1R36A

Nmr-based structure of autoinhibited murine ets-1 deltan301
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVSDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-ets-1 protein
publication title The Structural and Dynamic Basis of Ets-1 DNA Binding Autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r36A00
1TW3A 4HF0A 2LKPA 1ZG1A 2HTJA 4MQ9F 3DPTA 5DEQA 1Y0UA 4KA4A 1S29A 3PQKA 4U7DA 5DDGA 2ZFWA 4CICA 2FEZA 4HOBA 4E70A 2NS0A 4HF1A 4EV0A 3GYHX 4Z2YA 1I1GA 3WODF 5HDGA 1O3RA 4WK8F 2DQRA 3V7RA 5AIPA 3K69A 5L3DA 3V7SA 4UXNA 4EJTA 4L9JA 5LRRA 3SHFA 2YU3A 3HRMA 2PN6A 4AD9A 3FXQA 3REOA 2Z99A 2QWWA 2VONA 5HVQC 1X3UA 2FBIA 3CUQA 5D5UB 2RKHA 3GLXA 4FX0A 1BOAA 1F9NA 5K1YA 2ISZA 3QU6A 3L09A 2MLKA 3HYIA 3GFIA 1FSHA 3GX4X 1CGPA 2ELHA 5BOXA 2V1DA 1EH8A 3E3VA 1REPC 4A0ZA 5D8KB 1IRGA 4XSXF 5LGUA 2A68F 3E6DA 2E1CA 1B9MA 1F5TA 5ILUA 3J80K 4GGGA 3ZMDA 3SXYA 4P5OA 3TOAA 2GA1A 1D8KA 3WE2A 4HQEA 2VBWA 3I4PA 2YX4A 5DCMB 2CSOA 2P5VA 5JR3A 3LA7A 2QVOA 1O3SA 2UZKA 3LQQA 1P92A 1R5HA 1YQAA 1MD0A 5L3FA 1CF7A 3OOPA 1HKTA 3ABUA 3V8KA 3HSFA 1J0RA 5BQTA 2VOOA 2VE9A 5CVUA 3IL2A 4LD5A 1TQIA 3I53A 5ICEA 4IVNA 5FLXK 4IRHA 2XKOA 2ZBKA 4A2UA 2LF7A 3VOEA 5E1XA 3BOQA 4A0YA 2YX7A 4D0PA 1BIBA 2V1UA 2A07F 4ESFA 2M8EA 5CVIA 1KU3A 3BP8A 1BC7C 1WI9A 2HFHA 2CFXA 3BPXA 2OQRA 1PP7U 4KFCA 2RC4A 1UFMA 1OYYA 2X0LA 2Q2EA 4QWQA 1KU9A 1B4AA 2EV5A 4KIGA 3E5QA 1TNSA 2XV4S 2P7CB 1SMTA 2HTSA 5LHGA 2G7UA 4L9TA 2KJCA 3Q5FA 3QPTA 3DP7A 3RPUA 4XRFA 1IN5A 1FC3A 3KP6A 3ECOA 4IRIA 3IRRA 1OMIA 2O6GE 3TKYA 4MTEA 3GZ5A 5DCFA 1I5ZA 3RKWA 2VT3A 2JSCA 3FMQA 3W6JB 2D45A 2EK5A 4ZYHA 1LDDA 1PP8F 3O6BB 2L3DA 2QM3A 2OU2A 1XDSA 4JK1X 3HIFA 2Y48A 4KIFA 2GWRA 2QENA 4A6DA 4IJAA 1O3TA 3IKVA 3BJ6A 2G7HA 2ISYA 4HLYA 1YIOA 5F64A 5DD4A 3FM5A 3HUGA 2VBYA 2M5WA 2IJLA 1B1BA 3N97A 5DD8A 2ZO4A 4XLNF 1S7OA 5FO5A 2DI3A 3L9FA 4GCVA 4KIBA 1P2FA 4A5NA 2PMUA 1K79A 5ILVA 5DCMA 3ULQB 6PAXA 3TDZC 1FBUA 3GFMA 1R7JA 4K2EA 3HRSA 1VTNC 2Z5UA 5LHHA 4U88A 3RTRA 2QUFA 3R0AA 1K6OA 4IHTA 1ULYA 4YG2F 4CYDA 1BI0A 1XCBA 3RKYA 1LQ1A 2GXGA 3E6CC 1IXRC 3N4MA 4G7OF 5D4SA 4BHPA 4FX4A 3D5LA 5E20A 2IVMA 1G4DA 2VC1A 3QOPA 4M72A 4FT8A 4EM0B 2P6TA 2A6HF 1IN4A 2IP2A 2VXZA 4KUMA 2A3SA 3L7WA 2IPQX 4RAZA 1MKMA 4ASNA 3V8LA 4O6JA 4PGHA 5HS8A 1ZRDA 4OIPF 5HOOA 1B6AA 2VN2A 3JW4A 3IC7A 4U0WA 2HDCA 4G6QA 2KKOA 3E6BA 3BWGA 3NQOA 4YFKF 4UVCA 1ZRFA 3JAMK 4L0ZB 4AIKA 2DK5A 1G3TA 1SD4A 4ENNA 2DU9A 1U8RA 2VE8A 3HTUA 4LG0B 3KZYA 3F3XA 1STZA 2JPBA 4M9XA 3W6KB 2LSOA 3GUDA 3WTYC 2EFOA 1LB2A 1YG2A 3QAHA 3OV8A 4ENJA 4RGUA 4BNCA 4RGXA 5ED4A 3E5XA 3CUQC 2CYYA 1YFHA 1S6LA 1P4XA 1E17A 1UCRA 3B02A 2NAZA 2EB7A 1WKMA 1GXQA 4I2OA 3PFIA 3Q9SA 2FMLA 3BJAA 4L5JA 1W7PD 4P96A 4OOIA 2ESNA 5LLQA 4P9UA 3WTXC 2E1NA 4AWXB 4EGYA 1MJ9A 1JXSA 1FZPB 3ZP5A 1V4RA 3M1EA 3F6OA 3IKTA 3WTZA 3D0SA 1PUEE 3R6SA 4ENKA 4PCQA 4WX9A 2PMHA 1HKQA 2CW0F 2EV0A 5DV5A 3JAMZ 1TBXA 1D5VA 1LJ9A 1JGSA 1OR7A 3ISPA 4CDGA 5L3BA 1AOYA 1IZ1A 1E2XA 2ZCWA 3DKWA 4QLCU 1J7KA 2VT2A 2OZUA 1LNWA 4BYYA 1J9IA 3WTVC 1MJAA 3HRUA 2HKOA 4OIOF 1I6XA 4G7ZF 4XBFA 4NHJA 3F22A 4G8XA 2O61A 1SFEA 2J5PA 5JVTA 5J8FA 1ZLJA 4EVIA 1XSVA 4KT5C 3HOTA 3FXRA 1XSXA 2V9VA 1BI2A 2V79A 4AIHA 4GYIA 2VODA 4U7BA 5F6FA 2B0LA 2Z3YA 2CG4A 4Q4ZF 5H6RA 1XD7A 5CYVA 5KVRA 2BYVE 4YFNF 4R8HA 2PFBA 2HKXA 4GYGA 2CO5A 4RS8A 3C18A 3HRTA 5D5VB 5JI6A 4HLXA 1GXPA 1KU2A 2DQLA 5IT9Z 4H0EA 1IW7F 2DPDA 1IXCA 4EGZA 3GZ6A 3KLOA 2KIFA 2ADUA 2XAQA 2HZTA 4UV9A 2HOEA 3C7JA 4Q5SF 1ZN2A 3CTAA 4LG0A 4RGSA 2MH2A 1T98A 3G73A 3I64A 4MGRA 2OA4A 5FGMA 4HDVA 3CUOA 1KA8A 5D6FA 4N9IA 4LGWA 5HDKA 2F5CA 1UHMA 4CXFA 2RQPA 4L18B 2PI0A 1BBYA 5AONA 2YR2A 4EQQA 3ERED 4I0BA 1ZYRF 1A04A 2GZWA 2QLZA 3COAC 3RPQA 1UHWA 4EM2A 3ELKA 2FA5A 3QRFF 4UUVA 4I98B 3VEPA 4UVBA 1XDUA 1KYZA 2AS5F 5D4RA 3M8FA 5E8GA 2CWEA 3U2RA 1U5TC 3TO6A 1J2XA 3U9GA 2TDXA 4L5IA 3LA2A 2Q0OA 4CGZA 2IRFG 2H6CA 4KN4X 1LDJA 5ICCA 3TDUC 2P4WA 1XGNA 2XIGA 2RN7A 4LLNA 2M1BA 4DNCA 5K5QA 1W7PB 1G3YA 3LAJA 1HXDA 3NRVA 5LEJA 1MDMB 3KP7A 3LWFA 4LJZF 3MCZA 3K1MA 1TNTA 2WTEA 1R1TA 2F5FA 1YS6A 2FSWA 2GXBA 2W57A 1ZRCA 4KYWA 5JHUA 3ZN1A 2FU4A 5DYMA 5CJ9A 3WGHA 3PQJA 3T1BA 2A69F 2P5KA 4CZZA 2MBFA 5HLGA 2PLYA 3GVAA 3E97A 4ON0A 4HZFA 4LB5A 3F8FA 1FP1D 5CLSA 3J81Z 2GA2A 1YS7A 4U0VA 4FHTA 1IAWA 4XLPF 1QQIA 1R36A 2FXAA 1D3YA 3O3KA 4M9SA 2MA3A 1XSDA 3GEZA 3SZPA 1WQ2A 3FZVA 5HDNA 4UV8A 2L01A 2W24A 2ESHA 1R00A 4PGGA 1I27A 2KRFA 3J7AO 2ZNYA 3R0JA 4MHGA 1R1UA 3TGNA 3BJOA 3S2WA 3K9TA 1NHAA 1ZREA 4UHTA 3WTWC 2NNYA 1RI7A 2W84A 1U2WA 4ZZDA 5HLHA 2GAUA 4HDUA 5CVJA 1USSA 4M6XA 2DPUA 2ACJA 3WG9A 1FLIA 1O3QA 2AXLA 1QNTA 2FQ3A 4HX7A 2JTVA 3EDPA 4IPAA 1QGPA 1J5YA 1IRFA 1S8NA 3DPLC 5BS6A 4WXCA 2ZMEB 1H9GA 1QPMA 3BDDA 1R23A 1HSJA 2ZXJA 2XKPA 2EV6A 3K0LA 3GFLA 1TQMA 1Z05A 5BPIA 2D1VA 5ICFA 2HS5A 4LK0F 4GO1A 4O5VA 1ODDA 5D5WB 2F5EA 2JPCA 5FFZA 2E7XA 1P4WA 1W7PA 5DUIA 4RAYA 1XGOA 1KGSA 2C6YA 3QP5A 1JHHA 4HA8A 3CJNA 1W4MA 3ABTA 3M9AA 5J8CA 5TJJA 2DTRA 1J75A 1MDMA 2VBZA 4HYEA 2M45A 3Q9VA 2HQNA 4BHCA 2HGCA 1P6RA 2RGVA 4JQFA 2NRAC 3I59B 5A2QK 3T8TA 3AAFA 1QZZA 3SQNA 2F5DA 1DPUA 1ZAOA 2PJPA 4R79A 5EEGA 2ETHA 2WC2A 4KMFA 1ZARA 3P9KA 3JSPA 1WWXA 3ROUA 2HQRA 2M87A 1G3WA 3BY6A 1HW5A 1C0WA 2HR3A 5BPDA 1KQ8A 3K1NA 3P9CA 1W5SA 2EA2A 2EA4A 3QU3A 2DK8A 4TV7A 3I0TA 1FP2A 3DQVC 5E17F 2JRTA 4P9FA 1YTYA 3MFKA 1IUYA 3C1DA 1DPRA 1MGTA 4AVPA 3WTSC 3JTGA 1IN8A 3H3UA 3B73A 2E7WA 5D8LB 1LEBA 4N0BA 1SFXA 2PQ8A 2ZKZA 1EH7A 1R1VA 4CHUA 4I02A 1Z91A 1FYLA 1GVJA 1EV7A 3HHHA 1FYKA 2K02A 3EYYA 4G6DA 4PDKA 1V3FA 3WGIA 3FWEA 4A5MA 1TTYA 3BZ6A 4L9NA 1FBSA 3TO7A 3MAJA 3KEOA 3MWMA 4OU0A 5A2QZ 1LDKB 1RZ4A 3ZMUA 4ESBA 3BROA 3KP5A 5K5RA 4A6EA 4RGRA 4F7ZA 1SAXA 3ZMVA 5D5XB 4EJWA 4CO8A 1ZG3A 2ZMEA 4ZYGA 4DQ2A 2D1HA 1KQ9A 3WTUC 3FMSA 3QPHA 2DO7A 4A0XA 2MLGA 4BXUA 1RNLA 2Y0MA 2FF4A 3DXJF 1XCVA 4KICA 1SD5A 3HSEA 2PEXA 4PZJA 5HS9A 3F8BA 3ZMTA 1TQPA 3QP6A 1UB9A 5IT9K 4ENMA 1HQCA 1U6GA 5LHIA 4MEXF 2QQAA 5K5OA 3WU1B 2K27A 4OINF 3ML6A 3CO7C 4EJOA 1P4AA 2WV0A 3MZYA 4M73A 3HSRA 4BQAA 4L9VA 1KQ0A 2VOPA 4WCGA 1FY7A 2FBKA 1LEAA 5L3CA 1O57A 1OPCA 1IN7A 3I59A 3SZTA 3TQNA 2DAOA 2O8XA 5FD5A 2R3SA 1ZGAA 4A12A 3RYPA 3ZN0A 5HS7A 4OIRF 4IRGA 5LRSA 3FHZA 4KNYA 4HX8A 2CQKA 2XAJA 2K4JA 1U78A 2RDPA 3LSTA 2L54A 3L00A 3WU0A 3ZQ7A 5FD6A 1SD6A 1WSUA 1ZLKA 2FRHA 4O3MA 2F2EA 1HBXG 5E1WA 3HTSB 1G3SA 2A61A 2L4AA 3KP3A 2LNBA 2FNPA 1ON2A 4EM1A 3KLNA 5AIQA 4OMZA 3ZMZA 4ESJA 2R7DA 1XB4A 1ZH5A 2P6SA 4OIQF 1Z9CA 1MJBA 3MEXA 3DF8A 2STWA 3BPVA 3KE2A 1K7AA 2BEOA 1FT9A 5FFXA 4BH9A 3RDIA 2K86A 2DT5A 1EH6A 3CO6C 2JT1A 4BAYA 1IF1A 2XAGA 1L3LA 4G94A 4I0AA 4LFUA 3F23A 2GIVA 4LK1F 2Q8KA 3HHGA 4UVAA 2DFIA 1K78B 3ECHA 2Z9OA 1JHFA 1OKRA 2RV8A 2J5OA 1S3JA 2DW4A 2HYGD 2IT0A 3WTTC 1R58A 3SFZA 3KEQA 3J81K 4S04A 3F8MA 4LMYA 1YO5C 5HLIA 1SFUA 1Z1DA 1RIOH 1HSTA 2MH9A 1SD7A 4NB5A 1J59A 3GF2A 1T0FA 2XASA 1YW7A 3L2CA 3FM3A 4LB6B 4AIJA 1U5TB 3KP4A 2LDUA 2EFWA 4ZH4F 2ZNZA 3H92A 5KK1A 2XHKA 3LA3A 2H6BA 3T8RA 5LEKA 2HEOA 1AWCA 4N9HA 4Q47A 1XN7A 4HF2A 1O7LA 2FMYA 3F8CA 4RB0A 4HQMA 4M6YA 2QQBA 4B8XA 1XGMA 2MC3A 2Y75A 3KFWX 1T2KA 2BV6A 2L02A 4WWCA 1MZBA 3WE3A 3R4KA 3JTHA 2Z33A 3NEUA 4IHSA 1WRJA 2BGCA 2LF8A 1USTA 2P8TA 3LQRA 2KJBA 2A5YB 2BE5F 3I71A 4EMSA 1B59A 1XMKA 4RB1A 5F1RA 2RNJA 1F4KA 1D8JA 4MQVA 1Q1HA 5E1ZB 2ZJ2A 5L3GA 3I58A 2FBHA 3RJPA 1L0OC 1T38A 4L0YB 1S7AA 3J80Z 2QYOA 1FSEA 5ERIA 2PG4A 2EWNA 3IWFA 1BN5A 3GXOA 4GXOA 2UXNA 1RUNA 3F72A 2OBPA 2YSRA 3F21A 3GO5A 5TRDA 3LFKA 3CLOA 5LBQA 3P9IA 3EQLF 1R22A 1K78A 4KN7X 4HBLA 5CVRA 2FNAA 2K7LA 3FXUA 3RIRA 5FLXZ 4ETSA 3V4GA 1FX7A 2XVCA 1T6SA 5J6XA 3ZMSA 3ZPLA 1FBQA 1XMAA 4G9YA 2NNNA 4MNUA 2QBYB 2H27A 5CVVA 1U3EM 3JSOA 5DUKA 4M9ZA 4IXAA 2OD5A 3FF5A 2V1XA 1SMYF 1U5TA 1RUOA 2G9WA 4HW0A 3K2ZA 2YPRA 2EFQA 2EFNA 2RVCA 3R61A 1KU7A 3KETA 4HX4A 1IXSB 4P55A 1O7FA 1Z6RA 1OYWA 3MZHA 3EYIA 1HW1A 2KIUA 1T39A 3MQ0A 4HAMA 3TO9A 3I5UA 4IF4A 1DP7P 3KP2A 2QZ8A 3DV8A 1DDNA 2JZYA 2NYXA 2H09A 4YFXF 2DBBA 2V6CA 3FX3A 2W85A 3EETA 5LGTA 4M71A 1YW9A 4NQWA 2OZ6A 3RI4A 4R1HA 4S05A 1JE8A 1QZYA 3O2PE 4OMYA 3IWZA 1YYVA 2GQQA 4Q48A 2L4MA 4XSZF 3TOBA 1FPQA 4JBAA 4MEYF 1H0MA 2KIMA 2OQGA 2PBIA 1FNNA 3V8JA 4Y13A 4G7HF 1G6NA 1FWZA 1ZG5A 1KYWA 3DEUA 1ZGJA 3G3ZA 2MD5A 1LVAA 4ZZLA 3GFJA 2STTA 2H94A 5JFRA 3V7CA 5H20A 1BI3A 4LLLA 2UXXA 3FMRA 2W25A 4KDPA 3K1PA 4I09A 1ONVA 1TW2A 3IHUA 2UWMA 5ICGA 4YIIA 3KCCA 2CGPA 4I7HA 1Z6TA 1BI1A 4Y17A 1YLFA 2X4HA 4HV5A 3VODA 2R7FA 1IN6A 3LAPA 3P7NA 1R5GA 5BMZA 5H6QA 1QBJA 2HWVA 3DFGA 2D2WA 4U0YA 1YW8A 1QO0D 4WF2A 3CUQB 5LGNA 4M74A 2XUBA 4Y15A 1FOKA 3EUHA 1TLHB 5ILSA 5IT3A 1ZHFA 2IW5A 2IA2A 2QBYA 2IA1A 1OYIA 1DUXC 1B9NA 4YIFA 4BHBA 3WGGA 1F1ZA 2P7VB 2VC0A 3H3ZA 1HKSA 1PDNC 1H9TA 1BIAA 5FB2A 3GW2A 4RB2C 2FE3A 4EJUA 2XROA 4HV6A 2DLLA 3E5UA 2O0YA 1GHCA 4MTDA 1ON1A 3M7GA 1I1SA 2FOKA 4ZYEA 1HW2A 2COMA 3RYRA 2XAFA 2A6EF 2P5LC 2M30A 2BBYA 2IA0A 4LLGF 3RKXA 4KMUX 2XAHA 2EFPA 5D6EA 2HYFA 2EJRA 3F6VA 5EEHA 5E18F 3T0YA 3CDHA 2VBXA 3VFZA 1XGSA 3HOSA 5E8IA 3IRQA 2K4BA 3T5XA 1CF7B 1FYMA 4WXDA 2QQ9A 4EJVA 4UNOA 3M8EA 3KZZA 3C3WA 1BJAA 2O03A 3R60A 3VB2A 1BM9A 4B09A 3U1DA 1Z7UA 2OAZA 4I01A 2WWYA 1BC8C 2XRNA 2XGXA 3E6MA 3F8NA 4WXHA 5L3EA 4ZYDA 1W5TA 3GWZA 2O3FA 3I54A 4RB3C
chains in the Genus database with same CATH superfamily
3SDBA 1TW3A 4PSWA 1RC9A 5E3LA 3CF2A 4HF0A 1J09A 1CQTA 2LKPA 1ZG1A 4XN3A 1W0TA 3GCMA 2K9LA 3H9GA 1OISA 2FQ4A 2HTJA 3OYAA 1YJ9I 3HOXJ 4II3A 4MQ9F 3DPTA 5DEQA 3WHCA 1Y0UA 4KA4A 3OSGA 1VQLI 1S29A 1OCOH 3PQKA 4U7DA 5DDGA 2H1LA 2MW8A 2ZFWA 5J4VA 2M2EA 3F0CA 1V54H 2Q2EB 2X85A 4CICA 4XRMA 5HNFA 1PUFA 2FEZA 1WJCA 2COBA 4HOBA 4E70A 1SFKA 2NS0A 4HF1A 3JRGA 4EV0A 3GYHX 2NVQJ 4Z2YA 4XORA 1FIPA 1I1GA 2JN6A 3WODF 1UJ8A 5HDGA 2E2HJ 1O3RA 4WK8F 1MMNA 2M4KA 1MNEA 2QQ8A 2DQRA 3ONQA 3V7RA 5AIPA 3K69A 1UHSA 5L3DA 3CP2A 3V7SA 4UXNA 1D1BA 3CJQB 3FK7A 1HCRA 4EJTA 1VQ7I 4L9JA 5LRRA 1APLC 3FHNA 3I3LA 2NOJB 3ZQQA 3SHFA 2YU3A 3HRMA 2PN6A 4AD9A 3GTJJ 3FXQA 4ZYAA 3REOA 4ZDOA 2Z99A 2QWWA 3GBGA 2VONA 3OMYA 5HVQC 2VI6A 1HLVA 1U9OA 1X3UA 2FBIA 3CUQA 5D5UB 2IS1A 4E7SA 2RKHA 3GLXA 4FX0A 4NDLA 5IYCJ 1Y6IA 1WH5A 1BOAA 1F9NA 2DYRH 5K1YA 2ISZA 3QU6A 5F1JA 1D0ZA 4C3HJ 3L09A 4B1RA 3K4JA 4JOMA 4NUBA 1IJWC 3S3NA 2MLKA 4FTHA 3HYIA 3P5JA 3RZDJ 4JX4A 3GFIA 2R5YA 1FSHA 3GX4X 1S72I 1CGPA 2ELHA 5BOXA 4PFOA 2V1DA 3S1RJ 4Y3OA 1EH8A 1Y8RB 1JKRC 1UAAA 3E3VA 1REPC 4A0ZA 5D8KB 3HUGB 2IGMA 3GTQJ 1IRGA 4XSXF 1X3ZB 3HBLA 3DLAA 2A68F 5LGUA 3VYTB 3E6DA 4IO9F 2E1CA 4BXFA 2DFEA 2LRDA 2OCEA 2ZB9A 3TMOA 1B9MA 1F5TA 5ILUA 3J80K 1I3AA 4GGGA 3ZMDA 3AG4H 3SXYA 4P5OA 4U87A 3H5AA 3TOAA 1JKOC 1A35A 2GA1A 1D8KA 3WE2A 3MZ8A 4HQEA 2PJRB 2VBWA 3I4PA 2YX4A 2EH3A 3S1NJ 2GIZA 5DCMB 2CSOA 2P5VA 1BJZA 5JR3A 4XL9A 1K61A 3LA7A 4JYKA 2QVOA 1O3SA 3FXKA 1FTZA 2ICWG 3IUOA 2UZKA 2AXTC 3V42A 1PYVA 3LQQA 4GFBA 1P92A 1R5HA 1YQAA 1MD0A 5L3FA 2A5WA 3OOPA 1CF7A 1HKTA 2JA5J 3ABUA 1MBHA 3CMEI 5M5XJ 3FXMA 4BE1A 1RKTA 3V8KA 5IYDJ 3HSFA 1J0RA 2Y0SN 5BQTA 1YX5A 2DFFA 2VOOA 3BTJA 2VE9A 5CVUA 1FMVA 5EYRA 3IL2A 4LD5A 1TQIA 3I53A 5ICEA 4IVNA 5FLXK 4PJLA 4DYRA 2EZHA 2B9SA 2CW7A 4IRHA 2XKOA 2ZBKA 3CCYA 2XC7A 4A2UA 2LF7A 1VI0A 2NOGA 3VOEA 5E1XA 1WPKA 3BOQA 4A0YA 2MGQA 2ZC2A 4LIVA 2HVQA 2YX7A 4D0PA 1BIBA 2V1UA 4LIUA 2ELKA 2XGEA 2A07F 4ESFA 2M8EA 4FE4A 5CVIA 1AU7A 3G71I 4ZDPA 4OAYA 2HYJA 4XM3A 1KU3A 3BP8A 1BC7C 4XKCA 1WI9A 2BY0A 2HFHA 2LR8A 2LP0A 2CFXA 3BPXA 2OQRA 1PP7U 4KFCA 2RC4A 1UFMA 1OYYA 1A6QA 4RAFA 2X0LA 2Q2EA 4QWQA 3UR3C 1KU9A 1B4AA 1FOWA 2HXIA 2HQ5A 2BVMA 2EV5A 4KIGA 3A02A 1MNMC 3E5QA 5GTHC 2GLOA 1TNSA 2XV4S 3OYCA 1KONA 5FKKA 2P7CB 3S1QJ 1SMTA 3OS1A 2HTSA 5LHGA 3PO2J 1NG6A 2G7UA 4J19A 2OV7A 4L9TA 1XG1A 2BXYA 2KJCA 3M8JA 3I55I 3Q5FA 3QPTA 3DP7A 2L7MP 4X1EA 2BVLA 2X1CA 3RPUA 4XRFA 1IN5A 3L2QA 5FRMA 1FC3A 1TWGJ 3KP6A 3ECOA 4IRIA 3IRRA 2QCOA 1OMIA 3A0HC 2O6GE 3TKYA 2MYSA 4MTEA 3GZ5A 2E71A 2LK2A 4CA0A 5DCFA 3JRHA 3SDGA 1I5ZA 1TWHJ 3RKWA 3VSKA 2VT3A 1P9QC 2XF6A 3JR9A 4G6TB 2JSCA 3FMQA 3K4CA 3Q0WA 3W6JB 2Y9ZA 2D45A 2EK5A 2R4GA 4ZYHA 1LDDA 1PP8F 2ZXWH 5M3MJ 3O6BB 3PNTA 1FJLA 2L3DA 2QM3A 2OU2A 2K3PA 4Y7NJ 1XDSA 2V9PA 3HIFA 4JK1X 1IV8A 5GPAA 2Y48A 3GTMJ 3QYFA 2FOWA 4KIFA 2GWRA 4E7ZA 1R71A 4DYQA 1G8XA 3K4NA 5KNLA 2QENA 5EJCA 2I5UA 4A6DA 4IJAA 1O3TA 4XRSA 2ZMEC 3L2WA 3S15J 3J7ZI 3C2HA 4A3IJ 4FASD 3OYBA 2VQLA 3IKVA 3BJ6A 1VQMI 2G7HA 2ISYA 2O7OA 4HLYA 1YIOA 5F64A 5DD4A 4G12A 1SVMA 3FM5A 3OL3A 3HJEA 5IYBJ 1MBKA 2VBYA 3HUGA 2M5WA 2IS2A 2IJLA 1B1BA 5C4JJ 2W4SA 2DMQA 3N97A 5DD8A 4XQFA 1ETXA 2ZO4A 4XLNF 1S7OA 3BR5A 4LOCA 2W1OA 5FO5A 3OS0A 2DI3A 3L9FA 1WFXA 4GCVA 4KIBA 2PJRA 5FKMA 1P2FA 4A5NA 5GPCA 2PMUA 1K79A 5ILVA 5DCMA 3ULQB 3I4MJ 6PAXA 1DGWY 3TDZC 2W7NA 1FBUA 3GFMA 1ETKA 1R7JA 4K2EA 4MFEA 3HRSA 1VTNC 2Z5UA 3AG1H 1W5CC 4BU2A 5LHHA 3BG6A 4A3EJ 4NC6A 2DMNA 2XPUA 4U88A 3RTRA 2QUFA 3R0AA 3OYFA 1K6OA 1ULYA 4IHTA 5EF6A 2GM4A 1G59A 4YG2F 5J4YA 5FKOA 3RKYA 1BI0A 1XCBA 4CYDA 1LQ1A 1U8BA 2GXGA 3QOEA 1HA8A 3E6CC 1IXRC 2MSYA 3N4MA 4G7OF 5D4SA 1QVTA 4I76A 4BHPA 2MC4A 4HSTA 4FX4A 3JREA 3D5LA 5E20A 2IVMA 2DA3A 1G4DA 4OAZA 2CQQA 3K4MA 3W2AA 3D1NI 2VC1A 2HPMA 3QOPA 1Y56A 3E1SA 4M72A 1X2NA 4FT8A 4EM0B 3LNQA 2P6TA 2A6HF 1IN4A 2IP2A 4B47A 2VXZA 4KUMA 3OYNA 3RPUD 1V5GA 2A3SA 4F92B 3L7WA 2IPQX 3CCMI 2VLAA 2DYSH 3M3YJ 1XMXA 1MBEA 2MFZA 2PX9A 1U9NA 3OYEA 3H9JA 4RAZA 1MKMA 3OS2A 4E7JA 2E60A 2VJ4A 4YIRX 4C2TA 1K4SA 4ASNA 4YELA 3V8LA 4O6JA 4PGHA 5HS8A 3PM1A 3MKWB 1ZRDA 1SVOA 4OIPF 5HOOA 2Y2ZA 1B6AA 2FUG2 1VQNI 4IOCF 2VN2A 3JW4A 3IC7A 4U0WA 4PFPA 1VF9A 2D5VA 3GTLJ 2NVUB 1Y0NA 1QZEA 5HNHA 2HDCA 4G6QA 3VYUB 1XS9A 2M34A 2X6YA 1B72B 2KKOA 3W6VA 2GBYA 3J7YJ 3FXLA 5IP7J 1AA7A 3E6BA 1M1EB 3BWGA 3NQOA 3BQYA 1RPWA 4YFKF 4PSXA 4UVCA 1ZRFA 1W36D 1SC7A 3JAMK 4L0ZB 4AIKA 2VUMJ 3UNGC 2DK5A 1G3TA 3CC7I 1SD4A 5E79C 3RZOJ 3FXJA 4ENNA 2DU9A 1U8RA 3ZR8X 2VE8A 3HTUA 4LG0B 3KZYA 3F3XA 4PJJA 5B1BH 3ZQGA 4IHXA 2R7WA 1STZA 1YOVB 2JPBA 4M9XA 3W6KB 2LSOA 1OCZH 3GUDA 5J3LA 3WTYC 2EFOA 4XLHA 1JJ8C 5DM7F 1LB2A 1VNDA 1YG2A 3QAHA 3OV8A 4F3QA 2KLOA 4ENJA 3PNYA 4RGUA 4BNCA 4RGXA 2JK3A 2M9HA 3ABKH 3DWLE 5ED4A 4KT6A 3E5XA 3CUQC 2CYYA 1YFHA 5DTDA 4X0GA 1IO2A 1P4XA 1S6LA 4B48A 3CESA 3PUFA 1E17A 1UCRA 3B02A 3L2RA 3CDIA 2NAZA 2EB7A 1WKMA 3FK6A 3JRDA 4AU7A 1GXQA 2FD5A 4I2OA 1HF0A 3PFIA 3Q9SA 1N78A 2FMLA 3BJAA 4L5JA 2IGOA 1W7PD 2VKHA 4P96A 4OOIA 2EIJH 1IV6A 2ESNA 5LLQA 4P9UA 3WTXC 1IG7A 2E1NA 4AWXB 5IPAA 4EGYA 4A3CJ 4CH7A 1MJ9A 2TCTA 4BJ5C 2ME0A 1JXSA 4RDUA 1FZPB 2CQXA 3ZP5A 5FLVA 4M3FA 1V4RA 4IQ4A 2E19A 2ZJQF 1RKWA 3M1EA 3F6OA 4DBRA 3IKTA 1TWCJ 4XN0A 3ASOH 3D0SA 3WTZA 4DYCA 1PUEE 3R6SA 4ENKA 3G2BA 4PCQA 4WX9A 2PMHA 2L9VA 1HKQA 1RETA 2CW0F 2EV0A 3D5SC 5DV5A 3JAMZ 1R9TJ 1ETQA 1TBXA 2KL4A 1D5VA 1LJ9A 1JGSA 1OR7A 2IGNA 2VPLA 2CFOA 1WZ2A 3DKXA 5J1RA 2K9MA 3ISPA 3HZJA 4CDGA 4NNJA 4DGWB 5L3BA 1YIJI 3UKGA 1AOYA 3ZGKA 1IZ1A 3FISA 1E2XA 1V55H 2ZCWA 5E3MA 3LSPA 3DKWA 4QLCU 1J7KA 2VT2A 1VQOI 3PSFA 2OZUA 3EPZA 1LNWA 4BYYA 2GOMA 1J9IA 3WTVC 1MJAA 3HRUA 2HKOA 1WHUA 3TW7A 1I6XA 4G7ZF 3GZNB 4OIOF 3J7AY 2LREA 4XBFA 3AKZA 4NHJA 3F22A 2R7VA 4G8XA 1Y8QB 3G1OA 4BE2A 2O61A 1SFEA 2J5PA 3KYLA 1JGGA 5JVTA 5GTIC 5J8FA 1ZLJA 1T8IA 4EVIA 1XSVA 2LBFB 4KT5C 3HOTA 3FXRA 1NTCA 1YITI 2LG4A 1XSXA 2V9VA 3AFHA 1BI2A 2V79A 3FDYA 4AIHA 4GYIA 4ABZA 2VODA 1Z3YA 5K7FA 4U7BA 5F6FA 2B0LA 2Z3YA 3HG9A 3LSRA 4ZTFA 1H89C 2OPTA 1R5ID 2CG4A 2AQEA 5H6RA 4Q4ZF 1G2HA 1QRYA 1XD7A 3HDDA 2VKEA 1P7IA 1JUPA 5CYVA 1VQ6I 5KVRA 2BYVE 2JVHA 4YFNF 2DT6A 1YE9A 4R8HA 4KISA 2VJJA 2KQRA 1S7EA 2PFBA 3VYRB 1B72A 3ZOBA 2HKXA 4GYGA 2CO5A 4RS8A 3C18A 3HRTA 5D5VB 5JI6A 2DN0A 2ID6A 4HLXA 4GDFA 1GXPA 1VQKI 1KU2A 2DQLA 4W1UA 1X58A 4DW6A 5IT9Z 3RSNA 1IW7F 3IH3A 1ETWA 1NG7A 4H0EA 2DPDA 1IXCA 4EGZA 4BS9A 3GZ6A 3KLOA 3BR2A 4A3FJ 3LL7A 4D7MA 2KIFA 2ADUA 2XAQA 2HZTA 1HOMA 4RAGA 4UV9A 2HOEA 3C7JA 4KJZA 4Q5SF 1ZN2A 3CTAA 1Z77A 4LG0A 3K2AA 4IHYA 3GTPJ 1VQ8I 4UY8I 4RGSA 4ZJZA 3H9QA 2ZFUA 2ECBA 2O8KA 2MH2A 1T98A 3G73A 3I64A 4MGRA 2OA4A 5FGMA 4HDVA 3CUOA 3QYEA 4IHWA 1KA8A 5D6FA 1YI2I 4N9IA 4BDZA 4LGWA 5HDKA 2F5CA 1UHMA 2IBDA 4CXFA 2RQPA 4IHVA 2XF7A 4L18B 3LSJA 2PI0A 1OCPA 1BBYA 5AONA 5HODA 3Q0UA 1W0UA 2YR2A 4EQQA 3ERED 2CJJA 4I0BA 1ZYRF 1JTYA 5F0FA 4RM3A 5H2FC 3S3MA 1UG0A 1A04A 3OWTA 4F93B 4RLFA 3U21A 3IV5A 2GZWA 3SEQA 3VDXA 1ETOA 2QLZA 3COAC 3RPQA 1UHWA 2CUJA 4EM2A 3I9V2 3CJTB 2FA5A 3ELKA 3QRFF 4I98B 3VEPA 4UUVA 3DTIA 3BT9A 4UVBA 1XDUA 4FCYA 4BJTA 4I99C 1XX5A 1K4TA 1KYZA 2AS5F 5D4RA 3M8FA 5E8GA 4BQOA 3GTGJ 2CWEA 2WADA 4NBQA 3U2RA 2VJIA 4Z6YA 1U5TC 3TO6A 3OL4A 3OIQA 1J2XA 2KP6A 3U9GA 2TDXA 3KEYA 4ANJA 4L5IA 3KZIC 1LVKA 3LA2A 3ZQFA 2R93J 2Q0OA 4CGZA 4DIQA 2KIQA 2IRFG 5B5EC 1NH3A 2H6CA 3MD2A 4A3GJ 4AVZA 1GDTA 2XDVA 2DA2A 2L7KA 4KN4X 5JLXA 3M4OJ 1LDJA 2KPMA 2MG4A 5ICCA 1FTTA 3CCSI 3TDUC 3K70C 3C2GA 1WJDA 4A69C 5GAGJ 2P4WA 4P1WA 1QPIA 1XGNA 2DJNA 2XIGA 3OYMA 3HGYA 3HOYJ 2RN7A 4LLNA 2M1BA 2E5NA 2H8RA 4DNCA 5K5QA 1W7PB 1G3YA 4BUPA 2JUCA 2EZLA 5KHDA 3LAJA 2JA8J 1LE8B 5HLTA 1HXDA 3NRVA 4DOZA 5IP6A 1BR4A 2ZSHB 2LMDA 4QPOA 5LEJA 4N4OB 2JMWA 1MDMB 4B4CA 1DU0A 4IOAF 1GV2A 2IAIA 3KP7A 4BE0A 2AO9A 1NK3P 3LWFA 4S0HB 1OCRH 1A31A 4LJZF 2DODA 3MCZA 3ERMA 3DCFA 2LBFA 3K1MA 2CV1A 1TNTA 2WTEA 1R1TA 2DA4A 1YS6A 2F5FA 2FSWA 3DBLB 2GXBA 2W57A 3JRBA 3WHBA 1ZRCA 4KYWA 5JHUA 2DMTA 3ZN1A 2FU4A 5DYMA 5CJ9A 3WGHA 1Z21A 3PQJA 2V4JC 3T1BA 2A69F 2KRHA 1WJEA 2P5KA 3PSIA 4CZZA 2MBFA 2EQRA 5JHFA 5HLGA 2PLYA 3GVAA 3CLQA 2L5QA 3E97A 4ON0A 4HZFA 3L1PA 4LB5A 3F8FA 1FP1D 3GLLA 5CLSA 3J81Z 2GA2A 1YS7A 4CCJA 4F55A 4U0VA 4FHTA 1Y1VJ 4C2MJ 1IAWA 2HVSA 4HRIA 4XLPF 1QQIA 1WI3A 4UB8C 2X48A 4UUSB 1R36A 2FXAA 1D3YA 4E6KG 3O3KA 2LFBA 4M9SA 2MA3A 2QGUA 1XSDA 3G1MA 3GEZA 3SZPA 1VQ4I 1WQ2A 3IH2A 3G1LA 3BC8A 1K6YA 2DMUA 5GAEJ 3FZVA 3HOZJ 1ETVA 5HDNA 4UV8A 2L01A 2W24A 4HSRA 4C3IJ 4IX7A 2ESHA 4CCLA 9ANTA 1R00A 4PGGA 1I27A 1IGNA 2HQAA 2KRFA 4BQQA 3J7AO 2ZNYA 4CCOA 3R0JA 2V26A 4XKBA 1R1UA 4MHGA 4BDYA 3ASNH 1LPQA 4CZCA 2F4MB 3TGNA 3BJOA 2LYCA 3NWTA 3CDLA 3S14J 2AQFA 3S2WA 3K9TA 1NHAA 3SZGA 1ZREA 4UHTA 3WTWC 2NNYA 3WG7H 2R7UA 2QKMB 1F36A 1RI7A 2W84A 1HDDC 1U2WA 3GTOJ 2QA4I 4ZZDA 3FKJA 5HLHA 1MBFA 2R92J 1S5LC 2WY7Q 1MH4A 2GAUA 2LVSA 4HDUA 5CVJA 3H5RA 3BTIA 3CZ6A 4E7HA 1VQPI 1USSA 1WJBA 4XIDA 4M6XA 1ZR2A 2DPUA 2XAUA 3ZQCA 3LFUA 3EUHC 2ACJA 3FXOA 4W97A 3WG9A 2BW3B 5JLWA 1FLIA 1QA6A 1O3QA 2AXLA 2FJ1A 1QNTA 2FQ3A 2WB1A 4HX7A 2JTVA 3EDPA 4IPAA 1QGPA 1IDYA 3ZXSA 1J5YA 3KPHA 1IRFA 1S8NA 1X2MA 3DPLC 2CUZA 5BS6A 4B43A 4WXCA 3HGGA 2ZMEB 1R4NB 3PJRA 4H4KC 1H9GA 1RRJA 4D7NA 1TP4A 1QPMA 1TT5B 3BDDA 2VJ5A 1R23A 3E0JB 2YU9J 3S16J 4XR6A 3H1CA 3TW6A 1HSJA 2ZXJA 2NVTJ 3S2DJ 4A3LJ 2DDAA 2XKPA 2EV6A 3H0GJ 4BEHB 4D5FA 1ZK8A 3K0LA 2CH0A 3GFLA 1I39A 4IQJA 1RR8C 2F4OB 3ABLH 4HNVA 1TQMA 5J47A 1Z05A 2M7AA 5BPIA 2D1VA 1JJ6C 4F52A 4HG2A 5ICFA 2HS5A 2K9SA 1X1CA 4LK0F 3IP4B 1WCMJ 4GO1A 4O5VA 2V9KA 1ODDA 5D5WB 2F5EA 2JPCA 5FFZA 3OY9A 2E7XA 3BQZA 1P4WA 1W7PA 5DUIA 1PJRA 3DU5A 1OR7C 1XGOA 4RAYA 1KGSA 2C6YA 3QP5A 1EA3A 4HPQA 1LE8A 1JHHA 4HA8A 3SFIA 3CJNA 2XSDC 1W4MA 3ABTA 4YRVA 3M9AA 5J8CA 2OTJI 5TJJA 2DTRA 1J75A 1MDMA 1R49A 1FEXA 2VBZA 1IRZA 4PUSA 4HYEA 2M45A 3Q9VA 5J1YA 3X2QH 1FOYA 4RBOA 2OCCH 2HQNA 4BHCA 1JUSA 3BLYA 2QSFX 4V19K 2HGCA 1P6RA 2RGVA 3M1CA 3GMEA 4JQFA 3I4NJ 2NRAC 3I59B 5A2QK 1I3QJ 4EEFG 2UUZA 2WBMA 5EGOB 2LY9A 3T8TA 3AAFA 1QZZA 2XPWA 3SQNA 2F5DA 2WV1A 2L2OA 2H8WA 2CQ7A 2XF5A 4CCKA 5K7ZA 1A36A 1DPUA 1ZAOA 3Q0VA 2PJPA 1V5EA 4R79A 2Y31A 2HOTA 5EEGA 2ETHA 2WC2A 4KMFA 2IS4A 4M6VA 1ZARA 3P9KA 3B6AA 1WWXA 3JSPA 1Z3XA 2DJIA 3ROUA 2HQRA 4N4NB 2M87A 1G3WA 3BY6A 1HW5A 2RQQA 1C0WA 2HR3A 3AG2H 2VKDA 3ZCOA 1D1CA 4UUSA 5BPDA 1LKXA 1KQ8A 1DQUA 3K1NA 3P9CA 2M3AA 1W5SA 3LOCA 4MFDA 1ZTRA 2EA2A 2EA4A 3QU3A 2DK8A 5FKLA 1VQ9I 4BQNA 4TV7A 3A01B 3JRCA 3I0TA 1FP2A 2OF7A 3FBIB 3DQVC 3BR1A 5IP9J 5E17F 2WAFA 2JRTA 4P9FA 1YTYA 2M0CA 2CRGA 3MFKA 2JA6J 3RQIA 1IUYA 3C1DA 1DPRA 2DDBA 1MGTA 3DLLF 4AVPA 3WTSC 3JTGA 1IN8A 1ENHA 1X4OA 3H3UA 1R4MB 4AYBA 2VPRA 3B73A 4A3MJ 1MMSA 2E7WA 3S17J 2JSPA 2K85A 1X3WB 3JRAA 5D8LB 2Z2SB 1ZGWA 1LEBA 3W2WA 3JRIA 3CCLI 4N0BA 2JWTA 2LH9A 1ERDA 1SFXA 2E1OA 2NS7A 2PQ8A 2ZKZA 2B63J 3RKQA 1EH7A 3HEFA 1R1VA 4CHUA 4I02A 4D5CA 3LSMA 2DOEA 3LSHA 1Z91A 1FYLA 1Q1VA 3A1YA 2E35A 4BBRJ 3G4SI 1GVJA 1EV7A 3HHHA 4C30A 1FYKA 2K02A 3EYYA 4E7IA 5EG0B 4G6DA 5KCMA 4PDKA 3BCAA 5FKNA 3WU2C 1V3FA 3OIPA 3KYCB 3WGIA 3A03A 3FWEA 4L5EA 4A5MA 1TTYA 3BZ6A 4L9NA 1FBSA 4II2A 3TO7A 1N25A 3MAJA 1X1AA 3CQZJ 3KEOA 3MWMA 4OU0A 5A2QZ 1LDKB 1RZ4A 3ZMUA 5KAFC 4ESBA 3AL0C 2BW3A 3BROA 1UZCA 4QPQA 2FX0A 3KP5A 3HPHA 5K5RA 3CD6I 4A6EA 4RGRA 2K9NA 4F7ZA 1SAXA 3S1MJ 3CC2I 1SANA 3FKIJ 3ZMVA 5D5XB 5C44J 2F4IA 1VQ5I 4BY1J 3CCRI 4EJWA 2VQHA 4A3DJ 3DPUA 1WJAA 4CO8A 1IDZA 2WB1N 1ZG3A 2DT7B 2BHZA 2ZMEA 4DQ2A 4ZYGA 2D1HA 1KQ9A 2ZXIA 2HPIA 3WTUC 3FMSA 3IH4A 1POGA 3QPHA 1WGXA 5TGTA 4JX5A 2DO7A 4A0XA 2MLGA 4BXUA 1RNLA 2K40A 2Y0MA 4ZDLA 3PNVA 2FF4A 3DXJF 2X6OA 1XCVA 4KICA 1SD5A 3HSEA 4BEHA 2PEXA 4PZJA 5HS9A 3F8BA 3ZMTA 1H8AC 1TQPA 3QP6A 3ZRGA 1UB9A 5IT9K 3CJRB 4BKXA 4ENMA 1HQCA 4XKVA 1U6GA 4BY7J 5LHIA 2VKVA 4MEXF 2QQAA 5K5OA 3WU1B 1X4PA 4PJMA 4C3JJ 5M5YJ 5IOYA 1MNDA 1W1WE 1EJ9A 2K27A 4OINF 2R7QA 1R6RA 4RA2A 3DBHB 3ML6A 3DTEA 3QQAA 4UUTA 3CO7C 1OCTC 4IKFA 4EJOA 1P4AA 1JKPC 4C2UA 4PK4A 2JJ7A 2O5RA 1BR2A 2Q1ZB 2WV0A 3MZYA 4M73A 3HSRA 3BG5A 4BQAA 4L9VA 1KQ0A 3Q3SA 2VOPA 1E3PA 2L0KA 4WCGA 3SJMA 3C2BA 1FY7A 2FBKA 4XICA 1LEAA 1QVUA 5L3CA 1O57A 2P81A 2V6EA 1OPCA 1IN7A 3I59A 3SZTA 1MMDA 5C3EJ 3TQNA 5EGOA 2DAOA 3O8GA 2O8XA 1YJNI 5FD5A 2DTZA 5JVGF 2R3SA 1SVLA 5F0HA 1ZGAA 4B44A 4A12A 1GV5A 3MKZA 2R7OA 5TISC 2EZIA 4IL6C 2BY3A 3RYPA 3ZN0A 1MH3A 2CMPA 1SEUA 3EUAA 4RLQA 5HS7A 4OIRF 4IRGA 5K7HA 5LRSA 3FHZA 3U1KA 1OFCX 1RESA 3PIPF 4KNYA 4HX8A 1T56A 3O8HA 3PL8A 2CQKA 1H88C 1VZ0A 2XAJA 2K4JA 1U78A 1AHDP 2EILH 3CMYA 2RDPA 3LSTA 2L54A 3L00A 3WU0A 3ZQ7A 2JA2A 3A01A 2E1MB 5FD6A 1XPXA 2KFDA 1LUJB 3L2UA 1MMAA 4XMYA 2CUEA 2WAQA 4HNTA 1SD6A 1WSUA 3D5RC 4LG3A 1AKHB 1ZLKA 2FRHA 4D9JA 2E36A 4O3MA 2CV0A 1OJLA 1OLTA 2F2EA 1HBXG 5E1WA 3HTSB 1G3SA 1A5JA 2A61A 2L4AA 1BW5A 3KP3A 2KISA 2LNBA 2KZGA 2DMPA 2FNPA 5EZGA 1ON2A 3H3VK 2DXIA 4V2FA 4EM1A 3KIOA 4AYBN 3KLNA 2OC6A 2DA7A 2P0WA 3IAM2 5AIQA 1FOXA 4BACA 4OMZA 1S9HA 3ZMZA 1X1PA 2L9RA 4ESJA 2R7DA 1YRNB 1XB4A 2R7SA 3VYSB 3JCUC 4M3DA 2P6SA 1ZH5A 4OIQF 1Z9CA 1MJBA 1TWAJ 3MMYB 3MEXA 3K4LA 3QWLA 5DM6F 3DF8A 2STWA 3BPVA 2WA0A 5EG0A 1U0JA 3DBRB 2BHYA 3KE2A 3OSFA 1K7AA 1GLNA 2BEOA 4Y4RA 4XRSG 2Y30A 1FT9A 5FFXA 1O4XA 4BH9A 3RDIA 4AM3A 2K86A 2DT5A 4A3BJ 1DGRM 1BL0A 1EH6A 3CO6C 1DP3A 2JT1A 3OR2C 4BAYA 1IF1A 2XAGA 1L3LA 4G94A 4I0AA 4LFUA 4XKWA 2E34A 3F23A 2GIVA 4LK1F 3S3OA 3M07A 1P7JA 3BR3A 3HHGA 4UVAA 2Q8KA 2DFIA 3PFYA 1K78B 3TP0A 1UMQA 2RREA 3ECHA 4XOPA 1GT0C 2Z9OA 2RV8A 1JHFA 1OKRA 2J5OA 1QU3A 1KZHA 1S3JA 2HI3A 2WAEA 1ZR4A 2IS6A 4RM2A 2DW4A 1W36C 3DEEA 2HYGD 2MD0A 2IT0A 2JQ7A 3VSLA 1LFUP 3WTTC 2GOXB 2W82A 1R58A 5CQEA 4V2GA 3SFZA 4AC0A 5CKTA 2E2IJ 3KEQA 2NVYJ 2DA5A 2IEKA 4Y52J 4IZZA 4CYCB 3J81K 1TL8A 4S04A 1D1AA 2DOFA 1D0YA 3F8MA 4LMYA 1YO5C 5EZHA 5HLIA 2HZDA 1SFUA 1T95A 2MABA 2X6WA 3PIOF 1Z1DA 1RIOH 3CC4I 1HSTA 2MH9A 1SD7A 4NB5A 1J59A 3GF2A 1T0FA 5CPRB 2XASA 3A2KA 1YW7A 5IY5H 2R7TA 4KITB 3L2CA 2CU7A 2VL8A 5FJ8J 1EKEA 3FM3A 3S93A 4DBQA 1TWFJ 3PUBA 3K4KA 2BY2A 4LB6B 4CSWA 4AIJA 1U5TB 2DOAA 2DA6A 3KP4A 2LDUA 2CUFA 2EFWA 4ZH4F 3F9KA 4ZC3A 3NAUA 2ZNZA 4E7KA 3H92A 2X9DA 3MN2A 3CMMA 1X1DA 1XC5A 2BY1A 2NS8A 2XGDA 4NC7A 5KK1A 2XHKA 4LITA 3LA3A 4I6ZA 2H6BA 3T8RA 5LEKA 2HEOA 2EINH 3BR6A 1AWCA 2EBIA 4N9HA 4Q47A 1XN7A 3LSGA 3CCUI 1XTAA 1O7LA 2HOSA 3KYDB 3OYGA 2FMYA 4HF2A 1T33A 3F8CA 2TRTA 1TT0A 4RB0A 4HQMA 4M6YA 2QQBA 4HNUA 2HOAA 4AUXA 3FBNB 2RAEA 4B8XA 1XGMA 1K83J 2MC3A 5FROA 2K5CA 2H1KA 2Y75A 3KFWX 5B3SH 1T2KA 2BV6A 2L02A 2L9NA 5CQGA 4WWCA 1MZBA 2NVXJ 5F27A 3WE3A 3ABMH 3NWSA 3R4KA 2ELJA 3JTHA 2Z33A 1WVRA 4XK4A 3NEUA 5LFAA 4ZTJA 4IHSA 5GAHJ 1WRJA 2BGCA 2LF8A 3HM5A 1USTA 1E3HA 3DU6A 3BCBA 2P8TA 3LQRA 3OYLA 2KJBA 3DKYA 2A5YB 4NQWB 4XLEA 1X1BA 2BE5F 5LD2C 3I71A 3LMMA 4BBSJ 4EMSA 1B59A 1XMKA 4HEA2 5F1RA 4RB1A 1D5YA 3TL4X 2RNJA 3W2VA 5EEAA 1F4KA 3HOVJ 1D8JA 1IUFA 4MQVA 2VQCA 1Q1HA 1AKHA 5E1ZB 2ID3A 2ZJ2A 5KAIC 3AG3H 4DZPA 5L3GA 2LLKA 4FQGA 5M5WJ 2WAQN 1TC3C 1ZELA 1IRXA 2Y69H 3I58A 2FBHA 3RJPA 1JTXA 1MIJA 3H35A 1L0OC 4NC8A 3H0DA 1ZQ3P 5M3FJ 1T38A 4L0YB 2JUGA 4YEJA 1S7AA 1Z0XA 3LSKA 1YRNA 3J80Z 3QODA 2F6CA 2OJED 2ZSIB 2QYOA 3ZQHA 1FSEA 5EDNA 1MW7A 5ERIA 2PG4A 2X1EA 2EWNA 3OYKA 2IXSA 3IWFA 1BN5A 3OYDA 1MSFC 3GXOA 4GXOA 2UXNA 1N77A 1RUNA 3F72A 2OBPA 2UV1A 1UG2A 2L7ZA 3VWBA 2R0QC 2YSRA 3F21A 3OOUA 2N8GA 3GO5A 5TRDA 2CW8A 1MBGA 5IOZA 3LFKA 2LD5A 3CLOA 1ITYA 2HDDA 2IGKA 5FLMJ 5LBQA 3P9IA 3EQLF 2YS9A 1R22A 1K78A 4KN7X 3HC7A 4F91B 4HBLA 5CVRA 1E0EA 2VASA 2FNAA 3NARA 1MBJA 1WJFA 2K7LA 4JP0A 2EPFA 2KT0A 3FXUA 4FISA 1MSEC 2V1NA 3DTKA 1A6IA 3N05A 3RIRA 5FLXZ 4ETSA 5FRNA 2W00A 2QSGX 3BZKA 5BNGA 2LKSA 3V4GA 3QPLA 3BG7A 4FETA 3OR1C 1I6HJ 1FX7A 4CYCA 2E2JJ 3TEDA 2XVCA 1T6SA 2G0EA 5J6XA 3GTKJ 3ZMSA 4XOTA 3ZPLA 3HOUJ 1FBQA 1Y1WJ 3OIOA 1XMAA 2YUSA 3ZQIA 1BW6A 1B8IB 4G9YA 2NNNA 5J1UA 4MNUA 2QBYB 2H27A 2KHMA 5CVVA 3KX2A 1Z67A 1U3EM 3JSOA 5DUKA 4M9ZA 4IXAA 2OD5A 2XPVA 3FF5A 2V1XA 2L9SA 2E5ZA 4UB6C 1SMYF 1OCCH 5E3OA 1U5TA 2DCEA 1RUOA 5B66C 3CF5F 2X1DA 2G9WA 3CMAI 4HW0A 3L2VA 2NXNB 3K2ZA 3K6GA 2YPRA 2EFQA 2EFNA 2RVCA 3MKLA 3A4CA 3R61A 3W3CA 2ZJRF 2R5ZB 4DJAA 4Y33A 1KU7A 2RNGA 3KETA 4HX4A 3LSIA 2PMZA 4JX6A 2Z16A 4M3BA 1IXSB 1ETYA 2OUMA 3EUKL 4P55A 2GXAA 1HC8A 1O7FA 2DA1A 2K3FA 1Z6RA 1OYWA 3MZHA 3EYIA 1HW1A 2KIUA 4MO7A 3MQ0A 4HAMA 3TO9A 1T39A 3I5UA 4IF4A 1DP7P 3KP2A 2QZ8A 3DV8A 3H5NA 3CCQI 1JUMA 1Y39A 1DDNA 1I50J 3HKZA 2JZYA 2NYXA 2H09A 2XRLA 2X51A 3ESWB 2DBBA 4YFXF 3S2HJ 3K7AJ 2V6CA 4XNFA 3BR0A 4C9YA 4J00A 2LY1A 2HVRA 3FX3A 4QTRA 2W85A 4FE7A 5J40A 2BXZA 3EETA 2ME6A 3K4BA 5LGTA 4M71A 2QEXI 4CCNA 1YW9A 3JRFA 1YJWI 5B1AH 1ACIA 4NQWA 2OZ6A 4XONA 4GRIA 4R1HA 4S05A 3RI4A 5F0CA 1BOBA 3CP8A 1LFPA 3H36A 1JE8A 1QZYA 1X19A 3O2PE 4OMYA 3IWZA 2EIMH 2M4GA 1YYVA 2GQQA 2QSHX 3DEWA 1SAUA 4Q48A 2L4MA 2ECCA 4XSZF 1JKQC 3TOBA 4CCMA 1FPQA 2KZVA 4JBAA 4MEYF 1H0MA 2LKXA 4BXXJ 2CQNA 2KIMA 2JRMA 2OQGA 1F43A 2PBIA 3BTLA 4ITVA 1FNNA 3V8JA 1OQYA 2B7EA 3HXLA 4Y13A 1FIAA 4D1QA 1TZLA 3B6CA 2HXOA 4G7HF 1G6NA 1FWZA 2VXDA 1UELB 2M0MA 3BZCA 1ZG5A 1KYWA 3ZQLA 4X6AJ 3DEUA 2A05A 3OYIA 1ZGJA 3G3ZA 2MD5A 1LVAA 1NK2P 4ZZLA 1RR7A 3GFJA 2STTA 2HDWA 4XLCA 2H94A 1V5FA 5JFRA 4E7LA 5GADJ 3FIWA 3HOWJ 3V7CA 2V7FA 5H20A 2X6XA 4BJ6C 4BGDA 2W48A 1BI3A 2HU9A 4LLLA 4OWRB 2UXXA 3FMRA 2W25A 1WJ5A 1QHGA 1IC8A 4KDPA 3K1PA 2XSJC 3K10A 1PUFB 4I09A 1ONVA 1TW2A 3IHUA 1SFOJ 2UWMA 4AIDA 2EIKH 1DU6A 2KDOA 1BA5A 2VB6A 4DZJA 3G6EI 5ICGA 1ORKA 4YIIA 3KCCA 2CGPA 2QKLB 4I7HA 1Z6TA 1BI1A 4Y17A 1YLFA 3TP3A 2X4HA 1YX3A 2A6TA 4HV5A 3VODA 2R7FA 1N75A 1JI8A 2VIXA 1JT6A 2AHQA 1IN6A 3LAPA 4A3KJ 2EZKA 2CS3A 3P7NA 1R5GA 2LTPA 5BMZA 5H6QA 3E7LA 1QBJA 2XGCA 2HWVA 3DFGA 3RCOA 3I56I 2VQGA 2WY8Q 2D2WA 2O9LA 4U0YA 1GUUA 1YW8A 1QO0D 4WF2A 3CUQB 5LGNA 1EF4A 4M74A 3VPRA 2XUBA 4Y15A 4A93J 1FOKA 3EUHA 3QPSA 3K70D 3AL0B 1TLHB 5ILSA 5IT3A 2L7FP 4MIMA 1ZHFA 4QIWN 2IW5A 1B8IA 1D0XA 2IA2A 2R7RA 3HB9A 2QBYA 1HDPA 2QF7A 2IA1A 4M3GA 1OYIA 2Y9YA 1DUXC 1B9NA 4YIFA 4BHBA 3WGGA 1VFCA 5F08A 3S32A 1F1ZA 2P7VB 4B3AA 3OYJA 2VC0A 1E3OC 3H3ZA 1HKSA 4MLOA 1ZKGA 2R5YB 3CCJI 1PDNC 1H9TA 3MKYB 1BIAA 5FB2A 3GW2A 1T0FC 5C4XJ 4QSHA 2M8GX 2I10A 4RB2C 3SYTA 2FE3A 3BG9A 4EJUA 2XROA 3MVPA 4HV6A 2DLLA 1QHHD 4M3EA 3E5UA 2JVGA 2O0YA 4B3XA 2Z1DA 2R5ZA 2M7BA 4XLFA 3SEZA 1GVDA 4PJ0C 1YHQI 1GHCA 4MTDA 1ON1A 3M7GA 1JT0A 1I1SA 2FOKA 4ZYEA 2ZJPF 5E3NA 1HW2A 1PVEA 2BZTA 3QYBA 2COMA 3RQ4A 3RYRA 4E4HA 4CUGA 2F48A 4IEJA 2XAFA 2R7ZJ 2A6EF 2I8DA 2P5LC 2M30A 4A3JJ 2BBYA 2PMZN 2IA0A 4LLGF 1T08B 3RKXA 4KMUX 2XAHA 2EFPA 1FMWA 2HYFA 2EJRA 2LY2A 5D6EA 3HPGA 2HNHA 2DFHA 3F6VA 2CV2A 5F04A 2KMUA 5EEHA 5E18F 3T0YA 3CDHA 2VBXA 3VFZA 1XGSA 4BL0B 3HOSA 3A0BC 5E8IA 1BR1A 3IRQA 2K9QA 2BOLA 3IAS2 3HKZN 2K4BA 3HL2A 2Y0SA 2LOOA 3T5XA 1CF7B 3PO3J 1FYMA 4WXDA 5DS9A 2QQ9A 3CCEI 4EJVA 4UNOA 3M8EA 3KZZA 3C3WA 1BJAA 2ZXHA 2XB0X 1MMGA 2O03A 3R60A 3VB2A 1BM9A 4B09A 3U1DA 1Z7UA 2OAZA 3BG3A 4I01A 3S8PA 3BTCA 2WWYA 5GP9A 1BC8C 2XRNA 2JA7J 3CCVI 2XGXA 1LFBA 2LC2A 4J01A 4XLAA 1Z7LA 3OYHA 2XB5A 3E6MA 3F8NA 4WXHA 5L3EA 4ZYDA 2OTLI 2E1MC 2R7XA 4PJNA 4EATA 3TBIA 1W5TA 3GWZA 2O3FA 1WH7A 2KDZA 3I54A 4RMNA 4RB3C 2F5VA 2KRCA
chains in the Genus database with same CATH topology
1TW3A 4HF0A 2LKPA 1ZG1A 2HTJA 4MQ9F 3DPTA 5DEQA 1Y0UA 4KA4A 1S29A 3PQKA 4U7DA 5DDGA 2ZFWA 4CICA 2FEZA 4HOBA 4E70A 2NS0A 4HF1A 4EV0A 3GYHX 4Z2YA 1I1GA 3WODF 5HDGA 1O3RA 4WK8F 2DQRA 3V7RA 5AIPA 3K69A 5L3DA 3V7SA 4UXNA 4EJTA 4L9JA 5LRRA 3SHFA 2YU3A 3HRMA 2PN6A 4AD9A 3FXQA 3REOA 2Z99A 2QWWA 2VONA 5HVQC 1X3UA 2FBIA 3CUQA 5D5UB 2RKHA 3GLXA 4FX0A 1BOAA 1F9NA 5K1YA 2ISZA 3QU6A 3L09A 2MLKA 3HYIA 3GFIA 1FSHA 3GX4X 1CGPA 2ELHA 5BOXA 2V1DA 1EH8A 3E3VA 1REPC 4A0ZA 5D8KB 1IRGA 4XSXF 5LGUA 2A68F 3E6DA 2E1CA 1B9MA 1F5TA 5ILUA 3J80K 4GGGA 3ZMDA 3SXYA 4P5OA 3TOAA 2GA1A 1D8KA 3WE2A 4HQEA 2VBWA 3I4PA 2YX4A 5DCMB 2CSOA 2P5VA 5JR3A 3LA7A 2QVOA 1O3SA 2UZKA 3LQQA 1P92A 1R5HA 1YQAA 1MD0A 5L3FA 1CF7A 3OOPA 1HKTA 3ABUA 3V8KA 3HSFA 1J0RA 5BQTA 2VOOA 2VE9A 5CVUA 3IL2A 4LD5A 1TQIA 3I53A 5ICEA 4IVNA 5FLXK 4IRHA 2XKOA 2ZBKA 4A2UA 2LF7A 3VOEA 5E1XA 3BOQA 4A0YA 2YX7A 4D0PA 1BIBA 2V1UA 2A07F 4ESFA 2M8EA 5CVIA 1KU3A 3BP8A 1BC7C 1WI9A 2HFHA 2CFXA 3BPXA 2OQRA 1PP7U 4KFCA 2RC4A 1UFMA 1OYYA 2X0LA 2Q2EA 4QWQA 1KU9A 1B4AA 2EV5A 4KIGA 3E5QA 1TNSA 2XV4S 2P7CB 1SMTA 2HTSA 5LHGA 2G7UA 4L9TA 2KJCA 3Q5FA 3QPTA 3DP7A 3RPUA 4XRFA 1IN5A 1FC3A 3KP6A 3ECOA 4IRIA 3IRRA 1OMIA 2O6GE 3TKYA 4MTEA 3GZ5A 5DCFA 1I5ZA 3RKWA 2VT3A 2JSCA 3FMQA 3W6JB 2D45A 2EK5A 4ZYHA 1LDDA 1PP8F 3O6BB 2L3DA 2QM3A 2OU2A 1XDSA 4JK1X 3HIFA 2Y48A 4KIFA 2GWRA 2QENA 4A6DA 4IJAA 1O3TA 3IKVA 3BJ6A 2G7HA 2ISYA 4HLYA 1YIOA 5F64A 5DD4A 3FM5A 3HUGA 2VBYA 2M5WA 2IJLA 1B1BA 3N97A 5DD8A 2ZO4A 4XLNF 1S7OA 5FO5A 2DI3A 3L9FA 4GCVA 4KIBA 1P2FA 4A5NA 2PMUA 1K79A 5ILVA 5DCMA 3ULQB 6PAXA 3TDZC 1FBUA 3GFMA 1R7JA 4K2EA 3HRSA 1VTNC 2Z5UA 5LHHA 4U88A 3RTRA 2QUFA 3R0AA 1K6OA 4IHTA 1ULYA 4YG2F 4CYDA 1BI0A 1XCBA 3RKYA 1LQ1A 2GXGA 3E6CC 1IXRC 3N4MA 4G7OF 5D4SA 4BHPA 4FX4A 3D5LA 5E20A 2IVMA 1G4DA 2VC1A 3QOPA 4M72A 4FT8A 4EM0B 2P6TA 2A6HF 1IN4A 2IP2A 2VXZA 4KUMA 2A3SA 3L7WA 2IPQX 4RAZA 1MKMA 4ASNA 3V8LA 4O6JA 4PGHA 5HS8A 1ZRDA 4OIPF 5HOOA 1B6AA 2VN2A 3JW4A 3IC7A 4U0WA 2HDCA 4G6QA 2KKOA 3E6BA 3BWGA 3NQOA 4YFKF 4UVCA 1ZRFA 3JAMK 4L0ZB 4AIKA 2DK5A 1G3TA 1SD4A 4ENNA 2DU9A 1U8RA 2VE8A 3HTUA 4LG0B 3KZYA 3F3XA 1STZA 2JPBA 4M9XA 3W6KB 2LSOA 3GUDA 3WTYC 2EFOA 1LB2A 1YG2A 3QAHA 3OV8A 4ENJA 4RGUA 4BNCA 4RGXA 5ED4A 3E5XA 3CUQC 2CYYA 1YFHA 1S6LA 1P4XA 1E17A 1UCRA 3B02A 2NAZA 2EB7A 1WKMA 1GXQA 4I2OA 3PFIA 3Q9SA 2FMLA 3BJAA 4L5JA 1W7PD 4P96A 4OOIA 2ESNA 5LLQA 4P9UA 3WTXC 2E1NA 4AWXB 4EGYA 1MJ9A 1JXSA 1FZPB 3ZP5A 1V4RA 3M1EA 3F6OA 3IKTA 3WTZA 3D0SA 1PUEE 3R6SA 4ENKA 4PCQA 4WX9A 2PMHA 1HKQA 2CW0F 2EV0A 5DV5A 3JAMZ 1TBXA 1D5VA 1LJ9A 1JGSA 1OR7A 3ISPA 4CDGA 5L3BA 1AOYA 1IZ1A 1E2XA 2ZCWA 3DKWA 4QLCU 1J7KA 2VT2A 2OZUA 1LNWA 4BYYA 1J9IA 3WTVC 1MJAA 3HRUA 2HKOA 4OIOF 1I6XA 4G7ZF 4XBFA 4NHJA 3F22A 4G8XA 2O61A 1SFEA 2J5PA 5JVTA 5J8FA 1ZLJA 4EVIA 1XSVA 4KT5C 3HOTA 3FXRA 1XSXA 2V9VA 1BI2A 2V79A 4AIHA 4GYIA 2VODA 4U7BA 5F6FA 2B0LA 2Z3YA 2CG4A 4Q4ZF 5H6RA 1XD7A 5CYVA 5KVRA 2BYVE 4YFNF 4R8HA 2PFBA 2HKXA 4GYGA 2CO5A 4RS8A 3C18A 3HRTA 5D5VB 5JI6A 4HLXA 1GXPA 1KU2A 2DQLA 5IT9Z 4H0EA 1IW7F 2DPDA 1IXCA 4EGZA 3GZ6A 3KLOA 2KIFA 2ADUA 2XAQA 2HZTA 4UV9A 2HOEA 3C7JA 4Q5SF 1ZN2A 3CTAA 4LG0A 4RGSA 2MH2A 1T98A 3G73A 3I64A 4MGRA 2OA4A 5FGMA 4HDVA 3CUOA 1KA8A 5D6FA 4N9IA 4LGWA 5HDKA 2F5CA 1UHMA 4CXFA 2RQPA 4L18B 2PI0A 1BBYA 5AONA 2YR2A 4EQQA 3ERED 4I0BA 1ZYRF 1A04A 2GZWA 2QLZA 3COAC 3RPQA 1UHWA 4EM2A 3ELKA 2FA5A 3QRFF 4UUVA 4I98B 3VEPA 4UVBA 1XDUA 1KYZA 2AS5F 5D4RA 3M8FA 5E8GA 2CWEA 3U2RA 1U5TC 3TO6A 1J2XA 3U9GA 2TDXA 4L5IA 3LA2A 2Q0OA 4CGZA 2IRFG 2H6CA 4KN4X 1LDJA 5ICCA 3TDUC 2P4WA 1XGNA 2XIGA 2RN7A 4LLNA 2M1BA 4DNCA 5K5QA 1W7PB 1G3YA 3LAJA 1HXDA 3NRVA 5LEJA 1MDMB 3KP7A 3LWFA 4LJZF 3MCZA 3K1MA 1TNTA 2WTEA 1R1TA 2F5FA 1YS6A 2FSWA 2GXBA 2W57A 1ZRCA 4KYWA 5JHUA 3ZN1A 2FU4A 5DYMA 5CJ9A 3WGHA 3PQJA 3T1BA 2A69F 2P5KA 4CZZA 2MBFA 5HLGA 2PLYA 3GVAA 3E97A 4ON0A 4HZFA 4LB5A 3F8FA 1FP1D 5CLSA 3J81Z 2GA2A 1YS7A 4U0VA 4FHTA 1IAWA 4XLPF 1QQIA 1R36A 2FXAA 1D3YA 3O3KA 4M9SA 2MA3A 1XSDA 3GEZA 3SZPA 1WQ2A 3FZVA 5HDNA 4UV8A 2L01A 2W24A 2ESHA 1R00A 4PGGA 1I27A 2KRFA 3J7AO 2ZNYA 3R0JA 4MHGA 1R1UA 3TGNA 3BJOA 3S2WA 3K9TA 1NHAA 1ZREA 4UHTA 3WTWC 2NNYA 1RI7A 2W84A 1U2WA 4ZZDA 5HLHA 2GAUA 4HDUA 5CVJA 1USSA 4M6XA 2DPUA 2ACJA 3WG9A 1FLIA 1O3QA 2AXLA 1QNTA 2FQ3A 4HX7A 2JTVA 3EDPA 4IPAA 1QGPA 1J5YA 1IRFA 1S8NA 3DPLC 5BS6A 4WXCA 2ZMEB 1H9GA 1QPMA 3BDDA 1R23A 1HSJA 2ZXJA 2XKPA 2EV6A 3K0LA 3GFLA 1TQMA 1Z05A 5BPIA 2D1VA 5ICFA 2HS5A 4LK0F 4GO1A 4O5VA 1ODDA 5D5WB 2F5EA 2JPCA 5FFZA 2E7XA 1P4WA 1W7PA 5DUIA 4RAYA 1XGOA 1KGSA 2C6YA 3QP5A 1JHHA 4HA8A 3CJNA 1W4MA 3ABTA 3M9AA 5J8CA 5TJJA 2DTRA 1J75A 1MDMA 2VBZA 4HYEA 2M45A 3Q9VA 2HQNA 4BHCA 2HGCA 1P6RA 2RGVA 4JQFA 2NRAC 3I59B 5A2QK 3T8TA 3AAFA 1QZZA 3SQNA 2F5DA 1DPUA 1ZAOA 2PJPA 4R79A 5EEGA 2ETHA 2WC2A 4KMFA 1ZARA 3P9KA 3JSPA 1WWXA 3ROUA 2HQRA 2M87A 1G3WA 3BY6A 1HW5A 1C0WA 2HR3A 5BPDA 1KQ8A 3K1NA 3P9CA 1W5SA 2EA2A 2EA4A 3QU3A 2DK8A 4TV7A 3I0TA 1FP2A 3DQVC 5E17F 2JRTA 4P9FA 1YTYA 3MFKA 1IUYA 3C1DA 1DPRA 1MGTA 4AVPA 3WTSC 3JTGA 1IN8A 3H3UA 3B73A 2E7WA 5D8LB 1LEBA 4N0BA 1SFXA 2PQ8A 2ZKZA 1EH7A 1R1VA 4CHUA 4I02A 1Z91A 1FYLA 1GVJA 1EV7A 3HHHA 1FYKA 2K02A 3EYYA 4G6DA 4PDKA 1V3FA 3WGIA 3FWEA 4A5MA 1TTYA 3BZ6A 4L9NA 1FBSA 3TO7A 3MAJA 3KEOA 3MWMA 4OU0A 5A2QZ 1LDKB 1RZ4A 3ZMUA 4ESBA 3BROA 3KP5A 5K5RA 4A6EA 4RGRA 4F7ZA 1SAXA 3ZMVA 5D5XB 4EJWA 4CO8A 1ZG3A 2ZMEA 4ZYGA 4DQ2A 2D1HA 1KQ9A 3WTUC 3FMSA 3QPHA 2DO7A 4A0XA 2MLGA 4BXUA 1RNLA 2Y0MA 2FF4A 3DXJF 1XCVA 4KICA 1SD5A 3HSEA 2PEXA 4PZJA 5HS9A 3F8BA 3ZMTA 1TQPA 3QP6A 1UB9A 5IT9K 4ENMA 1HQCA 1U6GA 5LHIA 4MEXF 2QQAA 5K5OA 3WU1B 2K27A 4OINF 3ML6A 3CO7C 4EJOA 1P4AA 2WV0A 3MZYA 4M73A 3HSRA 4BQAA 4L9VA 1KQ0A 2VOPA 4WCGA 1FY7A 2FBKA 1LEAA 5L3CA 1O57A 1OPCA 1IN7A 3I59A 3SZTA 3TQNA 2DAOA 2O8XA 5FD5A 2R3SA 1ZGAA 4A12A 3RYPA 3ZN0A 5HS7A 4OIRF 4IRGA 5LRSA 3FHZA 4KNYA 4HX8A 2CQKA 2XAJA 2K4JA 1U78A 2RDPA 3LSTA 2L54A 3L00A 3WU0A 3ZQ7A 5FD6A 1SD6A 1WSUA 1ZLKA 2FRHA 4O3MA 2F2EA 1HBXG 5E1WA 3HTSB 1G3SA 2A61A 2L4AA 3KP3A 2LNBA 2FNPA 1ON2A 4EM1A 3KLNA 5AIQA 4OMZA 3ZMZA 4ESJA 2R7DA 1XB4A 1ZH5A 2P6SA 4OIQF 1Z9CA 1MJBA 3MEXA 3DF8A 2STWA 3BPVA 3KE2A 1K7AA 2BEOA 1FT9A 5FFXA 4BH9A 3RDIA 2K86A 2DT5A 1EH6A 3CO6C 2JT1A 4BAYA 1IF1A 2XAGA 1L3LA 4G94A 4I0AA 4LFUA 3F23A 2GIVA 4LK1F 2Q8KA 3HHGA 4UVAA 2DFIA 1K78B 3ECHA 2Z9OA 1JHFA 1OKRA 2RV8A 2J5OA 1S3JA 2DW4A 2HYGD 2IT0A 3WTTC 1R58A 3SFZA 3KEQA 3J81K 4S04A 3F8MA 4LMYA 1YO5C 5HLIA 1SFUA 1Z1DA 1RIOH 1HSTA 2MH9A 1SD7A 4NB5A 1J59A 3GF2A 1T0FA 2XASA 1YW7A 3L2CA 3FM3A 4LB6B 4AIJA 1U5TB 3KP4A 2LDUA 2EFWA 4ZH4F 2ZNZA 3H92A 5KK1A 2XHKA 3LA3A 2H6BA 3T8RA 5LEKA 2HEOA 1AWCA 4N9HA 4Q47A 1XN7A 4HF2A 1O7LA 2FMYA 3F8CA 4RB0A 4HQMA 4M6YA 2QQBA 4B8XA 1XGMA 2MC3A 2Y75A 3KFWX 1T2KA 2BV6A 2L02A 4WWCA 1MZBA 3WE3A 3R4KA 3JTHA 2Z33A 3NEUA 4IHSA 1WRJA 2BGCA 2LF8A 1USTA 2P8TA 3LQRA 2KJBA 2A5YB 2BE5F 3I71A 4EMSA 1B59A 1XMKA 4RB1A 5F1RA 2RNJA 1F4KA 1D8JA 4MQVA 1Q1HA 5E1ZB 2ZJ2A 5L3GA 3I58A 2FBHA 3RJPA 1L0OC 1T38A 4L0YB 1S7AA 3J80Z 2QYOA 1FSEA 5ERIA 2PG4A 2EWNA 3IWFA 1BN5A 3GXOA 4GXOA 2UXNA 1RUNA 3F72A 2OBPA 2YSRA 3F21A 3GO5A 5TRDA 3LFKA 3CLOA 5LBQA 3P9IA 3EQLF 1R22A 1K78A 4KN7X 4HBLA 5CVRA 2FNAA 2K7LA 3FXUA 3RIRA 5FLXZ 4ETSA 3V4GA 1FX7A 2XVCA 1T6SA 5J6XA 3ZMSA 3ZPLA 1FBQA 1XMAA 4G9YA 2NNNA 4MNUA 2QBYB 2H27A 5CVVA 1U3EM 3JSOA 5DUKA 4M9ZA 4IXAA 2OD5A 3FF5A 2V1XA 1SMYF 1U5TA 1RUOA 2G9WA 4HW0A 3K2ZA 2YPRA 2EFQA 2EFNA 2RVCA 3R61A 1KU7A 3KETA 4HX4A 1IXSB 4P55A 1O7FA 1Z6RA 1OYWA 3MZHA 3EYIA 1HW1A 2KIUA 1T39A 3MQ0A 4HAMA 3TO9A 3I5UA 4IF4A 1DP7P 3KP2A 2QZ8A 3DV8A 1DDNA 2JZYA 2NYXA 2H09A 4YFXF 2DBBA 2V6CA 3FX3A 2W85A 3EETA 5LGTA 4M71A 1YW9A 4NQWA 2OZ6A 3RI4A 4R1HA 4S05A 1JE8A 1QZYA 3O2PE 4OMYA 3IWZA 1YYVA 2GQQA 4Q48A 2L4MA 4XSZF 3TOBA 1FPQA 4JBAA 4MEYF 1H0MA 2KIMA 2OQGA 2PBIA 1FNNA 3V8JA 4Y13A 4G7HF 1G6NA 1FWZA 1ZG5A 1KYWA 3DEUA 1ZGJA 3G3ZA 2MD5A 1LVAA 4ZZLA 3GFJA 2STTA 2H94A 5JFRA 3V7CA 5H20A 1BI3A 4LLLA 2UXXA 3FMRA 2W25A 4KDPA 3K1PA 4I09A 1ONVA 1TW2A 3IHUA 2UWMA 5ICGA 4YIIA 3KCCA 2CGPA 4I7HA 1Z6TA 1BI1A 4Y17A 1YLFA 2X4HA 4HV5A 3VODA 2R7FA 1IN6A 3LAPA 3P7NA 1R5GA 5BMZA 5H6QA 1QBJA 2HWVA 3DFGA 2D2WA 4U0YA 1YW8A 1QO0D 4WF2A 3CUQB 5LGNA 4M74A 2XUBA 4Y15A 1FOKA 3EUHA 1TLHB 5ILSA 5IT3A 1ZHFA 2IW5A 2IA2A 2QBYA 2IA1A 1OYIA 1DUXC 1B9NA 4YIFA 4BHBA 3WGGA 1F1ZA 2P7VB 2VC0A 3H3ZA 1HKSA 1PDNC 1H9TA 1BIAA 5FB2A 3GW2A 4RB2C 2FE3A 4EJUA 2XROA 4HV6A 2DLLA 3E5UA 2O0YA 1GHCA 4MTDA 1ON1A 3M7GA 1I1SA 2FOKA 4ZYEA 1HW2A 2COMA 3RYRA 2XAFA 2A6EF 2P5LC 2M30A 2BBYA 2IA0A 4LLGF 3RKXA 4KMUX 2XAHA 2EFPA 5D6EA 2HYFA 2EJRA 3F6VA 5EEHA 5E18F 3T0YA 3CDHA 2VBXA 3VFZA 1XGSA 3HOSA 5E8IA 3IRQA 2K4BA 3T5XA 1CF7B 1FYMA 4WXDA 2QQ9A 4EJVA 4UNOA 3M8EA 3KZZA 3C3WA 1BJAA 2O03A 3R60A 3VB2A 1BM9A 4B09A 3U1DA 1Z7UA 2OAZA 4I01A 2WWYA 1BC8C 2XRNA 2XGXA 3E6MA 3F8NA 4WXHA 5L3EA 4ZYDA 1W5TA 3GWZA 2O3FA 3I54A 4RB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TW3 A;  4HF0 A;  2LKP A;  1ZG1 A;  2HTJ A;  4MQ9 F;  3DPT A;  5DEQ A;  1Y0U A;  4KA4 A;  1S29 A;  3PQK A;  4U7D A;  5DDG A;  2ZFW A;  4CIC A;  2FEZ A;  4HOB A;  4E70 A;  2NS0 A;  4HF1 A;  4EV0 A;  3GYH X;  4Z2Y A;  1I1G A;  3WOD F;  5HDG A;  1O3R A;  4WK8 F;  2DQR A;  3V7R A;  5AIP A;  3K69 A;  5L3D A;  3V7S A;  4UXN A;  4EJT A;  4L9J A;  5LRR A;  3SHF A;  2YU3 A;  3HRM A;  2PN6 A;  4AD9 A;  3FXQ A;  3REO A;  2Z99 A;  2QWW A;  2VON A;  5HVQ C;  1X3U A;  2FBI A;  3CUQ A;  5D5U B;  2RKH A;  3GLX A;  4FX0 A;  1BOA A;  1F9N A;  5K1Y A;  2ISZ A;  3QU6 A;  3L09 A;  2MLK A;  3HYI A;  3GFI A;  1FSH A;  3GX4 X;  1CGP A;  2ELH A;  5BOX A;  2V1D A;  1EH8 A;  3E3V A;  1REP C;  4A0Z A;  5D8K B;  1IRG A;  4XSX F;  5LGU A;  2A68 F;  3E6D A;  2E1C A;  1B9M A;  1F5T A;  5ILU A;  3J80 K;  4GGG A;  3ZMD A;  3SXY A;  4P5O A;  3TOA A;  2GA1 A;  1D8K A;  3WE2 A;  4HQE A;  2VBW A;  3I4P A;  2YX4 A;  5DCM B;  2CSO A;  2P5V A;  5JR3 A;  3LA7 A;  2QVO A;  1O3S A;  2UZK A;  3LQQ A;  1P92 A;  1R5H A;  1YQA A;  1MD0 A;  5L3F A;  1CF7 A;  3OOP A;  1HKT A;  3ABU A;  3V8K A;  3HSF A;  1J0R A;  5BQT A;  2VOO A;  2VE9 A;  5CVU A;  3IL2 A;  4LD5 A;  1TQI A;  3I53 A;  5ICE A;  4IVN A;  5FLX K;  4IRH A;  2XKO A;  2ZBK A;  4A2U A;  2LF7 A;  3VOE A;  5E1X A;  3BOQ A;  4A0Y A;  2YX7 A;  4D0P A;  1BIB A;  2V1U A;  2A07 F;  4ESF A;  2M8E A;  5CVI A;  1KU3 A;  3BP8 A;  1BC7 C;  1WI9 A;  2HFH A;  2CFX A;  3BPX A;  2OQR A;  1PP7 U;  4KFC A;  2RC4 A;  1UFM A;  1OYY A;  2X0L A;  2Q2E A;  4QWQ A;  1KU9 A;  1B4A A;  2EV5 A;  4KIG A;  3E5Q A;  1TNS A;  2XV4 S;  2P7C B;  1SMT A;  2HTS A;  5LHG A;  2G7U A;  4L9T A;  2KJC A;  3Q5F A;  3QPT A;  3DP7 A;  3RPU A;  4XRF A;  1IN5 A;  1FC3 A;  3KP6 A;  3ECO A;  4IRI A;  3IRR A;  1OMI A;  2O6G E;  3TKY A;  4MTE A;  3GZ5 A;  5DCF A;  1I5Z A;  3RKW A;  2VT3 A;  2JSC A;  3FMQ A;  3W6J B;  2D45 A;  2EK5 A;  4ZYH A;  1LDD A;  1PP8 F;  3O6B B;  2L3D A;  2QM3 A;  2OU2 A;  1XDS A;  4JK1 X;  3HIF A;  2Y48 A;  4KIF A;  2GWR A;  2QEN A;  4A6D A;  4IJA A;  1O3T A;  3IKV A;  3BJ6 A;  2G7H A;  2ISY A;  4HLY A;  1YIO A;  5F64 A;  5DD4 A;  3FM5 A;  3HUG A;  2VBY A;  2M5W A;  2IJL A;  1B1B A;  3N97 A;  5DD8 A;  2ZO4 A;  4XLN F;  1S7O A;  5FO5 A;  2DI3 A;  3L9F A;  4GCV A;  4KIB A;  1P2F A;  4A5N A;  2PMU A;  1K79 A;  5ILV A;  5DCM A;  3ULQ B;  6PAX A;  3TDZ C;  1FBU A;  3GFM A;  1R7J A;  4K2E A;  3HRS A;  1VTN C;  2Z5U A;  5LHH A;  4U88 A;  3RTR A;  2QUF A;  3R0A A;  1K6O A;  4IHT A;  1ULY A;  4YG2 F;  4CYD A;  1BI0 A;  1XCB A;  3RKY A;  1LQ1 A;  2GXG A;  3E6C C;  1IXR C;  3N4M A;  4G7O F;  5D4S A;  4BHP A;  4FX4 A;  3D5L A;  5E20 A;  2IVM A;  1G4D A;  2VC1 A;  3QOP A;  4M72 A;  4FT8 A;  4EM0 B;  2P6T A;  2A6H F;  1IN4 A;  2IP2 A;  2VXZ A;  4KUM A;  2A3S A;  3L7W A;  2IPQ X;  4RAZ A;  1MKM A;  4ASN A;  3V8L A;  4O6J A;  4PGH A;  5HS8 A;  1ZRD A;  4OIP F;  5HOO A;  1B6A A;  2VN2 A;  3JW4 A;  3IC7 A;  4U0W A;  2HDC A;  4G6Q A;  2KKO A;  3E6B A;  3BWG A;  3NQO A;  4YFK F;  4UVC A;  1ZRF A;  3JAM K;  4L0Z B;  4AIK A;  2DK5 A;  1G3T A;  1SD4 A;  4ENN A;  2DU9 A;  1U8R A;  2VE8 A;  3HTU A;  4LG0 B;  3KZY A;  3F3X A;  1STZ A;  2JPB A;  4M9X A;  3W6K B;  2LSO A;  3GUD A;  3WTY C;  2EFO A;  1LB2 A;  1YG2 A;  3QAH A;  3OV8 A;  4ENJ A;  4RGU A;  4BNC A;  4RGX A;  5ED4 A;  3E5X A;  3CUQ C;  2CYY A;  1YFH A;  1S6L A;  1P4X A;  1E17 A;  1UCR A;  3B02 A;  2NAZ A;  2EB7 A;  1WKM A;  1GXQ A;  4I2O A;  3PFI A;  3Q9S A;  2FML A;  3BJA A;  4L5J A;  1W7P D;  4P96 A;  4OOI A;  2ESN A;  5LLQ A;  4P9U A;  3WTX C;  2E1N A;  4AWX B;  4EGY A;  1MJ9 A;  1JXS A;  1FZP B;  3ZP5 A;  1V4R A;  3M1E A;  3F6O A;  3IKT A;  3WTZ A;  3D0S A;  1PUE E;  3R6S A;  4ENK A;  4PCQ A;  4WX9 A;  2PMH A;  1HKQ A;  2CW0 F;  2EV0 A;  5DV5 A;  3JAM Z;  1TBX A;  1D5V A;  1LJ9 A;  1JGS A;  1OR7 A;  3ISP A;  4CDG A;  5L3B A;  1AOY A;  1IZ1 A;  1E2X A;  2ZCW A;  3DKW A;  4QLC U;  1J7K A;  2VT2 A;  2OZU A;  1LNW A;  4BYY A;  1J9I A;  3WTV C;  1MJA A;  3HRU A;  2HKO A;  4OIO F;  1I6X A;  4G7Z F;  4XBF A;  4NHJ A;  3F22 A;  4G8X A;  2O61 A;  1SFE A;  2J5P A;  5JVT A;  5J8F A;  1ZLJ A;  4EVI A;  1XSV A;  4KT5 C;  3HOT A;  3FXR A;  1XSX A;  2V9V A;  1BI2 A;  2V79 A;  4AIH A;  4GYI A;  2VOD A;  4U7B A;  5F6F A;  2B0L A;  2Z3Y A;  2CG4 A;  4Q4Z F;  5H6R A;  1XD7 A;  5CYV A;  5KVR A;  2BYV E;  4YFN F;  4R8H A;  2PFB A;  2HKX A;  4GYG A;  2CO5 A;  4RS8 A;  3C18 A;  3HRT A;  5D5V B;  5JI6 A;  4HLX A;  1GXP A;  1KU2 A;  2DQL A;  5IT9 Z;  4H0E A;  1IW7 F;  2DPD A;  1IXC A;  4EGZ A;  3GZ6 A;  3KLO A;  2KIF A;  2ADU A;  2XAQ A;  2HZT A;  4UV9 A;  2HOE A;  3C7J A;  4Q5S F;  1ZN2 A;  3CTA A;  4LG0 A;  4RGS A;  2MH2 A;  1T98 A;  3G73 A;  3I64 A;  4MGR A;  2OA4 A;  5FGM A;  4HDV A;  3CUO A;  1KA8 A;  5D6F A;  4N9I A;  4LGW A;  5HDK A;  2F5C A;  1UHM A;  4CXF A;  2RQP A;  4L18 B;  2PI0 A;  1BBY A;  5AON A;  2YR2 A;  4EQQ A;  3ERE D;  4I0B A;  1ZYR F;  1A04 A;  2GZW A;  2QLZ A;  3COA C;  3RPQ A;  1UHW A;  4EM2 A;  3ELK A;  2FA5 A;  3QRF F;  4UUV A;  4I98 B;  3VEP A;  4UVB A;  1XDU A;  1KYZ A;  2AS5 F;  5D4R A;  3M8F A;  5E8G A;  2CWE A;  3U2R A;  1U5T C;  3TO6 A;  1J2X A;  3U9G A;  2TDX A;  4L5I A;  3LA2 A;  2Q0O A;  4CGZ A;  2IRF G;  2H6C A;  4KN4 X;  1LDJ A;  5ICC A;  3TDU C;  2P4W A;  1XGN A;  2XIG A;  2RN7 A;  4LLN A;  2M1B A;  4DNC A;  5K5Q A;  1W7P B;  1G3Y A;  3LAJ A;  1HXD A;  3NRV A;  5LEJ A;  1MDM B;  3KP7 A;  3LWF A;  4LJZ F;  3MCZ A;  3K1M A;  1TNT A;  2WTE A;  1R1T A;  2F5F A;  1YS6 A;  2FSW A;  2GXB A;  2W57 A;  1ZRC A;  4KYW A;  5JHU A;  3ZN1 A;  2FU4 A;  5DYM A;  5CJ9 A;  3WGH A;  3PQJ A;  3T1B A;  2A69 F;  2P5K A;  4CZZ A;  2MBF A;  5HLG A;  2PLY A;  3GVA A;  3E97 A;  4ON0 A;  4HZF A;  4LB5 A;  3F8F A;  1FP1 D;  5CLS A;  3J81 Z;  2GA2 A;  1YS7 A;  4U0V A;  4FHT A;  1IAW A;  4XLP F;  1QQI A;  1R36 A;  2FXA A;  1D3Y A;  3O3K A;  4M9S A;  2MA3 A;  1XSD A;  3GEZ A;  3SZP A;  1WQ2 A;  3FZV A;  5HDN A;  4UV8 A;  2L01 A;  2W24 A;  2ESH A;  1R00 A;  4PGG A;  1I27 A;  2KRF A;  3J7A O;  2ZNY A;  3R0J A;  4MHG A;  1R1U A;  3TGN A;  3BJO A;  3S2W A;  3K9T A;  1NHA A;  1ZRE A;  4UHT A;  3WTW C;  2NNY A;  1RI7 A;  2W84 A;  1U2W A;  4ZZD A;  5HLH A;  2GAU A;  4HDU A;  5CVJ A;  1USS A;  4M6X A;  2DPU A;  2ACJ A;  3WG9 A;  1FLI A;  1O3Q A;  2AXL A;  1QNT A;  2FQ3 A;  4HX7 A;  2JTV A;  3EDP A;  4IPA A;  1QGP A;  1J5Y A;  1IRF A;  1S8N A;  3DPL C;  5BS6 A;  4WXC A;  2ZME B;  1H9G A;  1QPM A;  3BDD A;  1R23 A;  1HSJ A;  2ZXJ A;  2XKP A;  2EV6 A;  3K0L A;  3GFL A;  1TQM A;  1Z05 A;  5BPI A;  2D1V A;  5ICF A;  2HS5 A;  4LK0 F;  4GO1 A;  4O5V A;  1ODD A;  5D5W B;  2F5E A;  2JPC A;  5FFZ A;  2E7X A;  1P4W A;  1W7P A;  5DUI A;  4RAY A;  1XGO A;  1KGS A;  2C6Y A;  3QP5 A;  1JHH A;  4HA8 A;  3CJN A;  1W4M A;  3ABT A;  3M9A A;  5J8C A;  5TJJ A;  2DTR A;  1J75 A;  1MDM A;  2VBZ A;  4HYE A;  2M45 A;  3Q9V A;  2HQN A;  4BHC A;  2HGC A;  1P6R A;  2RGV A;  4JQF A;  2NRA C;  3I59 B;  5A2Q K;  3T8T A;  3AAF A;  1QZZ A;  3SQN A;  2F5D A;  1DPU A;  1ZAO A;  2PJP A;  4R79 A;  5EEG A;  2ETH A;  2WC2 A;  4KMF A;  1ZAR A;  3P9K A;  3JSP A;  1WWX A;  3ROU A;  2HQR A;  2M87 A;  1G3W A;  3BY6 A;  1HW5 A;  1C0W A;  2HR3 A;  5BPD A;  1KQ8 A;  3K1N A;  3P9C A;  1W5S A;  2EA2 A;  2EA4 A;  3QU3 A;  2DK8 A;  4TV7 A;  3I0T A;  1FP2 A;  3DQV C;  5E17 F;  2JRT A;  4P9F A;  1YTY A;  3MFK A;  1IUY A;  3C1D A;  1DPR A;  1MGT A;  4AVP A;  3WTS C;  3JTG A;  1IN8 A;  3H3U A;  3B73 A;  2E7W A;  5D8L B;  1LEB A;  4N0B A;  1SFX A;  2PQ8 A;  2ZKZ A;  1EH7 A;  1R1V A;  4CHU A;  4I02 A;  1Z91 A;  1FYL A;  1GVJ A;  1EV7 A;  3HHH A;  1FYK A;  2K02 A;  3EYY A;  4G6D A;  4PDK A;  1V3F A;  3WGI A;  3FWE A;  4A5M A;  1TTY A;  3BZ6 A;  4L9N A;  1FBS A;  3TO7 A;  3MAJ A;  3KEO A;  3MWM A;  4OU0 A;  5A2Q Z;  1LDK B;  1RZ4 A;  3ZMU A;  4ESB A;  3BRO A;  3KP5 A;  5K5R A;  4A6E A;  4RGR A;  4F7Z A;  1SAX A;  3ZMV A;  5D5X B;  4EJW A;  4CO8 A;  1ZG3 A;  2ZME A;  4ZYG A;  4DQ2 A;  2D1H A;  1KQ9 A;  3WTU C;  3FMS A;  3QPH A;  2DO7 A;  4A0X A;  2MLG A;  4BXU A;  1RNL A;  2Y0M A;  2FF4 A;  3DXJ F;  1XCV A;  4KIC A;  1SD5 A;  3HSE A;  2PEX A;  4PZJ A;  5HS9 A;  3F8B A;  3ZMT A;  1TQP A;  3QP6 A;  1UB9 A;  5IT9 K;  4ENM A;  1HQC A;  1U6G A;  5LHI A;  4MEX F;  2QQA A;  5K5O A;  3WU1 B;  2K27 A;  4OIN F;  3ML6 A;  3CO7 C;  4EJO A;  1P4A A;  2WV0 A;  3MZY A;  4M73 A;  3HSR A;  4BQA A;  4L9V A;  1KQ0 A;  2VOP A;  4WCG A;  1FY7 A;  2FBK A;  1LEA A;  5L3C A;  1O57 A;  1OPC A;  1IN7 A;  3I59 A;  3SZT A;  3TQN A;  2DAO A;  2O8X A;  5FD5 A;  2R3S A;  1ZGA A;  4A12 A;  3RYP A;  3ZN0 A;  5HS7 A;  4OIR F;  4IRG A;  5LRS A;  3FHZ A;  4KNY A;  4HX8 A;  2CQK A;  2XAJ A;  2K4J A;  1U78 A;  2RDP A;  3LST A;  2L54 A;  3L00 A;  3WU0 A;  3ZQ7 A;  5FD6 A;  1SD6 A;  1WSU A;  1ZLK A;  2FRH A;  4O3M A;  2F2E A;  1HBX G;  5E1W A;  3HTS B;  1G3S A;  2A61 A;  2L4A A;  3KP3 A;  2LNB A;  2FNP A;  1ON2 A;  4EM1 A;  3KLN A;  5AIQ A;  4OMZ A;  3ZMZ A;  4ESJ A;  2R7D A;  1XB4 A;  1ZH5 A;  2P6S A;  4OIQ F;  1Z9C A;  1MJB A;  3MEX A;  3DF8 A;  2STW A;  3BPV A;  3KE2 A;  1K7A A;  2BEO A;  1FT9 A;  5FFX A;  4BH9 A;  3RDI A;  2K86 A;  2DT5 A;  1EH6 A;  3CO6 C;  2JT1 A;  4BAY A;  1IF1 A;  2XAG A;  1L3L A;  4G94 A;  4I0A A;  4LFU A;  3F23 A;  2GIV A;  4LK1 F;  2Q8K A;  3HHG A;  4UVA A;  2DFI A;  1K78 B;  3ECH A;  2Z9O A;  1JHF A;  1OKR A;  2RV8 A;  2J5O A;  1S3J A;  2DW4 A;  2HYG D;  2IT0 A;  3WTT C;  1R58 A;  3SFZ A;  3KEQ A;  3J81 K;  4S04 A;  3F8M A;  4LMY A;  1YO5 C;  5HLI A;  1SFU A;  1Z1D A;  1RIO H;  1HST A;  2MH9 A;  1SD7 A;  4NB5 A;  1J59 A;  3GF2 A;  1T0F A;  2XAS A;  1YW7 A;  3L2C A;  3FM3 A;  4LB6 B;  4AIJ A;  1U5T B;  3KP4 A;  2LDU A;  2EFW A;  4ZH4 F;  2ZNZ A;  3H92 A;  5KK1 A;  2XHK A;  3LA3 A;  2H6B A;  3T8R A;  5LEK A;  2HEO A;  1AWC A;  4N9H A;  4Q47 A;  1XN7 A;  4HF2 A;  1O7L A;  2FMY A;  3F8C A;  4RB0 A;  4HQM A;  4M6Y A;  2QQB A;  4B8X A;  1XGM A;  2MC3 A;  2Y75 A;  3KFW X;  1T2K A;  2BV6 A;  2L02 A;  4WWC A;  1MZB A;  3WE3 A;  3R4K A;  3JTH A;  2Z33 A;  3NEU A;  4IHS A;  1WRJ A;  2BGC A;  2LF8 A;  1UST A;  2P8T A;  3LQR A;  2KJB A;  2A5Y B;  2BE5 F;  3I71 A;  4EMS A;  1B59 A;  1XMK A;  4RB1 A;  5F1R A;  2RNJ A;  1F4K A;  1D8J A;  4MQV A;  1Q1H A;  5E1Z B;  2ZJ2 A;  5L3G A;  3I58 A;  2FBH A;  3RJP A;  1L0O C;  1T38 A;  4L0Y B;  1S7A A;  3J80 Z;  2QYO A;  1FSE A;  5ERI A;  2PG4 A;  2EWN A;  3IWF A;  1BN5 A;  3GXO A;  4GXO A;  2UXN A;  1RUN A;  3F72 A;  2OBP A;  2YSR A;  3F21 A;  3GO5 A;  5TRD A;  3LFK A;  3CLO A;  5LBQ A;  3P9I A;  3EQL F;  1R22 A;  1K78 A;  4KN7 X;  4HBL A;  5CVR A;  2FNA A;  2K7L A;  3FXU A;  3RIR A;  5FLX Z;  4ETS A;  3V4G A;  1FX7 A;  2XVC A;  1T6S A;  5J6X A;  3ZMS A;  3ZPL A;  1FBQ A;  1XMA A;  4G9Y A;  2NNN A;  4MNU A;  2QBY B;  2H27 A;  5CVV A;  1U3E M;  3JSO A;  5DUK A;  4M9Z A;  4IXA A;  2OD5 A;  3FF5 A;  2V1X A;  1SMY F;  1U5T A;  1RUO A;  2G9W A;  4HW0 A;  3K2Z A;  2YPR A;  2EFQ A;  2EFN A;  2RVC A;  3R61 A;  1KU7 A;  3KET A;  4HX4 A;  1IXS B;  4P55 A;  1O7F A;  1Z6R A;  1OYW A;  3MZH A;  3EYI A;  1HW1 A;  2KIU A;  1T39 A;  3MQ0 A;  4HAM A;  3TO9 A;  3I5U A;  4IF4 A;  1DP7 P;  3KP2 A;  2QZ8 A;  3DV8 A;  1DDN A;  2JZY A;  2NYX A;  2H09 A;  4YFX F;  2DBB A;  2V6C A;  3FX3 A;  2W85 A;  3EET A;  5LGT A;  4M71 A;  1YW9 A;  4NQW A;  2OZ6 A;  3RI4 A;  4R1H A;  4S05 A;  1JE8 A;  1QZY A;  3O2P E;  4OMY A;  3IWZ A;  1YYV A;  2GQQ A;  4Q48 A;  2L4M A;  4XSZ F;  3TOB A;  1FPQ A;  4JBA A;  4MEY F;  1H0M A;  2KIM A;  2OQG A;  2PBI A;  1FNN A;  3V8J A;  4Y13 A;  4G7H F;  1G6N A;  1FWZ A;  1ZG5 A;  1KYW A;  3DEU A;  1ZGJ A;  3G3Z A;  2MD5 A;  1LVA A;  4ZZL A;  3GFJ A;  2STT A;  2H94 A;  5JFR A;  3V7C A;  5H20 A;  1BI3 A;  4LLL A;  2UXX A;  3FMR A;  2W25 A;  4KDP A;  3K1P A;  4I09 A;  1ONV A;  1TW2 A;  3IHU A;  2UWM A;  5ICG A;  4YII A;  3KCC A;  2CGP A;  4I7H A;  1Z6T A;  1BI1 A;  4Y17 A;  1YLF A;  2X4H A;  4HV5 A;  3VOD A;  2R7F A;  1IN6 A;  3LAP A;  3P7N A;  1R5G A;  5BMZ A;  5H6Q A;  1QBJ A;  2HWV A;  3DFG A;  2D2W A;  4U0Y A;  1YW8 A;  1QO0 D;  4WF2 A;  3CUQ B;  5LGN A;  4M74 A;  2XUB A;  4Y15 A;  1FOK A;  3EUH A;  1TLH B;  5ILS A;  5IT3 A;  1ZHF A;  2IW5 A;  2IA2 A;  2QBY A;  2IA1 A;  1OYI A;  1DUX C;  1B9N A;  4YIF A;  4BHB A;  3WGG A;  1F1Z A;  2P7V B;  2VC0 A;  3H3Z A;  1HKS A;  1PDN C;  1H9T A;  1BIA A;  5FB2 A;  3GW2 A;  4RB2 C;  2FE3 A;  4EJU A;  2XRO A;  4HV6 A;  2DLL A;  3E5U A;  2O0Y A;  1GHC A;  4MTD A;  1ON1 A;  3M7G A;  1I1S A;  2FOK A;  4ZYE A;  1HW2 A;  2COM A;  3RYR A;  2XAF A;  2A6E F;  2P5L C;  2M30 A;  2BBY A;  2IA0 A;  4LLG F;  3RKX A;  4KMU X;  2XAH A;  2EFP A;  5D6E A;  2HYF A;  2EJR A;  3F6V A;  5EEH A;  5E18 F;  3T0Y A;  3CDH A;  2VBX A;  3VFZ A;  1XGS A;  3HOS A;  5E8I A;  3IRQ A;  2K4B A;  3T5X A;  1CF7 B;  1FYM A;  4WXD A;  2QQ9 A;  4EJV A;  4UNO A;  3M8E A;  3KZZ A;  3C3W A;  1BJA A;  2O03 A;  3R60 A;  3VB2 A;  1BM9 A;  4B09 A;  3U1D A;  1Z7U A;  2OAZ A;  4I01 A;  2WWY A;  1BC8 C;  2XRN A;  2XGX A;  3E6M A;  3F8N A;  4WXH A;  5L3E A;  4ZYD A;  1W5T A;  3GWZ A;  2O3F A;  3I54 A;  4RB3 C; 
#chains in the Genus database with same CATH topology
 3SDB A;  1TW3 A;  4PSW A;  1RC9 A;  5E3L A;  3CF2 A;  4HF0 A;  1J09 A;  1CQT A;  2LKP A;  1ZG1 A;  4XN3 A;  1W0T A;  3GCM A;  2K9L A;  3H9G A;  1OIS A;  2FQ4 A;  2HTJ A;  3OYA A;  1YJ9 I;  3HOX J;  4II3 A;  4MQ9 F;  3DPT A;  5DEQ A;  3WHC A;  1Y0U A;  4KA4 A;  3OSG A;  1VQL I;  1S29 A;  1OCO H;  3PQK A;  4U7D A;  5DDG A;  2H1L A;  2MW8 A;  2ZFW A;  5J4V A;  2M2E A;  3F0C A;  1V54 H;  2Q2E B;  2X85 A;  4CIC A;  4XRM A;  5HNF A;  1PUF A;  2FEZ A;  1WJC A;  2COB A;  4HOB A;  4E70 A;  1SFK A;  2NS0 A;  4HF1 A;  3JRG A;  4EV0 A;  3GYH X;  2NVQ J;  4Z2Y A;  4XOR A;  1FIP A;  1I1G A;  2JN6 A;  3WOD F;  1UJ8 A;  5HDG A;  2E2H J;  1O3R A;  4WK8 F;  1MMN A;  2M4K A;  1MNE A;  2QQ8 A;  2DQR A;  3ONQ A;  3V7R A;  5AIP A;  3K69 A;  1UHS A;  5L3D A;  3CP2 A;  3V7S A;  4UXN A;  1D1B A;  3CJQ B;  3FK7 A;  1HCR A;  4EJT A;  1VQ7 I;  4L9J A;  5LRR A;  1APL C;  3FHN A;  3I3L A;  2NOJ B;  3ZQQ A;  3SHF A;  2YU3 A;  3HRM A;  2PN6 A;  4AD9 A;  3GTJ J;  3FXQ A;  4ZYA A;  3REO A;  4ZDO A;  2Z99 A;  2QWW A;  3GBG A;  2VON A;  3OMY A;  5HVQ C;  2VI6 A;  1HLV A;  1U9O A;  1X3U A;  2FBI A;  3CUQ A;  5D5U B;  2IS1 A;  4E7S A;  2RKH A;  3GLX A;  4FX0 A;  4NDL A;  5IYC J;  1Y6I A;  1WH5 A;  1BOA A;  1F9N A;  2DYR H;  5K1Y A;  2ISZ A;  3QU6 A;  5F1J A;  1D0Z A;  4C3H J;  3L09 A;  4B1R A;  3K4J A;  4JOM A;  4NUB A;  1IJW C;  3S3N A;  2MLK A;  4FTH A;  3HYI A;  3P5J A;  3RZD J;  4JX4 A;  3GFI A;  2R5Y A;  1FSH A;  3GX4 X;  1S72 I;  1CGP A;  2ELH A;  5BOX A;  4PFO A;  2V1D A;  3S1R J;  4Y3O A;  1EH8 A;  1Y8R B;  1JKR C;  1UAA A;  3E3V A;  1REP C;  4A0Z A;  5D8K B;  3HUG B;  2IGM A;  3GTQ J;  1IRG A;  4XSX F;  1X3Z B;  3HBL A;  3DLA A;  2A68 F;  5LGU A;  3VYT B;  3E6D A;  4IO9 F;  2E1C A;  4BXF A;  2DFE A;  2LRD A;  2OCE A;  2ZB9 A;  3TMO A;  1B9M A;  1F5T A;  5ILU A;  3J80 K;  1I3A A;  4GGG A;  3ZMD A;  3AG4 H;  3SXY A;  4P5O A;  4U87 A;  3H5A A;  3TOA A;  1JKO C;  1A35 A;  2GA1 A;  1D8K A;  3WE2 A;  3MZ8 A;  4HQE A;  2PJR B;  2VBW A;  3I4P A;  2YX4 A;  2EH3 A;  3S1N J;  2GIZ A;  5DCM B;  2CSO A;  2P5V A;  1BJZ A;  5JR3 A;  4XL9 A;  1K61 A;  3LA7 A;  4JYK A;  2QVO A;  1O3S A;  3FXK A;  1FTZ A;  2ICW G;  3IUO A;  2UZK A;  2AXT C;  3V42 A;  1PYV A;  3LQQ A;  4GFB A;  1P92 A;  1R5H A;  1YQA A;  1MD0 A;  5L3F A;  2A5W A;  3OOP A;  1CF7 A;  1HKT A;  2JA5 J;  3ABU A;  1MBH A;  3CME I;  5M5X J;  3FXM A;  4BE1 A;  1RKT A;  3V8K A;  5IYD J;  3HSF A;  1J0R A;  2Y0S N;  5BQT A;  1YX5 A;  2DFF A;  2VOO A;  3BTJ A;  2VE9 A;  5CVU A;  1FMV A;  5EYR A;  3IL2 A;  4LD5 A;  1TQI A;  3I53 A;  5ICE A;  4IVN A;  5FLX K;  4PJL A;  4DYR A;  2EZH A;  2B9S A;  2CW7 A;  4IRH A;  2XKO A;  2ZBK A;  3CCY A;  2XC7 A;  4A2U A;  2LF7 A;  1VI0 A;  2NOG A;  3VOE A;  5E1X A;  1WPK A;  3BOQ A;  4A0Y A;  2MGQ A;  2ZC2 A;  4LIV A;  2HVQ A;  2YX7 A;  4D0P A;  1BIB A;  2V1U A;  4LIU A;  2ELK A;  2XGE A;  2A07 F;  4ESF A;  2M8E A;  4FE4 A;  5CVI A;  1AU7 A;  3G71 I;  4ZDP A;  4OAY A;  2HYJ A;  4XM3 A;  1KU3 A;  3BP8 A;  1BC7 C;  4XKC A;  1WI9 A;  2BY0 A;  2HFH A;  2LR8 A;  2LP0 A;  2CFX A;  3BPX A;  2OQR A;  1PP7 U;  4KFC A;  2RC4 A;  1UFM A;  1OYY A;  1A6Q A;  4RAF A;  2X0L A;  2Q2E A;  4QWQ A;  3UR3 C;  1KU9 A;  1B4A A;  1FOW A;  2HXI A;  2HQ5 A;  2BVM A;  2EV5 A;  4KIG A;  3A02 A;  1MNM C;  3E5Q A;  5GTH C;  2GLO A;  1TNS A;  2XV4 S;  3OYC A;  1KON A;  5FKK A;  2P7C B;  3S1Q J;  1SMT A;  3OS1 A;  2HTS A;  5LHG A;  3PO2 J;  1NG6 A;  2G7U A;  4J19 A;  2OV7 A;  4L9T A;  1XG1 A;  2BXY A;  2KJC A;  3M8J A;  3I55 I;  3Q5F A;  3QPT A;  3DP7 A;  2L7M P;  4X1E A;  2BVL A;  2X1C A;  3RPU A;  4XRF A;  1IN5 A;  3L2Q A;  5FRM A;  1FC3 A;  1TWG J;  3KP6 A;  3ECO A;  4IRI A;  3IRR A;  2QCO A;  1OMI A;  3A0H C;  2O6G E;  3TKY A;  2MYS A;  4MTE A;  3GZ5 A;  2E71 A;  2LK2 A;  4CA0 A;  5DCF A;  3JRH A;  3SDG A;  1I5Z A;  1TWH J;  3RKW A;  3VSK A;  2VT3 A;  1P9Q C;  2XF6 A;  3JR9 A;  4G6T B;  2JSC A;  3FMQ A;  3K4C A;  3Q0W A;  3W6J B;  2Y9Z A;  2D45 A;  2EK5 A;  2R4G A;  4ZYH A;  1LDD A;  1PP8 F;  2ZXW H;  5M3M J;  3O6B B;  3PNT A;  1FJL A;  2L3D A;  2QM3 A;  2OU2 A;  2K3P A;  4Y7N J;  1XDS A;  2V9P A;  3HIF A;  4JK1 X;  1IV8 A;  5GPA A;  2Y48 A;  3GTM J;  3QYF A;  2FOW A;  4KIF A;  2GWR A;  4E7Z A;  1R71 A;  4DYQ A;  1G8X A;  3K4N A;  5KNL A;  2QEN A;  5EJC A;  2I5U A;  4A6D A;  4IJA A;  1O3T A;  4XRS A;  2ZME C;  3L2W A;  3S15 J;  3J7Z I;  3C2H A;  4A3I J;  4FAS D;  3OYB A;  2VQL A;  3IKV A;  3BJ6 A;  1VQM I;  2G7H A;  2ISY A;  2O7O A;  4HLY A;  1YIO A;  5F64 A;  5DD4 A;  4G12 A;  1SVM A;  3FM5 A;  3OL3 A;  3HJE A;  5IYB J;  1MBK A;  2VBY A;  3HUG A;  2M5W A;  2IS2 A;  2IJL A;  1B1B A;  5C4J J;  2W4S A;  2DMQ A;  3N97 A;  5DD8 A;  4XQF A;  1ETX A;  2ZO4 A;  4XLN F;  1S7O A;  3BR5 A;  4LOC A;  2W1O A;  5FO5 A;  3OS0 A;  2DI3 A;  3L9F A;  1WFX A;  4GCV A;  4KIB A;  2PJR A;  5FKM A;  1P2F A;  4A5N A;  5GPC A;  2PMU A;  1K79 A;  5ILV A;  5DCM A;  3ULQ B;  3I4M J;  6PAX A;  1DGW Y;  3TDZ C;  2W7N A;  1FBU A;  3GFM A;  1ETK A;  1R7J A;  4K2E A;  4MFE A;  3HRS A;  1VTN C;  2Z5U A;  3AG1 H;  1W5C C;  4BU2 A;  5LHH A;  3BG6 A;  4A3E J;  4NC6 A;  2DMN A;  2XPU A;  4U88 A;  3RTR A;  2QUF A;  3R0A A;  3OYF A;  1K6O A;  1ULY A;  4IHT A;  5EF6 A;  2GM4 A;  1G59 A;  4YG2 F;  5J4Y A;  5FKO A;  3RKY A;  1BI0 A;  1XCB A;  4CYD A;  1LQ1 A;  1U8B A;  2GXG A;  3QOE A;  1HA8 A;  3E6C C;  1IXR C;  2MSY A;  3N4M A;  4G7O F;  5D4S A;  1QVT A;  4I76 A;  4BHP A;  2MC4 A;  4HST A;  4FX4 A;  3JRE A;  3D5L A;  5E20 A;  2IVM A;  2DA3 A;  1G4D A;  4OAZ A;  2CQQ A;  3K4M A;  3W2A A;  3D1N I;  2VC1 A;  2HPM A;  3QOP A;  1Y56 A;  3E1S A;  4M72 A;  1X2N A;  4FT8 A;  4EM0 B;  3LNQ A;  2P6T A;  2A6H F;  1IN4 A;  2IP2 A;  4B47 A;  2VXZ A;  4KUM A;  3OYN A;  3RPU D;  1V5G A;  2A3S A;  4F92 B;  3L7W A;  2IPQ X;  3CCM I;  2VLA A;  2DYS H;  3M3Y J;  1XMX A;  1MBE A;  2MFZ A;  2PX9 A;  1U9N A;  3OYE A;  3H9J A;  4RAZ A;  1MKM A;  3OS2 A;  4E7J A;  2E60 A;  2VJ4 A;  4YIR X;  4C2T A;  1K4S A;  4ASN A;  4YEL A;  3V8L A;  4O6J A;  4PGH A;  5HS8 A;  3PM1 A;  3MKW B;  1ZRD A;  1SVO A;  4OIP F;  5HOO A;  2Y2Z A;  1B6A A;  2FUG 2;  1VQN I;  4IOC F;  2VN2 A;  3JW4 A;  3IC7 A;  4U0W A;  4PFP A;  1VF9 A;  2D5V A;  3GTL J;  2NVU B;  1Y0N A;  1QZE A;  5HNH A;  2HDC A;  4G6Q A;  3VYU B;  1XS9 A;  2M34 A;  2X6Y A;  1B72 B;  2KKO A;  3W6V A;  2GBY A;  3J7Y J;  3FXL A;  5IP7 J;  1AA7 A;  3E6B A;  1M1E B;  3BWG A;  3NQO A;  3BQY A;  1RPW A;  4YFK F;  4PSX A;  4UVC A;  1ZRF A;  1W36 D;  1SC7 A;  3JAM K;  4L0Z B;  4AIK A;  2VUM J;  3UNG C;  2DK5 A;  1G3T A;  3CC7 I;  1SD4 A;  5E79 C;  3RZO J;  3FXJ A;  4ENN A;  2DU9 A;  1U8R A;  3ZR8 X;  2VE8 A;  3HTU A;  4LG0 B;  3KZY A;  3F3X A;  4PJJ A;  5B1B H;  3ZQG A;  4IHX A;  2R7W A;  1STZ A;  1YOV B;  2JPB A;  4M9X A;  3W6K B;  2LSO A;  1OCZ H;  3GUD A;  5J3L A;  3WTY C;  2EFO A;  4XLH A;  1JJ8 C;  5DM7 F;  1LB2 A;  1VND A;  1YG2 A;  3QAH A;  3OV8 A;  4F3Q A;  2KLO A;  4ENJ A;  3PNY A;  4RGU A;  4BNC A;  4RGX A;  2JK3 A;  2M9H A;  3ABK H;  3DWL E;  5ED4 A;  4KT6 A;  3E5X A;  3CUQ C;  2CYY A;  1YFH A;  5DTD A;  4X0G A;  1IO2 A;  1P4X A;  1S6L A;  4B48 A;  3CES A;  3PUF A;  1E17 A;  1UCR A;  3B02 A;  3L2R A;  3CDI A;  2NAZ A;  2EB7 A;  1WKM A;  3FK6 A;  3JRD A;  4AU7 A;  1GXQ A;  2FD5 A;  4I2O A;  1HF0 A;  3PFI A;  3Q9S A;  1N78 A;  2FML A;  3BJA A;  4L5J A;  2IGO A;  1W7P D;  2VKH A;  4P96 A;  4OOI A;  2EIJ H;  1IV6 A;  2ESN A;  5LLQ A;  4P9U A;  3WTX C;  1IG7 A;  2E1N A;  4AWX B;  5IPA A;  4EGY A;  4A3C J;  4CH7 A;  1MJ9 A;  2TCT A;  4BJ5 C;  2ME0 A;  1JXS A;  4RDU A;  1FZP B;  2CQX A;  3ZP5 A;  5FLV A;  4M3F A;  1V4R A;  4IQ4 A;  2E19 A;  2ZJQ F;  1RKW A;  3M1E A;  3F6O A;  4DBR A;  3IKT A;  1TWC J;  4XN0 A;  3ASO H;  3D0S A;  3WTZ A;  4DYC A;  1PUE E;  3R6S A;  4ENK A;  3G2B A;  4PCQ A;  4WX9 A;  2PMH A;  2L9V A;  1HKQ A;  1RET A;  2CW0 F;  2EV0 A;  3D5S C;  5DV5 A;  3JAM Z;  1R9T J;  1ETQ A;  1TBX A;  2KL4 A;  1D5V A;  1LJ9 A;  1JGS A;  1OR7 A;  2IGN A;  2VPL A;  2CFO A;  1WZ2 A;  3DKX A;  5J1R A;  2K9M A;  3ISP A;  3HZJ A;  4CDG A;  4NNJ A;  4DGW B;  5L3B A;  1YIJ I;  3UKG A;  1AOY A;  3ZGK A;  1IZ1 A;  3FIS A;  1E2X A;  1V55 H;  2ZCW A;  5E3M A;  3LSP A;  3DKW A;  4QLC U;  1J7K A;  2VT2 A;  1VQO I;  3PSF A;  2OZU A;  3EPZ A;  1LNW A;  4BYY A;  2GOM A;  1J9I A;  3WTV C;  1MJA A;  3HRU A;  2HKO A;  1WHU A;  3TW7 A;  1I6X A;  4G7Z F;  3GZN B;  4OIO F;  3J7A Y;  2LRE A;  4XBF A;  3AKZ A;  4NHJ A;  3F22 A;  2R7V A;  4G8X A;  1Y8Q B;  3G1O A;  4BE2 A;  2O61 A;  1SFE A;  2J5P A;  3KYL A;  1JGG A;  5JVT A;  5GTI C;  5J8F A;  1ZLJ A;  1T8I A;  4EVI A;  1XSV A;  2LBF B;  4KT5 C;  3HOT A;  3FXR A;  1NTC A;  1YIT I;  2LG4 A;  1XSX A;  2V9V A;  3AFH A;  1BI2 A;  2V79 A;  3FDY A;  4AIH A;  4GYI A;  4ABZ A;  2VOD A;  1Z3Y A;  5K7F A;  4U7B A;  5F6F A;  2B0L A;  2Z3Y A;  3HG9 A;  3LSR A;  4ZTF A;  1H89 C;  2OPT A;  1R5I D;  2CG4 A;  2AQE A;  5H6R A;  4Q4Z F;  1G2H A;  1QRY A;  1XD7 A;  3HDD A;  2VKE A;  1P7I A;  1JUP A;  5CYV A;  1VQ6 I;  5KVR A;  2BYV E;  2JVH A;  4YFN F;  2DT6 A;  1YE9 A;  4R8H A;  4KIS A;  2VJJ A;  2KQR A;  1S7E A;  2PFB A;  3VYR B;  1B72 A;  3ZOB A;  2HKX A;  4GYG A;  2CO5 A;  4RS8 A;  3C18 A;  3HRT A;  5D5V B;  5JI6 A;  2DN0 A;  2ID6 A;  4HLX A;  4GDF A;  1GXP A;  1VQK I;  1KU2 A;  2DQL A;  4W1U A;  1X58 A;  4DW6 A;  5IT9 Z;  3RSN A;  1IW7 F;  3IH3 A;  1ETW A;  1NG7 A;  4H0E A;  2DPD A;  1IXC A;  4EGZ A;  4BS9 A;  3GZ6 A;  3KLO A;  3BR2 A;  4A3F J;  3LL7 A;  4D7M A;  2KIF A;  2ADU A;  2XAQ A;  2HZT A;  1HOM A;  4RAG A;  4UV9 A;  2HOE A;  3C7J A;  4KJZ A;  4Q5S F;  1ZN2 A;  3CTA A;  1Z77 A;  4LG0 A;  3K2A A;  4IHY A;  3GTP J;  1VQ8 I;  4UY8 I;  4RGS A;  4ZJZ A;  3H9Q A;  2ZFU A;  2ECB A;  2O8K A;  2MH2 A;  1T98 A;  3G73 A;  3I64 A;  4MGR A;  2OA4 A;  5FGM A;  4HDV A;  3CUO A;  3QYE A;  4IHW A;  1KA8 A;  5D6F A;  1YI2 I;  4N9I A;  4BDZ A;  4LGW A;  5HDK A;  2F5C A;  1UHM A;  2IBD A;  4CXF A;  2RQP A;  4IHV A;  2XF7 A;  4L18 B;  3LSJ A;  2PI0 A;  1OCP A;  1BBY A;  5AON A;  5HOD A;  3Q0U A;  1W0U A;  2YR2 A;  4EQQ A;  3ERE D;  2CJJ A;  4I0B A;  1ZYR F;  1JTY A;  5F0F A;  4RM3 A;  5H2F C;  3S3M A;  1UG0 A;  1A04 A;  3OWT A;  4F93 B;  4RLF A;  3U21 A;  3IV5 A;  2GZW A;  3SEQ A;  3VDX A;  1ETO A;  2QLZ A;  3COA C;  3RPQ A;  1UHW A;  2CUJ A;  4EM2 A;  3I9V 2;  3CJT B;  2FA5 A;  3ELK A;  3QRF F;  4I98 B;  3VEP A;  4UUV A;  3DTI A;  3BT9 A;  4UVB A;  1XDU A;  4FCY A;  4BJT A;  4I99 C;  1XX5 A;  1K4T A;  1KYZ A;  2AS5 F;  5D4R A;  3M8F A;  5E8G A;  4BQO A;  3GTG J;  2CWE A;  2WAD A;  4NBQ A;  3U2R A;  2VJI A;  4Z6Y A;  1U5T C;  3TO6 A;  3OL4 A;  3OIQ A;  1J2X A;  2KP6 A;  3U9G A;  2TDX A;  3KEY A;  4ANJ A;  4L5I A;  3KZI C;  1LVK A;  3LA2 A;  3ZQF A;  2R93 J;  2Q0O A;  4CGZ A;  4DIQ A;  2KIQ A;  2IRF G;  5B5E C;  1NH3 A;  2H6C A;  3MD2 A;  4A3G J;  4AVZ A;  1GDT A;  2XDV A;  2DA2 A;  2L7K A;  4KN4 X;  5JLX A;  3M4O J;  1LDJ A;  2KPM A;  2MG4 A;  5ICC A;  1FTT A;  3CCS I;  3TDU C;  3K70 C;  3C2G A;  1WJD A;  4A69 C;  5GAG J;  2P4W A;  4P1W A;  1QPI A;  1XGN A;  2DJN A;  2XIG A;  3OYM A;  3HGY A;  3HOY J;  2RN7 A;  4LLN A;  2M1B A;  2E5N A;  2H8R A;  4DNC A;  5K5Q A;  1W7P B;  1G3Y A;  4BUP A;  2JUC A;  2EZL A;  5KHD A;  3LAJ A;  2JA8 J;  1LE8 B;  5HLT A;  1HXD A;  3NRV A;  4DOZ A;  5IP6 A;  1BR4 A;  2ZSH B;  2LMD A;  4QPO A;  5LEJ A;  4N4O B;  2JMW A;  1MDM B;  4B4C A;  1DU0 A;  4IOA F;  1GV2 A;  2IAI A;  3KP7 A;  4BE0 A;  2AO9 A;  1NK3 P;  3LWF A;  4S0H B;  1OCR H;  1A31 A;  4LJZ F;  2DOD A;  3MCZ A;  3ERM A;  3DCF A;  2LBF A;  3K1M A;  2CV1 A;  1TNT A;  2WTE A;  1R1T A;  2DA4 A;  1YS6 A;  2F5F A;  2FSW A;  3DBL B;  2GXB A;  2W57 A;  3JRB A;  3WHB A;  1ZRC A;  4KYW A;  5JHU A;  2DMT A;  3ZN1 A;  2FU4 A;  5DYM A;  5CJ9 A;  3WGH A;  1Z21 A;  3PQJ A;  2V4J C;  3T1B A;  2A69 F;  2KRH A;  1WJE A;  2P5K A;  3PSI A;  4CZZ A;  2MBF A;  2EQR A;  5JHF A;  5HLG A;  2PLY A;  3GVA A;  3CLQ A;  2L5Q A;  3E97 A;  4ON0 A;  4HZF A;  3L1P A;  4LB5 A;  3F8F A;  1FP1 D;  3GLL A;  5CLS A;  3J81 Z;  2GA2 A;  1YS7 A;  4CCJ A;  4F55 A;  4U0V A;  4FHT A;  1Y1V J;  4C2M J;  1IAW A;  2HVS A;  4HRI A;  4XLP F;  1QQI A;  1WI3 A;  4UB8 C;  2X48 A;  4UUS B;  1R36 A;  2FXA A;  1D3Y A;  4E6K G;  3O3K A;  2LFB A;  4M9S A;  2MA3 A;  2QGU A;  1XSD A;  3G1M A;  3GEZ A;  3SZP A;  1VQ4 I;  1WQ2 A;  3IH2 A;  3G1L A;  3BC8 A;  1K6Y A;  2DMU A;  5GAE J;  3FZV A;  3HOZ J;  1ETV A;  5HDN A;  4UV8 A;  2L01 A;  2W24 A;  4HSR A;  4C3I J;  4IX7 A;  2ESH A;  4CCL A;  9ANT A;  1R00 A;  4PGG A;  1I27 A;  1IGN A;  2HQA A;  2KRF A;  4BQQ A;  3J7A O;  2ZNY A;  4CCO A;  3R0J A;  2V26 A;  4XKB A;  1R1U A;  4MHG A;  4BDY A;  3ASN H;  1LPQ A;  4CZC A;  2F4M B;  3TGN A;  3BJO A;  2LYC A;  3NWT A;  3CDL A;  3S14 J;  2AQF A;  3S2W A;  3K9T A;  1NHA A;  3SZG A;  1ZRE A;  4UHT A;  3WTW C;  2NNY A;  3WG7 H;  2R7U A;  2QKM B;  1F36 A;  1RI7 A;  2W84 A;  1HDD C;  1U2W A;  3GTO J;  2QA4 I;  4ZZD A;  3FKJ A;  5HLH A;  1MBF A;  2R92 J;  1S5L C;  2WY7 Q;  1MH4 A;  2GAU A;  2LVS A;  4HDU A;  5CVJ A;  3H5R A;  3BTI A;  3CZ6 A;  4E7H A;  1VQP I;  1USS A;  1WJB A;  4XID A;  4M6X A;  1ZR2 A;  2DPU A;  2XAU A;  3ZQC A;  3LFU A;  3EUH C;  2ACJ A;  3FXO A;  4W97 A;  3WG9 A;  2BW3 B;  5JLW A;  1FLI A;  1QA6 A;  1O3Q A;  2AXL A;  2FJ1 A;  1QNT A;  2FQ3 A;  2WB1 A;  4HX7 A;  2JTV A;  3EDP A;  4IPA A;  1QGP A;  1IDY A;  3ZXS A;  1J5Y A;  3KPH A;  1IRF A;  1S8N A;  1X2M A;  3DPL C;  2CUZ A;  5BS6 A;  4B43 A;  4WXC A;  3HGG A;  2ZME B;  1R4N B;  3PJR A;  4H4K C;  1H9G A;  1RRJ A;  4D7N A;  1TP4 A;  1QPM A;  1TT5 B;  3BDD A;  2VJ5 A;  1R23 A;  3E0J B;  2YU9 J;  3S16 J;  4XR6 A;  3H1C A;  3TW6 A;  1HSJ A;  2ZXJ A;  2NVT J;  3S2D J;  4A3L J;  2DDA A;  2XKP A;  2EV6 A;  3H0G J;  4BEH B;  4D5F A;  1ZK8 A;  3K0L A;  2CH0 A;  3GFL A;  1I39 A;  4IQJ A;  1RR8 C;  2F4O B;  3ABL H;  4HNV A;  1TQM A;  5J47 A;  1Z05 A;  2M7A A;  5BPI A;  2D1V A;  1JJ6 C;  4F52 A;  4HG2 A;  5ICF A;  2HS5 A;  2K9S A;  1X1C A;  4LK0 F;  3IP4 B;  1WCM J;  4GO1 A;  4O5V A;  2V9K A;  1ODD A;  5D5W B;  2F5E A;  2JPC A;  5FFZ A;  3OY9 A;  2E7X A;  3BQZ A;  1P4W A;  1W7P A;  5DUI A;  1PJR A;  3DU5 A;  1OR7 C;  1XGO A;  4RAY A;  1KGS A;  2C6Y A;  3QP5 A;  1EA3 A;  4HPQ A;  1LE8 A;  1JHH A;  4HA8 A;  3SFI A;  3CJN A;  2XSD C;  1W4M A;  3ABT A;  4YRV A;  3M9A A;  5J8C A;  2OTJ I;  5TJJ A;  2DTR A;  1J75 A;  1MDM A;  1R49 A;  1FEX A;  2VBZ A;  1IRZ A;  4PUS A;  4HYE A;  2M45 A;  3Q9V A;  5J1Y A;  3X2Q H;  1FOY A;  4RBO A;  2OCC H;  2HQN A;  4BHC A;  1JUS A;  3BLY A;  2QSF X;  4V19 K;  2HGC A;  1P6R A;  2RGV A;  3M1C A;  3GME A;  4JQF A;  3I4N J;  2NRA C;  3I59 B;  5A2Q K;  1I3Q J;  4EEF G;  2UUZ A;  2WBM A;  5EGO B;  2LY9 A;  3T8T A;  3AAF A;  1QZZ A;  2XPW A;  3SQN A;  2F5D A;  2WV1 A;  2L2O A;  2H8W A;  2CQ7 A;  2XF5 A;  4CCK A;  5K7Z A;  1A36 A;  1DPU A;  1ZAO A;  3Q0V A;  2PJP A;  1V5E A;  4R79 A;  2Y31 A;  2HOT A;  5EEG A;  2ETH A;  2WC2 A;  4KMF A;  2IS4 A;  4M6V A;  1ZAR A;  3P9K A;  3B6A A;  1WWX A;  3JSP A;  1Z3X A;  2DJI A;  3ROU A;  2HQR A;  4N4N B;  2M87 A;  1G3W A;  3BY6 A;  1HW5 A;  2RQQ A;  1C0W A;  2HR3 A;  3AG2 H;  2VKD A;  3ZCO A;  1D1C A;  4UUS A;  5BPD A;  1LKX A;  1KQ8 A;  1DQU A;  3K1N A;  3P9C A;  2M3A A;  1W5S A;  3LOC A;  4MFD A;  1ZTR A;  2EA2 A;  2EA4 A;  3QU3 A;  2DK8 A;  5FKL A;  1VQ9 I;  4BQN A;  4TV7 A;  3A01 B;  3JRC A;  3I0T A;  1FP2 A;  2OF7 A;  3FBI B;  3DQV C;  3BR1 A;  5IP9 J;  5E17 F;  2WAF A;  2JRT A;  4P9F A;  1YTY A;  2M0C A;  2CRG A;  3MFK A;  2JA6 J;  3RQI A;  1IUY A;  3C1D A;  1DPR A;  2DDB A;  1MGT A;  3DLL F;  4AVP A;  3WTS C;  3JTG A;  1IN8 A;  1ENH A;  1X4O A;  3H3U A;  1R4M B;  4AYB A;  2VPR A;  3B73 A;  4A3M J;  1MMS A;  2E7W A;  3S17 J;  2JSP A;  2K85 A;  1X3W B;  3JRA A;  5D8L B;  2Z2S B;  1ZGW A;  1LEB A;  3W2W A;  3JRI A;  3CCL I;  4N0B A;  2JWT A;  2LH9 A;  1ERD A;  1SFX A;  2E1O A;  2NS7 A;  2PQ8 A;  2ZKZ A;  2B63 J;  3RKQ A;  1EH7 A;  3HEF A;  1R1V A;  4CHU A;  4I02 A;  4D5C A;  3LSM A;  2DOE A;  3LSH A;  1Z91 A;  1FYL A;  1Q1V A;  3A1Y A;  2E35 A;  4BBR J;  3G4S I;  1GVJ A;  1EV7 A;  3HHH A;  4C30 A;  1FYK A;  2K02 A;  3EYY A;  4E7I A;  5EG0 B;  4G6D A;  5KCM A;  4PDK A;  3BCA A;  5FKN A;  3WU2 C;  1V3F A;  3OIP A;  3KYC B;  3WGI A;  3A03 A;  3FWE A;  4L5E A;  4A5M A;  1TTY A;  3BZ6 A;  4L9N A;  1FBS A;  4II2 A;  3TO7 A;  1N25 A;  3MAJ A;  1X1A A;  3CQZ J;  3KEO A;  3MWM A;  4OU0 A;  5A2Q Z;  1LDK B;  1RZ4 A;  3ZMU A;  5KAF C;  4ESB A;  3AL0 C;  2BW3 A;  3BRO A;  1UZC A;  4QPQ A;  2FX0 A;  3KP5 A;  3HPH A;  5K5R A;  3CD6 I;  4A6E A;  4RGR A;  2K9N A;  4F7Z A;  1SAX A;  3S1M J;  3CC2 I;  1SAN A;  3FKI J;  3ZMV A;  5D5X B;  5C44 J;  2F4I A;  1VQ5 I;  4BY1 J;  3CCR I;  4EJW A;  2VQH A;  4A3D J;  3DPU A;  1WJA A;  4CO8 A;  1IDZ A;  2WB1 N;  1ZG3 A;  2DT7 B;  2BHZ A;  2ZME A;  4DQ2 A;  4ZYG A;  2D1H A;  1KQ9 A;  2ZXI A;  2HPI A;  3WTU C;  3FMS A;  3IH4 A;  1POG A;  3QPH A;  1WGX A;  5TGT A;  4JX5 A;  2DO7 A;  4A0X A;  2MLG A;  4BXU A;  1RNL A;  2K40 A;  2Y0M A;  4ZDL A;  3PNV A;  2FF4 A;  3DXJ F;  2X6O A;  1XCV A;  4KIC A;  1SD5 A;  3HSE A;  4BEH A;  2PEX A;  4PZJ A;  5HS9 A;  3F8B A;  3ZMT A;  1H8A C;  1TQP A;  3QP6 A;  3ZRG A;  1UB9 A;  5IT9 K;  3CJR B;  4BKX A;  4ENM A;  1HQC A;  4XKV A;  1U6G A;  4BY7 J;  5LHI A;  2VKV A;  4MEX F;  2QQA A;  5K5O A;  3WU1 B;  1X4P A;  4PJM A;  4C3J J;  5M5Y J;  5IOY A;  1MND A;  1W1W E;  1EJ9 A;  2K27 A;  4OIN F;  2R7Q A;  1R6R A;  4RA2 A;  3DBH B;  3ML6 A;  3DTE A;  3QQA A;  4UUT A;  3CO7 C;  1OCT C;  4IKF A;  4EJO A;  1P4A A;  1JKP C;  4C2U A;  4PK4 A;  2JJ7 A;  2O5R A;  1BR2 A;  2Q1Z B;  2WV0 A;  3MZY A;  4M73 A;  3HSR A;  3BG5 A;  4BQA A;  4L9V A;  1KQ0 A;  3Q3S A;  2VOP A;  1E3P A;  2L0K A;  4WCG A;  3SJM A;  3C2B A;  1FY7 A;  2FBK A;  4XIC A;  1LEA A;  1QVU A;  5L3C A;  1O57 A;  2P81 A;  2V6E A;  1OPC A;  1IN7 A;  3I59 A;  3SZT A;  1MMD A;  5C3E J;  3TQN A;  5EGO A;  2DAO A;  3O8G A;  2O8X A;  1YJN I;  5FD5 A;  2DTZ A;  5JVG F;  2R3S A;  1SVL A;  5F0H A;  1ZGA A;  4B44 A;  4A12 A;  1GV5 A;  3MKZ A;  2R7O A;  5TIS C;  2EZI A;  4IL6 C;  2BY3 A;  3RYP A;  3ZN0 A;  1MH3 A;  2CMP A;  1SEU A;  3EUA A;  4RLQ A;  5HS7 A;  4OIR F;  4IRG A;  5K7H A;  5LRS A;  3FHZ A;  3U1K A;  1OFC X;  1RES A;  3PIP F;  4KNY A;  4HX8 A;  1T56 A;  3O8H A;  3PL8 A;  2CQK A;  1H88 C;  1VZ0 A;  2XAJ A;  2K4J A;  1U78 A;  1AHD P;  2EIL H;  3CMY A;  2RDP A;  3LST A;  2L54 A;  3L00 A;  3WU0 A;  3ZQ7 A;  2JA2 A;  3A01 A;  2E1M B;  5FD6 A;  1XPX A;  2KFD A;  1LUJ B;  3L2U A;  1MMA A;  4XMY A;  2CUE A;  2WAQ A;  4HNT A;  1SD6 A;  1WSU A;  3D5R C;  4LG3 A;  1AKH B;  1ZLK A;  2FRH A;  4D9J A;  2E36 A;  4O3M A;  2CV0 A;  1OJL A;  1OLT A;  2F2E A;  1HBX G;  5E1W A;  3HTS B;  1G3S A;  1A5J A;  2A61 A;  2L4A A;  1BW5 A;  3KP3 A;  2KIS A;  2LNB A;  2KZG A;  2DMP A;  2FNP A;  5EZG A;  1ON2 A;  3H3V K;  2DXI A;  4V2F A;  4EM1 A;  3KIO A;  4AYB N;  3KLN A;  2OC6 A;  2DA7 A;  2P0W A;  3IAM 2;  5AIQ A;  1FOX A;  4BAC A;  4OMZ A;  1S9H A;  3ZMZ A;  1X1P A;  2L9R A;  4ESJ A;  2R7D A;  1YRN B;  1XB4 A;  2R7S A;  3VYS B;  3JCU C;  4M3D A;  2P6S A;  1ZH5 A;  4OIQ F;  1Z9C A;  1MJB A;  1TWA J;  3MMY B;  3MEX A;  3K4L A;  3QWL A;  5DM6 F;  3DF8 A;  2STW A;  3BPV A;  2WA0 A;  5EG0 A;  1U0J A;  3DBR B;  2BHY A;  3KE2 A;  3OSF A;  1K7A A;  1GLN A;  2BEO A;  4Y4R A;  4XRS G;  2Y30 A;  1FT9 A;  5FFX A;  1O4X A;  4BH9 A;  3RDI A;  4AM3 A;  2K86 A;  2DT5 A;  4A3B J;  1DGR M;  1BL0 A;  1EH6 A;  3CO6 C;  1DP3 A;  2JT1 A;  3OR2 C;  4BAY A;  1IF1 A;  2XAG A;  1L3L A;  4G94 A;  4I0A A;  4LFU A;  4XKW A;  2E34 A;  3F23 A;  2GIV A;  4LK1 F;  3S3O A;  3M07 A;  1P7J A;  3BR3 A;  3HHG A;  4UVA A;  2Q8K A;  2DFI A;  3PFY A;  1K78 B;  3TP0 A;  1UMQ A;  2RRE A;  3ECH A;  4XOP A;  1GT0 C;  2Z9O A;  2RV8 A;  1JHF A;  1OKR A;  2J5O A;  1QU3 A;  1KZH A;  1S3J A;  2HI3 A;  2WAE A;  1ZR4 A;  2IS6 A;  4RM2 A;  2DW4 A;  1W36 C;  3DEE A;  2HYG D;  2MD0 A;  2IT0 A;  2JQ7 A;  3VSL A;  1LFU P;  3WTT C;  2GOX B;  2W82 A;  1R58 A;  5CQE A;  4V2G A;  3SFZ A;  4AC0 A;  5CKT A;  2E2I J;  3KEQ A;  2NVY J;  2DA5 A;  2IEK A;  4Y52 J;  4IZZ A;  4CYC B;  3J81 K;  1TL8 A;  4S04 A;  1D1A A;  2DOF A;  1D0Y A;  3F8M A;  4LMY A;  1YO5 C;  5EZH A;  5HLI A;  2HZD A;  1SFU A;  1T95 A;  2MAB A;  2X6W A;  3PIO F;  1Z1D A;  1RIO H;  3CC4 I;  1HST A;  2MH9 A;  1SD7 A;  4NB5 A;  1J59 A;  3GF2 A;  1T0F A;  5CPR B;  2XAS A;  3A2K A;  1YW7 A;  5IY5 H;  2R7T A;  4KIT B;  3L2C A;  2CU7 A;  2VL8 A;  5FJ8 J;  1EKE A;  3FM3 A;  3S93 A;  4DBQ A;  1TWF J;  3PUB A;  3K4K A;  2BY2 A;  4LB6 B;  4CSW A;  4AIJ A;  1U5T B;  2DOA A;  2DA6 A;  3KP4 A;  2LDU A;  2CUF A;  2EFW A;  4ZH4 F;  3F9K A;  4ZC3 A;  3NAU A;  2ZNZ A;  4E7K A;  3H92 A;  2X9D A;  3MN2 A;  3CMM A;  1X1D A;  1XC5 A;  2BY1 A;  2NS8 A;  2XGD A;  4NC7 A;  5KK1 A;  2XHK A;  4LIT A;  3LA3 A;  4I6Z A;  2H6B A;  3T8R A;  5LEK A;  2HEO A;  2EIN H;  3BR6 A;  1AWC A;  2EBI A;  4N9H A;  4Q47 A;  1XN7 A;  3LSG A;  3CCU I;  1XTA A;  1O7L A;  2HOS A;  3KYD B;  3OYG A;  2FMY A;  4HF2 A;  1T33 A;  3F8C A;  2TRT A;  1TT0 A;  4RB0 A;  4HQM A;  4M6Y A;  2QQB A;  4HNU A;  2HOA A;  4AUX A;  3FBN B;  2RAE A;  4B8X A;  1XGM A;  1K83 J;  2MC3 A;  5FRO A;  2K5C A;  2H1K A;  2Y75 A;  3KFW X;  5B3S H;  1T2K A;  2BV6 A;  2L02 A;  2L9N A;  5CQG A;  4WWC A;  1MZB A;  2NVX J;  5F27 A;  3WE3 A;  3ABM H;  3NWS A;  3R4K A;  2ELJ A;  3JTH A;  2Z33 A;  1WVR A;  4XK4 A;  3NEU A;  5LFA A;  4ZTJ A;  4IHS A;  5GAH J;  1WRJ A;  2BGC A;  2LF8 A;  3HM5 A;  1UST A;  1E3H A;  3DU6 A;  3BCB A;  2P8T A;  3LQR A;  3OYL A;  2KJB A;  3DKY A;  2A5Y B;  4NQW B;  4XLE A;  1X1B A;  2BE5 F;  5LD2 C;  3I71 A;  3LMM A;  4BBS J;  4EMS A;  1B59 A;  1XMK A;  4HEA 2;  5F1R A;  4RB1 A;  1D5Y A;  3TL4 X;  2RNJ A;  3W2V A;  5EEA A;  1F4K A;  3HOV J;  1D8J A;  1IUF A;  4MQV A;  2VQC A;  1Q1H A;  1AKH A;  5E1Z B;  2ID3 A;  2ZJ2 A;  5KAI C;  3AG3 H;  4DZP A;  5L3G A;  2LLK A;  4FQG A;  5M5W J;  2WAQ N;  1TC3 C;  1ZEL A;  1IRX A;  2Y69 H;  3I58 A;  2FBH A;  3RJP A;  1JTX A;  1MIJ A;  3H35 A;  1L0O C;  4NC8 A;  3H0D A;  1ZQ3 P;  5M3F J;  1T38 A;  4L0Y B;  2JUG A;  4YEJ A;  1S7A A;  1Z0X A;  3LSK A;  1YRN A;  3J80 Z;  3QOD A;  2F6C A;  2OJE D;  2ZSI B;  2QYO A;  3ZQH A;  1FSE A;  5EDN A;  1MW7 A;  5ERI A;  2PG4 A;  2X1E A;  2EWN A;  3OYK A;  2IXS A;  3IWF A;  1BN5 A;  3OYD A;  1MSF C;  3GXO A;  4GXO A;  2UXN A;  1N77 A;  1RUN A;  3F72 A;  2OBP A;  2UV1 A;  1UG2 A;  2L7Z A;  3VWB A;  2R0Q C;  2YSR A;  3F21 A;  3OOU A;  2N8G A;  3GO5 A;  5TRD A;  2CW8 A;  1MBG A;  5IOZ A;  3LFK A;  2LD5 A;  3CLO A;  1ITY A;  2HDD A;  2IGK A;  5FLM J;  5LBQ A;  3P9I A;  3EQL F;  2YS9 A;  1R22 A;  1K78 A;  4KN7 X;  3HC7 A;  4F91 B;  4HBL A;  5CVR A;  1E0E A;  2VAS A;  2FNA A;  3NAR A;  1MBJ A;  1WJF A;  2K7L A;  4JP0 A;  2EPF A;  2KT0 A;  3FXU A;  4FIS A;  1MSE C;  2V1N A;  3DTK A;  1A6I A;  3N05 A;  3RIR A;  5FLX Z;  4ETS A;  5FRN A;  2W00 A;  2QSG X;  3BZK A;  5BNG A;  2LKS A;  3V4G A;  3QPL A;  3BG7 A;  4FET A;  3OR1 C;  1I6H J;  1FX7 A;  4CYC A;  2E2J J;  3TED A;  2XVC A;  1T6S A;  2G0E A;  5J6X A;  3GTK J;  3ZMS A;  4XOT A;  3ZPL A;  3HOU J;  1FBQ A;  1Y1W J;  3OIO A;  1XMA A;  2YUS A;  3ZQI A;  1BW6 A;  1B8I B;  4G9Y A;  2NNN A;  5J1U A;  4MNU A;  2QBY B;  2H27 A;  2KHM A;  5CVV A;  3KX2 A;  1Z67 A;  1U3E M;  3JSO A;  5DUK A;  4M9Z A;  4IXA A;  2OD5 A;  2XPV A;  3FF5 A;  2V1X A;  2L9S A;  2E5Z A;  4UB6 C;  1SMY F;  1OCC H;  5E3O A;  1U5T A;  2DCE A;  1RUO A;  5B66 C;  3CF5 F;  2X1D A;  2G9W A;  3CMA I;  4HW0 A;  3L2V A;  2NXN B;  3K2Z A;  3K6G A;  2YPR A;  2EFQ A;  2EFN A;  2RVC A;  3MKL A;  3A4C A;  3R61 A;  3W3C A;  2ZJR F;  2R5Z B;  4DJA A;  4Y33 A;  1KU7 A;  2RNG A;  3KET A;  4HX4 A;  3LSI A;  2PMZ A;  4JX6 A;  2Z16 A;  4M3B A;  1IXS B;  1ETY A;  2OUM A;  3EUK L;  4P55 A;  2GXA A;  1HC8 A;  1O7F A;  2DA1 A;  2K3F A;  1Z6R A;  1OYW A;  3MZH A;  3EYI A;  1HW1 A;  2KIU A;  4MO7 A;  3MQ0 A;  4HAM A;  3TO9 A;  1T39 A;  3I5U A;  4IF4 A;  1DP7 P;  3KP2 A;  2QZ8 A;  3DV8 A;  3H5N A;  3CCQ I;  1JUM A;  1Y39 A;  1DDN A;  1I50 J;  3HKZ A;  2JZY A;  2NYX A;  2H09 A;  2XRL A;  2X51 A;  3ESW B;  2DBB A;  4YFX F;  3S2H J;  3K7A J;  2V6C A;  4XNF A;  3BR0 A;  4C9Y A;  4J00 A;  2LY1 A;  2HVR A;  3FX3 A;  4QTR A;  2W85 A;  4FE7 A;  5J40 A;  2BXZ A;  3EET A;  2ME6 A;  3K4B A;  5LGT A;  4M71 A;  2QEX I;  4CCN A;  1YW9 A;  3JRF A;  1YJW I;  5B1A H;  1ACI A;  4NQW A;  2OZ6 A;  4XON A;  4GRI A;  4R1H A;  4S05 A;  3RI4 A;  5F0C A;  1BOB A;  3CP8 A;  1LFP A;  3H36 A;  1JE8 A;  1QZY A;  1X19 A;  3O2P E;  4OMY A;  3IWZ A;  2EIM H;  2M4G A;  1YYV A;  2GQQ A;  2QSH X;  3DEW A;  1SAU A;  4Q48 A;  2L4M A;  2ECC A;  4XSZ F;  1JKQ C;  3TOB A;  4CCM A;  1FPQ A;  2KZV A;  4JBA A;  4MEY F;  1H0M A;  2LKX A;  4BXX J;  2CQN A;  2KIM A;  2JRM A;  2OQG A;  1F43 A;  2PBI A;  3BTL A;  4ITV A;  1FNN A;  3V8J A;  1OQY A;  2B7E A;  3HXL A;  4Y13 A;  1FIA A;  4D1Q A;  1TZL A;  3B6C A;  2HXO A;  4G7H F;  1G6N A;  1FWZ A;  2VXD A;  1UEL B;  2M0M A;  3BZC A;  1ZG5 A;  1KYW A;  3ZQL A;  4X6A J;  3DEU A;  2A05 A;  3OYI A;  1ZGJ A;  3G3Z A;  2MD5 A;  1LVA A;  1NK2 P;  4ZZL A;  1RR7 A;  3GFJ A;  2STT A;  2HDW A;  4XLC A;  2H94 A;  1V5F A;  5JFR A;  4E7L A;  5GAD J;  3FIW A;  3HOW J;  3V7C A;  2V7F A;  5H20 A;  2X6X A;  4BJ6 C;  4BGD A;  2W48 A;  1BI3 A;  2HU9 A;  4LLL A;  4OWR B;  2UXX A;  3FMR A;  2W25 A;  1WJ5 A;  1QHG A;  1IC8 A;  4KDP A;  3K1P A;  2XSJ C;  3K10 A;  1PUF B;  4I09 A;  1ONV A;  1TW2 A;  3IHU A;  1SFO J;  2UWM A;  4AID A;  2EIK H;  1DU6 A;  2KDO A;  1BA5 A;  2VB6 A;  4DZJ A;  3G6E I;  5ICG A;  1ORK A;  4YII A;  3KCC A;  2CGP A;  2QKL B;  4I7H A;  1Z6T A;  1BI1 A;  4Y17 A;  1YLF A;  3TP3 A;  2X4H A;  1YX3 A;  2A6T A;  4HV5 A;  3VOD A;  2R7F A;  1N75 A;  1JI8 A;  2VIX A;  1JT6 A;  2AHQ A;  1IN6 A;  3LAP A;  4A3K J;  2EZK A;  2CS3 A;  3P7N A;  1R5G A;  2LTP A;  5BMZ A;  5H6Q A;  3E7L A;  1QBJ A;  2XGC A;  2HWV A;  3DFG A;  3RCO A;  3I56 I;  2VQG A;  2WY8 Q;  2D2W A;  2O9L A;  4U0Y A;  1GUU A;  1YW8 A;  1QO0 D;  4WF2 A;  3CUQ B;  5LGN A;  1EF4 A;  4M74 A;  3VPR A;  2XUB A;  4Y15 A;  4A93 J;  1FOK A;  3EUH A;  3QPS A;  3K70 D;  3AL0 B;  1TLH B;  5ILS A;  5IT3 A;  2L7F P;  4MIM A;  1ZHF A;  4QIW N;  2IW5 A;  1B8I A;  1D0X A;  2IA2 A;  2R7R A;  3HB9 A;  2QBY A;  1HDP A;  2QF7 A;  2IA1 A;  4M3G A;  1OYI A;  2Y9Y A;  1DUX C;  1B9N A;  4YIF A;  4BHB A;  3WGG A;  1VFC A;  5F08 A;  3S32 A;  1F1Z A;  2P7V B;  4B3A A;  3OYJ A;  2VC0 A;  1E3O C;  3H3Z A;  1HKS A;  4MLO A;  1ZKG A;  2R5Y B;  3CCJ I;  1PDN C;  1H9T A;  3MKY B;  1BIA A;  5FB2 A;  3GW2 A;  1T0F C;  5C4X J;  4QSH A;  2M8G X;  2I10 A;  4RB2 C;  3SYT A;  2FE3 A;  3BG9 A;  4EJU A;  2XRO A;  3MVP A;  4HV6 A;  2DLL A;  1QHH D;  4M3E A;  3E5U A;  2JVG A;  2O0Y A;  4B3X A;  2Z1D A;  2R5Z A;  2M7B A;  4XLF A;  3SEZ A;  1GVD A;  4PJ0 C;  1YHQ I;  1GHC A;  4MTD A;  1ON1 A;  3M7G A;  1JT0 A;  1I1S A;  2FOK A;  4ZYE A;  2ZJP F;  5E3N A;  1HW2 A;  1PVE A;  2BZT A;  3QYB A;  2COM A;  3RQ4 A;  3RYR A;  4E4H A;  4CUG A;  2F48 A;  4IEJ A;  2XAF A;  2R7Z J;  2A6E F;  2I8D A;  2P5L C;  2M30 A;  4A3J J;  2BBY A;  2PMZ N;  2IA0 A;  4LLG F;  1T08 B;  3RKX A;  4KMU X;  2XAH A;  2EFP A;  1FMW A;  2HYF A;  2EJR A;  2LY2 A;  5D6E A;  3HPG A;  2HNH A;  2DFH A;  3F6V A;  2CV2 A;  5F04 A;  2KMU A;  5EEH A;  5E18 F;  3T0Y A;  3CDH A;  2VBX A;  3VFZ A;  1XGS A;  4BL0 B;  3HOS A;  3A0B C;  5E8I A;  1BR1 A;  3IRQ A;  2K9Q A;  2BOL A;  3IAS 2;  3HKZ N;  2K4B A;  3HL2 A;  2Y0S A;  2LOO A;  3T5X A;  1CF7 B;  3PO3 J;  1FYM A;  4WXD A;  5DS9 A;  2QQ9 A;  3CCE I;  4EJV A;  4UNO A;  3M8E A;  3KZZ A;  3C3W A;  1BJA A;  2ZXH A;  2XB0 X;  1MMG A;  2O03 A;  3R60 A;  3VB2 A;  1BM9 A;  4B09 A;  3U1D A;  1Z7U A;  2OAZ A;  3BG3 A;  4I01 A;  3S8P A;  3BTC A;  2WWY A;  5GP9 A;  1BC8 C;  2XRN A;  2JA7 J;  3CCV I;  2XGX A;  1LFB A;  2LC2 A;  4J01 A;  4XLA A;  1Z7L A;  3OYH A;  2XB5 A;  3E6M A;  3F8N A;  4WXH A;  5L3E A;  4ZYD A;  2OTL I;  2E1M C;  2R7X A;  4PJN A;  4EAT A;  3TBI A;  1W5T A;  3GWZ A;  2O3F A;  1WH7 A;  2KDZ A;  3I54 A;  4RMN A;  4RB3 C;  2F5V A;  2KRC A; 
#chains in the Genus database with same CATH homology
 1TW3 A;  4HF0 A;  2LKP A;  1ZG1 A;  2HTJ A;  4MQ9 F;  3DPT A;  5DEQ A;  1Y0U A;  4KA4 A;  1S29 A;  3PQK A;  4U7D A;  5DDG A;  2ZFW A;  4CIC A;  2FEZ A;  4HOB A;  4E70 A;  2NS0 A;  4HF1 A;  4EV0 A;  3GYH X;  4Z2Y A;  1I1G A;  3WOD F;  5HDG A;  1O3R A;  4WK8 F;  2DQR A;  3V7R A;  5AIP A;  3K69 A;  5L3D A;  3V7S A;  4UXN A;  4EJT A;  4L9J A;  5LRR A;  3SHF A;  2YU3 A;  3HRM A;  2PN6 A;  4AD9 A;  3FXQ A;  3REO A;  2Z99 A;  2QWW A;  2VON A;  5HVQ C;  1X3U A;  2FBI A;  3CUQ A;  5D5U B;  2RKH A;  3GLX A;  4FX0 A;  1BOA A;  1F9N A;  5K1Y A;  2ISZ A;  3QU6 A;  3L09 A;  2MLK A;  3HYI A;  3GFI A;  1FSH A;  3GX4 X;  1CGP A;  2ELH A;  5BOX A;  2V1D A;  1EH8 A;  3E3V A;  1REP C;  4A0Z A;  5D8K B;  1IRG A;  4XSX F;  5LGU A;  2A68 F;  3E6D A;  2E1C A;  1B9M A;  1F5T A;  5ILU A;  3J80 K;  4GGG A;  3ZMD A;  3SXY A;  4P5O A;  3TOA A;  2GA1 A;  1D8K A;  3WE2 A;  4HQE A;  2VBW A;  3I4P A;  2YX4 A;  5DCM B;  2CSO A;  2P5V A;  5JR3 A;  3LA7 A;  2QVO A;  1O3S A;  2UZK A;  3LQQ A;  1P92 A;  1R5H A;  1YQA A;  1MD0 A;  5L3F A;  1CF7 A;  3OOP A;  1HKT A;  3ABU A;  3V8K A;  3HSF A;  1J0R A;  5BQT A;  2VOO A;  2VE9 A;  5CVU A;  3IL2 A;  4LD5 A;  1TQI A;  3I53 A;  5ICE A;  4IVN A;  5FLX K;  4IRH A;  2XKO A;  2ZBK A;  4A2U A;  2LF7 A;  3VOE A;  5E1X A;  3BOQ A;  4A0Y A;  2YX7 A;  4D0P A;  1BIB A;  2V1U A;  2A07 F;  4ESF A;  2M8E A;  5CVI A;  1KU3 A;  3BP8 A;  1BC7 C;  1WI9 A;  2HFH A;  2CFX A;  3BPX A;  2OQR A;  1PP7 U;  4KFC A;  2RC4 A;  1UFM A;  1OYY A;  2X0L A;  2Q2E A;  4QWQ A;  1KU9 A;  1B4A A;  2EV5 A;  4KIG A;  3E5Q A;  1TNS A;  2XV4 S;  2P7C B;  1SMT A;  2HTS A;  5LHG A;  2G7U A;  4L9T A;  2KJC A;  3Q5F A;  3QPT A;  3DP7 A;  3RPU A;  4XRF A;  1IN5 A;  1FC3 A;  3KP6 A;  3ECO A;  4IRI A;  3IRR A;  1OMI A;  2O6G E;  3TKY A;  4MTE A;  3GZ5 A;  5DCF A;  1I5Z A;  3RKW A;  2VT3 A;  2JSC A;  3FMQ A;  3W6J B;  2D45 A;  2EK5 A;  4ZYH A;  1LDD A;  1PP8 F;  3O6B B;  2L3D A;  2QM3 A;  2OU2 A;  1XDS A;  4JK1 X;  3HIF A;  2Y48 A;  4KIF A;  2GWR A;  2QEN A;  4A6D A;  4IJA A;  1O3T A;  3IKV A;  3BJ6 A;  2G7H A;  2ISY A;  4HLY A;  1YIO A;  5F64 A;  5DD4 A;  3FM5 A;  3HUG A;  2VBY A;  2M5W A;  2IJL A;  1B1B A;  3N97 A;  5DD8 A;  2ZO4 A;  4XLN F;  1S7O A;  5FO5 A;  2DI3 A;  3L9F A;  4GCV A;  4KIB A;  1P2F A;  4A5N A;  2PMU A;  1K79 A;  5ILV A;  5DCM A;  3ULQ B;  6PAX A;  3TDZ C;  1FBU A;  3GFM A;  1R7J A;  4K2E A;  3HRS A;  1VTN C;  2Z5U A;  5LHH A;  4U88 A;  3RTR A;  2QUF A;  3R0A A;  1K6O A;  4IHT A;  1ULY A;  4YG2 F;  4CYD A;  1BI0 A;  1XCB A;  3RKY A;  1LQ1 A;  2GXG A;  3E6C C;  1IXR C;  3N4M A;  4G7O F;  5D4S A;  4BHP A;  4FX4 A;  3D5L A;  5E20 A;  2IVM A;  1G4D A;  2VC1 A;  3QOP A;  4M72 A;  4FT8 A;  4EM0 B;  2P6T A;  2A6H F;  1IN4 A;  2IP2 A;  2VXZ A;  4KUM A;  2A3S A;  3L7W A;  2IPQ X;  4RAZ A;  1MKM A;  4ASN A;  3V8L A;  4O6J A;  4PGH A;  5HS8 A;  1ZRD A;  4OIP F;  5HOO A;  1B6A A;  2VN2 A;  3JW4 A;  3IC7 A;  4U0W A;  2HDC A;  4G6Q A;  2KKO A;  3E6B A;  3BWG A;  3NQO A;  4YFK F;  4UVC A;  1ZRF A;  3JAM K;  4L0Z B;  4AIK A;  2DK5 A;  1G3T A;  1SD4 A;  4ENN A;  2DU9 A;  1U8R A;  2VE8 A;  3HTU A;  4LG0 B;  3KZY A;  3F3X A;  1STZ A;  2JPB A;  4M9X A;  3W6K B;  2LSO A;  3GUD A;  3WTY C;  2EFO A;  1LB2 A;  1YG2 A;  3QAH A;  3OV8 A;  4ENJ A;  4RGU A;  4BNC A;  4RGX A;  5ED4 A;  3E5X A;  3CUQ C;  2CYY A;  1YFH A;  1S6L A;  1P4X A;  1E17 A;  1UCR A;  3B02 A;  2NAZ A;  2EB7 A;  1WKM A;  1GXQ A;  4I2O A;  3PFI A;  3Q9S A;  2FML A;  3BJA A;  4L5J A;  1W7P D;  4P96 A;  4OOI A;  2ESN A;  5LLQ A;  4P9U A;  3WTX C;  2E1N A;  4AWX B;  4EGY A;  1MJ9 A;  1JXS A;  1FZP B;  3ZP5 A;  1V4R A;  3M1E A;  3F6O A;  3IKT A;  3WTZ A;  3D0S A;  1PUE E;  3R6S A;  4ENK A;  4PCQ A;  4WX9 A;  2PMH A;  1HKQ A;  2CW0 F;  2EV0 A;  5DV5 A;  3JAM Z;  1TBX A;  1D5V A;  1LJ9 A;  1JGS A;  1OR7 A;  3ISP A;  4CDG A;  5L3B A;  1AOY A;  1IZ1 A;  1E2X A;  2ZCW A;  3DKW A;  4QLC U;  1J7K A;  2VT2 A;  2OZU A;  1LNW A;  4BYY A;  1J9I A;  3WTV C;  1MJA A;  3HRU A;  2HKO A;  4OIO F;  1I6X A;  4G7Z F;  4XBF A;  4NHJ A;  3F22 A;  4G8X A;  2O61 A;  1SFE A;  2J5P A;  5JVT A;  5J8F A;  1ZLJ A;  4EVI A;  1XSV A;  4KT5 C;  3HOT A;  3FXR A;  1XSX A;  2V9V A;  1BI2 A;  2V79 A;  4AIH A;  4GYI A;  2VOD A;  4U7B A;  5F6F A;  2B0L A;  2Z3Y A;  2CG4 A;  4Q4Z F;  5H6R A;  1XD7 A;  5CYV A;  5KVR A;  2BYV E;  4YFN F;  4R8H A;  2PFB A;  2HKX A;  4GYG A;  2CO5 A;  4RS8 A;  3C18 A;  3HRT A;  5D5V B;  5JI6 A;  4HLX A;  1GXP A;  1KU2 A;  2DQL A;  5IT9 Z;  4H0E A;  1IW7 F;  2DPD A;  1IXC A;  4EGZ A;  3GZ6 A;  3KLO A;  2KIF A;  2ADU A;  2XAQ A;  2HZT A;  4UV9 A;  2HOE A;  3C7J A;  4Q5S F;  1ZN2 A;  3CTA A;  4LG0 A;  4RGS A;  2MH2 A;  1T98 A;  3G73 A;  3I64 A;  4MGR A;  2OA4 A;  5FGM A;  4HDV A;  3CUO A;  1KA8 A;  5D6F A;  4N9I A;  4LGW A;  5HDK A;  2F5C A;  1UHM A;  4CXF A;  2RQP A;  4L18 B;  2PI0 A;  1BBY A;  5AON A;  2YR2 A;  4EQQ A;  3ERE D;  4I0B A;  1ZYR F;  1A04 A;  2GZW A;  2QLZ A;  3COA C;  3RPQ A;  1UHW A;  4EM2 A;  3ELK A;  2FA5 A;  3QRF F;  4UUV A;  4I98 B;  3VEP A;  4UVB A;  1XDU A;  1KYZ A;  2AS5 F;  5D4R A;  3M8F A;  5E8G A;  2CWE A;  3U2R A;  1U5T C;  3TO6 A;  1J2X A;  3U9G A;  2TDX A;  4L5I A;  3LA2 A;  2Q0O A;  4CGZ A;  2IRF G;  2H6C A;  4KN4 X;  1LDJ A;  5ICC A;  3TDU C;  2P4W A;  1XGN A;  2XIG A;  2RN7 A;  4LLN A;  2M1B A;  4DNC A;  5K5Q A;  1W7P B;  1G3Y A;  3LAJ A;  1HXD A;  3NRV A;  5LEJ A;  1MDM B;  3KP7 A;  3LWF A;  4LJZ F;  3MCZ A;  3K1M A;  1TNT A;  2WTE A;  1R1T A;  2F5F A;  1YS6 A;  2FSW A;  2GXB A;  2W57 A;  1ZRC A;  4KYW A;  5JHU A;  3ZN1 A;  2FU4 A;  5DYM A;  5CJ9 A;  3WGH A;  3PQJ A;  3T1B A;  2A69 F;  2P5K A;  4CZZ A;  2MBF A;  5HLG A;  2PLY A;  3GVA A;  3E97 A;  4ON0 A;  4HZF A;  4LB5 A;  3F8F A;  1FP1 D;  5CLS A;  3J81 Z;  2GA2 A;  1YS7 A;  4U0V A;  4FHT A;  1IAW A;  4XLP F;  1QQI A;  1R36 A;  2FXA A;  1D3Y A;  3O3K A;  4M9S A;  2MA3 A;  1XSD A;  3GEZ A;  3SZP A;  1WQ2 A;  3FZV A;  5HDN A;  4UV8 A;  2L01 A;  2W24 A;  2ESH A;  1R00 A;  4PGG A;  1I27 A;  2KRF A;  3J7A O;  2ZNY A;  3R0J A;  4MHG A;  1R1U A;  3TGN A;  3BJO A;  3S2W A;  3K9T A;  1NHA A;  1ZRE A;  4UHT A;  3WTW C;  2NNY A;  1RI7 A;  2W84 A;  1U2W A;  4ZZD A;  5HLH A;  2GAU A;  4HDU A;  5CVJ A;  1USS A;  4M6X A;  2DPU A;  2ACJ A;  3WG9 A;  1FLI A;  1O3Q A;  2AXL A;  1QNT A;  2FQ3 A;  4HX7 A;  2JTV A;  3EDP A;  4IPA A;  1QGP A;  1J5Y A;  1IRF A;  1S8N A;  3DPL C;  5BS6 A;  4WXC A;  2ZME B;  1H9G A;  1QPM A;  3BDD A;  1R23 A;  1HSJ A;  2ZXJ A;  2XKP A;  2EV6 A;  3K0L A;  3GFL A;  1TQM A;  1Z05 A;  5BPI A;  2D1V A;  5ICF A;  2HS5 A;  4LK0 F;  4GO1 A;  4O5V A;  1ODD A;  5D5W B;  2F5E A;  2JPC A;  5FFZ A;  2E7X A;  1P4W A;  1W7P A;  5DUI A;  4RAY A;  1XGO A;  1KGS A;  2C6Y A;  3QP5 A;  1JHH A;  4HA8 A;  3CJN A;  1W4M A;  3ABT A;  3M9A A;  5J8C A;  5TJJ A;  2DTR A;  1J75 A;  1MDM A;  2VBZ A;  4HYE A;  2M45 A;  3Q9V A;  2HQN A;  4BHC A;  2HGC A;  1P6R A;  2RGV A;  4JQF A;  2NRA C;  3I59 B;  5A2Q K;  3T8T A;  3AAF A;  1QZZ A;  3SQN A;  2F5D A;  1DPU A;  1ZAO A;  2PJP A;  4R79 A;  5EEG A;  2ETH A;  2WC2 A;  4KMF A;  1ZAR A;  3P9K A;  3JSP A;  1WWX A;  3ROU A;  2HQR A;  2M87 A;  1G3W A;  3BY6 A;  1HW5 A;  1C0W A;  2HR3 A;  5BPD A;  1KQ8 A;  3K1N A;  3P9C A;  1W5S A;  2EA2 A;  2EA4 A;  3QU3 A;  2DK8 A;  4TV7 A;  3I0T A;  1FP2 A;  3DQV C;  5E17 F;  2JRT A;  4P9F A;  1YTY A;  3MFK A;  1IUY A;  3C1D A;  1DPR A;  1MGT A;  4AVP A;  3WTS C;  3JTG A;  1IN8 A;  3H3U A;  3B73 A;  2E7W A;  5D8L B;  1LEB A;  4N0B A;  1SFX A;  2PQ8 A;  2ZKZ A;  1EH7 A;  1R1V A;  4CHU A;  4I02 A;  1Z91 A;  1FYL A;  1GVJ A;  1EV7 A;  3HHH A;  1FYK A;  2K02 A;  3EYY A;  4G6D A;  4PDK A;  1V3F A;  3WGI A;  3FWE A;  4A5M A;  1TTY A;  3BZ6 A;  4L9N A;  1FBS A;  3TO7 A;  3MAJ A;  3KEO A;  3MWM A;  4OU0 A;  5A2Q Z;  1LDK B;  1RZ4 A;  3ZMU A;  4ESB A;  3BRO A;  3KP5 A;  5K5R A;  4A6E A;  4RGR A;  4F7Z A;  1SAX A;  3ZMV A;  5D5X B;  4EJW A;  4CO8 A;  1ZG3 A;  2ZME A;  4ZYG A;  4DQ2 A;  2D1H A;  1KQ9 A;  3WTU C;  3FMS A;  3QPH A;  2DO7 A;  4A0X A;  2MLG A;  4BXU A;  1RNL A;  2Y0M A;  2FF4 A;  3DXJ F;  1XCV A;  4KIC A;  1SD5 A;  3HSE A;  2PEX A;  4PZJ A;  5HS9 A;  3F8B A;  3ZMT A;  1TQP A;  3QP6 A;  1UB9 A;  5IT9 K;  4ENM A;  1HQC A;  1U6G A;  5LHI A;  4MEX F;  2QQA A;  5K5O A;  3WU1 B;  2K27 A;  4OIN F;  3ML6 A;  3CO7 C;  4EJO A;  1P4A A;  2WV0 A;  3MZY A;  4M73 A;  3HSR A;  4BQA A;  4L9V A;  1KQ0 A;  2VOP A;  4WCG A;  1FY7 A;  2FBK A;  1LEA A;  5L3C A;  1O57 A;  1OPC A;  1IN7 A;  3I59 A;  3SZT A;  3TQN A;  2DAO A;  2O8X A;  5FD5 A;  2R3S A;  1ZGA A;  4A12 A;  3RYP A;  3ZN0 A;  5HS7 A;  4OIR F;  4IRG A;  5LRS A;  3FHZ A;  4KNY A;  4HX8 A;  2CQK A;  2XAJ A;  2K4J A;  1U78 A;  2RDP A;  3LST A;  2L54 A;  3L00 A;  3WU0 A;  3ZQ7 A;  5FD6 A;  1SD6 A;  1WSU A;  1ZLK A;  2FRH A;  4O3M A;  2F2E A;  1HBX G;  5E1W A;  3HTS B;  1G3S A;  2A61 A;  2L4A A;  3KP3 A;  2LNB A;  2FNP A;  1ON2 A;  4EM1 A;  3KLN A;  5AIQ A;  4OMZ A;  3ZMZ A;  4ESJ A;  2R7D A;  1XB4 A;  1ZH5 A;  2P6S A;  4OIQ F;  1Z9C A;  1MJB A;  3MEX A;  3DF8 A;  2STW A;  3BPV A;  3KE2 A;  1K7A A;  2BEO A;  1FT9 A;  5FFX A;  4BH9 A;  3RDI A;  2K86 A;  2DT5 A;  1EH6 A;  3CO6 C;  2JT1 A;  4BAY A;  1IF1 A;  2XAG A;  1L3L A;  4G94 A;  4I0A A;  4LFU A;  3F23 A;  2GIV A;  4LK1 F;  2Q8K A;  3HHG A;  4UVA A;  2DFI A;  1K78 B;  3ECH A;  2Z9O A;  1JHF A;  1OKR A;  2RV8 A;  2J5O A;  1S3J A;  2DW4 A;  2HYG D;  2IT0 A;  3WTT C;  1R58 A;  3SFZ A;  3KEQ A;  3J81 K;  4S04 A;  3F8M A;  4LMY A;  1YO5 C;  5HLI A;  1SFU A;  1Z1D A;  1RIO H;  1HST A;  2MH9 A;  1SD7 A;  4NB5 A;  1J59 A;  3GF2 A;  1T0F A;  2XAS A;  1YW7 A;  3L2C A;  3FM3 A;  4LB6 B;  4AIJ A;  1U5T B;  3KP4 A;  2LDU A;  2EFW A;  4ZH4 F;  2ZNZ A;  3H92 A;  5KK1 A;  2XHK A;  3LA3 A;  2H6B A;  3T8R A;  5LEK A;  2HEO A;  1AWC A;  4N9H A;  4Q47 A;  1XN7 A;  4HF2 A;  1O7L A;  2FMY A;  3F8C A;  4RB0 A;  4HQM A;  4M6Y A;  2QQB A;  4B8X A;  1XGM A;  2MC3 A;  2Y75 A;  3KFW X;  1T2K A;  2BV6 A;  2L02 A;  4WWC A;  1MZB A;  3WE3 A;  3R4K A;  3JTH A;  2Z33 A;  3NEU A;  4IHS A;  1WRJ A;  2BGC A;  2LF8 A;  1UST A;  2P8T A;  3LQR A;  2KJB A;  2A5Y B;  2BE5 F;  3I71 A;  4EMS A;  1B59 A;  1XMK A;  4RB1 A;  5F1R A;  2RNJ A;  1F4K A;  1D8J A;  4MQV A;  1Q1H A;  5E1Z B;  2ZJ2 A;  5L3G A;  3I58 A;  2FBH A;  3RJP A;  1L0O C;  1T38 A;  4L0Y B;  1S7A A;  3J80 Z;  2QYO A;  1FSE A;  5ERI A;  2PG4 A;  2EWN A;  3IWF A;  1BN5 A;  3GXO A;  4GXO A;  2UXN A;  1RUN A;  3F72 A;  2OBP A;  2YSR A;  3F21 A;  3GO5 A;  5TRD A;  3LFK A;  3CLO A;  5LBQ A;  3P9I A;  3EQL F;  1R22 A;  1K78 A;  4KN7 X;  4HBL A;  5CVR A;  2FNA A;  2K7L A;  3FXU A;  3RIR A;  5FLX Z;  4ETS A;  3V4G A;  1FX7 A;  2XVC A;  1T6S A;  5J6X A;  3ZMS A;  3ZPL A;  1FBQ A;  1XMA A;  4G9Y A;  2NNN A;  4MNU A;  2QBY B;  2H27 A;  5CVV A;  1U3E M;  3JSO A;  5DUK A;  4M9Z A;  4IXA A;  2OD5 A;  3FF5 A;  2V1X A;  1SMY F;  1U5T A;  1RUO A;  2G9W A;  4HW0 A;  3K2Z A;  2YPR A;  2EFQ A;  2EFN A;  2RVC A;  3R61 A;  1KU7 A;  3KET A;  4HX4 A;  1IXS B;  4P55 A;  1O7F A;  1Z6R A;  1OYW A;  3MZH A;  3EYI A;  1HW1 A;  2KIU A;  1T39 A;  3MQ0 A;  4HAM A;  3TO9 A;  3I5U A;  4IF4 A;  1DP7 P;  3KP2 A;  2QZ8 A;  3DV8 A;  1DDN A;  2JZY A;  2NYX A;  2H09 A;  4YFX F;  2DBB A;  2V6C A;  3FX3 A;  2W85 A;  3EET A;  5LGT A;  4M71 A;  1YW9 A;  4NQW A;  2OZ6 A;  3RI4 A;  4R1H A;  4S05 A;  1JE8 A;  1QZY A;  3O2P E;  4OMY A;  3IWZ A;  1YYV A;  2GQQ A;  4Q48 A;  2L4M A;  4XSZ F;  3TOB A;  1FPQ A;  4JBA A;  4MEY F;  1H0M A;  2KIM A;  2OQG A;  2PBI A;  1FNN A;  3V8J A;  4Y13 A;  4G7H F;  1G6N A;  1FWZ A;  1ZG5 A;  1KYW A;  3DEU A;  1ZGJ A;  3G3Z A;  2MD5 A;  1LVA A;  4ZZL A;  3GFJ A;  2STT A;  2H94 A;  5JFR A;  3V7C A;  5H20 A;  1BI3 A;  4LLL A;  2UXX A;  3FMR A;  2W25 A;  4KDP A;  3K1P A;  4I09 A;  1ONV A;  1TW2 A;  3IHU A;  2UWM A;  5ICG A;  4YII A;  3KCC A;  2CGP A;  4I7H A;  1Z6T A;  1BI1 A;  4Y17 A;  1YLF A;  2X4H A;  4HV5 A;  3VOD A;  2R7F A;  1IN6 A;  3LAP A;  3P7N A;  1R5G A;  5BMZ A;  5H6Q A;  1QBJ A;  2HWV A;  3DFG A;  2D2W A;  4U0Y A;  1YW8 A;  1QO0 D;  4WF2 A;  3CUQ B;  5LGN A;  4M74 A;  2XUB A;  4Y15 A;  1FOK A;  3EUH A;  1TLH B;  5ILS A;  5IT3 A;  1ZHF A;  2IW5 A;  2IA2 A;  2QBY A;  2IA1 A;  1OYI A;  1DUX C;  1B9N A;  4YIF A;  4BHB A;  3WGG A;  1F1Z A;  2P7V B;  2VC0 A;  3H3Z A;  1HKS A;  1PDN C;  1H9T A;  1BIA A;  5FB2 A;  3GW2 A;  4RB2 C;  2FE3 A;  4EJU A;  2XRO A;  4HV6 A;  2DLL A;  3E5U A;  2O0Y A;  1GHC A;  4MTD A;  1ON1 A;  3M7G A;  1I1S A;  2FOK A;  4ZYE A;  1HW2 A;  2COM A;  3RYR A;  2XAF A;  2A6E F;  2P5L C;  2M30 A;  2BBY A;  2IA0 A;  4LLG F;  3RKX A;  4KMU X;  2XAH A;  2EFP A;  5D6E A;  2HYF A;  2EJR A;  3F6V A;  5EEH A;  5E18 F;  3T0Y A;  3CDH A;  2VBX A;  3VFZ A;  1XGS A;  3HOS A;  5E8I A;  3IRQ A;  2K4B A;  3T5X A;  1CF7 B;  1FYM A;  4WXD A;  2QQ9 A;  4EJV A;  4UNO A;  3M8E A;  3KZZ A;  3C3W A;  1BJA A;  2O03 A;  3R60 A;  3VB2 A;  1BM9 A;  4B09 A;  3U1D A;  1Z7U A;  2OAZ A;  4I01 A;  2WWY A;  1BC8 C;  2XRN A;  2XGX A;  3E6M A;  3F8N A;  4WXH A;  5L3E A;  4ZYD A;  1W5T A;  3GWZ A;  2O3F A;  3I54 A;  4RB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...