2JMWA

Structure of dna-binding domain of arabidopsis gt-1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA binding protein GT-1
publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jmwA01
3ZQGA 3BG5A 3HOZJ 1VF9A 2JN6A 4I6ZA 3S1NJ 5FKNA 4LOCA 1RETA 3LSPA 2DMUA 4DZPA 1HF0A 2DN0A 2ELKA 2ME0A 4J19A 4B4CA 1I6HJ 1K83J 3BG9A 3TP0A 1ZQ3P 2P81A 3GBGA 4XICA 3ZOBA 2EZHA 4MFDA 2L7FP 2NS7A 1JT0A 2R5YB 1JKPC 2HOSA 3UKGA 1QVTA 3HB9A 1B72A 2YS9A 1CQTA 1Y1VJ 4C3JJ 2NVTJ 4W1UA 2B63J 2R5ZA 1MH3A 1U9OA 3M3YJ 2DJNA 2E1OA 3CMYA 1ETYA 5FKKA 5IYBJ 1H8AC 2R0QC 2L0KA 3BG3A 2AO9A 1LE8B 4DW6A 4A3JJ 2E2JJ 1JUMA 5EGOB 3H0GJ 3S1QJ 1P7IA 1WCMJ 2X6OA 1HCRA 3S16J 3JRHA 4AC0A 5GPCA 4XRSG 3WHCA 1GVDA 1POGA 5IYDJ 4BBRJ 5FKOA 3B6CA 5C4JJ 2GM4A 5EZGA 5J1UA 1MBJA 3BR0A 1UMQA 1ZTRA 2ME6A 1VNDA 1BA5A 2XB5A 3DEWA 3HGGA 1IUFA 4CYCB 1RKTA 2AHQA 3BQZA 5EF6A 3GTJJ 2JA8J 1NK3P 3BR1A 2NS8A 3G1OA 4JYKA 1H88C 4UUSB 4UUTA 1HDPA 3S17J 4DYQA 2OF7A 3BR5A 2R5YA 1MBFA 3JRBA 1OJLA 4FCYA 4X1EA 2QF7A 1U78A 2L7ZA 1ITYA 2EZLA 1TWCJ 2CUEA 2CRGA 1FTTA 3HM5A 1IGNA 1B8IB 3IH2A 1FIAA 1IG7A 3BR3A 4IEJA 1FJLA 4A3IJ 3HBLA 2XSDC 3HGYA 2O7OA 4AYBN 5HODA 3BTLA 1K61A 5EZHA 2TCTA 2WAQN 5F08A 1HOMA 4D5FA 1ZGWA 4BXXJ 2DA7A 4A3KJ 3LNQA 3GTKJ 1S7EA 3FK7A 4B1RA 3ZQCA 1ETKA 4CYCA 1JKQC 2N8GA 4MO7A 1ETWA 1UHSA 3K7AJ 1A6IA 4V2GA 3BTCA 3G1LA 5FLVA 5K7ZA 1WH5A 2LP0A 2K9QA 3OSFA 2X9DA 3HKZN 3Q0WA 3S1MJ 1Y1WJ 1FEXA 2XGDA 4FISA 5FJ8J 2XPVA 1SFOJ 4DYRA 2HI3A 2O8KA 3S1RJ 5J3LA 2DA2A 3Q3SA 5E3LA 2CU7A 4A3BJ 3LSRA 1GV5A 4DZJA 3H3VK 1SANA 4A69C 3S15J 2M9HA 2FX0A 1F36A 1JUPA 4M3GA 1B8IA 5EEAA 2HYJA 4MIMA 1BW6A 4V2FA 3SFIA 1FTZA 3TEDA 4JX5A 5M3MJ 1APLC 4QIWN 3S2HJ 3C2BA 4G12A 4B3AA 1VFCA 2JA5J 5GP9A 3A02A 4A93J 4S0HB 2XB0X 1W0UA 3BQYA 5IP7J 3LSGA 1AKHB 2EBIA 3VPRA 1IJWC 5DS9A 4M3DA 1QPIA 2CQXA 2Y31A 3FISA 4A3CJ 1X58A 3ZQIA 3ZQLA 1PUFB 2HOTA 2FD5A 3OSGA 3HOVJ 3HOYJ 2DMQA 5M5XJ 1TC3C 5BNGA 1WI3A 2Y0SN 3BTJA 1MNMC 5K7HA 2DA4A 5EG0B 3S14J 2EZKA 5JLWA 5E3NA 1MSFC 1BL0A 5IOYA 3MN2A 5C44J 1YRNB 1TWHJ 1IDZA 1MH4A 1ETXA 2NVXJ 1GT0C 4W97A 2ID3A 1IRZA 1U9NA 1IDYA 3PO3J 3JRIA 3WHBA 2LK2A 2HQ5A 3JRAA 3FIWA 4QTRA 3O8HA 3SDGA 3RZOJ 1MBHA 4IHWA 2VPRA 3K2AA 5IOZA 3GTLJ 1UG2A 2LLKA 3QPLA 4XRSA 4M3BA 2ZB9A 1TWGJ 3HEFA 3HOWJ 1XC5A 5FLMJ 2E2HJ 5C4XJ 3GTQJ 4C3IJ 3HDDA 2MGQA 2QCOA 2YU9J 3DCFA 2W48A 2NVQJ 3PM1A 1G2HA 1NK2P 4JX6A 2LY9A 1AKHA 3MKLA 2NOGA 3JRGA 3HOUJ 1Z77A 2K9NA 1H89C 3I4MJ 3ZQFA 3HOXJ 3O8GA 3GTPJ 1RR7A 1PUFA 2LD5A 1BW5A 2DA3A 2GBYA 1R9TJ 2DMNA 2G0EA 5F0CA 4DYCA 4M6VA 1LE8A 3S2DJ 3IH3A 1WGXA 2CJJA 5EGOA 1QVUA 1IV6A 2K40A 4BBSJ 4C2MJ 4ABZA 1HDDC 5M5WJ 1JTYA 3A03A 2JA6J 1JTXA 3GTOJ 4BY1J 3RQIA 2XGEA 3JR9A 4Y52J 2Y2ZA 4A3MJ 5J1RA 3M4OJ 3I4NJ 2ECBA 2Y30A 2LR8A 2Y9ZA 1BJZA 2WB1N 1AU7A 2D5VA 3OOUA 2IBDA 2PMZN 3CCYA 2GLOA 4UUSA 2TRTA 5EYRA 4GFBA 2M2EA 1I50J 1B72B 1AHDP 1XG1A 3MVPA 3B6AA 2JJ7A 5IP9J 1OCPA 4A3LJ 9ANTA 1TWAJ 5IP6A 4HNVA 4RBOA 1JJ8C 1W0TA 2L9RA 2DA5A 3ZQHA 3QPSA 2X48A 4EEFG 2EQRA 5DTDA 4MFEA 1MBEA 1ORKA 2DMPA 2LVSA 2VKEA 2HOAA 1X2NA 2I10A 2WV1A 3BR2A 1MSEC 1HLVA 1JKOC 2M34A 2MSYA 2CUFA 2H1KA 4FE7A 3JREA 3CQZJ 2XGCA 2VUMJ 4I76A 1RKWA 5F0FA 5FKLA 2ID6A 2EZIA 4BKXA 1OCTC 4Y7NJ 2MG4A 5IYCJ 1ETOA 1WPKA 1DU6A 3RKQA 2DA6A 5E3MA 1ZK8A 1X2MA 2LKXA 5GPAA 2DTZA 4JP0A 4MLOA 1MBGA 1IC8A 4NDLA 3CDLA 5M5YJ 3LOCA 1T33A 5M3FJ 4D5CA 1RESA 5J1YA 4FTHA 1JT6A 5FKMA 3SJMA 2VI6A 4A3FJ 1T56A 3FKIJ 4D7MA 1ENHA 3Q0UA 4XRMA 1DU0A 1GV2A 4BY7J 5F1JA 3RZDJ 3L1PA 1XS9A 1WH7A 3GTGJ 2HXIA 1NTCA 1JJ6C 1EF4A 3JRDA 1QRYA 2XRLA 2M0CA 4IHYA 3Q0VA 1TWFJ 2JK3A 3A01B 2R7ZJ 4M3EA 5JLXA 3OIOA 4AUXA 2XPWA 3BTIA 3JRCA 2FQ4A 5F0HA 3TP3A 4QSHA 1ETQA 2NVYJ 4JX4A 2XPUA 3JRFA 1JGGA 1ETVA 2OPTA 5IPAA 1OFCX 1GDTA 3W6VA 2JMWA 3TW7A 4C3HJ 1O4XA 1JKRC 1D5YA 1VI0A 3E7LA 2FJ1A 1F43A 4M3FA 1ZR4A 1LFBA 2O9LA 1I3QJ 5F27A 2M8GX 5EG0A 1MBKA 2K9SA 3BR6A 3D1NI 2YUSA 5F04A 1P7JA 2VKVA 1ZKGA 2R93J 2E2IJ 1YRNA 2Y9YA 5EDNA 3QQAA 4A3GJ 4FE4A 1ZR2A 3BT9A 4X6AJ 1Z0XA 2H8RA 2KDZA 1GUUA 2E19A 2IAIA 4D7NA 2RAEA 2LTPA 4A3EJ 3PO2J 4L5EA 2JA7J 3NAUA 3IV5A 2LFBA 3G1MA 3GTMJ 2COBA 2CQQA 2ECCA 2DMTA 3TW6A 2IEKA 1E3OC 2DA1A 2L7MP 5K7FA 3IH4A 3A01A 1Q1VA 2MW8A 1A5JA 1RPWA 2R5ZB 2KT0A 3NARA 4A3DJ 1LFUP 4IHVA 1FIPA 2HDDA 4RDUA 2EH3A 2HXOA 3FK6A 5E3OA 3LSJA 4XK4A 3F0CA 1JUSA 2JWTA 5C3EJ 2R92J 4IHXA 1U8BA 4XIDA
chains in the Genus database with same CATH superfamily
2E5ZA 3BG5A 1KQ0A 5GAGJ 1IV8A 4HLXA 4IPAA 3GFIA 4I6ZA 1XMKA 5FKNA 2W7NA 2A6HF 1RETA 2WAEA 4BU2A 4O3MA 4CO8A 2HDWA 2F4MB 2HEOA 3BZ6A 2VBXA 1I6HJ 3GFLA 4OU0A 3EUAA 4LMYA 1UHMA 2EWNA 3L00A 1DDNA 3BG9A 3E3VA 1SAXA 2P81A 1GXQA 2CV0A 1XGMA 2EZHA 4OIQF 2L7FP 2NS7A 3EPZA 1JT0A 1JKPC 3BCBA 1X1PA 4ESFA 1HBXG 2DOEA 3M8EA 5ICEA 2KISA 2W4SA 4IO9F 2R7OA 1QU3A 1CQTA 4C3JJ 4W1UA 3HTSB 5H20A 3KYDB 2R5ZA 1MH3A 2L01A 1U9OA 3M3YJ 1AOYA 2E1OA 5HOOA 2R7RA 3ERMA 3MWMA 2IXSA 2XRNA 5D4RA 2L0KA 3BG3A 2V79A 4C9YA 1ZG1A 2E2JJ 1FMVA 2EV6A 1E0EA 3DQVC 2FQ3A 2DO7A 2XAQA 4EJOA 2PJPA 3J81K 5LLQA 4OMYA 4HEA2 1TTYA 3KIOA 1XD7A 3B6CA 3GUDA 3H3ZA 3K0LA 5FKOA 4BBRJ 5J8FA 1XCVA 5J1UA 1MBJA 4P5OA 3SZTA 4C2UA 2HDCA 1UMQA 3NRVA 4AD9A 2ME6A 1VNDA 2Z2SB 2A69F 2Q0OA 3DEWA 2DQRA 5HLHA 1YO5C 2JA8J 4GCVA 1NK3P 5LD2C 2GIVA 2HPMA 1EF4A 1D0ZA 3B02A 2LC2A 5JVGF 1SD7A 3PUFA 2XKOA 3G3ZA 1X4PA 2EV5A 3P7NA 4LFUA 1FYKA 2R7XA 1HDPA 3QPTA 4XKCA 1IXSB 2OF7A 3R60A 4U88A 1D0XA 4NNJA 1MBFA 4M9XA 1E3PA 2GWRA 3KP3A 4FCYA 4I09A 1ITYA 2EZLA 3VYSB 2CRGA 1FTTA 1BM9A 1P4WA 4IQ4A 3WU2C 3PQKA 2LY2A 3IH2A 3WTZA 1IG7A 2JPCA 3BR3A 3I55I 4PUSA 4F55A 4BEHB 3HUGB 2IA0A 3ECOA 3HBLA 1OR7A 4I02A 3H9GA 4UXNA 2O7OA 2CQ7A 1R36A 3BTLA 3K9TA 4E7JA 3V8LA 2OBPA 4ZTFA 2W57A 2MC3A 5F08A 1S9HA 3K10A 2UV1A 2Q1ZB 2CV2A 1QPMA 3VEPA 5FD5A 4BXXJ 1DPUA 3H5RA 4A3KJ 1YQAA 4AVZA 4C30A 2H27A 3FK7A 4ZTJA 5ICCA 1VZ0A 1WJEA 2F5DA 4CYCA 2DT6A 3ZGKA 2WAQA 5E18F 1ETWA 3WU0A 2I5UA 3PNYA 2HS5A 4GGGA 3BTCA 1K4SA 5K7ZA 3ESWB 2WC2A 1WQ2A 3BWGA 1XX5A 2FXAA 2PMUA 3S1MJ 3KLNA 1BI1A 2VQGA 2UXXA 1N78A 4FETA 4FISA 2F4OB 4BL0B 5K5QA 3AAFA 3S1RJ 3WTXC 5E3LA 2AQEA 2DA2A 3Q3SA 5GTHC 3OYGA 4A3BJ 4R8HA 3H3VK 1SFXA 3K6GA 3LMMA 1FYLA 4ZDOA 2DAOA 2FX0A 5E8IA 2HYJA 1Z6RA 1BW6A 3HHHA 3V42A 4KN4X 4XORA 3TDUC 2ZBKA 4A0ZA 1WFXA 5DM6F 5BMZA 3FXLA 1APLC 1LUJB 4XLEA 1EJ9A 4M71A 3DBLB 4G12A 3LA2A 2LKPA 3P9IA 5GP9A 2QENA 4K2EA 2L4MA 1Z3YA 2LG4A 1W0UA 3ZN0A 1ZREA 5EEGA 2AXLA 3FZVA 4ZH4F 4RGUA 3VPRA 1B1BA 2L9VA 4M3DA 2L9SA 1Y8QB 1EA3A 3R4KA 4A3CJ 2VOPA 1A35A 4LB6B 1PVEA 2A61A 1TNTA 2FD5A 4YIRX 2DOFA 2X51A 1OQYA 2VBYA 5M5XJ 1TC3C 2CUJA 5K7HA 2CQNA 2HR3A 3AL0C 2JT1A 5JLWA 3F72A 4P9UA 5KHDA 1D1AA 1MSFC 4QPOA 2R3SA 4M6XA 1SVMA 2AQFA 1J2XA 1XSVA 5ED4A 2NVXJ 4LG0A 2ID3A 5E8GA 2M0MA 2BY1A 3AL0B 2QKMB 3WHBA 2E35A 3JRAA 5AIQA 3O8HA 1WVRA 3SDGA 4Z6YA 1XGNA 2BEOA 4A6EA 4B44A 4NC6A 2VPRA 3GTLJ 2LLKA 3CCUI 1T98A 2ZB9A 5CVIA 1UG0A 2OCCH 3WGIA 1KQ9A 3M07A 4BJ5C 4QWQA 5IY5H 2BV6A 2W48A 1Y56A 5DCFA 4RB1A 1I3AA 1G2HA 3LFUA 4JX6A 2FMYA 1T0FC 2LY9A 1AKHA 4OMZA 2Y75A 3QP5A 1S29A 5HS9A 4N4NB 1H89C 2K3FA 3O2PE 3ZQFA 2X1DA 2NOJB 4I01A 4UVBA 2GA2A 2K85A 3FXMA 2QM3A 4FX4A 2O5RA 1PUFA 3F23A 1V54H 1T39A 1R9TJ 4I98B 5F0CA 2KRCA 3VFZA 3ABKH 2PFBA 3VODA 2DU9A 2P5VA 1IV6A 4BBSJ 4UB8C 2R4GA 1HDDC 4CICA 1LEBA 3FXRA 1P4AA 1EKEA 4YG2F 2XF6A 3C1DA 5L3GA 4Y52J 5K5RA 5LBQA 3ZMSA 4KIFA 5J1RA 5J4VA 4IOAF 3H35A 4NBQA 1V3FA 4CCKA 1Y0UA 2LBFB 4OIPF 1RIOH 3CCYA 3J7AO 2Z1DA 3CCJI 4E7KA 3ZR8X 5EYRA 4GFBA 2M2EA 2XHKA 1B72B 1QHGA 4NC7A 5IP9J 3VWBA 2ZMEB 2L5QA 5DD8A 2P6TA 2VE9A 1W0TA 2L9RA 2ESNA 3IAM2 2CFOA 1PDNC 4A5MA 4CCLA 3F3XA 2X48A 3CUQC 4EEFG 2COMA 2CQKA 1P6RA 2MYSA 3DBRB 2LVSA 3SFZA 4BEHA 1FYMA 3HUGA 2WV1A 3BR2A 1I39A 4IHSA 3RKXA 3AG4H 5K1YA 4YEJA 4RLFA 4YIIA 2H1KA 3E0JB 3CUQB 3KCCA 4BACA 1R4NB 1RI7A 2HTSA 2XGCA 4I76A 1KU2A 2GZWA 3CP8A 5FKLA 2ID6A 2ACJA 1W5CC 1TW3A 4DQ2A 4Z2YA 4L9VA 4AWXB 1TW2A 2E60A 3ZMVA 1HKQA 4DBQA 5IYCJ 2MG4A 3OS1A 2ZXJA 1S7AA 1ZAOA 1OYIA 4GYIA 3R6SA 3IWZA 3VOEA 1ZK8A 4DJAA 4EM2A 4HLYA 2D1VA 2HNHA 1Y8RB 3CLOA 3ZPLA 3RPQA 2DTZA 4JP0A 4UB6C 2DK5A 3HJEA 4NDLA 3LFKA 2F2EA 1ZG3A 2STTA 2JSCA 3H92A 1WRJA 3F6OA 5J1YA 1JT6A 3A0BC 3CD6I 3N4MA 1QO0D 4E6KG 4LJZF 3OYIA 2TDXA 4D7MA 4LITA 1R5HA 4B3XA 2GOMA 4XRMA 3OIQA 3BROA 3L1PA 2R7VA 2ADUA 2HXIA 3CCQI 3RPUD 2KIFA 4A12A 3V8KA 2M3AA 3ABUA 4C2TA 2X85A 1PJRA 2KZGA 1BIAA 1YW7A 2YPRA 2BBYA 3BPXA 4N9IA 3MAJA 3QP6A 2Y48A 4UNOA 1P92A 1FC3A 2L02A 2F5EA 3QRFF 2JVGA 4XOTA 2XPWA 1R5GA 5DYMA 3JRCA 2R7SA 3K4KA 2V1XA 2ELHA 3JRFA 3Q5FA 3RPUA 5IPAA 1GDTA 3FMSA 3Q9VA 3W6VA 1J9IA 2JMWA 3TW7A 1FOWA 2KJCA 3DKXA 3CJTB 1HKTA 1JKRC 1JE8A 3OYFA 3WODF 1ZR4A 4GDFA 1I3QJ 3I3LA 1YS6A 3OOPA 4CZZA 5LRSA 2IT0A 4LK1F 3DKWA 2DYSH 1Z6TA 3WTVC 2MBFA 3RKYA 2XF7A 4HBLA 4HX4A 1H9TA 2E1MC 4PCQA 3I64A 3HG9A 1U0JA 2HVSA 3QQAA 4FE4A 2DFFA 1RC9A 4X6AJ 1Z0XA 2H8RA 2KDZA 3H5AA 4G7ZF 2RNGA 1DGRM 1YYVA 4HYEA 4D7NA 3H3UA 3PO2J 5ILVA 3J7ZI 4ESJA 1B6AA 2B9SA 4Y33A 4ENJA 2RC4A 2MA3A 2ECCA 2DMTA 3CF5F 3DEEA 2F5VA 3KZYA 1GHCA 4RM2A 1Q1VA 4UV9A 2R5ZB 2X4HA 2E7WA 4YFNF 4HA8A 5KAIC 5CJ9A 5ICGA 2R7UA 3H5NA 3NARA 4A3DJ 4IHVA 3WGHA 4ZYEA 4PJLA 4CHUA 2EH3A 1OCCH 4JBAA 5HLIA 3LSJA 4XK4A 3FKJA 4KFCA 2JWTA 5C3EJ 3MKYB 1GXPA 1CF7B 2XSJC 3C7JA 4IHXA 2L7KA 4UVCA 4XIDA 2CUZA 2K86A 4OAZA 1YOVB 3TOBA 3PIPF 1LDJA 1HSJA 2JN6A 3KZZA 4LLLA 1NG7A 3RSNA 1VQKI 3MFKA 2NNNA 2DN0A 1J7KA 3LQQA 4O6JA 1T6SA 1RNLA 2ME0A 2QZ8A 2ZJQF 3PQJA 4J19A 4B4CA 1P2FA 4IJAA 3CF2A 4UHTA 2QSHX 1G3TA 2XKPA 4PDKA 4LGWA 3WG7H 4XICA 1TNSA 3ZOBA 4MFDA 2Y0MA 3CDHA 4G94A 4HV5A 2NVUB 3MCZA 2IW5A 3QOEA 3HB9A 4I0AA 1B72A 2HQAA 3ZMZA 4XOPA 2ZMEA 1SFEA 4XONA 2L4AA 4EV0A 1X3WB 4O5VA 3VYTB 3CMYA 3VSKA 1SC7A 5F6FA 1U8RA 3ASNH 4OWRB 2R0QC 2Z5UA 4A3JJ 2EFQA 3S16J 2ICWG 4E7LA 3JRHA 3WE3A 2HZTA 4II2A 2ZC2A 5IT9Z 5DEQA 3U1KA 4KMUX 2VC0A 2JRMA 3K69A 3QU6A 1GLNA 4LG3A 2NYXA 3SZPA 1MGTA 4XNFA 4XKBA 3M7GA 2VOOA 1V5EA 3IUOA 2LY1A 4XSZF 5KAFC 4HZFA 4BJ6C 2FE3A 3H1CA 3NQOA 1O57A 1IUFA 2YSRA 3F9KA 4CYCB 4ASNA 1RKTA 3GTJJ 3TOAA 3CCLI 3PUBA 3BR1A 3QYFA 4HQEA 3G1OA 3CCRI 4HNUA 2VBWA 4F92B 3OIPA 4MQ9F 2ZO4A 3U2RA 2HQNA 3HZJA 3S17J 1FOYA 2EIKH 3HRSA 6PAXA 5DV5A 1A6QA 4F52A 3HPHA 1U78A 1HC8A 2L7ZA 5B5EC 3LSMA 3V4GA 1TWCJ 4IX7A 3CO6C 3KETA 2BY0A 2ESHA 4Q5SF 2P8TA 1FIAA 4BE2A 2DDBA 4IEJA 1FJLA 2FBKA 2KZVA 3GEZA 3G71I 2XSDC 1PP7U 3E6BA 4AYBN 1XSXA 1K61A 4BHCA 5EZHA 1USSA 5HLTA 1ZRCA 2DYRH 3S3NA 1MKMA 2L9NA 4D5FA 1ZGWA 2FU4A 4CDGA 1DP7P 4PJNA 3GTKJ 1IRGA 2RN7A 1ETKA 4BQAA 3IL2A 1BR4A 1JKQC 1IRFA 4XRFA 2FMLA 2JUCA 4S04A 3OYEA 1A6IA 4V2GA 3IWFA 1WH5A 1WI9A 2LP0A 2QQAA 2E34A 4XKVA 4AU7A 4QLCU 3HKZN 4KDPA 4EMSA 1Y1WJ 3D5LA 5EJCA 5J4YA 1V5GA 5CPRB 4UVAA 3L2UA 1QA6A 1B9NA 2DFHA 2P0WA 2PG4A 5B3SH 2CU7A 2IS4A 1VQ7I 2P4WA 4U7DA 1D1CA 4A69C 3S15J 3ZMUA 1M1EB 1HKSA 4M3GA 2YX7A 1B8IA 3HIFA 3JSOA 1G8XA 4MIMA 2A6EF 5CLSA 1FTZA 3TEDA 2OC6A 2G7UA 4BQNA 4QIWN 4Y17A 4WF2A 2WBMA 2QWWA 2YR2A 4ZDLA 4EJVA 4A93J 3BQYA 1DGWY 2IRFG 2HYFA 1AKHB 1ZRDA 1IJWC 2BZTA 5BS6A 4BE0A 2XAUA 5FROA 3HOSA 1WHUA 2OA4A 2B7EA 4N0BA 1X58A 1U2WA 4EJUA 1XGSA 3E6CC 1PUFB 1R1TA 1HW5A 3HOVJ 2ZJRF 3GCMA 2DMQA 5DUKA 3FHZA 1YHQI 2V4JC 3KEQA 1Z7LA 3DLLF 2H8WA 1A04A 2GXBA 5EG0B 2M7AA 2K27A 1K4TA 1CF7A 1UB9A 5IOYA 1DQUA 2EFOA 3K4MA 3MN2A 5C44J 2LREA 2ZFUA 2BY2A 3HYIA 2NXNB 3EUKL 5D6FA 3M9AA 4W97A 2WTEA 1F5TA 2Y0SA 1IDYA 3PO3J 1Y0NA 2G7HA 5TISC 1YJNI 3CP2A 3JRIA 4CA0A 1U6GA 2VC1A 1MBHA 3V7CA 2AS5F 3DF8A 2KQRA 4XRSA 4M3BA 1TQMA 1TWGJ 3D0SA 2P7CB 3KP7A 4E4HA 2GIZA 5C4XJ 3KP2A 3GTQJ 4FQGA 3RDIA 1FX7A 4KA4A 3T5XA 3J7AY 1ON2A 3PM1A 1XMXA 1IN8A 2M45A 5HNFA 2OCEA 3P9CA 1IN5A 2P6SA 3WGGA 1RR7A 1MMDA 3OWTA 3DPTA 4MQVA 4RMNA 4CUGA 2ZNZA 2GBYA 2DJIA 3R61A 2Z33A 4LK0F 4DYCA 1D0YA 1ZLJA 1WGXA 2CJJA 1QVUA 4A0XA 3H0DA 3A1YA 2K40A 1E17A 2RGVA 3EYYA 2ZJPF 4S05A 2XDVA 4ABZA 4G8XA 3B73A 5HS8A 4IHTA 2JA6J 5H2FC 2ZKZA 3LSKA 3KEOA 4BY1J 3RQIA 1TLHB 2ETHA 4KUMA 4HRIA 2QQ8A 1YFHA 1SEUA 4A2UA 1G3WA 5D6EA 1D3YA 4L9NA 1R22A 2LF8A 4RAGA 3ML6A 4BDZA 5B1AH 2ECBA 4IRGA 3ZQQA 2Y30A 4IF4A 4XL9A 2Y9ZA 3LA3A 2HWVA 1S5LC 1T95A 4PGGA 2D5VA 3OOUA 2JRTA 1BC7C 2VPLA 2X1CA 2GLOA 2Z16A 3F6VA 1AHDP 2XASA 3MVPA 1OCPA 2R7QA 2IS2A 1G3YA 4A3LJ 1UHWA 2VJ4A 4RBOA 3I71A 2DDAA 3IHUA 2RV8A 1ACIA 4NQWB 4XQFA 3M1EA 4M9SA 5E20A 2LKSA 3BLYA 3IAS2 4ZZLA 3PFYA 4MFEA 2H6BA 2W82A 2PMHA 2DMPA 2VKEA 1JHFA 2I10A 1V5FA 4U0YA 1HLVA 1MMSA 1RUNA 2BVLA 2PX9A 2MSYA 2FEZA 4ANJA 3CQZJ 1TT0A 4BH9A 1VTNC 1IXRC 2RNJA 4KT6A 2R7WA 3I9V2 2A5YB 3ZRGA 1V55H 1W5SA 4Y15A 5L3BA 2K5CA 3BDDA 2GA1A 4PSWA 5FD6A 3L2QA 4BDYA 1XPXA 1WPKA 2RQPA 3WU1B 3JW4A 2NS0A 1ONVA 2VODA 5GADJ 3RYRA 1X2MA 2LKXA 4KIGA 5GPAA 2E36A 1J75A 1R6RA 1MDMB 1IC8A 2P7VB 3KX2A 2GXGA 5M5YJ 5ILSA 5M3FJ 4D5CA 4L0YB 1W7PD 2XVCA 3GLXA 3P9KA 2VN2A 3VSLA 5FKMA 2VI6A 2L3DA 4IOCF 4A0YA 2FA5A 1ENHA 5IT9K 2KKOA 3K4JA 3Q0UA 3WTYC 4JQFA 3RZDJ 1LB2A 3RJPA 1XS9A 3SZGA 5CKTA 3DTIA 1HW2A 3DTEA 3KYLA 1WWXA 3OMYA 1Z21A 2W84A 3LAPA 2VASA 2I8DA 2MH9A 4CXFA 1A36A 2X0LA 1D8KA 1XN7A 2BHZA 3CMEI 1IXCA 1AWCA 3BJAA 2M0CA 2XF5A 3MZYA 2K9MA 3PNTA 4HPQA 2CSOA 2DI3A 3FMRA 4L18B 2R7ZJ 5LEJA 3GF2A 3OYAA 2W1OA 2O61A 1OPCA 3EUHA 1IN6A 5F0HA 2OAZA 3C3WA 3C2HA 3AG1H 5ILUA 3C18A 4PGHA 5ICFA 1YITI 1LJ9A 4BE1A 4HDVA 2UWMA 3GWZA 4FHTA 4MHGA 3CC7I 5D8KB 2HKOA 3BP8A 3HSRA 4WX9A 4H4KC 1TZLA 1D5YA 4L9JA 3ERED 3HRMA 2F48A 2O9LA 4AM3A 5EG0A 1MBKA 1SD6A 1BN5A 3BR6A 2LF7A 1LFPA 3KE2A 1P7JA 1DPRA 2XROA 2FF4A 3JAMK 1FY7A 4RGRA 3K4BA 4ZYHA 1F9NA 2WY7Q 5FB2A 1XMAA 4A3GJ 1MNEA 4RM3A 2E19A 2IAIA 4G6DA 1VQPI 2FNPA 2RAEA 4EVIA 3MZHA 1MD0A 2JA7J 4F91B 2ZMEC 2FBHA 5KVRA 4ENMA 3FM5A 3ROUA 1LVKA 4MGRA 1YX3A 3GTMJ 1LQ1A 3IRRA 2CQQA 4EATA 1STZA 3TW6A 2IEKA 1E3OC 2OQRA 1ZHFA 2VKHA 3NEUA 5HDGA 3A01A 2BW3B 5KCMA 2MW8A 1A5JA 5JHUA 1RPWA 4AYBA 3W2AA 2P5LC 1IZ1A 2KIUA 3V7SA 4XLFA 1LFUP 1LDKB 4RDUA 2HDDA 1KU3A 4D9JA 3KYCB 4E7ZA 1U5TB 3QAHA 4FASD 1ZN2A 5CVUA 4HX7A 3QWLA 3ZXSA 5DCMA 3F0CA 1JUSA 3RYPA 4HF0A 2HTJA 2WY8Q 2QQ9A 4BXUA 2LMDA 3HXLA 1IAWA 1X1BA 1B59A 1R58A 4NHJA 1LKXA 3N97A 1VF9A 1YS7A 1HQCA 4ZYDA 3S1NJ 3S93A 3A0HC 3GLLA 1OLTA 5GAHJ 1HF0A 3FMQA 2HFHA 2M8EA 3MMYB 2R7FA 3BZKA 1V4RA 2KIQA 5D5WB 4HAMA 4RAZA 3ISPA 1I6XA 5FO5A 3D5RC 3TP0A 2L54A 3T1BA 1T2KA 1C0WA 1L0OC 2KPMA 3K4LA 3T8RA 2HOSA 3UKGA 2E71A 4XLAA 3KFWX 3LSTA 1QVTA 3V7RA 1LDDA 3OYMA 3E5UA 4CCMA 1AA7A 2YS9A 3CUOA 3ZCOA 2NVTJ 4Y3OA 4F93B 3FF5A 3UNGC 2B63J 5A2QZ 3A4CA 3T0YA 1XSDA 1ETYA 4KICA 5FKKA 5IYBJ 4ON0A 1UAAA 1H8AC 3OL3A 3PNVA 4NQWA 2H1LA 3QYBA 1T8IA 4DW6A 2EPFA 2LRDA 4YFXF 4PFPA 3CCMI 4V19K 1HCRA 2FOWA 4ETSA 4AC0A 4PSXA 3L2VA 2JQ7A 3ELKA 3OR2C 1POGA 2BOLA 3RTRA 3HC7A 4N9HA 1R49A 4ENNA 2GM4A 1N75A 3BR0A 2EK5A 1B4AA 3E6DA 1ZTRA 4HF2A 4B8XA 3MD2A 2LH9A 4CCOA 1BBYA 3OYCA 3OYNA 3HGGA 3PSFA 2NS8A 5JI6A 4F7ZA 1G59A 2PI0A 4IRHA 2DK8A 3KLOA 4GRIA 4UUTA 2K9LA 1CGPA 3S3MA 2M4GA 1I1SA 4DYQA 3BR5A 1MDMA 4P1WA 1OCOH 4ENKA 2R5YA 5GTIC 1OJLA 3JRBA 5FLXZ 1U3EM 4MEYF 3DWLE 2CUEA 2WAFA 1IGNA 3IRQA 1B8IB 5HS7A 2A3SA 4IRIA 1G6NA 1LNWA 2F4IA 3FHNA 4A5NA 2VLAA 1GVJA 3QU3A 1ON1A 5IT3A 1R23A 3HGYA 3PJRA 3L9FA 4XLNF 1G4DA 2Q2EA 2TCTA 5BPDA 1YG2A 2WAQN 3BG6A 3L2RA 4R1HA 5HVQC 1J5YA 4M6YA 2OU2A 3WTWC 1ODDA 2XAFA 2Z3YA 5LGTA 1PP8F 2DA7A 4KITB 1S7EA 4EQQA 3KP5A 4KIBA 1BC8C 3FWEA 1ERDA 3O6BB 4PFOA 3D5SC 1FBSA 1UHSA 2MH2A 3K7AJ 2F5CA 3ABLH 3W3CA 3QPHA 2CO5A 3OSFA 2V9VA 1KU9A 3C2GA 2STWA 1VQ4I 5DD4A 3I58A 3OY9A 1T08B 2PQ8A 2JUGA 1WKMA 1SFOJ 4DYRA 2XIGA 4L9TA 2H6CA 4EM1A 1BJAA 2O8KA 5FGMA 3OYLA 2EFPA 3WTSC 4II3A 1GV5A 4DZJA 2EFNA 4U0VA 2LDUA 2M9HA 1ZLKA 4IVNA 4V2FA 2WADA 3RQ4A 3SFIA 3U1DA 3TL4X 1VQOI 4CCNA 2MD5A 2V6EA 2PBIA 3CCVI 1O3SA 5E1WA 1JGSA 4TV7A 5LHGA 2Z99A 3S2HJ 3C2BA 3SYTA 1MJAA 3OS0A 1VFCA 2JA5J 4I99C 2EA4A 3ECHA 2ZXIA 4RGXA 2XB0X 4AIHA 1ZGAA 3LSGA 4YFKF 4XLPF 2EBIA 4E7SA 1OR7C 2ZNYA 2RQQA 2DTRA 2QVOA 2K02A 5DS9A 1UELB 2V7FA 2BW3A 2Y31A 1DUXC 4WK8F 1F4KA 3ZQIA 2J5OA 3ZQLA 2OUMA 2HOTA 2IGNA 1OYYA 2O03A 2IVMA 3HOYJ 2JVHA 5BNGA 1WI3A 4ZYAA 2DA4A 1U5TA 4RGSA 2EZKA 5E3NA 4IQJA 4ZJZA 4B09A 3OYHA 3J80Z 1YRNB 3DU5A 3QYEA 1IDZA 1MW7A 1ETXA 4HDUA 4IXAA 4N4OB 4NC8A 1QZZA 2EV0A 2A05A 2OTLI 1MNDA 2LK2A 2DT7B 3FIWA 4QTRA 4CH7A 1E3HA 3BCAA 1SFKA 3H9JA 4ZZDA 3CCEI 3GZNB 4IHWA 1MMNA 1KYWA 5IOZA 1UFMA 1RUOA 1KQ8A 1UG2A 4U7BA 4DOZA 2E1CA 2VXZA 4CGZA 3LQRA 4P9FA 4OIOF 2DBBA 3HOWJ 2XGXA 4YRVA 4RLQA 5FLMJ 2E2HJ 3HRUA 1ULYA 4ITVA 2KIMA 1WZ2A 2MGQA 2QCOA 2YU9J 3L2WA 3DCFA 4XKWA 3S3OA 2NVQJ 4BQOA 1FBUA 1SVOA 4DNCA 1QBJA 1NK2P 1O3TA 3MKLA 3JRGA 3HOUJ 2DCEA 5J40A 1O7LA 3I4MJ 3HOXJ 1FOKA 2R7TA 1MIJA 2VQCA 2IGMA 1BW5A 2DA3A 3U9GA 2BY3A 2KLOA 2G0EA 3PFIA 3IC7A 3ZQ7A 2EFWA 2CYYA 4PJJA 1IW7F 4M6VA 3S2DJ 3IH3A 4LIVA 3AFHA 3E5XA 3HRTA 3PIOF 2IPQX 2QQBA 2HGCA 4C2MJ 3JAMZ 3FX3A 1FWZA 2X6XA 2KP6A 1JTYA 3A03A 2M4KA 1JTXA 1TQPA 4KJZA 2VJ5A 2K7LA 3VYRB 3OYDA 2XGEA 3TO9A 3JR9A 2FNAA 2M5WA 3G2BA 2HKXA 4L0ZB 2O3FA 3I0TA 3QOPA 2QKLB 1IF1A 4MEXF 1XDUA 2WA0A 4ZDPA 3RCOA 2Y2ZA 3M4OJ 4BYYA 1KGSA 3ONQA 2RKHA 1X3UA 1ZRFA 2LR8A 1K79A 1OMIA 5JR3A 2WB1N 2FRHA 1AU7A 3I4PA 3K1NA 3S8PA 5J47A 2LNBA 2PMZN 3BY6A 2TRTA 4RB0A 1YJWI 3DKYA 3HPGA 3ULQB 2DPDA 3LAJA 3B6AA 5AIPA 4I2OA 5D5VB 2QGUA 2JPBA 2OD5A 9ANTA 5IP6A 3REOA 4HNVA 1YX5A 3OYBA 4M74A 1JJ8C 1OISA 2DA5A 2NAZA 3CO7C 1R5ID 4BHBA 1HA8A 1TP4A 1QZYA 2EQRA 5DTDA 4EM0B 3GYHX 3EUHC 1D8JA 1ORKA 2G9WA 3K70D 2HOAA 1X2NA 4LIUA 1W7PB 3V8JA 1MSEC 4I7HA 4RA2A 1N77A 1JKOC 3O3KA 3LSIA 3JREA 2CS3A 4Q48A 1P4XA 3N05A 4BXFA 2VUMJ 1RKWA 2RVCA 3E6MA 1YW9A 2CFXA 1S8NA 1ZG5A 2EZIA 2HZDA 2BE5F 3ZN1A 2QSFX 1OCTC 2F6CA 4Y7NJ 1X1AA 1ETOA 5KNLA 3DU6A 1DU6A 3RKQA 1R71A 2DA6A 2OQGA 1IO2A 3K2ZA 2EINH 5A2QK 3SHFA 1SD5A 2CMPA 4ESBA 4MLOA 4CCJA 2VKDA 2ZXWH 3LOCA 1T33A 2BVMA 1RESA 1RZ4A 1Y39A 4H0EA 1WJDA 3SJMA 2QEXI 4GXOA 2QSGX 4NB5A 4OOIA 4R79A 2KRHA 4BJTA 4HOBA 3HOTA 1GV2A 4BY7J 5F1JA 2PJRB 1WH7A 3GTGJ 3S2WA 4G6TB 1NTCA 5CVJA 4XBFA 4XSXF 4B47A 1VQ6I 2E5NA 3OYJA 2DLLA 1BR2A 4X0GA 2XRLA 2Z9OA 3DTKA 2MLKA 3OR1C 1W1WE 4IHYA 3DLAA 3Q0VA 3BPVA 4G7HF 1TWFJ 4HX8A 1FLIA 3A01B 1A31A 3OL4A 4M3EA 5JLXA 1KONA 3BTIA 2FQ4A 1LPQA 3TP3A 1ETQA 2NRAC 4KN7X 1BIBA 2OPTA 5FLXK 4NUBA 4LLGF 4L5JA 2IS1A 5L3DA 4D0PA 3FBNB 3EDPA 4C3HJ 2QBYA 3R0JA 4HF1A 1UCRA 5DCMB 3F8CA 1VI0A 2H94A 2JZYA 2FJ1A 4BAYA 1F43A 1QHHD 5FFZA 3I53A 2M7BA 2EILH 2M8GX 2K9SA 3D1NI 3JSPA 2E7XA 2VKVA 2ZSHB 1ZKGA 1FOXA 4JK1X 2E2IJ 2DW4A 3CLQA 4HG2A 1YRNA 5HLGA 4HNTA 5EDNA 2XAGA 3BT9A 3FM3A 2O0YA 3I59B 2K4JA 1GUUA 2VT3A 2BHYA 2LTPA 5BOXA 1FSEA 2XAJA 4L5EA 5TJJA 5LHHA 2ISZA 4EJTA 4WXCA 1SFUA 4XR6A 3IV5A 3G1MA 1YE9A 4G7OF 5LEKA 3H9QA 2RDPA 1QGPA 2COBA 1VQ9I 1XGOA 2HOEA 2CGPA 3I5UA 1W36D 3SXYA 3BG7A 2RREA 3G4SI 5K7FA 1DP3A 5HDKA 1X3ZB 1K6YA 1QQIA 1B9MA 2WV0A 1Q1HA 2PN6A 1Z05A 1VQMI 2VXDA 3F8NA 2ISYA 3G6EI 1FIPA 1OCRH 2HXOA 1Z7UA 3AG2H 1R1UA 4I0BA 2A68F 4U87A 2DT5A 3TMOA 3IP4B 3U21A 3IKTA 1UZCA 3GMEA 3K1MA 2V9PA 3BC8A 5E1ZB 3VB2A 2HQRA 3WTUC 2R92J 5CQEA 1U8BA 3CZ6A 4KMFA 3UR3C 4Q47A 2KRFA 1J0RA 3ZP5A 2BXZA 3ZQGA 1L3LA 2MC4A 1YIOA 3TBIA 4KNYA 3HOZJ 2VQHA 2IGOA 5HNHA 2ZJ2A 5LGUA 4LOCA 2JTVA 3LSPA 4KYWA 2DMUA 4DZPA 2ELKA 5CQGA 5L3FA 2VB6A 3NWTA 3A2KA 1K83J 2QUFA 1BI0A 2HPIA 2BGCA 2IP2A 4J01A 1ZQ3P 4RAYA 3GBGA 2MLGA 3MKZA 5DUIA 2R5YB 1XB4A 2D45A 3M8JA 2GAUA 2MD0A 3GO5A 3FBIB 3TDZC 1K6OA 3CTAA 3SEQA 1Y1VJ 3J80K 5EEHA 3KPHA 5H6QA 1IRXA 2K3PA 3FXJA 2DJNA 1X4OA 2W25A 2EA2A 5L3CA 2AO9A 1LE8B 2HVQA 2CWEA 3IKVA 1JUMA 5EGOB 3H0GJ 3S1QJ 1P7IA 4A6DA 1WCMJ 2X6OA 2Q2EB 1KA8A 3COAC 5GPCA 4XRSG 3Q9SA 1Z91A 3OS2A 3WHCA 4RB2C 1NG6A 1W7PA 1GVDA 4HSRA 3BOQA 5IYDJ 5C4JJ 1YJ9I 5EZGA 4G9YA 3HHGA 1I1GA 3MZ8A 1BA5A 1FPQA 3H36A 2XB5A 1J09A 4Y13A 1Z9CA 2AHQA 3BQZA 5EF6A 3I54A 3DV8A 1OKRA 1QZEA 4B48A 5E79C 3FXQA 4YELA 4JYKA 2X1EA 4UUSB 1H88C 1BI2A 3TGNA 3JTGA 1Z1DA 2KL4A 3BZCA 4X1EA 2QF7A 4DBRA 4PZJA 1FSHA 1YI2I 5B1BH 4KISA 3TQNA 1X1DA 4HQMA 1S7OA 3HM5A 4BGDA 1LEAA 3L7WA 3E5QA 1YW8A 2V9KA 3FXUA 2PJRA 2BXYA 3EETA 3KEYA 2UUZA 1FMWA 4G6QA 4A3IJ 2KMUA 4BS9A 1MZBA 5HODA 1SMYF 4P96A 1MJ9A 3DP7A 1PUEE 2DOAA 2DFIA 4XN3A 4E70A 5FRNA 1HOMA 4JOMA 3L2CA 2MFZA 1U5TC 4RAFA 3TO6A 3LNQA 2A6TA 1P9QC 1E2XA 1R00A 2VJIA 4B1RA 3ZQCA 2Y69H 5F1RA 3BJOA 2CW8A 2N8GA 4MO7A 5LFAA 1BI3A 5L3EA 4WXDA 2CH0A 1D1BA 1Z3XA 3L09A 3G1LA 5FLVA 4XN0A 2P5KA 2K9QA 4ZC3A 2X9DA 3Q0WA 4UV8A 3ASOH 3CESA 3OYKA 4BUPA 1FEXA 3W2VA 1EH6A 2XGDA 5FJ8J 2XPVA 1OCZH 4IKFA 2HI3A 1R7JA 1W4MA 2UZKA 3HL2A 3R0AA 5J3LA 4WWCA 2WB1A 4WXHA 3LSRA 1KU7A 1SANA 3LWFA 1TT5B 2KHMA 4XLHA 2PMZA 1F36A 1JUPA 2OV7A 3HKZA 2ZSIB 5EEAA 1FBQA 4JX5A 2KFDA 3OV8A 3I59A 2IS6A 5M3MJ 1HSTA 4M9ZA 3M1CA 4XMYA 2OJED 2F5FA 1JHHA 1NH3A 3F8FA 3K4NA 4B3AA 3MQ0A 5E1XA 1XCBA 3A02A 1WJFA 4S0HB 5IP7J 1W5TA 1G3SA 1YLFA 1FZPB 1USTA 2DQLA 5JVTA 1QPIA 2CQXA 4UUVA 2V1DA 3ZMDA 1HXDA 3FISA 2W00A 1ZYRF 1J59A 3K4CA 1IUYA 4LB5A 3OSGA 3X2QH 2Y0SN 3BTJA 1MNMC 4OAYA 1VQNI 2JSPA 3SEZA 1PYVA 3S14J 1F1ZA 1WJAA 1TL8A 3T8TA 1S6LA 3AKZA 1ZELA 1BL0A 5E17F 3GXOA 3KP6A 1UJ8A 1TWHJ 1IN4A 1MH4A 1GT0C 1IRZA 4M73A 1U9NA 2R7DA 4PJMA 3M8FA 3JCUC 2VIXA 2HQ5A 3RZOJ 2XAHA 3W2WA 2EIJH 3J7YJ 2X6YA 2QLZA 3DPUA 3K2AA 3LL7A 4AVPA 3DFGA 3FXKA 3QPLA 2GQQA 5TGTA 3J81Z 1BOBA 4Q4ZF 2XC7A 3CDIA 1LVAA 1FT9A 3I56I 3HEFA 3G73A 1MJBA 2M1BA 1XC5A 1XTAA 2CG4A 2DXIA 4C3IJ 3HDDA 3QODA 2ZFWA 4BQQA 2OZ6A 1MMGA 1Z67A 2K4BA 2NOGA 2C6YA 4MTDA 1Z77A 2K9NA 2ELJA 1RRJA 4FX0A 2FUG2 4HSTA 3SDBA 3DPLC 1IN7A 4ZYGA 3O8GA 3GTPJ 1SMTA 4FT8A 2OTJI 3DEUA 4RS8A 2LD5A 2YX4A 2FOKA 1K78B 3F8MA 2DMNA 2PLYA 1LE8A 2ZXHA 5EGOA 2W24A 1O7FA 3GW2A 1QNTA 1T38A 4CZCA 1FNNA 3K70C 5M5WJ 1VQ8I 2CW0F 3S32A 5F64A 4L5IA 2D2WA 3GTOJ 4LD5A 2VE8A 3GX4X 4XLCA 1FP2A 3FXOA 5K5OA 2M30A 2M87A 4A3MJ 2KJBA 5D5UB 3I4NJ 5FFXA 2LSOA 2UXNA 4UY8I 2E1MB 1TBXA 1BJZA 1K7AA 1SVLA 2IBDA 4HW0A 2VQLA 4AIKA 4UUSA 1I50J 5HDNA 4AIJA 1XG1A 2JJ7A 1H0MA 3WG9A 1TWAJ 1TQIA 3CJRB 5LGNA 2IJLA 4CYDA 2V1UA 1KYZA 2O6GE 2VONA 3HSFA 3ZQHA 3GFMA 3QPSA 2CW7A 1EH8A 2GOXB 1MBEA 2FSWA 3K1PA 5CVVA 4E7IA 2HU9A 1T0FA 4EGYA 2HVRA 2MABA 1O3RA 2M34A 3KP4A 2CUFA 4FE7A 1RR8C 1VQLI 3NWSA 3EYIA 3ZMTA 3WE2A 2WWYA 3MKWB 5DM7F 3RIRA 1R4MB 2V6CA 5F0FA 1FP1D 1X1CA 4BKXA 1KZHA 1EV7A 3CCSI 5DDGA 2VBZA 4OINF 4J00A 2QBYB 5AONA 3ABTA 3GFJA 1NHAA 4Y4RA 5D5XB 5E3MA 2DFEA 4RB3C 2Q8KA 3CJQB 5BQTA 1SD4A 3WTTC 4BNCA 1S72I 3KZIC 2H09A 2AXTC 5LHIA 1MBGA 4KT5C 2LBFA 3MEXA 4MNUA 3CDLA 3GZ6A 3FDYA 4FTHA 2CV1A 3CJNA 4WCGA 2A5WA 2E1NA 1YTYA 4A3FJ 1T56A 1BOAA 3FKIJ 3TO7A 3EQLF 1DU0A 4PK4A 5D8LB 3W6JB 1OYWA 3JTHA 5KK1A 1JI8A 3AG3H 4HV6A 2ZCWA 4EGZA 4BHPA 3P5JA 2B0LA 4B43A 4IL6C 1WJBA 3DBHB 1JJ6C 3JRDA 5J8CA 5GAEJ 2QA4I 1QRYA 1ZARA 1SAUA 1YIJI 2DODA 2NNYA 5BPIA 1X19A 4LLNA 2W85A 5TRDA 5J6XA 2VJJA 2JK3A 3ABMH 3PSIA 1I5ZA 3CUQA 2JA2A 3OIOA 4AUXA 1JXSA 4YIFA 3F8BA 4QSHA 2NVYJ 4JX4A 2XPUA 4XM3A 3CC2I 1JGGA 2BYVE 1ETVA 4QPQA 2IA2A 3E1SA 2VT2A 1OFCX 2FBIA 1W36C 3LSHA 3HTUA 4OIRF 2GXAA 4F3QA 1O4XA 2XV4S 5LRRA 5H6RA 1WJCA 3E7LA 1BR1A 1I27A 3TKYA 4M3FA 1LFBA 1S3JA 2QYOA 5CYVA 3GVAA 2X6WA 5F27A 1ZGJA 1O3QA 3E97A 1VQ5I 2PEXA 2YUSA 5F04A 3CMMA 4MTEA 2V26A 1N25A 1MMAA 2YU3A 2R93J 3PL8A 2LOOA 4IZZA 2Y9YA 3BJ6A 4DGWB 3SQNA 3LA7A 4GYGA 1ZR2A 5CVRA 2D1HA 2L2OA 2IGKA 3GZ5A 3CMAI 1H9GA 4A3EJ 3CC4I 3DXJF 5B66C 1XDSA 2XUBA 3NAUA 2HYGD 5JHFA 2A07F 2LFBA 4CSWA 2EIMH 3F22A 1ZH5A 2LYCA 5D4SA 3VYUB 1Y6IA 2DPUA 2EB7A 2VL8A 2DA1A 2L7MP 4PJ0C 5JFRA 3IH4A 4M72A 1WJ5A 3RI4A 2KDOA 2O8XA 2KT0A 2IA1A 1WSUA 2J5PA 3HSEA 1R1VA 4P55A 3F21A 5ERIA 1REPC 3FK6A 4DIQA 5E3OA 1K78A 5FRMA 4U0WA 4D1QA 2EJRA 2V1NA 3RKWA 3W6KB 4EJWA 1HW1A 1EH7A 4AIDA 2OZUA 3VDXA 4E7HA 4LG0B 1D5VA 4GO1A
chains in the Genus database with same CATH topology
3ZQGA 3BG5A 3HOZJ 1VF9A 2JN6A 4I6ZA 3S1NJ 5FKNA 4LOCA 1RETA 3LSPA 2DMUA 4DZPA 1HF0A 2DN0A 2ELKA 2ME0A 4J19A 4B4CA 1I6HJ 1K83J 3BG9A 3TP0A 1ZQ3P 2P81A 3GBGA 4XICA 3ZOBA 2EZHA 4MFDA 2L7FP 2NS7A 1JT0A 2R5YB 1JKPC 2HOSA 3UKGA 1QVTA 3HB9A 1B72A 2YS9A 1CQTA 1Y1VJ 4C3JJ 2NVTJ 4W1UA 2B63J 2R5ZA 1MH3A 1U9OA 3M3YJ 2DJNA 2E1OA 3CMYA 1ETYA 5FKKA 5IYBJ 1H8AC 2R0QC 2L0KA 3BG3A 2AO9A 1LE8B 4DW6A 4A3JJ 2E2JJ 1JUMA 5EGOB 3H0GJ 3S1QJ 1P7IA 1WCMJ 2X6OA 1HCRA 3S16J 3JRHA 4AC0A 5GPCA 4XRSG 3WHCA 1GVDA 1POGA 5IYDJ 4BBRJ 5FKOA 3B6CA 5C4JJ 2GM4A 5EZGA 5J1UA 1MBJA 3BR0A 1UMQA 1ZTRA 2ME6A 1VNDA 1BA5A 2XB5A 3DEWA 3HGGA 1IUFA 4CYCB 1RKTA 2AHQA 3BQZA 5EF6A 3GTJJ 2JA8J 1NK3P 3BR1A 2NS8A 3G1OA 4JYKA 1H88C 4UUSB 4UUTA 1HDPA 3S17J 4DYQA 2OF7A 3BR5A 2R5YA 1MBFA 3JRBA 1OJLA 4FCYA 4X1EA 2QF7A 1U78A 2L7ZA 1ITYA 2EZLA 1TWCJ 2CUEA 2CRGA 1FTTA 3HM5A 1IGNA 1B8IB 3IH2A 1FIAA 1IG7A 3BR3A 4IEJA 1FJLA 4A3IJ 3HBLA 2XSDC 3HGYA 2O7OA 4AYBN 5HODA 3BTLA 1K61A 5EZHA 2TCTA 2WAQN 5F08A 1HOMA 4D5FA 1ZGWA 4BXXJ 2DA7A 4A3KJ 3LNQA 3GTKJ 1S7EA 3FK7A 4B1RA 3ZQCA 1ETKA 4CYCA 1JKQC 2N8GA 4MO7A 1ETWA 1UHSA 3K7AJ 1A6IA 4V2GA 3BTCA 3G1LA 5FLVA 5K7ZA 1WH5A 2LP0A 2K9QA 3OSFA 2X9DA 3HKZN 3Q0WA 3S1MJ 1Y1WJ 1FEXA 2XGDA 4FISA 5FJ8J 2XPVA 1SFOJ 4DYRA 2HI3A 2O8KA 3S1RJ 5J3LA 2DA2A 3Q3SA 5E3LA 2CU7A 4A3BJ 3LSRA 1GV5A 4DZJA 3H3VK 1SANA 4A69C 3S15J 2M9HA 2FX0A 1F36A 1JUPA 4M3GA 1B8IA 5EEAA 2HYJA 4MIMA 1BW6A 4V2FA 3SFIA 1FTZA 3TEDA 4JX5A 5M3MJ 1APLC 4QIWN 3S2HJ 3C2BA 4G12A 4B3AA 1VFCA 2JA5J 5GP9A 3A02A 4A93J 4S0HB 2XB0X 1W0UA 3BQYA 5IP7J 3LSGA 1AKHB 2EBIA 3VPRA 1IJWC 5DS9A 4M3DA 1QPIA 2CQXA 2Y31A 3FISA 4A3CJ 1X58A 3ZQIA 3ZQLA 1PUFB 2HOTA 2FD5A 3OSGA 3HOVJ 3HOYJ 2DMQA 5M5XJ 1TC3C 5BNGA 1WI3A 2Y0SN 3BTJA 1MNMC 5K7HA 2DA4A 5EG0B 3S14J 2EZKA 5JLWA 5E3NA 1MSFC 1BL0A 5IOYA 3MN2A 5C44J 1YRNB 1TWHJ 1IDZA 1MH4A 1ETXA 2NVXJ 1GT0C 4W97A 2ID3A 1IRZA 1U9NA 1IDYA 3PO3J 3JRIA 3WHBA 2LK2A 2HQ5A 3JRAA 3FIWA 4QTRA 3O8HA 3SDGA 3RZOJ 1MBHA 4IHWA 2VPRA 3K2AA 5IOZA 3GTLJ 1UG2A 2LLKA 3QPLA 4XRSA 4M3BA 2ZB9A 1TWGJ 3HEFA 3HOWJ 1XC5A 5FLMJ 2E2HJ 5C4XJ 3GTQJ 4C3IJ 3HDDA 2MGQA 2QCOA 2YU9J 3DCFA 2W48A 2NVQJ 3PM1A 1G2HA 1NK2P 4JX6A 2LY9A 1AKHA 3MKLA 2NOGA 3JRGA 3HOUJ 1Z77A 2K9NA 1H89C 3I4MJ 3ZQFA 3HOXJ 3O8GA 3GTPJ 1RR7A 1PUFA 2LD5A 1BW5A 2DA3A 2GBYA 1R9TJ 2DMNA 2G0EA 5F0CA 4DYCA 4M6VA 1LE8A 3S2DJ 3IH3A 1WGXA 2CJJA 5EGOA 1QVUA 1IV6A 2K40A 4BBSJ 4C2MJ 4ABZA 1HDDC 5M5WJ 1JTYA 3A03A 2JA6J 1JTXA 3GTOJ 4BY1J 3RQIA 2XGEA 3JR9A 4Y52J 2Y2ZA 4A3MJ 5J1RA 3M4OJ 3I4NJ 2ECBA 2Y30A 2LR8A 2Y9ZA 1BJZA 2WB1N 1AU7A 2D5VA 3OOUA 2IBDA 2PMZN 3CCYA 2GLOA 4UUSA 2TRTA 5EYRA 4GFBA 2M2EA 1I50J 1B72B 1AHDP 1XG1A 3MVPA 3B6AA 2JJ7A 5IP9J 1OCPA 4A3LJ 9ANTA 1TWAJ 5IP6A 4HNVA 4RBOA 1JJ8C 1W0TA 2L9RA 2DA5A 3ZQHA 3QPSA 2X48A 4EEFG 2EQRA 5DTDA 4MFEA 1MBEA 1ORKA 2DMPA 2LVSA 2VKEA 2HOAA 1X2NA 2I10A 2WV1A 3BR2A 1MSEC 1HLVA 1JKOC 2M34A 2MSYA 2CUFA 2H1KA 4FE7A 3JREA 3CQZJ 2XGCA 2VUMJ 4I76A 1RKWA 5F0FA 5FKLA 2ID6A 2EZIA 4BKXA 1OCTC 4Y7NJ 2MG4A 5IYCJ 1ETOA 1WPKA 1DU6A 3RKQA 2DA6A 5E3MA 1ZK8A 1X2MA 2LKXA 5GPAA 2DTZA 4JP0A 4MLOA 1MBGA 1IC8A 4NDLA 3CDLA 5M5YJ 3LOCA 1T33A 5M3FJ 4D5CA 1RESA 5J1YA 4FTHA 1JT6A 5FKMA 3SJMA 2VI6A 4A3FJ 1T56A 3FKIJ 4D7MA 1ENHA 3Q0UA 4XRMA 1DU0A 1GV2A 4BY7J 5F1JA 3RZDJ 3L1PA 1XS9A 1WH7A 3GTGJ 2HXIA 1NTCA 1JJ6C 1EF4A 3JRDA 1QRYA 2XRLA 2M0CA 4IHYA 3Q0VA 1TWFJ 2JK3A 3A01B 2R7ZJ 4M3EA 5JLXA 3OIOA 4AUXA 2XPWA 3BTIA 3JRCA 2FQ4A 5F0HA 3TP3A 4QSHA 1ETQA 2NVYJ 4JX4A 2XPUA 3JRFA 1JGGA 1ETVA 2OPTA 5IPAA 1OFCX 1GDTA 3W6VA 2JMWA 3TW7A 4C3HJ 1O4XA 1JKRC 1D5YA 1VI0A 3E7LA 2FJ1A 1F43A 4M3FA 1ZR4A 1LFBA 2O9LA 1I3QJ 5F27A 2M8GX 5EG0A 1MBKA 2K9SA 3BR6A 3D1NI 2YUSA 5F04A 1P7JA 2VKVA 1ZKGA 2R93J 2E2IJ 1YRNA 2Y9YA 5EDNA 3QQAA 4A3GJ 4FE4A 1ZR2A 3BT9A 4X6AJ 1Z0XA 2H8RA 2KDZA 1GUUA 2E19A 2IAIA 4D7NA 2RAEA 2LTPA 4A3EJ 3PO2J 4L5EA 2JA7J 3NAUA 3IV5A 2LFBA 3G1MA 3GTMJ 2COBA 2CQQA 2ECCA 2DMTA 3TW6A 2IEKA 1E3OC 2DA1A 2L7MP 5K7FA 3IH4A 3A01A 1Q1VA 2MW8A 1A5JA 1RPWA 2R5ZB 2KT0A 3NARA 4A3DJ 1LFUP 4IHVA 1FIPA 2HDDA 4RDUA 2EH3A 2HXOA 3FK6A 5E3OA 3LSJA 4XK4A 3F0CA 1JUSA 2JWTA 5C3EJ 2R92J 4IHXA 1U8BA 4XIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQG A;  3BG5 A;  3HOZ J;  1VF9 A;  2JN6 A;  4I6Z A;  3S1N J;  5FKN A;  4LOC A;  1RET A;  3LSP A;  2DMU A;  4DZP A;  1HF0 A;  2DN0 A;  2ELK A;  2ME0 A;  4J19 A;  4B4C A;  1I6H J;  1K83 J;  3BG9 A;  3TP0 A;  1ZQ3 P;  2P81 A;  3GBG A;  4XIC A;  3ZOB A;  2EZH A;  4MFD A;  2L7F P;  2NS7 A;  1JT0 A;  2R5Y B;  1JKP C;  2HOS A;  3UKG A;  1QVT A;  3HB9 A;  1B72 A;  2YS9 A;  1CQT A;  1Y1V J;  4C3J J;  2NVT J;  4W1U A;  2B63 J;  2R5Z A;  1MH3 A;  1U9O A;  3M3Y J;  2DJN A;  2E1O A;  3CMY A;  1ETY A;  5FKK A;  5IYB J;  1H8A C;  2R0Q C;  2L0K A;  3BG3 A;  2AO9 A;  1LE8 B;  4DW6 A;  4A3J J;  2E2J J;  1JUM A;  5EGO B;  3H0G J;  3S1Q J;  1P7I A;  1WCM J;  2X6O A;  1HCR A;  3S16 J;  3JRH A;  4AC0 A;  5GPC A;  4XRS G;  3WHC A;  1GVD A;  1POG A;  5IYD J;  4BBR J;  5FKO A;  3B6C A;  5C4J J;  2GM4 A;  5EZG A;  5J1U A;  1MBJ A;  3BR0 A;  1UMQ A;  1ZTR A;  2ME6 A;  1VND A;  1BA5 A;  2XB5 A;  3DEW A;  3HGG A;  1IUF A;  4CYC B;  1RKT A;  2AHQ A;  3BQZ A;  5EF6 A;  3GTJ J;  2JA8 J;  1NK3 P;  3BR1 A;  2NS8 A;  3G1O A;  4JYK A;  1H88 C;  4UUS B;  4UUT A;  1HDP A;  3S17 J;  4DYQ A;  2OF7 A;  3BR5 A;  2R5Y A;  1MBF A;  3JRB A;  1OJL A;  4FCY A;  4X1E A;  2QF7 A;  1U78 A;  2L7Z A;  1ITY A;  2EZL A;  1TWC J;  2CUE A;  2CRG A;  1FTT A;  3HM5 A;  1IGN A;  1B8I B;  3IH2 A;  1FIA A;  1IG7 A;  3BR3 A;  4IEJ A;  1FJL A;  4A3I J;  3HBL A;  2XSD C;  3HGY A;  2O7O A;  4AYB N;  5HOD A;  3BTL A;  1K61 A;  5EZH A;  2TCT A;  2WAQ N;  5F08 A;  1HOM A;  4D5F A;  1ZGW A;  4BXX J;  2DA7 A;  4A3K J;  3LNQ A;  3GTK J;  1S7E A;  3FK7 A;  4B1R A;  3ZQC A;  1ETK A;  4CYC A;  1JKQ C;  2N8G A;  4MO7 A;  1ETW A;  1UHS A;  3K7A J;  1A6I A;  4V2G A;  3BTC A;  3G1L A;  5FLV A;  5K7Z A;  1WH5 A;  2LP0 A;  2K9Q A;  3OSF A;  2X9D A;  3HKZ N;  3Q0W A;  3S1M J;  1Y1W J;  1FEX A;  2XGD A;  4FIS A;  5FJ8 J;  2XPV A;  1SFO J;  4DYR A;  2HI3 A;  2O8K A;  3S1R J;  5J3L A;  2DA2 A;  3Q3S A;  5E3L A;  2CU7 A;  4A3B J;  3LSR A;  1GV5 A;  4DZJ A;  3H3V K;  1SAN A;  4A69 C;  3S15 J;  2M9H A;  2FX0 A;  1F36 A;  1JUP A;  4M3G A;  1B8I A;  5EEA A;  2HYJ A;  4MIM A;  1BW6 A;  4V2F A;  3SFI A;  1FTZ A;  3TED A;  4JX5 A;  5M3M J;  1APL C;  4QIW N;  3S2H J;  3C2B A;  4G12 A;  4B3A A;  1VFC A;  2JA5 J;  5GP9 A;  3A02 A;  4A93 J;  4S0H B;  2XB0 X;  1W0U A;  3BQY A;  5IP7 J;  3LSG A;  1AKH B;  2EBI A;  3VPR A;  1IJW C;  5DS9 A;  4M3D A;  1QPI A;  2CQX A;  2Y31 A;  3FIS A;  4A3C J;  1X58 A;  3ZQI A;  3ZQL A;  1PUF B;  2HOT A;  2FD5 A;  3OSG A;  3HOV J;  3HOY J;  2DMQ A;  5M5X J;  1TC3 C;  5BNG A;  1WI3 A;  2Y0S N;  3BTJ A;  1MNM C;  5K7H A;  2DA4 A;  5EG0 B;  3S14 J;  2EZK A;  5JLW A;  5E3N A;  1MSF C;  1BL0 A;  5IOY A;  3MN2 A;  5C44 J;  1YRN B;  1TWH J;  1IDZ A;  1MH4 A;  1ETX A;  2NVX J;  1GT0 C;  4W97 A;  2ID3 A;  1IRZ A;  1U9N A;  1IDY A;  3PO3 J;  3JRI A;  3WHB A;  2LK2 A;  2HQ5 A;  3JRA A;  3FIW A;  4QTR A;  3O8H A;  3SDG A;  3RZO J;  1MBH A;  4IHW A;  2VPR A;  3K2A A;  5IOZ A;  3GTL J;  1UG2 A;  2LLK A;  3QPL A;  4XRS A;  4M3B A;  2ZB9 A;  1TWG J;  3HEF A;  3HOW J;  1XC5 A;  5FLM J;  2E2H J;  5C4X J;  3GTQ J;  4C3I J;  3HDD A;  2MGQ A;  2QCO A;  2YU9 J;  3DCF A;  2W48 A;  2NVQ J;  3PM1 A;  1G2H A;  1NK2 P;  4JX6 A;  2LY9 A;  1AKH A;  3MKL A;  2NOG A;  3JRG A;  3HOU J;  1Z77 A;  2K9N A;  1H89 C;  3I4M J;  3ZQF A;  3HOX J;  3O8G A;  3GTP J;  1RR7 A;  1PUF A;  2LD5 A;  1BW5 A;  2DA3 A;  2GBY A;  1R9T J;  2DMN A;  2G0E A;  5F0C A;  4DYC A;  4M6V A;  1LE8 A;  3S2D J;  3IH3 A;  1WGX A;  2CJJ A;  5EGO A;  1QVU A;  1IV6 A;  2K40 A;  4BBS J;  4C2M J;  4ABZ A;  1HDD C;  5M5W J;  1JTY A;  3A03 A;  2JA6 J;  1JTX A;  3GTO J;  4BY1 J;  3RQI A;  2XGE A;  3JR9 A;  4Y52 J;  2Y2Z A;  4A3M J;  5J1R A;  3M4O J;  3I4N J;  2ECB A;  2Y30 A;  2LR8 A;  2Y9Z A;  1BJZ A;  2WB1 N;  1AU7 A;  2D5V A;  3OOU A;  2IBD A;  2PMZ N;  3CCY A;  2GLO A;  4UUS A;  2TRT A;  5EYR A;  4GFB A;  2M2E A;  1I50 J;  1B72 B;  1AHD P;  1XG1 A;  3MVP A;  3B6A A;  2JJ7 A;  5IP9 J;  1OCP A;  4A3L J;  9ANT A;  1TWA J;  5IP6 A;  4HNV A;  4RBO A;  1JJ8 C;  1W0T A;  2L9R A;  2DA5 A;  3ZQH A;  3QPS A;  2X48 A;  4EEF G;  2EQR A;  5DTD A;  4MFE A;  1MBE A;  1ORK A;  2DMP A;  2LVS A;  2VKE A;  2HOA A;  1X2N A;  2I10 A;  2WV1 A;  3BR2 A;  1MSE C;  1HLV A;  1JKO C;  2M34 A;  2MSY A;  2CUF A;  2H1K A;  4FE7 A;  3JRE A;  3CQZ J;  2XGC A;  2VUM J;  4I76 A;  1RKW A;  5F0F A;  5FKL A;  2ID6 A;  2EZI A;  4BKX A;  1OCT C;  4Y7N J;  2MG4 A;  5IYC J;  1ETO A;  1WPK A;  1DU6 A;  3RKQ A;  2DA6 A;  5E3M A;  1ZK8 A;  1X2M A;  2LKX A;  5GPA A;  2DTZ A;  4JP0 A;  4MLO A;  1MBG A;  1IC8 A;  4NDL A;  3CDL A;  5M5Y J;  3LOC A;  1T33 A;  5M3F J;  4D5C A;  1RES A;  5J1Y A;  4FTH A;  1JT6 A;  5FKM A;  3SJM A;  2VI6 A;  4A3F J;  1T56 A;  3FKI J;  4D7M A;  1ENH A;  3Q0U A;  4XRM A;  1DU0 A;  1GV2 A;  4BY7 J;  5F1J A;  3RZD J;  3L1P A;  1XS9 A;  1WH7 A;  3GTG J;  2HXI A;  1NTC A;  1JJ6 C;  1EF4 A;  3JRD A;  1QRY A;  2XRL A;  2M0C A;  4IHY A;  3Q0V A;  1TWF J;  2JK3 A;  3A01 B;  2R7Z J;  4M3E A;  5JLX A;  3OIO A;  4AUX A;  2XPW A;  3BTI A;  3JRC A;  2FQ4 A;  5F0H A;  3TP3 A;  4QSH A;  1ETQ A;  2NVY J;  4JX4 A;  2XPU A;  3JRF A;  1JGG A;  1ETV A;  2OPT A;  5IPA A;  1OFC X;  1GDT A;  3W6V A;  2JMW A;  3TW7 A;  4C3H J;  1O4X A;  1JKR C;  1D5Y A;  1VI0 A;  3E7L A;  2FJ1 A;  1F43 A;  4M3F A;  1ZR4 A;  1LFB A;  2O9L A;  1I3Q J;  5F27 A;  2M8G X;  5EG0 A;  1MBK A;  2K9S A;  3BR6 A;  3D1N I;  2YUS A;  5F04 A;  1P7J A;  2VKV A;  1ZKG A;  2R93 J;  2E2I J;  1YRN A;  2Y9Y A;  5EDN A;  3QQA A;  4A3G J;  4FE4 A;  1ZR2 A;  3BT9 A;  4X6A J;  1Z0X A;  2H8R A;  2KDZ A;  1GUU A;  2E19 A;  2IAI A;  4D7N A;  2RAE A;  2LTP A;  4A3E J;  3PO2 J;  4L5E A;  2JA7 J;  3NAU A;  3IV5 A;  2LFB A;  3G1M A;  3GTM J;  2COB A;  2CQQ A;  2ECC A;  2DMT A;  3TW6 A;  2IEK A;  1E3O C;  2DA1 A;  2L7M P;  5K7F A;  3IH4 A;  3A01 A;  1Q1V A;  2MW8 A;  1A5J A;  1RPW A;  2R5Z B;  2KT0 A;  3NAR A;  4A3D J;  1LFU P;  4IHV A;  1FIP A;  2HDD A;  4RDU A;  2EH3 A;  2HXO A;  3FK6 A;  5E3O A;  3LSJ A;  4XK4 A;  3F0C A;  1JUS A;  2JWT A;  5C3E J;  2R92 J;  4IHX A;  1U8B A;  4XID A; 
#chains in the Genus database with same CATH topology
 2E5Z A;  3BG5 A;  1KQ0 A;  5GAG J;  1IV8 A;  4HLX A;  4IPA A;  3GFI A;  4I6Z A;  1XMK A;  5FKN A;  2W7N A;  2A6H F;  1RET A;  2WAE A;  4BU2 A;  4O3M A;  4CO8 A;  2HDW A;  2F4M B;  2HEO A;  3BZ6 A;  2VBX A;  1I6H J;  3GFL A;  4OU0 A;  3EUA A;  4LMY A;  1UHM A;  2EWN A;  3L00 A;  1DDN A;  3BG9 A;  3E3V A;  1SAX A;  2P81 A;  1GXQ A;  2CV0 A;  1XGM A;  2EZH A;  4OIQ F;  2L7F P;  2NS7 A;  3EPZ A;  1JT0 A;  1JKP C;  3BCB A;  1X1P A;  4ESF A;  1HBX G;  2DOE A;  3M8E A;  5ICE A;  2KIS A;  2W4S A;  4IO9 F;  2R7O A;  1QU3 A;  1CQT A;  4C3J J;  4W1U A;  3HTS B;  5H20 A;  3KYD B;  2R5Z A;  1MH3 A;  2L01 A;  1U9O A;  3M3Y J;  1AOY A;  2E1O A;  5HOO A;  2R7R A;  3ERM A;  3MWM A;  2IXS A;  2XRN A;  5D4R A;  2L0K A;  3BG3 A;  2V79 A;  4C9Y A;  1ZG1 A;  2E2J J;  1FMV A;  2EV6 A;  1E0E A;  3DQV C;  2FQ3 A;  2DO7 A;  2XAQ A;  4EJO A;  2PJP A;  3J81 K;  5LLQ A;  4OMY A;  4HEA 2;  1TTY A;  3KIO A;  1XD7 A;  3B6C A;  3GUD A;  3H3Z A;  3K0L A;  5FKO A;  4BBR J;  5J8F A;  1XCV A;  5J1U A;  1MBJ A;  4P5O A;  3SZT A;  4C2U A;  2HDC A;  1UMQ A;  3NRV A;  4AD9 A;  2ME6 A;  1VND A;  2Z2S B;  2A69 F;  2Q0O A;  3DEW A;  2DQR A;  5HLH A;  1YO5 C;  2JA8 J;  4GCV A;  1NK3 P;  5LD2 C;  2GIV A;  2HPM A;  1EF4 A;  1D0Z A;  3B02 A;  2LC2 A;  5JVG F;  1SD7 A;  3PUF A;  2XKO A;  3G3Z A;  1X4P A;  2EV5 A;  3P7N A;  4LFU A;  1FYK A;  2R7X A;  1HDP A;  3QPT A;  4XKC A;  1IXS B;  2OF7 A;  3R60 A;  4U88 A;  1D0X A;  4NNJ A;  1MBF A;  4M9X A;  1E3P A;  2GWR A;  3KP3 A;  4FCY A;  4I09 A;  1ITY A;  2EZL A;  3VYS B;  2CRG A;  1FTT A;  1BM9 A;  1P4W A;  4IQ4 A;  3WU2 C;  3PQK A;  2LY2 A;  3IH2 A;  3WTZ A;  1IG7 A;  2JPC A;  3BR3 A;  3I55 I;  4PUS A;  4F55 A;  4BEH B;  3HUG B;  2IA0 A;  3ECO A;  3HBL A;  1OR7 A;  4I02 A;  3H9G A;  4UXN A;  2O7O A;  2CQ7 A;  1R36 A;  3BTL A;  3K9T A;  4E7J A;  3V8L A;  2OBP A;  4ZTF A;  2W57 A;  2MC3 A;  5F08 A;  1S9H A;  3K10 A;  2UV1 A;  2Q1Z B;  2CV2 A;  1QPM A;  3VEP A;  5FD5 A;  4BXX J;  1DPU A;  3H5R A;  4A3K J;  1YQA A;  4AVZ A;  4C30 A;  2H27 A;  3FK7 A;  4ZTJ A;  5ICC A;  1VZ0 A;  1WJE A;  2F5D A;  4CYC A;  2DT6 A;  3ZGK A;  2WAQ A;  5E18 F;  1ETW A;  3WU0 A;  2I5U A;  3PNY A;  2HS5 A;  4GGG A;  3BTC A;  1K4S A;  5K7Z A;  3ESW B;  2WC2 A;  1WQ2 A;  3BWG A;  1XX5 A;  2FXA A;  2PMU A;  3S1M J;  3KLN A;  1BI1 A;  2VQG A;  2UXX A;  1N78 A;  4FET A;  4FIS A;  2F4O B;  4BL0 B;  5K5Q A;  3AAF A;  3S1R J;  3WTX C;  5E3L A;  2AQE A;  2DA2 A;  3Q3S A;  5GTH C;  3OYG A;  4A3B J;  4R8H A;  3H3V K;  1SFX A;  3K6G A;  3LMM A;  1FYL A;  4ZDO A;  2DAO A;  2FX0 A;  5E8I A;  2HYJ A;  1Z6R A;  1BW6 A;  3HHH A;  3V42 A;  4KN4 X;  4XOR A;  3TDU C;  2ZBK A;  4A0Z A;  1WFX A;  5DM6 F;  5BMZ A;  3FXL A;  1APL C;  1LUJ B;  4XLE A;  1EJ9 A;  4M71 A;  3DBL B;  4G12 A;  3LA2 A;  2LKP A;  3P9I A;  5GP9 A;  2QEN A;  4K2E A;  2L4M A;  1Z3Y A;  2LG4 A;  1W0U A;  3ZN0 A;  1ZRE A;  5EEG A;  2AXL A;  3FZV A;  4ZH4 F;  4RGU A;  3VPR A;  1B1B A;  2L9V A;  4M3D A;  2L9S A;  1Y8Q B;  1EA3 A;  3R4K A;  4A3C J;  2VOP A;  1A35 A;  4LB6 B;  1PVE A;  2A61 A;  1TNT A;  2FD5 A;  4YIR X;  2DOF A;  2X51 A;  1OQY A;  2VBY A;  5M5X J;  1TC3 C;  2CUJ A;  5K7H A;  2CQN A;  2HR3 A;  3AL0 C;  2JT1 A;  5JLW A;  3F72 A;  4P9U A;  5KHD A;  1D1A A;  1MSF C;  4QPO A;  2R3S A;  4M6X A;  1SVM A;  2AQF A;  1J2X A;  1XSV A;  5ED4 A;  2NVX J;  4LG0 A;  2ID3 A;  5E8G A;  2M0M A;  2BY1 A;  3AL0 B;  2QKM B;  3WHB A;  2E35 A;  3JRA A;  5AIQ A;  3O8H A;  1WVR A;  3SDG A;  4Z6Y A;  1XGN A;  2BEO A;  4A6E A;  4B44 A;  4NC6 A;  2VPR A;  3GTL J;  2LLK A;  3CCU I;  1T98 A;  2ZB9 A;  5CVI A;  1UG0 A;  2OCC H;  3WGI A;  1KQ9 A;  3M07 A;  4BJ5 C;  4QWQ A;  5IY5 H;  2BV6 A;  2W48 A;  1Y56 A;  5DCF A;  4RB1 A;  1I3A A;  1G2H A;  3LFU A;  4JX6 A;  2FMY A;  1T0F C;  2LY9 A;  1AKH A;  4OMZ A;  2Y75 A;  3QP5 A;  1S29 A;  5HS9 A;  4N4N B;  1H89 C;  2K3F A;  3O2P E;  3ZQF A;  2X1D A;  2NOJ B;  4I01 A;  4UVB A;  2GA2 A;  2K85 A;  3FXM A;  2QM3 A;  4FX4 A;  2O5R A;  1PUF A;  3F23 A;  1V54 H;  1T39 A;  1R9T J;  4I98 B;  5F0C A;  2KRC A;  3VFZ A;  3ABK H;  2PFB A;  3VOD A;  2DU9 A;  2P5V A;  1IV6 A;  4BBS J;  4UB8 C;  2R4G A;  1HDD C;  4CIC A;  1LEB A;  3FXR A;  1P4A A;  1EKE A;  4YG2 F;  2XF6 A;  3C1D A;  5L3G A;  4Y52 J;  5K5R A;  5LBQ A;  3ZMS A;  4KIF A;  5J1R A;  5J4V A;  4IOA F;  3H35 A;  4NBQ A;  1V3F A;  4CCK A;  1Y0U A;  2LBF B;  4OIP F;  1RIO H;  3CCY A;  3J7A O;  2Z1D A;  3CCJ I;  4E7K A;  3ZR8 X;  5EYR A;  4GFB A;  2M2E A;  2XHK A;  1B72 B;  1QHG A;  4NC7 A;  5IP9 J;  3VWB A;  2ZME B;  2L5Q A;  5DD8 A;  2P6T A;  2VE9 A;  1W0T A;  2L9R A;  2ESN A;  3IAM 2;  2CFO A;  1PDN C;  4A5M A;  4CCL A;  3F3X A;  2X48 A;  3CUQ C;  4EEF G;  2COM A;  2CQK A;  1P6R A;  2MYS A;  3DBR B;  2LVS A;  3SFZ A;  4BEH A;  1FYM A;  3HUG A;  2WV1 A;  3BR2 A;  1I39 A;  4IHS A;  3RKX A;  3AG4 H;  5K1Y A;  4YEJ A;  4RLF A;  4YII A;  2H1K A;  3E0J B;  3CUQ B;  3KCC A;  4BAC A;  1R4N B;  1RI7 A;  2HTS A;  2XGC A;  4I76 A;  1KU2 A;  2GZW A;  3CP8 A;  5FKL A;  2ID6 A;  2ACJ A;  1W5C C;  1TW3 A;  4DQ2 A;  4Z2Y A;  4L9V A;  4AWX B;  1TW2 A;  2E60 A;  3ZMV A;  1HKQ A;  4DBQ A;  5IYC J;  2MG4 A;  3OS1 A;  2ZXJ A;  1S7A A;  1ZAO A;  1OYI A;  4GYI A;  3R6S A;  3IWZ A;  3VOE A;  1ZK8 A;  4DJA A;  4EM2 A;  4HLY A;  2D1V A;  2HNH A;  1Y8R B;  3CLO A;  3ZPL A;  3RPQ A;  2DTZ A;  4JP0 A;  4UB6 C;  2DK5 A;  3HJE A;  4NDL A;  3LFK A;  2F2E A;  1ZG3 A;  2STT A;  2JSC A;  3H92 A;  1WRJ A;  3F6O A;  5J1Y A;  1JT6 A;  3A0B C;  3CD6 I;  3N4M A;  1QO0 D;  4E6K G;  4LJZ F;  3OYI A;  2TDX A;  4D7M A;  4LIT A;  1R5H A;  4B3X A;  2GOM A;  4XRM A;  3OIQ A;  3BRO A;  3L1P A;  2R7V A;  2ADU A;  2HXI A;  3CCQ I;  3RPU D;  2KIF A;  4A12 A;  3V8K A;  2M3A A;  3ABU A;  4C2T A;  2X85 A;  1PJR A;  2KZG A;  1BIA A;  1YW7 A;  2YPR A;  2BBY A;  3BPX A;  4N9I A;  3MAJ A;  3QP6 A;  2Y48 A;  4UNO A;  1P92 A;  1FC3 A;  2L02 A;  2F5E A;  3QRF F;  2JVG A;  4XOT A;  2XPW A;  1R5G A;  5DYM A;  3JRC A;  2R7S A;  3K4K A;  2V1X A;  2ELH A;  3JRF A;  3Q5F A;  3RPU A;  5IPA A;  1GDT A;  3FMS A;  3Q9V A;  3W6V A;  1J9I A;  2JMW A;  3TW7 A;  1FOW A;  2KJC A;  3DKX A;  3CJT B;  1HKT A;  1JKR C;  1JE8 A;  3OYF A;  3WOD F;  1ZR4 A;  4GDF A;  1I3Q J;  3I3L A;  1YS6 A;  3OOP A;  4CZZ A;  5LRS A;  2IT0 A;  4LK1 F;  3DKW A;  2DYS H;  1Z6T A;  3WTV C;  2MBF A;  3RKY A;  2XF7 A;  4HBL A;  4HX4 A;  1H9T A;  2E1M C;  4PCQ A;  3I64 A;  3HG9 A;  1U0J A;  2HVS A;  3QQA A;  4FE4 A;  2DFF A;  1RC9 A;  4X6A J;  1Z0X A;  2H8R A;  2KDZ A;  3H5A A;  4G7Z F;  2RNG A;  1DGR M;  1YYV A;  4HYE A;  4D7N A;  3H3U A;  3PO2 J;  5ILV A;  3J7Z I;  4ESJ A;  1B6A A;  2B9S A;  4Y33 A;  4ENJ A;  2RC4 A;  2MA3 A;  2ECC A;  2DMT A;  3CF5 F;  3DEE A;  2F5V A;  3KZY A;  1GHC A;  4RM2 A;  1Q1V A;  4UV9 A;  2R5Z B;  2X4H A;  2E7W A;  4YFN F;  4HA8 A;  5KAI C;  5CJ9 A;  5ICG A;  2R7U A;  3H5N A;  3NAR A;  4A3D J;  4IHV A;  3WGH A;  4ZYE A;  4PJL A;  4CHU A;  2EH3 A;  1OCC H;  4JBA A;  5HLI A;  3LSJ A;  4XK4 A;  3FKJ A;  4KFC A;  2JWT A;  5C3E J;  3MKY B;  1GXP A;  1CF7 B;  2XSJ C;  3C7J A;  4IHX A;  2L7K A;  4UVC A;  4XID A;  2CUZ A;  2K86 A;  4OAZ A;  1YOV B;  3TOB A;  3PIP F;  1LDJ A;  1HSJ A;  2JN6 A;  3KZZ A;  4LLL A;  1NG7 A;  3RSN A;  1VQK I;  3MFK A;  2NNN A;  2DN0 A;  1J7K A;  3LQQ A;  4O6J A;  1T6S A;  1RNL A;  2ME0 A;  2QZ8 A;  2ZJQ F;  3PQJ A;  4J19 A;  4B4C A;  1P2F A;  4IJA A;  3CF2 A;  4UHT A;  2QSH X;  1G3T A;  2XKP A;  4PDK A;  4LGW A;  3WG7 H;  4XIC A;  1TNS A;  3ZOB A;  4MFD A;  2Y0M A;  3CDH A;  4G94 A;  4HV5 A;  2NVU B;  3MCZ A;  2IW5 A;  3QOE A;  3HB9 A;  4I0A A;  1B72 A;  2HQA A;  3ZMZ A;  4XOP A;  2ZME A;  1SFE A;  4XON A;  2L4A A;  4EV0 A;  1X3W B;  4O5V A;  3VYT B;  3CMY A;  3VSK A;  1SC7 A;  5F6F A;  1U8R A;  3ASN H;  4OWR B;  2R0Q C;  2Z5U A;  4A3J J;  2EFQ A;  3S16 J;  2ICW G;  4E7L A;  3JRH A;  3WE3 A;  2HZT A;  4II2 A;  2ZC2 A;  5IT9 Z;  5DEQ A;  3U1K A;  4KMU X;  2VC0 A;  2JRM A;  3K69 A;  3QU6 A;  1GLN A;  4LG3 A;  2NYX A;  3SZP A;  1MGT A;  4XNF A;  4XKB A;  3M7G A;  2VOO A;  1V5E A;  3IUO A;  2LY1 A;  4XSZ F;  5KAF C;  4HZF A;  4BJ6 C;  2FE3 A;  3H1C A;  3NQO A;  1O57 A;  1IUF A;  2YSR A;  3F9K A;  4CYC B;  4ASN A;  1RKT A;  3GTJ J;  3TOA A;  3CCL I;  3PUB A;  3BR1 A;  3QYF A;  4HQE A;  3G1O A;  3CCR I;  4HNU A;  2VBW A;  4F92 B;  3OIP A;  4MQ9 F;  2ZO4 A;  3U2R A;  2HQN A;  3HZJ A;  3S17 J;  1FOY A;  2EIK H;  3HRS A;  6PAX A;  5DV5 A;  1A6Q A;  4F52 A;  3HPH A;  1U78 A;  1HC8 A;  2L7Z A;  5B5E C;  3LSM A;  3V4G A;  1TWC J;  4IX7 A;  3CO6 C;  3KET A;  2BY0 A;  2ESH A;  4Q5S F;  2P8T A;  1FIA A;  4BE2 A;  2DDB A;  4IEJ A;  1FJL A;  2FBK A;  2KZV A;  3GEZ A;  3G71 I;  2XSD C;  1PP7 U;  3E6B A;  4AYB N;  1XSX A;  1K61 A;  4BHC A;  5EZH A;  1USS A;  5HLT A;  1ZRC A;  2DYR H;  3S3N A;  1MKM A;  2L9N A;  4D5F A;  1ZGW A;  2FU4 A;  4CDG A;  1DP7 P;  4PJN A;  3GTK J;  1IRG A;  2RN7 A;  1ETK A;  4BQA A;  3IL2 A;  1BR4 A;  1JKQ C;  1IRF A;  4XRF A;  2FML A;  2JUC A;  4S04 A;  3OYE A;  1A6I A;  4V2G A;  3IWF A;  1WH5 A;  1WI9 A;  2LP0 A;  2QQA A;  2E34 A;  4XKV A;  4AU7 A;  4QLC U;  3HKZ N;  4KDP A;  4EMS A;  1Y1W J;  3D5L A;  5EJC A;  5J4Y A;  1V5G A;  5CPR B;  4UVA A;  3L2U A;  1QA6 A;  1B9N A;  2DFH A;  2P0W A;  2PG4 A;  5B3S H;  2CU7 A;  2IS4 A;  1VQ7 I;  2P4W A;  4U7D A;  1D1C A;  4A69 C;  3S15 J;  3ZMU A;  1M1E B;  1HKS A;  4M3G A;  2YX7 A;  1B8I A;  3HIF A;  3JSO A;  1G8X A;  4MIM A;  2A6E F;  5CLS A;  1FTZ A;  3TED A;  2OC6 A;  2G7U A;  4BQN A;  4QIW N;  4Y17 A;  4WF2 A;  2WBM A;  2QWW A;  2YR2 A;  4ZDL A;  4EJV A;  4A93 J;  3BQY A;  1DGW Y;  2IRF G;  2HYF A;  1AKH B;  1ZRD A;  1IJW C;  2BZT A;  5BS6 A;  4BE0 A;  2XAU A;  5FRO A;  3HOS A;  1WHU A;  2OA4 A;  2B7E A;  4N0B A;  1X58 A;  1U2W A;  4EJU A;  1XGS A;  3E6C C;  1PUF B;  1R1T A;  1HW5 A;  3HOV J;  2ZJR F;  3GCM A;  2DMQ A;  5DUK A;  3FHZ A;  1YHQ I;  2V4J C;  3KEQ A;  1Z7L A;  3DLL F;  2H8W A;  1A04 A;  2GXB A;  5EG0 B;  2M7A A;  2K27 A;  1K4T A;  1CF7 A;  1UB9 A;  5IOY A;  1DQU A;  2EFO A;  3K4M A;  3MN2 A;  5C44 J;  2LRE A;  2ZFU A;  2BY2 A;  3HYI A;  2NXN B;  3EUK L;  5D6F A;  3M9A A;  4W97 A;  2WTE A;  1F5T A;  2Y0S A;  1IDY A;  3PO3 J;  1Y0N A;  2G7H A;  5TIS C;  1YJN I;  3CP2 A;  3JRI A;  4CA0 A;  1U6G A;  2VC1 A;  1MBH A;  3V7C A;  2AS5 F;  3DF8 A;  2KQR A;  4XRS A;  4M3B A;  1TQM A;  1TWG J;  3D0S A;  2P7C B;  3KP7 A;  4E4H A;  2GIZ A;  5C4X J;  3KP2 A;  3GTQ J;  4FQG A;  3RDI A;  1FX7 A;  4KA4 A;  3T5X A;  3J7A Y;  1ON2 A;  3PM1 A;  1XMX A;  1IN8 A;  2M45 A;  5HNF A;  2OCE A;  3P9C A;  1IN5 A;  2P6S A;  3WGG A;  1RR7 A;  1MMD A;  3OWT A;  3DPT A;  4MQV A;  4RMN A;  4CUG A;  2ZNZ A;  2GBY A;  2DJI A;  3R61 A;  2Z33 A;  4LK0 F;  4DYC A;  1D0Y A;  1ZLJ A;  1WGX A;  2CJJ A;  1QVU A;  4A0X A;  3H0D A;  3A1Y A;  2K40 A;  1E17 A;  2RGV A;  3EYY A;  2ZJP F;  4S05 A;  2XDV A;  4ABZ A;  4G8X A;  3B73 A;  5HS8 A;  4IHT A;  2JA6 J;  5H2F C;  2ZKZ A;  3LSK A;  3KEO A;  4BY1 J;  3RQI A;  1TLH B;  2ETH A;  4KUM A;  4HRI A;  2QQ8 A;  1YFH A;  1SEU A;  4A2U A;  1G3W A;  5D6E A;  1D3Y A;  4L9N A;  1R22 A;  2LF8 A;  4RAG A;  3ML6 A;  4BDZ A;  5B1A H;  2ECB A;  4IRG A;  3ZQQ A;  2Y30 A;  4IF4 A;  4XL9 A;  2Y9Z A;  3LA3 A;  2HWV A;  1S5L C;  1T95 A;  4PGG A;  2D5V A;  3OOU A;  2JRT A;  1BC7 C;  2VPL A;  2X1C A;  2GLO A;  2Z16 A;  3F6V A;  1AHD P;  2XAS A;  3MVP A;  1OCP A;  2R7Q A;  2IS2 A;  1G3Y A;  4A3L J;  1UHW A;  2VJ4 A;  4RBO A;  3I71 A;  2DDA A;  3IHU A;  2RV8 A;  1ACI A;  4NQW B;  4XQF A;  3M1E A;  4M9S A;  5E20 A;  2LKS A;  3BLY A;  3IAS 2;  4ZZL A;  3PFY A;  4MFE A;  2H6B A;  2W82 A;  2PMH A;  2DMP A;  2VKE A;  1JHF A;  2I10 A;  1V5F A;  4U0Y A;  1HLV A;  1MMS A;  1RUN A;  2BVL A;  2PX9 A;  2MSY A;  2FEZ A;  4ANJ A;  3CQZ J;  1TT0 A;  4BH9 A;  1VTN C;  1IXR C;  2RNJ A;  4KT6 A;  2R7W A;  3I9V 2;  2A5Y B;  3ZRG A;  1V55 H;  1W5S A;  4Y15 A;  5L3B A;  2K5C A;  3BDD A;  2GA1 A;  4PSW A;  5FD6 A;  3L2Q A;  4BDY A;  1XPX A;  1WPK A;  2RQP A;  3WU1 B;  3JW4 A;  2NS0 A;  1ONV A;  2VOD A;  5GAD J;  3RYR A;  1X2M A;  2LKX A;  4KIG A;  5GPA A;  2E36 A;  1J75 A;  1R6R A;  1MDM B;  1IC8 A;  2P7V B;  3KX2 A;  2GXG A;  5M5Y J;  5ILS A;  5M3F J;  4D5C A;  4L0Y B;  1W7P D;  2XVC A;  3GLX A;  3P9K A;  2VN2 A;  3VSL A;  5FKM A;  2VI6 A;  2L3D A;  4IOC F;  4A0Y A;  2FA5 A;  1ENH A;  5IT9 K;  2KKO A;  3K4J A;  3Q0U A;  3WTY C;  4JQF A;  3RZD J;  1LB2 A;  3RJP A;  1XS9 A;  3SZG A;  5CKT A;  3DTI A;  1HW2 A;  3DTE A;  3KYL A;  1WWX A;  3OMY A;  1Z21 A;  2W84 A;  3LAP A;  2VAS A;  2I8D A;  2MH9 A;  4CXF A;  1A36 A;  2X0L A;  1D8K A;  1XN7 A;  2BHZ A;  3CME I;  1IXC A;  1AWC A;  3BJA A;  2M0C A;  2XF5 A;  3MZY A;  2K9M A;  3PNT A;  4HPQ A;  2CSO A;  2DI3 A;  3FMR A;  4L18 B;  2R7Z J;  5LEJ A;  3GF2 A;  3OYA A;  2W1O A;  2O61 A;  1OPC A;  3EUH A;  1IN6 A;  5F0H A;  2OAZ A;  3C3W A;  3C2H A;  3AG1 H;  5ILU A;  3C18 A;  4PGH A;  5ICF A;  1YIT I;  1LJ9 A;  4BE1 A;  4HDV A;  2UWM A;  3GWZ A;  4FHT A;  4MHG A;  3CC7 I;  5D8K B;  2HKO A;  3BP8 A;  3HSR A;  4WX9 A;  4H4K C;  1TZL A;  1D5Y A;  4L9J A;  3ERE D;  3HRM A;  2F48 A;  2O9L A;  4AM3 A;  5EG0 A;  1MBK A;  1SD6 A;  1BN5 A;  3BR6 A;  2LF7 A;  1LFP A;  3KE2 A;  1P7J A;  1DPR A;  2XRO A;  2FF4 A;  3JAM K;  1FY7 A;  4RGR A;  3K4B A;  4ZYH A;  1F9N A;  2WY7 Q;  5FB2 A;  1XMA A;  4A3G J;  1MNE A;  4RM3 A;  2E19 A;  2IAI A;  4G6D A;  1VQP I;  2FNP A;  2RAE A;  4EVI A;  3MZH A;  1MD0 A;  2JA7 J;  4F91 B;  2ZME C;  2FBH A;  5KVR A;  4ENM A;  3FM5 A;  3ROU A;  1LVK A;  4MGR A;  1YX3 A;  3GTM J;  1LQ1 A;  3IRR A;  2CQQ A;  4EAT A;  1STZ A;  3TW6 A;  2IEK A;  1E3O C;  2OQR A;  1ZHF A;  2VKH A;  3NEU A;  5HDG A;  3A01 A;  2BW3 B;  5KCM A;  2MW8 A;  1A5J A;  5JHU A;  1RPW A;  4AYB A;  3W2A A;  2P5L C;  1IZ1 A;  2KIU A;  3V7S A;  4XLF A;  1LFU P;  1LDK B;  4RDU A;  2HDD A;  1KU3 A;  4D9J A;  3KYC B;  4E7Z A;  1U5T B;  3QAH A;  4FAS D;  1ZN2 A;  5CVU A;  4HX7 A;  3QWL A;  3ZXS A;  5DCM A;  3F0C A;  1JUS A;  3RYP A;  4HF0 A;  2HTJ A;  2WY8 Q;  2QQ9 A;  4BXU A;  2LMD A;  3HXL A;  1IAW A;  1X1B A;  1B59 A;  1R58 A;  4NHJ A;  1LKX A;  3N97 A;  1VF9 A;  1YS7 A;  1HQC A;  4ZYD A;  3S1N J;  3S93 A;  3A0H C;  3GLL A;  1OLT A;  5GAH J;  1HF0 A;  3FMQ A;  2HFH A;  2M8E A;  3MMY B;  2R7F A;  3BZK A;  1V4R A;  2KIQ A;  5D5W B;  4HAM A;  4RAZ A;  3ISP A;  1I6X A;  5FO5 A;  3D5R C;  3TP0 A;  2L54 A;  3T1B A;  1T2K A;  1C0W A;  1L0O C;  2KPM A;  3K4L A;  3T8R A;  2HOS A;  3UKG A;  2E71 A;  4XLA A;  3KFW X;  3LST A;  1QVT A;  3V7R A;  1LDD A;  3OYM A;  3E5U A;  4CCM A;  1AA7 A;  2YS9 A;  3CUO A;  3ZCO A;  2NVT J;  4Y3O A;  4F93 B;  3FF5 A;  3UNG C;  2B63 J;  5A2Q Z;  3A4C A;  3T0Y A;  1XSD A;  1ETY A;  4KIC A;  5FKK A;  5IYB J;  4ON0 A;  1UAA A;  1H8A C;  3OL3 A;  3PNV A;  4NQW A;  2H1L A;  3QYB A;  1T8I A;  4DW6 A;  2EPF A;  2LRD A;  4YFX F;  4PFP A;  3CCM I;  4V19 K;  1HCR A;  2FOW A;  4ETS A;  4AC0 A;  4PSX A;  3L2V A;  2JQ7 A;  3ELK A;  3OR2 C;  1POG A;  2BOL A;  3RTR A;  3HC7 A;  4N9H A;  1R49 A;  4ENN A;  2GM4 A;  1N75 A;  3BR0 A;  2EK5 A;  1B4A A;  3E6D A;  1ZTR A;  4HF2 A;  4B8X A;  3MD2 A;  2LH9 A;  4CCO A;  1BBY A;  3OYC A;  3OYN A;  3HGG A;  3PSF A;  2NS8 A;  5JI6 A;  4F7Z A;  1G59 A;  2PI0 A;  4IRH A;  2DK8 A;  3KLO A;  4GRI A;  4UUT A;  2K9L A;  1CGP A;  3S3M A;  2M4G A;  1I1S A;  4DYQ A;  3BR5 A;  1MDM A;  4P1W A;  1OCO H;  4ENK A;  2R5Y A;  5GTI C;  1OJL A;  3JRB A;  5FLX Z;  1U3E M;  4MEY F;  3DWL E;  2CUE A;  2WAF A;  1IGN A;  3IRQ A;  1B8I B;  5HS7 A;  2A3S A;  4IRI A;  1G6N A;  1LNW A;  2F4I A;  3FHN A;  4A5N A;  2VLA A;  1GVJ A;  3QU3 A;  1ON1 A;  5IT3 A;  1R23 A;  3HGY A;  3PJR A;  3L9F A;  4XLN F;  1G4D A;  2Q2E A;  2TCT A;  5BPD A;  1YG2 A;  2WAQ N;  3BG6 A;  3L2R A;  4R1H A;  5HVQ C;  1J5Y A;  4M6Y A;  2OU2 A;  3WTW C;  1ODD A;  2XAF A;  2Z3Y A;  5LGT A;  1PP8 F;  2DA7 A;  4KIT B;  1S7E A;  4EQQ A;  3KP5 A;  4KIB A;  1BC8 C;  3FWE A;  1ERD A;  3O6B B;  4PFO A;  3D5S C;  1FBS A;  1UHS A;  2MH2 A;  3K7A J;  2F5C A;  3ABL H;  3W3C A;  3QPH A;  2CO5 A;  3OSF A;  2V9V A;  1KU9 A;  3C2G A;  2STW A;  1VQ4 I;  5DD4 A;  3I58 A;  3OY9 A;  1T08 B;  2PQ8 A;  2JUG A;  1WKM A;  1SFO J;  4DYR A;  2XIG A;  4L9T A;  2H6C A;  4EM1 A;  1BJA A;  2O8K A;  5FGM A;  3OYL A;  2EFP A;  3WTS C;  4II3 A;  1GV5 A;  4DZJ A;  2EFN A;  4U0V A;  2LDU A;  2M9H A;  1ZLK A;  4IVN A;  4V2F A;  2WAD A;  3RQ4 A;  3SFI A;  3U1D A;  3TL4 X;  1VQO I;  4CCN A;  2MD5 A;  2V6E A;  2PBI A;  3CCV I;  1O3S A;  5E1W A;  1JGS A;  4TV7 A;  5LHG A;  2Z99 A;  3S2H J;  3C2B A;  3SYT A;  1MJA A;  3OS0 A;  1VFC A;  2JA5 J;  4I99 C;  2EA4 A;  3ECH A;  2ZXI A;  4RGX A;  2XB0 X;  4AIH A;  1ZGA A;  3LSG A;  4YFK F;  4XLP F;  2EBI A;  4E7S A;  1OR7 C;  2ZNY A;  2RQQ A;  2DTR A;  2QVO A;  2K02 A;  5DS9 A;  1UEL B;  2V7F A;  2BW3 A;  2Y31 A;  1DUX C;  4WK8 F;  1F4K A;  3ZQI A;  2J5O A;  3ZQL A;  2OUM A;  2HOT A;  2IGN A;  1OYY A;  2O03 A;  2IVM A;  3HOY J;  2JVH A;  5BNG A;  1WI3 A;  4ZYA A;  2DA4 A;  1U5T A;  4RGS A;  2EZK A;  5E3N A;  4IQJ A;  4ZJZ A;  4B09 A;  3OYH A;  3J80 Z;  1YRN B;  3DU5 A;  3QYE A;  1IDZ A;  1MW7 A;  1ETX A;  4HDU A;  4IXA A;  4N4O B;  4NC8 A;  1QZZ A;  2EV0 A;  2A05 A;  2OTL I;  1MND A;  2LK2 A;  2DT7 B;  3FIW A;  4QTR A;  4CH7 A;  1E3H A;  3BCA A;  1SFK A;  3H9J A;  4ZZD A;  3CCE I;  3GZN B;  4IHW A;  1MMN A;  1KYW A;  5IOZ A;  1UFM A;  1RUO A;  1KQ8 A;  1UG2 A;  4U7B A;  4DOZ A;  2E1C A;  2VXZ A;  4CGZ A;  3LQR A;  4P9F A;  4OIO F;  2DBB A;  3HOW J;  2XGX A;  4YRV A;  4RLQ A;  5FLM J;  2E2H J;  3HRU A;  1ULY A;  4ITV A;  2KIM A;  1WZ2 A;  2MGQ A;  2QCO A;  2YU9 J;  3L2W A;  3DCF A;  4XKW A;  3S3O A;  2NVQ J;  4BQO A;  1FBU A;  1SVO A;  4DNC A;  1QBJ A;  1NK2 P;  1O3T A;  3MKL A;  3JRG A;  3HOU J;  2DCE A;  5J40 A;  1O7L A;  3I4M J;  3HOX J;  1FOK A;  2R7T A;  1MIJ A;  2VQC A;  2IGM A;  1BW5 A;  2DA3 A;  3U9G A;  2BY3 A;  2KLO A;  2G0E A;  3PFI A;  3IC7 A;  3ZQ7 A;  2EFW A;  2CYY A;  4PJJ A;  1IW7 F;  4M6V A;  3S2D J;  3IH3 A;  4LIV A;  3AFH A;  3E5X A;  3HRT A;  3PIO F;  2IPQ X;  2QQB A;  2HGC A;  4C2M J;  3JAM Z;  3FX3 A;  1FWZ A;  2X6X A;  2KP6 A;  1JTY A;  3A03 A;  2M4K A;  1JTX A;  1TQP A;  4KJZ A;  2VJ5 A;  2K7L A;  3VYR B;  3OYD A;  2XGE A;  3TO9 A;  3JR9 A;  2FNA A;  2M5W A;  3G2B A;  2HKX A;  4L0Z B;  2O3F A;  3I0T A;  3QOP A;  2QKL B;  1IF1 A;  4MEX F;  1XDU A;  2WA0 A;  4ZDP A;  3RCO A;  2Y2Z A;  3M4O J;  4BYY A;  1KGS A;  3ONQ A;  2RKH A;  1X3U A;  1ZRF A;  2LR8 A;  1K79 A;  1OMI A;  5JR3 A;  2WB1 N;  2FRH A;  1AU7 A;  3I4P A;  3K1N A;  3S8P A;  5J47 A;  2LNB A;  2PMZ N;  3BY6 A;  2TRT A;  4RB0 A;  1YJW I;  3DKY A;  3HPG A;  3ULQ B;  2DPD A;  3LAJ A;  3B6A A;  5AIP A;  4I2O A;  5D5V B;  2QGU A;  2JPB A;  2OD5 A;  9ANT A;  5IP6 A;  3REO A;  4HNV A;  1YX5 A;  3OYB A;  4M74 A;  1JJ8 C;  1OIS A;  2DA5 A;  2NAZ A;  3CO7 C;  1R5I D;  4BHB A;  1HA8 A;  1TP4 A;  1QZY A;  2EQR A;  5DTD A;  4EM0 B;  3GYH X;  3EUH C;  1D8J A;  1ORK A;  2G9W A;  3K70 D;  2HOA A;  1X2N A;  4LIU A;  1W7P B;  3V8J A;  1MSE C;  4I7H A;  4RA2 A;  1N77 A;  1JKO C;  3O3K A;  3LSI A;  3JRE A;  2CS3 A;  4Q48 A;  1P4X A;  3N05 A;  4BXF A;  2VUM J;  1RKW A;  2RVC A;  3E6M A;  1YW9 A;  2CFX A;  1S8N A;  1ZG5 A;  2EZI A;  2HZD A;  2BE5 F;  3ZN1 A;  2QSF X;  1OCT C;  2F6C A;  4Y7N J;  1X1A A;  1ETO A;  5KNL A;  3DU6 A;  1DU6 A;  3RKQ A;  1R71 A;  2DA6 A;  2OQG A;  1IO2 A;  3K2Z A;  2EIN H;  5A2Q K;  3SHF A;  1SD5 A;  2CMP A;  4ESB A;  4MLO A;  4CCJ A;  2VKD A;  2ZXW H;  3LOC A;  1T33 A;  2BVM A;  1RES A;  1RZ4 A;  1Y39 A;  4H0E A;  1WJD A;  3SJM A;  2QEX I;  4GXO A;  2QSG X;  4NB5 A;  4OOI A;  4R79 A;  2KRH A;  4BJT A;  4HOB A;  3HOT A;  1GV2 A;  4BY7 J;  5F1J A;  2PJR B;  1WH7 A;  3GTG J;  3S2W A;  4G6T B;  1NTC A;  5CVJ A;  4XBF A;  4XSX F;  4B47 A;  1VQ6 I;  2E5N A;  3OYJ A;  2DLL A;  1BR2 A;  4X0G A;  2XRL A;  2Z9O A;  3DTK A;  2MLK A;  3OR1 C;  1W1W E;  4IHY A;  3DLA A;  3Q0V A;  3BPV A;  4G7H F;  1TWF J;  4HX8 A;  1FLI A;  3A01 B;  1A31 A;  3OL4 A;  4M3E A;  5JLX A;  1KON A;  3BTI A;  2FQ4 A;  1LPQ A;  3TP3 A;  1ETQ A;  2NRA C;  4KN7 X;  1BIB A;  2OPT A;  5FLX K;  4NUB A;  4LLG F;  4L5J A;  2IS1 A;  5L3D A;  4D0P A;  3FBN B;  3EDP A;  4C3H J;  2QBY A;  3R0J A;  4HF1 A;  1UCR A;  5DCM B;  3F8C A;  1VI0 A;  2H94 A;  2JZY A;  2FJ1 A;  4BAY A;  1F43 A;  1QHH D;  5FFZ A;  3I53 A;  2M7B A;  2EIL H;  2M8G X;  2K9S A;  3D1N I;  3JSP A;  2E7X A;  2VKV A;  2ZSH B;  1ZKG A;  1FOX A;  4JK1 X;  2E2I J;  2DW4 A;  3CLQ A;  4HG2 A;  1YRN A;  5HLG A;  4HNT A;  5EDN A;  2XAG A;  3BT9 A;  3FM3 A;  2O0Y A;  3I59 B;  2K4J A;  1GUU A;  2VT3 A;  2BHY A;  2LTP A;  5BOX A;  1FSE A;  2XAJ A;  4L5E A;  5TJJ A;  5LHH A;  2ISZ A;  4EJT A;  4WXC A;  1SFU A;  4XR6 A;  3IV5 A;  3G1M A;  1YE9 A;  4G7O F;  5LEK A;  3H9Q A;  2RDP A;  1QGP A;  2COB A;  1VQ9 I;  1XGO A;  2HOE A;  2CGP A;  3I5U A;  1W36 D;  3SXY A;  3BG7 A;  2RRE A;  3G4S I;  5K7F A;  1DP3 A;  5HDK A;  1X3Z B;  1K6Y A;  1QQI A;  1B9M A;  2WV0 A;  1Q1H A;  2PN6 A;  1Z05 A;  1VQM I;  2VXD A;  3F8N A;  2ISY A;  3G6E I;  1FIP A;  1OCR H;  2HXO A;  1Z7U A;  3AG2 H;  1R1U A;  4I0B A;  2A68 F;  4U87 A;  2DT5 A;  3TMO A;  3IP4 B;  3U21 A;  3IKT A;  1UZC A;  3GME A;  3K1M A;  2V9P A;  3BC8 A;  5E1Z B;  3VB2 A;  2HQR A;  3WTU C;  2R92 J;  5CQE A;  1U8B A;  3CZ6 A;  4KMF A;  3UR3 C;  4Q47 A;  2KRF A;  1J0R A;  3ZP5 A;  2BXZ A;  3ZQG A;  1L3L A;  2MC4 A;  1YIO A;  3TBI A;  4KNY A;  3HOZ J;  2VQH A;  2IGO A;  5HNH A;  2ZJ2 A;  5LGU A;  4LOC A;  2JTV A;  3LSP A;  4KYW A;  2DMU A;  4DZP A;  2ELK A;  5CQG A;  5L3F A;  2VB6 A;  3NWT A;  3A2K A;  1K83 J;  2QUF A;  1BI0 A;  2HPI A;  2BGC A;  2IP2 A;  4J01 A;  1ZQ3 P;  4RAY A;  3GBG A;  2MLG A;  3MKZ A;  5DUI A;  2R5Y B;  1XB4 A;  2D45 A;  3M8J A;  2GAU A;  2MD0 A;  3GO5 A;  3FBI B;  3TDZ C;  1K6O A;  3CTA A;  3SEQ A;  1Y1V J;  3J80 K;  5EEH A;  3KPH A;  5H6Q A;  1IRX A;  2K3P A;  3FXJ A;  2DJN A;  1X4O A;  2W25 A;  2EA2 A;  5L3C A;  2AO9 A;  1LE8 B;  2HVQ A;  2CWE A;  3IKV A;  1JUM A;  5EGO B;  3H0G J;  3S1Q J;  1P7I A;  4A6D A;  1WCM J;  2X6O A;  2Q2E B;  1KA8 A;  3COA C;  5GPC A;  4XRS G;  3Q9S A;  1Z91 A;  3OS2 A;  3WHC A;  4RB2 C;  1NG6 A;  1W7P A;  1GVD A;  4HSR A;  3BOQ A;  5IYD J;  5C4J J;  1YJ9 I;  5EZG A;  4G9Y A;  3HHG A;  1I1G A;  3MZ8 A;  1BA5 A;  1FPQ A;  3H36 A;  2XB5 A;  1J09 A;  4Y13 A;  1Z9C A;  2AHQ A;  3BQZ A;  5EF6 A;  3I54 A;  3DV8 A;  1OKR A;  1QZE A;  4B48 A;  5E79 C;  3FXQ A;  4YEL A;  4JYK A;  2X1E A;  4UUS B;  1H88 C;  1BI2 A;  3TGN A;  3JTG A;  1Z1D A;  2KL4 A;  3BZC A;  4X1E A;  2QF7 A;  4DBR A;  4PZJ A;  1FSH A;  1YI2 I;  5B1B H;  4KIS A;  3TQN A;  1X1D A;  4HQM A;  1S7O A;  3HM5 A;  4BGD A;  1LEA A;  3L7W A;  3E5Q A;  1YW8 A;  2V9K A;  3FXU A;  2PJR A;  2BXY A;  3EET A;  3KEY A;  2UUZ A;  1FMW A;  4G6Q A;  4A3I J;  2KMU A;  4BS9 A;  1MZB A;  5HOD A;  1SMY F;  4P96 A;  1MJ9 A;  3DP7 A;  1PUE E;  2DOA A;  2DFI A;  4XN3 A;  4E70 A;  5FRN A;  1HOM A;  4JOM A;  3L2C A;  2MFZ A;  1U5T C;  4RAF A;  3TO6 A;  3LNQ A;  2A6T A;  1P9Q C;  1E2X A;  1R00 A;  2VJI A;  4B1R A;  3ZQC A;  2Y69 H;  5F1R A;  3BJO A;  2CW8 A;  2N8G A;  4MO7 A;  5LFA A;  1BI3 A;  5L3E A;  4WXD A;  2CH0 A;  1D1B A;  1Z3X A;  3L09 A;  3G1L A;  5FLV A;  4XN0 A;  2P5K A;  2K9Q A;  4ZC3 A;  2X9D A;  3Q0W A;  4UV8 A;  3ASO H;  3CES A;  3OYK A;  4BUP A;  1FEX A;  3W2V A;  1EH6 A;  2XGD A;  5FJ8 J;  2XPV A;  1OCZ H;  4IKF A;  2HI3 A;  1R7J A;  1W4M A;  2UZK A;  3HL2 A;  3R0A A;  5J3L A;  4WWC A;  2WB1 A;  4WXH A;  3LSR A;  1KU7 A;  1SAN A;  3LWF A;  1TT5 B;  2KHM A;  4XLH A;  2PMZ A;  1F36 A;  1JUP A;  2OV7 A;  3HKZ A;  2ZSI B;  5EEA A;  1FBQ A;  4JX5 A;  2KFD A;  3OV8 A;  3I59 A;  2IS6 A;  5M3M J;  1HST A;  4M9Z A;  3M1C A;  4XMY A;  2OJE D;  2F5F A;  1JHH A;  1NH3 A;  3F8F A;  3K4N A;  4B3A A;  3MQ0 A;  5E1X A;  1XCB A;  3A02 A;  1WJF A;  4S0H B;  5IP7 J;  1W5T A;  1G3S A;  1YLF A;  1FZP B;  1UST A;  2DQL A;  5JVT A;  1QPI A;  2CQX A;  4UUV A;  2V1D A;  3ZMD A;  1HXD A;  3FIS A;  2W00 A;  1ZYR F;  1J59 A;  3K4C A;  1IUY A;  4LB5 A;  3OSG A;  3X2Q H;  2Y0S N;  3BTJ A;  1MNM C;  4OAY A;  1VQN I;  2JSP A;  3SEZ A;  1PYV A;  3S14 J;  1F1Z A;  1WJA A;  1TL8 A;  3T8T A;  1S6L A;  3AKZ A;  1ZEL A;  1BL0 A;  5E17 F;  3GXO A;  3KP6 A;  1UJ8 A;  1TWH J;  1IN4 A;  1MH4 A;  1GT0 C;  1IRZ A;  4M73 A;  1U9N A;  2R7D A;  4PJM A;  3M8F A;  3JCU C;  2VIX A;  2HQ5 A;  3RZO J;  2XAH A;  3W2W A;  2EIJ H;  3J7Y J;  2X6Y A;  2QLZ A;  3DPU A;  3K2A A;  3LL7 A;  4AVP A;  3DFG A;  3FXK A;  3QPL A;  2GQQ A;  5TGT A;  3J81 Z;  1BOB A;  4Q4Z F;  2XC7 A;  3CDI A;  1LVA A;  1FT9 A;  3I56 I;  3HEF A;  3G73 A;  1MJB A;  2M1B A;  1XC5 A;  1XTA A;  2CG4 A;  2DXI A;  4C3I J;  3HDD A;  3QOD A;  2ZFW A;  4BQQ A;  2OZ6 A;  1MMG A;  1Z67 A;  2K4B A;  2NOG A;  2C6Y A;  4MTD A;  1Z77 A;  2K9N A;  2ELJ A;  1RRJ A;  4FX0 A;  2FUG 2;  4HST A;  3SDB A;  3DPL C;  1IN7 A;  4ZYG A;  3O8G A;  3GTP J;  1SMT A;  4FT8 A;  2OTJ I;  3DEU A;  4RS8 A;  2LD5 A;  2YX4 A;  2FOK A;  1K78 B;  3F8M A;  2DMN A;  2PLY A;  1LE8 A;  2ZXH A;  5EGO A;  2W24 A;  1O7F A;  3GW2 A;  1QNT A;  1T38 A;  4CZC A;  1FNN A;  3K70 C;  5M5W J;  1VQ8 I;  2CW0 F;  3S32 A;  5F64 A;  4L5I A;  2D2W A;  3GTO J;  4LD5 A;  2VE8 A;  3GX4 X;  4XLC A;  1FP2 A;  3FXO A;  5K5O A;  2M30 A;  2M87 A;  4A3M J;  2KJB A;  5D5U B;  3I4N J;  5FFX A;  2LSO A;  2UXN A;  4UY8 I;  2E1M B;  1TBX A;  1BJZ A;  1K7A A;  1SVL A;  2IBD A;  4HW0 A;  2VQL A;  4AIK A;  4UUS A;  1I50 J;  5HDN A;  4AIJ A;  1XG1 A;  2JJ7 A;  1H0M A;  3WG9 A;  1TWA J;  1TQI A;  3CJR B;  5LGN A;  2IJL A;  4CYD A;  2V1U A;  1KYZ A;  2O6G E;  2VON A;  3HSF A;  3ZQH A;  3GFM A;  3QPS A;  2CW7 A;  1EH8 A;  2GOX B;  1MBE A;  2FSW A;  3K1P A;  5CVV A;  4E7I A;  2HU9 A;  1T0F A;  4EGY A;  2HVR A;  2MAB A;  1O3R A;  2M34 A;  3KP4 A;  2CUF A;  4FE7 A;  1RR8 C;  1VQL I;  3NWS A;  3EYI A;  3ZMT A;  3WE2 A;  2WWY A;  3MKW B;  5DM7 F;  3RIR A;  1R4M B;  2V6C A;  5F0F A;  1FP1 D;  1X1C A;  4BKX A;  1KZH A;  1EV7 A;  3CCS I;  5DDG A;  2VBZ A;  4OIN F;  4J00 A;  2QBY B;  5AON A;  3ABT A;  3GFJ A;  1NHA A;  4Y4R A;  5D5X B;  5E3M A;  2DFE A;  4RB3 C;  2Q8K A;  3CJQ B;  5BQT A;  1SD4 A;  3WTT C;  4BNC A;  1S72 I;  3KZI C;  2H09 A;  2AXT C;  5LHI A;  1MBG A;  4KT5 C;  2LBF A;  3MEX A;  4MNU A;  3CDL A;  3GZ6 A;  3FDY A;  4FTH A;  2CV1 A;  3CJN A;  4WCG A;  2A5W A;  2E1N A;  1YTY A;  4A3F J;  1T56 A;  1BOA A;  3FKI J;  3TO7 A;  3EQL F;  1DU0 A;  4PK4 A;  5D8L B;  3W6J B;  1OYW A;  3JTH A;  5KK1 A;  1JI8 A;  3AG3 H;  4HV6 A;  2ZCW A;  4EGZ A;  4BHP A;  3P5J A;  2B0L A;  4B43 A;  4IL6 C;  1WJB A;  3DBH B;  1JJ6 C;  3JRD A;  5J8C A;  5GAE J;  2QA4 I;  1QRY A;  1ZAR A;  1SAU A;  1YIJ I;  2DOD A;  2NNY A;  5BPI A;  1X19 A;  4LLN A;  2W85 A;  5TRD A;  5J6X A;  2VJJ A;  2JK3 A;  3ABM H;  3PSI A;  1I5Z A;  3CUQ A;  2JA2 A;  3OIO A;  4AUX A;  1JXS A;  4YIF A;  3F8B A;  4QSH A;  2NVY J;  4JX4 A;  2XPU A;  4XM3 A;  3CC2 I;  1JGG A;  2BYV E;  1ETV A;  4QPQ A;  2IA2 A;  3E1S A;  2VT2 A;  1OFC X;  2FBI A;  1W36 C;  3LSH A;  3HTU A;  4OIR F;  2GXA A;  4F3Q A;  1O4X A;  2XV4 S;  5LRR A;  5H6R A;  1WJC A;  3E7L A;  1BR1 A;  1I27 A;  3TKY A;  4M3F A;  1LFB A;  1S3J A;  2QYO A;  5CYV A;  3GVA A;  2X6W A;  5F27 A;  1ZGJ A;  1O3Q A;  3E97 A;  1VQ5 I;  2PEX A;  2YUS A;  5F04 A;  3CMM A;  4MTE A;  2V26 A;  1N25 A;  1MMA A;  2YU3 A;  2R93 J;  3PL8 A;  2LOO A;  4IZZ A;  2Y9Y A;  3BJ6 A;  4DGW B;  3SQN A;  3LA7 A;  4GYG A;  1ZR2 A;  5CVR A;  2D1H A;  2L2O A;  2IGK A;  3GZ5 A;  3CMA I;  1H9G A;  4A3E J;  3CC4 I;  3DXJ F;  5B66 C;  1XDS A;  2XUB A;  3NAU A;  2HYG D;  5JHF A;  2A07 F;  2LFB A;  4CSW A;  2EIM H;  3F22 A;  1ZH5 A;  2LYC A;  5D4S A;  3VYU B;  1Y6I A;  2DPU A;  2EB7 A;  2VL8 A;  2DA1 A;  2L7M P;  4PJ0 C;  5JFR A;  3IH4 A;  4M72 A;  1WJ5 A;  3RI4 A;  2KDO A;  2O8X A;  2KT0 A;  2IA1 A;  1WSU A;  2J5P A;  3HSE A;  1R1V A;  4P55 A;  3F21 A;  5ERI A;  1REP C;  3FK6 A;  4DIQ A;  5E3O A;  1K78 A;  5FRM A;  4U0W A;  4D1Q A;  2EJR A;  2V1N A;  3RKW A;  3W6K B;  4EJW A;  1HW1 A;  1EH7 A;  4AID A;  2OZU A;  3VDX A;  4E7H A;  4LG0 B;  1D5V A;  4GO1 A; 
#chains in the Genus database with same CATH homology
 3ZQG A;  3BG5 A;  3HOZ J;  1VF9 A;  2JN6 A;  4I6Z A;  3S1N J;  5FKN A;  4LOC A;  1RET A;  3LSP A;  2DMU A;  4DZP A;  1HF0 A;  2DN0 A;  2ELK A;  2ME0 A;  4J19 A;  4B4C A;  1I6H J;  1K83 J;  3BG9 A;  3TP0 A;  1ZQ3 P;  2P81 A;  3GBG A;  4XIC A;  3ZOB A;  2EZH A;  4MFD A;  2L7F P;  2NS7 A;  1JT0 A;  2R5Y B;  1JKP C;  2HOS A;  3UKG A;  1QVT A;  3HB9 A;  1B72 A;  2YS9 A;  1CQT A;  1Y1V J;  4C3J J;  2NVT J;  4W1U A;  2B63 J;  2R5Z A;  1MH3 A;  1U9O A;  3M3Y J;  2DJN A;  2E1O A;  3CMY A;  1ETY A;  5FKK A;  5IYB J;  1H8A C;  2R0Q C;  2L0K A;  3BG3 A;  2AO9 A;  1LE8 B;  4DW6 A;  4A3J J;  2E2J J;  1JUM A;  5EGO B;  3H0G J;  3S1Q J;  1P7I A;  1WCM J;  2X6O A;  1HCR A;  3S16 J;  3JRH A;  4AC0 A;  5GPC A;  4XRS G;  3WHC A;  1GVD A;  1POG A;  5IYD J;  4BBR J;  5FKO A;  3B6C A;  5C4J J;  2GM4 A;  5EZG A;  5J1U A;  1MBJ A;  3BR0 A;  1UMQ A;  1ZTR A;  2ME6 A;  1VND A;  1BA5 A;  2XB5 A;  3DEW A;  3HGG A;  1IUF A;  4CYC B;  1RKT A;  2AHQ A;  3BQZ A;  5EF6 A;  3GTJ J;  2JA8 J;  1NK3 P;  3BR1 A;  2NS8 A;  3G1O A;  4JYK A;  1H88 C;  4UUS B;  4UUT A;  1HDP A;  3S17 J;  4DYQ A;  2OF7 A;  3BR5 A;  2R5Y A;  1MBF A;  3JRB A;  1OJL A;  4FCY A;  4X1E A;  2QF7 A;  1U78 A;  2L7Z A;  1ITY A;  2EZL A;  1TWC J;  2CUE A;  2CRG A;  1FTT A;  3HM5 A;  1IGN A;  1B8I B;  3IH2 A;  1FIA A;  1IG7 A;  3BR3 A;  4IEJ A;  1FJL A;  4A3I J;  3HBL A;  2XSD C;  3HGY A;  2O7O A;  4AYB N;  5HOD A;  3BTL A;  1K61 A;  5EZH A;  2TCT A;  2WAQ N;  5F08 A;  1HOM A;  4D5F A;  1ZGW A;  4BXX J;  2DA7 A;  4A3K J;  3LNQ A;  3GTK J;  1S7E A;  3FK7 A;  4B1R A;  3ZQC A;  1ETK A;  4CYC A;  1JKQ C;  2N8G A;  4MO7 A;  1ETW A;  1UHS A;  3K7A J;  1A6I A;  4V2G A;  3BTC A;  3G1L A;  5FLV A;  5K7Z A;  1WH5 A;  2LP0 A;  2K9Q A;  3OSF A;  2X9D A;  3HKZ N;  3Q0W A;  3S1M J;  1Y1W J;  1FEX A;  2XGD A;  4FIS A;  5FJ8 J;  2XPV A;  1SFO J;  4DYR A;  2HI3 A;  2O8K A;  3S1R J;  5J3L A;  2DA2 A;  3Q3S A;  5E3L A;  2CU7 A;  4A3B J;  3LSR A;  1GV5 A;  4DZJ A;  3H3V K;  1SAN A;  4A69 C;  3S15 J;  2M9H A;  2FX0 A;  1F36 A;  1JUP A;  4M3G A;  1B8I A;  5EEA A;  2HYJ A;  4MIM A;  1BW6 A;  4V2F A;  3SFI A;  1FTZ A;  3TED A;  4JX5 A;  5M3M J;  1APL C;  4QIW N;  3S2H J;  3C2B A;  4G12 A;  4B3A A;  1VFC A;  2JA5 J;  5GP9 A;  3A02 A;  4A93 J;  4S0H B;  2XB0 X;  1W0U A;  3BQY A;  5IP7 J;  3LSG A;  1AKH B;  2EBI A;  3VPR A;  1IJW C;  5DS9 A;  4M3D A;  1QPI A;  2CQX A;  2Y31 A;  3FIS A;  4A3C J;  1X58 A;  3ZQI A;  3ZQL A;  1PUF B;  2HOT A;  2FD5 A;  3OSG A;  3HOV J;  3HOY J;  2DMQ A;  5M5X J;  1TC3 C;  5BNG A;  1WI3 A;  2Y0S N;  3BTJ A;  1MNM C;  5K7H A;  2DA4 A;  5EG0 B;  3S14 J;  2EZK A;  5JLW A;  5E3N A;  1MSF C;  1BL0 A;  5IOY A;  3MN2 A;  5C44 J;  1YRN B;  1TWH J;  1IDZ A;  1MH4 A;  1ETX A;  2NVX J;  1GT0 C;  4W97 A;  2ID3 A;  1IRZ A;  1U9N A;  1IDY A;  3PO3 J;  3JRI A;  3WHB A;  2LK2 A;  2HQ5 A;  3JRA A;  3FIW A;  4QTR A;  3O8H A;  3SDG A;  3RZO J;  1MBH A;  4IHW A;  2VPR A;  3K2A A;  5IOZ A;  3GTL J;  1UG2 A;  2LLK A;  3QPL A;  4XRS A;  4M3B A;  2ZB9 A;  1TWG J;  3HEF A;  3HOW J;  1XC5 A;  5FLM J;  2E2H J;  5C4X J;  3GTQ J;  4C3I J;  3HDD A;  2MGQ A;  2QCO A;  2YU9 J;  3DCF A;  2W48 A;  2NVQ J;  3PM1 A;  1G2H A;  1NK2 P;  4JX6 A;  2LY9 A;  1AKH A;  3MKL A;  2NOG A;  3JRG A;  3HOU J;  1Z77 A;  2K9N A;  1H89 C;  3I4M J;  3ZQF A;  3HOX J;  3O8G A;  3GTP J;  1RR7 A;  1PUF A;  2LD5 A;  1BW5 A;  2DA3 A;  2GBY A;  1R9T J;  2DMN A;  2G0E A;  5F0C A;  4DYC A;  4M6V A;  1LE8 A;  3S2D J;  3IH3 A;  1WGX A;  2CJJ A;  5EGO A;  1QVU A;  1IV6 A;  2K40 A;  4BBS J;  4C2M J;  4ABZ A;  1HDD C;  5M5W J;  1JTY A;  3A03 A;  2JA6 J;  1JTX A;  3GTO J;  4BY1 J;  3RQI A;  2XGE A;  3JR9 A;  4Y52 J;  2Y2Z A;  4A3M J;  5J1R A;  3M4O J;  3I4N J;  2ECB A;  2Y30 A;  2LR8 A;  2Y9Z A;  1BJZ A;  2WB1 N;  1AU7 A;  2D5V A;  3OOU A;  2IBD A;  2PMZ N;  3CCY A;  2GLO A;  4UUS A;  2TRT A;  5EYR A;  4GFB A;  2M2E A;  1I50 J;  1B72 B;  1AHD P;  1XG1 A;  3MVP A;  3B6A A;  2JJ7 A;  5IP9 J;  1OCP A;  4A3L J;  9ANT A;  1TWA J;  5IP6 A;  4HNV A;  4RBO A;  1JJ8 C;  1W0T A;  2L9R A;  2DA5 A;  3ZQH A;  3QPS A;  2X48 A;  4EEF G;  2EQR A;  5DTD A;  4MFE A;  1MBE A;  1ORK A;  2DMP A;  2LVS A;  2VKE A;  2HOA A;  1X2N A;  2I10 A;  2WV1 A;  3BR2 A;  1MSE C;  1HLV A;  1JKO C;  2M34 A;  2MSY A;  2CUF A;  2H1K A;  4FE7 A;  3JRE A;  3CQZ J;  2XGC A;  2VUM J;  4I76 A;  1RKW A;  5F0F A;  5FKL A;  2ID6 A;  2EZI A;  4BKX A;  1OCT C;  4Y7N J;  2MG4 A;  5IYC J;  1ETO A;  1WPK A;  1DU6 A;  3RKQ A;  2DA6 A;  5E3M A;  1ZK8 A;  1X2M A;  2LKX A;  5GPA A;  2DTZ A;  4JP0 A;  4MLO A;  1MBG A;  1IC8 A;  4NDL A;  3CDL A;  5M5Y J;  3LOC A;  1T33 A;  5M3F J;  4D5C A;  1RES A;  5J1Y A;  4FTH A;  1JT6 A;  5FKM A;  3SJM A;  2VI6 A;  4A3F J;  1T56 A;  3FKI J;  4D7M A;  1ENH A;  3Q0U A;  4XRM A;  1DU0 A;  1GV2 A;  4BY7 J;  5F1J A;  3RZD J;  3L1P A;  1XS9 A;  1WH7 A;  3GTG J;  2HXI A;  1NTC A;  1JJ6 C;  1EF4 A;  3JRD A;  1QRY A;  2XRL A;  2M0C A;  4IHY A;  3Q0V A;  1TWF J;  2JK3 A;  3A01 B;  2R7Z J;  4M3E A;  5JLX A;  3OIO A;  4AUX A;  2XPW A;  3BTI A;  3JRC A;  2FQ4 A;  5F0H A;  3TP3 A;  4QSH A;  1ETQ A;  2NVY J;  4JX4 A;  2XPU A;  3JRF A;  1JGG A;  1ETV A;  2OPT A;  5IPA A;  1OFC X;  1GDT A;  3W6V A;  2JMW A;  3TW7 A;  4C3H J;  1O4X A;  1JKR C;  1D5Y A;  1VI0 A;  3E7L A;  2FJ1 A;  1F43 A;  4M3F A;  1ZR4 A;  1LFB A;  2O9L A;  1I3Q J;  5F27 A;  2M8G X;  5EG0 A;  1MBK A;  2K9S A;  3BR6 A;  3D1N I;  2YUS A;  5F04 A;  1P7J A;  2VKV A;  1ZKG A;  2R93 J;  2E2I J;  1YRN A;  2Y9Y A;  5EDN A;  3QQA A;  4A3G J;  4FE4 A;  1ZR2 A;  3BT9 A;  4X6A J;  1Z0X A;  2H8R A;  2KDZ A;  1GUU A;  2E19 A;  2IAI A;  4D7N A;  2RAE A;  2LTP A;  4A3E J;  3PO2 J;  4L5E A;  2JA7 J;  3NAU A;  3IV5 A;  2LFB A;  3G1M A;  3GTM J;  2COB A;  2CQQ A;  2ECC A;  2DMT A;  3TW6 A;  2IEK A;  1E3O C;  2DA1 A;  2L7M P;  5K7F A;  3IH4 A;  3A01 A;  1Q1V A;  2MW8 A;  1A5J A;  1RPW A;  2R5Z B;  2KT0 A;  3NAR A;  4A3D J;  1LFU P;  4IHV A;  1FIP A;  2HDD A;  4RDU A;  2EH3 A;  2HXO A;  3FK6 A;  5E3O A;  3LSJ A;  4XK4 A;  3F0C A;  1JUS A;  2JWT A;  5C3E J;  2R92 J;  4IHX A;  1U8B A;  4XID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...