3OL4A

Crystal structure of a putative uncharacterized protein from mycobacterium smegmatis, an ortholog of rv0543c
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
TTTFMDNVLGWLHKGYPEGVPPKDYFALLALLKRSLTEDEVVRAAQAILRSTDGQSPVTDDDIRNAVHQIIEKEPTAEEINQVAARLASVGWPLAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Unknown function
total genus 32
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11829 DUF3349 Protein of unknown function (DUF3349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3ol4A02
3OL4A 3OL3A
chains in the Genus database with same CATH superfamily
5LGTA 5HLTA 1S7OA 5GTHC 4B3XA 4CCLA 2QQ8A 3OIOA 2DPUA 1QPIA 1G59A 1GVJA 3AG1H 3J7AO 3K4CA 3MZ8A 4JOMA 5E1WA 4I6ZA 2F5EA 3SEQA 3DCFA 1W7PB 3N97A 1RNLA 1JUPA 3CCEI 3H5NA 4MTDA 3MMYB 2FQ4A 2CMPA 1SFEA 4MFEA 4FHTA 3CCJI 1ZLJA 1I3QJ 3CMMA 1H9GA 3CQZJ 4QPOA 2ZKZA 4DGWB 3HZJA 3GTOJ 2ZMEA 2DJNA 3PQJA 4IQ4A 3ESWB 4ZTFA 4ITVA 1MMDA 1FC3A 1X3WB 4MO7A 2VI6A 3W6VA 4XBFA 2EPFA 1XN7A 4YIFA 3L2RA 3LOCA 3DWLE 1Y56A 1DGRM 3A1YA 1RI7A 5LHHA 5JVTA 3W2AA 4J19A 1IN6A 3BTIA 2NVXJ 3DU6A 1PYVA 2IA2A 3KP4A 2WBMA 5TGTA 2VQHA 1FSHA 3SDBA 3FMRA 2WADA 2NAZA 4WF2A 2ZJ2A 2IS4A 4QSHA 1BA5A 2VE8A 1IN4A 1Z0XA 5ICFA 3K1NA 2MW8A 5CVJA 1ETVA 4B8XA 3OYBA 4MGRA 4Y3OA 2IRFG 3BR3A 1ZTRA 5B5EC 4MEYF 1A6QA 1ZRFA 2VBXA 3DBHB 2XF6A 2ISZA 2VBYA 3C1DA 4LLNA 4DNCA 4MLOA 3OYGA 1XPXA 2EB7A 2HYGD 3S2DJ 2V9PA 1VTNC 5M5WJ 3AL0B 1E17A 4B44A 1HW1A 1Z6RA 3OL4A 4Y15A 2LSOA 1P2FA 3HOZJ 5JHFA 1BOAA 2ZMEB 3H3ZA 4P55A 4YRVA 3ECHA 2DT7B 1IW7F 2IAIA 4BKXA 1TL8A 2JA5J 3ELKA 2KZGA 2FJ1A 1BI1A 2RKHA 3H0DA 4XSZF 2M5WA 3PJRA 2CFOA 1Y0NA 2O8KA 4BJTA 3GEZA 2PQ8A 2X6XA 2DJIA 4FT8A 2BBYA 3RQ4A 3QQAA 4QWQA 1R4MB 2LBFA 2XC7A 3IL2A 2F2EA 1T33A 1A31A 2AQEA 2UV1A 4XM3A 3GX4X 1WFXA 3Q9SA 3K10A 1LE8A 2VB6A 1MH3A 3LSHA 4LMYA 3O3KA 1BW5A 2X1DA 1QQIA 1XD7A 4BJ6C 3QOPA 1BR1A 5J1RA 1Z6TA 4E7ZA 2JJ7A 5FKNA 1LDJA 1IC8A 2W85A 1J09A 3QYFA 3Q0VA 4MIMA 5M3MJ 2FUG2 5IOZA 2ZNZA 3U1KA 3CUQC 1VQ7I 3BC8A 2QLZA 4EM2A 3IWFA 1SAUA 2HOSA 4F55A 2BW3A 2EK5A 3F0CA 2ETHA 4ZYHA 4EJVA 2FSWA 4FTHA 2CQNA 1FX7A 2CG4A 2WWYA 2E60A 2FOWA 4YELA 1KA8A 2E1OA 2E71A 4B48A 2JUCA 4HV6A 2Z99A 1A5JA 4FX4A 1BR2A 4XLNF 2ZSHB 4B1RA 2OF7A 3AG2H 4I99C 2EV5A 3E5UA 4P1WA 1KU7A 3F8MA 4BHPA 1KONA 3CUOA 4CCJA 5EEAA 4L9NA 1O3QA 2BHZA 2YPRA 2KZVA 2X1EA 3BQYA 4GYGA 5E3MA 3O2PE 1A6IA 5M5YJ 1DP7P 5J6XA 2VJIA 3UR3C 1Z77A 4X1EA 1SD7A 2EZLA 3CJRB 3K70D 1XSXA 3AAFA 4D9JA 4YFKF 3G1LA 5DUIA 5FRMA 1LE8B 1ZAOA 4CHUA 3EUKL 1UHWA 4HA8A 3ZQHA 1FIAA 5HS7A 3TO7A 2LFBA 2XAGA 4RA2A 3OYHA 3KP5A 5CQGA 2ZCWA 3RKWA 2DA7A 4BNCA 3CLQA 4OOIA 1TNTA 4HSTA 4YFXF 4X6AJ 4A0YA 2DCEA 4UV8A 3OYFA 2RC4A 2LMDA 1F4KA 3I0TA 1VQLI 4RBOA 2ESHA 3KP7A 3OYIA 1EKEA 2DXIA 2MBFA 1Y6IA 3CC4I 4NC6A 5FKLA 2H8RA 2KKOA 4O6JA 2L5QA 2UWMA 3DBLB 2R4GA 5F64A 4S0HB 2QQBA 2QCOA 2I10A 3FXUA 2MC4A 3RDIA 1QZYA 1E0EA 4XLHA 1LVAA 2YR2A 4JBAA 5H20A 2F5VA 2VXZA 4WWCA 1VQ8I 2Y75A 3R60A 1OCCH 2EJRA 4V2GA 2VN2A 2IGNA 4AIHA 1H89C 1QHHD 1B1BA 2LTPA 2KHMA 2PMZA 3REOA 3RQIA 3BROA 3JREA 4F92B 1ZELA 2CV2A 2DFFA 1KQ0A 2IS6A 2DOFA 3LWFA 3HEFA 5A2QZ 4G9YA 2MA3A 2JT1A 1FP2A 5D4SA 4ZDLA 2V79A 2NYXA 4LJZF 5EZHA 4HG2A 1G4DA 2NOGA 1MSEC 4I2OA 1FBUA 4G7HF 4O5VA 2H6BA 4GCVA 3BR0A 3GFMA 3C2GA 3PQKA 1S6LA 1Y1VJ 1YRNA 3BG3A 1UG0A 3LAJA 2R0QC 5C4JJ 1P6RA 4U7BA 2KIQA 4IHTA 2VQLA 2ELKA 5F0CA 3LSPA 1GHCA 4C3HJ 5M5XJ 4ZH4F 4IEJA 2P7CB 3B6AA 4FQGA 1X19A 2Y9YA 2K9SA 1JE8A 3J80Z 3L00A 1FYLA 3E97A 2DW4A 3ZPLA 4RLFA 3SZGA 3L1PA 2HZDA 3HRTA 4EQQA 1FSEA 5IP7J 3OMYA 1BW6A 5IP6A 5LBQA 4OIPF 3L2WA 4UVAA 4A6EA 2MYSA 3ROUA 3JAMZ 2ELHA 1XGMA 2JZYA 3I4MJ 2Y0SA 4G6QA 4XOTA 3SHFA 3RYPA 5IOYA 3I55I 2PJRB 3IP4B 2F5CA 3OS0A 2EZIA 2JA2A 1Z7LA 1ULYA 4NDLA 5ICGA 3L2CA 1IO2A 1BC7C 3K6GA 4F91B 5K5RA 5FJ8J 3OIQA 4CCKA 3JSOA 1ZG5A 1FOXA 3HTUA 1T39A 2CU7A 3TOBA 2CQQA 1J2XA 4HBLA 2XROA 3HGYA 3BPXA 1P7IA 1AU7A 3BZKA 4EJTA 3KX2A 4A69C 1HDPA 3L9FA 3SYTA 2K9QA 1HC8A 2ZJPF 3HOXJ 2JTVA 2DQLA 1DDNA 1LPQA 1I27A 2F48A 3HUGA 1MBKA 2PN6A 3PUFA 1R23A 3DEWA 3HL2A 1UG2A 2W84A 3T8RA 2V6EA 1X58A 1PUEE 5D6EA 2JK3A 3P9IA 3D1NI 1YS6A 2HWVA 3RZDJ 1EV7A 4AIKA 4FX0A 4IF4A 2RAEA 3E5QA 5KVRA 4BQAA 4KYWA 3RIRA 3LSTA 4HRIA 3LAPA 5GTIC 3G6EI 1RRJA 1UCRA 1TW2A 2L3DA 5DYMA 2HTJA 1YYVA 1KGSA 4IPAA 4ZYEA 2C6YA 2RREA 5A2QK 4G8XA 2DMUA 3K4JA 2KIFA 2MD0A 3G71I 1XB4A 2K7LA 2MFZA 1F5TA 2NXNB 1ENHA 2F4OB 2XPUA 4ZYDA 2DU9A 5ILUA 1AKHA 1GXQA 1WJDA 4XL9A 5C4XJ 2DMTA 3ZXSA 5L3GA 1O3RA 4Q47A 1R1UA 2G9WA 1UHSA 1B8IB 2IA0A 2JA7J 2O5RA 2D5VA 1BR4A 1V5FA 1I5ZA 3BTLA 1W36C 4Y7NJ 1J59A 1LFUP 3KETA 4CUGA 3PNVA 2GA1A 2X6OA 3D0SA 3J80K 4G12A 4JK1X 1YI2I 1ZQ3P 2R92J 3A2KA 4LIUA 1IRGA 1YJNI 3G2BA 1LKXA 2JSPA 3ZQGA 4ANJA 1J9IA 4WK8F 2NS7A 4XOPA 2HQ5A 4YIIA 3JAMK 3WODF 3S3NA 3JTGA 4ESFA 1F1ZA 2XAHA 4BGDA 4MEXF 2EQRA 3ZQFA 1YQAA 3T5XA 2HXOA 2AXTC 2J5PA 3JTHA 3JW4A 3K1PA 2NVUB 3IRRA 4D1QA 2N8GA 2EINH 1MZBA 1X4OA 2M45A 3KZZA 4XLPF 1HLVA 1I1SA 4LK1F 1K6OA 3OL3A 3OOUA 4RB0A 3LMMA 3ABUA 2R7UA 1LDKB 5E20A 1JGSA 4B43A 1QNTA 2EFWA 2YU3A 3BDDA 2WTEA 2OU2A 5DUKA 3GO5A 1A04A 1G2HA 1BIBA 3VYTB 4J01A 2RNJA 2VT2A 4BU2A 1JKPC 1YIJI 5AIPA 3F6VA 1R5ID 3BJOA 1YHQI 3L2QA 2HI3A 4BDZA 4A3KJ 3QWLA 4BL0B 3N4MA 2DK8A 4R79A 3OYMA 4EJWA 3U21A 4PK4A 4LG0A 4HX8A 4CZCA 1OLTA 3HTSB 4BXUA 1MH4A 2RDPA 4NC7A 4JYKA 5F6FA 1S72I 4M9XA 2CUZA 2BY2A 5KCMA 2MH9A 4AWXB 3GTPJ 3O6BB 3CJTB 2XGCA 2ZXIA 4DBRA 3OYCA 4I0AA 3M1CA 4I02A 3FXQA 1W0UA 1KU3A 3CO6C 1B59A 1XGNA 2VBZA 3FZVA 2XDVA 2L7KA 3VB2A 3G1MA 4FISA 2JPCA 1OR7A 2DT5A 4U0YA 1FLIA 3I9V2 2LRDA 4PDKA 3FF5A 4KISA 5D5XB 1FP1D 2Z2SB 1J7KA 3LA7A 3PSIA 4U0WA 3S1QJ 3R6SA 3V8KA 1QBJA 4ZJZA 3VWBA 4IJAA 2OUMA 2X0LA 3E0JB 2QWWA 2FE3A 2O03A 3P9CA 2BVMA 3W6KB 1X1PA 1H0MA 1STZA 1L3LA 3ML6A 3CTAA 5BOXA 4G7ZF 1S8NA 1DGWY 1JT0A 2LK2A 1U0JA 1JTXA 3HYIA 4HAMA 1ZR2A 4NC8A 5CVVA 1OMIA 2EA2A 3IHUA 5CYVA 2Y48A 4NB5A 4XLCA 1TWGJ 2XSDC 3GTQJ 2VPLA 3TGNA 4NUBA 4M3GA 5C3EJ 3NWTA 2XB0X 3HJEA 5F0HA 4XKBA 5F08A 4LG0B 3E7LA 3CP8A 4QTRA 3AFHA 2UXXA 3DTEA 4II3A 4FE4A 4FE7A 5FKMA 4WX9A 3MAJA 2OTJI 2L0KA 4A93J 2P0WA 5J8FA 3EYYA 4OAYA 4JQFA 4Y4RA 3JRFA 4RAZA 3J7ZI 1MBFA 3E6CC 1ORKA 5EDNA 1FTTA 3IH3A 3K70C 2OZUA 3SDGA 4XMYA 2YUSA 3TP3A 1I3AA 2PX9A 2CV0A 3J7YJ 1ON2A 1J0RA 1C0WA 2KIUA 3KEYA 4XRFA 3EPZA 1KZHA 5B1AH 2L7MP 3L7WA 3GXOA 2BXYA 1OPCA 4BUPA 2RNGA 4N4NB 4MHGA 4BY7J 2OCCH 1T2KA 3VPRA 2BY1A 4AVZA 3EDPA 3ZQCA 3FM5A 2EZHA 3OY9A 2KPMA 1D5YA 2M4KA 1RZ4A 2VJJA 1I50J 3M7GA 1MSFC 4Y17A 1PP8F 2L9SA 2VASA 3HGGA 4MTEA 4F52A 1W7PA 2RV8A 3ABTA 4H4KC 3BWGA 2K02A 4PCQA 5FGMA 2NOJB 4DZPA 1S9HA 2KJBA 5JLXA 3ZMTA 4E4HA 3ZQLA 3GBGA 3PUBA 4DYRA 3TEDA 3CDHA 3QP6A 3Q9VA 3MN2A 4M3EA 5J4YA 1Z21A 1Q1VA 2ZXJA 4IRIA 5IY5H 1MW7A 1GXPA 3CLOA 2A6EF 2TCTA 1XTAA 3ONQA 3K4BA 3A02A 1JKQC 3MKWB 2VC0A 2JRTA 3I59B 1XGSA 2IPQX 2JSCA 3A4CA 1F9NA 1N77A 2W24A 3GFLA 1G6NA 1Z05A 1GV2A 3WTXC 2BE5F 5J8CA 2BXZA 1JUSA 3KYLA 1WI9A 2V4JC 1WWXA 2ZFUA 4PJMA 4RGSA 4D7MA 1VQPI 4ASNA 2QYOA 3HB9A 3TP0A 1T0FC 3BTJA 3F9KA 2EWNA 4A3DJ 3ZR8X 3FXOA 5IPAA 3M1EA 3CCYA 1Z67A 4A3CJ 1WZ2A 2WC2A 1TQMA 3LSGA 1E3HA 2PMUA 2XVCA 3LNQA 2P6TA 1U9NA 1IV6A 3OV8A 2DODA 5KAIC 4PJLA 3ZQQA 1EF4A 4IHWA 1HW5A 3DPUA 1JTYA 2E1MC 4F7ZA 1BI3A 1BI2A 2HVQA 3IAS2 3TQNA 1VQNI 5LRRA 3FXJA 1TC3C 2JQ7A 3FMQA 4Z2YA 2GIVA 5FKKA 3ASNH 4E7JA 2L4AA 2PG4A 1BJZA 1ZKGA 3D5LA 3JRHA 3OR1C 3BZ6A 3LQQA 3KEOA 3J81Z 3CCSI 3JRGA 4IQJA 1AWCA 2HKOA 5BS6A 3K4LA 3JRCA 1TWHJ 1BL0A 1WGXA 1WHUA 3V8LA 1X4PA 3IKTA 3I3LA 3GF2A 1FMVA 4E7LA 2FMLA 4IKFA 5F1RA 3BLYA 2ZNYA 3F21A 2LYCA 1IRFA 1AHDP 3BPVA 4RAFA 1VQKI 2I5UA 3OSGA 1X1CA 2DA4A 2XGEA 4XLEA 4XKCA 1JKRC 1SVMA 2BV6A 1QPMA 3HIFA 3S14J 2EFOA 4LB6B 2QQAA 2XGDA 3CP2A 1IZ1A 3BCBA 4KN4X 3P9KA 4KFCA 1LDDA 2L9NA 2K86A 5TJJA 1HKSA 2A69F 2Q2EA 1IUFA 4GDFA 4BHCA 3WTVC 2BVLA 3CZ6A 2VT3A 4RS8A 4Z6YA 2F4MB 2CW7A 4H0EA 4E7KA 2OJED 3ULQB 3WG7H 1FTZA 4S05A 2A07F 3I5UA 2VIXA 1U3EM 1FZPB 4A3FJ 1SD5A 5D8KB 3F22A 2CJJA 2KISA 1PJRA 2LOOA 2GIZA 4XN0A 2XB5A 1OKRA 4G7OF 3CCMI 2EIJH 4UB6C 1JXSA 2YX4A 2MH2A 4P96A 3S16J 2Y31A 3HBLA 2OA4A 2L01A 1ETQA 3UNGC 2FMYA 4K2EA 4BBRJ 5JR3A 3AG4H 2D2WA 4M74A 3DLLF 4DZJA 2VKHA 2PMZN 2M0CA 1U6GA 3HSRA 3M4OJ 2FXAA 1Z7UA 2KJCA 1Z91A 3ZMUA 1H88C 3CO7C 1HW2A 1B6AA 5BPDA 1V4RA 2WV0A 2O7OA 5KK1A 5D6FA 5BMZA 1Q1HA 4KJZA 2JPBA 3OWTA 4RMNA 2Q2EB 2IVMA 2WY7Q 3J81K 3JSPA 5LFAA 3NWSA 1QA6A 3CC2I 4EGYA 3OSFA 1ETOA 2RVCA 1V5EA 3WHCA 2M2EA 2IS1A 3L2VA 1LNWA 4U0VA 4QPQA 2ECCA 3F72A 5AONA 4GYIA 5GP9A 2BZTA 3C7JA 2JVHA 1IJWC 4KNYA 3M9AA 2IGKA 3CCUI 3AL0C 1KU2A 2OD5A 2WAEA 3HXLA 2CUEA 3BZCA 4HNUA 3KZYA 3Q3SA 2MG4A 3CDIA 4XSXF 1UMQA 4HNTA 2ZMEC 4ZDPA 1K61A 2RQPA 2PJPA 1FBQA 2VXDA 3KP6A 1TWFJ 2Y0SN 2FD5A 4HLXA 3DV8A 3ASOH 4OIQF 4DYCA 2HS5A 2OQRA 3MFKA 2DA6A 2LY9A 1TQPA 5IYDJ 2E35A 2XV4S 2M1BA 2VQGA 4KUMA 3LFUA 3K1MA 2VKVA 3TO9A 1V5GA 2M87A 1YJWI 1VQ9I 5GAGJ 3K4NA 3K69A 5F1JA 2J5OA 2ZC2A 1MD0A 2YSRA 4GO1A 2KT0A 5K7ZA 3S1MJ 3VSKA 2KLOA 4F3QA 4CH7A 1J75A 2EZKA 3H1CA 3NAUA 5CPRB 4PGGA 1P7JA 4L5JA 5K7FA 1IXRC 3QODA 2P81A 1FYMA 1ZGAA 1Y8QB 2A3SA 3RJPA 2HPMA 4BXFA 2K85A 1I6XA 2XAJA 2XUBA 1TWAJ 2FEZA 2QA4I 1KQ9A 1MBHA 2H09A 5DDGA 1ETWA 1SEUA 1JT6A 2QM3A 2PJRA 2XAQA 3DKXA 4UVBA 2XPVA 2GA2A 1T6SA 1O57A 2H94A 1JUMA 2IJLA 1RIOH 1X2NA 4IHYA 2KDOA 1W0TA 4BQOA 3RPUA 5CVIA 3WU1B 4A5NA 1I1GA 4ENMA 2HXIA 1G3WA 2VKEA 2NS0A 1SMTA 5F04A 2AQFA 2NS8A 1I39A 1R5GA 3ABKH 3PL8A 3DTIA 4ESJA 1ZHFA 2FA5A 1REPC 3RZOJ 2H1KA 1MMAA 2DMQA 2QVOA 1OISA 3RCOA 2CWEA 1ZLKA 2XAUA 5JLWA 1RKTA 5H6RA 5BPIA 2A68F 5EG0A 4LD5A 2DAOA 4A3IJ 5LGNA 1IG7A 2IS2A 2NRAC 3DP7A 5E3LA 1IXCA 2H1LA 3F8FA 1UAAA 1N75A 2QQ9A 2LLKA 2QSFX 4C30A 3TW7A 1YJ9I 4M6VA 6PAXA 2X6YA 5HDGA 4GFBA 2G7HA 1G3TA 2HOEA 2HTSA 2R5ZB 4E7IA 3RI4A 2EA4A 4AD9A 4YIRX 1POGA 3QU6A 1HBXG 1NK3P 1XX5A 2K27A 3DBRB 2LY1A 3EYIA 2VLAA 2W1OA 5KHDA 1DU0A 1R22A 2QENA 1Y1WJ 5BNGA 3PO3J 3AG3H 1UB9A 2CQXA 3LSRA 4C3IJ 1NG6A 1B8IA 4IVNA 1QU3A 3VSLA 4MFDA 3VDXA 4XNFA 2E7WA 2FRHA 1R1TA 2CW0F 1XDSA 2KL4A 1QVUA 1W5CC 4DIQA 1R49A 3ERMA 4W1UA 2HNHA 4A3GJ 4PZJA 2K3PA 3KIOA 3KYDB 3SFIA 2LKSA 5E1ZB 2LKPA 1PVEA 4XLAA 2E34A 4RM3A 1XMAA 4R8HA 1Z3XA 1KQ8A 1V55H 2HGCA 3IKVA 1NHAA 2YU9J 1ITYA 2HU9A 5LRSA 1FEXA 1WPKA 1TP4A 3QPTA 3IC7A 3DKWA 4GGGA 2XSJC 2WA0A 2XRNA 2VONA 2EIKH 5EG0B 3GTJJ 3OYNA 4NBQA 1MBEA 2DYSH 2OQGA 2P6SA 4II2A 3LQRA 4XRSG 2M3AA 1PP7U 1K7AA 2XGXA 5DTDA 3WU0A 5LLQA 5J3LA 4ZZDA 2MLGA 4I01A 2A5WA 2VC1A 2D1VA 1VNDA 4IOCF 3SEZA 3FBNB 2M8GX 1MKMA 2Y9ZA 2OV7A 2RQQA 3O8GA 3MZYA 2O9LA 2LR8A 4DQ2A 2V1XA 4PUSA 3VYRB 2GXAA 3WTYC 1N78A 4BACA 1ONVA 4Y52J 1LFPA 1Y8RB 3BJ6A 4L5EA 1R9TJ 4HDUA 4RLQA 1OCPA 1W7PD 1B72A 4LLGF 2CH0A 2M4GA 1FJLA 5FO5A 4E7HA 2FNPA 3JR9A 1MMGA 2LY2A 2LC2A 3MVPA 4N9IA 1B4AA 1HXDA 3MEXA 1FNNA 2IEKA 4JX5A 5EF6A 3GZ6A 2DK5A 2A5YB 2MLKA 1SMYF 4IZZA 2DA1A 3HHGA 1E2XA 5HDKA 1Z1DA 1X2MA 1GVDA 3RTRA 4XKWA 1WH7A 3A03A 5FRNA 2QSGX 1W1WE 2P4WA 4RAGA 2V26A 4M3BA 1ZARA 3DF8A 2B7EA 3PFIA 5IYCJ 3CMYA 2JA6J 1D8KA 3O8HA 5LHIA 1F36A 1R00A 4XIDA 1DUXC 4CA0A 3F3XA 2Y0MA 2R5YB 1FWZA 2HEOA 3HOVJ 1RR8C 3MKLA 4LITA 5JI6A 2CQKA 1K4SA 3KE2A 2R7XA 1RUOA 5EJCA 5LD2C 4M3FA 4UUSB 1R71A 1T56A 2EIMH 2IGMA 1YTYA 1EJ9A 1Y0UA 3AKZA 1ZYRF 2P5VA 4LIVA 5DCMA 3V42A 3WGGA 1KYZA 1DP3A 1G3SA 1R4NB 2LH9A 2OBPA 2XF7A 2FU4A 1B72B 2ACJA 1YLFA 4XLFA 4JP0A 3KP3A 1IAWA 2HQAA 3PSFA 4IOAF 3K4KA 3QPHA 3JRIA 2HDDA 3N05A 2TDXA 4M71A 3JRAA 4C2UA 3V7SA 3H0GJ 5F0FA 2FBIA 1H9TA 1MNDA 4I0BA 2GM4A 2X6WA 2M9HA 4HX7A 2HOTA 4UHTA 2VJ5A 2B0LA 3OS1A 3E6BA 4BQNA 4B3AA 4A3MJ 3ZQ7A 5EEHA 1PUFA 3PFYA 5K5QA 4XR6A 4AYBA 4KA4A 1U5TA 1R5HA 1RETA 2GOMA 3A0HC 2FOKA 4M3DA 1ZREA 1VQ6I 2PMHA 2F6CA 2D45A 3HKZA 3GMEA 4M6YA 1CF7A 1TT5B 2XIGA 5B66C 2P5LC 5BQTA 5M3FJ 3GVAA 1GLNA 3G73A 3HOYJ 1OCTC 2VODA 1ERDA 3FMSA 5L3EA 5L3BA 4Q5SF 3OS2A 2DBBA 4LG3A 1OJLA 3G1OA 5DCMB 3C18A 1IDZA 4DOZA 2MC3A 3CCRI 3HPHA 5L3DA 3UKGA 4KIGA 1IV8A 1YW8A 1CQTA 2PLYA 4A12A 4ABZA 1A36A 4DW6A 3T1BA 1YG2A 4A5MA 3HM5A 2M8EA 4RB3C 2R7TA 4V2FA 3GZNB 5FFXA 1D0YA 4P9FA 3V7CA 3G3ZA 4P5OA 3WTWC 1UJ8A 4FETA 5B1BH 4ZYGA 2HDWA 2ZJRF 4CCNA 5TRDA 4AIJA 3ZMDA 1OFCX 5CQEA 4LLLA 2DFHA 4XQFA 4A3EJ 4BS9A 1PUFB 1RKWA 4CSWA 4WXDA 1BIAA 1YW9A 2L9RA 1U5TB 3I59A 5ICCA 1P92A 3COAC 4IHVA 1G8XA 1QZZA 1FIPA 2L7ZA 1ZH5A 1O4XA 1LJ9A 3PM1A 2IBDA 2LD5A 4M72A 1CF7B 5FD6A 1NTCA 2HVRA 1QO0D 2VPRA 3K4MA 1O3SA 4LFUA 4ENKA 1SFXA 4PSWA 3LSMA 4U88A 4BYYA 2IT0A 2G7UA 1IN8A 5E3OA 1W4MA 4IXAA 5IT9Z 3MD2A 2R7VA 1IUYA 2AHQA 3I56I 5JHUA 5HNHA 5JVGF 2Y30A 3E6MA 4A2UA 2K9MA 1MJAA 3HSFA 1B9MA 1LUJB 5CVRA 5HNFA 4KDPA 3NEUA 1SFKA 1WSUA 3LFKA 4HF1A 1VQ5I 2ESNA 3E6DA 4S04A 2W48A 2E19A 1FOYA 1D8JA 2A6TA 2V1DA 4TV7A 4L9VA 2DOAA 2JVGA 1ZRDA 4M9SA 2E1MB 2E5NA 5DCFA 4ZYAA 3TMOA 5CLSA 5GAEJ 3TL4X 4IHXA 4IL6C 2YX7A 4UV9A 2E5ZA 1KYWA 4HX4A 5DD8A 3IV5A 1OYYA 2E7XA 2Q0OA 2L02A 5DD4A 4CDGA 1EA3A 3S3MA 1HF0A 1IDYA 2ID6A 4L0ZB 2Z3YA 4FCYA 1GDTA 5AIQA 4ZZLA 3GYHX 3I64A 4N4OB 3SFZA 3JCUC 3VOEA 3JRDA 2QF7A 3S2HJ 1OR7C 2V1NA 4HSRA 5ED4A 2M7BA 4HNVA 3WTZA 4BAYA 1WVRA 5E1XA 3ERED 1ACIA 4RDUA 3GWZA 1FPQA 3HSEA 4UNOA 2HFHA 4CGZA 5IP9J 3X2QH 1JHHA 3C2BA 3QRFF 1X1BA 5E18F 5LEKA 3IRQA 1YOVB 2HYFA 2KP6A 3DEEA 4AC0A 1RR7A 1UHMA 1MNEA 2QKLB 2W82A 4WXHA 5ICEA 5J1YA 2IW5A 4XKVA 3HDDA 4N9HA 1MMSA 3GTMJ 5GPCA 1YS7A 4OIOF 3S1NJ 1VZ0A 4M9ZA 3FWEA 3BOQA 1K6YA 2Y69H 1OCOH 2L7FP 1XDUA 3OOPA 2WAQA 3HPGA 4BH9A 5DS9A 3CUQA 3M8EA 3S32A 3P5JA 2NNNA 5DV5A 1HSJA 2VOOA 1Z3YA 1DPRA 1APLC 3NRVA 4C2MJ 1YIOA 3ZP5A 2RGVA 2EH3A 1GT0C 1EH8A 4BEHB 5IT9K 5EGOB 2XF5A 2XASA 1R6RA 2OC6A 2PEXA 2VQCA 3DPTA 2FBKA 3H9JA 3RPUD 4HYEA 1IF1A 2V7FA 2DFIA 1FY7A 2R7OA 1EH6A 3C2HA 1T98A 2Z16A 3G4SI 1FT9A 2LREA 3VFZA 2P7VB 3HRMA 4D7NA 3F8BA 3I4NJ 4EATA 5K7HA 1W36D 1MDMA 4KT6A 4BY1J 4MQ9F 5FLMJ 5E8IA 1VI0A 2L54A 2MGQA 4CO8A 2NVQJ 5HLGA 3WG9A 2DFEA 4UY8I 2HOAA 5H2FC 5H6QA 2DYRH 4YEJA 4Q48A 1AA7A 1LEAA 1H8AC 4JX6A 3EUHC 2DOEA 4BXXJ 3LSIA 4JX4A 3H92A 3GCMA 4PFOA 2WB1N 5J40A 4EM0B 3T0YA 1U8BA 1S7EA 2R7DA 3KLOA 2UXNA 2M30A 3CUQB 3HOSA 4XN3A 3VEPA 3PNTA 3B6CA 3HC7A 1A35A 3F6OA 1FOWA 1TWCJ 4IO9F 1ODDA 2ID3A 1V3FA 1JKOC 1GV5A 2GZWA 1D3YA 3OYKA 2X4HA 2Z33A 2P5KA 2CRGA 3BT9A 4XORA 3RPQA 2F4IA 2NVYJ 1WKMA 3S2WA 3H5AA 5JFRA 1HKQA 2O61A 4XRSA 4ENNA 1F43A 3HRUA 5ERIA 1XMXA 5E3NA 4CYCA 4WCGA 1ETYA 2XPWA 3GLLA 3L2UA 2Q1ZB 1TLHB 5D8LB 5IYBJ 2HQRA 5E8GA 3SZPA 3W2WA 2LKXA 3Q0UA 1MDMB 2BY3A 1RESA 4UUVA 4HDVA 2IP2A 2D1HA 3GUDA 2HQNA 1TNSA 2LVSA 1ZK8A 3RSNA 1E3PA 3S8PA 1JHFA 4V19K 2QUFA 4CZZA 1TZLA 2H8WA 3WGHA 3GTGJ 1WJEA 1YFHA 5FLVA 1WJCA 2DDBA 1ETKA 5HS9A 4DBQA 1MMNA 4OMYA 2HDCA 4AUXA 1U8RA 4RGUA 2IA1A 2DTZA 2X9DA 3SZTA 1XCVA 2CO5A 4C2TA 1D5VA 2OTLI 3K7AJ 5HS8A 2ZJQF 1GUUA 3S1RJ 1RUNA 1MJBA 4GXOA 1HQCA 1SFOJ 2ZXWH 3M07A 3R0JA 3K2ZA 4E6KG 3DFGA 2MD5A 1QRYA 3GFIA 1D1AA 4EEFG 3M8JA 1ZGWA 2A61A 3OYDA 1X1DA 4I09A 4CCOA 2M0MA 3DKYA 4HV5A 3RKQA 4KITB 1SVOA 3H3VK 2LP0A 2HYJA 2JRMA 1FMWA 2LF8A 3R61A 1JGGA 9ANTA 2JWTA 1QHGA 2W25A 1JJ8C 2V6CA 4CYCB 4XRMA 1YX3A 3U9GA 2KDZA 1MNMC 2BEOA 3B73A 3DQVC 5D5UB 4EVIA 3BR6A 3FM3A 4Q4ZF 1TW3A 3V4GA 2WB1A 4OWRB 3VYUB 2H27A 2E2HJ 4A3JJ 4HW0A 2CGPA 4XICA 3E3VA 2DA5A 3ABLH 3KPHA 1UFMA 4U87A 3S15J 1IRXA 3H9QA 1BBYA 3BG6A 4C9YA 2LBFB 2VE9A 2X48A 1BOBA 3OIPA 3HOTA 4B4CA 3MZHA 4PSXA 3R0AA 2X1CA 3WHBA 4N0BA 2E36A 5EEGA 3B02A 1DPUA 4QIWN 2EV0A 2ZO4A 1HOMA 1TBXA 2FF4A 2R7QA 2K9LA 2KFDA 4BE0A 3H5RA 4MNUA 3CMAI 2R7ZJ 2OAZA 4RAYA 3D5RC 2R5ZA 1LVKA 3QP5A 3EETA 3FISA 2W4SA 2LDUA 1X3UA 1MBJA 1P4AA 2DA2A 3QU3A 3ZN1A 4A0XA 3MKZA 3S3OA 4A3LJ 4DJAA 3SQNA 2GOXB 1W5TA 4LB5A 4O3MA 3Q5FA 2X85A 4OIRF 2ICWG 3W2VA 5GADJ 5LGUA 3ZCOA 2V9KA 2BW3B 3FX3A 2COBA 3BQZA 3LA3A 1Y39A 1OYIA 1SAXA 5DM6F 2W57A 4DYQA 1P4WA 4BE1A 1T8IA 4D5CA 1WJBA 3P7NA 3K9TA 2MSYA 3ABMH 5EZGA 2E1CA 2ADUA 4BJ5C 3KYCB 2STWA 4CYDA 5F27A 3BG5A 1N25A 1XMKA 4OINF 2TRTA 3U1DA 4PJNA 1K79A 2F5DA 2NVTJ 2P8TA 1XG1A 3TO6A 2LNBA 4KIBA 2OPTA 3I71A 1YITI 4LOCA 2QBYA 4XK4A 4HF2A 4RGXA 4KIFA 1WQ2A 4NHJA 3HRSA 2ZFWA 3BR5A 5DEQA 2DO7A 4HEA2 4A3BJ 1VQOI 3KFWX 4BDYA 4I76A 5KNLA 3FHZA 3OR2C 2KRCA 3KCCA 3RKXA 2CYYA 3V7RA 5KAFC 3FK6A 3WTTC 1K83J 1E3OC 3FBIB 3KLNA 1HA8A 5CJ9A 1XC5A 3BR1A 3Q0WA 2GXGA 5GAHJ 1MIJA 3BJAA 1WCMJ 3F8NA 2L9VA 1TQIA 3IAM2 5K5OA 4G94A 3H35A 1OCRH 4I98B 3OYLA 1HDDC 2K4BA 2QEXI 3S17J 2DI3A 1XGOA 3WE3A 4UB8C 1ZR4A 3CF2A 3I54A 4CCMA 4CXFA 1K78A 4I7HA 1Z9CA 2R3SA 3I53A 4L9TA 4AU7A 4B47A 1NK2P 4AIDA 4IX7A 5HLHA 3CD6I 1T08B 3GFJA 2R7WA 1IRZA 2XKOA 3CF5F 3I4PA 3LL7A 2XAFA 1P9QC 2DPDA 2V1UA 1ZRCA 4IRGA 1DU6A 2DT6A 1ON1A 3HG9A 2XKPA 2AO9A 2VKDA 4LK0F 2Q8KA 2L2OA 4XONA 2QBYB 3T8TA 4OMZA 3NARA 1ZN2A 5J1UA 4EJUA 1NH3A 4EV0A 1BC8C 5L3CA 4YFNF 4KMUX 1LB2A 5FKOA 3BP8A 2QGUA 4MQVA 2R5YA 1QGPA 5CKTA 4E7SA 3ZRGA 1R1VA 3MCZA 1K4TA 2Z1DA 1YRNB 2JMWA 3E5XA 1ETXA 2WV1A 2PI0A 3KZIC 4AYBN 2HZTA 3PIPF 4D0PA 4UUSA 3GTKJ 3BR2A 3HKZN 2FBHA 1OQYA 3CJNA 4HQEA 1ZG3A 4L9JA 4HOBA 2PFBA 2HVSA 3GZ5A 5CVUA 3EUAA 3RKYA 3SXYA 1BN5A 4AM3A 2ZB9A 5K1YA 2OZ6A 1SFUA 5IT3A 2VBWA 1K78B 3U2RA 4L0YB 2DTRA 3RYRA 4PJ0C 1KU9A 4PFPA 3ZMVA 3H9GA 2I8DA 1G3YA 1YE9A 2BY0A 4M6XA 5J47A 2DN0A 1YO5C 3R4KA 2MABA 1S29A 1PDNC 3IH4A 4QLCU 3K0LA 4KN7X 4NQWA 2KRFA 2R7SA 3E1SA 5FROA 3FXMA 2FQ3A 1B9NA 2KQRA 3HHHA 5FFZA 5C44J 1LFBA 5FLXZ 1WH5A 1T38A 2K5CA 3I58A 1VF9A 3K2AA 4KT5C 4B09A 1QVTA 3OYJA 4L5IA 4BQQA 1XSDA 4UXNA 5L3FA 2DA3A 1D0XA 3DTKA 4J00A 3H3UA 3TDUC 3HUGB 3FDYA 3FK7A 3CESA 2LF7A 2M7AA 1HKTA 1S3JA 3OYEA 2XHKA 1D0ZA 1IN7A 4OU0A 4F93B 1O3TA 2QKMB 2STTA 4ESBA 5E79C 2VL8A 4A6DA 4EMSA 2O8XA 4D5FA 3A01A 3FHNA 2M34A 2CSOA 1TT0A 2F5FA 1VQMI 3VYSB 1L0OC 3WGIA 4PGHA 1SVLA 1U9OA 2UUZA 1S5LC 2K9NA 3EQLF 2JUGA 1VFCA 2R93J 2GAUA 3ECOA 1WJ5A 2O6GE 2ELJA 1BJAA 2CV1A 2VJ4A 2EBIA 1R7JA 1FBSA 1AKHB 3HOWJ 2FNAA 3QAHA 3TKYA 4NQWB 5B3SH 4OAZA 5ILVA 2CS3A 1WI3A 2DLLA 1O7LA 3ISPA 2W7NA 1MBGA 4EJOA 2RN7A 4E70A 5LHGA 1AOYA 4LGWA 1LQ1A 3JRBA 5D5WB 2E1NA 2WY8Q 3D5SC 4RB2C 2EFQA 1HCRA 4HF0A 2E2IJ 4BBSJ 1X3ZB 2Z5UA 2ZXHA 2GBYA 3FKJA 3VODA 3WTSC 3QPLA 3L09A 5TISC 2COMA 1USTA 1SANA 2L4MA 3ZMSA 3WE2A 2AS5F 2E2JJ 3FXKA 4WXCA 1WRJA 2YS9A 1QZEA 3A01B 3CMEI 4ZTJA 3FXRA 2WAFA 2ECBA 1X1AA 3ZOBA 2ZBKA 2CW8A 4CICA 2BHYA 1U2WA 5FD5A 4KMFA 2B63J 1J5YA 4RGRA 3WTUC 3BG7A 3WU2C 3BY6A 1IXSB 1T0FA 5FLXK 2GQQA 1S7AA 3GTLJ 3MWMA 3W6JB 1LEBA 2H6CA 2O0YA 5HOOA 1R36A 2B9SA 2VOPA 5HVQC 2GWRA 1I6HJ 1M1EB 3IH2A 3KEQA 1MGTA 3QYBA 3OYAA 2CQ7A 1USSA 1CGPA 3C3WA 4RM2A 1D1CA 3S93A 1YW7A 3PIOF 2DMNA 2HPIA 1FYKA 4W97A 4Y33A 2IXSA 2Y2ZA 1U78A 4BE2A 4NNJA 2KIMA 2FX0A 1WJFA 3DXJF 4M73A 3BTCA 2QZ8A 2ISYA 2WAQN 3PO2J 1BM9A 2VUMJ 2R7RA 1ZG1A 4P9UA 2KRHA 3TDZC 1XCBA 5D4RA 2XRLA 2QSHX 3TOAA 1YX5A 3ZMZA 1VQ4I 1R58A 1P4XA 4YG2F 4HQMA 5FB2A 1SC7A 3DEUA 1T95A 4G6DA 5D5VB 3MKYB 3CC7I 2NNYA 2IGOA 2HKXA 4GRIA 3IWZA 5HDNA 4U7DA 3CCQI 5LEJA 2EV6A 1RPWA 4Y13A 5EYRA 3QPSA 2GLOA 3CCVI 1IGNA 5HLIA 2LG4A 2K4JA 2V9VA 2CUJA 2W00A 2BOLA 3CJQB 4ZC3A 2ZSIB 3LA2A 4ENJA 3FXLA 4ON0A 3CCLI 1HSTA 3A0BC 2CUFA 4PJJA 4EGZA 3EUHA 2EILH 3M8FA 1XSVA 1D1BA 4AVPA 4ZDOA 4UVCA 2DMPA 5DM7F 2DDAA 1EH7A 2Z9OA 4RB1A 1MJ9A 1OCZH 2OCEA 2BGCA 4HZFA 3KP2A 3F23A 2JN6A 2BYVE 3LSJA 3TBIA 2A05A 2PBIA 1JJ6C 2AXLA 1WJAA 2R7FA 3DU5A 4BEHA 2UZKA 1OYWA 5EGOA 3DLAA 3ZQIA 2CFXA 3GLXA 3NQOA 3W3CA 3GW2A 1FOKA 4L18B 4UUTA 4C3JJ 4X0GA 4BHBA 2K3FA 3BCAA 3DPLC 1UELB 3FKIJ 1XS9A 4HPQA 1DQUA 1BI0A 2A6HF 4HLYA 1JI8A 2GXBA 4KICA 3TW6A 3CDLA 2HR3A 4ETSA 4A0ZA 5GPAA 3SJMA 3HOUJ 4IHSA 3ZN0A 3QOEA 3J7AY 1U5TC 2DQRA 3FIWA 1RC9A 4R1HA 3LSKA 5HODA 2O3FA 2X51A 1NG7A 4IRHA 5J4VA 1SD6A 3QYEA 1TTYA 5ILSA 4EM1A 2JA8J 2KMUA 3V8JA 2EFNA 1O7FA 3ZGKA 1ZGJA 3H36A 3F8CA 2ME6A 3PNYA 2K40A 2EFPA 4G6TB 3M3YJ 2G0EA 3IUOA 3BG9A 1IN5A 1UZCA 5E17F 3MQ0A 1W5SA 4FASD 1V54H 1SD4A 2ME0A
chains in the Genus database with same CATH topology
1FMWA 3I9V2 4RM3A 2LRDA 5HLTA 4KISA 2Z2SB 1Z3XA 4B3XA 4CCLA 1QHGA 3PSIA 4ZJZA 1G59A 3VWBA 2HU9A 3K4CA 1YX3A 2OUMA 3E0JB 4JOMA 3SEQA 3DQVC 2XSJC 2WA0A 2BVMA 3OYNA 3H5NA 4II2A 2WB1A 3MMYB 2M3AA 2CMPA 1DGWY 4OWRB 3VYUB 1U0JA 3CMMA 4NC8A 4QPOA 2A5WA 4DGWB 4XLCA 4IQ4A 4U87A 1IRXA 3H9QA 3SEZA 4ZTFA 3BG6A 4C9YA 3FBNB 2VPLA 2OV7A 4NUBA 4ITVA 2LBFB 2RQQA 3NWTA 3OIPA 1BOBA 1MMDA 3HOTA 4XKBA 4PSXA 2X1CA 3CP8A 4PUSA 3AFHA 3VYRB 3L2RA 3DTEA 4II3A 3DWLE 1Y56A 1DGRM 3A1YA 4BACA 1N78A 1LFPA 3W2AA 2R7QA 2K9LA 2P0WA 3DU6A 1PYVA 4OAYA 4JQFA 2WBMA 5TGTA 2VQHA 3H5RA 4RLQA 3SDBA 4Y4RA 3D5RC 2WADA 1LVKA 2CH0A 2M4GA 2IS4A 2W4SA 4E7HA 3K70C 4XMYA 1MMGA 2LY2A 3MKZA 3S3OA 2CV0A 4DJAA 2LC2A 2GOXB 3KEYA 3EPZA 3OYBA 4Y3OA 2X85A 3W2VA 4IZZA 3ZCOA 4BUPA 2V9KA 2BW3B 3RTRA 4XKWA 5FRNA 2XF6A 2RNGA 4N4NB 2V26A 4BE1A 4MLOA 1WJBA 3OYGA 4AVZA 4BJ5C 4CA0A 3OY9A 4PJNA 2KPMA 4B44A 3AL0B 2M4KA 2VJJA 3OL4A 4LITA 2R7XA 5JHFA 2L9SA 2VASA 4F52A 5LD2C 4H4KC 4YRVA 2DT7B 2NOJB 1S9HA 2IGMA 4E4HA 3AKZA 3GBGA 3PUBA 4HEA2 4LIVA 3V42A 4BDYA 3H0DA 3PJRA 1DP3A 5KNLA 2CFOA 2LH9A 3OR2C 2KRCA 2XF7A 4BJTA 2X6XA 1Z21A 2DJIA 1HA8A 3FBIB 4XLFA 4BE0A 1MW7A 3RQ4A 2LBFA 2HQAA 3PSFA 2XC7A 3ONQA 3K4KA 3K4BA 3IAM2 3N05A 3MKWB 2AQEA 2UV1A 3H35A 4XM3A 3OYLA 4C2UA 1WFXA 3K10A 2VB6A 3LSHA 2X1DA 3A4CA 1MNDA 4BJ6C 1BR1A 3CF2A 4CCMA 1N77A 2X6WA 4E7ZA 4AU7A 4B47A 2VJ5A 3OS1A 4IX7A 1J09A 3QYFA 4BQNA 2R7WA 3PFYA 3KYLA 2V4JC 4XR6A 2FUG2 4AYBA 3LL7A 4PJMA 1P9QC 2ZFUA 3BC8A 2GOMA 2DT6A 3HG9A 1SAUA 2F6CA 1T0FC 3HKZA 4F55A 3F9KA 2BW3A 3ZR8X 2VKDA 2L2OA 4XONA 3LSGA 1GLNA 1ERDA 2E60A 4YELA 4B48A 4PJLA 3ZQQA 3OS2A 1BR2A 4LG3A 3DPUA 2ZSHB 2E1MC 5CKTA 4E7SA 4DOZA 2HVQA 3IAS2 3ZRGA 4P1WA 4CCJA 1KONA 3HPHA 2Z1DA 2KZVA 2X1EA 4E7JA 2VJIA 3UR3C 3CJRB 3K70D 3D5LA 4D9JA 2R7TA 3OR1C 2HVSA 5FRMA 1D0YA 3EUAA 4IQJA 3EUKL 4P5OA 4FETA 3K4LA 2HDWA 4CCNA 3OYHA 5CQGA 5CQEA 1X4PA 3I3LA 1FMVA 4E7LA 4IKFA 3BLYA 4HSTA 4XQFA 4PFPA 2LYCA 4BS9A 3H9GA 2I8DA 1YE9A 4CSWA 2DCEA 2MABA 3OYFA 1X1CA 1G8XA 4XLEA 4XKCA 2R7SA 3E1SA 5FROA 3OYIA 2DXIA 1Y6IA 2KQRA 2L5QA 2UWMA 2R4GA 3CP2A 2HVRA 3BCBA 3K4MA 2MC4A 2K5CA 2L9NA 4PSWA 3LSMA 4XLHA 1E0EA 2F5VA 2VXZA 3OYJA 4BQQA 1D0XA 3MD2A 2R7VA 2IGNA 3DTKA 4J00A 1QHHD 2BVLA 3HUGB 3CZ6A 2KHMA 3FDYA 2PMZA 3CESA 4F92B 1ZELA 2M7AA 2CV2A 2CW7A 3OYEA 2IS6A 5HNHA 4E7KA 1D0ZA 4F93B 2QKMB 2K9MA 2VL8A 5HNFA 4ZDLA 1SFKA 2VIXA 3FHNA 4HG2A 1TT0A 2LOOA 1PJRA 3VYSB 2A6TA 4XN0A 2DOAA 2UUZA 2JUGA 2JVGA 3C2GA 1UG0A 4U7BA 2E1MB 2VQLA 2E5NA 4ZYAA 3TMOA 1WJ5A 2ELJA 3UNGC 3TL4X 2CV1A 2VJ4A 2VKHA 2E5ZA 4NQWB 1X19A 4OAZA 1EA3A 3S3MA 2CS3A 4RLFA 3SZGA 2HZDA 2W7NA 3OMYA 3L2WA 4N4OB 4KJZA 3OWTA 2MYSA 1OR7C 2V1NA 2Q2EB 4HSRA 2WY8Q 3D5SC 4RMNA 2M7BA 2WY7Q 2Y0SA 4XOTA 5LFAA 3NWSA 2PJRB 2ZXHA 3IP4B 3FKJA 3OS0A 2JA2A 1Z7LA 1V5EA 2IS1A 3L2VA 3K6GA 4QPQA 4F91B 3OIQA 4CCKA 1X1BA 2JVHA 2KP6A 3DEEA 1MNEA 2IGKA 2QKLB 2W82A 4ZTJA 2WAFA 1X1AA 4XKVA 3KX2A 3AL0C 3SYTA 2CW8A 2WAEA 3HXLA 1VZ0A 4HNUA 1K6YA 2WAQA 3HPGA 3S32A 4HNTA 4ZDPA 3BG7A 3HL2A 2VXDA 2V6EA 1Z3YA 5HOOA 5HVQC 3QYBA 4BEHB 3OYAA 2XF5A 4RM2A 1D1CA 1R6RA 3S93A 4HRIA 2OC6A 2VQCA 2HPIA 3DPTA 3H9JA 3RPUD 2VQGA 4Y33A 2V7FA 3C2HA 2IXSA 2R7OA 3LFUA 4BE2A 1V5GA 4NNJA 2Z16A 1WJFA 2LREA 2RREA 3K4NA 3K4JA 2MD0A 3VSKA 4EATA 2MFZA 1W36D 4KT6A 2KLOA 4F3QA 4CH7A 2R7RA 5CPRB 1WJDA 2KRHA 4XL9A 1YX5A 3ZXSA 3QODA 1T95A 4YEJA 3MKYB 1AA7A 2O5RA 2HPMA 2IGOA 3EUHC 4BXFA 4GRIA 3LSIA 1BR4A 1V5FA 1W36C 4PFOA 4CUGA 3PNVA 2PJRA 3DKXA 2LG4A 2CUJA 2W00A 2BOLA 3CJQB 4ZC3A 2ZSIB 3A2KA 4LIUA 3HOSA 4XN3A 3PNTA 2KDOA 3HC7A 3G2BA 1LKXA 2JSPA 4BQOA 4ANJA 4XOPA 4PJJA 3S3NA 1D1BA 2AQFA 3OYKA 4ZDOA 4BGDA 4XORA 3PL8A 2F4IA 3DTIA 3H5AA 4D1QA 1MMAA 1X4OA 3OL3A 3TBIA 3OOUA 3RCOA 3LMMA 2XAUA 3L2UA 2Q1ZB 2R7UA 1WJAA 1LDKB 3W2WA 4B43A 3DU5A 4BEHA 3DLAA 2IS2A 3W3CA 4X0GA 3DPLC 3BCAA 1UAAA 1N75A 1UELB 3RSNA 4C30A 3VYTB 3S8PA 4J01A 4HPQA 1DQUA 1TZLA 4BU2A 1WJEA 1JI8A 2X6YA 3L2QA 4E7IA 4BDZA 4BL0B 1WJCA 4R79A 3OYMA 4DBQA 3QOEA 3J7AY 2LY1A 3U21A 4PK4A 2VLAA 3LSKA 1MMNA 2W1OA 4CZCA 1OLTA 5KHDA 2X51A 1NG7A 4NC7A 1NG6A 3QYEA 4C2TA 2CUZA 1QU3A 2KMUA 3VSLA 5KCMA 3VDXA 4XNFA 3ZGKA 3PNYA 2KL4A 4G6TB 2ZXIA 4DBRA 4DIQA 3OYCA 4E6KG 3IUOA 3M1CA 1D1AA 2HNHA 3M8JA 2K3PA 3OYDA 1X1DA 2XDVA 4CCOA 2M0MA 2L7KA 4FASD 3DKYA 4KITB 4XLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL4 A;  3OL3 A; 
#chains in the Genus database with same CATH topology
 5LGT A;  5HLT A;  1S7O A;  5GTH C;  4B3X A;  4CCL A;  2QQ8 A;  3OIO A;  2DPU A;  1QPI A;  1G59 A;  1GVJ A;  3AG1 H;  3J7A O;  3K4C A;  3MZ8 A;  4JOM A;  5E1W A;  4I6Z A;  2F5E A;  3SEQ A;  3DCF A;  1W7P B;  3N97 A;  1RNL A;  1JUP A;  3CCE I;  3H5N A;  4MTD A;  3MMY B;  2FQ4 A;  2CMP A;  1SFE A;  4MFE A;  4FHT A;  3CCJ I;  1ZLJ A;  1I3Q J;  3CMM A;  1H9G A;  3CQZ J;  4QPO A;  2ZKZ A;  4DGW B;  3HZJ A;  3GTO J;  2ZME A;  2DJN A;  3PQJ A;  4IQ4 A;  3ESW B;  4ZTF A;  4ITV A;  1MMD A;  1FC3 A;  1X3W B;  4MO7 A;  2VI6 A;  3W6V A;  4XBF A;  2EPF A;  1XN7 A;  4YIF A;  3L2R A;  3LOC A;  3DWL E;  1Y56 A;  1DGR M;  3A1Y A;  1RI7 A;  5LHH A;  5JVT A;  3W2A A;  4J19 A;  1IN6 A;  3BTI A;  2NVX J;  3DU6 A;  1PYV A;  2IA2 A;  3KP4 A;  2WBM A;  5TGT A;  2VQH A;  1FSH A;  3SDB A;  3FMR A;  2WAD A;  2NAZ A;  4WF2 A;  2ZJ2 A;  2IS4 A;  4QSH A;  1BA5 A;  2VE8 A;  1IN4 A;  1Z0X A;  5ICF A;  3K1N A;  2MW8 A;  5CVJ A;  1ETV A;  4B8X A;  3OYB A;  4MGR A;  4Y3O A;  2IRF G;  3BR3 A;  1ZTR A;  5B5E C;  4MEY F;  1A6Q A;  1ZRF A;  2VBX A;  3DBH B;  2XF6 A;  2ISZ A;  2VBY A;  3C1D A;  4LLN A;  4DNC A;  4MLO A;  3OYG A;  1XPX A;  2EB7 A;  2HYG D;  3S2D J;  2V9P A;  1VTN C;  5M5W J;  3AL0 B;  1E17 A;  4B44 A;  1HW1 A;  1Z6R A;  3OL4 A;  4Y15 A;  2LSO A;  1P2F A;  3HOZ J;  5JHF A;  1BOA A;  2ZME B;  3H3Z A;  4P55 A;  4YRV A;  3ECH A;  2DT7 B;  1IW7 F;  2IAI A;  4BKX A;  1TL8 A;  2JA5 J;  3ELK A;  2KZG A;  2FJ1 A;  1BI1 A;  2RKH A;  3H0D A;  4XSZ F;  2M5W A;  3PJR A;  2CFO A;  1Y0N A;  2O8K A;  4BJT A;  3GEZ A;  2PQ8 A;  2X6X A;  2DJI A;  4FT8 A;  2BBY A;  3RQ4 A;  3QQA A;  4QWQ A;  1R4M B;  2LBF A;  2XC7 A;  3IL2 A;  2F2E A;  1T33 A;  1A31 A;  2AQE A;  2UV1 A;  4XM3 A;  3GX4 X;  1WFX A;  3Q9S A;  3K10 A;  1LE8 A;  2VB6 A;  1MH3 A;  3LSH A;  4LMY A;  3O3K A;  1BW5 A;  2X1D A;  1QQI A;  1XD7 A;  4BJ6 C;  3QOP A;  1BR1 A;  5J1R A;  1Z6T A;  4E7Z A;  2JJ7 A;  5FKN A;  1LDJ A;  1IC8 A;  2W85 A;  1J09 A;  3QYF A;  3Q0V A;  4MIM A;  5M3M J;  2FUG 2;  5IOZ A;  2ZNZ A;  3U1K A;  3CUQ C;  1VQ7 I;  3BC8 A;  2QLZ A;  4EM2 A;  3IWF A;  1SAU A;  2HOS A;  4F55 A;  2BW3 A;  2EK5 A;  3F0C A;  2ETH A;  4ZYH A;  4EJV A;  2FSW A;  4FTH A;  2CQN A;  1FX7 A;  2CG4 A;  2WWY A;  2E60 A;  2FOW A;  4YEL A;  1KA8 A;  2E1O A;  2E71 A;  4B48 A;  2JUC A;  4HV6 A;  2Z99 A;  1A5J A;  4FX4 A;  1BR2 A;  4XLN F;  2ZSH B;  4B1R A;  2OF7 A;  3AG2 H;  4I99 C;  2EV5 A;  3E5U A;  4P1W A;  1KU7 A;  3F8M A;  4BHP A;  1KON A;  3CUO A;  4CCJ A;  5EEA A;  4L9N A;  1O3Q A;  2BHZ A;  2YPR A;  2KZV A;  2X1E A;  3BQY A;  4GYG A;  5E3M A;  3O2P E;  1A6I A;  5M5Y J;  1DP7 P;  5J6X A;  2VJI A;  3UR3 C;  1Z77 A;  4X1E A;  1SD7 A;  2EZL A;  3CJR B;  3K70 D;  1XSX A;  3AAF A;  4D9J A;  4YFK F;  3G1L A;  5DUI A;  5FRM A;  1LE8 B;  1ZAO A;  4CHU A;  3EUK L;  1UHW A;  4HA8 A;  3ZQH A;  1FIA A;  5HS7 A;  3TO7 A;  2LFB A;  2XAG A;  4RA2 A;  3OYH A;  3KP5 A;  5CQG A;  2ZCW A;  3RKW A;  2DA7 A;  4BNC A;  3CLQ A;  4OOI A;  1TNT A;  4HST A;  4YFX F;  4X6A J;  4A0Y A;  2DCE A;  4UV8 A;  3OYF A;  2RC4 A;  2LMD A;  1F4K A;  3I0T A;  1VQL I;  4RBO A;  2ESH A;  3KP7 A;  3OYI A;  1EKE A;  2DXI A;  2MBF A;  1Y6I A;  3CC4 I;  4NC6 A;  5FKL A;  2H8R A;  2KKO A;  4O6J A;  2L5Q A;  2UWM A;  3DBL B;  2R4G A;  5F64 A;  4S0H B;  2QQB A;  2QCO A;  2I10 A;  3FXU A;  2MC4 A;  3RDI A;  1QZY A;  1E0E A;  4XLH A;  1LVA A;  2YR2 A;  4JBA A;  5H20 A;  2F5V A;  2VXZ A;  4WWC A;  1VQ8 I;  2Y75 A;  3R60 A;  1OCC H;  2EJR A;  4V2G A;  2VN2 A;  2IGN A;  4AIH A;  1H89 C;  1QHH D;  1B1B A;  2LTP A;  2KHM A;  2PMZ A;  3REO A;  3RQI A;  3BRO A;  3JRE A;  4F92 B;  1ZEL A;  2CV2 A;  2DFF A;  1KQ0 A;  2IS6 A;  2DOF A;  3LWF A;  3HEF A;  5A2Q Z;  4G9Y A;  2MA3 A;  2JT1 A;  1FP2 A;  5D4S A;  4ZDL A;  2V79 A;  2NYX A;  4LJZ F;  5EZH A;  4HG2 A;  1G4D A;  2NOG A;  1MSE C;  4I2O A;  1FBU A;  4G7H F;  4O5V A;  2H6B A;  4GCV A;  3BR0 A;  3GFM A;  3C2G A;  3PQK A;  1S6L A;  1Y1V J;  1YRN A;  3BG3 A;  1UG0 A;  3LAJ A;  2R0Q C;  5C4J J;  1P6R A;  4U7B A;  2KIQ A;  4IHT A;  2VQL A;  2ELK A;  5F0C A;  3LSP A;  1GHC A;  4C3H J;  5M5X J;  4ZH4 F;  4IEJ A;  2P7C B;  3B6A A;  4FQG A;  1X19 A;  2Y9Y A;  2K9S A;  1JE8 A;  3J80 Z;  3L00 A;  1FYL A;  3E97 A;  2DW4 A;  3ZPL A;  4RLF A;  3SZG A;  3L1P A;  2HZD A;  3HRT A;  4EQQ A;  1FSE A;  5IP7 J;  3OMY A;  1BW6 A;  5IP6 A;  5LBQ A;  4OIP F;  3L2W A;  4UVA A;  4A6E A;  2MYS A;  3ROU A;  3JAM Z;  2ELH A;  1XGM A;  2JZY A;  3I4M J;  2Y0S A;  4G6Q A;  4XOT A;  3SHF A;  3RYP A;  5IOY A;  3I55 I;  2PJR B;  3IP4 B;  2F5C A;  3OS0 A;  2EZI A;  2JA2 A;  1Z7L A;  1ULY A;  4NDL A;  5ICG A;  3L2C A;  1IO2 A;  1BC7 C;  3K6G A;  4F91 B;  5K5R A;  5FJ8 J;  3OIQ A;  4CCK A;  3JSO A;  1ZG5 A;  1FOX A;  3HTU A;  1T39 A;  2CU7 A;  3TOB A;  2CQQ A;  1J2X A;  4HBL A;  2XRO A;  3HGY A;  3BPX A;  1P7I A;  1AU7 A;  3BZK A;  4EJT A;  3KX2 A;  4A69 C;  1HDP A;  3L9F A;  3SYT A;  2K9Q A;  1HC8 A;  2ZJP F;  3HOX J;  2JTV A;  2DQL A;  1DDN A;  1LPQ A;  1I27 A;  2F48 A;  3HUG A;  1MBK A;  2PN6 A;  3PUF A;  1R23 A;  3DEW A;  3HL2 A;  1UG2 A;  2W84 A;  3T8R A;  2V6E A;  1X58 A;  1PUE E;  5D6E A;  2JK3 A;  3P9I A;  3D1N I;  1YS6 A;  2HWV A;  3RZD J;  1EV7 A;  4AIK A;  4FX0 A;  4IF4 A;  2RAE A;  3E5Q A;  5KVR A;  4BQA A;  4KYW A;  3RIR A;  3LST A;  4HRI A;  3LAP A;  5GTI C;  3G6E I;  1RRJ A;  1UCR A;  1TW2 A;  2L3D A;  5DYM A;  2HTJ A;  1YYV A;  1KGS A;  4IPA A;  4ZYE A;  2C6Y A;  2RRE A;  5A2Q K;  4G8X A;  2DMU A;  3K4J A;  2KIF A;  2MD0 A;  3G71 I;  1XB4 A;  2K7L A;  2MFZ A;  1F5T A;  2NXN B;  1ENH A;  2F4O B;  2XPU A;  4ZYD A;  2DU9 A;  5ILU A;  1AKH A;  1GXQ A;  1WJD A;  4XL9 A;  5C4X J;  2DMT A;  3ZXS A;  5L3G A;  1O3R A;  4Q47 A;  1R1U A;  2G9W A;  1UHS A;  1B8I B;  2IA0 A;  2JA7 J;  2O5R A;  2D5V A;  1BR4 A;  1V5F A;  1I5Z A;  3BTL A;  1W36 C;  4Y7N J;  1J59 A;  1LFU P;  3KET A;  4CUG A;  3PNV A;  2GA1 A;  2X6O A;  3D0S A;  3J80 K;  4G12 A;  4JK1 X;  1YI2 I;  1ZQ3 P;  2R92 J;  3A2K A;  4LIU A;  1IRG A;  1YJN I;  3G2B A;  1LKX A;  2JSP A;  3ZQG A;  4ANJ A;  1J9I A;  4WK8 F;  2NS7 A;  4XOP A;  2HQ5 A;  4YII A;  3JAM K;  3WOD F;  3S3N A;  3JTG A;  4ESF A;  1F1Z A;  2XAH A;  4BGD A;  4MEX F;  2EQR A;  3ZQF A;  1YQA A;  3T5X A;  2HXO A;  2AXT C;  2J5P A;  3JTH A;  3JW4 A;  3K1P A;  2NVU B;  3IRR A;  4D1Q A;  2N8G A;  2EIN H;  1MZB A;  1X4O A;  2M45 A;  3KZZ A;  4XLP F;  1HLV A;  1I1S A;  4LK1 F;  1K6O A;  3OL3 A;  3OOU A;  4RB0 A;  3LMM A;  3ABU A;  2R7U A;  1LDK B;  5E20 A;  1JGS A;  4B43 A;  1QNT A;  2EFW A;  2YU3 A;  3BDD A;  2WTE A;  2OU2 A;  5DUK A;  3GO5 A;  1A04 A;  1G2H A;  1BIB A;  3VYT B;  4J01 A;  2RNJ A;  2VT2 A;  4BU2 A;  1JKP C;  1YIJ I;  5AIP A;  3F6V A;  1R5I D;  3BJO A;  1YHQ I;  3L2Q A;  2HI3 A;  4BDZ A;  4A3K J;  3QWL A;  4BL0 B;  3N4M A;  2DK8 A;  4R79 A;  3OYM A;  4EJW A;  3U21 A;  4PK4 A;  4LG0 A;  4HX8 A;  4CZC A;  1OLT A;  3HTS B;  4BXU A;  1MH4 A;  2RDP A;  4NC7 A;  4JYK A;  5F6F A;  1S72 I;  4M9X A;  2CUZ A;  2BY2 A;  5KCM A;  2MH9 A;  4AWX B;  3GTP J;  3O6B B;  3CJT B;  2XGC A;  2ZXI A;  4DBR A;  3OYC A;  4I0A A;  3M1C A;  4I02 A;  3FXQ A;  1W0U A;  1KU3 A;  3CO6 C;  1B59 A;  1XGN A;  2VBZ A;  3FZV A;  2XDV A;  2L7K A;  3VB2 A;  3G1M A;  4FIS A;  2JPC A;  1OR7 A;  2DT5 A;  4U0Y A;  1FLI A;  3I9V 2;  2LRD A;  4PDK A;  3FF5 A;  4KIS A;  5D5X B;  1FP1 D;  2Z2S B;  1J7K A;  3LA7 A;  3PSI A;  4U0W A;  3S1Q J;  3R6S A;  3V8K A;  1QBJ A;  4ZJZ A;  3VWB A;  4IJA A;  2OUM A;  2X0L A;  3E0J B;  2QWW A;  2FE3 A;  2O03 A;  3P9C A;  2BVM A;  3W6K B;  1X1P A;  1H0M A;  1STZ A;  1L3L A;  3ML6 A;  3CTA A;  5BOX A;  4G7Z F;  1S8N A;  1DGW Y;  1JT0 A;  2LK2 A;  1U0J A;  1JTX A;  3HYI A;  4HAM A;  1ZR2 A;  4NC8 A;  5CVV A;  1OMI A;  2EA2 A;  3IHU A;  5CYV A;  2Y48 A;  4NB5 A;  4XLC A;  1TWG J;  2XSD C;  3GTQ J;  2VPL A;  3TGN A;  4NUB A;  4M3G A;  5C3E J;  3NWT A;  2XB0 X;  3HJE A;  5F0H A;  4XKB A;  5F08 A;  4LG0 B;  3E7L A;  3CP8 A;  4QTR A;  3AFH A;  2UXX A;  3DTE A;  4II3 A;  4FE4 A;  4FE7 A;  5FKM A;  4WX9 A;  3MAJ A;  2OTJ I;  2L0K A;  4A93 J;  2P0W A;  5J8F A;  3EYY A;  4OAY A;  4JQF A;  4Y4R A;  3JRF A;  4RAZ A;  3J7Z I;  1MBF A;  3E6C C;  1ORK A;  5EDN A;  1FTT A;  3IH3 A;  3K70 C;  2OZU A;  3SDG A;  4XMY A;  2YUS A;  3TP3 A;  1I3A A;  2PX9 A;  2CV0 A;  3J7Y J;  1ON2 A;  1J0R A;  1C0W A;  2KIU A;  3KEY A;  4XRF A;  3EPZ A;  1KZH A;  5B1A H;  2L7M P;  3L7W A;  3GXO A;  2BXY A;  1OPC A;  4BUP A;  2RNG A;  4N4N B;  4MHG A;  4BY7 J;  2OCC H;  1T2K A;  3VPR A;  2BY1 A;  4AVZ A;  3EDP A;  3ZQC A;  3FM5 A;  2EZH A;  3OY9 A;  2KPM A;  1D5Y A;  2M4K A;  1RZ4 A;  2VJJ A;  1I50 J;  3M7G A;  1MSF C;  4Y17 A;  1PP8 F;  2L9S A;  2VAS A;  3HGG A;  4MTE A;  4F52 A;  1W7P A;  2RV8 A;  3ABT A;  4H4K C;  3BWG A;  2K02 A;  4PCQ A;  5FGM A;  2NOJ B;  4DZP A;  1S9H A;  2KJB A;  5JLX A;  3ZMT A;  4E4H A;  3ZQL A;  3GBG A;  3PUB A;  4DYR A;  3TED A;  3CDH A;  3QP6 A;  3Q9V A;  3MN2 A;  4M3E A;  5J4Y A;  1Z21 A;  1Q1V A;  2ZXJ A;  4IRI A;  5IY5 H;  1MW7 A;  1GXP A;  3CLO A;  2A6E F;  2TCT A;  1XTA A;  3ONQ A;  3K4B A;  3A02 A;  1JKQ C;  3MKW B;  2VC0 A;  2JRT A;  3I59 B;  1XGS A;  2IPQ X;  2JSC A;  3A4C A;  1F9N A;  1N77 A;  2W24 A;  3GFL A;  1G6N A;  1Z05 A;  1GV2 A;  3WTX C;  2BE5 F;  5J8C A;  2BXZ A;  1JUS A;  3KYL A;  1WI9 A;  2V4J C;  1WWX A;  2ZFU A;  4PJM A;  4RGS A;  4D7M A;  1VQP I;  4ASN A;  2QYO A;  3HB9 A;  3TP0 A;  1T0F C;  3BTJ A;  3F9K A;  2EWN A;  4A3D J;  3ZR8 X;  3FXO A;  5IPA A;  3M1E A;  3CCY A;  1Z67 A;  4A3C J;  1WZ2 A;  2WC2 A;  1TQM A;  3LSG A;  1E3H A;  2PMU A;  2XVC A;  3LNQ A;  2P6T A;  1U9N A;  1IV6 A;  3OV8 A;  2DOD A;  5KAI C;  4PJL A;  3ZQQ A;  1EF4 A;  4IHW A;  1HW5 A;  3DPU A;  1JTY A;  2E1M C;  4F7Z A;  1BI3 A;  1BI2 A;  2HVQ A;  3IAS 2;  3TQN A;  1VQN I;  5LRR A;  3FXJ A;  1TC3 C;  2JQ7 A;  3FMQ A;  4Z2Y A;  2GIV A;  5FKK A;  3ASN H;  4E7J A;  2L4A A;  2PG4 A;  1BJZ A;  1ZKG A;  3D5L A;  3JRH A;  3OR1 C;  3BZ6 A;  3LQQ A;  3KEO A;  3J81 Z;  3CCS I;  3JRG A;  4IQJ A;  1AWC A;  2HKO A;  5BS6 A;  3K4L A;  3JRC A;  1TWH J;  1BL0 A;  1WGX A;  1WHU A;  3V8L A;  1X4P A;  3IKT A;  3I3L A;  3GF2 A;  1FMV A;  4E7L A;  2FML A;  4IKF A;  5F1R A;  3BLY A;  2ZNY A;  3F21 A;  2LYC A;  1IRF A;  1AHD P;  3BPV A;  4RAF A;  1VQK I;  2I5U A;  3OSG A;  1X1C A;  2DA4 A;  2XGE A;  4XLE A;  4XKC A;  1JKR C;  1SVM A;  2BV6 A;  1QPM A;  3HIF A;  3S14 J;  2EFO A;  4LB6 B;  2QQA A;  2XGD A;  3CP2 A;  1IZ1 A;  3BCB A;  4KN4 X;  3P9K A;  4KFC A;  1LDD A;  2L9N A;  2K86 A;  5TJJ A;  1HKS A;  2A69 F;  2Q2E A;  1IUF A;  4GDF A;  4BHC A;  3WTV C;  2BVL A;  3CZ6 A;  2VT3 A;  4RS8 A;  4Z6Y A;  2F4M B;  2CW7 A;  4H0E A;  4E7K A;  2OJE D;  3ULQ B;  3WG7 H;  1FTZ A;  4S05 A;  2A07 F;  3I5U A;  2VIX A;  1U3E M;  1FZP B;  4A3F J;  1SD5 A;  5D8K B;  3F22 A;  2CJJ A;  2KIS A;  1PJR A;  2LOO A;  2GIZ A;  4XN0 A;  2XB5 A;  1OKR A;  4G7O F;  3CCM I;  2EIJ H;  4UB6 C;  1JXS A;  2YX4 A;  2MH2 A;  4P96 A;  3S16 J;  2Y31 A;  3HBL A;  2OA4 A;  2L01 A;  1ETQ A;  3UNG C;  2FMY A;  4K2E A;  4BBR J;  5JR3 A;  3AG4 H;  2D2W A;  4M74 A;  3DLL F;  4DZJ A;  2VKH A;  2PMZ N;  2M0C A;  1U6G A;  3HSR A;  3M4O J;  2FXA A;  1Z7U A;  2KJC A;  1Z91 A;  3ZMU A;  1H88 C;  3CO7 C;  1HW2 A;  1B6A A;  5BPD A;  1V4R A;  2WV0 A;  2O7O A;  5KK1 A;  5D6F A;  5BMZ A;  1Q1H A;  4KJZ A;  2JPB A;  3OWT A;  4RMN A;  2Q2E B;  2IVM A;  2WY7 Q;  3J81 K;  3JSP A;  5LFA A;  3NWS A;  1QA6 A;  3CC2 I;  4EGY A;  3OSF A;  1ETO A;  2RVC A;  1V5E A;  3WHC A;  2M2E A;  2IS1 A;  3L2V A;  1LNW A;  4U0V A;  4QPQ A;  2ECC A;  3F72 A;  5AON A;  4GYI A;  5GP9 A;  2BZT A;  3C7J A;  2JVH A;  1IJW C;  4KNY A;  3M9A A;  2IGK A;  3CCU I;  3AL0 C;  1KU2 A;  2OD5 A;  2WAE A;  3HXL A;  2CUE A;  3BZC A;  4HNU A;  3KZY A;  3Q3S A;  2MG4 A;  3CDI A;  4XSX F;  1UMQ A;  4HNT A;  2ZME C;  4ZDP A;  1K61 A;  2RQP A;  2PJP A;  1FBQ A;  2VXD A;  3KP6 A;  1TWF J;  2Y0S N;  2FD5 A;  4HLX A;  3DV8 A;  3ASO H;  4OIQ F;  4DYC A;  2HS5 A;  2OQR A;  3MFK A;  2DA6 A;  2LY9 A;  1TQP A;  5IYD J;  2E35 A;  2XV4 S;  2M1B A;  2VQG A;  4KUM A;  3LFU A;  3K1M A;  2VKV A;  3TO9 A;  1V5G A;  2M87 A;  1YJW I;  1VQ9 I;  5GAG J;  3K4N A;  3K69 A;  5F1J A;  2J5O A;  2ZC2 A;  1MD0 A;  2YSR A;  4GO1 A;  2KT0 A;  5K7Z A;  3S1M J;  3VSK A;  2KLO A;  4F3Q A;  4CH7 A;  1J75 A;  2EZK A;  3H1C A;  3NAU A;  5CPR B;  4PGG A;  1P7J A;  4L5J A;  5K7F A;  1IXR C;  3QOD A;  2P81 A;  1FYM A;  1ZGA A;  1Y8Q B;  2A3S A;  3RJP A;  2HPM A;  4BXF A;  2K85 A;  1I6X A;  2XAJ A;  2XUB A;  1TWA J;  2FEZ A;  2QA4 I;  1KQ9 A;  1MBH A;  2H09 A;  5DDG A;  1ETW A;  1SEU A;  1JT6 A;  2QM3 A;  2PJR A;  2XAQ A;  3DKX A;  4UVB A;  2XPV A;  2GA2 A;  1T6S A;  1O57 A;  2H94 A;  1JUM A;  2IJL A;  1RIO H;  1X2N A;  4IHY A;  2KDO A;  1W0T A;  4BQO A;  3RPU A;  5CVI A;  3WU1 B;  4A5N A;  1I1G A;  4ENM A;  2HXI A;  1G3W A;  2VKE A;  2NS0 A;  1SMT A;  5F04 A;  2AQF A;  2NS8 A;  1I39 A;  1R5G A;  3ABK H;  3PL8 A;  3DTI A;  4ESJ A;  1ZHF A;  2FA5 A;  1REP C;  3RZO J;  2H1K A;  1MMA A;  2DMQ A;  2QVO A;  1OIS A;  3RCO A;  2CWE A;  1ZLK A;  2XAU A;  5JLW A;  1RKT A;  5H6R A;  5BPI A;  2A68 F;  5EG0 A;  4LD5 A;  2DAO A;  4A3I J;  5LGN A;  1IG7 A;  2IS2 A;  2NRA C;  3DP7 A;  5E3L A;  1IXC A;  2H1L A;  3F8F A;  1UAA A;  1N75 A;  2QQ9 A;  2LLK A;  2QSF X;  4C30 A;  3TW7 A;  1YJ9 I;  4M6V A;  6PAX A;  2X6Y A;  5HDG A;  4GFB A;  2G7H A;  1G3T A;  2HOE A;  2HTS A;  2R5Z B;  4E7I A;  3RI4 A;  2EA4 A;  4AD9 A;  4YIR X;  1POG A;  3QU6 A;  1HBX G;  1NK3 P;  1XX5 A;  2K27 A;  3DBR B;  2LY1 A;  3EYI A;  2VLA A;  2W1O A;  5KHD A;  1DU0 A;  1R22 A;  2QEN A;  1Y1W J;  5BNG A;  3PO3 J;  3AG3 H;  1UB9 A;  2CQX A;  3LSR A;  4C3I J;  1NG6 A;  1B8I A;  4IVN A;  1QU3 A;  3VSL A;  4MFD A;  3VDX A;  4XNF A;  2E7W A;  2FRH A;  1R1T A;  2CW0 F;  1XDS A;  2KL4 A;  1QVU A;  1W5C C;  4DIQ A;  1R49 A;  3ERM A;  4W1U A;  2HNH A;  4A3G J;  4PZJ A;  2K3P A;  3KIO A;  3KYD B;  3SFI A;  2LKS A;  5E1Z B;  2LKP A;  1PVE A;  4XLA A;  2E34 A;  4RM3 A;  1XMA A;  4R8H A;  1Z3X A;  1KQ8 A;  1V55 H;  2HGC A;  3IKV A;  1NHA A;  2YU9 J;  1ITY A;  2HU9 A;  5LRS A;  1FEX A;  1WPK A;  1TP4 A;  3QPT A;  3IC7 A;  3DKW A;  4GGG A;  2XSJ C;  2WA0 A;  2XRN A;  2VON A;  2EIK H;  5EG0 B;  3GTJ J;  3OYN A;  4NBQ A;  1MBE A;  2DYS H;  2OQG A;  2P6S A;  4II2 A;  3LQR A;  4XRS G;  2M3A A;  1PP7 U;  1K7A A;  2XGX A;  5DTD A;  3WU0 A;  5LLQ A;  5J3L A;  4ZZD A;  2MLG A;  4I01 A;  2A5W A;  2VC1 A;  2D1V A;  1VND A;  4IOC F;  3SEZ A;  3FBN B;  2M8G X;  1MKM A;  2Y9Z A;  2OV7 A;  2RQQ A;  3O8G A;  3MZY A;  2O9L A;  2LR8 A;  4DQ2 A;  2V1X A;  4PUS A;  3VYR B;  2GXA A;  3WTY C;  1N78 A;  4BAC A;  1ONV A;  4Y52 J;  1LFP A;  1Y8R B;  3BJ6 A;  4L5E A;  1R9T J;  4HDU A;  4RLQ A;  1OCP A;  1W7P D;  1B72 A;  4LLG F;  2CH0 A;  2M4G A;  1FJL A;  5FO5 A;  4E7H A;  2FNP A;  3JR9 A;  1MMG A;  2LY2 A;  2LC2 A;  3MVP A;  4N9I A;  1B4A A;  1HXD A;  3MEX A;  1FNN A;  2IEK A;  4JX5 A;  5EF6 A;  3GZ6 A;  2DK5 A;  2A5Y B;  2MLK A;  1SMY F;  4IZZ A;  2DA1 A;  3HHG A;  1E2X A;  5HDK A;  1Z1D A;  1X2M A;  1GVD A;  3RTR A;  4XKW A;  1WH7 A;  3A03 A;  5FRN A;  2QSG X;  1W1W E;  2P4W A;  4RAG A;  2V26 A;  4M3B A;  1ZAR A;  3DF8 A;  2B7E A;  3PFI A;  5IYC J;  3CMY A;  2JA6 J;  1D8K A;  3O8H A;  5LHI A;  1F36 A;  1R00 A;  4XID A;  1DUX C;  4CA0 A;  3F3X A;  2Y0M A;  2R5Y B;  1FWZ A;  2HEO A;  3HOV J;  1RR8 C;  3MKL A;  4LIT A;  5JI6 A;  2CQK A;  1K4S A;  3KE2 A;  2R7X A;  1RUO A;  5EJC A;  5LD2 C;  4M3F A;  4UUS B;  1R71 A;  1T56 A;  2EIM H;  2IGM A;  1YTY A;  1EJ9 A;  1Y0U A;  3AKZ A;  1ZYR F;  2P5V A;  4LIV A;  5DCM A;  3V42 A;  3WGG A;  1KYZ A;  1DP3 A;  1G3S A;  1R4N B;  2LH9 A;  2OBP A;  2XF7 A;  2FU4 A;  1B72 B;  2ACJ A;  1YLF A;  4XLF A;  4JP0 A;  3KP3 A;  1IAW A;  2HQA A;  3PSF A;  4IOA F;  3K4K A;  3QPH A;  3JRI A;  2HDD A;  3N05 A;  2TDX A;  4M71 A;  3JRA A;  4C2U A;  3V7S A;  3H0G J;  5F0F A;  2FBI A;  1H9T A;  1MND A;  4I0B A;  2GM4 A;  2X6W A;  2M9H A;  4HX7 A;  2HOT A;  4UHT A;  2VJ5 A;  2B0L A;  3OS1 A;  3E6B A;  4BQN A;  4B3A A;  4A3M J;  3ZQ7 A;  5EEH A;  1PUF A;  3PFY A;  5K5Q A;  4XR6 A;  4AYB A;  4KA4 A;  1U5T A;  1R5H A;  1RET A;  2GOM A;  3A0H C;  2FOK A;  4M3D A;  1ZRE A;  1VQ6 I;  2PMH A;  2F6C A;  2D45 A;  3HKZ A;  3GME A;  4M6Y A;  1CF7 A;  1TT5 B;  2XIG A;  5B66 C;  2P5L C;  5BQT A;  5M3F J;  3GVA A;  1GLN A;  3G73 A;  3HOY J;  1OCT C;  2VOD A;  1ERD A;  3FMS A;  5L3E A;  5L3B A;  4Q5S F;  3OS2 A;  2DBB A;  4LG3 A;  1OJL A;  3G1O A;  5DCM B;  3C18 A;  1IDZ A;  4DOZ A;  2MC3 A;  3CCR I;  3HPH A;  5L3D A;  3UKG A;  4KIG A;  1IV8 A;  1YW8 A;  1CQT A;  2PLY A;  4A12 A;  4ABZ A;  1A36 A;  4DW6 A;  3T1B A;  1YG2 A;  4A5M A;  3HM5 A;  2M8E A;  4RB3 C;  2R7T A;  4V2F A;  3GZN B;  5FFX A;  1D0Y A;  4P9F A;  3V7C A;  3G3Z A;  4P5O A;  3WTW C;  1UJ8 A;  4FET A;  5B1B H;  4ZYG A;  2HDW A;  2ZJR F;  4CCN A;  5TRD A;  4AIJ A;  3ZMD A;  1OFC X;  5CQE A;  4LLL A;  2DFH A;  4XQF A;  4A3E J;  4BS9 A;  1PUF B;  1RKW A;  4CSW A;  4WXD A;  1BIA A;  1YW9 A;  2L9R A;  1U5T B;  3I59 A;  5ICC A;  1P92 A;  3COA C;  4IHV A;  1G8X A;  1QZZ A;  1FIP A;  2L7Z A;  1ZH5 A;  1O4X A;  1LJ9 A;  3PM1 A;  2IBD A;  2LD5 A;  4M72 A;  1CF7 B;  5FD6 A;  1NTC A;  2HVR A;  1QO0 D;  2VPR A;  3K4M A;  1O3S A;  4LFU A;  4ENK A;  1SFX A;  4PSW A;  3LSM A;  4U88 A;  4BYY A;  2IT0 A;  2G7U A;  1IN8 A;  5E3O A;  1W4M A;  4IXA A;  5IT9 Z;  3MD2 A;  2R7V A;  1IUY A;  2AHQ A;  3I56 I;  5JHU A;  5HNH A;  5JVG F;  2Y30 A;  3E6M A;  4A2U A;  2K9M A;  1MJA A;  3HSF A;  1B9M A;  1LUJ B;  5CVR A;  5HNF A;  4KDP A;  3NEU A;  1SFK A;  1WSU A;  3LFK A;  4HF1 A;  1VQ5 I;  2ESN A;  3E6D A;  4S04 A;  2W48 A;  2E19 A;  1FOY A;  1D8J A;  2A6T A;  2V1D A;  4TV7 A;  4L9V A;  2DOA A;  2JVG A;  1ZRD A;  4M9S A;  2E1M B;  2E5N A;  5DCF A;  4ZYA A;  3TMO A;  5CLS A;  5GAE J;  3TL4 X;  4IHX A;  4IL6 C;  2YX7 A;  4UV9 A;  2E5Z A;  1KYW A;  4HX4 A;  5DD8 A;  3IV5 A;  1OYY A;  2E7X A;  2Q0O A;  2L02 A;  5DD4 A;  4CDG A;  1EA3 A;  3S3M A;  1HF0 A;  1IDY A;  2ID6 A;  4L0Z B;  2Z3Y A;  4FCY A;  1GDT A;  5AIQ A;  4ZZL A;  3GYH X;  3I64 A;  4N4O B;  3SFZ A;  3JCU C;  3VOE A;  3JRD A;  2QF7 A;  3S2H J;  1OR7 C;  2V1N A;  4HSR A;  5ED4 A;  2M7B A;  4HNV A;  3WTZ A;  4BAY A;  1WVR A;  5E1X A;  3ERE D;  1ACI A;  4RDU A;  3GWZ A;  1FPQ A;  3HSE A;  4UNO A;  2HFH A;  4CGZ A;  5IP9 J;  3X2Q H;  1JHH A;  3C2B A;  3QRF F;  1X1B A;  5E18 F;  5LEK A;  3IRQ A;  1YOV B;  2HYF A;  2KP6 A;  3DEE A;  4AC0 A;  1RR7 A;  1UHM A;  1MNE A;  2QKL B;  2W82 A;  4WXH A;  5ICE A;  5J1Y A;  2IW5 A;  4XKV A;  3HDD A;  4N9H A;  1MMS A;  3GTM J;  5GPC A;  1YS7 A;  4OIO F;  3S1N J;  1VZ0 A;  4M9Z A;  3FWE A;  3BOQ A;  1K6Y A;  2Y69 H;  1OCO H;  2L7F P;  1XDU A;  3OOP A;  2WAQ A;  3HPG A;  4BH9 A;  5DS9 A;  3CUQ A;  3M8E A;  3S32 A;  3P5J A;  2NNN A;  5DV5 A;  1HSJ A;  2VOO A;  1Z3Y A;  1DPR A;  1APL C;  3NRV A;  4C2M J;  1YIO A;  3ZP5 A;  2RGV A;  2EH3 A;  1GT0 C;  1EH8 A;  4BEH B;  5IT9 K;  5EGO B;  2XF5 A;  2XAS A;  1R6R A;  2OC6 A;  2PEX A;  2VQC A;  3DPT A;  2FBK A;  3H9J A;  3RPU D;  4HYE A;  1IF1 A;  2V7F A;  2DFI A;  1FY7 A;  2R7O A;  1EH6 A;  3C2H A;  1T98 A;  2Z16 A;  3G4S I;  1FT9 A;  2LRE A;  3VFZ A;  2P7V B;  3HRM A;  4D7N A;  3F8B A;  3I4N J;  4EAT A;  5K7H A;  1W36 D;  1MDM A;  4KT6 A;  4BY1 J;  4MQ9 F;  5FLM J;  5E8I A;  1VI0 A;  2L54 A;  2MGQ A;  4CO8 A;  2NVQ J;  5HLG A;  3WG9 A;  2DFE A;  4UY8 I;  2HOA A;  5H2F C;  5H6Q A;  2DYR H;  4YEJ A;  4Q48 A;  1AA7 A;  1LEA A;  1H8A C;  4JX6 A;  3EUH C;  2DOE A;  4BXX J;  3LSI A;  4JX4 A;  3H92 A;  3GCM A;  4PFO A;  2WB1 N;  5J40 A;  4EM0 B;  3T0Y A;  1U8B A;  1S7E A;  2R7D A;  3KLO A;  2UXN A;  2M30 A;  3CUQ B;  3HOS A;  4XN3 A;  3VEP A;  3PNT A;  3B6C A;  3HC7 A;  1A35 A;  3F6O A;  1FOW A;  1TWC J;  4IO9 F;  1ODD A;  2ID3 A;  1V3F A;  1JKO C;  1GV5 A;  2GZW A;  1D3Y A;  3OYK A;  2X4H A;  2Z33 A;  2P5K A;  2CRG A;  3BT9 A;  4XOR A;  3RPQ A;  2F4I A;  2NVY J;  1WKM A;  3S2W A;  3H5A A;  5JFR A;  1HKQ A;  2O61 A;  4XRS A;  4ENN A;  1F43 A;  3HRU A;  5ERI A;  1XMX A;  5E3N A;  4CYC A;  4WCG A;  1ETY A;  2XPW A;  3GLL A;  3L2U A;  2Q1Z B;  1TLH B;  5D8L B;  5IYB J;  2HQR A;  5E8G A;  3SZP A;  3W2W A;  2LKX A;  3Q0U A;  1MDM B;  2BY3 A;  1RES A;  4UUV A;  4HDV A;  2IP2 A;  2D1H A;  3GUD A;  2HQN A;  1TNS A;  2LVS A;  1ZK8 A;  3RSN A;  1E3P A;  3S8P A;  1JHF A;  4V19 K;  2QUF A;  4CZZ A;  1TZL A;  2H8W A;  3WGH A;  3GTG J;  1WJE A;  1YFH A;  5FLV A;  1WJC A;  2DDB A;  1ETK A;  5HS9 A;  4DBQ A;  1MMN A;  4OMY A;  2HDC A;  4AUX A;  1U8R A;  4RGU A;  2IA1 A;  2DTZ A;  2X9D A;  3SZT A;  1XCV A;  2CO5 A;  4C2T A;  1D5V A;  2OTL I;  3K7A J;  5HS8 A;  2ZJQ F;  1GUU A;  3S1R J;  1RUN A;  1MJB A;  4GXO A;  1HQC A;  1SFO J;  2ZXW H;  3M07 A;  3R0J A;  3K2Z A;  4E6K G;  3DFG A;  2MD5 A;  1QRY A;  3GFI A;  1D1A A;  4EEF G;  3M8J A;  1ZGW A;  2A61 A;  3OYD A;  1X1D A;  4I09 A;  4CCO A;  2M0M A;  3DKY A;  4HV5 A;  3RKQ A;  4KIT B;  1SVO A;  3H3V K;  2LP0 A;  2HYJ A;  2JRM A;  1FMW A;  2LF8 A;  3R61 A;  1JGG A;  9ANT A;  2JWT A;  1QHG A;  2W25 A;  1JJ8 C;  2V6C A;  4CYC B;  4XRM A;  1YX3 A;  3U9G A;  2KDZ A;  1MNM C;  2BEO A;  3B73 A;  3DQV C;  5D5U B;  4EVI A;  3BR6 A;  3FM3 A;  4Q4Z F;  1TW3 A;  3V4G A;  2WB1 A;  4OWR B;  3VYU B;  2H27 A;  2E2H J;  4A3J J;  4HW0 A;  2CGP A;  4XIC A;  3E3V A;  2DA5 A;  3ABL H;  3KPH A;  1UFM A;  4U87 A;  3S15 J;  1IRX A;  3H9Q A;  1BBY A;  3BG6 A;  4C9Y A;  2LBF B;  2VE9 A;  2X48 A;  1BOB A;  3OIP A;  3HOT A;  4B4C A;  3MZH A;  4PSX A;  3R0A A;  2X1C A;  3WHB A;  4N0B A;  2E36 A;  5EEG A;  3B02 A;  1DPU A;  4QIW N;  2EV0 A;  2ZO4 A;  1HOM A;  1TBX A;  2FF4 A;  2R7Q A;  2K9L A;  2KFD A;  4BE0 A;  3H5R A;  4MNU A;  3CMA I;  2R7Z J;  2OAZ A;  4RAY A;  3D5R C;  2R5Z A;  1LVK A;  3QP5 A;  3EET A;  3FIS A;  2W4S A;  2LDU A;  1X3U A;  1MBJ A;  1P4A A;  2DA2 A;  3QU3 A;  3ZN1 A;  4A0X A;  3MKZ A;  3S3O A;  4A3L J;  4DJA A;  3SQN A;  2GOX B;  1W5T A;  4LB5 A;  4O3M A;  3Q5F A;  2X85 A;  4OIR F;  2ICW G;  3W2V A;  5GAD J;  5LGU A;  3ZCO A;  2V9K A;  2BW3 B;  3FX3 A;  2COB A;  3BQZ A;  3LA3 A;  1Y39 A;  1OYI A;  1SAX A;  5DM6 F;  2W57 A;  4DYQ A;  1P4W A;  4BE1 A;  1T8I A;  4D5C A;  1WJB A;  3P7N A;  3K9T A;  2MSY A;  3ABM H;  5EZG A;  2E1C A;  2ADU A;  4BJ5 C;  3KYC B;  2STW A;  4CYD A;  5F27 A;  3BG5 A;  1N25 A;  1XMK A;  4OIN F;  2TRT A;  3U1D A;  4PJN A;  1K79 A;  2F5D A;  2NVT J;  2P8T A;  1XG1 A;  3TO6 A;  2LNB A;  4KIB A;  2OPT A;  3I71 A;  1YIT I;  4LOC A;  2QBY A;  4XK4 A;  4HF2 A;  4RGX A;  4KIF A;  1WQ2 A;  4NHJ A;  3HRS A;  2ZFW A;  3BR5 A;  5DEQ A;  2DO7 A;  4HEA 2;  4A3B J;  1VQO I;  3KFW X;  4BDY A;  4I76 A;  5KNL A;  3FHZ A;  3OR2 C;  2KRC A;  3KCC A;  3RKX A;  2CYY A;  3V7R A;  5KAF C;  3FK6 A;  3WTT C;  1K83 J;  1E3O C;  3FBI B;  3KLN A;  1HA8 A;  5CJ9 A;  1XC5 A;  3BR1 A;  3Q0W A;  2GXG A;  5GAH J;  1MIJ A;  3BJA A;  1WCM J;  3F8N A;  2L9V A;  1TQI A;  3IAM 2;  5K5O A;  4G94 A;  3H35 A;  1OCR H;  4I98 B;  3OYL A;  1HDD C;  2K4B A;  2QEX I;  3S17 J;  2DI3 A;  1XGO A;  3WE3 A;  4UB8 C;  1ZR4 A;  3CF2 A;  3I54 A;  4CCM A;  4CXF A;  1K78 A;  4I7H A;  1Z9C A;  2R3S A;  3I53 A;  4L9T A;  4AU7 A;  4B47 A;  1NK2 P;  4AID A;  4IX7 A;  5HLH A;  3CD6 I;  1T08 B;  3GFJ A;  2R7W A;  1IRZ A;  2XKO A;  3CF5 F;  3I4P A;  3LL7 A;  2XAF A;  1P9Q C;  2DPD A;  2V1U A;  1ZRC A;  4IRG A;  1DU6 A;  2DT6 A;  1ON1 A;  3HG9 A;  2XKP A;  2AO9 A;  2VKD A;  4LK0 F;  2Q8K A;  2L2O A;  4XON A;  2QBY B;  3T8T A;  4OMZ A;  3NAR A;  1ZN2 A;  5J1U A;  4EJU A;  1NH3 A;  4EV0 A;  1BC8 C;  5L3C A;  4YFN F;  4KMU X;  1LB2 A;  5FKO A;  3BP8 A;  2QGU A;  4MQV A;  2R5Y A;  1QGP A;  5CKT A;  4E7S A;  3ZRG A;  1R1V A;  3MCZ A;  1K4T A;  2Z1D A;  1YRN B;  2JMW A;  3E5X A;  1ETX A;  2WV1 A;  2PI0 A;  3KZI C;  4AYB N;  2HZT A;  3PIP F;  4D0P A;  4UUS A;  3GTK J;  3BR2 A;  3HKZ N;  2FBH A;  1OQY A;  3CJN A;  4HQE A;  1ZG3 A;  4L9J A;  4HOB A;  2PFB A;  2HVS A;  3GZ5 A;  5CVU A;  3EUA A;  3RKY A;  3SXY A;  1BN5 A;  4AM3 A;  2ZB9 A;  5K1Y A;  2OZ6 A;  1SFU A;  5IT3 A;  2VBW A;  1K78 B;  3U2R A;  4L0Y B;  2DTR A;  3RYR A;  4PJ0 C;  1KU9 A;  4PFP A;  3ZMV A;  3H9G A;  2I8D A;  1G3Y A;  1YE9 A;  2BY0 A;  4M6X A;  5J47 A;  2DN0 A;  1YO5 C;  3R4K A;  2MAB A;  1S29 A;  1PDN C;  3IH4 A;  4QLC U;  3K0L A;  4KN7 X;  4NQW A;  2KRF A;  2R7S A;  3E1S A;  5FRO A;  3FXM A;  2FQ3 A;  1B9N A;  2KQR A;  3HHH A;  5FFZ A;  5C44 J;  1LFB A;  5FLX Z;  1WH5 A;  1T38 A;  2K5C A;  3I58 A;  1VF9 A;  3K2A A;  4KT5 C;  4B09 A;  1QVT A;  3OYJ A;  4L5I A;  4BQQ A;  1XSD A;  4UXN A;  5L3F A;  2DA3 A;  1D0X A;  3DTK A;  4J00 A;  3H3U A;  3TDU C;  3HUG B;  3FDY A;  3FK7 A;  3CES A;  2LF7 A;  2M7A A;  1HKT A;  1S3J A;  3OYE A;  2XHK A;  1D0Z A;  1IN7 A;  4OU0 A;  4F93 B;  1O3T A;  2QKM B;  2STT A;  4ESB A;  5E79 C;  2VL8 A;  4A6D A;  4EMS A;  2O8X A;  4D5F A;  3A01 A;  3FHN A;  2M34 A;  2CSO A;  1TT0 A;  2F5F A;  1VQM I;  3VYS B;  1L0O C;  3WGI A;  4PGH A;  1SVL A;  1U9O A;  2UUZ A;  1S5L C;  2K9N A;  3EQL F;  2JUG A;  1VFC A;  2R93 J;  2GAU A;  3ECO A;  1WJ5 A;  2O6G E;  2ELJ A;  1BJA A;  2CV1 A;  2VJ4 A;  2EBI A;  1R7J A;  1FBS A;  1AKH B;  3HOW J;  2FNA A;  3QAH A;  3TKY A;  4NQW B;  5B3S H;  4OAZ A;  5ILV A;  2CS3 A;  1WI3 A;  2DLL A;  1O7L A;  3ISP A;  2W7N A;  1MBG A;  4EJO A;  2RN7 A;  4E70 A;  5LHG A;  1AOY A;  4LGW A;  1LQ1 A;  3JRB A;  5D5W B;  2E1N A;  2WY8 Q;  3D5S C;  4RB2 C;  2EFQ A;  1HCR A;  4HF0 A;  2E2I J;  4BBS J;  1X3Z B;  2Z5U A;  2ZXH A;  2GBY A;  3FKJ A;  3VOD A;  3WTS C;  3QPL A;  3L09 A;  5TIS C;  2COM A;  1UST A;  1SAN A;  2L4M A;  3ZMS A;  3WE2 A;  2AS5 F;  2E2J J;  3FXK A;  4WXC A;  1WRJ A;  2YS9 A;  1QZE A;  3A01 B;  3CME I;  4ZTJ A;  3FXR A;  2WAF A;  2ECB A;  1X1A A;  3ZOB A;  2ZBK A;  2CW8 A;  4CIC A;  2BHY A;  1U2W A;  5FD5 A;  4KMF A;  2B63 J;  1J5Y A;  4RGR A;  3WTU C;  3BG7 A;  3WU2 C;  3BY6 A;  1IXS B;  1T0F A;  5FLX K;  2GQQ A;  1S7A A;  3GTL J;  3MWM A;  3W6J B;  1LEB A;  2H6C A;  2O0Y A;  5HOO A;  1R36 A;  2B9S A;  2VOP A;  5HVQ C;  2GWR A;  1I6H J;  1M1E B;  3IH2 A;  3KEQ A;  1MGT A;  3QYB A;  3OYA A;  2CQ7 A;  1USS A;  1CGP A;  3C3W A;  4RM2 A;  1D1C A;  3S93 A;  1YW7 A;  3PIO F;  2DMN A;  2HPI A;  1FYK A;  4W97 A;  4Y33 A;  2IXS A;  2Y2Z A;  1U78 A;  4BE2 A;  4NNJ A;  2KIM A;  2FX0 A;  1WJF A;  3DXJ F;  4M73 A;  3BTC A;  2QZ8 A;  2ISY A;  2WAQ N;  3PO2 J;  1BM9 A;  2VUM J;  2R7R A;  1ZG1 A;  4P9U A;  2KRH A;  3TDZ C;  1XCB A;  5D4R A;  2XRL A;  2QSH X;  3TOA A;  1YX5 A;  3ZMZ A;  1VQ4 I;  1R58 A;  1P4X A;  4YG2 F;  4HQM A;  5FB2 A;  1SC7 A;  3DEU A;  1T95 A;  4G6D A;  5D5V B;  3MKY B;  3CC7 I;  2NNY A;  2IGO A;  2HKX A;  4GRI A;  3IWZ A;  5HDN A;  4U7D A;  3CCQ I;  5LEJ A;  2EV6 A;  1RPW A;  4Y13 A;  5EYR A;  3QPS A;  2GLO A;  3CCV I;  1IGN A;  5HLI A;  2LG4 A;  2K4J A;  2V9V A;  2CUJ A;  2W00 A;  2BOL A;  3CJQ B;  4ZC3 A;  2ZSI B;  3LA2 A;  4ENJ A;  3FXL A;  4ON0 A;  3CCL I;  1HST A;  3A0B C;  2CUF A;  4PJJ A;  4EGZ A;  3EUH A;  2EIL H;  3M8F A;  1XSV A;  1D1B A;  4AVP A;  4ZDO A;  4UVC A;  2DMP A;  5DM7 F;  2DDA A;  1EH7 A;  2Z9O A;  4RB1 A;  1MJ9 A;  1OCZ H;  2OCE A;  2BGC A;  4HZF A;  3KP2 A;  3F23 A;  2JN6 A;  2BYV E;  3LSJ A;  3TBI A;  2A05 A;  2PBI A;  1JJ6 C;  2AXL A;  1WJA A;  2R7F A;  3DU5 A;  4BEH A;  2UZK A;  1OYW A;  5EGO A;  3DLA A;  3ZQI A;  2CFX A;  3GLX A;  3NQO A;  3W3C A;  3GW2 A;  1FOK A;  4L18 B;  4UUT A;  4C3J J;  4X0G A;  4BHB A;  2K3F A;  3BCA A;  3DPL C;  1UEL B;  3FKI J;  1XS9 A;  4HPQ A;  1DQU A;  1BI0 A;  2A6H F;  4HLY A;  1JI8 A;  2GXB A;  4KIC A;  3TW6 A;  3CDL A;  2HR3 A;  4ETS A;  4A0Z A;  5GPA A;  3SJM A;  3HOU J;  4IHS A;  3ZN0 A;  3QOE A;  3J7A Y;  1U5T C;  2DQR A;  3FIW A;  1RC9 A;  4R1H A;  3LSK A;  5HOD A;  2O3F A;  2X51 A;  1NG7 A;  4IRH A;  5J4V A;  1SD6 A;  3QYE A;  1TTY A;  5ILS A;  4EM1 A;  2JA8 J;  2KMU A;  3V8J A;  2EFN A;  1O7F A;  3ZGK A;  1ZGJ A;  3H36 A;  3F8C A;  2ME6 A;  3PNY A;  2K40 A;  2EFP A;  4G6T B;  3M3Y J;  2G0E A;  3IUO A;  3BG9 A;  1IN5 A;  1UZC A;  5E17 F;  3MQ0 A;  1W5S A;  4FAS D;  1V54 H;  1SD4 A;  2ME0 A; 
#chains in the Genus database with same CATH homology
 1FMW A;  3I9V 2;  4RM3 A;  2LRD A;  5HLT A;  4KIS A;  2Z2S B;  1Z3X A;  4B3X A;  4CCL A;  1QHG A;  3PSI A;  4ZJZ A;  1G59 A;  3VWB A;  2HU9 A;  3K4C A;  1YX3 A;  2OUM A;  3E0J B;  4JOM A;  3SEQ A;  3DQV C;  2XSJ C;  2WA0 A;  2BVM A;  3OYN A;  3H5N A;  4II2 A;  2WB1 A;  3MMY B;  2M3A A;  2CMP A;  1DGW Y;  4OWR B;  3VYU B;  1U0J A;  3CMM A;  4NC8 A;  4QPO A;  2A5W A;  4DGW B;  4XLC A;  4IQ4 A;  4U87 A;  1IRX A;  3H9Q A;  3SEZ A;  4ZTF A;  3BG6 A;  4C9Y A;  3FBN B;  2VPL A;  2OV7 A;  4NUB A;  4ITV A;  2LBF B;  2RQQ A;  3NWT A;  3OIP A;  1BOB A;  1MMD A;  3HOT A;  4XKB A;  4PSX A;  2X1C A;  3CP8 A;  4PUS A;  3AFH A;  3VYR B;  3L2R A;  3DTE A;  4II3 A;  3DWL E;  1Y56 A;  1DGR M;  3A1Y A;  4BAC A;  1N78 A;  1LFP A;  3W2A A;  2R7Q A;  2K9L A;  2P0W A;  3DU6 A;  1PYV A;  4OAY A;  4JQF A;  2WBM A;  5TGT A;  2VQH A;  3H5R A;  4RLQ A;  3SDB A;  4Y4R A;  3D5R C;  2WAD A;  1LVK A;  2CH0 A;  2M4G A;  2IS4 A;  2W4S A;  4E7H A;  3K70 C;  4XMY A;  1MMG A;  2LY2 A;  3MKZ A;  3S3O A;  2CV0 A;  4DJA A;  2LC2 A;  2GOX B;  3KEY A;  3EPZ A;  3OYB A;  4Y3O A;  2X85 A;  3W2V A;  4IZZ A;  3ZCO A;  4BUP A;  2V9K A;  2BW3 B;  3RTR A;  4XKW A;  5FRN A;  2XF6 A;  2RNG A;  4N4N B;  2V26 A;  4BE1 A;  4MLO A;  1WJB A;  3OYG A;  4AVZ A;  4BJ5 C;  4CA0 A;  3OY9 A;  4PJN A;  2KPM A;  4B44 A;  3AL0 B;  2M4K A;  2VJJ A;  3OL4 A;  4LIT A;  2R7X A;  5JHF A;  2L9S A;  2VAS A;  4F52 A;  5LD2 C;  4H4K C;  4YRV A;  2DT7 B;  2NOJ B;  1S9H A;  2IGM A;  4E4H A;  3AKZ A;  3GBG A;  3PUB A;  4HEA 2;  4LIV A;  3V42 A;  4BDY A;  3H0D A;  3PJR A;  1DP3 A;  5KNL A;  2CFO A;  2LH9 A;  3OR2 C;  2KRC A;  2XF7 A;  4BJT A;  2X6X A;  1Z21 A;  2DJI A;  1HA8 A;  3FBI B;  4XLF A;  4BE0 A;  1MW7 A;  3RQ4 A;  2LBF A;  2HQA A;  3PSF A;  2XC7 A;  3ONQ A;  3K4K A;  3K4B A;  3IAM 2;  3N05 A;  3MKW B;  2AQE A;  2UV1 A;  3H35 A;  4XM3 A;  3OYL A;  4C2U A;  1WFX A;  3K10 A;  2VB6 A;  3LSH A;  2X1D A;  3A4C A;  1MND A;  4BJ6 C;  1BR1 A;  3CF2 A;  4CCM A;  1N77 A;  2X6W A;  4E7Z A;  4AU7 A;  4B47 A;  2VJ5 A;  3OS1 A;  4IX7 A;  1J09 A;  3QYF A;  4BQN A;  2R7W A;  3PFY A;  3KYL A;  2V4J C;  4XR6 A;  2FUG 2;  4AYB A;  3LL7 A;  4PJM A;  1P9Q C;  2ZFU A;  3BC8 A;  2GOM A;  2DT6 A;  3HG9 A;  1SAU A;  2F6C A;  1T0F C;  3HKZ A;  4F55 A;  3F9K A;  2BW3 A;  3ZR8 X;  2VKD A;  2L2O A;  4XON A;  3LSG A;  1GLN A;  1ERD A;  2E60 A;  4YEL A;  4B48 A;  4PJL A;  3ZQQ A;  3OS2 A;  1BR2 A;  4LG3 A;  3DPU A;  2ZSH B;  2E1M C;  5CKT A;  4E7S A;  4DOZ A;  2HVQ A;  3IAS 2;  3ZRG A;  4P1W A;  4CCJ A;  1KON A;  3HPH A;  2Z1D A;  2KZV A;  2X1E A;  4E7J A;  2VJI A;  3UR3 C;  3CJR B;  3K70 D;  3D5L A;  4D9J A;  2R7T A;  3OR1 C;  2HVS A;  5FRM A;  1D0Y A;  3EUA A;  4IQJ A;  3EUK L;  4P5O A;  4FET A;  3K4L A;  2HDW A;  4CCN A;  3OYH A;  5CQG A;  5CQE A;  1X4P A;  3I3L A;  1FMV A;  4E7L A;  4IKF A;  3BLY A;  4HST A;  4XQF A;  4PFP A;  2LYC A;  4BS9 A;  3H9G A;  2I8D A;  1YE9 A;  4CSW A;  2DCE A;  2MAB A;  3OYF A;  1X1C A;  1G8X A;  4XLE A;  4XKC A;  2R7S A;  3E1S A;  5FRO A;  3OYI A;  2DXI A;  1Y6I A;  2KQR A;  2L5Q A;  2UWM A;  2R4G A;  3CP2 A;  2HVR A;  3BCB A;  3K4M A;  2MC4 A;  2K5C A;  2L9N A;  4PSW A;  3LSM A;  4XLH A;  1E0E A;  2F5V A;  2VXZ A;  3OYJ A;  4BQQ A;  1D0X A;  3MD2 A;  2R7V A;  2IGN A;  3DTK A;  4J00 A;  1QHH D;  2BVL A;  3HUG B;  3CZ6 A;  2KHM A;  3FDY A;  2PMZ A;  3CES A;  4F92 B;  1ZEL A;  2M7A A;  2CV2 A;  2CW7 A;  3OYE A;  2IS6 A;  5HNH A;  4E7K A;  1D0Z A;  4F93 B;  2QKM B;  2K9M A;  2VL8 A;  5HNF A;  4ZDL A;  1SFK A;  2VIX A;  3FHN A;  4HG2 A;  1TT0 A;  2LOO A;  1PJR A;  3VYS B;  2A6T A;  4XN0 A;  2DOA A;  2UUZ A;  2JUG A;  2JVG A;  3C2G A;  1UG0 A;  4U7B A;  2E1M B;  2VQL A;  2E5N A;  4ZYA A;  3TMO A;  1WJ5 A;  2ELJ A;  3UNG C;  3TL4 X;  2CV1 A;  2VJ4 A;  2VKH A;  2E5Z A;  4NQW B;  1X19 A;  4OAZ A;  1EA3 A;  3S3M A;  2CS3 A;  4RLF A;  3SZG A;  2HZD A;  2W7N A;  3OMY A;  3L2W A;  4N4O B;  4KJZ A;  3OWT A;  2MYS A;  1OR7 C;  2V1N A;  2Q2E B;  4HSR A;  2WY8 Q;  3D5S C;  4RMN A;  2M7B A;  2WY7 Q;  2Y0S A;  4XOT A;  5LFA A;  3NWS A;  2PJR B;  2ZXH A;  3IP4 B;  3FKJ A;  3OS0 A;  2JA2 A;  1Z7L A;  1V5E A;  2IS1 A;  3L2V A;  3K6G A;  4QPQ A;  4F91 B;  3OIQ A;  4CCK A;  1X1B A;  2JVH A;  2KP6 A;  3DEE A;  1MNE A;  2IGK A;  2QKL B;  2W82 A;  4ZTJ A;  2WAF A;  1X1A A;  4XKV A;  3KX2 A;  3AL0 C;  3SYT A;  2CW8 A;  2WAE A;  3HXL A;  1VZ0 A;  4HNU A;  1K6Y A;  2WAQ A;  3HPG A;  3S32 A;  4HNT A;  4ZDP A;  3BG7 A;  3HL2 A;  2VXD A;  2V6E A;  1Z3Y A;  5HOO A;  5HVQ C;  3QYB A;  4BEH B;  3OYA A;  2XF5 A;  4RM2 A;  1D1C A;  1R6R A;  3S93 A;  4HRI A;  2OC6 A;  2VQC A;  2HPI A;  3DPT A;  3H9J A;  3RPU D;  2VQG A;  4Y33 A;  2V7F A;  3C2H A;  2IXS A;  2R7O A;  3LFU A;  4BE2 A;  1V5G A;  4NNJ A;  2Z16 A;  1WJF A;  2LRE A;  2RRE A;  3K4N A;  3K4J A;  2MD0 A;  3VSK A;  4EAT A;  2MFZ A;  1W36 D;  4KT6 A;  2KLO A;  4F3Q A;  4CH7 A;  2R7R A;  5CPR B;  1WJD A;  2KRH A;  4XL9 A;  1YX5 A;  3ZXS A;  3QOD A;  1T95 A;  4YEJ A;  3MKY B;  1AA7 A;  2O5R A;  2HPM A;  2IGO A;  3EUH C;  4BXF A;  4GRI A;  3LSI A;  1BR4 A;  1V5F A;  1W36 C;  4PFO A;  4CUG A;  3PNV A;  2PJR A;  3DKX A;  2LG4 A;  2CUJ A;  2W00 A;  2BOL A;  3CJQ B;  4ZC3 A;  2ZSI B;  3A2K A;  4LIU A;  3HOS A;  4XN3 A;  3PNT A;  2KDO A;  3HC7 A;  3G2B A;  1LKX A;  2JSP A;  4BQO A;  4ANJ A;  4XOP A;  4PJJ A;  3S3N A;  1D1B A;  2AQF A;  3OYK A;  4ZDO A;  4BGD A;  4XOR A;  3PL8 A;  2F4I A;  3DTI A;  3H5A A;  4D1Q A;  1MMA A;  1X4O A;  3OL3 A;  3TBI A;  3OOU A;  3RCO A;  3LMM A;  2XAU A;  3L2U A;  2Q1Z B;  2R7U A;  1WJA A;  1LDK B;  3W2W A;  4B43 A;  3DU5 A;  4BEH A;  3DLA A;  2IS2 A;  3W3C A;  4X0G A;  3DPL C;  3BCA A;  1UAA A;  1N75 A;  1UEL B;  3RSN A;  4C30 A;  3VYT B;  3S8P A;  4J01 A;  4HPQ A;  1DQU A;  1TZL A;  4BU2 A;  1WJE A;  1JI8 A;  2X6Y A;  3L2Q A;  4E7I A;  4BDZ A;  4BL0 B;  1WJC A;  4R79 A;  3OYM A;  4DBQ A;  3QOE A;  3J7A Y;  2LY1 A;  3U21 A;  4PK4 A;  2VLA A;  3LSK A;  1MMN A;  2W1O A;  4CZC A;  1OLT A;  5KHD A;  2X51 A;  1NG7 A;  4NC7 A;  1NG6 A;  3QYE A;  4C2T A;  2CUZ A;  1QU3 A;  2KMU A;  3VSL A;  5KCM A;  3VDX A;  4XNF A;  3ZGK A;  3PNY A;  2KL4 A;  4G6T B;  2ZXI A;  4DBR A;  4DIQ A;  3OYC A;  4E6K G;  3IUO A;  3M1C A;  1D1A A;  2HNH A;  3M8J A;  2K3P A;  3OYD A;  1X1D A;  2XDV A;  4CCO A;  2M0M A;  2L7K A;  4FAS D;  3DKY A;  4KIT B;  4XLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...