2JMWA

Structure of dna-binding domain of arabidopsis gt-1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords DNA binding protein GT-1
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jmwA01
2DA5A 2O7OA 2E1OA 1FTTA 2Y9YA 1TWAJ 1QRYA 1ZQ3P 1POGA 1UHSA 3LSGA 5J3LA 3Q3SA 2X6OA 1IG7A 2HOTA 2Y30A 4AYBN 3HB9A 4XRMA 5FLMJ 1FJLA 2VKVA 4MFDA 3BR0A 5E3MA 1JJ6C 2I10A 2XPWA 4FISA 3LNQA 5E3OA 1P7IA 2FJ1A 3S1MJ 3HKZN 3NARA 3D1NI 4V2FA 5IYDJ 1R9TJ 1TWGJ 1AU7A 1X2MA 1Y1VJ 1MBFA 1IC8A 1WH7A 3RQIA 1D5YA 3A01A 2HXIA 5IP6A 2K9QA 4JX5A 3BTLA 2L7ZA 4FTHA 5K7HA 2LKXA 4A3IJ 5GPAA 4S0HB 1Z77A 2COBA 5M5XJ 2FQ4A 2HQ5A 1FIPA 3TW6A 4M3EA 3HBLA 3JRIA 3RKQA 3ZQFA 3HM5A 4JYKA 3WHBA 3TP0A 2NOGA 3PO2J 4A93J 3BR6A 1ZR4A 1JKRC 3OIOA 3GTMJ 1W0UA 2Y0SN 3SJMA 1ETWA 5IOZA 1EF4A 2G0EA 1H88C 1WPKA 3S1RJ 1MBKA 2H8RA 2IEKA 2Y2ZA 4B1RA 3IH4A 4A3EJ 4UUTA 1TC3C 5BNGA 1HOMA 3C2BA 2NVQJ 5FKKA 5GPCA 1ETQA 3B6CA 2XB5A 3CMYA 2R93J 2JJ7A 4Y7NJ 2LLKA 1FIAA 1MBHA 4D5CA 1WGXA 3BR5A 3JRGA 1UG2A 5F0FA 2MG4A 3HEFA 2NS7A 5F0HA 4IHXA 3I4NJ 2HOAA 1T56A 5EZGA 5E3NA 1VI0A 1ETVA 5GP9A 2CU7A 1JKQC 5F04A 1NTCA 1B72B 2HDDA 4LOCA 3BG9A 3BQZA 3S2HJ 2CUEA 2DMNA 2XGEA 1YRNA 4MFEA 4MLOA 2CRGA 1G2HA 2LR8A 3BR1A 2LD5A 2JA8J 3GTOJ 2AHQA 2DA4A 3FK6A 3PO3J 3JRBA 5IP7J 4MO7A 5FJ8J 4AC0A 4A3LJ 5M5WJ 4D7NA 3DCFA 1JUMA 3BTIA 3SDGA 1ETYA 3JRFA 2Y9ZA 4A3DJ 4Y52J 1FTZA 4D7MA 3FIWA 1QVUA 1GVDA 2K9SA 1GT0C 1NK2P 4JX4A 5HODA 1VFCA 1OFCX 2XSDC 1IUFA 4C2MJ 4M3GA 3VPRA 3A01B 1HDDC 3BR3A 1PUFB 3ZQHA 1B72A 1ITYA 2VUMJ 2VKEA 1XG1A 1IDZA 3BQYA 5FKOA 2ZB9A 3RZOJ 1RKWA 5C3EJ 4DZJA 3OSFA 2L9RA 2R5ZB 2PMZN 1F36A 1B8IB 3HOZJ 1PUFA 5F27A 2HYJA 3JRAA 4G12A 3ZQCA 1LFBA 1BA5A 1JKPC 1BW6A 2OPTA 5EEAA 1TWFJ 5EGOB 2NS8A 1ZK8A 5E3LA 2DA6A 2VI6A 2RAEA 2R5ZA 2KT0A 3JRDA 1HLVA 2DTZA 3LSPA 1JT6A 3S17J 4IHYA 3TP3A 1SFOJ 1FEXA 1MH3A 2Y31A 2IBDA 3BG3A 3WHCA 1QPIA 4AUXA 3GTPJ 2CUFA 3QPSA 2DJNA 2DA7A 3HOXJ 1JGGA 2XRLA 4L5EA 5FKNA 2M8GX 4IHWA 4JX6A 3K2AA 4RDUA 4A3CJ 1JJ8C 4DW6A 2DA1A 1BW5A 1IJWC 3CQZJ 1A6IA 1K83J 4W97A 4M6VA 5K7ZA 2DMTA 4QTRA 2D5VA 2E19A 2VPRA 1MH4A 4JP0A 1CQTA 3OSGA 3W6VA 2P81A 5DTDA 1WH5A 5EDNA 1Z0XA 5J1YA 1I50J 1W0TA 1AKHA 2GBYA 3DEWA 2ELKA 2HOSA 1YRNB 3K7AJ 3TEDA 3BTCA 4QSHA 1RR7A 3IV5A 2EZIA 2JN6A 3BT9A 1LFUP 3GTGJ 3RZDJ 3O8GA 5M5YJ 2M9HA 1I6HJ 2XB0X 1X2NA 4XRSA 5EZHA 4X1EA 4BY1J 1OCPA 2L7MP 2M2EA 1MNMC 1E3OC 2ECCA 2CQQA 1WI3A 1JTXA 2H1KA 4MIMA 3G1MA 3JREA 4A3BJ 2NVTJ 1ETOA 1U9OA 2JMWA 2R7ZJ 1RETA 1IRZA 2CQXA 2YS9A 4FCYA 4I6ZA 1HDPA 2LK2A 3ZQLA 1H89C 1F43A 5J1UA 2ME6A 1U78A 5C4XJ 1ZTRA 2AO9A 3ZOBA 4BXXJ 5IP9J 3S1NJ 2B63J 9ANTA 1ETXA 3Q0WA 3A03A 3GTLJ 5IYCJ 2LTPA 3GTKJ 5EF6A 1MBJA 1MBGA 3BR2A 1AKHB 5DS9A 2YUSA 1U8BA 4FE4A 1K61A 3CDLA 5F0CA 2TRTA 5C44J 3E7LA 2XGDA 3LOCA 1B8IA 5F08A 4RBOA 3M4OJ 4GFBA 2DN0A 4BBSJ 2WV1A 1MBEA 1I3QJ 4DYQA 4HNVA 3M3YJ 3QPLA 3MVPA 4D5FA 5K7FA 3UKGA 3FKIJ 3LSJA 3Q0VA 3S14J 2CJJA 2R5YA 1ZGWA 2MW8A 5EGOA 4C3HJ 2X9DA 3GTQJ 2LP0A 3S16J 2HI3A 3ZQIA 5IYBJ 4CYCA 3SFIA 1QVTA 2NVXJ 1WCMJ 2MSYA 1VNDA 1GV5A 1HF0A 2WAQN 3H3VK 4DYRA 2JA6J 2E2IJ 5FLVA 3FISA 2R5YB 4M3DA 4DYCA 1P7JA 4QIWN 3ZQGA 3JRCA 3HOUJ 1BJZA 4A3MJ 1ETKA 2DMPA 5JLWA 3MKLA 1S7EA 1ORKA 2DMQA 4B4CA 1Y1WJ 3S1QJ 2WB1N 3BG5A 4A3GJ 2GM4A 4BBRJ 1ENHA 1JUPA 2EQRA 1MSEC 2N8GA 1IV6A 5C4JJ 1RKTA 3H0GJ 4V2GA 4NDLA 2OF7A 2X48A 1JT0A 1JUSA 2O8KA 2ID3A 2EBIA 3TW7A 2MGQA 4I76A 2M0CA 3L1PA 4ABZA 1TWCJ 3QQAA 2XGCA 2DA2A 5FKMA 4X6AJ 1ZR2A 3GBGA 3GTJJ 1X58A 2R0QC 2DMUA 2LVSA 3F0CA 4BY7J 1BL0A 3JRHA 1O4XA 4A69C 1XC5A 2TCTA 1IDYA 1Q1VA 2EH3A 1APLC 1DU6A 4XRSG 1TWHJ 1U9NA 3O8HA 1XS9A 4BKXA 4C3IJ 4XK4A 1DU0A 4A3KJ 2FX0A 3MN2A 2M34A 1RESA 2GLOA 1AHDP 3Q0UA 4M3FA 3HOYJ 2K9NA 2FD5A 4IEJA 1OCTC 1A5JA 1T33A 3IH3A 3A02A 4C3JJ 1MSFC 2ECBA 4XICA 5J1RA 5FKLA 1VF9A 3HGYA 3G1OA 1OJLA 2EZLA 5M3FJ 2LY9A 1IGNA 5JLXA 5IPAA 3NAUA 2LFBA 5M3MJ 2R92J 5IOYA 1HCRA 4B3AA 4DZPA 1GUUA 3PM1A 3CCYA 3G1LA 2EZKA 3I4MJ 2JA7J 2JK3A 2O9LA 5EYRA 1H8AC 2E2JJ 5F1JA 3HDDA 2W48A 1ZKGA 3IH2A 3HOVJ 2QCOA 3HOWJ 1SANA 2YU9J 3LSRA 4A3JJ 3S15J 2ME0A 3HGGA 1RPWA 1LE8B 5EG0B 4FE7A 2JA5J 2L0KA 2DA3A 1NK3P 4M3BA 2L7FP 4CYCB 1GDTA 2EZHA 4UUSA 2E2HJ 3BTJA 2IAIA 1UMQA 2K40A 4EEFG 4A3FJ 3JR9A 4IHVA 3B6AA 1LE8A 2JWTA 4XIDA 1JKOC 3OOUA 4J19A 2KDZA 1GV2A 1JTYA 5EG0A 2ID6A 3FK7A 2HXOA 2QF7A 2XPVA 4UUSB 3S2DJ 4W1UA 2XPUA 2NVYJ
chains in the Genus database with same CATH superfamily
2O7OA 4FX0A 4HDUA 4M9SA 1DDNA 3ABMH 3R61A 3EUHA 3GWZA 3FXMA 1BI1A 2HU9A 1XGMA 2V79A 3LSGA 1IG7A 5FRMA 5D5VB 1DPRA 1YIOA 1GLNA 2VKVA 4ENJA 4XN3A 5ILVA 5ICFA 1YS6A 2COMA 1JJ6C 2I10A 2AQFA 5EEGA 4FISA 3LNQA 5D4SA 3F8NA 5E3OA 1R5ID 1I27A 1IXCA 1AU7A 1JXSA 4K2EA 3GO5A 3F6OA 1WZ2A 4ESJA 3V8KA 2ETHA 3ZR8X 3IAS2 3K4LA 4LMYA 2K9QA 3CJNA 3HHHA 3AG4H 4YRVA 3KYDB 3ZN1A 4JX5A 2CQNA 1DQUA 4NBQA 3ECHA 3R0JA 2FMLA 3ZQ7A 3DKXA 3HXLA 3CCQI 4Q5SF 4FHTA 5D6FA 1RRJA 1Z77A 5M5XJ 1ZH5A 3L2CA 1S5LC 5CPRB 2V1UA 4EM1A 4M3EA 3HZJA 1X1BA 3HBLA 1FMWA 2X0LA 3ZQFA 1KU2A 2MC3A 3PIOF 1O3TA 2BYVE 1ZYRF 2R7WA 3K10A 3R0AA 2IS4A 2JQ7A 2X1CA 1WWXA 2EV6A 4QLCU 1Z21A 4A5NA 2HR3A 3CCVI 3PJRA 3NRVA 1WJFA 2HQNA 1DP7P 1MBKA 2Y2ZA 3N05A 1TC3C 4UUTA 1REPC 3L2QA 3FXQA 3JAMK 3CCLI 1OLTA 3OOPA 4BHCA 3A0HC 5E79C 2BZTA 5FKKA 3ZMTA 4B44A 1ETQA 5GPCA 2WAEA 1U6GA 4EVIA 3ZCOA 1G3YA 3LMMA 3CO7C 2A07F 1Z3YA 2JJ7A 3ASOH 3JCUC 4MTEA 4RB1A 1SAUA 1V4RA 3JRGA 1D5VA 2MD5A 3PFYA 5F0HA 4IHXA 1TT0A 4GO1A 4R8HA 2NVUB 2HTSA 4L5JA 2QSFX 1ETVA 1YE9A 1BC7C 1T2KA 1ZLKA 5F04A 2LBFB 4LJZF 2DYSH 3QYEA 2VQHA 1VQOI 1ZAOA 2XGEA 1OYIA 1HSJA 3TBIA 5IY5H 2P6TA 2R7TA 3KFWX 2HPMA 3GFMA 1XMXA 4L18B 3CP8A 5JHFA 2DOAA 4EM2A 2QUFA 2TDXA 1WJ5A 4XLEA 3CMEI 2FRHA 5FJ8J 2XKOA 4AC0A 5TGTA 1FX7A 2KLOA 4HNUA 4GYIA 3LFKA 4XONA 4BU2A 2JZYA 4KN4X 3SDGA 3BTIA 5D8LB 3VB2A 1W7PD 1AOYA 2CV1A 1XB4A 2WC2A 3L09A 3OYBA 4A3DJ 5B1AH 1JGSA 5D5XB 2YR2A 4D7MA 4KIGA 3FXLA 1QVUA 1GVDA 2FA5A 5GADJ 2OBPA 3RPUA 1GT0C 4UVAA 2ZC2A 1ZLJA 3CCRI 1EH7A 3VPRA 3LSMA 1FPQA 4G7ZF 5DCMA 4I2OA 5HDGA 5GTIC 1Q1HA 1JHFA 4ETSA 3S3OA 3F23A 1IDZA 3GFIA 5FKOA 1R1VA 3FXJA 4DZJA 5A2QZ 1FOKA 2MLKA 2PMZN 1DPUA 3I0TA 1J5YA 3M07A 4BJTA 4RAGA 2STWA 1LEBA 4GGGA 4G12A 1QQIA 3ZQCA 2CQKA 4Q47A 2HKOA 5AONA 2W84A 3I59A 3EDPA 4NC6A 4XSZF 5EGOB 2NS8A 1UHWA 3V8LA 5JI6A 2DDBA 1LEAA 2OQGA 1LB2A 1WRJA 1I1GA 3GZ5A 1E3PA 2DA6A 2VI6A 3CC7I 2EILH 2KT0A 1RZ4A 4IRHA 5E20A 5KK1A 5FGMA 3S17J 2WWYA 4EV0A 4KMUX 4HX7A 3DTIA 2ESNA 4AUXA 1U3EM 2M4KA 4PFPA 4LLLA 1G3TA 2XRLA 2EFOA 4UB8C 3L2UA 1JGGA 2M8GX 4U0YA 2IJLA 1HBXG 4CZZA 3VYTB 4A3CJ 5EEHA 1KQ9A 2BXZA 2LSOA 2DOEA 3A0BC 3M8EA 1B59A 4OMZA 3E5UA 1YX3A 4M6VA 4W97A 3CLQA 2JVHA 2M7BA 4QTRA 1I1SA 1DGRM 2A68F 1CQTA 1BN5A 2F5CA 3I4PA 3E6DA 4E6KG 2VJ4A 4LIVA 5J1YA 1VQ4I 1I50J 3UR3C 3DEWA 1TTYA 4KNYA 1W7PB 2QQBA 1UELB 4Y3OA 3FHZA 1R71A 3LA3A 3DPTA 3BTCA 2DQRA 2WA0A 4QSHA 2KKOA 2JN6A 3TOBA 2R7OA 3NWSA 1WQ2A 3GTGJ 3VWBA 3RZDJ 3SHFA 3KEQA 4NQWB 1BR1A 5JVGF 4IF4A 2LNBA 1X2NA 4PJNA 4XRSA 4BY1J 5TISC 2L7MP 4OINF 4I09A 5D6EA 1E3OC 4IQ4A 2R7VA 4KIBA 4MIMA 2QBYB 3J7AY 2MH9A 2VE9A 4LFUA 2KRCA 3PFIA 2UXXA 1P2FA 3ELKA 3TMOA 2VBXA 2V9PA 1YYVA 1TNSA 2LK2A 2UZKA 3ZQLA 1F43A 5HNFA 2XIGA 5C4XJ 3JSPA 1K4TA 2AO9A 1ZRDA 4BXXJ 3LQQA 3I5UA 3VFZA 4BDYA 4P9FA 2PJRB 2XVCA 9ANTA 2LYCA 1K6YA 1ETXA 2KMUA 5DM7F 4BE2A 3GTLJ 2LREA 4NB5A 3GTKJ 5EF6A 2DPDA 4RM2A 1FMVA 2BW3A 3H9JA 2DOFA 2PLYA 2YUSA 1JE8A 2LF7A 4BQAA 3CJRB 2TRTA 1XX5A 3L9FA 3G6EI 1OCCH 4XKVA 2KP6A 3CLOA 4RBOA 4GFBA 2NXNB 1MBEA 4DYQA 2EJRA 2F4MB 3DBLB 1IRFA 3FKIJ 3LSJA 2MW8A 5EGOA 2LP0A 4BYYA 4KICA 2E1MB 4NNJA 3U21A 4I0BA 4ZZLA 5J47A 3W3CA 3EUKL 3W2VA 3JTGA 5IT9K 2KFDA 1FNNA 2WAQN 4KITB 3H3VK 3Q5FA 3S93A 1WJCA 2E2IJ 5FLVA 3ZQGA 3JRCA 2E7WA 3BJ6A 4IQJA 3WTYC 4S04A 3HOUJ 2ZXIA 2EFWA 4A3MJ 1EH8A 2DMPA 4LLNA 3MWMA 3WTZA 3ZMUA 4M73A 1G3SA 2WB1N 4I0AA 4A3GJ 3B73A 3BPVA 3W6KB 1ENHA 4YELA 1T95A 4P1WA 2EQRA 2QZ8A 3QAHA 1P4AA 1IV6A 2HQAA 5C4JJ 3WGGA 5IT3A 3H0GJ 3DQVC 3O2PE 1N75A 2IS1A 1USSA 2M30A 2WB1A 2Z5UA 4HEA2 4I7HA 4CSWA 2OF7A 1NHAA 2X48A 3R4KA 1JUSA 5A2QK 1JT0A 2VB6A 2M0CA 3L1PA 4H0EA 2WY7Q 2BV6A 4OOIA 3QQAA 1KYZA 2VN2A 1D0XA 3MCZA 5FKMA 1ZR2A 3WGIA 3L00A 3C1DA 2DTRA 2DMUA 2KL4A 2UXNA 2R0QC 4RMNA 2A6HF 2P0WA 1QZZA 1W36D 3ERMA 3V7RA 2V1XA 1IDYA 1Q1VA 2FBIA 4HQEA 1APLC 2GIVA 1Y8RB 3T1BA 3ZMDA 2PG4A 4XRSG 5BMZA 3G2BA 4BKXA 4C3IJ 1DU0A 4QPQA 3DBRB 1RESA 2GLOA 2QBYA 4M3FA 2ZJRF 4PDKA 2K9NA 1D0ZA 2CMPA 4PJ0C 4FT8A 4XLFA 3OYHA 1A5JA 4XOPA 3ONQA 1BI0A 4C3JJ 1RUOA 3F21A 3RKWA 1KQ0A 2HGCA 3AG2H 2JRMA 5J1RA 5FKLA 2Q0OA 1YG2A 3LSTA 3HGYA 4L0YB 2EZLA 2PJRA 4OWRB 1BI3A 2LDUA 4RGSA 4WWCA 1BIAA 4PGGA 2A5WA 3PM1A 3N4MA 3ERED 3G1LA 3I4MJ 3V7CA 3HSRA 5EYRA 3BP8A 2E2JJ 1G4DA 2EFNA 2L5QA 3CP2A 4DQ2A 3BPXA 3QODA 4DBRA 1MD0A 4IRIA 1YOVB 2CSOA 4RS8A 2NNNA 3G73A 1FOYA 3LSRA 4A3JJ 4LB5A 3S15J 4UB6C 1FSEA 4BAYA 3L2WA 3U2RA 1VQ5I 2OD5A 5HS8A 3HOTA 3D5LA 1W5TA 2LOOA 2XAQA 1XGOA 4F91B 5FLXK 5EG0B 2O5RA 4FE7A 5LGNA 4HX4A 4XKCA 1FP1D 1NK3P 1V55H 1HKSA 2VOPA 4EMSA 4HLYA 3FXOA 3FZVA 5FD6A 5FROA 2P8TA 2QQ8A 4EEFG 1R1UA 1S7OA 2X1EA 1YITI 4A3FJ 4IHVA 4V19K 2DK8A 2BGCA 4O3MA 4XIDA 3P9CA 5JR3A 3KZZA 1IAWA 2KDZA 2ZJ2A 1ZGJA 4ESBA 1G3WA 3FK7A 5K5OA 3RYPA 2XPVA 1B9MA 4KA4A 4UUSB 3QP6A 4W1UA 4OIRF 1XSDA 2DA5A 1X4OA 4AIDA 3DLAA 5ED4A 3HRSA 3J80K 2Y9YA 4BE1A 2R7UA 1TWAJ 4KDPA 2VBYA 3CF2A 5KHDA 1POGA 4XLCA 3PNVA 2JPCA 3Q3SA 4XRFA 5J3LA 4CCJA 3QWLA 2Y30A 1PVEA 4CA0A 4PJMA 2XAUA 1P92A 2F48A 4XRMA 3BOQA 3GXOA 4HPQA 1XMAA 3BR0A 5E3MA 2F5EA 5LHIA 4PSXA 1TW3A 4XKBA 2XPWA 1WI9A 1D1AA 1P7IA 2FJ1A 3HKZN 3NARA 3PQKA 4M6XA 2DFFA 1TWGJ 3E5QA 3HSEA 3W2WA 3SZTA 1WH7A 1D5YA 3A01A 2HXIA 5IP6A 1QZYA 1Z6RA 4JBAA 2OCEA 3I64A 2M8EA 2EIMH 1B6AA 3BTLA 2FBHA 5E8GA 5AIQA 1SD7A 3IRRA 4OIOF 1XCBA 2VONA 1T38A 2XASA 5GPAA 1RUNA 2KRHA 4S0HB 4OAZA 2COBA 1G6NA 1KYWA 1LJ9A 3KP3A 1FIPA 4GDFA 5J4YA 3E1SA 2BVMA 2RQQA 1SFKA 1L0OC 3FXKA 1FBUA 2LY2A 3HM5A 1ZARA 3WHBA 5LFAA 2PN6A 1BBYA 5TJJA 2Y75A 3BR6A 4PZJA 4IKFA 3FMRA 3WTVC 5HLIA 1ZR4A 1PP7U 3BLYA 3DKYA 1TBXA 4BHPA 1W0UA 3GTMJ 2Y0SN 1ETWA 5IOZA 4L9TA 1EF4A 2VT3A 3C2GA 3IP4B 2NAZA 2KIQA 3IH4A 1VQLI 3OV8A 2VC1A 3BZCA 3C2BA 4PCQA 4EJOA 5FLXZ 1X4PA 5HDNA 3S3NA 1V5FA 3SZGA 3PNTA 4IOAF 1WHUA 5TRDA 2R93J 4Y7NJ 2BXYA 2GA2A 2IA0A 3L7WA 4O6JA 4B09A 2HVSA 1NG6A 3RKXA 5L3GA 2Q8KA 5F0FA 2R7QA 2Z16A 2MG4A 2NS7A 3I4NJ 2HOAA 1T56A 5J8FA 4ZDOA 1VI0A 3DLLF 3KYLA 1JKQC 1BIBA 3BCBA 2HDDA 3S2HJ 1N25A 1L3LA 1MMGA 2A6TA 2IXSA 3ZXSA 3TKYA 2DDAA 2V7FA 2IA1A 3OYFA 4BH9A 2HEOA 5CJ9A 5CLSA 3OYJA 1SFXA 4G6TB 1YJWI 4MLOA 2MH2A 1W1WE 2P7CB 3BR1A 2JA8J 1YFHA 2AHQA 3SQNA 1Y6IA 1T8IA 2QQAA 3GMEA 1U8RA 1PP8F 4MO7A 2E5ZA 1WKMA 4E7KA 4A3LJ 2B9SA 4I98B 5ERIA 1IN7A 1KQ8A 1OYYA 4BEHB 4D7NA 1JUMA 1XDSA 4LD5A 1EH6A 3OIQA 2BHZA 1HKQA 2GIZA 4A0XA 1P4WA 2MD0A 2Z99A 3TL4X 3FIWA 4EGYA 2K9SA 2ZFUA 1UAAA 2HOEA 1TQMA 1SMTA 1DGWY 2KJBA 4M9ZA 1OFCX 3RYRA 2XSDC 1HDDC 4C2MJ 2ADUA 4M3GA 5KCMA 3OYIA 4QWQA 3K70D 4G7HF 3RPQA 4KT5C 1PUFB 3ZQHA 5H6QA 3GVAA 1B72A 2X6XA 3IUOA 3AL0B 1U5TB 3GZNB 3WG7H 2Z9OA 3F8CA 4U88A 2IT0A 1AA7A 3WGHA 4ZYDA 2L9RA 3NWTA 2R5ZB 1B8IB 3HOZJ 1YHQI 1ZELA 1LVAA 3D0SA 2F2EA 5F27A 4ZYEA 1W36C 4HF0A 1XD7A 3KE2A 2KHMA 5EEAA 1TWFJ 2HZTA 2H09A 3K69A 4C2TA 1LDJA 2D2WA 2KISA 1D8JA 2XHKA 4IHSA 4IHYA 1OCZH 2UV1A 3CESA 3E97A 3TP3A 4CGZA 3P7NA 2Y31A 2CO5A 4FASD 2D1HA 1QPIA 3GTPJ 4MTDA 3QPSA 2QLZA 2DA7A 4HSRA 2DXIA 2X85A 4P5OA 5DEQA 3IKTA 2B0LA 2FQ3A 3DPLC 4MGRA 1BW5A 1ACIA 1A6IA 3OYNA 4HDVA 2QVOA 3BJAA 5E18F 3GW2A 2A05A 2D5VA 1A6QA 3B02A 3OSGA 2X1DA 2Z1DA 2CW0F 2K9LA 2KZVA 4GRIA 4ESFA 2I5UA 2E7XA 2IA2A 2VIXA 3BG6A 4HV5A 4EJVA 2H6CA 2ZXJA 3CUQB 3RIRA 1U0JA 1HXDA 3K7AJ 3GZ6A 3IV5A 2EZIA 2FEZA 2V1DA 4WXHA 3BZKA 3OYGA 2L54A 2ICWG 2NS0A 2QKMB 1I39A 4G9YA 4LITA 4DNCA 4ZZDA 5BQTA 3T0YA 1I6XA 1T98A 4BQOA 5J8CA 3C2HA 4X1EA 1OCPA 1P4XA 1MNMC 2GXBA 2DU9A 1B1BA 1V5GA 1WI3A 1JTXA 2W57A 3BWGA 1FWZA 1IN4A 4IPAA 3JREA 4A3BJ 4E7LA 2QQ9A 1QNTA 1U9OA 2XAFA 2FUG2 3MZHA 5HS9A 1RETA 4P55A 3HYIA 3EUHC 3JTHA 2IGKA 2MABA 3ABUA 1H89C 4IVNA 1D8KA 2CFXA 2ME6A 2BOLA 4BJ6C 3RCOA 2G7HA 1R4MB 2VJ5A 2MC4A 5IP9J 1TNTA 1NG7A 4M74A 3A03A 5IYCJ 3OYEA 2DT7B 1MBGA 2V26A 1VZ0A 1S6LA 3JW4A 3AKZA 1VQ9I 4KMFA 2EIKH 1B8IA 2IP2A 4BBSJ 1J0RA 2HTJA 2H8WA 2M0MA 4HNVA 5D5WB 3LA2A 2K02A 4D5FA 3RJPA 4N9HA 4BGDA 2P6SA 1OQYA 4HBLA 2C6YA 3I59B 2R5YA 2LKSA 2RN7A 5ICCA 3RI4A 1ZGWA 4CHUA 4A0YA 3GTQJ 1Y56A 1LKXA 3FHNA 1CF7A 4M9XA 5IYBJ 4IZZA 1YQAA 3OY9A 1QVTA 2YX7A 4EQQA 2VJIA 3IWZA 1O3SA 1QU3A 1O7FA 1WCMJ 1R5GA 1VNDA 1CGPA 3AFHA 5J6XA 1GV5A 3VODA 1HF0A 2A61A 4DYRA 2M45A 2JA6J 3H36A 2M5WA 2L3DA 3FISA 4HA8A 5FRNA 4N4NB 3CMMA 4QIWN 2O61A 3G3ZA 3Q9SA 2P4WA 4RLQA 3CDIA 2NRAC 1YS7A 3TO9A 3FXRA 5JLWA 2FXAA 3MKLA 4E7IA 2M4GA 2V6EA 1ORKA 1TL8A 3BCAA 3BG5A 5E1WA 3GF2A 5E1XA 2RVCA 2JTVA 3KEYA 1VQNI 3R60A 1OYWA 1F5TA 1IUYA 3QU3A 1X1AA 2DLLA 2K86A 3GYHX 4NDLA 2D1VA 2BE5F 4ON0A 5LEKA 2ID3A 2EBIA 1F1ZA 4WXDA 4NC7A 2PI0A 2KIUA 4ABZA 1TWCJ 5JVTA 2WTEA 3H5AA 2X6YA 2XGCA 2DBBA 1DP3A 5IT9Z 3GBGA 3NEUA 2GA1A 1X58A 1IW7F 3F0CA 4BY7J 1BL0A 3JRHA 1J7KA 2JT1A 1O4XA 3H0DA 5L3FA 3HTUA 3MKWB 2TCTA 1A35A 4R1HA 1T0FC 5E1ZB 2JRTA 1TWHJ 1U9NA 3IAM2 4UXNA 2O3FA 4M6YA 1XS9A 3T8RA 1ERDA 1D1CA 3D5RC 4A3KJ 2FX0A 1SD6A 2L9NA 3W6JB 3J7AO 2K9MA 1Z9CA 4FQGA 2L9SA 3Q0UA 3F8MA 4YG2F 1IXSB 1BC8C 2FD5A 2ZFWA 5DUKA 2OU2A 1T33A 1RNLA 4OIPF 2I8DA 1O3QA 1U2WA 2VODA 1OJLA 2H1LA 3KZIC 4LIUA 5GAGJ 5J40A 5M3MJ 5IOYA 3HG9A 3EETA 3EYYA 1GUUA 2JSPA 3J81Z 2EZKA 2JK3A 2O9LA 1FOWA 2ZXWH 1H8AC 3M8FA 3IC7A 5LHGA 1DUXC 2W48A 4ZTJA 3IH2A 5DM6F 3HOWJ 1MNEA 2BY2A 2V1NA 1XPXA 1FZPB 1PUEE 2YU9J 2CH0A 2VXZA 2ME0A 3DPUA 2HDCA 3QYBA 1LE8B 3ZQQA 1A36A 5LHHA 1UCRA 3FMQA 3V4GA 2DA3A 1K6OA 3HRTA 1J09A 1B9NA 2EA4A 3HPGA 1G59A 4Q48A 3O6BB 1Z3XA 5CVUA 1SVLA 5B66C 4CCNA 2K40A 3CC4I 1FC3A 4ITVA 1WFXA 3B6AA 2JWTA 4IOCF 2D45A 4BUPA 5GAHJ 2ZNZA 2DW4A 2KIFA 2WADA 3RTRA 3S8PA 1R1TA 5HLGA 3WTTC 5BOXA 1BR2A 3FDYA 1S29A 2XROA 1KU3A 1Z7LA 3REOA 5HDKA 2IGMA 3CD6I 4HF2A 4OMYA 4B48A 2E1OA 5ICGA 3KLNA 1D0YA 5KVRA 1ZQ3P 1OR7A 1UHSA 4NUBA 4D0PA 2X6OA 1BR4A 4RGUA 2E60A 4AYBN 5FO5A 3CMAI 5FLMJ 4MFDA 1Z67A 4EJTA 4YFXF 3BC8A 1QA6A 3MMYB 3WU0A 5CVJA 1Z91A 1VQKI 4FETA 4O5VA 1R9TJ 1X2MA 3PQJA 4XSXF 3OYLA 1Y1VJ 1Y0NA 3J80Z 3RQIA 2OQRA 5LRRA 2EV0A 4XORA 4UY8I 5KAIC 3WG9A 1G8XA 4QPOA 4XN0A 3BY6A 2XC7A 2DK5A 2L7ZA 4L9NA 4ENNA 5K7HA 1LNWA 3WTSC 2CG4A 4MHGA 2E1NA 4J00A 1WJAA 4ZC3A 1UZCA 4RAZA 4XNFA 1SVOA 4PJLA 2HQ5A 2HKXA 1RI7A 2ZJPF 1S7AA 3I54A 3RKQA 3SZPA 4JYKA 3UNGC 2HYGD 3PO2J 4A93J 3DWLE 4WCGA 2BY3A 3V8JA 4U7DA 2WAFA 3FF5A 2L4AA 1JKRC 4A6EA 3CCSI 3E5XA 3OIOA 2H6BA 2NNYA 2P5KA 3SJMA 1UB9A 2G0EA 4LB6B 1WPKA 1M1EB 2LG4A 1TQIA 2BEOA 1MZBA 1EV7A 3ZGKA 2HNHA 3VDXA 3GCMA 5FD5A 1HOMA 4ZYGA 1QBJA 4OAYA 2NVQJ 4B47A 3QOPA 1K78B 3T8TA 2M87A 3Q9VA 3TDZC 1ZRCA 2L02A 2QWWA 3CMYA 2BW3B 2LLKA 3OR1C 1FIAA 1B4AA 4D5CA 3BR5A 3M1CA 4I01A 1FYKA 3P5JA 3HEFA 5CYVA 1Y0UA 4L9JA 2VQCA 5H2FC 5E3NA 2ZSIB 4YEJA 1R7JA 4BQQA 5HNHA 4HQMA 1NTCA 1B72B 1FLIA 1BM9A 4LOCA 3MKZA 2HWVA 2PMHA 2DMNA 2PMZA 4KISA 3TGNA 4EJUA 3EUAA 3HHGA 1YRNA 2QSGX 4RB3C 4MFEA 1WVRA 1SVMA 2GOMA 3P9IA 2LD5A 5GAEJ 4JQFA 2LC2A 2DA4A 3IL2A 5DUIA 3KEOA 2R7XA 2LBFA 5IP7J 1MDMB 1VQPI 1FBQA 5LEJA 5ILSA 1HW5A 4DOZA 3DCFA 4E7ZA 1ETYA 2Y9ZA 3ZMSA 3J7ZI 2E71A 3JAMZ 1SMYF 2K4BA 3H1CA 1FTZA 3R6SA 3O3KA 5DD4A 2IS6A 4HSTA 2BY0A 5CKTA 5L3BA 3I56I 4G94A 2L01A 1MJBA 1UHMA 3SXYA 1KGSA 3U1DA 3ZMZA 4ASNA 3A01B 1Y8QB 3RQ4A 3BR3A 2R7RA 6PAXA 3L2VA 3DBHB 2OJED 1A04A 4N0BA 4RAFA 4AIJA 3TO6A 1ITYA 2F4OB 3GLXA 1XG1A 3VYUB 3W2AA 4UV9A 2VOOA 4CYDA 3BQYA 3QPHA 4I99C 2ZB9A 2M3AA 4GYGA 1RKWA 3CUOA 3QU6A 3MKYB 1YJ9I 1GHCA 1F36A 1ON2A 3K4CA 4NC8A 2O0YA 1PUFA 4IO9F 5DCMB 4B3XA 4L5IA 4XQFA 4AU7A 4HG2A 2FNPA 4P96A 3OYAA 1SC7A 2FU4A 4HAMA 1FYMA 1BW6A 2OPTA 4KJZA 4A12A 5JHUA 1MJ9A 1U5TA 2FBKA 2XAJA 2HQRA 4HV6A 1QHHD 2HZDA 5E3LA 2R5ZA 5AIPA 1R23A 4MEYF 2VC0A 2DTZA 2OUMA 1JT6A 3F3XA 3LSPA 5BS6A 2ACJA 3TQNA 4ZH4F 2VPLA 5KNLA 1SFOJ 4EM0B 1FEXA 1BI2A 1MH3A 2IBDA 4JK1X 4LGWA 2K27A 3CJTB 3ESWB 3CF5F 2CUFA 2DJNA 2QENA 3LFUA 4F92B 2ZXHA 5L3EA 5FKNA 1MMNA 4A2UA 4JX6A 3E0JB 5LLQA 1PJRA 3OYMA 3K2AA 2CGPA 4RDUA 2FF4A 5FFXA 1SAXA 2Z3YA 4AVZA 3CQZJ 2X6WA 1K83J 4EJWA 4KIFA 1IJWC 2DMTA 2W00A 1R00A 1QGPA 2VKHA 2E19A 4JP0A 2CWEA 3ZP5A 3W6VA 4RA2A 5EDNA 1W0TA 1AKHA 2GBYA 2QYOA 1UJ8A 4HOBA 3BZ6A 2VJJA 2M7AA 2HOSA 4DGWB 3KP6A 4F7ZA 4H4KC 5CVVA 3COAC 3HL2A 1S8NA 1RR7A 4II3A 1LFUP 2CUZA 3PL8A 2CFOA 3VYRB 1YIJI 2ELJA 3O8GA 1N77A 2L4MA 1S72I 2XUBA 2HFHA 1I6HJ 2XB0X 4Y17A 1YO5C 1TZLA 2M2EA 4RLFA 3P9KA 4PK4A 1JKOC 2MLGA 1PYVA 2MYSA 2RQPA 5DCFA 2H1KA 3DFGA 2NVTJ 2MFZA 4LG0A 3CCJI 2CQXA 1IRZA 1Y39A 2DODA 1H9TA 4E7JA 1HDPA 3M9AA 2A69F 2RREA 5J1UA 4PJJA 1ZTRA 3OWTA 4ENKA 4IJAA 2QGUA 3S1NJ 2OCCH 3PNYA 2DI3A 1SFEA 3Q0WA 4HLXA 3DXJF 3HSFA 4PSWA 3DU5A 1MBJA 3BR2A 4WF2A 1J2XA 4RGXA 3I3LA 1AKHB 5DS9A 1U8BA 4FE4A 3CDLA 1T0FA 2OZUA 3I58A 5F0CA 3WODF 5C44J 3E7LA 1USTA 2R4GA 3KCCA 1HQCA 2XGDA 3ABTA 3CZ6A 1OCOH 2DN0A 2O03A 2WV1A 3SDBA 1I3QJ 3M3YJ 2ZO4A 3QPLA 3MVPA 2K3PA 5H20A 5K7FA 1ZG1A 3Q0VA 3CDHA 3DP7A 3SYTA 1KZHA 2EV5A 2X9DA 3K1MA 3S16J 2HI3A 1GXQA 4CYCA 4UNOA 3SFIA 3KIOA 4L0ZB 2LKPA 2V6CA 3E3VA 2XSJC 4ZJZA 3KP4A 2E1MC 3WU1B 2XV4S 2R5YB 3OS2A 4ZTFA 3ZPLA 1X3UA 1P7JA 2Y69H 3HC7A 3K1PA 3HUGA 2VKDA 1J75A 5F1RA 1BJZA 2PJPA 3S3MA 4E7HA 1ETKA 1XMKA 1F9NA 4A5MA 1SEUA 3S1QJ 4AWXB 2GXGA 1D3YA 5DDGA 2Y0SA 4PUSA 5LBQA 2IGNA 2ZMEB 5K5RA 3H5RA 2N8GA 3SFZA 1RKTA 2VE8A 3VSLA 1I3AA 1T08B 4L9VA 3K4BA 3OL3A 1VQ6I 3KP7A 5HVQC 2O8KA 3TW7A 2MGQA 2KIMA 2BVLA 2Y48A 4XLAA 1XN7A 1S3JA 3U1KA 3OS1A 3K0LA 3GFLA 1ZRFA 4X6AJ 2RNGA 1K4SA 5DV5A 2DFEA 4BS9A 2IW5A 3LSKA 2ELHA 1R36A 2DT6A 3TOAA 2CW7A 1WJDA 4C30A 2EH3A 1LVKA 2YU3A 2JA2A 4AVPA 2KRFA 4J01A 1U5TC 3KP5A 3O8HA 4F55A 4EATA 4XK4A 1FT9A 3MN2A 3PIPF 1EA3A 2IS2A 1YX5A 1XGNA 4IEJA 1ONVA 1OCTC 1LFPA 5HLHA 3JSOA 2VT2A 3GLLA 3A02A 5E8IA 2ECBA 3MEXA 5GTHC 4C2UA 4GXOA 5HS7A 2PMUA 3FM5A 3G4SI 1VF9A 4RAYA 5DD8A 3WTXC 2DO7A 2DYRH 2DFIA 5JLXA 5IPAA 3HJEA 2MBFA 3NAUA 3F22A 3E6CC 4MQVA 1FYLA 1IV8A 4B3AA 2OTJI 2WAQA 1IN8A 3F6VA 3ABLH 2L7KA 3WE2A 3ZMVA 4E7SA 2JA7J 4CICA 2CQ7A 4F3QA 2W4SA 1ZREA 4HZFA 1J9IA 3K6GA 1IN6A 1JHHA 3OL4A 4AD9A 3LWFA 5K1YA 3CCMI 1FP2A 1ODDA 1ZKGA 2QCOA 5F6FA 3HOVJ 2ZNYA 5K5QA 5L3DA 2CUJA 4N4OB 2QM3A 3TDUC 3HGGA 1H9GA 2HYFA 3ML6A 2LMDA 1W7PA 1ULYA 2E36A 1E3HA 3H3ZA 2OA4A 3J81K 2EINH 1MMSA 2JA5J 2L0KA 3IKVA 2Z33A 2L7FP 2EZHA 2LY1A 3I71A 3LQRA 5KAFC 3SEZA 2J5OA 3RPUD 1YTYA 1SD5A 3IRQA 2Q2EB 1YLFA 5L3CA 2OV7A 2X51A 3QRFF 1VQMI 1HSTA 2NYXA 2EWNA 4HRIA 4Q4ZF 1VTNC 2ZMEC 3FWEA 3KX2A 5D8KB 1S9HA 1IRXA 2DQLA 5EG0A 2HXOA 2QF7A 2BHYA 4G6DA 2K4JA 4CXFA 1KU9A 1BJAA 3S2DJ 1K7AA 2XPUA 2JMWA 3WTWC 2GXAA 3V42A 4XKWA 3KETA 1FTTA 2ZJQF 5LD2C 1QRYA 3C3WA 2K7LA 3U9GA 1LQ1A 4XBFA 2HOTA 2W25A 2GOXB 5FB2A 3HB9A 1FJLA 4XLPF 4HW0A 5E17F 3K4KA 4BL0B 4ANJA 2OC6A 1TP4A 2PBIA 1WJBA 2W7NA 4U0VA 2X4HA 3S1MJ 3VYSB 1XSVA 3D1NI 4V2FA 3A2KA 5IYDJ 2AS5F 3CO6C 1HW1A 1MBFA 1IC8A 3L2RA 2PFBA 3D5SC 5D4RA 2RC4A 2RNJA 1D1BA 3WU2C 4D1QA 2AQEA 2OZ6A 3IWFA 4ZYHA 1K78A 2QKLB 4BJ5C 4IXAA 1YJNI 1N78A 4N9IA 1OMIA 2VBZA 3HRMA 2XAHA 4FTHA 1X1DA 1X1PA 4CCOA 2LKXA 3DV8A 3LL7A 4AYBA 4A3IJ 1VQ7I 3BG7A 1V5EA 4E4HA 1XTAA 1OR7C 2VBWA 1R58A 2FOKA 3QPTA 2FQ4A 2BY1A 3TW6A 3ZRGA 3JRIA 1HA8A 2KZGA 3TP0A 2EFPA 3OYCA 2AXLA 2NOGA 2CV2A 5B5EC 4B43A 3KPHA 3QOEA 4WXCA 3QP5A 4F93B 3K70C 3EYIA 2YX4A 2XDVA 2E1CA 4CCKA 4G8XA 1H88C 4I02A 4MNUA 2ISYA 3S1RJ 1PDNC 2H8RA 2IEKA 4G7OF 3GFJA 4B1RA 4A3EJ 4DBQA 2J5PA 1R5HA 2A3SA 4XMYA 4KFCA 5BNGA 3BROA 3KZYA 2K5CA 4WX9A 3KLOA 3B6CA 4B8XA 2XB5A 2FNAA 4F52A 2HDWA 2VQLA 2V4JC 1MBHA 3FXUA 3DF8A 1WGXA 2XRNA 1UG2A 4YFKF 4DJAA 1Z05A 3OMYA 2GQQA 3ABKH 1EJ9A 2IGOA 4A0ZA 5EZGA 1RIOH 3C7JA 1MMAA 2JSCA 5BPIA 1UG0A 5GP9A 2CU7A 3BG9A 3BQZA 2CUEA 3J7YJ 3OS0A 3DU6A 2DPUA 4BQNA 4BEHA 3HOSA 3GUDA 1E17A 2R7FA 3S32A 4OU0A 2CRGA 1G2HA 3PSIA 2LR8A 3HRUA 1X3ZB 3T5XA 3GTOJ 3FK6A 4MQ9F 3OIPA 4II2A 3PO3J 3JRBA 3FBIB 3QYFA 3K4JA 5CVRA 3K4NA 3OYDA 5M5WJ 3F8FA 3SEQA 1BOBA 2FE3A 3JRFA 1EKEA 2RKHA 3LAJA 4CUGA 4PGHA 1OKRA 1X1CA 4Y52J 4LLGF 2EIJH 2NOJB 2QEXI 3FX3A 1NK2P 4UHTA 4JX4A 1MDMA 5HODA 1MNDA 1VFCA 1C0WA 2FSWA 2KQRA 4CDGA 1IUFA 3K9TA 3OYKA 2F5FA 1R6RA 2QSHX 2OTLI 4FX4A 1KONA 5DYMA 1AWCA 4KUMA 2E34A 2IRFG 4G6QA 1R22A 1QPMA 3M1EA 1HC8A 2VUMJ 1A31A 2VKEA 2A5YB 4BHBA 2HVRA 2KJCA 3RZOJ 2ZBKA 3F9KA 5C3EJ 3ASNH 3VSKA 3OSFA 5CVIA 5B1BH 4RB0A 4XL9A 1ON1A 3VOEA 2HYJA 4U7BA 2XF7A 3JRAA 4RM3A 1LFBA 1BA5A 2RV8A 1JKPC 2FOWA 4Z2YA 3K2ZA 2ZKZA 4UUVA 2VLAA 2VXDA 1ZK8A 4Y4RA 3E6MA 2G7UA 2KPMA 2RAEA 1IF1A 3JRDA 3F8BA 1HLVA 1GXPA 4LK1F 1MKMA 3I9V2 3OR2C 4Y15A 3BG3A 3WHCA 2JUGA 1KU7A 1H0MA 3X2QH 2HVQA 1T6SA 3HOXJ 4L5EA 1OPCA 5J4VA 4IHWA 3MZ8A 5LRSA 3FMSA 4U87A 1OCRH 2CYYA 1MGTA 1JJ8C 4DW6A 1IZ1A 1F4KA 3LSIA 1STZA 2DA1A 3LAPA 4BDZA 2Q1ZB 5K7ZA 2RDPA 4YIRX 3GX4X 2VPRA 3DEUA 1QZEA 1MH4A 5FFZA 3S2WA 4M71A 5HOOA 1Z6TA 2P5LC 1V3FA 2P81A 5DTDA 1R49A 3HTSB 4MEXF 1WH5A 1MIJA 2VASA 1Z0XA 2E5NA 1IXRC 2CW8A 3CC2I 2BBYA 4YIFA 1MMDA 2EK5A 4UVBA 3A1YA 2ELKA 1XGSA 3MZYA 2EPFA 2STTA 2K85A 3PUBA 3EQLF 1XCVA 1YRNB 4BNCA 3H9GA 4U0WA 4WK8F 2CV0A 3TEDA 4XLNF 3MQ0A 5D5UB 2W82A 2P7VB 1X3WB 3BT9A 4BXUA 3M7GA 1LDKB 4HYEA 4TV7A 2MA3A 2PQ8A 1LPQA 1IN5A 2RGVA 2F5VA 3ROUA 3H3UA 5M5YJ 4RGRA 3LSHA 2M9HA 1Z7UA 2ISZA 2O8XA 5EZHA 5EJCA 3RKYA 2R7DA 1LDDA 2A6EF 4GCVA 1YW8A 4YFNF 2ECCA 2CQQA 4KT6A 3CTAA 3AL0C 1WJEA 3G1MA 4OIQF 1ETOA 3HIFA 2GZWA 5F64A 2R7ZJ 2YSRA 2IPQX 3MD2A 2W24A 2V9KA 2YS9A 2QA4I 4FCYA 4I6ZA 3CCEI 1HKTA 1UFMA 4BXFA 2OAZA 1U78A 4CZCA 3NQOA 4X0GA 2EB7A 4KYWA 2WV0A 3ZOBA 5LGTA 3F72A 3BJOA 2B63J 2DT5A 2JUCA 1OISA 2LTPA 3HUGB 2W1OA 2WY8Q 1O7LA 4LG0B 4CO8A 1RR8C 1K61A 2H27A 3DEEA 1KA8A 2UUZA 2YPRA 4XM3A 5ICEA 2XAGA 1ZGAA 3LOCA 3RDIA 1W5SA 5F08A 2IVMA 2L2OA 3M4OJ 4ZYAA 4CCMA 3FM3A 3K1NA 1ZHFA 2E35A 2EFQA 3E6BA 2DJIA 2AXTC 4NQWA 3UKGA 4UV8A 1V54H 2XKPA 3H35A 4Y33A 4YIIA 2JVGA 3S14J 2CJJA 2PEXA 4C3HJ 1P6RA 1T39A 1XSXA 3ZQIA 3V7SA 3HPHA 1O57A 1IO2A 2PX9A 2NVXJ 1E2XA 4IRGA 2GAUA 3TO7A 2MSYA 4RB2C 3BDDA 1O3RA 3CJQB 2Y0MA 5H6RA 2F4IA 2VL8A 3C18A 5LGUA 4M3DA 4A6DA 4Z6YA 4DYCA 2HPIA 1YI2I 5JFRA 3A4CA 4PFOA 3PUFA 4BE0A 1R4NB 1CF7B 4KN7X 4AM3A 4S05A 3PSFA 1FOXA 1S7EA 2L9VA 2DMQA 3FKJA 1ZG3A 4B4CA 1FY7A 1Y1WJ 3N97A 1I5ZA 4BBRJ 2GM4A 1JUPA 2F6CA 1MSEC 4ENMA 1JI8A 4V2GA 4XR6A 3LA7A 2UWMA 2DAOA 1TW2A 1J59A 4I76A 4UVCA 2JPBA 4EGZA 4M72A 4IL6C 1ZG5A 3H5NA 4P9UA 2DA2A 3WE3A 4IX7A 3GTJJ 3EPZA 2ZMEA 3KYCB 3AAFA 2LVSA 4BACA 2EA2A 1XDUA 2O6GE 4A69C 2VQGA 2LRDA 3KP2A 1XC5A 3M8JA 1RC9A 4LG3A 3GEZA 1K79A 2W85A 1HW2A 4CH7A 4LK0F 1DU6A 2V9VA 3FBNB 1TQPA 3AG3H 2HS5A 1P9QC 1MW7A 2R7SA 2M34A 2XGXA 1BOAA 1W4MA 1QO0D 4HX8A 1AHDP 1VQ8I 2XF6A 2FMYA 3ISPA 1MJAA 3HOYJ 2K3FA 1NH3A 1Z1DA 1LUJB 3K4MA 3IH3A 1MSFC 1GVJA 2Q2EA 2GWRA 4XICA 2LF8A 3IHUA 2ZSHB 2ESHA 2CS3A 5BPDA 1IRGA 5M3FJ 3G1OA 1IGNA 2LY9A 3CUQC 3MFKA 1SD4A 2LFBA 3G71I 4CCLA 3H9QA 2R92J 1E0EA 1HCRA 4IHTA 1W5CC 4R79A 4DZPA 1FSHA 2F5DA 1TLHB 3CCYA 3ULQB 2XF5A 3I53A 1SFUA 1TT5B 5F1JA 4AIKA 1WSUA 3HDDA 4XLHA 2R3SA 4XOTA 3CCUI 4D9JA 1SANA 2ZCWA 3DTKA 2G9WA 2KDOA 4DIQA 2WBMA 1YW9A 1RPWA 3CUQA 3DTEA 2P5VA 3I55I 5CQGA 4ZDLA 4M3BA 4CYCB 1X19A 3AG1H 4JOMA 1GDTA 3DKWA 3RSNA 4C9YA 4UUSA 2E2HJ 3H92A 3ZN0A 1YW7A 2H94A 2LH9A 2IAIA 1UMQA 3BTJA 3VEPA 4HNTA 2B7EA 4HF1A 3ECOA 4AIHA 5B3SH 3HKZA 5HLTA 3JR9A 1QHGA 1LE8A 3WTUC 2DCEA 4ZDPA 4NHJA 2Z2SB 3OOUA 4J19A 1GV2A 1JTYA 5ILUA 5CQEA 2ID6A 2M1BA 2DFHA 1ZN2A 4E70A 3MAJA 1FBSA 2NVYJ 4Y13A
chains in the Genus database with same CATH topology
2DA5A 2O7OA 2E1OA 1FTTA 2Y9YA 1TWAJ 1QRYA 1ZQ3P 1POGA 1UHSA 3LSGA 5J3LA 3Q3SA 2X6OA 1IG7A 2HOTA 2Y30A 4AYBN 3HB9A 4XRMA 5FLMJ 1FJLA 2VKVA 4MFDA 3BR0A 5E3MA 1JJ6C 2I10A 2XPWA 4FISA 3LNQA 5E3OA 1P7IA 2FJ1A 3S1MJ 3HKZN 3NARA 3D1NI 4V2FA 5IYDJ 1R9TJ 1TWGJ 1AU7A 1X2MA 1Y1VJ 1MBFA 1IC8A 1WH7A 3RQIA 1D5YA 3A01A 2HXIA 5IP6A 2K9QA 4JX5A 3BTLA 2L7ZA 4FTHA 5K7HA 2LKXA 4A3IJ 5GPAA 4S0HB 1Z77A 2COBA 5M5XJ 2FQ4A 2HQ5A 1FIPA 3TW6A 4M3EA 3HBLA 3JRIA 3RKQA 3ZQFA 3HM5A 4JYKA 3WHBA 3TP0A 2NOGA 3PO2J 4A93J 3BR6A 1ZR4A 1JKRC 3OIOA 3GTMJ 1W0UA 2Y0SN 3SJMA 1ETWA 5IOZA 1EF4A 2G0EA 1H88C 1WPKA 3S1RJ 1MBKA 2H8RA 2IEKA 2Y2ZA 4B1RA 3IH4A 4A3EJ 4UUTA 1TC3C 5BNGA 1HOMA 3C2BA 2NVQJ 5FKKA 5GPCA 1ETQA 3B6CA 2XB5A 3CMYA 2R93J 2JJ7A 4Y7NJ 2LLKA 1FIAA 1MBHA 4D5CA 1WGXA 3BR5A 3JRGA 1UG2A 5F0FA 2MG4A 3HEFA 2NS7A 5F0HA 4IHXA 3I4NJ 2HOAA 1T56A 5EZGA 5E3NA 1VI0A 1ETVA 5GP9A 2CU7A 1JKQC 5F04A 1NTCA 1B72B 2HDDA 4LOCA 3BG9A 3BQZA 3S2HJ 2CUEA 2DMNA 2XGEA 1YRNA 4MFEA 4MLOA 2CRGA 1G2HA 2LR8A 3BR1A 2LD5A 2JA8J 3GTOJ 2AHQA 2DA4A 3FK6A 3PO3J 3JRBA 5IP7J 4MO7A 5FJ8J 4AC0A 4A3LJ 5M5WJ 4D7NA 3DCFA 1JUMA 3BTIA 3SDGA 1ETYA 3JRFA 2Y9ZA 4A3DJ 4Y52J 1FTZA 4D7MA 3FIWA 1QVUA 1GVDA 2K9SA 1GT0C 1NK2P 4JX4A 5HODA 1VFCA 1OFCX 2XSDC 1IUFA 4C2MJ 4M3GA 3VPRA 3A01B 1HDDC 3BR3A 1PUFB 3ZQHA 1B72A 1ITYA 2VUMJ 2VKEA 1XG1A 1IDZA 3BQYA 5FKOA 2ZB9A 3RZOJ 1RKWA 5C3EJ 4DZJA 3OSFA 2L9RA 2R5ZB 2PMZN 1F36A 1B8IB 3HOZJ 1PUFA 5F27A 2HYJA 3JRAA 4G12A 3ZQCA 1LFBA 1BA5A 1JKPC 1BW6A 2OPTA 5EEAA 1TWFJ 5EGOB 2NS8A 1ZK8A 5E3LA 2DA6A 2VI6A 2RAEA 2R5ZA 2KT0A 3JRDA 1HLVA 2DTZA 3LSPA 1JT6A 3S17J 4IHYA 3TP3A 1SFOJ 1FEXA 1MH3A 2Y31A 2IBDA 3BG3A 3WHCA 1QPIA 4AUXA 3GTPJ 2CUFA 3QPSA 2DJNA 2DA7A 3HOXJ 1JGGA 2XRLA 4L5EA 5FKNA 2M8GX 4IHWA 4JX6A 3K2AA 4RDUA 4A3CJ 1JJ8C 4DW6A 2DA1A 1BW5A 1IJWC 3CQZJ 1A6IA 1K83J 4W97A 4M6VA 5K7ZA 2DMTA 4QTRA 2D5VA 2E19A 2VPRA 1MH4A 4JP0A 1CQTA 3OSGA 3W6VA 2P81A 5DTDA 1WH5A 5EDNA 1Z0XA 5J1YA 1I50J 1W0TA 1AKHA 2GBYA 3DEWA 2ELKA 2HOSA 1YRNB 3K7AJ 3TEDA 3BTCA 4QSHA 1RR7A 3IV5A 2EZIA 2JN6A 3BT9A 1LFUP 3GTGJ 3RZDJ 3O8GA 5M5YJ 2M9HA 1I6HJ 2XB0X 1X2NA 4XRSA 5EZHA 4X1EA 4BY1J 1OCPA 2L7MP 2M2EA 1MNMC 1E3OC 2ECCA 2CQQA 1WI3A 1JTXA 2H1KA 4MIMA 3G1MA 3JREA 4A3BJ 2NVTJ 1ETOA 1U9OA 2JMWA 2R7ZJ 1RETA 1IRZA 2CQXA 2YS9A 4FCYA 4I6ZA 1HDPA 2LK2A 3ZQLA 1H89C 1F43A 5J1UA 2ME6A 1U78A 5C4XJ 1ZTRA 2AO9A 3ZOBA 4BXXJ 5IP9J 3S1NJ 2B63J 9ANTA 1ETXA 3Q0WA 3A03A 3GTLJ 5IYCJ 2LTPA 3GTKJ 5EF6A 1MBJA 1MBGA 3BR2A 1AKHB 5DS9A 2YUSA 1U8BA 4FE4A 1K61A 3CDLA 5F0CA 2TRTA 5C44J 3E7LA 2XGDA 3LOCA 1B8IA 5F08A 4RBOA 3M4OJ 4GFBA 2DN0A 4BBSJ 2WV1A 1MBEA 1I3QJ 4DYQA 4HNVA 3M3YJ 3QPLA 3MVPA 4D5FA 5K7FA 3UKGA 3FKIJ 3LSJA 3Q0VA 3S14J 2CJJA 2R5YA 1ZGWA 2MW8A 5EGOA 4C3HJ 2X9DA 3GTQJ 2LP0A 3S16J 2HI3A 3ZQIA 5IYBJ 4CYCA 3SFIA 1QVTA 2NVXJ 1WCMJ 2MSYA 1VNDA 1GV5A 1HF0A 2WAQN 3H3VK 4DYRA 2JA6J 2E2IJ 5FLVA 3FISA 2R5YB 4M3DA 4DYCA 1P7JA 4QIWN 3ZQGA 3JRCA 3HOUJ 1BJZA 4A3MJ 1ETKA 2DMPA 5JLWA 3MKLA 1S7EA 1ORKA 2DMQA 4B4CA 1Y1WJ 3S1QJ 2WB1N 3BG5A 4A3GJ 2GM4A 4BBRJ 1ENHA 1JUPA 2EQRA 1MSEC 2N8GA 1IV6A 5C4JJ 1RKTA 3H0GJ 4V2GA 4NDLA 2OF7A 2X48A 1JT0A 1JUSA 2O8KA 2ID3A 2EBIA 3TW7A 2MGQA 4I76A 2M0CA 3L1PA 4ABZA 1TWCJ 3QQAA 2XGCA 2DA2A 5FKMA 4X6AJ 1ZR2A 3GBGA 3GTJJ 1X58A 2R0QC 2DMUA 2LVSA 3F0CA 4BY7J 1BL0A 3JRHA 1O4XA 4A69C 1XC5A 2TCTA 1IDYA 1Q1VA 2EH3A 1APLC 1DU6A 4XRSG 1TWHJ 1U9NA 3O8HA 1XS9A 4BKXA 4C3IJ 4XK4A 1DU0A 4A3KJ 2FX0A 3MN2A 2M34A 1RESA 2GLOA 1AHDP 3Q0UA 4M3FA 3HOYJ 2K9NA 2FD5A 4IEJA 1OCTC 1A5JA 1T33A 3IH3A 3A02A 4C3JJ 1MSFC 2ECBA 4XICA 5J1RA 5FKLA 1VF9A 3HGYA 3G1OA 1OJLA 2EZLA 5M3FJ 2LY9A 1IGNA 5JLXA 5IPAA 3NAUA 2LFBA 5M3MJ 2R92J 5IOYA 1HCRA 4B3AA 4DZPA 1GUUA 3PM1A 3CCYA 3G1LA 2EZKA 3I4MJ 2JA7J 2JK3A 2O9LA 5EYRA 1H8AC 2E2JJ 5F1JA 3HDDA 2W48A 1ZKGA 3IH2A 3HOVJ 2QCOA 3HOWJ 1SANA 2YU9J 3LSRA 4A3JJ 3S15J 2ME0A 3HGGA 1RPWA 1LE8B 5EG0B 4FE7A 2JA5J 2L0KA 2DA3A 1NK3P 4M3BA 2L7FP 4CYCB 1GDTA 2EZHA 4UUSA 2E2HJ 3BTJA 2IAIA 1UMQA 2K40A 4EEFG 4A3FJ 3JR9A 4IHVA 3B6AA 1LE8A 2JWTA 4XIDA 1JKOC 3OOUA 4J19A 2KDZA 1GV2A 1JTYA 5EG0A 2ID6A 3FK7A 2HXOA 2QF7A 2XPVA 4UUSB 3S2DJ 4W1UA 2XPUA 2NVYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA5 A;  2O7O A;  2E1O A;  1FTT A;  2Y9Y A;  1TWA J;  1QRY A;  1ZQ3 P;  1POG A;  1UHS A;  3LSG A;  5J3L A;  3Q3S A;  2X6O A;  1IG7 A;  2HOT A;  2Y30 A;  4AYB N;  3HB9 A;  4XRM A;  5FLM J;  1FJL A;  2VKV A;  4MFD A;  3BR0 A;  5E3M A;  1JJ6 C;  2I10 A;  2XPW A;  4FIS A;  3LNQ A;  5E3O A;  1P7I A;  2FJ1 A;  3S1M J;  3HKZ N;  3NAR A;  3D1N I;  4V2F A;  5IYD J;  1R9T J;  1TWG J;  1AU7 A;  1X2M A;  1Y1V J;  1MBF A;  1IC8 A;  1WH7 A;  3RQI A;  1D5Y A;  3A01 A;  2HXI A;  5IP6 A;  2K9Q A;  4JX5 A;  3BTL A;  2L7Z A;  4FTH A;  5K7H A;  2LKX A;  4A3I J;  5GPA A;  4S0H B;  1Z77 A;  2COB A;  5M5X J;  2FQ4 A;  2HQ5 A;  1FIP A;  3TW6 A;  4M3E A;  3HBL A;  3JRI A;  3RKQ A;  3ZQF A;  3HM5 A;  4JYK A;  3WHB A;  3TP0 A;  2NOG A;  3PO2 J;  4A93 J;  3BR6 A;  1ZR4 A;  1JKR C;  3OIO A;  3GTM J;  1W0U A;  2Y0S N;  3SJM A;  1ETW A;  5IOZ A;  1EF4 A;  2G0E A;  1H88 C;  1WPK A;  3S1R J;  1MBK A;  2H8R A;  2IEK A;  2Y2Z A;  4B1R A;  3IH4 A;  4A3E J;  4UUT A;  1TC3 C;  5BNG A;  1HOM A;  3C2B A;  2NVQ J;  5FKK A;  5GPC A;  1ETQ A;  3B6C A;  2XB5 A;  3CMY A;  2R93 J;  2JJ7 A;  4Y7N J;  2LLK A;  1FIA A;  1MBH A;  4D5C A;  1WGX A;  3BR5 A;  3JRG A;  1UG2 A;  5F0F A;  2MG4 A;  3HEF A;  2NS7 A;  5F0H A;  4IHX A;  3I4N J;  2HOA A;  1T56 A;  5EZG A;  5E3N A;  1VI0 A;  1ETV A;  5GP9 A;  2CU7 A;  1JKQ C;  5F04 A;  1NTC A;  1B72 B;  2HDD A;  4LOC A;  3BG9 A;  3BQZ A;  3S2H J;  2CUE A;  2DMN A;  2XGE A;  1YRN A;  4MFE A;  4MLO A;  2CRG A;  1G2H A;  2LR8 A;  3BR1 A;  2LD5 A;  2JA8 J;  3GTO J;  2AHQ A;  2DA4 A;  3FK6 A;  3PO3 J;  3JRB A;  5IP7 J;  4MO7 A;  5FJ8 J;  4AC0 A;  4A3L J;  5M5W J;  4D7N A;  3DCF A;  1JUM A;  3BTI A;  3SDG A;  1ETY A;  3JRF A;  2Y9Z A;  4A3D J;  4Y52 J;  1FTZ A;  4D7M A;  3FIW A;  1QVU A;  1GVD A;  2K9S A;  1GT0 C;  1NK2 P;  4JX4 A;  5HOD A;  1VFC A;  1OFC X;  2XSD C;  1IUF A;  4C2M J;  4M3G A;  3VPR A;  3A01 B;  1HDD C;  3BR3 A;  1PUF B;  3ZQH A;  1B72 A;  1ITY A;  2VUM J;  2VKE A;  1XG1 A;  1IDZ A;  3BQY A;  5FKO A;  2ZB9 A;  3RZO J;  1RKW A;  5C3E J;  4DZJ A;  3OSF A;  2L9R A;  2R5Z B;  2PMZ N;  1F36 A;  1B8I B;  3HOZ J;  1PUF A;  5F27 A;  2HYJ A;  3JRA A;  4G12 A;  3ZQC A;  1LFB A;  1BA5 A;  1JKP C;  1BW6 A;  2OPT A;  5EEA A;  1TWF J;  5EGO B;  2NS8 A;  1ZK8 A;  5E3L A;  2DA6 A;  2VI6 A;  2RAE A;  2R5Z A;  2KT0 A;  3JRD A;  1HLV A;  2DTZ A;  3LSP A;  1JT6 A;  3S17 J;  4IHY A;  3TP3 A;  1SFO J;  1FEX A;  1MH3 A;  2Y31 A;  2IBD A;  3BG3 A;  3WHC A;  1QPI A;  4AUX A;  3GTP J;  2CUF A;  3QPS A;  2DJN A;  2DA7 A;  3HOX J;  1JGG A;  2XRL A;  4L5E A;  5FKN A;  2M8G X;  4IHW A;  4JX6 A;  3K2A A;  4RDU A;  4A3C J;  1JJ8 C;  4DW6 A;  2DA1 A;  1BW5 A;  1IJW C;  3CQZ J;  1A6I A;  1K83 J;  4W97 A;  4M6V A;  5K7Z A;  2DMT A;  4QTR A;  2D5V A;  2E19 A;  2VPR A;  1MH4 A;  4JP0 A;  1CQT A;  3OSG A;  3W6V A;  2P81 A;  5DTD A;  1WH5 A;  5EDN A;  1Z0X A;  5J1Y A;  1I50 J;  1W0T A;  1AKH A;  2GBY A;  3DEW A;  2ELK A;  2HOS A;  1YRN B;  3K7A J;  3TED A;  3BTC A;  4QSH A;  1RR7 A;  3IV5 A;  2EZI A;  2JN6 A;  3BT9 A;  1LFU P;  3GTG J;  3RZD J;  3O8G A;  5M5Y J;  2M9H A;  1I6H J;  2XB0 X;  1X2N A;  4XRS A;  5EZH A;  4X1E A;  4BY1 J;  1OCP A;  2L7M P;  2M2E A;  1MNM C;  1E3O C;  2ECC A;  2CQQ A;  1WI3 A;  1JTX A;  2H1K A;  4MIM A;  3G1M A;  3JRE A;  4A3B J;  2NVT J;  1ETO A;  1U9O A;  2JMW A;  2R7Z J;  1RET A;  1IRZ A;  2CQX A;  2YS9 A;  4FCY A;  4I6Z A;  1HDP A;  2LK2 A;  3ZQL A;  1H89 C;  1F43 A;  5J1U A;  2ME6 A;  1U78 A;  5C4X J;  1ZTR A;  2AO9 A;  3ZOB A;  4BXX J;  5IP9 J;  3S1N J;  2B63 J;  9ANT A;  1ETX A;  3Q0W A;  3A03 A;  3GTL J;  5IYC J;  2LTP A;  3GTK J;  5EF6 A;  1MBJ A;  1MBG A;  3BR2 A;  1AKH B;  5DS9 A;  2YUS A;  1U8B A;  4FE4 A;  1K61 A;  3CDL A;  5F0C A;  2TRT A;  5C44 J;  3E7L A;  2XGD A;  3LOC A;  1B8I A;  5F08 A;  4RBO A;  3M4O J;  4GFB A;  2DN0 A;  4BBS J;  2WV1 A;  1MBE A;  1I3Q J;  4DYQ A;  4HNV A;  3M3Y J;  3QPL A;  3MVP A;  4D5F A;  5K7F A;  3UKG A;  3FKI J;  3LSJ A;  3Q0V A;  3S14 J;  2CJJ A;  2R5Y A;  1ZGW A;  2MW8 A;  5EGO A;  4C3H J;  2X9D A;  3GTQ J;  2LP0 A;  3S16 J;  2HI3 A;  3ZQI A;  5IYB J;  4CYC A;  3SFI A;  1QVT A;  2NVX J;  1WCM J;  2MSY A;  1VND A;  1GV5 A;  1HF0 A;  2WAQ N;  3H3V K;  4DYR A;  2JA6 J;  2E2I J;  5FLV A;  3FIS A;  2R5Y B;  4M3D A;  4DYC A;  1P7J A;  4QIW N;  3ZQG A;  3JRC A;  3HOU J;  1BJZ A;  4A3M J;  1ETK A;  2DMP A;  5JLW A;  3MKL A;  1S7E A;  1ORK A;  2DMQ A;  4B4C A;  1Y1W J;  3S1Q J;  2WB1 N;  3BG5 A;  4A3G J;  2GM4 A;  4BBR J;  1ENH A;  1JUP A;  2EQR A;  1MSE C;  2N8G A;  1IV6 A;  5C4J J;  1RKT A;  3H0G J;  4V2G A;  4NDL A;  2OF7 A;  2X48 A;  1JT0 A;  1JUS A;  2O8K A;  2ID3 A;  2EBI A;  3TW7 A;  2MGQ A;  4I76 A;  2M0C A;  3L1P A;  4ABZ A;  1TWC J;  3QQA A;  2XGC A;  2DA2 A;  5FKM A;  4X6A J;  1ZR2 A;  3GBG A;  3GTJ J;  1X58 A;  2R0Q C;  2DMU A;  2LVS A;  3F0C A;  4BY7 J;  1BL0 A;  3JRH A;  1O4X A;  4A69 C;  1XC5 A;  2TCT A;  1IDY A;  1Q1V A;  2EH3 A;  1APL C;  1DU6 A;  4XRS G;  1TWH J;  1U9N A;  3O8H A;  1XS9 A;  4BKX A;  4C3I J;  4XK4 A;  1DU0 A;  4A3K J;  2FX0 A;  3MN2 A;  2M34 A;  1RES A;  2GLO A;  1AHD P;  3Q0U A;  4M3F A;  3HOY J;  2K9N A;  2FD5 A;  4IEJ A;  1OCT C;  1A5J A;  1T33 A;  3IH3 A;  3A02 A;  4C3J J;  1MSF C;  2ECB A;  4XIC A;  5J1R A;  5FKL A;  1VF9 A;  3HGY A;  3G1O A;  1OJL A;  2EZL A;  5M3F J;  2LY9 A;  1IGN A;  5JLX A;  5IPA A;  3NAU A;  2LFB A;  5M3M J;  2R92 J;  5IOY A;  1HCR A;  4B3A A;  4DZP A;  1GUU A;  3PM1 A;  3CCY A;  3G1L A;  2EZK A;  3I4M J;  2JA7 J;  2JK3 A;  2O9L A;  5EYR A;  1H8A C;  2E2J J;  5F1J A;  3HDD A;  2W48 A;  1ZKG A;  3IH2 A;  3HOV J;  2QCO A;  3HOW J;  1SAN A;  2YU9 J;  3LSR A;  4A3J J;  3S15 J;  2ME0 A;  3HGG A;  1RPW A;  1LE8 B;  5EG0 B;  4FE7 A;  2JA5 J;  2L0K A;  2DA3 A;  1NK3 P;  4M3B A;  2L7F P;  4CYC B;  1GDT A;  2EZH A;  4UUS A;  2E2H J;  3BTJ A;  2IAI A;  1UMQ A;  2K40 A;  4EEF G;  4A3F J;  3JR9 A;  4IHV A;  3B6A A;  1LE8 A;  2JWT A;  4XID A;  1JKO C;  3OOU A;  4J19 A;  2KDZ A;  1GV2 A;  1JTY A;  5EG0 A;  2ID6 A;  3FK7 A;  2HXO A;  2QF7 A;  2XPV A;  4UUS B;  3S2D J;  4W1U A;  2XPU A;  2NVY J; 
#chains in the Genus database with same CATH topology
 2O7O A;  4FX0 A;  4HDU A;  4M9S A;  1DDN A;  3ABM H;  3R61 A;  3EUH A;  3GWZ A;  3FXM A;  1BI1 A;  2HU9 A;  1XGM A;  2V79 A;  3LSG A;  1IG7 A;  5FRM A;  5D5V B;  1DPR A;  1YIO A;  1GLN A;  2VKV A;  4ENJ A;  4XN3 A;  5ILV A;  5ICF A;  1YS6 A;  2COM A;  1JJ6 C;  2I10 A;  2AQF A;  5EEG A;  4FIS A;  3LNQ A;  5D4S A;  3F8N A;  5E3O A;  1R5I D;  1I27 A;  1IXC A;  1AU7 A;  1JXS A;  4K2E A;  3GO5 A;  3F6O A;  1WZ2 A;  4ESJ A;  3V8K A;  2ETH A;  3ZR8 X;  3IAS 2;  3K4L A;  4LMY A;  2K9Q A;  3CJN A;  3HHH A;  3AG4 H;  4YRV A;  3KYD B;  3ZN1 A;  4JX5 A;  2CQN A;  1DQU A;  4NBQ A;  3ECH A;  3R0J A;  2FML A;  3ZQ7 A;  3DKX A;  3HXL A;  3CCQ I;  4Q5S F;  4FHT A;  5D6F A;  1RRJ A;  1Z77 A;  5M5X J;  1ZH5 A;  3L2C A;  1S5L C;  5CPR B;  2V1U A;  4EM1 A;  4M3E A;  3HZJ A;  1X1B A;  3HBL A;  1FMW A;  2X0L A;  3ZQF A;  1KU2 A;  2MC3 A;  3PIO F;  1O3T A;  2BYV E;  1ZYR F;  2R7W A;  3K10 A;  3R0A A;  2IS4 A;  2JQ7 A;  2X1C A;  1WWX A;  2EV6 A;  4QLC U;  1Z21 A;  4A5N A;  2HR3 A;  3CCV I;  3PJR A;  3NRV A;  1WJF A;  2HQN A;  1DP7 P;  1MBK A;  2Y2Z A;  3N05 A;  1TC3 C;  4UUT A;  1REP C;  3L2Q A;  3FXQ A;  3JAM K;  3CCL I;  1OLT A;  3OOP A;  4BHC A;  3A0H C;  5E79 C;  2BZT A;  5FKK A;  3ZMT A;  4B44 A;  1ETQ A;  5GPC A;  2WAE A;  1U6G A;  4EVI A;  3ZCO A;  1G3Y A;  3LMM A;  3CO7 C;  2A07 F;  1Z3Y A;  2JJ7 A;  3ASO H;  3JCU C;  4MTE A;  4RB1 A;  1SAU A;  1V4R A;  3JRG A;  1D5V A;  2MD5 A;  3PFY A;  5F0H A;  4IHX A;  1TT0 A;  4GO1 A;  4R8H A;  2NVU B;  2HTS A;  4L5J A;  2QSF X;  1ETV A;  1YE9 A;  1BC7 C;  1T2K A;  1ZLK A;  5F04 A;  2LBF B;  4LJZ F;  2DYS H;  3QYE A;  2VQH A;  1VQO I;  1ZAO A;  2XGE A;  1OYI A;  1HSJ A;  3TBI A;  5IY5 H;  2P6T A;  2R7T A;  3KFW X;  2HPM A;  3GFM A;  1XMX A;  4L18 B;  3CP8 A;  5JHF A;  2DOA A;  4EM2 A;  2QUF A;  2TDX A;  1WJ5 A;  4XLE A;  3CME I;  2FRH A;  5FJ8 J;  2XKO A;  4AC0 A;  5TGT A;  1FX7 A;  2KLO A;  4HNU A;  4GYI A;  3LFK A;  4XON A;  4BU2 A;  2JZY A;  4KN4 X;  3SDG A;  3BTI A;  5D8L B;  3VB2 A;  1W7P D;  1AOY A;  2CV1 A;  1XB4 A;  2WC2 A;  3L09 A;  3OYB A;  4A3D J;  5B1A H;  1JGS A;  5D5X B;  2YR2 A;  4D7M A;  4KIG A;  3FXL A;  1QVU A;  1GVD A;  2FA5 A;  5GAD J;  2OBP A;  3RPU A;  1GT0 C;  4UVA A;  2ZC2 A;  1ZLJ A;  3CCR I;  1EH7 A;  3VPR A;  3LSM A;  1FPQ A;  4G7Z F;  5DCM A;  4I2O A;  5HDG A;  5GTI C;  1Q1H A;  1JHF A;  4ETS A;  3S3O A;  3F23 A;  1IDZ A;  3GFI A;  5FKO A;  1R1V A;  3FXJ A;  4DZJ A;  5A2Q Z;  1FOK A;  2MLK A;  2PMZ N;  1DPU A;  3I0T A;  1J5Y A;  3M07 A;  4BJT A;  4RAG A;  2STW A;  1LEB A;  4GGG A;  4G12 A;  1QQI A;  3ZQC A;  2CQK A;  4Q47 A;  2HKO A;  5AON A;  2W84 A;  3I59 A;  3EDP A;  4NC6 A;  4XSZ F;  5EGO B;  2NS8 A;  1UHW A;  3V8L A;  5JI6 A;  2DDB A;  1LEA A;  2OQG A;  1LB2 A;  1WRJ A;  1I1G A;  3GZ5 A;  1E3P A;  2DA6 A;  2VI6 A;  3CC7 I;  2EIL H;  2KT0 A;  1RZ4 A;  4IRH A;  5E20 A;  5KK1 A;  5FGM A;  3S17 J;  2WWY A;  4EV0 A;  4KMU X;  4HX7 A;  3DTI A;  2ESN A;  4AUX A;  1U3E M;  2M4K A;  4PFP A;  4LLL A;  1G3T A;  2XRL A;  2EFO A;  4UB8 C;  3L2U A;  1JGG A;  2M8G X;  4U0Y A;  2IJL A;  1HBX G;  4CZZ A;  3VYT B;  4A3C J;  5EEH A;  1KQ9 A;  2BXZ A;  2LSO A;  2DOE A;  3A0B C;  3M8E A;  1B59 A;  4OMZ A;  3E5U A;  1YX3 A;  4M6V A;  4W97 A;  3CLQ A;  2JVH A;  2M7B A;  4QTR A;  1I1S A;  1DGR M;  2A68 F;  1CQT A;  1BN5 A;  2F5C A;  3I4P A;  3E6D A;  4E6K G;  2VJ4 A;  4LIV A;  5J1Y A;  1VQ4 I;  1I50 J;  3UR3 C;  3DEW A;  1TTY A;  4KNY A;  1W7P B;  2QQB A;  1UEL B;  4Y3O A;  3FHZ A;  1R71 A;  3LA3 A;  3DPT A;  3BTC A;  2DQR A;  2WA0 A;  4QSH A;  2KKO A;  2JN6 A;  3TOB A;  2R7O A;  3NWS A;  1WQ2 A;  3GTG J;  3VWB A;  3RZD J;  3SHF A;  3KEQ A;  4NQW B;  1BR1 A;  5JVG F;  4IF4 A;  2LNB A;  1X2N A;  4PJN A;  4XRS A;  4BY1 J;  5TIS C;  2L7M P;  4OIN F;  4I09 A;  5D6E A;  1E3O C;  4IQ4 A;  2R7V A;  4KIB A;  4MIM A;  2QBY B;  3J7A Y;  2MH9 A;  2VE9 A;  4LFU A;  2KRC A;  3PFI A;  2UXX A;  1P2F A;  3ELK A;  3TMO A;  2VBX A;  2V9P A;  1YYV A;  1TNS A;  2LK2 A;  2UZK A;  3ZQL A;  1F43 A;  5HNF A;  2XIG A;  5C4X J;  3JSP A;  1K4T A;  2AO9 A;  1ZRD A;  4BXX J;  3LQQ A;  3I5U A;  3VFZ A;  4BDY A;  4P9F A;  2PJR B;  2XVC A;  9ANT A;  2LYC A;  1K6Y A;  1ETX A;  2KMU A;  5DM7 F;  4BE2 A;  3GTL J;  2LRE A;  4NB5 A;  3GTK J;  5EF6 A;  2DPD A;  4RM2 A;  1FMV A;  2BW3 A;  3H9J A;  2DOF A;  2PLY A;  2YUS A;  1JE8 A;  2LF7 A;  4BQA A;  3CJR B;  2TRT A;  1XX5 A;  3L9F A;  3G6E I;  1OCC H;  4XKV A;  2KP6 A;  3CLO A;  4RBO A;  4GFB A;  2NXN B;  1MBE A;  4DYQ A;  2EJR A;  2F4M B;  3DBL B;  1IRF A;  3FKI J;  3LSJ A;  2MW8 A;  5EGO A;  2LP0 A;  4BYY A;  4KIC A;  2E1M B;  4NNJ A;  3U21 A;  4I0B A;  4ZZL A;  5J47 A;  3W3C A;  3EUK L;  3W2V A;  3JTG A;  5IT9 K;  2KFD A;  1FNN A;  2WAQ N;  4KIT B;  3H3V K;  3Q5F A;  3S93 A;  1WJC A;  2E2I J;  5FLV A;  3ZQG A;  3JRC A;  2E7W A;  3BJ6 A;  4IQJ A;  3WTY C;  4S04 A;  3HOU J;  2ZXI A;  2EFW A;  4A3M J;  1EH8 A;  2DMP A;  4LLN A;  3MWM A;  3WTZ A;  3ZMU A;  4M73 A;  1G3S A;  2WB1 N;  4I0A A;  4A3G J;  3B73 A;  3BPV A;  3W6K B;  1ENH A;  4YEL A;  1T95 A;  4P1W A;  2EQR A;  2QZ8 A;  3QAH A;  1P4A A;  1IV6 A;  2HQA A;  5C4J J;  3WGG A;  5IT3 A;  3H0G J;  3DQV C;  3O2P E;  1N75 A;  2IS1 A;  1USS A;  2M30 A;  2WB1 A;  2Z5U A;  4HEA 2;  4I7H A;  4CSW A;  2OF7 A;  1NHA A;  2X48 A;  3R4K A;  1JUS A;  5A2Q K;  1JT0 A;  2VB6 A;  2M0C A;  3L1P A;  4H0E A;  2WY7 Q;  2BV6 A;  4OOI A;  3QQA A;  1KYZ A;  2VN2 A;  1D0X A;  3MCZ A;  5FKM A;  1ZR2 A;  3WGI A;  3L00 A;  3C1D A;  2DTR A;  2DMU A;  2KL4 A;  2UXN A;  2R0Q C;  4RMN A;  2A6H F;  2P0W A;  1QZZ A;  1W36 D;  3ERM A;  3V7R A;  2V1X A;  1IDY A;  1Q1V A;  2FBI A;  4HQE A;  1APL C;  2GIV A;  1Y8R B;  3T1B A;  3ZMD A;  2PG4 A;  4XRS G;  5BMZ A;  3G2B A;  4BKX A;  4C3I J;  1DU0 A;  4QPQ A;  3DBR B;  1RES A;  2GLO A;  2QBY A;  4M3F A;  2ZJR F;  4PDK A;  2K9N A;  1D0Z A;  2CMP A;  4PJ0 C;  4FT8 A;  4XLF A;  3OYH A;  1A5J A;  4XOP A;  3ONQ A;  1BI0 A;  4C3J J;  1RUO A;  3F21 A;  3RKW A;  1KQ0 A;  2HGC A;  3AG2 H;  2JRM A;  5J1R A;  5FKL A;  2Q0O A;  1YG2 A;  3LST A;  3HGY A;  4L0Y B;  2EZL A;  2PJR A;  4OWR B;  1BI3 A;  2LDU A;  4RGS A;  4WWC A;  1BIA A;  4PGG A;  2A5W A;  3PM1 A;  3N4M A;  3ERE D;  3G1L A;  3I4M J;  3V7C A;  3HSR A;  5EYR A;  3BP8 A;  2E2J J;  1G4D A;  2EFN A;  2L5Q A;  3CP2 A;  4DQ2 A;  3BPX A;  3QOD A;  4DBR A;  1MD0 A;  4IRI A;  1YOV B;  2CSO A;  4RS8 A;  2NNN A;  3G73 A;  1FOY A;  3LSR A;  4A3J J;  4LB5 A;  3S15 J;  4UB6 C;  1FSE A;  4BAY A;  3L2W A;  3U2R A;  1VQ5 I;  2OD5 A;  5HS8 A;  3HOT A;  3D5L A;  1W5T A;  2LOO A;  2XAQ A;  1XGO A;  4F91 B;  5FLX K;  5EG0 B;  2O5R A;  4FE7 A;  5LGN A;  4HX4 A;  4XKC A;  1FP1 D;  1NK3 P;  1V55 H;  1HKS A;  2VOP A;  4EMS A;  4HLY A;  3FXO A;  3FZV A;  5FD6 A;  5FRO A;  2P8T A;  2QQ8 A;  4EEF G;  1R1U A;  1S7O A;  2X1E A;  1YIT I;  4A3F J;  4IHV A;  4V19 K;  2DK8 A;  2BGC A;  4O3M A;  4XID A;  3P9C A;  5JR3 A;  3KZZ A;  1IAW A;  2KDZ A;  2ZJ2 A;  1ZGJ A;  4ESB A;  1G3W A;  3FK7 A;  5K5O A;  3RYP A;  2XPV A;  1B9M A;  4KA4 A;  4UUS B;  3QP6 A;  4W1U A;  4OIR F;  1XSD A;  2DA5 A;  1X4O A;  4AID A;  3DLA A;  5ED4 A;  3HRS A;  3J80 K;  2Y9Y A;  4BE1 A;  2R7U A;  1TWA J;  4KDP A;  2VBY A;  3CF2 A;  5KHD A;  1POG A;  4XLC A;  3PNV A;  2JPC A;  3Q3S A;  4XRF A;  5J3L A;  4CCJ A;  3QWL A;  2Y30 A;  1PVE A;  4CA0 A;  4PJM A;  2XAU A;  1P92 A;  2F48 A;  4XRM A;  3BOQ A;  3GXO A;  4HPQ A;  1XMA A;  3BR0 A;  5E3M A;  2F5E A;  5LHI A;  4PSX A;  1TW3 A;  4XKB A;  2XPW A;  1WI9 A;  1D1A A;  1P7I A;  2FJ1 A;  3HKZ N;  3NAR A;  3PQK A;  4M6X A;  2DFF A;  1TWG J;  3E5Q A;  3HSE A;  3W2W A;  3SZT A;  1WH7 A;  1D5Y A;  3A01 A;  2HXI A;  5IP6 A;  1QZY A;  1Z6R A;  4JBA A;  2OCE A;  3I64 A;  2M8E A;  2EIM H;  1B6A A;  3BTL A;  2FBH A;  5E8G A;  5AIQ A;  1SD7 A;  3IRR A;  4OIO F;  1XCB A;  2VON A;  1T38 A;  2XAS A;  5GPA A;  1RUN A;  2KRH A;  4S0H B;  4OAZ A;  2COB A;  1G6N A;  1KYW A;  1LJ9 A;  3KP3 A;  1FIP A;  4GDF A;  5J4Y A;  3E1S A;  2BVM A;  2RQQ A;  1SFK A;  1L0O C;  3FXK A;  1FBU A;  2LY2 A;  3HM5 A;  1ZAR A;  3WHB A;  5LFA A;  2PN6 A;  1BBY A;  5TJJ A;  2Y75 A;  3BR6 A;  4PZJ A;  4IKF A;  3FMR A;  3WTV C;  5HLI A;  1ZR4 A;  1PP7 U;  3BLY A;  3DKY A;  1TBX A;  4BHP A;  1W0U A;  3GTM J;  2Y0S N;  1ETW A;  5IOZ A;  4L9T A;  1EF4 A;  2VT3 A;  3C2G A;  3IP4 B;  2NAZ A;  2KIQ A;  3IH4 A;  1VQL I;  3OV8 A;  2VC1 A;  3BZC A;  3C2B A;  4PCQ A;  4EJO A;  5FLX Z;  1X4P A;  5HDN A;  3S3N A;  1V5F A;  3SZG A;  3PNT A;  4IOA F;  1WHU A;  5TRD A;  2R93 J;  4Y7N J;  2BXY A;  2GA2 A;  2IA0 A;  3L7W A;  4O6J A;  4B09 A;  2HVS A;  1NG6 A;  3RKX A;  5L3G A;  2Q8K A;  5F0F A;  2R7Q A;  2Z16 A;  2MG4 A;  2NS7 A;  3I4N J;  2HOA A;  1T56 A;  5J8F A;  4ZDO A;  1VI0 A;  3DLL F;  3KYL A;  1JKQ C;  1BIB A;  3BCB A;  2HDD A;  3S2H J;  1N25 A;  1L3L A;  1MMG A;  2A6T A;  2IXS A;  3ZXS A;  3TKY A;  2DDA A;  2V7F A;  2IA1 A;  3OYF A;  4BH9 A;  2HEO A;  5CJ9 A;  5CLS A;  3OYJ A;  1SFX A;  4G6T B;  1YJW I;  4MLO A;  2MH2 A;  1W1W E;  2P7C B;  3BR1 A;  2JA8 J;  1YFH A;  2AHQ A;  3SQN A;  1Y6I A;  1T8I A;  2QQA A;  3GME A;  1U8R A;  1PP8 F;  4MO7 A;  2E5Z A;  1WKM A;  4E7K A;  4A3L J;  2B9S A;  4I98 B;  5ERI A;  1IN7 A;  1KQ8 A;  1OYY A;  4BEH B;  4D7N A;  1JUM A;  1XDS A;  4LD5 A;  1EH6 A;  3OIQ A;  2BHZ A;  1HKQ A;  2GIZ A;  4A0X A;  1P4W A;  2MD0 A;  2Z99 A;  3TL4 X;  3FIW A;  4EGY A;  2K9S A;  2ZFU A;  1UAA A;  2HOE A;  1TQM A;  1SMT A;  1DGW Y;  2KJB A;  4M9Z A;  1OFC X;  3RYR A;  2XSD C;  1HDD C;  4C2M J;  2ADU A;  4M3G A;  5KCM A;  3OYI A;  4QWQ A;  3K70 D;  4G7H F;  3RPQ A;  4KT5 C;  1PUF B;  3ZQH A;  5H6Q A;  3GVA A;  1B72 A;  2X6X A;  3IUO A;  3AL0 B;  1U5T B;  3GZN B;  3WG7 H;  2Z9O A;  3F8C A;  4U88 A;  2IT0 A;  1AA7 A;  3WGH A;  4ZYD A;  2L9R A;  3NWT A;  2R5Z B;  1B8I B;  3HOZ J;  1YHQ I;  1ZEL A;  1LVA A;  3D0S A;  2F2E A;  5F27 A;  4ZYE A;  1W36 C;  4HF0 A;  1XD7 A;  3KE2 A;  2KHM A;  5EEA A;  1TWF J;  2HZT A;  2H09 A;  3K69 A;  4C2T A;  1LDJ A;  2D2W A;  2KIS A;  1D8J A;  2XHK A;  4IHS A;  4IHY A;  1OCZ H;  2UV1 A;  3CES A;  3E97 A;  3TP3 A;  4CGZ A;  3P7N A;  2Y31 A;  2CO5 A;  4FAS D;  2D1H A;  1QPI A;  3GTP J;  4MTD A;  3QPS A;  2QLZ A;  2DA7 A;  4HSR A;  2DXI A;  2X85 A;  4P5O A;  5DEQ A;  3IKT A;  2B0L A;  2FQ3 A;  3DPL C;  4MGR A;  1BW5 A;  1ACI A;  1A6I A;  3OYN A;  4HDV A;  2QVO A;  3BJA A;  5E18 F;  3GW2 A;  2A05 A;  2D5V A;  1A6Q A;  3B02 A;  3OSG A;  2X1D A;  2Z1D A;  2CW0 F;  2K9L A;  2KZV A;  4GRI A;  4ESF A;  2I5U A;  2E7X A;  2IA2 A;  2VIX A;  3BG6 A;  4HV5 A;  4EJV A;  2H6C A;  2ZXJ A;  3CUQ B;  3RIR A;  1U0J A;  1HXD A;  3K7A J;  3GZ6 A;  3IV5 A;  2EZI A;  2FEZ A;  2V1D A;  4WXH A;  3BZK A;  3OYG A;  2L54 A;  2ICW G;  2NS0 A;  2QKM B;  1I39 A;  4G9Y A;  4LIT A;  4DNC A;  4ZZD A;  5BQT A;  3T0Y A;  1I6X A;  1T98 A;  4BQO A;  5J8C A;  3C2H A;  4X1E A;  1OCP A;  1P4X A;  1MNM C;  2GXB A;  2DU9 A;  1B1B A;  1V5G A;  1WI3 A;  1JTX A;  2W57 A;  3BWG A;  1FWZ A;  1IN4 A;  4IPA A;  3JRE A;  4A3B J;  4E7L A;  2QQ9 A;  1QNT A;  1U9O A;  2XAF A;  2FUG 2;  3MZH A;  5HS9 A;  1RET A;  4P55 A;  3HYI A;  3EUH C;  3JTH A;  2IGK A;  2MAB A;  3ABU A;  1H89 C;  4IVN A;  1D8K A;  2CFX A;  2ME6 A;  2BOL A;  4BJ6 C;  3RCO A;  2G7H A;  1R4M B;  2VJ5 A;  2MC4 A;  5IP9 J;  1TNT A;  1NG7 A;  4M74 A;  3A03 A;  5IYC J;  3OYE A;  2DT7 B;  1MBG A;  2V26 A;  1VZ0 A;  1S6L A;  3JW4 A;  3AKZ A;  1VQ9 I;  4KMF A;  2EIK H;  1B8I A;  2IP2 A;  4BBS J;  1J0R A;  2HTJ A;  2H8W A;  2M0M A;  4HNV A;  5D5W B;  3LA2 A;  2K02 A;  4D5F A;  3RJP A;  4N9H A;  4BGD A;  2P6S A;  1OQY A;  4HBL A;  2C6Y A;  3I59 B;  2R5Y A;  2LKS A;  2RN7 A;  5ICC A;  3RI4 A;  1ZGW A;  4CHU A;  4A0Y A;  3GTQ J;  1Y56 A;  1LKX A;  3FHN A;  1CF7 A;  4M9X A;  5IYB J;  4IZZ A;  1YQA A;  3OY9 A;  1QVT A;  2YX7 A;  4EQQ A;  2VJI A;  3IWZ A;  1O3S A;  1QU3 A;  1O7F A;  1WCM J;  1R5G A;  1VND A;  1CGP A;  3AFH A;  5J6X A;  1GV5 A;  3VOD A;  1HF0 A;  2A61 A;  4DYR A;  2M45 A;  2JA6 J;  3H36 A;  2M5W A;  2L3D A;  3FIS A;  4HA8 A;  5FRN A;  4N4N B;  3CMM A;  4QIW N;  2O61 A;  3G3Z A;  3Q9S A;  2P4W A;  4RLQ A;  3CDI A;  2NRA C;  1YS7 A;  3TO9 A;  3FXR A;  5JLW A;  2FXA A;  3MKL A;  4E7I A;  2M4G A;  2V6E A;  1ORK A;  1TL8 A;  3BCA A;  3BG5 A;  5E1W A;  3GF2 A;  5E1X A;  2RVC A;  2JTV A;  3KEY A;  1VQN I;  3R60 A;  1OYW A;  1F5T A;  1IUY A;  3QU3 A;  1X1A A;  2DLL A;  2K86 A;  3GYH X;  4NDL A;  2D1V A;  2BE5 F;  4ON0 A;  5LEK A;  2ID3 A;  2EBI A;  1F1Z A;  4WXD A;  4NC7 A;  2PI0 A;  2KIU A;  4ABZ A;  1TWC J;  5JVT A;  2WTE A;  3H5A A;  2X6Y A;  2XGC A;  2DBB A;  1DP3 A;  5IT9 Z;  3GBG A;  3NEU A;  2GA1 A;  1X58 A;  1IW7 F;  3F0C A;  4BY7 J;  1BL0 A;  3JRH A;  1J7K A;  2JT1 A;  1O4X A;  3H0D A;  5L3F A;  3HTU A;  3MKW B;  2TCT A;  1A35 A;  4R1H A;  1T0F C;  5E1Z B;  2JRT A;  1TWH J;  1U9N A;  3IAM 2;  4UXN A;  2O3F A;  4M6Y A;  1XS9 A;  3T8R A;  1ERD A;  1D1C A;  3D5R C;  4A3K J;  2FX0 A;  1SD6 A;  2L9N A;  3W6J B;  3J7A O;  2K9M A;  1Z9C A;  4FQG A;  2L9S A;  3Q0U A;  3F8M A;  4YG2 F;  1IXS B;  1BC8 C;  2FD5 A;  2ZFW A;  5DUK A;  2OU2 A;  1T33 A;  1RNL A;  4OIP F;  2I8D A;  1O3Q A;  1U2W A;  2VOD A;  1OJL A;  2H1L A;  3KZI C;  4LIU A;  5GAG J;  5J40 A;  5M3M J;  5IOY A;  3HG9 A;  3EET A;  3EYY A;  1GUU A;  2JSP A;  3J81 Z;  2EZK A;  2JK3 A;  2O9L A;  1FOW A;  2ZXW H;  1H8A C;  3M8F A;  3IC7 A;  5LHG A;  1DUX C;  2W48 A;  4ZTJ A;  3IH2 A;  5DM6 F;  3HOW J;  1MNE A;  2BY2 A;  2V1N A;  1XPX A;  1FZP B;  1PUE E;  2YU9 J;  2CH0 A;  2VXZ A;  2ME0 A;  3DPU A;  2HDC A;  3QYB A;  1LE8 B;  3ZQQ A;  1A36 A;  5LHH A;  1UCR A;  3FMQ A;  3V4G A;  2DA3 A;  1K6O A;  3HRT A;  1J09 A;  1B9N A;  2EA4 A;  3HPG A;  1G59 A;  4Q48 A;  3O6B B;  1Z3X A;  5CVU A;  1SVL A;  5B66 C;  4CCN A;  2K40 A;  3CC4 I;  1FC3 A;  4ITV A;  1WFX A;  3B6A A;  2JWT A;  4IOC F;  2D45 A;  4BUP A;  5GAH J;  2ZNZ A;  2DW4 A;  2KIF A;  2WAD A;  3RTR A;  3S8P A;  1R1T A;  5HLG A;  3WTT C;  5BOX A;  1BR2 A;  3FDY A;  1S29 A;  2XRO A;  1KU3 A;  1Z7L A;  3REO A;  5HDK A;  2IGM A;  3CD6 I;  4HF2 A;  4OMY A;  4B48 A;  2E1O A;  5ICG A;  3KLN A;  1D0Y A;  5KVR A;  1ZQ3 P;  1OR7 A;  1UHS A;  4NUB A;  4D0P A;  2X6O A;  1BR4 A;  4RGU A;  2E60 A;  4AYB N;  5FO5 A;  3CMA I;  5FLM J;  4MFD A;  1Z67 A;  4EJT A;  4YFX F;  3BC8 A;  1QA6 A;  3MMY B;  3WU0 A;  5CVJ A;  1Z91 A;  1VQK I;  4FET A;  4O5V A;  1R9T J;  1X2M A;  3PQJ A;  4XSX F;  3OYL A;  1Y1V J;  1Y0N A;  3J80 Z;  3RQI A;  2OQR A;  5LRR A;  2EV0 A;  4XOR A;  4UY8 I;  5KAI C;  3WG9 A;  1G8X A;  4QPO A;  4XN0 A;  3BY6 A;  2XC7 A;  2DK5 A;  2L7Z A;  4L9N A;  4ENN A;  5K7H A;  1LNW A;  3WTS C;  2CG4 A;  4MHG A;  2E1N A;  4J00 A;  1WJA A;  4ZC3 A;  1UZC A;  4RAZ A;  4XNF A;  1SVO A;  4PJL A;  2HQ5 A;  2HKX A;  1RI7 A;  2ZJP F;  1S7A A;  3I54 A;  3RKQ A;  3SZP A;  4JYK A;  3UNG C;  2HYG D;  3PO2 J;  4A93 J;  3DWL E;  4WCG A;  2BY3 A;  3V8J A;  4U7D A;  2WAF A;  3FF5 A;  2L4A A;  1JKR C;  4A6E A;  3CCS I;  3E5X A;  3OIO A;  2H6B A;  2NNY A;  2P5K A;  3SJM A;  1UB9 A;  2G0E A;  4LB6 B;  1WPK A;  1M1E B;  2LG4 A;  1TQI A;  2BEO A;  1MZB A;  1EV7 A;  3ZGK A;  2HNH A;  3VDX A;  3GCM A;  5FD5 A;  1HOM A;  4ZYG A;  1QBJ A;  4OAY A;  2NVQ J;  4B47 A;  3QOP A;  1K78 B;  3T8T A;  2M87 A;  3Q9V A;  3TDZ C;  1ZRC A;  2L02 A;  2QWW A;  3CMY A;  2BW3 B;  2LLK A;  3OR1 C;  1FIA A;  1B4A A;  4D5C A;  3BR5 A;  3M1C A;  4I01 A;  1FYK A;  3P5J A;  3HEF A;  5CYV A;  1Y0U A;  4L9J A;  2VQC A;  5H2F C;  5E3N A;  2ZSI B;  4YEJ A;  1R7J A;  4BQQ A;  5HNH A;  4HQM A;  1NTC A;  1B72 B;  1FLI A;  1BM9 A;  4LOC A;  3MKZ A;  2HWV A;  2PMH A;  2DMN A;  2PMZ A;  4KIS A;  3TGN A;  4EJU A;  3EUA A;  3HHG A;  1YRN A;  2QSG X;  4RB3 C;  4MFE A;  1WVR A;  1SVM A;  2GOM A;  3P9I A;  2LD5 A;  5GAE J;  4JQF A;  2LC2 A;  2DA4 A;  3IL2 A;  5DUI A;  3KEO A;  2R7X A;  2LBF A;  5IP7 J;  1MDM B;  1VQP I;  1FBQ A;  5LEJ A;  5ILS A;  1HW5 A;  4DOZ A;  3DCF A;  4E7Z A;  1ETY A;  2Y9Z A;  3ZMS A;  3J7Z I;  2E71 A;  3JAM Z;  1SMY F;  2K4B A;  3H1C A;  1FTZ A;  3R6S A;  3O3K A;  5DD4 A;  2IS6 A;  4HST A;  2BY0 A;  5CKT A;  5L3B A;  3I56 I;  4G94 A;  2L01 A;  1MJB A;  1UHM A;  3SXY A;  1KGS A;  3U1D A;  3ZMZ A;  4ASN A;  3A01 B;  1Y8Q B;  3RQ4 A;  3BR3 A;  2R7R A;  6PAX A;  3L2V A;  3DBH B;  2OJE D;  1A04 A;  4N0B A;  4RAF A;  4AIJ A;  3TO6 A;  1ITY A;  2F4O B;  3GLX A;  1XG1 A;  3VYU B;  3W2A A;  4UV9 A;  2VOO A;  4CYD A;  3BQY A;  3QPH A;  4I99 C;  2ZB9 A;  2M3A A;  4GYG A;  1RKW A;  3CUO A;  3QU6 A;  3MKY B;  1YJ9 I;  1GHC A;  1F36 A;  1ON2 A;  3K4C A;  4NC8 A;  2O0Y A;  1PUF A;  4IO9 F;  5DCM B;  4B3X A;  4L5I A;  4XQF A;  4AU7 A;  4HG2 A;  2FNP A;  4P96 A;  3OYA A;  1SC7 A;  2FU4 A;  4HAM A;  1FYM A;  1BW6 A;  2OPT A;  4KJZ A;  4A12 A;  5JHU A;  1MJ9 A;  1U5T A;  2FBK A;  2XAJ A;  2HQR A;  4HV6 A;  1QHH D;  2HZD A;  5E3L A;  2R5Z A;  5AIP A;  1R23 A;  4MEY F;  2VC0 A;  2DTZ A;  2OUM A;  1JT6 A;  3F3X A;  3LSP A;  5BS6 A;  2ACJ A;  3TQN A;  4ZH4 F;  2VPL A;  5KNL A;  1SFO J;  4EM0 B;  1FEX A;  1BI2 A;  1MH3 A;  2IBD A;  4JK1 X;  4LGW A;  2K27 A;  3CJT B;  3ESW B;  3CF5 F;  2CUF A;  2DJN A;  2QEN A;  3LFU A;  4F92 B;  2ZXH A;  5L3E A;  5FKN A;  1MMN A;  4A2U A;  4JX6 A;  3E0J B;  5LLQ A;  1PJR A;  3OYM A;  3K2A A;  2CGP A;  4RDU A;  2FF4 A;  5FFX A;  1SAX A;  2Z3Y A;  4AVZ A;  3CQZ J;  2X6W A;  1K83 J;  4EJW A;  4KIF A;  1IJW C;  2DMT A;  2W00 A;  1R00 A;  1QGP A;  2VKH A;  2E19 A;  4JP0 A;  2CWE A;  3ZP5 A;  3W6V A;  4RA2 A;  5EDN A;  1W0T A;  1AKH A;  2GBY A;  2QYO A;  1UJ8 A;  4HOB A;  3BZ6 A;  2VJJ A;  2M7A A;  2HOS A;  4DGW B;  3KP6 A;  4F7Z A;  4H4K C;  5CVV A;  3COA C;  3HL2 A;  1S8N A;  1RR7 A;  4II3 A;  1LFU P;  2CUZ A;  3PL8 A;  2CFO A;  3VYR B;  1YIJ I;  2ELJ A;  3O8G A;  1N77 A;  2L4M A;  1S72 I;  2XUB A;  2HFH A;  1I6H J;  2XB0 X;  4Y17 A;  1YO5 C;  1TZL A;  2M2E A;  4RLF A;  3P9K A;  4PK4 A;  1JKO C;  2MLG A;  1PYV A;  2MYS A;  2RQP A;  5DCF A;  2H1K A;  3DFG A;  2NVT J;  2MFZ A;  4LG0 A;  3CCJ I;  2CQX A;  1IRZ A;  1Y39 A;  2DOD A;  1H9T A;  4E7J A;  1HDP A;  3M9A A;  2A69 F;  2RRE A;  5J1U A;  4PJJ A;  1ZTR A;  3OWT A;  4ENK A;  4IJA A;  2QGU A;  3S1N J;  2OCC H;  3PNY A;  2DI3 A;  1SFE A;  3Q0W A;  4HLX A;  3DXJ F;  3HSF A;  4PSW A;  3DU5 A;  1MBJ A;  3BR2 A;  4WF2 A;  1J2X A;  4RGX A;  3I3L A;  1AKH B;  5DS9 A;  1U8B A;  4FE4 A;  3CDL A;  1T0F A;  2OZU A;  3I58 A;  5F0C A;  3WOD F;  5C44 J;  3E7L A;  1UST A;  2R4G A;  3KCC A;  1HQC A;  2XGD A;  3ABT A;  3CZ6 A;  1OCO H;  2DN0 A;  2O03 A;  2WV1 A;  3SDB A;  1I3Q J;  3M3Y J;  2ZO4 A;  3QPL A;  3MVP A;  2K3P A;  5H20 A;  5K7F A;  1ZG1 A;  3Q0V A;  3CDH A;  3DP7 A;  3SYT A;  1KZH A;  2EV5 A;  2X9D A;  3K1M A;  3S16 J;  2HI3 A;  1GXQ A;  4CYC A;  4UNO A;  3SFI A;  3KIO A;  4L0Z B;  2LKP A;  2V6C A;  3E3V A;  2XSJ C;  4ZJZ A;  3KP4 A;  2E1M C;  3WU1 B;  2XV4 S;  2R5Y B;  3OS2 A;  4ZTF A;  3ZPL A;  1X3U A;  1P7J A;  2Y69 H;  3HC7 A;  3K1P A;  3HUG A;  2VKD A;  1J75 A;  5F1R A;  1BJZ A;  2PJP A;  3S3M A;  4E7H A;  1ETK A;  1XMK A;  1F9N A;  4A5M A;  1SEU A;  3S1Q J;  4AWX B;  2GXG A;  1D3Y A;  5DDG A;  2Y0S A;  4PUS A;  5LBQ A;  2IGN A;  2ZME B;  5K5R A;  3H5R A;  2N8G A;  3SFZ A;  1RKT A;  2VE8 A;  3VSL A;  1I3A A;  1T08 B;  4L9V A;  3K4B A;  3OL3 A;  1VQ6 I;  3KP7 A;  5HVQ C;  2O8K A;  3TW7 A;  2MGQ A;  2KIM A;  2BVL A;  2Y48 A;  4XLA A;  1XN7 A;  1S3J A;  3U1K A;  3OS1 A;  3K0L A;  3GFL A;  1ZRF A;  4X6A J;  2RNG A;  1K4S A;  5DV5 A;  2DFE A;  4BS9 A;  2IW5 A;  3LSK A;  2ELH A;  1R36 A;  2DT6 A;  3TOA A;  2CW7 A;  1WJD A;  4C30 A;  2EH3 A;  1LVK A;  2YU3 A;  2JA2 A;  4AVP A;  2KRF A;  4J01 A;  1U5T C;  3KP5 A;  3O8H A;  4F55 A;  4EAT A;  4XK4 A;  1FT9 A;  3MN2 A;  3PIP F;  1EA3 A;  2IS2 A;  1YX5 A;  1XGN A;  4IEJ A;  1ONV A;  1OCT C;  1LFP A;  5HLH A;  3JSO A;  2VT2 A;  3GLL A;  3A02 A;  5E8I A;  2ECB A;  3MEX A;  5GTH C;  4C2U A;  4GXO A;  5HS7 A;  2PMU A;  3FM5 A;  3G4S I;  1VF9 A;  4RAY A;  5DD8 A;  3WTX C;  2DO7 A;  2DYR H;  2DFI A;  5JLX A;  5IPA A;  3HJE A;  2MBF A;  3NAU A;  3F22 A;  3E6C C;  4MQV A;  1FYL A;  1IV8 A;  4B3A A;  2OTJ I;  2WAQ A;  1IN8 A;  3F6V A;  3ABL H;  2L7K A;  3WE2 A;  3ZMV A;  4E7S A;  2JA7 J;  4CIC A;  2CQ7 A;  4F3Q A;  2W4S A;  1ZRE A;  4HZF A;  1J9I A;  3K6G A;  1IN6 A;  1JHH A;  3OL4 A;  4AD9 A;  3LWF A;  5K1Y A;  3CCM I;  1FP2 A;  1ODD A;  1ZKG A;  2QCO A;  5F6F A;  3HOV J;  2ZNY A;  5K5Q A;  5L3D A;  2CUJ A;  4N4O B;  2QM3 A;  3TDU C;  3HGG A;  1H9G A;  2HYF A;  3ML6 A;  2LMD A;  1W7P A;  1ULY A;  2E36 A;  1E3H A;  3H3Z A;  2OA4 A;  3J81 K;  2EIN H;  1MMS A;  2JA5 J;  2L0K A;  3IKV A;  2Z33 A;  2L7F P;  2EZH A;  2LY1 A;  3I71 A;  3LQR A;  5KAF C;  3SEZ A;  2J5O A;  3RPU D;  1YTY A;  1SD5 A;  3IRQ A;  2Q2E B;  1YLF A;  5L3C A;  2OV7 A;  2X51 A;  3QRF F;  1VQM I;  1HST A;  2NYX A;  2EWN A;  4HRI A;  4Q4Z F;  1VTN C;  2ZME C;  3FWE A;  3KX2 A;  5D8K B;  1S9H A;  1IRX A;  2DQL A;  5EG0 A;  2HXO A;  2QF7 A;  2BHY A;  4G6D A;  2K4J A;  4CXF A;  1KU9 A;  1BJA A;  3S2D J;  1K7A A;  2XPU A;  2JMW A;  3WTW C;  2GXA A;  3V42 A;  4XKW A;  3KET A;  1FTT A;  2ZJQ F;  5LD2 C;  1QRY A;  3C3W A;  2K7L A;  3U9G A;  1LQ1 A;  4XBF A;  2HOT A;  2W25 A;  2GOX B;  5FB2 A;  3HB9 A;  1FJL A;  4XLP F;  4HW0 A;  5E17 F;  3K4K A;  4BL0 B;  4ANJ A;  2OC6 A;  1TP4 A;  2PBI A;  1WJB A;  2W7N A;  4U0V A;  2X4H A;  3S1M J;  3VYS B;  1XSV A;  3D1N I;  4V2F A;  3A2K A;  5IYD J;  2AS5 F;  3CO6 C;  1HW1 A;  1MBF A;  1IC8 A;  3L2R A;  2PFB A;  3D5S C;  5D4R A;  2RC4 A;  2RNJ A;  1D1B A;  3WU2 C;  4D1Q A;  2AQE A;  2OZ6 A;  3IWF A;  4ZYH A;  1K78 A;  2QKL B;  4BJ5 C;  4IXA A;  1YJN I;  1N78 A;  4N9I A;  1OMI A;  2VBZ A;  3HRM A;  2XAH A;  4FTH A;  1X1D A;  1X1P A;  4CCO A;  2LKX A;  3DV8 A;  3LL7 A;  4AYB A;  4A3I J;  1VQ7 I;  3BG7 A;  1V5E A;  4E4H A;  1XTA A;  1OR7 C;  2VBW A;  1R58 A;  2FOK A;  3QPT A;  2FQ4 A;  2BY1 A;  3TW6 A;  3ZRG A;  3JRI A;  1HA8 A;  2KZG A;  3TP0 A;  2EFP A;  3OYC A;  2AXL A;  2NOG A;  2CV2 A;  5B5E C;  4B43 A;  3KPH A;  3QOE A;  4WXC A;  3QP5 A;  4F93 B;  3K70 C;  3EYI A;  2YX4 A;  2XDV A;  2E1C A;  4CCK A;  4G8X A;  1H88 C;  4I02 A;  4MNU A;  2ISY A;  3S1R J;  1PDN C;  2H8R A;  2IEK A;  4G7O F;  3GFJ A;  4B1R A;  4A3E J;  4DBQ A;  2J5P A;  1R5H A;  2A3S A;  4XMY A;  4KFC A;  5BNG A;  3BRO A;  3KZY A;  2K5C A;  4WX9 A;  3KLO A;  3B6C A;  4B8X A;  2XB5 A;  2FNA A;  4F52 A;  2HDW A;  2VQL A;  2V4J C;  1MBH A;  3FXU A;  3DF8 A;  1WGX A;  2XRN A;  1UG2 A;  4YFK F;  4DJA A;  1Z05 A;  3OMY A;  2GQQ A;  3ABK H;  1EJ9 A;  2IGO A;  4A0Z A;  5EZG A;  1RIO H;  3C7J A;  1MMA A;  2JSC A;  5BPI A;  1UG0 A;  5GP9 A;  2CU7 A;  3BG9 A;  3BQZ A;  2CUE A;  3J7Y J;  3OS0 A;  3DU6 A;  2DPU A;  4BQN A;  4BEH A;  3HOS A;  3GUD A;  1E17 A;  2R7F A;  3S32 A;  4OU0 A;  2CRG A;  1G2H A;  3PSI A;  2LR8 A;  3HRU A;  1X3Z B;  3T5X A;  3GTO J;  3FK6 A;  4MQ9 F;  3OIP A;  4II2 A;  3PO3 J;  3JRB A;  3FBI B;  3QYF A;  3K4J A;  5CVR A;  3K4N A;  3OYD A;  5M5W J;  3F8F A;  3SEQ A;  1BOB A;  2FE3 A;  3JRF A;  1EKE A;  2RKH A;  3LAJ A;  4CUG A;  4PGH A;  1OKR A;  1X1C A;  4Y52 J;  4LLG F;  2EIJ H;  2NOJ B;  2QEX I;  3FX3 A;  1NK2 P;  4UHT A;  4JX4 A;  1MDM A;  5HOD A;  1MND A;  1VFC A;  1C0W A;  2FSW A;  2KQR A;  4CDG A;  1IUF A;  3K9T A;  3OYK A;  2F5F A;  1R6R A;  2QSH X;  2OTL I;  4FX4 A;  1KON A;  5DYM A;  1AWC A;  4KUM A;  2E34 A;  2IRF G;  4G6Q A;  1R22 A;  1QPM A;  3M1E A;  1HC8 A;  2VUM J;  1A31 A;  2VKE A;  2A5Y B;  4BHB A;  2HVR A;  2KJC A;  3RZO J;  2ZBK A;  3F9K A;  5C3E J;  3ASN H;  3VSK A;  3OSF A;  5CVI A;  5B1B H;  4RB0 A;  4XL9 A;  1ON1 A;  3VOE A;  2HYJ A;  4U7B A;  2XF7 A;  3JRA A;  4RM3 A;  1LFB A;  1BA5 A;  2RV8 A;  1JKP C;  2FOW A;  4Z2Y A;  3K2Z A;  2ZKZ A;  4UUV A;  2VLA A;  2VXD A;  1ZK8 A;  4Y4R A;  3E6M A;  2G7U A;  2KPM A;  2RAE A;  1IF1 A;  3JRD A;  3F8B A;  1HLV A;  1GXP A;  4LK1 F;  1MKM A;  3I9V 2;  3OR2 C;  4Y15 A;  3BG3 A;  3WHC A;  2JUG A;  1KU7 A;  1H0M A;  3X2Q H;  2HVQ A;  1T6S A;  3HOX J;  4L5E A;  1OPC A;  5J4V A;  4IHW A;  3MZ8 A;  5LRS A;  3FMS A;  4U87 A;  1OCR H;  2CYY A;  1MGT A;  1JJ8 C;  4DW6 A;  1IZ1 A;  1F4K A;  3LSI A;  1STZ A;  2DA1 A;  3LAP A;  4BDZ A;  2Q1Z B;  5K7Z A;  2RDP A;  4YIR X;  3GX4 X;  2VPR A;  3DEU A;  1QZE A;  1MH4 A;  5FFZ A;  3S2W A;  4M71 A;  5HOO A;  1Z6T A;  2P5L C;  1V3F A;  2P81 A;  5DTD A;  1R49 A;  3HTS B;  4MEX F;  1WH5 A;  1MIJ A;  2VAS A;  1Z0X A;  2E5N A;  1IXR C;  2CW8 A;  3CC2 I;  2BBY A;  4YIF A;  1MMD A;  2EK5 A;  4UVB A;  3A1Y A;  2ELK A;  1XGS A;  3MZY A;  2EPF A;  2STT A;  2K85 A;  3PUB A;  3EQL F;  1XCV A;  1YRN B;  4BNC A;  3H9G A;  4U0W A;  4WK8 F;  2CV0 A;  3TED A;  4XLN F;  3MQ0 A;  5D5U B;  2W82 A;  2P7V B;  1X3W B;  3BT9 A;  4BXU A;  3M7G A;  1LDK B;  4HYE A;  4TV7 A;  2MA3 A;  2PQ8 A;  1LPQ A;  1IN5 A;  2RGV A;  2F5V A;  3ROU A;  3H3U A;  5M5Y J;  4RGR A;  3LSH A;  2M9H A;  1Z7U A;  2ISZ A;  2O8X A;  5EZH A;  5EJC A;  3RKY A;  2R7D A;  1LDD A;  2A6E F;  4GCV A;  1YW8 A;  4YFN F;  2ECC A;  2CQQ A;  4KT6 A;  3CTA A;  3AL0 C;  1WJE A;  3G1M A;  4OIQ F;  1ETO A;  3HIF A;  2GZW A;  5F64 A;  2R7Z J;  2YSR A;  2IPQ X;  3MD2 A;  2W24 A;  2V9K A;  2YS9 A;  2QA4 I;  4FCY A;  4I6Z A;  3CCE I;  1HKT A;  1UFM A;  4BXF A;  2OAZ A;  1U78 A;  4CZC A;  3NQO A;  4X0G A;  2EB7 A;  4KYW A;  2WV0 A;  3ZOB A;  5LGT A;  3F72 A;  3BJO A;  2B63 J;  2DT5 A;  2JUC A;  1OIS A;  2LTP A;  3HUG B;  2W1O A;  2WY8 Q;  1O7L A;  4LG0 B;  4CO8 A;  1RR8 C;  1K61 A;  2H27 A;  3DEE A;  1KA8 A;  2UUZ A;  2YPR A;  4XM3 A;  5ICE A;  2XAG A;  1ZGA A;  3LOC A;  3RDI A;  1W5S A;  5F08 A;  2IVM A;  2L2O A;  3M4O J;  4ZYA A;  4CCM A;  3FM3 A;  3K1N A;  1ZHF A;  2E35 A;  2EFQ A;  3E6B A;  2DJI A;  2AXT C;  4NQW A;  3UKG A;  4UV8 A;  1V54 H;  2XKP A;  3H35 A;  4Y33 A;  4YII A;  2JVG A;  3S14 J;  2CJJ A;  2PEX A;  4C3H J;  1P6R A;  1T39 A;  1XSX A;  3ZQI A;  3V7S A;  3HPH A;  1O57 A;  1IO2 A;  2PX9 A;  2NVX J;  1E2X A;  4IRG A;  2GAU A;  3TO7 A;  2MSY A;  4RB2 C;  3BDD A;  1O3R A;  3CJQ B;  2Y0M A;  5H6R A;  2F4I A;  2VL8 A;  3C18 A;  5LGU A;  4M3D A;  4A6D A;  4Z6Y A;  4DYC A;  2HPI A;  1YI2 I;  5JFR A;  3A4C A;  4PFO A;  3PUF A;  4BE0 A;  1R4N B;  1CF7 B;  4KN7 X;  4AM3 A;  4S05 A;  3PSF A;  1FOX A;  1S7E A;  2L9V A;  2DMQ A;  3FKJ A;  1ZG3 A;  4B4C A;  1FY7 A;  1Y1W J;  3N97 A;  1I5Z A;  4BBR J;  2GM4 A;  1JUP A;  2F6C A;  1MSE C;  4ENM A;  1JI8 A;  4V2G A;  4XR6 A;  3LA7 A;  2UWM A;  2DAO A;  1TW2 A;  1J59 A;  4I76 A;  4UVC A;  2JPB A;  4EGZ A;  4M72 A;  4IL6 C;  1ZG5 A;  3H5N A;  4P9U A;  2DA2 A;  3WE3 A;  4IX7 A;  3GTJ J;  3EPZ A;  2ZME A;  3KYC B;  3AAF A;  2LVS A;  4BAC A;  2EA2 A;  1XDU A;  2O6G E;  4A69 C;  2VQG A;  2LRD A;  3KP2 A;  1XC5 A;  3M8J A;  1RC9 A;  4LG3 A;  3GEZ A;  1K79 A;  2W85 A;  1HW2 A;  4CH7 A;  4LK0 F;  1DU6 A;  2V9V A;  3FBN B;  1TQP A;  3AG3 H;  2HS5 A;  1P9Q C;  1MW7 A;  2R7S A;  2M34 A;  2XGX A;  1BOA A;  1W4M A;  1QO0 D;  4HX8 A;  1AHD P;  1VQ8 I;  2XF6 A;  2FMY A;  3ISP A;  1MJA A;  3HOY J;  2K3F A;  1NH3 A;  1Z1D A;  1LUJ B;  3K4M A;  3IH3 A;  1MSF C;  1GVJ A;  2Q2E A;  2GWR A;  4XIC A;  2LF8 A;  3IHU A;  2ZSH B;  2ESH A;  2CS3 A;  5BPD A;  1IRG A;  5M3F J;  3G1O A;  1IGN A;  2LY9 A;  3CUQ C;  3MFK A;  1SD4 A;  2LFB A;  3G71 I;  4CCL A;  3H9Q A;  2R92 J;  1E0E A;  1HCR A;  4IHT A;  1W5C C;  4R79 A;  4DZP A;  1FSH A;  2F5D A;  1TLH B;  3CCY A;  3ULQ B;  2XF5 A;  3I53 A;  1SFU A;  1TT5 B;  5F1J A;  4AIK A;  1WSU A;  3HDD A;  4XLH A;  2R3S A;  4XOT A;  3CCU I;  4D9J A;  1SAN A;  2ZCW A;  3DTK A;  2G9W A;  2KDO A;  4DIQ A;  2WBM A;  1YW9 A;  1RPW A;  3CUQ A;  3DTE A;  2P5V A;  3I55 I;  5CQG A;  4ZDL A;  4M3B A;  4CYC B;  1X19 A;  3AG1 H;  4JOM A;  1GDT A;  3DKW A;  3RSN A;  4C9Y A;  4UUS A;  2E2H J;  3H92 A;  3ZN0 A;  1YW7 A;  2H94 A;  2LH9 A;  2IAI A;  1UMQ A;  3BTJ A;  3VEP A;  4HNT A;  2B7E A;  4HF1 A;  3ECO A;  4AIH A;  5B3S H;  3HKZ A;  5HLT A;  3JR9 A;  1QHG A;  1LE8 A;  3WTU C;  2DCE A;  4ZDP A;  4NHJ A;  2Z2S B;  3OOU A;  4J19 A;  1GV2 A;  1JTY A;  5ILU A;  5CQE A;  2ID6 A;  2M1B A;  2DFH A;  1ZN2 A;  4E70 A;  3MAJ A;  1FBS A;  2NVY J;  4Y13 A; 
#chains in the Genus database with same CATH homology
 2DA5 A;  2O7O A;  2E1O A;  1FTT A;  2Y9Y A;  1TWA J;  1QRY A;  1ZQ3 P;  1POG A;  1UHS A;  3LSG A;  5J3L A;  3Q3S A;  2X6O A;  1IG7 A;  2HOT A;  2Y30 A;  4AYB N;  3HB9 A;  4XRM A;  5FLM J;  1FJL A;  2VKV A;  4MFD A;  3BR0 A;  5E3M A;  1JJ6 C;  2I10 A;  2XPW A;  4FIS A;  3LNQ A;  5E3O A;  1P7I A;  2FJ1 A;  3S1M J;  3HKZ N;  3NAR A;  3D1N I;  4V2F A;  5IYD J;  1R9T J;  1TWG J;  1AU7 A;  1X2M A;  1Y1V J;  1MBF A;  1IC8 A;  1WH7 A;  3RQI A;  1D5Y A;  3A01 A;  2HXI A;  5IP6 A;  2K9Q A;  4JX5 A;  3BTL A;  2L7Z A;  4FTH A;  5K7H A;  2LKX A;  4A3I J;  5GPA A;  4S0H B;  1Z77 A;  2COB A;  5M5X J;  2FQ4 A;  2HQ5 A;  1FIP A;  3TW6 A;  4M3E A;  3HBL A;  3JRI A;  3RKQ A;  3ZQF A;  3HM5 A;  4JYK A;  3WHB A;  3TP0 A;  2NOG A;  3PO2 J;  4A93 J;  3BR6 A;  1ZR4 A;  1JKR C;  3OIO A;  3GTM J;  1W0U A;  2Y0S N;  3SJM A;  1ETW A;  5IOZ A;  1EF4 A;  2G0E A;  1H88 C;  1WPK A;  3S1R J;  1MBK A;  2H8R A;  2IEK A;  2Y2Z A;  4B1R A;  3IH4 A;  4A3E J;  4UUT A;  1TC3 C;  5BNG A;  1HOM A;  3C2B A;  2NVQ J;  5FKK A;  5GPC A;  1ETQ A;  3B6C A;  2XB5 A;  3CMY A;  2R93 J;  2JJ7 A;  4Y7N J;  2LLK A;  1FIA A;  1MBH A;  4D5C A;  1WGX A;  3BR5 A;  3JRG A;  1UG2 A;  5F0F A;  2MG4 A;  3HEF A;  2NS7 A;  5F0H A;  4IHX A;  3I4N J;  2HOA A;  1T56 A;  5EZG A;  5E3N A;  1VI0 A;  1ETV A;  5GP9 A;  2CU7 A;  1JKQ C;  5F04 A;  1NTC A;  1B72 B;  2HDD A;  4LOC A;  3BG9 A;  3BQZ A;  3S2H J;  2CUE A;  2DMN A;  2XGE A;  1YRN A;  4MFE A;  4MLO A;  2CRG A;  1G2H A;  2LR8 A;  3BR1 A;  2LD5 A;  2JA8 J;  3GTO J;  2AHQ A;  2DA4 A;  3FK6 A;  3PO3 J;  3JRB A;  5IP7 J;  4MO7 A;  5FJ8 J;  4AC0 A;  4A3L J;  5M5W J;  4D7N A;  3DCF A;  1JUM A;  3BTI A;  3SDG A;  1ETY A;  3JRF A;  2Y9Z A;  4A3D J;  4Y52 J;  1FTZ A;  4D7M A;  3FIW A;  1QVU A;  1GVD A;  2K9S A;  1GT0 C;  1NK2 P;  4JX4 A;  5HOD A;  1VFC A;  1OFC X;  2XSD C;  1IUF A;  4C2M J;  4M3G A;  3VPR A;  3A01 B;  1HDD C;  3BR3 A;  1PUF B;  3ZQH A;  1B72 A;  1ITY A;  2VUM J;  2VKE A;  1XG1 A;  1IDZ A;  3BQY A;  5FKO A;  2ZB9 A;  3RZO J;  1RKW A;  5C3E J;  4DZJ A;  3OSF A;  2L9R A;  2R5Z B;  2PMZ N;  1F36 A;  1B8I B;  3HOZ J;  1PUF A;  5F27 A;  2HYJ A;  3JRA A;  4G12 A;  3ZQC A;  1LFB A;  1BA5 A;  1JKP C;  1BW6 A;  2OPT A;  5EEA A;  1TWF J;  5EGO B;  2NS8 A;  1ZK8 A;  5E3L A;  2DA6 A;  2VI6 A;  2RAE A;  2R5Z A;  2KT0 A;  3JRD A;  1HLV A;  2DTZ A;  3LSP A;  1JT6 A;  3S17 J;  4IHY A;  3TP3 A;  1SFO J;  1FEX A;  1MH3 A;  2Y31 A;  2IBD A;  3BG3 A;  3WHC A;  1QPI A;  4AUX A;  3GTP J;  2CUF A;  3QPS A;  2DJN A;  2DA7 A;  3HOX J;  1JGG A;  2XRL A;  4L5E A;  5FKN A;  2M8G X;  4IHW A;  4JX6 A;  3K2A A;  4RDU A;  4A3C J;  1JJ8 C;  4DW6 A;  2DA1 A;  1BW5 A;  1IJW C;  3CQZ J;  1A6I A;  1K83 J;  4W97 A;  4M6V A;  5K7Z A;  2DMT A;  4QTR A;  2D5V A;  2E19 A;  2VPR A;  1MH4 A;  4JP0 A;  1CQT A;  3OSG A;  3W6V A;  2P81 A;  5DTD A;  1WH5 A;  5EDN A;  1Z0X A;  5J1Y A;  1I50 J;  1W0T A;  1AKH A;  2GBY A;  3DEW A;  2ELK A;  2HOS A;  1YRN B;  3K7A J;  3TED A;  3BTC A;  4QSH A;  1RR7 A;  3IV5 A;  2EZI A;  2JN6 A;  3BT9 A;  1LFU P;  3GTG J;  3RZD J;  3O8G A;  5M5Y J;  2M9H A;  1I6H J;  2XB0 X;  1X2N A;  4XRS A;  5EZH A;  4X1E A;  4BY1 J;  1OCP A;  2L7M P;  2M2E A;  1MNM C;  1E3O C;  2ECC A;  2CQQ A;  1WI3 A;  1JTX A;  2H1K A;  4MIM A;  3G1M A;  3JRE A;  4A3B J;  2NVT J;  1ETO A;  1U9O A;  2JMW A;  2R7Z J;  1RET A;  1IRZ A;  2CQX A;  2YS9 A;  4FCY A;  4I6Z A;  1HDP A;  2LK2 A;  3ZQL A;  1H89 C;  1F43 A;  5J1U A;  2ME6 A;  1U78 A;  5C4X J;  1ZTR A;  2AO9 A;  3ZOB A;  4BXX J;  5IP9 J;  3S1N J;  2B63 J;  9ANT A;  1ETX A;  3Q0W A;  3A03 A;  3GTL J;  5IYC J;  2LTP A;  3GTK J;  5EF6 A;  1MBJ A;  1MBG A;  3BR2 A;  1AKH B;  5DS9 A;  2YUS A;  1U8B A;  4FE4 A;  1K61 A;  3CDL A;  5F0C A;  2TRT A;  5C44 J;  3E7L A;  2XGD A;  3LOC A;  1B8I A;  5F08 A;  4RBO A;  3M4O J;  4GFB A;  2DN0 A;  4BBS J;  2WV1 A;  1MBE A;  1I3Q J;  4DYQ A;  4HNV A;  3M3Y J;  3QPL A;  3MVP A;  4D5F A;  5K7F A;  3UKG A;  3FKI J;  3LSJ A;  3Q0V A;  3S14 J;  2CJJ A;  2R5Y A;  1ZGW A;  2MW8 A;  5EGO A;  4C3H J;  2X9D A;  3GTQ J;  2LP0 A;  3S16 J;  2HI3 A;  3ZQI A;  5IYB J;  4CYC A;  3SFI A;  1QVT A;  2NVX J;  1WCM J;  2MSY A;  1VND A;  1GV5 A;  1HF0 A;  2WAQ N;  3H3V K;  4DYR A;  2JA6 J;  2E2I J;  5FLV A;  3FIS A;  2R5Y B;  4M3D A;  4DYC A;  1P7J A;  4QIW N;  3ZQG A;  3JRC A;  3HOU J;  1BJZ A;  4A3M J;  1ETK A;  2DMP A;  5JLW A;  3MKL A;  1S7E A;  1ORK A;  2DMQ A;  4B4C A;  1Y1W J;  3S1Q J;  2WB1 N;  3BG5 A;  4A3G J;  2GM4 A;  4BBR J;  1ENH A;  1JUP A;  2EQR A;  1MSE C;  2N8G A;  1IV6 A;  5C4J J;  1RKT A;  3H0G J;  4V2G A;  4NDL A;  2OF7 A;  2X48 A;  1JT0 A;  1JUS A;  2O8K A;  2ID3 A;  2EBI A;  3TW7 A;  2MGQ A;  4I76 A;  2M0C A;  3L1P A;  4ABZ A;  1TWC J;  3QQA A;  2XGC A;  2DA2 A;  5FKM A;  4X6A J;  1ZR2 A;  3GBG A;  3GTJ J;  1X58 A;  2R0Q C;  2DMU A;  2LVS A;  3F0C A;  4BY7 J;  1BL0 A;  3JRH A;  1O4X A;  4A69 C;  1XC5 A;  2TCT A;  1IDY A;  1Q1V A;  2EH3 A;  1APL C;  1DU6 A;  4XRS G;  1TWH J;  1U9N A;  3O8H A;  1XS9 A;  4BKX A;  4C3I J;  4XK4 A;  1DU0 A;  4A3K J;  2FX0 A;  3MN2 A;  2M34 A;  1RES A;  2GLO A;  1AHD P;  3Q0U A;  4M3F A;  3HOY J;  2K9N A;  2FD5 A;  4IEJ A;  1OCT C;  1A5J A;  1T33 A;  3IH3 A;  3A02 A;  4C3J J;  1MSF C;  2ECB A;  4XIC A;  5J1R A;  5FKL A;  1VF9 A;  3HGY A;  3G1O A;  1OJL A;  2EZL A;  5M3F J;  2LY9 A;  1IGN A;  5JLX A;  5IPA A;  3NAU A;  2LFB A;  5M3M J;  2R92 J;  5IOY A;  1HCR A;  4B3A A;  4DZP A;  1GUU A;  3PM1 A;  3CCY A;  3G1L A;  2EZK A;  3I4M J;  2JA7 J;  2JK3 A;  2O9L A;  5EYR A;  1H8A C;  2E2J J;  5F1J A;  3HDD A;  2W48 A;  1ZKG A;  3IH2 A;  3HOV J;  2QCO A;  3HOW J;  1SAN A;  2YU9 J;  3LSR A;  4A3J J;  3S15 J;  2ME0 A;  3HGG A;  1RPW A;  1LE8 B;  5EG0 B;  4FE7 A;  2JA5 J;  2L0K A;  2DA3 A;  1NK3 P;  4M3B A;  2L7F P;  4CYC B;  1GDT A;  2EZH A;  4UUS A;  2E2H J;  3BTJ A;  2IAI A;  1UMQ A;  2K40 A;  4EEF G;  4A3F J;  3JR9 A;  4IHV A;  3B6A A;  1LE8 A;  2JWT A;  4XID A;  1JKO C;  3OOU A;  4J19 A;  2KDZ A;  1GV2 A;  1JTY A;  5EG0 A;  2ID6 A;  3FK7 A;  2HXO A;  2QF7 A;  2XPV A;  4UUS B;  3S2D J;  4W1U A;  2XPU A;  2NVY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...