2JMWA

Structure of dna-binding domain of arabidopsis gt-1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords DNA binding protein GT-1
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jmwA01
5FKLA 1R9TJ 3GTGJ 3OSFA 2DA4A 3Q0UA 4D5CA 4B3AA 1FTZA 1EF4A 5F0FA 1LFUP 1ETXA 5M5WJ 2XGCA 1JUPA 2WV1A 2R5YA 1SFOJ 3L1PA 3FIWA 4JX6A 1IUFA 2IBDA 4CYCA 1JT0A 1AKHB 1MBJA 1T33A 2JK3A 1RPWA 2ID3A 1WH7A 1MBFA 3GBGA 2DMTA 3BTIA 3LSRA 1Q1VA 1WI3A 3S15J 4MFDA 2XPWA 1JJ6C 1APLC 3O8HA 1XG1A 3Q0WA 4HNVA 2ID6A 4FCYA 3HB9A 4C3HJ 4IHXA 5DS9A 3HGYA 1IGNA 3BR6A 4A3KJ 2DA3A 4Y7NJ 5F04A 1JTXA 4C3IJ 2VI6A 1Z77A 1B72A 1RR7A 2L7FP 3BR3A 3LNQA 3ZQHA 4B4CA 4CYCB 2E19A 2K9QA 5M5XJ 2XPVA 1ENHA 2OF7A 3FKIJ 2EZLA 3K7AJ 3SFIA 1AKHA 4M3GA 3G1LA 1FEXA 4M3DA 4XICA 1MNMC 2CQQA 1IDYA 2B63J 1JTYA 2LP0A 2DTZA 5EG0B 1QVUA 1T56A 4QSHA 3A03A 3I4NJ 2YUSA 2YU9J 3BTLA 2XGDA 2X6OA 3IV5A 5BNGA 4I6ZA 4LOCA 1AU7A 4IHWA 4QIWN 1JKOC 2CJJA 1B72B 1JJ8C 4BY1J 2QF7A 2EZKA 3ZQCA 2KT0A 4XIDA 1ZGWA 3W6VA 2MW8A 2VKVA 2TRTA 3S14J 3B6AA 3JRHA 1HCRA 2VUMJ 4L5EA 5IP6A 2QCOA 3GTQJ 1RESA 2ME0A 5C44J 5GPCA 3F0CA 4IEJA 1UMQA 1MBKA 2VKEA 1FIAA 4FISA 3ZQGA 2CQXA 1IDZA 1TWGJ 1WCMJ 2XPUA 2COBA 3TW6A 1VF9A 1MH4A 4MIMA 1OCPA 2GLOA 1I3QJ 2Y2ZA 5F0HA 3GTPJ 1IRZA 3IH2A 2LLKA 2LFBA 3HGGA 3BQZA 1ZK8A 2R5ZA 1UG2A 3QQAA 1LE8B 1H8AC 4DZJA 4BY7J 3JRBA 2L0KA 2Y0SN 2WB1N 3O8GA 1RKTA 2DA6A 3S17J 4UUTA 1OFCX 3MKLA 2JJ7A 2XGEA 3FK6A 5FKKA 1JKRC 5M3FJ 2LK2A 2NVTJ 2M34A 1HDDC 2CUFA 4JYKA 1B8IB 2O8KA 5GPAA 5J1RA 3FK7A 2Y9ZA 3CCYA 4QTRA 3PO2J 1I6HJ 1GVDA 5F08A 4AYBN 2HI3A 1JT6A 2OPTA 2W48A 2XSDC 4W1UA 2G0EA 3S2HJ 2HQ5A 3MN2A 2DMPA 4I76A 1O4XA 1WH5A 4A3BJ 4A3MJ 2E2JJ 2M8GX 4G12A 4RBOA 3IH3A 1IC8A 1E3OC 3GTMJ 2Y31A 1QVTA 1Z0XA 2DA7A 3RQIA 1BJZA 2NVYJ 1NK3P 1MSFC 2R92J 1DU0A 4BXXJ 1SANA 3G1OA 2ECCA 1TC3C 3HOWJ 3JRAA 1GT0C 3S1MJ 2DA2A 2JA7J 1ORKA 3LSJA 1RKWA 1HDPA 3RKQA 1K83J 1TWFJ 2PMZN 1OJLA 2IEKA 2Y30A 3S1RJ 2AHQA 3QPLA 5JLWA 1VFCA 2RAEA 3I4MJ 4AUXA 5E3OA 5EEAA 4A3JJ 5DTDA 3LSGA 3WHCA 4DW6A 1GDTA 1BA5A 1F43A 3Q3SA 4RDUA 3OSGA 1QRYA 4GFBA 1GV2A 3BTCA 5EZHA 3SJMA 2H1KA 4DYQA 1P7IA 5EF6A 2MG4A 2L7MP 3HM5A 3TW7A 1X2MA 1P7JA 4XRSG 4UUSA 2JMWA 3BG5A 5J1UA 3CMYA 3A01A 2L9RA 3JRGA 4IHVA 3HOVJ 4ABZA 3LSPA 3G1MA 4MFEA 1HLVA 5EYRA 5GP9A 3H3VK 1Y1VJ 3A02A 3QPSA 4AC0A 3JREA 1G2HA 2R93J 1TWHJ 3JRIA 1VNDA 2ZB9A 3B6CA 2O9LA 2ME6A 1GUUA 3HOYJ 4A3EJ 3CDLA 4NDLA 2HYJA 2HXOA 2EH3A 2XB5A 1U8BA 4XRMA 4M3BA 3RZDJ 4DYRA 4V2GA 5IP9J 1MBGA 1FJLA 5EGOA 5C4JJ 1DU6A 3DCFA 2DN0A 4M6VA 3WHBA 4J19A 3DEWA 2M2EA 5C4XJ 2P81A 4D7NA 1JUMA 2R0QC 2EZIA 4A93J 4A3DJ 3HOUJ 1BW6A 4X1EA 2FD5A 1U9OA 1JGGA 5FLMJ 2DMUA 2E1OA 5J1YA 3Q0VA 5M5YJ 2R7ZJ 1GV5A 2DJNA 4MLOA 4S0HB 1ETOA 1ZR4A 5E3NA 1ITYA 1JUSA 1TWAJ 1PUFB 1MSEC 3S16J 2JA5J 3BR0A 2NS8A 4W97A 3S1NJ 3BQYA 5IOZA 3S1QJ 1S7EA 4A69C 2FQ4A 4BBSJ 5EGOB 2I10A 3S2DJ 1BL0A 1QPIA 2JWTA 3IH4A 1OCTC 3M4OJ 3VPRA 2FJ1A 1BW5A 2GM4A 2MGQA 4XRSA 5C3EJ 4DYCA 1LFBA 4A3IJ 1HOMA 2CRGA 2O7OA 2DA1A 3FISA 4JP0A 1ETWA 1B8IA 5K7ZA 1MBHA 2XB0X 2LY9A 1RETA 2CUEA 1ETKA 3CQZJ 5EZGA 1ETQA 1XC5A 3H0GJ 1POGA 5FKNA 2DMNA 2M9HA 3GTJJ 1IG7A 2Y9YA 2NVXJ 3JRFA 2CU7A 2KDZA 1X58A 2FX0A 5EDNA 3SDGA 2NOGA 4DZPA 1X2NA 1HF0A 2X9DA 2EBIA 1NTCA 2N8GA 4A3FJ 1D5YA 2HOTA 1YRNB 3BG9A 2LTPA 5F0CA 4C3JJ 1XS9A 5K7HA 5K7FA 9ANTA 4M3FA 5E3MA 2JA8J 5IYCJ 3M3YJ 2M0CA 2K9SA 3GTKJ 2L7ZA 1K61A 1YRNA 5IOYA 4B1RA 2K40A 2ECBA 3HDDA 4XK4A 2YS9A 3TP0A 1MH3A 2IAIA 5F1JA 4A3GJ 1A6IA 1H89C 2K9NA 2NS7A 1ZKGA 1F36A 2JA6J 4FE4A 1TWCJ 1WPKA 3MVPA 4A3LJ 1ZR2A 3BR5A 5IYBJ 3HOXJ 3NAUA 2HXIA 4UUSB 1MBEA 5IYDJ 1Y1WJ 4FE7A 3A01B 5FKMA 3TEDA 2LKXA 1CQTA 1JKQC 5JLXA 2VPRA 2E2IJ 3GTLJ 3BTJA 2H8RA 3HBLA 1I50J 1H88C 5IP7J 4MO7A 1NK2P 2WAQN 1LE8A 4M3EA 4V2FA 2GBYA 5FKOA 4FTHA 2HOAA 3OIOA 5FLVA 2HDDA 3LOCA 2HOSA 3BR1A 2MSYA 1W0TA 2LD5A 4C2MJ 3ZOBA 4IHYA 5E3LA 1UHSA 2AO9A 1ZQ3P 3RZOJ 4D5FA 1WGXA 1JKPC 3PM1A 2X48A 3BT9A 4Y52J 3C2BA 3E7LA 1A5JA 2XRLA 4JX5A 1FIPA 3HEFA 4X6AJ 4BKXA 3ZQIA 4D7MA 3PO3J 3BR2A 1ETYA 1AHDP 3HOZJ 1U9NA 2JN6A 2ELKA 2DMQA 4BBRJ 3GTOJ 2LVSA 1U78A 5FJ8J 2E2HJ 2EQRA 5M3MJ 2R5YB 3JRCA 3JR9A 5IPAA 4EEFG 5HODA 1ETVA 1IJWC 2DA5A 1W0UA 3NARA 2NVQJ 2R5ZB 3TP3A 3OOUA 3JRDA 3BG3A 1IV6A 2LR8A 3D1NI 4JX4A 2D5VA 2EZHA 2TCTA 5EG0A 1VI0A 3UKGA 3K2AA 5F27A 3ZQFA 4A3CJ 1PUFA 1FTTA 3ZQLA 1ZTRA 3HKZN 5J3LA
chains in the Genus database with same CATH superfamily
3WTWC 2DA4A 5ILVA 4E6KG 1IXRC 1ETXA 4RMNA 1FWZA 1RI7A 1VQPI 1RUOA 5ILSA 2KL4A 2WTEA 5JHUA 1JT0A 1AKHB 4XL9A 2BY2A 1T33A 1RPWA 3K2ZA 4HDUA 4XN3A 3GBGA 3KEOA 2IP2A 3I5UA 1Q1VA 2DDAA 4MFDA 4OOIA 1JJ6C 1A35A 5TGTA 4IVNA 4QWQA 4KDPA 2KIUA 2FBIA 1MJBA 2ID6A 2YR2A 3QP5A 4KICA 2E35A 2A5YB 4IXAA 4GYIA 1USSA 4RGXA 2V1UA 2STTA 3WTUC 1W7PB 3CCUI 2O61A 3BR6A 4A3KJ 5IT9Z 4Y7NJ 4XBFA 1JTXA 4C3IJ 4JOMA 2L7FP 1RZ4A 3DQVC 3ZQHA 3BP8A 4TV7A 2ELHA 3CDHA 1SD7A 2Q2EA 1ENHA 2XROA 1KZHA 3IRRA 3K7AJ 2BY3A 3ZMZA 2D1VA 2MH9A 4ZYEA 5FROA 5JVGF 1K6YA 5AIPA 4M3DA 1IF1A 2VE9A 4I2OA 1MNMC 2HYFA 1GXPA 1Z1DA 2B63J 2HNHA 3NRVA 3CJNA 3OR1C 2DTZA 3I56I 2R7VA 1YFHA 3TQNA 1STZA 4HPQA 1UG0A 2OD5A 1P4AA 1FSHA 1LKXA 2YUSA 3FX3A 3BTLA 3OYHA 4KFCA 2VOPA 3IV5A 5BNGA 1FX7A 3JAMZ 2CJJA 1B72B 3E3VA 3WGHA 2OCCH 3J7AY 3I59A 3MAJA 2DYSH 5B1AH 2KT0A 2NXNB 1SFXA 4Q5SF 2VKVA 1F5TA 1BN5A 2IW5A 1DDNA 3F8CA 3CUQC 2IS2A 3JRHA 1ZYRF 3BLYA 1HCRA 5IP6A 1XGMA 2QCOA 2PBIA 1LPQA 2FQ3A 3GTQJ 2L9SA 3K4BA 2R7SA 2EIJH 2P5KA 2WY8Q 1TWGJ 3E6DA 2XPUA 2COBA 4R1HA 1MJ9A 4MHGA 4BS9A 2DO7A 4MIMA 2GLOA 1I3QJ 1SMYF 2M45A 2Y2ZA 2K27A 1SVMA 1J7KA 1W7PA 1VZ0A 1IRZA 2LFBA 2F48A 3AG4H 3T8TA 3BQZA 1BI0A 5J4VA 2ZJPF 3MMYB 2H6CA 1S29A 1ZARA 3GMEA 1F1ZA 4RAFA 1LE8B 3C2HA 3OYAA 4BY7J 2HWVA 2RVCA 2E1MC 3NWSA 3GX4X 3S17J 4KT6A 1N75A 1OFCX 2W24A 4HSRA 2JJ7A 4OMZA 5FKKA 2QENA 4MQ9F 1FNNA 1EA3A 3LMMA 4I01A 2A5WA 1P4WA 3MZYA 3N4MA 1TT0A 2M34A 2VASA 4ESFA 4JYKA 3LL7A 2R7TA 2O8KA 5J1RA 2V7FA 3FK7A 2W82A 1GLNA 1XTAA 4IL6C 5F08A 3LA7A 2IVMA 1JT6A 3UNGC 2STWA 4Q4ZF 1Z3XA 1XSDA 1EKEA 3SDBA 1OR7C 3S2HJ 2LY2A 1D5VA 1X4PA 2E60A 2DJIA 3TO6A 1ZREA 3TBIA 2E2JJ 2COMA 3MKYB 1ULYA 2IJLA 1Y8QB 1E3OC 2IS1A 4S05A 2E5ZA 3KCCA 4XOTA 3IAM2 4CCKA 2R92J 1DU0A 4BXXJ 2KISA 1SANA 2HPMA 4P5OA 2Y69H 1LDDA 1R1TA 2M7AA 4HSTA 3JAMK 2DA2A 2PMZA 2BZTA 1HDPA 3RKQA 1IZ1A 1K83J 4HAMA 2A6TA 4MGRA 3SEZA 1OJLA 2GIVA 2Y30A 3S1RJ 2DTRA 4NQWB 2CGPA 4XLPF 2O3FA 2NRAC 1Z6TA 4G6DA 4AUXA 2O6GE 3I4MJ 4IF4A 3WHCA 1GDTA 1FOKA 3DTEA 4XKVA 1MNEA 2GWRA 5H6RA 3HJEA 3JW4A 3OSGA 1V3FA 1KONA 4FX0A 4GFBA 3SJMA 4ETSA 2H1KA 4N0BA 3DPLC 5EF6A 3GLXA 2JPBA 3GFLA 4GDFA 2AXLA 3PL8A 3ERMA 4R8HA 3HM5A 2L7MP 4BGDA 5DDGA 4KIFA 4MNUA 5J1UA 2OAZA 1IN7A 1V5FA 2L9RA 3A01A 1D8KA 4ABZA 2DCEA 4WX9A 1U5TB 4BDZA 4AC0A 2GOMA 3JRIA 1VNDA 3B6CA 2O9LA 5CVRA 4E7LA 2H6BA 2QWWA 3CDLA 3HRSA 3P9IA 2AS5F 3KEYA 2EH3A 2XB5A 3TO7A 4YIIA 4M3BA 2DFHA 3HC7A 4O6JA 4DYRA 4EJVA 3OYEA 1WWXA 4PSWA 3F22A 3VSKA 4U0YA 2CFXA 1SEUA 2DN0A 1EJ9A 3E5UA 4HYEA 3WHBA 4J19A 4LG3A 1HA8A 5C4XJ 2P81A 2EFOA 2R0QC 2EZIA 4EVIA 2IGOA 2XKPA 4A93J 4A0ZA 2Z9OA 3SXYA 5L3FA 1JI8A 3QPHA 3IHUA 3W2WA 3JCUC 1X3UA 1AWCA 1XN7A 1BR2A 4YFNF 2KJBA 1ETOA 2M7BA 2DT7B 4BHPA 1ITYA 3FMRA 1YW8A 1PUFB 3S16J 3MKWB 2EV5A 1REPC 5JFRA 5E1XA 3B73A 2VQGA 3MQ0A 3RDIA 1VTNC 3S1QJ 1MMSA 4KIBA 1YW7A 1ONVA 4BXFA 2FRHA 1E3PA 2RQQA 5K5OA 4BBSJ 4KN7X 3ELKA 1BL0A 1QPIA 5D6EA 3IH4A 3M4OJ 2FJ1A 1BW5A 2MGQA 4XRSA 4LITA 1HOMA 4DQ2A 5L3GA 2OC6A 4II2A 4ZTJA 3IUOA 3ZMDA 2XB0X 2FNAA 1ON1A 2L4AA 1ZGJA 4PJMA 5A2QK 3OV8A 2K9LA 2BEOA 3GTJJ 1IG7A 4PUSA 1S9HA 4N9IA 3JRFA 1J9IA 3FXLA 2KDZA 1Z05A 3DP7A 5DV5A 2E34A 3CZ6A 1ERDA 4CZCA 3D5SC 3DU5A 4G8XA 3K4KA 3C1DA 2LKPA 2X9DA 1NTCA 2LH9A 4NUBA 2HOTA 4Y33A 3BG9A 5F0CA 1XS9A 3K4NA 2V9PA 1YS7A 4GYGA 3JSOA 2R7XA 3FWEA 1BIAA 2OBPA 3CC7I 3D5RC 2W57A 1FOWA 1YRNA 2EFQA 3F9KA 5IOYA 3FXQA 3N05A 3OYBA 3SZGA 1DP3A 4HDVA 3CUOA 2YS9A 4XK4A 4A6EA 2ZKZA 2XF5A 2M30A 2EJRA 1YIOA 1H89C 3U9GA 2K9NA 2MBFA 1ZKGA 2HKOA 1FPQA 3FXKA 4FE4A 3J7AO 3MVPA 2XDVA 1XMKA 3OYDA 3NAUA 1GHCA 2EFPA 4XKBA 4UUSB 4RM3A 1MBEA 1YJWI 5FRMA 1ODDA 2MA3A 3I55I 5JLXA 2FE3A 2W1OA 3FZVA 2HDCA 2W85A 1R4MB 3RJPA 3UR3C 1J0RA 4GGGA 1T8IA 1H88C 4MO7A 3L2WA 2EFNA 2LY1A 2BVLA 3RTRA 1X19A 3CTAA 1FZPB 1VQLI 3KZIC 2FMLA 2GBYA 2JA2A 2BBYA 5FKOA 4FTHA 3WE2A 4RB2C 4ENMA 4HLYA 1B9NA 5HS8A 1MD0A 2PFBA 2ZXHA 2AXTC 2XF7A 1Z6RA 4M71A 2NOJB 4HBLA 1QBJA 1VQ7I 3I4PA 2CW8A 5FD6A 5E17F 3H1CA 1F4KA 5KCMA 1N78A 3VOEA 1K79A 5HDGA 1V5EA 5B5EC 2O03A 1YITI 3ZPLA 4CCNA 1FP1D 3OIQA 4P55A 4RS8A 1FMVA 5DD4A 2X48A 3BT9A 3KLOA 3IKTA 2VJJA 2QQ9A 2L9NA 3E7LA 3BZ6A 3RCOA 5GTIC 1MDMB 2PI0A 2XRLA 1SD6A 2L9VA 4B09A 3K1NA 3FHZA 1R5ID 4D7MA 1ETYA 1LB2A 4CCJA 2K4JA 4DBRA 3BCAA 3PFIA 4PFOA 1D1BA 1U9NA 2JN6A 4PFPA 1FMWA 3FMQA 1JGSA 4F92B 2IGKA 3KYLA 2D1HA 2RKHA 4EGZA 2FUG2 2K3FA 3F8FA 1TBXA 2IXSA 2KLOA 3HSRA 1NG6A 4YFXF 1EH7A 4UB6C 1IJWC 4E7HA 1ETVA 4DJAA 1QQIA 1I3AA 3FF5A 2DA5A 1MMNA 2R5ZB 3TP3A 3WTYC 2M8EA 3BG3A 3HHGA 1ZN2A 5HDKA 3JRDA 1G3SA 1MDMA 1SFEA 3RI4A 4JX4A 2D5VA 3T1BA 3LFKA 2VONA 3UKGA 5D4RA 3LQQA 2HOEA 4EGYA 1PUFA 2ZMEB 2RN7A 4J01A 1FTTA 5JI6A 2OA4A 4UVAA 4YRVA 2L5QA 4HLXA 3S8PA 1R23A 1ZTRA 3ECHA 2A05A 1O3TA 5DYMA 4KA4A 4OU0A 4QPOA 3F72A 3H35A 2E7WA 2LOOA 2A61A 4BHBA 3LFUA 3GTGJ 3ZMVA 4FETA 3OSFA 4B3AA 5CLSA 1FTZA 2G7HA 1O3RA 1LFUP 4X0GA 1I5ZA 2Q2EB 4BH9A 5LBQA 3HOSA 2R5YA 1PUEE 2F5FA 2FBKA 2Q1ZB 4JX6A 4CYCA 1VQ9I 1MBJA 3HL2A 3CMAI 1D0YA 1V5GA 4E7SA 1Z3YA 3H9QA 2HU9A 3F21A 3ZQ7A 2I5UA 2EIMH 3LSRA 1E3HA 3I0TA 3S15J 3OS0A 2XPWA 1XG1A 4HNVA 4CCMA 5ICGA 1G4DA 4XORA 3HB9A 2CQNA 4C3HJ 2DOEA 5J4YA 2Z16A 3CP2A 1I39A 1YG2A 3HGYA 4NNJA 2R7RA 1T2KA 3LQRA 2DA3A 1R49A 4G6QA 4ENKA 3E6MA 1YOVB 4EQQA 3K4MA 4RB3C 1KA8A 1RR7A 1RC9A 2WAFA 3HRMA 3MWMA 2ISZA 4CYCB 5M5XJ 2K9QA 4LMYA 2XPVA 3PFYA 1F9NA 5DUIA 3H5AA 3FKIJ 4UHTA 2KZVA 1AKHA 4M3GA 5KK1A 5JR3A 2BW3A 2ZMEC 2CO5A 3WTTC 1JE8A 4C2UA 1ZGAA 2CQQA 2RREA 1V54H 3FBNB 3MEXA 2QKLB 1R6RA 4FHTA 3QYBA 5ED4A 1FBSA 3V8JA 5BPIA 1IUYA 2YU9J 5BS6A 2QBYB 3KEQA 3LA3A 3NQOA 1OMIA 1TTYA 2XGDA 3VDXA 2X6OA 3QAHA 4ZYGA 2LNBA 2O5RA 4LOCA 3GEZA 1JKOC 3G71I 2IGNA 2KRCA 2H8WA 3L2VA 3ZQCA 1SAUA 5L3CA 4RGRA 5B66C 4XIDA 3W6VA 3S14J 4NC7A 4A5MA 4Q47A 1RIOH 4YIRX 2ELJA 3ZGKA 2L01A 4PSXA 2VUMJ 4L5EA 3V7CA 1VQNI 4LIVA 1WKMA 3EQLF 3OS2A 3HG9A 4P9UA 3TOBA 1A31A 1MBKA 1FIAA 4ZDOA 3PIPF 1IDZA 3HRUA 4XKWA 1WCMJ 3C2GA 1R1UA 2Z1DA 3HZJA 4AIHA 1A6QA 2L02A 3DV8A 4PJNA 2QZ8A 2EV6A 2K3PA 4RAYA 2VL8A 2JRTA 4H4KC 3VB2A 1QA6A 5F0HA 3AG1H 2E7XA 4ITVA 1SMTA 3CF2A 2LREA 3GTPJ 3C18A 2LLKA 5HLGA 3W2VA 1QNTA 2ZBKA 2JUCA 3E6CC 1IN8A 3BG6A 1UG2A 3QQAA 3K4JA 4LD5A 3K70C 3JRBA 2HTJA 1T39A 2KDOA 2Y0SN 4JBAA 4XLNF 2HVSA 1QGPA 2OV7A 2DA6A 1VQ5I 2L4MA 2V6CA 2XKOA 3R61A 3FK6A 4ZTFA 4BAYA 4IRGA 4M73A 1JKRC 3CESA 2YU3A 3HSEA 3RYPA 2LK2A 4BJ6C 3QWLA 2NVTJ 3KE2A 1TNTA 1UELB 3H0DA 2ZJQF 1CGPA 2DK8A 3W6KB 2XAHA 1B8IB 2EB7A 5GPAA 3R0JA 3ZP5A 2Y9ZA 4ZZLA 3CCYA 3PO2J 1NG7A 4UV8A 4ZZDA 2HI3A 5LHGA 1V4RA 1X4OA 4EM0B 1S3JA 2W48A 1T0FA 1M1EB 1W5CC 2G0EA 4P96A 1ZG5A 2HQ5A 4WCGA 2DK5A 2DMPA 1MIJA 4I76A 1O4XA 5DM6F 5LEJA 4KN4X 4H0EA 4A3BJ 2Z3YA 2F2EA 2RQPA 3M8JA 4RBOA 3X2QH 2CUZA 4B44A 1MGTA 1ZRFA 4AVPA 4UY8I 1SVOA 2XHKA 2KIQA 2Y31A 2DA7A 3RQIA 3RSNA 2M5WA 1S7OA 3CO6C 1BJZA 2NVYJ 1XCBA 2DLLA 2ZNZA 4NQWA 5HLHA 1MSFC 3FM5A 3T8RA 2ECCA 3HOWJ 2L7KA 3JRAA 3ONQA 3VYTB 1ORKA 3LSJA 1RKWA 3HHHA 2ZMEA 4G6TB 1BOBA 5LRRA 3IWFA 2AHQA 3DKWA 1TP4A 4PGHA 2GA2A 1VFCA 3VODA 5EEAA 5E3OA 3G73A 1UFMA 5HNFA 3L7WA 3LSGA 4DW6A 3FXRA 2K7LA 1QO0D 3K1MA 2OQRA 1R00A 1T98A 3E5QA 4BQAA 5EZHA 4XM3A 2F4MB 3AG3H 4L9TA 4U88A 3H92A 2MG4A 3TW7A 4UUSA 1WJAA 1P7JA 1X2MA 4RLQA 4L9NA 1KU3A 1WI9A 2K9MA 3CMYA 2WC2A 3LSMA 2ZO4A 4IPAA 5EYRA 3A02A 1O57A 1G2HA 2QYOA 1W5SA 4GRIA 2ME6A 4U0WA 1GUUA 2R7DA 4NDLA 2CW7A 4A3EJ 4CHUA 1BJAA 4LG0B 1R36A 2HXOA 3Q9SA 1U8BA 1X1DA 2FSWA 1T08B 4Y15A 1DPUA 1KGSA 3K0LA 4V2GA 5KVRA 2XV4S 4N4NB 5EGOA 2WV0A 4M6VA 5J40A 4D0PA 3IP4B 1JUMA 4D7NA 2HQRA 3BZCA 3FXUA 2LG4A 2CSOA 2JPCA 3J7YJ 1HKTA 2VKDA 4X1EA 5IY5H 1E0EA 4B3XA 1JGGA 5FLMJ 2DMUA 1YI2I 3Q0VA 2R7ZJ 4MLOA 1MKMA 3HIFA 2I8DA 2EA4A 2VPLA 1ZR4A 5D8LB 1MSEC 2IRFG 3GF2A 3HSFA 5CVJA 5IOZA 3MFKA 1VQ6I 1S7AA 4Q48A 5CPRB 2LBFB 3K10A 3DPUA 2KHMA 3G6EI 2A68F 4I02A 2L2OA 2PMHA 1IXCA 2JWTA 1OR7A 2BOLA 3F8BA 4OIRF 1FY7A 1DGRM 4XSXF 1W36C 1WQ2A 1LFBA 1LVKA 3RKYA 1IN6A 2DA1A 3FISA 2LYCA 2IA1A 2X1CA 2EFWA 2F6CA 1MBHA 3VSLA 1ZRCA 4L5JA 2K4BA 2LY9A 1RETA 3I54A 3SZTA 3CCEI 1ETKA 2F4IA 1ETQA 3ROUA 3QRFF 4CCOA 1POGA 2OQGA 2H09A 2VBZA 4BEHB 1Y0NA 3L2CA 2K85A 2MC3A 2VJIA 2JZYA 2DPUA 2PJPA 5EDNA 3L2UA 4IO9F 4ASNA 1S6LA 2P4WA 2CYYA 2NOGA 1X2NA 2OZ6A 4DZPA 4YFKF 4ENNA 4A3FJ 4IZZA 1YRNB 2XSJC 1VQ8I 3FMSA 4RB0A 5FLXZ 5E3MA 4QPQA 5IYCJ 2M0CA 3GTKJ 3GZ6A 3I59B 5DCFA 4B1RA 5LEKA 3HDDA 1FBQA 2IT0A 4V19K 4PGGA 5F1JA 1V55H 1MMDA 5CQGA 3ISPA 4QLCU 4NHJA 5E79C 4HV6A 3QYEA 3WU1B 2NS7A 4BXUA 3AL0B 1UCRA 4A3LJ 2UZKA 2GXGA 2EINH 3FBIB 5ICFA 1J2XA 2MLKA 4LB6B 3HOXJ 4M6YA 4KNYA 5IYDJ 4HA8A 1WSUA 2H94A 3ERED 1JKQC 3PNVA 2XC7A 2Z99A 3WG9A 3TOAA 2VPRA 3CJQB 2E2IJ 3COAC 3BTJA 2DT6A 4XQFA 1O7LA 5JVTA 5IP7J 4PCQA 4Y4RA 4I7HA 2WAQN 3DLAA 5J47A 3J81K 4M3EA 2ADUA 5L3DA 2D45A 2X1DA 4IQ4A 4IJAA 3PQKA 4HNTA 1O3QA 1QU3A 3GO5A 2X0LA 3KP2A 4ZJZA 1TLHB 4LK0F 3LOCA 1LDJA 2B9SA 3BR1A 4B48A 4C2MJ 4NBQA 2KJCA 4IHYA 3I64A 5E3LA 1OISA 1I6XA 2Y0MA 5FO5A 3WG7H 5J6XA 3PJRA 2JUGA 2G7UA 1Y0UA 1TZLA 2RDPA 3SYTA 1ZQ3P 3LSTA 1TL8A 3M07A 4D5FA 2V1NA 3PM1A 1XCVA 2DT5A 3ZQQA 3MZHA 1A04A 2HZDA 3JTHA 3DU6A 4HW0A 1RNLA 4CO8A 1SC7A 1OYWA 1FT9A 4JX5A 5F1RA 1VQMI 3F6OA 4L0YB 3VYUB 3ZQIA 3F6VA 2XGXA 1LEAA 2LKSA 3GFMA 2F5DA 1AHDP 3LSKA 3HKZA 2CH0A 5L3BA 3L2QA 2R3SA 4XLAA 5D4SA 2DMQA 3LAPA 1G3WA 1IRXA 4BBRJ 2OTJI 3Q9VA 4EMSA 5J8CA 1U78A 5E8IA 3BROA 5EJCA 5ERIA 2QEXI 4YG2F 1KQ0A 2CG4A 3MCZA 1LUJB 2X51A 3CD6I 5DM7F 2LR8A 3KP3A 4HZFA 4HOBA 2EZHA 4E7ZA 5EG0A 2DU9A 1XPXA 1QZYA 1MMAA 1G6NA 2X85A 4KMUX 1PP7U 2EPFA 3M9AA 1LDKB 1ZH5A 1P4XA 3CF5F 2KZGA 4CYDA 2WA0A 4M6XA 2R7WA 4HX7A 1TQPA 3GZNB 1YX3A 2P6TA 3DF8A 2LBFA 3K70D 1FYKA 5LGUA 5FLXK 1OCOH 3Q0UA 2HVQA 4D5CA 2RC4A 2YPRA 5EEGA 2J5PA 1EF4A 5F0FA 3KP4A 3U21A 3JTGA 1JUPA 3FXJA 1DQUA 4M9XA 3ZN1A 1R1VA 3L1PA 4N9HA 1IUFA 2IBDA 2JK3A 3RQ4A 3E1SA 3S3NA 1TW2A 2ID3A 1XSXA 1BC7C 1WH7A 3FDYA 1Z91A 2DMTA 3DBRB 4MTDA 1WI3A 1LJ9A 2VOOA 3L9FA 4NC8A 4IOAF 2VE8A 1LQ1A 3TDUC 4FCYA 5BQTA 2YSRA 2M0MA 3QYFA 5DS9A 1TNSA 1IGNA 5LLQA 3K6GA 2MH2A 3K4LA 2X6XA 2HQNA 5LRSA 2EILH 1Z77A 3CC4I 3BR3A 3MD2A 1MMGA 4B4CA 1J5YA 2ETHA 3H9GA 4HF1A 1D3YA 3R4KA 2KRFA 2FBHA 2OF7A 2CMPA 2HVRA 2EZLA 3SFIA 3EETA 4LB5A 1PP8F 3ESWB 3AFHA 3G1LA 1FEXA 3OR2C 1P2FA 1IDYA 2LF7A 4KIGA 2H27A 1JTYA 2A3SA 1YYVA 1YO5C 1PVEA 2CQ7A 2LP0A 4OINF 5EG0B 4BACA 2M3AA 2V79A 2ACJA 1T56A 3P7NA 4P1WA 4CUGA 1DP7P 3IC7A 1O7FA 2QQ8A 1WJBA 2XASA 4E70A 3I4NJ 1HXDA 3IWZA 2E1NA 2P5VA 4I6ZA 1VQKI 4QIWN 2Z33A 3GYHX 4BY1J 2VIXA 2QF7A 3FXMA 3DEUA 2BHYA 2EZKA 3O2PE 1ZGWA 1D0XA 2XAFA 2MW8A 1BBYA 2VJ4A 4F55A 2WB1A 3AL0C 3KLNA 3G2BA 3JSPA 3E97A 3K4CA 2VQLA 1RESA 2ME0A 5C44J 4IHSA 5LGTA 3F0CA 4EV0A 2F4OB 5L3EA 2RGVA 1X3WB 3H9JA 3CCLI 2VKEA 3LSIA 4EM1A 2CQXA 2P5LC 1RRJA 4G94A 3ZMTA 4WK8F 1PDNC 5BMZA 1OYIA 2W00A 3WTSC 1WVRA 1S72I 1VF9A 3QOEA 4AYBA 1MH4A 3AKZA 1LNWA 4Z2YA 4I0AA 2HZTA 2H1LA 4RM2A 2PX9A 2FF4A 2KIFA 2V9VA 3T0YA 3IH2A 4HX4A 3HGGA 1XGNA 2R5ZA 1HKQA 1ZAOA 4IRIA 4BQOA 1B9MA 2DAOA 4HEA2 3RPQA 1H8AC 2BE5F 3WGGA 4Y17A 2L0KA 2DQRA 2WB1N 4HG2A 1KU9A 3KP6A 3KZZA 4UUTA 4XLFA 2CWEA 1D1AA 2VB6A 4BQNA 5E18F 3LAJA 3BC8A 3I58A 3GZ5A 3OS1A 1B1BA 2E71A 1I6HJ 4B47A 3OL4A 2ZXJA 1AOYA 4XSZF 1GVDA 2CS3A 1ZELA 4M72A 3P5JA 1Y6IA 4M9ZA 1H0MA 2A6HF 4RAGA 4A0YA 5CVUA 3HTSB 1D0ZA 3V7RA 5E8GA 5H6QA 4CH7A 4AM3A 1WH5A 4A3MJ 1FBUA 2M8GX 4G12A 3V4GA 2Q0OA 3J7ZI 3RYRA 4KT5C 3A0BC 1QVTA 3OMYA 2XAJA 1NK3P 3ZMSA 5K1YA 4PZJA 3G1OA 2DW4A 3VYSB 1TC3C 2KKOA 1GT0C 3BJAA 3DPTA 3DTKA 5ICCA 2JA7J 2ZXWH 3I3LA 3O6BB 4EJUA 1TWFJ 2PMZN 5E1ZB 1ACIA 3EUHC 3OYLA 2PEXA 5GADJ 2HQAA 2FOKA 3H36A 3DWLE 4C9YA 4A3JJ 2GZWA 2BHZA 1T6SA 4HX8A 1BA5A 1YJ9I 4K2EA 5CQEA 2R7UA 2R4GA 4XONA 3FM3A 1OYYA 4RDUA 1S8NA 1GV2A 1R5GA 2OZUA 3SQNA 2V4JC 2QVOA 1HW5A 1PYVA 4XMYA 4BNCA 3ZXSA 3KX2A 4XRSG 1QZZA 4P9FA 3H5NA 1G8XA 3BG5A 1BC8C 4IHVA 3HOVJ 3ABUA 4ZYAA 1GVJA 1U0JA 4MFEA 1HLVA 4RAZA 1Y1VJ 4JQFA 4GO1A 2R93J 1TWHJ 4ZH4F 2ZB9A 3ASNH 2JVHA 1OCCH 2FMYA 2HYJA 3HUGA 3P9CA 2EA2A 4XRMA 4DBQA 3RZDJ 1R71A 3KZYA 4LGWA 5B3SH 1SVLA 2W25A 2FU4A 4O3MA 1MBGA 4D9JA 3W3CA 1S5LC 3DCFA 1WJCA 3SZPA 2JT1A 5E1WA 3VWBA 3DEWA 1FYLA 1TT5B 3BWGA 4XOPA 3DLLF 3HOUJ 3V8KA 4XN0A 3WU0A 5H2FC 1BW6A 5D5XB 2FD5A 2X6WA 5EEHA 3KYCB 2E1OA 4E7JA 3J80K 4NC6A 1FSEA 4BE2A 2DJNA 4S0HB 4FT8A 3S93A 1HKSA 5KAIC 1Z21A 5AONA 5E3NA 1TWAJ 3GLLA 3F3XA 1O3SA 2BV6A 5IT9K 4G9YA 3S1NJ 2G9WA 3MZ8A 3CCQI 1G3YA 2ZNYA 1S7EA 2PQ8A 1IN5A 3KIOA 4E4HA 1IO2A 3GXOA 2I10A 5EGOB 3HRTA 3WGIA 3IKVA 3VPRA 4WF2A 1R22A 5F64A 2WAEA 5C3EJ 2YX4A 4EJOA 4A3IJ 2BXYA 4AWXB 2O7OA 2V26A 2GOXB 1YIJI 2CV0A 3GW2A 2V1DA 2CFOA 4BEHA 1B8IA 3R0AA 2JQ7A 5CJ9A 3W6JB 3LSHA 2VBXA 1TW3A 1QZEA 3SEQA 3CQZJ 2O0YA 3WE3A 3EPZA 2AQFA 1XC5A 3H0GJ 5FKNA 2EWNA 1D1CA 2QKMB 3BZKA 3K9TA 5DEQA 5HVQC 3G4SI 3F23A 2CU7A 2NVXJ 3HUGB 1I27A 2FX0A 5FB2A 4BE1A 2R7QA 2DOFA 2EV0A 1YLFA 5LFAA 1U2WA 2EBIA 2V9KA 2N8GA 3BCBA 1D5YA 1FC3A 1UJ8A 3EUAA 2XRNA 4C3JJ 3C7JA 3TO9A 2BGCA 2DQLA 5DCMB 1DPRA 4M3FA 2QUFA 1HBXG 5HLIA 2JA8J 5TJJA 3S3MA 2HPIA 1BR4A 2VT3A 3P9KA 3D5LA 1K4SA 5D6FA 3QP6A 2K40A 2BVMA 1LVAA 2ECBA 5ILUA 2C6YA 3M1CA 5JHFA 4KISA 5K5QA 3TP0A 1MH3A 2IAIA 2HEOA 1WJEA 1CF7A 2FOWA 1UZCA 1QHGA 1A6IA 3OOPA 4Y3OA 2BYVE 4II3A 2LDUA 2GXAA 3OYKA 2JA6J 4UUVA 3WTVC 1WPKA 2M4KA 4HRIA 4DIQA 3AAFA 3BR5A 4KYWA 2HXIA 3I71A 3DXJF 3PQJA 4B43A 2V6EA 1YQAA 2MD0A 5LGNA 3QU6A 1CQTA 2PMUA 4KMFA 1TQMA 1FP2A 1XDUA 2WAQA 1I50J 5LHHA 5HNHA 2QGUA 1WJFA 3TKYA 2UXNA 1BIBA 4F3QA 4UNOA 4V2FA 6PAXA 1YW9A 5K5RA 2GQQA 2GIZA 3BPVA 2HOAA 3OIOA 2CW0F 3ECOA 5FLVA 2HDDA 4G7HF 5HLTA 1BI2A 1W0TA 4L9JA 2PJRB 5GTHC 4U7BA 3MKZA 1UHSA 1TQIA 2CV1A 2XAGA 4RGUA 3OIPA 2UWMA 3RKWA 1G3TA 4HNUA 4WWCA 5ICEA 1EV7A 1RR8C 4I98B 1YHQI 1SFUA 1WGXA 3I53A 1JKPC 2ZFWA 1IAWA 2NAZA 3C2BA 3BJ6A 3K69A 5HOOA 2WADA 4CZZA 5LD2C 1FOYA 4M74A 1FLIA 2IA0A 5KAFC 1A5JA 3CCVI 1W36D 2OU2A 1WRJA 2VN2A 3PNTA 5CYVA 3OWTA 2B7EA 1FIPA 3HEFA 4X6AJ 3PO3J 3HOTA 1Z7LA 1OPCA 3BR2A 4XKCA 4BDYA 4ENJA 4PJJA 4BJ5C 1X1PA 2E1CA 5A2QZ 2Z2SB 2ELKA 3FHNA 1WHUA 3CCSI 2O8XA 2F5CA 1KU2A 3GTOJ 2LVSA 5D5UB 5CKTA 1U6GA 3WTXC 2VJ5A 5FJ8J 4N4OB 2EQRA 1XGSA 3ZR8X 5BPDA 2PN6A 1JHFA 2NNYA 4MQVA 2DI3A 3JR9A 1BM9A 3VFZA 2X1EA 2MLGA 5IPAA 2J5OA 3H3ZA 3NARA 2BW3B 5HODA 2NVQJ 1AA7A 3OOUA 4RB1A 2RV8A 1LEBA 3PIOF 4GXOA 1OQYA 5E20A 3ABMH 2DFEA 2EIKH 2ISYA 2R7FA 4AU7A 1VI0A 2WBMA 3PNYA 2DXIA 5GAGJ 3K2AA 3ZQFA 3V7SA 4A3CJ 1D8JA 3ZQLA 5FRNA 3CUQA 1U8RA 1XGOA 3WU2C 3HKZN 2ZSIB 4ESBA 3EYIA 3SHFA 1RUNA 1MNDA 4PJ0C 4AIJA 1IRGA 5J3LA 3A0HC 4OIPF 2LC2A 5FKLA 1R9TJ 1KYZA 3REOA 3L00A 5M5WJ 2XGCA 2WV1A 5KHDA 4RLFA 2NYXA 1SFOJ 2UV1A 2MABA 2MFZA 3FIWA 2TDXA 2LMDA 1Y39A 2IGMA 1UB9A 2Y48A 4EJWA 1MBFA 3KFWX 4XNFA 4EATA 3BTIA 2M87A 4FX4A 3CUQB 1ZLJA 1APLC 3O8HA 3O3KA 3Q0WA 1Y56A 1H9TA 1L0OC 2E5NA 4PK4A 4EM2A 3ABTA 3M8FA 4KITB 3OYNA 3FXOA 1WFXA 2XIGA 4XLEA 4BYYA 3U1DA 4IHXA 3QPTA 1K7AA 2E1MB 4OAZA 3RIRA 2Q8KA 5F04A 2VI6A 2ZFUA 1HW2A 2IS6A 4BJTA 4DOZA 5J8FA 1B72A 4E7IA 2EK5A 1XD7A 2XUBA 3LNQA 3GCMA 1EH8A 1W1WE 2AQEA 4WXCA 2E19A 4S04A 1U5TC 1ZG1A 2YX7A 3I9V2 2XF6A 2GA1A 4EJTA 1X1AA 2L54A 2FXAA 3RKXA 4UB8C 1R58A 3NWTA 1UAAA 4XICA 2Z5UA 2QQAA 1USTA 4OIOF 5D5VB 2ZJ2A 2K02A 1T38A 1QVUA 3OYMA 4BUPA 4ANJA 4I09A 1SFKA 2FNPA 2VXDA 1XMXA 4QSHA 4MEYF 3DTIA 3A03A 3TDZC 5KNLA 2MYSA 3C3WA 3GUDA 2JVGA 2IPQX 4YEJA 3ZMUA 1AU7A 3H5RA 4IHWA 3CJTB 1UHMA 2R7OA 3AG2H 1KQ9A 3A1YA 3E5XA 4PJLA 4XLCA 1JJ8C 3E6BA 3DBLB 2P7VB 4CA0A 4IRHA 2LRDA 2CQKA 1X1BA 1SAXA 2TRTA 3B6AA 1I1SA 1WZ2A 1KQ8A 4O5VA 3DKYA 1B6AA 2ESNA 3M8EA 3NEUA 4Z6YA 3OYFA 3V8LA 5GPCA 2DODA 2P0WA 4IEJA 1UMQA 3GFIA 4F52A 4HQEA 3ZQGA 4FISA 4AVZA 2CV2A 1N25A 2FEZA 1IW7F 5B1BH 3TW6A 2VC1A 3OYJA 4AD9A 2MC4A 1OCPA 1N77A 2IA2A 2KIMA 4MTEA 1LFPA 3F8NA 1ZHFA 3ASOH 4OMYA 3B02A 2HGCA 1K78B 2GAUA 1KYWA 1ZK8A 3BJOA 2W7NA 4OIQF 3ML6A 1YJNI 4A5NA 4MEXF 4DZJA 2DBBA 1MJAA 5HDNA 4XR6A 3DBHB 3DFGA 3EUHA 3O8GA 1RKTA 1BI3A 2Y0SA 5FFZA 1XB4A 3MKLA 1HW1A 2XGEA 4UVBA 1W5TA 1XX5A 2VBWA 1G59A 4A2UA 5M3FJ 2OTLI 1R4NB 4KUMA 4CXFA 3HTUA 1HDDC 2CUFA 2A69F 2KFDA 3BDDA 2F5VA 4LLGF 1A36A 4QTRA 4HF0A 1ON2A 4AYBN 2XAUA 5AIQA 2KMUA 1K78A 2OPTA 2UUZA 4NB5A 3G3ZA 2XSDC 4W1UA 1W4MA 4XLHA 2IS4A 1Z7UA 1SD5A 3MN2A 2KQRA 4U87A 1KU7A 4XRFA 4Y13A 4IKFA 1WJDA 3BPXA 3IRQA 3HXLA 4F7ZA 3QODA 3IH3A 1IC8A 3IAS2 3ZN0A 3GTMJ 1Z0XA 2V1XA 3KPHA 1NH3A 2UXXA 5D8KB 3CCJI 1P9QC 1XDSA 4A0XA 4LIUA 4IOCF 3TMOA 3CLQA 3S1MJ 1HC8A 5DUKA 2W4SA 3BY6A 5F6FA 2ZCWA 3OYIA 4U0VA 2IEKA 3FKJA 1QHHD 3QPLA 5JLWA 5D5WB 1IRFA 5HS9A 4CDGA 2RAEA 4LLNA 5DTDA 2BY0A 3R6SA 1CF7B 3TGNA 1L3LA 4DNCA 3KETA 1XSVA 1F43A 3Q3SA 3VYRB 1JXSA 4LLLA 5H20A 2A6EF 2QSHX 1QRYA 2DOAA 3PSFA 2RNGA 3BTCA 3SFZA 4I99C 4FASD 4DYQA 1P7IA 4F91B 2QA4I 3J81Z 2JMWA 5FFXA 3JRGA 3LSPA 3QU3A 3G1MA 1Z9CA 5GP9A 3H3VK 2KPMA 3QPSA 3JREA 2HS5A 2WY7Q 4UVCA 3S3OA 4RGSA 3GVAA 3HOYJ 5GAHJ 3CCRI 1UHWA 5IT3A 3EUKL 1ZG3A 3K1PA 4FQGA 1VQOI 4BL0B 3QOPA 1GXQA 2B0LA 2NVUB 5IP9J 1Y8RB 2Y75A 2P8TA 1T0FC 1FJLA 5C4JJ 4HF2A 3DEEA 1DU6A 2VQCA 1K6OA 3TL4X 5CVVA 1WJ5A 2PJRA 2M2EA 3ABKH 4A3DJ 1DUXC 1HQCA 3ULQB 4IQJA 1U9OA 4R79A 4HV5A 3KYDB 2OCEA 4WXDA 5J1YA 5M5YJ 2NNNA 4L18B 4OWRB 1GV5A 1B4AA 4KJZA 1Z67A 3V42A 2X6YA 1JUSA 1X1CA 3F8MA 3HPGA 2JA5J 3BR0A 2NS8A 4W97A 2ZC2A 1YS6A 2JRMA 3BQYA 5CVIA 4GCVA 3IL2A 1K4TA 1FYMA 2P6SA 3PSIA 2VLAA 1YTYA 3WTZA 4A69C 4BU2A 4ZC3A 2OJED 2FQ4A 2LF8A 4M9SA 2QSFX 2QBYA 1W7PD 3S2DJ 2KP6A 3L09A 4I0BA 3RPUD 1OCTC 3Q5FA 1BI1A 1YX5A 2GM4A 4C30A 4BQQA 4DYCA 2DYRH 2NS0A 4IX7A 3R60A 4E7KA 2CRGA 2JTVA 3ABLH 4IHTA 3U1KA 3DKXA 4ESJA 2XAQA 5FGMA 4JP0A 3OY9A 1ETWA 4ZDLA 3PUFA 5K7ZA 4YIFA 2CUEA 5EZGA 2HTSA 3HPHA 3RPUA 4ON0A 2DMNA 2M9HA 4L9VA 2Y9YA 1R7JA 2DFIA 3N97A 1ZLKA 5DCMA 1X58A 5DD8A 1ZRDA 2F5EA 4HQMA 3SDGA 2VODA 1HF0A 2W84A 1P92A 2XVCA 3CDIA 1MZBA 2LTPA 3BOQA 3CC2I 5K7HA 5K7FA 2FA5A 4A12A 1OKRA 9ANTA 2WWYA 1IV8A 2ZXIA 2VXZA 3M3YJ 3J80Z 2K9SA 2L7ZA 2JSPA 1K61A 5HS7A 3A2KA 2LSOA 1I1GA 2M4GA 4ZYHA 2E36A 2QM3A 4CICA 2OUMA 3M1EA 2M1BA 3CMEI 1IN4A 2ICWG 3S32A 4ZYDA 4A3GJ 3LA2A 3KP7A 4G7OF 4JK1X 3ZRGA 1E2XA 2PLYA 1J59A 2A07F 1F36A 4RA2A 1C0WA 1TWCJ 3CCMI 1FOXA 1ZR2A 4YELA 3CMMA 3WODF 1IXSB 5IYBJ 2VQHA 2P7CB 3CP8A 2CUJA 4OAYA 2QSGX 3GWZA 3CO7C 1Y1WJ 4FE7A 3A01B 5FKMA 3TEDA 1SD4A 4ZDPA 3VEPA 2LKXA 5FD5A 1HSTA 1T95A 3HYIA 2DPDA 4F93B 2ZJRF 4AIDA 3GTLJ 2H8RA 5LHIA 3HBLA 4L0ZB 3S2WA 2HR3A 4AIKA 1NK2P 1NHAA 1LE8A 2GXBA 4LK1F 2QLZA 4G7ZF 1P6RA 2DFFA 3A4CA 1HSJA 2HFHA 1OCRH 1J75A 1PJRA 2HOSA 4L5IA 2MSYA 2LD5A 2BY1A 4B8XA 2VBYA 2KRHA 4C2TA 2DDBA 4UV9A 2VC0A 3ZOBA 3OL3A 2AO9A 3CJRB 5BOXA 2VT2A 1BR1A 4BE0A 1YE9A 3LWFA 1BOAA 4CSWA 2RNJA 4UXNA 3RZOJ 1U3EM 2MD5A 2HKXA 3D0SA 4CCLA 4Y52J 3L2RA 4LJZF 2BXZA 1DGWY 3KP5A 1X3ZB 4D1QA 4DGWB 4LFUA 4BKXA 5GAEJ 4CGZA 1J09A 3HOZJ 5TISC 2VKHA 2QQBA 3GFJA 4LG0A 4U7DA 1OLTA 5TRDA 1VQ4I 1MW7A 3PUBA 4J00A 1Q1HA 2ZSHB 3OYCA 3BG7A 1EH6A 3CLOA 2E2HJ 5M3MJ 2X4HA 2K86A 2K5CA 2PG4A 2R5YB 1JHHA 2D2WA 1QPMA 2HDWA 3JRCA 2HYGD 4EEFG 3U2RA 3OYGA 1R5HA 1W0UA 3M7GA 3H3UA 1H9GA 1OCZH 1IV6A 3D1NI 2JSCA 3EDPA 2TCTA 3E0JB 3ZCOA 4BHCA 3EYYA 3T5XA 4A6DA 4WXHA 5F27A 3W2AA 1E17A 2L3DA 2ESHA 1U5TA 1B59A 1XMAA 4PDKA
chains in the Genus database with same CATH topology
5FKLA 1R9TJ 3GTGJ 3OSFA 2DA4A 3Q0UA 4D5CA 4B3AA 1FTZA 1EF4A 5F0FA 1LFUP 1ETXA 5M5WJ 2XGCA 1JUPA 2WV1A 2R5YA 1SFOJ 3L1PA 3FIWA 4JX6A 1IUFA 2IBDA 4CYCA 1JT0A 1AKHB 1MBJA 1T33A 2JK3A 1RPWA 2ID3A 1WH7A 1MBFA 3GBGA 2DMTA 3BTIA 3LSRA 1Q1VA 1WI3A 3S15J 4MFDA 2XPWA 1JJ6C 1APLC 3O8HA 1XG1A 3Q0WA 4HNVA 2ID6A 4FCYA 3HB9A 4C3HJ 4IHXA 5DS9A 3HGYA 1IGNA 3BR6A 4A3KJ 2DA3A 4Y7NJ 5F04A 1JTXA 4C3IJ 2VI6A 1Z77A 1B72A 1RR7A 2L7FP 3BR3A 3LNQA 3ZQHA 4B4CA 4CYCB 2E19A 2K9QA 5M5XJ 2XPVA 1ENHA 2OF7A 3FKIJ 2EZLA 3K7AJ 3SFIA 1AKHA 4M3GA 3G1LA 1FEXA 4M3DA 4XICA 1MNMC 2CQQA 1IDYA 2B63J 1JTYA 2LP0A 2DTZA 5EG0B 1QVUA 1T56A 4QSHA 3A03A 3I4NJ 2YUSA 2YU9J 3BTLA 2XGDA 2X6OA 3IV5A 5BNGA 4I6ZA 4LOCA 1AU7A 4IHWA 4QIWN 1JKOC 2CJJA 1B72B 1JJ8C 4BY1J 2QF7A 2EZKA 3ZQCA 2KT0A 4XIDA 1ZGWA 3W6VA 2MW8A 2VKVA 2TRTA 3S14J 3B6AA 3JRHA 1HCRA 2VUMJ 4L5EA 5IP6A 2QCOA 3GTQJ 1RESA 2ME0A 5C44J 5GPCA 3F0CA 4IEJA 1UMQA 1MBKA 2VKEA 1FIAA 4FISA 3ZQGA 2CQXA 1IDZA 1TWGJ 1WCMJ 2XPUA 2COBA 3TW6A 1VF9A 1MH4A 4MIMA 1OCPA 2GLOA 1I3QJ 2Y2ZA 5F0HA 3GTPJ 1IRZA 3IH2A 2LLKA 2LFBA 3HGGA 3BQZA 1ZK8A 2R5ZA 1UG2A 3QQAA 1LE8B 1H8AC 4DZJA 4BY7J 3JRBA 2L0KA 2Y0SN 2WB1N 3O8GA 1RKTA 2DA6A 3S17J 4UUTA 1OFCX 3MKLA 2JJ7A 2XGEA 3FK6A 5FKKA 1JKRC 5M3FJ 2LK2A 2NVTJ 2M34A 1HDDC 2CUFA 4JYKA 1B8IB 2O8KA 5GPAA 5J1RA 3FK7A 2Y9ZA 3CCYA 4QTRA 3PO2J 1I6HJ 1GVDA 5F08A 4AYBN 2HI3A 1JT6A 2OPTA 2W48A 2XSDC 4W1UA 2G0EA 3S2HJ 2HQ5A 3MN2A 2DMPA 4I76A 1O4XA 1WH5A 4A3BJ 4A3MJ 2E2JJ 2M8GX 4G12A 4RBOA 3IH3A 1IC8A 1E3OC 3GTMJ 2Y31A 1QVTA 1Z0XA 2DA7A 3RQIA 1BJZA 2NVYJ 1NK3P 1MSFC 2R92J 1DU0A 4BXXJ 1SANA 3G1OA 2ECCA 1TC3C 3HOWJ 3JRAA 1GT0C 3S1MJ 2DA2A 2JA7J 1ORKA 3LSJA 1RKWA 1HDPA 3RKQA 1K83J 1TWFJ 2PMZN 1OJLA 2IEKA 2Y30A 3S1RJ 2AHQA 3QPLA 5JLWA 1VFCA 2RAEA 3I4MJ 4AUXA 5E3OA 5EEAA 4A3JJ 5DTDA 3LSGA 3WHCA 4DW6A 1GDTA 1BA5A 1F43A 3Q3SA 4RDUA 3OSGA 1QRYA 4GFBA 1GV2A 3BTCA 5EZHA 3SJMA 2H1KA 4DYQA 1P7IA 5EF6A 2MG4A 2L7MP 3HM5A 3TW7A 1X2MA 1P7JA 4XRSG 4UUSA 2JMWA 3BG5A 5J1UA 3CMYA 3A01A 2L9RA 3JRGA 4IHVA 3HOVJ 4ABZA 3LSPA 3G1MA 4MFEA 1HLVA 5EYRA 5GP9A 3H3VK 1Y1VJ 3A02A 3QPSA 4AC0A 3JREA 1G2HA 2R93J 1TWHJ 3JRIA 1VNDA 2ZB9A 3B6CA 2O9LA 2ME6A 1GUUA 3HOYJ 4A3EJ 3CDLA 4NDLA 2HYJA 2HXOA 2EH3A 2XB5A 1U8BA 4XRMA 4M3BA 3RZDJ 4DYRA 4V2GA 5IP9J 1MBGA 1FJLA 5EGOA 5C4JJ 1DU6A 3DCFA 2DN0A 4M6VA 3WHBA 4J19A 3DEWA 2M2EA 5C4XJ 2P81A 4D7NA 1JUMA 2R0QC 2EZIA 4A93J 4A3DJ 3HOUJ 1BW6A 4X1EA 2FD5A 1U9OA 1JGGA 5FLMJ 2DMUA 2E1OA 5J1YA 3Q0VA 5M5YJ 2R7ZJ 1GV5A 2DJNA 4MLOA 4S0HB 1ETOA 1ZR4A 5E3NA 1ITYA 1JUSA 1TWAJ 1PUFB 1MSEC 3S16J 2JA5J 3BR0A 2NS8A 4W97A 3S1NJ 3BQYA 5IOZA 3S1QJ 1S7EA 4A69C 2FQ4A 4BBSJ 5EGOB 2I10A 3S2DJ 1BL0A 1QPIA 2JWTA 3IH4A 1OCTC 3M4OJ 3VPRA 2FJ1A 1BW5A 2GM4A 2MGQA 4XRSA 5C3EJ 4DYCA 1LFBA 4A3IJ 1HOMA 2CRGA 2O7OA 2DA1A 3FISA 4JP0A 1ETWA 1B8IA 5K7ZA 1MBHA 2XB0X 2LY9A 1RETA 2CUEA 1ETKA 3CQZJ 5EZGA 1ETQA 1XC5A 3H0GJ 1POGA 5FKNA 2DMNA 2M9HA 3GTJJ 1IG7A 2Y9YA 2NVXJ 3JRFA 2CU7A 2KDZA 1X58A 2FX0A 5EDNA 3SDGA 2NOGA 4DZPA 1X2NA 1HF0A 2X9DA 2EBIA 1NTCA 2N8GA 4A3FJ 1D5YA 2HOTA 1YRNB 3BG9A 2LTPA 5F0CA 4C3JJ 1XS9A 5K7HA 5K7FA 9ANTA 4M3FA 5E3MA 2JA8J 5IYCJ 3M3YJ 2M0CA 2K9SA 3GTKJ 2L7ZA 1K61A 1YRNA 5IOYA 4B1RA 2K40A 2ECBA 3HDDA 4XK4A 2YS9A 3TP0A 1MH3A 2IAIA 5F1JA 4A3GJ 1A6IA 1H89C 2K9NA 2NS7A 1ZKGA 1F36A 2JA6J 4FE4A 1TWCJ 1WPKA 3MVPA 4A3LJ 1ZR2A 3BR5A 5IYBJ 3HOXJ 3NAUA 2HXIA 4UUSB 1MBEA 5IYDJ 1Y1WJ 4FE7A 3A01B 5FKMA 3TEDA 2LKXA 1CQTA 1JKQC 5JLXA 2VPRA 2E2IJ 3GTLJ 3BTJA 2H8RA 3HBLA 1I50J 1H88C 5IP7J 4MO7A 1NK2P 2WAQN 1LE8A 4M3EA 4V2FA 2GBYA 5FKOA 4FTHA 2HOAA 3OIOA 5FLVA 2HDDA 3LOCA 2HOSA 3BR1A 2MSYA 1W0TA 2LD5A 4C2MJ 3ZOBA 4IHYA 5E3LA 1UHSA 2AO9A 1ZQ3P 3RZOJ 4D5FA 1WGXA 1JKPC 3PM1A 2X48A 3BT9A 4Y52J 3C2BA 3E7LA 1A5JA 2XRLA 4JX5A 1FIPA 3HEFA 4X6AJ 4BKXA 3ZQIA 4D7MA 3PO3J 3BR2A 1ETYA 1AHDP 3HOZJ 1U9NA 2JN6A 2ELKA 2DMQA 4BBRJ 3GTOJ 2LVSA 1U78A 5FJ8J 2E2HJ 2EQRA 5M3MJ 2R5YB 3JRCA 3JR9A 5IPAA 4EEFG 5HODA 1ETVA 1IJWC 2DA5A 1W0UA 3NARA 2NVQJ 2R5ZB 3TP3A 3OOUA 3JRDA 3BG3A 1IV6A 2LR8A 3D1NI 4JX4A 2D5VA 2EZHA 2TCTA 5EG0A 1VI0A 3UKGA 3K2AA 5F27A 3ZQFA 4A3CJ 1PUFA 1FTTA 3ZQLA 1ZTRA 3HKZN 5J3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKL A;  1R9T J;  3GTG J;  3OSF A;  2DA4 A;  3Q0U A;  4D5C A;  4B3A A;  1FTZ A;  1EF4 A;  5F0F A;  1LFU P;  1ETX A;  5M5W J;  2XGC A;  1JUP A;  2WV1 A;  2R5Y A;  1SFO J;  3L1P A;  3FIW A;  4JX6 A;  1IUF A;  2IBD A;  4CYC A;  1JT0 A;  1AKH B;  1MBJ A;  1T33 A;  2JK3 A;  1RPW A;  2ID3 A;  1WH7 A;  1MBF A;  3GBG A;  2DMT A;  3BTI A;  3LSR A;  1Q1V A;  1WI3 A;  3S15 J;  4MFD A;  2XPW A;  1JJ6 C;  1APL C;  3O8H A;  1XG1 A;  3Q0W A;  4HNV A;  2ID6 A;  4FCY A;  3HB9 A;  4C3H J;  4IHX A;  5DS9 A;  3HGY A;  1IGN A;  3BR6 A;  4A3K J;  2DA3 A;  4Y7N J;  5F04 A;  1JTX A;  4C3I J;  2VI6 A;  1Z77 A;  1B72 A;  1RR7 A;  2L7F P;  3BR3 A;  3LNQ A;  3ZQH A;  4B4C A;  4CYC B;  2E19 A;  2K9Q A;  5M5X J;  2XPV A;  1ENH A;  2OF7 A;  3FKI J;  2EZL A;  3K7A J;  3SFI A;  1AKH A;  4M3G A;  3G1L A;  1FEX A;  4M3D A;  4XIC A;  1MNM C;  2CQQ A;  1IDY A;  2B63 J;  1JTY A;  2LP0 A;  2DTZ A;  5EG0 B;  1QVU A;  1T56 A;  4QSH A;  3A03 A;  3I4N J;  2YUS A;  2YU9 J;  3BTL A;  2XGD A;  2X6O A;  3IV5 A;  5BNG A;  4I6Z A;  4LOC A;  1AU7 A;  4IHW A;  4QIW N;  1JKO C;  2CJJ A;  1B72 B;  1JJ8 C;  4BY1 J;  2QF7 A;  2EZK A;  3ZQC A;  2KT0 A;  4XID A;  1ZGW A;  3W6V A;  2MW8 A;  2VKV A;  2TRT A;  3S14 J;  3B6A A;  3JRH A;  1HCR A;  2VUM J;  4L5E A;  5IP6 A;  2QCO A;  3GTQ J;  1RES A;  2ME0 A;  5C44 J;  5GPC A;  3F0C A;  4IEJ A;  1UMQ A;  1MBK A;  2VKE A;  1FIA A;  4FIS A;  3ZQG A;  2CQX A;  1IDZ A;  1TWG J;  1WCM J;  2XPU A;  2COB A;  3TW6 A;  1VF9 A;  1MH4 A;  4MIM A;  1OCP A;  2GLO A;  1I3Q J;  2Y2Z A;  5F0H A;  3GTP J;  1IRZ A;  3IH2 A;  2LLK A;  2LFB A;  3HGG A;  3BQZ A;  1ZK8 A;  2R5Z A;  1UG2 A;  3QQA A;  1LE8 B;  1H8A C;  4DZJ A;  4BY7 J;  3JRB A;  2L0K A;  2Y0S N;  2WB1 N;  3O8G A;  1RKT A;  2DA6 A;  3S17 J;  4UUT A;  1OFC X;  3MKL A;  2JJ7 A;  2XGE A;  3FK6 A;  5FKK A;  1JKR C;  5M3F J;  2LK2 A;  2NVT J;  2M34 A;  1HDD C;  2CUF A;  4JYK A;  1B8I B;  2O8K A;  5GPA A;  5J1R A;  3FK7 A;  2Y9Z A;  3CCY A;  4QTR A;  3PO2 J;  1I6H J;  1GVD A;  5F08 A;  4AYB N;  2HI3 A;  1JT6 A;  2OPT A;  2W48 A;  2XSD C;  4W1U A;  2G0E A;  3S2H J;  2HQ5 A;  3MN2 A;  2DMP A;  4I76 A;  1O4X A;  1WH5 A;  4A3B J;  4A3M J;  2E2J J;  2M8G X;  4G12 A;  4RBO A;  3IH3 A;  1IC8 A;  1E3O C;  3GTM J;  2Y31 A;  1QVT A;  1Z0X A;  2DA7 A;  3RQI A;  1BJZ A;  2NVY J;  1NK3 P;  1MSF C;  2R92 J;  1DU0 A;  4BXX J;  1SAN A;  3G1O A;  2ECC A;  1TC3 C;  3HOW J;  3JRA A;  1GT0 C;  3S1M J;  2DA2 A;  2JA7 J;  1ORK A;  3LSJ A;  1RKW A;  1HDP A;  3RKQ A;  1K83 J;  1TWF J;  2PMZ N;  1OJL A;  2IEK A;  2Y30 A;  3S1R J;  2AHQ A;  3QPL A;  5JLW A;  1VFC A;  2RAE A;  3I4M J;  4AUX A;  5E3O A;  5EEA A;  4A3J J;  5DTD A;  3LSG A;  3WHC A;  4DW6 A;  1GDT A;  1BA5 A;  1F43 A;  3Q3S A;  4RDU A;  3OSG A;  1QRY A;  4GFB A;  1GV2 A;  3BTC A;  5EZH A;  3SJM A;  2H1K A;  4DYQ A;  1P7I A;  5EF6 A;  2MG4 A;  2L7M P;  3HM5 A;  3TW7 A;  1X2M A;  1P7J A;  4XRS G;  4UUS A;  2JMW A;  3BG5 A;  5J1U A;  3CMY A;  3A01 A;  2L9R A;  3JRG A;  4IHV A;  3HOV J;  4ABZ A;  3LSP A;  3G1M A;  4MFE A;  1HLV A;  5EYR A;  5GP9 A;  3H3V K;  1Y1V J;  3A02 A;  3QPS A;  4AC0 A;  3JRE A;  1G2H A;  2R93 J;  1TWH J;  3JRI A;  1VND A;  2ZB9 A;  3B6C A;  2O9L A;  2ME6 A;  1GUU A;  3HOY J;  4A3E J;  3CDL A;  4NDL A;  2HYJ A;  2HXO A;  2EH3 A;  2XB5 A;  1U8B A;  4XRM A;  4M3B A;  3RZD J;  4DYR A;  4V2G A;  5IP9 J;  1MBG A;  1FJL A;  5EGO A;  5C4J J;  1DU6 A;  3DCF A;  2DN0 A;  4M6V A;  3WHB A;  4J19 A;  3DEW A;  2M2E A;  5C4X J;  2P81 A;  4D7N A;  1JUM A;  2R0Q C;  2EZI A;  4A93 J;  4A3D J;  3HOU J;  1BW6 A;  4X1E A;  2FD5 A;  1U9O A;  1JGG A;  5FLM J;  2DMU A;  2E1O A;  5J1Y A;  3Q0V A;  5M5Y J;  2R7Z J;  1GV5 A;  2DJN A;  4MLO A;  4S0H B;  1ETO A;  1ZR4 A;  5E3N A;  1ITY A;  1JUS A;  1TWA J;  1PUF B;  1MSE C;  3S16 J;  2JA5 J;  3BR0 A;  2NS8 A;  4W97 A;  3S1N J;  3BQY A;  5IOZ A;  3S1Q J;  1S7E A;  4A69 C;  2FQ4 A;  4BBS J;  5EGO B;  2I10 A;  3S2D J;  1BL0 A;  1QPI A;  2JWT A;  3IH4 A;  1OCT C;  3M4O J;  3VPR A;  2FJ1 A;  1BW5 A;  2GM4 A;  2MGQ A;  4XRS A;  5C3E J;  4DYC A;  1LFB A;  4A3I J;  1HOM A;  2CRG A;  2O7O A;  2DA1 A;  3FIS A;  4JP0 A;  1ETW A;  1B8I A;  5K7Z A;  1MBH A;  2XB0 X;  2LY9 A;  1RET A;  2CUE A;  1ETK A;  3CQZ J;  5EZG A;  1ETQ A;  1XC5 A;  3H0G J;  1POG A;  5FKN A;  2DMN A;  2M9H A;  3GTJ J;  1IG7 A;  2Y9Y A;  2NVX J;  3JRF A;  2CU7 A;  2KDZ A;  1X58 A;  2FX0 A;  5EDN A;  3SDG A;  2NOG A;  4DZP A;  1X2N A;  1HF0 A;  2X9D A;  2EBI A;  1NTC A;  2N8G A;  4A3F J;  1D5Y A;  2HOT A;  1YRN B;  3BG9 A;  2LTP A;  5F0C A;  4C3J J;  1XS9 A;  5K7H A;  5K7F A;  9ANT A;  4M3F A;  5E3M A;  2JA8 J;  5IYC J;  3M3Y J;  2M0C A;  2K9S A;  3GTK J;  2L7Z A;  1K61 A;  1YRN A;  5IOY A;  4B1R A;  2K40 A;  2ECB A;  3HDD A;  4XK4 A;  2YS9 A;  3TP0 A;  1MH3 A;  2IAI A;  5F1J A;  4A3G J;  1A6I A;  1H89 C;  2K9N A;  2NS7 A;  1ZKG A;  1F36 A;  2JA6 J;  4FE4 A;  1TWC J;  1WPK A;  3MVP A;  4A3L J;  1ZR2 A;  3BR5 A;  5IYB J;  3HOX J;  3NAU A;  2HXI A;  4UUS B;  1MBE A;  5IYD J;  1Y1W J;  4FE7 A;  3A01 B;  5FKM A;  3TED A;  2LKX A;  1CQT A;  1JKQ C;  5JLX A;  2VPR A;  2E2I J;  3GTL J;  3BTJ A;  2H8R A;  3HBL A;  1I50 J;  1H88 C;  5IP7 J;  4MO7 A;  1NK2 P;  2WAQ N;  1LE8 A;  4M3E A;  4V2F A;  2GBY A;  5FKO A;  4FTH A;  2HOA A;  3OIO A;  5FLV A;  2HDD A;  3LOC A;  2HOS A;  3BR1 A;  2MSY A;  1W0T A;  2LD5 A;  4C2M J;  3ZOB A;  4IHY A;  5E3L A;  1UHS A;  2AO9 A;  1ZQ3 P;  3RZO J;  4D5F A;  1WGX A;  1JKP C;  3PM1 A;  2X48 A;  3BT9 A;  4Y52 J;  3C2B A;  3E7L A;  1A5J A;  2XRL A;  4JX5 A;  1FIP A;  3HEF A;  4X6A J;  4BKX A;  3ZQI A;  4D7M A;  3PO3 J;  3BR2 A;  1ETY A;  1AHD P;  3HOZ J;  1U9N A;  2JN6 A;  2ELK A;  2DMQ A;  4BBR J;  3GTO J;  2LVS A;  1U78 A;  5FJ8 J;  2E2H J;  2EQR A;  5M3M J;  2R5Y B;  3JRC A;  3JR9 A;  5IPA A;  4EEF G;  5HOD A;  1ETV A;  1IJW C;  2DA5 A;  1W0U A;  3NAR A;  2NVQ J;  2R5Z B;  3TP3 A;  3OOU A;  3JRD A;  3BG3 A;  1IV6 A;  2LR8 A;  3D1N I;  4JX4 A;  2D5V A;  2EZH A;  2TCT A;  5EG0 A;  1VI0 A;  3UKG A;  3K2A A;  5F27 A;  3ZQF A;  4A3C J;  1PUF A;  1FTT A;  3ZQL A;  1ZTR A;  3HKZ N;  5J3L A; 
#chains in the Genus database with same CATH topology
 3WTW C;  2DA4 A;  5ILV A;  4E6K G;  1IXR C;  1ETX A;  4RMN A;  1FWZ A;  1RI7 A;  1VQP I;  1RUO A;  5ILS A;  2KL4 A;  2WTE A;  5JHU A;  1JT0 A;  1AKH B;  4XL9 A;  2BY2 A;  1T33 A;  1RPW A;  3K2Z A;  4HDU A;  4XN3 A;  3GBG A;  3KEO A;  2IP2 A;  3I5U A;  1Q1V A;  2DDA A;  4MFD A;  4OOI A;  1JJ6 C;  1A35 A;  5TGT A;  4IVN A;  4QWQ A;  4KDP A;  2KIU A;  2FBI A;  1MJB A;  2ID6 A;  2YR2 A;  3QP5 A;  4KIC A;  2E35 A;  2A5Y B;  4IXA A;  4GYI A;  1USS A;  4RGX A;  2V1U A;  2STT A;  3WTU C;  1W7P B;  3CCU I;  2O61 A;  3BR6 A;  4A3K J;  5IT9 Z;  4Y7N J;  4XBF A;  1JTX A;  4C3I J;  4JOM A;  2L7F P;  1RZ4 A;  3DQV C;  3ZQH A;  3BP8 A;  4TV7 A;  2ELH A;  3CDH A;  1SD7 A;  2Q2E A;  1ENH A;  2XRO A;  1KZH A;  3IRR A;  3K7A J;  2BY3 A;  3ZMZ A;  2D1V A;  2MH9 A;  4ZYE A;  5FRO A;  5JVG F;  1K6Y A;  5AIP A;  4M3D A;  1IF1 A;  2VE9 A;  4I2O A;  1MNM C;  2HYF A;  1GXP A;  1Z1D A;  2B63 J;  2HNH A;  3NRV A;  3CJN A;  3OR1 C;  2DTZ A;  3I56 I;  2R7V A;  1YFH A;  3TQN A;  1STZ A;  4HPQ A;  1UG0 A;  2OD5 A;  1P4A A;  1FSH A;  1LKX A;  2YUS A;  3FX3 A;  3BTL A;  3OYH A;  4KFC A;  2VOP A;  3IV5 A;  5BNG A;  1FX7 A;  3JAM Z;  2CJJ A;  1B72 B;  3E3V A;  3WGH A;  2OCC H;  3J7A Y;  3I59 A;  3MAJ A;  2DYS H;  5B1A H;  2KT0 A;  2NXN B;  1SFX A;  4Q5S F;  2VKV A;  1F5T A;  1BN5 A;  2IW5 A;  1DDN A;  3F8C A;  3CUQ C;  2IS2 A;  3JRH A;  1ZYR F;  3BLY A;  1HCR A;  5IP6 A;  1XGM A;  2QCO A;  2PBI A;  1LPQ A;  2FQ3 A;  3GTQ J;  2L9S A;  3K4B A;  2R7S A;  2EIJ H;  2P5K A;  2WY8 Q;  1TWG J;  3E6D A;  2XPU A;  2COB A;  4R1H A;  1MJ9 A;  4MHG A;  4BS9 A;  2DO7 A;  4MIM A;  2GLO A;  1I3Q J;  1SMY F;  2M45 A;  2Y2Z A;  2K27 A;  1SVM A;  1J7K A;  1W7P A;  1VZ0 A;  1IRZ A;  2LFB A;  2F48 A;  3AG4 H;  3T8T A;  3BQZ A;  1BI0 A;  5J4V A;  2ZJP F;  3MMY B;  2H6C A;  1S29 A;  1ZAR A;  3GME A;  1F1Z A;  4RAF A;  1LE8 B;  3C2H A;  3OYA A;  4BY7 J;  2HWV A;  2RVC A;  2E1M C;  3NWS A;  3GX4 X;  3S17 J;  4KT6 A;  1N75 A;  1OFC X;  2W24 A;  4HSR A;  2JJ7 A;  4OMZ A;  5FKK A;  2QEN A;  4MQ9 F;  1FNN A;  1EA3 A;  3LMM A;  4I01 A;  2A5W A;  1P4W A;  3MZY A;  3N4M A;  1TT0 A;  2M34 A;  2VAS A;  4ESF A;  4JYK A;  3LL7 A;  2R7T A;  2O8K A;  5J1R A;  2V7F A;  3FK7 A;  2W82 A;  1GLN A;  1XTA A;  4IL6 C;  5F08 A;  3LA7 A;  2IVM A;  1JT6 A;  3UNG C;  2STW A;  4Q4Z F;  1Z3X A;  1XSD A;  1EKE A;  3SDB A;  1OR7 C;  3S2H J;  2LY2 A;  1D5V A;  1X4P A;  2E60 A;  2DJI A;  3TO6 A;  1ZRE A;  3TBI A;  2E2J J;  2COM A;  3MKY B;  1ULY A;  2IJL A;  1Y8Q B;  1E3O C;  2IS1 A;  4S05 A;  2E5Z A;  3KCC A;  4XOT A;  3IAM 2;  4CCK A;  2R92 J;  1DU0 A;  4BXX J;  2KIS A;  1SAN A;  2HPM A;  4P5O A;  2Y69 H;  1LDD A;  1R1T A;  2M7A A;  4HST A;  3JAM K;  2DA2 A;  2PMZ A;  2BZT A;  1HDP A;  3RKQ A;  1IZ1 A;  1K83 J;  4HAM A;  2A6T A;  4MGR A;  3SEZ A;  1OJL A;  2GIV A;  2Y30 A;  3S1R J;  2DTR A;  4NQW B;  2CGP A;  4XLP F;  2O3F A;  2NRA C;  1Z6T A;  4G6D A;  4AUX A;  2O6G E;  3I4M J;  4IF4 A;  3WHC A;  1GDT A;  1FOK A;  3DTE A;  4XKV A;  1MNE A;  2GWR A;  5H6R A;  3HJE A;  3JW4 A;  3OSG A;  1V3F A;  1KON A;  4FX0 A;  4GFB A;  3SJM A;  4ETS A;  2H1K A;  4N0B A;  3DPL C;  5EF6 A;  3GLX A;  2JPB A;  3GFL A;  4GDF A;  2AXL A;  3PL8 A;  3ERM A;  4R8H A;  3HM5 A;  2L7M P;  4BGD A;  5DDG A;  4KIF A;  4MNU A;  5J1U A;  2OAZ A;  1IN7 A;  1V5F A;  2L9R A;  3A01 A;  1D8K A;  4ABZ A;  2DCE A;  4WX9 A;  1U5T B;  4BDZ A;  4AC0 A;  2GOM A;  3JRI A;  1VND A;  3B6C A;  2O9L A;  5CVR A;  4E7L A;  2H6B A;  2QWW A;  3CDL A;  3HRS A;  3P9I A;  2AS5 F;  3KEY A;  2EH3 A;  2XB5 A;  3TO7 A;  4YII A;  4M3B A;  2DFH A;  3HC7 A;  4O6J A;  4DYR A;  4EJV A;  3OYE A;  1WWX A;  4PSW A;  3F22 A;  3VSK A;  4U0Y A;  2CFX A;  1SEU A;  2DN0 A;  1EJ9 A;  3E5U A;  4HYE A;  3WHB A;  4J19 A;  4LG3 A;  1HA8 A;  5C4X J;  2P81 A;  2EFO A;  2R0Q C;  2EZI A;  4EVI A;  2IGO A;  2XKP A;  4A93 J;  4A0Z A;  2Z9O A;  3SXY A;  5L3F A;  1JI8 A;  3QPH A;  3IHU A;  3W2W A;  3JCU C;  1X3U A;  1AWC A;  1XN7 A;  1BR2 A;  4YFN F;  2KJB A;  1ETO A;  2M7B A;  2DT7 B;  4BHP A;  1ITY A;  3FMR A;  1YW8 A;  1PUF B;  3S16 J;  3MKW B;  2EV5 A;  1REP C;  5JFR A;  5E1X A;  3B73 A;  2VQG A;  3MQ0 A;  3RDI A;  1VTN C;  3S1Q J;  1MMS A;  4KIB A;  1YW7 A;  1ONV A;  4BXF A;  2FRH A;  1E3P A;  2RQQ A;  5K5O A;  4BBS J;  4KN7 X;  3ELK A;  1BL0 A;  1QPI A;  5D6E A;  3IH4 A;  3M4O J;  2FJ1 A;  1BW5 A;  2MGQ A;  4XRS A;  4LIT A;  1HOM A;  4DQ2 A;  5L3G A;  2OC6 A;  4II2 A;  4ZTJ A;  3IUO A;  3ZMD A;  2XB0 X;  2FNA A;  1ON1 A;  2L4A A;  1ZGJ A;  4PJM A;  5A2Q K;  3OV8 A;  2K9L A;  2BEO A;  3GTJ J;  1IG7 A;  4PUS A;  1S9H A;  4N9I A;  3JRF A;  1J9I A;  3FXL A;  2KDZ A;  1Z05 A;  3DP7 A;  5DV5 A;  2E34 A;  3CZ6 A;  1ERD A;  4CZC A;  3D5S C;  3DU5 A;  4G8X A;  3K4K A;  3C1D A;  2LKP A;  2X9D A;  1NTC A;  2LH9 A;  4NUB A;  2HOT A;  4Y33 A;  3BG9 A;  5F0C A;  1XS9 A;  3K4N A;  2V9P A;  1YS7 A;  4GYG A;  3JSO A;  2R7X A;  3FWE A;  1BIA A;  2OBP A;  3CC7 I;  3D5R C;  2W57 A;  1FOW A;  1YRN A;  2EFQ A;  3F9K A;  5IOY A;  3FXQ A;  3N05 A;  3OYB A;  3SZG A;  1DP3 A;  4HDV A;  3CUO A;  2YS9 A;  4XK4 A;  4A6E A;  2ZKZ A;  2XF5 A;  2M30 A;  2EJR A;  1YIO A;  1H89 C;  3U9G A;  2K9N A;  2MBF A;  1ZKG A;  2HKO A;  1FPQ A;  3FXK A;  4FE4 A;  3J7A O;  3MVP A;  2XDV A;  1XMK A;  3OYD A;  3NAU A;  1GHC A;  2EFP A;  4XKB A;  4UUS B;  4RM3 A;  1MBE A;  1YJW I;  5FRM A;  1ODD A;  2MA3 A;  3I55 I;  5JLX A;  2FE3 A;  2W1O A;  3FZV A;  2HDC A;  2W85 A;  1R4M B;  3RJP A;  3UR3 C;  1J0R A;  4GGG A;  1T8I A;  1H88 C;  4MO7 A;  3L2W A;  2EFN A;  2LY1 A;  2BVL A;  3RTR A;  1X19 A;  3CTA A;  1FZP B;  1VQL I;  3KZI C;  2FML A;  2GBY A;  2JA2 A;  2BBY A;  5FKO A;  4FTH A;  3WE2 A;  4RB2 C;  4ENM A;  4HLY A;  1B9N A;  5HS8 A;  1MD0 A;  2PFB A;  2ZXH A;  2AXT C;  2XF7 A;  1Z6R A;  4M71 A;  2NOJ B;  4HBL A;  1QBJ A;  1VQ7 I;  3I4P A;  2CW8 A;  5FD6 A;  5E17 F;  3H1C A;  1F4K A;  5KCM A;  1N78 A;  3VOE A;  1K79 A;  5HDG A;  1V5E A;  5B5E C;  2O03 A;  1YIT I;  3ZPL A;  4CCN A;  1FP1 D;  3OIQ A;  4P55 A;  4RS8 A;  1FMV A;  5DD4 A;  2X48 A;  3BT9 A;  3KLO A;  3IKT A;  2VJJ A;  2QQ9 A;  2L9N A;  3E7L A;  3BZ6 A;  3RCO A;  5GTI C;  1MDM B;  2PI0 A;  2XRL A;  1SD6 A;  2L9V A;  4B09 A;  3K1N A;  3FHZ A;  1R5I D;  4D7M A;  1ETY A;  1LB2 A;  4CCJ A;  2K4J A;  4DBR A;  3BCA A;  3PFI A;  4PFO A;  1D1B A;  1U9N A;  2JN6 A;  4PFP A;  1FMW A;  3FMQ A;  1JGS A;  4F92 B;  2IGK A;  3KYL A;  2D1H A;  2RKH A;  4EGZ A;  2FUG 2;  2K3F A;  3F8F A;  1TBX A;  2IXS A;  2KLO A;  3HSR A;  1NG6 A;  4YFX F;  1EH7 A;  4UB6 C;  1IJW C;  4E7H A;  1ETV A;  4DJA A;  1QQI A;  1I3A A;  3FF5 A;  2DA5 A;  1MMN A;  2R5Z B;  3TP3 A;  3WTY C;  2M8E A;  3BG3 A;  3HHG A;  1ZN2 A;  5HDK A;  3JRD A;  1G3S A;  1MDM A;  1SFE A;  3RI4 A;  4JX4 A;  2D5V A;  3T1B A;  3LFK A;  2VON A;  3UKG A;  5D4R A;  3LQQ A;  2HOE A;  4EGY A;  1PUF A;  2ZME B;  2RN7 A;  4J01 A;  1FTT A;  5JI6 A;  2OA4 A;  4UVA A;  4YRV A;  2L5Q A;  4HLX A;  3S8P A;  1R23 A;  1ZTR A;  3ECH A;  2A05 A;  1O3T A;  5DYM A;  4KA4 A;  4OU0 A;  4QPO A;  3F72 A;  3H35 A;  2E7W A;  2LOO A;  2A61 A;  4BHB A;  3LFU A;  3GTG J;  3ZMV A;  4FET A;  3OSF A;  4B3A A;  5CLS A;  1FTZ A;  2G7H A;  1O3R A;  1LFU P;  4X0G A;  1I5Z A;  2Q2E B;  4BH9 A;  5LBQ A;  3HOS A;  2R5Y A;  1PUE E;  2F5F A;  2FBK A;  2Q1Z B;  4JX6 A;  4CYC A;  1VQ9 I;  1MBJ A;  3HL2 A;  3CMA I;  1D0Y A;  1V5G A;  4E7S A;  1Z3Y A;  3H9Q A;  2HU9 A;  3F21 A;  3ZQ7 A;  2I5U A;  2EIM H;  3LSR A;  1E3H A;  3I0T A;  3S15 J;  3OS0 A;  2XPW A;  1XG1 A;  4HNV A;  4CCM A;  5ICG A;  1G4D A;  4XOR A;  3HB9 A;  2CQN A;  4C3H J;  2DOE A;  5J4Y A;  2Z16 A;  3CP2 A;  1I39 A;  1YG2 A;  3HGY A;  4NNJ A;  2R7R A;  1T2K A;  3LQR A;  2DA3 A;  1R49 A;  4G6Q A;  4ENK A;  3E6M A;  1YOV B;  4EQQ A;  3K4M A;  4RB3 C;  1KA8 A;  1RR7 A;  1RC9 A;  2WAF A;  3HRM A;  3MWM A;  2ISZ A;  4CYC B;  5M5X J;  2K9Q A;  4LMY A;  2XPV A;  3PFY A;  1F9N A;  5DUI A;  3H5A A;  3FKI J;  4UHT A;  2KZV A;  1AKH A;  4M3G A;  5KK1 A;  5JR3 A;  2BW3 A;  2ZME C;  2CO5 A;  3WTT C;  1JE8 A;  4C2U A;  1ZGA A;  2CQQ A;  2RRE A;  1V54 H;  3FBN B;  3MEX A;  2QKL B;  1R6R A;  4FHT A;  3QYB A;  5ED4 A;  1FBS A;  3V8J A;  5BPI A;  1IUY A;  2YU9 J;  5BS6 A;  2QBY B;  3KEQ A;  3LA3 A;  3NQO A;  1OMI A;  1TTY A;  2XGD A;  3VDX A;  2X6O A;  3QAH A;  4ZYG A;  2LNB A;  2O5R A;  4LOC A;  3GEZ A;  1JKO C;  3G71 I;  2IGN A;  2KRC A;  2H8W A;  3L2V A;  3ZQC A;  1SAU A;  5L3C A;  4RGR A;  5B66 C;  4XID A;  3W6V A;  3S14 J;  4NC7 A;  4A5M A;  4Q47 A;  1RIO H;  4YIR X;  2ELJ A;  3ZGK A;  2L01 A;  4PSX A;  2VUM J;  4L5E A;  3V7C A;  1VQN I;  4LIV A;  1WKM A;  3EQL F;  3OS2 A;  3HG9 A;  4P9U A;  3TOB A;  1A31 A;  1MBK A;  1FIA A;  4ZDO A;  3PIP F;  1IDZ A;  3HRU A;  4XKW A;  1WCM J;  3C2G A;  1R1U A;  2Z1D A;  3HZJ A;  4AIH A;  1A6Q A;  2L02 A;  3DV8 A;  4PJN A;  2QZ8 A;  2EV6 A;  2K3P A;  4RAY A;  2VL8 A;  2JRT A;  4H4K C;  3VB2 A;  1QA6 A;  5F0H A;  3AG1 H;  2E7X A;  4ITV A;  1SMT A;  3CF2 A;  2LRE A;  3GTP J;  3C18 A;  2LLK A;  5HLG A;  3W2V A;  1QNT A;  2ZBK A;  2JUC A;  3E6C C;  1IN8 A;  3BG6 A;  1UG2 A;  3QQA A;  3K4J A;  4LD5 A;  3K70 C;  3JRB A;  2HTJ A;  1T39 A;  2KDO A;  2Y0S N;  4JBA A;  4XLN F;  2HVS A;  1QGP A;  2OV7 A;  2DA6 A;  1VQ5 I;  2L4M A;  2V6C A;  2XKO A;  3R61 A;  3FK6 A;  4ZTF A;  4BAY A;  4IRG A;  4M73 A;  1JKR C;  3CES A;  2YU3 A;  3HSE A;  3RYP A;  2LK2 A;  4BJ6 C;  3QWL A;  2NVT J;  3KE2 A;  1TNT A;  1UEL B;  3H0D A;  2ZJQ F;  1CGP A;  2DK8 A;  3W6K B;  2XAH A;  1B8I B;  2EB7 A;  5GPA A;  3R0J A;  3ZP5 A;  2Y9Z A;  4ZZL A;  3CCY A;  3PO2 J;  1NG7 A;  4UV8 A;  4ZZD A;  2HI3 A;  5LHG A;  1V4R A;  1X4O A;  4EM0 B;  1S3J A;  2W48 A;  1T0F A;  1M1E B;  1W5C C;  2G0E A;  4P96 A;  1ZG5 A;  2HQ5 A;  4WCG A;  2DK5 A;  2DMP A;  1MIJ A;  4I76 A;  1O4X A;  5DM6 F;  5LEJ A;  4KN4 X;  4H0E A;  4A3B J;  2Z3Y A;  2F2E A;  2RQP A;  3M8J A;  4RBO A;  3X2Q H;  2CUZ A;  4B44 A;  1MGT A;  1ZRF A;  4AVP A;  4UY8 I;  1SVO A;  2XHK A;  2KIQ A;  2Y31 A;  2DA7 A;  3RQI A;  3RSN A;  2M5W A;  1S7O A;  3CO6 C;  1BJZ A;  2NVY J;  1XCB A;  2DLL A;  2ZNZ A;  4NQW A;  5HLH A;  1MSF C;  3FM5 A;  3T8R A;  2ECC A;  3HOW J;  2L7K A;  3JRA A;  3ONQ A;  3VYT B;  1ORK A;  3LSJ A;  1RKW A;  3HHH A;  2ZME A;  4G6T B;  1BOB A;  5LRR A;  3IWF A;  2AHQ A;  3DKW A;  1TP4 A;  4PGH A;  2GA2 A;  1VFC A;  3VOD A;  5EEA A;  5E3O A;  3G73 A;  1UFM A;  5HNF A;  3L7W A;  3LSG A;  4DW6 A;  3FXR A;  2K7L A;  1QO0 D;  3K1M A;  2OQR A;  1R00 A;  1T98 A;  3E5Q A;  4BQA A;  5EZH A;  4XM3 A;  2F4M B;  3AG3 H;  4L9T A;  4U88 A;  3H92 A;  2MG4 A;  3TW7 A;  4UUS A;  1WJA A;  1P7J A;  1X2M A;  4RLQ A;  4L9N A;  1KU3 A;  1WI9 A;  2K9M A;  3CMY A;  2WC2 A;  3LSM A;  2ZO4 A;  4IPA A;  5EYR A;  3A02 A;  1O57 A;  1G2H A;  2QYO A;  1W5S A;  4GRI A;  2ME6 A;  4U0W A;  1GUU A;  2R7D A;  4NDL A;  2CW7 A;  4A3E J;  4CHU A;  1BJA A;  4LG0 B;  1R36 A;  2HXO A;  3Q9S A;  1U8B A;  1X1D A;  2FSW A;  1T08 B;  4Y15 A;  1DPU A;  1KGS A;  3K0L A;  4V2G A;  5KVR A;  2XV4 S;  4N4N B;  5EGO A;  2WV0 A;  4M6V A;  5J40 A;  4D0P A;  3IP4 B;  1JUM A;  4D7N A;  2HQR A;  3BZC A;  3FXU A;  2LG4 A;  2CSO A;  2JPC A;  3J7Y J;  1HKT A;  2VKD A;  4X1E A;  5IY5 H;  1E0E A;  4B3X A;  1JGG A;  5FLM J;  2DMU A;  1YI2 I;  3Q0V A;  2R7Z J;  4MLO A;  1MKM A;  3HIF A;  2I8D A;  2EA4 A;  2VPL A;  1ZR4 A;  5D8L B;  1MSE C;  2IRF G;  3GF2 A;  3HSF A;  5CVJ A;  5IOZ A;  3MFK A;  1VQ6 I;  1S7A A;  4Q48 A;  5CPR B;  2LBF B;  3K10 A;  3DPU A;  2KHM A;  3G6E I;  2A68 F;  4I02 A;  2L2O A;  2PMH A;  1IXC A;  2JWT A;  1OR7 A;  2BOL A;  3F8B A;  4OIR F;  1FY7 A;  1DGR M;  4XSX F;  1W36 C;  1WQ2 A;  1LFB A;  1LVK A;  3RKY A;  1IN6 A;  2DA1 A;  3FIS A;  2LYC A;  2IA1 A;  2X1C A;  2EFW A;  2F6C A;  1MBH A;  3VSL A;  1ZRC A;  4L5J A;  2K4B A;  2LY9 A;  1RET A;  3I54 A;  3SZT A;  3CCE I;  1ETK A;  2F4I A;  1ETQ A;  3ROU A;  3QRF F;  4CCO A;  1POG A;  2OQG A;  2H09 A;  2VBZ A;  4BEH B;  1Y0N A;  3L2C A;  2K85 A;  2MC3 A;  2VJI A;  2JZY A;  2DPU A;  2PJP A;  5EDN A;  3L2U A;  4IO9 F;  4ASN A;  1S6L A;  2P4W A;  2CYY A;  2NOG A;  1X2N A;  2OZ6 A;  4DZP A;  4YFK F;  4ENN A;  4A3F J;  4IZZ A;  1YRN B;  2XSJ C;  1VQ8 I;  3FMS A;  4RB0 A;  5FLX Z;  5E3M A;  4QPQ A;  5IYC J;  2M0C A;  3GTK J;  3GZ6 A;  3I59 B;  5DCF A;  4B1R A;  5LEK A;  3HDD A;  1FBQ A;  2IT0 A;  4V19 K;  4PGG A;  5F1J A;  1V55 H;  1MMD A;  5CQG A;  3ISP A;  4QLC U;  4NHJ A;  5E79 C;  4HV6 A;  3QYE A;  3WU1 B;  2NS7 A;  4BXU A;  3AL0 B;  1UCR A;  4A3L J;  2UZK A;  2GXG A;  2EIN H;  3FBI B;  5ICF A;  1J2X A;  2MLK A;  4LB6 B;  3HOX J;  4M6Y A;  4KNY A;  5IYD J;  4HA8 A;  1WSU A;  2H94 A;  3ERE D;  1JKQ C;  3PNV A;  2XC7 A;  2Z99 A;  3WG9 A;  3TOA A;  2VPR A;  3CJQ B;  2E2I J;  3COA C;  3BTJ A;  2DT6 A;  4XQF A;  1O7L A;  5JVT A;  5IP7 J;  4PCQ A;  4Y4R A;  4I7H A;  2WAQ N;  3DLA A;  5J47 A;  3J81 K;  4M3E A;  2ADU A;  5L3D A;  2D45 A;  2X1D A;  4IQ4 A;  4IJA A;  3PQK A;  4HNT A;  1O3Q A;  1QU3 A;  3GO5 A;  2X0L A;  3KP2 A;  4ZJZ A;  1TLH B;  4LK0 F;  3LOC A;  1LDJ A;  2B9S A;  3BR1 A;  4B48 A;  4C2M J;  4NBQ A;  2KJC A;  4IHY A;  3I64 A;  5E3L A;  1OIS A;  1I6X A;  2Y0M A;  5FO5 A;  3WG7 H;  5J6X A;  3PJR A;  2JUG A;  2G7U A;  1Y0U A;  1TZL A;  2RDP A;  3SYT A;  1ZQ3 P;  3LST A;  1TL8 A;  3M07 A;  4D5F A;  2V1N A;  3PM1 A;  1XCV A;  2DT5 A;  3ZQQ A;  3MZH A;  1A04 A;  2HZD A;  3JTH A;  3DU6 A;  4HW0 A;  1RNL A;  4CO8 A;  1SC7 A;  1OYW A;  1FT9 A;  4JX5 A;  5F1R A;  1VQM I;  3F6O A;  4L0Y B;  3VYU B;  3ZQI A;  3F6V A;  2XGX A;  1LEA A;  2LKS A;  3GFM A;  2F5D A;  1AHD P;  3LSK A;  3HKZ A;  2CH0 A;  5L3B A;  3L2Q A;  2R3S A;  4XLA A;  5D4S A;  2DMQ A;  3LAP A;  1G3W A;  1IRX A;  4BBR J;  2OTJ I;  3Q9V A;  4EMS A;  5J8C A;  1U78 A;  5E8I A;  3BRO A;  5EJC A;  5ERI A;  2QEX I;  4YG2 F;  1KQ0 A;  2CG4 A;  3MCZ A;  1LUJ B;  2X51 A;  3CD6 I;  5DM7 F;  2LR8 A;  3KP3 A;  4HZF A;  4HOB A;  2EZH A;  4E7Z A;  5EG0 A;  2DU9 A;  1XPX A;  1QZY A;  1MMA A;  1G6N A;  2X85 A;  4KMU X;  1PP7 U;  2EPF A;  3M9A A;  1LDK B;  1ZH5 A;  1P4X A;  3CF5 F;  2KZG A;  4CYD A;  2WA0 A;  4M6X A;  2R7W A;  4HX7 A;  1TQP A;  3GZN B;  1YX3 A;  2P6T A;  3DF8 A;  2LBF A;  3K70 D;  1FYK A;  5LGU A;  5FLX K;  1OCO H;  3Q0U A;  2HVQ A;  4D5C A;  2RC4 A;  2YPR A;  5EEG A;  2J5P A;  1EF4 A;  5F0F A;  3KP4 A;  3U21 A;  3JTG A;  1JUP A;  3FXJ A;  1DQU A;  4M9X A;  3ZN1 A;  1R1V A;  3L1P A;  4N9H A;  1IUF A;  2IBD A;  2JK3 A;  3RQ4 A;  3E1S A;  3S3N A;  1TW2 A;  2ID3 A;  1XSX A;  1BC7 C;  1WH7 A;  3FDY A;  1Z91 A;  2DMT A;  3DBR B;  4MTD A;  1WI3 A;  1LJ9 A;  2VOO A;  3L9F A;  4NC8 A;  4IOA F;  2VE8 A;  1LQ1 A;  3TDU C;  4FCY A;  5BQT A;  2YSR A;  2M0M A;  3QYF A;  5DS9 A;  1TNS A;  1IGN A;  5LLQ A;  3K6G A;  2MH2 A;  3K4L A;  2X6X A;  2HQN A;  5LRS A;  2EIL H;  1Z77 A;  3CC4 I;  3BR3 A;  3MD2 A;  1MMG A;  4B4C A;  1J5Y A;  2ETH A;  3H9G A;  4HF1 A;  1D3Y A;  3R4K A;  2KRF A;  2FBH A;  2OF7 A;  2CMP A;  2HVR A;  2EZL A;  3SFI A;  3EET A;  4LB5 A;  1PP8 F;  3ESW B;  3AFH A;  3G1L A;  1FEX A;  3OR2 C;  1P2F A;  1IDY A;  2LF7 A;  4KIG A;  2H27 A;  1JTY A;  2A3S A;  1YYV A;  1YO5 C;  1PVE A;  2CQ7 A;  2LP0 A;  4OIN F;  5EG0 B;  4BAC A;  2M3A A;  2V79 A;  2ACJ A;  1T56 A;  3P7N A;  4P1W A;  4CUG A;  1DP7 P;  3IC7 A;  1O7F A;  2QQ8 A;  1WJB A;  2XAS A;  4E70 A;  3I4N J;  1HXD A;  3IWZ A;  2E1N A;  2P5V A;  4I6Z A;  1VQK I;  4QIW N;  2Z33 A;  3GYH X;  4BY1 J;  2VIX A;  2QF7 A;  3FXM A;  3DEU A;  2BHY A;  2EZK A;  3O2P E;  1ZGW A;  1D0X A;  2XAF A;  2MW8 A;  1BBY A;  2VJ4 A;  4F55 A;  2WB1 A;  3AL0 C;  3KLN A;  3G2B A;  3JSP A;  3E97 A;  3K4C A;  2VQL A;  1RES A;  2ME0 A;  5C44 J;  4IHS A;  5LGT A;  3F0C A;  4EV0 A;  2F4O B;  5L3E A;  2RGV A;  1X3W B;  3H9J A;  3CCL I;  2VKE A;  3LSI A;  4EM1 A;  2CQX A;  2P5L C;  1RRJ A;  4G94 A;  3ZMT A;  4WK8 F;  1PDN C;  5BMZ A;  1OYI A;  2W00 A;  3WTS C;  1WVR A;  1S72 I;  1VF9 A;  3QOE A;  4AYB A;  1MH4 A;  3AKZ A;  1LNW A;  4Z2Y A;  4I0A A;  2HZT A;  2H1L A;  4RM2 A;  2PX9 A;  2FF4 A;  2KIF A;  2V9V A;  3T0Y A;  3IH2 A;  4HX4 A;  3HGG A;  1XGN A;  2R5Z A;  1HKQ A;  1ZAO A;  4IRI A;  4BQO A;  1B9M A;  2DAO A;  4HEA 2;  3RPQ A;  1H8A C;  2BE5 F;  3WGG A;  4Y17 A;  2L0K A;  2DQR A;  2WB1 N;  4HG2 A;  1KU9 A;  3KP6 A;  3KZZ A;  4UUT A;  4XLF A;  2CWE A;  1D1A A;  2VB6 A;  4BQN A;  5E18 F;  3LAJ A;  3BC8 A;  3I58 A;  3GZ5 A;  3OS1 A;  1B1B A;  2E71 A;  1I6H J;  4B47 A;  3OL4 A;  2ZXJ A;  1AOY A;  4XSZ F;  1GVD A;  2CS3 A;  1ZEL A;  4M72 A;  3P5J A;  1Y6I A;  4M9Z A;  1H0M A;  2A6H F;  4RAG A;  4A0Y A;  5CVU A;  3HTS B;  1D0Z A;  3V7R A;  5E8G A;  5H6Q A;  4CH7 A;  4AM3 A;  1WH5 A;  4A3M J;  1FBU A;  2M8G X;  4G12 A;  3V4G A;  2Q0O A;  3J7Z I;  3RYR A;  4KT5 C;  3A0B C;  1QVT A;  3OMY A;  2XAJ A;  1NK3 P;  3ZMS A;  5K1Y A;  4PZJ A;  3G1O A;  2DW4 A;  3VYS B;  1TC3 C;  2KKO A;  1GT0 C;  3BJA A;  3DPT A;  3DTK A;  5ICC A;  2JA7 J;  2ZXW H;  3I3L A;  3O6B B;  4EJU A;  1TWF J;  2PMZ N;  5E1Z B;  1ACI A;  3EUH C;  3OYL A;  2PEX A;  5GAD J;  2HQA A;  2FOK A;  3H36 A;  3DWL E;  4C9Y A;  4A3J J;  2GZW A;  2BHZ A;  1T6S A;  4HX8 A;  1BA5 A;  1YJ9 I;  4K2E A;  5CQE A;  2R7U A;  2R4G A;  4XON A;  3FM3 A;  1OYY A;  4RDU A;  1S8N A;  1GV2 A;  1R5G A;  2OZU A;  3SQN A;  2V4J C;  2QVO A;  1HW5 A;  1PYV A;  4XMY A;  4BNC A;  3ZXS A;  3KX2 A;  4XRS G;  1QZZ A;  4P9F A;  3H5N A;  1G8X A;  3BG5 A;  1BC8 C;  4IHV A;  3HOV J;  3ABU A;  4ZYA A;  1GVJ A;  1U0J A;  4MFE A;  1HLV A;  4RAZ A;  1Y1V J;  4JQF A;  4GO1 A;  2R93 J;  1TWH J;  4ZH4 F;  2ZB9 A;  3ASN H;  2JVH A;  1OCC H;  2FMY A;  2HYJ A;  3HUG A;  3P9C A;  2EA2 A;  4XRM A;  4DBQ A;  3RZD J;  1R71 A;  3KZY A;  4LGW A;  5B3S H;  1SVL A;  2W25 A;  2FU4 A;  4O3M A;  1MBG A;  4D9J A;  3W3C A;  1S5L C;  3DCF A;  1WJC A;  3SZP A;  2JT1 A;  5E1W A;  3VWB A;  3DEW A;  1FYL A;  1TT5 B;  3BWG A;  4XOP A;  3DLL F;  3HOU J;  3V8K A;  4XN0 A;  3WU0 A;  5H2F C;  1BW6 A;  5D5X B;  2FD5 A;  2X6W A;  5EEH A;  3KYC B;  2E1O A;  4E7J A;  3J80 K;  4NC6 A;  1FSE A;  4BE2 A;  2DJN A;  4S0H B;  4FT8 A;  3S93 A;  1HKS A;  5KAI C;  1Z21 A;  5AON A;  5E3N A;  1TWA J;  3GLL A;  3F3X A;  1O3S A;  2BV6 A;  5IT9 K;  4G9Y A;  3S1N J;  2G9W A;  3MZ8 A;  3CCQ I;  1G3Y A;  2ZNY A;  1S7E A;  2PQ8 A;  1IN5 A;  3KIO A;  4E4H A;  1IO2 A;  3GXO A;  2I10 A;  5EGO B;  3HRT A;  3WGI A;  3IKV A;  3VPR A;  4WF2 A;  1R22 A;  5F64 A;  2WAE A;  5C3E J;  2YX4 A;  4EJO A;  4A3I J;  2BXY A;  4AWX B;  2O7O A;  2V26 A;  2GOX B;  1YIJ I;  2CV0 A;  3GW2 A;  2V1D A;  2CFO A;  4BEH A;  1B8I A;  3R0A A;  2JQ7 A;  5CJ9 A;  3W6J B;  3LSH A;  2VBX A;  1TW3 A;  1QZE A;  3SEQ A;  3CQZ J;  2O0Y A;  3WE3 A;  3EPZ A;  2AQF A;  1XC5 A;  3H0G J;  5FKN A;  2EWN A;  1D1C A;  2QKM B;  3BZK A;  3K9T A;  5DEQ A;  5HVQ C;  3G4S I;  3F23 A;  2CU7 A;  2NVX J;  3HUG B;  1I27 A;  2FX0 A;  5FB2 A;  4BE1 A;  2R7Q A;  2DOF A;  2EV0 A;  1YLF A;  5LFA A;  1U2W A;  2EBI A;  2V9K A;  2N8G A;  3BCB A;  1D5Y A;  1FC3 A;  1UJ8 A;  3EUA A;  2XRN A;  4C3J J;  3C7J A;  3TO9 A;  2BGC A;  2DQL A;  5DCM B;  1DPR A;  4M3F A;  2QUF A;  1HBX G;  5HLI A;  2JA8 J;  5TJJ A;  3S3M A;  2HPI A;  1BR4 A;  2VT3 A;  3P9K A;  3D5L A;  1K4S A;  5D6F A;  3QP6 A;  2K40 A;  2BVM A;  1LVA A;  2ECB A;  5ILU A;  2C6Y A;  3M1C A;  5JHF A;  4KIS A;  5K5Q A;  3TP0 A;  1MH3 A;  2IAI A;  2HEO A;  1WJE A;  1CF7 A;  2FOW A;  1UZC A;  1QHG A;  1A6I A;  3OOP A;  4Y3O A;  2BYV E;  4II3 A;  2LDU A;  2GXA A;  3OYK A;  2JA6 J;  4UUV A;  3WTV C;  1WPK A;  2M4K A;  4HRI A;  4DIQ A;  3AAF A;  3BR5 A;  4KYW A;  2HXI A;  3I71 A;  3DXJ F;  3PQJ A;  4B43 A;  2V6E A;  1YQA A;  2MD0 A;  5LGN A;  3QU6 A;  1CQT A;  2PMU A;  4KMF A;  1TQM A;  1FP2 A;  1XDU A;  2WAQ A;  1I50 J;  5LHH A;  5HNH A;  2QGU A;  1WJF A;  3TKY A;  2UXN A;  1BIB A;  4F3Q A;  4UNO A;  4V2F A;  6PAX A;  1YW9 A;  5K5R A;  2GQQ A;  2GIZ A;  3BPV A;  2HOA A;  3OIO A;  2CW0 F;  3ECO A;  5FLV A;  2HDD A;  4G7H F;  5HLT A;  1BI2 A;  1W0T A;  4L9J A;  2PJR B;  5GTH C;  4U7B A;  3MKZ A;  1UHS A;  1TQI A;  2CV1 A;  2XAG A;  4RGU A;  3OIP A;  2UWM A;  3RKW A;  1G3T A;  4HNU A;  4WWC A;  5ICE A;  1EV7 A;  1RR8 C;  4I98 B;  1YHQ I;  1SFU A;  1WGX A;  3I53 A;  1JKP C;  2ZFW A;  1IAW A;  2NAZ A;  3C2B A;  3BJ6 A;  3K69 A;  5HOO A;  2WAD A;  4CZZ A;  5LD2 C;  1FOY A;  4M74 A;  1FLI A;  2IA0 A;  5KAF C;  1A5J A;  3CCV I;  1W36 D;  2OU2 A;  1WRJ A;  2VN2 A;  3PNT A;  5CYV A;  3OWT A;  2B7E A;  1FIP A;  3HEF A;  4X6A J;  3PO3 J;  3HOT A;  1Z7L A;  1OPC A;  3BR2 A;  4XKC A;  4BDY A;  4ENJ A;  4PJJ A;  4BJ5 C;  1X1P A;  2E1C A;  5A2Q Z;  2Z2S B;  2ELK A;  3FHN A;  1WHU A;  3CCS I;  2O8X A;  2F5C A;  1KU2 A;  3GTO J;  2LVS A;  5D5U B;  5CKT A;  1U6G A;  3WTX C;  2VJ5 A;  5FJ8 J;  4N4O B;  2EQR A;  1XGS A;  3ZR8 X;  5BPD A;  2PN6 A;  1JHF A;  2NNY A;  4MQV A;  2DI3 A;  3JR9 A;  1BM9 A;  3VFZ A;  2X1E A;  2MLG A;  5IPA A;  2J5O A;  3H3Z A;  3NAR A;  2BW3 B;  5HOD A;  2NVQ J;  1AA7 A;  3OOU A;  4RB1 A;  2RV8 A;  1LEB A;  3PIO F;  4GXO A;  1OQY A;  5E20 A;  3ABM H;  2DFE A;  2EIK H;  2ISY A;  2R7F A;  4AU7 A;  1VI0 A;  2WBM A;  3PNY A;  2DXI A;  5GAG J;  3K2A A;  3ZQF A;  3V7S A;  4A3C J;  1D8J A;  3ZQL A;  5FRN A;  3CUQ A;  1U8R A;  1XGO A;  3WU2 C;  3HKZ N;  2ZSI B;  4ESB A;  3EYI A;  3SHF A;  1RUN A;  1MND A;  4PJ0 C;  4AIJ A;  1IRG A;  5J3L A;  3A0H C;  4OIP F;  2LC2 A;  5FKL A;  1R9T J;  1KYZ A;  3REO A;  3L00 A;  5M5W J;  2XGC A;  2WV1 A;  5KHD A;  4RLF A;  2NYX A;  1SFO J;  2UV1 A;  2MAB A;  2MFZ A;  3FIW A;  2TDX A;  2LMD A;  1Y39 A;  2IGM A;  1UB9 A;  2Y48 A;  4EJW A;  1MBF A;  3KFW X;  4XNF A;  4EAT A;  3BTI A;  2M87 A;  4FX4 A;  3CUQ B;  1ZLJ A;  1APL C;  3O8H A;  3O3K A;  3Q0W A;  1Y56 A;  1H9T A;  1L0O C;  2E5N A;  4PK4 A;  4EM2 A;  3ABT A;  3M8F A;  4KIT B;  3OYN A;  3FXO A;  1WFX A;  2XIG A;  4XLE A;  4BYY A;  3U1D A;  4IHX A;  3QPT A;  1K7A A;  2E1M B;  4OAZ A;  3RIR A;  2Q8K A;  5F04 A;  2VI6 A;  2ZFU A;  1HW2 A;  2IS6 A;  4BJT A;  4DOZ A;  5J8F A;  1B72 A;  4E7I A;  2EK5 A;  1XD7 A;  2XUB A;  3LNQ A;  3GCM A;  1EH8 A;  1W1W E;  2AQE A;  4WXC A;  2E19 A;  4S04 A;  1U5T C;  1ZG1 A;  2YX7 A;  3I9V 2;  2XF6 A;  2GA1 A;  4EJT A;  1X1A A;  2L54 A;  2FXA A;  3RKX A;  4UB8 C;  1R58 A;  3NWT A;  1UAA A;  4XIC A;  2Z5U A;  2QQA A;  1UST A;  4OIO F;  5D5V B;  2ZJ2 A;  2K02 A;  1T38 A;  1QVU A;  3OYM A;  4BUP A;  4ANJ A;  4I09 A;  1SFK A;  2FNP A;  2VXD A;  1XMX A;  4QSH A;  4MEY F;  3DTI A;  3A03 A;  3TDZ C;  5KNL A;  2MYS A;  3C3W A;  3GUD A;  2JVG A;  2IPQ X;  4YEJ A;  3ZMU A;  1AU7 A;  3H5R A;  4IHW A;  3CJT B;  1UHM A;  2R7O A;  3AG2 H;  1KQ9 A;  3A1Y A;  3E5X A;  4PJL A;  4XLC A;  1JJ8 C;  3E6B A;  3DBL B;  2P7V B;  4CA0 A;  4IRH A;  2LRD A;  2CQK A;  1X1B A;  1SAX A;  2TRT A;  3B6A A;  1I1S A;  1WZ2 A;  1KQ8 A;  4O5V A;  3DKY A;  1B6A A;  2ESN A;  3M8E A;  3NEU A;  4Z6Y A;  3OYF A;  3V8L A;  5GPC A;  2DOD A;  2P0W A;  4IEJ A;  1UMQ A;  3GFI A;  4F52 A;  4HQE A;  3ZQG A;  4FIS A;  4AVZ A;  2CV2 A;  1N25 A;  2FEZ A;  1IW7 F;  5B1B H;  3TW6 A;  2VC1 A;  3OYJ A;  4AD9 A;  2MC4 A;  1OCP A;  1N77 A;  2IA2 A;  2KIM A;  4MTE A;  1LFP A;  3F8N A;  1ZHF A;  3ASO H;  4OMY A;  3B02 A;  2HGC A;  1K78 B;  2GAU A;  1KYW A;  1ZK8 A;  3BJO A;  2W7N A;  4OIQ F;  3ML6 A;  1YJN I;  4A5N A;  4MEX F;  4DZJ A;  2DBB A;  1MJA A;  5HDN A;  4XR6 A;  3DBH B;  3DFG A;  3EUH A;  3O8G A;  1RKT A;  1BI3 A;  2Y0S A;  5FFZ A;  1XB4 A;  3MKL A;  1HW1 A;  2XGE A;  4UVB A;  1W5T A;  1XX5 A;  2VBW A;  1G59 A;  4A2U A;  5M3F J;  2OTL I;  1R4N B;  4KUM A;  4CXF A;  3HTU A;  1HDD C;  2CUF A;  2A69 F;  2KFD A;  3BDD A;  2F5V A;  4LLG F;  1A36 A;  4QTR A;  4HF0 A;  1ON2 A;  4AYB N;  2XAU A;  5AIQ A;  2KMU A;  1K78 A;  2OPT A;  2UUZ A;  4NB5 A;  3G3Z A;  2XSD C;  4W1U A;  1W4M A;  4XLH A;  2IS4 A;  1Z7U A;  1SD5 A;  3MN2 A;  2KQR A;  4U87 A;  1KU7 A;  4XRF A;  4Y13 A;  4IKF A;  1WJD A;  3BPX A;  3IRQ A;  3HXL A;  4F7Z A;  3QOD A;  3IH3 A;  1IC8 A;  3IAS 2;  3ZN0 A;  3GTM J;  1Z0X A;  2V1X A;  3KPH A;  1NH3 A;  2UXX A;  5D8K B;  3CCJ I;  1P9Q C;  1XDS A;  4A0X A;  4LIU A;  4IOC F;  3TMO A;  3CLQ A;  3S1M J;  1HC8 A;  5DUK A;  2W4S A;  3BY6 A;  5F6F A;  2ZCW A;  3OYI A;  4U0V A;  2IEK A;  3FKJ A;  1QHH D;  3QPL A;  5JLW A;  5D5W B;  1IRF A;  5HS9 A;  4CDG A;  2RAE A;  4LLN A;  5DTD A;  2BY0 A;  3R6S A;  1CF7 B;  3TGN A;  1L3L A;  4DNC A;  3KET A;  1XSV A;  1F43 A;  3Q3S A;  3VYR B;  1JXS A;  4LLL A;  5H20 A;  2A6E F;  2QSH X;  1QRY A;  2DOA A;  3PSF A;  2RNG A;  3BTC A;  3SFZ A;  4I99 C;  4FAS D;  4DYQ A;  1P7I A;  4F91 B;  2QA4 I;  3J81 Z;  2JMW A;  5FFX A;  3JRG A;  3LSP A;  3QU3 A;  3G1M A;  1Z9C A;  5GP9 A;  3H3V K;  2KPM A;  3QPS A;  3JRE A;  2HS5 A;  2WY7 Q;  4UVC A;  3S3O A;  4RGS A;  3GVA A;  3HOY J;  5GAH J;  3CCR I;  1UHW A;  5IT3 A;  3EUK L;  1ZG3 A;  3K1P A;  4FQG A;  1VQO I;  4BL0 B;  3QOP A;  1GXQ A;  2B0L A;  2NVU B;  5IP9 J;  1Y8R B;  2Y75 A;  2P8T A;  1T0F C;  1FJL A;  5C4J J;  4HF2 A;  3DEE A;  1DU6 A;  2VQC A;  1K6O A;  3TL4 X;  5CVV A;  1WJ5 A;  2PJR A;  2M2E A;  3ABK H;  4A3D J;  1DUX C;  1HQC A;  3ULQ B;  4IQJ A;  1U9O A;  4R79 A;  4HV5 A;  3KYD B;  2OCE A;  4WXD A;  5J1Y A;  5M5Y J;  2NNN A;  4L18 B;  4OWR B;  1GV5 A;  1B4A A;  4KJZ A;  1Z67 A;  3V42 A;  2X6Y A;  1JUS A;  1X1C A;  3F8M A;  3HPG A;  2JA5 J;  3BR0 A;  2NS8 A;  4W97 A;  2ZC2 A;  1YS6 A;  2JRM A;  3BQY A;  5CVI A;  4GCV A;  3IL2 A;  1K4T A;  1FYM A;  2P6S A;  3PSI A;  2VLA A;  1YTY A;  3WTZ A;  4A69 C;  4BU2 A;  4ZC3 A;  2OJE D;  2FQ4 A;  2LF8 A;  4M9S A;  2QSF X;  2QBY A;  1W7P D;  3S2D J;  2KP6 A;  3L09 A;  4I0B A;  3RPU D;  1OCT C;  3Q5F A;  1BI1 A;  1YX5 A;  2GM4 A;  4C30 A;  4BQQ A;  4DYC A;  2DYR H;  2NS0 A;  4IX7 A;  3R60 A;  4E7K A;  2CRG A;  2JTV A;  3ABL H;  4IHT A;  3U1K A;  3DKX A;  4ESJ A;  2XAQ A;  5FGM A;  4JP0 A;  3OY9 A;  1ETW A;  4ZDL A;  3PUF A;  5K7Z A;  4YIF A;  2CUE A;  5EZG A;  2HTS A;  3HPH A;  3RPU A;  4ON0 A;  2DMN A;  2M9H A;  4L9V A;  2Y9Y A;  1R7J A;  2DFI A;  3N97 A;  1ZLK A;  5DCM A;  1X58 A;  5DD8 A;  1ZRD A;  2F5E A;  4HQM A;  3SDG A;  2VOD A;  1HF0 A;  2W84 A;  1P92 A;  2XVC A;  3CDI A;  1MZB A;  2LTP A;  3BOQ A;  3CC2 I;  5K7H A;  5K7F A;  2FA5 A;  4A12 A;  1OKR A;  9ANT A;  2WWY A;  1IV8 A;  2ZXI A;  2VXZ A;  3M3Y J;  3J80 Z;  2K9S A;  2L7Z A;  2JSP A;  1K61 A;  5HS7 A;  3A2K A;  2LSO A;  1I1G A;  2M4G A;  4ZYH A;  2E36 A;  2QM3 A;  4CIC A;  2OUM A;  3M1E A;  2M1B A;  3CME I;  1IN4 A;  2ICW G;  3S32 A;  4ZYD A;  4A3G J;  3LA2 A;  3KP7 A;  4G7O F;  4JK1 X;  3ZRG A;  1E2X A;  2PLY A;  1J59 A;  2A07 F;  1F36 A;  4RA2 A;  1C0W A;  1TWC J;  3CCM I;  1FOX A;  1ZR2 A;  4YEL A;  3CMM A;  3WOD F;  1IXS B;  5IYB J;  2VQH A;  2P7C B;  3CP8 A;  2CUJ A;  4OAY A;  2QSG X;  3GWZ A;  3CO7 C;  1Y1W J;  4FE7 A;  3A01 B;  5FKM A;  3TED A;  1SD4 A;  4ZDP A;  3VEP A;  2LKX A;  5FD5 A;  1HST A;  1T95 A;  3HYI A;  2DPD A;  4F93 B;  2ZJR F;  4AID A;  3GTL J;  2H8R A;  5LHI A;  3HBL A;  4L0Z B;  3S2W A;  2HR3 A;  4AIK A;  1NK2 P;  1NHA A;  1LE8 A;  2GXB A;  4LK1 F;  2QLZ A;  4G7Z F;  1P6R A;  2DFF A;  3A4C A;  1HSJ A;  2HFH A;  1OCR H;  1J75 A;  1PJR A;  2HOS A;  4L5I A;  2MSY A;  2LD5 A;  2BY1 A;  4B8X A;  2VBY A;  2KRH A;  4C2T A;  2DDB A;  4UV9 A;  2VC0 A;  3ZOB A;  3OL3 A;  2AO9 A;  3CJR B;  5BOX A;  2VT2 A;  1BR1 A;  4BE0 A;  1YE9 A;  3LWF A;  1BOA A;  4CSW A;  2RNJ A;  4UXN A;  3RZO J;  1U3E M;  2MD5 A;  2HKX A;  3D0S A;  4CCL A;  4Y52 J;  3L2R A;  4LJZ F;  2BXZ A;  1DGW Y;  3KP5 A;  1X3Z B;  4D1Q A;  4DGW B;  4LFU A;  4BKX A;  5GAE J;  4CGZ A;  1J09 A;  3HOZ J;  5TIS C;  2VKH A;  2QQB A;  3GFJ A;  4LG0 A;  4U7D A;  1OLT A;  5TRD A;  1VQ4 I;  1MW7 A;  3PUB A;  4J00 A;  1Q1H A;  2ZSH B;  3OYC A;  3BG7 A;  1EH6 A;  3CLO A;  2E2H J;  5M3M J;  2X4H A;  2K86 A;  2K5C A;  2PG4 A;  2R5Y B;  1JHH A;  2D2W A;  1QPM A;  2HDW A;  3JRC A;  2HYG D;  4EEF G;  3U2R A;  3OYG A;  1R5H A;  1W0U A;  3M7G A;  3H3U A;  1H9G A;  1OCZ H;  1IV6 A;  3D1N I;  2JSC A;  3EDP A;  2TCT A;  3E0J B;  3ZCO A;  4BHC A;  3EYY A;  3T5X A;  4A6D A;  4WXH A;  5F27 A;  3W2A A;  1E17 A;  2L3D A;  2ESH A;  1U5T A;  1B59 A;  1XMA A;  4PDK A; 
#chains in the Genus database with same CATH homology
 5FKL A;  1R9T J;  3GTG J;  3OSF A;  2DA4 A;  3Q0U A;  4D5C A;  4B3A A;  1FTZ A;  1EF4 A;  5F0F A;  1LFU P;  1ETX A;  5M5W J;  2XGC A;  1JUP A;  2WV1 A;  2R5Y A;  1SFO J;  3L1P A;  3FIW A;  4JX6 A;  1IUF A;  2IBD A;  4CYC A;  1JT0 A;  1AKH B;  1MBJ A;  1T33 A;  2JK3 A;  1RPW A;  2ID3 A;  1WH7 A;  1MBF A;  3GBG A;  2DMT A;  3BTI A;  3LSR A;  1Q1V A;  1WI3 A;  3S15 J;  4MFD A;  2XPW A;  1JJ6 C;  1APL C;  3O8H A;  1XG1 A;  3Q0W A;  4HNV A;  2ID6 A;  4FCY A;  3HB9 A;  4C3H J;  4IHX A;  5DS9 A;  3HGY A;  1IGN A;  3BR6 A;  4A3K J;  2DA3 A;  4Y7N J;  5F04 A;  1JTX A;  4C3I J;  2VI6 A;  1Z77 A;  1B72 A;  1RR7 A;  2L7F P;  3BR3 A;  3LNQ A;  3ZQH A;  4B4C A;  4CYC B;  2E19 A;  2K9Q A;  5M5X J;  2XPV A;  1ENH A;  2OF7 A;  3FKI J;  2EZL A;  3K7A J;  3SFI A;  1AKH A;  4M3G A;  3G1L A;  1FEX A;  4M3D A;  4XIC A;  1MNM C;  2CQQ A;  1IDY A;  2B63 J;  1JTY A;  2LP0 A;  2DTZ A;  5EG0 B;  1QVU A;  1T56 A;  4QSH A;  3A03 A;  3I4N J;  2YUS A;  2YU9 J;  3BTL A;  2XGD A;  2X6O A;  3IV5 A;  5BNG A;  4I6Z A;  4LOC A;  1AU7 A;  4IHW A;  4QIW N;  1JKO C;  2CJJ A;  1B72 B;  1JJ8 C;  4BY1 J;  2QF7 A;  2EZK A;  3ZQC A;  2KT0 A;  4XID A;  1ZGW A;  3W6V A;  2MW8 A;  2VKV A;  2TRT A;  3S14 J;  3B6A A;  3JRH A;  1HCR A;  2VUM J;  4L5E A;  5IP6 A;  2QCO A;  3GTQ J;  1RES A;  2ME0 A;  5C44 J;  5GPC A;  3F0C A;  4IEJ A;  1UMQ A;  1MBK A;  2VKE A;  1FIA A;  4FIS A;  3ZQG A;  2CQX A;  1IDZ A;  1TWG J;  1WCM J;  2XPU A;  2COB A;  3TW6 A;  1VF9 A;  1MH4 A;  4MIM A;  1OCP A;  2GLO A;  1I3Q J;  2Y2Z A;  5F0H A;  3GTP J;  1IRZ A;  3IH2 A;  2LLK A;  2LFB A;  3HGG A;  3BQZ A;  1ZK8 A;  2R5Z A;  1UG2 A;  3QQA A;  1LE8 B;  1H8A C;  4DZJ A;  4BY7 J;  3JRB A;  2L0K A;  2Y0S N;  2WB1 N;  3O8G A;  1RKT A;  2DA6 A;  3S17 J;  4UUT A;  1OFC X;  3MKL A;  2JJ7 A;  2XGE A;  3FK6 A;  5FKK A;  1JKR C;  5M3F J;  2LK2 A;  2NVT J;  2M34 A;  1HDD C;  2CUF A;  4JYK A;  1B8I B;  2O8K A;  5GPA A;  5J1R A;  3FK7 A;  2Y9Z A;  3CCY A;  4QTR A;  3PO2 J;  1I6H J;  1GVD A;  5F08 A;  4AYB N;  2HI3 A;  1JT6 A;  2OPT A;  2W48 A;  2XSD C;  4W1U A;  2G0E A;  3S2H J;  2HQ5 A;  3MN2 A;  2DMP A;  4I76 A;  1O4X A;  1WH5 A;  4A3B J;  4A3M J;  2E2J J;  2M8G X;  4G12 A;  4RBO A;  3IH3 A;  1IC8 A;  1E3O C;  3GTM J;  2Y31 A;  1QVT A;  1Z0X A;  2DA7 A;  3RQI A;  1BJZ A;  2NVY J;  1NK3 P;  1MSF C;  2R92 J;  1DU0 A;  4BXX J;  1SAN A;  3G1O A;  2ECC A;  1TC3 C;  3HOW J;  3JRA A;  1GT0 C;  3S1M J;  2DA2 A;  2JA7 J;  1ORK A;  3LSJ A;  1RKW A;  1HDP A;  3RKQ A;  1K83 J;  1TWF J;  2PMZ N;  1OJL A;  2IEK A;  2Y30 A;  3S1R J;  2AHQ A;  3QPL A;  5JLW A;  1VFC A;  2RAE A;  3I4M J;  4AUX A;  5E3O A;  5EEA A;  4A3J J;  5DTD A;  3LSG A;  3WHC A;  4DW6 A;  1GDT A;  1BA5 A;  1F43 A;  3Q3S A;  4RDU A;  3OSG A;  1QRY A;  4GFB A;  1GV2 A;  3BTC A;  5EZH A;  3SJM A;  2H1K A;  4DYQ A;  1P7I A;  5EF6 A;  2MG4 A;  2L7M P;  3HM5 A;  3TW7 A;  1X2M A;  1P7J A;  4XRS G;  4UUS A;  2JMW A;  3BG5 A;  5J1U A;  3CMY A;  3A01 A;  2L9R A;  3JRG A;  4IHV A;  3HOV J;  4ABZ A;  3LSP A;  3G1M A;  4MFE A;  1HLV A;  5EYR A;  5GP9 A;  3H3V K;  1Y1V J;  3A02 A;  3QPS A;  4AC0 A;  3JRE A;  1G2H A;  2R93 J;  1TWH J;  3JRI A;  1VND A;  2ZB9 A;  3B6C A;  2O9L A;  2ME6 A;  1GUU A;  3HOY J;  4A3E J;  3CDL A;  4NDL A;  2HYJ A;  2HXO A;  2EH3 A;  2XB5 A;  1U8B A;  4XRM A;  4M3B A;  3RZD J;  4DYR A;  4V2G A;  5IP9 J;  1MBG A;  1FJL A;  5EGO A;  5C4J J;  1DU6 A;  3DCF A;  2DN0 A;  4M6V A;  3WHB A;  4J19 A;  3DEW A;  2M2E A;  5C4X J;  2P81 A;  4D7N A;  1JUM A;  2R0Q C;  2EZI A;  4A93 J;  4A3D J;  3HOU J;  1BW6 A;  4X1E A;  2FD5 A;  1U9O A;  1JGG A;  5FLM J;  2DMU A;  2E1O A;  5J1Y A;  3Q0V A;  5M5Y J;  2R7Z J;  1GV5 A;  2DJN A;  4MLO A;  4S0H B;  1ETO A;  1ZR4 A;  5E3N A;  1ITY A;  1JUS A;  1TWA J;  1PUF B;  1MSE C;  3S16 J;  2JA5 J;  3BR0 A;  2NS8 A;  4W97 A;  3S1N J;  3BQY A;  5IOZ A;  3S1Q J;  1S7E A;  4A69 C;  2FQ4 A;  4BBS J;  5EGO B;  2I10 A;  3S2D J;  1BL0 A;  1QPI A;  2JWT A;  3IH4 A;  1OCT C;  3M4O J;  3VPR A;  2FJ1 A;  1BW5 A;  2GM4 A;  2MGQ A;  4XRS A;  5C3E J;  4DYC A;  1LFB A;  4A3I J;  1HOM A;  2CRG A;  2O7O A;  2DA1 A;  3FIS A;  4JP0 A;  1ETW A;  1B8I A;  5K7Z A;  1MBH A;  2XB0 X;  2LY9 A;  1RET A;  2CUE A;  1ETK A;  3CQZ J;  5EZG A;  1ETQ A;  1XC5 A;  3H0G J;  1POG A;  5FKN A;  2DMN A;  2M9H A;  3GTJ J;  1IG7 A;  2Y9Y A;  2NVX J;  3JRF A;  2CU7 A;  2KDZ A;  1X58 A;  2FX0 A;  5EDN A;  3SDG A;  2NOG A;  4DZP A;  1X2N A;  1HF0 A;  2X9D A;  2EBI A;  1NTC A;  2N8G A;  4A3F J;  1D5Y A;  2HOT A;  1YRN B;  3BG9 A;  2LTP A;  5F0C A;  4C3J J;  1XS9 A;  5K7H A;  5K7F A;  9ANT A;  4M3F A;  5E3M A;  2JA8 J;  5IYC J;  3M3Y J;  2M0C A;  2K9S A;  3GTK J;  2L7Z A;  1K61 A;  1YRN A;  5IOY A;  4B1R A;  2K40 A;  2ECB A;  3HDD A;  4XK4 A;  2YS9 A;  3TP0 A;  1MH3 A;  2IAI A;  5F1J A;  4A3G J;  1A6I A;  1H89 C;  2K9N A;  2NS7 A;  1ZKG A;  1F36 A;  2JA6 J;  4FE4 A;  1TWC J;  1WPK A;  3MVP A;  4A3L J;  1ZR2 A;  3BR5 A;  5IYB J;  3HOX J;  3NAU A;  2HXI A;  4UUS B;  1MBE A;  5IYD J;  1Y1W J;  4FE7 A;  3A01 B;  5FKM A;  3TED A;  2LKX A;  1CQT A;  1JKQ C;  5JLX A;  2VPR A;  2E2I J;  3GTL J;  3BTJ A;  2H8R A;  3HBL A;  1I50 J;  1H88 C;  5IP7 J;  4MO7 A;  1NK2 P;  2WAQ N;  1LE8 A;  4M3E A;  4V2F A;  2GBY A;  5FKO A;  4FTH A;  2HOA A;  3OIO A;  5FLV A;  2HDD A;  3LOC A;  2HOS A;  3BR1 A;  2MSY A;  1W0T A;  2LD5 A;  4C2M J;  3ZOB A;  4IHY A;  5E3L A;  1UHS A;  2AO9 A;  1ZQ3 P;  3RZO J;  4D5F A;  1WGX A;  1JKP C;  3PM1 A;  2X48 A;  3BT9 A;  4Y52 J;  3C2B A;  3E7L A;  1A5J A;  2XRL A;  4JX5 A;  1FIP A;  3HEF A;  4X6A J;  4BKX A;  3ZQI A;  4D7M A;  3PO3 J;  3BR2 A;  1ETY A;  1AHD P;  3HOZ J;  1U9N A;  2JN6 A;  2ELK A;  2DMQ A;  4BBR J;  3GTO J;  2LVS A;  1U78 A;  5FJ8 J;  2E2H J;  2EQR A;  5M3M J;  2R5Y B;  3JRC A;  3JR9 A;  5IPA A;  4EEF G;  5HOD A;  1ETV A;  1IJW C;  2DA5 A;  1W0U A;  3NAR A;  2NVQ J;  2R5Z B;  3TP3 A;  3OOU A;  3JRD A;  3BG3 A;  1IV6 A;  2LR8 A;  3D1N I;  4JX4 A;  2D5V A;  2EZH A;  2TCT A;  5EG0 A;  1VI0 A;  3UKG A;  3K2A A;  5F27 A;  3ZQF A;  4A3C J;  1PUF A;  1FTT A;  3ZQL A;  1ZTR A;  3HKZ N;  5J3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...