4E70A

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
359
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPVLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
molecule tags Transferase
total genus 128
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4e70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4e70A02
1RI5A 1YO5C 2KJBA 1P4XA 5DEQA 3F8NA 4NQWA 1Z1DA 3MEXA 1OYWA 3ZMUA 1J59A 2ZBKA 1XN7A 2DAOA 3I4PA 5GINE 1HXDA 2VS1A 3ML6A 2CMHA 1W5TA 4KDPA 5BW4A 3E97A 4PGHA 3WGHA 5JUWA 2PX5A 1L3IA 3BZ6A 5E2BA 5DM4A 3KQWA 2OAZA 2JZYA 4G94A 4KDCA 5JHUA 4EJWA 2J5OA 4WCGA 3MWMA 3KPVA 4XUCA 4AIKA 5EGSA 1ODDA 5CVVA 3TGNA 4ON0A 5LGUA 4YMGA 3I59A 5DXJA 1R8XA 3KR9A 4PYIA 5E9QA 3LDUA 4RS8A 2HYFA 2O61A 3I54A 4P9UA 1O7LA 2NXNA 2VDWA 4HF0A 2ADUA 1NW6A 4RB1A 3EMDA 1FLIA 2Z99A 5DUIA 2UYQA 4OMYA 2EA2A 4QPNA 4YUXA 1J0RA 5DXAA 1AOYA 1AWCA 1GVJA 4I2OA 2EG5A 2ZIEA 4U0WA 3THSA 1UFKA 2GQQA 4M73A 5EEHA 3T5XA 5LHGA 3NRVA 4H0NA 1QO0D 2Q0OA 5JFRA 2P3OA 3UBTA 2FHPA 1K7AA 5EG5A 2RV8A 2PG4A 2ZBRA 4DMGA 5HEKA 5FQNA 5H6QA 4X60A 3B02A 5E1ZB 2QQ9A 1B9NA 2AOTB 3LCVB 3LX6A 1ZQ9A 5LEKA 2IGTA 5FLXZ 2A07F 2KIMA 4BY9E 2D45A 3OE5A 5KQRA 3GXOA 5GOZA 3KE2A 5BXYA 1KPHA 3P2IA 1EV7A 1JG4A 2VN2A 2A6EF 3HHGA 2RGVA 3M9AA 4FT8A 1R6AA 3K6RA 1V3FA 5GP1A 5CCXA 2HQNA 2OU2A 2R3SA 3GZ5A 2PX2A 2XVMA 1F4KA 2IPQX 3ZN0A 3V4GA 2PKWA 4DQ0A 5DM2A 2A69F 4E31A 3UJ6A 3P7NA 5DX8A 5IT9Z 2W25A 1AV6A 3DKWA 4RTPA 5KK1A 4CDGA 4H0EA 4RX1A 2HFHA 5K0LA 2MH2A 5LGNA 5TRDA 4CZZA 4P5OA 4V0QA 2VONA 2HKOA 4ER3A 4FT4A 4RYLA 2P35A 4AX8A 2EX4A 3DH0A 1CGPA 3EYYA 2JHAA 1NT2A 2NXJA 3Q87B 1QYRA 5J8CA 4RSRA 3PQKA 3SZPA 3E6CC 5E20A 3KHKA 4HYEA 3BROA 3E5UA 1BHJA 2OB2A 3OZRA 2HTSA 4HQMA 4M6YA 3KEOA 1ZLKA 4IHTA 1G55A 2EV5A 1T2KA 2ZWVA 3SSNA 5F2NA 3ME5A 3ISPA 5LLQA 3ZPLA 3EYIA 3IKVA 2VOOA 2EV6A 2HOEA 3F3XA 4ENJA 3FUWA 4WK8F 3FYDA 2K4MA 3LFKA 3C3WA 4FS8A 2LNBA 2CYYA 4A0XA 4G7OF 3MAJA 4QQKA 2UZKA 2BEOA 1MGTA 3OCJA 1TW2A 1JG3A 2H94A 4CGZA 4E33A 2Z6UA 1D5VA 1ZLJA 1SUIA 1S3JA 2QRVA 1DL5A 2RDPA 3EGVA 2Q8KA 2M1BA 4U0YA 2EFNA 5DM1A 3V7CA 3P9IA 2OXTA 2V9VA 4HA8A 2O05A 5HILA 1HSTA 3BJ6A 1U5TA 3FXUA 4FSDA 2C7PA 5K8VA 4R8HA 3K1NA 5C1IA 3KLNA 3HA7A 3QU6A 1KP9A 4G56A 4ATNA 4HX7A 5LHHA 3JW4A 2G7HA 4M36A 1NKVA 3RJPA 1N2XA 4LB6B 3D2LA 5D5VB 3WTSC 2QY6A 5DPMA 4PNEA 5K0EA 2P7HA 2FA5A 1ULYA 3NTVA 1XSXA 2PV0A 5D6EA 4F7ZA 2I7CA 1W7PB 1O54A 1XSVA 2VDUE 3GO4A 2A61A 2DK8A 3WU0A 2KJCA 1ONVA 2H1RA 1T38A 2G8NA 2K4JA 3JWGA 4M9XA 3F21A 4S05A 3EVBA 3KFWX 4LECA 1ZRDA 1QAQA 3FPFA 5ICCA 3EVDA 2Y1XA 4C07A 4ESFA 2RNJA 2YSRA 1OR7A 2ZJ2A 3ZMTA 2UZ4A 2EFWA 1J9IA 3AAFA 5BW5A 4HX8A 3PT9A 5DTMA 1FZPB 4BP3A 2Z33A 4RTSA 3WTUC 4L9JA 4LK0F 4CXMA 4RGRA 2ETHA 3F8BA 5DWQA 2XRNA 4XSZF 1TTYA 2H00A 2ZNYA 1VBFA 4F85A 4L9VA 1R5GA 3V8KA 4XLNF 2HGCA 3O6BB 1EJ6A 2ZZNA 3C3YA 2EFOA 2XASA 4P7JA 2PT6A 5E8GA 3HVJA 2NNNA 3P8ZA 1IW7F 4LLLA 4OIOF 3NW9A 2MBFA 2E1NA 2Y48A 3GUDA 4ESBA 3ERCA 4HBLA 1B6AA 5D4SA 1RUNA 1YW7A 2FU4A 3FTEA 4U7PB 3WTXC 2V74B 2DI3A 3I71A 1VTNC 3KKZA 4QVKA 3GYHX 1I27A 1B4AA 1RJGA 2YVLA 3EGEA 5K1YA 3DR5A 2XAGA 4AZSA 3BUSA 3K0BA 4EJTA 5DYMA 1U2WA 4PGGA 3SFZA 2MH9A 3J7AO 2XYVA 3U9GA 4DNCA 5D1NA 4CTJA 5L3CA 4G7ZF 3EMBA 3GDHA 7MHTA 4WXDA 3IWZA 4G8XA 5C0OE 2RVCA 2CSOA 5GIPE 3T7RA 2NRAC 1JHHA 3OU2A 1CF7A 5D8LB 2AZTA 1MHTA 3I5UA 3R24A 4E2ZA 3UA3A 5BP7A 1XTPA 3LAJA 3E8SA 5BOXA 4M9ZA 3TKYA 4IF4A 4IHSA 3OOPA 4RV9A 2Z6AA 2QM3A 2HQRA 1IN7A 5K5RA 3HVHA 2ZBQA 3JSPA 2DULA 4PCLA 2JRTA 1OR8A 4BHCA 2OZ6A 3KR2A 4KA4A 1R22A 3K0LA 1EQAA 1FBQA 2AS5F 3IYLW 4KUMA 1DP7P 1YW9A 4RTNA 5LGTA 4HAMA 3QP6A 4RWZA 4ENKA 1NE2A 5D4RA 2NXCA 2M87A 1Z9CA 3R3HA 4ER0A 2NP7A 5FWAA 4GC9A 3RKXA 3FZVA 3L2CA 2AR0A 2K02A 5ILVA 3AXTA 3HCFA 2Z9OA 3R9XB 1DPUA 3G3ZA 2B78A 1BC8C 1BKYA 4HDVA 5FD5A 3FRIA 3P2EA 3GRUA 4KN7X 4LWOA 5KS2A 1MZBA 3M6XA 2WA2A 4AIJA 1Z7UA 1FYMA 2E1CA 5U4XA 2AVDA 5KQSA 4EM0B 3IRRA 4X61A 1R8YA 4OA8A 1RNLA 3PFHA 3NJRA 3OU6A 4RB2C 3WTWC 2ZFUA 3B3JA 2CW0F 3L8DA 4XUDA 5CUQA 4IV0A 1PP8F 1DPRA 3DEUA 4I09A 3A7EA 4KRGA 3LA3A 2FBHA 2DQLA 4PCAA 2CGPA 1KIAA 3BWCA 2X0LA 2P8TA 5FADA 3TM4A 2IRFG 2YPRA 3TOAA 2WK1A 2B25A 3D5LA 3M70A 1XCBA 1YQAA 4HH4A 1M6EX 3BJOA 3L9FA 3B3FA 1R7JA 2HNKA 1A04A 3LSTA 1YG2A 3GFMA 2HWVA 1EAMA 3SQNA 1R36A 4ZYDA 1X1DA 3DLCA 4ESJA 3J81K 5ICFA 4YFNF 5L3FA 3LCCA 2PEXA 4PINA 1W4MA 2QENA 2ZW9A 4YIIA 2QQAA 4DQ2A 2PSSA 2K7LA 5LRRA 5KYGA 4NECA 4EQQA 2G9WA 2AOUA 3GRZA 5E1BA 1KPIA 3FM5A 3MB5A 1YFJA 1EG2A 5D8KB 3LKDA 2IH5A 1X1CA 3BDDA 2VP3A 2G1PA 3G88A 4KIGA 2FYTA 3KETA 2NYXA 3FM3A 10MHA 1MD0A 2V79A 1JGSA 2ZULA 1IN6A 2WTEA 3IV6A 3HSEA 1S29A 4QTTB 1JQ3A 3KP4A 5L3DA 3RDIA 3EDPA 3K9TA 4RTJA 2NS0A 4OIPF 5K05A 3TO7A 3H92A 3R0QA 3M8EA 3BGVA 1O9HA 2GXBA 3BPVA 3VC1A 3PFIA 3J80Z 3WTYC 5LQJA 1SG9A 2H6BA 3BWMA 3NWBA 1SD5A 5CCBA 3GW2A 4O6JA 2L4AA 4LK1F 2CQKA 3HIFA 1V39A 4CHUA 2UYOA 3T7TA 5K0JA 3FUXA 3LWFA 3EVEA 3BPXA 3TQSA 3BT7A 5D6FA 4FX4A 3V7SA 4IKPA 1WS6A 1BI0A 3HEMA 4R8SA 3FMQA 2VT2A 1XDSA 2AOWA 2DTRA 2P5KA 2BV6A 1P91A 4MWZA 3KQSA 4KW7A 3UA4A 1SMTA 3QOWA 1NW5A 5G02A 2HYGD 1EH8A 2GA2A 3OZTA 5HS7A 2STTA 2OQRA 1GHCA 2GWRA 3OU7A 4AD9A 1FYLA 4O3MA 4RGUA 1O9GA 1QANA 3WE2A 5EKXA 3DULA 1H1DA 1RZ4A 4I0BA 1NV8A 2ZTHA 3EVZA 2GA1A 2XKOA 5E8IA 4DKJA 3E6DA 5CVDA 2F5CA 3MQ0A 2YUIA 2ISZA 2ISYA 4CKBA 3E5XA 1HBXG 2XKPA 4U7DA 3GRRA 1YTYA 3CUQA 2STWA 5DRYA 2X4HA 3GFIA 1K6OA 3LDGA 2C7QA 2W84A 5IH3A 5HIIA 3KQOA 4F84A 2DK5A 3MFKA 5ERGB 2B9EA 3SR4A 2O0LA 3BWYA 2EV0A 1KYWA 3GFLA 4P58A 3UJ9A 2E7XA 5HZMA 2LF8A 2UWMA 2AVNA 2P5VA 1P39A 5K0NA 5CIYA 4HLYA 3GWZA 1J7KA 4KICA 3HA5A 1FPQA 1LDKB 2LSOA 1XVAA 4BP1A 5AIQA 3KQMA 2ESNA 5HLIA 3GF2A 1KGSA 1SMYF 3JTGA 2FRXA 1R74A 3A25A 1O3QA 2PXCA 2PJDA 4ISCA 5P8WA 1PUEE 4Z2YA 2MC3A 5DX0A 3HRMA 5KVRA 2F5FA 3THRA 1YS6A 4PYKA 3P71T 4YV1A 3JTHA 3RIEA 3ELUA 4GYIA 2IDKA 1DUXC 1D8KA 2NXEA 4XLPF 2OKCA 1D8JA 1KU9A 3HCCA 4LG0A 2MD5A 1IXCA 1SQFA 1Y0UA 2FXAA 3I9FA 4XCXA 5EMMA 3N97A 1PDNC 2G72A 3BKWA 1QNTA 4OQEA 4L5IA 3NDIA 3CLOA 1O57A 5BPIA 1XGSA 4OA5A 3ER9A 2Y0MA 5EKUA 5E8RA 2FEZA 3HP7A 5A2QK 4LLGF 1BIBA 3RYPA 1R1TA 1T0FA 5F6FA 1BM9A 1VP9A 2QLZA 2VXZA 4HZFA 3O4FA 1FWZA 3F23A 4AZTA 1X1AA 3C1DA 5CJ9A 1VLMA 3ELDA 2LD4A 4E32A 3QU3A 3T8TA 4IJAA 1TLHB 3FF5A 4F86A 8MHTA 3HHHA 5HS9A 3IKTA 1UHMA 4KDRA 2PLYA 1JTEA 5IT3A 3GJYA 2WWYA 1Q1HA 4MEYF 5IKMA 3WGIA 1XGOA 4HRAA 4M74A 4A0YA 3SMQA 4FHTA 3ID6C 2B3TA 2IPXA 2AXLA 5DV5A 1FBUA 4LGWA 2FCAA 2A14A 5DT2A 3JAMZ 1K78B 3G89A 1QAMA 5GIOE 3DQVC 3EPPA 1JQEA 4WXHA 1LDJA 1FJXA 1ZN2A 3ECOA 1FSEA 1Z05A 4WXCA 3TOBA 5FHRA 2JPCA 4EK9A 2H09A 4Q5SF 3PB3A 5DDGA 2FNAA 1B59A 4LD5A 1U5TB 3L09A 5EIWA 1D2GA 1P1CA 1FY7A 2HTJA 2ZMEB 3GGDA 2GLUA 5HDKA 4CYDA 2P41A 3PTAA 4BHPA 4FZVA 1XCLA 2GPYA 2FOKA 3HTSB 2Z5UA 1I6XA 2FRHA 2IVMA 3ABUA 1F38A 3HM2A 3FWEA 4I0AA 4MQ4A 4PYQA 3GO5A 4R79A 3KP7A 1LVAA 2MLKA 3E5QA 2UXXA 3IL2A 4U0VA 2GS9A 2VC1A 1ZKDA 1AF7A 4OX9Y 1AQJA 1G6Q1 3FHZA 4S04A 3UJ8A 2L01A 4HDUA 4HQEA 1J5YA 1KR5A 5D5XB 5D5WB 3BWBA 3UWPA 2DO7A 5HS8A 2L4MA 1KU2A 1NW8A 1SD6A 2HZTA 1R58A 4HF2A 4CO8A 3ELKA 5JI6A 1TW3A 1F5TA 3WE3A 2Y1WA 4GF5A 1XDUA 3EUHA 5CYVA 1S6LA 4Y17A 4L0ZB 2AOXA 2VT3A 3RIRA 1BOAA 1OYYA 4UVCA 4HTFA 3JSOA 4L5JA 5DUKA 1SVUA 1J75A 4AIHA 1MJFA 4R6WA 2KIUA 5BMZA 4FP9A 3MCZA 5L3BA 3ZP5A 2YXEA 2Q41A 5K03A 5J6XA 2AOTA 3A27A 3OFJA 4N9HA 4M9SA 1ZG5A 3PS9A 2BBYA 5HIKA 5K01A 2QBYA 5DCFA 3LAPA 2DU9A 3CUOA 3FTDA 5CLSA 4KFCA 5DLYA 2BM8A 2O6GE 2BGCA 1MDMB 1X1BA 2JT1A 3O2PE 3KZZA 3QOXA 3NQOA 2O06A 1R5HA 3LQRA 2FK7A 4YMHA 5GM2A 1MJAA 1NHAA 2YX7A 3FRHA 4KNYA 5MHTA 1R18A 1XJ5A 2F2EA 1H9GA 5BPDA 1KU7A 1H9TA 3M6UA 2XIGA 1OKRA 5CVJA 1HSJA 2A3SA 1WZNA 4RAZA 5FCDA 1ZYRF 1L3BA 3WU1B 4IRIA 2OD5A 1FNNA 4PYLA 5LQRA 3U2RA 2XV4S 2NAZA 4FR0A 3HSRA 3L7WA 3LCUA 3CJNA 3QPTA 1ZARA 3EVGA 5EVJA 4CWAA 5ILUA 2DLLA 1CF7B 1TBXA 2LKPA 1IRFA 4K2EA 2BR4A 3FPEA 3R60A 3HCAA 4RTRA 4HV6A 5EEGA 1ZREA 3CDHA 4CKCA 1I5ZA 1SD4A 4R8RA 3HCDA 3MTEA 3HVKA 4EJOA 3RW9A 3WTVC 2M45A 3JWJA 3CGGA 3V97A 1USTA 1ZGAA 2Y75A 3IHUA 4GCVA 1D2HA 1M6YA 2OA4A 2F5EA 1NBHA 3G5TA 1QZZA 4HG2A 4U88A 4RVGA 5CVUA 4PWYA 1BIAA 3TOSA 4C08A 2QE6A 2OBFA 4FX0A 2YU3A 1B42A 1LQ1A 3EVCA 2PXAA 2VDVE 3DXXA 3E6BA 4GOND 2IW5A 5ILSA 1H0MA 2VBYA 3CC8A 5HIMA 2IBTA 1BC7C 5KVAA 2R6ZA 2YQZA 5CVEA 3IC7A 2V6CA 5ED4A 2BZGA 3UJBA 1V4RA 1NBIA 4QTUB 3R6SA 4YV0A 4YV2A 1JQDA 3EGIA 4HOBA 2OB1A 3OFKA 2EWNA 4EJVA 3RPQA 2BYVE 1IF1A 4A0ZA 4EM1A 2QYOA 4LLNA 4BHBA 4IV8A 4PDKA 4RGXA 4B09A 3SHFA 2UYCA 1FOKA 1ORHA 1UWVA 2ZCJA 2P4WA 4QDJA 4C05A 4MEXF 4DZRA 4CICA 1REPC 1ZG1A 1JSZA 1ORIA 3FTCA 3OE4A 4V0RA 3SX0A 5DTQA 4A6DA 5F1RA 2PWYA 3B3GA 5E1XA 2XROA 2UXNA 2D1VA 2VC0A 3ABTA 3V8LA 3DXYA 4G6QA 3ECHA 2P40A 2NNYA 1EIZA 1Q0SA 1OYIA 2FF4A 1INLA 2AN5A 4L9TA 4ER5A 2ZWAA 5E8JA 3MZYA 1RI1A 1UCRA 2ZVJA 2Q2EA 1M0EA 4RAYA 5EMLA 1YIOA 2TDXA 3N4MA 5HFJA 3HA3A 1FSHA 4GXOA 1D3YA 3I58A 2P7CB 2ACJA 1RI7A 3LQQA 4WX9A 4FGZA 1JTFA 3C18A 4IPAA 3JWHA 5E9JA 1SFXA 3BXOA 1XCVA 3LDFA 4A12A 4BXUA 3MQ2A 2D2WA 3JWIA 4X41A 2ORED 2GIVA 3ER8A 1BJAA 2OQGA 2JTVA 2O03A 5BS6A 2E5WA 3AJDA 3GIWA 2XGXA 4ETSA 2COMA 4YUWA 1QZYA 2OZUA 2ZNZA 4GOLD 4BLWA 2BR5A 2PMUA 3G2QA 1GXQA 1I1SA 3S2WA 2VBWA 3LBYA 3GCZA 4HLXA 5FQOA 4OBXA 1U6GA 2VOPA 9MHTA 1U8RA 1VE3A 1VL5A 1G38A 4GGGA 5DCMB 1K79A 5EQJB 5E1MA 1IM8A 3R6TA 4RTOA 2W85A 1IUYA 1J2XA 4BYYA 5K09A 2FBKA 2OO3A 4A6EA 4QDKA 3G73A 4LJZF 3GX4X 5DRTA 1ZAOA 3PVCA 1GXPA 2IA2A 1WKMA 1XDZA 2VODA 3BGIA 3CO7C 1R23A 6PAXA 5IT9K 2KKOA 3RKYA 2IFTA 5EHIA 2DFIA 4RTQA 1F9NA 1WQ2A 1ZGJA 2FE3A 2ZCWA 2B0LA 3D0SA 4ASNA 1BI1A 2PQ8A 2HTEA 3HVIA 1HW5A 1P4WA 2YR0A 4EJUA 3FMSA 5ERIA 2IIPA 1BI3A 3KR0A 5T64A 2FBIA 5F2OA 5FD6A 1IY9A 1AQIA 3CUQB 4GOOD 2GA9A 3AXSA 3B7PA 4C4AA 3ZQ7A 4U7BA 3CCFA 2PN6A 3G8AA 3DMHA 4EGYA 1MJBA 2HR3A 2XUBA 3LA7A 2IA0A 5F2KA 2DBBA 1PJZA 2W57A 4Q4ZF 2G7UA 2IP2A 5LQUA 3MTIA 2PX8A 4QQNA 1R00A 1YF3A 2PJPA 3Q5FA 1P92A 4CTKA 2YXDA 5AONA 3KLOA 4RTKA 2JHPA 4A5MA 4L0YB 4LB5A 2R7FA 1TPYA 3W6KB 3DMFA 2P5LC 4HC4A 3QV2A 3QOPA 2FNPA 1VIDA 3KP6A 3I64A 3FPGA 1RIOH 4UVAA 1IN5A 1LDDA 5FUBA 4BQAA 1DCTA 4XSXF 1UIRA 4E2XA 4Q47A 3SXJA 3I59B 1YZHA 1F1ZA 4WF2A 4A2UA 4N9IA 4RB0A 2PX4A 1TQMA 2RQPA 4P96A 1PRYA 4LG0B 3KQQA 3DLIA 4MGRA 1G3YA 3TDZC 3BZBA 3G2MA 2HR1A 1WWXA 4L18B 3FPJA 2NYUA 2O3FA 2P7VB 2DPMA 4PYNA 4AZWA 4N0BA 4OBWA 3A26A 3FUVA 1HMYA 3TQNA 3NWEA 5B1SA 2VBXA 3DOUA 4UUVA 5H20A 1WXXA 3GRYA 1LEBA 4YUZA 2ZBPA 2O8XA 4HW0A 4MNUA 4YUVA 3M33A 3G7UA 1SFUA 5DD8A 2H6CA 2EJUA 4BAYA 3KCCA 5GM1A 4P9FA 5DD4A 4HGZA 3SZTA 3REOA 2ONYA 2K86A 2HV9A 1IXKA 3S68A 2BH2A 2KIFA 1O3SA 3P9CA 1G6NA 3SM3A 5FO5A 4GO1A 3ERED 4HF1A 4C04A 2JHCA 1L3CA 3R0AA 1JG2A 5K5OA 2XYRA 3F6VA 3FUUA 2IH2A 4KIBA 2M30A 2DPUA 3KPUA 2YX1A 3OV8A 4KVZA 2XAFA 3MGGA 2QZ8A 5M5BA 1P4AA 4DCMA 3HCBA 2DQRA 3P9KA 2YX4A 2UYHA 3R0JA 1I4WA 5HDGA 1SUSA 2RKHA 3MZHA 2OPBA 2C7RA 1TQIA 2L02A 3KP2A 1S8NA 2O57A 1QAOA 3GNLA 2HDCA 1U3EM 2P1DA 3M6WA 1FBNA 5FWDA 1E17A 3IRQA 4Y13A 2CG4A 2AN4A 5H6RA 1LEAA 4AZVA 3DUWA 4GUAA 4OOIA 4MIKA 1S7AA 2BE5F 4YG2F 4M38A 2XBMA 4GQBA 3P97A 5LQCA 1O7FA 1FX7A 5K0GA 1KQ8A 2KW5A 3T1BA 4AVPA 3LGAA 5EMJA 3NMUF 4ENMA 2HMYB 5TJJA 1U5TC 4E2YA 3ROUA 1R1VA 4YIFA 4EM2A 4KMFA 5DSTA 3IWFA 1G3SA 2P7IA 3KQPA 4PIMA 1XMAA 1IXRC 4KWCA 3NVMB 5LBQA 1IZ1A 5JR3A 3RTRA 4MQ9F 1DDNA 2JH8A 3LPMA 4IWNA 1E2XA 1KQ0A 3VEPA 3U81A 3GRVA 3ZN1A 5EPEA 2QVOA 3DPTA 5HIJA 2HS5A 1G3WA 4LWPA 4PYJA 4M7RA 3ZMDA 5E17F 2L54A 2LDUA 3H3UA 4HTFB 3PQJA 1YYVA 4JXJA 3G8BA 4ER7A 2QRVB 1UFMA 4XRFA 5JVTA 4JBAA 2VE9A 2ESHA 3U1DA 3TMAA 4GC5A 2PBFA 1Q0TA 2GAUA 2Z3YA 4Q48A 3CJRA 3RKWA 4OIQF 2QBYB 4GBED 1U78A 2EB7A 1R1UA 4DCGA 2PI0A 4PYOA 3VB2A 1N7JA 4OQDA 3O3KA 4I02A 1NV9A 2CKDA 5E1WA 3J81Z 2CO5A 3TFWA 1NW7A 4I7HA 3VSEA 3UJDA 5FTWA 2MLGA 4EKGA 4ZYGA 2P6SA 2E7WA 3KP3A 4I01A 3VFZA 2ZFWA 4ZZDA 3LBFA 1X19A 4QPPA 5LQNA 5E9WA 1QGPA 2HEOA 2PXXA 1FP1D 2AOVA 4Y2HA 3BOQA 3P9NA 3E3VA 1TNTA 2HKXA 4L9NA 5DX1A 4PCQA 3Q9SA 1BBYA 4EGZA 2P6TA 2EJTA 5FHQA 3F6OA 3KR1A 4CKEA 3DFGA 2PFBA 3SGLA 4KMUX 4MHGA 4G9YA 4LMYA 1YFHA 4PIPA 3LHDA 5C9ZA 4EV0A 4A5NA 5FA8A 3FYCA 4DF3A 3CBGA 3T0YA 3QAHA 4JK1X 1L0OC 3BWGA 3H2BA 1ON2A 3WG9A 3DPLC 3K2ZA 4MTDA 4OINF 3BKXA 2O07A 1WRJA 3AWIA 3KU1A 3PX3A 4MTEA 1FC3A 1IN4A 3TKAA 2M5WA 3GFJA 3QPHA 1OMIA 1IRGA 4R05A 4ZYHA 3F8MA 1QBJA 3AY0A 3DP7A 3DMGA 1I9GA 3GU3A 4PONA 2ONZA 2G70A 3HCEA 1YLFA 4XBFA 2QUFA 1XB4A 2XYQA 4EQZA 1IN8A 1USSA 3C0KA 3PLAE 2ELHA 3CVOA 1B1BA 4MTLA 4JQFA 3Q7EA 4HV5A 3DTNA 2NNWB 1BC5A 3HOTA 4ZTBA 3X0DA 5CVIA 2XAHA 1K78A 3EVFA 4M37A 4UV9A 2VE8A 3QP5A 2PGXA 2A5YB 1JSXA 1G3TA 2CMGA 1XXLA 5J8FA 3I53A 1F3LA 2XVAA 5FGMA 3ANXA 1S7OA 1EJ0A 1DUSA 1STZA 2ADMA 1G8AA 4PZJA 2IA1A 4UVBA 3G2OA 3UZUA 3RPUA 2ZMEA 3CJQA 4O29A 3G5LA 1TNSA 1ZH5A 3I0TA 3E6MA 2ZIGA 2MA3A 1LJ9A 3ZMSA 1L9KA 1IAWA 2P3LA 4M72A 4HSGA 3BJAA 2L3DA 4DM3A 1PP7U 1BI2A 5ICEA 4E70A 1QQIA 4LFUA 2EFPA 3E05A 3SSMA 5E1DA 2M8EA 5HVQC 4I98B 5F64A 1WXWA 2IJLA 3DXZA 1SD7A 3UJ7A 3J80K 1ZG3A 3HRUA 3O7WA 5T67A 2IH4A 1I1GA 2PWPA 2ZIFA 5FFXA 3A7DA 2P3QA 4KN4X 3B89A 3F4KA 3DF8A 4RTMA 2I6GA 2V7EA 3CKKA 3UJAA 5K0FA 1VQ1A 3C6MA 4ZZLA 4GOMD 3SVZA 1KPGA 1XSDA 1HKTA 2FMLA 5GWXA 2H27A 5LHIA 3Q9VA 3FXQA 3B5IA 1YB2A 1XD7A 3T8RA 3VYWA 1HKQA 3FXRA 4UXNA 3HRTA 1KXZA 2K27A 3HTUA 1SAXA 5K5QA 4X63A 3EQLF 3A4TA 3HUGA 4ZH4F 2DPDA 5HDNA 3M7GA 5EMKA 3L00A 1YS7A 5H02A 5DM0A 3SSOA 5DTRA 2CL5A 2FPOA 4UOEA 3F8FA 3M4XA 4IRHA 3EETA 4KT5C 1KQ9A 3WODF 3MAGA 4OMZA 3P2KA 3RODA 3NDJA 2AS0A 3TRKA 1JE8A 1MDMA 3KPYA 1Z6TA 2O0YA 5DSXA 2JSCA 4G6DA 4ZYEA 4M71A 5A2QZ 2EFJA 3ZMZA 1WY7A 2ZLBA 3KP5A 4P7KA 3CJTA 4DA4A 3M6VA 3R61A 3COAC 3RI4A 5AIPA 3MHTA 2EFQA 5HLHA 2C6YA 2GB4A 1HNNA 2OY0A 3CTAA 4RVDA 2D1HA 4BLVA 4X1OA 3UFBA 1LNWA 4GYGA 2NP6A 2EA4A 4R6XA 1W7PA 1Z91A 3HTXA 3MERA 5FULA 3T7SA 5FFZA 1RI4A 3WTZA 4XUEA 2QQBA 3NVKI 5LR6A 5D5UB 1L1EA 2FMYA 3EEYA 2YXLA 2F8LA 3ORHA 5ICGA 1VPTA 1XCJA 2GXGA 1YFLA 2V1XA 4Y15A 2WV0A 3T0IA 5LQAA 2ZKZA 1JR4A 2CFXA 2WC2A 3M8FA 2I9KA 1JXSA 3LECA 5HOOA 3SXYA 2AOUB 5EOVA 2G71A 4NB5A 5L3EA 3WSTA 4RB3C 4WWCA 1HW2A 4FSXA 2PT9A 3V7RA 4C03A 3ULQB 2AN3A 2YTZA 3HRSA 1XMKA 2FK8A 3KEQA 2P8JA 3IEIA 5K0CA 2DT5A 1O3RA 3PX2A 2EK5A 2GZWA 3VOEA 2OZVA 2FQ3A 1N7IA 1ZHFA 4RTLA 2LF7A 1FBSA 2DW4A 3FX3A 5HLGA 1G4DA 3E7PA 3DXJF 3GEZA 2B2CA 2IDJA 5FB2A 5CVRA 5EZQA 1BN5A 2V1DA 3TO6A 1WSUA 1SQGA 1WG8A 2JPBA 2A6HF 3CUQC 2A68F 2K4BA 1WI9A 1C0WA 1P6RA 4POOA 2N47A 2RC4A 3C7JA 5FLXK 1Y8CA 4L7VA 5BQTA 2VZ9A 2EJRA 3F22A 4G7HF 3FMRA 3LL7A 3ELYA 2V1UA 4MQVA 4OIRF 3C6KA 3JAMK 1Z3CA 3ELWA 3CO6C 1P1BA 3R4KA 2BM9A 3RYRA 1RUOA 2ZZKA 1SFEA 3V8VA 2IBSA 3DV8A 3HNRA 5EC8A 2IT0A 5E18F 3OPNA 4O5VA 4YFKF 3G2PA 3FTFA 4AUKA 1O3TA 3EEOA 4Y30A 4QLCU 2ZZMA 4BLUA 2JG3A 1RI3A 4BNCA 3GVAA 3HOSA 2WA1A 5CM2Z 1T6SA 4E30A 4KIFA 3KQVA 3K1MA 1MJ9A 3HYIA 3TLJA 2I62A 2W24A 4EKIA 2XVCA 2GH1A 1SKMA 2XAJA 3C3PA 1LB2A 1KYZA 3QRFF 3BY6A 1HQCA 4OU0A 1FT9A 3EVAA 4KYWA 4QVGA 3B73A 4EMSA 1RJFA 5L3GA 3VC2A 2PMHA 2C7OA 1FYKA 4CXFA 1B9MA 4YUYA 1TQPA 1KHHA 2FSWA 3GLXA 2HWKA 3K69A 4P7GA 2J5PA 3KPJA 4EVIA 3WTTC 4U7TB 3WGGA 3KQTA 1T43A 1T39A 3M1EA 1ZRCA 2GAFA 4RGSA 4K6MA 4LG1A 3FPHA 1T98A 1RJDA 3TO9A 4D0PA 1U2ZA 2VBZA 2PVCA 2PLWA 3OZSA 4IRGA 2YR2A 3W6JB 1YZ3A 4UV8A 3PFGA 1XGMA 2PY6A 3UJCA 4FT2A 5CD1A 4ENNA 3E23A 5LRSA 1RJEA 1KU3A 4HX4A 4HGYA 5FA5A 1ZRFA 2PBIA 4B17A 4R1HA 3GZ6A 3TDUC 2R7DA 3TPZA 4RVHA 1Z6RA 2JJQA 1P2FA 4QWQA 4GEKA 3MCTA 1ON1A 1JG1A 3TM5A 3K1PA 3BP8A 2QWWA 1L3LA 1EH6A 2ZSUA 1RI2A 2KRFA 1UHWA 1NW3A 2F5DA 1I1NA 2ESRA 2CWEA 4ER6A 4UHTA 2BR3A 3LKZA 3H3ZA 1IXSB 2OYRA 4WVLA 4P7FA 2JH9A 1FP2A 1XGNA 4IXAA 4MHTA 3FUTA 2ZO4A 3F72A 5DCMA 3VODA 4E2WA 5EIFA 3IHTA 4PYMA 3KQYA 4YFXF 1G8SA 1HW1A 5K0BA 5HOQA 1W7PD 3HSFA 1YUBA 1OPCA 3NEUA 1BOOA 5D1HA 4C06A 1G60A 4IVNA 5LEJA 3V8JA 1D2CA 3BGDA 1YW8A 2XHKA 3ZMVA 4AWXB 3O31A 5EHGA 1EH7A 4UNOA 5LQKA 5E1OA 1JHFA 1MKMA 4TV7A 2OBPA 4P55A 1W5SA 3KPWA 2CWWA 4B8XA 4RVFA 2RN7A 5T6BA 1HKSA 1X3UA 1QPMA 5EZSA 2ERCA 1UB9A 3F8CA 4M6XA 3KZYA 5LSAA 3LA2A 1VP3A 3FZGA 4BH9A 2XAQA 2H11A 5E2AA 1KA8A 4NHJA 3TR6A 2Z6QA 2ZXJA
chains in the Genus database with same CATH superfamily
3M2TA 5H9VA 1ST2A 1YULA 3KZNA 1M5RA 1IZYA 1HFJA 1YQQA 1T10A 4TL6A 5JUWA 1IBRA 6REQB 4I9FA 4EJWA 1TCAA 5AXCA 4AIKA 1MAHA 1PX0A 1R8XA 5E9QA 3HJRA 4ZQHA 1Z28A 4RUKA 4RB1A 4QYXA 2PKQP 2Q0XA 3TKLA 3RROA 4U0WA 2C7GA 1T15A 4EHHA 5TF0A 5C7YA 1WJ5A 2W71A 2HCRA 2GJKA 1E3EA 1PWZA 4CLHA 1CJCA 8LDHA 5C31A 5KOJB 3IBGA 4FHEA 3LSMA 1J2JA 1PK8A 4BY9E 3FVWA 1D9ZA 2IRWA 1V9CA 2QGFA 2QTBA 1MMGA 4KPGA 3FA2A 1CUDA 3DV2A 2BEUB 1KJYA 5AKHA 1EX6A 1P3DA 5IRCD 3OURA 4I4IA 1D5YA 3QELA 4EMTA 2G7MC 2I6UA 3GN1A 4J9UE 2R7ZJ 2LBFB 1D4OA 1MQAA 4AWAA 2EX4A 4WFIA 4IG4A 2O9LA 1NT2A 5LLSA 3PQKA 3SZPA 1X42A 1HF0A 2DWPA 1YJ9I 1NK2P 2ZBUA 3L7OA 4G5QA 5EZYF 1VYTA 3Q41A 3C2GA 2OPHA 3TFOA 4PLVA 2LLKA 1AURA 2VDOB 4D9NA 2OYCA 2I4RA 3KAPA 4OQLA 1HTWA 2CDRA 2LUOA 3PI7A 3FPSA 3R8XA 5ULLA 5FKOA 3NWJA 3OJCA 5GPCA 3NBQA 4URHA 1TT5A 1VPEA 1E4OA 3CF4G 3ESDA 4DMUB 3HGQA 1HSTA 4HL6A 4JXZA 3R2JA 5K8VA 4F0JA 2CNWD 3GAFA 4QD3A 1Y0NA 5IPFA 3SAJA 1UBFA 5F33A 1EBUA 1ULZA 2FPWA 1NTCA 4WADA 2OM2A 3SI7A 2OVFA 2EYQA 3AUKA 1O54A 2K9QA 4ZYAA 1Y48E 4TYYA 4DXHA 4TOIA 421PA 4W5NA 4L74A 1UBHS 3F97A 2EVWX 5JQGB 4FFBB 2Y1XA 3Q3JB 2V7FA 1J9IA 3PT9A 2E1MC 2PKEA 1VJDA 1COWA 4ACAA 5L3VA 2XWBF 5BPHA 3PDCA 1A35A 1OCOH 2XRNA 2Y71A 4LDQA 4C4TA 4L9VA 2KSQA 1W52X 4P7JA 1J2UA 3C14C 3A02A 2YCBA 3ERCA 1V5FA 1R0YA 1Z0AA 3I9MA 1VIMA 2M6SA 2DI3A 1FXWF 3I76A 5ALMA 3OD1A 4QUEA 3CLRC 1YOVA 3F5FA 3ILHA 1TCCA 4YFVA 4ALMA 3IWZA 4RSMA 2CY0A 1MHTA 3GT3A 3UWSA 4MUJA 3CW9A 3KXLA 5KCMA 1YMVA 1XZBA 1ESNA 4M60A 5CLHA 1EFAA 1PO7A 1SPXA 4D97A 4CCMA 2HPZA 1AKWA 2GHTA 4EA9A 5JXWA 1DP7P 3VKUA 2QTNA 1KFEB 4BNKA 4G4SO 1EKXA 4RBOA 2BTQA 1YKSA 2JC3A 2FMHA 3VR0A 1YHQI 3QF4A 4L4YA 3FGPA 5BSFA 3OE1A 5LN1A 1G3UA 1W35A 2YZMA 2J0QA 5KS2A 1WO8A 1QF9A 2ODAA 3QWFA 5KQSA 4TV9F 1W30A 4BDYA 1XC7A 3RUCA 2NOAA 3D0RA 1AUOA 3OIOA 4HSRA 1BYUA 3NIWA 3SS7X 1VC2A 3D5LA 4PLCA 3L9FA 2W6JA 1K88A 3TQFA 2X6OA 4JI8B 3IEVA 1EAMA 3A2NA 3E3AA 1IZ8A 3N6RA 4INPA 4WNAB 4F60A 2XXJA 3L8FA 4TRMA 4IDCA 2GZ1A 1PDWA 4EJ6A 1TA4A 4M9UA 1ZMXA 4BMPB 1MJ5A 3LZDA 2CVHA 1H2EA 3KEYA 2Z2IA 4X64B 5AHKA 5ADWA 2PLAA 1JJIA 1UK9A 3K7AJ 4C3UA 1U2DA 1LRLA 4WVFA 2NYXA 3KVYA 5G0UA 2RHJA 5E6SA 3EWIA 3BIXA 2C3YA 3ZE6A 4X7MA 1G4HA 1ACIA 3NYWA 1G8MA 2W58A 1Y37A 1Y82A 2E4WA 3CTPA 2QVCA 4RAQA 2COUA 3AVTA 3M8EA 4C7BA 5F9HA 2C07A 1PQPA 5DYWA 4P3XA 2ZCUA 3TIVA 3C4VA 1GHTA 3WL6A 3B9RA 2GCOA 3U4CA 5BYKA 2A1IA 2EW8A 2VKHA 3HACA 3ZCRA 4FX4A 4IJ6A 2DUJA 1HNZB 4RH0A 4H4CA 1PZGA 4Z6KA 1FDUA 2P5KA 4MVYA 1VG8A 2CW5A 3UA4A 3S5JA 1NYQA 4EFNA 1BJTA 4MUXA 4AD9A 4MP6A 2RGAA 1RR7A 3F7OA 5MDHA 4OXNA 2OGTA 1TC2A 3M7IA 4A3BJ 3ZDAA 1KA9H 1I5RA 1P4JA 3REGA 2ISZA 5JMPA 4EY3A 1ORKA 1VI2A 3GH1A 4ZT4A 1L0BA 1XPXA 1EFRD 5A5FA 2X4HA 3I2HA 5KHAA 4BN0A 2CFCA 3QRWA 4AROA 1RWPA 2RH9B 4CF5A 4RD0A 3KWFA 4M53A 3HJFA 3W2EA 3QBTA 2BEKA 3MG9A 5K0NA 3T99A 3VAZA 3VHQA 2ZVQX 1LDKB 4F1WA 1K4YA 3TRJA 1TJ5A 1CPYA 1X4OA 2IUEA 3NPMA 2JBAA 1L7XA 1YMQA 3ROTA 1TQDA 3TWOA 1LFBA 3ZY3A 1U3WA 1T2FA 2W2MA 2BKAA 4IL6C 1F8FA 3ZU4A 4EY4A 3EA4A 3QSYA 3DE2X 5FWYA 2N46A 4JR1A 4GYJA 1FEZA 4JBYA 5EWLA 5IAGA 1CX9B 4ZQIA 3UT5A 4W1RA 5TEWA 1Y6IA 4B35A 1MX3A 3JSXA 4OQZA 2QP4A 3FOWA 4P1WA 3BHMA 2P9TA 3W1WA 2QQ5A 4GLLA 1C41A 5I4IA 3BHJA 3NB0A 4HRAA 4I4TF 4Q7MB 2JLZA 3PWTA 4LGWA 3JAMZ 4M89A 5GIOE 1KQGA 4YAGA 3PA6A 4R2XA 3ZW7A 4RELA 4PC2A 5E3JA 2JIZD 2WSLA 1P1CA 4A0GA 5JDIA 4N5LA 2C78A 2P41A 1RAHA 4RNDB 2FOKA 4FTHA 1I01A 4HWRA 1WVRA 3HM2A 1R0SA 4HDNA 5KBYA 4X6AJ 1JDSA 1PDOA 2ZRFA 1UBEA 1R0CA 3LQ2A 4XVUA 4IUBS 4MW1A 2X9LA 4MVJG 4MW6A 2FFRA 1TVKA 3RB8A 1X13A 4HF2A 4XM1A 3KYJB 1K89A 3AETB 3JQ9A 2V7QA 5JI6A 4RS3A 4TWAA 3OZAA 5UKDA 2QUHA 4QXQA 1I14A 3B52X 5DUKA 1M6HA 4CE6A 2IIQA 5L3BA 3PICA 3OLWA 4K0KB 4FN5A 1GILA 5J2UA 1SPBS 1OX6A 2BBYA 5K01A 5PNTA 1ZJWA 3EXAA 2QHXA 3VVCA 1K3UB 2HMVA 2DQYA 3N39C 3KWLA 1NG9A 1UJCA 2IHVA 4OIFA 4BBRJ 3MKZA 2PRJA 1DARA 2GBFA 3OBBA 1KY3A 1VGRA 4J0IA 4LOIA 4PJNA 3M6UA 1Y5LA 4RXUA 4QBIA 1NJ6A 1GTRA 5FCDA 4CR7A 4FDMA 2INGX 1OREA 4F5WA 3QPTA 2ATXA 2DLLA 1CF7B 1RFLA 2W83A 3EFHA 1MH3A 2BE7A 5BY2A 1VHLA 4PC7A 4XD2A 2GUWA 5C81A 1DV1A 3JREA 2Y75A 3PQ7A 3ZIDA 1D2HA 1A27A 1E60A 4IM7A 4RVCA 2X0JA 3D6HA 3UHFA 1BIAA 1O03A 5LPNA 1B42A 2VRCA 1ISMA 3LLUA 4W1QA 2C2YA 4LF9B 4BRUA 3GCMA 4FWBA 1EHYA 2J07A 5ENDA 3W90A 4FR5A 2QV7A 3RTCA 3S2FA 2IYOA 3V4LA 3IDAA 2ZXEA 2BKEA 3BPSA 3OZEA 2B82A 4PO3X 2QT0A 1CUAA 3RSSA 4J19A 2ADFA 2Q5FA 4YV2A 1TI7A 3ADPA 4HOBA 1BQEA 2UZ1B 1JHQA 4MAMA 2G4CA 1P1JA 3DV0B 4RSHA 1IF1A 3RIGA 4NZ9A 1PGJA 5CW2A 4HYQA 2FWBA 1BGWA 3E7LA 2C7BA 1T6NA 2DECA 5JD4A 4YXFA 1ZJ6A 1AQUA 1YXMA 3LLMA 1R0KA 3QPSA 1E2GA 8AT1A 3RUPA 3CC7I 3I30X 2Z8YA 4TQUS 1ISRA 1IHDA 1U02A 3QKRA 3BD8A 2WUVA 1T4DA 3O8CA 3F71A 4YY3B 3LC7O 4UUAA 1EVKA 3K31A 5ARDA 4FNOA 5A0FA 1WTCA 1DBQA 3KQKA 1IVNA 1PFYA 4PAOA 3SDSA 5IYZA 3LDFA 1TLTA 2D2WA 1R6UA 4LC0A 4N0QA 4UQOA 2ZYRA 4FASD 1C14A 1U04A 4A36A 5FBQB 1R64A 3ESAA 4QOHA 3VPCA 3WISA 2HOTA 4FFMA 5JS2A 2EFYA 4P4UA 4HUJA 4NDNE 1OCEA 2J09A 2VBWA 3LBYA 1PQ4A 1G5PA 1RMQA 1GLVA 1G38A 2NOJB 3ZBPA 2PWBA 4C4OA 1UKYA 5EQJB 4D0NA 3TLAA 2O0MA 1O95D 4AM3A 3D8SA 2FBKA 2YZ2A 3N7TA 5DGCA 2AYYA 5J2TB 2BFOA 1Z4KA 1C9MA 3D0SA 2WIBA 3W6PA 2HTEA 1AKTA 4M3EA 5DHSA 2O5CA 2C5GA 5F2OA 3SHTA 5L3QB 3CUQB 1XZJA 2VF4X 1SEPA 3A9SA 3CCFA 3VR5A 5K9ZA 4GZMA 2JGNA 4ZIRA 3RTGA 1ULUA 1A8HA 4ICIA 3GFSA 3TNFA 4BNFA 1OMOA 1MOZA 4OJYA 1OI2A 2IYFA 2JHPA 3W5AA 3E9ZA 3P2YA 3TG2A 4EO7A 4Z53A 4IQ4A 3LT2A 5FL7A 2GR9A 3B2EA 2GCIA 3E61A 4Z7JA 1ONBA 1B6GA 4M98A 4XSXF 4RK5A 5BNWA 1XAHA 4P96A 2NYRA 4AICA 1G3YA 3BZBA 4L18B 3NBZC 4B4KA 1U9YA 2AMLA 2G88A 2QZ4A 4ZVQA 3A26A 4P33A 3NWEA 1JIXA 4PU0A 1DRKA 3OLQA 1XZCA 4HW0A 4YJ2B 1QS0A 1SFUA 5M7EA 1JB9A 1GT6A 4X0GA 1JAYA 4HGZA 2MABA 2ZXHA 2HV9A 1ATIA 3G9TA 2JHCA 1SH7A 1HFKA 4KL8S 2WWXA 2ZJPF 3IUNA 5CFMA 2QLJA 4OHFA 1E3OC 1ZWKA 3O8QA 5FPSA 3RSOA 4JQOA 4IHQA 5L6LB 3QEMB 2KBEA 1RJWA 4MV1A 4D26A 5DU2A 2Q5CA 4WN9A 3TECE 2VTKA 2VHZA 2X6QA 1OTHA 2Q7OE 1CB0A 5JXJA 1Z0SA 3OZDA 4M38A 5K0GA 5GP9A 1KQ8A 5LYJB 1PVEA 2EL7A 1LUJB 3PPXA 3C70A 5CAEB 3ROUA 4BWYA 4NBUA 3FWKA 1XWWA 3PQEA 1VECA 3C3JA 3CPHA 4O6VA 3FXKA 4ZI7F 5KHDA 3KQPA 3K70C 4AJKA 3GTMJ 2COEA 3K0SA 4KUEA 3HP4A 4KQEA 1DDNA 4EG1A 3LPMA 4NLLA 1Y9ZA 4OJMX 1OWLA 3QVOA 5JZOA 5E17F 3H3UA 1Y6QA 2Q1ZB 3HBMA 1DJOA 3PK0A 3LRXA 4LMRA 4BLSA 4DR5B 2YV1A 1M8GA 4NABA 4TWRA 1Q0ZA 3FMPB 5BT8A 1I0IA 4DLVA 3Q0IA 2CKDA 4U1RA 1QHYA 4MV7A 5C52B 4RKFA 2MLGA 2H4YA 4EKGA 3SZUA 2XR1A 1P2DA 4ZZDA 4DMCA 1A7AA 1S4QA 1PF7E 1P5FA 2XMSA 3DMPA 5FA6A 2JH3A 2DPHA 3LZCA 5DX1A 3UBMA 3CZCA 5FJIA 1X7WB 4ZVTA 4WXRA 3WV4A 2JF0A 4BJ6A 1RHRA 3QE2A 1EM6A 5J4KA 2RGRA 4PNZA 5B58C 5IDYA 1U2PA 1Y34E 3GHYA 4MTEA 3KFXA 1NP7A 4R7GA 4B7XA 1NIPA 2WJ4A 2HPHA 1HA3A 2QKLB 3GMIA 3PFCA 1QHEA 1ZMTA 5ELMA 3AMVA 1YHNA 4QJIA 2E34A 5LA6F 5AQEA 4QPQA 4LHWA 4HUQB 1XQWA 2EPFA 1TAUA 1MXFA 2A5YB 2BF7A 2JWTA 3PFWO 4CQMB 1H8HD 4U39A 5LU8A 2XRZA 1OHHA 3JQEA 2AZ4A 4KWEA 4B46A 1PP7U 2IW1A 4EJFA 1J5PA 2EU8A 3SSMA 1M8KA 4LHXA 1MMFB 2XJ4A 1ZG3A 2L9VA 3X2SA 3I4FA 5MN6A 4B6GA 2NSJA 4BN4A 2FMKA 4WOJA 2L82A 5HS6A 4YRPA 1IUFA 2M9MA 4GE0A 1AIPA 3KHUA 4YJKA 2HOAA 1NVFA 3IBCA 4LZJA 4N3AA 4UCQA 4GRDA 2Q5OA 2LR0A 3KYBA 1FFCA 3VOSA 3L9XA 2DWOA 2VCYA 3DAOA 4J7AA 1NVXQ 3B5IA 4OQQA 3ZHZA 1RAFA 3ETJA 2XMGA 2Q4BA 4Q02A 4F38A 4U8HA 1EB8A 1Z8FA 2BMVA 1CVIA 5HDNA 3C39A 4OB7A 3DCIA 4KFTA 4FXOA 3A4IA 3I01M 2ZIWB 5C1BA 1MW8X 4NCKA 1QGOA 1X8XA 3H0DA 2JSCA 1MC1A 2WTMA 4TXMA 4LFBB 5IP9J 4U7WA 5AR1A 1SAUA 4NZOA 5FOVA 4DMMA 4KXMA 1FFDA 3D3QA 2WHPB 3NDRA 4AC0A 4X1OA 5DDIP 1E4EA 3QKSA 4LVOA 3MERA 3TK1A 3NVKI 3A1VA 5KJEA 3FJYA 5D01A 4KP7A 5EXTA 2NSLA 5I5GA 2Z9CA 2CFXA 3HOWJ 3ZWVA 4NB5A 2BVLA 4EW3A 1HW2A 4WASA 2YNMC 1XMVA 3O2NA 1MBFA 5J40A 1EI9A 2ZSBA 5B1EA 4GX5A 3HGTA 2OHHA 2V7TA 2B1IA 1B8PA 2X13A 1WQ3A 3DOEA 2W2OA 1UPUA 2B2CA 2NYAA 1NJSA 3GCWA 3QE0A 1E1DA 1RQPA 2XCLA 3CUQC 3R7LA 2XUQA 2DE0X 4POOA 2QZSA 5FLXK 3GXBA 5BQTA 3LL7A 1H2WA 1SBQA 2ZUBA 2K9SA 3UPTA 2ID3A 3WRWA 1SFEA 3V8VA 3WHLA 3WXMA 4QYIB 3IIMA 3ODGA 3UMSA 2ZSFA 4P81A 2JG3A 3DHWC 4IZOA 2Q6VA 1RM3A 4R68A 4F3NA 4V1CI 4F8YA 1M2EA 2ZJ8A 4ETWA 1KFCB 3CNOA 3B73A 1VJGA 2EDAA 2P11A 4AY3A 4MIOA 3LBNA 5BSVA 3W4JA 1QONA 2CUFA 5K7FA 1KHHA 2FSWA 2C0QA 5CDTA 3ND8A 1QIFA 3KPJA 4BKUA 1Q15A 1T39A 2BFDB 4RGSA 1E99A 1N0VC 1RJDA 2I3BA 3ZQFA 1YU9A 4IUYA 1FYDA 1Z0FA 1MRSA 3TTSA 2Q5HA 5LRSA 5T41A 3HXMA 5TISC 2P9BA 1H2ZA 1FDWA 2V3VA 2QTVB 1ZS9A 2IVFA 3U7RA 3K1PA 2CFOA 2ZIVB 2C3MA 3L6DA 2ESRA 3UUFA 4FEEA 8ABPA 4IOMA 3H3ZA 4PE5B 3CWQA 2H48A 2PAFA 2GBLA 3U6KA 1IOLA 4E2WA 4CCYA 4QFCA 1G41A 3KQYA 2O3JA 4D4JA 2VJOA 1VYVA 1ZI8A 4BC0A 4JYAB 4OJTA 4OQPA 1D2CA 3MTDA 3NIDB 3I1IA 2YDYA 1W1IA 2KL4A 4OXYA 1NNSA 2N75A 2H92A 5BXQC 3D81A 3G9QA 5SV2A 4OAZA 1R0BA 4D3ZA 4NBVA 1H3FA 2CWWA 4P6VF 1XYYA 4DQDA 4DCVA 1P80A 4X7PA 3C5WP 3RAEC 5LSAA 2JGFA 2JAXA 2O8BB 3BJIC 5HUJA 2PKRA 3AWDA 5EYPA 1HETA 3UT6A 3ML6A 4ZCPA 3HADA 4FMDF 3ETCA 3REQB 4U7FA 3OO1A 1LSOA 2AJBA 2EOAA 2HD4A 3F0CA 3H42B 3UOAB 2DDAA 5JHUA 4WK2B 5G0VA 4JEIA 5CVVA 3TGNA 1KY4A 3TG8A 4Q4CA 3K35A 4AJHA 1F0KA 3A4NA 4C78A 5GAGJ 3TAXA 1OYVA 3EMDA 5KREA 5DUIA 1AOYA 4UJ5A 3LJKA 2ZWPA 2H7VA 3RQ4A 1NF9A 1CHDA 5LBUA 3FI9A 2SCUB 2HFKA 3RZDJ 3LQYA 5EWMA 5A9TA 3GMDA 2PWZA 2ZDQA 2O7OA 4LVCA 1VJRA 4Y0NA 1K7AA 3V9PA 3DKYA 1Y9AA 2RHDA 3ZD9A 2GO1A 3FPAA 1Z26A 3FNQA 3NTLA 3TLBA 1L4MA 2YZKA 5AKYA 3UB2A 3H11B 3MQ4A 5CH3A 3O4VA 1XVUA 3VSDA 1X87A 1K5DA 4RX1A 3I9V6 3G23A 5HQTA 1KTVA 1ZR2A 2PA0A 2RGXA 4L5BA 3PPWA 2IV3A 5E20A 2YYSA 4BVBA 4QG3A 3PHCA 2VYVA 3KEOA 3CCEI 1ZLKA 1X6VA 3T9BA 3QUCA 4PSCA 5DEIA 4URWR 4DSTA 2R6DA 4XLFA 1Y1TA 4DCOA 1OLTA 3F4BA 2H4JA 2LZ0A 2VN8A 1UH5A 4ZTJA 3I8SA 5AKIA 2UZKA 3DLLF 1F9EA 1IPFA 1PJ4A 1XR3A 2C4TA 1QRSA 1L5RA 1MQ9A 3ZXXA 3QHPA 2M1BA 3V7CA 4DDHA 4J0DA 4KWTA 3D6TB 5LXTF 1WU8A 2F9MA 5TMPA 2N1BA 4PTYA 1U1EA 3D3JA 1PJ3A 3FFAA 3R77A 4F9TA 3AJEA 4LB6B 5D5VB 1XPUA 1QWSA 4GXRA 2HIGA 4FFLA 4YCBA 3B1XA 1W7PB 3IGFA 3S44A 3FNEA 3OEED 3TRHA 3UYLA 3EGXB 1Z62A 4NBRA 1RYDA 4KN5A 2O14A 3V4PB 1RM4A 2JA8J 3BG3A 5CG2A 4WOBA 5TSDA 4MCJA 2HJ9A 1N0WA 2WAQA 2LXNA 4ARIA 4OFZA 4DEVA 2QB5A 3WTUC 4RGRA 2C2MA 2H4FA 2QVZX 1WSAA 5AW6A 1TTYA 3FGOA 1XCGB 1PD0A 2QS9A 2R7TA 1OFHA 3F74A 3NW9A 5IVKA 1SY7A 3W5SA 1DSSG 3HUUA 1X7YA 2HK8A 1NUPA 2ZJ5A 3KKZA 1C8LA 1VHQA 3DDOA 1DUIA 3OCCA 1J0EA 3CUSA 3PDHA 2MYSA 1CUZA 3PWSA 1S01A 5FAKA 1UK7A 4QGGA 4PO8A 4GFDA 1J09A 3IILA 2W42A 3JSPA 4PCLA 1P33A 1E3HA 4IIDA 3U0BA 1FBQA 5JCPA 3L2RA 4FEAA 3Q0EA 1B93A 2H85A 2OT3B 2I5PO 1JIJA 4HV4A 2PKCA 3OWXA 3WWCA 3AR3A 3U44B 3S4YA 5DP1A 4M1YA 2QYSA 3V1NA 5B7GA 2BVMA 4KN7X 2AZDA 2KLBA 4MRNA 3RS3A 3L4KA 3GAZA 3PNVA 2E1CA 2G1KA 1R8YA 2XXBA 4I9HA 3AJRA 3OWHA 3PXEA 3GX1A 2X0LA 4DUGA 2WK1A 3MLAA 3BJOA 1EWQA 1R7JA 5A7GA 4L2IA 3ZD6A 4P84A 4ZYDA 4RFLA 4EA7A 2J3DA 1ZN7A 5AM5A 3L8HA 5L3FA 3MT9A 4I5IA 2YXBA 4E5UA 2TMGA 3CY6A 5TQJA 5LRRA 4KOAA 1MB9A 4Q93A 2I2DA 1WLYA 4YQZA 5E1BA 3WLTA 2IBMA 3IPAA 3R7DA 4V02A 4LJ4A 5JNUA 4N5DA 4A2CA 2F9LA 1X74A 1F2DA 3KETA 4BO6A 3OZWA 1JGSA 1HDDC 1G20A 3UMGA 4I66A 4NH4A 4AXBA 4ZYWA 1U5BB 2Q4OA 4FIZA 1GAJA 1FVHA 1D2AA 3ISTA 2C2KA 5E7IA 4KLRA 3E81A 2WD9A 5LQJA 1SG9A 1QDUA 2H6BA 3DTYA 3BWMA 4L73A 3AEUA 4R5HA 1Y5IA 3R3UA 5JT1A 3X1MA 1W8IA 4HBZA 1GSOA 2FW8A 2Y1OA 4PR3A 5ADHA 4BZPA 3S1AB 4CV1A 3OZTA 1SUFA 2GWRA 4OMFG 3VKFA 3WE2A 2W2VA 1FDRA 3EOZA 5H81A 2CN1A 2LE0A 4Q9HA 5LUAA 1TEZA 1BR1A 2ISYA 3E5XA 3QXHA 5EJ8A 3T5AA 3NFRA 5DXFA 2Q7DA 3KQOA 3NUQA 3K6SA 4L07A 1P18A 5COBA 4IRUB 5IAKA 4E4YA 5EJAA 3GFLA 4HEJA 2E7XA 2YVKA 3Q3EA 3T9CA 4BNTA 4CMAA 4BU2A 4DUYB 3FM9A 1YCFA 5BVGB 4JR2A 4LYDA 5HF5A 4Q66C 1HKHA 5I9LA 2EIKH 3DEKA 5B7QA 4FMCF 1DAPA 4REOA 3WK8A 1OGYA 3IAUA 4XFDA 2F5FA 4HLUC 1EGAA 4TT3A 2CDNA 3ZVLA 1GNRA 1OI4A 3GQVA 1T5SA 3PQ2A 2IHKA 3T15A 1K27A 2G72A 3ZYZA 4J3FA 1OIWA 2IPLA 1G8JA 1XGSA 2WD7A 4FQ7A 2FEZA 5A2QK 1NM5C 4NU5A 3A11A 3F73A 1T5TA 4DGQA 2ZMEC 3H3FA 1DIOB 3NYQA 2O8VA 3EUFA 5LWQA 1IRZA 1EMDA 3ZDXB 2WWYA 3H84A 3WQQA 1WZIA 3IH5A 3BFPA 4A0YA 1IC6A 4MUIA 2AXLA 1NBMA 4Q7QA 2EZKA 1JIVA 2ZBFA 4OB8A 3DEFA 3A1FA 2DH5A 3IP4B 5IVDA 1U0HC 4Q5SF 2JNWA 4QYTA 2A9FA 2PD6A 3OQ6A 1TO6A 4HDAA 3HB4X 2XCOA 1JKPC 4PUSA 4LYHA 1I2AA 3KTOA 2BFWA 1EVQA 2NG1A 2C9MA 1KYVA 4FHGA 2Z1DA 3QXXA 3HTSB 2Z5UA 2IVMA 1XMSA 3DHVA 4RK0A 3X1YA 4HPXB 3V1UA 5EGNA 1H8ED 1M34A 4MQFA 1LDYA 4CDRA 4ML3A 4OX9Y 4YAKA 4HNHA 3W77A 5FAXA 1Z13A 1ZA1A 5ALXA 2RHCA 3L2QA 3AI1A 1GU7A 2OXEA 2PTGA 1ADFA 1MCZA 2DPXA 2JVHA 2N3ZA 3WGYA 5J3LA 1VMIA 3WE3A 4ALKA 1II8A 4Y17A 4HTFA 3CRNA 1LK0A 4AIHA 1HDOA 1N5MA 2QAJA 2HU9A 2PUBA 1LS1A 1T8YA 3ZP5A 2MG4A 3QLUC 1Y6RA 1ESCA 3BXXA 4IL5A 4AU1A 4M6VA 2OUIA 3S17J 2H8GA 5FFMA 5IT4A 1QQAA 4H4KC 3UANA 1E3LA 1DEOA 2GUGA 4L5CA 3E3MA 3LQRA 2O7VA 5KTMA 1QR2A 4B3FX 3ZHXA 1YZUA 2WAQN 1VQ7I 1Z08A 2LYCA 4WSOA 4YAOA 1XKTA 3S1QJ 3F5MA 1Q11A 2J5XA 5AJWA 4HX9A 3BB1A 3EVGA 5EVJA 1DAIA 1CV2A 3I6BA 4KTVE 1ZMBA 3W4KA 4EA6A 4B84A 4CCWA 4HWTA 3LBIA 1VKRA 3IHUA 4D1YA 1CEQA 4IHJA 1Z8NA 2ZIAA 2ATEA 3R09A 4JROA 5AVUA 4FX0A 4GECA 1H1LB 1LQ1A 3B5EA 2IOYA 3V42A 2PXAA 2H2AA 5HRCA 2PFSA 2HEGA 4U7GA 2QSYA 5ILSA 2C2WA 3CC8A 4WOPA 5BW8A 1BC7C 1A5SB 2ZYUX 3PNBA 4BQFA 2YHBA 1FUEA 4GGPA 3GLIB 1UXGA 3CSUA 3VYVA 3MFQA 3FNRA 3HDVA 1J2YA 1QKIA 1QZEA 1KERA 2B0JA 3TIIA 4EM1A 2AC4A 4XYBA 2QYOA 2WV1A 3U1VA 4E7OA 5DCUA 4ZKDA 1OPXA 1CULC 3H35A 1TCVA 5IJAA 4KHPB 2XPWA 1PSWA 2BDUA 2BL4A 4CHTA 5J59A 2K9NA 4RVSA 4RHUA 3QWBA 5E4JA 3O2JA 2BIFA 1X0XA 4NJMB 4BNIA 3WL7A 3QHQA 1N5KA 2ZVJA 2H54A 3VI4B 2ORYA 1Z88A 1ND6A 2QRKA 4L8WB 2B1QA 4B7AA 1MLDA 1G2IA 1EIWA 4IPAA 1SCJA 1X1SA 2R68A 2GN2A 2O6LA 4X41A 2FE1A 5CYOA 1YIAA 1CJVC 2PR7A 1PEKE 4F5YA 5BS6A 1GPBA 3AK4A 2XGXA 2G4LA 4MLZA 1MJGA 2OZUA 4B3SB 1C80A 4A3GJ 2XOXA 4ZK6A 4X6YA 1TMKA 1IRIA 1WDKA 4FKZA 4CPDA 9MHTA 2ZROA 1S2DA 1Q16A 3MRVA 4OXXA 4G0QA 3UWKA 2OO3A 3A6LA 1JJ6C 3GX4X 5CA0F 1N9GB 4WESB 6PAXA 2DFIA 3C87A 4PFPA 3T7DA 1UJMA 4IW3B 1GKUB 3CKMA 5IDVA 3D2CA 2BLNA 4H4EA 3A4CA 1P2SA 1PJLA 3M9XA 5L8VA 1GGKA 2X2OA 4TRNA 1XU7A 3HKEA 1CUEA 2IXBA 5GJCA 1BKDR 3G8AA 4EGYA 5BORA 3K1AA 3LT4A 4O4JF 3EOBI 3OKCA 4UUNA 1XF1A 1QHNA 3ZEIA 3FWNA 2ZR8A 3JD0A 4NQWB 1SOMA 3JQAA 5HE9A 4RE6A 1IAVA 4L0YB 3KTFA 1E2DA 1AKMA 2OHXA 4BXFA 1W5CC 1VIDA 3KXDA 3UB3A 3TR0A 4ZAXA 1P0FA 3OKFA 4D0GA 4MS1A 1XMXA 4A2UA 1YA8A 2Q2QA 3FCYA 3WHPA 3THXA 2ZETA 2C84A 1EFVB 4JD5A 4BMVA 1SVMA 1WWXA 2AKYA 3I1YA 4QQRA 4S1VA 4AP9A 1MBKA 3S3TA 1F9AA 2HRBA 2PS3A 3VC3A 3VDNB 2QD1A 3HMKA 2QL7A 2NO7A 3MKWB 4I5GA 1X2MA 1VSTA 4KH1A 1ETOA 4OUDA 4ZXPA 5L7TA 4U4AA 3ZS9A 4G0VA 3ZUPA 5K5OA 1IY1A 2WJJA 3KWMA 4G23A 3ZXUB 3MZHA 3KP2A 2O57A 2WF8A 1I33A 3WZLA 2MYUA 3B7GA 1FBNA 3WK4A 3IRQA 3WP1B 1MORA 2BY4A 2CG4A 3P9YA 3ONFA 1VLLA 1ZHOA 5EKSA 1J0CA 4WKCA 1XE3A 2PMCA 5EMJA 2R6R1 2ZJ4A 5TJJA 3AV3A 4GW3A 1NC3A 4KMFA 3DOIA 3IWFA 1R0ZA 1QO9A 1P4SA 3L7KA 1Y8ZA 1G3WA 3EYWA 3B78A 3QPDA 3CW8X 4LZPA 2PZEA 1VZ3A 2DJ5A 3W5IA 4Q48A 1U78A 1A9ZA 3AESB 1A6IA 1TZ2A 3T5BA 2OZKA 4PO1A 2YKGA 5AK3A 3A0RB 4AY5A 4UBIA 2XBLA 2E7WA 5CXSA 4Z4EA 1FDTA 2Y92A 1Z07A 4CGYA 4KYTA 4CLXA 4RESA 4PLZA 4I5DA 3O9ZA 4QU8A 2JDIA 2E7ZA 1F4PA 1H94A 5CA1B 1GOTA 4HD8A 1ZO8A 4FS3A 1W73A 2QUIA 5F0FA 1IHUA 4Y9SA 4H1UA 3HZHA 2I9PA 4A5NA 4ZA2A 3SF8A 3CBGA 4J43A 2YYAA 2VHVA 3U9SA 3O8NA 3K2ZA 4MTDA 1AZWA 2CQ7A 1D1AA 3LX8A 3UXEA 1D0IA 1JEYA 3OTGA 3AY0A 4A6PA 2FPXA 1XZEA 4QAQA 5FR2A 4XLTA 1SD2A 1KMHA 2YWFA 3ESRA 2LCIA 3TP3A 2SHKA 5AJXA 1OWOA 2I2AA 1MT3A 1UC8A 3OMXA 3OC6A 5T3UA 2QW0X 4UASA 4TZTA 5CYGA 1E7RA 1J23A 1ZGBA 3GZTB 1IEXA 5JSZA 5MFPA 1L4YA 2H8WA 1FIUA 2Y1DA 4XA8A 3KQUA 1UHSA 3KSDO 3E6MA 1DJPA 4YRRA 2OORC 4GI5A 4Y6SA 1RQLA 2NVTJ 2X7HA 3EAFA 1Z9BA 4LFUA 3L6RA 1G2PA 2ID8A 3QNUA 2LY2A 3IURA 1YA6A 3HRUA 2ZYTX 2ZYSA 2WEKA 1SUDA 1QP7A 3WTCA 3AR2A 2Q4TA 3DZHA 1LCIA 3A7DA 1G98A 1M54A 2HCJB 3HKCB 3LC2O 2Y1EA 1UDCA 4R9VA 4ZMSA 1IL0A 4I50A 4QKQA 4TKMA 2JL1A 3PUWA 3ZDZB 5JI3E 3M82A 4WERA 2CJWA 4ONEA 4U0JA 4Q1BA 4CU2A 4C4ZA 3IE2A 4MZXA 1NG1A 3I12A 2FPOA 5B4VA 1YGPA 1B8UA 5DJ5A 2B61A 2CUEA 1DHRA 1WY7A 1JUSA 2X0RA 1N6RA 1I6MA 4ZAVA 3I9V1 4Y0VA 1LNWA 4E1VA 1ZIXA 4JKIA 4YTEA 4UUTA 1MFZA 2DLNA 4NU6A 4ZN6A 1YDGA 3PGXA 1G1AA 2P1RA 1XCJA 4RDXA 2NO5A 1JR4A 1F12A 5KYVA 2I78A 1DRVA 1SRQA 1OU0A 4XH9B 3WSTA 1TK9A 2J9FB 5BV7A 2C2OA 2O0KA 1QRRA 4GXTA 1YVPA 2IKQA 4MGYR 5JCJA 4OVKA 2ZVDA 1DCFA 4A1FA 4MR7B 2JFNA 3FX3A 4G5RA 1VQ8I 1BR4A 4PG4A 1FF9A 3E7PA 4Y2GA 3CEHA 4DV2B 1YX5A 1PDVA 1C0WA 2W6PA 5J4VA 4RPKA 3FWZA 2L42A 2V03A 3QE9Y 4XTRA 4RLHA 2J41A 2WM8A 2XPCA 1R71A 1P4RA 3ABLH 5C32A 3H0GJ 2O2CA 3OPNA 3PHLA 4XRSG 3M5PA 1IJWC 1UZUA 5CT4A 4HUTA 4BNCA 3W8NA 1R9GA 4G3XA 4HVTA 4EVSA 3KQVA 1MJ9A 3ROKA 3MMYB 4H0CA 5AI4A 3A0BC 3TEFA 1FT9A 2Z4TA 5D7NA 4QVGA 4LY3A 4G1BA 3PA8A 1R4MA 4G0ZA 4IMPA 3BTOA 2KS6A 5CLIA 1AU7A 3BCAA 4R3UC 3PXGA 3BIOA 4LG1A 1DDOA 1DTWA 4Y2YA 1RKUA 3MGKA 1O9BA 1WH5A 4EYGA 3C3CA 1UKVY 4IRGA 1XGMA 4XPIB 5LP6C 1E98A 3HBLA 4HDKA 2GETA 4WIAA 4QWQA 1S6YA 4GEKA 2TMYA 4FCCA 3INTA 3V00A 3BP8A 1L3LA 4AKEA 5AKJA 1BAPA 1JV2B 3FPBA 1I1NA 1B16A 2FEKA 1CDDA 3PTLA 2WF9A 3LGSA 4KREA 4WA8A 3WWOA 1AQLA 3FYTA 2QLLA 4Z6YA 1XGNA 5SZIA 3C8HA 3U62A 3OL3A 1YUBA 2EG9A 4C06A 4GRIA 5AM0A 4FILA 2LY9A 3WO1A 2BGNA 1P75A 2DERA 1A2KC 3O31A 1PJRA 3LHSA 2ZUVA 5DNWA 4JI1B 1MX1A 2R7QA 3EQZA 3NUZA 4FCYA 3MIIA 3NORA 3O8DA 5JAMA 1ZFNA 4ND6A 3FWHA 2BFBA 2R7KA 1I10A 1NQVA 5AW2A 2WJVA 4DJ5X 4JP2A 2CEKA 4BRWA 1OLUB 4RZ3A 1AKEA 4ZHQA 5HW0A 2CMHA 5BW4A 3WGHA 3DOJA 3D4BA 4O2AB 2Y0DA 4K1LA 1IDZA 1VGVA 3HXLA 2V9KA 5EGSA 1ZNWA 4ON0A 1ZY2A 1CY0A 3WL4A 3KR9A 2LREA 5GV8A 3I54A 4RA2A 3OHSX 2ODNA 2F55A 3GCDA 3L2UA 2Z99A 1J0RA 4QELA 5M3BA 5DXAA 1K6EA 4XWTA 4QM7A 5AK4A 1XVVA 4BYMA 2AF3C 2YIVX 3WKDA 1TL7C 2Q21A 4OQ4A 2QL6A 5AT1A 2ZS8A 1QO0D 3H6GA 3CF6R 5HM8A 4JK3A 4O4IF 5HEKA 1O87A 1PHPA 4X1KA 1B9NA 1OI7A 2QSZA 1JLLA 1Q0PA 3MPOA 1NN5A 4ZZ2A 1YRWA 1QRYA 1A8UA 3ORRA 1R6AA 4AU7A 3ETNA 2HZBA 2P6UA 2PKWA 4YCSA 2XI4A 1I7SB 5DX8A 1EUZA 1S0UA 3SX2A 1ODLA 3IB3A 3O0DA 1C4XA 3T9DA 1ENOA 3DWIA 3CCQI 1H8AC 4PF1A 3RQIA 1MJNA 2QI9F 1CJSA 1FQWA 3AUYA 2I4TA 5KTNA 4C14A 3UMVA 1QIJA 4BN5A 2NO6A 1QU2A 3LVRE 3JRAA 1V1RB 5F7XA 2BZ1A 4ZJZA 1EGQA 2ZEJA 4CMBA 4IVRA 1MF7A 4ENJA 1EZ4A 3FUWA 1C1XA 3FAKA 4HLUA 2PCLA 1LPBB 3WLKX 4DWWA 1AKHB 4QQKA 3D9QX 1V2HE 5E95A 4IEFB 2J3LA 4KMRA 4NE7A 1Y3FE 3S6JA 4C21A 1T3LA 1ESMA 1O4WA 2VJJA 3FHCB 1WXDA 5EERA 5B2EA 3OUTA 5SYNA 1IG0A 4NFLA 1ZITA 3EXFA 3S2GA 3VR4A 5DZSA 2G7HA 1A3CA 4X1IA 2CQQA 5F51A 5HQ3A 1VHDA 1L5QA 2CVPA 3NTVA 2MYNA 2CW7A 3ZQLA 1JJBA 2P9JA 1AVTA 4F7ZA 4BZQA 5AUOB 2C31A 2VUUA 2RHTA 3H8WA 1ONVA 4P0QB 2H1RA 3OESA 3HOVJ 2HPIA 1XG1A 2QM0A 4LECA 1JQKA 3PNYA 2WJ6A 1RIIA 3FPFA 2GZMA 4ESFA 2X86A 1EK6A 3EK2A 2ZJ2A 3RNLA 2IZZA 2EFWA 3UK2A 2QXUA 4RTSA 3TSZA 1JDJA 3ZKAA 1KWKA 1KU0A 4CJXA 2XASA 4DPMA 3GUDA 4ANJA 2BD0A 2DQ4A 2K3PA 3KXPA 3KQHA 1UBGA 1E63A 2P6PA 3ILXA 3PQ4A 3KAQA 5D1NA 4AJ2A 1JHHA 3H2SA 2AZTA 3Q9NA 5LBIA 4XJVA 3E8SA 4WECA 5BOXA 4ON9A 4ID3A 1TWGJ 2E9SA 5ALPA 1Y5RA 3GG2A 1V4BA 2QIOA 5I9SA 1OQYA 2WFMA 3EXIA 2BDEA 3LCRA 4WKPA 3QP6A 4HFMA 3KX2A 1Z9CA 2NP7A 2VUMJ 1OZ0A 1J2TA 2PH7A 5ILVA 3OIDA 3HCFA 2XTMA 2F3RA 4GI7A 4I99C 1K06A 3GFBA 4OJQA 4FGJA 1EM8A 2ZTUA 4LWOA 1TOAA 3M6XA 1R12A 1UBNA 1W4AA 2ZB2A 5U4XA 4H1WA 3RC8A 2QLTA 4MUBA 5BYAA 2Z2JA 4WLEA 1U7ZA 2VP2A 3GA0A 2I1LA 1DIBA 3B3JA 2P78A 1PLJA 4I09A 3TOAA 4XLLA 2MOKA 3LLSA 4KAJA 1FB5A 5TPZA 1UMBA 4Z54A 2JLSA 4W8GA 3ZD8A 4YP1A 3L6CA 1VG9B 4B82A 3RC1A 5DYTA 2PMZA 4X92A 3URMA 3H1GA 4UREA 1G8HA 4PINA 1W4MA 1G42A 1UZNA 4QYWA 5JVDA 4RANA 1N5OX 2X48A 3OZXA 1BOBA 2P9CA 1JA0A 3FPLA 1KPIA 3FM5A 4XJSA 5D8KB 2R1UA 1U7WA 3BDDA 3U3KA 3K9BA 2QU8A 3RU9A 2E4YA 2FSGA 4FYYA 5ERYA 3PX7A 3D5SC 3NP7A 3PCXA 3L1IA 4OH1A 2PLRA 1AZSC 3H92A 4OL0A 1UPTA 4LTNA 2ANCA 1JSLA 3PV0A 5AW1A 5AJYA 1SKAA 1LNQA 4UZEA 4Z4IA 1WQ4A 5J1UA 3BPXA 2ENUA 1CC1S 3R6DA 3QOEA 4EHNA 2DR0A 4MDHA 3OFNA 3UICA 4N12A 3MMSA 521PA 4DQLA 4U2GA 2C9CA 4JJFA 5B66C 4IMIB 4KBFA 2VSNA 4G12A 3OTHA 2BMDA 3R7SA 3D2AA 2ZI6A 1AKQA 5IJ9B 1U7UA 2XKOA 4UTXA 3TXXA 3R44A 2OP1A 4BUJA 3A05A 2QRZA 4U7DA 2WWHA 3GRRA 4INOA 1SOVA 5DRYA 4PZZA 3LDGA 1O0BA 3G1OA 4DBLE 2O0LA 2ZRHA 1XVIA 4FD2A 3TQRA 5K6TA 3VM6A 4N18A 2D2IA 1PZEA 3PE4A 1YONA 2ZRPA 2VT6A 4KICA 2R8YA 4ERNA 1W0CA 4R4JA 2H16A 3UH1A 1A9QA 3JTGA 2DF8A 1D4AA 4GDFA 2Q50A 1R5NA 3JZAA 4V19K 1TEVA 1YS2X 3DE6X 5JG7A 1JJFA 2P9FA 4GLJA 2A6PA 1C1YA 1NVUQ 2NXEA 1AKRA 1DX6A 4LG0A 5G0SA 2XKKA 3P1JA 3PNPA 4H7KA 3GD5A 3KJGA 3HBNA 4FB4A 3L6EA 3FFBA 1KC3A 3ER9A 2HB6A 4ID9A 1S7GA 2FJ0A 2H5EA 2B4QA 2Q9CA 1Q3TA 1EGVB 1NI4B 2YS6A 4M8LA 4DADA 1FWZA 3C1DA 4P98A 2LD4A 4E3WA 4NONA 4ZYUA 2PLYA 2CHEA 1N75A 2HDOA 3E9YA 2BM1A 1U2TA 1BHQ1 4I5FA 3C3MA 3TMOA 1JHZA 3HYCA 1IK4A 4NMWA 1FNCA 1VQ9I 2XCSB 3TTUA 2EKBA 2MSWA 5I3ZA 4BHPA 4K2HA 1JXAA 1I6XA 4UBLA 1RXWA 4I0AA 1OV4A 3LSYA 5K3SA 1U0OC 3G82C 3V55A 4Z0PA 5CDFE 5AO9A 2G0NA 5FLYA 1P1IA 4MWCA 4OSEA 2RB4A 4YMVA 3S1NJ 4LYJA 4BXOA 3CUUA 5HS8A 4EZBA 4LV5B 3W8FA 2GCPA 1J99A 1ZD4A 4RZ2A 3L0DA 4N47A 4GI3A 2OXCA 3CZPA 1M1YA 2ZVPX 1S3IA 1T9AA 5BMZA 2HA0A 3TTTA 3PYMA 3K0FA 2JCSA 1WUYA 3UTDA 1EA3A 3LUKA 5CLSA 2BM8A 3OWOA 4DS3A 4PC1A 2RGYA 5HRUA 4DSOA 4BY1J 4CR6A 3WDMA 2WE7A 3DXFA 4O1IA 4RPIA 2F2EA 1ABEA 3FSJX 4I14A 1MMDA 3AH8A 4HDMB 4IR7A 3WNQA 1V9LA 2A3SA 1WZNA 3C8DA 1RMTA 1Y5MA 1RM0A 4I1YA 5ILUA 4UBKA 1BMFA 5FR1A 3FPEA 4HV6A 1UG2A 1IJBA 1SD4A 2OTLI 3C7AA 3ZNQA 5JSKA 3HB0A 3GL9A 1M33A 4QHTA 4YJFB 3W8RA 3NR2A 3WWPA 4C01A 5M34A 3MT7A 4JYPA 5KQGA 5CVUA 5AJZA 3WYAA 2QG4A 4HDRA 3EQ6A 2KIQA 4OG2A 2W2KB 5AICA 3BD7A 3EPHA 5BR1A 4F4CA 4BQQA 3AERA 3W5HA 1UFVA 1E9VA 5SICE 2DX7A 3J7ZI 1W94A 4BFXA 1XK7A 2WUWE 1GYRA 5EJGA 2LC2A 3OY7A 3DDHA 1K8YB 2AFRA 1I3LA 2OB1A 4MP8A 2BYVE 2VNKA 1QPIA 1CZHA 1A88A 2ZYWX 3ADKA 2D1QA 3OE4A 4V0RA 3RAGA 2EBWA 1UJ2A 3FHLA 1L7AA 3ZJ5A 2HVSA 1GSHA 2ADOA 3V8LA 2Q28A 1H2HA 2JAQA 3IVMA 4EF4A 5E8JA 3BB4A 4QNMA 4PN3A 2Q2EA 3VO1A 1TLFA 4RAYA 4PC3A 1VE6A 1YIOA 1JFLA 2O2EA 3WLRA 2OORA 1T9GS 2G0AA 2FPGA 3H1PA 1JTFA 2PMZN 1YR6A 3MKLA 1MQSA 3ZKWA 2GBPA 3WK7A 4CIWA 4DCNA 4FDUA 4KQGA 1Y7TA 1JP7A 3M6IA 1QOZA 2JGDB 5KJ1A 1P44A 3WLHA 1NY6A 4E5DA 1GAXA 4YCLA 4ZV9A 1LWOA 2QTLA 4MIMA 3BSWA 1BCSB 3TIXB 1XTSA 4D2IA 3I09A 4KPUB 3ASYA 1PYVA 3MN2A 2VHCA 2VH5R 3DHNA 2W85A 3E5NA 4TZ6A 2JVJA 5EDNA 5JAHA 1JFVA 4XGKA 4ZO4A 1QGYA 1E2NA 4M0DA 4PLGA 4P0TA 5CBPA 1BI1A 4ZCLA 1A4XA 5KNDD 2A5GA 1Z67A 1Z8DA 3FMSA 5EJ7A 3ZE7A 4HDSA 4HVCA 3PLRA 1GRNA 2F90A 5FD6A 3BGSA 4BBSJ 3ESYA 4KLNA 2VFAA 2QX4A 1W75A 5J58A 2HZDA 1MBJA 4PSKA 2PGIA 3TTYA 4IYRA 3LA7A 2EZ4A 4Q4ZF 2G7UA 2IP2A 1IMJA 4TMZA 3P4YA 4KAAA 4HGOA 2PJPA 3Q5FA 5FTLA 5CTJA 1G9XA 3D02A 4OU5A 2RFLA 3FLMA 3J7AC 2A9KA 1MU0A 4UVAA 1XQVA 1IN5A 4B85A 5EGOA 4BQAA 2XB4A 3KDAA 5DT9A 4E2XA 3FCUB 4Q1VA 1RC8A 5SY4A 4WF2A 2PX4A 1R4NB 1DFHA 3IESA 1ZSVA 2HR1A 3F1LA 1N0IA 3PNQA 3TGPA 4YO7A 2C8KA 4B4CA 1JZSA 2GYUA 4N82A 1WXXA 5CT5A 3RADC 1DAFA 3U39A 4MWOA 3GP8A 3BTCA 3S68A 5AM4A 4LIUA 4NP6A 4BVGA 1H5QA 4EG3A 4E6KG 3A1DA 3EUAA 1AKYA 4DARA 2AF4C 1IUKA 2RHWA 3EVTA 4XYMA 4LFCB 1Q50A 4TMVA 3GGSA 3MTAA 3M6MD 4EJSB 1ZD2P 3EF3A 3O6VA 1WKCA 5B57C 1OGIA 1I2ZA 4ZVUA 4CLOA 2O8EA 2I8CA 4IOKA 1FSZA 3M49A 2P1DA 3M6WA 1U1CA 3C1OA 2YMPA 1YB4A 4BX0A 1S7AA 4GQBA 3S7TA 3F47A 2KW5A 4Q4AB 2GPNA 2Z57A 4BBZA 5GQSA 2HHJA 4N5IX 4V3CA 5T57A 3AUSA 3K2BA 1B8OA 4F97A 4C7VA 3G1UA 1R0WA 4MYCA 4YJ3B 1DIAA 1U11A 5DTIA 3U81A 3BMQA 1Q1BA 1P1KA 1T3TA 3MMNA 1TGVA 1H88C 3P2MA 3JWPA 3ZU6A 2IP4A 3EE6A 2HA2A 1YQTA 2PBFA 4HWPA 3Q2IA 2FR1A 4HXFB 3R8CA 5LOVB 2JLYA 4I6JA 3DFZA 3OLVA 4Y6LA 3X1DA 3F8SA 2GHQA 4BO1A 4WOCA 4I01A 3L2VA 3HUEA 1XEXB 3SD7A 1IJKA 5I8WA 6REQA 2DFPA 2W8BA 2SECE 1MO5A 3FCOA 1F2TB 1QIEA 4HMPA 5CB8A 4WY5A 3WIVA 3TLXA 4G5YA 5HF8A 3WGOA 2P6TA 1A72A 1G5QA 3LHDA 1RXUA 1EGHA 1GDDA 1YHYA 5EZYB 1DO2A 3GDOA 4QPJC 1F8YA 1R37A 3I3SR 3QMMA 2XITA 1FQOA 2O07A 3AZQA 1FC3A 3LPAA 3NDPA 4EQZA 2P2CA 1XNHA 5KOJA 3JASA 1B1BA 1NLZA 4YECA 4JQFA 5JDCC 1C4OA 1Q0LA 2YV2A 4M9QA 1QGZA 4ZTBA 1OJLA 4U2EA 1NXPA 3RV4A 3KK0A 2QQFA 1ZMRA 3LSRA 4AMZA 2VE8A 4ZXFA 4CMIB 2BEUA 4JSTA 2EWWA 2VWQA 2KX7A 5K7SA 2IA1A 4DIUA 2R0QC 2LBFA 3KZIC 3IO5A 4M72A 2OXIA 2QRHA 3RFVA 4XQ0A 1H2AS 2M8EA 4G07A 3RGWS 1IB6A 3PR3A 3WIDA 4YPVA 1VLQA 3C2HA 4UTOA 2X51A 5ALEA 5JJLA 3B89A 4FW8A 3F4KA 4AQYB 5ILOA 3CKKA 4LJRA 2WB4A 3GCGA 5GWXA 2HQOA 2OQ2A 4KG7A 5L6MB 4LK3A 4AO6A 1Z0JA 1OD6A 2IS6A 3E03A 1VKOA 1IM5A 1CBUA 3HDHA 4FOTA 5JCXA 5EE5B 3N2GA 2OF7A 1NJFA 3AJ9A 1NQXA 5IP6A 5KEIA 4LWQA 2EW1A 1M6VB 3QF7A 3KPYA 4RJ2A 2CJJA 2M6LA