1R36A

Nmr-based structure of autoinhibited murine ets-1 deltan301
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVSDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural and Dynamic Basis of Ets-1 DNA Binding Autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords C-ets-1 protein
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r36A00
2WTEA 4OMZA 5L3GA 1XB4A 1JHFA 2YPRA 2HGCA 3MFKA 3KLNA 3EQLF 2DBBA 3IKTA 2ESNA 1D8JA 2HQNA 1O3SA 5D5VB 4HW0A 3WGIA 3KP7A 1Z9CA 4L5IA 1JE8A 4H0EA 2QZ8A 4GGGA 1WQ2A 3KEQA 3BJ6A 1OYWA 2M87A 2V1DA 3B73A 3TDUC 1PUEE 3F3XA 2X4HA 3FXRA 4BHPA 5CJ9A 3ULQB 1OYYA 3Q5FA 1SMTA 1DDNA 4ESFA 4XSXF 1J5YA 5LBQA 4BXUA 4MGRA 1T38A 1U2WA 2MLKA 2E1NA 1USTA 5FFXA 1TTYA 2O61A 1YW8A 2EV0A 3LQQA 5ICCA 3HHGA 1TLHB 1YIOA 2EA2A 1Y0UA 1OMIA 1ZLKA 5D6EA 2KIFA 1YS6A 1S7AA 3E6BA 2FF4A 3C7JA 1YW7A 3R0JA 4AWXB 1W4MA 1ON1A 3GFMA 4TV7A 3JAMZ 2KIUA 4AIJA 1P92A 4M9SA 2HYFA 4RAYA 2F5CA 2E7XA 3GO5A 3I71A 5FLXZ 2LF7A 2DK8A 5TJJA 1IXRC 3E6CC 5J8CA 2F2EA 2PG4A 3RKWA 3SZPA 5HS7A 2OBPA 2DTRA 1BIBA 1Z91A 2P8TA 1XGNA 1MZBA 2EFQA 5L3CA 4EQQA 4HLYA 4KICA 2XRNA 3M8EA 1I5ZA 5ICFA 5LRSA 2EB7A 5LRRA 2Q2EA 1FX7A 2NYXA 2P4WA 1SD7A 4HZFA 4KIGA 3NQOA 3R0AA 2VBYA 3LAJA 3JTGA 1YW9A 1V3FA 2DPUA 2M30A 3KP3A 2EV5A 4PCQA 3GYHX 3CO6C 3P7NA 2WC2A 4KIFA 5HVQC 3CDHA 3WTXC 2VOPA 5ILUA 3T5XA 1C0WA 4L0YB 1L0OC 4YFNF 4AIHA 2HWVA 3RTRA 3LA3A 4B09A 2H09A 4Y17A 3O3KA 4I0AA 3J81Z 3QPHA 1FBSA 5D8LB 3CUOA 1XSDA 2DLLA 4LFUA 3S2WA 1RIOH 3VEPA 1KU9A 2W84A 3F8FA 4L0ZB 3E97A 1T98A 3FMQA 3O6BB 2RKHA 4CDGA 1REPC 5HOOA 1BJAA 1V4RA 1RI7A 3K2ZA 4YFXF 2STTA 4GCVA 5LHGA 1XSVA 3N4MA 2PJPA 2UXXA 2DT5A 2Q0OA 4EMSA 4OMYA 2DQLA 3JSOA 1KU3A 2O03A 3IWFA 1WKMA 4MEXF 5HLHA 4EGYA 2LKPA 2DAOA 3DPTA 3ZMSA 2COMA 1XD7A 3KP2A 3CJNA 4IVNA 4NHJA 2IRFG 1IW7F 3MWMA 4A5MA 1QQIA 4O3MA 1ZRCA 4WF2A 1FWZA 3HSEA 4LK1F 1J9IA 1G6NA 1KQ0A 2A68F 1SD5A 5CVUA 4HV6A 2L02A 1K79A 1ZGAA 5ICGA 3F6OA 3GFLA 4M74A 2P7VB 3F22A 1MJAA 1QZYA 1DP7P 4RAZA 4ZZDA 4EM1A 5LGNA 1OR7A 4I02A 1F1ZA 2GQQA 2ISYA 3JW4A 4XLPF 5L3BA 5LEKA 1UHMA 1EH8A 2VN2A 4ZYEA 1UCRA 5L3EA 1S6LA 2MH2A 3F72A 3RI4A 1HSTA 3KP6A 3V7CA 2UWMA 3BDDA 2EA4A 5D8KB 2VOOA 3ZMTA 2EV6A 4QLCU 4IXAA 1LDKB 5D4RA 5K5RA 2HTJA 2K86A 5BPIA 3F8NA 2DI3A 3WTSC 3K9TA 4LMYA 2ACJA 4OIPF 3E6DA 4HF2A 2W85A 3IKVA 1WI9A 3HRTA 5FB2A 5E20A 4L9JA 1Q1HA 1IXCA 1R5HA 1J59A 3I58A 2FOKA 3WTUC 3I53A 4RB0A 1I1SA 5D5XB 2ZMEA 5LLQA 2F5FA 4A0XA 5E1ZB 1I1GA 4YG2F 4EM2A 5LHHA 3BPXA 1Z6RA 3RYPA 4UHTA 4I01A 1WRJA 2OZUA 2PI0A 1HKTA 2CWEA 4M6XA 3RKXA 3DQVC 2GWRA 1OYIA 3O2PE 3E5QA 3GW2A 3J81K 4LLLA 3BJOA 5E1XA 5AIPA 5DDGA 2A07F 4XBFA 2OQGA 1T2KA 3SFZA 4HBLA 1DPUA 3EYYA 3V8KA 1SMYF 3N97A 1BI0A 3KFWX 2M8EA 1ZAOA 2YX7A 1BM9A 1W5TA 4M9XA 3T1BA 2QQ9A 3CUQB 3T8RA 4MTEA 1DPRA 5DV5A 2NNYA 1BIAA 1R1UA 1KYZA 3DEUA 3Q9SA 2D2WA 3DV8A 2ZBKA 3ZQ7A 3EDPA 4D0PA 3KZYA 5E1WA 4CGZA 1YLFA 4N0BA 3V7SA 3VB2A 4LG0B 1E17A 4M9ZA 4P96A 2D1VA 1D5VA 4GYGA 1S8NA 5E18F 4GO1A 2CGPA 4BYYA 2VT3A 2IVMA 2Z3YA 3CUQA 4G8XA 2KIMA 2LSOA 5HDGA 4P55A 4P9UA 3DF8A 1XMKA 2V9VA 2O6GE 2F5EA 3GWZA 4HF1A 1A04A 4Q4ZF 4PZJA 1FSHA 1S29A 1LDDA 3HYIA 3WTTC 1ZG5A 4L9VA 3I4PA 1WWXA 2NS0A 1TNSA 4CZZA 2R7FA 5DUIA 2GXGA 1LJ9A 5ILVA 3LA2A 4BQAA 1I6XA 2DQRA 4I2OA 3NRVA 4F7ZA 2E1CA 2Z33A 1R23A 4KA4A 2OAZA 1PP7U 3E5XA 2FE3A 2O3FA 3K1MA 4IRGA 3H92A 4U7BA 3R60A 3QRFF 2VE9A 1YS7A 5ILSA 1QNTA 2ESHA 3TOAA 4WXHA 3LA7A 3HTUA 4U88A 3FX3A 3WGGA 2HZTA 2RNJA 2HYGD 4ZYDA 4HX7A 3W6JB 1AOYA 2NNNA 3MZYA 2VBZA 3WTWC 1XCBA 5IT3A 1XGSA 1FBUA 2RQPA 5HLIA 1ON2A 2V1UA 1ZRDA 2K02A 1IN4A 4I98B 5BS6A 2CW0F 4YIFA 4A12A 2FSWA 2HDCA 4GYIA 4Z2YA 3M9AA 1R1VA 1LDJA 2JSCA 5LGTA 4QWQA 1O7LA 2GA2A 5EEGA 2ZO4A 2Y0MA 3MCZA 4JQFA 1PDNC 5DCMB 3FXUA 1R36A 3G73A 2JRTA 5JHUA 1ZGJA 1ZLJA 1KA8A 2EK5A 4BHBA 2Z5UA 4CYDA 1LQ1A 3OOPA 1NHAA 3KP4A 3JAMK 2XIGA 1AWCA 2GAUA 4R1HA 2VBWA 3KCCA 3LFKA 2O8XA 4ESJA 3KZZA 3QP5A 4HF0A 5FLXK 3E6MA 2H6CA 4DQ2A 1FP1D 2OD5A 2EFNA 3FHZA 3REOA 1CF7A 1GVJA 4L18B 1U3EM 2L4MA 1FBQA 2A61A 4BH9A 4PGHA 1KGSA 3RPUA 1GXQA 4WCGA 4RGRA 4I09A 1KQ8A 2HKOA 1MGTA 3TDZC 3TO6A 3JSPA 4UUVA 1HXDA 2DPDA 5BPDA 3WU1B 4WXDA 3RKYA 1R5GA 3ECOA 3ZMVA 4HLXA 4K2EA 2V1XA 4ENMA 4UVCA 3AAFA 5JI6A 3U1DA 2CQKA 1FLIA 4U0VA 4G7OF 3HRSA 3FMSA 4IHSA 1R00A 2STWA 3ZMZA 1H9GA 2QLZA 2LNBA 2K4JA 5TRDA 3M7GA 1P4WA 3WTVC 2DFIA 2LF8A 2ZCWA 3QU3A 3ZN0A 3DXJF 4P5OA 3F8MA 2GIVA 2RC4A 2Y48A 5DD4A 2ZKZA 1K7AA 2B0LA 3PQKA 4EJOA 1HW2A 5HS8A 3HUGA 1B9MA 1JGSA 1SFUA 5DEQA 1FY7A 4XSZF 2DO7A 3HTSB 2IPQX 1X3UA 3TGNA 1STZA 3MZHA 3IHUA 4MQ9F 2XAQA 1HKSA 3JTHA 5FD6A 3SZTA 3HSFA 1XDUA 2F5DA 1FC3A 1W7PD 3IWZA 3R4KA 1BI2A 3F21A 5CVJA 4EJWA 1ZHFA 3CO7C 5BQTA 2XAGA 1F5TA 4OIQF 2DU9A 4WK8F 4KN7X 4LJZF 1IUYA 3WU0A 4U0WA 1MKMA 1FSEA 1EH7A 1RZ4A 2QM3A 2VC0A 1XGOA 3RIRA 5KVRA 4XLNF 5FO5A 2MD5A 3ZMDA 4FX4A 3D5LA 3K0LA 1F9NA 2HQRA 2P6TA 1TNTA 1MDMA 3BPVA 4MTDA 4EJUA 3L9FA 3OV8A 3U2RA 4OINF 1J2XA 1SD6A 3KP5A 3HIFA 2XKOA 4OU0A 5BOXA 2JT1A 1L3LA 5ED4A 2P7CB 2Y75A 3R61A 2FRHA 3HSRA 2RGVA 4IRHA 2IA2A 1XMAA 2PBIA 3HOSA 2P5KA 3L00A 5LEJA 3QOPA 2ZNYA 2UZKA 2IJLA 2XGXA 4Y15A 4YFKF 2GZWA 2NRAC 4Y13A 1I27A 1O57A 3FXQA 2OZ6A 3I0TA 2FA5A 2JZYA 3VFZA 2W57A 1UFMA 4CHUA 1IXSB 4UXNA 3TQNA 1VTNC 1OPCA 4WX9A 3E3VA 1W7PA 2JPBA 3RJPA 2XHKA 2XAFA 5D6FA 4JBAA 3TOBA 1U78A 3J80K 4OIOF 4RB2C 2QQBA 2QBYA 1W5SA 5IT9K 4ZYGA 2L3DA 4IJAA 2G7HA 1FNNA 4HA8A 4ZH4F 1BN5A 3P9KA 4HV5A 2OA4A 4IRIA 1J7KA 2RVCA 2K27A 1G3WA 4MNUA 5L3FA 2GXBA 3COAC 2MC3A 4HOBA 2VT2A 1U8RA 5JR3A 3DPLC 4EVIA 1QZZA 4EJVA 4N9IA 3LWFA 1O7FA 2H6BA 4RGSA 1XDSA 4UV9A 4Q47A 4G7ZF 5H6QA 3LAPA 5J6XA 1U6GA 4DNCA 2KKOA 1MJ9A 1E2XA 5AONA 1B59A 5F64A 1QO0D 4G9YA 2PN6A 3C18A 3SHFA 1S3JA 2XVCA 1Z1DA 4U7DA 2PFBA 1RUNA 1SFEA 1XSXA 2PEXA 1W7PB 2Z99A 1XGMA 2OQRA 1HSJA 3GFIA 1ZYRF 1K78A 1TW2A 2HTSA 1HKQA 1TQMA 4HDVA 3T0YA 2QQAA 3VODA 1YFHA 2L4AA 4WWCA 5DCMA 2EJRA 4KMFA 2YR2A 4RS8A 2MA3A 2WWYA 1BOAA 2A3SA 4S05A 1FYKA 2M45A 3BJAA 4BNCA 2HKXA 2VBXA 2EFWA 1FZPB 1ZREA 3QPTA 4UNOA 5J8FA 1YG2A 2NAZA 2XASA 4MEYF 3QP6A 3WE3A 3IRRA 1CF7B 2XV4S 1G3SA 2A6EF 4LLNA 2K4BA 4M6YA 1D3YA 2H27A 2DK5A 3V7RA 3HRMA 2Z9OA 1P4AA 2CYYA 2PMHA 4A2UA 1YQAA 2XUBA 5HDNA 4HQEA 4OIRF 3WTZA 5K5OA 1ZG1A 2FEZA 2R7DA 3TO9A 1LNWA 3KEOA 4LD5A 1P4XA 3G3ZA 4L5JA 3WG9A 5H6RA 5H20A 4ZZLA 1P6RA 2P6SA 4ASNA 4ESBA 1JHHA 5DUKA 2C6YA 3IC7A 3HRUA 4L9TA 2EFOA 2VE8A 1CGPA 5A2QZ 2ZXJA 3F8CA 5IT9Z 2PLYA 2HR3A 3H3UA 1FYLA 1TBXA 2PMUA 3BP8A 2ZFWA 2PQ8A 5JFRA 1MD0A 2TDXA 2ZJ2A 2WV0A 1TW3A 4A0ZA 3D0SA 4I7HA 4KT5C 1K78B 3ABTA 4LB5A 3KLOA 2QVOA 5AIQA 4EM0B 2ISZA 4I0BA 2LDUA 2BGCA 4YIIA 3R6SA 2QBYB 1R22A 2A69F 3L09A 3F8BA 2VODA 4ENNA 1QGPA 3F6VA 2XROA 1TQIA 2ADUA 3BWGA 3ZMUA 4LG0A 3L7WA 2GA1A 3IL2A 3QAHA 3LQRA 4G94A 4XRFA 2FMLA 1GXPA 3GF2A 2OU2A 1YYVA 2XKPA 4EJTA 2IA1A 3K1NA 4JK1X 1LEBA 1KU7A 5F6FA 1B1BA 2K7LA 1QBJA 2MLGA 3I5UA 3M8FA 4P9FA 4A0YA 4ENJA 2BV6A 3PFIA 5L3DA 3BY6A 4GXOA 3ERED 1ZARA 5CLSA 4KDPA 2RV8A 2KJCA 3ZP5A 4R8HA 3P9IA 3GEZA 4Q48A 3MEXA 3EETA 1RNLA 4AIKA 1WSUA 3GVAA 4LK0F 1ZG3A 3I59A 4EGZA 3WTYC 1R7JA 2FQ3A 5E8GA 3RDIA 2VC1A 3H3ZA 3J7AO 3T8TA 3GFJA 1ZRFA 3F23A 5HS9A 2FNAA 3LSTA 1BI1A 1IRFA 1FYMA 3ELKA 3C3WA 5CVRA 1GHCA 4AVPA 1PP8F 3BOQA 2VXZA 4HAMA 3W6KB 2E7WA 4KMUX 3ISPA 1R58A 2FBHA 3RYRA 4FT8A 1IN5A 4L9NA 1Z7UA 4A5NA 2HS5A 4G6QA 4RB3C 4U0YA 3FMRA 1U5TA 4KFCA 2FBIA 6PAXA 2G7UA 1YO5C 1ZH5A 2JPCA 2J5OA 5CVVA 1H9TA 5KK1A 4BHCA 4BAYA 2HFHA 1YTYA 2G9WA 3KETA 1HW5A 3EYIA 3WODF 2V79A 2FU4A 4KYWA 5LHIA 1QPMA 1Z6TA 4ETSA 4LGWA 3ZPLA 2MBFA 4M73A 4AD9A 2A5YB 4NB5A 1FPQA 1IZ1A 4RB1A 2EFPA 2QYOA 2CFXA 3WE2A 1G3YA 2P5VA 4IF4A 2UXNA 3M1EA 4CXFA 3NEUA 1MDMB 2KRFA 1FOKA 1Z05A 1UB9A 3RPQA 4UVAA 2CG4A 1LB2A 3V8JA 4M71A 2CSOA 3HHHA 3ML6A 3CLOA 1BC8C 4NQWA 1T39A 3DP7A 1B6AA 3FWEA 4HDUA 3KE2A 1D8KA 2O0YA 2YSRA 4S04A 5HDKA 4HX8A 3V4GA 4O6JA 2QUFA 5BMZA 2HOEA 2IT0A 2M5WA 4MQVA 4A6EA 1TQPA 4PDKA 3I59B 2QWWA 1EH6A 4A6DA 3EUHA 1SD4A 3ROUA 1SAXA 1O3QA 3TO7A 5DD8A 2AS5F 2ZMEB 3GX4X 1IRGA 3QU6A 1G4DA 3Q9VA 2BE5F 1BBYA 2XAJA 1IN6A 4ENKA 4UVBA 1DUXC 1FP2A 1T0FA 3B02A 4ZYHA 3BZ6A 3DKWA 1BI3A 3I64A 3K1PA 2L54A 1RUOA 1S7OA 2DW4A 4LLGF 1H0MA 1UHWA 3ABUA 3U9GA 2FBKA 5EEHA 4RGXA 4G7HF 4R79A 1U5TC 3WGHA 1O3RA 1T6SA 1J75A 1HW1A 5E8IA 3L2CA 2L01A 3MAJA 1P2FA 3FM5A 2W24A 5K5QA 4G6DA 5JVTA 3SQNA 4CICA 1USSA 3E5UA 3GUDA 1J0RA 1G3TA 3IRQA 3ECHA 1IF1A 2R3SA 5CYVA 5ERIA 2Q8KA 2XAHA 4CO8A 1B4AA 4MHGA 4PGGA 5D4SA 5HLGA 3J80Z 4UV8A 2BYVE 4FX0A 3CTAA 4HQMA 3CUQC 3SXYA 1MJBA 4KN4X 4WXCA 2RDPA 2VONA 5K1YA 4HX4A 5F1RA 5LGUA 4EV0A 2M1BA 1KU2A 1BC7C 1ZN2A 1ODDA 5FFZA 2YU3A 2IA0A 3GLXA 1IN8A 4N9HA 3TKYA 3BROA 2FNPA 5CVIA 2IP2A 3PQJA 3K69A 2IW5A 4Q5SF 4LB6B 2YX4A 2FMYA 2CO5A 4HYEA 4IPAA 1IAWA 3P9CA 1XCVA 3DFGA 3GZ6A 4IHTA 5D5WB 4FHTA 1HQCA 1KYWA 3I54A 1U5TB 5FD5A 1ULYA 4OOIA 4ON0A 5FGMA 3MQ0A 1XN7A 4E70A 4B8XA 5DYMA 1OKRA 5DCFA 1K6OA 1IN7A 2ETHA 2J5PA 2P5LC 2BBYA 3FM3A 1SFXA 3HOTA 3C1DA 1HBXG 2D1HA 3VOEA 3V8LA 4KIBA 4RGUA 1LVAA 2JTVA 2QENA 2AXLA 2D45A 1R1TA 3GXOA 4O5VA 1LEAA 3GZ5A 3FF5A 4KUMA 3FZVA 2X0LA 1JXSA 4M72A 2RN7A 5E17F 2KJBA 1ONVA 2MH9A 5A2QK 1EV7A 2V6CA 2ELHA 1FT9A 4KNYA 1KQ9A 1B9NA 2A6HF 2W25A 2BEOA 2EWNA 1F4KA 2FXAA 2ZNZA 2HEOA 3ZN1A 5ICEA 2H94A 5D5UB 1O3TA
chains in the Genus database with same CATH superfamily
5J4YA 3GMEA 1LVKA 2WTEA 3K4BA 2F4IA 3S14J 4OMZA 5L3GA 3V42A 1XB4A 1JHFA 2R93J 2YPRA 2GBYA 2HGCA 4U87A 5E3MA 5IP7J 3MFKA 5K7FA 1YRNB 4M3GA 3KLNA 2NVQJ 2K40A 3EQLF 2DBBA 3IKTA 2ESNA 3PNTA 2HQNA 1D8JA 4GFBA 2E5NA 1WI3A 1O3SA 3D1NI 5D5VB 4HW0A 1A35A 3KP7A 3WGIA 2M2EA 4BU2A 2HXIA 5M5WJ 1Z9CA 1VQ5I 4L5IA 1JE8A 4H0EA 3S2DJ 2CUFA 4MIMA 2QZ8A 1RKTA 4PSWA 4BBRJ 4GGGA 2BY0A 2M8GX 1WQ2A 3H1CA 3PM1A 3KEQA 3BJ6A 1XMXA 3BZKA 1OYWA 2VKVA 1RRJA 4ZDOA 2M87A 2Y31A 3X2QH 2V1DA 1O3TA 3B73A 2R5ZA 3TDUC 1PUEE 4MLOA 2EBIA 4ZDLA 2P0WA 3F3XA 2F48A 1Y8QB 2X4HA 3H36A 3FXRA 4BHPA 4I99C 5CJ9A 3L2VA 3ULQB 1OYYA 3Q5FA 1QHGA 4YIRX 1SMTA 3OYGA 2F5VA 2EIJH 1DDNA 1MW7A 3G1OA 4ESFA 4XSXF 3WU2C 2JVGA 3BC8A 1J5YA 5B1BH 2ZC2A 2O7OA 2IS4A 3QYEA 1ERDA 5LBQA 1GV5A 4MGRA 4BXUA 1T38A 1U2WA 4HPQA 2MLKA 3HOUJ 2E1NA 1USTA 1Y1VJ 1TTYA 5FFXA 1NH3A 2O61A 1YW8A 2EV0A 1MMNA 2WAEA 3LQQA 5ICCA 2KISA 3S3OA 3HHGA 1TLHB 4XQFA 1YIOA 3AG2H 2EA2A 4F93B 1A31A 1Y0UA 4PJJA 1OMIA 1ZLKA 5D6EA 3I4NJ 2E34A 1XTAA 2KIFA 3S3NA 1YS6A 1QA6A 4X6AJ 2IBDA 4OAYA 1S7AA 3E6BA 2FF4A 3C7JA 5EDNA 1YW7A 3R0JA 2OTLI 4AWXB 1W4MA 1ON1A 3GFMA 4TV7A 3JAMZ 2KIUA 3VSKA 4JX5A 4AIJA 1P92A 1D1CA 1BA5A 1ETOA 4M9SA 2HYFA 1HF0A 4RAYA 2E19A 2F5CA 2MSYA 2E7XA 3DKYA 3LSJA 3GO5A 3I71A 2WAFA 5FLXZ 2HQ5A 2LF7A 4BDZA 2DK8A 5TJJA 3H9JA 3NARA 1IXRC 3VWBA 1DP3A 3E6CC 1TP4A 2R92J 5J8CA 2F2EA 2PG4A 2X51A 3RKWA 2MFZA 3SZPA 5HS7A 2R7RA 2OBPA 2DTRA 1BIBA 1Z91A 2P8TA 5IP9J 2VKHA 5IOYA 1XGNA 1MZBA 3HKZN 2EFQA 5L3CA 4BKXA 1I39A 4EQQA 2EH3A 4HLYA 4KICA 2XRNA 3M8EA 5FKNA 1I5ZA 3WG7H 2EZIA 4G12A 5ICFA 5LRSA 2EB7A 2X6WA 5LRRA 3CJTB 4AM3A 1DGWY 5IY5H 5FLVA 4CH7A 2Q2EA 1FX7A 2NYXA 2P4WA 4Y4RA 4HZFA 2VPRA 4KIGA 3NQOA 3R0AA 5FRMA 2VBYA 3LAJA 3JCUC 4JX4A 3JTGA 2ICWG 1YW9A 2FD5A 2JQ7A 1V3FA 1D5YA 2DPUA 2KQRA 1FJLA 1XX5A 1MBKA 1Z77A 5KAFC 2M30A 2CQXA 3KP3A 3O8GA 1H88C 2EV5A 2KRHA 4PCQA 3OSGA 4IOCF 4BDYA 3GYHX 3CO6C 3P7NA 2WC2A 4E7ZA 4KIFA 5HVQC 3OYNA 3RCOA 3CDHA 3WTXC 4ZYAA 2VOPA 2R7QA 5ILUA 3T5XA 1C0WA 4L0YB 3GTPJ 3M8JA 1L0OC 4YFNF 4AIHA 1AA7A 2HWVA 3LA3A 3RTRA 4B09A 2H09A 4Y17A 4BJ6C 3O3KA 4I0AA 1B8IB 3J81Z 3QPHA 2Y2ZA 3CCYA 1FBSA 1LE8A 3S1MJ 2OUMA 5TISC 2NS8A 5D8LB 1K61A 1W1WE 4CYCB 3PO3J 3CUOA 1JUMA 2W7NA 3AL0B 1XSDA 1FIPA 1POGA 3HGYA 3CC2I 2DLLA 4LFUA 3S2WA 1RIOH 4FE7A 3VEPA 2Z16A 1KU9A 3CP2A 1JI8A 1MBHA 2W84A 3F8FA 4L0ZB 3E97A 1Z67A 1T98A 3FMQA 3O6BB 2RKHA 2BW3A 1WVRA 4CDGA 3ABKH 5J1RA 4RBOA 2CH0A 1REPC 5EZGA 2OCEA 5HOOA 1BJAA 1V4RA 1RI7A 2KMUA 1MH3A 3K2ZA 1YX5A 2RQQA 1RR7A 1YJ9I 4YFXF 2STTA 2XF5A 2LD5A 2ID3A 3PL8A 4GCVA 2VL8A 1VQ7I 3SJMA 2H8RA 5LHGA 2TRTA 4ZDPA 2ZJRF 2JA5J 5EEAA 2LBFA 1XSVA 4QPQA 3N4MA 2PJPA 2UXXA 2DT5A 2Q0OA 4JX6A 2Y0SA 4EMSA 5C44J 4OMYA 2DQLA 2KDOA 3JSOA 1KU3A 2UV1A 3E0JB 2O03A 3IWFA 3OYFA 1WKMA 3U1KA 1WJCA 4MEXF 2E71A 5HLHA 4EGYA 2LKPA 3H9QA 3DPTA 2DAOA 3ZMSA 2VQGA 2VKDA 3BR1A 3PSFA 2COMA 3I55I 1XD7A 3KP2A 1LPQA 4A3EJ 2R7SA 3UR3C 2OPTA 3CJNA 2DDBA 4IVNA 5F08A 2DYSH 3OWTA 1YIJI 4IZZA 4NHJA 2IRFG 1IW7F 3DPUA 4J00A 1IV6A 5F0CA 4BACA 4IHXA 3MWMA 2R7TA 1U8BA 4BQQA 2VQCA 4A5MA 3TW7A 1QQIA 1X2NA 1UG2A 4O3MA 2G0EA 1ZRCA 4BQNA 3MD2A 4XIDA 2JA6J 4WF2A 2DMQA 3OIQA 1XS9A 1FWZA 3OR2C 1JKRC 3HSEA 2W4SA 3Q3SA 4LK1F 4PFOA 3K6GA 1J9IA 1G6NA 1GV2A 2ZXHA 1KQ0A 2A68F 3AL0C 5M5XJ 1SD5A 2XPVA 2EPFA 5EF6A 1ETWA 1JKOC 1F43A 4QTRA 5DS9A 1Z3YA 5CVUA 4HV6A 2L02A 1K79A 1ZGAA 2JWTA 5B1AH 5ICGA 2KLOA 2BY3A 3F6OA 2E1MB 3GFLA 1IV8A 4M74A 2P7VB 3BTCA 3F22A 1MJAA 4JP0A 3VDXA 1QZYA 4BEHB 1DP7P 3DBHB 5KCMA 4RAZA 4ZZDA 4EM1A 4NBQA 1VZ0A 5LGNA 1OR7A 3HC7A 1MNMC 4DW6A 4I02A 1F1ZA 2GQQA 2ISYA 3JW4A 4XLPF 5K7HA 3MKWB 2XAUA 5L3BA 2JRMA 2WY7Q 3CDLA 5LEKA 1BR1A 1UHMA 1EH8A 3HEFA 1QZEA 2LOOA 4W97A 1HA8A 2VN2A 4UB8C 4ZYEA 2KDZA 4XLHA 3FXLA 3JRCA 1UCRA 4XNFA 5L3EA 1X1CA 1S6LA 3QODA 1ZQ3P 4XK4A 2MH2A 3F72A 4LIUA 1Z21A 2NS7A 3BCBA 3RI4A 4IO9F 1HSTA 2E36A 2L0KA 3KP6A 1MMSA 3V7CA 4M3FA 5GP9A 2UWMA 3BDDA 4BL0B 2XPWA 5EGOA 2EA4A 5D8KB 1Z3XA 4C3JJ 2VOOA 3ZMTA 2EV6A 4QLCU 3BR2A 4IXAA 1LDKB 1TWCJ 5D4RA 5K5RA 2HTJA 2K86A 2W1OA 2Z2SB 5BPIA 3F8NA 2NVUB 2DI3A 3KEYA 3MKZA 3O8HA 3B6AA 3PJRA 4DGWB 3WTSC 1V54H 3K9TA 4LMYA 5GAHJ 2ACJA 2QA4I 4OIPF 4XRSA 3E6DA 3AG4H 4HF2A 2W85A 3IKVA 3SFIA 3J7ZI 1UHSA 3G71I 3E7LA 1WI9A 3CC7I 3HRTA 3VSLA 3SZGA 1ETQA 3KYCB 5E20A 4L9JA 3W2WA 5FB2A 1Q1HA 2DFFA 3SYTA 3EUKL 1IXCA 1R5HA 1VQOI 4YELA 3RZDJ 1JGGA 1J59A 3S8PA 3I58A 2R7WA 1AKHA 3HXLA 2FOKA 2M0CA 5CQGA 3WTUC 3OYLA 4B4CA 5IPAA 1JJ6C 3I53A 1X19A 3OIPA 3DU6A 2LC2A 4RB0A 1I1SA 5D5XB 2ZMEA 5LLQA 2F5FA 4A0XA 5E1ZB 1F36A 3OIOA 4BQOA 1I1GA 3ONQA 3RKQA 2HXOA 4YG2F 4EM2A 5LHHA 1VQ4I 1AKHB 1R4NB 3BPXA 1Z6RA 4XLEA 4HNTA 3RYPA 4UHTA 2XF7A 1OCCH 4I01A 2PJRA 2PX9A 1IUFA 1WRJA 3QQAA 1A36A 4DYQA 2DOAA 4XKWA 2DFHA 1W5CC 2OZUA 4EATA 2PI0A 1HKTA 2UUZA 2CWEA 1W36D 4M6XA 3A4CA 3LSRA 3RKXA 4HSRA 3DQVC 3QYBA 5CPRB 3K4MA 4CCMA 3PUBA 1PUFA 2NOJB 2GWRA 1OYIA 3ZQFA 1MMGA 2MG4A 1HC8A 3O2PE 2HVRA 3E5QA 3GW2A 3J81K 4LLLA 3BJOA 5E1XA 5AIPA 2V4JC 2HOAA 4V2FA 5DDGA 1VFCA 2NVTJ 2A07F 2XC7A 4FE4A 4C2MJ 2CJJA 4XBFA 3LL7A 2OQGA 1T2KA 3SFZA 2DA1A 2YU9J 4HBLA 1BW5A 1DPUA 3EYYA 3V8KA 2E60A 1SMYF 3N97A 1BI0A 3KFWX 2M8EA 1ZAOA 2YX7A 3TL4X 1W0UA 3OS0A 3BCAA 1JUSA 1BM9A 1W5TA 4M9XA 3BG7A 2CUEA 2QQ9A 3CUQB 3T1BA 3T8RA 2VKEA 3CCQI 4A3GJ 5F0FA 1MMDA 2JN6A 2KL4A 2O8KA 4MTEA 5FRNA 1DPRA 5DV5A 3G6EI 3DCFA 1UG0A 4D5FA 2NNYA 1V5GA 2KHMA 4J19A 1BIAA 2BW3B 3TEDA 1WH5A 1R1UA 1KYZA 1E3HA 3DEUA 4HNUA 1T08B 3Q9SA 2D2WA 2DT6A 5TGTA 3CMYA 3DV8A 3D5RC 2ZBKA 3ZQ7A 3F0CA 3GTKJ 3EDPA 3JREA 4D0PA 3OYMA 3KZYA 1FMWA 2BOLA 5E1WA 4CGZA 3LFUA 4F91B 2LP0A 1YLFA 4N0BA 3V7SA 1J09A 3VB2A 2OJED 4CA0A 4LG0B 2CUZA 4M9ZA 1E17A 1MBGA 2E1OA 4M3BA 2VASA 4P96A 3OY9A 2D1VA 5JHFA 1RR8C 2CRGA 1D5VA 4GYGA 1H8AC 3CZ6A 1S8NA 2IAIA 3Q0WA 5E18F 2V1NA 4GO1A 5FKMA 2CGPA 1SAUA 4RLFA 4BYYA 3JRFA 2VT3A 2IVMA 2Z3YA 1SFOJ 3CUQA 4G8XA 1T33A 1E3PA 3JRIA 2KIMA 2LSOA 2M9HA 5HDGA 3S17J 3G4SI 3NWSA 5J40A 1DU0A 4P55A 4J01A 4P9UA 4A3DJ 3DF8A 5IOZA 1XMKA 2DOEA 2V9VA 2O6GE 2K85A 3HM5A 4CUGA 1JUPA 3QPLA 2PJRB 2F5EA 3GWZA 2NVXJ 4HF1A 1WJ5A 5GADJ 1A04A 4Q4ZF 4PZJA 1SEUA 1FSHA 2DA2A 1S29A 2QQ8A 5J1UA 1LDDA 3HYIA 2DT7B 4E7HA 3WTTC 3H5NA 2L7FP 3OYBA 1ZG5A 3J7AY 4L9VA 3I4PA 1WWXA 2NS0A 1TNSA 3C2HA 4CZZA 2R7FA 5DUIA 1WJFA 2GXGA 1LJ9A 2WAQN 5ILVA 3S32A 3ASNH 2O9LA 3LA2A 4BQAA 1I6XA 2CW8A 1OJLA 4AC0A 2EZLA 3K4CA 2DQRA 3OYIA 2LH9A 4I2OA 3NRVA 3MN2A 2DTZA 4F7ZA 3CJQB 2Y9YA 4A3KJ 2E1CA 2Z33A 3K4KA 1R23A 4KA4A 4PFPA 4XRMA 1QVUA 2OAZA 3FKIJ 5C4JJ 4M6VA 1PP7U 1ZK8A 3E5XA 2FE3A 2O3FA 3K1MA 1Z7LA 4IRGA 4RMNA 3H92A 1D0ZA 1G59A 1V5FA 4U7BA 3R60A 3QRFF 4AVZA 3MKYB 2VE9A 1YS7A 5ILSA 1LKXA 1QNTA 2ESHA 3TOAA 4GDFA 4B43A 3HOVJ 4WXHA 3LA7A 3FBNB 3HTUA 4U88A 3A2KA 3FX3A 1VQMI 1I3AA 3WGGA 1S9HA 3JRAA 3RQ4A 4BY7J 2HZTA 2RNJA 2GOMA 2HYGD 4ZYDA 4HX7A 3W6JB 2EZKA 1Y1WJ 2NNNA 1AOYA 5CKTA 3CF2A 1I6HJ 3MZYA 2VBZA 2XDVA 4F3QA 3WTWC 3I4MJ 2L9NA 1XCBA 5IT3A 1XGSA 1QRYA 1FBUA 2RQPA 5HLIA 1ON2A 2V1UA 1ZRDA 2K02A 3LSGA 4XORA 2B63J 2HU9A 4CCKA 4IHYA 4RLQA 1GVDA 1IN4A 2MC4A 1X2MA 4I98B 5BS6A 2CW0F 4YIFA 4DZPA 4A12A 2FSWA 2HDCA 4GYIA 1QHHD 4Z2YA 2R5YA 2XGCA 3M9AA 5C3EJ 1R1VA 2LREA 1LDJA 2JSCA 5LGTA 2L5QA 4QWQA 3A01A 2L9SA 1A6QA 1O7LA 2GA2A 5EEGA 2ZO4A 1BR2A 1ENHA 2Y0MA 3MCZA 3OL4A 5JLWA 4JQFA 1R5ID 2X6YA 5DCMB 1PDNC 1BOBA 1OCOH 3FXUA 4PSXA 3BR3A 1FTTA 1R36A 3H35A 3G73A 3CP8A 4E7SA 3JRDA 1DQUA 1DU6A 3LSIA 2JRTA 2JSPA 2PMZN 5JHUA 1ZGJA 1ZLJA 3KPHA 2WA0A 1KA8A 3HOXJ 2EK5A 4BEHA 2Z5UA 4BHBA 4S0HB 1WJDA 1EKEA 2EIKH 4CYDA 2WY8Q 1LQ1A 3OOPA 1NHAA 1EF4A 1N77A 3KP4A 1X58A 1FIAA 3JAMK 4ANJA 4OWRB 2XIGA 5FROA 1AWCA 2GAUA 4R1HA 2VBWA 4UY8I 1S7EA 3KCCA 3LFKA 2DFEA 5IYDJ 2O8XA 3FDYA 4ESJA 3KZZA 3QP5A 3P5JA 4HF0A 5FLXK 3E6MA 2H6CA 3KZIC 4DQ2A 1FP1D 2AXTC 2OD5A 4BJ5C 2HPMA 2EFNA 3FK6A 1Y8RB 3FHZA 3REOA 1CF7A 1GVJA 4L18B 5IYBJ 1U3EM 2L4MA 1FBQA 2A61A 2KP6A 3M4OJ 4BH9A 4PGHA 2X1EA 1WJAA 2V6EA 1KGSA 5C4XJ 3RPUA 2XB0X 4NC7A 1GXQA 4WCGA 4RGRA 3M1CA 4I09A 1NK2P 3BG5A 1KQ8A 2DMTA 2HKOA 3JR9A 2OC6A 1MGTA 2ZXWH 2KIQA 3TDZC 3TO6A 3W2VA 3JSPA 2JA7J 1R49A 4UUVA 1HXDA 2TCTA 1BL0A 2Y0SN 4F52A 2DPDA 3OR1C 5BPDA 2M4KA 4DOZA 3DLAA 3WU1B 1VQ6I 4WXDA 1TL8A 3RKYA 1R5GA 3ECOA 3H5RA 3ZMVA 4HLXA 2WB1N 4K2EA 2V1XA 3GTGJ 1LUJB 3FBIB 2IXSA 3M07A 4Y3OA 3CCMI 3K70C 4ENMA 4A93J 1BW6A 4ZTJA 4UVCA 3AAFA 5JI6A 3U1DA 2CQKA 1FLIA 4U0VA 4G7OF 3WHBA 2E2JJ 2CV2A 1AHDP 3HRSA 3FMSA 1EJ9A 4BUPA 1APLC 4IHSA 1R00A 2STWA 3ZMZA 3DLLF 3EPZA 1H9GA 1JT0A 2BY1A 4C3HJ 3FXOA 2HOSA 2QLZA 2E2IJ 2LNBA 3ZQCA 2K4JA 5TRDA 4IL6C 4AUXA 3IV5A 3M7GA 1P4WA 2QSFX 3WTVC 2DFIA 1G8XA 4KISA 2LF8A 2O5RA 2W82A 1X3WB 2ZCWA 3QU3A 3DTKA 3ZN0A 2W00A 3DXJF 4P5OA 3F8MA 4PJ0C 2GIVA 2RC4A 3CCRI 2Y48A 5F27A 4C2UA 2X48A 5DD4A 2ZKZA 2R7UA 1K7AA 2EQRA 1Y0NA 2B0LA 2ZMEC 3PQKA 4XONA 3E1SA 4RA2A 4EJOA 1HW2A 1OCTC 5HS8A 2XSDC 5E3LA 2HDWA 2WADA 1JKQC 3FXMA 1Y6IA 3HUGA 1B9MA 1JGSA 2KPMA 3S15J 3HOYJ 1SFUA 5DEQA 1FY7A 2VLAA 2L7KA 4XSZF 2DO7A 1TWFJ 2Q2EB 3OS1A 1ZTRA 3HTSB 2GIZA 2IPQX 1X3UA 2ELKA 4C2TA 3TGNA 1STZA 3MZHA 3IHUA 4DBQA 4MQ9F 5M3FJ 3OOUA 2DCEA 1HKSA 2K9SA 2L2OA 2XAQA 3JTHA 5FD6A 1A6IA 3SZTA 5F04A 4CZCA 3HSFA 1XDUA 4AYBA 2F5DA 1FC3A 1W7PD 3IWZA 3RPUD 3ZQGA 4IX7A 3TW6A 3R4KA 1BI2A 5GPAA 5CVJA 3F21A 4EJWA 4B47A 1ZHFA 3S1RJ 4E7LA 2QSHX 3CO7C 4FETA 3TMOA 5BQTA 2K9NA 2XAGA 1F5TA 3MMYB 3K10A 4OIQF 2DU9A 2RAEA 4WK8F 4ITVA 4KN7X 4DYCA 4W1UA 1IJWC 1A5JA 4LJZF 2ID6A 1IUYA 3IP4B 3WU0A 4U0WA 4V2GA 3OS2A 3GTJJ 2VJJA 3ZRGA 1D1AA 1VQKI 2ZXIA 1MKMA 1FSEA 1EH7A 1RZ4A 1ETKA 2QM3A 2VC0A 1XGOA 3RIRA 3IH3A 3K4JA 4II3A 5KVRA 4XLNF 3FXKA 1JTYA 1Y56A 3DBLB 5FO5A 1D0XA 2MD5A 1PVEA 3ZMDA 4FX4A 3BQZA 1FOWA 3D5LA 3K0LA 1F9NA 1X1DA 2HQRA 2M3AA 4JOMA 2QEXI 4XLAA 2P6TA 1TNTA 2I5UA 1MDMA 1LFPA 1OQYA 3BPVA 3QWLA 3S93A 4EJUA 4MTDA 3L9FA 5E3OA 3OV8A 3U2RA 4OINF 2E5ZA 1J2XA 1SD6A 2B7EA 3GTLJ 5GTHC 3KP5A 3HIFA 2XKOA 3I9V2 2VQHA 4OU0A 5BOXA 2JT1A 4DIQA 1L3LA 5EYRA 5ED4A 3I56I 4AYBN 2P7CB 1UAAA 2Y75A 2E2HJ 3S1QJ 3R61A 4I6ZA 3HKZA 4BBSJ 2FRHA 3OYDA 3B6CA 3HSRA 2RGVA 3CCEI 4IRHA 2IA2A 2LFBA 1ZELA 3CJRB 2FX0A 2Z1DA 2OV7A 1XMAA 2PBIA 2R4GA 3HOSA 2P5KA 2W48A 3L00A 4GRIA 5LEJA 3QOPA 3ZQIA 1BJZA 2ZNYA 2UZKA 1WPKA 4UUTA 4XOTA 4DYRA 3UKGA 3M3YJ 1IGNA 2IJLA 2XGXA 4B44A 3A01B 4Y15A 4YFKF 2GZWA 2X6OA 3BR0A 2NRAC 4Y13A 1I27A 1O57A 3FXQA 2OZ6A 4QPOA 3BTLA 3I0TA 3IUOA 3RQIA 2L9RA 2FA5A 2JZYA 3A0BC 3VFZA 5GPCA 3L1PA 1VQ8I 2W57A 1UFMA 4CHUA 2HVQA 4A3BJ 1IXSB 3JRHA 4UXNA 1RC9A 2X85A 3TQNA 4QIWN 2AO9A 3CQZJ 1YX3A 3CMMA 1VTNC 1OPCA 1SFKA 1ORKA 4BJTA 4WX9A 3E3VA 1T8IA 1W7PA 2IGOA 2JPBA 3RJPA 1K6YA 2XHKA 2XAFA 5D6FA 3U21A 3L2UA 4JBAA 2KT0A 4ABZA 3TOBA 1MSFC 1SVLA 1U78A 3J80K 2LKSA 5KHDA 2HYJA 5GAEJ 4RB2C 4B1RA 4OIOF 2LVSA 2JJ7A 2QQBA 2QBYA 1W5SA 5IT9K 4ZYGA 3H0GJ 4KITB 2VXDA 2L3DA 4IJAA 3RZOJ 3A03A 2G7HA 1FNNA 3VYSB 2DYRH 4HA8A 4ZH4F 1BN5A 3P9KA 4HV5A 2OA4A 5KAIC 2JK3A 2YUSA 4IRIA 1J7KA 2RVCA 2K9LA 4A69C 2I10A 2K27A 1G3WA 4MNUA 5L3FA 2GXBA 4FISA 3COAC 2MC3A 4HOBA 3CMAI 2OTJI 2ELJA 4V19K 2GOXB 4Y7NJ 4OAZA 4M3EA 2VT2A 1U8RA 3OYKA 5JR3A 3DPLC 4XR6A 4E4HA 1T95A 2DJNA 4EVIA 1QZZA 2DA4A 4EJVA 4N9IA 3LWFA 3A02A 1O7FA 2AHQA 2H6BA 4IQ4A 1MNDA 3BLYA 4RGSA 1B72A 4PJNA 2VJIA 1XDSA 1IC8A 4UV9A 3BTIA 5E3NA 3IH4A 2XGDA 2LMDA 4Q47A 4G7ZF 3G1LA 4NNJA 5H6QA 2F4OB 1K83J 1VF9A 2FUG2 1TT5B 5J6XA 3LAPA 2P81A 2FJ1A 1U6GA 1WGXA 4DNCA 3A0HC 1FOYA 2KKOA 2R7ZJ 1MJ9A 1E2XA 5AONA 1SANA 1B59A 5F64A 5H2FC 4CCNA 5HODA 1QO0D 2QGUA 4G9YA 3CD6I 2PN6A 3C18A 3SHFA 2DXIA 1S3JA 2XVCA 1Z1DA 2ZJPF 1T56A 1D1BA 1SVMA 1IO2A 2PFBA 4U7DA 2MD0A 3LSPA 3ERMA 2ECBA 1RUNA 1SFEA 2LYCA 3HOWJ 2LY1A 1MBFA 2D5VA 1XSXA 4NC8A 2PEXA 1W7PB 4II2A 3C2BA 4HNVA 3S16J 5DM6F 2Z99A 9ANTA 1XGMA 1TWHJ 2K3FA 2OQRA 1HSJA 4MFDA 3GFIA 1ZYRF 1K78A 3GTMJ 1TW2A 2HTSA 5KNLA 4A3LJ 1HKQA 2QSGX 2ZFUA 1TQMA 4HDVA 2NXNB 1FMVA 3T0YA 3PIPF 1QPIA 2QQAA 5CQEA 3VODA 2R0QC 1YFHA 2A5WA 4AIDA 2L4AA 2JUGA 4WWCA 5DCMA 2EJRA 4KMFA 2YR2A 4RS8A 1MSEC 3K2AA 2MA3A 1WJEA 3HPGA 2WWYA 1BOAA 2A3SA 3BG6A 5HNFA 3HL2A 2A6TA 3JRBA 5J1YA 4IHWA 4S05A 1FYKA 3K4NA 3HPHA 4QSHA 4LITA 2M45A 2CV1A 3BJAA 3ASOH 4BNCA 2BXYA 2HKXA 2VBXA 2EFWA 5LD2C 2XGEA 1FZPB 2WV1A 3HG9A 3FIWA 4UUSA 4G6TB 1ZREA 1IG7A 3QPTA 4UNOA 5J8FA 3Q0VA 3L2RA 2XASA 1YG2A 2NAZA 1U9OA 4MEYF 2QKLB 3QP6A 5EG0A 3WE3A 5M3MJ 3IRRA 1CF7B 2XV4S 1G3SA 2A6EF 3CESA 3FXJA 3K7AJ 2Q1ZB 4LLNA 1YJNI 2A05A 2WBMA 2K4BA 4M6YA 4YEJA 2X6XA 1D3YA 2CFOA 2ZJQF 2H27A 2DK5A 1YRNA 1RESA 4IHVA 3EUAA 3V7RA 3DEEA 2MYSA 2M4GA 1B8IA 3HRMA 2Z9OA 1TT0A 1XPXA 3OYCA 1P4AA 2CYYA 2PMHA 4A2UA 3I3LA 1YQAA 2XUBA 3EUHC 2M7BA 5HDNA 4HQEA 2JA2A 4CCOA 4OIRF 1WJBA 3WTZA 5K5OA 1ZG1A 1VQLI 1U0JA 2M7AA 2KFDA 1CQTA 2FEZA 2DA3A 2R7DA 3LSMA 3TO9A 4BS9A 1LNWA 4E7IA 3GTQJ 3KEOA 3IH2A 4LD5A 1P4XA 3G3ZA 4L5JA 1K4SA 2R7XA 3D5SC 1GUUA 3WG9A 2H1LA 5H20A 2VJ4A 5H6RA 5IYCJ 2H1KA 1T0FC 3FK7A 3CCLI 1IRZA 4ZZLA 3UNGC 2B9SA 1P6RA 2P6SA 4ASNA 1S72I 4ESBA 1JHHA 3CLQA 3NAUA 1YI2I 2BHZA 5DUKA 2C6YA 2R5YB 3IC7A 3HRUA 4L9TA 1NG6A 2NOGA 3G1MA 2EFOA 2VE8A 1CGPA 5A2QZ 2ZXJA 3F8CA 5IT9Z 2AQFA 2PLYA 2HR3A 1WZ2A 3H3UA 1FYLA 1GDTA 1TBXA 3W3CA 2PMUA 3BP8A 4P1WA 4CCLA 2ZFWA 2PQ8A 5JFRA 1HLVA 1MD0A 2TDXA 4A3JJ 1UMQA 1OR7C 3PNYA 3DTEA 2ZJ2A 2QKMB 2WV0A 2E35A 3PFYA 1TW3A 4A0ZA 3D0SA 1G2HA 1I50J 1RETA 4I7HA 4KT5C 1K78B 3ABTA 3DTIA 4MFEA 4LB5A 1XC5A 3KLOA 2X1CA 2YS9A 2CU7A 2HDDA 2IEKA 2QVOA 2K9MA 4LIVA 1KONA 5AIQA 3H9GA 3KIOA 3HUGB 2DDAA 1MH4A 1OLTA 4EM0B 2ISZA 1JJ8C 4I0BA 3GZNB 3K4LA 3ESWB 3BT9A 2LDUA 2VPLA 2BGCA 4YIIA 1SC7A 3R6SA 3KYLA 5F0HA 2QBYB 4XKBA 5DM7F 2HZDA 1R71A 1R22A 2A69F 3L09A 3F8BA 5J4VA 2VODA 4ENNA 1QGPA 3F6VA 4C30A 1GLNA 2XROA 1TQIA 3LMMA 1HCRA 1JKPC 2ADUA 5B66C 3BWGA 2QF7A 3ZMUA 4LG0A 3L7WA 3DWLE 2GA1A 1UELB 3HGGA 3IL2A 5FKKA 2X1DA 3KX2A 2LR8A 3QAHA 1OISA 3VYRB 1E3OC 2CS3A 3LQRA 3LNQA 3BG3A 4G94A 2CQQA 3DU5A 4XRFA 1E0EA 2FMLA 1GXPA 3GF2A 4LOCA 2OU2A 1YYVA 2CW7A 2XKPA 4EJTA 2M0MA 2CV0A 2IS6A 1P9QC 2IA1A 3K1NA 4JK1X 1LEBA 5F6FA 1LE8B 2AQEA 1KU7A 2R7OA 2DMNA 3FKJA 3QOEA 5FLMJ 4KT6A 2ME6A 1MBJA 2IS2A 3TP3A 3JRGA 1B1BA 2K7LA 1QBJA 1UZCA 2EZHA 1RPWA 2MLGA 3I5UA 3M8FA 4P9FA 4A0YA 4ENJA 2BV6A 5LFAA 3PFIA 5L3DA 3BY6A 1W0TA 4F55A 3DEWA 2N8GA 4GXOA 3ZR8X 3ERED 1ZARA 2V7FA 3OYEA 2BZTA 1UJ8A 4XRSG 3KYDB 1YOVB 1H89C 5CLSA 4KDPA 2RV8A 2KJCA 3PIOF 3ZP5A 4R8HA 2FOWA 4UB6C 3BR5A 2PMZA 3HB9A 3P9IA 3GEZA 3OSFA 4Q48A 2DODA 4N4OB 3MEXA 3EETA 1RNLA 2K3PA 4AIKA 1WSUA 3GVAA 4LK0F 4FCYA 4XICA 1ZG3A 5J47A 1MNEA 4HG2A 2LRDA 4E7KA 3I59A 3A1YA 5FKLA 4EGZA 4XMYA 3WTYC 2H8WA 1R7JA 2FQ3A 1VI0A 5E8GA 5DTDA 4XKVA 4A3MJ 1HOMA 4XOPA 3RDIA 2LLKA 2VC1A 3OMYA 4LG3A 3H3ZA 3J7AO 3T8TA 3GFJA 1Z0XA 1ZRFA 3F23A 5HS9A 5FKOA 2FNAA 3LSTA 3L2WA 1BI1A 1IRFA 1NTCA 3LSKA 2DJIA 1FYMA 3ELKA 2HPIA 3OYHA 2LKXA 3C3WA 2CMPA 3F9KA 5CVRA 1X1BA 3BQYA 3QPSA 4XM3A 1GHCA 4AVPA 4E6KG 1WHUA 1PP8F 4H4KC 3BOQA 3FISA 3BTJA 2VXZA 1TWGJ 4HAMA 2E7WA 4KMUX 3W6KB 1ZGWA 3ISPA 2GXAA 1R58A 1V5EA 2FBHA 3RYRA 4FT8A 1IN5A 4HSTA 4D1QA 5M5YJ 4L9NA 1Z7UA 2EILH 3MVPA 1ETYA 2K9QA 4CCJA 3GCMA 4A5NA 3AG3H 2DN0A 2HS5A 1VQPI 4G6QA 4RB3C 4U0YA 3FMRA 3H5AA 2R5ZB 3OYAA 1U5TA 3DKXA 4KFCA 1HDDC 4CSWA 2FBIA 3QYFA 2Y9ZA 4IOAF 6PAXA 2G7UA 1YO5C 4NDLA 3ABLH 1ZH5A 1TWAJ 1P7IA 2JPCA 2GLOA 2J5OA 5CVVA 1JTXA 1WFXA 1DGRM 1H9TA 2VIXA 5KK1A 2BHYA 4BHCA 4BAYA 2HFHA 1YTYA 2G9WA 1R4MB 3KETA 1HW5A 3WHCA 1X4PA 3GTOJ 1MIJA 1OCZH 3PSIA 4ZC3A 3W2AA 3HDDA 4IKFA 3EYIA 3WODF 2V79A 2FU4A 3AG1H 4KYWA 2DA5A 2M34A 5EJCA 5LHIA 1QPMA 3AKZA 1Z6TA 3TBIA 2IGMA 4ETSA 3BG9A 4E7JA 3NWTA 4LGWA 2ZSHB 3ZPLA 2MBFA 4RDUA 4M73A 4AD9A 2A5YB 2R7VA 4NB5A 2HI3A 2HQAA 2XSJC 1FPQA 2X9DA 1IZ1A 1NG7A 2EFPA 2Y30A 4RB1A 1LFBA 2CFXA 2QYOA 3WE2A 4FQGA 1YHQI 1P7JA 4C9YA 1G3YA 2P5VA 3L2QA 4IF4A 2UXNA 2IGNA 3M1EA 4CXFA 1OCRH 2OF7A 3NEUA 4HEA2 1MDMB 2KRFA 1FOKA 1Z05A 1UB9A 3RPQA 4UVAA 2CG4A 1LB2A 3V8JA 1IRXA 4M71A 5K7ZA 2CSOA 3GBGA 1X4OA 3HHHA 3ML6A 2KZVA 3ABMH 3CLOA 2KRCA 1BC8C 2XPUA 4NQWA 4PK4A 2BXZA 1ZR4A 1T39A 3DP7A 1B6AA 3FWEA 3SEQA 3KE2A 4PJMA 4HDUA 1QVTA 3SEZA 1D8KA 2O0YA 2YSRA 3N05A 5HDKA 4S04A 3OYJA 4HX8A 3CCSI 3V4GA 3CCVI 4O6JA 1RKWA 2QUFA 5BMZA 2HOEA 4PJLA 3HOZJ 2RNGA 3VYUB 3CDIA 1XG1A 2IT0A 2M5WA 4MQVA 3VPRA 4A6EA 1N25A 1TQPA 4D9JA 4PDKA 4A3IJ 1VQ9I 2CQ7A 2JVHA 3I59B 2LTPA 2QWWA 2VI6A 3FHNA 3OL3A 5EGOB 2ECCA 1B72B 1EH6A 2LBFB 1M1EB 4RM3A 3CF5F 4L5EA 4A6DA 3K70D 4RAGA 4D5CA 3EUHA 1SD4A 2ZSIB 1K4TA 4KJZA 3ROUA 1SAXA 1O3QA 3TO7A 3DBRB 5DD8A 5EZHA 2ZMEB 3GX4X 2AS5F 1IRGA 3QU6A 1ZKGA 1V55H 4NC6A 1G4DA 2QCOA 3Q9VA 4X1EA 1OFCX 2IGKA 2BE5F 1OCPA 2DA6A 1BBYA 2XAJA 1IN6A 4ENKA 4UVBA 1DUXC 1FP2A 1T0FA 3B02A 3CC4I 1I3QJ 4ZYHA 3BZ6A 3DKWA 3PUFA 1BI3A 3I64A 1MMAA 1AU7A 3K1PA 3CCUI 2L54A 1RUOA 3H3VK 1S7OA 2DW4A 4LLGF 4DJAA 3ZCOA 1H0MA 1JT6A 4ZJZA 1UHWA 3ABUA 2V9KA 4EEFG 3U9GA 2FBKA 3ZQHA 4DZJA 5JVGF 4Y33A 4D7NA 5EEHA 4RGXA 3Q0UA 4BXXJ 1LFUP 4G7HF 1QU3A 5GAGJ 4R79A 4M3DA 3AFHA 1FOXA 2HNHA 1N78A 1N75A 1U5TC 3WGHA 3ZXSA 1PYVA 1O3RA 2Y69H 4IEJA 1T6SA 3SDGA 1J75A 3CMEI 3ZGKA 4FASD 1HW1A 5E8IA 4B48A 1TC3C 2OCCH 3LSHA 3L2CA 1IDZA 2L01A 3MAJA 3G2BA 2MABA 1P2FA 2JMWA 2EINH 2FQ4A 1R9TJ 1ETVA 1Q1VA 3FM5A 2W24A 5K5QA 4AU7A 4G6DA 5JVTA 3SQNA 4CICA 5HNHA 4BE2A 1USSA 3E5UA 3GUDA 4YRVA 1PUFB 2VQLA 1PJRA 1J0RA 5IP6A 4BY1J 1G3TA 3BR6A 3IRQA 3ECHA 1IF1A 2WAQA 2R3SA 5CYVA 1KZHA 3MZ8A 5J3LA 4CYCA 3HJEA 4XL9A 1X1AA 5ERIA 2Q8KA 2XAHA 4CO8A 1B4AA 4MHGA 3S3MA 4JYKA 4PGGA 5D4SA 5HLGA 4F92B 4PUSA 3J80Z 4UV8A 2BYVE 4FX0A 4BGDA 3CTAA 3HBLA 4HQMA 2MGQA 3CUQC 3SXYA 1MJBA 4KN4X 4WXCA 2LK2A 4IQJA 2RDPA 2HOTA 2VONA 3RSNA 5K1YA 4B3AA 4HX4A 5F1RA 5LGUA 3TP0A 4EV0A 2M1BA 1ETXA 1Y39A 1KU2A 1BC7C 1ZN2A 3IAS2 2KZGA 1WH7A 1X3ZB 3VYTB 3W6VA 2BVLA 1ODDA 2CUJA 3C2GA 5FFZA 1NK3P 2DOFA 5BNGA 2L9VA 1EA3A 3S1NJ 4NQWB 2F4MB 2VJ5A 2YU3A 4BXFA 2IA0A 3GLXA 1IN8A 4XLCA 4N9HA 4HRIA 2ZB9A 3TKYA 4BE0A 2CQNA 3BROA 2FNPA 5CVIA 3H0DA 4XKCA 1YJWI 2IP2A 3PQJA 3K69A 4Y52J 2VB6A 2IW5A 2DMPA 2XF6A 4Q5SF 4LB6B 2YX4A 2FMYA 1IDYA 2CO5A 1BR4A 4HYEA 4IPAA 1IAWA 4XN0A 3P9CA 5JLXA 1XCVA 3DFGA 2HVSA 4X0GA 2DMUA 5E79C 3GZ6A 3GLLA 4IHTA 1VNDA 5D5WB 1ITYA 2ME0A 3SDBA 4UUSB 5HLTA 4D7MA 4FHTA 5B3SH 1X1PA 1O4XA 1HQCA 1KYWA 2RREA 2XB5A 3I54A 5B5EC 1U5TB 1U9NA 5FD5A 1ULYA 5FJ8J 4FTHA 3BZCA 4OOIA 2NVYJ 4ON0A 3ZOBA 2E1MC 5FGMA 2BVMA 3MQ0A 1FEXA 2L7ZA 5EG0B 1XN7A 4E70A 4B8XA 2V26A 5DYMA 4XLFA 2XRLA 1OKRA 3HZJA 4C3IJ 2V9PA 1TZLA 5DCFA 4RAFA 1IN7A 1K6OA 2JUCA 2ETHA 2J5PA 1YITI 2P5LC 2EIMH 2BBYA 1R6RA 4RM2A 3FM3A 3PNVA 1SFXA 4N4NB 3MKLA 3ZQQA 3HOTA 2F6CA 3C1DA 1D0YA 1HBXG 2D1HA 1ACIA 1W36C 4I76A 3VOEA 2BY2A 2I8DA 3V8LA 2VUMJ 4KIBA 1HDPA 3PO2J 2COBA 4RGUA 1LVAA 3IAM2 2LG4A 2JTVA 2QENA 4XN3A 2AXLA 2D45A 1MBEA 1R1TA 3GXOA 4O5VA 5F1JA 1VQNI 2WB1A 1LEAA 4ZTFA 3J7YJ 3GZ5A 3FF5A 2MW8A 4KUMA 5GTIC 3FZVA 4B3XA 2X0LA 1JXSA 4M72A 1YE9A 1ZR2A 2RN7A 4Z6YA 5E17F 1WCMJ 4DBRA 2KJBA 1GT0C 1ONVA 2MH9A 5A2QK 4A3CJ 1EV7A 2IS1A 2V6CA 1S5LC 2ELHA 1FT9A 4KNYA 1FTZA 1KQ9A 2DA7A 1B9NA 2A6HF 2K5CA 2W25A 2GM4A 3CCJI 3LOCA 2BEOA 2EWNA 1F4KA 2FXAA 2ZNZA 1SVOA 2HEOA 4BE1A 3S2HJ 4A3FJ 2JA8J 3ZN1A 4MO7A 3ZQLA 2LY9A 2LY2A 2H94A 5ICEA 5D5UB 4NUBA 1SD7A 2L7MP
chains in the Genus database with same CATH topology
2WTEA 4OMZA 5L3GA 1XB4A 1JHFA 2YPRA 2HGCA 3MFKA 3KLNA 3EQLF 2DBBA 3IKTA 2ESNA 1D8JA 2HQNA 1O3SA 5D5VB 4HW0A 3WGIA 3KP7A 1Z9CA 4L5IA 1JE8A 4H0EA 2QZ8A 4GGGA 1WQ2A 3KEQA 3BJ6A 1OYWA 2M87A 2V1DA 3B73A 3TDUC 1PUEE 3F3XA 2X4HA 3FXRA 4BHPA 5CJ9A 3ULQB 1OYYA 3Q5FA 1SMTA 1DDNA 4ESFA 4XSXF 1J5YA 5LBQA 4BXUA 4MGRA 1T38A 1U2WA 2MLKA 2E1NA 1USTA 5FFXA 1TTYA 2O61A 1YW8A 2EV0A 3LQQA 5ICCA 3HHGA 1TLHB 1YIOA 2EA2A 1Y0UA 1OMIA 1ZLKA 5D6EA 2KIFA 1YS6A 1S7AA 3E6BA 2FF4A 3C7JA 1YW7A 3R0JA 4AWXB 1W4MA 1ON1A 3GFMA 4TV7A 3JAMZ 2KIUA 4AIJA 1P92A 4M9SA 2HYFA 4RAYA 2F5CA 2E7XA 3GO5A 3I71A 5FLXZ 2LF7A 2DK8A 5TJJA 1IXRC 3E6CC 5J8CA 2F2EA 2PG4A 3RKWA 3SZPA 5HS7A 2OBPA 2DTRA 1BIBA 1Z91A 2P8TA 1XGNA 1MZBA 2EFQA 5L3CA 4EQQA 4HLYA 4KICA 2XRNA 3M8EA 1I5ZA 5ICFA 5LRSA 2EB7A 5LRRA 2Q2EA 1FX7A 2NYXA 2P4WA 1SD7A 4HZFA 4KIGA 3NQOA 3R0AA 2VBYA 3LAJA 3JTGA 1YW9A 1V3FA 2DPUA 2M30A 3KP3A 2EV5A 4PCQA 3GYHX 3CO6C 3P7NA 2WC2A 4KIFA 5HVQC 3CDHA 3WTXC 2VOPA 5ILUA 3T5XA 1C0WA 4L0YB 1L0OC 4YFNF 4AIHA 2HWVA 3RTRA 3LA3A 4B09A 2H09A 4Y17A 3O3KA 4I0AA 3J81Z 3QPHA 1FBSA 5D8LB 3CUOA 1XSDA 2DLLA 4LFUA 3S2WA 1RIOH 3VEPA 1KU9A 2W84A 3F8FA 4L0ZB 3E97A 1T98A 3FMQA 3O6BB 2RKHA 4CDGA 1REPC 5HOOA 1BJAA 1V4RA 1RI7A 3K2ZA 4YFXF 2STTA 4GCVA 5LHGA 1XSVA 3N4MA 2PJPA 2UXXA 2DT5A 2Q0OA 4EMSA 4OMYA 2DQLA 3JSOA 1KU3A 2O03A 3IWFA 1WKMA 4MEXF 5HLHA 4EGYA 2LKPA 2DAOA 3DPTA 3ZMSA 2COMA 1XD7A 3KP2A 3CJNA 4IVNA 4NHJA 2IRFG 1IW7F 3MWMA 4A5MA 1QQIA 4O3MA 1ZRCA 4WF2A 1FWZA 3HSEA 4LK1F 1J9IA 1G6NA 1KQ0A 2A68F 1SD5A 5CVUA 4HV6A 2L02A 1K79A 1ZGAA 5ICGA 3F6OA 3GFLA 4M74A 2P7VB 3F22A 1MJAA 1QZYA 1DP7P 4RAZA 4ZZDA 4EM1A 5LGNA 1OR7A 4I02A 1F1ZA 2GQQA 2ISYA 3JW4A 4XLPF 5L3BA 5LEKA 1UHMA 1EH8A 2VN2A 4ZYEA 1UCRA 5L3EA 1S6LA 2MH2A 3F72A 3RI4A 1HSTA 3KP6A 3V7CA 2UWMA 3BDDA 2EA4A 5D8KB 2VOOA 3ZMTA 2EV6A 4QLCU 4IXAA 1LDKB 5D4RA 5K5RA 2HTJA 2K86A 5BPIA 3F8NA 2DI3A 3WTSC 3K9TA 4LMYA 2ACJA 4OIPF 3E6DA 4HF2A 2W85A 3IKVA 1WI9A 3HRTA 5FB2A 5E20A 4L9JA 1Q1HA 1IXCA 1R5HA 1J59A 3I58A 2FOKA 3WTUC 3I53A 4RB0A 1I1SA 5D5XB 2ZMEA 5LLQA 2F5FA 4A0XA 5E1ZB 1I1GA 4YG2F 4EM2A 5LHHA 3BPXA 1Z6RA 3RYPA 4UHTA 4I01A 1WRJA 2OZUA 2PI0A 1HKTA 2CWEA 4M6XA 3RKXA 3DQVC 2GWRA 1OYIA 3O2PE 3E5QA 3GW2A 3J81K 4LLLA 3BJOA 5E1XA 5AIPA 5DDGA 2A07F 4XBFA 2OQGA 1T2KA 3SFZA 4HBLA 1DPUA 3EYYA 3V8KA 1SMYF 3N97A 1BI0A 3KFWX 2M8EA 1ZAOA 2YX7A 1BM9A 1W5TA 4M9XA 3T1BA 2QQ9A 3CUQB 3T8RA 4MTEA 1DPRA 5DV5A 2NNYA 1BIAA 1R1UA 1KYZA 3DEUA 3Q9SA 2D2WA 3DV8A 2ZBKA 3ZQ7A 3EDPA 4D0PA 3KZYA 5E1WA 4CGZA 1YLFA 4N0BA 3V7SA 3VB2A 4LG0B 1E17A 4M9ZA 4P96A 2D1VA 1D5VA 4GYGA 1S8NA 5E18F 4GO1A 2CGPA 4BYYA 2VT3A 2IVMA 2Z3YA 3CUQA 4G8XA 2KIMA 2LSOA 5HDGA 4P55A 4P9UA 3DF8A 1XMKA 2V9VA 2O6GE 2F5EA 3GWZA 4HF1A 1A04A 4Q4ZF 4PZJA 1FSHA 1S29A 1LDDA 3HYIA 3WTTC 1ZG5A 4L9VA 3I4PA 1WWXA 2NS0A 1TNSA 4CZZA 2R7FA 5DUIA 2GXGA 1LJ9A 5ILVA 3LA2A 4BQAA 1I6XA 2DQRA 4I2OA 3NRVA 4F7ZA 2E1CA 2Z33A 1R23A 4KA4A 2OAZA 1PP7U 3E5XA 2FE3A 2O3FA 3K1MA 4IRGA 3H92A 4U7BA 3R60A 3QRFF 2VE9A 1YS7A 5ILSA 1QNTA 2ESHA 3TOAA 4WXHA 3LA7A 3HTUA 4U88A 3FX3A 3WGGA 2HZTA 2RNJA 2HYGD 4ZYDA 4HX7A 3W6JB 1AOYA 2NNNA 3MZYA 2VBZA 3WTWC 1XCBA 5IT3A 1XGSA 1FBUA 2RQPA 5HLIA 1ON2A 2V1UA 1ZRDA 2K02A 1IN4A 4I98B 5BS6A 2CW0F 4YIFA 4A12A 2FSWA 2HDCA 4GYIA 4Z2YA 3M9AA 1R1VA 1LDJA 2JSCA 5LGTA 4QWQA 1O7LA 2GA2A 5EEGA 2ZO4A 2Y0MA 3MCZA 4JQFA 1PDNC 5DCMB 3FXUA 1R36A 3G73A 2JRTA 5JHUA 1ZGJA 1ZLJA 1KA8A 2EK5A 4BHBA 2Z5UA 4CYDA 1LQ1A 3OOPA 1NHAA 3KP4A 3JAMK 2XIGA 1AWCA 2GAUA 4R1HA 2VBWA 3KCCA 3LFKA 2O8XA 4ESJA 3KZZA 3QP5A 4HF0A 5FLXK 3E6MA 2H6CA 4DQ2A 1FP1D 2OD5A 2EFNA 3FHZA 3REOA 1CF7A 1GVJA 4L18B 1U3EM 2L4MA 1FBQA 2A61A 4BH9A 4PGHA 1KGSA 3RPUA 1GXQA 4WCGA 4RGRA 4I09A 1KQ8A 2HKOA 1MGTA 3TDZC 3TO6A 3JSPA 4UUVA 1HXDA 2DPDA 5BPDA 3WU1B 4WXDA 3RKYA 1R5GA 3ECOA 3ZMVA 4HLXA 4K2EA 2V1XA 4ENMA 4UVCA 3AAFA 5JI6A 3U1DA 2CQKA 1FLIA 4U0VA 4G7OF 3HRSA 3FMSA 4IHSA 1R00A 2STWA 3ZMZA 1H9GA 2QLZA 2LNBA 2K4JA 5TRDA 3M7GA 1P4WA 3WTVC 2DFIA 2LF8A 2ZCWA 3QU3A 3ZN0A 3DXJF 4P5OA 3F8MA 2GIVA 2RC4A 2Y48A 5DD4A 2ZKZA 1K7AA 2B0LA 3PQKA 4EJOA 1HW2A 5HS8A 3HUGA 1B9MA 1JGSA 1SFUA 5DEQA 1FY7A 4XSZF 2DO7A 3HTSB 2IPQX 1X3UA 3TGNA 1STZA 3MZHA 3IHUA 4MQ9F 2XAQA 1HKSA 3JTHA 5FD6A 3SZTA 3HSFA 1XDUA 2F5DA 1FC3A 1W7PD 3IWZA 3R4KA 1BI2A 3F21A 5CVJA 4EJWA 1ZHFA 3CO7C 5BQTA 2XAGA 1F5TA 4OIQF 2DU9A 4WK8F 4KN7X 4LJZF 1IUYA 3WU0A 4U0WA 1MKMA 1FSEA 1EH7A 1RZ4A 2QM3A 2VC0A 1XGOA 3RIRA 5KVRA 4XLNF 5FO5A 2MD5A 3ZMDA 4FX4A 3D5LA 3K0LA 1F9NA 2HQRA 2P6TA 1TNTA 1MDMA 3BPVA 4MTDA 4EJUA 3L9FA 3OV8A 3U2RA 4OINF 1J2XA 1SD6A 3KP5A 3HIFA 2XKOA 4OU0A 5BOXA 2JT1A 1L3LA 5ED4A 2P7CB 2Y75A 3R61A 2FRHA 3HSRA 2RGVA 4IRHA 2IA2A 1XMAA 2PBIA 3HOSA 2P5KA 3L00A 5LEJA 3QOPA 2ZNYA 2UZKA 2IJLA 2XGXA 4Y15A 4YFKF 2GZWA 2NRAC 4Y13A 1I27A 1O57A 3FXQA 2OZ6A 3I0TA 2FA5A 2JZYA 3VFZA 2W57A 1UFMA 4CHUA 1IXSB 4UXNA 3TQNA 1VTNC 1OPCA 4WX9A 3E3VA 1W7PA 2JPBA 3RJPA 2XHKA 2XAFA 5D6FA 4JBAA 3TOBA 1U78A 3J80K 4OIOF 4RB2C 2QQBA 2QBYA 1W5SA 5IT9K 4ZYGA 2L3DA 4IJAA 2G7HA 1FNNA 4HA8A 4ZH4F 1BN5A 3P9KA 4HV5A 2OA4A 4IRIA 1J7KA 2RVCA 2K27A 1G3WA 4MNUA 5L3FA 2GXBA 3COAC 2MC3A 4HOBA 2VT2A 1U8RA 5JR3A 3DPLC 4EVIA 1QZZA 4EJVA 4N9IA 3LWFA 1O7FA 2H6BA 4RGSA 1XDSA 4UV9A 4Q47A 4G7ZF 5H6QA 3LAPA 5J6XA 1U6GA 4DNCA 2KKOA 1MJ9A 1E2XA 5AONA 1B59A 5F64A 1QO0D 4G9YA 2PN6A 3C18A 3SHFA 1S3JA 2XVCA 1Z1DA 4U7DA 2PFBA 1RUNA 1SFEA 1XSXA 2PEXA 1W7PB 2Z99A 1XGMA 2OQRA 1HSJA 3GFIA 1ZYRF 1K78A 1TW2A 2HTSA 1HKQA 1TQMA 4HDVA 3T0YA 2QQAA 3VODA 1YFHA 2L4AA 4WWCA 5DCMA 2EJRA 4KMFA 2YR2A 4RS8A 2MA3A 2WWYA 1BOAA 2A3SA 4S05A 1FYKA 2M45A 3BJAA 4BNCA 2HKXA 2VBXA 2EFWA 1FZPB 1ZREA 3QPTA 4UNOA 5J8FA 1YG2A 2NAZA 2XASA 4MEYF 3QP6A 3WE3A 3IRRA 1CF7B 2XV4S 1G3SA 2A6EF 4LLNA 2K4BA 4M6YA 1D3YA 2H27A 2DK5A 3V7RA 3HRMA 2Z9OA 1P4AA 2CYYA 2PMHA 4A2UA 1YQAA 2XUBA 5HDNA 4HQEA 4OIRF 3WTZA 5K5OA 1ZG1A 2FEZA 2R7DA 3TO9A 1LNWA 3KEOA 4LD5A 1P4XA 3G3ZA 4L5JA 3WG9A 5H6RA 5H20A 4ZZLA 1P6RA 2P6SA 4ASNA 4ESBA 1JHHA 5DUKA 2C6YA 3IC7A 3HRUA 4L9TA 2EFOA 2VE8A 1CGPA 5A2QZ 2ZXJA 3F8CA 5IT9Z 2PLYA 2HR3A 3H3UA 1FYLA 1TBXA 2PMUA 3BP8A 2ZFWA 2PQ8A 5JFRA 1MD0A 2TDXA 2ZJ2A 2WV0A 1TW3A 4A0ZA 3D0SA 4I7HA 4KT5C 1K78B 3ABTA 4LB5A 3KLOA 2QVOA 5AIQA 4EM0B 2ISZA 4I0BA 2LDUA 2BGCA 4YIIA 3R6SA 2QBYB 1R22A 2A69F 3L09A 3F8BA 2VODA 4ENNA 1QGPA 3F6VA 2XROA 1TQIA 2ADUA 3BWGA 3ZMUA 4LG0A 3L7WA 2GA1A 3IL2A 3QAHA 3LQRA 4G94A 4XRFA 2FMLA 1GXPA 3GF2A 2OU2A 1YYVA 2XKPA 4EJTA 2IA1A 3K1NA 4JK1X 1LEBA 1KU7A 5F6FA 1B1BA 2K7LA 1QBJA 2MLGA 3I5UA 3M8FA 4P9FA 4A0YA 4ENJA 2BV6A 3PFIA 5L3DA 3BY6A 4GXOA 3ERED 1ZARA 5CLSA 4KDPA 2RV8A 2KJCA 3ZP5A 4R8HA 3P9IA 3GEZA 4Q48A 3MEXA 3EETA 1RNLA 4AIKA 1WSUA 3GVAA 4LK0F 1ZG3A 3I59A 4EGZA 3WTYC 1R7JA 2FQ3A 5E8GA 3RDIA 2VC1A 3H3ZA 3J7AO 3T8TA 3GFJA 1ZRFA 3F23A 5HS9A 2FNAA 3LSTA 1BI1A 1IRFA 1FYMA 3ELKA 3C3WA 5CVRA 1GHCA 4AVPA 1PP8F 3BOQA 2VXZA 4HAMA 3W6KB 2E7WA 4KMUX 3ISPA 1R58A 2FBHA 3RYRA 4FT8A 1IN5A 4L9NA 1Z7UA 4A5NA 2HS5A 4G6QA 4RB3C 4U0YA 3FMRA 1U5TA 4KFCA 2FBIA 6PAXA 2G7UA 1YO5C 1ZH5A 2JPCA 2J5OA 5CVVA 1H9TA 5KK1A 4BHCA 4BAYA 2HFHA 1YTYA 2G9WA 3KETA 1HW5A 3EYIA 3WODF 2V79A 2FU4A 4KYWA 5LHIA 1QPMA 1Z6TA 4ETSA 4LGWA 3ZPLA 2MBFA 4M73A 4AD9A 2A5YB 4NB5A 1FPQA 1IZ1A 4RB1A 2EFPA 2QYOA 2CFXA 3WE2A 1G3YA 2P5VA 4IF4A 2UXNA 3M1EA 4CXFA 3NEUA 1MDMB 2KRFA 1FOKA 1Z05A 1UB9A 3RPQA 4UVAA 2CG4A 1LB2A 3V8JA 4M71A 2CSOA 3HHHA 3ML6A 3CLOA 1BC8C 4NQWA 1T39A 3DP7A 1B6AA 3FWEA 4HDUA 3KE2A 1D8KA 2O0YA 2YSRA 4S04A 5HDKA 4HX8A 3V4GA 4O6JA 2QUFA 5BMZA 2HOEA 2IT0A 2M5WA 4MQVA 4A6EA 1TQPA 4PDKA 3I59B 2QWWA 1EH6A 4A6DA 3EUHA 1SD4A 3ROUA 1SAXA 1O3QA 3TO7A 5DD8A 2AS5F 2ZMEB 3GX4X 1IRGA 3QU6A 1G4DA 3Q9VA 2BE5F 1BBYA 2XAJA 1IN6A 4ENKA 4UVBA 1DUXC 1FP2A 1T0FA 3B02A 4ZYHA 3BZ6A 3DKWA 1BI3A 3I64A 3K1PA 2L54A 1RUOA 1S7OA 2DW4A 4LLGF 1H0MA 1UHWA 3ABUA 3U9GA 2FBKA 5EEHA 4RGXA 4G7HF 4R79A 1U5TC 3WGHA 1O3RA 1T6SA 1J75A 1HW1A 5E8IA 3L2CA 2L01A 3MAJA 1P2FA 3FM5A 2W24A 5K5QA 4G6DA 5JVTA 3SQNA 4CICA 1USSA 3E5UA 3GUDA 1J0RA 1G3TA 3IRQA 3ECHA 1IF1A 2R3SA 5CYVA 5ERIA 2Q8KA 2XAHA 4CO8A 1B4AA 4MHGA 4PGGA 5D4SA 5HLGA 3J80Z 4UV8A 2BYVE 4FX0A 3CTAA 4HQMA 3CUQC 3SXYA 1MJBA 4KN4X 4WXCA 2RDPA 2VONA 5K1YA 4HX4A 5F1RA 5LGUA 4EV0A 2M1BA 1KU2A 1BC7C 1ZN2A 1ODDA 5FFZA 2YU3A 2IA0A 3GLXA 1IN8A 4N9HA 3TKYA 3BROA 2FNPA 5CVIA 2IP2A 3PQJA 3K69A 2IW5A 4Q5SF 4LB6B 2YX4A 2FMYA 2CO5A 4HYEA 4IPAA 1IAWA 3P9CA 1XCVA 3DFGA 3GZ6A 4IHTA 5D5WB 4FHTA 1HQCA 1KYWA 3I54A 1U5TB 5FD5A 1ULYA 4OOIA 4ON0A 5FGMA 3MQ0A 1XN7A 4E70A 4B8XA 5DYMA 1OKRA 5DCFA 1K6OA 1IN7A 2ETHA 2J5PA 2P5LC 2BBYA 3FM3A 1SFXA 3HOTA 3C1DA 1HBXG 2D1HA 3VOEA 3V8LA 4KIBA 4RGUA 1LVAA 2JTVA 2QENA 2AXLA 2D45A 1R1TA 3GXOA 4O5VA 1LEAA 3GZ5A 3FF5A 4KUMA 3FZVA 2X0LA 1JXSA 4M72A 2RN7A 5E17F 2KJBA 1ONVA 2MH9A 5A2QK 1EV7A 2V6CA 2ELHA 1FT9A 4KNYA 1KQ9A 1B9NA 2A6HF 2W25A 2BEOA 2EWNA 1F4KA 2FXAA 2ZNZA 2HEOA 3ZN1A 5ICEA 2H94A 5D5UB 1O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WTE A;  4OMZ A;  5L3G A;  1XB4 A;  1JHF A;  2YPR A;  2HGC A;  3MFK A;  3KLN A;  3EQL F;  2DBB A;  3IKT A;  2ESN A;  1D8J A;  2HQN A;  1O3S A;  5D5V B;  4HW0 A;  3WGI A;  3KP7 A;  1Z9C A;  4L5I A;  1JE8 A;  4H0E A;  2QZ8 A;  4GGG A;  1WQ2 A;  3KEQ A;  3BJ6 A;  1OYW A;  2M87 A;  2V1D A;  3B73 A;  3TDU C;  1PUE E;  3F3X A;  2X4H A;  3FXR A;  4BHP A;  5CJ9 A;  3ULQ B;  1OYY A;  3Q5F A;  1SMT A;  1DDN A;  4ESF A;  4XSX F;  1J5Y A;  5LBQ A;  4BXU A;  4MGR A;  1T38 A;  1U2W A;  2MLK A;  2E1N A;  1UST A;  5FFX A;  1TTY A;  2O61 A;  1YW8 A;  2EV0 A;  3LQQ A;  5ICC A;  3HHG A;  1TLH B;  1YIO A;  2EA2 A;  1Y0U A;  1OMI A;  1ZLK A;  5D6E A;  2KIF A;  1YS6 A;  1S7A A;  3E6B A;  2FF4 A;  3C7J A;  1YW7 A;  3R0J A;  4AWX B;  1W4M A;  1ON1 A;  3GFM A;  4TV7 A;  3JAM Z;  2KIU A;  4AIJ A;  1P92 A;  4M9S A;  2HYF A;  4RAY A;  2F5C A;  2E7X A;  3GO5 A;  3I71 A;  5FLX Z;  2LF7 A;  2DK8 A;  5TJJ A;  1IXR C;  3E6C C;  5J8C A;  2F2E A;  2PG4 A;  3RKW A;  3SZP A;  5HS7 A;  2OBP A;  2DTR A;  1BIB A;  1Z91 A;  2P8T A;  1XGN A;  1MZB A;  2EFQ A;  5L3C A;  4EQQ A;  4HLY A;  4KIC A;  2XRN A;  3M8E A;  1I5Z A;  5ICF A;  5LRS A;  2EB7 A;  5LRR A;  2Q2E A;  1FX7 A;  2NYX A;  2P4W A;  1SD7 A;  4HZF A;  4KIG A;  3NQO A;  3R0A A;  2VBY A;  3LAJ A;  3JTG A;  1YW9 A;  1V3F A;  2DPU A;  2M30 A;  3KP3 A;  2EV5 A;  4PCQ A;  3GYH X;  3CO6 C;  3P7N A;  2WC2 A;  4KIF A;  5HVQ C;  3CDH A;  3WTX C;  2VOP A;  5ILU A;  3T5X A;  1C0W A;  4L0Y B;  1L0O C;  4YFN F;  4AIH A;  2HWV A;  3RTR A;  3LA3 A;  4B09 A;  2H09 A;  4Y17 A;  3O3K A;  4I0A A;  3J81 Z;  3QPH A;  1FBS A;  5D8L B;  3CUO A;  1XSD A;  2DLL A;  4LFU A;  3S2W A;  1RIO H;  3VEP A;  1KU9 A;  2W84 A;  3F8F A;  4L0Z B;  3E97 A;  1T98 A;  3FMQ A;  3O6B B;  2RKH A;  4CDG A;  1REP C;  5HOO A;  1BJA A;  1V4R A;  1RI7 A;  3K2Z A;  4YFX F;  2STT A;  4GCV A;  5LHG A;  1XSV A;  3N4M A;  2PJP A;  2UXX A;  2DT5 A;  2Q0O A;  4EMS A;  4OMY A;  2DQL A;  3JSO A;  1KU3 A;  2O03 A;  3IWF A;  1WKM A;  4MEX F;  5HLH A;  4EGY A;  2LKP A;  2DAO A;  3DPT A;  3ZMS A;  2COM A;  1XD7 A;  3KP2 A;  3CJN A;  4IVN A;  4NHJ A;  2IRF G;  1IW7 F;  3MWM A;  4A5M A;  1QQI A;  4O3M A;  1ZRC A;  4WF2 A;  1FWZ A;  3HSE A;  4LK1 F;  1J9I A;  1G6N A;  1KQ0 A;  2A68 F;  1SD5 A;  5CVU A;  4HV6 A;  2L02 A;  1K79 A;  1ZGA A;  5ICG A;  3F6O A;  3GFL A;  4M74 A;  2P7V B;  3F22 A;  1MJA A;  1QZY A;  1DP7 P;  4RAZ A;  4ZZD A;  4EM1 A;  5LGN A;  1OR7 A;  4I02 A;  1F1Z A;  2GQQ A;  2ISY A;  3JW4 A;  4XLP F;  5L3B A;  5LEK A;  1UHM A;  1EH8 A;  2VN2 A;  4ZYE A;  1UCR A;  5L3E A;  1S6L A;  2MH2 A;  3F72 A;  3RI4 A;  1HST A;  3KP6 A;  3V7C A;  2UWM A;  3BDD A;  2EA4 A;  5D8K B;  2VOO A;  3ZMT A;  2EV6 A;  4QLC U;  4IXA A;  1LDK B;  5D4R A;  5K5R A;  2HTJ A;  2K86 A;  5BPI A;  3F8N A;  2DI3 A;  3WTS C;  3K9T A;  4LMY A;  2ACJ A;  4OIP F;  3E6D A;  4HF2 A;  2W85 A;  3IKV A;  1WI9 A;  3HRT A;  5FB2 A;  5E20 A;  4L9J A;  1Q1H A;  1IXC A;  1R5H A;  1J59 A;  3I58 A;  2FOK A;  3WTU C;  3I53 A;  4RB0 A;  1I1S A;  5D5X B;  2ZME A;  5LLQ A;  2F5F A;  4A0X A;  5E1Z B;  1I1G A;  4YG2 F;  4EM2 A;  5LHH A;  3BPX A;  1Z6R A;  3RYP A;  4UHT A;  4I01 A;  1WRJ A;  2OZU A;  2PI0 A;  1HKT A;  2CWE A;  4M6X A;  3RKX A;  3DQV C;  2GWR A;  1OYI A;  3O2P E;  3E5Q A;  3GW2 A;  3J81 K;  4LLL A;  3BJO A;  5E1X A;  5AIP A;  5DDG A;  2A07 F;  4XBF A;  2OQG A;  1T2K A;  3SFZ A;  4HBL A;  1DPU A;  3EYY A;  3V8K A;  1SMY F;  3N97 A;  1BI0 A;  3KFW X;  2M8E A;  1ZAO A;  2YX7 A;  1BM9 A;  1W5T A;  4M9X A;  3T1B A;  2QQ9 A;  3CUQ B;  3T8R A;  4MTE A;  1DPR A;  5DV5 A;  2NNY A;  1BIA A;  1R1U A;  1KYZ A;  3DEU A;  3Q9S A;  2D2W A;  3DV8 A;  2ZBK A;  3ZQ7 A;  3EDP A;  4D0P A;  3KZY A;  5E1W A;  4CGZ A;  1YLF A;  4N0B A;  3V7S A;  3VB2 A;  4LG0 B;  1E17 A;  4M9Z A;  4P96 A;  2D1V A;  1D5V A;  4GYG A;  1S8N A;  5E18 F;  4GO1 A;  2CGP A;  4BYY A;  2VT3 A;  2IVM A;  2Z3Y A;  3CUQ A;  4G8X A;  2KIM A;  2LSO A;  5HDG A;  4P55 A;  4P9U A;  3DF8 A;  1XMK A;  2V9V A;  2O6G E;  2F5E A;  3GWZ A;  4HF1 A;  1A04 A;  4Q4Z F;  4PZJ A;  1FSH A;  1S29 A;  1LDD A;  3HYI A;  3WTT C;  1ZG5 A;  4L9V A;  3I4P A;  1WWX A;  2NS0 A;  1TNS A;  4CZZ A;  2R7F A;  5DUI A;  2GXG A;  1LJ9 A;  5ILV A;  3LA2 A;  4BQA A;  1I6X A;  2DQR A;  4I2O A;  3NRV A;  4F7Z A;  2E1C A;  2Z33 A;  1R23 A;  4KA4 A;  2OAZ A;  1PP7 U;  3E5X A;  2FE3 A;  2O3F A;  3K1M A;  4IRG A;  3H92 A;  4U7B A;  3R60 A;  3QRF F;  2VE9 A;  1YS7 A;  5ILS A;  1QNT A;  2ESH A;  3TOA A;  4WXH A;  3LA7 A;  3HTU A;  4U88 A;  3FX3 A;  3WGG A;  2HZT A;  2RNJ A;  2HYG D;  4ZYD A;  4HX7 A;  3W6J B;  1AOY A;  2NNN A;  3MZY A;  2VBZ A;  3WTW C;  1XCB A;  5IT3 A;  1XGS A;  1FBU A;  2RQP A;  5HLI A;  1ON2 A;  2V1U A;  1ZRD A;  2K02 A;  1IN4 A;  4I98 B;  5BS6 A;  2CW0 F;  4YIF A;  4A12 A;  2FSW A;  2HDC A;  4GYI A;  4Z2Y A;  3M9A A;  1R1V A;  1LDJ A;  2JSC A;  5LGT A;  4QWQ A;  1O7L A;  2GA2 A;  5EEG A;  2ZO4 A;  2Y0M A;  3MCZ A;  4JQF A;  1PDN C;  5DCM B;  3FXU A;  1R36 A;  3G73 A;  2JRT A;  5JHU A;  1ZGJ A;  1ZLJ A;  1KA8 A;  2EK5 A;  4BHB A;  2Z5U A;  4CYD A;  1LQ1 A;  3OOP A;  1NHA A;  3KP4 A;  3JAM K;  2XIG A;  1AWC A;  2GAU A;  4R1H A;  2VBW A;  3KCC A;  3LFK A;  2O8X A;  4ESJ A;  3KZZ A;  3QP5 A;  4HF0 A;  5FLX K;  3E6M A;  2H6C A;  4DQ2 A;  1FP1 D;  2OD5 A;  2EFN A;  3FHZ A;  3REO A;  1CF7 A;  1GVJ A;  4L18 B;  1U3E M;  2L4M A;  1FBQ A;  2A61 A;  4BH9 A;  4PGH A;  1KGS A;  3RPU A;  1GXQ A;  4WCG A;  4RGR A;  4I09 A;  1KQ8 A;  2HKO A;  1MGT A;  3TDZ C;  3TO6 A;  3JSP A;  4UUV A;  1HXD A;  2DPD A;  5BPD A;  3WU1 B;  4WXD A;  3RKY A;  1R5G A;  3ECO A;  3ZMV A;  4HLX A;  4K2E A;  2V1X A;  4ENM A;  4UVC A;  3AAF A;  5JI6 A;  3U1D A;  2CQK A;  1FLI A;  4U0V A;  4G7O F;  3HRS A;  3FMS A;  4IHS A;  1R00 A;  2STW A;  3ZMZ A;  1H9G A;  2QLZ A;  2LNB A;  2K4J A;  5TRD A;  3M7G A;  1P4W A;  3WTV C;  2DFI A;  2LF8 A;  2ZCW A;  3QU3 A;  3ZN0 A;  3DXJ F;  4P5O A;  3F8M A;  2GIV A;  2RC4 A;  2Y48 A;  5DD4 A;  2ZKZ A;  1K7A A;  2B0L A;  3PQK A;  4EJO A;  1HW2 A;  5HS8 A;  3HUG A;  1B9M A;  1JGS A;  1SFU A;  5DEQ A;  1FY7 A;  4XSZ F;  2DO7 A;  3HTS B;  2IPQ X;  1X3U A;  3TGN A;  1STZ A;  3MZH A;  3IHU A;  4MQ9 F;  2XAQ A;  1HKS A;  3JTH A;  5FD6 A;  3SZT A;  3HSF A;  1XDU A;  2F5D A;  1FC3 A;  1W7P D;  3IWZ A;  3R4K A;  1BI2 A;  3F21 A;  5CVJ A;  4EJW A;  1ZHF A;  3CO7 C;  5BQT A;  2XAG A;  1F5T A;  4OIQ F;  2DU9 A;  4WK8 F;  4KN7 X;  4LJZ F;  1IUY A;  3WU0 A;  4U0W A;  1MKM A;  1FSE A;  1EH7 A;  1RZ4 A;  2QM3 A;  2VC0 A;  1XGO A;  3RIR A;  5KVR A;  4XLN F;  5FO5 A;  2MD5 A;  3ZMD A;  4FX4 A;  3D5L A;  3K0L A;  1F9N A;  2HQR A;  2P6T A;  1TNT A;  1MDM A;  3BPV A;  4MTD A;  4EJU A;  3L9F A;  3OV8 A;  3U2R A;  4OIN F;  1J2X A;  1SD6 A;  3KP5 A;  3HIF A;  2XKO A;  4OU0 A;  5BOX A;  2JT1 A;  1L3L A;  5ED4 A;  2P7C B;  2Y75 A;  3R61 A;  2FRH A;  3HSR A;  2RGV A;  4IRH A;  2IA2 A;  1XMA A;  2PBI A;  3HOS A;  2P5K A;  3L00 A;  5LEJ A;  3QOP A;  2ZNY A;  2UZK A;  2IJL A;  2XGX A;  4Y15 A;  4YFK F;  2GZW A;  2NRA C;  4Y13 A;  1I27 A;  1O57 A;  3FXQ A;  2OZ6 A;  3I0T A;  2FA5 A;  2JZY A;  3VFZ A;  2W57 A;  1UFM A;  4CHU A;  1IXS B;  4UXN A;  3TQN A;  1VTN C;  1OPC A;  4WX9 A;  3E3V A;  1W7P A;  2JPB A;  3RJP A;  2XHK A;  2XAF A;  5D6F A;  4JBA A;  3TOB A;  1U78 A;  3J80 K;  4OIO F;  4RB2 C;  2QQB A;  2QBY A;  1W5S A;  5IT9 K;  4ZYG A;  2L3D A;  4IJA A;  2G7H A;  1FNN A;  4HA8 A;  4ZH4 F;  1BN5 A;  3P9K A;  4HV5 A;  2OA4 A;  4IRI A;  1J7K A;  2RVC A;  2K27 A;  1G3W A;  4MNU A;  5L3F A;  2GXB A;  3COA C;  2MC3 A;  4HOB A;  2VT2 A;  1U8R A;  5JR3 A;  3DPL C;  4EVI A;  1QZZ A;  4EJV A;  4N9I A;  3LWF A;  1O7F A;  2H6B A;  4RGS A;  1XDS A;  4UV9 A;  4Q47 A;  4G7Z F;  5H6Q A;  3LAP A;  5J6X A;  1U6G A;  4DNC A;  2KKO A;  1MJ9 A;  1E2X A;  5AON A;  1B59 A;  5F64 A;  1QO0 D;  4G9Y A;  2PN6 A;  3C18 A;  3SHF A;  1S3J A;  2XVC A;  1Z1D A;  4U7D A;  2PFB A;  1RUN A;  1SFE A;  1XSX A;  2PEX A;  1W7P B;  2Z99 A;  1XGM A;  2OQR A;  1HSJ A;  3GFI A;  1ZYR F;  1K78 A;  1TW2 A;  2HTS A;  1HKQ A;  1TQM A;  4HDV A;  3T0Y A;  2QQA A;  3VOD A;  1YFH A;  2L4A A;  4WWC A;  5DCM A;  2EJR A;  4KMF A;  2YR2 A;  4RS8 A;  2MA3 A;  2WWY A;  1BOA A;  2A3S A;  4S05 A;  1FYK A;  2M45 A;  3BJA A;  4BNC A;  2HKX A;  2VBX A;  2EFW A;  1FZP B;  1ZRE A;  3QPT A;  4UNO A;  5J8F A;  1YG2 A;  2NAZ A;  2XAS A;  4MEY F;  3QP6 A;  3WE3 A;  3IRR A;  1CF7 B;  2XV4 S;  1G3S A;  2A6E F;  4LLN A;  2K4B A;  4M6Y A;  1D3Y A;  2H27 A;  2DK5 A;  3V7R A;  3HRM A;  2Z9O A;  1P4A A;  2CYY A;  2PMH A;  4A2U A;  1YQA A;  2XUB A;  5HDN A;  4HQE A;  4OIR F;  3WTZ A;  5K5O A;  1ZG1 A;  2FEZ A;  2R7D A;  3TO9 A;  1LNW A;  3KEO A;  4LD5 A;  1P4X A;  3G3Z A;  4L5J A;  3WG9 A;  5H6R A;  5H20 A;  4ZZL A;  1P6R A;  2P6S A;  4ASN A;  4ESB A;  1JHH A;  5DUK A;  2C6Y A;  3IC7 A;  3HRU A;  4L9T A;  2EFO A;  2VE8 A;  1CGP A;  5A2Q Z;  2ZXJ A;  3F8C A;  5IT9 Z;  2PLY A;  2HR3 A;  3H3U A;  1FYL A;  1TBX A;  2PMU A;  3BP8 A;  2ZFW A;  2PQ8 A;  5JFR A;  1MD0 A;  2TDX A;  2ZJ2 A;  2WV0 A;  1TW3 A;  4A0Z A;  3D0S A;  4I7H A;  4KT5 C;  1K78 B;  3ABT A;  4LB5 A;  3KLO A;  2QVO A;  5AIQ A;  4EM0 B;  2ISZ A;  4I0B A;  2LDU A;  2BGC A;  4YII A;  3R6S A;  2QBY B;  1R22 A;  2A69 F;  3L09 A;  3F8B A;  2VOD A;  4ENN A;  1QGP A;  3F6V A;  2XRO A;  1TQI A;  2ADU A;  3BWG A;  3ZMU A;  4LG0 A;  3L7W A;  2GA1 A;  3IL2 A;  3QAH A;  3LQR A;  4G94 A;  4XRF A;  2FML A;  1GXP A;  3GF2 A;  2OU2 A;  1YYV A;  2XKP A;  4EJT A;  2IA1 A;  3K1N A;  4JK1 X;  1LEB A;  1KU7 A;  5F6F A;  1B1B A;  2K7L A;  1QBJ A;  2MLG A;  3I5U A;  3M8F A;  4P9F A;  4A0Y A;  4ENJ A;  2BV6 A;  3PFI A;  5L3D A;  3BY6 A;  4GXO A;  3ERE D;  1ZAR A;  5CLS A;  4KDP A;  2RV8 A;  2KJC A;  3ZP5 A;  4R8H A;  3P9I A;  3GEZ A;  4Q48 A;  3MEX A;  3EET A;  1RNL A;  4AIK A;  1WSU A;  3GVA A;  4LK0 F;  1ZG3 A;  3I59 A;  4EGZ A;  3WTY C;  1R7J A;  2FQ3 A;  5E8G A;  3RDI A;  2VC1 A;  3H3Z A;  3J7A O;  3T8T A;  3GFJ A;  1ZRF A;  3F23 A;  5HS9 A;  2FNA A;  3LST A;  1BI1 A;  1IRF A;  1FYM A;  3ELK A;  3C3W A;  5CVR A;  1GHC A;  4AVP A;  1PP8 F;  3BOQ A;  2VXZ A;  4HAM A;  3W6K B;  2E7W A;  4KMU X;  3ISP A;  1R58 A;  2FBH A;  3RYR A;  4FT8 A;  1IN5 A;  4L9N A;  1Z7U A;  4A5N A;  2HS5 A;  4G6Q A;  4RB3 C;  4U0Y A;  3FMR A;  1U5T A;  4KFC A;  2FBI A;  6PAX A;  2G7U A;  1YO5 C;  1ZH5 A;  2JPC A;  2J5O A;  5CVV A;  1H9T A;  5KK1 A;  4BHC A;  4BAY A;  2HFH A;  1YTY A;  2G9W A;  3KET A;  1HW5 A;  3EYI A;  3WOD F;  2V79 A;  2FU4 A;  4KYW A;  5LHI A;  1QPM A;  1Z6T A;  4ETS A;  4LGW A;  3ZPL A;  2MBF A;  4M73 A;  4AD9 A;  2A5Y B;  4NB5 A;  1FPQ A;  1IZ1 A;  4RB1 A;  2EFP A;  2QYO A;  2CFX A;  3WE2 A;  1G3Y A;  2P5V A;  4IF4 A;  2UXN A;  3M1E A;  4CXF A;  3NEU A;  1MDM B;  2KRF A;  1FOK A;  1Z05 A;  1UB9 A;  3RPQ A;  4UVA A;  2CG4 A;  1LB2 A;  3V8J A;  4M71 A;  2CSO A;  3HHH A;  3ML6 A;  3CLO A;  1BC8 C;  4NQW A;  1T39 A;  3DP7 A;  1B6A A;  3FWE A;  4HDU A;  3KE2 A;  1D8K A;  2O0Y A;  2YSR A;  4S04 A;  5HDK A;  4HX8 A;  3V4G A;  4O6J A;  2QUF A;  5BMZ A;  2HOE A;  2IT0 A;  2M5W A;  4MQV A;  4A6E A;  1TQP A;  4PDK A;  3I59 B;  2QWW A;  1EH6 A;  4A6D A;  3EUH A;  1SD4 A;  3ROU A;  1SAX A;  1O3Q A;  3TO7 A;  5DD8 A;  2AS5 F;  2ZME B;  3GX4 X;  1IRG A;  3QU6 A;  1G4D A;  3Q9V A;  2BE5 F;  1BBY A;  2XAJ A;  1IN6 A;  4ENK A;  4UVB A;  1DUX C;  1FP2 A;  1T0F A;  3B02 A;  4ZYH A;  3BZ6 A;  3DKW A;  1BI3 A;  3I64 A;  3K1P A;  2L54 A;  1RUO A;  1S7O A;  2DW4 A;  4LLG F;  1H0M A;  1UHW A;  3ABU A;  3U9G A;  2FBK A;  5EEH A;  4RGX A;  4G7H F;  4R79 A;  1U5T C;  3WGH A;  1O3R A;  1T6S A;  1J75 A;  1HW1 A;  5E8I A;  3L2C A;  2L01 A;  3MAJ A;  1P2F A;  3FM5 A;  2W24 A;  5K5Q A;  4G6D A;  5JVT A;  3SQN A;  4CIC A;  1USS A;  3E5U A;  3GUD A;  1J0R A;  1G3T A;  3IRQ A;  3ECH A;  1IF1 A;  2R3S A;  5CYV A;  5ERI A;  2Q8K A;  2XAH A;  4CO8 A;  1B4A A;  4MHG A;  4PGG A;  5D4S A;  5HLG A;  3J80 Z;  4UV8 A;  2BYV E;  4FX0 A;  3CTA A;  4HQM A;  3CUQ C;  3SXY A;  1MJB A;  4KN4 X;  4WXC A;  2RDP A;  2VON A;  5K1Y A;  4HX4 A;  5F1R A;  5LGU A;  4EV0 A;  2M1B A;  1KU2 A;  1BC7 C;  1ZN2 A;  1ODD A;  5FFZ A;  2YU3 A;  2IA0 A;  3GLX A;  1IN8 A;  4N9H A;  3TKY A;  3BRO A;  2FNP A;  5CVI A;  2IP2 A;  3PQJ A;  3K69 A;  2IW5 A;  4Q5S F;  4LB6 B;  2YX4 A;  2FMY A;  2CO5 A;  4HYE A;  4IPA A;  1IAW A;  3P9C A;  1XCV A;  3DFG A;  3GZ6 A;  4IHT A;  5D5W B;  4FHT A;  1HQC A;  1KYW A;  3I54 A;  1U5T B;  5FD5 A;  1ULY A;  4OOI A;  4ON0 A;  5FGM A;  3MQ0 A;  1XN7 A;  4E70 A;  4B8X A;  5DYM A;  1OKR A;  5DCF A;  1K6O A;  1IN7 A;  2ETH A;  2J5P A;  2P5L C;  2BBY A;  3FM3 A;  1SFX A;  3HOT A;  3C1D A;  1HBX G;  2D1H A;  3VOE A;  3V8L A;  4KIB A;  4RGU A;  1LVA A;  2JTV A;  2QEN A;  2AXL A;  2D45 A;  1R1T A;  3GXO A;  4O5V A;  1LEA A;  3GZ5 A;  3FF5 A;  4KUM A;  3FZV A;  2X0L A;  1JXS A;  4M72 A;  2RN7 A;  5E17 F;  2KJB A;  1ONV A;  2MH9 A;  5A2Q K;  1EV7 A;  2V6C A;  2ELH A;  1FT9 A;  4KNY A;  1KQ9 A;  1B9N A;  2A6H F;  2W25 A;  2BEO A;  2EWN A;  1F4K A;  2FXA A;  2ZNZ A;  2HEO A;  3ZN1 A;  5ICE A;  2H94 A;  5D5U B;  1O3T A; 
#chains in the Genus database with same CATH topology
 5J4Y A;  3GME A;  1LVK A;  2WTE A;  3K4B A;  2F4I A;  3S14 J;  4OMZ A;  5L3G A;  3V42 A;  1XB4 A;  1JHF A;  2R93 J;  2YPR A;  2GBY A;  2HGC A;  4U87 A;  5E3M A;  5IP7 J;  3MFK A;  5K7F A;  1YRN B;  4M3G A;  3KLN A;  2NVQ J;  2K40 A;  3EQL F;  2DBB A;  3IKT A;  2ESN A;  3PNT A;  2HQN A;  1D8J A;  4GFB A;  2E5N A;  1WI3 A;  1O3S A;  3D1N I;  5D5V B;  4HW0 A;  1A35 A;  3KP7 A;  3WGI A;  2M2E A;  4BU2 A;  2HXI A;  5M5W J;  1Z9C A;  1VQ5 I;  4L5I A;  1JE8 A;  4H0E A;  3S2D J;  2CUF A;  4MIM A;  2QZ8 A;  1RKT A;  4PSW A;  4BBR J;  4GGG A;  2BY0 A;  2M8G X;  1WQ2 A;  3H1C A;  3PM1 A;  3KEQ A;  3BJ6 A;  1XMX A;  3BZK A;  1OYW A;  2VKV A;  1RRJ A;  4ZDO A;  2M87 A;  2Y31 A;  3X2Q H;  2V1D A;  1O3T A;  3B73 A;  2R5Z A;  3TDU C;  1PUE E;  4MLO A;  2EBI A;  4ZDL A;  2P0W A;  3F3X A;  2F48 A;  1Y8Q B;  2X4H A;  3H36 A;  3FXR A;  4BHP A;  4I99 C;  5CJ9 A;  3L2V A;  3ULQ B;  1OYY A;  3Q5F A;  1QHG A;  4YIR X;  1SMT A;  3OYG A;  2F5V A;  2EIJ H;  1DDN A;  1MW7 A;  3G1O A;  4ESF A;  4XSX F;  3WU2 C;  2JVG A;  3BC8 A;  1J5Y A;  5B1B H;  2ZC2 A;  2O7O A;  2IS4 A;  3QYE A;  1ERD A;  5LBQ A;  1GV5 A;  4MGR A;  4BXU A;  1T38 A;  1U2W A;  4HPQ A;  2MLK A;  3HOU J;  2E1N A;  1UST A;  1Y1V J;  1TTY A;  5FFX A;  1NH3 A;  2O61 A;  1YW8 A;  2EV0 A;  1MMN A;  2WAE A;  3LQQ A;  5ICC A;  2KIS A;  3S3O A;  3HHG A;  1TLH B;  4XQF A;  1YIO A;  3AG2 H;  2EA2 A;  4F93 B;  1A31 A;  1Y0U A;  4PJJ A;  1OMI A;  1ZLK A;  5D6E A;  3I4N J;  2E34 A;  1XTA A;  2KIF A;  3S3N A;  1YS6 A;  1QA6 A;  4X6A J;  2IBD A;  4OAY A;  1S7A A;  3E6B A;  2FF4 A;  3C7J A;  5EDN A;  1YW7 A;  3R0J A;  2OTL I;  4AWX B;  1W4M A;  1ON1 A;  3GFM A;  4TV7 A;  3JAM Z;  2KIU A;  3VSK A;  4JX5 A;  4AIJ A;  1P92 A;  1D1C A;  1BA5 A;  1ETO A;  4M9S A;  2HYF A;  1HF0 A;  4RAY A;  2E19 A;  2F5C A;  2MSY A;  2E7X A;  3DKY A;  3LSJ A;  3GO5 A;  3I71 A;  2WAF A;  5FLX Z;  2HQ5 A;  2LF7 A;  4BDZ A;  2DK8 A;  5TJJ A;  3H9J A;  3NAR A;  1IXR C;  3VWB A;  1DP3 A;  3E6C C;  1TP4 A;  2R92 J;  5J8C A;  2F2E A;  2PG4 A;  2X51 A;  3RKW A;  2MFZ A;  3SZP A;  5HS7 A;  2R7R A;  2OBP A;  2DTR A;  1BIB A;  1Z91 A;  2P8T A;  5IP9 J;  2VKH A;  5IOY A;  1XGN A;  1MZB A;  3HKZ N;  2EFQ A;  5L3C A;  4BKX A;  1I39 A;  4EQQ A;  2EH3 A;  4HLY A;  4KIC A;  2XRN A;  3M8E A;  5FKN A;  1I5Z A;  3WG7 H;  2EZI A;  4G12 A;  5ICF A;  5LRS A;  2EB7 A;  2X6W A;  5LRR A;  3CJT B;  4AM3 A;  1DGW Y;  5IY5 H;  5FLV A;  4CH7 A;  2Q2E A;  1FX7 A;  2NYX A;  2P4W A;  4Y4R A;  4HZF A;  2VPR A;  4KIG A;  3NQO A;  3R0A A;  5FRM A;  2VBY A;  3LAJ A;  3JCU C;  4JX4 A;  3JTG A;  2ICW G;  1YW9 A;  2FD5 A;  2JQ7 A;  1V3F A;  1D5Y A;  2DPU A;  2KQR A;  1FJL A;  1XX5 A;  1MBK A;  1Z77 A;  5KAF C;  2M30 A;  2CQX A;  3KP3 A;  3O8G A;  1H88 C;  2EV5 A;  2KRH A;  4PCQ A;  3OSG A;  4IOC F;  4BDY A;  3GYH X;  3CO6 C;  3P7N A;  2WC2 A;  4E7Z A;  4KIF A;  5HVQ C;  3OYN A;  3RCO A;  3CDH A;  3WTX C;  4ZYA A;  2VOP A;  2R7Q A;  5ILU A;  3T5X A;  1C0W A;  4L0Y B;  3GTP J;  3M8J A;  1L0O C;  4YFN F;  4AIH A;  1AA7 A;  2HWV A;  3LA3 A;  3RTR A;  4B09 A;  2H09 A;  4Y17 A;  4BJ6 C;  3O3K A;  4I0A A;  1B8I B;  3J81 Z;  3QPH A;  2Y2Z A;  3CCY A;  1FBS A;  1LE8 A;  3S1M J;  2OUM A;  5TIS C;  2NS8 A;  5D8L B;  1K61 A;  1W1W E;  4CYC B;  3PO3 J;  3CUO A;  1JUM A;  2W7N A;  3AL0 B;  1XSD A;  1FIP A;  1POG A;  3HGY A;  3CC2 I;  2DLL A;  4LFU A;  3S2W A;  1RIO H;  4FE7 A;  3VEP A;  2Z16 A;  1KU9 A;  3CP2 A;  1JI8 A;  1MBH A;  2W84 A;  3F8F A;  4L0Z B;  3E97 A;  1Z67 A;  1T98 A;  3FMQ A;  3O6B B;  2RKH A;  2BW3 A;  1WVR A;  4CDG A;  3ABK H;  5J1R A;  4RBO A;  2CH0 A;  1REP C;  5EZG A;  2OCE A;  5HOO A;  1BJA A;  1V4R A;  1RI7 A;  2KMU A;  1MH3 A;  3K2Z A;  1YX5 A;  2RQQ A;  1RR7 A;  1YJ9 I;  4YFX F;  2STT A;  2XF5 A;  2LD5 A;  2ID3 A;  3PL8 A;  4GCV A;  2VL8 A;  1VQ7 I;  3SJM A;  2H8R A;  5LHG A;  2TRT A;  4ZDP A;  2ZJR F;  2JA5 J;  5EEA A;  2LBF A;  1XSV A;  4QPQ A;  3N4M A;  2PJP A;  2UXX A;  2DT5 A;  2Q0O A;  4JX6 A;  2Y0S A;  4EMS A;  5C44 J;  4OMY A;  2DQL A;  2KDO A;  3JSO A;  1KU3 A;  2UV1 A;  3E0J B;  2O03 A;  3IWF A;  3OYF A;  1WKM A;  3U1K A;  1WJC A;  4MEX F;  2E71 A;  5HLH A;  4EGY A;  2LKP A;  3H9Q A;  3DPT A;  2DAO A;  3ZMS A;  2VQG A;  2VKD A;  3BR1 A;  3PSF A;  2COM A;  3I55 I;  1XD7 A;  3KP2 A;  1LPQ A;  4A3E J;  2R7S A;  3UR3 C;  2OPT A;  3CJN A;  2DDB A;  4IVN A;  5F08 A;  2DYS H;  3OWT A;  1YIJ I;  4IZZ A;  4NHJ A;  2IRF G;  1IW7 F;  3DPU A;  4J00 A;  1IV6 A;  5F0C A;  4BAC A;  4IHX A;  3MWM A;  2R7T A;  1U8B A;  4BQQ A;  2VQC A;  4A5M A;  3TW7 A;  1QQI A;  1X2N A;  1UG2 A;  4O3M A;  2G0E A;  1ZRC A;  4BQN A;  3MD2 A;  4XID A;  2JA6 J;  4WF2 A;  2DMQ A;  3OIQ A;  1XS9 A;  1FWZ A;  3OR2 C;  1JKR C;  3HSE A;  2W4S A;  3Q3S A;  4LK1 F;  4PFO A;  3K6G A;  1J9I A;  1G6N A;  1GV2 A;  2ZXH A;  1KQ0 A;  2A68 F;  3AL0 C;  5M5X J;  1SD5 A;  2XPV A;  2EPF A;  5EF6 A;  1ETW A;  1JKO C;  1F43 A;  4QTR A;  5DS9 A;  1Z3Y A;  5CVU A;  4HV6 A;  2L02 A;  1K79 A;  1ZGA A;  2JWT A;  5B1A H;  5ICG A;  2KLO A;  2BY3 A;  3F6O A;  2E1M B;  3GFL A;  1IV8 A;  4M74 A;  2P7V B;  3BTC A;  3F22 A;  1MJA A;  4JP0 A;  3VDX A;  1QZY A;  4BEH B;  1DP7 P;  3DBH B;  5KCM A;  4RAZ A;  4ZZD A;  4EM1 A;  4NBQ A;  1VZ0 A;  5LGN A;  1OR7 A;  3HC7 A;  1MNM C;  4DW6 A;  4I02 A;  1F1Z A;  2GQQ A;  2ISY A;  3JW4 A;  4XLP F;  5K7H A;  3MKW B;  2XAU A;  5L3B A;  2JRM A;  2WY7 Q;  3CDL A;  5LEK A;  1BR1 A;  1UHM A;  1EH8 A;  3HEF A;  1QZE A;  2LOO A;  4W97 A;  1HA8 A;  2VN2 A;  4UB8 C;  4ZYE A;  2KDZ A;  4XLH A;  3FXL A;  3JRC A;  1UCR A;  4XNF A;  5L3E A;  1X1C A;  1S6L A;  3QOD A;  1ZQ3 P;  4XK4 A;  2MH2 A;  3F72 A;  4LIU A;  1Z21 A;  2NS7 A;  3BCB A;  3RI4 A;  4IO9 F;  1HST A;  2E36 A;  2L0K A;  3KP6 A;  1MMS A;  3V7C A;  4M3F A;  5GP9 A;  2UWM A;  3BDD A;  4BL0 B;  2XPW A;  5EGO A;  2EA4 A;  5D8K B;  1Z3X A;  4C3J J;  2VOO A;  3ZMT A;  2EV6 A;  4QLC U;  3BR2 A;  4IXA A;  1LDK B;  1TWC J;  5D4R A;  5K5R A;  2HTJ A;  2K86 A;  2W1O A;  2Z2S B;  5BPI A;  3F8N A;  2NVU B;  2DI3 A;  3KEY A;  3MKZ A;  3O8H A;  3B6A A;  3PJR A;  4DGW B;  3WTS C;  1V54 H;  3K9T A;  4LMY A;  5GAH J;  2ACJ A;  2QA4 I;  4OIP F;  4XRS A;  3E6D A;  3AG4 H;  4HF2 A;  2W85 A;  3IKV A;  3SFI A;  3J7Z I;  1UHS A;  3G71 I;  3E7L A;  1WI9 A;  3CC7 I;  3HRT A;  3VSL A;  3SZG A;  1ETQ A;  3KYC B;  5E20 A;  4L9J A;  3W2W A;  5FB2 A;  1Q1H A;  2DFF A;  3SYT A;  3EUK L;  1IXC A;  1R5H A;  1VQO I;  4YEL A;  3RZD J;  1JGG A;  1J59 A;  3S8P A;  3I58 A;  2R7W A;  1AKH A;  3HXL A;  2FOK A;  2M0C A;  5CQG A;  3WTU C;  3OYL A;  4B4C A;  5IPA A;  1JJ6 C;  3I53 A;  1X19 A;  3OIP A;  3DU6 A;  2LC2 A;  4RB0 A;  1I1S A;  5D5X B;  2ZME A;  5LLQ A;  2F5F A;  4A0X A;  5E1Z B;  1F36 A;  3OIO A;  4BQO A;  1I1G A;  3ONQ A;  3RKQ A;  2HXO A;  4YG2 F;  4EM2 A;  5LHH A;  1VQ4 I;  1AKH B;  1R4N B;  3BPX A;  1Z6R A;  4XLE A;  4HNT A;  3RYP A;  4UHT A;  2XF7 A;  1OCC H;  4I01 A;  2PJR A;  2PX9 A;  1IUF A;  1WRJ A;  3QQA A;  1A36 A;  4DYQ A;  2DOA A;  4XKW A;  2DFH A;  1W5C C;  2OZU A;  4EAT A;  2PI0 A;  1HKT A;  2UUZ A;  2CWE A;  1W36 D;  4M6X A;  3A4C A;  3LSR A;  3RKX A;  4HSR A;  3DQV C;  3QYB A;  5CPR B;  3K4M A;  4CCM A;  3PUB A;  1PUF A;  2NOJ B;  2GWR A;  1OYI A;  3ZQF A;  1MMG A;  2MG4 A;  1HC8 A;  3O2P E;  2HVR A;  3E5Q A;  3GW2 A;  3J81 K;  4LLL A;  3BJO A;  5E1X A;  5AIP A;  2V4J C;  2HOA A;  4V2F A;  5DDG A;  1VFC A;  2NVT J;  2A07 F;  2XC7 A;  4FE4 A;  4C2M J;  2CJJ A;  4XBF A;  3LL7 A;  2OQG A;  1T2K A;  3SFZ A;  2DA1 A;  2YU9 J;  4HBL A;  1BW5 A;  1DPU A;  3EYY A;  3V8K A;  2E60 A;  1SMY F;  3N97 A;  1BI0 A;  3KFW X;  2M8E A;  1ZAO A;  2YX7 A;  3TL4 X;  1W0U A;  3OS0 A;  3BCA A;  1JUS A;  1BM9 A;  1W5T A;  4M9X A;  3BG7 A;  2CUE A;  2QQ9 A;  3CUQ B;  3T1B A;  3T8R A;  2VKE A;  3CCQ I;  4A3G J;  5F0F A;  1MMD A;  2JN6 A;  2KL4 A;  2O8K A;  4MTE A;  5FRN A;  1DPR A;  5DV5 A;  3G6E I;  3DCF A;  1UG0 A;  4D5F A;  2NNY A;  1V5G A;  2KHM A;  4J19 A;  1BIA A;  2BW3 B;  3TED A;  1WH5 A;  1R1U A;  1KYZ A;  1E3H A;  3DEU A;  4HNU A;  1T08 B;  3Q9S A;  2D2W A;  2DT6 A;  5TGT A;  3CMY A;  3DV8 A;  3D5R C;  2ZBK A;  3ZQ7 A;  3F0C A;  3GTK J;  3EDP A;  3JRE A;  4D0P A;  3OYM A;  3KZY A;  1FMW A;  2BOL A;  5E1W A;  4CGZ A;  3LFU A;  4F91 B;  2LP0 A;  1YLF A;  4N0B A;  3V7S A;  1J09 A;  3VB2 A;  2OJE D;  4CA0 A;  4LG0 B;  2CUZ A;  4M9Z A;  1E17 A;  1MBG A;  2E1O A;  4M3B A;  2VAS A;  4P96 A;  3OY9 A;  2D1V A;  5JHF A;  1RR8 C;  2CRG A;  1D5V A;  4GYG A;  1H8A C;  3CZ6 A;  1S8N A;  2IAI A;  3Q0W A;  5E18 F;  2V1N A;  4GO1 A;  5FKM A;  2CGP A;  1SAU A;  4RLF A;  4BYY A;  3JRF A;  2VT3 A;  2IVM A;  2Z3Y A;  1SFO J;  3CUQ A;  4G8X A;  1T33 A;  1E3P A;  3JRI A;  2KIM A;  2LSO A;  2M9H A;  5HDG A;  3S17 J;  3G4S I;  3NWS A;  5J40 A;  1DU0 A;  4P55 A;  4J01 A;  4P9U A;  4A3D J;  3DF8 A;  5IOZ A;  1XMK A;  2DOE A;  2V9V A;  2O6G E;  2K85 A;  3HM5 A;  4CUG A;  1JUP A;  3QPL A;  2PJR B;  2F5E A;  3GWZ A;  2NVX J;  4HF1 A;  1WJ5 A;  5GAD J;  1A04 A;  4Q4Z F;  4PZJ A;  1SEU A;  1FSH A;  2DA2 A;  1S29 A;  2QQ8 A;  5J1U A;  1LDD A;  3HYI A;  2DT7 B;  4E7H A;  3WTT C;  3H5N A;  2L7F P;  3OYB A;  1ZG5 A;  3J7A Y;  4L9V A;  3I4P A;  1WWX A;  2NS0 A;  1TNS A;  3C2H A;  4CZZ A;  2R7F A;  5DUI A;  1WJF A;  2GXG A;  1LJ9 A;  2WAQ N;  5ILV A;  3S32 A;  3ASN H;  2O9L A;  3LA2 A;  4BQA A;  1I6X A;  2CW8 A;  1OJL A;  4AC0 A;  2EZL A;  3K4C A;  2DQR A;  3OYI A;  2LH9 A;  4I2O A;  3NRV A;  3MN2 A;  2DTZ A;  4F7Z A;  3CJQ B;  2Y9Y A;  4A3K J;  2E1C A;  2Z33 A;  3K4K A;  1R23 A;  4KA4 A;  4PFP A;  4XRM A;  1QVU A;  2OAZ A;  3FKI J;  5C4J J;  4M6V A;  1PP7 U;  1ZK8 A;  3E5X A;  2FE3 A;  2O3F A;  3K1M A;  1Z7L A;  4IRG A;  4RMN A;  3H92 A;  1D0Z A;  1G59 A;  1V5F A;  4U7B A;  3R60 A;  3QRF F;  4AVZ A;  3MKY B;  2VE9 A;  1YS7 A;  5ILS A;  1LKX A;  1QNT A;  2ESH A;  3TOA A;  4GDF A;  4B43 A;  3HOV J;  4WXH A;  3LA7 A;  3FBN B;  3HTU A;  4U88 A;  3A2K A;  3FX3 A;  1VQM I;  1I3A A;  3WGG A;  1S9H A;  3JRA A;  3RQ4 A;  4BY7 J;  2HZT A;  2RNJ A;  2GOM A;  2HYG D;  4ZYD A;  4HX7 A;  3W6J B;  2EZK A;  1Y1W J;  2NNN A;  1AOY A;  5CKT A;  3CF2 A;  1I6H J;  3MZY A;  2VBZ A;  2XDV A;  4F3Q A;  3WTW C;  3I4M J;  2L9N A;  1XCB A;  5IT3 A;  1XGS A;  1QRY A;  1FBU A;  2RQP A;  5HLI A;  1ON2 A;  2V1U A;  1ZRD A;  2K02 A;  3LSG A;  4XOR A;  2B63 J;  2HU9 A;  4CCK A;  4IHY A;  4RLQ A;  1GVD A;  1IN4 A;  2MC4 A;  1X2M A;  4I98 B;  5BS6 A;  2CW0 F;  4YIF A;  4DZP A;  4A12 A;  2FSW A;  2HDC A;  4GYI A;  1QHH D;  4Z2Y A;  2R5Y A;  2XGC A;  3M9A A;  5C3E J;  1R1V A;  2LRE A;  1LDJ A;  2JSC A;  5LGT A;  2L5Q A;  4QWQ A;  3A01 A;  2L9S A;  1A6Q A;  1O7L A;  2GA2 A;  5EEG A;  2ZO4 A;  1BR2 A;  1ENH A;  2Y0M A;  3MCZ A;  3OL4 A;  5JLW A;  4JQF A;  1R5I D;  2X6Y A;  5DCM B;  1PDN C;  1BOB A;  1OCO H;  3FXU A;  4PSX A;  3BR3 A;  1FTT A;  1R36 A;  3H35 A;  3G73 A;  3CP8 A;  4E7S A;  3JRD A;  1DQU A;  1DU6 A;  3LSI A;  2JRT A;  2JSP A;  2PMZ N;  5JHU A;  1ZGJ A;  1ZLJ A;  3KPH A;  2WA0 A;  1KA8 A;  3HOX J;  2EK5 A;  4BEH A;  2Z5U A;  4BHB A;  4S0H B;  1WJD A;  1EKE A;  2EIK H;  4CYD A;  2WY8 Q;  1LQ1 A;  3OOP A;  1NHA A;  1EF4 A;  1N77 A;  3KP4 A;  1X58 A;  1FIA A;  3JAM K;  4ANJ A;  4OWR B;  2XIG A;  5FRO A;  1AWC A;  2GAU A;  4R1H A;  2VBW A;  4UY8 I;  1S7E A;  3KCC A;  3LFK A;  2DFE A;  5IYD J;  2O8X A;  3FDY A;  4ESJ A;  3KZZ A;  3QP5 A;  3P5J A;  4HF0 A;  5FLX K;  3E6M A;  2H6C A;  3KZI C;  4DQ2 A;  1FP1 D;  2AXT C;  2OD5 A;  4BJ5 C;  2HPM A;  2EFN A;  3FK6 A;  1Y8R B;  3FHZ A;  3REO A;  1CF7 A;  1GVJ A;  4L18 B;  5IYB J;  1U3E M;  2L4M A;  1FBQ A;  2A61 A;  2KP6 A;  3M4O J;  4BH9 A;  4PGH A;  2X1E A;  1WJA A;  2V6E A;  1KGS A;  5C4X J;  3RPU A;  2XB0 X;  4NC7 A;  1GXQ A;  4WCG A;  4RGR A;  3M1C A;  4I09 A;  1NK2 P;  3BG5 A;  1KQ8 A;  2DMT A;  2HKO A;  3JR9 A;  2OC6 A;  1MGT A;  2ZXW H;  2KIQ A;  3TDZ C;  3TO6 A;  3W2V A;  3JSP A;  2JA7 J;  1R49 A;  4UUV A;  1HXD A;  2TCT A;  1BL0 A;  2Y0S N;  4F52 A;  2DPD A;  3OR1 C;  5BPD A;  2M4K A;  4DOZ A;  3DLA A;  3WU1 B;  1VQ6 I;  4WXD A;  1TL8 A;  3RKY A;  1R5G A;  3ECO A;  3H5R A;  3ZMV A;  4HLX A;  2WB1 N;  4K2E A;  2V1X A;  3GTG J;  1LUJ B;  3FBI B;  2IXS A;  3M07 A;  4Y3O A;  3CCM I;  3K70 C;  4ENM A;  4A93 J;  1BW6 A;  4ZTJ A;  4UVC A;  3AAF A;  5JI6 A;  3U1D A;  2CQK A;  1FLI A;  4U0V A;  4G7O F;  3WHB A;  2E2J J;  2CV2 A;  1AHD P;  3HRS A;  3FMS A;  1EJ9 A;  4BUP A;  1APL C;  4IHS A;  1R00 A;  2STW A;  3ZMZ A;  3DLL F;  3EPZ A;  1H9G A;  1JT0 A;  2BY1 A;  4C3H J;  3FXO A;  2HOS A;  2QLZ A;  2E2I J;  2LNB A;  3ZQC A;  2K4J A;  5TRD A;  4IL6 C;  4AUX A;  3IV5 A;  3M7G A;  1P4W A;  2QSF X;  3WTV C;  2DFI A;  1G8X A;  4KIS A;  2LF8 A;  2O5R A;  2W82 A;  1X3W B;  2ZCW A;  3QU3 A;  3DTK A;  3ZN0 A;  2W00 A;  3DXJ F;  4P5O A;  3F8M A;  4PJ0 C;  2GIV A;  2RC4 A;  3CCR I;  2Y48 A;  5F27 A;  4C2U A;  2X48 A;  5DD4 A;  2ZKZ A;  2R7U A;  1K7A A;  2EQR A;  1Y0N A;  2B0L A;  2ZME C;  3PQK A;  4XON A;  3E1S A;  4RA2 A;  4EJO A;  1HW2 A;  1OCT C;  5HS8 A;  2XSD C;  5E3L A;  2HDW A;  2WAD A;  1JKQ C;  3FXM A;  1Y6I A;  3HUG A;  1B9M A;  1JGS A;  2KPM A;  3S15 J;  3HOY J;  1SFU A;  5DEQ A;  1FY7 A;  2VLA A;  2L7K A;  4XSZ F;  2DO7 A;  1TWF J;  2Q2E B;  3OS1 A;  1ZTR A;  3HTS B;  2GIZ A;  2IPQ X;  1X3U A;  2ELK A;  4C2T A;  3TGN A;  1STZ A;  3MZH A;  3IHU A;  4DBQ A;  4MQ9 F;  5M3F J;  3OOU A;  2DCE A;  1HKS A;  2K9S A;  2L2O A;  2XAQ A;  3JTH A;  5FD6 A;  1A6I A;  3SZT A;  5F04 A;  4CZC A;  3HSF A;  1XDU A;  4AYB A;  2F5D A;  1FC3 A;  1W7P D;  3IWZ A;  3RPU D;  3ZQG A;  4IX7 A;  3TW6 A;  3R4K A;  1BI2 A;  5GPA A;  5CVJ A;  3F21 A;  4EJW A;  4B47 A;  1ZHF A;  3S1R J;  4E7L A;  2QSH X;  3CO7 C;  4FET A;  3TMO A;  5BQT A;  2K9N A;  2XAG A;  1F5T A;  3MMY B;  3K10 A;  4OIQ F;  2DU9 A;  2RAE A;  4WK8 F;  4ITV A;  4KN7 X;  4DYC A;  4W1U A;  1IJW C;  1A5J A;  4LJZ F;  2ID6 A;  1IUY A;  3IP4 B;  3WU0 A;  4U0W A;  4V2G A;  3OS2 A;  3GTJ J;  2VJJ A;  3ZRG A;  1D1A A;  1VQK I;  2ZXI A;  1MKM A;  1FSE A;  1EH7 A;  1RZ4 A;  1ETK A;  2QM3 A;  2VC0 A;  1XGO A;  3RIR A;  3IH3 A;  3K4J A;  4II3 A;  5KVR A;  4XLN F;  3FXK A;  1JTY A;  1Y56 A;  3DBL B;  5FO5 A;  1D0X A;  2MD5 A;  1PVE A;  3ZMD A;  4FX4 A;  3BQZ A;  1FOW A;  3D5L A;  3K0L A;  1F9N A;  1X1D A;  2HQR A;  2M3A A;  4JOM A;  2QEX I;  4XLA A;  2P6T A;  1TNT A;  2I5U A;  1MDM A;  1LFP A;  1OQY A;  3BPV A;  3QWL A;  3S93 A;  4EJU A;  4MTD A;  3L9F A;  5E3O A;  3OV8 A;  3U2R A;  4OIN F;  2E5Z A;  1J2X A;  1SD6 A;  2B7E A;  3GTL J;  5GTH C;  3KP5 A;  3HIF A;  2XKO A;  3I9V 2;  2VQH A;  4OU0 A;  5BOX A;  2JT1 A;  4DIQ A;  1L3L A;  5EYR A;  5ED4 A;  3I56 I;  4AYB N;  2P7C B;  1UAA A;  2Y75 A;  2E2H J;  3S1Q J;  3R61 A;  4I6Z A;  3HKZ A;  4BBS J;  2FRH A;  3OYD A;  3B6C A;  3HSR A;  2RGV A;  3CCE I;  4IRH A;  2IA2 A;  2LFB A;  1ZEL A;  3CJR B;  2FX0 A;  2Z1D A;  2OV7 A;  1XMA A;  2PBI A;  2R4G A;  3HOS A;  2P5K A;  2W48 A;  3L00 A;  4GRI A;  5LEJ A;  3QOP A;  3ZQI A;  1BJZ A;  2ZNY A;  2UZK A;  1WPK A;  4UUT A;  4XOT A;  4DYR A;  3UKG A;  3M3Y J;  1IGN A;  2IJL A;  2XGX A;  4B44 A;  3A01 B;  4Y15 A;  4YFK F;  2GZW A;  2X6O A;  3BR0 A;  2NRA C;  4Y13 A;  1I27 A;  1O57 A;  3FXQ A;  2OZ6 A;  4QPO A;  3BTL A;  3I0T A;  3IUO A;  3RQI A;  2L9R A;  2FA5 A;  2JZY A;  3A0B C;  3VFZ A;  5GPC A;  3L1P A;  1VQ8 I;  2W57 A;  1UFM A;  4CHU A;  2HVQ A;  4A3B J;  1IXS B;  3JRH A;  4UXN A;  1RC9 A;  2X85 A;  3TQN A;  4QIW N;  2AO9 A;  3CQZ J;  1YX3 A;  3CMM A;  1VTN C;  1OPC A;  1SFK A;  1ORK A;  4BJT A;  4WX9 A;  3E3V A;  1T8I A;  1W7P A;  2IGO A;  2JPB A;  3RJP A;  1K6Y A;  2XHK A;  2XAF A;  5D6F A;  3U21 A;  3L2U A;  4JBA A;  2KT0 A;  4ABZ A;  3TOB A;  1MSF C;  1SVL A;  1U78 A;  3J80 K;  2LKS A;  5KHD A;  2HYJ A;  5GAE J;  4RB2 C;  4B1R A;  4OIO F;  2LVS A;  2JJ7 A;  2QQB A;  2QBY A;  1W5S A;  5IT9 K;  4ZYG A;  3H0G J;  4KIT B;  2VXD A;  2L3D A;  4IJA A;  3RZO J;  3A03 A;  2G7H A;  1FNN A;  3VYS B;  2DYR H;  4HA8 A;  4ZH4 F;  1BN5 A;  3P9K A;  4HV5 A;  2OA4 A;  5KAI C;  2JK3 A;  2YUS A;  4IRI A;  1J7K A;  2RVC A;  2K9L A;  4A69 C;  2I10 A;  2K27 A;  1G3W A;  4MNU A;  5L3F A;  2GXB A;  4FIS A;  3COA C;  2MC3 A;  4HOB A;  3CMA I;  2OTJ I;  2ELJ A;  4V19 K;  2GOX B;  4Y7N J;  4OAZ A;  4M3E A;  2VT2 A;  1U8R A;  3OYK A;  5JR3 A;  3DPL C;  4XR6 A;  4E4H A;  1T95 A;  2DJN A;  4EVI A;  1QZZ A;  2DA4 A;  4EJV A;  4N9I A;  3LWF A;  3A02 A;  1O7F A;  2AHQ A;  2H6B A;  4IQ4 A;  1MND A;  3BLY A;  4RGS A;  1B72 A;  4PJN A;  2VJI A;  1XDS A;  1IC8 A;  4UV9 A;  3BTI A;  5E3N A;  3IH4 A;  2XGD A;  2LMD A;  4Q47 A;  4G7Z F;  3G1L A;  4NNJ A;  5H6Q A;  2F4O B;  1K83 J;  1VF9 A;  2FUG 2;  1TT5 B;  5J6X A;  3LAP A;  2P81 A;  2FJ1 A;  1U6G A;  1WGX A;  4DNC A;  3A0H C;  1FOY A;  2KKO A;  2R7Z J;  1MJ9 A;  1E2X A;  5AON A;  1SAN A;  1B59 A;  5F64 A;  5H2F C;  4CCN A;  5HOD A;  1QO0 D;  2QGU A;  4G9Y A;  3CD6 I;  2PN6 A;  3C18 A;  3SHF A;  2DXI A;  1S3J A;  2XVC A;  1Z1D A;  2ZJP F;  1T56 A;  1D1B A;  1SVM A;  1IO2 A;  2PFB A;  4U7D A;  2MD0 A;  3LSP A;  3ERM A;  2ECB A;  1RUN A;  1SFE A;  2LYC A;  3HOW J;  2LY1 A;  1MBF A;  2D5V A;  1XSX A;  4NC8 A;  2PEX A;  1W7P B;  4II2 A;  3C2B A;  4HNV A;  3S16 J;  5DM6 F;  2Z99 A;  9ANT A;  1XGM A;  1TWH J;  2K3F A;  2OQR A;  1HSJ A;  4MFD A;  3GFI A;  1ZYR F;  1K78 A;  3GTM J;  1TW2 A;  2HTS A;  5KNL A;  4A3L J;  1HKQ A;  2QSG X;  2ZFU A;  1TQM A;  4HDV A;  2NXN B;  1FMV A;  3T0Y A;  3PIP F;  1QPI A;  2QQA A;  5CQE A;  3VOD A;  2R0Q C;  1YFH A;  2A5W A;  4AID A;  2L4A A;  2JUG A;  4WWC A;  5DCM A;  2EJR A;  4KMF A;  2YR2 A;  4RS8 A;  1MSE C;  3K2A A;  2MA3 A;  1WJE A;  3HPG A;  2WWY A;  1BOA A;  2A3S A;  3BG6 A;  5HNF A;  3HL2 A;  2A6T A;  3JRB A;  5J1Y A;  4IHW A;  4S05 A;  1FYK A;  3K4N A;  3HPH A;  4QSH A;  4LIT A;  2M45 A;  2CV1 A;  3BJA A;  3ASO H;  4BNC A;  2BXY A;  2HKX A;  2VBX A;  2EFW A;  5LD2 C;  2XGE A;  1FZP B;  2WV1 A;  3HG9 A;  3FIW A;  4UUS A;  4G6T B;  1ZRE A;  1IG7 A;  3QPT A;  4UNO A;  5J8F A;  3Q0V A;  3L2R A;  2XAS A;  1YG2 A;  2NAZ A;  1U9O A;  4MEY F;  2QKL B;  3QP6 A;  5EG0 A;  3WE3 A;  5M3M J;  3IRR A;  1CF7 B;  2XV4 S;  1G3S A;  2A6E F;  3CES A;  3FXJ A;  3K7A J;  2Q1Z B;  4LLN A;  1YJN I;  2A05 A;  2WBM A;  2K4B A;  4M6Y A;  4YEJ A;  2X6X A;  1D3Y A;  2CFO A;  2ZJQ F;  2H27 A;  2DK5 A;  1YRN A;  1RES A;  4IHV A;  3EUA A;  3V7R A;  3DEE A;  2MYS A;  2M4G A;  1B8I A;  3HRM A;  2Z9O A;  1TT0 A;  1XPX A;  3OYC A;  1P4A A;  2CYY A;  2PMH A;  4A2U A;  3I3L A;  1YQA A;  2XUB A;  3EUH C;  2M7B A;  5HDN A;  4HQE A;  2JA2 A;  4CCO A;  4OIR F;  1WJB A;  3WTZ A;  5K5O A;  1ZG1 A;  1VQL I;  1U0J A;  2M7A A;  2KFD A;  1CQT A;  2FEZ A;  2DA3 A;  2R7D A;  3LSM A;  3TO9 A;  4BS9 A;  1LNW A;  4E7I A;  3GTQ J;  3KEO A;  3IH2 A;  4LD5 A;  1P4X A;  3G3Z A;  4L5J A;  1K4S A;  2R7X A;  3D5S C;  1GUU A;  3WG9 A;  2H1L A;  5H20 A;  2VJ4 A;  5H6R A;  5IYC J;  2H1K A;  1T0F C;  3FK7 A;  3CCL I;  1IRZ A;  4ZZL A;  3UNG C;  2B9S A;  1P6R A;  2P6S A;  4ASN A;  1S72 I;  4ESB A;  1JHH A;  3CLQ A;  3NAU A;  1YI2 I;  2BHZ A;  5DUK A;  2C6Y A;  2R5Y B;  3IC7 A;  3HRU A;  4L9T A;  1NG6 A;  2NOG A;  3G1M A;  2EFO A;  2VE8 A;  1CGP A;  5A2Q Z;  2ZXJ A;  3F8C A;  5IT9 Z;  2AQF A;  2PLY A;  2HR3 A;  1WZ2 A;  3H3U A;  1FYL A;  1GDT A;  1TBX A;  3W3C A;  2PMU A;  3BP8 A;  4P1W A;  4CCL A;  2ZFW A;  2PQ8 A;  5JFR A;  1HLV A;  1MD0 A;  2TDX A;  4A3J J;  1UMQ A;  1OR7 C;  3PNY A;  3DTE A;  2ZJ2 A;  2QKM B;  2WV0 A;  2E35 A;  3PFY A;  1TW3 A;  4A0Z A;  3D0S A;  1G2H A;  1I50 J;  1RET A;  4I7H A;  4KT5 C;  1K78 B;  3ABT A;  3DTI A;  4MFE A;  4LB5 A;  1XC5 A;  3KLO A;  2X1C A;  2YS9 A;  2CU7 A;  2HDD A;  2IEK A;  2QVO A;  2K9M A;  4LIV A;  1KON A;  5AIQ A;  3H9G A;  3KIO A;  3HUG B;  2DDA A;  1MH4 A;  1OLT A;  4EM0 B;  2ISZ A;  1JJ8 C;  4I0B A;  3GZN B;  3K4L A;  3ESW B;  3BT9 A;  2LDU A;  2VPL A;  2BGC A;  4YII A;  1SC7 A;  3R6S A;  3KYL A;  5F0H A;  2QBY B;  4XKB A;  5DM7 F;  2HZD A;  1R71 A;  1R22 A;  2A69 F;  3L09 A;  3F8B A;  5J4V A;  2VOD A;  4ENN A;  1QGP A;  3F6V A;  4C30 A;  1GLN A;  2XRO A;  1TQI A;  3LMM A;  1HCR A;  1JKP C;  2ADU A;  5B66 C;  3BWG A;  2QF7 A;  3ZMU A;  4LG0 A;  3L7W A;  3DWL E;  2GA1 A;  1UEL B;  3HGG A;  3IL2 A;  5FKK A;  2X1D A;  3KX2 A;  2LR8 A;  3QAH A;  1OIS A;  3VYR B;  1E3O C;  2CS3 A;  3LQR A;  3LNQ A;  3BG3 A;  4G94 A;  2CQQ A;  3DU5 A;  4XRF A;  1E0E A;  2FML A;  1GXP A;  3GF2 A;  4LOC A;  2OU2 A;  1YYV A;  2CW7 A;  2XKP A;  4EJT A;  2M0M A;  2CV0 A;  2IS6 A;  1P9Q C;  2IA1 A;  3K1N A;  4JK1 X;  1LEB A;  5F6F A;  1LE8 B;  2AQE A;  1KU7 A;  2R7O A;  2DMN A;  3FKJ A;  3QOE A;  5FLM J;  4KT6 A;  2ME6 A;  1MBJ A;  2IS2 A;  3TP3 A;  3JRG A;  1B1B A;  2K7L A;  1QBJ A;  1UZC A;  2EZH A;  1RPW A;  2MLG A;  3I5U A;  3M8F A;  4P9F A;  4A0Y A;  4ENJ A;  2BV6 A;  5LFA A;  3PFI A;  5L3D A;  3BY6 A;  1W0T A;  4F55 A;  3DEW A;  2N8G A;  4GXO A;  3ZR8 X;  3ERE D;  1ZAR A;  2V7F A;  3OYE A;  2BZT A;  1UJ8 A;  4XRS G;  3KYD B;  1YOV B;  1H89 C;  5CLS A;  4KDP A;  2RV8 A;  2KJC A;  3PIO F;  3ZP5 A;  4R8H A;  2FOW A;  4UB6 C;  3BR5 A;  2PMZ A;  3HB9 A;  3P9I A;  3GEZ A;  3OSF A;  4Q48 A;  2DOD A;  4N4O B;  3MEX A;  3EET A;  1RNL A;  2K3P A;  4AIK A;  1WSU A;  3GVA A;  4LK0 F;  4FCY A;  4XIC A;  1ZG3 A;  5J47 A;  1MNE A;  4HG2 A;  2LRD A;  4E7K A;  3I59 A;  3A1Y A;  5FKL A;  4EGZ A;  4XMY A;  3WTY C;  2H8W A;  1R7J A;  2FQ3 A;  1VI0 A;  5E8G A;  5DTD A;  4XKV A;  4A3M J;  1HOM A;  4XOP A;  3RDI A;  2LLK A;  2VC1 A;  3OMY A;  4LG3 A;  3H3Z A;  3J7A O;  3T8T A;  3GFJ A;  1Z0X A;  1ZRF A;  3F23 A;  5HS9 A;  5FKO A;  2FNA A;  3LST A;  3L2W A;  1BI1 A;  1IRF A;  1NTC A;  3LSK A;  2DJI A;  1FYM A;  3ELK A;  2HPI A;  3OYH A;  2LKX A;  3C3W A;  2CMP A;  3F9K A;  5CVR A;  1X1B A;  3BQY A;  3QPS A;  4XM3 A;  1GHC A;  4AVP A;  4E6K G;  1WHU A;  1PP8 F;  4H4K C;  3BOQ A;  3FIS A;  3BTJ A;  2VXZ A;  1TWG J;  4HAM A;  2E7W A;  4KMU X;  3W6K B;  1ZGW A;  3ISP A;  2GXA A;  1R58 A;  1V5E A;  2FBH A;  3RYR A;  4FT8 A;  1IN5 A;  4HST A;  4D1Q A;  5M5Y J;  4L9N A;  1Z7U A;  2EIL H;  3MVP A;  1ETY A;  2K9Q A;  4CCJ A;  3GCM A;  4A5N A;  3AG3 H;  2DN0 A;  2HS5 A;  1VQP I;  4G6Q A;  4RB3 C;  4U0Y A;  3FMR A;  3H5A A;  2R5Z B;  3OYA A;  1U5T A;  3DKX A;  4KFC A;  1HDD C;  4CSW A;  2FBI A;  3QYF A;  2Y9Z A;  4IOA F;  6PAX A;  2G7U A;  1YO5 C;  4NDL A;  3ABL H;  1ZH5 A;  1TWA J;  1P7I A;  2JPC A;  2GLO A;  2J5O A;  5CVV A;  1JTX A;  1WFX A;  1DGR M;  1H9T A;  2VIX A;  5KK1 A;  2BHY A;  4BHC A;  4BAY A;  2HFH A;  1YTY A;  2G9W A;  1R4M B;  3KET A;  1HW5 A;  3WHC A;  1X4P A;  3GTO J;  1MIJ A;  1OCZ H;  3PSI A;  4ZC3 A;  3W2A A;  3HDD A;  4IKF A;  3EYI A;  3WOD F;  2V79 A;  2FU4 A;  3AG1 H;  4KYW A;  2DA5 A;  2M34 A;  5EJC A;  5LHI A;  1QPM A;  3AKZ A;  1Z6T A;  3TBI A;  2IGM A;  4ETS A;  3BG9 A;  4E7J A;  3NWT A;  4LGW A;  2ZSH B;  3ZPL A;  2MBF A;  4RDU A;  4M73 A;  4AD9 A;  2A5Y B;  2R7V A;  4NB5 A;  2HI3 A;  2HQA A;  2XSJ C;  1FPQ A;  2X9D A;  1IZ1 A;  1NG7 A;  2EFP A;  2Y30 A;  4RB1 A;  1LFB A;  2CFX A;  2QYO A;  3WE2 A;  4FQG A;  1YHQ I;  1P7J A;  4C9Y A;  1G3Y A;  2P5V A;  3L2Q A;  4IF4 A;  2UXN A;  2IGN A;  3M1E A;  4CXF A;  1OCR H;  2OF7 A;  3NEU A;  4HEA 2;  1MDM B;  2KRF A;  1FOK A;  1Z05 A;  1UB9 A;  3RPQ A;  4UVA A;  2CG4 A;  1LB2 A;  3V8J A;  1IRX A;  4M71 A;  5K7Z A;  2CSO A;  3GBG A;  1X4O A;  3HHH A;  3ML6 A;  2KZV A;  3ABM H;  3CLO A;  2KRC A;  1BC8 C;  2XPU A;  4NQW A;  4PK4 A;  2BXZ A;  1ZR4 A;  1T39 A;  3DP7 A;  1B6A A;  3FWE A;  3SEQ A;  3KE2 A;  4PJM A;  4HDU A;  1QVT A;  3SEZ A;  1D8K A;  2O0Y A;  2YSR A;  3N05 A;  5HDK A;  4S04 A;  3OYJ A;  4HX8 A;  3CCS I;  3V4G A;  3CCV I;  4O6J A;  1RKW A;  2QUF A;  5BMZ A;  2HOE A;  4PJL A;  3HOZ J;  2RNG A;  3VYU B;  3CDI A;  1XG1 A;  2IT0 A;  2M5W A;  4MQV A;  3VPR A;  4A6E A;  1N25 A;  1TQP A;  4D9J A;  4PDK A;  4A3I J;  1VQ9 I;  2CQ7 A;  2JVH A;  3I59 B;  2LTP A;  2QWW A;  2VI6 A;  3FHN A;  3OL3 A;  5EGO B;  2ECC A;  1B72 B;  1EH6 A;  2LBF B;  1M1E B;  4RM3 A;  3CF5 F;  4L5E A;  4A6D A;  3K70 D;  4RAG A;  4D5C A;  3EUH A;  1SD4 A;  2ZSI B;  1K4T A;  4KJZ A;  3ROU A;  1SAX A;  1O3Q A;  3TO7 A;  3DBR B;  5DD8 A;  5EZH A;  2ZME B;  3GX4 X;  2AS5 F;  1IRG A;  3QU6 A;  1ZKG A;  1V55 H;  4NC6 A;  1G4D A;  2QCO A;  3Q9V A;  4X1E A;  1OFC X;  2IGK A;  2BE5 F;  1OCP A;  2DA6 A;  1BBY A;  2XAJ A;  1IN6 A;  4ENK A;  4UVB A;  1DUX C;  1FP2 A;  1T0F A;  3B02 A;  3CC4 I;  1I3Q J;  4ZYH A;  3BZ6 A;  3DKW A;  3PUF A;  1BI3 A;  3I64 A;  1MMA A;  1AU7 A;  3K1P A;  3CCU I;  2L54 A;  1RUO A;  3H3V K;  1S7O A;  2DW4 A;  4LLG F;  4DJA A;  3ZCO A;  1H0M A;  1JT6 A;  4ZJZ A;  1UHW A;  3ABU A;  2V9K A;  4EEF G;  3U9G A;  2FBK A;  3ZQH A;  4DZJ A;  5JVG F;  4Y33 A;  4D7N A;  5EEH A;  4RGX A;  3Q0U A;  4BXX J;  1LFU P;  4G7H F;  1QU3 A;  5GAG J;  4R79 A;  4M3D A;  3AFH A;  1FOX A;  2HNH A;  1N78 A;  1N75 A;  1U5T C;  3WGH A;  3ZXS A;  1PYV A;  1O3R A;  2Y69 H;  4IEJ A;  1T6S A;  3SDG A;  1J75 A;  3CME I;  3ZGK A;  4FAS D;  1HW1 A;  5E8I A;  4B48 A;  1TC3 C;  2OCC H;  3LSH A;  3L2C A;  1IDZ A;  2L01 A;  3MAJ A;  3G2B A;  2MAB A;  1P2F A;  2JMW A;  2EIN H;  2FQ4 A;  1R9T J;  1ETV A;  1Q1V A;  3FM5 A;  2W24 A;  5K5Q A;  4AU7 A;  4G6D A;  5JVT A;  3SQN A;  4CIC A;  5HNH A;  4BE2 A;  1USS A;  3E5U A;  3GUD A;  4YRV A;  1PUF B;  2VQL A;  1PJR A;  1J0R A;  5IP6 A;  4BY1 J;  1G3T A;  3BR6 A;  3IRQ A;  3ECH A;  1IF1 A;  2WAQ A;  2R3S A;  5CYV A;  1KZH A;  3MZ8 A;  5J3L A;  4CYC A;  3HJE A;  4XL9 A;  1X1A A;  5ERI A;  2Q8K A;  2XAH A;  4CO8 A;  1B4A A;  4MHG A;  3S3M A;  4JYK A;  4PGG A;  5D4S A;  5HLG A;  4F92 B;  4PUS A;  3J80 Z;  4UV8 A;  2BYV E;  4FX0 A;  4BGD A;  3CTA A;  3HBL A;  4HQM A;  2MGQ A;  3CUQ C;  3SXY A;  1MJB A;  4KN4 X;  4WXC A;  2LK2 A;  4IQJ A;  2RDP A;  2HOT A;  2VON A;  3RSN A;  5K1Y A;  4B3A A;  4HX4 A;  5F1R A;  5LGU A;  3TP0 A;  4EV0 A;  2M1B A;  1ETX A;  1Y39 A;  1KU2 A;  1BC7 C;  1ZN2 A;  3IAS 2;  2KZG A;  1WH7 A;  1X3Z B;  3VYT B;  3W6V A;  2BVL A;  1ODD A;  2CUJ A;  3C2G A;  5FFZ A;  1NK3 P;  2DOF A;  5BNG A;  2L9V A;  1EA3 A;  3S1N J;  4NQW B;  2F4M B;  2VJ5 A;  2YU3 A;  4BXF A;  2IA0 A;  3GLX A;  1IN8 A;  4XLC A;  4N9H A;  4HRI A;  2ZB9 A;  3TKY A;  4BE0 A;  2CQN A;  3BRO A;  2FNP A;  5CVI A;  3H0D A;  4XKC A;  1YJW I;  2IP2 A;  3PQJ A;  3K69 A;  4Y52 J;  2VB6 A;  2IW5 A;  2DMP A;  2XF6 A;  4Q5S F;  4LB6 B;  2YX4 A;  2FMY A;  1IDY A;  2CO5 A;  1BR4 A;  4HYE A;  4IPA A;  1IAW A;  4XN0 A;  3P9C A;  5JLX A;  1XCV A;  3DFG A;  2HVS A;  4X0G A;  2DMU A;  5E79 C;  3GZ6 A;  3GLL A;  4IHT A;  1VND A;  5D5W B;  1ITY A;  2ME0 A;  3SDB A;  4UUS B;  5HLT A;  4D7M A;  4FHT A;  5B3S H;  1X1P A;  1O4X A;  1HQC A;  1KYW A;  2RRE A;  2XB5 A;  3I54 A;  5B5E C;  1U5T B;  1U9N A;  5FD5 A;  1ULY A;  5FJ8 J;  4FTH A;  3BZC A;  4OOI A;  2NVY J;  4ON0 A;  3ZOB A;  2E1M C;  5FGM A;  2BVM A;  3MQ0 A;  1FEX A;  2L7Z A;  5EG0 B;  1XN7 A;  4E70 A;  4B8X A;  2V26 A;  5DYM A;  4XLF A;  2XRL A;  1OKR A;  3HZJ A;  4C3I J;  2V9P A;  1TZL A;  5DCF A;  4RAF A;  1IN7 A;  1K6O A;  2JUC A;  2ETH A;  2J5P A;  1YIT I;  2P5L C;  2EIM H;  2BBY A;  1R6R A;  4RM2 A;  3FM3 A;  3PNV A;  1SFX A;  4N4N B;  3MKL A;  3ZQQ A;  3HOT A;  2F6C A;  3C1D A;  1D0Y A;  1HBX G;  2D1H A;  1ACI A;  1W36 C;  4I76 A;  3VOE A;  2BY2 A;  2I8D A;  3V8L A;  2VUM J;  4KIB A;  1HDP A;  3PO2 J;  2COB A;  4RGU A;  1LVA A;  3IAM 2;  2LG4 A;  2JTV A;  2QEN A;  4XN3 A;  2AXL A;  2D45 A;  1MBE A;  1R1T A;  3GXO A;  4O5V A;  5F1J A;  1VQN I;  2WB1 A;  1LEA A;  4ZTF A;  3J7Y J;  3GZ5 A;  3FF5 A;  2MW8 A;  4KUM A;  5GTI C;  3FZV A;  4B3X A;  2X0L A;  1JXS A;  4M72 A;  1YE9 A;  1ZR2 A;  2RN7 A;  4Z6Y A;  5E17 F;  1WCM J;  4DBR A;  2KJB A;  1GT0 C;  1ONV A;  2MH9 A;  5A2Q K;  4A3C J;  1EV7 A;  2IS1 A;  2V6C A;  1S5L C;  2ELH A;  1FT9 A;  4KNY A;  1FTZ A;  1KQ9 A;  2DA7 A;  1B9N A;  2A6H F;  2K5C A;  2W25 A;  2GM4 A;  3CCJ I;  3LOC A;  2BEO A;  2EWN A;  1F4K A;  2FXA A;  2ZNZ A;  1SVO A;  2HEO A;  4BE1 A;  3S2H J;  4A3F J;  2JA8 J;  3ZN1 A;  4MO7 A;  3ZQL A;  2LY9 A;  2LY2 A;  2H94 A;  5ICE A;  5D5U B;  4NUB A;  1SD7 A;  2L7M P; 
#chains in the Genus database with same CATH homology
 2WTE A;  4OMZ A;  5L3G A;  1XB4 A;  1JHF A;  2YPR A;  2HGC A;  3MFK A;  3KLN A;  3EQL F;  2DBB A;  3IKT A;  2ESN A;  1D8J A;  2HQN A;  1O3S A;  5D5V B;  4HW0 A;  3WGI A;  3KP7 A;  1Z9C A;  4L5I A;  1JE8 A;  4H0E A;  2QZ8 A;  4GGG A;  1WQ2 A;  3KEQ A;  3BJ6 A;  1OYW A;  2M87 A;  2V1D A;  3B73 A;  3TDU C;  1PUE E;  3F3X A;  2X4H A;  3FXR A;  4BHP A;  5CJ9 A;  3ULQ B;  1OYY A;  3Q5F A;  1SMT A;  1DDN A;  4ESF A;  4XSX F;  1J5Y A;  5LBQ A;  4BXU A;  4MGR A;  1T38 A;  1U2W A;  2MLK A;  2E1N A;  1UST A;  5FFX A;  1TTY A;  2O61 A;  1YW8 A;  2EV0 A;  3LQQ A;  5ICC A;  3HHG A;  1TLH B;  1YIO A;  2EA2 A;  1Y0U A;  1OMI A;  1ZLK A;  5D6E A;  2KIF A;  1YS6 A;  1S7A A;  3E6B A;  2FF4 A;  3C7J A;  1YW7 A;  3R0J A;  4AWX B;  1W4M A;  1ON1 A;  3GFM A;  4TV7 A;  3JAM Z;  2KIU A;  4AIJ A;  1P92 A;  4M9S A;  2HYF A;  4RAY A;  2F5C A;  2E7X A;  3GO5 A;  3I71 A;  5FLX Z;  2LF7 A;  2DK8 A;  5TJJ A;  1IXR C;  3E6C C;  5J8C A;  2F2E A;  2PG4 A;  3RKW A;  3SZP A;  5HS7 A;  2OBP A;  2DTR A;  1BIB A;  1Z91 A;  2P8T A;  1XGN A;  1MZB A;  2EFQ A;  5L3C A;  4EQQ A;  4HLY A;  4KIC A;  2XRN A;  3M8E A;  1I5Z A;  5ICF A;  5LRS A;  2EB7 A;  5LRR A;  2Q2E A;  1FX7 A;  2NYX A;  2P4W A;  1SD7 A;  4HZF A;  4KIG A;  3NQO A;  3R0A A;  2VBY A;  3LAJ A;  3JTG A;  1YW9 A;  1V3F A;  2DPU A;  2M30 A;  3KP3 A;  2EV5 A;  4PCQ A;  3GYH X;  3CO6 C;  3P7N A;  2WC2 A;  4KIF A;  5HVQ C;  3CDH A;  3WTX C;  2VOP A;  5ILU A;  3T5X A;  1C0W A;  4L0Y B;  1L0O C;  4YFN F;  4AIH A;  2HWV A;  3RTR A;  3LA3 A;  4B09 A;  2H09 A;  4Y17 A;  3O3K A;  4I0A A;  3J81 Z;  3QPH A;  1FBS A;  5D8L B;  3CUO A;  1XSD A;  2DLL A;  4LFU A;  3S2W A;  1RIO H;  3VEP A;  1KU9 A;  2W84 A;  3F8F A;  4L0Z B;  3E97 A;  1T98 A;  3FMQ A;  3O6B B;  2RKH A;  4CDG A;  1REP C;  5HOO A;  1BJA A;  1V4R A;  1RI7 A;  3K2Z A;  4YFX F;  2STT A;  4GCV A;  5LHG A;  1XSV A;  3N4M A;  2PJP A;  2UXX A;  2DT5 A;  2Q0O A;  4EMS A;  4OMY A;  2DQL A;  3JSO A;  1KU3 A;  2O03 A;  3IWF A;  1WKM A;  4MEX F;  5HLH A;  4EGY A;  2LKP A;  2DAO A;  3DPT A;  3ZMS A;  2COM A;  1XD7 A;  3KP2 A;  3CJN A;  4IVN A;  4NHJ A;  2IRF G;  1IW7 F;  3MWM A;  4A5M A;  1QQI A;  4O3M A;  1ZRC A;  4WF2 A;  1FWZ A;  3HSE A;  4LK1 F;  1J9I A;  1G6N A;  1KQ0 A;  2A68 F;  1SD5 A;  5CVU A;  4HV6 A;  2L02 A;  1K79 A;  1ZGA A;  5ICG A;  3F6O A;  3GFL A;  4M74 A;  2P7V B;  3F22 A;  1MJA A;  1QZY A;  1DP7 P;  4RAZ A;  4ZZD A;  4EM1 A;  5LGN A;  1OR7 A;  4I02 A;  1F1Z A;  2GQQ A;  2ISY A;  3JW4 A;  4XLP F;  5L3B A;  5LEK A;  1UHM A;  1EH8 A;  2VN2 A;  4ZYE A;  1UCR A;  5L3E A;  1S6L A;  2MH2 A;  3F72 A;  3RI4 A;  1HST A;  3KP6 A;  3V7C A;  2UWM A;  3BDD A;  2EA4 A;  5D8K B;  2VOO A;  3ZMT A;  2EV6 A;  4QLC U;  4IXA A;  1LDK B;  5D4R A;  5K5R A;  2HTJ A;  2K86 A;  5BPI A;  3F8N A;  2DI3 A;  3WTS C;  3K9T A;  4LMY A;  2ACJ A;  4OIP F;  3E6D A;  4HF2 A;  2W85 A;  3IKV A;  1WI9 A;  3HRT A;  5FB2 A;  5E20 A;  4L9J A;  1Q1H A;  1IXC A;  1R5H A;  1J59 A;  3I58 A;  2FOK A;  3WTU C;  3I53 A;  4RB0 A;  1I1S A;  5D5X B;  2ZME A;  5LLQ A;  2F5F A;  4A0X A;  5E1Z B;  1I1G A;  4YG2 F;  4EM2 A;  5LHH A;  3BPX A;  1Z6R A;  3RYP A;  4UHT A;  4I01 A;  1WRJ A;  2OZU A;  2PI0 A;  1HKT A;  2CWE A;  4M6X A;  3RKX A;  3DQV C;  2GWR A;  1OYI A;  3O2P E;  3E5Q A;  3GW2 A;  3J81 K;  4LLL A;  3BJO A;  5E1X A;  5AIP A;  5DDG A;  2A07 F;  4XBF A;  2OQG A;  1T2K A;  3SFZ A;  4HBL A;  1DPU A;  3EYY A;  3V8K A;  1SMY F;  3N97 A;  1BI0 A;  3KFW X;  2M8E A;  1ZAO A;  2YX7 A;  1BM9 A;  1W5T A;  4M9X A;  3T1B A;  2QQ9 A;  3CUQ B;  3T8R A;  4MTE A;  1DPR A;  5DV5 A;  2NNY A;  1BIA A;  1R1U A;  1KYZ A;  3DEU A;  3Q9S A;  2D2W A;  3DV8 A;  2ZBK A;  3ZQ7 A;  3EDP A;  4D0P A;  3KZY A;  5E1W A;  4CGZ A;  1YLF A;  4N0B A;  3V7S A;  3VB2 A;  4LG0 B;  1E17 A;  4M9Z A;  4P96 A;  2D1V A;  1D5V A;  4GYG A;  1S8N A;  5E18 F;  4GO1 A;  2CGP A;  4BYY A;  2VT3 A;  2IVM A;  2Z3Y A;  3CUQ A;  4G8X A;  2KIM A;  2LSO A;  5HDG A;  4P55 A;  4P9U A;  3DF8 A;  1XMK A;  2V9V A;  2O6G E;  2F5E A;  3GWZ A;  4HF1 A;  1A04 A;  4Q4Z F;  4PZJ A;  1FSH A;  1S29 A;  1LDD A;  3HYI A;  3WTT C;  1ZG5 A;  4L9V A;  3I4P A;  1WWX A;  2NS0 A;  1TNS A;  4CZZ A;  2R7F A;  5DUI A;  2GXG A;  1LJ9 A;  5ILV A;  3LA2 A;  4BQA A;  1I6X A;  2DQR A;  4I2O A;  3NRV A;  4F7Z A;  2E1C A;  2Z33 A;  1R23 A;  4KA4 A;  2OAZ A;  1PP7 U;  3E5X A;  2FE3 A;  2O3F A;  3K1M A;  4IRG A;  3H92 A;  4U7B A;  3R60 A;  3QRF F;  2VE9 A;  1YS7 A;  5ILS A;  1QNT A;  2ESH A;  3TOA A;  4WXH A;  3LA7 A;  3HTU A;  4U88 A;  3FX3 A;  3WGG A;  2HZT A;  2RNJ A;  2HYG D;  4ZYD A;  4HX7 A;  3W6J B;  1AOY A;  2NNN A;  3MZY A;  2VBZ A;  3WTW C;  1XCB A;  5IT3 A;  1XGS A;  1FBU A;  2RQP A;  5HLI A;  1ON2 A;  2V1U A;  1ZRD A;  2K02 A;  1IN4 A;  4I98 B;  5BS6 A;  2CW0 F;  4YIF A;  4A12 A;  2FSW A;  2HDC A;  4GYI A;  4Z2Y A;  3M9A A;  1R1V A;  1LDJ A;  2JSC A;  5LGT A;  4QWQ A;  1O7L A;  2GA2 A;  5EEG A;  2ZO4 A;  2Y0M A;  3MCZ A;  4JQF A;  1PDN C;  5DCM B;  3FXU A;  1R36 A;  3G73 A;  2JRT A;  5JHU A;  1ZGJ A;  1ZLJ A;  1KA8 A;  2EK5 A;  4BHB A;  2Z5U A;  4CYD A;  1LQ1 A;  3OOP A;  1NHA A;  3KP4 A;  3JAM K;  2XIG A;  1AWC A;  2GAU A;  4R1H A;  2VBW A;  3KCC A;  3LFK A;  2O8X A;  4ESJ A;  3KZZ A;  3QP5 A;  4HF0 A;  5FLX K;  3E6M A;  2H6C A;  4DQ2 A;  1FP1 D;  2OD5 A;  2EFN A;  3FHZ A;  3REO A;  1CF7 A;  1GVJ A;  4L18 B;  1U3E M;  2L4M A;  1FBQ A;  2A61 A;  4BH9 A;  4PGH A;  1KGS A;  3RPU A;  1GXQ A;  4WCG A;  4RGR A;  4I09 A;  1KQ8 A;  2HKO A;  1MGT A;  3TDZ C;  3TO6 A;  3JSP A;  4UUV A;  1HXD A;  2DPD A;  5BPD A;  3WU1 B;  4WXD A;  3RKY A;  1R5G A;  3ECO A;  3ZMV A;  4HLX A;  4K2E A;  2V1X A;  4ENM A;  4UVC A;  3AAF A;  5JI6 A;  3U1D A;  2CQK A;  1FLI A;  4U0V A;  4G7O F;  3HRS A;  3FMS A;  4IHS A;  1R00 A;  2STW A;  3ZMZ A;  1H9G A;  2QLZ A;  2LNB A;  2K4J A;  5TRD A;  3M7G A;  1P4W A;  3WTV C;  2DFI A;  2LF8 A;  2ZCW A;  3QU3 A;  3ZN0 A;  3DXJ F;  4P5O A;  3F8M A;  2GIV A;  2RC4 A;  2Y48 A;  5DD4 A;  2ZKZ A;  1K7A A;  2B0L A;  3PQK A;  4EJO A;  1HW2 A;  5HS8 A;  3HUG A;  1B9M A;  1JGS A;  1SFU A;  5DEQ A;  1FY7 A;  4XSZ F;  2DO7 A;  3HTS B;  2IPQ X;  1X3U A;  3TGN A;  1STZ A;  3MZH A;  3IHU A;  4MQ9 F;  2XAQ A;  1HKS A;  3JTH A;  5FD6 A;  3SZT A;  3HSF A;  1XDU A;  2F5D A;  1FC3 A;  1W7P D;  3IWZ A;  3R4K A;  1BI2 A;  3F21 A;  5CVJ A;  4EJW A;  1ZHF A;  3CO7 C;  5BQT A;  2XAG A;  1F5T A;  4OIQ F;  2DU9 A;  4WK8 F;  4KN7 X;  4LJZ F;  1IUY A;  3WU0 A;  4U0W A;  1MKM A;  1FSE A;  1EH7 A;  1RZ4 A;  2QM3 A;  2VC0 A;  1XGO A;  3RIR A;  5KVR A;  4XLN F;  5FO5 A;  2MD5 A;  3ZMD A;  4FX4 A;  3D5L A;  3K0L A;  1F9N A;  2HQR A;  2P6T A;  1TNT A;  1MDM A;  3BPV A;  4MTD A;  4EJU A;  3L9F A;  3OV8 A;  3U2R A;  4OIN F;  1J2X A;  1SD6 A;  3KP5 A;  3HIF A;  2XKO A;  4OU0 A;  5BOX A;  2JT1 A;  1L3L A;  5ED4 A;  2P7C B;  2Y75 A;  3R61 A;  2FRH A;  3HSR A;  2RGV A;  4IRH A;  2IA2 A;  1XMA A;  2PBI A;  3HOS A;  2P5K A;  3L00 A;  5LEJ A;  3QOP A;  2ZNY A;  2UZK A;  2IJL A;  2XGX A;  4Y15 A;  4YFK F;  2GZW A;  2NRA C;  4Y13 A;  1I27 A;  1O57 A;  3FXQ A;  2OZ6 A;  3I0T A;  2FA5 A;  2JZY A;  3VFZ A;  2W57 A;  1UFM A;  4CHU A;  1IXS B;  4UXN A;  3TQN A;  1VTN C;  1OPC A;  4WX9 A;  3E3V A;  1W7P A;  2JPB A;  3RJP A;  2XHK A;  2XAF A;  5D6F A;  4JBA A;  3TOB A;  1U78 A;  3J80 K;  4OIO F;  4RB2 C;  2QQB A;  2QBY A;  1W5S A;  5IT9 K;  4ZYG A;  2L3D A;  4IJA A;  2G7H A;  1FNN A;  4HA8 A;  4ZH4 F;  1BN5 A;  3P9K A;  4HV5 A;  2OA4 A;  4IRI A;  1J7K A;  2RVC A;  2K27 A;  1G3W A;  4MNU A;  5L3F A;  2GXB A;  3COA C;  2MC3 A;  4HOB A;  2VT2 A;  1U8R A;  5JR3 A;  3DPL C;  4EVI A;  1QZZ A;  4EJV A;  4N9I A;  3LWF A;  1O7F A;  2H6B A;  4RGS A;  1XDS A;  4UV9 A;  4Q47 A;  4G7Z F;  5H6Q A;  3LAP A;  5J6X A;  1U6G A;  4DNC A;  2KKO A;  1MJ9 A;  1E2X A;  5AON A;  1B59 A;  5F64 A;  1QO0 D;  4G9Y A;  2PN6 A;  3C18 A;  3SHF A;  1S3J A;  2XVC A;  1Z1D A;  4U7D A;  2PFB A;  1RUN A;  1SFE A;  1XSX A;  2PEX A;  1W7P B;  2Z99 A;  1XGM A;  2OQR A;  1HSJ A;  3GFI A;  1ZYR F;  1K78 A;  1TW2 A;  2HTS A;  1HKQ A;  1TQM A;  4HDV A;  3T0Y A;  2QQA A;  3VOD A;  1YFH A;  2L4A A;  4WWC A;  5DCM A;  2EJR A;  4KMF A;  2YR2 A;  4RS8 A;  2MA3 A;  2WWY A;  1BOA A;  2A3S A;  4S05 A;  1FYK A;  2M45 A;  3BJA A;  4BNC A;  2HKX A;  2VBX A;  2EFW A;  1FZP B;  1ZRE A;  3QPT A;  4UNO A;  5J8F A;  1YG2 A;  2NAZ A;  2XAS A;  4MEY F;  3QP6 A;  3WE3 A;  3IRR A;  1CF7 B;  2XV4 S;  1G3S A;  2A6E F;  4LLN A;  2K4B A;  4M6Y A;  1D3Y A;  2H27 A;  2DK5 A;  3V7R A;  3HRM A;  2Z9O A;  1P4A A;  2CYY A;  2PMH A;  4A2U A;  1YQA A;  2XUB A;  5HDN A;  4HQE A;  4OIR F;  3WTZ A;  5K5O A;  1ZG1 A;  2FEZ A;  2R7D A;  3TO9 A;  1LNW A;  3KEO A;  4LD5 A;  1P4X A;  3G3Z A;  4L5J A;  3WG9 A;  5H6R A;  5H20 A;  4ZZL A;  1P6R A;  2P6S A;  4ASN A;  4ESB A;  1JHH A;  5DUK A;  2C6Y A;  3IC7 A;  3HRU A;  4L9T A;  2EFO A;  2VE8 A;  1CGP A;  5A2Q Z;  2ZXJ A;  3F8C A;  5IT9 Z;  2PLY A;  2HR3 A;  3H3U A;  1FYL A;  1TBX A;  2PMU A;  3BP8 A;  2ZFW A;  2PQ8 A;  5JFR A;  1MD0 A;  2TDX A;  2ZJ2 A;  2WV0 A;  1TW3 A;  4A0Z A;  3D0S A;  4I7H A;  4KT5 C;  1K78 B;  3ABT A;  4LB5 A;  3KLO A;  2QVO A;  5AIQ A;  4EM0 B;  2ISZ A;  4I0B A;  2LDU A;  2BGC A;  4YII A;  3R6S A;  2QBY B;  1R22 A;  2A69 F;  3L09 A;  3F8B A;  2VOD A;  4ENN A;  1QGP A;  3F6V A;  2XRO A;  1TQI A;  2ADU A;  3BWG A;  3ZMU A;  4LG0 A;  3L7W A;  2GA1 A;  3IL2 A;  3QAH A;  3LQR A;  4G94 A;  4XRF A;  2FML A;  1GXP A;  3GF2 A;  2OU2 A;  1YYV A;  2XKP A;  4EJT A;  2IA1 A;  3K1N A;  4JK1 X;  1LEB A;  1KU7 A;  5F6F A;  1B1B A;  2K7L A;  1QBJ A;  2MLG A;  3I5U A;  3M8F A;  4P9F A;  4A0Y A;  4ENJ A;  2BV6 A;  3PFI A;  5L3D A;  3BY6 A;  4GXO A;  3ERE D;  1ZAR A;  5CLS A;  4KDP A;  2RV8 A;  2KJC A;  3ZP5 A;  4R8H A;  3P9I A;  3GEZ A;  4Q48 A;  3MEX A;  3EET A;  1RNL A;  4AIK A;  1WSU A;  3GVA A;  4LK0 F;  1ZG3 A;  3I59 A;  4EGZ A;  3WTY C;  1R7J A;  2FQ3 A;  5E8G A;  3RDI A;  2VC1 A;  3H3Z A;  3J7A O;  3T8T A;  3GFJ A;  1ZRF A;  3F23 A;  5HS9 A;  2FNA A;  3LST A;  1BI1 A;  1IRF A;  1FYM A;  3ELK A;  3C3W A;  5CVR A;  1GHC A;  4AVP A;  1PP8 F;  3BOQ A;  2VXZ A;  4HAM A;  3W6K B;  2E7W A;  4KMU X;  3ISP A;  1R58 A;  2FBH A;  3RYR A;  4FT8 A;  1IN5 A;  4L9N A;  1Z7U A;  4A5N A;  2HS5 A;  4G6Q A;  4RB3 C;  4U0Y A;  3FMR A;  1U5T A;  4KFC A;  2FBI A;  6PAX A;  2G7U A;  1YO5 C;  1ZH5 A;  2JPC A;  2J5O A;  5CVV A;  1H9T A;  5KK1 A;  4BHC A;  4BAY A;  2HFH A;  1YTY A;  2G9W A;  3KET A;  1HW5 A;  3EYI A;  3WOD F;  2V79 A;  2FU4 A;  4KYW A;  5LHI A;  1QPM A;  1Z6T A;  4ETS A;  4LGW A;  3ZPL A;  2MBF A;  4M73 A;  4AD9 A;  2A5Y B;  4NB5 A;  1FPQ A;  1IZ1 A;  4RB1 A;  2EFP A;  2QYO A;  2CFX A;  3WE2 A;  1G3Y A;  2P5V A;  4IF4 A;  2UXN A;  3M1E A;  4CXF A;  3NEU A;  1MDM B;  2KRF A;  1FOK A;  1Z05 A;  1UB9 A;  3RPQ A;  4UVA A;  2CG4 A;  1LB2 A;  3V8J A;  4M71 A;  2CSO A;  3HHH A;  3ML6 A;  3CLO A;  1BC8 C;  4NQW A;  1T39 A;  3DP7 A;  1B6A A;  3FWE A;  4HDU A;  3KE2 A;  1D8K A;  2O0Y A;  2YSR A;  4S04 A;  5HDK A;  4HX8 A;  3V4G A;  4O6J A;  2QUF A;  5BMZ A;  2HOE A;  2IT0 A;  2M5W A;  4MQV A;  4A6E A;  1TQP A;  4PDK A;  3I59 B;  2QWW A;  1EH6 A;  4A6D A;  3EUH A;  1SD4 A;  3ROU A;  1SAX A;  1O3Q A;  3TO7 A;  5DD8 A;  2AS5 F;  2ZME B;  3GX4 X;  1IRG A;  3QU6 A;  1G4D A;  3Q9V A;  2BE5 F;  1BBY A;  2XAJ A;  1IN6 A;  4ENK A;  4UVB A;  1DUX C;  1FP2 A;  1T0F A;  3B02 A;  4ZYH A;  3BZ6 A;  3DKW A;  1BI3 A;  3I64 A;  3K1P A;  2L54 A;  1RUO A;  1S7O A;  2DW4 A;  4LLG F;  1H0M A;  1UHW A;  3ABU A;  3U9G A;  2FBK A;  5EEH A;  4RGX A;  4G7H F;  4R79 A;  1U5T C;  3WGH A;  1O3R A;  1T6S A;  1J75 A;  1HW1 A;  5E8I A;  3L2C A;  2L01 A;  3MAJ A;  1P2F A;  3FM5 A;  2W24 A;  5K5Q A;  4G6D A;  5JVT A;  3SQN A;  4CIC A;  1USS A;  3E5U A;  3GUD A;  1J0R A;  1G3T A;  3IRQ A;  3ECH A;  1IF1 A;  2R3S A;  5CYV A;  5ERI A;  2Q8K A;  2XAH A;  4CO8 A;  1B4A A;  4MHG A;  4PGG A;  5D4S A;  5HLG A;  3J80 Z;  4UV8 A;  2BYV E;  4FX0 A;  3CTA A;  4HQM A;  3CUQ C;  3SXY A;  1MJB A;  4KN4 X;  4WXC A;  2RDP A;  2VON A;  5K1Y A;  4HX4 A;  5F1R A;  5LGU A;  4EV0 A;  2M1B A;  1KU2 A;  1BC7 C;  1ZN2 A;  1ODD A;  5FFZ A;  2YU3 A;  2IA0 A;  3GLX A;  1IN8 A;  4N9H A;  3TKY A;  3BRO A;  2FNP A;  5CVI A;  2IP2 A;  3PQJ A;  3K69 A;  2IW5 A;  4Q5S F;  4LB6 B;  2YX4 A;  2FMY A;  2CO5 A;  4HYE A;  4IPA A;  1IAW A;  3P9C A;  1XCV A;  3DFG A;  3GZ6 A;  4IHT A;  5D5W B;  4FHT A;  1HQC A;  1KYW A;  3I54 A;  1U5T B;  5FD5 A;  1ULY A;  4OOI A;  4ON0 A;  5FGM A;  3MQ0 A;  1XN7 A;  4E70 A;  4B8X A;  5DYM A;  1OKR A;  5DCF A;  1K6O A;  1IN7 A;  2ETH A;  2J5P A;  2P5L C;  2BBY A;  3FM3 A;  1SFX A;  3HOT A;  3C1D A;  1HBX G;  2D1H A;  3VOE A;  3V8L A;  4KIB A;  4RGU A;  1LVA A;  2JTV A;  2QEN A;  2AXL A;  2D45 A;  1R1T A;  3GXO A;  4O5V A;  1LEA A;  3GZ5 A;  3FF5 A;  4KUM A;  3FZV A;  2X0L A;  1JXS A;  4M72 A;  2RN7 A;  5E17 F;  2KJB A;  1ONV A;  2MH9 A;  5A2Q K;  1EV7 A;  2V6C A;  2ELH A;  1FT9 A;  4KNY A;  1KQ9 A;  1B9N A;  2A6H F;  2W25 A;  2BEO A;  2EWN A;  1F4K A;  2FXA A;  2ZNZ A;  2HEO A;  3ZN1 A;  5ICE A;  2H94 A;  5D5U B;  1O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...