3OL4A

Crystal structure of a putative uncharacterized protein from mycobacterium smegmatis, an ortholog of rv0543c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 32
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol4A02
3OL3A 3OL4A
chains in the Genus database with same CATH superfamily
2K40A 3E6CC 2NVQJ 2EV5A 3BQZA 2XAHA 4CCJA 3CLOA 2A61A 4KN7X 3F8BA 4IVNA 5EGOB 3CMYA 3HGYA 4J00A 1UHSA 4Y3OA 4Y13A 2XDVA 1CF7A 1TT0A 2W48A 3TO7A 4ZDOA 2A69F 3P9CA 2GQQA 2E35A 2WY8Q 1X3UA 1MMAA 1SAUA 2MH9A 3H9JA 3H1CA 4DGWB 1CF7B 2J5OA 2UUZA 4MNUA 3KEYA 4E7HA 3CCYA 3KETA 2OAZA 4OMZA 1USTA 2IXSA 2M4KA 1IUFA 3CUOA 3HPHA 1PYVA 1R1UA 4LMYA 2VQCA 1TW2A 1DGWY 3M3YJ 1G3SA 1GDTA 3K0LA 1KYZA 2EA4A 4B09A 2XRNA 1IUYA 2EZHA 2KIUA 2LG4A 1FZPB 2VXDA 4ZZDA 1TWAJ 3D5SC 3DQVC 3F8FA 3PUFA 1F36A 3TW7A 1K6YA 2HI3A 1G2HA 1UCRA 4BEHA 5FD6A 1IXSB 3ABKH 3E97A 2K5CA 4F91B 5CVIA 3ERED 4S0HB 4CGZA 1B1BA 3K70C 1FJLA 1MSEC 1MKMA 2KFDA 4XKCA 4BEHB 3WTWC 2W82A 5LFAA 1YTYA 5DCMA 2VL8A 2C6YA 4A2UA 3KX2A 5E1XA 1KONA 2FE3A 4RAGA 2EQRA 2XV4S 4A5NA 1LVKA 5ILVA 1W5SA 2QEXI 1SAXA 3JW4A 1NK2P 5HNFA 4WXDA 2XGDA 4IO9F 3MZHA 4CYDA 2W1OA 4M74A 3NEUA 2M2EA 1Y39A 4M9ZA 3U21A 1RUOA 1HSJA 2IP2A 2MYSA 4M6XA 1U5TA 2VODA 2V1UA 4M6YA 4BHBA 2DMNA 1LE8A 1W1WE 4BS9A 3E6DA 3L1PA 1E3PA 3CMAI 2EFWA 3EQLF 3HM5A 4E7SA 3J80Z 3BG5A 2DI3A 1P4WA 1U5TB 3SZTA 2NVYJ 4BBRJ 4NB5A 2B9SA 1LE8B 2QVOA 5IYBJ 5JR3A 2DU9A 1E3OC 4HNTA 5DS9A 2O0YA 1VQ7I 2PX9A 4M9SA 1MH3A 3DLAA 2BY1A 2HOSA 1ETKA 3E6BA 3WTXC 4RGRA 3CO7C 2FOKA 5BNGA 3HOUJ 1JKRC 3DXJF 4D9JA 1P2FA 2JUGA 2FBHA 2LKSA 3S3NA 1JHFA 3FHZA 1ZARA 2L9SA 1R5HA 2OUMA 3OYMA 3BDDA 1D8KA 5DDGA 1EJ9A 5L3GA 1FT9A 3WTZA 3RSNA 1JXSA 1NG6A 5FB2A 2DA4A 1KU7A 4EM2A 4I99C 5IT9K 2JTVA 3BG9A 4C3JJ 1BC8C 3ABMH 1ZK8A 4BXXJ 2VOPA 2XHKA 4BXFA 4LJZF 1I39A 3F22A 1JGSA 5JVTA 1MH4A 2OZUA 4GYIA 1QA6A 5GAGJ 3RCOA 1YE9A 4MEXF 3S2WA 3DBRB 3E3VA 3IV5A 1Z77A 5DD4A 1KA8A 1SVOA 3H9QA 5D5WB 2ZJQF 4LB5A 1NTCA 2EWNA 4XMYA 3EDPA 2HTSA 1X3WB 3GFJA 5IPAA 3AG3H 2UZKA 4H4KC 2IA0A 3CMMA 1VQKI 4BY1J 3BCAA 2LREA 1HQCA 3V7CA 2K3PA 5C44J 3S8PA 5D6EA 3DCFA 5D6FA 3LOCA 3M8JA 2LF7A 3KCCA 3KEOA 4PSXA 2BYVE 4HBLA 4FETA 4CCKA 3SJMA 2DT7B 2FF4A 5K7ZA 4NNJA 3ZQGA 2JSPA 1IRFA 5GPCA 4OWRB 1ON1A 3S3MA 5FKMA 5IYDJ 2HXIA 5IT9Z 4FTHA 1B6AA 3LQRA 4MHGA 3FBNB 3FZVA 4M73A 2M1BA 3OS1A 1LJ9A 3HRSA 4GRIA 1UZCA 3NWSA 1FYLA 3CO6C 2IA2A 3BJ6A 1XSXA 1BI0A 5KAFC 1WH5A 3M8FA 4LIVA 1WPKA 1X1BA 4Y52J 4N9IA 5J6XA 2EZIA 3CDIA 4HX8A 1WGXA 4YFKF 3F23A 3LSKA 3CCJI 4ZC3A 2CFOA 1ZREA 3ZXSA 1IC8A 1BI1A 2FBIA 2KLOA 1PUFA 3TOAA 5BQTA 5CVJA 4UVAA 1Q1HA 4YEJA 1TNTA 3DPUA 1O3SA 1VQLI 3GFMA 2WAFA 1GVJA 3CP2A 4DYCA 4ETSA 1PUFB 1ZGJA 3RI4A 1ETOA 1MNEA 4A0ZA 3K1PA 3QPSA 3FKIJ 3TO9A 3S15J 2L9RA 4A0YA 2DA1A 2VKDA 3K4CA 1VQ9I 4CA0A 3JRIA 1REPC 1A6QA 2WAEA 5E3LA 1TL8A 4IQ4A 2V9PA 2UXNA 3DPTA 3NARA 3ZOBA 1X2NA 5E1WA 2FEZA 3ZN1A 1HSTA 2VKHA 2QKLB 3MKZA 4BE0A 1MW7A 3H9GA 5ED4A 2EJRA 2R7RA 4CHUA 3LFKA 1PP8F 3C1DA 4IXAA 3FXQA 4EJWA 2EFOA 3K7AJ 3F8MA 1P9QC 3QU3A 3CJNA 1QNTA 2CUJA 3RTRA 2DPUA 3FXRA 1DQUA 3IH3A 3JRHA 3S1QJ 3FM3A 3MCZA 4ZTFA 4E6KG 3HRTA 2JVHA 4L5IA 4A12A 2LTPA 1SMYF 4A3DJ 2W84A 4JX6A 1W5CC 1JKPC 2O6GE 3HDDA 4A3FJ 4LLLA 1ZR4A 2CW8A 2L9VA 3ZQ7A 4ZJZA 2L4MA 2M3AA 4AM3A 4BHPA 4IRGA 2AXLA 1WJEA 1XGNA 3DKYA 3C3WA 3F21A 3GTLJ 4BDZA 1ZH5A 3Q3SA 1U8RA 2UWMA 2DA3A 3H3VK 3K2ZA 1X1DA 3M1CA 4KICA 4BHCA 3DTIA 3I55I 3ZQLA 2HZTA 4XLEA 4FCYA 2OTJI 5B1BH 1HW2A 2VPLA 2N8GA 1JT0A 4L5JA 2K9SA 3DTEA 5FKLA 1RETA 1Z7UA 3A4CA 4FE4A 3I4MJ 4A6DA 1LEBA 1R23A 2MGQA 3W2WA 5ERIA 2W85A 2Y30A 2VUMJ 5LEJA 4EV0A 5DM7F 4MTDA 1Z3XA 2A68F 5J8FA 3S14J 2KT0A 3A1YA 3WTTC 3M4OJ 4DW6A 3W6VA 2CMPA 2IVMA 5L3BA 2H6CA 2ELJA 1X3ZB 4IZZA 2HYJA 3CF2A 3LAPA 2VXZA 3H5NA 1XMKA 2H94A 4XKBA 3KZIC 2KISA 4JP0A 3VWBA 1P7JA 2XGEA 4B3AA 2IS4A 2PI0A 3MWMA 1K4TA 4BJ6C 1Z9CA 1LFBA 3L2VA 1IZ1A 1IXRC 3ZR8X 2OA4A 2DMPA 4UB6C 5LBQA 5LEKA 2XASA 1QO0D 5A2QK 1PVEA 2F5DA 2NRAC 4I7HA 2K9NA 2Z2SB 5GADJ 4IHXA 1L3LA 1G3YA 3QAHA 1ZGAA 3O2PE 3GMEA 3IKTA 4E7IA 1V5FA 3CD6I 3QYFA 2YU9J 4CZCA 4IOAF 5B5EC 1H0MA 1BC7C 2A6EF 2R7ZJ 5L3CA 1T2KA 1SFKA 1P92A 4XOTA 1IV8A 2QM3A 4B8XA 1YG2A 1UJ8A 1MMNA 2ADUA 3CP8A 4KT5C 1ETWA 2LKPA 3E1SA 1FBQA 1U5TC 3CDLA 3ASNH 3FISA 1V5EA 4R79A 4HNVA 5HVQC 1WCMJ 3ZMZA 3PUBA 3ZRGA 3R0JA 5HODA 1RI7A 2B63J 2VQHA 2M7BA 3I4PA 5HDNA 3JRGA 3BCBA 3E0JB 4I09A 1T6SA 2Z1DA 3OSFA 2PMZN 1Z0XA 1OCRH 1SFEA 2R7OA 1TLHB 1FX7A 2Q2EA 4C9YA 5CJ9A 4ZDPA 1RUNA 1QGPA 3JRCA 2WA0A 1GV5A 5C4JJ 3RKQA 1XB4A 4RAYA 4HV6A 3ASOH 4MLOA 2QQAA 1L0OC 1JGGA 3VSKA 3C7JA 2Q2EB 3L09A 1YFHA 1V5GA 2H6BA 3ZGKA 2WADA 2E5ZA 3DU5A 3TP3A 1PDNC 3JCUC 1WJBA 2E2IJ 3HOZJ 3HSFA 5ICCA 3H3UA 1VQNI 1E3HA 2LOOA 1QHGA 1NG7A 2O9LA 4MQ9F 1ERDA 2M34A 2LYCA 1K78A 3J81K 5FFXA 2V7FA 3V8LA 2R7SA 4PCQA 2PQ8A 3EUHA 1YLFA 1IN7A 4L18B 2L01A 2HYFA 5DV5A 4WF2A 4HSTA 1VQ4I 2KP6A 1K78B 2NNYA 1RC9A 1Z7LA 2E1CA 2VJ5A 5IT3A 2Z33A 1B72A 4UVCA 5J1RA 3E5UA 3KP4A 3C18A 5E3OA 1GLNA 1FTTA 3FMSA 2M0MA 1A04A 2P81A 4XR6A 4CCOA 1W0UA 1QZYA 2CS3A 1F9NA 4ITVA 2MH2A 1ENHA 4E70A 2JA2A 2MLGA 4KT6A 4PGGA 4F93B 2R7UA 5DUKA 3GFIA 2QQ9A 4XOPA 2EILH 3KFWX 5FKOA 5J3LA 4D5FA 1EV7A 2B0LA 3QODA 3FX3A 3O6BB 1FPQA 3MAJA 2L2OA 5E3NA 4HLXA 3L00A 1WVRA 1X4PA 1DUXC 3OV8A 2VC0A 2YX7A 4IL6C 1D0ZA 3ZQCA 1N77A 4NDLA 3PO3J 1Z6TA 3HTUA 4II3A 4KISA 2O61A 2RAEA 2ZXHA 4XRSG 1ZN2A 2A6HF 4IHVA 4KIGA 1X2MA 3BTCA 2EZKA 2HS5A 3CCEI 2XPWA 1SC7A 1IN8A 1VQ5I 2ZMEA 1K4SA 4Y17A 2YSRA 1WWXA 1BIAA 1X1PA 2XAFA 3ULQB 5GTHC 3OIPA 2ZMEB 5LRSA 2P5KA 1R22A 2OZ6A 1T95A 3B02A 2WB1A 3DWLE 4RLFA 3BT9A 1UB9A 1W4MA 4QTRA 2P7CB 1ODDA 1XC5A 1XMXA 2DO7A 4PDKA 4MGRA 1ZAOA 3D0SA 1STZA 2QSFX 5FGMA 2LP0A 3JREA 3BZCA 1SVLA 2P6TA 2OPTA 2XGCA 1MDMA 3BOQA 3G1LA 2XB0X 5JVGF 4BACA 4F55A 3P9KA 4BU2A 2K86A 4IRIA 3CC4I 5HLIA 4F7ZA 3HOWJ 4ENNA 1MDMB 1XTAA 5F0FA 2W4SA 3VSLA 5E3MA 2STWA 3I53A 2R5YB 2MG4A 2GBYA 1LVAA 2KJCA 4XONA 1YIOA 2CSOA 4O5VA 1IV6A 5HDKA 1HBXG 3LA2A 1EA3A 1BW5A 2HDWA 1R4NB 2M0CA 3Q9VA 3WGGA 3PJRA 3L2UA 4YFXF 2QUFA 2DDBA 4BJTA 1BI2A 2BHYA 3I58A 2KIFA 4KJZA 1D1AA 2PJPA 2QLZA 3HZJA 1ZG3A 2EK5A 5CVUA 4A3MJ 1EKEA 2V4JC 2E60A 5EYRA 1G6NA 1FMVA 5TGTA 3GUDA 2QBYA 2NOJB 2VPRA 2BXYA 1V54H 1YHQI 2MFZA 4LITA 4FE7A 1HA8A 3OYNA 3BZKA 2VJ4A 2ZC2A 3DBLB 1FYMA 1QHHD 2QBYB 1A6IA 5F1JA 2XAUA 3EYYA 1AHDP 4F52A 2Z5UA 1X1AA 4QPOA 1HDDC 1X19A 4NC6A 1MJ9A 3QU6A 2VB6A 1OISA 2K9QA 2M5WA 1IRXA 1QZEA 3I3LA 2EFPA 2ACJA 2DFEA 2BZTA 4XBFA 2KIMA 3VDXA 1B8IB 4H0EA 1S7AA 1UG0A 4GYGA 4RDUA 1SD6A 3CQZJ 1M1EB 3LSIA 1H9GA 1HW5A 1I50J 3OYKA 4R1HA 1JT6A 2QKMB 1ONVA 2DW4A 3T8RA 3S17J 3LSHA 3G73A 2ZSHB 4RS8A 3A03A 1TNSA 1ZKGA 3OYAA 2F48A 4MQVA 1Z3YA 4CDGA 5GAHJ 2PJRA 4OIRF 1BA5A 1RR7A 2LKXA 3LSTA 4J19A 3AL0C 4G8XA 2YX4A 5BPIA 3NAUA 3GTOJ 2AQEA 1JUSA 1R58A 2A5WA 2PJRB 3NWTA 4WCGA 4GFBA 5EJCA 2IS1A 3FWEA 1BBYA 1OFCX 2GIVA 4A3JJ 3B6CA 2ISZA 1TC3C 3RPQA 3HOYJ 3ROUA 2H1LA 4YIFA 1MNMC 3AKZA 1JHHA 2DOFA 2GAUA 2P7VB 5FO5A 1R5ID 2WWYA 1FP2A 5E17F 1BJZA 2R7XA 2DA5A 1V4RA 1BN5A 2CQXA 3DPLC 1A31A 3MKLA 1J7KA 5DTDA 2A05A 1OCPA 2CUZA 1IW7F 1POGA 5E1ZB 3PL8A 2QYOA 3ESWB 1P4XA 5DEQA 4FQGA 4FX4A 2X9DA 5LRRA 3JRBA 3TP0A 2HXOA 3PQKA 4P5OA 3C2GA 1WH7A 5CPRB 4LLNA 2L9NA 1TW3A 4RB2C 3CCRI 2FA5A 5CLSA 2XAJA 1WHUA 3L2RA 2VBZA 1G4DA 2KJBA 1ZTRA 1U9OA 2GOXB 3GTKJ 3MD2A 1ZR2A 4M3EA 1SANA 1YX3A 3KLNA 1K7AA 1LEAA 4D7MA 2A3SA 2QF7A 3REOA 4NC8A 3AG2H 3DFGA 2GWRA 3JTHA 3JRFA 4OINF 3W3CA 3F6VA 4MO7A 2V6EA 1T33A 4V2GA 5D8KB 3BTIA 3WU1B 5ICEA 2BXZA 3OYLA 1JI8A 1SD5A 3PFIA 2E2HJ 3L2WA 2A07F 1ORKA 2JRTA 1RIOH 1MNDA 2KZGA 2A5YB 1DP7P 1GT0C 4CUGA 3KZYA 1Z1DA 1I6HJ 2YR2A 3BR5A 3TKYA 4PGHA 1R9TJ 4G7HF 3EUHC 4KDPA 3QQAA 2KHMA 3I4NJ 5F6FA 1IF1A 2VJJA 2ZXIA 4A3IJ 2DMUA 1SFOJ 1HKSA 3H0GJ 5HS8A 1MBFA 3UR3C 4FASD 2VQLA 5JHFA 4ZYHA 5DM6F 4L9VA 2EB7A 2EFQA 3FF5A 2KIQA 4MFEA 4P1WA 5EDNA 2L4AA 2KDOA 3QPLA 2AHQA 3QPHA 3LQQA 4A69C 1MBGA 1LDJA 2VBYA 4IEJA 4WXCA 3SXYA 3JRDA 2DQRA 4N4NB 1OYYA 4RB0A 5CVVA 1YI2I 2QWWA 2BE5F 1JKQC 1R00A 2R92J 4RB1A 2XAGA 3H36A 4M6VA 2WV1A 4HEA2 1IN4A 3RDIA 4F92B 3F9KA 3DKXA 4IPAA 5EEAA 3JSOA 1AWCA 1UFMA 3EPZA 3ZQFA 3I0TA 1YO5C 4C2TA 2DA2A 3BPVA 2L02A 2ISYA 4I0BA 2DMQA 2NS8A 4OOIA 5LHGA 2XIGA 2DK8A 3X2QH 2VOOA 5M3MJ 3HXLA 1A35A 2YPRA 2ZMEC 3IHUA 2R7QA 4AVZA 2OV7A 3CMEI 2VIXA 3BG6A 2DXIA 1BJAA 4IKFA 1AOYA 3WTVC 2K7LA 1LB2A 4QPQA 4UXNA 3CF5F 2KRFA 4YELA 2XPUA 4ZYAA 3JAMK 2X6OA 2MC3A 3HOTA 1SFUA 2G0EA 2IGMA 3ECHA 2JA5J 3WTYC 1FY7A 2EV0A 2ME0A 3CCVI 5D5VB 2PN6A 2I8DA 1QQIA 3CLQA 4XKWA 4LK1F 5KCMA 2R5ZA 3P7NA 4B44A 4CH7A 2TDXA 3KZZA 1DPRA 3U1DA 3PQJA 5CYVA 3Q0UA 2JA8J 1O3RA 1Z91A 4BQAA 1HOMA 4A6EA 1TTYA 1MSFC 2GXAA 2O8KA 2FD5A 3GTQJ 1T56A 2R5ZB 3F0CA 4DJAA 1ZRFA 4IHYA 3TL4X 4BUPA 4KITB 2JMWA 2CV1A 2NS7A 3JRAA 1WQ2A 1B4AA 2XRLA 3UKGA 3OYJA 4OAYA 4HX4A 3OIOA 2GXBA 3FMRA 5EF6A 2VONA 2D1VA 3K1MA 2O8XA 2GXGA 1P7IA 1JKOC 2IS6A 3M1EA 2JUCA 2X85A 4YFNF 3SQNA 1JJ6C 1FMWA 1IO2A 2W00A 5K5RA 3ZMDA 4ASNA 1HXDA 1Y0NA 4Z6YA 2VE9A 1W5TA 3OYBA 2F5FA 2EIKH 4ON0A 2E19A 4CSWA 3CZ6A 1YX5A 3WHCA 2F5EA 1R49A 5D8LB 3RYPA 1VI0A 2X51A 4HF0A 3J7AY 3G6EI 2LR8A 3TW6A 5J1UA 4RAFA 2M45A 2X0LA 1OCTC 3HC7A 2VJIA 2MC4A 3EUAA 2ZJ2A 4DYRA 3G1MA 3RKWA 5CQEA 1J59A 1IXCA 5K7FA 3GWZA 2K02A 1ZYRF 2DK5A 1X1CA 4HSRA 1T39A 3U1KA 3FXJA 3BR1A 1NH3A 2IA1A 3TDZC 3CUQA 5E20A 2KL4A 3S3OA 2NXNB 2OQRA 2CUEA 3ZP5A 4YIRX 2I10A 3G4SI 1K79A 2EFNA 2HDDA 1HW1A 4JBAA 2XSDC 2CW7A 1UHWA 5FD5A 3CUQB 2QA4I 5HLHA 5TRDA 2COBA 4BQOA 3HOXJ 5EEGA 1RZ4A 4ZYGA 2HKXA 3GXOA 2XROA 4XRMA 3MKYB 3F6OA 3Q0VA 2COMA 2HVSA 5K7HA 3OS0A 2RVCA 1GHCA 3K4JA 5H2FC 2HU9A 3ABUA 2LSOA 2HQRA 1SMTA 2ECBA 2P6SA 4RAZA 4B4CA 1D1CA 3FM5A 1LDDA 1WI3A 4XLPF 4RB3C 2ZB9A 3TQNA 3E5XA 1IG7A 4UV9A 2FXAA 1TT5B 1MZBA 3E5QA 2LRDA 2ZBKA 1TBXA 3U2RA 3K9TA 4BH9A 2EV6A 2ZCWA 2L5QA 4Y15A 2PMZA 2D2WA 3BR6A 4Q47A 3G1OA 4G6QA 2XUBA 4D1QA 4U7BA 5EG0A 2Z16A 4G7OF 3GYHX 3G71I 3BJAA 5H6RA 2H1KA 4A3GJ 5EG0B 2Y2ZA 2GZWA 3O3KA 3CC2I 5IP9J 1U2WA 3T0YA 5E8GA 1H89C 1H88C 2H09A 1R4MB 3A0BC 2JRMA 2GA2A 4AIKA 1S72I 1I3QJ 2R0QC 2L7FP 4TV7A 4N9HA 3KP7A 3BZ6A 3GLXA 3NQOA 3LA3A 1B9MA 3WGHA 3K4LA 2XKOA 3GZ5A 3BPXA 3GW2A 3R0AA 4IX7A 5BPDA 1ZHFA 2Y9ZA 2OTLI 4YIIA 1VQ6I 2E71A 4BQQA 1IRZA 2HR3A 2K4JA 5FLXK 4UVBA 2IBDA 1X58A 3BP8A 3KPHA 3RKYA 4XKVA 2YUSA 2VKVA 3BLYA 1UELB 4A3KJ 1XS9A 1ZLJA 1S5LC 3IC7A 1USSA 3MKWB 1I1GA 1MMGA 4XRFA 1MBHA 3R6SA 4UUVA 5AIPA 1IDYA 2VBXA 1D5VA 3CCSI 1K83J 4BNCA 4NC7A 2RGVA 3P5JA 3KP6A 3ZQQA 3HHHA 2QZ8A 1ETQA 2VBWA 2Y31A 4Y7NJ 4DZJA 1G8XA 2R7TA 2FMYA 3OYEA 2FSWA 3RKXA 5HNHA 1IGNA 2VASA 3K10A 3WGIA 2DPDA 2OQGA 1YS6A 1XN7A 2WAQN 3BG3A 1F43A 4G7ZF 4L0YB 4I76A 3K4BA 4JYKA 3IKVA 3U9GA 4S04A 1FC3A 3EYIA 2ESNA 5A2QZ 1KQ8A 2NS0A 4U88A 1XG1A 3S2DJ 1SEUA 4OIQF 2DFIA 1MD0A 4WXHA 1FSHA 1GUUA 1S8NA 2F6CA 2LC2A 4HYEA 3VYTB 4BAYA 4FHTA 2H27A 4MEYF 3E7LA 3G2BA 2IGNA 3LWFA 3CJTB 2D1HA 1C0WA 4W1UA 5J1YA 5M5XJ 1FLIA 4IHTA 4LK0F 4EVIA 1H8AC 3O8GA 1F5TA 1E0EA 3FK6A 1KZHA 3V8KA 2X6XA 4KMUX 1IRGA 2FMLA 4HW0A 5F0CA 1QBJA 4GO1A 5E79C 1DPUA 1LKXA 1U8BA 2IPQX 1VF9A 3OMYA 3HJEA 2F5VA 2KQRA 1XGOA 2NYXA 2GA1A 3W6KB 3I59B 2F4MB 3I9V2 1UMQA 1RR8C 4A3BJ 1JUPA 1XDSA 4MTEA 3CCMI 3D5LA 4LD5A 4U87A 1FOWA 1U9NA 1W7PB 5FRNA 4II2A 1KQ9A 1LNWA 2K9MA 2E7XA 2CG4A 4HQMA 2PFBA 3J81Z 2QGUA 2WTEA 1WFXA 3G3ZA 2VC1A 4J01A 3K4NA 3I5UA 4V2FA 4BL0B 1KU3A 4CYCA 2JVGA 4DQ2A 3MMYB 2IAIA 4F3QA 3BY6A 3Q0WA 4DIQA 4B47A 1J5YA 4OIOF 1BR1A 4BBSJ 3GFLA 2DYRH 4FX0A 3IUOA 2ZFWA 4OU0A 3BR0A 5DD8A 4CYCB 2DYSH 4HDVA 3TEDA 4ENJA 5BOXA 4KIFA 4UNOA 2M4GA 4G6TB 5H6QA 1IN5A 3TMOA 4M3GA 1SFXA 5B1AH 3M07A 3LL7A 1TQIA 3HL2A 2IS2A 2CU7A 2E1NA 2ID6A 3LA7A 2X1EA 2F4OB 2OCEA 2V6CA 3B6AA 4JQFA 3VODA 3HG9A 1DDNA 1LPQA 2L7MP 2NVTJ 3DEEA 2PG4A 2LVSA 1W0TA 2JA6J 3MEXA 5J40A 4LGWA 2TCTA 4IOCF 5BMZA 2QSHX 2JA7J 4JX5A 2R5YA 2LBFA 2E36A 3V7RA 1JTYA 1I5ZA 2DQLA 5HOOA 2JPCA 2DJIA 4XLAA 2RN7A 3WG7H 1VQMI 2RNJA 1QPIA 3ERMA 3CESA 4PJ0C 3HOSA 2LBFB 3WE2A 1VQPI 2XPVA 5GPAA 4E7KA 1S7OA 2K9LA 2K27A 2NAZA 4EMSA 4PJJA 4YRVA 3RQIA 2AS5F 3QP6A 2HWVA 4V19K 2JJ7A 5C4XJ 4BQNA 2DJNA 2G7UA 3JSPA 1VTNC 2HTJA 4W97A 2E1OA 3A01A 4M3DA 2B7EA 2PMUA 3OYDA 1MJAA 2V79A 2M9HA 3CUQC 3HRUA 1FBUA 2RDPA 5CVRA 2JN6A 3SFZA 3I64A 1QPMA 1RRJA 1ULYA 4JX4A 3A01B 2BY0A 2HVQA 3F72A 3GLLA 4C2MJ 3HTSB 3K4MA 2BY3A 3H5AA 4ENKA 2CGPA 4PJNA 3WE3A 1Y56A 4L5EA 3B73A 4BKXA 9ANTA 5AONA 3V7SA 4LG0A 4XRSA 3S1NJ 1RESA 4NQWA 4A0XA 1SVMA 4KMFA 1U0JA 2EINH 3M9AA 1K6OA 3F8CA 3FHNA 1O3QA 2EZLA 2PEXA 3S16J 3H5RA 1MGTA 3A2KA 5EZGA 3BWGA 4EGYA 2HOTA 3T1BA 4HDUA 3WTSC 3W2AA 3GVAA 4LG0B 4NQWB 3NRVA 2VN2A 1XDUA 3OOPA 4C3IJ 3FK7A 2HNHA 3PSFA 3DBHB 1LDKB 4PK4A 4CZZA 4EJUA 2OC6A 2HOEA 3AG1H 3TDUC 3ZMUA 2M87A 4AU7A 3D1NI 2ZJRF 3OYFA 3RZDJ 3J7YJ 2R7WA 4XLCA 1B8IA 1P4AA 1Y8QB 2MD5A 3FBIB 4X1EA 1IAWA 3S2HJ 1V3FA 3HSEA 1R1VA 1YOVB 1Y6IA 3OIQA 1FIAA 5K5OA 1J0RA 3KEQA 3FXKA 2HEOA 2KZVA 1OYIA 4I02A 3IAM2 2RV8A 1ZG5A 1HDPA 1JJ8C 4PUSA 3IWFA 1DU0A 4JOMA 5JLWA 2NNNA 3HEFA 3F8NA 3QRFF 3MQ0A 3GCMA 1O4XA 4XN0A 4HF1A 3BQYA 1FOKA 4LIUA 2MD0A 4Q48A 4PFPA 2EH3A 2BVMA 3RJPA 2ZO4A 3VPRA 1MIJA 2KRCA 2Y69H 4A93J 3DEUA 1MJBA 5HS7A 5ILSA 4DYQA 3LNQA 4ZYDA 2DOAA 2JWTA 4GCVA 5D5XB 1OMIA 1QVUA 1S3JA 4NBQA 3BTLA 3OL3A 4XM3A 4XICA 4KFCA 4D5CA 1TWFJ 1S6LA 1YW7A 2ICWG 2JSCA 2LK2A 5AIQA 3CJRB 2KRHA 3H92A 5FLVA 2Y0SA 4XQFA 1OCZH 2AXTC 2OU2A 1WJ5A 2VKEA 2Z3YA 3IH2A 3OOUA 2ME6A 5M5YJ 3CCQI 2HQ5A 2XC7A 1IDZA 4XLFA 4AVPA 1BM9A 1TZLA 3JR9A 2ZXWH 3W2VA 4Q4ZF 2V9VA 1W36C 4KA4A 1XCVA 2RREA 5BS6A 4LB6B 1BR4A 2LY2A 1N75A 1BR2A 2M30A 5KK1A 4XL9A 3S32A 3SDBA 2M8EA 3ECOA 3IP4B 4I2OA 1JTXA 1UG2A 1YJWI 1BOAA 2LLKA 3VYSB 5HLTA 4D7NA 1ZGWA 3EETA 2DOEA 3FXMA 4CICA 3J80K 1GVDA 1HC8A 2CV2A 1XPXA 2CH0A 4AYBA 1YS7A 4XSZF 1R36A 2JZYA 2XKPA 1Y1VJ 1YITI 3QOPA 1I27A 5JFRA 4HG2A 3T5XA 1TP4A 3PNYA 3GTGJ 4C2UA 2CYYA 2D45A 2X4HA 2RNGA 3HYIA 2V26A 1QZZA 2XGXA 1Z67A 2IJLA 4RMNA 4BE1A 4ENMA 3KIOA 3ZMSA 1HCRA 1MBJA 3C2HA 3DEWA 4XSXF 3K4KA 2K4BA 4C30A 2OJED 1X4OA 3BROA 4E7JA 2GOMA 1OR7A 2QCOA 5ICGA 1I6XA 1O7LA 1V55H 2F5CA 4PJMA 4CCNA 1EH6A 4YG2F 3QPTA 1VFCA 1IJWC 2FQ3A 1EH8A 5DCMB 3TBIA 3OS2A 5J8CA 4O6JA 2E7WA 4AIHA 2ID3A 4XN3A 4N0BA 4AIJA 2PLYA 2Y0SN 4JK1X 2PMHA 4CXFA 4DNCA 4AWXB 3I56I 3OYCA 4BYYA 2CO5A 4ZH4F 1B59A 4UUSA 4HX7A 2O5RA 4I01A 3L2QA 4XK4A 4RLQA 3OR2C 1DU6A 5C3EJ 3VEPA 3KP2A 4GGGA 4P96A 2DFHA 2G7HA 3ML6A 4UUSB 2V1DA 1T0FA 1KQ0A 5IOYA 1WRJA 1WJFA 3N4MA 3H3ZA 2WV0A 4Y33A 4RM2A 2DAOA 3V8JA 2R93J 2HYGD 3D5RC 3OL4A 3LSRA 1Y0UA 1R71A 1O7FA 2IGOA 5F08A 1HKQA 3AG4H 3DU6A 1G3TA 3GTMJ 3WU0A 1UAAA 3ZMVA 3HRMA 2ZJPF 4BDYA 4HPQA 4PFOA 5M3FJ 2ZXJA 3PIOF 4IHWA 2O7OA 2MW8A 2X48A 4IF4A 4KN4X 4AYBN 3MVPA 3CJQB 4DZPA 4WX9A 1VQ8I 3IH4A 3DKWA 2DA6A 4NHJA 4ZYEA 5LD2C 1FNNA 4IRHA 2V1NA 3ISPA 4HAMA 2VT3A 2H8RA 2LY9A 2RQPA 3RYRA 1YYVA 2P5LC 5FKNA 4ZZLA 5KHDA 3OYGA 4G12A 5F1RA 5JLXA 2ETHA 2VE8A 2XVCA 4HNUA 4QWQA 2FU4A 4UY8I 5FKKA 3R4KA 4FISA 1T98A 1KYWA 2LFBA 4AUXA 3HPGA 1MMSA 1FSEA 2DT5A 1OCCH 2P5VA 4UHTA 3GEZA 3HHGA 1FWZA 1S9HA 5FFZA 5FRMA 1OYWA 4Q5SF 1LUJB 4BGDA 3QOEA 3IWZA 2VT2A 2V1XA 2FNPA 2X6YA 3QYEA 2XSJC 4IQJA 3GZ6A 1TWHJ 2E5NA 2L7ZA 2UV1A 4XNFA 4E4HA 3VB2A 2Z9OA 2DCEA 5LHHA 1VQOI 5E18F 1K61A 2DA7A 2HGCA 1F1ZA 3GZNB 1KGSA 1J9IA 3K2AA 3GF2A 5JI6A 3ELKA 4BXUA 1ZRDA 3EUKL 3PNVA 3JAMZ 4ESFA 2R3SA 2GIZA 2DBBA 1R5GA 3PFYA 5IOZA 3SFIA 2Q0OA 1RKTA 4EATA 2FQ4A 3HUGA 3SDGA 5GAEJ 2HZDA 1APLC 1Z05A 2R4GA 3V42A 3AFHA 3KYCB 4ABZA 4U0VA 2ZKZA 3ZPLA 3HUGB 1RPWA 3IAS2 2QENA 1O57A 2FRHA 5DUIA 1OQYA 2ESHA 1PJRA 2NVUB 4IHSA 5IP6A 2NVXJ 4UB8C 3LSJA 2IEKA 1CGPA 2DTZA 2BVLA 4K2EA 2TRTA 2O03A 4LLGF 3SEZA 2BW3A 4X0GA 2F4IA 1A5JA 4UV8A 3V4GA 1EH7A 1GXQA 1VNDA 4KUMA 2LNBA 1HLVA 3R60A 2BW3B 5L3EA 2V9KA 1OCOH 5EEHA 5F04A 2LD5A 1BW6A 1Q1VA 1Y8RB 4A3EJ 5GTIC 4RGXA 4U0YA 1D3YA 2I5UA 4I98B 4M71A 2HKOA 3PNTA 4EJVA 3DF8A 3LSPA 1B9NA 1R1TA 4BY7J 2HQAA 5D4RA 1EF4A 3DTKA 2E34A 3H0DA 3MZYA 4B3XA 1W36D 2O3FA 3BR2A 2FNAA 1SD4A 3DV8A 2IW5A 1FYKA 2CV0A 3LSMA 3QWLA 1T08B 3PSIA 5KVRA 4EM1A 3ZQIA 2STTA 2XAQA 5L3FA 2WAQA 2R7DA 5J47A 4AC0A 1XGMA 4OIPF 1R7JA 2DDAA 4O3MA 5IY5H 2LDUA 1QU3A 2MA3A 3MZ8A 1KU9A 1SD7A 2FX0A 3TO6A 1ZRCA 4RGUA 1ITYA 2EBIA 4E7ZA 2L54A 4HA8A 2RC4A 3FMQA 2K3FA 3A0HC 5FLMJ 3FDYA 4G6DA 3VYUB 1S7EA 2NOGA 3ZMTA 2X6WA 2LY1A 1E2XA 2W24A 1S29A 1WJDA 4KNYA 5K5QA 1ZG1A 2PBIA 2EIMH 3OWTA 2D5VA 3KP5A 1Z6RA 2MBFA 3HSRA 2JT1A 3M7GA 2CQKA 3ZN0A 1FEXA 6PAXA 5HS9A 3N05A 3K70D 1U78A 1P6RA 4HV5A 1GV2A 1QVTA 1U6GA 2X1CA 2E1MB 3L2CA 3FXUA 1OLTA 3SYTA 2DMTA 3H35A 1Y1WJ 5HLGA 4KYWA 2R7VA 4EGZA 3OSGA 1BIBA 1MBEA 3HKZA 3WHBA 3AAFA 3HB9A 2MLKA 1N78A 4S05A 5K1YA 4EJTA 3IRRA 4KIBA 2BEOA 3WODF 1YIJI 3L7WA 1BOBA 3AL0B 2WBMA 5JHUA 1F4KA 4HLYA 5CKTA 3ZQHA 3RZOJ 2HQNA 1H9TA 3GO5A 2LH9A 3FIWA 3GBGA 5KAIC 1J09A 1W7PD 2F2EA 4BJ5C 5FJ8J 2DFFA 1D8JA 1LFUP 1MBKA 2ECCA 3VOEA 4LOCA 1NHAA 2BV6A 1OR7C 2ZSIB 1OPCA 1WJCA 2BBYA 4AIDA 3J7ZI 3PM1A 1AU7A 2EA2A 3Q9SA 4PJLA 4XLNF 5B3SH 1XMAA 2XF7A 5LLQA 4DBRA 1Z21A 4XIDA 1WSUA 1I3AA 2FBKA 2VQGA 3HBLA 1ZELA 3FXOA 3LMMA 4EEFG 1AA7A 4EQQA 1FP1D 1YW9A 2W57A 3RIRA 4ZTJA 5TJJA 2CQNA 3DLLF 4P55A 5HDGA 4A5MA 2HPIA 3P9IA 3FKJA 3TOBA 5J4YA 5FLXZ 3K69A 2A6TA 4M72A 1WI9A 5E8IA 2J5PA 4XORA 1MMDA 3CCUI 3E6MA 2HOAA 1T0FC 3SZPA 2JK3A 1LQ1A 2H8WA 3MFKA 3S1RJ 3OYIA 3KP3A 5D4SA 4E7LA 2LMDA 2YS9A 1J2XA 1YW8A 3BTJA 4G9YA 5F27A 3RPUD 3COAC 1YJNI 2VLAA 2Q8KA 4QSHA 4WK8F 1DP3A 1GXPA 2CFXA 5LHIA 3CTAA 2CQ7A 2KKOA 1JE8A 4M3BA 1A36A 4LFUA 1FOXA 3IL2A 3C2BA 3L9FA 2OBPA 3I59A 3KYDB 1G59A 2Y0MA 5ICFA 4Z2YA 2GM4A 1XSDA 3HKZN 4B48A 1ZLKA 2CWEA 3VFZA 4I0AA 3WU2C 4L0ZB 1W7PA 4B1RA 2FOWA 1WKMA 4D0PA 1CQTA 1HF0A 4U7DA 4AD9A 4RBOA 4G94A 1XX5A 4L9NA 1FOYA 3ZCOA 1AKHA 4RGSA 4L9TA 4XLHA 4EJOA 1DGRM 3TGNA 2DTRA 2R7FA 1B72B 3F3XA 1AKHB 1PP7U 1TWGJ 1UHMA 4WWCA 2BY2A 2CQQA 4I6ZA 3DP7A 3OYHA 1JUMA 4ZDLA 4OMYA 2P0WA 4PZJA 2RKHA 2IRFG 5J4VA 2K85A 4M3FA 1ETYA 5ILUA 2XB5A 4ESJA 4HQEA 2GLOA 1OKRA 2Y9YA 2EPFA 5EZHA 4RM3A 2FUG2 5FROA 1ON2A 3SHFA 3QYBA 2MSYA 2WC2A 4CCMA 2BGCA 4UUTA 4RA2A 1LFPA 3A02A 1QRYA 2ELHA 5DYMA 3RPUA 3KYLA 3SEQA 3FXLA 4EM0B 1WJAA 4R8HA 1TQPA 5DCFA 3RQ4A 4GDFA 1D5YA 4QLCU 2L0KA 2UXXA 1U3EM 4C3HJ 1O3TA 2ZNYA 1RKWA 4DBQA 4GXOA 3SZGA 3M8EA 2CRGA 3K6GA 2VI6A 2E2JJ 3VYRB 1J75A 2BOLA 2DLLA 3LFUA 2LF8A 2XF5A 4HOBA 2AQFA 5F64A 4BE2A 1VZ0A 3J7AO 4OAZA 5M5WJ 2YU3A 1IN6A 2KMUA 3WTUC 2QQ8A 2OCCH 3LAJA 5F0HA 2OD5A 3PIPF 2IGKA 2ELKA 3KLOA 1YRNA 5B66C 3LSGA 3QP5A 4P9FA 1E17A 1WZ2A 5L3DA 2AO9A 2DT6A 2Q1ZB 4L9JA 1KU2A 3GX4X 3BG7A 4NUBA 3IRQA 1YRNB 2KPMA 3R61A 1T8IA 4M9XA 1D1BA 1N25A 1RNLA 2HFHA 4HZFA 4QIWN 3GTPJ 3N97A 1G3WA 4P9UA 3HOVJ 1FIPA 4MFDA 3BR3A 1ETVA 2WY7Q 5TISC 5LGTA 2W25A 2JQ7A 4MIMA 5IYCJ 4FT8A 1XD7A 2JPBA 1D0YA 2FJ1A 3HIFA 4IJAA 4DOZA 3MN2A 4B43A 4CO8A 5D5UB 4X6AJ 2HPMA 3BJOA 4HF2A 2CJJA 5LGNA 2L7KA 1I1SA 5IP7J 5H20A 2P4WA 3CCLI 2CUFA 2KDZA 2Z99A 1XCBA 4ESBA 2EIJH 1NK3P 2XF6A 2QSGX 1ETXA 3K1NA 1BL0A 3UNGC 3S1MJ 1R6RA 2L3DA 4PSWA 3W6JB 1XGSA 4A3LJ 1D0XA 4HRIA 2ZNZA 3BC8A 3I54A 2MABA 3OY9A 4CCLA 3PO2J 1YQAA 1FBSA 3JTGA 1T38A 3O8HA 1PUEE 1ACIA 2G9WA 2Y48A 3S93A 2ZFUA 1OJLA 5GP9A 2Y75A 3ABLH 3T8TA 2M7AA 5LGUA 3OR1C 2P8TA 2DN0A 4Y4RA 2WB1N 2X1DA 4N4OB 1ZQ3P 3Q5FA 1TQMA 3WG9A 4U0WA 1YJ9I 4A3CJ 1XSVA 2RQQA 3KE2A 3ABTA 4ANJA 2HDCA 2HVRA 1BI3A 5KNLA 2CW0F 2M8GX 1FTZA 1TWCJ 2E1MC 5CQGA 3CC7I 2IT0A 3CDHA 3HGGA 3ONQA 2BHZA 3GTJJ 2W7NA 2DODA 1HKTA 2OF7A 2QQBA 4LG3A 3I71A 5EGOA
chains in the Genus database with same CATH topology
2L2OA 2V1NA 2Z16A 1X4PA 4CCJA 5KHDA 1D0ZA 3OYGA 1N77A 4J00A 4HNUA 4Y3OA 2XDVA 4II3A 1TT0A 4KISA 2ZXHA 4ZDOA 2WY8Q 1MMAA 1SAUA 3HPGA 4DGWB 3H9JA 2UUZA 4E7HA 3K4LA 3KEYA 1S9HA 5FRMA 3OIPA 4BGDA 4IX7A 2IXSA 3QOEA 2M4KA 3HPHA 1PYVA 1T95A 4BQQA 2VQCA 2WB1A 3DWLE 2X6YA 4RLFA 1DGWY 3QYEA 2XSJC 4IQJA 2E5NA 2UV1A 4XNFA 4E4HA 2DCEA 4XKVA 3BLYA 1UELB 2LG4A 2VXDA 3D5SC 3MKWB 3DQVC 1MMGA 4BACA 4F55A 1K6YA 4BU2A 4NC7A 4BEHA 3EUKL 3PNVA 3ZQQA 2K5CA 3PFYA 2W4SA 3VSLA 4F91B 4EATA 3K70C 4XKCA 4XONA 4BEHB 2HZDA 2W82A 5LFAA 1G8XA 2R4GA 2VL8A 2R7TA 3OYEA 3V42A 3AFHA 5HNHA 1EA3A 2VASA 3K10A 3KX2A 1KONA 2HDWA 3HUGB 3IAS2 3K4BA 3PJRA 3L2UA 1LVKA 4BJTA 5HNFA 1PJRA 4KJZA 1D1AA 2W1OA 3U21A 2BVLA 2MYSA 2V4JC 2E60A 4BS9A 2LC2A 2F6CA 3VYTB 1FMVA 5TGTA 3SEZA 2BW3A 4E7SA 4X0GA 2F4IA 2NOJB 3G2BA 2IGNA 2MFZA 4LITA 1HA8A 4HNTA 3OYNA 2BW3B 2VJ4A 2V9KA 1QHHD 3DLAA 1E0EA 2XAUA 2X6XA 4D9JA 4F52A 1X1AA 4QPOA 2JUGA 3S3NA 1X19A 1LKXA 3PNTA 2L9SA 2OUMA 2VB6A 3OYMA 2HQAA 3DTKA 3H0DA 3OMYA 1IRXA 2F5VA 4B3XA 2KQRA 1W36D 3I3LA 3RSNA 1NG6A 2CV0A 3LSMA 3PSIA 3VDXA 3I9V2 1UG0A 3LSIA 2WAQA 4BXFA 3D5LA 3OYKA 2QKMB 4U87A 1QU3A 3LSHA 2ZSHB 3RCOA 5FRNA 1YE9A 4II2A 4E7ZA 2K9MA 3OYAA 1Z3YA 3FDYA 3VYUB 2PJRA 2X6WA 1WFXA 2LY1A 3H9QA 4J01A 3K4NA 1WJDA 3AL0C 4XMYA 4BL0B 2JVGA 4H4KC 2AQEA 3MMYB 3CMMA 3OWTA 2A5WA 4F3QA 4DIQA 3NWTA 4B47A 2PJRB 3BCAA 2LREA 2K3PA 1BR1A 3S8PA 2IS1A 3IUOA 3M8JA 3N05A 3K70D 4PSXA 4FETA 4CCKA 2DT7B 2X1CA 3AKZA 2M4GA 4G6TB 2E1MB 3TMOA 2R7XA 4NNJA 2JSPA 4OWRB 3LL7A 3S3MA 3HL2A 2IS2A 3DPLC 1OLTA 3SYTA 3H35A 2X1EA 2CUZA 3FBNB 2R7VA 3OS1A 3HKZA 4JQFA 3PL8A 3HG9A 4GRIA 3DEEA 1N78A 3NWSA 3AL0B 1BOBA 4P5OA 2WBMA 3C2GA 4LIVA 5CPRB 2L9NA 2LBFA 1X1BA 5CKTA 5HOOA 2LH9A 3L2RA 3GBGA 2DJIA 4XLAA 1J09A 4BJ5C 2GOXB 3CESA 3LSKA 3HOSA 3MD2A 2LBFB 4ZC3A 2CFOA 3ZXSA 1OR7C 4E7KA 2ZSIB 2K9LA 1YX3A 2KLOA 4PJJA 4YRVA 1WJCA 4YEJA 4NC8A 4PJLA 3DPUA 4BQNA 2XF7A 4DBRA 2WAFA 3CP2A 3W3CA 1Z21A 2V6EA 2VQGA 3OYDA 1MNEA 1ZELA 3LMMA 1AA7A 3OYLA 1JI8A 4ZTJA 3L2WA 2VKDA 3K4CA 2HVQA 1MNDA 2HPIA 4CA0A 3K4MA 3FKJA 2WAEA 3H5AA 4CUGA 4PJNA 1Y56A 2A6TA 4IQ4A 3DPTA 3EUHC 4XORA 2KHMA 1MMDA 1U0JA 1T0FC 2VKHA 2VJJA 2ZXIA 2QKLB 3FHNA 3MKZA 4BE0A 1MW7A 3H5RA 3H9GA 3OYIA 3A2KA 2R7RA 4E7LA 3RPUD 3W2AA 4FASD 3UR3C 2VQLA 2VLAA 4NQWB 5JHFA 1DP3A 2HNHA 3PSFA 1P9QC 4P1WA 1LDKB 4PK4A 2KDOA 2OC6A 4AU7A 3OYFA 2CUJA 2R7WA 4XLCA 3RTRA 1DQUA 4N4NB 1G59A 3FBIB 4B48A 4ZTFA 4E6KG 1Y6IA 3OIQA 2JVHA 2KZVA 3IAM2 4HEA2 4F92B 4PUSA 3F9KA 3DKXA 4JOMA 3EPZA 3ZCOA 4C2TA 2CW8A 4XLHA 4ZJZA 1DGRM 2M3AA 1WJEA 4XN0A 3DKYA 4LIUA 4BDZA 2MD0A 4PFPA 2UWMA 3OYHA 3M1CA 1X1DA 4ZDLA 2P0WA 3DTIA 2BVMA 3HXLA 2KRCA 4XLEA 2R7QA 4AVZA 2VPLA 2OV7A 2VIXA 3BG6A 2DOAA 3DTEA 4RM3A 2FUG2 5FROA 3A4CA 2DXIA 3OL3A 4XM3A 4IKFA 3W2WA 3QYBA 4QPQA 3CJRB 4CCMA 2KRHA 1LFPA 4YELA 4ZYAA 1Z3XA 2Y0SA 3HOTA 4XQFA 2IGMA 3A1YA 3KYLA 1WJ5A 3SEQA 3OOUA 2CMPA 2XC7A 1WJAA 3RQ4A 2ELJA 4XLFA 4IZZA 1TZLA 3CF2A 2VXZA 3H5NA 4XKBA 3W2VA 2I8DA 3VWBA 4XKWA 5KCMA 2IS4A 1W36C 4B44A 4CH7A 2RREA 4DBQA 1BR4A 4BJ6C 2LY2A 3SZGA 3L2VA 3ZR8X 3K6GA 3VYRB 1N75A 1BR2A 4DJAA 3TL4X 4BUPA 4KITB 2CV1A 2BOLA 3LFUA 4XL9A 3S32A 2XF5A 3SDBA 2Z2SB 3IP4B 2AQFA 4BE2A 3OYJA 1VZ0A 4OAYA 4E7IA 1V5FA 4OAZA 3QYFA 4CZCA 2KMUA 3VYSB 2IS6A 5HLTA 2IGKA 2X85A 1SFKA 3LSGA 1FMWA 2CV2A 2W00A 2CH0A 4XOTA 4AYBA 2DT6A 2Q1ZB 3OYBA 1MMNA 3BG7A 4NUBA 4CSWA 2KPMA 3CP8A 4HG2A 3CZ6A 3E1SA 1YX5A 1D1BA 3PNYA 1V5EA 4C2UA 4R79A 2RNGA 3J7AY 2X51A 5HVQC 2V26A 4RMNA 3PUBA 4BE1A 3ZRGA 3C2HA 2VQHA 2M7BA 3K4KA 3BCBA 4C30A 2WY7Q 3E0JB 1X4OA 3HC7A 4E7JA 2GOMA 2Z1DA 2VJIA 2MC4A 3EUAA 4PJMA 2R7OA 4CCNA 1D0YA 5CQEA 4C9YA 4ZDPA 2WA0A 3TBIA 4DOZA 4MLOA 3OS2A 4B43A 1X1CA 4HSRA 2HPMA 3VSKA 2Q2EB 2L7KA 1V5GA 4XN3A 3ZGKA 2WADA 2E5ZA 3DU5A 1WJBA 2KL4A 3S3OA 3OYCA 2XF6A 2LOOA 1QHGA 3UNGC 2O5RA 1R6RA 1NG7A 3L2QA 1ERDA 4PSWA 2CW7A 4RLQA 2LYCA 3OR2C 2V7FA 1D0XA 4HRIA 2R7SA 3BC8A 4BQOA 2MABA 3OY9A 4CCLA 4HSTA 2KP6A 1WJFA 3MKYB 1Z7LA 3S93A 2HVSA 2ZFUA 4Y33A 2VJ5A 4RM2A 3OS0A 3K4JA 2HU9A 3D5RC 2M7AA 3OL4A 1D1CA 3OR1C 2IGOA 3DU6A 4Y4RA 1GLNA 2X1DA 4XR6A 2M0MA 4N4OB 4CCOA 1UAAA 4BDYA 2CS3A 2LRDA 4HPQA 4PFOA 2RQQA 4ITVA 4ANJA 2HVRA 2JA2A 4KT6A 5KNLA 4F93B 2R7UA 2E1MC 2L5QA 5CQGA 4XOPA 2PMZA 3ONQA 2W7NA 3CJQB 4D1QA 3QODA 4LG3A 4U7BA 5LD2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL3 A;  3OL4 A; 
#chains in the Genus database with same CATH topology
 2K40 A;  3E6C C;  2NVQ J;  2EV5 A;  3BQZ A;  2XAH A;  4CCJ A;  3CLO A;  2A61 A;  4KN7 X;  3F8B A;  4IVN A;  5EGO B;  3CMY A;  3HGY A;  4J00 A;  1UHS A;  4Y3O A;  4Y13 A;  2XDV A;  1CF7 A;  1TT0 A;  2W48 A;  3TO7 A;  4ZDO A;  2A69 F;  3P9C A;  2GQQ A;  2E35 A;  2WY8 Q;  1X3U A;  1MMA A;  1SAU A;  2MH9 A;  3H9J A;  3H1C A;  4DGW B;  1CF7 B;  2J5O A;  2UUZ A;  4MNU A;  3KEY A;  4E7H A;  3CCY A;  3KET A;  2OAZ A;  4OMZ A;  1UST A;  2IXS A;  2M4K A;  1IUF A;  3CUO A;  3HPH A;  1PYV A;  1R1U A;  4LMY A;  2VQC A;  1TW2 A;  1DGW Y;  3M3Y J;  1G3S A;  1GDT A;  3K0L A;  1KYZ A;  2EA4 A;  4B09 A;  2XRN A;  1IUY A;  2EZH A;  2KIU A;  2LG4 A;  1FZP B;  2VXD A;  4ZZD A;  1TWA J;  3D5S C;  3DQV C;  3F8F A;  3PUF A;  1F36 A;  3TW7 A;  1K6Y A;  2HI3 A;  1G2H A;  1UCR A;  4BEH A;  5FD6 A;  1IXS B;  3ABK H;  3E97 A;  2K5C A;  4F91 B;  5CVI A;  3ERE D;  4S0H B;  4CGZ A;  1B1B A;  3K70 C;  1FJL A;  1MSE C;  1MKM A;  2KFD A;  4XKC A;  4BEH B;  3WTW C;  2W82 A;  5LFA A;  1YTY A;  5DCM A;  2VL8 A;  2C6Y A;  4A2U A;  3KX2 A;  5E1X A;  1KON A;  2FE3 A;  4RAG A;  2EQR A;  2XV4 S;  4A5N A;  1LVK A;  5ILV A;  1W5S A;  2QEX I;  1SAX A;  3JW4 A;  1NK2 P;  5HNF A;  4WXD A;  2XGD A;  4IO9 F;  3MZH A;  4CYD A;  2W1O A;  4M74 A;  3NEU A;  2M2E A;  1Y39 A;  4M9Z A;  3U21 A;  1RUO A;  1HSJ A;  2IP2 A;  2MYS A;  4M6X A;  1U5T A;  2VOD A;  2V1U A;  4M6Y A;  4BHB A;  2DMN A;  1LE8 A;  1W1W E;  4BS9 A;  3E6D A;  3L1P A;  1E3P A;  3CMA I;  2EFW A;  3EQL F;  3HM5 A;  4E7S A;  3J80 Z;  3BG5 A;  2DI3 A;  1P4W A;  1U5T B;  3SZT A;  2NVY J;  4BBR J;  4NB5 A;  2B9S A;  1LE8 B;  2QVO A;  5IYB J;  5JR3 A;  2DU9 A;  1E3O C;  4HNT A;  5DS9 A;  2O0Y A;  1VQ7 I;  2PX9 A;  4M9S A;  1MH3 A;  3DLA A;  2BY1 A;  2HOS A;  1ETK A;  3E6B A;  3WTX C;  4RGR A;  3CO7 C;  2FOK A;  5BNG A;  3HOU J;  1JKR C;  3DXJ F;  4D9J A;  1P2F A;  2JUG A;  2FBH A;  2LKS A;  3S3N A;  1JHF A;  3FHZ A;  1ZAR A;  2L9S A;  1R5H A;  2OUM A;  3OYM A;  3BDD A;  1D8K A;  5DDG A;  1EJ9 A;  5L3G A;  1FT9 A;  3WTZ A;  3RSN A;  1JXS A;  1NG6 A;  5FB2 A;  2DA4 A;  1KU7 A;  4EM2 A;  4I99 C;  5IT9 K;  2JTV A;  3BG9 A;  4C3J J;  1BC8 C;  3ABM H;  1ZK8 A;  4BXX J;  2VOP A;  2XHK A;  4BXF A;  4LJZ F;  1I39 A;  3F22 A;  1JGS A;  5JVT A;  1MH4 A;  2OZU A;  4GYI A;  1QA6 A;  5GAG J;  3RCO A;  1YE9 A;  4MEX F;  3S2W A;  3DBR B;  3E3V A;  3IV5 A;  1Z77 A;  5DD4 A;  1KA8 A;  1SVO A;  3H9Q A;  5D5W B;  2ZJQ F;  4LB5 A;  1NTC A;  2EWN A;  4XMY A;  3EDP A;  2HTS A;  1X3W B;  3GFJ A;  5IPA A;  3AG3 H;  2UZK A;  4H4K C;  2IA0 A;  3CMM A;  1VQK I;  4BY1 J;  3BCA A;  2LRE A;  1HQC A;  3V7C A;  2K3P A;  5C44 J;  3S8P A;  5D6E A;  3DCF A;  5D6F A;  3LOC A;  3M8J A;  2LF7 A;  3KCC A;  3KEO A;  4PSX A;  2BYV E;  4HBL A;  4FET A;  4CCK A;  3SJM A;  2DT7 B;  2FF4 A;  5K7Z A;  4NNJ A;  3ZQG A;  2JSP A;  1IRF A;  5GPC A;  4OWR B;  1ON1 A;  3S3M A;  5FKM A;  5IYD J;  2HXI A;  5IT9 Z;  4FTH A;  1B6A A;  3LQR A;  4MHG A;  3FBN B;  3FZV A;  4M73 A;  2M1B A;  3OS1 A;  1LJ9 A;  3HRS A;  4GRI A;  1UZC A;  3NWS A;  1FYL A;  3CO6 C;  2IA2 A;  3BJ6 A;  1XSX A;  1BI0 A;  5KAF C;  1WH5 A;  3M8F A;  4LIV A;  1WPK A;  1X1B A;  4Y52 J;  4N9I A;  5J6X A;  2EZI A;  3CDI A;  4HX8 A;  1WGX A;  4YFK F;  3F23 A;  3LSK A;  3CCJ I;  4ZC3 A;  2CFO A;  1ZRE A;  3ZXS A;  1IC8 A;  1BI1 A;  2FBI A;  2KLO A;  1PUF A;  3TOA A;  5BQT A;  5CVJ A;  4UVA A;  1Q1H A;  4YEJ A;  1TNT A;  3DPU A;  1O3S A;  1VQL I;  3GFM A;  2WAF A;  1GVJ A;  3CP2 A;  4DYC A;  4ETS A;  1PUF B;  1ZGJ A;  3RI4 A;  1ETO A;  1MNE A;  4A0Z A;  3K1P A;  3QPS A;  3FKI J;  3TO9 A;  3S15 J;  2L9R A;  4A0Y A;  2DA1 A;  2VKD A;  3K4C A;  1VQ9 I;  4CA0 A;  3JRI A;  1REP C;  1A6Q A;  2WAE A;  5E3L A;  1TL8 A;  4IQ4 A;  2V9P A;  2UXN A;  3DPT A;  3NAR A;  3ZOB A;  1X2N A;  5E1W A;  2FEZ A;  3ZN1 A;  1HST A;  2VKH A;  2QKL B;  3MKZ A;  4BE0 A;  1MW7 A;  3H9G A;  5ED4 A;  2EJR A;  2R7R A;  4CHU A;  3LFK A;  1PP8 F;  3C1D A;  4IXA A;  3FXQ A;  4EJW A;  2EFO A;  3K7A J;  3F8M A;  1P9Q C;  3QU3 A;  3CJN A;  1QNT A;  2CUJ A;  3RTR A;  2DPU A;  3FXR A;  1DQU A;  3IH3 A;  3JRH A;  3S1Q J;  3FM3 A;  3MCZ A;  4ZTF A;  4E6K G;  3HRT A;  2JVH A;  4L5I A;  4A12 A;  2LTP A;  1SMY F;  4A3D J;  2W84 A;  4JX6 A;  1W5C C;  1JKP C;  2O6G E;  3HDD A;  4A3F J;  4LLL A;  1ZR4 A;  2CW8 A;  2L9V A;  3ZQ7 A;  4ZJZ A;  2L4M A;  2M3A A;  4AM3 A;  4BHP A;  4IRG A;  2AXL A;  1WJE A;  1XGN A;  3DKY A;  3C3W A;  3F21 A;  3GTL J;  4BDZ A;  1ZH5 A;  3Q3S A;  1U8R A;  2UWM A;  2DA3 A;  3H3V K;  3K2Z A;  1X1D A;  3M1C A;  4KIC A;  4BHC A;  3DTI A;  3I55 I;  3ZQL A;  2HZT A;  4XLE A;  4FCY A;  2OTJ I;  5B1B H;  1HW2 A;  2VPL A;  2N8G A;  1JT0 A;  4L5J A;  2K9S A;  3DTE A;  5FKL A;  1RET A;  1Z7U A;  3A4C A;  4FE4 A;  3I4M J;  4A6D A;  1LEB A;  1R23 A;  2MGQ A;  3W2W A;  5ERI A;  2W85 A;  2Y30 A;  2VUM J;  5LEJ A;  4EV0 A;  5DM7 F;  4MTD A;  1Z3X A;  2A68 F;  5J8F A;  3S14 J;  2KT0 A;  3A1Y A;  3WTT C;  3M4O J;  4DW6 A;  3W6V A;  2CMP A;  2IVM A;  5L3B A;  2H6C A;  2ELJ A;  1X3Z B;  4IZZ A;  2HYJ A;  3CF2 A;  3LAP A;  2VXZ A;  3H5N A;  1XMK A;  2H94 A;  4XKB A;  3KZI C;  2KIS A;  4JP0 A;  3VWB A;  1P7J A;  2XGE A;  4B3A A;  2IS4 A;  2PI0 A;  3MWM A;  1K4T A;  4BJ6 C;  1Z9C A;  1LFB A;  3L2V A;  1IZ1 A;  1IXR C;  3ZR8 X;  2OA4 A;  2DMP A;  4UB6 C;  5LBQ A;  5LEK A;  2XAS A;  1QO0 D;  5A2Q K;  1PVE A;  2F5D A;  2NRA C;  4I7H A;  2K9N A;  2Z2S B;  5GAD J;  4IHX A;  1L3L A;  1G3Y A;  3QAH A;  1ZGA A;  3O2P E;  3GME A;  3IKT A;  4E7I A;  1V5F A;  3CD6 I;  3QYF A;  2YU9 J;  4CZC A;  4IOA F;  5B5E C;  1H0M A;  1BC7 C;  2A6E F;  2R7Z J;  5L3C A;  1T2K A;  1SFK A;  1P92 A;  4XOT A;  1IV8 A;  2QM3 A;  4B8X A;  1YG2 A;  1UJ8 A;  1MMN A;  2ADU A;  3CP8 A;  4KT5 C;  1ETW A;  2LKP A;  3E1S A;  1FBQ A;  1U5T C;  3CDL A;  3ASN H;  3FIS A;  1V5E A;  4R79 A;  4HNV A;  5HVQ C;  1WCM J;  3ZMZ A;  3PUB A;  3ZRG A;  3R0J A;  5HOD A;  1RI7 A;  2B63 J;  2VQH A;  2M7B A;  3I4P A;  5HDN A;  3JRG A;  3BCB A;  3E0J B;  4I09 A;  1T6S A;  2Z1D A;  3OSF A;  2PMZ N;  1Z0X A;  1OCR H;  1SFE A;  2R7O A;  1TLH B;  1FX7 A;  2Q2E A;  4C9Y A;  5CJ9 A;  4ZDP A;  1RUN A;  1QGP A;  3JRC A;  2WA0 A;  1GV5 A;  5C4J J;  3RKQ A;  1XB4 A;  4RAY A;  4HV6 A;  3ASO H;  4MLO A;  2QQA A;  1L0O C;  1JGG A;  3VSK A;  3C7J A;  2Q2E B;  3L09 A;  1YFH A;  1V5G A;  2H6B A;  3ZGK A;  2WAD A;  2E5Z A;  3DU5 A;  3TP3 A;  1PDN C;  3JCU C;  1WJB A;  2E2I J;  3HOZ J;  3HSF A;  5ICC A;  3H3U A;  1VQN I;  1E3H A;  2LOO A;  1QHG A;  1NG7 A;  2O9L A;  4MQ9 F;  1ERD A;  2M34 A;  2LYC A;  1K78 A;  3J81 K;  5FFX A;  2V7F A;  3V8L A;  2R7S A;  4PCQ A;  2PQ8 A;  3EUH A;  1YLF A;  1IN7 A;  4L18 B;  2L01 A;  2HYF A;  5DV5 A;  4WF2 A;  4HST A;  1VQ4 I;  2KP6 A;  1K78 B;  2NNY A;  1RC9 A;  1Z7L A;  2E1C A;  2VJ5 A;  5IT3 A;  2Z33 A;  1B72 A;  4UVC A;  5J1R A;  3E5U A;  3KP4 A;  3C18 A;  5E3O A;  1GLN A;  1FTT A;  3FMS A;  2M0M A;  1A04 A;  2P81 A;  4XR6 A;  4CCO A;  1W0U A;  1QZY A;  2CS3 A;  1F9N A;  4ITV A;  2MH2 A;  1ENH A;  4E70 A;  2JA2 A;  2MLG A;  4KT6 A;  4PGG A;  4F93 B;  2R7U A;  5DUK A;  3GFI A;  2QQ9 A;  4XOP A;  2EIL H;  3KFW X;  5FKO A;  5J3L A;  4D5F A;  1EV7 A;  2B0L A;  3QOD A;  3FX3 A;  3O6B B;  1FPQ A;  3MAJ A;  2L2O A;  5E3N A;  4HLX A;  3L00 A;  1WVR A;  1X4P A;  1DUX C;  3OV8 A;  2VC0 A;  2YX7 A;  4IL6 C;  1D0Z A;  3ZQC A;  1N77 A;  4NDL A;  3PO3 J;  1Z6T A;  3HTU A;  4II3 A;  4KIS A;  2O61 A;  2RAE A;  2ZXH A;  4XRS G;  1ZN2 A;  2A6H F;  4IHV A;  4KIG A;  1X2M A;  3BTC A;  2EZK A;  2HS5 A;  3CCE I;  2XPW A;  1SC7 A;  1IN8 A;  1VQ5 I;  2ZME A;  1K4S A;  4Y17 A;  2YSR A;  1WWX A;  1BIA A;  1X1P A;  2XAF A;  3ULQ B;  5GTH C;  3OIP A;  2ZME B;  5LRS A;  2P5K A;  1R22 A;  2OZ6 A;  1T95 A;  3B02 A;  2WB1 A;  3DWL E;  4RLF A;  3BT9 A;  1UB9 A;  1W4M A;  4QTR A;  2P7C B;  1ODD A;  1XC5 A;  1XMX A;  2DO7 A;  4PDK A;  4MGR A;  1ZAO A;  3D0S A;  1STZ A;  2QSF X;  5FGM A;  2LP0 A;  3JRE A;  3BZC A;  1SVL A;  2P6T A;  2OPT A;  2XGC A;  1MDM A;  3BOQ A;  3G1L A;  2XB0 X;  5JVG F;  4BAC A;  4F55 A;  3P9K A;  4BU2 A;  2K86 A;  4IRI A;  3CC4 I;  5HLI A;  4F7Z A;  3HOW J;  4ENN A;  1MDM B;  1XTA A;  5F0F A;  2W4S A;  3VSL A;  5E3M A;  2STW A;  3I53 A;  2R5Y B;  2MG4 A;  2GBY A;  1LVA A;  2KJC A;  4XON A;  1YIO A;  2CSO A;  4O5V A;  1IV6 A;  5HDK A;  1HBX G;  3LA2 A;  1EA3 A;  1BW5 A;  2HDW A;  1R4N B;  2M0C A;  3Q9V A;  3WGG A;  3PJR A;  3L2U A;  4YFX F;  2QUF A;  2DDB A;  4BJT A;  1BI2 A;  2BHY A;  3I58 A;  2KIF A;  4KJZ A;  1D1A A;  2PJP A;  2QLZ A;  3HZJ A;  1ZG3 A;  2EK5 A;  5CVU A;  4A3M J;  1EKE A;  2V4J C;  2E60 A;  5EYR A;  1G6N A;  1FMV A;  5TGT A;  3GUD A;  2QBY A;  2NOJ B;  2VPR A;  2BXY A;  1V54 H;  1YHQ I;  2MFZ A;  4LIT A;  4FE7 A;  1HA8 A;  3OYN A;  3BZK A;  2VJ4 A;  2ZC2 A;  3DBL B;  1FYM A;  1QHH D;  2QBY B;  1A6I A;  5F1J A;  2XAU A;  3EYY A;  1AHD P;  4F52 A;  2Z5U A;  1X1A A;  4QPO A;  1HDD C;  1X19 A;  4NC6 A;  1MJ9 A;  3QU6 A;  2VB6 A;  1OIS A;  2K9Q A;  2M5W A;  1IRX A;  1QZE A;  3I3L A;  2EFP A;  2ACJ A;  2DFE A;  2BZT A;  4XBF A;  2KIM A;  3VDX A;  1B8I B;  4H0E A;  1S7A A;  1UG0 A;  4GYG A;  4RDU A;  1SD6 A;  3CQZ J;  1M1E B;  3LSI A;  1H9G A;  1HW5 A;  1I50 J;  3OYK A;  4R1H A;  1JT6 A;  2QKM B;  1ONV A;  2DW4 A;  3T8R A;  3S17 J;  3LSH A;  3G73 A;  2ZSH B;  4RS8 A;  3A03 A;  1TNS A;  1ZKG A;  3OYA A;  2F48 A;  4MQV A;  1Z3Y A;  4CDG A;  5GAH J;  2PJR A;  4OIR F;  1BA5 A;  1RR7 A;  2LKX A;  3LST A;  4J19 A;  3AL0 C;  4G8X A;  2YX4 A;  5BPI A;  3NAU A;  3GTO J;  2AQE A;  1JUS A;  1R58 A;  2A5W A;  2PJR B;  3NWT A;  4WCG A;  4GFB A;  5EJC A;  2IS1 A;  3FWE A;  1BBY A;  1OFC X;  2GIV A;  4A3J J;  3B6C A;  2ISZ A;  1TC3 C;  3RPQ A;  3HOY J;  3ROU A;  2H1L A;  4YIF A;  1MNM C;  3AKZ A;  1JHH A;  2DOF A;  2GAU A;  2P7V B;  5FO5 A;  1R5I D;  2WWY A;  1FP2 A;  5E17 F;  1BJZ A;  2R7X A;  2DA5 A;  1V4R A;  1BN5 A;  2CQX A;  3DPL C;  1A31 A;  3MKL A;  1J7K A;  5DTD A;  2A05 A;  1OCP A;  2CUZ A;  1IW7 F;  1POG A;  5E1Z B;  3PL8 A;  2QYO A;  3ESW B;  1P4X A;  5DEQ A;  4FQG A;  4FX4 A;  2X9D A;  5LRR A;  3JRB A;  3TP0 A;  2HXO A;  3PQK A;  4P5O A;  3C2G A;  1WH7 A;  5CPR B;  4LLN A;  2L9N A;  1TW3 A;  4RB2 C;  3CCR I;  2FA5 A;  5CLS A;  2XAJ A;  1WHU A;  3L2R A;  2VBZ A;  1G4D A;  2KJB A;  1ZTR A;  1U9O A;  2GOX B;  3GTK J;  3MD2 A;  1ZR2 A;  4M3E A;  1SAN A;  1YX3 A;  3KLN A;  1K7A A;  1LEA A;  4D7M A;  2A3S A;  2QF7 A;  3REO A;  4NC8 A;  3AG2 H;  3DFG A;  2GWR A;  3JTH A;  3JRF A;  4OIN F;  3W3C A;  3F6V A;  4MO7 A;  2V6E A;  1T33 A;  4V2G A;  5D8K B;  3BTI A;  3WU1 B;  5ICE A;  2BXZ A;  3OYL A;  1JI8 A;  1SD5 A;  3PFI A;  2E2H J;  3L2W A;  2A07 F;  1ORK A;  2JRT A;  1RIO H;  1MND A;  2KZG A;  2A5Y B;  1DP7 P;  1GT0 C;  4CUG A;  3KZY A;  1Z1D A;  1I6H J;  2YR2 A;  3BR5 A;  3TKY A;  4PGH A;  1R9T J;  4G7H F;  3EUH C;  4KDP A;  3QQA A;  2KHM A;  3I4N J;  5F6F A;  1IF1 A;  2VJJ A;  2ZXI A;  4A3I J;  2DMU A;  1SFO J;  1HKS A;  3H0G J;  5HS8 A;  1MBF A;  3UR3 C;  4FAS D;  2VQL A;  5JHF A;  4ZYH A;  5DM6 F;  4L9V A;  2EB7 A;  2EFQ A;  3FF5 A;  2KIQ A;  4MFE A;  4P1W A;  5EDN A;  2L4A A;  2KDO A;  3QPL A;  2AHQ A;  3QPH A;  3LQQ A;  4A69 C;  1MBG A;  1LDJ A;  2VBY A;  4IEJ A;  4WXC A;  3SXY A;  3JRD A;  2DQR A;  4N4N B;  1OYY A;  4RB0 A;  5CVV A;  1YI2 I;  2QWW A;  2BE5 F;  1JKQ C;  1R00 A;  2R92 J;  4RB1 A;  2XAG A;  3H36 A;  4M6V A;  2WV1 A;  4HEA 2;  1IN4 A;  3RDI A;  4F92 B;  3F9K A;  3DKX A;  4IPA A;  5EEA A;  3JSO A;  1AWC A;  1UFM A;  3EPZ A;  3ZQF A;  3I0T A;  1YO5 C;  4C2T A;  2DA2 A;  3BPV A;  2L02 A;  2ISY A;  4I0B A;  2DMQ A;  2NS8 A;  4OOI A;  5LHG A;  2XIG A;  2DK8 A;  3X2Q H;  2VOO A;  5M3M J;  3HXL A;  1A35 A;  2YPR A;  2ZME C;  3IHU A;  2R7Q A;  4AVZ A;  2OV7 A;  3CME I;  2VIX A;  3BG6 A;  2DXI A;  1BJA A;  4IKF A;  1AOY A;  3WTV C;  2K7L A;  1LB2 A;  4QPQ A;  4UXN A;  3CF5 F;  2KRF A;  4YEL A;  2XPU A;  4ZYA A;  3JAM K;  2X6O A;  2MC3 A;  3HOT A;  1SFU A;  2G0E A;  2IGM A;  3ECH A;  2JA5 J;  3WTY C;  1FY7 A;  2EV0 A;  2ME0 A;  3CCV I;  5D5V B;  2PN6 A;  2I8D A;  1QQI A;  3CLQ A;  4XKW A;  4LK1 F;  5KCM A;  2R5Z A;  3P7N A;  4B44 A;  4CH7 A;  2TDX A;  3KZZ A;  1DPR A;  3U1D A;  3PQJ A;  5CYV A;  3Q0U A;  2JA8 J;  1O3R A;  1Z91 A;  4BQA A;  1HOM A;  4A6E A;  1TTY A;  1MSF C;  2GXA A;  2O8K A;  2FD5 A;  3GTQ J;  1T56 A;  2R5Z B;  3F0C A;  4DJA A;  1ZRF A;  4IHY A;  3TL4 X;  4BUP A;  4KIT B;  2JMW A;  2CV1 A;  2NS7 A;  3JRA A;  1WQ2 A;  1B4A A;  2XRL A;  3UKG A;  3OYJ A;  4OAY A;  4HX4 A;  3OIO A;  2GXB A;  3FMR A;  5EF6 A;  2VON A;  2D1V A;  3K1M A;  2O8X A;  2GXG A;  1P7I A;  1JKO C;  2IS6 A;  3M1E A;  2JUC A;  2X85 A;  4YFN F;  3SQN A;  1JJ6 C;  1FMW A;  1IO2 A;  2W00 A;  5K5R A;  3ZMD A;  4ASN A;  1HXD A;  1Y0N A;  4Z6Y A;  2VE9 A;  1W5T A;  3OYB A;  2F5F A;  2EIK H;  4ON0 A;  2E19 A;  4CSW A;  3CZ6 A;  1YX5 A;  3WHC A;  2F5E A;  1R49 A;  5D8L B;  3RYP A;  1VI0 A;  2X51 A;  4HF0 A;  3J7A Y;  3G6E I;  2LR8 A;  3TW6 A;  5J1U A;  4RAF A;  2M45 A;  2X0L A;  1OCT C;  3HC7 A;  2VJI A;  2MC4 A;  3EUA A;  2ZJ2 A;  4DYR A;  3G1M A;  3RKW A;  5CQE A;  1J59 A;  1IXC A;  5K7F A;  3GWZ A;  2K02 A;  1ZYR F;  2DK5 A;  1X1C A;  4HSR A;  1T39 A;  3U1K A;  3FXJ A;  3BR1 A;  1NH3 A;  2IA1 A;  3TDZ C;  3CUQ A;  5E20 A;  2KL4 A;  3S3O A;  2NXN B;  2OQR A;  2CUE A;  3ZP5 A;  4YIR X;  2I10 A;  3G4S I;  1K79 A;  2EFN A;  2HDD A;  1HW1 A;  4JBA A;  2XSD C;  2CW7 A;  1UHW A;  5FD5 A;  3CUQ B;  2QA4 I;  5HLH A;  5TRD A;  2COB A;  4BQO A;  3HOX J;  5EEG A;  1RZ4 A;  4ZYG A;  2HKX A;  3GXO A;  2XRO A;  4XRM A;  3MKY B;  3F6O A;  3Q0V A;  2COM A;  2HVS A;  5K7H A;  3OS0 A;  2RVC A;  1GHC A;  3K4J A;  5H2F C;  2HU9 A;  3ABU A;  2LSO A;  2HQR A;  1SMT A;  2ECB A;  2P6S A;  4RAZ A;  4B4C A;  1D1C A;  3FM5 A;  1LDD A;  1WI3 A;  4XLP F;  4RB3 C;  2ZB9 A;  3TQN A;  3E5X A;  1IG7 A;  4UV9 A;  2FXA A;  1TT5 B;  1MZB A;  3E5Q A;  2LRD A;  2ZBK A;  1TBX A;  3U2R A;  3K9T A;  4BH9 A;  2EV6 A;  2ZCW A;  2L5Q A;  4Y15 A;  2PMZ A;  2D2W A;  3BR6 A;  4Q47 A;  3G1O A;  4G6Q A;  2XUB A;  4D1Q A;  4U7B A;  5EG0 A;  2Z16 A;  4G7O F;  3GYH X;  3G71 I;  3BJA A;  5H6R A;  2H1K A;  4A3G J;  5EG0 B;  2Y2Z A;  2GZW A;  3O3K A;  3CC2 I;  5IP9 J;  1U2W A;  3T0Y A;  5E8G A;  1H89 C;  1H88 C;  2H09 A;  1R4M B;  3A0B C;  2JRM A;  2GA2 A;  4AIK A;  1S72 I;  1I3Q J;  2R0Q C;  2L7F P;  4TV7 A;  4N9H A;  3KP7 A;  3BZ6 A;  3GLX A;  3NQO A;  3LA3 A;  1B9M A;  3WGH A;  3K4L A;  2XKO A;  3GZ5 A;  3BPX A;  3GW2 A;  3R0A A;  4IX7 A;  5BPD A;  1ZHF A;  2Y9Z A;  2OTL I;  4YII A;  1VQ6 I;  2E71 A;  4BQQ A;  1IRZ A;  2HR3 A;  2K4J A;  5FLX K;  4UVB A;  2IBD A;  1X58 A;  3BP8 A;  3KPH A;  3RKY A;  4XKV A;  2YUS A;  2VKV A;  3BLY A;  1UEL B;  4A3K J;  1XS9 A;  1ZLJ A;  1S5L C;  3IC7 A;  1USS A;  3MKW B;  1I1G A;  1MMG A;  4XRF A;  1MBH A;  3R6S A;  4UUV A;  5AIP A;  1IDY A;  2VBX A;  1D5V A;  3CCS I;  1K83 J;  4BNC A;  4NC7 A;  2RGV A;  3P5J A;  3KP6 A;  3ZQQ A;  3HHH A;  2QZ8 A;  1ETQ A;  2VBW A;  2Y31 A;  4Y7N J;  4DZJ A;  1G8X A;  2R7T A;  2FMY A;  3OYE A;  2FSW A;  3RKX A;  5HNH A;  1IGN A;  2VAS A;  3K10 A;  3WGI A;  2DPD A;  2OQG A;  1YS6 A;  1XN7 A;  2WAQ N;  3BG3 A;  1F43 A;  4G7Z F;  4L0Y B;  4I76 A;  3K4B A;  4JYK A;  3IKV A;  3U9G A;  4S04 A;  1FC3 A;  3EYI A;  2ESN A;  5A2Q Z;  1KQ8 A;  2NS0 A;  4U88 A;  1XG1 A;  3S2D J;  1SEU A;  4OIQ F;  2DFI A;  1MD0 A;  4WXH A;  1FSH A;  1GUU A;  1S8N A;  2F6C A;  2LC2 A;  4HYE A;  3VYT B;  4BAY A;  4FHT A;  2H27 A;  4MEY F;  3E7L A;  3G2B A;  2IGN A;  3LWF A;  3CJT B;  2D1H A;  1C0W A;  4W1U A;  5J1Y A;  5M5X J;  1FLI A;  4IHT A;  4LK0 F;  4EVI A;  1H8A C;  3O8G A;  1F5T A;  1E0E A;  3FK6 A;  1KZH A;  3V8K A;  2X6X A;  4KMU X;  1IRG A;  2FML A;  4HW0 A;  5F0C A;  1QBJ A;  4GO1 A;  5E79 C;  1DPU A;  1LKX A;  1U8B A;  2IPQ X;  1VF9 A;  3OMY A;  3HJE A;  2F5V A;  2KQR A;  1XGO A;  2NYX A;  2GA1 A;  3W6K B;  3I59 B;  2F4M B;  3I9V 2;  1UMQ A;  1RR8 C;  4A3B J;  1JUP A;  1XDS A;  4MTE A;  3CCM I;  3D5L A;  4LD5 A;  4U87 A;  1FOW A;  1U9N A;  1W7P B;  5FRN A;  4II2 A;  1KQ9 A;  1LNW A;  2K9M A;  2E7X A;  2CG4 A;  4HQM A;  2PFB A;  3J81 Z;  2QGU A;  2WTE A;  1WFX A;  3G3Z A;  2VC1 A;  4J01 A;  3K4N A;  3I5U A;  4V2F A;  4BL0 B;  1KU3 A;  4CYC A;  2JVG A;  4DQ2 A;  3MMY B;  2IAI A;  4F3Q A;  3BY6 A;  3Q0W A;  4DIQ A;  4B47 A;  1J5Y A;  4OIO F;  1BR1 A;  4BBS J;  3GFL A;  2DYR H;  4FX0 A;  3IUO A;  2ZFW A;  4OU0 A;  3BR0 A;  5DD8 A;  4CYC B;  2DYS H;  4HDV A;  3TED A;  4ENJ A;  5BOX A;  4KIF A;  4UNO A;  2M4G A;  4G6T B;  5H6Q A;  1IN5 A;  3TMO A;  4M3G A;  1SFX A;  5B1A H;  3M07 A;  3LL7 A;  1TQI A;  3HL2 A;  2IS2 A;  2CU7 A;  2E1N A;  2ID6 A;  3LA7 A;  2X1E A;  2F4O B;  2OCE A;  2V6C A;  3B6A A;  4JQF A;  3VOD A;  3HG9 A;  1DDN A;  1LPQ A;  2L7M P;  2NVT J;  3DEE A;  2PG4 A;  2LVS A;  1W0T A;  2JA6 J;  3MEX A;  5J40 A;  4LGW A;  2TCT A;  4IOC F;  5BMZ A;  2QSH X;  2JA7 J;  4JX5 A;  2R5Y A;  2LBF A;  2E36 A;  3V7R A;  1JTY A;  1I5Z A;  2DQL A;  5HOO A;  2JPC A;  2DJI A;  4XLA A;  2RN7 A;  3WG7 H;  1VQM I;  2RNJ A;  1QPI A;  3ERM A;  3CES A;  4PJ0 C;  3HOS A;  2LBF B;  3WE2 A;  1VQP I;  2XPV A;  5GPA A;  4E7K A;  1S7O A;  2K9L A;  2K27 A;  2NAZ A;  4EMS A;  4PJJ A;  4YRV A;  3RQI A;  2AS5 F;  3QP6 A;  2HWV A;  4V19 K;  2JJ7 A;  5C4X J;  4BQN A;  2DJN A;  2G7U A;  3JSP A;  1VTN C;  2HTJ A;  4W97 A;  2E1O A;  3A01 A;  4M3D A;  2B7E A;  2PMU A;  3OYD A;  1MJA A;  2V79 A;  2M9H A;  3CUQ C;  3HRU A;  1FBU A;  2RDP A;  5CVR A;  2JN6 A;  3SFZ A;  3I64 A;  1QPM A;  1RRJ A;  1ULY A;  4JX4 A;  3A01 B;  2BY0 A;  2HVQ A;  3F72 A;  3GLL A;  4C2M J;  3HTS B;  3K4M A;  2BY3 A;  3H5A A;  4ENK A;  2CGP A;  4PJN A;  3WE3 A;  1Y56 A;  4L5E A;  3B73 A;  4BKX A;  9ANT A;  5AON A;  3V7S A;  4LG0 A;  4XRS A;  3S1N J;  1RES A;  4NQW A;  4A0X A;  1SVM A;  4KMF A;  1U0J A;  2EIN H;  3M9A A;  1K6O A;  3F8C A;  3FHN A;  1O3Q A;  2EZL A;  2PEX A;  3S16 J;  3H5R A;  1MGT A;  3A2K A;  5EZG A;  3BWG A;  4EGY A;  2HOT A;  3T1B A;  4HDU A;  3WTS C;  3W2A A;  3GVA A;  4LG0 B;  4NQW B;  3NRV A;  2VN2 A;  1XDU A;  3OOP A;  4C3I J;  3FK7 A;  2HNH A;  3PSF A;  3DBH B;  1LDK B;  4PK4 A;  4CZZ A;  4EJU A;  2OC6 A;  2HOE A;  3AG1 H;  3TDU C;  3ZMU A;  2M87 A;  4AU7 A;  3D1N I;  2ZJR F;  3OYF A;  3RZD J;  3J7Y J;  2R7W A;  4XLC A;  1B8I A;  1P4A A;  1Y8Q B;  2MD5 A;  3FBI B;  4X1E A;  1IAW A;  3S2H J;  1V3F A;  3HSE A;  1R1V A;  1YOV B;  1Y6I A;  3OIQ A;  1FIA A;  5K5O A;  1J0R A;  3KEQ A;  3FXK A;  2HEO A;  2KZV A;  1OYI A;  4I02 A;  3IAM 2;  2RV8 A;  1ZG5 A;  1HDP A;  1JJ8 C;  4PUS A;  3IWF A;  1DU0 A;  4JOM A;  5JLW A;  2NNN A;  3HEF A;  3F8N A;  3QRF F;  3MQ0 A;  3GCM A;  1O4X A;  4XN0 A;  4HF1 A;  3BQY A;  1FOK A;  4LIU A;  2MD0 A;  4Q48 A;  4PFP A;  2EH3 A;  2BVM A;  3RJP A;  2ZO4 A;  3VPR A;  1MIJ A;  2KRC A;  2Y69 H;  4A93 J;  3DEU A;  1MJB A;  5HS7 A;  5ILS A;  4DYQ A;  3LNQ A;  4ZYD A;  2DOA A;  2JWT A;  4GCV A;  5D5X B;  1OMI A;  1QVU A;  1S3J A;  4NBQ A;  3BTL A;  3OL3 A;  4XM3 A;  4XIC A;  4KFC A;  4D5C A;  1TWF J;  1S6L A;  1YW7 A;  2ICW G;  2JSC A;  2LK2 A;  5AIQ A;  3CJR B;  2KRH A;  3H92 A;  5FLV A;  2Y0S A;  4XQF A;  1OCZ H;  2AXT C;  2OU2 A;  1WJ5 A;  2VKE A;  2Z3Y A;  3IH2 A;  3OOU A;  2ME6 A;  5M5Y J;  3CCQ I;  2HQ5 A;  2XC7 A;  1IDZ A;  4XLF A;  4AVP A;  1BM9 A;  1TZL A;  3JR9 A;  2ZXW H;  3W2V A;  4Q4Z F;  2V9V A;  1W36 C;  4KA4 A;  1XCV A;  2RRE A;  5BS6 A;  4LB6 B;  1BR4 A;  2LY2 A;  1N75 A;  1BR2 A;  2M30 A;  5KK1 A;  4XL9 A;  3S32 A;  3SDB A;  2M8E A;  3ECO A;  3IP4 B;  4I2O A;  1JTX A;  1UG2 A;  1YJW I;  1BOA A;  2LLK A;  3VYS B;  5HLT A;  4D7N A;  1ZGW A;  3EET A;  2DOE A;  3FXM A;  4CIC A;  3J80 K;  1GVD A;  1HC8 A;  2CV2 A;  1XPX A;  2CH0 A;  4AYB A;  1YS7 A;  4XSZ F;  1R36 A;  2JZY A;  2XKP A;  1Y1V J;  1YIT I;  3QOP A;  1I27 A;  5JFR A;  4HG2 A;  3T5X A;  1TP4 A;  3PNY A;  3GTG J;  4C2U A;  2CYY A;  2D45 A;  2X4H A;  2RNG A;  3HYI A;  2V26 A;  1QZZ A;  2XGX A;  1Z67 A;  2IJL A;  4RMN A;  4BE1 A;  4ENM A;  3KIO A;  3ZMS A;  1HCR A;  1MBJ A;  3C2H A;  3DEW A;  4XSX F;  3K4K A;  2K4B A;  4C30 A;  2OJE D;  1X4O A;  3BRO A;  4E7J A;  2GOM A;  1OR7 A;  2QCO A;  5ICG A;  1I6X A;  1O7L A;  1V55 H;  2F5C A;  4PJM A;  4CCN A;  1EH6 A;  4YG2 F;  3QPT A;  1VFC A;  1IJW C;  2FQ3 A;  1EH8 A;  5DCM B;  3TBI A;  3OS2 A;  5J8C A;  4O6J A;  2E7W A;  4AIH A;  2ID3 A;  4XN3 A;  4N0B A;  4AIJ A;  2PLY A;  2Y0S N;  4JK1 X;  2PMH A;  4CXF A;  4DNC A;  4AWX B;  3I56 I;  3OYC A;  4BYY A;  2CO5 A;  4ZH4 F;  1B59 A;  4UUS A;  4HX7 A;  2O5R A;  4I01 A;  3L2Q A;  4XK4 A;  4RLQ A;  3OR2 C;  1DU6 A;  5C3E J;  3VEP A;  3KP2 A;  4GGG A;  4P96 A;  2DFH A;  2G7H A;  3ML6 A;  4UUS B;  2V1D A;  1T0F A;  1KQ0 A;  5IOY A;  1WRJ A;  1WJF A;  3N4M A;  3H3Z A;  2WV0 A;  4Y33 A;  4RM2 A;  2DAO A;  3V8J A;  2R93 J;  2HYG D;  3D5R C;  3OL4 A;  3LSR A;  1Y0U A;  1R71 A;  1O7F A;  2IGO A;  5F08 A;  1HKQ A;  3AG4 H;  3DU6 A;  1G3T A;  3GTM J;  3WU0 A;  1UAA A;  3ZMV A;  3HRM A;  2ZJP F;  4BDY A;  4HPQ A;  4PFO A;  5M3F J;  2ZXJ A;  3PIO F;  4IHW A;  2O7O A;  2MW8 A;  2X48 A;  4IF4 A;  4KN4 X;  4AYB N;  3MVP A;  3CJQ B;  4DZP A;  4WX9 A;  1VQ8 I;  3IH4 A;  3DKW A;  2DA6 A;  4NHJ A;  4ZYE A;  5LD2 C;  1FNN A;  4IRH A;  2V1N A;  3ISP A;  4HAM A;  2VT3 A;  2H8R A;  2LY9 A;  2RQP A;  3RYR A;  1YYV A;  2P5L C;  5FKN A;  4ZZL A;  5KHD A;  3OYG A;  4G12 A;  5F1R A;  5JLX A;  2ETH A;  2VE8 A;  2XVC A;  4HNU A;  4QWQ A;  2FU4 A;  4UY8 I;  5FKK A;  3R4K A;  4FIS A;  1T98 A;  1KYW A;  2LFB A;  4AUX A;  3HPG A;  1MMS A;  1FSE A;  2DT5 A;  1OCC H;  2P5V A;  4UHT A;  3GEZ A;  3HHG A;  1FWZ A;  1S9H A;  5FFZ A;  5FRM A;  1OYW A;  4Q5S F;  1LUJ B;  4BGD A;  3QOE A;  3IWZ A;  2VT2 A;  2V1X A;  2FNP A;  2X6Y A;  3QYE A;  2XSJ C;  4IQJ A;  3GZ6 A;  1TWH J;  2E5N A;  2L7Z A;  2UV1 A;  4XNF A;  4E4H A;  3VB2 A;  2Z9O A;  2DCE A;  5LHH A;  1VQO I;  5E18 F;  1K61 A;  2DA7 A;  2HGC A;  1F1Z A;  3GZN B;  1KGS A;  1J9I A;  3K2A A;  3GF2 A;  5JI6 A;  3ELK A;  4BXU A;  1ZRD A;  3EUK L;  3PNV A;  3JAM Z;  4ESF A;  2R3S A;  2GIZ A;  2DBB A;  1R5G A;  3PFY A;  5IOZ A;  3SFI A;  2Q0O A;  1RKT A;  4EAT A;  2FQ4 A;  3HUG A;  3SDG A;  5GAE J;  2HZD A;  1APL C;  1Z05 A;  2R4G A;  3V42 A;  3AFH A;  3KYC B;  4ABZ A;  4U0V A;  2ZKZ A;  3ZPL A;  3HUG B;  1RPW A;  3IAS 2;  2QEN A;  1O57 A;  2FRH A;  5DUI A;  1OQY A;  2ESH A;  1PJR A;  2NVU B;  4IHS A;  5IP6 A;  2NVX J;  4UB8 C;  3LSJ A;  2IEK A;  1CGP A;  2DTZ A;  2BVL A;  4K2E A;  2TRT A;  2O03 A;  4LLG F;  3SEZ A;  2BW3 A;  4X0G A;  2F4I A;  1A5J A;  4UV8 A;  3V4G A;  1EH7 A;  1GXQ A;  1VND A;  4KUM A;  2LNB A;  1HLV A;  3R60 A;  2BW3 B;  5L3E A;  2V9K A;  1OCO H;  5EEH A;  5F04 A;  2LD5 A;  1BW6 A;  1Q1V A;  1Y8R B;  4A3E J;  5GTI C;  4RGX A;  4U0Y A;  1D3Y A;  2I5U A;  4I98 B;  4M71 A;  2HKO A;  3PNT A;  4EJV A;  3DF8 A;  3LSP A;  1B9N A;  1R1T A;  4BY7 J;  2HQA A;  5D4R A;  1EF4 A;  3DTK A;  2E34 A;  3H0D A;  3MZY A;  4B3X A;  1W36 D;  2O3F A;  3BR2 A;  2FNA A;  1SD4 A;  3DV8 A;  2IW5 A;  1FYK A;  2CV0 A;  3LSM A;  3QWL A;  1T08 B;  3PSI A;  5KVR A;  4EM1 A;  3ZQI A;  2STT A;  2XAQ A;  5L3F A;  2WAQ A;  2R7D A;  5J47 A;  4AC0 A;  1XGM A;  4OIP F;  1R7J A;  2DDA A;  4O3M A;  5IY5 H;  2LDU A;  1QU3 A;  2MA3 A;  3MZ8 A;  1KU9 A;  1SD7 A;  2FX0 A;  3TO6 A;  1ZRC A;  4RGU A;  1ITY A;  2EBI A;  4E7Z A;  2L54 A;  4HA8 A;  2RC4 A;  3FMQ A;  2K3F A;  3A0H C;  5FLM J;  3FDY A;  4G6D A;  3VYU B;  1S7E A;  2NOG A;  3ZMT A;  2X6W A;  2LY1 A;  1E2X A;  2W24 A;  1S29 A;  1WJD A;  4KNY A;  5K5Q A;  1ZG1 A;  2PBI A;  2EIM H;  3OWT A;  2D5V A;  3KP5 A;  1Z6R A;  2MBF A;  3HSR A;  2JT1 A;  3M7G A;  2CQK A;  3ZN0 A;  1FEX A;  6PAX A;  5HS9 A;  3N05 A;  3K70 D;  1U78 A;  1P6R A;  4HV5 A;  1GV2 A;  1QVT A;  1U6G A;  2X1C A;  2E1M B;  3L2C A;  3FXU A;  1OLT A;  3SYT A;  2DMT A;  3H35 A;  1Y1W J;  5HLG A;  4KYW A;  2R7V A;  4EGZ A;  3OSG A;  1BIB A;  1MBE A;  3HKZ A;  3WHB A;  3AAF A;  3HB9 A;  2MLK A;  1N78 A;  4S05 A;  5K1Y A;  4EJT A;  3IRR A;  4KIB A;  2BEO A;  3WOD F;  1YIJ I;  3L7W A;  1BOB A;  3AL0 B;  2WBM A;  5JHU A;  1F4K A;  4HLY A;  5CKT A;  3ZQH A;  3RZO J;  2HQN A;  1H9T A;  3GO5 A;  2LH9 A;  3FIW A;  3GBG A;  5KAI C;  1J09 A;  1W7P D;  2F2E A;  4BJ5 C;  5FJ8 J;  2DFF A;  1D8J A;  1LFU P;  1MBK A;  2ECC A;  3VOE A;  4LOC A;  1NHA A;  2BV6 A;  1OR7 C;  2ZSI B;  1OPC A;  1WJC A;  2BBY A;  4AID A;  3J7Z I;  3PM1 A;  1AU7 A;  2EA2 A;  3Q9S A;  4PJL A;  4XLN F;  5B3S H;  1XMA A;  2XF7 A;  5LLQ A;  4DBR A;  1Z21 A;  4XID A;  1WSU A;  1I3A A;  2FBK A;  2VQG A;  3HBL A;  1ZEL A;  3FXO A;  3LMM A;  4EEF G;  1AA7 A;  4EQQ A;  1FP1 D;  1YW9 A;  2W57 A;  3RIR A;  4ZTJ A;  5TJJ A;  2CQN A;  3DLL F;  4P55 A;  5HDG A;  4A5M A;  2HPI A;  3P9I A;  3FKJ A;  3TOB A;  5J4Y A;  5FLX Z;  3K69 A;  2A6T A;  4M72 A;  1WI9 A;  5E8I A;  2J5P A;  4XOR A;  1MMD A;  3CCU I;  3E6M A;  2HOA A;  1T0F C;  3SZP A;  2JK3 A;  1LQ1 A;  2H8W A;  3MFK A;  3S1R J;  3OYI A;  3KP3 A;  5D4S A;  4E7L A;  2LMD A;  2YS9 A;  1J2X A;  1YW8 A;  3BTJ A;  4G9Y A;  5F27 A;  3RPU D;  3COA C;  1YJN I;  2VLA A;  2Q8K A;  4QSH A;  4WK8 F;  1DP3 A;  1GXP A;  2CFX A;  5LHI A;  3CTA A;  2CQ7 A;  2KKO A;  1JE8 A;  4M3B A;  1A36 A;  4LFU A;  1FOX A;  3IL2 A;  3C2B A;  3L9F A;  2OBP A;  3I59 A;  3KYD B;  1G59 A;  2Y0M A;  5ICF A;  4Z2Y A;  2GM4 A;  1XSD A;  3HKZ N;  4B48 A;  1ZLK A;  2CWE A;  3VFZ A;  4I0A A;  3WU2 C;  4L0Z B;  1W7P A;  4B1R A;  2FOW A;  1WKM A;  4D0P A;  1CQT A;  1HF0 A;  4U7D A;  4AD9 A;  4RBO A;  4G94 A;  1XX5 A;  4L9N A;  1FOY A;  3ZCO A;  1AKH A;  4RGS A;  4L9T A;  4XLH A;  4EJO A;  1DGR M;  3TGN A;  2DTR A;  2R7F A;  1B72 B;  3F3X A;  1AKH B;  1PP7 U;  1TWG J;  1UHM A;  4WWC A;  2BY2 A;  2CQQ A;  4I6Z A;  3DP7 A;  3OYH A;  1JUM A;  4ZDL A;  4OMY A;  2P0W A;  4PZJ A;  2RKH A;  2IRF G;  5J4V A;  2K85 A;  4M3F A;  1ETY A;  5ILU A;  2XB5 A;  4ESJ A;  4HQE A;  2GLO A;  1OKR A;  2Y9Y A;  2EPF A;  5EZH A;  4RM3 A;  2FUG 2;  5FRO A;  1ON2 A;  3SHF A;  3QYB A;  2MSY A;  2WC2 A;  4CCM A;  2BGC A;  4UUT A;  4RA2 A;  1LFP A;  3A02 A;  1QRY A;  2ELH A;  5DYM A;  3RPU A;  3KYL A;  3SEQ A;  3FXL A;  4EM0 B;  1WJA A;  4R8H A;  1TQP A;  5DCF A;  3RQ4 A;  4GDF A;  1D5Y A;  4QLC U;  2L0K A;  2UXX A;  1U3E M;  4C3H J;  1O3T A;  2ZNY A;  1RKW A;  4DBQ A;  4GXO A;  3SZG A;  3M8E A;  2CRG A;  3K6G A;  2VI6 A;  2E2J J;  3VYR B;  1J75 A;  2BOL A;  2DLL A;  3LFU A;  2LF8 A;  2XF5 A;  4HOB A;  2AQF A;  5F64 A;  4BE2 A;  1VZ0 A;  3J7A O;  4OAZ A;  5M5W J;  2YU3 A;  1IN6 A;  2KMU A;  3WTU C;  2QQ8 A;  2OCC H;  3LAJ A;  5F0H A;  2OD5 A;  3PIP F;  2IGK A;  2ELK A;  3KLO A;  1YRN A;  5B66 C;  3LSG A;  3QP5 A;  4P9F A;  1E17 A;  1WZ2 A;  5L3D A;  2AO9 A;  2DT6 A;  2Q1Z B;  4L9J A;  1KU2 A;  3GX4 X;  3BG7 A;  4NUB A;  3IRQ A;  1YRN B;  2KPM A;  3R61 A;  1T8I A;  4M9X A;  1D1B A;  1N25 A;  1RNL A;  2HFH A;  4HZF A;  4QIW N;  3GTP J;  3N97 A;  1G3W A;  4P9U A;  3HOV J;  1FIP A;  4MFD A;  3BR3 A;  1ETV A;  2WY7 Q;  5TIS C;  5LGT A;  2W25 A;  2JQ7 A;  4MIM A;  5IYC J;  4FT8 A;  1XD7 A;  2JPB A;  1D0Y A;  2FJ1 A;  3HIF A;  4IJA A;  4DOZ A;  3MN2 A;  4B43 A;  4CO8 A;  5D5U B;  4X6A J;  2HPM A;  3BJO A;  4HF2 A;  2CJJ A;  5LGN A;  2L7K A;  1I1S A;  5IP7 J;  5H20 A;  2P4W A;  3CCL I;  2CUF A;  2KDZ A;  2Z99 A;  1XCB A;  4ESB A;  2EIJ H;  1NK3 P;  2XF6 A;  2QSG X;  1ETX A;  3K1N A;  1BL0 A;  3UNG C;  3S1M J;  1R6R A;  2L3D A;  4PSW A;  3W6J B;  1XGS A;  4A3L J;  1D0X A;  4HRI A;  2ZNZ A;  3BC8 A;  3I54 A;  2MAB A;  3OY9 A;  4CCL A;  3PO2 J;  1YQA A;  1FBS A;  3JTG A;  1T38 A;  3O8H A;  1PUE E;  1ACI A;  2G9W A;  2Y48 A;  3S93 A;  2ZFU A;  1OJL A;  5GP9 A;  2Y75 A;  3ABL H;  3T8T A;  2M7A A;  5LGU A;  3OR1 C;  2P8T A;  2DN0 A;  4Y4R A;  2WB1 N;  2X1D A;  4N4O B;  1ZQ3 P;  3Q5F A;  1TQM A;  3WG9 A;  4U0W A;  1YJ9 I;  4A3C J;  1XSV A;  2RQQ A;  3KE2 A;  3ABT A;  4ANJ A;  2HDC A;  2HVR A;  1BI3 A;  5KNL A;  2CW0 F;  2M8G X;  1FTZ A;  1TWC J;  2E1M C;  5CQG A;  3CC7 I;  2IT0 A;  3CDH A;  3HGG A;  3ONQ A;  2BHZ A;  3GTJ J;  2W7N A;  2DOD A;  1HKT A;  2OF7 A;  2QQB A;  4LG3 A;  3I71 A;  5EGO A; 
#chains in the Genus database with same CATH homology
 2L2O A;  2V1N A;  2Z16 A;  1X4P A;  4CCJ A;  5KHD A;  1D0Z A;  3OYG A;  1N77 A;  4J00 A;  4HNU A;  4Y3O A;  2XDV A;  4II3 A;  1TT0 A;  4KIS A;  2ZXH A;  4ZDO A;  2WY8 Q;  1MMA A;  1SAU A;  3HPG A;  4DGW B;  3H9J A;  2UUZ A;  4E7H A;  3K4L A;  3KEY A;  1S9H A;  5FRM A;  3OIP A;  4BGD A;  4IX7 A;  2IXS A;  3QOE A;  2M4K A;  3HPH A;  1PYV A;  1T95 A;  4BQQ A;  2VQC A;  2WB1 A;  3DWL E;  2X6Y A;  4RLF A;  1DGW Y;  3QYE A;  2XSJ C;  4IQJ A;  2E5N A;  2UV1 A;  4XNF A;  4E4H A;  2DCE A;  4XKV A;  3BLY A;  1UEL B;  2LG4 A;  2VXD A;  3D5S C;  3MKW B;  3DQV C;  1MMG A;  4BAC A;  4F55 A;  1K6Y A;  4BU2 A;  4NC7 A;  4BEH A;  3EUK L;  3PNV A;  3ZQQ A;  2K5C A;  3PFY A;  2W4S A;  3VSL A;  4F91 B;  4EAT A;  3K70 C;  4XKC A;  4XON A;  4BEH B;  2HZD A;  2W82 A;  5LFA A;  1G8X A;  2R4G A;  2VL8 A;  2R7T A;  3OYE A;  3V42 A;  3AFH A;  5HNH A;  1EA3 A;  2VAS A;  3K10 A;  3KX2 A;  1KON A;  2HDW A;  3HUG B;  3IAS 2;  3K4B A;  3PJR A;  3L2U A;  1LVK A;  4BJT A;  5HNF A;  1PJR A;  4KJZ A;  1D1A A;  2W1O A;  3U21 A;  2BVL A;  2MYS A;  2V4J C;  2E60 A;  4BS9 A;  2LC2 A;  2F6C A;  3VYT B;  1FMV A;  5TGT A;  3SEZ A;  2BW3 A;  4E7S A;  4X0G A;  2F4I A;  2NOJ B;  3G2B A;  2IGN A;  2MFZ A;  4LIT A;  1HA8 A;  4HNT A;  3OYN A;  2BW3 B;  2VJ4 A;  2V9K A;  1QHH D;  3DLA A;  1E0E A;  2XAU A;  2X6X A;  4D9J A;  4F52 A;  1X1A A;  4QPO A;  2JUG A;  3S3N A;  1X19 A;  1LKX A;  3PNT A;  2L9S A;  2OUM A;  2VB6 A;  3OYM A;  2HQA A;  3DTK A;  3H0D A;  3OMY A;  1IRX A;  2F5V A;  4B3X A;  2KQR A;  1W36 D;  3I3L A;  3RSN A;  1NG6 A;  2CV0 A;  3LSM A;  3PSI A;  3VDX A;  3I9V 2;  1UG0 A;  3LSI A;  2WAQ A;  4BXF A;  3D5L A;  3OYK A;  2QKM B;  4U87 A;  1QU3 A;  3LSH A;  2ZSH B;  3RCO A;  5FRN A;  1YE9 A;  4II2 A;  4E7Z A;  2K9M A;  3OYA A;  1Z3Y A;  3FDY A;  3VYU B;  2PJR A;  2X6W A;  1WFX A;  2LY1 A;  3H9Q A;  4J01 A;  3K4N A;  1WJD A;  3AL0 C;  4XMY A;  4BL0 B;  2JVG A;  4H4K C;  2AQE A;  3MMY B;  3CMM A;  3OWT A;  2A5W A;  4F3Q A;  4DIQ A;  3NWT A;  4B47 A;  2PJR B;  3BCA A;  2LRE A;  2K3P A;  1BR1 A;  3S8P A;  2IS1 A;  3IUO A;  3M8J A;  3N05 A;  3K70 D;  4PSX A;  4FET A;  4CCK A;  2DT7 B;  2X1C A;  3AKZ A;  2M4G A;  4G6T B;  2E1M B;  3TMO A;  2R7X A;  4NNJ A;  2JSP A;  4OWR B;  3LL7 A;  3S3M A;  3HL2 A;  2IS2 A;  3DPL C;  1OLT A;  3SYT A;  3H35 A;  2X1E A;  2CUZ A;  3FBN B;  2R7V A;  3OS1 A;  3HKZ A;  4JQF A;  3PL8 A;  3HG9 A;  4GRI A;  3DEE A;  1N78 A;  3NWS A;  3AL0 B;  1BOB A;  4P5O A;  2WBM A;  3C2G A;  4LIV A;  5CPR B;  2L9N A;  2LBF A;  1X1B A;  5CKT A;  5HOO A;  2LH9 A;  3L2R A;  3GBG A;  2DJI A;  4XLA A;  1J09 A;  4BJ5 C;  2GOX B;  3CES A;  3LSK A;  3HOS A;  3MD2 A;  2LBF B;  4ZC3 A;  2CFO A;  3ZXS A;  1OR7 C;  4E7K A;  2ZSI B;  2K9L A;  1YX3 A;  2KLO A;  4PJJ A;  4YRV A;  1WJC A;  4YEJ A;  4NC8 A;  4PJL A;  3DPU A;  4BQN A;  2XF7 A;  4DBR A;  2WAF A;  3CP2 A;  3W3C A;  1Z21 A;  2V6E A;  2VQG A;  3OYD A;  1MNE A;  1ZEL A;  3LMM A;  1AA7 A;  3OYL A;  1JI8 A;  4ZTJ A;  3L2W A;  2VKD A;  3K4C A;  2HVQ A;  1MND A;  2HPI A;  4CA0 A;  3K4M A;  3FKJ A;  2WAE A;  3H5A A;  4CUG A;  4PJN A;  1Y56 A;  2A6T A;  4IQ4 A;  3DPT A;  3EUH C;  4XOR A;  2KHM A;  1MMD A;  1U0J A;  1T0F C;  2VKH A;  2VJJ A;  2ZXI A;  2QKL B;  3FHN A;  3MKZ A;  4BE0 A;  1MW7 A;  3H5R A;  3H9G A;  3OYI A;  3A2K A;  2R7R A;  4E7L A;  3RPU D;  3W2A A;  4FAS D;  3UR3 C;  2VQL A;  2VLA A;  4NQW B;  5JHF A;  1DP3 A;  2HNH A;  3PSF A;  1P9Q C;  4P1W A;  1LDK B;  4PK4 A;  2KDO A;  2OC6 A;  4AU7 A;  3OYF A;  2CUJ A;  2R7W A;  4XLC A;  3RTR A;  1DQU A;  4N4N B;  1G59 A;  3FBI B;  4B48 A;  4ZTF A;  4E6K G;  1Y6I A;  3OIQ A;  2JVH A;  2KZV A;  3IAM 2;  4HEA 2;  4F92 B;  4PUS A;  3F9K A;  3DKX A;  4JOM A;  3EPZ A;  3ZCO A;  4C2T A;  2CW8 A;  4XLH A;  4ZJZ A;  1DGR M;  2M3A A;  1WJE A;  4XN0 A;  3DKY A;  4LIU A;  4BDZ A;  2MD0 A;  4PFP A;  2UWM A;  3OYH A;  3M1C A;  1X1D A;  4ZDL A;  2P0W A;  3DTI A;  2BVM A;  3HXL A;  2KRC A;  4XLE A;  2R7Q A;  4AVZ A;  2VPL A;  2OV7 A;  2VIX A;  3BG6 A;  2DOA A;  3DTE A;  4RM3 A;  2FUG 2;  5FRO A;  3A4C A;  2DXI A;  3OL3 A;  4XM3 A;  4IKF A;  3W2W A;  3QYB A;  4QPQ A;  3CJR B;  4CCM A;  2KRH A;  1LFP A;  4YEL A;  4ZYA A;  1Z3X A;  2Y0S A;  3HOT A;  4XQF A;  2IGM A;  3A1Y A;  3KYL A;  1WJ5 A;  3SEQ A;  3OOU A;  2CMP A;  2XC7 A;  1WJA A;  3RQ4 A;  2ELJ A;  4XLF A;  4IZZ A;  1TZL A;  3CF2 A;  2VXZ A;  3H5N A;  4XKB A;  3W2V A;  2I8D A;  3VWB A;  4XKW A;  5KCM A;  2IS4 A;  1W36 C;  4B44 A;  4CH7 A;  2RRE A;  4DBQ A;  1BR4 A;  4BJ6 C;  2LY2 A;  3SZG A;  3L2V A;  3ZR8 X;  3K6G A;  3VYR B;  1N75 A;  1BR2 A;  4DJA A;  3TL4 X;  4BUP A;  4KIT B;  2CV1 A;  2BOL A;  3LFU A;  4XL9 A;  3S32 A;  2XF5 A;  3SDB A;  2Z2S B;  3IP4 B;  2AQF A;  4BE2 A;  3OYJ A;  1VZ0 A;  4OAY A;  4E7I A;  1V5F A;  4OAZ A;  3QYF A;  4CZC A;  2KMU A;  3VYS B;  2IS6 A;  5HLT A;  2IGK A;  2X85 A;  1SFK A;  3LSG A;  1FMW A;  2CV2 A;  2W00 A;  2CH0 A;  4XOT A;  4AYB A;  2DT6 A;  2Q1Z B;  3OYB A;  1MMN A;  3BG7 A;  4NUB A;  4CSW A;  2KPM A;  3CP8 A;  4HG2 A;  3CZ6 A;  3E1S A;  1YX5 A;  1D1B A;  3PNY A;  1V5E A;  4C2U A;  4R79 A;  2RNG A;  3J7A Y;  2X51 A;  5HVQ C;  2V26 A;  4RMN A;  3PUB A;  4BE1 A;  3ZRG A;  3C2H A;  2VQH A;  2M7B A;  3K4K A;  3BCB A;  4C30 A;  2WY7 Q;  3E0J B;  1X4O A;  3HC7 A;  4E7J A;  2GOM A;  2Z1D A;  2VJI A;  2MC4 A;  3EUA A;  4PJM A;  2R7O A;  4CCN A;  1D0Y A;  5CQE A;  4C9Y A;  4ZDP A;  2WA0 A;  3TBI A;  4DOZ A;  4MLO A;  3OS2 A;  4B43 A;  1X1C A;  4HSR A;  2HPM A;  3VSK A;  2Q2E B;  2L7K A;  1V5G A;  4XN3 A;  3ZGK A;  2WAD A;  2E5Z A;  3DU5 A;  1WJB A;  2KL4 A;  3S3O A;  3OYC A;  2XF6 A;  2LOO A;  1QHG A;  3UNG C;  2O5R A;  1R6R A;  1NG7 A;  3L2Q A;  1ERD A;  4PSW A;  2CW7 A;  4RLQ A;  2LYC A;  3OR2 C;  2V7F A;  1D0X A;  4HRI A;  2R7S A;  3BC8 A;  4BQO A;  2MAB A;  3OY9 A;  4CCL A;  4HST A;  2KP6 A;  1WJF A;  3MKY B;  1Z7L A;  3S93 A;  2HVS A;  2ZFU A;  4Y33 A;  2VJ5 A;  4RM2 A;  3OS0 A;  3K4J A;  2HU9 A;  3D5R C;  2M7A A;  3OL4 A;  1D1C A;  3OR1 C;  2IGO A;  3DU6 A;  4Y4R A;  1GLN A;  2X1D A;  4XR6 A;  2M0M A;  4N4O B;  4CCO A;  1UAA A;  4BDY A;  2CS3 A;  2LRD A;  4HPQ A;  4PFO A;  2RQQ A;  4ITV A;  4ANJ A;  2HVR A;  2JA2 A;  4KT6 A;  5KNL A;  4F93 B;  2R7U A;  2E1M C;  2L5Q A;  5CQG A;  4XOP A;  2PMZ A;  3ONQ A;  2W7N A;  3CJQ B;  4D1Q A;  3QOD A;  4LG3 A;  4U7B A;  5LD2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...