4E70A

Crystal structure analysis of coniferyl alcohol 9-o-methyltransferase from linum nodiflorum in complex with coniferyl alcohol
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
368
structure length
359
Chain Sequence
MDAATAVELLDAQPQVWHHFLGYINSMTLQCALELDIADVIHRHGHPIPLNQLAAALEIPQTKAPFLSRLMRMLVHLGYFTQVITKPVLPSYWLAPLSRLLLKQNPYNARSLTFCSVHEHLVDPWRQMSAWLRTGKEDGKDTPNAFAFAHEGKKVYEVCSEDANFSQLFSEGMAGDSWLFSRALVSKCRDAFEGLSSLVDVGGGTGNTSKVIAETFPNIHCTVFDLPHVVSGPKQTHPNLDYESGNMFTDEIPHADAVLFKWVLCDWPDEPVLKMLKQCKKALTKKGKLMIADHVLDHESCNDSNSMGTSLILDMLFMSFLEGSLRTEKQWAKLFAEAGFKDYKITPVGGLRVLIEVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Coniferyl alcohol 9-O-methyltransferase
publication title Structural analysis of coniferyl alcohol 9-O-methyltransferase from Linum nodiflorum reveals a novel active-site environment.
pubmed doi rcsb
source organism Linum nodiflorum
total genus 128
structure length 359
sequence length 368
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4e70A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4e70A02
2W85A 3QPTA 4CDGA 3HA3A 1YB2A 5DPMA 3LQRA 4G9YA 5DTQA 4E2YA 4CTKA 3G3ZA 2XASA 3C6MA 1Z91A 1WRJA 2K4BA 3KP5A 5LGUA 1XMKA 2ZULA 4M36A 2LF7A 2P40A 2LF8A 5AONA 4P96A 3TKYA 1ZGJA 4EJVA 4KDCA 1VIDA 1JTFA 1KYZA 2DQRA 5LHIA 2I9KA 1FOKA 2DAOA 2YX4A 1SUSA 3BWYA 1YZHA 3LDGA 5CLSA 1FYMA 1WWXA 2FMLA 2EA4A 2PMHA 4BP3A 1NW6A 1IN4A 1PP8F 4OINF 1K7AA 3AXTA 3E6BA 4XBFA 5D5UB 3EYIA 5EQJB 1Z1DA 4L9TA 2E7WA 5ICFA 4LK1F 2I7CA 4LFUA 2P7CB 2PGXA 2QWWA 1ZH5A 5IKMA 1R74A 1F1ZA 3OU6A 1FBQA 3J7AO 5C0OE 3G5TA 2M5WA 1KR5A 3G2OA 4OMYA 4MQVA 4RYLA 4P55A 4I02A 4BH9A 5E1BA 1VP3A 3KEQA 2O0LA 5FGMA 2HYFA 2K4JA 4PCAA 2RKHA 1G6Q1 3B7PA 2AR0A 5FA5A 3V8LA 4DM3A 2JH9A 4E70A 3EVBA 1J9IA 4EVIA 2ETHA 4R6XA 2HR3A 4AD9A 2WK1A 3ANXA 4YIFA 3NWBA 5FD6A 3M6UA 1VPTA 2AOXA 1L1EA 2HWVA 2B9EA 5F2KA 3FM3A 2B2CA 2C7RA 4HQEA 5EIWA 1RJGA 4H0NA 4BLUA 3FRHA 4HA8A 1SKMA 2OQGA 3L09A 4ATNA 4EJTA 4BAYA 4UOEA 3KP2A 4Q47A 5BPDA 5BW5A 1QZZA 3BP8A 4L0ZB 5DXJA 5L3CA 1UWVA 1HW5A 3BGDA 5CVUA 4ENJA 5FCDA 2YR2A 5DM2A 2BR3A 2KW5A 1FBNA 2AOWA 3SZTA 1MJAA 2P1DA 1NV8A 3HRUA 2QBYA 2M30A 1NW7A 1XSVA 4QDJA 3FUXA 5KVAA 5FO5A 5E1DA 4KDPA 2NNYA 4HGZA 4GYIA 3EMDA 4POOA 4Y15A 1D5VA 1YO5C 5CIYA 2VBWA 2PQ8A 1JHHA 2ESRA 2DW4A 3VOEA 4HX8A 4M37A 4GO1A 4CTJA 2C7OA 3P2IA 2W57A 4YUVA 4PYLA 1O9HA 3W6KB 3I53A 4CXMA 1S7OA 4KICA 1G60A 3M8FA 5FUBA 1O3TA 3CJNA 3FPGA 3ECOA 1JSXA 3TR6A 4CKCA 3LCUA 4RTLA 3FTFA 1BC8C 4Z2YA 3ZQ7A 3F8NA 3TKAA 4S04A 4HGYA 2K7LA 3SM3A 2E7XA 4MGRA 4QDKA 2HDCA 4NB5A 1Y8CA 5GOZA 1LDKB 1T6SA 5HDKA 1XDZA 2QZ8A 4G7ZF 2UYQA 1FSEA 5D6EA 5D5XB 4C06A 4WXDA 5LSAA 3ROUA 2H6BA 3HTUA 4L9JA 3KQVA 2EFOA 4C08A 4XCXA 2YQZA 3KQWA 5M5BA 1IN8A 1WSUA 2P6SA 4U0YA 3ERED 1F9NA 5DX8A 2FMYA 2C7QA 4YUZA 4G8XA 4L5JA 3ABTA 3UJDA 5TRDA 3GGDA 3G73A 5MHTA 1QNTA 3CC8A 3LPMA 5BXYA 4UHTA 2EV0A 3BKXA 5E9QA 4LG0A 4AZTA 3HTXA 4ZYEA 1EH7A 4EM0B 3E6DA 3RW9A 1R23A 3IKTA 3VC1A 2DU9A 5EC8A 2IPXA 1HMYA 2KIUA 1BC7C 2K86A 5K0NA 1ON1A 2EFNA 2EFQA 4QLCU 4I0BA 5D8LB 2HMYB 3E8SA 2ADMA 3TPZA 4N0BA 1B42A 2FQ3A 2FBKA 1X19A 2DPMA 1YYVA 4RGXA 3V8VA 2IH5A 3KCCA 1ZKDA 3FXUA 2BM8A 4HF0A 4UV8A 1IY9A 4R05A 5F64A 4GYGA 3T5XA 3KQSA 3BT7A 5CJ9A 4U7TB 4RTQA 1TPYA 4QPPA 1KU3A 4PCQA 3GFLA 1ZN2A 2Q8KA 2XHKA 1WG8A 1QQIA 2OKCA 2E1NA 3FHZA 1ZG3A 3R9XB 2IA0A 2EFPA 1PRYA 3KETA 2IP2A 4EMSA 4YV0A 2O6GE 3KPYA 3PVCA 2F5DA 3M33A 3KR0A 5EKXA 4I2OA 3IKVA 1PJZA 4DCMA 4RTSA 4IPAA 3K0LA 1VTNC 3RTRA 2CYYA 5HOQA 3FXRA 3GUDA 1P91A 3PFGA 1Q1HA 3VODA 1FP2A 1AQJA 1B6AA 4GOLD 3BWBA 1KA8A 1K6OA 4HC4A 3S2WA 1U78A 3RPQA 4MQ9F 1YS6A 4PYQA 3NVMB 4I98B 1G8AA 5E8RA 2FF4A 3MCZA 4LWOA 1MDMA 3WGHA 3DLCA 5K0GA 4RVFA 4A0YA 1ODDA 1MKMA 5BPIA 4KWCA 4N9HA 1QO0D 3KR2A 1HSTA 1U2WA 3JAMK 4OBXA 1O3RA 2QM3A 4U7BA 2DBBA 2R7DA 5E17F 3GRYA 3PFIA 4AUKA 4DZRA 2JPCA 3V7CA 1YFLA 2Y75A 2JHPA 4IHTA 2ZFWA 3RIEA 1BIAA 1LJ9A 1RZ4A 1SD5A 2UWMA 3NWEA 4H0EA 1MJFA 3K2ZA 1JQDA 3HRSA 4XSZF 1WXXA 2D1VA 3KQMA 4OA5A 9MHTA 2M1BA 5E9JA 5ERGB 3CUQC 5E8GA 4RVDA 2XRNA 4OOIA 2BH2A 2A6EF 4GGGA 4HDVA 5K01A 1O7LA 1R1VA 4KRGA 3G2MA 1UHWA 3TO9A 1F5TA 4QQKA 4IV8A 1ORIA 3A27A 3NW9A 3FZVA 1UIRA 1IN6A 5HOOA 3RKXA 1PP7U 5EMMA 2P41A 2VN2A 4E2XA 5E2AA 2KJBA 1KHHA 2ZVJA 1SG9A 5LQAA 1ORHA 1HQCA 2NNWB 5LBQA 3GRUA 2PFBA 1L3CA 3R4KA 3GIWA 3R0AA 4A6DA 5LQJA 3UJ8A 4CHUA 1KU9A 3WTTC 3C18A 4QVGA 3PQJA 4IKPA 3OV8A 2Z33A 2DK5A 2MC3A 3DR5A 2PJDA 3JAMZ 3GJYA 2IDKA 1JG2A 2G7UA 2NNNA 4CGZA 2AN5A 3LBYA 3R61A 2IBTA 3IV6A 4FSXA 3DMHA 2PX4A 2A5YB 3MQ0A 3MQ2A 5E20A 3E6MA 4WWCA 1RI7A 3V8JA 3A25A 3TFWA 4FT2A 1BOAA 4L18B 3OPNA 4RGUA 5EZQA 5FD5A 2UZ4A 3DFGA 2CG4A 3H2BA 3FPJA 4QTTB 2M45A 1XCLA 1BN5A 1P2FA 3P71T 4M74A 5CVJA 1R7JA 4ENNA 3HVIA 10MHA 2YR0A 5EGSA 2L3DA 3T7TA 3CUOA 1STZA 1HKTA 3PLAE 2O05A 5LRSA 4HTFB 2VE9A 1KXZA 4RVHA 3LSTA 4PNEA 6PAXA 3LAJA 2L01A 3WGGA 4PYMA 3CLOA 1KGSA 5K0FA 4HBLA 3HEMA 3GU3A 1OYWA 5E18F 3ZMTA 3QOPA 5LQRA 2QENA 4RB3C 4BHCA 3E5UA 3WTYC 5DRTA 3T0IA 4GOND 3ELWA 3WTZA 5ED4A 2V1UA 5KVRA 3K1NA 4AIKA 2F5EA 3FRIA 2AS0A 1O54A 4LECA 2CGPA 1DDNA 1L9KA 1FYKA 2RGVA 3G88A 4I7HA 1DPUA 4EGYA 3OE4A 2QUFA 3PS9A 2JTVA 2IGTA 3LCCA 4C03A 1SAXA 1B4AA 2CKDA 1HBXG 4KN4X 3JTGA 4I01A 2P8TA 5CCXA 5E1ZB 5DSXA 3MZHA 4ESFA 2D1HA 3BOQA 1RJDA 2PMUA 3MAGA 3WE3A 4TV7A 3F21A 2GB4A 3BWGA 5LLQA 1NT2A 3F22A 5B1SA 2HTSA 4A12A 3RKYA 2FHPA 3M6WA 1HW2A 4JBAA 1T98A 4X63A 1FSHA 2NXJA 2F5FA 5J8CA 3CKKA 4IF4A 5D5VB 1R58A 5KK1A 2Z6AA 1RI1A 2ZFUA 1YW9A 5HIIA 3U2RA 5H02A 2VDUE 1YTYA 2ZWAA 2DFIA 3FMRA 5DX0A 4GC9A 4IRIA 2L4MA 5LEJA 3ZMSA 3M7GA 2V7EA 1FZPB 3UA3A 2JSCA 4AWXB 4NHJA 3LCVB 4RTPA 2QY6A 3MTIA 3DV8A 1HNNA 3KLOA 5K05A 2YXEA 3ID6C 2EJUA 2MLKA 3HOSA 2I62A 4M73A 4FP9A 1W7PD 3NRVA 3HCAA 3JSOA 2GAUA 2ESNA 4CZZA 2B78A 2ZO4A 3HCCA 2NXNA 4YUYA 4P9FA 5DX1A 2A07F 3GVAA 3JTHA 3E5QA 4EM1A 2VZ9A 4X61A 1HSJA 1DUXC 3SX0A 5ICGA 1ZAOA 5DD8A 2EFWA 1U3EM 2PX5A 2XGXA 3EVDA 2EJTA 2QRVA 4UVCA 1ZRFA 1RJFA 4Y17A 3F3XA 3FXQA 3MAJA 3LFKA 1SD6A 2PVCA 1P1CA 1YLFA 3TM4A 5E8IA 3WU0A 4LLLA 3VB2A 4MWZA 4F85A 3WU1B 2F5CA 5FHQA 2PXXA 3L7WA 3M8EA 4ER0A 1XMAA 3KPVA 3WTUC 4FX0A 1HW1A 3BPVA 1Z9CA 3ISPA 1O3QA 1NV9A 3P9NA 4JQFA 5EG5A 3HRMA 4DF3A 4QPNA 3QRFF 1K79A 2OB1A 3A4TA 5K0CA 3HM2A 4E32A 1X1DA 1T43A 2QYOA 3P9IA 3P2EA 5GINE 5EKUA 3FTEA 3NQOA 2ZBKA 3R60A 3CVOA 2P7HA 4IVNA 2PBFA 2OO3A 4XLNF 1XSXA 1X3UA 2P7VB 2M8EA 1LEAA 3RI4A 1EQAA 3JWGA 3UJBA 2MH9A 3WG9A 2EG5A 3V7RA 2PG4A 2BR5A 1OR8A 3O6BB 4AIHA 4RTOA 2FA5A 3D5LA 2ZIFA 1Z6TA 5HS8A 4IHSA 3DF8A 4GC5A 4ASNA 4QWQA 3RDIA 3ZMUA 2AN4A 5KS2A 1P4AA 1K78B 4YV1A 4U7DA 1U5TA 1TTYA 4BQAA 5D8KB 3NMUF 3KEOA 4YUWA 5H6QA 3B89A 4HV5A 1D2HA 2L4AA 5CVRA 4YFNF 4JXJA 3TO7A 1W5TA 2HYGD 2ZBPA 3OU2A 3TLJA 1T2KA 5FB2A 3AWIA 4RVGA 2ZBRA 3SGLA 3U81A 4AX8A 2ZZMA 4HRAA 3GX4X 4XUDA 3U9GA 2LD4A 3LKZA 4RTKA 2R7FA 3TDUC 1XTPA 3OFKA 4F86A 5DDGA 3QOWA 5DCFA 2PT6A 3SVZA 2OZVA 4LK0F 5DSTA 1YF3A 3KKZA 5TJJA 1VQ1A 3BZ6A 3R0JA 3G8AA 2G71A 4GUAA 2F8LA 3NVKI 3HVHA 1S7AA 3J80K 3SSOA 4MHGA 4CICA 3ELKA 3FUUA 1W7PB 3COAC 1IZ1A 2WA2A 4YV2A 3CTAA 2UXNA 3KHKA 4K2EA 2IIPA 3GDHA 4HX4A 4AZVA 2CQKA 2CWEA 2P35A 2XAJA 1XCJA 1B59A 1RNLA 2RDPA 4KVZA 4G7HF 5EOVA 4M6YA 1ZG5A 5LQNA 2ZZNA 4RAZA 2ZMEA 1WKMA 2EV6A 1CF7A 1R1UA 1I5ZA 4XSXF 2OBFA 3PFHA 1R18A 3L00A 3EYYA 3H92A 3DQVC 4E33A 3VYWA 2PXCA 2Z9OA 3LA2A 4CYDA 2NAZA 1C0WA 5LGTA 3A26A 2VDWA 4YG2F 1QANA 3UJ7A 1XSDA 4KIBA 1Q0SA 1UCRA 2G72A 3B5IA 1JTEA 1FP1D 2VODA 3MFKA 4WF2A 4K6MA 4E30A 2MLGA 1D3YA 3OU7A 3F6OA 1DUSA 2BYVE 1BOOA 5LGNA 1N2XA 4ETSA 3SXJA 1MD0A 1WY7A 3QP6A 4U88A 4RTMA 1IN7A 2HNKA 5LR6A 2DLLA 1REPC 1I1SA 3F23A 2IW5A 4B09A 2FRXA 1KYWA 1IXSB 5FLXK 3I5UA 2GPYA 3VC2A 4YFXF 4L9VA 2VOOA 2BEOA 4LB5A 2Y0MA 4Q48A 2IFTA 4HDUA 4MIKA 1I6XA 4EM2A 3HSEA 2O06A 1FT9A 3FMSA 5L3GA 2EV5A 2PY6A 5BS6A 4G94A 5K1YA 5D4RA 2HEOA 5DYMA 1P1BA 4ZYDA 2G70A 3SQNA 5F2NA 2OB2A 2VP3A 5EHGA 1OYYA 3P7NA 1USTA 4MTDA 1YFHA 4Q5SF 3BY6A 1M6YA 2Z3YA 2CFXA 4N9IA 3BPXA 4F7ZA 1IM8A 2Y1WA 2RNJA 1ZLKA 2AOUB 3I0TA 3N97A 5ERIA 3HHGA 3FPFA 4LLNA 4KA4A 1BIBA 3I59B 4DCGA 3MHTA 4PYIA 5DM4A 1R00A 2AZTA 2P3QA 4KN7X 2GXBA 4O29A 1YIOA 3I54A 3RKWA 5LHHA 1XDSA 2IJLA 1O3SA 3EQLF 2VS1A 4DQ2A 1G3SA 4FT4A 3C3PA 4LLGF 1VBFA 5EVJA 3VEPA 5C9ZA 4LB6B 5DCMA 3OCJA 4OIOF 2VBYA 5FFXA 3ER9A 4O3MA 2PX8A 5GIPE 4D0PA 3HA7A 2O03A 3UJ9A 3JSPA 2H6CA 2IA1A 4YUXA 1XGOA 1LB2A 2ZJ2A 1JXSA 3SHFA 3RYRA 2PV0A 2CMGA 4RTJA 4FT8A 1MZBA 4B8XA 4MEXF 3KR1A 3GLXA 3IRRA 3K6RA 3CO6C 3A7DA 4EQQA 3I58A 3TM5A 4CXFA 3C0KA 2FBHA 3UJ6A 1J5YA 4ISCA 2YTZA 2K02A 5GIOE 1BHJA 5LQCA 2ZCWA 1TLHB 2LSOA 1H9TA 3M70A 3TQSA 4PIPA 1XB4A 3ELUA 5KQRA 4CWAA 3ZMZA 2KIFA 4A5MA 4MQ4A 2A14A 4AZWA 3I71A 4BLWA 3C3WA 3HYIA 2ZBQA 3M9AA 4Q4ZF 2GZWA 2Q2EA 4M6XA 2RN7A 5E1WA 3O4FA 1UHMA 2V1DA 1CGPA 2ZCJA 2CMHA 1WQ2A 4RX1A 5DM1A 1Q0TA 5E9WA 5BMZA 3JWIA 2DI3A 2PLYA 1I9GA 2P3LA 5EPEA 3BKWA 3QOXA 3DOUA 2IA2A 2TDXA 2IBSA 3KP4A 3T7RA 3U1DA 3KU1A 2P7IA 3OZSA 4C07A 1R36A 2RVCA 3W6JB 1IXRC 2GLUA 4KW7A 1NW8A 2OZ6A 2VC0A 3ZN1A 4F84A 1MGTA 1G8SA 4KMFA 1KIAA 3GO5A 2NXCA 4HF2A 2FCAA 1E17A 1NE2A 2P5KA 2VE8A 3H3ZA 2ZNYA 5HS9A 3IHUA 5EMLA 3ECHA 2P4WA 3MWMA 3R0QA 1L3BA 4R8SA 1OPCA 3ZP5A 4YIIA 4LMYA 2CWWA 3CGGA 2ZSUA 2EX4A 3Q87B 3REOA 3RYPA 1BI2A 2JHAA 5L3FA 3KPJA 2A69F 5E8JA 2K27A 3L9FA 3V4GA 4OIRF 5JHUA 1INLA 3GNLA 1O9GA 3KP6A 4RGRA 3DUWA 4AZSA 3GRVA 3DLIA 1RJEA 2NS0A 3KZZA 3E23A 4GF5A 4BP1A 4MEYF 1YZ3A 4RS8A 1IXKA 1ZG1A 4L5IA 2NXEA 3OE5A 4Y30A 4HYEA 1Y0UA 3UJAA 2FK8A 3WTSC 3SMQA 1J7KA 1GXPA 4G6QA 2P5LC 4HLYA 1U5TC 2NYUA 2QBYB 3EETA 1S6LA 5JR3A 3TOAA 3LKDA 3IWZA 4OQDA 5FULA 1VL5A 4GOOD 4PINA 4KYWA 5GM1A 2P3OA 2EK5A 2RC4A 1NBIA 2J5OA 3IRQA 4EGZA 2KJCA 2C7PA 3TQNA 1R6AA 1OYIA 1F4KA 1XVAA 1BM9A 2Q41A 3PX3A 1JR4A 2HQNA 4WK8F 2OYRA 2B25A 3EGVA 3AAFA 3GFIA 3MEXA 5E1OA 1BI0A 3K1MA 1ZRCA 4R8HA 4KNYA 4PONA 3LAPA 1JGSA 4GQBA 1ZREA 3V7SA 3T8TA 4E2WA 1QZYA 2FPOA 2DPDA 2Y1XA 1GHCA 4M72A 5ILSA 4O6JA 4DNCA 5BW4A 2GS9A 3B3GA 4OQEA 4UNOA 4EV0A 2R6ZA 1UB9A 3KQYA 3F8FA 1IW7F 4A0ZA 3KPWA 5IH3A 3BWMA 2D2WA 2VONA 2FEZA 3HCFA 4MNUA 3EEOA 3E5XA 4CKEA 1QAOA 2RQPA 1MJ9A 3N4MA 2H1RA 3ER8A 5AIPA 4BYYA 4WCGA 3BWCA 3FF5A 1TQMA 1TNTA 2EB7A 3AY0A 1A04A 3ZMDA 3QU3A 3TO6A 3R6SA 2ZTHA 5HLGA 3IYLW 3KQPA 1I1NA 1IN5A 3WTXC 4S05A 2PKWA 4LG0B 2Q0OA 2YPRA 4HH4A 2GA1A 5FADA 4OMZA 3WE2A 4P58A 4LGWA 1U2ZA 3DMFA 3PTAA 3R24A 1B1BA 2VT3A 1NW3A 4Y2HA 4FHTA 2ZWVA 5A2QK 1D8JA 2XAQA 2QE6A 3KE2A 5LRRA 5FWDA 1G4DA 2H27A 1U6GA 5K0LA 5L3BA 3LHDA 2STTA 3BZBA 4DA4A 1ZRDA 1FWZA 2OU2A 5D1HA 2G7HA 2XROA 1RUNA 1XGNA 2HGCA 1JG4A 2ZIGA 1QBJA 3EGEA 2HS5A 3L2CA 4BNCA 2AOVA 3NJRA 4IRGA 3EDPA 4I0AA 2VOPA 2BM9A 2IT0A 2O8XA 4ESJA 3D0SA 3NTVA 2PWYA 3H3UA 2H00A 3ZMVA 4RWZA 2ACJA 4P9UA 1TNSA 5HFJA 3Q9VA 3WTWC 5IT9K 4ZZDA 3O7WA 3O3KA 3LX6A 1YUBA 1TW2A 1T39A 2PWPA 4FS8A 4RV9A 5DUKA 2JHCA 5GWXA 3UBTA 3BJOA 1HKQA 2G1PA 3K9TA 4XUEA 3B02A 3GEZA 3E05A 3M6VA 3K0BA 2HQRA 2C6YA 1FBUA 2GIVA 3NDJA 2RV8A 1T0FA 3MERA 4YFKF 4FX4A 2UZKA 3FUTA 3C1DA 1MJBA 4NQWA 1AV6A 4LG1A 3UJCA 5EHIA 3Q7EA 3SXYA 1EH8A 1EJ0A 2G9WA 3B3FA 3ABUA 4KDRA 2IH4A 4HV6A 4FSDA 3DXJF 4A6EA 1R8YA 4HQMA 1MDMB 5DTRA 5J6XA 1SMYF 2PT9A 3LBFA 1JE8A 2AN3A 2Y48A 1OKRA 1B9NA 2I6GA 2BGCA 5J8FA 3G5LA 4XUCA 4HLXA 2GA9A 2FOKA 1QAMA 1EAMA 4HOBA 4P7JA 2CL5A 4V0RA 4IRHA 4UVBA 4RTNA 5HEKA 3LDFA 5FWAA 5DT2A 1SD7A 4FZVA 2JPBA 4GXOA 3EMBA 3M4XA 5HDNA 4PYOA 3SR4A 2DT5A 3LDUA 1O57A 4HW0A 2DTRA 5DUIA 2BV6A 4I09A 5IT9Z 3OZTA 5GM2A 3KP3A 4ER7A 3FYDA 2IPQX 3V8KA 2ORED 1BJAA 4QTUB 3EVFA 2ONZA 1XXLA 4PYKA 3JWHA 2FXAA 2H94A 2VBXA 3A7EA 3E97A 4GBED 5E2BA 3I64A 3VFZA 4BHBA 1NW5A 1E2XA 4MTLA 5K0BA 4M9XA 3DULA 3R3HA 3AJDA 1LVAA 3T8RA 4EKGA 3G7UA 2JRTA 2ONYA 2NRAC 2CO5A 4OX9Y 4QQNA 1TQPA 3F72A 1SMTA 4EJOA 4EJWA 5ILVA 1JG1A 3KQQA 3G8BA 5HZMA 1EH6A 5CCBA 1SD4A 3OOPA 4CO8A 1USSA 3E3VA 4WX9A 4YMHA 3WTVC 3FPEA 3C6KA 5HIKA 5T64A 3F8BA 4OIPF 1FY7A 2PBIA 2F2EA 4DQ0A 2DULA 3MZYA 1H9GA 3SSMA 3HCEA 3QV2A 1QPMA 1UFKA 2EA2A 1BI3A 1MHTA 4HF1A 3EPPA 5KQSA 3HCDA 2XYVA 5HS7A 2WA1A 4U7PB 4IWNA 1PUEE 3MB5A 1BBYA 2CSOA 2D45A 3F8CA 3RIRA 2YUIA 3TOSA 1YQAA 3BDDA 5D1NA 1EV7A 3HRTA 2YX7A 5JI6A 2FNAA 1EIZA 3PT9A 3GRRA 3G2QA 5CYVA 1ZYRF 3PQKA 2ZLBA 2W24A 5AIQA 5D6FA 3RODA 1LDJA 3HP7A 2ESHA 2PN6A 2WWYA 1R5HA 4P5OA 5DV5A 1J75A 1JG3A 3KLNA 5T6BA 3QU6A 2Z6UA 2YVLA 5K09A 5K0EA 5K5OA 2WC2A 1OMIA 4BXUA 2UXXA 5LQUA 2H09A 3LGAA 5K5RA 5DWQA 2ZNZA 3RJPA 2VDVE 5CUQA 5FTWA 4AVPA 5HLHA 5EZSA 4FR0A 3B3JA 2XAFA 1JSZA 4R79A 1R1TA 3HHHA 2HTEA 5CD1A 1XD7A 3MTEA 3X0DA 5JFRA 4KMUX 2ZIEA 2EWNA 2XAGA 1JHFA 3NEUA 3P9KA 1RI2A 2XBMA 4ZH4F 3BXOA 1EG2A 3BJ6A 5CVEA 2EJRA 1EJ6A 1AWCA 1TW3A 2FYTA 4ZZLA 4PWYA 3IHTA 4OBWA 4L9NA 2XIGA 2AXLA 1SVUA 4A0XA 3G2PA 2XVCA 1X1CA 1RI5A 4UXNA 2A68F 3S68A 1J2XA 3J80Z 4HTFA 2FE3A 3IWFA 2XV4S 2OY0A 3BGIA 1TQIA 2LDUA 4P7GA 2K4MA 5H20A 3KPUA 2VXZA 3GCZA 1YW7A 1ZQ9A 3EVGA 3ZPLA 3LECA 4U0VA 1RI4A 2LNBA 4UUVA 1F38A 5EEHA 1ZARA 2GAFA 2P5VA 2W84A 3F6VA 1YS7A 4GEKA 3TMAA 3FUWA 2AVDA 4R8RA 2W25A 2HTJA 1BC5A 1Z6RA 2QLZA 1L3LA 2XVAA 3L8DA 5DM0A 4BHPA 1S29A 2GQQA 2OPBA 3DXYA 3M6XA 3PX2A 4XRFA 1LEBA 1L3IA 4P7FA 1YW8A 3C7JA 2XKOA 3F8MA 2CW0F 2B0LA 4Y13A 4ER6A 1NHAA 1P6RA 4C04A 3UZUA 3TOBA 4BLVA 2PEXA 4IJAA 3T1BA 2AOTB 4R6WA 5DXAA 2O0YA 3DTNA 1J0RA 3EGIA 3P9CA 2AVNA 3HIFA 3FTDA 4GOMD 2Z99A 1KPHA 3GFJA 2A61A 5K0JA 1DCTA 1S3JA 2IDJA 2PX2A 1BI1A 4RGSA 2AS5F 2JG3A 1IRGA 3KFWX 4KIGA 3KR9A 1FJXA 1ULYA 3FX3A 1IUYA 3CUQB 1IF1A 2QRVB 1LQ1A 3EUHA 3GO4A 3UWPA 5FLXZ 5DEQA 4X60A 5K5QA 4ON0A 2V1XA 4OIQF 2YXDA 3C3YA 2OD5A 1M6EX 4PCLA 2J5PA 3B73A 3HA5A 2FBIA 2MD5A 3R6TA 2HOEA 1KU2A 4OA8A 3CO7C 2FNPA 1DP7P 3VSEA 3FUVA 2GH1A 4HX7A 1X1AA 5E1MA 4EJUA 1XDUA 2OZUA 1DL5A 1ZHFA 4PGHA 3EVAA 2KRFA 5CM2Z 1SFEA 5IT3A 3DP7A 1FC3A 1GVJA 3SFZA 3GRZA 3F4KA 2ZZKA 2FU4A 4C05A 1VP9A 1KPGA 2ZW9A 4ZYHA 3FZGA 1XGSA 4RB1A 5DTMA 2V79A 1KQ8A 4ENMA 5FQNA 3FWEA 3DH0A 2WTEA 1XCBA 4ER3A 1ON2A 1ZGAA 3AXSA 2NP6A 5ICCA 5EEGA 2R3SA 1ZLJA 4MTEA 1FYLA 1WZNA 1N7IA 1D8KA 3LA3A 1HKSA 1G38A 1W4MA 4KFCA 4A5NA 4PIMA 1KQ0A 2UYHA 2PJPA 1G3YA 2OAZA 3BJAA 2EFJA 3V97A 3LWFA 2ISZA 2HR1A 5ILUA 3E6CC 4M38A 4XLPF 3CDHA 1BKYA 3IEIA 1AQIA 1U5TB 3CJRA 2A3SA 5CVDA 2KIMA 4WXHA 5LQKA 5F2OA 8MHTA 3HVKA 2DQLA 3FMQA 3D2LA 4HSGA 3ERCA 2X0LA 2E1CA 5T67A 3K69A 3TDZC 2V9VA 2A6HF 3QP5A 3ME5A 2IVMA 2IH2A 5HLIA 3GF2A 2PI0A 1VLMA 2JT1A 3Q5FA 5DRYA 1H1DA 1IRFA 2YU3A 3DXXA 1G3WA 1L0OC 1S8NA 4EQZA 2HFHA 3CCFA 3T7SA 4PYNA 4C4AA 3WODF 1JQ3A 5G02A 2MA3A 1LDDA 3ULQB 2PXAA 5EMKA 3I9FA 3KQOA 3UFBA 1KQ9A 2M87A 2L54A 3M1EA 4EK9A 4BY9E 2UYOA 1O7FA 4UV9A 4ESBA 3FPHA 1FPQA 1FLIA 2XAHA 5JVTA 4G6DA 1V4RA 3SZPA 1B9MA 5L3EA 4FGZA 3DXZA 1G3TA 3J81K 2O61A 1AOYA 2OQRA 2QQ9A 3DMGA 2N47A 4G56A 2XVMA 2JJQA 2YXLA 3EVEA 4X41A 3FYCA 1P4WA 2HZTA 2Z5UA 2IRFG 2STWA 3JWJA 4B17A 1K78A 4RB2C 4EKIA 4RTRA 1Z7UA 2OBPA 5L3DA 3E7PA 2ZMEB 2JH8A 3HNRA 5FHRA 2BZGA 3SSNA 3EVZA 1Z05A 1CF7B 4AIJA 1DPRA 3T0YA 3BGVA 1NKVA 4L0YB 1G6NA 2HKOA 3LA7A 1I4WA 2P6TA 5H6RA 1N7JA 4GCVA 5HIJA 1F3LA 2O07A 5HILA 4ZTBA 2O3FA 3THRA 3JW4A 4O5VA 3TGNA 1XCVA 1KU7A 1HXDA 2OXTA 3PB3A 1T38A 3GZ5A 1SQGA 5JUWA 5DLYA 3Q9SA 1VE3A 4PGGA 3DKWA 1XGMA 2HKXA 3HOTA 5D4SA 1W7PA 2Z6QA 3EEYA 4ER5A 2QVOA 1QYRA 2ADUA 1R22A 2L02A 3DPLC 1GXQA 4IXAA 5HDGA 3GW2A 4DKJA 3HSRA 3IC7A 1RI3A 4DMGA 2XKPA 4KUMA 4LD5A 5BQTA 3J81Z 3QAHA 3THSA 1PDNC 4WVLA 1WXWA 3I4PA 1Z3CA 5KYGA 1OR7A 2GXGA 3GXOA 1UFMA 1I27A 2GWRA 2WV0A 4R1HA 4HG2A 4UVAA 4LWPA 1D2CA 3HCBA 2DO7A 5C1IA 3ELYA 3KP7A 1G55A 1XN7A 3DPTA 5EIFA 3HUGA 3ORHA 5BP7A 4CKBA 1P4XA 2NP7A 1RIOH 4QVKA 2YX1A 5ICEA 2P8JA 3LL7A 4P7KA 4A2UA 2B3TA 4PZJA 5HVQC 5E1XA 3FTCA 3OFJA 3IL2A 1V39A 2E5WA 4E2ZA 5U4XA 2VT2A 2G8NA 2OA4A 4M9SA 1H0MA 3CBGA 4KT5C 3P8ZA 2KKOA 2ZXJA 2ISYA 2O57A 4E31A 4KIFA 5BOXA 1SFUA 2DPUA 3GZ6A 2LKPA 4M71A 4RSRA 4WXCA 5DD4A 2FSWA 3KZYA 4L7VA 2X4HA 4YMGA 1QGPA 3GYHX 1J59A 1YFJA 3KQTA 1U8RA 4X1OA 2VC1A 5DCMB 1RUOA 1JQEA 4LJZF 1ONVA 1YG2A 1KPIA 2H11A 4PYJA 4IV0A 2GA2A 1SUIA 2HV9A 1D2GA 1WI9A 2BE5F 1I1GA 4NECA 3BROA 5P8WA 1FNNA 2HWKA 5F1RA 4HZFA 1W5SA 4ZYGA 2FK7A 3G89A 2BBYA 5F6FA 3P97A 2QQBA 1P39A 3CJQA 5FA8A 1AF7A 5GP1A 1KP9A 2BR4A 2QQAA 3O2PE 1R5GA 5D5WB 5LHGA 5FFZA 2DK8A 4G7OF 3MCTA 2UYCA 4M7RA 4V0QA 4MHTA 2MH2A 2XUBA 3WGIA 3GWZA 2XYRA 1V3FA 2AOUA 2ELHA 2MBFA 3O31A 3OZRA 3ELDA 2PSSA 3I59A 2V6CA 5CVIA 5CVVA 5A2QZ 2V74B 3EVCA 3BUSA 2AOTA 1FX7A 1IAWA 3DEUA 3WSTA 3ZN0A 4RAYA 4U0WA 1FBSA 3GFMA 1P92A 3QPHA 4PDKA 4OU0A 4ENKA 3HTSB 1LNWA 2PLWA 3CJTA 2FRHA 3ML6A 1XJ5A 1SQFA 1QAQA 3LQQA 1WS6A 1M0EA 2COMA 5EMJA 3K1PA 2ERCA 1X1BA 4M9ZA 2VBZA 5LEKA 2YSRA 3UA4A 3CUQA 1R8XA 7MHTA 3HSFA 5FQOA 3TRKA 1SFXA 2ZKZA 1TBXA 3P2KA 4RB0A 3MGGA 5K8VA 2NYXA 4HAMA 1NBHA 3RPUA 3FM5A 4JK1X 2XYQA 1IXCA 3HVJA 3NDIA 2JZYA 5K03A 5HIMA
chains in the Genus database with same CATH superfamily
4DA6A 3RABA 3CH4B 4MV3A 1PGQA 2ZYSA 4UEWA 3PUWA 5JALA 2M6KA 5J40A 1X2NA 1NP7A 2OENG 1C4KA 3DR3A 2HRBA 4QT0A 5TF4A 4DJJA 4EJVA 1ZU5A 1M1XB 4NI5A 4G6ZA 1C30B 1O0BA 1Z26A 2B1IA 4B9EA 3VGPA 5CLSA 2EA4A 3NP9A 3Q85A 1OVGA 5DGIA 1RRFA 1AQYA 5CJJA 2G06A 4Z49A 1YJBA 4QUGA 1N1EA 3LM8A 1FNMA 3OU6A 7ADHA 3U7QA 4I9FA 3FYHA 4OUDA 4RYLA 4YAEA 2WINI 3KEQA 2A5JA 3GFSA 4CLDA 1U8XX 2AMLA 3KSAC 2ZKIA 2WC1A 4YRRA 3OTQA 2WNHA 4V1CB 1FFDA 3JYPA 3KBBA 4P32A 1L1EA 4QUIA 4YREA 1FX1A 1RJGA 3FLMA 1BXZA 4QUDA 4ESEA 4BEHA 4YJGB 1L1QA 3DFZA 3FETA 3ND7A 3OPYI 1QO9A 1YZKA 1JFTA 1ZVVA 1OREA 5BW5A 4Q19A 1CUAA 1DDOA 2AOWA 4IGKA 1CR6A 2JAXA 4F2DA 1O96B 4MAAA 2M30A 5FO5A 5JLJA 1CQJA 2BF7A 3OTIA 3P2IA 5G2OA 1QHHB 4CXMA 3C1OA 4HRIA 5CNJA 1JKFA 3KS9A 2Q1YA 3RCOA 3Q7SA 3MSXA 3V1UA 3MLAA 2HF9A 4GX0A 5D6EA 1QA6A 5JQGA 1QU2A 3SFTA 3I0NA 5TIIA 2DA1A 4EJ6A 1IN8A 3BQZA 1DU6A 1O58A 5BNGA 1AX9A 5HF6A 4F7WA 4UBIA 4U0KA 3IRUA 5GZ3A 2VXBA 1MW8X 5BXYA 4ZJYA 4LG0A 1K68A 2Z58A 5J1UA 3IKTA 1QP7A 2C4UA 3HKBA 3MWJA 5HA5A 3VPDA 3QPLA 3UK7A 1KYXA 4FFNA 4Y2GA 2JFPA 3UWDA 1E0JA 2RGNC 3AF4A 2YMPA 3H7AA 4YCDA 4DJFC 5CLGA 4J7XA 3HH8A 2VSOA 1VJTA 3BE5A 4D7NA 1ZG3A 4YPFA 1GTJ1 3QOFA 4I2NA 4ODIA 1VRVA 4J07A 3RTRA 2W8ZA 4OLFA 3GUVA 2ODBA 2IS4A 1D0ZA 1B23P 4YJ2A 3D8HA 3TL2A 1JMVA 4FWBA 2QD2A 2Y0SN 4KR0A 1T0JB 2OZPA 1RZRD 2COBA 1J25A 3G8DA 1H5UA 4N9HA 1LNQA 4ESHA 1YTLA 1Z6AA 4Y9SA 1SD5A 3UV7A 4ARBA 2PUVA 4XIGS 2WB2A 3M4OJ 3K1TA 4E4HA 3NANA 4DJAA 3SR0A 5T41A 1UHWA 4HFJA 3IUEA 5L3VA 2IQ5A 3FRJA 2REOA 5HKKD 4IAOA 2P41A 2VNJA 3CZ9A 3JVDA 2JLZA 5KJFA 1JHYA 3W6UA 2VHQA 3IQEA 1WTAA 3O0TA 3PC4A 3EWAA 2YW2A 3CRZA 3T5MA 3N5CA 5ES3A 3DR5A 2PJDA 2VDOB 4RFLA 2C4WA 4CGZA 3R61A 1DQZA 2LKXA 3S55A 1VMKA 1SA0A 4F21A 3LQ4A 4HDQB 3BZCA 5IULC 1NUPA 4JN6B 2MSLA 3JV7A 3OPNA 4RGUA 2CUZA 2DOFA 3GLGB 4PRZA 2O8DA 1SCIA 3SD7A 1K7SN 1OT3A 1ZHHA 3ZVNA 1W4ZA 2VE9A 1BR4A 1UXIA 3QEBZ 2AD1A 3M9XA 2AXTC 3GU3A 3P7MA 3U3MA 1PEAA 3SC6A 3ELWA 3RJZA 3PLNA 1BKSB 4QU8A 1GGJA 1CZHA 4L8YA 5ESWA 1L7RA 5ALYA 1WSDA 1SRQA 2XW6A 2R8RA 4I50B 2VJLA 4XGRA 2NYVA 1NG7A 1CS4C 3WL8A 1XHFA 2M9MA 5EXDA 3QJ5A 3BZKA 3RC9A 2ZSEA 1E5QA 1B4AA 2CKDA 1WZEA 2QY9A 1N5MA 1TDJA 1QYDA 2X4DA 2X42A 3KOMA 1LQTA 3QFFA 1JDBC 1ZN8A 2F9MA 4QWWA 3RKYA 1O6CA 5BYJA 1Y33E 2BV3A 1JE0A 4B6EA 1JFLA 4FFBA 2I4TA 1TWAJ 3HCOA 5LQSA 3M4JA 3CP2A 3THWA 4QDZA 4XRSG 3TZEA 3HDDA 1QGED 2NADA 5LEJA 1T4MA 1YXMA 4UPEA 1T6YA 4AWXB 1HE4A 1KRWA 3NATA 3I9KA 2C2MA 4PAWA 4F1WA 4JMLA 2ZAMA 4CA0A 3Q9UA 4WJKB 4GVLA 4ACAA 2ESNA 1PZXA 4B1RA 4XVQA 4FI3F 1H0HA 1STOA 4IOLA 2VZ9A 3GLSA 1VXOA 3C2QA 1VL2A 1J49A 2GOYA 4YCNA 1NIPA 2XGXA 3GTKJ 3ZU4A 3ZWMA 2CBXA 3ZVLA 3WLAA 1YLFA 1B0AA 4HAVA 3K9CA 4F85A 3IH2A 1UUFA 5BORA 5CK4A 1KJ8A 4P3YA 3K6SA 3VSCA 1YX5A 3B38A 5FWYB 4FKMA 3WAKA 1ICIA 2BE7A 5E4JA 4XKBA 4EPWA 3VFDA 2ZBKA 1ZIPA 2AFIE 5FKOA 4JXKA 4IVNA 1J90A 5F78A 4XLNF 1EQAA 5KX5F 3R7SA 3M4NA 1A5SB 2D1QA 4GGOA 1IEWA 4NKRA 3ZQLA 3IEPA 2GD6A 3ZMUA 4YWHA 4ZI7B 4JJEA 4W1QA 1BCSA 5I7FA 5K7SA 3LP6A 5CVRA 4KFSA 4R1NA 5JAHA 2JEYA 4XD7A 3O9ZA 1G18A 2Y0DA 4RS3A 5DBHX 3F6CA 4WFQA 4TMFA 4KEAA 1E58A 2LD4A 1HC8A 3TDUC 1WM1A 1ISSA 2GD2A 2Z8ZA 1JKJB 1EK6A 3PRKE 1ZHOA 3SSOA 1VRWA 4CICA 3BGSA 3L0CA 3O4IA 3O2NA 3HI4A 2PRKA 2BY3A 3GDHA 5JH7B 4DUGA 2NYRA 5AKGA 1I10A 4DG5A 2KLHA 2ZMEA 4TT3A 1LLQA 3U5TA 2YJZA 4G25A 3R7AA 3H92A 3QNWA 4R2KA 2ETXA 4I1UA 1R0CA 2QQFA 2R4QA 3RFFA 5EP3A 4XKJA 2VC2B 2HNBA 4AO8A 3R0IA 4DYCA 4NXMB 4NCBA 2E3JA 5AK6A 4ETSA 2ZS8A 1UM9B 4OHUA 2HNKA 4XGQA 3F23A 4LWZA 1SHLA 3L6DA 4ZVLA 1KYWA 1DGQA 3LS2A 1ORVA 3IMEA 4YMLA 4ZYAA 2NVTJ 3GT4A 1TTTA 3DMTC 2UVDA 5JJ5A 3F6PA 1KOGA 3QBEA 1P1BA 4WRRA 3RT7A 5JBNA 3GARA 2VP3A 4J7CA 5JI3E 5DHQA 1T15A 4WK0B 1R0YA 4N9IA 1IM8A 3I0TA 3VV2A 2WF5A 3LSMA 4ZYTA 1N3LA 3IHKA 5IJAA 2OV2A 5F9HA 3LK7A 3Q10A 3LHFA 1XN1A 2R1UA 2IRWA 2XVXA 1G3SA 5IJ0A 4TX1A 4IV5A 1ETUA 3ASOH 5KDDA 2Q46A 2VBYA 4O3MA 4PLZA 5GPBA 4TVOA 5A5DA 4GVPA 3Q5DA 1OB2A 1X8JA 4HH0A 5IH7A 4YUXA 1T8YA 1WR8A 2NV6A 5AVYA 3BOSA 4JJGA 3PRJA 3HGMA 3L0IB 3AONB 2ZDGA 3L82B 3HOXJ 2DPLA 1NNSA 4UNSA 4OQ4A 3O90A 3VYVA 5FPYA 1H9TA 3SBOA 3TQSA 1J0DA 4EHHA 2JLUA 3LFTA 4A5MA 4EG8A 1SCUA 1VA4A 3BJRA 3RH0A 1U9IC 1SZCA 4UHFA 4NYJQ 4Q37A 1GA1A 3RZDJ 4LRUA 3AHCA 4NYMQ 4WACA 2G5CA 4CT0A 3OZSA 3NBZC 2W2XA 1P8AA 4I4CA 4DCSA 4LG3A 3LVQE 3SJCA 1USKA 3D7NA 1UG2A 5DNWA 3GO5A 2GXAA 3T3NA 1GCAA 2QD5A 4MA4A 3MKWB 2ZSIA 4BN5A 1EH5A 4AJPA 5EY5B 3WA7A 2PMDA 3GBPA 2XGEA 2ORYA 3KJGA 4L6AA 1ZUWA 3NC1C 3U2QA 3KP6A 2H5LA 3WSWA 1XBTA 1DC8A 2P91A 3OWOA 5D3QA 3UW3A 4JQCA 3ZG6A 4N03A 2XPVA 1S2LA 1GXSA 2ID8A 1P9QC 2FK8A 4FLEA 2OC9A 3IELA 2FFBA 5JR3A 1KVRA 1U0EA 1ZIXA 4OQDA 2OM6A 4O08A 4CR6A 2QRZA 2WM2A 1WJFA 2IYXA 1OW3B 1H85A 5DN6A 3ENZA 1R6AA 3F67A 4RENA 3IDSA 4WL0A 1MMAA 3LLCA 3U0BA 1A69A 3V7SA 1ZGCA 2DPDA 5BW4A 1Y6FA 3HWSA 3MTDA 3FOZA 3WLNA 2F4MB 4A0ZA 4Q3AA 4M6WB 3FYUB 2YFQA 3WIDA 1YMQA 5C1BA 4LBZA 3E5XA 3QQPA 4L85A 5DH9A 3EZXA 1Q77A 3I37X 3HPQA 4D4JA 4HAWA 3DZDA 5DHPA 4BB5A 4II7A 4N47A 1WHTA 3OMYA 1LDYA 1DEAA 4S05A 1DKUA 1S4MA 4P58A 4MKHA 2PRYA 3MWDA 2QUAA 1B1BA 4JLDA 1D8JA 2RH9B 4J1QA 3I52A 4NV3A 2P79A 1GUUA 4BN4A 3RKSA 4AF7A 2AEFA 2HS5A 3GFRA 2AOVA 5JO9A 4CIBA 3IRVA 4FQ8A 1QG2A 2ACJA 4P9UA 3IP1A 3VR4H 2ON6A 5IT9K 2VYCA 3CF0A 1YUBA 2PWPA 4BP9A 4RV9A 2F4OB 5FRNA 2FZLA 2JFYA 4CFZA 3RVNA 1B6RA 1UAYA 2RV8A 1T0FA 1VLJA 3LOPA 4A8HA 4C29A 4CV2A 5LBUA 4UVGA 1RR8C 5HM6A 4EY7A 1Z7BA 1J6UA 4BXOA 2WSBA 3DXJF 4B6JA 3KVRA 2GASA 1QH1A 4BDTA 3G5LA 3PPVA 2QT1A 3JQ8B 4UBMA 2YZ2A 2VHCA 5IEBA 4IGEA 4F8YA 1OCEA 2KBFA 2PD4A 1SULA 3CLQA 1C3OA 4GG1A 5C7OO 4GBED 1MNDA 1I2AA 5CFRA 4HPJB 3G0HA 4RLFA 3CN9A 2WNSA 1E59A 2ATXA 2R6FA 1LPQA 4JY7A 5BSTA 4BRZA 4QQNA 4EJWA 3H9BA 4UM7A 1FTTA 1E7YA 5EIAA 2IEAA 2V7TA 1GR0A 2HY7A 3AR9A 3MT8A 3ASYA 3K15A 1YC5A 4P3PA 4X71A 5K45A 2QVBA 2GGSA 2ZCVA 4IGFA 1UANA 4CTNA 4E0BA 2AX3A 3O8NA 3MD0A 2Q5QA 4I76A 3AJRA 1JEYA 1PUEE 4RK5A 1JRLA 2W6ZA 3F8CA 4B0PA 2YZ7A 4WSOA 2JLCA 2EV9A 3QU9A 4S3MA 2BCJQ 3PT9A 4MH0R 3ABZA 1I6LA 1M2KA 2P9QA 4BDSA 4IHJF 3K53A 3KOYA 4W1RA 2P9BA 4V3BA 1TZLA 3RODA 3HP7A 1UBEA 1G7RA 4P5OA 5DV5A 1HDRA 4ZEOA 1GAQA 1OPXA 1JIKA 3UM9A 2Z2ZA 2CQXA 3OZAA 5HLHA 2EEPA 1WW8A 4GR9A 2FDXA 4UDOA 1NOJA 1JIXA 3MT7A 4ARUA 2OVBA 3CTPA 4DR6B 2IQIA 3ZQ4A 4L8WB 1RBZA 4WZBA 4DW6A 4Q4HA 4G1FA 1TW3A 5GJWC 1RPAA 3IHTA 3INTA 2VJCA 5C18A 2H63A 4G23A 4E3ZA 2J4CA 2IGKA 1J23A 1WAMA 1VJ1A 3RS7A 4KX5A 3J80Z 3RQ4A 5BQOA 1C0IA 5BSHA 3HDGA 1TQIA 1PEKE 4G4GA 2VPRA 3PITA 4JOMA 2DHCA 1Z2CA 1EHCA 1ZARA 5K7FA 2P5VA 1BOFA 1LLCA 3EAQA 4B46A 4GEKA 4W8OA 4R8RA 1FL9A 2WMNB 2FZGA 1L3LA 4IVRA 3TR5A 1A8QA 3UAYA 3VNQA 1I0ZA 5AKEA 4XRFA 3EYWA 2V7BA 5MN6A 4OIMA 2PUBA 1M6HA 2PD3A 1OFHA 1NHAA 1G20B 1XCGB 4ZRMA 1UMBA 3HCPA 3BHNA 2PGAA 2NPFA 3AYXB 1L4LA 3DTNA 4KQJA 5LN1A 3ZKWB 1YAJA 5HMMA 1DQRA 4MVJH 4MNTA 4DUGD 1U04A 2MGQA 4EAAA 4JSRA 1U3TA 4LIVA 1IVNA 1IUYA 3EW9A 1WO8A 3D59A 3IIJA 1HL3A 2QA5A 4G1CA 4X60A 5K5QA 1EG7A 1Z7YA 4M86A 4OYRA 2BGWA 1U2DC 4XKVA 3N2GB 2P27A 2FNPA 4ZAWA 5KNBH 1ZVQA 4QJ5A 5CM2Z 3KE8A 1FMJA 3D8TA 1X7WA 3FNHA 4YS6A 1AB6A 1IATA 1XQYA 1COZA 5D5PA 2HU5A 3EBPA 4S0ZA 5LYJB 3O1IC 1TEHA 3FVTA 2E48A 1EK2A 4MVJG 1O4VA 1QU3A 1Q1NA 2RQQA 1DRJA 1N7IA 3UMRA 5LZ9A 5FTMA 1U98A 2OM2A 2OAZA 4LZAA 2BEVB 2BD0A 3LWFA 4D79A 2Z2KA 3W5UA 5DB4A 4D45A 4BTVA 1RYHA 3QUBA 3TIIA 1KMCA 2C78A 5IUKC 1AZLA 4AX4A 2IVMA 1E2DA 1X7DA 4G1UC 1CE8A 1QP8A 2UV8A 1J7JA 4NBRA 4JI6B 1I4OA 2OORA 1DELA 2GPSA 1X13A 2IOFA 1W4LA 2JGAA 5JVTA 3DXZA 1G3TA 1F2TB 1VPLA 4FEAA 2YXLA 5LKRA 1FMFA 3OUUA 5I45A 5BMVF 4B17A 1K78A 1XCOA 1JUDA 3KFXA 4C4ZA 2ACEA 2JH8A 2Q1UA 3RJ5A 1HCRA 2DBZA 4RZIA 3HDTA 3QENA 3K4PA 4JOBA 1N7JA 3PFNA 1QONA 3KG2A 2R7UA 2VF5X 4DDWA 3ZWQA 3ZWDA 4UCXA 1LNSA 3CCJI 2VYVD 3HOTA 3B53X 2Q5IA 2Z6QA 2QL9A 2HQSA 4FW8A 2ADUA 2QR2A 2M7AA 1GXQA 4DKJA 5IDWA 4C2UA 3DAPA 1BTOA 1R16A 3WJ1A 2M1XA 2HC9A 4DLSA 4KIUA 5JT1A 4UASA 1XU4A 2GXGA 3T3EA 4HG2A 3SDZA 2FE4A 4LZJA 3IP6A 5C1IA 2A1UA 3AV3A 4JB2A 1OFUA 2NP7A 1E4EA 3W5JA 1ULZA 2P8JA 5DXFA 4A2UA 5HVQC 1W88A 4UHBA 2I2XB 3H35A 3OFJA 4FGLA 5U4XA 4X1IA 4OQFA 4WNAB 3CBGA 4RD1A 3FPKA 3DGEC 1SIBE 5AOBA 2LKPA 3D8UA 4IXNA 3GLIE 5AR1A 3PENA 4DYRA 4LJZF 2E0IA 2GCGA 3DKXA 1SUIA 3SVTA 1D2GA 2IP4A 3O4GA 5HLTA 4OGGA 4PJ0C 1HT1E 1N5DA 2BBYA 2W6JA 1Y4AE 1RWNA 3HN2A 3GBGA 5E4FA 4WKBA 2V6JA 5DN6D 4MITA 3K2QA 1KFJB 3B20A 1K08A 2Q45A 3Q15C 3KXIA 2ELHA 3Q8MA 2QI9C 2PSSA 4U1RA 3SP1A 2Z8XA 3TPCA 3BUSA 3TYXA 1IY2A 4YECA 4CZCA 4WLEA 1VYUA 4OHMA 4FR5A 4CYCA 1NE7A 4Y2VA 1RWQA 4JENA 3QJGA 2UUOA 3UA4A 3P0IA 5CLHA 1QO7A 2VTBA 1MBGA 3HSFA 3I6ZA 2J3QA 1VI5A 2LY1A 4C4SA 1QCCA 2XYQA 5DP1A 1IXCA 4QFBA 1T36A 3C45A 3GB9A 3K73O 2PSJA 4BNLA 2PAFA 3KSZO 1M2JA 4G5FA 1CHDA 3KQHA 1CUZA 4ALKA 2O3RA 2R9VA 1S3IA 4C0HA 4C21A 2O4CA 5ENDA 4BFLA 5DCLA 4M36A 4NBUA 1CQPA 1KMNA 2WTAA 1YDEA 4PRYA 4B81A 1FDSA 1XZGA 2DFTA 3JD4A 1XE3A 1NN1A 3DE6X 5K6RA 1YHNA 1X1QA 4XBFA 4QLBA 5EQJB 3VKVA 4L9TA 4IQ0A 1TCAA 3E7DA 2IPLA 3EY9A 1R74A 1QMPA 2TSYB 4ZCMA 1RHMA 2P69A 4P93A 3EMVA 3VHQA 2K4JA 4LUCA 3A02A 3B7PA 2AR0A 4GEGA 3VKGA 3RT1A 2W2PA 3N75A 3KUDA 4OB6A 5CX1A 2NYAA 2GHTA 4ZJUA 1PG5A 5KHOC 5FD6A 1E60A 3C43A 2NSYA 1A31A 5LU9A 4EA7A 2V3WA 2C7RA 3EHDA 4FEEA 1MBJA 2MSNA 4DR5B 1SKMA 1L5LA 2QSUA 2R97A 3JU3A 2G07A 4RPJA 4N3AA 3N2NA 2BFWA 1CXZA 2O2ZA 4YAGA 1VQKI 1X7HA 5DM2A 3ZHBA 2BR3A 4DA9A 5F23A 3LJKA 1NV8A 5HMLA 4UQPA 5E1DA 1M2FA 4PANA 2CFTA 4YIRX 1DX6A 2O20A 5IXSA 3Q2IA 5KNBA 5JY6A 1QCDA 3IUMA 1J8QA 4YRKA 3FOCA 1Z5ZA 2V6MA 4KN9S 4CTJA 4E5KA 4QU9A 4MR8B 1ND5A 3EE6A 2E1PA 3I39X 2BHTA 3FCCA 4BLQA 2XA1A 3FXLA 4B6GA 4Z7NB 4CKCA 2QE7A 4X9XA 1ONPA 4NB5A 3GQBA 3BPSA 4QQFA 4M54A 5BNIA 2F5VA 1KI4A 3T4PA 1UM8A 1RPZA 2E55A 1UPCA 5ITZA 5M5BA 1AU7A 2IXGA 3RVDA 1MJHA 2AR9A 1PUFB 5D8DA 1G2QA 1EX9A 4FZRA 4JVNA 1K5GA 1C4OA 2CLFB 4RFVA 1Y3IA 1YR9A 4NQRA 2EU8A 3KWFA 2QYSA 3FNEA 1DBRA 4QPDA 1BC7C 5JO0A 3A14A 4N0BA 2DPMA 1R4NB 2G83A 1AKMA 2ZIXB 3EVNA 2JIZA 1GV1A 1L1RA 4UV8A 1XD2A 1TA4A 3JALA 4IDQA 4RKYA 2XUQA 2JFOA 3ZWCA 1HLFA 1Q6YA 1SBIA 1T34A 1NF8A 1RWKA 4MAMA 1XLVA 3KETA 3MPUA 3W5AA 3FCXA 3NBFA 4HQOA 2WUGA 2OQVA 4QDUA 2HDWA 4JMPA 1GYQA 3U3JA 3EZ6A 4RWEA 1PE0A 1FP2A 5BR1A 2BGTA 2G1UA 1RP7A 4MV9A 4ZI5A 1PJLA 1Y6GA 2HPVA 4IXDA 2WQ7A 2RHHA 4CF4A 1CVRA 1VLZA 2G9VA 2QM3A 5C81A 3V2GA 2R7DA 2BMWA 3EZFA 3O8CA 1GPKA 4IHTA 2ASEA 2B4KA 1NOIA 3HN7A 1OB5A 3HRSA 1S8OA 3IUQA 3E8MA 2HJRA 3K31A 3P0FA 2DH5A 1AG9A 3PDUA 5K3SA 1R1VA 4OKIA 1BW5A 1VQ4I 4NRDA 4IV8A 5JNVA 1PU2A 1EF4A 3A3YA 1S01A 1YE5A 5JAOA 3RKXA 2VN2A 1YTUA 4RSHA 1KHHA 2B1QA 1C7JA 2WJGA 4TLAA 3ZYZA 1ZRMA 2PFBA 2VK8A 1KBQA 5LQJA 3UJ8A 1ZD3A 1N33B 4O4IF 2NVWA 3OEWA 5B58T 2MCFA 4UQLA 2OUIA 3OETA 1UBRS 2HPAA 5DFAA 4NEGA 3ZWWA 3NH6A 5G0TA 2FVYA 4DYHA 2MW8A 2VQLA 4PGAA 3LGSA 2AO9A 3GLVA 4IS3A 4WCFA 4EEFG 4W8HA 3PLRA 3CUOA 1AUPA 4HDMB 4D8YA 3Q2KA 4DRYA 3KLBA 3LAJA 3DFKA 5KNLA 4HZGA 4ARAA 5EZYF 3T0IA 4HAUA 2GSDA 3RUHA 5AVTA 1L9KA 5B2FA 1RTTA 4Q9DA 3OY7A 4ND8A 4H0FA 4ZREA 2V7GA 4IWYA 3QLVC 2BZ0A 2JK0A 2P8TA 3H86A 4ZOQI 4F4UA 2QRKA 3RKUA 2J6IA 4IDAA 4FLFA 5A2GA 2CNBA 4GIBA 5BOSB 1LDNA 4UB6C 5B53A 4JBAA 3U44A 4PO3X 1FSHA 2F5FA 1FW6A 3UMBA 3FJ1A 1FRVA 3UEOA 4BKUA 3ZRGA 3GCGA 1UK8A 5HIIA 4AMVA 3A1YA 5AVZA 2CYCA 3OHMA 4IRIA 5IYDJ 4LZOA 2AC2A 3UA3A 3VR4D 4NC7A 1LVGA 3I9V2 1ZVKA 1JLRA 4EI9A 3H11A 5LZ8A 2EJUA 1GAEO 3T7JA 1HDOA 2P2ZA 5LP6C 3OOUA 2XMPA 4YUYA 1R37A 5ALFA 4GI3A 1N2CB 1CETA 1K61A 2IHUA 3CEAA 1QIIA 3PSFA 1NHGA 1U7ZA 2OZLA 1H42A 4FETA 3FXQA 1FQOA 1QH9A 5SY9A 3I8SA 3MMZA 1NUQA 1OLTA 2O14A 1W9HA 2ZYRA 3NRJA 4FX2A 2WIAA 3KU4A 3O2JA 3I6BA 2BP7B 3WRYC 3K3PA 2R4TA 4MWEA 1IXYA 1HYHA 1NVEA 2ABWA 3A4VA 3JD2A 3N0VA 3L4KA 3P45A 3QVKA 1RRJA 2TYSB 3VPHA 1VE1A 2WZCA 4JI7B 5HWSA 1JFFA 4MUMA 2JF0A 4DPKA 1F5NA 3R8CA 3BR1A 1HOTA 2H8KA 2VHXA 7REQA 1QYXA 3OWTA 2B63J 1Y3BE 1I6HJ 4U7DA 5A6SA 5AW3A 4RBNA 3VVBA 5TR9A 4UUTA 5FUMA 1TCUA 4AT1A 4XDHA 4NG4A 1HWYA 3PHLA 1QHIA 2YV2A 3D8BA 4KXVA 3SGLA 1Z73A 3VWBA 1IFXA 4RANA 4RIEA 3ENNA 4GKBA 2C0CA 1QR6A 3J80K 3QBDA 3GPDG 3COAC 3IJPA 3RBXA 1DZ3A 1AKHB 2H65A 3D4IA 5KSOA 3IIEA 5KOJA 2V8OA 5ARBA 1Y0NA 1XCJA 1DBVO 2DY1A 2BUBA 3E5HA 5CITA 1C4XA 4ZVKA 4PHFA 1JXAA 2IW1A 4C7JA 5JTTA 1I5ZA 5SZJA 1ZRHA 1RAEA 3DLBA 1AZWA 1GLGA 4M0MA 5C31A 1QVWA 2PXCA 4TTIA 3R5JA 5BN5B 4FUTA 1MH4A 2M2EA 4K6MA 1RBYA 5GJVC 5THXA 2BYVE 5GAGJ 3UTCA 4WKPA 2SECE 1CV2A 3MZ8A 2HVRA 4XX0B 3DL2A 4AURA 2UVPB 5TQJA 4EECA 4I9GA 3I5UA 1BS9A 3VPAA 1ZD2P 4YFXF 4HZUB 4ZAZA 3O5AA 2OO5A 2IFTA 1BG6A 4QO7A 1PLKA 3HUEA 2QTVA 3ILSA 5DYMA 4TXLA 2XUAA 1GWNA 2IS2A 4WBNF 2WIBA 3GHYA 2JJ8A 3G6KA 1YFHA 4YAUA 4ZOLB 4UHKA 2CFXA 4OK5A 4KXNA 1MF7A 4Y1FA 3RFTA 1RC1A 2AWNA 3EQ6A 4LHYA 2AMJA 3QHQA 2D62A 4E51A 4ZDLA 1FTQA 4Y6QA 3B1FA 2B3DA 3ESQA 3IODA 3T1HB 5I4KA 5JARA 1LB2A 2WABA 3H9UA 4Z1MA 1DAFA 1MV5A 1IJWC 5KNBD 4RTJA 1SXJE 4KOAA 5BQPA 3TNLA 4RORA 3AB3A 4B8XA 1L6RA 2Z43A 1E61A 3C0KA 1KSHA 2FBHA 1NQTA 4LXYA 3ABOB 4B4VA 1TJPB 3LQFA 3FHJA 5GADJ 1AHIA 4I5GA 2EJCA 4PF1A 2JATA 1H2BA 4CE6A 4BU2A 5FPTA 1NMXA 1X7XA 2CC2A 2AN9A 3S27A 4ICIA 5EPEA 2G63A 2TDXA 5A9SB 1RCUA 2IBSA 4CI9A 4I81A 4I8DA 1EB8A 3CRQA 4MIEA 2F7SA 1KIAA 5F0CA 4FCWA 1WD7A 1W0CA 5EMLA 3ECHA 3MELA 2P4WA 2JIZD 2X8JB 1NKTA 3VH2A 2FQXA 1SVKA 2XQGA 2W9XA 4RHXA 3EF0A 2GRAA 4L8VA 1FMWA 2ZSUA 4IJQA 2EX4A 3Q87B 1TVKA 5B66C 4KUEA 1SU7A 2K27A 3PO3J 2AR7A 1INLA 1O9GA 2FDCA 1I7QB 1JMKC 5HR5A 2MHCA 4BWYA 4TWRA 3RVMA 1GNRA 1SIUA 4G6QA 1U5TC 4GZ6A 1VSUA 2GUWA 5J2UF 3LKDA 2X4LA 3OYGA 1NF3A 5EHNA 4E15A 2VIIA 3URKA 4YV7A 3WYFA 4WI1A 1PR2A 3K1AB 2GJSA 3AAFA 1ZINA 1F2VA 4OAZA 2C1ZA 3CKMA 3NYQA 4MMYB 4KAXA 2QU8A 2C9MA 4TSFA 1FOWA 3RROA 1EZZA 4W7HA 1E2BA 1U2GC 3N70A 4F5ZA 4IDNA 1GM5A 3L5OA 4OQNA 2RQPA 3ZBTA 3VVMA 2C31A 2DGDA 3U13A 1MAWA 2YRFA 2AUNA 4EO9A 2ZTHA 4CF6A 1MABA 3OOYA 3I34X 4YCBA 5LD2C 4HQLA 4KQFA 1VHLA 2VK1A 1CD5A 1Z75A 2XAQA 2N1MA 1CUYA 3I2YX 5K0LA 1RPWA 3HA2A 4I4TA 1FYDA 4D57A 5IBRA 5K3DA 2B7LA 2GF2A 4I0AA 5I7WA 4CKWB 1CIJA 2H00A 4JYCA 2UVQA 2BH9A 1OI2A 2PFGA 3KT6A 4RSGA 3Q9VA 3WTWC 3O03A 4JELA 4HEA2 2OGZA 4EHIA 3EWSA 1AGRA 1MC4A 2DBYA 4WY8A 3KD2A 2G1PA 4B4KA 3F1LA 3KZMA 3GT0A 4O4LF 2GIVA 2WB1A 2ZJ6A 1EUCB 3OJFA 4TL8A 2FSPA 2EHDA 3DD5A 2JANA 3GJ7A 3DP9A 1EJ0A 2HZDA 3WQBA 3ABUA 1MDMB 5IKXA 1VBMA 2RAPA 1HDIA 5JDIC 2COKA 4N6OA 2W58A 1XPJA 4R8KA 4D8TA 3INYA 3UB2A 3M4XA 4D8XA 4WLOA 4N3GA 3HV2A 5IT9Z 3FOAA 3KP3A 2P5TB 1G8KA 4B1FA 1TEVA 2EGHA 2H9YA 1NPDA 4PYKA 1R50A 3SBEA 3HFGA 4BHBA 2GN4A 1O08A 4C6TB 1CLEA 2XWQA 4CTMA 3T8RA 4FMDB 2GVZC 5IC4A 4C30A 4ZEXA 1YJXA 4B31A 4KXXA 4G5QA 1ETKA 1SD4A 2JRLA 1LKXA 2KDZA 3UUFA 3FPEA 1W4RA 1DINA 2P9EA 3N2KB 4MRMA 3FCUB 2JJ2A 3L77A 3PNKA 5AVJA 3P4UA 1L7VC 1WDLA 5BT9A 4IMIB 1ZGBA 1HLGA 3T5PA 1QPGA 4UTPA 2ZXWH 5HS7A 3OJEA 3UXMA 5F3DA 4MGEA 4DLBA 1UP6A 3KCQA 4MLPA 4TWIA 4HDNA 4HX9A 1L8XA 4JU8A 1MG0A 4Y9DA 1F7UA 4B7ZA 3NQ41 5JS6A 3PTZA 4KB5A 4YEDA 3AV0B 1G3RA 2R96A 1ZNWA 1ITZA 3IQHX 3DHVA 3QK7A 1V96A 3QKRB 3JCZA 4DIFA 1Z4PX 4OH7A 3FFBA 5EZSA 1U90A 3RANA 1HETA 5GPAA 5EQTA 1PVVA 4EUNA 4EPYA 3CZ5A 4CCSA 621PA 3FJYA 4M4SA 4O4JF 3HB4X 1PVOA 1RI2A 3LTNC 3AR3A 1YS4A 4RIGA 2C94A 1K8QA 3GGPA 1NNLA 3WG7H 3A6HA 3NDRA 4ZZ2A 3ER6A 4BNIA 1QKJA 2XV4S 3JYHA 3BGIA 1IIBA 1VG8A 2OGWA 1XCMA 5EYPB 1ZA1A 1RI4A 2JVHA 4UE3S 2YUSA 4B0OA 3X1JA 1JKMA 2O19A 1X7GA 4EJFA 4MS1B 3NCTA 3VKWA 5DNUA 3WK5A 4HHEA 3HKCA 1JU3A 1P9NA 4OGLA 4P7FA 1YW8A 2DM6A 5I9IA 4XW2A 3IO3A 1PUXA 5T3UA 1T13A 3LKVA 4LVCA 3A0UA 3DO6A 3EPKA 4OWRB 5K0JA 4DUYB 4HTAA 3ZQCA 2W6IA 1PK7A 5ANRB 2OD9A 1ULYA 4QXOA 2O7SA 1BDBA 2EHJA 2L5QA 2LE0A 5DNVA 3PZRA 2ZSFA 2HGZA 3CO0S 3E84A 2MABA 1SOVA 3EVAA 1XHLA 1XYGA 4Y2TA 1FC3A 1V7PC 4URUR 4RJ2A 4BQRA 4E2FA 2DWQA 3RI3A 2OMKA 3GX1A 1IC8A 1CZNA 2NP6A 2AFRA 4B71A 2AFHE 4QICA 1TI7A 4FJ0A 1NQAO 3W4KA 1LK7A 4JX9A 4DA0A 3OYKA 1ZC4A 3C6ZA 4JX4A 2AFIB 3LXMA 3OE1A 4Z0HO 1IQ0A 4L27A 2ZBEA 3QOEA 2QSHX 1BKYA 3IALA 3GLFA 2O3TA 5JIBA 3HBJA 1EK5A 1LPPA 2W8BB 2WTUA 4QXMA 2HXOA 2QEQA 4K8RB 5TF0A 4MS3A 3TDZC 1JILA 1EXVA 1LUJB 4NMLA 2YOHA 1TF7A 3KAKA 4PYNA 2B4QA 1U7OA 3HY3A 2BBTA 1E3WA 5EJ5A 1F2DA 4P82A 3AUSA 4GZ3A 4BY9E 1KI3A 2XF8A 3K9HA 2Q3JA 3PC6A 5JZSA 5KYXA 4DCUA 4G3XA 1LBHA 2C2HA 1WBJB 3CYFA 4Z1MD 2IZOA 2HZTA 4DXHA 2YVAA 5L3DA 1XRSB 3QA3E 2M2IA 2V8BA 2ZRFA 4QGGA 3SSNA 4E3WA 4RSMA 3BL8A 2J3HA 3BWDD 2F48A 2EPFA 2HHHB 3RHTA 3WFJA 4NH0A 1CY7A 3BCSA 3V8PA 3SEZA 4NBNA 1YZVA 2GEUA 3W3ZB 2W82A 5AM5A 5BN1A 3CCSI 1BAPA 2YN2A 5FRDA 5EGOB 3QH4A 1A36A 1SQGA 3OLYA 3RDPA 1CEEA 1D1BA 1E2HA 2P2GA 3RRFA 4P5DA 2VDLB 5JZVA 1T8SA 4ZKDA 1N6NA 1Q1GA 3QAHA 1N6OA 5GJCA 4EIWA 3HL4A 5ALNA 5U1PA 1UFMA 2QLJA 3PCTA 4LWPA 3HBFA 1HFJA 1ZEJA 2IXAA 3NT2A 3R3ZA 4IIGA 3HXPA 3HUGA 3KOOA 4XJXA 1D5CA 1P4XA 3I2GA 2LKSA 4LF4B 2UUBB 2CLSA 4G6TB 2K9MA 2X41A 3PFWO 4DR7B 2VT2A 2GEVA 3CA8A 4EH1A 3KTAA 4BUCA 4UUBA 2RBGA 3CWCA 4X44A 2P0EA 1E3OC 4XYBA 4WUVA 3AEUB 4WPGA 2WWXA 4E4RA 2OCBA 3KZYA 2X4HA 1S8AA 2EWVA 1H4SA 4YLYA 1J59A 2P4QA 3VSLA 2JKZA 1R27A 3G3EA 4QAQA 4DUPA 2AEMA 3Q7PA 1SNYA 4DLNA 3FNQA 2JZNA 1WGXA 4B4DA 2GPBA 5F1RA 3G89A 4ZOBA 2E2JJ 1Q21A 5KTYA 3IVXA 3JPYA 2XRYA 3K4JA 3KYCA 5D5WB 3Q7QA 2QRLA 1K83J 3D8NA 3GWZA 4CW7A 4JI0B 4K2HA 5E7JA 1Z15A 2GPWA 2JVKA 2GSWA 3P26A 2I55A 3ZGKA 5ENVA 5AJWA 1L5ZA 2JFZA 1MIOB 1XJQA 2NUTA 3MJHA 2Q2EB 4DZPA 1L7XA 2COMA 1CYEA 4KDFA 1X1BA 4WOJA 5H5JA 2VUTA 3P4YA 5JFGA 4E7IA 5REQA 1A82A 2G80A 1WPQA 4KFTA 2OTCA 3ROGA 4GE0A 4EVQA 4E94A 2I4NA 1FPMA 4KN8A 4RA2A 1PV4A 3ZQKA 4OLBA 2EFGA 4A26A 1F8UA 3OMLA 2ZQYA 1U8AA 2AJBA 2EQRA 1TYDE 1E18A 2C8VA 4DCOA 2VQEB 2HHAA 4DA8A 1A8IA 5LGUA 1P4HA 5JEEA 2ZAIA 2P40A 2C8LA 2RKBA 4P9NA 1JTFA 2PUHA 3O4JA 4POAA 1SUSA 5GTHC 3VXKA 1FYMA 4ERXA 3OM9A 3TK1A 2BEWB 3E6BA 4KWTA 3C2BA 3S3MA 5D5UB 1M67A 4BKMA 3QLUC 5BY2A 3GJ3A 2JI6A 3NPAA 2XF2A 4ZVNA 1NUTA 5EI5A 1FBQA 3P20A 2ZJFA 2AI1A 4JUDX 2JGNA 4OMYA 3CM0A 3I5XA 2WWWA 3F4BA 3NM4A 1IZ0A 2ARKA 3GVXA 3NAMA 2DHDA 1G6Q1 2R1VA 2FQ1A 4LISA 4DR1B 3T1OA 2D2XA 1HTTA 1EP2B 1PIWA 2QN9A 4W5HA 2FGJA 2V0NA 2IXTA 4MMZB 4R8VA 3JSAA 3IB6A 5F2KA 4HQEA 2EFEB 3SR3A 1SCQA 3OF5A 4INZA 4KWIA 2W2OA 3OE7A 5CQEA 2CEAA 5BPDA 4Q24A 4J91A 1E2EA 5EWLA 1EPUA 2WKQA 5TRTA 3AP3A 3M9LA 2P1DA 1H5NA 4JS0A 3AO0B 3P27A 2JKYA 2PUAA 4TSKA 4HCJA 1Y8RA 1XEAA 2NUAB 4CNBA 2HPHA 3Q0VA 1F6DA 2QB5A 4YUVA 3LT5A 4M1MA 4BFWA 4F8JA 4PYLA 2PE5A 3ESXA 4IP0A 1XTAA 1DTSA 3HJEA 5JNLA 2HFJA 3FXMA 4PG6A 2YW9A 5EYRA 3LVBA 1OFIA 5MGNA 1UFQA 4BMYA 1Y6RA 4G7ZF 3CUUA 4BNDB 1TEXA 4RGQA 1WFXA 3COVA 2OK7A 2ELJA 2Y2VA 3VX3A 2YQZA 3ICVA 3TG2A 2I4LA 3IE2A 2GNOA 2W7TA 2FMXA 3AUTA 4TYMA 5E9QA 3ONFA 3D8SA 2MSYA 1EDEA 5JMPA 4BQOA 3HACA 2ZYWX 1EI9A 4ZCRA 4UEOA 2HMYB 5DISB 1LC0A 5LL6P 3ICOA 3H8WA 1CWUA 3FXUA 4HF0A 2HK6A 2V9ZA 2QYHA 2PIDA 5GPCA 1MA3A 2QIPA 3TL4X 3OBBA 2A33A 4P2BA 1J07A 2AJDA 4MVJF 2O0MA 4FYMA 4WNCA 3GC6A 2XDVA 4UKDA 4CMJA 3FI0A 5GZ1A 3GTQJ 1CR4A 1S72I 1EBUA 2DR2A 1Z29A 1SQ5A 4C4OA 2F8TA 5D6OA 4PYQA 3PXXA 3WGHA 4KDEA 3NC0C 5K0GA 4YRQA 5T6MA 3REQB 4CMHA 1HSOA 3F5QA 4KBFA 1Z83A 3RYCA 1O3RA 3L7OA 1B3RA 3C24A 3GRYA 1GV5A 4L75A 1NPYA 2Q3DA 5DM6F 1LJ9A 3NWEA 1XAHA 4EJSA 1YDFA 3RYHB 9MHTA 2VF2A 4RVDA 1TM1E 2XRNA 4OOIA 4M8SA 5KMGA 4Q18A 4GM1A 3I4NJ 2Z98A 3G2MA 1WJ5A 2CUNA 3TO9A 1N5OX 1L7QA 3NW9A 5I9TA 3FZVA 1IXZA 2WM3A 2MSCB 3LSKA 4UVHA 4NR0A 4E2XA 5TNXA 1GPDG 2M8GX 4RADA 4QL3A 1ADYA 3G17A 5HJ7A 5LOVB 1SVNA 3P0JA 1NL3A 2AUTA 5C8YF 1Q7RA 2G6TA 4TMKA 3R0AA 4A6DA 4CGYA 1FSSA 3C18A 5BQFA 4JLWA 2DRIA 5B4VA 1V8ZA 2I2FA 2HREA 3MBIA 3AVWA 1FSGA 4QT4A 3ESWB 3DMHA 2A5YB 4ENPA 2DHQA 1OXUA 4XQEA 2GX6A 4IUCS 2CMDA 2LH9A 2QUKA 2Y3IA 3JTMA 1UWLA 5KOHB 3ZDAA 4DBRA 3E9EA 1YKGA 1C7RA 2DYKA 2EZ9A 3MT0A 5FOQA 3QOPA 1ERDA 4ZXPA 5LUAA 2RG1A 4MTCA 3E5UA 3IAM2 3O73A 4GOND 3WTZA 5ED4A 4G41A 1U8BA 5MFPA 4FC6A 2QLFA 4MCIA 1O54A 3T7IA 3T6KA 4YAOA 2ODQA 3H87A 4QXRA 5IARA 3O74A 4HLUA 1W8DA 4WY5A 4KYIB 1SAXA 2Q0XA 3UV3A 2ZUDA 5BV0A 1OH7A 3M4YA 1FMTA 4DLZA 1EUZA 4C01A 3SAJA 3DDWA 3F21A 5B58C 4MAFA 4AP9A 2K7FA 1TNDA 3C5HA 4QEKA 3T99A 2JWTA 2O8BB 1A76A 2QKMB 1QZXA 2C88A 2IOYA 3B6AA 3PICA 2RD2A 2FJ1A 3KEMA 1KSJA 1XALA 5A4DA 3GLQA 4LE2A 3F0TA 2B82A 1D4FA 3B6IA 1DFHA 3QWAA 3LDAA 2CLOB 1RMQA 1X1EA 4IJKA 4IF6A 4JJZA 1ORTA 2YXEA 4O2AA 1FIAA 1JT6A 2WSSA 3H1AA 4KQEA 3NRVA 4HGNA 2ECBA 3HCCA 1N3IA 3AUAA 1ZGWA 5DX1A 2A07F 3W9SA 4BNTA 3JTHA 5HDBB 3U9SA 1TQ8A 4FFWA 4MWGA 4MGIR 4FOPA 1R9GA 1XTVA 4L51A 3CF4A 1M0SA 1K7YA 3GJTA 1P80A 2AWOA 1U7UA 2JI7A 2R8ZA 3F3XA 3MAJA 3O8HA 4B83A 4TXMA 3VB2A 5EJ4A 4XL9A 3T41A 4CCYA 1JWAB 1UZLA 1K7EB 4BO7A 1GPNA 5JSUA 3E9RA 2WTMA 1QS0B 1F4VA 2PPVA 1NV9A 3P9NA 5EG5A 4NFSA 4QPNA 2FA9A 5K0CA 3EAFA 3NORA 2MSEB 4I66A 1PFVA 2HF8A 2ZSKA 1N77A 2AG6A 2IE0A 3TZCA 1OIXA 5IM4F 3KM0A 3L8EA 2JVJA 2EG5A 4PW0A 3EQ9A 1T4DA 3OZIA 2ZIFA 3KB6A 4IHSA 4OLJA 2PDAA 4RCYA 1KF0A 1E9BA 4ZYUA 3U17A 5BW8A 2QNBA 1GZ3A 5A4KA 3TLJA 2PTGA 1E2JA 5I9MA 3HPHA 3P32A 1RSZA 1J56A 1Z06A 3U9GA 1B0UA 3HXMA 4TQ9A 3H2ZA 1TAHA 2A5DA 5DSTA 5CGQB 5JXWA 3JASB 3J7YJ 4XYGA 1W85A 3CLKA 2VF7A 4NOJA 2C8KA 3GTLJ 3NAZA 2D4AA 5AM4A 3GWGA 1KGDA 3EA4A 4BNNA 4MB2A 3GRFA 5LMCA 1KQOA 1WF3A 3CONA 2HA6A 5ALUA 821PA 2C04A 1IRZA 4TTSA 5AT1A 5BSEA 3S0JA 3H7IA 2MIIA 3TW7A 1FF9A 3QQAA 2CVZA 3GJ4A 1KL7A 4EG1A 4EGAA 2LC2A 1Z4OA 1U3CA 2QXYA 1ILWA 4CEHA 4JI3B 4XCVA 1XEXB 2YHBA 4O2BA 3BVPA 3IAFA 4E7ZA 1UCRA 3WGVA 3VTZA 3K0HA 3MFKA 4NMHA 4TXJA 3LVFO 4B44A 3E3LA 4LQCA 1ZJ5A 3S2SA 1FOYA 2DLLA 2CL7X 1E5LA 4MXDA 3H9CA 2HHCA 3LWZA 1I4LD 1Z88A 4Z1OA 3HDYA 4G5RA 1SJ9A 3GLIB 3ASUA 4XD7D 2FOLA 4Q48A 1LDGA 4Z9FA 4MOWA 4G94A 4NYIQ 2OMEA 3QXGA 3VPBA 3D3WB 1OYYA 4QDXA 4MTDA 1F7VA 2B92A 5JYEA 3LUFA 4JYZA 1VHJA 1K5DA 3RGWS 2K5CA 3FPFA 3E4CA 1VMEA 2CLKB 4M22A 3S1QJ 5DM4A 1UKYA 2AZTA 3RNOA 2P3QA 3CLRD 5F73A 1E6EA 3RKWA 3OE7D 3G82C 1C29B 3DDUA 4Z54A 5C32A 3VHXA 121PA 4TT3D 3K4NA 3G0DA 3QM1A 2PX8A 1OA0A 1WW2A 4GZMA 3UJ9A 1E2UA 1KU0A 1EGQA 2IHBA 2H5EA 1THTA 2IA1A 4A8JA 1T4BA 3EOAI 3DNFA 3TUIC 1NZJA 2PV0A 2WU4A 2O5RA 5IYZA 1I2ZA 1JNXX 4FT8A 4RKFA 1KWGA 4N9QA 421PA 1P3JA 3K6RA 5DYIA 5ERXA 3A1NA 3WDLA 4UJ3A 2JIMA 3CMMA 3KOUA 4HMPA 5LQCA 4DLKA 3JARB 3DO8A 3ELUA 1QQ6A 5BV7A 1GAXA 4BJ6A 4BLWA 2GZWA 2PQ6A 3T4EA 1OGIA 1A9RA 2FPXA 5BMOA 1G4UR 3UPUA 1JEJA 3WTCA 4HAOA 5FOVA 2FUG1 4HDRA 4MI6A 1BEEA 1NW8A 2OZ6A 3J80A 5KHDA 1NJ2A 1PZFA 4UFNA 1G8SA 4BC0A 1AKYA 3RSZA 5CRIA 2D0IA 1W0KA 4RE5A 3ROPA 3AUFA 4D9GA 4PZCA 4AJOA 3RRJA 3ROMA 5EVCA 3REOA 1HZZC 1AUQA 5CEEA 2IXFA 4IDFA 4CN9A 2NS0A 3OTOB 1BMTA 4RS8A 5CA0A 3S17J 1YFZA 1DV2A 1RE0A 2Q6VA 2F1JA 1XZPA 1HYBA 3B48A 5CW1A 3K0FB 3PXEA 3T7EA 1U9OA 2J5OA 1QK4A 4NWIA 5TPWA 2H18A 2Z9DA 2L18A 2O59A 1KS9A 3FOBA 4X93A 3H4TA 3FWPA 3GH3A 5FKKA 1WRBA 1FUIA 1M66A 3BDAA 3M1YA 4XWTA 2GS9A 2WW8A 3ZWOA 4PC2A 2UYYA 3BWMA 4R16A 2JA5J 4CV3A 3EEOA 4MI9A 4G4SO 2VJ4A 2C5AA 2EZUA 2H1RA 4R1LA 2QTRA 3Q8LA 4RD0A 4PICA 5C3UA 1IUFA 2WY2D 2NTVA 4QG7A 2HZ7A 5HLGA 4Q6WA 4W1PA 2FSIA 4YI3A 4TMVA 2Q0OA 1RYEA 5KTMA 3Q0UA 1I2CA 2Q4RA 4S0XA 1QZUA 4HDSB 3BIFA 3PE6A 4GWGA 1ZRDA 5E95A 2BTEA 1QBJA 1HF3A 3S1SA 3H5AA 2VOPA 2IY7A 1JT9A 2PEYA 3UAGA 1DOZA 4BV3A 3G7NA 2QR5A 3IP5A 3QWBA 3VPGA 3R6GA 1FDTA 5E2IA 1KVSA 2IEZA 4JFAA 1G21E 4RY0A 2YOGA 3OJ0A 4YFYA 2IHZA 4M1OA 3ACDA 3ZQ6A 4N5NA 3QP9A 4OTZA 4HQMA 1Z7LA 3K92A 1AMNA 2GA9A 4C5AA 4CM6A 4LIUA 3U48A 4BFCA 4JUCA 2JJYA 1O6ZA 1T9GR 4KSYA 4A0SA 4UCFA 3EARA 2ORED 5KTOA 1W0JA 4GM4A 3EDOA 1J20A 2W00A 3A0RB 2ZUSA 1JTYA 3O38A 4JP0A 3E97A 1RJWA 3ASVA 4GX2A 4MJLA 3DE4X 2KSQA 4DBQA 5I8ZA 2GXSA 1K0FA 4MKFA 3EUFA 2ZJ7A 1LUAA 1O77A 1T4GA 4F3TA 2P11A 3C5CA 3PEYA 3S7TA 3G8BA 4UM8B 4L9RA 3I6YA 5EIEA 3E81A 3U56A 4JLSA 3HVRA 3F8BA 3I73A 2JFXA 2DULA 4RNCA 1B8VA 1H9GA 4UBKA 1QIHA 3QVUA 4I4TF 3LUBA 4Q5IA 1RJ9A 2Z8YA 1ZIOA 4M3EA 3QSGA 5AIBA 4Q3EA 4RK7A 2WSSD 4LITA 4TKLA 2G36A 3PUHA 2G4VA 3T3PB 2VK4A 1UKBA 4M1SA 3C16C 2P9ZA 3EG5A 2PRZA 4DLLA 2W24A 3SHQA 4WZ6A 1EVLA 4ALLA 1E3QA 1KC3A 2ME0A 2EL9A 4CDRA 5A02A 3QU6A 2YVLA 5JNRA 4ACBA 4FM9A 5JFTA 4BMVA 1E1KA 3NAQA 2Z8YM 4PQRA 4OAQA 3MTEA 2BFFA 3SQMA 4K9MA 4ZJPA 1EDOA 1PKXA 5C4IA 3LUGA 2XTJA 2QKYA 5T7BA 3UH0A 1PNRA 2GZSA 3H3XA 1QJCA 3PA8A 4DJ5X 4XM3A 4RY2A 4X0GA 3WO0A 1ZQ9A 2CLIB 3SS9X 4YY3B 3FVVA 1R4MB 2W84A 3LZDA 1GOTA 4DKXA 3WDMA 1N2BA 5L53A 5JCJA 1QH8A 4NNOA 3M6XA 4TV8B 2MDTA 4XORA 4ZFNA 2CBGA 3QKTA 2VPLA 3DW1X 5H68A 1KZ1A 3ZW8A 1B14A 2CJPA 2OCGA 1AGYA 2VJYA 5DWVA 3C3AA 4M55A 5EJIA 4D9BA 1IMOA 3EGIA 1HV8A 1VHQA 4ENWA 2HJVA 2FUCA 1KPHA 3ZDZB 4H2DA 1IPEA 2WHXA 4HEHA 4OJTA 2TS1A 2JIRA 3W6VA 3A6EA 5AI8A 3W1VA 1NM5C 2QRVB 3X1WA