4E70A

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
359
Chain Sequence
b'MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPVLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coniferyl alcohol 9-O-methyltransferase
molecule tags Transferase
source organism Linum nodiflorum
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
total genus 128
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4e70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4e70A02
4Q4ZF 4S04A 1BC8C 2XAGA 2LNBA 4A0YA 5BW5A 2YXLA 4ER7A 4G9YA 2BM9A 3RYRA 5JR3A 3HCCA 2AVDA 2YXDA 4Q47A 3F8MA 4HZFA 5D5UB 3ULQB 4B17A 2DQLA 4P58A 4MQ9F 1IXRC 1IM8A 3KR9A 3RPQA 2TDXA 4Q5SF 2JHCA 4GOOD 3JWHA 5E8RA 3F3XA 4V0QA 3HRUA 4MGRA 3EVFA 4C4AA 3RJPA 2EFOA 2VONA 4YFKF 4QTUB 1WZNA 2AOTB 5E1ZB 3U2RA 1Z91A 1L1EA 3HCEA 2XBMA 4GXOA 4FX0A 5LBQA 2P6TA 1QBJA 2IBTA 2HFHA 5E18F 4YIFA 2IA1A 4U7DA 5K01A 3CVOA 4R6XA 4AZVA 3LA2A 5CLSA 4IHTA 4HG2A 2V9VA 3IL2A 5HS8A 1BKYA 3T7SA 3T8RA 1XMAA 1ZG3A 3DH0A 2IVMA 2IPQX 2OO3A 1HW1A 5K0JA 5JHUA 2NXJA 1MHTA 4GCVA 2R3SA 3L09A 1K78A 3MHTA 4RVDA 3KPJA 2OQGA 2A6HF 2VOPA 2C7OA 1ZAOA 2F2EA 1DPUA 2BYVE 4HH4A 2G71A 4MTLA 2OA4A 2M30A 5TRDA 1CF7B 2Q8KA 1ZRCA 4CKCA 4RB2C 1YIOA 5DCFA 2DI3A 2XASA 1OYYA 2VBWA 4KVZA 1U3EM 5GM1A 2C7PA 1R5HA 3RKWA 4KIGA 4PCLA 1FBQA 4DCGA 4RTSA 4RTPA 5BMZA 4AIJA 3ELYA 5DRYA 1T43A 3LQQA 2IH2A 5L3EA 1CF7A 1ON2A 4I0AA 3MZYA 1R7JA 3IHUA 5KVAA 5CM2Z 3NJRA 4U0WA 3HVHA 4EM2A 1KQ8A 2VOOA 1TBXA 2O03A 2XAFA 3HHGA 1SG9A 1NW5A 1OMIA 4ENJA 4QQNA 3C3WA 4ESFA 2K02A 2CWEA 3MFKA 4LMYA 2FNPA 2QQAA 2EG5A 1J9IA 3GRVA 5LHIA 4KUMA 3ZMZA 2FMYA 4NECA 4AD9A 3HVIA 4FS8A 4Y2HA 3FXQA 3KR2A 2LF7A 5LQKA 1P4WA 3BP8A 3WTSC 1HW5A 2ZMEB 3LAJA 3FXRA 1RJEA 3EVGA 3WGHA 1F9NA 5B1SA 1ZARA 4RVGA 3QPTA 1R74A 1HXDA 3C6KA 2NP7A 2MA3A 1XGSA 1EG2A 1Q0TA 3QU3A 5J8FA 3DTNA 3LL7A 5DSXA 3LX6A 5LQAA 2CGPA 2JTVA 5FD6A 2IBSA 4JK1X 5D1NA 5BPDA 2CKDA 3OU2A 1XD7A 1NV8A 1JTEA 3W6JB 2P3OA 3FYCA 5IT3A 4OIPF 2CMGA 3T7TA 4O5VA 4F84A 1XMKA 2AOUA 2YR2A 4G7OF 3EEYA 3BDDA 1QAMA 5E8JA 4BLWA 4CKEA 2H94A 2XAQA 3M7GA 3TKYA 5HIIA 1IF1A 2O6GE 1USSA 1JTFA 3UJBA 2HOEA 5HLGA 4LLNA 1MDMB 5L3GA 1NW6A 1RI4A 3HCAA 4X63A 1L3CA 3SQNA 1FT9A 3E5XA 3FUTA 3HA5A 4XLNF 2L01A 2HGCA 2DT5A 4UHTA 5D4RA 2FRHA 1ORIA 5FTWA 2FBIA 1BC5A 5HIMA 5BW4A 3O7WA 1AOYA 2EFNA 4ZYGA 4C05A 4F86A 3UBTA 5BPIA 4C03A 2O57A 5LQNA 2AOWA 4OA8A 2H6BA 5M5BA 3M8FA 4E32A 4LG0A 2KW5A 3ZMVA 1NW8A 4WVLA 2PJDA 3TO6A 3KPWA 3E3VA 3CBGA 4PDKA 1JQEA 1N7JA 5EMKA 4ON0A 5DV5A 1EIZA 1M0EA 2O06A 3V8VA 2W84A 1R6AA 4MTDA 4AIHA 3ID6C 3P2EA 3TDUC 1D2CA 3TOBA 4I7HA 2WC2A 1AV6A 1XGMA 2OD5A 2HZTA 2EWNA 3AJDA 2CFXA 5DTRA 4GYIA 2RDPA 5DPMA 2B9EA 2V74B 1G6NA 3C3YA 3GNLA 2PXXA 5FA5A 3HRMA 2A3SA 2FXAA 2VDWA 1XDSA 3CGGA 5MHTA 2HS5A 3PVCA 2XVAA 1YZ3A 4O6JA 5H20A 2P41A 3WTYC 5A2QZ 5E1OA 3TM5A 3FTFA 3KETA 2P35A 4Y30A 2RKHA 1XCVA 1I1GA 4E2YA 3LDFA 1XSVA 5HIKA 4YV1A 1P2FA 3FPEA 5DUIA 3UJ6A 4OMZA 1KYZA 1XDUA 3FRHA 3KPYA 2PVCA 3GZ6A 2BR4A 4I02A 2FQ3A 3VSEA 1SMTA 2VC0A 1BI0A 3PT9A 1L3BA 2BZGA 3FUVA 3LHDA 2QRVA 2MLGA 2ZXJA 3J80K 3F21A 4HF1A 2P1DA 2OAZA 4PYQA 2P8JA 4YFNF 4IRGA 3M4XA 2KIFA 1J7KA 5HZMA 2JHAA 4PIPA 4LWOA 4AZTA 3FXUA 3I0TA 3DMFA 3F6OA 2IA2A 5EEHA 5K0BA 2RN7A 2RGVA 4YV2A 3MQ2A 5DLYA 3DP7A 5DXAA 1WKMA 2GAFA 1IRGA 5HDGA 5EQJB 2K27A 2FK7A 5E8IA 1HMYA 2Q2EA 2M8EA 3RW9A 2WWYA 3OZRA 1FPQA 2FBHA 4GOND 4E33A 3DOUA 1VE3A 3WE3A 5K5OA 3KQPA 3V4GA 2RC4A 1MJBA 5DTQA 1QGPA 1DUSA 1G8SA 3CJNA 2VP3A 1R1VA 2HYFA 2ZBPA 3BKWA 2AS0A 4RTJA 4GOMD 3KQOA 1R00A 5H6QA 5D6FA 5KYGA 1HSTA 2UXXA 5EKUA 3RKYA 1T98A 2OBFA 3K6RA 4GF5A 4ER3A 1P91A 1W5TA 3FHZA 3HOTA 3VC1A 2O0YA 4ATNA 3B02A 3HM2A 5EVJA 3TMAA 1R5GA 1UCRA 5AONA 2Y1XA 3CJQA 1K79A 2M1BA 1U2ZA 4EJTA 4LD5A 2VN2A 3MQ0A 3OPNA 2EV6A 3QOXA 1V4RA 3KP4A 2XYRA 5CUQA 4IRHA 3K1PA 2A14A 3UWPA 4GBED 1BIAA 2WTEA 3SFZA 4GGGA 1BC7C 1DUXC 3PFIA 5E17F 3FWEA 4GOLD 4MQVA 1RJDA 1KPGA 2PFBA 4RV9A 4OA5A 4L9NA 3BZ6A 4PIMA 2HWVA 4PCAA 3ZMUA 5EZQA 2BGCA 4RB3C 4FHTA 2YPRA 1D3YA 1EJ6A 1I1NA 2X0LA 3RDIA 1VQ1A 3WTTC 1TTYA 3TO9A 1G3WA 3PS9A 3LBFA 2Y75A 3QU6A 2AN3A 1F38A 5HILA 3GRUA 4U7BA 5CVEA 3F8NA 3LGAA 1P4AA 3EQLF 3ZMSA 3LKDA 4QPPA 2FF4A 3HSRA 1YW8A 2KIUA 1S7AA 2K4MA 4IV0A 3MEXA 2ZWAA 2O05A 4CICA 4TV7A 5HOOA 1U5TC 3HSEA 2WA2A 4PGGA 1FOKA 1ZG1A 3WGGA 3VODA 2YUIA 4LG0B 1X1AA 3LECA 2F5FA 1IXSB 1IN4A 2ZW9A 3LPMA 4PYIA 3FPFA 3JW4A 3SHFA 3TQSA 3HA7A 1H9TA 3IV6A 2PV0A 2F5EA 2P4WA 5E20A 2NYUA 3KQQA 2P3LA 3PQJA 5E2AA 4GYGA 1U8RA 2FBKA 3ZPLA 1TPYA 4DZRA 4R1HA 4RTQA 4HAMA 1KYWA 5FO5A 2XAJA 2VE9A 3ELWA 5ERIA 4RGRA 1NV9A 4CWAA 1EH8A 2BM8A 2ZSUA 1MDMA 1Q0SA 2ZNYA 2DK5A 2WA1A 2P6SA 5DRTA 3X0DA 3OOPA 4L0YB 1T0FA 2H27A 1TLHB 3BGVA 2PLYA 1MJAA 1FYKA 3UJDA 1OKRA 3H92A 3CUQA 10MHA 2ZIGA 3B3JA 3LDGA 3WU0A 3RIRA 3ZN1A 1H9GA 1YLFA 3P2IA 1RI3A 2DK8A 5LRSA 3KR1A 2O61A 1SFXA 2DQRA 3V7SA 3S2WA 4POOA 3GRYA 4NHJA 3P7NA 4I98B 3P97A 1I4WA 3QAHA 4Y15A 2M5WA 1U78A 3GDHA 3KQWA 1W7PD 1Q1HA 4KIBA 3BROA 1U5TB 2CW0F 2UZ4A 2XUBA 5IH3A 4BAYA 1LEBA 2L4AA 2NAZA 2UZKA 3TOAA 3HCFA 3HRTA 3B3GA 2HR1A 3EEOA 4ZZLA 5U4XA 3IWFA 2H1RA 1OYIA 3A25A 2IFTA 1YYVA 4UNOA 1W7PB 1XSXA 1IRFA 5CVIA 3HNRA 1RI7A 3KP2A 4WX9A 4G7HF 1AWCA 4M9XA 2H11A 3ELKA 4WXDA 3JTGA 5DSTA 4ER0A 4M9SA 3UJAA 4KFCA 2D1VA 4CGZA 1WSUA 4R8RA 3WTUC 5HDNA 3DLIA 3HA3A 1EAMA 1HKSA 1D2HA 2KRFA 2A69F 4HYEA 2QBYB 3FPJA 5F1RA 5HOQA 3FMSA 3LCCA 1G60A 3QOPA 2L4MA 1O9GA 5CVDA 4OU0A 4FGZA 3NQOA 4M72A 3COAC 2J5PA 4KN4X 5DCMB 1KXZA 3DUWA 4PYMA 3UFBA 3FMRA 3D0SA 3G2MA 3BKXA 3ZMDA 2ESNA 3HTUA 2E5WA 4YG2F 4EVIA 2NP6A 4RWZA 5DWQA 4N9IA 3R0JA 2IDKA 4KICA 3TFWA 4EQZA 3Q9VA 2Y1WA 3TPZA 3GXOA 2VBXA 2QBYA 2VODA 1LVAA 4M73A 2MLKA 4YMHA 3NEUA 1B42A 2AN4A 1IAWA 1JQ3A 4ENMA 1P4XA 3I9FA 5DTMA 2A6EF 1ODDA 5CVVA 2ZLBA 2ZIEA 4HSGA 3L7WA 2FYTA 2B25A 4K6MA 2HYGD 1MD0A 1DCTA 4GQBA 1P39A 2Z6QA 4QVGA 2JH9A 5CIYA 3EMDA 1Z7UA 4WK8F 4E2XA 4C04A 2HQNA 4NB5A 1SUIA 4IVNA 2HV9A 5LQJA 1Z1DA 1QAQA 4DCMA 1HBXG 5DYMA 2D2WA 4O3MA 3BZBA 5K0CA 1REPC 1HW2A 4UOEA 4UVAA 4PYOA 5LHGA 2JZYA 3BJ6A 4YFXF 3JWIA 2OXTA 3EVDA 2PWPA 3P2KA 1Z9CA 2YX7A 1TQPA 4L9TA 3M6UA 4CO8A 1WWXA 4EJUA 2L3DA 5EMJA 4Z2YA 2JPCA 2NNWB 1IN5A 4HX8A 4R6WA 2GA1A 2HR3A 4RAYA 3HVKA 1N2XA 2PMHA 2V1DA 4UXNA 1KU7A 3TGNA 3R6TA 3WSTA 2EA2A 2G7HA 4BHPA 4E70A 4HV6A 2ZIFA 4BLUA 1AF7A 2IPXA 1L3IA 5FFXA 1NW3A 1QZZA 3SR4A 4DQ0A 2P5KA 5L3CA 5CD1A 2N47A 1S29A 2ZKZA 3NRVA 4XBFA 2COMA 5T64A 3C6MA 5HFJA 3GFJA 1X19A 4JBAA 2K4JA 1O7LA 2HKXA 2Z33A 3MAJA 3ELDA 3SM3A 3CUQB 4OQEA 3M70A 3EETA 5FADA 2PX5A 3ZN0A 2VBZA 5JVTA 4WCGA 4BLVA 2MH9A 3EYIA 1E2XA 5LEJA 4IWNA 2ONZA 2OZVA 3TDZC 2OKCA 5F6FA 4P7KA 1O57A 4HGYA 4MEYF 1IZ1A 1PP8F 5EKXA 3E23A 1FY7A 1Z05A 3M6XA 1BIBA 5F64A 3WTVC 1VIDA 3Q9SA 5EHGA 1WXWA 4FSXA 1JXSA 2CSOA 2PSSA 2UYCA 5LGTA 1O7FA 3QOWA 3I58A 3M9AA 3HCBA 3KKZA 5EGSA 2UYHA 3VFZA 3KQMA 2DBBA 2W85A 1USTA 2ZCWA 3EGIA 2G1PA 2ONYA 1I27A 1MGTA 3EUHA 1J75A 4ETSA 1BOOA 5HVQC 3UJ7A 1JR4A 5J6XA 2OB2A 1KA8A 2DLLA 4KDCA 3FPGA 3EMBA 4LWPA 4C06A 4RGUA 5F2KA 1CGPA 1XTPA 2GZWA 2H6CA 1YF3A 4YMGA 5ILUA 1FC3A 3NDIA 3BWBA 2ZJ2A 1QANA 3M6WA 4OBXA 2PWYA 4U0VA 1ZHFA 3E5UA 3IKVA 5ICGA 1ZG5A 4ASNA 4PYKA 4PZJA 3O2PE 3D2LA 3N4MA 1NBIA 2DTRA 4ENNA 1HNNA 2PJPA 4H0EA 3K2ZA 1C0WA 1DDNA 4KT5C 5D5WB 1W4MA 2HKOA 3K9TA 3V7RA 3V8KA 1G38A 1WRJA 4N0BA 1WI9A 3VB2A 3ERCA 3LSTA 3G88A 2MD5A 3GF2A 3TR6A 1ONVA 3OE4A 3UA4A 2ACJA 3IKTA 1O3SA 5BOXA 3A7DA 2EJUA 2H09A 3DMHA 1V39A 3GYHX 2ADUA 3RTRA 4UVBA 3H3ZA 1XGOA 1R36A 2A07F 4C08A 2O8XA 4RVFA 3HOSA 3HHHA 4RB0A 4D0PA 4RGXA 2G7UA 2B2CA 3RODA 1FZPB 1AQIA 4AIKA 4KDPA 3NMUF 2K86A 3BJAA 3EVBA 1EV7A 3IRQA 1KIAA 4FZVA 2AOUB 4HGZA 2LF8A 4MHGA 1INLA 3K0BA 3GX4X 4EM0B 4PNEA 1YFJA 1ON1A 3DPTA 1EJ0A 3G8BA 2ZBKA 1LEAA 3DKWA 2LSOA 3O3KA 5D8KB 1EH6A 2IJLA 5EG5A 1FWZA 3GFLA 4K2EA 4HDUA 1PJZA 5CVRA 2ZZNA 1SUSA 2ZULA 3T8TA 1YW9A 3CKKA 1J2XA 2XKOA 4BXUA 4AZSA 1G8AA 5EC8A 2FOKA 3I59A 1LDDA 2HNKA 4CXMA 4BY9E 3WG9A 1Z3CA 2XRNA 4UVCA 5FWAA 3ER8A 4GC9A 2RV8A 3BOQA 3G2QA 4BH9A 4M71A 2KJBA 3U81A 2VT3A 5LR6A 2DU9A 5DM4A 1RI1A 1IN6A 1HKTA 4YUZA 3I53A 3KPUA 3FM3A 3GW2A 3LDUA 2VDUE 3GUDA 3BWMA 4X61A 5EPEA 4I0BA 2AVNA 2B78A 3PX2A 4F7ZA 3R60A 3P71T 3W6KB 2A68F 1WS6A 1SMYF 3GZ5A 3IC7A 4ZYDA 4XSXF 2ZBQA 4YUXA 5K0NA 3BUSA 3SVZA 2NYXA 5D8LB 3J80Z 1B9NA 1KPHA 1KQ9A 1SQGA 2OB1A 3HVJA 5K09A 1I1SA 3ECHA 5GM2A 3H3UA 2EFQA 1GVJA 3FZVA 5T67A 3VEPA 4HQMA 1XVAA 2P7HA 4CZZA 5E9WA 1YG2A 4CKBA 3F8BA 4QTTB 3DR5A 5K5QA 2FU4A 1QPMA 2A5YB 2EB7A 1B6AA 1L3LA 3ISPA 1EQAA 1SAXA 3SXJA 4A5MA 4AZWA 4E2WA 1XSDA 4P96A 3SSNA 3KEOA 3N97A 3REOA 1WY7A 2BEOA 3I4PA 3PB3A 3KP3A 5P8WA 1KGSA 1X1BA 3NWEA 3EVCA 1IN7A 4EJVA 3WTXC 2Q41A 3G8AA 3RI4A 3SZPA 1O3TA 5GINE 4EGYA 5D4SA 4GO1A 3R9XB 4FR0A 1W7PA 3DQVC 4M6XA 3PFHA 3BJOA 2ZVJA 2ERCA 2XYVA 2CQKA 2QLZA 3UA3A 3GWZA 4BQAA 4EK9A 3K69A 1YO5C 1S7OA 4M74A 3QV2A 3LA7A 3MZHA 3OV8A 2EFWA 2ZMEA 4G94A 4YV0A 5DX0A 3FUWA 4HTFA 5KK1A 3R0AA 5DX8A 2FMLA 1FLIA 1RI2A 2YVLA 4HQEA 2I62A 2RQPA 2OYRA 3HUGA 5K03A 2DO7A 1U2WA 2R6ZA 2ESHA 3FUUA 2XAHA 3E97A 2XVCA 3AWIA 1BI3A 2GWRA 3KQVA 3G7UA 2CL5A 3ANXA 5E1MA 1FSEA 2UYQA 3B73A 6PAXA 2PX2A 3HP7A 2V1UA 1RI5A 2HTJA 3Q87B 4HW0A 2Z5UA 3FTDA 4KMFA 3MTIA 2ISYA 4DKJA 2DFIA 3G5LA 3KLOA 4HA8A 5T6BA 3GVAA 4M7RA 4HTFB 1ULYA 1L0OC 3BWGA 3F6VA 3E6CC 4IKPA 4DMGA 5G02A 5LQRA 1YZHA 1T6SA 3R61A 3FM5A 3LAPA 1ZREA 1PUEE 5GP1A 4YUYA 3THSA 3P9CA 4PWYA 4PYLA 3BXOA 2O0LA 4KWCA 5DD8A 2F5DA 1JSXA 3F8CA 5K0LA 3CUQC 2GLUA 2RNJA 3GRRA 5DM1A 1KU9A 3U1DA 4CDGA 1M6YA 1U5TA 2UXNA 1LB2A 2P5LC 4CTKA 3KLNA 5LQUA 5LQCA 3BPXA 5E8GA 3I5UA 4QLCU 3AY0A 2OZ6A 4V0RA 1RUNA 2AOVA 2ZNZA 3G3ZA 5K05A 2BH2A 3NDJA 2JRTA 3TRKA 3HYIA 1I5ZA 3FZGA 1TQIA 2YX4A 1E17A 1R8XA 5FB2A 4P7JA 1O54A 2AN5A 1B4AA 5K8VA 2JG3A 2PT9A 3KE2A 4UV8A 5EIWA 3R6SA 2DULA 2Y48A 2QQBA 3P9NA 2G9WA 1UHWA 1JQDA 4LB6B 3EGEA 1ZQ9A 3KP5A 4OX9Y 1XCJA 3RIEA 4LLGF 1H0MA 3NW9A 1G3SA 3E5QA 1FBSA 1MJ9A 4YUVA 4DQ2A 1NW7A 1SD5A 2JJQA 4KMUX 5L3BA 1Z6TA 4LJZF 1BM9A 1R8YA 1KP9A 3ORHA 3FRIA 4U7TB 2WV0A 4IF4A 2PX8A 5EMLA 4AVPA 4PGHA 3JAMK 3F8FA 4PCQA 1VLMA 3DXXA 4YUWA 1D5VA 4JXJA 5GIPE 3I64A 2Y0MA 1SD7A 3JSPA 1DP7P 2V7EA 1LDJA 1XB4A 4G56A 2ZFUA 5FCDA 5CCBA 4KW7A 2PXCA 3LBYA 1HQCA 2A61A 1D8JA 3ML6A 5KS2A 3V8JA 2P5VA 1G3TA 5D6EA 2QRVB 3D5LA 3C3PA 3BGDA 2GXBA 5E9JA 1IW7F 2EV5A 2ELHA 2PKWA 5CVUA 2FK8A 2OY0A 2QUFA 3M8EA 3B3FA 4M37A 3AXTA 2DW4A 1JG2A 3I54A 5BP7A 2M45A 3GIWA 3DV8A 1YFHA 3KR0A 2K4BA 3J7AO 1LDKB 3M33A 2STTA 1A04A 2JSCA 3EVZA 3RYPA 4MHTA 3BY6A 2JHPA 2D45A 4DNCA 1OYWA 2PBIA 4EM1A 1NE2A 4FT4A 5CJ9A 2I9KA 5DM0A 1P6RA 2XROA 3VYWA 3EPPA 1FSHA 4G6QA 4EKGA 2DPUA 2EV0A 5DCMA 2G70A 3ZMTA 1SVUA 1UFMA 1F3LA 4FT8A 2P40A 4E2ZA 3WTZA 2LDUA 3EVEA 3CLOA 1LNWA 3F72A 4B8XA 5H02A 2R7FA 4I2OA 1F1ZA 2IT0A 4RS8A 4LB5A 2QQ9A 4M36A 5J8CA 1K7AA 5E1BA 2ZO4A 4XUEA 1H1DA 3BWYA 3SX0A 3G2PA 3GGDA 3NVKI 5FQNA 3IEIA 2ETHA 3H2BA 5C1IA 3UJ9A 2O3FA 4RTMA 3GJYA 2LKPA 4E30A 2IH5A 5ICEA 2GQQA 3PX3A 2F5CA 2HMYB 4WXCA 1Y8CA 5EOVA 1FP1D 2STWA 5H6RA 2OBPA 2V79A 1S3JA 3QP5A 4ZTBA 4HC4A 3QRFF 1VTNC 4XCXA 3ELUA 4HV5A 3LFKA 2GAUA 3KU1A 3DFGA 1XCLA 1SD6A 2AOXA 2G72A 1J0RA 4KRGA 2W57A 4CHUA 1QAOA 3BGIA 3P9IA 2V1XA 4UV9A 2PGXA 3F22A 3P8ZA 3PTAA 2P7IA 2HEOA 4X1OA 2PQ8A 5FFZA 4EGZA 4P7GA 1SD4A 3HTSB 3KFWX 1R18A 3SMQA 4LK0F 1PDNC 2Z3YA 3O6BB 4AWXB 8MHTA 2X4HA 4MIKA 2BR5A 3QP6A 3C0KA 2AZTA 7MHTA 3HTXA 5HS7A 3ER9A 5IT9Z 1IN8A 1MJFA 1VL5A 1KU3A 3FPHA 5ICCA 4AX8A 1IUYA 1O3QA 5DM2A 2J5OA 2VT2A 1FX7A 5ILSA 2Z6UA 3DF8A 3P9KA 2R7DA 3F23A 2IA0A 4RX1A 5BXYA 4OIRF 2O07A 2BV6A 4IPAA 4IXAA 3A27A 4L0ZB 2EJTA 5JFRA 2KIMA 5KQRA 3O4FA 3V97A 4A6DA 1K78B 4S05A 5FQOA 1ZLKA 1D8KA 2HQRA 3T1BA 2IRFG 1JG1A 1BBYA 2BE5F 4IHSA 3OE5A 4BP3A 1Y0UA 3EGVA 4HBLA 3DXYA 4FT2A 3TOSA 1YS7A 4HDVA 1QQIA 2FHPA 1UFKA 3MGGA 9MHTA 3C7JA 1RUOA 2G8NA 1PRYA 1JG3A 1WG8A 3KPVA 3OCJA 1F4KA 5EMMA 3B89A 4HRAA 3MCTA 2YTZA 1FYMA 3TLJA 1UB9A 4G8XA 5HEKA 5C9ZA 3KQSA 1KHHA 2PBFA 5GOZA 1OPCA 2NNNA 1KQ0A 2VZ9A 2EA4A 3DULA 1XXLA 3GCZA 4FSDA 3FTEA 4P55A 1BN5A 1VP9A 2IGTA 2RVCA 2ZBRA 1ZN2A 3KQTA 4NQWA 5E1DA 5FD5A 3SSOA 3UJ8A 1BJAA 5D5VB 2FNAA 1YQAA 2IDJA 2XVMA 1DL5A 3TKAA 3G5TA 2IIPA 5ICFA 2YX1A 1X3UA 5BS6A 1XDZA 3RKXA 3KP7A 4HX7A 4BNCA 1HSJA 3I59B 2QE6A 2XHKA 4R8SA 1UWVA 3GEZA 3DLCA 1KR5A 4ZH4F 3NVMB 5D5XB 5DDGA 1JGSA 1TQMA 2GIVA 5E1XA 3ZQ7A 2XGXA 1JG4A 1DPRA 3R4KA 3CCFA 5KQSA 4C07A 1RZ4A 1IY9A 5K1YA 4DM3A 4L9VA 4F85A 2ISZA 5K0EA 3SSMA 1ZGAA 5HS9A 3F4KA 2GA2A 1WQ2A 2PXAA 4XRFA 4PYNA 1R23A 4P9FA 2PG4A 1D2GA 4R79A 2GPYA 4P7FA 3FTCA 3R24A 3EVAA 2XIGA 2XKPA 2NNYA 2FEZA 4WF2A 4LECA 1GXQA 4X41A 1R22A 3RPUA 3AAFA 4PONA 1T39A 4O29A 3HIFA 3G73A 5FUBA 3E7PA 2GH1A 4LLLA 2YR0A 4Q48A 3BPVA 2C7RA 4I09A 2P8TA 3L00A 1VBFA 1P92A 3KZYA 1P1BA 3KP6A 5LSAA 4YIIA 1UIRA 4OOIA 1ZH5A 4KYWA 1SFEA 3OZSA 3GLXA 4KA4A 3MWMA 3WE2A 4RTLA 4E31A 3OFJA 3E05A 5D1HA 1Z6RA 3DPLC 3CO6C 4MQ4A 3A26A 1B1BA 2E7XA 2KKOA 1ZLJA 4ENKA 5FLXK 2EX4A 3TO7A 1BI2A 4LG1A 5EZSA 5A2QK 1T38A 1BI1A 2HDCA 1K6OA 3DMGA 2E1NA 1EH7A 2MC3A 2EFJA 3DEUA 3C1DA 4IV8A 2L02A 2K7LA 3E8SA 1UHMA 4ER6A 2JPBA 4BHCA 1OR7A 2VDVE 3FUXA 1FJXA 4HOBA 2KJCA 5HLIA 5FA8A 5FWDA 3HCDA 2FSWA 3GU3A 1YB2A 4RVHA 4MNUA 4A6EA 3MB5A 1KU2A 2B3TA 3QPHA 4EQQA 3ROUA 3CDHA 2HTSA 3WU1B 4A0ZA 1N7IA 2I7CA 3C18A 4R05A 4PYJA 2P7VB 4OMYA 3KHKA 5C0OE 1FP2A 3KZZA 5E1WA 1TW3A 2PMUA 3K1NA 1R1UA 1S6LA 2W24A 5DEQA 5FULA 3J81K 3CO7C 5FLXZ 5IT9K 2ADMA 3TQNA 2QY6A 4A2UA 4P9UA 4ESJA 1NHAA 5ERGB 4IJAA 4KNYA 4RTOA 2FPOA 4OIOF 4RB1A 2V6CA 1G3YA 3FMQA 1B59A 3U9GA 4N9HA 4OINF 2NXCA 4KDRA 3DXJF 2ZZMA 2DPMA 2XYQA 2BR3A 1SQFA 4DF3A 3O31A 2E7WA 2Q0OA 4QPNA 3PFGA 1QO0D 2M87A 2IH4A 4PINA 4RTKA 1AQJA 3B5IA 3OZTA 2QM3A 5K0GA 2PEXA 2AOTA 5L3FA 4GUAA 5AIPA 2VS1A 3M1EA 3IYLW 3E6BA 4OBWA 2LD4A 5DUKA 4QDKA 3PLAE 2YU3A 3OFKA 1FNNA 3L8DA 2ESRA 2GS9A 1U6GA 4RAZA 2I6GA 3IHTA 5E2BA 1RIOH 1FBNA 3KQYA 1R1TA 1XGNA 4OIQF 3V7CA 1ZYRF 3CTAA 3Q5FA 4CYDA 2CYYA 3ERED 3BT7A 2IP2A 2GA9A 4OQDA 1QZYA 3IRRA 4HLYA 2YSRA 3LA3A 1F5TA 1YFLA 3T0YA 1XCBA 5F2NA 5JI6A 4H0NA 3LCUA 5E9QA 1O9HA 1JHHA 5DT2A 4L18B 3KEQA 1KPIA 3JTHA 5ILVA 3K0LA 4U7PB 4UUVA 2VXZA 2PY6A 1XJ5A 1GXPA 3MTEA 3A7EA 4QWQA 4U88A 3K1MA 2CO5A 5JUWA 2E1CA 2W25A 2OPBA 4GC5A 4L9JA 1FYLA 5DXJA 1JE8A 1YW7A 4HLXA 3FX3A 1V3FA 4HF0A 3T5XA 3LWFA 4L5IA 5K0FA 3EDPA 1VP3A 5HIJA 3WTWC 1MZBA 1VPTA 2CWWA 2D1HA 2ORED 2EK5A 3LKZA 1TNTA 1TNSA 3HSFA 3R0QA 2PT6A 1X1CA 4R8HA 5F2OA 5LGUA 2FE3A 3MERA 2HWKA 5BQTA 2PN6A 3WGIA 2QWWA 3IWZA 4M38A 3EYYA 3NWBA 1P1CA 4EMSA 3OU6A 1TW2A 1R58A 3GO4A 5L3DA 3J81Z 3SZTA 1X1DA 5LLQA 2PI0A 1J59A 4RYLA 3UZUA 3G89A 4I01A 2NS0A 2IW5A 4KIFA 3BWCA 1NBHA 1LJ9A 5KVRA 3JSOA 1SFUA 1YUBA 3DXZA 1M6EX 3CJRA 4JQFA 2WK1A 2YXEA 4WXHA 5TJJA 1G55A 2OU2A 2CMHA 3TM4A 3FF5A 2VC1A 4LFUA 1RNLA 2BBYA 3M6VA 2MBFA 2B0LA 1FBUA 1B9MA 3HEMA 1ZKDA 1NT2A 2QZ8A 4XSZF 1RJGA 5EHIA 4EV0A 4XUCA 4ER5A 2QVOA 2AXLA 2VE8A 3FYDA 2MH2A 1JHFA 2NXEA 2FCAA 1J5YA 3T0IA 1STZA 4G6DA 1PP7U 3B7PA 3VC2A 1QNTA 3L2CA 3GRZA 3VOEA 4ISCA 1ZRDA 4KN7X 4Y13A 3CC8A 4RGSA 2H00A 2QYOA 4HF2A 2UYOA 4L7VA 2C7QA 1NKVA 4EKIA 1BOAA 1T2KA 4B09A 2C6YA 4A12A 2NXNA 5GWXA 4CXFA 1YTYA 2AR0A 1ZRFA 3GFMA 5LRRA 4FX4A 3I71A 2DAOA 5HLHA 5ED4A 4ESBA 3MCZA 2FRXA 4ZYHA 5CVJA 4A0XA 3G2OA 1G4DA 2VBYA 4MEXF 5FHQA 3JAMZ 5IKMA 1ZGJA 4MTEA 5AIQA 3MAGA 2Z9OA 1JSZA 2PLWA 3A4TA 2XV4S 2EJRA 2Z99A 4GEKA 4CTJA 2DPDA 2PX4A 4WWCA 3KCCA 1W5SA 3ME5A 4MWZA 3L9FA 5DX1A 5FHRA 4LK1F 1O3RA 2JH8A 5HDKA 2F8LA 2L54A 1WXXA 3JWJA 5CCXA 4DA4A 3CUOA 2ZCJA 1RJFA 3AXSA 1G6Q1 1I6XA 3S68A 4Y17A 4HX4A 4QVKA 1L9KA 3LCVB 4EJWA 4M9ZA 2Z6AA 3JWGA 1MKMA 5GIOE 4M6YA 4IRIA 4L5JA 5EEGA 4P5OA 3SXYA 5EIFA 2UWMA 2GB4A 2YQZA 1OR8A 2FA5A 4QQKA 4U0YA 4RTNA 3ABUA 5CYVA 5LHHA 3ZP5A 2ZTHA 4RTRA 4ZYEA 2ZZKA 4QDJA 2P3QA 3PQKA 3ABTA 2OQRA 2P7CB 4FP9A 4XLPF 3T7RA 5DD4A 3HRSA 1IXKA 5LEKA 3OU7A 2ZWVA 3E6MA 2CG4A 2ZFWA 4BYYA 3LQRA 3UJCA 4A5NA 3ECOA 1LQ1A 1ORHA 4G7ZF 3V8LA 3THRA 1YS6A 2QENA 4BP1A 4LGWA 5FGMA 5K5RA 2NRAC 4XUDA 3E6DA 1BHJA 3R3HA 2OZUA 4RSRA 1XN7A 3GO5A 4AUKA 1IXCA 4X60A 4ZZDA 2EFPA 3Q7EA 1SKMA 2JT1A 2GXGA 1I9GA 3CJTA 1QYRA 2HTEA 4BHBA 1GHCA 3SGLA 3WODF 3GFIA 5LGNA 3NTVA 2AS5F 1HKQA 1S8NA 4EJOA
chains in the Genus database with same CATH superfamily
1VSVA 2B36A 5G40A 3IOYA 5C1BA 3ONWA 4IHQA 3SQMA 3ZW7A 1L7MA 1RJWA 1LF5A 1DQPA 3RSLA 3H17A 5FTJA 2D5BA 2Y2UA 1NYRA 4IDBA 2K40A 3DL7A 5TE9A 3RC2A 2Z2XA 2MGQA 2GN9A 4G9YA 1L7PA 3RYRA 1USGA 1VJTA 3FNFA 3JYNA 4KUHA 1DRJA 5E0OA 4Y6PA 3B85A 4MDYA 2VG8A 3IILA 3QE9Y 1U0SY 1NM5A 4NY1A 3RUPA 5KU7A 4Q47A 2VPLA 5D5UB 3HMQA 3LRPA 2WPDD 2VIXA 1XHEA 2QVZX 1AA7A 3N3BC 3OYDA 1VXOA 4RQTA 4WNAB 1IXRC 4IJ6A 3CG4A 3NR2A 2QIPA 4Q5SF 5JWOA 2FVYA 3JWHA 2X86A 2VTKA 2G1KA 2YFKA 3F3XA 3KVOA 1Y1QA 4FFRA 4YJ2F 5JZVA 1BCSB 4MGRA 1CQIB 3G0GA 3W5SA 4RACA 3ZDQA 1JIXA 5ALRA 4EVSA 5CB0A 2FOIA 3R23A 1EB9A 2F3SA 2GRUA 1IJWC 1H65A 2AOTB 5E1ZB 3WYFA 1L1EA 1EM6A 4G67A 2HYIC 1ZOIA 4GXOA 1K89A 2EP8A 2CW7A 4LQLA 1EYZA 1Z82A 4NBNA 3I4LA 1WBDA 3NDRA 5FXMA 3TGWA 5GJBA 2HFHA 5JPCA 5E18F 2HMUA 1QG6A 2A9VA 2B99A 4OP1A 4YIFA 5CCEA 6Q21A 2IA1A 4U7DA 5IAOA 3ZU6A 3QE3A 2O8DA 5E6RB 1QR2A 3H1FA 3OX1A 2AQIA 1I01A 5CLSA 4LHYA 3LBAA 4HG2A 3DZ8A 5J4YA 5ECGC 1EFLA 3H2KA 4N6OA 3DE3X 1PLJA 3I9V6 3MGBA 3SICE 2F5VA 1SUAA 1UBTS 4HOYA 2P6MA 3G2JA 2IVMA 1KZ4A 2GNOA 2IPQX 1WW8A 4MUNA 3V3TA 2BKUA 3MBKA 4US0R 1KP2A 2JJ2D 1FZQA 3OX4A 4Q15A 1GNSA 5B64A 4OQZA 1MHTA 1QPZA 2EGHA 3ZEAA 3ZE9A 2RCYA 3R3SA 1VCIA 3VNBA 3BMQB 3IH5A 1MB0A 4NOLA 2H08A 1QHEA 4HQOA 2QN9A 3PE3A 2CL0X 2HUNA 4R40A 3G13A 4ZGBA 3MWDB 3OYAA 2FUG6 5LLDA 3FYHA 2JN6A 2REXB 3H42B 1ZAOA 1CDZA 3AW8A 3DT8A 5ALHA 3W6UA 1C3VA 1HMPA 1YMVA 4YN3A 2CK3A 2BVNA 2BYVE 1FFDA 2G71A 3FAZA 3KHSA 4MTLA 2OA4A 1CF7B 1EK6A 1M1EB 1Y8QA 2ZPUA 4A2WA 4RB2C 5HMMA 2G08A 1TB4A 2ZRGA 3RV3A 3CMYA 4EUHA 3IUNA 5E7MA 1ORKA 5ITZB 2VBWA 3MSXA 1NVGA 1PT8A 1I2MA 1U3EM 1GU1A 2EKZA 1OZ0A 2BUBA 2PH1A 3RKWA 2BP7A 1ABEA 4WKOA 4I5DA 4ZRMA 4E88A 1FBQA 3R3ZA 3ELBA 2H65A 4YDHB 3KLMX 2FX2A 3L1HA 2XB2A 4GR4A 4BVBA 4AIJA 3OHSX 4XB6B 3HSKA 4KIUA 3STWA 1O6FA 1C3OA 4BQQA 1E1CB 4ZO7A 3CCSI 3VU9B 4DRZA 4F5EA 1UT8A 2IH2A 1CF7A 2G04A 4DW6A 2QJOA 3MZYA 5EN4A 3W2IA 3IQEA 1JFTA 3ICQB 1K8QA 1RKBA 2D06A 3FB1A 3QEMB 4I50F 3TIVA 4DBRA 5KVAA 3EXFB 1YIAA 4IIJA 4NQZA 5CLFA 3F78A 1SQSA 4E5MA 2DFNA 1XKQA 3BMCA 3WRVA 3ADKA 4F5WA 3B6ZA 2VOOA 2QSJA 1RXIA 2ZB4A 3NTUA 4JR1A 4PLFA 5AVQA 2XAFA 1ODIA 4CA0A 1NW5A 5DYYA 1OMIA 4ENJA 1C7JA 2FPKA 2H5EA 4XVCA 2CWEA 1GY8A 2BFBA 4JITA 5CA0A 2FNPA 2BKLA 3ZNPA 1S2LA 3GEHA 3V7FA 4Q3KA 2Z8ZA 5ALMA 5ITZA 4WBXC 3QX3A 2XQFA 5KQMA 3K09C 4Y6OA 2V7VA 5FUYA 2QRKA 2GRAA 1MJNA 4MIYA 3DU5A 1L4FA 2D2IA 2RH8A 3AONB 4NECA 4PANA 3HVIA 5DGCA 2PRKA 1GGKA 4PC3A 3QKSA 4TSKA 3TNJA 1CY7A 1T4CA 3BP8A 5IVIA 4ZI7F 2V26A 1NDQA 5BMVB 4R1TA 4UJ5A 4K6KA 1YVPA 3LW8A 4NFYA 3EVGA 3T61A 3OBIA 4M22A 4YJ3F 3A6ZA 1ZARA 5JU6A 1GZ6A 2C5LA 4RVGA 2YWJA 3V9AA 3ZJ4A 2COEA 1E3SA 3JPYA 4EECA 1EG2A 4B87A 1JKQC 1KFBB 4E1BA 4GWGA 5FROA 3LL7A 5DSXA 4CFYA 4X24A 3UENA 2IODA 4FYIA 1HYGA 2V7QA 1Y3BE 5FD6A 2EARA 3FCAA 5LQAA 4JK1X 2XUHA 4DMCA 2KQRA 2CKDA 1QG4A 4L50A 4YRMA 1PKEA 3T35A 3W9UA 1G3RA 5EPUA 3BZKA 5KQLA 4X65B 2P3OA 3JQ8A 4D0NA 3FYCA 2RAVA 5IXJA 4GZ6A 2JFZA 5U9CA 3GJZA 3BOSA 1I39A 2CUJA 3E9CA 1QRYA 2AOUA 4JB0A 4FWBA 1KE1A 2H5IA 5BMVA 1ENYA 5G0WA 2KFDA 4DBLC 2LVSA 3VR3A 1PR0A 1N8TA 4DDWA 3BDDA 4W9NC 3TQCA 1FUEA 2P5TB 4J07A 1OX4A 3M9LA 1LGYA 1SHTX 3RBAA 1WCMJ 3M7GA 4BE2A 3NALA 2FWIA 1XEWX 3PR1A 1BXRA 4ASUA 2GPWA 3JAWB 3R5HA 4GBJA 4C3UA 4F3CA 2WOJA 5A03A 3TKYA 1OXUA 4PY2A 2O6GE 1GZ3A 2ZREA 3C98A 1Z2DA 3CNBA 3JQPA 4Z8XA 2LKXA 1JTFA 4BMZA 1A9XA 4DQLA 1YC5A 1FRNA 3ESAA 3GEDA 3HYLA 4MITA 5SYMA 5SYNA 2Q1XA 3OAAA 3JASA 5EIAA 1RI4A 2CCGA 2AYXA 2YQ4A 3ROKA 2R5FA 3QUCA 4ITRC 3HCAA 4B3JA 3J81k 1TT7A 5AVZA 3D4OA 3E5XA 1KH3A 4FLFA 1EUCA 4N0EA 2HGCA 4D7MA 2P4SA 3FVVA 3TXAA 3TZQA 5D4RA 2FRHA 2VJPA 4UTOA 4ZVUA 2MSCB 3KVVA 5FBKA 4A0GA 5DHTA 4BQSA 2FBIA 5IZCA 1BC5A 4NYJR 5HXAA 2GCPA 5A5GA 1AOYA 4DLBA 3TQTA 1I3KA 3CZCA 3PXBA 3JARA 4BKMA 2PM8A 3O3CA 2GOYA 2O57A 1ZD8A 1YRAA 3BE4A 1B4DA 3MWYW 1XK6A 4DM4A 3BD7A 3DM5A 1GZ7A 4NG4A 1MRZA 3FOBA 4M0PA 1G9XA 4OA8A 3DL4A 4OHUA 4RA9B 4TSRA 2C2HA 3L8HA 3ZGZA 3M7IA 4Q3OA 2QRZA 3OVMA 4LG0A 3GLUA 4XOPA 4B3IA 1EDDA 2D8AA 4PTLA 4EG3A 1NW8A 3H19A 2VYQA 4LJ9A 4WVLA 4BO0A 5BSMA 2DAPA 4RVSA 1GLGA 3STUA 3CNLA 2RGRA 3E3VA 2JCXA 5D3MB 4CM8A 1VHJA 1ZMTA 1T1RA 1U63A 3INTA 1F2TA 4EL0A 1XMIA 4JK3A 3Q5EA 2AG6A 3HN7A 1RDFA 4TMYA 2ONJA 2OHVA 4XSHA 3IBYA 4GM0A 4F6LA 2BFWA 5ESDA 5KHLB 5E7IA 3UHFA 4IWXA 3ZQFA 1NW4A 1IQPA 2REBA 3DF7A 1R6AA 1X3SA 3D1LA 4X64B 5C37A 4AIHA 1BE8A 4JY7A 5TPZA 3GLGE 2Y05A 2ZK7A 1ZESA 3SZMA 3TOBA 5K8CA 4I7HA 2EW2A 4MV0A 3FCUB 5AKEA 3HBJA 2HU7A 5K3AA 1MW7A 2WC2A 1CQTA 4DDHA 1WTCA 2JLYA 3L0CA 4PLZA 1AV6A 1Z0XA 1FVFA 5C2JB 4JZKA 3FDJA 5A1JA 5JSUA 5K6AA 3K9BA 3MEQA 3GL9A 2QF7A 3DE5X 3OYHA 2TYSB 3DAHA 3IE0A 4FCWA 2ZR8A 3T34A 3VU3A 4BFVA 4LV5B 2KPOA 3TLZA 3K0AB 4DRYA 1A96A 2IF0A 3BIJA 4LX0A 4JX5A 3C3YA 1T2VA 5GVRA 2B98A 5PNTA 3TW8B 4CF6A 4QPQA 2I3ZA 2R1VA 3LSGA 4IGFA 2A3SA 2VDWA 4CKBB 3GFRA 4JOSA 1VNDA 4C5BA 3PVCA 2RK4A 1MQ8B 4H60A 4U7JA 3REGA 2R86A 2OZPA 2ZWOA 4LZAA 4OJKA 5DNYB 3OYKA 5H20A 3K0CC 4MVYA 1KY2A 1XKTA 1TC1A 2MR6A 2QVLA 3GMDA 1GGHA 1Q77A 3NJ8A 4S2UA 5E1OA 4N47A 1R4ZA 1GG8A 1T6XA 1W4ZA 2PTHA 3DW1X 3ZHYA 3AHCA 2P35A 1UINA 1X1SA 2JSPA 3CZ5A 1WI3A 3O9ZA 1Q50A 3MT9A 3H11A 4Y30A 2W6OA 4BP9A 2R8BA 4Y3UA 1I1GA 3BCBA 1DU4A 2A0XA 2E9SA 3ORRA 3K7AJ 4IS2A 2BSAA 4MGKR 2H54A 4FXPA 1YV9A 5EESA 2VDNB 3QF7A 3FPEA 2N8GA 3GARA 4K1LA 3HNOA 5DUIA 4MQFA 4OMZA 2W6ID 3UJ6A 3M3YJ 3KPYA 1TZBA 1JF8A 2VTVA 2HEIA 1KDYA 2G6TA 3P0EA 2HFKA 4MR7B 4CM6A 3VHLB 4HXEB 3PXDA 3DTYA 4JSRA 1R37A 4HPQA 4AUNA 4CYMA 1ZUWA 4ND1A 3M81A 2HJRA 4V03A 4CUGA 2OAZA 1E1QA 3B9PA 1CUYA 1ZPDA 1MW9X 2Z2JA 1FXSA 1R8QA 4H35A 2JGEA 3ZNQA 5L8VA 4IRGA 3LT4A 3HU3A 2BDUA 3B6EA 3FZEA 1A36A 3LK7A 2HNHA 1VSTA 4A92A 1KMMA 3X2QH 3CO0S 3FAKA 1FXUA 3GVHA 4PIPA 1EKEA 3T4EA 3SBOA 1UELB 4L5CA 3A1WA 3GZTB 4ZEMA 2I4LA 4JNKA 1H8EA 2YCBA 4WFIA 4H7JA 5LMNB 4HS9A 2CHVA 3DMNA 4URVR 3A1CA 1OCZH 1T35A 1A50B 3I0TA 3AUJB 3ZG6A 1LDNA 3CUKA 2AEJA 1ZQ1A 5EEHA 1LTHR 2RGUA 5K0BA 3VYTB 3HY4A 3T7EA 2RN7A 2JI4A 3AEQA 3MQ2A 5BV1A 3W2FA 4UVDA 4TYMA 3WFIA 4Q9NA 5DXAA 1WKMA 2VUMJ 3QU2A 1JAXA 1BE6A 1KO1A 1P0CA 4EA8A 2PYZA 3MCAA 3FKQA 4KQ1A 1LFBA 3VHRA 3B6AA 3RRBA 4F45A 3PVZA 4GSLA 3DE4X 3NHMA 1QU2A 3VPHA 2K27A 2FK7A 3SE0A 1KMIY 3ZDBA 1RM3A 2G0AA 4QBGB 3RSHA 3WDMA 1AK1A 4Z4HA 2AC2A 3BF7A 4N3GA 4YV7A 3SAJA 3WGZA 2WWYA 2NS7A 3WLKX 3TG2A 3T1YB 4E6KG 3AM5A 1OISA 1RLIA 2C5HA 3GFTA 3DOUA 4RLQA 3T3GA 1XRNA 1RWMA 3CUWA 2AQFA 3WE3A 5KX5A 2R8XA 3AEZA 2VHUA 3RYHB 3DFKA 3KQPA 4R8LA 1Q1GA 4PFQA 1VE1A 4QUIA 1R0SA 1JHYA 4NJEB 3R76A 3OM9A 2QP4A 1F4LA 4M53A 3W7VA 4UHDA 1IAQA 1GEGA 2YJGA 1JDBB 1VSUA 3Q4GA 2YHUA 3C8HA 2H4JA 1QIGA 3CJNA 2O5VA 2VYNA 2ZGVA 3BKWA 2HYFA 4IHJB 4RTJA 1B8UA 4GOMD 3DZCA 3FF1A 3QVLA 1R00A 1ZIXA 1JH8A 3EXEB 3VV2A 5JS2A 2R00C 2WYVA 1LRJA 1VG1A 3V6LA 1SKUA 3NC4A 3PEEA 5EKUA 3U16A 1R6XA 2OBFA 3EZ6A 2HC9A 1ODCA 2WJIA 3H5LA 4PLGA 3N2KA 3S2UA 1P7IA 1W5TA 4IUDS 3VPGA 2AC4A 5IVKA 4GE0A 1E0JA 1F12A 1PS9A 1UDWA 2AKYA 4WKBA 3WLIA 3PNYA 1C80A 3B02A 1YK1A 2M4GA 2EDAA 2PR2A 1AUVA 2JGNA 3K0EA 3TZHA 5EVJA 3TMAA 5JEDA 3GLFB 1OROA 1TCVA 1FEZA 2Y1XA 3CJQA 3A6LA 3HH8A 4CMEA 2QMEA 3OZGA 5CDHA 1E2KA 4C6TB 3HN6A 4CKWA 2IYAA 3TEDA 1A7UA 1NULA 1V7ZA 4KI7A 2WY2D 8AT1A 4LD5A 2ZJ6A 2GEJA 2JEYA 1QOQB 1YU6A 4OJTA 1KSHA 2XC7A 3KEGA 3P5BA 5EJ5A 1RWOA 4C04A 2AN1A 4LNUA 5CNJA 5J5AA 1AMUA 4MLCA 4ZU3A 1VRVA 1X7XB 4RCYA 4YROA 1IY8A 3TXYA 2XYRA 3EPKA 4D8VA 1DNPA 1L1RA 4IRHA 3K1PA 4RSMA 1BIAA 1M2FA 2ECKA 2M6RA 2Z08A 4IJQA 4YV0A 2HCBA 4K0KB 3DAPA 5E17F 2QB5A 2W4MA 3QHQA 1GAEO 3QPAA 4JL5A 2X8WA 3LLSA 1FBTA 1D5YA 2JFUA 2O0MA 1KPGA 2PFBA 1OT5A 3MWGA 4RH1A 2G4LA 4NYJQ 5FWNA 4BQPA 1Z22A 1LQUA 5CK5A 1G6HA 2AC7A 3LIIA 2YIDA 1WSDA 1WVGA 1M5UA 2O1EA 2FPGA 1GUBA 1NMSA 2QMQA 5JSHA 1NJ6A 3GLFA 2WHRA 2BGCA 1I2DA 2G07A 3OTOB 4WOJA 1NPDA 4TPKA 5FTMA 2Q3HA 3T15A 4AU1A 4UDYX 4S1TA 2I4RA 1Z4NA 3TO9A 3PS9A 5IPAA 4PIVA 3LBFA 3CF6R 4AICA 4LYAA 5LP1A 3GJ5A 4IV5A 4B4CA 5A3SA 3QU6A 3EAFA 5G1NA 2PL5A 4AG5A 1E3QA 3NCTA 4QU5A 4MRPA 2EIJH 3LGAA 5F5XA 2R7ZJ 1C50A 3K4HA 3EQLF 4DCJA 4URYR 2JJ1A 2HOQA 3EDQA 4E7PA 3RVMA 1AHHA 4M7WA 1HLVA 4QPPA 3HSRA 1MAWA 5EQDA 3EZ7A 4IO0A 4HBGA 5ILQA 2PBRA 5A4IS 2AFHE 2ISQA 2FF7A 3KSAC 4YLYA 4QC2A 4DNOA 3I4MJ 2NVBA 1HY3A 1NN0A 1T6NA 3MT0A 2O05A 3BFVA 5GPBA 2O1WA 3T9AA 5I5EA 2W42A 4OXXA 2V1NA 2ZBEA 4ENPA 1LVHA 2HDDA 1A95A 1PKXA 1XZJA 1RQPA 3KALA 3W1VA 3OE7A 2H59A 4O8ZA 4UARA 3WGGA 4CV0A 1YJCA 2FCRA 1N3IA 4FYMA 4Y2GA 5IYZA 3S93A 2B4YA 4G5XA 3D4PA 4YI3A 3RE1A 1NC3A 4DJEC 2DJNA 1LH0A 4OP2A 2F5FA 2HJSA 4WN9B 3M5PA 5B5EC 4KB5A 1APBA 3B3AA 1OFUA 3NAZA 1X7XA 2JFWA 3AR9A 3NHPA 2VJ4A 2VWGA 3LNCA 3O47A 5CXXA 1TWFJ 4B3SB 2QX8A 2QPLA 5CX4A 3Q41A 3QI2A 4XJXA 3IV6A 2O8CA 3U62A 5JSYA 2YS9A 1T24A 2X15A 3IV7A 2F5EA 3Q3SA 4U5QA 5ALEA 1V3VA 3SOPA 3WNCA 4MARA 4RD1A 4ZI2A 1GZHB 1SC6A 1GAQA 3K10A 5DYGA 4BLSA 1XNRB 4GYGA 4MUYA 1U8RA 2ODBA 3TTUA 5KX5B 4NCAA 4R1HA 3FNQA 1OHHD 4Z7OB 1K4KA 3BYZA 3CE9A 2QAGC 2QDKA 1JWLA 1T3LA 4HAMA 1VIVA 4CCAA 2XAJA 2NSLA 5D86A 1N0UA 1QIJA 1T9AA 1ZAKA 5THXA 4F56A 1C3JA 2YFYA 4HNRA 1U1DA 1LI4A 1L7RA 4DUGA 1JJ6C 1XD2B 2CQNA 4MXDA 2A9JA 2V5UA 2ZNYA 2DK5A 2C04A 1MBEA 4C3JJ 2OHXA 1N9GA 3PJDA 2DMQA 3MJSA 1MGPA 4O4HA 5AK4A 1NVEA 2PSHA 2FUG1 2CVOA 3W5HA 5ISMA 3Q2OA 3EJ6A 3HA2A 1WUYA 3D31A 5AM1A 1T0FA 2QXTA 3M5DA 4EL5A 2FZ5A 3DONA 2YVKA 1RQGA 1T36B 1Y34E 1Y82A 1JN0A 1Z0UA 2QWXA 1FRFS 2YMQA 3F5DA 3EMKA 1OLUB 1OKRA 2PRYA 3E48A 4BNLA 1X2BA 4CLOB 4DCNA 1ETOA 3CUQA 1F0KA 1UWLA 4UAJA 4URWR 1ZONA 4KOEC 1ZJYA 4JI5B 5HCUA 4ME6A 1LPNA 3WU0A 4CMBA 2BGUA 3O1LA 4ZVNA 2M32A 3GNSA 2NYAA 3MXOA 1Y5NA 2AZXA 1JU3A 5IBRA 2FW1A 2O61A 5CK4A 2QK4A 2Q6OA 1WXEA 4FDMA 3D7NA 4KH1A 4DT1B 2EERA 1KONA 5JXGA 4POOA 4UEWA 2X2FA 3F7TA 3S1QJ 3Q2KA 3WHKA 3DBHB 2EV9A 1Y5RA 4ZVVA 3ERMA 1UBNA 4LJRA 4EJMA 2R6R1 3TIGA 3FYUB 3UG7A 1UFVA 3AF5A 1T0IA 2RNGA 3BH0A 3EDCA 1QIEA 1R50A 5KOIA 1QV7A 2DOKA 4ND4A 5JSQA 4CEIB 2W22A 3CZQA 1GCOA 3BROA 3ONVA 2HLHA 2Q4RA 1P1RA 1XNJA 2CW0F 2Q9AA 1QSGA 2WIJA 5T6MA 2VYFA 4PO9A 1LEBA 2XPUA 5T4BA 5F76A 1JKOC 4XX0B 5JLXA 2NZWA 3GRPA 3HRTA 3B3GA 5HR5A 2YV1A 3D54D 5I7SA 1LTKA 2HR1A 2GILA 4J1TC 4ZZLA 2L7MP 1Q91A 3DKRA 5U4XA 1PGJA 4BN4A 3IWFA 3RUHA 4LHEA 1OYIA 3A25A 1P9OA 4DFDA 2JZNA 5KNBD 1A97A 2Q8QA 1P0MA 5K20A 3V34A 2AE2A 3Q9NA 4YDQA 1A9YA 1AGNA 4UFOA 1IRFA 3DOEA 4JB3A 1BH6A 3HNRA 2R1VB 3KP2A 4KGZA 1Z2NX 4EELA 2QJRA 1TTPB 1XD9A 1THGA 2WADA 1YR9A 3G2LA 1EDOA 1PWXA 3PD1A 3IDZA 1WL8A 4IUBS 1TMOA 4ER0A 2Q5FA 1N5JA 3DO5A 1JPNA 4KFCA 2ACEA 3O95A 1W36B 4CGZA 3RROA 1WSUA 4R8RA 4DYVA 3H5NA 1ACJA 5HDNA 3Q2IA 4UUSA 3OFNA 3ZWXA 1HTTA 4WK0B 1HKSA 1EKXA 2ETXA 5AO9A 3QIAA 4J01A 1AO0A 3MT7A 2A69F 3R7WB 3HJFA 1DAMA 3H4VA 1MGOA 2GCNA 5F1RA 3WMGA 1XQVA 3SU8A 1KU6A 1Q7TA 4Y18A 3WYGA 4EWLA 5HOQA 3U7HB 1WAMA 4KWTA 1UJ2A 2KDZA 5KVVA 1ENZA 3QVMA 4N76A 4F12A 2L4MA 3LH5A 1Y8AA 2EKBA 5FUQA 3GAAA 4I1VA 2JBHA 1YI1A 3ZIUA 3COAC 1DJQA 1UOQA 3RTBA 3AG4H 1NQAO 1POWA 2PJRB 2BOVA 3FFXA 4P36A 2ADFA 3EPLA 4JXZA 2ZYWX 1ODTC 1KXZA 2LKDA 2X0KA 2GETA 2XD9A 3A1TA 3M1YA 4NV1A 1ECLA 1IDYA 2GBYA 1DPGA 1LLFA 2D7CA 3FMRA 2YRWA 4HD8A 4PZAA 4X92A 1N1MA 3D0SA 1NZFA 4R1LA 3BKXA 1NJ1A 1EUDA 2RREA 3G9UA 3KBBA 2ESNA 3EPJA 3GLLA 3CC4I 1QB7A 2E5WA 2X8AA 4CGYA 4OI0A 3CIOA 3V8BA 1Z36A 1ZNWA 5LNK6 1DADA 3OMLA 1II0A 2VUUA 2WF8A 5DV9A 2GERA 4NDLA 1PHRA 3OMXA 2IYSA 1RU3A 3OO0A 1YCFA 4FVTA 3K9LA 4KICA 4Z3DA 2WB1N 2XNHA 3H7AA 1HE4A 4YAWA 1RWWA 1IULA 1OU0A 3TPZA 4Q1CA 1EFHA 3V42A 1FB5A 1MX3A 5AKZA 2VBXA 1IBKB 2BFDA 2VODA 1QH1A 1X80B 2Q8PA 2QN2A 4M73A 3AMVA 3OLQA 4KPFC 3W34A 5I7UA 3MIIA 2HPMA 5F5NA 2AD1A 3OP1A 5BWOA 5GZ3A 1QFYA 4MKFA 1IAWA 4H7PA 4IFBA 1JQ3A 2V9ZA 2WSLA 4GI3A 3KIPA 4RQUA 3JRAA 3T0GA 3VPDA 1B6GA 5DTMA 5AW2A 1CE8A 2FJPA 2A6EF 3BHMA 2OHHA 1P3DA 4R31A 5FOSA 2MOKA 4CTOA 3I61A 2ZXEA 5CLQA 3L7OA 1D2AA 1M0SA 4HSGA 4D43A 4JP0A 3WRYC 5B7QA 1C1XB 1ECFA 5J5VA 1TFRA 2VRCD 1O7JA 5AW3A 3I9V2 2D62A 1P39A 3JRFA 4AJKA 1IBCA 1YBMA 3AHDA 1EWQA 1J0AA 1NU8A 1XXHE 4RMHA 3T3NA 3TX2A 5BSWA 1IY1A 2V7UA 2WJWA 4Z4FA 3G1UA 3V5NA 4BNDA 1OXBB 4E2XA 2HQNA 4IVNA 4R83A 2HV9A 5LQJA 4B4WA 2XKAA 1Z1DA 3ZK8A 1QAQA 2Y1CA 5FX2A 1EESA 4UXJA 4B2PA 2IIVA 2D2WA 2Y76A 2L19A 4OJQA 4UZSA 3UAWA 4BNJA 1RXWA 3QH4A 4OFWA 2OCLA 4UOEA 1WXIA 3OX2A 2ENWA 2OXTA 1E7MA 4COOA 4TL7A 4MA4A 4RKRA 4AJ9A 3KQNA 1C0PA 2XXAA 3FVTA 5EMNA 4KODA 1K2VN 1U8AA 4R9NA 2ZWPA 3IP7A 4OYRA 1FX0A 1NASA 2A3RA 3CCBA 4MWOA 5BPFA 3AHEA 1XZ8A 2YNMA 1SCNE 3I5XA 3T52A 4U8HA 3QEBZ 1DX6A 4CO8A 1T8PA 1Y7HA 4FZJA 2BMDA 1SANA 1WFXA 2NV6A 4PO3X 5E3IA 1TLFA 4XD2A 3SHOA 4Z2YA 5D85A 5COQA 2GX6A 5ALWA 1F2UA 4I6ZA 1HE2A 4KYTA 5JAPA 1DHTA 4KR0A 1PNRA 4X20B 1EJ2A 3JRCA 3ESDA 3NBQA 3FXKA 1N2IA 3VR5H 4AG6A 3ZBUA 1KC3A 2X51A 3Q6NA 4XPIB 1P1KA 5J2UB 2P4UA 3PHHA 1UWKA 1N34B 5JJ5A 2G28A 4MMYB 1G291 5TNXA 3QI7A 3R6TA 1I4LD 1TPZA 3LPAA 1G20E 3OIVA 2G7HA 1N2ZA 3EISA 3A1DA 4E70A 1FLAA 3O8BA 4F3KA 2IVFA 2QU8A 1ZQ3P 4ZJZA 3MGKA 3O83A 4DCTA 3IOEA 4YIHA 2VYVA 1AF7A 3GLHE 1Z0AA 3V33A 1QZZA 3P5JA 1P6QA 1ZK2A 2NZYA 3HJUA 2EATA 4JN6B 4FNMA 4XB2A 1NBWB 2HU2A 1RTTA 5CD1A 5FPSA 1UMCB 2GYVA 1QH9A 2VKVA 1KYQA 2APJA 3C6MA 1HRDA 2FZGA 1X19A 3UWDA 1TJPB 2PEYA 4JBAA 1MOSA 2K4JA 2E4WA 1JR3A 2NSJA 3TAHA 3ZN2A 2H51A 3O1HB 3MAJA 3TVYA 2O7SA 3CUQB 3W6OA 3M70A 3N0RA 4OH7A 2I6UA 3EIQA 2IEGA 4B7CA 4BKUA 2X2EA 4B2LA 3ZN0A 4WCGA 3RLIA 3W5JA 4PZZA 2JA2A 4QTZA 2ONZA 3LYUA 1NG9A 3GIDA 3BSFA 5HOEA 2PRIA 2XYPA 3SQLA 3OUUA 4DY6A 2NUPB 3Q10A 5BPHA 2NAFA 1A5JA 1LNQA 4O4HB 1M2VA 1XLTC 4JS0A 3HCPA 4MRNA 4X1EA 1E98A 3QVVA 4P7KA 3VPCA 5HJ5A 1VLHA 1M8JA 4DIQA 1K63A 3FWKA 3ORQA 1YTUA 3NIBA 2X7JA 3DZGA 1Y33E 2NUTA 5EKXA 2PPLA 3U39A 3I04M 2ZUDA 4O2BB 1KYTA 1BIBA 3IC5A 5CHEA 5AW4A 2FW6A 4PS1A 3Q9SA 2FSUA 4BACA 4I6JA 4R9RA 3W1WA 4KXNA 1JXSA 2GJKA 1XTRA 4A0FA 1EHYA 2ACWA 2HIAA 3N8HA 5TGTA 5J9FA 1F7UA 4YA6A 5LGTA 3S2IA 2ISSD 2XRFA 3FSJX 5AHXA 5DK4A 1ZIYA 3HPGA 1QIDA 3O26A 3QOWA 3SKYA 7AT1A 2V6GA 3V2GA 5EGSA 5KJ1A 5EHQA 3EY4A 5IH3A 1USWA 5ARCA 2A05A 2GAOA 2LC2A 2WYUA 5ALTA 2XGDA 3RVBA 3Q0IA 2PUJA 2H9IA 2RQQA 1EINA 4TTSA 2PQ0A 2OSVA 2PCLA 1J0DA 3EGIA 4Z0NA 5AM3A 1KRHA 5BV7A 2G1PA 1I27A 1M8KA 3EULA 3QG1A 4ETSA 1BOOA 2AH5A 5REQA 4WH0A 3UJ7A 1QGZA 1UC4B 4D3ZA 2OCXA 3HL0A 1XQ9A 1NURA 1KJZA 2E1RA 4QD3A 1NYLA 1W25A 2X9LA 3BICA 1KA8A 5DW3A 5KQPA 1PYOA 2W82A 1QQ5A 1T13A 2YWCA 4KQKA 4GPBA 3ICPA 3HHEA 5JFOA 5K6TA 3EMBA 2X23A 3T1QA 1IO2A 1FFSA 4NEGA 4EMUA 2C3OA 2VRWA 1E60A 5F2KA 5IT5A 4ZEOA 1Z6GA 2XUJA 4FTWA 2F64A 2FHSA 2H3HA 4K03A 4YX9A 5LVAA 1FC3A 3ABKH 1KA9H 1DBIA 2PK3A 3FE2A 3ILVA 3NHZA 1E7YA 4TLCA 1QANA 5CM8B 2O2DA 4OBXA 13PKA 1JAZA 1PNTA 1HDXA 4U0VA 1AGYA 2I87A 4CQMA 4Z7JA 4AJHA 3BR5A 4HADA 3DFIA 4LDJA 1OTXA 1P45A 1UR5A 2C9OA 3O2QB 4M1TA 4OHVA 5AXCA 4PZJA 1LW6E 5AJUA 3C3CA 2Q2OA 3FYTA 2K7ZA 4M6WA 4D4LA 5CKTA 3V8RA 4RV5A 2XB9A 1XL0A 5H59A 1C4WA 3E82A 2QRHA 1NN1A 1DIRA 1AB6A 1MZVA 1XZEA 2XPVA 1UJ4A 2XDWA 2GRJA 3B82A 1UFRA 3R5SA 1A5ZA 1T8WA 4CTNA 1JPUA 4I2NA 4H0EA 2Q29A 3EIUA 3GA5A 2G4VA 1K4SA 5D5WB 3K94A 1WZCA 5FI0B 4JJAA 3WLJA 3P94A 1W4MA 1AHDP 2WI8A 4UHCA 3K9TA 3V7RA 3ABQB 3PHCA 5KO2A 5F7XA 3PIPF 4GH5A 2LVBA 1TU4A 1WI9A 1E6LA 3L1UA 2M4KA 1GDDA 4OQFA 2WYHA 1QWSA 2JANA 2ZVQX 3IOBA 4MZXA 1OBFO 4YPOA 4JX4A 2IPNA 3GF2A 1JFVA 3BRCA 5BNIA 4U9IS 1XYGA 3OE4A 3ZQQA 3TLAA 3WNBA 4NFHA 2EJUA 4S24A 1OZAA 1Z6ZA 4CDMA 3AVYA 1N8NA 5NULA 2BELA 3I1YA 3TLCA 4AKGA 1EJBA 4RVCA 1FSPA 3T1HB 3AETA 4L73A 5A6VA 3CH7A 4HH0A 3RTGA 3H3ZA 3ZW8A 3DTVA 2QZ4A 3UMJA 1ISRA 3VSKA 2FY8A 4P4TA 5EI5A 4KPEC 2O8XA 5D5PA 2G67A 5JCXA 3HHHA 2MINA 2ENUA 3G82C 4LEIA 2WD7B 3G6EI 4PSWA 3PIRA 1PBNA 4FFMA 4RELA 2VJIA 3EWIA 3D8TA 1CR6A 2CDNA 3B38A 1UBHS 2P0AA 2A9PA 3UYKA 4B79A 1EV7A 3SM9A 3UB4A 3IKJA 1WBJB 5DTEA 4D0RA 1TU3A 4CIWA 1M6VB 3W2AA 1ZLXA 1ZD2P 2AX3A 2X4IA 2Y0SA 2A9OA 3SHWA 2Q0SA 3D5TA 4PJJA 3K0BA 4TKZA 3MPUA 2QRQA 4I1OA 1J8YF 1S9HA 4D99A 3RSGA 4CCMA 5KWVA 1YFJA 4TVSA 3VOTA 2ZBKA 3HOWJ 4UB8C 5IFLA 3H8SA 4EGJA 2LSOA 4BCDA 1EH6A 4II3A 3QMPA 2IJLA 4MVWA 5DEIA 1W30A 2BBOA 1AQUA 3BMXA 4ROTA 2KPMA 1PJZA 3MM4A 5CVRA 3EG9B 2ZZNA 4WXMA 4HXFB 4L1KA 2ZULA 2XDVA 2Z04A 3AEUA 4HQRA 2FMUA 3UT5A 2R7RA 3AL0B 3BDVA 3DZFA 3T8TA 5EYPA 2WJZB 3BT9A 4A3GJ 1A27A 5HTKA 3JQ7A 4BXUA 2RJOA 1F0NA 2VH1A 2ZVPX 4BJ6A 2FG6C 3NAGA 1CLEA 1IEWA 1MORA 4DN6A 3ADCA 5FKOA 3WG9A 1Z3CA 2ZBDA 5IU6A 2VCHA 4XGRA 3I2IA 1OWPA 3ASOH 1RD4A 2JJMA 2QN8A 3UJNA 3ZPXA 5H2FC 5HYVA 1MABB 1H9CA 3KSRA 2DQZA 2PSDA 4IFEA 1KARA 2C00A 3ZQ4A 1CQJB 4J3JA 4E5NA 1E6EA 1BR4A 3ST7A 3A4NA 1RI1A 1OXMA 1ES9A 1DKOA 3IMEA 1HKTA 5FORA 1GCGA 3IESA 4CKZA 3KPUA 4EOGA 2Y6UA 4D9KA 4WCFC 2FDRA 2QJTA 3C7AA 3ADDA 3KYDA 4CEJB 2QE7A 2VDUE 1FYWA 4JLNA 4B3FX 4I0BA 4Z53A 1JDSA 4Y52J 5A1TA 3AOEC 2OBXA 1QZ3A 3P71T 5D87A 5FO0A 4QJ4A 1JR6A 2A68F 1I3CA 1WS6A 1SMYF 3GZ5A 3AB3A 2ELJA 5K3BA 4EIWA 4YUXA 3KSBC 3GY0A 1VFNA 5I7AA 3BUSA 4F2WA 5ER6A 4B3XA 1X7WA 5FI1B 3ITKA 4Z3KA 1KPHA 1L9XA 1SQGA 2YY6A 2ZB3A 5T4FA 1I1SA 1T4DA 2GN1A 2MYSA 5GM2A 4XLTA 3JRXA 1A2QA 3VKWA 3E4DA 2Q3DA 1PFKA 2AJDA 4FE4A 1VZ3A 1H22A 3JVEA 1JH9A 4K2HA 1XVAA 4AIRA 4O4IB 1CS4C 4ZV4A 2QAGB 2UZAA 1RP7A 3LC7O 1CFJA 4HQNA 4NBLA 1KZYC 2ZIZA 5H16A 2A0UA 4EDFA 2VQFB 1P2SA 4QBFA 1G9SA 2QA5A 3WI7A 3BQ9A 3DQPA 3OZ7A 1E1DA 1J2UA 1H2HA 1U94A 2PS3A 4JA0A 5BN4B 3FPKA 3NTOA 2A5YB 1DC3A 2H1HA 1QQBA 2VF5X 1DIHA 4E2WA 4R3NA 4A5MA 1O5IA 4TQAA 1I24A 4ZA2A 2GCOA 2YVQA 7GPBA 4MLPA 1QYCA 2DY0A 3L1KA 1VMIA 1JBQA 1VJ5A 3N97A 2ZRJA 3ESWB 3U1VA 1WY7A 2BEOA 1XRQA 4G09A 9LDBA 1Q19A 3QQAA 1ZL0A 4J0DA 4OVKA 4TVOA 1XTVA 5P8WA 1TQ6A 3VGJA 3NATA 4ESEA 3ZVNA 2OPHA 2EIXA 2TRSB 2Q41A 3WTXC 3RSNA 1FU8A 2NSYA 5DHRA 4HAWA 2DYRH 4BJTA 2EF0A 1TUIA 3ED5A 2Y0PA 3EGXB 3G8AA 3D02A 1BHQ1 1O3TA 4H59A 4MB2A 5EJ4A 4FIDA 4PX5A 3HR8A 4KHPB 2FZWA 4H27A 4KTVE 5D4SA 3SY8A 1DO2A 3N8DA 5ALZA 3R9XB 1NI4B 3QKRB 1ACMA 3GJ7A 3OPYB 3K0HA 1WV0A 5JLWA 2B6HA 3PFHA 5EEAA 4D9FA 1GPBA 4DV6B 2IQIA 1NE7A 2ERCA 4JOQA 3UM9A 4MI1A 4DZJA 2R1UA 1PV2A 2QLZA 2GF0A 1IQ0A 1S7OA 4JJFA 3U56A 2WKQA 1IOLA 3PQFA 3RS0A 3U5ZB 5CLGA 1S3IA 3OV8A 1CIPA 1HG0A 2A92A 3BFPA 4G94A 2VBFA 3FPAA 3QXHA 4L15A 4X7BA 5DX0A 3VJMA 4HTFA 4WASA 4B35A 4WVFA 5BWNA 5C52B 1ZUIA 2JLAA 3T3IA 3DAOA 2ATXA 1RI2A 2K2WA 3BH7A 4HQEA 1FSGA 1RXUA 1XPOA 1DP3A 2OBBA 2GN6A 4D56A 1W1WA 1AKRA 4YP6A 1SVMA 1USUA 5CB8A 2AG8A 1NOKA 4FC6A 3MYYA 5JS7A 4D7NA 2IT1A 4CG3A 2BEVA 2EZUA 2YWEA 3FUUA 2HK8A 4X90A 2XAHA 4ZO4A 1BCRA 2D3WA 3R8XA 3ODPA 4DOMA 3F9CA 2F8SA 3E3OA 3HB7A 2WDZA 4MO9A 2GWRA 2ECFA 1L5KA 3ZNNA 3G7UA 3ANXA 3MTDA 5U4QA 4R1UA 2GPTA 3HYTA 1KDTA 3RUFA 4J8PA 5JIBA 1AXRA 1JDTA 2E18A 5F5LA 4MYCA 4LOHA 3WL5A 1JSRA 4UREA 4EFKA 5ALOA 1R12A 2ZCVA 3Q87B 2YV3A 1EK5A 3TTWA 3VNQA 4WW0A 4AY4A 4KMFA 4FQ8A 2GM5A 3KLOA 4HA8A 3KJHA 5C7OO 4AK9A 3UCFA 3GVAA 1OC2A 1TA9A 4FMBB 4M7RA 4PFSA 2FX0A 1Y4UA 2Q4BA 4K9LA 1NLMA 4IKPA 4J1SA 1NTCA 3ACDA 3L07A 5LUAA 2YIVX 4LF4B 1D4AA 2GCIA 4PHGA 4B5KA 2HPIA 2RI0A 3OSFA 1Q11A 1YZHA 1T6SA 5AKXA 4Z9YA 2HMWA 4JKOA 5FFFA 4GIBA 2L18A 2PMFA 3HZOA 1W96A 1ZREA 2AYYA 2QV7A 1ZMRA 3E9EA 1CK4A 2A6PA 2ZPTX 3FOAA 4RSHA 1P2DA 4K6GA 4P82A 2L9VA 3I1FA 3M34A 4G4GA 4US1R 5CAEA 3CEPB 4ZO8A 3L6DA 2F55A 4XIIA 4Y2UA 1MFPA 4DXAA 2WIDA 4OJYA 5F3WB 1Z34A 1E6KA 2HWUA 2ZANA 4PYLA 5BV8A 3L92A 2JIPA 2O0LA 2OMEA 2GVDC 3Q6IA 3CUQC 5K0LA 4FHEA 2RNJA 2EEZA 4DLVA 1H66A 3U1DA 4CDGA 2AFIE 2ZBFA 1PVEA 3LUGA 4L8YA 4PCUA 1KEZA 4U0JA 4WZBB 1E5TA 3A6JA 3BG3A 1IYZA 2UXNA 2OSBA 2W6CX 4K9DA 4RGQA 4P3NA 1FY2A 1M2EA 3SIWA 1MIOB 3VZDA 3R1IA 1GZSA 2MJLA 3NOXA 5E8GA 4HK4A 5DNWA 5JYEA 1CVIA 2X1VA 3AYZB 1H4QA 1X7WB 2OZ6A 1VXRA 3WX0A 1UBJS 5FWXB 1YRHA 4DCCA 4NWIA 2X8JB 3MMXA 2PZBA 3G3ZA 3C1OA 2WFMA 1CR1A 1VOTA 1KZ7B 3NDJA 1SKYB 2G7ZA 4HATA 5CTAA 3HYIA 4G12A 3WRXC 4FC7A 3RVPA 1E8DA 3HI4A 2E19A 2CJFA 4ZCSA 2R60A 3SYKA 5I01A 2EBHX 2O2EA 2P9ZA 5HSGA 3TRJA 1WZEA 4NC7A 1O87A 4GP7A 1PX2A 3QVUA 2DXIA 2PUWA 1FYDA 3IO5A 4RU1A 3S8MA 5FB2A 4ZJYA 2P9JA 3OS2A 1XROA 1O54A 2JRCA 2YWBA 2AN5A 5EINA 1QRUA 1ICIA 3N86A 4A2PA 1KVTA 1GXSA 1YIDA 4QWWA 4XWGA 3AF4A 3REQA 2B63J 2DULA 4H17A 3HEAA 4X66B 2DUUA 1XRMA 1LW7A 2ZJOA 5SY6A 3KZOA 1UHWA 4EW1A 3A9UA 4IGEA 4LB6B 3EGEA 3TSZA 2WABA 1ZQ9A 5AKYA 3SQOA 4HYQA 3AUKA 2DG2A 4BX8A 5EE1A 2BCGY 1HT0A 3VMMA 5EZ6B 2QTTA 1P9WA 3O8LA 3RIEA 3LNQA 1YKFA 2JK3A 4LLGF 2FQ1A 2OCIA 3HXKA 3NW9A 4TTRA 2EU8A 3TD6A 5JXJA 1CEYA 4C29A 1MJ9A 4YUVA 1TXGA 3TINA 2UUPA 1SD5A 4TV9A 2LBFB 1BFKA 2VSQA 3HO6A 1MDBA 3FFTA 4BE9A 2JA8J 2IXEA 2OK8A 4MRMB 2XA9A 1BM9A 1R8YA 2CNKA 2DT8A 4DYQA 3UUWA 2ZUSA 2FW7A 2D7JA 5GP9A 1EFCA 1B8IB 3RO7A 1AQNA 3BX1A 4E5KA 3WDLA 1MZPA 1C1XA 1JBKA 1EVYA 2ZG6A 1GL3A 1FQWA 3CC7I 2Q9BA 3EOAI 3GH1A 2MSYA 1UBRS 1TP4A 3F8FA 4PCQA 1F8FA 2GZAA 3BMOA 1QHSA 1L7EA 2OO5A 3BMNB 4G5GA 3L8EA 4H7DA 2NADA 2GN4A 4JXJA 4K7JA 4CLEA 4NP6A 3ROFA 1KQGA 1LPOA 3Q8LA 2WP0A 5HJEA 4GPTA 1ZHOA 3E61A 4WGFA 1EF4A 2YY5A 1HDZA 3KO8A 4A8HA 1F5SA 1JI8A 2VQGA 4WQMA 1C8VB 2ZUTA 1LDJA 5K3FA 4ENWA 2FGKA 3IX7A 4G56A 1XMSA 2OUIA 2OD9A 1V47A 3KU4A 4FHGA 3LBYA 3FHLA 2J87A 1XRRA 4J1TA 2W83A 2Z2YA 3GGOA 1ZHHA 3INRA 1L4UA 3NRJA 3P32A 2CUFA 1Q0PA 1XCMA 5A3VA 1N4AA 1D8JA 4ZREA 1ZP6A 5F98A 3BTIA 1LDYA 5D6EA 1QZTA 4NNPA 2PUFA 2P2DA 3PEVA 3D5LA 4HHEA 3C3PA 4ICIA 1FJLA 1E99A 4LJ6A 3WB1A 1QJ4A 2DFHA 4K8OA 1IW7F 2EV5A 2ELHA 3I6BA 2PKWA 5L7YA 4YXWA 2Q4DA 1F9AA 4FMPA 2H4YA 3IIJA 4N7JA 3BIFA 1GADO 2BFOA 4TROA 3ZGOA 1W2WB 4MAFA 4QOGA 1Z0KA 5B7NA 2SECE 2DR2A 1YB1A 5H81A 3BA1A 5A3QA 1C1YA 1PSZA 3RYFB 1JG2A 3IAS6 5EE3A 3I54A 3RPEA 4GMDA 1GN9A 1S8AA 1X0VA 2HK6A 2JCGA 4FCTA 4IGIA 3GIWA 4M2LA 3ZQLA 4ENVA 3KR0A 1YFHA 1RQLA 1A2BA 3GP3A 3PG5A 4LXYA 3VISA 4IO1A 3PQCA 3H9UA 1LC3A 1U7UA 1WMSA 2HI0A 1R4NA 2ZE5A 5BNWA 3HJBA 3CRVA 2M8GX 1JT0A 1VZ0A 2D45A 4EARA 3D5RC 4EM1A 1NE2A 4FT4A 1J5XA 4M98A 1A5AB 1FSFA 3TSAA 3ZQIA 2X6TA 1P6RA 3TL6A 1XTZA 821PA 1QX4A 5M3BA 3OFSA 2GPNA 3VYWA 3I28A 3PUKA 5EZ5A 4EEKA 1B1AA 3GJ4A 3ETHA 5F33A 4LFAB 3ZWNA 3HKEB 1TJ5A 3I01A 2G70A 3ZMTA 2IITA 2IC5A 3CUYA 5JLAA 5I7OA 1KFJB 1Q17A 4YJFA 4BNIA 3X43A 3HXPA 3PTLA 1SFKA 4TMTA 3RRFA 4WBSA 4Y67A 5A5FA 1J49A 3A1YA 1DP4A 2BHLA 1X6VA 2B5VA 1ZGHA 3SEQA 3RKQA 3EVEA 2DEUA 1M6HA 1YRBA 2WWVD 1E2JA 4KPUA 3LF2A 4IX7A 2R48A 3U4CA 3GD5A 1E3PA 4I2OA 4WEQA 4BDZA 3GZNB 2HA3A 1PUXA 1AGXA 1QQ6A 1RRFA 3KOOA 4N9WA 2ZEJA 3L02A 1JIJA 3BXEA 4GG1A 2GAIA 2QUHA 4IP0A 4YAOA 3W5UA 2QN1A 4A3JJ 2QQGA 2IXDA 3BWYA 4XASA 3SX0A 4ZRDA 2GWHA 3G2PA 3NGXA 2ROQA 4J6EA 3VNAA 2OGTA 3NVKI 2KBFA 2KHZA 2R7NA 4X44A 1H0SA 1MMGA 2M98A 1WGXA 3D4NA 3FROA 5EQFA 1F60A 3T1VA 4EG0A 1E9CA 1EUZA 1V9SA 2HJ9A 2IY9A 1XAHA 3GVXA 3HDJA 3MELA 4I1UA 2EZTA 1J1UA 1R15A 4BBAA 3PFKA 2YV2A 3LW7A 4PXAA 2SKCA 1EXDA 1Z77A 1UDRA 2O2SA 4QUKA 1JQJC 2VQ3A 2LD5A 4UCWA 3LC0A 1Y8CA 1QFSA 2MYTA 2V65A 2FH5B 3UK0A 4DUYB 1TFUA 1TU0A 2XAAA 4H31A 2VEDA 2DBZA 3NXKA 4RVNA 4A82A 5B1EA 3JR9A 4ZTBA 2FFHA 1X8JA 2N1MA 3ELUA 2BY2A 2XWQA 3MWEA 3DDSA 3H1PA 5FKJA 2IP1A 2Q7DA 3HP4A 3TN7A 5EJ2A 4HEA6 3OFVA 4TYPA 5HF5A 4BNVA 3KU1A 5JALA 3UN1A 4AJ1A 2GD1O 3G5AA 1J0RA 1U0GA 3OA0A 2W57A 4KRGA 4O1IA 4HDCA 1OA0A 2GLXA 1S2GA 2ODWA 3DVAB 1E1RA 2B8WA 4J0CA 4UU1A 5B57C 5I3CA 5LYJF 2V1XA 3EC2A 3N8IA 2R8EA 3P8ZA 2BFAA 2JVJA 4H2DA 1SC7A 1L5ZA 1NDUA 2P7IA 3PITA 3U9SA 2PZ8A 2PQ8A 4GGMX 5I4CA 2QYTA 1D0ZA 2XMBA 4OLJA 3KFWX 2IZZA 1VPWA 3GLIB 1FFCA 4LK0F 1V9LA 4AWXB 2HLNA 2OC9A 3CT4A 3QU4A 5COAA 3SMQA 3FOFC 1PV4A 2O6HA 3AU9A 4FGWA 4KFRA 4FJ2A 5DP2A 1H9BA 4TRMA 3AG3H 1NHWA 5KHDA 3OESA 3KEFA 4F52A 5GZ6A 4KN5A 3D7SA 4Y6RA 4FFLA 3K4CA 3AJRA 3OQVA 1YHYA 4XRGA 1DG9A 3O8GA 3IUYA 2J3JA 4IYRA 5EVCA 3C5EA 1DRVA 1K7SN 2HIGA 5A4FS 2XWBF 4IFIA 3H83A 1J0EA 1XZMA 3D7KA 3IR5A 4LZNA 1MJFA 3KB1A 3MOIA 3QUQA 2G5CA 1F14A 4J7AA 5ICCA 4IVPA 4AX8A 2G9QA 3THWB 1C9YA 2BMWA 3PLRA 4MTCA 4N4NB 3J7AC 4AMGA 2WLTA 2VT2A 5KNDD 3KKLA 4A3DJ 1Q7RA 1VBNA 2P68A 3SS7X 5TLSA 3DF8A 2Z6UA 3TXXA 4Q16A 3HG7A 4X1YB 3H1CA 3R5TA 3SS8A 4RX1A 2ZJPF 5M5XJ 3LZDA 4AX4A 5HKOA 1JJFA 5DTJA 4XKWA 2A1TS 4WDQA 1VL8A 2E4XA 2M6KA 1IJFA 4DIFA 2JWTA 3PIOF 5EG0A 1Z8NA 4XM2A 5JFRA 1PD0A 3B6MA 3EZ9A 1R0XA 3O4FA 4I5IA 2DQSA 4R68A 1Z63A 3HOZJ 2C03A 1K78B 1ULTA 1ZH0A 4UUAA 3ADOA 3JZMA 3R40A 3PR3A 2X6WA 3E84A 3T1BA 4WZZA 4XKCA 5FQOA 3IDAA 1ZJ6A 1JG1A 2FN7A 1JMYA 4JP1A 4M3FA 4WAUA 4GMGA 2QX6A 3M83A 4YRNA 3OE5A 1JMVA 3ZDAA 4UUPA 1ISSA 1YVDA 4AYTA 1IMJA 2I7TA 4HBLA 2VT7A 4FT2A 3JVVA 4EP1A 1THTA 1YS7A 2ID7A 4JXXA 3K20A 1Q5PA 3F1LA 3WRYA 3BULA 4LZLA 4PX3A 3HZHA 3M6FA 1Y1VJ 1NJFA 4IAOA 1YZVA 2VHQA 3DC2A 2Y0SN 3IPAA 4J29A 3KAQA 4OOEA 2RG1A 3MGGA 9MHTA 1CRPA 1VGQA