5FLMJ

Structure of transcribing mammalian rna polymerase ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structure of Transcribing Mammalian RNA Polymerase II
pubmed doi rcsb
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5flmJ00
1W0TA 3S15J 2H8RA 2FJ1A 2M0CA 3S14J 2NVYJ 2O8KA 2JK3A 2LD5A 5GP9A 2HOSA 3LSJA 1GT0C 5F0CA 1U9OA 1O4XA 4BBSJ 2OPTA 3CCYA 2XRLA 4DYQA 4MFEA 3OOUA 4V2FA 1BJZA 5EEAA 5C3EJ 4M3FA 1IG7A 3HGGA 2M2EA 4M3DA 5FLMJ 3QQAA 4JYKA 2CU7A 2DA5A 2NS7A 2E2HJ 4BXXJ 3W6VA 2HXOA 1RKWA 2K40A 1IDYA 2CJJA 3H0GJ 2L7MP 3K2AA 3SDGA 1IRZA 2D5VA 4IHVA 2R92J 4X1EA 1U78A 2XPWA 2MSYA 2LY9A 5F04A 4DZJA 3QPLA 3IH4A 2M34A 3JRFA 1BW5A 3HDDA 1UG2A 2EZKA 2XPVA 4V2GA 3M3YJ 3BTCA 1OCPA 5EZHA 3RZOJ 3ZQCA 1QVTA 5F0HA 3TP3A 1VF9A 4QIWN 2H1KA 2GM4A 2B63J 2LFBA 1JT6A 4AYBN 2VUMJ 2Y9ZA 3GTQJ 2Y0SN 1XS9A 3A03A 1JKRC 2WB1N 3A01B 3JR9A 1OFCX 4A93J 4A3IJ 1HLVA 4A3CJ 1WI3A 2LTPA 1I50J 3G1MA 2HOAA 3MKLA 1LE8B 3FIWA 2DTZA 2Y31A 4C3HJ 1K61A 3BR2A 3A01A 5BNGA 4MIMA 4HNVA 3BTLA 4UUSB 2M9HA 3HOUJ 3MN2A 1MBGA 3ZQGA 4A69C 1JGGA 4BY1J 3S17J 2VPRA 3BT9A 4XRSG 1LE8A 1JKPC 2L7ZA 1ZR2A 2E1OA 1ETYA 2AHQA 3GTOJ 1P7JA 1OCTC 4UUSA 3E7LA 1Z77A 1F36A 1JJ8C 4A3GJ 3JRHA 4I6ZA 2E19A 4A3DJ 3HOZJ 4BBRJ 4A3MJ 2JA6J 1MH4A 2JMWA 3OIOA 2E2JJ 3GTPJ 1ETVA 3A02A 1W0UA 1X2MA 1T56A 4A3BJ 1I6HJ 2KT0A 1FTZA 1FIPA 2O7OA 3HOWJ 1IDZA 2K9QA 2HDDA 1Q1VA 4D7MA 5J3LA 1XC5A 3L1PA 1IC8A 2ME0A 2AO9A 1WPKA 4A3KJ 2JA5J 2WV1A 2DA1A 4FCYA 3Q0UA 1F43A 1RETA 3HKZN 1HF0A 4IHYA 3SFIA 2ECBA 2HYJA 1AHDP 3S2HJ 1R9TJ 1GDTA 1NTCA 4A3JJ 2JN6A 3H3VK 2XPUA 3Q0WA 2EZLA 2LK2A 1ITYA 5FLVA 2LLKA 1POGA 3HGYA 5M3FJ 2ZB9A 2K9NA 1BL0A 4A3LJ 2DA3A 3LNQA 1FEXA 1ETKA 5FKKA 4JX6A 1UMQA 3PM1A 1ETOA 1NK2P 1DU6A 5M3MJ 1I3QJ 3SJMA 4S0HB 3D1NI 4IHXA 1FTTA 1Y1VJ 1ETQA 5C4XJ 3HBLA 1U8BA 1D5YA 1MBHA 4CYCB 3FK7A 2JJ7A 2MGQA 3CDLA 4DW6A 5F27A 2EZHA 4ABZA 1X2NA 3CQZJ 1WH7A 4LOCA 3JRCA 1TWCJ 4RBOA 1RESA 3C2BA 3MVPA 3JRDA 1Y1WJ 4CYCA 1JUMA 1ORKA 4M3GA 1LFBA 5E3MA 2CQQA 2DA7A 4G12A 3DCFA 4M3BA 3JRBA 2O9LA 2X6OA 1HDDC 2DMTA 1JTXA 1A6IA 2MG4A 1HOMA 4BKXA 3QPSA 2ECCA 2NOGA 5FKLA 2XB0X 1P7IA 2DA2A 2E2IJ 2X9DA 2VKEA 4C2MJ 1HCRA 3OSGA 1ENHA 4NDLA 2NVXJ 1U9NA 3ZOBA 5J1YA 3BG3A 2LKXA 5IYCJ 3HOXJ 1JJ6C 1IUFA 3TEDA 3ZQLA 4DYCA 1IJWC 4AC0A 2Y9YA 2COBA 2QF7A 2YUSA 3FKIJ 2CUFA 4RDUA 2TRTA 1SANA 2LR8A 1ZGWA 4A3EJ 1JT0A 3JRGA 5IOZA 1A5JA 3BR5A 1H89C 5F0FA 3ZQIA 5C4JJ 4XK4A 1MNMC 3Q3SA 4C3IJ 5DTDA 4IEJA 1JUPA 4BY7J 5EGOB 2R5YB 5IYBJ 2LP0A 9ANTA 1VFCA 4MFDA 2MW8A 5HODA 1IGNA 1GUUA 4D5FA 5IP7J 4JP0A 4FE7A 2XSDC 3BQYA 2TCTA 5GPAA 4B4CA 2R5YA 1PUFB 5EGOA 2L0KA 2IBDA 2ID3A 3BR1A 3HOYJ 5DS9A 3JRIA 2JA8J 2GBYA 3S1NJ 3LOCA 3LSRA 1MBKA 2L9RA 1OJLA 1K83J 1YRNB 1MSEC 1T33A 1JKQC 2XGCA 2M8GX 1PUFA 2HXIA 1UHSA 4AUXA 1ZR4A 2ME6A 1AU7A 2GLOA 1CQTA 3I4MJ 4JX5A 4MO7A 2Y30A 4J19A 3GBGA 4XRMA 3JRAA 3GTJJ 3LSPA 4DZPA 2G0EA 1YRNA 1MBJA 2HI3A 2DMQA 1WH5A 5JLWA 3IV5A 2X48A 4MLOA 3VPRA 4A3FJ 2KDZA 5IPAA 5FKMA 4C3JJ 2DA4A 2R0QC 2N8GA 1ETXA 3JREA 3BG9A 5J1RA 2HQ5A 4D7NA 1APLC 2IEKA 1ZTRA 5E3NA 1ZK8A 3ZQFA 2OF7A 1ZQ3P 1BW6A 2EZIA 3NAUA 2VKVA 5IYDJ 4D5CA 3RZDJ 3TW7A 4GFBA 1TWFJ 4EEFG 3DEWA 2R93J 2ELKA 1G2HA 4JX4A 5FKNA 1JTYA 2YS9A 5F1JA 1VNDA 5M5XJ 1WGXA 2R7ZJ 2FD5A 3IH3A 4M6VA 2EH3A 1SFOJ 2CRGA 3LSGA 2YU9J 2NVQJ 1TWGJ 1VI0A 1B8IB 3BQZA 3GTKJ 3BR0A 3WHCA 3CMYA 3S1MJ 3ZQHA 4XIDA 3BR6A 1HDPA 1NK3P 4B1RA 1FJLA 3K7AJ 2DMPA 4L5EA 4M3EA 1B8IA 4DYRA 3I4NJ 3B6CA 2I10A 3HB9A 4X6AJ 3G1LA 3WHBA 3GTGJ 2JA7J 1MBEA 2LVSA 2DJNA 2CUEA 5IP9J 3PO3J 5K7ZA 5M5WJ 1B72B 2WAQN 5E3OA 3RQIA 3HOVJ 3FK6A 3BG5A 2DN0A 2W48A 3Q0VA 1RKTA 3BTJA 5M5YJ 1GVDA 2Y2ZA 1B72A 1XG1A 3FISA 2XB5A 1H88C 1LFUP 5EDNA 5K7HA 1ETWA 5IOYA 3GTLJ 3RKQA 3IH2A 1EF4A 3S2DJ 5J1UA 1FIAA 2ID6A 5K7FA 3O8HA 2EBIA 3NARA 1JKOC 3PO2J 1E3OC 1H8AC 1QPIA 1Z0XA 2NS8A 1DU0A 4QSHA 3OSFA 1BA5A 2CQXA 1AKHB 5EZGA 5GPCA 1TWHJ 3O8GA 3G1OA 5FJ8J 2FX0A 4Y52J 1GV2A 1WCMJ 2IAIA 1QRYA 4B3AA 5IP6A 2R5ZB 5JLXA 5FKOA 1X58A 1AKHA 2EQRA 2XGDA 3HEFA 1IV6A 1MSFC 2XGEA 2NVTJ 3UKGA 4XICA 1JUSA 3HM5A 5EYRA 1S7EA 5EG0B 3BTIA 5C44J 4QTRA 2R5ZA 1ZKGA 5EF6A 1MBFA 3S1RJ 2PMZN 4FISA 1TC3C 3TW6A 2FQ4A 2QCOA 3B6AA 2L7FP 4Y7NJ 3GTMJ 1RR7A 5EG0A 1RPWA 1GV5A 3BR3A 4FTHA 3F0CA 3S16J 2JWTA 2DMUA 4XRSA 1MH3A 4W1UA 3M4OJ 2DMNA 3S1QJ 4FE4A 3TP0A 2HOTA 4W97A 1QVUA 5E3LA 2VI6A 2K9SA 4UUTA 2P81A 2RAEA 4IHWA 2DA6A 1TWAJ 4I76A 5F08A
chains in the Genus database with same CATH superfamily
1FY7A 2XDVA 1LPQA 1REPC 4BEHB 1Z6TA 4HAMA 1WI9A 1X1BA 2FJ1A 4BUPA 3S14J 2OQRA 2NVYJ 3MZYA 2V7FA 3B02A 5GP9A 4S04A 2H94A 4ZZDA 3H0DA 3HHGA 5F0CA 3JTGA 3ECHA 3SYTA 2HKOA 2ZMEB 1RUNA 4AVZA 3OOUA 5FLXZ 2D1VA 4X0GA 1KU9A 3HGGA 3E1SA 2W57A 3GXOA 2EINH 3KP3A 4CDGA 1IDYA 1R22A 2JPCA 3ONQA 4KITB 2R92J 1U78A 2JTVA 2VBZA 1XGOA 2MSYA 4E7HA 3WTUC 4DZJA 4GXOA 5DCFA 3QPLA 4IHSA 2M34A 1OCOH 4ZYAA 3L09A 2IXSA 4IOAF 2RDPA 1PJRA 1UG2A 2FBIA 2XPVA 3COAC 2MLGA 5EZHA 5LRRA 3CCLI 3JW4A 3PNVA 5E1ZB 5HLGA 1YX3A 3FXQA 5H6RA 3GLXA 3VYSB 1SVMA 1VF9A 2A3SA 1JT6A 2K7LA 3CZ6A 4KICA 2QSFX 5JHUA 5LD2C 4AYBN 2ZNZA 3I59B 1KA8A 3GTQJ 4CH7A 2O3FA 2R4GA 5JFRA 4RB2C 1XDUA 1OFCX 2ZC2A 3HIFA 1FOKA 1HLVA 2V6EA 2R7WA 1WI3A 2LTPA 1I50J 3HYIA 3PQJA 5CPRB 1Z21A 2DTZA 2Y31A 2HR3A 1DPUA 3O6BB 5LHGA 1YI2I 1MIJA 2Q8KA 3BR2A 1FMWA 1HKSA 3MFKA 1LDKB 2O03A 5A2QK 2M9HA 5CYVA 1MBGA 4BY1J 2FE3A 1T95A 2NAZA 5IY5H 2W25A 1LEAA 2ACJA 3BT9A 1SD5A 3H36A 2QVOA 1ZR2A 3ECOA 2MFZA 2A6HF 1ETYA 2AHQA 2DPDA 5B5EC 4F3QA 3X2QH 3ZGKA 3F8NA 1N77A 2KFDA 1VQKI 2GXGA 5JI6A 2V9KA 2LKPA 1JJ8C 3BC8A 1L0OC 3GYHX 1AWCA 1J59A 1G3YA 4GYGA 4I6ZA 1A36A 4I99C 2E19A 3HPHA 4XLCA 3T0YA 2M4GA 4BBRJ 4A6DA 1FYMA 4IXAA 2XUBA 2J5PA 2MYSA 4XKVA 3QYBA 2TDXA 2Y0SA 1AOYA 2QQBA 3EUHC 3OYIA 1HBXG 3R0AA 5CQEA 3QWLA 1FBQA 3F3XA 2O5RA 1SVLA 2HFHA 2O7OA 2EB7A 1GVJA 3WTZA 4HDUA 4ESBA 3PFYA 2IPQX 2K9QA 1S29A 3DKWA 3NEUA 2HDDA 2MBFA 4WF2A 2BW3A 1A31A 1USSA 2PJPA 1J2XA 1ONVA 2DODA 3L1PA 1WPKA 4AWXB 1QBJA 4KISA 1XMAA 3FXOA 4XN0A 4A3KJ 5DCMA 2Y69H 4OIOF 2R7XA 2WV1A 3DTIA 2VL8A 2B0LA 1F43A 1G3SA 2H8WA 2Z16A 3LAJA 4HDVA 2HYJA 4OINF 3O3KA 3M8EA 3S2HJ 1GDTA 1NTCA 3GFJA 1QPMA 4A3JJ 2CYYA 2K27A 3KYLA 1YE9A 3HGYA 4A3LJ 3WE2A 2VOOA 3HZJA 3FKJA 3CUQC 4CHUA 3CJTB 2NVUB 5FKKA 4JX6A 3VFZA 2I5UA 1NG7A 2NOJB 2BZTA 3J7AY 2RQQA 1ETOA 3P9IA 5M3MJ 3OYMA 3E5XA 1I3QJ 3AG2H 4PK4A 4XKCA 1WWXA 4ASNA 4G7HF 4KUMA 4IHXA 1Y1VJ 5CLSA 2VJJA 3CP2A 1F5TA 5C4XJ 2VQLA 2OTLI 2JRMA 4LB5A 3HBLA 1DUXC 1FT9A 1W5CC 2JJ7A 2MGQA 2VT3A 2BYVE 4U7DA 4OMZA 3WU0A 1FOWA 1X2NA 4GYIA 2KDOA 4L5IA 4XMYA 3CQZJ 1YS6A 3VSLA 1H9TA 1BR1A 3JRCA 2JVHA 4RBOA 1RESA 4HZFA 1JUMA 3H3ZA 3KP5A 3A4CA 3LA3A 4Q47A 4TV7A 3H5RA 1U0JA 5KAIC 1LFBA 3OS2A 3MKYB 3DCFA 4EJWA 1SC7A 4QLCU 5HDKA 4M73A 5BOXA 4O5VA 1MDMA 1D3YA 4BE2A 2R7VA 2LBFB 2Z5UA 2QEXI 3QPSA 4ESFA 3W3CA 5D5UB 1MJBA 2X9DA 2VKEA 4C2MJ 1HKQA 1IAWA 3MWMA 4M72A 2BEOA 2VXDA 2O61A 2WAEA 2E7XA 2DXIA 2W84A 2ADUA 3I53A 2O0YA 3I0TA 3TEDA 3ZQLA 4UUVA 4CO8A 5AIQA 3WODF 2Y9YA 1OKRA 1UCRA 4IZZA 5HS9A 4MEYF 3GX4X 5LLQA 2CW8A 2MD5A 2BE5F 3FXMA 2GA1A 2LF7A 2FBKA 6PAXA 4BXFA 3H9GA 2LY1A 2KRCA 2E1MC 3R61A 3KEYA 5TGTA 5E1WA 2EFWA 2XIGA 3OYGA 3ZP5A 1B9MA 4A3EJ 5AONA 4A0YA 1ZGWA 3JRGA 1JT0A 2KLOA 4KYWA 4AYBA 1BOAA 3K69A 4AD9A 1BJAA 2L02A 4HNTA 3SEQA 1S3JA 1A5JA 5ICCA 3BR5A 2HU9A 1H89C 2JUCA 1T8IA 4CUGA 2MABA 5C4JJ 1MNMC 1ULYA 2DLLA 5DTDA 2WAFA 5EGOB 3CUOA 2ICWG 1VFCA 4BGDA 2VBYA 3S3MA 1YW8A 5HODA 1IGNA 3U9GA 5HVQC 1GUUA 2M8EA 5IP7J 2CFOA 1XB4A 4JP0A 3BQYA 2TCTA 2VXZA 4B4CA 2VLAA 2L0KA 2VB6A 4JBAA 4U0VA 2EV0A 4WXCA 3CCJI 4RGRA 3QU6A 4HX8A 3LOCA 2RNJA 1OJLA 2KL4A 4ZDOA 3CJQB 3WGHA 3PNYA 1MMGA 3T8RA 2DYSH 1BOBA 1PUFA 2WWYA 1TT0A 2P6TA 2IP2A 5CKTA 2DFIA 4B09A 3DF8A 4ENNA 1SD6A 2LG4A 2EIMH 2KKOA 3GBGA 4PJ0C 3N97A 2F4IA 3V7SA 3LSPA 4RMNA 2K9LA 2HI3A 2JPBA 3FXUA 2K5CA 3DEUA 3I9V2 4BDZA 2DBBA 1U5TC 4NQWB 3K70C 5JLWA 2X48A 3R4KA 2LSOA 2JA2A 1YG2A 3K4NA 3VPRA 4EATA 2KDZA 2FNPA 1IXSB 2MC4A 2MLKA 2W1OA 4C3JJ 3WTYC 3OYLA 2XGXA 3BG9A 1MD0A 2LY2A 1APLC 3OR1C 1ZTRA 3IKVA 4NUBA 4ETSA 4XLEA 3W6KB 1FBSA 2RC4A 3AL0C 4L18B 2EZIA 3GFLA 1P9QC 3KE2A 1Y0UA 3BG6A 2UV1A 4L9JA 1IV8A 2BY2A 4EM2A 3F22A 1YLFA 1NHAA 3DEWA 4L9NA 4BXUA 3A0HC 1ZYRF 2YS9A 1VNDA 4Z6YA 5AIPA 3D0SA 5TISC 4Y15A 3LQQA 3RSNA 2EH3A 2GWRA 3FWEA 3OYAA 2HPIA 2V6CA 3WHCA 2F5DA 2DOAA 4Y33A 3J80K 4BACA 3BJ6A 1UFMA 3S1MJ 1O7LA 2FOKA 1FC3A 2V9VA 5DD8A 4DGWB 1E0EA 2VQCA 1I6XA 1JHHA 1B8IA 4DYRA 3O2PE 3N4MA 3I4NJ 5HLTA 2IA2A 4YG2F 4X6AJ 5ILSA 4L9TA 3WHBA 1YJWI 3GTGJ 1MBEA 2CUEA 2O6GE 3BG7A 3EUAA 1TLHB 3KP4A 5M5WJ 3HL2A 3VDXA 1HSJA 3BWGA 5K5RA 3A0BC 1UELB 4PCQA 2DN0A 1VZ0A 2L9VA 2P6SA 1DGWY 3M1CA 3HOSA 1W7PD 3CUQB 2K3FA 4MGRA 2X1CA 5FFXA 4Z2YA 1D1BA 3PQKA 3DQVC 3CMMA 5K7HA 5EDNA 5IOYA 3AKZA 3RKQA 3ZN0A 1U6GA 3CD6I 1OMIA 3FBNB 1T2KA 4U7BA 2VKHA 5K7FA 3NARA 1JKOC 1KYWA 3DFGA 1H8AC 4CXFA 2HVRA 1BA5A 1KQ0A 4WWCA 3GLLA 3QU3A 4ENJA 3KLOA 1UJ8A 4O6JA 1IRGA 5EZGA 1WJAA 4Y13A 2ZO4A 1WFXA 4BQOA 3O8GA 4Q48A 3TDUC 5K5OA 3KIOA 3EUKL 3DTEA 5LFAA 3QOPA 5KK1A 1WCMJ 1D8JA 3C7JA 3DBRB 4MEXF 1W5TA 4A2UA 1JXSA 2XGDA 4CCKA 1V5EA 5CJ9A 1WRJA 2XGEA 1OYWA 2NVTJ 1WSUA 3HM5A 2F4MB 4ZTFA 4EJTA 3S3NA 2R5ZA 2A5WA 2VC0A 2Z3YA 4IQ4A 4PSWA 5EF6A 3S1RJ 4KMUX 4DNCA 2PMZN 1B9NA 3GMEA 4FX0A 4PFPA 1UAAA 1MNEA 2ZSHB 2CQ7A 4XSXF 1EV7A 5KHDA 1GV5A 4LGWA 3REOA 3Q9SA 3LQRA 2UXXA 5B1AH 3M4OJ 2DMNA 4PGHA 3HSFA 4XKWA 2IJLA 1LKXA 4HSTA 2CW0F 2F5CA 2VI6A 2J5OA 2Z99A 3HXLA 3GO5A 4CCNA 2DFHA 3UNGC 5ICGA 2JUGA 2ESNA 3A2KA 2HOAA 3BLYA 4U88A 1V5FA 5FRNA 4L9VA 4E6KG 2O8KA 4J01A 2JK3A 2M4KA 1IN7A 3WTVC 3G73A 1GT0C 1VQMI 4ZTJA 3CMEI 3K4MA 3KYCB 3CCQI 4BBSJ 3RPUD 2GIZA 3BJOA 1CF7A 4P55A 4A6EA 4V2FA 4DYQA 5C3EJ 2PBIA 3OYNA 2Z1DA 3OIPA 1ZLKA 3HPGA 3QQAA 4JYKA 2CV0A 1LDJA 4MNUA 2HXOA 4IVNA 1RKWA 2K40A 2GXBA 3CC4I 3K2AA 4IRIA 3R6SA 1OR7A 2D5VA 1X1DA 5HS7A 4X1EA 2XPWA 4KT5C 3V7CA 1R7JA 3RDIA 2M1BA 4GRIA 1XD7A 4LD5A 2STTA 1BW5A 2EZKA 2ZNYA 3BTCA 1OCPA 1ZRCA 4RM2A 2DCEA 1YQAA 3SFZA 2ISZA 1T6SA 2VT2A 3W6JB 2NYXA 4I2OA 2XASA 2D45A 2A07F 1XMKA 3ZMZA 5KAFC 2VUMJ 2EIJH 2Y0SN 5JR3A 5J47A 4CYDA 3A01B 1XCVA 1OISA 2FQ3A 3WTWC 4A93J 3PUBA 4YELA 4A3IJ 2A5YB 4WXHA 4A3CJ 3G1MA 2UWMA 3MKLA 1U5TB 1LE8B 2L7KA 4LG3A 4C3HJ 3I3LA 4AIKA 3LMMA 3IWZA 3N05A 2R7QA 4O3MA 5BNGA 4KNYA 3OYCA 2BY0A 3BTLA 2KQRA 4P96A 3BY6A 1QHHD 3K10A 2VPRA 3VB2A 4XRSG 3CO6C 4OOIA 5GAGJ 2L7ZA 2XF5A 2E1OA 2ZJPF 3GTOJ 5JVGF 2E5NA 1P7JA 4H0EA 1G4DA 1OCTC 2EFOA 4UUSA 3E7LA 1Z77A 1F36A 5IT9K 2M7AA 3VODA 3S3OA 4HG2A 5CVUA 4ZC3A 3HOZJ 3U1DA 4RB0A 1IF1A 3K1MA 2G9WA 1P4WA 4CCOA 4MTDA 3ZR8X 1G6NA 1R5GA 2QENA 3RYPA 4EM1A 2EJRA 2JA6J 5JHFA 1DGRM 4I0AA 1X4OA 2JMWA 3IC7A 2HYFA 3V8JA 2M0MA 2E2JJ 1LNWA 1K4SA 1WJBA 5FD5A 4KFCA 1Z7LA 3VOEA 1W7PA 2QQAA 1TZLA 1X2MA 2V1NA 1T56A 2XSJC 5JVTA 1RC9A 2ELJA 4CCMA 1YO5C 3HOWJ 3J7AO 5H6QA 1Y0NA 2HS5A 4BHCA 1HW2A 4XBFA 1Y6IA 1N25A 1V5GA 2QA4I 5D8KB 2IGMA 4EGYA 1LJ9A 3FMQA 3EPZA 3OYHA 3S2WA 1TQIA 3MKZA 2DOEA 3W2AA 2E60A 1PUEE 2R7OA 3OOPA 2X4HA 4FCYA 3Q0UA 3M7GA 3DPTA 1HF0A 3SFIA 2FU4A 3KYDB 5L3GA 3CF5F 1XCBA 2OQGA 3K0LA 2JN6A 2YSRA 3GVAA 3H3VK 1IN4A 2EZLA 2LK2A 2PEXA 1POGA 3ZPLA 3RQ4A 1ETKA 3MQ0A 4C2UA 4LIUA 3DBHB 2QBYB 3GFIA 3PM1A 5BPDA 1E3PA 3SQNA 1NK2P 2G7UA 1IRFA 1ZGJA 5H2FC 5E20A 1BN5A 1UG0A 2DTRA 2CV2A 3HC7A 1ETQA 4OIPF 2PMZA 1L3LA 4N0BA 3F6VA 2F6CA 1X19A 4A0XA 4CYCB 3FK7A 3BROA 3WTTC 4CZZA 4DW6A 2HZDA 5LGUA 2QKLB 2XKPA 2EZHA 5LGTA 3I4PA 4IHTA 2M30A 2DJIA 1WH7A 2JT1A 1BM9A 2O8XA 2K3PA 2A61A 3ESWB 3HHHA 1A6QA 1TWCJ 3JRDA 1W0UA 1Y1WJ 3H3UA 3OMYA 4M3GA 4OAZA 2R7RA 2CQQA 2DA7A 2ETHA 3G4SI 2V4JC 1BI3A 4XRFA 5HOOA 4CGZA 4IX7A 1JTXA 1A6IA 3OV8A 4BKXA 3RPUA 1RR8C 1TQMA 2NRAC 1R4MB 2DA2A 3B73A 2E2IJ 2VIXA 2PMUA 1HCRA 1C0WA 3JSPA 1GHCA 1ENHA 1YYVA 4MHGA 2ZSIB 1KQ8A 2OA4A 4F55A 3V8KA 1P4AA 5J1YA 1R23A 3BOQA 5E1XA 1JJ6C 2VE8A 4AC0A 5L3CA 4R8HA 2L2OA 4E70A 1J75A 5GADJ 3HUGA 4PJJA 1BR4A 1FMVA 4P1WA 2ZXIA 1IXCA 5EJCA 1MKMA 1ZAOA 2BBYA 3HTUA 2HOEA 1W36D 3HRTA 3BP8A 3WGIA 3J81K 2E7WA 1QHGA 4AU7A 3H9QA 2XF6A 1WJCA 2BGCA 3W2WA 2P7VB 1D0ZA 2BV6A 4I7HA 2QM3A 5F0FA 3P7NA 2FMLA 3Q3SA 2R5YB 4BE1A 3FBIB 5IYBJ 3ZQ7A 1B1BA 2HNHA 3TBIA 2LP0A 3S32A 4YIRX 1IXRC 2MW8A 1BR2A 2L01A 5J8FA 2PX9A 3QP5A 2HDCA 1K79A 3C2HA 1UB9A 2PJRA 3ABLH 4LG0B 3ISPA 3ELKA 3IRQA 2ID3A 2CSOA 1SMTA 2KJCA 5K1YA 1F4KA 4LLLA 3S1NJ 3DU6A 3I5UA 4XL9A 1YRNB 1MSEC 1T33A 5DDGA 1QZEA 1JKQC 1R4NB 1VQ7I 5BPIA 2KZGA 1UHSA 1P2FA 2RVCA 2Q2EA 2ME6A 1XSVA 4XRMA 2VBXA 3JRAA 5FLXK 3GTJJ 1YTYA 3BPXA 2NS0A 4LFUA 4MQ9F 1O7FA 3VYRB 3V42A 2IRFG 2ZFWA 1I5ZA 2NXNB 3T1BA 5FD6A 2DA4A 1XGSA 3KZZA 1ETXA 1YFHA 2HQ5A 3V7RA 2DFFA 4R1HA 5B3SH 1ZK8A 5KVRA 5K5QA 2R7UA 3ZQFA 3RTRA 1SFEA 2H6CA 4D1QA 2KMUA 4D5CA 3E5UA 2FRHA 4GFBA 1FOYA 1TWFJ 5FO5A 1G2HA 1RIOH 5FKNA 4GGGA 1JTYA 5M5XJ 3AAFA 3ASNH 2Z33A 1I1GA 2ISYA 4M6VA 3K4BA 3LSGA 2OCCH 2YU9J 4XONA 3L2VA 1VI0A 1Z6RA 1NH3A 3SXYA 3F8CA 3ZMDA 2LC2A 4RLQA 3HRMA 1H0MA 2CWEA 3JTHA 4QPOA 3ZQHA 1O3RA 1HDPA 2E5ZA 1FJLA 2DMPA 4RAFA 2IA0A 1ZREA 1G3TA 2V1XA 2A69F 1K78A 1QU3A 5D5XB 1HSTA 2I10A 1Z1DA 3G1LA 4P5OA 1X1AA 4NC6A 2LVSA 2K9MA 1G3WA 5E3OA 2W00A 3FK6A 3BG5A 4BJ6C 2K4JA 2HZTA 3F8BA 4GDFA 1JI8A 1UHWA 3WE3A 3BTJA 1GVDA 2Y2ZA 3ERED 5HDGA 1XTAA 1B72A 1XG1A 2ZJQF 3FISA 4OMYA 1YOVB 3RKWA 3RYRA 1M1EB 3AG3H 1H88C 3LFKA 3FZVA 1LFUP 1QGPA 3GTLJ 2R7SA 1EF4A 4E7ZA 3U2RA 5DYMA 2ID6A 2F2EA 4LITA 3NQOA 3PO2J 2XAUA 3QPTA 1QPIA 2LF8A 4HF0A 1DU0A 4QSHA 3IRRA 4PGGA 4UXNA 1AKHB 3GZ5A 4LK1F 5J6XA 3ABMH 2GOMA 4BQNA 3FF5A 4ZYHA 2CQKA 1JGSA 4QWQA 1LDDA 4EJUA 2NNNA 2G7HA 2CUZA 2V79A 5J4YA 1V54H 4M6YA 4Y52J 1GV2A 2L9NA 5IP6A 2NNYA 5JLXA 2KPMA 1WVRA 1X58A 2EQRA 4WCGA 1K4TA 2E34A 1MSFC 3G3ZA 3RKXA 3MD2A 2HEOA 1HC8A 3UKGA 4EJOA 2WAQA 1EH8A 4XLFA 3BZ6A 5EYRA 1S7EA 3M8FA 4QTRA 2OAZA 1KGSA 1ZKGA 1LFPA 3I55I 4FISA 1USTA 2FQ4A 2QCOA 3K4KA 2L7FP 4Y7NJ 1XPXA 4E7SA 3F9KA 1RR7A 4ZDPA 5EG0A 2VBWA 4XKBA 2JWTA 3OR2C 2DMUA 2WV0A 5D6FA 4XRSA 2CGPA 3ULQB 4BL0B 4W1UA 3S1QJ 3WU1B 1R6RA 4FE4A 3TP0A 1TW2A 3TOAA 4W97A 1QVUA 2M87A 3FMSA 5E3LA 1BC8C 2K9SA 5D4RA 3GFMA 2FA5A 1TWAJ 3FXJA 1FNNA 1W0TA 3S15J 1IZ1A 3WTXC 2IS6A 2M0CA 1J7KA 2R7DA 2LD5A 2K02A 1X1CA 4ITVA 5E18F 1U9OA 2D2WA 5FB2A 1O4XA 4HOBA 4BEHA 3CCYA 4BH9A 2XRLA 2E71A 4UV8A 4MFEA 1IG7A 2BHZA 1R71A 2IGKA 1IO2A 5FLMJ 1OCZH 2QZ8A 1P4XA 2E1NA 4C9YA 5GTIC 3FM5A 2CJJA 3H0GJ 2BXYA 1FP1D 2ZMEA 2VONA 1SFKA 2W82A 3MEXA 5CQGA 4IQJA 2RNGA 4HV5A 1RI7A 5F04A 2VASA 4EVIA 3JRFA 3M3YJ 4HQMA 4B48A 2HTJA 4B47A 2MD0A 2QSHX 3I71A 3CC7I 4F7ZA 4ZDLA 1MMSA 1QVTA 5F0HA 1Z05A 2BVLA 2DK5A 3F72A 3HRUA 5CVRA 3TP3A 2GM4A 2H1KA 1LVAA 2IGNA 2B63J 3J7YJ 2CH0A 2I8DA 1MJAA 1Z3YA 4EM0B 1Z9CA 5DD4A 2VOPA 2EA4A 2Y48A 1RNLA 2Y9ZA 3ROUA 1XS9A 3A03A 4L0ZB 1JKRC 3EETA 2GIVA 4HYEA 4G6DA 1VTNC 3DPUA 2WA0A 4FQGA 4I98B 1LVKA 2HQRA 1PDNC 3I59A 1K61A 3H92A 2X6WA 3PSIA 4DBRA 2HQAA 3KP6A 4MIMA 4P9UA 2HVQA 4KDPA 4RM3A 4FHTA 2FOWA 3ZQGA 4A69C 5HS8A 3S17J 2KZVA 2WY8Q 5BMZA 1QNTA 4OIQF 2ZXHA 1SAUA 1D1CA 1R5ID 2OJED 3R0JA 4QPQA 2QKMB 2DT7B 2VE9A 4HLYA 1VQ4I 4M9SA 3KP2A 4XLHA 5HNHA 4BDYA 2F48A 3DLAA 1TW3A 2CW7A 3VYUB 3FHZA 3GEZA 3JRHA 1ZELA 2RN7A 3L00A 4A0ZA 2KRHA 4Y17A 4A3DJ 2PN6A 3CCVI 2ZXWH 2W85A 5E8GA 1ODDA 5CVJA 3RJPA 3K1NA 3RKYA 3LSIA 2XHKA 3E5QA 2ZMEC 1P92A 2DK8A 4RGSA 4BJ5C 4LK0F 4A3MJ 3H9JA 1MH4A 1CGPA 3FMRA 3OIOA 4RGUA 2ZBKA 2BW3B 2H27A 2IT0A 1B4AA 1ETVA 2WB1A 5CVVA 4CSWA 1ZHFA 1X4PA 2EILH 3A02A 3IAM2 1OYYA 3J7ZI 1HXDA 2X6YA 4HNUA 3ZMSA 3KLNA 4NC7A 2KT0A 1FIPA 2E36A 1LB2A 1Y8RB 1O57A 5DCMB 2LKSA 4XOTA 2KHMA 1Q1VA 2HDWA 3JAMZ 3E6CC 2DFEA 4UY8I 1XC5A 4UNOA 4FT8A 4KT6A 1D5VA 2OBPA 2GA2A 2XAFA 1UZCA 4UV9A 1SMYF 2E1CA 4IOCF 1ZG1A 1DP7P 3AFHA 1RZ4A 1RETA 3HKZN 3HG9A 4IHYA 2ECBA 3NWSA 4I09A 5F64A 1AHDP 1R9TJ 3G2BA 1TNSA 1QO0D 2Y75A 1KYZA 4KN4X 4HRIA 3BCBA 1W5SA 3P9CA 1ZARA 5D8LB 2IW5A 2LLKA 5M3FJ 2E1MB 2KRFA 3GUDA 4RAZA 5ILVA 4L0YB 1FEXA 4HW0A 1QA6A 5EEHA 4RAYA 1D0YA 1MW7A 4E4HA 1UMQA 4BS9A 3DKXA 3TMOA 5E17F 1JHFA 1DU6A 3C1DA 2XAHA 4XOPA 4PUSA 3LA2A 4S0HB 1Z7UA 1ZH5A 3GF2A 3TQNA 3GZNB 1FTTA 2STWA 3F23A 1SVOA 1TT5B 2DPUA 2C6YA 2E35A 1J09A 1ZRFA 1N78A 3LFUA 2BVMA 1D5YA 3TO7A 3K9TA 4F93B 4NBQA 5ICEA 4KMFA 5F27A 4J00A 1OYIA 1EJ9A 1T0FA 4ABZA 4M6XA 1BBYA 5D5WB 4E7JA 5LEKA 1MDMB 1DP3A 4LOCA 3TL4X 2JSCA 3MVPA 4Y4RA 1ORKA 4YIIA 2KISA 3R60A 5H20A 2Z2SB 2M5WA 4AM3A 2XV4S 3JRBA 2OZ6A 2X6OA 4BNCA 2LREA 4JQFA 2ZCWA 2KIQA 1D0XA 3QAHA 2DMTA 3GCMA 4PFOA 1HOMA 2HVSA 1O3TA 1P7IA 4KN7X 2QSGX 4WXDA 1OQYA 2P8TA 1ON1A 2LBFA 1D8KA 3OSGA 1T08B 4XNFA 4A5MA 1OLTA 1SAXA 3CDIA 3DV8A 2DO7A 2X51A 4EV0A 1G59A 1HQCA 2LKXA 3ZOBA 1F9NA 3BG3A 5E79C 3ZXSA 5TRDA 2NVXJ 3AL0B 3WU2C 5IYCJ 1XX5A 3TKYA 5LHIA 5DUIA 3HOXJ 2CQNA 2PMHA 3PUFA 4C2TA 3BPVA 4B8XA 1FZPB 2WY7Q 3BCAA 2AQEA 2FMYA 4G6TB 4YFNF 4HV6A 3GZ6A 1HW1A 1R49A 4RA2A 2COBA 1FSEA 2QF7A 2YUSA 3FKIJ 2CUFA 5J4VA 5BS6A 1SANA 3KEOA 2YX4A 1TNTA 2CO5A 2QLZA 3LAPA 1OR7C 3ABUA 2DW4A 5A2QZ 3ZMTA 4HBLA 3U1KA 1PP7U 3KZYA 1T39A 1LQ1A 2GXAA 3ZQIA 3MZHA 3QPHA 2X1EA 4XK4A 4C3IJ 2KJBA 4IEJA 4UVBA 4N9HA 2M45A 4CA0A 1D1AA 2LH9A 2ESHA 3CLOA 3FXKA 1PYVA 4LIVA 4D5FA 4HF1A 5HDNA 2XSDC 5GPAA 3WGGA 1PUFB 5EGOA 4I02A 3BR1A 1WJDA 4IKFA 2JA8J 3KP7A 3EYIA 2GBYA 1PVEA 1XDSA 3LSRA 2L9RA 1FOXA 2UUZA 3IAS2 3C2GA 3OL4A 5L3DA 4D9JA 3IL2A 2L3DA 2BHYA 4XORA 4AUXA 1ZR4A 1SFUA 1KQ9A 1CQTA 2GLOA 4M71A 4MO7A 4J19A 2X85A 4N4NB 1B59A 4DQ2A 2G0EA 1QQIA 4D0PA 1WH5A 4MLOA 3KX2A 3SZGA 4I01A 3OWTA 2R7FA 3OYFA 3CO7C 2R0QC 4PDKA 2JQ7A 3JREA 3DWLE 1E17A 5J1RA 3IHUA 4D7NA 2DU9A 2GAUA 2IEKA 4B43A 3IUOA 2VN2A 4NQWA 2MH9A 2OF7A 1R1UA 1BW6A 3NAUA 3ZQQA 5E8IA 2OTJI 2XRNA 3SZTA 2K4BA 4ZYGA 3RZDJ 3BZKA 3TW7A 2DDBA 4BAYA 4EEFG 2B7EA 2R93J 5IT3A 1YJNI 1MMAA 3QYFA 1K7AA 5F1JA 2FD5A 3LSKA 1KZHA 3IH3A 4FETA 4F92B 1SFOJ 3HKZA 1B6AA 3PIOF 1TWGJ 3K70D 1B8IB 3EUHA 4XN3A 4XIDA 1OCRH 1Y56A 2L9SA 3SHFA 4B1RA 3OS0A 1F1ZA 2RREA 1FP2A 2VQHA 4L5EA 4AIDA 2WBMA 3TGNA 2KIUA 3ERMA 3F8MA 4Q5SF 3DXJF 2UXNA 4XLAA 2DT6A 4AIJA 2DJNA 5B66C 5IP9J 1WHUA 3JCUC 4YIFA 2WAQN 4Q4ZF 3HOVJ 3CCUI 4XLPF 4U87A 1WQ2A 1VQLI 2L4AA 1FYKA 1U3EM 2W48A 3OYBA 1QZZA 5F1RA 2DQRA 4F52A 3MKWB 2RQPA 3BJAA 3BDDA 3V4GA 1VQNI 2BY1A 2XB5A 3IWFA 3TO6A 1ZRDA 1S7AA 3ABTA 4I0BA 1ETWA 3DBLB 3OYJA 3FXRA 3S2DJ 1J0RA 5HLHA 3DTKA 2DDAA 5J1UA 2WTEA 3G6EI 3CUQA 2P5KA 1GXPA 5DM7F 1WZ2A 3SZPA 3I64A 1W4MA 3DKYA 1Z0XA 4HPQA 1ON2A 2A68F 4ZYDA 3OSFA 2LMDA 5KCMA 4RB3C 4HEA2 2X6XA 1R1TA 1R5HA 2JSPA 3CTAA 5GPCA 4KJZA 4G7ZF 1TWHJ 2ZJ2A 5DM6F 3AG1H 2FSWA 4PJLA 5FGMA 3K4JA 2IAIA 2EA2A 4B3AA 4S05A 1FX7A 4CCJA 1WJ5A 2L4MA 5FFZA 3S93A 1FBUA 3CP8A 2R5ZB 2PI0A 3HEFA 4N9IA 2MC3A 1MGTA 2X1DA 4B44A 4E7KA 4BHBA 3BTIA 4M74A 2GOXB 1I27A 3E97A 2HTSA 3RIRA 2FXAA 5BQTA 1MBFA 2EFPA 4UVAA 4ANJA 1TC3C 2AXLA 2CS3A 5ED4A 5J40A 2AQFA 4M9XA 1FPQA 2Q1ZB 1RPWA 2LDUA 3JSOA 1IRXA 3BR3A 3CESA 4FTHA 1NG6A 3S16J 3A1YA 2H1LA 4FX4A 1VQOI 1S72I 2F5VA 3K2ZA 3M1EA 1Y39A 4XM3A 2DT5A 1O3QA 2P81A 5HNFA 5F08A 2Q0OA 3VSKA 4G9YA 3LSHA 2H8RA 3S8PA 1CF7B 3T5XA 2Z9OA 1R1VA 2HOSA 4ESJA 1MMNA 2M7BA 3LSJA 1XGNA 2A6EF 1RRJA 1EA3A 4H4KC 1X3WB 4BQQA 2OPTA 1MJ9A 1EH6A 1Y8QB 4MQVA 5EEAA 1BJZA 4HSRA 3OYKA 4M3FA 5L3EA 4NB5A 1EKEA 2P5LC 2M2EA 4M3DA 2KP6A 1ZG3A 2FEZA 1YW7A 2CU7A 2DA5A 2NS7A 4YFXF 2E2HJ 3W6VA 4IL6C 4BXXJ 5GTHC 4CCLA 2PFBA 2WADA 2FBHA 2L7MP 3DU5A 3SDGA 3I56I 1IRZA 1G8XA 5KNLA 4IHVA 2QQ9A 3E6MA 3LSMA 4M9ZA 1H9GA 1SD7A 2LY9A 3E6BA 4F91B 4HF2A 3IH4A 2HWVA 2VJ5A 2W4SA 3P5JA 1MNDA 3CCEI 4E7LA 3HDDA 2PLYA 4V2GA 1KU7A 4II2A 3RZOJ 3H1CA 1BI1A 2ZJRF 4NC8A 3ZQCA 2EPFA 5J8CA 2XAGA 2P0WA 1X1PA 4QIWN 2LFBA 5EEGA 4R79A 3ZMUA 2OC6A 2LYCA 2YR2A 5F6FA 2WB1N 3WG9A 1VQ8I 3JR9A 1S7OA 3L2CA 3K1PA 1YITI 1ACIA 3OYDA 2Y0MA 2EK5A 4DIQA 2ZFUA 3CJNA 3J80Z 2XC7A 3FIWA 3CCRI 2V1DA 4OAYA 4G94A 4V19K 2OD5A 3C18A 3A01A 4HNVA 4UUSB 3HOUJ 3MN2A 1V4RA 1OCCH 4JOMA 1JGGA 1T38A 2GQQA 1ZN2A 1U5TA 2VJ4A 1JKPC 1LE8A 3LA7A 1IW7F 5HLIA 4XQFA 2F5EA 1QZYA 2R7TA 2IA1A 1S9HA 4FASD 3KEQA 3OY9A 2KIFA 1V3FA 2VC1A 3MAJA 4EMSA 2DI3A 1DQUA 2RKHA 4A3GJ 3GW2A 2K86A 2AXTC 1J9IA 1V55H 2HYGD 2A05A 5GAEJ 1W7PB 2VPLA 1BI2A 3TO9A 2CMPA 2EIKH 3E6DA 3VYTB 1KU2A 1XGMA 2RGVA 4HLXA 3GTPJ 1VQ5I 4NHJA 3LWFA 3L2WA 1X3ZB 5B1BH 4YFKF 4A3BJ 1LEBA 3H5NA 1I6HJ 3LL7A 2DYRH 2IS4A 1FTZA 3KCCA 1IDZA 2K85A 5FRMA 4ZJZA 2EWNA 2VODA 4D7MA 4OU0A 5J3LA 4EQQA 1FLIA 1IC8A 2ME0A 1E2XA 5CVIA 2UZKA 2AO9A 2F5FA 4DOZA 2D1HA 2LOOA 2RV8A 4UB6C 1EH7A 2JA5J 4HX7A 1ZLJA 2WC2A 1Z3XA 1GXQA 2DA1A 3MZ8A 3DLLF 1YHQI 1TBXA 1YS7A 3P9KA 1KONA 4ENKA 3HRSA 2CV1A 2EV6A 3CCMI 2VKDA 3UR3C 3ASOH 2EFQA 2XPUA 4WK8F 3Q0WA 4ZYEA 1ITYA 5FLVA 2ZB9A 2K9NA 1BL0A 2DA3A 3PSFA 2XROA 3EQLF 3LNQA 2ELHA 2LNBA 1YIOA 3Q9VA 4UB8C 2XVCA 1VQPI 5ILUA 2EV5A 2FNAA 2YPRA 4L5JA 3SEZA 3VEPA 3L2QA 3F21A 5ICFA 1BI0A 2B9SA 4IO9F 1SD4A 3FM3A 3SJMA 3D1NI 1KU3A 2AS5F 4EJVA 4IF4A 1HA8A 3E3VA 1XSDA 2QBYA 3I54A 1FSHA 4AVPA 5D6EA 1MBHA 3AG4H 4IRGA 1U8BA 1SEUA 1S8NA 1U8RA 3CDLA 1VQ6I 2YU3A 2A6TA 2W7NA 3QRFF 2F4OB 3CJRB 4BU2A 3WTSC 1VQ9I 3E0JB 4JK1X 5LGNA 2GZWA 4ON0A 4DBQA 1R00A 5DV5A 3M07A 3C2BA 3OIQA 4CYCA 3D5SC 2OZUA 3QYEA 5E3MA 1IN8A 4G12A 3G71I 4MTEA 5LBQA 4M3BA 5DEQA 3CC2I 4KIBA 2O9LA 1YX5A 3ZN1A 2MA3A 2R3SA 4RB1A 2HPMA 4BYYA 1HDDC 4LB6B 2JVGA 2MG4A 3K6GA 1I1SA 4OWRB 2ECCA 2NOGA 5FKLA 1W36C 2XB0X 2H09A 4HQEA 1Z91A 2VQGA 1TQPA 3HOTA 4RLFA 4A12A 3DP7A 2P5VA 4RS8A 4NDLA 2ZXJA 1AA7A 1ZGAA 3QODA 3HUGB 4HA8A 1U9NA 2JRTA 4ZH4F 3CCSI 1BC7C 3K4CA 4XSZF 1IUFA 4PSXA 4DYCA 5FROA 5DUKA 3NRVA 1IJWC 1DDNA 3H35A 2XKOA 3KZIC 5LEJA 3PNTA 1J5YA 4B3XA 2EFNA 1WJEA 5L3BA 4RDUA 3HSEA 2TRTA 5TJJA 2LR8A 2DOFA 4EGZA 4G7OF 3HSRA 4U0YA 1K6YA 4KIGA 5IOZA 3FXLA 4CICA 2IGOA 1MMDA 4HX4A 3F6OA 2V9PA 1RUOA 3EDPA 4WX9A 1A04A 3LSTA 5D5VB 2PJRB 4PZJA 1JUPA 1Q1HA 4BY7J 3ZRGA 4OIRF 9ANTA 1W1WE 4MFDA 5IT9Z 3RPQA 3I58A 2HGCA 4BQAA 3FDYA 3EYYA 2OCEA 3V8LA 3CLQA 4FE7A 3W2VA 1DPRA 3QOEA 3SDBA 2R5YA 2IBDA 2M3AA 2V26A 3ABKH 2Q2EB 5DS9A 3JRIA 3HOYJ 2OUMA 1WJFA 1MBKA 3C3WA 3L7WA 1K83J 2IS1A 3DPLC 2XGCA 2M8GX 4LG0A 2HXIA 1FYLA 5GAHJ 4XR6A 1AU7A 3I4MJ 3D5LA 4JX5A 2Y30A 4A5NA 3WG7H 4DZPA 4G8XA 1YRNA 1MBJA 4KIFA 2DMQA 4IJAA 4DJAA 4N4OB 3IV5A 4A3FJ 3BZCA 2DAOA 5IPAA 5FKMA 3OL3A 4PJMA 2N8GA 1JE8A 4LLGF 3CF2A 1R58A 2KIMA 5E3NA 4II3A 2QQ8A 4UVCA 1YW9A 5LHHA 1ZQ3P 2MH2A 4RGXA 1TP4A 2VKVA 5IYDJ 3T8TA 2BY3A 2CG4A 3OYEA 2ELKA 3PJRA 5ERIA 4JX4A 1P6RA 2QWWA 3IKTA 3F8FA 4C30A 3K4LA 1WGXA 1K6OA 2R7ZJ 1ZG5A 3M9AA 1T98A 1O3SA 2L5QA 2CRGA 4BE0A 2NVQJ 3M8JA 2HKXA 3RCOA 2BOLA 3BQZA 1S5LC 3GTKJ 1K78B 2OV7A 3BR0A 3ZMVA 1XSXA 3CMYA 3BR6A 1NK3P 4E7IA 3K7AJ 1XMXA 4GO1A 1WKMA 1Z67A 1IN6A 4M3EA 5L3FA 2VJIA 2FUG2 3B6CA 3KETA 3HB9A 3L9FA 4LMYA 4LJZF 4YRVA 2JA7J 2H6BA 4NNJA 2ZKZA 4ENMA 3PO3J 3U21A 3MCZA 5K7ZA 1B72B 3NWTA 4K2EA 3RQIA 4BHPA 2JZYA 3PIPF 4ZZLA 4U0WA 1TL8A 2OU2A 3GWZA 3Q0VA 1RKTA 3TOBA 5M5YJ 3HTSB 1PP8F 2LRDA 2PG4A 4Y3OA 2YX7A 1S6LA 3CDHA 3FX3A 3HJEA 1ERDA 1A35A 3IH2A 2PQ8A 4KA4A 1FIAA 3OS1A 2CUJA 1XN7A 3O8HA 1E3HA 2EBIA 1N75A 2V1UA 3MMYB 1E3OC 4UHTA 2NS8A 2CQXA 4IPAA 3ZCOA 5LRSA 1I39A 2FF4A 2L54A 2X0LA 3KPHA 1U2WA 3PL8A 2BXZA 2QUFA 1T0FC 1X3UA 3G1OA 5FJ8J 3VWBA 2XAJA 2FX0A 2QGUA 3JAMK 1STZA 3RI4A 1QRYA 4XLNF 5D4SA 1R36A 2COMA 5FKOA 1AKHA 1IV6A 3CMAI 1MZBA 4YEJA 1IN5A 4XICA 1JUSA 4GCVA 3FHNA 3KFWX 3ML6A 5EG0B 1HKTA 5C44J 1BIAA 3J81Z 1UHMA 3D5RC 3L2RA 1BIBA 3TW6A 1FWZA 1HW5A 3B6AA 3DEEA 1I3AA 4AIHA 1GLNA 2HQNA 4RAGA 1IUYA 3IP4B 3GTMJ 2IVMA 2P7CB 4P9FA 3F0CA 1MH3A 3H5AA 3PFIA 2DQLA 2XF7A 4CZCA 1LUJB 3Q5FA 2CFXA 1YJ9I 1OPCA 2HOTA 1SFXA 2XAQA 4BJTA 2QYOA 4PJNA 4IRHA 3QP6A 2IS2A 4G6QA 4UUTA 1YIJI 1TTYA 2RAEA 3L2UA 3TDZC 2DA6A 2W24A 4IHWA 4LLNA 2P4WA 4I76A
chains in the Genus database with same CATH topology
1W0TA 3S15J 2H8RA 2FJ1A 2M0CA 3S14J 2NVYJ 2O8KA 2JK3A 2LD5A 5GP9A 2HOSA 3LSJA 1GT0C 5F0CA 1U9OA 1O4XA 4BBSJ 2OPTA 3CCYA 2XRLA 4DYQA 4MFEA 3OOUA 4V2FA 1BJZA 5EEAA 5C3EJ 4M3FA 1IG7A 3HGGA 2M2EA 4M3DA 5FLMJ 3QQAA 4JYKA 2CU7A 2DA5A 2NS7A 2E2HJ 4BXXJ 3W6VA 2HXOA 1RKWA 2K40A 1IDYA 2CJJA 3H0GJ 2L7MP 3K2AA 3SDGA 1IRZA 2D5VA 4IHVA 2R92J 4X1EA 1U78A 2XPWA 2MSYA 2LY9A 5F04A 4DZJA 3QPLA 3IH4A 2M34A 3JRFA 1BW5A 3HDDA 1UG2A 2EZKA 2XPVA 4V2GA 3M3YJ 3BTCA 1OCPA 5EZHA 3RZOJ 3ZQCA 1QVTA 5F0HA 3TP3A 1VF9A 4QIWN 2H1KA 2GM4A 2B63J 2LFBA 1JT6A 4AYBN 2VUMJ 2Y9ZA 3GTQJ 2Y0SN 1XS9A 3A03A 1JKRC 2WB1N 3A01B 3JR9A 1OFCX 4A93J 4A3IJ 1HLVA 4A3CJ 1WI3A 2LTPA 1I50J 3G1MA 2HOAA 3MKLA 1LE8B 3FIWA 2DTZA 2Y31A 4C3HJ 1K61A 3BR2A 3A01A 5BNGA 4MIMA 4HNVA 3BTLA 4UUSB 2M9HA 3HOUJ 3MN2A 1MBGA 3ZQGA 4A69C 1JGGA 4BY1J 3S17J 2VPRA 3BT9A 4XRSG 1LE8A 1JKPC 2L7ZA 1ZR2A 2E1OA 1ETYA 2AHQA 3GTOJ 1P7JA 1OCTC 4UUSA 3E7LA 1Z77A 1F36A 1JJ8C 4A3GJ 3JRHA 4I6ZA 2E19A 4A3DJ 3HOZJ 4BBRJ 4A3MJ 2JA6J 1MH4A 2JMWA 3OIOA 2E2JJ 3GTPJ 1ETVA 3A02A 1W0UA 1X2MA 1T56A 4A3BJ 1I6HJ 2KT0A 1FTZA 1FIPA 2O7OA 3HOWJ 1IDZA 2K9QA 2HDDA 1Q1VA 4D7MA 5J3LA 1XC5A 3L1PA 1IC8A 2ME0A 2AO9A 1WPKA 4A3KJ 2JA5J 2WV1A 2DA1A 4FCYA 3Q0UA 1F43A 1RETA 3HKZN 1HF0A 4IHYA 3SFIA 2ECBA 2HYJA 1AHDP 3S2HJ 1R9TJ 1GDTA 1NTCA 4A3JJ 2JN6A 3H3VK 2XPUA 3Q0WA 2EZLA 2LK2A 1ITYA 5FLVA 2LLKA 1POGA 3HGYA 5M3FJ 2ZB9A 2K9NA 1BL0A 4A3LJ 2DA3A 3LNQA 1FEXA 1ETKA 5FKKA 4JX6A 1UMQA 3PM1A 1ETOA 1NK2P 1DU6A 5M3MJ 1I3QJ 3SJMA 4S0HB 3D1NI 4IHXA 1FTTA 1Y1VJ 1ETQA 5C4XJ 3HBLA 1U8BA 1D5YA 1MBHA 4CYCB 3FK7A 2JJ7A 2MGQA 3CDLA 4DW6A 5F27A 2EZHA 4ABZA 1X2NA 3CQZJ 1WH7A 4LOCA 3JRCA 1TWCJ 4RBOA 1RESA 3C2BA 3MVPA 3JRDA 1Y1WJ 4CYCA 1JUMA 1ORKA 4M3GA 1LFBA 5E3MA 2CQQA 2DA7A 4G12A 3DCFA 4M3BA 3JRBA 2O9LA 2X6OA 1HDDC 2DMTA 1JTXA 1A6IA 2MG4A 1HOMA 4BKXA 3QPSA 2ECCA 2NOGA 5FKLA 2XB0X 1P7IA 2DA2A 2E2IJ 2X9DA 2VKEA 4C2MJ 1HCRA 3OSGA 1ENHA 4NDLA 2NVXJ 1U9NA 3ZOBA 5J1YA 3BG3A 2LKXA 5IYCJ 3HOXJ 1JJ6C 1IUFA 3TEDA 3ZQLA 4DYCA 1IJWC 4AC0A 2Y9YA 2COBA 2QF7A 2YUSA 3FKIJ 2CUFA 4RDUA 2TRTA 1SANA 2LR8A 1ZGWA 4A3EJ 1JT0A 3JRGA 5IOZA 1A5JA 3BR5A 1H89C 5F0FA 3ZQIA 5C4JJ 4XK4A 1MNMC 3Q3SA 4C3IJ 5DTDA 4IEJA 1JUPA 4BY7J 5EGOB 2R5YB 5IYBJ 2LP0A 9ANTA 1VFCA 4MFDA 2MW8A 5HODA 1IGNA 1GUUA 4D5FA 5IP7J 4JP0A 4FE7A 2XSDC 3BQYA 2TCTA 5GPAA 4B4CA 2R5YA 1PUFB 5EGOA 2L0KA 2IBDA 2ID3A 3BR1A 3HOYJ 5DS9A 3JRIA 2JA8J 2GBYA 3S1NJ 3LOCA 3LSRA 1MBKA 2L9RA 1OJLA 1K83J 1YRNB 1MSEC 1T33A 1JKQC 2XGCA 2M8GX 1PUFA 2HXIA 1UHSA 4AUXA 1ZR4A 2ME6A 1AU7A 2GLOA 1CQTA 3I4MJ 4JX5A 4MO7A 2Y30A 4J19A 3GBGA 4XRMA 3JRAA 3GTJJ 3LSPA 4DZPA 2G0EA 1YRNA 1MBJA 2HI3A 2DMQA 1WH5A 5JLWA 3IV5A 2X48A 4MLOA 3VPRA 4A3FJ 2KDZA 5IPAA 5FKMA 4C3JJ 2DA4A 2R0QC 2N8GA 1ETXA 3JREA 3BG9A 5J1RA 2HQ5A 4D7NA 1APLC 2IEKA 1ZTRA 5E3NA 1ZK8A 3ZQFA 2OF7A 1ZQ3P 1BW6A 2EZIA 3NAUA 2VKVA 5IYDJ 4D5CA 3RZDJ 3TW7A 4GFBA 1TWFJ 4EEFG 3DEWA 2R93J 2ELKA 1G2HA 4JX4A 5FKNA 1JTYA 2YS9A 5F1JA 1VNDA 5M5XJ 1WGXA 2R7ZJ 2FD5A 3IH3A 4M6VA 2EH3A 1SFOJ 2CRGA 3LSGA 2YU9J 2NVQJ 1TWGJ 1VI0A 1B8IB 3BQZA 3GTKJ 3BR0A 3WHCA 3CMYA 3S1MJ 3ZQHA 4XIDA 3BR6A 1HDPA 1NK3P 4B1RA 1FJLA 3K7AJ 2DMPA 4L5EA 4M3EA 1B8IA 4DYRA 3I4NJ 3B6CA 2I10A 3HB9A 4X6AJ 3G1LA 3WHBA 3GTGJ 2JA7J 1MBEA 2LVSA 2DJNA 2CUEA 5IP9J 3PO3J 5K7ZA 5M5WJ 1B72B 2WAQN 5E3OA 3RQIA 3HOVJ 3FK6A 3BG5A 2DN0A 2W48A 3Q0VA 1RKTA 3BTJA 5M5YJ 1GVDA 2Y2ZA 1B72A 1XG1A 3FISA 2XB5A 1H88C 1LFUP 5EDNA 5K7HA 1ETWA 5IOYA 3GTLJ 3RKQA 3IH2A 1EF4A 3S2DJ 5J1UA 1FIAA 2ID6A 5K7FA 3O8HA 2EBIA 3NARA 1JKOC 3PO2J 1E3OC 1H8AC 1QPIA 1Z0XA 2NS8A 1DU0A 4QSHA 3OSFA 1BA5A 2CQXA 1AKHB 5EZGA 5GPCA 1TWHJ 3O8GA 3G1OA 5FJ8J 2FX0A 4Y52J 1GV2A 1WCMJ 2IAIA 1QRYA 4B3AA 5IP6A 2R5ZB 5JLXA 5FKOA 1X58A 1AKHA 2EQRA 2XGDA 3HEFA 1IV6A 1MSFC 2XGEA 2NVTJ 3UKGA 4XICA 1JUSA 3HM5A 5EYRA 1S7EA 5EG0B 3BTIA 5C44J 4QTRA 2R5ZA 1ZKGA 5EF6A 1MBFA 3S1RJ 2PMZN 4FISA 1TC3C 3TW6A 2FQ4A 2QCOA 3B6AA 2L7FP 4Y7NJ 3GTMJ 1RR7A 5EG0A 1RPWA 1GV5A 3BR3A 4FTHA 3F0CA 3S16J 2JWTA 2DMUA 4XRSA 1MH3A 4W1UA 3M4OJ 2DMNA 3S1QJ 4FE4A 3TP0A 2HOTA 4W97A 1QVUA 5E3LA 2VI6A 2K9SA 4UUTA 2P81A 2RAEA 4IHWA 2DA6A 1TWAJ 4I76A 5F08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0T A;  3S15 J;  2H8R A;  2FJ1 A;  2M0C A;  3S14 J;  2NVY J;  2O8K A;  2JK3 A;  2LD5 A;  5GP9 A;  2HOS A;  3LSJ A;  1GT0 C;  5F0C A;  1U9O A;  1O4X A;  4BBS J;  2OPT A;  3CCY A;  2XRL A;  4DYQ A;  4MFE A;  3OOU A;  4V2F A;  1BJZ A;  5EEA A;  5C3E J;  4M3F A;  1IG7 A;  3HGG A;  2M2E A;  4M3D A;  5FLM J;  3QQA A;  4JYK A;  2CU7 A;  2DA5 A;  2NS7 A;  2E2H J;  4BXX J;  3W6V A;  2HXO A;  1RKW A;  2K40 A;  1IDY A;  2CJJ A;  3H0G J;  2L7M P;  3K2A A;  3SDG A;  1IRZ A;  2D5V A;  4IHV A;  2R92 J;  4X1E A;  1U78 A;  2XPW A;  2MSY A;  2LY9 A;  5F04 A;  4DZJ A;  3QPL A;  3IH4 A;  2M34 A;  3JRF A;  1BW5 A;  3HDD A;  1UG2 A;  2EZK A;  2XPV A;  4V2G A;  3M3Y J;  3BTC A;  1OCP A;  5EZH A;  3RZO J;  3ZQC A;  1QVT A;  5F0H A;  3TP3 A;  1VF9 A;  4QIW N;  2H1K A;  2GM4 A;  2B63 J;  2LFB A;  1JT6 A;  4AYB N;  2VUM J;  2Y9Z A;  3GTQ J;  2Y0S N;  1XS9 A;  3A03 A;  1JKR C;  2WB1 N;  3A01 B;  3JR9 A;  1OFC X;  4A93 J;  4A3I J;  1HLV A;  4A3C J;  1WI3 A;  2LTP A;  1I50 J;  3G1M A;  2HOA A;  3MKL A;  1LE8 B;  3FIW A;  2DTZ A;  2Y31 A;  4C3H J;  1K61 A;  3BR2 A;  3A01 A;  5BNG A;  4MIM A;  4HNV A;  3BTL A;  4UUS B;  2M9H A;  3HOU J;  3MN2 A;  1MBG A;  3ZQG A;  4A69 C;  1JGG A;  4BY1 J;  3S17 J;  2VPR A;  3BT9 A;  4XRS G;  1LE8 A;  1JKP C;  2L7Z A;  1ZR2 A;  2E1O A;  1ETY A;  2AHQ A;  3GTO J;  1P7J A;  1OCT C;  4UUS A;  3E7L A;  1Z77 A;  1F36 A;  1JJ8 C;  4A3G J;  3JRH A;  4I6Z A;  2E19 A;  4A3D J;  3HOZ J;  4BBR J;  4A3M J;  2JA6 J;  1MH4 A;  2JMW A;  3OIO A;  2E2J J;  3GTP J;  1ETV A;  3A02 A;  1W0U A;  1X2M A;  1T56 A;  4A3B J;  1I6H J;  2KT0 A;  1FTZ A;  1FIP A;  2O7O A;  3HOW J;  1IDZ A;  2K9Q A;  2HDD A;  1Q1V A;  4D7M A;  5J3L A;  1XC5 A;  3L1P A;  1IC8 A;  2ME0 A;  2AO9 A;  1WPK A;  4A3K J;  2JA5 J;  2WV1 A;  2DA1 A;  4FCY A;  3Q0U A;  1F43 A;  1RET A;  3HKZ N;  1HF0 A;  4IHY A;  3SFI A;  2ECB A;  2HYJ A;  1AHD P;  3S2H J;  1R9T J;  1GDT A;  1NTC A;  4A3J J;  2JN6 A;  3H3V K;  2XPU A;  3Q0W A;  2EZL A;  2LK2 A;  1ITY A;  5FLV A;  2LLK A;  1POG A;  3HGY A;  5M3F J;  2ZB9 A;  2K9N A;  1BL0 A;  4A3L J;  2DA3 A;  3LNQ A;  1FEX A;  1ETK A;  5FKK A;  4JX6 A;  1UMQ A;  3PM1 A;  1ETO A;  1NK2 P;  1DU6 A;  5M3M J;  1I3Q J;  3SJM A;  4S0H B;  3D1N I;  4IHX A;  1FTT A;  1Y1V J;  1ETQ A;  5C4X J;  3HBL A;  1U8B A;  1D5Y A;  1MBH A;  4CYC B;  3FK7 A;  2JJ7 A;  2MGQ A;  3CDL A;  4DW6 A;  5F27 A;  2EZH A;  4ABZ A;  1X2N A;  3CQZ J;  1WH7 A;  4LOC A;  3JRC A;  1TWC J;  4RBO A;  1RES A;  3C2B A;  3MVP A;  3JRD A;  1Y1W J;  4CYC A;  1JUM A;  1ORK A;  4M3G A;  1LFB A;  5E3M A;  2CQQ A;  2DA7 A;  4G12 A;  3DCF A;  4M3B A;  3JRB A;  2O9L A;  2X6O A;  1HDD C;  2DMT A;  1JTX A;  1A6I A;  2MG4 A;  1HOM A;  4BKX A;  3QPS A;  2ECC A;  2NOG A;  5FKL A;  2XB0 X;  1P7I A;  2DA2 A;  2E2I J;  2X9D A;  2VKE A;  4C2M J;  1HCR A;  3OSG A;  1ENH A;  4NDL A;  2NVX J;  1U9N A;  3ZOB A;  5J1Y A;  3BG3 A;  2LKX A;  5IYC J;  3HOX J;  1JJ6 C;  1IUF A;  3TED A;  3ZQL A;  4DYC A;  1IJW C;  4AC0 A;  2Y9Y A;  2COB A;  2QF7 A;  2YUS A;  3FKI J;  2CUF A;  4RDU A;  2TRT A;  1SAN A;  2LR8 A;  1ZGW A;  4A3E J;  1JT0 A;  3JRG A;  5IOZ A;  1A5J A;  3BR5 A;  1H89 C;  5F0F A;  3ZQI A;  5C4J J;  4XK4 A;  1MNM C;  3Q3S A;  4C3I J;  5DTD A;  4IEJ A;  1JUP A;  4BY7 J;  5EGO B;  2R5Y B;  5IYB J;  2LP0 A;  9ANT A;  1VFC A;  4MFD A;  2MW8 A;  5HOD A;  1IGN A;  1GUU A;  4D5F A;  5IP7 J;  4JP0 A;  4FE7 A;  2XSD C;  3BQY A;  2TCT A;  5GPA A;  4B4C A;  2R5Y A;  1PUF B;  5EGO A;  2L0K A;  2IBD A;  2ID3 A;  3BR1 A;  3HOY J;  5DS9 A;  3JRI A;  2JA8 J;  2GBY A;  3S1N J;  3LOC A;  3LSR A;  1MBK A;  2L9R A;  1OJL A;  1K83 J;  1YRN B;  1MSE C;  1T33 A;  1JKQ C;  2XGC A;  2M8G X;  1PUF A;  2HXI A;  1UHS A;  4AUX A;  1ZR4 A;  2ME6 A;  1AU7 A;  2GLO A;  1CQT A;  3I4M J;  4JX5 A;  4MO7 A;  2Y30 A;  4J19 A;  3GBG A;  4XRM A;  3JRA A;  3GTJ J;  3LSP A;  4DZP A;  2G0E A;  1YRN A;  1MBJ A;  2HI3 A;  2DMQ A;  1WH5 A;  5JLW A;  3IV5 A;  2X48 A;  4MLO A;  3VPR A;  4A3F J;  2KDZ A;  5IPA A;  5FKM A;  4C3J J;  2DA4 A;  2R0Q C;  2N8G A;  1ETX A;  3JRE A;  3BG9 A;  5J1R A;  2HQ5 A;  4D7N A;  1APL C;  2IEK A;  1ZTR A;  5E3N A;  1ZK8 A;  3ZQF A;  2OF7 A;  1ZQ3 P;  1BW6 A;  2EZI A;  3NAU A;  2VKV A;  5IYD J;  4D5C A;  3RZD J;  3TW7 A;  4GFB A;  1TWF J;  4EEF G;  3DEW A;  2R93 J;  2ELK A;  1G2H A;  4JX4 A;  5FKN A;  1JTY A;  2YS9 A;  5F1J A;  1VND A;  5M5X J;  1WGX A;  2R7Z J;  2FD5 A;  3IH3 A;  4M6V A;  2EH3 A;  1SFO J;  2CRG A;  3LSG A;  2YU9 J;  2NVQ J;  1TWG J;  1VI0 A;  1B8I B;  3BQZ A;  3GTK J;  3BR0 A;  3WHC A;  3CMY A;  3S1M J;  3ZQH A;  4XID A;  3BR6 A;  1HDP A;  1NK3 P;  4B1R A;  1FJL A;  3K7A J;  2DMP A;  4L5E A;  4M3E A;  1B8I A;  4DYR A;  3I4N J;  3B6C A;  2I10 A;  3HB9 A;  4X6A J;  3G1L A;  3WHB A;  3GTG J;  2JA7 J;  1MBE A;  2LVS A;  2DJN A;  2CUE A;  5IP9 J;  3PO3 J;  5K7Z A;  5M5W J;  1B72 B;  2WAQ N;  5E3O A;  3RQI A;  3HOV J;  3FK6 A;  3BG5 A;  2DN0 A;  2W48 A;  3Q0V A;  1RKT A;  3BTJ A;  5M5Y J;  1GVD A;  2Y2Z A;  1B72 A;  1XG1 A;  3FIS A;  2XB5 A;  1H88 C;  1LFU P;  5EDN A;  5K7H A;  1ETW A;  5IOY A;  3GTL J;  3RKQ A;  3IH2 A;  1EF4 A;  3S2D J;  5J1U A;  1FIA A;  2ID6 A;  5K7F A;  3O8H A;  2EBI A;  3NAR A;  1JKO C;  3PO2 J;  1E3O C;  1H8A C;  1QPI A;  1Z0X A;  2NS8 A;  1DU0 A;  4QSH A;  3OSF A;  1BA5 A;  2CQX A;  1AKH B;  5EZG A;  5GPC A;  1TWH J;  3O8G A;  3G1O A;  5FJ8 J;  2FX0 A;  4Y52 J;  1GV2 A;  1WCM J;  2IAI A;  1QRY A;  4B3A A;  5IP6 A;  2R5Z B;  5JLX A;  5FKO A;  1X58 A;  1AKH A;  2EQR A;  2XGD A;  3HEF A;  1IV6 A;  1MSF C;  2XGE A;  2NVT J;  3UKG A;  4XIC A;  1JUS A;  3HM5 A;  5EYR A;  1S7E A;  5EG0 B;  3BTI A;  5C44 J;  4QTR A;  2R5Z A;  1ZKG A;  5EF6 A;  1MBF A;  3S1R J;  2PMZ N;  4FIS A;  1TC3 C;  3TW6 A;  2FQ4 A;  2QCO A;  3B6A A;  2L7F P;  4Y7N J;  3GTM J;  1RR7 A;  5EG0 A;  1RPW A;  1GV5 A;  3BR3 A;  4FTH A;  3F0C A;  3S16 J;  2JWT A;  2DMU A;  4XRS A;  1MH3 A;  4W1U A;  3M4O J;  2DMN A;  3S1Q J;  4FE4 A;  3TP0 A;  2HOT A;  4W97 A;  1QVU A;  5E3L A;  2VI6 A;  2K9S A;  4UUT A;  2P81 A;  2RAE A;  4IHW A;  2DA6 A;  1TWA J;  4I76 A;  5F08 A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  2XDV A;  1LPQ A;  1REP C;  4BEH B;  1Z6T A;  4HAM A;  1WI9 A;  1X1B A;  2FJ1 A;  4BUP A;  3S14 J;  2OQR A;  2NVY J;  3MZY A;  2V7F A;  3B02 A;  5GP9 A;  4S04 A;  2H94 A;  4ZZD A;  3H0D A;  3HHG A;  5F0C A;  3JTG A;  3ECH A;  3SYT A;  2HKO A;  2ZME B;  1RUN A;  4AVZ A;  3OOU A;  5FLX Z;  2D1V A;  4X0G A;  1KU9 A;  3HGG A;  3E1S A;  2W57 A;  3GXO A;  2EIN H;  3KP3 A;  4CDG A;  1IDY A;  1R22 A;  2JPC A;  3ONQ A;  4KIT B;  2R92 J;  1U78 A;  2JTV A;  2VBZ A;  1XGO A;  2MSY A;  4E7H A;  3WTU C;  4DZJ A;  4GXO A;  5DCF A;  3QPL A;  4IHS A;  2M34 A;  1OCO H;  4ZYA A;  3L09 A;  2IXS A;  4IOA F;  2RDP A;  1PJR A;  1UG2 A;  2FBI A;  2XPV A;  3COA C;  2MLG A;  5EZH A;  5LRR A;  3CCL I;  3JW4 A;  3PNV A;  5E1Z B;  5HLG A;  1YX3 A;  3FXQ A;  5H6R A;  3GLX A;  3VYS B;  1SVM A;  1VF9 A;  2A3S A;  1JT6 A;  2K7L A;  3CZ6 A;  4KIC A;  2QSF X;  5JHU A;  5LD2 C;  4AYB N;  2ZNZ A;  3I59 B;  1KA8 A;  3GTQ J;  4CH7 A;  2O3F A;  2R4G A;  5JFR A;  4RB2 C;  1XDU A;  1OFC X;  2ZC2 A;  3HIF A;  1FOK A;  1HLV A;  2V6E A;  2R7W A;  1WI3 A;  2LTP A;  1I50 J;  3HYI A;  3PQJ A;  5CPR B;  1Z21 A;  2DTZ A;  2Y31 A;  2HR3 A;  1DPU A;  3O6B B;  5LHG A;  1YI2 I;  1MIJ A;  2Q8K A;  3BR2 A;  1FMW A;  1HKS A;  3MFK A;  1LDK B;  2O03 A;  5A2Q K;  2M9H A;  5CYV A;  1MBG A;  4BY1 J;  2FE3 A;  1T95 A;  2NAZ A;  5IY5 H;  2W25 A;  1LEA A;  2ACJ A;  3BT9 A;  1SD5 A;  3H36 A;  2QVO A;  1ZR2 A;  3ECO A;  2MFZ A;  2A6H F;  1ETY A;  2AHQ A;  2DPD A;  5B5E C;  4F3Q A;  3X2Q H;  3ZGK A;  3F8N A;  1N77 A;  2KFD A;  1VQK I;  2GXG A;  5JI6 A;  2V9K A;  2LKP A;  1JJ8 C;  3BC8 A;  1L0O C;  3GYH X;  1AWC A;  1J59 A;  1G3Y A;  4GYG A;  4I6Z A;  1A36 A;  4I99 C;  2E19 A;  3HPH A;  4XLC A;  3T0Y A;  2M4G A;  4BBR J;  4A6D A;  1FYM A;  4IXA A;  2XUB A;  2J5P A;  2MYS A;  4XKV A;  3QYB A;  2TDX A;  2Y0S A;  1AOY A;  2QQB A;  3EUH C;  3OYI A;  1HBX G;  3R0A A;  5CQE A;  3QWL A;  1FBQ A;  3F3X A;  2O5R A;  1SVL A;  2HFH A;  2O7O A;  2EB7 A;  1GVJ A;  3WTZ A;  4HDU A;  4ESB A;  3PFY A;  2IPQ X;  2K9Q A;  1S29 A;  3DKW A;  3NEU A;  2HDD A;  2MBF A;  4WF2 A;  2BW3 A;  1A31 A;  1USS A;  2PJP A;  1J2X A;  1ONV A;  2DOD A;  3L1P A;  1WPK A;  4AWX B;  1QBJ A;  4KIS A;  1XMA A;  3FXO A;  4XN0 A;  4A3K J;  5DCM A;  2Y69 H;  4OIO F;  2R7X A;  2WV1 A;  3DTI A;  2VL8 A;  2B0L A;  1F43 A;  1G3S A;  2H8W A;  2Z16 A;  3LAJ A;  4HDV A;  2HYJ A;  4OIN F;  3O3K A;  3M8E A;  3S2H J;  1GDT A;  1NTC A;  3GFJ A;  1QPM A;  4A3J J;  2CYY A;  2K27 A;  3KYL A;  1YE9 A;  3HGY A;  4A3L J;  3WE2 A;  2VOO A;  3HZJ A;  3FKJ A;  3CUQ C;  4CHU A;  3CJT B;  2NVU B;  5FKK A;  4JX6 A;  3VFZ A;  2I5U A;  1NG7 A;  2NOJ B;  2BZT A;  3J7A Y;  2RQQ A;  1ETO A;  3P9I A;  5M3M J;  3OYM A;  3E5X A;  1I3Q J;  3AG2 H;  4PK4 A;  4XKC A;  1WWX A;  4ASN A;  4G7H F;  4KUM A;  4IHX A;  1Y1V J;  5CLS A;  2VJJ A;  3CP2 A;  1F5T A;  5C4X J;  2VQL A;  2OTL I;  2JRM A;  4LB5 A;  3HBL A;  1DUX C;  1FT9 A;  1W5C C;  2JJ7 A;  2MGQ A;  2VT3 A;  2BYV E;  4U7D A;  4OMZ A;  3WU0 A;  1FOW A;  1X2N A;  4GYI A;  2KDO A;  4L5I A;  4XMY A;  3CQZ J;  1YS6 A;  3VSL A;  1H9T A;  1BR1 A;  3JRC A;  2JVH A;  4RBO A;  1RES A;  4HZF A;  1JUM A;  3H3Z A;  3KP5 A;  3A4C A;  3LA3 A;  4Q47 A;  4TV7 A;  3H5R A;  1U0J A;  5KAI C;  1LFB A;  3OS2 A;  3MKY B;  3DCF A;  4EJW A;  1SC7 A;  4QLC U;  5HDK A;  4M73 A;  5BOX A;  4O5V A;  1MDM A;  1D3Y A;  4BE2 A;  2R7V A;  2LBF B;  2Z5U A;  2QEX I;  3QPS A;  4ESF A;  3W3C A;  5D5U B;  1MJB A;  2X9D A;  2VKE A;  4C2M J;  1HKQ A;  1IAW A;  3MWM A;  4M72 A;  2BEO A;  2VXD A;  2O61 A;  2WAE A;  2E7X A;  2DXI A;  2W84 A;  2ADU A;  3I53 A;  2O0Y A;  3I0T A;  3TED A;  3ZQL A;  4UUV A;  4CO8 A;  5AIQ A;  3WOD F;  2Y9Y A;  1OKR A;  1UCR A;  4IZZ A;  5HS9 A;  4MEY F;  3GX4 X;  5LLQ A;  2CW8 A;  2MD5 A;  2BE5 F;  3FXM A;  2GA1 A;  2LF7 A;  2FBK A;  6PAX A;  4BXF A;  3H9G A;  2LY1 A;  2KRC A;  2E1M C;  3R61 A;  3KEY A;  5TGT A;  5E1W A;  2EFW A;  2XIG A;  3OYG A;  3ZP5 A;  1B9M A;  4A3E J;  5AON A;  4A0Y A;  1ZGW A;  3JRG A;  1JT0 A;  2KLO A;  4KYW A;  4AYB A;  1BOA A;  3K69 A;  4AD9 A;  1BJA A;  2L02 A;  4HNT A;  3SEQ A;  1S3J A;  1A5J A;  5ICC A;  3BR5 A;  2HU9 A;  1H89 C;  2JUC A;  1T8I A;  4CUG A;  2MAB A;  5C4J J;  1MNM C;  1ULY A;  2DLL A;  5DTD A;  2WAF A;  5EGO B;  3CUO A;  2ICW G;  1VFC A;  4BGD A;  2VBY A;  3S3M A;  1YW8 A;  5HOD A;  1IGN A;  3U9G A;  5HVQ C;  1GUU A;  2M8E A;  5IP7 J;  2CFO A;  1XB4 A;  4JP0 A;  3BQY A;  2TCT A;  2VXZ A;  4B4C A;  2VLA A;  2L0K A;  2VB6 A;  4JBA A;  4U0V A;  2EV0 A;  4WXC A;  3CCJ I;  4RGR A;  3QU6 A;  4HX8 A;  3LOC A;  2RNJ A;  1OJL A;  2KL4 A;  4ZDO A;  3CJQ B;  3WGH A;  3PNY A;  1MMG A;  3T8R A;  2DYS H;  1BOB A;  1PUF A;  2WWY A;  1TT0 A;  2P6T A;  2IP2 A;  5CKT A;  2DFI A;  4B09 A;  3DF8 A;  4ENN A;  1SD6 A;  2LG4 A;  2EIM H;  2KKO A;  3GBG A;  4PJ0 C;  3N97 A;  2F4I A;  3V7S A;  3LSP A;  4RMN A;  2K9L A;  2HI3 A;  2JPB A;  3FXU A;  2K5C A;  3DEU A;  3I9V 2;  4BDZ A;  2DBB A;  1U5T C;  4NQW B;  3K70 C;  5JLW A;  2X48 A;  3R4K A;  2LSO A;  2JA2 A;  1YG2 A;  3K4N A;  3VPR A;  4EAT A;  2KDZ A;  2FNP A;  1IXS B;  2MC4 A;  2MLK A;  2W1O A;  4C3J J;  3WTY C;  3OYL A;  2XGX A;  3BG9 A;  1MD0 A;  2LY2 A;  1APL C;  3OR1 C;  1ZTR A;  3IKV A;  4NUB A;  4ETS A;  4XLE A;  3W6K B;  1FBS A;  2RC4 A;  3AL0 C;  4L18 B;  2EZI A;  3GFL A;  1P9Q C;  3KE2 A;  1Y0U A;  3BG6 A;  2UV1 A;  4L9J A;  1IV8 A;  2BY2 A;  4EM2 A;  3F22 A;  1YLF A;  1NHA A;  3DEW A;  4L9N A;  4BXU A;  3A0H C;  1ZYR F;  2YS9 A;  1VND A;  4Z6Y A;  5AIP A;  3D0S A;  5TIS C;  4Y15 A;  3LQQ A;  3RSN A;  2EH3 A;  2GWR A;  3FWE A;  3OYA A;  2HPI A;  2V6C A;  3WHC A;  2F5D A;  2DOA A;  4Y33 A;  3J80 K;  4BAC A;  3BJ6 A;  1UFM A;  3S1M J;  1O7L A;  2FOK A;  1FC3 A;  2V9V A;  5DD8 A;  4DGW B;  1E0E A;  2VQC A;  1I6X A;  1JHH A;  1B8I A;  4DYR A;  3O2P E;  3N4M A;  3I4N J;  5HLT A;  2IA2 A;  4YG2 F;  4X6A J;  5ILS A;  4L9T A;  3WHB A;  1YJW I;  3GTG J;  1MBE A;  2CUE A;  2O6G E;  3BG7 A;  3EUA A;  1TLH B;  3KP4 A;  5M5W J;  3HL2 A;  3VDX A;  1HSJ A;  3BWG A;  5K5R A;  3A0B C;  1UEL B;  4PCQ A;  2DN0 A;  1VZ0 A;  2L9V A;  2P6S A;  1DGW Y;  3M1C A;  3HOS A;  1W7P D;  3CUQ B;  2K3F A;  4MGR A;  2X1C A;  5FFX A;  4Z2Y A;  1D1B A;  3PQK A;  3DQV C;  3CMM A;  5K7H A;  5EDN A;  5IOY A;  3AKZ A;  3RKQ A;  3ZN0 A;  1U6G A;  3CD6 I;  1OMI A;  3FBN B;  1T2K A;  4U7B A;  2VKH A;  5K7F A;  3NAR A;  1JKO C;  1KYW A;  3DFG A;  1H8A C;  4CXF A;  2HVR A;  1BA5 A;  1KQ0 A;  4WWC A;  3GLL A;  3QU3 A;  4ENJ A;  3KLO A;  1UJ8 A;  4O6J A;  1IRG A;  5EZG A;  1WJA A;  4Y13 A;  2ZO4 A;  1WFX A;  4BQO A;  3O8G A;  4Q48 A;  3TDU C;  5K5O A;  3KIO A;  3EUK L;  3DTE A;  5LFA A;  3QOP A;  5KK1 A;  1WCM J;  1D8J A;  3C7J A;  3DBR B;  4MEX F;  1W5T A;  4A2U A;  1JXS A;  2XGD A;  4CCK A;  1V5E A;  5CJ9 A;  1WRJ A;  2XGE A;  1OYW A;  2NVT J;  1WSU A;  3HM5 A;  2F4M B;  4ZTF A;  4EJT A;  3S3N A;  2R5Z A;  2A5W A;  2VC0 A;  2Z3Y A;  4IQ4 A;  4PSW A;  5EF6 A;  3S1R J;  4KMU X;  4DNC A;  2PMZ N;  1B9N A;  3GME A;  4FX0 A;  4PFP A;  1UAA A;  1MNE A;  2ZSH B;  2CQ7 A;  4XSX F;  1EV7 A;  5KHD A;  1GV5 A;  4LGW A;  3REO A;  3Q9S A;  3LQR A;  2UXX A;  5B1A H;  3M4O J;  2DMN A;  4PGH A;  3HSF A;  4XKW A;  2IJL A;  1LKX A;  4HST A;  2CW0 F;  2F5C A;  2VI6 A;  2J5O A;  2Z99 A;  3HXL A;  3GO5 A;  4CCN A;  2DFH A;  3UNG C;  5ICG A;  2JUG A;  2ESN A;  3A2K A;  2HOA A;  3BLY A;  4U88 A;  1V5F A;  5FRN A;  4L9V A;  4E6K G;  2O8K A;  4J01 A;  2JK3 A;  2M4K A;  1IN7 A;  3WTV C;  3G73 A;  1GT0 C;  1VQM I;  4ZTJ A;  3CME I;  3K4M A;  3KYC B;  3CCQ I;  4BBS J;  3RPU D;  2GIZ A;  3BJO A;  1CF7 A;  4P55 A;  4A6E A;  4V2F A;  4DYQ A;  5C3E J;  2PBI A;  3OYN A;  2Z1D A;  3OIP A;  1ZLK A;  3HPG A;  3QQA A;  4JYK A;  2CV0 A;  1LDJ A;  4MNU A;  2HXO A;  4IVN A;  1RKW A;  2K40 A;  2GXB A;  3CC4 I;  3K2A A;  4IRI A;  3R6S A;  1OR7 A;  2D5V A;  1X1D A;  5HS7 A;  4X1E A;  2XPW A;  4KT5 C;  3V7C A;  1R7J A;  3RDI A;  2M1B A;  4GRI A;  1XD7 A;  4LD5 A;  2STT A;  1BW5 A;  2EZK A;  2ZNY A;  3BTC A;  1OCP A;  1ZRC A;  4RM2 A;  2DCE A;  1YQA A;  3SFZ A;  2ISZ A;  1T6S A;  2VT2 A;  3W6J B;  2NYX A;  4I2O A;  2XAS A;  2D45 A;  2A07 F;  1XMK A;  3ZMZ A;  5KAF C;  2VUM J;  2EIJ H;  2Y0S N;  5JR3 A;  5J47 A;  4CYD A;  3A01 B;  1XCV A;  1OIS A;  2FQ3 A;  3WTW C;  4A93 J;  3PUB A;  4YEL A;  4A3I J;  2A5Y B;  4WXH A;  4A3C J;  3G1M A;  2UWM A;  3MKL A;  1U5T B;  1LE8 B;  2L7K A;  4LG3 A;  4C3H J;  3I3L A;  4AIK A;  3LMM A;  3IWZ A;  3N05 A;  2R7Q A;  4O3M A;  5BNG A;  4KNY A;  3OYC A;  2BY0 A;  3BTL A;  2KQR A;  4P96 A;  3BY6 A;  1QHH D;  3K10 A;  2VPR A;  3VB2 A;  4XRS G;  3CO6 C;  4OOI A;  5GAG J;  2L7Z A;  2XF5 A;  2E1O A;  2ZJP F;  3GTO J;  5JVG F;  2E5N A;  1P7J A;  4H0E A;  1G4D A;  1OCT C;  2EFO A;  4UUS A;  3E7L A;  1Z77 A;  1F36 A;  5IT9 K;  2M7A A;  3VOD A;  3S3O A;  4HG2 A;  5CVU A;  4ZC3 A;  3HOZ J;  3U1D A;  4RB0 A;  1IF1 A;  3K1M A;  2G9W A;  1P4W A;  4CCO A;  4MTD A;  3ZR8 X;  1G6N A;  1R5G A;  2QEN A;  3RYP A;  4EM1 A;  2EJR A;  2JA6 J;  5JHF A;  1DGR M;  4I0A A;  1X4O A;  2JMW A;  3IC7 A;  2HYF A;  3V8J A;  2M0M A;  2E2J J;  1LNW A;  1K4S A;  1WJB A;  5FD5 A;  4KFC A;  1Z7L A;  3VOE A;  1W7P A;  2QQA A;  1TZL A;  1X2M A;  2V1N A;  1T56 A;  2XSJ C;  5JVT A;  1RC9 A;  2ELJ A;  4CCM A;  1YO5 C;  3HOW J;  3J7A O;  5H6Q A;  1Y0N A;  2HS5 A;  4BHC A;  1HW2 A;  4XBF A;  1Y6I A;  1N25 A;  1V5G A;  2QA4 I;  5D8K B;  2IGM A;  4EGY A;  1LJ9 A;  3FMQ A;  3EPZ A;  3OYH A;  3S2W A;  1TQI A;  3MKZ A;  2DOE A;  3W2A A;  2E60 A;  1PUE E;  2R7O A;  3OOP A;  2X4H A;  4FCY A;  3Q0U A;  3M7G A;  3DPT A;  1HF0 A;  3SFI A;  2FU4 A;  3KYD B;  5L3G A;  3CF5 F;  1XCB A;  2OQG A;  3K0L A;  2JN6 A;  2YSR A;  3GVA A;  3H3V K;  1IN4 A;  2EZL A;  2LK2 A;  2PEX A;  1POG A;  3ZPL A;  3RQ4 A;  1ETK A;  3MQ0 A;  4C2U A;  4LIU A;  3DBH B;  2QBY B;  3GFI A;  3PM1 A;  5BPD A;  1E3P A;  3SQN A;  1NK2 P;  2G7U A;  1IRF A;  1ZGJ A;  5H2F C;  5E20 A;  1BN5 A;  1UG0 A;  2DTR A;  2CV2 A;  3HC7 A;  1ETQ A;  4OIP F;  2PMZ A;  1L3L A;  4N0B A;  3F6V A;  2F6C A;  1X19 A;  4A0X A;  4CYC B;  3FK7 A;  3BRO A;  3WTT C;  4CZZ A;  4DW6 A;  2HZD A;  5LGU A;  2QKL B;  2XKP A;  2EZH A;  5LGT A;  3I4P A;  4IHT A;  2M30 A;  2DJI A;  1WH7 A;  2JT1 A;  1BM9 A;  2O8X A;  2K3P A;  2A61 A;  3ESW B;  3HHH A;  1A6Q A;  1TWC J;  3JRD A;  1W0U A;  1Y1W J;  3H3U A;  3OMY A;  4M3G A;  4OAZ A;  2R7R A;  2CQQ A;  2DA7 A;  2ETH A;  3G4S I;  2V4J C;  1BI3 A;  4XRF A;  5HOO A;  4CGZ A;  4IX7 A;  1JTX A;  1A6I A;  3OV8 A;  4BKX A;  3RPU A;  1RR8 C;  1TQM A;  2NRA C;  1R4M B;  2DA2 A;  3B73 A;  2E2I J;  2VIX A;  2PMU A;  1HCR A;  1C0W A;  3JSP A;  1GHC A;  1ENH A;  1YYV A;  4MHG A;  2ZSI B;  1KQ8 A;  2OA4 A;  4F55 A;  3V8K A;  1P4A A;  5J1Y A;  1R23 A;  3BOQ A;  5E1X A;  1JJ6 C;  2VE8 A;  4AC0 A;  5L3C A;  4R8H A;  2L2O A;  4E70 A;  1J75 A;  5GAD J;  3HUG A;  4PJJ A;  1BR4 A;  1FMV A;  4P1W A;  2ZXI A;  1IXC A;  5EJC A;  1MKM A;  1ZAO A;  2BBY A;  3HTU A;  2HOE A;  1W36 D;  3HRT A;  3BP8 A;  3WGI A;  3J81 K;  2E7W A;  1QHG A;  4AU7 A;  3H9Q A;  2XF6 A;  1WJC A;  2BGC A;  3W2W A;  2P7V B;  1D0Z A;  2BV6 A;  4I7H A;  2QM3 A;  5F0F A;  3P7N A;  2FML A;  3Q3S A;  2R5Y B;  4BE1 A;  3FBI B;  5IYB J;  3ZQ7 A;  1B1B A;  2HNH A;  3TBI A;  2LP0 A;  3S32 A;  4YIR X;  1IXR C;  2MW8 A;  1BR2 A;  2L01 A;  5J8F A;  2PX9 A;  3QP5 A;  2HDC A;  1K79 A;  3C2H A;  1UB9 A;  2PJR A;  3ABL H;  4LG0 B;  3ISP A;  3ELK A;  3IRQ A;  2ID3 A;  2CSO A;  1SMT A;  2KJC A;  5K1Y A;  1F4K A;  4LLL A;  3S1N J;  3DU6 A;  3I5U A;  4XL9 A;  1YRN B;  1MSE C;  1T33 A;  5DDG A;  1QZE A;  1JKQ C;  1R4N B;  1VQ7 I;  5BPI A;  2KZG A;  1UHS A;  1P2F A;  2RVC A;  2Q2E A;  2ME6 A;  1XSV A;  4XRM A;  2VBX A;  3JRA A;  5FLX K;  3GTJ J;  1YTY A;  3BPX A;  2NS0 A;  4LFU A;  4MQ9 F;  1O7F A;  3VYR B;  3V42 A;  2IRF G;  2ZFW A;  1I5Z A;  2NXN B;  3T1B A;  5FD6 A;  2DA4 A;  1XGS A;  3KZZ A;  1ETX A;  1YFH A;  2HQ5 A;  3V7R A;  2DFF A;  4R1H A;  5B3S H;  1ZK8 A;  5KVR A;  5K5Q A;  2R7U A;  3ZQF A;  3RTR A;  1SFE A;  2H6C A;  4D1Q A;  2KMU A;  4D5C A;  3E5U A;  2FRH A;  4GFB A;  1FOY A;  1TWF J;  5FO5 A;  1G2H A;  1RIO H;  5FKN A;  4GGG A;  1JTY A;  5M5X J;  3AAF A;  3ASN H;  2Z33 A;  1I1G A;  2ISY A;  4M6V A;  3K4B A;  3LSG A;  2OCC H;  2YU9 J;  4XON A;  3L2V A;  1VI0 A;  1Z6R A;  1NH3 A;  3SXY A;  3F8C A;  3ZMD A;  2LC2 A;  4RLQ A;  3HRM A;  1H0M A;  2CWE A;  3JTH A;  4QPO A;  3ZQH A;  1O3R A;  1HDP A;  2E5Z A;  1FJL A;  2DMP A;  4RAF A;  2IA0 A;  1ZRE A;  1G3T A;  2V1X A;  2A69 F;  1K78 A;  1QU3 A;  5D5X B;  1HST A;  2I10 A;  1Z1D A;  3G1L A;  4P5O A;  1X1A A;  4NC6 A;  2LVS A;  2K9M A;  1G3W A;  5E3O A;  2W00 A;  3FK6 A;  3BG5 A;  4BJ6 C;  2K4J A;  2HZT A;  3F8B A;  4GDF A;  1JI8 A;  1UHW A;  3WE3 A;  3BTJ A;  1GVD A;  2Y2Z A;  3ERE D;  5HDG A;  1XTA A;  1B72 A;  1XG1 A;  2ZJQ F;  3FIS A;  4OMY A;  1YOV B;  3RKW A;  3RYR A;  1M1E B;  3AG3 H;  1H88 C;  3LFK A;  3FZV A;  1LFU P;  1QGP A;  3GTL J;  2R7S A;  1EF4 A;  4E7Z A;  3U2R A;  5DYM A;  2ID6 A;  2F2E A;  4LIT A;  3NQO A;  3PO2 J;  2XAU A;  3QPT A;  1QPI A;  2LF8 A;  4HF0 A;  1DU0 A;  4QSH A;  3IRR A;  4PGG A;  4UXN A;  1AKH B;  3GZ5 A;  4LK1 F;  5J6X A;  3ABM H;  2GOM A;  4BQN A;  3FF5 A;  4ZYH A;  2CQK A;  1JGS A;  4QWQ A;  1LDD A;  4EJU A;  2NNN A;  2G7H A;  2CUZ A;  2V79 A;  5J4Y A;  1V54 H;  4M6Y A;  4Y52 J;  1GV2 A;  2L9N A;  5IP6 A;  2NNY A;  5JLX A;  2KPM A;  1WVR A;  1X58 A;  2EQR A;  4WCG A;  1K4T A;  2E34 A;  1MSF C;  3G3Z A;  3RKX A;  3MD2 A;  2HEO A;  1HC8 A;  3UKG A;  4EJO A;  2WAQ A;  1EH8 A;  4XLF A;  3BZ6 A;  5EYR A;  1S7E A;  3M8F A;  4QTR A;  2OAZ A;  1KGS A;  1ZKG A;  1LFP A;  3I55 I;  4FIS A;  1UST A;  2FQ4 A;  2QCO A;  3K4K A;  2L7F P;  4Y7N J;  1XPX A;  4E7S A;  3F9K A;  1RR7 A;  4ZDP A;  5EG0 A;  2VBW A;  4XKB A;  2JWT A;  3OR2 C;  2DMU A;  2WV0 A;  5D6F A;  4XRS A;  2CGP A;  3ULQ B;  4BL0 B;  4W1U A;  3S1Q J;  3WU1 B;  1R6R A;  4FE4 A;  3TP0 A;  1TW2 A;  3TOA A;  4W97 A;  1QVU A;  2M87 A;  3FMS A;  5E3L A;  1BC8 C;  2K9S A;  5D4R A;  3GFM A;  2FA5 A;  1TWA J;  3FXJ A;  1FNN A;  1W0T A;  3S15 J;  1IZ1 A;  3WTX C;  2IS6 A;  2M0C A;  1J7K A;  2R7D A;  2LD5 A;  2K02 A;  1X1C A;  4ITV A;  5E18 F;  1U9O A;  2D2W A;  5FB2 A;  1O4X A;  4HOB A;  4BEH A;  3CCY A;  4BH9 A;  2XRL A;  2E71 A;  4UV8 A;  4MFE A;  1IG7 A;  2BHZ A;  1R71 A;  2IGK A;  1IO2 A;  5FLM J;  1OCZ H;  2QZ8 A;  1P4X A;  2E1N A;  4C9Y A;  5GTI C;  3FM5 A;  2CJJ A;  3H0G J;  2BXY A;  1FP1 D;  2ZME A;  2VON A;  1SFK A;  2W82 A;  3MEX A;  5CQG A;  4IQJ A;  2RNG A;  4HV5 A;  1RI7 A;  5F04 A;  2VAS A;  4EVI A;  3JRF A;  3M3Y J;  4HQM A;  4B48 A;  2HTJ A;  4B47 A;  2MD0 A;  2QSH X;  3I71 A;  3CC7 I;  4F7Z A;  4ZDL A;  1MMS A;  1QVT A;  5F0H A;  1Z05 A;  2BVL A;  2DK5 A;  3F72 A;  3HRU A;  5CVR A;  3TP3 A;  2GM4 A;  2H1K A;  1LVA A;  2IGN A;  2B63 J;  3J7Y J;  2CH0 A;  2I8D A;  1MJA A;  1Z3Y A;  4EM0 B;  1Z9C A;  5DD4 A;  2VOP A;  2EA4 A;  2Y48 A;  1RNL A;  2Y9Z A;  3ROU A;  1XS9 A;  3A03 A;  4L0Z B;  1JKR C;  3EET A;  2GIV A;  4HYE A;  4G6D A;  1VTN C;  3DPU A;  2WA0 A;  4FQG A;  4I98 B;  1LVK A;  2HQR A;  1PDN C;  3I59 A;  1K61 A;  3H92 A;  2X6W A;  3PSI A;  4DBR A;  2HQA A;  3KP6 A;  4MIM A;  4P9U A;  2HVQ A;  4KDP A;  4RM3 A;  4FHT A;  2FOW A;  3ZQG A;  4A69 C;  5HS8 A;  3S17 J;  2KZV A;  2WY8 Q;  5BMZ A;  1QNT A;  4OIQ F;  2ZXH A;  1SAU A;  1D1C A;  1R5I D;  2OJE D;  3R0J A;  4QPQ A;  2QKM B;  2DT7 B;  2VE9 A;  4HLY A;  1VQ4 I;  4M9S A;  3KP2 A;  4XLH A;  5HNH A;  4BDY A;  2F48 A;  3DLA A;  1TW3 A;  2CW7 A;  3VYU B;  3FHZ A;  3GEZ A;  3JRH A;  1ZEL A;  2RN7 A;  3L00 A;  4A0Z A;  2KRH A;  4Y17 A;  4A3D J;  2PN6 A;  3CCV I;  2ZXW H;  2W85 A;  5E8G A;  1ODD A;  5CVJ A;  3RJP A;  3K1N A;  3RKY A;  3LSI A;  2XHK A;  3E5Q A;  2ZME C;  1P92 A;  2DK8 A;  4RGS A;  4BJ5 C;  4LK0 F;  4A3M J;  3H9J A;  1MH4 A;  1CGP A;  3FMR A;  3OIO A;  4RGU A;  2ZBK A;  2BW3 B;  2H27 A;  2IT0 A;  1B4A A;  1ETV A;  2WB1 A;  5CVV A;  4CSW A;  1ZHF A;  1X4P A;  2EIL H;  3A02 A;  3IAM 2;  1OYY A;  3J7Z I;  1HXD A;  2X6Y A;  4HNU A;  3ZMS A;  3KLN A;  4NC7 A;  2KT0 A;  1FIP A;  2E36 A;  1LB2 A;  1Y8R B;  1O57 A;  5DCM B;  2LKS A;  4XOT A;  2KHM A;  1Q1V A;  2HDW A;  3JAM Z;  3E6C C;  2DFE A;  4UY8 I;  1XC5 A;  4UNO A;  4FT8 A;  4KT6 A;  1D5V A;  2OBP A;  2GA2 A;  2XAF A;  1UZC A;  4UV9 A;  1SMY F;  2E1C A;  4IOC F;  1ZG1 A;  1DP7 P;  3AFH A;  1RZ4 A;  1RET A;  3HKZ N;  3HG9 A;  4IHY A;  2ECB A;  3NWS A;  4I09 A;  5F64 A;  1AHD P;  1R9T J;  3G2B A;  1TNS A;  1QO0 D;  2Y75 A;  1KYZ A;  4KN4 X;  4HRI A;  3BCB A;  1W5S A;  3P9C A;  1ZAR A;  5D8L B;  2IW5 A;  2LLK A;  5M3F J;  2E1M B;  2KRF A;  3GUD A;  4RAZ A;  5ILV A;  4L0Y B;  1FEX A;  4HW0 A;  1QA6 A;  5EEH A;  4RAY A;  1D0Y A;  1MW7 A;  4E4H A;  1UMQ A;  4BS9 A;  3DKX A;  3TMO A;  5E17 F;  1JHF A;  1DU6 A;  3C1D A;  2XAH A;  4XOP A;  4PUS A;  3LA2 A;  4S0H B;  1Z7U A;  1ZH5 A;  3GF2 A;  3TQN A;  3GZN B;  1FTT A;  2STW A;  3F23 A;  1SVO A;  1TT5 B;  2DPU A;  2C6Y A;  2E35 A;  1J09 A;  1ZRF A;  1N78 A;  3LFU A;  2BVM A;  1D5Y A;  3TO7 A;  3K9T A;  4F93 B;  4NBQ A;  5ICE A;  4KMF A;  5F27 A;  4J00 A;  1OYI A;  1EJ9 A;  1T0F A;  4ABZ A;  4M6X A;  1BBY A;  5D5W B;  4E7J A;  5LEK A;  1MDM B;  1DP3 A;  4LOC A;  3TL4 X;  2JSC A;  3MVP A;  4Y4R A;  1ORK A;  4YII A;  2KIS A;  3R60 A;  5H20 A;  2Z2S B;  2M5W A;  4AM3 A;  2XV4 S;  3JRB A;  2OZ6 A;  2X6O A;  4BNC A;  2LRE A;  4JQF A;  2ZCW A;  2KIQ A;  1D0X A;  3QAH A;  2DMT A;  3GCM A;  4PFO A;  1HOM A;  2HVS A;  1O3T A;  1P7I A;  4KN7 X;  2QSG X;  4WXD A;  1OQY A;  2P8T A;  1ON1 A;  2LBF A;  1D8K A;  3OSG A;  1T08 B;  4XNF A;  4A5M A;  1OLT A;  1SAX A;  3CDI A;  3DV8 A;  2DO7 A;  2X51 A;  4EV0 A;  1G59 A;  1HQC A;  2LKX A;  3ZOB A;  1F9N A;  3BG3 A;  5E79 C;  3ZXS A;  5TRD A;  2NVX J;  3AL0 B;  3WU2 C;  5IYC J;  1XX5 A;  3TKY A;  5LHI A;  5DUI A;  3HOX J;  2CQN A;  2PMH A;  3PUF A;  4C2T A;  3BPV A;  4B8X A;  1FZP B;  2WY7 Q;  3BCA A;  2AQE A;  2FMY A;  4G6T B;  4YFN F;  4HV6 A;  3GZ6 A;  1HW1 A;  1R49 A;  4RA2 A;  2COB A;  1FSE A;  2QF7 A;  2YUS A;  3FKI J;  2CUF A;  5J4V A;  5BS6 A;  1SAN A;  3KEO A;  2YX4 A;  1TNT A;  2CO5 A;  2QLZ A;  3LAP A;  1OR7 C;  3ABU A;  2DW4 A;  5A2Q Z;  3ZMT A;  4HBL A;  3U1K A;  1PP7 U;  3KZY A;  1T39 A;  1LQ1 A;  2GXA A;  3ZQI A;  3MZH A;  3QPH A;  2X1E A;  4XK4 A;  4C3I J;  2KJB A;  4IEJ A;  4UVB A;  4N9H A;  2M45 A;  4CA0 A;  1D1A A;  2LH9 A;  2ESH A;  3CLO A;  3FXK A;  1PYV A;  4LIV A;  4D5F A;  4HF1 A;  5HDN A;  2XSD C;  5GPA A;  3WGG A;  1PUF B;  5EGO A;  4I02 A;  3BR1 A;  1WJD A;  4IKF A;  2JA8 J;  3KP7 A;  3EYI A;  2GBY A;  1PVE A;  1XDS A;  3LSR A;  2L9R A;  1FOX A;  2UUZ A;  3IAS 2;  3C2G A;  3OL4 A;  5L3D A;  4D9J A;  3IL2 A;  2L3D A;  2BHY A;  4XOR A;  4AUX A;  1ZR4 A;  1SFU A;  1KQ9 A;  1CQT A;  2GLO A;  4M71 A;  4MO7 A;  4J19 A;  2X85 A;  4N4N B;  1B59 A;  4DQ2 A;  2G0E A;  1QQI A;  4D0P A;  1WH5 A;  4MLO A;  3KX2 A;  3SZG A;  4I01 A;  3OWT A;  2R7F A;  3OYF A;  3CO7 C;  2R0Q C;  4PDK A;  2JQ7 A;  3JRE A;  3DWL E;  1E17 A;  5J1R A;  3IHU A;  4D7N A;  2DU9 A;  2GAU A;  2IEK A;  4B43 A;  3IUO A;  2VN2 A;  4NQW A;  2MH9 A;  2OF7 A;  1R1U A;  1BW6 A;  3NAU A;  3ZQQ A;  5E8I A;  2OTJ I;  2XRN A;  3SZT A;  2K4B A;  4ZYG A;  3RZD J;  3BZK A;  3TW7 A;  2DDB A;  4BAY A;  4EEF G;  2B7E A;  2R93 J;  5IT3 A;  1YJN I;  1MMA A;  3QYF A;  1K7A A;  5F1J A;  2FD5 A;  3LSK A;  1KZH A;  3IH3 A;  4FET A;  4F92 B;  1SFO J;  3HKZ A;  1B6A A;  3PIO F;  1TWG J;  3K70 D;  1B8I B;  3EUH A;  4XN3 A;  4XID A;  1OCR H;  1Y56 A;  2L9S A;  3SHF A;  4B1R A;  3OS0 A;  1F1Z A;  2RRE A;  1FP2 A;  2VQH A;  4L5E A;  4AID A;  2WBM A;  3TGN A;  2KIU A;  3ERM A;  3F8M A;  4Q5S F;  3DXJ F;  2UXN A;  4XLA A;  2DT6 A;  4AIJ A;  2DJN A;  5B66 C;  5IP9 J;  1WHU A;  3JCU C;  4YIF A;  2WAQ N;  4Q4Z F;  3HOV J;  3CCU I;  4XLP F;  4U87 A;  1WQ2 A;  1VQL I;  2L4A A;  1FYK A;  1U3E M;  2W48 A;  3OYB A;  1QZZ A;  5F1R A;  2DQR A;  4F52 A;  3MKW B;  2RQP A;  3BJA A;  3BDD A;  3V4G A;  1VQN I;  2BY1 A;  2XB5 A;  3IWF A;  3TO6 A;  1ZRD A;  1S7A A;  3ABT A;  4I0B A;  1ETW A;  3DBL B;  3OYJ A;  3FXR A;  3S2D J;  1J0R A;  5HLH A;  3DTK A;  2DDA A;  5J1U A;  2WTE A;  3G6E I;  3CUQ A;  2P5K A;  1GXP A;  5DM7 F;  1WZ2 A;  3SZP A;  3I64 A;  1W4M A;  3DKY A;  1Z0X A;  4HPQ A;  1ON2 A;  2A68 F;  4ZYD A;  3OSF A;  2LMD A;  5KCM A;  4RB3 C;  4HEA 2;  2X6X A;  1R1T A;  1R5H A;  2JSP A;  3CTA A;  5GPC A;  4KJZ A;  4G7Z F;  1TWH J;  2ZJ2 A;  5DM6 F;  3AG1 H;  2FSW A;  4PJL A;  5FGM A;  3K4J A;  2IAI A;  2EA2 A;  4B3A A;  4S05 A;  1FX7 A;  4CCJ A;  1WJ5 A;  2L4M A;  5FFZ A;  3S93 A;  1FBU A;  3CP8 A;  2R5Z B;  2PI0 A;  3HEF A;  4N9I A;  2MC3 A;  1MGT A;  2X1D A;  4B44 A;  4E7K A;  4BHB A;  3BTI A;  4M74 A;  2GOX B;  1I27 A;  3E97 A;  2HTS A;  3RIR A;  2FXA A;  5BQT A;  1MBF A;  2EFP A;  4UVA A;  4ANJ A;  1TC3 C;  2AXL A;  2CS3 A;  5ED4 A;  5J40 A;  2AQF A;  4M9X A;  1FPQ A;  2Q1Z B;  1RPW A;  2LDU A;  3JSO A;  1IRX A;  3BR3 A;  3CES A;  4FTH A;  1NG6 A;  3S16 J;  3A1Y A;  2H1L A;  4FX4 A;  1VQO I;  1S72 I;  2F5V A;  3K2Z A;  3M1E A;  1Y39 A;  4XM3 A;  2DT5 A;  1O3Q A;  2P81 A;  5HNF A;  5F08 A;  2Q0O A;  3VSK A;  4G9Y A;  3LSH A;  2H8R A;  3S8P A;  1CF7 B;  3T5X A;  2Z9O A;  1R1V A;  2HOS A;  4ESJ A;  1MMN A;  2M7B A;  3LSJ A;  1XGN A;  2A6E F;  1RRJ A;  1EA3 A;  4H4K C;  1X3W B;  4BQQ A;  2OPT A;  1MJ9 A;  1EH6 A;  1Y8Q B;  4MQV A;  5EEA A;  1BJZ A;  4HSR A;  3OYK A;  4M3F A;  5L3E A;  4NB5 A;  1EKE A;  2P5L C;  2M2E A;  4M3D A;  2KP6 A;  1ZG3 A;  2FEZ A;  1YW7 A;  2CU7 A;  2DA5 A;  2NS7 A;  4YFX F;  2E2H J;  3W6V A;  4IL6 C;  4BXX J;  5GTH C;  4CCL A;  2PFB A;  2WAD A;  2FBH A;  2L7M P;  3DU5 A;  3SDG A;  3I56 I;  1IRZ A;  1G8X A;  5KNL A;  4IHV A;  2QQ9 A;  3E6M A;  3LSM A;  4M9Z A;  1H9G A;  1SD7 A;  2LY9 A;  3E6B A;  4F91 B;  4HF2 A;  3IH4 A;  2HWV A;  2VJ5 A;  2W4S A;  3P5J A;  1MND A;  3CCE I;  4E7L A;  3HDD A;  2PLY A;  4V2G A;  1KU7 A;  4II2 A;  3RZO J;  3H1C A;  1BI1 A;  2ZJR F;  4NC8 A;  3ZQC A;  2EPF A;  5J8C A;  2XAG A;  2P0W A;  1X1P A;  4QIW N;  2LFB A;  5EEG A;  4R79 A;  3ZMU A;  2OC6 A;  2LYC A;  2YR2 A;  5F6F A;  2WB1 N;  3WG9 A;  1VQ8 I;  3JR9 A;  1S7O A;  3L2C A;  3K1P A;  1YIT I;  1ACI A;  3OYD A;  2Y0M A;  2EK5 A;  4DIQ A;  2ZFU A;  3CJN A;  3J80 Z;  2XC7 A;  3FIW A;  3CCR I;  2V1D A;  4OAY A;  4G94 A;  4V19 K;  2OD5 A;  3C18 A;  3A01 A;  4HNV A;  4UUS B;  3HOU J;  3MN2 A;  1V4R A;  1OCC H;  4JOM A;  1JGG A;  1T38 A;  2GQQ A;  1ZN2 A;  1U5T A;  2VJ4 A;  1JKP C;  1LE8 A;  3LA7 A;  1IW7 F;  5HLI A;  4XQF A;  2F5E A;  1QZY A;  2R7T A;  2IA1 A;  1S9H A;  4FAS D;  3KEQ A;  3OY9 A;  2KIF A;  1V3F A;  2VC1 A;  3MAJ A;  4EMS A;  2DI3 A;  1DQU A;  2RKH A;  4A3G J;  3GW2 A;  2K86 A;  2AXT C;  1J9I A;  1V55 H;  2HYG D;  2A05 A;  5GAE J;  1W7P B;  2VPL A;  1BI2 A;  3TO9 A;  2CMP A;  2EIK H;  3E6D A;  3VYT B;  1KU2 A;  1XGM A;  2RGV A;  4HLX A;  3GTP J;  1VQ5 I;  4NHJ A;  3LWF A;  3L2W A;  1X3Z B;  5B1B H;  4YFK F;  4A3B J;  1LEB A;  3H5N A;  1I6H J;  3LL7 A;  2DYR H;  2IS4 A;  1FTZ A;  3KCC A;  1IDZ A;  2K85 A;  5FRM A;  4ZJZ A;  2EWN A;  2VOD A;  4D7M A;  4OU0 A;  5J3L A;  4EQQ A;  1FLI A;  1IC8 A;  2ME0 A;  1E2X A;  5CVI A;  2UZK A;  2AO9 A;  2F5F A;  4DOZ A;  2D1H A;  2LOO A;  2RV8 A;  4UB6 C;  1EH7 A;  2JA5 J;  4HX7 A;  1ZLJ A;  2WC2 A;  1Z3X A;  1GXQ A;  2DA1 A;  3MZ8 A;  3DLL F;  1YHQ I;  1TBX A;  1YS7 A;  3P9K A;  1KON A;  4ENK A;  3HRS A;  2CV1 A;  2EV6 A;  3CCM I;  2VKD A;  3UR3 C;  3ASO H;  2EFQ A;  2XPU A;  4WK8 F;  3Q0W A;  4ZYE A;  1ITY A;  5FLV A;  2ZB9 A;  2K9N A;  1BL0 A;  2DA3 A;  3PSF A;  2XRO A;  3EQL F;  3LNQ A;  2ELH A;  2LNB A;  1YIO A;  3Q9V A;  4UB8 C;  2XVC A;  1VQP I;  5ILU A;  2EV5 A;  2FNA A;  2YPR A;  4L5J A;  3SEZ A;  3VEP A;  3L2Q A;  3F21 A;  5ICF A;  1BI0 A;  2B9S A;  4IO9 F;  1SD4 A;  3FM3 A;  3SJM A;  3D1N I;  1KU3 A;  2AS5 F;  4EJV A;  4IF4 A;  1HA8 A;  3E3V A;  1XSD A;  2QBY A;  3I54 A;  1FSH A;  4AVP A;  5D6E A;  1MBH A;  3AG4 H;  4IRG A;  1U8B A;  1SEU A;  1S8N A;  1U8R A;  3CDL A;  1VQ6 I;  2YU3 A;  2A6T A;  2W7N A;  3QRF F;  2F4O B;  3CJR B;  4BU2 A;  3WTS C;  1VQ9 I;  3E0J B;  4JK1 X;  5LGN A;  2GZW A;  4ON0 A;  4DBQ A;  1R00 A;  5DV5 A;  3M07 A;  3C2B A;  3OIQ A;  4CYC A;  3D5S C;  2OZU A;  3QYE A;  5E3M A;  1IN8 A;  4G12 A;  3G71 I;  4MTE A;  5LBQ A;  4M3B A;  5DEQ A;  3CC2 I;  4KIB A;  2O9L A;  1YX5 A;  3ZN1 A;  2MA3 A;  2R3S A;  4RB1 A;  2HPM A;  4BYY A;  1HDD C;  4LB6 B;  2JVG A;  2MG4 A;  3K6G A;  1I1S A;  4OWR B;  2ECC A;  2NOG A;  5FKL A;  1W36 C;  2XB0 X;  2H09 A;  4HQE A;  1Z91 A;  2VQG A;  1TQP A;  3HOT A;  4RLF A;  4A12 A;  3DP7 A;  2P5V A;  4RS8 A;  4NDL A;  2ZXJ A;  1AA7 A;  1ZGA A;  3QOD A;  3HUG B;  4HA8 A;  1U9N A;  2JRT A;  4ZH4 F;  3CCS I;  1BC7 C;  3K4C A;  4XSZ F;  1IUF A;  4PSX A;  4DYC A;  5FRO A;  5DUK A;  3NRV A;  1IJW C;  1DDN A;  3H35 A;  2XKO A;  3KZI C;  5LEJ A;  3PNT A;  1J5Y A;  4B3X A;  2EFN A;  1WJE A;  5L3B A;  4RDU A;  3HSE A;  2TRT A;  5TJJ A;  2LR8 A;  2DOF A;  4EGZ A;  4G7O F;  3HSR A;  4U0Y A;  1K6Y A;  4KIG A;  5IOZ A;  3FXL A;  4CIC A;  2IGO A;  1MMD A;  4HX4 A;  3F6O A;  2V9P A;  1RUO A;  3EDP A;  4WX9 A;  1A04 A;  3LST A;  5D5V B;  2PJR B;  4PZJ A;  1JUP A;  1Q1H A;  4BY7 J;  3ZRG A;  4OIR F;  9ANT A;  1W1W E;  4MFD A;  5IT9 Z;  3RPQ A;  3I58 A;  2HGC A;  4BQA A;  3FDY A;  3EYY A;  2OCE A;  3V8L A;  3CLQ A;  4FE7 A;  3W2V A;  1DPR A;  3QOE A;  3SDB A;  2R5Y A;  2IBD A;  2M3A A;  2V26 A;  3ABK H;  2Q2E B;  5DS9 A;  3JRI A;  3HOY J;  2OUM A;  1WJF A;  1MBK A;  3C3W A;  3L7W A;  1K83 J;  2IS1 A;  3DPL C;  2XGC A;  2M8G X;  4LG0 A;  2HXI A;  1FYL A;  5GAH J;  4XR6 A;  1AU7 A;  3I4M J;  3D5L A;  4JX5 A;  2Y30 A;  4A5N A;  3WG7 H;  4DZP A;  4G8X A;  1YRN A;  1MBJ A;  4KIF A;  2DMQ A;  4IJA A;  4DJA A;  4N4O B;  3IV5 A;  4A3F J;  3BZC A;  2DAO A;  5IPA A;  5FKM A;  3OL3 A;  4PJM A;  2N8G A;  1JE8 A;  4LLG F;  3CF2 A;  1R58 A;  2KIM A;  5E3N A;  4II3 A;  2QQ8 A;  4UVC A;  1YW9 A;  5LHH A;  1ZQ3 P;  2MH2 A;  4RGX A;  1TP4 A;  2VKV A;  5IYD J;  3T8T A;  2BY3 A;  2CG4 A;  3OYE A;  2ELK A;  3PJR A;  5ERI A;  4JX4 A;  1P6R A;  2QWW A;  3IKT A;  3F8F A;  4C30 A;  3K4L A;  1WGX A;  1K6O A;  2R7Z J;  1ZG5 A;  3M9A A;  1T98 A;  1O3S A;  2L5Q A;  2CRG A;  4BE0 A;  2NVQ J;  3M8J A;  2HKX A;  3RCO A;  2BOL A;  3BQZ A;  1S5L C;  3GTK J;  1K78 B;  2OV7 A;  3BR0 A;  3ZMV A;  1XSX A;  3CMY A;  3BR6 A;  1NK3 P;  4E7I A;  3K7A J;  1XMX A;  4GO1 A;  1WKM A;  1Z67 A;  1IN6 A;  4M3E A;  5L3F A;  2VJI A;  2FUG 2;  3B6C A;  3KET A;  3HB9 A;  3L9F A;  4LMY A;  4LJZ F;  4YRV A;  2JA7 J;  2H6B A;  4NNJ A;  2ZKZ A;  4ENM A;  3PO3 J;  3U21 A;  3MCZ A;  5K7Z A;  1B72 B;  3NWT A;  4K2E A;  3RQI A;  4BHP A;  2JZY A;  3PIP F;  4ZZL A;  4U0W A;  1TL8 A;  2OU2 A;  3GWZ A;  3Q0V A;  1RKT A;  3TOB A;  5M5Y J;  3HTS B;  1PP8 F;  2LRD A;  2PG4 A;  4Y3O A;  2YX7 A;  1S6L A;  3CDH A;  3FX3 A;  3HJE A;  1ERD A;  1A35 A;  3IH2 A;  2PQ8 A;  4KA4 A;  1FIA A;  3OS1 A;  2CUJ A;  1XN7 A;  3O8H A;  1E3H A;  2EBI A;  1N75 A;  2V1U A;  3MMY B;  1E3O C;  4UHT A;  2NS8 A;  2CQX A;  4IPA A;  3ZCO A;  5LRS A;  1I39 A;  2FF4 A;  2L54 A;  2X0L A;  3KPH A;  1U2W A;  3PL8 A;  2BXZ A;  2QUF A;  1T0F C;  1X3U A;  3G1O A;  5FJ8 J;  3VWB A;  2XAJ A;  2FX0 A;  2QGU A;  3JAM K;  1STZ A;  3RI4 A;  1QRY A;  4XLN F;  5D4S A;  1R36 A;  2COM A;  5FKO A;  1AKH A;  1IV6 A;  3CMA I;  1MZB A;  4YEJ A;  1IN5 A;  4XIC A;  1JUS A;  4GCV A;  3FHN A;  3KFW X;  3ML6 A;  5EG0 B;  1HKT A;  5C44 J;  1BIA A;  3J81 Z;  1UHM A;  3D5R C;  3L2R A;  1BIB A;  3TW6 A;  1FWZ A;  1HW5 A;  3B6A A;  3DEE A;  1I3A A;  4AIH A;  1GLN A;  2HQN A;  4RAG A;  1IUY A;  3IP4 B;  3GTM J;  2IVM A;  2P7C B;  4P9F A;  3F0C A;  1MH3 A;  3H5A A;  3PFI A;  2DQL A;  2XF7 A;  4CZC A;  1LUJ B;  3Q5F A;  2CFX A;  1YJ9 I;  1OPC A;  2HOT A;  1SFX A;  2XAQ A;  4BJT A;  2QYO A;  4PJN A;  4IRH A;  3QP6 A;  2IS2 A;  4G6Q A;  4UUT A;  1YIJ I;  1TTY A;  2RAE A;  3L2U A;  3TDZ C;  2DA6 A;  2W24 A;  4IHW A;  4LLN A;  2P4W A;  4I76 A; 
#chains in the Genus database with same CATH homology
 1W0T A;  3S15 J;  2H8R A;  2FJ1 A;  2M0C A;  3S14 J;  2NVY J;  2O8K A;  2JK3 A;  2LD5 A;  5GP9 A;  2HOS A;  3LSJ A;  1GT0 C;  5F0C A;  1U9O A;  1O4X A;  4BBS J;  2OPT A;  3CCY A;  2XRL A;  4DYQ A;  4MFE A;  3OOU A;  4V2F A;  1BJZ A;  5EEA A;  5C3E J;  4M3F A;  1IG7 A;  3HGG A;  2M2E A;  4M3D A;  5FLM J;  3QQA A;  4JYK A;  2CU7 A;  2DA5 A;  2NS7 A;  2E2H J;  4BXX J;  3W6V A;  2HXO A;  1RKW A;  2K40 A;  1IDY A;  2CJJ A;  3H0G J;  2L7M P;  3K2A A;  3SDG A;  1IRZ A;  2D5V A;  4IHV A;  2R92 J;  4X1E A;  1U78 A;  2XPW A;  2MSY A;  2LY9 A;  5F04 A;  4DZJ A;  3QPL A;  3IH4 A;  2M34 A;  3JRF A;  1BW5 A;  3HDD A;  1UG2 A;  2EZK A;  2XPV A;  4V2G A;  3M3Y J;  3BTC A;  1OCP A;  5EZH A;  3RZO J;  3ZQC A;  1QVT A;  5F0H A;  3TP3 A;  1VF9 A;  4QIW N;  2H1K A;  2GM4 A;  2B63 J;  2LFB A;  1JT6 A;  4AYB N;  2VUM J;  2Y9Z A;  3GTQ J;  2Y0S N;  1XS9 A;  3A03 A;  1JKR C;  2WB1 N;  3A01 B;  3JR9 A;  1OFC X;  4A93 J;  4A3I J;  1HLV A;  4A3C J;  1WI3 A;  2LTP A;  1I50 J;  3G1M A;  2HOA A;  3MKL A;  1LE8 B;  3FIW A;  2DTZ A;  2Y31 A;  4C3H J;  1K61 A;  3BR2 A;  3A01 A;  5BNG A;  4MIM A;  4HNV A;  3BTL A;  4UUS B;  2M9H A;  3HOU J;  3MN2 A;  1MBG A;  3ZQG A;  4A69 C;  1JGG A;  4BY1 J;  3S17 J;  2VPR A;  3BT9 A;  4XRS G;  1LE8 A;  1JKP C;  2L7Z A;  1ZR2 A;  2E1O A;  1ETY A;  2AHQ A;  3GTO J;  1P7J A;  1OCT C;  4UUS A;  3E7L A;  1Z77 A;  1F36 A;  1JJ8 C;  4A3G J;  3JRH A;  4I6Z A;  2E19 A;  4A3D J;  3HOZ J;  4BBR J;  4A3M J;  2JA6 J;  1MH4 A;  2JMW A;  3OIO A;  2E2J J;  3GTP J;  1ETV A;  3A02 A;  1W0U A;  1X2M A;  1T56 A;  4A3B J;  1I6H J;  2KT0 A;  1FTZ A;  1FIP A;  2O7O A;  3HOW J;  1IDZ A;  2K9Q A;  2HDD A;  1Q1V A;  4D7M A;  5J3L A;  1XC5 A;  3L1P A;  1IC8 A;  2ME0 A;  2AO9 A;  1WPK A;  4A3K J;  2JA5 J;  2WV1 A;  2DA1 A;  4FCY A;  3Q0U A;  1F43 A;  1RET A;  3HKZ N;  1HF0 A;  4IHY A;  3SFI A;  2ECB A;  2HYJ A;  1AHD P;  3S2H J;  1R9T J;  1GDT A;  1NTC A;  4A3J J;  2JN6 A;  3H3V K;  2XPU A;  3Q0W A;  2EZL A;  2LK2 A;  1ITY A;  5FLV A;  2LLK A;  1POG A;  3HGY A;  5M3F J;  2ZB9 A;  2K9N A;  1BL0 A;  4A3L J;  2DA3 A;  3LNQ A;  1FEX A;  1ETK A;  5FKK A;  4JX6 A;  1UMQ A;  3PM1 A;  1ETO A;  1NK2 P;  1DU6 A;  5M3M J;  1I3Q J;  3SJM A;  4S0H B;  3D1N I;  4IHX A;  1FTT A;  1Y1V J;  1ETQ A;  5C4X J;  3HBL A;  1U8B A;  1D5Y A;  1MBH A;  4CYC B;  3FK7 A;  2JJ7 A;  2MGQ A;  3CDL A;  4DW6 A;  5F27 A;  2EZH A;  4ABZ A;  1X2N A;  3CQZ J;  1WH7 A;  4LOC A;  3JRC A;  1TWC J;  4RBO A;  1RES A;  3C2B A;  3MVP A;  3JRD A;  1Y1W J;  4CYC A;  1JUM A;  1ORK A;  4M3G A;  1LFB A;  5E3M A;  2CQQ A;  2DA7 A;  4G12 A;  3DCF A;  4M3B A;  3JRB A;  2O9L A;  2X6O A;  1HDD C;  2DMT A;  1JTX A;  1A6I A;  2MG4 A;  1HOM A;  4BKX A;  3QPS A;  2ECC A;  2NOG A;  5FKL A;  2XB0 X;  1P7I A;  2DA2 A;  2E2I J;  2X9D A;  2VKE A;  4C2M J;  1HCR A;  3OSG A;  1ENH A;  4NDL A;  2NVX J;  1U9N A;  3ZOB A;  5J1Y A;  3BG3 A;  2LKX A;  5IYC J;  3HOX J;  1JJ6 C;  1IUF A;  3TED A;  3ZQL A;  4DYC A;  1IJW C;  4AC0 A;  2Y9Y A;  2COB A;  2QF7 A;  2YUS A;  3FKI J;  2CUF A;  4RDU A;  2TRT A;  1SAN A;  2LR8 A;  1ZGW A;  4A3E J;  1JT0 A;  3JRG A;  5IOZ A;  1A5J A;  3BR5 A;  1H89 C;  5F0F A;  3ZQI A;  5C4J J;  4XK4 A;  1MNM C;  3Q3S A;  4C3I J;  5DTD A;  4IEJ A;  1JUP A;  4BY7 J;  5EGO B;  2R5Y B;  5IYB J;  2LP0 A;  9ANT A;  1VFC A;  4MFD A;  2MW8 A;  5HOD A;  1IGN A;  1GUU A;  4D5F A;  5IP7 J;  4JP0 A;  4FE7 A;  2XSD C;  3BQY A;  2TCT A;  5GPA A;  4B4C A;  2R5Y A;  1PUF B;  5EGO A;  2L0K A;  2IBD A;  2ID3 A;  3BR1 A;  3HOY J;  5DS9 A;  3JRI A;  2JA8 J;  2GBY A;  3S1N J;  3LOC A;  3LSR A;  1MBK A;  2L9R A;  1OJL A;  1K83 J;  1YRN B;  1MSE C;  1T33 A;  1JKQ C;  2XGC A;  2M8G X;  1PUF A;  2HXI A;  1UHS A;  4AUX A;  1ZR4 A;  2ME6 A;  1AU7 A;  2GLO A;  1CQT A;  3I4M J;  4JX5 A;  4MO7 A;  2Y30 A;  4J19 A;  3GBG A;  4XRM A;  3JRA A;  3GTJ J;  3LSP A;  4DZP A;  2G0E A;  1YRN A;  1MBJ A;  2HI3 A;  2DMQ A;  1WH5 A;  5JLW A;  3IV5 A;  2X48 A;  4MLO A;  3VPR A;  4A3F J;  2KDZ A;  5IPA A;  5FKM A;  4C3J J;  2DA4 A;  2R0Q C;  2N8G A;  1ETX A;  3JRE A;  3BG9 A;  5J1R A;  2HQ5 A;  4D7N A;  1APL C;  2IEK A;  1ZTR A;  5E3N A;  1ZK8 A;  3ZQF A;  2OF7 A;  1ZQ3 P;  1BW6 A;  2EZI A;  3NAU A;  2VKV A;  5IYD J;  4D5C A;  3RZD J;  3TW7 A;  4GFB A;  1TWF J;  4EEF G;  3DEW A;  2R93 J;  2ELK A;  1G2H A;  4JX4 A;  5FKN A;  1JTY A;  2YS9 A;  5F1J A;  1VND A;  5M5X J;  1WGX A;  2R7Z J;  2FD5 A;  3IH3 A;  4M6V A;  2EH3 A;  1SFO J;  2CRG A;  3LSG A;  2YU9 J;  2NVQ J;  1TWG J;  1VI0 A;  1B8I B;  3BQZ A;  3GTK J;  3BR0 A;  3WHC A;  3CMY A;  3S1M J;  3ZQH A;  4XID A;  3BR6 A;  1HDP A;  1NK3 P;  4B1R A;  1FJL A;  3K7A J;  2DMP A;  4L5E A;  4M3E A;  1B8I A;  4DYR A;  3I4N J;  3B6C A;  2I10 A;  3HB9 A;  4X6A J;  3G1L A;  3WHB A;  3GTG J;  2JA7 J;  1MBE A;  2LVS A;  2DJN A;  2CUE A;  5IP9 J;  3PO3 J;  5K7Z A;  5M5W J;  1B72 B;  2WAQ N;  5E3O A;  3RQI A;  3HOV J;  3FK6 A;  3BG5 A;  2DN0 A;  2W48 A;  3Q0V A;  1RKT A;  3BTJ A;  5M5Y J;  1GVD A;  2Y2Z A;  1B72 A;  1XG1 A;  3FIS A;  2XB5 A;  1H88 C;  1LFU P;  5EDN A;  5K7H A;  1ETW A;  5IOY A;  3GTL J;  3RKQ A;  3IH2 A;  1EF4 A;  3S2D J;  5J1U A;  1FIA A;  2ID6 A;  5K7F A;  3O8H A;  2EBI A;  3NAR A;  1JKO C;  3PO2 J;  1E3O C;  1H8A C;  1QPI A;  1Z0X A;  2NS8 A;  1DU0 A;  4QSH A;  3OSF A;  1BA5 A;  2CQX A;  1AKH B;  5EZG A;  5GPC A;  1TWH J;  3O8G A;  3G1O A;  5FJ8 J;  2FX0 A;  4Y52 J;  1GV2 A;  1WCM J;  2IAI A;  1QRY A;  4B3A A;  5IP6 A;  2R5Z B;  5JLX A;  5FKO A;  1X58 A;  1AKH A;  2EQR A;  2XGD A;  3HEF A;  1IV6 A;  1MSF C;  2XGE A;  2NVT J;  3UKG A;  4XIC A;  1JUS A;  3HM5 A;  5EYR A;  1S7E A;  5EG0 B;  3BTI A;  5C44 J;  4QTR A;  2R5Z A;  1ZKG A;  5EF6 A;  1MBF A;  3S1R J;  2PMZ N;  4FIS A;  1TC3 C;  3TW6 A;  2FQ4 A;  2QCO A;  3B6A A;  2L7F P;  4Y7N J;  3GTM J;  1RR7 A;  5EG0 A;  1RPW A;  1GV5 A;  3BR3 A;  4FTH A;  3F0C A;  3S16 J;  2JWT A;  2DMU A;  4XRS A;  1MH3 A;  4W1U A;  3M4O J;  2DMN A;  3S1Q J;  4FE4 A;  3TP0 A;  2HOT A;  4W97 A;  1QVU A;  5E3L A;  2VI6 A;  2K9S A;  4UUT A;  2P81 A;  2RAE A;  4IHW A;  2DA6 A;  1TWA J;  4I76 A;  5F08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...