4NDLA

Computational design and experimental verification of a symmetric homodimer
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
44
structure length
44
Chain Sequence
FSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo protein
molecule keywords ENH-c2b, computational designed homodimer
total genus 9
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4ndlA00
4MFEA 2FQ4A 2W48A 5FKNA 1BA5A 4QIWN 2WB1N 2YS9A 3FK6A 1XS9A 1BL0A 2E2HJ 2NS8A 2YU9J 1P7IA 4EEFG 2B63J 3QQAA 4L5EA 5F0FA 3GBGA 1W0UA 2Y30A 1ZR2A 2NOGA 5C4XJ 3QPSA 2X6OA 5EG0B 3IV5A 2LKXA 3F0CA 5FJ8J 5C3EJ 3K2AA 4DZPA 3TP0A 4AYBN 4DZJA 2NVXJ 4RBOA 4DYRA 3JRCA 1B72A 4A3JJ 2HXOA 3O8GA 1JUMA 5IOYA 1TWFJ 2CRGA 2FX0A 3OSGA 1MH4A 5DS9A 3GTOJ 3GTKJ 5M5WJ 4DYQA 1APLC 1MBHA 1MBKA 2R92J 3MN2A 4V2GA 4IHXA 5J1RA 2E19A 1GVDA 4XIDA 1R9TJ 3MVPA 1OFCX 5M3FJ 3S1MJ 3HGYA 4C2MJ 5IP9J 2NVQJ 4A93J 1MBJA 3BR3A 1PUFB 1AKHA 3GTMJ 3OOUA 1F43A 2XGEA 3G1OA 2EZHA 2AO9A 2IBDA 2IAIA 3NAUA 3JRGA 1MH3A 1IDYA 2M2EA 1U9OA 5M5XJ 3HDDA 4I76A 2XPUA 1A6IA 1PUFA 1IJWC 2HI3A 1U9NA 4A3MJ 1F36A 3K7AJ 2KDZA 4AUXA 1AHDP 3BR1A 3HGGA 2YUSA 2LY9A 3LSRA 5F27A 1MBFA 2CUFA 1WGXA 2GLOA 4Y52J 4IHYA 1P7JA 2TCTA 2HXIA 1WPKA 1ZR4A 4M3DA 5BNGA 4A3CJ 1IV6A 2DA5A 1AKHB 1JT0A 3TW6A 5EDNA 1OJLA 1JTYA 2LK2A 3BG5A 3PO3J 1NTCA 4JX5A 4M3GA 1I6HJ 1IG7A 3RKQA 2D5VA 1K83J 2EBIA 2EZKA 2ID3A 1IDZA 4MFDA 2VKEA 2CU7A 1T56A 3LOCA 5FLVA 3CDLA 3LSJA 3BR2A 5EG0A 3DEWA 3A01A 1JKQC 2EZIA 3OIOA 1ETQA 1UMQA 4A3BJ 3BG9A 3S14J 1GV2A 2NVTJ 5EF6A 2QF7A 4M6VA 1SFOJ 1TC3C 4QSHA 4C3JJ 4DYCA 1IC8A 1VNDA 4MO7A 4A3DJ 3JRIA 5F0HA 1ZK8A 2XB5A 1U8BA 2Y31A 3D1NI 1ETYA 4IEJA 1JKPC 2DA7A 1ITYA 4CYCB 2Y2ZA 3JRBA 5J1YA 1HDDC 2CUEA 4D5CA 5FKLA 1JJ8C 1FIAA 3HKZN 2XPVA 4BKXA 5FLMJ 1JKRC 3BTIA 3RZOJ 1Y1WJ 3IH4A 4NDLA 4CYCA 2ECCA 4XRSA 5F04A 3VPRA 2DA6A 1FIPA 2IEKA 3O8HA 1OCTC 5IYDJ 5JLXA 1QVTA 4IHVA 1I50J 1JT6A 2Y0SN 2XSDC 5J3LA 4X1EA 4A69C 4Y7NJ 2M8GX 1ETOA 5F1JA 3SDGA 1SANA 5EYRA 2ME6A 4A3IJ 5F0CA 5K7FA 4DW6A 2N8GA 3S17J 2WV1A 1JKOC 2DMPA 3H3VK 5EEAA 2XGDA 4D7MA 3H0GJ 2OPTA 3UKGA 1JTXA 5IYCJ 1GUUA 4C3HJ 4UUTA 4V2FA 4RDUA 5IPAA 3HB9A 3CCYA 4JYKA 2X9DA 3IH3A 1OCPA 2NS7A 1BJZA 4JX6A 4JX4A 2HOTA 1X2MA 3I4MJ 3JRHA 2VUMJ 1K61A 1QVUA 2DJNA 3WHBA 2VI6A 3BR5A 2M9HA 3S1QJ 4GFBA 3LSGA 4XRMA 2XB0X 1IGNA 3S2HJ 1MSEC 3CQZJ 2AHQA 3TW7A 4XRSG 2R5YB 3BTLA 3MKLA 2VKVA 3BR0A 3BTCA 3ZQFA 1D5YA 3HBLA 1Y1VJ 1CQTA 1ENHA 2LR8A 1X58A 2HYJA 2LVSA 2R5ZB 1TWCJ 1U78A 2MGQA 3ZQGA 5EGOB 3ZQLA 2TRTA 4M3EA 4XK4A 5F08A 5EZHA 2MG4A 2JA8J 2PMZN 1E3OC 1FTTA 2R0QC 1G2HA 2JN6A 3HOYJ 1TWHJ 1LE8B 1H8AC 4B4CA 3SJMA 2QCOA 2DTZA 3BQYA 4UUSB 2DMTA 3WHCA 1H88C 1UG2A 1JGGA 1ZTRA 5IP7J 4A3GJ 3ZQHA 2CQXA 3CMYA 1H89C 2Y9ZA 3JREA 2COBA 4MLOA 1ETXA 1MBEA 3W6VA 2HOAA 1WCMJ 2JJ7A 2OF7A 2GBYA 1ZKGA 4I6ZA 2K40A 3BQZA 3S2DJ 2L7ZA 2E2JJ 3GTGJ 3HOWJ 2DMNA 5IP6A 1HOMA 2DA1A 5GPAA 3M3YJ 1VI0A 2VPRA 5FKMA 3BR6A 1Z77A 3GTJJ 2R7ZJ 1FTZA 4A3KJ 1I3QJ 4BBSJ 2ID6A 3FISA 1EF4A 5FKKA 1B8IB 3RZDJ 5GP9A 1IUFA 1GDTA 3HOUJ 2LLKA 2XRLA 1DU0A 2ECBA 2GM4A 1FEXA 1RKTA 3Q0UA 1DU6A 3JRFA 3GTLJ 2DN0A 2DMUA 3Q0WA 3BTJA 1XG1A 2FJ1A 3L1PA 1QPIA 2JA6J 2ME0A 1MNMC 4D5FA 3A03A 1LE8A 2EZLA 2JMWA 9ANTA 4A3FJ 2L7FP 1WH5A 3S1RJ 1ZGWA 1LFBA 4J19A 3JRDA 1NK2P 2JWTA 2H1KA 2LTPA 4S0HB 1HCRA 1Q1VA 2KT0A 1XC5A 1RKWA 2O8KA 5EGOA 4M3BA 2HOSA 1VFCA 1S7EA 3QPLA 1MSFC 4JP0A 5K7ZA 2DA3A 3B6AA 3FKIJ 2X48A 5IYBJ 2G0EA 2R5ZA 4FCYA 3JRAA 4IHWA 3PO2J 2O7OA 1GV5A 3TEDA 5JLWA 3BT9A 3JR9A 2Y9YA 4BXXJ 1MBGA 2CQQA 2R5YA 2DA4A 5HODA 1RPWA 2DMQA 2HQ5A 4W1UA 2HDDA 2L9RA 3B6CA 1ZQ3P 1BW5A 2E2IJ 3A01B 4W97A 4A3LJ 4UUSA 3Q3SA 4BY7J 5E3NA 2DA2A 1TWAJ 2L0KA 4X6AJ 2M34A 1WH7A 5GPCA 3S1NJ 4FISA 4MIMA 4B1RA 3C2BA 1RR7A 2FD5A 3RQIA 4QTRA 1UHSA 4LOCA 2LD5A 3GTPJ 3HOXJ 1HF0A 2ELKA 2XGCA 1ETVA 2MSYA 3S16J 2I10A 2K9SA 1YRNA 2XPWA 5E3MA 4FE7A 3PM1A 2JK3A 2LFBA 3Q0VA 3OSFA 3HM5A 1YRNB 4B3AA 1GT0C 1T33A 2K9NA 3HOZJ 2CJJA 1QRYA 4ABZA 1IRZA 3FIWA 1ETWA 2L7MP 1O4XA 3S15J 1BW6A 1VF9A 3BG3A 3G1LA 1TWGJ 3ZQCA 1FJLA 3GTQJ 2EQRA 5J1UA 5M3MJ 4D7NA 1POGA 1JJ6C 4HNVA 2P81A 2H8RA 3LNQA 5K7HA 1LFUP 1HLVA 1Z0XA 2JA7J 2MW8A 3FK7A 5E3OA 2JA5J 5M5YJ 2E1OA 5DTDA 3TP3A 1W0TA 4BBRJ 2K9QA 4BY1J 1AU7A 3HOVJ 5C44J 3A02A 3SFIA 3IH2A 4AC0A 1B8IA 5C4JJ 3DCFA 2O9LA 3NARA 1A5JA 4FE4A 2WAQN 1ETKA 1ORKA 4FTHA 1WI3A 1HDPA 5EZGA 4A3EJ 5IOZA 5E3LA 3LSPA 5FKOA 4M3FA 1JUPA 3HEFA 2EH3A 3M4OJ 2ZB9A 1NK3P 3I4NJ 4G12A 2NVYJ 3E7LA 4XICA 1X2NA 2LP0A 3G1MA 3ZOBA 1RESA 3ZQIA 1RETA 2RAEA 1JUSA 2M0CA 1B72B 2R93J 4C3IJ
chains in the Genus database with same CATH superfamily
3KIOA 2FQ4A 4ZDOA 3L7WA 2BY2A 4XRFA 2OD5A 1XS9A 1SD7A 1Z7UA 2IW5A 4EATA 1I5ZA 3FMQA 3SZGA 1WFXA 5F0FA 3WTYC 1MZBA 1W0UA 2ZJPF 4RB2C 4MQVA 2HVRA 2DYRH 2HPIA 3NWTA 5D8LB 3P9IA 1JE8A 1IRGA 3ZMSA 2PLYA 1ZRDA 2FXAA 3KZIC 3R0AA 3RYPA 2B7EA 2KDOA 2A05A 5HDGA 2KHMA 5LLQA 4EMSA 3MEXA 2M7AA 1YS6A 2CH0A 1SEUA 1HW1A 1WJ5A 3N05A 3GZ6A 1ZG1A 3ISPA 2HXOA 2R7TA 3VSKA 5FD6A 2CRGA 1O7FA 2ZMEB 1R4NB 4QPOA 3SZPA 3OSGA 4BXFA 1MH4A 5DS9A 3ZR8X 5JI6A 3GTOJ 4R1HA 3OYGA 1KU9A 3R61A 1T2KA 3B73A 1K78A 3LA2A 4M74A 4YRVA 1MBKA 2VJ4A 4BQOA 3IHUA 4V2GA 4RGSA 5J1RA 3LWFA 3NEUA 1R9TJ 4HNUA 3S1MJ 1OQYA 1K6OA 3F6VA 4C2UA 2VJJA 2K27A 3DKXA 3HGYA 4E6KG 1IF1A 4YFKF 3VWBA 1DP7P 1P4AA 1WI9A 3BR3A 2FMYA 4L9NA 1PUFB 5HDNA 5CQGA 1R5HA 3VEPA 2XGEA 3BCAA 3MZ8A 2HVSA 3C18A 2EZHA 2AO9A 4BJTA 2XV4S 3NAUA 2XAUA 1IDYA 2LY2A 2Z2SB 2EFQA 4I76A 4R8HA 4A5MA 2XKPA 4XOPA 3CCMI 1PUFA 1EH6A 3OYLA 1U9NA 1PYVA 4N0BA 2DLLA 3KP2A 4A3MJ 1BN5A 2KQRA 2W84A 3BLYA 4YEJA 2BOLA 2W1OA 4HF2A 4Q47A 3K69A 3W6JB 2LBFA 3K70D 5KVRA 3KP5A 2LSOA 4KA4A 4A0YA 3EUKL 3F23A 3TO9A 4XLNF 5DUKA 3LSRA 5F27A 3JCUC 2NRAC 4BS9A 4Y52J 4Y33A 4H0EA 2M87A 1WPKA 2IA0A 5BNGA 4P9UA 5IT9Z 3CCUI 1IV6A 4KIBA 1KYWA 1EA3A 1JT0A 1U3EM 2F5EA 1FP1D 5IT3A 5EDNA 4G7OF 3E3VA 3D0SA 3VOEA 3PO3J 3GO5A 4JX5A 4BE2A 4LMYA 2XUBA 4LIVA 1K83J 2EBIA 3WTZA 4MFDA 4L9TA 1J2XA 2VKEA 2CU7A 1VZ0A 1OR7A 1ZRCA 3MKZA 5EG0A 3BR2A 3WU1B 1SVLA 4MNUA 4OIOF 2K86A 1SMTA 3A4CA 4WX9A 3S14J 4ZYDA 1HW5A 5EF6A 2QF7A 4M6VA 1RIOH 3CCRI 1VQOI 1R71A 1FC3A 2BW3A 2DW4A 1N78A 4DYCA 1S7AA 4MO7A 4BHBA 3ROUA 4HF1A 3JRIA 4PSWA 5F0HA 4NQWB 1ZK8A 4BUPA 5E20A 2Y31A 3WTXC 2CW8A 5BPDA 3ZPLA 2I5UA 1JGSA 3E5XA 5CVRA 3WU2C 2CV2A 4B8XA 2A6EF 3O2PE 4CYCB 3BJ6A 3GF2A 1LDDA 2WV0A 3JRBA 2MH9A 1OYIA 5CJ9A 5LEKA 2ZO4A 2CUEA 2VL8A 4D5CA 3G71I 2HZTA 1O3TA 3I3LA 4HA8A 2IJLA 5DV5A 4BKXA 2VXDA 1MW7A 3IC7A 3GEZA 2IEKA 3O8HA 5IYDJ 1QVTA 2WADA 4IHVA 3AKZA 2YR2A 1W4MA 2Y0SN 2KJBA 1E17A 4IHSA 2HTSA 1N25A 3ML6A 2OQGA 4EM0B 1Y0NA 4FETA 5EYRA 4A3IJ 3OYHA 5D5XB 3Q9SA 3WGIA 3FXOA 1BC8C 5F0CA 3SEZA 1XSVA 2V4JC 1BI3A 3FXJA 4Y13A 4ZYEA 5L3FA 1XMAA 5JVGF 2VN2A 2C6YA 1QU3A 2PMHA 2DMPA 3H3VK 1UB9A 2VBZA 3FDYA 3RPQA 3H3ZA 3CCEI 4HV6A 1IV8A 1ULYA 2VQLA 3C2HA 3K4CA 4C3HJ 4KUMA 4V2FA 4RDUA 4ASNA 3HB9A 3IAS2 2IVMA 2X9DA 1MJBA 3LFUA 4NBQA 2LMDA 2NS7A 3IH3A 4JX4A 1UHWA 2HOTA 2R3SA 1K78B 4BJ6C 2JA2A 1I1SA 3WHBA 4GFBA 4JBAA 2LBFB 4XRMA 2GXAA 1SD5A 1IGNA 4C2TA 3P9KA 1W5TA 4CDGA 1YITI 3TW7A 5L3CA 1XGMA 3MKLA 2X1CA 4I01A 1ZLJA 1YJ9I 2QKLB 3BTCA 4LIUA 4E7HA 2KRHA 2ETHA 2QM3A 1FMWA 1MD0A 5ERIA 1XMXA 1YS7A 1SMYF 2HYJA 2JUGA 3TQNA 1QHGA 2MGQA 3TMOA 3VYTB 2F4OB 4LB5A 2E36A 2DOAA 3RPUD 3ZQLA 1SAUA 1LVKA 4XK4A 2DOFA 2H8WA 4QWQA 4U7BA 4F3QA 3A1YA 5EZHA 3I55I 1FYLA 2GIZA 4KN4X 4P5OA 4Y3OA 1TQMA 2JN6A 4HOBA 2R0QC 3BP8A 4IO9F 1LE8B 1G3TA 2QBYA 3WU0A 3OR2C 3JAMK 4PJ0C 2DTZA 4BE1A 1EJ9A 1E3PA 1LVAA 1JGGA 5JHFA 1R6RA 1H89C 1TBXA 3I59B 3LSKA 1V3FA 3DPLC 2IT0A 4MTDA 4BAYA 4XMYA 4U7DA 1Z3YA 1WCMJ 4FX0A 1S8NA 3OYDA 3V4GA 4G6TB 5HS8A 3CCSI 4PDKA 1VI0A 2VE9A 5FO5A 2R7ZJ 1FTZA 1D1CA 1ZHFA 1I3QJ 4AWXB 2ID6A 1Z6RA 4AIHA 2D1VA 1P4XA 4KT5C 3F6OA 3HZJA 3HOUJ 4RAZA 1B6AA 3GZNB 1M1EB 1X1CA 2ECBA 3HKZA 3M8FA 1DU6A 4MQ9F 4IXAA 2XF6A 3DU5A 4IQJA 2QLZA 1NHAA 1YLFA 3BG7A 4CGZA 4YIFA 1MNMC 4HX7A 4E4HA 3A03A 2X51A 2JMWA 3GMEA 2FE3A 1ONVA 4B47A 1GHCA 1LFBA 4J19A 3JRDA 3B02A 3M8EA 4E7IA 1XC5A 1RKWA 5EGOA 2HOSA 1KU3A 1OCCH 3HIFA 1DQUA 1I1GA 3FXLA 4HAMA 5FRNA 4IHTA 2R5ZA 2V1DA 3PO2J 5HLGA 4ZDPA 3IWFA 4AVPA 5IT9K 2CFXA 1GV5A 2R7RA 2P5VA 4CICA 3EDPA 1W5SA 1MBGA 2R5YA 5IY5H 3DLLF 2XDVA 5GADJ 1RPWA 5HODA 3OS0A 4E7LA 2HDDA 1TNSA 4G6QA 4XLAA 2E2IJ 3ZCOA 3DPUA 3A0BC 1G8XA 1RNLA 1LEAA 5E3NA 2L0KA 2O0YA 2HTJA 1XN7A 1XTAA 2PQ8A 4LK0F 5GPCA 3S1NJ 3LSTA 1ERDA 2NS0A 1RR7A 2FD5A 3RQIA 1UHSA 3RIRA 2NAZA 3U1DA 5HLTA 2F5VA 5D5WB 4LOCA 2LD5A 4HNTA 3HOXJ 1HF0A 2NVUB 2ELKA 3OYBA 2MSYA 3ABLH 5E3MA 1OMIA 5DM6F 2L02A 3K2ZA 2PX9A 5GTIC 1GT0C 1LDKB 1BM9A 2DAOA 2K9NA 2VBXA 2R7FA 1REPC 3HRUA 1ETWA 2Z5UA 1O4XA 3QU6A 1TT0A 1HC8A 1VTNC 3S15J 1BW6A 2DU9A 2WWYA 1FJLA 5CLSA 3GTQJ 5HLHA 1POGA 5DCMA 4PFOA 1EH8A 1UAAA 3BJAA 5HDKA 1FY7A 2X4HA 3OWTA 4NHJA 2XAJA 1FP2A 3H1CA 5FD5A 2MW8A 3KP7A 3MMYB 2O6GE 4BACA 3AG1H 3FK7A 5CYVA 4A12A 4G7ZF 1K4SA 3J80K 1OKRA 3TDUC 4PJLA 2ZMEA 4XKVA 3W6KB 1V4RA 3A02A 2IP2A 3TGNA 1SD6A 3IH2A 2AS5F 2DFIA 1IO2A 2E5ZA 2BW3B 3DCFA 2O9LA 2ACJA 2WAQN 1ETKA 3I56I 4XLEA 2OUMA 1HDPA 2Y0MA 2IGOA 5BS6A 4KISA 1R00A 3DP7A 5FKOA 3KYCB 3HEFA 3GWZA 2EH3A 3OYFA 1NK3P 2J5PA 3I4NJ 2LNBA 2FOWA 1HQCA 1WRJA 2HU9A 2E7WA 2FBKA 1T0FA 2CGPA 2LP0A 2DK5A 3G1MA 1DPUA 1BOBA 2Z1DA 1RESA 2P4WA 2RAEA 4HSRA 2Z33A 1JUSA 3I4PA 3W2VA 1PUEE 3HPHA 3F9KA 1R1TA 2XF5A 2YSRA 2V1UA 1D8JA 2M7BA 5FKNA 3T8RA 2KP6A 4EJOA 1MMAA 3FK6A 3DTIA 3RI4A 3ABTA 2NS8A 4B48A 4HW0A 5FRMA 2KIQA 1K7AA 2HQAA 1Z6TA 2NOGA 2IS4A 3GZ5A 1V55H 3CLQA 2MABA 3IV5A 1R36A 5C3EJ 4DZPA 4N4NB 3KETA 1D3YA 3VDXA 4CCLA 4JQFA 4RBOA 4HQEA 3K4LA 4M9ZA 1RR8C 3K6GA 1B72A 4IF4A 5JHUA 3CCLI 3FX3A 1PP7U 2FX0A 3GTKJ 2LH9A 3MCZA 4EQQA 3FXUA 4DYQA 1XD7A 3MN2A 2F5CA 2PJRB 1GVDA 2GA1A 2M0MA 5M3FJ 4WK8F 1QZYA 1W1WE 2AXLA 3DXJF 2EPFA 3KEQA 2O3FA 4A93J 1MBJA 3BC8A 3DLAA 1AKHA 4CXFA 1X1BA 2G7HA 4DBQA 3G1OA 2CUJA 4BDZA 3OIPA 4DBRA 3PFYA 3EYYA 3E6DA 2KIUA 4HBLA 2V1NA 3OMYA 2AXTC 2XPUA 1IJWC 2HI3A 3ZMZA 2V1XA 2QQAA 3K70C 3RSNA 2EV0A 1F36A 3K7AJ 4DNCA 3S3NA 2HZDA 2FA5A 1DUXC 2JRTA 3BR1A 2XAFA 3HGGA 4PUSA 2EJRA 3PIOF 2LY9A 2Q8KA 1MBFA 2CUFA 3R0JA 1WGXA 1KQ0A 3NWSA 2GLOA 4F7ZA 4II3A 4IHYA 2JRMA 1B9NA 3AL0C 2XGXA 2HDCA 2HXIA 1YW7A 3PFIA 2FF4A 5ED4A 4NUBA 4Z6YA 3FHNA 4RLFA 4FX4A 2V7FA 3IWZA 4FHTA 2CS3A 5GAEJ 3PNYA 4GYGA 1Z9CA 4A0XA 1HSJA 1NG6A 3BG5A 2KPMA 3AG2H 4I98B 5CVUA 2K9MA 2UUZA 4M3GA 4QLCU 1I6HJ 1P2FA 2D5VA 1T0FC 4Y4RA 2E1CA 4A0ZA 1KQ8A 3AAFA 3ASNH 2P6TA 2GXGA 1IN5A 2Q0OA 3KYLA 5HS9A 3CJTB 3RKYA 3CDLA 3LSJA 5D4RA 3DEWA 4BEHA 1O3SA 1D8KA 4ENJA 4F55A 5HVQC 1UMQA 1GV2A 2W57A 4PK4A 5D5VB 3MFKA 1YOVB 4QSHA 4C3JJ 1XGSA 3SQNA 5J8FA 1EKEA 1VNDA 1I3AA 4A3DJ 1TNTA 3K4KA 2XB5A 4RM2A 3FXKA 4ZTJA 3FF5A 4IEJA 3HRSA 2KL4A 1BR1A 2DA7A 2STTA 3F8NA 2Y2ZA 4AYBA 4HQMA 2CG4A 5E8IA 2VC0A 1TLHB 4HG2A 4I99C 2XKOA 1HDDC 2A6TA 4KIGA 5GAGJ 1O3QA 4I2OA 3RZOJ 2DBBA 2HR3A 3I58A 4EJTA 4RGUA 1Y1WJ 1XSXA 3IH4A 1USTA 4NDLA 4CYCA 4PJJA 2FNPA 5JLXA 3KP4A 3BPVA 1I50J 3PUBA 1MNEA 2LY1A 2AQEA 3FXQA 1FBUA 3ZP5A 1X3ZB 4XN0A 4KITB 5J3LA 3FKJA 4X1EA 3U2RA 4A69C 4Y7NJ 4XLFA 1J09A 1HKSA 2KRCA 3DQVC 3BG6A 4Y15A 5F1JA 2UXNA 3K0LA 1KU2A 2M30A 3TOBA 2RNJA 2J5OA 3E6BA 1P4WA 3F21A 3R4KA 2ZFUA 5BQTA 1Z67A 1HBXG 2A61A 5K7FA 2O8XA 3CUQA 4CCMA 4ZZDA 4GO1A 4WXDA 1V5GA 3G4SI 4DW6A 2N8GA 2EIMH 4RLQA 2WV1A 2X0LA 3KYDB 1RI7A 4RAGA 2GWRA 1LUJB 4XORA 2F4IA 3SYTA 1VQMI 4KYWA 2VIXA 2W85A 5GTHC 4LG0A 4PJMA 2PMZA 3IAM2 4NC7A 4UUTA 3REOA 3L09A 2QA4I 3CCYA 2DT5A 3MAJA 3IL2A 2V6CA 2IS1A 1BJZA 4JX6A 1U0JA 1G4DA 4LITA 1K61A 4RA2A 4E7JA 2VI6A 4WCGA 3S1QJ 1TTYA 2W24A 3LSGA 4YIRX 3OL3A 2KKOA 1YIOA 4UVAA 2A69F 4I02A 5DD8A 4XRSG 2WAFA 1B1BA 1IRFA 1KQ9A 2LF8A 3J7AY 1S29A 3EUHC 1Y1VJ 1CQTA 1JI8A 3RTRA 1ENHA 4E7SA 2LR8A 4Z2YA 1TWCJ 1U78A 1T08B 2DI3A 4BH9A 2V9VA 2HEOA 3ZMDA 1VQ4I 3E6MA 1X19A 3N4MA 3CC2I 1FOYA 3OYJA 4M3EA 3LA3A 1ZH5A 1XDSA 2MG4A 3EPZA 4UB6C 5DYMA 5LRRA 2R7SA 2PMZN 2PG4A 1BI2A 2X6WA 3FMSA 1G2HA 3TKYA 5LD2C 3G3ZA 1TWHJ 3L2CA 2QSGX 1H8AC 3SJMA 1YE9A 4ZC3A 3BQYA 5KHDA 4UUSB 5D8KB 1SVMA 2DMTA 2OJED 3WHCA 2ZXJA 1R4MB 1Y39A 2QWWA 3S2WA 4A3GJ 3KFWX 4D0PA 2IS6A 3ZQHA 3GLXA 2CQXA 3MD2A 5ICCA 3CMYA 1HSTA 2WAQA 2HFHA 1DDNA 4DOZA 1CF7B 1QZEA 4G6DA 4UHTA 3RDIA 2COBA 2HOEA 1USSA 3P9CA 1YJWI 3OIQA 2HOAA 3COAC 3GVAA 4E7KA 3W3CA 2VJIA 3HOWJ 3I64A 3KEOA 4ENMA 1RC9A 2HQRA 2IA1A 3F3XA 4M73A 5F64A 1B59A 1H9TA 1F1ZA 3ZMVA 4BDYA 4A3KJ 5BPIA 1S7OA 4IX7A 3FISA 2Q2EB 1IUFA 1T8IA 1GDTA 1YYVA 3H35A 1ZLKA 5AIPA 1DU0A 2EFWA 3H92A 1ZREA 3Q0UA 2XVCA 4C30A 3ULQB 1R5GA 4XONA 1XMKA 2KFDA 3HRTA 1WJFA 3HYIA 1XG1A 5TISC 4J00A 2JA6J 4BHPA 1D5VA 3LL7A 1LPQA 1GXQA 2EZLA 4CCOA 1ZGWA 2R7XA 5F1RA 2GZWA 3H3UA 3JW4A 5B1AH 5HOOA 2JWTA 1NK2P 4IRGA 2LTPA 2H1KA 1Q1VA 3HC7A 1R49A 1U5TB 4J01A 1WHUA 3L2VA 3PL8A 1VFCA 2A5WA 2XC7A 1TP4A 4JP0A 5K7ZA 1T95A 1V5FA 3AL0B 3JRAA 2R7UA 4L5IA 1FOKA 2BBYA 4EM1A 3TEDA 3FBIB 5LHIA 3K1NA 4PFPA 3SZTA 3JR9A 3HXLA 4UXNA 5D6FA 3LAPA 3GLLA 4Q4ZF 3AFHA 1DGWY 2DA4A 1O57A 2BHYA 3BZKA 1XSDA 2L9RA 3OOPA 2L2OA 3B6CA 2RQPA 2CV1A 1ZAOA 4L5JA 4N9IA 2QENA 2XAHA 4A3LJ 1MJ9A 2R7OA 4HLXA 1ZGAA 5KAFC 2M1BA 1MNDA 1TQIA 4FISA 3PNVA 2ZXIA 1SAXA 4PZJA 4QTRA 2WB1A 4OIRF 4V19K 4RB1A 2MYSA 5B3SH 3H5RA 2YPRA 3ZN0A 4EVIA 1S72I 1J9IA 5A2QK 2XPWA 1G3WA 3BZCA 3F22A 1ZG5A 1N75A 1MMSA 1XGNA 2JK3A 2KISA 4DQ2A 4S05A 3NQOA 2ZCWA 1YRNB 2H6CA 1T33A 4DIQA 1SC7A 1W36D 2RQQA 1IRZA 2WA0A 4Q48A 2Y69H 2FNAA 3FIWA 3CTAA 2L7MP 1XB4A 1FPQA 1VF9A 3JSPA 3ZQCA 2EQRA 1VQLI 4D7NA 2K4JA 2VQCA 3S8PA 4HNVA 3OYEA 2P81A 4F92B 1BJAA 5E18F 2PI0A 2QSFX 4BNCA 2LDUA 3LNQA 1WJBA 1BR2A 3HG9A 2JUCA 2ZSIB 2R7QA 4OAYA 3PIPF 1W36C 5F6FA 2V9PA 5DTDA 2IS2A 1ZELA 3BOQA 3FXMA 3TP3A 3MZHA 4AVZA 1ODDA 1TT5B 4WF2A 2JSCA 3HSEA 2W4SA 4XKCA 4FQGA 3QOEA 1ZN2A 4BL0B 4HEA2 4OAZA 2PJRA 3ERED 4FTHA 4L18B 2RVCA 3K4NA 2LC2A 2H1LA 1FBSA 1LFPA 4OWRB 3FWEA 1VQ9I 4OMZA 3CD6I 3G2BA 1DPRA 2HQNA 1JUPA 3M4OJ 5CVVA 2ZB9A 5ICEA 1S9HA 1OLTA 1BC7C 2L9SA 2BY3A 2BXYA 3E7LA 1Z21A 3M07A 2VQGA 1FBQA 1TW2A 4L0YB 2L9NA 3ZOBA 3ZQIA 1RETA 2EIJH 1P6RA 1YTYA 2M0CA 1PP8F 1B72B 3DBLB 1BA5A 2QSHX 1IXRC 2MFZA 2YU9J 4EEFG 4NC8A 4E70A 4XN3A 3QOPA 3GFIA 2HYGD 3GBGA 2FQ3A 3GXOA 2H94A 2X85A 2YX7A 1ZR2A 3NRVA 1OYYA 2E5NA 1OCZH 2Y0SA 2X6OA 5EG0B 1VQ6I 2UZKA 2JPBA 4CCNA 3F0CA 5FJ8J 2LKXA 1FMVA 3J7YJ 1VQNI 5A2QZ 4AIDA 3Q9VA 1YIJI 5JVTA 4DZJA 2FBIA 3IKVA 1U8RA 1RUOA 5CVIA 3ZMTA 2MD5A 3UR3C 3JRCA 3ECHA 3RPUA 4A3JJ 2FU4A 3O8GA 3HOSA 2VOPA 2XRNA 1F9NA 3I71A 4B09A 1WJEA 2DYSH 4D1QA 1YQAA 4F52A 4Q5SF 4IHXA 2E19A 3MVPA 2QEXI 1ZRFA 2WTEA 2KZGA 4JK1X 4ESJA 4ENKA 2Z9OA 1I6XA 2MC4A 4C2MJ 4BXUA 1OR7C 2O61A 2I8DA 1QGPA 3OS1A 4KJZA 1TL8A 5KCMA 3MKWB 1K79A 3GTMJ 1X1AA 2LYCA 3OOUA 5L3EA 5E1WA 3SHFA 1Z91A 3D5SC 1P9QC 1R1VA 2DQRA 4NNJA 1S6LA 4A6EA 1WJDA 2KIFA 3V8LA 1U9OA 3DPTA 5EEGA 2OA4A 5M5XJ 2A07F 3U1KA 2W25A 3E5UA 2WY8Q 3DEUA 2CYYA 1AHDP 1UFMA 4ZZLA 2YUSA 1XCVA 4GDFA 4WXCA 2OCCH 4XBFA 3ECOA 3QPTA 2H6BA 2DT6A 1B9MA 5B5EC 2DA5A 1MGTA 3JTHA 3TW6A 3CO6C 3LFKA 4G7HF 4IRIA 4BU2A 5J4YA 1NTCA 3VODA 4IRHA 2XF7A 4L9JA 3ZQ7A 4XSXF 1IG7A 5DDGA 2EZKA 2ID3A 1IDZA 4KN7X 4I0BA 2ZXWH 2QQBA 3DEEA 3KLOA 3V8KA 1T56A 4IPAA 4I0AA 4HDVA 3BZ6A 2A68F 5FLVA 1LDJA 3S93A 3BCBA 2Y48A 1GXPA 3A01A 1JKQC 2EZIA 4BYYA 1YW8A 3CCVI 3OIOA 2R4GA 4PGGA 3SEQA 3QP6A 4G94A 3E5QA 4AU7A 1E3HA 2XSJC 3W2WA 3IRRA 2W7NA 5E8GA 2WBMA 3OYNA 4PCQA 1IC8A 2P0WA 2COMA 3OS2A 1U8BA 5ILUA 2E35A 3RJPA 1X4PA 5TJJA 5GAHJ 4UNOA 4M9XA 4CZCA 4IOCF 4U0VA 4UB8C 2DO7A 3BPXA 4YG2F 2ADUA 3ABUA 4OMYA 2HKXA 4BEHB 2FSWA 2VB6A 4P55A 1Z1DA 2BYVE 3O3KA 2L01A 3BJOA 1PVEA 5H6RA 1KGSA 3CDHA 5LRSA 1JJ8C 5K5QA 1Q1HA 2DQLA 2XPVA 2Q1ZB 1D0XA 3BTIA 4EJVA 4BJ5C 4JOMA 2L4MA 5FLMJ 4EGYA 2ECCA 4RB0A 1LEBA 4PJNA 2HNHA 3CP8A 2DA6A 1FIPA 4U0WA 1OCTC 4L0ZB 1JT6A 1Y6IA 1F5TA 3TO7A 3TO6A 3IP4B 2L4AA 3H5NA 2VT2A 4UVBA 3BROA 4ESBA 2XSDC 2IA2A 2M8GX 1ETOA 3SDGA 2RDPA 5J8CA 1SANA 3I53A 2EFOA 5FB2A 2STWA 3DV8A 1FWZA 2ME6A 4D9JA 1YX5A 4ZYGA 3CESA 5FGMA 1U5TC 4ZYHA 5K1YA 2D1HA 3C7JA 1MDMA 2DJIA 2CWEA 2GOXB 2QBYB 3ERMA 2QUFA 3LSHA 5CPRB 3T8TA 1JKOC 4OU0A 4B43A 1D1AA 3G73A 2NYXA 4RAYA 3HUGB 1FZPB 2DTRA 2EILH 5EEAA 2XGDA 4D7MA 3E6CC 2RNGA 3M7GA 1WWXA 4OINF 1RRJA 2EA2A 3PQKA 4E7ZA 3UKGA 2FEZA 5DUIA 5IYCJ 2VASA 3H0DA 5ILSA 5HLIA 2BVMA 3N97A 3OR1C 4GCVA 4M6XA 3L9FA 3H5AA 1X2MA 3I4MJ 3JRHA 3KLNA 2VUMJ 2WAEA 2F5DA 2L5QA 4CO8A 3BR5A 3EUHA 2M9HA 1QHHD 2R7WA 1LB2A 2CUZA 3CP2A 1IW7F 3OYAA 2XHKA 4RMNA 2UV1A 2DDAA 1J59A 2FUG2 2OU2A 3CQZJ 1QQIA 4XL9A 1J75A 1YFHA 2DPDA 1MMGA 3BR0A 1BBYA 2H09A 3ZQFA 5LGNA 1ZGJA 3HBLA 3T0YA 5KAIC 1QNTA 1SFXA 2P6SA 1Z05A 5CKTA 2R5ZB 2ZKZA 3AG3H 5E1XA 2OAZA 2ELHA 4M9SA 5EJCA 3ZQGA 3LA7A 5EGOB 2W00A 1O3RA 1D1BA 2P8TA 2TRTA 1I39A 4LK1F 1T6SA 1FX7A 4ANJA 4XR6A 3OYKA 5BOXA 1FTTA 2CQ7A 2IXSA 3CUOA 2R7DA 5HNHA 3HOYJ 4YFXF 3KZZA 2CMPA 4L9VA 2DPUA 4GXOA 3QP5A 2HPMA 2IPQX 1UG2A 5LHHA 4QPQA 5K5OA 4XLCA 2FOKA 4OOIA 2E1MB 4ON0A 2GIVA 2RC4A 4RGRA 4LLNA 2B0LA 4UUVA 2JPCA 4XNFA 1ON2A 3J81K 3QU3A 2IGKA 1MBEA 2XROA 3BWGA 3W6VA 4LG0B 1Y8RB 2OF7A 2GBYA 1ZKGA 2DK8A 2K40A 1QA6A 3S2DJ 1WKMA 4BGDA 2E2JJ 3GTGJ 2DMNA 4HYEA 5IP6A 1HOMA 2BGCA 2DA1A 1T38A 3M3YJ 2DOEA 2V6EA 2EB7A 2VPRA 5FKMA 3BR6A 4KIFA 3E97A 5J4VA 1E0EA 2QQ8A 1YG2A 2K4BA 4EV0A 1G3YA 1L0OC 3A0HC 1IN6A 1B8IB 1WZ2A 2JT1A 1J0RA 2LLKA 1CF7A 3O6BB 3J80Z 2GM4A 1RKTA 1FEXA 3RCOA 4RAFA 4ZYAA 3GTLJ 3S3OA 2DMUA 3ABMH 2H27A 3BTJA 2NOJB 4WWCA 1XCBA 3MKYB 3K4BA 3H9GA 1QPIA 4P1WA 2ME0A 2CSOA 3LSIA 2EV5A 1LE8A 2MLKA 9ANTA 3ELKA 1W5CC 5E1ZB 5H6QA 2EIKH 2PN6A 3G6EI 2VKHA 4B44A 3F72A 3WGGA 1QPMA 2ZFWA 2G9WA 2EK5A 2O8KA 3F8BA 3P7NA 1X1DA 2VBWA 4O5VA 1S7EA 3QPLA 2FBHA 4IZZA 2ZJRF 1J7KA 5D6EA 5IYBJ 4FCYA 4IHWA 4LFUA 4EM2A 1KU7A 1AA7A 2O7OA 2YX4A 4MGRA 3WTWC 3CZ6A 3J7ZI 4A5NA 3CCQI 1FLIA 3CF5F 4CZZA 2KRFA 3FMRA 1HW2A 3DU6A 3HUGA 2CQQA 2ICWG 2K3PA 2RV8A 3SXYA 3WE2A 2HQ5A 4W1UA 4C9YA 1QZZA 2O5RA 1JKRC 1BR4A 2ZMEC 4GGGA 3Q3SA 2DA2A 1TWAJ 2K02A 2ELJA 2M34A 4KMUX 3C2GA 1IXSB 2IRFG 2EINH 4HLYA 4MIMA 1RZ4A 4B1RA 3TDZC 1H0MA 1UJ8A 4YFNF 1T39A 1YO5C 1TQPA 2XGCA 2HGCA 2K85A 1ETVA 3HOTA 1K4TA 1TZLA 4I7HA 2K9SA 1YRNA 4FE7A 1XPXA 3PM1A 3PNTA 2M3AA 4ENNA 2ZNYA 2F4MB 3DWLE 5TRDA 2ZJ2A 2L54A 3OL4A 4RS8A 1J5YA 3PJRA 5ICFA 1QRYA 4ABZA 1GVJA 3K4MA 3ZQQA 3RKWA 4O3MA 3DF8A 2LKSA 3K9TA 3BG3A 3G1LA 4A2UA 5M3MJ 5J1UA 4KDPA 4XQFA 3KPHA 5BMZA 1IN8A 2H8RA 2MLGA 3F8CA 1CGPA 5K7HA 1FSEA 2BY1A 2EFNA 1LFUP 1Z0XA 3WTSC 2MH2A 1FOWA 2JA7J 4AM3A 1XGOA 2DT7B 2E60A 5M5YJ 2E1OA 2JA5J 2K3FA 1PJRA 2IGNA 4BQAA 3OV8A 3LAJA 2ZC2A 1MJAA 1FNNA 3FBNB 3HOVJ 5C44J 2IGMA 1HKTA 2PFBA 4LB6B 3L2UA 2CFOA 3RYRA 2Q2EA 3BY6A 1PDNC 2PEXA 3CC7I 4LJZF 2A6HF 2BEOA 3ZXSA 4XKBA 1OISA 2HVQA 1ZARA 4XLHA 3CJRB 3WODF 5EZGA 4A3EJ 1GLNA 3VFZA 2DFFA 2BZTA 3LSPA 4M72A 2ZXHA 4XLPF 4M3FA 2OCEA 4P9FA 3WTUC 4CUGA 2VXZA 3LQQA 4AIJA 1C0WA 2DFHA 1VQKI 5B1BH 1Y56A 4NC6A 4O6JA 3TL4X 3UNGC 1YX3A 3GX4X 1R7JA 4HRIA 1Z7LA 3V7CA 2LRDA 4C3IJ 2R93J 3QODA 1YHQI 4MFEA 4TV7A 3MWMA 2W48A 4QIWN 4KICA 2WB1N 2YS9A 1BL0A 2E2HJ 3GFJA 5B66C 1P7IA 4HPQA 2B63J 3QQAA 4L5EA 2Y30A 2NXNB 5C4XJ 3V7RA 3QPSA 3ZRGA 3L2WA 5LEJA 3LMMA 4ZDLA 5TGTA 2F2EA 1DGRM 4BQQA 3K2AA 2F48A 4EJUA 3TP0A 4AYBN 2V9KA 2NVXJ 3EUAA 2QGUA 1ZG3A 4DYRA 1AWCA 1WJAA 1BI1A 2GXBA 1R22A 4I09A 2QYOA 2E34A 2VJ5A 5IOYA 1JUMA 3PUFA 1TWFJ 1KYZA 4ITVA 5LGTA 5M5WJ 2E71A 3WTVC 1APLC 2EV6A 1MBHA 2P7CB 1R58A 4FASD 2R92J 2CV0A 1ZYRF 4XIDA 2KIMA 1OFCX 4K2EA 5CQEA 2KMUA 2ZNZA 1R1UA 2PMUA 2BXZA 5IP9J 2NVQJ 5JR3A 4UVCA 2KJCA 5L3GA 4AD9A 1F43A 3ASOH 4RB3C 3D5LA 3I9V2 2IBDA 1F4KA 2IAIA 2F5FA 2F6CA 3J81Z 1MH3A 3JRGA 2M2EA 1A36A 3HDDA 2RREA 2QZ8A 2RGVA 1FT9A 2QVOA 1A6IA 2MA3A 3I59A 4X0GA 1WVRA 2KDZA 4AUXA 2OTLI 1LJ9A 3QPHA 3ZGKA 2VONA 3DTEA 3KCCA 1LNWA 2V79A 1A31A 4NB5A 3DTKA 3J7AO 2LKPA 3I0TA 3U21A 1P7JA 3CO7C 3C3WA 2TCTA 1ZR4A 2VODA 4M3DA 4BHCA 2X1DA 4A3CJ 2KZVA 4IL6C 1AKHB 1B4AA 3K10A 5LFAA 3GFLA 4LLGF 1FSHA 4H4KC 2R7VA 2EA4A 3K4JA 1OJLA 1JTYA 2DCEA 2LK2A 3IUOA 1UELB 4OIQF 4OIPF 1Y8QB 2FRHA 1D0YA 3CCJI 5D4SA 3RKQA 5KK1A 2UXXA 3DKYA 3I54A 1KONA 2CO5A 4U88A 1L3LA 3V7SA 1X3UA 5LHGA 4HSTA 1UG0A 3LOCA 3TOAA 1VQPI 4XM3A 1JHHA 2VT3A 4ZH4F 1UHMA 3HSRA 4XSZF 3H9JA 2X1EA 1ETQA 1TW3A 4A3BJ 3BG9A 3VYSB 4LG3A 2NVTJ 3TBIA 1SFOJ 2ISZA 2M45A 1TC3C 1BOAA 4UV8A 3GUDA 3WTTC 1EV7A 1STZA 4KT6A 3C1DA 3HTSB 3HL2A 2UWMA 3HRMA 2G7UA 2B9SA 3FXRA 3GCMA 1MKMA 3D1NI 1ETYA 4U0YA 3WGHA 3T5XA 3T1BA 1JKPC 2OBPA 3SDBA 3JAMZ 4ZTFA 2HKOA 2ESNA 1ITYA 3U9GA 2JZYA 3FZVA 2K7LA 1S3JA 3QWLA 1OCOH 5J1YA 2CW0F 2BV6A 5FKLA 2GA2A 4PSXA 4GYIA 1FIAA 3HKZN 1FYMA 4UV9A 1X4OA 4ESFA 5HS7A 5F04A 4XRSA 3K1PA 3VPRA 3CC4I 3WG7H 1N77A 2V26A 1VQ8I 4F91B 2CQNA 3CLOA 2P5LC 3GW2A 1OCRH 3FM5A 2OV7A 2DODA 3H36A 4FT8A 2LG4A 1FOXA 2DXIA 3FHZA 1ACIA 1P92A 1S5LC 2OC6A 1K6YA 3V42A 5AIQA 4N9HA 3RQ4A 4EGZA 2PBIA 4XKWA 2ZSHB 3GYHX 1ON1A 3S17J 2Z99A 4S04A 4HX4A 3W2AA 3HPGA 4ETSA 5L3BA 3L2QA 3ONQA 1XDUA 4DJAA 3OYIA 2QQ9A 1YJNI 1W7PD 3H0GJ 2MD0A 3QYFA 1QO0D 2OPTA 1JTXA 4DGWB 1IN4A 1GUUA 1G3SA 2K9LA 4LD5A 5IPAA 4M6YA 4IKFA 4JYKA 3R60A 4NQWA 1OCPA 4MEXF 1BI0A 2OZUA 4CYDA 2L7KA 3PSFA 1V5EA 3WE3A 2ISYA 1V54H 1QVUA 1W7PB 2DJNA 1NH3A 3KX2A 3CUQC 2XB0X 3S2HJ 2VLAA 2OZ6A 3ZN1A 3V8JA 5HNFA 2AHQA 1MSEC 3VYUB 2HDWA 5EEHA 2L9VA 2VE8A 3BTLA 1H9GA 2R5YB 2VKVA 4YIIA 2XAGA 4LLLA 1KA8A 4HDUA 1YW9A 4HZFA 1BIAA 1D5YA 5H20A 1I27A 1X58A 2LVSA 4G9YA 5J47A 2Z16A 3MZYA 3HSFA 1X1PA 2ZJQF 2NNNA 2LF7A 5F08A 3KZYA 2JA8J 3L2RA 2VKDA 1E3OC 3CUQB 4CCJA 2D2WA 4ZJZA 3R6SA 2LOOA 2AQFA 4B4CA 2QCOA 1LKXA 3CMAI 1HXDA 1JXSA 2A3SA 3WG9A 2E7XA 4LGWA 1H88C 1AOYA 3ESWB 3P5JA 5FLXZ 2NNYA 1ZTRA 5IP7J 4XOTA 4UY8I 2BHZA 3CF2A 3KEYA 3S3MA 1DP3A 2Y9ZA 3JREA 3ZMUA 1O7LA 2M4GA 4MLOA 2FMLA 2LREA 1UCRA 4HX8A 5JFRA 1ETXA 2CW7A 3Q5FA 2VOOA 1HA8A 4HF0A 2JJ7A 2MBFA 5FFXA 2KLOA 4I6ZA 2K5CA 2L3DA 3BQZA 4IQ4A 2L7ZA 4G8XA 3K1MA 5GPAA 3DBRB 3HHHA 3F8MA 2RN7A 1Z77A 3GTJJ 2X6YA 5DEQA 3DFGA 4BBSJ 3JSOA 2Z3YA 1EF4A 2EWNA 5FKKA 3RZDJ 5GP9A 2HYFA 3OYMA 2PJPA 1IZ1A 2XRLA 4P96A 2GQQA 2GOMA 1Y0UA 2YU3A 2W82A 3JRFA 1G59A 2DN0A 2D45A 3Q0WA 3EQLF 4EJWA 3L00A 2BY0A 3CJNA 2FJ1A 3L1PA 4D5FA 3OY9A 5DCMB 3M1EA 3M8JA 2O03A 4A3FJ 2L7FP 2WY7Q 1WSUA 1WH5A 1X3WB 3AG4H 3S1RJ 3HJEA 1W7PA 2A5YB 2ESHA 4IVNA 4S0HB 1HCRA 4KNYA 4MTEA 3M9AA 2KT0A 4MHGA 1SVOA 3CMMA 3KP3A 1UZCA 1IN7A 4M3BA 2DFEA 2HS5A 1MSFC 3E0JB 4M71A 5L3DA 2WC2A 3MQ0A 1QBJA 3B6AA 3FKIJ 2XIGA 2DA3A 1WQ2A 2G0EA 2QKMB 2VBYA 2CQKA 2X48A 4IJAA 2JSPA 4II2A 5KNLA 5JLWA 2BE5F 3BT9A 1U2WA 3CJQB 2Y9YA 4KFCA 3RKXA 2DDBA 4CHUA 4BXXJ 1HKQA 2OTJI 5DCFA 1D0ZA 3VSLA 1LQ1A 1FYKA 2DMQA 2HWVA 4PGHA 4HV5A 1OPCA 5J40A 2P5KA 3DBHB 3H9QA 4BQNA 1ZQ3P 1BW5A 1IRXA 3A01B 4W97A 2JQ7A 2P7VB 4UUSA 4BY7J 3KE2A 4WXHA 5LBQA 4U87A 4X6AJ 3I5UA 3X2QH 1WH7A 1MIJA 1MMDA 1OYWA 4N4OB 3E1SA 3QRFF 2GAUA 1MMNA 3C2BA 1VQ7I 1VQ5I 3KP6A 5D5UB 1XX5A 3LSMA 1JHFA 1SFKA 3IRQA 3OYCA 1SD4A 3GTPJ 1G6NA 2JTVA 3ABKH 3QAHA 5H2FC 5DD4A 3S16J 2I10A 4RM3A 2MC3A 5E17F 1SFEA 2VPLA 4CSWA 1R23A 1WJCA 1YI2I 3EYIA 2LFBA 3Q0VA 3OSFA 3HM5A 4CA0A 4B3AA 1T98A 3D5RC 3HOZJ 3JTGA 3BDDA 2CJJA 1E2XA 1MDMB 3EETA 4AIKA 1NG7A 2X6XA 1U6GA 5DM7F 4IOAF 3PQJA 3A2KA 1A35A 2VC1A 3FM3A 1TWGJ 2XAQA 3GFMA 2Y75A 3VB2A 1JJ6C 2M4KA 2M5WA 4CH7A 5LGUA 5FLXK 3QYBA 4Y17A 1HLVA 5ICGA 3LQRA 3HTUA 4KMFA 2E1MC 2TDXA 1BIBA 2M8EA 5E3OA 1EH7A 1IUYA 2E1NA 4BE0A 1W0TA 4BBRJ 2K9QA 3VYRB 3QYEA 1IAWA 4BY1J 3PSIA 1AU7A 3F8FA 5AONA 3HHGA 1A04A 3SFIA 4AC0A 1B8IA 2OQRA 4CCKA 1A6QA 5FROA 5C4JJ 1SFUA 1A5JA 3NARA 4FE4A 5FFZA 3CMEI 5E79C 5K5RA 1ORKA 1Z3XA 4GRIA 4A6DA 5ILVA 1IXCA 1WI3A 1U5TA 5IOZA 5E3LA 2JVGA 5J6XA 4F93B 2VQHA 2ZBKA 3CDIA 6PAXA 4MEYF 3SFZA 5CVJA 4R79A 1R5ID 2EFPA 4B3XA 2RKHA 4G12A 2NVYJ 2XASA 2BVLA 4XICA 1X2NA 4YELA 3S32A 1KZHA 3M1CA 4RGXA 2JVHA 3DKWA 1RUNA 3IKTA
chains in the Genus database with same CATH topology
4MFEA 2FQ4A 2W48A 5FKNA 1BA5A 4QIWN 2WB1N 2YS9A 3FK6A 1XS9A 1BL0A 2E2HJ 2NS8A 2YU9J 1P7IA 4EEFG 2B63J 3QQAA 4L5EA 5F0FA 3GBGA 1W0UA 2Y30A 1ZR2A 2NOGA 5C4XJ 3QPSA 2X6OA 5EG0B 3IV5A 2LKXA 3F0CA 5FJ8J 5C3EJ 3K2AA 4DZPA 3TP0A 4AYBN 4DZJA 2NVXJ 4RBOA 4DYRA 3JRCA 1B72A 4A3JJ 2HXOA 3O8GA 1JUMA 5IOYA 1TWFJ 2CRGA 2FX0A 3OSGA 1MH4A 5DS9A 3GTOJ 3GTKJ 5M5WJ 4DYQA 1APLC 1MBHA 1MBKA 2R92J 3MN2A 4V2GA 4IHXA 5J1RA 2E19A 1GVDA 4XIDA 1R9TJ 3MVPA 1OFCX 5M3FJ 3S1MJ 3HGYA 4C2MJ 5IP9J 2NVQJ 4A93J 1MBJA 3BR3A 1PUFB 1AKHA 3GTMJ 3OOUA 1F43A 2XGEA 3G1OA 2EZHA 2AO9A 2IBDA 2IAIA 3NAUA 3JRGA 1MH3A 1IDYA 2M2EA 1U9OA 5M5XJ 3HDDA 4I76A 2XPUA 1A6IA 1PUFA 1IJWC 2HI3A 1U9NA 4A3MJ 1F36A 3K7AJ 2KDZA 4AUXA 1AHDP 3BR1A 3HGGA 2YUSA 2LY9A 3LSRA 5F27A 1MBFA 2CUFA 1WGXA 2GLOA 4Y52J 4IHYA 1P7JA 2TCTA 2HXIA 1WPKA 1ZR4A 4M3DA 5BNGA 4A3CJ 1IV6A 2DA5A 1AKHB 1JT0A 3TW6A 5EDNA 1OJLA 1JTYA 2LK2A 3BG5A 3PO3J 1NTCA 4JX5A 4M3GA 1I6HJ 1IG7A 3RKQA 2D5VA 1K83J 2EBIA 2EZKA 2ID3A 1IDZA 4MFDA 2VKEA 2CU7A 1T56A 3LOCA 5FLVA 3CDLA 3LSJA 3BR2A 5EG0A 3DEWA 3A01A 1JKQC 2EZIA 3OIOA 1ETQA 1UMQA 4A3BJ 3BG9A 3S14J 1GV2A 2NVTJ 5EF6A 2QF7A 4M6VA 1SFOJ 1TC3C 4QSHA 4C3JJ 4DYCA 1IC8A 1VNDA 4MO7A 4A3DJ 3JRIA 5F0HA 1ZK8A 2XB5A 1U8BA 2Y31A 3D1NI 1ETYA 4IEJA 1JKPC 2DA7A 1ITYA 4CYCB 2Y2ZA 3JRBA 5J1YA 1HDDC 2CUEA 4D5CA 5FKLA 1JJ8C 1FIAA 3HKZN 2XPVA 4BKXA 5FLMJ 1JKRC 3BTIA 3RZOJ 1Y1WJ 3IH4A 4NDLA 4CYCA 2ECCA 4XRSA 5F04A 3VPRA 2DA6A 1FIPA 2IEKA 3O8HA 1OCTC 5IYDJ 5JLXA 1QVTA 4IHVA 1I50J 1JT6A 2Y0SN 2XSDC 5J3LA 4X1EA 4A69C 4Y7NJ 2M8GX 1ETOA 5F1JA 3SDGA 1SANA 5EYRA 2ME6A 4A3IJ 5F0CA 5K7FA 4DW6A 2N8GA 3S17J 2WV1A 1JKOC 2DMPA 3H3VK 5EEAA 2XGDA 4D7MA 3H0GJ 2OPTA 3UKGA 1JTXA 5IYCJ 1GUUA 4C3HJ 4UUTA 4V2FA 4RDUA 5IPAA 3HB9A 3CCYA 4JYKA 2X9DA 3IH3A 1OCPA 2NS7A 1BJZA 4JX6A 4JX4A 2HOTA 1X2MA 3I4MJ 3JRHA 2VUMJ 1K61A 1QVUA 2DJNA 3WHBA 2VI6A 3BR5A 2M9HA 3S1QJ 4GFBA 3LSGA 4XRMA 2XB0X 1IGNA 3S2HJ 1MSEC 3CQZJ 2AHQA 3TW7A 4XRSG 2R5YB 3BTLA 3MKLA 2VKVA 3BR0A 3BTCA 3ZQFA 1D5YA 3HBLA 1Y1VJ 1CQTA 1ENHA 2LR8A 1X58A 2HYJA 2LVSA 2R5ZB 1TWCJ 1U78A 2MGQA 3ZQGA 5EGOB 3ZQLA 2TRTA 4M3EA 4XK4A 5F08A 5EZHA 2MG4A 2JA8J 2PMZN 1E3OC 1FTTA 2R0QC 1G2HA 2JN6A 3HOYJ 1TWHJ 1LE8B 1H8AC 4B4CA 3SJMA 2QCOA 2DTZA 3BQYA 4UUSB 2DMTA 3WHCA 1H88C 1UG2A 1JGGA 1ZTRA 5IP7J 4A3GJ 3ZQHA 2CQXA 3CMYA 1H89C 2Y9ZA 3JREA 2COBA 4MLOA 1ETXA 1MBEA 3W6VA 2HOAA 1WCMJ 2JJ7A 2OF7A 2GBYA 1ZKGA 4I6ZA 2K40A 3BQZA 3S2DJ 2L7ZA 2E2JJ 3GTGJ 3HOWJ 2DMNA 5IP6A 1HOMA 2DA1A 5GPAA 3M3YJ 1VI0A 2VPRA 5FKMA 3BR6A 1Z77A 3GTJJ 2R7ZJ 1FTZA 4A3KJ 1I3QJ 4BBSJ 2ID6A 3FISA 1EF4A 5FKKA 1B8IB 3RZDJ 5GP9A 1IUFA 1GDTA 3HOUJ 2LLKA 2XRLA 1DU0A 2ECBA 2GM4A 1FEXA 1RKTA 3Q0UA 1DU6A 3JRFA 3GTLJ 2DN0A 2DMUA 3Q0WA 3BTJA 1XG1A 2FJ1A 3L1PA 1QPIA 2JA6J 2ME0A 1MNMC 4D5FA 3A03A 1LE8A 2EZLA 2JMWA 9ANTA 4A3FJ 2L7FP 1WH5A 3S1RJ 1ZGWA 1LFBA 4J19A 3JRDA 1NK2P 2JWTA 2H1KA 2LTPA 4S0HB 1HCRA 1Q1VA 2KT0A 1XC5A 1RKWA 2O8KA 5EGOA 4M3BA 2HOSA 1VFCA 1S7EA 3QPLA 1MSFC 4JP0A 5K7ZA 2DA3A 3B6AA 3FKIJ 2X48A 5IYBJ 2G0EA 2R5ZA 4FCYA 3JRAA 4IHWA 3PO2J 2O7OA 1GV5A 3TEDA 5JLWA 3BT9A 3JR9A 2Y9YA 4BXXJ 1MBGA 2CQQA 2R5YA 2DA4A 5HODA 1RPWA 2DMQA 2HQ5A 4W1UA 2HDDA 2L9RA 3B6CA 1ZQ3P 1BW5A 2E2IJ 3A01B 4W97A 4A3LJ 4UUSA 3Q3SA 4BY7J 5E3NA 2DA2A 1TWAJ 2L0KA 4X6AJ 2M34A 1WH7A 5GPCA 3S1NJ 4FISA 4MIMA 4B1RA 3C2BA 1RR7A 2FD5A 3RQIA 4QTRA 1UHSA 4LOCA 2LD5A 3GTPJ 3HOXJ 1HF0A 2ELKA 2XGCA 1ETVA 2MSYA 3S16J 2I10A 2K9SA 1YRNA 2XPWA 5E3MA 4FE7A 3PM1A 2JK3A 2LFBA 3Q0VA 3OSFA 3HM5A 1YRNB 4B3AA 1GT0C 1T33A 2K9NA 3HOZJ 2CJJA 1QRYA 4ABZA 1IRZA 3FIWA 1ETWA 2L7MP 1O4XA 3S15J 1BW6A 1VF9A 3BG3A 3G1LA 1TWGJ 3ZQCA 1FJLA 3GTQJ 2EQRA 5J1UA 5M3MJ 4D7NA 1POGA 1JJ6C 4HNVA 2P81A 2H8RA 3LNQA 5K7HA 1LFUP 1HLVA 1Z0XA 2JA7J 2MW8A 3FK7A 5E3OA 2JA5J 5M5YJ 2E1OA 5DTDA 3TP3A 1W0TA 4BBRJ 2K9QA 4BY1J 1AU7A 3HOVJ 5C44J 3A02A 3SFIA 3IH2A 4AC0A 1B8IA 5C4JJ 3DCFA 2O9LA 3NARA 1A5JA 4FE4A 2WAQN 1ETKA 1ORKA 4FTHA 1WI3A 1HDPA 5EZGA 4A3EJ 5IOZA 5E3LA 3LSPA 5FKOA 4M3FA 1JUPA 3HEFA 2EH3A 3M4OJ 2ZB9A 1NK3P 3I4NJ 4G12A 2NVYJ 3E7LA 4XICA 1X2NA 2LP0A 3G1MA 3ZOBA 1RESA 3ZQIA 1RETA 2RAEA 1JUSA 2M0CA 1B72B 2R93J 4C3IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFE A;  2FQ4 A;  2W48 A;  5FKN A;  1BA5 A;  4QIW N;  2WB1 N;  2YS9 A;  3FK6 A;  1XS9 A;  1BL0 A;  2E2H J;  2NS8 A;  2YU9 J;  1P7I A;  4EEF G;  2B63 J;  3QQA A;  4L5E A;  5F0F A;  3GBG A;  1W0U A;  2Y30 A;  1ZR2 A;  2NOG A;  5C4X J;  3QPS A;  2X6O A;  5EG0 B;  3IV5 A;  2LKX A;  3F0C A;  5FJ8 J;  5C3E J;  3K2A A;  4DZP A;  3TP0 A;  4AYB N;  4DZJ A;  2NVX J;  4RBO A;  4DYR A;  3JRC A;  1B72 A;  4A3J J;  2HXO A;  3O8G A;  1JUM A;  5IOY A;  1TWF J;  2CRG A;  2FX0 A;  3OSG A;  1MH4 A;  5DS9 A;  3GTO J;  3GTK J;  5M5W J;  4DYQ A;  1APL C;  1MBH A;  1MBK A;  2R92 J;  3MN2 A;  4V2G A;  4IHX A;  5J1R A;  2E19 A;  1GVD A;  4XID A;  1R9T J;  3MVP A;  1OFC X;  5M3F J;  3S1M J;  3HGY A;  4C2M J;  5IP9 J;  2NVQ J;  4A93 J;  1MBJ A;  3BR3 A;  1PUF B;  1AKH A;  3GTM J;  3OOU A;  1F43 A;  2XGE A;  3G1O A;  2EZH A;  2AO9 A;  2IBD A;  2IAI A;  3NAU A;  3JRG A;  1MH3 A;  1IDY A;  2M2E A;  1U9O A;  5M5X J;  3HDD A;  4I76 A;  2XPU A;  1A6I A;  1PUF A;  1IJW C;  2HI3 A;  1U9N A;  4A3M J;  1F36 A;  3K7A J;  2KDZ A;  4AUX A;  1AHD P;  3BR1 A;  3HGG A;  2YUS A;  2LY9 A;  3LSR A;  5F27 A;  1MBF A;  2CUF A;  1WGX A;  2GLO A;  4Y52 J;  4IHY A;  1P7J A;  2TCT A;  2HXI A;  1WPK A;  1ZR4 A;  4M3D A;  5BNG A;  4A3C J;  1IV6 A;  2DA5 A;  1AKH B;  1JT0 A;  3TW6 A;  5EDN A;  1OJL A;  1JTY A;  2LK2 A;  3BG5 A;  3PO3 J;  1NTC A;  4JX5 A;  4M3G A;  1I6H J;  1IG7 A;  3RKQ A;  2D5V A;  1K83 J;  2EBI A;  2EZK A;  2ID3 A;  1IDZ A;  4MFD A;  2VKE A;  2CU7 A;  1T56 A;  3LOC A;  5FLV A;  3CDL A;  3LSJ A;  3BR2 A;  5EG0 A;  3DEW A;  3A01 A;  1JKQ C;  2EZI A;  3OIO A;  1ETQ A;  1UMQ A;  4A3B J;  3BG9 A;  3S14 J;  1GV2 A;  2NVT J;  5EF6 A;  2QF7 A;  4M6V A;  1SFO J;  1TC3 C;  4QSH A;  4C3J J;  4DYC A;  1IC8 A;  1VND A;  4MO7 A;  4A3D J;  3JRI A;  5F0H A;  1ZK8 A;  2XB5 A;  1U8B A;  2Y31 A;  3D1N I;  1ETY A;  4IEJ A;  1JKP C;  2DA7 A;  1ITY A;  4CYC B;  2Y2Z A;  3JRB A;  5J1Y A;  1HDD C;  2CUE A;  4D5C A;  5FKL A;  1JJ8 C;  1FIA A;  3HKZ N;  2XPV A;  4BKX A;  5FLM J;  1JKR C;  3BTI A;  3RZO J;  1Y1W J;  3IH4 A;  4NDL A;  4CYC A;  2ECC A;  4XRS A;  5F04 A;  3VPR A;  2DA6 A;  1FIP A;  2IEK A;  3O8H A;  1OCT C;  5IYD J;  5JLX A;  1QVT A;  4IHV A;  1I50 J;  1JT6 A;  2Y0S N;  2XSD C;  5J3L A;  4X1E A;  4A69 C;  4Y7N J;  2M8G X;  1ETO A;  5F1J A;  3SDG A;  1SAN A;  5EYR A;  2ME6 A;  4A3I J;  5F0C A;  5K7F A;  4DW6 A;  2N8G A;  3S17 J;  2WV1 A;  1JKO C;  2DMP A;  3H3V K;  5EEA A;  2XGD A;  4D7M A;  3H0G J;  2OPT A;  3UKG A;  1JTX A;  5IYC J;  1GUU A;  4C3H J;  4UUT A;  4V2F A;  4RDU A;  5IPA A;  3HB9 A;  3CCY A;  4JYK A;  2X9D A;  3IH3 A;  1OCP A;  2NS7 A;  1BJZ A;  4JX6 A;  4JX4 A;  2HOT A;  1X2M A;  3I4M J;  3JRH A;  2VUM J;  1K61 A;  1QVU A;  2DJN A;  3WHB A;  2VI6 A;  3BR5 A;  2M9H A;  3S1Q J;  4GFB A;  3LSG A;  4XRM A;  2XB0 X;  1IGN A;  3S2H J;  1MSE C;  3CQZ J;  2AHQ A;  3TW7 A;  4XRS G;  2R5Y B;  3BTL A;  3MKL A;  2VKV A;  3BR0 A;  3BTC A;  3ZQF A;  1D5Y A;  3HBL A;  1Y1V J;  1CQT A;  1ENH A;  2LR8 A;  1X58 A;  2HYJ A;  2LVS A;  2R5Z B;  1TWC J;  1U78 A;  2MGQ A;  3ZQG A;  5EGO B;  3ZQL A;  2TRT A;  4M3E A;  4XK4 A;  5F08 A;  5EZH A;  2MG4 A;  2JA8 J;  2PMZ N;  1E3O C;  1FTT A;  2R0Q C;  1G2H A;  2JN6 A;  3HOY J;  1TWH J;  1LE8 B;  1H8A C;  4B4C A;  3SJM A;  2QCO A;  2DTZ A;  3BQY A;  4UUS B;  2DMT A;  3WHC A;  1H88 C;  1UG2 A;  1JGG A;  1ZTR A;  5IP7 J;  4A3G J;  3ZQH A;  2CQX A;  3CMY A;  1H89 C;  2Y9Z A;  3JRE A;  2COB A;  4MLO A;  1ETX A;  1MBE A;  3W6V A;  2HOA A;  1WCM J;  2JJ7 A;  2OF7 A;  2GBY A;  1ZKG A;  4I6Z A;  2K40 A;  3BQZ A;  3S2D J;  2L7Z A;  2E2J J;  3GTG J;  3HOW J;  2DMN A;  5IP6 A;  1HOM A;  2DA1 A;  5GPA A;  3M3Y J;  1VI0 A;  2VPR A;  5FKM A;  3BR6 A;  1Z77 A;  3GTJ J;  2R7Z J;  1FTZ A;  4A3K J;  1I3Q J;  4BBS J;  2ID6 A;  3FIS A;  1EF4 A;  5FKK A;  1B8I B;  3RZD J;  5GP9 A;  1IUF A;  1GDT A;  3HOU J;  2LLK A;  2XRL A;  1DU0 A;  2ECB A;  2GM4 A;  1FEX A;  1RKT A;  3Q0U A;  1DU6 A;  3JRF A;  3GTL J;  2DN0 A;  2DMU A;  3Q0W A;  3BTJ A;  1XG1 A;  2FJ1 A;  3L1P A;  1QPI A;  2JA6 J;  2ME0 A;  1MNM C;  4D5F A;  3A03 A;  1LE8 A;  2EZL A;  2JMW A;  9ANT A;  4A3F J;  2L7F P;  1WH5 A;  3S1R J;  1ZGW A;  1LFB A;  4J19 A;  3JRD A;  1NK2 P;  2JWT A;  2H1K A;  2LTP A;  4S0H B;  1HCR A;  1Q1V A;  2KT0 A;  1XC5 A;  1RKW A;  2O8K A;  5EGO A;  4M3B A;  2HOS A;  1VFC A;  1S7E A;  3QPL A;  1MSF C;  4JP0 A;  5K7Z A;  2DA3 A;  3B6A A;  3FKI J;  2X48 A;  5IYB J;  2G0E A;  2R5Z A;  4FCY A;  3JRA A;  4IHW A;  3PO2 J;  2O7O A;  1GV5 A;  3TED A;  5JLW A;  3BT9 A;  3JR9 A;  2Y9Y A;  4BXX J;  1MBG A;  2CQQ A;  2R5Y A;  2DA4 A;  5HOD A;  1RPW A;  2DMQ A;  2HQ5 A;  4W1U A;  2HDD A;  2L9R A;  3B6C A;  1ZQ3 P;  1BW5 A;  2E2I J;  3A01 B;  4W97 A;  4A3L J;  4UUS A;  3Q3S A;  4BY7 J;  5E3N A;  2DA2 A;  1TWA J;  2L0K A;  4X6A J;  2M34 A;  1WH7 A;  5GPC A;  3S1N J;  4FIS A;  4MIM A;  4B1R A;  3C2B A;  1RR7 A;  2FD5 A;  3RQI A;  4QTR A;  1UHS A;  4LOC A;  2LD5 A;  3GTP J;  3HOX J;  1HF0 A;  2ELK A;  2XGC A;  1ETV A;  2MSY A;  3S16 J;  2I10 A;  2K9S A;  1YRN A;  2XPW A;  5E3M A;  4FE7 A;  3PM1 A;  2JK3 A;  2LFB A;  3Q0V A;  3OSF A;  3HM5 A;  1YRN B;  4B3A A;  1GT0 C;  1T33 A;  2K9N A;  3HOZ J;  2CJJ A;  1QRY A;  4ABZ A;  1IRZ A;  3FIW A;  1ETW A;  2L7M P;  1O4X A;  3S15 J;  1BW6 A;  1VF9 A;  3BG3 A;  3G1L A;  1TWG J;  3ZQC A;  1FJL A;  3GTQ J;  2EQR A;  5J1U A;  5M3M J;  4D7N A;  1POG A;  1JJ6 C;  4HNV A;  2P81 A;  2H8R A;  3LNQ A;  5K7H A;  1LFU P;  1HLV A;  1Z0X A;  2JA7 J;  2MW8 A;  3FK7 A;  5E3O A;  2JA5 J;  5M5Y J;  2E1O A;  5DTD A;  3TP3 A;  1W0T A;  4BBR J;  2K9Q A;  4BY1 J;  1AU7 A;  3HOV J;  5C44 J;  3A02 A;  3SFI A;  3IH2 A;  4AC0 A;  1B8I A;  5C4J J;  3DCF A;  2O9L A;  3NAR A;  1A5J A;  4FE4 A;  2WAQ N;  1ETK A;  1ORK A;  4FTH A;  1WI3 A;  1HDP A;  5EZG A;  4A3E J;  5IOZ A;  5E3L A;  3LSP A;  5FKO A;  4M3F A;  1JUP A;  3HEF A;  2EH3 A;  3M4O J;  2ZB9 A;  1NK3 P;  3I4N J;  4G12 A;  2NVY J;  3E7L A;  4XIC A;  1X2N A;  2LP0 A;  3G1M A;  3ZOB A;  1RES A;  3ZQI A;  1RET A;  2RAE A;  1JUS A;  2M0C A;  1B72 B;  2R93 J;  4C3I J; 
#chains in the Genus database with same CATH topology
 3KIO A;  2FQ4 A;  4ZDO A;  3L7W A;  2BY2 A;  4XRF A;  2OD5 A;  1XS9 A;  1SD7 A;  1Z7U A;  2IW5 A;  4EAT A;  1I5Z A;  3FMQ A;  3SZG A;  1WFX A;  5F0F A;  3WTY C;  1MZB A;  1W0U A;  2ZJP F;  4RB2 C;  4MQV A;  2HVR A;  2DYR H;  2HPI A;  3NWT A;  5D8L B;  3P9I A;  1JE8 A;  1IRG A;  3ZMS A;  2PLY A;  1ZRD A;  2FXA A;  3KZI C;  3R0A A;  3RYP A;  2B7E A;  2KDO A;  2A05 A;  5HDG A;  2KHM A;  5LLQ A;  4EMS A;  3MEX A;  2M7A A;  1YS6 A;  2CH0 A;  1SEU A;  1HW1 A;  1WJ5 A;  3N05 A;  3GZ6 A;  1ZG1 A;  3ISP A;  2HXO A;  2R7T A;  3VSK A;  5FD6 A;  2CRG A;  1O7F A;  2ZME B;  1R4N B;  4QPO A;  3SZP A;  3OSG A;  4BXF A;  1MH4 A;  5DS9 A;  3ZR8 X;  5JI6 A;  3GTO J;  4R1H A;  3OYG A;  1KU9 A;  3R61 A;  1T2K A;  3B73 A;  1K78 A;  3LA2 A;  4M74 A;  4YRV A;  1MBK A;  2VJ4 A;  4BQO A;  3IHU A;  4V2G A;  4RGS A;  5J1R A;  3LWF A;  3NEU A;  1R9T J;  4HNU A;  3S1M J;  1OQY A;  1K6O A;  3F6V A;  4C2U A;  2VJJ A;  2K27 A;  3DKX A;  3HGY A;  4E6K G;  1IF1 A;  4YFK F;  3VWB A;  1DP7 P;  1P4A A;  1WI9 A;  3BR3 A;  2FMY A;  4L9N A;  1PUF B;  5HDN A;  5CQG A;  1R5H A;  3VEP A;  2XGE A;  3BCA A;  3MZ8 A;  2HVS A;  3C18 A;  2EZH A;  2AO9 A;  4BJT A;  2XV4 S;  3NAU A;  2XAU A;  1IDY A;  2LY2 A;  2Z2S B;  2EFQ A;  4I76 A;  4R8H A;  4A5M A;  2XKP A;  4XOP A;  3CCM I;  1PUF A;  1EH6 A;  3OYL A;  1U9N A;  1PYV A;  4N0B A;  2DLL A;  3KP2 A;  4A3M J;  1BN5 A;  2KQR A;  2W84 A;  3BLY A;  4YEJ A;  2BOL A;  2W1O A;  4HF2 A;  4Q47 A;  3K69 A;  3W6J B;  2LBF A;  3K70 D;  5KVR A;  3KP5 A;  2LSO A;  4KA4 A;  4A0Y A;  3EUK L;  3F23 A;  3TO9 A;  4XLN F;  5DUK A;  3LSR A;  5F27 A;  3JCU C;  2NRA C;  4BS9 A;  4Y52 J;  4Y33 A;  4H0E A;  2M87 A;  1WPK A;  2IA0 A;  5BNG A;  4P9U A;  5IT9 Z;  3CCU I;  1IV6 A;  4KIB A;  1KYW A;  1EA3 A;  1JT0 A;  1U3E M;  2F5E A;  1FP1 D;  5IT3 A;  5EDN A;  4G7O F;  3E3V A;  3D0S A;  3VOE A;  3PO3 J;  3GO5 A;  4JX5 A;  4BE2 A;  4LMY A;  2XUB A;  4LIV A;  1K83 J;  2EBI A;  3WTZ A;  4MFD A;  4L9T A;  1J2X A;  2VKE A;  2CU7 A;  1VZ0 A;  1OR7 A;  1ZRC A;  3MKZ A;  5EG0 A;  3BR2 A;  3WU1 B;  1SVL A;  4MNU A;  4OIO F;  2K86 A;  1SMT A;  3A4C A;  4WX9 A;  3S14 J;  4ZYD A;  1HW5 A;  5EF6 A;  2QF7 A;  4M6V A;  1RIO H;  3CCR I;  1VQO I;  1R71 A;  1FC3 A;  2BW3 A;  2DW4 A;  1N78 A;  4DYC A;  1S7A A;  4MO7 A;  4BHB A;  3ROU A;  4HF1 A;  3JRI A;  4PSW A;  5F0H A;  4NQW B;  1ZK8 A;  4BUP A;  5E20 A;  2Y31 A;  3WTX C;  2CW8 A;  5BPD A;  3ZPL A;  2I5U A;  1JGS A;  3E5X A;  5CVR A;  3WU2 C;  2CV2 A;  4B8X A;  2A6E F;  3O2P E;  4CYC B;  3BJ6 A;  3GF2 A;  1LDD A;  2WV0 A;  3JRB A;  2MH9 A;  1OYI A;  5CJ9 A;  5LEK A;  2ZO4 A;  2CUE A;  2VL8 A;  4D5C A;  3G71 I;  2HZT A;  1O3T A;  3I3L A;  4HA8 A;  2IJL A;  5DV5 A;  4BKX A;  2VXD A;  1MW7 A;  3IC7 A;  3GEZ A;  2IEK A;  3O8H A;  5IYD J;  1QVT A;  2WAD A;  4IHV A;  3AKZ A;  2YR2 A;  1W4M A;  2Y0S N;  2KJB A;  1E17 A;  4IHS A;  2HTS A;  1N25 A;  3ML6 A;  2OQG A;  4EM0 B;  1Y0N A;  4FET A;  5EYR A;  4A3I J;  3OYH A;  5D5X B;  3Q9S A;  3WGI A;  3FXO A;  1BC8 C;  5F0C A;  3SEZ A;  1XSV A;  2V4J C;  1BI3 A;  3FXJ A;  4Y13 A;  4ZYE A;  5L3F A;  1XMA A;  5JVG F;  2VN2 A;  2C6Y A;  1QU3 A;  2PMH A;  2DMP A;  3H3V K;  1UB9 A;  2VBZ A;  3FDY A;  3RPQ A;  3H3Z A;  3CCE I;  4HV6 A;  1IV8 A;  1ULY A;  2VQL A;  3C2H A;  3K4C A;  4C3H J;  4KUM A;  4V2F A;  4RDU A;  4ASN A;  3HB9 A;  3IAS 2;  2IVM A;  2X9D A;  1MJB A;  3LFU A;  4NBQ A;  2LMD A;  2NS7 A;  3IH3 A;  4JX4 A;  1UHW A;  2HOT A;  2R3S A;  1K78 B;  4BJ6 C;  2JA2 A;  1I1S A;  3WHB A;  4GFB A;  4JBA A;  2LBF B;  4XRM A;  2GXA A;  1SD5 A;  1IGN A;  4C2T A;  3P9K A;  1W5T A;  4CDG A;  1YIT I;  3TW7 A;  5L3C A;  1XGM A;  3MKL A;  2X1C A;  4I01 A;  1ZLJ A;  1YJ9 I;  2QKL B;  3BTC A;  4LIU A;  4E7H A;  2KRH A;  2ETH A;  2QM3 A;  1FMW A;  1MD0 A;  5ERI A;  1XMX A;  1YS7 A;  1SMY F;  2HYJ A;  2JUG A;  3TQN A;  1QHG A;  2MGQ A;  3TMO A;  3VYT B;  2F4O B;  4LB5 A;  2E36 A;  2DOA A;  3RPU D;  3ZQL A;  1SAU A;  1LVK A;  4XK4 A;  2DOF A;  2H8W A;  4QWQ A;  4U7B A;  4F3Q A;  3A1Y A;  5EZH A;  3I55 I;  1FYL A;  2GIZ A;  4KN4 X;  4P5O A;  4Y3O A;  1TQM A;  2JN6 A;  4HOB A;  2R0Q C;  3BP8 A;  4IO9 F;  1LE8 B;  1G3T A;  2QBY A;  3WU0 A;  3OR2 C;  3JAM K;  4PJ0 C;  2DTZ A;  4BE1 A;  1EJ9 A;  1E3P A;  1LVA A;  1JGG A;  5JHF A;  1R6R A;  1H89 C;  1TBX A;  3I59 B;  3LSK A;  1V3F A;  3DPL C;  2IT0 A;  4MTD A;  4BAY A;  4XMY A;  4U7D A;  1Z3Y A;  1WCM J;  4FX0 A;  1S8N A;  3OYD A;  3V4G A;  4G6T B;  5HS8 A;  3CCS I;  4PDK A;  1VI0 A;  2VE9 A;  5FO5 A;  2R7Z J;  1FTZ A;  1D1C A;  1ZHF A;  1I3Q J;  4AWX B;  2ID6 A;  1Z6R A;  4AIH A;  2D1V A;  1P4X A;  4KT5 C;  3F6O A;  3HZJ A;  3HOU J;  4RAZ A;  1B6A A;  3GZN B;  1M1E B;  1X1C A;  2ECB A;  3HKZ A;  3M8F A;  1DU6 A;  4MQ9 F;  4IXA A;  2XF6 A;  3DU5 A;  4IQJ A;  2QLZ A;  1NHA A;  1YLF A;  3BG7 A;  4CGZ A;  4YIF A;  1MNM C;  4HX7 A;  4E4H A;  3A03 A;  2X51 A;  2JMW A;  3GME A;  2FE3 A;  1ONV A;  4B47 A;  1GHC A;  1LFB A;  4J19 A;  3JRD A;  3B02 A;  3M8E A;  4E7I A;  1XC5 A;  1RKW A;  5EGO A;  2HOS A;  1KU3 A;  1OCC H;  3HIF A;  1DQU A;  1I1G A;  3FXL A;  4HAM A;  5FRN A;  4IHT A;  2R5Z A;  2V1D A;  3PO2 J;  5HLG A;  4ZDP A;  3IWF A;  4AVP A;  5IT9 K;  2CFX A;  1GV5 A;  2R7R A;  2P5V A;  4CIC A;  3EDP A;  1W5S A;  1MBG A;  2R5Y A;  5IY5 H;  3DLL F;  2XDV A;  5GAD J;  1RPW A;  5HOD A;  3OS0 A;  4E7L A;  2HDD A;  1TNS A;  4G6Q A;  4XLA A;  2E2I J;  3ZCO A;  3DPU A;  3A0B C;  1G8X A;  1RNL A;  1LEA A;  5E3N A;  2L0K A;  2O0Y A;  2HTJ A;  1XN7 A;  1XTA A;  2PQ8 A;  4LK0 F;  5GPC A;  3S1N J;  3LST A;  1ERD A;  2NS0 A;  1RR7 A;  2FD5 A;  3RQI A;  1UHS A;  3RIR A;  2NAZ A;  3U1D A;  5HLT A;  2F5V A;  5D5W B;  4LOC A;  2LD5 A;  4HNT A;  3HOX J;  1HF0 A;  2NVU B;  2ELK A;  3OYB A;  2MSY A;  3ABL H;  5E3M A;  1OMI A;  5DM6 F;  2L02 A;  3K2Z A;  2PX9 A;  5GTI C;  1GT0 C;  1LDK B;  1BM9 A;  2DAO A;  2K9N A;  2VBX A;  2R7F A;  1REP C;  3HRU A;  1ETW A;  2Z5U A;  1O4X A;  3QU6 A;  1TT0 A;  1HC8 A;  1VTN C;  3S15 J;  1BW6 A;  2DU9 A;  2WWY A;  1FJL A;  5CLS A;  3GTQ J;  5HLH A;  1POG A;  5DCM A;  4PFO A;  1EH8 A;  1UAA A;  3BJA A;  5HDK A;  1FY7 A;  2X4H A;  3OWT A;  4NHJ A;  2XAJ A;  1FP2 A;  3H1C A;  5FD5 A;  2MW8 A;  3KP7 A;  3MMY B;  2O6G E;  4BAC A;  3AG1 H;  3FK7 A;  5CYV A;  4A12 A;  4G7Z F;  1K4S A;  3J80 K;  1OKR A;  3TDU C;  4PJL A;  2ZME A;  4XKV A;  3W6K B;  1V4R A;  3A02 A;  2IP2 A;  3TGN A;  1SD6 A;  3IH2 A;  2AS5 F;  2DFI A;  1IO2 A;  2E5Z A;  2BW3 B;  3DCF A;  2O9L A;  2ACJ A;  2WAQ N;  1ETK A;  3I56 I;  4XLE A;  2OUM A;  1HDP A;  2Y0M A;  2IGO A;  5BS6 A;  4KIS A;  1R00 A;  3DP7 A;  5FKO A;  3KYC B;  3HEF A;  3GWZ A;  2EH3 A;  3OYF A;  1NK3 P;  2J5P A;  3I4N J;  2LNB A;  2FOW A;  1HQC A;  1WRJ A;  2HU9 A;  2E7W A;  2FBK A;  1T0F A;  2CGP A;  2LP0 A;  2DK5 A;  3G1M A;  1DPU A;  1BOB A;  2Z1D A;  1RES A;  2P4W A;  2RAE A;  4HSR A;  2Z33 A;  1JUS A;  3I4P A;  3W2V A;  1PUE E;  3HPH A;  3F9K A;  1R1T A;  2XF5 A;  2YSR A;  2V1U A;  1D8J A;  2M7B A;  5FKN A;  3T8R A;  2KP6 A;  4EJO A;  1MMA A;  3FK6 A;  3DTI A;  3RI4 A;  3ABT A;  2NS8 A;  4B48 A;  4HW0 A;  5FRM A;  2KIQ A;  1K7A A;  2HQA A;  1Z6T A;  2NOG A;  2IS4 A;  3GZ5 A;  1V55 H;  3CLQ A;  2MAB A;  3IV5 A;  1R36 A;  5C3E J;  4DZP A;  4N4N B;  3KET A;  1D3Y A;  3VDX A;  4CCL A;  4JQF A;  4RBO A;  4HQE A;  3K4L A;  4M9Z A;  1RR8 C;  3K6G A;  1B72 A;  4IF4 A;  5JHU A;  3CCL I;  3FX3 A;  1PP7 U;  2FX0 A;  3GTK J;  2LH9 A;  3MCZ A;  4EQQ A;  3FXU A;  4DYQ A;  1XD7 A;  3MN2 A;  2F5C A;  2PJR B;  1GVD A;  2GA1 A;  2M0M A;  5M3F J;  4WK8 F;  1QZY A;  1W1W E;  2AXL A;  3DXJ F;  2EPF A;  3KEQ A;  2O3F A;  4A93 J;  1MBJ A;  3BC8 A;  3DLA A;  1AKH A;  4CXF A;  1X1B A;  2G7H A;  4DBQ A;  3G1O A;  2CUJ A;  4BDZ A;  3OIP A;  4DBR A;  3PFY A;  3EYY A;  3E6D A;  2KIU A;  4HBL A;  2V1N A;  3OMY A;  2AXT C;  2XPU A;  1IJW C;  2HI3 A;  3ZMZ A;  2V1X A;  2QQA A;  3K70 C;  3RSN A;  2EV0 A;  1F36 A;  3K7A J;  4DNC A;  3S3N A;  2HZD A;  2FA5 A;  1DUX C;  2JRT A;  3BR1 A;  2XAF A;  3HGG A;  4PUS A;  2EJR A;  3PIO F;  2LY9 A;  2Q8K A;  1MBF A;  2CUF A;  3R0J A;  1WGX A;  1KQ0 A;  3NWS A;  2GLO A;  4F7Z A;  4II3 A;  4IHY A;  2JRM A;  1B9N A;  3AL0 C;  2XGX A;  2HDC A;  2HXI A;  1YW7 A;  3PFI A;  2FF4 A;  5ED4 A;  4NUB A;  4Z6Y A;  3FHN A;  4RLF A;  4FX4 A;  2V7F A;  3IWZ A;  4FHT A;  2CS3 A;  5GAE J;  3PNY A;  4GYG A;  1Z9C A;  4A0X A;  1HSJ A;  1NG6 A;  3BG5 A;  2KPM A;  3AG2 H;  4I98 B;  5CVU A;  2K9M A;  2UUZ A;  4M3G A;  4QLC U;  1I6H J;  1P2F A;  2D5V A;  1T0F C;  4Y4R A;  2E1C A;  4A0Z A;  1KQ8 A;  3AAF A;  3ASN H;  2P6T A;  2GXG A;  1IN5 A;  2Q0O A;  3KYL A;  5HS9 A;  3CJT B;  3RKY A;  3CDL A;  3LSJ A;  5D4R A;  3DEW A;  4BEH A;  1O3S A;  1D8K A;  4ENJ A;  4F55 A;  5HVQ C;  1UMQ A;  1GV2 A;  2W57 A;  4PK4 A;  5D5V B;  3MFK A;  1YOV B;  4QSH A;  4C3J J;  1XGS A;  3SQN A;  5J8F A;  1EKE A;  1VND A;  1I3A A;  4A3D J;  1TNT A;  3K4K A;  2XB5 A;  4RM2 A;  3FXK A;  4ZTJ A;  3FF5 A;  4IEJ A;  3HRS A;  2KL4 A;  1BR1 A;  2DA7 A;  2STT A;  3F8N A;  2Y2Z A;  4AYB A;  4HQM A;  2CG4 A;  5E8I A;  2VC0 A;  1TLH B;  4HG2 A;  4I99 C;  2XKO A;  1HDD C;  2A6T A;  4KIG A;  5GAG J;  1O3Q A;  4I2O A;  3RZO J;  2DBB A;  2HR3 A;  3I58 A;  4EJT A;  4RGU A;  1Y1W J;  1XSX A;  3IH4 A;  1UST A;  4NDL A;  4CYC A;  4PJJ A;  2FNP A;  5JLX A;  3KP4 A;  3BPV A;  1I50 J;  3PUB A;  1MNE A;  2LY1 A;  2AQE A;  3FXQ A;  1FBU A;  3ZP5 A;  1X3Z B;  4XN0 A;  4KIT B;  5J3L A;  3FKJ A;  4X1E A;  3U2R A;  4A69 C;  4Y7N J;  4XLF A;  1J09 A;  1HKS A;  2KRC A;  3DQV C;  3BG6 A;  4Y15 A;  5F1J A;  2UXN A;  3K0L A;  1KU2 A;  2M30 A;  3TOB A;  2RNJ A;  2J5O A;  3E6B A;  1P4W A;  3F21 A;  3R4K A;  2ZFU A;  5BQT A;  1Z67 A;  1HBX G;  2A61 A;  5K7F A;  2O8X A;  3CUQ A;  4CCM A;  4ZZD A;  4GO1 A;  4WXD A;  1V5G A;  3G4S I;  4DW6 A;  2N8G A;  2EIM H;  4RLQ A;  2WV1 A;  2X0L A;  3KYD B;  1RI7 A;  4RAG A;  2GWR A;  1LUJ B;  4XOR A;  2F4I A;  3SYT A;  1VQM I;  4KYW A;  2VIX A;  2W85 A;  5GTH C;  4LG0 A;  4PJM A;  2PMZ A;  3IAM 2;  4NC7 A;  4UUT A;  3REO A;  3L09 A;  2QA4 I;  3CCY A;  2DT5 A;  3MAJ A;  3IL2 A;  2V6C A;  2IS1 A;  1BJZ A;  4JX6 A;  1U0J A;  1G4D A;  4LIT A;  1K61 A;  4RA2 A;  4E7J A;  2VI6 A;  4WCG A;  3S1Q J;  1TTY A;  2W24 A;  3LSG A;  4YIR X;  3OL3 A;  2KKO A;  1YIO A;  4UVA A;  2A69 F;  4I02 A;  5DD8 A;  4XRS G;  2WAF A;  1B1B A;  1IRF A;  1KQ9 A;  2LF8 A;  3J7A Y;  1S29 A;  3EUH C;  1Y1V J;  1CQT A;  1JI8 A;  3RTR A;  1ENH A;  4E7S A;  2LR8 A;  4Z2Y A;  1TWC J;  1U78 A;  1T08 B;  2DI3 A;  4BH9 A;  2V9V A;  2HEO A;  3ZMD A;  1VQ4 I;  3E6M A;  1X19 A;  3N4M A;  3CC2 I;  1FOY A;  3OYJ A;  4M3E A;  3LA3 A;  1ZH5 A;  1XDS A;  2MG4 A;  3EPZ A;  4UB6 C;  5DYM A;  5LRR A;  2R7S A;  2PMZ N;  2PG4 A;  1BI2 A;  2X6W A;  3FMS A;  1G2H A;  3TKY A;  5LD2 C;  3G3Z A;  1TWH J;  3L2C A;  2QSG X;  1H8A C;  3SJM A;  1YE9 A;  4ZC3 A;  3BQY A;  5KHD A;  4UUS B;  5D8K B;  1SVM A;  2DMT A;  2OJE D;  3WHC A;  2ZXJ A;  1R4M B;  1Y39 A;  2QWW A;  3S2W A;  4A3G J;  3KFW X;  4D0P A;  2IS6 A;  3ZQH A;  3GLX A;  2CQX A;  3MD2 A;  5ICC A;  3CMY A;  1HST A;  2WAQ A;  2HFH A;  1DDN A;  4DOZ A;  1CF7 B;  1QZE A;  4G6D A;  4UHT A;  3RDI A;  2COB A;  2HOE A;  1USS A;  3P9C A;  1YJW I;  3OIQ A;  2HOA A;  3COA C;  3GVA A;  4E7K A;  3W3C A;  2VJI A;  3HOW J;  3I64 A;  3KEO A;  4ENM A;  1RC9 A;  2HQR A;  2IA1 A;  3F3X A;  4M73 A;  5F64 A;  1B59 A;  1H9T A;  1F1Z A;  3ZMV A;  4BDY A;  4A3K J;  5BPI A;  1S7O A;  4IX7 A;  3FIS A;  2Q2E B;  1IUF A;  1T8I A;  1GDT A;  1YYV A;  3H35 A;  1ZLK A;  5AIP A;  1DU0 A;  2EFW A;  3H92 A;  1ZRE A;  3Q0U A;  2XVC A;  4C30 A;  3ULQ B;  1R5G A;  4XON A;  1XMK A;  2KFD A;  3HRT A;  1WJF A;  3HYI A;  1XG1 A;  5TIS C;  4J00 A;  2JA6 J;  4BHP A;  1D5V A;  3LL7 A;  1LPQ A;  1GXQ A;  2EZL A;  4CCO A;  1ZGW A;  2R7X A;  5F1R A;  2GZW A;  3H3U A;  3JW4 A;  5B1A H;  5HOO A;  2JWT A;  1NK2 P;  4IRG A;  2LTP A;  2H1K A;  1Q1V A;  3HC7 A;  1R49 A;  1U5T B;  4J01 A;  1WHU A;  3L2V A;  3PL8 A;  1VFC A;  2A5W A;  2XC7 A;  1TP4 A;  4JP0 A;  5K7Z A;  1T95 A;  1V5F A;  3AL0 B;  3JRA A;  2R7U A;  4L5I A;  1FOK A;  2BBY A;  4EM1 A;  3TED A;  3FBI B;  5LHI A;  3K1N A;  4PFP A;  3SZT A;  3JR9 A;  3HXL A;  4UXN A;  5D6F A;  3LAP A;  3GLL A;  4Q4Z F;  3AFH A;  1DGW Y;  2DA4 A;  1O57 A;  2BHY A;  3BZK A;  1XSD A;  2L9R A;  3OOP A;  2L2O A;  3B6C A;  2RQP A;  2CV1 A;  1ZAO A;  4L5J A;  4N9I A;  2QEN A;  2XAH A;  4A3L J;  1MJ9 A;  2R7O A;  4HLX A;  1ZGA A;  5KAF C;  2M1B A;  1MND A;  1TQI A;  4FIS A;  3PNV A;  2ZXI A;  1SAX A;  4PZJ A;  4QTR A;  2WB1 A;  4OIR F;  4V19 K;  4RB1 A;  2MYS A;  5B3S H;  3H5R A;  2YPR A;  3ZN0 A;  4EVI A;  1S72 I;  1J9I A;  5A2Q K;  2XPW A;  1G3W A;  3BZC A;  3F22 A;  1ZG5 A;  1N75 A;  1MMS A;  1XGN A;  2JK3 A;  2KIS A;  4DQ2 A;  4S05 A;  3NQO A;  2ZCW A;  1YRN B;  2H6C A;  1T33 A;  4DIQ A;  1SC7 A;  1W36 D;  2RQQ A;  1IRZ A;  2WA0 A;  4Q48 A;  2Y69 H;  2FNA A;  3FIW A;  3CTA A;  2L7M P;  1XB4 A;  1FPQ A;  1VF9 A;  3JSP A;  3ZQC A;  2EQR A;  1VQL I;  4D7N A;  2K4J A;  2VQC A;  3S8P A;  4HNV A;  3OYE A;  2P81 A;  4F92 B;  1BJA A;  5E18 F;  2PI0 A;  2QSF X;  4BNC A;  2LDU A;  3LNQ A;  1WJB A;  1BR2 A;  3HG9 A;  2JUC A;  2ZSI B;  2R7Q A;  4OAY A;  3PIP F;  1W36 C;  5F6F A;  2V9P A;  5DTD A;  2IS2 A;  1ZEL A;  3BOQ A;  3FXM A;  3TP3 A;  3MZH A;  4AVZ A;  1ODD A;  1TT5 B;  4WF2 A;  2JSC A;  3HSE A;  2W4S A;  4XKC A;  4FQG A;  3QOE A;  1ZN2 A;  4BL0 B;  4HEA 2;  4OAZ A;  2PJR A;  3ERE D;  4FTH A;  4L18 B;  2RVC A;  3K4N A;  2LC2 A;  2H1L A;  1FBS A;  1LFP A;  4OWR B;  3FWE A;  1VQ9 I;  4OMZ A;  3CD6 I;  3G2B A;  1DPR A;  2HQN A;  1JUP A;  3M4O J;  5CVV A;  2ZB9 A;  5ICE A;  1S9H A;  1OLT A;  1BC7 C;  2L9S A;  2BY3 A;  2BXY A;  3E7L A;  1Z21 A;  3M07 A;  2VQG A;  1FBQ A;  1TW2 A;  4L0Y B;  2L9N A;  3ZOB A;  3ZQI A;  1RET A;  2EIJ H;  1P6R A;  1YTY A;  2M0C A;  1PP8 F;  1B72 B;  3DBL B;  1BA5 A;  2QSH X;  1IXR C;  2MFZ A;  2YU9 J;  4EEF G;  4NC8 A;  4E70 A;  4XN3 A;  3QOP A;  3GFI A;  2HYG D;  3GBG A;  2FQ3 A;  3GXO A;  2H94 A;  2X85 A;  2YX7 A;  1ZR2 A;  3NRV A;  1OYY A;  2E5N A;  1OCZ H;  2Y0S A;  2X6O A;  5EG0 B;  1VQ6 I;  2UZK A;  2JPB A;  4CCN A;  3F0C A;  5FJ8 J;  2LKX A;  1FMV A;  3J7Y J;  1VQN I;  5A2Q Z;  4AID A;  3Q9V A;  1YIJ I;  5JVT A;  4DZJ A;  2FBI A;  3IKV A;  1U8R A;  1RUO A;  5CVI A;  3ZMT A;  2MD5 A;  3UR3 C;  3JRC A;  3ECH A;  3RPU A;  4A3J J;  2FU4 A;  3O8G A;  3HOS A;  2VOP A;  2XRN A;  1F9N A;  3I71 A;  4B09 A;  1WJE A;  2DYS H;  4D1Q A;  1YQA A;  4F52 A;  4Q5S F;  4IHX A;  2E19 A;  3MVP A;  2QEX I;  1ZRF A;  2WTE A;  2KZG A;  4JK1 X;  4ESJ A;  4ENK A;  2Z9O A;  1I6X A;  2MC4 A;  4C2M J;  4BXU A;  1OR7 C;  2O61 A;  2I8D A;  1QGP A;  3OS1 A;  4KJZ A;  1TL8 A;  5KCM A;  3MKW B;  1K79 A;  3GTM J;  1X1A A;  2LYC A;  3OOU A;  5L3E A;  5E1W A;  3SHF A;  1Z91 A;  3D5S C;  1P9Q C;  1R1V A;  2DQR A;  4NNJ A;  1S6L A;  4A6E A;  1WJD A;  2KIF A;  3V8L A;  1U9O A;  3DPT A;  5EEG A;  2OA4 A;  5M5X J;  2A07 F;  3U1K A;  2W25 A;  3E5U A;  2WY8 Q;  3DEU A;  2CYY A;  1AHD P;  1UFM A;  4ZZL A;  2YUS A;  1XCV A;  4GDF A;  4WXC A;  2OCC H;  4XBF A;  3ECO A;  3QPT A;  2H6B A;  2DT6 A;  1B9M A;  5B5E C;  2DA5 A;  1MGT A;  3JTH A;  3TW6 A;  3CO6 C;  3LFK A;  4G7H F;  4IRI A;  4BU2 A;  5J4Y A;  1NTC A;  3VOD A;  4IRH A;  2XF7 A;  4L9J A;  3ZQ7 A;  4XSX F;  1IG7 A;  5DDG A;  2EZK A;  2ID3 A;  1IDZ A;  4KN7 X;  4I0B A;  2ZXW H;  2QQB A;  3DEE A;  3KLO A;  3V8K A;  1T56 A;  4IPA A;  4I0A A;  4HDV A;  3BZ6 A;  2A68 F;  5FLV A;  1LDJ A;  3S93 A;  3BCB A;  2Y48 A;  1GXP A;  3A01 A;  1JKQ C;  2EZI A;  4BYY A;  1YW8 A;  3CCV I;  3OIO A;  2R4G A;  4PGG A;  3SEQ A;  3QP6 A;  4G94 A;  3E5Q A;  4AU7 A;  1E3H A;  2XSJ C;  3W2W A;  3IRR A;  2W7N A;  5E8G A;  2WBM A;  3OYN A;  4PCQ A;  1IC8 A;  2P0W A;  2COM A;  3OS2 A;  1U8B A;  5ILU A;  2E35 A;  3RJP A;  1X4P A;  5TJJ A;  5GAH J;  4UNO A;  4M9X A;  4CZC A;  4IOC F;  4U0V A;  4UB8 C;  2DO7 A;  3BPX A;  4YG2 F;  2ADU A;  3ABU A;  4OMY A;  2HKX A;  4BEH B;  2FSW A;  2VB6 A;  4P55 A;  1Z1D A;  2BYV E;  3O3K A;  2L01 A;  3BJO A;  1PVE A;  5H6R A;  1KGS A;  3CDH A;  5LRS A;  1JJ8 C;  5K5Q A;  1Q1H A;  2DQL A;  2XPV A;  2Q1Z B;  1D0X A;  3BTI A;  4EJV A;  4BJ5 C;  4JOM A;  2L4M A;  5FLM J;  4EGY A;  2ECC A;  4RB0 A;  1LEB A;  4PJN A;  2HNH A;  3CP8 A;  2DA6 A;  1FIP A;  4U0W A;  1OCT C;  4L0Z B;  1JT6 A;  1Y6I A;  1F5T A;  3TO7 A;  3TO6 A;  3IP4 B;  2L4A A;  3H5N A;  2VT2 A;  4UVB A;  3BRO A;  4ESB A;  2XSD C;  2IA2 A;  2M8G X;  1ETO A;  3SDG A;  2RDP A;  5J8C A;  1SAN A;  3I53 A;  2EFO A;  5FB2 A;  2STW A;  3DV8 A;  1FWZ A;  2ME6 A;  4D9J A;  1YX5 A;  4ZYG A;  3CES A;  5FGM A;  1U5T C;  4ZYH A;  5K1Y A;  2D1H A;  3C7J A;  1MDM A;  2DJI A;  2CWE A;  2GOX B;  2QBY B;  3ERM A;  2QUF A;  3LSH A;  5CPR B;  3T8T A;  1JKO C;  4OU0 A;  4B43 A;  1D1A A;  3G73 A;  2NYX A;  4RAY A;  3HUG B;  1FZP B;  2DTR A;  2EIL H;  5EEA A;  2XGD A;  4D7M A;  3E6C C;  2RNG A;  3M7G A;  1WWX A;  4OIN F;  1RRJ A;  2EA2 A;  3PQK A;  4E7Z A;  3UKG A;  2FEZ A;  5DUI A;  5IYC J;  2VAS A;  3H0D A;  5ILS A;  5HLI A;  2BVM A;  3N97 A;  3OR1 C;  4GCV A;  4M6X A;  3L9F A;  3H5A A;  1X2M A;  3I4M J;  3JRH A;  3KLN A;  2VUM J;  2WAE A;  2F5D A;  2L5Q A;  4CO8 A;  3BR5 A;  3EUH A;  2M9H A;  1QHH D;  2R7W A;  1LB2 A;  2CUZ A;  3CP2 A;  1IW7 F;  3OYA A;  2XHK A;  4RMN A;  2UV1 A;  2DDA A;  1J59 A;  2FUG 2;  2OU2 A;  3CQZ J;  1QQI A;  4XL9 A;  1J75 A;  1YFH A;  2DPD A;  1MMG A;  3BR0 A;  1BBY A;  2H09 A;  3ZQF A;  5LGN A;  1ZGJ A;  3HBL A;  3T0Y A;  5KAI C;  1QNT A;  1SFX A;  2P6S A;  1Z05 A;  5CKT A;  2R5Z B;  2ZKZ A;  3AG3 H;  5E1X A;  2OAZ A;  2ELH A;  4M9S A;  5EJC A;  3ZQG A;  3LA7 A;  5EGO B;  2W00 A;  1O3R A;  1D1B A;  2P8T A;  2TRT A;  1I39 A;  4LK1 F;  1T6S A;  1FX7 A;  4ANJ A;  4XR6 A;  3OYK A;  5BOX A;  1FTT A;  2CQ7 A;  2IXS A;  3CUO A;  2R7D A;  5HNH A;  3HOY J;  4YFX F;  3KZZ A;  2CMP A;  4L9V A;  2DPU A;  4GXO A;  3QP5 A;  2HPM A;  2IPQ X;  1UG2 A;  5LHH A;  4QPQ A;  5K5O A;  4XLC A;  2FOK A;  4OOI A;  2E1M B;  4ON0 A;  2GIV A;  2RC4 A;  4RGR A;  4LLN A;  2B0L A;  4UUV A;  2JPC A;  4XNF A;  1ON2 A;  3J81 K;  3QU3 A;  2IGK A;  1MBE A;  2XRO A;  3BWG A;  3W6V A;  4LG0 B;  1Y8R B;  2OF7 A;  2GBY A;  1ZKG A;  2DK8 A;  2K40 A;  1QA6 A;  3S2D J;  1WKM A;  4BGD A;  2E2J J;  3GTG J;  2DMN A;  4HYE A;  5IP6 A;  1HOM A;  2BGC A;  2DA1 A;  1T38 A;  3M3Y J;  2DOE A;  2V6E A;  2EB7 A;  2VPR A;  5FKM A;  3BR6 A;  4KIF A;  3E97 A;  5J4V A;  1E0E A;  2QQ8 A;  1YG2 A;  2K4B A;  4EV0 A;  1G3Y A;  1L0O C;  3A0H C;  1IN6 A;  1B8I B;  1WZ2 A;  2JT1 A;  1J0R A;  2LLK A;  1CF7 A;  3O6B B;  3J80 Z;  2GM4 A;  1RKT A;  1FEX A;  3RCO A;  4RAF A;  4ZYA A;  3GTL J;  3S3O A;  2DMU A;  3ABM H;  2H27 A;  3BTJ A;  2NOJ B;  4WWC A;  1XCB A;  3MKY B;  3K4B A;  3H9G A;  1QPI A;  4P1W A;  2ME0 A;  2CSO A;  3LSI A;  2EV5 A;  1LE8 A;  2MLK A;  9ANT A;  3ELK A;  1W5C C;  5E1Z B;  5H6Q A;  2EIK H;  2PN6 A;  3G6E I;  2VKH A;  4B44 A;  3F72 A;  3WGG A;  1QPM A;  2ZFW A;  2G9W A;  2EK5 A;  2O8K A;  3F8B A;  3P7N A;  1X1D A;  2VBW A;  4O5V A;  1S7E A;  3QPL A;  2FBH A;  4IZZ A;  2ZJR F;  1J7K A;  5D6E A;  5IYB J;  4FCY A;  4IHW A;  4LFU A;  4EM2 A;  1KU7 A;  1AA7 A;  2O7O A;  2YX4 A;  4MGR A;  3WTW C;  3CZ6 A;  3J7Z I;  4A5N A;  3CCQ I;  1FLI A;  3CF5 F;  4CZZ A;  2KRF A;  3FMR A;  1HW2 A;  3DU6 A;  3HUG A;  2CQQ A;  2ICW G;  2K3P A;  2RV8 A;  3SXY A;  3WE2 A;  2HQ5 A;  4W1U A;  4C9Y A;  1QZZ A;  2O5R A;  1JKR C;  1BR4 A;  2ZME C;  4GGG A;  3Q3S A;  2DA2 A;  1TWA J;  2K02 A;  2ELJ A;  2M34 A;  4KMU X;  3C2G A;  1IXS B;  2IRF G;  2EIN H;  4HLY A;  4MIM A;  1RZ4 A;  4B1R A;  3TDZ C;  1H0M A;  1UJ8 A;  4YFN F;  1T39 A;  1YO5 C;  1TQP A;  2XGC A;  2HGC A;  2K85 A;  1ETV A;  3HOT A;  1K4T A;  1TZL A;  4I7H A;  2K9S A;  1YRN A;  4FE7 A;  1XPX A;  3PM1 A;  3PNT A;  2M3A A;  4ENN A;  2ZNY A;  2F4M B;  3DWL E;  5TRD A;  2ZJ2 A;  2L54 A;  3OL4 A;  4RS8 A;  1J5Y A;  3PJR A;  5ICF A;  1QRY A;  4ABZ A;  1GVJ A;  3K4M A;  3ZQQ A;  3RKW A;  4O3M A;  3DF8 A;  2LKS A;  3K9T A;  3BG3 A;  3G1L A;  4A2U A;  5M3M J;  5J1U A;  4KDP A;  4XQF A;  3KPH A;  5BMZ A;  1IN8 A;  2H8R A;  2MLG A;  3F8C A;  1CGP A;  5K7H A;  1FSE A;  2BY1 A;  2EFN A;  1LFU P;  1Z0X A;  3WTS C;  2MH2 A;  1FOW A;  2JA7 J;  4AM3 A;  1XGO A;  2DT7 B;  2E60 A;  5M5Y J;  2E1O A;  2JA5 J;  2K3F A;  1PJR A;  2IGN A;  4BQA A;  3OV8 A;  3LAJ A;  2ZC2 A;  1MJA A;  1FNN A;  3FBN B;  3HOV J;  5C44 J;  2IGM A;  1HKT A;  2PFB A;  4LB6 B;  3L2U A;  2CFO A;  3RYR A;  2Q2E A;  3BY6 A;  1PDN C;  2PEX A;  3CC7 I;  4LJZ F;  2A6H F;  2BEO A;  3ZXS A;  4XKB A;  1OIS A;  2HVQ A;  1ZAR A;  4XLH A;  3CJR B;  3WOD F;  5EZG A;  4A3E J;  1GLN A;  3VFZ A;  2DFF A;  2BZT A;  3LSP A;  4M72 A;  2ZXH A;  4XLP F;  4M3F A;  2OCE A;  4P9F A;  3WTU C;  4CUG A;  2VXZ A;  3LQQ A;  4AIJ A;  1C0W A;  2DFH A;  1VQK I;  5B1B H;  1Y56 A;  4NC6 A;  4O6J A;  3TL4 X;  3UNG C;  1YX3 A;  3GX4 X;  1R7J A;  4HRI A;  1Z7L A;  3V7C A;  2LRD A;  4C3I J;  2R93 J;  3QOD A;  1YHQ I;  4MFE A;  4TV7 A;  3MWM A;  2W48 A;  4QIW N;  4KIC A;  2WB1 N;  2YS9 A;  1BL0 A;  2E2H J;  3GFJ A;  5B66 C;  1P7I A;  4HPQ A;  2B63 J;  3QQA A;  4L5E A;  2Y30 A;  2NXN B;  5C4X J;  3V7R A;  3QPS A;  3ZRG A;  3L2W A;  5LEJ A;  3LMM A;  4ZDL A;  5TGT A;  2F2E A;  1DGR M;  4BQQ A;  3K2A A;  2F48 A;  4EJU A;  3TP0 A;  4AYB N;  2V9K A;  2NVX J;  3EUA A;  2QGU A;  1ZG3 A;  4DYR A;  1AWC A;  1WJA A;  1BI1 A;  2GXB A;  1R22 A;  4I09 A;  2QYO A;  2E34 A;  2VJ5 A;  5IOY A;  1JUM A;  3PUF A;  1TWF J;  1KYZ A;  4ITV A;  5LGT A;  5M5W J;  2E71 A;  3WTV C;  1APL C;  2EV6 A;  1MBH A;  2P7C B;  1R58 A;  4FAS D;  2R92 J;  2CV0 A;  1ZYR F;  4XID A;  2KIM A;  1OFC X;  4K2E A;  5CQE A;  2KMU A;  2ZNZ A;  1R1U A;  2PMU A;  2BXZ A;  5IP9 J;  2NVQ J;  5JR3 A;  4UVC A;  2KJC A;  5L3G A;  4AD9 A;  1F43 A;  3ASO H;  4RB3 C;  3D5L A;  3I9V 2;  2IBD A;  1F4K A;  2IAI A;  2F5F A;  2F6C A;  3J81 Z;  1MH3 A;  3JRG A;  2M2E A;  1A36 A;  3HDD A;  2RRE A;  2QZ8 A;  2RGV A;  1FT9 A;  2QVO A;  1A6I A;  2MA3 A;  3I59 A;  4X0G A;  1WVR A;  2KDZ A;  4AUX A;  2OTL I;  1LJ9 A;  3QPH A;  3ZGK A;  2VON A;  3DTE A;  3KCC A;  1LNW A;  2V79 A;  1A31 A;  4NB5 A;  3DTK A;  3J7A O;  2LKP A;  3I0T A;  3U21 A;  1P7J A;  3CO7 C;  3C3W A;  2TCT A;  1ZR4 A;  2VOD A;  4M3D A;  4BHC A;  2X1D A;  4A3C J;  2KZV A;  4IL6 C;  1AKH B;  1B4A A;  3K10 A;  5LFA A;  3GFL A;  4LLG F;  1FSH A;  4H4K C;  2R7V A;  2EA4 A;  3K4J A;  1OJL A;  1JTY A;  2DCE A;  2LK2 A;  3IUO A;  1UEL B;  4OIQ F;  4OIP F;  1Y8Q B;  2FRH A;  1D0Y A;  3CCJ I;  5D4S A;  3RKQ A;  5KK1 A;  2UXX A;  3DKY A;  3I54 A;  1KON A;  2CO5 A;  4U88 A;  1L3L A;  3V7S A;  1X3U A;  5LHG A;  4HST A;  1UG0 A;  3LOC A;  3TOA A;  1VQP I;  4XM3 A;  1JHH A;  2VT3 A;  4ZH4 F;  1UHM A;  3HSR A;  4XSZ F;  3H9J A;  2X1E A;  1ETQ A;  1TW3 A;  4A3B J;  3BG9 A;  3VYS B;  4LG3 A;  2NVT J;  3TBI A;  1SFO J;  2ISZ A;  2M45 A;  1TC3 C;  1BOA A;  4UV8 A;  3GUD A;  3WTT C;  1EV7 A;  1STZ A;  4KT6 A;  3C1D A;  3HTS B;  3HL2 A;  2UWM A;  3HRM A;  2G7U A;  2B9S A;  3FXR A;  3GCM A;  1MKM A;  3D1N I;  1ETY A;  4U0Y A;  3WGH A;  3T5X A;  3T1B A;  1JKP C;  2OBP A;  3SDB A;  3JAM Z;  4ZTF A;  2HKO A;  2ESN A;  1ITY A;  3U9G A;  2JZY A;  3FZV A;  2K7L A;  1S3J A;  3QWL A;  1OCO H;  5J1Y A;  2CW0 F;  2BV6 A;  5FKL A;  2GA2 A;  4PSX A;  4GYI A;  1FIA A;  3HKZ N;  1FYM A;  4UV9 A;  1X4O A;  4ESF A;  5HS7 A;  5F04 A;  4XRS A;  3K1P A;  3VPR A;  3CC4 I;  3WG7 H;  1N77 A;  2V26 A;  1VQ8 I;  4F91 B;  2CQN A;  3CLO A;  2P5L C;  3GW2 A;  1OCR H;  3FM5 A;  2OV7 A;  2DOD A;  3H36 A;  4FT8 A;  2LG4 A;  1FOX A;  2DXI A;  3FHZ A;  1ACI A;  1P92 A;  1S5L C;  2OC6 A;  1K6Y A;  3V42 A;  5AIQ A;  4N9H A;  3RQ4 A;  4EGZ A;  2PBI A;  4XKW A;  2ZSH B;  3GYH X;  1ON1 A;  3S17 J;  2Z99 A;  4S04 A;  4HX4 A;  3W2A A;  3HPG A;  4ETS A;  5L3B A;  3L2Q A;  3ONQ A;  1XDU A;  4DJA A;  3OYI A;  2QQ9 A;  1YJN I;  1W7P D;  3H0G J;  2MD0 A;  3QYF A;  1QO0 D;  2OPT A;  1JTX A;  4DGW B;  1IN4 A;  1GUU A;  1G3S A;  2K9L A;  4LD5 A;  5IPA A;  4M6Y A;  4IKF A;  4JYK A;  3R60 A;  4NQW A;  1OCP A;  4MEX F;  1BI0 A;  2OZU A;  4CYD A;  2L7K A;  3PSF A;  1V5E A;  3WE3 A;  2ISY A;  1V54 H;  1QVU A;  1W7P B;  2DJN A;  1NH3 A;  3KX2 A;  3CUQ C;  2XB0 X;  3S2H J;  2VLA A;  2OZ6 A;  3ZN1 A;  3V8J A;  5HNF A;  2AHQ A;  1MSE C;  3VYU B;  2HDW A;  5EEH A;  2L9V A;  2VE8 A;  3BTL A;  1H9G A;  2R5Y B;  2VKV A;  4YII A;  2XAG A;  4LLL A;  1KA8 A;  4HDU A;  1YW9 A;  4HZF A;  1BIA A;  1D5Y A;  5H20 A;  1I27 A;  1X58 A;  2LVS A;  4G9Y A;  5J47 A;  2Z16 A;  3MZY A;  3HSF A;  1X1P A;  2ZJQ F;  2NNN A;  2LF7 A;  5F08 A;  3KZY A;  2JA8 J;  3L2R A;  2VKD A;  1E3O C;  3CUQ B;  4CCJ A;  2D2W A;  4ZJZ A;  3R6S A;  2LOO A;  2AQF A;  4B4C A;  2QCO A;  1LKX A;  3CMA I;  1HXD A;  1JXS A;  2A3S A;  3WG9 A;  2E7X A;  4LGW A;  1H88 C;  1AOY A;  3ESW B;  3P5J A;  5FLX Z;  2NNY A;  1ZTR A;  5IP7 J;  4XOT A;  4UY8 I;  2BHZ A;  3CF2 A;  3KEY A;  3S3M A;  1DP3 A;  2Y9Z A;  3JRE A;  3ZMU A;  1O7L A;  2M4G A;  4MLO A;  2FML A;  2LRE A;  1UCR A;  4HX8 A;  5JFR A;  1ETX A;  2CW7 A;  3Q5F A;  2VOO A;  1HA8 A;  4HF0 A;  2JJ7 A;  2MBF A;  5FFX A;  2KLO A;  4I6Z A;  2K5C A;  2L3D A;  3BQZ A;  4IQ4 A;  2L7Z A;  4G8X A;  3K1M A;  5GPA A;  3DBR B;  3HHH A;  3F8M A;  2RN7 A;  1Z77 A;  3GTJ J;  2X6Y A;  5DEQ A;  3DFG A;  4BBS J;  3JSO A;  2Z3Y A;  1EF4 A;  2EWN A;  5FKK A;  3RZD J;  5GP9 A;  2HYF A;  3OYM A;  2PJP A;  1IZ1 A;  2XRL A;  4P96 A;  2GQQ A;  2GOM A;  1Y0U A;  2YU3 A;  2W82 A;  3JRF A;  1G59 A;  2DN0 A;  2D45 A;  3Q0W A;  3EQL F;  4EJW A;  3L00 A;  2BY0 A;  3CJN A;  2FJ1 A;  3L1P A;  4D5F A;  3OY9 A;  5DCM B;  3M1E A;  3M8J A;  2O03 A;  4A3F J;  2L7F P;  2WY7 Q;  1WSU A;  1WH5 A;  1X3W B;  3AG4 H;  3S1R J;  3HJE A;  1W7P A;  2A5Y B;  2ESH A;  4IVN A;  4S0H B;  1HCR A;  4KNY A;  4MTE A;  3M9A A;  2KT0 A;  4MHG A;  1SVO A;  3CMM A;  3KP3 A;  1UZC A;  1IN7 A;  4M3B A;  2DFE A;  2HS5 A;  1MSF C;  3E0J B;  4M71 A;  5L3D A;  2WC2 A;  3MQ0 A;  1QBJ A;  3B6A A;  3FKI J;  2XIG A;  2DA3 A;  1WQ2 A;  2G0E A;  2QKM B;  2VBY A;  2CQK A;  2X48 A;  4IJA A;  2JSP A;  4II2 A;  5KNL A;  5JLW A;  2BE5 F;  3BT9 A;  1U2W A;  3CJQ B;  2Y9Y A;  4KFC A;  3RKX A;  2DDB A;  4CHU A;  4BXX J;  1HKQ A;  2OTJ I;  5DCF A;  1D0Z A;  3VSL A;  1LQ1 A;  1FYK A;  2DMQ A;  2HWV A;  4PGH A;  4HV5 A;  1OPC A;  5J40 A;  2P5K A;  3DBH B;  3H9Q A;  4BQN A;  1ZQ3 P;  1BW5 A;  1IRX A;  3A01 B;  4W97 A;  2JQ7 A;  2P7V B;  4UUS A;  4BY7 J;  3KE2 A;  4WXH A;  5LBQ A;  4U87 A;  4X6A J;  3I5U A;  3X2Q H;  1WH7 A;  1MIJ A;  1MMD A;  1OYW A;  4N4O B;  3E1S A;  3QRF F;  2GAU A;  1MMN A;  3C2B A;  1VQ7 I;  1VQ5 I;  3KP6 A;  5D5U B;  1XX5 A;  3LSM A;  1JHF A;  1SFK A;  3IRQ A;  3OYC A;  1SD4 A;  3GTP J;  1G6N A;  2JTV A;  3ABK H;  3QAH A;  5H2F C;  5DD4 A;  3S16 J;  2I10 A;  4RM3 A;  2MC3 A;  5E17 F;  1SFE A;  2VPL A;  4CSW A;  1R23 A;  1WJC A;  1YI2 I;  3EYI A;  2LFB A;  3Q0V A;  3OSF A;  3HM5 A;  4CA0 A;  4B3A A;  1T98 A;  3D5R C;  3HOZ J;  3JTG A;  3BDD A;  2CJJ A;  1E2X A;  1MDM B;  3EET A;  4AIK A;  1NG7 A;  2X6X A;  1U6G A;  5DM7 F;  4IOA F;  3PQJ A;  3A2K A;  1A35 A;  2VC1 A;  3FM3 A;  1TWG J;  2XAQ A;  3GFM A;  2Y75 A;  3VB2 A;  1JJ6 C;  2M4K A;  2M5W A;  4CH7 A;  5LGU A;  5FLX K;  3QYB A;  4Y17 A;  1HLV A;  5ICG A;  3LQR A;  3HTU A;  4KMF A;  2E1M C;  2TDX A;  1BIB A;  2M8E A;  5E3O A;  1EH7 A;  1IUY A;  2E1N A;  4BE0 A;  1W0T A;  4BBR J;  2K9Q A;  3VYR B;  3QYE A;  1IAW A;  4BY1 J;  3PSI A;  1AU7 A;  3F8F A;  5AON A;  3HHG A;  1A04 A;  3SFI A;  4AC0 A;  1B8I A;  2OQR A;  4CCK A;  1A6Q A;  5FRO A;  5C4J J;  1SFU A;  1A5J A;  3NAR A;  4FE4 A;  5FFZ A;  3CME I;  5E79 C;  5K5R A;  1ORK A;  1Z3X A;  4GRI A;  4A6D A;  5ILV A;  1IXC A;  1WI3 A;  1U5T A;  5IOZ A;  5E3L A;  2JVG A;  5J6X A;  4F93 B;  2VQH A;  2ZBK A;  3CDI A;  6PAX A;  4MEY F;  3SFZ A;  5CVJ A;  4R79 A;  1R5I D;  2EFP A;  4B3X A;  2RKH A;  4G12 A;  2NVY J;  2XAS A;  2BVL A;  4XIC A;  1X2N A;  4YEL A;  3S32 A;  1KZH A;  3M1C A;  4RGX A;  2JVH A;  3DKW A;  1RUN A;  3IKT A; 
#chains in the Genus database with same CATH homology
 4MFE A;  2FQ4 A;  2W48 A;  5FKN A;  1BA5 A;  4QIW N;  2WB1 N;  2YS9 A;  3FK6 A;  1XS9 A;  1BL0 A;  2E2H J;  2NS8 A;  2YU9 J;  1P7I A;  4EEF G;  2B63 J;  3QQA A;  4L5E A;  5F0F A;  3GBG A;  1W0U A;  2Y30 A;  1ZR2 A;  2NOG A;  5C4X J;  3QPS A;  2X6O A;  5EG0 B;  3IV5 A;  2LKX A;  3F0C A;  5FJ8 J;  5C3E J;  3K2A A;  4DZP A;  3TP0 A;  4AYB N;  4DZJ A;  2NVX J;  4RBO A;  4DYR A;  3JRC A;  1B72 A;  4A3J J;  2HXO A;  3O8G A;  1JUM A;  5IOY A;  1TWF J;  2CRG A;  2FX0 A;  3OSG A;  1MH4 A;  5DS9 A;  3GTO J;  3GTK J;  5M5W J;  4DYQ A;  1APL C;  1MBH A;  1MBK A;  2R92 J;  3MN2 A;  4V2G A;  4IHX A;  5J1R A;  2E19 A;  1GVD A;  4XID A;  1R9T J;  3MVP A;  1OFC X;  5M3F J;  3S1M J;  3HGY A;  4C2M J;  5IP9 J;  2NVQ J;  4A93 J;  1MBJ A;  3BR3 A;  1PUF B;  1AKH A;  3GTM J;  3OOU A;  1F43 A;  2XGE A;  3G1O A;  2EZH A;  2AO9 A;  2IBD A;  2IAI A;  3NAU A;  3JRG A;  1MH3 A;  1IDY A;  2M2E A;  1U9O A;  5M5X J;  3HDD A;  4I76 A;  2XPU A;  1A6I A;  1PUF A;  1IJW C;  2HI3 A;  1U9N A;  4A3M J;  1F36 A;  3K7A J;  2KDZ A;  4AUX A;  1AHD P;  3BR1 A;  3HGG A;  2YUS A;  2LY9 A;  3LSR A;  5F27 A;  1MBF A;  2CUF A;  1WGX A;  2GLO A;  4Y52 J;  4IHY A;  1P7J A;  2TCT A;  2HXI A;  1WPK A;  1ZR4 A;  4M3D A;  5BNG A;  4A3C J;  1IV6 A;  2DA5 A;  1AKH B;  1JT0 A;  3TW6 A;  5EDN A;  1OJL A;  1JTY A;  2LK2 A;  3BG5 A;  3PO3 J;  1NTC A;  4JX5 A;  4M3G A;  1I6H J;  1IG7 A;  3RKQ A;  2D5V A;  1K83 J;  2EBI A;  2EZK A;  2ID3 A;  1IDZ A;  4MFD A;  2VKE A;  2CU7 A;  1T56 A;  3LOC A;  5FLV A;  3CDL A;  3LSJ A;  3BR2 A;  5EG0 A;  3DEW A;  3A01 A;  1JKQ C;  2EZI A;  3OIO A;  1ETQ A;  1UMQ A;  4A3B J;  3BG9 A;  3S14 J;  1GV2 A;  2NVT J;  5EF6 A;  2QF7 A;  4M6V A;  1SFO J;  1TC3 C;  4QSH A;  4C3J J;  4DYC A;  1IC8 A;  1VND A;  4MO7 A;  4A3D J;  3JRI A;  5F0H A;  1ZK8 A;  2XB5 A;  1U8B A;  2Y31 A;  3D1N I;  1ETY A;  4IEJ A;  1JKP C;  2DA7 A;  1ITY A;  4CYC B;  2Y2Z A;  3JRB A;  5J1Y A;  1HDD C;  2CUE A;  4D5C A;  5FKL A;  1JJ8 C;  1FIA A;  3HKZ N;  2XPV A;  4BKX A;  5FLM J;  1JKR C;  3BTI A;  3RZO J;  1Y1W J;  3IH4 A;  4NDL A;  4CYC A;  2ECC A;  4XRS A;  5F04 A;  3VPR A;  2DA6 A;  1FIP A;  2IEK A;  3O8H A;  1OCT C;  5IYD J;  5JLX A;  1QVT A;  4IHV A;  1I50 J;  1JT6 A;  2Y0S N;  2XSD C;  5J3L A;  4X1E A;  4A69 C;  4Y7N J;  2M8G X;  1ETO A;  5F1J A;  3SDG A;  1SAN A;  5EYR A;  2ME6 A;  4A3I J;  5F0C A;  5K7F A;  4DW6 A;  2N8G A;  3S17 J;  2WV1 A;  1JKO C;  2DMP A;  3H3V K;  5EEA A;  2XGD A;  4D7M A;  3H0G J;  2OPT A;  3UKG A;  1JTX A;  5IYC J;  1GUU A;  4C3H J;  4UUT A;  4V2F A;  4RDU A;  5IPA A;  3HB9 A;  3CCY A;  4JYK A;  2X9D A;  3IH3 A;  1OCP A;  2NS7 A;  1BJZ A;  4JX6 A;  4JX4 A;  2HOT A;  1X2M A;  3I4M J;  3JRH A;  2VUM J;  1K61 A;  1QVU A;  2DJN A;  3WHB A;  2VI6 A;  3BR5 A;  2M9H A;  3S1Q J;  4GFB A;  3LSG A;  4XRM A;  2XB0 X;  1IGN A;  3S2H J;  1MSE C;  3CQZ J;  2AHQ A;  3TW7 A;  4XRS G;  2R5Y B;  3BTL A;  3MKL A;  2VKV A;  3BR0 A;  3BTC A;  3ZQF A;  1D5Y A;  3HBL A;  1Y1V J;  1CQT A;  1ENH A;  2LR8 A;  1X58 A;  2HYJ A;  2LVS A;  2R5Z B;  1TWC J;  1U78 A;  2MGQ A;  3ZQG A;  5EGO B;  3ZQL A;  2TRT A;  4M3E A;  4XK4 A;  5F08 A;  5EZH A;  2MG4 A;  2JA8 J;  2PMZ N;  1E3O C;  1FTT A;  2R0Q C;  1G2H A;  2JN6 A;  3HOY J;  1TWH J;  1LE8 B;  1H8A C;  4B4C A;  3SJM A;  2QCO A;  2DTZ A;  3BQY A;  4UUS B;  2DMT A;  3WHC A;  1H88 C;  1UG2 A;  1JGG A;  1ZTR A;  5IP7 J;  4A3G J;  3ZQH A;  2CQX A;  3CMY A;  1H89 C;  2Y9Z A;  3JRE A;  2COB A;  4MLO A;  1ETX A;  1MBE A;  3W6V A;  2HOA A;  1WCM J;  2JJ7 A;  2OF7 A;  2GBY A;  1ZKG A;  4I6Z A;  2K40 A;  3BQZ A;  3S2D J;  2L7Z A;  2E2J J;  3GTG J;  3HOW J;  2DMN A;  5IP6 A;  1HOM A;  2DA1 A;  5GPA A;  3M3Y J;  1VI0 A;  2VPR A;  5FKM A;  3BR6 A;  1Z77 A;  3GTJ J;  2R7Z J;  1FTZ A;  4A3K J;  1I3Q J;  4BBS J;  2ID6 A;  3FIS A;  1EF4 A;  5FKK A;  1B8I B;  3RZD J;  5GP9 A;  1IUF A;  1GDT A;  3HOU J;  2LLK A;  2XRL A;  1DU0 A;  2ECB A;  2GM4 A;  1FEX A;  1RKT A;  3Q0U A;  1DU6 A;  3JRF A;  3GTL J;  2DN0 A;  2DMU A;  3Q0W A;  3BTJ A;  1XG1 A;  2FJ1 A;  3L1P A;  1QPI A;  2JA6 J;  2ME0 A;  1MNM C;  4D5F A;  3A03 A;  1LE8 A;  2EZL A;  2JMW A;  9ANT A;  4A3F J;  2L7F P;  1WH5 A;  3S1R J;  1ZGW A;  1LFB A;  4J19 A;  3JRD A;  1NK2 P;  2JWT A;  2H1K A;  2LTP A;  4S0H B;  1HCR A;  1Q1V A;  2KT0 A;  1XC5 A;  1RKW A;  2O8K A;  5EGO A;  4M3B A;  2HOS A;  1VFC A;  1S7E A;  3QPL A;  1MSF C;  4JP0 A;  5K7Z A;  2DA3 A;  3B6A A;  3FKI J;  2X48 A;  5IYB J;  2G0E A;  2R5Z A;  4FCY A;  3JRA A;  4IHW A;  3PO2 J;  2O7O A;  1GV5 A;  3TED A;  5JLW A;  3BT9 A;  3JR9 A;  2Y9Y A;  4BXX J;  1MBG A;  2CQQ A;  2R5Y A;  2DA4 A;  5HOD A;  1RPW A;  2DMQ A;  2HQ5 A;  4W1U A;  2HDD A;  2L9R A;  3B6C A;  1ZQ3 P;  1BW5 A;  2E2I J;  3A01 B;  4W97 A;  4A3L J;  4UUS A;  3Q3S A;  4BY7 J;  5E3N A;  2DA2 A;  1TWA J;  2L0K A;  4X6A J;  2M34 A;  1WH7 A;  5GPC A;  3S1N J;  4FIS A;  4MIM A;  4B1R A;  3C2B A;  1RR7 A;  2FD5 A;  3RQI A;  4QTR A;  1UHS A;  4LOC A;  2LD5 A;  3GTP J;  3HOX J;  1HF0 A;  2ELK A;  2XGC A;  1ETV A;  2MSY A;  3S16 J;  2I10 A;  2K9S A;  1YRN A;  2XPW A;  5E3M A;  4FE7 A;  3PM1 A;  2JK3 A;  2LFB A;  3Q0V A;  3OSF A;  3HM5 A;  1YRN B;  4B3A A;  1GT0 C;  1T33 A;  2K9N A;  3HOZ J;  2CJJ A;  1QRY A;  4ABZ A;  1IRZ A;  3FIW A;  1ETW A;  2L7M P;  1O4X A;  3S15 J;  1BW6 A;  1VF9 A;  3BG3 A;  3G1L A;  1TWG J;  3ZQC A;  1FJL A;  3GTQ J;  2EQR A;  5J1U A;  5M3M J;  4D7N A;  1POG A;  1JJ6 C;  4HNV A;  2P81 A;  2H8R A;  3LNQ A;  5K7H A;  1LFU P;  1HLV A;  1Z0X A;  2JA7 J;  2MW8 A;  3FK7 A;  5E3O A;  2JA5 J;  5M5Y J;  2E1O A;  5DTD A;  3TP3 A;  1W0T A;  4BBR J;  2K9Q A;  4BY1 J;  1AU7 A;  3HOV J;  5C44 J;  3A02 A;  3SFI A;  3IH2 A;  4AC0 A;  1B8I A;  5C4J J;  3DCF A;  2O9L A;  3NAR A;  1A5J A;  4FE4 A;  2WAQ N;  1ETK A;  1ORK A;  4FTH A;  1WI3 A;  1HDP A;  5EZG A;  4A3E J;  5IOZ A;  5E3L A;  3LSP A;  5FKO A;  4M3F A;  1JUP A;  3HEF A;  2EH3 A;  3M4O J;  2ZB9 A;  1NK3 P;  3I4N J;  4G12 A;  2NVY J;  3E7L A;  4XIC A;  1X2N A;  2LP0 A;  3G1M A;  3ZOB A;  1RES A;  3ZQI A;  1RET A;  2RAE A;  1JUS A;  2M0C A;  1B72 B;  2R93 J;  4C3I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...