5FLMJ

Structure of transcribing mammalian rna polymerase ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
molecule tags Transcription
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5flmJ00
3OSFA 3SDGA 3BTLA 2HI3A 1BW5A 3Q0VA 1P7JA 2M34A 3PO3J 2LVSA 3ZQLA 1MH4A 4FE7A 4L5EA 2EBIA 1IV6A 1IDYA 2M2EA 2YS9A 3O8HA 5F04A 1FTTA 2HOSA 4I6ZA 1QVUA 3LSPA 1TWAJ 3IH3A 2ECBA 5IPAA 3B6CA 2JA6J 4A69C 3HOXJ 2R5YA 1B72B 3S2DJ 1PUFA 1ZTRA 3IV5A 5IP9J 2CU7A 1MSFC 5E3NA 1TWFJ 2ZB9A 3GTGJ 5IYDJ 1DU0A 1O4XA 2LKXA 1UHSA 1RESA 2XGDA 4UUSB 2WAQN 3A01B 5GPAA 3JRBA 1JUMA 1U9OA 2K9NA 1JKQC 4IEJA 3SFIA 4QSHA 3ZQHA 2GLOA 3D1NI 2CRGA 2ECCA 4DYCA 3LNQA 5EGOB 5DTDA 1VF9A 5C3EJ 1BA5A 4MLOA 1EF4A 2DMQA 4W97A 1CQTA 2EH3A 3HOWJ 1VI0A 1Z77A 5EG0A 2WB1N 1JTYA 1GV2A 4B1RA 2LP0A 2L0KA 2W48A 3JRIA 1NK2P 4CYCA 4BY7J 2QCOA 4QTRA 1I50J 5HODA 2NVQJ 1ETOA 3PO2J 1JUSA 1GT0C 3HKZN 3H3VK 2VKEA 3ZQGA 3S1QJ 2P81A 1JGGA 1SANA 3BR6A 2XRLA 4MIMA 5F0FA 2R92J 1Y1WJ 2LLKA 1JTXA 2IAIA 3LOCA 5FKLA 2R93J 3OOUA 1E3OC 5IP7J 1S7EA 2NVXJ 2YU9J 3RKQA 5E3OA 2DA1A 5IP6A 1WI3A 3BTIA 1FTZA 3F0CA 2EZLA 1T33A 4C2MJ 2WV1A 2X6OA 2DA7A 3HBLA 2X9DA 3GTLJ 2JN6A 1OCPA 1QVTA 3OSGA 1MBKA 1D5YA 1MBHA 1XG1A 4BXXJ 4AYBN 2HQ5A 1H8AC 2PMZN 5M5YJ 4A3MJ 2EZKA 9ANTA 2XSDC 3SJMA 1WCMJ 2O9LA 3S1MJ 3A03A 2ME6A 1LFBA 2N8GA 1ETQA 3G1OA 5J3LA 1HLVA 1AKHB 4V2GA 1A6IA 3B6AA 1R9TJ 1A5JA 3HDDA 4XK4A 4C3HJ 2COBA 4Y52J 2CUEA 1QRYA 4DZJA 4XIDA 4A3IJ 1Y1VJ 2ID6A 3GTQJ 3ZQFA 2Y31A 2Y30A 3E7LA 4W1UA 1MH3A 1AHDP 4A3DJ 1IC8A 4DW6A 2KT0A 1GVDA 2MGQA 2TCTA 2JA5J 5FKKA 4XRMA 1RKWA 2LTPA 4D5FA 2M0CA 1W0UA 2D5VA 4A3LJ 3MN2A 3FKIJ 3CDLA 5K7FA 2DJNA 2NVYJ 3RQIA 1HDDC 2VI6A 1IJWC 2R5YB 1HDPA 2Y9ZA 3Q0UA 1PUFB 5J1YA 1W0TA 3BG3A 3BR1A 3DEWA 1LFUP 4A3KJ 1VFCA 1RKTA 5E3MA 3NARA 2HOTA 1IRZA 2CJJA 1JKPC 2R5ZA 1Z0XA 2M9HA 4FISA 2VUMJ 4DZPA 2E1OA 1JUPA 4EEFG 1RR7A 4X6AJ 1WPKA 2L9RA 3BTJA 3O8GA 3GTJJ 4XICA 1ETYA 3NAUA 5GPCA 2XPUA 2DMPA 4MO7A 5FKNA 4IHWA 5M5WJ 4JX6A 4C3JJ 4ABZA 5EEAA 1NK3P 4AC0A 3HOZJ 4FTHA 5EG0B 4IHXA 2LD5A 3I4NJ 3HGYA 1F43A 3TEDA 3FIWA 3TW7A 2JA7J 2EZIA 4D5CA 3S2HJ 4CYCB 2ELKA 3S14J 1H88C 1IUFA 3RZOJ 2AO9A 2H1KA 5IOYA 2EQRA 5EF6A 1ITYA 4GFBA 3L1PA 4I76A 5M3FJ 2GM4A 2VPRA 2K9QA 2LFBA 3PM1A 2H8RA 1B8IA 5EZHA 3CCYA 3JRDA 1UG2A 3K2AA 3HOVJ 1T56A 2DA6A 2L7MP 2FX0A 1HF0A 5F1JA 2HYJA 2EZHA 4FE4A 1K61A 3Q3SA 2ID3A 2L7FP 1X2NA 1TC3C 1RPWA 2DA4A 2E19A 2FD5A 3LSRA 1JJ6C 4Y7NJ 2GBYA 2Y2ZA 2R0QC 3HM5A 1WH5A 4MFDA 2CQXA 2M8GX 4RDUA 2MSYA 1K83J 3BTCA 1XS9A 3JRAA 3UKGA 2XPVA 3BG9A 3JR9A 2DA5A 4AUXA 4UUTA 5C44J 4XRSG 1H89C 1G2HA 1ZR4A 5IYCJ 2DMNA 2DA2A 2OPTA 5FKMA 4IHVA 2E2IJ 3MVPA 4BBRJ 1HOMA 3IH4A 1MSEC 2OF7A 4DYRA 3BG5A 3FISA 4QIWN 1MNMC 1LE8A 4B4CA 1ZKGA 5F0CA 1NTCA 4LOCA 1ETXA 2QF7A 3S16J 4A93J 1U8BA 1FJLA 2G0EA 3M3YJ 1QPIA 3BR5A 1HCRA 1JKOC 2LK2A 3IH2A 2X48A 4D7NA 5F08A 4JX4A 5EZGA 2B63J 2R7ZJ 1I3QJ 5K7HA 1YRNA 2JWTA 3WHBA 4M3FA 2E2HJ 3VPRA 1BW6A 1FIAA 3CQZJ 4A3CJ 4DYQA 3S17J 1GV5A 3W6VA 1MBGA 5FLVA 1BJZA 1ETVA 3BR0A 2I10A 1SFOJ 5J1RA 3HOYJ 5J1UA 4BBSJ 2JA8J 5EDNA 1ZK8A 5JLXA 5EYRA 4A3GJ 1Q1VA 2TRTA 4M3EA 3GTMJ 2L7ZA 1RETA 5BNGA 4V2FA 2VKVA 3DCFA 2HXOA 1POGA 1MBEA 1VNDA 1MBFA 2XGEA 4JP0A 1JJ8C 1FEXA 2NOGA 4A3EJ 3FK6A 2DN0A 2R5ZB 3JRCA 3Q0WA 3JREA 2MW8A 1B72A 2O7OA 2ME0A 1OCTC 3HOUJ 2CUFA 2NVTJ 1FIPA 2K9SA 1ETKA 1F36A 1MBJA 2Y9YA 2YUSA 5DS9A 4G12A 3CMYA 3RZDJ 3QPSA 4UUSA 1ETWA 2DMTA 1JKRC 5FJ8J 4S0HB 4J19A 4HNVA 1U78A 3A01A 5FKOA 2NS8A 4BKXA 3GBGA 1XC5A 3S15J 3JRHA 4A3JJ 1X2MA 3G1MA 3TW6A 1ZQ3P 2KDZA 3K7AJ 5EGOA 3FK7A 2MG4A 2JJ7A 1GDTA 2IBDA 1OJLA 4RBOA 1ZGWA 3BR2A 2LY9A 5C4XJ 1TWHJ 3TP0A 3LSGA 3HEFA 3C2BA 4C3IJ 1BL0A 5F0HA 3BQYA 3H0GJ 5C4JJ 1ZR2A 3GTPJ 3ZOBA 2E2JJ 3ZQCA 2IEKA 5E3LA 4D7MA 4BY1J 3JRFA 5GP9A 2JK3A 1ENHA 1X58A 3GTKJ 1B8IB 2Y0SN 3I4MJ 1JT6A 4IHYA 3BT9A 4M6VA 2FQ4A 4MFEA 5M3MJ 1OFCX 5FLMJ 1IG7A 5K7ZA 2HOAA 5JLWA 4M3BA 3HGGA 2HDDA 4XRSA 1IDZA 3GTOJ 2JMWA 2DA3A 3OIOA 1DU6A 4X1EA 3BR3A 3BQZA 2HXIA 1GUUA 2XPWA 2DTZA 5F27A 4M3GA 2CQQA 1WGXA 2XB5A 3QQAA 2DMUA 1ORKA 3WHCA 2K40A 5M5XJ 1I6HJ 1TWCJ 2FJ1A 4A3BJ 1WH7A 3A02A 3S1RJ 2XB0X 3HB9A 3QPLA 3JRGA 1IGNA 1AU7A 2XGCA 3LSJA 4NDLA 3ZQIA 4FCYA 3G1LA 1P7IA 2RAEA 3S1NJ 3TP3A 1LE8B 4M3DA 5IYBJ 2LR8A 1AKHA 2O8KA 4JX5A 5IOZA 3M4OJ 1APLC 4B3AA 2NS7A 1TWGJ 1UMQA 3MKLA 1JT0A 4JYKA 2AHQA 1YRNB 1U9NA 4A3FJ
chains in the Genus database with same CATH superfamily
3VFZA 3SDGA 5IT3A 2DOEA 3R4KA 4I98B 2JZYA 4I09A 4B8XA 2LVSA 3ZQLA 1YFHA 2L9VA 5CJ9A 2ADUA 2B0LA 3CCEI 4RB1A 2GZWA 1IV6A 2M2EA 1F9NA 3HOTA 3O8HA 1RI7A 5FB2A 2YSRA 3SZPA 1FNNA 1GVJA 2PBIA 2HOSA 1QVUA 3L2CA 1J7KA 2R7RA 1HA8A 3J7AO 2KZVA 1Y56A 2LSOA 4A69C 1PJRA 3B02A 3S8PA 1IW7F 3VYTB 3HPGA 2VOOA 5E20A 3V8JA 2CQKA 4RLQA 3V7RA 5IP9J 4PFPA 3JSPA 1T38A 1Y39A 2A6HF 3QYFA 2IA1A 2QWWA 2CV0A 3AG2H 3LSKA 3T0YA 5E3NA 2KRCA 5IYDJ 2LKXA 1LQ1A 4UUSB 4EV0A 4XSXF 3OYBA 3LQRA 2JSPA 2K3PA 3JRBA 4QPQA 1K4SA 4HSRA 4IEJA 4X0GA 2XDVA 3SFIA 1Z3YA 2F5FA 4LG3A 2QYOA 3ZQHA 5ERIA 2R7XA 2XF7A 1FBQA 1S8NA 3OOPA 5J40A 1FWZA 1JI8A 2ECCA 1VF9A 3QYEA 1BA5A 3BCAA 3D5LA 2PJPA 3KEQA 1N78A 4M6YA 1SD5A 3H5NA 4H4KC 1ODDA 2EH3A 1OYWA 4EM0B 3CTAA 1JTYA 4HQMA 2FNPA 2LP0A 1KQ9A 2WY7Q 3BG7A 4LITA 2HZTA 2BY2A 2NYXA 4CYCA 4A6EA 2K4BA 5HODA 3QU3A 2DOFA 2L02A 5KVRA 1AOYA 1GT0C 2Q1ZB 4XKVA 1R22A 4ETSA 2ISZA 3S1QJ 1HW5A 4MIMA 1IXCA 3C7JA 4F3QA 4BS9A 2XAGA 3WGHA 3I64A 3WU1B 3LSHA 4LD5A 3Q5FA 1R36A 1ZARA 2BGCA 3NWSA 4UV9A 1S7EA 3A2KA 3RSNA 3FX3A 3GLLA 2EPFA 4XSZF 1LKXA 3F0CA 3ZMUA 2PX9A 2X6OA 2Q0OA 4HF1A 2WB1A 3LL7A 2JN6A 1OCPA 3QU6A 2HR3A 5E79C 2IJLA 2OJED 1FC3A 1XCVA 3IWZA 3SQNA 2FE3A 2ZO4A 5L3CA 1H8AC 2YR2A 5M5YJ 3KFWX 4MQVA 3OR2C 9ANTA 2O9LA 1UCRA 3PFIA 2CG4A 2ZNZA 3GZNB 2ME6A 3VSKA 3H1CA 3JAMZ 5CKTA 4V2GA 3E5QA 1R9TJ 5HS8A 1A5JA 1FMVA 4KN7X 2HEOA 3HDDA 3RKXA 4E6KG 2QSFX 2F4OB 2CUEA 1Z6TA 1WJEA 2JPCA 4XIDA 2LDUA 3GX4X 1YJWI 1Y1VJ 2ID6A 3CUOA 1R5ID 4DBQA 1Y8QB 4A3DJ 5CYVA 1Z91A 1GVDA 2KIMA 2TCTA 3FXKA 4BE1A 1IUYA 5CVVA 4E7SA 4BUPA 4L18B 1X19A 4D0PA 3ZMDA 1EKEA 3FKIJ 3VB2A 2L7KA 4WWCA 3CO6C 3BZ6A 4DIQA 2VODA 2LF8A 1BI3A 2X1EA 3LSMA 4G9YA 4L9NA 1R00A 2CW7A 4EJOA 4NB5A 1A36A 3AG3H 2VI6A 1VQOI 1IJWC 1KONA 1A35A 3I3LA 2L4AA 4M71A 1LUJB 2HKOA 3W3CA 5J1YA 1U5TA 3BG3A 3FXQA 2V6CA 2XF6A 3DEWA 4A3KJ 2XAFA 2ZSIB 5E3MA 2P5KA 1IAWA 4J00A 2VQHA 1UELB 4CGZA 3VWBA 3KLOA 5DD8A 3IRQA 4CCOA 3ZMTA 2HVRA 4AVPA 4RGUA 3SZGA 2QA4I 2VJJA 3BPXA 3RKYA 4EJVA 4XM3A 1VQ7I 3HTSB 5KAIC 4ZYEA 3CJQB 3BPVA 1WPKA 3SXYA 2XUBA 3O8GA 1KYZA 2KKOA 4DBRA 1ETYA 4XICA 3GTJJ 2OU2A 2DCEA 4IO9F 2XPUA 1YW7A 2HDCA 5FKNA 5FLXK 1Z6RA 2VPLA 2ZFUA 2EIJH 5ICCA 4L5JA 1ONVA 1G3WA 5BS6A 3HUGA 1F43A 1KQ0A 3ZGKA 1YX3A 2LNBA 5JFRA 1QQIA 3FHZA 4ZJZA 4CYCB 2Z99A 4ZC3A 3V8KA 3EUKL 4CSWA 2CUJA 4EGZA 2XV4S 1X1CA 1FPQA 1R5GA 2RREA 3I59A 3K4CA 5FROA 3OS1A 1W1WE 1KZHA 1SFUA 1FLIA 3BG6A 5B1AH 3IL2A 2VPRA 2K9QA 5M3FJ 3QOPA 5DD4A 2E60A 3I53A 3JRDA 3CF5F 2F48A 3HOVJ 2FX0A 1HF0A 1UFMA 3KP3A 1O3SA 3ABUA 2DT5A 2ID3A 4RMNA 2XIGA 4HSTA 4MNUA 2CQNA 1G59A 1SVMA 3F8BA 5CQGA 1QHGA 2Y2ZA 1LVKA 3RQ4A 5IT9K 3DF8A 2PLYA 4MFDA 3HJEA 2CQXA 1S7AA 4OINF 4HYEA 4C2UA 5ICEA 2EK5A 4RDUA 4KYWA 4CYDA 2FMLA 3ELKA 3JR9A 5CVIA 2BXYA 4RS8A 3FXRA 2DW4A 4Z2YA 4PSWA 1FYKA 5IYCJ 5FKMA 2Z33A 2OPTA 4ENKA 2EFOA 2HVSA 4FASD 1PP8F 3P5JA 4HLYA 3J7AY 2L01A 4EGYA 4BBRJ 3BROA 4Y4RA 1HOMA 3IH4A 2CFOA 3FXJA 5H6RA 1LE8A 1ZKGA 5F0CA 3S93A 1ETXA 1OISA 2V1UA 1ZG3A 4ITVA 4L9TA 2D1VA 2FXAA 3BR5A 3NEUA 3IH2A 4RGSA 2OV7A 1MW7A 5LRSA 1MMDA 1H0MA 3DPLC 1I3QJ 2JWTA 1MJAA 3D5RC 4RGXA 2K27A 1V5EA 2BHYA 2E2HJ 5IT9Z 2V1NA 4KUMA 4PCQA 2DDAA 3CQZJ 3I54A 4HG2A 3C18A 4A3CJ 2XROA 5TISC 2VBYA 1BJZA 4BE0A 4M6XA 2HS5A 4UY8I 1HKSA 3HOSA 5J1UA 3GFLA 2MC4A 5EDNA 5EYRA 1U5TB 1MNEA 1Q1VA 1SFEA 4EQQA 2L7ZA 1GHCA 5KK1A 2HYFA 1IF1A 2QGUA 3LFKA 3DCFA 4L0YB 2E5ZA 3GZ6A 1WSUA 4M72A 2NOGA 5DCFA 1OLTA 3K1PA 1V3FA 3JREA 4II3A 2I8DA 3GZ5A 1DDNA 2J5PA 3DPTA 3MKZA 2K9SA 5B1BH 1ETKA 1F36A 2QM3A 2EIMH 1ZAOA 2GXGA 3ZP5A 1XMAA 3O2PE 2GWRA 2D45A 2ZJRF 1ETWA 2DMTA 5FJ8J 4BDYA 4HDVA 3F6OA 3OL4A 3GEZA 4J01A 4U0YA 1SEUA 5FKOA 3CDHA 2DI3A 4PJ0C 3S15J 2W7NA 3AG1H 3HUGB 1T8IA 1VQ6I 2L5QA 3CLOA 2VASA 3CMMA 1ZQ3P 3K7AJ 5EGOA 2ZBKA 3FK7A 4AWXB 5HOOA 3OYJA 3FM3A 3H92A 3LFUA 2Y69H 3WODF 4RBOA 3IHUA 1TW2A 1XTAA 4MEXF 4XNFA 2OCEA 1FOKA 1Y8RB 3L7WA 2H09A 1MNDA 3HXLA 4YIIA 2WA0A 1N75A 3OL3A 3ZOBA 3OYMA 4BY1J 2IVMA 3I59B 4D7MA 5GP9A 2Z2SB 5HVQC 1XDUA 3SEQA 2JK3A 1ENHA 1X58A 5K1YA 2PJRA 4MHGA 1M1EB 3TQNA 2VT3A 3BT9A 4M6VA 4UV8A 4WX9A 2FQ4A 4MFEA 5M3MJ 1GXQA 3HRSA 1LEAA 1S72I 1KU2A 5CVJA 4BXFA 2HOAA 4M9SA 3OWTA 5FO5A 1K6YA 4ESJA 2IT0A 2QKLB 3OYIA 2K85A 2ZJPF 4XRSA 2DU9A 2HDDA 1IDZA 1OYIA 2CW0F 3K9TA 2IGOA 3A4CA 2DA3A 2E71A 4CDGA 3K70D 3M1EA 5BQTA 3BR3A 2HWVA 3BQZA 1HC8A 2AQEA 5JHFA 2V7FA 2X6XA 5F27A 1BC8C 1OR7C 4YG2F 1HBXG 4DOZA 5KAFC 2CQQA 1DGRM 2XB5A 1I3AA 2DFHA 1W5TA 4WCGA 2W84A 2K40A 2OTLI 1I6HJ 1ZGJA 3FXLA 1PDNC 3MD2A 5E8IA 2G7UA 2XGCA 5HLGA 4RB0A 4PJLA 2CMPA 2E7WA 3ZQIA 3OYGA 4G6TB 5HS7A 3PFYA 2ELJA 1TQMA 1PYVA 3IAM2 1LE8B 2FQ3A 3KP5A 3S1NJ 2LR8A 2QUFA 4K2EA 3BP8A 1AKHA 3S3MA 4ZYDA 4C9YA 5J4YA 3OYCA 1F4KA 4RA2A 1X3WB 1VQ9I 3U9GA 2AHQA 2F5DA 4FT8A 1U9NA 1XN7A 2BXZA 2BVLA 2IS4A 1YW9A 2OQGA 2WWYA 2ZJ2A 5TGTA 2M0MA 3BTLA 3CC2I 2HI3A 5TRDA 1BW5A 2EIKH 1YW8A 3PO3J 1IN8A 3P7NA 2KZGA 4IRHA 5CVRA 3CD6I 3KE2A 3OYAA 1O7FA 4C30A 1MMSA 2EV5A 3KIOA 5F04A 2VT2A 2DT7B 5D5VB 1YTYA 1H9GA 3CJNA 4XLPF 1J09A 1TWAJ 2X51A 3FXUA 4RAZA 2XAUA 3TO9A 3EUAA 3ZPLA 1FY7A 1V54H 1I1GA 2KHMA 4CHUA 4WXDA 2KL4A 4CH7A 1PUFA 2IGNA 5LBQA 2NOJB 1MSFC 2FU4A 1R4NB 2IGMA 2ZB9A 2H27A 4JQFA 1DU0A 3DXJF 1IRFA 1UHSA 4Z6YA 1U3EM 4AIKA 2Z3YA 1YOVB 1HSTA 2WAQN 3N4MA 1XMXA 2VBZA 3WU2C 1F5TA 1OYYA 2K9NA 4BHPA 4QSHA 3OIQA 5HNFA 3LA7A 2GLOA 1TQIA 4BXUA 3HSFA 4PSXA 2CRGA 2LOOA 4LMYA 3PUBA 5DTDA 5EGOB 1NHAA 3HTUA 4S04A 2DT6A 1EA3A 3ASNH 1RIOH 2D1HA 2AXLA 5L3EA 1QGPA 2P4WA 4JOMA 1VI0A 1WKMA 1Z77A 2I5UA 2W24A 3GF2A 2OCCH 4B1RA 2IPQX 1K7AA 2L0KA 2W48A 1NK2P 3F6VA 3OS0A 2PJRB 2QCOA 1D1BA 2DK8A 1SD4A 1JUSA 3LWFA 4BQQA 1WJFA 3HKZN 2VKEA 3X2QH 2A68F 1WVRA 2DFEA 1JGGA 4HDUA 2XRLA 1TNSA 1Y1WJ 2Z1DA 4I7HA 4Q5SF 1E3PA 5HLHA 1OCZH 5FKLA 4RGRA 3IKTA 4ZTFA 4FX0A 2NVXJ 1RZ4A 3J80Z 1B9MA 1TLHB 1ZLJA 2DA1A 2X0LA 4B44A 5IP6A 1FTZA 5D5WB 2EZLA 2WV1A 1LDDA 4BHCA 3W2VA 2FSWA 3VODA 2DTRA 2X9DA 1XSDA 2P5LC 1X1BA 1QVTA 2JRTA 3MZ8A 2JSCA 4XLEA 3S2WA 3SEZA 1F1ZA 4N4NB 4DGWB 2H1LA 3OYDA 3CCRI 2PMZN 4PFOA 3KLNA 1YS7A 4ENMA 2HTJA 2EFQA 2GAUA 2F5EA 3FDYA 4ASNA 3A03A 2N8GA 5J3LA 2LG4A 2KDOA 2P6SA 3R0JA 5ICGA 1AKHB 1E0EA 2MLKA 2VQCA 3CF2A 1D1AA 5LEKA 3G71I 4Y3OA 2COBA 2H94A 1LVAA 3E5XA 4RB2C 3F3XA 2VOPA 4OU0A 2Y30A 1AHDP 3P9CA 4D9JA 4HX4A 1LDJA 4KN4X 2RV8A 4XONA 3AL0C 4XRMA 4M9ZA 4D5FA 2E35A 1W0UA 2MH2A 2FUG2 2H6BA 4AYBA 3CDLA 1R71A 2UXNA 3E6BA 2NVYJ 2EB7A 1FOYA 3K10A 5AIQA 2UXXA 3RQIA 3ASOH 2JQ7A 3EYYA 3F8FA 2L54A 4LLNA 2PQ8A 2VJIA 1EH8A 2BE5F 1HDPA 2XVCA 3QWLA 2O6GE 4G7HF 4XKCA 4Y15A 1W0TA 1PUFB 5A2QK 1UB9A 1SVOA 2L3DA 3BR1A 1XSVA 1LFUP 4I02A 5ED4A 1OPCA 1YJ9I 3FKJA 1X3ZB 1RKTA 4NUBA 2HOTA 1IRZA 4U0WA 3IRRA 1G8XA 3EPZA 3QPTA 2CJJA 5AONA 2R5ZA 4GO1A 4BL0B 2E1OA 5GAHJ 4U7DA 1ZH5A 2KFDA 4EEFG 1QU3A 4U7BA 6PAXA 2L9RA 3BTJA 1SAXA 4BHBA 1PP7U 2LRDA 4E7JA 2HQAA 2DMPA 4GRIA 3OYFA 4MO7A 4JX6A 2KQRA 4LJZF 4C3JJ 5J6XA 3TOBA 3HOZJ 3V7SA 3NRVA 5HDKA 2LD5A 4XN0A 5GTIC 1TQPA 2JA7J 4D5CA 3BDDA 2VL8A 3EUHA 5A2QZ 4OIQF 5FRMA 2HDWA 3RPUD 2ELKA 1YHQI 2IW5A 1H88C 4FHTA 1TW3A 1YX5A 3EUHC 1IUFA 3REOA 5DUKA 3RZOJ 4N0BA 1O57A 3JAMK 4UNOA 2EQRA 1HKTA 2LC2A 3ZMZA 4L0ZB 2UZKA 4PJJA 4BACA 2H8RA 4I0BA 2O3FA 3CCYA 4U87A 1UG2A 3K2AA 2L7MP 2M3AA 1D5VA 2V6EA 4Q47A 1VZ0A 4C2TA 3F23A 3UR3C 1ZN2A 2W85A 3DQVC 4N4OB 1N77A 3PL8A 2EJRA 2JUGA 3M8JA 2E19A 1JJ6C 2GQQA 3O3KA 4Y7NJ 2GBYA 2CFXA 2R0QC 3HM5A 1WH5A 4BQOA 2NXNB 4XRFA 3TKYA 4A0YA 3KYDB 2EILH 2M87A 2MSYA 4MGRA 4EMSA 3UKGA 1TT0A 2XPVA 3ROUA 4XLFA 3CMEI 4LGWA 4XR6A 2ZKZA 5C44J 1H89C 4XRSG 2VBWA 4IHVA 2KPMA 3WTVC 1R49A 5DV5A 1FZPB 2RN7A 3DKYA 3KZYA 1BI1A 4E7IA 1WJBA 4P5OA 4P1WA 2BY1A 2ESNA 1MSEC 2QKMB 1VQPI 3AL0B 4ZYGA 3FISA 1MNMC 4LLGF 1P92A 5DEQA 3TO6A 5E1XA 2QQ8A 5F64A 1KA8A 5L3GA 2BEOA 4A0XA 1J59A 1MKMA 3FBIB 1QPIA 2R4GA 1JKOC 5F6FA 4AU7A 2OAZA 5BMZA 1P2FA 4JX4A 5EZGA 1YRNA 2IGKA 4M3FA 3MKYB 1VTNC 3GWZA 4BQAA 3VPRA 2JA2A 2BZTA 3V4GA 1QZEA 4E70A 1GV5A 1WHUA 3W6VA 3GFMA 1LEBA 2I10A 5J1RA 4BBSJ 2JA8J 2HGCA 4BNCA 4A3GJ 1U6GA 2CW8A 2Y75A 3CESA 5TJJA 4M3EA 2R7VA 1RETA 1U5TC 3SHFA 4Q48A 4V2FA 2VKVA 1HW1A 4DNCA 1VNDA 4RAGA 1MBFA 2O5RA 2EFNA 2XGEA 4JP0A 1VQNI 4MQ9F 4KIGA 3VEPA 4A3EJ 5D6EA 1J5YA 4CCMA 2R5ZB 2CSOA 3JRCA 1ZELA 1S29A 2MW8A 4HOBA 1B72A 2O8XA 1OCTC 4M9XA 1ZRFA 3FWEA 2BBYA 4G94A 2P7CB 1FIPA 1GXPA 1BR2A 4IX7A 2VB6A 2JPBA 3FMRA 3KPHA 1WI9A 2HVQA 3U1DA 1B9NA 5DS9A 2XC7A 5H20A 1IN7A 3N97A 3OYHA 3QPSA 3T8RA 3IAS2 3Q9SA 2E36A 3AFHA 2LREA 1U78A 3PQJA 1Y6IA 1OCRH 4IRIA 5D4RA 3ABLH 3GBGA 1XC5A 1O3QA 1Y0NA 2GIVA 3BC8A 3E1SA 4A3JJ 2VC0A 3GCMA 3GW2A 1SMTA 4Y17A 2JJ7A 2XRNA 3ERED 2AXTC 2IBDA 2XF5A 1ZGWA 3BR2A 2LY9A 4YIFA 2BY0A 3ZQQA 1TWHJ 2BHZA 3LSGA 3HEFA 3C2BA 3BQYA 3H0GJ 3TL4X 2WTEA 1Q1HA 1NG6A 1STZA 1ZR2A 1EV7A 3GTPJ 1FP1D 5E3LA 4G6DA 1U2WA 5DCMA 4O3MA 2GIZA 4LK0F 3JSOA 4HNUA 4G6QA 4JK1X 3I4MJ 4MTEA 4IHYA 4HF0A 1BBYA 2E5NA 3SZTA 1OFCX 1E3HA 1J9IA 2NS0A 2W00A 4KMFA 4YRVA 1E17A 4RLFA 5HLIA 2A5YB 3LSIA 2L4MA 3BJOA 3PNVA 3HGGA 3CZ6A 1R6RA 3HL2A 4F92B 3WTZA 3ZMSA 5B3SH 2WC2A 5KCMA 3L9FA 4EM1A 1HSJA 1UHWA 2ZC2A 1ORKA 3HC7A 2CH0A 5ILVA 5M5XJ 5JR3A 1TWCJ 3L2WA 3LA3A 1WH7A 5GADJ 3A02A 2LBFA 2XB0X 3WE3A 4O5VA 3M07A 2Y0SA 3RYRA 4F91B 2ICWG 3DKXA 4FCYA 2ISYA 1DP7P 2A3SA 1L3LA 2ESHA 4ZYHA 3KP7A 3TP3A 1RRJA 3HPHA 5IYBJ 1MMGA 1X4OA 3VSLA 3H3UA 4JX5A 2FEZA 3DTEA 3F8NA 4LB5A 2STWA 1TWGJ 1XB4A 3MKLA 2L9SA 3E97A 3K4JA 4B48A 4A12A 4WXCA 1YRNB 4EVIA 3K1MA 1BM9A 5CVUA 5FD6A 3BOQA 1RNLA 3EYIA 1FX7A 2LY2A 2XASA 3OSFA 2HFHA 4QWQA 2V1DA 4XOTA 3F22A 3Q0VA 2Q8KA 1P7JA 2M34A 1O3TA 4PZJA 2EA4A 3V42A 1CF7A 1Z21A 4YFKF 2H8WA 3ZMVA 1IDYA 1BOAA 2Y48A 1FTTA 1Z7UA 3WTWC 4QPOA 4I6ZA 1B1BA 3LSPA 2MLGA 1IN5A 2FBIA 3B6CA 2VIXA 2JA6J 3OYLA 1B4AA 3I58A 3HOXJ 1B72B 1L0OC 4OOIA 4A5NA 3ML6A 5HLTA 3R0AA 3IV5A 2X1CA 2CU7A 3QOEA 1FYLA 5KHDA 1HW2A 3C3WA 1TWFJ 2QBYA 2M8EA 3C2HA 3K1NA 2LF7A 1QZZA 3MAJA 4N9IA 2XGDA 1O4XA 2R7FA 3BZCA 4ENJA 1U8RA 3A0BC 4P9UA 4P55A 5BPDA 5GPAA 1BR1A 1JUMA 1U9OA 2QENA 1JKQC 2K3FA 4XL9A 2DPUA 2VBXA 1JHFA 2JUCA 1XGSA 4H0EA 4YEJA 3D1NI 4DYCA 3K4BA 2FRHA 3DBLB 4MLOA 3CCUI 2DMQA 2A5WA 1EJ9A 2O03A 2WV0A 3LMMA 3M7GA 1X1AA 2W4SA 3HOWJ 2R7UA 1FMWA 2WB1N 1IO2A 4BH9A 4PUSA 1VQ8I 2VONA 2K86A 2W25A 2J5OA 3MKWB 3H0DA 3G73A 2OA4A 4IPAA 4PK4A 4XQFA 2NVQJ 1SD6A 4AIHA 1YLFA 4NC6A 1ETOA 3HHGA 4OMYA 1ZHFA 1Z05A 1DPUA 1QPMA 1R23A 2Y0MA 3H3VK 2LKPA 3PNTA 3WU0A 4CO8A 3BR6A 2F5VA 2K7LA 2LH9A 5F0FA 4ZTJA 4HF2A 4UVBA 3RIRA 3SDBA 4IRGA 5HDNA 3CCVI 3TDUC 3SYTA 2LLKA 1JTXA 3OMYA 3LOCA 1IN4A 3RJPA 2G7HA 2E7XA 3MEXA 1E3OC 4KT6A 2W1OA 1MD0A 2F5CA 2CV2A 1ZRCA 2G9WA 3T8TA 1Z7LA 3BTIA 2KMUA 1YYVA 4B47A 2Q2EA 1T33A 4C2MJ 2D2WA 4BAYA 5LGUA 3GTLJ 4LK1F 2QEXI 1UJ8A 5IY5H 3G6EI 3OSGA 1MBKA 4XLHA 3ERMA 2K5CA 4BXXJ 2NNNA 2LBFB 2HQ5A 3I0TA 3GYHX 2RQPA 4AM3A 4A3MJ 2ZXJA 3GLXA 4OAYA 4I2OA 1FT9A 5D8LB 3SJMA 1BJAA 1WCMJ 2V79A 5J8FA 3S1MJ 3CUQA 4HAMA 4IZZA 3KCCA 3GUDA 2YPRA 3DEEA 3G1OA 1W7PA 2F6CA 1A6IA 2JTVA 1Z1DA 3B6AA 4EM2A 4YFXF 2KIQA 3CUQC 4XKBA 1ZG1A 4XK4A 4UB6C 4A6DA 1UAAA 3HZJA 3LSTA 1Z67A 4DZJA 1FBUA 3KP6A 3K6GA 4ON0A 2VKHA 3ZN1A 3ZQFA 1YJNI 3GTQJ 2Y31A 2MC3A 3JTHA 4W1UA 4NC7A 1IC8A 2HU9A 4KNYA 1YIOA 3DU5A 2Z5UA 2MGQA 4IKFA 2DBBA 5FKKA 1RKWA 2LTPA 3K0LA 1ZGAA 2M1BA 1X3UA 4NBQA 1CF7B 5GAEJ 1S7OA 2GOMA 4WF2A 3WG9A 2DJNA 4F7ZA 5LFAA 2MFZA 2QSGX 2F4MB 3DPUA 1KU7A 2R3SA 4PJMA 3KEOA 4PGGA 3GFIA 2Y9ZA 3V7CA 3GXOA 1FBSA 4ZDLA 1RR8C 2HQRA 1V4RA 1SC7A 4KISA 3DLAA 2VXZA 2WADA 2QBYB 5BOXA 3FF5A 2QQBA 4B09A 1IN6A 2K02A 3EQLF 3VDXA 3FBNB 1ON2A 3WTYC 3BCBA 3AG4H 2A61A 1NH3A 1JKPC 1Z0XA 3P9IA 1B6AA 2M9HA 4DZPA 5HNHA 1R5HA 1BI0A 1J2XA 1RR7A 4HX7A 5K5RA 4U0VA 1T98A 3VYRB 4DJAA 1IRXA 2FA5A 5LHGA 2UUZA 4XOPA 3I5UA 5GPCA 3J80K 1T2KA 2K9LA 2RNJA 5M5WJ 1ZREA 3G4SI 1UG0A 2GA2A 4KA4A 2DQRA 5EEAA 4B43A 4AC0A 4FTHA 3F8MA 3J81Z 2ETHA 5J8CA 4IHXA 3I4NJ 1JGSA 3HGYA 2QQ9A 1ZG5A 3PQKA 3TW7A 3S2HJ 1OQYA 4HA8A 4S05A 3PIPF 3CC7I 3DWLE 3S14J 3AAFA 2BOLA 2AO9A 2H1KA 2XAJA 5IOYA 2RGVA 2PMHA 3WE2A 4CCLA 3A0HC 2CYYA 4GFBA 3CCMI 2GM4A 1IXSB 4FETA 3R60A 4BJTA 2LKSA 4OWRB 1K79A 5EZHA 1B8IA 4IQJA 1FP2A 4YIRX 2QSHX 4U88A 4ANJA 1YIJI 2HPMA 2EZHA 2MD5A 4HBLA 1X1DA 4FE4A 1K61A 3Q3SA 4F55A 2KRHA 3PJRA 2Q2EB 3PNYA 4NQWA 1U0JA 5LRRA 3OYEA 4AIJA 1TC3C 1RPWA 4TV7A 1VQLI 2EFWA 3ZR8X 3U1KA 3RCOA 3LSRA 4KIBA 5FRNA 2KP6A 3CO7C 3L2QA 3IC7A 2QZ8A 2JT1A 1UHMA 2M8GX 2P8TA 4HV5A 2IS6A 4XLAA 3BTCA 1XS9A 2GXBA 2XAQA 1RUOA 1TTYA 3IUOA 3CUQB 1SFXA 2DJIA 3BWGA 5FGMA 2NAZA 4GXOA 3BG9A 1YI2I 1W7PB 1OCOH 1G2HA 4UUTA 2VE9A 3MZHA 2DMNA 2DA2A 1QHHD 2LMDA 1A31A 1T95A 2VKDA 3W6JB 1FSHA 3MVPA 1ULYA 1DQUA 3HRUA 2OF7A 2E34A 3PSFA 4DYRA 2NVUB 4BE2A 4QIWN 2JVHA 4Q4ZF 1NTCA 2VN2A 4XMYA 2QF7A 1BR4A 3S16J 3S3OA 3H5RA 4A93J 1FJLA 1ZRDA 4CCNA 2LK2A 4D7NA 1PVEA 5F08A 2BVMA 3ABMH 2B63J 5K7HA 3FHNA 4EATA 2NNYA 1A6QA 3T5XA 5L3FA 2OBPA 1P6RA 1TBXA 3OR1C 1BW6A 1FIAA 3WG7H 3CCLI 5E18F 3BY6A 1D8KA 4ZH4F 5FLVA 1SFOJ 1XMKA 3HOYJ 4CZZA 5E1ZB 1ZK8A 4P96A 4MTDA 1ZLKA 4UHTA 2TRTA 2O61A 3GTMJ 3FMSA 5BNGA 2ZXWH 4UXNA 1JJ8C 1POGA 2STTA 2K9MA 3VYSB 3OIPA 3L09A 1S5LC 5ILUA 2DN0A 3BJAA 1R7JA 3Q0WA 5D5XB 4WXHA 2O7OA 3WTXC 3HOUJ 1LPQA 5D4SA 2OZ6A 1JHHA 4L5IA 1SFKA 3CJTB 3CP8A 2KISA 2YUSA 4G12A 5B66C 3CJRB 4BQNA 2DAOA 2P5VA 3ONQA 1JKRC 2ZXIA 3EDPA 3RDIA 4J19A 3QP6A 2FOWA 3A01A 3KX2A 2NS8A 4BKXA 4E7KA 2JRMA 3JRHA 3WGIA 4ZZLA 3E5UA 1WJ5A 4ZDPA 1X2MA 2XHKA 3G1MA 3TW6A 1XGOA 2WY8Q 4HW0A 1GDTA 5F1RA 3ECOA 2E1CA 2VJ4A 3MZYA 3TP0A 3H5AA 4II2A 5C4JJ 1D1CA 4KFCA 1WZ2A 2KIUA 2IEKA 3ZQCA 5L3DA 3CP2A 4UVAA 1TL8A 3DEUA 3W2WA 5H2FC 1R1VA 1B8IB 4HX8A 1MJ9A 2COMA 1EH6A 1KGSA 1MMNA 4AIDA 2R7SA 5B5EC 1G3TA 2XAHA 4XLNF 2M5WA 4FQGA 1MDMA 1T39A 1Z9CA 3OS2A 1MMAA 5LEJA 2R7WA 4KICA 2KLOA 1D0YA 4DQ2A 4G7OF 5JLWA 3HRMA 4NQWB 1I27A 2R7QA 3ABTA 4RM2A 1I1SA 4M3BA 4O6JA 1OKRA 1T6SA 1USTA 3W2AA 1WQ2A 2K4JA 3DV8A 3KETA 1USSA 3OIOA 1DU6A 1D0XA 1ZYRF 4X1EA 4B3XA 2PI0A 2HXIA 1GUUA 1WJAA 2XPWA 3WTSC 5CQEA 2F4IA 1W7PD 2MH9A 3L00A 4LLLA 3QQAA 2DMUA 3WHCA 4F52A 1XSXA 4XBFA 3TMOA 3UNGC 2VC1A 3F72A 4IVNA 2IA2A 1DUXC 2X1DA 1IGNA 3JRGA 3U2RA 1AU7A 4E7LA 1SMYF 4NDLA 2LYCA 1HKQA 5D5UB 1P7IA 3CLQA 5CPRB 2CV1A 4YELA 1XD7A 4CA0A 4ESBA 4M3DA 3RTRA 3M9AA 3GVAA 3K70C 4OIPF 3KYCB 3M4OJ 1DP3A 1APLC 4E7ZA 2NS7A 5CLSA 1UMQA 3C1DA 3ZQ7A 4JYKA 2KRFA 1XX5A 2CGPA 2YX7A 3SFZA 5J47A 2DK5A 3L2UA 5HS9A 1FOXA 4IJAA 5D8KB 2V1XA 5GTHC 2AS5F 4KITB 2X4HA 4BYYA 3VYUB 3KZIC 1QA6A 1MH4A 3E6DA 4FE7A 4L5EA 3LQQA 2EBIA 2FNAA 3AKZA 1ON1A 2QVOA 2DDBA 2BW3A 3MFKA 2YS9A 5H6QA 3J7ZI 1QNTA 2MBFA 3CDIA 1XPXA 1CGPA 3HSRA 3A1YA 3MQ0A 4QLCU 3IH3A 2ECBA 1P4AA 5IPAA 2KIFA 4PJNA 3CCSI 2W57A 3M8FA 2PMUA 2P0WA 2R5YA 3I4PA 3S2DJ 1ZTRA 5BPIA 4R1HA 2ZJQF 1X1PA 4XORA 2OZUA 2IXSA 4ZDOA 3GTGJ 3QRFF 3P9KA 2IP2A 4R8HA 1FYMA 1HQCA 1RESA 3HG9A 4PGHA 4LB6B 1YQAA 1IRGA 1G3YA 4A2UA 4CUGA 2V9VA 2EWNA 3A01B 3ZCOA 1W5CC 4IOAF 1WJDA 3S32A 4CCJA 3BZKA 2LY1A 2B9SA 1ACIA 5EEHA 4BGDA 3M1CA 4HPQA 3H35A 3JCUC 3LNQA 5C3EJ 3MWMA 1EF4A 3OY9A 4IQ4A 1D8JA 4BJ5C 4W97A 2UWMA 3KYLA 1CQTA 4BU2A 2BV6A 4R79A 4BEHA 5EG0A 5L3BA 4NNJA 1GV2A 1W36C 1I5ZA 5LGTA 3JRIA 3Q9VA 3RI4A 4BY7J 1R1UA 1I50J 2HYGD 4QTRA 1D0ZA 4PDKA 3PO2J 3VOEA 2GXAA 5KNLA 1BI2A 1I39A 4I01A 2WAEA 5GAGJ 2EINH 2BY3A 1MDMB 2WAQA 3IWFA 3H36A 3JTGA 1VQMI 3ZQGA 2QQAA 2P81A 2A69F 1SANA 3DU6A 2OUMA 2R92J 2FBKA 2V4JC 5JVGF 2IAIA 5E17F 2HQNA 2R93J 3OOUA 4KJZA 2VQGA 3FXOA 2RC4A 5IP7J 1Z3XA 2YU9J 2AQFA 2DO7A 3I71A 5ICFA 3RKQA 5E3OA 3K4LA 5FFZA 1WI3A 3OYKA 5FLXZ 5LD2C 3TOAA 1TZLA 3H9GA 1K78A 2DA7A 1P9QC 2WAFA 3HBLA 5DYMA 3K4KA 4OIOF 1H9TA 3HHHA 2KJBA 1VQKI 2IS1A 2R7OA 1J0RA 1MBHA 1XG1A 4LG0A 4AYBN 1D5YA 3GMEA 3K69A 1GLNA 4KMUX 1KU3A 4HNTA 1RUNA 3F21A 3CMAI 2PN6A 2ACJA 1WFXA 2EZKA 3HYIA 2A05A 3ECHA 3FXMA 3HKZA 2XSDC 5LGNA 1JXSA 1HXDA 1OCCH 1LFBA 4EJTA 1ETQA 1HLVA 2KJCA 1IZ1A 3I56I 2RNGA 2OC6A 2DYRH 4C3HJ 5E1WA 3L2VA 5EEGA 4Y52J 4GGGA 2R7DA 1QRYA 1YG2A 1MGTA 1S9HA 3G3ZA 2MABA 4XLCA 1D3YA 4A3IJ 3E7LA 3MMYB 1MH3A 4DW6A 2KT0A 1BOBA 1V5GA 2JA5J 1S3JA 1LB2A 2M0CA 3ZN0A 1WRJA 2OQRA 4F93B 2IA0A 2A6TA 2A6EF 4EJUA 2D5VA 4A3LJ 3MN2A 3F9KA 2M30A 4GDFA 1LJ9A 2BW3B 2DODA 5K7FA 4LFUA 2PMZA 2V26A 3B73A 2B7EA 3HSEA 1N25A 1HDDC 2R7TA 2R5YB 3Q0UA 1YITI 4RB3C 2E1MC 3GFJA 1VFCA 2V9KA 2EV0A 2FBHA 3RKWA 3NARA 2CUZA 3PUFA 4WK8F 3KP4A 2HNHA 3COAC 3I55I 2TDXA 1SD7A 1XGNA 5D6FA 2VUMJ 4FISA 2QLZA 2PG4A 1JUPA 2VQLA 4GYIA 3E6MA 3H9QA 2FOKA 1AWCA 4X6AJ 1EH7A 1YO5C 4GYGA 2O0YA 2IS2A 3CCJI 4UUVA 3NAUA 1T0FA 2DOAA 2RVCA 3C2GA 4P9FA 4CCKA 4ESFA 3KZZA 1REPC 4I0AA 4IHTA 3DFGA 4IHWA 3ISPA 1G4DA 3FMQA 2V9PA 1T0FC 5J4VA 3E3VA 4ABZA 1K6OA 1NK3P 4BEHB 5EG0B 2HKXA 2P6TA 4IXAA 4EJWA 4KIFA 1LNWA 3TEDA 3FIWA 4N9HA 2EZIA 5DCMB 3DBHB 2VLAA 2XSJC 3E0JB 2CWEA 3DTKA 3FZVA 2DPDA 2EV6A 3G2BA 3DBRB 5EF6A 3ESWB 1O7LA 2ZXHA 2H6CA 1SVLA 2M4KA 1R4MB 3LAPA 4HLXA 3L1PA 3CC4I 2L9NA 4Y13A 1X4PA 3L2RA 4I76A 2DFIA 3WGGA 3V8LA 2F2EA 1FSEA 1R58A 2LFBA 3PM1A 1QO0D 4Y33A 4NHJA 4UVCA 2EA2A 2RQQA 4IL6C 1T56A 3QYBA 2DA6A 3NWTA 2EFPA 4D1QA 4ENNA 2ZMEA 3RPUA 5F1JA 2ZNYA 2HYJA 4JBAA 1G6NA 1T08B 2L7FP 3H3ZA 1K78B 2ZMEC 4XKWA 3WTUC 1TNTA 1X2NA 4ZYAA 2CS3A 4G7ZF 1B59A 2DA4A 2FD5A 1VQ4I 1KYWA 4AVZA 1KQ8A 4OAZA 5LHIA 1SAUA 3TDZC 4LG0B 2RDPA 1I6XA 3LAJA 2MYSA 1LDKB 1OR7A 2ZSHB 4LIVA 3IP4B 4RAYA 4UB8C 1K83J 1JE8A 3E6CC 3QPHA 3JRAA 3KEYA 5JI6A 3OV8A 1WJCA 2ZCWA 2DA5A 4AUXA 2GA1A 2VXDA 1ZR4A 2BYVE 2X85A 1BN5A 1C0WA 2W82A 1MJBA 2E2IJ 4L9JA 1QBJA 3CCQI 1RC9A 3T1BA 2M7AA 3EETA 5E8GA 2WBMA 2P7VB 3BJ6A 3BG5A 4YFNF 5JVTA 1VQ5I 2CQ7A 4B4CA 3HIFA 4LOCA 1U8BA 2G0EA 4XN3A 3WTTC 1R1TA 3M3YJ 1W5SA 1HCRA 5DDGA 2X48A 1FOWA 3H9JA 2R7ZJ 3PSIA 3TGNA 3DTIA 3WHBA 5K5OA 4GCVA 2YX4A 4DYQA 3S17J 1PUEE 3J81K 1MBGA 2XKOA 3LA2A 4CICA 1LFPA 3MCZA 3ULQB 1ETVA 2VE8A 1W4MA 3BR0A 2E1MB 4KDPA 5FD5A 4OIRF 3S3NA 5JLXA 1G3SA 4CZCA 3ZXSA 2JVGA 2MA3A 1BC7C 1TP4A 2MD0A 2HXOA 1MBEA 1FEXA 4IHSA 3J7YJ 4A5MA 3NQOA 3FK6A 2IRFG 5DM6F 2DFFA 2GOXB 3JW4A 3QODA 1J75A 4I99C 5ILSA 2A07F 1UZCA 2ME0A 4OMZA 2CUFA 1ITYA 3N05A 2NVTJ 3F8CA 3O6BB 3W6KB 2PFBA 3ABKH 1A04A 1MBJA 2Y9YA 3IKVA 5AIPA 4MEYF 3TBIA 1TT5B 4A0ZA 3CMYA 3K4NA 3RZDJ 1W36D 4UUSA 5HDGA 5LLQA 1XCBA 4S0HB 3R6SA 4HNVA 2ELHA 4HEA2 2DXIA 5DUIA 3R61A 3U21A 1IXRC 4RAFA 3HRTA 5K5QA 3DKWA 3GO5A 2Z9OA 2E1NA 4HZFA 4ZZDA 2OTJI 2KDZA 4CXFA 3RPQA 4L9VA 2MG4A 1Y0UA 4BJ6C 4HQEA 3ZRGA 1OJLA 4AD9A 1YS6A 2HPIA 3KP2A 5C4XJ 3RYPA 3TO7A 3D5SC 4C3IJ 1BL0A 3QAHA 1DGWY 2HOEA 3K2ZA 5F0HA 4E7HA 3I9V2 2E2JJ 1DPRA 3QP5A 3JRFA 2FMYA 1XDSA 1BIAA 3GTKJ 2Y0SN 1XGMA 2RKHA 2OD5A 4KT5C 1JT6A 3OYNA 2ZMEB 2C6YA 2CO5A 5FLMJ 1O3RA 2L2OA 1IG7A 5JHUA 5K7ZA 1V55H 3FM5A 4IOCF 3BLYA 5EJCA 2M7BA 5LHHA 4HRIA 1AA7A 3GTOJ 3K4MA 5FFXA 2JMWA 1P4WA 1S6LA 3DP7A 1YE9A 2XGXA 1WWXA 1NG7A 2DTZA 2FF4A 3M8EA 1KU9A 1V5FA 2VJ5A 4M3GA 1WGXA 2M4GA 4E4HA 2X6YA 4IF4A 4NC8A 2NRAC 1MIJA 1BIBA 2M45A 2UV1A 5DM7F 1P4XA 4HV6A 3D0SA 1IV8A 2FJ1A 4A3BJ 3S1RJ 3HB9A 3QPLA 4LIUA 3PIOF 4RM3A 3LSJA 1OMIA 2DYSH 3G1LA 2DQLA 2DLLA 1MZBA 2PEXA 4M73A 2RAEA 4V19K 2YU3A 4M74A 4BDZA 2X6WA 2O8KA 3DLLF 1QZYA 5IOZA 2XKPA 4G8XA 4B3AA 2HZDA 1JT0A 1K4TA 2Z16A 1ERDA 1E2XA 2ZFWA 4A3FJ 4FX4A 2HTSA
chains in the Genus database with same CATH topology
3OSFA 3SDGA 3BTLA 2HI3A 1BW5A 3Q0VA 1P7JA 2M34A 3PO3J 2LVSA 3ZQLA 1MH4A 4FE7A 4L5EA 2EBIA 1IV6A 1IDYA 2M2EA 2YS9A 3O8HA 5F04A 1FTTA 2HOSA 4I6ZA 1QVUA 3LSPA 1TWAJ 3IH3A 2ECBA 5IPAA 3B6CA 2JA6J 4A69C 3HOXJ 2R5YA 1B72B 3S2DJ 1PUFA 1ZTRA 3IV5A 5IP9J 2CU7A 1MSFC 5E3NA 1TWFJ 2ZB9A 3GTGJ 5IYDJ 1DU0A 1O4XA 2LKXA 1UHSA 1RESA 2XGDA 4UUSB 2WAQN 3A01B 5GPAA 3JRBA 1JUMA 1U9OA 2K9NA 1JKQC 4IEJA 3SFIA 4QSHA 3ZQHA 2GLOA 3D1NI 2CRGA 2ECCA 4DYCA 3LNQA 5EGOB 5DTDA 1VF9A 5C3EJ 1BA5A 4MLOA 1EF4A 2DMQA 4W97A 1CQTA 2EH3A 3HOWJ 1VI0A 1Z77A 5EG0A 2WB1N 1JTYA 1GV2A 4B1RA 2LP0A 2L0KA 2W48A 3JRIA 1NK2P 4CYCA 4BY7J 2QCOA 4QTRA 1I50J 5HODA 2NVQJ 1ETOA 3PO2J 1JUSA 1GT0C 3HKZN 3H3VK 2VKEA 3ZQGA 3S1QJ 2P81A 1JGGA 1SANA 3BR6A 2XRLA 4MIMA 5F0FA 2R92J 1Y1WJ 2LLKA 1JTXA 2IAIA 3LOCA 5FKLA 2R93J 3OOUA 1E3OC 5IP7J 1S7EA 2NVXJ 2YU9J 3RKQA 5E3OA 2DA1A 5IP6A 1WI3A 3BTIA 1FTZA 3F0CA 2EZLA 1T33A 4C2MJ 2WV1A 2X6OA 2DA7A 3HBLA 2X9DA 3GTLJ 2JN6A 1OCPA 1QVTA 3OSGA 1MBKA 1D5YA 1MBHA 1XG1A 4BXXJ 4AYBN 2HQ5A 1H8AC 2PMZN 5M5YJ 4A3MJ 2EZKA 9ANTA 2XSDC 3SJMA 1WCMJ 2O9LA 3S1MJ 3A03A 2ME6A 1LFBA 2N8GA 1ETQA 3G1OA 5J3LA 1HLVA 1AKHB 4V2GA 1A6IA 3B6AA 1R9TJ 1A5JA 3HDDA 4XK4A 4C3HJ 2COBA 4Y52J 2CUEA 1QRYA 4DZJA 4XIDA 4A3IJ 1Y1VJ 2ID6A 3GTQJ 3ZQFA 2Y31A 2Y30A 3E7LA 4W1UA 1MH3A 1AHDP 4A3DJ 1IC8A 4DW6A 2KT0A 1GVDA 2MGQA 2TCTA 2JA5J 5FKKA 4XRMA 1RKWA 2LTPA 4D5FA 2M0CA 1W0UA 2D5VA 4A3LJ 3MN2A 3FKIJ 3CDLA 5K7FA 2DJNA 2NVYJ 3RQIA 1HDDC 2VI6A 1IJWC 2R5YB 1HDPA 2Y9ZA 3Q0UA 1PUFB 5J1YA 1W0TA 3BG3A 3BR1A 3DEWA 1LFUP 4A3KJ 1VFCA 1RKTA 5E3MA 3NARA 2HOTA 1IRZA 2CJJA 1JKPC 2R5ZA 1Z0XA 2M9HA 4FISA 2VUMJ 4DZPA 2E1OA 1JUPA 4EEFG 1RR7A 4X6AJ 1WPKA 2L9RA 3BTJA 3O8GA 3GTJJ 4XICA 1ETYA 3NAUA 5GPCA 2XPUA 2DMPA 4MO7A 5FKNA 4IHWA 5M5WJ 4JX6A 4C3JJ 4ABZA 5EEAA 1NK3P 4AC0A 3HOZJ 4FTHA 5EG0B 4IHXA 2LD5A 3I4NJ 3HGYA 1F43A 3TEDA 3FIWA 3TW7A 2JA7J 2EZIA 4D5CA 3S2HJ 4CYCB 2ELKA 3S14J 1H88C 1IUFA 3RZOJ 2AO9A 2H1KA 5IOYA 2EQRA 5EF6A 1ITYA 4GFBA 3L1PA 4I76A 5M3FJ 2GM4A 2VPRA 2K9QA 2LFBA 3PM1A 2H8RA 1B8IA 5EZHA 3CCYA 3JRDA 1UG2A 3K2AA 3HOVJ 1T56A 2DA6A 2L7MP 2FX0A 1HF0A 5F1JA 2HYJA 2EZHA 4FE4A 1K61A 3Q3SA 2ID3A 2L7FP 1X2NA 1TC3C 1RPWA 2DA4A 2E19A 2FD5A 3LSRA 1JJ6C 4Y7NJ 2GBYA 2Y2ZA 2R0QC 3HM5A 1WH5A 4MFDA 2CQXA 2M8GX 4RDUA 2MSYA 1K83J 3BTCA 1XS9A 3JRAA 3UKGA 2XPVA 3BG9A 3JR9A 2DA5A 4AUXA 4UUTA 5C44J 4XRSG 1H89C 1G2HA 1ZR4A 5IYCJ 2DMNA 2DA2A 2OPTA 5FKMA 4IHVA 2E2IJ 3MVPA 4BBRJ 1HOMA 3IH4A 1MSEC 2OF7A 4DYRA 3BG5A 3FISA 4QIWN 1MNMC 1LE8A 4B4CA 1ZKGA 5F0CA 1NTCA 4LOCA 1ETXA 2QF7A 3S16J 4A93J 1U8BA 1FJLA 2G0EA 3M3YJ 1QPIA 3BR5A 1HCRA 1JKOC 2LK2A 3IH2A 2X48A 4D7NA 5F08A 4JX4A 5EZGA 2B63J 2R7ZJ 1I3QJ 5K7HA 1YRNA 2JWTA 3WHBA 4M3FA 2E2HJ 3VPRA 1BW6A 1FIAA 3CQZJ 4A3CJ 4DYQA 3S17J 1GV5A 3W6VA 1MBGA 5FLVA 1BJZA 1ETVA 3BR0A 2I10A 1SFOJ 5J1RA 3HOYJ 5J1UA 4BBSJ 2JA8J 5EDNA 1ZK8A 5JLXA 5EYRA 4A3GJ 1Q1VA 2TRTA 4M3EA 3GTMJ 2L7ZA 1RETA 5BNGA 4V2FA 2VKVA 3DCFA 2HXOA 1POGA 1MBEA 1VNDA 1MBFA 2XGEA 4JP0A 1JJ8C 1FEXA 2NOGA 4A3EJ 3FK6A 2DN0A 2R5ZB 3JRCA 3Q0WA 3JREA 2MW8A 1B72A 2O7OA 2ME0A 1OCTC 3HOUJ 2CUFA 2NVTJ 1FIPA 2K9SA 1ETKA 1F36A 1MBJA 2Y9YA 2YUSA 5DS9A 4G12A 3CMYA 3RZDJ 3QPSA 4UUSA 1ETWA 2DMTA 1JKRC 5FJ8J 4S0HB 4J19A 4HNVA 1U78A 3A01A 5FKOA 2NS8A 4BKXA 3GBGA 1XC5A 3S15J 3JRHA 4A3JJ 1X2MA 3G1MA 3TW6A 1ZQ3P 2KDZA 3K7AJ 5EGOA 3FK7A 2MG4A 2JJ7A 1GDTA 2IBDA 1OJLA 4RBOA 1ZGWA 3BR2A 2LY9A 5C4XJ 1TWHJ 3TP0A 3LSGA 3HEFA 3C2BA 4C3IJ 1BL0A 5F0HA 3BQYA 3H0GJ 5C4JJ 1ZR2A 3GTPJ 3ZOBA 2E2JJ 3ZQCA 2IEKA 5E3LA 4D7MA 4BY1J 3JRFA 5GP9A 2JK3A 1ENHA 1X58A 3GTKJ 1B8IB 2Y0SN 3I4MJ 1JT6A 4IHYA 3BT9A 4M6VA 2FQ4A 4MFEA 5M3MJ 1OFCX 5FLMJ 1IG7A 5K7ZA 2HOAA 5JLWA 4M3BA 3HGGA 2HDDA 4XRSA 1IDZA 3GTOJ 2JMWA 2DA3A 3OIOA 1DU6A 4X1EA 3BR3A 3BQZA 2HXIA 1GUUA 2XPWA 2DTZA 5F27A 4M3GA 2CQQA 1WGXA 2XB5A 3QQAA 2DMUA 1ORKA 3WHCA 2K40A 5M5XJ 1I6HJ 1TWCJ 2FJ1A 4A3BJ 1WH7A 3A02A 3S1RJ 2XB0X 3HB9A 3QPLA 3JRGA 1IGNA 1AU7A 2XGCA 3LSJA 4NDLA 3ZQIA 4FCYA 3G1LA 1P7IA 2RAEA 3S1NJ 3TP3A 1LE8B 4M3DA 5IYBJ 2LR8A 1AKHA 2O8KA 4JX5A 5IOZA 3M4OJ 1APLC 4B3AA 2NS7A 1TWGJ 1UMQA 3MKLA 1JT0A 4JYKA 2AHQA 1YRNB 1U9NA 4A3FJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSF A;  3SDG A;  3BTL A;  2HI3 A;  1BW5 A;  3Q0V A;  1P7J A;  2M34 A;  3PO3 J;  2LVS A;  3ZQL A;  1MH4 A;  4FE7 A;  4L5E A;  2EBI A;  1IV6 A;  1IDY A;  2M2E A;  2YS9 A;  3O8H A;  5F04 A;  1FTT A;  2HOS A;  4I6Z A;  1QVU A;  3LSP A;  1TWA J;  3IH3 A;  2ECB A;  5IPA A;  3B6C A;  2JA6 J;  4A69 C;  3HOX J;  2R5Y A;  1B72 B;  3S2D J;  1PUF A;  1ZTR A;  3IV5 A;  5IP9 J;  2CU7 A;  1MSF C;  5E3N A;  1TWF J;  2ZB9 A;  3GTG J;  5IYD J;  1DU0 A;  1O4X A;  2LKX A;  1UHS A;  1RES A;  2XGD A;  4UUS B;  2WAQ N;  3A01 B;  5GPA A;  3JRB A;  1JUM A;  1U9O A;  2K9N A;  1JKQ C;  4IEJ A;  3SFI A;  4QSH A;  3ZQH A;  2GLO A;  3D1N I;  2CRG A;  2ECC A;  4DYC A;  3LNQ A;  5EGO B;  5DTD A;  1VF9 A;  5C3E J;  1BA5 A;  4MLO A;  1EF4 A;  2DMQ A;  4W97 A;  1CQT A;  2EH3 A;  3HOW J;  1VI0 A;  1Z77 A;  5EG0 A;  2WB1 N;  1JTY A;  1GV2 A;  4B1R A;  2LP0 A;  2L0K A;  2W48 A;  3JRI A;  1NK2 P;  4CYC A;  4BY7 J;  2QCO A;  4QTR A;  1I50 J;  5HOD A;  2NVQ J;  1ETO A;  3PO2 J;  1JUS A;  1GT0 C;  3HKZ N;  3H3V K;  2VKE A;  3ZQG A;  3S1Q J;  2P81 A;  1JGG A;  1SAN A;  3BR6 A;  2XRL A;  4MIM A;  5F0F A;  2R92 J;  1Y1W J;  2LLK A;  1JTX A;  2IAI A;  3LOC A;  5FKL A;  2R93 J;  3OOU A;  1E3O C;  5IP7 J;  1S7E A;  2NVX J;  2YU9 J;  3RKQ A;  5E3O A;  2DA1 A;  5IP6 A;  1WI3 A;  3BTI A;  1FTZ A;  3F0C A;  2EZL A;  1T33 A;  4C2M J;  2WV1 A;  2X6O A;  2DA7 A;  3HBL A;  2X9D A;  3GTL J;  2JN6 A;  1OCP A;  1QVT A;  3OSG A;  1MBK A;  1D5Y A;  1MBH A;  1XG1 A;  4BXX J;  4AYB N;  2HQ5 A;  1H8A C;  2PMZ N;  5M5Y J;  4A3M J;  2EZK A;  9ANT A;  2XSD C;  3SJM A;  1WCM J;  2O9L A;  3S1M J;  3A03 A;  2ME6 A;  1LFB A;  2N8G A;  1ETQ A;  3G1O A;  5J3L A;  1HLV A;  1AKH B;  4V2G A;  1A6I A;  3B6A A;  1R9T J;  1A5J A;  3HDD A;  4XK4 A;  4C3H J;  2COB A;  4Y52 J;  2CUE A;  1QRY A;  4DZJ A;  4XID A;  4A3I J;  1Y1V J;  2ID6 A;  3GTQ J;  3ZQF A;  2Y31 A;  2Y30 A;  3E7L A;  4W1U A;  1MH3 A;  1AHD P;  4A3D J;  1IC8 A;  4DW6 A;  2KT0 A;  1GVD A;  2MGQ A;  2TCT A;  2JA5 J;  5FKK A;  4XRM A;  1RKW A;  2LTP A;  4D5F A;  2M0C A;  1W0U A;  2D5V A;  4A3L J;  3MN2 A;  3FKI J;  3CDL A;  5K7F A;  2DJN A;  2NVY J;  3RQI A;  1HDD C;  2VI6 A;  1IJW C;  2R5Y B;  1HDP A;  2Y9Z A;  3Q0U A;  1PUF B;  5J1Y A;  1W0T A;  3BG3 A;  3BR1 A;  3DEW A;  1LFU P;  4A3K J;  1VFC A;  1RKT A;  5E3M A;  3NAR A;  2HOT A;  1IRZ A;  2CJJ A;  1JKP C;  2R5Z A;  1Z0X A;  2M9H A;  4FIS A;  2VUM J;  4DZP A;  2E1O A;  1JUP A;  4EEF G;  1RR7 A;  4X6A J;  1WPK A;  2L9R A;  3BTJ A;  3O8G A;  3GTJ J;  4XIC A;  1ETY A;  3NAU A;  5GPC A;  2XPU A;  2DMP A;  4MO7 A;  5FKN A;  4IHW A;  5M5W J;  4JX6 A;  4C3J J;  4ABZ A;  5EEA A;  1NK3 P;  4AC0 A;  3HOZ J;  4FTH A;  5EG0 B;  4IHX A;  2LD5 A;  3I4N J;  3HGY A;  1F43 A;  3TED A;  3FIW A;  3TW7 A;  2JA7 J;  2EZI A;  4D5C A;  3S2H J;  4CYC B;  2ELK A;  3S14 J;  1H88 C;  1IUF A;  3RZO J;  2AO9 A;  2H1K A;  5IOY A;  2EQR A;  5EF6 A;  1ITY A;  4GFB A;  3L1P A;  4I76 A;  5M3F J;  2GM4 A;  2VPR A;  2K9Q A;  2LFB A;  3PM1 A;  2H8R A;  1B8I A;  5EZH A;  3CCY A;  3JRD A;  1UG2 A;  3K2A A;  3HOV J;  1T56 A;  2DA6 A;  2L7M P;  2FX0 A;  1HF0 A;  5F1J A;  2HYJ A;  2EZH A;  4FE4 A;  1K61 A;  3Q3S A;  2ID3 A;  2L7F P;  1X2N A;  1TC3 C;  1RPW A;  2DA4 A;  2E19 A;  2FD5 A;  3LSR A;  1JJ6 C;  4Y7N J;  2GBY A;  2Y2Z A;  2R0Q C;  3HM5 A;  1WH5 A;  4MFD A;  2CQX A;  2M8G X;  4RDU A;  2MSY A;  1K83 J;  3BTC A;  1XS9 A;  3JRA A;  3UKG A;  2XPV A;  3BG9 A;  3JR9 A;  2DA5 A;  4AUX A;  4UUT A;  5C44 J;  4XRS G;  1H89 C;  1G2H A;  1ZR4 A;  5IYC J;  2DMN A;  2DA2 A;  2OPT A;  5FKM A;  4IHV A;  2E2I J;  3MVP A;  4BBR J;  1HOM A;  3IH4 A;  1MSE C;  2OF7 A;  4DYR A;  3BG5 A;  3FIS A;  4QIW N;  1MNM C;  1LE8 A;  4B4C A;  1ZKG A;  5F0C A;  1NTC A;  4LOC A;  1ETX A;  2QF7 A;  3S16 J;  4A93 J;  1U8B A;  1FJL A;  2G0E A;  3M3Y J;  1QPI A;  3BR5 A;  1HCR A;  1JKO C;  2LK2 A;  3IH2 A;  2X48 A;  4D7N A;  5F08 A;  4JX4 A;  5EZG A;  2B63 J;  2R7Z J;  1I3Q J;  5K7H A;  1YRN A;  2JWT A;  3WHB A;  4M3F A;  2E2H J;  3VPR A;  1BW6 A;  1FIA A;  3CQZ J;  4A3C J;  4DYQ A;  3S17 J;  1GV5 A;  3W6V A;  1MBG A;  5FLV A;  1BJZ A;  1ETV A;  3BR0 A;  2I10 A;  1SFO J;  5J1R A;  3HOY J;  5J1U A;  4BBS J;  2JA8 J;  5EDN A;  1ZK8 A;  5JLX A;  5EYR A;  4A3G J;  1Q1V A;  2TRT A;  4M3E A;  3GTM J;  2L7Z A;  1RET A;  5BNG A;  4V2F A;  2VKV A;  3DCF A;  2HXO A;  1POG A;  1MBE A;  1VND A;  1MBF A;  2XGE A;  4JP0 A;  1JJ8 C;  1FEX A;  2NOG A;  4A3E J;  3FK6 A;  2DN0 A;  2R5Z B;  3JRC A;  3Q0W A;  3JRE A;  2MW8 A;  1B72 A;  2O7O A;  2ME0 A;  1OCT C;  3HOU J;  2CUF A;  2NVT J;  1FIP A;  2K9S A;  1ETK A;  1F36 A;  1MBJ A;  2Y9Y A;  2YUS A;  5DS9 A;  4G12 A;  3CMY A;  3RZD J;  3QPS A;  4UUS A;  1ETW A;  2DMT A;  1JKR C;  5FJ8 J;  4S0H B;  4J19 A;  4HNV A;  1U78 A;  3A01 A;  5FKO A;  2NS8 A;  4BKX A;  3GBG A;  1XC5 A;  3S15 J;  3JRH A;  4A3J J;  1X2M A;  3G1M A;  3TW6 A;  1ZQ3 P;  2KDZ A;  3K7A J;  5EGO A;  3FK7 A;  2MG4 A;  2JJ7 A;  1GDT A;  2IBD A;  1OJL A;  4RBO A;  1ZGW A;  3BR2 A;  2LY9 A;  5C4X J;  1TWH J;  3TP0 A;  3LSG A;  3HEF A;  3C2B A;  4C3I J;  1BL0 A;  5F0H A;  3BQY A;  3H0G J;  5C4J J;  1ZR2 A;  3GTP J;  3ZOB A;  2E2J J;  3ZQC A;  2IEK A;  5E3L A;  4D7M A;  4BY1 J;  3JRF A;  5GP9 A;  2JK3 A;  1ENH A;  1X58 A;  3GTK J;  1B8I B;  2Y0S N;  3I4M J;  1JT6 A;  4IHY A;  3BT9 A;  4M6V A;  2FQ4 A;  4MFE A;  5M3M J;  1OFC X;  5FLM J;  1IG7 A;  5K7Z A;  2HOA A;  5JLW A;  4M3B A;  3HGG A;  2HDD A;  4XRS A;  1IDZ A;  3GTO J;  2JMW A;  2DA3 A;  3OIO A;  1DU6 A;  4X1E A;  3BR3 A;  3BQZ A;  2HXI A;  1GUU A;  2XPW A;  2DTZ A;  5F27 A;  4M3G A;  2CQQ A;  1WGX A;  2XB5 A;  3QQA A;  2DMU A;  1ORK A;  3WHC A;  2K40 A;  5M5X J;  1I6H J;  1TWC J;  2FJ1 A;  4A3B J;  1WH7 A;  3A02 A;  3S1R J;  2XB0 X;  3HB9 A;  3QPL A;  3JRG A;  1IGN A;  1AU7 A;  2XGC A;  3LSJ A;  4NDL A;  3ZQI A;  4FCY A;  3G1L A;  1P7I A;  2RAE A;  3S1N J;  3TP3 A;  1LE8 B;  4M3D A;  5IYB J;  2LR8 A;  1AKH A;  2O8K A;  4JX5 A;  5IOZ A;  3M4O J;  1APL C;  4B3A A;  2NS7 A;  1TWG J;  1UMQ A;  3MKL A;  1JT0 A;  4JYK A;  2AHQ A;  1YRN B;  1U9N A;  4A3F J; 
#chains in the Genus database with same CATH topology
 3VFZ A;  3SDG A;  5IT3 A;  2DOE A;  3R4K A;  4I98 B;  2JZY A;  4I09 A;  4B8X A;  2LVS A;  3ZQL A;  1YFH A;  2L9V A;  5CJ9 A;  2ADU A;  2B0L A;  3CCE I;  4RB1 A;  2GZW A;  1IV6 A;  2M2E A;  1F9N A;  3HOT A;  3O8H A;  1RI7 A;  5FB2 A;  2YSR A;  3SZP A;  1FNN A;  1GVJ A;  2PBI A;  2HOS A;  1QVU A;  3L2C A;  1J7K A;  2R7R A;  1HA8 A;  3J7A O;  2KZV A;  1Y56 A;  2LSO A;  4A69 C;  1PJR A;  3B02 A;  3S8P A;  1IW7 F;  3VYT B;  3HPG A;  2VOO A;  5E20 A;  3V8J A;  2CQK A;  4RLQ A;  3V7R A;  5IP9 J;  4PFP A;  3JSP A;  1T38 A;  1Y39 A;  2A6H F;  3QYF A;  2IA1 A;  2QWW A;  2CV0 A;  3AG2 H;  3LSK A;  3T0Y A;  5E3N A;  2KRC A;  5IYD J;  2LKX A;  1LQ1 A;  4UUS B;  4EV0 A;  4XSX F;  3OYB A;  3LQR A;  2JSP A;  2K3P A;  3JRB A;  4QPQ A;  1K4S A;  4HSR A;  4IEJ A;  4X0G A;  2XDV A;  3SFI A;  1Z3Y A;  2F5F A;  4LG3 A;  2QYO A;  3ZQH A;  5ERI A;  2R7X A;  2XF7 A;  1FBQ A;  1S8N A;  3OOP A;  5J40 A;  1FWZ A;  1JI8 A;  2ECC A;  1VF9 A;  3QYE A;  1BA5 A;  3BCA A;  3D5L A;  2PJP A;  3KEQ A;  1N78 A;  4M6Y A;  1SD5 A;  3H5N A;  4H4K C;  1ODD A;  2EH3 A;  1OYW A;  4EM0 B;  3CTA A;  1JTY A;  4HQM A;  2FNP A;  2LP0 A;  1KQ9 A;  2WY7 Q;  3BG7 A;  4LIT A;  2HZT A;  2BY2 A;  2NYX A;  4CYC A;  4A6E A;  2K4B A;  5HOD A;  3QU3 A;  2DOF A;  2L02 A;  5KVR A;  1AOY A;  1GT0 C;  2Q1Z B;  4XKV A;  1R22 A;  4ETS A;  2ISZ A;  3S1Q J;  1HW5 A;  4MIM A;  1IXC A;  3C7J A;  4F3Q A;  4BS9 A;  2XAG A;  3WGH A;  3I64 A;  3WU1 B;  3LSH A;  4LD5 A;  3Q5F A;  1R36 A;  1ZAR A;  2BGC A;  3NWS A;  4UV9 A;  1S7E A;  3A2K A;  3RSN A;  3FX3 A;  3GLL A;  2EPF A;  4XSZ F;  1LKX A;  3F0C A;  3ZMU A;  2PX9 A;  2X6O A;  2Q0O A;  4HF1 A;  2WB1 A;  3LL7 A;  2JN6 A;  1OCP A;  3QU6 A;  2HR3 A;  5E79 C;  2IJL A;  2OJE D;  1FC3 A;  1XCV A;  3IWZ A;  3SQN A;  2FE3 A;  2ZO4 A;  5L3C A;  1H8A C;  2YR2 A;  5M5Y J;  3KFW X;  4MQV A;  3OR2 C;  9ANT A;  2O9L A;  1UCR A;  3PFI A;  2CG4 A;  2ZNZ A;  3GZN B;  2ME6 A;  3VSK A;  3H1C A;  3JAM Z;  5CKT A;  4V2G A;  3E5Q A;  1R9T J;  5HS8 A;  1A5J A;  1FMV A;  4KN7 X;  2HEO A;  3HDD A;  3RKX A;  4E6K G;  2QSF X;  2F4O B;  2CUE A;  1Z6T A;  1WJE A;  2JPC A;  4XID A;  2LDU A;  3GX4 X;  1YJW I;  1Y1V J;  2ID6 A;  3CUO A;  1R5I D;  4DBQ A;  1Y8Q B;  4A3D J;  5CYV A;  1Z91 A;  1GVD A;  2KIM A;  2TCT A;  3FXK A;  4BE1 A;  1IUY A;  5CVV A;  4E7S A;  4BUP A;  4L18 B;  1X19 A;  4D0P A;  3ZMD A;  1EKE A;  3FKI J;  3VB2 A;  2L7K A;  4WWC A;  3CO6 C;  3BZ6 A;  4DIQ A;  2VOD A;  2LF8 A;  1BI3 A;  2X1E A;  3LSM A;  4G9Y A;  4L9N A;  1R00 A;  2CW7 A;  4EJO A;  4NB5 A;  1A36 A;  3AG3 H;  2VI6 A;  1VQO I;  1IJW C;  1KON A;  1A35 A;  3I3L A;  2L4A A;  4M71 A;  1LUJ B;  2HKO A;  3W3C A;  5J1Y A;  1U5T A;  3BG3 A;  3FXQ A;  2V6C A;  2XF6 A;  3DEW A;  4A3K J;  2XAF A;  2ZSI B;  5E3M A;  2P5K A;  1IAW A;  4J00 A;  2VQH A;  1UEL B;  4CGZ A;  3VWB A;  3KLO A;  5DD8 A;  3IRQ A;  4CCO A;  3ZMT A;  2HVR A;  4AVP A;  4RGU A;  3SZG A;  2QA4 I;  2VJJ A;  3BPX A;  3RKY A;  4EJV A;  4XM3 A;  1VQ7 I;  3HTS B;  5KAI C;  4ZYE A;  3CJQ B;  3BPV A;  1WPK A;  3SXY A;  2XUB A;  3O8G A;  1KYZ A;  2KKO A;  4DBR A;  1ETY A;  4XIC A;  3GTJ J;  2OU2 A;  2DCE A;  4IO9 F;  2XPU A;  1YW7 A;  2HDC A;  5FKN A;  5FLX K;  1Z6R A;  2VPL A;  2ZFU A;  2EIJ H;  5ICC A;  4L5J A;  1ONV A;  1G3W A;  5BS6 A;  3HUG A;  1F43 A;  1KQ0 A;  3ZGK A;  1YX3 A;  2LNB A;  5JFR A;  1QQI A;  3FHZ A;  4ZJZ A;  4CYC B;  2Z99 A;  4ZC3 A;  3V8K A;  3EUK L;  4CSW A;  2CUJ A;  4EGZ A;  2XV4 S;  1X1C A;  1FPQ A;  1R5G A;  2RRE A;  3I59 A;  3K4C A;  5FRO A;  3OS1 A;  1W1W E;  1KZH A;  1SFU A;  1FLI A;  3BG6 A;  5B1A H;  3IL2 A;  2VPR A;  2K9Q A;  5M3F J;  3QOP A;  5DD4 A;  2E60 A;  3I53 A;  3JRD A;  3CF5 F;  2F48 A;  3HOV J;  2FX0 A;  1HF0 A;  1UFM A;  3KP3 A;  1O3S A;  3ABU A;  2DT5 A;  2ID3 A;  4RMN A;  2XIG A;  4HST A;  4MNU A;  2CQN A;  1G59 A;  1SVM A;  3F8B A;  5CQG A;  1QHG A;  2Y2Z A;  1LVK A;  3RQ4 A;  5IT9 K;  3DF8 A;  2PLY A;  4MFD A;  3HJE A;  2CQX A;  1S7A A;  4OIN F;  4HYE A;  4C2U A;  5ICE A;  2EK5 A;  4RDU A;  4KYW A;  4CYD A;  2FML A;  3ELK A;  3JR9 A;  5CVI A;  2BXY A;  4RS8 A;  3FXR A;  2DW4 A;  4Z2Y A;  4PSW A;  1FYK A;  5IYC J;  5FKM A;  2Z33 A;  2OPT A;  4ENK A;  2EFO A;  2HVS A;  4FAS D;  1PP8 F;  3P5J A;  4HLY A;  3J7A Y;  2L01 A;  4EGY A;  4BBR J;  3BRO A;  4Y4R A;  1HOM A;  3IH4 A;  2CFO A;  3FXJ A;  5H6R A;  1LE8 A;  1ZKG A;  5F0C A;  3S93 A;  1ETX A;  1OIS A;  2V1U A;  1ZG3 A;  4ITV A;  4L9T A;  2D1V A;  2FXA A;  3BR5 A;  3NEU A;  3IH2 A;  4RGS A;  2OV7 A;  1MW7 A;  5LRS A;  1MMD A;  1H0M A;  3DPL C;  1I3Q J;  2JWT A;  1MJA A;  3D5R C;  4RGX A;  2K27 A;  1V5E A;  2BHY A;  2E2H J;  5IT9 Z;  2V1N A;  4KUM A;  4PCQ A;  2DDA A;  3CQZ J;  3I54 A;  4HG2 A;  3C18 A;  4A3C J;  2XRO A;  5TIS C;  2VBY A;  1BJZ A;  4BE0 A;  4M6X A;  2HS5 A;  4UY8 I;  1HKS A;  3HOS A;  5J1U A;  3GFL A;  2MC4 A;  5EDN A;  5EYR A;  1U5T B;  1MNE A;  1Q1V A;  1SFE A;  4EQQ A;  2L7Z A;  1GHC A;  5KK1 A;  2HYF A;  1IF1 A;  2QGU A;  3LFK A;  3DCF A;  4L0Y B;  2E5Z A;  3GZ6 A;  1WSU A;  4M72 A;  2NOG A;  5DCF A;  1OLT A;  3K1P A;  1V3F A;  3JRE A;  4II3 A;  2I8D A;  3GZ5 A;  1DDN A;  2J5P A;  3DPT A;  3MKZ A;  2K9S A;  5B1B H;  1ETK A;  1F36 A;  2QM3 A;  2EIM H;  1ZAO A;  2GXG A;  3ZP5 A;  1XMA A;  3O2P E;  2GWR A;  2D45 A;  2ZJR F;  1ETW A;  2DMT A;  5FJ8 J;  4BDY A;  4HDV A;  3F6O A;  3OL4 A;  3GEZ A;  4J01 A;  4U0Y A;  1SEU A;  5FKO A;  3CDH A;  2DI3 A;  4PJ0 C;  3S15 J;  2W7N A;  3AG1 H;  3HUG B;  1T8I A;  1VQ6 I;  2L5Q A;  3CLO A;  2VAS A;  3CMM A;  1ZQ3 P;  3K7A J;  5EGO A;  2ZBK A;  3FK7 A;  4AWX B;  5HOO A;  3OYJ A;  3FM3 A;  3H92 A;  3LFU A;  2Y69 H;  3WOD F;  4RBO A;  3IHU A;  1TW2 A;  1XTA A;  4MEX F;  4XNF A;  2OCE A;  1FOK A;  1Y8R B;  3L7W A;  2H09 A;  1MND A;  3HXL A;  4YII A;  2WA0 A;  1N75 A;  3OL3 A;  3ZOB A;  3OYM A;  4BY1 J;  2IVM A;  3I59 B;  4D7M A;  5GP9 A;  2Z2S B;  5HVQ C;  1XDU A;  3SEQ A;  2JK3 A;  1ENH A;  1X58 A;  5K1Y A;  2PJR A;  4MHG A;  1M1E B;  3TQN A;  2VT3 A;  3BT9 A;  4M6V A;  4UV8 A;  4WX9 A;  2FQ4 A;  4MFE A;  5M3M J;  1GXQ A;  3HRS A;  1LEA A;  1S72 I;  1KU2 A;  5CVJ A;  4BXF A;  2HOA A;  4M9S A;  3OWT A;  5FO5 A;  1K6Y A;  4ESJ A;  2IT0 A;  2QKL B;  3OYI A;  2K85 A;  2ZJP F;  4XRS A;  2DU9 A;  2HDD A;  1IDZ A;  1OYI A;  2CW0 F;  3K9T A;  2IGO A;  3A4C A;  2DA3 A;  2E71 A;  4CDG A;  3K70 D;  3M1E A;  5BQT A;  3BR3 A;  2HWV A;  3BQZ A;  1HC8 A;  2AQE A;  5JHF A;  2V7F A;  2X6X A;  5F27 A;  1BC8 C;  1OR7 C;  4YG2 F;  1HBX G;  4DOZ A;  5KAF C;  2CQQ A;  1DGR M;  2XB5 A;  1I3A A;  2DFH A;  1W5T A;  4WCG A;  2W84 A;  2K40 A;  2OTL I;  1I6H J;  1ZGJ A;  3FXL A;  1PDN C;  3MD2 A;  5E8I A;  2G7U A;  2XGC A;  5HLG A;  4RB0 A;  4PJL A;  2CMP A;  2E7W A;  3ZQI A;  3OYG A;  4G6T B;  5HS7 A;  3PFY A;  2ELJ A;  1TQM A;  1PYV A;  3IAM 2;  1LE8 B;  2FQ3 A;  3KP5 A;  3S1N J;  2LR8 A;  2QUF A;  4K2E A;  3BP8 A;  1AKH A;  3S3M A;  4ZYD A;  4C9Y A;  5J4Y A;  3OYC A;  1F4K A;  4RA2 A;  1X3W B;  1VQ9 I;  3U9G A;  2AHQ A;  2F5D A;  4FT8 A;  1U9N A;  1XN7 A;  2BXZ A;  2BVL A;  2IS4 A;  1YW9 A;  2OQG A;  2WWY A;  2ZJ2 A;  5TGT A;  2M0M A;  3BTL A;  3CC2 I;  2HI3 A;  5TRD A;  1BW5 A;  2EIK H;  1YW8 A;  3PO3 J;  1IN8 A;  3P7N A;  2KZG A;  4IRH A;  5CVR A;  3CD6 I;  3KE2 A;  3OYA A;  1O7F A;  4C30 A;  1MMS A;  2EV5 A;  3KIO A;  5F04 A;  2VT2 A;  2DT7 B;  5D5V B;  1YTY A;  1H9G A;  3CJN A;  4XLP F;  1J09 A;  1TWA J;  2X51 A;  3FXU A;  4RAZ A;  2XAU A;  3TO9 A;  3EUA A;  3ZPL A;  1FY7 A;  1V54 H;  1I1G A;  2KHM A;  4CHU A;  4WXD A;  2KL4 A;  4CH7 A;  1PUF A;  2IGN A;  5LBQ A;  2NOJ B;  1MSF C;  2FU4 A;  1R4N B;  2IGM A;  2ZB9 A;  2H27 A;  4JQF A;  1DU0 A;  3DXJ F;  1IRF A;  1UHS A;  4Z6Y A;  1U3E M;  4AIK A;  2Z3Y A;  1YOV B;  1HST A;  2WAQ N;  3N4M A;  1XMX A;  2VBZ A;  3WU2 C;  1F5T A;  1OYY A;  2K9N A;  4BHP A;  4QSH A;  3OIQ A;  5HNF A;  3LA7 A;  2GLO A;  1TQI A;  4BXU A;  3HSF A;  4PSX A;  2CRG A;  2LOO A;  4LMY A;  3PUB A;  5DTD A;  5EGO B;  1NHA A;  3HTU A;  4S04 A;  2DT6 A;  1EA3 A;  3ASN H;  1RIO H;  2D1H A;  2AXL A;  5L3E A;  1QGP A;  2P4W A;  4JOM A;  1VI0 A;  1WKM A;  1Z77 A;  2I5U A;  2W24 A;  3GF2 A;  2OCC H;  4B1R A;  2IPQ X;  1K7A A;  2L0K A;  2W48 A;  1NK2 P;  3F6V A;  3OS0 A;  2PJR B;  2QCO A;  1D1B A;  2DK8 A;  1SD4 A;  1JUS A;  3LWF A;  4BQQ A;  1WJF A;  3HKZ N;  2VKE A;  3X2Q H;  2A68 F;  1WVR A;  2DFE A;  1JGG A;  4HDU A;  2XRL A;  1TNS A;  1Y1W J;  2Z1D A;  4I7H A;  4Q5S F;  1E3P A;  5HLH A;  1OCZ H;  5FKL A;  4RGR A;  3IKT A;  4ZTF A;  4FX0 A;  2NVX J;  1RZ4 A;  3J80 Z;  1B9M A;  1TLH B;  1ZLJ A;  2DA1 A;  2X0L A;  4B44 A;  5IP6 A;  1FTZ A;  5D5W B;  2EZL A;  2WV1 A;  1LDD A;  4BHC A;  3W2V A;  2FSW A;  3VOD A;  2DTR A;  2X9D A;  1XSD A;  2P5L C;  1X1B A;  1QVT A;  2JRT A;  3MZ8 A;  2JSC A;  4XLE A;  3S2W A;  3SEZ A;  1F1Z A;  4N4N B;  4DGW B;  2H1L A;  3OYD A;  3CCR I;  2PMZ N;  4PFO A;  3KLN A;  1YS7 A;  4ENM A;  2HTJ A;  2EFQ A;  2GAU A;  2F5E A;  3FDY A;  4ASN A;  3A03 A;  2N8G A;  5J3L A;  2LG4 A;  2KDO A;  2P6S A;  3R0J A;  5ICG A;  1AKH B;  1E0E A;  2MLK A;  2VQC A;  3CF2 A;  1D1A A;  5LEK A;  3G71 I;  4Y3O A;  2COB A;  2H94 A;  1LVA A;  3E5X A;  4RB2 C;  3F3X A;  2VOP A;  4OU0 A;  2Y30 A;  1AHD P;  3P9C A;  4D9J A;  4HX4 A;  1LDJ A;  4KN4 X;  2RV8 A;  4XON A;  3AL0 C;  4XRM A;  4M9Z A;  4D5F A;  2E35 A;  1W0U A;  2MH2 A;  2FUG 2;  2H6B A;  4AYB A;  3CDL A;  1R71 A;  2UXN A;  3E6B A;  2NVY J;  2EB7 A;  1FOY A;  3K10 A;  5AIQ A;  2UXX A;  3RQI A;  3ASO H;  2JQ7 A;  3EYY A;  3F8F A;  2L54 A;  4LLN A;  2PQ8 A;  2VJI A;  1EH8 A;  2BE5 F;  1HDP A;  2XVC A;  3QWL A;  2O6G E;  4G7H F;  4XKC A;  4Y15 A;  1W0T A;  1PUF B;  5A2Q K;  1UB9 A;  1SVO A;  2L3D A;  3BR1 A;  1XSV A;  1LFU P;  4I02 A;  5ED4 A;  1OPC A;  1YJ9 I;  3FKJ A;  1X3Z B;  1RKT A;  4NUB A;  2HOT A;  1IRZ A;  4U0W A;  3IRR A;  1G8X A;  3EPZ A;  3QPT A;  2CJJ A;  5AON A;  2R5Z A;  4GO1 A;  4BL0 B;  2E1O A;  5GAH J;  4U7D A;  1ZH5 A;  2KFD A;  4EEF G;  1QU3 A;  4U7B A;  6PAX A;  2L9R A;  3BTJ A;  1SAX A;  4BHB A;  1PP7 U;  2LRD A;  4E7J A;  2HQA A;  2DMP A;  4GRI A;  3OYF A;  4MO7 A;  4JX6 A;  2KQR A;  4LJZ F;  4C3J J;  5J6X A;  3TOB A;  3HOZ J;  3V7S A;  3NRV A;  5HDK A;  2LD5 A;  4XN0 A;  5GTI C;  1TQP A;  2JA7 J;  4D5C A;  3BDD A;  2VL8 A;  3EUH A;  5A2Q Z;  4OIQ F;  5FRM A;  2HDW A;  3RPU D;  2ELK A;  1YHQ I;  2IW5 A;  1H88 C;  4FHT A;  1TW3 A;  1YX5 A;  3EUH C;  1IUF A;  3REO A;  5DUK A;  3RZO J;  4N0B A;  1O57 A;  3JAM K;  4UNO A;  2EQR A;  1HKT A;  2LC2 A;  3ZMZ A;  4L0Z B;  2UZK A;  4PJJ A;  4BAC A;  2H8R A;  4I0B A;  2O3F A;  3CCY A;  4U87 A;  1UG2 A;  3K2A A;  2L7M P;  2M3A A;  1D5V A;  2V6E A;  4Q47 A;  1VZ0 A;  4C2T A;  3F23 A;  3UR3 C;  1ZN2 A;  2W85 A;  3DQV C;  4N4O B;  1N77 A;  3PL8 A;  2EJR A;  2JUG A;  3M8J A;  2E19 A;  1JJ6 C;  2GQQ A;  3O3K A;  4Y7N J;  2GBY A;  2CFX A;  2R0Q C;  3HM5 A;  1WH5 A;  4BQO A;  2NXN B;  4XRF A;  3TKY A;  4A0Y A;  3KYD B;  2EIL H;  2M87 A;  2MSY A;  4MGR A;  4EMS A;  3UKG A;  1TT0 A;  2XPV A;  3ROU A;  4XLF A;  3CME I;  4LGW A;  4XR6 A;  2ZKZ A;  5C44 J;  1H89 C;  4XRS G;  2VBW A;  4IHV A;  2KPM A;  3WTV C;  1R49 A;  5DV5 A;  1FZP B;  2RN7 A;  3DKY A;  3KZY A;  1BI1 A;  4E7I A;  1WJB A;  4P5O A;  4P1W A;  2BY1 A;  2ESN A;  1MSE C;  2QKM B;  1VQP I;  3AL0 B;  4ZYG A;  3FIS A;  1MNM C;  4LLG F;  1P92 A;  5DEQ A;  3TO6 A;  5E1X A;  2QQ8 A;  5F64 A;  1KA8 A;  5L3G A;  2BEO A;  4A0X A;  1J59 A;  1MKM A;  3FBI B;  1QPI A;  2R4G A;  1JKO C;  5F6F A;  4AU7 A;  2OAZ A;  5BMZ A;  1P2F A;  4JX4 A;  5EZG A;  1YRN A;  2IGK A;  4M3F A;  3MKY B;  1VTN C;  3GWZ A;  4BQA A;  3VPR A;  2JA2 A;  2BZT A;  3V4G A;  1QZE A;  4E70 A;  1GV5 A;  1WHU A;  3W6V A;  3GFM A;  1LEB A;  2I10 A;  5J1R A;  4BBS J;  2JA8 J;  2HGC A;  4BNC A;  4A3G J;  1U6G A;  2CW8 A;  2Y75 A;  3CES A;  5TJJ A;  4M3E A;  2R7V A;  1RET A;  1U5T C;  3SHF A;  4Q48 A;  4V2F A;  2VKV A;  1HW1 A;  4DNC A;  1VND A;  4RAG A;  1MBF A;  2O5R A;  2EFN A;  2XGE A;  4JP0 A;  1VQN I;  4MQ9 F;  4KIG A;  3VEP A;  4A3E J;  5D6E A;  1J5Y A;  4CCM A;  2R5Z B;  2CSO A;  3JRC A;  1ZEL A;  1S29 A;  2MW8 A;  4HOB A;  1B72 A;  2O8X A;  1OCT C;  4M9X A;  1ZRF A;  3FWE A;  2BBY A;  4G94 A;  2P7C B;  1FIP A;  1GXP A;  1BR2 A;  4IX7 A;  2VB6 A;  2JPB A;  3FMR A;  3KPH A;  1WI9 A;  2HVQ A;  3U1D A;  1B9N A;  5DS9 A;  2XC7 A;  5H20 A;  1IN7 A;  3N97 A;  3OYH A;  3QPS A;  3T8R A;  3IAS 2;  3Q9S A;  2E36 A;  3AFH A;  2LRE A;  1U78 A;  3PQJ A;  1Y6I A;  1OCR H;  4IRI A;  5D4R A;  3ABL H;  3GBG A;  1XC5 A;  1O3Q A;  1Y0N A;  2GIV A;  3BC8 A;  3E1S A;  4A3J J;  2VC0 A;  3GCM A;  3GW2 A;  1SMT A;  4Y17 A;  2JJ7 A;  2XRN A;  3ERE D;  2AXT C;  2IBD A;  2XF5 A;  1ZGW A;  3BR2 A;  2LY9 A;  4YIF A;  2BY0 A;  3ZQQ A;  1TWH J;  2BHZ A;  3LSG A;  3HEF A;  3C2B A;  3BQY A;  3H0G J;  3TL4 X;  2WTE A;  1Q1H A;  1NG6 A;  1STZ A;  1ZR2 A;  1EV7 A;  3GTP J;  1FP1 D;  5E3L A;  4G6D A;  1U2W A;  5DCM A;  4O3M A;  2GIZ A;  4LK0 F;  3JSO A;  4HNU A;  4G6Q A;  4JK1 X;  3I4M J;  4MTE A;  4IHY A;  4HF0 A;  1BBY A;  2E5N A;  3SZT A;  1OFC X;  1E3H A;  1J9I A;  2NS0 A;  2W00 A;  4KMF A;  4YRV A;  1E17 A;  4RLF A;  5HLI A;  2A5Y B;  3LSI A;  2L4M A;  3BJO A;  3PNV A;  3HGG A;  3CZ6 A;  1R6R A;  3HL2 A;  4F92 B;  3WTZ A;  3ZMS A;  5B3S H;  2WC2 A;  5KCM A;  3L9F A;  4EM1 A;  1HSJ A;  1UHW A;  2ZC2 A;  1ORK A;  3HC7 A;  2CH0 A;  5ILV A;  5M5X J;  5JR3 A;  1TWC J;  3L2W A;  3LA3 A;  1WH7 A;  5GAD J;  3A02 A;  2LBF A;  2XB0 X;  3WE3 A;  4O5V A;  3M07 A;  2Y0S A;  3RYR A;  4F91 B;  2ICW G;  3DKX A;  4FCY A;  2ISY A;  1DP7 P;  2A3S A;  1L3L A;  2ESH A;  4ZYH A;  3KP7 A;  3TP3 A;  1RRJ A;  3HPH A;  5IYB J;  1MMG A;  1X4O A;  3VSL A;  3H3U A;  4JX5 A;  2FEZ A;  3DTE A;  3F8N A;  4LB5 A;  2STW A;  1TWG J;  1XB4 A;  3MKL A;  2L9S A;  3E97 A;  3K4J A;  4B48 A;  4A12 A;  4WXC A;  1YRN B;  4EVI A;  3K1M A;  1BM9 A;  5CVU A;  5FD6 A;  3BOQ A;  1RNL A;  3EYI A;  1FX7 A;  2LY2 A;  2XAS A;  3OSF A;  2HFH A;  4QWQ A;  2V1D A;  4XOT A;  3F22 A;  3Q0V A;  2Q8K A;  1P7J A;  2M34 A;  1O3T A;  4PZJ A;  2EA4 A;  3V42 A;  1CF7 A;  1Z21 A;  4YFK F;  2H8W A;  3ZMV A;  1IDY A;  1BOA A;  2Y48 A;  1FTT A;  1Z7U A;  3WTW C;  4QPO A;  4I6Z A;  1B1B A;  3LSP A;  2MLG A;  1IN5 A;  2FBI A;  3B6C A;  2VIX A;  2JA6 J;  3OYL A;  1B4A A;  3I58 A;  3HOX J;  1B72 B;  1L0O C;  4OOI A;  4A5N A;  3ML6 A;  5HLT A;  3R0A A;  3IV5 A;  2X1C A;  2CU7 A;  3QOE A;  1FYL A;  5KHD A;  1HW2 A;  3C3W A;  1TWF J;  2QBY A;  2M8E A;  3C2H A;  3K1N A;  2LF7 A;  1QZZ A;  3MAJ A;  4N9I A;  2XGD A;  1O4X A;  2R7F A;  3BZC A;  4ENJ A;  1U8R A;  3A0B C;  4P9U A;  4P55 A;  5BPD A;  5GPA A;  1BR1 A;  1JUM A;  1U9O A;  2QEN A;  1JKQ C;  2K3F A;  4XL9 A;  2DPU A;  2VBX A;  1JHF A;  2JUC A;  1XGS A;  4H0E A;  4YEJ A;  3D1N I;  4DYC A;  3K4B A;  2FRH A;  3DBL B;  4MLO A;  3CCU I;  2DMQ A;  2A5W A;  1EJ9 A;  2O03 A;  2WV0 A;  3LMM A;  3M7G A;  1X1A A;  2W4S A;  3HOW J;  2R7U A;  1FMW A;  2WB1 N;  1IO2 A;  4BH9 A;  4PUS A;  1VQ8 I;  2VON A;  2K86 A;  2W25 A;  2J5O A;  3MKW B;  3H0D A;  3G73 A;  2OA4 A;  4IPA A;  4PK4 A;  4XQF A;  2NVQ J;  1SD6 A;  4AIH A;  1YLF A;  4NC6 A;  1ETO A;  3HHG A;  4OMY A;  1ZHF A;  1Z05 A;  1DPU A;  1QPM A;  1R23 A;  2Y0M A;  3H3V K;  2LKP A;  3PNT A;  3WU0 A;  4CO8 A;  3BR6 A;  2F5V A;  2K7L A;  2LH9 A;  5F0F A;  4ZTJ A;  4HF2 A;  4UVB A;  3RIR A;  3SDB A;  4IRG A;  5HDN A;  3CCV I;  3TDU C;  3SYT A;  2LLK A;  1JTX A;  3OMY A;  3LOC A;  1IN4 A;  3RJP A;  2G7H A;  2E7X A;  3MEX A;  1E3O C;  4KT6 A;  2W1O A;  1MD0 A;  2F5C A;  2CV2 A;  1ZRC A;  2G9W A;  3T8T A;  1Z7L A;  3BTI A;  2KMU A;  1YYV A;  4B47 A;  2Q2E A;  1T33 A;  4C2M J;  2D2W A;  4BAY A;  5LGU A;  3GTL J;  4LK1 F;  2QEX I;  1UJ8 A;  5IY5 H;  3G6E I;  3OSG A;  1MBK A;  4XLH A;  3ERM A;  2K5C A;  4BXX J;  2NNN A;  2LBF B;  2HQ5 A;  3I0T A;  3GYH X;  2RQP A;  4AM3 A;  4A3M J;  2ZXJ A;  3GLX A;  4OAY A;  4I2O A;  1FT9 A;  5D8L B;  3SJM A;  1BJA A;  1WCM J;  2V79 A;  5J8F A;  3S1M J;  3CUQ A;  4HAM A;  4IZZ A;  3KCC A;  3GUD A;  2YPR A;  3DEE A;  3G1O A;  1W7P A;  2F6C A;  1A6I A;  2JTV A;  1Z1D A;  3B6A A;  4EM2 A;  4YFX F;  2KIQ A;  3CUQ C;  4XKB A;  1ZG1 A;  4XK4 A;  4UB6 C;  4A6D A;  1UAA A;  3HZJ A;  3LST A;  1Z67 A;  4DZJ A;  1FBU A;  3KP6 A;  3K6G A;  4ON0 A;  2VKH A;  3ZN1 A;  3ZQF A;  1YJN I;  3GTQ J;  2Y31 A;  2MC3 A;  3JTH A;  4W1U A;  4NC7 A;  1IC8 A;  2HU9 A;  4KNY A;  1YIO A;  3DU5 A;  2Z5U A;  2MGQ A;  4IKF A;  2DBB A;  5FKK A;  1RKW A;  2LTP A;  3K0L A;  1ZGA A;  2M1B A;  1X3U A;  4NBQ A;  1CF7 B;  5GAE J;  1S7O A;  2GOM A;  4WF2 A;  3WG9 A;  2DJN A;  4F7Z A;  5LFA A;  2MFZ A;  2QSG X;  2F4M B;  3DPU A;  1KU7 A;  2R3S A;  4PJM A;  3KEO A;  4PGG A;  3GFI A;  2Y9Z A;  3V7C A;  3GXO A;  1FBS A;  4ZDL A;  1RR8 C;  2HQR A;  1V4R A;  1SC7 A;  4KIS A;  3DLA A;  2VXZ A;  2WAD A;  2QBY B;  5BOX A;  3FF5 A;  2QQB A;  4B09 A;  1IN6 A;  2K02 A;  3EQL F;  3VDX A;  3FBN B;  1ON2 A;  3WTY C;  3BCB A;  3AG4 H;  2A61 A;  1NH3 A;  1JKP C;  1Z0X A;  3P9I A;  1B6A A;  2M9H A;  4DZP A;  5HNH A;  1R5H A;  1BI0 A;  1J2X A;  1RR7 A;  4HX7 A;  5K5R A;  4U0V A;  1T98 A;  3VYR B;  4DJA A;  1IRX A;  2FA5 A;  5LHG A;  2UUZ A;  4XOP A;  3I5U A;  5GPC A;  3J80 K;  1T2K A;  2K9L A;  2RNJ A;  5M5W J;  1ZRE A;  3G4S I;  1UG0 A;  2GA2 A;  4KA4 A;  2DQR A;  5EEA A;  4B43 A;  4AC0 A;  4FTH A;  3F8M A;  3J81 Z;  2ETH A;  5J8C A;  4IHX A;  3I4N J;  1JGS A;  3HGY A;  2QQ9 A;  1ZG5 A;  3PQK A;  3TW7 A;  3S2H J;  1OQY A;  4HA8 A;  4S05 A;  3PIP F;  3CC7 I;  3DWL E;  3S14 J;  3AAF A;  2BOL A;  2AO9 A;  2H1K A;  2XAJ A;  5IOY A;  2RGV A;  2PMH A;  3WE2 A;  4CCL A;  3A0H C;  2CYY A;  4GFB A;  3CCM I;  2GM4 A;  1IXS B;  4FET A;  3R60 A;  4BJT A;  2LKS A;  4OWR B;  1K79 A;  5EZH A;  1B8I A;  4IQJ A;  1FP2 A;  4YIR X;  2QSH X;  4U88 A;  4ANJ A;  1YIJ I;  2HPM A;  2EZH A;  2MD5 A;  4HBL A;  1X1D A;  4FE4 A;  1K61 A;  3Q3S A;  4F55 A;  2KRH A;  3PJR A;  2Q2E B;  3PNY A;  4NQW A;  1U0J A;  5LRR A;  3OYE A;  4AIJ A;  1TC3 C;  1RPW A;  4TV7 A;  1VQL I;  2EFW A;  3ZR8 X;  3U1K A;  3RCO A;  3LSR A;  4KIB A;  5FRN A;  2KP6 A;  3CO7 C;  3L2Q A;  3IC7 A;  2QZ8 A;  2JT1 A;  1UHM A;  2M8G X;  2P8T A;  4HV5 A;  2IS6 A;  4XLA A;  3BTC A;  1XS9 A;  2GXB A;  2XAQ A;  1RUO A;  1TTY A;  3IUO A;  3CUQ B;  1SFX A;  2DJI A;  3BWG A;  5FGM A;  2NAZ A;  4GXO A;  3BG9 A;  1YI2 I;  1W7P B;  1OCO H;  1G2H A;  4UUT A;  2VE9 A;  3MZH A;  2DMN A;  2DA2 A;  1QHH D;  2LMD A;  1A31 A;  1T95 A;  2VKD A;  3W6J B;  1FSH A;  3MVP A;  1ULY A;  1DQU A;  3HRU A;  2OF7 A;  2E34 A;  3PSF A;  4DYR A;  2NVU B;  4BE2 A;  4QIW N;  2JVH A;  4Q4Z F;  1NTC A;  2VN2 A;  4XMY A;  2QF7 A;  1BR4 A;  3S16 J;  3S3O A;  3H5R A;  4A93 J;  1FJL A;  1ZRD A;  4CCN A;  2LK2 A;  4D7N A;  1PVE A;  5F08 A;  2BVM A;  3ABM H;  2B63 J;  5K7H A;  3FHN A;  4EAT A;  2NNY A;  1A6Q A;  3T5X A;  5L3F A;  2OBP A;  1P6R A;  1TBX A;  3OR1 C;  1BW6 A;  1FIA A;  3WG7 H;  3CCL I;  5E18 F;  3BY6 A;  1D8K A;  4ZH4 F;  5FLV A;  1SFO J;  1XMK A;  3HOY J;  4CZZ A;  5E1Z B;  1ZK8 A;  4P96 A;  4MTD A;  1ZLK A;  4UHT A;  2TRT A;  2O61 A;  3GTM J;  3FMS A;  5BNG A;  2ZXW H;  4UXN A;  1JJ8 C;  1POG A;  2STT A;  2K9M A;  3VYS B;  3OIP A;  3L09 A;  1S5L C;  5ILU A;  2DN0 A;  3BJA A;  1R7J A;  3Q0W A;  5D5X B;  4WXH A;  2O7O A;  3WTX C;  3HOU J;  1LPQ A;  5D4S A;  2OZ6 A;  1JHH A;  4L5I A;  1SFK A;  3CJT B;  3CP8 A;  2KIS A;  2YUS A;  4G12 A;  5B66 C;  3CJR B;  4BQN A;  2DAO A;  2P5V A;  3ONQ A;  1JKR C;  2ZXI A;  3EDP A;  3RDI A;  4J19 A;  3QP6 A;  2FOW A;  3A01 A;  3KX2 A;  2NS8 A;  4BKX A;  4E7K A;  2JRM A;  3JRH A;  3WGI A;  4ZZL A;  3E5U A;  1WJ5 A;  4ZDP A;  1X2M A;  2XHK A;  3G1M A;  3TW6 A;  1XGO A;  2WY8 Q;  4HW0 A;  1GDT A;  5F1R A;  3ECO A;  2E1C A;  2VJ4 A;  3MZY A;  3TP0 A;  3H5A A;  4II2 A;  5C4J J;  1D1C A;  4KFC A;  1WZ2 A;  2KIU A;  2IEK A;  3ZQC A;  5L3D A;  3CP2 A;  4UVA A;  1TL8 A;  3DEU A;  3W2W A;  5H2F C;  1R1V A;  1B8I B;  4HX8 A;  1MJ9 A;  2COM A;  1EH6 A;  1KGS A;  1MMN A;  4AID A;  2R7S A;  5B5E C;  1G3T A;  2XAH A;  4XLN F;  2M5W A;  4FQG A;  1MDM A;  1T39 A;  1Z9C A;  3OS2 A;  1MMA A;  5LEJ A;  2R7W A;  4KIC A;  2KLO A;  1D0Y A;  4DQ2 A;  4G7O F;  5JLW A;  3HRM A;  4NQW B;  1I27 A;  2R7Q A;  3ABT A;  4RM2 A;  1I1S A;  4M3B A;  4O6J A;  1OKR A;  1T6S A;  1UST A;  3W2A A;  1WQ2 A;  2K4J A;  3DV8 A;  3KET A;  1USS A;  3OIO A;  1DU6 A;  1D0X A;  1ZYR F;  4X1E A;  4B3X A;  2PI0 A;  2HXI A;  1GUU A;  1WJA A;  2XPW A;  3WTS C;  5CQE A;  2F4I A;  1W7P D;  2MH9 A;  3L00 A;  4LLL A;  3QQA A;  2DMU A;  3WHC A;  4F52 A;  1XSX A;  4XBF A;  3TMO A;  3UNG C;  2VC1 A;  3F72 A;  4IVN A;  2IA2 A;  1DUX C;  2X1D A;  1IGN A;  3JRG A;  3U2R A;  1AU7 A;  4E7L A;  1SMY F;  4NDL A;  2LYC A;  1HKQ A;  5D5U B;  1P7I A;  3CLQ A;  5CPR B;  2CV1 A;  4YEL A;  1XD7 A;  4CA0 A;  4ESB A;  4M3D A;  3RTR A;  3M9A A;  3GVA A;  3K70 C;  4OIP F;  3KYC B;  3M4O J;  1DP3 A;  1APL C;  4E7Z A;  2NS7 A;  5CLS A;  1UMQ A;  3C1D A;  3ZQ7 A;  4JYK A;  2KRF A;  1XX5 A;  2CGP A;  2YX7 A;  3SFZ A;  5J47 A;  2DK5 A;  3L2U A;  5HS9 A;  1FOX A;  4IJA A;  5D8K B;  2V1X A;  5GTH C;  2AS5 F;  4KIT B;  2X4H A;  4BYY A;  3VYU B;  3KZI C;  1QA6 A;  1MH4 A;  3E6D A;  4FE7 A;  4L5E A;  3LQQ A;  2EBI A;  2FNA A;  3AKZ A;  1ON1 A;  2QVO A;  2DDB A;  2BW3 A;  3MFK A;  2YS9 A;  5H6Q A;  3J7Z I;  1QNT A;  2MBF A;  3CDI A;  1XPX A;  1CGP A;  3HSR A;  3A1Y A;  3MQ0 A;  4QLC U;  3IH3 A;  2ECB A;  1P4A A;  5IPA A;  2KIF A;  4PJN A;  3CCS I;  2W57 A;  3M8F A;  2PMU A;  2P0W A;  2R5Y A;  3I4P A;  3S2D J;  1ZTR A;  5BPI A;  4R1H A;  2ZJQ F;  1X1P A;  4XOR A;  2OZU A;  2IXS A;  4ZDO A;  3GTG J;  3QRF F;  3P9K A;  2IP2 A;  4R8H A;  1FYM A;  1HQC A;  1RES A;  3HG9 A;  4PGH A;  4LB6 B;  1YQA A;  1IRG A;  1G3Y A;  4A2U A;  4CUG A;  2V9V A;  2EWN A;  3A01 B;  3ZCO A;  1W5C C;  4IOA F;  1WJD A;  3S32 A;  4CCJ A;  3BZK A;  2LY1 A;  2B9S A;  1ACI A;  5EEH A;  4BGD A;  3M1C A;  4HPQ A;  3H35 A;  3JCU C;  3LNQ A;  5C3E J;  3MWM A;  1EF4 A;  3OY9 A;  4IQ4 A;  1D8J A;  4BJ5 C;  4W97 A;  2UWM A;  3KYL A;  1CQT A;  4BU2 A;  2BV6 A;  4R79 A;  4BEH A;  5EG0 A;  5L3B A;  4NNJ A;  1GV2 A;  1W36 C;  1I5Z A;  5LGT A;  3JRI A;  3Q9V A;  3RI4 A;  4BY7 J;  1R1U A;  1I50 J;  2HYG D;  4QTR A;  1D0Z A;  4PDK A;  3PO2 J;  3VOE A;  2GXA A;  5KNL A;  1BI2 A;  1I39 A;  4I01 A;  2WAE A;  5GAG J;  2EIN H;  2BY3 A;  1MDM B;  2WAQ A;  3IWF A;  3H36 A;  3JTG A;  1VQM I;  3ZQG A;  2QQA A;  2P81 A;  2A69 F;  1SAN A;  3DU6 A;  2OUM A;  2R92 J;  2FBK A;  2V4J C;  5JVG F;  2IAI A;  5E17 F;  2HQN A;  2R93 J;  3OOU A;  4KJZ A;  2VQG A;  3FXO A;  2RC4 A;  5IP7 J;  1Z3X A;  2YU9 J;  2AQF A;  2DO7 A;  3I71 A;  5ICF A;  3RKQ A;  5E3O A;  3K4L A;  5FFZ A;  1WI3 A;  3OYK A;  5FLX Z;  5LD2 C;  3TOA A;  1TZL A;  3H9G A;  1K78 A;  2DA7 A;  1P9Q C;  2WAF A;  3HBL A;  5DYM A;  3K4K A;  4OIO F;  1H9T A;  3HHH A;  2KJB A;  1VQK I;  2IS1 A;  2R7O A;  1J0R A;  1MBH A;  1XG1 A;  4LG0 A;  4AYB N;  1D5Y A;  3GME A;  3K69 A;  1GLN A;  4KMU X;  1KU3 A;  4HNT A;  1RUN A;  3F21 A;  3CMA I;  2PN6 A;  2ACJ A;  1WFX A;  2EZK A;  3HYI A;  2A05 A;  3ECH A;  3FXM A;  3HKZ A;  2XSD C;  5LGN A;  1JXS A;  1HXD A;  1OCC H;  1LFB A;  4EJT A;  1ETQ A;  1HLV A;  2KJC A;  1IZ1 A;  3I56 I;  2RNG A;  2OC6 A;  2DYR H;  4C3H J;  5E1W A;  3L2V A;  5EEG A;  4Y52 J;  4GGG A;  2R7D A;  1QRY A;  1YG2 A;  1MGT A;  1S9H A;  3G3Z A;  2MAB A;  4XLC A;  1D3Y A;  4A3I J;  3E7L A;  3MMY B;  1MH3 A;  4DW6 A;  2KT0 A;  1BOB A;  1V5G A;  2JA5 J;  1S3J A;  1LB2 A;  2M0C A;  3ZN0 A;  1WRJ A;  2OQR A;  4F93 B;  2IA0 A;  2A6T A;  2A6E F;  4EJU A;  2D5V A;  4A3L J;  3MN2 A;  3F9K A;  2M30 A;  4GDF A;  1LJ9 A;  2BW3 B;  2DOD A;  5K7F A;  4LFU A;  2PMZ A;  2V26 A;  3B73 A;  2B7E A;  3HSE A;  1N25 A;  1HDD C;  2R7T A;  2R5Y B;  3Q0U A;  1YIT I;  4RB3 C;  2E1M C;  3GFJ A;  1VFC A;  2V9K A;  2EV0 A;  2FBH A;  3RKW A;  3NAR A;  2CUZ A;  3PUF A;  4WK8 F;  3KP4 A;  2HNH A;  3COA C;  3I55 I;  2TDX A;  1SD7 A;  1XGN A;  5D6F A;  2VUM J;  4FIS A;  2QLZ A;  2PG4 A;  1JUP A;  2VQL A;  4GYI A;  3E6M A;  3H9Q A;  2FOK A;  1AWC A;  4X6A J;  1EH7 A;  1YO5 C;  4GYG A;  2O0Y A;  2IS2 A;  3CCJ I;  4UUV A;  3NAU A;  1T0F A;  2DOA A;  2RVC A;  3C2G A;  4P9F A;  4CCK A;  4ESF A;  3KZZ A;  1REP C;  4I0A A;  4IHT A;  3DFG A;  4IHW A;  3ISP A;  1G4D A;  3FMQ A;  2V9P A;  1T0F C;  5J4V A;  3E3V A;  4ABZ A;  1K6O A;  1NK3 P;  4BEH B;  5EG0 B;  2HKX A;  2P6T A;  4IXA A;  4EJW A;  4KIF A;  1LNW A;  3TED A;  3FIW A;  4N9H A;  2EZI A;  5DCM B;  3DBH B;  2VLA A;  2XSJ C;  3E0J B;  2CWE A;  3DTK A;  3FZV A;  2DPD A;  2EV6 A;  3G2B A;  3DBR B;  5EF6 A;  3ESW B;  1O7L A;  2ZXH A;  2H6C A;  1SVL A;  2M4K A;  1R4M B;  3LAP A;  4HLX A;  3L1P A;  3CC4 I;  2L9N A;  4Y13 A;  1X4P A;  3L2R A;  4I76 A;  2DFI A;  3WGG A;  3V8L A;  2F2E A;  1FSE A;  1R58 A;  2LFB A;  3PM1 A;  1QO0 D;  4Y33 A;  4NHJ A;  4UVC A;  2EA2 A;  2RQQ A;  4IL6 C;  1T56 A;  3QYB A;  2DA6 A;  3NWT A;  2EFP A;  4D1Q A;  4ENN A;  2ZME A;  3RPU A;  5F1J A;  2ZNY A;  2HYJ A;  4JBA A;  1G6N A;  1T08 B;  2L7F P;  3H3Z A;  1K78 B;  2ZME C;  4XKW A;  3WTU C;  1TNT A;  1X2N A;  4ZYA A;  2CS3 A;  4G7Z F;  1B59 A;  2DA4 A;  2FD5 A;  1VQ4 I;  1KYW A;  4AVZ A;  1KQ8 A;  4OAZ A;  5LHI A;  1SAU A;  3TDZ C;  4LG0 B;  2RDP A;  1I6X A;  3LAJ A;  2MYS A;  1LDK B;  1OR7 A;  2ZSH B;  4LIV A;  3IP4 B;  4RAY A;  4UB8 C;  1K83 J;  1JE8 A;  3E6C C;  3QPH A;  3JRA A;  3KEY A;  5JI6 A;  3OV8 A;  1WJC A;  2ZCW A;  2DA5 A;  4AUX A;  2GA1 A;  2VXD A;  1ZR4 A;  2BYV E;  2X85 A;  1BN5 A;  1C0W A;  2W82 A;  1MJB A;  2E2I J;  4L9J A;  1QBJ A;  3CCQ I;  1RC9 A;  3T1B A;  2M7A A;  3EET A;  5E8G A;  2WBM A;  2P7V B;  3BJ6 A;  3BG5 A;  4YFN F;  5JVT A;  1VQ5 I;  2CQ7 A;  4B4C A;  3HIF A;  4LOC A;  1U8B A;  2G0E A;  4XN3 A;  3WTT C;  1R1T A;  3M3Y J;  1W5S A;  1HCR A;  5DDG A;  2X48 A;  1FOW A;  3H9J A;  2R7Z J;  3PSI A;  3TGN A;  3DTI A;  3WHB A;  5K5O A;  4GCV A;  2YX4 A;  4DYQ A;  3S17 J;  1PUE E;  3J81 K;  1MBG A;  2XKO A;  3LA2 A;  4CIC A;  1LFP A;  3MCZ A;  3ULQ B;  1ETV A;  2VE8 A;  1W4M A;  3BR0 A;  2E1M B;  4KDP A;  5FD5 A;  4OIR F;  3S3N A;  5JLX A;  1G3S A;  4CZC A;  3ZXS A;  2JVG A;  2MA3 A;  1BC7 C;  1TP4 A;  2MD0 A;  2HXO A;  1MBE A;  1FEX A;  4IHS A;  3J7Y J;  4A5M A;  3NQO A;  3FK6 A;  2IRF G;  5DM6 F;  2DFF A;  2GOX B;  3JW4 A;  3QOD A;  1J75 A;  4I99 C;  5ILS A;  2A07 F;  1UZC A;  2ME0 A;  4OMZ A;  2CUF A;  1ITY A;  3N05 A;  2NVT J;  3F8C A;  3O6B B;  3W6K B;  2PFB A;  3ABK H;  1A04 A;  1MBJ A;  2Y9Y A;  3IKV A;  5AIP A;  4MEY F;  3TBI A;  1TT5 B;  4A0Z A;  3CMY A;  3K4N A;  3RZD J;  1W36 D;  4UUS A;  5HDG A;  5LLQ A;  1XCB A;  4S0H B;  3R6S A;  4HNV A;  2ELH A;  4HEA 2;  2DXI A;  5DUI A;  3R61 A;  3U21 A;  1IXR C;  4RAF A;  3HRT A;  5K5Q A;  3DKW A;  3GO5 A;  2Z9O A;  2E1N A;  4HZF A;  4ZZD A;  2OTJ I;  2KDZ A;  4CXF A;  3RPQ A;  4L9V A;  2MG4 A;  1Y0U A;  4BJ6 C;  4HQE A;  3ZRG A;  1OJL A;  4AD9 A;  1YS6 A;  2HPI A;  3KP2 A;  5C4X J;  3RYP A;  3TO7 A;  3D5S C;  4C3I J;  1BL0 A;  3QAH A;  1DGW Y;  2HOE A;  3K2Z A;  5F0H A;  4E7H A;  3I9V 2;  2E2J J;  1DPR A;  3QP5 A;  3JRF A;  2FMY A;  1XDS A;  1BIA A;  3GTK J;  2Y0S N;  1XGM A;  2RKH A;  2OD5 A;  4KT5 C;  1JT6 A;  3OYN A;  2ZME B;  2C6Y A;  2CO5 A;  5FLM J;  1O3R A;  2L2O A;  1IG7 A;  5JHU A;  5K7Z A;  1V55 H;  3FM5 A;  4IOC F;  3BLY A;  5EJC A;  2M7B A;  5LHH A;  4HRI A;  1AA7 A;  3GTO J;  3K4M A;  5FFX A;  2JMW A;  1P4W A;  1S6L A;  3DP7 A;  1YE9 A;  2XGX A;  1WWX A;  1NG7 A;  2DTZ A;  2FF4 A;  3M8E A;  1KU9 A;  1V5F A;  2VJ5 A;  4M3G A;  1WGX A;  2M4G A;  4E4H A;  2X6Y A;  4IF4 A;  4NC8 A;  2NRA C;  1MIJ A;  1BIB A;  2M45 A;  2UV1 A;  5DM7 F;  1P4X A;  4HV6 A;  3D0S A;  1IV8 A;  2FJ1 A;  4A3B J;  3S1R J;  3HB9 A;  3QPL A;  4LIU A;  3PIO F;  4RM3 A;  3LSJ A;  1OMI A;  2DYS H;  3G1L A;  2DQL A;  2DLL A;  1MZB A;  2PEX A;  4M73 A;  2RAE A;  4V19 K;  2YU3 A;  4M74 A;  4BDZ A;  2X6W A;  2O8K A;  3DLL F;  1QZY A;  5IOZ A;  2XKP A;  4G8X A;  4B3A A;  2HZD A;  1JT0 A;  1K4T A;  2Z16 A;  1ERD A;  1E2X A;  2ZFW A;  4A3F J;  4FX4 A;  2HTS A; 
#chains in the Genus database with same CATH homology
 3OSF A;  3SDG A;  3BTL A;  2HI3 A;  1BW5 A;  3Q0V A;  1P7J A;  2M34 A;  3PO3 J;  2LVS A;  3ZQL A;  1MH4 A;  4FE7 A;  4L5E A;  2EBI A;  1IV6 A;  1IDY A;  2M2E A;  2YS9 A;  3O8H A;  5F04 A;  1FTT A;  2HOS A;  4I6Z A;  1QVU A;  3LSP A;  1TWA J;  3IH3 A;  2ECB A;  5IPA A;  3B6C A;  2JA6 J;  4A69 C;  3HOX J;  2R5Y A;  1B72 B;  3S2D J;  1PUF A;  1ZTR A;  3IV5 A;  5IP9 J;  2CU7 A;  1MSF C;  5E3N A;  1TWF J;  2ZB9 A;  3GTG J;  5IYD J;  1DU0 A;  1O4X A;  2LKX A;  1UHS A;  1RES A;  2XGD A;  4UUS B;  2WAQ N;  3A01 B;  5GPA A;  3JRB A;  1JUM A;  1U9O A;  2K9N A;  1JKQ C;  4IEJ A;  3SFI A;  4QSH A;  3ZQH A;  2GLO A;  3D1N I;  2CRG A;  2ECC A;  4DYC A;  3LNQ A;  5EGO B;  5DTD A;  1VF9 A;  5C3E J;  1BA5 A;  4MLO A;  1EF4 A;  2DMQ A;  4W97 A;  1CQT A;  2EH3 A;  3HOW J;  1VI0 A;  1Z77 A;  5EG0 A;  2WB1 N;  1JTY A;  1GV2 A;  4B1R A;  2LP0 A;  2L0K A;  2W48 A;  3JRI A;  1NK2 P;  4CYC A;  4BY7 J;  2QCO A;  4QTR A;  1I50 J;  5HOD A;  2NVQ J;  1ETO A;  3PO2 J;  1JUS A;  1GT0 C;  3HKZ N;  3H3V K;  2VKE A;  3ZQG A;  3S1Q J;  2P81 A;  1JGG A;  1SAN A;  3BR6 A;  2XRL A;  4MIM A;  5F0F A;  2R92 J;  1Y1W J;  2LLK A;  1JTX A;  2IAI A;  3LOC A;  5FKL A;  2R93 J;  3OOU A;  1E3O C;  5IP7 J;  1S7E A;  2NVX J;  2YU9 J;  3RKQ A;  5E3O A;  2DA1 A;  5IP6 A;  1WI3 A;  3BTI A;  1FTZ A;  3F0C A;  2EZL A;  1T33 A;  4C2M J;  2WV1 A;  2X6O A;  2DA7 A;  3HBL A;  2X9D A;  3GTL J;  2JN6 A;  1OCP A;  1QVT A;  3OSG A;  1MBK A;  1D5Y A;  1MBH A;  1XG1 A;  4BXX J;  4AYB N;  2HQ5 A;  1H8A C;  2PMZ N;  5M5Y J;  4A3M J;  2EZK A;  9ANT A;  2XSD C;  3SJM A;  1WCM J;  2O9L A;  3S1M J;  3A03 A;  2ME6 A;  1LFB A;  2N8G A;  1ETQ A;  3G1O A;  5J3L A;  1HLV A;  1AKH B;  4V2G A;  1A6I A;  3B6A A;  1R9T J;  1A5J A;  3HDD A;  4XK4 A;  4C3H J;  2COB A;  4Y52 J;  2CUE A;  1QRY A;  4DZJ A;  4XID A;  4A3I J;  1Y1V J;  2ID6 A;  3GTQ J;  3ZQF A;  2Y31 A;  2Y30 A;  3E7L A;  4W1U A;  1MH3 A;  1AHD P;  4A3D J;  1IC8 A;  4DW6 A;  2KT0 A;  1GVD A;  2MGQ A;  2TCT A;  2JA5 J;  5FKK A;  4XRM A;  1RKW A;  2LTP A;  4D5F A;  2M0C A;  1W0U A;  2D5V A;  4A3L J;  3MN2 A;  3FKI J;  3CDL A;  5K7F A;  2DJN A;  2NVY J;  3RQI A;  1HDD C;  2VI6 A;  1IJW C;  2R5Y B;  1HDP A;  2Y9Z A;  3Q0U A;  1PUF B;  5J1Y A;  1W0T A;  3BG3 A;  3BR1 A;  3DEW A;  1LFU P;  4A3K J;  1VFC A;  1RKT A;  5E3M A;  3NAR A;  2HOT A;  1IRZ A;  2CJJ A;  1JKP C;  2R5Z A;  1Z0X A;  2M9H A;  4FIS A;  2VUM J;  4DZP A;  2E1O A;  1JUP A;  4EEF G;  1RR7 A;  4X6A J;  1WPK A;  2L9R A;  3BTJ A;  3O8G A;  3GTJ J;  4XIC A;  1ETY A;  3NAU A;  5GPC A;  2XPU A;  2DMP A;  4MO7 A;  5FKN A;  4IHW A;  5M5W J;  4JX6 A;  4C3J J;  4ABZ A;  5EEA A;  1NK3 P;  4AC0 A;  3HOZ J;  4FTH A;  5EG0 B;  4IHX A;  2LD5 A;  3I4N J;  3HGY A;  1F43 A;  3TED A;  3FIW A;  3TW7 A;  2JA7 J;  2EZI A;  4D5C A;  3S2H J;  4CYC B;  2ELK A;  3S14 J;  1H88 C;  1IUF A;  3RZO J;  2AO9 A;  2H1K A;  5IOY A;  2EQR A;  5EF6 A;  1ITY A;  4GFB A;  3L1P A;  4I76 A;  5M3F J;  2GM4 A;  2VPR A;  2K9Q A;  2LFB A;  3PM1 A;  2H8R A;  1B8I A;  5EZH A;  3CCY A;  3JRD A;  1UG2 A;  3K2A A;  3HOV J;  1T56 A;  2DA6 A;  2L7M P;  2FX0 A;  1HF0 A;  5F1J A;  2HYJ A;  2EZH A;  4FE4 A;  1K61 A;  3Q3S A;  2ID3 A;  2L7F P;  1X2N A;  1TC3 C;  1RPW A;  2DA4 A;  2E19 A;  2FD5 A;  3LSR A;  1JJ6 C;  4Y7N J;  2GBY A;  2Y2Z A;  2R0Q C;  3HM5 A;  1WH5 A;  4MFD A;  2CQX A;  2M8G X;  4RDU A;  2MSY A;  1K83 J;  3BTC A;  1XS9 A;  3JRA A;  3UKG A;  2XPV A;  3BG9 A;  3JR9 A;  2DA5 A;  4AUX A;  4UUT A;  5C44 J;  4XRS G;  1H89 C;  1G2H A;  1ZR4 A;  5IYC J;  2DMN A;  2DA2 A;  2OPT A;  5FKM A;  4IHV A;  2E2I J;  3MVP A;  4BBR J;  1HOM A;  3IH4 A;  1MSE C;  2OF7 A;  4DYR A;  3BG5 A;  3FIS A;  4QIW N;  1MNM C;  1LE8 A;  4B4C A;  1ZKG A;  5F0C A;  1NTC A;  4LOC A;  1ETX A;  2QF7 A;  3S16 J;  4A93 J;  1U8B A;  1FJL A;  2G0E A;  3M3Y J;  1QPI A;  3BR5 A;  1HCR A;  1JKO C;  2LK2 A;  3IH2 A;  2X48 A;  4D7N A;  5F08 A;  4JX4 A;  5EZG A;  2B63 J;  2R7Z J;  1I3Q J;  5K7H A;  1YRN A;  2JWT A;  3WHB A;  4M3F A;  2E2H J;  3VPR A;  1BW6 A;  1FIA A;  3CQZ J;  4A3C J;  4DYQ A;  3S17 J;  1GV5 A;  3W6V A;  1MBG A;  5FLV A;  1BJZ A;  1ETV A;  3BR0 A;  2I10 A;  1SFO J;  5J1R A;  3HOY J;  5J1U A;  4BBS J;  2JA8 J;  5EDN A;  1ZK8 A;  5JLX A;  5EYR A;  4A3G J;  1Q1V A;  2TRT A;  4M3E A;  3GTM J;  2L7Z A;  1RET A;  5BNG A;  4V2F A;  2VKV A;  3DCF A;  2HXO A;  1POG A;  1MBE A;  1VND A;  1MBF A;  2XGE A;  4JP0 A;  1JJ8 C;  1FEX A;  2NOG A;  4A3E J;  3FK6 A;  2DN0 A;  2R5Z B;  3JRC A;  3Q0W A;  3JRE A;  2MW8 A;  1B72 A;  2O7O A;  2ME0 A;  1OCT C;  3HOU J;  2CUF A;  2NVT J;  1FIP A;  2K9S A;  1ETK A;  1F36 A;  1MBJ A;  2Y9Y A;  2YUS A;  5DS9 A;  4G12 A;  3CMY A;  3RZD J;  3QPS A;  4UUS A;  1ETW A;  2DMT A;  1JKR C;  5FJ8 J;  4S0H B;  4J19 A;  4HNV A;  1U78 A;  3A01 A;  5FKO A;  2NS8 A;  4BKX A;  3GBG A;  1XC5 A;  3S15 J;  3JRH A;  4A3J J;  1X2M A;  3G1M A;  3TW6 A;  1ZQ3 P;  2KDZ A;  3K7A J;  5EGO A;  3FK7 A;  2MG4 A;  2JJ7 A;  1GDT A;  2IBD A;  1OJL A;  4RBO A;  1ZGW A;  3BR2 A;  2LY9 A;  5C4X J;  1TWH J;  3TP0 A;  3LSG A;  3HEF A;  3C2B A;  4C3I J;  1BL0 A;  5F0H A;  3BQY A;  3H0G J;  5C4J J;  1ZR2 A;  3GTP J;  3ZOB A;  2E2J J;  3ZQC A;  2IEK A;  5E3L A;  4D7M A;  4BY1 J;  3JRF A;  5GP9 A;  2JK3 A;  1ENH A;  1X58 A;  3GTK J;  1B8I B;  2Y0S N;  3I4M J;  1JT6 A;  4IHY A;  3BT9 A;  4M6V A;  2FQ4 A;  4MFE A;  5M3M J;  1OFC X;  5FLM J;  1IG7 A;  5K7Z A;  2HOA A;  5JLW A;  4M3B A;  3HGG A;  2HDD A;  4XRS A;  1IDZ A;  3GTO J;  2JMW A;  2DA3 A;  3OIO A;  1DU6 A;  4X1E A;  3BR3 A;  3BQZ A;  2HXI A;  1GUU A;  2XPW A;  2DTZ A;  5F27 A;  4M3G A;  2CQQ A;  1WGX A;  2XB5 A;  3QQA A;  2DMU A;  1ORK A;  3WHC A;  2K40 A;  5M5X J;  1I6H J;  1TWC J;  2FJ1 A;  4A3B J;  1WH7 A;  3A02 A;  3S1R J;  2XB0 X;  3HB9 A;  3QPL A;  3JRG A;  1IGN A;  1AU7 A;  2XGC A;  3LSJ A;  4NDL A;  3ZQI A;  4FCY A;  3G1L A;  1P7I A;  2RAE A;  3S1N J;  3TP3 A;  1LE8 B;  4M3D A;  5IYB J;  2LR8 A;  1AKH A;  2O8K A;  4JX5 A;  5IOZ A;  3M4O J;  1APL C;  4B3A A;  2NS7 A;  1TWG J;  1UMQ A;  3MKL A;  1JT0 A;  4JYK A;  2AHQ A;  1YRN B;  1U9N A;  4A3F J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...