3OL4A

Crystal structure of a putative uncharacterized protein from mycobacterium smegmatis, an ortholog of rv0543c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 32
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol4A02
3OL4A 3OL3A
chains in the Genus database with same CATH superfamily
1YW9A 3G3ZA 2DDAA 3M9AA 2HDWA 2EFOA 3TO6A 3TP3A 1STZA 1T2KA 2JA6J 2KDOA 2FQ3A 1Z7UA 5FLMJ 2EA2A 1JT0A 1TL8A 1APLC 2GIVA 2OZ6A 3SJMA 2IS1A 2PI0A 3G1MA 2OBPA 2HDDA 2ZFWA 2BV6A 3OL3A 5FFXA 3ABUA 4U7BA 5GPAA 5H20A 1Z05A 4NC8A 1XTAA 1S8NA 5AIPA 4FTHA 2NVXJ 5D8KB 1JJ6C 4JYKA 4I01A 1PUFA 3OV8A 5F0HA 1Q1VA 3JSPA 3S8PA 3KPHA 3E6DA 3RPUD 1XGSA 1EF4A 2L7KA 1UG0A 2LLKA 2NS8A 4EVIA 4MHGA 1P6RA 4B1RA 4XK4A 2W00A 5LFAA 1K61A 3F8MA 1XB4A 1LDJA 3OOUA 4KUMA 2XROA 2LKPA 2PFBA 1ODDA 3DU5A 5FKNA 5H2FC 1WHUA 2R0QC 1O7LA 3VPRA 5J4VA 3RJPA 2QKMB 4C3HJ 2DOAA 2NNYA 2DPUA 1XMAA 1GHCA 4A5NA 3OSFA 2WC2A 2JPCA 5C3EJ 2KIMA 4XQFA 1JUPA 5CLSA 2DA1A 2I10A 1WH5A 3QQAA 4MFEA 5D6FA 3CCUI 2IJLA 2E1NA 4HF1A 1X2MA 1VQ9I 5IPAA 4BQAA 1JKPC 1MGTA 3QYBA 3PL8A 2EFWA 3F8FA 2YU3A 2JA5J 2EFNA 2VPRA 3LFUA 5K7HA 4R8HA 3LA7A 4JQFA 2NS0A 2ZMEB 4IJAA 2KRHA 2VC1A 2Z9OA 1FTZA 2Z3YA 3F6OA 3SEQA 2VLAA 1FOXA 4ZYAA 1RR7A 2R7FA 4L9NA 4EM2A 3D5RC 3H0DA 2VXZA 4IHTA 1FMWA 3VB2A 2ECCA 2R7OA 2X48A 3P9KA 1EKEA 1Z9CA 2K9SA 2XGDA 3IH2A 1D5VA 3KE2A 4KITB 2MH2A 1V5EA 3LAPA 4BACA 1MW7A 1FOWA 3BOQA 5C4XJ 3N97A 4BHBA 3KETA 5DUIA 2JSPA 3BT9A 4M9ZA 5E3MA 1A35A 2XPWA 4RGXA 2L7ZA 1SMYF 3JAMZ 2H1KA 3R4KA 3S3MA 5IT9K 2DTRA 3H92A 3RI4A 2L4MA 2K86A 4G6QA 3CESA 3K0LA 1B8IB 4RDUA 3GW2A 4BU2A 2QKLB 3LOCA 2EZHA 3QOEA 1XGNA 1B8IA 2AS5F 2ZXJA 5CVIA 2VPLA 2G7HA 3BROA 2PX9A 4IO9F 5EZHA 2X6OA 1ERDA 4G7ZF 3OYCA 3OYLA 2B9SA 3C1DA 3HHHA 3F8NA 1MKMA 1K6YA 2LG4A 2VJIA 3C2BA 2BXYA 1HC8A 1R4NB 4LOCA 4RAGA 1ETQA 1W5SA 3K4MA 4L0ZB 5E1XA 2R3SA 2XRNA 3DF8A 3ONQA 1IRFA 2OAZA 2XPUA 3CDHA 2E2JJ 1IRGA 2O7OA 1YJWI 4HSTA 2H6CA 2CSOA 3S32A 3L2RA 1R5ID 1B59A 1IXRC 1FP1D 1WJ5A 3BQZA 1RNLA 1S7OA 2ZMEC 3ERED 1V5GA 4FE4A 3GTJJ 1F9NA 2BHZA 3CTAA 2WAQN 1LDDA 2OZUA 4CCNA 3CLOA 2LREA 3CCEI 3GWZA 4AWXB 2B63J 1IUYA 4I6ZA 3ZQ7A 4E7KA 4UVCA 3OYEA 1WVRA 4HPQA 3KLOA 3W6JB 4II2A 2R7WA 2E60A 1QZYA 3I53A 1SVMA 5E17F 5IYBJ 3K70D 1RESA 4AD9A 3K4NA 1W36C 4Y13A 1HOMA 1KYWA 2WBMA 5FKKA 2IS6A 4ANJA 4F93B 1UZCA 5AIQA 1B72B 4OIQF 1G6NA 4IRIA 3I54A 4E7SA 3K70C 2J5PA 2DMNA 3DTEA 3JTGA 4ENKA 3ZN1A 1JTXA 4XSZF 4NBQA 1FBUA 2BY3A 1Y0NA 2V9KA 5LEKA 4QSHA 3L2UA 2CQQA 4FISA 2DU9A 2DODA 4A3DJ 2K9NA 3A0BC 3K10A 3U1DA 2HOAA 5F04A 2WA0A 4C30A 2BYVE 1YRNA 5CYVA 4G7HF 4OU0A 4PJLA 3C2HA 3CLQA 1TT0A 3FMRA 3PJRA 4YFXF 2VJ4A 4B4CA 3CCJI 3HPGA 5GAHJ 4E70A 1UJ8A 1VI0A 5FD5A 1JE8A 1EH8A 2CUJA 3OYGA 2LSOA 2O03A 2HOSA 1K83J 3TOBA 1DGRM 2H09A 3NEUA 4L9VA 2DYRH 4HA8A 2R5YB 2DFFA 1A5JA 1FP2A 1SFKA 4WCGA 4X6AJ 2L0KA 2H1LA 3QRFF 4L18B 3Q0UA 4LMYA 2CYYA 1DU6A 1WGXA 1JKRC 3M07A 5IY5H 5GPCA 5C44J 4A3JJ 3CUQC 3RYRA 2Y9ZA 3GZ6A 1B9NA 1MMGA 3KX2A 4EJWA 3IKTA 2BVMA 1G8XA 3F3XA 1P2FA 5L3FA 3PUFA 3I71A 3K1NA 4XKCA 3IV5A 1S5LC 3FIWA 4MO7A 2XC7A 2R7RA 4Z6YA 1H88C 4CXFA 2Y0SN 4PSWA 2E1CA 1YLFA 1BR4A 5JFRA 3D5LA 2BE5F 4XN3A 5DCMA 1G3YA 1OCOH 4IQJA 2IGOA 1Z0XA 3NWTA 1FBSA 1OYYA 1Z3YA 5K5RA 3RZOJ 2HQNA 2K40A 3U21A 4Q48A 3RKXA 2X1DA 5K5OA 3CMYA 5LGNA 4BBRJ 4EATA 2EV0A 2XSJC 1T6SA 4S0HB 4JX6A 2CV0A 1BI1A 3VSLA 2QUFA 3LSJA 2L7MP 3OYIA 2DAOA 3CQZJ 1NH3A 2W57A 4HSRA 4EQQA 1KQ9A 3EUHC 3GMEA 2JMWA 5E8IA 4HLYA 2BY0A 4ENNA 4GFBA 4ABZA 3A2KA 1P92A 1HKSA 3HRMA 4CCLA 2VKEA 1GUUA 4HEA2 3FHNA 4KA4A 4BNCA 1OKRA 3I56I 3RKWA 1GV2A 3P7NA 2L02A 4LG3A 2DA6A 5BMZA 1YRNB 1U0JA 4U7DA 4XOTA 2PEXA 5KHDA 3S16J 4HYEA 4RGSA 5M5XJ 2M7AA 4M3GA 3TKYA 4GCVA 1WI9A 3EUHA 3BG5A 4GXOA 4N9IA 4D9JA 2L9VA 4AYBN 2CJJA 4UV8A 3O2PE 2E1OA 3V7CA 1LB2A 3I58A 3I64A 2M2EA 5FO5A 4KISA 1VQMI 1B72A 4ON0A 2M9HA 4IF4A 1IRZA 3VYSB 1IN6A 1BBYA 2K9MA 1HCRA 2DT5A 3BC8A 1E2XA 2A6HF 3GLXA 5K7FA 1IZ1A 2QSHX 1SFOJ 5IOYA 2VBZA 3OYDA 3JRAA 1IO2A 3HOYJ 1R1TA 5J1UA 3GEZA 2DXIA 2G7UA 3DQVC 4ZDOA 1OPCA 1O3QA 2RQPA 2X85A 5IYDJ 3IRQA 3KYDB 2KJCA 5JR3A 4NUBA 1Z91A 3S93A 4HQMA 3S15J 3ZCOA 4BH9A 1TZLA 4HOBA 1U8BA 2E1MB 2DA5A 1ZRCA 3WTZA 3WGIA 3D1NI 2KRFA 2R7SA 3KP6A 2YPRA 3CCQI 1KU3A 4IZZA 4IOCF 1D5YA 3PUBA 4IL6C 3V4GA 4IHSA 1A6IA 3DPLC 2L4AA 2XAUA 1RKTA 3GFMA 4M6YA 4XLFA 4YEJA 3TW7A 1ON1A 3IH3A 4MIMA 4EMSA 2IRFG 1OJLA 5JVTA 2LD5A 4CH7A 3F6VA 1UELB 4H0EA 2A5WA 3AL0B 3VSKA 3HL2A 4KN4X 1KZHA 2F5CA 2CFOA 3PNYA 5K1YA 2ESHA 3WTTC 4IHVA 4M6VA 3L7WA 1FYLA 2LVSA 3S1NJ 2MA3A 1ETWA 1V3FA 3PQJA 4E7JA 4G6TB 1F5TA 1HDPA 2F6CA 2TDXA 1X1BA 2V7FA 4LGWA 4E7HA 3E6BA 2QCOA 1YQAA 2Z16A 4EJVA 2CQNA 2VL8A 4BL0B 2R5ZB 1WWXA 4ZDPA 3KEYA 2F5EA 1QU3A 2NAZA 2ICWG 2M7BA 2QQBA 3HZJA 2EFPA 3S1MJ 3L2CA 2X0LA 5HOOA 4G7OF 3WGHA 4OOIA 2MLGA 2PMHA 2Q2EB 1MNDA 2ZKZA 4BDZA 2CV2A 1ZGAA 2K3PA 4L5JA 1W5TA 1FJLA 1XMKA 1BR2A 4XLCA 3OIPA 1WQ2A 3WG9A 3ECOA 1RETA 1RR8C 3GTOJ 1VQLI 4P55A 4EGZA 3AG3H 3JRBA 1DPRA 2L7FP 4S05A 2NYXA 2PMZN 1Z6RA 4OMZA 3DKYA 2QBYA 2H8WA 4KNYA 3GX4X 5HNHA 2KIUA 3FHZA 1USTA 4CYDA 1OCZH 2M8EA 2XKPA 4XSXF 2F5VA 3HG9A 2ME6A 1GVJA 2FMLA 2M45A 1IGNA 1CQTA 1QRYA 2VT2A 3TO7A 4P1WA 3AFHA 4F91B 1ZRFA 3D5SC 2UZKA 3EETA 3FXMA 5JLWA 3EQLF 3N05A 3JW4A 4U0YA 3FISA 1QHHD 1P7IA 2ZNYA 3KP7A 4HNTA 3HRUA 1U8RA 4CUGA 2P6TA 2IA1A 4A3IJ 1X1DA 4NNJA 5J40A 3ZQQA 4XRFA 2B0LA 4ESFA 1W0TA 4UXNA 2CS3A 3WHCA 1SANA 2QF7A 1EH6A 5DYMA 2VIXA 4NC6A 4B44A 2XAFA 3B02A 1S7AA 3CF2A 3FXUA 4PK4A 3ZQFA 4DW6A 2DYSH 2X6XA 4J01A 1SEUA 4A3CJ 2MD5A 2PMZA 1LFBA 1UG2A 4M74A 4BQNA 5FRMA 1LE8B 3TDZC 2E2IJ 3WHBA 1VTNC 4F92B 3OS0A 2CH0A 3GO5A 4KIFA 2JPBA 5F08A 1W7PD 4A6DA 3VDXA 1MJ9A 1MMSA 2A05A 4D7MA 4NB5A 2CUEA 1LEAA 2LC2A 1FYMA 3S2HJ 4B3AA 2Z2SB 4CO8A 5DCMB 2F48A 4I0BA 4X1EA 4BXUA 1IV8A 2HVRA 4A0YA 2KIFA 2R7DA 1ENHA 3MKWB 1AHDP 2W24A 4XBFA 3KZIC 3J80K 2PJRB 2EINH 4XLEA 5DM6F 2B7EA 1XG1A 2WTEA 3JAMK 2IT0A 1U5TC 2OC6A 2XB0X 5BNGA 4WX9A 2FQ4A 2EA4A 1W5CC 2M34A 4ZYEA 4E7LA 4KFCA 1YTYA 2AXLA 1R6RA 1X3UA 2ZFUA 3IHUA 5HLIA 2ETHA 2HTJA 1XSVA 3UNGC 1W0UA 3FM3A 4HW0A 4AUXA 1G2HA 5HLTA 2EIKH 2XGCA 3TL4X 2VKDA 1HW1A 3GTGJ 2VKHA 4A3EJ 2GZWA 2EFQA 5E8GA 3T0YA 3SHFA 3GTKJ 5HDNA 1TWFJ 4BEHB 2VUMJ 1WJAA 3EUAA 3EYYA 2KRCA 2CW0F 3SYTA 2I8DA 3W2AA 3HPHA 4UUSB 1HDDC 3Q5FA 1MDMB 4HAMA 2L54A 4Y33A 3BPVA 3ZQGA 3RTRA 2Q2EA 5DCFA 5BPIA 4WXHA 3HIFA 1D0XA 2ZXHA 4K2EA 3OSGA 3R6SA 1YX3A 2DA4A 3FBNB 5GAEJ 1R36A 5IT3A 5E79C 2CUZA 1QPIA 3QP5A 2QGUA 1OCPA 1UHMA 3WTUC 4U88A 4BS9A 2GXBA 1KQ0A 2WAFA 3QAHA 4BKXA 4UUSA 3SZTA 1J0RA 3L1PA 3QPSA 2W85A 3G71I 2YSRA 4MEYF 2Z33A 1ETKA 4BEHA 1AKHB 5M3MJ 2R7TA 2MC3A 3OOPA 1ZQ3P 2ELHA 3M8EA 1P4AA 1D0ZA 1JUSA 3E7LA 4IRHA 1T56A 1GDTA 3CUOA 3OL4A 3DV8A 4HNVA 4DOZA 5KAIC 2HQRA 3LAJA 3LSTA 1DQUA 5KK1A 4PJMA 3H35A 2VQLA 3BCAA 2V9VA 5LGUA 3PFIA 2V1XA 1RPWA 2R7XA 4KMUX 3ZQLA 2KPMA 5ICFA 3ML6A 4RB2C 2Y69H 2W1OA 4GO1A 3ZMTA 3HKZA 1PP7U 1ZAOA 5HS9A 1I5ZA 3K4BA 4RM2A 1I6HJ 1ORKA 2F4MB 3SQNA 2QQ8A 2NXNB 3BR0A 3WTYC 1UHSA 4HV5A 2LF7A 1MMNA 3KCCA 1ZELA 5JI6A 2L5QA 3AG2H 5CQGA 1MSEC 2A3SA 4S04A 3E3VA 2YX4A 2HEOA 1IN4A 2O0YA 2KHMA 2V79A 3IAS2 2BEOA 3K6GA 1X1AA 3GF2A 2V6EA 5KCMA 3VYTB 3ZP5A 3U2RA 1HKQA 4F52A 2E35A 5EYRA 4MLOA 2UXNA 1R58A 2P5KA 4UUVA 4HNUA 2LH9A 2XGXA 5E3OA 3FXKA 2M5WA 3BDDA 5E3LA 1ZG3A 2CQXA 4HDUA 2DA7A 5L3BA 3TW6A 1JGSA 5F1JA 3ABKH 1ZG5A 5D5VB 3FBIB 3HOSA 1X2NA 1LQ1A 4OINF 1MH3A 2RGVA 3H3ZA 3OR1C 1QBJA 1RUNA 4LG0B 1FT9A 2ZCWA 3J7ZI 1REPC 4BY7J 2BY1A 3P9CA 2H8RA 3HGGA 3PSFA 3FZVA 2UUZA 4IHYA 4CDGA 1U5TA 1C0WA 2IGMA 2Y0SA 1QZZA 3HYIA 5FKLA 1N75A 3NWSA 3GYHX 3X2QH 4N4NB 2QYOA 3HBLA 2CW7A 1R7JA 5ICEA 3UKGA 4V19K 4XKBA 3ZQHA 3LA2A 4NC7A 1ZTRA 1AA7A 1TT5B 1RIOH 5GADJ 4A5MA 3MEXA 5TGTA 2LRDA 3DU6A 4A3BJ 2JWTA 3CD6I 2ADUA 3VYUB 3DWLE 4M6XA 3FWEA 4KIGA 2WAEA 2LP0A 1ONVA 2R92J 4A6EA 1JHHA 3L00A 5J1YA 2DLLA 4A12A 2A07F 4KDPA 1UFMA 5C4JJ 2O5RA 1EA3A 2Y75A 2CGPA 2K7LA 5J47A 1QPMA 1PVEA 4OAZA 1MBGA 1XD7A 2HWVA 1VQPI 3LSMA 5A2QK 2JT1A 4B8XA 1XSDA 1VQKI 4CZZA 1W36D 5EEAA 5CKTA 1E3PA 1UMQA 2XGEA 3MQ0A 1R1VA 1HSJA 3CUQA 3J7YJ 2XSDC 4M71A 1XDSA 5DUKA 4J19A 2M4GA 2EZKA 4PCQA 3OYAA 2JVGA 5HNFA 3LFKA 4E7ZA 3OYBA 2XAGA 1FPQA 3DCFA 1EV7A 2Y9YA 2R7QA 4FX4A 3JREA 2X6YA 2EBIA 1O7FA 1FEXA 2DK8A 1IC8A 4ENMA 3W2VA 3KZYA 1LPQA 1ACIA 2BZTA 4CSWA 4RB3C 3H5NA 4XRSG 2HXIA 2QVOA 2ZJPF 2HKOA 3QPHA 2GM4A 3FXRA 3ABLH 4XICA 2FBIA 3HOUJ 1A31A 2XUBA 4IXAA 2VQCA 5HLHA 2LMDA 3PNVA 1SFEA 1OCTC 1EH7A 3AKZA 2VKVA 9ANTA 2DMQA 4XLAA 3CCRI 2K9QA 1BOAA 2XPVA 3LWFA 2DOEA 1DGWY 3BR6A 4BE1A 3WODF 4FT8A 1R4MB 1WH7A 5JHUA 1OR7C 1VZ0A 4R79A 2C6YA 3SZGA 2IGKA 3WTXC 2K9LA 1OCRH 1JUMA 4N9HA 2A6EF 1B1BA 5BOXA 2DMPA 3M3YJ 2EB7A 4DQ2A 2K02A 2P5VA 1O57A 2RQQA 4RGRA 4A3MJ 3EYIA 3JRHA 3BR3A 5J1RA 4NQWB 1Z7LA 4M9SA 1BL0A 2Y48A 1SMTA 3SDGA 2EWNA 3ASOH 3SEZA 3ZMUA 3KZZA 2K4JA 2X4HA 5D4RA 2FUG2 2AQFA 5K5QA 5EEGA 1XCBA 3MAJA 4WK8F 3BTJA 3OYHA 3E5QA 5KNLA 3G6EI 1NTCA 1Y1WJ 3HC7A 3DFGA 1S6LA 1VF9A 4ESJA 3I3LA 1NK2P 5F0CA 2FBKA 3CP8A 3CC2I 1XC5A 2M1BA 3COAC 1HA8A 3VOEA 2PJPA 3O6BB 4DNCA 3LSPA 1ZGJA 3IL2A 5IYCJ 2E7WA 2KZVA 3E5UA 2KIQA 2MBFA 3BTCA 4QIWN 3F8CA 3JR9A 2V4JC 4ZZLA 1MIJA 3RCOA 5HODA 3KFWX 2XAQA 3BR2A 2XASA 2GA2A 1ZLKA 1F36A 5KAFC 5HS8A 1MDMA 1FX7A 1NHAA 1IAWA 2Y30A 3GFJA 3A02A 3HSEA 2RVCA 2RN7A 4BE2A 1L3LA 1MZBA 1BN5A 4HF0A 3BZKA 1P9QC 2JA7J 4AU7A 5GAGJ 3HOXJ 4CHUA 2M4KA 1BC7C 4A3LJ 2LKSA 4MGRA 2ACJA 1SAXA 1BA5A 3S14J 2PG4A 1YJNI 4DYCA 4BDYA 2RDPA 1X3ZB 2EV5A 2XRLA 2AQEA 3L2VA 2Q1ZB 3KP3A 1OYWA 1J9IA 3FKIJ 3C18A 3JSOA 3H3UA 3PM1A 2R7ZJ 4XRMA 1AKHA 4B43A 2WWYA 1KGSA 2JTVA 5FKMA 3RSNA 2HTSA 2LY9A 5HVQC 4DZJA 3EPZA 2EPFA 4OWRB 1U9OA 3BTLA 2JA8J 3HOZJ 2JVHA 4DIQA 1FYKA 1ZKGA 1KQ8A 3BG3A 3IKVA 3JTHA 2QWWA 5LHGA 1FIPA 2UWMA 4I0AA 2DQRA 3FK6A 4L5EA 2FBHA 1XMXA 4JX5A 1U2WA 2YR2A 3BR5A 3PFYA 1HW2A 2L9SA 4G6DA 4B48A 3J7AO 2BW3A 3RQ4A 2FF4A 4PJ0C 3TQNA 2QZ8A 3WE3A 1YJ9I 1Y39A 3DTIA 3CC7I 3V8JA 1PUEE 2DK5A 4A93J 5IP7J 1D1AA 4DZPA 3ZR8X 5EEHA 4IHWA 3ULQB 4O3MA 4UVAA 1LUJB 3MZYA 4A3FJ 2HOTA 3O3KA 3ZN0A 1T33A 2O61A 1USSA 2D1VA 3HRTA 2TCTA 1XDUA 1Y1VJ 3ABTA 3NQOA 3I5UA 5BQTA 1TC3C 2MC4A 3V42A 4D7NA 5LEJA 1TWAJ 1IXSB 1T0FA 3HOWJ 1BM9A 1TLHB 1I39A 2VT3A 3C2GA 1R71A 1FTTA 3SFIA 1A36A 4HDVA 3T8RA 1K78A 2M3AA 1IF1A 1W7PA 2VE9A 4XL9A 2DT6A 3KYLA 2VBYA 4PZJA 1TQPA 5ERIA 1T38A 4I98B 3PO3J 3GBGA 5J8CA 2KFDA 3BY6A 2A68F 2ZSHB 1OLTA 5K7ZA 3GUDA 3FXJA 4F3QA 3BPXA 4IX7A 1CGPA 3DKWA 4UVBA 2ME0A 4KIBA 2V9PA 3QODA 4L9TA 2O6GE 3HGYA 2OV7A 2CRGA 1BOBA 2E5ZA 1LKXA 2A61A 1UAAA 4D1QA 1XX5A 4I99C 3VWBA 4LD5A 1U3EM 4XMYA 2KZGA 5J8FA 4A3GJ 2NVYJ 3TBIA 1H8AC 3TO9A 2MG4A 2HI3A 2DJNA 3BJAA 2F4OB 4ETSA 4PJJA 3H5RA 5IP6A 3LL7A 1FWZA 1Y56A 2Y2ZA 2LKXA 1JGGA 3HOTA 1MBKA 4E4HA 1J5YA 1MBFA 3RPUA 5IT9Z 4RAFA 4YRVA 4NHJA 3ERMA 1M1EB 2HZDA 4LJZF 1OQYA 4DYRA 2QSGX 2M30A 2VXDA 2BBYA 1YFHA 1CF7A 5HDGA 4XONA 3BJ6A 4G9YA 4NDLA 4V2FA 5BS6A 3WU1B 1MBHA 2IA2A 2PQ8A 4WXDA 1U5TB 3K2ZA 3BWGA 4ZYGA 2IVMA 4RS8A 1TNTA 1XGMA 5F1RA 2LBFA 2KISA 3ISPA 4HG2A 3PNTA 4D5FA 5L3CA 2XHKA 3I4PA 2IS2A 1JTYA 1FNNA 1J09A 4CICA 4F7ZA 2VQGA 5TRDA 1GVDA 4V2GA 2P81A 4FX0A 1LEBA 5HLGA 3MZ8A 1IV6A 2VB6A 1RC9A 3IWFA 3G2BA 1YG2A 3OY9A 1ZG1A 4LLLA 5EG0B 2GIZA 4D0PA 3RIRA 2D5VA 1B6AA 1WJBA 5B3SH 2JRMA 4P9FA 2J5OA 3CJQB 4GDFA 3J81Z 1YITI 2DFIA 3Q9SA 3ROUA 1YW7A 3CO7C 1HKTA 3FDYA 5E1ZB 1IDZA 3HXLA 4P9UA 4WWCA 2M8GX 3V8KA 3KIOA 4IKFA 5ILUA 2CMPA 2CQKA 3I59A 2VOOA 5LLQA 2HQ5A 3ZXSA 1MJAA 4FE7A 4ENJA 1S7EA 3ZMDA 2CQ7A 1PUFB 1LJ9A 4WXCA 3ASNH 2DJIA 3DKXA 2OQRA 2HZTA 4Z2YA 4A2UA 3TEDA 1GXPA 2JSCA 2OTJI 1DU0A 3K7AJ 2M0MA 4AC0A 2MW8A 4PJNA 4E6KG 2QQAA 3SFZA 1AU7A 2AHQA 2LF8A 1S3JA 3A0HC 1R22A 1ETVA 3M7GA 1G3SA 1MSFC 1ZH5A 2HFHA 3OYMA 4OMYA 1SVOA 3BLYA 2DMTA 1GLNA 3DPUA 3G1OA 1T39A 1JKQC 3R60A 1VFCA 2DMUA 3CJTB 3JCUC 4CCJA 1ZYRF 3ZPLA 2VI6A 4B47A 5CVVA 3RKQA 1QA6A 2ECBA 5AONA 2YU9J 1BI2A 3LMMA 1K79A 2WAQA 5CJ9A 4F55A 5EGOA 1H9GA 1OCCH 1JXSA 1D1BA 2VC0A 2LFBA 1W1WE 2WADA 3DXJF 4XNFA 4BHPA 4BUPA 3GLLA 2X9DA 2P7CB 3CZ6A 1WFXA 2HYJA 3KP2A 3ZOBA 3GZNB 2KLOA 4PSXA 4JX4A 2EZIA 1VQOI 1FBQA 2GXAA 4U0VA 5F27A 3F21A 2F4IA 2XB5A 3BQYA 2CG4A 1I27A 2ZC2A 2VN2A 2V1NA 2K5CA 4RLFA 4Y3OA 3T1BA 4IPAA 4U87A 2DDBA 4L9JA 2IEKA 1D0YA 2R93J 1DP7P 4I7HA 1BIAA 1HF0A 5EDNA 3S2WA 5FLVA 3J81K 1TW2A 1QZEA 3W2WA 1IRXA 3WTVC 2EQRA 2VJJA 3CJRB 1P4XA 1E3OC 1EJ9A 3S3NA 3FF5A 2BXZA 4HBLA 3WU0A 2DPDA 4RM3A 1HLVA 1DPUA 4BXFA 2ZJQF 4G94A 5L3EA 3MMYB 2LYCA 3DLLF 5LGTA 1FOKA 1WJDA 1U78A 2P8TA 3FK7A 4IRGA 3LSRA 2FA5A 1TQMA 2DA2A 2KKOA 5CQEA 1HXDA 4PGGA 2DI3A 2FXAA 3MKLA 2H27A 2M87A 4BJTA 3PQKA 3C7JA 2QQ9A 1FSHA 5JVGF 3IP4B 2W7NA 2AXTC 4D5CA 3OMYA 4HX7A 2E71A 3MWMA 3P9IA 5CVJA 3HTSB 2ZJ2A 5GTHC 3J80Z 2KJBA 1IN7A 1OYIA 4EJOA 1SVLA 4LB5A 2LR8A 2YUSA 3MD2A 2HQAA 1ZHFA 3DEEA 1YIOA 3I55I 2XF7A 1ZK8A 3TP0A 1MBEA 1ZREA 3RQIA 3RZDJ 3CMAI 4DBRA 2NOGA 2HVSA 1DUXC 4BE0A 3CCSI 1PYVA 2EIJH 4Y17A 3REOA 2VODA 1BJZA 2GXGA 3DP7A 2R5ZA 3GTLJ 2NRAC 5LRSA 1NG7A 2M0CA 4B3XA 3IAM2 1IN5A 2MSYA 2O9LA 2E19A 2GAUA 4MTEA 1SD5A 3LQRA 5EG0A 3BCBA 4XIDA 1NG6A 4M9XA 5FJ8J 4ITVA 4J00A 2HYGD 3HHGA 1ZR2A 2LDUA 3I9V2 3RYPA 1QGPA 2BVLA 4RB1A 1X1PA 3WTWC 3I4MJ 1FOYA 2RC4A 4RBOA 2QA4I 3J7AY 3S1QJ 3RDIA 5LRRA 4ZYDA 1T95A 3WE2A 2HPMA 1O3RA 4LK1F 3MFKA 4IHXA 5D5UB 2L3DA 2KP6A 1N25A 1ON2A 5F0FA 2FRHA 3BJOA 3H9JA 5ILVA 1G4DA 5EF6A 2VBXA 1VNDA 3LSGA 2IS4A 1A04A 4FCYA 2VOPA 4QPOA 5D4SA 3ECHA 5L3DA 2BW3B 2TRTA 4KN7X 5GTIC 4W97A 2D45A 3BG7A 2HYFA 3CF5F 3QYEA 4DGWB 3BZ6A 5ICGA 1YIJI 4MEXF 2Z1DA 1IDYA 1XPXA 2DFHA 4MQVA 5ED4A 4UHTA 3S1RJ 3MKYB 1AOYA 1UB9A 1J59A 5FFZA 1IUFA 4U0WA 4WF2A 2FMYA 2RNJA 4LLNA 1ZLJA 4LLGF 1KONA 4BAYA 4EV0A 3CP2A 5DD8A 3VFZA 3DBHB 1PDNC 3B6AA 3FXOA 2OCCH 4BQQA 3A01A 4AIJA 1VQ7I 3BG9A 2XIGA 1QO0D 2XV4S 4ASNA 1WJEA 4PFOA 1XGOA 5FRNA 1JI8A 1Z77A 1F4KA 3GZ5A 2OA4A 1V55H 3E0JB 2E7XA 2OJED 3TOAA 4XOPA 1ETOA 1I3AA 4OIPF 3KEOA 1FIAA 1KYZA 1WRJA 3FXQA 2A6TA 4YIIA 3F9KA 2P0WA 4EJTA 2A5YB 4HX4A 3RKYA 2VBWA 2WY7Q 1KA8A 2D1HA 3LSHA 4A69C 4XN0A 1TTYA 3R61A 5J4YA 3U1KA 2O8XA 2IA0A 4HQEA 1D3YA 1JT6A 1D8JA 1QVUA 3MKZA 1QHGA 3WGGA 5M5WJ 4UUTA 1ZARA 2LTPA 2HR3A 4BHCA 1DP3A 3P5JA 2ZMEA 4ZDLA 3KP5A 1J75A 2ESNA 4Q4ZF 4KYWA 4GYGA 2DTZA 4BGDA 2L2OA 4Q47A 4LB6B 5F6FA 3CUQB 1K7AA 2R5YA 3GTMJ 2G0EA 3QPTA 2PBIA 4ZC3A 5E1WA 3EDPA 5H6QA 3TDUC 3U9GA 4BYYA 3QP6A 4JBAA 1YS6A 1H0MA 4XORA 4YFKF 2FE3A 3G4SI 4TV7A 2MGQA 3UR3C 1MMDA 2Z5UA 3K2AA 2XKOA 3HUGA 5GP9A 2MABA 2E1MC 3H5AA 2JN6A 2GOMA 2ZJRF 3DLAA 1S9HA 1F1ZA 1R00A 1PP8F 4OAYA 3HTUA 2ZO4A 5CVRA 3JRGA 1SC7A 2CFXA 1X4OA 5D8LB 2COMA 3CDLA 5FB2A 4O6JA 3OIQA 2L01A 2DCEA 2LOOA 3ABMH 4Y52J 4EM1A 3CCMI 2Y0MA 2JQ7A 3JRIA 1SD4A 2V6CA 5J6XA 1SFUA 1E3HA 3Q0WA 4M73A 2F5FA 1BR1A 2NVTJ 2CWEA 1Y8RB 1R49A 2X51A 3HUGB 4JK1X 3K9TA 1T08B 1R5HA 4EM0B 2GLOA 1I1GA 2JK3A 3LNQA 4QTRA 2X6WA 2L9RA 3AG1H 2IGNA 3CMEI 3AL0C 3H9QA 3MVPA 2NS7A 1QVTA 1I3QJ 4QPQA 3O8GA 2FSWA 1IJWC 1P7JA 2EH3A 4MQ9F 1BW6A 3HSFA 3VYRB 1T98A 2NVQJ 2XDVA 5A2QZ 3PO2J 5E3NA 2HNHA 4BY1J 2OUMA 1R23A 5FGMA 4FETA 4JOMA 3G1LA 3HRSA 1TBXA 1Y8QB 2BGCA 3DBLB 4RAZA 3KP4A 3FMSA 3A01B 1W7PB 2HVQA 3BP8A 3IH4A 4C2MJ 2EV6A 2OCEA 4X0GA 4ZZDA 3F23A 4AVZA 3A03A 4Y7NJ 4KMFA 2ZNZA 3F22A 2VONA 1YOVB 3BG6A 3V8LA 3PIPF 4DYQA 2PMUA 4NQWA 5IP9J 4XLPF 3OYNA 3I4NJ 2ID6A 2ISYA 3IWZA 2KT0A 1L0OC 1V54H 2MH9A 6PAXA 3OWTA 2QEXI 3M4OJ 2LY1A 1BI3A 5DS9A 4ZJZA 4BJ6C 1O3SA 1ZR4A 3TMOA 3MN2A 1SD6A 1X3WB 1MBJA 4RAYA 4CYCA 1GXQA 4HRIA 3GFLA 4DBQA 3CCLI 4ZTJA 2FX0A 3L2QA 4BXXJ 4YG2F 1G3TA 4CYCB 5D5XB 4I2OA 2VJ5A 3VODA 3JRCA 1BC8C 2JJ7A 4H4KC 3TGNA 3QU3A 1QNTA 3SZPA 1CF7B 2MLKA 1VQNI 4EGYA 3T8TA 3BR1A 2EZLA 2MYSA 4I02A 2JUGA 4L5IA 3IRRA 1G3WA 3BTIA 4P5OA 5LD2C 1FC3A 3H36A 5J3LA 4CGZA 1D1CA 1AWCA 3ESWB 4OIRF 4CA0A 1Q1HA 1IW7F 2E5NA 2Y31A 3ZGKA 3ZRGA 5B1AH 1WPKA 1RKWA 2FJ1A 2LK2A 5DM7F 3HDDA 1HBXG 3F8BA 5LHIA 2IAIA 1MNMC 1RUOA 2DO7A 3F72A 1RRJA 4LK0F 1LVKA 3K4JA 2OTLI 1KU9A 4OIOF 4UB8C 1RZ4A 4PGHA 4M72A 1LDKB 2DT7B 2GBYA 5LBQA 2HPIA 2WV0A 3QWLA 2EILH 5IOZA 1E0EA 1LNWA 1QQIA 4RLQA 4FHTA 3S3OA 4CCKA 1VQ6I 2ZXWH 5ILSA 3A1YA 1ETYA 3KEQA 1HSTA 3DEWA 3B73A 5FKOA 5FROA 3H9GA 5CPRB 1YS7A 1X19A 2MFZA 2GQQA 3GTPJ 5FLXZ 1XN7A 4RMNA 1WSUA 1TWCJ 2V26A 3Q3SA 3B6CA 2CU7A 2BY2A 1T8IA 4AM3A 3OS1A 1E17A 2LNBA 2HXOA 2XF5A 2OU2A 1MJBA 2K85A 2P6SA 3GTQJ 4YFNF 1IXCA 3I59B 3RPQA 4BQOA 2HS5A 2VASA 1TWGJ 4IOAF 2HOEA 4Y4RA 1LFUP 1K4SA 4RA2A 4M3EA 4B09A 3K4KA 4I09A 3K4LA 2VE8A 3M8FA 1ZN2A 1MD0A 5H6RA 1R5GA 1Y6IA 4HF2A 4C9YA 2QSFX 2GWRA 3LSKA 2JRTA 3A4CA 1ULYA 1J7KA 4QLCU 1GT0C 3SDBA 1LE8A 2H6BA 2YS9A 2G9WA 2QLZA 1TP4A 2BOLA 1Z6TA 3E1SA 3HM5A 3LSIA 3L09A 3K1PA 2OPTA 2QM3A 3SXYA 1ZRDA 2EK5A 1BJAA 2W82A 1DDNA 4M3FA 4PUSA 2K4BA 2KDZA 1XCVA 3GVAA 4L0YB 4UNOA 5DEQA 2UV1A 1P4WA 2XF6A 1WI3A 4IQ4A 4MNUA 3QPLA 3S17J 1V4RA 3AG4H 4CZCA 2Z99A 5EGOB 1V5FA 2WB1N 1YYVA 3KYCB 2NNNA 3NAUA 3FXLA 3R0JA 3DEUA 2E36A 2Q0OA 4AVPA 2K27A 2AO9A 2FOKA 1H9TA 2STWA 3R0AA 4M3BA 2COBA 2E2HJ 4ZYHA 2STTA 1JKOC 5DDGA 2RREA 2IBDA 4KICA 1OMIA 4G12A 5EJCA 3T5XA 1X58A 1Z67A 4XKWA 3FM5A 4EJUA 1VQ8I 2CV1A 4G8XA 1T0FC 4EEFG 4C3JJ 3MCZA 1O3TA 4N4OB 5D6EA 1Z1DA 2O8KA 4AIDA 4JP0A 3OYFA 1I1SA 2R7UA 4ESBA 1Y0UA 1FLIA 1YW8A 2X1EA 4A0XA 3DBRB 1K6OA 1PJRA 1WJFA 2CUFA 1FMVA 3ZMSA 1U6GA 3ELKA 2PJRA 1KU7A 1IN8A 4A3KJ 1YE9A 1OR7A 2FNPA 4CCMA 3JRFA 1N78A 1BW5A 2JZYA 2XAJA 3CJNA 4LIVA 1MNEA 1MH4A 4M3DA 1XS9A 3Q9VA 4XKVA 2MD0A 3QYFA 3JRDA 1LFPA 2OF7A 3K69A 2VQHA 3H3VK 2W48A 3CMMA 3E97A 3H1CA 5DD4A 3MZHA 2ELKA 2DOFA 1UCRA 2RKHA 2PLYA 2QBYB 1MMAA 3BZCA 5B5EC 4PDKA 2CO5A 3GCMA 2V1UA 2DN0A 1POGA 2JUCA 3FMQA 2DW4A 4QWQA 1B4AA 4Y15A 4FQGA 1YX5A 5DV5A 3E6MA 1R1UA 3NRVA 1Z3XA 4BJ5C 1UHWA 1ZGWA 5EZGA 1OFCX 4N0BA 3W6VA 5D5WB 2EJRA 3EUKL 2GA1A 3NARA 5JHFA 4YIRX 3OS2A 5FLXK 2LY2A 5M5YJ 4XLNF 3WG7H 2IP2A 1TNSA 4A0ZA 4ZTFA 3CCYA 3E6CC 2P5LC 2UXXA 3M8JA 3GFIA 4P96A 1FZPB 2HGCA 3N4MA 3KLNA 4ZH4F 3LA3A 1H89C 3C3WA 3OIOA 1K4TA 1YO5C 3DPTA 2IXSA 1VQ5I 1FSEA 4O5VA 5B1BH 1VQ4I 1TWHJ 2ZXIA 1O4XA 4E7IA 1B9MA 1A6QA 2WB1A 3I0TA 1YHQI 4LITA 2L9NA 3ZQIA 4I76A 3QOPA 4DJAA 3W6KB 5JLXA 3HEFA 2ZBKA 4GYIA 5TISC 1Z21A 2I5UA 2IW5A 3CDIA 1S72I 5B66C 2A69F 5FD6A 2KQRA 1OISA 1U9NA 2GOXB 4RGUA 2FD5A 3W3CA 2ID3A 3HOVJ 2XVCA 2IPQX 2Q8KA 3HKZN 2W4SA 1JJ8C 3VEPA 4W1UA 2W25A 3FKJA 4HV6A 1S29A 2NOJB 2QENA 2LBFB 4YIFA 1X4PA 3OYJA 1RI7A 2DFEA 2O3FA 4LG0A 3HB9A 4KT6A 2D2WA 3OYKA 1N77A 2R7VA 2RAEA 3V7RA 5ICCA 1I6XA 3QU6A 5CVUA 1J2XA 3O8HA 2N8GA 3G73A 2FEZA 3PIOF 2DA3A 4GGGA 2YX7A 1YI2I 1R9TJ 3ZMVA 4XR6A 4HZFA 5BPDA 1WKMA 1GV5A 2XAHA 1XSXA 4C2TA 2FU4A 1FY7A 2KMUA 3L2WA 4C3IJ 5M3FJ 1ITYA 1KU2A 3ZQCA 2H94A 2KL4A 1TW3A 1HW5A 4AIKA 3CC4I 1WZ2A 2ELJA 5TJJA 5HS7A 4XM3A 3ZMZA 2DQLA 3LQQA 4FASD 2V1DA 4RB0A 3AAFA 2HU9A 3F0CA 2NVUB 2BHYA 4IEJA 2K3FA 4AYBA 3WTSC 3PSIA 3M1CA 4UV9A 1LVAA 3E5XA 4GRIA 4PFPA 3WU2C 5DTDA 4UB6C 3Q0VA 2RNGA 1D8KA 5KVRA 1BIBA 3DTKA 1K78B 4LFUA 3HSRA 1TQIA 2FNAA 3IC7A 4LIUA 1WJCA 1WCMJ 4KJZA 1F43A 2DBBA 4XLHA 1X1CA 4AIHA 2CW8A 3L9FA 4MTDA 3K1MA 2PN6A 3IUOA 4MFDA 5L3GA 3GXOA 3S2DJ 2OQGA 4IVNA 3OR2C 1HQCA 2P7VB 2ZB9A 5E20A 2EIMH 2OD5A 1JHFA 1SD7A 3D0SA 4KT5C 4BBSJ 4Q5SF 4UY8I 2JA2A 3CO6C 2HDCA 2FOWA 3V7SA 4HX8A 1G59A 3H0GJ 2ISZA 1I50J 4XRSA 5HDKA 2P4WA 1BI0A 2WV1A 1NK3P 4R1HA 1SFXA 2F2EA 1ETXA 2F5DA 2W84A 3M1EA 2E34A 4CCOA 2HKXA 2X1CA 4YELA 1SAUA 4HLXA 1IG7A 5E18F 2ZSIB 2WY8Q 3FX3A 3HJEA 2R4GA 2RV8A 3CCVI 4II3A 5LHHA 1W4MA 5F64A 3K4CA 4C2UA
chains in the Genus database with same CATH topology
1BR1A 3AFHA 4F91B 2HDWA 2MC4A 3V42A 2X51A 3HUGB 3D5SC 2KDOA 3C2GA 3N05A 1QHHD 2M3AA 2IS1A 4HNTA 2X6WA 4CUGA 4XL9A 2IGNA 3AL0C 1X1DA 2DT6A 4NNJA 3OL3A 3H9QA 4U7BA 3KYLA 3ZQQA 4NC8A 4QPQA 2CS3A 3GBGA 2VIXA 2ZSHB 1OLTA 4B44A 3CF2A 4J01A 4PK4A 2X6XA 4F3QA 4IX7A 2PMZA 3S8PA 3VYRB 4BQNA 2XDVA 3RPUD 3QODA 5FRMA 2HNHA 2OV7A 1BOBA 2L7KA 2E5ZA 2OUMA 1UG0A 1LKXA 4F92B 1UAAA 4D1QA 4FETA 3OS0A 4JOMA 3VWBA 2CH0A 2W00A 4XMYA 3VDXA 5LFAA 3TBIA 3OOUA 2LC2A 2HVQA 2Z2SB 3DU5A 4X0GA 4PJJA 3H5RA 4AVZA 2HVRA 3LL7A 2QKMB 2DOAA 1Y56A 3BG6A 3HOTA 4E4HA 3MKWB 3OYNA 4YRVA 2PJRB 4XLEA 4XQFA 2HZDA 2OC6A 3OWTA 2LY1A 2VXDA 4ZJZA 4E7LA 3QYBA 4XONA 4BJ6C 3TMOA 1R6RA 3PL8A 2ZFUA 3LFUA 3UNGC 4JQFA 4HRIA 4DBQA 4ZTJA 5HLTA 3TL4X 2VKDA 3L2QA 2KRHA 2VKHA 3SEQA 2VLAA 2LBFA 4HG2A 2VJ5A 4ZYAA 3PNTA 2IS2A 3D5RC 3H0DA 2VXZA 4H4KC 1J09A 1FMWA 4BEHB 1WJAA 3EUAA 2VQGA 2KRCA 2R7OA 3SYTA 2I8DA 3W2AA 2MYSA 2JUGA 3HPHA 5LD2C 4P5OA 4KITB 1V5EA 2VB6A 1D1CA 4BACA 4CA0A 3G2BA 3OY9A 4Y33A 1MW7A 2E5NA 3ZGKA 3RTRA 3ZRGA 1WJBA 1D0XA 2ZXHA 2JSPA 1YX3A 3FBNB 3CJQB 2CUZA 3S3MA 1LVKA 3K4JA 4BS9A 3FDYA 3CESA 2WAFA 3HXLA 1LDKB 2DT7B 1E0EA 2HPIA 4BU2A 2QKLB 3QOEA 4BEHA 4IKFA 4RLQA 2CMPA 3S3OA 4CCKA 2VPLA 2R7TA 3A1YA 3ZXSA 1D0ZA 1ERDA 3OYCA 3OYLA 3OL4A 1K6YA 2LG4A 4DOZA 5FROA 3H9GA 5CPRB 2VJIA 2DJIA 3DKXA 1DQUA 1X19A 2MFZA 4PJMA 3H35A 2VQLA 3BCAA 3K4MA 2M0MA 4PJNA 4RMNA 4E6KG 2R7XA 2V26A 2KPMA 3ONQA 3OS1A 4HSTA 2XF5A 3OYMA 2W1OA 3S32A 3BLYA 3HKZA 3L2RA 1WJ5A 1GLNA 3DPUA 4BQOA 3K4BA 2VASA 4RM2A 1V5GA 4Y4RA 4CCJA 4B47A 3K4KA 3K4LA 4CCNA 1MMNA 2LREA 1ZELA 3LMMA 2L5QA 5CQGA 2WAQA 4E7KA 1Y6IA 3OYEA 4C9YA 4HPQA 4F55A 3LSKA 4II2A 3A4CA 1D1BA 2R7WA 2E60A 3IAS2 2KHMA 2WADA 3K70D 4XNFA 3SDBA 1W36C 3K4NA 3K6GA 1X1AA 4BUPA 2WBMA 2V6EA 3CZ6A 1WFXA 2BOLA 5KCMA 3VYTB 4ANJA 2IS6A 3E1SA 4PSXA 2KLOA 3LSIA 4F93B 4F52A 2F4IA 4MLOA 4E7SA 2W82A 4HNUA 2LH9A 3K70C 3DTEA 4PUSA 2V1NA 2K5CA 4RLFA 4Y3OA 2UV1A 4U87A 2XF6A 4IQ4A 2V9KA 1D0YA 4CZCA 3FBIB 3HOSA 3L2UA 1V5FA 3OR1C 3K10A 3W2WA 2WA0A 1IRXA 4C30A 2VJJA 3CJRB 3PSFA 2UUZA 4PJLA 3S3NA 2IGMA 3C2HA 1TT0A 3PJRA 2Y0SA 1N75A 2RREA 3NWSA 4RM3A 2VJ4A 4N4NB 4BXFA 3HPGA 4XKWA 2CV1A 3MMYB 1T0FC 2CW7A 2LYCA 2CUJA 3OYGA 1WJDA 4XKBA 4N4OB 1DGRM 4NC7A 1AA7A 5TGTA 3OYFA 2LRDA 3DU6A 1SFKA 2R7UA 2X1EA 5CQEA 1PJRA 1WJFA 3VYUB 3DWLE 1FMVA 2WAEA 2PJRA 4BJTA 1MMGA 1YE9A 4CCMA 1N78A 3IP4B 2W7NA 3KX2A 3OMYA 2O5RA 2BVMA 4LIVA 1MNEA 1G8XA 1EA3A 4OAZA 4XKVA 2MD0A 4XKCA 3QYFA 3LSMA 2XC7A 1LFPA 2R7RA 2VQHA 4PSWA 3CMMA 1W36D 1BR4A 3MD2A 2HQAA 3DEEA 5CKTA 1MMAA 2XF7A 3D5LA 4XN3A 2M4GA 4IQJA 4DBRA 2HVSA 3OYAA 2IGOA 2JVGA 4BE0A 5HNFA 4E7ZA 1PYVA 3OYBA 3NWTA 1Z3YA 1YX5A 1Z3XA 4BJ5C 2R7QA 1NG7A 3U21A 2X1DA 4B3XA 3IAM2 2X6YA 4EATA 3EUKL 2XSJC 5JHFA 2CV0A 3VSLA 3OS2A 3W2VA 2LY2A 4CSWA 3BCBA 3H5NA 3OYIA 4HSRA 1NG6A 4ZTFA 4J00A 3EUHC 4ITVA 3M8JA 3I9V2 3A2KA 2VQCA 2BVLA 3PNVA 4CCLA 4HEA2 3FHNA 3AKZA 3J7AY 3DPTA 2IXSA 1T95A 4XLAA 4LG3A 2HPMA 1U0JA 4XOTA 1DGWY 5KHDA 4BE1A 2ZXIA 2KP6A 4E7IA 1OR7C 1VZ0A 2M7AA 4R79A 2WB1A 3SZGA 2IGKA 3H9JA 2K9LA 2L9NA 4LITA 4DJAA 4D9JA 2IS4A 3LSGA 4QPOA 2RQQA 1Z21A 2BW3B 2KQRA 2GOXB 4KISA 3W3CA 3BG7A 1Z7LA 4NQWB 3QYEA 4DGWB 2Z1DA 2W4SA 3FKJA 3SEZA 2NOJB 3VYSB 2K9MA 3MKYB 3BC8A 2LBFB 2FUG2 2AQFA 1X4PA 3OYJA 4KT6A 3OYKA 2R7VA 1N77A 3OYDA 1KONA 3OYHA 5KNLA 3HC7A 2DXIA 3CP2A 3I3LA 3DQVC 3CP8A 4ZDOA 4XR6A 2X85A 1HA8A 4BQQA 4C2TA 2KMUA 4NUBA 3L2WA 3S93A 1WJEA 3ZCOA 2KZVA 1TZLA 4PFOA 5FRNA 1JI8A 2E1MB 2KL4A 3E0JB 2V4JC 2R7SA 3RCOA 2ELJA 4XOPA 4XM3A 4IZZA 3PUBA 2A6TA 4FASD 3F9KA 2P0WA 3DPLC 2XAUA 2HU9A 2WY7Q 4XLFA 4BE2A 3LSHA 4YEJA 4XN0A 4AYBA 3PSIA 3M1CA 1P9QC 4GRIA 4CH7A 4AU7A 4PFPA 1UELB 2A5WA 2M4KA 3AL0B 3MKZA 3VSKA 3HL2A 1QHGA 4BDYA 2RNGA 2AQEA 2CFOA 3PNYA 1DP3A 3DTKA 3L2VA 2Q1ZB 4ZDLA 4LIUA 4BGDA 1WJCA 4E7JA 4KJZA 4G6TB 2L2OA 4B43A 4XLHA 1X1CA 2F6CA 3RSNA 2CW8A 5HVQC 1X1BA 2V7FA 3EPZA 4ZC3A 4OWRB 4E7HA 3IUOA 2Z16A 2JVHA 4DIQA 2VL8A 4BL0B 4ZDPA 3KEYA 3OR2C 1QU3A 2M7BA 4XORA 5HOOA 3UR3C 2UWMA 1MMDA 2MABA 2Q2EB 1MNDA 2E1MC 2JA2A 3H5AA 2GOMA 4BDZA 3DLAA 3PFYA 2CV2A 1S9HA 2K3PA 2L9SA 1G59A 4B48A 4XLCA 1BR2A 2BW3A 4OAYA 3OIPA 3RQ4A 1X4OA 3DTIA 4CCOA 1D1AA 3DKYA 3ZR8X 2X1CA 3OIQA 5HNHA 4YELA 1SAUA 2DCEA 2LOOA 2ZSIB 2F5VA 2WY8Q 3HG9A 2R4GA 4II3A 3K4CA 4C2UA 4P1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL4 A;  3OL3 A; 
#chains in the Genus database with same CATH topology
 1YW9 A;  3G3Z A;  2DDA A;  3M9A A;  2HDW A;  2EFO A;  3TO6 A;  3TP3 A;  1STZ A;  1T2K A;  2JA6 J;  2KDO A;  2FQ3 A;  1Z7U A;  5FLM J;  2EA2 A;  1JT0 A;  1TL8 A;  1APL C;  2GIV A;  2OZ6 A;  3SJM A;  2IS1 A;  2PI0 A;  3G1M A;  2OBP A;  2HDD A;  2ZFW A;  2BV6 A;  3OL3 A;  5FFX A;  3ABU A;  4U7B A;  5GPA A;  5H20 A;  1Z05 A;  4NC8 A;  1XTA A;  1S8N A;  5AIP A;  4FTH A;  2NVX J;  5D8K B;  1JJ6 C;  4JYK A;  4I01 A;  1PUF A;  3OV8 A;  5F0H A;  1Q1V A;  3JSP A;  3S8P A;  3KPH A;  3E6D A;  3RPU D;  1XGS A;  1EF4 A;  2L7K A;  1UG0 A;  2LLK A;  2NS8 A;  4EVI A;  4MHG A;  1P6R A;  4B1R A;  4XK4 A;  2W00 A;  5LFA A;  1K61 A;  3F8M A;  1XB4 A;  1LDJ A;  3OOU A;  4KUM A;  2XRO A;  2LKP A;  2PFB A;  1ODD A;  3DU5 A;  5FKN A;  5H2F C;  1WHU A;  2R0Q C;  1O7L A;  3VPR A;  5J4V A;  3RJP A;  2QKM B;  4C3H J;  2DOA A;  2NNY A;  2DPU A;  1XMA A;  1GHC A;  4A5N A;  3OSF A;  2WC2 A;  2JPC A;  5C3E J;  2KIM A;  4XQF A;  1JUP A;  5CLS A;  2DA1 A;  2I10 A;  1WH5 A;  3QQA A;  4MFE A;  5D6F A;  3CCU I;  2IJL A;  2E1N A;  4HF1 A;  1X2M A;  1VQ9 I;  5IPA A;  4BQA A;  1JKP C;  1MGT A;  3QYB A;  3PL8 A;  2EFW A;  3F8F A;  2YU3 A;  2JA5 J;  2EFN A;  2VPR A;  3LFU A;  5K7H A;  4R8H A;  3LA7 A;  4JQF A;  2NS0 A;  2ZME B;  4IJA A;  2KRH A;  2VC1 A;  2Z9O A;  1FTZ A;  2Z3Y A;  3F6O A;  3SEQ A;  2VLA A;  1FOX A;  4ZYA A;  1RR7 A;  2R7F A;  4L9N A;  4EM2 A;  3D5R C;  3H0D A;  2VXZ A;  4IHT A;  1FMW A;  3VB2 A;  2ECC A;  2R7O A;  2X48 A;  3P9K A;  1EKE A;  1Z9C A;  2K9S A;  2XGD A;  3IH2 A;  1D5V A;  3KE2 A;  4KIT B;  2MH2 A;  1V5E A;  3LAP A;  4BAC A;  1MW7 A;  1FOW A;  3BOQ A;  5C4X J;  3N97 A;  4BHB A;  3KET A;  5DUI A;  2JSP A;  3BT9 A;  4M9Z A;  5E3M A;  1A35 A;  2XPW A;  4RGX A;  2L7Z A;  1SMY F;  3JAM Z;  2H1K A;  3R4K A;  3S3M A;  5IT9 K;  2DTR A;  3H92 A;  3RI4 A;  2L4M A;  2K86 A;  4G6Q A;  3CES A;  3K0L A;  1B8I B;  4RDU A;  3GW2 A;  4BU2 A;  2QKL B;  3LOC A;  2EZH A;  3QOE A;  1XGN A;  1B8I A;  2AS5 F;  2ZXJ A;  5CVI A;  2VPL A;  2G7H A;  3BRO A;  2PX9 A;  4IO9 F;  5EZH A;  2X6O A;  1ERD A;  4G7Z F;  3OYC A;  3OYL A;  2B9S A;  3C1D A;  3HHH A;  3F8N A;  1MKM A;  1K6Y A;  2LG4 A;  2VJI A;  3C2B A;  2BXY A;  1HC8 A;  1R4N B;  4LOC A;  4RAG A;  1ETQ A;  1W5S A;  3K4M A;  4L0Z B;  5E1X A;  2R3S A;  2XRN A;  3DF8 A;  3ONQ A;  1IRF A;  2OAZ A;  2XPU A;  3CDH A;  2E2J J;  1IRG A;  2O7O A;  1YJW I;  4HST A;  2H6C A;  2CSO A;  3S32 A;  3L2R A;  1R5I D;  1B59 A;  1IXR C;  1FP1 D;  1WJ5 A;  3BQZ A;  1RNL A;  1S7O A;  2ZME C;  3ERE D;  1V5G A;  4FE4 A;  3GTJ J;  1F9N A;  2BHZ A;  3CTA A;  2WAQ N;  1LDD A;  2OZU A;  4CCN A;  3CLO A;  2LRE A;  3CCE I;  3GWZ A;  4AWX B;  2B63 J;  1IUY A;  4I6Z A;  3ZQ7 A;  4E7K A;  4UVC A;  3OYE A;  1WVR A;  4HPQ A;  3KLO A;  3W6J B;  4II2 A;  2R7W A;  2E60 A;  1QZY A;  3I53 A;  1SVM A;  5E17 F;  5IYB J;  3K70 D;  1RES A;  4AD9 A;  3K4N A;  1W36 C;  4Y13 A;  1HOM A;  1KYW A;  2WBM A;  5FKK A;  2IS6 A;  4ANJ A;  4F93 B;  1UZC A;  5AIQ A;  1B72 B;  4OIQ F;  1G6N A;  4IRI A;  3I54 A;  4E7S A;  3K70 C;  2J5P A;  2DMN A;  3DTE A;  3JTG A;  4ENK A;  3ZN1 A;  1JTX A;  4XSZ F;  4NBQ A;  1FBU A;  2BY3 A;  1Y0N A;  2V9K A;  5LEK A;  4QSH A;  3L2U A;  2CQQ A;  4FIS A;  2DU9 A;  2DOD A;  4A3D J;  2K9N A;  3A0B C;  3K10 A;  3U1D A;  2HOA A;  5F04 A;  2WA0 A;  4C30 A;  2BYV E;  1YRN A;  5CYV A;  4G7H F;  4OU0 A;  4PJL A;  3C2H A;  3CLQ A;  1TT0 A;  3FMR A;  3PJR A;  4YFX F;  2VJ4 A;  4B4C A;  3CCJ I;  3HPG A;  5GAH J;  4E70 A;  1UJ8 A;  1VI0 A;  5FD5 A;  1JE8 A;  1EH8 A;  2CUJ A;  3OYG A;  2LSO A;  2O03 A;  2HOS A;  1K83 J;  3TOB A;  1DGR M;  2H09 A;  3NEU A;  4L9V A;  2DYR H;  4HA8 A;  2R5Y B;  2DFF A;  1A5J A;  1FP2 A;  1SFK A;  4WCG A;  4X6A J;  2L0K A;  2H1L A;  3QRF F;  4L18 B;  3Q0U A;  4LMY A;  2CYY A;  1DU6 A;  1WGX A;  1JKR C;  3M07 A;  5IY5 H;  5GPC A;  5C44 J;  4A3J J;  3CUQ C;  3RYR A;  2Y9Z A;  3GZ6 A;  1B9N A;  1MMG A;  3KX2 A;  4EJW A;  3IKT A;  2BVM A;  1G8X A;  3F3X A;  1P2F A;  5L3F A;  3PUF A;  3I71 A;  3K1N A;  4XKC A;  3IV5 A;  1S5L C;  3FIW A;  4MO7 A;  2XC7 A;  2R7R A;  4Z6Y A;  1H88 C;  4CXF A;  2Y0S N;  4PSW A;  2E1C A;  1YLF A;  1BR4 A;  5JFR A;  3D5L A;  2BE5 F;  4XN3 A;  5DCM A;  1G3Y A;  1OCO H;  4IQJ A;  2IGO A;  1Z0X A;  3NWT A;  1FBS A;  1OYY A;  1Z3Y A;  5K5R A;  3RZO J;  2HQN A;  2K40 A;  3U21 A;  4Q48 A;  3RKX A;  2X1D A;  5K5O A;  3CMY A;  5LGN A;  4BBR J;  4EAT A;  2EV0 A;  2XSJ C;  1T6S A;  4S0H B;  4JX6 A;  2CV0 A;  1BI1 A;  3VSL A;  2QUF A;  3LSJ A;  2L7M P;  3OYI A;  2DAO A;  3CQZ J;  1NH3 A;  2W57 A;  4HSR A;  4EQQ A;  1KQ9 A;  3EUH C;  3GME A;  2JMW A;  5E8I A;  4HLY A;  2BY0 A;  4ENN A;  4GFB A;  4ABZ A;  3A2K A;  1P92 A;  1HKS A;  3HRM A;  4CCL A;  2VKE A;  1GUU A;  4HEA 2;  3FHN A;  4KA4 A;  4BNC A;  1OKR A;  3I56 I;  3RKW A;  1GV2 A;  3P7N A;  2L02 A;  4LG3 A;  2DA6 A;  5BMZ A;  1YRN B;  1U0J A;  4U7D A;  4XOT A;  2PEX A;  5KHD A;  3S16 J;  4HYE A;  4RGS A;  5M5X J;  2M7A A;  4M3G A;  3TKY A;  4GCV A;  1WI9 A;  3EUH A;  3BG5 A;  4GXO A;  4N9I A;  4D9J A;  2L9V A;  4AYB N;  2CJJ A;  4UV8 A;  3O2P E;  2E1O A;  3V7C A;  1LB2 A;  3I58 A;  3I64 A;  2M2E A;  5FO5 A;  4KIS A;  1VQM I;  1B72 A;  4ON0 A;  2M9H A;  4IF4 A;  1IRZ A;  3VYS B;  1IN6 A;  1BBY A;  2K9M A;  1HCR A;  2DT5 A;  3BC8 A;  1E2X A;  2A6H F;  3GLX A;  5K7F A;  1IZ1 A;  2QSH X;  1SFO J;  5IOY A;  2VBZ A;  3OYD A;  3JRA A;  1IO2 A;  3HOY J;  1R1T A;  5J1U A;  3GEZ A;  2DXI A;  2G7U A;  3DQV C;  4ZDO A;  1OPC A;  1O3Q A;  2RQP A;  2X85 A;  5IYD J;  3IRQ A;  3KYD B;  2KJC A;  5JR3 A;  4NUB A;  1Z91 A;  3S93 A;  4HQM A;  3S15 J;  3ZCO A;  4BH9 A;  1TZL A;  4HOB A;  1U8B A;  2E1M B;  2DA5 A;  1ZRC A;  3WTZ A;  3WGI A;  3D1N I;  2KRF A;  2R7S A;  3KP6 A;  2YPR A;  3CCQ I;  1KU3 A;  4IZZ A;  4IOC F;  1D5Y A;  3PUB A;  4IL6 C;  3V4G A;  4IHS A;  1A6I A;  3DPL C;  2L4A A;  2XAU A;  1RKT A;  3GFM A;  4M6Y A;  4XLF A;  4YEJ A;  3TW7 A;  1ON1 A;  3IH3 A;  4MIM A;  4EMS A;  2IRF G;  1OJL A;  5JVT A;  2LD5 A;  4CH7 A;  3F6V A;  1UEL B;  4H0E A;  2A5W A;  3AL0 B;  3VSK A;  3HL2 A;  4KN4 X;  1KZH A;  2F5C A;  2CFO A;  3PNY A;  5K1Y A;  2ESH A;  3WTT C;  4IHV A;  4M6V A;  3L7W A;  1FYL A;  2LVS A;  3S1N J;  2MA3 A;  1ETW A;  1V3F A;  3PQJ A;  4E7J A;  4G6T B;  1F5T A;  1HDP A;  2F6C A;  2TDX A;  1X1B A;  2V7F A;  4LGW A;  4E7H A;  3E6B A;  2QCO A;  1YQA A;  2Z16 A;  4EJV A;  2CQN A;  2VL8 A;  4BL0 B;  2R5Z B;  1WWX A;  4ZDP A;  3KEY A;  2F5E A;  1QU3 A;  2NAZ A;  2ICW G;  2M7B A;  2QQB A;  3HZJ A;  2EFP A;  3S1M J;  3L2C A;  2X0L A;  5HOO A;  4G7O F;  3WGH A;  4OOI A;  2MLG A;  2PMH A;  2Q2E B;  1MND A;  2ZKZ A;  4BDZ A;  2CV2 A;  1ZGA A;  2K3P A;  4L5J A;  1W5T A;  1FJL A;  1XMK A;  1BR2 A;  4XLC A;  3OIP A;  1WQ2 A;  3WG9 A;  3ECO A;  1RET A;  1RR8 C;  3GTO J;  1VQL I;  4P55 A;  4EGZ A;  3AG3 H;  3JRB A;  1DPR A;  2L7F P;  4S05 A;  2NYX A;  2PMZ N;  1Z6R A;  4OMZ A;  3DKY A;  2QBY A;  2H8W A;  4KNY A;  3GX4 X;  5HNH A;  2KIU A;  3FHZ A;  1UST A;  4CYD A;  1OCZ H;  2M8E A;  2XKP A;  4XSX F;  2F5V A;  3HG9 A;  2ME6 A;  1GVJ A;  2FML A;  2M45 A;  1IGN A;  1CQT A;  1QRY A;  2VT2 A;  3TO7 A;  4P1W A;  3AFH A;  4F91 B;  1ZRF A;  3D5S C;  2UZK A;  3EET A;  3FXM A;  5JLW A;  3EQL F;  3N05 A;  3JW4 A;  4U0Y A;  3FIS A;  1QHH D;  1P7I A;  2ZNY A;  3KP7 A;  4HNT A;  3HRU A;  1U8R A;  4CUG A;  2P6T A;  2IA1 A;  4A3I J;  1X1D A;  4NNJ A;  5J40 A;  3ZQQ A;  4XRF A;  2B0L A;  4ESF A;  1W0T A;  4UXN A;  2CS3 A;  3WHC A;  1SAN A;  2QF7 A;  1EH6 A;  5DYM A;  2VIX A;  4NC6 A;  4B44 A;  2XAF A;  3B02 A;  1S7A A;  3CF2 A;  3FXU A;  4PK4 A;  3ZQF A;  4DW6 A;  2DYS H;  2X6X A;  4J01 A;  1SEU A;  4A3C J;  2MD5 A;  2PMZ A;  1LFB A;  1UG2 A;  4M74 A;  4BQN A;  5FRM A;  1LE8 B;  3TDZ C;  2E2I J;  3WHB A;  1VTN C;  4F92 B;  3OS0 A;  2CH0 A;  3GO5 A;  4KIF A;  2JPB A;  5F08 A;  1W7P D;  4A6D A;  3VDX A;  1MJ9 A;  1MMS A;  2A05 A;  4D7M A;  4NB5 A;  2CUE A;  1LEA A;  2LC2 A;  1FYM A;  3S2H J;  4B3A A;  2Z2S B;  4CO8 A;  5DCM B;  2F48 A;  4I0B A;  4X1E A;  4BXU A;  1IV8 A;  2HVR A;  4A0Y A;  2KIF A;  2R7D A;  1ENH A;  3MKW B;  1AHD P;  2W24 A;  4XBF A;  3KZI C;  3J80 K;  2PJR B;  2EIN H;  4XLE A;  5DM6 F;  2B7E A;  1XG1 A;  2WTE A;  3JAM K;  2IT0 A;  1U5T C;  2OC6 A;  2XB0 X;  5BNG A;  4WX9 A;  2FQ4 A;  2EA4 A;  1W5C C;  2M34 A;  4ZYE A;  4E7L A;  4KFC A;  1YTY A;  2AXL A;  1R6R A;  1X3U A;  2ZFU A;  3IHU A;  5HLI A;  2ETH A;  2HTJ A;  1XSV A;  3UNG C;  1W0U A;  3FM3 A;  4HW0 A;  4AUX A;  1G2H A;  5HLT A;  2EIK H;  2XGC A;  3TL4 X;  2VKD A;  1HW1 A;  3GTG J;  2VKH A;  4A3E J;  2GZW A;  2EFQ A;  5E8G A;  3T0Y A;  3SHF A;  3GTK J;  5HDN A;  1TWF J;  4BEH B;  2VUM J;  1WJA A;  3EUA A;  3EYY A;  2KRC A;  2CW0 F;  3SYT A;  2I8D A;  3W2A A;  3HPH A;  4UUS B;  1HDD C;  3Q5F A;  1MDM B;  4HAM A;  2L54 A;  4Y33 A;  3BPV A;  3ZQG A;  3RTR A;  2Q2E A;  5DCF A;  5BPI A;  4WXH A;  3HIF A;  1D0X A;  2ZXH A;  4K2E A;  3OSG A;  3R6S A;  1YX3 A;  2DA4 A;  3FBN B;  5GAE J;  1R36 A;  5IT3 A;  5E79 C;  2CUZ A;  1QPI A;  3QP5 A;  2QGU A;  1OCP A;  1UHM A;  3WTU C;  4U88 A;  4BS9 A;  2GXB A;  1KQ0 A;  2WAF A;  3QAH A;  4BKX A;  4UUS A;  3SZT A;  1J0R A;  3L1P A;  3QPS A;  2W85 A;  3G71 I;  2YSR A;  4MEY F;  2Z33 A;  1ETK A;  4BEH A;  1AKH B;  5M3M J;  2R7T A;  2MC3 A;  3OOP A;  1ZQ3 P;  2ELH A;  3M8E A;  1P4A A;  1D0Z A;  1JUS A;  3E7L A;  4IRH A;  1T56 A;  1GDT A;  3CUO A;  3OL4 A;  3DV8 A;  4HNV A;  4DOZ A;  5KAI C;  2HQR A;  3LAJ A;  3LST A;  1DQU A;  5KK1 A;  4PJM A;  3H35 A;  2VQL A;  3BCA A;  2V9V A;  5LGU A;  3PFI A;  2V1X A;  1RPW A;  2R7X A;  4KMU X;  3ZQL A;  2KPM A;  5ICF A;  3ML6 A;  4RB2 C;  2Y69 H;  2W1O A;  4GO1 A;  3ZMT A;  3HKZ A;  1PP7 U;  1ZAO A;  5HS9 A;  1I5Z A;  3K4B A;  4RM2 A;  1I6H J;  1ORK A;  2F4M B;  3SQN A;  2QQ8 A;  2NXN B;  3BR0 A;  3WTY C;  1UHS A;  4HV5 A;  2LF7 A;  1MMN A;  3KCC A;  1ZEL A;  5JI6 A;  2L5Q A;  3AG2 H;  5CQG A;  1MSE C;  2A3S A;  4S04 A;  3E3V A;  2YX4 A;  2HEO A;  1IN4 A;  2O0Y A;  2KHM A;  2V79 A;  3IAS 2;  2BEO A;  3K6G A;  1X1A A;  3GF2 A;  2V6E A;  5KCM A;  3VYT B;  3ZP5 A;  3U2R A;  1HKQ A;  4F52 A;  2E35 A;  5EYR A;  4MLO A;  2UXN A;  1R58 A;  2P5K A;  4UUV A;  4HNU A;  2LH9 A;  2XGX A;  5E3O A;  3FXK A;  2M5W A;  3BDD A;  5E3L A;  1ZG3 A;  2CQX A;  4HDU A;  2DA7 A;  5L3B A;  3TW6 A;  1JGS A;  5F1J A;  3ABK H;  1ZG5 A;  5D5V B;  3FBI B;  3HOS A;  1X2N A;  1LQ1 A;  4OIN F;  1MH3 A;  2RGV A;  3H3Z A;  3OR1 C;  1QBJ A;  1RUN A;  4LG0 B;  1FT9 A;  2ZCW A;  3J7Z I;  1REP C;  4BY7 J;  2BY1 A;  3P9C A;  2H8R A;  3HGG A;  3PSF A;  3FZV A;  2UUZ A;  4IHY A;  4CDG A;  1U5T A;  1C0W A;  2IGM A;  2Y0S A;  1QZZ A;  3HYI A;  5FKL A;  1N75 A;  3NWS A;  3GYH X;  3X2Q H;  4N4N B;  2QYO A;  3HBL A;  2CW7 A;  1R7J A;  5ICE A;  3UKG A;  4V19 K;  4XKB A;  3ZQH A;  3LA2 A;  4NC7 A;  1ZTR A;  1AA7 A;  1TT5 B;  1RIO H;  5GAD J;  4A5M A;  3MEX A;  5TGT A;  2LRD A;  3DU6 A;  4A3B J;  2JWT A;  3CD6 I;  2ADU A;  3VYU B;  3DWL E;  4M6X A;  3FWE A;  4KIG A;  2WAE A;  2LP0 A;  1ONV A;  2R92 J;  4A6E A;  1JHH A;  3L00 A;  5J1Y A;  2DLL A;  4A12 A;  2A07 F;  4KDP A;  1UFM A;  5C4J J;  2O5R A;  1EA3 A;  2Y75 A;  2CGP A;  2K7L A;  5J47 A;  1QPM A;  1PVE A;  4OAZ A;  1MBG A;  1XD7 A;  2HWV A;  1VQP I;  3LSM A;  5A2Q K;  2JT1 A;  4B8X A;  1XSD A;  1VQK I;  4CZZ A;  1W36 D;  5EEA A;  5CKT A;  1E3P A;  1UMQ A;  2XGE A;  3MQ0 A;  1R1V A;  1HSJ A;  3CUQ A;  3J7Y J;  2XSD C;  4M71 A;  1XDS A;  5DUK A;  4J19 A;  2M4G A;  2EZK A;  4PCQ A;  3OYA A;  2JVG A;  5HNF A;  3LFK A;  4E7Z A;  3OYB A;  2XAG A;  1FPQ A;  3DCF A;  1EV7 A;  2Y9Y A;  2R7Q A;  4FX4 A;  3JRE A;  2X6Y A;  2EBI A;  1O7F A;  1FEX A;  2DK8 A;  1IC8 A;  4ENM A;  3W2V A;  3KZY A;  1LPQ A;  1ACI A;  2BZT A;  4CSW A;  4RB3 C;  3H5N A;  4XRS G;  2HXI A;  2QVO A;  2ZJP F;  2HKO A;  3QPH A;  2GM4 A;  3FXR A;  3ABL H;  4XIC A;  2FBI A;  3HOU J;  1A31 A;  2XUB A;  4IXA A;  2VQC A;  5HLH A;  2LMD A;  3PNV A;  1SFE A;  1OCT C;  1EH7 A;  3AKZ A;  2VKV A;  9ANT A;  2DMQ A;  4XLA A;  3CCR I;  2K9Q A;  1BOA A;  2XPV A;  3LWF A;  2DOE A;  1DGW Y;  3BR6 A;  4BE1 A;  3WOD F;  4FT8 A;  1R4M B;  1WH7 A;  5JHU A;  1OR7 C;  1VZ0 A;  4R79 A;  2C6Y A;  3SZG A;  2IGK A;  3WTX C;  2K9L A;  1OCR H;  1JUM A;  4N9H A;  2A6E F;  1B1B A;  5BOX A;  2DMP A;  3M3Y J;  2EB7 A;  4DQ2 A;  2K02 A;  2P5V A;  1O57 A;  2RQQ A;  4RGR A;  4A3M J;  3EYI A;  3JRH A;  3BR3 A;  5J1R A;  4NQW B;  1Z7L A;  4M9S A;  1BL0 A;  2Y48 A;  1SMT A;  3SDG A;  2EWN A;  3ASO H;  3SEZ A;  3ZMU A;  3KZZ A;  2K4J A;  2X4H A;  5D4R A;  2FUG 2;  2AQF A;  5K5Q A;  5EEG A;  1XCB A;  3MAJ A;  4WK8 F;  3BTJ A;  3OYH A;  3E5Q A;  5KNL A;  3G6E I;  1NTC A;  1Y1W J;  3HC7 A;  3DFG A;  1S6L A;  1VF9 A;  4ESJ A;  3I3L A;  1NK2 P;  5F0C A;  2FBK A;  3CP8 A;  3CC2 I;  1XC5 A;  2M1B A;  3COA C;  1HA8 A;  3VOE A;  2PJP A;  3O6B B;  4DNC A;  3LSP A;  1ZGJ A;  3IL2 A;  5IYC J;  2E7W A;  2KZV A;  3E5U A;  2KIQ A;  2MBF A;  3BTC A;  4QIW N;  3F8C A;  3JR9 A;  2V4J C;  4ZZL A;  1MIJ A;  3RCO A;  5HOD A;  3KFW X;  2XAQ A;  3BR2 A;  2XAS A;  2GA2 A;  1ZLK A;  1F36 A;  5KAF C;  5HS8 A;  1MDM A;  1FX7 A;  1NHA A;  1IAW A;  2Y30 A;  3GFJ A;  3A02 A;  3HSE A;  2RVC A;  2RN7 A;  4BE2 A;  1L3L A;  1MZB A;  1BN5 A;  4HF0 A;  3BZK A;  1P9Q C;  2JA7 J;  4AU7 A;  5GAG J;  3HOX J;  4CHU A;  2M4K A;  1BC7 C;  4A3L J;  2LKS A;  4MGR A;  2ACJ A;  1SAX A;  1BA5 A;  3S14 J;  2PG4 A;  1YJN I;  4DYC A;  4BDY A;  2RDP A;  1X3Z B;  2EV5 A;  2XRL A;  2AQE A;  3L2V A;  2Q1Z B;  3KP3 A;  1OYW A;  1J9I A;  3FKI J;  3C18 A;  3JSO A;  3H3U A;  3PM1 A;  2R7Z J;  4XRM A;  1AKH A;  4B43 A;  2WWY A;  1KGS A;  2JTV A;  5FKM A;  3RSN A;  2HTS A;  2LY9 A;  5HVQ C;  4DZJ A;  3EPZ A;  2EPF A;  4OWR B;  1U9O A;  3BTL A;  2JA8 J;  3HOZ J;  2JVH A;  4DIQ A;  1FYK A;  1ZKG A;  1KQ8 A;  3BG3 A;  3IKV A;  3JTH A;  2QWW A;  5LHG A;  1FIP A;  2UWM A;  4I0A A;  2DQR A;  3FK6 A;  4L5E A;  2FBH A;  1XMX A;  4JX5 A;  1U2W A;  2YR2 A;  3BR5 A;  3PFY A;  1HW2 A;  2L9S A;  4G6D A;  4B48 A;  3J7A O;  2BW3 A;  3RQ4 A;  2FF4 A;  4PJ0 C;  3TQN A;  2QZ8 A;  3WE3 A;  1YJ9 I;  1Y39 A;  3DTI A;  3CC7 I;  3V8J A;  1PUE E;  2DK5 A;  4A93 J;  5IP7 J;  1D1A A;  4DZP A;  3ZR8 X;  5EEH A;  4IHW A;  3ULQ B;  4O3M A;  4UVA A;  1LUJ B;  3MZY A;  4A3F J;  2HOT A;  3O3K A;  3ZN0 A;  1T33 A;  2O61 A;  1USS A;  2D1V A;  3HRT A;  2TCT A;  1XDU A;  1Y1V J;  3ABT A;  3NQO A;  3I5U A;  5BQT A;  1TC3 C;  2MC4 A;  3V42 A;  4D7N A;  5LEJ A;  1TWA J;  1IXS B;  1T0F A;  3HOW J;  1BM9 A;  1TLH B;  1I39 A;  2VT3 A;  3C2G A;  1R71 A;  1FTT A;  3SFI A;  1A36 A;  4HDV A;  3T8R A;  1K78 A;  2M3A A;  1IF1 A;  1W7P A;  2VE9 A;  4XL9 A;  2DT6 A;  3KYL A;  2VBY A;  4PZJ A;  1TQP A;  5ERI A;  1T38 A;  4I98 B;  3PO3 J;  3GBG A;  5J8C A;  2KFD A;  3BY6 A;  2A68 F;  2ZSH B;  1OLT A;  5K7Z A;  3GUD A;  3FXJ A;  4F3Q A;  3BPX A;  4IX7 A;  1CGP A;  3DKW A;  4UVB A;  2ME0 A;  4KIB A;  2V9P A;  3QOD A;  4L9T A;  2O6G E;  3HGY A;  2OV7 A;  2CRG A;  1BOB A;  2E5Z A;  1LKX A;  2A61 A;  1UAA A;  4D1Q A;  1XX5 A;  4I99 C;  3VWB A;  4LD5 A;  1U3E M;  4XMY A;  2KZG A;  5J8F A;  4A3G J;  2NVY J;  3TBI A;  1H8A C;  3TO9 A;  2MG4 A;  2HI3 A;  2DJN A;  3BJA A;  2F4O B;  4ETS A;  4PJJ A;  3H5R A;  5IP6 A;  3LL7 A;  1FWZ A;  1Y56 A;  2Y2Z A;  2LKX A;  1JGG A;  3HOT A;  1MBK A;  4E4H A;  1J5Y A;  1MBF A;  3RPU A;  5IT9 Z;  4RAF A;  4YRV A;  4NHJ A;  3ERM A;  1M1E B;  2HZD A;  4LJZ F;  1OQY A;  4DYR A;  2QSG X;  2M30 A;  2VXD A;  2BBY A;  1YFH A;  1CF7 A;  5HDG A;  4XON A;  3BJ6 A;  4G9Y A;  4NDL A;  4V2F A;  5BS6 A;  3WU1 B;  1MBH A;  2IA2 A;  2PQ8 A;  4WXD A;  1U5T B;  3K2Z A;  3BWG A;  4ZYG A;  2IVM A;  4RS8 A;  1TNT A;  1XGM A;  5F1R A;  2LBF A;  2KIS A;  3ISP A;  4HG2 A;  3PNT A;  4D5F A;  5L3C A;  2XHK A;  3I4P A;  2IS2 A;  1JTY A;  1FNN A;  1J09 A;  4CIC A;  4F7Z A;  2VQG A;  5TRD A;  1GVD A;  4V2G A;  2P81 A;  4FX0 A;  1LEB A;  5HLG A;  3MZ8 A;  1IV6 A;  2VB6 A;  1RC9 A;  3IWF A;  3G2B A;  1YG2 A;  3OY9 A;  1ZG1 A;  4LLL A;  5EG0 B;  2GIZ A;  4D0P A;  3RIR A;  2D5V A;  1B6A A;  1WJB A;  5B3S H;  2JRM A;  4P9F A;  2J5O A;  3CJQ B;  4GDF A;  3J81 Z;  1YIT I;  2DFI A;  3Q9S A;  3ROU A;  1YW7 A;  3CO7 C;  1HKT A;  3FDY A;  5E1Z B;  1IDZ A;  3HXL A;  4P9U A;  4WWC A;  2M8G X;  3V8K A;  3KIO A;  4IKF A;  5ILU A;  2CMP A;  2CQK A;  3I59 A;  2VOO A;  5LLQ A;  2HQ5 A;  3ZXS A;  1MJA A;  4FE7 A;  4ENJ A;  1S7E A;  3ZMD A;  2CQ7 A;  1PUF B;  1LJ9 A;  4WXC A;  3ASN H;  2DJI A;  3DKX A;  2OQR A;  2HZT A;  4Z2Y A;  4A2U A;  3TED A;  1GXP A;  2JSC A;  2OTJ I;  1DU0 A;  3K7A J;  2M0M A;  4AC0 A;  2MW8 A;  4PJN A;  4E6K G;  2QQA A;  3SFZ A;  1AU7 A;  2AHQ A;  2LF8 A;  1S3J A;  3A0H C;  1R22 A;  1ETV A;  3M7G A;  1G3S A;  1MSF C;  1ZH5 A;  2HFH A;  3OYM A;  4OMY A;  1SVO A;  3BLY A;  2DMT A;  1GLN A;  3DPU A;  3G1O A;  1T39 A;  1JKQ C;  3R60 A;  1VFC A;  2DMU A;  3CJT B;  3JCU C;  4CCJ A;  1ZYR F;  3ZPL A;  2VI6 A;  4B47 A;  5CVV A;  3RKQ A;  1QA6 A;  2ECB A;  5AON A;  2YU9 J;  1BI2 A;  3LMM A;  1K79 A;  2WAQ A;  5CJ9 A;  4F55 A;  5EGO A;  1H9G A;  1OCC H;  1JXS A;  1D1B A;  2VC0 A;  2LFB A;  1W1W E;  2WAD A;  3DXJ F;  4XNF A;  4BHP A;  4BUP A;  3GLL A;  2X9D A;  2P7C B;  3CZ6 A;  1WFX A;  2HYJ A;  3KP2 A;  3ZOB A;  3GZN B;  2KLO A;  4PSX A;  4JX4 A;  2EZI A;  1VQO I;  1FBQ A;  2GXA A;  4U0V A;  5F27 A;  3F21 A;  2F4I A;  2XB5 A;  3BQY A;  2CG4 A;  1I27 A;  2ZC2 A;  2VN2 A;  2V1N A;  2K5C A;  4RLF A;  4Y3O A;  3T1B A;  4IPA A;  4U87 A;  2DDB A;  4L9J A;  2IEK A;  1D0Y A;  2R93 J;  1DP7 P;  4I7H A;  1BIA A;  1HF0 A;  5EDN A;  3S2W A;  5FLV A;  3J81 K;  1TW2 A;  1QZE A;  3W2W A;  1IRX A;  3WTV C;  2EQR A;  2VJJ A;  3CJR B;  1P4X A;  1E3O C;  1EJ9 A;  3S3N A;  3FF5 A;  2BXZ A;  4HBL A;  3WU0 A;  2DPD A;  4RM3 A;  1HLV A;  1DPU A;  4BXF A;  2ZJQ F;  4G94 A;  5L3E A;  3MMY B;  2LYC A;  3DLL F;  5LGT A;  1FOK A;  1WJD A;  1U78 A;  2P8T A;  3FK7 A;  4IRG A;  3LSR A;  2FA5 A;  1TQM A;  2DA2 A;  2KKO A;  5CQE A;  1HXD A;  4PGG A;  2DI3 A;  2FXA A;  3MKL A;  2H27 A;  2M87 A;  4BJT A;  3PQK A;  3C7J A;  2QQ9 A;  1FSH A;  5JVG F;  3IP4 B;  2W7N A;  2AXT C;  4D5C A;  3OMY A;  4HX7 A;  2E71 A;  3MWM A;  3P9I A;  5CVJ A;  3HTS B;  2ZJ2 A;  5GTH C;  3J80 Z;  2KJB A;  1IN7 A;  1OYI A;  4EJO A;  1SVL A;  4LB5 A;  2LR8 A;  2YUS A;  3MD2 A;  2HQA A;  1ZHF A;  3DEE A;  1YIO A;  3I55 I;  2XF7 A;  1ZK8 A;  3TP0 A;  1MBE A;  1ZRE A;  3RQI A;  3RZD J;  3CMA I;  4DBR A;  2NOG A;  2HVS A;  1DUX C;  4BE0 A;  3CCS I;  1PYV A;  2EIJ H;  4Y17 A;  3REO A;  2VOD A;  1BJZ A;  2GXG A;  3DP7 A;  2R5Z A;  3GTL J;  2NRA C;  5LRS A;  1NG7 A;  2M0C A;  4B3X A;  3IAM 2;  1IN5 A;  2MSY A;  2O9L A;  2E19 A;  2GAU A;  4MTE A;  1SD5 A;  3LQR A;  5EG0 A;  3BCB A;  4XID A;  1NG6 A;  4M9X A;  5FJ8 J;  4ITV A;  4J00 A;  2HYG D;  3HHG A;  1ZR2 A;  2LDU A;  3I9V 2;  3RYP A;  1QGP A;  2BVL A;  4RB1 A;  1X1P A;  3WTW C;  3I4M J;  1FOY A;  2RC4 A;  4RBO A;  2QA4 I;  3J7A Y;  3S1Q J;  3RDI A;  5LRR A;  4ZYD A;  1T95 A;  3WE2 A;  2HPM A;  1O3R A;  4LK1 F;  3MFK A;  4IHX A;  5D5U B;  2L3D A;  2KP6 A;  1N25 A;  1ON2 A;  5F0F A;  2FRH A;  3BJO A;  3H9J A;  5ILV A;  1G4D A;  5EF6 A;  2VBX A;  1VND A;  3LSG A;  2IS4 A;  1A04 A;  4FCY A;  2VOP A;  4QPO A;  5D4S A;  3ECH A;  5L3D A;  2BW3 B;  2TRT A;  4KN7 X;  5GTI C;  4W97 A;  2D45 A;  3BG7 A;  2HYF A;  3CF5 F;  3QYE A;  4DGW B;  3BZ6 A;  5ICG A;  1YIJ I;  4MEX F;  2Z1D A;  1IDY A;  1XPX A;  2DFH A;  4MQV A;  5ED4 A;  4UHT A;  3S1R J;  3MKY B;  1AOY A;  1UB9 A;  1J59 A;  5FFZ A;  1IUF A;  4U0W A;  4WF2 A;  2FMY A;  2RNJ A;  4LLN A;  1ZLJ A;  4LLG F;  1KON A;  4BAY A;  4EV0 A;  3CP2 A;  5DD8 A;  3VFZ A;  3DBH B;  1PDN C;  3B6A A;  3FXO A;  2OCC H;  4BQQ A;  3A01 A;  4AIJ A;  1VQ7 I;  3BG9 A;  2XIG A;  1QO0 D;  2XV4 S;  4ASN A;  1WJE A;  4PFO A;  1XGO A;  5FRN A;  1JI8 A;  1Z77 A;  1F4K A;  3GZ5 A;  2OA4 A;  1V55 H;  3E0J B;  2E7X A;  2OJE D;  3TOA A;  4XOP A;  1ETO A;  1I3A A;  4OIP F;  3KEO A;  1FIA A;  1KYZ A;  1WRJ A;  3FXQ A;  2A6T A;  4YII A;  3F9K A;  2P0W A;  4EJT A;  2A5Y B;  4HX4 A;  3RKY A;  2VBW A;  2WY7 Q;  1KA8 A;  2D1H A;  3LSH A;  4A69 C;  4XN0 A;  1TTY A;  3R61 A;  5J4Y A;  3U1K A;  2O8X A;  2IA0 A;  4HQE A;  1D3Y A;  1JT6 A;  1D8J A;  1QVU A;  3MKZ A;  1QHG A;  3WGG A;  5M5W J;  4UUT A;  1ZAR A;  2LTP A;  2HR3 A;  4BHC A;  1DP3 A;  3P5J A;  2ZME A;  4ZDL A;  3KP5 A;  1J75 A;  2ESN A;  4Q4Z F;  4KYW A;  4GYG A;  2DTZ A;  4BGD A;  2L2O A;  4Q47 A;  4LB6 B;  5F6F A;  3CUQ B;  1K7A A;  2R5Y A;  3GTM J;  2G0E A;  3QPT A;  2PBI A;  4ZC3 A;  5E1W A;  3EDP A;  5H6Q A;  3TDU C;  3U9G A;  4BYY A;  3QP6 A;  4JBA A;  1YS6 A;  1H0M A;  4XOR A;  4YFK F;  2FE3 A;  3G4S I;  4TV7 A;  2MGQ A;  3UR3 C;  1MMD A;  2Z5U A;  3K2A A;  2XKO A;  3HUG A;  5GP9 A;  2MAB A;  2E1M C;  3H5A A;  2JN6 A;  2GOM A;  2ZJR F;  3DLA A;  1S9H A;  1F1Z A;  1R00 A;  1PP8 F;  4OAY A;  3HTU A;  2ZO4 A;  5CVR A;  3JRG A;  1SC7 A;  2CFX A;  1X4O A;  5D8L B;  2COM A;  3CDL A;  5FB2 A;  4O6J A;  3OIQ A;  2L01 A;  2DCE A;  2LOO A;  3ABM H;  4Y52 J;  4EM1 A;  3CCM I;  2Y0M A;  2JQ7 A;  3JRI A;  1SD4 A;  2V6C A;  5J6X A;  1SFU A;  1E3H A;  3Q0W A;  4M73 A;  2F5F A;  1BR1 A;  2NVT J;  2CWE A;  1Y8R B;  1R49 A;  2X51 A;  3HUG B;  4JK1 X;  3K9T A;  1T08 B;  1R5H A;  4EM0 B;  2GLO A;  1I1G A;  2JK3 A;  3LNQ A;  4QTR A;  2X6W A;  2L9R A;  3AG1 H;  2IGN A;  3CME I;  3AL0 C;  3H9Q A;  3MVP A;  2NS7 A;  1QVT A;  1I3Q J;  4QPQ A;  3O8G A;  2FSW A;  1IJW C;  1P7J A;  2EH3 A;  4MQ9 F;  1BW6 A;  3HSF A;  3VYR B;  1T98 A;  2NVQ J;  2XDV A;  5A2Q Z;  3PO2 J;  5E3N A;  2HNH A;  4BY1 J;  2OUM A;  1R23 A;  5FGM A;  4FET A;  4JOM A;  3G1L A;  3HRS A;  1TBX A;  1Y8Q B;  2BGC A;  3DBL B;  4RAZ A;  3KP4 A;  3FMS A;  3A01 B;  1W7P B;  2HVQ A;  3BP8 A;  3IH4 A;  4C2M J;  2EV6 A;  2OCE A;  4X0G A;  4ZZD A;  3F23 A;  4AVZ A;  3A03 A;  4Y7N J;  4KMF A;  2ZNZ A;  3F22 A;  2VON A;  1YOV B;  3BG6 A;  3V8L A;  3PIP F;  4DYQ A;  2PMU A;  4NQW A;  5IP9 J;  4XLP F;  3OYN A;  3I4N J;  2ID6 A;  2ISY A;  3IWZ A;  2KT0 A;  1L0O C;  1V54 H;  2MH9 A;  6PAX A;  3OWT A;  2QEX I;  3M4O J;  2LY1 A;  1BI3 A;  5DS9 A;  4ZJZ A;  4BJ6 C;  1O3S A;  1ZR4 A;  3TMO A;  3MN2 A;  1SD6 A;  1X3W B;  1MBJ A;  4RAY A;  4CYC A;  1GXQ A;  4HRI A;  3GFL A;  4DBQ A;  3CCL I;  4ZTJ A;  2FX0 A;  3L2Q A;  4BXX J;  4YG2 F;  1G3T A;  4CYC B;  5D5X B;  4I2O A;  2VJ5 A;  3VOD A;  3JRC A;  1BC8 C;  2JJ7 A;  4H4K C;  3TGN A;  3QU3 A;  1QNT A;  3SZP A;  1CF7 B;  2MLK A;  1VQN I;  4EGY A;  3T8T A;  3BR1 A;  2EZL A;  2MYS A;  4I02 A;  2JUG A;  4L5I A;  3IRR A;  1G3W A;  3BTI A;  4P5O A;  5LD2 C;  1FC3 A;  3H36 A;  5J3L A;  4CGZ A;  1D1C A;  1AWC A;  3ESW B;  4OIR F;  4CA0 A;  1Q1H A;  1IW7 F;  2E5N A;  2Y31 A;  3ZGK A;  3ZRG A;  5B1A H;  1WPK A;  1RKW A;  2FJ1 A;  2LK2 A;  5DM7 F;  3HDD A;  1HBX G;  3F8B A;  5LHI A;  2IAI A;  1MNM C;  1RUO A;  2DO7 A;  3F72 A;  1RRJ A;  4LK0 F;  1LVK A;  3K4J A;  2OTL I;  1KU9 A;  4OIO F;  4UB8 C;  1RZ4 A;  4PGH A;  4M72 A;  1LDK B;  2DT7 B;  2GBY A;  5LBQ A;  2HPI A;  2WV0 A;  3QWL A;  2EIL H;  5IOZ A;  1E0E A;  1LNW A;  1QQI A;  4RLQ A;  4FHT A;  3S3O A;  4CCK A;  1VQ6 I;  2ZXW H;  5ILS A;  3A1Y A;  1ETY A;  3KEQ A;  1HST A;  3DEW A;  3B73 A;  5FKO A;  5FRO A;  3H9G A;  5CPR B;  1YS7 A;  1X19 A;  2MFZ A;  2GQQ A;  3GTP J;  5FLX Z;  1XN7 A;  4RMN A;  1WSU A;  1TWC J;  2V26 A;  3Q3S A;  3B6C A;  2CU7 A;  2BY2 A;  1T8I A;  4AM3 A;  3OS1 A;  1E17 A;  2LNB A;  2HXO A;  2XF5 A;  2OU2 A;  1MJB A;  2K85 A;  2P6S A;  3GTQ J;  4YFN F;  1IXC A;  3I59 B;  3RPQ A;  4BQO A;  2HS5 A;  2VAS A;  1TWG J;  4IOA F;  2HOE A;  4Y4R A;  1LFU P;  1K4S A;  4RA2 A;  4M3E A;  4B09 A;  3K4K A;  4I09 A;  3K4L A;  2VE8 A;  3M8F A;  1ZN2 A;  1MD0 A;  5H6R A;  1R5G A;  1Y6I A;  4HF2 A;  4C9Y A;  2QSF X;  2GWR A;  3LSK A;  2JRT A;  3A4C A;  1ULY A;  1J7K A;  4QLC U;  1GT0 C;  3SDB A;  1LE8 A;  2H6B A;  2YS9 A;  2G9W A;  2QLZ A;  1TP4 A;  2BOL A;  1Z6T A;  3E1S A;  3HM5 A;  3LSI A;  3L09 A;  3K1P A;  2OPT A;  2QM3 A;  3SXY A;  1ZRD A;  2EK5 A;  1BJA A;  2W82 A;  1DDN A;  4M3F A;  4PUS A;  2K4B A;  2KDZ A;  1XCV A;  3GVA A;  4L0Y B;  4UNO A;  5DEQ A;  2UV1 A;  1P4W A;  2XF6 A;  1WI3 A;  4IQ4 A;  4MNU A;  3QPL A;  3S17 J;  1V4R A;  3AG4 H;  4CZC A;  2Z99 A;  5EGO B;  1V5F A;  2WB1 N;  1YYV A;  3KYC B;  2NNN A;  3NAU A;  3FXL A;  3R0J A;  3DEU A;  2E36 A;  2Q0O A;  4AVP A;  2K27 A;  2AO9 A;  2FOK A;  1H9T A;  2STW A;  3R0A A;  4M3B A;  2COB A;  2E2H J;  4ZYH A;  2STT A;  1JKO C;  5DDG A;  2RRE A;  2IBD A;  4KIC A;  1OMI A;  4G12 A;  5EJC A;  3T5X A;  1X58 A;  1Z67 A;  4XKW A;  3FM5 A;  4EJU A;  1VQ8 I;  2CV1 A;  4G8X A;  1T0F C;  4EEF G;  4C3J J;  3MCZ A;  1O3T A;  4N4O B;  5D6E A;  1Z1D A;  2O8K A;  4AID A;  4JP0 A;  3OYF A;  1I1S A;  2R7U A;  4ESB A;  1Y0U A;  1FLI A;  1YW8 A;  2X1E A;  4A0X A;  3DBR B;  1K6O A;  1PJR A;  1WJF A;  2CUF A;  1FMV A;  3ZMS A;  1U6G A;  3ELK A;  2PJR A;  1KU7 A;  1IN8 A;  4A3K J;  1YE9 A;  1OR7 A;  2FNP A;  4CCM A;  3JRF A;  1N78 A;  1BW5 A;  2JZY A;  2XAJ A;  3CJN A;  4LIV A;  1MNE A;  1MH4 A;  4M3D A;  1XS9 A;  3Q9V A;  4XKV A;  2MD0 A;  3QYF A;  3JRD A;  1LFP A;  2OF7 A;  3K69 A;  2VQH A;  3H3V K;  2W48 A;  3CMM A;  3E97 A;  3H1C A;  5DD4 A;  3MZH A;  2ELK A;  2DOF A;  1UCR A;  2RKH A;  2PLY A;  2QBY B;  1MMA A;  3BZC A;  5B5E C;  4PDK A;  2CO5 A;  3GCM A;  2V1U A;  2DN0 A;  1POG A;  2JUC A;  3FMQ A;  2DW4 A;  4QWQ A;  1B4A A;  4Y15 A;  4FQG A;  1YX5 A;  5DV5 A;  3E6M A;  1R1U A;  3NRV A;  1Z3X A;  4BJ5 C;  1UHW A;  1ZGW A;  5EZG A;  1OFC X;  4N0B A;  3W6V A;  5D5W B;  2EJR A;  3EUK L;  2GA1 A;  3NAR A;  5JHF A;  4YIR X;  3OS2 A;  5FLX K;  2LY2 A;  5M5Y J;  4XLN F;  3WG7 H;  2IP2 A;  1TNS A;  4A0Z A;  4ZTF A;  3CCY A;  3E6C C;  2P5L C;  2UXX A;  3M8J A;  3GFI A;  4P96 A;  1FZP B;  2HGC A;  3N4M A;  3KLN A;  4ZH4 F;  3LA3 A;  1H89 C;  3C3W A;  3OIO A;  1K4T A;  1YO5 C;  3DPT A;  2IXS A;  1VQ5 I;  1FSE A;  4O5V A;  5B1B H;  1VQ4 I;  1TWH J;  2ZXI A;  1O4X A;  4E7I A;  1B9M A;  1A6Q A;  2WB1 A;  3I0T A;  1YHQ I;  4LIT A;  2L9N A;  3ZQI A;  4I76 A;  3QOP A;  4DJA A;  3W6K B;  5JLX A;  3HEF A;  2ZBK A;  4GYI A;  5TIS C;  1Z21 A;  2I5U A;  2IW5 A;  3CDI A;  1S72 I;  5B66 C;  2A69 F;  5FD6 A;  2KQR A;  1OIS A;  1U9N A;  2GOX B;  4RGU A;  2FD5 A;  3W3C A;  2ID3 A;  3HOV J;  2XVC A;  2IPQ X;  2Q8K A;  3HKZ N;  2W4S A;  1JJ8 C;  3VEP A;  4W1U A;  2W25 A;  3FKJ A;  4HV6 A;  1S29 A;  2NOJ B;  2QEN A;  2LBF B;  4YIF A;  1X4P A;  3OYJ A;  1RI7 A;  2DFE A;  2O3F A;  4LG0 A;  3HB9 A;  4KT6 A;  2D2W A;  3OYK A;  1N77 A;  2R7V A;  2RAE A;  3V7R A;  5ICC A;  1I6X A;  3QU6 A;  5CVU A;  1J2X A;  3O8H A;  2N8G A;  3G73 A;  2FEZ A;  3PIO F;  2DA3 A;  4GGG A;  2YX7 A;  1YI2 I;  1R9T J;  3ZMV A;  4XR6 A;  4HZF A;  5BPD A;  1WKM A;  1GV5 A;  2XAH A;  1XSX A;  4C2T A;  2FU4 A;  1FY7 A;  2KMU A;  3L2W A;  4C3I J;  5M3F J;  1ITY A;  1KU2 A;  3ZQC A;  2H94 A;  2KL4 A;  1TW3 A;  1HW5 A;  4AIK A;  3CC4 I;  1WZ2 A;  2ELJ A;  5TJJ A;  5HS7 A;  4XM3 A;  3ZMZ A;  2DQL A;  3LQQ A;  4FAS D;  2V1D A;  4RB0 A;  3AAF A;  2HU9 A;  3F0C A;  2NVU B;  2BHY A;  4IEJ A;  2K3F A;  4AYB A;  3WTS C;  3PSI A;  3M1C A;  4UV9 A;  1LVA A;  3E5X A;  4GRI A;  4PFP A;  3WU2 C;  5DTD A;  4UB6 C;  3Q0V A;  2RNG A;  1D8K A;  5KVR A;  1BIB A;  3DTK A;  1K78 B;  4LFU A;  3HSR A;  1TQI A;  2FNA A;  3IC7 A;  4LIU A;  1WJC A;  1WCM J;  4KJZ A;  1F43 A;  2DBB A;  4XLH A;  1X1C A;  4AIH A;  2CW8 A;  3L9F A;  4MTD A;  3K1M A;  2PN6 A;  3IUO A;  4MFD A;  5L3G A;  3GXO A;  3S2D J;  2OQG A;  4IVN A;  3OR2 C;  1HQC A;  2P7V B;  2ZB9 A;  5E20 A;  2EIM H;  2OD5 A;  1JHF A;  1SD7 A;  3D0S A;  4KT5 C;  4BBS J;  4Q5S F;  4UY8 I;  2JA2 A;  3CO6 C;  2HDC A;  2FOW A;  3V7S A;  4HX8 A;  1G59 A;  3H0G J;  2ISZ A;  1I50 J;  4XRS A;  5HDK A;  2P4W A;  1BI0 A;  2WV1 A;  1NK3 P;  4R1H A;  1SFX A;  2F2E A;  1ETX A;  2F5D A;  2W84 A;  3M1E A;  2E34 A;  4CCO A;  2HKX A;  2X1C A;  4YEL A;  1SAU A;  4HLX A;  1IG7 A;  5E18 F;  2ZSI B;  2WY8 Q;  3FX3 A;  3HJE A;  2R4G A;  2RV8 A;  3CCV I;  4II3 A;  5LHH A;  1W4M A;  5F64 A;  3K4C A;  4C2U A; 
#chains in the Genus database with same CATH homology
 1BR1 A;  3AFH A;  4F91 B;  2HDW A;  2MC4 A;  3V42 A;  2X51 A;  3HUG B;  3D5S C;  2KDO A;  3C2G A;  3N05 A;  1QHH D;  2M3A A;  2IS1 A;  4HNT A;  2X6W A;  4CUG A;  4XL9 A;  2IGN A;  3AL0 C;  1X1D A;  2DT6 A;  4NNJ A;  3OL3 A;  3H9Q A;  4U7B A;  3KYL A;  3ZQQ A;  4NC8 A;  4QPQ A;  2CS3 A;  3GBG A;  2VIX A;  2ZSH B;  1OLT A;  4B44 A;  3CF2 A;  4J01 A;  4PK4 A;  2X6X A;  4F3Q A;  4IX7 A;  2PMZ A;  3S8P A;  3VYR B;  4BQN A;  2XDV A;  3RPU D;  3QOD A;  5FRM A;  2HNH A;  2OV7 A;  1BOB A;  2L7K A;  2E5Z A;  2OUM A;  1UG0 A;  1LKX A;  4F92 B;  1UAA A;  4D1Q A;  4FET A;  3OS0 A;  4JOM A;  3VWB A;  2CH0 A;  2W00 A;  4XMY A;  3VDX A;  5LFA A;  3TBI A;  3OOU A;  2LC2 A;  2HVQ A;  2Z2S B;  3DU5 A;  4X0G A;  4PJJ A;  3H5R A;  4AVZ A;  2HVR A;  3LL7 A;  2QKM B;  2DOA A;  1Y56 A;  3BG6 A;  3HOT A;  4E4H A;  3MKW B;  3OYN A;  4YRV A;  2PJR B;  4XLE A;  4XQF A;  2HZD A;  2OC6 A;  3OWT A;  2LY1 A;  2VXD A;  4ZJZ A;  4E7L A;  3QYB A;  4XON A;  4BJ6 C;  3TMO A;  1R6R A;  3PL8 A;  2ZFU A;  3LFU A;  3UNG C;  4JQF A;  4HRI A;  4DBQ A;  4ZTJ A;  5HLT A;  3TL4 X;  2VKD A;  3L2Q A;  2KRH A;  2VKH A;  3SEQ A;  2VLA A;  2LBF A;  4HG2 A;  2VJ5 A;  4ZYA A;  3PNT A;  2IS2 A;  3D5R C;  3H0D A;  2VXZ A;  4H4K C;  1J09 A;  1FMW A;  4BEH B;  1WJA A;  3EUA A;  2VQG A;  2KRC A;  2R7O A;  3SYT A;  2I8D A;  3W2A A;  2MYS A;  2JUG A;  3HPH A;  5LD2 C;  4P5O A;  4KIT B;  1V5E A;  2VB6 A;  1D1C A;  4BAC A;  4CA0 A;  3G2B A;  3OY9 A;  4Y33 A;  1MW7 A;  2E5N A;  3ZGK A;  3RTR A;  3ZRG A;  1WJB A;  1D0X A;  2ZXH A;  2JSP A;  1YX3 A;  3FBN B;  3CJQ B;  2CUZ A;  3S3M A;  1LVK A;  3K4J A;  4BS9 A;  3FDY A;  3CES A;  2WAF A;  3HXL A;  1LDK B;  2DT7 B;  1E0E A;  2HPI A;  4BU2 A;  2QKL B;  3QOE A;  4BEH A;  4IKF A;  4RLQ A;  2CMP A;  3S3O A;  4CCK A;  2VPL A;  2R7T A;  3A1Y A;  3ZXS A;  1D0Z A;  1ERD A;  3OYC A;  3OYL A;  3OL4 A;  1K6Y A;  2LG4 A;  4DOZ A;  5FRO A;  3H9G A;  5CPR B;  2VJI A;  2DJI A;  3DKX A;  1DQU A;  1X19 A;  2MFZ A;  4PJM A;  3H35 A;  2VQL A;  3BCA A;  3K4M A;  2M0M A;  4PJN A;  4RMN A;  4E6K G;  2R7X A;  2V26 A;  2KPM A;  3ONQ A;  3OS1 A;  4HST A;  2XF5 A;  3OYM A;  2W1O A;  3S32 A;  3BLY A;  3HKZ A;  3L2R A;  1WJ5 A;  1GLN A;  3DPU A;  4BQO A;  3K4B A;  2VAS A;  4RM2 A;  1V5G A;  4Y4R A;  4CCJ A;  4B47 A;  3K4K A;  3K4L A;  4CCN A;  1MMN A;  2LRE A;  1ZEL A;  3LMM A;  2L5Q A;  5CQG A;  2WAQ A;  4E7K A;  1Y6I A;  3OYE A;  4C9Y A;  4HPQ A;  4F55 A;  3LSK A;  4II2 A;  3A4C A;  1D1B A;  2R7W A;  2E60 A;  3IAS 2;  2KHM A;  2WAD A;  3K70 D;  4XNF A;  3SDB A;  1W36 C;  3K4N A;  3K6G A;  1X1A A;  4BUP A;  2WBM A;  2V6E A;  3CZ6 A;  1WFX A;  2BOL A;  5KCM A;  3VYT B;  4ANJ A;  2IS6 A;  3E1S A;  4PSX A;  2KLO A;  3LSI A;  4F93 B;  4F52 A;  2F4I A;  4MLO A;  4E7S A;  2W82 A;  4HNU A;  2LH9 A;  3K70 C;  3DTE A;  4PUS A;  2V1N A;  2K5C A;  4RLF A;  4Y3O A;  2UV1 A;  4U87 A;  2XF6 A;  4IQ4 A;  2V9K A;  1D0Y A;  4CZC A;  3FBI B;  3HOS A;  3L2U A;  1V5F A;  3OR1 C;  3K10 A;  3W2W A;  2WA0 A;  1IRX A;  4C30 A;  2VJJ A;  3CJR B;  3PSF A;  2UUZ A;  4PJL A;  3S3N A;  2IGM A;  3C2H A;  1TT0 A;  3PJR A;  2Y0S A;  1N75 A;  2RRE A;  3NWS A;  4RM3 A;  2VJ4 A;  4N4N B;  4BXF A;  3HPG A;  4XKW A;  2CV1 A;  3MMY B;  1T0F C;  2CW7 A;  2LYC A;  2CUJ A;  3OYG A;  1WJD A;  4XKB A;  4N4O B;  1DGR M;  4NC7 A;  1AA7 A;  5TGT A;  3OYF A;  2LRD A;  3DU6 A;  1SFK A;  2R7U A;  2X1E A;  5CQE A;  1PJR A;  1WJF A;  3VYU B;  3DWL E;  1FMV A;  2WAE A;  2PJR A;  4BJT A;  1MMG A;  1YE9 A;  4CCM A;  1N78 A;  3IP4 B;  2W7N A;  3KX2 A;  3OMY A;  2O5R A;  2BVM A;  4LIV A;  1MNE A;  1G8X A;  1EA3 A;  4OAZ A;  4XKV A;  2MD0 A;  4XKC A;  3QYF A;  3LSM A;  2XC7 A;  1LFP A;  2R7R A;  2VQH A;  4PSW A;  3CMM A;  1W36 D;  1BR4 A;  3MD2 A;  2HQA A;  3DEE A;  5CKT A;  1MMA A;  2XF7 A;  3D5L A;  4XN3 A;  2M4G A;  4IQJ A;  4DBR A;  2HVS A;  3OYA A;  2IGO A;  2JVG A;  4BE0 A;  5HNF A;  4E7Z A;  1PYV A;  3OYB A;  3NWT A;  1Z3Y A;  1YX5 A;  1Z3X A;  4BJ5 C;  2R7Q A;  1NG7 A;  3U21 A;  2X1D A;  4B3X A;  3IAM 2;  2X6Y A;  4EAT A;  3EUK L;  2XSJ C;  5JHF A;  2CV0 A;  3VSL A;  3OS2 A;  3W2V A;  2LY2 A;  4CSW A;  3BCB A;  3H5N A;  3OYI A;  4HSR A;  1NG6 A;  4ZTF A;  4J00 A;  3EUH C;  4ITV A;  3M8J A;  3I9V 2;  3A2K A;  2VQC A;  2BVL A;  3PNV A;  4CCL A;  4HEA 2;  3FHN A;  3AKZ A;  3J7A Y;  3DPT A;  2IXS A;  1T95 A;  4XLA A;  4LG3 A;  2HPM A;  1U0J A;  4XOT A;  1DGW Y;  5KHD A;  4BE1 A;  2ZXI A;  2KP6 A;  4E7I A;  1OR7 C;  1VZ0 A;  2M7A A;  4R79 A;  2WB1 A;  3SZG A;  2IGK A;  3H9J A;  2K9L A;  2L9N A;  4LIT A;  4DJA A;  4D9J A;  2IS4 A;  3LSG A;  4QPO A;  2RQQ A;  1Z21 A;  2BW3 B;  2KQR A;  2GOX B;  4KIS A;  3W3C A;  3BG7 A;  1Z7L A;  4NQW B;  3QYE A;  4DGW B;  2Z1D A;  2W4S A;  3FKJ A;  3SEZ A;  2NOJ B;  3VYS B;  2K9M A;  3MKY B;  3BC8 A;  2LBF B;  2FUG 2;  2AQF A;  1X4P A;  3OYJ A;  4KT6 A;  3OYK A;  2R7V A;  1N77 A;  3OYD A;  1KON A;  3OYH A;  5KNL A;  3HC7 A;  2DXI A;  3CP2 A;  3I3L A;  3DQV C;  3CP8 A;  4ZDO A;  4XR6 A;  2X85 A;  1HA8 A;  4BQQ A;  4C2T A;  2KMU A;  4NUB A;  3L2W A;  3S93 A;  1WJE A;  3ZCO A;  2KZV A;  1TZL A;  4PFO A;  5FRN A;  1JI8 A;  2E1M B;  2KL4 A;  3E0J B;  2V4J C;  2R7S A;  3RCO A;  2ELJ A;  4XOP A;  4XM3 A;  4IZZ A;  3PUB A;  2A6T A;  4FAS D;  3F9K A;  2P0W A;  3DPL C;  2XAU A;  2HU9 A;  2WY7 Q;  4XLF A;  4BE2 A;  3LSH A;  4YEJ A;  4XN0 A;  4AYB A;  3PSI A;  3M1C A;  1P9Q C;  4GRI A;  4CH7 A;  4AU7 A;  4PFP A;  1UEL B;  2A5W A;  2M4K A;  3AL0 B;  3MKZ A;  3VSK A;  3HL2 A;  1QHG A;  4BDY A;  2RNG A;  2AQE A;  2CFO A;  3PNY A;  1DP3 A;  3DTK A;  3L2V A;  2Q1Z B;  4ZDL A;  4LIU A;  4BGD A;  1WJC A;  4E7J A;  4KJZ A;  4G6T B;  2L2O A;  4B43 A;  4XLH A;  1X1C A;  2F6C A;  3RSN A;  2CW8 A;  5HVQ C;  1X1B A;  2V7F A;  3EPZ A;  4ZC3 A;  4OWR B;  4E7H A;  3IUO A;  2Z16 A;  2JVH A;  4DIQ A;  2VL8 A;  4BL0 B;  4ZDP A;  3KEY A;  3OR2 C;  1QU3 A;  2M7B A;  4XOR A;  5HOO A;  3UR3 C;  2UWM A;  1MMD A;  2MAB A;  2Q2E B;  1MND A;  2E1M C;  2JA2 A;  3H5A A;  2GOM A;  4BDZ A;  3DLA A;  3PFY A;  2CV2 A;  1S9H A;  2K3P A;  2L9S A;  1G59 A;  4B48 A;  4XLC A;  1BR2 A;  2BW3 A;  4OAY A;  3OIP A;  3RQ4 A;  1X4O A;  3DTI A;  4CCO A;  1D1A A;  3DKY A;  3ZR8 X;  2X1C A;  3OIQ A;  5HNH A;  4YEL A;  1SAU A;  2DCE A;  2LOO A;  2ZSI B;  2F5V A;  2WY8 Q;  3HG9 A;  2R4G A;  4II3 A;  3K4C A;  4C2U A;  4P1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...