1R36A

Nmr-based structure of autoinhibited murine ets-1 deltan301
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVSDLQSLLGYTPEELHAMLDVKPDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C-ets-1 protein
publication title The Structural and Dynamic Basis of Ets-1 DNA Binding Autoinhibition
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 37
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r36A00
5IT9K 3R0JA 1Z6TA 2EV6A 3Q9VA 4M9SA 1XD7A 4BAYA 2GA1A 2DPUA 2Y75A 4CYDA 1W5SA 1RZ4A 4ASNA 2XHKA 2BGCA 1P4XA 5DD4A 4GGGA 3CUQC 3I58A 2Z5UA 4A6DA 2MD5A 1Q1HA 2ETHA 3GVAA 5LRRA 4OIRF 4P55A 3W6JB 1ZHFA 2W25A 2GWRA 2P6TA 2YU3A 1TW3A 2VBYA 2V1XA 5J6XA 4BH9A 5E1ZB 3V4GA 3I64A 3IC7A 5JFRA 3TO6A 5CVVA 1YLFA 2D1VA 2TDXA 3F6VA 2FSWA 5JR3A 3ZP5A 5D5VB 4I0AA 1YG2A 4HYEA 5D8LB 2K86A 3HRMA 4A5MA 4R1HA 1HW5A 3L09A 3G3ZA 4WX9A 2L4MA 1ZH5A 5L3DA 1F1ZA 3B73A 1D5VA 3O2PE 2V79A 2GAUA 5D5WB 1YO5C 1J59A 3GF2A 3F21A 4M74A 1ZG1A 2F5CA 1IRFA 1O3QA 1FSHA 4L9JA 2VC0A 2LDUA 3L7WA 1MDMB 5J8FA 3PQKA 4IRHA 3BP8A 1BI1A 3DPTA 2Q8KA 2HQRA 2XVCA 1MGTA 5A2QZ 3RPQA 4TV7A 1ZRDA 2X4HA 5K5OA 1IW7F 3IKVA 1PDNC 1U6GA 1T2KA 1SFUA 2DU9A 3P9CA 2HR3A 2IPQX 2DO7A 1J9IA 5E17F 2P4WA 2E7WA 2EV5A 4U0YA 1YIOA 2XAGA 4EJWA 2NYXA 1QBJA 1Z91A 3VB2A 2K27A 5LBQA 4N9IA 4ENKA 3I5UA 1R5GA 4RGRA 1UFMA 2STWA 3U1DA 3CTAA 2FE3A 2WTEA 3IRRA 5F6FA 2HQNA 1FZPB 4B09A 3KFWX 2HEOA 4L9NA 2VE9A 4ZYHA 4HX4A 4MHGA 1G4DA 1O7LA 1WQ2A 3LFKA 4GXOA 2W57A 2VBWA 3ELKA 4HX8A 1J0RA 3I53A 2VE8A 1R1TA 5A2QK 2VODA 3CO7C 2DW4A 3ZMVA 1MJAA 2FOKA 2ZCWA 4KIFA 3F23A 2D2WA 1XSXA 1FT9A 1TQPA 2A5YB 3Q5FA 1HSJA 2O0YA 2VONA 1X3UA 1B59A 3M8FA 1BM9A 1QQIA 3QPHA 4B8XA 1STZA 1IN4A 2P5KA 4M72A 1E2XA 3JTHA 1HW2A 4O3MA 4RGXA 4ESFA 4XLNF 2CO5A 1YW7A 2EFNA 4P9FA 1KU3A 1WSUA 1ODDA 2ZKZA 4QLCU 2KKOA 1T0FA 2RQPA 2LKPA 2MA3A 3L2CA 1R58A 3K1PA 3HOTA 2A6HF 5ERIA 4BQAA 2GQQA 2ESNA 1ZLJA 4MEYF 1FPQA 3RPUA 3VOEA 2YPRA 4MEXF 4ESJA 3V7CA 1S6LA 5KK1A 4L0YB 2KIMA 2M1BA 5K5RA 5HLHA 5E18F 3BROA 3JW4A 4H0EA 2XASA 4BXUA 2H94A 2RV8A 2ZBKA 4HV6A 3GX4X 4G7HF 2R7FA 1J7KA 3REOA 2FU4A 5D5XB 3FXUA 4HQEA 2RKHA 2PEXA 2VOPA 2MLKA 1DDNA 2CG4A 1R36A 2DQRA 1RUOA 4EQQA 1DPRA 3TQNA 4U0WA 2EFWA 1OYYA 2FBHA 1BI3A 3KLNA 1USSA 3LSTA 5ICFA 4EGYA 1JHFA 2EA4A 4ZYGA 1XGNA 4KFCA 3HOSA 1HW1A 2NS0A 2KJCA 3V8KA 3U2RA 2QLZA 3CUOA 4I02A 4P9UA 1LDKB 1NHAA 5ICCA 2LF7A 4Q47A 2G7UA 2UXNA 3QOPA 2W84A 2ZNYA 3WTWC 4RS8A 4KA4A 4Y17A 2XRNA 4AWXB 2PFBA 4EMSA 3ZPLA 3ECHA 5BOXA 1IN7A 4HA8A 1LDJA 1HKTA 4OINF 4MTEA 3ML6A 2RC4A 1LB2A 3LA7A 1HKQA 1TQMA 2QENA 2Z3YA 3GEZA 2WWYA 4RAYA 3DQVC 3WG9A 4OU0A 1SD5A 1HBXG 2WC2A 1I5ZA 1R7JA 3MAJA 3KCCA 2COMA 1WI9A 3CJNA 2RDPA 1KQ0A 3BPVA 2Q0OA 1ZAOA 1MDMA 3MFKA 1LDDA 1ZRFA 2K02A 4EJTA 2FNAA 3TO9A 1I6XA 3MCZA 3K2ZA 3ZMTA 1BBYA 3TKYA 2OBPA 4IHSA 4UNOA 2MH2A 3BPXA 1A04A 1S7OA 2ZO4A 2M87A 4PGGA 5D6FA 2A69F 2HTJA 4L9TA 2O6GE 2VN2A 4I7HA 2BV6A 1IXSB 2FRHA 2FBKA 3E5UA 1W5TA 3C18A 2ZXJA 1P92A 1BI0A 2UWMA 3GWZA 3W6KB 3K1MA 4EV0A 1LQ1A 2JSCA 2DK5A 1XGSA 1PUEE 3E6DA 4DNCA 4KN4X 3FXQA 4OMZA 3QRFF 4N0BA 4ENMA 4MQ9F 5AONA 4IPAA 4E70A 4KDPA 2Z9OA 2QBYB 1U5TB 2L54A 1H0MA 3VEPA 2IVMA 3FXRA 2XAQA 5D4RA 2BBYA 1YW9A 3F8BA 3SXYA 2ISYA 3D0SA 2FF4A 2EJRA 5CVJA 2GXBA 4RB1A 4XRFA 1FYKA 3QP5A 4IRIA 1YYVA 4FX0A 3LAJA 1XN7A 4WK8F 2P7VB 2ZFWA 5HS8A 1FBSA 2DK8A 1JGSA 3QAHA 2DQLA 2BYVE 2OU2A 1OR7A 2DLLA 4YG2F 2UZKA 1D8KA 4UVBA 1TNSA 5HDGA 4M73A 1RIOH 2LSOA 4CHUA 4OOIA 4EM1A 4LMYA 3F72A 1KU9A 3F8FA 3F22A 3J80Z 2PG4A 3T8RA 1TQIA 2WV0A 2JT1A 2G7HA 3LWFA 2O03A 2YSRA 4HF0A 2VBXA 4KICA 2PI0A 2RNJA 3ECOA 2PJPA 1FLIA 3BY6A 3RKXA 2CGPA 2PMUA 2ACJA 5LHGA 3VODA 1WRJA 3QU3A 1U78A 4IHTA 1LNWA 3GYHX 4M9XA 4G7ZF 1P4WA 3ZMZA 5K5QA 1IN8A 5HS7A 3GFJA 5FO5A 4NHJA 3TO7A 3WU0A 4GYIA 3BOQA 4G6DA 5E1XA 4AIKA 4MNUA 3BDDA 3BJOA 3M1EA 4KYWA 2PBIA 1JE8A 4HV5A 2HDCA 2A07F 3D5LA 4KMUX 4YIIA 4PDKA 2ZMEB 1V4RA 3QPTA 3KP5A 3P9IA 3H3ZA 4L18B 4L5JA 3J80K 1Z9CA 3KE2A 4UUVA 4YFXF 1OKRA 2FNPA 4RGUA 4AD9A 4KN7X 1QPMA 4UHTA 1FOKA 3TOBA 3KZYA 3NEUA 3K1NA 2LF8A 2RGVA 2GA2A 2YX7A 2XIGA 2A6EF 1ZGAA 3NQOA 3PQJA 2K4BA 1QGPA 3I71A 2P5LC 4BHBA 1KYWA 3ABTA 2VT3A 3L9FA 3EDPA 5FD5A 3L00A 1Z05A 3IWZA 4Y15A 2IW5A 2P7CB 3HTUA 5JVTA 2QQ9A 1KGSA 4AVPA 3ZMSA 2P5VA 4MQVA 5LHHA 4ZZDA 4L0ZB 4LLNA 4HF2A 5LEJA 4UVAA 2CWEA 2M45A 2OQGA 3DPLC 3WTSC 3WTUC 3HTSB 2Y0MA 3J7AO 4LK1F 1KU2A 4QWQA 3RJPA 2M30A 4I98B 3CO6C 4R8HA 5FGMA 3RKWA 2EFPA 5DCFA 3EETA 5DUIA 2IA0A 3WTVC 2C6YA 1S29A 4ZYDA 1XCVA 2V1DA 1T6SA 1OYIA 4YIFA 1S3JA 5LGNA 2VOOA 4CZZA 3RKYA 4KMFA 4HOBA 1V3FA 5AIQA 3HYIA 2VT2A 4G8XA 2NNYA 3KZZA 5L3BA 4U0VA 2V9VA 5HVQC 1CF7B 4LLLA 1Y0UA 2CYYA 2F5DA 2AXLA 3HSFA 5CJ9A 4Z2YA 3JAMZ 2EA2A 1GXQA 3FZVA 4NB5A 2BEOA 3HHGA 3BJ6A 3C7JA 1SAXA 3C3WA 1ZN2A 1IXCA 1TBXA 3E5QA 5HDNA 4LJZF 3IL2A 3MWMA 1UHWA 2EB7A 3HRUA 1J75A 1R1VA 2QBYA 1U5TA 2XGXA 4BHCA 1HQCA 2KIFA 2J5OA 4M71A 5ICEA 2B0LA 1KQ9A 2PN6A 3KLOA 3G73A 4CXFA 1WWXA 5E8GA 1SFXA 3LQQA 2E1NA 3BJAA 4FX4A 1FBUA 4WXCA 2O8XA 2OZ6A 5JHUA 2H6CA 3FM3A 3ZN1A 2GIVA 1XDUA 5DDGA 1YS6A 4L5IA 1ZLKA 2DT5A 3EYYA 4LK0F 2DI3A 1LJ9A 2E1CA 4BHPA 5K1YA 3ULQB 3KP3A 3S2WA 5CVIA 2XKOA 3JAMK 3GZ5A 2W24A 1P2FA 4GCVA 2RVCA 1IF1A 3WTZA 3T1BA 4A0ZA 4FT8A 5ICGA 3WGGA 2F5EA 1MJBA 5AIPA 1G3WA 3NRVA 3F8NA 1C0WA 1U5TC 1O3RA 1KA8A 4Q5SF 4JBAA 3GFMA 1ZGJA 4EM2A 3T0YA 4IRGA 3IRQA 1HKSA 1S8NA 1PP7U 1AOYA 5ILUA 2GZWA 1T39A 4XBFA 5BQTA 3M7GA 4Y13A 1FBQA 3JSOA 1H9GA 5DD8A 4HF1A 2A61A 2FXAA 1DP7P 4FHTA 4U7BA 3FMSA 3FMQA 1XDSA 4CO8A 1HXDA 1ZRCA 4HBLA 4OIQF 4LG0B 2HWVA 2JZYA 5EEHA 3KEOA 1UHMA 1IN6A 3DP7A 3KP2A 3WGIA 1TLHB 1YQAA 5DCMB 5F64A 3GXOA 1EH8A 2JPCA 1F4KA 1O3TA 2ADUA 3OOPA 1ON2A 1FWZA 3ROUA 4OMYA 4YFNF 2MLGA 3HIFA 3V8LA 1G3SA 4L9VA 4MGRA 3N4MA 5BPIA 2ZMEA 5DEQA 1BIAA 1R00A 2ZNZA 3BZ6A 1FP1D 2XAJA 5F1RA 3R61A 1W7PB 1K6OA 2K7LA 2QM3A 4HLXA 1TW2A 1B1BA 2J5PA 4A6EA 3V7RA 5J8CA 1P4AA 5FLXZ 4CGZA 3GW2A 5TJJA 4NQWA 4EGZA 4U88A 3FWEA 4ETSA 3TDUC 1O57A 1BN5A 4KNYA 1IRGA 2HKOA 1U8RA 4KIBA 1F5TA 4HQMA 3GO5A 1B9NA 4ENJA 1XB4A 1IUYA 2L02A 4AIJA 1LEBA 2PMHA 4F7ZA 4N9HA 2VC1A 3C1DA 3WE2A 3R4KA 4XSXF 3TGNA 3FMRA 2QVOA 1FNNA 2L3DA 1OPCA 3O3KA 1B6AA 2DTRA 4HZFA 4HDUA 3VFZA 1QNTA 1Z7UA 4LB5A 1I27A 2Z33A 2O3FA 1VTNC 3T5XA 3LA2A 4JK1X 1BI2A 4ENNA 3SQNA 2O61A 3ABUA 4A0XA 4Q4ZF 5KVRA 1FYLA 5CVUA 2XV4S 2PLYA 2IA2A 2QQAA 2IT0A 4EJOA 3WU1B 2R3SA 3ISPA 4G7OF 1YTYA 1D8JA 3SZPA 1W7PD 4KUMA 4P96A 4G94A 2JTVA 4G9YA 4OIPF 1U2WA 2D1HA 2NAZA 2OQRA 3OV8A 2JPBA 4MTDA 1JHHA 2L4AA 3KP4A 4PCQA 1ZARA 1EV7A 1J5YA 3DXJF 4HLYA 1L0OC 4M6YA 1CF7A 1IN5A 2ZJ2A 1MZBA 1WKMA 5EEGA 1FYMA 4RB2C 3R0AA 5D5UB 5BS6A 5L3FA 5ILSA 1K78B 2CW0F 1GVJA 2YR2A 4BYYA 1IZ1A 1UB9A 2EWNA 4HDVA 3RTRA 3Q9SA 4LB6B 2XUBA 3F3XA 5D8KB 1K7AA 4YFKF 5LRSA 3E5XA 2K4JA 5DUKA 2XKPA 2QQBA 1T98A 3EUHA 3MQ0A 2OAZA 4UVCA 4O6JA 2G9WA 3TDZC 1QO0D 4I01A 1BC7C 4OIOF 1MJ9A 3WODF 2QUFA 3PFIA 1AWCA 2STTA 3V7SA 2PQ8A 3QU6A 4M9ZA 5CVRA 3K9TA 3GUDA 3R60A 4ESBA 3B02A 5HS9A 5JI6A 4LFUA 5HDKA 1GHCA 4LGWA 1ZREA 3FF5A 3LQRA 5CLSA 2HKXA 2HYFA 1O7FA 5HOOA 1PP8F 3I59B 1CGPA 1B9MA 4U7DA 2CFXA 3M8EA 2QZ8A 3H3UA 1K79A 4EM0B 1XMAA 2EV0A 2LNBA 4HAMA 5FD6A 3WTYC 4WWCA 4K2EA 1T38A 4RAZA 4IF4A 5TRDA 5ED4A 3U9GA 4IVNA 1XSVA 1S7AA 4ZH4F 5E8IA 2HOEA 4P5OA 2FBIA 3J81Z 5CYVA 3ZMUA 2CQKA 3EYIA 1FP2A 4RB3C 1XCBA 4LG0A 4WF2A 2DFIA 1SD4A 1R22A 5DCMA 2KIUA 3P9KA 1XGMA 2P8TA 3CDHA 5E20A 1EH6A 2IP2A 2Z99A 4HX7A 4PGHA 3TOAA 2HGCA 2HS5A 4A2UA 3CUQB 2RN7A 3ZQ7A 2VXZA 3T8TA 3HHHA 4CICA 3I54A 1REPC 3ZMDA 1XMKA 6PAXA 1W7PA 4WCGA 4O5VA 1G3TA 3H92A 1MKMA 1ZG5A 1L3LA 3JSPA 2D45A 3F8CA 1BC8C 1TNTA 3HSRA 3BWGA 3I4PA 3HRSA 3FM5A 2JRTA 1BJAA 3K0LA 3RDIA 4XLPF 3J81K 2F5FA 2HFHA 1HSTA 1I1GA 2HTSA 5LGUA 3HRTA 2A68F 3FHZA 4ON0A 2OA4A 5DV5A 3FX3A 1I1SA 3N97A 2VBZA 4EJVA 3E6CC 5FFZA 2AS5F 1G3YA 1RNLA 1ZG3A 2UXXA 4UV8A 5BMZA 3F8MA 3M9AA 4BNCA 3DFGA 2V6CA 4PZJA 1EH7A 1R5HA 3P7NA 4XSZF 3GZ6A 2A3SA 3O6BB 1D3YA 2DBBA 1B4AA 2DAOA 3SZTA 1H9TA 4KT5C 5HLGA 2QYOA 2OD5A 1SFEA 3JTGA 2FQ3A 2DPDA 1ONVA 3KP6A 2XROA 1BIBA 2L01A 4AIHA 5FFXA 3GLXA 5DYMA 5D4SA 5H20A 4S05A 1OYWA 4G6QA 3ZN0A 1K78A 2R7DA 3COAC 3E6BA 1GXPA 3RYPA 4RB0A 2ELHA 1FX7A 3SFZA 2FMLA 3IKTA 1KU7A 3IHUA 1BOAA 4LD5A 1YFHA 4I0BA 2FA5A 4IXAA 4I09A 4WXHA 1OMIA 4I2OA 2YX4A 1IAWA 2H6BA 1KQ8A 2EK5A 1P6RA 1Z1DA 5ILVA 1G6NA 1E17A 2BE5F 2H09A 4A5NA 1SMYF 3E3VA 2ISZA 3K69A 2FMYA 1SD7A 1Z6RA 5LGTA 1O3SA 1QZZA 3ERED 2GXGA 5L3EA 3KEQA 4ZZLA 4DQ2A 1DPUA 4UV9A 1U3EM 2EFQA 3WTXC 2NNNA 4EJUA 3SHFA 4GO1A 2CSOA 4EVIA 3I59A 2E7XA 5HLIA 4R79A 4KIGA 3I0TA 5LHIA 1XSDA 1SD6A 4GYGA 3HUGA 4A0YA 1J2XA 1ZYRF 3MEXA 3LA3A 4Q48A 2NRAC 3LAPA 1YS7A 3DEUA 3QP6A 3WTTC 1UCRA 5E1WA 3R6SA 2HZTA 3KETA 5H6RA 3V8JA 4RGSA 3CLOA 1FC3A 4UXNA 2H27A 2F2EA 2M5WA 3GFLA 2FEZA 1USTA 1KYZA 5IT3A 3DF8A 3HSEA 3IWFA 2HYGD 3EQLF 3WGHA 3GFIA 2P6SA 2X0LA 5IT9Z 1ULYA 1XGOA 4JQFA 1MD0A 2Q2EA 2MH9A 4WXDA 5D6EA 2IA1A 2XAHA 1R23A 1JXSA 2EFOA 1SMTA 1LEAA 5FB2A 2QWWA 3F6OA 3RYRA 2M8EA 3MZHA 1F9NA 5LEKA 5BPDA 5L3CA 3CUQA 2IRFG 1QZYA 2KJBA 4CDGA 3E6MA 5H6QA 1YW8A 1TTYA 2KRFA 1ON1A 3DKWA 3RIRA 2W85A 2Y48A 4S04A 2V1UA 2MC3A 1RI7A 4ZYEA 5FLXK 3WE3A 4A12A 3KP7A 1IXRC 1R1UA 2XAFA 2ESHA 2MBFA 3AAFA 5LLQA 2IJLA 4HW0A 1RUNA 1FSEA 5L3GA 4M6XA 1W4MA 1LVAA 3MZYA 4LLGF 1DUXC 1FY7A 3RI4A 4IJAA 4D0PA 3DV8A 3E97A 2OZUA
chains in the Genus database with same CATH superfamily
5IT9K 1P7JA 3R0JA 1Z6TA 2EV6A 3Q9VA 4BGDA 3S16J 4M9SA 4BQOA 1XD7A 4BAYA 2HU9A 2GA1A 4E4HA 2DPUA 2Y75A 3S2DJ 4CYDA 1W5SA 1RZ4A 2W1OA 2VI6A 2XHKA 2BGCA 4ASNA 4JX5A 2HOTA 1P4XA 2R7UA 5DD4A 4GGGA 3CUQC 4RDUA 3MZ8A 5JLWA 3I58A 2Z5UA 3DWLE 4A6DA 3IP4B 2WAEA 2MD5A 2KFDA 1Q1HA 4YRVA 3OYJA 2M7BA 2ETHA 1MH4A 2JUCA 3GVAA 5LRRA 1G2HA 3GTOJ 1X1CA 4OIRF 4OWRB 4P55A 2DYSH 3W6JB 1ZHFA 2M4KA 2W25A 1QPIA 2GWRA 2P6TA 2YU3A 1TW3A 1FMWA 1E3HA 2VBYA 4PUSA 2VKVA 1H89C 1MSEC 2L7ZA 2V1XA 3BR1A 4IKFA 5J6XA 4BH9A 1GT0C 2HPMA 2DFEA 3HEFA 3QPLA 4DZPA 3HPHA 2DT6A 5E1ZB 1BL0A 3Q3SA 3OOUA 3CJTB 3V4GA 3I64A 1D0XA 3IC7A 4D7MA 5JFRA 2X1EA 3TO6A 5CVVA 1YLFA 2D1VA 2TDXA 2E1MC 4D9JA 3F6VA 2FSWA 4PFPA 5JR3A 2XSDC 3BG5A 3QYBA 2LKSA 1D0ZA 3ZP5A 2Y9ZA 5D5VB 4I0AA 5CQEA 4FE4A 1YG2A 2E19A 2B7EA 3U21A 4HYEA 5D8LB 2K86A 2KZGA 2BVMA 3HRMA 3HZJA 4A5MA 4R1HA 1HW5A 2BW3A 3L09A 3G3ZA 3AG1H 5EZGA 4WX9A 4V2FA 5IYDJ 2L4MA 3LSRA 3UNGC 1ZH5A 5L3DA 1F1ZA 3B73A 1D5VA 4XMYA 2CMPA 1Y6IA 3O2PE 3LNQA 2V79A 2V7FA 2GAUA 3FBNB 5D5WB 1YO5C 2PMZN 2QGUA 1J59A 2HQAA 3GF2A 3F21A 4M74A 3U1KA 4BJTA 2LY9A 4BDZA 1ZG1A 3JRHA 4CH7A 2F5CA 1IRFA 1O3QA 1FSHA 1D1BA 4L9JA 2VC0A 4BE2A 4PJLA 2LDUA 3L7WA 3GLLA 1MDMB 5J8FA 3DCFA 2JMWA 3PQKA 4IRHA 3I4NJ 3BP8A 3HDDA 1BI1A 3RSNA 4L5EA 2E36A 3S93A 3DPTA 2NVXJ 2Q8KA 3FDYA 2EINH 2HQRA 2XVCA 1MBKA 1MGTA 5A2QZ 1TC3C 4RM3A 4DBRA 5E3MA 3RPQA 2ECCA 1X4OA 4EATA 4BS9A 2DOEA 3W6VA 1ETXA 1Z21A 4HSTA 1GUUA 3BR3A 4TV7A 1VQ4I 1ZRDA 2X4HA 5K5OA 4BY7J 1PJRA 1IW7F 1FOXA 2I5UA 3IKVA 1PDNC 1U6GA 2E60A 4QSHA 1T2KA 4XORA 1SFUA 1IG7A 2DU9A 2QSGX 3PO2J 3P9CA 2HR3A 3RCOA 2IPQX 2DO7A 2NS8A 3OS2A 1J9IA 4UB6C 3M1CA 4CCOA 3TBIA 5E17F 2P4WA 3IV5A 1EJ9A 2QA4I 2E7WA 2EV5A 2VQGA 2YU9J 2CS3A 4U0YA 1YIOA 2L9VA 2XAGA 4EJWA 1QU3A 4DZJA 2NYXA 1QBJA 1Z91A 3VB2A 2K27A 5LBQA 4N9IA 3RQIA 4ENKA 3I5UA 3BQYA 2R5ZB 4IHVA 2OC6A 2M34A 1R5GA 5DTDA 4B3AA 4RGRA 5TISC 2Z1DA 3JREA 1UFMA 4BDYA 1JUPA 2CV2A 2STWA 3U1DA 2CW7A 3CTAA 3IH2A 2FE3A 5M5YJ 3K10A 4DBQA 3MMYB 3PUFA 2IGNA 3GTJJ 2WTEA 3IRRA 1D1CA 2CUEA 5F6FA 5BNGA 2HQNA 1R4MB 2HXOA 2MC4A 2F6CA 1XMXA 1PUFB 1FZPB 4B09A 4YIRX 4E7IA 1YJ9I 3KFWX 5FKLA 1QA6A 2HEOA 2R7OA 3H35A 4L9NA 3SDBA 2HDDA 3VPRA 3CP8A 1VZ0A 1Y8QB 2VE9A 4ZYHA 3ZQCA 4HX4A 2HZDA 2O7OA 4MHGA 1YX5A 3Q0UA 2UV1A 1G4DA 1O7LA 2OUMA 4BE0A 3A1YA 1WQ2A 3LFKA 2LOOA 2W57A 4GXOA 2VBWA 3ELKA 4HX8A 4CYCB 2NVUB 4II2A 1J0RA 1JJ8C 2WADA 3I53A 2VE8A 4XONA 1R1TA 2HVQA 5A2QK 2VODA 3CO7C 2DW4A 3S1RJ 1YE9A 2XB5A 3ZMVA 3HL2A 1MJAA 3FXJA 2FOKA 2ZCWA 4KIFA 2MG4A 3F23A 4HNUA 2R93J 3FKIJ 2D2WA 1XSXA 2DA6A 2CH0A 1MIJA 1FT9A 1HCRA 1TQPA 1IRZA 2A5YB 3Q5FA 1HSJA 1KZHA 2O0YA 2VONA 1X3UA 1B59A 2DT7B 2HI3A 2KZVA 1HC8A 3M8FA 1BM9A 1QQIA 3QPHA 1T8IA 4B8XA 2E1OA 1ENHA 1STZA 1MBJA 1IN4A 2P5KA 4M72A 4XIDA 3HJEA 1E2XA 3BR0A 3ZQGA 2KRCA 3JTHA 4ZYAA 1HW2A 4O3MA 4RGXA 2KDZA 4ESFA 5J1RA 2K3FA 1XPXA 3FXOA 4XLNF 4M3BA 3E7LA 4BXFA 2CO5A 1YW7A 3BG9A 3HOVJ 2EFNA 2WB1A 4P9FA 5CPRB 1KU3A 1WSUA 1ODDA 2ZKZA 5LFAA 4QLCU 1Z0XA 2KKOA 2DODA 1T0FA 2RQPA 2IBDA 3D5RC 3FHNA 2LKPA 2MA3A 3L2CA 4NDLA 1R58A 3K1PA 3HOTA 1IJWC 2A6HF 5ERIA 3DPUA 2WY8Q 4BQAA 1Y56A 1V5GA 2GQQA 2E5ZA 3L2WA 1S9HA 2ESNA 3ESWB 4IHWA 1ZLJA 4MEYF 1FPQA 3ASOH 5EJCA 3RZOJ 3RPUA 3CC7I 1BJZA 4DW6A 3VOEA 1SVOA 3HKZN 3CLQA 3VYSB 2YPRA 1TP4A 2Z2SB 2M8GX 4MEXF 4ESJA 3V7CA 1S6LA 2LD5A 1AU7A 2DFHA 3WHCA 5KK1A 5DS9A 4L0YB 5C4XJ 3A02A 3BT9A 2PX9A 2KIMA 2M1BA 5K5RA 1W36C 5HLHA 5E18F 2I8DA 1JKOC 1YJNI 4PJNA 4AU7A 3P5JA 3BROA 1G8XA 3JW4A 4H0EA 3AL0C 2K9MA 2XASA 1SAUA 4BXUA 2H94A 4FQGA 3AG4H 3HC7A 2RV8A 2KPMA 4IOAF 2ZBKA 4HV6A 2H1KA 3GX4X 4G7HF 2R7FA 1J7KA 3REOA 3SJMA 1DP3A 4E7KA 2FU4A 1MNEA 2B63J 5D5XB 4BJ6C 1E3OC 3A4CA 5GAEJ 3FXUA 3S17J 4HQEA 3FXLA 3CMYA 1ZELA 2RKHA 3SDGA 2PEXA 2VOPA 2MLKA 1DDNA 2CG4A 1R36A 4ZC3A 2DQRA 3DBHB 1G59A 2ME0A 2XGDA 4M3EA 1RUOA 3BTIA 4EQQA 2IS1A 1DPRA 4B44A 3TQNA 4U0WA 1T0FC 3G4SI 2A6TA 2EFWA 1OYYA 2FBHA 3KZIC 2WAQN 2RAEA 4XLCA 4AIDA 2RNGA 5C4JJ 2QSHX 1BI3A 1RESA 2M0CA 3KLNA 4E7SA 2QF7A 2P0WA 1USSA 3BG7A 2TRTA 3LSTA 5ICFA 4EGYA 1JHFA 2DMUA 2EA4A 5CQGA 4LG3A 3OYCA 4ZYGA 1XGNA 4KFCA 3HOSA 5JHFA 1E0EA 1HW1A 2NS0A 4RLQA 2DN0A 2KJCA 3V8KA 3QWLA 4F3QA 3U2RA 4JP0A 2VQCA 2GBYA 2QLZA 3CUOA 3OSFA 4I02A 1UHSA 1X4PA 4A3BJ 1DQUA 3JRDA 4P9UA 1LDKB 4D7NA 1NHAA 5ICCA 2LF7A 4Q47A 1EA3A 2LFBA 2G7UA 2UXNA 1SEUA 2CQQA 3QOPA 2EIKH 1JGGA 4XOPA 2W84A 4YELA 2ZNYA 3WTWC 2M7AA 5DM6F 3I9V2 3QYEA 4RS8A 2DA4A 3DBLB 1PVEA 2OCCH 1IRXA 4KA4A 4Y17A 2XRNA 4AWXB 2L0KA 2PFBA 4EMSA 3ZPLA 3ECHA 5BOXA 1IN7A 1FEXA 4HA8A 1QVUA 3B6AA 1LDJA 2JA8J 2VASA 1Z3YA 4BBRJ 5KHDA 1HKTA 4PSWA 4OINF 3CMMA 2FUG2 1WH7A 4LOCA 4MTEA 1SANA 5KNLA 3ML6A 4RMNA 1FOYA 2RC4A 1LB2A 3K70D 2E35A 3RZDJ 3LA7A 1D0YA 3FBIB 1HKQA 3A0BC 2V9PA 5IP7J 2COBA 1NTCA 1TQMA 2KDOA 2QENA 2VJIA 2F5VA 2ELJA 2WY7Q 2Z3YA 3GEZA 5IYCJ 3A01B 2WWYA 4RAYA 3C2GA 3DQVC 3WG9A 1N77A 1X1PA 1SD5A 4OU0A 1HBXG 2WC2A 3OWTA 4IHYA 1I5ZA 1R7JA 3LSGA 1T56A 3MAJA 4AC0A 3JRCA 2QQ8A 3KCCA 2JA2A 2COMA 1WI9A 2E2JJ 3CMEI 4NNJA 2BY3A 2MABA 2HXIA 3CJNA 2RDPA 1KQ0A 2E2HJ 3BPVA 2Q0OA 4BEHB 3F0CA 4CSWA 1ZAOA 1MDMA 1AHDP 3MFKA 1LDDA 1ZRFA 2K02A 1GVDA 4EJTA 1D5YA 2FNAA 3OYMA 3TO9A 2HVSA 1I6XA 3MCZA 3K2ZA 3ZMTA 1BBYA 1VQ6I 1ZKGA 3VYUB 3TKYA 2OBPA 4IHSA 4UNOA 3PSIA 1N78A 1OJLA 2MH2A 3BPXA 1A04A 5F0HA 3WG7H 1S7OA 5B3SH 4XK4A 2ZO4A 5J1UA 2AO9A 4QIWN 2M87A 4PGGA 1UAAA 5D6FA 2A69F 1QVTA 2HTJA 2LVSA 4L9TA 5LD2C 2O6GE 2LTPA 2VN2A 4I7HA 2BV6A 4FASD 3VYRB 1IXSB 2FRHA 2FBKA 5GTIC 3E5UA 4A3DJ 1W5TA 3OYBA 1V5EA 4BJ5C 3C18A 2ZXJA 3S2HJ 1P92A 1BI0A 2UWMA 2JUGA 3GWZA 5FKOA 3W6KB 3K1MA 4EV0A 2NS7A 5IY5H 1LQ1A 1TWHJ 2JSCA 3VWBA 2FOWA 4A3MJ 1ACIA 1XS9A 2ICWG 2ID3A 4RLFA 2DK5A 4LIVA 1XGSA 1PUEE 3E6DA 2KMUA 2R5ZA 4DNCA 4KN4X 3FXQA 4OMZA 3QRFF 2LC2A 4N0BA 4ENMA 4MQ9F 1S5LC 4RAGA 5AONA 1U9NA 4IPAA 4E70A 4KDPA 4GDFA 2Z9OA 2LBFB 2QBYB 1U5TB 2Y2ZA 1JTYA 2L54A 1H0MA 3VEPA 3M3YJ 2IVMA 3FXRA 2XAQA 5D4RA 2BBYA 2WAFA 1YW9A 3F8BA 3SXYA 2ZJPF 2ZC2A 2ISYA 3SFIA 1PUFA 3D0SA 2FF4A 2Y69H 4MIMA 3VSLA 3ZRGA 1IC8A 1GV2A 2LMDA 2O8KA 2EJRA 5CVJA 3FXMA 2GXBA 4RB1A 4XRFA 1FYKA 3HGYA 1JUSA 3QP5A 4IRIA 2NVQJ 5GTHC 3GTMJ 1YYVA 4FX0A 3LAJA 1MMSA 3PNTA 1XN7A 3NWSA 4WK8F 2P7VB 2ZFWA 5HS8A 1FBSA 2YUSA 3M4OJ 5FKKA 3GTLJ 3VDXA 4CYCA 2DK8A 2L5QA 5EG0B 2IEKA 2QCOA 2IGMA 1JGSA 2XF6A 3QAHA 1I3AA 2DQLA 3JR9A 2XF5A 2BYVE 2OU2A 1OR7A 2DLLA 2HDWA 4YG2F 1NG6A 2UZKA 1D8KA 4UVBA 1TNSA 2ELKA 1BOBA 5EF6A 5HNFA 2OJED 5HDGA 4KISA 4M73A 1RIOH 1VF9A 2LSOA 4CHUA 4OOIA 4EM1A 2HPIA 4FCYA 4LMYA 3ZQIA 2VJJA 1LKXA 4IX7A 3OYKA 3H0GJ 3F72A 2MFZA 1R9TJ 2DJIA 1KU9A 4QPOA 3F8FA 3F22A 4RBOA 3J80Z 3G6EI 2PG4A 3T8RA 1TQIA 4ZDPA 2WV0A 3OYGA 4A69C 4DOZA 2JT1A 2G7HA 4PJ0C 3LWFA 2O03A 2YSRA 4HF0A 1P9QC 2VBXA 2ZFUA 3HBLA 4KICA 3ZQFA 4M3DA 3IH4A 2DMTA 2PI0A 2RNJA 3ECOA 3G1LA 2PJPA 1FLIA 2X48A 3BY6A 3K4BA 4CUGA 3RKXA 2CGPA 1UELB 2PMUA 1PYVA 5LHGA 2ACJA 3VODA 1WRJA 3QU3A 3PIPF 1TZLA 1Z67A 1U78A 1XX5A 2DXIA 2PMZA 4IHTA 1LNWA 3QODA 3GYHX 2JSPA 3DKYA 2Y31A 4M9XA 3PFYA 4CCNA 2DFFA 4D5CA 4G7ZF 2K9SA 1GV5A 1P4WA 3BG6A 3ZMZA 4FE7A 4E6KG 3L2RA 3IAM2 3QQAA 2YS9A 4I6ZA 3H36A 2NVYJ 3PM1A 1MMGA 3BTCA 5K5QA 1IN8A 2K9QA 5HS7A 3GFJA 2ZXHA 4C3JJ 5FO5A 5J3LA 4NHJA 3FXKA 3TO7A 3DEWA 3WU0A 4BQNA 1OR7C 3UR3C 4BQQA 1OCTC 4GYIA 3BOQA 3HOYJ 3EUAA 4G6DA 4MLOA 1JKQC 2JA5J 5E1XA 4AIKA 3ABKH 2VL8A 2LR8A 3HB9A 4BL0B 5E3NA 4MNUA 3BDDA 3ZR8X 3A2KA 3BJOA 4A3FJ 1Y8RB 3M1EA 4KYWA 2PBIA 1JE8A 4HV5A 2CV1A 2KHMA 3QOEA 2V6EA 2HDCA 2A07F 3D5LA 2R7QA 4KMUX 4YIIA 4PDKA 1IO2A 2KLOA 2KP6A 2ZMEB 2JA7J 3AG2H 2LH9A 1V4RA 3QPTA 3KP5A 3P9IA 3H3ZA 1FIAA 1M1EB 1DGRM 4L18B 4L5JA 3J80K 5E79C 1Z9CA 1VNDA 3KE2A 4UUVA 4YFXF 1OKRA 2FNPA 4RGUA 4AD9A 4KN7X 1QPMA 4UHTA 1FOKA 2X6OA 1R6RA 3TOBA 3TP0A 2LP0A 2MD0A 3KZYA 2R4GA 3NEUA 3K1NA 2LF8A 2RGVA 2GA2A 2H8WA 3OS1A 2YX7A 2XIGA 2A6EF 1ZGAA 3DTKA 3LSIA 3NQOA 3PQJA 2K4BA 1QGPA 2DOFA 3WU2C 1AKHB 1IV8A 4Y52J 3I71A 2R7WA 3BTJA 3OYNA 4NQWB 2P5LC 4BHBA 3S3NA 1K6YA 1KYWA 3ABTA 2VT3A 2EZHA 2EIMH 3S32A 2KIQA 3NWTA 3L9FA 3EDPA 3PNYA 5FD5A 3CMAI 1V5FA 2LYCA 1Z05A 2W00A 3CCYA 3IWZA 3L00A 4Y15A 2IW5A 2GLOA 4MFEA 4ZDLA 2P7CB 3HTUA 4C3IJ 1OCRH 5JVTA 2QQ9A 1KGSA 4AVPA 4MO7A 1SC7A 3ZMSA 3K70C 2P5VA 3CCEI 4MQVA 1A35A 4V19K 5LHHA 4ZZDA 3DLAA 4L0ZB 4LLNA 5TGTA 4HF2A 3BLYA 5LEJA 1VQOI 2TCTA 1V54H 3DU6A 2NXNB 3GTGJ 4UVAA 2LY1A 2CWEA 2M45A 2OQGA 3H5RA 2ID6A 2X85A 3TP3A 3DPLC 5GADJ 1X3ZB 3WTSC 3WTUC 5H2FC 3HTSB 2Y0MA 5FJ8J 3J7AO 2CV0A 1HOMA 4LK1F 1KU2A 3PL8A 2CJJA 4QWQA 2ZJQF 5FLVA 1POGA 3RJPA 5FLMJ 2M30A 1FOWA 4I98B 3CO6C 4R8HA 3K2AA 5FGMA 3H9QA 3RKWA 1B72B 2EFPA 5DCFA 3S3OA 4XICA 3MN2A 3EETA 5DUIA 2IA0A 3WTVC 3A01A 2C6YA 2V1NA 3N05A 1MBGA 1S29A 4ZYDA 3G71I 1XCVA 2V1DA 1T6SA 1OYIA 2UUZA 3G2BA 3BTLA 2DDBA 4A3CJ 1ZGWA 4YIFA 4BEHA 4NUBA 3I4MJ 2KRHA 1S3JA 1VFCA 2OCEA 3JCUC 5LGNA 2VOOA 3OYFA 1ERDA 2IGKA 3X2QH 4CZZA 3GBGA 3RKYA 2DJNA 5F0CA 3WHBA 4KMFA 4HOBA 1V3FA 4B48A 3OIPA 3ONQA 4NC8A 5AIQA 3HYIA 4XR6A 2VT2A 3HKZA 4G8XA 2NNYA 3KZZA 3RKQA 2FX0A 2XB0X 4B4CA 4XRMA 4ZJZA 3CCJI 5F0FA 5L3BA 4U0VA 2V9VA 5HVQC 2BY1A 3KYLA 1CF7B 4LLLA 1Y0UA 2CYYA 2F5DA 3C2HA 2CW8A 2AXLA 3HSFA 4UY8I 4NC7A 5CJ9A 2W4SA 4Z2YA 3JAMZ 4MFDA 4C30A 5JLXA 2EA2A 3LSKA 1GXQA 3FZVA 4NB5A 5FKNA 2BEOA 4AYBA 2PJRB 3HHGA 4F92B 2ZB9A 5DM7F 3BJ6A 3C7JA 1SAXA 3C3WA 3ZCOA 1ZN2A 1IXCA 3TEDA 2XPVA 2BHYA 3E1SA 1TBXA 3E5QA 1JKPC 5HDNA 3ZQQA 4PFOA 1VQNI 3ZQLA 3CCMI 4LJZF 3IL2A 4J19A 3MWMA 4X1EA 2LBFA 1UHWA 2EB7A 3HRUA 1J75A 1R1VA 2QBYA 1U5TA 2XGXA 3OYIA 4BHCA 4JOMA 3ASNH 2L9RA 1HQCA 2KIFA 2M9HA 5K7FA 2J5OA 4M71A 1MMAA 2KT0A 2WAQA 4ANJA 2OPTA 5ICEA 2B0LA 2DA1A 1KQ9A 4DGWB 2PN6A 3KLOA 3G73A 3I56I 4CXFA 2RREA 1WWXA 5E8GA 1SFXA 3LQQA 5EYRA 2VKDA 2E1NA 3BJAA 3F9KA 4FETA 4FX4A 3CC2I 1FBUA 1BA5A 5EG0A 4WXCA 4BXXJ 2O8XA 2OZ6A 3BZKA 5JHUA 2H6CA 3FM3A 2BVLA 3ZN1A 2GIVA 1XDUA 5DDGA 1YS6A 3TL4X 1A31A 2M4GA 4L5IA 3CESA 2DT5A 1ZLKA 3EYYA 3MD2A 5M5WJ 2LREA 4LK0F 3CCSI 2DI3A 1LJ9A 2E1CA 1ETWA 3H5AA 2HQ5A 4BHPA 1K83J 5K1YA 1S7EA 3ULQB 2WB1N 3KP3A 3S2WA 3SYTA 5CVIA 2XKOA 3JAMK 3GZ5A 1LFUP 2W24A 1P2FA 4GCVA 2DYRH 2RVCA 1IF1A 3BCAA 3WTZA 1QHGA 2AQFA 3T1BA 4A0ZA 4FT8A 5ICGA 3WGGA 2F5EA 5J4VA 4AM3A 1MJBA 5AIPA 1G3WA 2R7SA 3NRVA 3F8NA 1C0WA 1U5TC 1O3RA 3OR2C 1O4XA 2IS6A 1R49A 1B8IB 1KA8A 4Q5SF 4JBAA 1Z77A 4F52A 3GFMA 2VUMJ 2X6WA 1JUMA 1ZGJA 2OTJI 4EM2A 3T0YA 4IRGA 1IDZA 3IRQA 1HKSA 1S8NA 2R5YB 1PP7U 1ZQ3P 1AOYA 5ILUA 2GZWA 3J7AY 1T39A 1MBEA 1HF0A 5K7HA 4XBFA 5BQTA 3M7GA 4Y13A 1FBQA 1Q1VA 2DA3A 3JSOA 1H9GA 5DD8A 4HF1A 1HA8A 4AUXA 1I50J 2A61A 4PJJA 2FXAA 3SZGA 1DP7P 4FHTA 2OV7A 4P1WA 1U0JA 5EEAA 4U7BA 3FMSA 2E34A 3FMQA 1XDSA 4CO8A 1HXDA 2K9NA 3UKGA 4HBLA 4JX4A 1ZRCA 1WJEA 4OIQF 3W2WA 4LG0B 2HWVA 2JZYA 5EEHA 1YOVB 3KEOA 1UHMA 1IN6A 3DP7A 2DCEA 3KP2A 2GOMA 1OCOH 3WGIA 1TLHB 1YQAA 2EZIA 5DCMB 5F64A 5E3LA 3GXOA 1EH8A 1JKRC 2JPCA 2K9LA 1O3TA 5IPAA 1F4KA 1WGXA 2ADUA 3CCLI 1YJWI 3OOPA 1ON2A 4I76A 1FWZA 2MYSA 4RM2A 3ROUA 4OMYA 4YFNF 2MLGA 5FROA 4C2UA 3HIFA 3K4CA 3KX2A 3V8LA 4IOCF 1G3SA 4L9VA 1I39A 4MGRA 3N4MA 5BPIA 2ZMEA 5DEQA 1H8AC 5HODA 2HVRA 1TWFJ 1BIAA 2GOXB 1HLVA 1R00A 2ZNZA 1WJFA 4G12A 4XRSA 3BZ6A 1FP1D 3DTIA 2Y9YA 2LK2A 3H9JA 1MNDA 4F93B 1RC9A 2XAJA 2L2OA 5F1RA 2VQLA 1SVMA 5GAGJ 3R61A 3DKXA 1W7PB 2VJ5A 2K7LA 2QM3A 3DBRB 1K6OA 1WJBA 1MBFA 3ZGKA 4HLXA 1TW2A 1B1BA 2J5PA 3GMEA 4A6EA 2X1CA 2XC7A 2CUZA 3KEYA 3V7RA 4XM3A 5J8CA 1P4AA 2GIZA 2V26A 5FLXZ 4X6AJ 5GAHJ 3OL3A 1YI2I 4CGZA 3MVPA 3GW2A 1AKHA 5TJJA 4NQWA 5EZHA 4EGZA 2DA5A 4U88A 3FWEA 4B1RA 4ETSA 2N8GA 2IS4A 3TDUC 1O57A 2EILH 1WI3A 1BN5A 2O9LA 4A3GJ 2AHQA 4OAZA 4KNYA 1W1WE 3ZOBA 4I99C 1N75A 1U9OA 1IRGA 2HKOA 4XKVA 4UB8C 1U8RA 1XTAA 4KIBA 1F5TA 3CDLA 4Y33A 3CJRB 4HQMA 1X2NA 2ECBA 3GO5A 1B9NA 4ENJA 3C2BA 1SFKA 1XB4A 1IUYA 2L02A 4J01A 3K4MA 2CRGA 4AIJA 4KJZA 1LEBA 2PMHA 3LL7A 4F7ZA 4N9HA 1X58A 1P7IA 2ZMEC 1K61A 3LSHA 1QZEA 2VC1A 2L9SA 3C1DA 3WE2A 2P81A 3R4KA 4XSXF 2DA7A 3ABMH 2RQQA 3TGNA 2E2IJ 3FMRA 4OAYA 1VQPI 2QVOA 1FNNA 2L3DA 4XKCA 1OPCA 3O3KA 1B6AA 2DTRA 4HZFA 1VQ8I 4HDUA 1UZCA 2LG4A 3VFZA 1QNTA 2CQXA 3AG3H 4II3A 1Z7UA 3S1NJ 5M3MJ 2FQ4A 1B72A 1BR1A 2WV1A 4LB5A 1I27A 2Z33A 2O3FA 1VTNC 3T5XA 4ABZA 1R5ID 1A6QA 3S3MA 1LVKA 2Z16A 3CP2A 4DJAA 3LA2A 3M8JA 4JK1X 3L2QA 3HPGA 3TW6A 1BI2A 3HOZJ 4ENNA 3SQNA 1HDPA 2GM4A 2O61A 3ABUA 3E0JB 4A0XA 4Q4ZF 1ZTRA 5KVRA 1FYLA 5CVUA 2XV4S 2PLYA 1ZK8A 2IA2A 2QQAA 2IT0A 2GXAA 2KQRA 1EKEA 1MMDA 1ETOA 4QTRA 1SFOJ 4EJOA 3WU1B 2R3SA 3ISPA 1IDYA 2XAUA 4G7OF 3S1MJ 1YTYA 1S72I 1D8JA 3SZPA 1ETQA 1W7PD 4KUMA 2R92J 4P96A 4G94A 4D5FA 2JTVA 4G9YA 1VQMI 1WZ2A 4OIPF 3KIOA 1U2WA 2D1HA 2NAZA 2OQRA 3AFHA 2HOAA 3OV8A 2JPBA 3BC8A 4MTDA 1JHHA 2L4AA 3VSKA 2X6YA 3KP4A 4PCQA 1ZARA 1EV7A 4BE1A 1J5YA 3DXJF 5GPAA 4HLYA 3OIOA 1L0OC 2EQRA 2ZSIB 4M6YA 2JVGA 4B3XA 1CF7A 2NVTJ 1IN5A 3LSPA 2ZJ2A 1MZBA 4HG2A 1WKMA 4IL6C 5EEGA 1FYMA 4RB2C 3R0AA 5D5UB 5BS6A 5L3FA 5ILSA 1K78B 1UG2A 2CW0F 5EGOB 1GVJA 2YR2A 2Y0SN 1IGNA 4N4OB 4BYYA 1IZ1A 2F4MB 1UB9A 2EWNA 2KISA 3CF5F 4HDVA 2PJRA 2BHZA 3RTRA 3Q9SA 2VLAA 4LB6B 4ZTFA 2JQ7A 1XG1A 2XUBA 4E7LA 3F3XA 2Y30A 5D8KB 1K7AA 3OYHA 2K3PA 4YFKF 5LRSA 4KT6A 3HG9A 1TT0A 3E5XA 2JRMA 3NARA 1R71A 3TMOA 2K4JA 5DUKA 2XKPA 1W0UA 1YX3A 2AXTC 3IUOA 5M5XJ 1WJCA 2QQBA 3CQZJ 1T98A 3S8PA 3EUHA 1BW5A 3MQ0A 2OAZA 4UVCA 3LSMA 3OYAA 1QHHD 5HLTA 4O6JA 4CCKA 2G9WA 2I10A 2IS2A 2CQNA 2W48A 3TDZC 1BW6A 3W2AA 1YRNB 1QO0D 4I01A 1OCCH 1BC7C 4OIOF 3LSJA 5F1JA 1MJ9A 1ETVA 3WODF 2QUFA 3JRFA 3JRBA 2KL4A 4RA2A 3H9GA 3PFIA 4IQJA 1WVRA 4A3KJ 3H5NA 1AWCA 5B66C 2STTA 3V7SA 2JN6A 3ZXSA 2PQ8A 3QU6A 4M9ZA 5CVRA 3RPUD 3K9TA 3GUDA 2A05A 3R60A 1ITYA 4ESBA 2XGCA 2XPUA 3B02A 4XN0A 5HS9A 5JI6A 1RPWA 4LFUA 5HDKA 3AKZA 2EZKA 2M0MA 4UUSB 2Q1ZB 4NC6A 1GHCA 4LGWA 1ZREA 3FF5A 1X1AA 3LQRA 5CLSA 2X51A 2HKXA 2M3AA 3FKJA 2HYFA 3FK6A 1O7FA 5HOOA 1PP8F 3I59B 5B5EC 5JVGF 1CGPA 1I6HJ 2CU7A 4IQ4A 1VQKI 4BBSJ 4C2MJ 1B9MA 2EPFA 4U7DA 3HUGB 1LUJB 4HSRA 2CFXA 3M8EA 5IOZA 2QZ8A 3H3UA 2O5RA 1K79A 3EUKL 4EM0B 3L2UA 1XMAA 1MH3A 3CCRI 2W7NA 1ZR2A 4DYQA 1FMVA 1QRYA 3L1PA 2EV0A 2LNBA 3EUHC 2VJ4A 4HAMA 1OLTA 3GTKJ 5FD6A 1B8IA 1LE8B 3K4NA 3WTYC 4WWCA 4K2EA 1T38A 1FTTA 3FISA 3DU5A 4RAZA 4IF4A 5CKTA 3JRIA 1RR7A 4BACA 5TRDA 2R5YA 5ED4A 3U9GA 2NOJB 1Z7LA 4IVNA 4S0HB 3SEZA 1XSVA 1S7AA 2OTLI 4RAFA 4ZH4F 2R7ZJ 4ZDOA 1EF4A 1IV6A 5E8IA 2HOEA 4A3LJ 2X9DA 5IYBJ 4P5OA 2FBIA 3J81Z 5C44J 5CYVA 1X3WB 3ZMUA 2CQKA 3EYIA 4ZTJA 1MBHA 1FP2A 2XRLA 2XSJC 3FIWA 4RB3C 4PSXA 1K4SA 1XCBA 2XDVA 2CUFA 2Q2EB 4XN3A 4LG0A 2LKXA 4BU2A 4WF2A 3ABLH 2DFIA 1NK2P 4E7HA 1SD4A 1R22A 5DCMA 2KIUA 3P9KA 1XGMA 3H1CA 3FK7A 2P8TA 2D5VA 3CJQB 3CDHA 4BY1J 3CF2A 5E20A 1EH6A 2A5WA 2IP2A 2Z99A 3HOXJ 4HX7A 4Y3OA 5J40A 3M07A 4PGHA 3O8HA 3TOAA 2HGCA 4JYKA 1YIJI 3G1MA 2BY2A 2HS5A 4A2UA 3HXLA 3CUQB 2RN7A 3ERMA 2VXZA 3ZQ7A 4Y7NJ 3T8TA 1D1AA 4CA0A 3HHHA 1MW7A 2WA0A 4CICA 4PK4A 4IO9F 3BCBA 3I54A 1REPC 3ZMDA 2LRDA 1JI8A 2X1DA 3D5SC 2AQEA 1XMKA 6PAXA 1W7PA 1DGWY 4G6TB 4WCGA 4O5VA 3NAUA 1G3TA 3H92A 4QPQA 1MKMA 3K4JA 3KYDB 1ZG5A 1L3LA 4A93J 1WH5A 2V9KA 2ZJRF 4XKBA 3JSPA 2D45A 4XOTA 2MGQA 1YITI 3F8CA 3LMMA 3OYDA 1BC8C 2BZTA 2CQ7A 3B6CA 3HOUJ 1TNTA 3SEQA 1J09A 3HSRA 3BWGA 1T08B 3I4PA 1T33A 3HRSA 5FRMA 3FM5A 2K40A 2E1MB 2JRTA 3BQZA 1BJAA 3K0LA 3RDIA 4XLPF 2F48A 3MKYB 3PIOF 3J81K 2F5FA 2HFHA 1ETKA 3K4LA 4HPQA 5M3FJ 1HSTA 3MKZA 1I1GA 3IAS2 2HTSA 5LGUA 5HNHA 4XLEA 2DDAA 2ZSHB 3BZCA 3HRTA 2A68F 3FHZA 2VXDA 4ON0A 2OA4A 1X2MA 3MKWB 3PSFA 2B9SA 4UUTA 4B43A 4B47A 2QKMB 5DV5A 3FX3A 3I3LA 3J7YJ 1AA7A 1I1SA 3N97A 4LIUA 4XLHA 5KCMA 5EDNA 2VBZA 4EJVA 1MNMC 5B1AH 1TL8A 1NH3A 3E6CC 1GLNA 1I3QJ 3Q0WA 2EBIA 5FFZA 4BUPA 2IAIA 2OF7A 2R7VA 1ETYA 2AS5F 2ZXWH 2HOSA 1G3YA 1RNLA 1ZG3A 2UXXA 1TWGJ 4UV8A 4XKWA 1A36A 2V4JC 5BMZA 3F8MA 4BKXA 3IH3A 3M9AA 4BNCA 3DFGA 2V6CA 3GZNB 4PZJA 3EPZA 5IOYA 1EH7A 1R5HA 3P7NA 2EZLA 2EH3A 4XSZF 4XQFA 1VQ5I 3OYLA 3GZ6A 1JJ6C 2A3SA 2H1LA 2XGEA 4W1UA 2W82A 3O6BB 1D3YA 3CCUI 2DBBA 1B4AA 1NG7A 2BXYA 3I55I 1HDDC 2DAOA 1X1BA 5J1YA 3SZTA 1OQYA 1H9TA 1RKTA 2IGOA 3QYFA 4KT5C 3D1NI 2XF7A 1OCPA 5HLGA 1RETA 3L2VA 3CDIA 2QYOA 3S1QJ 4Z6YA 1YHQI 2OD5A 1SFEA 3OMYA 3JTGA 1GDTA 2NOGA 1TWAJ 2BW3B 2FQ3A 4H4KC 2DPDA 1ONVA 3KP6A 4F91B 1BIBA 2XROA 2L01A 1XC5A 4M3FA 1MSFC 2DA2A 3CZ6A 4AIHA 4AYBN 5FFXA 3MKLA 3GLXA 5DYMA 5D4SA 5H20A 4S05A 3PNVA 3HOWJ 4E7JA 1OYWA 2XPWA 4U87A 1TT5B 4G6QA 4V2GA 2DMNA 2R7XA 3ZN0A 4YEJA 2CFOA 1K78A 2X6XA 4FISA 2R7DA 5EGOA 3COAC 4X0GA 1FIPA 3E6BA 1GXPA 3RYPA 1F43A 4RB0A 3G1OA 2ELHA 1FX7A 2EIJH 3SFZA 2FMLA 1LFBA 3IKTA 1KU7A 3KYCB 4N4NB 3OY9A 1V55H 4F55A 2IXSA 3BR5A 3IHUA 1BOAA 4LD5A 1YFHA 4I0BA 2FA5A 3W2VA 4IXAA 1OFCX 1Y1WJ 1DU6A 4I09A 3HM5A 4WXHA 4W97A 4DIQA 4KITB 1OMIA 2FD5A 4A3JJ 4I2OA 2VPLA 1KONA 2BY0A 2YX4A 2ME6A 3OS0A 1IAWA 2H6BA 1JTXA 4DYCA 1KQ8A 3CCVI 2DOAA 1YRNA 5IP6A 2EK5A 1P6RA 1Z1DA 5ILVA 1RRJA 4A3IJ 2F4OB 3OYEA 1G6NA 1Z3XA 1FTZA 1WJ5A 5F04A 1E17A 5IP9J 1R4NB 2BE5F 2H09A 4A5NA 3OSGA 2ZXIA 4C3HJ 3VYTB 3KPHA 1JT6A 1SMYF 3HGGA 3E3VA 5K7ZA 2ISZA 2QKLB 3K69A 2R7TA 2L7KA 2FMYA 3DLLF 1SD7A 3W3CA 4C2TA 1Z6RA 3OR1C 1WJDA 1Y1VJ 1Y0NA 2CUJA 5LGTA 1O3SA 1QZZA 1SVLA 5KAIC 3ERED 4M3GA 2QSFX 2GXGA 2JVHA 3OIQA 5L3EA 3KEQA 4ZZLA 4UUSA 4DQ2A 1DPUA 2VKEA 4UV9A 1U3EM 2EFQA 2WBMA 3WTXC 2NNNA 2L7FP 1VQLI 3SHFA 4EJUA 4GO1A 1ZR4A 2CSOA 4EVIA 3I59A 2E7XA 2MSYA 2JK3A 3QPSA 5HLIA 4IEJA 2DMPA 4R79A 4KIGA 3I0TA 5LHIA 3GTQJ 1XSDA 1SD6A 2E5NA 4GYGA 3O8GA 1F36A 3HUGA 5C3EJ 4M6VA 4A0YA 1J2XA 1ZYRF 2VIXA 4J00A 1UG0A 3MEXA 3LA3A 4Q48A 2NRAC 2MW8A 3LAPA 2JJ7A 1YS7A 2R0QC 3DEUA 3QP6A 3J7ZI 3WTTC 1UCRA 5E1WA 3CCQI 1X1DA 3ZQHA 5F08A 1CQTA 3R6SA 3PUBA 4IZZA 1ORKA 2HZTA 5FRNA 5B1BH 3KETA 3DEEA 1TWCJ 1LE8A 1N25A 5H6RA 1E3PA 3GCMA 3V8JA 3K6GA 1RKWA 4RGSA 3CLOA 1FC3A 4UXNA 2H27A 1FJLA 2F2EA 2LLKA 2M5WA 3AL0B 3GTPJ 4LITA 3GFLA 1U8BA 4E7ZA 9ANTA 1WCMJ 4JX6A 2FEZA 1USTA 1KYZA 5IT3A 3DF8A 4A3EJ 3K7AJ 3HSEA 3DTEA 3BG3A 3IWFA 4HRIA 2R7RA 2HYGD 3OL4A 1NK3P 1OISA 3EQLF 3WGHA 2H8RA 1WHUA 1BR4A 4AVZA 2VKHA 5J4YA 1BR2A 3PO3J 4XL9A 1K4TA 3GFIA 3H3VK 2M2EA 4HNVA 3LFUA 4XNFA 1APLC 1MMNA 1W0TA 2P6SA 2X0LA 1WFXA 2VQHA 5IT9Z 2DTZA 1ULYA 3BR2A 1XGOA 4NBQA 1DU0A 1VQ7I 4JQFA 1MD0A 2Q2EA 4GFBA 2MH9A 4WXDA 5D6EA 2IA1A 4HNTA 2XAHA 3BR6A 1Y39A 1R23A 4ITVA 1JXSA 2EFOA 2F4IA 2JWTA 3A03A 1SMTA 2HNHA 1LEAA 3RQ4A 3LOCA 2K5CA 5FB2A 4XRSG 1W5CC 1WJAA 2LY2A 2QWWA 3CD6I 3F6OA 3RYRA 4HEA2 2JA6J 4EEFG 4XLFA 2M8EA 2BXZA 3MZHA 1F9NA 5LEKA 2Y0SA 2VPRA 5BPDA 1T95A 1VQ9I 5L3CA 5J47A 2E71A 2QEXI 2G0EA 4C9YA 3CUQA 2IRFG 1QZYA 2KJBA 3CC4I 4PJMA 4Y4RA 1OCZH 4CDGA 3E6MA 3S14J 3V42A 5H6QA 1LPQA 1YW8A 2HYJA 1TTYA 2KRFA 2BOLA 1ON1A 2DMQA 2VB6A 1LFPA 2W85A 3DKWA 3K4KA 3RIRA 3H0DA 2Y48A 4S04A 2V1UA 5GPCA 2MC3A 4CCJA 5KAFC 4FTHA 1RI7A 4DYRA 4ZYEA 5FLXK 1WPKA 1X19A 3WE3A 4A12A 3JRGA 1H88C 4CZCA 2K85A 1JT0A 3KP7A 1IXRC 4D1QA 1R1UA 1UMQA 4CCLA 2XAFA 1IUFA 2ESHA 2FJ1A 4CCMA 2L7MP 5F27A 1UJ8A 2MBFA 3AAFA 5LLQA 3S15J 4IHXA 2IJLA 3PJRA 3A0HC 4HW0A 5GP9A 1RUNA 1A6IA 1A5JA 3Q0VA 1FSEA 3TW7A 5L3GA 4M6XA 1W4MA 1W36D 1LVAA 3MZYA 4LLGF 1DUXC 1RR8C 1FY7A 5E3OA 3JRAA 5FKMA 4GRIA 3RI4A 4IJAA 4D0PA 3DV8A 4XLAA 2L9NA 1VI0A 3E97A 2OZUA
chains in the Genus database with same CATH topology
5IT9K 3R0JA 1Z6TA 2EV6A 3Q9VA 4M9SA 1XD7A 4BAYA 2GA1A 2DPUA 2Y75A 4CYDA 1W5SA 1RZ4A 4ASNA 2XHKA 2BGCA 1P4XA 5DD4A 4GGGA 3CUQC 3I58A 2Z5UA 4A6DA 2MD5A 1Q1HA 2ETHA 3GVAA 5LRRA 4OIRF 4P55A 3W6JB 1ZHFA 2W25A 2GWRA 2P6TA 2YU3A 1TW3A 2VBYA 2V1XA 5J6XA 4BH9A 5E1ZB 3V4GA 3I64A 3IC7A 5JFRA 3TO6A 5CVVA 1YLFA 2D1VA 2TDXA 3F6VA 2FSWA 5JR3A 3ZP5A 5D5VB 4I0AA 1YG2A 4HYEA 5D8LB 2K86A 3HRMA 4A5MA 4R1HA 1HW5A 3L09A 3G3ZA 4WX9A 2L4MA 1ZH5A 5L3DA 1F1ZA 3B73A 1D5VA 3O2PE 2V79A 2GAUA 5D5WB 1YO5C 1J59A 3GF2A 3F21A 4M74A 1ZG1A 2F5CA 1IRFA 1O3QA 1FSHA 4L9JA 2VC0A 2LDUA 3L7WA 1MDMB 5J8FA 3PQKA 4IRHA 3BP8A 1BI1A 3DPTA 2Q8KA 2HQRA 2XVCA 1MGTA 5A2QZ 3RPQA 4TV7A 1ZRDA 2X4HA 5K5OA 1IW7F 3IKVA 1PDNC 1U6GA 1T2KA 1SFUA 2DU9A 3P9CA 2HR3A 2IPQX 2DO7A 1J9IA 5E17F 2P4WA 2E7WA 2EV5A 4U0YA 1YIOA 2XAGA 4EJWA 2NYXA 1QBJA 1Z91A 3VB2A 2K27A 5LBQA 4N9IA 4ENKA 3I5UA 1R5GA 4RGRA 1UFMA 2STWA 3U1DA 3CTAA 2FE3A 2WTEA 3IRRA 5F6FA 2HQNA 1FZPB 4B09A 3KFWX 2HEOA 4L9NA 2VE9A 4ZYHA 4HX4A 4MHGA 1G4DA 1O7LA 1WQ2A 3LFKA 4GXOA 2W57A 2VBWA 3ELKA 4HX8A 1J0RA 3I53A 2VE8A 1R1TA 5A2QK 2VODA 3CO7C 2DW4A 3ZMVA 1MJAA 2FOKA 2ZCWA 4KIFA 3F23A 2D2WA 1XSXA 1FT9A 1TQPA 2A5YB 3Q5FA 1HSJA 2O0YA 2VONA 1X3UA 1B59A 3M8FA 1BM9A 1QQIA 3QPHA 4B8XA 1STZA 1IN4A 2P5KA 4M72A 1E2XA 3JTHA 1HW2A 4O3MA 4RGXA 4ESFA 4XLNF 2CO5A 1YW7A 2EFNA 4P9FA 1KU3A 1WSUA 1ODDA 2ZKZA 4QLCU 2KKOA 1T0FA 2RQPA 2LKPA 2MA3A 3L2CA 1R58A 3K1PA 3HOTA 2A6HF 5ERIA 4BQAA 2GQQA 2ESNA 1ZLJA 4MEYF 1FPQA 3RPUA 3VOEA 2YPRA 4MEXF 4ESJA 3V7CA 1S6LA 5KK1A 4L0YB 2KIMA 2M1BA 5K5RA 5HLHA 5E18F 3BROA 3JW4A 4H0EA 2XASA 4BXUA 2H94A 2RV8A 2ZBKA 4HV6A 3GX4X 4G7HF 2R7FA 1J7KA 3REOA 2FU4A 5D5XB 3FXUA 4HQEA 2RKHA 2PEXA 2VOPA 2MLKA 1DDNA 2CG4A 1R36A 2DQRA 1RUOA 4EQQA 1DPRA 3TQNA 4U0WA 2EFWA 1OYYA 2FBHA 1BI3A 3KLNA 1USSA 3LSTA 5ICFA 4EGYA 1JHFA 2EA4A 4ZYGA 1XGNA 4KFCA 3HOSA 1HW1A 2NS0A 2KJCA 3V8KA 3U2RA 2QLZA 3CUOA 4I02A 4P9UA 1LDKB 1NHAA 5ICCA 2LF7A 4Q47A 2G7UA 2UXNA 3QOPA 2W84A 2ZNYA 3WTWC 4RS8A 4KA4A 4Y17A 2XRNA 4AWXB 2PFBA 4EMSA 3ZPLA 3ECHA 5BOXA 1IN7A 4HA8A 1LDJA 1HKTA 4OINF 4MTEA 3ML6A 2RC4A 1LB2A 3LA7A 1HKQA 1TQMA 2QENA 2Z3YA 3GEZA 2WWYA 4RAYA 3DQVC 3WG9A 4OU0A 1SD5A 1HBXG 2WC2A 1I5ZA 1R7JA 3MAJA 3KCCA 2COMA 1WI9A 3CJNA 2RDPA 1KQ0A 3BPVA 2Q0OA 1ZAOA 1MDMA 3MFKA 1LDDA 1ZRFA 2K02A 4EJTA 2FNAA 3TO9A 1I6XA 3MCZA 3K2ZA 3ZMTA 1BBYA 3TKYA 2OBPA 4IHSA 4UNOA 2MH2A 3BPXA 1A04A 1S7OA 2ZO4A 2M87A 4PGGA 5D6FA 2A69F 2HTJA 4L9TA 2O6GE 2VN2A 4I7HA 2BV6A 1IXSB 2FRHA 2FBKA 3E5UA 1W5TA 3C18A 2ZXJA 1P92A 1BI0A 2UWMA 3GWZA 3W6KB 3K1MA 4EV0A 1LQ1A 2JSCA 2DK5A 1XGSA 1PUEE 3E6DA 4DNCA 4KN4X 3FXQA 4OMZA 3QRFF 4N0BA 4ENMA 4MQ9F 5AONA 4IPAA 4E70A 4KDPA 2Z9OA 2QBYB 1U5TB 2L54A 1H0MA 3VEPA 2IVMA 3FXRA 2XAQA 5D4RA 2BBYA 1YW9A 3F8BA 3SXYA 2ISYA 3D0SA 2FF4A 2EJRA 5CVJA 2GXBA 4RB1A 4XRFA 1FYKA 3QP5A 4IRIA 1YYVA 4FX0A 3LAJA 1XN7A 4WK8F 2P7VB 2ZFWA 5HS8A 1FBSA 2DK8A 1JGSA 3QAHA 2DQLA 2BYVE 2OU2A 1OR7A 2DLLA 4YG2F 2UZKA 1D8KA 4UVBA 1TNSA 5HDGA 4M73A 1RIOH 2LSOA 4CHUA 4OOIA 4EM1A 4LMYA 3F72A 1KU9A 3F8FA 3F22A 3J80Z 2PG4A 3T8RA 1TQIA 2WV0A 2JT1A 2G7HA 3LWFA 2O03A 2YSRA 4HF0A 2VBXA 4KICA 2PI0A 2RNJA 3ECOA 2PJPA 1FLIA 3BY6A 3RKXA 2CGPA 2PMUA 2ACJA 5LHGA 3VODA 1WRJA 3QU3A 1U78A 4IHTA 1LNWA 3GYHX 4M9XA 4G7ZF 1P4WA 3ZMZA 5K5QA 1IN8A 5HS7A 3GFJA 5FO5A 4NHJA 3TO7A 3WU0A 4GYIA 3BOQA 4G6DA 5E1XA 4AIKA 4MNUA 3BDDA 3BJOA 3M1EA 4KYWA 2PBIA 1JE8A 4HV5A 2HDCA 2A07F 3D5LA 4KMUX 4YIIA 4PDKA 2ZMEB 1V4RA 3QPTA 3KP5A 3P9IA 3H3ZA 4L18B 4L5JA 3J80K 1Z9CA 3KE2A 4UUVA 4YFXF 1OKRA 2FNPA 4RGUA 4AD9A 4KN7X 1QPMA 4UHTA 1FOKA 3TOBA 3KZYA 3NEUA 3K1NA 2LF8A 2RGVA 2GA2A 2YX7A 2XIGA 2A6EF 1ZGAA 3NQOA 3PQJA 2K4BA 1QGPA 3I71A 2P5LC 4BHBA 1KYWA 3ABTA 2VT3A 3L9FA 3EDPA 5FD5A 3L00A 1Z05A 3IWZA 4Y15A 2IW5A 2P7CB 3HTUA 5JVTA 2QQ9A 1KGSA 4AVPA 3ZMSA 2P5VA 4MQVA 5LHHA 4ZZDA 4L0ZB 4LLNA 4HF2A 5LEJA 4UVAA 2CWEA 2M45A 2OQGA 3DPLC 3WTSC 3WTUC 3HTSB 2Y0MA 3J7AO 4LK1F 1KU2A 4QWQA 3RJPA 2M30A 4I98B 3CO6C 4R8HA 5FGMA 3RKWA 2EFPA 5DCFA 3EETA 5DUIA 2IA0A 3WTVC 2C6YA 1S29A 4ZYDA 1XCVA 2V1DA 1T6SA 1OYIA 4YIFA 1S3JA 5LGNA 2VOOA 4CZZA 3RKYA 4KMFA 4HOBA 1V3FA 5AIQA 3HYIA 2VT2A 4G8XA 2NNYA 3KZZA 5L3BA 4U0VA 2V9VA 5HVQC 1CF7B 4LLLA 1Y0UA 2CYYA 2F5DA 2AXLA 3HSFA 5CJ9A 4Z2YA 3JAMZ 2EA2A 1GXQA 3FZVA 4NB5A 2BEOA 3HHGA 3BJ6A 3C7JA 1SAXA 3C3WA 1ZN2A 1IXCA 1TBXA 3E5QA 5HDNA 4LJZF 3IL2A 3MWMA 1UHWA 2EB7A 3HRUA 1J75A 1R1VA 2QBYA 1U5TA 2XGXA 4BHCA 1HQCA 2KIFA 2J5OA 4M71A 5ICEA 2B0LA 1KQ9A 2PN6A 3KLOA 3G73A 4CXFA 1WWXA 5E8GA 1SFXA 3LQQA 2E1NA 3BJAA 4FX4A 1FBUA 4WXCA 2O8XA 2OZ6A 5JHUA 2H6CA 3FM3A 3ZN1A 2GIVA 1XDUA 5DDGA 1YS6A 4L5IA 1ZLKA 2DT5A 3EYYA 4LK0F 2DI3A 1LJ9A 2E1CA 4BHPA 5K1YA 3ULQB 3KP3A 3S2WA 5CVIA 2XKOA 3JAMK 3GZ5A 2W24A 1P2FA 4GCVA 2RVCA 1IF1A 3WTZA 3T1BA 4A0ZA 4FT8A 5ICGA 3WGGA 2F5EA 1MJBA 5AIPA 1G3WA 3NRVA 3F8NA 1C0WA 1U5TC 1O3RA 1KA8A 4Q5SF 4JBAA 3GFMA 1ZGJA 4EM2A 3T0YA 4IRGA 3IRQA 1HKSA 1S8NA 1PP7U 1AOYA 5ILUA 2GZWA 1T39A 4XBFA 5BQTA 3M7GA 4Y13A 1FBQA 3JSOA 1H9GA 5DD8A 4HF1A 2A61A 2FXAA 1DP7P 4FHTA 4U7BA 3FMSA 3FMQA 1XDSA 4CO8A 1HXDA 1ZRCA 4HBLA 4OIQF 4LG0B 2HWVA 2JZYA 5EEHA 3KEOA 1UHMA 1IN6A 3DP7A 3KP2A 3WGIA 1TLHB 1YQAA 5DCMB 5F64A 3GXOA 1EH8A 2JPCA 1F4KA 1O3TA 2ADUA 3OOPA 1ON2A 1FWZA 3ROUA 4OMYA 4YFNF 2MLGA 3HIFA 3V8LA 1G3SA 4L9VA 4MGRA 3N4MA 5BPIA 2ZMEA 5DEQA 1BIAA 1R00A 2ZNZA 3BZ6A 1FP1D 2XAJA 5F1RA 3R61A 1W7PB 1K6OA 2K7LA 2QM3A 4HLXA 1TW2A 1B1BA 2J5PA 4A6EA 3V7RA 5J8CA 1P4AA 5FLXZ 4CGZA 3GW2A 5TJJA 4NQWA 4EGZA 4U88A 3FWEA 4ETSA 3TDUC 1O57A 1BN5A 4KNYA 1IRGA 2HKOA 1U8RA 4KIBA 1F5TA 4HQMA 3GO5A 1B9NA 4ENJA 1XB4A 1IUYA 2L02A 4AIJA 1LEBA 2PMHA 4F7ZA 4N9HA 2VC1A 3C1DA 3WE2A 3R4KA 4XSXF 3TGNA 3FMRA 2QVOA 1FNNA 2L3DA 1OPCA 3O3KA 1B6AA 2DTRA 4HZFA 4HDUA 3VFZA 1QNTA 1Z7UA 4LB5A 1I27A 2Z33A 2O3FA 1VTNC 3T5XA 3LA2A 4JK1X 1BI2A 4ENNA 3SQNA 2O61A 3ABUA 4A0XA 4Q4ZF 5KVRA 1FYLA 5CVUA 2XV4S 2PLYA 2IA2A 2QQAA 2IT0A 4EJOA 3WU1B 2R3SA 3ISPA 4G7OF 1YTYA 1D8JA 3SZPA 1W7PD 4KUMA 4P96A 4G94A 2JTVA 4G9YA 4OIPF 1U2WA 2D1HA 2NAZA 2OQRA 3OV8A 2JPBA 4MTDA 1JHHA 2L4AA 3KP4A 4PCQA 1ZARA 1EV7A 1J5YA 3DXJF 4HLYA 1L0OC 4M6YA 1CF7A 1IN5A 2ZJ2A 1MZBA 1WKMA 5EEGA 1FYMA 4RB2C 3R0AA 5D5UB 5BS6A 5L3FA 5ILSA 1K78B 2CW0F 1GVJA 2YR2A 4BYYA 1IZ1A 1UB9A 2EWNA 4HDVA 3RTRA 3Q9SA 4LB6B 2XUBA 3F3XA 5D8KB 1K7AA 4YFKF 5LRSA 3E5XA 2K4JA 5DUKA 2XKPA 2QQBA 1T98A 3EUHA 3MQ0A 2OAZA 4UVCA 4O6JA 2G9WA 3TDZC 1QO0D 4I01A 1BC7C 4OIOF 1MJ9A 3WODF 2QUFA 3PFIA 1AWCA 2STTA 3V7SA 2PQ8A 3QU6A 4M9ZA 5CVRA 3K9TA 3GUDA 3R60A 4ESBA 3B02A 5HS9A 5JI6A 4LFUA 5HDKA 1GHCA 4LGWA 1ZREA 3FF5A 3LQRA 5CLSA 2HKXA 2HYFA 1O7FA 5HOOA 1PP8F 3I59B 1CGPA 1B9MA 4U7DA 2CFXA 3M8EA 2QZ8A 3H3UA 1K79A 4EM0B 1XMAA 2EV0A 2LNBA 4HAMA 5FD6A 3WTYC 4WWCA 4K2EA 1T38A 4RAZA 4IF4A 5TRDA 5ED4A 3U9GA 4IVNA 1XSVA 1S7AA 4ZH4F 5E8IA 2HOEA 4P5OA 2FBIA 3J81Z 5CYVA 3ZMUA 2CQKA 3EYIA 1FP2A 4RB3C 1XCBA 4LG0A 4WF2A 2DFIA 1SD4A 1R22A 5DCMA 2KIUA 3P9KA 1XGMA 2P8TA 3CDHA 5E20A 1EH6A 2IP2A 2Z99A 4HX7A 4PGHA 3TOAA 2HGCA 2HS5A 4A2UA 3CUQB 2RN7A 3ZQ7A 2VXZA 3T8TA 3HHHA 4CICA 3I54A 1REPC 3ZMDA 1XMKA 6PAXA 1W7PA 4WCGA 4O5VA 1G3TA 3H92A 1MKMA 1ZG5A 1L3LA 3JSPA 2D45A 3F8CA 1BC8C 1TNTA 3HSRA 3BWGA 3I4PA 3HRSA 3FM5A 2JRTA 1BJAA 3K0LA 3RDIA 4XLPF 3J81K 2F5FA 2HFHA 1HSTA 1I1GA 2HTSA 5LGUA 3HRTA 2A68F 3FHZA 4ON0A 2OA4A 5DV5A 3FX3A 1I1SA 3N97A 2VBZA 4EJVA 3E6CC 5FFZA 2AS5F 1G3YA 1RNLA 1ZG3A 2UXXA 4UV8A 5BMZA 3F8MA 3M9AA 4BNCA 3DFGA 2V6CA 4PZJA 1EH7A 1R5HA 3P7NA 4XSZF 3GZ6A 2A3SA 3O6BB 1D3YA 2DBBA 1B4AA 2DAOA 3SZTA 1H9TA 4KT5C 5HLGA 2QYOA 2OD5A 1SFEA 3JTGA 2FQ3A 2DPDA 1ONVA 3KP6A 2XROA 1BIBA 2L01A 4AIHA 5FFXA 3GLXA 5DYMA 5D4SA 5H20A 4S05A 1OYWA 4G6QA 3ZN0A 1K78A 2R7DA 3COAC 3E6BA 1GXPA 3RYPA 4RB0A 2ELHA 1FX7A 3SFZA 2FMLA 3IKTA 1KU7A 3IHUA 1BOAA 4LD5A 1YFHA 4I0BA 2FA5A 4IXAA 4I09A 4WXHA 1OMIA 4I2OA 2YX4A 1IAWA 2H6BA 1KQ8A 2EK5A 1P6RA 1Z1DA 5ILVA 1G6NA 1E17A 2BE5F 2H09A 4A5NA 1SMYF 3E3VA 2ISZA 3K69A 2FMYA 1SD7A 1Z6RA 5LGTA 1O3SA 1QZZA 3ERED 2GXGA 5L3EA 3KEQA 4ZZLA 4DQ2A 1DPUA 4UV9A 1U3EM 2EFQA 3WTXC 2NNNA 4EJUA 3SHFA 4GO1A 2CSOA 4EVIA 3I59A 2E7XA 5HLIA 4R79A 4KIGA 3I0TA 5LHIA 1XSDA 1SD6A 4GYGA 3HUGA 4A0YA 1J2XA 1ZYRF 3MEXA 3LA3A 4Q48A 2NRAC 3LAPA 1YS7A 3DEUA 3QP6A 3WTTC 1UCRA 5E1WA 3R6SA 2HZTA 3KETA 5H6RA 3V8JA 4RGSA 3CLOA 1FC3A 4UXNA 2H27A 2F2EA 2M5WA 3GFLA 2FEZA 1USTA 1KYZA 5IT3A 3DF8A 3HSEA 3IWFA 2HYGD 3EQLF 3WGHA 3GFIA 2P6SA 2X0LA 5IT9Z 1ULYA 1XGOA 4JQFA 1MD0A 2Q2EA 2MH9A 4WXDA 5D6EA 2IA1A 2XAHA 1R23A 1JXSA 2EFOA 1SMTA 1LEAA 5FB2A 2QWWA 3F6OA 3RYRA 2M8EA 3MZHA 1F9NA 5LEKA 5BPDA 5L3CA 3CUQA 2IRFG 1QZYA 2KJBA 4CDGA 3E6MA 5H6QA 1YW8A 1TTYA 2KRFA 1ON1A 3DKWA 3RIRA 2W85A 2Y48A 4S04A 2V1UA 2MC3A 1RI7A 4ZYEA 5FLXK 3WE3A 4A12A 3KP7A 1IXRC 1R1UA 2XAFA 2ESHA 2MBFA 3AAFA 5LLQA 2IJLA 4HW0A 1RUNA 1FSEA 5L3GA 4M6XA 1W4MA 1LVAA 3MZYA 4LLGF 1DUXC 1FY7A 3RI4A 4IJAA 4D0PA 3DV8A 3E97A 2OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 K;  3R0J A;  1Z6T A;  2EV6 A;  3Q9V A;  4M9S A;  1XD7 A;  4BAY A;  2GA1 A;  2DPU A;  2Y75 A;  4CYD A;  1W5S A;  1RZ4 A;  4ASN A;  2XHK A;  2BGC A;  1P4X A;  5DD4 A;  4GGG A;  3CUQ C;  3I58 A;  2Z5U A;  4A6D A;  2MD5 A;  1Q1H A;  2ETH A;  3GVA A;  5LRR A;  4OIR F;  4P55 A;  3W6J B;  1ZHF A;  2W25 A;  2GWR A;  2P6T A;  2YU3 A;  1TW3 A;  2VBY A;  2V1X A;  5J6X A;  4BH9 A;  5E1Z B;  3V4G A;  3I64 A;  3IC7 A;  5JFR A;  3TO6 A;  5CVV A;  1YLF A;  2D1V A;  2TDX A;  3F6V A;  2FSW A;  5JR3 A;  3ZP5 A;  5D5V B;  4I0A A;  1YG2 A;  4HYE A;  5D8L B;  2K86 A;  3HRM A;  4A5M A;  4R1H A;  1HW5 A;  3L09 A;  3G3Z A;  4WX9 A;  2L4M A;  1ZH5 A;  5L3D A;  1F1Z A;  3B73 A;  1D5V A;  3O2P E;  2V79 A;  2GAU A;  5D5W B;  1YO5 C;  1J59 A;  3GF2 A;  3F21 A;  4M74 A;  1ZG1 A;  2F5C A;  1IRF A;  1O3Q A;  1FSH A;  4L9J A;  2VC0 A;  2LDU A;  3L7W A;  1MDM B;  5J8F A;  3PQK A;  4IRH A;  3BP8 A;  1BI1 A;  3DPT A;  2Q8K A;  2HQR A;  2XVC A;  1MGT A;  5A2Q Z;  3RPQ A;  4TV7 A;  1ZRD A;  2X4H A;  5K5O A;  1IW7 F;  3IKV A;  1PDN C;  1U6G A;  1T2K A;  1SFU A;  2DU9 A;  3P9C A;  2HR3 A;  2IPQ X;  2DO7 A;  1J9I A;  5E17 F;  2P4W A;  2E7W A;  2EV5 A;  4U0Y A;  1YIO A;  2XAG A;  4EJW A;  2NYX A;  1QBJ A;  1Z91 A;  3VB2 A;  2K27 A;  5LBQ A;  4N9I A;  4ENK A;  3I5U A;  1R5G A;  4RGR A;  1UFM A;  2STW A;  3U1D A;  3CTA A;  2FE3 A;  2WTE A;  3IRR A;  5F6F A;  2HQN A;  1FZP B;  4B09 A;  3KFW X;  2HEO A;  4L9N A;  2VE9 A;  4ZYH A;  4HX4 A;  4MHG A;  1G4D A;  1O7L A;  1WQ2 A;  3LFK A;  4GXO A;  2W57 A;  2VBW A;  3ELK A;  4HX8 A;  1J0R A;  3I53 A;  2VE8 A;  1R1T A;  5A2Q K;  2VOD A;  3CO7 C;  2DW4 A;  3ZMV A;  1MJA A;  2FOK A;  2ZCW A;  4KIF A;  3F23 A;  2D2W A;  1XSX A;  1FT9 A;  1TQP A;  2A5Y B;  3Q5F A;  1HSJ A;  2O0Y A;  2VON A;  1X3U A;  1B59 A;  3M8F A;  1BM9 A;  1QQI A;  3QPH A;  4B8X A;  1STZ A;  1IN4 A;  2P5K A;  4M72 A;  1E2X A;  3JTH A;  1HW2 A;  4O3M A;  4RGX A;  4ESF A;  4XLN F;  2CO5 A;  1YW7 A;  2EFN A;  4P9F A;  1KU3 A;  1WSU A;  1ODD A;  2ZKZ A;  4QLC U;  2KKO A;  1T0F A;  2RQP A;  2LKP A;  2MA3 A;  3L2C A;  1R58 A;  3K1P A;  3HOT A;  2A6H F;  5ERI A;  4BQA A;  2GQQ A;  2ESN A;  1ZLJ A;  4MEY F;  1FPQ A;  3RPU A;  3VOE A;  2YPR A;  4MEX F;  4ESJ A;  3V7C A;  1S6L A;  5KK1 A;  4L0Y B;  2KIM A;  2M1B A;  5K5R A;  5HLH A;  5E18 F;  3BRO A;  3JW4 A;  4H0E A;  2XAS A;  4BXU A;  2H94 A;  2RV8 A;  2ZBK A;  4HV6 A;  3GX4 X;  4G7H F;  2R7F A;  1J7K A;  3REO A;  2FU4 A;  5D5X B;  3FXU A;  4HQE A;  2RKH A;  2PEX A;  2VOP A;  2MLK A;  1DDN A;  2CG4 A;  1R36 A;  2DQR A;  1RUO A;  4EQQ A;  1DPR A;  3TQN A;  4U0W A;  2EFW A;  1OYY A;  2FBH A;  1BI3 A;  3KLN A;  1USS A;  3LST A;  5ICF A;  4EGY A;  1JHF A;  2EA4 A;  4ZYG A;  1XGN A;  4KFC A;  3HOS A;  1HW1 A;  2NS0 A;  2KJC A;  3V8K A;  3U2R A;  2QLZ A;  3CUO A;  4I02 A;  4P9U A;  1LDK B;  1NHA A;  5ICC A;  2LF7 A;  4Q47 A;  2G7U A;  2UXN A;  3QOP A;  2W84 A;  2ZNY A;  3WTW C;  4RS8 A;  4KA4 A;  4Y17 A;  2XRN A;  4AWX B;  2PFB A;  4EMS A;  3ZPL A;  3ECH A;  5BOX A;  1IN7 A;  4HA8 A;  1LDJ A;  1HKT A;  4OIN F;  4MTE A;  3ML6 A;  2RC4 A;  1LB2 A;  3LA7 A;  1HKQ A;  1TQM A;  2QEN A;  2Z3Y A;  3GEZ A;  2WWY A;  4RAY A;  3DQV C;  3WG9 A;  4OU0 A;  1SD5 A;  1HBX G;  2WC2 A;  1I5Z A;  1R7J A;  3MAJ A;  3KCC A;  2COM A;  1WI9 A;  3CJN A;  2RDP A;  1KQ0 A;  3BPV A;  2Q0O A;  1ZAO A;  1MDM A;  3MFK A;  1LDD A;  1ZRF A;  2K02 A;  4EJT A;  2FNA A;  3TO9 A;  1I6X A;  3MCZ A;  3K2Z A;  3ZMT A;  1BBY A;  3TKY A;  2OBP A;  4IHS A;  4UNO A;  2MH2 A;  3BPX A;  1A04 A;  1S7O A;  2ZO4 A;  2M87 A;  4PGG A;  5D6F A;  2A69 F;  2HTJ A;  4L9T A;  2O6G E;  2VN2 A;  4I7H A;  2BV6 A;  1IXS B;  2FRH A;  2FBK A;  3E5U A;  1W5T A;  3C18 A;  2ZXJ A;  1P92 A;  1BI0 A;  2UWM A;  3GWZ A;  3W6K B;  3K1M A;  4EV0 A;  1LQ1 A;  2JSC A;  2DK5 A;  1XGS A;  1PUE E;  3E6D A;  4DNC A;  4KN4 X;  3FXQ A;  4OMZ A;  3QRF F;  4N0B A;  4ENM A;  4MQ9 F;  5AON A;  4IPA A;  4E70 A;  4KDP A;  2Z9O A;  2QBY B;  1U5T B;  2L54 A;  1H0M A;  3VEP A;  2IVM A;  3FXR A;  2XAQ A;  5D4R A;  2BBY A;  1YW9 A;  3F8B A;  3SXY A;  2ISY A;  3D0S A;  2FF4 A;  2EJR A;  5CVJ A;  2GXB A;  4RB1 A;  4XRF A;  1FYK A;  3QP5 A;  4IRI A;  1YYV A;  4FX0 A;  3LAJ A;  1XN7 A;  4WK8 F;  2P7V B;  2ZFW A;  5HS8 A;  1FBS A;  2DK8 A;  1JGS A;  3QAH A;  2DQL A;  2BYV E;  2OU2 A;  1OR7 A;  2DLL A;  4YG2 F;  2UZK A;  1D8K A;  4UVB A;  1TNS A;  5HDG A;  4M73 A;  1RIO H;  2LSO A;  4CHU A;  4OOI A;  4EM1 A;  4LMY A;  3F72 A;  1KU9 A;  3F8F A;  3F22 A;  3J80 Z;  2PG4 A;  3T8R A;  1TQI A;  2WV0 A;  2JT1 A;  2G7H A;  3LWF A;  2O03 A;  2YSR A;  4HF0 A;  2VBX A;  4KIC A;  2PI0 A;  2RNJ A;  3ECO A;  2PJP A;  1FLI A;  3BY6 A;  3RKX A;  2CGP A;  2PMU A;  2ACJ A;  5LHG A;  3VOD A;  1WRJ A;  3QU3 A;  1U78 A;  4IHT A;  1LNW A;  3GYH X;  4M9X A;  4G7Z F;  1P4W A;  3ZMZ A;  5K5Q A;  1IN8 A;  5HS7 A;  3GFJ A;  5FO5 A;  4NHJ A;  3TO7 A;  3WU0 A;  4GYI A;  3BOQ A;  4G6D A;  5E1X A;  4AIK A;  4MNU A;  3BDD A;  3BJO A;  3M1E A;  4KYW A;  2PBI A;  1JE8 A;  4HV5 A;  2HDC A;  2A07 F;  3D5L A;  4KMU X;  4YII A;  4PDK A;  2ZME B;  1V4R A;  3QPT A;  3KP5 A;  3P9I A;  3H3Z A;  4L18 B;  4L5J A;  3J80 K;  1Z9C A;  3KE2 A;  4UUV A;  4YFX F;  1OKR A;  2FNP A;  4RGU A;  4AD9 A;  4KN7 X;  1QPM A;  4UHT A;  1FOK A;  3TOB A;  3KZY A;  3NEU A;  3K1N A;  2LF8 A;  2RGV A;  2GA2 A;  2YX7 A;  2XIG A;  2A6E F;  1ZGA A;  3NQO A;  3PQJ A;  2K4B A;  1QGP A;  3I71 A;  2P5L C;  4BHB A;  1KYW A;  3ABT A;  2VT3 A;  3L9F A;  3EDP A;  5FD5 A;  3L00 A;  1Z05 A;  3IWZ A;  4Y15 A;  2IW5 A;  2P7C B;  3HTU A;  5JVT A;  2QQ9 A;  1KGS A;  4AVP A;  3ZMS A;  2P5V A;  4MQV A;  5LHH A;  4ZZD A;  4L0Z B;  4LLN A;  4HF2 A;  5LEJ A;  4UVA A;  2CWE A;  2M45 A;  2OQG A;  3DPL C;  3WTS C;  3WTU C;  3HTS B;  2Y0M A;  3J7A O;  4LK1 F;  1KU2 A;  4QWQ A;  3RJP A;  2M30 A;  4I98 B;  3CO6 C;  4R8H A;  5FGM A;  3RKW A;  2EFP A;  5DCF A;  3EET A;  5DUI A;  2IA0 A;  3WTV C;  2C6Y A;  1S29 A;  4ZYD A;  1XCV A;  2V1D A;  1T6S A;  1OYI A;  4YIF A;  1S3J A;  5LGN A;  2VOO A;  4CZZ A;  3RKY A;  4KMF A;  4HOB A;  1V3F A;  5AIQ A;  3HYI A;  2VT2 A;  4G8X A;  2NNY A;  3KZZ A;  5L3B A;  4U0V A;  2V9V A;  5HVQ C;  1CF7 B;  4LLL A;  1Y0U A;  2CYY A;  2F5D A;  2AXL A;  3HSF A;  5CJ9 A;  4Z2Y A;  3JAM Z;  2EA2 A;  1GXQ A;  3FZV A;  4NB5 A;  2BEO A;  3HHG A;  3BJ6 A;  3C7J A;  1SAX A;  3C3W A;  1ZN2 A;  1IXC A;  1TBX A;  3E5Q A;  5HDN A;  4LJZ F;  3IL2 A;  3MWM A;  1UHW A;  2EB7 A;  3HRU A;  1J75 A;  1R1V A;  2QBY A;  1U5T A;  2XGX A;  4BHC A;  1HQC A;  2KIF A;  2J5O A;  4M71 A;  5ICE A;  2B0L A;  1KQ9 A;  2PN6 A;  3KLO A;  3G73 A;  4CXF A;  1WWX A;  5E8G A;  1SFX A;  3LQQ A;  2E1N A;  3BJA A;  4FX4 A;  1FBU A;  4WXC A;  2O8X A;  2OZ6 A;  5JHU A;  2H6C A;  3FM3 A;  3ZN1 A;  2GIV A;  1XDU A;  5DDG A;  1YS6 A;  4L5I A;  1ZLK A;  2DT5 A;  3EYY A;  4LK0 F;  2DI3 A;  1LJ9 A;  2E1C A;  4BHP A;  5K1Y A;  3ULQ B;  3KP3 A;  3S2W A;  5CVI A;  2XKO A;  3JAM K;  3GZ5 A;  2W24 A;  1P2F A;  4GCV A;  2RVC A;  1IF1 A;  3WTZ A;  3T1B A;  4A0Z A;  4FT8 A;  5ICG A;  3WGG A;  2F5E A;  1MJB A;  5AIP A;  1G3W A;  3NRV A;  3F8N A;  1C0W A;  1U5T C;  1O3R A;  1KA8 A;  4Q5S F;  4JBA A;  3GFM A;  1ZGJ A;  4EM2 A;  3T0Y A;  4IRG A;  3IRQ A;  1HKS A;  1S8N A;  1PP7 U;  1AOY A;  5ILU A;  2GZW A;  1T39 A;  4XBF A;  5BQT A;  3M7G A;  4Y13 A;  1FBQ A;  3JSO A;  1H9G A;  5DD8 A;  4HF1 A;  2A61 A;  2FXA A;  1DP7 P;  4FHT A;  4U7B A;  3FMS A;  3FMQ A;  1XDS A;  4CO8 A;  1HXD A;  1ZRC A;  4HBL A;  4OIQ F;  4LG0 B;  2HWV A;  2JZY A;  5EEH A;  3KEO A;  1UHM A;  1IN6 A;  3DP7 A;  3KP2 A;  3WGI A;  1TLH B;  1YQA A;  5DCM B;  5F64 A;  3GXO A;  1EH8 A;  2JPC A;  1F4K A;  1O3T A;  2ADU A;  3OOP A;  1ON2 A;  1FWZ A;  3ROU A;  4OMY A;  4YFN F;  2MLG A;  3HIF A;  3V8L A;  1G3S A;  4L9V A;  4MGR A;  3N4M A;  5BPI A;  2ZME A;  5DEQ A;  1BIA A;  1R00 A;  2ZNZ A;  3BZ6 A;  1FP1 D;  2XAJ A;  5F1R A;  3R61 A;  1W7P B;  1K6O A;  2K7L A;  2QM3 A;  4HLX A;  1TW2 A;  1B1B A;  2J5P A;  4A6E A;  3V7R A;  5J8C A;  1P4A A;  5FLX Z;  4CGZ A;  3GW2 A;  5TJJ A;  4NQW A;  4EGZ A;  4U88 A;  3FWE A;  4ETS A;  3TDU C;  1O57 A;  1BN5 A;  4KNY A;  1IRG A;  2HKO A;  1U8R A;  4KIB A;  1F5T A;  4HQM A;  3GO5 A;  1B9N A;  4ENJ A;  1XB4 A;  1IUY A;  2L02 A;  4AIJ A;  1LEB A;  2PMH A;  4F7Z A;  4N9H A;  2VC1 A;  3C1D A;  3WE2 A;  3R4K A;  4XSX F;  3TGN A;  3FMR A;  2QVO A;  1FNN A;  2L3D A;  1OPC A;  3O3K A;  1B6A A;  2DTR A;  4HZF A;  4HDU A;  3VFZ A;  1QNT A;  1Z7U A;  4LB5 A;  1I27 A;  2Z33 A;  2O3F A;  1VTN C;  3T5X A;  3LA2 A;  4JK1 X;  1BI2 A;  4ENN A;  3SQN A;  2O61 A;  3ABU A;  4A0X A;  4Q4Z F;  5KVR A;  1FYL A;  5CVU A;  2XV4 S;  2PLY A;  2IA2 A;  2QQA A;  2IT0 A;  4EJO A;  3WU1 B;  2R3S A;  3ISP A;  4G7O F;  1YTY A;  1D8J A;  3SZP A;  1W7P D;  4KUM A;  4P96 A;  4G94 A;  2JTV A;  4G9Y A;  4OIP F;  1U2W A;  2D1H A;  2NAZ A;  2OQR A;  3OV8 A;  2JPB A;  4MTD A;  1JHH A;  2L4A A;  3KP4 A;  4PCQ A;  1ZAR A;  1EV7 A;  1J5Y A;  3DXJ F;  4HLY A;  1L0O C;  4M6Y A;  1CF7 A;  1IN5 A;  2ZJ2 A;  1MZB A;  1WKM A;  5EEG A;  1FYM A;  4RB2 C;  3R0A A;  5D5U B;  5BS6 A;  5L3F A;  5ILS A;  1K78 B;  2CW0 F;  1GVJ A;  2YR2 A;  4BYY A;  1IZ1 A;  1UB9 A;  2EWN A;  4HDV A;  3RTR A;  3Q9S A;  4LB6 B;  2XUB A;  3F3X A;  5D8K B;  1K7A A;  4YFK F;  5LRS A;  3E5X A;  2K4J A;  5DUK A;  2XKP A;  2QQB A;  1T98 A;  3EUH A;  3MQ0 A;  2OAZ A;  4UVC A;  4O6J A;  2G9W A;  3TDZ C;  1QO0 D;  4I01 A;  1BC7 C;  4OIO F;  1MJ9 A;  3WOD F;  2QUF A;  3PFI A;  1AWC A;  2STT A;  3V7S A;  2PQ8 A;  3QU6 A;  4M9Z A;  5CVR A;  3K9T A;  3GUD A;  3R60 A;  4ESB A;  3B02 A;  5HS9 A;  5JI6 A;  4LFU A;  5HDK A;  1GHC A;  4LGW A;  1ZRE A;  3FF5 A;  3LQR A;  5CLS A;  2HKX A;  2HYF A;  1O7F A;  5HOO A;  1PP8 F;  3I59 B;  1CGP A;  1B9M A;  4U7D A;  2CFX A;  3M8E A;  2QZ8 A;  3H3U A;  1K79 A;  4EM0 B;  1XMA A;  2EV0 A;  2LNB A;  4HAM A;  5FD6 A;  3WTY C;  4WWC A;  4K2E A;  1T38 A;  4RAZ A;  4IF4 A;  5TRD A;  5ED4 A;  3U9G A;  4IVN A;  1XSV A;  1S7A A;  4ZH4 F;  5E8I A;  2HOE A;  4P5O A;  2FBI A;  3J81 Z;  5CYV A;  3ZMU A;  2CQK A;  3EYI A;  1FP2 A;  4RB3 C;  1XCB A;  4LG0 A;  4WF2 A;  2DFI A;  1SD4 A;  1R22 A;  5DCM A;  2KIU A;  3P9K A;  1XGM A;  2P8T A;  3CDH A;  5E20 A;  1EH6 A;  2IP2 A;  2Z99 A;  4HX7 A;  4PGH A;  3TOA A;  2HGC A;  2HS5 A;  4A2U A;  3CUQ B;  2RN7 A;  3ZQ7 A;  2VXZ A;  3T8T A;  3HHH A;  4CIC A;  3I54 A;  1REP C;  3ZMD A;  1XMK A;  6PAX A;  1W7P A;  4WCG A;  4O5V A;  1G3T A;  3H92 A;  1MKM A;  1ZG5 A;  1L3L A;  3JSP A;  2D45 A;  3F8C A;  1BC8 C;  1TNT A;  3HSR A;  3BWG A;  3I4P A;  3HRS A;  3FM5 A;  2JRT A;  1BJA A;  3K0L A;  3RDI A;  4XLP F;  3J81 K;  2F5F A;  2HFH A;  1HST A;  1I1G A;  2HTS A;  5LGU A;  3HRT A;  2A68 F;  3FHZ A;  4ON0 A;  2OA4 A;  5DV5 A;  3FX3 A;  1I1S A;  3N97 A;  2VBZ A;  4EJV A;  3E6C C;  5FFZ A;  2AS5 F;  1G3Y A;  1RNL A;  1ZG3 A;  2UXX A;  4UV8 A;  5BMZ A;  3F8M A;  3M9A A;  4BNC A;  3DFG A;  2V6C A;  4PZJ A;  1EH7 A;  1R5H A;  3P7N A;  4XSZ F;  3GZ6 A;  2A3S A;  3O6B B;  1D3Y A;  2DBB A;  1B4A A;  2DAO A;  3SZT A;  1H9T A;  4KT5 C;  5HLG A;  2QYO A;  2OD5 A;  1SFE A;  3JTG A;  2FQ3 A;  2DPD A;  1ONV A;  3KP6 A;  2XRO A;  1BIB A;  2L01 A;  4AIH A;  5FFX A;  3GLX A;  5DYM A;  5D4S A;  5H20 A;  4S05 A;  1OYW A;  4G6Q A;  3ZN0 A;  1K78 A;  2R7D A;  3COA C;  3E6B A;  1GXP A;  3RYP A;  4RB0 A;  2ELH A;  1FX7 A;  3SFZ A;  2FML A;  3IKT A;  1KU7 A;  3IHU A;  1BOA A;  4LD5 A;  1YFH A;  4I0B A;  2FA5 A;  4IXA A;  4I09 A;  4WXH A;  1OMI A;  4I2O A;  2YX4 A;  1IAW A;  2H6B A;  1KQ8 A;  2EK5 A;  1P6R A;  1Z1D A;  5ILV A;  1G6N A;  1E17 A;  2BE5 F;  2H09 A;  4A5N A;  1SMY F;  3E3V A;  2ISZ A;  3K69 A;  2FMY A;  1SD7 A;  1Z6R A;  5LGT A;  1O3S A;  1QZZ A;  3ERE D;  2GXG A;  5L3E A;  3KEQ A;  4ZZL A;  4DQ2 A;  1DPU A;  4UV9 A;  1U3E M;  2EFQ A;  3WTX C;  2NNN A;  4EJU A;  3SHF A;  4GO1 A;  2CSO A;  4EVI A;  3I59 A;  2E7X A;  5HLI A;  4R79 A;  4KIG A;  3I0T A;  5LHI A;  1XSD A;  1SD6 A;  4GYG A;  3HUG A;  4A0Y A;  1J2X A;  1ZYR F;  3MEX A;  3LA3 A;  4Q48 A;  2NRA C;  3LAP A;  1YS7 A;  3DEU A;  3QP6 A;  3WTT C;  1UCR A;  5E1W A;  3R6S A;  2HZT A;  3KET A;  5H6R A;  3V8J A;  4RGS A;  3CLO A;  1FC3 A;  4UXN A;  2H27 A;  2F2E A;  2M5W A;  3GFL A;  2FEZ A;  1UST A;  1KYZ A;  5IT3 A;  3DF8 A;  3HSE A;  3IWF A;  2HYG D;  3EQL F;  3WGH A;  3GFI A;  2P6S A;  2X0L A;  5IT9 Z;  1ULY A;  1XGO A;  4JQF A;  1MD0 A;  2Q2E A;  2MH9 A;  4WXD A;  5D6E A;  2IA1 A;  2XAH A;  1R23 A;  1JXS A;  2EFO A;  1SMT A;  1LEA A;  5FB2 A;  2QWW A;  3F6O A;  3RYR A;  2M8E A;  3MZH A;  1F9N A;  5LEK A;  5BPD A;  5L3C A;  3CUQ A;  2IRF G;  1QZY A;  2KJB A;  4CDG A;  3E6M A;  5H6Q A;  1YW8 A;  1TTY A;  2KRF A;  1ON1 A;  3DKW A;  3RIR A;  2W85 A;  2Y48 A;  4S04 A;  2V1U A;  2MC3 A;  1RI7 A;  4ZYE A;  5FLX K;  3WE3 A;  4A12 A;  3KP7 A;  1IXR C;  1R1U A;  2XAF A;  2ESH A;  2MBF A;  3AAF A;  5LLQ A;  2IJL A;  4HW0 A;  1RUN A;  1FSE A;  5L3G A;  4M6X A;  1W4M A;  1LVA A;  3MZY A;  4LLG F;  1DUX C;  1FY7 A;  3RI4 A;  4IJA A;  4D0P A;  3DV8 A;  3E97 A;  2OZU A; 
#chains in the Genus database with same CATH topology
 5IT9 K;  1P7J A;  3R0J A;  1Z6T A;  2EV6 A;  3Q9V A;  4BGD A;  3S16 J;  4M9S A;  4BQO A;  1XD7 A;  4BAY A;  2HU9 A;  2GA1 A;  4E4H A;  2DPU A;  2Y75 A;  3S2D J;  4CYD A;  1W5S A;  1RZ4 A;  2W1O A;  2VI6 A;  2XHK A;  2BGC A;  4ASN A;  4JX5 A;  2HOT A;  1P4X A;  2R7U A;  5DD4 A;  4GGG A;  3CUQ C;  4RDU A;  3MZ8 A;  5JLW A;  3I58 A;  2Z5U A;  3DWL E;  4A6D A;  3IP4 B;  2WAE A;  2MD5 A;  2KFD A;  1Q1H A;  4YRV A;  3OYJ A;  2M7B A;  2ETH A;  1MH4 A;  2JUC A;  3GVA A;  5LRR A;  1G2H A;  3GTO J;  1X1C A;  4OIR F;  4OWR B;  4P55 A;  2DYS H;  3W6J B;  1ZHF A;  2M4K A;  2W25 A;  1QPI A;  2GWR A;  2P6T A;  2YU3 A;  1TW3 A;  1FMW A;  1E3H A;  2VBY A;  4PUS A;  2VKV A;  1H89 C;  1MSE C;  2L7Z A;  2V1X A;  3BR1 A;  4IKF A;  5J6X A;  4BH9 A;  1GT0 C;  2HPM A;  2DFE A;  3HEF A;  3QPL A;  4DZP A;  3HPH A;  2DT6 A;  5E1Z B;  1BL0 A;  3Q3S A;  3OOU A;  3CJT B;  3V4G A;  3I64 A;  1D0X A;  3IC7 A;  4D7M A;  5JFR A;  2X1E A;  3TO6 A;  5CVV A;  1YLF A;  2D1V A;  2TDX A;  2E1M C;  4D9J A;  3F6V A;  2FSW A;  4PFP A;  5JR3 A;  2XSD C;  3BG5 A;  3QYB A;  2LKS A;  1D0Z A;  3ZP5 A;  2Y9Z A;  5D5V B;  4I0A A;  5CQE A;  4FE4 A;  1YG2 A;  2E19 A;  2B7E A;  3U21 A;  4HYE A;  5D8L B;  2K86 A;  2KZG A;  2BVM A;  3HRM A;  3HZJ A;  4A5M A;  4R1H A;  1HW5 A;  2BW3 A;  3L09 A;  3G3Z A;  3AG1 H;  5EZG A;  4WX9 A;  4V2F A;  5IYD J;  2L4M A;  3LSR A;  3UNG C;  1ZH5 A;  5L3D A;  1F1Z A;  3B73 A;  1D5V A;  4XMY A;  2CMP A;  1Y6I A;  3O2P E;  3LNQ A;  2V79 A;  2V7F A;  2GAU A;  3FBN B;  5D5W B;  1YO5 C;  2PMZ N;  2QGU A;  1J59 A;  2HQA A;  3GF2 A;  3F21 A;  4M74 A;  3U1K A;  4BJT A;  2LY9 A;  4BDZ A;  1ZG1 A;  3JRH A;  4CH7 A;  2F5C A;  1IRF A;  1O3Q A;  1FSH A;  1D1B A;  4L9J A;  2VC0 A;  4BE2 A;  4PJL A;  2LDU A;  3L7W A;  3GLL A;  1MDM B;  5J8F A;  3DCF A;  2JMW A;  3PQK A;  4IRH A;  3I4N J;  3BP8 A;  3HDD A;  1BI1 A;  3RSN A;  4L5E A;  2E36 A;  3S93 A;  3DPT A;  2NVX J;  2Q8K A;  3FDY A;  2EIN H;  2HQR A;  2XVC A;  1MBK A;  1MGT A;  5A2Q Z;  1TC3 C;  4RM3 A;  4DBR A;  5E3M A;  3RPQ A;  2ECC A;  1X4O A;  4EAT A;  4BS9 A;  2DOE A;  3W6V A;  1ETX A;  1Z21 A;  4HST A;  1GUU A;  3BR3 A;  4TV7 A;  1VQ4 I;  1ZRD A;  2X4H A;  5K5O A;  4BY7 J;  1PJR A;  1IW7 F;  1FOX A;  2I5U A;  3IKV A;  1PDN C;  1U6G A;  2E60 A;  4QSH A;  1T2K A;  4XOR A;  1SFU A;  1IG7 A;  2DU9 A;  2QSG X;  3PO2 J;  3P9C A;  2HR3 A;  3RCO A;  2IPQ X;  2DO7 A;  2NS8 A;  3OS2 A;  1J9I A;  4UB6 C;  3M1C A;  4CCO A;  3TBI A;  5E17 F;  2P4W A;  3IV5 A;  1EJ9 A;  2QA4 I;  2E7W A;  2EV5 A;  2VQG A;  2YU9 J;  2CS3 A;  4U0Y A;  1YIO A;  2L9V A;  2XAG A;  4EJW A;  1QU3 A;  4DZJ A;  2NYX A;  1QBJ A;  1Z91 A;  3VB2 A;  2K27 A;  5LBQ A;  4N9I A;  3RQI A;  4ENK A;  3I5U A;  3BQY A;  2R5Z B;  4IHV A;  2OC6 A;  2M34 A;  1R5G A;  5DTD A;  4B3A A;  4RGR A;  5TIS C;  2Z1D A;  3JRE A;  1UFM A;  4BDY A;  1JUP A;  2CV2 A;  2STW A;  3U1D A;  2CW7 A;  3CTA A;  3IH2 A;  2FE3 A;  5M5Y J;  3K10 A;  4DBQ A;  3MMY B;  3PUF A;  2IGN A;  3GTJ J;  2WTE A;  3IRR A;  1D1C A;  2CUE A;  5F6F A;  5BNG A;  2HQN A;  1R4M B;  2HXO A;  2MC4 A;  2F6C A;  1XMX A;  1PUF B;  1FZP B;  4B09 A;  4YIR X;  4E7I A;  1YJ9 I;  3KFW X;  5FKL A;  1QA6 A;  2HEO A;  2R7O A;  3H35 A;  4L9N A;  3SDB A;  2HDD A;  3VPR A;  3CP8 A;  1VZ0 A;  1Y8Q B;  2VE9 A;  4ZYH A;  3ZQC A;  4HX4 A;  2HZD A;  2O7O A;  4MHG A;  1YX5 A;  3Q0U A;  2UV1 A;  1G4D A;  1O7L A;  2OUM A;  4BE0 A;  3A1Y A;  1WQ2 A;  3LFK A;  2LOO A;  2W57 A;  4GXO A;  2VBW A;  3ELK A;  4HX8 A;  4CYC B;  2NVU B;  4II2 A;  1J0R A;  1JJ8 C;  2WAD A;  3I53 A;  2VE8 A;  4XON A;  1R1T A;  2HVQ A;  5A2Q K;  2VOD A;  3CO7 C;  2DW4 A;  3S1R J;  1YE9 A;  2XB5 A;  3ZMV A;  3HL2 A;  1MJA A;  3FXJ A;  2FOK A;  2ZCW A;  4KIF A;  2MG4 A;  3F23 A;  4HNU A;  2R93 J;  3FKI J;  2D2W A;  1XSX A;  2DA6 A;  2CH0 A;  1MIJ A;  1FT9 A;  1HCR A;  1TQP A;  1IRZ A;  2A5Y B;  3Q5F A;  1HSJ A;  1KZH A;  2O0Y A;  2VON A;  1X3U A;  1B59 A;  2DT7 B;  2HI3 A;  2KZV A;  1HC8 A;  3M8F A;  1BM9 A;  1QQI A;  3QPH A;  1T8I A;  4B8X A;  2E1O A;  1ENH A;  1STZ A;  1MBJ A;  1IN4 A;  2P5K A;  4M72 A;  4XID A;  3HJE A;  1E2X A;  3BR0 A;  3ZQG A;  2KRC A;  3JTH A;  4ZYA A;  1HW2 A;  4O3M A;  4RGX A;  2KDZ A;  4ESF A;  5J1R A;  2K3F A;  1XPX A;  3FXO A;  4XLN F;  4M3B A;  3E7L A;  4BXF A;  2CO5 A;  1YW7 A;  3BG9 A;  3HOV J;  2EFN A;  2WB1 A;  4P9F A;  5CPR B;  1KU3 A;  1WSU A;  1ODD A;  2ZKZ A;  5LFA A;  4QLC U;  1Z0X A;  2KKO A;  2DOD A;  1T0F A;  2RQP A;  2IBD A;  3D5R C;  3FHN A;  2LKP A;  2MA3 A;  3L2C A;  4NDL A;  1R58 A;  3K1P A;  3HOT A;  1IJW C;  2A6H F;  5ERI A;  3DPU A;  2WY8 Q;  4BQA A;  1Y56 A;  1V5G A;  2GQQ A;  2E5Z A;  3L2W A;  1S9H A;  2ESN A;  3ESW B;  4IHW A;  1ZLJ A;  4MEY F;  1FPQ A;  3ASO H;  5EJC A;  3RZO J;  3RPU A;  3CC7 I;  1BJZ A;  4DW6 A;  3VOE A;  1SVO A;  3HKZ N;  3CLQ A;  3VYS B;  2YPR A;  1TP4 A;  2Z2S B;  2M8G X;  4MEX F;  4ESJ A;  3V7C A;  1S6L A;  2LD5 A;  1AU7 A;  2DFH A;  3WHC A;  5KK1 A;  5DS9 A;  4L0Y B;  5C4X J;  3A02 A;  3BT9 A;  2PX9 A;  2KIM A;  2M1B A;  5K5R A;  1W36 C;  5HLH A;  5E18 F;  2I8D A;  1JKO C;  1YJN I;  4PJN A;  4AU7 A;  3P5J A;  3BRO A;  1G8X A;  3JW4 A;  4H0E A;  3AL0 C;  2K9M A;  2XAS A;  1SAU A;  4BXU A;  2H94 A;  4FQG A;  3AG4 H;  3HC7 A;  2RV8 A;  2KPM A;  4IOA F;  2ZBK A;  4HV6 A;  2H1K A;  3GX4 X;  4G7H F;  2R7F A;  1J7K A;  3REO A;  3SJM A;  1DP3 A;  4E7K A;  2FU4 A;  1MNE A;  2B63 J;  5D5X B;  4BJ6 C;  1E3O C;  3A4C A;  5GAE J;  3FXU A;  3S17 J;  4HQE A;  3FXL A;  3CMY A;  1ZEL A;  2RKH A;  3SDG A;  2PEX A;  2VOP A;  2MLK A;  1DDN A;  2CG4 A;  1R36 A;  4ZC3 A;  2DQR A;  3DBH B;  1G59 A;  2ME0 A;  2XGD A;  4M3E A;  1RUO A;  3BTI A;  4EQQ A;  2IS1 A;  1DPR A;  4B44 A;  3TQN A;  4U0W A;  1T0F C;  3G4S I;  2A6T A;  2EFW A;  1OYY A;  2FBH A;  3KZI C;  2WAQ N;  2RAE A;  4XLC A;  4AID A;  2RNG A;  5C4J J;  2QSH X;  1BI3 A;  1RES A;  2M0C A;  3KLN A;  4E7S A;  2QF7 A;  2P0W A;  1USS A;  3BG7 A;  2TRT A;  3LST A;  5ICF A;  4EGY A;  1JHF A;  2DMU A;  2EA4 A;  5CQG A;  4LG3 A;  3OYC A;  4ZYG A;  1XGN A;  4KFC A;  3HOS A;  5JHF A;  1E0E A;  1HW1 A;  2NS0 A;  4RLQ A;  2DN0 A;  2KJC A;  3V8K A;  3QWL A;  4F3Q A;  3U2R A;  4JP0 A;  2VQC A;  2GBY A;  2QLZ A;  3CUO A;  3OSF A;  4I02 A;  1UHS A;  1X4P A;  4A3B J;  1DQU A;  3JRD A;  4P9U A;  1LDK B;  4D7N A;  1NHA A;  5ICC A;  2LF7 A;  4Q47 A;  1EA3 A;  2LFB A;  2G7U A;  2UXN A;  1SEU A;  2CQQ A;  3QOP A;  2EIK H;  1JGG A;  4XOP A;  2W84 A;  4YEL A;  2ZNY A;  3WTW C;  2M7A A;  5DM6 F;  3I9V 2;  3QYE A;  4RS8 A;  2DA4 A;  3DBL B;  1PVE A;  2OCC H;  1IRX A;  4KA4 A;  4Y17 A;  2XRN A;  4AWX B;  2L0K A;  2PFB A;  4EMS A;  3ZPL A;  3ECH A;  5BOX A;  1IN7 A;  1FEX A;  4HA8 A;  1QVU A;  3B6A A;  1LDJ A;  2JA8 J;  2VAS A;  1Z3Y A;  4BBR J;  5KHD A;  1HKT A;  4PSW A;  4OIN F;  3CMM A;  2FUG 2;  1WH7 A;  4LOC A;  4MTE A;  1SAN A;  5KNL A;  3ML6 A;  4RMN A;  1FOY A;  2RC4 A;  1LB2 A;  3K70 D;  2E35 A;  3RZD J;  3LA7 A;  1D0Y A;  3FBI B;  1HKQ A;  3A0B C;  2V9P A;  5IP7 J;  2COB A;  1NTC A;  1TQM A;  2KDO A;  2QEN A;  2VJI A;  2F5V A;  2ELJ A;  2WY7 Q;  2Z3Y A;  3GEZ A;  5IYC J;  3A01 B;  2WWY A;  4RAY A;  3C2G A;  3DQV C;  3WG9 A;  1N77 A;  1X1P A;  1SD5 A;  4OU0 A;  1HBX G;  2WC2 A;  3OWT A;  4IHY A;  1I5Z A;  1R7J A;  3LSG A;  1T56 A;  3MAJ A;  4AC0 A;  3JRC A;  2QQ8 A;  3KCC A;  2JA2 A;  2COM A;  1WI9 A;  2E2J J;  3CME I;  4NNJ A;  2BY3 A;  2MAB A;  2HXI A;  3CJN A;  2RDP A;  1KQ0 A;  2E2H J;  3BPV A;  2Q0O A;  4BEH B;  3F0C A;  4CSW A;  1ZAO A;  1MDM A;  1AHD P;  3MFK A;  1LDD A;  1ZRF A;  2K02 A;  1GVD A;  4EJT A;  1D5Y A;  2FNA A;  3OYM A;  3TO9 A;  2HVS A;  1I6X A;  3MCZ A;  3K2Z A;  3ZMT A;  1BBY A;  1VQ6 I;  1ZKG A;  3VYU B;  3TKY A;  2OBP A;  4IHS A;  4UNO A;  3PSI A;  1N78 A;  1OJL A;  2MH2 A;  3BPX A;  1A04 A;  5F0H A;  3WG7 H;  1S7O A;  5B3S H;  4XK4 A;  2ZO4 A;  5J1U A;  2AO9 A;  4QIW N;  2M87 A;  4PGG A;  1UAA A;  5D6F A;  2A69 F;  1QVT A;  2HTJ A;  2LVS A;  4L9T A;  5LD2 C;  2O6G E;  2LTP A;  2VN2 A;  4I7H A;  2BV6 A;  4FAS D;  3VYR B;  1IXS B;  2FRH A;  2FBK A;  5GTI C;  3E5U A;  4A3D J;  1W5T A;  3OYB A;  1V5E A;  4BJ5 C;  3C18 A;  2ZXJ A;  3S2H J;  1P92 A;  1BI0 A;  2UWM A;  2JUG A;  3GWZ A;  5FKO A;  3W6K B;  3K1M A;  4EV0 A;  2NS7 A;  5IY5 H;  1LQ1 A;  1TWH J;  2JSC A;  3VWB A;  2FOW A;  4A3M J;  1ACI A;  1XS9 A;  2ICW G;  2ID3 A;  4RLF A;  2DK5 A;  4LIV A;  1XGS A;  1PUE E;  3E6D A;  2KMU A;  2R5Z A;  4DNC A;  4KN4 X;  3FXQ A;  4OMZ A;  3QRF F;  2LC2 A;  4N0B A;  4ENM A;  4MQ9 F;  1S5L C;  4RAG A;  5AON A;  1U9N A;  4IPA A;  4E70 A;  4KDP A;  4GDF A;  2Z9O A;  2LBF B;  2QBY B;  1U5T B;  2Y2Z A;  1JTY A;  2L54 A;  1H0M A;  3VEP A;  3M3Y J;  2IVM A;  3FXR A;  2XAQ A;  5D4R A;  2BBY A;  2WAF A;  1YW9 A;  3F8B A;  3SXY A;  2ZJP F;  2ZC2 A;  2ISY A;  3SFI A;  1PUF A;  3D0S A;  2FF4 A;  2Y69 H;  4MIM A;  3VSL A;  3ZRG A;  1IC8 A;  1GV2 A;  2LMD A;  2O8K A;  2EJR A;  5CVJ A;  3FXM A;  2GXB A;  4RB1 A;  4XRF A;  1FYK A;  3HGY A;  1JUS A;  3QP5 A;  4IRI A;  2NVQ J;  5GTH C;  3GTM J;  1YYV A;  4FX0 A;  3LAJ A;  1MMS A;  3PNT A;  1XN7 A;  3NWS A;  4WK8 F;  2P7V B;  2ZFW A;  5HS8 A;  1FBS A;  2YUS A;  3M4O J;  5FKK A;  3GTL J;  3VDX A;  4CYC A;  2DK8 A;  2L5Q A;  5EG0 B;  2IEK A;  2QCO A;  2IGM A;  1JGS A;  2XF6 A;  3QAH A;  1I3A A;  2DQL A;  3JR9 A;  2XF5 A;  2BYV E;  2OU2 A;  1OR7 A;  2DLL A;  2HDW A;  4YG2 F;  1NG6 A;  2UZK A;  1D8K A;  4UVB A;  1TNS A;  2ELK A;  1BOB A;  5EF6 A;  5HNF A;  2OJE D;  5HDG A;  4KIS A;  4M73 A;  1RIO H;  1VF9 A;  2LSO A;  4CHU A;  4OOI A;  4EM1 A;  2HPI A;  4FCY A;  4LMY A;  3ZQI A;  2VJJ A;  1LKX A;  4IX7 A;  3OYK A;  3H0G J;  3F72 A;  2MFZ A;  1R9T J;  2DJI A;  1KU9 A;  4QPO A;  3F8F A;  3F22 A;  4RBO A;  3J80 Z;  3G6E I;  2PG4 A;  3T8R A;  1TQI A;  4ZDP A;  2WV0 A;  3OYG A;  4A69 C;  4DOZ A;  2JT1 A;  2G7H A;  4PJ0 C;  3LWF A;  2O03 A;  2YSR A;  4HF0 A;  1P9Q C;  2VBX A;  2ZFU A;  3HBL A;  4KIC A;  3ZQF A;  4M3D A;  3IH4 A;  2DMT A;  2PI0 A;  2RNJ A;  3ECO A;  3G1L A;  2PJP A;  1FLI A;  2X48 A;  3BY6 A;  3K4B A;  4CUG A;  3RKX A;  2CGP A;  1UEL B;  2PMU A;  1PYV A;  5LHG A;  2ACJ A;  3VOD A;  1WRJ A;  3QU3 A;  3PIP F;  1TZL A;  1Z67 A;  1U78 A;  1XX5 A;  2DXI A;  2PMZ A;  4IHT A;  1LNW A;  3QOD A;  3GYH X;  2JSP A;  3DKY A;  2Y31 A;  4M9X A;  3PFY A;  4CCN A;  2DFF A;  4D5C A;  4G7Z F;  2K9S A;  1GV5 A;  1P4W A;  3BG6 A;  3ZMZ A;  4FE7 A;  4E6K G;  3L2R A;  3IAM 2;  3QQA A;  2YS9 A;  4I6Z A;  3H36 A;  2NVY J;  3PM1 A;  1MMG A;  3BTC A;  5K5Q A;  1IN8 A;  2K9Q A;  5HS7 A;  3GFJ A;  2ZXH A;  4C3J J;  5FO5 A;  5J3L A;  4NHJ A;  3FXK A;  3TO7 A;  3DEW A;  3WU0 A;  4BQN A;  1OR7 C;  3UR3 C;  4BQQ A;  1OCT C;  4GYI A;  3BOQ A;  3HOY J;  3EUA A;  4G6D A;  4MLO A;  1JKQ C;  2JA5 J;  5E1X A;  4AIK A;  3ABK H;  2VL8 A;  2LR8 A;  3HB9 A;  4BL0 B;  5E3N A;  4MNU A;  3BDD A;  3ZR8 X;  3A2K A;  3BJO A;  4A3F J;  1Y8R B;  3M1E A;  4KYW A;  2PBI A;  1JE8 A;  4HV5 A;  2CV1 A;  2KHM A;  3QOE A;  2V6E A;  2HDC A;  2A07 F;  3D5L A;  2R7Q A;  4KMU X;  4YII A;  4PDK A;  1IO2 A;  2KLO A;  2KP6 A;  2ZME B;  2JA7 J;  3AG2 H;  2LH9 A;  1V4R A;  3QPT A;  3KP5 A;  3P9I A;  3H3Z A;  1FIA A;  1M1E B;  1DGR M;  4L18 B;  4L5J A;  3J80 K;  5E79 C;  1Z9C A;  1VND A;  3KE2 A;  4UUV A;  4YFX F;  1OKR A;  2FNP A;  4RGU A;  4AD9 A;  4KN7 X;  1QPM A;  4UHT A;  1FOK A;  2X6O A;  1R6R A;  3TOB A;  3TP0 A;  2LP0 A;  2MD0 A;  3KZY A;  2R4G A;  3NEU A;  3K1N A;  2LF8 A;  2RGV A;  2GA2 A;  2H8W A;  3OS1 A;  2YX7 A;  2XIG A;  2A6E F;  1ZGA A;  3DTK A;  3LSI A;  3NQO A;  3PQJ A;  2K4B A;  1QGP A;  2DOF A;  3WU2 C;  1AKH B;  1IV8 A;  4Y52 J;  3I71 A;  2R7W A;  3BTJ A;  3OYN A;  4NQW B;  2P5L C;  4BHB A;  3S3N A;  1K6Y A;  1KYW A;  3ABT A;  2VT3 A;  2EZH A;  2EIM H;  3S32 A;  2KIQ A;  3NWT A;  3L9F A;  3EDP A;  3PNY A;  5FD5 A;  3CMA I;  1V5F A;  2LYC A;  1Z05 A;  2W00 A;  3CCY A;  3IWZ A;  3L00 A;  4Y15 A;  2IW5 A;  2GLO A;  4MFE A;  4ZDL A;  2P7C B;  3HTU A;  4C3I J;  1OCR H;  5JVT A;  2QQ9 A;  1KGS A;  4AVP A;  4MO7 A;  1SC7 A;  3ZMS A;  3K70 C;  2P5V A;  3CCE I;  4MQV A;  1A35 A;  4V19 K;  5LHH A;  4ZZD A;  3DLA A;  4L0Z B;  4LLN A;  5TGT A;  4HF2 A;  3BLY A;  5LEJ A;  1VQO I;  2TCT A;  1V54 H;  3DU6 A;  2NXN B;  3GTG J;  4UVA A;  2LY1 A;  2CWE A;  2M45 A;  2OQG A;  3H5R A;  2ID6 A;  2X85 A;  3TP3 A;  3DPL C;  5GAD J;  1X3Z B;  3WTS C;  3WTU C;  5H2F C;  3HTS B;  2Y0M A;  5FJ8 J;  3J7A O;  2CV0 A;  1HOM A;  4LK1 F;  1KU2 A;  3PL8 A;  2CJJ A;  4QWQ A;  2ZJQ F;  5FLV A;  1POG A;  3RJP A;  5FLM J;  2M30 A;  1FOW A;  4I98 B;  3CO6 C;  4R8H A;  3K2A A;  5FGM A;  3H9Q A;  3RKW A;  1B72 B;  2EFP A;  5DCF A;  3S3O A;  4XIC A;  3MN2 A;  3EET A;  5DUI A;  2IA0 A;  3WTV C;  3A01 A;  2C6Y A;  2V1N A;  3N05 A;  1MBG A;  1S29 A;  4ZYD A;  3G71 I;  1XCV A;  2V1D A;  1T6S A;  1OYI A;  2UUZ A;  3G2B A;  3BTL A;  2DDB A;  4A3C J;  1ZGW A;  4YIF A;  4BEH A;  4NUB A;  3I4M J;  2KRH A;  1S3J A;  1VFC A;  2OCE A;  3JCU C;  5LGN A;  2VOO A;  3OYF A;  1ERD A;  2IGK A;  3X2Q H;  4CZZ A;  3GBG A;  3RKY A;  2DJN A;  5F0C A;  3WHB A;  4KMF A;  4HOB A;  1V3F A;  4B48 A;  3OIP A;  3ONQ A;  4NC8 A;  5AIQ A;  3HYI A;  4XR6 A;  2VT2 A;  3HKZ A;  4G8X A;  2NNY A;  3KZZ A;  3RKQ A;  2FX0 A;  2XB0 X;  4B4C A;  4XRM A;  4ZJZ A;  3CCJ I;  5F0F A;  5L3B A;  4U0V A;  2V9V A;  5HVQ C;  2BY1 A;  3KYL A;  1CF7 B;  4LLL A;  1Y0U A;  2CYY A;  2F5D A;  3C2H A;  2CW8 A;  2AXL A;  3HSF A;  4UY8 I;  4NC7 A;  5CJ9 A;  2W4S A;  4Z2Y A;  3JAM Z;  4MFD A;  4C30 A;  5JLX A;  2EA2 A;  3LSK A;  1GXQ A;  3FZV A;  4NB5 A;  5FKN A;  2BEO A;  4AYB A;  2PJR B;  3HHG A;  4F92 B;  2ZB9 A;  5DM7 F;  3BJ6 A;  3C7J A;  1SAX A;  3C3W A;  3ZCO A;  1ZN2 A;  1IXC A;  3TED A;  2XPV A;  2BHY A;  3E1S A;  1TBX A;  3E5Q A;  1JKP C;  5HDN A;  3ZQQ A;  4PFO A;  1VQN I;  3ZQL A;  3CCM I;  4LJZ F;  3IL2 A;  4J19 A;  3MWM A;  4X1E A;  2LBF A;  1UHW A;  2EB7 A;  3HRU A;  1J75 A;  1R1V A;  2QBY A;  1U5T A;  2XGX A;  3OYI A;  4BHC A;  4JOM A;  3ASN H;  2L9R A;  1HQC A;  2KIF A;  2M9H A;  5K7F A;  2J5O A;  4M71 A;  1MMA A;  2KT0 A;  2WAQ A;  4ANJ A;  2OPT A;  5ICE A;  2B0L A;  2DA1 A;  1KQ9 A;  4DGW B;  2PN6 A;  3KLO A;  3G73 A;  3I56 I;  4CXF A;  2RRE A;  1WWX A;  5E8G A;  1SFX A;  3LQQ A;  5EYR A;  2VKD A;  2E1N A;  3BJA A;  3F9K A;  4FET A;  4FX4 A;  3CC2 I;  1FBU A;  1BA5 A;  5EG0 A;  4WXC A;  4BXX J;  2O8X A;  2OZ6 A;  3BZK A;  5JHU A;  2H6C A;  3FM3 A;  2BVL A;  3ZN1 A;  2GIV A;  1XDU A;  5DDG A;  1YS6 A;  3TL4 X;  1A31 A;  2M4G A;  4L5I A;  3CES A;  2DT5 A;  1ZLK A;  3EYY A;  3MD2 A;  5M5W J;  2LRE A;  4LK0 F;  3CCS I;  2DI3 A;  1LJ9 A;  2E1C A;  1ETW A;  3H5A A;  2HQ5 A;  4BHP A;  1K83 J;  5K1Y A;  1S7E A;  3ULQ B;  2WB1 N;  3KP3 A;  3S2W A;  3SYT A;  5CVI A;  2XKO A;  3JAM K;  3GZ5 A;  1LFU P;  2W24 A;  1P2F A;  4GCV A;  2DYR H;  2RVC A;  1IF1 A;  3BCA A;  3WTZ A;  1QHG A;  2AQF A;  3T1B A;  4A0Z A;  4FT8 A;  5ICG A;  3WGG A;  2F5E A;  5J4V A;  4AM3 A;  1MJB A;  5AIP A;  1G3W A;  2R7S A;  3NRV A;  3F8N A;  1C0W A;  1U5T C;  1O3R A;  3OR2 C;  1O4X A;  2IS6 A;  1R49 A;  1B8I B;  1KA8 A;  4Q5S F;  4JBA A;  1Z77 A;  4F52 A;  3GFM A;  2VUM J;  2X6W A;  1JUM A;  1ZGJ A;  2OTJ I;  4EM2 A;  3T0Y A;  4IRG A;  1IDZ A;  3IRQ A;  1HKS A;  1S8N A;  2R5Y B;  1PP7 U;  1ZQ3 P;  1AOY A;  5ILU A;  2GZW A;  3J7A Y;  1T39 A;  1MBE A;  1HF0 A;  5K7H A;  4XBF A;  5BQT A;  3M7G A;  4Y13 A;  1FBQ A;  1Q1V A;  2DA3 A;  3JSO A;  1H9G A;  5DD8 A;  4HF1 A;  1HA8 A;  4AUX A;  1I50 J;  2A61 A;  4PJJ A;  2FXA A;  3SZG A;  1DP7 P;  4FHT A;  2OV7 A;  4P1W A;  1U0J A;  5EEA A;  4U7B A;  3FMS A;  2E34 A;  3FMQ A;  1XDS A;  4CO8 A;  1HXD A;  2K9N A;  3UKG A;  4HBL A;  4JX4 A;  1ZRC A;  1WJE A;  4OIQ F;  3W2W A;  4LG0 B;  2HWV A;  2JZY A;  5EEH A;  1YOV B;  3KEO A;  1UHM A;  1IN6 A;  3DP7 A;  2DCE A;  3KP2 A;  2GOM A;  1OCO H;  3WGI A;  1TLH B;  1YQA A;  2EZI A;  5DCM B;  5F64 A;  5E3L A;  3GXO A;  1EH8 A;  1JKR C;  2JPC A;  2K9L A;  1O3T A;  5IPA A;  1F4K A;  1WGX A;  2ADU A;  3CCL I;  1YJW I;  3OOP A;  1ON2 A;  4I76 A;  1FWZ A;  2MYS A;  4RM2 A;  3ROU A;  4OMY A;  4YFN F;  2MLG A;  5FRO A;  4C2U A;  3HIF A;  3K4C A;  3KX2 A;  3V8L A;  4IOC F;  1G3S A;  4L9V A;  1I39 A;  4MGR A;  3N4M A;  5BPI A;  2ZME A;  5DEQ A;  1H8A C;  5HOD A;  2HVR A;  1TWF J;  1BIA A;  2GOX B;  1HLV A;  1R00 A;  2ZNZ A;  1WJF A;  4G12 A;  4XRS A;  3BZ6 A;  1FP1 D;  3DTI A;  2Y9Y A;  2LK2 A;  3H9J A;  1MND A;  4F93 B;  1RC9 A;  2XAJ A;  2L2O A;  5F1R A;  2VQL A;  1SVM A;  5GAG J;  3R61 A;  3DKX A;  1W7P B;  2VJ5 A;  2K7L A;  2QM3 A;  3DBR B;  1K6O A;  1WJB A;  1MBF A;  3ZGK A;  4HLX A;  1TW2 A;  1B1B A;  2J5P A;  3GME A;  4A6E A;  2X1C A;  2XC7 A;  2CUZ A;  3KEY A;  3V7R A;  4XM3 A;  5J8C A;  1P4A A;  2GIZ A;  2V26 A;  5FLX Z;  4X6A J;  5GAH J;  3OL3 A;  1YI2 I;  4CGZ A;  3MVP A;  3GW2 A;  1AKH A;  5TJJ A;  4NQW A;  5EZH A;  4EGZ A;  2DA5 A;  4U88 A;  3FWE A;  4B1R A;  4ETS A;  2N8G A;  2IS4 A;  3TDU C;  1O57 A;  2EIL H;  1WI3 A;  1BN5 A;  2O9L A;  4A3G J;  2AHQ A;  4OAZ A;  4KNY A;  1W1W E;  3ZOB A;  4I99 C;  1N75 A;  1U9O A;  1IRG A;  2HKO A;  4XKV A;  4UB8 C;  1U8R A;  1XTA A;  4KIB A;  1F5T A;  3CDL A;  4Y33 A;  3CJR B;  4HQM A;  1X2N A;  2ECB A;  3GO5 A;  1B9N A;  4ENJ A;  3C2B A;  1SFK A;  1XB4 A;  1IUY A;  2L02 A;  4J01 A;  3K4M A;  2CRG A;  4AIJ A;  4KJZ A;  1LEB A;  2PMH A;  3LL7 A;  4F7Z A;  4N9H A;  1X58 A;  1P7I A;  2ZME C;  1K61 A;  3LSH A;  1QZE A;  2VC1 A;  2L9S A;  3C1D A;  3WE2 A;  2P81 A;  3R4K A;  4XSX F;  2DA7 A;  3ABM H;  2RQQ A;  3TGN A;  2E2I J;  3FMR A;  4OAY A;  1VQP I;  2QVO A;  1FNN A;  2L3D A;  4XKC A;  1OPC A;  3O3K A;  1B6A A;  2DTR A;  4HZF A;  1VQ8 I;  4HDU A;  1UZC A;  2LG4 A;  3VFZ A;  1QNT A;  2CQX A;  3AG3 H;  4II3 A;  1Z7U A;  3S1N J;  5M3M J;  2FQ4 A;  1B72 A;  1BR1 A;  2WV1 A;  4LB5 A;  1I27 A;  2Z33 A;  2O3F A;  1VTN C;  3T5X A;  4ABZ A;  1R5I D;  1A6Q A;  3S3M A;  1LVK A;  2Z16 A;  3CP2 A;  4DJA A;  3LA2 A;  3M8J A;  4JK1 X;  3L2Q A;  3HPG A;  3TW6 A;  1BI2 A;  3HOZ J;  4ENN A;  3SQN A;  1HDP A;  2GM4 A;  2O61 A;  3ABU A;  3E0J B;  4A0X A;  4Q4Z F;  1ZTR A;  5KVR A;  1FYL A;  5CVU A;  2XV4 S;  2PLY A;  1ZK8 A;  2IA2 A;  2QQA A;  2IT0 A;  2GXA A;  2KQR A;  1EKE A;  1MMD A;  1ETO A;  4QTR A;  1SFO J;  4EJO A;  3WU1 B;  2R3S A;  3ISP A;  1IDY A;  2XAU A;  4G7O F;  3S1M J;  1YTY A;  1S72 I;  1D8J A;  3SZP A;  1ETQ A;  1W7P D;  4KUM A;  2R92 J;  4P96 A;  4G94 A;  4D5F A;  2JTV A;  4G9Y A;  1VQM I;  1WZ2 A;  4OIP F;  3KIO A;  1U2W A;  2D1H A;  2NAZ A;  2OQR A;  3AFH A;  2HOA A;  3OV8 A;  2JPB A;  3BC8 A;  4MTD A;  1JHH A;  2L4A A;  3VSK A;  2X6Y A;  3KP4 A;  4PCQ A;  1ZAR A;  1EV7 A;  4BE1 A;  1J5Y A;  3DXJ F;  5GPA A;  4HLY A;  3OIO A;  1L0O C;  2EQR A;  2ZSI B;  4M6Y A;  2JVG A;  4B3X A;  1CF7 A;  2NVT J;  1IN5 A;  3LSP A;  2ZJ2 A;  1MZB A;  4HG2 A;  1WKM A;  4IL6 C;  5EEG A;  1FYM A;  4RB2 C;  3R0A A;  5D5U B;  5BS6 A;  5L3F A;  5ILS A;  1K78 B;  1UG2 A;  2CW0 F;  5EGO B;  1GVJ A;  2YR2 A;  2Y0S N;  1IGN A;  4N4O B;  4BYY A;  1IZ1 A;  2F4M B;  1UB9 A;  2EWN A;  2KIS A;  3CF5 F;  4HDV A;  2PJR A;  2BHZ A;  3RTR A;  3Q9S A;  2VLA A;  4LB6 B;  4ZTF A;  2JQ7 A;  1XG1 A;  2XUB A;  4E7L A;  3F3X A;  2Y30 A;  5D8K B;  1K7A A;  3OYH A;  2K3P A;  4YFK F;  5LRS A;  4KT6 A;  3HG9 A;  1TT0 A;  3E5X A;  2JRM A;  3NAR A;  1R71 A;  3TMO A;  2K4J A;  5DUK A;  2XKP A;  1W0U A;  1YX3 A;  2AXT C;  3IUO A;  5M5X J;  1WJC A;  2QQB A;  3CQZ J;  1T98 A;  3S8P A;  3EUH A;  1BW5 A;  3MQ0 A;  2OAZ A;  4UVC A;  3LSM A;  3OYA A;  1QHH D;  5HLT A;  4O6J A;  4CCK A;  2G9W A;  2I10 A;  2IS2 A;  2CQN A;  2W48 A;  3TDZ C;  1BW6 A;  3W2A A;  1YRN B;  1QO0 D;  4I01 A;  1OCC H;  1BC7 C;  4OIO F;  3LSJ A;  5F1J A;  1MJ9 A;  1ETV A;  3WOD F;  2QUF A;  3JRF A;  3JRB A;  2KL4 A;  4RA2 A;  3H9G A;  3PFI A;  4IQJ A;  1WVR A;  4A3K J;  3H5N A;  1AWC A;  5B66 C;  2STT A;  3V7S A;  2JN6 A;  3ZXS A;  2PQ8 A;  3QU6 A;  4M9Z A;  5CVR A;  3RPU D;  3K9T A;  3GUD A;  2A05 A;  3R60 A;  1ITY A;  4ESB A;  2XGC A;  2XPU A;  3B02 A;  4XN0 A;  5HS9 A;  5JI6 A;  1RPW A;  4LFU A;  5HDK A;  3AKZ A;  2EZK A;  2M0M A;  4UUS B;  2Q1Z B;  4NC6 A;  1GHC A;  4LGW A;  1ZRE A;  3FF5 A;  1X1A A;  3LQR A;  5CLS A;  2X51 A;  2HKX A;  2M3A A;  3FKJ A;  2HYF A;  3FK6 A;  1O7F A;  5HOO A;  1PP8 F;  3I59 B;  5B5E C;  5JVG F;  1CGP A;  1I6H J;  2CU7 A;  4IQ4 A;  1VQK I;  4BBS J;  4C2M J;  1B9M A;  2EPF A;  4U7D A;  3HUG B;  1LUJ B;  4HSR A;  2CFX A;  3M8E A;  5IOZ A;  2QZ8 A;  3H3U A;  2O5R A;  1K79 A;  3EUK L;  4EM0 B;  3L2U A;  1XMA A;  1MH3 A;  3CCR I;  2W7N A;  1ZR2 A;  4DYQ A;  1FMV A;  1QRY A;  3L1P A;  2EV0 A;  2LNB A;  3EUH C;  2VJ4 A;  4HAM A;  1OLT A;  3GTK J;  5FD6 A;  1B8I A;  1LE8 B;  3K4N A;  3WTY C;  4WWC A;  4K2E A;  1T38 A;  1FTT A;  3FIS A;  3DU5 A;  4RAZ A;  4IF4 A;  5CKT A;  3JRI A;  1RR7 A;  4BAC A;  5TRD A;  2R5Y A;  5ED4 A;  3U9G A;  2NOJ B;  1Z7L A;  4IVN A;  4S0H B;  3SEZ A;  1XSV A;  1S7A A;  2OTL I;  4RAF A;  4ZH4 F;  2R7Z J;  4ZDO A;  1EF4 A;  1IV6 A;  5E8I A;  2HOE A;  4A3L J;  2X9D A;  5IYB J;  4P5O A;  2FBI A;  3J81 Z;  5C44 J;  5CYV A;  1X3W B;  3ZMU A;  2CQK A;  3EYI A;  4ZTJ A;  1MBH A;  1FP2 A;  2XRL A;  2XSJ C;  3FIW A;  4RB3 C;  4PSX A;  1K4S A;  1XCB A;  2XDV A;  2CUF A;  2Q2E B;  4XN3 A;  4LG0 A;  2LKX A;  4BU2 A;  4WF2 A;  3ABL H;  2DFI A;  1NK2 P;  4E7H A;  1SD4 A;  1R22 A;  5DCM A;  2KIU A;  3P9K A;  1XGM A;  3H1C A;  3FK7 A;  2P8T A;  2D5V A;  3CJQ B;  3CDH A;  4BY1 J;  3CF2 A;  5E20 A;  1EH6 A;  2A5W A;  2IP2 A;  2Z99 A;  3HOX J;  4HX7 A;  4Y3O A;  5J40 A;  3M07 A;  4PGH A;  3O8H A;  3TOA A;  2HGC A;  4JYK A;  1YIJ I;  3G1M A;  2BY2 A;  2HS5 A;  4A2U A;  3HXL A;  3CUQ B;  2RN7 A;  3ERM A;  2VXZ A;  3ZQ7 A;  4Y7N J;  3T8T A;  1D1A A;  4CA0 A;  3HHH A;  1MW7 A;  2WA0 A;  4CIC A;  4PK4 A;  4IO9 F;  3BCB A;  3I54 A;  1REP C;  3ZMD A;  2LRD A;  1JI8 A;  2X1D A;  3D5S C;  2AQE A;  1XMK A;  6PAX A;  1W7P A;  1DGW Y;  4G6T B;  4WCG A;  4O5V A;  3NAU A;  1G3T A;  3H92 A;  4QPQ A;  1MKM A;  3K4J A;  3KYD B;  1ZG5 A;  1L3L A;  4A93 J;  1WH5 A;  2V9K A;  2ZJR F;  4XKB A;  3JSP A;  2D45 A;  4XOT A;  2MGQ A;  1YIT I;  3F8C A;  3LMM A;  3OYD A;  1BC8 C;  2BZT A;  2CQ7 A;  3B6C A;  3HOU J;  1TNT A;  3SEQ A;  1J09 A;  3HSR A;  3BWG A;  1T08 B;  3I4P A;  1T33 A;  3HRS A;  5FRM A;  3FM5 A;  2K40 A;  2E1M B;  2JRT A;  3BQZ A;  1BJA A;  3K0L A;  3RDI A;  4XLP F;  2F48 A;  3MKY B;  3PIO F;  3J81 K;  2F5F A;  2HFH A;  1ETK A;  3K4L A;  4HPQ A;  5M3F J;  1HST A;  3MKZ A;  1I1G A;  3IAS 2;  2HTS A;  5LGU A;  5HNH A;  4XLE A;  2DDA A;  2ZSH B;  3BZC A;  3HRT A;  2A68 F;  3FHZ A;  2VXD A;  4ON0 A;  2OA4 A;  1X2M A;  3MKW B;  3PSF A;  2B9S A;  4UUT A;  4B43 A;  4B47 A;  2QKM B;  5DV5 A;  3FX3 A;  3I3L A;  3J7Y J;  1AA7 A;  1I1S A;  3N97 A;  4LIU A;  4XLH A;  5KCM A;  5EDN A;  2VBZ A;  4EJV A;  1MNM C;  5B1A H;  1TL8 A;  1NH3 A;  3E6C C;  1GLN A;  1I3Q J;  3Q0W A;  2EBI A;  5FFZ A;  4BUP A;  2IAI A;  2OF7 A;  2R7V A;  1ETY A;  2AS5 F;  2ZXW H;  2HOS A;  1G3Y A;  1RNL A;  1ZG3 A;  2UXX A;  1TWG J;  4UV8 A;  4XKW A;  1A36 A;  2V4J C;  5BMZ A;  3F8M A;  4BKX A;  3IH3 A;  3M9A A;  4BNC A;  3DFG A;  2V6C A;  3GZN B;  4PZJ A;  3EPZ A;  5IOY A;  1EH7 A;  1R5H A;  3P7N A;  2EZL A;  2EH3 A;  4XSZ F;  4XQF A;  1VQ5 I;  3OYL A;  3GZ6 A;  1JJ6 C;  2A3S A;  2H1L A;  2XGE A;  4W1U A;  2W82 A;  3O6B B;  1D3Y A;  3CCU I;  2DBB A;  1B4A A;  1NG7 A;  2BXY A;  3I55 I;  1HDD C;  2DAO A;  1X1B A;  5J1Y A;  3SZT A;  1OQY A;  1H9T A;  1RKT A;  2IGO A;  3QYF A;  4KT5 C;  3D1N I;  2XF7 A;  1OCP A;  5HLG A;  1RET A;  3L2V A;  3CDI A;  2QYO A;  3S1Q J;  4Z6Y A;  1YHQ I;  2OD5 A;  1SFE A;  3OMY A;  3JTG A;  1GDT A;  2NOG A;  1TWA J;  2BW3 B;  2FQ3 A;  4H4K C;  2DPD A;  1ONV A;  3KP6 A;  4F91 B;  1BIB A;  2XRO A;  2L01 A;  1XC5 A;  4M3F A;  1MSF C;  2DA2 A;  3CZ6 A;  4AIH A;  4AYB N;  5FFX A;  3MKL A;  3GLX A;  5DYM A;  5D4S A;  5H20 A;  4S05 A;  3PNV A;  3HOW J;  4E7J A;  1OYW A;  2XPW A;  4U87 A;  1TT5 B;  4G6Q A;  4V2G A;  2DMN A;  2R7X A;  3ZN0 A;  4YEJ A;  2CFO A;  1K78 A;  2X6X A;  4FIS A;  2R7D A;  5EGO A;  3COA C;  4X0G A;  1FIP A;  3E6B A;  1GXP A;  3RYP A;  1F43 A;  4RB0 A;  3G1O A;  2ELH A;  1FX7 A;  2EIJ H;  3SFZ A;  2FML A;  1LFB A;  3IKT A;  1KU7 A;  3KYC B;  4N4N B;  3OY9 A;  1V55 H;  4F55 A;  2IXS A;  3BR5 A;  3IHU A;  1BOA A;  4LD5 A;  1YFH A;  4I0B A;  2FA5 A;  3W2V A;  4IXA A;  1OFC X;  1Y1W J;  1DU6 A;  4I09 A;  3HM5 A;  4WXH A;  4W97 A;  4DIQ A;  4KIT B;  1OMI A;  2FD5 A;  4A3J J;  4I2O A;  2VPL A;  1KON A;  2BY0 A;  2YX4 A;  2ME6 A;  3OS0 A;  1IAW A;  2H6B A;  1JTX A;  4DYC A;  1KQ8 A;  3CCV I;  2DOA A;  1YRN A;  5IP6 A;  2EK5 A;  1P6R A;  1Z1D A;  5ILV A;  1RRJ A;  4A3I J;  2F4O B;  3OYE A;  1G6N A;  1Z3X A;  1FTZ A;  1WJ5 A;  5F04 A;  1E17 A;  5IP9 J;  1R4N B;  2BE5 F;  2H09 A;  4A5N A;  3OSG A;  2ZXI A;  4C3H J;  3VYT B;  3KPH A;  1JT6 A;  1SMY F;  3HGG A;  3E3V A;  5K7Z A;  2ISZ A;  2QKL B;  3K69 A;  2R7T A;  2L7K A;  2FMY A;  3DLL F;  1SD7 A;  3W3C A;  4C2T A;  1Z6R A;  3OR1 C;  1WJD A;  1Y1V J;  1Y0N A;  2CUJ A;  5LGT A;  1O3S A;  1QZZ A;  1SVL A;  5KAI C;  3ERE D;  4M3G A;  2QSF X;  2GXG A;  2JVH A;  3OIQ A;  5L3E A;  3KEQ A;  4ZZL A;  4UUS A;  4DQ2 A;  1DPU A;  2VKE A;  4UV9 A;  1U3E M;  2EFQ A;  2WBM A;  3WTX C;  2NNN A;  2L7F P;  1VQL I;  3SHF A;  4EJU A;  4GO1 A;  1ZR4 A;  2CSO A;  4EVI A;  3I59 A;  2E7X A;  2MSY A;  2JK3 A;  3QPS A;  5HLI A;  4IEJ A;  2DMP A;  4R79 A;  4KIG A;  3I0T A;  5LHI A;  3GTQ J;  1XSD A;  1SD6 A;  2E5N A;  4GYG A;  3O8G A;  1F36 A;  3HUG A;  5C3E J;  4M6V A;  4A0Y A;  1J2X A;  1ZYR F;  2VIX A;  4J00 A;  1UG0 A;  3MEX A;  3LA3 A;  4Q48 A;  2NRA C;  2MW8 A;  3LAP A;  2JJ7 A;  1YS7 A;  2R0Q C;  3DEU A;  3QP6 A;  3J7Z I;  3WTT C;  1UCR A;  5E1W A;  3CCQ I;  1X1D A;  3ZQH A;  5F08 A;  1CQT A;  3R6S A;  3PUB A;  4IZZ A;  1ORK A;  2HZT A;  5FRN A;  5B1B H;  3KET A;  3DEE A;  1TWC J;  1LE8 A;  1N25 A;  5H6R A;  1E3P A;  3GCM A;  3V8J A;  3K6G A;  1RKW A;  4RGS A;  3CLO A;  1FC3 A;  4UXN A;  2H27 A;  1FJL A;  2F2E A;  2LLK A;  2M5W A;  3AL0 B;  3GTP J;  4LIT A;  3GFL A;  1U8B A;  4E7Z A;  9ANT A;  1WCM J;  4JX6 A;  2FEZ A;  1UST A;  1KYZ A;  5IT3 A;  3DF8 A;  4A3E J;  3K7A J;  3HSE A;  3DTE A;  3BG3 A;  3IWF A;  4HRI A;  2R7R A;  2HYG D;  3OL4 A;  1NK3 P;  1OIS A;  3EQL F;  3WGH A;  2H8R A;  1WHU A;  1BR4 A;  4AVZ A;  2VKH A;  5J4Y A;  1BR2 A;  3PO3 J;  4XL9 A;  1K4T A;  3GFI A;  3H3V K;  2M2E A;  4HNV A;  3LFU A;  4XNF A;  1APL C;  1MMN A;  1W0T A;  2P6S A;  2X0L A;  1WFX A;  2VQH A;  5IT9 Z;  2DTZ A;  1ULY A;  3BR2 A;  1XGO A;  4NBQ A;  1DU0 A;  1VQ7 I;  4JQF A;  1MD0 A;  2Q2E A;  4GFB A;  2MH9 A;  4WXD A;  5D6E A;  2IA1 A;  4HNT A;  2XAH A;  3BR6 A;  1Y39 A;  1R23 A;  4ITV A;  1JXS A;  2EFO A;  2F4I A;  2JWT A;  3A03 A;  1SMT A;  2HNH A;  1LEA A;  3RQ4 A;  3LOC A;  2K5C A;  5FB2 A;  4XRS G;  1W5C C;  1WJA A;  2LY2 A;  2QWW A;  3CD6 I;  3F6O A;  3RYR A;  4HEA 2;  2JA6 J;  4EEF G;  4XLF A;  2M8E A;  2BXZ A;  3MZH A;  1F9N A;  5LEK A;  2Y0S A;  2VPR A;  5BPD A;  1T95 A;  1VQ9 I;  5L3C A;  5J47 A;  2E71 A;  2QEX I;  2G0E A;  4C9Y A;  3CUQ A;  2IRF G;  1QZY A;  2KJB A;  3CC4 I;  4PJM A;  4Y4R A;  1OCZ H;  4CDG A;  3E6M A;  3S14 J;  3V42 A;  5H6Q A;  1LPQ A;  1YW8 A;  2HYJ A;  1TTY A;  2KRF A;  2BOL A;  1ON1 A;  2DMQ A;  2VB6 A;  1LFP A;  2W85 A;  3DKW A;  3K4K A;  3RIR A;  3H0D A;  2Y48 A;  4S04 A;  2V1U A;  5GPC A;  2MC3 A;  4CCJ A;  5KAF C;  4FTH A;  1RI7 A;  4DYR A;  4ZYE A;  5FLX K;  1WPK A;  1X19 A;  3WE3 A;  4A12 A;  3JRG A;  1H88 C;  4CZC A;  2K85 A;  1JT0 A;  3KP7 A;  1IXR C;  4D1Q A;  1R1U A;  1UMQ A;  4CCL A;  2XAF A;  1IUF A;  2ESH A;  2FJ1 A;  4CCM A;  2L7M P;  5F27 A;  1UJ8 A;  2MBF A;  3AAF A;  5LLQ A;  3S15 J;  4IHX A;  2IJL A;  3PJR A;  3A0H C;  4HW0 A;  5GP9 A;  1RUN A;  1A6I A;  1A5J A;  3Q0V A;  1FSE A;  3TW7 A;  5L3G A;  4M6X A;  1W4M A;  1W36 D;  1LVA A;  3MZY A;  4LLG F;  1DUX C;  1RR8 C;  1FY7 A;  5E3O A;  3JRA A;  5FKM A;  4GRI A;  3RI4 A;  4IJA A;  4D0P A;  3DV8 A;  4XLA A;  2L9N A;  1VI0 A;  3E97 A;  2OZU A; 
#chains in the Genus database with same CATH homology
 5IT9 K;  3R0J A;  1Z6T A;  2EV6 A;  3Q9V A;  4M9S A;  1XD7 A;  4BAY A;  2GA1 A;  2DPU A;  2Y75 A;  4CYD A;  1W5S A;  1RZ4 A;  4ASN A;  2XHK A;  2BGC A;  1P4X A;  5DD4 A;  4GGG A;  3CUQ C;  3I58 A;  2Z5U A;  4A6D A;  2MD5 A;  1Q1H A;  2ETH A;  3GVA A;  5LRR A;  4OIR F;  4P55 A;  3W6J B;  1ZHF A;  2W25 A;  2GWR A;  2P6T A;  2YU3 A;  1TW3 A;  2VBY A;  2V1X A;  5J6X A;  4BH9 A;  5E1Z B;  3V4G A;  3I64 A;  3IC7 A;  5JFR A;  3TO6 A;  5CVV A;  1YLF A;  2D1V A;  2TDX A;  3F6V A;  2FSW A;  5JR3 A;  3ZP5 A;  5D5V B;  4I0A A;  1YG2 A;  4HYE A;  5D8L B;  2K86 A;  3HRM A;  4A5M A;  4R1H A;  1HW5 A;  3L09 A;  3G3Z A;  4WX9 A;  2L4M A;  1ZH5 A;  5L3D A;  1F1Z A;  3B73 A;  1D5V A;  3O2P E;  2V79 A;  2GAU A;  5D5W B;  1YO5 C;  1J59 A;  3GF2 A;  3F21 A;  4M74 A;  1ZG1 A;  2F5C A;  1IRF A;  1O3Q A;  1FSH A;  4L9J A;  2VC0 A;  2LDU A;  3L7W A;  1MDM B;  5J8F A;  3PQK A;  4IRH A;  3BP8 A;  1BI1 A;  3DPT A;  2Q8K A;  2HQR A;  2XVC A;  1MGT A;  5A2Q Z;  3RPQ A;  4TV7 A;  1ZRD A;  2X4H A;  5K5O A;  1IW7 F;  3IKV A;  1PDN C;  1U6G A;  1T2K A;  1SFU A;  2DU9 A;  3P9C A;  2HR3 A;  2IPQ X;  2DO7 A;  1J9I A;  5E17 F;  2P4W A;  2E7W A;  2EV5 A;  4U0Y A;  1YIO A;  2XAG A;  4EJW A;  2NYX A;  1QBJ A;  1Z91 A;  3VB2 A;  2K27 A;  5LBQ A;  4N9I A;  4ENK A;  3I5U A;  1R5G A;  4RGR A;  1UFM A;  2STW A;  3U1D A;  3CTA A;  2FE3 A;  2WTE A;  3IRR A;  5F6F A;  2HQN A;  1FZP B;  4B09 A;  3KFW X;  2HEO A;  4L9N A;  2VE9 A;  4ZYH A;  4HX4 A;  4MHG A;  1G4D A;  1O7L A;  1WQ2 A;  3LFK A;  4GXO A;  2W57 A;  2VBW A;  3ELK A;  4HX8 A;  1J0R A;  3I53 A;  2VE8 A;  1R1T A;  5A2Q K;  2VOD A;  3CO7 C;  2DW4 A;  3ZMV A;  1MJA A;  2FOK A;  2ZCW A;  4KIF A;  3F23 A;  2D2W A;  1XSX A;  1FT9 A;  1TQP A;  2A5Y B;  3Q5F A;  1HSJ A;  2O0Y A;  2VON A;  1X3U A;  1B59 A;  3M8F A;  1BM9 A;  1QQI A;  3QPH A;  4B8X A;  1STZ A;  1IN4 A;  2P5K A;  4M72 A;  1E2X A;  3JTH A;  1HW2 A;  4O3M A;  4RGX A;  4ESF A;  4XLN F;  2CO5 A;  1YW7 A;  2EFN A;  4P9F A;  1KU3 A;  1WSU A;  1ODD A;  2ZKZ A;  4QLC U;  2KKO A;  1T0F A;  2RQP A;  2LKP A;  2MA3 A;  3L2C A;  1R58 A;  3K1P A;  3HOT A;  2A6H F;  5ERI A;  4BQA A;  2GQQ A;  2ESN A;  1ZLJ A;  4MEY F;  1FPQ A;  3RPU A;  3VOE A;  2YPR A;  4MEX F;  4ESJ A;  3V7C A;  1S6L A;  5KK1 A;  4L0Y B;  2KIM A;  2M1B A;  5K5R A;  5HLH A;  5E18 F;  3BRO A;  3JW4 A;  4H0E A;  2XAS A;  4BXU A;  2H94 A;  2RV8 A;  2ZBK A;  4HV6 A;  3GX4 X;  4G7H F;  2R7F A;  1J7K A;  3REO A;  2FU4 A;  5D5X B;  3FXU A;  4HQE A;  2RKH A;  2PEX A;  2VOP A;  2MLK A;  1DDN A;  2CG4 A;  1R36 A;  2DQR A;  1RUO A;  4EQQ A;  1DPR A;  3TQN A;  4U0W A;  2EFW A;  1OYY A;  2FBH A;  1BI3 A;  3KLN A;  1USS A;  3LST A;  5ICF A;  4EGY A;  1JHF A;  2EA4 A;  4ZYG A;  1XGN A;  4KFC A;  3HOS A;  1HW1 A;  2NS0 A;  2KJC A;  3V8K A;  3U2R A;  2QLZ A;  3CUO A;  4I02 A;  4P9U A;  1LDK B;  1NHA A;  5ICC A;  2LF7 A;  4Q47 A;  2G7U A;  2UXN A;  3QOP A;  2W84 A;  2ZNY A;  3WTW C;  4RS8 A;  4KA4 A;  4Y17 A;  2XRN A;  4AWX B;  2PFB A;  4EMS A;  3ZPL A;  3ECH A;  5BOX A;  1IN7 A;  4HA8 A;  1LDJ A;  1HKT A;  4OIN F;  4MTE A;  3ML6 A;  2RC4 A;  1LB2 A;  3LA7 A;  1HKQ A;  1TQM A;  2QEN A;  2Z3Y A;  3GEZ A;  2WWY A;  4RAY A;  3DQV C;  3WG9 A;  4OU0 A;  1SD5 A;  1HBX G;  2WC2 A;  1I5Z A;  1R7J A;  3MAJ A;  3KCC A;  2COM A;  1WI9 A;  3CJN A;  2RDP A;  1KQ0 A;  3BPV A;  2Q0O A;  1ZAO A;  1MDM A;  3MFK A;  1LDD A;  1ZRF A;  2K02 A;  4EJT A;  2FNA A;  3TO9 A;  1I6X A;  3MCZ A;  3K2Z A;  3ZMT A;  1BBY A;  3TKY A;  2OBP A;  4IHS A;  4UNO A;  2MH2 A;  3BPX A;  1A04 A;  1S7O A;  2ZO4 A;  2M87 A;  4PGG A;  5D6F A;  2A69 F;  2HTJ A;  4L9T A;  2O6G E;  2VN2 A;  4I7H A;  2BV6 A;  1IXS B;  2FRH A;  2FBK A;  3E5U A;  1W5T A;  3C18 A;  2ZXJ A;  1P92 A;  1BI0 A;  2UWM A;  3GWZ A;  3W6K B;  3K1M A;  4EV0 A;  1LQ1 A;  2JSC A;  2DK5 A;  1XGS A;  1PUE E;  3E6D A;  4DNC A;  4KN4 X;  3FXQ A;  4OMZ A;  3QRF F;  4N0B A;  4ENM A;  4MQ9 F;  5AON A;  4IPA A;  4E70 A;  4KDP A;  2Z9O A;  2QBY B;  1U5T B;  2L54 A;  1H0M A;  3VEP A;  2IVM A;  3FXR A;  2XAQ A;  5D4R A;  2BBY A;  1YW9 A;  3F8B A;  3SXY A;  2ISY A;  3D0S A;  2FF4 A;  2EJR A;  5CVJ A;  2GXB A;  4RB1 A;  4XRF A;  1FYK A;  3QP5 A;  4IRI A;  1YYV A;  4FX0 A;  3LAJ A;  1XN7 A;  4WK8 F;  2P7V B;  2ZFW A;  5HS8 A;  1FBS A;  2DK8 A;  1JGS A;  3QAH A;  2DQL A;  2BYV E;  2OU2 A;  1OR7 A;  2DLL A;  4YG2 F;  2UZK A;  1D8K A;  4UVB A;  1TNS A;  5HDG A;  4M73 A;  1RIO H;  2LSO A;  4CHU A;  4OOI A;  4EM1 A;  4LMY A;  3F72 A;  1KU9 A;  3F8F A;  3F22 A;  3J80 Z;  2PG4 A;  3T8R A;  1TQI A;  2WV0 A;  2JT1 A;  2G7H A;  3LWF A;  2O03 A;  2YSR A;  4HF0 A;  2VBX A;  4KIC A;  2PI0 A;  2RNJ A;  3ECO A;  2PJP A;  1FLI A;  3BY6 A;  3RKX A;  2CGP A;  2PMU A;  2ACJ A;  5LHG A;  3VOD A;  1WRJ A;  3QU3 A;  1U78 A;  4IHT A;  1LNW A;  3GYH X;  4M9X A;  4G7Z F;  1P4W A;  3ZMZ A;  5K5Q A;  1IN8 A;  5HS7 A;  3GFJ A;  5FO5 A;  4NHJ A;  3TO7 A;  3WU0 A;  4GYI A;  3BOQ A;  4G6D A;  5E1X A;  4AIK A;  4MNU A;  3BDD A;  3BJO A;  3M1E A;  4KYW A;  2PBI A;  1JE8 A;  4HV5 A;  2HDC A;  2A07 F;  3D5L A;  4KMU X;  4YII A;  4PDK A;  2ZME B;  1V4R A;  3QPT A;  3KP5 A;  3P9I A;  3H3Z A;  4L18 B;  4L5J A;  3J80 K;  1Z9C A;  3KE2 A;  4UUV A;  4YFX F;  1OKR A;  2FNP A;  4RGU A;  4AD9 A;  4KN7 X;  1QPM A;  4UHT A;  1FOK A;  3TOB A;  3KZY A;  3NEU A;  3K1N A;  2LF8 A;  2RGV A;  2GA2 A;  2YX7 A;  2XIG A;  2A6E F;  1ZGA A;  3NQO A;  3PQJ A;  2K4B A;  1QGP A;  3I71 A;  2P5L C;  4BHB A;  1KYW A;  3ABT A;  2VT3 A;  3L9F A;  3EDP A;  5FD5 A;  3L00 A;  1Z05 A;  3IWZ A;  4Y15 A;  2IW5 A;  2P7C B;  3HTU A;  5JVT A;  2QQ9 A;  1KGS A;  4AVP A;  3ZMS A;  2P5V A;  4MQV A;  5LHH A;  4ZZD A;  4L0Z B;  4LLN A;  4HF2 A;  5LEJ A;  4UVA A;  2CWE A;  2M45 A;  2OQG A;  3DPL C;  3WTS C;  3WTU C;  3HTS B;  2Y0M A;  3J7A O;  4LK1 F;  1KU2 A;  4QWQ A;  3RJP A;  2M30 A;  4I98 B;  3CO6 C;  4R8H A;  5FGM A;  3RKW A;  2EFP A;  5DCF A;  3EET A;  5DUI A;  2IA0 A;  3WTV C;  2C6Y A;  1S29 A;  4ZYD A;  1XCV A;  2V1D A;  1T6S A;  1OYI A;  4YIF A;  1S3J A;  5LGN A;  2VOO A;  4CZZ A;  3RKY A;  4KMF A;  4HOB A;  1V3F A;  5AIQ A;  3HYI A;  2VT2 A;  4G8X A;  2NNY A;  3KZZ A;  5L3B A;  4U0V A;  2V9V A;  5HVQ C;  1CF7 B;  4LLL A;  1Y0U A;  2CYY A;  2F5D A;  2AXL A;  3HSF A;  5CJ9 A;  4Z2Y A;  3JAM Z;  2EA2 A;  1GXQ A;  3FZV A;  4NB5 A;  2BEO A;  3HHG A;  3BJ6 A;  3C7J A;  1SAX A;  3C3W A;  1ZN2 A;  1IXC A;  1TBX A;  3E5Q A;  5HDN A;  4LJZ F;  3IL2 A;  3MWM A;  1UHW A;  2EB7 A;  3HRU A;  1J75 A;  1R1V A;  2QBY A;  1U5T A;  2XGX A;  4BHC A;  1HQC A;  2KIF A;  2J5O A;  4M71 A;  5ICE A;  2B0L A;  1KQ9 A;  2PN6 A;  3KLO A;  3G73 A;  4CXF A;  1WWX A;  5E8G A;  1SFX A;  3LQQ A;  2E1N A;  3BJA A;  4FX4 A;  1FBU A;  4WXC A;  2O8X A;  2OZ6 A;  5JHU A;  2H6C A;  3FM3 A;  3ZN1 A;  2GIV A;  1XDU A;  5DDG A;  1YS6 A;  4L5I A;  1ZLK A;  2DT5 A;  3EYY A;  4LK0 F;  2DI3 A;  1LJ9 A;  2E1C A;  4BHP A;  5K1Y A;  3ULQ B;  3KP3 A;  3S2W A;  5CVI A;  2XKO A;  3JAM K;  3GZ5 A;  2W24 A;  1P2F A;  4GCV A;  2RVC A;  1IF1 A;  3WTZ A;  3T1B A;  4A0Z A;  4FT8 A;  5ICG A;  3WGG A;  2F5E A;  1MJB A;  5AIP A;  1G3W A;  3NRV A;  3F8N A;  1C0W A;  1U5T C;  1O3R A;  1KA8 A;  4Q5S F;  4JBA A;  3GFM A;  1ZGJ A;  4EM2 A;  3T0Y A;  4IRG A;  3IRQ A;  1HKS A;  1S8N A;  1PP7 U;  1AOY A;  5ILU A;  2GZW A;  1T39 A;  4XBF A;  5BQT A;  3M7G A;  4Y13 A;  1FBQ A;  3JSO A;  1H9G A;  5DD8 A;  4HF1 A;  2A61 A;  2FXA A;  1DP7 P;  4FHT A;  4U7B A;  3FMS A;  3FMQ A;  1XDS A;  4CO8 A;  1HXD A;  1ZRC A;  4HBL A;  4OIQ F;  4LG0 B;  2HWV A;  2JZY A;  5EEH A;  3KEO A;  1UHM A;  1IN6 A;  3DP7 A;  3KP2 A;  3WGI A;  1TLH B;  1YQA A;  5DCM B;  5F64 A;  3GXO A;  1EH8 A;  2JPC A;  1F4K A;  1O3T A;  2ADU A;  3OOP A;  1ON2 A;  1FWZ A;  3ROU A;  4OMY A;  4YFN F;  2MLG A;  3HIF A;  3V8L A;  1G3S A;  4L9V A;  4MGR A;  3N4M A;  5BPI A;  2ZME A;  5DEQ A;  1BIA A;  1R00 A;  2ZNZ A;  3BZ6 A;  1FP1 D;  2XAJ A;  5F1R A;  3R61 A;  1W7P B;  1K6O A;  2K7L A;  2QM3 A;  4HLX A;  1TW2 A;  1B1B A;  2J5P A;  4A6E A;  3V7R A;  5J8C A;  1P4A A;  5FLX Z;  4CGZ A;  3GW2 A;  5TJJ A;  4NQW A;  4EGZ A;  4U88 A;  3FWE A;  4ETS A;  3TDU C;  1O57 A;  1BN5 A;  4KNY A;  1IRG A;  2HKO A;  1U8R A;  4KIB A;  1F5T A;  4HQM A;  3GO5 A;  1B9N A;  4ENJ A;  1XB4 A;  1IUY A;  2L02 A;  4AIJ A;  1LEB A;  2PMH A;  4F7Z A;  4N9H A;  2VC1 A;  3C1D A;  3WE2 A;  3R4K A;  4XSX F;  3TGN A;  3FMR A;  2QVO A;  1FNN A;  2L3D A;  1OPC A;  3O3K A;  1B6A A;  2DTR A;  4HZF A;  4HDU A;  3VFZ A;  1QNT A;  1Z7U A;  4LB5 A;  1I27 A;  2Z33 A;  2O3F A;  1VTN C;  3T5X A;  3LA2 A;  4JK1 X;  1BI2 A;  4ENN A;  3SQN A;  2O61 A;  3ABU A;  4A0X A;  4Q4Z F;  5KVR A;  1FYL A;  5CVU A;  2XV4 S;  2PLY A;  2IA2 A;  2QQA A;  2IT0 A;  4EJO A;  3WU1 B;  2R3S A;  3ISP A;  4G7O F;  1YTY A;  1D8J A;  3SZP A;  1W7P D;  4KUM A;  4P96 A;  4G94 A;  2JTV A;  4G9Y A;  4OIP F;  1U2W A;  2D1H A;  2NAZ A;  2OQR A;  3OV8 A;  2JPB A;  4MTD A;  1JHH A;  2L4A A;  3KP4 A;  4PCQ A;  1ZAR A;  1EV7 A;  1J5Y A;  3DXJ F;  4HLY A;  1L0O C;  4M6Y A;  1CF7 A;  1IN5 A;  2ZJ2 A;  1MZB A;  1WKM A;  5EEG A;  1FYM A;  4RB2 C;  3R0A A;  5D5U B;  5BS6 A;  5L3F A;  5ILS A;  1K78 B;  2CW0 F;  1GVJ A;  2YR2 A;  4BYY A;  1IZ1 A;  1UB9 A;  2EWN A;  4HDV A;  3RTR A;  3Q9S A;  4LB6 B;  2XUB A;  3F3X A;  5D8K B;  1K7A A;  4YFK F;  5LRS A;  3E5X A;  2K4J A;  5DUK A;  2XKP A;  2QQB A;  1T98 A;  3EUH A;  3MQ0 A;  2OAZ A;  4UVC A;  4O6J A;  2G9W A;  3TDZ C;  1QO0 D;  4I01 A;  1BC7 C;  4OIO F;  1MJ9 A;  3WOD F;  2QUF A;  3PFI A;  1AWC A;  2STT A;  3V7S A;  2PQ8 A;  3QU6 A;  4M9Z A;  5CVR A;  3K9T A;  3GUD A;  3R60 A;  4ESB A;  3B02 A;  5HS9 A;  5JI6 A;  4LFU A;  5HDK A;  1GHC A;  4LGW A;  1ZRE A;  3FF5 A;  3LQR A;  5CLS A;  2HKX A;  2HYF A;  1O7F A;  5HOO A;  1PP8 F;  3I59 B;  1CGP A;  1B9M A;  4U7D A;  2CFX A;  3M8E A;  2QZ8 A;  3H3U A;  1K79 A;  4EM0 B;  1XMA A;  2EV0 A;  2LNB A;  4HAM A;  5FD6 A;  3WTY C;  4WWC A;  4K2E A;  1T38 A;  4RAZ A;  4IF4 A;  5TRD A;  5ED4 A;  3U9G A;  4IVN A;  1XSV A;  1S7A A;  4ZH4 F;  5E8I A;  2HOE A;  4P5O A;  2FBI A;  3J81 Z;  5CYV A;  3ZMU A;  2CQK A;  3EYI A;  1FP2 A;  4RB3 C;  1XCB A;  4LG0 A;  4WF2 A;  2DFI A;  1SD4 A;  1R22 A;  5DCM A;  2KIU A;  3P9K A;  1XGM A;  2P8T A;  3CDH A;  5E20 A;  1EH6 A;  2IP2 A;  2Z99 A;  4HX7 A;  4PGH A;  3TOA A;  2HGC A;  2HS5 A;  4A2U A;  3CUQ B;  2RN7 A;  3ZQ7 A;  2VXZ A;  3T8T A;  3HHH A;  4CIC A;  3I54 A;  1REP C;  3ZMD A;  1XMK A;  6PAX A;  1W7P A;  4WCG A;  4O5V A;  1G3T A;  3H92 A;  1MKM A;  1ZG5 A;  1L3L A;  3JSP A;  2D45 A;  3F8C A;  1BC8 C;  1TNT A;  3HSR A;  3BWG A;  3I4P A;  3HRS A;  3FM5 A;  2JRT A;  1BJA A;  3K0L A;  3RDI A;  4XLP F;  3J81 K;  2F5F A;  2HFH A;  1HST A;  1I1G A;  2HTS A;  5LGU A;  3HRT A;  2A68 F;  3FHZ A;  4ON0 A;  2OA4 A;  5DV5 A;  3FX3 A;  1I1S A;  3N97 A;  2VBZ A;  4EJV A;  3E6C C;  5FFZ A;  2AS5 F;  1G3Y A;  1RNL A;  1ZG3 A;  2UXX A;  4UV8 A;  5BMZ A;  3F8M A;  3M9A A;  4BNC A;  3DFG A;  2V6C A;  4PZJ A;  1EH7 A;  1R5H A;  3P7N A;  4XSZ F;  3GZ6 A;  2A3S A;  3O6B B;  1D3Y A;  2DBB A;  1B4A A;  2DAO A;  3SZT A;  1H9T A;  4KT5 C;  5HLG A;  2QYO A;  2OD5 A;  1SFE A;  3JTG A;  2FQ3 A;  2DPD A;  1ONV A;  3KP6 A;  2XRO A;  1BIB A;  2L01 A;  4AIH A;  5FFX A;  3GLX A;  5DYM A;  5D4S A;  5H20 A;  4S05 A;  1OYW A;  4G6Q A;  3ZN0 A;  1K78 A;  2R7D A;  3COA C;  3E6B A;  1GXP A;  3RYP A;  4RB0 A;  2ELH A;  1FX7 A;  3SFZ A;  2FML A;  3IKT A;  1KU7 A;  3IHU A;  1BOA A;  4LD5 A;  1YFH A;  4I0B A;  2FA5 A;  4IXA A;  4I09 A;  4WXH A;  1OMI A;  4I2O A;  2YX4 A;  1IAW A;  2H6B A;  1KQ8 A;  2EK5 A;  1P6R A;  1Z1D A;  5ILV A;  1G6N A;  1E17 A;  2BE5 F;  2H09 A;  4A5N A;  1SMY F;  3E3V A;  2ISZ A;  3K69 A;  2FMY A;  1SD7 A;  1Z6R A;  5LGT A;  1O3S A;  1QZZ A;  3ERE D;  2GXG A;  5L3E A;  3KEQ A;  4ZZL A;  4DQ2 A;  1DPU A;  4UV9 A;  1U3E M;  2EFQ A;  3WTX C;  2NNN A;  4EJU A;  3SHF A;  4GO1 A;  2CSO A;  4EVI A;  3I59 A;  2E7X A;  5HLI A;  4R79 A;  4KIG A;  3I0T A;  5LHI A;  1XSD A;  1SD6 A;  4GYG A;  3HUG A;  4A0Y A;  1J2X A;  1ZYR F;  3MEX A;  3LA3 A;  4Q48 A;  2NRA C;  3LAP A;  1YS7 A;  3DEU A;  3QP6 A;  3WTT C;  1UCR A;  5E1W A;  3R6S A;  2HZT A;  3KET A;  5H6R A;  3V8J A;  4RGS A;  3CLO A;  1FC3 A;  4UXN A;  2H27 A;  2F2E A;  2M5W A;  3GFL A;  2FEZ A;  1UST A;  1KYZ A;  5IT3 A;  3DF8 A;  3HSE A;  3IWF A;  2HYG D;  3EQL F;  3WGH A;  3GFI A;  2P6S A;  2X0L A;  5IT9 Z;  1ULY A;  1XGO A;  4JQF A;  1MD0 A;  2Q2E A;  2MH9 A;  4WXD A;  5D6E A;  2IA1 A;  2XAH A;  1R23 A;  1JXS A;  2EFO A;  1SMT A;  1LEA A;  5FB2 A;  2QWW A;  3F6O A;  3RYR A;  2M8E A;  3MZH A;  1F9N A;  5LEK A;  5BPD A;  5L3C A;  3CUQ A;  2IRF G;  1QZY A;  2KJB A;  4CDG A;  3E6M A;  5H6Q A;  1YW8 A;  1TTY A;  2KRF A;  1ON1 A;  3DKW A;  3RIR A;  2W85 A;  2Y48 A;  4S04 A;  2V1U A;  2MC3 A;  1RI7 A;  4ZYE A;  5FLX K;  3WE3 A;  4A12 A;  3KP7 A;  1IXR C;  1R1U A;  2XAF A;  2ESH A;  2MBF A;  3AAF A;  5LLQ A;  2IJL A;  4HW0 A;  1RUN A;  1FSE A;  5L3G A;  4M6X A;  1W4M A;  1LVA A;  3MZY A;  4LLG F;  1DUX C;  1FY7 A;  3RI4 A;  4IJA A;  4D0P A;  3DV8 A;  3E97 A;  2OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...