2JMWA

Structure of dna-binding domain of arabidopsis gt-1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
KKRAETWVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGNGSAKMSYYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA binding protein GT-1
publication title Solution structures of the trihelix DNA-binding domains of the wild-type and a phosphomimetic mutant of Arabidopsis GT-1: mechanism for an increase in DNA-binding affinity through phosphorylation.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 20
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2006-12-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2jmwA01
2DA1A 1JT6A 2YU9J 1TWAJ 2M0CA 4DZJA 2M9HA 5M5XJ 3ZQGA 2LD5A 4A3CJ 5EG0A 3FISA 1ZKGA 5EGOB 5EZHA 3GTQJ 1FIPA 5E3NA 1IV6A 3Q0VA 3GTKJ 1F36A 2ID3A 4B3AA 1UMQA 2LVSA 2M34A 1HF0A 4XIDA 4DYCA 1U9NA 4C3JJ 3OSFA 1JT0A 4I76A 4A3EJ 3S14J 4IHVA 5F0FA 5M3MJ 4S0HB 1HLVA 1T56A 1B72A 4MO7A 1GVDA 2L9RA 1IDZA 1DU6A 1MBGA 3BG9A 3HGYA 5IP7J 4A3FJ 3IH2A 2FX0A 1DU0A 3H0GJ 3HBLA 1UG2A 3MN2A 2HOAA 1I3QJ 4XICA 3BR6A 4MLOA 1MBFA 5HODA 3OSGA 3A01B 1XG1A 4D7NA 4QTRA 4XRMA 2I10A 3HGGA 3B6CA 1RESA 5BNGA 1I6HJ 4FTHA 4A69C 2R93J 3O8HA 4RDUA 3JREA 5JLWA 1MBKA 4XRSA 4ABZA 2JA7J 4BKXA 4M3GA 5EF6A 1JUSA 2VKEA 5C4JJ 4J19A 1B8IA 4GFBA 1JTYA 3WHBA 3G1OA 2CQXA 5DTDA 1JKOC 4CYCA 3WHCA 4XRSG 1JGGA 5E3MA 3RZOJ 2XPVA 2B63J 2IEKA 2D5VA 2R92J 3BR0A 2PMZN 2DN0A 1W0TA 5EGOA 1Y1WJ 2DMUA 1I50J 3LSGA 4IHXA 1QVTA 1XS9A 5EZGA 2L0KA 1AHDP 5IYDJ 1YRNB 2HDDA 3HOZJ 2KT0A 1TWCJ 3Q0WA 5JLXA 1ENHA 1TWGJ 2ELKA 1CQTA 3S1NJ 2JJ7A 2AO9A 3SJMA 3ZQCA 1JTXA 1QRYA 1XC5A 1FEXA 5F27A 1Q1VA 2YUSA 2IAIA 1IC8A 4JX5A 4BBRJ 4IHWA 1GDTA 1K61A 1JUPA 1NK3P 1JJ6C 2X9DA 3HOUJ 1IG7A 1HCRA 2XPUA 4FISA 4UUTA 2OPTA 3LSJA 5FKNA 3JRGA 5F08A 2DA6A 2H1KA 5GP9A 2EZLA 2G0EA 3A01A 1ZQ3P 3W6VA 3JRCA 3OOUA 4G12A 3JRBA 3S15J 3JRFA 2DA4A 3BG3A 2X48A 5FJ8J 2VPRA 5IOYA 2DA3A 4C2MJ 1ETQA 1UHSA 1HDPA 2Y9ZA 3FIWA 1HDDC 3SFIA 1GV2A 2E19A 3Q3SA 4FE4A 2NVQJ 3S1RJ 4A3DJ 2Y30A 1WH7A 5K7HA 2P81A 3BQZA 4DYRA 2DMTA 3CMYA 1ORKA 4UUSB 1ETKA 2CU7A 2R7ZJ 1GT0C 2MG4A 3GTLJ 2CJJA 1A5JA 2RAEA 4FE7A 1RR7A 1H89C 4B4CA 2XSDC 2DMPA 2O9LA 2JN6A 5E3OA 3HM5A 3ZOBA 1MBHA 3LSRA 4AYBN 3JRDA 5J1RA 5K7FA 1O4XA 2R0QC 4IEJA 3A02A 2Y2ZA 2ZB9A 1H88C 4MIMA 4XK4A 5E3LA 4JYKA 1Z77A 4V2GA 2FJ1A 1YRNA 3GTJJ 3LNQA 5J1YA 5K7ZA 1FTZA 3FK7A 4FCYA 2K9QA 4I6ZA 3O8GA 4B1RA 2NOGA 2CRGA 4JX4A 4AUXA 5EEAA 4A3JJ 4X1EA 5C3EJ 1ETOA 3MKLA 2QF7A 5F04A 3TP0A 3CDLA 1R9TJ 1OCTC 5F1JA 1S7EA 2VKVA 3LOCA 3BR1A 1WPKA 3G1LA 3ZQFA 2DMQA 2X6OA 2EZKA 3S1MJ 1IUFA 3K7AJ 5IYBJ 4IHYA 1MBJA 2LK2A 2K9NA 1K83J 1SANA 2K9SA 3TW7A 5IYCJ 1ZTRA 3IH4A 2YS9A 1U8BA 4A3IJ 5GPCA 1MSEC 4W97A 1ETVA 1D5YA 3VPRA 3IH3A 3QPSA 3HOXJ 2HQ5A 3BTLA 1RKTA 5M3FJ 1JUMA 3BTCA 2E2IJ 1MH3A 1ETWA 2N8GA 4C3HJ 5F0HA 3NARA 1TWHJ 3BR5A 3HDDA 4EEFG 3BTIA 3PO3J 2AHQA 1BW6A 2HXOA 4UUSA 5FLVA 3GTGJ 2E2JJ 2JA8J 4NDLA 3RQIA 3TW6A 5FLMJ 1ZR4A 1AKHB 3GTOJ 1OFCX 1MSFC 5M5YJ 2CQQA 1JKPC 1SFOJ 2IBDA 2XB5A 1JJ8C 3F0CA 2HXIA 2XPWA 1WI3A 3HKZN 2WAQN 3C2BA 2MSYA 2JMWA 2LKXA 1PUFB 4Y52J 1IGNA 4BY1J 2XB0X 1IDYA 1HOMA 9ANTA 1EF4A 4Y7NJ 4M3DA 2COBA 2GM4A 5GPAA 3BQYA 3ZQLA 1ITYA 1FJLA 1RKWA 1E3OC 4X6AJ 1X2NA 2R5YA 2GLOA 2XGDA 2LLKA 3CCYA 1LE8A 2ID6A 3RZDJ 2NVTJ 1MBEA 3B6AA 1QPIA 4A3LJ 4DYQA 1WH5A 1QVUA 2K40A 1P7JA 2Y0SN 1H8AC 1P7IA 3GTPJ 2M8GX 3GBGA 2FQ4A 2Y9YA 2LY9A 2LR8A 1TC3C 1RETA 2ME6A 3SDGA 4JX6A 5C4XJ 3ZQIA 1AU7A 4JP0A 3RKQA 3FK6A 1MH4A 4L5EA 4BXXJ 2JA5J 3HOVJ 4C3IJ 2DA7A 2XRLA 2H8RA 2DA5A 1FTTA 1Y1VJ 4M3FA 4M3EA 4A3GJ 3JRIA 3S16J 1VNDA 5IP6A 3JRHA 3BR3A 3CQZJ 1ZR2A 2R5ZB 5F0CA 1NTCA 2NS8A 2JWTA 1GUUA 2L7MP 2QCOA 2E2HJ 1ETXA 2WB1N 4LOCA 1JKRC 3QQAA 4D5CA 1AKHA 3HB9A 1VI0A 2O7OA 1TWFJ 4DW6A 2R5YB 1MNMC 2ECCA 1JKQC 4V2FA 1LE8B 2GBYA 1OCPA 1PUFA 3TP3A 3D1NI 1U78A 3BTJA 3GTMJ 2DTZA 4A3MJ 2DJNA 1Z0XA 3IV5A 3HOYJ 2CUEA 1FIAA 1W0UA 2EBIA 5C44J 2EH3A 2EQRA 5IOZA 3JRAA 2HOSA 2Y31A 3DCFA 1APLC 2NVXJ 1WGXA 1LFUP 3OIOA 1GV5A 3G1MA 5FKOA 2L7FP 1LFBA 3QPLA 2TRTA 5J1UA 4A3BJ 5IP9J 1T33A 2XGCA 1BW5A 2LTPA 3FKIJ 4M3BA 4DZPA 2HOTA 5FKMA 3S2DJ 4QSHA 3Q0UA 4HNVA 3K2AA 3BR2A 4MFDA 5M5WJ 5EG0B 2HYJA 2OF7A 3LSPA 4AC0A 3S2HJ 1X2MA 4A93J 2O8KA 5FKKA 3UKGA 4A3KJ 2NVYJ 3S1QJ 3ZQHA 2ME0A 2WV1A 1A6IA 5DS9A 1POGA 3JR9A 3I4NJ 5IPAA 2HI3A 2JA6J 1G2HA 1IJWC 1OJLA 1B72B 5FKLA 3M4OJ 2R5ZA 3HOWJ 4W1UA 4RBOA 2M2EA 4D5FA 3S17J 1WCMJ 2JK3A 3A03A 2E1OA 2VUMJ 2NS7A 1BA5A 2DA2A 4BBSJ 4QIWN 5J3LA 1U9OA 1ZK8A 1BJZA 3BG5A 2MGQA 2ECBA 3TEDA 3PO2J 2MW8A 2LP0A 2LFBA 2TCTA 1NK2P 1X58A 3MVPA 1ETYA 2CUFA 3M3YJ 3H3VK 2KDZA 1VF9A 2DMNA 4M6VA 4MFEA 1RPWA 2L7ZA 5EDNA 2FD5A 3L1PA 3E7LA 1BL0A 1ZGWA 3NAUA 3I4MJ 4BY7J 2W48A 2EZIA 2XGEA 2EZHA 3BT9A 3HEFA 1B8IB 1VFCA 3DEWA 4D7MA 1F43A 3PM1A 5EYRA 2VI6A 1IRZA 4CYCB
chains in the Genus database with same CATH superfamily
1YIJI 1WJEA 3ML6A 4BEHB 4IVNA 4A5MA 3RKYA 4UY8I 2M0CA 4DZJA 3KP4A 4A3CJ 3IHUA 1STZA 4AIKA 3BP8A 4LLLA 2HPMA 2STWA 2VODA 3F23A 2M4GA 5EGOB 1X3WB 3K70D 1A35A 1F36A 3GTKJ 1A04A 4YIRX 1OCRH 1HF0A 4MNUA 4IHSA 2BHYA 4I76A 3S14J 4IHVA 4J00A 4ZYGA 4G7ZF 2QLZA 4IQ4A 2EV5A 1F5TA 3V7CA 4S0HB 4L9VA 5J4VA 1GVDA 3ZRGA 3CCJI 1B59A 2JVHA 4IRHA 2K7LA 4JBAA 3ISPA 1F1ZA 1IXCA 2JPBA 4RS8A 4AIDA 1NG6A 5IP7J 4A3FJ 2D1VA 3IAS2 3IH2A 2MD0A 3IWZA 2F5VA 3OYKA 4MLOA 1R4NB 5KCMA 1TNSA 3I5UA 4PJLA 2R4GA 3UR3C 3OYMA 1HA8A 4HBLA 1MJ9A 5GAHJ 1XPXA 5LHIA 3FMQA 3DP7A 4XONA 3O8HA 1SC7A 3ZP5A 2CO5A 2JA7J 1E0EA 3L2QA 3H9JA 3KP6A 4O6JA 5HLTA 4LG0A 1LVAA 1RC9A 2DFIA 2R7FA 1OCCH 2B7EA 4N9HA 4S04A 3WU0A 1CF7B 5DM6F 4A0YA 5JR3A 1HBXG 3DQVC 1T39A 4WK8F 1W7PD 4JK1X 5LGUA 2R7RA 1MD0A 3KZYA 4OMYA 1EH7A 4GFBA 3EUKL 2IA1A 2FQ3A 2P5VA 3REOA 2V6EA 2BW3A 3S2WA 4NQWB 4ZZLA 2CQXA 3WHCA 1UG0A 1JGGA 5E3MA 3ZQQA 4AM3A 4O3MA 2D5VA 3LQRA 3SEQA 3IKVA 1KONA 1CGPA 2G7UA 4PGHA 4KISA 3Q9VA 2DT5A 3ELKA 4ZYEA 3L9FA 1QVTA 3MAJA 4CXFA 2L0KA 2L9NA 4C2UA 3GZNB 4FHTA 3KYDB 2LKPA 4NHJA 1TWCJ 1ENHA 1U8RA 4GGGA 2JJ7A 2AO9A 4G8XA 4KN7X 1JTXA 1TQPA 3GW2A 2KIUA 4BS9A 1Q1VA 2EV6A 2K4JA 4IHWA 4ESBA 3RPQA 3DPTA 1UFMA 3OYEA 1XCBA 2X9DA 2EPFA 1RI7A 2M8EA 3K4CA 1HCRA 4D1QA 5F08A 5J6XA 4B48A 2Q2EB 2AQFA 2XSJC 3ASOH 5DCFA 4ZZDA 3KP2A 3JRBA 3G4SI 3CESA 3BG3A 5ILVA 3K4MA 5FJ8J 1FLIA 4PJ0C 5IOYA 3QODA 2XAJA 3FIWA 3QWLA 3I9V2 2XIGA 4LIUA 4QWQA 2HKOA 4Z6YA 4M6XA 2ZSHB 4MHGA 3R6SA 2FBIA 4RM3A 3K10A 2VJIA 3Q3SA 1TTYA 4Z2YA 3G6EI 1FC3A 3DPUA 2EFNA 3MMYB 1X1CA 3HHGA 3SZTA 3CP8A 2P81A 2ZXIA 3KYCB 1MDMB 3PNYA 1ORKA 2CU7A 2DK5A 1GT0C 4HF2A 2K02A 2PI0A 1G3SA 2F4OB 2ZSIB 2LMDA 4BQOA 4FE7A 1WHUA 2COMA 3EDPA 2JN6A 1FSEA 3ZOBA 3GMEA 1T6SA 3PQJA 1XCVA 3W2AA 2P7CB 1MIJA 5HS7A 3L2WA 2HGCA 4II3A 5B1BH 3DKYA 4XK4A 2M45A 4J01A 2FJ1A 3CZ6A 1W4MA 3F22A 4CZCA 5GTHC 2R7VA 1W7PB 5H6RA 3FK7A 4FCYA 2K9QA 3I54A 3CCSI 2H8WA 1BIAA 2WAEA 3FKJA 4B1RA 3MEXA 2E1MC 3PNTA 1R22A 4M9XA 2H94A 5EEAA 3W6JB 3OMYA 1OCOH 2RQQA 2QF7A 4I0BA 4JQFA 5F04A 1OCTC 1S7EA 3R0AA 1YS6A 2IA2A 4U7BA 1KU7A 5ILSA 3BR1A 3JCUC 1XGMA 2WB1A 2W00A 4P5OA 5LEJA 4M6YA 1IUFA 3K7AJ 4HX7A 4Y3OA 1USTA 2FSWA 2K9SA 2XGXA 4D9JA 4OAZA 2VOPA 2M7BA 2H27A 1JXSA 1MNEA 4LLGF 3HSFA 1U8BA 4XLHA 4EJTA 3LA2A 2IS1A 5GAEJ 5L3FA 3IH3A 3HOXJ 4UV9A 2HQ5A 1JUMA 1SMYF 3HG9A 4B3XA 2PBIA 3I0TA 5D6EA 4WXCA 4HV5A 1Z9CA 2DBBA 4EEFG 3BTIA 2DTRA 3CDIA 4HQEA 1Z21A 1BW6A 5FFZA 2JA8J 2L4AA 3KPHA 4CO8A 1PVEA 4EV0A 2E71A 3NQOA 5FLMJ 1ZR4A 2EK5A 2GXAA 1H9TA 1TQMA 1FT9A 2O3FA 4BQQA 1OFCX 1D1AA 1BN5A 2OBPA 1ZLJA 2XB5A 1PYVA 1S7OA 2WAQN 2JMWA 3OS1A 2XKOA 2XB0X 3FXLA 3HHHA 1IDYA 1OISA 2YX7A 5E20A 4M3DA 4AD9A 4Q47A 2CWEA 1TL8A 3MQ0A 1YW8A 1REPC 3RYPA 4Q5SF 4G6TB 3PIPF 2W4SA 3KX2A 5IT3A 3IP4B 4BGDA 5LBQA 4TV7A 1D8KA 4PCQA 1MBEA 1QPIA 2ICWG 2A5YB 3HPHA 2EFWA 2VXDA 3LSMA 2W84A 4PJJA 1KGSA 3WTTC 3ABUA 1R49A 2Y0SN 1JHFA 2EIJH 3HUGA 3IL2A 2XHKA 2M8GX 2V1UA 2KZGA 3E1SA 2FUG2 5LRSA 2K5CA 4E7IA 2DPUA 2Y9YA 2LY9A 2NAZA 2LR8A 5D8LB 3CMAI 1TC3C 5IY5H 1G4DA 3FWEA 4AIJA 4DIQA 2DOAA 2QBYA 4BQAA 1G3TA 1EH6A 2V1DA 1LNWA 1UB9A 4IXAA 1GXPA 5CVVA 2IVMA 2L7KA 4L5EA 2JA5J 1LDDA 3HOVJ 2PJRA 2V79A 3U9GA 3ZXSA 2E60A 2M87A 1D0YA 3RIRA 4HLYA 2XRLA 5BMZA 4I01A 5DCMB 3WU2C 2VN2A 4M3FA 4M3EA 1R5HA 2BXZA 2OC6A 2Y69H 3BR3A 5CQGA 2R5ZB 1HKTA 2DDAA 3P7NA 1V5EA 4RAFA 2JWTA 1WJ5A 4CCJA 4RGUA 2EINH 3I55I 4IL6C 4LOCA 4RB3C 3QU3A 3I59A 2A68F 2LY1A 5H2FC 2O7OA 4XR6A 1TWFJ 2FNPA 1MNMC 1FMVA 1Z3XA 4AIHA 4ESFA 1I6XA 2RVCA 4I02A 1IRGA 3DTIA 5L3BA 1U3EM 1U78A 5CVJA 4HG2A 3BTJA 4KJZA 4NC7A 4A3MJ 1Z0XA 4GXOA 3IV5A 4A6EA 1FIAA 3MKZA 3GZ6A 1IAWA 4OIRF 3HOYJ 3J7ZI 2EBIA 2JVGA 5C44J 3LSTA 3J80K 2WC2A 4EQQA 2EQRA 2HOSA 2V6CA 4U0WA 2Y31A 2DK8A 3DCFA 2NVXJ 1S72I 2VT2A 2GIZA 5CKTA 2UV1A 3J80Z 3G1MA 2L5QA 4F3QA 1VQ6I 5FKOA 3MKYB 1X1BA 1LFBA 1YOVB 2TRTA 3FXRA 1NG7A 2XF5A 2XGCA 1PUEE 1BW5A 3FKIJ 1RUNA 1VTNC 1K6YA 3J7AO 4DZPA 2HOTA 3OS2A 4QLCU 2HOEA 3CP2A 3VSKA 4RB0A 3ZN1A 4H0EA 4OIQF 3GUDA 4OU0A 4U7DA 3FXOA 1Y56A 4EJVA 4A3KJ 2W24A 5E1WA 2DT7B 3ZQHA 2EIKH 4RMNA 3LSIA 2FMYA 2WV1A 1A6IA 3DV8A 2PLYA 2QWWA 2NNNA 4UV8A 1G2HA 2JA6J 5LGTA 1IN7A 3P9IA 1OJLA 2P6TA 4WXHA 4RBOA 2BBYA 3WODF 4ZTJA 1VQNI 4UVCA 1X1AA 4NC6A 1YE9A 3TOAA 2QENA 2LOOA 2VUMJ 5E17F 2BZTA 4XN3A 2A07F 4YFNF 5J3LA 5GTIC 4L0ZB 2MGQA 4BU2A 1ZREA 4F92B 3PO2J 2MW8A 2VBXA 1AWCA 4CH7A 3ERED 4HF1A 2LP0A 4NB5A 2RGVA 1X58A 1S5LC 2JUCA 2LY2A 3VSLA 3BC8A 4OMZA 4P1WA 4RGSA 4DNCA 3JSOA 2EWNA 1JI8A 1QNTA 4M6VA 1RPWA 2L7ZA 2QEXI 2FD5A 5LGNA 1S6LA 2RN7A 4LG0B 1B9NA 1R5GA 3GZ5A 4CUGA 3I4MJ 1JE8A 5D4RA 1A36A 2EZHA 1QU3A 2MLGA 1ZGJA 4L5IA 3S3MA 4IJAA 1F43A 3L2UA 1X3UA 2BW3B 4BAYA 3P5JA 4PZJA 2DA1A 3AFHA 2YU9J 1TWAJ 4XOPA 1E3HA 3OYLA 2DYSH 2VOOA 3H9GA 2E7WA 1KYWA 2O6GE 1ZKGA 3NRVA 1HW2A 1G59A 5EZHA 1FIPA 1D3YA 3Q0VA 1VQ5I 2IGMA 3ABTA 3LSKA 2LVSA 2M34A 3OYFA 4XIDA 3KP7A 1U9NA 4DYCA 3A0BC 1OMIA 3C2GA 3OSFA 1LFPA 3GO5A 5JFRA 3S3NA 2FU4A 5F0FA 5E79C 4GO1A 3HC7A 3K2ZA 3KP3A 1T56A 2D1HA 3KEYA 3H5RA 4MO7A 4Q48A 2L9RA 2VBZA 1IDZA 3K1MA 2E1MB 1ONVA 3FBIB 1AOYA 3KZZA 3FXJA 3TBIA 5A2QK 4AVZA 2ZFWA 2DT6A 4BDYA 5E18F 3LFUA 3C3WA 3LFKA 2VJ5A 3E3VA 3PQKA 4DQ2A 3HBLA 2EA2A 3FZVA 3A4CA 4XICA 3BR6A 3O2PE 3FXKA 4P9UA 2KIQA 5HS8A 5HODA 3OSGA 4D7NA 3IWFA 4AYBA 2XROA 2I10A 3CUQA 3CLOA 1KQ9A 2XDVA 1RESA 1WVRA 3BOQA 3HIFA 1I6HJ 4FTHA 3E5UA 3LAPA 5JLWA 3E0JB 1B4AA 4XRSA 4XLAA 4UUVA 1YW9A 1IO2A 4FX0A 4M3GA 2RDPA 2ZXHA 3L2VA 1D1CA 2BEOA 2OA4A 5CLSA 4I98B 1EV7A 5C4JJ 1UAAA 3R0JA 4J19A 3FXQA 3LQQA 1QBJA 5TJJA 5CVIA 2Z3YA 3M07A 5DTDA 2VKDA 1W36C 1S9HA 3R61A 3CCRI 1XMAA 3RZOJ 4DGWB 2VPLA 2H6CA 4XLNF 4RAGA 2ZXWH 1Y1WJ 1IXRC 2ZJPF 1YX5A 4IHXA 3LSGA 1B9MA 1VQ8I 2HQNA 5EZGA 5IYDJ 1X4OA 1AHDP 4CCKA 4CYDA 5EEHA 4YG2F 1VQ7I 3ERMA 2KT0A 4DBQA 1K79A 1TW2A 3F3XA 4PK4A 4A2UA 2ELKA 3OYJA 3ZQCA 1DPUA 4FT8A 2K9LA 2AXLA 1QRYA 1XC5A 3ECHA 3OYDA 5TISC 2HNHA 4GCVA 1IC8A 2YUSA 2BVLA 1H9GA 1BI0A 2X6YA 5CQEA 4BBRJ 4LGWA 4XM3A 1K61A 1ULYA 1NK3P 3JAMZ 2CQNA 2F6CA 2VONA 2VL8A 2UWMA 3HOUJ 3K4KA 4I7HA 2XPUA 4UUTA 2OPTA 3V4GA 1WJBA 2DA6A 4HDVA 1QHHD 5DEQA 3W6VA 3JRCA 3CUQC 2CG4A 4E7HA 3S15J 3JRFA 2EFPA 3CCMI 4MTDA 4XORA 3OIPA 5HLGA 2R7WA 2CYYA 5BQTA 4ENKA 1BOAA 4V19K 3AG4H 2Y9ZA 2V26A 3OR2C 1VQKI 2LBFA 1GV2A 1K4TA 5FROA 4BJ5C 2E19A 2F4MB 1T98A 3S1RJ 2CUZA 3E97A 4A3DJ 2VB6A 1V5GA 2QSGX 1ETKA 2M5WA 1T08B 2QQAA 1XGNA 5ILUA 4OIOF 1TT0A 3LWFA 3GYHX 2LYCA 2RAEA 4C2TA 3OV8A 5KHDA 1H89C 2G9WA 5ICCA 1V3FA 3HZJA 3E5QA 5L3DA 3ZGKA 5E3OA 2NS0A 2KRCA 1MBHA 1FP1D 5J1RA 3K4BA 3X2QH 3ZMDA 1MMDA 2R0QC 2Y2ZA 2V1XA 3U1KA 2W57A 1TNTA 2PQ8A 4MIMA 3T8TA 1Y39A 5E3LA 2NYXA 1EJ9A 1SD7A 3WE3A 3DKWA 2YR2A 2NNYA 1YRNA 2R7UA 2Z33A 4NNJA 3LNQA 3LA7A 5J1YA 5K7ZA 3PJRA 4FETA 2WA0A 1FTZA 4HX4A 5D5WB 1Z7UA 1R1UA 1V55H 4I6ZA 3W2WA 3O8GA 3OYCA 2HQAA 3DU5A 4G94A 2NOGA 3KCCA 4HV6A 2IA0A 1K78A 3OR1C 4A3JJ 3O3KA 2CH0A 5LLQA 1ETOA 3MKLA 3PL8A 2L2OA 4KIFA 4XKVA 4FX4A 2KRHA 3LOCA 2B0LA 3G73A 3CUOA 3FXUA 2DMQA 3HUGB 2GAUA 4BQNA 3CD6I 1USSA 1Z6RA 4Y4RA 3W2VA 4E6KG 1BIBA 2KL4A 1K83J 2LF7A 5E1XA 3V8JA 2Y75A 4YFXF 3A2KA 1TW3A 2QBYB 5GPCA 4G9YA 1ETVA 3F6OA 3VPRA 4DBRA 3E5XA 3I58A 3J7AY 1J2XA 5D5VB 2JRMA 1W1WE 2KRFA 4QPQA 2PJRB 2X85A 3ULQB 1OQYA 1MH3A 2XASA 2K86A 3TGNA 3PUFA 2VQHA 3GFMA 2RQPA 1O57A 1QPMA 1TWHJ 4FASD 3QYFA 3N05A 3HDDA 3GFJA 5D6FA 1BC8C 2HXOA 4UUSA 4RAYA 3GTGJ 2E2JJ 1SVOA 2GOMA 4NDLA 3TO6A 3RQIA 2O8XA 1WKMA 1QZYA 2X4HA 3I59B 1BM9A 4KN4X 1MSFC 1ZYRF 4B43A 2CQQA 1RIOH 3PUBA 3LA3A 4HNTA 1FPQA 1JJ8C 4R1HA 3F0CA 4LFUA 3HKZN 2MSYA 1W36D 3KFWX 1IGNA 1HOMA 9ANTA 1EF4A 3CCQI 2CV0A 2COBA 2GM4A 3BQYA 1FBQA 1Z3YA 3Q9SA 3T5XA 5B3SH 4U0VA 2Q1ZB 1OR7A 5E8IA 1XD7A 4X6AJ 1X2NA 2R5YA 5L3CA 1ZELA 2LLKA 3CCEI 2BXYA 3LSHA 3HKZA 3K4NA 2Z9OA 4YFKF 2DDBA 2K85A 2KJBA 1I27A 4EM1A 1ZLKA 3F21A 5HS9A 1BBYA 1XB4A 1VQ4I 3GBGA 2BGCA 5D4SA 4B8XA 2GIVA 1F9NA 2F5CA 2WY8Q 3K6GA 5JHFA 3RKWA 4KYWA 1OLTA 1TLHB 1FY7A 4CCNA 1IN5A 1W5TA 3ZQIA 1AU7A 5C4XJ 3DF8A 4F7ZA 4JP0A 4M74A 2GA1A 2D45A 3RKQA 1YG2A 1MH4A 3FK6A 3PSIA 1QZEA 3CJQB 3SZGA 3K69A 2CFXA 2DA5A 2UXXA 4E70A 5HOOA 1XDSA 4UNOA 3MKWB 1DQUA 1D1BA 5DYMA 3JRHA 2HKXA 1W5CC 3H3UA 3CQZJ 5F1RA 5IP6A 3JSPA 3FHZA 3KLOA 2IS4A 4UB6C 1WJAA 3BROA 2ZNYA 2AS5F 2A69F 2QCOA 1B6AA 3VWBA 2WB1N 4EJUA 1JKRC 3QQAA 1AKHA 3OYIA 2CSOA 2IW5A 3BJAA 3J7YJ 1YX3A 2XAUA 4HOBA 1MMGA 3LL7A 3M7GA 2ZMEB 2R3SA 4MQVA 4V2FA 1LE8B 2TDXA 4HSRA 1OCPA 3A1YA 3TP3A 5DD4A 1T38A 1TZLA 4KMFA 4XL9A 3HRTA 3GTMJ 5CYVA 2ACJA 1J75A 1W0UA 1BR4A 2W7NA 1OR7C 4HA8A 4PFPA 4CHUA 2WADA 5HDKA 5J8FA 3CMMA 4U0YA 4BJ6C 3EQLF 4E7SA 3JTGA 1XSXA 1WGXA 3F8CA 4ON0A 1LFUP 3OIOA 2P6SA 2ZJQF 1W5SA 2P4WA 2LF8A 1WFXA 5J1UA 1DGWY 5IP9J 5K5RA 5KNLA 2R7XA 1I5ZA 2BV6A 2ZCWA 1VQOI 3J81K 3QRFF 3S2DJ 1Y8QB 4PDKA 2IXSA 3C1DA 3BR2A 3CF2A 3F8FA 2IP2A 4A12A 4AC0A 1R23A 3UNGC 3UKGA 1MMSA 2NVYJ 1E3PA 3HSRA 5LHGA 3S1QJ 3I56I 2Q8KA 3JR9A 2DXIA 1ZRDA 2CS3A 3DTEA 4ENNA 4BJTA 4CZZA 2ESNA 5FKLA 4CCLA 2M3AA 2W82A 1IN8A 1GVJA 4ZDLA 1XSVA 4KMUX 1U5TA 1X19A 2VQGA 2VT3A 1MGTA 4PFOA 2M2EA 4D5FA 2L4MA 2OQGA 2E1OA 2HZDA 3OY9A 2E7XA 1VQMI 2R7DA 5K1YA 2FOWA 1EKEA 4BBSJ 2FBKA 3CO6C 2ZJRF 3MWMA 3WTZA 5KK1A 1J5YA 3ZR8X 2TCTA 5BPIA 3VYTB 4KFCA 3BPVA 3MVPA 1ETYA 4L0YB 2DO7A 3M3YJ 3H92A 3CJTB 4I0AA 3A0HC 2DMNA 4XNFA 4WX9A 3L1PA 1D0ZA 3FXMA 1LEBA 3RI4A 5JHUA 2K27A 3BCAA 2EZIA 2XGEA 2FRHA 2LRDA 1J09A 5ERIA 3OS0A 2DCEA 2QZ8A 3HRMA 1VFCA 4HSTA 5F6FA 1IRZA 3VODA 3P9CA 1N77A 1GHCA 2MC4A 3H1CA 4IF4A 2IRFG 1JT6A 3U21A 1N25A 2M9HA 2LREA 2LD5A 1UJ8A 1UHMA 2OAZA 3FISA 3KLNA 3GTQJ 3F8MA 5J8CA 1QQIA 4B3AA 1V5FA 3RKXA 1UMQA 3GLXA 4BHPA 1O3SA 1DUXC 3CC2I 1YO5C 4C3JJ 3OYGA 2XAQA 1JT0A 2JA2A 4E7JA 4GYGA 3S93A 1PP7U 1TQIA 2FOKA 3I3LA 3KE2A 4XKWA 1FYLA 2R7OA 1HLVA 2RV8A 3RCOA 3CF5F 1B72A 3C7JA 5CJ9A 4K2EA 1T95A 1U5TC 4H4KC 1DU6A 1IZ1A 2EV0A 2DW4A 2CQ7A 2OCCH 4HEA2 5IT9K 5J40A 3D0SA 3H0GJ 4IRGA 2VIXA 2HVQA 1ZG1A 5IT9Z 1UG2A 3MN2A 2HOAA 4ZYHA 2B9SA 3TDZC 4ZJZA 1MBFA 1SD5A 4BUPA 1XG1A 2ELHA 2GZWA 2OUMA 5DV5A 3HGGA 3B6CA 2RREA 2XAGA 5BNGA 2WAFA 2J5PA 5B5EC 2ISYA 5LD2C 2LC2A 4RDUA 5KAFC 1MBKA 2CW7A 4ABZA 4ANJA 1LDJA 2LBFB 2E35A 6PAXA 5EF6A 4Y33A 1R7JA 2Q2EA 3VOEA 4IHTA 3ESWB 2VKEA 3L7WA 1RRJA 3CCVI 4ENMA 4LD5A 4HYEA 1U2WA 4KNYA 2W25A 4PJMA 4BYYA 4HQMA 2PX9A 2EFQA 1SFEA 1JKOC 4CYCA 4XRSG 4ZDPA 1BC7C 2XPVA 4LB5A 2WBMA 3BR0A 5DUKA 3RTRA 2DN0A 1W0TA 2Z5UA 1L0OC 1H0MA 4AU7A 4XSZF 3H0DA 4HDUA 4UXNA 2JPCA 5FRNA 1I50J 1S7AA 2YPRA 3ZN0A 3SDBA 3DU6A 1YRNB 3FF5A 3H5AA 1VQLI 2RKHA 3JW4A 2L3DA 3Q0WA 1TWGJ 4LB6B 3ECOA 3S1NJ 4E4HA 2JQ7A 2JRTA 4MEYF 1FEXA 1KU2A 5F27A 2Z1DA 1K78B 2IAIA 1D0XA 4JX5A 1SFXA 1GDTA 4OIPF 1PJRA 3MFKA 5FO5A 3WE2A 1KQ0A 3D5LA 2ZBKA 4ETSA 3K1NA 3I64A 1IXSB 3JRGA 1T0FA 2IS2A 1K7AA 1YJWI 4F91B 2H1KA 5GP9A 1UELB 2EZLA 2G0EA 5ICGA 5EEGA 3A01A 3OOUA 3ZMSA 2HPIA 1EA3A 2X48A 4G6QA 3S8PA 2VPRA 3ROUA 2YX4A 1YLFA 5GAGJ 1ETQA 3TDUC 3MZ8A 3NWSA 2VLAA 2EJRA 4IX7A 1U6GA 3GWZA 4MQ9F 1RUOA 4FE4A 3AL0C 4N9IA 2V9PA 1WH7A 2Y30A 5K7HA 2HS5A 3BQZA 5ICFA 2MC3A 2QVOA 3QOEA 2DMTA 3CCLI 1A6QA 2KFDA 4UUSB 3IAM2 2MG4A 3GTLJ 2CJJA 1P4AA 3L09A 3M1EA 4QPOA 2AQEA 2NXNB 4L18B 1OPCA 2JSCA 4B4CA 4WF2A 2R7SA 2DMPA 4ASNA 1MJAA 3DFGA 4A0XA 3HM5A 2ADUA 2FMLA 3DKXA 4AYBN 3OL4A 4KIGA 5K7FA 1G8XA 4BDZA 4XRFA 2ZB9A 2XAFA 3BZ6A 4B09A 5FD6A 1D5VA 1RZ4A 2EB7A 4JYKA 1Z77A 3HXLA 4EGYA 1QGPA 3WTYC 5A2QZ 1KYZA 2A05A 1IV8A 5K5OA 1ZRCA 2Z16A 1LKXA 3F72A 1SD4A 2MYSA 3F6VA 4AUXA 2CRGA 4JX4A 4ZH4F 2K3PA 4X1EA 3T8RA 1R4MB 3TP0A 4FQGA 1R9TJ 5ICEA 2VKVA 1WPKA 3G1LA 3ZQFA 2X6OA 3COAC 3H5NA 3ZMTA 2HYGD 2LDUA 3GLLA 4KA4A 4BACA 1T0FC 3S1MJ 4M73A 4IHYA 2QKMB 3BWGA 1EH8A 1MBJA 2FEZA 4R8HA 1ZTRA 5HNFA 4EATA 3IH4A 1ZH5A 1FX7A 4NUBA 4YIFA 1FMWA 1MMAA 5H20A 3RPUA 1MSEC 1XN7A 4IZZA 2H1LA 1D5YA 1QZZA 4S05A 3DTKA 2E1CA 2YU3A 3SEZA 1T8IA 5M3FJ 3OOPA 4MGRA 4HPQA 2F5DA 1K4SA 1ZAOA 1YI2I 5KAIC 4BE2A 2UUZA 3OYHA 1FOYA 2QUFA 1HW5A 5JVGF 2C6YA 4C3HJ 2PMUA 3AG3H 3BR5A 4RGXA 3DEUA 3IC7A 3CCUI 3FDYA 3E6DA 4U87A 1Z91A 1U0JA 2DFHA 1X1DA 5FLVA 4ENJA 2BYVE 2A61A 2ETHA 2MD5A 3TW6A 1XX5A 4EM0B 1G6NA 4GDFA 2K3FA 1AKHB 3B73A 2HFHA 4RA2A 3GTOJ 3N4MA 1FNNA 4LK1F 5M5YJ 1JKPC 1Y6IA 1YTYA 1SFOJ 2L54A 2QQ9A 2RNGA 3OIQA 2HXIA 2XPWA 3L2CA 1HQCA 3C2BA 1X1PA 2XC7A 1XTAA 2OCEA 2LKXA 3N97A 2HU9A 4Y52J 1SFKA 2X51A 1DDNA 4C9YA 4Y7NJ 4UB8C 2ZFUA 3SYTA 5HVQC 1UHWA 4LLNA 1ITYA 1RKWA 3HYIA 2YSRA 1E3OC 2XUBA 2XGDA 2GLOA 1IW7F 3WG9A 4HNUA 3CLQA 1P92A 2WTEA 4LG3A 2NVTJ 2P7VB 1LEAA 2KIMA 3B6AA 3DXJF 4LK0F 4A3LJ 3WTWC 1P2FA 4A5NA 4DYQA 1DGRM 3MZHA 2BY0A 1MW7A 1L3LA 2QSHX 4RLFA 1P7JA 5TRDA 1Z05A 3FM3A 1H8AC 3K1PA 2M1BA 5HLHA 2ZKZA 2R7TA 4E7LA 1WJFA 2A6EF 2XVCA 2ZXJA 2P5KA 2VQCA 4RB2C 2MA3A 4WWCA 1QHGA 1FYMA 4JX6A 1KU9A 1D8JA 2VC1A 2QKLB 1PP8F 4YEJA 3HL2A 1OYIA 4LIVA 2QYOA 1R36A 3SFZA 3VB2A 2E5ZA 4C3IJ 4CICA 1Y1VJ 1DP3A 2BHZA 2KZVA 4A3GJ 1Z1DA 3DBHB 1FBUA 1KU3A 1VNDA 3S16J 2VC0A 1ZR2A 1WWXA 1E17A 4E7KA 5F0CA 3AKZA 2NS8A 2R7QA 1U5TB 2H6BA 1SVLA 1OYYA 2FNAA 2QQBA 2MLKA 1Z7LA 2FXAA 3BLYA 1A31A 4D5CA 2DI3A 3HB9A 2ISZA 1P4XA 3RJPA 4P96A 2IGKA 2XRNA 2ECCA 5E1ZB 2LH9A 2MH9A 3BG6A 4YIIA 1PUFA 1BR2A 5J47A 4G7HF 1IN4A 4OINF 2CUEA 3FM5A 5ED4A 3FHNA 1WJCA 1VQ9I 1IUYA 2HTSA 2EH3A 3JRAA 5IOZA 5GADJ 1LB2A 2X0LA 1APLC 3B02A 2Q0OA 1I1GA 1YHQI 1SFUA 1V4RA 2CGPA 3TQNA 2G7HA 3SQNA 3QPLA 4RLQA 4A3BJ 3DPLC 1T33A 2O5RA 2LTPA 4UVBA 2KDOA 2Y48A 3ZMZA 5DDGA 2RNJA 3D5RC 4HNVA 3K2AA 4BNCA 1B1BA 1I1SA 4MFDA 2QSFX 5M5WJ 5LEKA 4Y15A 2FA5A 2HYJA 5DD8A 3S2HJ 2VQLA 2DJIA 3PSFA 3NWTA 3TKYA 2ESHA 1I39A 3WTSC 2X1DA 5FGMA 1P9QC 2KIFA 5FFXA 3QU6A 2STTA 1IN6A 3M8FA 2ME0A 2X1EA 5FLXK 3CDHA 4DOZA 2PJPA 3I4NJ 2NVUB 1IJWC 2BY3A 5FLXZ 1B72B 1ACIA 3KZIC 3FMSA 5L3GA 2VE9A 3HOWJ 1XGOA 4W1UA 3I4PA 1WCMJ 2JK3A 3H35A 4XLPF 2IPQX 5J4YA 4Q4ZF 3W3CA 1AA7A 1N75A 3IUOA 3QOPA 2M7AA 4QIWN 1U9OA 4NBQA 1ZK8A 1R58A 1RNLA 3TEDA 1HXDA 1G3WA 2L02A 2LFBA 4GRIA 2JZYA 1NK2P 3GFLA 3WGGA 2DOFA 1OKRA 3H3ZA 2CUFA 3PFYA 5AIQA 1DPRA 3H3VK 1YIOA 2KDZA 1ODDA 1VF9A 3I53A 1P4WA 3M8EA 4MFEA 3BCBA 1R71A 4BXUA 1BL0A 2BY1A 2V1NA 1NH3A 4AWXB 1WRJA 3M9AA 3NAUA 3V8LA 3AL0B 4BL0B 4B47A 2DQRA 3HEFA 3DEWA 1KA8A 1O3TA 3QAHA 5EYRA 2VI6A 2UZKA 1KQ8A 1LVKA 3TO9A 2LSOA 5CVUA 4CYCB 4IOAF 1RR8C 2JSPA 2VASA 2X6WA 5M5XJ 4JOMA 3ZQGA 2PEXA 5EG0A 3DWLE 3C18A 4BHCA 5E3NA 1IV6A 3SZPA 3V7RA 4L9JA 1F4KA 1N78A 4HF0A 2ID3A 2DU9A 1S29A 2CFOA 4IRIA 2F48A 1R6RA 5FB2A 4A3EJ 2PFBA 3RPUD 1FBSA 2RC4A 4CSWA 2E5NA 2F5EA 3DLLF 1PDNC 2KP6A 2WWYA 5M3MJ 5HNHA 2DFFA 1X4PA 2HQRA 1ZRFA 2DQLA 4X0GA 4GYIA 4KITB 1MZBA 3GEZA 5B66C 3CJNA 2VJJA 1MBGA 2P0WA 2V9VA 1WQ2A 2V4JC 4HLXA 4N4OB 1BJAA 2D2WA 3E6BA 1YFHA 3BG9A 3HGYA 1UZCA 2FX0A 1LUJB 1DU0A 2DPDA 4G7OF 2BOLA 2K9MA 2QM3A 5H6QA 3VFZA 1G3YA 1I3QJ 1SD6A 4HZFA 4M72A 4ZYAA 2X6XA 3A01B 1MMNA 5JVTA 1O3RA 4QTRA 4I09A 4XRMA 5FRMA 1S8NA 3F9KA 3BG7A 4A69C 1WZ2A 2R93J 2Z2SB 3QYBA 3JREA 1BI1A 3HOTA 5JI6A 3DLAA 1ON2A 4RGRA 4BKXA 1JUSA 1LJ9A 2XV4S 1JHHA 4XKCA 1HKSA 3J81Z 2W85A 1Y8RB 1R5ID 2NOJB 3TMOA 1O3QA 1B8IA 2UXNA 1JTYA 3OYNA 3WHBA 3QPHA 4PGGA 4XKBA 4EJWA 4R79A 4F93B 2HVSA 3G1OA 4KIBA 3CTAA 3HOSA 5F64A 3U2RA 4BEHA 4BHBA 3BDDA 4IQJA 2W1OA 4E7ZA 5D5UB 2CV1A 1YITI 2B63J 2IEKA 5D8KB 2R92J 3KEOA 4XLFA 2HTJA 3KETA 2PMZN 3ZPLA 2AXTC 5EGOA 3OWTA 4G6DA 5CVRA 2DMUA 3MD2A 3EUHA 2BY2A 3QP5A 1WJDA 4CDGA 4RB1A 1XS9A 2HDDA 1WI9A 4P55A 3ABMH 3KYLA 3HOZJ 2QQ8A 4RAZA 2Z99A 5JLXA 1E2XA 1ERDA 1CQTA 4OAYA 3SJMA 2I5UA 1NHAA 2HEOA 2PMZA 2XF6A 4YRVA 3CUQB 3EYIA 1J7KA 3CJRB 3C2HA 4AVPA 1O7LA 2FE3A 2MH2A 2OU2A 1JUPA 3K0LA 5BOXA 5FD5A 2X1CA 1SVMA 1X3ZB 3K4JA 4PUSA 1JJ6C 4IPAA 2HVRA 3GXOA 1VZ0A 1IG7A 2P5LC 4FISA 2O0YA 3DBLB 3LSJA 5FKNA 1IF1A 1Z67A 4U88A 1ZQ3P 4M9ZA 4XMYA 4G12A 3R60A 2DA4A 2WAQA 2DA3A 2DLLA 4M9SA 4C2MJ 1HC8A 1GXQA 4ZTFA 4CCMA 2DOEA 4WXDA 5HDGA 1UHSA 1HDPA 1TT5B 1HSTA 2KISA 3HRSA 3SFIA 1HDDC 2JT1A 2ELJA 1I3AA 4MTEA 2XF7A 2HZTA 1YW7A 2OTJI 2DAOA 4PJNA 3T1BA 4XQFA 1CF7A 2EFOA 2NVQJ 2EIMH 1TP4A 2I8DA 1MJBA 2QA4I 3BZKA 4DYRA 1OCZH 3CMYA 4P9FA 1YQAA 3VYRB 1QO0D 1V54H 3KEQA 2R7ZJ 1YS7A 1BR1A 2KKOA 4NQWA 1XSDA 1SAUA 2VE8A 1A5JA 2Y0SA 2A5WA 2GXBA 3JTHA 1RR7A 1C0WA 3U1DA 3SXYA 3RSNA 2XSDC 1SEUA 1ZG3A 4EMSA 2O9LA 2HYFA 3EUAA 2GA2A 2LG4A 3L00A 2MABA 2A6HF 3OL3A 3WTVC 3LSRA 2OD5A 3OYAA 3JRDA 3VYUB 1O4XA 3IRRA 1ZHFA 4XSXF 4IEJA 3A02A 2KLOA 2VXZA 4BE0A 2FF4A 5DM7F 3EUHC 1H88C 1HW1A 3KP5A 3TL4X 4V2GA 3LAJA 3PFIA 3GTJJ 2VKHA 5LRRA 3ZMVA 2HDCA 2KJCA 2HR3A 3FX3A 1BI2A 3FMRA 4PSXA 3WU1B 2CMPA 2PG4A 4XLCA 5C3EJ 2KQRA 2A6TA 3CDLA 5F1JA 3M1CA 2PN6A 3MCZA 3AG2H 3V42A 3CC4I 2EZKA 1GLNA 4A6DA 2WY7Q 1YYVA 4LMYA 1XGSA 3G71I 5IYBJ 1LQ1A 1XMKA 2K4BA 4WCGA 2LK2A 2K9NA 2XAHA 1SANA 4ITVA 3TW7A 5IYCJ 1FOWA 3KIOA 4BXFA 2YS9A 4A3IJ 5AONA 4W97A 1J0RA 3GFIA 3LMMA 2BVMA 3QPSA 4D0PA 3WGIA 2F2EA 2V7FA 3BTLA 1RKTA 2V9KA 3BTCA 1ZN2A 5CPRB 4EM2A 5BS6A 2E2IJ 3HTSB 5HLIA 3SHFA 2ZO4A 3ABLH 3HPGA 3RDIA 1ETWA 2N8GA 2GWRA 5F0HA 2KMUA 3NARA 4HRIA 2CQKA 2JTVA 3CO7C 3PO3J 1HSJA 2OJED 2AHQA 3OYBA 3BJ6A 2F5FA 1MDMA 3ABKH 2DFEA 4EGZA 1SAXA 3RQ4A 4IO9F 1K6OA 3GX4X 1UCRA 3EYYA 3HTUA 4EVIA 3HJEA 2IBDA 2Y0MA 3K9TA 4CA0A 3W6KB 2H09A 2MFZA 4HX8A 2P8TA 1WI3A 5K5QA 2O61A 4XLEA 1PUFB 4BY1J 2CW0F 2IGNA 1FZPB 2NRAC 2LNBA 5GPAA 1BOBA 2F4IA 3CC7I 5AIPA 1FOXA 3ZQLA 4LITA 1W7PA 1FJLA 4F52A 2IT0A 3GCMA 4Y17A 4UHTA 2ZMEA 1LPQA 3CCYA 1LE8A 4KICA 1P6RA 2ID6A 3TOBA 3RZDJ 2E36A 2KPMA 3HSEA 5BPDA 2PMHA 4KDPA 1WH5A 1QVUA 2L9VA 2WV0A 3ZQ7A 2K40A 3CMEI 3DEEA 1P7IA 2DYRH 3GTPJ 4LJZF 2GXGA 1SMTA 3K70C 2FQ4A 4RM2A 4XOTA 1KZHA 3S3OA 3FBNB 1YJ9I 4ZC3A 1RETA 3F8NA 4OWRB 5HDNA 1M1EB 3S32A 2ME6A 3SDGA 1LDKB 2ZJ2A 5E8GA 1FYKA 4BH9A 4BXXJ 2VJ4A 3K4LA 1ZARA 1FWZA 1FP2A 2DA7A 4BE1A 2H8RA 3QYEA 1FTTA 1TBXA 1Q1HA 3RYRA 4L9NA 3JRIA 3L2RA 1QA6A 3H36A 4YELA 1HKQA 4N4NB 3IRQA 1NTCA 3V7SA 1GUUA 2IJLA 4KT6A 2L7MP 2OV7A 2E2HJ 1ETXA 3VDXA 4HW0A 2HWVA 3VEPA 2M30A 1VI0A 3R4KA 3M8JA 4PSWA 1VQPI 4MEXF 1J9IA 3EPZA 3E6MA 4DW6A 2ZNZA 2R5YB 3AAFA 3WTXC 1JKQC 4ZYDA 2OZUA 2GBYA 2OTLI 1MNDA 3BJOA 3D1NI 2M0MA 1FSHA 4F55A 2L9SA 2HDWA 4C30A 4B44A 2DTZA 4KT5C 2DJNA 3F8BA 4I99C 1T2KA 3MZYA 1ON1A 2M4KA 4XN0A 4CCOA 2GOXB 5LFAA 4M71A 4OOIA 2ZMEC 3T0YA 3AG1H 3H9QA 2FBHA 1IRXA 2EA4A 1YJNI 1R1TA 1GV5A 1S3JA 2L7FP 2OQRA 3WGHA 4N0BA 4M3BA 2O03A 5FKMA 5EJCA 3P9KA 3Q0UA 4QSHA 5TGTA 3Q5FA 4IOCF 2VBYA 5EG0B 2OF7A 3LSPA 4A93J 1X2MA 2CV2A 2O8KA 5FKKA 4L9TA 3I71A 4UVAA 3ZMUA 2QGUA 3QP6A 2E34A 3BZCA 3BPXA 2EILH 2IS6A 5DS9A 1POGA 2J5OA 5KVRA 3GF2A 5LHHA 3EETA 4O5VA 2CUJA 5DCMA 2HI3A 2XKPA 5IPAA 4IKFA 3BY6A 3O6BB 3VYSB 3M4OJ 2R5ZA 3ONQA 5DUIA 4ESJA 3E6CC 4CGZA 1XDUA 2CW8A 1XMXA 2L01A 3V8KA 1O7FA 4EJOA 1JGSA 3S17J 4A0ZA 1Y0NA 3A03A 2BE5F 2GQQA 3D5SC 4HAMA 3ASNH 3DBRB 2OZ6A 2NS7A 1Y0UA 1BA5A 3WTUC 3QPTA 2DA2A 3G2BA 3IKTA 1IRFA 1BJZA 4ZDOA 2ZC2A 3BG5A 2ECBA 1J59A 3JAMK 3GVAA 3PNVA 2JUGA 3PIOF 1FOKA 2DODA 2A3SA 1R00A 2IGOA 3NEUA 1BI3A 1DP7P 3HRUA 2MBFA 4I2OA 4XBFA 3G3ZA 5EDNA 3E7LA 1ZGWA 5B1AH 1MKMA 2KHMA 4BY7J 2W48A 5D5XB 1Z6TA 2VBWA 4DJAA 3BT9A 5L3EA 1B8IB 4II2A 3WG7H 4D7MA 4L5JA 3TO7A 3ZCOA 3PM1A 1R1VA 1WSUA 1OYWA 4KUMA 1ZGAA 2E1NA 1ZG5A 4NC8A 4Y13A 2LKSA
chains in the Genus database with same CATH topology
2DA1A 1JT6A 2YU9J 1TWAJ 2M0CA 4DZJA 2M9HA 5M5XJ 3ZQGA 2LD5A 4A3CJ 5EG0A 3FISA 1ZKGA 5EGOB 5EZHA 3GTQJ 1FIPA 5E3NA 1IV6A 3Q0VA 3GTKJ 1F36A 2ID3A 4B3AA 1UMQA 2LVSA 2M34A 1HF0A 4XIDA 4DYCA 1U9NA 4C3JJ 3OSFA 1JT0A 4I76A 4A3EJ 3S14J 4IHVA 5F0FA 5M3MJ 4S0HB 1HLVA 1T56A 1B72A 4MO7A 1GVDA 2L9RA 1IDZA 1DU6A 1MBGA 3BG9A 3HGYA 5IP7J 4A3FJ 3IH2A 2FX0A 1DU0A 3H0GJ 3HBLA 1UG2A 3MN2A 2HOAA 1I3QJ 4XICA 3BR6A 4MLOA 1MBFA 5HODA 3OSGA 3A01B 1XG1A 4D7NA 4QTRA 4XRMA 2I10A 3HGGA 3B6CA 1RESA 5BNGA 1I6HJ 4FTHA 4A69C 2R93J 3O8HA 4RDUA 3JREA 5JLWA 1MBKA 4XRSA 4ABZA 2JA7J 4BKXA 4M3GA 5EF6A 1JUSA 2VKEA 5C4JJ 4J19A 1B8IA 4GFBA 1JTYA 3WHBA 3G1OA 2CQXA 5DTDA 1JKOC 4CYCA 3WHCA 4XRSG 1JGGA 5E3MA 3RZOJ 2XPVA 2B63J 2IEKA 2D5VA 2R92J 3BR0A 2PMZN 2DN0A 1W0TA 5EGOA 1Y1WJ 2DMUA 1I50J 3LSGA 4IHXA 1QVTA 1XS9A 5EZGA 2L0KA 1AHDP 5IYDJ 1YRNB 2HDDA 3HOZJ 2KT0A 1TWCJ 3Q0WA 5JLXA 1ENHA 1TWGJ 2ELKA 1CQTA 3S1NJ 2JJ7A 2AO9A 3SJMA 3ZQCA 1JTXA 1QRYA 1XC5A 1FEXA 5F27A 1Q1VA 2YUSA 2IAIA 1IC8A 4JX5A 4BBRJ 4IHWA 1GDTA 1K61A 1JUPA 1NK3P 1JJ6C 2X9DA 3HOUJ 1IG7A 1HCRA 2XPUA 4FISA 4UUTA 2OPTA 3LSJA 5FKNA 3JRGA 5F08A 2DA6A 2H1KA 5GP9A 2EZLA 2G0EA 3A01A 1ZQ3P 3W6VA 3JRCA 3OOUA 4G12A 3JRBA 3S15J 3JRFA 2DA4A 3BG3A 2X48A 5FJ8J 2VPRA 5IOYA 2DA3A 4C2MJ 1ETQA 1UHSA 1HDPA 2Y9ZA 3FIWA 1HDDC 3SFIA 1GV2A 2E19A 3Q3SA 4FE4A 2NVQJ 3S1RJ 4A3DJ 2Y30A 1WH7A 5K7HA 2P81A 3BQZA 4DYRA 2DMTA 3CMYA 1ORKA 4UUSB 1ETKA 2CU7A 2R7ZJ 1GT0C 2MG4A 3GTLJ 2CJJA 1A5JA 2RAEA 4FE7A 1RR7A 1H89C 4B4CA 2XSDC 2DMPA 2O9LA 2JN6A 5E3OA 3HM5A 3ZOBA 1MBHA 3LSRA 4AYBN 3JRDA 5J1RA 5K7FA 1O4XA 2R0QC 4IEJA 3A02A 2Y2ZA 2ZB9A 1H88C 4MIMA 4XK4A 5E3LA 4JYKA 1Z77A 4V2GA 2FJ1A 1YRNA 3GTJJ 3LNQA 5J1YA 5K7ZA 1FTZA 3FK7A 4FCYA 2K9QA 4I6ZA 3O8GA 4B1RA 2NOGA 2CRGA 4JX4A 4AUXA 5EEAA 4A3JJ 4X1EA 5C3EJ 1ETOA 3MKLA 2QF7A 5F04A 3TP0A 3CDLA 1R9TJ 1OCTC 5F1JA 1S7EA 2VKVA 3LOCA 3BR1A 1WPKA 3G1LA 3ZQFA 2DMQA 2X6OA 2EZKA 3S1MJ 1IUFA 3K7AJ 5IYBJ 4IHYA 1MBJA 2LK2A 2K9NA 1K83J 1SANA 2K9SA 3TW7A 5IYCJ 1ZTRA 3IH4A 2YS9A 1U8BA 4A3IJ 5GPCA 1MSEC 4W97A 1ETVA 1D5YA 3VPRA 3IH3A 3QPSA 3HOXJ 2HQ5A 3BTLA 1RKTA 5M3FJ 1JUMA 3BTCA 2E2IJ 1MH3A 1ETWA 2N8GA 4C3HJ 5F0HA 3NARA 1TWHJ 3BR5A 3HDDA 4EEFG 3BTIA 3PO3J 2AHQA 1BW6A 2HXOA 4UUSA 5FLVA 3GTGJ 2E2JJ 2JA8J 4NDLA 3RQIA 3TW6A 5FLMJ 1ZR4A 1AKHB 3GTOJ 1OFCX 1MSFC 5M5YJ 2CQQA 1JKPC 1SFOJ 2IBDA 2XB5A 1JJ8C 3F0CA 2HXIA 2XPWA 1WI3A 3HKZN 2WAQN 3C2BA 2MSYA 2JMWA 2LKXA 1PUFB 4Y52J 1IGNA 4BY1J 2XB0X 1IDYA 1HOMA 9ANTA 1EF4A 4Y7NJ 4M3DA 2COBA 2GM4A 5GPAA 3BQYA 3ZQLA 1ITYA 1FJLA 1RKWA 1E3OC 4X6AJ 1X2NA 2R5YA 2GLOA 2XGDA 2LLKA 3CCYA 1LE8A 2ID6A 3RZDJ 2NVTJ 1MBEA 3B6AA 1QPIA 4A3LJ 4DYQA 1WH5A 1QVUA 2K40A 1P7JA 2Y0SN 1H8AC 1P7IA 3GTPJ 2M8GX 3GBGA 2FQ4A 2Y9YA 2LY9A 2LR8A 1TC3C 1RETA 2ME6A 3SDGA 4JX6A 5C4XJ 3ZQIA 1AU7A 4JP0A 3RKQA 3FK6A 1MH4A 4L5EA 4BXXJ 2JA5J 3HOVJ 4C3IJ 2DA7A 2XRLA 2H8RA 2DA5A 1FTTA 1Y1VJ 4M3FA 4M3EA 4A3GJ 3JRIA 3S16J 1VNDA 5IP6A 3JRHA 3BR3A 3CQZJ 1ZR2A 2R5ZB 5F0CA 1NTCA 2NS8A 2JWTA 1GUUA 2L7MP 2QCOA 2E2HJ 1ETXA 2WB1N 4LOCA 1JKRC 3QQAA 4D5CA 1AKHA 3HB9A 1VI0A 2O7OA 1TWFJ 4DW6A 2R5YB 1MNMC 2ECCA 1JKQC 4V2FA 1LE8B 2GBYA 1OCPA 1PUFA 3TP3A 3D1NI 1U78A 3BTJA 3GTMJ 2DTZA 4A3MJ 2DJNA 1Z0XA 3IV5A 3HOYJ 2CUEA 1FIAA 1W0UA 2EBIA 5C44J 2EH3A 2EQRA 5IOZA 3JRAA 2HOSA 2Y31A 3DCFA 1APLC 2NVXJ 1WGXA 1LFUP 3OIOA 1GV5A 3G1MA 5FKOA 2L7FP 1LFBA 3QPLA 2TRTA 5J1UA 4A3BJ 5IP9J 1T33A 2XGCA 1BW5A 2LTPA 3FKIJ 4M3BA 4DZPA 2HOTA 5FKMA 3S2DJ 4QSHA 3Q0UA 4HNVA 3K2AA 3BR2A 4MFDA 5M5WJ 5EG0B 2HYJA 2OF7A 3LSPA 4AC0A 3S2HJ 1X2MA 4A93J 2O8KA 5FKKA 3UKGA 4A3KJ 2NVYJ 3S1QJ 3ZQHA 2ME0A 2WV1A 1A6IA 5DS9A 1POGA 3JR9A 3I4NJ 5IPAA 2HI3A 2JA6J 1G2HA 1IJWC 1OJLA 1B72B 5FKLA 3M4OJ 2R5ZA 3HOWJ 4W1UA 4RBOA 2M2EA 4D5FA 3S17J 1WCMJ 2JK3A 3A03A 2E1OA 2VUMJ 2NS7A 1BA5A 2DA2A 4BBSJ 4QIWN 5J3LA 1U9OA 1ZK8A 1BJZA 3BG5A 2MGQA 2ECBA 3TEDA 3PO2J 2MW8A 2LP0A 2LFBA 2TCTA 1NK2P 1X58A 3MVPA 1ETYA 2CUFA 3M3YJ 3H3VK 2KDZA 1VF9A 2DMNA 4M6VA 4MFEA 1RPWA 2L7ZA 5EDNA 2FD5A 3L1PA 3E7LA 1BL0A 1ZGWA 3NAUA 3I4MJ 4BY7J 2W48A 2EZIA 2XGEA 2EZHA 3BT9A 3HEFA 1B8IB 1VFCA 3DEWA 4D7MA 1F43A 3PM1A 5EYRA 2VI6A 1IRZA 4CYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA1 A;  1JT6 A;  2YU9 J;  1TWA J;  2M0C A;  4DZJ A;  2M9H A;  5M5X J;  3ZQG A;  2LD5 A;  4A3C J;  5EG0 A;  3FIS A;  1ZKG A;  5EGO B;  5EZH A;  3GTQ J;  1FIP A;  5E3N A;  1IV6 A;  3Q0V A;  3GTK J;  1F36 A;  2ID3 A;  4B3A A;  1UMQ A;  2LVS A;  2M34 A;  1HF0 A;  4XID A;  4DYC A;  1U9N A;  4C3J J;  3OSF A;  1JT0 A;  4I76 A;  4A3E J;  3S14 J;  4IHV A;  5F0F A;  5M3M J;  4S0H B;  1HLV A;  1T56 A;  1B72 A;  4MO7 A;  1GVD A;  2L9R A;  1IDZ A;  1DU6 A;  1MBG A;  3BG9 A;  3HGY A;  5IP7 J;  4A3F J;  3IH2 A;  2FX0 A;  1DU0 A;  3H0G J;  3HBL A;  1UG2 A;  3MN2 A;  2HOA A;  1I3Q J;  4XIC A;  3BR6 A;  4MLO A;  1MBF A;  5HOD A;  3OSG A;  3A01 B;  1XG1 A;  4D7N A;  4QTR A;  4XRM A;  2I10 A;  3HGG A;  3B6C A;  1RES A;  5BNG A;  1I6H J;  4FTH A;  4A69 C;  2R93 J;  3O8H A;  4RDU A;  3JRE A;  5JLW A;  1MBK A;  4XRS A;  4ABZ A;  2JA7 J;  4BKX A;  4M3G A;  5EF6 A;  1JUS A;  2VKE A;  5C4J J;  4J19 A;  1B8I A;  4GFB A;  1JTY A;  3WHB A;  3G1O A;  2CQX A;  5DTD A;  1JKO C;  4CYC A;  3WHC A;  4XRS G;  1JGG A;  5E3M A;  3RZO J;  2XPV A;  2B63 J;  2IEK A;  2D5V A;  2R92 J;  3BR0 A;  2PMZ N;  2DN0 A;  1W0T A;  5EGO A;  1Y1W J;  2DMU A;  1I50 J;  3LSG A;  4IHX A;  1QVT A;  1XS9 A;  5EZG A;  2L0K A;  1AHD P;  5IYD J;  1YRN B;  2HDD A;  3HOZ J;  2KT0 A;  1TWC J;  3Q0W A;  5JLX A;  1ENH A;  1TWG J;  2ELK A;  1CQT A;  3S1N J;  2JJ7 A;  2AO9 A;  3SJM A;  3ZQC A;  1JTX A;  1QRY A;  1XC5 A;  1FEX A;  5F27 A;  1Q1V A;  2YUS A;  2IAI A;  1IC8 A;  4JX5 A;  4BBR J;  4IHW A;  1GDT A;  1K61 A;  1JUP A;  1NK3 P;  1JJ6 C;  2X9D A;  3HOU J;  1IG7 A;  1HCR A;  2XPU A;  4FIS A;  4UUT A;  2OPT A;  3LSJ A;  5FKN A;  3JRG A;  5F08 A;  2DA6 A;  2H1K A;  5GP9 A;  2EZL A;  2G0E A;  3A01 A;  1ZQ3 P;  3W6V A;  3JRC A;  3OOU A;  4G12 A;  3JRB A;  3S15 J;  3JRF A;  2DA4 A;  3BG3 A;  2X48 A;  5FJ8 J;  2VPR A;  5IOY A;  2DA3 A;  4C2M J;  1ETQ A;  1UHS A;  1HDP A;  2Y9Z A;  3FIW A;  1HDD C;  3SFI A;  1GV2 A;  2E19 A;  3Q3S A;  4FE4 A;  2NVQ J;  3S1R J;  4A3D J;  2Y30 A;  1WH7 A;  5K7H A;  2P81 A;  3BQZ A;  4DYR A;  2DMT A;  3CMY A;  1ORK A;  4UUS B;  1ETK A;  2CU7 A;  2R7Z J;  1GT0 C;  2MG4 A;  3GTL J;  2CJJ A;  1A5J A;  2RAE A;  4FE7 A;  1RR7 A;  1H89 C;  4B4C A;  2XSD C;  2DMP A;  2O9L A;  2JN6 A;  5E3O A;  3HM5 A;  3ZOB A;  1MBH A;  3LSR A;  4AYB N;  3JRD A;  5J1R A;  5K7F A;  1O4X A;  2R0Q C;  4IEJ A;  3A02 A;  2Y2Z A;  2ZB9 A;  1H88 C;  4MIM A;  4XK4 A;  5E3L A;  4JYK A;  1Z77 A;  4V2G A;  2FJ1 A;  1YRN A;  3GTJ J;  3LNQ A;  5J1Y A;  5K7Z A;  1FTZ A;  3FK7 A;  4FCY A;  2K9Q A;  4I6Z A;  3O8G A;  4B1R A;  2NOG A;  2CRG A;  4JX4 A;  4AUX A;  5EEA A;  4A3J J;  4X1E A;  5C3E J;  1ETO A;  3MKL A;  2QF7 A;  5F04 A;  3TP0 A;  3CDL A;  1R9T J;  1OCT C;  5F1J A;  1S7E A;  2VKV A;  3LOC A;  3BR1 A;  1WPK A;  3G1L A;  3ZQF A;  2DMQ A;  2X6O A;  2EZK A;  3S1M J;  1IUF A;  3K7A J;  5IYB J;  4IHY A;  1MBJ A;  2LK2 A;  2K9N A;  1K83 J;  1SAN A;  2K9S A;  3TW7 A;  5IYC J;  1ZTR A;  3IH4 A;  2YS9 A;  1U8B A;  4A3I J;  5GPC A;  1MSE C;  4W97 A;  1ETV A;  1D5Y A;  3VPR A;  3IH3 A;  3QPS A;  3HOX J;  2HQ5 A;  3BTL A;  1RKT A;  5M3F J;  1JUM A;  3BTC A;  2E2I J;  1MH3 A;  1ETW A;  2N8G A;  4C3H J;  5F0H A;  3NAR A;  1TWH J;  3BR5 A;  3HDD A;  4EEF G;  3BTI A;  3PO3 J;  2AHQ A;  1BW6 A;  2HXO A;  4UUS A;  5FLV A;  3GTG J;  2E2J J;  2JA8 J;  4NDL A;  3RQI A;  3TW6 A;  5FLM J;  1ZR4 A;  1AKH B;  3GTO J;  1OFC X;  1MSF C;  5M5Y J;  2CQQ A;  1JKP C;  1SFO J;  2IBD A;  2XB5 A;  1JJ8 C;  3F0C A;  2HXI A;  2XPW A;  1WI3 A;  3HKZ N;  2WAQ N;  3C2B A;  2MSY A;  2JMW A;  2LKX A;  1PUF B;  4Y52 J;  1IGN A;  4BY1 J;  2XB0 X;  1IDY A;  1HOM A;  9ANT A;  1EF4 A;  4Y7N J;  4M3D A;  2COB A;  2GM4 A;  5GPA A;  3BQY A;  3ZQL A;  1ITY A;  1FJL A;  1RKW A;  1E3O C;  4X6A J;  1X2N A;  2R5Y A;  2GLO A;  2XGD A;  2LLK A;  3CCY A;  1LE8 A;  2ID6 A;  3RZD J;  2NVT J;  1MBE A;  3B6A A;  1QPI A;  4A3L J;  4DYQ A;  1WH5 A;  1QVU A;  2K40 A;  1P7J A;  2Y0S N;  1H8A C;  1P7I A;  3GTP J;  2M8G X;  3GBG A;  2FQ4 A;  2Y9Y A;  2LY9 A;  2LR8 A;  1TC3 C;  1RET A;  2ME6 A;  3SDG A;  4JX6 A;  5C4X J;  3ZQI A;  1AU7 A;  4JP0 A;  3RKQ A;  3FK6 A;  1MH4 A;  4L5E A;  4BXX J;  2JA5 J;  3HOV J;  4C3I J;  2DA7 A;  2XRL A;  2H8R A;  2DA5 A;  1FTT A;  1Y1V J;  4M3F A;  4M3E A;  4A3G J;  3JRI A;  3S16 J;  1VND A;  5IP6 A;  3JRH A;  3BR3 A;  3CQZ J;  1ZR2 A;  2R5Z B;  5F0C A;  1NTC A;  2NS8 A;  2JWT A;  1GUU A;  2L7M P;  2QCO A;  2E2H J;  1ETX A;  2WB1 N;  4LOC A;  1JKR C;  3QQA A;  4D5C A;  1AKH A;  3HB9 A;  1VI0 A;  2O7O A;  1TWF J;  4DW6 A;  2R5Y B;  1MNM C;  2ECC A;  1JKQ C;  4V2F A;  1LE8 B;  2GBY A;  1OCP A;  1PUF A;  3TP3 A;  3D1N I;  1U78 A;  3BTJ A;  3GTM J;  2DTZ A;  4A3M J;  2DJN A;  1Z0X A;  3IV5 A;  3HOY J;  2CUE A;  1FIA A;  1W0U A;  2EBI A;  5C44 J;  2EH3 A;  2EQR A;  5IOZ A;  3JRA A;  2HOS A;  2Y31 A;  3DCF A;  1APL C;  2NVX J;  1WGX A;  1LFU P;  3OIO A;  1GV5 A;  3G1M A;  5FKO A;  2L7F P;  1LFB A;  3QPL A;  2TRT A;  5J1U A;  4A3B J;  5IP9 J;  1T33 A;  2XGC A;  1BW5 A;  2LTP A;  3FKI J;  4M3B A;  4DZP A;  2HOT A;  5FKM A;  3S2D J;  4QSH A;  3Q0U A;  4HNV A;  3K2A A;  3BR2 A;  4MFD A;  5M5W J;  5EG0 B;  2HYJ A;  2OF7 A;  3LSP A;  4AC0 A;  3S2H J;  1X2M A;  4A93 J;  2O8K A;  5FKK A;  3UKG A;  4A3K J;  2NVY J;  3S1Q J;  3ZQH A;  2ME0 A;  2WV1 A;  1A6I A;  5DS9 A;  1POG A;  3JR9 A;  3I4N J;  5IPA A;  2HI3 A;  2JA6 J;  1G2H A;  1IJW C;  1OJL A;  1B72 B;  5FKL A;  3M4O J;  2R5Z A;  3HOW J;  4W1U A;  4RBO A;  2M2E A;  4D5F A;  3S17 J;  1WCM J;  2JK3 A;  3A03 A;  2E1O A;  2VUM J;  2NS7 A;  1BA5 A;  2DA2 A;  4BBS J;  4QIW N;  5J3L A;  1U9O A;  1ZK8 A;  1BJZ A;  3BG5 A;  2MGQ A;  2ECB A;  3TED A;  3PO2 J;  2MW8 A;  2LP0 A;  2LFB A;  2TCT A;  1NK2 P;  1X58 A;  3MVP A;  1ETY A;  2CUF A;  3M3Y J;  3H3V K;  2KDZ A;  1VF9 A;  2DMN A;  4M6V A;  4MFE A;  1RPW A;  2L7Z A;  5EDN A;  2FD5 A;  3L1P A;  3E7L A;  1BL0 A;  1ZGW A;  3NAU A;  3I4M J;  4BY7 J;  2W48 A;  2EZI A;  2XGE A;  2EZH A;  3BT9 A;  3HEF A;  1B8I B;  1VFC A;  3DEW A;  4D7M A;  1F43 A;  3PM1 A;  5EYR A;  2VI6 A;  1IRZ A;  4CYC B; 
#chains in the Genus database with same CATH topology
 1YIJ I;  1WJE A;  3ML6 A;  4BEH B;  4IVN A;  4A5M A;  3RKY A;  4UY8 I;  2M0C A;  4DZJ A;  3KP4 A;  4A3C J;  3IHU A;  1STZ A;  4AIK A;  3BP8 A;  4LLL A;  2HPM A;  2STW A;  2VOD A;  3F23 A;  2M4G A;  5EGO B;  1X3W B;  3K70 D;  1A35 A;  1F36 A;  3GTK J;  1A04 A;  4YIR X;  1OCR H;  1HF0 A;  4MNU A;  4IHS A;  2BHY A;  4I76 A;  3S14 J;  4IHV A;  4J00 A;  4ZYG A;  4G7Z F;  2QLZ A;  4IQ4 A;  2EV5 A;  1F5T A;  3V7C A;  4S0H B;  4L9V A;  5J4V A;  1GVD A;  3ZRG A;  3CCJ I;  1B59 A;  2JVH A;  4IRH A;  2K7L A;  4JBA A;  3ISP A;  1F1Z A;  1IXC A;  2JPB A;  4RS8 A;  4AID A;  1NG6 A;  5IP7 J;  4A3F J;  2D1V A;  3IAS 2;  3IH2 A;  2MD0 A;  3IWZ A;  2F5V A;  3OYK A;  4MLO A;  1R4N B;  5KCM A;  1TNS A;  3I5U A;  4PJL A;  2R4G A;  3UR3 C;  3OYM A;  1HA8 A;  4HBL A;  1MJ9 A;  5GAH J;  1XPX A;  5LHI A;  3FMQ A;  3DP7 A;  4XON A;  3O8H A;  1SC7 A;  3ZP5 A;  2CO5 A;  2JA7 J;  1E0E A;  3L2Q A;  3H9J A;  3KP6 A;  4O6J A;  5HLT A;  4LG0 A;  1LVA A;  1RC9 A;  2DFI A;  2R7F A;  1OCC H;  2B7E A;  4N9H A;  4S04 A;  3WU0 A;  1CF7 B;  5DM6 F;  4A0Y A;  5JR3 A;  1HBX G;  3DQV C;  1T39 A;  4WK8 F;  1W7P D;  4JK1 X;  5LGU A;  2R7R A;  1MD0 A;  3KZY A;  4OMY A;  1EH7 A;  4GFB A;  3EUK L;  2IA1 A;  2FQ3 A;  2P5V A;  3REO A;  2V6E A;  2BW3 A;  3S2W A;  4NQW B;  4ZZL A;  2CQX A;  3WHC A;  1UG0 A;  1JGG A;  5E3M A;  3ZQQ A;  4AM3 A;  4O3M A;  2D5V A;  3LQR A;  3SEQ A;  3IKV A;  1KON A;  1CGP A;  2G7U A;  4PGH A;  4KIS A;  3Q9V A;  2DT5 A;  3ELK A;  4ZYE A;  3L9F A;  1QVT A;  3MAJ A;  4CXF A;  2L0K A;  2L9N A;  4C2U A;  3GZN B;  4FHT A;  3KYD B;  2LKP A;  4NHJ A;  1TWC J;  1ENH A;  1U8R A;  4GGG A;  2JJ7 A;  2AO9 A;  4G8X A;  4KN7 X;  1JTX A;  1TQP A;  3GW2 A;  2KIU A;  4BS9 A;  1Q1V A;  2EV6 A;  2K4J A;  4IHW A;  4ESB A;  3RPQ A;  3DPT A;  1UFM A;  3OYE A;  1XCB A;  2X9D A;  2EPF A;  1RI7 A;  2M8E A;  3K4C A;  1HCR A;  4D1Q A;  5F08 A;  5J6X A;  4B48 A;  2Q2E B;  2AQF A;  2XSJ C;  3ASO H;  5DCF A;  4ZZD A;  3KP2 A;  3JRB A;  3G4S I;  3CES A;  3BG3 A;  5ILV A;  3K4M A;  5FJ8 J;  1FLI A;  4PJ0 C;  5IOY A;  3QOD A;  2XAJ A;  3FIW A;  3QWL A;  3I9V 2;  2XIG A;  4LIU A;  4QWQ A;  2HKO A;  4Z6Y A;  4M6X A;  2ZSH B;  4MHG A;  3R6S A;  2FBI A;  4RM3 A;  3K10 A;  2VJI A;  3Q3S A;  1TTY A;  4Z2Y A;  3G6E I;  1FC3 A;  3DPU A;  2EFN A;  3MMY B;  1X1C A;  3HHG A;  3SZT A;  3CP8 A;  2P81 A;  2ZXI A;  3KYC B;  1MDM B;  3PNY A;  1ORK A;  2CU7 A;  2DK5 A;  1GT0 C;  4HF2 A;  2K02 A;  2PI0 A;  1G3S A;  2F4O B;  2ZSI B;  2LMD A;  4BQO A;  4FE7 A;  1WHU A;  2COM A;  3EDP A;  2JN6 A;  1FSE A;  3ZOB A;  3GME A;  1T6S A;  3PQJ A;  1XCV A;  3W2A A;  2P7C B;  1MIJ A;  5HS7 A;  3L2W A;  2HGC A;  4II3 A;  5B1B H;  3DKY A;  4XK4 A;  2M45 A;  4J01 A;  2FJ1 A;  3CZ6 A;  1W4M A;  3F22 A;  4CZC A;  5GTH C;  2R7V A;  1W7P B;  5H6R A;  3FK7 A;  4FCY A;  2K9Q A;  3I54 A;  3CCS I;  2H8W A;  1BIA A;  2WAE A;  3FKJ A;  4B1R A;  3MEX A;  2E1M C;  3PNT A;  1R22 A;  4M9X A;  2H94 A;  5EEA A;  3W6J B;  3OMY A;  1OCO H;  2RQQ A;  2QF7 A;  4I0B A;  4JQF A;  5F04 A;  1OCT C;  1S7E A;  3R0A A;  1YS6 A;  2IA2 A;  4U7B A;  1KU7 A;  5ILS A;  3BR1 A;  3JCU C;  1XGM A;  2WB1 A;  2W00 A;  4P5O A;  5LEJ A;  4M6Y A;  1IUF A;  3K7A J;  4HX7 A;  4Y3O A;  1UST A;  2FSW A;  2K9S A;  2XGX A;  4D9J A;  4OAZ A;  2VOP A;  2M7B A;  2H27 A;  1JXS A;  1MNE A;  4LLG F;  3HSF A;  1U8B A;  4XLH A;  4EJT A;  3LA2 A;  2IS1 A;  5GAE J;  5L3F A;  3IH3 A;  3HOX J;  4UV9 A;  2HQ5 A;  1JUM A;  1SMY F;  3HG9 A;  4B3X A;  2PBI A;  3I0T A;  5D6E A;  4WXC A;  4HV5 A;  1Z9C A;  2DBB A;  4EEF G;  3BTI A;  2DTR A;  3CDI A;  4HQE A;  1Z21 A;  1BW6 A;  5FFZ A;  2JA8 J;  2L4A A;  3KPH A;  4CO8 A;  1PVE A;  4EV0 A;  2E71 A;  3NQO A;  5FLM J;  1ZR4 A;  2EK5 A;  2GXA A;  1H9T A;  1TQM A;  1FT9 A;  2O3F A;  4BQQ A;  1OFC X;  1D1A A;  1BN5 A;  2OBP A;  1ZLJ A;  2XB5 A;  1PYV A;  1S7O A;  2WAQ N;  2JMW A;  3OS1 A;  2XKO A;  2XB0 X;  3FXL A;  3HHH A;  1IDY A;  1OIS A;  2YX7 A;  5E20 A;  4M3D A;  4AD9 A;  4Q47 A;  2CWE A;  1TL8 A;  3MQ0 A;  1YW8 A;  1REP C;  3RYP A;  4Q5S F;  4G6T B;  3PIP F;  2W4S A;  3KX2 A;  5IT3 A;  3IP4 B;  4BGD A;  5LBQ A;  4TV7 A;  1D8K A;  4PCQ A;  1MBE A;  1QPI A;  2ICW G;  2A5Y B;  3HPH A;  2EFW A;  2VXD A;  3LSM A;  2W84 A;  4PJJ A;  1KGS A;  3WTT C;  3ABU A;  1R49 A;  2Y0S N;  1JHF A;  2EIJ H;  3HUG A;  3IL2 A;  2XHK A;  2M8G X;  2V1U A;  2KZG A;  3E1S A;  2FUG 2;  5LRS A;  2K5C A;  4E7I A;  2DPU A;  2Y9Y A;  2LY9 A;  2NAZ A;  2LR8 A;  5D8L B;  3CMA I;  1TC3 C;  5IY5 H;  1G4D A;  3FWE A;  4AIJ A;  4DIQ A;  2DOA A;  2QBY A;  4BQA A;  1G3T A;  1EH6 A;  2V1D A;  1LNW A;  1UB9 A;  4IXA A;  1GXP A;  5CVV A;  2IVM A;  2L7K A;  4L5E A;  2JA5 J;  1LDD A;  3HOV J;  2PJR A;  2V79 A;  3U9G A;  3ZXS A;  2E60 A;  2M87 A;  1D0Y A;  3RIR A;  4HLY A;  2XRL A;  5BMZ A;  4I01 A;  5DCM B;  3WU2 C;  2VN2 A;  4M3F A;  4M3E A;  1R5H A;  2BXZ A;  2OC6 A;  2Y69 H;  3BR3 A;  5CQG A;  2R5Z B;  1HKT A;  2DDA A;  3P7N A;  1V5E A;  4RAF A;  2JWT A;  1WJ5 A;  4CCJ A;  4RGU A;  2EIN H;  3I55 I;  4IL6 C;  4LOC A;  4RB3 C;  3QU3 A;  3I59 A;  2A68 F;  2LY1 A;  5H2F C;  2O7O A;  4XR6 A;  1TWF J;  2FNP A;  1MNM C;  1FMV A;  1Z3X A;  4AIH A;  4ESF A;  1I6X A;  2RVC A;  4I02 A;  1IRG A;  3DTI A;  5L3B A;  1U3E M;  1U78 A;  5CVJ A;  4HG2 A;  3BTJ A;  4KJZ A;  4NC7 A;  4A3M J;  1Z0X A;  4GXO A;  3IV5 A;  4A6E A;  1FIA A;  3MKZ A;  3GZ6 A;  1IAW A;  4OIR F;  3HOY J;  3J7Z I;  2EBI A;  2JVG A;  5C44 J;  3LST A;  3J80 K;  2WC2 A;  4EQQ A;  2EQR A;  2HOS A;  2V6C A;  4U0W A;  2Y31 A;  2DK8 A;  3DCF A;  2NVX J;  1S72 I;  2VT2 A;  2GIZ A;  5CKT A;  2UV1 A;  3J80 Z;  3G1M A;  2L5Q A;  4F3Q A;  1VQ6 I;  5FKO A;  3MKY B;  1X1B A;  1LFB A;  1YOV B;  2TRT A;  3FXR A;  1NG7 A;  2XF5 A;  2XGC A;  1PUE E;  1BW5 A;  3FKI J;  1RUN A;  1VTN C;  1K6Y A;  3J7A O;  4DZP A;  2HOT A;  3OS2 A;  4QLC U;  2HOE A;  3CP2 A;  3VSK A;  4RB0 A;  3ZN1 A;  4H0E A;  4OIQ F;  3GUD A;  4OU0 A;  4U7D A;  3FXO A;  1Y56 A;  4EJV A;  4A3K J;  2W24 A;  5E1W A;  2DT7 B;  3ZQH A;  2EIK H;  4RMN A;  3LSI A;  2FMY A;  2WV1 A;  1A6I A;  3DV8 A;  2PLY A;  2QWW A;  2NNN A;  4UV8 A;  1G2H A;  2JA6 J;  5LGT A;  1IN7 A;  3P9I A;  1OJL A;  2P6T A;  4WXH A;  4RBO A;  2BBY A;  3WOD F;  4ZTJ A;  1VQN I;  4UVC A;  1X1A A;  4NC6 A;  1YE9 A;  3TOA A;  2QEN A;  2LOO A;  2VUM J;  5E17 F;  2BZT A;  4XN3 A;  2A07 F;  4YFN F;  5J3L A;  5GTI C;  4L0Z B;  2MGQ A;  4BU2 A;  1ZRE A;  4F92 B;  3PO2 J;  2MW8 A;  2VBX A;  1AWC A;  4CH7 A;  3ERE D;  4HF1 A;  2LP0 A;  4NB5 A;  2RGV A;  1X58 A;  1S5L C;  2JUC A;  2LY2 A;  3VSL A;  3BC8 A;  4OMZ A;  4P1W A;  4RGS A;  4DNC A;  3JSO A;  2EWN A;  1JI8 A;  1QNT A;  4M6V A;  1RPW A;  2L7Z A;  2QEX I;  2FD5 A;  5LGN A;  1S6L A;  2RN7 A;  4LG0 B;  1B9N A;  1R5G A;  3GZ5 A;  4CUG A;  3I4M J;  1JE8 A;  5D4R A;  1A36 A;  2EZH A;  1QU3 A;  2MLG A;  1ZGJ A;  4L5I A;  3S3M A;  4IJA A;  1F43 A;  3L2U A;  1X3U A;  2BW3 B;  4BAY A;  3P5J A;  4PZJ A;  2DA1 A;  3AFH A;  2YU9 J;  1TWA J;  4XOP A;  1E3H A;  3OYL A;  2DYS H;  2VOO A;  3H9G A;  2E7W A;  1KYW A;  2O6G E;  1ZKG A;  3NRV A;  1HW2 A;  1G59 A;  5EZH A;  1FIP A;  1D3Y A;  3Q0V A;  1VQ5 I;  2IGM A;  3ABT A;  3LSK A;  2LVS A;  2M34 A;  3OYF A;  4XID A;  3KP7 A;  1U9N A;  4DYC A;  3A0B C;  1OMI A;  3C2G A;  3OSF A;  1LFP A;  3GO5 A;  5JFR A;  3S3N A;  2FU4 A;  5F0F A;  5E79 C;  4GO1 A;  3HC7 A;  3K2Z A;  3KP3 A;  1T56 A;  2D1H A;  3KEY A;  3H5R A;  4MO7 A;  4Q48 A;  2L9R A;  2VBZ A;  1IDZ A;  3K1M A;  2E1M B;  1ONV A;  3FBI B;  1AOY A;  3KZZ A;  3FXJ A;  3TBI A;  5A2Q K;  4AVZ A;  2ZFW A;  2DT6 A;  4BDY A;  5E18 F;  3LFU A;  3C3W A;  3LFK A;  2VJ5 A;  3E3V A;  3PQK A;  4DQ2 A;  3HBL A;  2EA2 A;  3FZV A;  3A4C A;  4XIC A;  3BR6 A;  3O2P E;  3FXK A;  4P9U A;  2KIQ A;  5HS8 A;  5HOD A;  3OSG A;  4D7N A;  3IWF A;  4AYB A;  2XRO A;  2I10 A;  3CUQ A;  3CLO A;  1KQ9 A;  2XDV A;  1RES A;  1WVR A;  3BOQ A;  3HIF A;  1I6H J;  4FTH A;  3E5U A;  3LAP A;  5JLW A;  3E0J B;  1B4A A;  4XRS A;  4XLA A;  4UUV A;  1YW9 A;  1IO2 A;  4FX0 A;  4M3G A;  2RDP A;  2ZXH A;  3L2V A;  1D1C A;  2BEO A;  2OA4 A;  5CLS A;  4I98 B;  1EV7 A;  5C4J J;  1UAA A;  3R0J A;  4J19 A;  3FXQ A;  3LQQ A;  1QBJ A;  5TJJ A;  5CVI A;  2Z3Y A;  3M07 A;  5DTD A;  2VKD A;  1W36 C;  1S9H A;  3R61 A;  3CCR I;  1XMA A;  3RZO J;  4DGW B;  2VPL A;  2H6C A;  4XLN F;  4RAG A;  2ZXW H;  1Y1W J;  1IXR C;  2ZJP F;  1YX5 A;  4IHX A;  3LSG A;  1B9M A;  1VQ8 I;  2HQN A;  5EZG A;  5IYD J;  1X4O A;  1AHD P;  4CCK A;  4CYD A;  5EEH A;  4YG2 F;  1VQ7 I;  3ERM A;  2KT0 A;  4DBQ A;  1K79 A;  1TW2 A;  3F3X A;  4PK4 A;  4A2U A;  2ELK A;  3OYJ A;  3ZQC A;  1DPU A;  4FT8 A;  2K9L A;  2AXL A;  1QRY A;  1XC5 A;  3ECH A;  3OYD A;  5TIS C;  2HNH A;  4GCV A;  1IC8 A;  2YUS A;  2BVL A;  1H9G A;  1BI0 A;  2X6Y A;  5CQE A;  4BBR J;  4LGW A;  4XM3 A;  1K61 A;  1ULY A;  1NK3 P;  3JAM Z;  2CQN A;  2F6C A;  2VON A;  2VL8 A;  2UWM A;  3HOU J;  3K4K A;  4I7H A;  2XPU A;  4UUT A;  2OPT A;  3V4G A;  1WJB A;  2DA6 A;  4HDV A;  1QHH D;  5DEQ A;  3W6V A;  3JRC A;  3CUQ C;  2CG4 A;  4E7H A;  3S15 J;  3JRF A;  2EFP A;  3CCM I;  4MTD A;  4XOR A;  3OIP A;  5HLG A;  2R7W A;  2CYY A;  5BQT A;  4ENK A;  1BOA A;  4V19 K;  3AG4 H;  2Y9Z A;  2V26 A;  3OR2 C;  1VQK I;  2LBF A;  1GV2 A;  1K4T A;  5FRO A;  4BJ5 C;  2E19 A;  2F4M B;  1T98 A;  3S1R J;  2CUZ A;  3E97 A;  4A3D J;  2VB6 A;  1V5G A;  2QSG X;  1ETK A;  2M5W A;  1T08 B;  2QQA A;  1XGN A;  5ILU A;  4OIO F;  1TT0 A;  3LWF A;  3GYH X;  2LYC A;  2RAE A;  4C2T A;  3OV8 A;  5KHD A;  1H89 C;  2G9W A;  5ICC A;  1V3F A;  3HZJ A;  3E5Q A;  5L3D A;  3ZGK A;  5E3O A;  2NS0 A;  2KRC A;  1MBH A;  1FP1 D;  5J1R A;  3K4B A;  3X2Q H;  3ZMD A;  1MMD A;  2R0Q C;  2Y2Z A;  2V1X A;  3U1K A;  2W57 A;  1TNT A;  2PQ8 A;  4MIM A;  3T8T A;  1Y39 A;  5E3L A;  2NYX A;  1EJ9 A;  1SD7 A;  3WE3 A;  3DKW A;  2YR2 A;  2NNY A;  1YRN A;  2R7U A;  2Z33 A;  4NNJ A;  3LNQ A;  3LA7 A;  5J1Y A;  5K7Z A;  3PJR A;  4FET A;  2WA0 A;  1FTZ A;  4HX4 A;  5D5W B;  1Z7U A;  1R1U A;  1V55 H;  4I6Z A;  3W2W A;  3O8G A;  3OYC A;  2HQA A;  3DU5 A;  4G94 A;  2NOG A;  3KCC A;  4HV6 A;  2IA0 A;  1K78 A;  3OR1 C;  4A3J J;  3O3K A;  2CH0 A;  5LLQ A;  1ETO A;  3MKL A;  3PL8 A;  2L2O A;  4KIF A;  4XKV A;  4FX4 A;  2KRH A;  3LOC A;  2B0L A;  3G73 A;  3CUO A;  3FXU A;  2DMQ A;  3HUG B;  2GAU A;  4BQN A;  3CD6 I;  1USS A;  1Z6R A;  4Y4R A;  3W2V A;  4E6K G;  1BIB A;  2KL4 A;  1K83 J;  2LF7 A;  5E1X A;  3V8J A;  2Y75 A;  4YFX F;  3A2K A;  1TW3 A;  2QBY B;  5GPC A;  4G9Y A;  1ETV A;  3F6O A;  3VPR A;  4DBR A;  3E5X A;  3I58 A;  3J7A Y;  1J2X A;  5D5V B;  2JRM A;  1W1W E;  2KRF A;  4QPQ A;  2PJR B;  2X85 A;  3ULQ B;  1OQY A;  1MH3 A;  2XAS A;  2K86 A;  3TGN A;  3PUF A;  2VQH A;  3GFM A;  2RQP A;  1O57 A;  1QPM A;  1TWH J;  4FAS D;  3QYF A;  3N05 A;  3HDD A;  3GFJ A;  5D6F A;  1BC8 C;  2HXO A;  4UUS A;  4RAY A;  3GTG J;  2E2J J;  1SVO A;  2GOM A;  4NDL A;  3TO6 A;  3RQI A;  2O8X A;  1WKM A;  1QZY A;  2X4H A;  3I59 B;  1BM9 A;  4KN4 X;  1MSF C;  1ZYR F;  4B43 A;  2CQQ A;  1RIO H;  3PUB A;  3LA3 A;  4HNT A;  1FPQ A;  1JJ8 C;  4R1H A;  3F0C A;  4LFU A;  3HKZ N;  2MSY A;  1W36 D;  3KFW X;  1IGN A;  1HOM A;  9ANT A;  1EF4 A;  3CCQ I;  2CV0 A;  2COB A;  2GM4 A;  3BQY A;  1FBQ A;  1Z3Y A;  3Q9S A;  3T5X A;  5B3S H;  4U0V A;  2Q1Z B;  1OR7 A;  5E8I A;  1XD7 A;  4X6A J;  1X2N A;  2R5Y A;  5L3C A;  1ZEL A;  2LLK A;  3CCE I;  2BXY A;  3LSH A;  3HKZ A;  3K4N A;  2Z9O A;  4YFK F;  2DDB A;  2K85 A;  2KJB A;  1I27 A;  4EM1 A;  1ZLK A;  3F21 A;  5HS9 A;  1BBY A;  1XB4 A;  1VQ4 I;  3GBG A;  2BGC A;  5D4S A;  4B8X A;  2GIV A;  1F9N A;  2F5C A;  2WY8 Q;  3K6G A;  5JHF A;  3RKW A;  4KYW A;  1OLT A;  1TLH B;  1FY7 A;  4CCN A;  1IN5 A;  1W5T A;  3ZQI A;  1AU7 A;  5C4X J;  3DF8 A;  4F7Z A;  4JP0 A;  4M74 A;  2GA1 A;  2D45 A;  3RKQ A;  1YG2 A;  1MH4 A;  3FK6 A;  3PSI A;  1QZE A;  3CJQ B;  3SZG A;  3K69 A;  2CFX A;  2DA5 A;  2UXX A;  4E70 A;  5HOO A;  1XDS A;  4UNO A;  3MKW B;  1DQU A;  1D1B A;  5DYM A;  3JRH A;  2HKX A;  1W5C C;  3H3U A;  3CQZ J;  5F1R A;  5IP6 A;  3JSP A;  3FHZ A;  3KLO A;  2IS4 A;  4UB6 C;  1WJA A;  3BRO A;  2ZNY A;  2AS5 F;  2A69 F;  2QCO A;  1B6A A;  3VWB A;  2WB1 N;  4EJU A;  1JKR C;  3QQA A;  1AKH A;  3OYI A;  2CSO A;  2IW5 A;  3BJA A;  3J7Y J;  1YX3 A;  2XAU A;  4HOB A;  1MMG A;  3LL7 A;  3M7G A;  2ZME B;  2R3S A;  4MQV A;  4V2F A;  1LE8 B;  2TDX A;  4HSR A;  1OCP A;  3A1Y A;  3TP3 A;  5DD4 A;  1T38 A;  1TZL A;  4KMF A;  4XL9 A;  3HRT A;  3GTM J;  5CYV A;  2ACJ A;  1J75 A;  1W0U A;  1BR4 A;  2W7N A;  1OR7 C;  4HA8 A;  4PFP A;  4CHU A;  2WAD A;  5HDK A;  5J8F A;  3CMM A;  4U0Y A;  4BJ6 C;  3EQL F;  4E7S A;  3JTG A;  1XSX A;  1WGX A;  3F8C A;  4ON0 A;  1LFU P;  3OIO A;  2P6S A;  2ZJQ F;  1W5S A;  2P4W A;  2LF8 A;  1WFX A;  5J1U A;  1DGW Y;  5IP9 J;  5K5R A;  5KNL A;  2R7X A;  1I5Z A;  2BV6 A;  2ZCW A;  1VQO I;  3J81 K;  3QRF F;  3S2D J;  1Y8Q B;  4PDK A;  2IXS A;  3C1D A;  3BR2 A;  3CF2 A;  3F8F A;  2IP2 A;  4A12 A;  4AC0 A;  1R23 A;  3UNG C;  3UKG A;  1MMS A;  2NVY J;  1E3P A;  3HSR A;  5LHG A;  3S1Q J;  3I56 I;  2Q8K A;  3JR9 A;  2DXI A;  1ZRD A;  2CS3 A;  3DTE A;  4ENN A;  4BJT A;  4CZZ A;  2ESN A;  5FKL A;  4CCL A;  2M3A A;  2W82 A;  1IN8 A;  1GVJ A;  4ZDL A;  1XSV A;  4KMU X;  1U5T A;  1X19 A;  2VQG A;  2VT3 A;  1MGT A;  4PFO A;  2M2E A;  4D5F A;  2L4M A;  2OQG A;  2E1O A;  2HZD A;  3OY9 A;  2E7X A;  1VQM I;  2R7D A;  5K1Y A;  2FOW A;  1EKE A;  4BBS J;  2FBK A;  3CO6 C;  2ZJR F;  3MWM A;  3WTZ A;  5KK1 A;  1J5Y A;  3ZR8 X;  2TCT A;  5BPI A;  3VYT B;  4KFC A;  3BPV A;  3MVP A;  1ETY A;  4L0Y B;  2DO7 A;  3M3Y J;  3H92 A;  3CJT B;  4I0A A;  3A0H C;  2DMN A;  4XNF A;  4WX9 A;  3L1P A;  1D0Z A;  3FXM A;  1LEB A;  3RI4 A;  5JHU A;  2K27 A;  3BCA A;  2EZI A;  2XGE A;  2FRH A;  2LRD A;  1J09 A;  5ERI A;  3OS0 A;  2DCE A;  2QZ8 A;  3HRM A;  1VFC A;  4HST A;  5F6F A;  1IRZ A;  3VOD A;  3P9C A;  1N77 A;  1GHC A;  2MC4 A;  3H1C A;  4IF4 A;  2IRF G;  1JT6 A;  3U21 A;  1N25 A;  2M9H A;  2LRE A;  2LD5 A;  1UJ8 A;  1UHM A;  2OAZ A;  3FIS A;  3KLN A;  3GTQ J;  3F8M A;  5J8C A;  1QQI A;  4B3A A;  1V5F A;  3RKX A;  1UMQ A;  3GLX A;  4BHP A;  1O3S A;  1DUX C;  3CC2 I;  1YO5 C;  4C3J J;  3OYG A;  2XAQ A;  1JT0 A;  2JA2 A;  4E7J A;  4GYG A;  3S93 A;  1PP7 U;  1TQI A;  2FOK A;  3I3L A;  3KE2 A;  4XKW A;  1FYL A;  2R7O A;  1HLV A;  2RV8 A;  3RCO A;  3CF5 F;  1B72 A;  3C7J A;  5CJ9 A;  4K2E A;  1T95 A;  1U5T C;  4H4K C;  1DU6 A;  1IZ1 A;  2EV0 A;  2DW4 A;  2CQ7 A;  2OCC H;  4HEA 2;  5IT9 K;  5J40 A;  3D0S A;  3H0G J;  4IRG A;  2VIX A;  2HVQ A;  1ZG1 A;  5IT9 Z;  1UG2 A;  3MN2 A;  2HOA A;  4ZYH A;  2B9S A;  3TDZ C;  4ZJZ A;  1MBF A;  1SD5 A;  4BUP A;  1XG1 A;  2ELH A;  2GZW A;  2OUM A;  5DV5 A;  3HGG A;  3B6C A;  2RRE A;  2XAG A;  5BNG A;  2WAF A;  2J5P A;  5B5E C;  2ISY A;  5LD2 C;  2LC2 A;  4RDU A;  5KAF C;  1MBK A;  2CW7 A;  4ABZ A;  4ANJ A;  1LDJ A;  2LBF B;  2E35 A;  6PAX A;  5EF6 A;  4Y33 A;  1R7J A;  2Q2E A;  3VOE A;  4IHT A;  3ESW B;  2VKE A;  3L7W A;  1RRJ A;  3CCV I;  4ENM A;  4LD5 A;  4HYE A;  1U2W A;  4KNY A;  2W25 A;  4PJM A;  4BYY A;  4HQM A;  2PX9 A;  2EFQ A;  1SFE A;  1JKO C;  4CYC A;  4XRS G;  4ZDP A;  1BC7 C;  2XPV A;  4LB5 A;  2WBM A;  3BR0 A;  5DUK A;  3RTR A;  2DN0 A;  1W0T A;  2Z5U A;  1L0O C;  1H0M A;  4AU7 A;  4XSZ F;  3H0D A;  4HDU A;  4UXN A;  2JPC A;  5FRN A;  1I50 J;  1S7A A;  2YPR A;  3ZN0 A;  3SDB A;  3DU6 A;  1YRN B;  3FF5 A;  3H5A A;  1VQL I;  2RKH A;  3JW4 A;  2L3D A;  3Q0W A;  1TWG J;  4LB6 B;  3ECO A;  3S1N J;  4E4H A;  2JQ7 A;  2JRT A;  4MEY F;  1FEX A;  1KU2 A;  5F27 A;  2Z1D A;  1K78 B;  2IAI A;  1D0X A;  4JX5 A;  1SFX A;  1GDT A;  4OIP F;  1PJR A;  3MFK A;  5FO5 A;  3WE2 A;  1KQ0 A;  3D5L A;  2ZBK A;  4ETS A;  3K1N A;  3I64 A;  1IXS B;  3JRG A;  1T0F A;  2IS2 A;  1K7A A;  1YJW I;  4F91 B;  2H1K A;  5GP9 A;  1UEL B;  2EZL A;  2G0E A;  5ICG A;  5EEG A;  3A01 A;  3OOU A;  3ZMS A;  2HPI A;  1EA3 A;  2X48 A;  4G6Q A;  3S8P A;  2VPR A;  3ROU A;  2YX4 A;  1YLF A;  5GAG J;  1ETQ A;  3TDU C;  3MZ8 A;  3NWS A;  2VLA A;  2EJR A;  4IX7 A;  1U6G A;  3GWZ A;  4MQ9 F;  1RUO A;  4FE4 A;  3AL0 C;  4N9I A;  2V9P A;  1WH7 A;  2Y30 A;  5K7H A;  2HS5 A;  3BQZ A;  5ICF A;  2MC3 A;  2QVO A;  3QOE A;  2DMT A;  3CCL I;  1A6Q A;  2KFD A;  4UUS B;  3IAM 2;  2MG4 A;  3GTL J;  2CJJ A;  1P4A A;  3L09 A;  3M1E A;  4QPO A;  2AQE A;  2NXN B;  4L18 B;  1OPC A;  2JSC A;  4B4C A;  4WF2 A;  2R7S A;  2DMP A;  4ASN A;  1MJA A;  3DFG A;  4A0X A;  3HM5 A;  2ADU A;  2FML A;  3DKX A;  4AYB N;  3OL4 A;  4KIG A;  5K7F A;  1G8X A;  4BDZ A;  4XRF A;  2ZB9 A;  2XAF A;  3BZ6 A;  4B09 A;  5FD6 A;  1D5V A;  1RZ4 A;  2EB7 A;  4JYK A;  1Z77 A;  3HXL A;  4EGY A;  1QGP A;  3WTY C;  5A2Q Z;  1KYZ A;  2A05 A;  1IV8 A;  5K5O A;  1ZRC A;  2Z16 A;  1LKX A;  3F72 A;  1SD4 A;  2MYS A;  3F6V A;  4AUX A;  2CRG A;  4JX4 A;  4ZH4 F;  2K3P A;  4X1E A;  3T8R A;  1R4M B;  3TP0 A;  4FQG A;  1R9T J;  5ICE A;  2VKV A;  1WPK A;  3G1L A;  3ZQF A;  2X6O A;  3COA C;  3H5N A;  3ZMT A;  2HYG D;  2LDU A;  3GLL A;  4KA4 A;  4BAC A;  1T0F C;  3S1M J;  4M73 A;  4IHY A;  2QKM B;  3BWG A;  1EH8 A;  1MBJ A;  2FEZ A;  4R8H A;  1ZTR A;  5HNF A;  4EAT A;  3IH4 A;  1ZH5 A;  1FX7 A;  4NUB A;  4YIF A;  1FMW A;  1MMA A;  5H20 A;  3RPU A;  1MSE C;  1XN7 A;  4IZZ A;  2H1L A;  1D5Y A;  1QZZ A;  4S05 A;  3DTK A;  2E1C A;  2YU3 A;  3SEZ A;  1T8I A;  5M3F J;  3OOP A;  4MGR A;  4HPQ A;  2F5D A;  1K4S A;  1ZAO A;  1YI2 I;  5KAI C;  4BE2 A;  2UUZ A;  3OYH A;  1FOY A;  2QUF A;  1HW5 A;  5JVG F;  2C6Y A;  4C3H J;  2PMU A;  3AG3 H;  3BR5 A;  4RGX A;  3DEU A;  3IC7 A;  3CCU I;  3FDY A;  3E6D A;  4U87 A;  1Z91 A;  1U0J A;  2DFH A;  1X1D A;  5FLV A;  4ENJ A;  2BYV E;  2A61 A;  2ETH A;  2MD5 A;  3TW6 A;  1XX5 A;  4EM0 B;  1G6N A;  4GDF A;  2K3F A;  1AKH B;  3B73 A;  2HFH A;  4RA2 A;  3GTO J;  3N4M A;  1FNN A;  4LK1 F;  5M5Y J;  1JKP C;  1Y6I A;  1YTY A;  1SFO J;  2L54 A;  2QQ9 A;  2RNG A;  3OIQ A;  2HXI A;  2XPW A;  3L2C A;  1HQC A;  3C2B A;  1X1P A;  2XC7 A;  1XTA A;  2OCE A;  2LKX A;  3N97 A;  2HU9 A;  4Y52 J;  1SFK A;  2X51 A;  1DDN A;  4C9Y A;  4Y7N J;  4UB8 C;  2ZFU A;  3SYT A;  5HVQ C;  1UHW A;  4LLN A;  1ITY A;  1RKW A;  3HYI A;  2YSR A;  1E3O C;  2XUB A;  2XGD A;  2GLO A;  1IW7 F;  3WG9 A;  4HNU A;  3CLQ A;  1P92 A;  2WTE A;  4LG3 A;  2NVT J;  2P7V B;  1LEA A;  2KIM A;  3B6A A;  3DXJ F;  4LK0 F;  4A3L J;  3WTW C;  1P2F A;  4A5N A;  4DYQ A;  1DGR M;  3MZH A;  2BY0 A;  1MW7 A;  1L3L A;  2QSH X;  4RLF A;  1P7J A;  5TRD A;  1Z05 A;  3FM3 A;  1H8A C;  3K1P A;  2M1B A;  5HLH A;  2ZKZ A;  2R7T A;  4E7L A;  1WJF A;  2A6E F;  2XVC A;  2ZXJ A;  2P5K A;  2VQC A;  4RB2 C;  2MA3 A;  4WWC A;  1QHG A;  1FYM A;  4JX6 A;  1KU9 A;  1D8J A;  2VC1 A;  2QKL B;  1PP8 F;  4YEJ A;  3HL2 A;  1OYI A;  4LIV A;  2QYO A;  1R36 A;  3SFZ A;  3VB2 A;  2E5Z A;  4C3I J;  4CIC A;  1Y1V J;  1DP3 A;  2BHZ A;  2KZV A;  4A3G J;  1Z1D A;  3DBH B;  1FBU A;  1KU3 A;  1VND A;  3S16 J;  2VC0 A;  1ZR2 A;  1WWX A;  1E17 A;  4E7K A;  5F0C A;  3AKZ A;  2NS8 A;  2R7Q A;  1U5T B;  2H6B A;  1SVL A;  1OYY A;  2FNA A;  2QQB A;  2MLK A;  1Z7L A;  2FXA A;  3BLY A;  1A31 A;  4D5C A;  2DI3 A;  3HB9 A;  2ISZ A;  1P4X A;  3RJP A;  4P96 A;  2IGK A;  2XRN A;  2ECC A;  5E1Z B;  2LH9 A;  2MH9 A;  3BG6 A;  4YII A;  1PUF A;  1BR2 A;  5J47 A;  4G7H F;  1IN4 A;  4OIN F;  2CUE A;  3FM5 A;  5ED4 A;  3FHN A;  1WJC A;  1VQ9 I;  1IUY A;  2HTS A;  2EH3 A;  3JRA A;  5IOZ A;  5GAD J;  1LB2 A;  2X0L A;  1APL C;  3B02 A;  2Q0O A;  1I1G A;  1YHQ I;  1SFU A;  1V4R A;  2CGP A;  3TQN A;  2G7H A;  3SQN A;  3QPL A;  4RLQ A;  4A3B J;  3DPL C;  1T33 A;  2O5R A;  2LTP A;  4UVB A;  2KDO A;  2Y48 A;  3ZMZ A;  5DDG A;  2RNJ A;  3D5R C;  4HNV A;  3K2A A;  4BNC A;  1B1B A;  1I1S A;  4MFD A;  2QSF X;  5M5W J;  5LEK A;  4Y15 A;  2FA5 A;  2HYJ A;  5DD8 A;  3S2H J;  2VQL A;  2DJI A;  3PSF A;  3NWT A;  3TKY A;  2ESH A;  1I39 A;  3WTS C;  2X1D A;  5FGM A;  1P9Q C;  2KIF A;  5FFX A;  3QU6 A;  2STT A;  1IN6 A;  3M8F A;  2ME0 A;  2X1E A;  5FLX K;  3CDH A;  4DOZ A;  2PJP A;  3I4N J;  2NVU B;  1IJW C;  2BY3 A;  5FLX Z;  1B72 B;  1ACI A;  3KZI C;  3FMS A;  5L3G A;  2VE9 A;  3HOW J;  1XGO A;  4W1U A;  3I4P A;  1WCM J;  2JK3 A;  3H35 A;  4XLP F;  2IPQ X;  5J4Y A;  4Q4Z F;  3W3C A;  1AA7 A;  1N75 A;  3IUO A;  3QOP A;  2M7A A;  4QIW N;  1U9O A;  4NBQ A;  1ZK8 A;  1R58 A;  1RNL A;  3TED A;  1HXD A;  1G3W A;  2L02 A;  2LFB A;  4GRI A;  2JZY A;  1NK2 P;  3GFL A;  3WGG A;  2DOF A;  1OKR A;  3H3Z A;  2CUF A;  3PFY A;  5AIQ A;  1DPR A;  3H3V K;  1YIO A;  2KDZ A;  1ODD A;  1VF9 A;  3I53 A;  1P4W A;  3M8E A;  4MFE A;  3BCB A;  1R71 A;  4BXU A;  1BL0 A;  2BY1 A;  2V1N A;  1NH3 A;  4AWX B;  1WRJ A;  3M9A A;  3NAU A;  3V8L A;  3AL0 B;  4BL0 B;  4B47 A;  2DQR A;  3HEF A;  3DEW A;  1KA8 A;  1O3T A;  3QAH A;  5EYR A;  2VI6 A;  2UZK A;  1KQ8 A;  1LVK A;  3TO9 A;  2LSO A;  5CVU A;  4CYC B;  4IOA F;  1RR8 C;  2JSP A;  2VAS A;  2X6W A;  5M5X J;  4JOM A;  3ZQG A;  2PEX A;  5EG0 A;  3DWL E;  3C18 A;  4BHC A;  5E3N A;  1IV6 A;  3SZP A;  3V7R A;  4L9J A;  1F4K A;  1N78 A;  4HF0 A;  2ID3 A;  2DU9 A;  1S29 A;  2CFO A;  4IRI A;  2F48 A;  1R6R A;  5FB2 A;  4A3E J;  2PFB A;  3RPU D;  1FBS A;  2RC4 A;  4CSW A;  2E5N A;  2F5E A;  3DLL F;  1PDN C;  2KP6 A;  2WWY A;  5M3M J;  5HNH A;  2DFF A;  1X4P A;  2HQR A;  1ZRF A;  2DQL A;  4X0G A;  4GYI A;  4KIT B;  1MZB A;  3GEZ A;  5B66 C;  3CJN A;  2VJJ A;  1MBG A;  2P0W A;  2V9V A;  1WQ2 A;  2V4J C;  4HLX A;  4N4O B;  1BJA A;  2D2W A;  3E6B A;  1YFH A;  3BG9 A;  3HGY A;  1UZC A;  2FX0 A;  1LUJ B;  1DU0 A;  2DPD A;  4G7O F;  2BOL A;  2K9M A;  2QM3 A;  5H6Q A;  3VFZ A;  1G3Y A;  1I3Q J;  1SD6 A;  4HZF A;  4M72 A;  4ZYA A;  2X6X A;  3A01 B;  1MMN A;  5JVT A;  1O3R A;  4QTR A;  4I09 A;  4XRM A;  5FRM A;  1S8N A;  3F9K A;  3BG7 A;  4A69 C;  1WZ2 A;  2R93 J;  2Z2S B;  3QYB A;  3JRE A;  1BI1 A;  3HOT A;  5JI6 A;  3DLA A;  1ON2 A;  4RGR A;  4BKX A;  1JUS A;  1LJ9 A;  2XV4 S;  1JHH A;  4XKC A;  1HKS A;  3J81 Z;  2W85 A;  1Y8R B;  1R5I D;  2NOJ B;  3TMO A;  1O3Q A;  1B8I A;  2UXN A;  1JTY A;  3OYN A;  3WHB A;  3QPH A;  4PGG A;  4XKB A;  4EJW A;  4R79 A;  4F93 B;  2HVS A;  3G1O A;  4KIB A;  3CTA A;  3HOS A;  5F64 A;  3U2R A;  4BEH A;  4BHB A;  3BDD A;  4IQJ A;  2W1O A;  4E7Z A;  5D5U B;  2CV1 A;  1YIT I;  2B63 J;  2IEK A;  5D8K B;  2R92 J;  3KEO A;  4XLF A;  2HTJ A;  3KET A;  2PMZ N;  3ZPL A;  2AXT C;  5EGO A;  3OWT A;  4G6D A;  5CVR A;  2DMU A;  3MD2 A;  3EUH A;  2BY2 A;  3QP5 A;  1WJD A;  4CDG A;  4RB1 A;  1XS9 A;  2HDD A;  1WI9 A;  4P55 A;  3ABM H;  3KYL A;  3HOZ J;  2QQ8 A;  4RAZ A;  2Z99 A;  5JLX A;  1E2X A;  1ERD A;  1CQT A;  4OAY A;  3SJM A;  2I5U A;  1NHA A;  2HEO A;  2PMZ A;  2XF6 A;  4YRV A;  3CUQ B;  3EYI A;  1J7K A;  3CJR B;  3C2H A;  4AVP A;  1O7L A;  2FE3 A;  2MH2 A;  2OU2 A;  1JUP A;  3K0L A;  5BOX A;  5FD5 A;  2X1C A;  1SVM A;  1X3Z B;  3K4J A;  4PUS A;  1JJ6 C;  4IPA A;  2HVR A;  3GXO A;  1VZ0 A;  1IG7 A;  2P5L C;  4FIS A;  2O0Y A;  3DBL B;  3LSJ A;  5FKN A;  1IF1 A;  1Z67 A;  4U88 A;  1ZQ3 P;  4M9Z A;  4XMY A;  4G12 A;  3R60 A;  2DA4 A;  2WAQ A;  2DA3 A;  2DLL A;  4M9S A;  4C2M J;  1HC8 A;  1GXQ A;  4ZTF A;  4CCM A;  2DOE A;  4WXD A;  5HDG A;  1UHS A;  1HDP A;  1TT5 B;  1HST A;  2KIS A;  3HRS A;  3SFI A;  1HDD C;  2JT1 A;  2ELJ A;  1I3A A;  4MTE A;  2XF7 A;  2HZT A;  1YW7 A;  2OTJ I;  2DAO A;  4PJN A;  3T1B A;  4XQF A;  1CF7 A;  2EFO A;  2NVQ J;  2EIM H;  1TP4 A;  2I8D A;  1MJB A;  2QA4 I;  3BZK A;  4DYR A;  1OCZ H;  3CMY A;  4P9F A;  1YQA A;  3VYR B;  1QO0 D;  1V54 H;  3KEQ A;  2R7Z J;  1YS7 A;  1BR1 A;  2KKO A;  4NQW A;  1XSD A;  1SAU A;  2VE8 A;  1A5J A;  2Y0S A;  2A5W A;  2GXB A;  3JTH A;  1RR7 A;  1C0W A;  3U1D A;  3SXY A;  3RSN A;  2XSD C;  1SEU A;  1ZG3 A;  4EMS A;  2O9L A;  2HYF A;  3EUA A;  2GA2 A;  2LG4 A;  3L00 A;  2MAB A;  2A6H F;  3OL3 A;  3WTV C;  3LSR A;  2OD5 A;  3OYA A;  3JRD A;  3VYU B;  1O4X A;  3IRR A;  1ZHF A;  4XSX F;  4IEJ A;  3A02 A;  2KLO A;  2VXZ A;  4BE0 A;  2FF4 A;  5DM7 F;  3EUH C;  1H88 C;  1HW1 A;  3KP5 A;  3TL4 X;  4V2G A;  3LAJ A;  3PFI A;  3GTJ J;  2VKH A;  5LRR A;  3ZMV A;  2HDC A;  2KJC A;  2HR3 A;  3FX3 A;  1BI2 A;  3FMR A;  4PSX A;  3WU1 B;  2CMP A;  2PG4 A;  4XLC A;  5C3E J;  2KQR A;  2A6T A;  3CDL A;  5F1J A;  3M1C A;  2PN6 A;  3MCZ A;  3AG2 H;  3V42 A;  3CC4 I;  2EZK A;  1GLN A;  4A6D A;  2WY7 Q;  1YYV A;  4LMY A;  1XGS A;  3G71 I;  5IYB J;  1LQ1 A;  1XMK A;  2K4B A;  4WCG A;  2LK2 A;  2K9N A;  2XAH A;  1SAN A;  4ITV A;  3TW7 A;  5IYC J;  1FOW A;  3KIO A;  4BXF A;  2YS9 A;  4A3I J;  5AON A;  4W97 A;  1J0R A;  3GFI A;  3LMM A;  2BVM A;  3QPS A;  4D0P A;  3WGI A;  2F2E A;  2V7F A;  3BTL A;  1RKT A;  2V9K A;  3BTC A;  1ZN2 A;  5CPR B;  4EM2 A;  5BS6 A;  2E2I J;  3HTS B;  5HLI A;  3SHF A;  2ZO4 A;  3ABL H;  3HPG A;  3RDI A;  1ETW A;  2N8G A;  2GWR A;  5F0H A;  2KMU A;  3NAR A;  4HRI A;  2CQK A;  2JTV A;  3CO7 C;  3PO3 J;  1HSJ A;  2OJE D;  2AHQ A;  3OYB A;  3BJ6 A;  2F5F A;  1MDM A;  3ABK H;  2DFE A;  4EGZ A;  1SAX A;  3RQ4 A;  4IO9 F;  1K6O A;  3GX4 X;  1UCR A;  3EYY A;  3HTU A;  4EVI A;  3HJE A;  2IBD A;  2Y0M A;  3K9T A;  4CA0 A;  3W6K B;  2H09 A;  2MFZ A;  4HX8 A;  2P8T A;  1WI3 A;  5K5Q A;  2O61 A;  4XLE A;  1PUF B;  4BY1 J;  2CW0 F;  2IGN A;  1FZP B;  2NRA C;  2LNB A;  5GPA A;  1BOB A;  2F4I A;  3CC7 I;  5AIP A;  1FOX A;  3ZQL A;  4LIT A;  1W7P A;  1FJL A;  4F52 A;  2IT0 A;  3GCM A;  4Y17 A;  4UHT A;  2ZME A;  1LPQ A;  3CCY A;  1LE8 A;  4KIC A;  1P6R A;  2ID6 A;  3TOB A;  3RZD J;  2E36 A;  2KPM A;  3HSE A;  5BPD A;  2PMH A;  4KDP A;  1WH5 A;  1QVU A;  2L9V A;  2WV0 A;  3ZQ7 A;  2K40 A;  3CME I;  3DEE A;  1P7I A;  2DYR H;  3GTP J;  4LJZ F;  2GXG A;  1SMT A;  3K70 C;  2FQ4 A;  4RM2 A;  4XOT A;  1KZH A;  3S3O A;  3FBN B;  1YJ9 I;  4ZC3 A;  1RET A;  3F8N A;  4OWR B;  5HDN A;  1M1E B;  3S32 A;  2ME6 A;  3SDG A;  1LDK B;  2ZJ2 A;  5E8G A;  1FYK A;  4BH9 A;  4BXX J;  2VJ4 A;  3K4L A;  1ZAR A;  1FWZ A;  1FP2 A;  2DA7 A;  4BE1 A;  2H8R A;  3QYE A;  1FTT A;  1TBX A;  1Q1H A;  3RYR A;  4L9N A;  3JRI A;  3L2R A;  1QA6 A;  3H36 A;  4YEL A;  1HKQ A;  4N4N B;  3IRQ A;  1NTC A;  3V7S A;  1GUU A;  2IJL A;  4KT6 A;  2L7M P;  2OV7 A;  2E2H J;  1ETX A;  3VDX A;  4HW0 A;  2HWV A;  3VEP A;  2M30 A;  1VI0 A;  3R4K A;  3M8J A;  4PSW A;  1VQP I;  4MEX F;  1J9I A;  3EPZ A;  3E6M A;  4DW6 A;  2ZNZ A;  2R5Y B;  3AAF A;  3WTX C;  1JKQ C;  4ZYD A;  2OZU A;  2GBY A;  2OTL I;  1MND A;  3BJO A;  3D1N I;  2M0M A;  1FSH A;  4F55 A;  2L9S A;  2HDW A;  4C30 A;  4B44 A;  2DTZ A;  4KT5 C;  2DJN A;  3F8B A;  4I99 C;  1T2K A;  3MZY A;  1ON1 A;  2M4K A;  4XN0 A;  4CCO A;  2GOX B;  5LFA A;  4M71 A;  4OOI A;  2ZME C;  3T0Y A;  3AG1 H;  3H9Q A;  2FBH A;  1IRX A;  2EA4 A;  1YJN I;  1R1T A;  1GV5 A;  1S3J A;  2L7F P;  2OQR A;  3WGH A;  4N0B A;  4M3B A;  2O03 A;  5FKM A;  5EJC A;  3P9K A;  3Q0U A;  4QSH A;  5TGT A;  3Q5F A;  4IOC F;  2VBY A;  5EG0 B;  2OF7 A;  3LSP A;  4A93 J;  1X2M A;  2CV2 A;  2O8K A;  5FKK A;  4L9T A;  3I71 A;  4UVA A;  3ZMU A;  2QGU A;  3QP6 A;  2E34 A;  3BZC A;  3BPX A;  2EIL H;  2IS6 A;  5DS9 A;  1POG A;  2J5O A;  5KVR A;  3GF2 A;  5LHH A;  3EET A;  4O5V A;  2CUJ A;  5DCM A;  2HI3 A;  2XKP A;  5IPA A;  4IKF A;  3BY6 A;  3O6B B;  3VYS B;  3M4O J;  2R5Z A;  3ONQ A;  5DUI A;  4ESJ A;  3E6C C;  4CGZ A;  1XDU A;  2CW8 A;  1XMX A;  2L01 A;  3V8K A;  1O7F A;  4EJO A;  1JGS A;  3S17 J;  4A0Z A;  1Y0N A;  3A03 A;  2BE5 F;  2GQQ A;  3D5S C;  4HAM A;  3ASN H;  3DBR B;  2OZ6 A;  2NS7 A;  1Y0U A;  1BA5 A;  3WTU C;  3QPT A;  2DA2 A;  3G2B A;  3IKT A;  1IRF A;  1BJZ A;  4ZDO A;  2ZC2 A;  3BG5 A;  2ECB A;  1J59 A;  3JAM K;  3GVA A;  3PNV A;  2JUG A;  3PIO F;  1FOK A;  2DOD A;  2A3S A;  1R00 A;  2IGO A;  3NEU A;  1BI3 A;  1DP7 P;  3HRU A;  2MBF A;  4I2O A;  4XBF A;  3G3Z A;  5EDN A;  3E7L A;  1ZGW A;  5B1A H;  1MKM A;  2KHM A;  4BY7 J;  2W48 A;  5D5X B;  1Z6T A;  2VBW A;  4DJA A;  3BT9 A;  5L3E A;  1B8I B;  4II2 A;  3WG7 H;  4D7M A;  4L5J A;  3TO7 A;  3ZCO A;  3PM1 A;  1R1V A;  1WSU A;  1OYW A;  4KUM A;  1ZGA A;  2E1N A;  1ZG5 A;  4NC8 A;  4Y13 A;  2LKS A; 
#chains in the Genus database with same CATH homology
 2DA1 A;  1JT6 A;  2YU9 J;  1TWA J;  2M0C A;  4DZJ A;  2M9H A;  5M5X J;  3ZQG A;  2LD5 A;  4A3C J;  5EG0 A;  3FIS A;  1ZKG A;  5EGO B;  5EZH A;  3GTQ J;  1FIP A;  5E3N A;  1IV6 A;  3Q0V A;  3GTK J;  1F36 A;  2ID3 A;  4B3A A;  1UMQ A;  2LVS A;  2M34 A;  1HF0 A;  4XID A;  4DYC A;  1U9N A;  4C3J J;  3OSF A;  1JT0 A;  4I76 A;  4A3E J;  3S14 J;  4IHV A;  5F0F A;  5M3M J;  4S0H B;  1HLV A;  1T56 A;  1B72 A;  4MO7 A;  1GVD A;  2L9R A;  1IDZ A;  1DU6 A;  1MBG A;  3BG9 A;  3HGY A;  5IP7 J;  4A3F J;  3IH2 A;  2FX0 A;  1DU0 A;  3H0G J;  3HBL A;  1UG2 A;  3MN2 A;  2HOA A;  1I3Q J;  4XIC A;  3BR6 A;  4MLO A;  1MBF A;  5HOD A;  3OSG A;  3A01 B;  1XG1 A;  4D7N A;  4QTR A;  4XRM A;  2I10 A;  3HGG A;  3B6C A;  1RES A;  5BNG A;  1I6H J;  4FTH A;  4A69 C;  2R93 J;  3O8H A;  4RDU A;  3JRE A;  5JLW A;  1MBK A;  4XRS A;  4ABZ A;  2JA7 J;  4BKX A;  4M3G A;  5EF6 A;  1JUS A;  2VKE A;  5C4J J;  4J19 A;  1B8I A;  4GFB A;  1JTY A;  3WHB A;  3G1O A;  2CQX A;  5DTD A;  1JKO C;  4CYC A;  3WHC A;  4XRS G;  1JGG A;  5E3M A;  3RZO J;  2XPV A;  2B63 J;  2IEK A;  2D5V A;  2R92 J;  3BR0 A;  2PMZ N;  2DN0 A;  1W0T A;  5EGO A;  1Y1W J;  2DMU A;  1I50 J;  3LSG A;  4IHX A;  1QVT A;  1XS9 A;  5EZG A;  2L0K A;  1AHD P;  5IYD J;  1YRN B;  2HDD A;  3HOZ J;  2KT0 A;  1TWC J;  3Q0W A;  5JLX A;  1ENH A;  1TWG J;  2ELK A;  1CQT A;  3S1N J;  2JJ7 A;  2AO9 A;  3SJM A;  3ZQC A;  1JTX A;  1QRY A;  1XC5 A;  1FEX A;  5F27 A;  1Q1V A;  2YUS A;  2IAI A;  1IC8 A;  4JX5 A;  4BBR J;  4IHW A;  1GDT A;  1K61 A;  1JUP A;  1NK3 P;  1JJ6 C;  2X9D A;  3HOU J;  1IG7 A;  1HCR A;  2XPU A;  4FIS A;  4UUT A;  2OPT A;  3LSJ A;  5FKN A;  3JRG A;  5F08 A;  2DA6 A;  2H1K A;  5GP9 A;  2EZL A;  2G0E A;  3A01 A;  1ZQ3 P;  3W6V A;  3JRC A;  3OOU A;  4G12 A;  3JRB A;  3S15 J;  3JRF A;  2DA4 A;  3BG3 A;  2X48 A;  5FJ8 J;  2VPR A;  5IOY A;  2DA3 A;  4C2M J;  1ETQ A;  1UHS A;  1HDP A;  2Y9Z A;  3FIW A;  1HDD C;  3SFI A;  1GV2 A;  2E19 A;  3Q3S A;  4FE4 A;  2NVQ J;  3S1R J;  4A3D J;  2Y30 A;  1WH7 A;  5K7H A;  2P81 A;  3BQZ A;  4DYR A;  2DMT A;  3CMY A;  1ORK A;  4UUS B;  1ETK A;  2CU7 A;  2R7Z J;  1GT0 C;  2MG4 A;  3GTL J;  2CJJ A;  1A5J A;  2RAE A;  4FE7 A;  1RR7 A;  1H89 C;  4B4C A;  2XSD C;  2DMP A;  2O9L A;  2JN6 A;  5E3O A;  3HM5 A;  3ZOB A;  1MBH A;  3LSR A;  4AYB N;  3JRD A;  5J1R A;  5K7F A;  1O4X A;  2R0Q C;  4IEJ A;  3A02 A;  2Y2Z A;  2ZB9 A;  1H88 C;  4MIM A;  4XK4 A;  5E3L A;  4JYK A;  1Z77 A;  4V2G A;  2FJ1 A;  1YRN A;  3GTJ J;  3LNQ A;  5J1Y A;  5K7Z A;  1FTZ A;  3FK7 A;  4FCY A;  2K9Q A;  4I6Z A;  3O8G A;  4B1R A;  2NOG A;  2CRG A;  4JX4 A;  4AUX A;  5EEA A;  4A3J J;  4X1E A;  5C3E J;  1ETO A;  3MKL A;  2QF7 A;  5F04 A;  3TP0 A;  3CDL A;  1R9T J;  1OCT C;  5F1J A;  1S7E A;  2VKV A;  3LOC A;  3BR1 A;  1WPK A;  3G1L A;  3ZQF A;  2DMQ A;  2X6O A;  2EZK A;  3S1M J;  1IUF A;  3K7A J;  5IYB J;  4IHY A;  1MBJ A;  2LK2 A;  2K9N A;  1K83 J;  1SAN A;  2K9S A;  3TW7 A;  5IYC J;  1ZTR A;  3IH4 A;  2YS9 A;  1U8B A;  4A3I J;  5GPC A;  1MSE C;  4W97 A;  1ETV A;  1D5Y A;  3VPR A;  3IH3 A;  3QPS A;  3HOX J;  2HQ5 A;  3BTL A;  1RKT A;  5M3F J;  1JUM A;  3BTC A;  2E2I J;  1MH3 A;  1ETW A;  2N8G A;  4C3H J;  5F0H A;  3NAR A;  1TWH J;  3BR5 A;  3HDD A;  4EEF G;  3BTI A;  3PO3 J;  2AHQ A;  1BW6 A;  2HXO A;  4UUS A;  5FLV A;  3GTG J;  2E2J J;  2JA8 J;  4NDL A;  3RQI A;  3TW6 A;  5FLM J;  1ZR4 A;  1AKH B;  3GTO J;  1OFC X;  1MSF C;  5M5Y J;  2CQQ A;  1JKP C;  1SFO J;  2IBD A;  2XB5 A;  1JJ8 C;  3F0C A;  2HXI A;  2XPW A;  1WI3 A;  3HKZ N;  2WAQ N;  3C2B A;  2MSY A;  2JMW A;  2LKX A;  1PUF B;  4Y52 J;  1IGN A;  4BY1 J;  2XB0 X;  1IDY A;  1HOM A;  9ANT A;  1EF4 A;  4Y7N J;  4M3D A;  2COB A;  2GM4 A;  5GPA A;  3BQY A;  3ZQL A;  1ITY A;  1FJL A;  1RKW A;  1E3O C;  4X6A J;  1X2N A;  2R5Y A;  2GLO A;  2XGD A;  2LLK A;  3CCY A;  1LE8 A;  2ID6 A;  3RZD J;  2NVT J;  1MBE A;  3B6A A;  1QPI A;  4A3L J;  4DYQ A;  1WH5 A;  1QVU A;  2K40 A;  1P7J A;  2Y0S N;  1H8A C;  1P7I A;  3GTP J;  2M8G X;  3GBG A;  2FQ4 A;  2Y9Y A;  2LY9 A;  2LR8 A;  1TC3 C;  1RET A;  2ME6 A;  3SDG A;  4JX6 A;  5C4X J;  3ZQI A;  1AU7 A;  4JP0 A;  3RKQ A;  3FK6 A;  1MH4 A;  4L5E A;  4BXX J;  2JA5 J;  3HOV J;  4C3I J;  2DA7 A;  2XRL A;  2H8R A;  2DA5 A;  1FTT A;  1Y1V J;  4M3F A;  4M3E A;  4A3G J;  3JRI A;  3S16 J;  1VND A;  5IP6 A;  3JRH A;  3BR3 A;  3CQZ J;  1ZR2 A;  2R5Z B;  5F0C A;  1NTC A;  2NS8 A;  2JWT A;  1GUU A;  2L7M P;  2QCO A;  2E2H J;  1ETX A;  2WB1 N;  4LOC A;  1JKR C;  3QQA A;  4D5C A;  1AKH A;  3HB9 A;  1VI0 A;  2O7O A;  1TWF J;  4DW6 A;  2R5Y B;  1MNM C;  2ECC A;  1JKQ C;  4V2F A;  1LE8 B;  2GBY A;  1OCP A;  1PUF A;  3TP3 A;  3D1N I;  1U78 A;  3BTJ A;  3GTM J;  2DTZ A;  4A3M J;  2DJN A;  1Z0X A;  3IV5 A;  3HOY J;  2CUE A;  1FIA A;  1W0U A;  2EBI A;  5C44 J;  2EH3 A;  2EQR A;  5IOZ A;  3JRA A;  2HOS A;  2Y31 A;  3DCF A;  1APL C;  2NVX J;  1WGX A;  1LFU P;  3OIO A;  1GV5 A;  3G1M A;  5FKO A;  2L7F P;  1LFB A;  3QPL A;  2TRT A;  5J1U A;  4A3B J;  5IP9 J;  1T33 A;  2XGC A;  1BW5 A;  2LTP A;  3FKI J;  4M3B A;  4DZP A;  2HOT A;  5FKM A;  3S2D J;  4QSH A;  3Q0U A;  4HNV A;  3K2A A;  3BR2 A;  4MFD A;  5M5W J;  5EG0 B;  2HYJ A;  2OF7 A;  3LSP A;  4AC0 A;  3S2H J;  1X2M A;  4A93 J;  2O8K A;  5FKK A;  3UKG A;  4A3K J;  2NVY J;  3S1Q J;  3ZQH A;  2ME0 A;  2WV1 A;  1A6I A;  5DS9 A;  1POG A;  3JR9 A;  3I4N J;  5IPA A;  2HI3 A;  2JA6 J;  1G2H A;  1IJW C;  1OJL A;  1B72 B;  5FKL A;  3M4O J;  2R5Z A;  3HOW J;  4W1U A;  4RBO A;  2M2E A;  4D5F A;  3S17 J;  1WCM J;  2JK3 A;  3A03 A;  2E1O A;  2VUM J;  2NS7 A;  1BA5 A;  2DA2 A;  4BBS J;  4QIW N;  5J3L A;  1U9O A;  1ZK8 A;  1BJZ A;  3BG5 A;  2MGQ A;  2ECB A;  3TED A;  3PO2 J;  2MW8 A;  2LP0 A;  2LFB A;  2TCT A;  1NK2 P;  1X58 A;  3MVP A;  1ETY A;  2CUF A;  3M3Y J;  3H3V K;  2KDZ A;  1VF9 A;  2DMN A;  4M6V A;  4MFE A;  1RPW A;  2L7Z A;  5EDN A;  2FD5 A;  3L1P A;  3E7L A;  1BL0 A;  1ZGW A;  3NAU A;  3I4M J;  4BY7 J;  2W48 A;  2EZI A;  2XGE A;  2EZH A;  3BT9 A;  3HEF A;  1B8I B;  1VFC A;  3DEW A;  4D7M A;  1F43 A;  3PM1 A;  5EYR A;  2VI6 A;  1IRZ A;  4CYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...