4E70A

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
359
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPVLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
total genus 128
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4e70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4e70A02
3EVEA 5K0NA 3CJQA 1IN4A 1D2GA 5LSAA 3I53A 1LDJA 2YR2A 2BR4A 2HGCA 5LQKA 4KVZA 4GC5A 4D0PA 4Z2YA 2AZTA 2X4HA 4I09A 4M6XA 1TPYA 5CVRA 5FWAA 2ADUA 3U1DA 4CICA 4PZJA 2PBIA 1CF7B 1PP8F 2PX2A 3EVAA 1W4MA 1BHJA 3REOA 4HOBA 2HR3A 1Z91A 5LHHA 1KXZA 3LCCA 1B9NA 1HW2A 2YQZA 3R9XB 2HOEA 1JHFA 4QVGA 3ERED 4ENNA 5K0LA 1B59A 2K02A 2OA4A 3HM2A 2UYCA 3GCZA 2V6CA 1P6RA 4AZTA 2HKXA 2BZGA 5FD5A 1I1GA 3GXOA 3P9KA 3EUHA 3LFKA 4QQNA 2CQKA 3HCAA 5C1IA 3PX2A 2KJCA 1YB2A 5EHGA 1YTYA 3EMBA 3A25A 1H9TA 2Q2EA 3WTUC 2QBYA 3U2RA 5CVVA 2OKCA 2PLWA 2HYGD 4RX1A 1YW7A 2STWA 3L8DA 3R3HA 1EH7A 2YTZA 1LEBA 1D2HA 4AZVA 1ZRDA 3HSFA 1BIAA 4PYMA 5E9WA 1GXQA 1NW7A 2O05A 3K2ZA 3GO4A 3F22A 4EMSA 1KP9A 1B4AA 3T7RA 3W6KB 5B1SA 4IHTA 3K69A 2DBBA 2GXBA 3JW4A 1K7AA 4HYEA 1AOYA 5DM2A 5CJ9A 3ZMUA 4N9HA 3BXOA 3NDJA 1IRFA 3BWGA 4ER7A 4MEXF 5BW5A 1F1ZA 5ERGB 5LQJA 3K1NA 3LAPA 4ISCA 4UUVA 1XD7A 1FT9A 3KQYA 4YUXA 4Y15A 1WWXA 5EIFA 4L18B 3BROA 3LA2A 4KWCA 1XGOA 3KR1A 3QPHA 3IRRA 2A61A 1P1CA 3TOBA 4A0XA 1S8NA 2Q8KA 5LHGA 3RI4A 5LGNA 2BM9A 1RJEA 2ZVJA 5GWXA 2ZNYA 3CJTA 2NP7A 4M6YA 1K6OA 2DU9A 4G94A 4XLPF 5HEKA 4YUVA 4RB1A 4H0NA 4ENKA 2QRVB 2CMGA 3G8BA 2IDKA 2OZ6A 3FX3A 4RVDA 3EVDA 2AS0A 1FY7A 2VONA 2UZ4A 5GM1A 4L9NA 4EQQA 4HLYA 1WG8A 1JQ3A 2BR3A 5IKMA 3MQ0A 5K0GA 1ZH5A 1X1BA 4RB3C 2FK8A 3E8SA 1XMKA 3DXJF 3BPVA 2P7CB 3UA4A 3EGIA 1TBXA 3ER8A 4P96A 3NVKI 4PONA 2OB1A 3GZ6A 4ESFA 2AOTA 5BW4A 1FC3A 3OU6A 1ZRCA 3V8JA 3IWZA 1WXXA 4Q5SF 3ZQ7A 2XROA 3MEXA 3ER9A 5FWDA 3HA5A 3KQSA 2IVMA 4WX9A 1BI0A 4U7PB 1YLFA 2PMHA 3EGEA 1IN7A 1X19A 4L9TA 1VP3A 3LGAA 2XAGA 2ZCWA 3EVCA 1J9IA 4G9YA 2O07A 5J8FA 3WGIA 3BWMA 4XUCA 5GIOE 4RTMA 4FZVA 5EQJB 3M7GA 3CC8A 1AQIA 5EZSA 2P5KA 3LPMA 3LX6A 1TQPA 3KR9A 1M6EX 1SAXA 5DT2A 3UWPA 3LA3A 3KQOA 3T7TA 3TRKA 2NXJA 3MGGA 3PFGA 3M6WA 4HV6A 4GGGA 3K1PA 3EVGA 1EH8A 4MHGA 5U4XA 4OIRF 3R24A 8MHTA 3OCJA 2PSSA 3QPTA 4B8XA 4KMFA 3TKYA 4PIMA 3I0TA 1PRYA 2PWYA 3ZPLA 3A7EA 3HHGA 4M36A 1O3QA 3UJ6A 2M8EA 2OZUA 2P7HA 5EZQA 2FYTA 3PQKA 4FS8A 2HS5A 1N2XA 1R6AA 5E1DA 3GO5A 2EJRA 3KCCA 3KP5A 2Y0MA 2VT3A 1FWZA 4UVAA 4C4AA 3R0JA 4XSXF 5DDGA 3GU3A 2HTEA 3FXUA 1C0WA 2RDPA 6PAXA 4DCGA 5E9JA 2IA2A 2FRXA 1BN5A 4QLCU 1KQ9A 3MTIA 3LDFA 4XCXA 1F38A 1R5GA 2FCAA 2YPRA 3KPUA 4FSDA 1HKSA 1V4RA 2CWEA 2VC1A 2N47A 4U88A 1AF7A 2HNKA 2GIVA 1QNTA 2V79A 5JI6A 2IP2A 3C1DA 5BOXA 4CXMA 3TQNA 5K0EA 4HF2A 1S29A 5E17F 4I0AA 2PQ8A 3EYYA 1FBUA 2VBWA 4P7GA 3AXTA 4BYYA 3TFWA 4HQMA 4ZYEA 3V7RA 3EETA 5EG5A 2FBHA 4GOOD 3TOAA 1WXWA 1G8AA 1G38A 3HEMA 3UBTA 2ISYA 3CDHA 4KUMA 4AZWA 1E17A 3Q9VA 1YIOA 4WXDA 1BBYA 3C0KA 3TPZA 1GXPA 1RJGA 1P92A 5TJJA 2WK1A 5L3CA 2BEOA 3G88A 3H92A 3V8LA 3KLOA 1E2XA 2QWWA 3FUTA 4MIKA 3HVIA 1Z9CA 3OE5A 2W84A 3G2MA 5ICFA 1IN5A 2B25A 3RKXA 2G7UA 4YFNF 5HDKA 4PYJA 1JE8A 4KMUX 3WSTA 4RVGA 3K1MA 2FF4A 5FQOA 1XCLA 2F5FA 5LQNA 1YYVA 1TW2A 1R8XA 2GA1A 1NBIA 4EV0A 2HEOA 5K5RA 1GVJA 4LB6B 3KQMA 2H09A 3PB3A 4BY9E 3M6XA 2PX8A 4QQKA 5HIMA 2C7RA 3G2QA 4CTJA 2YXEA 1H1DA 3CJRA 3BJ6A 3DF8A 4EGYA 3E05A 3BOQA 4P55A 3B3FA 2E1NA 3JTHA 4XBFA 2Z9OA 2O6GE 3DUWA 2CGPA 4XRFA 1F3LA 5EHIA 3DFGA 3HCFA 4HTFB 4OIQF 2V74B 2HFHA 3IHTA 1FX7A 4ASNA 2CL5A 2NAZA 3GIWA 4GCVA 5P8WA 2R3SA 4PCQA 2JJQA 4AVPA 2A68F 2DK5A 3MWMA 4X1OA 1SMTA 3PS9A 5FHQA 4L7VA 5FULA 2Z6AA 3F8CA 2IBSA 3IKTA 2VT2A 2XYQA 2RKHA 4DZRA 3GFMA 5HIJA 3QP6A 3GRZA 3CKKA 4MNUA 3E7PA 2AN5A 1IRGA 4L9VA 2NYUA 3HA3A 1BJAA 2KKOA 2XKPA 3HRUA 2P8TA 5E8JA 3WTZA 1HSTA 1YW9A 5HOQA 4POOA 2JT1A 4A0ZA 5HS8A 3TKAA 1R22A 1IY9A 3VSEA 3GDHA 4OBWA 3G5TA 4E2WA 3WTSC 2OY0A 5GOZA 3J80K 2ESNA 4HA8A 3B7PA 3RPUA 5D5VB 4MQ9F 2LNBA 2F5EA 2P3LA 3FHZA 3C6MA 4HF1A 2ZBRA 4M38A 5LQUA 3I59A 3FTEA 2GA9A 4LG0A 3JAMZ 1HW1A 3WTVC 3LSTA 4KW7A 1HXDA 2Z6UA 3IYLW 3HCEA 2QRVA 4Q47A 5CM2Z 4PGHA 1JQEA 5FFXA 5EMMA 5MHTA 3FZGA 5E1OA 3FPEA 1OYWA 1R7JA 2W57A 4AX8A 10MHA 1R18A 5DWQA 1DCTA 1G60A 2DTRA 2QYOA 3FUWA 1S3JA 4IKPA 3G89A 4OX9Y 2H6CA 3ZMVA 4LG1A 3GFIA 2VDVE 2PJDA 1UHWA 2R6ZA 2K7LA 3KP7A 1XTPA 2IPXA 4DMGA 2ZCJA 5FGMA 1ON1A 4AUKA 1QAQA 4GOMD 1L9KA 4P7JA 4YFKF 2FXAA 2JG3A 3V7CA 4E30A 1KYZA 5E8RA 5T6BA 3R60A 3DOUA 2VZ9A 4DNCA 2X0LA 2PGXA 1V39A 2NS0A 4NQWA 2YXDA 2ZWAA 3O7WA 4CKBA 1B9MA 4PIPA 4I98B 3WTXC 3HP7A 3BGIA 1L1EA 5K0CA 2MD5A 4NHJA 2AOTB 5JR3A 1YW8A 1D8JA 1PP7U 2HTJA 2HZTA 2ADMA 4KIFA 3NMUF 3K9TA 4GO1A 2IH5A 3CUQA 3VC2A 5CVUA 2XYRA 3OZTA 3BPXA 2PX5A 4M7RA 1ODDA 1KR5A 1LB2A 4HC4A 4BLUA 1QZZA 2A6HF 2UYOA 3C3WA 2L4MA 2ETHA 2RN7A 3Q9SA 3GX4X 4B17A 3CO7C 5K03A 2ZZMA 4QTTB 4R8RA 4IRGA 3MAGA 2AOWA 4AIKA 2CYYA 3R6TA 2DPDA 3Q87B 1O9GA 4G7ZF 3HCBA 3KP6A 3LWFA 2IPQX 3FM5A 2H6BA 1JXSA 3I9FA 1YFJA 2LD4A 3M6UA 3DR5A 4P9FA 2NNYA 4BP3A 3N4MA 3LL7A 5KS2A 2WC2A 4KIGA 1Z6TA 3BJAA 3FMQA 3HSRA 1ZREA 1T38A 3UJDA 1N7JA 4HF0A 4M9SA 1QZYA 5EIWA 3EMDA 5FLXZ 3NDIA 3DH0A 2F5CA 5HDNA 5D4SA 2ZNZA 3MZYA 5DXAA 3UJCA 3DXYA 2GAUA 2ERCA 1XDSA 5EPEA 4QTUB 5F2OA 5LQAA 2VDWA 1YF3A 2JHCA 1FSHA 3V4GA 4KN4X 5DCFA 1UFMA 2MH2A 1JTEA 4QVKA 3SR4A 5DX0A 2L01A 2B2CA 2VOOA 2DFIA 1ORHA 5F6FA 2DPUA 2VDUE 1MD0A 1SQFA 5D5XB 3KEQA 4GEKA 2P3OA 3J80Z 1ONVA 4QPPA 5E1XA 5LRRA 2O06A 1U2ZA 4PYOA 1TTYA 2HKOA 4YV1A 3BGVA 5DRYA 3E23A 3RJPA 4HGZA 3WTYC 1FBNA 2LF8A 4BH9A 2EFJA 5C0OE 3JWGA 5EMLA 4JBAA 2E7WA 4KFCA 1VLMA 3SZTA 4LD5A 4V0QA 1JG4A 1P2FA 3R0QA 5DSTA 1ZHFA 3OU7A 4HG2A 5A2QK 2FRHA 4YFXF 2JHAA 4O5VA 5E8GA 1IM8A 3GW2A 3PX3A 1FP1D 1ZGJA 5EOVA 5IH3A 3PFHA 2RC4A 3BKXA 4YUYA 2C7QA 5CCBA 3ROUA 1HBXG 4XUEA 1LNWA 5LLQA 3HTXA 2YU3A 4QPNA 5DV5A 4YMGA 3CO6C 2PJPA 1MHTA 1B6AA 2EA2A 3E5UA 1EH6A 3GFJA 1G4DA 4IRHA 3QV2A 1NW8A 5CVJA 3DULA 4GYIA 4DKJA 1L0OC 3M6VA 3KLNA 3JWJA 1HW5A 4FX0A 3FZVA 3U9GA 1NKVA 2RQPA 4PYNA 3H3UA 2DK8A 3DMFA 4F84A 3I64A 2CKDA 4DQ2A 2OBPA 1I4WA 1QAMA 5LGTA 3NJRA 4G7OF 3F23A 1IXKA 1J2XA 5E1BA 1QQIA 1SUIA 1K78B 2FU4A 5M5BA 4X61A 3UJAA 3G7UA 5K05A 3MTEA 1LVAA 4HX4A 1SVUA 2Q41A 2R7DA 4ESBA 2XVMA 1Y0UA 2F5DA 4ZZDA 2FMLA 3F8FA 3J81K 2K4JA 3TR6A 3GUDA 5ICGA 3WE2A 4YUWA 2IW5A 4EGZA 4OINF 3MAJA 3ECOA 2MLKA 2P7IA 5IT3A 4OMZA 2ZIFA 1FNNA 5DXJA 3RKWA 3UJ9A 2PXCA 1P4XA 1SUSA 1OYYA 3KEOA 3OZSA 4RGSA 2H94A 2L02A 5CVIA 4OU0A 2P4WA 5HLHA 4WXCA 3LA7A 4LWPA 4DA4A 3DEUA 4XLNF 1STZA 3FXRA 1UCRA 2OPBA 4O6JA 3KR0A 3RIRA 2XBMA 4Y17A 5DEQA 5BMZA 3B89A 1X3UA 2QQ9A 5KQSA 3CBGA 1Q0TA 2XASA 2UYHA 4LK0F 2NXCA 3SM3A 2QM3A 4E31A 2DW4A 2AOUA 3E6CC 5BXYA 2PX4A 5DYMA 4QDKA 5L3GA 2Y48A 5LEJA 1RI4A 2ZO4A 5K5OA 2EFWA 1XSVA 4E33A 1D5VA 3JSPA 5JUWA 4H0EA 3Q7EA 2ZZKA 3TM5A 5K8VA 4ER3A 2M1BA 1M6YA 1FZPB 4OOIA 1RZ4A 4KICA 4M37A 3RIEA 1P4AA 3GLXA 1T43A 1N7IA 3T7SA 4U7BA 3T1BA 4MTDA 3FTFA 4EM0B 5IT9Z 1XVAA 3Q5FA 1XSDA 1JSZA 2EK5A 5IT9K 1O57A 5LBQA 4MTLA 3W6JB 4P7FA 4F85A 3H2BA 1KU2A 4P5OA 3B3GA 4OMYA 4FT4A 1S7OA 4KDCA 5FA5A 5E20A 2K27A 5GP1A 3ZMZA 4RTRA 2R7FA 3P9NA 2G72A 4IVNA 1BC8C 2ONYA 2BGCA 4RAYA 2BE5F 1AWCA 1P4WA 3M4XA 2ACJA 4M74A 1EAMA 1EJ0A 1U78A 1L3BA 1ZQ9A 5H02A 1G55A 1RUOA 2P7VB 4LFUA 4RB0A 4OIPF 2EB7A 2MA3A 2JH8A 2L54A 4U0VA 4ON0A 1FLIA 3V97A 2O8XA 1XXLA 3CVOA 5CIYA 1XJ5A 5A2QZ 1ULYA 1BKYA 2V1XA 1WZNA 2H11A 3SSMA 1OR7A 3E6MA 1KIAA 1IAWA 4V0RA 4ZYDA 2Q0OA 3IRQA 1U3EM 5FHRA 1OR8A 4CO8A 2V1UA 4BHPA 1X1AA 2G7HA 4BNCA 4CHUA 5LQRA 2QUFA 2UWMA 1FOKA 5T67A 2DT5A 2MLGA 1H9GA 3G8AA 5JFRA 2PVCA 1SFEA 1MJBA 1O9HA 4RB2C 1FYLA 5T64A 1J7KA 3GFLA 2J5OA 3FPJA 1W7PD 3HIFA 2OD5A 1FPQA 3ID6C 5KVAA 1MZBA 3ORHA 4MQ4A 2FHPA 3RODA 2HMYB 3EGVA 3HRMA 3UJ8A 3SGLA 4E2ZA 2H1RA 1P1BA 2EG5A 4MWZA 3TO6A 1DUSA 4RGRA 1WRJA 2PMUA 5DPMA 3O4FA 4L5IA 1SD7A 3T8RA 4IHSA 4PYLA 1KYWA 3TGNA 3OFJA 3SHFA 2UXNA 4U0YA 4XUDA 3LCVB 1Q0SA 3IKVA 5EGSA 4FX4A 4RTJA 3ECHA 2PBFA 5KK1A 1SMYF 2Z5UA 2OYRA 3QOPA 4EQZA 3FPFA 2PN6A 4OBXA 4C06A 2P1DA 5EMJA 4PNEA 3KP3A 3ML6A 1RI1A 3HVHA 3C7JA 5FADA 2XVCA 3SXJA 4F86A 3PQJA 3FF5A 2YUIA 3V8KA 3M33A 2MC3A 3PVCA 5EKXA 1XB4A 2WTEA 2D2WA 2O57A 3LBYA 4TV7A 1VE3A 2W25A 4IF4A 1WKMA 3BWCA 3CTAA 5HOOA 1USSA 3D0SA 4M9ZA 2LF7A 2O61A 2HQNA 2YX4A 4U0WA 3TDUC 3CLOA 1F4KA 3GGDA 3ANXA 2VS1A 3B5IA 4ER0A 4IJAA 4U7TB 4ZH4F 3MFKA 1T0FA 4I2OA 1ZLKA 2B78A 3UZUA 3R0AA 1ZRFA 1XCVA 1W7PB 1JG2A 1BC7C 2M87A 1WQ2A 1PUEE 3E5QA 1DUXC 4A12A 1GHCA 1Z7UA 4U7DA 3EVFA 2B0LA 4A6DA 2EV6A 1YS6A 3DPLC 1KU7A 2FOKA 1U6GA 1IXCA 1ZN2A 4A5MA 4MTEA 2B9EA 2JPBA 1FYKA 1QANA 3HYIA 2GB4A 4M73A 3B3JA 4KN7X 2I6GA 4HW0A 3WTTC 3NWEA 2D1HA 3PT9A 5CUQA 4G6DA 2P6SA 1J75A 4HTFA 4UVBA 3LKDA 3R6SA 1CF7A 2OZVA 4M72A 1O7FA 1KPHA 3DPTA 2IH4A 3NEUA 2GZWA 4EM2A 2K4MA 4C04A 5EC8A 2QQAA 3OZRA 3HSEA 1L3LA 2YX1A 2ZFUA 2ZW9A 4X63A 2UYQA 5GINE 2P35A 3HCCA 5EMKA 1DDNA 2NYXA 4L0YB 2O0LA 3RDIA 2AOXA 2EFQA 1RI2A 2JZYA 2BYVE 2BV6A 1ZYRF 4KDPA 3L00A 4KYWA 3ELYA 1RJFA 5EKUA 3JWIA 2NP6A 4AD9A 5DX1A 3KE2A 2WV0A 2IGTA 2L3DA 1EJ6A 2PT9A 2PY6A 2NNWB 5L3BA 2EJUA 5LRSA 5F2KA 1JG3A 3GZ5A 4C07A 2DAOA 3J7AO 2D45A 2HV9A 3BY6A 3LECA 1R58A 3GEZA 1VTNC 1J0RA 2F2EA 4PGGA 3NRVA 3C3PA 2M5WA 4FGZA 4FHTA 2AN4A 2VE9A 2FBIA 5CVEA 2EFOA 4MHTA 1NW6A 4IRIA 3FUVA 1G6NA 2HQRA 3KETA 3QU3A 2D1VA 5FD6A 4E2YA 4UHTA 1ZGAA 4IV8A 3ZMDA 3IL2A 1KA8A 3THSA 5K01A 2CG4A 1HNNA 1VPTA 5ILVA 3KPWA 2XGXA 4UXNA 4P9UA 1HKTA 5KVRA 4CTKA 3JTGA 1LDDA 3DMHA 3QRFF 2G8NA 3ELWA 5FO5A 2XAJA 3DXXA 3AJDA 4NECA 1KHHA 3A27A 2QQBA 1AQJA 1I27A 3TO7A 3MHTA 3T5XA 5D1HA 4LGWA 3OE4A 3BP8A 3AWIA 2COMA 3P9IA 3HHHA 5HIIA 1TW3A 1Y8CA 3UA3A 3F8MA 2WA2A 1FYMA 3KKZA 4FSXA 4A5NA 3B73A 2AS5F 5KYGA 2EFPA 4PYKA 1IXSB 5F1RA 1R23A 2OQRA 3TDZC 3BZ6A 3BWYA 5ED4A 1MJ9A 3M70A 4UV8A 2M45A 2AVDA 1A04A 2W24A 3R61A 2I62A 1JSXA 3V8VA 2VP3A 4K6MA 2GQQA 4EJVA 3ZP5A 1TNSA 3WG9A 1QGPA 2K86A 5K09A 2FNPA 3M8FA 4YUZA 3KQTA 4F7ZA 1D3YA 1QYRA 2EA4A 1I9GA 2K4BA 3KP4A 1KPGA 4HGYA 1X1CA 5BPIA 1SFXA 4ENMA 1DPRA 3HVKA 5JVTA 4C08A 2PKWA 4BQAA 1NV9A 4L5JA 3P97A 2RV8A 1DL5A 1XGSA 4ZTBA 1O3SA 5FA8A 1VBFA 3ZN1A 3AAFA 3JAMK 1O54A 2WA1A 2ZZNA 4G7HF 3D5LA 2ESRA 2BR5A 3EVBA 2EV0A 3K6RA 3WU1B 1F5TA 2IT0A 1MKMA 3AY0A 3BKWA 4CZZA 2P5LC 2I9KA 4RGUA 2IA0A 1RI3A 1TLHB 2Z33A 2EJTA 3GRYA 3TOSA 2Y75A 2DPMA 5GIPE 4RTSA 4LLNA 1Z05A 1NT2A 4Q48A 1U2WA 3DV8A 4PCAA 4GBED 1KGSA 1F9NA 4OQEA 4G8XA 1W5SA 1XN7A 5GM2A 3GVAA 3LCUA 1LJ9A 2RGVA 1TQMA 2QVOA 4WF2A 7MHTA 3F4KA 4PYQA 5L3FA 3NWBA 3HUGA 4ATNA 4RGXA 2CWWA 4FT2A 2A14A 5TRDA 1NW5A 4RTNA 1QPMA 4A0YA 3FMSA 2KRFA 1SQGA 2Z3YA 3PTAA 4R6WA 4L9JA 1M0EA 3WODF 3DQVC 4CYDA 1ZKDA 4EJWA 5LHIA 1R5HA 4DM3A 5FLXK 5DLYA 2XRNA 4LLLA 2O03A 1PDNC 2PG4A 3M9AA 2H27A 3KP2A 2G71A 5D6FA 4MEYF 5HS9A 2XVAA 2E1CA 2OAZA 4KIBA 4GOND 4NB5A 2OB2A 3M1EA 4RVFA 1INLA 1R74A 3FRHA 5KQRA 1EIZA 2G9WA 3OPNA 2FK7A 4EJUA 1OPCA 4LWOA 2ONZA 5HILA 2P8JA 1NBHA 4UOEA 3C18A 4HX8A 4HQEA 3K0LA 2AVNA 2GAFA 3ELUA 4S05A 3AXSA 3ABTA 5H6QA 2GPYA 5G02A 1OYIA 2BH2A 2PI0A 5K0BA 3FTDA 2P6TA 3SSNA 2IA1A 3VODA 2IH2A 3KQWA 4FT8A 2FEZA 3HA7A 2GXGA 5D1NA 1G3WA 3F72A 3JWHA 4RTKA 1QBJA 4UVCA 1L3CA 1K79A 4X60A 3GF2A 3SQNA 2OBFA 4QDJA 3QOWA 3N97A 2ZIEA 2VBZA 2G70A 4R1HA 2KIMA 1O7LA 1DPUA 3P7NA 3KPYA 4KRGA 2A6EF 4IPAA 3G2OA 2YX7A 3MERA 1TNTA 5H6RA 1JR4A 3TO9A 1JGSA 4YV0A 2FE3A 4YG2F 1NE2A 1JQDA 5D8KB 1BIBA 2ZJ2A 2WWYA 3LBFA 3LQQA 3FYCA 3H3ZA 2A07F 2ZSUA 3UJ7A 3QU6A 4C03A 3IWFA 4KA4A 3HTUA 1P39A 1HMYA 2P40A 2KJBA 1KU3A 4CKCA 3VYWA 3ULQB 3FPGA 1BI1A 4HDUA 1BOOA 1MDMB 1P91A 2NRAC 4P58A 4HV5A 2KIFA 2QZ8A 5ICEA 5DTRA 2NNNA 4LG0B 2MBFA 2PWPA 4GC9A 5FCDA 4Q4ZF 3SVZA 2FMYA 2JHPA 1G6Q1 4HLXA 3CGGA 1XCBA 5E1MA 4I01A 4EVIA 1ZLJA 3A7DA 1LQ1A 4FR0A 2G1PA 4RWZA 1O3TA 1SD5A 2IIPA 4RS8A 5CYVA 1IF1A 3KPVA 3F8BA 3DLCA 1D8KA 3ELDA 2VODA 2PV0A 2KW5A 4C05A 1AV6A 3M8EA 5CCXA 1W7PA 2ZMEA 2O0YA 3ABUA 1G3TA 4LK1F 3FTCA 2BBYA 1JHHA 3I71A 5AIPA 1YZ3A 2YXLA 3ERCA 2UXXA 2ZBPA 3IC7A 1RNLA 1YFHA 3CCFA 5HLIA 4OIOF 2A69F 1I6XA 5L3EA 4CGZA 4I02A 1ON2A 2JTVA 2OXTA 2C6YA 4HAMA 4E70A 4M9XA 3BWBA 4PDKA 3D2LA 5FFZA 2YR0A 2V7EA 3KU1A 2FSWA 1RIOH 4HSGA 3F6OA 2M30A 5DD4A 5LR6A 3EPPA 5DUIA 2GWRA 2GLUA 4QWQA 4N9IA 4JQFA 2EWNA 2A5YB 2PEXA 2YSRA 3DKWA 4ENJA 2IDJA 1R1UA 2CO5A 1XDUA 1IUYA 1R1VA 4KT5C 2PXAA 4O29A 5E2AA 2FPOA 4BXUA 3VOEA 2GH1A 4EK9A 2MH9A 1VQ1A 2Z6QA 3IV6A 4ER6A 1FJXA 1T98A 5D8LB 4K2EA 4AZSA 3WE3A 4RSRA 4RTPA 5D5UB 3LHDA 4G6QA 1YQAA 2V1DA 3FUXA 3E6DA 4OQDA 3HVJA 4EKIA 3J81Z 5DRTA 2UZKA 4ZZLA 3GJYA 1QO0D 2H00A 4GXOA 3SZPA 1VL5A 9MHTA 2OU2A 2P5VA 3I58A 1XDZA 2VOPA 3GRRA 2CFXA 3G73A 3UFBA 2P41A 2XV4S 5EEGA 3VB2A 5K1YA 1V3FA 5DUKA 3BDDA 5HS7A 3DMGA 4RV9A 1XCJA 4UNOA 5AIQA 2ZMEB 4I7HA 1G8SA 1U5TA 2DQLA 1KQ0A 1G3SA 1RUNA 4GOLD 1LDKB 3FRIA 5FTWA 1SD4A 3OFKA 1U8RA 3F8NA 4ER5A 5AONA 5EEHA 2QBYB 1BOAA 2HWKA 3EEOA 1HSJA 1JTFA 4HDVA 4EKGA 3E97A 3P2EA 3NTVA 3OU2A 4IXAA 3OOPA 4KDRA 2PFBA 3BUSA 3ZN0A 2P3QA 2HWVA 3OV8A 4S04A 3HRSA 2VE8A 2ELHA 2W85A 2A3SA 3BGDA 4GF5A 2ZXJA 3O2PE 2XAQA 5D5WB 2RNJA 5F64A 1IZ1A 3O31A 4YMHA 5DM4A 1YS7A 4MGRA 3KQQA 4IWNA 5J8CA 2HYFA 5BPDA 4Y2HA 4DQ0A 2LSOA 4PWYA 2QY6A 3G5LA 3KFWX 3O3KA 4RAZA 2VXZA 2XKOA 4AWXB 3G2PA 3HRTA 4R8HA 4RTOA 3P8ZA 3TLJA 1FBQA 1SG9A 2FNAA 5E8IA 1ORIA 2EFNA 4BLVA 4BLWA 3GRUA 4KNYA 5CD1A 3CJNA 4RTQA 3P2KA 3O6BB 4G56A 2B3TA 3IEIA 1RJDA 1MJAA 3RPQA 3DXZA 4CDGA 1EV7A 3BT7A 3CUQB 1Z6RA 1WSUA 1MJFA 3A4TA 5F2NA 5DCMB 4RYLA 1KQ8A 4A6EA 1FSEA 3EQLF 3QOXA 5HZMA 3FXQA 5LEKA 4DF3A 3TM4A 1BC5A 4AIHA 2L4AA 3CUOA 3VFZA 4CWAA 3GWZA 1S7AA 2Z99A 2E5WA 3EDPA 4YIFA 1J59A 2V9VA 1MGTA 1TQIA 5DTMA 3THRA 1O3RA 5D6EA 2HR1A 2QENA 3F21A 3FPHA 5ICCA 1G3YA 1B42A 2XHKA 5CVDA 3SMQA 3MZHA 2DQRA 4B09A 4BP1A 1WI9A 1KPIA 1QAOA 1OKRA 4ESJA 3NQOA 1T39A 5HIKA 3UJBA 2OO3A 1BI3A 3FM3A 1I1NA 1SKMA 1HKQA 1ZG3A 3U81A 1UB9A 4WK8F 4HH4A 3FYDA 2CMHA 3EVZA 1R36A 3B02A 5DX8A 5K0JA 4LJZF 3F3XA 2AN3A 1IXRC 3T0IA 5E9QA 4YIIA 5HLGA 5ILUA 1UWVA 1USTA 3I4PA 4JK1X 4PINA 3QAHA 3ZMSA 2FBKA 2EV5A 2IJLA 1WS6A 2XAFA 3DP7A 1IN8A 1NHAA 4UV9A 3E5XA 1I1SA 1UIRA 2ZKZA 3L7WA 1I5ZA 4E32A 1ZARA 2DO7A 2QLZA 3E3VA 3HCDA 3WTWC 4DCMA 5K5QA 2XAHA 1MDMA 2C7PA 1YZHA 5BP7A 1B1BA 4LB5A 4OA5A 2AOUB 2GA2A 3I59B 2PLYA 5LQCA 2JRTA 4GUAA 2VN2A 4LECA 2KIUA 3LAJA 4GYGA 4LLGF 4FP9A 3PLAE 5DM0A 1VIDA 3DTNA 2AR0A 4PYIA 1S6LA 1Z3CA 4WCGA 2DLLA 1HQCA 3CUQC 2VBYA 2JPCA 4AIJA 3FMRA 4HBLA 1IW7F 4WVLA 2GS9A 4XSZF 4ETSA 1YG2A 2IBTA 4RVHA 2TDXA 4L0ZB 4BHCA 2RVCA 5FB2A 1XMAA 2ZIGA 1XGNA 4WXHA 3WU0A 5HVQC 1Z1DA 3NW9A 1YFLA 2J5PA 3IHUA 3L9FA 3L2CA 5EVJA 5C9ZA 5FQNA 4R8SA 3F6VA 2CW0F 3P71T 3K0BA 3FUUA 3I54A 2IRFG 2O3FA 5DCMA 5ERIA 2NXEA 2E7XA 2DULA 3SXYA 5H20A 3DLIA 3GRVA 4HRAA 3RW9A 4M71A 4BHBA 2Y1WA 4RTLA 5K0FA 3GYHX 3RKYA 2FA5A 3WGHA 1U5TB 3X0DA 1R00A 2XYVA 3VC1A 2XUBA 3I5UA 5L3DA 3KQVA 2YVLA 3EYIA 3G3ZA 4CKEA 1RI7A 5DM1A 3TMAA 2XIGA 1IN6A 1REPC 2NXNA 4X41A 3MCTA 2ESHA 4EM1A 2OQGA 1FBSA 1W5TA 4LMYA 3NVMB 1NV8A 3KPJA 3EEYA 5ILSA 4EJOA 2EX4A 4PCLA 3C3YA 3FWEA 1KU9A 2ZLBA 3ME5A 3HNRA 2VC0A 3P2IA 1PJZA 4R6XA 1K78A 3S2WA 3S68A 4ZYHA 3SX0A 3VEPA 1U5TC 4R79A 1R8YA 3HOSA 4YV2A 1EQAA 4P7KA 2JH9A 4IV0A 1T6SA 1EG2A 1T2KA 2FQ3A 2STTA 3LQRA 1Q1HA 3T0YA 5FUBA 3JSOA 3LDUA 5E1WA 4WWCA 3A26A 4BAYA 2Y1XA 3MCZA 3BJOA 3SSOA 5E2BA 3HOTA 3E6BA 1YUBA 2PXXA 2AXLA 4R05A 3KHKA 4E2XA 1UHMA 1ZG5A 5DTQA 3L09A 3V7SA 1X1DA 1WY7A 4CXFA 2HDCA 1DP7P 2BM8A 1L3IA 2IFTA 3KZZA 5DD8A 2ZFWA 1ZG1A 4I0BA 4Y13A 3QP5A 5E1ZB 2I7CA 2DI3A 2ISZA 1YO5C 3RYPA 2ZTHA 2HTSA 1H0MA 4N0BA 2LKPA 2QE6A 3ISPA 4A2UA 1JG1A 3LKZA 4HX7A 3HTSB 3RYRA 1R1TA 5BQTA 4ZYGA 3BZBA 3TQSA 2JSCA 1FP2A 3GNLA 1LEAA 2ZBKA 5LGUA 2CSOA 3KQPA 1VP9A 5J6XA 3WGGA 4JXJA 3COAC 4OA8A 2ZWVA 5E18F 1NW3A 5BS6A 2ZULA 2PT6A 4HZFA 3MQ2A 1BM9A 2C7OA 3ZMTA 1J5YA 5HFJA 4O3MA 1D2CA 5CLSA 3P9CA 1SFUA 5DSXA 1BI2A 2LDUA 3KZYA 5HDGA 1SD6A 2AOVA 3SFZA 3MB5A 1XGMA 2ORED 1ZAOA 3PFIA 3LDGA 2ZBQA 4GQBA 1UFKA 3C6KA 3RTRA 1RI5A 1CGPA 5JHUA 3T8TA 1OMIA 3R4KA 4EJTA 2F8LA 4MQVA 1XSXA 4Y30A 2VBXA 3KR2A 5D4RA 3ELKA
chains in the Genus database with same CATH superfamily
5K6TA 2OG1A 3EW7A 3BYZA 1HYQA 1D2GA 2VZEA 1RMTA 3I53A 3NTRA 3MJFA 3OTIA 4GPZA 3TCKA 4BBJA 2YR2A 1AKQA 5LN1A 4PC2A 1VA4A 5ALFA 3H11B 3VTZA 5LQKA 3H4MA 4IIBA 1D1PA 2HMVA 1V6SA 4GXNA 1GAQA 2X4HA 4M6XA 2J4FA 5FKMA 1G41A 1KY3A 2YY7A 3NPAA 2OHJA 5I9BA 1ZM7A 1Z0JA 3U1DA 2QE7A 2H4FA 4BUJA 4U3JB 4DIOA 3KDSE 1PP8F 2PX2A 5IJ9B 2C9CA 3HR7A 3L7OA 4HOBA 2HR3A 1Z91A 4FN5A 4TTSA 3SNHA 4YAUA 2DBZA 3U6BA 1DTSA 1F5SA 5FPYA 4GMDA 3TAUA 4JJFA 3CPSA 4BQQA 2B36A 3H1GA 5LNK1 3R2JA 5JH7A 3GPDG 4M0FA 5EQFA 3R9XB 4N3NA 4S35A 1OF1A 2WMYA 3TX6A 2D59A 4DMRA 3D6MA 2ZYAA 3FCEA 2FGKA 4ENNA 4MQFB 1U65A 4V0KA 5IAJA 1ZA1A 2P2LA 4JNCA 2UYCA 4E14A 3ZNNA 4NX2A 4BBAA 4YJKA 1RHJA 4RO0A 4JLVA 4HYYA 2II6A 1FRZA 4CCKA 2IHUA 5FPSA 3HJTA 4AZTA 4D45A 2E89A 3UWMA 3EH1A 4IQ0A 4G1CA 1SURA 2HU2A 3QU2A 1NLFA 1U1FA 2OBBA 3MOGA 4L6CA 4NU5A 1Z7YA 3CA8A 5DISB 1KE2A 3P9KA 2V7FA 3EUHA 1NJ8A 2XYHA 1J25A 4CZCA 2FOXA 2XCTB 4RXMA 1JYFA 3DNMA 2GOYA 2NU9B 2PPVA 2NVYJ 4CDRA 5EJ8A 5LFAA 3ASUA 3SHTA 4INPA 3QODA 4X71A 5AVXA 1A8PA 1H05A 2POQX 1UKCA 2QBYA 1FLAA 2O2EA 4PHCA 4BYMA 4J01A 1NQXA 4IY1A 2NOJB 1XPJA 1R9GA 1SVWA 2OKCA 2Q0SA 1JMVA 2QD4A 3IIJA 3KTOA 4LYGA 5FNVF 3RLIA 5JVDB 4RVSA 3ZBUA 2HYGD 3A4NA 4G37A 2ZVDA 3C98A 1ZN8A 1VOTA 3CLTC 3GZTB 1II8A 2RGNC 4Y6RA 4B4UA 5EKSA 2ZBVA 4X6XA 5ELLA 2HJWA 2ODWA 1LEBA 1D2HA 2GERA 2X8LA 4Y0NA 3WR5A 4XSVA 3HSFA 1PJBA 2X1VA 4MP8A 5AJTA 4MGHA 4O2LA 4YCDA 3RRJA 4PYMA 5E9WA 2YW9A 1CCWA 4IIJF 4DLZA 3GO4A 4L8LA 1O4VA 3B1KA 3BQYA 3SHVA 1H2ZA 2ZAYA 1E69A 3EFBA 3OYDA 2OAP1 1C3XA 4MWOA 4R4JA 1B4AA 2OV6A 3NWJA 3OZVA 3GL9A 5ALXA 4F97A 4LOLA 1D9ZA 1JJAA 2QMOA 2QVXX 4RZSA 3WIVA 2AHOA 4IHTA 1FPMA 1SEUA 1BCRA 1EA5A 1JFVA 2RAVA 3LY9A 2QWXA 2NOAA 4LSGA 4PRKA 3TVTA 5CBPB 3JW4A 3EGXA 1FFXB 4PSDA 5JVDF 1T91A 2FSIA 1Q74A 2G7MC 3D6NB 4ZT3A 5AW5A 3FD8A 5BSFA 3WJ1A 2H1IA 5F7JA 1YQUA 3ZMUA 3AM5A 5KSPA 3BXOA 3H17A 4LXXA 3T52A 3QSYA 4ER7A 4MEXF 2MCFA 2NTEA 1UINA 2ET6A 1F1ZA 4IL5A 3A2KA 2VSNA 3MUFA 4J2TA 4XYMA 2YOFA 2MMGA 3K1NA 3OG9A 5DI9A 3EN0A 5IVHA 4EHAA 2IOHA 3K16A 5GGXA 4UUVA 4BATA 4ND3A 1XD7A 4OK3A 4PUSA 1FT9A 3EUHC 3T5GA 4P2GA 1D1SA 1ZU5A 2GEFA 4R5MA 3QX3A 4Y15A 1WWXA 1P74A 2LR0A 3ZBQA 4EFDA 1JEQB 3M4OJ 1M6HA 1J1UA 4KVAA 1UOPA 5GGYA 3LLMA 3LA2A 1XGOA 4DTCA 3ENQA 4PG8A 4DUZB 5CGZA 2PMKA 3GPCA 4MCHA 3OT1B 2GETA 1GUDA 3ENKA 4A8JA 1WXDA 2O2CA 2R1TA 4P3OA 3K3PA 2HVSA 2ZRLA 2Q8KA 1KO8A 3GUUA 1EHYA 3HYRA 3NAQA 3ONWA 3I37X 1ECCA 1GDDA 3HB1A 5TQJA 2JPDA 1B72B 2LNDA 4N01A 4ETMA 1NX6A 2SBTA 4YAWA 1R27A 3JW8A 3IPAA 4CKBB 1CB7A 2VJAA 1WF6A 5BXYA 4DR4B 2ELJA 4P83A 3KZNA 4F3QA 4ACAA 1NP6A 4B84A 4ALJA 1A7AA 4G94A 1OXSC 3L8MA 4JB8A 3KTAA 1HKUA 4YUVA 5JZVA 2AF4C 4MW6A 3ZHCA 1EK6A 1CLEA 4ARVA 2P4QA 1C0LA 4PJMA 1F48A 1OROA 3CNOA 3JQBA 3NIGB 3QFCA 4K46A 2M1ZA 2JS7A 1PDVA 1V2GA 2FFQA 2YJ4A 2Z2YA 3ABMH 2NO4A 3I2HA 3KS9A 1SVMA 3N0RA 4LTDA 5ECWA 5M04A 3L01A 2JKVA 2CNLA 2YFQA 1LRLA 1NI4B 1S0UA 3QYAA 5SZKB 1GSHA 3W6PA 3ZCQA 2D0OB 1Z4IA 2M7AA 2CLMB 2GRJA 1LFBA 4UXIA 3O47A 1HETA 3GK3A 4HLYA 1WG8A 2FZCA 4UW9A 3WL3A 4GZ5A 5I4BA 5EL0A 1UDXA 1SVSA 3P27A 4CCWA 4EG0A 5IKMA 3CNEA 3ZKAA 2XCRB 1M8KA 4MNTA 3L3BA 2WPNA 3LCMA 1Q17A 3VPHA 2CDRA 1T2DA 2AZ4A 4OK5A 5TPZA 2PE5A 2B1RA 3L2VA 4I4NA 5BOSA 4A03A 4OQNA 2WM3A 5I9TA 1LKXA 1XRQA 5BMOA 3I8OA 1WNTA 1XMKA 2P7CB 3BPVA 4L51A 4O02B 2A5FA 3EGIA 3UA4A 1TBXA 2FWNA 4B75A 3JTEA 2BIFA 3PYMA 1HE5A 3ER8A 4LEIA 1NJ2A 3S93A 3ABRB 3CZPA 4F1WA 4ZIRB 2DFPA 2K7FA 5IBRA 1IOZA 1ZRCA 3EGOA 3HJHA 3JREA 3V8JA 1YITI 2EINH 2H2HA 3TB4A 4BMZA 3ZQ7A 3UY4A 3WKAA 4CF7A 2JBWA 1DC5A 1QQ5A 1S9HA 4HDOB 4AF8A 3AU9A 3FI9A 2JFYA 5H59A 3RTGA 1TF2A 3QJYA 2QJRA 2PO5A 3EISA 1Y9DA 3UT6A 2ZR8A 4BMSA 4P4SB 1M2FA 3COSA 3S44A 2XB6A 1O96B 2ZYDA 2WVHA 3LF2A 2JFUA 5IT0A 4A8JB 2E7ZA 4BLPA 4KVFA 4GLBA 3I9OA 4PPQA 3LGAA 4L3OA 4C22A 4GGOA 3AOEA 1ZDMA 2WQZA 3H0DA 1T8IA 4G9YA 3EVCA 4GKVA 2QQ5A 4CMBA 4JKIA 1PJ4A 2RONA 1JRLA 3NHLA 3RRYA 4ARSA 3PA8A 5EQJB 4WBSA 4ZAVA 5BMVA 3H3JA 3GWGA 2YASA 3OIPA 2RKBA 1G20E 1SAXA 3IOCA 5F77A 2VPRA 1NJSA 2E55A 2PLRA 2XSZA 4NSNA 2C2GA 4NULA 5F1KA 3C85A 4OQQA 2NSLA 1BX3A 3IEKA 1UJNA 3MGGA 1W75A 2Y77A 4GGGA 2V6IA 2Y2VA 3PFGA 4PS1A 4GT1A 4AMVA 1O95D 1NJ6A 5IM5A 2YMPA 4GI3A 2XF6A 5U4XA 2QN2A 4OIRF 2O5RA 1JUSA 1JLSA 2QZ9A 3QPTA 2GJ4A 3ORFA 1G8HA 5U4QA 3TKYA 2HCJB 4PIMA 3WLMA 2MTBA 3KSDO 2DR0A 2PWYA 1CQZA 3NBMA 3IAHA 1PDWA 3OQHA 1KS2A 2TMDA 1O3QA 4M36A 3NAGA 3VZCA 1VI0A 3IQGX 4L8GA 4FGLA 4BX9A 3HUEA 2D06A 2P7HA 5JDIA 2PUGA 3DPSA 1YHNA 2K9MA 3NEPX 4LQLA 2HS5A 1R6AA 1PS9A 2XGCA 2C04A 3B9QA 3D1VA 1B41A 2ORIA 4NG5A 4BMPB 5IAOA 1J24A 3KP5A 5JJ5A 3KCNA 4IFBA 3QE3A 3GAAA 4FR5A 4P4UA 4RMJA 2IY9A 5JPIA 4B6GA 4WASA 4TSRA 4W5NA 5DDGA 3GU3A 5AR1A 4INZA 4QGGA 1YJ8A 4YREA 3UXHA 3FXUA 3E9MA 5D7NA 5JT1A 1TCAA 4NAUA 1IJFA 3DS8A 5MGBA 2IA2A 3PNTA 1OGIA 1D6JA 2OHHA 2X23A 5TLSA 5BW6B 3A1WA 1L5WA 2ENWA 4R3WA 4S1NA 4QG3A 5JEDA 1TU0A 4QGAA 3LDFA 2DA1A 2ZAOA 5LYJF 1M2EA 2YPRA 3DGFC 2WAEA 1R1DA 2LW7A 3M3PA 4G1EB 4IJKA 4FHDA 4MKFA 2N47A 1V4RA 4US2R 2B5VA 1Y3AA 5JAPA 3WQRA 2J46A 3A6JA 4NJEA 4CETA 2GIVA 4QYSA 3VUFA 2RGYA 3HO8A 4LF4B 2BF7A 1VPVA 3QTTA 5EJGA 5BSUA 1ZIDA 5LC1A 1DKOA 5KINB 5E3LA 2NW6A 3V9PA 3ZQIA 3TQNA 2IHTA 4WKGA 1KI6A 4X44A 4BUZA 1BMDA 3FJOA 5E17F 3GLGA 3K9NA 2YBEA 3AF0A 3AWDA 2ORYA 1A5AB 3EYYA 3DKPA 2H1KA 2X8AA 3IP1A 1N6HA 3AXTA 3L6UA 3WL8A 3VKWA 2FSUA 3EXHB 1KFJB 2A0XA 3EEIA 3EIEA 2R8OA 3EETA 2AUTA 1YBFA 2WIJA 3JS5A 1JZSA 3NT2A 2FBHA 1DWOA 1M34A 1RXSA 4FI3C 4GOOD 2WWVD 5I3ZA 1OFVA 1L5MA 3LW7A 3JCUC 1J49A 3PSAA 4IDGA 4BBPA 4ACBA 1JAHA 3SJZA 3MD9A 4D6XA 5IDWA 3QHAA 5DNYB 4D81A 2ISYA 2Z09A 1NBMD 1KE1A 1UDBA 1DKQA 1QIGA 3L4BC 4ZT2A 5KWIA 3DLHA 1AV7A 3Q9VA 4I4LA 4ZKDA 3QY9A 1MMDA 2H1VA 4AF6A 3JZMA 3K4PA 2ZSEA 3TPZA 1PT6A 2HQBA 1IM5A 1Q57A 1RJGA 1P92A 1WPXA 4Q7LA 4MO7A 3H5IA 2GKGA 2WK1A 1IHPA 2QYSA 2JGJA 2BEOA 2UVPA 5JATA 5H3LA 4V2GA 5JZ9A 2FETA 3N39C 4JVSB 4HQKA 3VZQA 1BD3A 2OC4A 4RWEA 4AJ4A 4BHTA 3AILA 4QPOA 4OHOA 1EDOA 2YQ4A 5T57A 3HVIA 1T2NA 1QV9A 1VHLA 4QYIB 1V54H 5AW1A 2V1NA 2W84A 3A0BC 2JJYA 1HMPA 4IX9A 2I0FA 3RGWS 2Q1WA 1M2GA 2R6AA 4HBGA 5A71A 2IXGA 1C9KA 5IJZA 1E20A 1GVNB 4Q4LA 1K2VN 3OOEA 2A30A 1JE8A 1Y98A 4W8OA 1TI7A 3ESRA 1MH3A 4D25A 4MQUA 1UMCA 5AKIA 3SF8A 2QM7A 4WERA 3RS0A 3STTA 3WSTA 2I2CA 4QNRA 3K1MA 1I4DD 1K86A 2HRDA 4M22A 3ESDA 4JVNA 1KU6A 2K2QB 3G7SA 4XKJA 1SUPA 2NO9A 3IBFA 1XCLA 1BE0A 2XNDD 1A9TA 1KU0A 1TW2A 1W96A 1KRHA 3K2BA 3OJCA 1PUIA 4EHKA 1O96A 1M66A 2Z1MA 3HDJA 1MORA 1XQ9A 3RC9A 1MX1A 2W8BA 1SH7A 4N4AA 1XK7A 1U9IA 2X13A 4XWWA 5AKGA 2X3UA 3SBOA 2Q0QA 1F43A 1GFZA 1AKHB 2JA7J 2R87A 3PUKA 4UZSA 2FWMX 1RQXA 3P2YA 2W37A 3AB7A 3E9YA 2WLTA 3WLQA 1V11A 4MICA 5P21A 1DAEA 1FIUA 4LOJA 4C3ZA 4ZOCA 4YJ2B 5FYQA 3QYPA 3JTHA 2H7XA 4PV7A 1AKTA 3GI1A 3ZHBA 2O6GE 1X8LA 1YDMA 1CDDA 2CGPA 4PSXA 3FFTA 5AW3A 3WRXC 1M34B 4QEKA 5HKKD 2LIVA 3BA1A 1SULA 4S12A 4YRQA 5AK5A 5K4AA 4B3SB 3WU2C 1VCOA 2X41A 3E4CA 3AX6A 4FEEA 4K9MA 3U62A 1JR3E 1NZJA 5DLEA 4HTFB 1R4NA 1CXZA 1K8RA 2LE0A 3D2AA 4BVKA 5JH7F 4KUEA 2P2SA 4C6TB 5C31A 3TTSA 2XQIA 4HSTA 3EXG1 4A3JJ 1UK7A 2X5NA 4JDUA 3AFMA 4KYUA 2W2LD 3IA7A 4YACA 3PS9A 3RYCA 4L7VA 3D31A 2WDZA 1JTVA 3LQ2A 3VO1A 4XTRA 4HWKA 1PFQA 2ZIUB 4C21A 3KYJB 2IBSA 4DR2B 4FNOA 5ALSA 2WQ6A 2XYQA 2BFOA 4TLAA 2C31A 3S28A 2CHQA 1TK3A 3CMYA 1PYDA 3CZ6A 2CDBA 1R64A 4DA9A 1QC5A 3CKKA 4MNUA 1T0PA 2QTAA 3EA5A 3OP1A 2Q4DA 2WAOA 2XKPA 1QGZA 3PQEA 1CZUA 4I4IA 5DM70 3THYB 2WWWA 1FTGA 2H0RA 1RYZA 2HGZA 4FMPA 2MHCA 4OH1A 5E8JA 1XLVA 1HSTA 1ONSA 2WYVA 4O33A 5HOQA 4LF6B 4W5TA 4PZEA 4X93A 4POOA 3OOSA 2HF8A 3IOMA 3K9FC 3S3NA 4RJJA 4U02A 4A0ZA 3KTDA 2ABWA 5HS8A 1WPRA 1R22A 1JJVA 5ARCA 5AXBA 4KISA 2G9QA 3TKAA 2Q3EA 5M3FJ 4D4MA 5CR9A 5EJ6A 3WTSC 1JL3A 5IAEA 4BKOA 3GLFB 1ML3A 4Q4HB 2ZDGA 4I50B 2PSDA 4UQOA 4Y1FA 4FISA 3JD4A 4A0FA 2CLFB 1RJ9B 1J0CA 3CF4G 3OMXA 4KBYA 4DSNA 3U40A 3BF8A 1RYBA 3NZEA 4FQ5A 4P0PB 5D00A 4D57A 4IIVA 5B5EC 3AMVA 5FUWA 3OESA 2D7DA 1FFHA 3IDSA 4MHOA 3FHZA 4WL0A 2RGRA 4BFXA 1GCOA 4TYWA 2JKZA 1NTRA 1BQEA 1ZZEA 4Q4AB 5M5WJ 2R7LA 3E1KA 1HQDA 3MCVA 4K87A 5LQUA 1KRWA 3I59A 3BMQA 3P96A 2CJPA 3FTEA 2WFZA 3L8CA 3RVSA 3I9LA 2QROA 3RANA 1Z0SA 3R20A 1BU8A 3IP8A 2OO5A 4MJXA 3QTBA 4J1TA 4AKGA 2XUJA 1G8JA 1QH0A 2IU3A 4PZUA 4BMCA 4BS9A 2WU8A 4MWTA 1NPTO 4F4JA 5LLSA 5T4HA 1TU3A 1LDNA 3AK4A 4A0RA 1XLUA 3B2NA 3O8QA 5EMMA 3QEJA 4XLAA 1MO3A 1V8OA 1NYRA 5H9WA 4BX3A 3U7HB 1ACJA 4HB3A 4XFKA 4L75A 2W57A 2OTCA 2VSQA 5AVUA 1LA2A 1U99A 1D2RA 5DWQA 5K4HA 1DCTA 3ZY6A 2Y0SA 2QYOA 1JDSA 5DNUA 1C7FA 1A9XB 2EKPA 4EQ6B 3N07A 5JDCA 2H6CA 3ZMVA 1DAOA 2J48A 4CLXA 3WX0A 1PR5A 2XRZA 2WJHA 3KHTA 4JSYA 1MBJA 5K3AA 4X1IB 2DB3A 4M3DA 2VDVE 1YZNA 8OHMA 5JC8A 4AS1A 1QYWA 2IHBA 4OYRA 1UHWA 3C1UA 3GLSA 3D4OA 5LP6C 1MAAA 2ZI6A 3PU6A 1ON1A 3JR9A 2CNBA 2BXZA 2FN8A 4TN5A 2PQ0A 5E7QA 4AUKA 3RQSA 1L9KA 3ZUGA 3I1JA 1O94D 4P7JA 3HJUA 1GA4A 4GBJA 4O3FA 2WY8Q 1RKWA 2RGXA 3G79A 1IO2A 3I56I 5CCDA 1PDOA 3AIIA 2CB9A 1Z9BA 3P5JA 3CXUA 3F97A 4GNKA 1KYZA 4XLEA 1RPZA 2NUTB 5F04A 2PVPA 1NG9A 1WY5A 2HPVA 2AXTC 1V39A 1LX6A 4V0ME 1U3GA 4UVIA 2GXQA 1AA9A 1J9ZA 2VJKA 5HMLA 3O7WA 2YJGA 4RY9A 3L05A 4I98B 2BRUA 3HP7A 4WLFA 5HJEA 3NG1A 4XD2A 3BGIA 4KR7A 1VQMI 2A57A 2HSWA 1F0PA 2MD5A 2BMJA 2ZIAA 4JLKA 5J2UA 4NHJA 2DUMA 1DOAA 2UAGA 4IJ6A 4QGBA 2AOTB 4FYPA 3IELA 3QUSA 3DE0X 3GLHE 4GSYA 4KODA 1RXVA 1T9HA 1VJDA 3EXEB 4B46A 1IVYA 4AYTA 3BQZA 1V1RA 3KWJA 2O7RA 1XZAA 5IYZF 3M1IA 1NPYA 5CLJA 1RM3A 2IU4A 1T0HB 2ZKIA 1OI4A 3IE2A 5D51S 1OOEA 1NFFA 3AGQA 3Q6MA 4OXIA 5TARA 3VC2A 1U3CA 3GJ6A 5JMTA 4LHSA 3OZTA 3BPXA 2CZCA 1LNZA 3GFQA 3IHWA 4AO8A 4HUQA 3J7AC 5FD8A 2LCQA 4KLNA 3ZZUA 4CA0A 5B53A 5JJCA 5I9MA 4IYRA 4YY3B 3I4LA 5LB2A 4RDXA 3DPUA 1HDIA 4XD7A 1DWPA 3QEMB 4UMEA 5IAKA 1SU6A 3LPAA 3ZBPA 2ETHA 1WXIA 2RN7A 3NB0A 4IZHA 3LP8A 3QOEA 1F51E 4R8RA 1NVMB 3HU1A 5JCJA 4DW8A 1WMEA 3HGGA 5GONF 4UCXA 1M1YB 3LWDA 4O4LA 1KDZA 2LIPA 3PM1A 1XZKA 1YKFA 4BXOB 3TEFA 1NR7A 4QUEA 1M6NA 2PWAA 2Q49A 3OUZA 4OWRB 3G1MA 4GRIA 2QT9A 3R6TA 4H1UA 3Q87B 3PPIA 4PZAA 1IJBA 4YXFA 1MRZA 5DGHA 2OHVA 2GHTA 3GJ5A 3FDFA 5I47A 5IMSA 1PQWA 3KP6A 3LWFA 2XUAA 2RH8A 3NHSA 2H6BA 2HA3A 4LJ8A 2X7JA 1ND6A 3CW2A 4H3SA 4LRXA 4ROTA 3ZQFA 1TMKA 3F8WA 3MJSA 2NNYA 3CCVI 1X80A 1AT1A 1GAJA 1WAMA 2JD1A 1YI8A 2Q4RA 3HRKA 2ZUEA 1N2JA 3F7MA 4WBXC 1Z6TA 5ALLA 3BJAA 5DTDA 3WGMA 4G24A 4WESA 4YEDA 4NDLA 1CRQA 3UJDA 4J4BA 1ZITA 3L8EA 2C2HA 3GNSA 4DC0A 1P7PA 2J3JA 3DH0A 3T5BA 2YN2A 1JBKA 1V8PA 4BCBA 4B3HA 3B7GA 1OIXA 2XIQA 3CO0S 4QPZA 5DXFA 5EKDA 2C2MA 4EGFA 2QLTA 4B4CA 1NQTA 2WPDD 1KORA 4EGQA 4KWTA 4L9WA 1OV6A 5D4SA 1OYVA 4QAQA 5KJ6A 5DXAA 1FFSA 3LSPA 1UBHS 2QN6A 2KI5A 3DXYA 3IPRA 1A88A 4O2BA 1MFZA 1VFNA 4JP1A 3GCMA 2GBYA 2G0TA 3BORA 1QRAA 1H2BA 1KH3A 2FEPA 4LXQA 1WZUA 3LX8A 1GPJA 4G1VA 4QTUB 2FZVA 3DWFA 4R7GA 5K99A 4UUSA 2EZ4A 5BNIA 4H18A 1ZI6A 4C0QC 1C4XA 5GTHC 1HBJA 1AZSC 1NYQA 2B9SA 5DCFA 2A86A 2GVZC 2MH2A 2OV1A 3JZDA 4ZV7A 3SR4A 3DEZA 2L01A 3SQMA 1EUDB 4A9AA 4S1TA 2VOOA 1D0SA 2I29A 4KQ1A 4C2AA 2HREA 1JKRC 2FEWB 3CKYA 4GPD1 5KNCA 3FMPB 4B40A 3HWSA 4BL5A 2AW5A 1W9MA 1SQFA 4PO1A 2UXCB 3MMNA 2MSKA 4BN0A 3IO3A 4GEKA 2P3OA 3PE4A 3EC1A 4FFWA 5EWLA 1P73A 2DDBA 2Y67A 4QPPA 1AO0A 1Z5WA 5LRRA 5HLTA 1JXMA 2YIMA 3QX7A 3UMFA 3V9AA 4H1WA 1YRHA 3H19A 3KUUA 4HT3B 1XP5A 2FN3A 1PZFA 4X1YB 2XDVA 4IHAA 1LX7A 5FWXA 3Q1LA 1FBNA 3RU9A 2PS9A 4K0KB 1Y1QA 4BMOB 4MQMA 2DY0A 2PUCA 1S8FA 1PJRA 2A3RA 4EHJA 1GQYA 2H5IA 1N2CB 4PLWA 1V8FA 4UZFA 4N6NA 1QIIA 3JWGA 3QQPA 1YB5A 2IHZA 3Q7TA 5G41A 5C0OE 1U3VA 5EMLA 2EFCB 2EBWA 2E7WA 4FU0A 2X86A 2K85A 3SZTA 4BB5A 5JCOC 2JVIA 3VVBA 3KZXA 1P2FA 1RQNA 5JWHA 4FYXA 1ZHFA 2IXFA 3CRRA 3EASA 3L04A 1CUWA 3R3YA 5F5LA 4CNBA 3PRYA 2FRHA 4YFXF 3ANTA 4EELA 1MOQA 13PKA 4CPDA 2PUJA 4R1UA 1QFYA 1YNSA 6ADHA 4EI2A 2CDCA 3JWEA 4LDRA 2WILA 2BGUA 2HF2A 3PCRB 3PFHA 4X45A 2C7QA 3OP4A 4D7NA 1GPLA 2BW0A 4TYYA 4WNIA 3E3MA 1OCZH 1JUMA 2M7BA 4CCMA 2IE8A 4PR3A 4U2CA 3JALA 4BKUA 4F11A 1P1FA 1FXUA 1LNWA 5PNTA 3HTXA 3R7AA 4X8HA 3G85A 2P6OA 5G0WA 4XRGA 1RQGA 3UMGA 4IO0A 3CO6C 3ZXXA 4BB6A 3NHPA 5CB6A 1VG8A 5FI3A 1Z6XA 3HY3A 1NMQA 3IB6A 4JR2A 2W4MA 1OBVA 2XDAA 3IALA 2H17A 4QHTA 2GMWA 3IDFA 4OHVA 4MFDA 5ADHA 4IRHA 1CPYA 3VZSA 2V7UA 2YZKA 3N8GA 1N77A 2CJWA 3QV2A 2ZWPA 1KJNA 4Q15A 4M8NE 4CM9D 1L0OC 3CZ5A 3DAOA 3BRWD 5CHEA 1NR5A 3LLSA 4HDCA 1ZIOA 3OJWA 3ZK8A 3NP9A 5LUBA 2VR1A 2XCOA 4YYZA 4NI5A 3KLNA 3DZKA 1R0BA 3LY5A 3BWDD 4G8DA 4CMKA 4D0RA 4B3RB 3ZV7A 1ZX1A 2R1VB 4IRMA 1E18A 4TMZA 1TK9A 1R50A 4O2BF 4UM9D 2IWRA 1BMQA 2AK2A 4ZTUB 5H3HA 2D3TA 3ZBTA 5K0SA 4INOA 5KYYB 2DC1A 2D0DA 4GSLA 2W22A 3ONVA 4FYKA 4M0PA 4NZ9A 4OYLA 4ZQEA 1KBOA 5AO9A 5HUHA 5JQGA 1PTKA 1JS1X 1W1WE 2DK8A 1LZLA 2EW1A 5FKJA 1Y5IA 4BO4A 4D4JA 1SQ0A 4WK0B 3OR1C 3MCAA 4F84A 5KX5F 3TLGA 2CKDA 4DQ2A 2XUZA 4MV7A 4RVNA 3VKUA 4DY6A 4EX7A 5LGTA 1G9XA 3JZIA 5DKFA 1BMTA 3NJRA 4HX5A 4UBJA 3K9LA 4RA9B 4G7OF 5TRTA 3BTJA 2VDWB 1UBTS 3GFBA 4XM0A 4ABZA 2A5JA 2O7VA 2C9OA 2IQ5A 1ZJ4A 4AUEA 4RHCA 4PLCA 5YASA 1K78B 2PLNA 3R1IA 2D5IA 5C8VA 1DGWY 3C6ZA 3E9EA 1R6TA 3G7UA 2O9JA 3MTEA 1IHXA 4J7XA 2ISQA 3MS7A 1JHXA 3JWPA 4E5PA 6REQB 2QYHA 4LZNA 2IP1A 2R7DA 1EXNA 2A9RA 3ONEA 4L3WA 5C8YB 3KQUA 3JQDA 2XVMA 2XBUA 3QWBA 4GVLA 4LRTB 4XYEA 2HF7A 2A5LA 1E59A 2COKA 4FGWA 2YRFA 4M9CA 2XQJA 4DLLA 1PL8A 3L0SA 3J81K 1IG0A 1Z4NA 3DZDA 4NBLA 5JS6A 4R8VA 2FKNA 3ZU6A 4BC1A 4YMVA 3JZAA 1L7QA 1P9NA 4LRYA 4A36A 1XZMA 3IH5A 5DJ5A 1AY0A 1HYGA 5K6AC 4BJ6C 1U1GA 2VQ6A 3EIHA 2O2DA 2O20A 5AQ1A 2Y6UA 1EX1A 3EDOA 2H4YA 4F04A 4BE2A 1OXMA 5ISMA 1TIBA 1S3FA 2P7IA 2YQ5A 2YNMC 1YCGA 1FNNA 3O8DA 3OMLA 4MK4A 1XMSA 3L5KA 3UJ9A 4B85A 4PLHA 2YVKA 3FWHA 1SUSA 5KMGB 1ZCZA 4RK6A 2M0MA 3ZQQA 3ZGLA 4ANFA 5L6LB 3KEOA 1UADA 4CM9A 1WXFA 3OZSA 4E22A 3HXMA 4MVJD 5KVQA 4DA7A 4JX4A 1TQDA 4HAIA 2L02A 4LMAA 2I4MA 1PJCA 1R8SA 1ZK8A 1VI6A 1N9ZA 3GLVA 1GUUA 1AHNA 3JU3A 3LUCA 5CJPA 5SZJA 4HDSA 3ZY4A 5LU9A 4IX7A 3UGKA 4O6JA 1ZWLA 4GDFA 1Q11A 2Q3MA 3CGWA 3DOEA 2J3EA 1P2UA 4ZEWA 1C7EA 1LK0A 3TG2A 1ODLA 1OVGA 4M8SA 2XDWA 2Z5FA 3AGPA 621PA 5BMZA 3B89A 3FBWA 4JLNA 1X3UA 4UM7A 4HCJA 3V1KA 1XU7A 2XWPA 3HKCB 5CM8B 1K5PA 1Q0TA 1E96A 3U4QA 1EFUA 1CIPA 3SM3A 4K88A 2LZ0A 2QM3A 9LDTA 3KQNA 2M2IA 4G0UA 3CUEF 4NCNA 5AYVA 1A2BA 4DC1A 2VJMA 2UU9B 3WHIA 3HKDB 1RI4A 4DDHA 5K5OA 2EBHX 3FCCA 4BL0B 5TISC 1NUHA 1SCDA 1VGRA 2BGRA 2PYIA 3BSSA 1LFPA 3BGSA 2DLDA 3L18A 3OC0A 2FMHA 4Q66C 4Q9DA 4WUTA 1G4HA 2OCLA 4XMYA 3SJMA 1GITA 4J7UA 4YMWA 3JSPA 6PFKA 2ECPA 5FTMA 3Q12A 4Q1DA 5D6NA 3TIGA 2QCOA 4JC5A 4Z7OB 4HFMA 5JUWA 2IYQA 3TRHA 5F33A 5CDHA 2O59A 1IB6A 1E5TA 2UUZA 3R7WB 4NQWB 1FZPB 2VDMB 4OOIA 1GPAA 2VRCA 1Z6AA 3DG9A 4JZKA 3RAEC 1G8PA 4M37A 1IHOA 2X22A 2YS9A 3GLXA 2I65A 1U3FA 1N7IA 3IH2A 3T7SA 4MEBA 2OCKA 2ZUWA 4B2YA 5CLQA 3X44A 5EFZA 4HDNA 1XX6A 1W0CA 3F96A 1M6VB 3HB5X 3KHSA 4DZZA 3FTFA 1XVAA 1Z5OA 1E1NA 4UREA 3ZUPA 3HOWJ 1PTJA 2OCIA 2GHIA 2YHBA 3KKOA 1XVLA 3ND8A 1C3JA 4K6HA 1O57A 5LBQA 4RZIA 4NAVA 4P7FA 3EB9A 5IF3A 1VCIA 3O8LA 1DDIA 5BSMA 2QR3A 3A11A 3Q40A 1TKAA 3QX9A 2HDNB 3G8CA 2VF2A 2DF8A 1K4MA 2H9YA 3A4VA 4KSYA 3C6YA 4KDCA 5FA5A 2BSQA 2CL7X 3EFEA 3HJGA 5EXEA 4W7IA 3RFXA 2OD7A 1EP3B 3DP9A 4RTRA 2VJNA 1NASA 1ZD2P 3O4HA 3P9NA 5C7YA 1I1QB 1BC8C 1NVTA 4UMFA 3O3CA 3KHUA 2BGCA 2I1VB 3R6LA 2JAHA 3ZHOA 1AWCA 3NGXA 2JI9A 3UOWA 5SY6A 1O5TA 2ACJA 1Z3XA 4M74A 2ECFA 4AL4A 4BNLA 1EJ0A 4PBRA 4WN3A 3TLGB 3W9BA 5H02A 1G55A 5JRDS 4B3MB 3ZHZA 5IDVA 4IWXA 1AA6A 4L4RA 5A06A 3LPLA 2P7VB 3O8OA 3UMCA 2YHIB 1ZNXA 4QDUA 4LFUA 2MSNA 4OIPF 1BA2A 4DYRA 1JHMA 3PSHA 2L42A 1B1AA 5DHSA 5H16A 4Z1MD 2O8XA 4AECA 3BMNB 2AFRA 4YRAA 4DV0B 3A1FA 2G1JA 5I3CA 4G0VA 5JZBA 3GRCA 3OKPA 3DLBA 1UHSA 5BURA 4YWHA 2HO5A 1ULYA 3GLHB 5L7YA 4DBQA 2VBFA 2EERA 4MS4B 4A15A 3LLUA 4B6PA 1KZGB 1OR7A 3E6MA 3O75A 3FCUB 1YH3A 4V0RA 4NBVA 4JI8B 3J7TA 3IRQA 4IDEA 4KRXA 3REQB 1DC3A 5FHRA 4NBTA 2V1UA 1BWQA 1U2DC 2Z2KA 1VZ2A 4AP9A 5A5DA 5KOYA 3BPSA 4EY7A 1CZHA 4BNCA 5FR1A 4XSGA 1CYEA 3RJZA 3K7EA 2YZMA 4XR6A 2HDHA 4FGUA 1US8A 2VCEA 4R0NA 4BO9A 3CCUI 2YMLA 4NCXA 1TADA 2VB6A 2UWMA 3PKIA 2DA4A 4KLAA 4P33A 3GTMJ 1A8HA 2XPWA 1PGOA 2MLGA 4Q7MB 4S24A 4ZYVA 1H9GA 2VAWA 2Q4OA 3NWSA 3GGSA 4KUGA 1UZMA 4F2PA 2M32A 4M6WB 3OFNA 4IP0A 1BXZA 1UWCA 1SBQA 2QW1A 3THYA 4J1NA 2A9QA 4H77A 1J7KA 1U0RA 4UOQA 1X1PA 3FPJA 4BU0A 3G8YA 1W7PD 4TL9A 3HIFA 3ZE8A 2Q5JA 3PX7A 1KAEA 1UOEA 5DNVA 4O4LF 4PCVA 2C9ZA 1HFJA 4DSTA 2JIPA 3ORHA 3KUCA 4WFJA 3W5JA 5ER9A 4CQJA 2X0DA 4D41A 3L6CA 1WB9A 2HW8A 3L2WA 4R01A 3OM8A 1PWZA 4G23A 4E2ZA 1TF7A 2H1RA 2CN1A 4F9FA 1KDTA 2EG5A 4F1KA 2BSAA 1N9GB 2UUOA 4ZREA 3B9BA 4HNUA 1ZUWA 1DUSA 1BA5A 1JFFA 1E9SA 1FP6A 1K4KA 1YZGA 3HFJA 4GW3A 4Q05A 4UU8A 1QFSA 3AHFA 2XCLA 1E9BA 1XGKA 2MDTA 4H0FA 1XPXA 4XONA 2QW8A 3HEAA 1KYWA 3TGNA 1VKRA 1XTBA 3OFJA 1PT8A 3SHFA 1L5ZA 3LUHA 3Q8XB 3N2ZB 2UXNA 4GZLA 3GJXC 5LDHA 2HIAA 4AU7A 1J7JA 3U4AA 1XTAA 4PJ0C 3ZYCA 2P0WA 1EGHA 4DV3B 4HQ0A 1P9LA 1GNVA 3FPAA 3H2HA 5EHQA 3RRNA 2DLNA 2DOFA 1PJAA 1Q0SA 1W5BA 3B60A 4FYMA 4FNGA 5EGSA 3RJ5A 4FX4A 5C8XA 1USKA 1XKTA 1UPCA 1M2VA 1VYHA 4J16C 4ZT5A 1W87A 4NENA 1SMYF 1TQ4A 3FYUB 5IH7A 3ZDAA 4CKWA 4H31A 1DU0A 1B0ZA 5IWCA 1AKNA 1U4SA 3H8WA 3H2IA 1JBEA 3J81A 3BK2A 4HH1A 2UVDA 4WBNB 1IULA 5L4SA 2CQQA 4D1QA 1C7IA 4AVZA 2QNRA 3C7JA 1FDTA 1QS0A 4NJMB 5HBGA 3SXJA 3WTCA 1HYBA 1CB0A 1X6VA 3AR5A 3FB4A 5BYAA 2MC3A 1UFRA 4XVRA 1QP0A 2ZSDA 1PR6A 5DOVA 3TK1A 3ADCA 1XB4A 1IDZA 2XNJA 3NX4A 1DKRA 2P0EA 5ABPA 3M1YA 1LF5A 1IXZA 2CV0A 1WCV1 3LBYA 1DX9A 1MAVA 3S70A 1YVRA 4WV3A 3BWCA 4IF4A 1EDEA 3V1MA 5HOOA 1USSA 3TIIA 3V80A 1YJCA 3UKGA 2QI9C 1LLQA 2QP3A 3BK1A 3DZCA 3LA8A 2C3MA 2CC2A 1PV1A 1Z62A 4LHYA 3C8DA 4AJ2A 4EG5A 1MH4A 3S3TA 2QNBA 2AQ8A 3TAXA 2IW3A 4JUIA 4OP2A 4QECA 1F4KA 3WVNA 1M33A 3CEMA 2A58A 5DBEX 3LY8A 5JG7A 4IJAA 3K15A 1VE6A 3NWOA 3MFKA 2WE7A 2WV7A 1R5BA 2ECQA 1CEYA 5JSFA 5K3FB 4DM7A 1O03A 4RHUA 3FX2A 3Q7SA 5EZYF 2ONCA 4UJ5A 4O6VA 1QNFA 1W7PB 3WWDA 3X2SA 3O3OB 2M87A 5AKYA 3WNZA 4DSAA 4UBOA 3E5QA 3T38A 2FZLA 1Z29A 4NL4H 4C3OB 3FPBA 1Z7UA 4ILKA 4QICA 5THKA 5GAEJ 1YZKA 4RZHA 4YLGA 4MPPA 5LA6A 4X65B 1YS6A 4O25A 4GMXA 1NM5A 4A92A 3Q15C 2JJMA 4WZAE 4AZ0B 3PQFA 1IXCA 1TJYA 3K35A 2XF8A 1XL1A 4CVNA 4ZYTA 3JRWA 4GX2A 4MTEA 4JLMA 3D8UA 2B9EA 1FYWA 2VUHB 5F1JA 1OLXB 1QANA 4Q9JA 2O52A 4XIIA 3DT8A 2JRLA 3DT6A 2K5UA 4L8FA 3NKFA 3PT9A 3NWEA 3CS3A 5HKAA 3URMA 2BI7A 4FMDB 1UBJS 5DN6D 2IKSA 4JJ6A 4YP5A 5ALZA 1J75A 2IEYA 3MTJA 1FRFS 3LKDA 5CB4B 3R6SA 1F06A 1GNQA 1CF7A 2H5JA 5KTOA 3C7KA 2OZVA 4HATA 2J3IA 3CLRD 2Z04A 2DUJA 5HP4A 1VQOI 1KPHA 2Q1SA 3DPTA 1G66A 2R7VA 2Y27A 3CVJA 2H1HA 2JCSA 1CJTC 2K4MA 5TQ0B 1R15A 3ZXYA 2QQAA 4NYJQ 3OZRA 3AV3A 3OYNA 2ZFUA 4XQ9A 5AQEA 3O8HA 2I87A 2WW8A 2VO1A 2P35A 3D3WA 4G81A 4J3JA 1DDNA 1XAIA 1JQLB 3H1BA 3CPHA 5SYMA 3RDIA 2AMYA 3N7UA 3FTPA 4C0KA 2EFQA 1QMGA 2QRQA 2F4IA 2JZYA 1KYXA 3VKFA 5BN1A 1NQVA 4C2TA 3EHEA 4CMJA 3GBSA 1TWGJ 5DHFA 4DDMA 2UDPA 3DAHA 5FO1A 2ZWIA 2Q5EA 3WGNA 3ZD9A 5F9FA 3JWIA 1RRJA 1LEHA 2KRCA 5K3CA 3OZIA 1A31A 3FWYA 1AD2A 4G5XA 5T8KA 2PRJA 1QFXA 2L3DA 3C2HA 2C9YA 3KJNA 5L3BA 1T5DX 2EJUA 4C30A 3D5SC 4D8UA 5JHHB 3F0TA 5EWJA 2RC5A 4AM8A 1AKHA 2DAOA 1E2JA 2HA4A 4XWOA 3V7YA 1BDHA 2Q2EB 3V2GA 4JI4B 5K3OA 1CIVA 2FJ1A 1GPMA 3RAJA 2GK6A 1R58A 5IC4A 1Z3IX 2EJWA 3STUA 1J0RA 3EYWA 3AUXA 3QFRA 5LXTB 2F2EA 2WSSD 4BNNA 1NN3A 2OE2A 2LOOA 1L7VC 4P54A 4PGGA 3RUIA 4KDRA 3HSKA 3NRVA 4QG7A 1GV0A 1DQNA 3A06A 3FAKA 4MW7A 3ZW7A 3C3PA 1E3SA 2B6NA 2M5WA 3DDZX 4FGZA 2V4UA 1Z77A 4HGQA 3E1SA 2EEZA 2QAJA 221PA 1OLXA 3I2FA 1CLUA 1LTHR 3PLNA 4LX0A 1P81A 2VJLA 3P19A 4RXTA 3L02A 2EFOA 1H6BA 4CI9A 3OO1A 1LLCA 3KETA 4RH3A 2HQSA 3TW4A 3QU3A 1RC8A 1L5QA 5EJIA 4JT2A 3HRHA 4TSFD 1ZIXA 2E37A 2N75A 3L8ZA 4IV8A 4IOAF 1IUKA 1XZQA 4DLAA 1QGUB 2Q6LA 1NYTA 2QRLA 3HQ4O 3ILYA 4L0CA 1XZJA 5AW4A 3MMSA 1P6QA 1LZKA 4KWEA 4EA9A 1W5EA 4XLZA 4FOLA 2BVNA 3MF4A 4C3VA 2XLCA 1VFCA 3HWWA 2RJNA 2Q45A 1KMMA 3FOWA 4JU8A 4LYYA 1Y89A 4U5QA 3MOIA 3QRFF 2G8NA 1ZSVA 3S0JA 2Q6OA 4C1BA 2JDIA 2BFCB 4HDKB 1U5AA 1M8FA 3O26A 4NECA 1Q0UA 3TQOA 1I30A 3HCWA 1PGNA 1PD0A 2A84A 3MHTA 1X13A 1EU1A 3N2IA 3OE4A 1MIOB 3TP3A 2X76A 4CGYA 1KDOA 1Y4ZA 3PTZA 3KUDA 5A4KA 5JD3A 4BNIA 3BRWA 5CD9A 3P9IA 3DAPA 3I73A 5HIIA 1UH5A 3DOJA 3F78A 4FNAA 4W8GA 5BYBA 3UW1A 1SCIA 2VDLB 1FDOA 2WJJA 2XT6A 1VQKI 4IXWA 1QH8B 1XK6A 4A5NA 4ZVTA 5IVPA 5JD5A 1AMNA 3DKVA 5KYGA 4GVPA 3UV6A 4TZKA 5F1RA 2BTOA 2DHRA 4JMPA 1FW6A 1GTVA 4E7OA 1OFUA 1JHDA 3JATB 2WJPA 3RR2A 1KGDA 4LQCA 1ZR4A 1Z47A 2GZAA 3EQ9A 3MJDA 4QC2A 1ISJA 2PZFA 5ED4A 2BY4A 1IHUA 4NZYA 4L16A 4Y1EA 4R7TA 3FMIA 1APBA 4JLPA 5KTTA 5TGTA 1CYDA 5EE0A 2ZYTX 4UV8A 1M1ZA 2QTLA 1P31A 2KS6A 1YULA 3AIMA 2LDXA 2KPMA 5I4IA 1QHSA 1TZLA 4IIFA 3WSVA 4QM7A 4M21A 5B1AH 4DJFC 2Q1ZB 1N34B 3KSUA 4PTZA 3H1AA 1N3LA 4JLOA 5EIBC 5HDQA 5I7EA 4QIWN 3UK0A 2GQQA 2H2DA 2PKEA 2E5FA 1PKEA 2R2GA 2RHBA 3ZS8A 4M8IA 5IF9A 4YAKA 1E89A 3TUIC 2I6TA 4ENSA 2DWUA 2WIGA 3QW4B 2K86A 4NQZA 5BW8A 1LTKA 1N0WA 1FIPA 4FQGA 3KAKA 1PVDA 2R1VA 3HUFA 3B6AA 4F7ZA 1VL2A 1GG8A 1R10A 2A9JA 2SICE 3R4VA 3ZWXA 1LUAA 3AZPA 3UAYA 4BRWA 2DZDA 2R1TB 1SXJE 2E48A 2RCNA 4OUDA 3T5CA 3U9LA 1X1CA 3U1TA 1TQ6A 2J0SA 3VU9A 5DYGA 4V2UA 4RIGA 5KSWB 2W6CX 2O5CA 1X7WA 3HVKA 2ST1A 2LBFA 2LKCA 1UJ2A 4LY0A 1XKQA 5JJBA 5L53A 4PSWA 1PHRA 1NV9A 4FFNA 4Y98A 2J85A 4AAYA 1UP6A 1XCGB 1MUUA 2E82A 3IE1A 4LVCA 4UBNA 2JDID 1XGSA 1UBEA 4GM0A 5FA8A 2QX8A 1W29A 3DU5A 3ZN1A 3AAFA 4MI6A 2RHWA 4QOJA 3OZCA 4H59A 4U4AA 3MUEA 2WJWA 4BV2A 3OEHA 5HK8A 1C1XA 2Q6KA 3F73A 3K05A 3AM4A 1ABFA 2WFAA 3A3OA 2C2OA 2OK8A 4IIJB 5HZGA 1WMBA 1DPFA 3CRVA 5KVCA 1LJ8A 5GJVC 3KQKA 4A2QA 2VNHA 1QQ6A 1Q83A 3DVQX 1F5TA 2XCUA 3H3VK 2IT0A 2OM6A 1MKMA 5FFNA 4KLRA 5ALUA 3K6GA 1KEZA 1H3FA 1QPIA 1G6HA 1UAGA 3AO0B 3BKWA 3HL4A 2GYWA 4CZZA 4HWOA 4KFUA 4HAVA 3M07A 5AM5A 4C9BA 1HORA 4E7PA 1B76A 1SC3A 3KQLA 2WD7B 3PWKA 1JZTA 1Z05A 5FB3A 3ZLVA 5L3RA 4IDAA 1KIFA 1F14A 1NT2A 2UZ1B 3IIKA 4EZBA 1C7JA 2L82A 2WPDA 3MCWA 3AC0A 1RFGE 3RE1A 5K2MA 1KGSA 2JLCA 1DIBA 3KJXA 3AW9A 1QKKA 1OB2A 4G8XA 1W5SA 3GVAA 2GK4A 2R48A 4IDQA 4TLBA 3VR5H 1LJ9A 3ZQKA 1TQMA 2QVOA 4ASUD 2QW0X 4F4FA 2FWPA 2AG8A 1OUMA 3GUHA 3OLYA 4RDHA 2O8CB 1GGFA 5L4LA 3PR2B 1DU6A 3HPGA 4QODA 2HPHA 3I1YA 2B37A 4Q01A 3U7EB 2ETVA 5FBWB 1Q7CA 4G41A 4I1IA 1L4GA 1GR1A 4RTNA 1ZLXA 2DH6A 2QRPA 2BBTA 1KY4A 2VTDA 3FMSA 2IY7A 3ABQB 2B4AA 1F4LA 4HX9A 2G80A 4TWBA 2HQOA 1NE7A 1KO1A 1GDHA 4R6WA 3HOXJ 3RSGA 1I2AA 1RESA 2BXYA 1ZOIA 1D1TA 1KO5A 3NUZA 3SAJA 3UN1A 3USZA 5EF6A 1ZAKA 1ZKDA 2GEJA 4EGSA 3SWWA 1SXPA 3PEVA 2VEDA 2FLWA 3IDQA 1MVOA 2OBYA 4QASA 2DQ4A 4URHA 4D0LB 4DM3A 2QSGX 5DLYA 3G1OA 3IGFA 3MINB 1Z0XA 1ULZA 3ET5A 3R40A 1N5LA 3L79A 4K9NA 5JSQA 2PS3A 1FE8A 3CX7A 3Q5GA 4YFYA 3ROKA 4AX8A 3M9AA 1A50B 4XGRA 1PGPA 1IVNA 4HUTA 3VAYA 4MEYF 3VDQA 2E1CA 4AMUA 3S1NJ 3CKMA 3JQ9C 5HCNA 3MN1A 4OMFG 4MUJA 1JNXX 1PHPA 2X9NA 5DNEA 5DWVA 3RVLA 5I48A 1HE1C 3ZQLA 1FTQA 1FSPA 1Z8NA 1EIZA 1KVTA 4LWQA 4R54A 4D8YA 1XZBA 2ONZA 2QT1A 1DI0A 3HXKA 4MIMA 1NBHA 1FX0A 2ZJ1A 4LHWA 3FJ1A 4G5GA 3QEAZ 2QN9A 1BH2A 4UBMA 5A62A 3FR8A 1Q0ZA 4HX8A 2AVNA 2D1QA 2JIOA 4J4TA 1SU4A 3WWEA 2IZ1A 3ZWBA 1EFDN 4ZZ2A 4LYDA 1IV8A 3V55A 5H6QA 5EXDA 4CV3A 2PI0A 4EF4A 2XODA 4HH0A 1K5GA 4YIHA 2HPAA 5D87A 1L5NA 1FZTA 4P5EA 3PJDA 3SSNA 4DA6A 4R9SA 3WNQA 1SCUB 3EDMA 1HNWB 3HBNA 4ESHA 3E7WA 1V16B 5AUPB 4HTAA 2ZI4A 3ULKA 2P8SA 1EP2B 2X7HA 2J0QA 1LV7A 3KQWA 1C0EA 4DWVA 2GJAA 2I22A 2WYUA 5A0VA 3CCBA 2QM8A 1G3WA 4OI0A 1F0YA 3FWZA 1GZHB 3B3QA 1KAQA 1HG0A 4N54A 1L7AA 1EUCB 2BRUC 2ZRGA 5C1BA 1T9AA 1ZPDA 2QSHX 1I51A 3AOEC 2HSEA 2C42A 3BH0A 1DBPA 3N5CA 2D5CA 1K9VF 1P61B 1CUIA 3OURA 4H6WA 4U0KA 3T3HA 1XRLA 2G70A 4R1HA 1GRNA 3DTEA 4GP7A 4L0MA 4RQBA 4BNGA 4NZNA 3BFJA 5CX1B 5BMVB 5KOIA 4WTOA 4CEHA 2F17A 1C5KA 4AURA 5JSYA 1YE9A 1CULC 2FPIB 3F6BX 4Z8YA 4C0AC 2TRTA 3IP7A 4A3BJ 4B5KA 1BFKA 1TNTA 2N0SA 1JR4A 2N8GA 2FWJA 5KAIC 1BEUB 2NO0A 4TWAA 5IHPA 4IINA 4EGCB 4PAOA 3ZW8A 1WJFA 2Q6IA 3GTPJ 1ZWKA 4CLDA 2GPWA 4B6SA 5K20A 3E81A 1BIBA 2ZJ2A 1W0JA 1P5FA 2EATA 3PNMA 1RWQA 1W2GA 3EXHA 3S3MA 3O4VA 4HQRA 1Z4KA 2FPWA 5L3QB 1GNTA 4X0GA 1JHOA 2IH4A 1O95A 1YIAA 2ZSUA 4C03A 4KX3A 3ZU4A 3IWFA 1FOWA 1UJ5A 9ATCA 1ULSA 3T0GA 1PR3A 4UHDA 3FYUA 4KQIA 4QXQA 4US0R 2J33A 4G9EA 2P40A 3UAVA 3VR1A 2EL7A 2V6GA 4CKCA 3FI0A 1D5CA 5CBPA 5L7TA 3CUWA 2QTVB 3FOEC 1BOOA 2CLDX 2Z4SA 3GYGA 2C4NA 4IGFA 2DOAA 1MJ5A 4KH1A 1KI1A 5DTRA 2QZ8A 2I78A 3WFIA 2NNNA 1XJCA 2WAAA 2GM5A 1ULHA 2XC7A 2JAUA 4HRVA 5FCDA 2C78A 4Z9YA 3VI3B 4AYWA 3A8TA 2FMYA 2JHPA 2MC4A 1G6Q1 3GEDA 3AETA 3I4MJ 1CUHA 1W6RA 1RS0A