1R36A

Nmr-based structure of autoinhibited murine ets-1 deltan301
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVSDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords C-ets-1 protein
publication title The Structural and Dynamic Basis of Ets-1 DNA Binding Autoinhibition
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r36A00
3V4GA 3HTUA 2XVCA 1X3UA 2WC2A 2Z33A 5L3CA 1P92A 1LEAA 3ZMDA 1YW8A 4WXDA 1ZG5A 1KYZA 4ZH4F 1S7AA 3ZPLA 4KA4A 2UXNA 2CWEA 4HQEA 4QLCU 3GVAA 4WXCA 2ZNZA 4ESJA 4L5JA 4MEXF 5F6FA 2JPBA 2X4HA 3F8FA 2FU4A 5E1XA 3QOPA 2H6CA 1YW9A 5LEKA 5ERIA 4MGRA 1BI3A 1KYWA 1YLFA 3TDZC 1IN8A 4EVIA 1T39A 1ZARA 4A6EA 3MCZA 1R1VA 3M7GA 4M9XA 5DCMB 1YFHA 4HW0A 5J6XA 4EGYA 3MEXA 5ILVA 4CO8A 4EM2A 2EA2A 3V8JA 4A2UA 1I27A 5H6RA 1IRGA 1BI1A 1BI2A 4LGWA 5D5WB 2XHKA 4FX0A 4HZFA 4OMZA 4HA8A 1XMKA 3D0SA 3RJPA 5D8KB 3TGNA 3KFWX 2ISZA 4IXAA 2CW0F 1F1ZA 5HS7A 2HYGD 4K2EA 3ERED 4L9VA 4UXNA 2IVMA 4HX7A 2NAZA 1R1UA 4KNYA 4OIQF 4AIHA 2YX4A 3L2CA 3DPTA 1S3JA 5K1YA 2ZO4A 3ZMUA 1KQ9A 1IXCA 3FXRA 1AOYA 2VBZA 4B8XA 3T1BA 2XROA 2PMUA 3R0JA 1ZRDA 2HTSA 3VEPA 4PZJA 1FSEA 3TKYA 2DFIA 4CGZA 3IWZA 5K5QA 2A61A 2FEZA 5J8FA 1QGPA 5K5OA 3V8LA 3CUQA 3K69A 1V4RA 1R36A 3R60A 1HKSA 3VFZA 3I54A 3R61A 1LJ9A 5ILUA 1R5GA 3J81K 3CO7C 1I6XA 3ROUA 1B9NA 1QBJA 4RGRA 1WI9A 1RIOH 2QUFA 2DQLA 1RUNA 3SFZA 1U5TB 3WTVC 1T6SA 3Q5FA 4BQAA 4ESBA 1REPC 3WE3A 3BOQA 3NEUA 3P7NA 1UHWA 1HQCA 3KP4A 2P7VB 1OYIA 1V3FA 4KIBA 3T8TA 1W7PB 5L3EA 2A6HF 5D5UB 3LQRA 2HKXA 1GXQA 3H3ZA 5BS6A 4EJWA 4IVNA 4ZYDA 2COMA 3F8MA 3GO5A 4G8XA 5LGTA 2IRFG 1R23A 3WTUC 2NYXA 2R3SA 2ZJ2A 4EJUA 4ENNA 1W5TA 1ZRFA 4BNCA 2VC1A 2GWRA 1B1BA 3PFIA 2ACJA 3L9FA 2WWYA 5ICEA 3E6MA 3SXYA 2XAHA 4L5IA 1BBYA 5LBQA 5IT9Z 2E7WA 5CVIA 3CTAA 1CF7B 5DCMA 2XKOA 4MTDA 1XCBA 4U0YA 1Z91A 1OYWA 1DDNA 3FF5A 1JHFA 2XASA 3TO6A 4MQ9F 2PG4A 1Q1HA 4D0PA 3BDDA 2V1DA 5K5RA 3J80K 1HBXG 3U1DA 1MJ9A 1FWZA 3LA7A 3T0YA 2O3FA 4TV7A 3WG9A 3SZPA 3C7JA 2DK8A 3CUOA 4BXUA 3BROA 4RB1A 2V79A 3VOEA 1BIAA 5ED4A 4EV0A 5ICCA 3RPQA 5D4SA 1SFUA 2Z9OA 1FSHA 3BWGA 3WU1B 4EJVA 3FXQA 5JI6A 4YG2F 3TQNA 3I71A 2VN2A 3HUGA 4RB2C 2A07F 2R7DA 1SMTA 4L0ZB 2KJBA 3LAJA 3IWFA 5FFZA 2JPCA 2EFPA 1F5TA 3ECOA 1MJBA 2NNYA 1MDMB 3MZYA 4IHTA 2PFBA 1JHHA 1XCVA 5KK1A 3FMRA 3WTZA 4IRIA 3J7AO 2ZXJA 5E1ZB 2P4WA 2DAOA 3RTRA 1ZAOA 4WX9A 1J0RA 2ETHA 2JZYA 4UVAA 5DD8A 2GIVA 1U5TA 3QP6A 4U0VA 4ZZLA 3GZ5A 4EGZA 3RIRA 1Z05A 3QAHA 2XAFA 4XSZF 1W7PA 4WK8F 4ZYEA 3F6VA 1FC3A 2CSOA 4LMYA 4KYWA 2FBHA 1P4WA 1XSDA 1XGNA 5F1RA 1PDNC 1FX7A 2K27A 1B4AA 4A0XA 4NQWA 2FNAA 3COAC 4EJTA 3GFIA 2M8EA 1ZHFA 3F8CA 5HLGA 1S6LA 5CYVA 5E8GA 3P9CA 3IKVA 5CJ9A 1IAWA 3BJAA 2GZWA 3U2RA 1OYYA 1HW1A 1BC7C 5HVQC 3WU0A 1CF7A 4A5MA 3EQLF 3HSFA 3QP5A 3LFKA 1T2KA 2J5OA 3ABUA 4Q5SF 3JAMZ 3GFJA 1WRJA 1H9TA 3V7SA 5FFXA 4WWCA 4WCGA 4BH9A 3EETA 4GYGA 1W7PD 2M45A 2FBIA 3DF8A 5IT3A 4ZYGA 3E97A 1FP2A 1K7AA 1QNTA 4NB5A 2LF7A 2FOKA 5HOOA 2E1NA 2EFOA 5DDGA 4EJOA 1YS6A 2AS5F 1YO5C 3CLOA 4YFXF 4M72A 1W5SA 4ZZDA 4PGGA 4KDPA 3KEOA 3FM3A 3K1MA 1HSJA 1XMAA 4M9ZA 4LK1F 2V9VA 3HRTA 1SD7A 2FRHA 1XN7A 3C3WA 5L3FA 1MZBA 1DPUA 2LNBA 4Y15A 4CDGA 3E6DA 2Z3YA 1YTYA 4GO1A 4UV8A 4R8HA 1LDJA 1TNSA 3N4MA 1MDMA 2ADUA 1FPQA 2OZUA 1P2FA 1ZGJA 2OA4A 1IN5A 5FO5A 3J81Z 2DPDA 2M87A 1KU3A 4G9YA 3LQQA 2OAZA 3H92A 5DCFA 3ELKA 2JRTA 3DFGA 1FZPB 3GZ6A 1RI7A 1ZH5A 5D6EA 3S2WA 3DQVC 4CYDA 3ECHA 1T0FA 2LKPA 4HLXA 2DI3A 1FP1D 2PQ8A 3F8BA 5LGUA 2D1HA 2DT5A 1MJAA 4UNOA 5HLIA 1F4KA 2QZ8A 3HHGA 3HRUA 2IA2A 1EV7A 2QYOA 4ON0A 3HRMA 3P9KA 2A68F 3T5XA 2K02A 1LNWA 3R6SA 1QPMA 1Z1DA 1KU9A 4S05A 3ISPA 1USTA 4G6DA 3E6BA 3FM5A 4U7DA 4B09A 1YS7A 2OZ6A 1ZRCA 2HR3A 2O03A 4G7ZF 3EYIA 3E3VA 3JTHA 3ULQB 1Z6TA 4M9SA 2GXBA 2XV4S 1ZYRF 3KZYA 2HEOA 2GAUA 3DXJF 1MKMA 4LLLA 5DD4A 1LDKB 3CJNA 2DO7A 4OIOF 1TW3A 2HQNA 4A6DA 3TO9A 2D1VA 3JSPA 1OMIA 1IRFA 3J80Z 4MEYF 3KCCA 2BE5F 3GX4X 1GXPA 2L02A 2L4MA 4CXFA 5L3BA 3JW4A 1U78A 4OMYA 2YSRA 3Q9VA 3F21A 4ENJA 2ZBKA 4OINF 3DKWA 2FE3A 4IRGA 3QPTA 4E70A 4S04A 1STZA 3N97A 1VTNC 2STTA 3KP7A 1U2WA 2P5VA 2RC4A 4EM0B 1RNLA 3GW2A 3I53A 1JE8A 1K78B 2V1XA 3BJOA 1USSA 2DQRA 2RNJA 1SD5A 1JGSA 4MQVA 1MGTA 4I98B 3QU6A 1TQIA 3GUDA 2H27A 2KIUA 1ZG3A 4LLNA 5D4RA 1HW2A 2PBIA 4F7ZA 5D5VB 3RPUA 5CVUA 2FQ3A 1IZ1A 3WGIA 4KMUX 1Z6RA 4XLNF 1QQIA 2K7LA 4KT5C 1OKRA 2EFQA 2RV8A 4L9JA 2QWWA 3F6OA 2KKOA 4RS8A 3IL2A 1AWCA 1R1TA 3FHZA 1KA8A 2PMHA 1ZREA 1XGOA 2DW4A 5E8IA 1IXSB 5CVVA 1TNTA 5AIQA 2GA1A 3E5UA 4KN7X 2CG4A 3GYHX 2X0LA 2RGVA 1ZN2A 2QENA 3GFMA 5ICFA 3ZMVA 1YG2A 3E6CC 3ZMZA 1ULYA 3WTSC 1ODDA 1O3SA 2MD5A 1U6GA 3PQJA 3BY6A 2QQAA 4R79A 2ISYA 2ZMEB 1KU7A 1HKQA 2C6YA 5FD5A 1XD7A 2TDXA 5HLHA 4U88A 2HQRA 3KE2A 5DV5A 4Y17A 5FB2A 3TOAA 3BZ6A 4RB0A 4BHCA 5DUIA 2EFNA 2KRFA 2NS0A 2OQGA 3D5LA 4KICA 4M73A 2CFXA 1KQ8A 2XGXA 5A2QZ 3U9GA 2MC3A 3RYPA 1LDDA 3I59B 2VT3A 3ZP5A 4NHJA 5JFRA 2P5KA 2A6EF 3TO7A 1XGMA 2K86A 2QVOA 5D6FA 1GVJA 1P4XA 3O3KA 1D8KA 4RAZA 5ILSA 3K9TA 2EWNA 4HF2A 1HSTA 1L3LA 1ZG1A 4M6YA 5FLXK 3V7CA 3K0LA 3RI4A 4OIRF 3LAPA 1BM9A 4HQMA 2M1BA 1RZ4A 1FYKA 2HGCA 5LGNA 1IN6A 2IP2A 2IA0A 4ZYHA 1K78A 3C1DA 1G3SA 3KP3A 1OPCA 3OV8A 4HDUA 3O2PE 4P5OA 2F2EA 3H3UA 4FHTA 3HRSA 1FNNA 2PLYA 2Q0OA 1TQMA 3MFKA 3GEZA 2G7HA 4CHUA 1NHAA 1ZLJA 1XGSA 2GQQA 1I1GA 3E5QA 3SHFA 2HWVA 5DYMA 4RGXA 1UHMA 5LRRA 1BI0A 3R0AA 4MTEA 2O61A 3RKXA 1O7LA 2PEXA 1YQAA 1O3TA 3GWZA 1B6AA 1K79A 3ZMSA 2GA2A 4DNCA 1G3WA 2RKHA 2VODA 4ENMA 1YIOA 5LHIA 2XIGA 4KIGA 3FZVA 3NRVA 4HV6A 1A04A 2RQPA 1IW7F 2QM3A 3CDHA 4I7HA 2HKOA 4EQQA 3Q9SA 3HHHA 2CYYA 4KN4X 3W6JB 4AIKA 3PQKA 3BJ6A 4UVCA 3V8KA 1YW7A 4GXOA 5HDGA 1PP8F 3JSOA 1G4DA 2HOEA 4JK1X 2ZKZA 3M9AA 2ZMEA 4A0YA 2Q8KA 3TDUC 4HAMA 4UVBA 2KIFA 2QQ9A 3ZQ7A 1KQ0A 5CVRA 4OU0A 4G94A 4LLGF 3CUQB 2Q2EA 4HF0A 1GHCA 1PUEE 2L4AA 1G6NA 1G3YA 3OOPA 3F23A 1EH8A 1IN7A 3BPVA 4A12A 4G7OF 2MLKA 2UZKA 3ABTA 2P8TA 4RGUA 2FBKA 3F8NA 3EDPA 5LEJA 3QRFF 3QU3A 1IN4A 2Y0MA 4RGSA 3LA2A 2NNNA 4AIJA 3KZZA 2VBWA 4HYEA 2VT2A 3GXOA 2J5PA 3I59A 2HS5A 3E5XA 3WTTC 3CO6C 2JT1A 2VOPA 1EH7A 3MWMA 1L0OC 1TBXA 2UWMA 3M1EA 2IPQX 5LRSA 4A0ZA 4HBLA 2F5EA 2VONA 1D3YA 2D2WA 1MD0A 4ENKA 1LQ1A 3LA3A 2WTEA 4HDVA 1WSUA 1LEBA 1R58A 3F3XA 2H6BA 2VOOA 1J7KA 1SFXA 2G9WA 4N0BA 2RDPA 1SAXA 3P9IA 5TJJA 4LG0B 1J9IA 3B73A 1IUYA 2DK5A 3L7WA 5L3GA 1O7FA 5LHGA 3QPHA 5H6QA 3W6KB 1QZZA 4IF4A 3K1NA 4WF2A 3WGGA 2P6SA 2GXGA 5HDKA 2V6CA 4YIFA 2YR2A 1UB9A 2H09A 1IF1A 3DV8A 4LK0F 4GCVA 2W25A 2QQBA 4P9UA 2UXXA 5CLSA 1HKTA 3JAMK 2DU9A 5JHUA 2RN7A 4HX8A 3HTSB 4M74A 2DTRA 2B0LA 4OIPF 2KJCA 3WTWC 5KVRA 2ESHA 1S8NA 4IRHA 3O6BB 1H0MA 2V1UA 4U0WA 3I0TA 4Z2YA 2F5DA 2F5CA 2O0YA 3TOBA 2E7XA 2VE9A 1XDSA 2Z5UA 2LDUA 4LFUA 2DLLA 5HS9A 2MH2A 3V7RA 4YIIA 3HIFA 2MBFA 3REOA 1OR7A 2PN6A 1QZYA 5D5XB 2FSWA 2O8XA 5AIPA 4AWXB 2FNPA 3DEUA 2O6GE 3NQOA 1SMYF 2M30A 4BHBA 3B02A 3F22A 2YU3A 3F72A 1U8RA 2XUBA 2FMYA 3DPLC 3T8RA 4AD9A 3M8FA 2L3DA 2Y48A 3VODA 4OOIA 4IHSA 4L0YB 4LB5A 4JQFA 3L00A 2Z99A 4FX4A 3GF2A 3GFLA 5HDNA 2HYFA 1XDUA 2W57A 2EV0A 4M6XA 2LSOA 2A3SA 1DPRA 2HTJA 1BOAA 3EYYA 2BBYA 5BQTA 2VE8A 4N9HA 4EM1A 4UUVA 1G3TA 2HZTA 1E2XA 2JSCA 4DQ2A 1KU2A 3HSRA 2EV6A 3KETA 1BIBA 5FGMA 5E1WA 1ON2A 4N9IA 3EUHA 2OD5A 4RB3C 4Q4ZF 1SD4A 1FT9A 4G7HF 4P96A 1F9NA 2K4JA 2STWA 5BPIA 4CICA 4KUMA 5AONA 4ASNA 2HFHA 2H94A 2YPRA 3FMSA 3L09A 3CUQC 3MAJA 1TTYA 4MHGA 2IT0A 4KFCA 5BMZA 5FLXZ 2CO5A 2EV5A 5CVJA 1I5ZA 2CGPA 4KMFA 2A5YB 4HX4A 4PGHA 2AXLA 1R00A 3IRRA 2IA1A 2P5LC 4LG0A 3FXUA 1S29A 4LD5A 3GLXA 2IW5A 2EA4A 1QO0D 3HOSA 2L01A 1O3QA 3RDIA 5LLQA 4BYYA 1R5HA 4I0BA 1SD6A 2D45A 3C18A 4AVPA 4O5VA 4Q48A 1J5YA 4YFKF 3M8EA 1ON1A 3BPXA 5E20A 1PP7U 4Y13A 3IKTA 3RKYA 2FMLA 3WE2A 2W24A 2FA5A 4HV5A 3RYRA 1H9GA 1SFEA 2DBBA 1E17A 2XAGA 2VXZA 2QBYB 4I01A 4P55A 4JBAA 3IC7A 3JTGA 2VBYA 3LWFA 5LHHA 1LVAA 2JTVA 5J8CA 3HSEA 1D8JA 3K2ZA 5E17F 4Q47A 1ZGAA 3KLOA 1FLIA 1U3EM 4XLPF 1DP7P 3SQNA 2CQKA 6PAXA 2XRNA 3FX3A 1FYLA 2ZNYA 4L9TA 1XSVA 4O3MA 2OQRA 2EK5A 2FF4A 2R7FA 3KP6A 4BAYA 5TRDA 1JXSA 1B9MA 4KIFA 4EMSA 2P7CB 5DEQA 1K6OA 3KLNA 1WWXA 4M71A 2ZFWA 4GYIA 4PDKA 1FBQA 1P6RA 2MLGA 1BJAA 1W4MA 1J2XA 1KGSA 2MA3A 4U7BA 2F5FA 5EEGA 1T38A 2OBPA 1I1SA 1RUOA 5EEHA 1TLHB 1TW2A 2DPUA 2MH9A 2VBXA 4HOBA 4BHPA 2PI0A 2BEOA 2A69F 2ESNA 3I58A 4I09A 1R22A 3WGHA 1UFMA 1S7OA 3I4PA 2E1CA 1R7JA 1FOKA 5FD6A 3R4KA 5D8LB 2BGCA 5JR3A 2LF8A 5L3DA 4PCQA 2VC0A 4CZZA 2HDCA 4ESFA 2NRAC 2EFWA 1XSXA 3WTXC 1O3RA 3ML6A 1P4AA 1ONVA 3FMQA 3WODF 1HW5A 1J59A 2EB7A 2XKPA 4I02A 3MZHA 5IT9K 4O6JA 4LJZF 5BPDA 1CGPA 3LSTA 1C0WA 2ELHA 5DUKA 1WQ2A 4YFNF 2KIMA 5BOXA 4HLYA 3AAFA 3IRQA 3ZN1A 4XBFA 2BV6A 4L9NA 4MNUA 1ZLKA 1U5TC 2YX7A 5JVTA 1T98A 3I5UA 4P9FA 3RKWA 3KP5A 1BN5A 1EH6A 2L54A 2FXAA 2G7UA 3I64A 2K4BA 1Y0UA 5H20A 2IJLA 3ZMTA 1D5VA 3HYIA 5ICGA 4IPAA 2W84A 4A5NA 1WKMA 1TQPA 1BC8C 3BP8A 1B59A 3KP2A 1J75A 4XSXF 1LB2A 1DUXC 4I2OA 4G6QA 2XAQA 2PJPA 4HF1A 3SZTA 3DP7A 3VB2A 1IXRC 1YYVA 4LB6B 4QWQA 3G73A 1FBUA 2QBYA 3KEQA 4IJAA 1FBSA 1Z9CA 2M5WA 3MQ0A 2XAJA 5E18F 5A2QK 2Y75A 3G3ZA 3HOTA 4GGGA 1FYMA 4ETSA 2RVCA 4UHTA 2W85A 5HS8A 4UV9A 2OU2A 3ZN0A 2EJRA 4FT8A 5F64A 2P6TA 1XB4A 4XRFA 2WV0A 1FY7A 1Z7UA 3IHUA 4R1HA 3WTYC 4I0AA 4L18B 4H0EA 4WXHA 1O57A 3K1PA 4RAYA 1UCRA 3FWEA 2QLZA 2ZCWA 2BYVE 1HXDA
chains in the Genus database with same CATH superfamily
3V4GA 3HPGA 1MMAA 2XVCA 3HTUA 1X3UA 1HCRA 4A3GJ 2WC2A 2Z33A 5KAFC 1T8IA 5L3CA 2E34A 1P92A 1LEAA 1MH4A 3ZMDA 1YW8A 4WXDA 1ZG5A 1A6QA 1KYZA 2R5YB 2KT0A 3E0JB 4HNTA 4ZH4F 1S7AA 3H5NA 3ZPLA 4KA4A 1HLVA 4IL6C 2DN0A 2UXNA 2PX9A 1VQPI 4FCYA 2CWEA 4HQEA 3OR1C 2A6TA 4QLCU 3GVAA 4WXCA 4DYQA 2ZNZA 4ESJA 1PJRA 4XL9A 4L5JA 4MEXF 5EJCA 2Z2SB 2ECCA 5F6FA 3QYBA 2JPBA 2X4HA 3F8FA 4RBOA 2FU4A 5E1XA 4YIRX 2QSGX 4D9JA 3QOPA 1CQTA 3M3YJ 2H6CA 4F55A 1YW9A 3DPUA 2VJ4A 5LEKA 2DOEA 3OYHA 4MGRA 5ERIA 2WBMA 3H35A 1BI3A 2HOTA 1KYWA 2M8GX 1YLFA 1UG0A 4C30A 1G59A 3TDZC 1IN8A 4EVIA 4HNUA 2CQ7A 1T39A 1ZARA 4A6EA 3WU2C 3MCZA 1R1VA 5HNHA 3M7GA 4M9XA 5DCMB 4E7LA 1YFHA 2JA6J 4HW0A 5J6XA 4EGYA 1H89C 3MEXA 2H1LA 2XRLA 3A4CA 5ILVA 1VQNI 1QVUA 4CO8A 4EM2A 2EA2A 1U9NA 3V8JA 2M0MA 2NVTJ 2NVUB 2O5RA 3HC7A 2E2IJ 4A2UA 2LKXA 1ETQA 1I27A 5H6RA 1IRGA 3W6VA 1VQLI 1BI1A 1BI2A 4LGWA 2R7SA 2ZSIB 5D5WB 3OYJA 2XHKA 4FX0A 4XIDA 3BCBA 1WHUA 4HZFA 4OMZA 4HA8A 1T08B 3J7ZI 1ERDA 2NOGA 1T0FC 1XMKA 4IKFA 3D0SA 3RJPA 5JVGF 2XF6A 5J1YA 5D8KB 3TGNA 3KFWX 2ISZA 4IXAA 2CW0F 1F1ZA 4X0GA 5M3MJ 4PFOA 5HS7A 2CQXA 1QA6A 1JTXA 1MBGA 4PJLA 3PM1A 2HYGD 4K2EA 3ERED 4L9VA 4UXNA 2IVMA 4HSTA 4HX7A 2NAZA 1R1UA 4KNYA 4XKCA 3TP3A 4OIQF 4AIHA 1JUPA 2YX4A 3L2CA 1X1AA 2X6WA 4DJAA 3DPTA 1S3JA 5K1YA 1XPXA 2ZO4A 2R7ZJ 3ZMUA 3EUAA 1KQ9A 2GIZA 1IXCA 3S17J 1W5CC 3A02A 3FXRA 1N78A 1AOYA 2LBFB 4BDZA 5EEAA 2VBZA 3HUGB 4B8XA 1S72I 4GFBA 3T1BA 3HL2A 4P1WA 2XROA 3F9KA 3CDLA 3A1YA 2PMUA 3BR5A 3R0JA 1ZRDA 2HTSA 3VEPA 1ZR2A 5FLVA 2KMUA 4PZJA 2ID3A 1FSEA 3TKYA 2DFIA 4CGZA 3IWZA 1VQ9I 5DTDA 3G6EI 1RR8C 4A3BJ 5K5QA 5IYCJ 2A61A 2FEZA 2HYJA 1QGPA 5J8FA 2X6XA 5K5OA 3V8LA 1ZELA 3CUQA 1V4RA 3K69A 2CUFA 3OYDA 1R36A 3R60A 2E19A 1HKSA 4DZPA 3VFZA 3I54A 1D1AA 1MNEA 2V4JC 3R61A 1LJ9A 5ILUA 1R5GA 3J81K 3CO7C 5EZGA 4Y52J 1I6XA 1M1EB 3ROUA 1B9NA 1QBJA 4B3XA 1QVTA 5E3OA 2F6CA 3FHNA 4RGRA 1OLTA 3D1NI 1WI9A 1MMNA 5B3SH 1RIOH 1DQUA 2KFDA 3TEDA 2QUFA 2DQLA 2MFZA 1RUNA 4Y7NJ 3BZCA 1U5TB 3SFZA 1VFCA 3WTVC 1T6SA 3Q5FA 4BQAA 4LG3A 1WCMJ 4ESBA 4E7IA 2XGEA 1REPC 2PJRB 3WE3A 3K4CA 3OSGA 3BOQA 3NEUA 3P7NA 1UHWA 1HQCA 3KP4A 2P7VB 3ZR8X 1IG7A 1OYIA 1V3FA 3SEQA 2X6YA 4KIBA 3T8TA 1YE9A 1W7PB 5L3EA 1HOMA 4XORA 4PK4A 2A6HF 2QKLB 1FJLA 5D5UB 3LQRA 1Y8QB 1GXQA 2HKXA 3H3ZA 5BS6A 1K4TA 1GT0C 4EJWA 4IVNA 4ZYDA 2COMA 1G8XA 3F8MA 3GO5A 2HVQA 4A3CJ 4AVZA 2DYSH 4G8XA 1GV5A 5LGTA 2IRFG 1SAUA 2OPTA 1R23A 4OWRB 3WTUC 1JT6A 4NC8A 1JTYA 2NYXA 2R3SA 2ZJ2A 4IEJA 4EJUA 4ENNA 1W5TA 2L5QA 1ZRFA 4BNCA 2VC1A 2GWRA 3DU6A 1B1BA 1E3HA 1V5FA 2ME6A 1KZHA 2R7VA 3PFIA 5E3MA 1OFCX 3HM5A 1VQMI 1J09A 3TBIA 2OTLI 2ACJA 2IGMA 3L9FA 3GTOJ 2MABA 3HOZJ 2GOXB 2WWYA 1SVLA 3OYKA 2JVHA 5ICEA 2ZXWH 3E6MA 5GTIC 3SXYA 1K61A 2M4KA 4FETA 2XAHA 1TL8A 4L5IA 1BBYA 5LBQA 5IT9Z 2EBIA 2E7WA 1B8IA 2L2OA 5CVIA 3CTAA 3RSNA 2KRCA 3CCYA 1CF7B 2I5UA 2BXYA 3G4SI 5DCMA 2LREA 2XKOA 2HOSA 4MTDA 1MSEC 1XCBA 4U0YA 1Z91A 2VPLA 2JK3A 1OYWA 2VQCA 1QRYA 2DA3A 2V26A 1BR2A 1IV8A 4XN3A 2X1EA 1ENHA 1MIJA 3K7AJ 3DTIA 2EH3A 3L2VA 4A3EJ 1DDNA 3BG5A 3FF5A 1JHFA 2ELJA 2EZIA 2XASA 3TO6A 4QPQA 5IYDJ 2KPMA 3CLQA 3OSFA 4CA0A 1NG6A 2ID6A 2L0KA 3CCRI 5GAGJ 4MQ9F 2V7FA 4H4KC 2PG4A 2LRDA 1TWFJ 1Q1HA 4D0PA 3BDDA 4N4OB 3AKZA 5M3FJ 2V1DA 5K5RA 2LH9A 5FRNA 4M6VA 5F0CA 3J80K 1Y0NA 4BQOA 1OQYA 3N05A 3U1DA 1HBXG 3BTCA 1MJ9A 2VIXA 1FWZA 3DBLB 3L1PA 3MKWB 3RPUD 3LA7A 3T0YA 2MYSA 2O3FA 1BW6A 4TV7A 1VQ4I 2JUGA 2JA7J 2JSPA 3WG9A 2E5NA 3GCMA 3SZPA 3C7JA 3CMEI 2M7BA 1YJ9I 2DK8A 2JVGA 3CUOA 3BROA 2L7FP 4BXUA 4RB1A 2V79A 5C3EJ 3VOEA 1BIAA 2CW8A 4E4HA 5ED4A 4EV0A 5ICCA 3RPQA 3ZQCA 5D4SA 1SFUA 2Z9OA 4UB6C 3PSFA 1FSHA 3BWGA 4CZCA 2E35A 1X1DA 3WU1B 4EJVA 3GTMJ 3FXQA 3PL8A 5JI6A 2XGDA 4YG2F 3TQNA 3U1KA 1F43A 3I71A 4V19K 2LBFA 2VN2A 1Z3XA 3HUGA 3CCSI 5B1BH 3OIPA 4RB2C 2VKHA 2A07F 2L9NA 4W1UA 2R7DA 1SMTA 2JMWA 4L0ZB 1TP4A 2KJBA 1Y6IA 3LAJA 3IWFA 4Y3OA 5FFZA 2JPCA 2EFPA 3BC8A 1F5TA 3ECOA 1A36A 4FISA 2HU9A 1BOBA 2DJIA 3LSIA 1MJBA 1OCCH 4A3MJ 2NNYA 1MDMB 2XF5A 3MZYA 4IHTA 2PFBA 2HVSA 1JHHA 1XCVA 5KK1A 3FMRA 3WTZA 2W48A 4IRIA 3J7AO 1VF9A 4RMNA 2ZXJA 5E1ZB 1MNMC 1IGNA 3OIQA 2P4WA 2DAOA 2M4GA 2OCEA 2X51A 3RTRA 3I4NJ 1SFKA 1ZAOA 1WH5A 4WX9A 4PSXA 5GP9A 1J0RA 1R4MB 3I9V2 3H9JA 2ECBA 1DP3A 2ETHA 2JZYA 4UVAA 3RQIA 3H5AA 5DD8A 2GIVA 1U5TA 3QP6A 1JI8A 5GADJ 1R49A 2PJRA 4U0VA 3PIOF 2IBDA 3A0BC 3OYNA 1EA3A 4ZZLA 3H3VK 3GZ5A 4EGZA 2DMQA 3RIRA 1Z05A 2E60A 3SJMA 3QAHA 1TWGJ 2K9LA 1LFPA 2XAFA 3BLYA 4XSZF 4XNFA 1W7PA 4WK8F 4ZYEA 3F6VA 1FC3A 2CSOA 4LMYA 4ITVA 4B43A 5F04A 3TW7A 4KYWA 2DFFA 5C44J 4E6KG 2X1CA 3OWTA 4HG2A 2FBHA 1P4WA 1XSDA 4A3IJ 2QCOA 1XGNA 5TGTA 2DA1A 3PO2J 5DS9A 5F1RA 4J01A 1PDNC 1WJAA 1FX7A 2K27A 3S3MA 1RRJA 1B4AA 4A0XA 4NQWA 2K9NA 2FNAA 3LNQA 4IHXA 4AU7A 3COAC 1W0TA 3H5RA 3S93A 4EJTA 3S2DJ 2E2JJ 3GFIA 5J1UA 2M8EA 4F3QA 3K4BA 3LOCA 1X3ZB 1ZHFA 2DT7B 3FIWA 3F8CA 5HLGA 1S6LA 1A35A 3NARA 5H2FC 5CYVA 1JKOC 4IHWA 5E8GA 2KIQA 3P9CA 4BUPA 2JWTA 1NK3P 3IKVA 5CJ9A 2VXDA 1IAWA 5J4YA 1WJDA 3BJAA 2GZWA 2TRTA 3SFIA 5JLWA 3U2RA 3TL4X 1OYYA 1HW1A 1I6HJ 3VDXA 1BC7C 3S3OA 5HVQC 1ITYA 3WU0A 2OCCH 1CF7A 4A5MA 3EQLF 4XN0A 3HSFA 3QP5A 3LFKA 3OYMA 1T2KA 4IHYA 2J5OA 3ABUA 4Q5SF 4BGDA 3JAMZ 3SZGA 3CP8A 3GFJA 1B72B 3FXKA 1WRJA 3IV5A 1QPIA 1H9TA 3NWTA 3V7SA 5FFXA 4PJ0C 1OCZH 1W0UA 4WWCA 4WCGA 4BH9A 2PMZN 3EETA 4GYGA 4RDUA 2LMDA 1W7PD 4MFEA 2M45A 2FBIA 1VQ6I 3DF8A 5IT3A 4ZYGA 3E97A 1FP2A 2EILH 2EZKA 2XSJC 1K7AA 2M0CA 3RZDJ 1RC9A 2B7EA 1QNTA 4NB5A 2LF7A 2XSDC 2YUSA 1I50J 3KZIC 2CU7A 5B66C 3DCFA 1S9HA 2FOKA 4F91B 2BY1A 2E1NA 5HOOA 3EPZA 2EFOA 1VQ5I 3DBHB 5DDGA 4EJOA 1YS6A 2AHQA 2AS5F 4MLOA 2B9SA 1YO5C 2XAUA 4XLCA 3W3CA 3CC2I 3CLOA 1ACIA 1IV6A 4YFXF 4M72A 1W5SA 4ZZDA 4PGGA 1OCPA 4I76A 2VJ5A 3KPHA 4BQQA 3KEOA 4KDPA 2CUEA 3FM3A 3K1MA 1HSJA 1XMAA 1JKRC 2NOJB 3BT9A 4ZTJA 4M9ZA 3DLLF 2R7OA 1FIAA 1WJFA 4M3EA 4LK1F 1K6YA 2V9VA 3HRTA 2Y0SN 1SD7A 2Y0SA 4I6ZA 2FRHA 1XN7A 1V5GA 3C3WA 5L3FA 4RAFA 1MZBA 1DPUA 2LNBA 4Y15A 4ZDLA 4CDGA 1X2NA 3PO3J 2W82A 3E6DA 1WJCA 2Z3YA 1YTYA 4GO1A 4UV8A 4R8HA 4JYKA 1LDJA 2ZMEC 4C3HJ 2DXIA 1TNSA 1I39A 2F4OB 3QODA 3N4MA 1XS9A 1MDMA 2ADUA 1TWHJ 4XLAA 4A3FJ 1FPQA 4XKWA 4BY1J 3D5SC 2OZUA 1P2FA 2Q1ZB 1ZGJA 2OA4A 1IN5A 5FO5A 4XONA 2TCTA 3J81Z 5E79C 5K7FA 2DPDA 5KNLA 1VQKI 4DOZA 3HOXJ 2M87A 1KU3A 2QQ8A 4RLFA 4G9YA 1T56A 3AG2H 3LQQA 3W2VA 3B6AA 2OAZA 4A3KJ 4HEA2 4A69C 5F0HA 2MD0A 4ABZA 3H92A 3A2KA 5DCFA 2BY3A 3JRBA 3ELKA 3LSMA 2CV2A 2JRTA 2JJ7A 3DFGA 1MBEA 1MNDA 4NUBA 1N25A 5FKLA 3S8PA 1FZPB 3GZ6A 3CQZJ 2IGOA 3AG4H 3GTJJ 1RI7A 3Q0UA 4PUSA 1WH7A 1ZH5A 5D6EA 3S2WA 3DQVC 2WAQN 4CYDA 3ECHA 1TZLA 4GRIA 1T0FA 2WAQA 5FKMA 2LKPA 3IH3A 4XM3A 4E7HA 5BNGA 1JKQC 4HLXA 2DI3A 1FP1D 1HDDC 1U9OA 2PQ8A 2F4MB 4JP0A 1X1CA 3JRDA 3F8BA 2ZB9A 5LGUA 2D1HA 2DT5A 1DU6A 3M4OJ 1MJAA 1EF4A 4UNOA 1P9QC 2XPUA 1AA7A 3VYSB 2R4GA 3TP0A 2VJIA 5HLIA 3JRCA 1F4KA 2BY2A 2QZ8A 1E3PA 3HHGA 3HRUA 1QHHD 3PIPF 2IA2A 1EV7A 2QYOA 1XC5A 2LLKA 3BG7A 3SDBA 3OYCA 4ON0A 2R7TA 3HRMA 3P9KA 3H0GJ 3PNVA 5LFAA 4IX7A 2A68F 3G1OA 3HDDA 3ZGKA 1NH3A 3T5XA 2R7XA 1T95A 4I99C 2K02A 1TWAJ 2KRHA 3G1MA 4A3LJ 1LNWA 4KT6A 5EZHA 3R6SA 1MMGA 1VI0A 5F08A 1QPMA 1Z1DA 3UR3C 1KU9A 4S05A 5JHFA 3ISPA 5F0FA 1USTA 4G6DA 4II2A 4YRVA 3E6BA 1TC3C 2Y69H 3V42A 3FM5A 4B09A 4U7DA 4OAZA 3VPRA 1YS7A 2OZ6A 1ZRCA 2HR3A 1Y1WJ 2O03A 2CQNA 1LVKA 4NDLA 4G7ZF 2DCEA 4S0HB 3EYIA 3E3VA 2H1KA 3JTHA 3ULQB 4YELA 3PFYA 1HF0A 1Z6TA 4M9SA 3FXMA 4G12A 2GXBA 2XV4S 2CUZA 2OF7A 1ZYRF 3ABLH 3KZYA 3LSGA 2HEOA 2GAUA 3VYTB 3DXJF 1MKMA 1Y56A 1B72A 5B1AH 3MVPA 4LLLA 5DD4A 2BVLA 1LDKB 1WGXA 1WFXA 3CJNA 3JRHA 2DO7A 2EIKH 1GUUA 4OIOF 1FIPA 4IZZA 4E7ZA 3ZQQA 1TW3A 5GAEJ 2BHYA 2HQNA 2LOOA 1SANA 4A6DA 3TO9A 4PJNA 4M3GA 2D1VA 4B3AA 1EJ9A 3JSPA 1OMIA 1IRFA 3CCVI 3HOVJ 3J80Z 4MEYF 1IDYA 3KCCA 3AL0C 1LE8B 3QYFA 3LL7A 2VQHA 1DU0A 2BE5F 1TT5B 2ZJRF 3GX4X 1GXPA 2L02A 2L4MA 4FE7A 3CMAI 4CXFA 3B6CA 2VPRA 5L3BA 2WAFA 2JN6A 2WV1A 5KCMA 3JW4A 1U78A 4OMYA 4BY7J 2QGUA 3JRGA 1JJ6C 2YSRA 3O8GA 4DW6A 3Q9VA 3F21A 2V1NA 1FTTA 4ENJA 1OR7C 1PUFB 2ZBKA 3ZQIA 4OINF 2DA2A 3DKWA 4B48A 2FE3A 4IRGA 2VQLA 4X1EA 3QPTA 4DYCA 3OY9A 3MKYB 1Z0XA 1A5JA 2DA5A 1N75A 4E70A 1R6RA 3HGYA 4QIWN 4S04A 4X6AJ 4ZYAA 1STZA 2Y2ZA 3ZCOA 3N97A 1VTNC 4E7JA 4RA2A 2STTA 3KP7A 3ZRGA 1U2WA 5CPRB 2P5VA 2RC4A 2KZGA 2DOFA 4EM0B 1RNLA 3GW2A 3I53A 1JE8A 4C9YA 1K78B 2V1XA 4NC6A 2KISA 2COBA 4KITB 3BJOA 3GTGJ 1USSA 3FBIB 2DQRA 3W2AA 3A0HC 4J00A 2RNJA 1I3AA 3ZQLA 1SD5A 5JLXA 1JGSA 4MQVA 2F5VA 1MGTA 5F1JA 4I98B 3OYBA 3QU6A 1TQIA 3GUDA 2H27A 1ZK8A 3QPLA 5M5WJ 3A01B 2KIUA 1ZG3A 3WHBA 2R5YA 4LLNA 2QKMB 5D4RA 1HW2A 2PBIA 4F7ZA 2Y9ZA 1ETXA 2XPVA 3RPUA 5D5VB 2IS2A 2CV0A 5CVUA 5HODA 4XQFA 2LG4A 4DYRA 1Z67A 2FQ3A 4B47A 4CCMA 3PUBA 1IZ1A 4KJZA 1RPWA 2KHMA 4C2MJ 3CCEI 1O4XA 1WPKA 3DEEA 4PSWA 3WGIA 4OAYA 4KMUX 4L5EA 3DLAA 3ABMH 4AUXA 1ETVA 3S32A 4D7MA 1Z6RA 2CV1A 1V55H 4XLNF 2WB1N 1QQIA 1WJBA 2K7LA 1YITI 1GV2A 2CFOA 2I8DA 2WB1A 3IP4B 1OKRA 2EFQA 2RV8A 4KT5C 4L9JA 2QWWA 3EUHC 3F6OA 2KKOA 4RS8A 3IL2A 4AM3A 5CQEA 1AWCA 1R1TA 1UZCA 3FHZA 2OC6A 1PVEA 1KA8A 5M5XJ 2LP0A 2PMHA 1ZREA 2R93J 1XGOA 3HXLA 1SVOA 2L9SA 2HDDA 2DW4A 5E8IA 1IXSB 1UAAA 5GTHC 5CVVA 2LR8A 1TNTA 5AIQA 3HBLA 2P81A 4W97A 2WA0A 2DOAA 2GA1A 3E5UA 2MGQA 3RZOJ 4CCJA 4RM3A 3GTPJ 4KN7X 3KIOA 4DGWB 3KEYA 4J19A 3HKZN 3QYEA 2CG4A 1ETWA 2DDAA 3DKYA 3GYHX 2X0LA 3D5RC 2BXZA 1K4SA 2RGVA 2VJJA 1ZN2A 2QENA 3GFMA 5ICFA 3L2QA 2JA2A 3ZMVA 1TWCJ 1YG2A 2VASA 4XRSG 5M5YJ 3DU5A 3OYEA 2IXSA 3E6CC 2KZVA 3CCQI 1FTZA 3P5JA 3ZMZA 1T33A 1ULYA 3FXLA 2YS9A 5IYBJ 3WTSC 1MH3A 1ODDA 2QSFX 2LYCA 3OIOA 4ANJA 2LY9A 1O3SA 1G2HA 2MD5A 1U6GA 3PQJA 4F92B 3BY6A 2QQAA 4R79A 2ISYA 3CJTB 1X2MA 1X1BA 2ZMEB 3HEFA 2L7KA 1KU7A 1HKQA 2C6YA 5FD5A 1XD7A 3PNTA 3CMMA 3CCMI 5J40A 2TDXA 3FDYA 2HXIA 4JX6A 1U8BA 2E36A 3PSIA 2IAIA 5HLHA 2K5CA 4U88A 2H8WA 2UV1A 2HQRA 3KE2A 4D5FA 2Q2EB 4V2FA 5DV5A 4Y17A 5FB2A 3TOAA 3S1NJ 3GMEA 3BZ6A 2EINH 4RB0A 5EG0B 4BHCA 3MMYB 5FKOA 5DUIA 2EFNA 2KRFA 2NS0A 2DA7A 2OQGA 4BBRJ 3D5LA 3TW6A 2MW8A 4KICA 4M73A 2BZTA 2CFXA 1KQ8A 2XGXA 4BDYA 2DT6A 3HOUJ 5A2QZ 1VZ0A 5DM7F 2Z1DA 3U9GA 3UNGC 3W2WA 2MC3A 2K3PA 1JGGA 1IRZA 3LSRA 2CH0A 3RYPA 1NTCA 1OISA 4BEHB 1LDDA 3I59B 1JKPC 2A5WA 2VT3A 3ZP5A 4NHJA 5JFRA 2P5KA 2A6EF 3TO7A 1XGMA 1NK2P 4C2UA 3C2HA 2VLAA 2K86A 2D5VA 2QVOA 2QF7A 5D6FA 1GVJA 1P4XA 3O3KA 1W36C 3BTJA 3CCJI 4PJMA 1D8KA 4RAZA 1WJ5A 4ZDOA 5ILSA 3L2WA 3K9TA 3ESWB 1E3OC 2EWNA 4HF2A 1HSTA 1L3LA 1ZG1A 4M6YA 5FLXK 5CQGA 3V7CA 9ANTA 3H0DA 3VYRB 3K0LA 3ASOH 3BG6A 4OIRF 3RI4A 3LAPA 4IO9F 1R9TJ 3CESA 1BM9A 4HQMA 2M1BA 1RZ4A 1FYKA 1QU3A 1MBHA 2VKDA 2HGCA 3IH4A 3K4NA 2X48A 5LGNA 1IN6A 2IP2A 1DGWY 2IA0A 4ZYHA 1K78A 4UUSB 3C1DA 4QSHA 2VKVA 1G3SA 4A3DJ 2KP6A 2BHZA 3KP3A 3HZJA 1OPCA 5C4XJ 3AG1H 3ONQA 2E1OA 3OV8A 4HDUA 4E7SA 3O2PE 3NAUA 5IP7J 1W36D 1U0JA 3JCUC 2VI6A 4P5OA 2F2EA 3A01A 3H3UA 4FHTA 3HRSA 1FNNA 4DIQA 2VL8A 2PLYA 4HNVA 2Q0OA 1TQMA 1JUSA 2W4SA 3MFKA 3GEZA 2G7HA 4CHUA 1NHAA 1ZLJA 1XGSA 2GQQA 1I1GA 1I3QJ 3E5QA 3SHFA 2HWVA 5DYMA 2DA6A 1OCTC 4RGXA 1UHMA 4II3A 1BI0A 2F48A 3R0AA 5LRRA 2L7MP 4B4CA 3ZQHA 4MTEA 2ZXIA 5J1RA 3S2HJ 4BE0A 2O61A 3RKXA 1RKWA 1O7LA 2PEXA 1AU7A 2R7WA 1YQAA 1O3TA 3GWZA 1B6AA 5EGOB 3ZMSA 1K79A 1D0XA 2GA2A 4DNCA 2HPMA 3AL0B 1G3WA 4QTRA 2RKHA 2RREA 2VODA 4ENMA 1HC8A 1YIOA 2L7ZA 5LHIA 3LSPA 2XIGA 4KIGA 2GXAA 3FZVA 1X3WB 3K70C 3L2UA 3NRVA 1D1CA 2G0EA 1GLNA 4HV6A 1A04A 1SEUA 2RQPA 2R5ZB 1IW7F 1D1BA 4FE4A 2QM3A 3CF5F 3FKIJ 4FQGA 3CDHA 3IUOA 4I7HA 5IY5H 2GOMA 3PJRA 2HKOA 4PFPA 3ZQFA 4CUGA 2PMZA 4EQQA 3LMMA 5FLMJ 1VQOI 4F52A 3Q9SA 1YOVB 2XB0X 3HHHA 1H8AC 3HGGA 2XF7A 2CYYA 2K40A 4XOPA 2EZHA 4HPQA 4KN4X 3W6JB 2RAEA 5IP9J 3ZXSA 4AIKA 3PQKA 1BJZA 3JR9A 2LD5A 4EATA 1A31A 2CUJA 3BJ6A 4G6TB 4UVCA 3V8KA 1YW7A 3HJEA 4GXOA 1UELB 3BR6A 2DMNA 5HDGA 1PP8F 3JSOA 3K70D 1G4DA 2HOEA 4JK1X 2DYRH 4BBSJ 1ZGWA 2ZKZA 3M9AA 2K85A 3PNYA 2IEKA 2ZMEA 4A0YA 2Q8KA 3TDUC 3K4LA 4XKVA 3BCAA 4M3DA 3CC7I 3G2BA 4HAMA 2DA4A 4UVBA 2KIFA 3S16J 2QQ9A 3ZQ7A 1KQ0A 5CVRA 4OU0A 3MKZA 4G94A 4LLGF 3CUQB 2Q2EA 4HF0A 4HSRA 1YRNB 1GHCA 1X1PA 1PUEE 2L4AA 1G6NA 2ZJQF 3GTKJ 1G3YA 3OOPA 4XMYA 3F23A 1EH8A 1IN7A 3BPVA 5EG0A 1S5LC 4LITA 4D5CA 4A12A 1LUJB 4G7OF 2MLKA 2UZKA 3IH2A 2ME0A 3ABTA 1AHDP 2P8TA 1YJWI 3DEWA 4RGUA 1UG2A 4JX5A 2FBKA 1V54H 2V9PA 3F8NA 1IRXA 3EDPA 5LEJA 3K4KA 3QRFF 3DKXA 3QU3A 1IN4A 3HB9A 2Y0MA 2LY2A 4RGSA 3CC4I 3LA2A 2NNNA 4AIJA 2VUMJ 3KZZA 3K6GA 2VBWA 4M3FA 2IGKA 4HYEA 1OCOH 5IOYA 2VT2A 5HNFA 3MN2A 2JQ7A 2UUZA 1YX5A 3GXOA 4BEHA 2J5PA 5K7ZA 3I59A 2HS5A 3E5XA 3WTTC 1LFBA 2JT1A 4MO7A 5GPAA 3CO6C 2VOPA 1EH7A 1Y8RB 1EKEA 3MWMA 4A93J 1L0OC 2I10A 1DGRM 1TBXA 2E1MB 4XICA 4FTHA 3M1EA 2VB6A 2UWMA 5GAHJ 3HOWJ 3AG3H 2IPQX 2HNHA 5LRSA 4N4NB 3ASNH 4A0ZA 4HBLA 4DBQA 2F5EA 2VONA 1D3YA 2D2WA 1MD0A 4ENKA 2W7NA 1LQ1A 2X85A 3LA3A 2BW3B 1P7JA 2OUMA 1WJEA 2WTEA 3OYFA 4HDVA 2MSYA 2NVYJ 1LPQA 3ERMA 1YI2I 1WSUA 2OTJI 4BL0B 1LEBA 1R58A 3F3XA 2H6BA 4BXFA 1J7KA 2VOOA 3HPHA 4B1RA 2ZC2A 4UB8C 1NG7A 1SFXA 4YEJA 1X4PA 2ZJPF 2CMPA 2G9WA 3Q0WA 4N0BA 2RDPA 2DDBA 3I3LA 1SAXA 3P9IA 2BY0A 5TJJA 4LG0B 1J9IA 3B73A 2HQAA 4Y33A 3GTQJ 2HVRA 1IUYA 2NS7A 2DK5A 3L7WA 5L3GA 1O7FA 1Q1VA 5LHGA 1Z3YA 2WADA 3JREA 2K9QA 3K2AA 4UUSA 1UMQA 3QPHA 5H6QA 3W6KB 3MKLA 1QZZA 4IF4A 4JOMA 4XLHA 2GM4A 3K1NA 4XRMA 2FX0A 4WF2A 2ICWG 5E3LA 3MZ8A 3WGGA 2P6SA 1Z21A 1IO2A 2M2EA 2HQ5A 1SC7A 1X58A 2GXGA 5HDKA 1XX5A 2V6CA 3BR0A 4YIFA 1B8IB 2YR2A 3Q0VA 3OS1A 1FMVA 1UB9A 2DMTA 2H09A 5E3NA 3OYAA 1IF1A 3QPSA 1ETOA 2P0WA 1V5EA 3DV8A 1AKHB 1F36A 2L9RA 3OYLA 2XPWA 2V6EA 4LK0F 4GCVA 2W25A 2QQBA 2X1DA 4UUTA 2UXXA 4P9UA 5CLSA 1RETA 2M34A 2FD5A 3CDIA 1HKTA 3JAMK 3DWLE 4CCOA 2DU9A 5JHUA 4AC0A 2RN7A 4BKXA 4HX8A 3HTSB 4M74A 2DTRA 2B0LA 5IOZA 4OIPF 2KJCA 3WTWC 4MIMA 1WI3A 5KVRA 2ESHA 2Y9YA 1S8NA 4IRHA 3O6BB 4D7NA 1H0MA 2V1UA 5EGOA 2O7OA 4U0WA 3QQAA 1P7IA 4BE2A 1KONA 2FJ1A 3I0TA 4Z2YA 3VYUB 3IAS2 1IDZA 2F5DA 3JRIA 2ZSHB 1A6IA 2F5CA 2O0YA 3TOBA 2E7XA 2VE9A 3CZ6A 5EDNA 1XDSA 2Z5UA 4CSWA 2IS1A 2XGCA 1D0YA 2LDUA 2O8KA 2R5ZA 5FRMA 2WY8Q 4LFUA 1QZEA 2OJED 2DLLA 5HS9A 2MH2A 3V7RA 4YIIA 3HIFA 4FASD 3GLLA 3CCUI 2EPFA 2MBFA 3REOA 1OR7A 2KDOA 2IS6A 1FEXA 2PN6A 1QZYA 5D5XB 2FSWA 3K10A 4IQJA 2O8XA 1MMDA 2FNPA 1RKTA 3DEUA 5AIPA 4AWXB 5J3LA 3NQOA 1SMYF 2O6GE 2M30A 2DFEA 4BHBA 3B02A 3F22A 3BQYA 3X2QH 2YU3A 3F72A 2R7QA 1U8RA 3S14J 2Y31A 2XUBA 3SEZA 3RCOA 1BR4A 2FMYA 3DPLC 3T8RA 4AD9A 2JA5J 3M8FA 2L3DA 2CRGA 4ZTFA 1GVDA 3JRAA 2Y48A 2BVMA 4OOIA 3VODA 5C4JJ 4IHSA 4L0YB 4LB5A 2KLOA 3DBRB 5FJ8J 4JQFA 4BJ5C 3L00A 2Z99A 3CP2A 4FX4A 2R7UA 3GF2A 2R0QC 1HDPA 3GFLA 5HDNA 2NVQJ 2HYFA 1XDUA 1Y1VJ 2W57A 2EV0A 2LKSA 4M6XA 2LSOA 2A3SA 2M9HA 1DPRA 2GBYA 1PYVA 3FXOA 2HTJA 1BOAA 3EYYA 2BBYA 1BW5A 5BQTA 2HPIA 5F27A 1YRNA 2VE8A 4N9HA 4EM1A 4UUVA 5J47A 1G3TA 1APLC 3OL3A 5KAIC 1IC8A 4IHVA 3K4JA 2HZTA 4C2TA 1JJ8C 4M3BA 2EQRA 3LFUA 2K3FA 3BQZA 1E2XA 2JSCA 4DQ2A 1KU2A 3HSRA 2EV6A 4F93B 3KETA 1BIBA 5FGMA 4XLFA 5E1WA 3BR3A 3OS2A 1ON2A 1FOWA 4N9IA 4MFDA 3EUHA 2OD5A 4RB3C 4Q4ZF 1SD4A 2AQEA 1FT9A 2NXNB 4G7HF 4P96A 1F9NA 3RKQA 2K4JA 2STWA 5BPIA 4CICA 4B44A 2R92J 4KUMA 5AONA 4ASNA 2HFHA 4C3JJ 4XRSA 3VSLA 2H94A 2O9LA 1FMWA 2YPRA 3FMSA 3L09A 3FISA 3CUQC 2LVSA 3MAJA 1TTYA 4MHGA 3FXJA 1GDTA 1ORKA 2IT0A 4DZJA 4LOCA 2DMPA 4KFCA 5BMZA 2BW3A 2LTPA 1ZR4A 1WZ2A 3OR2C 5FLXZ 1X4OA 2CO5A 2EV5A 3EUKL 5CVJA 1R4NB 4NQWB 3BR2A 1I5ZA 2CGPA 4KMFA 2A5YB 4XOTA 2LC2A 4HX4A 4IQ4A 3SYTA 3BZKA 1R5ID 2H8RA 4PGHA 2AXLA 1Y39A 3KX2A 1R00A 3IRRA 2IA1A 4NBQA 5B5EC 4LG0A 2P5LC 3FXUA 1S29A 2HZDA 4LD5A 3GLXA 2FQ4A 4QPOA 2IW5A 2EA4A 1QO0D 3HOSA 2L01A 4D1QA 1O3QA 3NWSA 3I4MJ 3RDIA 1POGA 2E1MC 3VWBA 5LLQA 1WVRA 4BYYA 1LKXA 1R5HA 2VKEA 1SD6A 4I0BA 2D45A 1E0EA 1VQ7I 3C18A 4AVPA 4O5VA 4Q48A 2LY1A 1J5YA 4BS9A 3CJRB 4GDFA 1MBFA 4YFKF 4UY8I 1MMSA 3AFHA 2V9KA 3JRFA 3M8EA 3CJQB 1ON1A 3HKZA 4NNJA 3OL4A 3BPXA 5E20A 1PP7U 3OYIA 1AKHA 3QWLA 4BJTA 4Y13A 3IKTA 1N77A 4DBRA 3S3NA 3RKYA 3I55I 2FMLA 3WE2A 2W24A 2FA5A 4HV5A 2IS4A 3RYRA 1H9GA 4Y4RA 3GZNB 2KDZA 1SFEA 1UHSA 2DBBA 1E17A 2XAGA 3H1CA 3H9GA 1TT0A 2VXZA 2LFBA 2QBYB 4I01A 2YU9J 4P55A 4JBAA 1MBJA 3IC7A 5HLTA 3JTGA 2VBYA 3LWFA 3WHCA 5LHHA 1XG1A 1LVAA 2XB5A 2JTVA 3S15J 5J8CA 3HSEA 3F0CA 1D8JA 5EYRA 4LIVA 3OMYA 3K2ZA 5E17F 4V2GA 4Q47A 2K9MA 1ZGAA 3KLOA 1FLIA 1U3EM 4XLPF 1DP7P 1VNDA 3SQNA 4BACA 2CQKA 1D0ZA 6PAXA 2XRNA 3BG9A 3FX3A 3PUFA 1FYLA 5CKTA 2ZNYA 5DM6F 3BR1A 1XSVA 4L9TA 2HI3A 1ZTRA 4RM2A 4XR6A 1BR1A 2OQRA 4RLQA 4CYCB 4O3MA 2DJNA 2EK5A 2FF4A 2DFHA 2EIJH 2R7FA 3KP6A 4BU2A 4BAYA 5TRDA 1JXSA 1B9MA 2CS3A 2NVXJ 4KIFA 2B63J 4EMSA 3C2GA 5FKNA 1JT0A 3HG9A 2P7CB 4BJ6C 5DEQA 4CCLA 1K6OA 3KLNA 1WWXA 2E5ZA 2ZFWA 4M71A 4GYIA 4PDKA 1FBQA 1P6RA 2MLGA 4E7KA 3HOYJ 2DTZA 1LE8A 1BL0A 1BJAA 2QA4I 3VSKA 3A03A 1S7EA 1W4MA 3OS0A 3UKGA 5FKKA 1J2XA 3S1QJ 1KGSA 2MA3A 4U7BA 1HA8A 2F5FA 1JUMA 1LFUP 5EEGA 1T38A 2OBPA 1I1SA 3M8JA 1RUOA 5EEHA 1TLHB 1TW2A 2DPUA 4U87A 2MH9A 2VBXA 2HDWA 3BTIA 4ZDPA 2HOAA 4HOBA 1PUFA 3BG3A 4BHPA 2PI0A 2EIMH 2BEOA 2E2HJ 4AIDA 2A69F 2ESNA 3I58A 4I09A 3KYCB 1YIJI 1R22A 3WGHA 1UFMA 1S7OA 3I4PA 3E7LA 5GPCA 5LD2C 2E1CA 2QEXI 1R7JA 3M07A 3FKJA 4JX4A 1FOKA 4ZC3A 2ELKA 2X9DA 5FD6A 3CCLI 1K83J 1FOXA 3R4KA 5D8LB 2BGCA 5JR3A 2LF8A 3E1SA 4EEFG 5L3DA 4PCQA 2VC0A 5TISC 4CZZA 3TMOA 2HDCA 4ESFA 1QHGA 2RQQA 2JUCA 2NRAC 2RNGA 1ETYA 2EFWA 1XSXA 3WTXC 3J7YJ 1O3RA 3ML6A 1P4AA 3ZQGA 1ONVA 3FMQA 1OJLA 3WODF 2LK2A 1HW5A 2XC7A 1J59A 2EB7A 2XKPA 4HRIA 4CH7A 4I02A 2EZLA 3C2BA 3MZHA 5IT9K 5FROA 2DODA 4O6JA 3LSHA 3Q3SA 1SVMA 4LJZF 3OOUA 5BPDA 3KYDB 5EF6A 1CGPA 3LSTA 1C0WA 1X19A 2ELHA 5DUKA 1WQ2A 4YFNF 2A05A 4BXXJ 2KIMA 2WAEA 2WY7Q 1Z7LA 3K4MA 5BOXA 4IOAF 4HLYA 2FOWA 3AAFA 3IRQA 3FK6A 5IP6A 1SFOJ 3ZN1A 4KISA 4XBFA 3I56I 2BV6A 2MC4A 4L9NA 4MNUA 1ZLKA 2AQFA 1U5TC 2YX7A 2NS8A 5JVTA 1MW7A 1T98A 2XDVA 1IUFA 3I5UA 3CD6I 3G71I 4P9FA 3RKWA 2ZFUA 2JA8J 3KP5A 3KYLA 1BN5A 1EH6A 2L54A 2FXAA 2G7UA 3I64A 2K4BA 1Y0UA 5H20A 2IJLA 1YHQI 2X6OA 4XKBA 3O8HA 3ZMTA 3LSJA 1UJ8A 3J7AY 2Z16A 1D5VA 3CF2A 3HYIA 3G1LA 3M1CA 5ICGA 4IPAA 2IGNA 2W84A 1FOYA 3QOEA 1RR7A 4A5NA 1WKMA 1TQPA 1H88C 1BC8C 3BP8A 1B59A 4A3JJ 3FBNB 3KP2A 1J75A 1ZQ3P 2BOLA 3ZOBA 1ZKGA 2KQRA 1IJWC 2GLOA 2HXOA 2CQQA 3H36A 4XSXF 1LB2A 1DUXC 4I2OA 4G6QA 1W1WE 2W00A 2XAQA 4ZJZA 5KHDA 2PJPA 3MD2A 3RQ4A 2FUG2 1RESA 1MBKA 2Y30A 4HF1A 4Z6YA 3SZTA 3DP7A 4PJJA 3VB2A 1VQ8I 4LIUA 1OCRH 1IXRC 1YYVA 5K7HA 5J4VA 2K9SA 1D5YA 4LB6B 4QWQA 3G73A 2M3AA 2AXTC 2KL4A 1FBUA 2E71A 2QBYA 3KEQA 4NC7A 4IJAA 3IAM2 2N8GA 1FBSA 1Z9CA 2MG4A 4BQNA 4XLEA 2M5WA 3MQ0A 2ZXHA 2XAJA 2AO9A 5E18F 5A2QK 1YJNI 1ETKA 1MSFC 3GBGA 2Y75A 3G3ZA 4CCKA 3DTKA 3HOTA 4GGGA 4AYBN 1FYMA 4ETSA 2RVCA 4RAGA 2W85A 4UHTA 5HS8A 5IPAA 4UV9A 2OU2A 3DTEA 4AYBA 4XK4A 3H9QA 2CW7A 3ZN0A 4BE1A 2EJRA 4FT8A 3GTLJ 3OYGA 1R71A 4C3IJ 5F64A 3BTLA 2P6TA 3S1RJ 1XB4A 4CCNA 2R7RA 1BA5A 4XRFA 2WV0A 1FY7A 1Z7UA 3FK7A 3IHUA 3LSKA 4CYCA 2L9VA 4R1HA 1XTAA 1XMXA 2F4IA 3WTYC 2VQGA 2JRMA 4I0AA 1YX3A 3L2RA 4L18B 2QSHX 4IOCF 3ABKH 2OV7A 4H0EA 3SDGA 3WG7H 4WXHA 1O57A 2CJJA 3CMYA 1Z77A 3K1PA 3S1MJ 4RAYA 1UCRA 2DMUA 3FWEA 2QLZA 3U21A 2M7AA 2ZCWA 2BYVE 2W1OA 1HXDA
chains in the Genus database with same CATH topology
3V4GA 3HTUA 2XVCA 1X3UA 2WC2A 2Z33A 5L3CA 1P92A 1LEAA 3ZMDA 1YW8A 4WXDA 1ZG5A 1KYZA 4ZH4F 1S7AA 3ZPLA 4KA4A 2UXNA 2CWEA 4HQEA 4QLCU 3GVAA 4WXCA 2ZNZA 4ESJA 4L5JA 4MEXF 5F6FA 2JPBA 2X4HA 3F8FA 2FU4A 5E1XA 3QOPA 2H6CA 1YW9A 5LEKA 5ERIA 4MGRA 1BI3A 1KYWA 1YLFA 3TDZC 1IN8A 4EVIA 1T39A 1ZARA 4A6EA 3MCZA 1R1VA 3M7GA 4M9XA 5DCMB 1YFHA 4HW0A 5J6XA 4EGYA 3MEXA 5ILVA 4CO8A 4EM2A 2EA2A 3V8JA 4A2UA 1I27A 5H6RA 1IRGA 1BI1A 1BI2A 4LGWA 5D5WB 2XHKA 4FX0A 4HZFA 4OMZA 4HA8A 1XMKA 3D0SA 3RJPA 5D8KB 3TGNA 3KFWX 2ISZA 4IXAA 2CW0F 1F1ZA 5HS7A 2HYGD 4K2EA 3ERED 4L9VA 4UXNA 2IVMA 4HX7A 2NAZA 1R1UA 4KNYA 4OIQF 4AIHA 2YX4A 3L2CA 3DPTA 1S3JA 5K1YA 2ZO4A 3ZMUA 1KQ9A 1IXCA 3FXRA 1AOYA 2VBZA 4B8XA 3T1BA 2XROA 2PMUA 3R0JA 1ZRDA 2HTSA 3VEPA 4PZJA 1FSEA 3TKYA 2DFIA 4CGZA 3IWZA 5K5QA 2A61A 2FEZA 5J8FA 1QGPA 5K5OA 3V8LA 3CUQA 3K69A 1V4RA 1R36A 3R60A 1HKSA 3VFZA 3I54A 3R61A 1LJ9A 5ILUA 1R5GA 3J81K 3CO7C 1I6XA 3ROUA 1B9NA 1QBJA 4RGRA 1WI9A 1RIOH 2QUFA 2DQLA 1RUNA 3SFZA 1U5TB 3WTVC 1T6SA 3Q5FA 4BQAA 4ESBA 1REPC 3WE3A 3BOQA 3NEUA 3P7NA 1UHWA 1HQCA 3KP4A 2P7VB 1OYIA 1V3FA 4KIBA 3T8TA 1W7PB 5L3EA 2A6HF 5D5UB 3LQRA 2HKXA 1GXQA 3H3ZA 5BS6A 4EJWA 4IVNA 4ZYDA 2COMA 3F8MA 3GO5A 4G8XA 5LGTA 2IRFG 1R23A 3WTUC 2NYXA 2R3SA 2ZJ2A 4EJUA 4ENNA 1W5TA 1ZRFA 4BNCA 2VC1A 2GWRA 1B1BA 3PFIA 2ACJA 3L9FA 2WWYA 5ICEA 3E6MA 3SXYA 2XAHA 4L5IA 1BBYA 5LBQA 5IT9Z 2E7WA 5CVIA 3CTAA 1CF7B 5DCMA 2XKOA 4MTDA 1XCBA 4U0YA 1Z91A 1OYWA 1DDNA 3FF5A 1JHFA 2XASA 3TO6A 4MQ9F 2PG4A 1Q1HA 4D0PA 3BDDA 2V1DA 5K5RA 3J80K 1HBXG 3U1DA 1MJ9A 1FWZA 3LA7A 3T0YA 2O3FA 4TV7A 3WG9A 3SZPA 3C7JA 2DK8A 3CUOA 4BXUA 3BROA 4RB1A 2V79A 3VOEA 1BIAA 5ED4A 4EV0A 5ICCA 3RPQA 5D4SA 1SFUA 2Z9OA 1FSHA 3BWGA 3WU1B 4EJVA 3FXQA 5JI6A 4YG2F 3TQNA 3I71A 2VN2A 3HUGA 4RB2C 2A07F 2R7DA 1SMTA 4L0ZB 2KJBA 3LAJA 3IWFA 5FFZA 2JPCA 2EFPA 1F5TA 3ECOA 1MJBA 2NNYA 1MDMB 3MZYA 4IHTA 2PFBA 1JHHA 1XCVA 5KK1A 3FMRA 3WTZA 4IRIA 3J7AO 2ZXJA 5E1ZB 2P4WA 2DAOA 3RTRA 1ZAOA 4WX9A 1J0RA 2ETHA 2JZYA 4UVAA 5DD8A 2GIVA 1U5TA 3QP6A 4U0VA 4ZZLA 3GZ5A 4EGZA 3RIRA 1Z05A 3QAHA 2XAFA 4XSZF 1W7PA 4WK8F 4ZYEA 3F6VA 1FC3A 2CSOA 4LMYA 4KYWA 2FBHA 1P4WA 1XSDA 1XGNA 5F1RA 1PDNC 1FX7A 2K27A 1B4AA 4A0XA 4NQWA 2FNAA 3COAC 4EJTA 3GFIA 2M8EA 1ZHFA 3F8CA 5HLGA 1S6LA 5CYVA 5E8GA 3P9CA 3IKVA 5CJ9A 1IAWA 3BJAA 2GZWA 3U2RA 1OYYA 1HW1A 1BC7C 5HVQC 3WU0A 1CF7A 4A5MA 3EQLF 3HSFA 3QP5A 3LFKA 1T2KA 2J5OA 3ABUA 4Q5SF 3JAMZ 3GFJA 1WRJA 1H9TA 3V7SA 5FFXA 4WWCA 4WCGA 4BH9A 3EETA 4GYGA 1W7PD 2M45A 2FBIA 3DF8A 5IT3A 4ZYGA 3E97A 1FP2A 1K7AA 1QNTA 4NB5A 2LF7A 2FOKA 5HOOA 2E1NA 2EFOA 5DDGA 4EJOA 1YS6A 2AS5F 1YO5C 3CLOA 4YFXF 4M72A 1W5SA 4ZZDA 4PGGA 4KDPA 3KEOA 3FM3A 3K1MA 1HSJA 1XMAA 4M9ZA 4LK1F 2V9VA 3HRTA 1SD7A 2FRHA 1XN7A 3C3WA 5L3FA 1MZBA 1DPUA 2LNBA 4Y15A 4CDGA 3E6DA 2Z3YA 1YTYA 4GO1A 4UV8A 4R8HA 1LDJA 1TNSA 3N4MA 1MDMA 2ADUA 1FPQA 2OZUA 1P2FA 1ZGJA 2OA4A 1IN5A 5FO5A 3J81Z 2DPDA 2M87A 1KU3A 4G9YA 3LQQA 2OAZA 3H92A 5DCFA 3ELKA 2JRTA 3DFGA 1FZPB 3GZ6A 1RI7A 1ZH5A 5D6EA 3S2WA 3DQVC 4CYDA 3ECHA 1T0FA 2LKPA 4HLXA 2DI3A 1FP1D 2PQ8A 3F8BA 5LGUA 2D1HA 2DT5A 1MJAA 4UNOA 5HLIA 1F4KA 2QZ8A 3HHGA 3HRUA 2IA2A 1EV7A 2QYOA 4ON0A 3HRMA 3P9KA 2A68F 3T5XA 2K02A 1LNWA 3R6SA 1QPMA 1Z1DA 1KU9A 4S05A 3ISPA 1USTA 4G6DA 3E6BA 3FM5A 4U7DA 4B09A 1YS7A 2OZ6A 1ZRCA 2HR3A 2O03A 4G7ZF 3EYIA 3E3VA 3JTHA 3ULQB 1Z6TA 4M9SA 2GXBA 2XV4S 1ZYRF 3KZYA 2HEOA 2GAUA 3DXJF 1MKMA 4LLLA 5DD4A 1LDKB 3CJNA 2DO7A 4OIOF 1TW3A 2HQNA 4A6DA 3TO9A 2D1VA 3JSPA 1OMIA 1IRFA 3J80Z 4MEYF 3KCCA 2BE5F 3GX4X 1GXPA 2L02A 2L4MA 4CXFA 5L3BA 3JW4A 1U78A 4OMYA 2YSRA 3Q9VA 3F21A 4ENJA 2ZBKA 4OINF 3DKWA 2FE3A 4IRGA 3QPTA 4E70A 4S04A 1STZA 3N97A 1VTNC 2STTA 3KP7A 1U2WA 2P5VA 2RC4A 4EM0B 1RNLA 3GW2A 3I53A 1JE8A 1K78B 2V1XA 3BJOA 1USSA 2DQRA 2RNJA 1SD5A 1JGSA 4MQVA 1MGTA 4I98B 3QU6A 1TQIA 3GUDA 2H27A 2KIUA 1ZG3A 4LLNA 5D4RA 1HW2A 2PBIA 4F7ZA 5D5VB 3RPUA 5CVUA 2FQ3A 1IZ1A 3WGIA 4KMUX 1Z6RA 4XLNF 1QQIA 2K7LA 4KT5C 1OKRA 2EFQA 2RV8A 4L9JA 2QWWA 3F6OA 2KKOA 4RS8A 3IL2A 1AWCA 1R1TA 3FHZA 1KA8A 2PMHA 1ZREA 1XGOA 2DW4A 5E8IA 1IXSB 5CVVA 1TNTA 5AIQA 2GA1A 3E5UA 4KN7X 2CG4A 3GYHX 2X0LA 2RGVA 1ZN2A 2QENA 3GFMA 5ICFA 3ZMVA 1YG2A 3E6CC 3ZMZA 1ULYA 3WTSC 1ODDA 1O3SA 2MD5A 1U6GA 3PQJA 3BY6A 2QQAA 4R79A 2ISYA 2ZMEB 1KU7A 1HKQA 2C6YA 5FD5A 1XD7A 2TDXA 5HLHA 4U88A 2HQRA 3KE2A 5DV5A 4Y17A 5FB2A 3TOAA 3BZ6A 4RB0A 4BHCA 5DUIA 2EFNA 2KRFA 2NS0A 2OQGA 3D5LA 4KICA 4M73A 2CFXA 1KQ8A 2XGXA 5A2QZ 3U9GA 2MC3A 3RYPA 1LDDA 3I59B 2VT3A 3ZP5A 4NHJA 5JFRA 2P5KA 2A6EF 3TO7A 1XGMA 2K86A 2QVOA 5D6FA 1GVJA 1P4XA 3O3KA 1D8KA 4RAZA 5ILSA 3K9TA 2EWNA 4HF2A 1HSTA 1L3LA 1ZG1A 4M6YA 5FLXK 3V7CA 3K0LA 3RI4A 4OIRF 3LAPA 1BM9A 4HQMA 2M1BA 1RZ4A 1FYKA 2HGCA 5LGNA 1IN6A 2IP2A 2IA0A 4ZYHA 1K78A 3C1DA 1G3SA 3KP3A 1OPCA 3OV8A 4HDUA 3O2PE 4P5OA 2F2EA 3H3UA 4FHTA 3HRSA 1FNNA 2PLYA 2Q0OA 1TQMA 3MFKA 3GEZA 2G7HA 4CHUA 1NHAA 1ZLJA 1XGSA 2GQQA 1I1GA 3E5QA 3SHFA 2HWVA 5DYMA 4RGXA 1UHMA 5LRRA 1BI0A 3R0AA 4MTEA 2O61A 3RKXA 1O7LA 2PEXA 1YQAA 1O3TA 3GWZA 1B6AA 1K79A 3ZMSA 2GA2A 4DNCA 1G3WA 2RKHA 2VODA 4ENMA 1YIOA 5LHIA 2XIGA 4KIGA 3FZVA 3NRVA 4HV6A 1A04A 2RQPA 1IW7F 2QM3A 3CDHA 4I7HA 2HKOA 4EQQA 3Q9SA 3HHHA 2CYYA 4KN4X 3W6JB 4AIKA 3PQKA 3BJ6A 4UVCA 3V8KA 1YW7A 4GXOA 5HDGA 1PP8F 3JSOA 1G4DA 2HOEA 4JK1X 2ZKZA 3M9AA 2ZMEA 4A0YA 2Q8KA 3TDUC 4HAMA 4UVBA 2KIFA 2QQ9A 3ZQ7A 1KQ0A 5CVRA 4OU0A 4G94A 4LLGF 3CUQB 2Q2EA 4HF0A 1GHCA 1PUEE 2L4AA 1G6NA 1G3YA 3OOPA 3F23A 1EH8A 1IN7A 3BPVA 4A12A 4G7OF 2MLKA 2UZKA 3ABTA 2P8TA 4RGUA 2FBKA 3F8NA 3EDPA 5LEJA 3QRFF 3QU3A 1IN4A 2Y0MA 4RGSA 3LA2A 2NNNA 4AIJA 3KZZA 2VBWA 4HYEA 2VT2A 3GXOA 2J5PA 3I59A 2HS5A 3E5XA 3WTTC 3CO6C 2JT1A 2VOPA 1EH7A 3MWMA 1L0OC 1TBXA 2UWMA 3M1EA 2IPQX 5LRSA 4A0ZA 4HBLA 2F5EA 2VONA 1D3YA 2D2WA 1MD0A 4ENKA 1LQ1A 3LA3A 2WTEA 4HDVA 1WSUA 1LEBA 1R58A 3F3XA 2H6BA 2VOOA 1J7KA 1SFXA 2G9WA 4N0BA 2RDPA 1SAXA 3P9IA 5TJJA 4LG0B 1J9IA 3B73A 1IUYA 2DK5A 3L7WA 5L3GA 1O7FA 5LHGA 3QPHA 5H6QA 3W6KB 1QZZA 4IF4A 3K1NA 4WF2A 3WGGA 2P6SA 2GXGA 5HDKA 2V6CA 4YIFA 2YR2A 1UB9A 2H09A 1IF1A 3DV8A 4LK0F 4GCVA 2W25A 2QQBA 4P9UA 2UXXA 5CLSA 1HKTA 3JAMK 2DU9A 5JHUA 2RN7A 4HX8A 3HTSB 4M74A 2DTRA 2B0LA 4OIPF 2KJCA 3WTWC 5KVRA 2ESHA 1S8NA 4IRHA 3O6BB 1H0MA 2V1UA 4U0WA 3I0TA 4Z2YA 2F5DA 2F5CA 2O0YA 3TOBA 2E7XA 2VE9A 1XDSA 2Z5UA 2LDUA 4LFUA 2DLLA 5HS9A 2MH2A 3V7RA 4YIIA 3HIFA 2MBFA 3REOA 1OR7A 2PN6A 1QZYA 5D5XB 2FSWA 2O8XA 5AIPA 4AWXB 2FNPA 3DEUA 2O6GE 3NQOA 1SMYF 2M30A 4BHBA 3B02A 3F22A 2YU3A 3F72A 1U8RA 2XUBA 2FMYA 3DPLC 3T8RA 4AD9A 3M8FA 2L3DA 2Y48A 3VODA 4OOIA 4IHSA 4L0YB 4LB5A 4JQFA 3L00A 2Z99A 4FX4A 3GF2A 3GFLA 5HDNA 2HYFA 1XDUA 2W57A 2EV0A 4M6XA 2LSOA 2A3SA 1DPRA 2HTJA 1BOAA 3EYYA 2BBYA 5BQTA 2VE8A 4N9HA 4EM1A 4UUVA 1G3TA 2HZTA 1E2XA 2JSCA 4DQ2A 1KU2A 3HSRA 2EV6A 3KETA 1BIBA 5FGMA 5E1WA 1ON2A 4N9IA 3EUHA 2OD5A 4RB3C 4Q4ZF 1SD4A 1FT9A 4G7HF 4P96A 1F9NA 2K4JA 2STWA 5BPIA 4CICA 4KUMA 5AONA 4ASNA 2HFHA 2H94A 2YPRA 3FMSA 3L09A 3CUQC 3MAJA 1TTYA 4MHGA 2IT0A 4KFCA 5BMZA 5FLXZ 2CO5A 2EV5A 5CVJA 1I5ZA 2CGPA 4KMFA 2A5YB 4HX4A 4PGHA 2AXLA 1R00A 3IRRA 2IA1A 2P5LC 4LG0A 3FXUA 1S29A 4LD5A 3GLXA 2IW5A 2EA4A 1QO0D 3HOSA 2L01A 1O3QA 3RDIA 5LLQA 4BYYA 1R5HA 4I0BA 1SD6A 2D45A 3C18A 4AVPA 4O5VA 4Q48A 1J5YA 4YFKF 3M8EA 1ON1A 3BPXA 5E20A 1PP7U 4Y13A 3IKTA 3RKYA 2FMLA 3WE2A 2W24A 2FA5A 4HV5A 3RYRA 1H9GA 1SFEA 2DBBA 1E17A 2XAGA 2VXZA 2QBYB 4I01A 4P55A 4JBAA 3IC7A 3JTGA 2VBYA 3LWFA 5LHHA 1LVAA 2JTVA 5J8CA 3HSEA 1D8JA 3K2ZA 5E17F 4Q47A 1ZGAA 3KLOA 1FLIA 1U3EM 4XLPF 1DP7P 3SQNA 2CQKA 6PAXA 2XRNA 3FX3A 1FYLA 2ZNYA 4L9TA 1XSVA 4O3MA 2OQRA 2EK5A 2FF4A 2R7FA 3KP6A 4BAYA 5TRDA 1JXSA 1B9MA 4KIFA 4EMSA 2P7CB 5DEQA 1K6OA 3KLNA 1WWXA 4M71A 2ZFWA 4GYIA 4PDKA 1FBQA 1P6RA 2MLGA 1BJAA 1W4MA 1J2XA 1KGSA 2MA3A 4U7BA 2F5FA 5EEGA 1T38A 2OBPA 1I1SA 1RUOA 5EEHA 1TLHB 1TW2A 2DPUA 2MH9A 2VBXA 4HOBA 4BHPA 2PI0A 2BEOA 2A69F 2ESNA 3I58A 4I09A 1R22A 3WGHA 1UFMA 1S7OA 3I4PA 2E1CA 1R7JA 1FOKA 5FD6A 3R4KA 5D8LB 2BGCA 5JR3A 2LF8A 5L3DA 4PCQA 2VC0A 4CZZA 2HDCA 4ESFA 2NRAC 2EFWA 1XSXA 3WTXC 1O3RA 3ML6A 1P4AA 1ONVA 3FMQA 3WODF 1HW5A 1J59A 2EB7A 2XKPA 4I02A 3MZHA 5IT9K 4O6JA 4LJZF 5BPDA 1CGPA 3LSTA 1C0WA 2ELHA 5DUKA 1WQ2A 4YFNF 2KIMA 5BOXA 4HLYA 3AAFA 3IRQA 3ZN1A 4XBFA 2BV6A 4L9NA 4MNUA 1ZLKA 1U5TC 2YX7A 5JVTA 1T98A 3I5UA 4P9FA 3RKWA 3KP5A 1BN5A 1EH6A 2L54A 2FXAA 2G7UA 3I64A 2K4BA 1Y0UA 5H20A 2IJLA 3ZMTA 1D5VA 3HYIA 5ICGA 4IPAA 2W84A 4A5NA 1WKMA 1TQPA 1BC8C 3BP8A 1B59A 3KP2A 1J75A 4XSXF 1LB2A 1DUXC 4I2OA 4G6QA 2XAQA 2PJPA 4HF1A 3SZTA 3DP7A 3VB2A 1IXRC 1YYVA 4LB6B 4QWQA 3G73A 1FBUA 2QBYA 3KEQA 4IJAA 1FBSA 1Z9CA 2M5WA 3MQ0A 2XAJA 5E18F 5A2QK 2Y75A 3G3ZA 3HOTA 4GGGA 1FYMA 4ETSA 2RVCA 4UHTA 2W85A 5HS8A 4UV9A 2OU2A 3ZN0A 2EJRA 4FT8A 5F64A 2P6TA 1XB4A 4XRFA 2WV0A 1FY7A 1Z7UA 3IHUA 4R1HA 3WTYC 4I0AA 4L18B 4H0EA 4WXHA 1O57A 3K1PA 4RAYA 1UCRA 3FWEA 2QLZA 2ZCWA 2BYVE 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  3HTU A;  2XVC A;  1X3U A;  2WC2 A;  2Z33 A;  5L3C A;  1P92 A;  1LEA A;  3ZMD A;  1YW8 A;  4WXD A;  1ZG5 A;  1KYZ A;  4ZH4 F;  1S7A A;  3ZPL A;  4KA4 A;  2UXN A;  2CWE A;  4HQE A;  4QLC U;  3GVA A;  4WXC A;  2ZNZ A;  4ESJ A;  4L5J A;  4MEX F;  5F6F A;  2JPB A;  2X4H A;  3F8F A;  2FU4 A;  5E1X A;  3QOP A;  2H6C A;  1YW9 A;  5LEK A;  5ERI A;  4MGR A;  1BI3 A;  1KYW A;  1YLF A;  3TDZ C;  1IN8 A;  4EVI A;  1T39 A;  1ZAR A;  4A6E A;  3MCZ A;  1R1V A;  3M7G A;  4M9X A;  5DCM B;  1YFH A;  4HW0 A;  5J6X A;  4EGY A;  3MEX A;  5ILV A;  4CO8 A;  4EM2 A;  2EA2 A;  3V8J A;  4A2U A;  1I27 A;  5H6R A;  1IRG A;  1BI1 A;  1BI2 A;  4LGW A;  5D5W B;  2XHK A;  4FX0 A;  4HZF A;  4OMZ A;  4HA8 A;  1XMK A;  3D0S A;  3RJP A;  5D8K B;  3TGN A;  3KFW X;  2ISZ A;  4IXA A;  2CW0 F;  1F1Z A;  5HS7 A;  2HYG D;  4K2E A;  3ERE D;  4L9V A;  4UXN A;  2IVM A;  4HX7 A;  2NAZ A;  1R1U A;  4KNY A;  4OIQ F;  4AIH A;  2YX4 A;  3L2C A;  3DPT A;  1S3J A;  5K1Y A;  2ZO4 A;  3ZMU A;  1KQ9 A;  1IXC A;  3FXR A;  1AOY A;  2VBZ A;  4B8X A;  3T1B A;  2XRO A;  2PMU A;  3R0J A;  1ZRD A;  2HTS A;  3VEP A;  4PZJ A;  1FSE A;  3TKY A;  2DFI A;  4CGZ A;  3IWZ A;  5K5Q A;  2A61 A;  2FEZ A;  5J8F A;  1QGP A;  5K5O A;  3V8L A;  3CUQ A;  3K69 A;  1V4R A;  1R36 A;  3R60 A;  1HKS A;  3VFZ A;  3I54 A;  3R61 A;  1LJ9 A;  5ILU A;  1R5G A;  3J81 K;  3CO7 C;  1I6X A;  3ROU A;  1B9N A;  1QBJ A;  4RGR A;  1WI9 A;  1RIO H;  2QUF A;  2DQL A;  1RUN A;  3SFZ A;  1U5T B;  3WTV C;  1T6S A;  3Q5F A;  4BQA A;  4ESB A;  1REP C;  3WE3 A;  3BOQ A;  3NEU A;  3P7N A;  1UHW A;  1HQC A;  3KP4 A;  2P7V B;  1OYI A;  1V3F A;  4KIB A;  3T8T A;  1W7P B;  5L3E A;  2A6H F;  5D5U B;  3LQR A;  2HKX A;  1GXQ A;  3H3Z A;  5BS6 A;  4EJW A;  4IVN A;  4ZYD A;  2COM A;  3F8M A;  3GO5 A;  4G8X A;  5LGT A;  2IRF G;  1R23 A;  3WTU C;  2NYX A;  2R3S A;  2ZJ2 A;  4EJU A;  4ENN A;  1W5T A;  1ZRF A;  4BNC A;  2VC1 A;  2GWR A;  1B1B A;  3PFI A;  2ACJ A;  3L9F A;  2WWY A;  5ICE A;  3E6M A;  3SXY A;  2XAH A;  4L5I A;  1BBY A;  5LBQ A;  5IT9 Z;  2E7W A;  5CVI A;  3CTA A;  1CF7 B;  5DCM A;  2XKO A;  4MTD A;  1XCB A;  4U0Y A;  1Z91 A;  1OYW A;  1DDN A;  3FF5 A;  1JHF A;  2XAS A;  3TO6 A;  4MQ9 F;  2PG4 A;  1Q1H A;  4D0P A;  3BDD A;  2V1D A;  5K5R A;  3J80 K;  1HBX G;  3U1D A;  1MJ9 A;  1FWZ A;  3LA7 A;  3T0Y A;  2O3F A;  4TV7 A;  3WG9 A;  3SZP A;  3C7J A;  2DK8 A;  3CUO A;  4BXU A;  3BRO A;  4RB1 A;  2V79 A;  3VOE A;  1BIA A;  5ED4 A;  4EV0 A;  5ICC A;  3RPQ A;  5D4S A;  1SFU A;  2Z9O A;  1FSH A;  3BWG A;  3WU1 B;  4EJV A;  3FXQ A;  5JI6 A;  4YG2 F;  3TQN A;  3I71 A;  2VN2 A;  3HUG A;  4RB2 C;  2A07 F;  2R7D A;  1SMT A;  4L0Z B;  2KJB A;  3LAJ A;  3IWF A;  5FFZ A;  2JPC A;  2EFP A;  1F5T A;  3ECO A;  1MJB A;  2NNY A;  1MDM B;  3MZY A;  4IHT A;  2PFB A;  1JHH A;  1XCV A;  5KK1 A;  3FMR A;  3WTZ A;  4IRI A;  3J7A O;  2ZXJ A;  5E1Z B;  2P4W A;  2DAO A;  3RTR A;  1ZAO A;  4WX9 A;  1J0R A;  2ETH A;  2JZY A;  4UVA A;  5DD8 A;  2GIV A;  1U5T A;  3QP6 A;  4U0V A;  4ZZL A;  3GZ5 A;  4EGZ A;  3RIR A;  1Z05 A;  3QAH A;  2XAF A;  4XSZ F;  1W7P A;  4WK8 F;  4ZYE A;  3F6V A;  1FC3 A;  2CSO A;  4LMY A;  4KYW A;  2FBH A;  1P4W A;  1XSD A;  1XGN A;  5F1R A;  1PDN C;  1FX7 A;  2K27 A;  1B4A A;  4A0X A;  4NQW A;  2FNA A;  3COA C;  4EJT A;  3GFI A;  2M8E A;  1ZHF A;  3F8C A;  5HLG A;  1S6L A;  5CYV A;  5E8G A;  3P9C A;  3IKV A;  5CJ9 A;  1IAW A;  3BJA A;  2GZW A;  3U2R A;  1OYY A;  1HW1 A;  1BC7 C;  5HVQ C;  3WU0 A;  1CF7 A;  4A5M A;  3EQL F;  3HSF A;  3QP5 A;  3LFK A;  1T2K A;  2J5O A;  3ABU A;  4Q5S F;  3JAM Z;  3GFJ A;  1WRJ A;  1H9T A;  3V7S A;  5FFX A;  4WWC A;  4WCG A;  4BH9 A;  3EET A;  4GYG A;  1W7P D;  2M45 A;  2FBI A;  3DF8 A;  5IT3 A;  4ZYG A;  3E97 A;  1FP2 A;  1K7A A;  1QNT A;  4NB5 A;  2LF7 A;  2FOK A;  5HOO A;  2E1N A;  2EFO A;  5DDG A;  4EJO A;  1YS6 A;  2AS5 F;  1YO5 C;  3CLO A;  4YFX F;  4M72 A;  1W5S A;  4ZZD A;  4PGG A;  4KDP A;  3KEO A;  3FM3 A;  3K1M A;  1HSJ A;  1XMA A;  4M9Z A;  4LK1 F;  2V9V A;  3HRT A;  1SD7 A;  2FRH A;  1XN7 A;  3C3W A;  5L3F A;  1MZB A;  1DPU A;  2LNB A;  4Y15 A;  4CDG A;  3E6D A;  2Z3Y A;  1YTY A;  4GO1 A;  4UV8 A;  4R8H A;  1LDJ A;  1TNS A;  3N4M A;  1MDM A;  2ADU A;  1FPQ A;  2OZU A;  1P2F A;  1ZGJ A;  2OA4 A;  1IN5 A;  5FO5 A;  3J81 Z;  2DPD A;  2M87 A;  1KU3 A;  4G9Y A;  3LQQ A;  2OAZ A;  3H92 A;  5DCF A;  3ELK A;  2JRT A;  3DFG A;  1FZP B;  3GZ6 A;  1RI7 A;  1ZH5 A;  5D6E A;  3S2W A;  3DQV C;  4CYD A;  3ECH A;  1T0F A;  2LKP A;  4HLX A;  2DI3 A;  1FP1 D;  2PQ8 A;  3F8B A;  5LGU A;  2D1H A;  2DT5 A;  1MJA A;  4UNO A;  5HLI A;  1F4K A;  2QZ8 A;  3HHG A;  3HRU A;  2IA2 A;  1EV7 A;  2QYO A;  4ON0 A;  3HRM A;  3P9K A;  2A68 F;  3T5X A;  2K02 A;  1LNW A;  3R6S A;  1QPM A;  1Z1D A;  1KU9 A;  4S05 A;  3ISP A;  1UST A;  4G6D A;  3E6B A;  3FM5 A;  4U7D A;  4B09 A;  1YS7 A;  2OZ6 A;  1ZRC A;  2HR3 A;  2O03 A;  4G7Z F;  3EYI A;  3E3V A;  3JTH A;  3ULQ B;  1Z6T A;  4M9S A;  2GXB A;  2XV4 S;  1ZYR F;  3KZY A;  2HEO A;  2GAU A;  3DXJ F;  1MKM A;  4LLL A;  5DD4 A;  1LDK B;  3CJN A;  2DO7 A;  4OIO F;  1TW3 A;  2HQN A;  4A6D A;  3TO9 A;  2D1V A;  3JSP A;  1OMI A;  1IRF A;  3J80 Z;  4MEY F;  3KCC A;  2BE5 F;  3GX4 X;  1GXP A;  2L02 A;  2L4M A;  4CXF A;  5L3B A;  3JW4 A;  1U78 A;  4OMY A;  2YSR A;  3Q9V A;  3F21 A;  4ENJ A;  2ZBK A;  4OIN F;  3DKW A;  2FE3 A;  4IRG A;  3QPT A;  4E70 A;  4S04 A;  1STZ A;  3N97 A;  1VTN C;  2STT A;  3KP7 A;  1U2W A;  2P5V A;  2RC4 A;  4EM0 B;  1RNL A;  3GW2 A;  3I53 A;  1JE8 A;  1K78 B;  2V1X A;  3BJO A;  1USS A;  2DQR A;  2RNJ A;  1SD5 A;  1JGS A;  4MQV A;  1MGT A;  4I98 B;  3QU6 A;  1TQI A;  3GUD A;  2H27 A;  2KIU A;  1ZG3 A;  4LLN A;  5D4R A;  1HW2 A;  2PBI A;  4F7Z A;  5D5V B;  3RPU A;  5CVU A;  2FQ3 A;  1IZ1 A;  3WGI A;  4KMU X;  1Z6R A;  4XLN F;  1QQI A;  2K7L A;  4KT5 C;  1OKR A;  2EFQ A;  2RV8 A;  4L9J A;  2QWW A;  3F6O A;  2KKO A;  4RS8 A;  3IL2 A;  1AWC A;  1R1T A;  3FHZ A;  1KA8 A;  2PMH A;  1ZRE A;  1XGO A;  2DW4 A;  5E8I A;  1IXS B;  5CVV A;  1TNT A;  5AIQ A;  2GA1 A;  3E5U A;  4KN7 X;  2CG4 A;  3GYH X;  2X0L A;  2RGV A;  1ZN2 A;  2QEN A;  3GFM A;  5ICF A;  3ZMV A;  1YG2 A;  3E6C C;  3ZMZ A;  1ULY A;  3WTS C;  1ODD A;  1O3S A;  2MD5 A;  1U6G A;  3PQJ A;  3BY6 A;  2QQA A;  4R79 A;  2ISY A;  2ZME B;  1KU7 A;  1HKQ A;  2C6Y A;  5FD5 A;  1XD7 A;  2TDX A;  5HLH A;  4U88 A;  2HQR A;  3KE2 A;  5DV5 A;  4Y17 A;  5FB2 A;  3TOA A;  3BZ6 A;  4RB0 A;  4BHC A;  5DUI A;  2EFN A;  2KRF A;  2NS0 A;  2OQG A;  3D5L A;  4KIC A;  4M73 A;  2CFX A;  1KQ8 A;  2XGX A;  5A2Q Z;  3U9G A;  2MC3 A;  3RYP A;  1LDD A;  3I59 B;  2VT3 A;  3ZP5 A;  4NHJ A;  5JFR A;  2P5K A;  2A6E F;  3TO7 A;  1XGM A;  2K86 A;  2QVO A;  5D6F A;  1GVJ A;  1P4X A;  3O3K A;  1D8K A;  4RAZ A;  5ILS A;  3K9T A;  2EWN A;  4HF2 A;  1HST A;  1L3L A;  1ZG1 A;  4M6Y A;  5FLX K;  3V7C A;  3K0L A;  3RI4 A;  4OIR F;  3LAP A;  1BM9 A;  4HQM A;  2M1B A;  1RZ4 A;  1FYK A;  2HGC A;  5LGN A;  1IN6 A;  2IP2 A;  2IA0 A;  4ZYH A;  1K78 A;  3C1D A;  1G3S A;  3KP3 A;  1OPC A;  3OV8 A;  4HDU A;  3O2P E;  4P5O A;  2F2E A;  3H3U A;  4FHT A;  3HRS A;  1FNN A;  2PLY A;  2Q0O A;  1TQM A;  3MFK A;  3GEZ A;  2G7H A;  4CHU A;  1NHA A;  1ZLJ A;  1XGS A;  2GQQ A;  1I1G A;  3E5Q A;  3SHF A;  2HWV A;  5DYM A;  4RGX A;  1UHM A;  5LRR A;  1BI0 A;  3R0A A;  4MTE A;  2O61 A;  3RKX A;  1O7L A;  2PEX A;  1YQA A;  1O3T A;  3GWZ A;  1B6A A;  1K79 A;  3ZMS A;  2GA2 A;  4DNC A;  1G3W A;  2RKH A;  2VOD A;  4ENM A;  1YIO A;  5LHI A;  2XIG A;  4KIG A;  3FZV A;  3NRV A;  4HV6 A;  1A04 A;  2RQP A;  1IW7 F;  2QM3 A;  3CDH A;  4I7H A;  2HKO A;  4EQQ A;  3Q9S A;  3HHH A;  2CYY A;  4KN4 X;  3W6J B;  4AIK A;  3PQK A;  3BJ6 A;  4UVC A;  3V8K A;  1YW7 A;  4GXO A;  5HDG A;  1PP8 F;  3JSO A;  1G4D A;  2HOE A;  4JK1 X;  2ZKZ A;  3M9A A;  2ZME A;  4A0Y A;  2Q8K A;  3TDU C;  4HAM A;  4UVB A;  2KIF A;  2QQ9 A;  3ZQ7 A;  1KQ0 A;  5CVR A;  4OU0 A;  4G94 A;  4LLG F;  3CUQ B;  2Q2E A;  4HF0 A;  1GHC A;  1PUE E;  2L4A A;  1G6N A;  1G3Y A;  3OOP A;  3F23 A;  1EH8 A;  1IN7 A;  3BPV A;  4A12 A;  4G7O F;  2MLK A;  2UZK A;  3ABT A;  2P8T A;  4RGU A;  2FBK A;  3F8N A;  3EDP A;  5LEJ A;  3QRF F;  3QU3 A;  1IN4 A;  2Y0M A;  4RGS A;  3LA2 A;  2NNN A;  4AIJ A;  3KZZ A;  2VBW A;  4HYE A;  2VT2 A;  3GXO A;  2J5P A;  3I59 A;  2HS5 A;  3E5X A;  3WTT C;  3CO6 C;  2JT1 A;  2VOP A;  1EH7 A;  3MWM A;  1L0O C;  1TBX A;  2UWM A;  3M1E A;  2IPQ X;  5LRS A;  4A0Z A;  4HBL A;  2F5E A;  2VON A;  1D3Y A;  2D2W A;  1MD0 A;  4ENK A;  1LQ1 A;  3LA3 A;  2WTE A;  4HDV A;  1WSU A;  1LEB A;  1R58 A;  3F3X A;  2H6B A;  2VOO A;  1J7K A;  1SFX A;  2G9W A;  4N0B A;  2RDP A;  1SAX A;  3P9I A;  5TJJ A;  4LG0 B;  1J9I A;  3B73 A;  1IUY A;  2DK5 A;  3L7W A;  5L3G A;  1O7F A;  5LHG A;  3QPH A;  5H6Q A;  3W6K B;  1QZZ A;  4IF4 A;  3K1N A;  4WF2 A;  3WGG A;  2P6S A;  2GXG A;  5HDK A;  2V6C A;  4YIF A;  2YR2 A;  1UB9 A;  2H09 A;  1IF1 A;  3DV8 A;  4LK0 F;  4GCV A;  2W25 A;  2QQB A;  4P9U A;  2UXX A;  5CLS A;  1HKT A;  3JAM K;  2DU9 A;  5JHU A;  2RN7 A;  4HX8 A;  3HTS B;  4M74 A;  2DTR A;  2B0L A;  4OIP F;  2KJC A;  3WTW C;  5KVR A;  2ESH A;  1S8N A;  4IRH A;  3O6B B;  1H0M A;  2V1U A;  4U0W A;  3I0T A;  4Z2Y A;  2F5D A;  2F5C A;  2O0Y A;  3TOB A;  2E7X A;  2VE9 A;  1XDS A;  2Z5U A;  2LDU A;  4LFU A;  2DLL A;  5HS9 A;  2MH2 A;  3V7R A;  4YII A;  3HIF A;  2MBF A;  3REO A;  1OR7 A;  2PN6 A;  1QZY A;  5D5X B;  2FSW A;  2O8X A;  5AIP A;  4AWX B;  2FNP A;  3DEU A;  2O6G E;  3NQO A;  1SMY F;  2M30 A;  4BHB A;  3B02 A;  3F22 A;  2YU3 A;  3F72 A;  1U8R A;  2XUB A;  2FMY A;  3DPL C;  3T8R A;  4AD9 A;  3M8F A;  2L3D A;  2Y48 A;  3VOD A;  4OOI A;  4IHS A;  4L0Y B;  4LB5 A;  4JQF A;  3L00 A;  2Z99 A;  4FX4 A;  3GF2 A;  3GFL A;  5HDN A;  2HYF A;  1XDU A;  2W57 A;  2EV0 A;  4M6X A;  2LSO A;  2A3S A;  1DPR A;  2HTJ A;  1BOA A;  3EYY A;  2BBY A;  5BQT A;  2VE8 A;  4N9H A;  4EM1 A;  4UUV A;  1G3T A;  2HZT A;  1E2X A;  2JSC A;  4DQ2 A;  1KU2 A;  3HSR A;  2EV6 A;  3KET A;  1BIB A;  5FGM A;  5E1W A;  1ON2 A;  4N9I A;  3EUH A;  2OD5 A;  4RB3 C;  4Q4Z F;  1SD4 A;  1FT9 A;  4G7H F;  4P96 A;  1F9N A;  2K4J A;  2STW A;  5BPI A;  4CIC A;  4KUM A;  5AON A;  4ASN A;  2HFH A;  2H94 A;  2YPR A;  3FMS A;  3L09 A;  3CUQ C;  3MAJ A;  1TTY A;  4MHG A;  2IT0 A;  4KFC A;  5BMZ A;  5FLX Z;  2CO5 A;  2EV5 A;  5CVJ A;  1I5Z A;  2CGP A;  4KMF A;  2A5Y B;  4HX4 A;  4PGH A;  2AXL A;  1R00 A;  3IRR A;  2IA1 A;  2P5L C;  4LG0 A;  3FXU A;  1S29 A;  4LD5 A;  3GLX A;  2IW5 A;  2EA4 A;  1QO0 D;  3HOS A;  2L01 A;  1O3Q A;  3RDI A;  5LLQ A;  4BYY A;  1R5H A;  4I0B A;  1SD6 A;  2D45 A;  3C18 A;  4AVP A;  4O5V A;  4Q48 A;  1J5Y A;  4YFK F;  3M8E A;  1ON1 A;  3BPX A;  5E20 A;  1PP7 U;  4Y13 A;  3IKT A;  3RKY A;  2FML A;  3WE2 A;  2W24 A;  2FA5 A;  4HV5 A;  3RYR A;  1H9G A;  1SFE A;  2DBB A;  1E17 A;  2XAG A;  2VXZ A;  2QBY B;  4I01 A;  4P55 A;  4JBA A;  3IC7 A;  3JTG A;  2VBY A;  3LWF A;  5LHH A;  1LVA A;  2JTV A;  5J8C A;  3HSE A;  1D8J A;  3K2Z A;  5E17 F;  4Q47 A;  1ZGA A;  3KLO A;  1FLI A;  1U3E M;  4XLP F;  1DP7 P;  3SQN A;  2CQK A;  6PAX A;  2XRN A;  3FX3 A;  1FYL A;  2ZNY A;  4L9T A;  1XSV A;  4O3M A;  2OQR A;  2EK5 A;  2FF4 A;  2R7F A;  3KP6 A;  4BAY A;  5TRD A;  1JXS A;  1B9M A;  4KIF A;  4EMS A;  2P7C B;  5DEQ A;  1K6O A;  3KLN A;  1WWX A;  4M71 A;  2ZFW A;  4GYI A;  4PDK A;  1FBQ A;  1P6R A;  2MLG A;  1BJA A;  1W4M A;  1J2X A;  1KGS A;  2MA3 A;  4U7B A;  2F5F A;  5EEG A;  1T38 A;  2OBP A;  1I1S A;  1RUO A;  5EEH A;  1TLH B;  1TW2 A;  2DPU A;  2MH9 A;  2VBX A;  4HOB A;  4BHP A;  2PI0 A;  2BEO A;  2A69 F;  2ESN A;  3I58 A;  4I09 A;  1R22 A;  3WGH A;  1UFM A;  1S7O A;  3I4P A;  2E1C A;  1R7J A;  1FOK A;  5FD6 A;  3R4K A;  5D8L B;  2BGC A;  5JR3 A;  2LF8 A;  5L3D A;  4PCQ A;  2VC0 A;  4CZZ A;  2HDC A;  4ESF A;  2NRA C;  2EFW A;  1XSX A;  3WTX C;  1O3R A;  3ML6 A;  1P4A A;  1ONV A;  3FMQ A;  3WOD F;  1HW5 A;  1J59 A;  2EB7 A;  2XKP A;  4I02 A;  3MZH A;  5IT9 K;  4O6J A;  4LJZ F;  5BPD A;  1CGP A;  3LST A;  1C0W A;  2ELH A;  5DUK A;  1WQ2 A;  4YFN F;  2KIM A;  5BOX A;  4HLY A;  3AAF A;  3IRQ A;  3ZN1 A;  4XBF A;  2BV6 A;  4L9N A;  4MNU A;  1ZLK A;  1U5T C;  2YX7 A;  5JVT A;  1T98 A;  3I5U A;  4P9F A;  3RKW A;  3KP5 A;  1BN5 A;  1EH6 A;  2L54 A;  2FXA A;  2G7U A;  3I64 A;  2K4B A;  1Y0U A;  5H20 A;  2IJL A;  3ZMT A;  1D5V A;  3HYI A;  5ICG A;  4IPA A;  2W84 A;  4A5N A;  1WKM A;  1TQP A;  1BC8 C;  3BP8 A;  1B59 A;  3KP2 A;  1J75 A;  4XSX F;  1LB2 A;  1DUX C;  4I2O A;  4G6Q A;  2XAQ A;  2PJP A;  4HF1 A;  3SZT A;  3DP7 A;  3VB2 A;  1IXR C;  1YYV A;  4LB6 B;  4QWQ A;  3G73 A;  1FBU A;  2QBY A;  3KEQ A;  4IJA A;  1FBS A;  1Z9C A;  2M5W A;  3MQ0 A;  2XAJ A;  5E18 F;  5A2Q K;  2Y75 A;  3G3Z A;  3HOT A;  4GGG A;  1FYM A;  4ETS A;  2RVC A;  4UHT A;  2W85 A;  5HS8 A;  4UV9 A;  2OU2 A;  3ZN0 A;  2EJR A;  4FT8 A;  5F64 A;  2P6T A;  1XB4 A;  4XRF A;  2WV0 A;  1FY7 A;  1Z7U A;  3IHU A;  4R1H A;  3WTY C;  4I0A A;  4L18 B;  4H0E A;  4WXH A;  1O57 A;  3K1P A;  4RAY A;  1UCR A;  3FWE A;  2QLZ A;  2ZCW A;  2BYV E;  1HXD A; 
#chains in the Genus database with same CATH topology
 3V4G A;  3HPG A;  1MMA A;  2XVC A;  3HTU A;  1X3U A;  1HCR A;  4A3G J;  2WC2 A;  2Z33 A;  5KAF C;  1T8I A;  5L3C A;  2E34 A;  1P92 A;  1LEA A;  1MH4 A;  3ZMD A;  1YW8 A;  4WXD A;  1ZG5 A;  1A6Q A;  1KYZ A;  2R5Y B;  2KT0 A;  3E0J B;  4HNT A;  4ZH4 F;  1S7A A;  3H5N A;  3ZPL A;  4KA4 A;  1HLV A;  4IL6 C;  2DN0 A;  2UXN A;  2PX9 A;  1VQP I;  4FCY A;  2CWE A;  4HQE A;  3OR1 C;  2A6T A;  4QLC U;  3GVA A;  4WXC A;  4DYQ A;  2ZNZ A;  4ESJ A;  1PJR A;  4XL9 A;  4L5J A;  4MEX F;  5EJC A;  2Z2S B;  2ECC A;  5F6F A;  3QYB A;  2JPB A;  2X4H A;  3F8F A;  4RBO A;  2FU4 A;  5E1X A;  4YIR X;  2QSG X;  4D9J A;  3QOP A;  1CQT A;  3M3Y J;  2H6C A;  4F55 A;  1YW9 A;  3DPU A;  2VJ4 A;  5LEK A;  2DOE A;  3OYH A;  4MGR A;  5ERI A;  2WBM A;  3H35 A;  1BI3 A;  2HOT A;  1KYW A;  2M8G X;  1YLF A;  1UG0 A;  4C30 A;  1G59 A;  3TDZ C;  1IN8 A;  4EVI A;  4HNU A;  2CQ7 A;  1T39 A;  1ZAR A;  4A6E A;  3WU2 C;  3MCZ A;  1R1V A;  5HNH A;  3M7G A;  4M9X A;  5DCM B;  4E7L A;  1YFH A;  2JA6 J;  4HW0 A;  5J6X A;  4EGY A;  1H89 C;  3MEX A;  2H1L A;  2XRL A;  3A4C A;  5ILV A;  1VQN I;  1QVU A;  4CO8 A;  4EM2 A;  2EA2 A;  1U9N A;  3V8J A;  2M0M A;  2NVT J;  2NVU B;  2O5R A;  3HC7 A;  2E2I J;  4A2U A;  2LKX A;  1ETQ A;  1I27 A;  5H6R A;  1IRG A;  3W6V A;  1VQL I;  1BI1 A;  1BI2 A;  4LGW A;  2R7S A;  2ZSI B;  5D5W B;  3OYJ A;  2XHK A;  4FX0 A;  4XID A;  3BCB A;  1WHU A;  4HZF A;  4OMZ A;  4HA8 A;  1T08 B;  3J7Z I;  1ERD A;  2NOG A;  1T0F C;  1XMK A;  4IKF A;  3D0S A;  3RJP A;  5JVG F;  2XF6 A;  5J1Y A;  5D8K B;  3TGN A;  3KFW X;  2ISZ A;  4IXA A;  2CW0 F;  1F1Z A;  4X0G A;  5M3M J;  4PFO A;  5HS7 A;  2CQX A;  1QA6 A;  1JTX A;  1MBG A;  4PJL A;  3PM1 A;  2HYG D;  4K2E A;  3ERE D;  4L9V A;  4UXN A;  2IVM A;  4HST A;  4HX7 A;  2NAZ A;  1R1U A;  4KNY A;  4XKC A;  3TP3 A;  4OIQ F;  4AIH A;  1JUP A;  2YX4 A;  3L2C A;  1X1A A;  2X6W A;  4DJA A;  3DPT A;  1S3J A;  5K1Y A;  1XPX A;  2ZO4 A;  2R7Z J;  3ZMU A;  3EUA A;  1KQ9 A;  2GIZ A;  1IXC A;  3S17 J;  1W5C C;  3A02 A;  3FXR A;  1N78 A;  1AOY A;  2LBF B;  4BDZ A;  5EEA A;  2VBZ A;  3HUG B;  4B8X A;  1S72 I;  4GFB A;  3T1B A;  3HL2 A;  4P1W A;  2XRO A;  3F9K A;  3CDL A;  3A1Y A;  2PMU A;  3BR5 A;  3R0J A;  1ZRD A;  2HTS A;  3VEP A;  1ZR2 A;  5FLV A;  2KMU A;  4PZJ A;  2ID3 A;  1FSE A;  3TKY A;  2DFI A;  4CGZ A;  3IWZ A;  1VQ9 I;  5DTD A;  3G6E I;  1RR8 C;  4A3B J;  5K5Q A;  5IYC J;  2A61 A;  2FEZ A;  2HYJ A;  1QGP A;  5J8F A;  2X6X A;  5K5O A;  3V8L A;  1ZEL A;  3CUQ A;  1V4R A;  3K69 A;  2CUF A;  3OYD A;  1R36 A;  3R60 A;  2E19 A;  1HKS A;  4DZP A;  3VFZ A;  3I54 A;  1D1A A;  1MNE A;  2V4J C;  3R61 A;  1LJ9 A;  5ILU A;  1R5G A;  3J81 K;  3CO7 C;  5EZG A;  4Y52 J;  1I6X A;  1M1E B;  3ROU A;  1B9N A;  1QBJ A;  4B3X A;  1QVT A;  5E3O A;  2F6C A;  3FHN A;  4RGR A;  1OLT A;  3D1N I;  1WI9 A;  1MMN A;  5B3S H;  1RIO H;  1DQU A;  2KFD A;  3TED A;  2QUF A;  2DQL A;  2MFZ A;  1RUN A;  4Y7N J;  3BZC A;  1U5T B;  3SFZ A;  1VFC A;  3WTV C;  1T6S A;  3Q5F A;  4BQA A;  4LG3 A;  1WCM J;  4ESB A;  4E7I A;  2XGE A;  1REP C;  2PJR B;  3WE3 A;  3K4C A;  3OSG A;  3BOQ A;  3NEU A;  3P7N A;  1UHW A;  1HQC A;  3KP4 A;  2P7V B;  3ZR8 X;  1IG7 A;  1OYI A;  1V3F A;  3SEQ A;  2X6Y A;  4KIB A;  3T8T A;  1YE9 A;  1W7P B;  5L3E A;  1HOM A;  4XOR A;  4PK4 A;  2A6H F;  2QKL B;  1FJL A;  5D5U B;  3LQR A;  1Y8Q B;  1GXQ A;  2HKX A;  3H3Z A;  5BS6 A;  1K4T A;  1GT0 C;  4EJW A;  4IVN A;  4ZYD A;  2COM A;  1G8X A;  3F8M A;  3GO5 A;  2HVQ A;  4A3C J;  4AVZ A;  2DYS H;  4G8X A;  1GV5 A;  5LGT A;  2IRF G;  1SAU A;  2OPT A;  1R23 A;  4OWR B;  3WTU C;  1JT6 A;  4NC8 A;  1JTY A;  2NYX A;  2R3S A;  2ZJ2 A;  4IEJ A;  4EJU A;  4ENN A;  1W5T A;  2L5Q A;  1ZRF A;  4BNC A;  2VC1 A;  2GWR A;  3DU6 A;  1B1B A;  1E3H A;  1V5F A;  2ME6 A;  1KZH A;  2R7V A;  3PFI A;  5E3M A;  1OFC X;  3HM5 A;  1VQM I;  1J09 A;  3TBI A;  2OTL I;  2ACJ A;  2IGM A;  3L9F A;  3GTO J;  2MAB A;  3HOZ J;  2GOX B;  2WWY A;  1SVL A;  3OYK A;  2JVH A;  5ICE A;  2ZXW H;  3E6M A;  5GTI C;  3SXY A;  1K61 A;  2M4K A;  4FET A;  2XAH A;  1TL8 A;  4L5I A;  1BBY A;  5LBQ A;  5IT9 Z;  2EBI A;  2E7W A;  1B8I A;  2L2O A;  5CVI A;  3CTA A;  3RSN A;  2KRC A;  3CCY A;  1CF7 B;  2I5U A;  2BXY A;  3G4S I;  5DCM A;  2LRE A;  2XKO A;  2HOS A;  4MTD A;  1MSE C;  1XCB A;  4U0Y A;  1Z91 A;  2VPL A;  2JK3 A;  1OYW A;  2VQC A;  1QRY A;  2DA3 A;  2V26 A;  1BR2 A;  1IV8 A;  4XN3 A;  2X1E A;  1ENH A;  1MIJ A;  3K7A J;  3DTI A;  2EH3 A;  3L2V A;  4A3E J;  1DDN A;  3BG5 A;  3FF5 A;  1JHF A;  2ELJ A;  2EZI A;  2XAS A;  3TO6 A;  4QPQ A;  5IYD J;  2KPM A;  3CLQ A;  3OSF A;  4CA0 A;  1NG6 A;  2ID6 A;  2L0K A;  3CCR I;  5GAG J;  4MQ9 F;  2V7F A;  4H4K C;  2PG4 A;  2LRD A;  1TWF J;  1Q1H A;  4D0P A;  3BDD A;  4N4O B;  3AKZ A;  5M3F J;  2V1D A;  5K5R A;  2LH9 A;  5FRN A;  4M6V A;  5F0C A;  3J80 K;  1Y0N A;  4BQO A;  1OQY A;  3N05 A;  3U1D A;  1HBX G;  3BTC A;  1MJ9 A;  2VIX A;  1FWZ A;  3DBL B;  3L1P A;  3MKW B;  3RPU D;  3LA7 A;  3T0Y A;  2MYS A;  2O3F A;  1BW6 A;  4TV7 A;  1VQ4 I;  2JUG A;  2JA7 J;  2JSP A;  3WG9 A;  2E5N A;  3GCM A;  3SZP A;  3C7J A;  3CME I;  2M7B A;  1YJ9 I;  2DK8 A;  2JVG A;  3CUO A;  3BRO A;  2L7F P;  4BXU A;  4RB1 A;  2V79 A;  5C3E J;  3VOE A;  1BIA A;  2CW8 A;  4E4H A;  5ED4 A;  4EV0 A;  5ICC A;  3RPQ A;  3ZQC A;  5D4S A;  1SFU A;  2Z9O A;  4UB6 C;  3PSF A;  1FSH A;  3BWG A;  4CZC A;  2E35 A;  1X1D A;  3WU1 B;  4EJV A;  3GTM J;  3FXQ A;  3PL8 A;  5JI6 A;  2XGD A;  4YG2 F;  3TQN A;  3U1K A;  1F43 A;  3I71 A;  4V19 K;  2LBF A;  2VN2 A;  1Z3X A;  3HUG A;  3CCS I;  5B1B H;  3OIP A;  4RB2 C;  2VKH A;  2A07 F;  2L9N A;  4W1U A;  2R7D A;  1SMT A;  2JMW A;  4L0Z B;  1TP4 A;  2KJB A;  1Y6I A;  3LAJ A;  3IWF A;  4Y3O A;  5FFZ A;  2JPC A;  2EFP A;  3BC8 A;  1F5T A;  3ECO A;  1A36 A;  4FIS A;  2HU9 A;  1BOB A;  2DJI A;  3LSI A;  1MJB A;  1OCC H;  4A3M J;  2NNY A;  1MDM B;  2XF5 A;  3MZY A;  4IHT A;  2PFB A;  2HVS A;  1JHH A;  1XCV A;  5KK1 A;  3FMR A;  3WTZ A;  2W48 A;  4IRI A;  3J7A O;  1VF9 A;  4RMN A;  2ZXJ A;  5E1Z B;  1MNM C;  1IGN A;  3OIQ A;  2P4W A;  2DAO A;  2M4G A;  2OCE A;  2X51 A;  3RTR A;  3I4N J;  1SFK A;  1ZAO A;  1WH5 A;  4WX9 A;  4PSX A;  5GP9 A;  1J0R A;  1R4M B;  3I9V 2;  3H9J A;  2ECB A;  1DP3 A;  2ETH A;  2JZY A;  4UVA A;  3RQI A;  3H5A A;  5DD8 A;  2GIV A;  1U5T A;  3QP6 A;  1JI8 A;  5GAD J;  1R49 A;  2PJR A;  4U0V A;  3PIO F;  2IBD A;  3A0B C;  3OYN A;  1EA3 A;  4ZZL A;  3H3V K;  3GZ5 A;  4EGZ A;  2DMQ A;  3RIR A;  1Z05 A;  2E60 A;  3SJM A;  3QAH A;  1TWG J;  2K9L A;  1LFP A;  2XAF A;  3BLY A;  4XSZ F;  4XNF A;  1W7P A;  4WK8 F;  4ZYE A;  3F6V A;  1FC3 A;  2CSO A;  4LMY A;  4ITV A;  4B43 A;  5F04 A;  3TW7 A;  4KYW A;  2DFF A;  5C44 J;  4E6K G;  2X1C A;  3OWT A;  4HG2 A;  2FBH A;  1P4W A;  1XSD A;  4A3I J;  2QCO A;  1XGN A;  5TGT A;  2DA1 A;  3PO2 J;  5DS9 A;  5F1R A;  4J01 A;  1PDN C;  1WJA A;  1FX7 A;  2K27 A;  3S3M A;  1RRJ A;  1B4A A;  4A0X A;  4NQW A;  2K9N A;  2FNA A;  3LNQ A;  4IHX A;  4AU7 A;  3COA C;  1W0T A;  3H5R A;  3S93 A;  4EJT A;  3S2D J;  2E2J J;  3GFI A;  5J1U A;  2M8E A;  4F3Q A;  3K4B A;  3LOC A;  1X3Z B;  1ZHF A;  2DT7 B;  3FIW A;  3F8C A;  5HLG A;  1S6L A;  1A35 A;  3NAR A;  5H2F C;  5CYV A;  1JKO C;  4IHW A;  5E8G A;  2KIQ A;  3P9C A;  4BUP A;  2JWT A;  1NK3 P;  3IKV A;  5CJ9 A;  2VXD A;  1IAW A;  5J4Y A;  1WJD A;  3BJA A;  2GZW A;  2TRT A;  3SFI A;  5JLW A;  3U2R A;  3TL4 X;  1OYY A;  1HW1 A;  1I6H J;  3VDX A;  1BC7 C;  3S3O A;  5HVQ C;  1ITY A;  3WU0 A;  2OCC H;  1CF7 A;  4A5M A;  3EQL F;  4XN0 A;  3HSF A;  3QP5 A;  3LFK A;  3OYM A;  1T2K A;  4IHY A;  2J5O A;  3ABU A;  4Q5S F;  4BGD A;  3JAM Z;  3SZG A;  3CP8 A;  3GFJ A;  1B72 B;  3FXK A;  1WRJ A;  3IV5 A;  1QPI A;  1H9T A;  3NWT A;  3V7S A;  5FFX A;  4PJ0 C;  1OCZ H;  1W0U A;  4WWC A;  4WCG A;  4BH9 A;  2PMZ N;  3EET A;  4GYG A;  4RDU A;  2LMD A;  1W7P D;  4MFE A;  2M45 A;  2FBI A;  1VQ6 I;  3DF8 A;  5IT3 A;  4ZYG A;  3E97 A;  1FP2 A;  2EIL H;  2EZK A;  2XSJ C;  1K7A A;  2M0C A;  3RZD J;  1RC9 A;  2B7E A;  1QNT A;  4NB5 A;  2LF7 A;  2XSD C;  2YUS A;  1I50 J;  3KZI C;  2CU7 A;  5B66 C;  3DCF A;  1S9H A;  2FOK A;  4F91 B;  2BY1 A;  2E1N A;  5HOO A;  3EPZ A;  2EFO A;  1VQ5 I;  3DBH B;  5DDG A;  4EJO A;  1YS6 A;  2AHQ A;  2AS5 F;  4MLO A;  2B9S A;  1YO5 C;  2XAU A;  4XLC A;  3W3C A;  3CC2 I;  3CLO A;  1ACI A;  1IV6 A;  4YFX F;  4M72 A;  1W5S A;  4ZZD A;  4PGG A;  1OCP A;  4I76 A;  2VJ5 A;  3KPH A;  4BQQ A;  3KEO A;  4KDP A;  2CUE A;  3FM3 A;  3K1M A;  1HSJ A;  1XMA A;  1JKR C;  2NOJ B;  3BT9 A;  4ZTJ A;  4M9Z A;  3DLL F;  2R7O A;  1FIA A;  1WJF A;  4M3E A;  4LK1 F;  1K6Y A;  2V9V A;  3HRT A;  2Y0S N;  1SD7 A;  2Y0S A;  4I6Z A;  2FRH A;  1XN7 A;  1V5G A;  3C3W A;  5L3F A;  4RAF A;  1MZB A;  1DPU A;  2LNB A;  4Y15 A;  4ZDL A;  4CDG A;  1X2N A;  3PO3 J;  2W82 A;  3E6D A;  1WJC A;  2Z3Y A;  1YTY A;  4GO1 A;  4UV8 A;  4R8H A;  4JYK A;  1LDJ A;  2ZME C;  4C3H J;  2DXI A;  1TNS A;  1I39 A;  2F4O B;  3QOD A;  3N4M A;  1XS9 A;  1MDM A;  2ADU A;  1TWH J;  4XLA A;  4A3F J;  1FPQ A;  4XKW A;  4BY1 J;  3D5S C;  2OZU A;  1P2F A;  2Q1Z B;  1ZGJ A;  2OA4 A;  1IN5 A;  5FO5 A;  4XON A;  2TCT A;  3J81 Z;  5E79 C;  5K7F A;  2DPD A;  5KNL A;  1VQK I;  4DOZ A;  3HOX J;  2M87 A;  1KU3 A;  2QQ8 A;  4RLF A;  4G9Y A;  1T56 A;  3AG2 H;  3LQQ A;  3W2V A;  3B6A A;  2OAZ A;  4A3K J;  4HEA 2;  4A69 C;  5F0H A;  2MD0 A;  4ABZ A;  3H92 A;  3A2K A;  5DCF A;  2BY3 A;  3JRB A;  3ELK A;  3LSM A;  2CV2 A;  2JRT A;  2JJ7 A;  3DFG A;  1MBE A;  1MND A;  4NUB A;  1N25 A;  5FKL A;  3S8P A;  1FZP B;  3GZ6 A;  3CQZ J;  2IGO A;  3AG4 H;  3GTJ J;  1RI7 A;  3Q0U A;  4PUS A;  1WH7 A;  1ZH5 A;  5D6E A;  3S2W A;  3DQV C;  2WAQ N;  4CYD A;  3ECH A;  1TZL A;  4GRI A;  1T0F A;  2WAQ A;  5FKM A;  2LKP A;  3IH3 A;  4XM3 A;  4E7H A;  5BNG A;  1JKQ C;  4HLX A;  2DI3 A;  1FP1 D;  1HDD C;  1U9O A;  2PQ8 A;  2F4M B;  4JP0 A;  1X1C A;  3JRD A;  3F8B A;  2ZB9 A;  5LGU A;  2D1H A;  2DT5 A;  1DU6 A;  3M4O J;  1MJA A;  1EF4 A;  4UNO A;  1P9Q C;  2XPU A;  1AA7 A;  3VYS B;  2R4G A;  3TP0 A;  2VJI A;  5HLI A;  3JRC A;  1F4K A;  2BY2 A;  2QZ8 A;  1E3P A;  3HHG A;  3HRU A;  1QHH D;  3PIP F;  2IA2 A;  1EV7 A;  2QYO A;  1XC5 A;  2LLK A;  3BG7 A;  3SDB A;  3OYC A;  4ON0 A;  2R7T A;  3HRM A;  3P9K A;  3H0G J;  3PNV A;  5LFA A;  4IX7 A;  2A68 F;  3G1O A;  3HDD A;  3ZGK A;  1NH3 A;  3T5X A;  2R7X A;  1T95 A;  4I99 C;  2K02 A;  1TWA J;  2KRH A;  3G1M A;  4A3L J;  1LNW A;  4KT6 A;  5EZH A;  3R6S A;  1MMG A;  1VI0 A;  5F08 A;  1QPM A;  1Z1D A;  3UR3 C;  1KU9 A;  4S05 A;  5JHF A;  3ISP A;  5F0F A;  1UST A;  4G6D A;  4II2 A;  4YRV A;  3E6B A;  1TC3 C;  2Y69 H;  3V42 A;  3FM5 A;  4B09 A;  4U7D A;  4OAZ A;  3VPR A;  1YS7 A;  2OZ6 A;  1ZRC A;  2HR3 A;  1Y1W J;  2O03 A;  2CQN A;  1LVK A;  4NDL A;  4G7Z F;  2DCE A;  4S0H B;  3EYI A;  3E3V A;  2H1K A;  3JTH A;  3ULQ B;  4YEL A;  3PFY A;  1HF0 A;  1Z6T A;  4M9S A;  3FXM A;  4G12 A;  2GXB A;  2XV4 S;  2CUZ A;  2OF7 A;  1ZYR F;  3ABL H;  3KZY A;  3LSG A;  2HEO A;  2GAU A;  3VYT B;  3DXJ F;  1MKM A;  1Y56 A;  1B72 A;  5B1A H;  3MVP A;  4LLL A;  5DD4 A;  2BVL A;  1LDK B;  1WGX A;  1WFX A;  3CJN A;  3JRH A;  2DO7 A;  2EIK H;  1GUU A;  4OIO F;  1FIP A;  4IZZ A;  4E7Z A;  3ZQQ A;  1TW3 A;  5GAE J;  2BHY A;  2HQN A;  2LOO A;  1SAN A;  4A6D A;  3TO9 A;  4PJN A;  4M3G A;  2D1V A;  4B3A A;  1EJ9 A;  3JSP A;  1OMI A;  1IRF A;  3CCV I;  3HOV J;  3J80 Z;  4MEY F;  1IDY A;  3KCC A;  3AL0 C;  1LE8 B;  3QYF A;  3LL7 A;  2VQH A;  1DU0 A;  2BE5 F;  1TT5 B;  2ZJR F;  3GX4 X;  1GXP A;  2L02 A;  2L4M A;  4FE7 A;  3CMA I;  4CXF A;  3B6C A;  2VPR A;  5L3B A;  2WAF A;  2JN6 A;  2WV1 A;  5KCM A;  3JW4 A;  1U78 A;  4OMY A;  4BY7 J;  2QGU A;  3JRG A;  1JJ6 C;  2YSR A;  3O8G A;  4DW6 A;  3Q9V A;  3F21 A;  2V1N A;  1FTT A;  4ENJ A;  1OR7 C;  1PUF B;  2ZBK A;  3ZQI A;  4OIN F;  2DA2 A;  3DKW A;  4B48 A;  2FE3 A;  4IRG A;  2VQL A;  4X1E A;  3QPT A;  4DYC A;  3OY9 A;  3MKY B;  1Z0X A;  1A5J A;  2DA5 A;  1N75 A;  4E70 A;  1R6R A;  3HGY A;  4QIW N;  4S04 A;  4X6A J;  4ZYA A;  1STZ A;  2Y2Z A;  3ZCO A;  3N97 A;  1VTN C;  4E7J A;  4RA2 A;  2STT A;  3KP7 A;  3ZRG A;  1U2W A;  5CPR B;  2P5V A;  2RC4 A;  2KZG A;  2DOF A;  4EM0 B;  1RNL A;  3GW2 A;  3I53 A;  1JE8 A;  4C9Y A;  1K78 B;  2V1X A;  4NC6 A;  2KIS A;  2COB A;  4KIT B;  3BJO A;  3GTG J;  1USS A;  3FBI B;  2DQR A;  3W2A A;  3A0H C;  4J00 A;  2RNJ A;  1I3A A;  3ZQL A;  1SD5 A;  5JLX A;  1JGS A;  4MQV A;  2F5V A;  1MGT A;  5F1J A;  4I98 B;  3OYB A;  3QU6 A;  1TQI A;  3GUD A;  2H27 A;  1ZK8 A;  3QPL A;  5M5W J;  3A01 B;  2KIU A;  1ZG3 A;  3WHB A;  2R5Y A;  4LLN A;  2QKM B;  5D4R A;  1HW2 A;  2PBI A;  4F7Z A;  2Y9Z A;  1ETX A;  2XPV A;  3RPU A;  5D5V B;  2IS2 A;  2CV0 A;  5CVU A;  5HOD A;  4XQF A;  2LG4 A;  4DYR A;  1Z67 A;  2FQ3 A;  4B47 A;  4CCM A;  3PUB A;  1IZ1 A;  4KJZ A;  1RPW A;  2KHM A;  4C2M J;  3CCE I;  1O4X A;  1WPK A;  3DEE A;  4PSW A;  3WGI A;  4OAY A;  4KMU X;  4L5E A;  3DLA A;  3ABM H;  4AUX A;  1ETV A;  3S32 A;  4D7M A;  1Z6R A;  2CV1 A;  1V55 H;  4XLN F;  2WB1 N;  1QQI A;  1WJB A;  2K7L A;  1YIT I;  1GV2 A;  2CFO A;  2I8D A;  2WB1 A;  3IP4 B;  1OKR A;  2EFQ A;  2RV8 A;  4KT5 C;  4L9J A;  2QWW A;  3EUH C;  3F6O A;  2KKO A;  4RS8 A;  3IL2 A;  4AM3 A;  5CQE A;  1AWC A;  1R1T A;  1UZC A;  3FHZ A;  2OC6 A;  1PVE A;  1KA8 A;  5M5X J;  2LP0 A;  2PMH A;  1ZRE A;  2R93 J;  1XGO A;  3HXL A;  1SVO A;  2L9S A;  2HDD A;  2DW4 A;  5E8I A;  1IXS B;  1UAA A;  5GTH C;  5CVV A;  2LR8 A;  1TNT A;  5AIQ A;  3HBL A;  2P81 A;  4W97 A;  2WA0 A;  2DOA A;  2GA1 A;  3E5U A;  2MGQ A;  3RZO J;  4CCJ A;  4RM3 A;  3GTP J;  4KN7 X;  3KIO A;  4DGW B;  3KEY A;  4J19 A;  3HKZ N;  3QYE A;  2CG4 A;  1ETW A;  2DDA A;  3DKY A;  3GYH X;  2X0L A;  3D5R C;  2BXZ A;  1K4S A;  2RGV A;  2VJJ A;  1ZN2 A;  2QEN A;  3GFM A;  5ICF A;  3L2Q A;  2JA2 A;  3ZMV A;  1TWC J;  1YG2 A;  2VAS A;  4XRS G;  5M5Y J;  3DU5 A;  3OYE A;  2IXS A;  3E6C C;  2KZV A;  3CCQ I;  1FTZ A;  3P5J A;  3ZMZ A;  1T33 A;  1ULY A;  3FXL A;  2YS9 A;  5IYB J;  3WTS C;  1MH3 A;  1ODD A;  2QSF X;  2LYC A;  3OIO A;  4ANJ A;  2LY9 A;  1O3S A;  1G2H A;  2MD5 A;  1U6G A;  3PQJ A;  4F92 B;  3BY6 A;  2QQA A;  4R79 A;  2ISY A;  3CJT B;  1X2M A;  1X1B A;  2ZME B;  3HEF A;  2L7K A;  1KU7 A;  1HKQ A;  2C6Y A;  5FD5 A;  1XD7 A;  3PNT A;  3CMM A;  3CCM I;  5J40 A;  2TDX A;  3FDY A;  2HXI A;  4JX6 A;  1U8B A;  2E36 A;  3PSI A;  2IAI A;  5HLH A;  2K5C A;  4U88 A;  2H8W A;  2UV1 A;  2HQR A;  3KE2 A;  4D5F A;  2Q2E B;  4V2F A;  5DV5 A;  4Y17 A;  5FB2 A;  3TOA A;  3S1N J;  3GME A;  3BZ6 A;  2EIN H;  4RB0 A;  5EG0 B;  4BHC A;  3MMY B;  5FKO A;  5DUI A;  2EFN A;  2KRF A;  2NS0 A;  2DA7 A;  2OQG A;  4BBR J;  3D5L A;  3TW6 A;  2MW8 A;  4KIC A;  4M73 A;  2BZT A;  2CFX A;  1KQ8 A;  2XGX A;  4BDY A;  2DT6 A;  3HOU J;  5A2Q Z;  1VZ0 A;  5DM7 F;  2Z1D A;  3U9G A;  3UNG C;  3W2W A;  2MC3 A;  2K3P A;  1JGG A;  1IRZ A;  3LSR A;  2CH0 A;  3RYP A;  1NTC A;  1OIS A;  4BEH B;  1LDD A;  3I59 B;  1JKP C;  2A5W A;  2VT3 A;  3ZP5 A;  4NHJ A;  5JFR A;  2P5K A;  2A6E F;  3TO7 A;  1XGM A;  1NK2 P;  4C2U A;  3C2H A;  2VLA A;  2K86 A;  2D5V A;  2QVO A;  2QF7 A;  5D6F A;  1GVJ A;  1P4X A;  3O3K A;  1W36 C;  3BTJ A;  3CCJ I;  4PJM A;  1D8K A;  4RAZ A;  1WJ5 A;  4ZDO A;  5ILS A;  3L2W A;  3K9T A;  3ESW B;  1E3O C;  2EWN A;  4HF2 A;  1HST A;  1L3L A;  1ZG1 A;  4M6Y A;  5FLX K;  5CQG A;  3V7C A;  9ANT A;  3H0D A;  3VYR B;  3K0L A;  3ASO H;  3BG6 A;  4OIR F;  3RI4 A;  3LAP A;  4IO9 F;  1R9T J;  3CES A;  1BM9 A;  4HQM A;  2M1B A;  1RZ4 A;  1FYK A;  1QU3 A;  1MBH A;  2VKD A;  2HGC A;  3IH4 A;  3K4N A;  2X48 A;  5LGN A;  1IN6 A;  2IP2 A;  1DGW Y;  2IA0 A;  4ZYH A;  1K78 A;  4UUS B;  3C1D A;  4QSH A;  2VKV A;  1G3S A;  4A3D J;  2KP6 A;  2BHZ A;  3KP3 A;  3HZJ A;  1OPC A;  5C4X J;  3AG1 H;  3ONQ A;  2E1O A;  3OV8 A;  4HDU A;  4E7S A;  3O2P E;  3NAU A;  5IP7 J;  1W36 D;  1U0J A;  3JCU C;  2VI6 A;  4P5O A;  2F2E A;  3A01 A;  3H3U A;  4FHT A;  3HRS A;  1FNN A;  4DIQ A;  2VL8 A;  2PLY A;  4HNV A;  2Q0O A;  1TQM A;  1JUS A;  2W4S A;  3MFK A;  3GEZ A;  2G7H A;  4CHU A;  1NHA A;  1ZLJ A;  1XGS A;  2GQQ A;  1I1G A;  1I3Q J;  3E5Q A;  3SHF A;  2HWV A;  5DYM A;  2DA6 A;  1OCT C;  4RGX A;  1UHM A;  4II3 A;  1BI0 A;  2F48 A;  3R0A A;  5LRR A;  2L7M P;  4B4C A;  3ZQH A;  4MTE A;  2ZXI A;  5J1R A;  3S2H J;  4BE0 A;  2O61 A;  3RKX A;  1RKW A;  1O7L A;  2PEX A;  1AU7 A;  2R7W A;  1YQA A;  1O3T A;  3GWZ A;  1B6A A;  5EGO B;  3ZMS A;  1K79 A;  1D0X A;  2GA2 A;  4DNC A;  2HPM A;  3AL0 B;  1G3W A;  4QTR A;  2RKH A;  2RRE A;  2VOD A;  4ENM A;  1HC8 A;  1YIO A;  2L7Z A;  5LHI A;  3LSP A;  2XIG A;  4KIG A;  2GXA A;  3FZV A;  1X3W B;  3K70 C;  3L2U A;  3NRV A;  1D1C A;  2G0E A;  1GLN A;  4HV6 A;  1A04 A;  1SEU A;  2RQP A;  2R5Z B;  1IW7 F;  1D1B A;  4FE4 A;  2QM3 A;  3CF5 F;  3FKI J;  4FQG A;  3CDH A;  3IUO A;  4I7H A;  5IY5 H;  2GOM A;  3PJR A;  2HKO A;  4PFP A;  3ZQF A;  4CUG A;  2PMZ A;  4EQQ A;  3LMM A;  5FLM J;  1VQO I;  4F52 A;  3Q9S A;  1YOV B;  2XB0 X;  3HHH A;  1H8A C;  3HGG A;  2XF7 A;  2CYY A;  2K40 A;  4XOP A;  2EZH A;  4HPQ A;  4KN4 X;  3W6J B;  2RAE A;  5IP9 J;  3ZXS A;  4AIK A;  3PQK A;  1BJZ A;  3JR9 A;  2LD5 A;  4EAT A;  1A31 A;  2CUJ A;  3BJ6 A;  4G6T B;  4UVC A;  3V8K A;  1YW7 A;  3HJE A;  4GXO A;  1UEL B;  3BR6 A;  2DMN A;  5HDG A;  1PP8 F;  3JSO A;  3K70 D;  1G4D A;  2HOE A;  4JK1 X;  2DYR H;  4BBS J;  1ZGW A;  2ZKZ A;  3M9A A;  2K85 A;  3PNY A;  2IEK A;  2ZME A;  4A0Y A;  2Q8K A;  3TDU C;  3K4L A;  4XKV A;  3BCA A;  4M3D A;  3CC7 I;  3G2B A;  4HAM A;  2DA4 A;  4UVB A;  2KIF A;  3S16 J;  2QQ9 A;  3ZQ7 A;  1KQ0 A;  5CVR A;  4OU0 A;  3MKZ A;  4G94 A;  4LLG F;  3CUQ B;  2Q2E A;  4HF0 A;  4HSR A;  1YRN B;  1GHC A;  1X1P A;  1PUE E;  2L4A A;  1G6N A;  2ZJQ F;  3GTK J;  1G3Y A;  3OOP A;  4XMY A;  3F23 A;  1EH8 A;  1IN7 A;  3BPV A;  5EG0 A;  1S5L C;  4LIT A;  4D5C A;  4A12 A;  1LUJ B;  4G7O F;  2MLK A;  2UZK A;  3IH2 A;  2ME0 A;  3ABT A;  1AHD P;  2P8T A;  1YJW I;  3DEW A;  4RGU A;  1UG2 A;  4JX5 A;  2FBK A;  1V54 H;  2V9P A;  3F8N A;  1IRX A;  3EDP A;  5LEJ A;  3K4K A;  3QRF F;  3DKX A;  3QU3 A;  1IN4 A;  3HB9 A;  2Y0M A;  2LY2 A;  4RGS A;  3CC4 I;  3LA2 A;  2NNN A;  4AIJ A;  2VUM J;  3KZZ A;  3K6G A;  2VBW A;  4M3F A;  2IGK A;  4HYE A;  1OCO H;  5IOY A;  2VT2 A;  5HNF A;  3MN2 A;  2JQ7 A;  2UUZ A;  1YX5 A;  3GXO A;  4BEH A;  2J5P A;  5K7Z A;  3I59 A;  2HS5 A;  3E5X A;  3WTT C;  1LFB A;  2JT1 A;  4MO7 A;  5GPA A;  3CO6 C;  2VOP A;  1EH7 A;  1Y8R B;  1EKE A;  3MWM A;  4A93 J;  1L0O C;  2I10 A;  1DGR M;  1TBX A;  2E1M B;  4XIC A;  4FTH A;  3M1E A;  2VB6 A;  2UWM A;  5GAH J;  3HOW J;  3AG3 H;  2IPQ X;  2HNH A;  5LRS A;  4N4N B;  3ASN H;  4A0Z A;  4HBL A;  4DBQ A;  2F5E A;  2VON A;  1D3Y A;  2D2W A;  1MD0 A;  4ENK A;  2W7N A;  1LQ1 A;  2X85 A;  3LA3 A;  2BW3 B;  1P7J A;  2OUM A;  1WJE A;  2WTE A;  3OYF A;  4HDV A;  2MSY A;  2NVY J;  1LPQ A;  3ERM A;  1YI2 I;  1WSU A;  2OTJ I;  4BL0 B;  1LEB A;  1R58 A;  3F3X A;  2H6B A;  4BXF A;  1J7K A;  2VOO A;  3HPH A;  4B1R A;  2ZC2 A;  4UB8 C;  1NG7 A;  1SFX A;  4YEJ A;  1X4P A;  2ZJP F;  2CMP A;  2G9W A;  3Q0W A;  4N0B A;  2RDP A;  2DDB A;  3I3L A;  1SAX A;  3P9I A;  2BY0 A;  5TJJ A;  4LG0 B;  1J9I A;  3B73 A;  2HQA A;  4Y33 A;  3GTQ J;  2HVR A;  1IUY A;  2NS7 A;  2DK5 A;  3L7W A;  5L3G A;  1O7F A;  1Q1V A;  5LHG A;  1Z3Y A;  2WAD A;  3JRE A;  2K9Q A;  3K2A A;  4UUS A;  1UMQ A;  3QPH A;  5H6Q A;  3W6K B;  3MKL A;  1QZZ A;  4IF4 A;  4JOM A;  4XLH A;  2GM4 A;  3K1N A;  4XRM A;  2FX0 A;  4WF2 A;  2ICW G;  5E3L A;  3MZ8 A;  3WGG A;  2P6S A;  1Z21 A;  1IO2 A;  2M2E A;  2HQ5 A;  1SC7 A;  1X58 A;  2GXG A;  5HDK A;  1XX5 A;  2V6C A;  3BR0 A;  4YIF A;  1B8I B;  2YR2 A;  3Q0V A;  3OS1 A;  1FMV A;  1UB9 A;  2DMT A;  2H09 A;  5E3N A;  3OYA A;  1IF1 A;  3QPS A;  1ETO A;  2P0W A;  1V5E A;  3DV8 A;  1AKH B;  1F36 A;  2L9R A;  3OYL A;  2XPW A;  2V6E A;  4LK0 F;  4GCV A;  2W25 A;  2QQB A;  2X1D A;  4UUT A;  2UXX A;  4P9U A;  5CLS A;  1RET A;  2M34 A;  2FD5 A;  3CDI A;  1HKT A;  3JAM K;  3DWL E;  4CCO A;  2DU9 A;  5JHU A;  4AC0 A;  2RN7 A;  4BKX A;  4HX8 A;  3HTS B;  4M74 A;  2DTR A;  2B0L A;  5IOZ A;  4OIP F;  2KJC A;  3WTW C;  4MIM A;  1WI3 A;  5KVR A;  2ESH A;  2Y9Y A;  1S8N A;  4IRH A;  3O6B B;  4D7N A;  1H0M A;  2V1U A;  5EGO A;  2O7O A;  4U0W A;  3QQA A;  1P7I A;  4BE2 A;  1KON A;  2FJ1 A;  3I0T A;  4Z2Y A;  3VYU B;  3IAS 2;  1IDZ A;  2F5D A;  3JRI A;  2ZSH B;  1A6I A;  2F5C A;  2O0Y A;  3TOB A;  2E7X A;  2VE9 A;  3CZ6 A;  5EDN A;  1XDS A;  2Z5U A;  4CSW A;  2IS1 A;  2XGC A;  1D0Y A;  2LDU A;  2O8K A;  2R5Z A;  5FRM A;  2WY8 Q;  4LFU A;  1QZE A;  2OJE D;  2DLL A;  5HS9 A;  2MH2 A;  3V7R A;  4YII A;  3HIF A;  4FAS D;  3GLL A;  3CCU I;  2EPF A;  2MBF A;  3REO A;  1OR7 A;  2KDO A;  2IS6 A;  1FEX A;  2PN6 A;  1QZY A;  5D5X B;  2FSW A;  3K10 A;  4IQJ A;  2O8X A;  1MMD A;  2FNP A;  1RKT A;  3DEU A;  5AIP A;  4AWX B;  5J3L A;  3NQO A;  1SMY F;  2O6G E;  2M30 A;  2DFE A;  4BHB A;  3B02 A;  3F22 A;  3BQY A;  3X2Q H;  2YU3 A;  3F72 A;  2R7Q A;  1U8R A;  3S14 J;  2Y31 A;  2XUB A;  3SEZ A;  3RCO A;  1BR4 A;  2FMY A;  3DPL C;  3T8R A;  4AD9 A;  2JA5 J;  3M8F A;  2L3D A;  2CRG A;  4ZTF A;  1GVD A;  3JRA A;  2Y48 A;  2BVM A;  4OOI A;  3VOD A;  5C4J J;  4IHS A;  4L0Y B;  4LB5 A;  2KLO A;  3DBR B;  5FJ8 J;  4JQF A;  4BJ5 C;  3L00 A;  2Z99 A;  3CP2 A;  4FX4 A;  2R7U A;  3GF2 A;  2R0Q C;  1HDP A;  3GFL A;  5HDN A;  2NVQ J;  2HYF A;  1XDU A;  1Y1V J;  2W57 A;  2EV0 A;  2LKS A;  4M6X A;  2LSO A;  2A3S A;  2M9H A;  1DPR A;  2GBY A;  1PYV A;  3FXO A;  2HTJ A;  1BOA A;  3EYY A;  2BBY A;  1BW5 A;  5BQT A;  2HPI A;  5F27 A;  1YRN A;  2VE8 A;  4N9H A;  4EM1 A;  4UUV A;  5J47 A;  1G3T A;  1APL C;  3OL3 A;  5KAI C;  1IC8 A;  4IHV A;  3K4J A;  2HZT A;  4C2T A;  1JJ8 C;  4M3B A;  2EQR A;  3LFU A;  2K3F A;  3BQZ A;  1E2X A;  2JSC A;  4DQ2 A;  1KU2 A;  3HSR A;  2EV6 A;  4F93 B;  3KET A;  1BIB A;  5FGM A;  4XLF A;  5E1W A;  3BR3 A;  3OS2 A;  1ON2 A;  1FOW A;  4N9I A;  4MFD A;  3EUH A;  2OD5 A;  4RB3 C;  4Q4Z F;  1SD4 A;  2AQE A;  1FT9 A;  2NXN B;  4G7H F;  4P96 A;  1F9N A;  3RKQ A;  2K4J A;  2STW A;  5BPI A;  4CIC A;  4B44 A;  2R92 J;  4KUM A;  5AON A;  4ASN A;  2HFH A;  4C3J J;  4XRS A;  3VSL A;  2H94 A;  2O9L A;  1FMW A;  2YPR A;  3FMS A;  3L09 A;  3FIS A;  3CUQ C;  2LVS A;  3MAJ A;  1TTY A;  4MHG A;  3FXJ A;  1GDT A;  1ORK A;  2IT0 A;  4DZJ A;  4LOC A;  2DMP A;  4KFC A;  5BMZ A;  2BW3 A;  2LTP A;  1ZR4 A;  1WZ2 A;  3OR2 C;  5FLX Z;  1X4O A;  2CO5 A;  2EV5 A;  3EUK L;  5CVJ A;  1R4N B;  4NQW B;  3BR2 A;  1I5Z A;  2CGP A;  4KMF A;  2A5Y B;  4XOT A;  2LC2 A;  4HX4 A;  4IQ4 A;  3SYT A;  3BZK A;  1R5I D;  2H8R A;  4PGH A;  2AXL A;  1Y39 A;  3KX2 A;  1R00 A;  3IRR A;  2IA1 A;  4NBQ A;  5B5E C;  4LG0 A;  2P5L C;  3FXU A;  1S29 A;  2HZD A;  4LD5 A;  3GLX A;  2FQ4 A;  4QPO A;  2IW5 A;  2EA4 A;  1QO0 D;  3HOS A;  2L01 A;  4D1Q A;  1O3Q A;  3NWS A;  3I4M J;  3RDI A;  1POG A;  2E1M C;  3VWB A;  5LLQ A;  1WVR A;  4BYY A;  1LKX A;  1R5H A;  2VKE A;  1SD6 A;  4I0B A;  2D45 A;  1E0E A;  1VQ7 I;  3C18 A;  4AVP A;  4O5V A;  4Q48 A;  2LY1 A;  1J5Y A;  4BS9 A;  3CJR B;  4GDF A;  1MBF A;  4YFK F;  4UY8 I;  1MMS A;  3AFH A;  2V9K A;  3JRF A;  3M8E A;  3CJQ B;  1ON1 A;  3HKZ A;  4NNJ A;  3OL4 A;  3BPX A;  5E20 A;  1PP7 U;  3OYI A;  1AKH A;  3QWL A;  4BJT A;  4Y13 A;  3IKT A;  1N77 A;  4DBR A;  3S3N A;  3RKY A;  3I55 I;  2FML A;  3WE2 A;  2W24 A;  2FA5 A;  4HV5 A;  2IS4 A;  3RYR A;  1H9G A;  4Y4R A;  3GZN B;  2KDZ A;  1SFE A;  1UHS A;  2DBB A;  1E17 A;  2XAG A;  3H1C A;  3H9G A;  1TT0 A;  2VXZ A;  2LFB A;  2QBY B;  4I01 A;  2YU9 J;  4P55 A;  4JBA A;  1MBJ A;  3IC7 A;  5HLT A;  3JTG A;  2VBY A;  3LWF A;  3WHC A;  5LHH A;  1XG1 A;  1LVA A;  2XB5 A;  2JTV A;  3S15 J;  5J8C A;  3HSE A;  3F0C A;  1D8J A;  5EYR A;  4LIV A;  3OMY A;  3K2Z A;  5E17 F;  4V2G A;  4Q47 A;  2K9M A;  1ZGA A;  3KLO A;  1FLI A;  1U3E M;  4XLP F;  1DP7 P;  1VND A;  3SQN A;  4BAC A;  2CQK A;  1D0Z A;  6PAX A;  2XRN A;  3BG9 A;  3FX3 A;  3PUF A;  1FYL A;  5CKT A;  2ZNY A;  5DM6 F;  3BR1 A;  1XSV A;  4L9T A;  2HI3 A;  1ZTR A;  4RM2 A;  4XR6 A;  1BR1 A;  2OQR A;  4RLQ A;  4CYC B;  4O3M A;  2DJN A;  2EK5 A;  2FF4 A;  2DFH A;  2EIJ H;  2R7F A;  3KP6 A;  4BU2 A;  4BAY A;  5TRD A;  1JXS A;  1B9M A;  2CS3 A;  2NVX J;  4KIF A;  2B63 J;  4EMS A;  3C2G A;  5FKN A;  1JT0 A;  3HG9 A;  2P7C B;  4BJ6 C;  5DEQ A;  4CCL A;  1K6O A;  3KLN A;  1WWX A;  2E5Z A;  2ZFW A;  4M71 A;  4GYI A;  4PDK A;  1FBQ A;  1P6R A;  2MLG A;  4E7K A;  3HOY J;  2DTZ A;  1LE8 A;  1BL0 A;  1BJA A;  2QA4 I;  3VSK A;  3A03 A;  1S7E A;  1W4M A;  3OS0 A;  3UKG A;  5FKK A;  1J2X A;  3S1Q J;  1KGS A;  2MA3 A;  4U7B A;  1HA8 A;  2F5F A;  1JUM A;  1LFU P;  5EEG A;  1T38 A;  2OBP A;  1I1S A;  3M8J A;  1RUO A;  5EEH A;  1TLH B;  1TW2 A;  2DPU A;  4U87 A;  2MH9 A;  2VBX A;  2HDW A;  3BTI A;  4ZDP A;  2HOA A;  4HOB A;  1PUF A;  3BG3 A;  4BHP A;  2PI0 A;  2EIM H;  2BEO A;  2E2H J;  4AID A;  2A69 F;  2ESN A;  3I58 A;  4I09 A;  3KYC B;  1YIJ I;  1R22 A;  3WGH A;  1UFM A;  1S7O A;  3I4P A;  3E7L A;  5GPC A;  5LD2 C;  2E1C A;  2QEX I;  1R7J A;  3M07 A;  3FKJ A;  4JX4 A;  1FOK A;  4ZC3 A;  2ELK A;  2X9D A;  5FD6 A;  3CCL I;  1K83 J;  1FOX A;  3R4K A;  5D8L B;  2BGC A;  5JR3 A;  2LF8 A;  3E1S A;  4EEF G;  5L3D A;  4PCQ A;  2VC0 A;  5TIS C;  4CZZ A;  3TMO A;  2HDC A;  4ESF A;  1QHG A;  2RQQ A;  2JUC A;  2NRA C;  2RNG A;  1ETY A;  2EFW A;  1XSX A;  3WTX C;  3J7Y J;  1O3R A;  3ML6 A;  1P4A A;  3ZQG A;  1ONV A;  3FMQ A;  1OJL A;  3WOD F;  2LK2 A;  1HW5 A;  2XC7 A;  1J59 A;  2EB7 A;  2XKP A;  4HRI A;  4CH7 A;  4I02 A;  2EZL A;  3C2B A;  3MZH A;  5IT9 K;  5FRO A;  2DOD A;  4O6J A;  3LSH A;  3Q3S A;  1SVM A;  4LJZ F;  3OOU A;  5BPD A;  3KYD B;  5EF6 A;  1CGP A;  3LST A;  1C0W A;  1X19 A;  2ELH A;  5DUK A;  1WQ2 A;  4YFN F;  2A05 A;  4BXX J;  2KIM A;  2WAE A;  2WY7 Q;  1Z7L A;  3K4M A;  5BOX A;  4IOA F;  4HLY A;  2FOW A;  3AAF A;  3IRQ A;  3FK6 A;  5IP6 A;  1SFO J;  3ZN1 A;  4KIS A;  4XBF A;  3I56 I;  2BV6 A;  2MC4 A;  4L9N A;  4MNU A;  1ZLK A;  2AQF A;  1U5T C;  2YX7 A;  2NS8 A;  5JVT A;  1MW7 A;  1T98 A;  2XDV A;  1IUF A;  3I5U A;  3CD6 I;  3G71 I;  4P9F A;  3RKW A;  2ZFU A;  2JA8 J;  3KP5 A;  3KYL A;  1BN5 A;  1EH6 A;  2L54 A;  2FXA A;  2G7U A;  3I64 A;  2K4B A;  1Y0U A;  5H20 A;  2IJL A;  1YHQ I;  2X6O A;  4XKB A;  3O8H A;  3ZMT A;  3LSJ A;  1UJ8 A;  3J7A Y;  2Z16 A;  1D5V A;  3CF2 A;  3HYI A;  3G1L A;  3M1C A;  5ICG A;  4IPA A;  2IGN A;  2W84 A;  1FOY A;  3QOE A;  1RR7 A;  4A5N A;  1WKM A;  1TQP A;  1H88 C;  1BC8 C;  3BP8 A;  1B59 A;  4A3J J;  3FBN B;  3KP2 A;  1J75 A;  1ZQ3 P;  2BOL A;  3ZOB A;  1ZKG A;  2KQR A;  1IJW C;  2GLO A;  2HXO A;  2CQQ A;  3H36 A;  4XSX F;  1LB2 A;  1DUX C;  4I2O A;  4G6Q A;  1W1W E;  2W00 A;  2XAQ A;  4ZJZ A;  5KHD A;  2PJP A;  3MD2 A;  3RQ4 A;  2FUG 2;  1RES A;  1MBK A;  2Y30 A;  4HF1 A;  4Z6Y A;  3SZT A;  3DP7 A;  4PJJ A;  3VB2 A;  1VQ8 I;  4LIU A;  1OCR H;  1IXR C;  1YYV A;  5K7H A;  5J4V A;  2K9S A;  1D5Y A;  4LB6 B;  4QWQ A;  3G73 A;  2M3A A;  2AXT C;  2KL4 A;  1FBU A;  2E71 A;  2QBY A;  3KEQ A;  4NC7 A;  4IJA A;  3IAM 2;  2N8G A;  1FBS A;  1Z9C A;  2MG4 A;  4BQN A;  4XLE A;  2M5W A;  3MQ0 A;  2ZXH A;  2XAJ A;  2AO9 A;  5E18 F;  5A2Q K;  1YJN I;  1ETK A;  1MSF C;  3GBG A;  2Y75 A;  3G3Z A;  4CCK A;  3DTK A;  3HOT A;  4GGG A;  4AYB N;  1FYM A;  4ETS A;  2RVC A;  4RAG A;  2W85 A;  4UHT A;  5HS8 A;  5IPA A;  4UV9 A;  2OU2 A;  3DTE A;  4AYB A;  4XK4 A;  3H9Q A;  2CW7 A;  3ZN0 A;  4BE1 A;  2EJR A;  4FT8 A;  3GTL J;  3OYG A;  1R71 A;  4C3I J;  5F64 A;  3BTL A;  2P6T A;  3S1R J;  1XB4 A;  4CCN A;  2R7R A;  1BA5 A;  4XRF A;  2WV0 A;  1FY7 A;  1Z7U A;  3FK7 A;  3IHU A;  3LSK A;  4CYC A;  2L9V A;  4R1H A;  1XTA A;  1XMX A;  2F4I A;  3WTY C;  2VQG A;  2JRM A;  4I0A A;  1YX3 A;  3L2R A;  4L18 B;  2QSH X;  4IOC F;  3ABK H;  2OV7 A;  4H0E A;  3SDG A;  3WG7 H;  4WXH A;  1O57 A;  2CJJ A;  3CMY A;  1Z77 A;  3K1P A;  3S1M J;  4RAY A;  1UCR A;  2DMU A;  3FWE A;  2QLZ A;  3U21 A;  2M7A A;  2ZCW A;  2BYV E;  2W1O A;  1HXD A; 
#chains in the Genus database with same CATH homology
 3V4G A;  3HTU A;  2XVC A;  1X3U A;  2WC2 A;  2Z33 A;  5L3C A;  1P92 A;  1LEA A;  3ZMD A;  1YW8 A;  4WXD A;  1ZG5 A;  1KYZ A;  4ZH4 F;  1S7A A;  3ZPL A;  4KA4 A;  2UXN A;  2CWE A;  4HQE A;  4QLC U;  3GVA A;  4WXC A;  2ZNZ A;  4ESJ A;  4L5J A;  4MEX F;  5F6F A;  2JPB A;  2X4H A;  3F8F A;  2FU4 A;  5E1X A;  3QOP A;  2H6C A;  1YW9 A;  5LEK A;  5ERI A;  4MGR A;  1BI3 A;  1KYW A;  1YLF A;  3TDZ C;  1IN8 A;  4EVI A;  1T39 A;  1ZAR A;  4A6E A;  3MCZ A;  1R1V A;  3M7G A;  4M9X A;  5DCM B;  1YFH A;  4HW0 A;  5J6X A;  4EGY A;  3MEX A;  5ILV A;  4CO8 A;  4EM2 A;  2EA2 A;  3V8J A;  4A2U A;  1I27 A;  5H6R A;  1IRG A;  1BI1 A;  1BI2 A;  4LGW A;  5D5W B;  2XHK A;  4FX0 A;  4HZF A;  4OMZ A;  4HA8 A;  1XMK A;  3D0S A;  3RJP A;  5D8K B;  3TGN A;  3KFW X;  2ISZ A;  4IXA A;  2CW0 F;  1F1Z A;  5HS7 A;  2HYG D;  4K2E A;  3ERE D;  4L9V A;  4UXN A;  2IVM A;  4HX7 A;  2NAZ A;  1R1U A;  4KNY A;  4OIQ F;  4AIH A;  2YX4 A;  3L2C A;  3DPT A;  1S3J A;  5K1Y A;  2ZO4 A;  3ZMU A;  1KQ9 A;  1IXC A;  3FXR A;  1AOY A;  2VBZ A;  4B8X A;  3T1B A;  2XRO A;  2PMU A;  3R0J A;  1ZRD A;  2HTS A;  3VEP A;  4PZJ A;  1FSE A;  3TKY A;  2DFI A;  4CGZ A;  3IWZ A;  5K5Q A;  2A61 A;  2FEZ A;  5J8F A;  1QGP A;  5K5O A;  3V8L A;  3CUQ A;  3K69 A;  1V4R A;  1R36 A;  3R60 A;  1HKS A;  3VFZ A;  3I54 A;  3R61 A;  1LJ9 A;  5ILU A;  1R5G A;  3J81 K;  3CO7 C;  1I6X A;  3ROU A;  1B9N A;  1QBJ A;  4RGR A;  1WI9 A;  1RIO H;  2QUF A;  2DQL A;  1RUN A;  3SFZ A;  1U5T B;  3WTV C;  1T6S A;  3Q5F A;  4BQA A;  4ESB A;  1REP C;  3WE3 A;  3BOQ A;  3NEU A;  3P7N A;  1UHW A;  1HQC A;  3KP4 A;  2P7V B;  1OYI A;  1V3F A;  4KIB A;  3T8T A;  1W7P B;  5L3E A;  2A6H F;  5D5U B;  3LQR A;  2HKX A;  1GXQ A;  3H3Z A;  5BS6 A;  4EJW A;  4IVN A;  4ZYD A;  2COM A;  3F8M A;  3GO5 A;  4G8X A;  5LGT A;  2IRF G;  1R23 A;  3WTU C;  2NYX A;  2R3S A;  2ZJ2 A;  4EJU A;  4ENN A;  1W5T A;  1ZRF A;  4BNC A;  2VC1 A;  2GWR A;  1B1B A;  3PFI A;  2ACJ A;  3L9F A;  2WWY A;  5ICE A;  3E6M A;  3SXY A;  2XAH A;  4L5I A;  1BBY A;  5LBQ A;  5IT9 Z;  2E7W A;  5CVI A;  3CTA A;  1CF7 B;  5DCM A;  2XKO A;  4MTD A;  1XCB A;  4U0Y A;  1Z91 A;  1OYW A;  1DDN A;  3FF5 A;  1JHF A;  2XAS A;  3TO6 A;  4MQ9 F;  2PG4 A;  1Q1H A;  4D0P A;  3BDD A;  2V1D A;  5K5R A;  3J80 K;  1HBX G;  3U1D A;  1MJ9 A;  1FWZ A;  3LA7 A;  3T0Y A;  2O3F A;  4TV7 A;  3WG9 A;  3SZP A;  3C7J A;  2DK8 A;  3CUO A;  4BXU A;  3BRO A;  4RB1 A;  2V79 A;  3VOE A;  1BIA A;  5ED4 A;  4EV0 A;  5ICC A;  3RPQ A;  5D4S A;  1SFU A;  2Z9O A;  1FSH A;  3BWG A;  3WU1 B;  4EJV A;  3FXQ A;  5JI6 A;  4YG2 F;  3TQN A;  3I71 A;  2VN2 A;  3HUG A;  4RB2 C;  2A07 F;  2R7D A;  1SMT A;  4L0Z B;  2KJB A;  3LAJ A;  3IWF A;  5FFZ A;  2JPC A;  2EFP A;  1F5T A;  3ECO A;  1MJB A;  2NNY A;  1MDM B;  3MZY A;  4IHT A;  2PFB A;  1JHH A;  1XCV A;  5KK1 A;  3FMR A;  3WTZ A;  4IRI A;  3J7A O;  2ZXJ A;  5E1Z B;  2P4W A;  2DAO A;  3RTR A;  1ZAO A;  4WX9 A;  1J0R A;  2ETH A;  2JZY A;  4UVA A;  5DD8 A;  2GIV A;  1U5T A;  3QP6 A;  4U0V A;  4ZZL A;  3GZ5 A;  4EGZ A;  3RIR A;  1Z05 A;  3QAH A;  2XAF A;  4XSZ F;  1W7P A;  4WK8 F;  4ZYE A;  3F6V A;  1FC3 A;  2CSO A;  4LMY A;  4KYW A;  2FBH A;  1P4W A;  1XSD A;  1XGN A;  5F1R A;  1PDN C;  1FX7 A;  2K27 A;  1B4A A;  4A0X A;  4NQW A;  2FNA A;  3COA C;  4EJT A;  3GFI A;  2M8E A;  1ZHF A;  3F8C A;  5HLG A;  1S6L A;  5CYV A;  5E8G A;  3P9C A;  3IKV A;  5CJ9 A;  1IAW A;  3BJA A;  2GZW A;  3U2R A;  1OYY A;  1HW1 A;  1BC7 C;  5HVQ C;  3WU0 A;  1CF7 A;  4A5M A;  3EQL F;  3HSF A;  3QP5 A;  3LFK A;  1T2K A;  2J5O A;  3ABU A;  4Q5S F;  3JAM Z;  3GFJ A;  1WRJ A;  1H9T A;  3V7S A;  5FFX A;  4WWC A;  4WCG A;  4BH9 A;  3EET A;  4GYG A;  1W7P D;  2M45 A;  2FBI A;  3DF8 A;  5IT3 A;  4ZYG A;  3E97 A;  1FP2 A;  1K7A A;  1QNT A;  4NB5 A;  2LF7 A;  2FOK A;  5HOO A;  2E1N A;  2EFO A;  5DDG A;  4EJO A;  1YS6 A;  2AS5 F;  1YO5 C;  3CLO A;  4YFX F;  4M72 A;  1W5S A;  4ZZD A;  4PGG A;  4KDP A;  3KEO A;  3FM3 A;  3K1M A;  1HSJ A;  1XMA A;  4M9Z A;  4LK1 F;  2V9V A;  3HRT A;  1SD7 A;  2FRH A;  1XN7 A;  3C3W A;  5L3F A;  1MZB A;  1DPU A;  2LNB A;  4Y15 A;  4CDG A;  3E6D A;  2Z3Y A;  1YTY A;  4GO1 A;  4UV8 A;  4R8H A;  1LDJ A;  1TNS A;  3N4M A;  1MDM A;  2ADU A;  1FPQ A;  2OZU A;  1P2F A;  1ZGJ A;  2OA4 A;  1IN5 A;  5FO5 A;  3J81 Z;  2DPD A;  2M87 A;  1KU3 A;  4G9Y A;  3LQQ A;  2OAZ A;  3H92 A;  5DCF A;  3ELK A;  2JRT A;  3DFG A;  1FZP B;  3GZ6 A;  1RI7 A;  1ZH5 A;  5D6E A;  3S2W A;  3DQV C;  4CYD A;  3ECH A;  1T0F A;  2LKP A;  4HLX A;  2DI3 A;  1FP1 D;  2PQ8 A;  3F8B A;  5LGU A;  2D1H A;  2DT5 A;  1MJA A;  4UNO A;  5HLI A;  1F4K A;  2QZ8 A;  3HHG A;  3HRU A;  2IA2 A;  1EV7 A;  2QYO A;  4ON0 A;  3HRM A;  3P9K A;  2A68 F;  3T5X A;  2K02 A;  1LNW A;  3R6S A;  1QPM A;  1Z1D A;  1KU9 A;  4S05 A;  3ISP A;  1UST A;  4G6D A;  3E6B A;  3FM5 A;  4U7D A;  4B09 A;  1YS7 A;  2OZ6 A;  1ZRC A;  2HR3 A;  2O03 A;  4G7Z F;  3EYI A;  3E3V A;  3JTH A;  3ULQ B;  1Z6T A;  4M9S A;  2GXB A;  2XV4 S;  1ZYR F;  3KZY A;  2HEO A;  2GAU A;  3DXJ F;  1MKM A;  4LLL A;  5DD4 A;  1LDK B;  3CJN A;  2DO7 A;  4OIO F;  1TW3 A;  2HQN A;  4A6D A;  3TO9 A;  2D1V A;  3JSP A;  1OMI A;  1IRF A;  3J80 Z;  4MEY F;  3KCC A;  2BE5 F;  3GX4 X;  1GXP A;  2L02 A;  2L4M A;  4CXF A;  5L3B A;  3JW4 A;  1U78 A;  4OMY A;  2YSR A;  3Q9V A;  3F21 A;  4ENJ A;  2ZBK A;  4OIN F;  3DKW A;  2FE3 A;  4IRG A;  3QPT A;  4E70 A;  4S04 A;  1STZ A;  3N97 A;  1VTN C;  2STT A;  3KP7 A;  1U2W A;  2P5V A;  2RC4 A;  4EM0 B;  1RNL A;  3GW2 A;  3I53 A;  1JE8 A;  1K78 B;  2V1X A;  3BJO A;  1USS A;  2DQR A;  2RNJ A;  1SD5 A;  1JGS A;  4MQV A;  1MGT A;  4I98 B;  3QU6 A;  1TQI A;  3GUD A;  2H27 A;  2KIU A;  1ZG3 A;  4LLN A;  5D4R A;  1HW2 A;  2PBI A;  4F7Z A;  5D5V B;  3RPU A;  5CVU A;  2FQ3 A;  1IZ1 A;  3WGI A;  4KMU X;  1Z6R A;  4XLN F;  1QQI A;  2K7L A;  4KT5 C;  1OKR A;  2EFQ A;  2RV8 A;  4L9J A;  2QWW A;  3F6O A;  2KKO A;  4RS8 A;  3IL2 A;  1AWC A;  1R1T A;  3FHZ A;  1KA8 A;  2PMH A;  1ZRE A;  1XGO A;  2DW4 A;  5E8I A;  1IXS B;  5CVV A;  1TNT A;  5AIQ A;  2GA1 A;  3E5U A;  4KN7 X;  2CG4 A;  3GYH X;  2X0L A;  2RGV A;  1ZN2 A;  2QEN A;  3GFM A;  5ICF A;  3ZMV A;  1YG2 A;  3E6C C;  3ZMZ A;  1ULY A;  3WTS C;  1ODD A;  1O3S A;  2MD5 A;  1U6G A;  3PQJ A;  3BY6 A;  2QQA A;  4R79 A;  2ISY A;  2ZME B;  1KU7 A;  1HKQ A;  2C6Y A;  5FD5 A;  1XD7 A;  2TDX A;  5HLH A;  4U88 A;  2HQR A;  3KE2 A;  5DV5 A;  4Y17 A;  5FB2 A;  3TOA A;  3BZ6 A;  4RB0 A;  4BHC A;  5DUI A;  2EFN A;  2KRF A;  2NS0 A;  2OQG A;  3D5L A;  4KIC A;  4M73 A;  2CFX A;  1KQ8 A;  2XGX A;  5A2Q Z;  3U9G A;  2MC3 A;  3RYP A;  1LDD A;  3I59 B;  2VT3 A;  3ZP5 A;  4NHJ A;  5JFR A;  2P5K A;  2A6E F;  3TO7 A;  1XGM A;  2K86 A;  2QVO A;  5D6F A;  1GVJ A;  1P4X A;  3O3K A;  1D8K A;  4RAZ A;  5ILS A;  3K9T A;  2EWN A;  4HF2 A;  1HST A;  1L3L A;  1ZG1 A;  4M6Y A;  5FLX K;  3V7C A;  3K0L A;  3RI4 A;  4OIR F;  3LAP A;  1BM9 A;  4HQM A;  2M1B A;  1RZ4 A;  1FYK A;  2HGC A;  5LGN A;  1IN6 A;  2IP2 A;  2IA0 A;  4ZYH A;  1K78 A;  3C1D A;  1G3S A;  3KP3 A;  1OPC A;  3OV8 A;  4HDU A;  3O2P E;  4P5O A;  2F2E A;  3H3U A;  4FHT A;  3HRS A;  1FNN A;  2PLY A;  2Q0O A;  1TQM A;  3MFK A;  3GEZ A;  2G7H A;  4CHU A;  1NHA A;  1ZLJ A;  1XGS A;  2GQQ A;  1I1G A;  3E5Q A;  3SHF A;  2HWV A;  5DYM A;  4RGX A;  1UHM A;  5LRR A;  1BI0 A;  3R0A A;  4MTE A;  2O61 A;  3RKX A;  1O7L A;  2PEX A;  1YQA A;  1O3T A;  3GWZ A;  1B6A A;  1K79 A;  3ZMS A;  2GA2 A;  4DNC A;  1G3W A;  2RKH A;  2VOD A;  4ENM A;  1YIO A;  5LHI A;  2XIG A;  4KIG A;  3FZV A;  3NRV A;  4HV6 A;  1A04 A;  2RQP A;  1IW7 F;  2QM3 A;  3CDH A;  4I7H A;  2HKO A;  4EQQ A;  3Q9S A;  3HHH A;  2CYY A;  4KN4 X;  3W6J B;  4AIK A;  3PQK A;  3BJ6 A;  4UVC A;  3V8K A;  1YW7 A;  4GXO A;  5HDG A;  1PP8 F;  3JSO A;  1G4D A;  2HOE A;  4JK1 X;  2ZKZ A;  3M9A A;  2ZME A;  4A0Y A;  2Q8K A;  3TDU C;  4HAM A;  4UVB A;  2KIF A;  2QQ9 A;  3ZQ7 A;  1KQ0 A;  5CVR A;  4OU0 A;  4G94 A;  4LLG F;  3CUQ B;  2Q2E A;  4HF0 A;  1GHC A;  1PUE E;  2L4A A;  1G6N A;  1G3Y A;  3OOP A;  3F23 A;  1EH8 A;  1IN7 A;  3BPV A;  4A12 A;  4G7O F;  2MLK A;  2UZK A;  3ABT A;  2P8T A;  4RGU A;  2FBK A;  3F8N A;  3EDP A;  5LEJ A;  3QRF F;  3QU3 A;  1IN4 A;  2Y0M A;  4RGS A;  3LA2 A;  2NNN A;  4AIJ A;  3KZZ A;  2VBW A;  4HYE A;  2VT2 A;  3GXO A;  2J5P A;  3I59 A;  2HS5 A;  3E5X A;  3WTT C;  3CO6 C;  2JT1 A;  2VOP A;  1EH7 A;  3MWM A;  1L0O C;  1TBX A;  2UWM A;  3M1E A;  2IPQ X;  5LRS A;  4A0Z A;  4HBL A;  2F5E A;  2VON A;  1D3Y A;  2D2W A;  1MD0 A;  4ENK A;  1LQ1 A;  3LA3 A;  2WTE A;  4HDV A;  1WSU A;  1LEB A;  1R58 A;  3F3X A;  2H6B A;  2VOO A;  1J7K A;  1SFX A;  2G9W A;  4N0B A;  2RDP A;  1SAX A;  3P9I A;  5TJJ A;  4LG0 B;  1J9I A;  3B73 A;  1IUY A;  2DK5 A;  3L7W A;  5L3G A;  1O7F A;  5LHG A;  3QPH A;  5H6Q A;  3W6K B;  1QZZ A;  4IF4 A;  3K1N A;  4WF2 A;  3WGG A;  2P6S A;  2GXG A;  5HDK A;  2V6C A;  4YIF A;  2YR2 A;  1UB9 A;  2H09 A;  1IF1 A;  3DV8 A;  4LK0 F;  4GCV A;  2W25 A;  2QQB A;  4P9U A;  2UXX A;  5CLS A;  1HKT A;  3JAM K;  2DU9 A;  5JHU A;  2RN7 A;  4HX8 A;  3HTS B;  4M74 A;  2DTR A;  2B0L A;  4OIP F;  2KJC A;  3WTW C;  5KVR A;  2ESH A;  1S8N A;  4IRH A;  3O6B B;  1H0M A;  2V1U A;  4U0W A;  3I0T A;  4Z2Y A;  2F5D A;  2F5C A;  2O0Y A;  3TOB A;  2E7X A;  2VE9 A;  1XDS A;  2Z5U A;  2LDU A;  4LFU A;  2DLL A;  5HS9 A;  2MH2 A;  3V7R A;  4YII A;  3HIF A;  2MBF A;  3REO A;  1OR7 A;  2PN6 A;  1QZY A;  5D5X B;  2FSW A;  2O8X A;  5AIP A;  4AWX B;  2FNP A;  3DEU A;  2O6G E;  3NQO A;  1SMY F;  2M30 A;  4BHB A;  3B02 A;  3F22 A;  2YU3 A;  3F72 A;  1U8R A;  2XUB A;  2FMY A;  3DPL C;  3T8R A;  4AD9 A;  3M8F A;  2L3D A;  2Y48 A;  3VOD A;  4OOI A;  4IHS A;  4L0Y B;  4LB5 A;  4JQF A;  3L00 A;  2Z99 A;  4FX4 A;  3GF2 A;  3GFL A;  5HDN A;  2HYF A;  1XDU A;  2W57 A;  2EV0 A;  4M6X A;  2LSO A;  2A3S A;  1DPR A;  2HTJ A;  1BOA A;  3EYY A;  2BBY A;  5BQT A;  2VE8 A;  4N9H A;  4EM1 A;  4UUV A;  1G3T A;  2HZT A;  1E2X A;  2JSC A;  4DQ2 A;  1KU2 A;  3HSR A;  2EV6 A;  3KET A;  1BIB A;  5FGM A;  5E1W A;  1ON2 A;  4N9I A;  3EUH A;  2OD5 A;  4RB3 C;  4Q4Z F;  1SD4 A;  1FT9 A;  4G7H F;  4P96 A;  1F9N A;  2K4J A;  2STW A;  5BPI A;  4CIC A;  4KUM A;  5AON A;  4ASN A;  2HFH A;  2H94 A;  2YPR A;  3FMS A;  3L09 A;  3CUQ C;  3MAJ A;  1TTY A;  4MHG A;  2IT0 A;  4KFC A;  5BMZ A;  5FLX Z;  2CO5 A;  2EV5 A;  5CVJ A;  1I5Z A;  2CGP A;  4KMF A;  2A5Y B;  4HX4 A;  4PGH A;  2AXL A;  1R00 A;  3IRR A;  2IA1 A;  2P5L C;  4LG0 A;  3FXU A;  1S29 A;  4LD5 A;  3GLX A;  2IW5 A;  2EA4 A;  1QO0 D;  3HOS A;  2L01 A;  1O3Q A;  3RDI A;  5LLQ A;  4BYY A;  1R5H A;  4I0B A;  1SD6 A;  2D45 A;  3C18 A;  4AVP A;  4O5V A;  4Q48 A;  1J5Y A;  4YFK F;  3M8E A;  1ON1 A;  3BPX A;  5E20 A;  1PP7 U;  4Y13 A;  3IKT A;  3RKY A;  2FML A;  3WE2 A;  2W24 A;  2FA5 A;  4HV5 A;  3RYR A;  1H9G A;  1SFE A;  2DBB A;  1E17 A;  2XAG A;  2VXZ A;  2QBY B;  4I01 A;  4P55 A;  4JBA A;  3IC7 A;  3JTG A;  2VBY A;  3LWF A;  5LHH A;  1LVA A;  2JTV A;  5J8C A;  3HSE A;  1D8J A;  3K2Z A;  5E17 F;  4Q47 A;  1ZGA A;  3KLO A;  1FLI A;  1U3E M;  4XLP F;  1DP7 P;  3SQN A;  2CQK A;  6PAX A;  2XRN A;  3FX3 A;  1FYL A;  2ZNY A;  4L9T A;  1XSV A;  4O3M A;  2OQR A;  2EK5 A;  2FF4 A;  2R7F A;  3KP6 A;  4BAY A;  5TRD A;  1JXS A;  1B9M A;  4KIF A;  4EMS A;  2P7C B;  5DEQ A;  1K6O A;  3KLN A;  1WWX A;  4M71 A;  2ZFW A;  4GYI A;  4PDK A;  1FBQ A;  1P6R A;  2MLG A;  1BJA A;  1W4M A;  1J2X A;  1KGS A;  2MA3 A;  4U7B A;  2F5F A;  5EEG A;  1T38 A;  2OBP A;  1I1S A;  1RUO A;  5EEH A;  1TLH B;  1TW2 A;  2DPU A;  2MH9 A;  2VBX A;  4HOB A;  4BHP A;  2PI0 A;  2BEO A;  2A69 F;  2ESN A;  3I58 A;  4I09 A;  1R22 A;  3WGH A;  1UFM A;  1S7O A;  3I4P A;  2E1C A;  1R7J A;  1FOK A;  5FD6 A;  3R4K A;  5D8L B;  2BGC A;  5JR3 A;  2LF8 A;  5L3D A;  4PCQ A;  2VC0 A;  4CZZ A;  2HDC A;  4ESF A;  2NRA C;  2EFW A;  1XSX A;  3WTX C;  1O3R A;  3ML6 A;  1P4A A;  1ONV A;  3FMQ A;  3WOD F;  1HW5 A;  1J59 A;  2EB7 A;  2XKP A;  4I02 A;  3MZH A;  5IT9 K;  4O6J A;  4LJZ F;  5BPD A;  1CGP A;  3LST A;  1C0W A;  2ELH A;  5DUK A;  1WQ2 A;  4YFN F;  2KIM A;  5BOX A;  4HLY A;  3AAF A;  3IRQ A;  3ZN1 A;  4XBF A;  2BV6 A;  4L9N A;  4MNU A;  1ZLK A;  1U5T C;  2YX7 A;  5JVT A;  1T98 A;  3I5U A;  4P9F A;  3RKW A;  3KP5 A;  1BN5 A;  1EH6 A;  2L54 A;  2FXA A;  2G7U A;  3I64 A;  2K4B A;  1Y0U A;  5H20 A;  2IJL A;  3ZMT A;  1D5V A;  3HYI A;  5ICG A;  4IPA A;  2W84 A;  4A5N A;  1WKM A;  1TQP A;  1BC8 C;  3BP8 A;  1B59 A;  3KP2 A;  1J75 A;  4XSX F;  1LB2 A;  1DUX C;  4I2O A;  4G6Q A;  2XAQ A;  2PJP A;  4HF1 A;  3SZT A;  3DP7 A;  3VB2 A;  1IXR C;  1YYV A;  4LB6 B;  4QWQ A;  3G73 A;  1FBU A;  2QBY A;  3KEQ A;  4IJA A;  1FBS A;  1Z9C A;  2M5W A;  3MQ0 A;  2XAJ A;  5E18 F;  5A2Q K;  2Y75 A;  3G3Z A;  3HOT A;  4GGG A;  1FYM A;  4ETS A;  2RVC A;  4UHT A;  2W85 A;  5HS8 A;  4UV9 A;  2OU2 A;  3ZN0 A;  2EJR A;  4FT8 A;  5F64 A;  2P6T A;  1XB4 A;  4XRF A;  2WV0 A;  1FY7 A;  1Z7U A;  3IHU A;  4R1H A;  3WTY C;  4I0A A;  4L18 B;  4H0E A;  4WXH A;  1O57 A;  3K1P A;  4RAY A;  1UCR A;  3FWE A;  2QLZ A;  2ZCW A;  2BYV E;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...