 A;  3S1Q J;  2HI3 A;  4UUS A;  5C44 J;  2R5Y A;  3JRI A;  4XRS G;  2XB0 X;  1ZKG A;  4M3E A;  3TP3 A;  3H0G J;  5EG0 A;  1QPI A;  4FCY A;  5K7H A;  1H89 C;  1WPK A;  3JRD A;  1AHD P;  5IP9 J;  2JJ7 A;  3GTM J;  2HXI A;  5IYD J;  2XGC A;  3LNQ A;  2M34 A;  3B6C A;  4UUS B;  2VKE A;  1U78 A;  2Y31 A;  2R5Y B;  2W48 A;  2VUM J;  3SFI A;  2VI6 A;  4AUX A;  5K7F A;  2R0Q C;  3VPR A;  5F1J A;  5EG0 B;  2L7M P;  2DN0 A;  1U9N A;  3LOC A;  4XIC A;  3O8H A;  1W0T A;  1H88 C;  1A6I A;  1WGX A;  1P7I A;  2VKV A;  1XS9 A;  1R9T J;  3DCF A;  3HOZ J;  1A5J A;  4X1E A;  4RBO A;  4A3I J;  1X58 A;  3G1O A;  4W97 A;  1PUF A;  4AC0 A;  2JA8 J;  3BQY A;  1ETW A;  2D5V A;  1MBG A;  1HCR A;  1BJZ A;  4Y7N J;  3OIO A;  1YRN A;  1JJ6 C;  1ETK A;  1Z77 A;  4DYR A;  3FIS A;  2KT0 A;  2G0E A;  1WCM J;  2OPT A;  1JKP C;  3S1M J;  4FE7 A;  3BR5 A;  2FX0 A;  1PUF B;  3JRG A;  3IH3 A;  5HOD A;  2H8R A;  2HYJ A;  1WH7 A;  1B8I A;  3HM5 A;  3E7L A;  5E3L A;  4XRS A;  4FE4 A;  1UMQ A;  1YRN B;  1RKT A;  4XRM A;  1BW5 A;  4M6V A;  5DS9 A;  3H3V K;  1LFU P;  4M3F A;  2L9R A;  1MBJ A;  4J19 A;  5IPA A;  2COB A;  3TW7 A;  2K9N A;  4MO7 A;  3IV5 A;  5IYC J;  2XRL A;  3BTJ A;  1B8I B;  4M3B A;  1B72 A;  3Q3S A;  2JK3 A;  5GPA A;  1MNM C;  1E3O C;  3ZQI A;  2LLK A;  1IDZ A;  3G1M A;  3L1P A;  2HOT A;  4MFE A;  4D7N A;  2MSY A;  2X6O A;  4BBR J;  3GTL J;  4A3D J;  2OF7 A;  2AO9 A;  1S7E A;  1B72 B;  2X48 A;  1JTX A;  4Y52 J;  4JYK A;  1RKW A;  4M3G A;  5GP9 A;  2I10 A;  1BW6 A;  2XPV A;  3HB9 A;  3OOU A;  3BTL A;  5F04 A;  5IP7 J;  4QTR A;  3BR1 A;  4QIW N;  1RR7 A;  1MBK A;  4D5C A;  3ZQH A;  3DEW A;  3CDL A;  2DA4 A;  3S14 J;  4FIS A;  2M8G X;  1T33 A;  3TED A;  3HBL A;  2GBY A;  3SDG A;  2LFB A;  2E1O A;  2E2H J;  2O8K A;  3RQI A;  1U8B A;  4BXX J;  1APL C;  1FIA A;  2NVT J;  5M3M J;  1F43 A;  3BG3 A;  1RET A;  3K7A J;  4IHW A;  1FIP A;  2Y0S N;  1BA5 A;  3JRC A;  1SAN A;  3S15 J;  2XPW A;  4C3I J;  1MBE A;  1TWF J;  4FTH A;  2LTP A;  1TWG J;  1I6H J;  1UHS A;  3A01 A;  5C3E J;  2JA5 J;  3MVP A;  2DA1 A;  5IOZ A;  3S16 J;  3LSP A;  1MBH A;  2JMW A;  1MH3 A;  3S1N J;  3G1L A;  2XSD C;  4W1U A;  4A3M J;  2QF7 A;  3Q0U A;  2M0C A;  4A69 C;  2NVX J;  2ELK A;  3I4N J;  5FKL A;  2DTZ A;  3A01 B;  2R5Z A;  4V2G A;  3SJM A;  1VFC A;  3HKZ N;  1LFB A;  1LE8 A;  3O8G A;  1JT0 A;  3HOU J;  3HOX J;  3MN2 A;  2K9S A;  1W0U A;  2YUS A;  1JKR C;  1X2N A;  3ZQL A;  3GTG J;  4A3E J;  4IEJ A;  4X6A J;  1AKH A;  1O4X A;  2R5Z B;  2EZK A;  5M3F J;  2ID6 A;  3NAU A;  1LE8 B;  4XID A;  2XPU A;  3BR3 A;  3ZOB A;  4BBS J;  5EEA A;  5E3O A;  2MG4 A;  2JA7 J;  5FLV A;  4M3D A;  5F08 A;  3JRB A;  1AKH B;  2QCO A;  3Q0W A;  4BKX A;  2CRG A;  3WHC A;  1MSF C;  3S17 J;  2ME0 A;  4DYQ A;  5EYR A;  1DU0 A;  4JX5 A;  2EQR A;  1JKO C;  1VI0 A;  3BR6 A;  2EZI A;  2N8G A;  1D5Y A;  4B1R A;  3CMY A;  3BR0 A;  3HOY J;  3LSJ A;  1QVT A;  2L0K A;  1IRZ A;  2XB5 A;  4A3F J;  4LOC A;  2CU7 A;  3QPL A;  2DA6 A;  1RES A;  3FIW A;  4DW6 A;  1IV6 A;  1VND A;  1QVU A;  2IAI A;  1MBF A;  1T56 A;  3CCY A;  2Y30 A;  3ZQG A;  2ME6 A;  1GUU A;  1NTC A;  2YS9 A;  3FK7 A;  1OJL A;  5C4X J;  3GTQ J;  1JUS A;  4A3L J;  3LSR A;  2VPR A;  1JT6 A;  1ZTR A;  3HGY A;  1GV2 A;  1HOM A;  3JRH A;  3RKQ A;  1ZQ3 P;  3GBG A;  4G12 A;  2M2E A;  3QPS A;  2E2I J;  2Y9Y A;  2FD5 A;  4BY7 J;  3BQZ A;  2DA3 A;  2DA2 A;  5GPC A;  1IJW C;  3TW6 A;  2H1K A;  3HDD A;  2MW8 A;  5E3M A;  1P7J A;  1VF9 A;  2CUE A;  1FTZ A;  5EGO A;  2DMN A;  2PMZ N;  2Y2Z A;  4B4C A;  3OSG A;  1H8A C;  1TWA J;  3HOV J;  4D5F A;  5F27 A;  2WB1 N;  2AHQ A;  2JA6 J;  5K7Z A;  3GTP J;  5J1R A;  3PM1 A;  3JR9 A;  1FJL A;  1Y1W J;  3IH2 A;  2NVY J;  2LY9 A;  3TP0 A;  1WH5 A;  2WV1 A;  5M5X J;  5EGO B;  2CQX A;  2HOA A;  1POG A;  1ZR4 A;  2IBD A;  3PO2 J;  2KDZ A;  1XG1 A;  2FJ1 A;  5FKK A;  1IG7 A;  3ZQF A;  4S0H B;  2JN6 A;  4DZJ A;  2EBI A;  2XGD A;  3CQZ J;  1NK2 P;  3BR2 A;  1ZGW A;  3W6V A;  3Q0V A;  1ETY A;  2DMQ A;  1AU7 A;  4HNV A;  5JLX A;  1CQT A;  3GTK J;  4C3H J;  2ID3 A;  4ABZ A;  3RZD J;  1Q1V A;  1QRY A;  2ECC A;  4C3J J;  1EF4 A;  2XGE A;  3ZQC A;  2EZL A;  1HDD C;  3S1R J;  1ZK8 A;  3JRF A;  5J1Y A;  9ANT A;  4DZP A;  5M5W J;  5EF6 A;  2HXO A;  2FQ4 A;  1UG2 A;  1Y1V J;  3BG9 A;  1FTT A;  5J1U A;  5FKN A;  2DA7 A;  2WAQ N;  4A3C J;  2NS7 A;  3OSF A;  1U9O A;  4A3G J;  2HDD A;  5F0H A;  2LP0 A;  2DMU A;  3BT9 A;  1X2M A;  1G2H A;  4IHV A;  2K9Q A;  1ITY A;  3UKG A;  1ETO A;  2O9L A;  1JTY A;  2DJN A;  5F0C A;  2ECB A;  4MIM A;  5FKM A;  2HQ5 A;  4V2F A;  3B6A A;  1IDY A;  4AYB N;  5FJ8 J;  3GTJ J;  2EH3 A;  5FKO A;  1HDP A;  2CQQ A;  2ZB9 A;  5EDN A;  3JRA A;  4NDL A;  2NOG A;  2P81 A;  3IH4 A;  5JLW A;  2LK2 A;  4JX6 A;  3K2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...