2JMWA

Structure of dna-binding domain of arabidopsis gt-1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords DNA binding protein GT-1
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jmwA01
4C3HJ 1I50J 4RBOA 2DA3A 2JWTA 2K40A 4C3IJ 3S17J 1ZKGA 1TWCJ 1B72A 4XIDA 2JA6J 4A93J 3BQYA 4A3KJ 1YRNA 2JJ7A 1JJ6C 2YU9J 3G1LA 3BG9A 1MBHA 1U8BA 5IYDJ 4QSHA 4A3EJ 3HB9A 4XK4A 5F0FA 2K9SA 1AHDP 1Z0XA 2YUSA 1NK2P 2Y9YA 4DYCA 1TWHJ 3BG3A 1XG1A 5EGOA 4CYCA 4V2GA 4I6ZA 3OIOA 1P7JA 2CUEA 5IYCJ 3BR2A 1HLVA 4AYBN 3ZQHA 1FJLA 4NDLA 3HOUJ 4RDUA 2I10A 3GTJJ 4D5CA 2CQXA 1OCTC 3ZQCA 2NVQJ 2ELKA 3QPLA 3JREA 3RZOJ 4I76A 4A3CJ 2DA7A 1AKHB 3ZQGA 1DU0A 2X48A 2EH3A 2R5ZB 4BY7J 4D7NA 3C2BA 2DA2A 2JA8J 1GV2A 1ETVA 1K83J 3LNQA 2HXOA 3ZQLA 3IV5A 2IBDA 2DMPA 1CQTA 1WI3A 2GBYA 3HBLA 3HOXJ 2NVTJ 2G0EA 3BR3A 1LFBA 2E1OA 3JRAA 2LR8A 3A02A 3GBGA 3TW7A 5EYRA 5JLWA 4MFDA 5GPCA 2VUMJ 4JX4A 2GM4A 2M2EA 1JGGA 4JP0A 3S1RJ 2Y2ZA 1TC3C 1Q1VA 3MVPA 2K9QA 4W1UA 5J1UA 2DA4A 1APLC 2D5VA 1F43A 2IAIA 3RZDJ 5FJ8J 2DN0A 1JT6A 2VKVA 1OJLA 2NVXJ 1TWAJ 1G2HA 1B8IA 1JTXA 1H88C 2Y31A 5FKMA 1LFUP 3HOYJ 3HOWJ 1TWFJ 1JKQC 1RETA 3O8GA 5DS9A 1HF0A 1H89C 1U78A 2QCOA 4W97A 3SFIA 2CJJA 5F0HA 1IV6A 4BY1J 5F1JA 2LFBA 2FX0A 1JUPA 3WHBA 5M3MJ 3LSRA 3GTGJ 1JKPC 2LK2A 1FTTA 1OCPA 1UG2A 1T33A 5C44J 5FLMJ 4G12A 4MIMA 2XPUA 2E2JJ 2MSYA 1WH5A 1YRNB 1FIPA 4V2FA 2LVSA 4DW6A 4DYQA 2XPVA 2EZIA 4FE4A 1BL0A 3M4OJ 5IP7J 1IGNA 2JMWA 5C3EJ 1U9NA 1Z77A 2LP0A 3RKQA 1GDTA 2L9RA 2XGDA 5FLVA 3RQIA 5FKLA 4M3EA 1HOMA 2R93J 4QTRA 5EEAA 3NARA 1PUFB 3GTMJ 4M3BA 1JJ8C 1W0UA 1U9OA 1F36A 3B6CA 5EGOB 4C2MJ 2DA1A 3JRIA 3ZQIA 3FISA 4UUSA 2L7FP 4AC0A 1RKWA 2HOSA 1A6IA 1QRYA 1ITYA 3IH3A 1VF9A 4FE7A 3GTQJ 2RAEA 5F04A 2FQ4A 4XRSG 5BNGA 1SANA 4BKXA 5EF6A 2HOTA 2R7ZJ 1W0TA 3HKZN 2VKEA 2ECCA 3HGYA 5IPAA 1AKHA 1ZTRA 1EF4A 4XRMA 2R5YB 5M5WJ 2MW8A 2DMUA 1UMQA 2WV1A 1VNDA 3DEWA 4A69C 1VFCA 2R5YA 1JT0A 2HI3A 5M3FJ 5J3LA 4DYRA 5EDNA 1H8AC 2ME6A 2M0CA 3JR9A 3PO3J 3HOZJ 3S16J 2CRGA 1MBKA 4DZPA 2FJ1A 2N8GA 3TEDA 3CMYA 3S1MJ 3MN2A 3FK6A 4XICA 4A3DJ 2OPTA 2VPRA 1I3QJ 4UUSB 2EZKA 3BTCA 4M3DA 1VI0A 4MO7A 2MG4A 3OSGA 1NTCA 3ZQFA 5F27A 2WAQN 1Y1VJ 3QQAA 1RR7A 3Q0UA 3LSGA 3GTOJ 1FEXA 1B72B 3S2HJ 1MBGA 2DA6A 3HM5A 3H0GJ 4M3GA 1T56A 5E3LA 1ZR2A 5DTDA 2OF7A 3G1MA 2Y0SN 2JN6A 2E2IJ 2XRLA 2O7OA 1HCRA 1RESA 3BR1A 2TCTA 3BR6A 2Y9ZA 3FK7A 4MFEA 3FIWA 3BQZA 1ORKA 4X1EA 4S0HB 4A3FJ 3S15J 3Q0VA 3BR0A 5FKOA 3TP0A 4CYCB 1I6HJ 2M34A 3L1PA 2WB1N 1LE8A 5K7ZA 1IJWC 4IEJA 3HEFA 1ZR4A 1ZQ3P 2XSDC 3D1NI 2NVYJ 3CQZJ 3Q3SA 2X9DA 5F08A 3SDGA 4D5FA 5M5XJ 2E19A 2Y30A 3ZOBA 4C3JJ 5C4JJ 4ABZA 5EG0A 2DA5A 2X6OA 2DTZA 1K61A 4Y52J 1BW5A 5J1YA 2CUFA 3B6AA 2O9LA 4DZJA 1Y1WJ 1B8IB 1MBJA 2AHQA 4FTHA 2MGQA 1IDZA 2ME0A 1WGXA 4LOCA 3JRDA 1WPKA 3JRFA 1ETKA 1NK3P 3A01B 5K7HA 4L5EA 2W48A 3BTIA 1GT0C 5IP9J 3CDLA 3JRCA 3WHCA 5EZHA 3H3VK 2ZB9A 3GTPJ 5E3MA 2LKXA 2O8KA 2COBA 2KT0A 4BBSJ 2IEKA 5K7FA 1QPIA 2QF7A 1S7EA 2L7ZA 4A3JJ 4GFBA 1X2NA 1O4XA 2R5ZA 5GPAA 3GTLJ 5FKKA 1OFCX 4A3IJ 1MNMC 4UUTA 4QIWN 2K9NA 3TP3A 4MLOA 2NOGA 4AUXA 2EZHA 1LE8B 1IUFA 5F0CA 1UHSA 3IH2A 1BJZA 1JKOC 3E7LA 3G1OA 1A5JA 3JRHA 5C4XJ 2XPWA 3BTJA 1MBEA 1ETYA 5E3OA 2DMQA 1E3OC 2XGEA 3BG5A 2L0KA 1XS9A 1JUSA 2DMNA 3K2AA 2LLKA 1WCMJ 3A03A 4JX6A 4BXXJ 1MSEC 1XC5A 1IRZA 4D7MA 1AU7A 1HDDC 1HDPA 1MH4A 1JUMA 5E3NA 3FKIJ 1BW6A 3OOUA 3S1QJ 5J1RA 1IG7A 3BR5A 2DMTA 1JTYA 2R0QC 4Y7NJ 1POGA 2GLOA 1IDYA 5IOYA 1JKRC 2JA5J 2JA7J 1QVUA 3PM1A 1D5YA 3M3YJ 3S14J 3HDDA 1SFOJ 2HDDA 2DJNA 2P81A 1DU6A 1P7IA 1TWGJ 4M6VA 3GTKJ 2LD5A 3VPRA 3SJMA 2NS8A 2KDZA 1WH7A 1RKTA 3NAUA 1FIAA 2ECBA 3Q0WA 4BBRJ 1R9TJ 5EZGA 2M9HA 1ZK8A 1FTZA 1ETWA 2FD5A 3MKLA 2HOAA 4B1RA 3CCYA 1QVTA 2EBIA 2AO9A 5HODA 1RPWA 9ANTA 1GUUA 2YS9A 3HOVJ 5GP9A 1ETQA 3I4NJ 4A3MJ 3JRBA 3PO2J 3LSJA 5IYBJ 1MH3A 4XRSA 2LTPA 3TW6A 2LY9A 4IHXA 2H8RA 3A01A 1IC8A 2HXIA 4EEFG 4A3BJ 2TRTA 3I4MJ 2XB0X 4IHYA 2EQRA 2PMZN 3O8HA 4JX5A 1GVDA 3LOCA 2VI6A 4JYKA 1ETOA 5JLXA 3BTLA 2B63J 4FCYA 1ENHA 3W6VA 3BT9A 3F0CA 4IHVA 4FISA 3S1NJ 1MBFA 2XGCA 2CQQA 3S2DJ 3JRGA 1ETXA 2HQ5A 1ZGWA 3OSFA 4A3LJ 4HNVA 1X58A 4A3GJ 2CU7A 3UKGA 2JK3A 3IH4A 1PUFA 5EG0B 3K7AJ 4B4CA 2H1KA 3QPSA 2EZLA 3DCFA 3LSPA 2HYJA 4B3AA 4J19A 2L7MP 5IOZA 1BA5A 2ID3A 4M3FA 5M5YJ 2ID6A 2E2HJ 3HGGA 1GV5A 2M8GX 4IHWA 2XB5A 5IP6A 2R92J 4X6AJ 2NS7A 1MSFC 5FKNA 1X2MA
chains in the Genus database with same CATH superfamily
4U88A 4C3HJ 4HNTA 1X19A 1N77A 1Z05A 1D0YA 1O3RA 2ZFWA 3E5QA 2K86A 2KJBA 2PJPA 2DA3A 2DBBA 2OUMA 3S17J 1B72A 1FMVA 4NQWA 4UHTA 4AIDA 3HSFA 1LDKB 4BQNA 3F8CA 3V8KA 4U0YA 4J00A 3CCEI 4G6TB 3FWEA 2VJ4A 4IHSA 2FOKA 5ED4A 1LPQA 1O3QA 3RKXA 5LGNA 1ZG5A 2M4KA 1I27A 1G6NA 2XKOA 4A3EJ 3G73A 1YO5C 1XSXA 3TO9A 5ICGA 1K79A 5F0FA 2K9SA 4P1WA 1S72I 4AVZA 1Z0XA 2YUSA 3F3XA 1NK2P 4EJVA 1XB4A 1XG1A 2GIVA 4I6ZA 3OIOA 4RAZA 1U3EM 3WTWC 1R7JA 1FJLA 1Y6IA 5JVTA 3BZKA 2L54A 5KK1A 1R49A 2W85A 1OCTC 4U7DA 1R1UA 3NQOA 1EA3A 3E6CC 2ELKA 3OYFA 4JOMA 2FF4A 1YFHA 3RZOJ 4NUBA 2HU9A 3QU3A 2Y75A 3FF5A 1DU0A 3T5XA 3DBHB 2K3PA 3ZPLA 2LREA 2IRFG 2A6HF 2EH3A 4D7NA 2DA2A 1KZHA 1ETVA 2IBDA 1WI3A 2GBYA 3HOXJ 3AKZA 2IA0A 2NVTJ 2G0EA 2FBHA 2E1OA 2Z1DA 2R7RA 3TO7A 1BR4A 2XASA 2KIUA 2L4MA 1IXRC 4R79A 1VQPI 2P7VB 3R4KA 1T95A 1TLHB 4JX4A 4UB6C 1JGGA 4P55A 3MKYB 4BDZA 1KGSA 1J59A 4B8XA 1Q1VA 3MVPA 1APLC 3FMQA 4C2TA 4PZJA 1QZZA 3WGGA 3MZ8A 1ON2A 2MBFA 3IHUA 3IUOA 2VKVA 2W82A 3CCLI 5IT9K 2V9PA 3OIQA 4U7BA 2BY0A 3OYHA 4GYIA 1B8IA 4X0GA 1JTXA 2G7UA 3BJOA 2Y31A 3MCZA 1SD5A 1XMXA 1MMGA 1RETA 4QLCU 4OIOF 3SXYA 3ABKH 2K9MA 2O3FA 1ZHFA 5F0HA 2XAHA 2LFBA 4A0XA 1JUPA 2V6CA 3WHBA 4ZTJA 3LSRA 2CW7A 1TNSA 3FKJA 3QYFA 1JKPC 2QZ8A 3LSKA 3FXRA 2FMYA 1OR7A 4LIVA 3OYCA 2E2JJ 2ESHA 2EWNA 2J5PA 3ZMSA 1R5HA 2NOJB 5DD4A 3VYUB 2FNPA 1XGSA 2C6YA 1Y39A 2JMWA 1BIAA 2LP0A 1B9NA 1Z77A 2NNYA 2L9RA 1HSTA 3DPUA 1MJAA 3WU1B 4U0WA 2R93J 2OAZA 2XHKA 1V5FA 3DTEA 2EFOA 5IY5H 1SAUA 4LJZF 3VSKA 5B66C 1UELB 1PUFB 2IS1A 3GTMJ 1W5CC 1ZN2A 2XDVA 2EK5A 5F6FA 3ELKA 1W0UA 1U9OA 4HPQA 2ZSIB 2VLAA 3B6CA 1OQYA 3JRIA 3V7RA 3HTUA 2HR3A 2L02A 1J2XA 1Y0NA 3DWLE 3ZQIA 1ZRDA 4AC0A 4RB1A 1VQ6I 1MMAA 3HOTA 5HLIA 4CCOA 3ONQA 4ITVA 3LAPA 2BVLA 3I64A 4I98B 3CCSI 4M73A 3N4MA 1ITYA 3IH3A 3GTQJ 2B0LA 2RAEA 4FASD 5KAFC 2FQ4A 1BN5A 2LH9A 3C1DA 5BNGA 2Z33A 3TQNA 4EMSA 1W0TA 3CC7I 4HZFA 1DQUA 1OKRA 2RV8A 2AQEA 3OMYA 1SVLA 1AKHA 1OCZH 1MW7A 4B09A 3FXQA 4ZYAA 1EF4A 2R5YB 1AOYA 3E0JB 4BQOA 1VNDA 3SDBA 3I58A 4EJUA 2D1HA 2X1DA 3LFUA 1VFCA 2IGOA 3CZ6A 3HKZA 3PFIA 1YW9A 5K1YA 3SZTA 5BQTA 2E35A 3DEUA 4YG2F 3VYSB 3GYHX 2Y0MA 4EGYA 5FRNA 4KDPA 4L0ZB 5DV5A 1RC9A 3TEDA 3H92A 4PSXA 5FO5A 1FOKA 1H0MA 2L4AA 3F6OA 3MN2A 1LNWA 3FBIB 1I3QJ 2BHYA 1LDJA 2QSHX 2BV6A 3E97A 2M8EA 1JI8A 4E7IA 3Q0UA 3GTOJ 1OCOH 4RAGA 1FYMA 3E6DA 2DA6A 2EV6A 3HM5A 4I0AA 4Z6YA 5E3LA 4B44A 4OU0A 4RS8A 4BE2A 1FP2A 2Y0SN 2CQKA 5HNFA 3RSNA 2O7OA 4KISA 3ZMVA 1SFUA 2TCTA 2Y9ZA 1FC3A 1Z67A 3AL0C 4X1EA 2EJRA 2KJCA 2M7AA 4A3FJ 3BR0A 3U1KA 2E1NA 3TP0A 4DIQA 4CYCB 3KETA 2M34A 3L1PA 2VPLA 3FXKA 2P4WA 3QPHA 4NBQA 3M07A 3KP2A 1YX3A 4ZZDA 1IRFA 1T8IA 2NVYJ 4BJTA 1EKEA 1YOVB 2DPUA 3CQZJ 1W7PD 1XMKA 2OCEA 3H5NA 2QWWA 2HTSA 2EIJH 3Q3SA 2ZMEA 4N9HA 1D1AA 2H6CA 2E19A 3FXMA 4C3JJ 5C4JJ 1HSJA 2DA5A 4HSTA 2M87A 2VL8A 4YFXF 3M8FA 3IWFA 3LMMA 5J1YA 2CUFA 4ZYEA 1QQIA 1O3SA 4RGRA 2A5YB 4P9UA 5LFAA 1NH3A 1P6RA 3KYCB 2ME0A 3HJEA 3KP3A 1WPKA 4HSRA 4PGGA 4NHJA 2L3DA 2E60A 2V26A 2TDXA 4HF1A 4AIJA 3SFZA 1E2XA 2F5DA 4HBLA 3WTZA 1GT0C 4IRIA 5IP9J 5CVUA 1F4KA 3CDLA 3SZGA 1KQ0A 3WHCA 3JRCA 2AS5F 2H94A 3CDHA 3VDXA 2COBA 2E7XA 4BBSJ 5K7FA 5TGTA 4ESBA 4ETSA 2CGPA 4GFBA 3O3KA 1YX5A 1YITI 4RGSA 4F55A 3L2RA 1HXDA 3K1PA 2KP6A 1IUYA 4QIWN 1U6GA 2PMHA 4F7ZA 4AUXA 4FQGA 2M0MA 1IUFA 5F0CA 4E7HA 3A0HC 4ZJZA 3AG2H 4MQ9F 1WFXA 2LYCA 3JRHA 2E5NA 4YRVA 2XPWA 1I39A 3BTJA 1P4WA 3KLNA 1G3TA 2CW0F 4ON0A 5HVQC 4ZZLA 2FQ3A 2EPFA 1XCVA 3CMMA 4QWQA 4H4KC 1FMWA 4JX6A 2IS2A 2F2EA 1HKSA 1IF1A 1XC5A 3I9V2 4D7MA 1AU7A 2DAOA 1WJAA 2EV5A 5IT3A 3HUGB 1D0XA 5E8GA 1TZLA 5J1RA 3G6EI 1KU9A 3JSPA 3S93A 2ICWG 4B3XA 4IX7A 1J75A 3DFGA 1IDYA 3REOA 4KN4X 3K1NA 2B7EA 2JA5J 3PM1A 3M3YJ 2FEZA 1XSDA 1TL8A 5CQEA 2F5FA 2X0LA 2DJNA 4ANJA 1DU6A 2YPRA 4E7JA 3I3LA 4UXNA 1TWGJ 4HEA2 2DFEA 2WY8Q 4M6VA 5H20A 2LD5A 5D8LB 3V4GA 5BPIA 2K4JA 1WH7A 3G3ZA 3AL0B 4MTDA 2ECBA 2L5QA 2HKOA 1FSHA 2E34A 4NB5A 4RMNA 4IQJA 1O3TA 4MNUA 2F4MB 2M9HA 2ZNZA 4IQ4A 4BDYA 1ETWA 4HX7A 3LA3A 1WVRA 5D4SA 3GFMA 4KT6A 4XLEA 3CCYA 4BH9A 2L01A 1KU7A 2MYSA 2AO9A 2KRHA 3MWMA 5H2FC 9ANTA 3T8TA 2YS9A 2R7FA 4CH7A 5CKTA 1LVKA 4RGXA 3FDYA 2X51A 3N05A 4KN7X 4ZYDA 3LSJA 5IT9Z 3TW6A 4IHXA 1QZEA 3A01A 1XX5A 2HXIA 2KHMA 3M8JA 4A12A 1QA6A 2RNJA 2BVMA 2GXAA 3I4MJ 1CF7B 4G9YA 1VQ4I 5CLSA 3ERED 2I5UA 4HA8A 1UG0A 3FMSA 3O8HA 1DUXC 2PMUA 4PJJA 3LOCA 2XROA 1S9HA 4JYKA 1S8NA 4LB6B 5D5VB 1ETOA 5JLXA 3LFKA 4KA4A 4IHVA 4OOIA 3S1NJ 3U1DA 1U8RA 3OYLA 1Z7LA 2HQ5A 3OSFA 4B48A 1O7FA 2GWRA 1DPRA 5D5XB 1VQKI 2CU7A 3WU0A 1UCRA 3O6BB 3GFIA 1PDNC 2EZLA 2WAEA 4WK8F 3HG9A 3J7AO 5HLGA 3DTKA 1GV5A 2M8GX 1TP4A 5IP6A 1TQMA 2R92J 2YX7A 2IGKA 1SD6A 4HG2A 5H6QA 3D5LA 2I8DA 1B4AA 1LKXA 2F4IA 1I50J 3CF2A 4G6QA 4HF0A 4RBOA 5DYMA 2JPCA 4BJ5C 4DNCA 2DI3A 4XIDA 3KYLA 3ASNH 2JA6J 1P4AA 4BXFA 1ULYA 2OCCH 1OMIA 1YRNA 5KNLA 2JJ7A 1JJ6C 2VJJA 3G1LA 4XR6A 3VODA 3BG9A 3RPUA 3JSOA 1W4MA 2DW4A 5BPDA 2HQAA 2OTJI 1ON1A 1AHDP 2Y9YA 4XONA 4DYCA 5JHUA 2Y0SA 4DBQA 1TW3A 1NG6A 2ETHA 1V3FA 4HOBA 1P7JA 2VT2A 4CA0A 3OYEA 2CH0A 4AYBN 3ZQHA 2KLOA 3K4JA 4M71A 4E7ZA 4NDLA 5CQGA 1P9QC 3M9AA 4M6XA 3F22A 1T39A 4RDUA 1B9MA 3RQ4A 5DDGA 2LY2A 3TDUC 4ENMA 2OZUA 2VKDA 1KONA 2E71A 2PG4A 2EFPA 2EA4A 1BM9A 3H9GA 3QPLA 1U2WA 3GVAA 2P5LC 4DQ2A 2VC0A 1IN4A 2W4SA 2M3AA 3CF5F 3MMYB 2ZJPF 2X1EA 3BPXA 3GCMA 1ZLJA 4D1QA 1XMAA 1OLTA 4G7ZF 3CUQC 3CJNA 4HDVA 2JA8J 1GV2A 1YI2I 4C30A 3ZQLA 4DGWB 4MTEA 2FBKA 1ZG1A 2DMPA 2K7LA 4U0VA 3OYJA 4PJMA 3HBLA 2F4OB 2JZYA 5HS7A 1D0ZA 3BR3A 3W2WA 4H0EA 2A6TA 3EYIA 5GTIC 4UV8A 3FMRA 4MEYF 4KIFA 2OBPA 3I59A 3GBGA 3TW7A 4M9SA 3K10A 1PJRA 1SFXA 3CO6C 2VUMJ 2DT5A 4UVBA 1YG2A 1YJWI 2GOXB 2HPMA 4FT8A 4LFUA 2DK5A 2RDPA 4JP0A 4Y4RA 4KYWA 4L9TA 2Y2ZA 2WBMA 2D5VA 4R1HA 3J80Z 2IAIA 4IRGA 3BZCA 2VJ5A 4JBAA 1BI1A 2WTEA 2XVCA 4WX9A 2XRNA 5KVRA 1K6OA 2V79A 1G59A 3OWTA 2A5WA 1FOYA 3I0TA 1OJLA 2NVXJ 2JRTA 2L7KA 4XKWA 3J81Z 3Q9SA 3HOYJ 3GF2A 5CVRA 3HSEA 3FM5A 2Z16A 3OS0A 1HF0A 1U78A 4W97A 3SFIA 3HOSA 3DKWA 1IV6A 3A1YA 4DJAA 1DGWY 3JAMK 3AG1H 3KZZA 1UB9A 1SD7A 4BY1J 2FX0A 5M3MJ 2ZJ2A 1K4SA 3GO5A 4YIIA 1Z1DA 3CP8A 1BOAA 1IAWA 2LK2A 4DBRA 2QA4I 1MMSA 1OCPA 2Z99A 4N4OB 1MJBA 5FLMJ 2XV4S 2DODA 2HQRA 4HV5A 2QQ9A 3K2ZA 3HXLA 3CUOA 2VOOA 1WH5A 2A61A 2LDUA 4CCMA 4V2FA 2LVSA 4F52A 5FB2A 5KHDA 2X1CA 4UB8C 3P9IA 4YELA 5IP7J 1IGNA 4ASNA 1OCRH 2XGDA 1U0JA 2QSGX 5GAGJ 2QGUA 1BOBA 4A6DA 3OL3A 2ZSHB 2XAFA 5J4YA 4U87A 2A69F 2MH9A 4UY8I 4JK1X 1G3WA 2A05A 4M3BA 5DEQA 2DFFA 4TV7A 3RPUD 3DQVC 5TISC 4C2MJ 5ICEA 4M74A 3FISA 2FA5A 4I99C 5KAIC 2UXNA 2HOSA 1A6IA 1I6XA 1TBXA 4LLNA 2FNAA 2YSRA 3AFHA 5A2QK 4K2EA 1Z21A 2HOTA 3HL2A 4LD5A 2VKEA 1RNLA 3JCUC 3C2GA 2A3SA 4XKBA 4EJOA 4XRMA 4S04A 1UMQA 1IXCA 3DEWA 4A69C 3HRSA 3T8RA 3ECHA 3ZCOA 2R5YA 2HI3A 4WF2A 3J7YJ 2W24A 3HSRA 5J3LA 5EDNA 4Y33A 1MJ9A 3E1SA 2ME6A 3JR9A 4E7KA 3RKWA 3PO3J 5DD8A 2CRGA 1RIOH 3RYPA 4DZPA 2FJ1A 2N8GA 4HQMA 2VQHA 4L18B 2B9SA 4ESJA 3S1MJ 3K0LA 3F8FA 2BXZA 2VPRA 1FOWA 1IRXA 2EA2A 1A35A 3QODA 1VI0A 3CD6I 4WCGA 3CCUI 2MG4A 2RNGA 2PFBA 4XOPA 2E1MC 3DF8A 1PP8F 3ZQFA 4EJTA 2WAQN 3H36A 4P96A 3PIPF 2WB1A 4XNFA 3OYNA 2KQRA 5LLQA 3SEQA 2EFQA 5J40A 4YFNF 1KYZA 4ZH4F 5ICFA 5DTDA 4BYYA 2XKPA 1QO0D 2W84A 1YYVA 2E2IJ 3QOPA 1CGPA 1RESA 1A6QA 2QQBA 3BR1A 3GW2A 2HDCA 3BR6A 3J7AY 4UVCA 2A07F 1FBUA 4S0HB 1LB2A 4YIFA 3Q0VA 2DOEA 2FXAA 2PBIA 1R00A 3CP2A 5AIQA 4IL6C 3KX2A 1WRJA 1HA8A 2R7WA 2R7UA 3D1NI 1G3SA 3DU6A 3ZMZA 4OIQF 1SFKA 4MHGA 4BHCA 2Q0OA 4LMYA 2Y30A 3R60A 1QU3A 1HKTA 5EG0A 2K9LA 3BWGA 2E5ZA 2X6OA 1K61A 1BW5A 1ZREA 1T0FC 1T6SA 4GCVA 2VODA 4DZJA 3PQKA 3OYIA 2Q1ZB 2ZO4A 1B8IB 1MBJA 2LC2A 1O57A 4FTHA 2KIFA 3ASOH 1STZA 1ZH5A 1REPC 1ETKA 2L9SA 1AWCA 2LBFA 2LRDA 1LJ9A 4RM2A 1ACIA 3BTIA 3V8LA 2KRCA 3VSLA 3GX4X 1S7OA 3UNGC 5EZHA 3R6SA 5CYVA 3L2UA 2CQ7A 3KP4A 3E3VA 4PJNA 2W7NA 1G3YA 2RKHA 4CICA 1JE8A 1FYKA 2CV1A 2O8KA 2QM3A 2VE9A 1LDDA 2IEKA 2OD5A 3C2HA 3TGNA 4XMYA 1S7EA 4A3JJ 1X2NA 4JQFA 1QNTA 4XM3A 2CSOA 1WWXA 2OZ6A 5FKKA 1OFCX 2LF7A 1MNMC 5L3FA 3DPLC 3IRRA 2ACJA 2V6EA 3LA2A 4L9VA 3EDPA 3QYBA 4Q5SF 2K9NA 3TP3A 3PL8A 2D45A 2OA4A 1VQLI 4E6KG 3IH2A 1BJZA 3E7LA 1A5JA 2GIZA 5E8IA 2PX9A 2ZXIA 4WXDA 2ZJRF 5C4XJ 3P5JA 3CDIA 5A2QZ 2R7SA 5D4RA 2XGEA 3BG5A 1HQCA 3S2WA 3K2AA 5DCMB 1Z6TA 2JPBA 3H5AA 4KUMA 4EM1A 1R1VA 3NWTA 2FSWA 2LLKA 4GGGA 1EJ9A 1ZGJA 3FHZA 4I0BA 2DLLA 3FKIJ 1PYVA 2DTRA 3OOUA 1GXPA 3S1QJ 1IG7A 6PAXA 2HQNA 2DMTA 5JHFA 3Q9VA 5EEHA 2BW3B 3DV8A 5DM7F 2BZTA 1POGA 2JSPA 3F8NA 3DXJF 3FXJA 5IOYA 3PSFA 4ENKA 4XN3A 4BQAA 1QVUA 3S14J 3CLOA 1XD7A 3HDDA 1SFOJ 2K3FA 1KA8A 2DDBA 2WY7Q 3W6KB 2EFNA 2PEXA 3GTKJ 4CO8A 2VJIA 2J5OA 1FP1D 5LBQA 2CO5A 1FIAA 1VQMI 2MABA 3QPTA 2QENA 3Q0WA 2ZJQF 2LNBA 3JAMZ 1KYWA 3MKLA 3S32A 2WC2A 4B1RA 3RKYA 4YIRX 3LSTA 2G9WA 3JW4A 4ZDOA 2EBIA 1YLFA 3C3WA 1RPWA 2CYYA 4ZDLA 3CJTB 1GUUA 3EUHA 3E5XA 5GP9A 4PJ0C 2V1NA 4A3MJ 1ZLKA 1IN7A 1EH7A 1MH3A 4XRSA 2O5RA 2LY9A 3MKWB 3BY6A 2H8RA 1Y8RB 1IC8A 1XGOA 2M30A 1WQ2A 4A3BJ 1V54H 2HS5A 3V7CA 2G7HA 3OL4A 2XB0X 1GVJA 3CCMI 3ZQ7A 1K78A 1GVDA 2VI6A 1BI2A 2RQPA 1L0OC 2X6YA 4FCYA 3W6VA 2QBYB 1FBSA 1FY7A 3L09A 3L00A 2P5KA 2KPMA 4O6JA 5B1AH 2IW5A 2EV0A 1D8KA 3KEQA 1RI7A 2BXYA 3OOPA 4BJ6C 5LHGA 3DBLB 3ZRGA 1EH8A 4ENJA 4IVNA 3CCQI 4A3LJ 2OU2A 1BC8C 3M1EA 4A3GJ 3WG7H 2R7TA 2MFZA 1PUFA 1D5VA 4BE0A 4B4CA 1ZRCA 3G4SI 3BDDA 2JQ7A 3KYDB 3OYGA 3OS1A 4NC6A 4B3AA 4J19A 3K9TA 3CJRB 4A0ZA 1YE9A 3WTYC 4HDUA 4M3FA 5M5YJ 3HGGA 5LGUA 2XB5A 1N25A 1MD0A 4CSWA 2W57A 3DTIA 4EM0B 4F3QA 2O03A 2KDZA 1RUOA 3QRFF 2RVCA 3MAJA 2ZKZA 4MGRA 4OWRB 4RAYA 3JTGA 1OYWA 3ESWB 3GZ5A 4KT5C 2K40A 4C3IJ 3OS2A 1ZKGA 5E79C 3ZMTA 4A93J 1ZRFA 4A3KJ 2P0WA 2MA3A 1A36A 4OMZA 2V9KA 4M6YA 3B02A 1VQ5I 2IS6A 2YU9J 1SC7A 2JUGA 5E17F 1R5ID 2VQGA 1ZAOA 2CUZA 1U8BA 4QSHA 3VWBA 4BQQA 4NNJA 3WU2C 2HOEA 5D5UB 1Y8QB 1MMNA 3BCBA 4Y3OA 1TWHJ 5EGOA 4CYCA 5EEGA 2CUEA 5IYCJ 2GA1A 3BR2A 4L5IA 2H1LA 3IAM2 3HOUJ 1BI3A 2I10A 2QQAA 2FUG2 4D5CA 2CQXA 4IKFA 2DYRH 5DM6F 2HVQA 2Q2EB 2VBZA 2ZMEC 3A0BC 4AIHA 1X3ZB 2YX4A 2DPDA 1H9GA 2PJRA 2NVQJ 1WHUA 2E36A 3LQQA 4AIKA 3M8EA 4ZC3A 3MQ0A 1FT9A 2BY1A 1WSUA 2X48A 3HC7A 2XSJC 2R5ZB 3C2BA 1Z91A 1X1PA 5FD5A 3GMEA 4ENNA 1CQTA 2HDWA 4QPOA 2JVGA 1RZ4A 2W00A 3IKTA 4PFOA 1LFBA 3JRAA 4AVPA 1W5TA 2WV0A 3L2CA 1B59A 4BACA 3DBRB 4MFDA 5GAHJ 5GPCA 3TMOA 5CVVA 2GM4A 4M9XA 3X2QH 5J8CA 3SZPA 5FLXK 5JR3A 2K9QA 1BR2A 2DA4A 3T0YA 2BOLA 1FX7A 2DCEA 4O3MA 3RZDJ 3BROA 2DN0A 3RI4A 1FWZA 1UZCA 1YHQI 1XCBA 1JHFA 2FOWA 1HW2A 4FETA 1TWAJ 1XDSA 4CXFA 2PJRB 4AU7A 1H88C 5FKMA 1LFUP 2X4HA 3HOWJ 4CZCA 1YW7A 5BS6A 5DS9A 3CCRI 3RTRA 1KQ9A 2XC7A 4BGDA 2QCOA 3F6VA 1PVEA 2Z3YA 3VB2A 2CMPA 4HX8A 2ELHA 5F1JA 1BJAA 4N0BA 2DDAA 2E7WA 2VT3A 3K1MA 3GTGJ 4AWXB 3PQJA 2HVSA 2V7FA 1FTTA 1ZARA 2A68F 2WAQA 1V4RA 2DOFA 4G12A 3GFLA 4HRIA 2H27A 2AXTC 1FIPA 4DW6A 4DYQA 1UFMA 1TTYA 3ZN1A 2EZIA 1J0RA 2FBIA 2XGXA 4A5NA 3M4OJ 1YIJI 2BY2A 5FLVA 1P2FA 4HW0A 1GDTA 4RGUA 1GHCA 3RQIA 1X1DA 4M3EA 1LVAA 2Q8KA 5K5OA 2CV2A 1HOMA 4Y17A 4B47A 5L3BA 2NVUB 3ULQB 2GXGA 3NARA 3IC7A 2DK8A 2Z9OA 2XUBA 3MKZA 2CUJA 5AONA 3T1BA 5EGOB 4LG0B 2EILH 4XSXF 2FMLA 4UUSA 1RKWA 1R1TA 5FD6A 3GFJA 3BJAA 3FBNB 4LLGF 1UHMA 2BYVE 4FE7A 5J47A 1SD4A 5F04A 3S3MA 3K4CA 4CCJA 2D2WA 3BOQA 3C7JA 2ZC2A 5BOXA 2LF8A 4HAMA 4BKXA 5EF6A 2R7ZJ 3HKZN 4I09A 2ECCA 2OQGA 5F64A 5IPAA 1MNEA 3W3CA 1ZTRA 2NRAC 2DMUA 2Y69H 3ABMH 2V4JC 4IOCF 2ELJA 1JT0A 3CCVI 3K4LA 4XLHA 4WXHA 1PP7U 2L9NA 3OYKA 2BGCA 2DYSH 2IVMA 1RUNA 3S16J 1MBKA 3SYTA 2ZFUA 2F5VA 2STWA 1MNDA 2HZDA 1WJEA 2NYXA 3B73A 3ZXSA 4E4HA 1K6YA 3K70D 2QKLB 5LGTA 4G6DA 4A3DJ 2BW3A 2OPTA 3WTVC 1F9NA 3KE2A 5J4VA 2GQQA 4M3DA 1IZ1A 4MO7A 4HV6A 2X6XA 3PIOF 2ISYA 5LD2C 1DP7P 1MGTA 5FRMA 2QKMB 1Y1VJ 2VASA 3QQAA 4F91B 1B6AA 1RR7A 2GAUA 3L7WA 1RR8C 1C0WA 4HX4A 1FEXA 3H0GJ 1X1AA 3P7NA 1T56A 4M3GA 3L2QA 2V1UA 2VN2A 1V5EA 4F92B 3G1MA 4OAZA 3AAFA 1JGSA 3O2PE 1ONVA 4KIBA 2JN6A 2E1MB 2RN7A 5FLXZ 1HCRA 2DQLA 3FXOA 2CWEA 4LITA 5H6RA 1SVMA 3TOBA 4EM2A 4Q4ZF 1D8JA 1R58A 3FIWA 3BQZA 3CMAI 1ORKA 3K6GA 1O7LA 4V19K 5LRRA 2X6WA 1HBXG 2E1CA 4IHTA 2UZKA 3S15J 5FFZA 4EJWA 2KMUA 2WB1N 5K7ZA 1FYLA 4ZTFA 4IEJA 1LQ1A 3ML6A 1BC7C 1ZR4A 1ZQ3P 1I1SA 2KRFA 2XSDC 4CDGA 3QP6A 2FU4A 3KEYA 1Z3XA 1X1BA 4GYGA 3DKYA 3OV8A 3KZIC 3HRUA 5B1BH 3I4PA 4PUSA 5F08A 4XLCA 2JSCA 4D5FA 3IP4B 3LAJA 2UUZA 3ZR8X 4ABZA 2F6CA 4XRFA 3D5RC 4Y52J 3TDZC 2VBXA 1F5TA 4E70A 4KIGA 2M5WA 2O9LA 1IN6A 1B1BA 2W25A 2DQRA 2HNHA 1U5TA 2MC3A 1Y1WJ 4PK4A 2AHQA 2MGQA 1OCCH 4G94A 1IDZA 3D5SC 3JRDA 5E1XA 3JRFA 5F1RA 4BE1A 3A01B 1WJ5A 5K7HA 3ABTA 5D8KB 1NHAA 1K78B 2MH2A 3U9GA 2NXNB 1TW2A 2PN6A 1WKMA 2Y48A 5HLHA 3GTPJ 2KT0A 1QHHD 1BBYA 3I55I 2L7ZA 4LG0A 1LUJB 1O4XA 2R5ZA 3GTLJ 3HUGA 2AXLA 2RREA 3KP5A 5FROA 5J8FA 4D9JA 2O0YA 3PFYA 2MC4A 4AYBA 1HW5A 4A5MA 3HPGA 4BEHA 5E1WA 2KISA 1IW7F 2NOGA 1LE8B 3FXLA 3KPHA 4S05A 1JKOC 5AIPA 2HVRA 4Z2YA 1NG7A 3H1CA 4F93B 2COMA 2IA2A 2W1OA 2ZBKA 2DMQA 2CFXA 1YW8A 1X4PA 2JT1A 1FNNA 4LK0F 2L0KA 1XS9A 1JUSA 1QZYA 2DMNA 4BS9A 3ZMUA 1Y56A 3D0SA 1XDUA 1WCMJ 3BZ6A 3MFKA 3LSHA 1MSEC 1IRZA 2VONA 1M1EB 1HDDC 1Z6RA 1JUMA 5E3NA 2ZXWH 1BIBA 4BL0B 4I2OA 2M1BA 5GTHC 4CHUA 1J9IA 3EQLF 2EB7A 3AG4H 3RJPA 1MDMA 2NNNA 5J6XA 3R0AA 1JTYA 2R0QC 2QQ8A 1YS7A 1IRGA 1W7PB 1X3WB 3JTHA 3FHNA 2QVOA 1JKRC 3G71I 2VQCA 5K5RA 1D5YA 2JA7J 2IXSA 3I59B 4O5VA 4Y15A 2BHZA 2P7CB 1SFEA 2HDDA 1WJFA 1E17A 5FFXA 2X85A 1OR7C 5LHHA 1PUEE 4XKCA 3SJMA 5TRDA 2NS8A 2OQRA 4I7HA 3HTSB 1RKTA 2P8TA 2IS4A 3H9QA 3NAUA 1JHHA 1TQPA 4I01A 1DDNA 4I02A 3PJRA 1FOXA 2RGVA 5LHIA 4J01A 1R9TJ 5EZGA 2VE8A 4PJLA 1ZK8A 2EINH 3W2AA 2K27A 1FTZA 1D1BA 2HOAA 3BC8A 2O61A 3ABLH 2UV1A 2V1DA 4PFPA 3VEPA 3MD2A 3TL4X 4M72A 3HOVJ 1U5TC 3HHHA 3VFZA 3JRBA 3PO2J 1XGNA 5IYBJ 3QAHA 2ADUA 2ISZA 1VQNI 4HLYA 2LG4A 4L9JA 4PDKA 4XLAA 2PMZA 1TNTA 3ABUA 3BLYA 1SMYF 2KIMA 5TJJA 4BUPA 4IHYA 2EQRA 5HDGA 1YIOA 2WA0A 2JTVA 1WI9A 4KFCA 2KFDA 3FZVA 2Q2EA 3K70C 4C2UA 2R7QA 3BTLA 2B63J 3R0JA 3H3ZA 3LWFA 1EH6A 4FISA 4LK1F 1S7AA 1MBFA 4KMFA 2XGCA 2CQQA 3JRGA 2QLZA 2QEXI 3E6MA 1J7KA 2VBWA 1ZG3A 1T2KA 3W2VA 4HNVA 3KZYA 3L2WA 2JUCA 1W36C 3R61A 2HZTA 4OIRF 2JK3A 3UKGA 1K7AA 4WXCA 2OV7A 3E6BA 1GLNA 4II3A 4E7SA 4BEHB 5EG0B 4FHTA 1E3PA 1MMDA 3QPSA 3LSPA 2HYJA 3VYRB 3F23A 3PUFA 2L7MP 1BA5A 3WGHA 3CCJI 1IN8A 3V7SA 2VXZA 2DO7A 3OY9A 4XQFA 2E2HJ 1G8XA 1CF7A 2ZNYA 5HOOA 4UVAA 2R7XA 1ZYRF 4CGZA 2NS7A 4X6AJ 1MSFC 2IA1A 1X2MA 4P5OA 3RYRA 1YJNI 3KCCA 4OIPF 5HS8A 1N78A 2BEOA 1D3YA 1A04A 1QGPA 4XLNF 5ILSA 2JWTA 2LOOA 4Y13A 3HIFA 2VBYA 1TWCJ 3BQYA 4CCNA 4IOAF 4AM3A 3GEZA 4M9ZA 3EUHC 2QUFA 3CLQA 1BI0A 1XGMA 1MBHA 1VQ7I 2DJIA 5IYDJ 1SAXA 3GUDA 4HQEA 3TO6A 3UR3C 2F5CA 3HB9A 4XK4A 5BMZA 4YFKF 3ROUA 5L3DA 3BG3A 3K69A 2DU9A 4V2GA 2V9VA 2OC6A 2KL4A 3HRTA 1HLVA 2HWVA 4NC8A 5DUIA 3IL2A 1XN7A 3PUBA 3GTJJ 1I1GA 4KJZA 5E20A 4FX4A 4L9NA 1R4MB 3ZQCA 1R4NB 3JREA 4RAFA 2STTA 4I76A 4A3CJ 2DA7A 3OIPA 3HYIA 3S3OA 1E0EA 2HFHA 1AKHB 3ZQGA 4YEJA 2K5CA 2CS3A 3OR1C 1UHWA 2ZXHA 2XF6A 5L3EA 2CQNA 4BY7J 4DOZA 3BG6A 3VYTB 4RB2C 3F8BA 1K83J 3LNQA 2HXOA 4NC7A 3RPQA 3IV5A 1ERDA 3RIRA 5LRSA 3RDIA 3CTAA 5GADJ 1HC8A 1H9TA 3QWLA 4FX0A 5D6FA 2LR8A 3A02A 1YTYA 3ZMDA 3GLLA 2WAFA 3I54A 5EYRA 1R71A 2EFWA 5JLWA 2MD5A 4C9YA 5HDNA 4UUVA 2M2EA 3IKVA 4IRHA 2XAUA 3S1RJ 2LSOA 3L9FA 2QBYA 1FBQA 4G8XA 2DT6A 1TC3C 5CVIA 4W1UA 5J1UA 5JVGF 3J7ZI 1F43A 2CG4A 3Q5FA 5ERIA 2CW8A 2ZCWA 4II2A 5FJ8J 1OISA 4IZZA 3DP7A 3PNTA 1JT6A 3SEZA 4XKVA 3H5RA 2R7OA 2K4BA 4ZYGA 1G2HA 4HYEA 1FSEA 1U5TB 2D1VA 2QSFX 2VOPA 1TWFJ 3OYDA 1JKQC 3MZYA 2A6EF 3ISPA 3A4CA 3O8GA 5JI6A 4EGZA 1Q1HA 1H89C 2CJJA 3OYAA 2KZGA 3GZNB 2DT7B 2P6SA 3LL7A 5HS9A 3LQRA 1BR1A 2IPQX 4CCKA 2VKHA 4CZZA 1IXSB 5FGMA 5HNHA 3ECOA 4KICA 4XN0A 1VQ9I 2H6BA 3TKYA 4GO1A 5E1ZB 5B3SH 1UG2A 2GA2A 1T33A 1X4OA 4BNCA 3K4NA 5C44J 5DCMA 4MIMA 2XPUA 2MSYA 2HGCA 1FZPB 1YRNB 2LBFB 3WTUC 4Q48A 2XPVA 4FE4A 3WE3A 3CUQA 3U21A 1BL0A 1UJ8A 5E18F 3ZGKA 5C3EJ 1U9NA 3RKQA 2DOAA 2KIQA 2XAJA 5FKLA 4N9IA 1USTA 2NS0A 5CVJA 1T08B 2XAGA 4QTRA 2HYFA 3DKXA 3K4BA 3W6JB 2RQQA 5EEAA 4KNYA 4BHPA 3KIOA 5CJ9A 1L3LA 3M7GA 4ESFA 2H8WA 4WWCA 1JJ8C 2GOMA 5LEKA 1XTAA 1F36A 3HPHA 1P4XA 2DA1A 2L7FP 3P9CA 3OYMA 2BE5F 1QRYA 3LSMA 3HRMA 3PNVA 2IJLA 2M7BA 1VF9A 1SEUA 4XRSG 1LEAA 3OR2C 3F21A 3P9KA 3CMEI 2VC1A 1SANA 2XF5A 4MQVA 2XIGA 5D6EA 1W1WE 4XSZF 4LB5A 1J5YA 3MZHA 2GXBA 1KU3A 4LGWA 4PCQA 1A31A 3HGYA 2JA2A 3I5UA 3H35A 3RCOA 2WADA 2MW8A 5M5WJ 2DXIA 1TT5B 2WV1A 4GDFA 1X1CA 1EV7A 4RLFA 2QYOA 4XBFA 3F9KA 3GLXA 5M3FJ 4DYRA 3G2BA 1H8AC 1G4DA 4G7OF 1AA7A 1Z3YA 2M0CA 3HOZJ 1MDMB 3FXUA 3DLAA 4HF2A 4CCLA 3CMYA 1SMTA 3V42A 3BCAA 2F5EA 3FK6A 4XICA 2L9VA 1R22A 3EUKL 2L2OA 4A6EA 1W7PA 1HKQA 2HTJA 2EZKA 3BTCA 4UUSB 4BAYA 3SHFA 1VQ8I 1Z9CA 3OSGA 1NTCA 2XF7A 5F27A 4QPQA 5GAEJ 3LSGA 4N4NB 2IGNA 2KDOA 3EPZA 1V5GA 2OJED 1B72B 5DUKA 3S2HJ 3NWSA 1MBGA 2EIMH 4OAYA 3IRQA 4NQWB 2VB6A 4P9FA 5ILVA 1R23A 2VQLA 3E5UA 1ZR2A 2MD0A 3F72A 2OF7A 3C18A 3EYYA 2V1XA 3PSIA 5KCMA 2XRLA 2MLKA 1I3AA 3NRVA 1DPUA 2DFIA 3FK7A 4MFEA 3CC2I 1UAAA 1OPCA 5CPRB 4XLPF 2P5VA 2Z5UA 4EATA 5FKOA 1I6HJ 3ZN0A 1S6LA 4Q47A 1DGRM 1LE8A 3J81K 4IJAA 1IJWC 4RLQA 3WTXC 3HEFA 4XOTA 2JRMA 2UWMA 1QHGA 2LMDA 3CC4I 1KQ8A 4PGHA 2WWYA 4XORA 3QP5A 2X9DA 3SDGA 5M5XJ 2M45A 3ZOBA 3J80K 3GZ6A 3QYEA 2DTZA 3BJ6A 1RRJA 1USSA 1WZ2A 3B6AA 1GXQA 1Z7UA 2DFHA 1FLIA 2Z2SB 2EIKH 3BPVA 3BP8A 2VIXA 4RM3A 4RB3C 1WGXA 4LOCA 3FM3A 4R8HA 2HEOA 4GRIA 1IN5A 1XSVA 2LY1A 1NK3P 2UXXA 2R4GA 1N75A 4L5EA 2W48A 3DLLF 3DU5A 3I71A 2MLGA 4L5JA 2OTLI 4IPAA 3H3VK 3WODF 2ZB9A 3KP7A 3K4KA 1LEBA 1DP3A 2ZMEB 5E3MA 2LKXA 1MKMA 4EVIA 2IT0A 1QPIA 4EQQA 2QF7A 3TOAA 1OYYA 3GXOA 3EUAA 5GPAA 1F1ZA 2PI0A 3AG3H 3DPTA 3K4MA 2CFOA 4A3IJ 1HW1A 1QPMA 4UUTA 4UNOA 4MLOA 3LA7A 4HNUA 2EZHA 2KKOA 1J09A 1UHSA 4G7HF 2RC4A 1WJDA 3WTTC 3CESA 3G1OA 3GWZA 1T38A 2O6GE 3COAC 3VOEA 5HLTA 1R5GA 1MBEA 1ETYA 4EV0A 5E3OA 1E3OC 1IV8A 1ZGAA 4CUGA 2ESNA 1VQOI 5ICCA 3F8MA 1V55H 2HKXA 3BG7A 2JVHA 1XPXA 3A03A 1K4TA 2PQ8A 4BXUA 3ZP5A 4BXXJ 4MEXF 1HDPA 1MH4A 4CYDA 1TQIA 3FX3A 2CV0A 4A2UA 1BW6A 1P92A 5EJCA 3QOEA 3BR5A 2PLYA 4B43A 3ERMA 2NAZA 4UV9A 1T0FA 3M1CA 3SQNA 4Y7NJ 2R7VA 2H09A 3U2RA 3OYBA 3EETA 4HLXA 4LG3A 4ZDPA 2GLOA 3L2VA 3IWZA 1W5SA 3CJQB 2IP2A 2K02A 2ZXJA 3KEOA 1YQAA 1W36D 3IAS2 2P81A 1P7IA 4D0PA 4KMUX 3VPRA 1R36A 4AD9A 3MEXA 3S3NA 3HHGA 1R6RA 3V8JA 5LEJA 1S5LC 4RB0A 4E7LA 5ILUA 5JFRA 1WJCA 3WG9A 3WGIA 1OYIA 4LLLA 4BBRJ 1S3JA 3KFWX 1I5ZA 1ZELA 2YU3A 2IGMA 3CUQB 2FD5A 1T98A 3S8PA 2FRHA 1IO2A 1LFPA 1SVOA 2K85A 4A0YA 2R3SA 5L3CA 1QVTA 3I53A 3H9JA 3KLOA 2F48A 5HODA 5K5QA 1ODDA 2XAQA 1ETQA 3I4NJ 4XLFA 1Y0UA 4XL9A 2HPIA 2LTPA 1YS6A 5D5WB 5L3GA 4EEFG 2TRTA 2HYGD 2O8XA 1VZ0A 1X3UA 4BU2A 4OINF 2VXDA 1MIJA 4GXOA 3A2KA 2PMZN 4IO9F 5B5EC 2GZWA 4JX5A 3H0DA 2P6TA 4ZYHA 1QBJA 4IF4A 3WTSC 1FPQA 2FE3A 1ENHA 4OMYA 3BT9A 3F0CA 1WJBA 1TT0A 3HZJA 3LSIA 3DEEA 2AQFA 3QU6A 1E3HA 3N97A 3S2DJ 3NEUA 2KZVA 4KITB 1ETXA 1ZGWA 1YJ9I 1JXSA 5HDKA 2YR2A 3ZQQA 1X58A 3H3UA 2M4GA 1KU2A 2LKSA 2LKPA 3IH4A 3CO7C 2R7DA 3K7AJ 3KP6A 3WE2A 2H1KA 1VTNC 3DCFA 4RA2A 2BY3A 4LIUA 5IOZA 1S29A 2ID3A 4IXAA 4L0YB 2ID6A 1D1CA 1MZBA 4IHWA 3PNYA 4PSWA 2BBYA 3TBIA 4BHBA 5DCFA 3I56I 5FKNA
chains in the Genus database with same CATH topology
4C3HJ 1I50J 4RBOA 2DA3A 2JWTA 2K40A 4C3IJ 3S17J 1ZKGA 1TWCJ 1B72A 4XIDA 2JA6J 4A93J 3BQYA 4A3KJ 1YRNA 2JJ7A 1JJ6C 2YU9J 3G1LA 3BG9A 1MBHA 1U8BA 5IYDJ 4QSHA 4A3EJ 3HB9A 4XK4A 5F0FA 2K9SA 1AHDP 1Z0XA 2YUSA 1NK2P 2Y9YA 4DYCA 1TWHJ 3BG3A 1XG1A 5EGOA 4CYCA 4V2GA 4I6ZA 3OIOA 1P7JA 2CUEA 5IYCJ 3BR2A 1HLVA 4AYBN 3ZQHA 1FJLA 4NDLA 3HOUJ 4RDUA 2I10A 3GTJJ 4D5CA 2CQXA 1OCTC 3ZQCA 2NVQJ 2ELKA 3QPLA 3JREA 3RZOJ 4I76A 4A3CJ 2DA7A 1AKHB 3ZQGA 1DU0A 2X48A 2EH3A 2R5ZB 4BY7J 4D7NA 3C2BA 2DA2A 2JA8J 1GV2A 1ETVA 1K83J 3LNQA 2HXOA 3ZQLA 3IV5A 2IBDA 2DMPA 1CQTA 1WI3A 2GBYA 3HBLA 3HOXJ 2NVTJ 2G0EA 3BR3A 1LFBA 2E1OA 3JRAA 2LR8A 3A02A 3GBGA 3TW7A 5EYRA 5JLWA 4MFDA 5GPCA 2VUMJ 4JX4A 2GM4A 2M2EA 1JGGA 4JP0A 3S1RJ 2Y2ZA 1TC3C 1Q1VA 3MVPA 2K9QA 4W1UA 5J1UA 2DA4A 1APLC 2D5VA 1F43A 2IAIA 3RZDJ 5FJ8J 2DN0A 1JT6A 2VKVA 1OJLA 2NVXJ 1TWAJ 1G2HA 1B8IA 1JTXA 1H88C 2Y31A 5FKMA 1LFUP 3HOYJ 3HOWJ 1TWFJ 1JKQC 1RETA 3O8GA 5DS9A 1HF0A 1H89C 1U78A 2QCOA 4W97A 3SFIA 2CJJA 5F0HA 1IV6A 4BY1J 5F1JA 2LFBA 2FX0A 1JUPA 3WHBA 5M3MJ 3LSRA 3GTGJ 1JKPC 2LK2A 1FTTA 1OCPA 1UG2A 1T33A 5C44J 5FLMJ 4G12A 4MIMA 2XPUA 2E2JJ 2MSYA 1WH5A 1YRNB 1FIPA 4V2FA 2LVSA 4DW6A 4DYQA 2XPVA 2EZIA 4FE4A 1BL0A 3M4OJ 5IP7J 1IGNA 2JMWA 5C3EJ 1U9NA 1Z77A 2LP0A 3RKQA 1GDTA 2L9RA 2XGDA 5FLVA 3RQIA 5FKLA 4M3EA 1HOMA 2R93J 4QTRA 5EEAA 3NARA 1PUFB 3GTMJ 4M3BA 1JJ8C 1W0UA 1U9OA 1F36A 3B6CA 5EGOB 4C2MJ 2DA1A 3JRIA 3ZQIA 3FISA 4UUSA 2L7FP 4AC0A 1RKWA 2HOSA 1A6IA 1QRYA 1ITYA 3IH3A 1VF9A 4FE7A 3GTQJ 2RAEA 5F04A 2FQ4A 4XRSG 5BNGA 1SANA 4BKXA 5EF6A 2HOTA 2R7ZJ 1W0TA 3HKZN 2VKEA 2ECCA 3HGYA 5IPAA 1AKHA 1ZTRA 1EF4A 4XRMA 2R5YB 5M5WJ 2MW8A 2DMUA 1UMQA 2WV1A 1VNDA 3DEWA 4A69C 1VFCA 2R5YA 1JT0A 2HI3A 5M3FJ 5J3LA 4DYRA 5EDNA 1H8AC 2ME6A 2M0CA 3JR9A 3PO3J 3HOZJ 3S16J 2CRGA 1MBKA 4DZPA 2FJ1A 2N8GA 3TEDA 3CMYA 3S1MJ 3MN2A 3FK6A 4XICA 4A3DJ 2OPTA 2VPRA 1I3QJ 4UUSB 2EZKA 3BTCA 4M3DA 1VI0A 4MO7A 2MG4A 3OSGA 1NTCA 3ZQFA 5F27A 2WAQN 1Y1VJ 3QQAA 1RR7A 3Q0UA 3LSGA 3GTOJ 1FEXA 1B72B 3S2HJ 1MBGA 2DA6A 3HM5A 3H0GJ 4M3GA 1T56A 5E3LA 1ZR2A 5DTDA 2OF7A 3G1MA 2Y0SN 2JN6A 2E2IJ 2XRLA 2O7OA 1HCRA 1RESA 3BR1A 2TCTA 3BR6A 2Y9ZA 3FK7A 4MFEA 3FIWA 3BQZA 1ORKA 4X1EA 4S0HB 4A3FJ 3S15J 3Q0VA 3BR0A 5FKOA 3TP0A 4CYCB 1I6HJ 2M34A 3L1PA 2WB1N 1LE8A 5K7ZA 1IJWC 4IEJA 3HEFA 1ZR4A 1ZQ3P 2XSDC 3D1NI 2NVYJ 3CQZJ 3Q3SA 2X9DA 5F08A 3SDGA 4D5FA 5M5XJ 2E19A 2Y30A 3ZOBA 4C3JJ 5C4JJ 4ABZA 5EG0A 2DA5A 2X6OA 2DTZA 1K61A 4Y52J 1BW5A 5J1YA 2CUFA 3B6AA 2O9LA 4DZJA 1Y1WJ 1B8IB 1MBJA 2AHQA 4FTHA 2MGQA 1IDZA 2ME0A 1WGXA 4LOCA 3JRDA 1WPKA 3JRFA 1ETKA 1NK3P 3A01B 5K7HA 4L5EA 2W48A 3BTIA 1GT0C 5IP9J 3CDLA 3JRCA 3WHCA 5EZHA 3H3VK 2ZB9A 3GTPJ 5E3MA 2LKXA 2O8KA 2COBA 2KT0A 4BBSJ 2IEKA 5K7FA 1QPIA 2QF7A 1S7EA 2L7ZA 4A3JJ 4GFBA 1X2NA 1O4XA 2R5ZA 5GPAA 3GTLJ 5FKKA 1OFCX 4A3IJ 1MNMC 4UUTA 4QIWN 2K9NA 3TP3A 4MLOA 2NOGA 4AUXA 2EZHA 1LE8B 1IUFA 5F0CA 1UHSA 3IH2A 1BJZA 1JKOC 3E7LA 3G1OA 1A5JA 3JRHA 5C4XJ 2XPWA 3BTJA 1MBEA 1ETYA 5E3OA 2DMQA 1E3OC 2XGEA 3BG5A 2L0KA 1XS9A 1JUSA 2DMNA 3K2AA 2LLKA 1WCMJ 3A03A 4JX6A 4BXXJ 1MSEC 1XC5A 1IRZA 4D7MA 1AU7A 1HDDC 1HDPA 1MH4A 1JUMA 5E3NA 3FKIJ 1BW6A 3OOUA 3S1QJ 5J1RA 1IG7A 3BR5A 2DMTA 1JTYA 2R0QC 4Y7NJ 1POGA 2GLOA 1IDYA 5IOYA 1JKRC 2JA5J 2JA7J 1QVUA 3PM1A 1D5YA 3M3YJ 3S14J 3HDDA 1SFOJ 2HDDA 2DJNA 2P81A 1DU6A 1P7IA 1TWGJ 4M6VA 3GTKJ 2LD5A 3VPRA 3SJMA 2NS8A 2KDZA 1WH7A 1RKTA 3NAUA 1FIAA 2ECBA 3Q0WA 4BBRJ 1R9TJ 5EZGA 2M9HA 1ZK8A 1FTZA 1ETWA 2FD5A 3MKLA 2HOAA 4B1RA 3CCYA 1QVTA 2EBIA 2AO9A 5HODA 1RPWA 9ANTA 1GUUA 2YS9A 3HOVJ 5GP9A 1ETQA 3I4NJ 4A3MJ 3JRBA 3PO2J 3LSJA 5IYBJ 1MH3A 4XRSA 2LTPA 3TW6A 2LY9A 4IHXA 2H8RA 3A01A 1IC8A 2HXIA 4EEFG 4A3BJ 2TRTA 3I4MJ 2XB0X 4IHYA 2EQRA 2PMZN 3O8HA 4JX5A 1GVDA 3LOCA 2VI6A 4JYKA 1ETOA 5JLXA 3BTLA 2B63J 4FCYA 1ENHA 3W6VA 3BT9A 3F0CA 4IHVA 4FISA 3S1NJ 1MBFA 2XGCA 2CQQA 3S2DJ 3JRGA 1ETXA 2HQ5A 1ZGWA 3OSFA 4A3LJ 4HNVA 1X58A 4A3GJ 2CU7A 3UKGA 2JK3A 3IH4A 1PUFA 5EG0B 3K7AJ 4B4CA 2H1KA 3QPSA 2EZLA 3DCFA 3LSPA 2HYJA 4B3AA 4J19A 2L7MP 5IOZA 1BA5A 2ID3A 4M3FA 5M5YJ 2ID6A 2E2HJ 3HGGA 1GV5A 2M8GX 4IHWA 2XB5A 5IP6A 2R92J 4X6AJ 2NS7A 1MSFC 5FKNA 1X2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H J;  1I50 J;  4RBO A;  2DA3 A;  2JWT A;  2K40 A;  4C3I J;  3S17 J;  1ZKG A;  1TWC J;  1B72 A;  4XID A;  2JA6 J;  4A93 J;  3BQY A;  4A3K J;  1YRN A;  2JJ7 A;  1JJ6 C;  2YU9 J;  3G1L A;  3BG9 A;  1MBH A;  1U8B A;  5IYD J;  4QSH A;  4A3E J;  3HB9 A;  4XK4 A;  5F0F A;  2K9S A;  1AHD P;  1Z0X A;  2YUS A;  1NK2 P;  2Y9Y A;  4DYC A;  1TWH J;  3BG3 A;  1XG1 A;  5EGO A;  4CYC A;  4V2G A;  4I6Z A;  3OIO A;  1P7J A;  2CUE A;  5IYC J;  3BR2 A;  1HLV A;  4AYB N;  3ZQH A;  1FJL A;  4NDL A;  3HOU J;  4RDU A;  2I10 A;  3GTJ J;  4D5C A;  2CQX A;  1OCT C;  3ZQC A;  2NVQ J;  2ELK A;  3QPL A;  3JRE A;  3RZO J;  4I76 A;  4A3C J;  2DA7 A;  1AKH B;  3ZQG A;  1DU0 A;  2X48 A;  2EH3 A;  2R5Z B;  4BY7 J;  4D7N A;  3C2B A;  2DA2 A;  2JA8 J;  1GV2 A;  1ETV A;  1K83 J;  3LNQ A;  2HXO A;  3ZQL A;  3IV5 A;  2IBD A;  2DMP A;  1CQT A;  1WI3 A;  2GBY A;  3HBL A;  3HOX J;  2NVT J;  2G0E A;  3BR3 A;  1LFB A;  2E1O A;  3JRA A;  2LR8 A;  3A02 A;  3GBG A;  3TW7 A;  5EYR A;  5JLW A;  4MFD A;  5GPC A;  2VUM J;  4JX4 A;  2GM4 A;  2M2E A;  1JGG A;  4JP0 A;  3S1R J;  2Y2Z A;  1TC3 C;  1Q1V A;  3MVP A;  2K9Q A;  4W1U A;  5J1U A;  2DA4 A;  1APL C;  2D5V A;  1F43 A;  2IAI A;  3RZD J;  5FJ8 J;  2DN0 A;  1JT6 A;  2VKV A;  1OJL A;  2NVX J;  1TWA J;  1G2H A;  1B8I A;  1JTX A;  1H88 C;  2Y31 A;  5FKM A;  1LFU P;  3HOY J;  3HOW J;  1TWF J;  1JKQ C;  1RET A;  3O8G A;  5DS9 A;  1HF0 A;  1H89 C;  1U78 A;  2QCO A;  4W97 A;  3SFI A;  2CJJ A;  5F0H A;  1IV6 A;  4BY1 J;  5F1J A;  2LFB A;  2FX0 A;  1JUP A;  3WHB A;  5M3M J;  3LSR A;  3GTG J;  1JKP C;  2LK2 A;  1FTT A;  1OCP A;  1UG2 A;  1T33 A;  5C44 J;  5FLM J;  4G12 A;  4MIM A;  2XPU A;  2E2J J;  2MSY A;  1WH5 A;  1YRN B;  1FIP A;  4V2F A;  2LVS A;  4DW6 A;  4DYQ A;  2XPV A;  2EZI A;  4FE4 A;  1BL0 A;  3M4O J;  5IP7 J;  1IGN A;  2JMW A;  5C3E J;  1U9N A;  1Z77 A;  2LP0 A;  3RKQ A;  1GDT A;  2L9R A;  2XGD A;  5FLV A;  3RQI A;  5FKL A;  4M3E A;  1HOM A;  2R93 J;  4QTR A;  5EEA A;  3NAR A;  1PUF B;  3GTM J;  4M3B A;  1JJ8 C;  1W0U A;  1U9O A;  1F36 A;  3B6C A;  5EGO B;  4C2M J;  2DA1 A;  3JRI A;  3ZQI A;  3FIS A;  4UUS A;  2L7F P;  4AC0 A;  1RKW A;  2HOS A;  1A6I A;  1QRY A;  1ITY A;  3IH3 A;  1VF9 A;  4FE7 A;  3GTQ J;  2RAE A;  5F04 A;  2FQ4 A;  4XRS G;  5BNG A;  1SAN A;  4BKX A;  5EF6 A;  2HOT A;  2R7Z J;  1W0T A;  3HKZ N;  2VKE A;  2ECC A;  3HGY A;  5IPA A;  1AKH A;  1ZTR A;  1EF4 A;  4XRM A;  2R5Y B;  5M5W J;  2MW8 A;  2DMU A;  1UMQ A;  2WV1 A;  1VND A;  3DEW A;  4A69 C;  1VFC A;  2R5Y A;  1JT0 A;  2HI3 A;  5M3F J;  5J3L A;  4DYR A;  5EDN A;  1H8A C;  2ME6 A;  2M0C A;  3JR9 A;  3PO3 J;  3HOZ J;  3S16 J;  2CRG A;  1MBK A;  4DZP A;  2FJ1 A;  2N8G A;  3TED A;  3CMY A;  3S1M J;  3MN2 A;  3FK6 A;  4XIC A;  4A3D J;  2OPT A;  2VPR A;  1I3Q J;  4UUS B;  2EZK A;  3BTC A;  4M3D A;  1VI0 A;  4MO7 A;  2MG4 A;  3OSG A;  1NTC A;  3ZQF A;  5F27 A;  2WAQ N;  1Y1V J;  3QQA A;  1RR7 A;  3Q0U A;  3LSG A;  3GTO J;  1FEX A;  1B72 B;  3S2H J;  1MBG A;  2DA6 A;  3HM5 A;  3H0G J;  4M3G A;  1T56 A;  5E3L A;  1ZR2 A;  5DTD A;  2OF7 A;  3G1M A;  2Y0S N;  2JN6 A;  2E2I J;  2XRL A;  2O7O A;  1HCR A;  1RES A;  3BR1 A;  2TCT A;  3BR6 A;  2Y9Z A;  3FK7 A;  4MFE A;  3FIW A;  3BQZ A;  1ORK A;  4X1E A;  4S0H B;  4A3F J;  3S15 J;  3Q0V A;  3BR0 A;  5FKO A;  3TP0 A;  4CYC B;  1I6H J;  2M34 A;  3L1P A;  2WB1 N;  1LE8 A;  5K7Z A;  1IJW C;  4IEJ A;  3HEF A;  1ZR4 A;  1ZQ3 P;  2XSD C;  3D1N I;  2NVY J;  3CQZ J;  3Q3S A;  2X9D A;  5F08 A;  3SDG A;  4D5F A;  5M5X J;  2E19 A;  2Y30 A;  3ZOB A;  4C3J J;  5C4J J;  4ABZ A;  5EG0 A;  2DA5 A;  2X6O A;  2DTZ A;  1K61 A;  4Y52 J;  1BW5 A;  5J1Y A;  2CUF A;  3B6A A;  2O9L A;  4DZJ A;  1Y1W J;  1B8I B;  1MBJ A;  2AHQ A;  4FTH A;  2MGQ A;  1IDZ A;  2ME0 A;  1WGX A;  4LOC A;  3JRD A;  1WPK A;  3JRF A;  1ETK A;  1NK3 P;  3A01 B;  5K7H A;  4L5E A;  2W48 A;  3BTI A;  1GT0 C;  5IP9 J;  3CDL A;  3JRC A;  3WHC A;  5EZH A;  3H3V K;  2ZB9 A;  3GTP J;  5E3M A;  2LKX A;  2O8K A;  2COB A;  2KT0 A;  4BBS J;  2IEK A;  5K7F A;  1QPI A;  2QF7 A;  1S7E A;  2L7Z A;  4A3J J;  4GFB A;  1X2N A;  1O4X A;  2R5Z A;  5GPA A;  3GTL J;  5FKK A;  1OFC X;  4A3I J;  1MNM C;  4UUT A;  4QIW N;  2K9N A;  3TP3 A;  4MLO A;  2NOG A;  4AUX A;  2EZH A;  1LE8 B;  1IUF A;  5F0C A;  1UHS A;  3IH2 A;  1BJZ A;  1JKO C;  3E7L A;  3G1O A;  1A5J A;  3JRH A;  5C4X J;  2XPW A;  3BTJ A;  1MBE A;  1ETY A;  5E3O A;  2DMQ A;  1E3O C;  2XGE A;  3BG5 A;  2L0K A;  1XS9 A;  1JUS A;  2DMN A;  3K2A A;  2LLK A;  1WCM J;  3A03 A;  4JX6 A;  4BXX J;  1MSE C;  1XC5 A;  1IRZ A;  4D7M A;  1AU7 A;  1HDD C;  1HDP A;  1MH4 A;  1JUM A;  5E3N A;  3FKI J;  1BW6 A;  3OOU A;  3S1Q J;  5J1R A;  1IG7 A;  3BR5 A;  2DMT A;  1JTY A;  2R0Q C;  4Y7N J;  1POG A;  2GLO A;  1IDY A;  5IOY A;  1JKR C;  2JA5 J;  2JA7 J;  1QVU A;  3PM1 A;  1D5Y A;  3M3Y J;  3S14 J;  3HDD A;  1SFO J;  2HDD A;  2DJN A;  2P81 A;  1DU6 A;  1P7I A;  1TWG J;  4M6V A;  3GTK J;  2LD5 A;  3VPR A;  3SJM A;  2NS8 A;  2KDZ A;  1WH7 A;  1RKT A;  3NAU A;  1FIA A;  2ECB A;  3Q0W A;  4BBR J;  1R9T J;  5EZG A;  2M9H A;  1ZK8 A;  1FTZ A;  1ETW A;  2FD5 A;  3MKL A;  2HOA A;  4B1R A;  3CCY A;  1QVT A;  2EBI A;  2AO9 A;  5HOD A;  1RPW A;  9ANT A;  1GUU A;  2YS9 A;  3HOV J;  5GP9 A;  1ETQ A;  3I4N J;  4A3M J;  3JRB A;  3PO2 J;  3LSJ A;  5IYB J;  1MH3 A;  4XRS A;  2LTP A;  3TW6 A;  2LY9 A;  4IHX A;  2H8R A;  3A01 A;  1IC8 A;  2HXI A;  4EEF G;  4A3B J;  2TRT A;  3I4M J;  2XB0 X;  4IHY A;  2EQR A;  2PMZ N;  3O8H A;  4JX5 A;  1GVD A;  3LOC A;  2VI6 A;  4JYK A;  1ETO A;  5JLX A;  3BTL A;  2B63 J;  4FCY A;  1ENH A;  3W6V A;  3BT9 A;  3F0C A;  4IHV A;  4FIS A;  3S1N J;  1MBF A;  2XGC A;  2CQQ A;  3S2D J;  3JRG A;  1ETX A;  2HQ5 A;  1ZGW A;  3OSF A;  4A3L J;  4HNV A;  1X58 A;  4A3G J;  2CU7 A;  3UKG A;  2JK3 A;  3IH4 A;  1PUF A;  5EG0 B;  3K7A J;  4B4C A;  2H1K A;  3QPS A;  2EZL A;  3DCF A;  3LSP A;  2HYJ A;  4B3A A;  4J19 A;  2L7M P;  5IOZ A;  1BA5 A;  2ID3 A;  4M3F A;  5M5Y J;  2ID6 A;  2E2H J;  3HGG A;  1GV5 A;  2M8G X;  4IHW A;  2XB5 A;  5IP6 A;  2R92 J;  4X6A J;  2NS7 A;  1MSF C;  5FKN A;  1X2M A; 
#chains in the Genus database with same CATH topology
 4U88 A;  4C3H J;  4HNT A;  1X19 A;  1N77 A;  1Z05 A;  1D0Y A;  1O3R A;  2ZFW A;  3E5Q A;  2K86 A;  2KJB A;  2PJP A;  2DA3 A;  2DBB A;  2OUM A;  3S17 J;  1B72 A;  1FMV A;  4NQW A;  4UHT A;  4AID A;  3HSF A;  1LDK B;  4BQN A;  3F8C A;  3V8K A;  4U0Y A;  4J00 A;  3CCE I;  4G6T B;  3FWE A;  2VJ4 A;  4IHS A;  2FOK A;  5ED4 A;  1LPQ A;  1O3Q A;  3RKX A;  5LGN A;  1ZG5 A;  2M4K A;  1I27 A;  1G6N A;  2XKO A;  4A3E J;  3G73 A;  1YO5 C;  1XSX A;  3TO9 A;  5ICG A;  1K79 A;  5F0F A;  2K9S A;  4P1W A;  1S72 I;  4AVZ A;  1Z0X A;  2YUS A;  3F3X A;  1NK2 P;  4EJV A;  1XB4 A;  1XG1 A;  2GIV A;  4I6Z A;  3OIO A;  4RAZ A;  1U3E M;  3WTW C;  1R7J A;  1FJL A;  1Y6I A;  5JVT A;  3BZK A;  2L54 A;  5KK1 A;  1R49 A;  2W85 A;  1OCT C;  4U7D A;  1R1U A;  3NQO A;  1EA3 A;  3E6C C;  2ELK A;  3OYF A;  4JOM A;  2FF4 A;  1YFH A;  3RZO J;  4NUB A;  2HU9 A;  3QU3 A;  2Y75 A;  3FF5 A;  1DU0 A;  3T5X A;  3DBH B;  2K3P A;  3ZPL A;  2LRE A;  2IRF G;  2A6H F;  2EH3 A;  4D7N A;  2DA2 A;  1KZH A;  1ETV A;  2IBD A;  1WI3 A;  2GBY A;  3HOX J;  3AKZ A;  2IA0 A;  2NVT J;  2G0E A;  2FBH A;  2E1O A;  2Z1D A;  2R7R A;  3TO7 A;  1BR4 A;  2XAS A;  2KIU A;  2L4M A;  1IXR C;  4R79 A;  1VQP I;  2P7V B;  3R4K A;  1T95 A;  1TLH B;  4JX4 A;  4UB6 C;  1JGG A;  4P55 A;  3MKY B;  4BDZ A;  1KGS A;  1J59 A;  4B8X A;  1Q1V A;  3MVP A;  1APL C;  3FMQ A;  4C2T A;  4PZJ A;  1QZZ A;  3WGG A;  3MZ8 A;  1ON2 A;  2MBF A;  3IHU A;  3IUO A;  2VKV A;  2W82 A;  3CCL I;  5IT9 K;  2V9P A;  3OIQ A;  4U7B A;  2BY0 A;  3OYH A;  4GYI A;  1B8I A;  4X0G A;  1JTX A;  2G7U A;  3BJO A;  2Y31 A;  3MCZ A;  1SD5 A;  1XMX A;  1MMG A;  1RET A;  4QLC U;  4OIO F;  3SXY A;  3ABK H;  2K9M A;  2O3F A;  1ZHF A;  5F0H A;  2XAH A;  2LFB A;  4A0X A;  1JUP A;  2V6C A;  3WHB A;  4ZTJ A;  3LSR A;  2CW7 A;  1TNS A;  3FKJ A;  3QYF A;  1JKP C;  2QZ8 A;  3LSK A;  3FXR A;  2FMY A;  1OR7 A;  4LIV A;  3OYC A;  2E2J J;  2ESH A;  2EWN A;  2J5P A;  3ZMS A;  1R5H A;  2NOJ B;  5DD4 A;  3VYU B;  2FNP A;  1XGS A;  2C6Y A;  1Y39 A;  2JMW A;  1BIA A;  2LP0 A;  1B9N A;  1Z77 A;  2NNY A;  2L9R A;  1HST A;  3DPU A;  1MJA A;  3WU1 B;  4U0W A;  2R93 J;  2OAZ A;  2XHK A;  1V5F A;  3DTE A;  2EFO A;  5IY5 H;  1SAU A;  4LJZ F;  3VSK A;  5B66 C;  1UEL B;  1PUF B;  2IS1 A;  3GTM J;  1W5C C;  1ZN2 A;  2XDV A;  2EK5 A;  5F6F A;  3ELK A;  1W0U A;  1U9O A;  4HPQ A;  2ZSI B;  2VLA A;  3B6C A;  1OQY A;  3JRI A;  3V7R A;  3HTU A;  2HR3 A;  2L02 A;  1J2X A;  1Y0N A;  3DWL E;  3ZQI A;  1ZRD A;  4AC0 A;  4RB1 A;  1VQ6 I;  1MMA A;  3HOT A;  5HLI A;  4CCO A;  3ONQ A;  4ITV A;  3LAP A;  2BVL A;  3I64 A;  4I98 B;  3CCS I;  4M73 A;  3N4M A;  1ITY A;  3IH3 A;  3GTQ J;  2B0L A;  2RAE A;  4FAS D;  5KAF C;  2FQ4 A;  1BN5 A;  2LH9 A;  3C1D A;  5BNG A;  2Z33 A;  3TQN A;  4EMS A;  1W0T A;  3CC7 I;  4HZF A;  1DQU A;  1OKR A;  2RV8 A;  2AQE A;  3OMY A;  1SVL A;  1AKH A;  1OCZ H;  1MW7 A;  4B09 A;  3FXQ A;  4ZYA A;  1EF4 A;  2R5Y B;  1AOY A;  3E0J B;  4BQO A;  1VND A;  3SDB A;  3I58 A;  4EJU A;  2D1H A;  2X1D A;  3LFU A;  1VFC A;  2IGO A;  3CZ6 A;  3HKZ A;  3PFI A;  1YW9 A;  5K1Y A;  3SZT A;  5BQT A;  2E35 A;  3DEU A;  4YG2 F;  3VYS B;  3GYH X;  2Y0M A;  4EGY A;  5FRN A;  4KDP A;  4L0Z B;  5DV5 A;  1RC9 A;  3TED A;  3H92 A;  4PSX A;  5FO5 A;  1FOK A;  1H0M A;  2L4A A;  3F6O A;  3MN2 A;  1LNW A;  3FBI B;  1I3Q J;  2BHY A;  1LDJ A;  2QSH X;  2BV6 A;  3E97 A;  2M8E A;  1JI8 A;  4E7I A;  3Q0U A;  3GTO J;  1OCO H;  4RAG A;  1FYM A;  3E6D A;  2DA6 A;  2EV6 A;  3HM5 A;  4I0A A;  4Z6Y A;  5E3L A;  4B44 A;  4OU0 A;  4RS8 A;  4BE2 A;  1FP2 A;  2Y0S N;  2CQK A;  5HNF A;  3RSN A;  2O7O A;  4KIS A;  3ZMV A;  1SFU A;  2TCT A;  2Y9Z A;  1FC3 A;  1Z67 A;  3AL0 C;  4X1E A;  2EJR A;  2KJC A;  2M7A A;  4A3F J;  3BR0 A;  3U1K A;  2E1N A;  3TP0 A;  4DIQ A;  4CYC B;  3KET A;  2M34 A;  3L1P A;  2VPL A;  3FXK A;  2P4W A;  3QPH A;  4NBQ A;  3M07 A;  3KP2 A;  1YX3 A;  4ZZD A;  1IRF A;  1T8I A;  2NVY J;  4BJT A;  1EKE A;  1YOV B;  2DPU A;  3CQZ J;  1W7P D;  1XMK A;  2OCE A;  3H5N A;  2QWW A;  2HTS A;  2EIJ H;  3Q3S A;  2ZME A;  4N9H A;  1D1A A;  2H6C A;  2E19 A;  3FXM A;  4C3J J;  5C4J J;  1HSJ A;  2DA5 A;  4HST A;  2M87 A;  2VL8 A;  4YFX F;  3M8F A;  3IWF A;  3LMM A;  5J1Y A;  2CUF A;  4ZYE A;  1QQI A;  1O3S A;  4RGR A;  2A5Y B;  4P9U A;  5LFA A;  1NH3 A;  1P6R A;  3KYC B;  2ME0 A;  3HJE A;  3KP3 A;  1WPK A;  4HSR A;  4PGG A;  4NHJ A;  2L3D A;  2E60 A;  2V26 A;  2TDX A;  4HF1 A;  4AIJ A;  3SFZ A;  1E2X A;  2F5D A;  4HBL A;  3WTZ A;  1GT0 C;  4IRI A;  5IP9 J;  5CVU A;  1F4K A;  3CDL A;  3SZG A;  1KQ0 A;  3WHC A;  3JRC A;  2AS5 F;  2H94 A;  3CDH A;  3VDX A;  2COB A;  2E7X A;  4BBS J;  5K7F A;  5TGT A;  4ESB A;  4ETS A;  2CGP A;  4GFB A;  3O3K A;  1YX5 A;  1YIT I;  4RGS A;  4F55 A;  3L2R A;  1HXD A;  3K1P A;  2KP6 A;  1IUY A;  4QIW N;  1U6G A;  2PMH A;  4F7Z A;  4AUX A;  4FQG A;  2M0M A;  1IUF A;  5F0C A;  4E7H A;  3A0H C;  4ZJZ A;  3AG2 H;  4MQ9 F;  1WFX A;  2LYC A;  3JRH A;  2E5N A;  4YRV A;  2XPW A;  1I39 A;  3BTJ A;  1P4W A;  3KLN A;  1G3T A;  2CW0 F;  4ON0 A;  5HVQ C;  4ZZL A;  2FQ3 A;  2EPF A;  1XCV A;  3CMM A;  4QWQ A;  4H4K C;  1FMW A;  4JX6 A;  2IS2 A;  2F2E A;  1HKS A;  1IF1 A;  1XC5 A;  3I9V 2;  4D7M A;  1AU7 A;  2DAO A;  1WJA A;  2EV5 A;  5IT3 A;  3HUG B;  1D0X A;  5E8G A;  1TZL A;  5J1R A;  3G6E I;  1KU9 A;  3JSP A;  3S93 A;  2ICW G;  4B3X A;  4IX7 A;  1J75 A;  3DFG A;  1IDY A;  3REO A;  4KN4 X;  3K1N A;  2B7E A;  2JA5 J;  3PM1 A;  3M3Y J;  2FEZ A;  1XSD A;  1TL8 A;  5CQE A;  2F5F A;  2X0L A;  2DJN A;  4ANJ A;  1DU6 A;  2YPR A;  4E7J A;  3I3L A;  4UXN A;  1TWG J;  4HEA 2;  2DFE A;  2WY8 Q;  4M6V A;  5H20 A;  2LD5 A;  5D8L B;  3V4G A;  5BPI A;  2K4J A;  1WH7 A;  3G3Z A;  3AL0 B;  4MTD A;  2ECB A;  2L5Q A;  2HKO A;  1FSH A;  2E34 A;  4NB5 A;  4RMN A;  4IQJ A;  1O3T A;  4MNU A;  2F4M B;  2M9H A;  2ZNZ A;  4IQ4 A;  4BDY A;  1ETW A;  4HX7 A;  3LA3 A;  1WVR A;  5D4S A;  3GFM A;  4KT6 A;  4XLE A;  3CCY A;  4BH9 A;  2L01 A;  1KU7 A;  2MYS A;  2AO9 A;  2KRH A;  3MWM A;  5H2F C;  9ANT A;  3T8T A;  2YS9 A;  2R7F A;  4CH7 A;  5CKT A;  1LVK A;  4RGX A;  3FDY A;  2X51 A;  3N05 A;  4KN7 X;  4ZYD A;  3LSJ A;  5IT9 Z;  3TW6 A;  4IHX A;  1QZE A;  3A01 A;  1XX5 A;  2HXI A;  2KHM A;  3M8J A;  4A12 A;  1QA6 A;  2RNJ A;  2BVM A;  2GXA A;  3I4M J;  1CF7 B;  4G9Y A;  1VQ4 I;  5CLS A;  3ERE D;  2I5U A;  4HA8 A;  1UG0 A;  3FMS A;  3O8H A;  1DUX C;  2PMU A;  4PJJ A;  3LOC A;  2XRO A;  1S9H A;  4JYK A;  1S8N A;  4LB6 B;  5D5V B;  1ETO A;  5JLX A;  3LFK A;  4KA4 A;  4IHV A;  4OOI A;  3S1N J;  3U1D A;  1U8R A;  3OYL A;  1Z7L A;  2HQ5 A;  3OSF A;  4B48 A;  1O7F A;  2GWR A;  1DPR A;  5D5X B;  1VQK I;  2CU7 A;  3WU0 A;  1UCR A;  3O6B B;  3GFI A;  1PDN C;  2EZL A;  2WAE A;  4WK8 F;  3HG9 A;  3J7A O;  5HLG A;  3DTK A;  1GV5 A;  2M8G X;  1TP4 A;  5IP6 A;  1TQM A;  2R92 J;  2YX7 A;  2IGK A;  1SD6 A;  4HG2 A;  5H6Q A;  3D5L A;  2I8D A;  1B4A A;  1LKX A;  2F4I A;  1I50 J;  3CF2 A;  4G6Q A;  4HF0 A;  4RBO A;  5DYM A;  2JPC A;  4BJ5 C;  4DNC A;  2DI3 A;  4XID A;  3KYL A;  3ASN H;  2JA6 J;  1P4A A;  4BXF A;  1ULY A;  2OCC H;  1OMI A;  1YRN A;  5KNL A;  2JJ7 A;  1JJ6 C;  2VJJ A;  3G1L A;  4XR6 A;  3VOD A;  3BG9 A;  3RPU A;  3JSO A;  1W4M A;  2DW4 A;  5BPD A;  2HQA A;  2OTJ I;  1ON1 A;  1AHD P;  2Y9Y A;  4XON A;  4DYC A;  5JHU A;  2Y0S A;  4DBQ A;  1TW3 A;  1NG6 A;  2ETH A;  1V3F A;  4HOB A;  1P7J A;  2VT2 A;  4CA0 A;  3OYE A;  2CH0 A;  4AYB N;  3ZQH A;  2KLO A;  3K4J A;  4M71 A;  4E7Z A;  4NDL A;  5CQG A;  1P9Q C;  3M9A A;  4M6X A;  3F22 A;  1T39 A;  4RDU A;  1B9M A;  3RQ4 A;  5DDG A;  2LY2 A;  3TDU C;  4ENM A;  2OZU A;  2VKD A;  1KON A;  2E71 A;  2PG4 A;  2EFP A;  2EA4 A;  1BM9 A;  3H9G A;  3QPL A;  1U2W A;  3GVA A;  2P5L C;  4DQ2 A;  2VC0 A;  1IN4 A;  2W4S A;  2M3A A;  3CF5 F;  3MMY B;  2ZJP F;  2X1E A;  3BPX A;  3GCM A;  1ZLJ A;  4D1Q A;  1XMA A;  1OLT A;  4G7Z F;  3CUQ C;  3CJN A;  4HDV A;  2JA8 J;  1GV2 A;  1YI2 I;  4C30 A;  3ZQL A;  4DGW B;  4MTE A;  2FBK A;  1ZG1 A;  2DMP A;  2K7L A;  4U0V A;  3OYJ A;  4PJM A;  3HBL A;  2F4O B;  2JZY A;  5HS7 A;  1D0Z A;  3BR3 A;  3W2W A;  4H0E A;  2A6T A;  3EYI A;  5GTI C;  4UV8 A;  3FMR A;  4MEY F;  4KIF A;  2OBP A;  3I59 A;  3GBG A;  3TW7 A;  4M9S A;  3K10 A;  1PJR A;  1SFX A;  3CO6 C;  2VUM J;  2DT5 A;  4UVB A;  1YG2 A;  1YJW I;  2GOX B;  2HPM A;  4FT8 A;  4LFU A;  2DK5 A;  2RDP A;  4JP0 A;  4Y4R A;  4KYW A;  4L9T A;  2Y2Z A;  2WBM A;  2D5V A;  4R1H A;  3J80 Z;  2IAI A;  4IRG A;  3BZC A;  2VJ5 A;  4JBA A;  1BI1 A;  2WTE A;  2XVC A;  4WX9 A;  2XRN A;  5KVR A;  1K6O A;  2V79 A;  1G59 A;  3OWT A;  2A5W A;  1FOY A;  3I0T A;  1OJL A;  2NVX J;  2JRT A;  2L7K A;  4XKW A;  3J81 Z;  3Q9S A;  3HOY J;  3GF2 A;  5CVR A;  3HSE A;  3FM5 A;  2Z16 A;  3OS0 A;  1HF0 A;  1U78 A;  4W97 A;  3SFI A;  3HOS A;  3DKW A;  1IV6 A;  3A1Y A;  4DJA A;  1DGW Y;  3JAM K;  3AG1 H;  3KZZ A;  1UB9 A;  1SD7 A;  4BY1 J;  2FX0 A;  5M3M J;  2ZJ2 A;  1K4S A;  3GO5 A;  4YII A;  1Z1D A;  3CP8 A;  1BOA A;  1IAW A;  2LK2 A;  4DBR A;  2QA4 I;  1MMS A;  1OCP A;  2Z99 A;  4N4O B;  1MJB A;  5FLM J;  2XV4 S;  2DOD A;  2HQR A;  4HV5 A;  2QQ9 A;  3K2Z A;  3HXL A;  3CUO A;  2VOO A;  1WH5 A;  2A61 A;  2LDU A;  4CCM A;  4V2F A;  2LVS A;  4F52 A;  5FB2 A;  5KHD A;  2X1C A;  4UB8 C;  3P9I A;  4YEL A;  5IP7 J;  1IGN A;  4ASN A;  1OCR H;  2XGD A;  1U0J A;  2QSG X;  5GAG J;  2QGU A;  1BOB A;  4A6D A;  3OL3 A;  2ZSH B;  2XAF A;  5J4Y A;  4U87 A;  2A69 F;  2MH9 A;  4UY8 I;  4JK1 X;  1G3W A;  2A05 A;  4M3B A;  5DEQ A;  2DFF A;  4TV7 A;  3RPU D;  3DQV C;  5TIS C;  4C2M J;  5ICE A;  4M74 A;  3FIS A;  2FA5 A;  4I99 C;  5KAI C;  2UXN A;  2HOS A;  1A6I A;  1I6X A;  1TBX A;  4LLN A;  2FNA A;  2YSR A;  3AFH A;  5A2Q K;  4K2E A;  1Z21 A;  2HOT A;  3HL2 A;  4LD5 A;  2VKE A;  1RNL A;  3JCU C;  3C2G A;  2A3S A;  4XKB A;  4EJO A;  4XRM A;  4S04 A;  1UMQ A;  1IXC A;  3DEW A;  4A69 C;  3HRS A;  3T8R A;  3ECH A;  3ZCO A;  2R5Y A;  2HI3 A;  4WF2 A;  3J7Y J;  2W24 A;  3HSR A;  5J3L A;  5EDN A;  4Y33 A;  1MJ9 A;  3E1S A;  2ME6 A;  3JR9 A;  4E7K A;  3RKW A;  3PO3 J;  5DD8 A;  2CRG A;  1RIO H;  3RYP A;  4DZP A;  2FJ1 A;  2N8G A;  4HQM A;  2VQH A;  4L18 B;  2B9S A;  4ESJ A;  3S1M J;  3K0L A;  3F8F A;  2BXZ A;  2VPR A;  1FOW A;  1IRX A;  2EA2 A;  1A35 A;  3QOD A;  1VI0 A;  3CD6 I;  4WCG A;  3CCU I;  2MG4 A;  2RNG A;  2PFB A;  4XOP A;  2E1M C;  3DF8 A;  1PP8 F;  3ZQF A;  4EJT A;  2WAQ N;  3H36 A;  4P96 A;  3PIP F;  2WB1 A;  4XNF A;  3OYN A;  2KQR A;  5LLQ A;  3SEQ A;  2EFQ A;  5J40 A;  4YFN F;  1KYZ A;  4ZH4 F;  5ICF A;  5DTD A;  4BYY A;  2XKP A;  1QO0 D;  2W84 A;  1YYV A;  2E2I J;  3QOP A;  1CGP A;  1RES A;  1A6Q A;  2QQB A;  3BR1 A;  3GW2 A;  2HDC A;  3BR6 A;  3J7A Y;  4UVC A;  2A07 F;  1FBU A;  4S0H B;  1LB2 A;  4YIF A;  3Q0V A;  2DOE A;  2FXA A;  2PBI A;  1R00 A;  3CP2 A;  5AIQ A;  4IL6 C;  3KX2 A;  1WRJ A;  1HA8 A;  2R7W A;  2R7U A;  3D1N I;  1G3S A;  3DU6 A;  3ZMZ A;  4OIQ F;  1SFK A;  4MHG A;  4BHC A;  2Q0O A;  4LMY A;  2Y30 A;  3R60 A;  1QU3 A;  1HKT A;  5EG0 A;  2K9L A;  3BWG A;  2E5Z A;  2X6O A;  1K61 A;  1BW5 A;  1ZRE A;  1T0F C;  1T6S A;  4GCV A;  2VOD A;  4DZJ A;  3PQK A;  3OYI A;  2Q1Z B;  2ZO4 A;  1B8I B;  1MBJ A;  2LC2 A;  1O57 A;  4FTH A;  2KIF A;  3ASO H;  1STZ A;  1ZH5 A;  1REP C;  1ETK A;  2L9S A;  1AWC A;  2LBF A;  2LRD A;  1LJ9 A;  4RM2 A;  1ACI A;  3BTI A;  3V8L A;  2KRC A;  3VSL A;  3GX4 X;  1S7O A;  3UNG C;  5EZH A;  3R6S A;  5CYV A;  3L2U A;  2CQ7 A;  3KP4 A;  3E3V A;  4PJN A;  2W7N A;  1G3Y A;  2RKH A;  4CIC A;  1JE8 A;  1FYK A;  2CV1 A;  2O8K A;  2QM3 A;  2VE9 A;  1LDD A;  2IEK A;  2OD5 A;  3C2H A;  3TGN A;  4XMY A;  1S7E A;  4A3J J;  1X2N A;  4JQF A;  1QNT A;  4XM3 A;  2CSO A;  1WWX A;  2OZ6 A;  5FKK A;  1OFC X;  2LF7 A;  1MNM C;  5L3F A;  3DPL C;  3IRR A;  2ACJ A;  2V6E A;  3LA2 A;  4L9V A;  3EDP A;  3QYB A;  4Q5S F;  2K9N A;  3TP3 A;  3PL8 A;  2D45 A;  2OA4 A;  1VQL I;  4E6K G;  3IH2 A;  1BJZ A;  3E7L A;  1A5J A;  2GIZ A;  5E8I A;  2PX9 A;  2ZXI A;  4WXD A;  2ZJR F;  5C4X J;  3P5J A;  3CDI A;  5A2Q Z;  2R7S A;  5D4R A;  2XGE A;  3BG5 A;  1HQC A;  3S2W A;  3K2A A;  5DCM B;  1Z6T A;  2JPB A;  3H5A A;  4KUM A;  4EM1 A;  1R1V A;  3NWT A;  2FSW A;  2LLK A;  4GGG A;  1EJ9 A;  1ZGJ A;  3FHZ A;  4I0B A;  2DLL A;  3FKI J;  1PYV A;  2DTR A;  3OOU A;  1GXP A;  3S1Q J;  1IG7 A;  6PAX A;  2HQN A;  2DMT A;  5JHF A;  3Q9V A;  5EEH A;  2BW3 B;  3DV8 A;  5DM7 F;  2BZT A;  1POG A;  2JSP A;  3F8N A;  3DXJ F;  3FXJ A;  5IOY A;  3PSF A;  4ENK A;  4XN3 A;  4BQA A;  1QVU A;  3S14 J;  3CLO A;  1XD7 A;  3HDD A;  1SFO J;  2K3F A;  1KA8 A;  2DDB A;  2WY7 Q;  3W6K B;  2EFN A;  2PEX A;  3GTK J;  4CO8 A;  2VJI A;  2J5O A;  1FP1 D;  5LBQ A;  2CO5 A;  1FIA A;  1VQM I;  2MAB A;  3QPT A;  2QEN A;  3Q0W A;  2ZJQ F;  2LNB A;  3JAM Z;  1KYW A;  3MKL A;  3S32 A;  2WC2 A;  4B1R A;  3RKY A;  4YIR X;  3LST A;  2G9W A;  3JW4 A;  4ZDO A;  2EBI A;  1YLF A;  3C3W A;  1RPW A;  2CYY A;  4ZDL A;  3CJT B;  1GUU A;  3EUH A;  3E5X A;  5GP9 A;  4PJ0 C;  2V1N A;  4A3M J;  1ZLK A;  1IN7 A;  1EH7 A;  1MH3 A;  4XRS A;  2O5R A;  2LY9 A;  3MKW B;  3BY6 A;  2H8R A;  1Y8R B;  1IC8 A;  1XGO A;  2M30 A;  1WQ2 A;  4A3B J;  1V54 H;  2HS5 A;  3V7C A;  2G7H A;  3OL4 A;  2XB0 X;  1GVJ A;  3CCM I;  3ZQ7 A;  1K78 A;  1GVD A;  2VI6 A;  1BI2 A;  2RQP A;  1L0O C;  2X6Y A;  4FCY A;  3W6V A;  2QBY B;  1FBS A;  1FY7 A;  3L09 A;  3L00 A;  2P5K A;  2KPM A;  4O6J A;  5B1A H;  2IW5 A;  2EV0 A;  1D8K A;  3KEQ A;  1RI7 A;  2BXY A;  3OOP A;  4BJ6 C;  5LHG A;  3DBL B;  3ZRG A;  1EH8 A;  4ENJ A;  4IVN A;  3CCQ I;  4A3L J;  2OU2 A;  1BC8 C;  3M1E A;  4A3G J;  3WG7 H;  2R7T A;  2MFZ A;  1PUF A;  1D5V A;  4BE0 A;  4B4C A;  1ZRC A;  3G4S I;  3BDD A;  2JQ7 A;  3KYD B;  3OYG A;  3OS1 A;  4NC6 A;  4B3A A;  4J19 A;  3K9T A;  3CJR B;  4A0Z A;  1YE9 A;  3WTY C;  4HDU A;  4M3F A;  5M5Y J;  3HGG A;  5LGU A;  2XB5 A;  1N25 A;  1MD0 A;  4CSW A;  2W57 A;  3DTI A;  4EM0 B;  4F3Q A;  2O03 A;  2KDZ A;  1RUO A;  3QRF F;  2RVC A;  3MAJ A;  2ZKZ A;  4MGR A;  4OWR B;  4RAY A;  3JTG A;  1OYW A;  3ESW B;  3GZ5 A;  4KT5 C;  2K40 A;  4C3I J;  3OS2 A;  1ZKG A;  5E79 C;  3ZMT A;  4A93 J;  1ZRF A;  4A3K J;  2P0W A;  2MA3 A;  1A36 A;  4OMZ A;  2V9K A;  4M6Y A;  3B02 A;  1VQ5 I;  2IS6 A;  2YU9 J;  1SC7 A;  2JUG A;  5E17 F;  1R5I D;  2VQG A;  1ZAO A;  2CUZ A;  1U8B A;  4QSH A;  3VWB A;  4BQQ A;  4NNJ A;  3WU2 C;  2HOE A;  5D5U B;  1Y8Q B;  1MMN A;  3BCB A;  4Y3O A;  1TWH J;  5EGO A;  4CYC A;  5EEG A;  2CUE A;  5IYC J;  2GA1 A;  3BR2 A;  4L5I A;  2H1L A;  3IAM 2;  3HOU J;  1BI3 A;  2I10 A;  2QQA A;  2FUG 2;  4D5C A;  2CQX A;  4IKF A;  2DYR H;  5DM6 F;  2HVQ A;  2Q2E B;  2VBZ A;  2ZME C;  3A0B C;  4AIH A;  1X3Z B;  2YX4 A;  2DPD A;  1H9G A;  2PJR A;  2NVQ J;  1WHU A;  2E36 A;  3LQQ A;  4AIK A;  3M8E A;  4ZC3 A;  3MQ0 A;  1FT9 A;  2BY1 A;  1WSU A;  2X48 A;  3HC7 A;  2XSJ C;  2R5Z B;  3C2B A;  1Z91 A;  1X1P A;  5FD5 A;  3GME A;  4ENN A;  1CQT A;  2HDW A;  4QPO A;  2JVG A;  1RZ4 A;  2W00 A;  3IKT A;  4PFO A;  1LFB A;  3JRA A;  4AVP A;  1W5T A;  2WV0 A;  3L2C A;  1B59 A;  4BAC A;  3DBR B;  4MFD A;  5GAH J;  5GPC A;  3TMO A;  5CVV A;  2GM4 A;  4M9X A;  3X2Q H;  5J8C A;  3SZP A;  5FLX K;  5JR3 A;  2K9Q A;  1BR2 A;  2DA4 A;  3T0Y A;  2BOL A;  1FX7 A;  2DCE A;  4O3M A;  3RZD J;  3BRO A;  2DN0 A;  3RI4 A;  1FWZ A;  1UZC A;  1YHQ I;  1XCB A;  1JHF A;  2FOW A;  1HW2 A;  4FET A;  1TWA J;  1XDS A;  4CXF A;  2PJR B;  4AU7 A;  1H88 C;  5FKM A;  1LFU P;  2X4H A;  3HOW J;  4CZC A;  1YW7 A;  5BS6 A;  5DS9 A;  3CCR I;  3RTR A;  1KQ9 A;  2XC7 A;  4BGD A;  2QCO A;  3F6V A;  1PVE A;  2Z3Y A;  3VB2 A;  2CMP A;  4HX8 A;  2ELH A;  5F1J A;  1BJA A;  4N0B A;  2DDA A;  2E7W A;  2VT3 A;  3K1M A;  3GTG J;  4AWX B;  3PQJ A;  2HVS A;  2V7F A;  1FTT A;  1ZAR A;  2A68 F;  2WAQ A;  1V4R A;  2DOF A;  4G12 A;  3GFL A;  4HRI A;  2H27 A;  2AXT C;  1FIP A;  4DW6 A;  4DYQ A;  1UFM A;  1TTY A;  3ZN1 A;  2EZI A;  1J0R A;  2FBI A;  2XGX A;  4A5N A;  3M4O J;  1YIJ I;  2BY2 A;  5FLV A;  1P2F A;  4HW0 A;  1GDT A;  4RGU A;  1GHC A;  3RQI A;  1X1D A;  4M3E A;  1LVA A;  2Q8K A;  5K5O A;  2CV2 A;  1HOM A;  4Y17 A;  4B47 A;  5L3B A;  2NVU B;  3ULQ B;  2GXG A;  3NAR A;  3IC7 A;  2DK8 A;  2Z9O A;  2XUB A;  3MKZ A;  2CUJ A;  5AON A;  3T1B A;  5EGO B;  4LG0 B;  2EIL H;  4XSX F;  2FML A;  4UUS A;  1RKW A;  1R1T A;  5FD6 A;  3GFJ A;  3BJA A;  3FBN B;  4LLG F;  1UHM A;  2BYV E;  4FE7 A;  5J47 A;  1SD4 A;  5F04 A;  3S3M A;  3K4C A;  4CCJ A;  2D2W A;  3BOQ A;  3C7J A;  2ZC2 A;  5BOX A;  2LF8 A;  4HAM A;  4BKX A;  5EF6 A;  2R7Z J;  3HKZ N;  4I09 A;  2ECC A;  2OQG A;  5F64 A;  5IPA A;  1MNE A;  3W3C A;  1ZTR A;  2NRA C;  2DMU A;  2Y69 H;  3ABM H;  2V4J C;  4IOC F;  2ELJ A;  1JT0 A;  3CCV I;  3K4L A;  4XLH A;  4WXH A;  1PP7 U;  2L9N A;  3OYK A;  2BGC A;  2DYS H;  2IVM A;  1RUN A;  3S16 J;  1MBK A;  3SYT A;  2ZFU A;  2F5V A;  2STW A;  1MND A;  2HZD A;  1WJE A;  2NYX A;  3B73 A;  3ZXS A;  4E4H A;  1K6Y A;  3K70 D;  2QKL B;  5LGT A;  4G6D A;  4A3D J;  2BW3 A;  2OPT A;  3WTV C;  1F9N A;  3KE2 A;  5J4V A;  2GQQ A;  4M3D A;  1IZ1 A;  4MO7 A;  4HV6 A;  2X6X A;  3PIO F;  2ISY A;  5LD2 C;  1DP7 P;  1MGT A;  5FRM A;  2QKM B;  1Y1V J;  2VAS A;  3QQA A;  4F91 B;  1B6A A;  1RR7 A;  2GAU A;  3L7W A;  1RR8 C;  1C0W A;  4HX4 A;  1FEX A;  3H0G J;  1X1A A;  3P7N A;  1T56 A;  4M3G A;  3L2Q A;  2V1U A;  2VN2 A;  1V5E A;  4F92 B;  3G1M A;  4OAZ A;  3AAF A;  1JGS A;  3O2P E;  1ONV A;  4KIB A;  2JN6 A;  2E1M B;  2RN7 A;  5FLX Z;  1HCR A;  2DQL A;  3FXO A;  2CWE A;  4LIT A;  5H6R A;  1SVM A;  3TOB A;  4EM2 A;  4Q4Z F;  1D8J A;  1R58 A;  3FIW A;  3BQZ A;  3CMA I;  1ORK A;  3K6G A;  1O7L A;  4V19 K;  5LRR A;  2X6W A;  1HBX G;  2E1C A;  4IHT A;  2UZK A;  3S15 J;  5FFZ A;  4EJW A;  2KMU A;  2WB1 N;  5K7Z A;  1FYL A;  4ZTF A;  4IEJ A;  1LQ1 A;  3ML6 A;  1BC7 C;  1ZR4 A;  1ZQ3 P;  1I1S A;  2KRF A;  2XSD C;  4CDG A;  3QP6 A;  2FU4 A;  3KEY A;  1Z3X A;  1X1B A;  4GYG A;  3DKY A;  3OV8 A;  3KZI C;  3HRU A;  5B1B H;  3I4P A;  4PUS A;  5F08 A;  4XLC A;  2JSC A;  4D5F A;  3IP4 B;  3LAJ A;  2UUZ A;  3ZR8 X;  4ABZ A;  2F6C A;  4XRF A;  3D5R C;  4Y52 J;  3TDZ C;  2VBX A;  1F5T A;  4E70 A;  4KIG A;  2M5W A;  2O9L A;  1IN6 A;  1B1B A;  2W25 A;  2DQR A;  2HNH A;  1U5T A;  2MC3 A;  1Y1W J;  4PK4 A;  2AHQ A;  2MGQ A;  1OCC H;  4G94 A;  1IDZ A;  3D5S C;  3JRD A;  5E1X A;  3JRF A;  5F1R A;  4BE1 A;  3A01 B;  1WJ5 A;  5K7H A;  3ABT A;  5D8K B;  1NHA A;  1K78 B;  2MH2 A;  3U9G A;  2NXN B;  1TW2 A;  2PN6 A;  1WKM A;  2Y48 A;  5HLH A;  3GTP J;  2KT0 A;  1QHH D;  1BBY A;  3I55 I;  2L7Z A;  4LG0 A;  1LUJ B;  1O4X A;  2R5Z A;  3GTL J;  3HUG A;  2AXL A;  2RRE A;  3KP5 A;  5FRO A;  5J8F A;  4D9J A;  2O0Y A;  3PFY A;  2MC4 A;  4AYB A;  1HW5 A;  4A5M A;  3HPG A;  4BEH A;  5E1W A;  2KIS A;  1IW7 F;  2NOG A;  1LE8 B;  3FXL A;  3KPH A;  4S05 A;  1JKO C;  5AIP A;  2HVR A;  4Z2Y A;  1NG7 A;  3H1C A;  4F93 B;  2COM A;  2IA2 A;  2W1O A;  2ZBK A;  2DMQ A;  2CFX A;  1YW8 A;  1X4P A;  2JT1 A;  1FNN A;  4LK0 F;  2L0K A;  1XS9 A;  1JUS A;  1QZY A;  2DMN A;  4BS9 A;  3ZMU A;  1Y56 A;  3D0S A;  1XDU A;  1WCM J;  3BZ6 A;  3MFK A;  3LSH A;  1MSE C;  1IRZ A;  2VON A;  1M1E B;  1HDD C;  1Z6R A;  1JUM A;  5E3N A;  2ZXW H;  1BIB A;  4BL0 B;  4I2O A;  2M1B A;  5GTH C;  4CHU A;  1J9I A;  3EQL F;  2EB7 A;  3AG4 H;  3RJP A;  1MDM A;  2NNN A;  5J6X A;  3R0A A;  1JTY A;  2R0Q C;  2QQ8 A;  1YS7 A;  1IRG A;  1W7P B;  1X3W B;  3JTH A;  3FHN A;  2QVO A;  1JKR C;  3G71 I;  2VQC A;  5K5R A;  1D5Y A;  2JA7 J;  2IXS A;  3I59 B;  4O5V A;  4Y15 A;  2BHZ A;  2P7C B;  1SFE A;  2HDD A;  1WJF A;  1E17 A;  5FFX A;  2X85 A;  1OR7 C;  5LHH A;  1PUE E;  4XKC A;  3SJM A;  5TRD A;  2NS8 A;  2OQR A;  4I7H A;  3HTS B;  1RKT A;  2P8T A;  2IS4 A;  3H9Q A;  3NAU A;  1JHH A;  1TQP A;  4I01 A;  1DDN A;  4I02 A;  3PJR A;  1FOX A;  2RGV A;  5LHI A;  4J01 A;  1R9T J;  5EZG A;  2VE8 A;  4PJL A;  1ZK8 A;  2EIN H;  3W2A A;  2K27 A;  1FTZ A;  1D1B A;  2HOA A;  3BC8 A;  2O61 A;  3ABL H;  2UV1 A;  2V1D A;  4PFP A;  3VEP A;  3MD2 A;  3TL4 X;  4M72 A;  3HOV J;  1U5T C;  3HHH A;  3VFZ A;  3JRB A;  3PO2 J;  1XGN A;  5IYB J;  3QAH A;  2ADU A;  2ISZ A;  1VQN I;  4HLY A;  2LG4 A;  4L9J A;  4PDK A;  4XLA A;  2PMZ A;  1TNT A;  3ABU A;  3BLY A;  1SMY F;  2KIM A;  5TJJ A;  4BUP A;  4IHY A;  2EQR A;  5HDG A;  1YIO A;  2WA0 A;  2JTV A;  1WI9 A;  4KFC A;  2KFD A;  3FZV A;  2Q2E A;  3K70 C;  4C2U A;  2R7Q A;  3BTL A;  2B63 J;  3R0J A;  3H3Z A;  3LWF A;  1EH6 A;  4FIS A;  4LK1 F;  1S7A A;  1MBF A;  4KMF A;  2XGC A;  2CQQ A;  3JRG A;  2QLZ A;  2QEX I;  3E6M A;  1J7K A;  2VBW A;  1ZG3 A;  1T2K A;  3W2V A;  4HNV A;  3KZY A;  3L2W A;  2JUC A;  1W36 C;  3R61 A;  2HZT A;  4OIR F;  2JK3 A;  3UKG A;  1K7A A;  4WXC A;  2OV7 A;  3E6B A;  1GLN A;  4II3 A;  4E7S A;  4BEH B;  5EG0 B;  4FHT A;  1E3P A;  1MMD A;  3QPS A;  3LSP A;  2HYJ A;  3VYR B;  3F23 A;  3PUF A;  2L7M P;  1BA5 A;  3WGH A;  3CCJ I;  1IN8 A;  3V7S A;  2VXZ A;  2DO7 A;  3OY9 A;  4XQF A;  2E2H J;  1G8X A;  1CF7 A;  2ZNY A;  5HOO A;  4UVA A;  2R7X A;  1ZYR F;  4CGZ A;  2NS7 A;  4X6A J;  1MSF C;  2IA1 A;  1X2M A;  4P5O A;  3RYR A;  1YJN I;  3KCC A;  4OIP F;  5HS8 A;  1N78 A;  2BEO A;  1D3Y A;  1A04 A;  1QGP A;  4XLN F;  5ILS A;  2JWT A;  2LOO A;  4Y13 A;  3HIF A;  2VBY A;  1TWC J;  3BQY A;  4CCN A;  4IOA F;  4AM3 A;  3GEZ A;  4M9Z A;  3EUH C;  2QUF A;  3CLQ A;  1BI0 A;  1XGM A;  1MBH A;  1VQ7 I;  2DJI A;  5IYD J;  1SAX A;  3GUD A;  4HQE A;  3TO6 A;  3UR3 C;  2F5C A;  3HB9 A;  4XK4 A;  5BMZ A;  4YFK F;  3ROU A;  5L3D A;  3BG3 A;  3K69 A;  2DU9 A;  4V2G A;  2V9V A;  2OC6 A;  2KL4 A;  3HRT A;  1HLV A;  2HWV A;  4NC8 A;  5DUI A;  3IL2 A;  1XN7 A;  3PUB A;  3GTJ J;  1I1G A;  4KJZ A;  5E20 A;  4FX4 A;  4L9N A;  1R4M B;  3ZQC A;  1R4N B;  3JRE A;  4RAF A;  2STT A;  4I76 A;  4A3C J;  2DA7 A;  3OIP A;  3HYI A;  3S3O A;  1E0E A;  2HFH A;  1AKH B;  3ZQG A;  4YEJ A;  2K5C A;  2CS3 A;  3OR1 C;  1UHW A;  2ZXH A;  2XF6 A;  5L3E A;  2CQN A;  4BY7 J;  4DOZ A;  3BG6 A;  3VYT B;  4RB2 C;  3F8B A;  1K83 J;  3LNQ A;  2HXO A;  4NC7 A;  3RPQ A;  3IV5 A;  1ERD A;  3RIR A;  5LRS A;  3RDI A;  3CTA A;  5GAD J;  1HC8 A;  1H9T A;  3QWL A;  4FX0 A;  5D6F A;  2LR8 A;  3A02 A;  1YTY A;  3ZMD A;  3GLL A;  2WAF A;  3I54 A;  5EYR A;  1R71 A;  2EFW A;  5JLW A;  2MD5 A;  4C9Y A;  5HDN A;  4UUV A;  2M2E A;  3IKV A;  4IRH A;  2XAU A;  3S1R J;  2LSO A;  3L9F A;  2QBY A;  1FBQ A;  4G8X A;  2DT6 A;  1TC3 C;  5CVI A;  4W1U A;  5J1U A;  5JVG F;  3J7Z I;  1F43 A;  2CG4 A;  3Q5F A;  5ERI A;  2CW8 A;  2ZCW A;  4II2 A;  5FJ8 J;  1OIS A;  4IZZ A;  3DP7 A;  3PNT A;  1JT6 A;  3SEZ A;  4XKV A;  3H5R A;  2R7O A;  2K4B A;  4ZYG A;  1G2H A;  4HYE A;  1FSE A;  1U5T B;  2D1V A;  2QSF X;  2VOP A;  1TWF J;  3OYD A;  1JKQ C;  3MZY A;  2A6E F;  3ISP A;  3A4C A;  3O8G A;  5JI6 A;  4EGZ A;  1Q1H A;  1H89 C;  2CJJ A;  3OYA A;  2KZG A;  3GZN B;  2DT7 B;  2P6S A;  3LL7 A;  5HS9 A;  3LQR A;  1BR1 A;  2IPQ X;  4CCK A;  2VKH A;  4CZZ A;  1IXS B;  5FGM A;  5HNH A;  3ECO A;  4KIC A;  4XN0 A;  1VQ9 I;  2H6B A;  3TKY A;  4GO1 A;  5E1Z B;  5B3S H;  1UG2 A;  2GA2 A;  1T33 A;  1X4O A;  4BNC A;  3K4N A;  5C44 J;  5DCM A;  4MIM A;  2XPU A;  2MSY A;  2HGC A;  1FZP B;  1YRN B;  2LBF B;  3WTU C;  4Q48 A;  2XPV A;  4FE4 A;  3WE3 A;  3CUQ A;  3U21 A;  1BL0 A;  1UJ8 A;  5E18 F;  3ZGK A;  5C3E J;  1U9N A;  3RKQ A;  2DOA A;  2KIQ A;  2XAJ A;  5FKL A;  4N9I A;  1UST A;  2NS0 A;  5CVJ A;  1T08 B;  2XAG A;  4QTR A;  2HYF A;  3DKX A;  3K4B A;  3W6J B;  2RQQ A;  5EEA A;  4KNY A;  4BHP A;  3KIO A;  5CJ9 A;  1L3L A;  3M7G A;  4ESF A;  2H8W A;  4WWC A;  1JJ8 C;  2GOM A;  5LEK A;  1XTA A;  1F36 A;  3HPH A;  1P4X A;  2DA1 A;  2L7F P;  3P9C A;  3OYM A;  2BE5 F;  1QRY A;  3LSM A;  3HRM A;  3PNV A;  2IJL A;  2M7B A;  1VF9 A;  1SEU A;  4XRS G;  1LEA A;  3OR2 C;  3F21 A;  3P9K A;  3CME I;  2VC1 A;  1SAN A;  2XF5 A;  4MQV A;  2XIG A;  5D6E A;  1W1W E;  4XSZ F;  4LB5 A;  1J5Y A;  3MZH A;  2GXB A;  1KU3 A;  4LGW A;  4PCQ A;  1A31 A;  3HGY A;  2JA2 A;  3I5U A;  3H35 A;  3RCO A;  2WAD A;  2MW8 A;  5M5W J;  2DXI A;  1TT5 B;  2WV1 A;  4GDF A;  1X1C A;  1EV7 A;  4RLF A;  2QYO A;  4XBF A;  3F9K A;  3GLX A;  5M3F J;  4DYR A;  3G2B A;  1H8A C;  1G4D A;  4G7O F;  1AA7 A;  1Z3Y A;  2M0C A;  3HOZ J;  1MDM B;  3FXU A;  3DLA A;  4HF2 A;  4CCL A;  3CMY A;  1SMT A;  3V42 A;  3BCA A;  2F5E A;  3FK6 A;  4XIC A;  2L9V A;  1R22 A;  3EUK L;  2L2O A;  4A6E A;  1W7P A;  1HKQ A;  2HTJ A;  2EZK A;  3BTC A;  4UUS B;  4BAY A;  3SHF A;  1VQ8 I;  1Z9C A;  3OSG A;  1NTC A;  2XF7 A;  5F27 A;  4QPQ A;  5GAE J;  3LSG A;  4N4N B;  2IGN A;  2KDO A;  3EPZ A;  1V5G A;  2OJE D;  1B72 B;  5DUK A;  3S2H J;  3NWS A;  1MBG A;  2EIM H;  4OAY A;  3IRQ A;  4NQW B;  2VB6 A;  4P9F A;  5ILV A;  1R23 A;  2VQL A;  3E5U A;  1ZR2 A;  2MD0 A;  3F72 A;  2OF7 A;  3C18 A;  3EYY A;  2V1X A;  3PSI A;  5KCM A;  2XRL A;  2MLK A;  1I3A A;  3NRV A;  1DPU A;  2DFI A;  3FK7 A;  4MFE A;  3CC2 I;  1UAA A;  1OPC A;  5CPR B;  4XLP F;  2P5V A;  2Z5U A;  4EAT A;  5FKO A;  1I6H J;  3ZN0 A;  1S6L A;  4Q47 A;  1DGR M;  1LE8 A;  3J81 K;  4IJA A;  1IJW C;  4RLQ A;  3WTX C;  3HEF A;  4XOT A;  2JRM A;  2UWM A;  1QHG A;  2LMD A;  3CC4 I;  1KQ8 A;  4PGH A;  2WWY A;  4XOR A;  3QP5 A;  2X9D A;  3SDG A;  5M5X J;  2M45 A;  3ZOB A;  3J80 K;  3GZ6 A;  3QYE A;  2DTZ A;  3BJ6 A;  1RRJ A;  1USS A;  1WZ2 A;  3B6A A;  1GXQ A;  1Z7U A;  2DFH A;  1FLI A;  2Z2S B;  2EIK H;  3BPV A;  3BP8 A;  2VIX A;  4RM3 A;  4RB3 C;  1WGX A;  4LOC A;  3FM3 A;  4R8H A;  2HEO A;  4GRI A;  1IN5 A;  1XSV A;  2LY1 A;  1NK3 P;  2UXX A;  2R4G A;  1N75 A;  4L5E A;  2W48 A;  3DLL F;  3DU5 A;  3I71 A;  2MLG A;  4L5J A;  2OTL I;  4IPA A;  3H3V K;  3WOD F;  2ZB9 A;  3KP7 A;  3K4K A;  1LEB A;  1DP3 A;  2ZME B;  5E3M A;  2LKX A;  1MKM A;  4EVI A;  2IT0 A;  1QPI A;  4EQQ A;  2QF7 A;  3TOA A;  1OYY A;  3GXO A;  3EUA A;  5GPA A;  1F1Z A;  2PI0 A;  3AG3 H;  3DPT A;  3K4M A;  2CFO A;  4A3I J;  1HW1 A;  1QPM A;  4UUT A;  4UNO A;  4MLO A;  3LA7 A;  4HNU A;  2EZH A;  2KKO A;  1J09 A;  1UHS A;  4G7H F;  2RC4 A;  1WJD A;  3WTT C;  3CES A;  3G1O A;  3GWZ A;  1T38 A;  2O6G E;  3COA C;  3VOE A;  5HLT A;  1R5G A;  1MBE A;  1ETY A;  4EV0 A;  5E3O A;  1E3O C;  1IV8 A;  1ZGA A;  4CUG A;  2ESN A;  1VQO I;  5ICC A;  3F8M A;  1V55 H;  2HKX A;  3BG7 A;  2JVH A;  1XPX A;  3A03 A;  1K4T A;  2PQ8 A;  4BXU A;  3ZP5 A;  4BXX J;  4MEX F;  1HDP A;  1MH4 A;  4CYD A;  1TQI A;  3FX3 A;  2CV0 A;  4A2U A;  1BW6 A;  1P92 A;  5EJC A;  3QOE A;  3BR5 A;  2PLY A;  4B43 A;  3ERM A;  2NAZ A;  4UV9 A;  1T0F A;  3M1C A;  3SQN A;  4Y7N J;  2R7V A;  2H09 A;  3U2R A;  3OYB A;  3EET A;  4HLX A;  4LG3 A;  4ZDP A;  2GLO A;  3L2V A;  3IWZ A;  1W5S A;  3CJQ B;  2IP2 A;  2K02 A;  2ZXJ A;  3KEO A;  1YQA A;  1W36 D;  3IAS 2;  2P81 A;  1P7I A;  4D0P A;  4KMU X;  3VPR A;  1R36 A;  4AD9 A;  3MEX A;  3S3N A;  3HHG A;  1R6R A;  3V8J A;  5LEJ A;  1S5L C;  4RB0 A;  4E7L A;  5ILU A;  5JFR A;  1WJC A;  3WG9 A;  3WGI A;  1OYI A;  4LLL A;  4BBR J;  1S3J A;  3KFW X;  1I5Z A;  1ZEL A;  2YU3 A;  2IGM A;  3CUQ B;  2FD5 A;  1T98 A;  3S8P A;  2FRH A;  1IO2 A;  1LFP A;  1SVO A;  2K85 A;  4A0Y A;  2R3S A;  5L3C A;  1QVT A;  3I53 A;  3H9J A;  3KLO A;  2F48 A;  5HOD A;  5K5Q A;  1ODD A;  2XAQ A;  1ETQ A;  3I4N J;  4XLF A;  1Y0U A;  4XL9 A;  2HPI A;  2LTP A;  1YS6 A;  5D5W B;  5L3G A;  4EEF G;  2TRT A;  2HYG D;  2O8X A;  1VZ0 A;  1X3U A;  4BU2 A;  4OIN F;  2VXD A;  1MIJ A;  4GXO A;  3A2K A;  2PMZ N;  4IO9 F;  5B5E C;  2GZW A;  4JX5 A;  3H0D A;  2P6T A;  4ZYH A;  1QBJ A;  4IF4 A;  3WTS C;  1FPQ A;  2FE3 A;  1ENH A;  4OMY A;  3BT9 A;  3F0C A;  1WJB A;  1TT0 A;  3HZJ A;  3LSI A;  3DEE A;  2AQF A;  3QU6 A;  1E3H A;  3N97 A;  3S2D J;  3NEU A;  2KZV A;  4KIT B;  1ETX A;  1ZGW A;  1YJ9 I;  1JXS A;  5HDK A;  2YR2 A;  3ZQQ A;  1X58 A;  3H3U A;  2M4G A;  1KU2 A;  2LKS A;  2LKP A;  3IH4 A;  3CO7 C;  2R7D A;  3K7A J;  3KP6 A;  3WE2 A;  2H1K A;  1VTN C;  3DCF A;  4RA2 A;  2BY3 A;  4LIU A;  5IOZ A;  1S29 A;  2ID3 A;  4IXA A;  4L0Y B;  2ID6 A;  1D1C A;  1MZB A;  4IHW A;  3PNY A;  4PSW A;  2BBY A;  3TBI A;  4BHB A;  5DCF A;  3I56 I;  5FKN A; 
#chains in the Genus database with same CATH homology
 4C3H J;  1I50 J;  4RBO A;  2DA3 A;  2JWT A;  2K40 A;  4C3I J;  3S17 J;  1ZKG A;  1TWC J;  1B72 A;  4XID A;  2JA6 J;  4A93 J;  3BQY A;  4A3K J;  1YRN A;  2JJ7 A;  1JJ6 C;  2YU9 J;  3G1L A;  3BG9 A;  1MBH A;  1U8B A;  5IYD J;  4QSH A;  4A3E J;  3HB9 A;  4XK4 A;  5F0F A;  2K9S A;  1AHD P;  1Z0X A;  2YUS A;  1NK2 P;  2Y9Y A;  4DYC A;  1TWH J;  3BG3 A;  1XG1 A;  5EGO A;  4CYC A;  4V2G A;  4I6Z A;  3OIO A;  1P7J A;  2CUE A;  5IYC J;  3BR2 A;  1HLV A;  4AYB N;  3ZQH A;  1FJL A;  4NDL A;  3HOU J;  4RDU A;  2I10 A;  3GTJ J;  4D5C A;  2CQX A;  1OCT C;  3ZQC A;  2NVQ J;  2ELK A;  3QPL A;  3JRE A;  3RZO J;  4I76 A;  4A3C J;  2DA7 A;  1AKH B;  3ZQG A;  1DU0 A;  2X48 A;  2EH3 A;  2R5Z B;  4BY7 J;  4D7N A;  3C2B A;  2DA2 A;  2JA8 J;  1GV2 A;  1ETV A;  1K83 J;  3LNQ A;  2HXO A;  3ZQL A;  3IV5 A;  2IBD A;  2DMP A;  1CQT A;  1WI3 A;  2GBY A;  3HBL A;  3HOX J;  2NVT J;  2G0E A;  3BR3 A;  1LFB A;  2E1O A;  3JRA A;  2LR8 A;  3A02 A;  3GBG A;  3TW7 A;  5EYR A;  5JLW A;  4MFD A;  5GPC A;  2VUM J;  4JX4 A;  2GM4 A;  2M2E A;  1JGG A;  4JP0 A;  3S1R J;  2Y2Z A;  1TC3 C;  1Q1V A;  3MVP A;  2K9Q A;  4W1U A;  5J1U A;  2DA4 A;  1APL C;  2D5V A;  1F43 A;  2IAI A;  3RZD J;  5FJ8 J;  2DN0 A;  1JT6 A;  2VKV A;  1OJL A;  2NVX J;  1TWA J;  1G2H A;  1B8I A;  1JTX A;  1H88 C;  2Y31 A;  5FKM A;  1LFU P;  3HOY J;  3HOW J;  1TWF J;  1JKQ C;  1RET A;  3O8G A;  5DS9 A;  1HF0 A;  1H89 C;  1U78 A;  2QCO A;  4W97 A;  3SFI A;  2CJJ A;  5F0H A;  1IV6 A;  4BY1 J;  5F1J A;  2LFB A;  2FX0 A;  1JUP A;  3WHB A;  5M3M J;  3LSR A;  3GTG J;  1JKP C;  2LK2 A;  1FTT A;  1OCP A;  1UG2 A;  1T33 A;  5C44 J;  5FLM J;  4G12 A;  4MIM A;  2XPU A;  2E2J J;  2MSY A;  1WH5 A;  1YRN B;  1FIP A;  4V2F A;  2LVS A;  4DW6 A;  4DYQ A;  2XPV A;  2EZI A;  4FE4 A;  1BL0 A;  3M4O J;  5IP7 J;  1IGN A;  2JMW A;  5C3E J;  1U9N A;  1Z77 A;  2LP0 A;  3RKQ A;  1GDT A;  2L9R A;  2XGD A;  5FLV A;  3RQI A;  5FKL A;  4M3E A;  1HOM A;  2R93 J;  4QTR A;  5EEA A;  3NAR A;  1PUF B;  3GTM J;  4M3B A;  1JJ8 C;  1W0U A;  1U9O A;  1F36 A;  3B6C A;  5EGO B;  4C2M J;  2DA1 A;  3JRI A;  3ZQI A;  3FIS A;  4UUS A;  2L7F P;  4AC0 A;  1RKW A;  2HOS A;  1A6I A;  1QRY A;  1ITY A;  3IH3 A;  1VF9 A;  4FE7 A;  3GTQ J;  2RAE A;  5F04 A;  2FQ4 A;  4XRS G;  5BNG A;  1SAN A;  4BKX A;  5EF6 A;  2HOT A;  2R7Z J;  1W0T A;  3HKZ N;  2VKE A;  2ECC A;  3HGY A;  5IPA A;  1AKH A;  1ZTR A;  1EF4 A;  4XRM A;  2R5Y B;  5M5W J;  2MW8 A;  2DMU A;  1UMQ A;  2WV1 A;  1VND A;  3DEW A;  4A69 C;  1VFC A;  2R5Y A;  1JT0 A;  2HI3 A;  5M3F J;  5J3L A;  4DYR A;  5EDN A;  1H8A C;  2ME6 A;  2M0C A;  3JR9 A;  3PO3 J;  3HOZ J;  3S16 J;  2CRG A;  1MBK A;  4DZP A;  2FJ1 A;  2N8G A;  3TED A;  3CMY A;  3S1M J;  3MN2 A;  3FK6 A;  4XIC A;  4A3D J;  2OPT A;  2VPR A;  1I3Q J;  4UUS B;  2EZK A;  3BTC A;  4M3D A;  1VI0 A;  4MO7 A;  2MG4 A;  3OSG A;  1NTC A;  3ZQF A;  5F27 A;  2WAQ N;  1Y1V J;  3QQA A;  1RR7 A;  3Q0U A;  3LSG A;  3GTO J;  1FEX A;  1B72 B;  3S2H J;  1MBG A;  2DA6 A;  3HM5 A;  3H0G J;  4M3G A;  1T56 A;  5E3L A;  1ZR2 A;  5DTD A;  2OF7 A;  3G1M A;  2Y0S N;  2JN6 A;  2E2I J;  2XRL A;  2O7O A;  1HCR A;  1RES A;  3BR1 A;  2TCT A;  3BR6 A;  2Y9Z A;  3FK7 A;  4MFE A;  3FIW A;  3BQZ A;  1ORK A;  4X1E A;  4S0H B;  4A3F J;  3S15 J;  3Q0V A;  3BR0 A;  5FKO A;  3TP0 A;  4CYC B;  1I6H J;  2M34 A;  3L1P A;  2WB1 N;  1LE8 A;  5K7Z A;  1IJW C;  4IEJ A;  3HEF A;  1ZR4 A;  1ZQ3 P;  2XSD C;  3D1N I;  2NVY J;  3CQZ J;  3Q3S A;  2X9D A;  5F08 A;  3SDG A;  4D5F A;  5M5X J;  2E19 A;  2Y30 A;  3ZOB A;  4C3J J;  5C4J J;  4ABZ A;  5EG0 A;  2DA5 A;  2X6O A;  2DTZ A;  1K61 A;  4Y52 J;  1BW5 A;  5J1Y A;  2CUF A;  3B6A A;  2O9L A;  4DZJ A;  1Y1W J;  1B8I B;  1MBJ A;  2AHQ A;  4FTH A;  2MGQ A;  1IDZ A;  2ME0 A;  1WGX A;  4LOC A;  3JRD A;  1WPK A;  3JRF A;  1ETK A;  1NK3 P;  3A01 B;  5K7H A;  4L5E A;  2W48 A;  3BTI A;  1GT0 C;  5IP9 J;  3CDL A;  3JRC A;  3WHC A;  5EZH A;  3H3V K;  2ZB9 A;  3GTP J;  5E3M A;  2LKX A;  2O8K A;  2COB A;  2KT0 A;  4BBS J;  2IEK A;  5K7F A;  1QPI A;  2QF7 A;  1S7E A;  2L7Z A;  4A3J J;  4GFB A;  1X2N A;  1O4X A;  2R5Z A;  5GPA A;  3GTL J;  5FKK A;  1OFC X;  4A3I J;  1MNM C;  4UUT A;  4QIW N;  2K9N A;  3TP3 A;  4MLO A;  2NOG A;  4AUX A;  2EZH A;  1LE8 B;  1IUF A;  5F0C A;  1UHS A;  3IH2 A;  1BJZ A;  1JKO C;  3E7L A;  3G1O A;  1A5J A;  3JRH A;  5C4X J;  2XPW A;  3BTJ A;  1MBE A;  1ETY A;  5E3O A;  2DMQ A;  1E3O C;  2XGE A;  3BG5 A;  2L0K A;  1XS9 A;  1JUS A;  2DMN A;  3K2A A;  2LLK A;  1WCM J;  3A03 A;  4JX6 A;  4BXX J;  1MSE C;  1XC5 A;  1IRZ A;  4D7M A;  1AU7 A;  1HDD C;  1HDP A;  1MH4 A;  1JUM A;  5E3N A;  3FKI J;  1BW6 A;  3OOU A;  3S1Q J;  5J1R A;  1IG7 A;  3BR5 A;  2DMT A;  1JTY A;  2R0Q C;  4Y7N J;  1POG A;  2GLO A;  1IDY A;  5IOY A;  1JKR C;  2JA5 J;  2JA7 J;  1QVU A;  3PM1 A;  1D5Y A;  3M3Y J;  3S14 J;  3HDD A;  1SFO J;  2HDD A;  2DJN A;  2P81 A;  1DU6 A;  1P7I A;  1TWG J;  4M6V A;  3GTK J;  2LD5 A;  3VPR A;  3SJM A;  2NS8 A;  2KDZ A;  1WH7 A;  1RKT A;  3NAU A;  1FIA A;  2ECB A;  3Q0W A;  4BBR J;  1R9T J;  5EZG A;  2M9H A;  1ZK8 A;  1FTZ A;  1ETW A;  2FD5 A;  3MKL A;  2HOA A;  4B1R A;  3CCY A;  1QVT A;  2EBI A;  2AO9 A;  5HOD A;  1RPW A;  9ANT A;  1GUU A;  2YS9 A;  3HOV J;  5GP9 A;  1ETQ A;  3I4N J;  4A3M J;  3JRB A;  3PO2 J;  3LSJ A;  5IYB J;  1MH3 A;  4XRS A;  2LTP A;  3TW6 A;  2LY9 A;  4IHX A;  2H8R A;  3A01 A;  1IC8 A;  2HXI A;  4EEF G;  4A3B J;  2TRT A;  3I4M J;  2XB0 X;  4IHY A;  2EQR A;  2PMZ N;  3O8H A;  4JX5 A;  1GVD A;  3LOC A;  2VI6 A;  4JYK A;  1ETO A;  5JLX A;  3BTL A;  2B63 J;  4FCY A;  1ENH A;  3W6V A;  3BT9 A;  3F0C A;  4IHV A;  4FIS A;  3S1N J;  1MBF A;  2XGC A;  2CQQ A;  3S2D J;  3JRG A;  1ETX A;  2HQ5 A;  1ZGW A;  3OSF A;  4A3L J;  4HNV A;  1X58 A;  4A3G J;  2CU7 A;  3UKG A;  2JK3 A;  3IH4 A;  1PUF A;  5EG0 B;  3K7A J;  4B4C A;  2H1K A;  3QPS A;  2EZL A;  3DCF A;  3LSP A;  2HYJ A;  4B3A A;  4J19 A;  2L7M P;  5IOZ A;  1BA5 A;  2ID3 A;  4M3F A;  5M5Y J;  2ID6 A;  2E2H J;  3HGG A;  1GV5 A;  2M8G X;  4IHW A;  2XB5 A;  5IP6 A;  2R92 J;  4X6A J;  2NS7 A;  1MSF C;  5FKN A;  1X2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...