4NDLA

Computational design and experimental verification of a symmetric homodimer
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
44
structure length
44
Chain Sequence
FSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENH-c2b, computational designed homodimer
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo protein
total genus 9
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4ndlA00
2EZKA 1JT0A 2HOTA 2DTZA 1GVDA 1MH3A 1EF4A 3CQZJ 1MBKA 5IP7J 2HYJA 4C2MJ 1B8IB 3A03A 2KDZA 2XPUA 3NAUA 4UUSB 3B6AA 3WHCA 3A01A 5FLMJ 1ITYA 3BR1A 3IH4A 4B3AA 1FJLA 1H88C 3S17J 2DA7A 1WH5A 2MW8A 2XPVA 3FKIJ 1HLVA 3HOUJ 1WI3A 3SFIA 2ECBA 3JRAA 2D5VA 2FD5A 2K9NA 2L9RA 1TWAJ 5FKNA 2LK2A 1MSFC 3Q0UA 3F0CA 4J19A 2L0KA 4C3HJ 4A3KJ 1VFCA 1NTCA 5IOZA 2JMWA 4B4CA 2Y9ZA 2X9DA 3ZQHA 2QCOA 3QPSA 5FKMA 4FCYA 1MBGA 1Y1VJ 1IJWC 5IPAA 1PUFB 1HOMA 1ETVA 1IC8A 3TP3A 3BG3A 5J1RA 2DA1A 1MH4A 1HDDC 5E3OA 2JK3A 1P7JA 1LE8B 4DZPA 4G12A 1P7IA 2GLOA 3D1NI 4A3IJ 2E2JJ 2M8GX 3LSRA 2E1OA 3JR9A 4DYQA 2DMNA 5FKKA 3G1MA 3TW7A 3HBLA 3ZQIA 5IOYA 1ETKA 4IHVA 4IEJA 4M6VA 1A5JA 4I76A 2COBA 5F0CA 3LNQA 2L7MP 5K7FA 5EG0A 4JX6A 1JUPA 2ID3A 3JRIA 1JKOC 1CQTA 2FX0A 2R7ZJ 1DU0A 2TRTA 1I6HJ 4XICA 1AHDP 2EH3A 3UKGA 2DA2A 3ZQLA 1BJZA 1QVTA 2HDDA 1MBFA 9ANTA 1Z0XA 2NVQJ 1K83J 3BQZA 2K40A 3VPRA 3JRCA 4XIDA 2PMZN 2CUFA 4M3BA 3LSPA 2G0EA 2HI3A 2H8RA 2GBYA 1ZGWA 5J1YA 5M5WJ 4A3FJ 3HOZJ 2DN0A 3E7LA 3GTLJ 5EF6A 5F08A 2M0CA 1AKHB 5EZHA 3IV5A 1U8BA 5EEAA 1BW6A 3G1LA 4FE7A 4MO7A 1NK3P 5EDNA 3HEFA 1YRNA 1I50J 3QPLA 2HOAA 2CQQA 3O8HA 5BNGA 1JT6A 1UG2A 2YS9A 1R9TJ 4JX4A 3GTPJ 2MG4A 5M3MJ 2ME0A 1LFUP 4B1RA 4A3EJ 2RAEA 2WV1A 1DU6A 2LTPA 4BKXA 2VKVA 2AHQA 3JRGA 3OIOA 1VNDA 1GUUA 3A02A 2HOSA 1WGXA 2NS8A 1JTXA 3B6CA 4JP0A 1TWGJ 2ECCA 2X48A 2LVSA 5M5XJ 4AYBN 4GFBA 1B8IA 2W48A 3S2DJ 4IHXA 5M5YJ 1K61A 3SDGA 3CMYA 1SFOJ 1IRZA 1JKRC 2XSDC 2DA6A 4D5FA 1RPWA 2XPWA 2XRLA 1W0UA 1VF9A 3HDDA 1FTTA 3BG9A 2R5ZA 1ZR2A 3HOXJ 3TW6A 1RKWA 4A3BJ 2HQ5A 4BXXJ 1FIAA 4AC0A 3ZQFA 3BTIA 5E3NA 5IP6A 3S1NJ 3GTMJ 2IBDA 2NVTJ 3JRHA 1BL0A 2EZIA 1WPKA 4FTHA 1Y1WJ 3BR3A 1MSEC 1ETYA 2R92J 5F1JA 3NARA 1SANA 3PM1A 5C4JJ 4DZJA 1RETA 1Z77A 3ZOBA 4D7MA 4M3FA 2Y30A 3GTOJ 2JA7J 4W97A 1A6IA 1OCTC 3PO3J 4Y52J 2XB5A 2O7OA 3HM5A 5FLVA 1TWFJ 1ETQA 3FIWA 2LP0A 1JJ6C 3S1MJ 1LE8A 4S0HB 2ELKA 3I4NJ 4XK4A 3HKZN 2IAIA 3IH3A 2WAQN 5K7ZA 4C3IJ 2LLKA 1JTYA 3L1PA 5DTDA 1U9NA 1ORKA 3S2HJ 4NDLA 5EGOA 4A3MJ 1TWHJ 4A3CJ 2WB1N 3ZQCA 2P81A 1ETWA 3BG5A 2MGQA 1FEXA 2VI6A 2YUSA 1MBEA 1ZK8A 1B72B 1HF0A 1Q1VA 4V2FA 3OSGA 3WHBA 3H3VK 2X6OA 4RBOA 4MFDA 1W0TA 2VUMJ 1JKQC 2FQ4A 1MNMC 5DS9A 2YU9J 3GBGA 2NVXJ 2LD5A 1JUSA 1FIPA 1ZTRA 2JA8J 1VI0A 2R0QC 1O4XA 2DMTA 1APLC 1GDTA 1ZR4A 1T33A 2KT0A 4ABZA 3HOYJ 4EEFG 2DA3A 5EYRA 1AKHA 1GV2A 3TEDA 1IG7A 1UMQA 3W6VA 2K9QA 1JGGA 2L7FP 2TCTA 2DJNA 4X1EA 3HOVJ 1IDZA 4MLOA 2JA6J 2EZLA 4MFEA 1H89C 3HOWJ 4CYCB 2M2EA 1OCPA 1IUFA 1RR7A 3BR6A 3BR0A 4UUTA 5M3FJ 1IV6A 2O9LA 3I4MJ 1I3QJ 3Q3SA 1XG1A 1JUMA 5FKLA 4JYKA 5GP9A 1TC3C 3S1QJ 3Q0WA 4X6AJ 3M4OJ 2FJ1A 4M3GA 3C2BA 1HDPA 3MVPA 1D5YA 2NOGA 2R5YB 1T56A 4UUSA 2DMUA 2L7ZA 3G1OA 4V2GA 1U9OA 1QRYA 3ZQGA 4RDUA 4XRSA 5GPCA 3RZDJ 4LOCA 2Y31A 3GTQJ 1WCMJ 4BBSJ 4FE4A 2JA5J 2R93J 4C3JJ 1ETXA 2XB0X 1ZQ3P 1MBJA 2M9HA 2VKEA 3BTCA 5JLWA 1F36A 3BQYA 2Y2ZA 1F43A 2NS7A 3A01B 5E3MA 3CCYA 3RQIA 4QSHA 2DA5A 2R5ZB 5IYCJ 2E19A 3S15J 5F0HA 2XGCA 4QTRA 2OPTA 1PUFA 3LSGA 3SJMA 5F27A 4DW6A 5IP9J 4XRSG 4DYCA 2E2HJ 4FISA 2LY9A 5JLXA 5C3EJ 3M3YJ 1X58A 3GTKJ 5FKOA 1QPIA 1XC5A 5F0FA 2M34A 4A3JJ 5EZGA 4DYRA 3HGGA 4Y7NJ 1RESA 2CU7A 4A69C 4IHWA 3BR5A 3MKLA 5J1UA 2DMPA 3TP0A 1AU7A 4BY1J 5IYBJ 2LKXA 2I10A 4JX5A 5HODA 2IEKA 3S14J 1X2MA 2CUEA 1B72A 1HCRA 1UHSA 2CQXA 2XGEA 4QIWN 2CRGA 5C4XJ 1ZKGA 2LR8A 2CJJA 1IDYA 5FJ8J 4M3EA 1TWCJ 5EGOB 3LOCA 2ID6A 3JREA 4L5EA 5E3LA 3LSJA 3JRBA 4A3GJ 3GTJJ 5EG0B 1U78A 3FK7A 2ME6A 4M3DA 1NK2P 3OSFA 3K7AJ 2DA4A 2XGDA 2HXOA 3GTGJ 2DMQA 1BW5A 2E2IJ 4MIMA 1OJLA 1H8AC 4BY7J 1G2HA 3BTJA 3QQAA 3IH2A 4HNVA 2B63J 3BT9A 4I6ZA 1E3OC 2LFBA 3HGYA 3JRDA 1XS9A 2AO9A 2JN6A 3CDLA 2O8KA 2H1KA 2EBIA 2HXIA 3FISA 1OFCX 1GT0C 3FK6A 4BBRJ 2JWTA 5K7HA 3S16J 4AUXA 1GV5A 2K9SA 3RKQA 4A3LJ 1LFBA 2QF7A 4CYCA 1JKPC 1BA5A 5GPAA 3DEWA 1S7EA 2JJ7A 2VPRA 2OF7A 2ZB9A 3S1RJ 1IGNA 2NVYJ 2N8GA 5F04A 1YRNB 4IHYA 3OOUA 2EZHA 2Y0SN 1RKTA 2EQRA 1POGA 2Y9YA 3MN2A 3PO2J 4A3DJ 3K2AA 2R5YA 3HB9A 3H0GJ 4A93J 3RZOJ 2MSYA 1X2NA 3DCFA 4D5CA 5C44J 1WH7A 3BTLA 1ENHA 3Q0VA 3O8GA 1JJ8C 5J3LA 4W1UA 4D7NA 1MBHA 1ETOA 4XRMA 1FTZA 5IYDJ 1QVUA 3BR2A 2GM4A 3JRFA
chains in the Genus database with same CATH superfamily
2Y69H 1WKMA 4U0VA 3DBRB 3ZPLA 1MBKA 2HYJA 2LY1A 3A03A 2KDZA 2R3SA 2XPUA 3NAUA 4BE2A 1Y8QB 2EIKH 3K9TA 3WHCA 3IL2A 3TOAA 3GO5A 3IH4A 4EM1A 4U87A 1FJLA 2DA7A 2CQNA 5H6QA 4IHTA 1Z6TA 1UHMA 2BW3B 3FKIJ 1G4DA 2MLKA 3E6MA 3VYTB 4WXHA 2V6CA 2D5VA 4AIKA 2HDWA 3WGIA 1MSFC 1R71A 1BR2A 4MHGA 3F0CA 1CF7A 2HPIA 4HNUA 4H4KC 1STZA 3CESA 4HSRA 1RI7A 2VQCA 3WTTC 2L4AA 4N0BA 4B4CA 1LEBA 2XSJC 2QZ8A 3GFMA 3V7CA 1HC8A 1ZLJA 3KPHA 2KZVA 2VJIA 2OZUA 3WE2A 3F6VA 4BJ6C 1R1TA 3T5XA 1HOMA 2L4MA 1IC8A 3IHUA 2BXZA 4E7LA 1Q1HA 2CUJA 1DGRM 5J1RA 2DA1A 2JUCA 2QENA 4U7DA 3R6SA 2X0LA 4YG2F 3K1MA 4NUBA 4BXUA 2ZSHB 1P7IA 1QO0D 4HEA2 3CJQB 3LSHA 3HUGB 3ERMA 3MAJA 3JR9A 2DMNA 3J7AO 3G1MA 2JPBA 4XLAA 3RPUA 3VEPA 3ZQIA 3CJRB 3ABTA 4RB3C 1O7LA 1ETKA 4IHVA 3K4KA 1YQAA 4I76A 3PNVA 2COBA 3LNQA 3KP4A 1W7PD 2UUZA 1L3LA 4UV8A 2ID3A 2Z5UA 2R7ZJ 2IGOA 5CPRB 3F8CA 1I6HJ 2BZTA 2Z99A 4XICA 1FYMA 2VC0A 2DA2A 1BJZA 2AQEA 1OCRH 1OLTA 2WBMA 4OIPF 3FXJA 1MBFA 1YE9A 2HZDA 3LAJA 1ON2A 1Z0XA 2NVQJ 1MMAA 1YJWI 2K40A 1P4XA 4XIDA 3LSPA 3DQVC 2R7FA 2ZNZA 1O57A 2GBYA 1QZYA 1ZGWA 5J1YA 1WVRA 2M45A 3K4LA 2P8TA 4LK0F 2DQRA 1ZYRF 3E7LA 3F8BA 1HBXG 4B48A 5EZHA 3IV5A 1U8BA 1BW6A 1Y0NA 3OYAA 2ZFUA 3KCCA 4H0EA 1G8XA 1WJ5A 5HS8A 5B5EC 1X1BA 1I50J 1EKEA 3K1PA 2LMDA 2CQQA 2IGKA 2VXDA 3ISPA 2X51A 2VT3A 4ZTJA 4F7ZA 1XPXA 2HVQA 2Q1ZB 4IX7A 2K4JA 4RB1A 4XLPF 1D5VA 4HOBA 1YW8A 1D3YA 5FLXK 4F91B 2CW0F 1LFUP 2VODA 3ZMVA 4B1RA 4A3EJ 4IOAF 1DU6A 3M8JA 4BKXA 4HX4A 2E5ZA 3OIOA 1VNDA 2FBHA 2DFEA 4OMZA 3FM3A 3DFGA 1JTXA 5DUKA 3LQQA 1TW3A 2VB6A 3V8LA 4A2UA 3DBLB 2CW8A 2JT1A 2W48A 3S2DJ 2KIQA 1TL8A 2DPUA 1WJDA 1YLFA 1SFOJ 2IA1A 3HDDA 1W0UA 2E1CA 3IRQA 3QRFF 2DOFA 2R5ZA 1X4OA 1WJFA 1WJEA 1YITI 3A2KA 3TW6A 1RKWA 2O3FA 3KZIC 3WGHA 3R0JA 1LVKA 1XD7A 1J5YA 4AC0A 3QP6A 5H2FC 1HKTA 2KL4A 1TBXA 2AQFA 3GCMA 5IP6A 5E3NA 3F72A 1TNSA 3OYMA 4KYWA 2IP2A 2Q0OA 1IN6A 2X6YA 2VBZA 4G7OF 5F64A 4BEHB 3BJ6A 5F1JA 4BQAA 1DPRA 1LNWA 4R8HA 2Y30A 2IS1A 1SD4A 1X3UA 1R5HA 1A6IA 4ZYDA 3PO3J 3WTWC 5FB2A 4KJZA 2F5FA 2O7OA 1U0JA 4L0YB 4IVNA 2QA4I 1CF7B 4ZZLA 4XKWA 2UWMA 4XK4A 3HKZN 2IAIA 3HTSB 3P5JA 2WAQN 1G3WA 3QU6A 3BZ6A 3OS0A 4GRIA 4XSZF 3KYCB 4F55A 3LA7A 2LLKA 1JTYA 2XROA 3EUHA 3L1PA 2X85A 2RC4A 3S2HJ 4E7IA 4KDPA 4YRVA 3HSRA 4O6JA 2WB1N 4L9NA 4GCVA 2P81A 3L2UA 2LOOA 3DF8A 3BG5A 2O03A 2ZMEC 3IUOA 5EEGA 4HA8A 3RKXA 2OJED 4BJTA 4V2FA 5JHFA 1IO2A 3WHBA 4TV7A 2ZXIA 2HR3A 4AYBA 4RS8A 3J81Z 1BJAA 2EJRA 2IXSA 2R7OA 3UNGC 1ODDA 1IAWA 1QPMA 3VB2A 1SFKA 4I2OA 2Z16A 1FIPA 2GIZA 3HRMA 1ZTRA 3L9FA 4KUMA 1XMKA 2VLAA 2LF8A 4HX8A 5KVRA 3DPTA 3BJOA 1GDTA 2GOXB 4E6KG 1ZG1A 2QLZA 5HLGA 4CICA 2DA3A 5HOOA 4UHTA 1A04A 1AKHA 1IG7A 1J7KA 1K7AA 4C9YA 2HVSA 2BYVE 2L7FP 1QGPA 2VJ5A 5E79C 3ABKH 1IDZA 1PJRA 4PJLA 3ZCOA 2JA6J 5E1XA 2UXXA 4QWQA 2VKDA 3G73A 2EZLA 4MFEA 3KYDB 3HOWJ 1R1VA 3SZGA 1QU3A 2A68F 1OCPA 5L3DA 2LH9A 2HTJA 3BR0A 3ZN0A 4UUTA 5M3FJ 3KEOA 1IV6A 2RQPA 3I4MJ 1A36A 3ZQ7A 3L2WA 4RB0A 1NHAA 5GP9A 4RAYA 1YS6A 5D6EA 4LB6B 1Z05A 3EUAA 3OR1C 2FJ1A 3PSIA 1WHUA 1MDMA 3W2VA 1USTA 3QAHA 1KGSA 4BNCA 4UUSA 2DMUA 4R1HA 4UVCA 3GW2A 1K6YA 3G1OA 3HIFA 3KZYA 3K70C 4M6YA 4A0XA 2CFOA 3ZQGA 2HFHA 3H35A 4XRSA 2R7TA 4RGXA 5D5VB 3RZDJ 3FMSA 3HTUA 1VQNI 2Y31A 3D5LA 2GA1A 4HF1A 2R93J 4DQ2A 1ETXA 4N9HA 1V5FA 3PIOF 1XCBA 2XHKA 1QQIA 5AIQA 4LK1F 1W1WE 3H9QA 3OS1A 3FXQA 1RRJA 2WY8Q 1HW2A 5LHHA 2R5ZB 1XX5A 4MGRA 1OCOH 2E35A 3B02A 4B8XA 2CV0A 2H8WA 4FHTA 3RKWA 5JHUA 4IPAA 5F27A 3OWTA 1FLIA 3BROA 3NRVA 4XRSG 4DYCA 4M9ZA 2PMHA 1F1ZA 2LYCA 4FISA 5JLXA 1T8IA 5FKOA 1IUYA 4YFNF 3E1SA 5F0FA 2HOEA 2M34A 2DT6A 1V3FA 4A3JJ 3QPHA 5EZGA 1KU9A 5ILUA 2ZBKA 5LLQA 2XAUA 2XAFA 3RDIA 2UXNA 1T38A 3KE2A 1FX7A 1P4WA 1X4PA 2CU7A 1MJ9A 2KIMA 4M9XA 2ELJA 1ACIA 3SYTA 3QOPA 3K4NA 5J1UA 2DMPA 4N4OB 3WTVC 2MABA 3PUFA 3OL4A 4BY1J 2QEXI 3WG9A 5D5XB 2IEKA 1X2MA 4ASNA 1FY7A 2CMPA 1HCRA 4CH7A 1UHSA 2KKOA 5LGTA 1D1CA 3TMOA 2CRGA 1ZKGA 1KZHA 1DGWY 3KP5A 2OCEA 4WXDA 3OYKA 3VWBA 3LOCA 1QA6A 4L5EA 1BC8C 2QSGX 2Y48A 5EG0B 2ADUA 2YPRA 1YO5C 4DGWB 3OYCA 1LEAA 3DLLF 2Z3YA 3ZRGA 2ESHA 4LG0A 4I09A 5CJ9A 3GFLA 1GVJA 2E2IJ 2DYSH 3WE3A 2W24A 3ZP5A 4IO9F 4V19K 2IS2A 1G2HA 3BTJA 2EIJH 1R36A 1MMNA 5GAHJ 3BT9A 1VQ5I 2DU9A 4RM2A 3BOQA 2D2WA 1YW7A 2JN6A 2RDPA 5B66C 1ZRFA 3S32A 3FMQA 2AXTC 3FISA 5E17F 2VOPA 1OFCX 1GT0C 3FK6A 2JWTA 2HEOA 1VTNC 2K9SA 1XDUA 3C7JA 1BA5A 2XGXA 3DEWA 3QU3A 1S7EA 2CSOA 1Z7UA 4AM3A 3BCBA 3CDIA 5F04A 4Z6YA 3TO6A 5E20A 1RKTA 1R4NB 2EQRA 1X1AA 4F52A 4B47A 4E7KA 3DTKA 2KRFA 3MN2A 4EJVA 3K2AA 3HB9A 1AWCA 4LLGF 1HQCA 3QYBA 1KU3A 4ESFA 3GLLA 1YHQI 4OIQF 2IS6A 4A6EA 5GTHC 4WWCA 4IOCF 1B6AA 2MC3A 2KIFA 4MQ9F 1S7AA 2Y75A 4OMYA 1R7JA 3M1CA 4XRMA 2OZ6A 3P9IA 2EZKA 1JT0A 4HNTA 2AS5F 1GVDA 3WTSC 5D8LB 1EF4A 3CQZJ 3ZN1A 2VKHA 3HSEA 4GO1A 2OTJI 4UUSB 5HVQC 4PFPA 1A6QA 2F6CA 5BQTA 3K69A 3CUOA 2GIVA 3DPUA 1WH5A 2MW8A 2XPVA 3JAMK 1HLVA 4O5VA 3CMAI 4PJ0C 3JRAA 2NVUB 2XC7A 4M73A 1TWAJ 2HYFA 3E6DA 3OIQA 2KQRA 3HRTA 4BQNA 4FX4A 3Q0UA 3KLNA 4LJZF 2QQ8A 4RGRA 1OCCH 4UXNA 2HYGD 2KZGA 1X19A 4ZDLA 3I59A 3FXLA 2CO5A 1PP7U 4KISA 3LA3A 4NQWB 5GADJ 4S05A 2Y9ZA 2X9DA 4FCYA 2GAUA 3FHNA 2XIGA 5IPAA 2P7VB 3GF2A 2KMUA 3TP3A 2V1XA 3BG3A 1N75A 1FP1D 1U3EM 5B1AH 3JAMZ 1S29A 2KFDA 1ONVA 3Q9VA 1V4RA 2ZO4A 3VOEA 3SEQA 3MEXA 4AVPA 2GLOA 5HLIA 2Y0SA 4ENJA 2M8GX 4CCLA 4DYQA 5FKKA 2ZCWA 2OUMA 2GWRA 4KITB 1XGNA 4I98B 1FYKA 1T39A 5IOYA 1H9TA 2IGMA 3CUQA 4UNOA 4LB5A 1Y39A 1A5JA 1IRGA 3H92A 4YEJA 4II3A 2EV6A 4HBLA 2L7MP 5K7FA 1UB9A 2UZKA 1OCZH 2VXZA 3OYHA 4PGGA 3OS2A 1JKOC 2TRTA 3UKGA 3MKWB 5DDGA 2STTA 4AU7A 1YI2I 2LF7A 3QP5A 5A2QZ 3PUBA 1K83J 5D6FA 2XF6A 2HS5A 3JRCA 3P7NA 2Y0MA 2FEZA 4I99C 2VASA 4M3BA 3F8FA 1WZ2A 3FM5A 2DOAA 2QVOA 5KNLA 2H8RA 2QUFA 2EFNA 4G94A 3X2QH 4OAZA 4Y33A 4LG0B 4L9VA 1HXDA 5D4SA 4D1QA 2JRTA 5ICCA 1K4SA 4RB2C 4XRFA 3AL0C 3GTLJ 5EF6A 2FQ3A 1E2XA 4KMFA 5F08A 3DP7A 4ZC3A 3G1LA 2DCEA 5EDNA 2CS3A 3HEFA 3M07A 3QPLA 2OQGA 3CCMI 2P0WA 2XKOA 3F3XA 1O3TA 1JT6A 1UG2A 1YYVA 2YS9A 2F5VA 3QODA 3I3LA 4JX4A 1ZAOA 3QYFA 2MG4A 5M3MJ 3F22A 2ME0A 3SEZA 1TTYA 4DOZA 4BDZA 1FZPB 5J6XA 4ZTFA 2RAEA 2WV1A 3GMEA 4KT5C 3VYSB 3ZQQA 3JRGA 4HV6A 1GUUA 4ZZDA 4OWRB 5LEJA 3BG7A 1MNEA 2HOSA 1WGXA 5JR3A 3RIRA 4B3XA 2VONA 1TWGJ 3LSMA 2XASA 4RLQA 5M5XJ 3GZ5A 5LRRA 1GHCA 1B8IA 4BAYA 4LD5A 3CMYA 2XSDC 2NRAC 3V7RA 2DA6A 1OKRA 1RPWA 2F5EA 2XPWA 1VF9A 1E3PA 4LITA 3U21A 1ZR2A 3H3ZA 1XGOA 3CCVI 1HKSA 3GYHX 4A3BJ 2DFHA 2HQ5A 2L02A 4GXOA 2E1MB 2HQNA 1XGSA 3CMEI 4BXXJ 3G6EI 4EJUA 3TGNA 4HDVA 2EV0A 4HQMA 2ZJQF 3GTMJ 4DBRA 2EZIA 4BDYA 4FTHA 2ICWG 2P4WA 2QQAA 4I7HA 4BGDA 4XKCA 3OYJA 3LSTA 4HSTA 2V7FA 3KX2A 4M3FA 2MLGA 2VOOA 4P9FA 3BG6A 2M30A 3WGGA 2XB5A 1WJBA 1I5ZA 5FLVA 2LP0A 1LE8A 4S0HB 2ELKA 3IH3A 2YSRA 5K7ZA 2QSFX 2JSCA 4I02A 5H6RA 4ENNA 3L2VA 3GZ6A 1MIJA 4KMUX 5EGOA 3QYEA 4G6DA 4A3MJ 2A5WA 4A3CJ 5ED4A 3ZQCA 1G3TA 4L5JA 3H36A 2IGNA 1U5TC 4GDFA 1MBEA 1BIBA 1B72B 1EH7A 1UZCA 4ESBA 4I01A 1HW1A 2CGPA 2X6OA 1LVAA 1IXRC 1EH8A 2LRDA 1W7PA 4MFDA 4RBOA 1W0TA 1MNMC 3A4CA 3TL4X 4MQVA 2DAOA 3GBGA 2NVXJ 4L9JA 3TDZC 4YIRX 1KQ0A 1W5SA 2K7LA 3CC2I 2KPMA 3CCLI 3LSKA 2R0QC 3T8RA 3E97A 3OYGA 2DMTA 2FE3A 2EPFA 2BV6A 3C1DA 2P7CB 1D8JA 1ZELA 3PSFA 4ABZA 3H5AA 3HOYJ 1I27A 4NBQA 3PQJA 5CVIA 1UMQA 4HLXA 1R1UA 3FXKA 1K78A 3ESWB 1D1BA 2JVHA 2ETHA 2MFZA 2XRNA 3FX3A 1T0FC 1WJCA 1Z21A 2TCTA 1LDJA 4QPOA 4YFKF 2W57A 3RCOA 1KQ8A 1WRJA 5CVRA 2M3AA 3KP2A 3AFHA 5FFZA 4CYCB 5BPDA 2A69F 3LQRA 4ENMA 2OU2A 4XL9A 3RSNA 3H9JA 2C6YA 4BQOA 5DV5A 3BR6A 2ZJ2A 3REOA 2A5YB 2PBIA 4AD9A 2O9LA 4IHSA 5B3SH 1MJBA 3HKZA 4DJAA 1RR8C 1XG1A 2WAQA 1DP7P 2Q8KA 1TC3C 4GYGA 3S1QJ 3VYUB 3M9AA 2LG4A 2EFQA 3KYLA 3M4OJ 4X6AJ 4M3GA 1V5GA 2X1DA 4B09A 1D5YA 1YG2A 2QKLB 2R5YB 1HSTA 1T56A 1Z3XA 2XF7A 1FPQA 1GLNA 3ZMDA 1TQPA 2O8XA 2WB1A 3P9CA 3CMMA 2RQQA 4AWXB 5GPCA 1BI0A 2GXGA 4LOCA 4ZH4F 2CV1A 4BBSJ 4FE4A 2K4BA 2XAGA 1JI8A 1Z1DA 3H9GA 3L09A 1KONA 2VN2A 2YR2A 2CG4A 3N4MA 2GZWA 4EJWA 3CC7I 1F43A 2NS7A 2JVGA 3K4BA 3V4GA 4DBQA 5DD4A 4QSHA 2DA5A 2W84A 2E19A 5IYCJ 3C2HA 3JSOA 1N78A 2XGCA 2O61A 1J9IA 1O3SA 3E3VA 2FUG2 4QTRA 3IWFA 4E70A 3OYIA 4PJJA 1PUFA 3LSGA 3MMYB 3SJMA 1HA8A 5FRNA 1GXPA 3UR3C 3RYRA 2E2HJ 2CV2A 2FA5A 2E60A 3M3YJ 5LFAA 2PJRA 3GTKJ 2MA3A 4P1WA 3J81K 1H0MA 3KLOA 3HRUA 2W7NA 2B7EA 4DYRA 3H5RA 1EV7A 3FKJA 3C18A 5CVUA 1S5LC 3EQLF 3MCZA 3B73A 4XORA 4A69C 3SZPA 2EFOA 5DCFA 3BZKA 1U5TA 3ULQB 4LGWA 2I10A 2L9SA 1K4TA 3J7AY 4JX5A 3EETA 4MTEA 3I53A 3GLXA 5HODA 3S14J 1UJ8A 2CUEA 4KT6A 1E17A 3BPXA 2XGEA 5CVJA 5C4XJ 1KYWA 2CJJA 4AIDA 1IDYA 5FJ8J 3DTIA 1X1CA 4CCMA 1FOWA 4M9SA 5EGOB 2ID6A 3JRBA 4RMNA 3CCRI 3ZXSA 4PDKA 3KP3A 4LG3A 4A3GJ 4HZFA 4UVBA 1U78A 3FF5A 4AVZA 3GTGJ 1BW5A 2W85A 4XLCA 3G4SI 2P5VA 1XSVA 1FSEA 3OY9A 1H8AC 3TO9A 1UHWA 3NEUA 4RA2A 4Y15A 3IH2A 4HNVA 3BWGA 4U0WA 4II2A 3DPLC 1EJ9A 1ON1A 2LFBA 1TP4A 4XBFA 4NHJA 1A31A 2M1BA 2EA2A 1ULYA 2EBIA 4EMSA 2V9KA 2HVRA 3LL7A 2VE8A 1MD0A 3H3UA 5FGMA 1FBUA 4ZYAA 2FSWA 5K7HA 2YX4A 4AUXA 3MZHA 4OOIA 3F21A 3DEEA 4A3LJ 3BP8A 4EM0B 1JKPC 4XOPA 5J4VA 1VQMI 2OF7A 3L2RA 3S1RJ 2I5UA 2NVYJ 3K1NA 4XQFA 5K5RA 1FWZA 3K4JA 4BE0A 2KLOA 4RM3A 2A05A 4IHYA 1P2FA 3ONQA 3OOUA 4J01A 4JK1X 2DFFA 3PJRA 1XMXA 1SVLA 4PSXA 3U1KA 3CD6I 5LGNA 3DKXA 1B9MA 4A3DJ 4ZDOA 4EATA 1G59A 2R7RA 3S3MA 1YIJI 1Y8RB 3ROUA 4HRIA 4A93J 3RZOJ 2MSYA 1X2NA 3DCFA 5LD2C 1ENHA 1X1DA 3Q0VA 4CDGA 3K4CA 2DXIA 2E5NA 4D7NA 6PAXA 1ETOA 2JUGA 5IYDJ 1U8RA 1V5EA 3FHZA 2VJ4A 1BI2A 2DTZA 5CQGA 3JSPA 2WAEA 4LLNA 4JQFA 4C2MJ 5IP7J 3W6KB 2H27A 3BCAA 4KIBA 4M72A 3TQNA 3J80K 5BOXA 3A01A 5FLMJ 1ITYA 3BR1A 1ZHFA 1I1SA 1P4AA 4U88A 3ASOH 1H88C 1WSUA 3S17J 4QPQA 2M87A 3HOUJ 2DO7A 3CF5F 2ZJPF 3SFIA 3LA2A 2NXNB 1FSHA 2GQQA 3D5RC 3OYEA 2M0MA 5DD8A 3TOBA 1ERDA 2DK8A 1J2XA 1R49A 4CZCA 2FNPA 2PN6A 3T1BA 2F5CA 3I0TA 2L0KA 4C3HJ 3KIOA 1D1AA 3I71A 2OQRA 2RGVA 1NTCA 5IOZA 3U2RA 2EFWA 4OIOF 4IXAA 5L3GA 2IJLA 1ZRCA 3GFIA 3ZQHA 2QCOA 3QPSA 4M74A 5FKMA 3N97A 1MBGA 1Y1VJ 3J80Z 1PUFB 1ETVA 2EFPA 4RGSA 2MD0A 2ZMEA 2FNAA 3CCUI 1HDDC 1M1EB 5AONA 2JK3A 4CA0A 1I3AA 4RAGA 4DZPA 1SFXA 3T0YA 3LSRA 2E1OA 1Z9CA 2CUZA 3TW7A 3HBLA 5J8FA 1X1PA 3ZMTA 2FRHA 4M6VA 1DQUA 2IW5A 5ILSA 4A0YA 3CCEI 3LFKA 1KA8A 5HDNA 1FOYA 2EIMH 4OINF 4L5IA 1JUPA 1QNTA 5J8CA 3KP6A 4ZYHA 2OAZA 3JRIA 2EWNA 1XSXA 1CQTA 2FX0A 3I5UA 1USSA 3LWFA 2J5OA 2ISZA 1AHDP 2EH3A 1TQIA 3L7WA 4PUSA 3H1CA 1SVMA 3W6JB 1XSDA 1ZG3A 1J09A 2MC4A 4PCQA 2OCCH 2STWA 9ANTA 1TNTA 1C0WA 1MJAA 3VPRA 3N05A 2PMZN 2CUFA 4KIGA 5LHGA 1S3JA 3F8MA 2G0EA 1YOVB 2HI3A 2IA2A 2ZKZA 4LMYA 2AXLA 3SZTA 3DU5A 1JHHA 2D1HA 3HPHA 3CO6C 2GXAA 4RAFA 4EM2A 4UUVA 4A3FJ 3HOZJ 2KHMA 3PIPF 1FNNA 3KEYA 4A12A 4OAYA 1JE8A 3IC7A 1QHHD 2M0CA 1AKHB 5EEAA 1XCVA 3W2AA 4BUPA 3I9V2 1A35A 5HS9A 2KP6A 3HJEA 2R7XA 1YRNA 4C2TA 2HOAA 4XKBA 3O8HA 4HV5A 2OBPA 1SEUA 1LQ1A 3MD2A 4FT8A 4XM3A 4Q48A 2WTEA 3E5XA 3GTPJ 1FBQA 3I64A 2Z2SB 1T6SA 4KFCA 2O0YA 5J47A 2M4KA 4IRHA 2VKVA 3S8PA 5F1RA 2GOMA 3PNYA 3A02A 1IN4A 1HW5A 2K85A 2NS8A 4KN4X 2NOJB 5CYVA 4HF2A 4Y17A 1S72I 2OA4A 2H6CA 2G9WA 3MZ8A 1MDMB 2ECCA 1SMTA 2LVSA 2F4IA 1VQ9I 1JGSA 1T08B 1EH6A 2P5LC 1SAXA 4IHXA 2VBYA 5M5YJ 1K61A 3SDGA 2OTLI 1JKRC 3OIPA 4D5FA 4YELA 5FFXA 4G8XA 1SC7A 2BW3A 1BI3A 4I0AA 3DBHB 2BGCA 4ZYEA 3HOTA 1IF1A 1DP3A 1RIOH 4Y3OA 1E0EA 1FIAA 3E6CC 2K02A 4PSWA 4L18B 2VQLA 3IRRA 4LIUA 3BTIA 1W4MA 1W36C 3S1NJ 2IBDA 4B44A 1U6GA 4E7ZA 4BACA 2ACJA 2ESNA 3HHGA 3TBIA 1MSEC 1ETYA 2DDBA 4E7HA 4UB8C 3PM1A 2RN7A 5C4JJ 2H09A 3TKYA 1I6XA 1RETA 1Z77A 3ZOBA 2JA7J 1IN8A 5LGUA 5FO5A 3WTUC 1R5GA 2WWYA 2E7WA 4CHUA 4XR6A 2NS0A 3IKVA 3DV8A 1FYLA 2IA0A 2ISYA 5J4YA 3ABUA 3V8KA 2L54A 5HNFA 5A2QK 4XKVA 4Z2YA 3I4NJ 3F9KA 3HSFA 4EVIA 2EILH 2WC2A 2EK5A 2XVCA 5CQEA 4C3IJ 3ZMUA 4DNCA 2QGUA 1ZG5A 2FBIA 2WV0A 5J40A 4HPQA 2HWVA 3FXUA 3G2BA 3CO7C 3FWEA 1ORKA 2HQRA 3CCQI 1OISA 1TWHJ 3BDDA 3W3CA 4U7BA 1ETWA 2LC2A 2RNGA 3CDHA 2V1DA 4CCNA 3A1YA 1FEXA 1TLHB 2G7HA 2VI6A 3PL8A 1ZK8A 1HF0A 1Q1VA 1QZZA 5HDGA 5D5UB 1B9NA 3OSGA 2DK5A 2BVLA 5GAEJ 3MKYB 4ZJZA 4P55A 3P9KA 3H3VK 2DT7B 3CTAA 1JKQC 5L3CA 2FQ4A 2CYYA 4RAZA 5K5QA 1IN5A 1B4AA 2W82A 2YU9J 1F9NA 2A3SA 1VQOI 3OR2C 2LD5A 2HU9A 1MNDA 4ETSA 1QHGA 3HC7A 1FMWA 1R00A 2L01A 2IRFG 2VJJA 2R7DA 1LJ9A 5GTIC 4X0GA 1APLC 4D0PA 1T33A 1MKMA 3CF2A 4L0ZB 2KT0A 3H5NA 4EEFG 4J00A 1J75A 1FMVA 2IPQX 2O5RA 3L2QA 2DPDA 1GV2A 5JFRA 1T95A 1VQPI 3WTXC 3IAS2 2LNBA 2VQHA 4BHBA 2VIXA 3V7SA 2P5KA 2HPMA 4X1EA 3HOVJ 2W1OA 1UELB 2BY3A 2XAQA 2QBYA 2KRHA 1OYWA 4Q47A 2XF5A 5EJCA 5GAGJ 2A6HF 1P92A 2CQKA 5LBQA 1IUFA 4HDUA 1FOXA 1RR7A 5D5WB 2FF4A 3EYIA 3C3WA 4BU2A 2DI3A 3NQOA 3Q3SA 1MZBA 1JUMA 2JQ7A 5FKLA 4JYKA 3NWTA 3Q0WA 1LKXA 2YX7A 5ICFA 1O3QA 4PK4A 3LAPA 1YS7A 3MVPA 4A0ZA 2F5DA 1LPQA 3K6GA 1W36D 4I0BA 4XN3A 2V26A 1BM9A 2BY2A 4V2GA 1WJAA 5DM6F 1QRYA 3BLYA 4HF0A 2H94A 2PX9A 1DPUA 3O6BB 1E3HA 3HOSA 3GTQJ 5ERIA 3KP7A 3M7GA 1BN5A 2XB0X 1NG7A 3DKYA 3J7ZI 3AAFA 4E7JA 3JCUC 3VFZA 1YW9A 2COMA 4XLNF 4OIRF 2VKEA 3BTCA 3M1EA 3T8TA 1F36A 3OMYA 1DUXC 3BQYA 1G6NA 2RKHA 2X6WA 3CC4I 2BVMA 4BEHA 2HKXA 3HYIA 1UAAA 3CCYA 2B9SA 1KU2A 4KIFA 2EINH 4LIVA 2TDXA 5FD6A 2PEXA 3RQ4A 3V8JA 4NC7A 4MNUA 2OPTA 2YU3A 2CFXA 2L5QA 4CO8A 2QQ9A 5K1YA 5IP9J 2FOKA 5HS7A 4CCJA 4G9YA 1Y6IA 1ZARA 4JOMA 2WY7Q 2LY9A 2MH9A 4O3MA 1HKQA 2R7WA 4WF2A 1GXQA 2E34A 2P6SA 3I59B 4N9IA 2ZXJA 1K6OA 3I55I 3OOPA 2FMYA 2PQ8A 2DBBA 3HGGA 4Y7NJ 5HDKA 1RESA 1XB4A 4CGZA 3FDYA 3ZMZA 1IXSB 1R4MB 3BR5A 1XN7A 4XLEA 1XMAA 3TP0A 1AU7A 1YJ9I 5IYBJ 2LKXA 3RPUD 2X1CA 1D0ZA 2LKPA 4IKFA 3I56I 1CGPA 2LSOA 2FXAA 1BR4A 2CQXA 1IRXA 1R23A 2EA4A 4EQQA 2DW4A 4QIWN 3CUQB 3MFKA 1VQ8I 1MW7A 1TWCJ 1OMIA 3JREA 1LB2A 5E3LA 1LFPA 3LSJA 3EUHC 4YIIA 4A5NA 4BH9A 1SAUA 3C2GA 4LFUA 1NK2P 3OSFA 3EDPA 4CUGA 2HXOA 3BC8A 4UY8I 1XDSA 2DYRH 2D1VA 4MIMA 1OJLA 1TT5B 3ECHA 4BY7J 2D45A 3QQAA 3AG4H 1Z3YA 1BOBA 2Z9OA 2E36A 2FBKA 1N25A 2ZXWH 2LKSA 3E5QA 1E3OC 3FMRA 5FROA 4P96A 5IT3A 1LDKB 3ERED 3SHFA 1XS9A 3CDLA 2O8KA 2PJPA 4ESJA 4AIHA 4CCKA 5JVGF 1BIAA 4XNFA 4BQQA 2K9MA 3S16J 1VQ4I 1GV5A 4N4NB 1RUNA 1LFBA 2QF7A 3WU2C 4BXFA 4FX0A 5ILVA 3S3NA 2VPRA 1YIOA 2ZB9A 3ZGKA 3GUDA 2JTVA 5TISC 3H0DA 4Y4RA 5ICGA 2HTSA 1PDNC 1POGA 1ZGJA 1KQ9A 2XKPA 4BYYA 3QWLA 1S9HA 3PO2J 4E7SA 1ZLKA 4PJMA 1I1GA 3H0GJ 2QBYB 4D5CA 5FRMA 4F3QA 2BEOA 2E71A 3BTLA 3R4KA 1O7FA 3O8GA 2QYOA 5J3LA 4W1UA 1FTZA 3BR2A 3KZZA 4FASD 2ZXHA 3JRFA 5L3EA 2HOTA 2VQGA 3SXYA 1MH3A 1YTYA 3CP2A 2IS4A 1B8IB 5KHDA 2ZSIB 3F23A 4AIJA 5DUIA 2HZTA 3B6AA 3F8NA 2K86A 1OPCA 1SMYF 4B3AA 1I39A 1SFUA 2R7QA 3L2CA 5KAFC 4PZJA 2L3DA 5FLXZ 1WI3A 3VSLA 1MMSA 4G6TB 3GVAA 4Y13A 2ECBA 1ZREA 2FD5A 2K9NA 2L9RA 1FOKA 5FKNA 1R22A 2LK2A 2IT0A 2X1EA 4EJTA 4J19A 1U2WA 5E1ZB 4A3KJ 4CZZA 2A6TA 1VFCA 5CLSA 1R6RA 2JMWA 2NNNA 2FMLA 1PYVA 4XONA 4WCGA 3VDXA 2K27A 2MH2A 3ML6A 4HW0A 4XLFA 2V9PA 5H20A 1IJWC 4C2UA 2G7UA 3BZCA 3I4PA 5B1BH 3DLAA 5EEHA 4BS9A 2DLLA 4QLCU 5K5OA 1MH4A 5L3FA 4YFXF 5E3OA 4C30A 1QBJA 1P7JA 2M4GA 3V42A 1LE8B 2Q2EA 2P6TA 1Z7LA 1ZGAA 2BOLA 4G12A 3WODF 3O3KA 3D1NI 4A3IJ 2E2JJ 2GA2A 1P9QC 1BI1A 3CZ6A 4CSWA 1T98A 2CW7A 2KJBA 1SFEA 3CCSI 2OV7A 3PFIA 3VYRB 4IEJA 1LUJB 2F4MB 4BHCA 4XOTA 5F0CA 4BL0B 4GYIA 5EG0A 4JX6A 3HL2A 3MKZA 3ABMH 3ASNH 3BJAA 4IQJA 3OYBA 4FQGA 4G7ZF 1DU0A 5TRDA 1ZRDA 2BHZA 5FD5A 2W00A 1QVTA 3RJPA 1W7PB 3WTZA 3CCJI 3ZQLA 2HDDA 1T0FA 4XMYA 2QWWA 1TT0A 2BBYA 2EB7A 4R79A 3HHHA 3MWMA 1RC9A 3BQZA 4F92B 4P9UA 4ZYGA 2K3PA 1TZLA 4ITVA 5E8IA 1HSJA 2A6EF 5HNHA 3AL0B 1BR1A 5DYMA 1PP8F 5M5WJ 4G7HF 3G71I 1KYZA 4EJOA 3WG7H 1WWXA 3OYFA 2DN0A 2DQLA 3EYYA 4ZDPA 2V1UA 4IRGA 5KCMA 1FP2A 3OL3A 2KRCA 3ELKA 2LY2A 3S3OA 4FE7A 2MBFA 1K78B 1OR7C 4MEYF 4MO7A 1NK3P 2DOEA 2X6XA 5JI6A 1X3ZB 4RGUA 1S8NA 3W2WA 2ELHA 5D8KB 2DT5A 5BNGA 1Y56A 1Y0UA 4HLYA 1R9TJ 3COAC 2XDVA 3FBIB 1D0XA 1LDDA 1SD6A 3BPVA 5E18F 2E1NA 1R5ID 2RREA 1EA3A 1WI9A 2LTPA 3G3ZA 2AHQA 2MYSA 3NWSA 2K5CA 3KFWX 3M8EA 5HLHA 3GX4X 2F2EA 4WX9A 3E6BA 1AOYA 2JSPA 3B6CA 4JP0A 4M71A 2X48A 4AYBN 4EGYA 4GFBA 2BE5F 4NC6A 3O2PE 2RV8A 3KETA 1IRZA 1YX3A 2VPLA 4M6XA 3IAM2 1FTTA 3CJNA 1O3RA 2XRLA 3BG9A 1VQKI 1T2KA 3EPZA 3HOXJ 2VT2A 4U0YA 2VL8A 2PFBA 4B43A 1WFXA 1UFMA 3F6OA 2OC6A 5TJJA 3ZQFA 4A5MA 5HLTA 3CLOA 5DCMA 4HAMA 2NVTJ 3SFZA 2E1MC 3DWLE 3HG9A 3JRHA 1BL0A 1WPKA 1Y1WJ 3HXLA 1B59A 2KJCA 2HDCA 2PMZA 3BR3A 2R92J 4IQ4A 4MTDA 3DU6A 2CQ7A 3A0HC 3NARA 1D0YA 1SANA 2CWEA 3ABLH 2JPCA 3AG3H 4NQWA 2L2OA 1VQ7I 4DZJA 3GTOJ 4D7MA 2DJIA 3EUKL 2W25A 1IW7F 3GZNB 4W97A 5AIPA 1WQ2A 1OCTC 3QOEA 3OV8A 1FT9A 4PFOA 4Y52J 1FBSA 3HM5A 4EGZA 4BHPA 2VBXA 3AKZA 2PJRB 1TWFJ 1ETQA 2WADA 3FIWA 4S04A 1S6LA 1JJ6C 3RI4A 3S1MJ 2QKMB 2V9VA 4Q4ZF 2V4JC 4RLFA 1XGMA 2F4OB 4BE1A 1OQYA 2O6GE 3FZVA 3JW4A 5KAIC 3DTEA 1ZH5A 2M8EA 4PJNA 5DTDA 1J59A 1U9NA 1RNLA 3S2WA 1PUEE 3IP4B 4NDLA 3FXMA 1U5TB 1IZ1A 1IRFA 4IF4A 3Q5FA 4LLLA 1S7OA 3E5UA 4NC8A 2R7UA 1MMGA 2KISA 2PI0A 2NAZA 2Q2EB 2MGQA 2BHYA 3FXOA 2YUSA 3WU1B 2VE9A 3K0LA 2DTRA 2QSHX 2V1NA 1NH3A 1H9GA 1VZ0A 4HQEA 2VUMJ 1P6RA 2A07F 1RZ4A 5DS9A 5LRSA 3MQ0A 5BS6A 4CXFA 3OYDA 1W5CC 1JUSA 2R4GA 3OYLA 2LBFA 2HQAA 3CUQC 1NG6A 2JA8J 1VI0A 3R0AA 5DEQA 1UG0A 1O4XA 1Z6RA 3D0SA 5LEKA 2K3FA 2A61A 2Z1DA 1VQLI 1ZR4A 2GXBA 1OR7A 1DDNA 3TDUC 5IY5H 2I8DA 5EYRA 2BY0A 1Z91A 4ANJA 3TEDA 3W6VA 2K9QA 2DFIA 3LFUA 3K2ZA 1JGGA 3JTHA 2DJNA 3RYPA 3JTGA 1JHFA 1PVEA 4MLOA 2ZJRF 3ZMSA 5JVTA 2EV5A 3FXRA 1H89C 5BMZA 1VQ6I 2M2EA 3J7YJ 2NNYA 2OD5A 1X3WB 3MZYA 4XN0A 4JBAA 3K70D 3CP8A 3E0JB 1I3QJ 4GGGA 2HNHA 3SDBA 3CJTB 3A0BC 2DDAA 4KNYA 3C2BA 3TO7A 1OYIA 1HDPA 1SVOA 1OYYA 2B0LA 2KIUA 2NOGA 3AG1H 5D4RA 3S93A 1R58A 2L7ZA 4HYEA 2XAHA 4D9JA 1YFHA 2M5WA 1Z67A 1U9OA 2RNJA 4RDUA 4UVAA 3PQKA 3OYNA 3KEQA 4KN7X 2XAJA 2L9NA 1N77A 2V79A 1WCMJ 1IV8A 1B1BA 4UB6C 2JA5J 4C3JJ 3I54A 1ZQ3P 2Z33A 1MBJA 2M9HA 1K79A 4IZZA 1TW2A 2L9VA 5JLWA 1AA7A 1D8KA 3QPTA 1L0OC 1SD7A 2Y2ZA 4A6DA 3A01B 3D5SC 5E3MA 2H6BA 3RQIA 2JZYA 4PGHA 4CYDA 1IXCA 3S15J 3Q9SA 3WU0A 3K10A 5F0HA 3HPGA 2K9LA 2XV4S 4YIFA 3LSIA 1YJNI 1F5TA 3PNTA 4DW6A 1MMDA 2X4HA 1SD5A 5DCMB 1UCRA 2HGCA 2PG4A 2JRMA 3DKWA 5C3EJ 1X58A 2PLYA 1QPIA 2XUBA 1XC5A 2J5PA 3GWZA 5KK1A 1KU7A 3HUGA 2VC1A 4HG2A 3VODA 2FOWA 2H1LA 1W5TA 1F4KA 2QQBA 3ECOA 4NNJA 4IHWA 2ZMEB 3MKLA 4DIQA 4L9TA 1FC3A 3RKYA 2DODA 1V54H 4KICA 4OU0A 4K2EA 2KDOA 3I58A 4Q5SF 5CKTA 2HKOA 2RVCA 1B72A 1G3YA 2BY1A 4WK8F 3GFJA 4WXCA 2ZNYA 2F48A 1G3SA 3AG2H 2LR8A 2FU4A 4M3EA 3FBNB 3M8FA 1REPC 4P5OA 3GTJJ 4NB5A 5IT9K 4EV0A 5LHIA 5F6FA 3FK7A 2UV1A 2ME6A 3RTRA 1IN7A 4M3DA 2WAFA 3K7AJ 3LMMA 2DA4A 1JXSA 2XGDA 3GXOA 2LDUA 4IJAA 2DMQA 3ZR8X 3DXJF 2WA0A 2PMUA 2R7SA 3IWZA 2ZFWA 1ZN2A 1XTAA 2B63J 4HX7A 3R61A 1MGTA 4I6ZA 3U9GA 2CH0A 3HGYA 3JRDA 1TQMA 5ICEA 2AO9A 2LBFB 4G6QA 4XLHA 3IKTA 2H1KA 4ENKA 2HXIA 4XSXF 2QM3A 1BBYA 4BBRJ 3PFYA 5CVVA 3SQNA 4FETA 4KA4A 3RKQA 3BY6A 4MEXF 5IT9Z 2E7XA 2R7VA 2BXYA 4CYCA 2ZC2A 5GPAA 5TGTA 5L3BA 2W4SA 3HZJA 2M7BA 2JJ7A 1BOAA 2VBWA 3GEZA 4F93B 3L00A 1IGNA 4IL6C 1J0RA 2N8GA 1YX5A 2MD5A 1YRNB 2EZHA 2Y0SN 2V6EA 3HRSA 4CCOA 4IRIA 2LREA 4UV9A 3DEUA 5BPIA 2Y9YA 2M7AA 3CLQA 2IVMA 1BC7C 2R5YA 1QZEA 3U1DA 5E8GA 4ON0A 2JA2A 4E4HA 1RUOA 5C44J 2NYXA 1V55H 4BJ5C 3WTYC 1WH7A 5E1WA 1JJ8C 3RPQA 3VSKA 1MBHA 3K4MA 2L7KA 1QVUA 5DM7F 2GM4A 3R60A
chains in the Genus database with same CATH topology
2EZKA 1JT0A 2HOTA 2DTZA 1GVDA 1MH3A 1EF4A 3CQZJ 1MBKA 5IP7J 2HYJA 4C2MJ 1B8IB 3A03A 2KDZA 2XPUA 3NAUA 4UUSB 3B6AA 3WHCA 3A01A 5FLMJ 1ITYA 3BR1A 3IH4A 4B3AA 1FJLA 1H88C 3S17J 2DA7A 1WH5A 2MW8A 2XPVA 3FKIJ 1HLVA 3HOUJ 1WI3A 3SFIA 2ECBA 3JRAA 2D5VA 2FD5A 2K9NA 2L9RA 1TWAJ 5FKNA 2LK2A 1MSFC 3Q0UA 3F0CA 4J19A 2L0KA 4C3HJ 4A3KJ 1VFCA 1NTCA 5IOZA 2JMWA 4B4CA 2Y9ZA 2X9DA 3ZQHA 2QCOA 3QPSA 5FKMA 4FCYA 1MBGA 1Y1VJ 1IJWC 5IPAA 1PUFB 1HOMA 1ETVA 1IC8A 3TP3A 3BG3A 5J1RA 2DA1A 1MH4A 1HDDC 5E3OA 2JK3A 1P7JA 1LE8B 4DZPA 4G12A 1P7IA 2GLOA 3D1NI 4A3IJ 2E2JJ 2M8GX 3LSRA 2E1OA 3JR9A 4DYQA 2DMNA 5FKKA 3G1MA 3TW7A 3HBLA 3ZQIA 5IOYA 1ETKA 4IHVA 4IEJA 4M6VA 1A5JA 4I76A 2COBA 5F0CA 3LNQA 2L7MP 5K7FA 5EG0A 4JX6A 1JUPA 2ID3A 3JRIA 1JKOC 1CQTA 2FX0A 2R7ZJ 1DU0A 2TRTA 1I6HJ 4XICA 1AHDP 2EH3A 3UKGA 2DA2A 3ZQLA 1BJZA 1QVTA 2HDDA 1MBFA 9ANTA 1Z0XA 2NVQJ 1K83J 3BQZA 2K40A 3VPRA 3JRCA 4XIDA 2PMZN 2CUFA 4M3BA 3LSPA 2G0EA 2HI3A 2H8RA 2GBYA 1ZGWA 5J1YA 5M5WJ 4A3FJ 3HOZJ 2DN0A 3E7LA 3GTLJ 5EF6A 5F08A 2M0CA 1AKHB 5EZHA 3IV5A 1U8BA 5EEAA 1BW6A 3G1LA 4FE7A 4MO7A 1NK3P 5EDNA 3HEFA 1YRNA 1I50J 3QPLA 2HOAA 2CQQA 3O8HA 5BNGA 1JT6A 1UG2A 2YS9A 1R9TJ 4JX4A 3GTPJ 2MG4A 5M3MJ 2ME0A 1LFUP 4B1RA 4A3EJ 2RAEA 2WV1A 1DU6A 2LTPA 4BKXA 2VKVA 2AHQA 3JRGA 3OIOA 1VNDA 1GUUA 3A02A 2HOSA 1WGXA 2NS8A 1JTXA 3B6CA 4JP0A 1TWGJ 2ECCA 2X48A 2LVSA 5M5XJ 4AYBN 4GFBA 1B8IA 2W48A 3S2DJ 4IHXA 5M5YJ 1K61A 3SDGA 3CMYA 1SFOJ 1IRZA 1JKRC 2XSDC 2DA6A 4D5FA 1RPWA 2XPWA 2XRLA 1W0UA 1VF9A 3HDDA 1FTTA 3BG9A 2R5ZA 1ZR2A 3HOXJ 3TW6A 1RKWA 4A3BJ 2HQ5A 4BXXJ 1FIAA 4AC0A 3ZQFA 3BTIA 5E3NA 5IP6A 3S1NJ 3GTMJ 2IBDA 2NVTJ 3JRHA 1BL0A 2EZIA 1WPKA 4FTHA 1Y1WJ 3BR3A 1MSEC 1ETYA 2R92J 5F1JA 3NARA 1SANA 3PM1A 5C4JJ 4DZJA 1RETA 1Z77A 3ZOBA 4D7MA 4M3FA 2Y30A 3GTOJ 2JA7J 4W97A 1A6IA 1OCTC 3PO3J 4Y52J 2XB5A 2O7OA 3HM5A 5FLVA 1TWFJ 1ETQA 3FIWA 2LP0A 1JJ6C 3S1MJ 1LE8A 4S0HB 2ELKA 3I4NJ 4XK4A 3HKZN 2IAIA 3IH3A 2WAQN 5K7ZA 4C3IJ 2LLKA 1JTYA 3L1PA 5DTDA 1U9NA 1ORKA 3S2HJ 4NDLA 5EGOA 4A3MJ 1TWHJ 4A3CJ 2WB1N 3ZQCA 2P81A 1ETWA 3BG5A 2MGQA 1FEXA 2VI6A 2YUSA 1MBEA 1ZK8A 1B72B 1HF0A 1Q1VA 4V2FA 3OSGA 3WHBA 3H3VK 2X6OA 4RBOA 4MFDA 1W0TA 2VUMJ 1JKQC 2FQ4A 1MNMC 5DS9A 2YU9J 3GBGA 2NVXJ 2LD5A 1JUSA 1FIPA 1ZTRA 2JA8J 1VI0A 2R0QC 1O4XA 2DMTA 1APLC 1GDTA 1ZR4A 1T33A 2KT0A 4ABZA 3HOYJ 4EEFG 2DA3A 5EYRA 1AKHA 1GV2A 3TEDA 1IG7A 1UMQA 3W6VA 2K9QA 1JGGA 2L7FP 2TCTA 2DJNA 4X1EA 3HOVJ 1IDZA 4MLOA 2JA6J 2EZLA 4MFEA 1H89C 3HOWJ 4CYCB 2M2EA 1OCPA 1IUFA 1RR7A 3BR6A 3BR0A 4UUTA 5M3FJ 1IV6A 2O9LA 3I4MJ 1I3QJ 3Q3SA 1XG1A 1JUMA 5FKLA 4JYKA 5GP9A 1TC3C 3S1QJ 3Q0WA 4X6AJ 3M4OJ 2FJ1A 4M3GA 3C2BA 1HDPA 3MVPA 1D5YA 2NOGA 2R5YB 1T56A 4UUSA 2DMUA 2L7ZA 3G1OA 4V2GA 1U9OA 1QRYA 3ZQGA 4RDUA 4XRSA 5GPCA 3RZDJ 4LOCA 2Y31A 3GTQJ 1WCMJ 4BBSJ 4FE4A 2JA5J 2R93J 4C3JJ 1ETXA 2XB0X 1ZQ3P 1MBJA 2M9HA 2VKEA 3BTCA 5JLWA 1F36A 3BQYA 2Y2ZA 1F43A 2NS7A 3A01B 5E3MA 3CCYA 3RQIA 4QSHA 2DA5A 2R5ZB 5IYCJ 2E19A 3S15J 5F0HA 2XGCA 4QTRA 2OPTA 1PUFA 3LSGA 3SJMA 5F27A 4DW6A 5IP9J 4XRSG 4DYCA 2E2HJ 4FISA 2LY9A 5JLXA 5C3EJ 3M3YJ 1X58A 3GTKJ 5FKOA 1QPIA 1XC5A 5F0FA 2M34A 4A3JJ 5EZGA 4DYRA 3HGGA 4Y7NJ 1RESA 2CU7A 4A69C 4IHWA 3BR5A 3MKLA 5J1UA 2DMPA 3TP0A 1AU7A 4BY1J 5IYBJ 2LKXA 2I10A 4JX5A 5HODA 2IEKA 3S14J 1X2MA 2CUEA 1B72A 1HCRA 1UHSA 2CQXA 2XGEA 4QIWN 2CRGA 5C4XJ 1ZKGA 2LR8A 2CJJA 1IDYA 5FJ8J 4M3EA 1TWCJ 5EGOB 3LOCA 2ID6A 3JREA 4L5EA 5E3LA 3LSJA 3JRBA 4A3GJ 3GTJJ 5EG0B 1U78A 3FK7A 2ME6A 4M3DA 1NK2P 3OSFA 3K7AJ 2DA4A 2XGDA 2HXOA 3GTGJ 2DMQA 1BW5A 2E2IJ 4MIMA 1OJLA 1H8AC 4BY7J 1G2HA 3BTJA 3QQAA 3IH2A 4HNVA 2B63J 3BT9A 4I6ZA 1E3OC 2LFBA 3HGYA 3JRDA 1XS9A 2AO9A 2JN6A 3CDLA 2O8KA 2H1KA 2EBIA 2HXIA 3FISA 1OFCX 1GT0C 3FK6A 4BBRJ 2JWTA 5K7HA 3S16J 4AUXA 1GV5A 2K9SA 3RKQA 4A3LJ 1LFBA 2QF7A 4CYCA 1JKPC 1BA5A 5GPAA 3DEWA 1S7EA 2JJ7A 2VPRA 2OF7A 2ZB9A 3S1RJ 1IGNA 2NVYJ 2N8GA 5F04A 1YRNB 4IHYA 3OOUA 2EZHA 2Y0SN 1RKTA 2EQRA 1POGA 2Y9YA 3MN2A 3PO2J 4A3DJ 3K2AA 2R5YA 3HB9A 3H0GJ 4A93J 3RZOJ 2MSYA 1X2NA 3DCFA 4D5CA 5C44J 1WH7A 3BTLA 1ENHA 3Q0VA 3O8GA 1JJ8C 5J3LA 4W1UA 4D7NA 1MBHA 1ETOA 4XRMA 1FTZA 5IYDJ 1QVUA 3BR2A 2GM4A 3JRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZK A;  1JT0 A;  2HOT A;  2DTZ A;  1GVD A;  1MH3 A;  1EF4 A;  3CQZ J;  1MBK A;  5IP7 J;  2HYJ A;  4C2M J;  1B8I B;  3A03 A;  2KDZ A;  2XPU A;  3NAU A;  4UUS B;  3B6A A;  3WHC A;  3A01 A;  5FLM J;  1ITY A;  3BR1 A;  3IH4 A;  4B3A A;  1FJL A;  1H88 C;  3S17 J;  2DA7 A;  1WH5 A;  2MW8 A;  2XPV A;  3FKI J;  1HLV A;  3HOU J;  1WI3 A;  3SFI A;  2ECB A;  3JRA A;  2D5V A;  2FD5 A;  2K9N A;  2L9R A;  1TWA J;  5FKN A;  2LK2 A;  1MSF C;  3Q0U A;  3F0C A;  4J19 A;  2L0K A;  4C3H J;  4A3K J;  1VFC A;  1NTC A;  5IOZ A;  2JMW A;  4B4C A;  2Y9Z A;  2X9D A;  3ZQH A;  2QCO A;  3QPS A;  5FKM A;  4FCY A;  1MBG A;  1Y1V J;  1IJW C;  5IPA A;  1PUF B;  1HOM A;  1ETV A;  1IC8 A;  3TP3 A;  3BG3 A;  5J1R A;  2DA1 A;  1MH4 A;  1HDD C;  5E3O A;  2JK3 A;  1P7J A;  1LE8 B;  4DZP A;  4G12 A;  1P7I A;  2GLO A;  3D1N I;  4A3I J;  2E2J J;  2M8G X;  3LSR A;  2E1O A;  3JR9 A;  4DYQ A;  2DMN A;  5FKK A;  3G1M A;  3TW7 A;  3HBL A;  3ZQI A;  5IOY A;  1ETK A;  4IHV A;  4IEJ A;  4M6V A;  1A5J A;  4I76 A;  2COB A;  5F0C A;  3LNQ A;  2L7M P;  5K7F A;  5EG0 A;  4JX6 A;  1JUP A;  2ID3 A;  3JRI A;  1JKO C;  1CQT A;  2FX0 A;  2R7Z J;  1DU0 A;  2TRT A;  1I6H J;  4XIC A;  1AHD P;  2EH3 A;  3UKG A;  2DA2 A;  3ZQL A;  1BJZ A;  1QVT A;  2HDD A;  1MBF A;  9ANT A;  1Z0X A;  2NVQ J;  1K83 J;  3BQZ A;  2K40 A;  3VPR A;  3JRC A;  4XID A;  2PMZ N;  2CUF A;  4M3B A;  3LSP A;  2G0E A;  2HI3 A;  2H8R A;  2GBY A;  1ZGW A;  5J1Y A;  5M5W J;  4A3F J;  3HOZ J;  2DN0 A;  3E7L A;  3GTL J;  5EF6 A;  5F08 A;  2M0C A;  1AKH B;  5EZH A;  3IV5 A;  1U8B A;  5EEA A;  1BW6 A;  3G1L A;  4FE7 A;  4MO7 A;  1NK3 P;  5EDN A;  3HEF A;  1YRN A;  1I50 J;  3QPL A;  2HOA A;  2CQQ A;  3O8H A;  5BNG A;  1JT6 A;  1UG2 A;  2YS9 A;  1R9T J;  4JX4 A;  3GTP J;  2MG4 A;  5M3M J;  2ME0 A;  1LFU P;  4B1R A;  4A3E J;  2RAE A;  2WV1 A;  1DU6 A;  2LTP A;  4BKX A;  2VKV A;  2AHQ A;  3JRG A;  3OIO A;  1VND A;  1GUU A;  3A02 A;  2HOS A;  1WGX A;  2NS8 A;  1JTX A;  3B6C A;  4JP0 A;  1TWG J;  2ECC A;  2X48 A;  2LVS A;  5M5X J;  4AYB N;  4GFB A;  1B8I A;  2W48 A;  3S2D J;  4IHX A;  5M5Y J;  1K61 A;  3SDG A;  3CMY A;  1SFO J;  1IRZ A;  1JKR C;  2XSD C;  2DA6 A;  4D5F A;  1RPW A;  2XPW A;  2XRL A;  1W0U A;  1VF9 A;  3HDD A;  1FTT A;  3BG9 A;  2R5Z A;  1ZR2 A;  3HOX J;  3TW6 A;  1RKW A;  4A3B J;  2HQ5 A;  4BXX J;  1FIA A;  4AC0 A;  3ZQF A;  3BTI A;  5E3N A;  5IP6 A;  3S1N J;  3GTM J;  2IBD A;  2NVT J;  3JRH A;  1BL0 A;  2EZI A;  1WPK A;  4FTH A;  1Y1W J;  3BR3 A;  1MSE C;  1ETY A;  2R92 J;  5F1J A;  3NAR A;  1SAN A;  3PM1 A;  5C4J J;  4DZJ A;  1RET A;  1Z77 A;  3ZOB A;  4D7M A;  4M3F A;  2Y30 A;  3GTO J;  2JA7 J;  4W97 A;  1A6I A;  1OCT C;  3PO3 J;  4Y52 J;  2XB5 A;  2O7O A;  3HM5 A;  5FLV A;  1TWF J;  1ETQ A;  3FIW A;  2LP0 A;  1JJ6 C;  3S1M J;  1LE8 A;  4S0H B;  2ELK A;  3I4N J;  4XK4 A;  3HKZ N;  2IAI A;  3IH3 A;  2WAQ N;  5K7Z A;  4C3I J;  2LLK A;  1JTY A;  3L1P A;  5DTD A;  1U9N A;  1ORK A;  3S2H J;  4NDL A;  5EGO A;  4A3M J;  1TWH J;  4A3C J;  2WB1 N;  3ZQC A;  2P81 A;  1ETW A;  3BG5 A;  2MGQ A;  1FEX A;  2VI6 A;  2YUS A;  1MBE A;  1ZK8 A;  1B72 B;  1HF0 A;  1Q1V A;  4V2F A;  3OSG A;  3WHB A;  3H3V K;  2X6O A;  4RBO A;  4MFD A;  1W0T A;  2VUM J;  1JKQ C;  2FQ4 A;  1MNM C;  5DS9 A;  2YU9 J;  3GBG A;  2NVX J;  2LD5 A;  1JUS A;  1FIP A;  1ZTR A;  2JA8 J;  1VI0 A;  2R0Q C;  1O4X A;  2DMT A;  1APL C;  1GDT A;  1ZR4 A;  1T33 A;  2KT0 A;  4ABZ A;  3HOY J;  4EEF G;  2DA3 A;  5EYR A;  1AKH A;  1GV2 A;  3TED A;  1IG7 A;  1UMQ A;  3W6V A;  2K9Q A;  1JGG A;  2L7F P;  2TCT A;  2DJN A;  4X1E A;  3HOV J;  1IDZ A;  4MLO A;  2JA6 J;  2EZL A;  4MFE A;  1H89 C;  3HOW J;  4CYC B;  2M2E A;  1OCP A;  1IUF A;  1RR7 A;  3BR6 A;  3BR0 A;  4UUT A;  5M3F J;  1IV6 A;  2O9L A;  3I4M J;  1I3Q J;  3Q3S A;  1XG1 A;  1JUM A;  5FKL A;  4JYK A;  5GP9 A;  1TC3 C;  3S1Q J;  3Q0W A;  4X6A J;  3M4O J;  2FJ1 A;  4M3G A;  3C2B A;  1HDP A;  3MVP A;  1D5Y A;  2NOG A;  2R5Y B;  1T56 A;  4UUS A;  2DMU A;  2L7Z A;  3G1O A;  4V2G A;  1U9O A;  1QRY A;  3ZQG A;  4RDU A;  4XRS A;  5GPC A;  3RZD J;  4LOC A;  2Y31 A;  3GTQ J;  1WCM J;  4BBS J;  4FE4 A;  2JA5 J;  2R93 J;  4C3J J;  1ETX A;  2XB0 X;  1ZQ3 P;  1MBJ A;  2M9H A;  2VKE A;  3BTC A;  5JLW A;  1F36 A;  3BQY A;  2Y2Z A;  1F43 A;  2NS7 A;  3A01 B;  5E3M A;  3CCY A;  3RQI A;  4QSH A;  2DA5 A;  2R5Z B;  5IYC J;  2E19 A;  3S15 J;  5F0H A;  2XGC A;  4QTR A;  2OPT A;  1PUF A;  3LSG A;  3SJM A;  5F27 A;  4DW6 A;  5IP9 J;  4XRS G;  4DYC A;  2E2H J;  4FIS A;  2LY9 A;  5JLX A;  5C3E J;  3M3Y J;  1X58 A;  3GTK J;  5FKO A;  1QPI A;  1XC5 A;  5F0F A;  2M34 A;  4A3J J;  5EZG A;  4DYR A;  3HGG A;  4Y7N J;  1RES A;  2CU7 A;  4A69 C;  4IHW A;  3BR5 A;  3MKL A;  5J1U A;  2DMP A;  3TP0 A;  1AU7 A;  4BY1 J;  5IYB J;  2LKX A;  2I10 A;  4JX5 A;  5HOD A;  2IEK A;  3S14 J;  1X2M A;  2CUE A;  1B72 A;  1HCR A;  1UHS A;  2CQX A;  2XGE A;  4QIW N;  2CRG A;  5C4X J;  1ZKG A;  2LR8 A;  2CJJ A;  1IDY A;  5FJ8 J;  4M3E A;  1TWC J;  5EGO B;  3LOC A;  2ID6 A;  3JRE A;  4L5E A;  5E3L A;  3LSJ A;  3JRB A;  4A3G J;  3GTJ J;  5EG0 B;  1U78 A;  3FK7 A;  2ME6 A;  4M3D A;  1NK2 P;  3OSF A;  3K7A J;  2DA4 A;  2XGD A;  2HXO A;  3GTG J;  2DMQ A;  1BW5 A;  2E2I J;  4MIM A;  1OJL A;  1H8A C;  4BY7 J;  1G2H A;  3BTJ A;  3QQA A;  3IH2 A;  4HNV A;  2B63 J;  3BT9 A;  4I6Z A;  1E3O C;  2LFB A;  3HGY A;  3JRD A;  1XS9 A;  2AO9 A;  2JN6 A;  3CDL A;  2O8K A;  2H1K A;  2EBI A;  2HXI A;  3FIS A;  1OFC X;  1GT0 C;  3FK6 A;  4BBR J;  2JWT A;  5K7H A;  3S16 J;  4AUX A;  1GV5 A;  2K9S A;  3RKQ A;  4A3L J;  1LFB A;  2QF7 A;  4CYC A;  1JKP C;  1BA5 A;  5GPA A;  3DEW A;  1S7E A;  2JJ7 A;  2VPR A;  2OF7 A;  2ZB9 A;  3S1R J;  1IGN A;  2NVY J;  2N8G A;  5F04 A;  1YRN B;  4IHY A;  3OOU A;  2EZH A;  2Y0S N;  1RKT A;  2EQR A;  1POG A;  2Y9Y A;  3MN2 A;  3PO2 J;  4A3D J;  3K2A A;  2R5Y A;  3HB9 A;  3H0G J;  4A93 J;  3RZO J;  2MSY A;  1X2N A;  3DCF A;  4D5C A;  5C44 J;  1WH7 A;  3BTL A;  1ENH A;  3Q0V A;  3O8G A;  1JJ8 C;  5J3L A;  4W1U A;  4D7N A;  1MBH A;  1ETO A;  4XRM A;  1FTZ A;  5IYD J;  1QVU A;  3BR2 A;  2GM4 A;  3JRF A; 
#chains in the Genus database with same CATH topology
 2Y69 H;  1WKM A;  4U0V A;  3DBR B;  3ZPL A;  1MBK A;  2HYJ A;  2LY1 A;  3A03 A;  2KDZ A;  2R3S A;  2XPU A;  3NAU A;  4BE2 A;  1Y8Q B;  2EIK H;  3K9T A;  3WHC A;  3IL2 A;  3TOA A;  3GO5 A;  3IH4 A;  4EM1 A;  4U87 A;  1FJL A;  2DA7 A;  2CQN A;  5H6Q A;  4IHT A;  1Z6T A;  1UHM A;  2BW3 B;  3FKI J;  1G4D A;  2MLK A;  3E6M A;  3VYT B;  4WXH A;  2V6C A;  2D5V A;  4AIK A;  2HDW A;  3WGI A;  1MSF C;  1R71 A;  1BR2 A;  4MHG A;  3F0C A;  1CF7 A;  2HPI A;  4HNU A;  4H4K C;  1STZ A;  3CES A;  4HSR A;  1RI7 A;  2VQC A;  3WTT C;  2L4A A;  4N0B A;  4B4C A;  1LEB A;  2XSJ C;  2QZ8 A;  3GFM A;  3V7C A;  1HC8 A;  1ZLJ A;  3KPH A;  2KZV A;  2VJI A;  2OZU A;  3WE2 A;  3F6V A;  4BJ6 C;  1R1T A;  3T5X A;  1HOM A;  2L4M A;  1IC8 A;  3IHU A;  2BXZ A;  4E7L A;  1Q1H A;  2CUJ A;  1DGR M;  5J1R A;  2DA1 A;  2JUC A;  2QEN A;  4U7D A;  3R6S A;  2X0L A;  4YG2 F;  3K1M A;  4NUB A;  4BXU A;  2ZSH B;  1P7I A;  1QO0 D;  4HEA 2;  3CJQ B;  3LSH A;  3HUG B;  3ERM A;  3MAJ A;  3JR9 A;  2DMN A;  3J7A O;  3G1M A;  2JPB A;  4XLA A;  3RPU A;  3VEP A;  3ZQI A;  3CJR B;  3ABT A;  4RB3 C;  1O7L A;  1ETK A;  4IHV A;  3K4K A;  1YQA A;  4I76 A;  3PNV A;  2COB A;  3LNQ A;  3KP4 A;  1W7P D;  2UUZ A;  1L3L A;  4UV8 A;  2ID3 A;  2Z5U A;  2R7Z J;  2IGO A;  5CPR B;  3F8C A;  1I6H J;  2BZT A;  2Z99 A;  4XIC A;  1FYM A;  2VC0 A;  2DA2 A;  1BJZ A;  2AQE A;  1OCR H;  1OLT A;  2WBM A;  4OIP F;  3FXJ A;  1MBF A;  1YE9 A;  2HZD A;  3LAJ A;  1ON2 A;  1Z0X A;  2NVQ J;  1MMA A;  1YJW I;  2K40 A;  1P4X A;  4XID A;  3LSP A;  3DQV C;  2R7F A;  2ZNZ A;  1O57 A;  2GBY A;  1QZY A;  1ZGW A;  5J1Y A;  1WVR A;  2M45 A;  3K4L A;  2P8T A;  4LK0 F;  2DQR A;  1ZYR F;  3E7L A;  3F8B A;  1HBX G;  4B48 A;  5EZH A;  3IV5 A;  1U8B A;  1BW6 A;  1Y0N A;  3OYA A;  2ZFU A;  3KCC A;  4H0E A;  1G8X A;  1WJ5 A;  5HS8 A;  5B5E C;  1X1B A;  1I50 J;  1EKE A;  3K1P A;  2LMD A;  2CQQ A;  2IGK A;  2VXD A;  3ISP A;  2X51 A;  2VT3 A;  4ZTJ A;  4F7Z A;  1XPX A;  2HVQ A;  2Q1Z B;  4IX7 A;  2K4J A;  4RB1 A;  4XLP F;  1D5V A;  4HOB A;  1YW8 A;  1D3Y A;  5FLX K;  4F91 B;  2CW0 F;  1LFU P;  2VOD A;  3ZMV A;  4B1R A;  4A3E J;  4IOA F;  1DU6 A;  3M8J A;  4BKX A;  4HX4 A;  2E5Z A;  3OIO A;  1VND A;  2FBH A;  2DFE A;  4OMZ A;  3FM3 A;  3DFG A;  1JTX A;  5DUK A;  3LQQ A;  1TW3 A;  2VB6 A;  3V8L A;  4A2U A;  3DBL B;  2CW8 A;  2JT1 A;  2W48 A;  3S2D J;  2KIQ A;  1TL8 A;  2DPU A;  1WJD A;  1YLF A;  1SFO J;  2IA1 A;  3HDD A;  1W0U A;  2E1C A;  3IRQ A;  3QRF F;  2DOF A;  2R5Z A;  1X4O A;  1WJF A;  1WJE A;  1YIT I;  3A2K A;  3TW6 A;  1RKW A;  2O3F A;  3KZI C;  3WGH A;  3R0J A;  1LVK A;  1XD7 A;  1J5Y A;  4AC0 A;  3QP6 A;  5H2F C;  1HKT A;  2KL4 A;  1TBX A;  2AQF A;  3GCM A;  5IP6 A;  5E3N A;  3F72 A;  1TNS A;  3OYM A;  4KYW A;  2IP2 A;  2Q0O A;  1IN6 A;  2X6Y A;  2VBZ A;  4G7O F;  5F64 A;  4BEH B;  3BJ6 A;  5F1J A;  4BQA A;  1DPR A;  1LNW A;  4R8H A;  2Y30 A;  2IS1 A;  1SD4 A;  1X3U A;  1R5H A;  1A6I A;  4ZYD A;  3PO3 J;  3WTW C;  5FB2 A;  4KJZ A;  2F5F A;  2O7O A;  1U0J A;  4L0Y B;  4IVN A;  2QA4 I;  1CF7 B;  4ZZL A;  4XKW A;  2UWM A;  4XK4 A;  3HKZ N;  2IAI A;  3HTS B;  3P5J A;  2WAQ N;  1G3W A;  3QU6 A;  3BZ6 A;  3OS0 A;  4GRI A;  4XSZ F;  3KYC B;  4F55 A;  3LA7 A;  2LLK A;  1JTY A;  2XRO A;  3EUH A;  3L1P A;  2X85 A;  2RC4 A;  3S2H J;  4E7I A;  4KDP A;  4YRV A;  3HSR A;  4O6J A;  2WB1 N;  4L9N A;  4GCV A;  2P81 A;  3L2U A;  2LOO A;  3DF8 A;  3BG5 A;  2O03 A;  2ZME C;  3IUO A;  5EEG A;  4HA8 A;  3RKX A;  2OJE D;  4BJT A;  4V2F A;  5JHF A;  1IO2 A;  3WHB A;  4TV7 A;  2ZXI A;  2HR3 A;  4AYB A;  4RS8 A;  3J81 Z;  1BJA A;  2EJR A;  2IXS A;  2R7O A;  3UNG C;  1ODD A;  1IAW A;  1QPM A;  3VB2 A;  1SFK A;  4I2O A;  2Z16 A;  1FIP A;  2GIZ A;  3HRM A;  1ZTR A;  3L9F A;  4KUM A;  1XMK A;  2VLA A;  2LF8 A;  4HX8 A;  5KVR A;  3DPT A;  3BJO A;  1GDT A;  2GOX B;  4E6K G;  1ZG1 A;  2QLZ A;  5HLG A;  4CIC A;  2DA3 A;  5HOO A;  4UHT A;  1A04 A;  1AKH A;  1IG7 A;  1J7K A;  1K7A A;  4C9Y A;  2HVS A;  2BYV E;  2L7F P;  1QGP A;  2VJ5 A;  5E79 C;  3ABK H;  1IDZ A;  1PJR A;  4PJL A;  3ZCO A;  2JA6 J;  5E1X A;  2UXX A;  4QWQ A;  2VKD A;  3G73 A;  2EZL A;  4MFE A;  3KYD B;  3HOW J;  1R1V A;  3SZG A;  1QU3 A;  2A68 F;  1OCP A;  5L3D A;  2LH9 A;  2HTJ A;  3BR0 A;  3ZN0 A;  4UUT A;  5M3F J;  3KEO A;  1IV6 A;  2RQP A;  3I4M J;  1A36 A;  3ZQ7 A;  3L2W A;  4RB0 A;  1NHA A;  5GP9 A;  4RAY A;  1YS6 A;  5D6E A;  4LB6 B;  1Z05 A;  3EUA A;  3OR1 C;  2FJ1 A;  3PSI A;  1WHU A;  1MDM A;  3W2V A;  1UST A;  3QAH A;  1KGS A;  4BNC A;  4UUS A;  2DMU A;  4R1H A;  4UVC A;  3GW2 A;  1K6Y A;  3G1O A;  3HIF A;  3KZY A;  3K70 C;  4M6Y A;  4A0X A;  2CFO A;  3ZQG A;  2HFH A;  3H35 A;  4XRS A;  2R7T A;  4RGX A;  5D5V B;  3RZD J;  3FMS A;  3HTU A;  1VQN I;  2Y31 A;  3D5L A;  2GA1 A;  4HF1 A;  2R93 J;  4DQ2 A;  1ETX A;  4N9H A;  1V5F A;  3PIO F;  1XCB A;  2XHK A;  1QQI A;  5AIQ A;  4LK1 F;  1W1W E;  3H9Q A;  3OS1 A;  3FXQ A;  1RRJ A;  2WY8 Q;  1HW2 A;  5LHH A;  2R5Z B;  1XX5 A;  4MGR A;  1OCO H;  2E35 A;  3B02 A;  4B8X A;  2CV0 A;  2H8W A;  4FHT A;  3RKW A;  5JHU A;  4IPA A;  5F27 A;  3OWT A;  1FLI A;  3BRO A;  3NRV A;  4XRS G;  4DYC A;  4M9Z A;  2PMH A;  1F1Z A;  2LYC A;  4FIS A;  5JLX A;  1T8I A;  5FKO A;  1IUY A;  4YFN F;  3E1S A;  5F0F A;  2HOE A;  2M34 A;  2DT6 A;  1V3F A;  4A3J J;  3QPH A;  5EZG A;  1KU9 A;  5ILU A;  2ZBK A;  5LLQ A;  2XAU A;  2XAF A;  3RDI A;  2UXN A;  1T38 A;  3KE2 A;  1FX7 A;  1P4W A;  1X4P A;  2CU7 A;  1MJ9 A;  2KIM A;  4M9X A;  2ELJ A;  1ACI A;  3SYT A;  3QOP A;  3K4N A;  5J1U A;  2DMP A;  4N4O B;  3WTV C;  2MAB A;  3PUF A;  3OL4 A;  4BY1 J;  2QEX I;  3WG9 A;  5D5X B;  2IEK A;  1X2M A;  4ASN A;  1FY7 A;  2CMP A;  1HCR A;  4CH7 A;  1UHS A;  2KKO A;  5LGT A;  1D1C A;  3TMO A;  2CRG A;  1ZKG A;  1KZH A;  1DGW Y;  3KP5 A;  2OCE A;  4WXD A;  3OYK A;  3VWB A;  3LOC A;  1QA6 A;  4L5E A;  1BC8 C;  2QSG X;  2Y48 A;  5EG0 B;  2ADU A;  2YPR A;  1YO5 C;  4DGW B;  3OYC A;  1LEA A;  3DLL F;  2Z3Y A;  3ZRG A;  2ESH A;  4LG0 A;  4I09 A;  5CJ9 A;  3GFL A;  1GVJ A;  2E2I J;  2DYS H;  3WE3 A;  2W24 A;  3ZP5 A;  4IO9 F;  4V19 K;  2IS2 A;  1G2H A;  3BTJ A;  2EIJ H;  1R36 A;  1MMN A;  5GAH J;  3BT9 A;  1VQ5 I;  2DU9 A;  4RM2 A;  3BOQ A;  2D2W A;  1YW7 A;  2JN6 A;  2RDP A;  5B66 C;  1ZRF A;  3S32 A;  3FMQ A;  2AXT C;  3FIS A;  5E17 F;  2VOP A;  1OFC X;  1GT0 C;  3FK6 A;  2JWT A;  2HEO A;  1VTN C;  2K9S A;  1XDU A;  3C7J A;  1BA5 A;  2XGX A;  3DEW A;  3QU3 A;  1S7E A;  2CSO A;  1Z7U A;  4AM3 A;  3BCB A;  3CDI A;  5F04 A;  4Z6Y A;  3TO6 A;  5E20 A;  1RKT A;  1R4N B;  2EQR A;  1X1A A;  4F52 A;  4B47 A;  4E7K A;  3DTK A;  2KRF A;  3MN2 A;  4EJV A;  3K2A A;  3HB9 A;  1AWC A;  4LLG F;  1HQC A;  3QYB A;  1KU3 A;  4ESF A;  3GLL A;  1YHQ I;  4OIQ F;  2IS6 A;  4A6E A;  5GTH C;  4WWC A;  4IOC F;  1B6A A;  2MC3 A;  2KIF A;  4MQ9 F;  1S7A A;  2Y75 A;  4OMY A;  1R7J A;  3M1C A;  4XRM A;  2OZ6 A;  3P9I A;  2EZK A;  1JT0 A;  4HNT A;  2AS5 F;  1GVD A;  3WTS C;  5D8L B;  1EF4 A;  3CQZ J;  3ZN1 A;  2VKH A;  3HSE A;  4GO1 A;  2OTJ I;  4UUS B;  5HVQ C;  4PFP A;  1A6Q A;  2F6C A;  5BQT A;  3K69 A;  3CUO A;  2GIV A;  3DPU A;  1WH5 A;  2MW8 A;  2XPV A;  3JAM K;  1HLV A;  4O5V A;  3CMA I;  4PJ0 C;  3JRA A;  2NVU B;  2XC7 A;  4M73 A;  1TWA J;  2HYF A;  3E6D A;  3OIQ A;  2KQR A;  3HRT A;  4BQN A;  4FX4 A;  3Q0U A;  3KLN A;  4LJZ F;  2QQ8 A;  4RGR A;  1OCC H;  4UXN A;  2HYG D;  2KZG A;  1X19 A;  4ZDL A;  3I59 A;  3FXL A;  2CO5 A;  1PP7 U;  4KIS A;  3LA3 A;  4NQW B;  5GAD J;  4S05 A;  2Y9Z A;  2X9D A;  4FCY A;  2GAU A;  3FHN A;  2XIG A;  5IPA A;  2P7V B;  3GF2 A;  2KMU A;  3TP3 A;  2V1X A;  3BG3 A;  1N75 A;  1FP1 D;  1U3E M;  5B1A H;  3JAM Z;  1S29 A;  2KFD A;  1ONV A;  3Q9V A;  1V4R A;  2ZO4 A;  3VOE A;  3SEQ A;  3MEX A;  4AVP A;  2GLO A;  5HLI A;  2Y0S A;  4ENJ A;  2M8G X;  4CCL A;  4DYQ A;  5FKK A;  2ZCW A;  2OUM A;  2GWR A;  4KIT B;  1XGN A;  4I98 B;  1FYK A;  1T39 A;  5IOY A;  1H9T A;  2IGM A;  3CUQ A;  4UNO A;  4LB5 A;  1Y39 A;  1A5J A;  1IRG A;  3H92 A;  4YEJ A;  4II3 A;  2EV6 A;  4HBL A;  2L7M P;  5K7F A;  1UB9 A;  2UZK A;  1OCZ H;  2VXZ A;  3OYH A;  4PGG A;  3OS2 A;  1JKO C;  2TRT A;  3UKG A;  3MKW B;  5DDG A;  2STT A;  4AU7 A;  1YI2 I;  2LF7 A;  3QP5 A;  5A2Q Z;  3PUB A;  1K83 J;  5D6F A;  2XF6 A;  2HS5 A;  3JRC A;  3P7N A;  2Y0M A;  2FEZ A;  4I99 C;  2VAS A;  4M3B A;  3F8F A;  1WZ2 A;  3FM5 A;  2DOA A;  2QVO A;  5KNL A;  2H8R A;  2QUF A;  2EFN A;  4G94 A;  3X2Q H;  4OAZ A;  4Y33 A;  4LG0 B;  4L9V A;  1HXD A;  5D4S A;  4D1Q A;  2JRT A;  5ICC A;  1K4S A;  4RB2 C;  4XRF A;  3AL0 C;  3GTL J;  5EF6 A;  2FQ3 A;  1E2X A;  4KMF A;  5F08 A;  3DP7 A;  4ZC3 A;  3G1L A;  2DCE A;  5EDN A;  2CS3 A;  3HEF A;  3M07 A;  3QPL A;  2OQG A;  3CCM I;  2P0W A;  2XKO A;  3F3X A;  1O3T A;  1JT6 A;  1UG2 A;  1YYV A;  2YS9 A;  2F5V A;  3QOD A;  3I3L A;  4JX4 A;  1ZAO A;  3QYF A;  2MG4 A;  5M3M J;  3F22 A;  2ME0 A;  3SEZ A;  1TTY A;  4DOZ A;  4BDZ A;  1FZP B;  5J6X A;  4ZTF A;  2RAE A;  2WV1 A;  3GME A;  4KT5 C;  3VYS B;  3ZQQ A;  3JRG A;  4HV6 A;  1GUU A;  4ZZD A;  4OWR B;  5LEJ A;  3BG7 A;  1MNE A;  2HOS A;  1WGX A;  5JR3 A;  3RIR A;  4B3X A;  2VON A;  1TWG J;  3LSM A;  2XAS A;  4RLQ A;  5M5X J;  3GZ5 A;  5LRR A;  1GHC A;  1B8I A;  4BAY A;  4LD5 A;  3CMY A;  2XSD C;  2NRA C;  3V7R A;  2DA6 A;  1OKR A;  1RPW A;  2F5E A;  2XPW A;  1VF9 A;  1E3P A;  4LIT A;  3U21 A;  1ZR2 A;  3H3Z A;  1XGO A;  3CCV I;  1HKS A;  3GYH X;  4A3B J;  2DFH A;  2HQ5 A;  2L02 A;  4GXO A;  2E1M B;  2HQN A;  1XGS A;  3CME I;  4BXX J;  3G6E I;  4EJU A;  3TGN A;  4HDV A;  2EV0 A;  4HQM A;  2ZJQ F;  3GTM J;  4DBR A;  2EZI A;  4BDY A;  4FTH A;  2ICW G;  2P4W A;  2QQA A;  4I7H A;  4BGD A;  4XKC A;  3OYJ A;  3LST A;  4HST A;  2V7F A;  3KX2 A;  4M3F A;  2MLG A;  2VOO A;  4P9F A;  3BG6 A;  2M30 A;  3WGG A;  2XB5 A;  1WJB A;  1I5Z A;  5FLV A;  2LP0 A;  1LE8 A;  4S0H B;  2ELK A;  3IH3 A;  2YSR A;  5K7Z A;  2QSF X;  2JSC A;  4I02 A;  5H6R A;  4ENN A;  3L2V A;  3GZ6 A;  1MIJ A;  4KMU X;  5EGO A;  3QYE A;  4G6D A;  4A3M J;  2A5W A;  4A3C J;  5ED4 A;  3ZQC A;  1G3T A;  4L5J A;  3H36 A;  2IGN A;  1U5T C;  4GDF A;  1MBE A;  1BIB A;  1B72 B;  1EH7 A;  1UZC A;  4ESB A;  4I01 A;  1HW1 A;  2CGP A;  2X6O A;  1LVA A;  1IXR C;  1EH8 A;  2LRD A;  1W7P A;  4MFD A;  4RBO A;  1W0T A;  1MNM C;  3A4C A;  3TL4 X;  4MQV A;  2DAO A;  3GBG A;  2NVX J;  4L9J A;  3TDZ C;  4YIR X;  1KQ0 A;  1W5S A;  2K7L A;  3CC2 I;  2KPM A;  3CCL I;  3LSK A;  2R0Q C;  3T8R A;  3E97 A;  3OYG A;  2DMT A;  2FE3 A;  2EPF A;  2BV6 A;  3C1D A;  2P7C B;  1D8J A;  1ZEL A;  3PSF A;  4ABZ A;  3H5A A;  3HOY J;  1I27 A;  4NBQ A;  3PQJ A;  5CVI A;  1UMQ A;  4HLX A;  1R1U A;  3FXK A;  1K78 A;  3ESW B;  1D1B A;  2JVH A;  2ETH A;  2MFZ A;  2XRN A;  3FX3 A;  1T0F C;  1WJC A;  1Z21 A;  2TCT A;  1LDJ A;  4QPO A;  4YFK F;  2W57 A;  3RCO A;  1KQ8 A;  1WRJ A;  5CVR A;  2M3A A;  3KP2 A;  3AFH A;  5FFZ A;  4CYC B;  5BPD A;  2A69 F;  3LQR A;  4ENM A;  2OU2 A;  4XL9 A;  3RSN A;  3H9J A;  2C6Y A;  4BQO A;  5DV5 A;  3BR6 A;  2ZJ2 A;  3REO A;  2A5Y B;  2PBI A;  4AD9 A;  2O9L A;  4IHS A;  5B3S H;  1MJB A;  3HKZ A;  4DJA A;  1RR8 C;  1XG1 A;  2WAQ A;  1DP7 P;  2Q8K A;  1TC3 C;  4GYG A;  3S1Q J;  3VYU B;  3M9A A;  2LG4 A;  2EFQ A;  3KYL A;  3M4O J;  4X6A J;  4M3G A;  1V5G A;  2X1D A;  4B09 A;  1D5Y A;  1YG2 A;  2QKL B;  2R5Y B;  1HST A;  1T56 A;  1Z3X A;  2XF7 A;  1FPQ A;  1GLN A;  3ZMD A;  1TQP A;  2O8X A;  2WB1 A;  3P9C A;  3CMM A;  2RQQ A;  4AWX B;  5GPC A;  1BI0 A;  2GXG A;  4LOC A;  4ZH4 F;  2CV1 A;  4BBS J;  4FE4 A;  2K4B A;  2XAG A;  1JI8 A;  1Z1D A;  3H9G A;  3L09 A;  1KON A;  2VN2 A;  2YR2 A;  2CG4 A;  3N4M A;  2GZW A;  4EJW A;  3CC7 I;  1F43 A;  2NS7 A;  2JVG A;  3K4B A;  3V4G A;  4DBQ A;  5DD4 A;  4QSH A;  2DA5 A;  2W84 A;  2E19 A;  5IYC J;  3C2H A;  3JSO A;  1N78 A;  2XGC A;  2O61 A;  1J9I A;  1O3S A;  3E3V A;  2FUG 2;  4QTR A;  3IWF A;  4E70 A;  3OYI A;  4PJJ A;  1PUF A;  3LSG A;  3MMY B;  3SJM A;  1HA8 A;  5FRN A;  1GXP A;  3UR3 C;  3RYR A;  2E2H J;  2CV2 A;  2FA5 A;  2E60 A;  3M3Y J;  5LFA A;  2PJR A;  3GTK J;  2MA3 A;  4P1W A;  3J81 K;  1H0M A;  3KLO A;  3HRU A;  2W7N A;  2B7E A;  4DYR A;  3H5R A;  1EV7 A;  3FKJ A;  3C18 A;  5CVU A;  1S5L C;  3EQL F;  3MCZ A;  3B73 A;  4XOR A;  4A69 C;  3SZP A;  2EFO A;  5DCF A;  3BZK A;  1U5T A;  3ULQ B;  4LGW A;  2I10 A;  2L9S A;  1K4T A;  3J7A Y;  4JX5 A;  3EET A;  4MTE A;  3I53 A;  3GLX A;  5HOD A;  3S14 J;  1UJ8 A;  2CUE A;  4KT6 A;  1E17 A;  3BPX A;  2XGE A;  5CVJ A;  5C4X J;  1KYW A;  2CJJ A;  4AID A;  1IDY A;  5FJ8 J;  3DTI A;  1X1C A;  4CCM A;  1FOW A;  4M9S A;  5EGO B;  2ID6 A;  3JRB A;  4RMN A;  3CCR I;  3ZXS A;  4PDK A;  3KP3 A;  4LG3 A;  4A3G J;  4HZF A;  4UVB A;  1U78 A;  3FF5 A;  4AVZ A;  3GTG J;  1BW5 A;  2W85 A;  4XLC A;  3G4S I;  2P5V A;  1XSV A;  1FSE A;  3OY9 A;  1H8A C;  3TO9 A;  1UHW A;  3NEU A;  4RA2 A;  4Y15 A;  3IH2 A;  4HNV A;  3BWG A;  4U0W A;  4II2 A;  3DPL C;  1EJ9 A;  1ON1 A;  2LFB A;  1TP4 A;  4XBF A;  4NHJ A;  1A31 A;  2M1B A;  2EA2 A;  1ULY A;  2EBI A;  4EMS A;  2V9K A;  2HVR A;  3LL7 A;  2VE8 A;  1MD0 A;  3H3U A;  5FGM A;  1FBU A;  4ZYA A;  2FSW A;  5K7H A;  2YX4 A;  4AUX A;  3MZH A;  4OOI A;  3F21 A;  3DEE A;  4A3L J;  3BP8 A;  4EM0 B;  1JKP C;  4XOP A;  5J4V A;  1VQM I;  2OF7 A;  3L2R A;  3S1R J;  2I5U A;  2NVY J;  3K1N A;  4XQF A;  5K5R A;  1FWZ A;  3K4J A;  4BE0 A;  2KLO A;  4RM3 A;  2A05 A;  4IHY A;  1P2F A;  3ONQ A;  3OOU A;  4J01 A;  4JK1 X;  2DFF A;  3PJR A;  1XMX A;  1SVL A;  4PSX A;  3U1K A;  3CD6 I;  5LGN A;  3DKX A;  1B9M A;  4A3D J;  4ZDO A;  4EAT A;  1G59 A;  2R7R A;  3S3M A;  1YIJ I;  1Y8R B;  3ROU A;  4HRI A;  4A93 J;  3RZO J;  2MSY A;  1X2N A;  3DCF A;  5LD2 C;  1ENH A;  1X1D A;  3Q0V A;  4CDG A;  3K4C A;  2DXI A;  2E5N A;  4D7N A;  6PAX A;  1ETO A;  2JUG A;  5IYD J;  1U8R A;  1V5E A;  3FHZ A;  2VJ4 A;  1BI2 A;  2DTZ A;  5CQG A;  3JSP A;  2WAE A;  4LLN A;  4JQF A;  4C2M J;  5IP7 J;  3W6K B;  2H27 A;  3BCA A;  4KIB A;  4M72 A;  3TQN A;  3J80 K;  5BOX A;  3A01 A;  5FLM J;  1ITY A;  3BR1 A;  1ZHF A;  1I1S A;  1P4A A;  4U88 A;  3ASO H;  1H88 C;  1WSU A;  3S17 J;  4QPQ A;  2M87 A;  3HOU J;  2DO7 A;  3CF5 F;  2ZJP F;  3SFI A;  3LA2 A;  2NXN B;  1FSH A;  2GQQ A;  3D5R C;  3OYE A;  2M0M A;  5DD8 A;  3TOB A;  1ERD A;  2DK8 A;  1J2X A;  1R49 A;  4CZC A;  2FNP A;  2PN6 A;  3T1B A;  2F5C A;  3I0T A;  2L0K A;  4C3H J;  3KIO A;  1D1A A;  3I71 A;  2OQR A;  2RGV A;  1NTC A;  5IOZ A;  3U2R A;  2EFW A;  4OIO F;  4IXA A;  5L3G A;  2IJL A;  1ZRC A;  3GFI A;  3ZQH A;  2QCO A;  3QPS A;  4M74 A;  5FKM A;  3N97 A;  1MBG A;  1Y1V J;  3J80 Z;  1PUF B;  1ETV A;  2EFP A;  4RGS A;  2MD0 A;  2ZME A;  2FNA A;  3CCU I;  1HDD C;  1M1E B;  5AON A;  2JK3 A;  4CA0 A;  1I3A A;  4RAG A;  4DZP A;  1SFX A;  3T0Y A;  3LSR A;  2E1O A;  1Z9C A;  2CUZ A;  3TW7 A;  3HBL A;  5J8F A;  1X1P A;  3ZMT A;  2FRH A;  4M6V A;  1DQU A;  2IW5 A;  5ILS A;  4A0Y A;  3CCE I;  3LFK A;  1KA8 A;  5HDN A;  1FOY A;  2EIM H;  4OIN F;  4L5I A;  1JUP A;  1QNT A;  5J8C A;  3KP6 A;  4ZYH A;  2OAZ A;  3JRI A;  2EWN A;  1XSX A;  1CQT A;  2FX0 A;  3I5U A;  1USS A;  3LWF A;  2J5O A;  2ISZ A;  1AHD P;  2EH3 A;  1TQI A;  3L7W A;  4PUS A;  3H1C A;  1SVM A;  3W6J B;  1XSD A;  1ZG3 A;  1J09 A;  2MC4 A;  4PCQ A;  2OCC H;  2STW A;  9ANT A;  1TNT A;  1C0W A;  1MJA A;  3VPR A;  3N05 A;  2PMZ N;  2CUF A;  4KIG A;  5LHG A;  1S3J A;  3F8M A;  2G0E A;  1YOV B;  2HI3 A;  2IA2 A;  2ZKZ A;  4LMY A;  2AXL A;  3SZT A;  3DU5 A;  1JHH A;  2D1H A;  3HPH A;  3CO6 C;  2GXA A;  4RAF A;  4EM2 A;  4UUV A;  4A3F J;  3HOZ J;  2KHM A;  3PIP F;  1FNN A;  3KEY A;  4A12 A;  4OAY A;  1JE8 A;  3IC7 A;  1QHH D;  2M0C A;  1AKH B;  5EEA A;  1XCV A;  3W2A A;  4BUP A;  3I9V 2;  1A35 A;  5HS9 A;  2KP6 A;  3HJE A;  2R7X A;  1YRN A;  4C2T A;  2HOA A;  4XKB A;  3O8H A;  4HV5 A;  2OBP A;  1SEU A;  1LQ1 A;  3MD2 A;  4FT8 A;  4XM3 A;  4Q48 A;  2WTE A;  3E5X A;  3GTP J;  1FBQ A;  3I64 A;  2Z2S B;  1T6S A;  4KFC A;  2O0Y A;  5J47 A;  2M4K A;  4IRH A;  2VKV A;  3S8P A;  5F1R A;  2GOM A;  3PNY A;  3A02 A;  1IN4 A;  1HW5 A;  2K85 A;  2NS8 A;  4KN4 X;  2NOJ B;  5CYV A;  4HF2 A;  4Y17 A;  1S72 I;  2OA4 A;  2H6C A;  2G9W A;  3MZ8 A;  1MDM B;  2ECC A;  1SMT A;  2LVS A;  2F4I A;  1VQ9 I;  1JGS A;  1T08 B;  1EH6 A;  2P5L C;  1SAX A;  4IHX A;  2VBY A;  5M5Y J;  1K61 A;  3SDG A;  2OTL I;  1JKR C;  3OIP A;  4D5F A;  4YEL A;  5FFX A;  4G8X A;  1SC7 A;  2BW3 A;  1BI3 A;  4I0A A;  3DBH B;  2BGC A;  4ZYE A;  3HOT A;  1IF1 A;  1DP3 A;  1RIO H;  4Y3O A;  1E0E A;  1FIA A;  3E6C C;  2K02 A;  4PSW A;  4L18 B;  2VQL A;  3IRR A;  4LIU A;  3BTI A;  1W4M A;  1W36 C;  3S1N J;  2IBD A;  4B44 A;  1U6G A;  4E7Z A;  4BAC A;  2ACJ A;  2ESN A;  3HHG A;  3TBI A;  1MSE C;  1ETY A;  2DDB A;  4E7H A;  4UB8 C;  3PM1 A;  2RN7 A;  5C4J J;  2H09 A;  3TKY A;  1I6X A;  1RET A;  1Z77 A;  3ZOB A;  2JA7 J;  1IN8 A;  5LGU A;  5FO5 A;  3WTU C;  1R5G A;  2WWY A;  2E7W A;  4CHU A;  4XR6 A;  2NS0 A;  3IKV A;  3DV8 A;  1FYL A;  2IA0 A;  2ISY A;  5J4Y A;  3ABU A;  3V8K A;  2L54 A;  5HNF A;  5A2Q K;  4XKV A;  4Z2Y A;  3I4N J;  3F9K A;  3HSF A;  4EVI A;  2EIL H;  2WC2 A;  2EK5 A;  2XVC A;  5CQE A;  4C3I J;  3ZMU A;  4DNC A;  2QGU A;  1ZG5 A;  2FBI A;  2WV0 A;  5J40 A;  4HPQ A;  2HWV A;  3FXU A;  3G2B A;  3CO7 C;  3FWE A;  1ORK A;  2HQR A;  3CCQ I;  1OIS A;  1TWH J;  3BDD A;  3W3C A;  4U7B A;  1ETW A;  2LC2 A;  2RNG A;  3CDH A;  2V1D A;  4CCN A;  3A1Y A;  1FEX A;  1TLH B;  2G7H A;  2VI6 A;  3PL8 A;  1ZK8 A;  1HF0 A;  1Q1V A;  1QZZ A;  5HDG A;  5D5U B;  1B9N A;  3OSG A;  2DK5 A;  2BVL A;  5GAE J;  3MKY B;  4ZJZ A;  4P55 A;  3P9K A;  3H3V K;  2DT7 B;  3CTA A;  1JKQ C;  5L3C A;  2FQ4 A;  2CYY A;  4RAZ A;  5K5Q A;  1IN5 A;  1B4A A;  2W82 A;  2YU9 J;  1F9N A;  2A3S A;  1VQO I;  3OR2 C;  2LD5 A;  2HU9 A;  1MND A;  4ETS A;  1QHG A;  3HC7 A;  1FMW A;  1R00 A;  2L01 A;  2IRF G;  2VJJ A;  2R7D A;  1LJ9 A;  5GTI C;  4X0G A;  1APL C;  4D0P A;  1T33 A;  1MKM A;  3CF2 A;  4L0Z B;  2KT0 A;  3H5N A;  4EEF G;  4J00 A;  1J75 A;  1FMV A;  2IPQ X;  2O5R A;  3L2Q A;  2DPD A;  1GV2 A;  5JFR A;  1T95 A;  1VQP I;  3WTX C;  3IAS 2;  2LNB A;  2VQH A;  4BHB A;  2VIX A;  3V7S A;  2P5K A;  2HPM A;  4X1E A;  3HOV J;  2W1O A;  1UEL B;  2BY3 A;  2XAQ A;  2QBY A;  2KRH A;  1OYW A;  4Q47 A;  2XF5 A;  5EJC A;  5GAG J;  2A6H F;  1P92 A;  2CQK A;  5LBQ A;  1IUF A;  4HDU A;  1FOX A;  1RR7 A;  5D5W B;  2FF4 A;  3EYI A;  3C3W A;  4BU2 A;  2DI3 A;  3NQO A;  3Q3S A;  1MZB A;  1JUM A;  2JQ7 A;  5FKL A;  4JYK A;  3NWT A;  3Q0W A;  1LKX A;  2YX7 A;  5ICF A;  1O3Q A;  4PK4 A;  3LAP A;  1YS7 A;  3MVP A;  4A0Z A;  2F5D A;  1LPQ A;  3K6G A;  1W36 D;  4I0B A;  4XN3 A;  2V26 A;  1BM9 A;  2BY2 A;  4V2G A;  1WJA A;  5DM6 F;  1QRY A;  3BLY A;  4HF0 A;  2H94 A;  2PX9 A;  1DPU A;  3O6B B;  1E3H A;  3HOS A;  3GTQ J;  5ERI A;  3KP7 A;  3M7G A;  1BN5 A;  2XB0 X;  1NG7 A;  3DKY A;  3J7Z I;  3AAF A;  4E7J A;  3JCU C;  3VFZ A;  1YW9 A;  2COM A;  4XLN F;  4OIR F;  2VKE A;  3BTC A;  3M1E A;  3T8T A;  1F36 A;  3OMY A;  1DUX C;  3BQY A;  1G6N A;  2RKH A;  2X6W A;  3CC4 I;  2BVM A;  4BEH A;  2HKX A;  3HYI A;  1UAA A;  3CCY A;  2B9S A;  1KU2 A;  4KIF A;  2EIN H;  4LIV A;  2TDX A;  5FD6 A;  2PEX A;  3RQ4 A;  3V8J A;  4NC7 A;  4MNU A;  2OPT A;  2YU3 A;  2CFX A;  2L5Q A;  4CO8 A;  2QQ9 A;  5K1Y A;  5IP9 J;  2FOK A;  5HS7 A;  4CCJ A;  4G9Y A;  1Y6I A;  1ZAR A;  4JOM A;  2WY7 Q;  2LY9 A;  2MH9 A;  4O3M A;  1HKQ A;  2R7W A;  4WF2 A;  1GXQ A;  2E34 A;  2P6S A;  3I59 B;  4N9I A;  2ZXJ A;  1K6O A;  3I55 I;  3OOP A;  2FMY A;  2PQ8 A;  2DBB A;  3HGG A;  4Y7N J;  5HDK A;  1RES A;  1XB4 A;  4CGZ A;  3FDY A;  3ZMZ A;  1IXS B;  1R4M B;  3BR5 A;  1XN7 A;  4XLE A;  1XMA A;  3TP0 A;  1AU7 A;  1YJ9 I;  5IYB J;  2LKX A;  3RPU D;  2X1C A;  1D0Z A;  2LKP A;  4IKF A;  3I56 I;  1CGP A;  2LSO A;  2FXA A;  1BR4 A;  2CQX A;  1IRX A;  1R23 A;  2EA4 A;  4EQQ A;  2DW4 A;  4QIW N;  3CUQ B;  3MFK A;  1VQ8 I;  1MW7 A;  1TWC J;  1OMI A;  3JRE A;  1LB2 A;  5E3L A;  1LFP A;  3LSJ A;  3EUH C;  4YII A;  4A5N A;  4BH9 A;  1SAU A;  3C2G A;  4LFU A;  1NK2 P;  3OSF A;  3EDP A;  4CUG A;  2HXO A;  3BC8 A;  4UY8 I;  1XDS A;  2DYR H;  2D1V A;  4MIM A;  1OJL A;  1TT5 B;  3ECH A;  4BY7 J;  2D45 A;  3QQA A;  3AG4 H;  1Z3Y A;  1BOB A;  2Z9O A;  2E36 A;  2FBK A;  1N25 A;  2ZXW H;  2LKS A;  3E5Q A;  1E3O C;  3FMR A;  5FRO A;  4P96 A;  5IT3 A;  1LDK B;  3ERE D;  3SHF A;  1XS9 A;  3CDL A;  2O8K A;  2PJP A;  4ESJ A;  4AIH A;  4CCK A;  5JVG F;  1BIA A;  4XNF A;  4BQQ A;  2K9M A;  3S16 J;  1VQ4 I;  1GV5 A;  4N4N B;  1RUN A;  1LFB A;  2QF7 A;  3WU2 C;  4BXF A;  4FX0 A;  5ILV A;  3S3N A;  2VPR A;  1YIO A;  2ZB9 A;  3ZGK A;  3GUD A;  2JTV A;  5TIS C;  3H0D A;  4Y4R A;  5ICG A;  2HTS A;  1PDN C;  1POG A;  1ZGJ A;  1KQ9 A;  2XKP A;  4BYY A;  3QWL A;  1S9H A;  3PO2 J;  4E7S A;  1ZLK A;  4PJM A;  1I1G A;  3H0G J;  2QBY B;  4D5C A;  5FRM A;  4F3Q A;  2BEO A;  2E71 A;  3BTL A;  3R4K A;  1O7F A;  3O8G A;  2QYO A;  5J3L A;  4W1U A;  1FTZ A;  3BR2 A;  3KZZ A;  4FAS D;  2ZXH A;  3JRF A;  5L3E A;  2HOT A;  2VQG A;  3SXY A;  1MH3 A;  1YTY A;  3CP2 A;  2IS4 A;  1B8I B;  5KHD A;  2ZSI B;  3F23 A;  4AIJ A;  5DUI A;  2HZT A;  3B6A A;  3F8N A;  2K86 A;  1OPC A;  1SMY F;  4B3A A;  1I39 A;  1SFU A;  2R7Q A;  3L2C A;  5KAF C;  4PZJ A;  2L3D A;  5FLX Z;  1WI3 A;  3VSL A;  1MMS A;  4G6T B;  3GVA A;  4Y13 A;  2ECB A;  1ZRE A;  2FD5 A;  2K9N A;  2L9R A;  1FOK A;  5FKN A;  1R22 A;  2LK2 A;  2IT0 A;  2X1E A;  4EJT A;  4J19 A;  1U2W A;  5E1Z B;  4A3K J;  4CZZ A;  2A6T A;  1VFC A;  5CLS A;  1R6R A;  2JMW A;  2NNN A;  2FML A;  1PYV A;  4XON A;  4WCG A;  3VDX A;  2K27 A;  2MH2 A;  3ML6 A;  4HW0 A;  4XLF A;  2V9P A;  5H20 A;  1IJW C;  4C2U A;  2G7U A;  3BZC A;  3I4P A;  5B1B H;  3DLA A;  5EEH A;  4BS9 A;  2DLL A;  4QLC U;  5K5O A;  1MH4 A;  5L3F A;  4YFX F;  5E3O A;  4C30 A;  1QBJ A;  1P7J A;  2M4G A;  3V42 A;  1LE8 B;  2Q2E A;  2P6T A;  1Z7L A;  1ZGA A;  2BOL A;  4G12 A;  3WOD F;  3O3K A;  3D1N I;  4A3I J;  2E2J J;  2GA2 A;  1P9Q C;  1BI1 A;  3CZ6 A;  4CSW A;  1T98 A;  2CW7 A;  2KJB A;  1SFE A;  3CCS I;  2OV7 A;  3PFI A;  3VYR B;  4IEJ A;  1LUJ B;  2F4M B;  4BHC A;  4XOT A;  5F0C A;  4BL0 B;  4GYI A;  5EG0 A;  4JX6 A;  3HL2 A;  3MKZ A;  3ABM H;  3ASN H;  3BJA A;  4IQJ A;  3OYB A;  4FQG A;  4G7Z F;  1DU0 A;  5TRD A;  1ZRD A;  2BHZ A;  5FD5 A;  2W00 A;  1QVT A;  3RJP A;  1W7P B;  3WTZ A;  3CCJ I;  3ZQL A;  2HDD A;  1T0F A;  4XMY A;  2QWW A;  1TT0 A;  2BBY A;  2EB7 A;  4R79 A;  3HHH A;  3MWM A;  1RC9 A;  3BQZ A;  4F92 B;  4P9U A;  4ZYG A;  2K3P A;  1TZL A;  4ITV A;  5E8I A;  1HSJ A;  2A6E F;  5HNH A;  3AL0 B;  1BR1 A;  5DYM A;  1PP8 F;  5M5W J;  4G7H F;  3G71 I;  1KYZ A;  4EJO A;  3WG7 H;  1WWX A;  3OYF A;  2DN0 A;  2DQL A;  3EYY A;  4ZDP A;  2V1U A;  4IRG A;  5KCM A;  1FP2 A;  3OL3 A;  2KRC A;  3ELK A;  2LY2 A;  3S3O A;  4FE7 A;  2MBF A;  1K78 B;  1OR7 C;  4MEY F;  4MO7 A;  1NK3 P;  2DOE A;  2X6X A;  5JI6 A;  1X3Z B;  4RGU A;  1S8N A;  3W2W A;  2ELH A;  5D8K B;  2DT5 A;  5BNG A;  1Y56 A;  1Y0U A;  4HLY A;  1R9T J;  3COA C;  2XDV A;  3FBI B;  1D0X A;  1LDD A;  1SD6 A;  3BPV A;  5E18 F;  2E1N A;  1R5I D;  2RRE A;  1EA3 A;  1WI9 A;  2LTP A;  3G3Z A;  2AHQ A;  2MYS A;  3NWS A;  2K5C A;  3KFW X;  3M8E A;  5HLH A;  3GX4 X;  2F2E A;  4WX9 A;  3E6B A;  1AOY A;  2JSP A;  3B6C A;  4JP0 A;  4M71 A;  2X48 A;  4AYB N;  4EGY A;  4GFB A;  2BE5 F;  4NC6 A;  3O2P E;  2RV8 A;  3KET A;  1IRZ A;  1YX3 A;  2VPL A;  4M6X A;  3IAM 2;  1FTT A;  3CJN A;  1O3R A;  2XRL A;  3BG9 A;  1VQK I;  1T2K A;  3EPZ A;  3HOX J;  2VT2 A;  4U0Y A;  2VL8 A;  2PFB A;  4B43 A;  1WFX A;  1UFM A;  3F6O A;  2OC6 A;  5TJJ A;  3ZQF A;  4A5M A;  5HLT A;  3CLO A;  5DCM A;  4HAM A;  2NVT J;  3SFZ A;  2E1M C;  3DWL E;  3HG9 A;  3JRH A;  1BL0 A;  1WPK A;  1Y1W J;  3HXL A;  1B59 A;  2KJC A;  2HDC A;  2PMZ A;  3BR3 A;  2R92 J;  4IQ4 A;  4MTD A;  3DU6 A;  2CQ7 A;  3A0H C;  3NAR A;  1D0Y A;  1SAN A;  2CWE A;  3ABL H;  2JPC A;  3AG3 H;  4NQW A;  2L2O A;  1VQ7 I;  4DZJ A;  3GTO J;  4D7M A;  2DJI A;  3EUK L;  2W25 A;  1IW7 F;  3GZN B;  4W97 A;  5AIP A;  1WQ2 A;  1OCT C;  3QOE A;  3OV8 A;  1FT9 A;  4PFO A;  4Y52 J;  1FBS A;  3HM5 A;  4EGZ A;  4BHP A;  2VBX A;  3AKZ A;  2PJR B;  1TWF J;  1ETQ A;  2WAD A;  3FIW A;  4S04 A;  1S6L A;  1JJ6 C;  3RI4 A;  3S1M J;  2QKM B;  2V9V A;  4Q4Z F;  2V4J C;  4RLF A;  1XGM A;  2F4O B;  4BE1 A;  1OQY A;  2O6G E;  3FZV A;  3JW4 A;  5KAI C;  3DTE A;  1ZH5 A;  2M8E A;  4PJN A;  5DTD A;  1J59 A;  1U9N A;  1RNL A;  3S2W A;  1PUE E;  3IP4 B;  4NDL A;  3FXM A;  1U5T B;  1IZ1 A;  1IRF A;  4IF4 A;  3Q5F A;  4LLL A;  1S7O A;  3E5U A;  4NC8 A;  2R7U A;  1MMG A;  2KIS A;  2PI0 A;  2NAZ A;  2Q2E B;  2MGQ A;  2BHY A;  3FXO A;  2YUS A;  3WU1 B;  2VE9 A;  3K0L A;  2DTR A;  2QSH X;  2V1N A;  1NH3 A;  1H9G A;  1VZ0 A;  4HQE A;  2VUM J;  1P6R A;  2A07 F;  1RZ4 A;  5DS9 A;  5LRS A;  3MQ0 A;  5BS6 A;  4CXF A;  3OYD A;  1W5C C;  1JUS A;  2R4G A;  3OYL A;  2LBF A;  2HQA A;  3CUQ C;  1NG6 A;  2JA8 J;  1VI0 A;  3R0A A;  5DEQ A;  1UG0 A;  1O4X A;  1Z6R A;  3D0S A;  5LEK A;  2K3F A;  2A61 A;  2Z1D A;  1VQL I;  1ZR4 A;  2GXB A;  1OR7 A;  1DDN A;  3TDU C;  5IY5 H;  2I8D A;  5EYR A;  2BY0 A;  1Z91 A;  4ANJ A;  3TED A;  3W6V A;  2K9Q A;  2DFI A;  3LFU A;  3K2Z A;  1JGG A;  3JTH A;  2DJN A;  3RYP A;  3JTG A;  1JHF A;  1PVE A;  4MLO A;  2ZJR F;  3ZMS A;  5JVT A;  2EV5 A;  3FXR A;  1H89 C;  5BMZ A;  1VQ6 I;  2M2E A;  3J7Y J;  2NNY A;  2OD5 A;  1X3W B;  3MZY A;  4XN0 A;  4JBA A;  3K70 D;  3CP8 A;  3E0J B;  1I3Q J;  4GGG A;  2HNH A;  3SDB A;  3CJT B;  3A0B C;  2DDA A;  4KNY A;  3C2B A;  3TO7 A;  1OYI A;  1HDP A;  1SVO A;  1OYY A;  2B0L A;  2KIU A;  2NOG A;  3AG1 H;  5D4R A;  3S93 A;  1R58 A;  2L7Z A;  4HYE A;  2XAH A;  4D9J A;  1YFH A;  2M5W A;  1Z67 A;  1U9O A;  2RNJ A;  4RDU A;  4UVA A;  3PQK A;  3OYN A;  3KEQ A;  4KN7 X;  2XAJ A;  2L9N A;  1N77 A;  2V79 A;  1WCM J;  1IV8 A;  1B1B A;  4UB6 C;  2JA5 J;  4C3J J;  3I54 A;  1ZQ3 P;  2Z33 A;  1MBJ A;  2M9H A;  1K79 A;  4IZZ A;  1TW2 A;  2L9V A;  5JLW A;  1AA7 A;  1D8K A;  3QPT A;  1L0O C;  1SD7 A;  2Y2Z A;  4A6D A;  3A01 B;  3D5S C;  5E3M A;  2H6B A;  3RQI A;  2JZY A;  4PGH A;  4CYD A;  1IXC A;  3S15 J;  3Q9S A;  3WU0 A;  3K10 A;  5F0H A;  3HPG A;  2K9L A;  2XV4 S;  4YIF A;  3LSI A;  1YJN I;  1F5T A;  3PNT A;  4DW6 A;  1MMD A;  2X4H A;  1SD5 A;  5DCM B;  1UCR A;  2HGC A;  2PG4 A;  2JRM A;  3DKW A;  5C3E J;  1X58 A;  2PLY A;  1QPI A;  2XUB A;  1XC5 A;  2J5P A;  3GWZ A;  5KK1 A;  1KU7 A;  3HUG A;  2VC1 A;  4HG2 A;  3VOD A;  2FOW A;  2H1L A;  1W5T A;  1F4K A;  2QQB A;  3ECO A;  4NNJ A;  4IHW A;  2ZME B;  3MKL A;  4DIQ A;  4L9T A;  1FC3 A;  3RKY A;  2DOD A;  1V54 H;  4KIC A;  4OU0 A;  4K2E A;  2KDO A;  3I58 A;  4Q5S F;  5CKT A;  2HKO A;  2RVC A;  1B72 A;  1G3Y A;  2BY1 A;  4WK8 F;  3GFJ A;  4WXC A;  2ZNY A;  2F48 A;  1G3S A;  3AG2 H;  2LR8 A;  2FU4 A;  4M3E A;  3FBN B;  3M8F A;  1REP C;  4P5O A;  3GTJ J;  4NB5 A;  5IT9 K;  4EV0 A;  5LHI A;  5F6F A;  3FK7 A;  2UV1 A;  2ME6 A;  3RTR A;  1IN7 A;  4M3D A;  2WAF A;  3K7A J;  3LMM A;  2DA4 A;  1JXS A;  2XGD A;  3GXO A;  2LDU A;  4IJA A;  2DMQ A;  3ZR8 X;  3DXJ F;  2WA0 A;  2PMU A;  2R7S A;  3IWZ A;  2ZFW A;  1ZN2 A;  1XTA A;  2B63 J;  4HX7 A;  3R61 A;  1MGT A;  4I6Z A;  3U9G A;  2CH0 A;  3HGY A;  3JRD A;  1TQM A;  5ICE A;  2AO9 A;  2LBF B;  4G6Q A;  4XLH A;  3IKT A;  2H1K A;  4ENK A;  2HXI A;  4XSX F;  2QM3 A;  1BBY A;  4BBR J;  3PFY A;  5CVV A;  3SQN A;  4FET A;  4KA4 A;  3RKQ A;  3BY6 A;  4MEX F;  5IT9 Z;  2E7X A;  2R7V A;  2BXY A;  4CYC A;  2ZC2 A;  5GPA A;  5TGT A;  5L3B A;  2W4S A;  3HZJ A;  2M7B A;  2JJ7 A;  1BOA A;  2VBW A;  3GEZ A;  4F93 B;  3L00 A;  1IGN A;  4IL6 C;  1J0R A;  2N8G A;  1YX5 A;  2MD5 A;  1YRN B;  2EZH A;  2Y0S N;  2V6E A;  3HRS A;  4CCO A;  4IRI A;  2LRE A;  4UV9 A;  3DEU A;  5BPI A;  2Y9Y A;  2M7A A;  3CLQ A;  2IVM A;  1BC7 C;  2R5Y A;  1QZE A;  3U1D A;  5E8G A;  4ON0 A;  2JA2 A;  4E4H A;  1RUO A;  5C44 J;  2NYX A;  1V55 H;  4BJ5 C;  3WTY C;  1WH7 A;  5E1W A;  1JJ8 C;  3RPQ A;  3VSK A;  1MBH A;  3K4M A;  2L7K A;  1QVU A;  5DM7 F;  2GM4 A;  3R60 A; 
#chains in the Genus database with same CATH homology
 2EZK A;  1JT0 A;  2HOT A;  2DTZ A;  1GVD A;  1MH3 A;  1EF4 A;  3CQZ J;  1MBK A;  5IP7 J;  2HYJ A;  4C2M J;  1B8I B;  3A03 A;  2KDZ A;  2XPU A;  3NAU A;  4UUS B;  3B6A A;  3WHC A;  3A01 A;  5FLM J;  1ITY A;  3BR1 A;  3IH4 A;  4B3A A;  1FJL A;  1H88 C;  3S17 J;  2DA7 A;  1WH5 A;  2MW8 A;  2XPV A;  3FKI J;  1HLV A;  3HOU J;  1WI3 A;  3SFI A;  2ECB A;  3JRA A;  2D5V A;  2FD5 A;  2K9N A;  2L9R A;  1TWA J;  5FKN A;  2LK2 A;  1MSF C;  3Q0U A;  3F0C A;  4J19 A;  2L0K A;  4C3H J;  4A3K J;  1VFC A;  1NTC A;  5IOZ A;  2JMW A;  4B4C A;  2Y9Z A;  2X9D A;  3ZQH A;  2QCO A;  3QPS A;  5FKM A;  4FCY A;  1MBG A;  1Y1V J;  1IJW C;  5IPA A;  1PUF B;  1HOM A;  1ETV A;  1IC8 A;  3TP3 A;  3BG3 A;  5J1R A;  2DA1 A;  1MH4 A;  1HDD C;  5E3O A;  2JK3 A;  1P7J A;  1LE8 B;  4DZP A;  4G12 A;  1P7I A;  2GLO A;  3D1N I;  4A3I J;  2E2J J;  2M8G X;  3LSR A;  2E1O A;  3JR9 A;  4DYQ A;  2DMN A;  5FKK A;  3G1M A;  3TW7 A;  3HBL A;  3ZQI A;  5IOY A;  1ETK A;  4IHV A;  4IEJ A;  4M6V A;  1A5J A;  4I76 A;  2COB A;  5F0C A;  3LNQ A;  2L7M P;  5K7F A;  5EG0 A;  4JX6 A;  1JUP A;  2ID3 A;  3JRI A;  1JKO C;  1CQT A;  2FX0 A;  2R7Z J;  1DU0 A;  2TRT A;  1I6H J;  4XIC A;  1AHD P;  2EH3 A;  3UKG A;  2DA2 A;  3ZQL A;  1BJZ A;  1QVT A;  2HDD A;  1MBF A;  9ANT A;  1Z0X A;  2NVQ J;  1K83 J;  3BQZ A;  2K40 A;  3VPR A;  3JRC A;  4XID A;  2PMZ N;  2CUF A;  4M3B A;  3LSP A;  2G0E A;  2HI3 A;  2H8R A;  2GBY A;  1ZGW A;  5J1Y A;  5M5W J;  4A3F J;  3HOZ J;  2DN0 A;  3E7L A;  3GTL J;  5EF6 A;  5F08 A;  2M0C A;  1AKH B;  5EZH A;  3IV5 A;  1U8B A;  5EEA A;  1BW6 A;  3G1L A;  4FE7 A;  4MO7 A;  1NK3 P;  5EDN A;  3HEF A;  1YRN A;  1I50 J;  3QPL A;  2HOA A;  2CQQ A;  3O8H A;  5BNG A;  1JT6 A;  1UG2 A;  2YS9 A;  1R9T J;  4JX4 A;  3GTP J;  2MG4 A;  5M3M J;  2ME0 A;  1LFU P;  4B1R A;  4A3E J;  2RAE A;  2WV1 A;  1DU6 A;  2LTP A;  4BKX A;  2VKV A;  2AHQ A;  3JRG A;  3OIO A;  1VND A;  1GUU A;  3A02 A;  2HOS A;  1WGX A;  2NS8 A;  1JTX A;  3B6C A;  4JP0 A;  1TWG J;  2ECC A;  2X48 A;  2LVS A;  5M5X J;  4AYB N;  4GFB A;  1B8I A;  2W48 A;  3S2D J;  4IHX A;  5M5Y J;  1K61 A;  3SDG A;  3CMY A;  1SFO J;  1IRZ A;  1JKR C;  2XSD C;  2DA6 A;  4D5F A;  1RPW A;  2XPW A;  2XRL A;  1W0U A;  1VF9 A;  3HDD A;  1FTT A;  3BG9 A;  2R5Z A;  1ZR2 A;  3HOX J;  3TW6 A;  1RKW A;  4A3B J;  2HQ5 A;  4BXX J;  1FIA A;  4AC0 A;  3ZQF A;  3BTI A;  5E3N A;  5IP6 A;  3S1N J;  3GTM J;  2IBD A;  2NVT J;  3JRH A;  1BL0 A;  2EZI A;  1WPK A;  4FTH A;  1Y1W J;  3BR3 A;  1MSE C;  1ETY A;  2R92 J;  5F1J A;  3NAR A;  1SAN A;  3PM1 A;  5C4J J;  4DZJ A;  1RET A;  1Z77 A;  3ZOB A;  4D7M A;  4M3F A;  2Y30 A;  3GTO J;  2JA7 J;  4W97 A;  1A6I A;  1OCT C;  3PO3 J;  4Y52 J;  2XB5 A;  2O7O A;  3HM5 A;  5FLV A;  1TWF J;  1ETQ A;  3FIW A;  2LP0 A;  1JJ6 C;  3S1M J;  1LE8 A;  4S0H B;  2ELK A;  3I4N J;  4XK4 A;  3HKZ N;  2IAI A;  3IH3 A;  2WAQ N;  5K7Z A;  4C3I J;  2LLK A;  1JTY A;  3L1P A;  5DTD A;  1U9N A;  1ORK A;  3S2H J;  4NDL A;  5EGO A;  4A3M J;  1TWH J;  4A3C J;  2WB1 N;  3ZQC A;  2P81 A;  1ETW A;  3BG5 A;  2MGQ A;  1FEX A;  2VI6 A;  2YUS A;  1MBE A;  1ZK8 A;  1B72 B;  1HF0 A;  1Q1V A;  4V2F A;  3OSG A;  3WHB A;  3H3V K;  2X6O A;  4RBO A;  4MFD A;  1W0T A;  2VUM J;  1JKQ C;  2FQ4 A;  1MNM C;  5DS9 A;  2YU9 J;  3GBG A;  2NVX J;  2LD5 A;  1JUS A;  1FIP A;  1ZTR A;  2JA8 J;  1VI0 A;  2R0Q C;  1O4X A;  2DMT A;  1APL C;  1GDT A;  1ZR4 A;  1T33 A;  2KT0 A;  4ABZ A;  3HOY J;  4EEF G;  2DA3 A;  5EYR A;  1AKH A;  1GV2 A;  3TED A;  1IG7 A;  1UMQ A;  3W6V A;  2K9Q A;  1JGG A;  2L7F P;  2TCT A;  2DJN A;  4X1E A;  3HOV J;  1IDZ A;  4MLO A;  2JA6 J;  2EZL A;  4MFE A;  1H89 C;  3HOW J;  4CYC B;  2M2E A;  1OCP A;  1IUF A;  1RR7 A;  3BR6 A;  3BR0 A;  4UUT A;  5M3F J;  1IV6 A;  2O9L A;  3I4M J;  1I3Q J;  3Q3S A;  1XG1 A;  1JUM A;  5FKL A;  4JYK A;  5GP9 A;  1TC3 C;  3S1Q J;  3Q0W A;  4X6A J;  3M4O J;  2FJ1 A;  4M3G A;  3C2B A;  1HDP A;  3MVP A;  1D5Y A;  2NOG A;  2R5Y B;  1T56 A;  4UUS A;  2DMU A;  2L7Z A;  3G1O A;  4V2G A;  1U9O A;  1QRY A;  3ZQG A;  4RDU A;  4XRS A;  5GPC A;  3RZD J;  4LOC A;  2Y31 A;  3GTQ J;  1WCM J;  4BBS J;  4FE4 A;  2JA5 J;  2R93 J;  4C3J J;  1ETX A;  2XB0 X;  1ZQ3 P;  1MBJ A;  2M9H A;  2VKE A;  3BTC A;  5JLW A;  1F36 A;  3BQY A;  2Y2Z A;  1F43 A;  2NS7 A;  3A01 B;  5E3M A;  3CCY A;  3RQI A;  4QSH A;  2DA5 A;  2R5Z B;  5IYC J;  2E19 A;  3S15 J;  5F0H A;  2XGC A;  4QTR A;  2OPT A;  1PUF A;  3LSG A;  3SJM A;  5F27 A;  4DW6 A;  5IP9 J;  4XRS G;  4DYC A;  2E2H J;  4FIS A;  2LY9 A;  5JLX A;  5C3E J;  3M3Y J;  1X58 A;  3GTK J;  5FKO A;  1QPI A;  1XC5 A;  5F0F A;  2M34 A;  4A3J J;  5EZG A;  4DYR A;  3HGG A;  4Y7N J;  1RES A;  2CU7 A;  4A69 C;  4IHW A;  3BR5 A;  3MKL A;  5J1U A;  2DMP A;  3TP0 A;  1AU7 A;  4BY1 J;  5IYB J;  2LKX A;  2I10 A;  4JX5 A;  5HOD A;  2IEK A;  3S14 J;  1X2M A;  2CUE A;  1B72 A;  1HCR A;  1UHS A;  2CQX A;  2XGE A;  4QIW N;  2CRG A;  5C4X J;  1ZKG A;  2LR8 A;  2CJJ A;  1IDY A;  5FJ8 J;  4M3E A;  1TWC J;  5EGO B;  3LOC A;  2ID6 A;  3JRE A;  4L5E A;  5E3L A;  3LSJ A;  3JRB A;  4A3G J;  3GTJ J;  5EG0 B;  1U78 A;  3FK7 A;  2ME6 A;  4M3D A;  1NK2 P;  3OSF A;  3K7A J;  2DA4 A;  2XGD A;  2HXO A;  3GTG J;  2DMQ A;  1BW5 A;  2E2I J;  4MIM A;  1OJL A;  1H8A C;  4BY7 J;  1G2H A;  3BTJ A;  3QQA A;  3IH2 A;  4HNV A;  2B63 J;  3BT9 A;  4I6Z A;  1E3O C;  2LFB A;  3HGY A;  3JRD A;  1XS9 A;  2AO9 A;  2JN6 A;  3CDL A;  2O8K A;  2H1K A;  2EBI A;  2HXI A;  3FIS A;  1OFC X;  1GT0 C;  3FK6 A;  4BBR J;  2JWT A;  5K7H A;  3S16 J;  4AUX A;  1GV5 A;  2K9S A;  3RKQ A;  4A3L J;  1LFB A;  2QF7 A;  4CYC A;  1JKP C;  1BA5 A;  5GPA A;  3DEW A;  1S7E A;  2JJ7 A;  2VPR A;  2OF7 A;  2ZB9 A;  3S1R J;  1IGN A;  2NVY J;  2N8G A;  5F04 A;  1YRN B;  4IHY A;  3OOU A;  2EZH A;  2Y0S N;  1RKT A;  2EQR A;  1POG A;  2Y9Y A;  3MN2 A;  3PO2 J;  4A3D J;  3K2A A;  2R5Y A;  3HB9 A;  3H0G J;  4A93 J;  3RZO J;  2MSY A;  1X2N A;  3DCF A;  4D5C A;  5C44 J;  1WH7 A;  3BTL A;  1ENH A;  3Q0V A;  3O8G A;  1JJ8 C;  5J3L A;  4W1U A;  4D7N A;  1MBH A;  1ETO A;  4XRM A;  1FTZ A;  5IYD J;  1QVU A;  3BR2 A;  2GM4 A;  3JRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...