4E70A

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
359
Chain Sequence
b'MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPVLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 128
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4e70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4e70A02
2Q0OA 2UYCA 5FLXZ 1IRFA 2FMLA 4AIKA 2NS0A 4R79A 4ZZDA 4BNCA 4WXCA 1J59A 2PXXA 2E7WA 3LKZA 1W7PA 4RSRA 4YMHA 2EFQA 3ORHA 3KLOA 4HQEA 4IV0A 2EJUA 5LSAA 3N4MA 2PG4A 2EFPA 4JQFA 4ASNA 2C7PA 3E6MA 2ADMA 5LLQA 1KA8A 1LVAA 1D3YA 3RKYA 1EG2A 3CUQA 1S29A 4RTKA 3RIEA 4RB0A 3VYWA 2LKPA 1YW8A 3I71A 3HTXA 2OZUA 2NYUA 4GC9A 5CVIA 2QUFA 1H1DA 1F38A 5LQUA 2CFXA 5LQAA 5KYGA 4HZFA 4RGSA 1F3LA 1KPGA 2PY6A 4PONA 3REOA 3X0DA 2QRVA 4M71A 4IRIA 2NNYA 2VE8A 5D1NA 3E5XA 3SFZA 5DXJA 3DTNA 3EYYA 2ZKZA 1YB2A 1JG3A 1FBUA 4EM0B 3AJDA 2VZ9A 2IH4A 5KQSA 3MB5A 2YX7A 3HCAA 2K4BA 3IWFA 2MH2A 3EMDA 4HH4A 4RGRA 5P8WA 4KDCA 1I4WA 4EQQA 5FB2A 2N47A 4MGRA 4MHTA 3EPPA 2BEOA 3P9CA 1UWVA 3RI4A 4U0YA 1FLIA 1CGPA 1VLMA 1FYKA 1G55A 1F9NA 4MEYF 4U88A 3GRVA 5DM0A 1VPTA 4QDKA 2ISYA 3LBFA 3QPTA 4AZVA 3BZBA 2ZTHA 5CYVA 5CJ9A 3Q9SA 1L3CA 3ML6A 4HSGA 3MHTA 1G3TA 2FA5A 1BI0A 4DQ0A 3UJDA 1NT2A 1Z1DA 4C05A 1SUIA 2G7HA 2YSRA 4LLGF 3EGVA 4RVGA 5MHTA 3SXJA 3K0LA 2DPDA 5EG5A 3BXOA 2JRTA 3WE3A 4I0AA 1I9GA 2P3QA 2FOKA 1YW9A 2AS0A 4UV8A 2FBIA 3KCCA 1DL5A 3DOUA 4FP9A 2QZ8A 5J8FA 1BIAA 1DPUA 2O0LA 3TOSA 2FXAA 1L3BA 2IA0A 3BKWA 4MWZA 2ZMEA 5CIYA 3KPUA 2EFJA 2O05A 3BKXA 5EGSA 5BOXA 2WA1A 4XUCA 3OZTA 2CG4A 3TO7A 2CO5A 2AXLA 2VXZA 4DQ2A 2XRNA 1H9GA 1STZA 3P7NA 2PJPA 1PUEE 5FA5A 2DPUA 2O3FA 4KN4X 5TRDA 3TKYA 5KQRA 3KR0A 4OMZA 9MHTA 4YFNF 3EGEA 3QOXA 4LG1A 3ME5A 4QVKA 1BC7C 3FUTA 4A5NA 3OU6A 1TQPA 3B89A 5E1MA 2O06A 4OINF 3ELYA 5IH3A 2GZWA 1KP9A 3NWBA 2XYVA 4KVZA 1ORHA 4OIPF 3FRHA 2Z6QA 2BM8A 3BWYA 3FUUA 4CZZA 4PGHA 4ZYEA 2YXDA 1RJDA 3V8LA 3I58A 10MHA 3ID6C 4DMGA 2F5CA 1R22A 4L9JA 3MGGA 2PEXA 4KMUX 2OQRA 5CCBA 2EA4A 3F23A 1T6SA 3M6UA 2BV6A 2ORED 3I9FA 2OBPA 1NHAA 1P6RA 3HCFA 1BJAA 5DXAA 3OE4A 1S7AA 2JZYA 2XASA 2ZFWA 4GOMD 3NJRA 2JH9A 3FYCA 4L0ZB 4KNYA 2ZNZA 1P39A 3PLAE 2NXJA 2I7CA 3NEUA 4R1HA 2CWWA 2V7EA 4WWCA 4UHTA 2PX4A 3O2PE 4CKBA 4EJUA 5HLIA 4CGZA 3HHGA 5D8LB 3SVZA 4P96A 3JSPA 3ANXA 1HMYA 4RB3C 2V1XA 1ZARA 3Q7EA 2HKOA 5LHIA 4LWPA 3MQ2A 3WGHA 2G1PA 1H0MA 4FGZA 2EA2A 3AXTA 2ZCJA 1MJ9A 3QPHA 2HWKA 5LGNA 2TDXA 4BXUA 4LK0F 2XGXA 2XHKA 3WGIA 4KIBA 2PWYA 4G6DA 3TDZC 3GNLA 1QQIA 1G4DA 5LQKA 4WXHA 1BI3A 3WTWC 3EVGA 2GA2A 5BXYA 1G3SA 5E20A 3O6BB 3LA2A 1USSA 4PINA 5HIJA 2V74B 2DT5A 1O9GA 3IL2A 1RI3A 1XVAA 2ZBQA 5EMMA 2RN7A 3TO9A 1XSVA 3NTVA 4PZJA 1NE2A 1EJ0A 2FBKA 4HGYA 3SGLA 3UA3A 2EG5A 1J0RA 3K69A 3PS9A 1SD6A 4M9XA 5A2QK 1QBJA 3R0AA 3F72A 2HS5A 2QYOA 5JFRA 2QWWA 3FPGA 4GCVA 2Y75A 2NP6A 3I54A 1QZYA 1XMAA 3EQLF 2PJDA 2FRXA 2DULA 3I53A 3OZRA 5DD8A 4F86A 2MH9A 4A5MA 3GGDA 3T0IA 4BH9A 2IGTA 1P2FA 2PQ8A 1FC3A 1KR5A 1B42A 1EV7A 2NAZA 5L3EA 2KIMA 1GXQA 3MWMA 3JTGA 2ZZMA 2G9WA 4IJAA 1XXLA 5D4RA 4KT5C 4IRGA 2EFOA 5EMJA 3T8TA 1ZG5A 1J7KA 4HDUA 3BPXA 3RJPA 5F2NA 2KJBA 2W25A 3FMQA 2ZULA 5BW5A 2I9KA 1YS7A 3QAHA 3M33A 2DW4A 3DXXA 1OKRA 2B0LA 4PYQA 3WG9A 1R7JA 3G2PA 4YV2A 3B3GA 1HW1A 3FM3A 3J80K 3THSA 4PCLA 5KK1A 5D8KB 3LBYA 4F84A 2C7RA 3P2KA 3LSTA 3F8BA 1L9KA 3RDIA 2C7QA 1XGOA 1YIOA 4M6XA 3WSTA 4E2XA 2ZLBA 4CICA 1MJAA 1F1ZA 5BPIA 2ZSUA 2FE3A 3BGIA 1RI2A 3LPMA 3DQVC 1TQIA 1ZG3A 1BC8C 1BHJA 2OZVA 4C08A 2R7FA 3SQNA 3DF8A 4HV5A 3BOQA 3VC2A 2KJCA 4O5VA 5DX1A 2HWVA 3WTUC 2PFBA 3VB2A 4R8SA 4XUEA 2V9VA 2FHPA 3KE2A 3FRIA 1B1BA 3V7RA 1T2KA 1U8RA 4MTDA 3C7JA 5CCXA 1UCRA 5LQNA 2K27A 1JG2A 1J5YA 4O29A 5CM2Z 4IWNA 4U0WA 3J81K 3W6JB 1ZLJA 5FWDA 1P1CA 3GCZA 3L8DA 3IC7A 3BUSA 2H6BA 1NBHA 3E23A 1VIDA 3KQYA 3FXRA 5EKXA 2OAZA 3K1MA 5E8GA 3IWZA 3JW4A 4KFCA 4YUZA 1SMYF 4QPPA 3A26A 4Q47A 3V8KA 3C6KA 2VODA 2HYGD 3F21A 2A61A 4L5JA 3CO6C 4DNCA 4XCXA 2P5LC 3R9XB 4L18B 3FHZA 3BGVA 1FY7A 5FADA 2QRVB 3LCCA 5LRSA 4OBXA 3DLCA 1JTFA 2UXXA 3MZYA 3IYLW 1XN7A 2AZTA 3KQQA 3R6TA 3RYRA 2C6YA 3DUWA 2YX4A 4A0XA 1VBFA 3S2WA 4AZSA 4M9ZA 4RTQA 3PFGA 2OD5A 2VC1A 4ER6A 4GO1A 3V7CA 4WCGA 3KQTA 2OYRA 4CXMA 4YUVA 2VBZA 4NECA 2PBIA 4C4AA 1EH7A 2DQRA 4KUMA 1MKMA 1X19A 3KR2A 5FQOA 2V1UA 1RZ4A 3LAPA 2PI0A 5LEJA 3B7PA 2RKHA 3UFBA 4POOA 2F5FA 3JTHA 2O0YA 4I02A 2PGXA 4IV8A 3DKWA 2YXEA 5LEKA 1RI4A 1RJFA 2A6EF 3FMSA 5FCDA 2RQPA 3C3PA 5E8IA 3LX6A 4ER5A 3NWEA 4GC5A 5JR3A 3WTZA 2B3TA 1W5TA 2CGPA 1V39A 2F8LA 3FUWA 1QANA 1DUXC 1XD7A 1LDJA 3LGAA 4FX0A 4PCQA 3EVAA 1KU3A 1EJ6A 4GUAA 5DSTA 2F2EA 4KN7X 2A07F 3HHHA 1KQ9A 1WSUA 2JG3A 1JQEA 5GIPE 4MNUA 1XJ5A 2ZMEB 1G6NA 1IXSB 1YFHA 4IKPA 1ZN2A 4RTPA 1XCVA 2YU3A 1KU2A 1R1VA 2R7DA 1NV9A 4X60A 2EWNA 2JHAA 3M8FA 1FOKA 4B09A 1T43A 4GYIA 2L3DA 4RYLA 4LLLA 4QLCU 3FTCA 2P5KA 1SQFA 2E1NA 2CKDA 2Z9OA 8MHTA 4AZTA 2FK7A 1KIAA 2NXEA 4HW0A 3Q5FA 2IP2A 2B2CA 4L7VA 4PYKA 2XYQA 3HA7A 1VP3A 2VN2A 5L3DA 4GOOD 2PKWA 4ENMA 3EVCA 3KQOA 3TQNA 3DULA 2RNJA 3GUDA 2HOEA 4OOIA 1TW2A 3LAJA 5DM4A 3UA4A 2OB2A 3ZN1A 1PP7U 1K78B 3ELKA 1O9HA 3GRZA 1Y8CA 4MTLA 4Q48A 1RI5A 4DZRA 1QPMA 1EH8A 1Z7UA 1HW2A 2HFHA 2DO7A 2P4WA 2KW5A 2UYQA 1NW7A 3T1BA 3U2RA 5E1OA 4P9UA 1U6GA 3FUXA 3U1DA 5HLGA 1YZ3A 5F2KA 3QOPA 2YVLA 3H92A 2XVAA 2NXCA 2K86A 4WXDA 1ORIA 4AVPA 1FT9A 2CL5A 4QQKA 5ICGA 1YZHA 2ONZA 4A2UA 5DWQA 5DCFA 4RGUA 1ZGJA 3QU6A 3JSOA 1IF1A 4EVIA 1K6OA 3KP3A 1N2XA 1QZZA 1XCBA 1XB4A 2VT2A 5IT9K 2FU4A 2J5OA 4ZH4F 1IRGA 3G5TA 4CTJA 5D5XB 2AVNA 3F8CA 3ZP5A 1U5TA 4IHTA 4HG2A 3MCZA 3NDJA 4NQWA 5HIKA 2IPXA 4Q5SF 3IRRA 1U3EM 4V0QA 5HVQC 4ENKA 1IN4A 4ZYHA 1ZH5A 5C9ZA 4E31A 4BHBA 2AN4A 3R0QA 3K6RA 4GBED 3DPLC 1JTEA 1IXRC 1B9NA 5E1BA 5HDKA 2H09A 3C18A 1AV6A 5K05A 3OV8A 1JGSA 4JK1X 1W7PD 1SUSA 3ECHA 1YS6A 2MC3A 1C0WA 3MERA 3P2IA 3E7PA 4XLNF 3V8VA 3GEZA 3MQ0A 4PYLA 3DXZA 2HTJA 2ZJ2A 5EEGA 3SHFA 5C0OE 3T8RA 3ZPLA 1SD7A 1YF3A 4PYNA 4PCAA 3H3UA 2IVMA 4PYMA 1P92A 5L3GA 3HRMA 4P5OA 1NW5A 5EC8A 1S8NA 1MJBA 4KMFA 1G6Q1 2IDKA 2NXNA 3GRUA 2H94A 2Q8KA 1XGMA 3CJNA 2ZW9A 3KQSA 4XSXF 2QQAA 1WG8A 2IH5A 1TLHB 4OBWA 2DBBA 2L01A 2LDUA 3U9GA 2VDWA 1UFKA 5E1WA 1BOAA 4ZYGA 4ZTBA 3EYIA 3O31A 4L9TA 1LQ1A 2H1RA 5HEKA 2BR4A 1NW3A 1MDMA 1R23A 3I5UA 3KU1A 4RV9A 3R61A 5HOOA 4MQ4A 4EJOA 3WU0A 2AOXA 2CWEA 3KQWA 5ERGB 1V4RA 3P9IA 3ZMZA 2MBFA 3ER8A 3SXYA 3SZTA 4I2OA 3LA3A 4G7HF 2V1DA 3ERCA 4U7TB 1PDNC 1ON2A 4WK8F 3L09A 2JSCA 5C1IA 3UJAA 5GM2A 2VDUE 3ISPA 1TW3A 1RI1A 3DMGA 2PN6A 3CC8A 4WX9A 2EX4A 4EJTA 3E3VA 1YO5C 3F8FA 3B5IA 1M6EX 2XBMA 4HA8A 3G88A 2DLLA 1X1DA 4UVAA 4DCMA 3F6OA 2NP7A 4QWQA 2UWMA 1RUNA 1T98A 2FNPA 5DDGA 3JAMK 5CVRA 3TQSA 5BMZA 1FNNA 4R8RA 3HSEA 4XSZF 1WZNA 2RV8A 1XDUA 1IN8A 5DEQA 3OOPA 4Y13A 3KP2A 1KHHA 5LRRA 2W85A 1W4MA 3JWIA 1EIZA 2HGCA 4E32A 3GW2A 1K78A 3T5XA 4RAYA 2WA2A 5K8VA 3I4PA 4GF5A 4ZYDA 3CJRA 1WKMA 3HVJA 2HMYB 3A7DA 3B3JA 2AOWA 4FS8A 5LHHA 3G3ZA 2WWYA 3RYPA 3P9KA 3RIRA 5L3FA 1VE3A 5FHRA 2H6CA 3RPQA 4PYOA 4RX1A 2HV9A 2E5WA 1R8XA 1I1NA 2ZVJA 3SSOA 1HQCA 4P7FA 5EHIA 4GEKA 4M73A 1DP7P 3GO5A 2X0LA 3CDHA 1QAQA 1TNTA 3TKAA 4DCGA 3FPJA 1IN6A 3ERED 1F5TA 3ZMSA 3E6DA 2ZFUA 4P7GA 1YG2A 5LGUA 4EKGA 3HOTA 2UYOA 3M6VA 5JI6A 3CUOA 3EVZA 3KHKA 1VTNC 1KYWA 5E8RA 4RTLA 1S7OA 1A04A 3AWIA 4G9YA 3WTVC 2D45A 1X1CA 2M30A 1X3UA 2XUBA 4UUVA 2ERCA 4XRFA 2JHPA 3FWEA 3I0TA 1KU7A 3FXUA 4PYIA 5CVDA 2MLKA 1R18A 4GOND 2DU9A 3E5QA 2P5VA 4EM1A 5H20A 4JXJA 5K0GA 5KVRA 3FX3A 5K0FA 2XVMA 3P9NA 1JSZA 2Z6AA 5A2QZ 3FTFA 5JUWA 2VOPA 1U5TC 2AS5F 5ILSA 2XAHA 5E2AA 3HVHA 3C0KA 2DFIA 2M1BA 2ZBRA 5EZQA 4H0NA 5D5VB 1L3LA 1NKVA 1JR4A 1HXDA 1T38A 5FFXA 1HKSA 3G89A 2EV5A 5HOQA 4KIGA 2K02A 3FYDA 3V4GA 1D2CA 5HILA 2P7CB 1YW7A 1PJZA 4S04A 2NNNA 5HS7A 3WODF 1Z05A 1R58A 4HC4A 2Q41A 3WGGA 2GQQA 1REPC 2AR0A 2P6SA 3R0JA 3IRQA 2A6HF 3OCJA 2UYHA 4AZWA 2FSWA 3C3YA 3SMQA 4I09A 2R6ZA 4A0YA 2QQ9A 3FF5A 1F4KA 4UNOA 2CMGA 4YUYA 3B02A 3P8ZA 3TM5A 2ZIFA 2FNAA 5E9QA 3HSRA 2Y1XA 5EMLA 5DX0A 3UJ7A 1ZKDA 4FSDA 4V0RA 5K5RA 3M6XA 1B9MA 1T0FA 2BYVE 3J80Z 3IHTA 5FULA 2IBTA 3GRRA 1FSHA 1KPHA 2FF4A 4RVDA 3TOAA 1FJXA 4LK1F 4LG0A 4AWXB 2HTSA 4M72A 2BGCA 5G02A 2XROA 4KW7A 4OIRF 1J75A 3BPVA 3DR5A 2IDJA 4FT2A 1N7JA 2M5WA 3TDUC 5DUKA 1BM9A 1FX7A 2JTVA 2OU2A 3FMRA 2ESNA 3ZMUA 4CKEA 1GXPA 2G8NA 3DEUA 3GRYA 3KP7A 3ROUA 2HTEA 1T39A 1SVUA 4M9SA 2YTZA 3K0BA 3CLOA 2W84A 4C04A 5U4XA 5F2OA 4JBAA 3T7RA 4RVHA 2PT6A 4EV0A 4ENNA 5D6EA 5DX8A 5T67A 3TFWA 2CYYA 3M6WA 3ECOA 1BN5A 2JPCA 2ADUA 3KR9A 2IA2A 1Q0SA 1I27A 3RODA 1K7AA 1P91A 2W24A 1BKYA 4LMYA 1GVJA 3O7WA 2COMA 3P97A 2BR5A 5LR6A 1FYLA 3EMBA 1Z9CA 4TV7A 3MAJA 2GH1A 3LFKA 4BLUA 4WVLA 1G8SA 4RTRA 3UJBA 4E2WA 2PV0A 2L54A 5JVTA 2XAFA 4OQEA 2DTRA 3QV2A 4L9VA 3CVOA 2O61A 3HTUA 2O8XA 4G8XA 4QVGA 5FFZA 4N0BA 5DCMA 4M74A 3TGNA 2EK5A 3V97A 2AOUA 2ACJA 1U5TB 2QENA 1HKTA 3NW9A 5E17F 5EIWA 1ODDA 3C3WA 3ABTA 1R6AA 4DM3A 1FBQA 3EUHA 4WF2A 5BW4A 4L9NA 2HZTA 4NB5A 2RDPA 3HVKA 1FWZA 3HYIA 5HS9A 4OA8A 1Z3CA 1SAXA 4X1OA 2P41A 4GOLD 4DA4A 3ZMTA 1FP2A 1NV8A 5K0BA 2LF8A 3LCUA 5GWXA 2FEZA 3RW9A 4YFKF 5GP1A 2QLZA 4CWAA 2EV0A 3HM2A 1ZRCA 1P4WA 4K6MA 1G3YA 3SX0A 1AOYA 2BE5F 4KIFA 4G7ZF 3WTXC 1UB9A 4OQDA 1O3SA 2RVCA 5LHGA 2IH2A 2DK5A 1SFUA 4Y2HA 1R00A 4E33A 4M38A 2B25A 4IRHA 2AN3A 1M0EA 2Z5UA 2AOTA 5TJJA 2A5YB 1G60A 5BQTA 3PT9A 2JPBA 3ZMVA 2F5EA 3KQPA 4AX8A 5HLHA 3LDUA 1INLA 3VODA 2IFTA 3F8MA 2G71A 4HLYA 1OYYA 4X61A 1G8AA 1EAMA 3GF2A 2PBFA 3KR1A 1ONVA 1CF7B 1R5GA 1LJ9A 3NDIA 1R8YA 3UBTA 3BJAA 2OPBA 1U78A 3OU7A 2EB7A 3E97A 4G56A 5F6FA 1MDMB 1D2GA 1P4XA 4M36A 4X63A 1BBYA 2XAJA 1I1GA 2M8EA 2E1CA 1OPCA 4PNEA 3M8EA 3UJ6A 1MZBA 3ER9A 3GFLA 3EETA 5D5UB 2YXLA 3IHUA 3M4XA 6PAXA 1XDSA 3HIFA 2PLYA 4MIKA 1FP1D 3R24A 2OBFA 5EKUA 5E8JA 2LNBA 3QU3A 2IIPA 3HRSA 2P7IA 1SMTA 1XCLA 3MCTA 4OU0A 2DQLA 3KEOA 2HEOA 4ON0A 7MHTA 2A3SA 1DDNA 3PX3A 1DPRA 1D8KA 1FYMA 1TQMA 2EFWA 3S68A 1G38A 5ICFA 5E1ZB 1IUYA 3OE5A 2Z33A 3BWBA 2HR3A 2XYRA 3DP7A 3OZSA 4HYEA 3RPUA 2Q2EA 1XSDA 2J5PA 2PLWA 4E2ZA 4UV9A 3QOWA 3HNRA 1JE8A 2P8TA 3V7SA 4F7ZA 4GXOA 1IXCA 2WV0A 2OA4A 1GHCA 4P7JA 3G2OA 4HTFA 4BLVA 4FHTA 3PFHA 4ATNA 5HFJA 2JJQA 3KP4A 5IT9Z 1SKMA 5LGTA 1N7IA 3D2LA 4RVFA 2DAOA 4RS8A 4EM2A 1PP8F 5J8CA 2ZCWA 3A4TA 3PX2A 3LL7A 2LD4A 3OFJA 3FTEA 5ED4A 1X1AA 1MGTA 5DRTA 1XMKA 2XIGA 1ZYRF 4YIIA 5ICCA 2I6GA 3CBGA 5K0LA 3G2QA 1HNNA 2ONYA 2Y48A 5AONA 3GO4A 2KRFA 2PWPA 4UOEA 1EQAA 4GGGA 3MZHA 4RAZA 3MEXA 3JWGA 4MQVA 3FPFA 1KQ8A 4BLWA 1V3FA 5H6RA 3ZQ7A 1SG9A 2ZIGA 1ZAOA 2GA1A 5M5BA 3KZYA 3EEYA 5EHGA 1KXZA 4N9HA 1TPYA 2DPMA 1UHWA 2ESHA 4F85A 3TRKA 4LWOA 2VBYA 4LFUA 1Z6RA 5FTWA 3R4KA 1Q0TA 2ZO4A 4A12A 2VBXA 4X41A 4BAYA 4HAMA 4G6QA 4Y17A 5DT2A 5DUIA 3GIWA 3VSEA 5H02A 2FQ3A 2HNKA 3HCBA 2H11A 2CSOA 4FSXA 5HDGA 5L3CA 4YUXA 1OYIA 5CVVA 1IZ1A 4KDPA 1OR8A 5GOZA 5CUQA 5IKMA 1BI2A 4RTNA 1J2XA 1SFXA 3ULQB 2B9EA 2EJTA 3HOSA 2VT3A 4IVNA 3T0YA 1RNLA 5D4SA 2YQZA 3DFGA 3RKXA 1R1TA 3CGGA 2HYFA 3CO7C 1IXKA 2P35A 2FMYA 2A14A 1L3IA 1E2XA 2I62A 2GS9A 5FD5A 4IF4A 3N97A 5FLXK 1NW8A 2G70A 3F4KA 2VOOA 1IM8A 3C1DA 1IY9A 2ZWAA 4PWYA 2NYXA 3KPWA 4MTEA 5DTQA 3ELDA 1I6XA 4NHJA 3VC1A 1R1UA 2P8JA 4LD5A 3NQOA 2Z6UA 4ESFA 1XDZA 4E70A 1CF7A 3BP8A 1L1EA 2QQBA 3V8JA 4YFXF 4H0EA 1O54A 2JHCA 3A7EA 1ZGAA 3GU3A 5DTMA 4Z2YA 1JHFA 2KKOA 3LHDA 3Q9VA 4HRAA 2UZ4A 1H9TA 3HA5A 4ER0A 1XSXA 5K0NA 3PB3A 5LQRA 2LSOA 2ZNYA 2FYTA 3TOBA 4BY9E 3FPHA 1NBIA 4AD9A 2L4MA 3FXQA 3KETA 2HR1A 4A0ZA 3CTAA 2H00A 1S3JA 3LA7A 2BH2A 5T6BA 4LG0B 1DCTA 1OYWA 4HF0A 2FK8A 2QBYA 4E30A 1IN7A 3DV8A 4Y30A 4XBFA 3JAMZ 4RB1A 4RB2C 3WTSC 4RTJA 4HV6A 1QAOA 3UJ8A 1WI9A 1YYVA 1FBSA 4P58A 3UWPA 1HKQA 3JWHA 2P3OA 3HSFA 1WS6A 1AQJA 3G8BA 5FO5A 2ZIEA 1WWXA 1O3QA 2P7HA 4ESBA 1EH6A 5D6FA 1R36A 4HF1A 3K2ZA 2XAQA 4ISCA 3E6BA 5FWAA 5E9WA 1ULYA 2A68F 4MEXF 3KEQA 3M7GA 1SQGA 1D8JA 2CW0F 4D0PA 3WTYC 3KQMA 3E5UA 4HOBA 1TTYA 2EV6A 4R6XA 1VQ1A 2ESRA 1P1BA 2O57A 3IEIA 5DLYA 1HSJA 3VOEA 2YUIA 2HKXA 5K0CA 4UVCA 5CVUA 1QAMA 4BP1A 1OR7A 4AIHA 2L4AA 1D2HA 2GXBA 3VFZA 3G2MA 1BOOA 5K0JA 1JG4A 4CKCA 3RTRA 4HLXA 3R3HA 4FR0A 2GIVA 3I59B 3UJ9A 5DCMB 1UFMA 1UHMA 3K1PA 4LB6B 4IPAA 4B8XA 2AOUB 3K1NA 2G7UA 4EK9A 1XTPA 5CVEA 2D1VA 2DK8A 2FRHA 3OU2A 1RIOH 3DPTA 4U0VA 5FHQA 2PX2A 1BIBA 3LQRA 3IV6A 5CVJA 5F64A 2HQRA 5CLSA 1YQAA 5F1RA 2UZKA 2RC4A 3CCFA 4HGZA 2XKPA 2QY6A 1KQ0A 3O4FA 3BROA 5LQJA 3HCDA 2G72A 1O3TA 3KLNA 3NVKI 5CD1A 2OO3A 1WRJA 2OQGA 2P3LA 3FM5A 5DM1A 4M37A 3KZZA 3HVIA 3U81A 3H3ZA 1XCJA 2Z3YA 4LLNA 4A6DA 5EOVA 1IW7F 2OB1A 1ZHFA 3FPEA 3CKKA 4FX4A 3HRTA 3NMUF 1AWCA 2IPQX 1YTYA 1RUOA 3T7SA 5FQNA 2GLUA 3TO6A 2AOTB 3AXSA 1QGPA 4PDKA 2AN5A 5FA8A 3LCVB 5LBQA 3P2EA 3WE2A 1SD4A 2ISZA 1L0OC 3MTEA 2X4HA 2OY0A 3FTDA 2O6GE 3TM4A 3LQQA 5KS2A 3KPYA 3LKDA 4QDJA 3F22A 5FUBA 2D2WA 4BYYA 3BY6A 3DMFA 2GAUA 2FCAA 3L2CA 2M87A 4CTKA 1LEAA 5J6XA 1R74A 2YR0A 1R5HA 4P9FA 4K2EA 2VP3A 1QNTA 3G8AA 3EVFA 1O3RA 3LECA 4GQBA 1HSTA 2PMUA 3H2BA 1FSEA 2EFNA 4CDGA 3SSNA 5KVAA 1QYRA 5E9JA 5EPEA 3ZMDA 1XGSA 2XVCA 3LDGA 1Z91A 5D1HA 3FZGA 4B17A 2PSSA 4N9IA 3E8SA 5AIPA 5EIFA 3LWFA 3CUQC 2WC2A 4L0YB 2QVOA 3MFKA 2O03A 4EKIA 4KDRA 3M9AA 3COAC 3AAFA 1FPQA 5FD6A 4ESJA 1ZQ9A 1SFEA 3ZN0A 4CXFA 2LF7A 3PQKA 3DMHA 4FT4A 1RJEA 4YUWA 1G3WA 3QP5A 2GXGA 1K79A 3G7UA 3HCCA 1KYZA 5HIMA 3D0SA 5DD4A 2F5DA 4I01A 1ZG1A 2ZXJA 1UIRA 4G94A 4KRGA 4M7RA 2D1HA 3F8NA 4HF2A 1ZLKA 2GWRA 1D5VA 4C07A 2AOVA 2NRAC 3PFIA 4IXAA 2PT9A 4P7KA 1O7LA 2V79A 3BJOA 1M6YA 5EEHA 4DKJA 2WK1A 4ETSA 5HIIA 4YV1A 1HBXG 1WXWA 4AIJA 1ZRFA 5LQCA 4KA4A 3PTAA 4HTFB 3SZPA 5E1XA 3KP5A 5ILVA 5DSXA 1KU9A 2KIUA 5K03A 4EJWA 2PXAA 2Y0MA 3MTIA 4I98B 5K5OA 4EGZA 1FZPB 2XAGA 4RTOA 4U7BA 4G7OF 1ZRDA 3J81Z 3EVDA 1NW6A 5IT3A 2L02A 2EJRA 3J7AO 4LGWA 1Z6TA 3E6CC 3HTSB 2ETHA 3B3FA 2GPYA 5AIQA 2P40A 4I7HA 4OIOF 5HZMA 3LDFA 3GLXA 5K09A 1B59A 2MLGA 1AF7A 3SR4A 1BC5A 1XGNA 1JQDA 1WXXA 3TR6A 3G73A 1U2ZA 3TPZA 4IHSA 1P4AA 3I59A 1JHHA 2STWA 3BT7A 4OIQF 3OFKA 1KGSA 4HDVA 2FPOA 4C06A 1LEBA 3EEOA 1TBXA 4ENJA 5GIOE 4RTMA 2Y1WA 3EVEA 2CMHA 3SSMA 2YPRA 2ZWVA 3GDHA 3O3KA 1JSXA 2C7OA 1RI7A 4U7PB 2V6CA 3IKVA 5K0EA 3Q87B 2FBHA 3D5LA 4QTTB 3C6MA 1MJFA 2UXNA 2PX5A 4LECA 5BPDA 1JG1A 1ON1A 1W7PB 3R60A 4ER3A 2VC0A 4YIFA 2P1DA 4BQAA 4RGXA 1E17A 3EDPA 5B1SA 3TMAA 4PIMA 4YG2F 1PRYA 2GAFA 5DV5A 5DYMA 3CUQB 5E18F 1LDKB 3WU1B 5K1YA 4HQMA 4Y15A 2OZ6A 3FUVA 4A6EA 3DXYA 3F3XA 2DI3A 1B4AA 4BHPA 3PQJA 3BWCA 4I0BA 2ELHA 5D5WB 1YFJA 1X1BA 4PIPA 2AVDA 4MQ9F 2XV4S 2BM9A 4C03A 4BP3A 4R8HA 2QM3A 2B78A 3HUGA 1W5SA 4MHGA 4R6WA 2BZGA 3PVCA 1IN5A 3GVAA 4O6JA 3BWGA 2A69F 4EMSA 3GX4X 4OX9Y 1KPIA 3NVMB 3M70A 1HW5A 5JHUA 1I5ZA 2HDCA 2ZBKA 3TLJA 2OXTA 3GWZA 1LNWA 3BJ6A 2GB4A 3WTTC 2VS1A 3T7TA 5ICEA 3W6KB 5BS6A 2QE6A 4UXNA 3HA3A 3KP6A 4CYDA 4Q4ZF 3R6SA 3GJYA 3RKWA 3DXJF 4PGGA 4DF3A 2HQNA 4YMGA 2JT1A 2QBYB 4HBLA 5T64A 4E2YA 2KIFA 4HX8A 1DUSA 3KKZA 5EZSA 3CJQA 2H27A 4LB5A 3KQVA 3MAGA 3F6VA 2YX1A 2XKOA 1WY7A 3NRVA 1AQIA 1JXSA 4YV0A 5BP7A 3B73A 1B6AA 2ZZNA 1IAWA 1O7FA 2GA9A 1YLFA 1MD0A 4QQNA 3CJTA 3GYHX 1I1SA 2ZZKA 1VL5A 3G5LA 1VP9A 3EVBA 2IBSA 4BHCA 2VBWA 5ILUA 2O07A 4XLPF 3K9TA 2MA3A 3P71T 3BZ6A 2IJLA 3DH0A 2Z99A 2K4MA 5GINE 3L00A 3QP6A 5HS8A 1OMIA 2W57A 4ZZLA 1WQ2A 3GFIA 5FGMA 4R05A 3OPNA 1QO0D 4HX7A 2IT0A 4RWZA 2K7LA 1S6LA 3I64A 5E1DA 1YFLA 4KICA 2BR3A 3E05A 4KWCA 3HCEA 1FBNA 3GFJA 3GZ5A 3A27A 2VONA 2VDVE 1SD5A 1USTA 5EQJB 5DPMA 4O3MA 2YR2A 4CHUA 2MD5A 2STTA 3ELUA 2VE9A 4QTUB 4EQZA 3KFWX 1LDDA 3JWJA 2E7XA 4P55A 4AUKA 1RJGA 3HEMA 1MHTA 2R3SA 5K5QA 3L7WA 4HX4A 3DLIA 3HP7A 2ZBPA 2CQKA 4EJVA 2IA1A 4QPNA 1J9IA 3BWMA 2WTEA 4LJZF 3M1EA 4RTSA 2OKCA 3GZ6A 4OMYA 2NNWB 3FZVA 2RGVA 3SM3A 4FZVA 4S05A 3VEPA 4GYGA 4KYWA 2P7VB 3UZUA 3HRUA 3KPJA 4XUDA 2PMHA 3GFMA 5ERIA 2IW5A 3A25A 5DTRA 4OA5A 5EVJA 3AY0A 4CO8A 5E2BA 4M6YA 2PX8A 1TNSA 2PVCA 3THRA 2IRFG 4U7DA 4ER7A 3ABUA 2BBYA 1O57A 5K01A 2JH8A 2M45A 2K4JA 4UVBA 3QRFF 2PXCA 5EMKA 3IKTA 5L3BA 5DM2A 3BDDA 3L9FA 3GXOA 5GM1A 3EGIA 1Y0UA 4PYJA 5HDNA 1U2WA 3ELWA 1BI1A 2P6TA 1ZREA 5DRYA 4L5IA 1Q1HA 4FT8A 5H6QA 1YUBA 1LB2A 1JQ3A 3BGDA 3KPVA 3UJCA 4EGYA
chains in the Genus database with same CATH superfamily
4MW5A 2FMLA 1RQGA 1XNHA 2PSEA 1COZA 3HDJA 4NFSA 1JAZA 1W7PA 2W2TA 3TQHA 1DOHA 4I99A 4ASNA 5KO2A 2ZJYA 3COZA 1A4XA 4O4IB 1ZL0A 3CUQA 2V55B 4RVCA 4CM4B 1Z38A 4R98A 4YRVA 3PGKA 1H1DA 2O8KA 4PONA 3R9XA 2PY6A 1BMQA 3HGTA 3QM1A 1E3HA 3K9HA 1FRZA 2VKEA 3MRSA 1MT0A 3L49A 2PDAA 3DM9B 4AO6A 3RKRA 2W70A 2X1EA 1M1EB 1MQ8B 3QE9Y 4XQCA 2JGIA 3VPHA 4C87A 1IWPB 1DBWA 1GYPA 5ILGA 3DMTC 2ISYA 3QPTA 2L17A 1FTGA 5BUZA 5EP4A 1GUFA 2KB0A 3EG5A 2F90A 3DQPA 4QC2A 4D74A 721PA 1OC4A 4IIYA 3W0LB 5TE9A 2JA1A 2O23A 2C2OA 4QEKA 1L3BA 5HKKA 2PVSA 2Y2UA 1BWPA 4A4DA 3G6KA 4CIWA 2H1SA 4XLCA 1B72A 621PA 4HPJB 3GLIE 4GDMA 1H9GA 1LTHR 3K0SA 4TYMA 1KDZA 3IH3A 1EJ9A 1JFTA 2QJRA 4OINF 3DL2A 3ELYA 3IHKA 5IH3A 4FDTA 1UT5A 5JZ9A 1JN0A 3UWKA 4GFDA 1Y6FA 5DKFA 5HJ2A 1UOOA 1R22A 4QYWA 2DH6A 3GCDA 1ZUNB 5BW8A 3DAOA 3EIWA 4GX5A 4OHVA 1GDTA 3MCUA 3J7AY 2YN4A 5CTAA 3F1LA 3GLGA 1BA3A 1PD1A 3EX7C 3DHYA 1PGQA 3VHRA 4CGZA 5D8LB 2JUCA 4O4HB 4V0ME 3H8SA 1ZCZA 1XP5A 1GGVA 3G2BA 3HPGA 1H0MA 2DR0A 5F1PA 5EQTA 4XUGB 3H11A 1MJ9A 1SPBS 3EA4A 2R5YB 4BRSA 2XGXA 2XHKA 4N5DA 3SIRA 3UFXA 2NUTA 2PWYA 2BY3A 3T41A 3DBHA 3LA2A 2WHEA 3HL4A 3ASVA 2V74B 3OYJA 1RI3A 1XVAA 3O1IC 2REBA 4L2IA 2XRYA 2RB5A 4BP8A 1H2WA 1QH1B 1RWNA 4OAQA 4GR4A 1SD6A 1LW6E 1NPYA 3AERB 1OXBB 4EMUA 3P32A 3P0RA 5CFOA 3CEAA 4R2XA 2XUDA 1KVUA 3TD9A 1ZICA 2MSYA 2PEYA 1I2BA 1AO0A 1RM0A 3PDUA 3SLKA 1VE9A 2D5IA 5IDXA 4TTRA 2AQFA 4ZV9A 4TRNA 1IL0A 3PICA 2O2HA 4R3WA 4FE3A 3LIIA 3MWMA 5H0IA 3KIPA 4IH4A 3E7XA 4RHYA 3A1NA 1TP4A 4IQ4A 2PUJA 5AJZA 5KOJA 4TMVA 4IQ8A 1D3AA 1XDDA 3CWQA 4PCLA 4ZT2A 3P2KA 4C2AA 1F1ZA 3VNRA 1PG5A 3MQ4A 1DBRA 1N75A 3K20A 1EFDN 2V6FA 3RRNA 3O92A 1BHJA 2R7FA 2I78A 3DF8A 4HV5A 1OTXA 3S7TA 3PWZA 3FB1A 3VTAA 4D92A 1KYIA 1T2KA 2NO7A 2J0SA 3E5RA 5LQNA 3IKMB 1OTHA 5AFSA 4UASA 1STOA 2Q46A 3O03A 1FW6A 5BN5A 5CKTA 1ZOIA 3DFMA 4Q24A 5EKXA 4QUJA 4KVGA 2RH5A 1A4RA 5FOQA 5JS6A 4DNCA 2ZPTX 4OO3A 2YIMA 2R92J 2ZUFA 2UXXA 2VF4X 5HNFA 3HYLA 3NBZC 1Z47A 3AYXB 3L1JA 1PFWA 2C3UA 4M9ZA 5CAEB 2XEDA 2VNSA 4LXXA 3AU9A 1EH7A 4LYFA 1WQ3A 2V1UA 3W6NA 3VDMA 3IE2A 1SOMA 2CUFA 2DA6A 2MSDB 1Y1RA 3COSA 3VJLA 1Z88A 1WU7A 3ETEA 4Y6GB 2B3TA 2CGPA 3LY9A 4MUHA 4URFA 5B1BH 4E11A 4LBVA 5B6IA 3G1LA 3N7TA 1MH3A 3HWX1 3ABOB 4E7LA 4Y8VA 2ZAOA 5DWDA 5BOSB 2PMFA 4P4NA 3NNDA 3RUFA 4BEVA 2XMQA 1TQDA 1OAKA 1YBFA 1DG9A 2OZLA 1GKLA 2YU3A 1ZQ1A 3FETA 1Z67A 2LKDA 2X76A 4XIYA 2A57A 3RSLA 5EJ8A 4RNDB 1CFZA 4I5IA 3FMVA 4K81B 1Y1KE 2HBQA 3IEKA 4GOOD 1YR3A 2Q1UA 3EVCA 2JEYA 1K63A 1NQUA 5CW2A 5CYOA 5DM4A 3PEVA 1PP7U 2HK6A 2YQ4A 3BD9A 2RHHA 3W7VA 1E1LA 1IJFA 3I12A 4KR3A 3N7AA 2YVLA 3THWA 3ZCOA 2Y0CA 1ORIA 3O1JC 1U7DA 1GNTA 1Z4JA 3D6FA 3ICVA 4RGUA 4O08A 3QU6A 1MAAA 3KP3A 1BDJA 1JP7A 2FP3A 2Z09A 3JATB 3PE3A 3G5TA 4CKBB 1NPDA 1WZ2A 1TUEA 2VP4A 5BWCA 1DGQA 2HU5A 3LSGA 1KZGB 4N8SA 1ZH5A 1OOEA 1QX3A 1T9GS 5ULLA 4UJ3A 2QG9A 3C1AA 2C4VA 5E1BA 2XX3A 3RHTA 1HORA 5JRDS 1JGSA 1ZCBA 2RGAA 2QW8A 4KXYA 2PMCA 2X19A 4ZKEA 2MFZA 2KS6A 1F2DA 1BMFD 5EEGA 3PC7A 4KXMA 2RC5A 1RYDA 4WDQA 1RJWA 2DBBA 4DUGD 2LDUA 2VDWA 1TAHA 5AJUA 1U2GA 1IC8A 2XAAA 1NRIA 3LY7A 4L9TA 2QD1A 3VJKA 3RJMA 2FEXA 5IK2D 1LJUA 1LS6A 3TL4X 2CDBA 1FFXA 2GEUA 4FBGA 1A98A 5LMNB 3LMKA 4QOJA 4Y0AA 1C1XA 3DEEA 1RYMA 3R5KA 3QQPA 2QDKA 1B3RA 2ODTX 2WQZA 2MBFA 3R7NA 1XQWA 5HK8A 4DV6B 3LA3A 3EA0A 4CEJB 3UJAA 3BS4A 3B6ZA 1G8PA 4D80A 3GRFA 3OC0A 2FFQA 5JYDA 3PUFA 4M1MA 5LLTA 4RFSB 1IPFA 1NKTA 1FX0B 1GVNB 4EJSC 3GWGA 2XMDA 4Z2AA 3VYVA 1XZHA 1BXZA 4HLUC 1DBIA 5K8VA 3WL3A 3CJRA 5ALXA 4LYDA 1QB7A 2AK2A 1B3BA 4Q7JB 4HX5A 3MF4A 5JFTA 4AT1A 3OS1A 1GZHB 1RPJA 4OYLA 2HV9A 3VX3A 4ZVSA 3SJAA 4DMCA 4RADA 1A95A 1IN6A 2CE7A 3EVZA 3TSYA 2WNHA 3DUFA 1ZEJA 4HSEA 1R49A 4B32A 4ZYZA 2OC6A 4PTLA 4DSUA 4OV6B 3SDBA 4N0QA 2DJ5A 3E5QA 4EM1A 1JSZA 2QN9A 3KLBA 1Z35A 3GP3A 5ALOA 2E9SA 5T5QA 4J91A 1JHYA 2TYSB 2PUTA 3ZE0B 2ZJ4A 4N1AA 2IHJA 3E8MA 1FMCA 1J1UA 1SKYE 1O95D 2NU7A 1U7XA 2K02A 5L40A 1D2CA 3I4CA 1PGPA 5K3DA 2YY5A 4REQA 1VKNA 2DFHA 2PZ8A 2VBIA 4QG7A 3RU3A 1ZS9A 4HDSA 2YV2A 1VG8A 2FLVA 1OH7A 4B85A 3G23A 4X62B 3OTOB 4LYGA 5CG2A 2C7BA 1ZKDA 4HTAA 5K5RA 1SPXA 3M7IA 4MW9A 1GZUA 3MWFA 1XMQB 3WK9A 2OBLA 1A8QA 2IPNA 4KW7A 2TECE 4DNFA 1XAHA 1ETVA 5JMOA 4OHOA 3E9MA 2HTEA 2W58A 2HREA 2PUCA 2PUBA 4X85A 1RVDA 3ZCUA 2OWDA 3VKGA 2PLNA 3D7KA 2DMUA 2IKQA 2ZITA 1TF5A 2D6FA 4HN2A 3SLRA 1R1DA 1I3CA 1A3CA 3H16A 1BKYA 2FG7C 3DTTA 1FYLA 3V4OA 2F4NA 4ABZA 4TN1A 5HS4A 1KSFX 2Z57A 4AZ0A 5CIWA 4D44A 4OQEA 3FOEC 2EBWA 1QJ4A 5AKEA 3NBKA 5IWCA 2ACJA 4Q1BA 4TS3A 4KGXA 1KBQA 1QG2A 4IS2A 4UJ5A 3DZ8A 1KNQA 3S70A 2BMJA 3KAQA 3GJ7A 2L9RA 2B8NA 1PG2A 3BBLA 4JBIA 5GWXA 4UU8A 5BWMA 3HB5X 2WJ6A 5DGTA 3MXOA 1G21A 5KOIA 1O3SA 4NK4A 4Y9DA 2H1CA 5FTMA 4BUZA 2I8AA 4QGAA 4AY5A 3ZLJA 3A58B 2ZU6A 4JOSA 1ZIPA 4RPCA 2Z5UA 2C5LA 3RIMA 5TJHA 1TO1E 4WBXC 3J7YJ 4XDYA 3INYA 4C6RA 4MXDA 3ES9A 5IT0A 2VA8A 3U3ZA 3WHPA 4AC9A 1NX6A 5BQ5A 5B1EA 4YQZA 1CF7B 2NV2B 4LC9A 1U63A 3HNPA 4S1TA 1PFYA 3IR5A 3F5DA 1XLWA 1G3IA 3Q9UA 3JRNA 4E51A 4V2GA 5CT8A 5REQA 4FZJA 3C5EA 4C7BA 5D5UB 5CLHA 4B3IA 3T9AA 1GTG1 1HDYA 2VF2A 3OWOA 4K9SA 1NMQA 2R1ZA 1X7YB 4NU5A 5I7WA 3GFSA 3QUAA 4HB4A 1BVYF 1N5MA 3SIXA 1NVGA 4F21A 3VR6D 1GG8A 2P75A 3H65A 4G3XA 3S68A 3ZXUB 4S0HB 3CE6A 1CSEE 4B40A 4YRSA 4KMSA 4B84A 2NAPA 3IUBA 4FUQA 3INRA 4GXOA 3MJEA 3G02A 3ETJA 1PEKE 3JQ6A 4LE1A 1X1PA 2JJQA 2WIJA 1LWNA 2ISCA 2B36A 5HHTA 3W8NA 5ED4A 4DJ5X 4GRDA 2ONKA 2EW8A 1JHPA 4DA6A 3MZHA 4XIIA 3VH2A 2XPUA 1NVMB 4N3GA 3FNGA 5H6RA 1GV0A 4EA6A 3I3OA 1TWFJ 2IHKA 3IRVA 4HAXA 4JYPA 1V37A 3R5FA 3TRKA 5IKEA 1OB5A 1GEEA 5FTWA 3DFFA 4O4LB 2H59A 4NI5A 4BAYA 2X1LA 2NN3C 1IH8A 4DLNA 5HDGA 3CNLA 1ZC3A 5FUQA 1JUDA 1JQ5A 1TM2A 1C81A 2WINI 4ENPA 3QLJA 1OXTA 5I7VA 3PFYA 3ZJTA 1FU8A 4LF9B 1CHNA 4GH5A 1XZQA 5CA0F 1AXGA 4B6SA 3R7DA 5EP3A 2GS9A 3PIDA 4BNDA 1KVSA 2QTMA 3GLFA 3W3CA 1WP4A 3A01A 4M21A 2G07A 5K8TA 5HGJA 4EJMA 2HBYA 1KDPA 2OP1A 4ZARA 2MR5A 3CG0A 2F2TA 1U1DA 4AL4A 3GL9A 2CUNA 4YFXF 3TZLA 1M2GA 1FX1A 1QHHB 4UM9D 3DLHA 2ZNYA 3N53A 1UFVA 4QGBA 2BEWB 2C99A 4A0ZA 4XWGA 2JCVA 1EK2A 2G17A 4PAOA 2WA0A 3JAMZ 4FILA 1OT5A 5LWHA 5A4FS 4ETWA 3WWZA 4G1MB 1UWKA 2KZVA 3AUYA 4L8GA 1JMYA 2C4WA 2SKDA 1C7QA 2A68F 4D0PA 1NIJA 5KQPA 1CK4A 4FK8A 3GJZA 4KDFA 1HSJA 3R0XA 1QFMA 1B26A 1BA5A 4GRAA 3BMOA 1XT6A 4C0AC 2VJJA 3FIUA 4Q16A 1ULTA 2QTBA 3R41A 4MFDA 1YR1A 3RS9A 4OKIA 5GY7A 1KDTA 4MQFB 4MCIA 3JQ9C 4IPAA 2R66A 3G59A 2FRHA 3GPCA 3TTVA 1RIOH 4XXHA 1QTRA 4IGFA 4QNMA 1QZEA 5DK4A 5KOYA 5AJXA 4QT0A 3BMCA 1GARA 3CXUA 1O3TA 2HEGA 3NVKI 3H9EO 3HSKA 1P8JA 1KK2A 4H7FA 1RWWA 4FGSA 2NZYA 2DECA 3WLMA 2AFIA 2QX7A 1I51A 4IKFA 2Z1DA 4NRDA 4CT4B 2VHTA 1AWCA 1YE9A 3G2HA 5FQNA 1RRJA 1QGPA 4EF5A 3LC1O 4R2WA 2J9FB 3TI7A 3H05A 4HPWA 1K7SN 2OSBA 5KS2A 4MS3B 4BJTA 4BFVA 4POAA 3M9WA 2DOEA 3U17A 3PG5A 4INZA 2NZJA 1NOKA 1WDLA 3GD7A 4PO8A 2YMLA 3WGMA 1BXGA 2LNDA 5JNRA 1JIUA 2EFNA 4NBQA 1VCMA 4RORA 1Z5NA 1F1BA 4RHCA 4DUPA 3KQUA 3RRYA 3ZGYA 4I66A 1JX6A 3CLTD 2C1XA 3B85A 2QL7A 3GT7A 1DP3A 3AB8A 2A9KA 1I7SB 4OI4A 5C18A 1EFUA 1ZAYA 3T3IA 3USCS 3NM6B 3L92A 4RANA 1A71A 3I72A 3SZUA 4EW2A 3DB1A 2YZGA 1OKKD 1YRNA 3K7EA 2CNBA 4AX4A 4OX9B 3GTGJ 3WGYA 4DT1A 1UZCA 3B70A 3SZPA 4HDMA 3FNFA 4P36A 3TEMA 3BLYA 2XYGA 1M54A 1FZPB 2BELA 2UXCB 3J81Z 3OSFA 1B1CA 3BULA 3JALB 1G5RA 4XFDA 2VYQA 2FFBA 1SFOJ 3PFWO 5K09A 2XW6A 1EG7A 2V6EA 2HIGA 2ONJA 4PZPA 4EGQA 2R8EA 4BO7A 4EG8A 1DUVG 3R5SA 1I0LA 2R68A 1G8FA 1QLHA 4B3FX 3H2JA 3E27A 1AKQA 1PUIA 4LZPA 3A1FA 4DJFC 1OX4A 1ZQ3P 3HYCA 3C6XA 3EDCA 3EDPA 5TLSA 4GT1A 4C0SA 1XS9A 5JXIA 2LYCA 3FUVA 3EZXA 1THMA 3UAYA 4RDXA 3WDKA 3SS7X 2ELHA 3N6RA 4UQLA 2MSEB 4DG8A 2I03A 1HDEA 1BJZA 1R7RA 2P6MA 4R6WA 1X6VA 3LBHA 2H8GA 3FAKA 2R5ZB 3ORQA 4UVGA 3AK4A 1ZVKA 3TLJA 3NH9A 3D8TA 1P5RA 4BVJA 2D2EA 2CZCA 1VM6A 3W2EA 2JK0A 3B7WA 3NM4A 2QRLA 3NB0A 5EPUA 1T91A 3HGGA 5T64A 2G80A 4JJ6A 2YMPA 2BVLA 3M6MD 4ZVNA 3MAGA 3QIAA 3AUAA 5T8KC 1CDEA 5A9TA 2FV8A 2X9GA 1VLVA 2NS7A 2IBSA 2VVTA 2I71A 2DPXA 3K9TA 2LY1A 3DH0A 4H1VA 1MAUA 3EN0A 2Y4OA 1JDNA 4I1SA 7REQA 3I01A 1F43A 5E1DA 2EL9A 1YJXA 1U81A 2V4ZA 2QLLA 3G3EA 3LSRA 1QGYA 2AL7A 2XA1A 4YCJA 4LJSA 3RSNA 1VJDA 1ESDA 1KP2A 1VZ3A 2D1QA 3KOUA 4JT4A 1CJVC 4TV9F 1ETQA 3BDIA 1DRWA 3KPJA 5ADVA 1S3SA 1U3WA 3N05A 3H5WA 4EEXA 2X8LA 4KLAA 1LZKA 1IPEA 4AXXA 4MVJD 3K2QA 4HQ6A 3JYHA 2X0IA 3SFVA 3O1LA 2DFFA 5EMKA 2QG6A 1I30A 1CQIA 3P2YA 2E71A 1BD3A 3CY6A 3VH1A 2Q9CA 3CDLA 1J0CA 4Y2YA 3DOHA 3L04A 1KMHB 5EYRA 3ADPA 4WXCA 1G2QA 1TMKA 2HJRA 2EFQA 3STTA 1E6LA 4HQEA 3HP4A 4D4IA 3NYWA 1E4OA 4JQFA 3ROZA 3K96A 1AQYA 2BHYA 16PKA 1BMFA 1Z36A 2XSDC 3C6ZA 3BJEA 4IY1A 5TMDA 1FFDA 4MYSA 3IAM2 4G63A 3DF7A 1W4ZA 3IULA 3D3KA 1DU6A 2FW1A 4DEYA 4DUGA 1HCRA 1YB2A 1T26A 2NWQA 4F4DA 5KQSA 3QH4A 2MH2A 5IK2A 5ARDA 1QRRA 4GLFA 3LSJA 3LC2O 5FB2A 2QR3A 4ZO6A 3P9CA 1UWVA 1HQYE 3RI4A 2R7LA 3MWEB 1DO8A 1LE8B 5DM0A 3S3MA 3RYHB 1ZCJA 3GZNB 4AZVA 1MC4A 3Q9SA 2HU2A 1FVXA 2ZYAA 1OE0A 4LF8B 2PQ2A 4MJXA 4HDCA 5J43A 1NYQA 4II7A 3A2LA 1T6BY 4GKBA 1GDDA 4B4CA 1HQKA 1CUUA 1G16A 1K88A 4XLAA 2WJGA 3WFZA 4Q9DA 1TF2A 2CY0A 4XUCA 2JWTA 3CZRA 1NVXQ 1T5TA 1NE7A 2XRNA 1STZA 5FA5A 3UUEA 3PC8A 1U9NA 2C61A 3MGAA 1AG9A 1YK1A 2BFBA 5DYYA 1F5NA 2ZI6A 1XTUA 3RSOA 2OOKA 5K8UA 3JVIA 2O06A 3WLQA 2XRMA 3G7SA 1KP9A 3KK0A 4X6XA 3W2HA 3OYGA 5EJMA 1AJEA 3TL2A 2N0SA 2R6AA 3U5ZB 1AK9A 3NETA 3HDHA 4FCTA 2GASA 3HDQA 4QX6A 3OA2A 2W8ZA 4AIDA 5ER6A 1E61A 1LXCA 1VPLA 2Y1LA 2GF9A 1DAIA 3GUCA 3OI7A 1BHSA 1L7MA 3O2PE 1QCCA 1GL7A 1M5RA 5FPHA 5IW8A 4BE7B 3IOYA 2OO5C 4YS6A 2HNBA 3QW4B 3O4HA 5EJ9A 4TV9A 2YN2A 3X1MA 4XD2A 4I2NA 4RL6A 1O95A 1BSVA 2WHPA 4K7JA 3TOVA 3ZY3A 1WF6A 3GH1A 4RQBA 1E9BA 2ZBQA 1QYDA 1ABBA 1IBLB 4AU7A 3UUFA 4BMDA 4FMBB 2PJUA 1H0KA 4NZNA 2FPPB 2WOOA 1DXOA 2P4HX 2VWHA 1Z6PA 2NO4A 3GP8A 1MORA 3L2RA 2ACVA 3TTTA 2QYTA 4MROA 3I52A 3OT1B 2QN8A 3QPLA 2PH5A 1NMEA 1NUSA 1PJCA 3D81A 1B42A 1PN3A 3REGA 5L3EA 1NFFA 2EHJA 1GXQA 1BDBA 4YDQA 3KVNA 3BIWA 2JQ7A 4MR7B 3OIDA 4AF8A 5EMJA 3T4PA 1G9TA 2NUPB 2OBYA 3K2BA 4QRIA 2FX0A 4AJ9A 1OHHD 4LTNA 3S5UA 1HW1A 3DBOB 5KK1A 2JLQA 4F3NA 1XGOA 1ND6A 4L02A 2XUKA 4D5FA 2PZKA 5FTNA 3ZVLA 3C97A 4YP9A 4NONA 5KNDD 2CT8A 3H17A 4IL6C 1X2BA 3MTJA 2HOAA 4L50A 1GILA 3LFUA 1QYWA 3L1IA 4R8SA 4XUEA 4P53A 5A4DA 4KR6A 5FYQA 4J0IA 2QD2A 1J5YA 4O29A 2AF4C 3L8DA 4XM0A 4CH7A 1V3QE 1VXRA 3WWPA 3B12A 2G9NA 3ACCA 4ZCIA 3JW4A 1OIXA 1SMYF 3A26A 2HQBA 4Q47A 1NLYA 2B1IA 2XUZA 3C6KA 4EOGA 1KZ6A 5AR1A 2XXAA 2AX3A 1CEXA 4DB2A 4DIBA 2FQXA 3OM8A 2AZTA 3OUTA 3FYSA 2C6YA 3L0YA 4TMFA 1JL3A 3S2WA 2JFNA 3HJEA 3A6ZA 3OJ0A 4XL9A 4LK2A 2X0JA 5IX8A 3ZBUA 1RZ4A 5IJZA 3LAPA 3L8ZA 3FX2A 4G25A 1IY8A 1AY0A 2YXEA 4M7OA 2XSJC 8AT1A 2JCBA 3DVAB 4MYDA 2LCQA 1XQ9A 1Y48E 4EMTA 3VR3D 4UOZA 3RE1A 3GVIA 5LM3A 1TQ4A 4BLQA 2W71A 4OLBA 1RR8C 3VR6A 3Q8XB 1WQ1R 1V7CA 3A03A 1DV2A 1YFHA 3PPVA 3C87A 4HGRA 5AW9A 1TYCA 3Q1LA 5LNK1 3MTGA 4O2AB 4X7MA 1XPJA 4BDTA 1BWQA 3PENA 4O5AA 2E1NA 1EPUA 2NXEA 2COKA 4ND8A 4PIVA 1ZINA 4Q82A 4B35A 1P2BA 2VASA 2RB4A 5L3DA 3QLVA 1CNMA 2CXPA 5LIRA 3QWLA 2CVPA 3FGZA 2IPAB 1SHJA 4K1LA 4DZRA 3E4DA 1TCVA 2HFHA 2DFTA 3KTFA 1Z4OA 5E1OA 4P9UA 1OLUA 1KAGA 2VHQA 1IUFA 3DFZA 3KWJA 5HLGA 1JKPC 4YECA 4YX9A 4QQKA 4B1FA 5IAGA 4RF3A 3VXKA 1HNZB 1I2DA 3T1NA 3R7WB 3AVYA 5IT9K 2J5OA 3TEFA 4ANFA 1NRWA 1DMRA 5GTHC 1U11A 3QE2A 1NXQA 4TTSA 5DN6D 2DQYA 1EUDA 2RH8A 4NFYA 3Q9NA 4F56A 3FYUC 2BIFA 2PX6A 2PEZA 2ZSIB 3UB3A 2F43B 4AJLA 2CLMB 4KKVA 2W2MA 3P52A 4B46A 1XMOB 4MKFA 2CJYA 1C0WA 1YBHA 1TA4A 3M4OJ 3GEZA 2Q1SA 2IJGX 3RTCA 2ZRHA 1C3OA 3DLAA 4J0DA 2Z0MA 4JJGA 2NXNA 3MA0A 4YJ3B 3GRUA 3NANA 3RU2A 3BWXA 2GKOA 2XB2A 5JANA 1MH1A 2QSFX 2YDYA 3WK4A 3QNMA 1HNWB 4MVWA 1LQ1A 2ZTUA 3DZDA 4IOMA 2KBFA 4YCMA 4UTNA 4L73A 1ZJYA 2BF4A 1G9SA 1ML3A 4LF6B 5ERGB 3T7KA 3P9IA 2D0PB 4UFNA 4L07A 1F0YA 3CG4A 4G7HF 3ZKWA 4YCLA 4MB2A 2H9AA 4N0PA 1H23A 1VL6A 2VDUE 2JFQA 3SJ7A 3ZLVA 2EX4A 3HBAA 3VI4B 3MZ8A 1M6EX 2FQWA 3IQFA 4HVAA 3T9EA 5IHPA 4OBBA 1W0TA 1NQAO 3BWVA 3HRHA 2YJ3A 3GY0A 1Z3YA 221PA 4YYEA 1B15A 4UU7A 4WA7A 3HOZJ 3N2ZB 1K1EA 1KHHA 4UU0A 5C2JB 1TYDE 2B8TA 2CGEA 4D4KA 4M89A 4R9VA 1JSCA 4GF5A 2BHZA 3WLAA 3ONDA 3GF4A 1JFVA 2HMYB 3FFWA 3KU4A 1IJEA 4C7JA 2WADA 1E3QA 1RYEA 4M4SA 3P9KA 4PG5A 1B8IA 5CXXA 2P1RA 2HCBA 3ZU3A 2BY0A 2YIJA 3PVSA 1N33B 3TP0A 1V4BA 3SG0A 3BFXA 2RGNA 1Q7CA 3ROXA 3CUOA 3QBDA 2QTHA 3NHWA 2R1TA 5IKPA 1WGXA 4AUXA 2QNBA 3ASNH 4ZOCA 1LDNA 3SQWA 1MNAA 4PYIA 3V1YA 1DCFA 2F4VB 4B3TB 1CRQA 3B1WA 4DIQA 5KVRA 1OC2A 4WUTA 5HKBA 3WGOA 3BEDA 3I0ZA 2VOPA 2W6MA 3I6ZA 2B98A 1D1SA 1U0TA 2QQ8A 5HMLA 2WSYB 1UK6A 1CW2B 3PXAA 2G4CA 4TUYF 3B2NA 3FZEA 2DODA 1T38A 4XTRA 3FYDA 1H94A 5IDQA 1CE8A 2R5FA 2RK6A 3DLBA 4MVJF 4DRYA 3PJFA 1XA3A 5IC5A 1XRMA 2M1ZA 1G7TA 4UNOA 2FP4B 2FZCA 4WEOA 2WJ3A 1OKKA 2FNAA 1QGDA 1KJQA 4KQFA 3HSRA 4WCVA 1J5PA 1Q77A 3U16A 4ZZ2A 3LC7O 4RVDA 3RT9A 3BD6A 4U8GA 4BOYA 1WM1A 4Y7CA 1MV8A 1GXPA 3DEUA 2CLSA 3KP7A 3ROUA 1T39A 1VHLA 3HZRA 1OV4A 5U4XA 4D6XA 1BXKA 5JZOA 3J7ZI 4G5OA 2WV1A 2CYYA 2IA2A 2DFLA 4KKXB 2JK3A 3GRPA 1GGMA 4G2NA 1BJTA 2C9BA 1WUTA 5DNAA 3N58A 2XAFA 5EHZA 1P0PA 4L9VA 1T9KA 4LZNA 1ZONA 5G3ZA 1Z62A 1DAKA 3GVXA 1FBQA 4JOMA 5BW4A 1P29A 4NQWB 3UY4A 1KMCA 5J47A 1OPRA 4CZCA 2BHNA 4C4RA 3DKVA 3LA8A 5DU2A 4DR5B 1L4HA 1FP2A 1N7GA 4TWJA 4EW1A 3MCAA 4YLEA 4P35A 3PKJA 2RVCA 2BW3A 4RVOA 1N7HA 4R41A 2AN3A 3IJ5A 1WY5A 3QXGA 1I7LA 5TJJA 2F00A 3GPIA 1PFVA 2JPBA 5JFGA 1OMOA 1I24A 3DVLA 4L1KA 4M9RA 3IUMA 3T9FA 1QOQB 3KR1A 1ONVA 1DEXA 4EX7A 3BJAA 4BNLA 4BRZA 4G85A 4LW8A 1VYTA 1RRGA 3EE6A 1UBSB 5DVZA 1PBNA 1Z0ZA 2ZSHB 3GCGA 1E2LA 1LSOA 3GFLA 3UPUA 1ABFA 2GK6A 2J0VA 2P7IA 2EL7A 1GGNA 2HVSA 1Q95A 3FJYA 2D7DA 1RJ9A 4DFDA 4PAGA 3SKVA 4JVLA 1FYMA 5BNWA 2EFWA 2QL9A 2LIPA 2Z33A 1E7QA 1A9XB 4UMFA 3NIBA 3CLQA 2Q2EA 4BDYA 3D1JA 4TUYA 4MVCA 5KQLA 3NNSA 2IPOA 2OQVA 3GTOJ 1O1YA 3BTIA 3BFJA 1M7BA 2IXSA 1JBEA 3N2NA 3PFHA 4JNKA 3KYCB 1LUJB 4MVJA 4QYMA 4TXLA 1K68A 3GEBA 3A4TA 3DWEX 3V4SA 3GLKA 5DRTA 1DAOA 5IJ9B 3MVPA 1HNNA 5AONA 2X5NA 3CKYA 2GPAA 4NK5A 3CCRI 1PFKA 3OF5A 4N6OA 4LX8A 1C30A 4BLWA 2XCLA 2GXAA 5M5BA 3D4NA 4A8PA 3K9BA 4M1YA 1XHEA 2VBYA 4EHNA 3HKCA 3IDZA 1R9JA 4M1KA 4RJLA 3PGLA 4BGUA 2FQ3A 2HPVA 3K70B 4REOA 2QZ9A 2KLOA 2DA3A 4ZCMA 4W1PA 4HNTA 1GA6A 2G82A 3NOQA 4US0R 3RV4A 2M6RA 1M73E 3R5HA 3DAHA 2A1UA 3BF7A 2HYFA 1VSUA 5FD5A 1HPLA 1IM8A 4M3EA 1YJCA 1JXMA 3S2IA 1KC1A 3UXYA 1LPPA 1ORTA 2P8JA 4GGPA 2OV7A 5KAFC 3PR3A 2ZIZA 8LDHA 4JI4B 4R9SA 4CF5A 4MJ7A 1YIDA 5J2UF 4HRAA 3GUZA 5AK5A 5ABPA 3S81A 5DHAA 4G9BA 2D74A 1RSZA 1NBIA 4WDRA 1PVDA 4DR1B 3GDFA 1UPBA 3MKWB 3FPAA 2I2FA 1WRBA 5AXCA 2ZJRF 1W4AA 2DKNA 5F7XA 3BXEA 2AE1A 5IVHA 3IA7A 4ISBA 3KLMX 4UHCA 2QKYA 1UC5B 1T2UA 5KI6A 4IICA 3DB2A 1F2TB 2YFYA 3L4BA 4OJKA 1ZVMA 4HDNA 3S29A 2EV6A 4R6XA 2PJRA 5IVKA 3N8NA 3LOUA 1UOPA 1FMVA 5K0CA 5BUCA 1S5PA 5CG1A 2CJFA 2GNAA 2J0QA 5JSUA 2DOKA 1K0UA 3TZQA 2H48A 4I4LA 2WMYA 2Q1XA 2AN9A 1DJMA 3HMQA 3REFA 3EAFA 3OU2A 4U0VA 1VCOA 2BP7B 2IEBA 3D8HA 3TLMA 5KYXA 1C7ZA 2UZKA 3MC1A 5E95A 2LY9A 4C4PA 5LQJA 1XGKA 4FHCA 3FHLA 1FRFS 2FRDC 2HPAA 2Q9UA 1E1MA 1XDWA 2B20A 5BNGA 5LP6B 2AW5A 1VQPI 4BKXA 5AW3A 2ISZA 3TM4A 2O6GE 5FI1B 1XD9A 3MKZA 3OOHA 3K8QA 1T36A 4MS4A 1E6EA 4LDRA 1BN6A 4TVKA 1MJ5A 3QEOA 1V7QA 2M87A 3RROA 5JMPA 3HKEB 3T5PA 1BDHA 1L4BA 3CZ4A 1ETHA 3GGCA 1WPGA 4GYWA 3EXHA 3LDGA 1QVAA 4GL4A 1BG6A 4L0YB 4DV1B 3MFKA 4FZRA 2E2HJ 1EUCB 2XQKA 2K7FA 3CJTB 2FSUA 3OEWA 2QVCA 4CXFA 5G3YA 4B0PA 4LXGA 1AMOA 1MUUA 1FOXA 1Y1WJ 5KYVA 2QTAA 4U7WA 1C4OA 5EEHA 1KVTA 1G3UA 1OHHA 3FVTA 4UTRA 3ZXIA 3S2YA 2OTCA 3KP5A 3VX4A 1NNI1 5HW0A 3MMYB 2G5PA 2Y0MA 3MTIA 4E21A 5K5OA 3D4BA 4X7BA 1XF1A 2XJ4A 5L6LB 1WHTA 1FDOA 1GOTA 4FDUA 1OX5A 2OGWA 5AIQA 5J2UA 3CCUI 2FR0A 3GLXA 1RAGA 4OIMA 5A0FA 2HXGA 1WAMA 5UKDA 3UJ3X 1JKFA 4UB6C 5AXDA 4LPKA 4EUFA 3W5IA 1QE5A 4ZV7A 1E96A 4QWMA 2Q7OE 1YGPA 2VDRB 1Q84A 3OIQA 3D6NB 2VJOA 4I4TF 2VDNB 2VPZA 3EVEA 3P96A 1VG9B 3TB4A 1ZM3A 4DDVA 3WYDA 3IKVA 1EVYA 2OTLI 5FKLA 4RVNA 2Q1WA 3TZHA 5LCXA 1V55H 3R60A 3CLKA 4DMMA 1J0XO 4GUDA 2VC0A 4XKWA 1MNQA 3T12A 1PYVA 5DNDA 3CZPA 1C14A 3TS1A 3UHFA 4KYVA 4A6EA 3VI3B 3I9NA 1K6XA 2GGSA 3ASOH 1SJ9A 1CQZA 1HGXA 2AMYA 3A9TA 4FFVA 1U5CA 5SY6A 2QM3A 2B78A 5BNZA 3MPOA 6REQA 1ZWLA 2DZDA 5IAOA 2ZXUA 1VF9A 2ZDQA 4EG1A 3NBUA 3OKPA 4Z0TA 5CB4B 3VR3A 4E13A 2PANA 1KMMA 1W34A 2NQ8A 3DZGA 5KDDA 4LQ4A 5EUMA 3K70C 4CNBA 3TQOA 3MMSA 4TVOA 5EIBC 2H5LA 2YZ7A 2GAOA 4ZT4A 3CF4G 1CG6A 1Q1QA 3K6KA 2GESA 1SQ0A 4URVR 1OY1A 3LZ6A 1C9JA 1QWSA 1D8AA 3W05A 2FSIA 5HE8A 1D2NA 1VL5A 2J48A 3O3MB 1Z8NA 3RPEA 5BRNA 1JILA 5FBVB 3R40A 2R7NA 4JGGA 4F4CA 3VVCA 2PGIA 1GUAA 1S7CA 2EV9A 3R74A 3FSJX 4KICA 1GAQA 4AY3A 4TXMA 3Q3EA 4GI7A 3D8BA 3R3SA 3NTUA 2L2QA 3IURA 2WKRA 5E3HA 4G5GA 3GFOA 4D1QA 1SOVA 4H17A 5DNUA 4OAYA 4QPNA 2CNNA 3H35A 2JVHA 3GZ6A 2ME0A 4FZVA 4S05A 4GYGA 3KZIC 3ZV5A 4Q1FA 4EY5A 1VE1A 1JIVA 1XCGB 4OA5A 5DNVA 3IH4A 4OQLA 4X7RA 4CO8A 3CUVA 5TMPA 2WYVA 2JH8A 5H2FC 1ZMTA 1NI5A 3FPCA 4GX0A 5DN6A 3BDDA 4BO6A 3OWTA 3IRUA 1BI1A 2GM9A 3H8JA 3ZQCA 1P4GA 3TMOA 1P0CA 3BGDA 4OREX 4JMPA 2HWWA 2UYCA 2CQ7A 3WLHA 4AIKA 2V6BA 4P4UA 4ZZDA 1Z37A 5JCJD 1M2JA 4TL7A 2PS1A 1R0BA 2JEOA 3LT1A 3S8PA 1IZYA 2I29A 4U9IS 1BMDA 2DUJA 3CXRA 2QW1A 1NBEA 4EI2A 1ZSYA 1PTKA 3RSFA 4QYSA 1KPGA 2E3JA 2QRVA 2V5UA 2Z9CA 5EQDA 1OAOC 5D1NA 3E5XA 4ZAYA 1J8MF 2CF5A 4OQPA 4D0NA 2QGNA 1GNSA 4RA9B 1P4RA 5LP6C 3MB5A 4I4TA 3EMDA 4J6FA 1TVEA 3EPPA 4URHA 5BN4A 2QVXX 4DRXB 3M2PA 5F78A 4ARZA 1Q7TA 1VLMA 2ZJBA 1UQRA 4NZ9A 3GJTA 4JX6A 3ML6A 3OPQA 2O8EB 3TNJA 2VB6A 1NT2A 1Z1DA 1Z4PX 4I8XA 2OYSA 1FU4A 4NH0A 4XRGA 2M0MA 1M1ZA 2M6SA 3ZTYA 2WF6A 3IE1A 3KCCA 2IQIA 1OXUA 4FP9A 1U0BB 3F5MA 3VKFA 1UEXC 2I9PA 4IFEA 2WWXA 2WSMA 4TMYA 3BKWA 2YHAA 3CH6A 4LF5B 3L9WA 2DTXA 1K9SA 3G4SI 3QPBA 3G6WA 3HADA 4NATA 4LC0A 5AVQA 1DFGA 3MGCA 2ET6A 1OI7A 1A4UA 1WW8A 4JB0A 1CCWA 3OIYA 4WKBA 3U4AA 1N5JA 2BYTA 1BYIA 1XRPA 2CXRA 1FDTA 4C7KA 2CDRA 3LXXA 2ZYVX 4AMUA 1GZDA 1AGXA 1KYVA 4BNXA 1MA0A 1SEUA 2GTHA 4N0MA 5JWRA 3EF0A 5EJCA 2CBZA 3SCZA 2PO7A 1IWBB 2QRUA 4IMIB 3O8RA 3F67A 2C2HA 3V4PB 3E9ZA 2VAMA 2FEPA 2OFFA 1EVIA 5IBPA 2GJKA 3VZDA 1PT6A 1WMDA 2EA4A 5TY0A 2IS6A 1D2RA 2ZTMA 2C97A 4MVYA 1FSFA 2N9UA 1U5AA 5I5EA 3ITDA 5FOVA 3FYCA 1C9YA 5IBRA 1ZDMA 3TOZA 1E2BA 2SCUA 4M0CA 2CWWA 5L3RA 3HHGA 4QODA 1T0BA 3H5AA 3JX9A 3IB3A 2MINA 5FBZA 4CV3A 4LK0F 5G1NA 2PO5A 3GNLA 1E6KA 1M2HA 1ZM2A 3A36A 2NU9A 2QSHX 4KO3S 4PUSA 1XZ8A 4N3NA 1PDOA 1G5FA 4PZJA 1NE2A 1PNRA 3UMVA 4I5DA 2BZSA 2VCYA 2ID6A 3UMSA 1N3YA 3OLQA 3PXCX 5ES3A 1N6LA 4K87A 4BEWA 1IHUA 4NMWA 4RKWA 1GU0A 2XUGA 3FPGA 2VJMB 2ZB8A 1W19A 4Q9AA 5C4IA 2PN1A 1ZNQO 3D54D 4UEOA 3UGTA 2IUSA 3UK1A 1R12A 5C51B 1A9RA 4A7PA 3QFHA 2RKWA 4MKIA 4MV4A 2H2GA 1UXHA 3JTGA 4UTZA 3KSAC 3R3ZA 2VPYA 3VSKA 3GRCA 4IRGA 1M5UA 4Q3OA 5AW2A 2B7LA 3QVMA 4Y9TA 5F2NA 3BR5A 1YS7A 3X2FA 1ZZGA 5JDIC 3GMDA 1GN9A 2E21A 2HSZA 4PYQA 2JJYA 2ANBA 3OZVA 4WW0A 2GUWA 4RZIA 5CEJA 1ZCFA 3LSTA 3JRCA 3CV3A 3I0MA 3ZD7A 1MJAA 2O8CA 2AJ8A 3TJZA 3BGIA 4FWIB 4XGNA 1YR2A 4HNGA 4AVYA 1DWUA 2PBRA 4ZC8A 5CPFA 2ZRBA 1B7GO 3BOQA 4C4ZA 3DKRA 5DX1A 4RELA 1DKLA 1AQUA 3VB2A 4X71A 3PQ8A 4UEWA 4X54A 4G26A 2KQUA 1IG7A 5DMXA 3AETB 1EQUA 3EWSA 4FFSA 3UK6A 1ZESA 2X9VA 4BB0A 3SIWA 1O5OA 4HEA1 1QFZA 1CJTC 1VIDA 2PSHA 5KX5F 3OCUA 1VI6A 2PIAA 1AUOA 4JB2A 4CMCA 3KD3A 5EYPB 4CMJA 3V8KA 4Y0NA 1ZIOA 5A2QA 5AW6A 4L5JA 2FUEA 4BKMA 3HZOA 4D9IA 2ZS9A 3BGVA 4PFSA 2D59A 1Q7GA 2XDWA 2CJPA 4KR0A 1S2IA 3WGNA 1XN7A 1NNSA 5LMUB 2KDZA 4JUIA 1YJ8A 1COWD 1X7WB 2JZNA 1K2VN 1OXSC 3OQJA 4M9UA 1X2EA 4WCGA 3NHBA 1NMYA 3OZAA 3OP4A 2VBZA 4E5SA 4QPOA 3I45A 1JLKA 2OV1A 2RKHA 3OZIA 3S16J 5CB0A 5C31A 2LBFB 2EPFA 4OB6A 4MR9B 1A27A 1L4KA 4NYMR 1J24A 3B6AA 4F97A 3CZQA 1KU3A 4IDEA 2A58A 1VDMA 4KYIB 1WSUA 2GN8A 3OX4A 2HFKA 1VQ5I 1G6NA 1KFEB 2NTYC 5J1SB 3OQ1A 1DU0A 1WXGA 1EX1A 2Y2ZA 5ARCA 2NPIA 4MMZB 1T43A 2COEA 1NG9A 3O2SB 1NLZA 3GTLJ 4BVLA 3NO4A 4L7VA 5JI2E 4UAGA 3F2IA 2CW7A 2AEJA 3HA7A 5I7OA 1XZEA 2X22A 3GBSA 2AHQA 4BJ5A 1OI3A 3UJNA 1Z0XA 2BFAA 5FWXB 5KQMA 3JARB 1Y8CA 3GUUA 2FPMA 1BVUA 1P3DA 2DY1A 3VSBA 2UYQA 3Q7TA 3D43A 4X97A 3ESWB 5GJWC 4QSMA 3FUXA 3U61B 3VTZA 3QOPA 2K2QB 2HZDA 4YFVA 1WV0A 5AIBA 5ICGA 1YZHA 5DCFA 3WL4A 4KAFA 4UREA 3HA2A 1SMKA 3ZDFA 4FFLA 1XTTA 3KVOA 1VQ7I 4UNNA 1ZJJA 2AVNA 3GGPA 2C0CA 5IM5A 5CX1B 2Z8YM 3FE2A 3GAZA 2I80A 1MH4A 3N9IA 5TR9A 5CVCA 5NULA 4E31A 1QLWA 4QDZA 2OL4A 1AKYA 2QD3A 3BRWD 1N2CB 1Z77A 2H09A 1RXSA 3OV8A 4A27A 3MLAA 1IHYA 2GFQA 3BH7A 3E7PA 4MVJP 3NM5A 1ORKA 2ZJ2A 3PRKE 2P5TB 3A14A 5DHFA 2Q6KA 3V34A 3ZZ1A 1DDIA 4GBMA 1Z6GA 1IIRA 3NR2A 3VU9B 4KMFA 1JAIA 2QQAA 4YJDA 2BEUB 4US1R 4JU9A 5E1WA 1JPNA 2UVPB 3N86A 4ZYGA 1AZTA 3OKCA 5JXJA 4JELA 3LTNC 5KX5A 3FXMA 1P33A 1I6WA 1R23A 3I5UA 2ZT7A 3FFXA 4I6ZA 2W4MA 3ESXA 3A9UA 2Q1ZB 2I67A 6ADHA 3BJZA 3SXYA 4NEQA 4OKNA 3IE0A 4HNVA 2B92A 4QO8A 3DEIA 5GTDA 1WZIA 4U3JA 3E3OA 3G1OA 4EJTA 1ESMA 2HMWA 5EZGA 2R8ZA 3D7NA 3G88A 4C3UA 5CFPA 2X77A 2XCIA 1F8GA 2QZ4A 5BUSA 2XD9A 5TEVA 4XCQA 2MR6A 1ODSA 3X1DA 2INGX 3HSEA 1LLCA 2AYYA 4C2UA 4D9BA 3UT0A 2F9MA 4HUQA 3FK6A 3HB7A 1F60A 3E7FA 1V1RB 1K78A 3UMRA 2WA2A 4FQ8A 5AHKA 3VDRA 1NN5A 3KO8A 3EAGA 5LHHA 3G3ZA 1ODCA 1LD3A 1A7AA 1PJTA 3WMEA 3A3OA 3IP6A 1V48A 2WYIA 1TE2A 1EKEA 3IP3A 4M73A 4NXMB 4TMZA 3HKBB 3GO5A 1E1QD 4DCGA 2R84A 4G24A 1F5TA 1XHFA 1X9IA 5B36A 1WSDA 3AUSA 3KJGA 2JRCA 1W0UA 1P75A 3ROEA 4JJ8A 1YOVA 3AM3A 5ICMA 3JYQA 4UHDA 4OB8A 4WZ6A 1R66A 1E32A 1CY2A 2CMKA 3ZD9A 3C45A 1KU7A 3RQIA 1XDGA 2HF2A 5CURA 1V95A 5K0GA 2EDAA 2AS5F 1RCFA 1D0ZA 1CXZA 3ANNA 4G0PA 5D5VB 4UXIA 2C2YA 2IUFA 3QEAZ 1JAXA 1L4NA 2G67A 1M1YA 4M6WA 1RYHA 2FHSA 4X0GA 2HOTA 3MCWA 1ZJ5A 3PNSA 3WODF 3VJRA 4HC4A 4AZWA 3C41J 2IYVA 5CYPA 1E2DA 2R7XA 3ICWA 1JKXA 3WKAA 2ZDGA 4I6JA 3TGWA 2CLKB 1T35A 4KDEA 5ALWA 1BIFA 3P4XA 5LJIA 5FULA 3J80Z 2EP8A 3CSUA 3IOCA 4H31A 2R2GA 1CQXA 3U21A 2AO9A 4FU0A 4NOKA 4YRRA 5B7QA 5G02A 5CNMA 4KMRA 4BV2A 2EFGA 4QUIA 3DR5A 1T3SA 1QKJA 5GADJ 1QC5B 3GGGA 2PSFA 2YTZA 4PRZA 4N7JA 3FMFA 3ORRA 3EGDB 4LEIA 1NQXA 1EDBA 3AEKA 3PVZA 5T67A 3TFWA 1K7AA 5FNZA 4QQ8A 4O6VA 3A37A 2IL1A 4K03A 4X91A 3FKIJ 4WVLA 4RTRA 2WFLA 4RCVA 2FPUA 3TK1A 1J90A 3ANTA 2JGKA 3V97A 1U5TB 5JC8A 3AIIA 2FAXA 3S2DJ 1E1CB 2G5TA 1XMIA 4L9NA 3BOSA 2HZTA 2J7PD 2YC4C 3HYIA 1QZUA 5DFAA 2M3AA 2EP5A 4X1OA 3ONNA 5AVJA 4TMTA 3ZMTA 4U7JA 5K0BA 5HNKA 1XMXA 4M60A 3K4KA 2QUHA 2VHZA 1VZ2A 1ESCA 2A94A 2OE2A 4BJ1A 2PQMA 1LLDA 2O8FB 4YRFA 4DPMA 4LRQA 4L8YA 1NDHA 1SVWA 1E4EA 4TQAA 2ZYUX 1T56A 1Q44A 5IJXA 4IMJB 4HVTA 1O4VA 3OURA 4TTAA 3HG7A 1SVMA 3A2NA 1YH3A 1E6WA 1ND5A 2HWUA 4CCMA 1Z5GA 5DE3A 5IASA 2J07A 5EWLB 3N87A 3M1IA 2KP6A 3KEMA 1X3LA 2LDXA 1O96A 3UOGA 1UMQA 1Q11A 4MIKA 4DLLA 4AQDA 2LR8A 1BFKA 1X80A 5EKUA 2X9DA 5D85A 2IIPA 3GEPA 3EDQA 2WILA 3EH1A 3ROMA 4YGYA 3WK5A 4RM2A 3VFDA 2J6CA 1D8KA 3S3NA 4HBZA 5KVQA 2HHLA 3MG9A 3A3NA 4AWXA 1GRVA 4MGIR 3WADA 2J31A 3QOWA 1E18A 2E55A 3T3MB 4YONB 4FNGA 4LJAA 2A4MA 4MW2A 1NVKA 2X51A 5BO5A 2SNIE 3GA0A 3E7LA 2BGLA 5FIUA 1N7IA 5F9HA 4RS8A 4WKCA 4NDNE 2E4WA 3V8BA 1FU7A 4J0GA 1UFQA 3N5CA 3QFFA 2H07A 4BNJA 4FGWA 3SYNA 3OJXA 1W5CC 4BQNA 5JTTA 1Q50A 4MQVA 2GCOB 1FY2A 1ZAOA 3F47A 5JCJA 1TPYA 1SG6A 4YQYA 3WNQA 1EI9A 5KYYA 3WHIA 2VBXA 2BGMA 4HAMA 4Y17A 3VSEA 4IVPA 1J42A 3U44B 1Z0KA 2CFIA 4IHWA 1C2YA 4KWHA 2YHIA 4FLFA 3GCXA 2W93A 3V6MA 3UCFA 4PGFA 5DGIA 1V8ZA 3RKXA 4EUNA 3ZI0A 3AL0B 4HH3C 5C1BA 3NHRA 1Y6JA 4MEBA 2DFDA 3LX4A 5A4KA 1N1DA 4ZTUB 4NHJA 3Q3HA 4LD5A 1AHNA 5FEUA 4FOSA 1TJYA 3EJ6A 4R69A 3BXZA 3GLLA 1MBGA 3CCQI 3LT5A 5BMOA 5CLGA 4RV4A 1PGJA 4ZCRA 4S24A 1YVRA 3OE7D 5KSPA 1VE7A 2CRGA 3WHKA 1PO7A 3KXPA 1JU4A 4HV6A 1SZJG 1CP2A 4XR6A 5JSZB 6NULA 1YRWA 4IG4A 3TSZA 1YSCA 3OQIA 1WCYA 2O0JA 2Y68A 4AN0A 3U5TA 5E9WA 4P82A 1ULYA 1SCJA 3KEQA 4XX1A 2CW0F 3LM8A 3WTYC 1N0WA 3PUHA 1J0EA 5CTJA 5LLDA 1PI3A 2K5CA 2Y1DA 5JI3E 2PKYX 1YUMA 3BA1A 3L46A 4KNVA 5HWSA 5DDIP 4HGNA 2XLCA 2ZTVA 2W7TA 1PR2A 5IF3A 5DCMB 4LB6B 3K1PA 4G9GA 1OXMA 2H2DA 2AT1A 2DK8A 2WFZA 1CRPA 3DPTA 4CDNA 2Q4EA 4ERXA 2HQRA 1U8CB 2ZIUB 5F1RA 1WBBA 3CCFA 4IX7A 3HCDA 2P9HA 3MUNA 5CDYA 1FVHA 3CPHA 4MLZA 4FHDA 3QEMA 2J4CA 4N54A 4A6DA 3UMCA 2XVYA 3NMUF 3OLWA 3RR2A 2GLUA 2AOTB 4PDKA 1LV8A 3LCVB 4YQEA 2CXUA 3CWZA 1F8XA 2Z5VA 2UAGA 1EHCA 2XF6A 1M83A 3KPYA 1FSSA 4BYYA 4DNQA 3KSZO 4BPRA 1Z5PA 3RRXA 1LEAA 4HP8A 4Q4LA 3AHHA 3G8AA 3EVFA 4ALJA 3AZOA 1KRWA 1H2RS 1P72A 3ICQB 4WXYB 3PNPA 1SIUA 5EN4A 1GTZA 5BV1A 1MR3F 2ZB7A 2QR5A 2A9OA 3W9YA 4JJFA 4I8DA 5J5AA 5BQFA 4IDBA 4D3SA 1OD6A 3L18A 4E4RA 4BNWA 4L5AA 1Z7LA 5B12A 2I65A