3K0LA

Crystal structure of putative marr family transcriptional regulator from acinetobacter sp. adp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k0lA00
2P6SA 4DNCA 4OIPF 1ODDA 3LSTA 3HHGA 3GZ5A 5L3DA 5FGMA 3I4PA 4MTEA 2Y0MA 2F5CA 3C3WA 1D8KA 2L54A 2ZXJA 4L5IA 5FFXA 1USSA 4U7DA 4YFKF 3T5XA 2G7HA 1YFHA 2P5LC 3W6KB 4BNCA 4OOIA 2Y75A 5BPDA 4ESBA 2F5FA 2GA2A 4HZFA 1J0RA 3IHUA 2W25A 1ZN2A 1T38A 1V4RA 2IA2A 2CYYA 4ENNA 2XUBA 1Z1DA 2VBWA 4A2UA 3QRFF 2Z99A 1O3TA 2XVCA 4FT8A 1D5VA 2JPCA 2WTEA 1GXPA 3MZHA 5JVTA 4XLPF 1U8RA 3E6CC 4GYGA 4M71A 3J7AO 1BN5A 3DFGA 4EJTA 5E1ZB 5ICGA 1DPRA 1W5SA 2EV0A 2MH2A 1KYWA 4N9IA 4L0ZB 2DQRA 3EDPA 4XSZF 4GYIA 4QLCU 5LRRA 3G73A 5TJJA 1RZ4A 2YR2A 2JSCA 2ZFWA 3QP6A 3H3ZA 4PGHA 5F64A 2G7UA 1J9IA 2W57A 2O8XA 2H27A 2H6BA 3KETA 4RB0A 2XASA 3JW4A 4RGXA 4OIQF 1UHWA 3PQKA 3RPUA 4R1HA 5CVVA 1IN6A 5D6FA 1CGPA 1SD4A 4HF1A 5KVRA 3WGIA 2L4MA 4M74A 3GXOA 3EQLF 3L09A 2HR3A 1ZLKA 2A5YB 4XBFA 2FBIA 3BDDA 3KP3A 4M6YA 3RKWA 1U5TC 4M9XA 2L01A 3V4GA 2HKOA 4YIFA 2H09A 1V3FA 2XAQA 1FT9A 4HA8A 4AD9A 5LHIA 1OYYA 1S3JA 4FHTA 2XRNA 1B4AA 4WWCA 2M30A 1ZHFA 1T2KA 1XSDA 1P4WA 4AIKA 2P5KA 2Z9OA 5JI6A 4WK8F 5DCFA 2K02A 2LF7A 2D1HA 2YX7A 1R58A 2YX4A 2R7DA 4ZZLA 1OR7A 2KRFA 4O6JA 5E20A 3KLOA 3CLOA 2W24A 3O2PE 4Q5SF 5E1WA 1FYLA 1WSUA 3GVAA 1MJ9A 2NRAC 2DO7A 2NAZA 2FE3A 3RTRA 2JTVA 4HDVA 3RPQA 2K4BA 1YTYA 1ZGAA 5HDNA 3SQNA 2R3SA 1W7PD 3L7WA 4U88A 2ZBKA 2KKOA 4KMFA 3KP4A 2QBYB 1XCBA 4I02A 4ZYEA 3FX3A 1R1VA 2GXBA 1WRJA 2JT1A 1YG2A 1TW2A 5D4RA 4S05A 3GUDA 4IRHA 5HVQC 5FD5A 2HOEA 5D6EA 1LDKB 2LDUA 2VE8A 4EVIA 2XKOA 3MQ0A 1ZG5A 5CJ9A 5EEGA 4MGRA 3HUGA 4I98B 4HLXA 2XAJA 3LFKA 3J80Z 3GFLA 3SXYA 2VC0A 2A3SA 2E1NA 2XROA 1XCVA 5HLIA 5ICCA 3I59B 2HQNA 3I58A 3E6DA 1J5YA 3BY6A 3I5UA 1R00A 1R36A 3EYIA 2GAUA 1A04A 4CZZA 2FBHA 3HOTA 2OU2A 1Z05A 1S8NA 4G7HF 1FYKA 4KYWA 3E6MA 2F2EA 3FMQA 3JSPA 2OA4A 4HDUA 4RAYA 3BJAA 3R0JA 3KZYA 3M1EA 4ESFA 4LJZF 5E8IA 3F8NA 4NQWA 3I64A 4A0YA 4FX0A 2NNYA 1KQ9A 2EFOA 1K78A 2QQ9A 3BJ6A 4F7ZA 5D8KB 2EA4A 4G8XA 2QUFA 2OD5A 4HLYA 1DP7P 4I01A 4BHCA 1IRGA 4EJVA 3G3ZA 4L5JA 2ZNYA 4HX7A 4ZYGA 3ROUA 2OZUA 2MLGA 4K2EA 5AIQA 4MQ9F 3IKTA 2FRHA 4ZYHA 4A6EA 1QBJA 4A5MA 3HRSA 4CHUA 1KYZA 5JR3A 4JQFA 4LG0B 4IRIA 3F6VA 2K4JA 3DXJF 1EH7A 2FNPA 3GO5A 4EJUA 3T0YA 4L0YB 3ISPA 4ESJA 2E1CA 4LFUA 5AIPA 3WTVC 1IN7A 3QU3A 3DPLC 5DCMA 1XDSA 1TTYA 3Q9VA 1FP1D 3EETA 2QVOA 4M9ZA 4YFXF 1TLHB 2HYFA 1YLFA 3ZMTA 1OMIA 4UUVA 1W4MA 4IJAA 2PMHA 3Q5FA 2STTA 2VBZA 2ZMEB 1I5ZA 1BI1A 4D0PA 5CYVA 1ZGJA 4RS8A 4IPAA 3V7SA 1LQ1A 2RQPA 5HLHA 2EFWA 3K1PA 2HDCA 4M9SA 3RJPA 5J8FA 1Y0UA 3RIRA 1C0WA 1LDDA 1KU9A 3LWFA 2H94A 1L3LA 3ULQB 1BIAA 3GWZA 3ZMDA 1FZPB 1O3SA 4P9FA 1QPMA 2W84A 3NRVA 3BPVA 4GXOA 5CVUA 3LAPA 3TDZC 1F5TA 3KCCA 3PFIA 1UHMA 1R1UA 5FO5A 2PLYA 2VOPA 4XSXF 5LLQA 2KJBA 4AWXB 4GGGA 1Q1HA 2H6CA 1FYMA 5D5UB 3CDHA 3IWZA 1W7PB 5LRSA 1XMAA 2OBPA 4ZYDA 3MFKA 5LGNA 2ZNZA 1XGMA 3F23A 4EQQA 3K2ZA 2L4AA 4LLGF 5CVRA 2HFHA 5LGUA 4OMYA 4HOBA 4G6DA 1P4XA 5CLSA 4ASNA 3V7CA 2G9WA 1MGTA 2P7CB 4CGZA 4I2OA 1O3QA 1MJAA 1K79A 1QNTA 1UB9A 3TGNA 3WTXC 4I09A 1MDMA 1R7JA 1MJBA 2HTSA 4GCVA 3JAMZ 2P4WA 1ZAOA 3J80K 4IXAA 1K7AA 1KU2A 3BWGA 4PDKA 4KA4A 4PZJA 1J7KA 2GIVA 2V1XA 3GZ6A 2NNNA 1BIBA 4Y17A 3QOPA 1BI3A 3LAJA 4NB5A 4UVBA 1YS6A 3VEPA 1BJAA 4N0BA 1R23A 3HRUA 3M8FA 5JHUA 4OIRF 2ADUA 4Y15A 5E1XA 1KQ8A 3H3UA 1YQAA 5E18F 1YW8A 3PQJA 5ILUA 3ABUA 3MAJA 3ZMUA 1LDJA 3DF8A 4M73A 3I54A 4XLNF 2PG4A 2ISZA 1F4KA 2WV0A 2Z33A 2QWWA 1B9NA 2ACJA 5D5VB 3HSRA 3I71A 3TOBA 3CJNA 4CO8A 5K5OA 5K5RA 3C7JA 3GX4X 4BAYA 4PGGA 1U5TA 3HRTA 2FF4A 2O0YA 3DKWA 2X4HA 3RI4A 4A6DA 5KK1A 3DP7A 1TW3A 2IJLA 2ELHA 1UCRA 2DI3A 3TO9A 1JXSA 4LD5A 4LMYA 4L9VA 5BOXA 3GFJA 2WWYA 4YIIA 2W85A 2VT2A 4WXHA 1BI2A 3O6BB 1FBQA 1T6SA 4CYDA 1USTA 2V79A 4GO1A 3KP7A 1ZRCA 1TQIA 4AVPA 2PQ8A 3V8LA 4EGYA 2ETHA 1HQCA 1ULYA 3RKXA 2HYGD 3E6BA 3WE3A 2IT0A 4KFCA 3MZYA 3VODA 1B59A 4ENJA 2FSWA 2M87A 4MQVA 3F3XA 2TDXA 2IP2A 3BP8A 3V7RA 5D8LB 4LLLA 1ZG3A 2D2WA 2DLLA 2L3DA 1EV7A 1IW7F 5HOOA 2DQLA 1DUXC 2Y48A 5LGTA 2EK5A 4HV5A 4QWQA 3WODF 4A5NA 1XGOA 5A2QZ 2DU9A 2IA0A 2A69F 4BHBA 4IHSA 2PFBA 4WCGA 4HV6A 4ON0A 5FD6A 2QYOA 1P2FA 3HTSB 1HKSA 2P7VB 5L3BA 1QZZA 3FM3A 1E2XA 2DBBA 2K86A 4L9TA 2DT5A 3R4KA 2D45A 4L9NA 4IHTA 3HSEA 2HZTA 2RDPA 2UXXA 4CICA 1ZG1A 2V1DA 4Q4ZF 4EJWA 2XAFA 1P4AA 2KIFA 3V8JA 1B1BA 5LEJA 1SFEA 2MD5A 5BS6A 3ECOA 2MBFA 2ESHA 5HS9A 4KIGA 3N97A 3JSOA 3JTHA 3ZN1A 1OYWA 3FXUA 2RGVA 3K1MA 3WTUC 4G94A 2K27A 1SMTA 1J75A 4RGRA 2VBYA 2Q0OA 3HSFA 4N9HA 1FX7A 4A0XA 5L3FA 3B73A 2A61A 1J2XA 1KA8A 1Z9CA 1AWCA 1LNWA 3GYHX 3RYPA 4Y13A 4G7OF 5HDGA 4AIJA 2YSRA 4OMZA 1KGSA 1SMYF 1YW9A 3U1DA 3REOA 3TO7A 4MNUA 3SFZA 1IXSB 2ZKZA 1FC3A 3R6SA 1FBUA 3MCZA 4A0ZA 3FF5A 2VODA 4ENMA 2FMLA 2HWVA 3QU6A 4KMUX 4P55A 4KN7X 3BPXA 2FEZA 2QLZA 2QQAA 4BYYA 2P6TA 4IRGA 1KQ0A 4G7ZF 2O61A 2EV5A 1K78B 3O3KA 3HHHA 2M45A 1I1GA 3IKVA 5AONA 4Z2YA 3P9KA 5BQTA 2VE9A 2IPQX 3WTSC 1K6OA 3AAFA 1R5HA 3FHZA 1YO5C 3E3VA 3E5XA 2VT3A 2Z3YA 1FP2A 4PCQA 1WWXA 1ZARA 2VBXA 1XB4A 3ABTA 1H9TA 4H0EA 3FMSA 4HX8A 2CQKA 3F8CA 2X0LA 1O7LA 2PI0A 4UVAA 4OU0A 3BJOA 4KN4X 1J59A 4XRFA 1SD7A 2XIGA 4EGZA 4I0BA 3P9CA 1G4DA 3S2WA 2IA1A 3CO6C 3CUQB 5D5WB 2FNAA 2RVCA 5DCMB 5ERIA 2XGXA 5LEKA 1LJ9A 2OAZA 1HSTA 2OQRA 2F5DA 3CUQA 5BPIA 4KUMA 1FBSA 4Q47A 3J81Z 1LB2A 1KU3A 3FWEA 4U0WA 3FMRA 1GVJA 4MEXF 1G3TA 1GXQA 2RNJA 5J6XA 2VN2A 3E97A 3K1NA 2KIMA 1ZREA 1Z91A 3HYIA 4WXDA 2L02A 2FA5A 3CO7C 5F1RA 3D5LA 2DFIA 2V6CA 3ZMSA 1QGPA 4MEYF 3WTWC 1P92A 2STWA 4EV0A 5E8GA 5EEHA 1IN4A 2RC4A 4ZH4F 3IRRA 3L00A 2XKPA 1QO0D 3H92A 3GFIA 1JE8A 3ZMVA 1FY7A 3KP5A 3ZPLA 4U7BA 4RAZA 5H20A 3F8BA 4HQEA 3LA3A 2XV4S 3T8RA 2IRFG 2MA3A 1JHFA 3QAHA 2K7LA 1R22A 3R61A 4P5OA 5DUIA 2OQGA 1H0MA 2F5EA 3NQOA 3EYYA 1O57A 4LGWA 2B0LA 2Q8KA 1U6GA 4RB1A 1YS7A 3E5QA 2AXLA 3LA2A 1ZH5A 1F9NA 2QQBA 1S6LA 2A07F 2EFPA 4EM2A 3VB2A 3RYRA 5DYMA 1FPQA 2M1BA 1MDMB 3TOAA 1BC8C 4CDGA 2IVMA 3KP6A 4LB5A 3M7GA 4HAMA 5FFZA 2LSOA 2V9VA 3FXQA 1EH8A 4UV8A 2GZWA 2FMYA 3KEOA 2NYXA 1E17A 2QENA 3BZ6A 3GF2A 2EV6A 1IAWA 3ZN0A 2CGPA 3ERED 1IN5A 2EFQA 2MH9A 3KP2A 3IL2A 3HOSA 2BYVE 4BXUA 2GXGA 3OOPA 1ZRDA 1WI9A 1HSJA 1D8JA 3FM5A 5H6RA 4B8XA 2RN7A 5LHHA 2J5OA 5FLXZ 3I0TA 2HKXA 2CWEA 1PUEE 1T0FA 2M5WA 1XSVA 3EUHA 1T98A 3SHFA 2DK8A 1R1TA 3P9IA 4OINF 3M9AA 1HBXG 3HTUA 4R79A 5JFRA 3W6JB 1HW1A 2E7XA 2EA2A 1TQPA 4HBLA 1I27A 3HIFA 1OPCA 1HKTA 5E17F 1S29A 4UXNA 1W5TA 1DPUA 2HTJA 3ZQ7A 1U5TB 4O3MA 1TNTA 4B09A 2CSOA 1EH6A 2FBKA 3TKYA 3IC7A 1G3YA 1ZRFA 2BEOA 2V1UA 2GQQA 4HX4A 4LLNA 4LK1F 1YYVA 2FXAA 1FWZA 4L18B 3TDUC 1Z6RA 3K9TA 2LNBA 3GFMA 3IWFA 1FLIA 4KNYA 1S7OA 2DTRA 3M8EA 5LHGA 2CW0F 3WE2A 3F22A 2HQRA 3WTZA 1VTNC 5ILVA 5HDKA 2KIUA 5HS7A 4WXCA 3F6OA 2CO5A 1HXDA 4EMSA 4BQAA 1L0OC 1TBXA 1QZYA 3J81K 1FNNA 1IXRC 2MLKA 3R0AA 2JRTA 1RI7A 2P5VA 4RGUA 1B6AA 1LEBA 1S7AA 1LVAA 4UVCA 4AIHA 3QPTA 1OYIA 3DEUA 3FXRA 2M8EA 2ESNA 4KIFA 3U2RA 1BBYA 4HYEA 3ML6A 5HLGA 1BOAA 3LA7A 4HF2A 4FX4A 5HS8A 5CVIA 5D4SA 2DPUA 1RNLA 2A6EF 3VFZA 2EJRA 1XMKA 1FSHA 3F72A 1IZ1A 1LEAA 4LK0F 2VC1A 3LQQA 5DD4A 2PMUA 3DV8A 3L2CA 2RV8A 4HF0A 1SAXA 4E70A 1WKMA 3HRMA 4MHGA 2PN6A 3F21A 5ED4A 2VONA 3RKYA 3ZP5A 1O7FA 5L3GA 4S04A 1ONVA 2D1VA 1B9MA 5DD8A 2O6GE 2FOKA 1SFUA 3WU1B 5DUKA 1BI0A 5ILSA 1XN7A 2DPDA 1ZYRF 2C6YA 5CVJA 1R5GA 4A12A 3V8KA 2XHKA 6PAXA 1IF1A 5BMZA 2PBIA 2O3FA 2BBYA 1YIOA 1TNSA 2Z5UA 2QM3A 3TO6A 1UFMA 3MWMA 4YFNF 3SZPA 4HW0A 2BE5F 3ECHA 3L9FA 1U3EM 4P96A 5DV5A 1XD7A 3QP5A 4WF2A 1JGSA 3KEQA 2KJCA 5TRDA 5ICFA 3KE2A 2QBYA 3GW2A 1U2WA 2GA1A 3JAMK 2COMA 2EB7A 2JPBA 5IT9Z 4RB3C 5D5XB 1XSXA 2CG4A 1XGNA 2ZO4A 1MZBA 1XDUA 3IRQA 2P8TA 4JK1X 4I0AA 5FLXK 2ZJ2A 3P7NA 3TQNA 1SD6A 2O03A 2YPRA 4IF4A 3NEUA 1BC7C 2BGCA 2LF8A 4ZZDA 1X3UA 4O5VA 3I59A 2R7FA 3WTYC 1NHAA 1P6RA 1DDNA 1AOYA 3RDIA 2RKHA 5H6QA 3BOQA 2CFXA 3MEXA 4IVNA 2EFNA 4HQMA 3FZVA 4UV9A 2DW4A 1IXCA 3ELKA 5F6FA 2FQ3A 3GEZA 3D0SA 2GWRA 3C18A 1FOKA 3BROA 2MC3A 4BH9A 4EJOA 3WGHA 4MTDA 2DAOA 1KU7A 2DK5A 2YU3A 3COAC 1OKRA 4Q48A 2JZYA 1CF7B 5K5QA 2EWNA 1ON2A 4RGSA 3WGGA 3ZMZA 1QQIA 1MKMA 2A6HF 1CF7A 1G3WA 4ETSA 5DEQA 1SFXA 1PDNC 2AS5F 5L3EA 5DDGA 1FSEA 4KICA 4U0VA 3DPTA 1RUNA 4LG0A 3U9GA 1HKQA 1SD5A 2E7WA 1G3SA 3KZZA 3K69A 3KFWX 3QPHA 2NS0A 1D3YA 4EM1A 1U78A 4P9UA 2LKPA 4RB2C 1JHHA 1PP8F 3LQRA 2FU4A 3T8TA 2HS5A 4R8HA 2Q2EA 1HW5A 2VXZA 4KDPA 2UXNA 2QZ8A 5L3CA 2PEXA 2ZCWA 1G6NA 1WQ2A 2WC2A 3JTGA 5A2QK 3I53A 1T39A 1GHCA 2OZ6A 3CUOA 3Q9SA 1STZA 4EM0B 4M72A 2ZMEA 4LB6B 2UWMA 4U0YA 3C1DA 3DQVC 1REPC 1IN8A 3KLNA 3CTAA 2J5PA 3K0LA 3CUQC 1PP7U 4L9JA 1IRFA 2IW5A 5LBQA 2A68F 1RUOA 1ON1A 2HGCA 1Z7UA 5ICEA 1HW2A 4BHPA 2XAGA 5FB2A 2ISYA 1XGSA 3E5UA 3B02A 4I7HA 3N4MA 4G6QA 4UHTA 1I6XA 1TQMA 4DQ2A 2VOOA 4UNOA 1O3RA 4KT5C 4JBAA 1H9GA 5IT3A 2HEOA 3WG9A 3VOEA 3SZTA 1ZLJA 2PJPA 1BM9A 4M6XA 4YG2F 3F8FA 1MD0A 4G9YA 2XAHA 3F8MA 1YW7A 1W7PA 4WX9A 3GLXA 4OIOF 4ENKA 3WU0A 1RIOH 3OV8A 3WTTC 2BV6A 4NHJA 1F1ZA 3T1BA 1I1SA 4KIBA 5IT9K 4TV7A 2UZKA 1Z6TA 3R60A 5J8CA 1IUYA 5K1YA 4CXFA
chains in the Genus database with same CATH superfamily
2CS3A 1IDYA 2P6SA 4DNCA 2DA6A 2JMWA 5F04A 4OIPF 1ODDA 3LSTA 4XLHA 2HVQA 3H5AA 1VQOI 3HHGA 3GZ5A 3QYFA 5L3DA 1OQYA 5FGMA 3I4PA 4MTEA 2Y0MA 2F5CA 1X1AA 4A3GJ 3C3WA 1D8KA 2L54A 3SEQA 1YRNB 1IV8A 2FX0A 2ZXJA 4HG2A 4PJNA 4L5IA 5FFXA 1HDPA 2EBIA 2R5YB 4BXFA 4Y4RA 1QA6A 2LOOA 1USSA 1ACIA 2L9RA 4U7DA 4YFKF 4PFPA 3T5XA 1OCPA 3DKYA 4E7JA 2G7HA 1YFHA 1WFXA 5JLWA 2Y30A 1YRNA 3CCLI 2P5LC 2M7BA 3W6KB 4BNCA 4DZPA 4OOIA 2IEKA 2ZC2A 2Y75A 5BPDA 3MVPA 2XPVA 2FUG2 4ESBA 2IXSA 2F5FA 2EIKH 2GA2A 3OR2C 4UUSA 4HZFA 1J0RA 1UMQA 1MIJA 4LIUA 3IHUA 1Z3YA 2W25A 1ZN2A 4PUSA 1T38A 3FXJA 4OAYA 2BXYA 2KRCA 1V4RA 2JVHA 1WJ5A 2IA2A 2CYYA 3E7LA 4E7IA 1V5FA 2NS8A 2P81A 1R49A 3AKZA 1Y1VJ 4F3QA 2XUBA 4ENNA 1NK2P 1Z1DA 2IS6A 2VBWA 4A2UA 4XORA 2Z99A 3QRFF 4D5FA 1O3TA 2M3AA 3OWTA 2XVCA 4FT8A 1D5VA 1D0ZA 2X9DA 2JPCA 1TWCJ 2WTEA 1GXPA 3MZHA 4DJAA 5JVTA 4M3EA 4XLPF 3E6CC 2CJJA 1U8RA 1ERDA 1Y0NA 4GYGA 4BKXA 4M71A 3BZCA 3J7AO 3AG2H 2HDDA 1BN5A 3DFGA 4EJTA 5E1ZB 5ICGA 4YEJA 3F0CA 1DPRA 1Z21A 3IUOA 4IZZA 2ZB9A 1W5SA 3SEZA 3LSIA 2BHZA 2EV0A 2MH2A 1KYWA 3HOUJ 1VQPI 1E3OC 3PJRA 4N9IA 4L0ZB 2DQRA 3BTCA 1GLNA 3EDPA 4XSZF 2I10A 2HPIA 3OYBA 3EUHC 4GYIA 5LRRA 4QLCU 3G73A 1G59A 5TJJA 1RZ4A 4ANJA 3I56I 2YR2A 2JSCA 1SVOA 1PVEA 2ZFWA 3C2HA 1RRJA 3QP6A 3H3ZA 2CV1A 4PGHA 5F64A 2G7UA 2Y2ZA 3H9GA 2IS2A 1P9QC 4C30A 3ZOBA 1J9IA 3K70D 1D5YA 4LOCA 2W57A 5J4VA 5E3OA 2O8XA 2Z1DA 2H27A 2H6BA 3OYJA 3P5JA 3KETA 4RB0A 2FOWA 2XASA 3JW4A 5IOYA 4RGXA 1D1CA 4OIQF 1IO2A 4J00A 1UHWA 3PQKA 1V55H 3RPUA 1W0UA 3VWBA 4R1HA 5CVVA 1YJ9I 1IN6A 5D6FA 2L2OA 4DBRA 2XSJC 4M3GA 3S32A 2D5VA 2F4MB 1CGPA 3JR9A 2LREA 1SD4A 3A0HC 1LUJB 4HF1A 1K83J 2X85A 5KVRA 3WHCA 3WGIA 2L4MA 4M74A 3GXOA 3EQLF 3L09A 2HR3A 1ZLKA 3HC7A 2A5YB 3AL0B 2ECBA 4XBFA 3CC2I 2FBIA 3BDDA 3KP3A 4M6YA 5J1UA 5J4YA 2NVUB 1W36D 1AU7A 1IRZA 4Y7NJ 3RKWA 1U5TC 4M9XA 3QYBA 3PO2J 4ZC3A 2L01A 4L5EA 5GADJ 1VQ8I 3L2VA 3V4GA 2HKOA 4YIFA 1ETQA 2H09A 1V3FA 4H4KC 2XAQA 1FT9A 4HA8A 4AD9A 1X19A 1Z77A 3ZQGA 5LHIA 1OYYA 1S3JA 3MKYB 4FHTA 1OCCH 2XRNA 2HOTA 4II3A 1B4AA 3OYEA 4B48A 4A3IJ 4WWCA 3CP2A 2M30A 1ZHFA 3DEWA 1T2KA 1XSDA 2M8GX 2DDBA 3BR3A 2WAQN 4CZCA 4B44A 2LKXA 1P4WA 4G12A 4AIKA 2P5KA 4XICA 3CCRI 2Z9OA 5JI6A 4WK8F 3FISA 1B72A 5DCFA 4BBSJ 2K02A 3HBLA 3S1MJ 1HC8A 2LF7A 2D1HA 2YX7A 1VNDA 1I50J 1R58A 1ZR4A 2YX4A 1LFPA 2R7DA 1OR7A 4PJ0C 4ZZLA 1Y8QB 2KRFA 4KT6A 4QIWN 4O6JA 2E36A 5E20A 3LSRA 2EILH 3KLOA 3I9V2 1ZQ3P 2DFEA 3IP4B 2ME6A 2DA4A 4B43A 4C2UA 3CLOA 2W24A 2LY9A 3KYCB 3O2PE 3OYDA 3NWTA 1YE9A 4Q5SF 3CJRB 5E1WA 3BG7A 3MKWB 1FYLA 1WSUA 3GVAA 1MJ9A 2NRAC 1HF0A 2VQGA 5F08A 4ABZA 3ONQA 2DO7A 2NAZA 2FE3A 3RTRA 2JTVA 4HDVA 3HGYA 3RPQA 2K4BA 1YTYA 1ZGAA 2DA5A 5HDNA 4GFBA 3SQNA 2R3SA 1W7PD 2BXZA 2XPUA 1U9OA 3L7WA 4U88A 2ZBKA 3ZQHA 2KKOA 4KMFA 3KP4A 4RM3A 2QBYB 1XCBA 4I02A 4A3MJ 4ZYEA 3FX3A 3UKGA 1A36A 1R1VA 4XKWA 3ZR8X 2GXBA 1WRJA 2DJNA 4RDUA 2JT1A 1YG2A 1TW2A 5D4RA 4S05A 1R4NB 3GUDA 2HNHA 4IRHA 1XG1A 5HVQC 5HNFA 5FD5A 2R7ZJ 2HOEA 2Y0SA 5D6EA 4YRVA 2IBDA 1LDKB 2LDUA 5FKKA 3HUGB 2VE8A 4EVIA 2XKOA 3MQ0A 1ZG5A 5CJ9A 5EEGA 4A3DJ 1N77A 2CW7A 2HQ5A 1R71A 4MGRA 1QHHD 2JUCA 3HUGA 4I98B 2ZJQF 3PUFA 2MGQA 1FTTA 4HLXA 2JQ7A 1G8XA 3BG5A 5IYDJ 1N25A 2XAJA 3LFKA 3J80Z 3BCAA 3GFLA 2KZGA 1FMWA 3SXYA 2VC0A 2A3SA 2AXTC 2ZFUA 4V2FA 2E1NA 2BHYA 2XROA 3DBRB 5GPCA 1XCVA 5HLIA 5ICCA 3I59B 2HQNA 3I58A 3E6DA 3PIOF 1RETA 1J5YA 3K4MA 3BY6A 3I5UA 4UY8I 3ABMH 3BG6A 1R00A 1R36A 3EYIA 4DW6A 2GAUA 5C4JJ 2DOFA 5IYBJ 1A04A 4CZZA 1X4OA 2FBHA 3M4OJ 2YS9A 2DA2A 3HOTA 2OU2A 3S2HJ 1Z05A 4J19A 3BR0A 1IDZA 5EGOB 2R7WA 1YIJI 1S8NA 4G7HF 1Z0XA 3BG9A 4LITA 1FYKA 4IOCF 4KYWA 3E6MA 3HGGA 2F2EA 3CF2A 2LC2A 3TMOA 4CUGA 1HA8A 3FMQA 3JSPA 2OA4A 1ZGWA 1Y1WJ 4HDUA 2KIQA 3HPHA 4RAYA 3BJAA 3R0JA 2HOSA 1LFBA 3KZYA 3M1EA 5TISC 2L9VA 4ESFA 4LJZF 3DPUA 2LMDA 2XSDC 5E8IA 4UB6C 1Y56A 3F8NA 4NQWA 3I64A 4A0YA 4CA0A 4FX0A 2NNYA 1KQ9A 2EFOA 2NXNB 3NARA 3BTLA 2VJJA 4BEHB 1K78A 3HDDA 2QQ9A 2PMZN 3BJ6A 2LY2A 4F7ZA 5D8KB 3H0GJ 1FMVA 2LP0A 2EA4A 3H1CA 4C2TA 4I99C 2VKDA 4G8XA 1KZHA 3FBIB 2QUFA 1X1DA 2OD5A 4QSHA 4HLYA 1DP7P 4I01A 4BHCA 2DMTA 1IRGA 4EJVA 3G3ZA 4L5JA 2ZNYA 1E3PA 3ZCOA 4HX7A 4ZYGA 3ROUA 2OZUA 4E7ZA 2MLGA 4K2EA 5J1YA 5AIQA 4MQ9F 3IKTA 2FRHA 3HOVJ 3W2VA 4B3AA 4HPQA 4IOAF 2E1MC 4Y33A 3GTKJ 3WG7H 4ZYHA 1OJLA 4A6EA 2MG4A 1QBJA 4A5MA 3HRSA 4CCJA 4CHUA 1KYZA 3ZXSA 5JR3A 4JQFA 4LG0B 3GTPJ 2EINH 1I3AA 4IRIA 3JRDA 3F6VA 4CYCA 2K4JA 3HPGA 1GVDA 1T95A 4B1RA 4MFEA 3ASOH 3DXJF 4Y52J 3FDYA 1EH7A 2FNPA 3GO5A 4EJUA 1POGA 1ZK8A 1OFCX 2DMUA 3U21A 3T0YA 4MIMA 3ESWB 1SFOJ 2JUGA 3ISPA 4AC0A 4ESJA 1U8BA 4C3HJ 2E1CA 4L0YB 1X1CA 3N05A 3W6VA 1D0YA 4LFUA 2LD5A 5AIPA 2M9HA 3WTVC 1VQ6I 4BJ6C 3Q3SA 1IN7A 3QU3A 5KHDA 3DPLC 5DCMA 1GV5A 3O8HA 1WJCA 2YUSA 4ZTFA 4CCLA 1UZCA 1XDSA 1TTYA 1VI0A 3Q9VA 5FKNA 1FP1D 3EETA 3QWLA 1GDTA 2QVOA 4M9ZA 4YFXF 1TLHB 3OOUA 2HYFA 2XF7A 1YLFA 3OYNA 2K9SA 3ZMTA 1OMIA 4UUVA 4OWRB 4A3LJ 1W4MA 4IJAA 4RM2A 2E2IJ 4HRIA 4BXXJ 4FASD 2PMHA 2JA5J 4C3JJ 3GTMJ 3Q5FA 2STTA 1K61A 2VBZA 2ZMEB 4IHYA 1I5ZA 1BI1A 3IH4A 3A02A 4D0PA 2HPMA 1PUFB 3K2AA 3HOZJ 5CYVA 2E2HJ 1BR4A 5LFAA 1ZGJA 4RS8A 1EA3A 2KRHA 4IPAA 4XIDA 4ZDLA 3V7SA 1H88C 1LQ1A 2RQPA 5HLHA 1ENHA 2EFWA 4FISA 1T56A 3K1PA 2HDCA 1PUFA 1DGWY 4M9SA 3RJPA 5J8FA 1Y0UA 2DMNA 2KP6A 3RIRA 1C0WA 1LDDA 3IH3A 1KU9A 1AKHB 4A3KJ 3A4CA 3BLYA 3LWFA 2H94A 3A0BC 1L3LA 3ULQB 3ZGKA 1BIAA 3GWZA 3CD6I 3KYLA 3ZMDA 1UHSA 1SFKA 2X6YA 1FZPB 2BW3B 2ELJA 1O3SA 4IL6C 4P9FA 2JA6J 2NVQJ 5KNLA 1QPMA 2W84A 3NRVA 3BPVA 4GXOA 5CVUA 5B3SH 3ZQCA 4UB8C 1AKHA 3DLLF 3LAPA 3TDZC 1F5TA 3IAM2 3AG3H 3KCCA 3PFIA 4HSTA 1UHMA 2O9LA 1DU6A 1R1UA 4XK4A 4XR6A 5FO5A 2PLYA 2VOPA 1EJ9A 3L2UA 3G6EI 2JWTA 1GV2A 4XSXF 2CUEA 2ZSHB 3MMYB 3OR1C 5LLQA 3RSNA 2KJBA 4AWXB 2DFFA 3X2QH 2R0QC 3OS0A 4GGGA 2NOGA 3GTGJ 1Q1HA 1T33A 2H6CA 3DKXA 1FYMA 4S0HB 2IS4A 1I3QJ 1Z3XA 5D5UB 3CDHA 3IWZA 3KYDB 4MLOA 1W7PB 4IX7A 5LRSA 2QSFX 1XMAA 2OBPA 4ZYDA 2R7XA 3MFKA 5LGNA 2ZNZA 1XGMA 1JTXA 1ZELA 2VXDA 3F23A 4PJLA 1BW6A 2E5NA 4EQQA 3HL2A 2Q1ZB 3K2ZA 2L4AA 3FXMA 4LLGF 5CVRA 2G0EA 2HFHA 2DTZA 2BY2A 5EZGA 5LGUA 4OMYA 4HOBA 4G6DA 1P4XA 4XN0A 5CLSA 3V7CA 4ASNA 5E3MA 1LE8B 2AQEA 3OSGA 1MBJA 2G9WA 1MGTA 3AG1H 2P7CB 4CGZA 4I2OA 1O3QA 1MJAA 2LBFA 3CF5F 2BY0A 1K79A 2DXIA 2Y69H 1QNTA 1UB9A 3TGNA 3WTXC 4I09A 1MDMA 3DWLE 3PO3J 3OMYA 1AHDP 1R7JA 1MJBA 4CCNA 2HTSA 3CP8A 4GCVA 3JAMZ 2QCOA 2GXAA 2P4WA 1ZAOA 3J80K 4BACA 4IXAA 2ECCA 3RZDJ 1K7AA 4XLEA 2JJ7A 3LSHA 1KU2A 4MO7A 5GP9A 3BWGA 4PDKA 2BZTA 4KA4A 4PZJA 1J7KA 2GIVA 2V1XA 4C2MJ 3GZ6A 2NNNA 1MMNA 2K85A 1BIBA 4Y17A 3QOPA 1BI3A 3LAJA 3D5RC 1RPWA 1W5CC 3CCMI 2VQCA 2DT7B 2X1CA 4NB5A 4UVBA 3FIWA 4UUSB 1JJ8C 2ID6A 5B1AH 1YS6A 3IAS2 3VEPA 1BJAA 1VF9A 1DGRM 4N0BA 2LK2A 1R23A 4BU2A 3HRUA 3M8FA 5JHUA 3JRCA 4OIRF 1YOVB 2ADUA 4Y15A 1F36A 1OCTC 5E1XA 3RKQA 5F0FA 1KQ8A 2VJ5A 3H3UA 1YQAA 4E6KG 2V6EA 2BVLA 5E18F 1YW8A 3PQJA 2KISA 5ILUA 2KQRA 3ABUA 3PIPF 2CUFA 3MAJA 3ZMUA 1LDJA 3DF8A 4M73A 3I54A 4XLNF 2PG4A 4BE0A 1R6RA 3HOYJ 2F4IA 2ISZA 3SDBA 1F4KA 2WV0A 3DU5A 1R9TJ 1FOWA 3S93A 1LE8A 2E2JJ 4KITB 2Z33A 2QWWA 3C2BA 1B9NA 2ACJA 5D5VB 1AA7A 3HSRA 3I71A 3TOBA 3CJNA 3PNTA 1Y39A 2GLOA 2JA7J 5E3LA 4CO8A 2H8RA 5K5OA 1RKWA 5K5RA 3S14J 2VQHA 3C7JA 1N78A 4RLFA 3GX4X 4BAYA 4PGGA 5M3MJ 3G4SI 1U5TA 2L5QA 3HRTA 5DM7F 2FF4A 3GCMA 2O0YA 3DKWA 4J01A 2X4HA 3PSFA 1QHGA 3OYIA 3EUAA 5C4XJ 3RI4A 3QYEA 4A6DA 2TCTA 5KK1A 5EF6A 1T0FC 2ID3A 1IC8A 3PM1A 3DP7A 3VYTB 1TW3A 2IJLA 3BT9A 2ELHA 1UCRA 2DI3A 3TO9A 1MMAA 4U87A 5B66C 1D0XA 4E7KA 1NTCA 1I39A 3QOEA 1JXSA 4LD5A 2I5UA 4LMYA 4GRIA 4L9VA 2JA8J 4HSRA 2V9PA 5BOXA 3GFJA 4N4NB 1ZTRA 2WWYA 4RMNA 4YIIA 2W85A 2VT2A 1X58A 2RREA 2R7RA 4WXHA 1BI2A 3O6BB 5FRMA 1FBQA 1T6SA 4CYDA 1USTA 2XPWA 2R7VA 2L7FP 3FKJA 2V79A 4GO1A 3KP7A 1ZRCA 1YHQI 1B8IB 1TQIA 3S3NA 4AVPA 2DMQA 3EUKL 2PQ8A 3V8LA 4ITVA 4EGYA 1WPKA 2W82A 2R92J 2ETHA 2K9QA 2MFZA 1HQCA 4Y3OA 2R7OA 2M0MA 1ULYA 2OPTA 3G1MA 3LSGA 3RKXA 3GTLJ 3NWSA 2HYGD 1FOXA 3E6BA 1S7EA 3WE3A 2IT0A 3S3MA 4KFCA 3MZYA 2W4SA 2E1OA 3VODA 1B8IA 2Y31A 1B59A 5J1RA 1OLTA 2X6OA 4AM3A 4ENJA 2R7SA 2FSWA 2M87A 4AYBN 4MQVA 3F3XA 2TDXA 4BQOA 5HLTA 1D1BA 2IP2A 2M4KA 3BP8A 2XAUA 2COBA 3JCUC 5EG0A 3LSPA 1V54H 3V7RA 5D8LB 4LLLA 1ZG3A 2D2WA 3DTEA 2DLLA 4F93B 2IAIA 3TEDA 2L3DA 1EV7A 5EYRA 1IW7F 2EZKA 2AQFA 5HOOA 2DQLA 1JUSA 3FKIJ 1DUXC 1FEXA 2Y48A 5LGTA 2EK5A 2I8DA 4HV5A 1B72B 3HEFA 4QWQA 3WODF 4A5NA 4BQQA 1XGOA 5A2QZ 3JRIA 4DIQA 2DU9A 5HODA 2IA0A 2A69F 1XMXA 4BHBA 4IHSA 2ELKA 3O8GA 5GAGJ 2HXOA 2PFBA 4DOZA 4WCGA 4HV6A 4ON0A 1A35A 1A5JA 5FD6A 2CMPA 2Y9ZA 2QYOA 1P2FA 3HTSB 1HKSA 2WB1N 4XRSG 2P7VB 5L3BA 2TRTA 3LSJA 1WJDA 5GTHC 2VIXA 1QZZA 1YX5A 3FM3A 3S1RJ 1WZ2A 1E2XA 4NBQA 2DBBA 2K86A 4BJ5C 1UG2A 3DTKA 4L9TA 2DT5A 2R5ZA 3R4KA 1YX3A 2D45A 2VQLA 4L9NA 2X1DA 4XONA 1GUUA 4IHTA 3HSEA 1MMSA 1MNEA 2HZTA 1EF4A 3JRHA 4DBQA 2RDPA 1IV6A 2UXXA 2KT0A 2AHQA 2RQQA 4CICA 3GMEA 1ZG1A 1VQMI 4DGWB 2NVTJ 4ZDOA 2V1DA 2XRLA 4Q4ZF 3S1NJ 1MSEC 3JREA 2VLAA 4EJWA 4D7NA 2XAFA 1WJFA 1P4AA 2O8KA 2KIFA 3V8JA 1B1BA 5LEJA 2K9NA 1SFEA 3SZGA 2MD5A 5BS6A 3ECOA 2MBFA 3LL7A 4HNTA 1RESA 4II2A 1RR7A 4JP0A 2ESHA 5HS9A 1DQUA 2LR8A 4KIGA 1BR2A 3N97A 1GT0C 3JSOA 3JTHA 3ZN1A 2R93J 3D5SC 1OYWA 3FXUA 4BQNA 4DYCA 3VSLA 5K7ZA 2RGVA 1ORKA 2XB0X 3E0JB 3K1MA 3WTUC 4G94A 2K27A 3AL0C 1SMTA 1J75A 4RGRA 4C3IJ 1OISA 2VBYA 2Q0OA 3K4LA 3HSFA 4N9HA 2OCEA 5DTDA 2L9NA 5FKOA 1FX7A 5KAFC 2VUMJ 4A0XA 3BG3A 5L3FA 3B73A 2A61A 4C9YA 3WHBA 1J2XA 1KA8A 2K9MA 3J7AY 1Z9CA 4BBRJ 1AWCA 1LNWA 3GYHX 2IGOA 1OCZH 1APLC 3RYPA 4Y13A 4G7OF 5HDGA 4AIJA 2YSRA 3ZQQA 4M6VA 2V1NA 1KGSA 4OMZA 4ZJZA 1O4XA 3HKZA 2F6CA 2HI3A 2LLKA 1SMYF 4JX5A 1YW9A 3U1DA 3REOA 3TO7A 2E1MB 4MNUA 2ZJPF 3CC4I 4B4CA 2N8GA 3RZOJ 2E34A 3SFZA 1JKQC 2EH3A 1IXSB 2ZKZA 1FC3A 3R6SA 1FBUA 3MCZA 4D1QA 4A0ZA 1X1BA 3FF5A 2VODA 4ENMA 2FMLA 2JRMA 3M8JA 2HWVA 3QU6A 5GAHJ 2OTJI 2DODA 3F9KA 5F27A 4KMUX 3CC7I 4P55A 4KN7X 4P1WA 3BPXA 1P7JA 2FEZA 2QLZA 3M07A 4NQWB 4X0GA 2X51A 2QQAA 4BYYA 2P6TA 4A3JJ 4IRGA 1KQ0A 2DA1A 3K4KA 2JA2A 4G7ZF 2O61A 2EV5A 1K78B 2CV2A 1S9HA 3O3KA 3HHHA 2LKSA 2XF5A 4F52A 2M45A 1I1GA 3IKVA 1SANA 5AONA 3C2GA 3H36A 4Z2YA 3P9KA 2IS1A 5BQTA 1IUFA 3ABKH 1MMDA 2VE9A 2IPQX 3H0DA 3K4NA 3WTSC 1K6OA 3AAFA 1N75A 1R5HA 2QQ8A 3FHZA 3HOXJ 3L2WA 3TL4X 1YO5C 3E3VA 2E19A 2XGDA 3E5XA 2VT3A 2Z2SB 2Z3YA 1BJZA 1FP2A 3A2KA 4PCQA 3Q0WA 1WWXA 1ZARA 3ZQFA 2H1LA 2M34A 3A03A 1PJRA 2VBXA 1XB4A 3ABTA 2OV7A 1H9TA 4H0EA 3OYCA 3FMSA 4X6AJ 4HX8A 2CQKA 3F8CA 4YELA 2X0LA 1O7LA 5E3NA 2PI0A 1QZEA 4N4OB 1WH7A 4UVAA 4XRSA 3W2AA 4OU0A 3BJOA 4KN4X 1VQLI 2L7KA 1J59A 4XRFA 1SD7A 2WADA 2XIGA 4CYCB 4EGZA 4I0BA 3VYSB 3ZQLA 3P9CA 3J7ZI 2CRGA 3OIPA 3MD2A 1G4DA 3S2WA 1RKTA 4M3DA 1E3HA 2IA1A 4XLAA 4RLQA 3I55I 2MD0A 3CO6C 3CUQB 3DBHB 5D5WB 2VJ4A 2FNAA 1JTYA 2LH9A 2RVCA 1I6HJ 5DCMB 5ERIA 2XGXA 5LEKA 1LJ9A 2OAZA 1HSTA 2OQRA 2VL8A 1BR1A 4PSXA 4XM3A 2F5DA 3CUQA 3CCSI 5BPIA 4KUMA 1FBSA 3BQYA 2DN0A 4Q47A 2VASA 3J81Z 1LB2A 1VQ5I 4E7HA 1KU3A 3FWEA 4U0WA 4CCMA 3FMRA 1GVJA 2X6XA 1YJWI 4MEXF 3Q0UA 3BTJA 3G1LA 1G3TA 2KHMA 2LYCA 1GXQA 3AG4H 2RNJA 5J6XA 2A5WA 4CCOA 3QPSA 2VN2A 3E97A 3K1NA 2KIMA 5EEAA 1ZREA 3PL8A 3VSKA 1M1EB 5DM6F 1Z91A 3HYIA 4LG3A 1V5GA 4WXDA 2L02A 2FA5A 3CO7C 5F1RA 2E5ZA 3D5LA 2DFIA 4ZDPA 2V6CA 3ZMSA 5FKMA 1QGPA 1TWFJ 4MEYF 3WTWC 1P92A 2STWA 1WJBA 3J7YJ 1QVUA 4EV0A 5E8GA 5EEHA 1VQNI 1IN4A 2HQAA 3FXLA 2RC4A 4XN3A 3CMAI 4ZH4F 3IRRA 3L00A 2WBMA 2XKPA 1QO0D 4A3BJ 1UELB 3H92A 3GFIA 3K4CA 1JE8A 2HOAA 1MMGA 3FK7A 1E0EA 3DLAA 2DMPA 3ZMVA 4IQJA 1FY7A 1WJEA 2XF6A 3KP5A 3ZPLA 4U7BA 4RAZA 1JUMA 5H20A 3F8BA 2KZVA 4HQEA 1SEUA 2L9SA 3LA3A 5FJ8J 2XV4S 2W48A 3TW7A 4ZTJA 3T8RA 2IRFG 1MH4A 4FE4A 4FTHA 2MA3A 1D1AA 1JHFA 1K4TA 3QAHA 4BUPA 2K7LA 4MFDA 1JT6A 5M5YJ 1UJ8A 1R22A 5B1BH 3R61A 1TWAJ 1ETVA 3S1QJ 5FLMJ 1RC9A 2H1KA 4P5OA 2K5CA 1K6YA 5DUIA 3CCEI 2OQGA 1H0MA 2F5EA 3TW6A 3NQOA 3EYYA 1OCRH 3K70C 3CDLA 1O57A 4RAGA 2EZIA 2Y0SN 4LGWA 2B0LA 2Q8KA 1U6GA 4RB1A 2DYRH 1YS7A 3LOCA 1HOMA 3OYKA 3E5QA 3S2DJ 2AXLA 2XC7A 4E7SA 3SJMA 1OCOH 1FIPA 3LA2A 1ZH5A 3A01B 1F9NA 2QQBA 3H9JA 1PYVA 5M5WJ 2WAQA 1TT0A 1S6LA 2A07F 2QKLB 2EFPA 2LBFB 4EM2A 3VB2A 3KEYA 3RYRA 5DYMA 1FPQA 2DOEA 4RA2A 2R7UA 1W36C 3A01A 2M1BA 1MDMB 3TOAA 2HXIA 1BC8C 4CDGA 2IVMA 3Q0VA 3KP6A 3RCOA 3MN2A 1T08B 5EJCA 4I76A 4LB5A 3M7GA 2ZMEC 3S17J 1ZR2A 1HDDC 4HAMA 5E79C 3E1SA 4JOMA 3CZ6A 1TC3C 5FFZA 1XC5A 2LSOA 2V9VA 3DEEA 3HB9A 2A6TA 3FXQA 5IPAA 1EH8A 2GIZA 2UUZA 3CESA 4UV8A 2GZWA 3W2WA 1TL8A 4E7LA 2FMYA 5M3FJ 3KEOA 2XGCA 3KZIC 2NYXA 1E17A 2QENA 3BZ6A 5FROA 3GF2A 2EV6A 3H5NA 3ZN0A 1IAWA 1WGXA 1X2MA 5H2FC 2K40A 3ERED 2CGPA 3OYMA 1IN5A 4NC6A 2EFQA 3VDXA 4BY7J 4W1UA 2MH9A 3KP2A 5J47A 3IL2A 3HOSA 2BYVE 4BXUA 2XDVA 5LD2C 2GXGA 2QF7A 3OOPA 1ZRDA 1WI9A 3HJEA 1HSJA 5KCMA 1D8JA 3FM5A 5H6RA 4B8XA 2RN7A 3OIOA 2EZLA 5LHHA 2KMUA 1S5LC 3QPLA 2J5OA 2V4JC 4A3CJ 5FLXZ 4A93J 3I0TA 3BR6A 2HKXA 2DYSH 3LMMA 2CWEA 1PUEE 1T0FA 2M5WA 1XSVA 5IP9J 1WCMJ 3D1NI 2DA7A 3H9QA 3EUHA 3GLLA 1T98A 3SHFA 3CCUI 2DK8A 1R1TA 3P9IA 5F1JA 1SAUA 4OINF 3LSMA 3M9AA 2HU9A 1HBXG 3HTUA 4R79A 4V19K 5JFRA 3W6JB 3TP3A 4JYKA 1HW1A 1Z67A 4NC8A 2E7XA 3DCFA 3U1KA 3BC8A 3BZKA 1KONA 2EA2A 2OUMA 2R5YA 2ZXWH 2KLOA 1TQPA 4HBLA 4F55A 1I27A 3HIFA 2NS7A 5J3LA 1OPCA 3M3YJ 1Y6IA 1HKTA 3AFHA 5C44J 1S29A 2HVRA 4UXNA 1W5TA 1Z7LA 5E17F 1DPUA 3CCQI 4BE1A 3NAUA 5FRNA 2HTJA 2W1OA 3ZQ7A 1W0TA 4M3FA 1ETWA 3CQZJ 3GBGA 1FTZA 1YJNI 1U5TB 4EEFG 2LRDA 4NDLA 4O3MA 1JT0A 4DZJA 3K10A 3KX2A 1TNTA 2FD5A 4B09A 2CSOA 1EH6A 2FBKA 4XOPA 3OYLA 3SFIA 3TKYA 1CQTA 3IC7A 1NG7A 1G3YA 1ZRFA 2BEOA 1SVMA 1NK3P 2V1UA 1X2NA 1ITYA 4XLFA 2GQQA 4HX4A 2GOXB 4NUBA 4LLNA 3G1OA 4LK1F 5CQEA 2ME0A 3A1YA 5JHFA 1YYVA 2RAEA 2FXAA 1FWZA 2ZJRF 4L18B 3TDUC 1F43A 1Z6RA 1ZKGA 3K9TA 2LNBA 3GTQJ 3GFMA 2CFOA 2CQ7A 2BY1A 2DOAA 3IWFA 3K4BA 4KNYA 1S7OA 1FLIA 4G6TB 2DTRA 2V26A 4XLCA 3M8EA 5LHGA 3L2QA 2LG4A 4XKCA 2CW0F 3WE2A 1ETOA 3F22A 1QU3A 2HQRA 3WTZA 2PMZA 5HNHA 5ILVA 1VTNC 5HDKA 1QPIA 3PFYA 1UAAA 2KIUA 5HS7A 4WXCA 1G2HA 4QPQA 4Z6YA 3F6OA 2CO5A 4DYQA 1HXDA 4EMSA 4BQAA 2MSYA 1MNMC 3PUBA 3OSFA 1W1WE 3JRFA 2EPFA 4PK4A 1L0OC 1TBXA 1FOYA 1QZYA 3J81K 1FNNA 4XRMA 1MNDA 1IXRC 2MLKA 4ZYAA 2GOMA 4BDYA 3R0AA 2JRTA 1RI7A 2OCCH 5EG0B 2CQXA 2P5VA 4RGUA 1B6AA 3JRGA 3KPHA 3TP0A 1LEBA 2Z16A 4QPOA 1S7AA 1LVAA 4UVCA 2M2EA 4AIHA 3S3OA 3CJQB 3DU6A 3CDIA 4CH7A 4B3XA 3QPTA 2W00A 1OYIA 3DEUA 1BL0A 1Y8RB 3FXRA 2LFBA 2M8EA 4BL0B 2ESNA 1WI3A 4KIFA 3S8PA 1A6IA 3JRAA 3U2RA 1BBYA 1JKPC 1YI2I 4HYEA 3ML6A 3OL3A 5HLGA 1BOAA 3BR5A 3LA7A 4HF2A 4FX4A 3BCBA 2EIMH 5HS8A 3H35A 5CVIA 5D4SA 2DPUA 4HEA2 1JKRC 3DBLB 2E35A 5B5EC 1RNLA 2A6EF 5DS9A 5EZHA 1A31A 3VFZA 1A6QA 2EJRA 3CLQA 4LIVA 1XMKA 2R5ZB 2IGKA 2H8WA 1NH3A 1FSHA 3EPZA 2K3PA 3F72A 1IZ1A 1LEAA 4LK0F 2W7NA 5J40A 2VC1A 3LQQA 4HNVA 2VKVA 5DD4A 2PMUA 3DV8A 3L2CA 3QQAA 2RV8A 1T8IA 4HF0A 3BQZA 2KPMA 2HDWA 9ANTA 1SAXA 4E70A 3VYRB 2Y9YA 1WKMA 1NG6A 1MW7A 5GAEJ 3HRMA 4MHGA 5FKLA 4IHWA 2PN6A 3GZNB 4PJJA 4CSWA 3F21A 1H89C 2DJIA 1WH5A 5ED4A 2VONA 3RKYA 1SC7A 1JJ6C 1MH3A 3ZP5A 1MBHA 1XPXA 1O7FA 1X1PA 4X1EA 5L3GA 4DYRA 3L2RA 4S04A 3VPRA 1ONVA 2D1VA 1B9MA 1TWGJ 5JLXA 5DD8A 2O6GE 2FOKA 1SFUA 3WU1B 2KDOA 4XQFA 2QSHX 1BA5A 5DUKA 1BI0A 1U0JA 2EIJH 3CCJI 5JVGF 5ILSA 1XN7A 2DPDA 1ZYRF 3BTIA 2C6YA 5CVJA 3RQ4A 2UV1A 1R5GA 4A12A 3V8KA 2XHKA 6PAXA 1IF1A 3K4JA 5BMZA 2PBIA 4A3EJ 2O3FA 1DP3A 2BBYA 1YIOA 4FE7A 1TNSA 1X3WB 1ETXA 2JSPA 1EKEA 2Z5UA 2QM3A 3TO6A 4XMYA 2A05A 1UFMA 3ERMA 2MW8A 4E4HA 4QTRA 3MWMA 4YFNF 1RR8C 3SZPA 4HW0A 2BE5F 3ECHA 3L9FA 4BDZA 1U3EM 2HZDA 4P96A 1Q1VA 5DV5A 1XD7A 2ZSIB 3QP5A 4WF2A 1JGSA 4UUTA 2DFHA 2X48A 1IG7A 3CMEI 1TZLA 3OYHA 3MKLA 3KEQA 4FCYA 2KJCA 2WA0A 5TRDA 2BVMA 5ICFA 3KE2A 4BJTA 2QBYA 3GW2A 4XNFA 1U2WA 2GA1A 3JAMK 3SDGA 2COMA 2EB7A 5IP7J 2JPBA 5IT9Z 4RB3C 5D5XB 4F91B 4BY1J 1VQ7I 1LVKA 3KIOA 1OR7C 4RAFA 3HOWJ 3UR3C 2VJIA 1XSXA 2CG4A 1FIAA 2L7ZA 4I6ZA 1XGNA 3I3LA 2B7EA 2CQNA 5M5XJ 2ZO4A 5CPRB 1MZBA 3MKZA 1XDUA 3IRQA 1P7IA 3CCVI 2P8TA 2BOLA 4JK1X 1HCRA 2L0KA 4I0AA 5FLXK 2ZJ2A 2K9LA 5GTIC 3P7NA 3L1PA 3TQNA 1LKXA 2F5VA 1IRXA 1SD6A 3ASNH 2O03A 2NVYJ 4W97A 2QA4I 4KJZA 2CUJA 1S72I 2YPRA 3MZ8A 4IF4A 3NEUA 1BC7C 1SVLA 2MABA 3S15J 2BGCA 2LF8A 4FQGA 4ZZDA 1X3UA 4O5VA 3I59A 5IY5H 2R7FA 3WTYC 3FHNA 1NHAA 4IEJA 5CQGA 2NOJB 3W3CA 1MBGA 2PX9A 1P6RA 2EQRA 1DDNA 4D7MA 1AOYA 1XTAA 1VQ4I 3RDIA 2RKHA 2KDZA 4NC7A 1JI8A 2CU7A 2ICWG 5TGTA 1VZ0A 5H6QA 2QEXI 3RQIA 3BOQA 4KISA 5EGOA 3ZQIA 2CFXA 1U9NA 3MEXA 3WU2C 2V9KA 4IVNA 3V42A 2F4OB 1HLVA 5K7HA 5EDNA 2EFNA 4HQMA 2QSGX 1X3ZB 3FZVA 2DCEA 2CUZA 2JK3A 4UV9A 2FQ4A 3FXOA 5IOZA 2DW4A 5FLVA 1IXCA 3ELKA 5F6FA 2FQ3A 2QGUA 5F0CA 2R7QA 1LPQA 2R7TA 3FK6A 4BS9A 2GBYA 3GEZA 4PSWA 3TBIA 3D0SA 2GWRA 3C18A 1FOKA 3BROA 2MC3A 4D5CA 5IP6A 2XGEA 4BH9A 2HVSA 2LY1A 2CH0A 4EJOA 3WGHA 4MTDA 2DAOA 3M1CA 1KU7A 2DK5A 4GDFA 4BEHA 2VKEA 2YU3A 3COAC 1OKRA 2CW8A 4Q48A 3OL4A 1WVRA 2JZYA 2O7OA 5K5QA 1CF7B 2EWNA 1ON2A 2EZHA 4RGSA 3WGGA 3ZMZA 1QQIA 4PFOA 4JX6A 2AO9A 1MKMA 2IGNA 2V7FA 3CCYA 3LNQA 5CKTA 3JRBA 2A6HF 1QRYA 5GPAA 1WJAA 3H3VK 1CF7A 2DT6A 1G3WA 4ETSA 5DEQA 1SFXA 3DTIA 1BOBA 2JN6A 1JUPA 2R4GA 1PDNC 2AS5F 3OS1A 4YIRX 2WV1A 3HXLA 2CQQA 1LFUP 1UG0A 5L3EA 5DDGA 1FSEA 1MBEA 3LFUA 2PJRB 3IH2A 3BR2A 4KICA 3RPUD 2X1EA 4U0VA 2F48A 2B9SA 3DPTA 2BY3A 1RUNA 4LG0A 3U9GA 3G2BA 2L7MP 2P0WA 1IJWC 3B6AA 1HKQA 1SD5A 1IGNA 2E7WA 1G3SA 3KZZA 2Q2EB 3K69A 4OAZA 2PJRA 1R4MB 2LVSA 2O5RA 3KFWX 3QPHA 2NS0A 3S16J 1D3YA 4XKVA 4EM1A 1U78A 4P9UA 1MBKA 2LKPA 2WY7Q 4RB2C 1JHHA 1PP8F 1WHUA 3LQRA 2FU4A 3OY9A 2VKHA 3T8TA 4AUXA 2HS5A 3I4NJ 4R8HA 4EATA 2Q2EA 3HM5A 1HW5A 2VXZA 2OTLI 5K7FA 1XS9A 4IQ4A 3OYAA 4KDPA 3I4MJ 2GM4A 4XOTA 2UXNA 1TWHJ 2QZ8A 5L3CA 1QVTA 2PEXA 2ZCWA 2HYJA 5BNGA 1G6NA 1WQ2A 2WC2A 3K6GA 4F92B 3JTGA 5A2QK 1XX5A 3I53A 4XKBA 1T39A 1GHCA 3HG9A 4IHVA 2LTPA 3PNVA 2OZ6A 2FJ1A 3CUOA 2CV0A 3Q9SA 3OIQA 5IYCJ 2MYSA 1FJLA 4AIDA 1STZA 4EM0B 4M72A 2ZMEA 4LB6B 3GTOJ 2WAFA 2M7AA 2VPLA 4PJMA 3FXKA 2UWMA 3IV5A 1YITI 4U0YA 2NVXJ 3UNGC 3C1DA 3PSIA 3LSKA 1MSFC 3DQVC 4AVZA 2DA3A 1REPC 1IN8A 2M0CA 3VYUB 4IHXA 3KLNA 3CTAA 2ZXHA 4AYBA 1R5ID 2J5PA 3PNYA 3K0LA 3G71I 4CCKA 3ZRGA 3CUQC 1MBFA 1PP7U 2E71A 2WY8Q 4L9JA 1IRFA 2IW5A 4XL9A 2ZXIA 1ETKA 2A68F 2RNGA 5LBQA 1RUOA 1ON1A 1X4PA 3QODA 2HGCA 5F0HA 1Z7UA 5ICEA 2VI6A 4HNUA 1HW2A 2BW3A 4BHPA 2XAGA 5C3EJ 1ETYA 1DU0A 5FB2A 2ISYA 1XGSA 2X6WA 3OYGA 1H8AC 2OJED 1VQ9I 2OC6A 3E5UA 3B02A 4I7HA 3N4MA 3H5RA 3CMMA 4G6QA 1K4SA 4UHTA 1I6XA 4JX4A 1TQMA 4DQ2A 1TP4A 1TT5B 2OF7A 2KFDA 3OYFA 2VOOA 2E60A 4UNOA 1O3RA 4IO9F 4AU7A 4KT5C 1JGGA 2QKMB 4JBAA 1H9GA 4RBOA 5IT3A 2IGMA 2WB1A 2HEOA 3WG9A 3VOEA 3SZTA 1ZLJA 2PJPA 2KL4A 3HKZN 4IKFA 1BM9A 1V5EA 4M6XA 3SYTA 4YG2F 2K3FA 2M4GA 2DDAA 3BR1A 3OS2A 2B63J 3F8FA 1MD0A 4G9YA 4A3FJ 2XAHA 3F8MA 4M3BA 1YW7A 4NNJA 3GTJJ 1W7PA 3ABLH 4WX9A 3GLXA 4OIOF 4D9JA 4ENKA 3WU0A 2MC4A 2VB6A 3FBNB 1RIOH 1JKOC 4B47A 3OV8A 3WTTC 3K7AJ 2BV6A 3CMYA 1BW5A 2XB5A 1VQKI 4NHJA 1F1ZA 4BGDA 3B6CA 1VFCA 5KAIC 3T1BA 2JVGA 4V2GA 3CJTB 1I1SA 4KIBA 4FETA 5IT9K 4TV7A 2VPRA 4A69C 2UZKA 1J09A 4BE2A 1Z6TA 3R60A 5J8CA 2YU9J 1IUYA 3HZJA 5K1YA 4CXFA 2WAEA
chains in the Genus database with same CATH topology
2P6SA 4DNCA 4OIPF 1ODDA 3LSTA 3HHGA 3GZ5A 5L3DA 5FGMA 3I4PA 4MTEA 2Y0MA 2F5CA 3C3WA 1D8KA 2L54A 2ZXJA 4L5IA 5FFXA 1USSA 4U7DA 4YFKF 3T5XA 2G7HA 1YFHA 2P5LC 3W6KB 4BNCA 4OOIA 2Y75A 5BPDA 4ESBA 2F5FA 2GA2A 4HZFA 1J0RA 3IHUA 2W25A 1ZN2A 1T38A 1V4RA 2IA2A 2CYYA 4ENNA 2XUBA 1Z1DA 2VBWA 4A2UA 3QRFF 2Z99A 1O3TA 2XVCA 4FT8A 1D5VA 2JPCA 2WTEA 1GXPA 3MZHA 5JVTA 4XLPF 1U8RA 3E6CC 4GYGA 4M71A 3J7AO 1BN5A 3DFGA 4EJTA 5E1ZB 5ICGA 1DPRA 1W5SA 2EV0A 2MH2A 1KYWA 4N9IA 4L0ZB 2DQRA 3EDPA 4XSZF 4GYIA 4QLCU 5LRRA 3G73A 5TJJA 1RZ4A 2YR2A 2JSCA 2ZFWA 3QP6A 3H3ZA 4PGHA 5F64A 2G7UA 1J9IA 2W57A 2O8XA 2H27A 2H6BA 3KETA 4RB0A 2XASA 3JW4A 4RGXA 4OIQF 1UHWA 3PQKA 3RPUA 4R1HA 5CVVA 1IN6A 5D6FA 1CGPA 1SD4A 4HF1A 5KVRA 3WGIA 2L4MA 4M74A 3GXOA 3EQLF 3L09A 2HR3A 1ZLKA 2A5YB 4XBFA 2FBIA 3BDDA 3KP3A 4M6YA 3RKWA 1U5TC 4M9XA 2L01A 3V4GA 2HKOA 4YIFA 2H09A 1V3FA 2XAQA 1FT9A 4HA8A 4AD9A 5LHIA 1OYYA 1S3JA 4FHTA 2XRNA 1B4AA 4WWCA 2M30A 1ZHFA 1T2KA 1XSDA 1P4WA 4AIKA 2P5KA 2Z9OA 5JI6A 4WK8F 5DCFA 2K02A 2LF7A 2D1HA 2YX7A 1R58A 2YX4A 2R7DA 4ZZLA 1OR7A 2KRFA 4O6JA 5E20A 3KLOA 3CLOA 2W24A 3O2PE 4Q5SF 5E1WA 1FYLA 1WSUA 3GVAA 1MJ9A 2NRAC 2DO7A 2NAZA 2FE3A 3RTRA 2JTVA 4HDVA 3RPQA 2K4BA 1YTYA 1ZGAA 5HDNA 3SQNA 2R3SA 1W7PD 3L7WA 4U88A 2ZBKA 2KKOA 4KMFA 3KP4A 2QBYB 1XCBA 4I02A 4ZYEA 3FX3A 1R1VA 2GXBA 1WRJA 2JT1A 1YG2A 1TW2A 5D4RA 4S05A 3GUDA 4IRHA 5HVQC 5FD5A 2HOEA 5D6EA 1LDKB 2LDUA 2VE8A 4EVIA 2XKOA 3MQ0A 1ZG5A 5CJ9A 5EEGA 4MGRA 3HUGA 4I98B 4HLXA 2XAJA 3LFKA 3J80Z 3GFLA 3SXYA 2VC0A 2A3SA 2E1NA 2XROA 1XCVA 5HLIA 5ICCA 3I59B 2HQNA 3I58A 3E6DA 1J5YA 3BY6A 3I5UA 1R00A 1R36A 3EYIA 2GAUA 1A04A 4CZZA 2FBHA 3HOTA 2OU2A 1Z05A 1S8NA 4G7HF 1FYKA 4KYWA 3E6MA 2F2EA 3FMQA 3JSPA 2OA4A 4HDUA 4RAYA 3BJAA 3R0JA 3KZYA 3M1EA 4ESFA 4LJZF 5E8IA 3F8NA 4NQWA 3I64A 4A0YA 4FX0A 2NNYA 1KQ9A 2EFOA 1K78A 2QQ9A 3BJ6A 4F7ZA 5D8KB 2EA4A 4G8XA 2QUFA 2OD5A 4HLYA 1DP7P 4I01A 4BHCA 1IRGA 4EJVA 3G3ZA 4L5JA 2ZNYA 4HX7A 4ZYGA 3ROUA 2OZUA 2MLGA 4K2EA 5AIQA 4MQ9F 3IKTA 2FRHA 4ZYHA 4A6EA 1QBJA 4A5MA 3HRSA 4CHUA 1KYZA 5JR3A 4JQFA 4LG0B 4IRIA 3F6VA 2K4JA 3DXJF 1EH7A 2FNPA 3GO5A 4EJUA 3T0YA 4L0YB 3ISPA 4ESJA 2E1CA 4LFUA 5AIPA 3WTVC 1IN7A 3QU3A 3DPLC 5DCMA 1XDSA 1TTYA 3Q9VA 1FP1D 3EETA 2QVOA 4M9ZA 4YFXF 1TLHB 2HYFA 1YLFA 3ZMTA 1OMIA 4UUVA 1W4MA 4IJAA 2PMHA 3Q5FA 2STTA 2VBZA 2ZMEB 1I5ZA 1BI1A 4D0PA 5CYVA 1ZGJA 4RS8A 4IPAA 3V7SA 1LQ1A 2RQPA 5HLHA 2EFWA 3K1PA 2HDCA 4M9SA 3RJPA 5J8FA 1Y0UA 3RIRA 1C0WA 1LDDA 1KU9A 3LWFA 2H94A 1L3LA 3ULQB 1BIAA 3GWZA 3ZMDA 1FZPB 1O3SA 4P9FA 1QPMA 2W84A 3NRVA 3BPVA 4GXOA 5CVUA 3LAPA 3TDZC 1F5TA 3KCCA 3PFIA 1UHMA 1R1UA 5FO5A 2PLYA 2VOPA 4XSXF 5LLQA 2KJBA 4AWXB 4GGGA 1Q1HA 2H6CA 1FYMA 5D5UB 3CDHA 3IWZA 1W7PB 5LRSA 1XMAA 2OBPA 4ZYDA 3MFKA 5LGNA 2ZNZA 1XGMA 3F23A 4EQQA 3K2ZA 2L4AA 4LLGF 5CVRA 2HFHA 5LGUA 4OMYA 4HOBA 4G6DA 1P4XA 5CLSA 4ASNA 3V7CA 2G9WA 1MGTA 2P7CB 4CGZA 4I2OA 1O3QA 1MJAA 1K79A 1QNTA 1UB9A 3TGNA 3WTXC 4I09A 1MDMA 1R7JA 1MJBA 2HTSA 4GCVA 3JAMZ 2P4WA 1ZAOA 3J80K 4IXAA 1K7AA 1KU2A 3BWGA 4PDKA 4KA4A 4PZJA 1J7KA 2GIVA 2V1XA 3GZ6A 2NNNA 1BIBA 4Y17A 3QOPA 1BI3A 3LAJA 4NB5A 4UVBA 1YS6A 3VEPA 1BJAA 4N0BA 1R23A 3HRUA 3M8FA 5JHUA 4OIRF 2ADUA 4Y15A 5E1XA 1KQ8A 3H3UA 1YQAA 5E18F 1YW8A 3PQJA 5ILUA 3ABUA 3MAJA 3ZMUA 1LDJA 3DF8A 4M73A 3I54A 4XLNF 2PG4A 2ISZA 1F4KA 2WV0A 2Z33A 2QWWA 1B9NA 2ACJA 5D5VB 3HSRA 3I71A 3TOBA 3CJNA 4CO8A 5K5OA 5K5RA 3C7JA 3GX4X 4BAYA 4PGGA 1U5TA 3HRTA 2FF4A 2O0YA 3DKWA 2X4HA 3RI4A 4A6DA 5KK1A 3DP7A 1TW3A 2IJLA 2ELHA 1UCRA 2DI3A 3TO9A 1JXSA 4LD5A 4LMYA 4L9VA 5BOXA 3GFJA 2WWYA 4YIIA 2W85A 2VT2A 4WXHA 1BI2A 3O6BB 1FBQA 1T6SA 4CYDA 1USTA 2V79A 4GO1A 3KP7A 1ZRCA 1TQIA 4AVPA 2PQ8A 3V8LA 4EGYA 2ETHA 1HQCA 1ULYA 3RKXA 2HYGD 3E6BA 3WE3A 2IT0A 4KFCA 3MZYA 3VODA 1B59A 4ENJA 2FSWA 2M87A 4MQVA 3F3XA 2TDXA 2IP2A 3BP8A 3V7RA 5D8LB 4LLLA 1ZG3A 2D2WA 2DLLA 2L3DA 1EV7A 1IW7F 5HOOA 2DQLA 1DUXC 2Y48A 5LGTA 2EK5A 4HV5A 4QWQA 3WODF 4A5NA 1XGOA 5A2QZ 2DU9A 2IA0A 2A69F 4BHBA 4IHSA 2PFBA 4WCGA 4HV6A 4ON0A 5FD6A 2QYOA 1P2FA 3HTSB 1HKSA 2P7VB 5L3BA 1QZZA 3FM3A 1E2XA 2DBBA 2K86A 4L9TA 2DT5A 3R4KA 2D45A 4L9NA 4IHTA 3HSEA 2HZTA 2RDPA 2UXXA 4CICA 1ZG1A 2V1DA 4Q4ZF 4EJWA 2XAFA 1P4AA 2KIFA 3V8JA 1B1BA 5LEJA 1SFEA 2MD5A 5BS6A 3ECOA 2MBFA 2ESHA 5HS9A 4KIGA 3N97A 3JSOA 3JTHA 3ZN1A 1OYWA 3FXUA 2RGVA 3K1MA 3WTUC 4G94A 2K27A 1SMTA 1J75A 4RGRA 2VBYA 2Q0OA 3HSFA 4N9HA 1FX7A 4A0XA 5L3FA 3B73A 2A61A 1J2XA 1KA8A 1Z9CA 1AWCA 1LNWA 3GYHX 3RYPA 4Y13A 4G7OF 5HDGA 4AIJA 2YSRA 4OMZA 1KGSA 1SMYF 1YW9A 3U1DA 3REOA 3TO7A 4MNUA 3SFZA 1IXSB 2ZKZA 1FC3A 3R6SA 1FBUA 3MCZA 4A0ZA 3FF5A 2VODA 4ENMA 2FMLA 2HWVA 3QU6A 4KMUX 4P55A 4KN7X 3BPXA 2FEZA 2QLZA 2QQAA 4BYYA 2P6TA 4IRGA 1KQ0A 4G7ZF 2O61A 2EV5A 1K78B 3O3KA 3HHHA 2M45A 1I1GA 3IKVA 5AONA 4Z2YA 3P9KA 5BQTA 2VE9A 2IPQX 3WTSC 1K6OA 3AAFA 1R5HA 3FHZA 1YO5C 3E3VA 3E5XA 2VT3A 2Z3YA 1FP2A 4PCQA 1WWXA 1ZARA 2VBXA 1XB4A 3ABTA 1H9TA 4H0EA 3FMSA 4HX8A 2CQKA 3F8CA 2X0LA 1O7LA 2PI0A 4UVAA 4OU0A 3BJOA 4KN4X 1J59A 4XRFA 1SD7A 2XIGA 4EGZA 4I0BA 3P9CA 1G4DA 3S2WA 2IA1A 3CO6C 3CUQB 5D5WB 2FNAA 2RVCA 5DCMB 5ERIA 2XGXA 5LEKA 1LJ9A 2OAZA 1HSTA 2OQRA 2F5DA 3CUQA 5BPIA 4KUMA 1FBSA 4Q47A 3J81Z 1LB2A 1KU3A 3FWEA 4U0WA 3FMRA 1GVJA 4MEXF 1G3TA 1GXQA 2RNJA 5J6XA 2VN2A 3E97A 3K1NA 2KIMA 1ZREA 1Z91A 3HYIA 4WXDA 2L02A 2FA5A 3CO7C 5F1RA 3D5LA 2DFIA 2V6CA 3ZMSA 1QGPA 4MEYF 3WTWC 1P92A 2STWA 4EV0A 5E8GA 5EEHA 1IN4A 2RC4A 4ZH4F 3IRRA 3L00A 2XKPA 1QO0D 3H92A 3GFIA 1JE8A 3ZMVA 1FY7A 3KP5A 3ZPLA 4U7BA 4RAZA 5H20A 3F8BA 4HQEA 3LA3A 2XV4S 3T8RA 2IRFG 2MA3A 1JHFA 3QAHA 2K7LA 1R22A 3R61A 4P5OA 5DUIA 2OQGA 1H0MA 2F5EA 3NQOA 3EYYA 1O57A 4LGWA 2B0LA 2Q8KA 1U6GA 4RB1A 1YS7A 3E5QA 2AXLA 3LA2A 1ZH5A 1F9NA 2QQBA 1S6LA 2A07F 2EFPA 4EM2A 3VB2A 3RYRA 5DYMA 1FPQA 2M1BA 1MDMB 3TOAA 1BC8C 4CDGA 2IVMA 3KP6A 4LB5A 3M7GA 4HAMA 5FFZA 2LSOA 2V9VA 3FXQA 1EH8A 4UV8A 2GZWA 2FMYA 3KEOA 2NYXA 1E17A 2QENA 3BZ6A 3GF2A 2EV6A 1IAWA 3ZN0A 2CGPA 3ERED 1IN5A 2EFQA 2MH9A 3KP2A 3IL2A 3HOSA 2BYVE 4BXUA 2GXGA 3OOPA 1ZRDA 1WI9A 1HSJA 1D8JA 3FM5A 5H6RA 4B8XA 2RN7A 5LHHA 2J5OA 5FLXZ 3I0TA 2HKXA 2CWEA 1PUEE 1T0FA 2M5WA 1XSVA 3EUHA 1T98A 3SHFA 2DK8A 1R1TA 3P9IA 4OINF 3M9AA 1HBXG 3HTUA 4R79A 5JFRA 3W6JB 1HW1A 2E7XA 2EA2A 1TQPA 4HBLA 1I27A 3HIFA 1OPCA 1HKTA 5E17F 1S29A 4UXNA 1W5TA 1DPUA 2HTJA 3ZQ7A 1U5TB 4O3MA 1TNTA 4B09A 2CSOA 1EH6A 2FBKA 3TKYA 3IC7A 1G3YA 1ZRFA 2BEOA 2V1UA 2GQQA 4HX4A 4LLNA 4LK1F 1YYVA 2FXAA 1FWZA 4L18B 3TDUC 1Z6RA 3K9TA 2LNBA 3GFMA 3IWFA 1FLIA 4KNYA 1S7OA 2DTRA 3M8EA 5LHGA 2CW0F 3WE2A 3F22A 2HQRA 3WTZA 1VTNC 5ILVA 5HDKA 2KIUA 5HS7A 4WXCA 3F6OA 2CO5A 1HXDA 4EMSA 4BQAA 1L0OC 1TBXA 1QZYA 3J81K 1FNNA 1IXRC 2MLKA 3R0AA 2JRTA 1RI7A 2P5VA 4RGUA 1B6AA 1LEBA 1S7AA 1LVAA 4UVCA 4AIHA 3QPTA 1OYIA 3DEUA 3FXRA 2M8EA 2ESNA 4KIFA 3U2RA 1BBYA 4HYEA 3ML6A 5HLGA 1BOAA 3LA7A 4HF2A 4FX4A 5HS8A 5CVIA 5D4SA 2DPUA 1RNLA 2A6EF 3VFZA 2EJRA 1XMKA 1FSHA 3F72A 1IZ1A 1LEAA 4LK0F 2VC1A 3LQQA 5DD4A 2PMUA 3DV8A 3L2CA 2RV8A 4HF0A 1SAXA 4E70A 1WKMA 3HRMA 4MHGA 2PN6A 3F21A 5ED4A 2VONA 3RKYA 3ZP5A 1O7FA 5L3GA 4S04A 1ONVA 2D1VA 1B9MA 5DD8A 2O6GE 2FOKA 1SFUA 3WU1B 5DUKA 1BI0A 5ILSA 1XN7A 2DPDA 1ZYRF 2C6YA 5CVJA 1R5GA 4A12A 3V8KA 2XHKA 6PAXA 1IF1A 5BMZA 2PBIA 2O3FA 2BBYA 1YIOA 1TNSA 2Z5UA 2QM3A 3TO6A 1UFMA 3MWMA 4YFNF 3SZPA 4HW0A 2BE5F 3ECHA 3L9FA 1U3EM 4P96A 5DV5A 1XD7A 3QP5A 4WF2A 1JGSA 3KEQA 2KJCA 5TRDA 5ICFA 3KE2A 2QBYA 3GW2A 1U2WA 2GA1A 3JAMK 2COMA 2EB7A 2JPBA 5IT9Z 4RB3C 5D5XB 1XSXA 2CG4A 1XGNA 2ZO4A 1MZBA 1XDUA 3IRQA 2P8TA 4JK1X 4I0AA 5FLXK 2ZJ2A 3P7NA 3TQNA 1SD6A 2O03A 2YPRA 4IF4A 3NEUA 1BC7C 2BGCA 2LF8A 4ZZDA 1X3UA 4O5VA 3I59A 2R7FA 3WTYC 1NHAA 1P6RA 1DDNA 1AOYA 3RDIA 2RKHA 5H6QA 3BOQA 2CFXA 3MEXA 4IVNA 2EFNA 4HQMA 3FZVA 4UV9A 2DW4A 1IXCA 3ELKA 5F6FA 2FQ3A 3GEZA 3D0SA 2GWRA 3C18A 1FOKA 3BROA 2MC3A 4BH9A 4EJOA 3WGHA 4MTDA 2DAOA 1KU7A 2DK5A 2YU3A 3COAC 1OKRA 4Q48A 2JZYA 1CF7B 5K5QA 2EWNA 1ON2A 4RGSA 3WGGA 3ZMZA 1QQIA 1MKMA 2A6HF 1CF7A 1G3WA 4ETSA 5DEQA 1SFXA 1PDNC 2AS5F 5L3EA 5DDGA 1FSEA 4KICA 4U0VA 3DPTA 1RUNA 4LG0A 3U9GA 1HKQA 1SD5A 2E7WA 1G3SA 3KZZA 3K69A 3KFWX 3QPHA 2NS0A 1D3YA 4EM1A 1U78A 4P9UA 2LKPA 4RB2C 1JHHA 1PP8F 3LQRA 2FU4A 3T8TA 2HS5A 4R8HA 2Q2EA 1HW5A 2VXZA 4KDPA 2UXNA 2QZ8A 5L3CA 2PEXA 2ZCWA 1G6NA 1WQ2A 2WC2A 3JTGA 5A2QK 3I53A 1T39A 1GHCA 2OZ6A 3CUOA 3Q9SA 1STZA 4EM0B 4M72A 2ZMEA 4LB6B 2UWMA 4U0YA 3C1DA 3DQVC 1REPC 1IN8A 3KLNA 3CTAA 2J5PA 3K0LA 3CUQC 1PP7U 4L9JA 1IRFA 2IW5A 5LBQA 2A68F 1RUOA 1ON1A 2HGCA 1Z7UA 5ICEA 1HW2A 4BHPA 2XAGA 5FB2A 2ISYA 1XGSA 3E5UA 3B02A 4I7HA 3N4MA 4G6QA 4UHTA 1I6XA 1TQMA 4DQ2A 2VOOA 4UNOA 1O3RA 4KT5C 4JBAA 1H9GA 5IT3A 2HEOA 3WG9A 3VOEA 3SZTA 1ZLJA 2PJPA 1BM9A 4M6XA 4YG2F 3F8FA 1MD0A 4G9YA 2XAHA 3F8MA 1YW7A 1W7PA 4WX9A 3GLXA 4OIOF 4ENKA 3WU0A 1RIOH 3OV8A 3WTTC 2BV6A 4NHJA 1F1ZA 3T1BA 1I1SA 4KIBA 5IT9K 4TV7A 2UZKA 1Z6TA 3R60A 5J8CA 1IUYA 5K1YA 4CXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6S A;  4DNC A;  4OIP F;  1ODD A;  3LST A;  3HHG A;  3GZ5 A;  5L3D A;  5FGM A;  3I4P A;  4MTE A;  2Y0M A;  2F5C A;  3C3W A;  1D8K A;  2L54 A;  2ZXJ A;  4L5I A;  5FFX A;  1USS A;  4U7D A;  4YFK F;  3T5X A;  2G7H A;  1YFH A;  2P5L C;  3W6K B;  4BNC A;  4OOI A;  2Y75 A;  5BPD A;  4ESB A;  2F5F A;  2GA2 A;  4HZF A;  1J0R A;  3IHU A;  2W25 A;  1ZN2 A;  1T38 A;  1V4R A;  2IA2 A;  2CYY A;  4ENN A;  2XUB A;  1Z1D A;  2VBW A;  4A2U A;  3QRF F;  2Z99 A;  1O3T A;  2XVC A;  4FT8 A;  1D5V A;  2JPC A;  2WTE A;  1GXP A;  3MZH A;  5JVT A;  4XLP F;  1U8R A;  3E6C C;  4GYG A;  4M71 A;  3J7A O;  1BN5 A;  3DFG A;  4EJT A;  5E1Z B;  5ICG A;  1DPR A;  1W5S A;  2EV0 A;  2MH2 A;  1KYW A;  4N9I A;  4L0Z B;  2DQR A;  3EDP A;  4XSZ F;  4GYI A;  4QLC U;  5LRR A;  3G73 A;  5TJJ A;  1RZ4 A;  2YR2 A;  2JSC A;  2ZFW A;  3QP6 A;  3H3Z A;  4PGH A;  5F64 A;  2G7U A;  1J9I A;  2W57 A;  2O8X A;  2H27 A;  2H6B A;  3KET A;  4RB0 A;  2XAS A;  3JW4 A;  4RGX A;  4OIQ F;  1UHW A;  3PQK A;  3RPU A;  4R1H A;  5CVV A;  1IN6 A;  5D6F A;  1CGP A;  1SD4 A;  4HF1 A;  5KVR A;  3WGI A;  2L4M A;  4M74 A;  3GXO A;  3EQL F;  3L09 A;  2HR3 A;  1ZLK A;  2A5Y B;  4XBF A;  2FBI A;  3BDD A;  3KP3 A;  4M6Y A;  3RKW A;  1U5T C;  4M9X A;  2L01 A;  3V4G A;  2HKO A;  4YIF A;  2H09 A;  1V3F A;  2XAQ A;  1FT9 A;  4HA8 A;  4AD9 A;  5LHI A;  1OYY A;  1S3J A;  4FHT A;  2XRN A;  1B4A A;  4WWC A;  2M30 A;  1ZHF A;  1T2K A;  1XSD A;  1P4W A;  4AIK A;  2P5K A;  2Z9O A;  5JI6 A;  4WK8 F;  5DCF A;  2K02 A;  2LF7 A;  2D1H A;  2YX7 A;  1R58 A;  2YX4 A;  2R7D A;  4ZZL A;  1OR7 A;  2KRF A;  4O6J A;  5E20 A;  3KLO A;  3CLO A;  2W24 A;  3O2P E;  4Q5S F;  5E1W A;  1FYL A;  1WSU A;  3GVA A;  1MJ9 A;  2NRA C;  2DO7 A;  2NAZ A;  2FE3 A;  3RTR A;  2JTV A;  4HDV A;  3RPQ A;  2K4B A;  1YTY A;  1ZGA A;  5HDN A;  3SQN A;  2R3S A;  1W7P D;  3L7W A;  4U88 A;  2ZBK A;  2KKO A;  4KMF A;  3KP4 A;  2QBY B;  1XCB A;  4I02 A;  4ZYE A;  3FX3 A;  1R1V A;  2GXB A;  1WRJ A;  2JT1 A;  1YG2 A;  1TW2 A;  5D4R A;  4S05 A;  3GUD A;  4IRH A;  5HVQ C;  5FD5 A;  2HOE A;  5D6E A;  1LDK B;  2LDU A;  2VE8 A;  4EVI A;  2XKO A;  3MQ0 A;  1ZG5 A;  5CJ9 A;  5EEG A;  4MGR A;  3HUG A;  4I98 B;  4HLX A;  2XAJ A;  3LFK A;  3J80 Z;  3GFL A;  3SXY A;  2VC0 A;  2A3S A;  2E1N A;  2XRO A;  1XCV A;  5HLI A;  5ICC A;  3I59 B;  2HQN A;  3I58 A;  3E6D A;  1J5Y A;  3BY6 A;  3I5U A;  1R00 A;  1R36 A;  3EYI A;  2GAU A;  1A04 A;  4CZZ A;  2FBH A;  3HOT A;  2OU2 A;  1Z05 A;  1S8N A;  4G7H F;  1FYK A;  4KYW A;  3E6M A;  2F2E A;  3FMQ A;  3JSP A;  2OA4 A;  4HDU A;  4RAY A;  3BJA A;  3R0J A;  3KZY A;  3M1E A;  4ESF A;  4LJZ F;  5E8I A;  3F8N A;  4NQW A;  3I64 A;  4A0Y A;  4FX0 A;  2NNY A;  1KQ9 A;  2EFO A;  1K78 A;  2QQ9 A;  3BJ6 A;  4F7Z A;  5D8K B;  2EA4 A;  4G8X A;  2QUF A;  2OD5 A;  4HLY A;  1DP7 P;  4I01 A;  4BHC A;  1IRG A;  4EJV A;  3G3Z A;  4L5J A;  2ZNY A;  4HX7 A;  4ZYG A;  3ROU A;  2OZU A;  2MLG A;  4K2E A;  5AIQ A;  4MQ9 F;  3IKT A;  2FRH A;  4ZYH A;  4A6E A;  1QBJ A;  4A5M A;  3HRS A;  4CHU A;  1KYZ A;  5JR3 A;  4JQF A;  4LG0 B;  4IRI A;  3F6V A;  2K4J A;  3DXJ F;  1EH7 A;  2FNP A;  3GO5 A;  4EJU A;  3T0Y A;  4L0Y B;  3ISP A;  4ESJ A;  2E1C A;  4LFU A;  5AIP A;  3WTV C;  1IN7 A;  3QU3 A;  3DPL C;  5DCM A;  1XDS A;  1TTY A;  3Q9V A;  1FP1 D;  3EET A;  2QVO A;  4M9Z A;  4YFX F;  1TLH B;  2HYF A;  1YLF A;  3ZMT A;  1OMI A;  4UUV A;  1W4M A;  4IJA A;  2PMH A;  3Q5F A;  2STT A;  2VBZ A;  2ZME B;  1I5Z A;  1BI1 A;  4D0P A;  5CYV A;  1ZGJ A;  4RS8 A;  4IPA A;  3V7S A;  1LQ1 A;  2RQP A;  5HLH A;  2EFW A;  3K1P A;  2HDC A;  4M9S A;  3RJP A;  5J8F A;  1Y0U A;  3RIR A;  1C0W A;  1LDD A;  1KU9 A;  3LWF A;  2H94 A;  1L3L A;  3ULQ B;  1BIA A;  3GWZ A;  3ZMD A;  1FZP B;  1O3S A;  4P9F A;  1QPM A;  2W84 A;  3NRV A;  3BPV A;  4GXO A;  5CVU A;  3LAP A;  3TDZ C;  1F5T A;  3KCC A;  3PFI A;  1UHM A;  1R1U A;  5FO5 A;  2PLY A;  2VOP A;  4XSX F;  5LLQ A;  2KJB A;  4AWX B;  4GGG A;  1Q1H A;  2H6C A;  1FYM A;  5D5U B;  3CDH A;  3IWZ A;  1W7P B;  5LRS A;  1XMA A;  2OBP A;  4ZYD A;  3MFK A;  5LGN A;  2ZNZ A;  1XGM A;  3F23 A;  4EQQ A;  3K2Z A;  2L4A A;  4LLG F;  5CVR A;  2HFH A;  5LGU A;  4OMY A;  4HOB A;  4G6D A;  1P4X A;  5CLS A;  4ASN A;  3V7C A;  2G9W A;  1MGT A;  2P7C B;  4CGZ A;  4I2O A;  1O3Q A;  1MJA A;  1K79 A;  1QNT A;  1UB9 A;  3TGN A;  3WTX C;  4I09 A;  1MDM A;  1R7J A;  1MJB A;  2HTS A;  4GCV A;  3JAM Z;  2P4W A;  1ZAO A;  3J80 K;  4IXA A;  1K7A A;  1KU2 A;  3BWG A;  4PDK A;  4KA4 A;  4PZJ A;  1J7K A;  2GIV A;  2V1X A;  3GZ6 A;  2NNN A;  1BIB A;  4Y17 A;  3QOP A;  1BI3 A;  3LAJ A;  4NB5 A;  4UVB A;  1YS6 A;  3VEP A;  1BJA A;  4N0B A;  1R23 A;  3HRU A;  3M8F A;  5JHU A;  4OIR F;  2ADU A;  4Y15 A;  5E1X A;  1KQ8 A;  3H3U A;  1YQA A;  5E18 F;  1YW8 A;  3PQJ A;  5ILU A;  3ABU A;  3MAJ A;  3ZMU A;  1LDJ A;  3DF8 A;  4M73 A;  3I54 A;  4XLN F;  2PG4 A;  2ISZ A;  1F4K A;  2WV0 A;  2Z33 A;  2QWW A;  1B9N A;  2ACJ A;  5D5V B;  3HSR A;  3I71 A;  3TOB A;  3CJN A;  4CO8 A;  5K5O A;  5K5R A;  3C7J A;  3GX4 X;  4BAY A;  4PGG A;  1U5T A;  3HRT A;  2FF4 A;  2O0Y A;  3DKW A;  2X4H A;  3RI4 A;  4A6D A;  5KK1 A;  3DP7 A;  1TW3 A;  2IJL A;  2ELH A;  1UCR A;  2DI3 A;  3TO9 A;  1JXS A;  4LD5 A;  4LMY A;  4L9V A;  5BOX A;  3GFJ A;  2WWY A;  4YII A;  2W85 A;  2VT2 A;  4WXH A;  1BI2 A;  3O6B B;  1FBQ A;  1T6S A;  4CYD A;  1UST A;  2V79 A;  4GO1 A;  3KP7 A;  1ZRC A;  1TQI A;  4AVP A;  2PQ8 A;  3V8L A;  4EGY A;  2ETH A;  1HQC A;  1ULY A;  3RKX A;  2HYG D;  3E6B A;  3WE3 A;  2IT0 A;  4KFC A;  3MZY A;  3VOD A;  1B59 A;  4ENJ A;  2FSW A;  2M87 A;  4MQV A;  3F3X A;  2TDX A;  2IP2 A;  3BP8 A;  3V7R A;  5D8L B;  4LLL A;  1ZG3 A;  2D2W A;  2DLL A;  2L3D A;  1EV7 A;  1IW7 F;  5HOO A;  2DQL A;  1DUX C;  2Y48 A;  5LGT A;  2EK5 A;  4HV5 A;  4QWQ A;  3WOD F;  4A5N A;  1XGO A;  5A2Q Z;  2DU9 A;  2IA0 A;  2A69 F;  4BHB A;  4IHS A;  2PFB A;  4WCG A;  4HV6 A;  4ON0 A;  5FD6 A;  2QYO A;  1P2F A;  3HTS B;  1HKS A;  2P7V B;  5L3B A;  1QZZ A;  3FM3 A;  1E2X A;  2DBB A;  2K86 A;  4L9T A;  2DT5 A;  3R4K A;  2D45 A;  4L9N A;  4IHT A;  3HSE A;  2HZT A;  2RDP A;  2UXX A;  4CIC A;  1ZG1 A;  2V1D A;  4Q4Z F;  4EJW A;  2XAF A;  1P4A A;  2KIF A;  3V8J A;  1B1B A;  5LEJ A;  1SFE A;  2MD5 A;  5BS6 A;  3ECO A;  2MBF A;  2ESH A;  5HS9 A;  4KIG A;  3N97 A;  3JSO A;  3JTH A;  3ZN1 A;  1OYW A;  3FXU A;  2RGV A;  3K1M A;  3WTU C;  4G94 A;  2K27 A;  1SMT A;  1J75 A;  4RGR A;  2VBY A;  2Q0O A;  3HSF A;  4N9H A;  1FX7 A;  4A0X A;  5L3F A;  3B73 A;  2A61 A;  1J2X A;  1KA8 A;  1Z9C A;  1AWC A;  1LNW A;  3GYH X;  3RYP A;  4Y13 A;  4G7O F;  5HDG A;  4AIJ A;  2YSR A;  4OMZ A;  1KGS A;  1SMY F;  1YW9 A;  3U1D A;  3REO A;  3TO7 A;  4MNU A;  3SFZ A;  1IXS B;  2ZKZ A;  1FC3 A;  3R6S A;  1FBU A;  3MCZ A;  4A0Z A;  3FF5 A;  2VOD A;  4ENM A;  2FML A;  2HWV A;  3QU6 A;  4KMU X;  4P55 A;  4KN7 X;  3BPX A;  2FEZ A;  2QLZ A;  2QQA A;  4BYY A;  2P6T A;  4IRG A;  1KQ0 A;  4G7Z F;  2O61 A;  2EV5 A;  1K78 B;  3O3K A;  3HHH A;  2M45 A;  1I1G A;  3IKV A;  5AON A;  4Z2Y A;  3P9K A;  5BQT A;  2VE9 A;  2IPQ X;  3WTS C;  1K6O A;  3AAF A;  1R5H A;  3FHZ A;  1YO5 C;  3E3V A;  3E5X A;  2VT3 A;  2Z3Y A;  1FP2 A;  4PCQ A;  1WWX A;  1ZAR A;  2VBX A;  1XB4 A;  3ABT A;  1H9T A;  4H0E A;  3FMS A;  4HX8 A;  2CQK A;  3F8C A;  2X0L A;  1O7L A;  2PI0 A;  4UVA A;  4OU0 A;  3BJO A;  4KN4 X;  1J59 A;  4XRF A;  1SD7 A;  2XIG A;  4EGZ A;  4I0B A;  3P9C A;  1G4D A;  3S2W A;  2IA1 A;  3CO6 C;  3CUQ B;  5D5W B;  2FNA A;  2RVC A;  5DCM B;  5ERI A;  2XGX A;  5LEK A;  1LJ9 A;  2OAZ A;  1HST A;  2OQR A;  2F5D A;  3CUQ A;  5BPI A;  4KUM A;  1FBS A;  4Q47 A;  3J81 Z;  1LB2 A;  1KU3 A;  3FWE A;  4U0W A;  3FMR A;  1GVJ A;  4MEX F;  1G3T A;  1GXQ A;  2RNJ A;  5J6X A;  2VN2 A;  3E97 A;  3K1N A;  2KIM A;  1ZRE A;  1Z91 A;  3HYI A;  4WXD A;  2L02 A;  2FA5 A;  3CO7 C;  5F1R A;  3D5L A;  2DFI A;  2V6C A;  3ZMS A;  1QGP A;  4MEY F;  3WTW C;  1P92 A;  2STW A;  4EV0 A;  5E8G A;  5EEH A;  1IN4 A;  2RC4 A;  4ZH4 F;  3IRR A;  3L00 A;  2XKP A;  1QO0 D;  3H92 A;  3GFI A;  1JE8 A;  3ZMV A;  1FY7 A;  3KP5 A;  3ZPL A;  4U7B A;  4RAZ A;  5H20 A;  3F8B A;  4HQE A;  3LA3 A;  2XV4 S;  3T8R A;  2IRF G;  2MA3 A;  1JHF A;  3QAH A;  2K7L A;  1R22 A;  3R61 A;  4P5O A;  5DUI A;  2OQG A;  1H0M A;  2F5E A;  3NQO A;  3EYY A;  1O57 A;  4LGW A;  2B0L A;  2Q8K A;  1U6G A;  4RB1 A;  1YS7 A;  3E5Q A;  2AXL A;  3LA2 A;  1ZH5 A;  1F9N A;  2QQB A;  1S6L A;  2A07 F;  2EFP A;  4EM2 A;  3VB2 A;  3RYR A;  5DYM A;  1FPQ A;  2M1B A;  1MDM B;  3TOA A;  1BC8 C;  4CDG A;  2IVM A;  3KP6 A;  4LB5 A;  3M7G A;  4HAM A;  5FFZ A;  2LSO A;  2V9V A;  3FXQ A;  1EH8 A;  4UV8 A;  2GZW A;  2FMY A;  3KEO A;  2NYX A;  1E17 A;  2QEN A;  3BZ6 A;  3GF2 A;  2EV6 A;  1IAW A;  3ZN0 A;  2CGP A;  3ERE D;  1IN5 A;  2EFQ A;  2MH9 A;  3KP2 A;  3IL2 A;  3HOS A;  2BYV E;  4BXU A;  2GXG A;  3OOP A;  1ZRD A;  1WI9 A;  1HSJ A;  1D8J A;  3FM5 A;  5H6R A;  4B8X A;  2RN7 A;  5LHH A;  2J5O A;  5FLX Z;  3I0T A;  2HKX A;  2CWE A;  1PUE E;  1T0F A;  2M5W A;  1XSV A;  3EUH A;  1T98 A;  3SHF A;  2DK8 A;  1R1T A;  3P9I A;  4OIN F;  3M9A A;  1HBX G;  3HTU A;  4R79 A;  5JFR A;  3W6J B;  1HW1 A;  2E7X A;  2EA2 A;  1TQP A;  4HBL A;  1I27 A;  3HIF A;  1OPC A;  1HKT A;  5E17 F;  1S29 A;  4UXN A;  1W5T A;  1DPU A;  2HTJ A;  3ZQ7 A;  1U5T B;  4O3M A;  1TNT A;  4B09 A;  2CSO A;  1EH6 A;  2FBK A;  3TKY A;  3IC7 A;  1G3Y A;  1ZRF A;  2BEO A;  2V1U A;  2GQQ A;  4HX4 A;  4LLN A;  4LK1 F;  1YYV A;  2FXA A;  1FWZ A;  4L18 B;  3TDU C;  1Z6R A;  3K9T A;  2LNB A;  3GFM A;  3IWF A;  1FLI A;  4KNY A;  1S7O A;  2DTR A;  3M8E A;  5LHG A;  2CW0 F;  3WE2 A;  3F22 A;  2HQR A;  3WTZ A;  1VTN C;  5ILV A;  5HDK A;  2KIU A;  5HS7 A;  4WXC A;  3F6O A;  2CO5 A;  1HXD A;  4EMS A;  4BQA A;  1L0O C;  1TBX A;  1QZY A;  3J81 K;  1FNN A;  1IXR C;  2MLK A;  3R0A A;  2JRT A;  1RI7 A;  2P5V A;  4RGU A;  1B6A A;  1LEB A;  1S7A A;  1LVA A;  4UVC A;  4AIH A;  3QPT A;  1OYI A;  3DEU A;  3FXR A;  2M8E A;  2ESN A;  4KIF A;  3U2R A;  1BBY A;  4HYE A;  3ML6 A;  5HLG A;  1BOA A;  3LA7 A;  4HF2 A;  4FX4 A;  5HS8 A;  5CVI A;  5D4S A;  2DPU A;  1RNL A;  2A6E F;  3VFZ A;  2EJR A;  1XMK A;  1FSH A;  3F72 A;  1IZ1 A;  1LEA A;  4LK0 F;  2VC1 A;  3LQQ A;  5DD4 A;  2PMU A;  3DV8 A;  3L2C A;  2RV8 A;  4HF0 A;  1SAX A;  4E70 A;  1WKM A;  3HRM A;  4MHG A;  2PN6 A;  3F21 A;  5ED4 A;  2VON A;  3RKY A;  3ZP5 A;  1O7F A;  5L3G A;  4S04 A;  1ONV A;  2D1V A;  1B9M A;  5DD8 A;  2O6G E;  2FOK A;  1SFU A;  3WU1 B;  5DUK A;  1BI0 A;  5ILS A;  1XN7 A;  2DPD A;  1ZYR F;  2C6Y A;  5CVJ A;  1R5G A;  4A12 A;  3V8K A;  2XHK A;  6PAX A;  1IF1 A;  5BMZ A;  2PBI A;  2O3F A;  2BBY A;  1YIO A;  1TNS A;  2Z5U A;  2QM3 A;  3TO6 A;  1UFM A;  3MWM A;  4YFN F;  3SZP A;  4HW0 A;  2BE5 F;  3ECH A;  3L9F A;  1U3E M;  4P96 A;  5DV5 A;  1XD7 A;  3QP5 A;  4WF2 A;  1JGS A;  3KEQ A;  2KJC A;  5TRD A;  5ICF A;  3KE2 A;  2QBY A;  3GW2 A;  1U2W A;  2GA1 A;  3JAM K;  2COM A;  2EB7 A;  2JPB A;  5IT9 Z;  4RB3 C;  5D5X B;  1XSX A;  2CG4 A;  1XGN A;  2ZO4 A;  1MZB A;  1XDU A;  3IRQ A;  2P8T A;  4JK1 X;  4I0A A;  5FLX K;  2ZJ2 A;  3P7N A;  3TQN A;  1SD6 A;  2O03 A;  2YPR A;  4IF4 A;  3NEU A;  1BC7 C;  2BGC A;  2LF8 A;  4ZZD A;  1X3U A;  4O5V A;  3I59 A;  2R7F A;  3WTY C;  1NHA A;  1P6R A;  1DDN A;  1AOY A;  3RDI A;  2RKH A;  5H6Q A;  3BOQ A;  2CFX A;  3MEX A;  4IVN A;  2EFN A;  4HQM A;  3FZV A;  4UV9 A;  2DW4 A;  1IXC A;  3ELK A;  5F6F A;  2FQ3 A;  3GEZ A;  3D0S A;  2GWR A;  3C18 A;  1FOK A;  3BRO A;  2MC3 A;  4BH9 A;  4EJO A;  3WGH A;  4MTD A;  2DAO A;  1KU7 A;  2DK5 A;  2YU3 A;  3COA C;  1OKR A;  4Q48 A;  2JZY A;  1CF7 B;  5K5Q A;  2EWN A;  1ON2 A;  4RGS A;  3WGG A;  3ZMZ A;  1QQI A;  1MKM A;  2A6H F;  1CF7 A;  1G3W A;  4ETS A;  5DEQ A;  1SFX A;  1PDN C;  2AS5 F;  5L3E A;  5DDG A;  1FSE A;  4KIC A;  4U0V A;  3DPT A;  1RUN A;  4LG0 A;  3U9G A;  1HKQ A;  1SD5 A;  2E7W A;  1G3S A;  3KZZ A;  3K69 A;  3KFW X;  3QPH A;  2NS0 A;  1D3Y A;  4EM1 A;  1U78 A;  4P9U A;  2LKP A;  4RB2 C;  1JHH A;  1PP8 F;  3LQR A;  2FU4 A;  3T8T A;  2HS5 A;  4R8H A;  2Q2E A;  1HW5 A;  2VXZ A;  4KDP A;  2UXN A;  2QZ8 A;  5L3C A;  2PEX A;  2ZCW A;  1G6N A;  1WQ2 A;  2WC2 A;  3JTG A;  5A2Q K;  3I53 A;  1T39 A;  1GHC A;  2OZ6 A;  3CUO A;  3Q9S A;  1STZ A;  4EM0 B;  4M72 A;  2ZME A;  4LB6 B;  2UWM A;  4U0Y A;  3C1D A;  3DQV C;  1REP C;  1IN8 A;  3KLN A;  3CTA A;  2J5P A;  3K0L A;  3CUQ C;  1PP7 U;  4L9J A;  1IRF A;  2IW5 A;  5LBQ A;  2A68 F;  1RUO A;  1ON1 A;  2HGC A;  1Z7U A;  5ICE A;  1HW2 A;  4BHP A;  2XAG A;  5FB2 A;  2ISY A;  1XGS A;  3E5U A;  3B02 A;  4I7H A;  3N4M A;  4G6Q A;  4UHT A;  1I6X A;  1TQM A;  4DQ2 A;  2VOO A;  4UNO A;  1O3R A;  4KT5 C;  4JBA A;  1H9G A;  5IT3 A;  2HEO A;  3WG9 A;  3VOE A;  3SZT A;  1ZLJ A;  2PJP A;  1BM9 A;  4M6X A;  4YG2 F;  3F8F A;  1MD0 A;  4G9Y A;  2XAH A;  3F8M A;  1YW7 A;  1W7P A;  4WX9 A;  3GLX A;  4OIO F;  4ENK A;  3WU0 A;  1RIO H;  3OV8 A;  3WTT C;  2BV6 A;  4NHJ A;  1F1Z A;  3T1B A;  1I1S A;  4KIB A;  5IT9 K;  4TV7 A;  2UZK A;  1Z6T A;  3R60 A;  5J8C A;  1IUY A;  5K1Y A;  4CXF A; 
#chains in the Genus database with same CATH topology
 2CS3 A;  1IDY A;  2P6S A;  4DNC A;  2DA6 A;  2JMW A;  5F04 A;  4OIP F;  1ODD A;  3LST A;  4XLH A;  2HVQ A;  3H5A A;  1VQO I;  3HHG A;  3GZ5 A;  3QYF A;  5L3D A;  1OQY A;  5FGM A;  3I4P A;  4MTE A;  2Y0M A;  2F5C A;  1X1A A;  4A3G J;  3C3W A;  1D8K A;  2L54 A;  3SEQ A;  1YRN B;  1IV8 A;  2FX0 A;  2ZXJ A;  4HG2 A;  4PJN A;  4L5I A;  5FFX A;  1HDP A;  2EBI A;  2R5Y B;  4BXF A;  4Y4R A;  1QA6 A;  2LOO A;  1USS A;  1ACI A;  2L9R A;  4U7D A;  4YFK F;  4PFP A;  3T5X A;  1OCP A;  3DKY A;  4E7J A;  2G7H A;  1YFH A;  1WFX A;  5JLW A;  2Y30 A;  1YRN A;  3CCL I;  2P5L C;  2M7B A;  3W6K B;  4BNC A;  4DZP A;  4OOI A;  2IEK A;  2ZC2 A;  2Y75 A;  5BPD A;  3MVP A;  2XPV A;  2FUG 2;  4ESB A;  2IXS A;  2F5F A;  2EIK H;  2GA2 A;  3OR2 C;  4UUS A;  4HZF A;  1J0R A;  1UMQ A;  1MIJ A;  4LIU A;  3IHU A;  1Z3Y A;  2W25 A;  1ZN2 A;  4PUS A;  1T38 A;  3FXJ A;  4OAY A;  2BXY A;  2KRC A;  1V4R A;  2JVH A;  1WJ5 A;  2IA2 A;  2CYY A;  3E7L A;  4E7I A;  1V5F A;  2NS8 A;  2P81 A;  1R49 A;  3AKZ A;  1Y1V J;  4F3Q A;  2XUB A;  4ENN A;  1NK2 P;  1Z1D A;  2IS6 A;  2VBW A;  4A2U A;  4XOR A;  2Z99 A;  3QRF F;  4D5F A;  1O3T A;  2M3A A;  3OWT A;  2XVC A;  4FT8 A;  1D5V A;  1D0Z A;  2X9D A;  2JPC A;  1TWC J;  2WTE A;  1GXP A;  3MZH A;  4DJA A;  5JVT A;  4M3E A;  4XLP F;  3E6C C;  2CJJ A;  1U8R A;  1ERD A;  1Y0N A;  4GYG A;  4BKX A;  4M71 A;  3BZC A;  3J7A O;  3AG2 H;  2HDD A;  1BN5 A;  3DFG A;  4EJT A;  5E1Z B;  5ICG A;  4YEJ A;  3F0C A;  1DPR A;  1Z21 A;  3IUO A;  4IZZ A;  2ZB9 A;  1W5S A;  3SEZ A;  3LSI A;  2BHZ A;  2EV0 A;  2MH2 A;  1KYW A;  3HOU J;  1VQP I;  1E3O C;  3PJR A;  4N9I A;  4L0Z B;  2DQR A;  3BTC A;  1GLN A;  3EDP A;  4XSZ F;  2I10 A;  2HPI A;  3OYB A;  3EUH C;  4GYI A;  5LRR A;  4QLC U;  3G73 A;  1G59 A;  5TJJ A;  1RZ4 A;  4ANJ A;  3I56 I;  2YR2 A;  2JSC A;  1SVO A;  1PVE A;  2ZFW A;  3C2H A;  1RRJ A;  3QP6 A;  3H3Z A;  2CV1 A;  4PGH A;  5F64 A;  2G7U A;  2Y2Z A;  3H9G A;  2IS2 A;  1P9Q C;  4C30 A;  3ZOB A;  1J9I A;  3K70 D;  1D5Y A;  4LOC A;  2W57 A;  5J4V A;  5E3O A;  2O8X A;  2Z1D A;  2H27 A;  2H6B A;  3OYJ A;  3P5J A;  3KET A;  4RB0 A;  2FOW A;  2XAS A;  3JW4 A;  5IOY A;  4RGX A;  1D1C A;  4OIQ F;  1IO2 A;  4J00 A;  1UHW A;  3PQK A;  1V55 H;  3RPU A;  1W0U A;  3VWB A;  4R1H A;  5CVV A;  1YJ9 I;  1IN6 A;  5D6F A;  2L2O A;  4DBR A;  2XSJ C;  4M3G A;  3S32 A;  2D5V A;  2F4M B;  1CGP A;  3JR9 A;  2LRE A;  1SD4 A;  3A0H C;  1LUJ B;  4HF1 A;  1K83 J;  2X85 A;  5KVR A;  3WHC A;  3WGI A;  2L4M A;  4M74 A;  3GXO A;  3EQL F;  3L09 A;  2HR3 A;  1ZLK A;  3HC7 A;  2A5Y B;  3AL0 B;  2ECB A;  4XBF A;  3CC2 I;  2FBI A;  3BDD A;  3KP3 A;  4M6Y A;  5J1U A;  5J4Y A;  2NVU B;  1W36 D;  1AU7 A;  1IRZ A;  4Y7N J;  3RKW A;  1U5T C;  4M9X A;  3QYB A;  3PO2 J;  4ZC3 A;  2L01 A;  4L5E A;  5GAD J;  1VQ8 I;  3L2V A;  3V4G A;  2HKO A;  4YIF A;  1ETQ A;  2H09 A;  1V3F A;  4H4K C;  2XAQ A;  1FT9 A;  4HA8 A;  4AD9 A;  1X19 A;  1Z77 A;  3ZQG A;  5LHI A;  1OYY A;  1S3J A;  3MKY B;  4FHT A;  1OCC H;  2XRN A;  2HOT A;  4II3 A;  1B4A A;  3OYE A;  4B48 A;  4A3I J;  4WWC A;  3CP2 A;  2M30 A;  1ZHF A;  3DEW A;  1T2K A;  1XSD A;  2M8G X;  2DDB A;  3BR3 A;  2WAQ N;  4CZC A;  4B44 A;  2LKX A;  1P4W A;  4G12 A;  4AIK A;  2P5K A;  4XIC A;  3CCR I;  2Z9O A;  5JI6 A;  4WK8 F;  3FIS A;  1B72 A;  5DCF A;  4BBS J;  2K02 A;  3HBL A;  3S1M J;  1HC8 A;  2LF7 A;  2D1H A;  2YX7 A;  1VND A;  1I50 J;  1R58 A;  1ZR4 A;  2YX4 A;  1LFP A;  2R7D A;  1OR7 A;  4PJ0 C;  4ZZL A;  1Y8Q B;  2KRF A;  4KT6 A;  4QIW N;  4O6J A;  2E36 A;  5E20 A;  3LSR A;  2EIL H;  3KLO A;  3I9V 2;  1ZQ3 P;  2DFE A;  3IP4 B;  2ME6 A;  2DA4 A;  4B43 A;  4C2U A;  3CLO A;  2W24 A;  2LY9 A;  3KYC B;  3O2P E;  3OYD A;  3NWT A;  1YE9 A;  4Q5S F;  3CJR B;  5E1W A;  3BG7 A;  3MKW B;  1FYL A;  1WSU A;  3GVA A;  1MJ9 A;  2NRA C;  1HF0 A;  2VQG A;  5F08 A;  4ABZ A;  3ONQ A;  2DO7 A;  2NAZ A;  2FE3 A;  3RTR A;  2JTV A;  4HDV A;  3HGY A;  3RPQ A;  2K4B A;  1YTY A;  1ZGA A;  2DA5 A;  5HDN A;  4GFB A;  3SQN A;  2R3S A;  1W7P D;  2BXZ A;  2XPU A;  1U9O A;  3L7W A;  4U88 A;  2ZBK A;  3ZQH A;  2KKO A;  4KMF A;  3KP4 A;  4RM3 A;  2QBY B;  1XCB A;  4I02 A;  4A3M J;  4ZYE A;  3FX3 A;  3UKG A;  1A36 A;  1R1V A;  4XKW A;  3ZR8 X;  2GXB A;  1WRJ A;  2DJN A;  4RDU A;  2JT1 A;  1YG2 A;  1TW2 A;  5D4R A;  4S05 A;  1R4N B;  3GUD A;  2HNH A;  4IRH A;  1XG1 A;  5HVQ C;  5HNF A;  5FD5 A;  2R7Z J;  2HOE A;  2Y0S A;  5D6E A;  4YRV A;  2IBD A;  1LDK B;  2LDU A;  5FKK A;  3HUG B;  2VE8 A;  4EVI A;  2XKO A;  3MQ0 A;  1ZG5 A;  5CJ9 A;  5EEG A;  4A3D J;  1N77 A;  2CW7 A;  2HQ5 A;  1R71 A;  4MGR A;  1QHH D;  2JUC A;  3HUG A;  4I98 B;  2ZJQ F;  3PUF A;  2MGQ A;  1FTT A;  4HLX A;  2JQ7 A;  1G8X A;  3BG5 A;  5IYD J;  1N25 A;  2XAJ A;  3LFK A;  3J80 Z;  3BCA A;  3GFL A;  2KZG A;  1FMW A;  3SXY A;  2VC0 A;  2A3S A;  2AXT C;  2ZFU A;  4V2F A;  2E1N A;  2BHY A;  2XRO A;  3DBR B;  5GPC A;  1XCV A;  5HLI A;  5ICC A;  3I59 B;  2HQN A;  3I58 A;  3E6D A;  3PIO F;  1RET A;  1J5Y A;  3K4M A;  3BY6 A;  3I5U A;  4UY8 I;  3ABM H;  3BG6 A;  1R00 A;  1R36 A;  3EYI A;  4DW6 A;  2GAU A;  5C4J J;  2DOF A;  5IYB J;  1A04 A;  4CZZ A;  1X4O A;  2FBH A;  3M4O J;  2YS9 A;  2DA2 A;  3HOT A;  2OU2 A;  3S2H J;  1Z05 A;  4J19 A;  3BR0 A;  1IDZ A;  5EGO B;  2R7W A;  1YIJ I;  1S8N A;  4G7H F;  1Z0X A;  3BG9 A;  4LIT A;  1FYK A;  4IOC F;  4KYW A;  3E6M A;  3HGG A;  2F2E A;  3CF2 A;  2LC2 A;  3TMO A;  4CUG A;  1HA8 A;  3FMQ A;  3JSP A;  2OA4 A;  1ZGW A;  1Y1W J;  4HDU A;  2KIQ A;  3HPH A;  4RAY A;  3BJA A;  3R0J A;  2HOS A;  1LFB A;  3KZY A;  3M1E A;  5TIS C;  2L9V A;  4ESF A;  4LJZ F;  3DPU A;  2LMD A;  2XSD C;  5E8I A;  4UB6 C;  1Y56 A;  3F8N A;  4NQW A;  3I64 A;  4A0Y A;  4CA0 A;  4FX0 A;  2NNY A;  1KQ9 A;  2EFO A;  2NXN B;  3NAR A;  3BTL A;  2VJJ A;  4BEH B;  1K78 A;  3HDD A;  2QQ9 A;  2PMZ N;  3BJ6 A;  2LY2 A;  4F7Z A;  5D8K B;  3H0G J;  1FMV A;  2LP0 A;  2EA4 A;  3H1C A;  4C2T A;  4I99 C;  2VKD A;  4G8X A;  1KZH A;  3FBI B;  2QUF A;  1X1D A;  2OD5 A;  4QSH A;  4HLY A;  1DP7 P;  4I01 A;  4BHC A;  2DMT A;  1IRG A;  4EJV A;  3G3Z A;  4L5J A;  2ZNY A;  1E3P A;  3ZCO A;  4HX7 A;  4ZYG A;  3ROU A;  2OZU A;  4E7Z A;  2MLG A;  4K2E A;  5J1Y A;  5AIQ A;  4MQ9 F;  3IKT A;  2FRH A;  3HOV J;  3W2V A;  4B3A A;  4HPQ A;  4IOA F;  2E1M C;  4Y33 A;  3GTK J;  3WG7 H;  4ZYH A;  1OJL A;  4A6E A;  2MG4 A;  1QBJ A;  4A5M A;  3HRS A;  4CCJ A;  4CHU A;  1KYZ A;  3ZXS A;  5JR3 A;  4JQF A;  4LG0 B;  3GTP J;  2EIN H;  1I3A A;  4IRI A;  3JRD A;  3F6V A;  4CYC A;  2K4J A;  3HPG A;  1GVD A;  1T95 A;  4B1R A;  4MFE A;  3ASO H;  3DXJ F;  4Y52 J;  3FDY A;  1EH7 A;  2FNP A;  3GO5 A;  4EJU A;  1POG A;  1ZK8 A;  1OFC X;  2DMU A;  3U21 A;  3T0Y A;  4MIM A;  3ESW B;  1SFO J;  2JUG A;  3ISP A;  4AC0 A;  4ESJ A;  1U8B A;  4C3H J;  2E1C A;  4L0Y B;  1X1C A;  3N05 A;  3W6V A;  1D0Y A;  4LFU A;  2LD5 A;  5AIP A;  2M9H A;  3WTV C;  1VQ6 I;  4BJ6 C;  3Q3S A;  1IN7 A;  3QU3 A;  5KHD A;  3DPL C;  5DCM A;  1GV5 A;  3O8H A;  1WJC A;  2YUS A;  4ZTF A;  4CCL A;  1UZC A;  1XDS A;  1TTY A;  1VI0 A;  3Q9V A;  5FKN A;  1FP1 D;  3EET A;  3QWL A;  1GDT A;  2QVO A;  4M9Z A;  4YFX F;  1TLH B;  3OOU A;  2HYF A;  2XF7 A;  1YLF A;  3OYN A;  2K9S A;  3ZMT A;  1OMI A;  4UUV A;  4OWR B;  4A3L J;  1W4M A;  4IJA A;  4RM2 A;  2E2I J;  4HRI A;  4BXX J;  4FAS D;  2PMH A;  2JA5 J;  4C3J J;  3GTM J;  3Q5F A;  2STT A;  1K61 A;  2VBZ A;  2ZME B;  4IHY A;  1I5Z A;  1BI1 A;  3IH4 A;  3A02 A;  4D0P A;  2HPM A;  1PUF B;  3K2A A;  3HOZ J;  5CYV A;  2E2H J;  1BR4 A;  5LFA A;  1ZGJ A;  4RS8 A;  1EA3 A;  2KRH A;  4IPA A;  4XID A;  4ZDL A;  3V7S A;  1H88 C;  1LQ1 A;  2RQP A;  5HLH A;  1ENH A;  2EFW A;  4FIS A;  1T56 A;  3K1P A;  2HDC A;  1PUF A;  1DGW Y;  4M9S A;  3RJP A;  5J8F A;  1Y0U A;  2DMN A;  2KP6 A;  3RIR A;  1C0W A;  1LDD A;  3IH3 A;  1KU9 A;  1AKH B;  4A3K J;  3A4C A;  3BLY A;  3LWF A;  2H94 A;  3A0B C;  1L3L A;  3ULQ B;  3ZGK A;  1BIA A;  3GWZ A;  3CD6 I;  3KYL A;  3ZMD A;  1UHS A;  1SFK A;  2X6Y A;  1FZP B;  2BW3 B;  2ELJ A;  1O3S A;  4IL6 C;  4P9F A;  2JA6 J;  2NVQ J;  5KNL A;  1QPM A;  2W84 A;  3NRV A;  3BPV A;  4GXO A;  5CVU A;  5B3S H;  3ZQC A;  4UB8 C;  1AKH A;  3DLL F;  3LAP A;  3TDZ C;  1F5T A;  3IAM 2;  3AG3 H;  3KCC A;  3PFI A;  4HST A;  1UHM A;  2O9L A;  1DU6 A;  1R1U A;  4XK4 A;  4XR6 A;  5FO5 A;  2PLY A;  2VOP A;  1EJ9 A;  3L2U A;  3G6E I;  2JWT A;  1GV2 A;  4XSX F;  2CUE A;  2ZSH B;  3MMY B;  3OR1 C;  5LLQ A;  3RSN A;  2KJB A;  4AWX B;  2DFF A;  3X2Q H;  2R0Q C;  3OS0 A;  4GGG A;  2NOG A;  3GTG J;  1Q1H A;  1T33 A;  2H6C A;  3DKX A;  1FYM A;  4S0H B;  2IS4 A;  1I3Q J;  1Z3X A;  5D5U B;  3CDH A;  3IWZ A;  3KYD B;  4MLO A;  1W7P B;  4IX7 A;  5LRS A;  2QSF X;  1XMA A;  2OBP A;  4ZYD A;  2R7X A;  3MFK A;  5LGN A;  2ZNZ A;  1XGM A;  1JTX A;  1ZEL A;  2VXD A;  3F23 A;  4PJL A;  1BW6 A;  2E5N A;  4EQQ A;  3HL2 A;  2Q1Z B;  3K2Z A;  2L4A A;  3FXM A;  4LLG F;  5CVR A;  2G0E A;  2HFH A;  2DTZ A;  2BY2 A;  5EZG A;  5LGU A;  4OMY A;  4HOB A;  4G6D A;  1P4X A;  4XN0 A;  5CLS A;  3V7C A;  4ASN A;  5E3M A;  1LE8 B;  2AQE A;  3OSG A;  1MBJ A;  2G9W A;  1MGT A;  3AG1 H;  2P7C B;  4CGZ A;  4I2O A;  1O3Q A;  1MJA A;  2LBF A;  3CF5 F;  2BY0 A;  1K79 A;  2DXI A;  2Y69 H;  1QNT A;  1UB9 A;  3TGN A;  3WTX C;  4I09 A;  1MDM A;  3DWL E;  3PO3 J;  3OMY A;  1AHD P;  1R7J A;  1MJB A;  4CCN A;  2HTS A;  3CP8 A;  4GCV A;  3JAM Z;  2QCO A;  2GXA A;  2P4W A;  1ZAO A;  3J80 K;  4BAC A;  4IXA A;  2ECC A;  3RZD J;  1K7A A;  4XLE A;  2JJ7 A;  3LSH A;  1KU2 A;  4MO7 A;  5GP9 A;  3BWG A;  4PDK A;  2BZT A;  4KA4 A;  4PZJ A;  1J7K A;  2GIV A;  2V1X A;  4C2M J;  3GZ6 A;  2NNN A;  1MMN A;  2K85 A;  1BIB A;  4Y17 A;  3QOP A;  1BI3 A;  3LAJ A;  3D5R C;  1RPW A;  1W5C C;  3CCM I;  2VQC A;  2DT7 B;  2X1C A;  4NB5 A;  4UVB A;  3FIW A;  4UUS B;  1JJ8 C;  2ID6 A;  5B1A H;  1YS6 A;  3IAS 2;  3VEP A;  1BJA A;  1VF9 A;  1DGR M;  4N0B A;  2LK2 A;  1R23 A;  4BU2 A;  3HRU A;  3M8F A;  5JHU A;  3JRC A;  4OIR F;  1YOV B;  2ADU A;  4Y15 A;  1F36 A;  1OCT C;  5E1X A;  3RKQ A;  5F0F A;  1KQ8 A;  2VJ5 A;  3H3U A;  1YQA A;  4E6K G;  2V6E A;  2BVL A;  5E18 F;  1YW8 A;  3PQJ A;  2KIS A;  5ILU A;  2KQR A;  3ABU A;  3PIP F;  2CUF A;  3MAJ A;  3ZMU A;  1LDJ A;  3DF8 A;  4M73 A;  3I54 A;  4XLN F;  2PG4 A;  4BE0 A;  1R6R A;  3HOY J;  2F4I A;  2ISZ A;  3SDB A;  1F4K A;  2WV0 A;  3DU5 A;  1R9T J;  1FOW A;  3S93 A;  1LE8 A;  2E2J J;  4KIT B;  2Z33 A;  2QWW A;  3C2B A;  1B9N A;  2ACJ A;  5D5V B;  1AA7 A;  3HSR A;  3I71 A;  3TOB A;  3CJN A;  3PNT A;  1Y39 A;  2GLO A;  2JA7 J;  5E3L A;  4CO8 A;  2H8R A;  5K5O A;  1RKW A;  5K5R A;  3S14 J;  2VQH A;  3C7J A;  1N78 A;  4RLF A;  3GX4 X;  4BAY A;  4PGG A;  5M3M J;  3G4S I;  1U5T A;  2L5Q A;  3HRT A;  5DM7 F;  2FF4 A;  3GCM A;  2O0Y A;  3DKW A;  4J01 A;  2X4H A;  3PSF A;  1QHG A;  3OYI A;  3EUA A;  5C4X J;  3RI4 A;  3QYE A;  4A6D A;  2TCT A;  5KK1 A;  5EF6 A;  1T0F C;  2ID3 A;  1IC8 A;  3PM1 A;  3DP7 A;  3VYT B;  1TW3 A;  2IJL A;  3BT9 A;  2ELH A;  1UCR A;  2DI3 A;  3TO9 A;  1MMA A;  4U87 A;  5B66 C;  1D0X A;  4E7K A;  1NTC A;  1I39 A;  3QOE A;  1JXS A;  4LD5 A;  2I5U A;  4LMY A;  4GRI A;  4L9V A;  2JA8 J;  4HSR A;  2V9P A;  5BOX A;  3GFJ A;  4N4N B;  1ZTR A;  2WWY A;  4RMN A;  4YII A;  2W85 A;  2VT2 A;  1X58 A;  2RRE A;  2R7R A;  4WXH A;  1BI2 A;  3O6B B;  5FRM A;  1FBQ A;  1T6S A;  4CYD A;  1UST A;  2XPW A;  2R7V A;  2L7F P;  3FKJ A;  2V79 A;  4GO1 A;  3KP7 A;  1ZRC A;  1YHQ I;  1B8I B;  1TQI A;  3S3N A;  4AVP A;  2DMQ A;  3EUK L;  2PQ8 A;  3V8L A;  4ITV A;  4EGY A;  1WPK A;  2W82 A;  2R92 J;  2ETH A;  2K9Q A;  2MFZ A;  1HQC A;  4Y3O A;  2R7O A;  2M0M A;  1ULY A;  2OPT A;  3G1M A;  3LSG A;  3RKX A;  3GTL J;  3NWS A;  2HYG D;  1FOX A;  3E6B A;  1S7E A;  3WE3 A;  2IT0 A;  3S3M A;  4KFC A;  3MZY A;  2W4S A;  2E1O A;  3VOD A;  1B8I A;  2Y31 A;  1B59 A;  5J1R A;  1OLT A;  2X6O A;  4AM3 A;  4ENJ A;  2R7S A;  2FSW A;  2M87 A;  4AYB N;  4MQV A;  3F3X A;  2TDX A;  4BQO A;  5HLT A;  1D1B A;  2IP2 A;  2M4K A;  3BP8 A;  2XAU A;  2COB A;  3JCU C;  5EG0 A;  3LSP A;  1V54 H;  3V7R A;  5D8L B;  4LLL A;  1ZG3 A;  2D2W A;  3DTE A;  2DLL A;  4F93 B;  2IAI A;  3TED A;  2L3D A;  1EV7 A;  5EYR A;  1IW7 F;  2EZK A;  2AQF A;  5HOO A;  2DQL A;  1JUS A;  3FKI J;  1DUX C;  1FEX A;  2Y48 A;  5LGT A;  2EK5 A;  2I8D A;  4HV5 A;  1B72 B;  3HEF A;  4QWQ A;  3WOD F;  4A5N A;  4BQQ A;  1XGO A;  5A2Q Z;  3JRI A;  4DIQ A;  2DU9 A;  5HOD A;  2IA0 A;  2A69 F;  1XMX A;  4BHB A;  4IHS A;  2ELK A;  3O8G A;  5GAG J;  2HXO A;  2PFB A;  4DOZ A;  4WCG A;  4HV6 A;  4ON0 A;  1A35 A;  1A5J A;  5FD6 A;  2CMP A;  2Y9Z A;  2QYO A;  1P2F A;  3HTS B;  1HKS A;  2WB1 N;  4XRS G;  2P7V B;  5L3B A;  2TRT A;  3LSJ A;  1WJD A;  5GTH C;  2VIX A;  1QZZ A;  1YX5 A;  3FM3 A;  3S1R J;  1WZ2 A;  1E2X A;  4NBQ A;  2DBB A;  2K86 A;  4BJ5 C;  1UG2 A;  3DTK A;  4L9T A;  2DT5 A;  2R5Z A;  3R4K A;  1YX3 A;  2D45 A;  2VQL A;  4L9N A;  2X1D A;  4XON A;  1GUU A;  4IHT A;  3HSE A;  1MMS A;  1MNE A;  2HZT A;  1EF4 A;  3JRH A;  4DBQ A;  2RDP A;  1IV6 A;  2UXX A;  2KT0 A;  2AHQ A;  2RQQ A;  4CIC A;  3GME A;  1ZG1 A;  1VQM I;  4DGW B;  2NVT J;  4ZDO A;  2V1D A;  2XRL A;  4Q4Z F;  3S1N J;  1MSE C;  3JRE A;  2VLA A;  4EJW A;  4D7N A;  2XAF A;  1WJF A;  1P4A A;  2O8K A;  2KIF A;  3V8J A;  1B1B A;  5LEJ A;  2K9N A;  1SFE A;  3SZG A;  2MD5 A;  5BS6 A;  3ECO A;  2MBF A;  3LL7 A;  4HNT A;  1RES A;  4II2 A;  1RR7 A;  4JP0 A;  2ESH A;  5HS9 A;  1DQU A;  2LR8 A;  4KIG A;  1BR2 A;  3N97 A;  1GT0 C;  3JSO A;  3JTH A;  3ZN1 A;  2R93 J;  3D5S C;  1OYW A;  3FXU A;  4BQN A;  4DYC A;  3VSL A;  5K7Z A;  2RGV A;  1ORK A;  2XB0 X;  3E0J B;  3K1M A;  3WTU C;  4G94 A;  2K27 A;  3AL0 C;  1SMT A;  1J75 A;  4RGR A;  4C3I J;  1OIS A;  2VBY A;  2Q0O A;  3K4L A;  3HSF A;  4N9H A;  2OCE A;  5DTD A;  2L9N A;  5FKO A;  1FX7 A;  5KAF C;  2VUM J;  4A0X A;  3BG3 A;  5L3F A;  3B73 A;  2A61 A;  4C9Y A;  3WHB A;  1J2X A;  1KA8 A;  2K9M A;  3J7A Y;  1Z9C A;  4BBR J;  1AWC A;  1LNW A;  3GYH X;  2IGO A;  1OCZ H;  1APL C;  3RYP A;  4Y13 A;  4G7O F;  5HDG A;  4AIJ A;  2YSR A;  3ZQQ A;  4M6V A;  2V1N A;  1KGS A;  4OMZ A;  4ZJZ A;  1O4X A;  3HKZ A;  2F6C A;  2HI3 A;  2LLK A;  1SMY F;  4JX5 A;  1YW9 A;  3U1D A;  3REO A;  3TO7 A;  2E1M B;  4MNU A;  2ZJP F;  3CC4 I;  4B4C A;  2N8G A;  3RZO J;  2E34 A;  3SFZ A;  1JKQ C;  2EH3 A;  1IXS B;  2ZKZ A;  1FC3 A;  3R6S A;  1FBU A;  3MCZ A;  4D1Q A;  4A0Z A;  1X1B A;  3FF5 A;  2VOD A;  4ENM A;  2FML A;  2JRM A;  3M8J A;  2HWV A;  3QU6 A;  5GAH J;  2OTJ I;  2DOD A;  3F9K A;  5F27 A;  4KMU X;  3CC7 I;  4P55 A;  4KN7 X;  4P1W A;  3BPX A;  1P7J A;  2FEZ A;  2QLZ A;  3M07 A;  4NQW B;  4X0G A;  2X51 A;  2QQA A;  4BYY A;  2P6T A;  4A3J J;  4IRG A;  1KQ0 A;  2DA1 A;  3K4K A;  2JA2 A;  4G7Z F;  2O61 A;  2EV5 A;  1K78 B;  2CV2 A;  1S9H A;  3O3K A;  3HHH A;  2LKS A;  2XF5 A;  4F52 A;  2M45 A;  1I1G A;  3IKV A;  1SAN A;  5AON A;  3C2G A;  3H36 A;  4Z2Y A;  3P9K A;  2IS1 A;  5BQT A;  1IUF A;  3ABK H;  1MMD A;  2VE9 A;  2IPQ X;  3H0D A;  3K4N A;  3WTS C;  1K6O A;  3AAF A;  1N75 A;  1R5H A;  2QQ8 A;  3FHZ A;  3HOX J;  3L2W A;  3TL4 X;  1YO5 C;  3E3V A;  2E19 A;  2XGD A;  3E5X A;  2VT3 A;  2Z2S B;  2Z3Y A;  1BJZ A;  1FP2 A;  3A2K A;  4PCQ A;  3Q0W A;  1WWX A;  1ZAR A;  3ZQF A;  2H1L A;  2M34 A;  3A03 A;  1PJR A;  2VBX A;  1XB4 A;  3ABT A;  2OV7 A;  1H9T A;  4H0E A;  3OYC A;  3FMS A;  4X6A J;  4HX8 A;  2CQK A;  3F8C A;  4YEL A;  2X0L A;  1O7L A;  5E3N A;  2PI0 A;  1QZE A;  4N4O B;  1WH7 A;  4UVA A;  4XRS A;  3W2A A;  4OU0 A;  3BJO A;  4KN4 X;  1VQL I;  2L7K A;  1J59 A;  4XRF A;  1SD7 A;  2WAD A;  2XIG A;  4CYC B;  4EGZ A;  4I0B A;  3VYS B;  3ZQL A;  3P9C A;  3J7Z I;  2CRG A;  3OIP A;  3MD2 A;  1G4D A;  3S2W A;  1RKT A;  4M3D A;  1E3H A;  2IA1 A;  4XLA A;  4RLQ A;  3I55 I;  2MD0 A;  3CO6 C;  3CUQ B;  3DBH B;  5D5W B;  2VJ4 A;  2FNA A;  1JTY A;  2LH9 A;  2RVC A;  1I6H J;  5DCM B;  5ERI A;  2XGX A;  5LEK A;  1LJ9 A;  2OAZ A;  1HST A;  2OQR A;  2VL8 A;  1BR1 A;  4PSX A;  4XM3 A;  2F5D A;  3CUQ A;  3CCS I;  5BPI A;  4KUM A;  1FBS A;  3BQY A;  2DN0 A;  4Q47 A;  2VAS A;  3J81 Z;  1LB2 A;  1VQ5 I;  4E7H A;  1KU3 A;  3FWE A;  4U0W A;  4CCM A;  3FMR A;  1GVJ A;  2X6X A;  1YJW I;  4MEX F;  3Q0U A;  3BTJ A;  3G1L A;  1G3T A;  2KHM A;  2LYC A;  1GXQ A;  3AG4 H;  2RNJ A;  5J6X A;  2A5W A;  4CCO A;  3QPS A;  2VN2 A;  3E97 A;  3K1N A;  2KIM A;  5EEA A;  1ZRE A;  3PL8 A;  3VSK A;  1M1E B;  5DM6 F;  1Z91 A;  3HYI A;  4LG3 A;  1V5G A;  4WXD A;  2L02 A;  2FA5 A;  3CO7 C;  5F1R A;  2E5Z A;  3D5L A;  2DFI A;  4ZDP A;  2V6C A;  3ZMS A;  5FKM A;  1QGP A;  1TWF J;  4MEY F;  3WTW C;  1P92 A;  2STW A;  1WJB A;  3J7Y J;  1QVU A;  4EV0 A;  5E8G A;  5EEH A;  1VQN I;  1IN4 A;  2HQA A;  3FXL A;  2RC4 A;  4XN3 A;  3CMA I;  4ZH4 F;  3IRR A;  3L00 A;  2WBM A;  2XKP A;  1QO0 D;  4A3B J;  1UEL B;  3H92 A;  3GFI A;  3K4C A;  1JE8 A;  2HOA A;  1MMG A;  3FK7 A;  1E0E A;  3DLA A;  2DMP A;  3ZMV A;  4IQJ A;  1FY7 A;  1WJE A;  2XF6 A;  3KP5 A;  3ZPL A;  4U7B A;  4RAZ A;  1JUM A;  5H20 A;  3F8B A;  2KZV A;  4HQE A;  1SEU A;  2L9S A;  3LA3 A;  5FJ8 J;  2XV4 S;  2W48 A;  3TW7 A;  4ZTJ A;  3T8R A;  2IRF G;  1MH4 A;  4FE4 A;  4FTH A;  2MA3 A;  1D1A A;  1JHF A;  1K4T A;  3QAH A;  4BUP A;  2K7L A;  4MFD A;  1JT6 A;  5M5Y J;  1UJ8 A;  1R22 A;  5B1B H;  3R61 A;  1TWA J;  1ETV A;  3S1Q J;  5FLM J;  1RC9 A;  2H1K A;  4P5O A;  2K5C A;  1K6Y A;  5DUI A;  3CCE I;  2OQG A;  1H0M A;  2F5E A;  3TW6 A;  3NQO A;  3EYY A;  1OCR H;  3K70 C;  3CDL A;  1O57 A;  4RAG A;  2EZI A;  2Y0S N;  4LGW A;  2B0L A;  2Q8K A;  1U6G A;  4RB1 A;  2DYR H;  1YS7 A;  3LOC A;  1HOM A;  3OYK A;  3E5Q A;  3S2D J;  2AXL A;  2XC7 A;  4E7S A;  3SJM A;  1OCO H;  1FIP A;  3LA2 A;  1ZH5 A;  3A01 B;  1F9N A;  2QQB A;  3H9J A;  1PYV A;  5M5W J;  2WAQ A;  1TT0 A;  1S6L A;  2A07 F;  2QKL B;  2EFP A;  2LBF B;  4EM2 A;  3VB2 A;  3KEY A;  3RYR A;  5DYM A;  1FPQ A;  2DOE A;  4RA2 A;  2R7U A;  1W36 C;  3A01 A;  2M1B A;  1MDM B;  3TOA A;  2HXI A;  1BC8 C;  4CDG A;  2IVM A;  3Q0V A;  3KP6 A;  3RCO A;  3MN2 A;  1T08 B;  5EJC A;  4I76 A;  4LB5 A;  3M7G A;  2ZME C;  3S17 J;  1ZR2 A;  1HDD C;  4HAM A;  5E79 C;  3E1S A;  4JOM A;  3CZ6 A;  1TC3 C;  5FFZ A;  1XC5 A;  2LSO A;  2V9V A;  3DEE A;  3HB9 A;  2A6T A;  3FXQ A;  5IPA A;  1EH8 A;  2GIZ A;  2UUZ A;  3CES A;  4UV8 A;  2GZW A;  3W2W A;  1TL8 A;  4E7L A;  2FMY A;  5M3F J;  3KEO A;  2XGC A;  3KZI C;  2NYX A;  1E17 A;  2QEN A;  3BZ6 A;  5FRO A;  3GF2 A;  2EV6 A;  3H5N A;  3ZN0 A;  1IAW A;  1WGX A;  1X2M A;  5H2F C;  2K40 A;  3ERE D;  2CGP A;  3OYM A;  1IN5 A;  4NC6 A;  2EFQ A;  3VDX A;  4BY7 J;  4W1U A;  2MH9 A;  3KP2 A;  5J47 A;  3IL2 A;  3HOS A;  2BYV E;  4BXU A;  2XDV A;  5LD2 C;  2GXG A;  2QF7 A;  3OOP A;  1ZRD A;  1WI9 A;  3HJE A;  1HSJ A;  5KCM A;  1D8J A;  3FM5 A;  5H6R A;  4B8X A;  2RN7 A;  3OIO A;  2EZL A;  5LHH A;  2KMU A;  1S5L C;  3QPL A;  2J5O A;  2V4J C;  4A3C J;  5FLX Z;  4A93 J;  3I0T A;  3BR6 A;  2HKX A;  2DYS H;  3LMM A;  2CWE A;  1PUE E;  1T0F A;  2M5W A;  1XSV A;  5IP9 J;  1WCM J;  3D1N I;  2DA7 A;  3H9Q A;  3EUH A;  3GLL A;  1T98 A;  3SHF A;  3CCU I;  2DK8 A;  1R1T A;  3P9I A;  5F1J A;  1SAU A;  4OIN F;  3LSM A;  3M9A A;  2HU9 A;  1HBX G;  3HTU A;  4R79 A;  4V19 K;  5JFR A;  3W6J B;  3TP3 A;  4JYK A;  1HW1 A;  1Z67 A;  4NC8 A;  2E7X A;  3DCF A;  3U1K A;  3BC8 A;  3BZK A;  1KON A;  2EA2 A;  2OUM A;  2R5Y A;  2ZXW H;  2KLO A;  1TQP A;  4HBL A;  4F55 A;  1I27 A;  3HIF A;  2NS7 A;  5J3L A;  1OPC A;  3M3Y J;  1Y6I A;  1HKT A;  3AFH A;  5C44 J;  1S29 A;  2HVR A;  4UXN A;  1W5T A;  1Z7L A;  5E17 F;  1DPU A;  3CCQ I;  4BE1 A;  3NAU A;  5FRN A;  2HTJ A;  2W1O A;  3ZQ7 A;  1W0T A;  4M3F A;  1ETW A;  3CQZ J;  3GBG A;  1FTZ A;  1YJN I;  1U5T B;  4EEF G;  2LRD A;  4NDL A;  4O3M A;  1JT0 A;  4DZJ A;  3K10 A;  3KX2 A;  1TNT A;  2FD5 A;  4B09 A;  2CSO A;  1EH6 A;  2FBK A;  4XOP A;  3OYL A;  3SFI A;  3TKY A;  1CQT A;  3IC7 A;  1NG7 A;  1G3Y A;  1ZRF A;  2BEO A;  1SVM A;  1NK3 P;  2V1U A;  1X2N A;  1ITY A;  4XLF A;  2GQQ A;  4HX4 A;  2GOX B;  4NUB A;  4LLN A;  3G1O A;  4LK1 F;  5CQE A;  2ME0 A;  3A1Y A;  5JHF A;  1YYV A;  2RAE A;  2FXA A;  1FWZ A;  2ZJR F;  4L18 B;  3TDU C;  1F43 A;  1Z6R A;  1ZKG A;  3K9T A;  2LNB A;  3GTQ J;  3GFM A;  2CFO A;  2CQ7 A;  2BY1 A;  2DOA A;  3IWF A;  3K4B A;  4KNY A;  1S7O A;  1FLI A;  4G6T B;  2DTR A;  2V26 A;  4XLC A;  3M8E A;  5LHG A;  3L2Q A;  2LG4 A;  4XKC A;  2CW0 F;  3WE2 A;  1ETO A;  3F22 A;  1QU3 A;  2HQR A;  3WTZ A;  2PMZ A;  5HNH A;  5ILV A;  1VTN C;  5HDK A;  1QPI A;  3PFY A;  1UAA A;  2KIU A;  5HS7 A;  4WXC A;  1G2H A;  4QPQ A;  4Z6Y A;  3F6O A;  2CO5 A;  4DYQ A;  1HXD A;  4EMS A;  4BQA A;  2MSY A;  1MNM C;  3PUB A;  3OSF A;  1W1W E;  3JRF A;  2EPF A;  4PK4 A;  1L0O C;  1TBX A;  1FOY A;  1QZY A;  3J81 K;  1FNN A;  4XRM A;  1MND A;  1IXR C;  2MLK A;  4ZYA A;  2GOM A;  4BDY A;  3R0A A;  2JRT A;  1RI7 A;  2OCC H;  5EG0 B;  2CQX A;  2P5V A;  4RGU A;  1B6A A;  3JRG A;  3KPH A;  3TP0 A;  1LEB A;  2Z16 A;  4QPO A;  1S7A A;  1LVA A;  4UVC A;  2M2E A;  4AIH A;  3S3O A;  3CJQ B;  3DU6 A;  3CDI A;  4CH7 A;  4B3X A;  3QPT A;  2W00 A;  1OYI A;  3DEU A;  1BL0 A;  1Y8R B;  3FXR A;  2LFB A;  2M8E A;  4BL0 B;  2ESN A;  1WI3 A;  4KIF A;  3S8P A;  1A6I A;  3JRA A;  3U2R A;  1BBY A;  1JKP C;  1YI2 I;  4HYE A;  3ML6 A;  3OL3 A;  5HLG A;  1BOA A;  3BR5 A;  3LA7 A;  4HF2 A;  4FX4 A;  3BCB A;  2EIM H;  5HS8 A;  3H35 A;  5CVI A;  5D4S A;  2DPU A;  4HEA 2;  1JKR C;  3DBL B;  2E35 A;  5B5E C;  1RNL A;  2A6E F;  5DS9 A;  5EZH A;  1A31 A;  3VFZ A;  1A6Q A;  2EJR A;  3CLQ A;  4LIV A;  1XMK A;  2R5Z B;  2IGK A;  2H8W A;  1NH3 A;  1FSH A;  3EPZ A;  2K3P A;  3F72 A;  1IZ1 A;  1LEA A;  4LK0 F;  2W7N A;  5J40 A;  2VC1 A;  3LQQ A;  4HNV A;  2VKV A;  5DD4 A;  2PMU A;  3DV8 A;  3L2C A;  3QQA A;  2RV8 A;  1T8I A;  4HF0 A;  3BQZ A;  2KPM A;  2HDW A;  9ANT A;  1SAX A;  4E70 A;  3VYR B;  2Y9Y A;  1WKM A;  1NG6 A;  1MW7 A;  5GAE J;  3HRM A;  4MHG A;  5FKL A;  4IHW A;  2PN6 A;  3GZN B;  4PJJ A;  4CSW A;  3F21 A;  1H89 C;  2DJI A;  1WH5 A;  5ED4 A;  2VON A;  3RKY A;  1SC7 A;  1JJ6 C;  1MH3 A;  3ZP5 A;  1MBH A;  1XPX A;  1O7F A;  1X1P A;  4X1E A;  5L3G A;  4DYR A;  3L2R A;  4S04 A;  3VPR A;  1ONV A;  2D1V A;  1B9M A;  1TWG J;  5JLX A;  5DD8 A;  2O6G E;  2FOK A;  1SFU A;  3WU1 B;  2KDO A;  4XQF A;  2QSH X;  1BA5 A;  5DUK A;  1BI0 A;  1U0J A;  2EIJ H;  3CCJ I;  5JVG F;  5ILS A;  1XN7 A;  2DPD A;  1ZYR F;  3BTI A;  2C6Y A;  5CVJ A;  3RQ4 A;  2UV1 A;  1R5G A;  4A12 A;  3V8K A;  2XHK A;  6PAX A;  1IF1 A;  3K4J A;  5BMZ A;  2PBI A;  4A3E J;  2O3F A;  1DP3 A;  2BBY A;  1YIO A;  4FE7 A;  1TNS A;  1X3W B;  1ETX A;  2JSP A;  1EKE A;  2Z5U A;  2QM3 A;  3TO6 A;  4XMY A;  2A05 A;  1UFM A;  3ERM A;  2MW8 A;  4E4H A;  4QTR A;  3MWM A;  4YFN F;  1RR8 C;  3SZP A;  4HW0 A;  2BE5 F;  3ECH A;  3L9F A;  4BDZ A;  1U3E M;  2HZD A;  4P96 A;  1Q1V A;  5DV5 A;  1XD7 A;  2ZSI B;  3QP5 A;  4WF2 A;  1JGS A;  4UUT A;  2DFH A;  2X48 A;  1IG7 A;  3CME I;  1TZL A;  3OYH A;  3MKL A;  3KEQ A;  4FCY A;  2KJC A;  2WA0 A;  5TRD A;  2BVM A;  5ICF A;  3KE2 A;  4BJT A;  2QBY A;  3GW2 A;  4XNF A;  1U2W A;  2GA1 A;  3JAM K;  3SDG A;  2COM A;  2EB7 A;  5IP7 J;  2JPB A;  5IT9 Z;  4RB3 C;  5D5X B;  4F91 B;  4BY1 J;  1VQ7 I;  1LVK A;  3KIO A;  1OR7 C;  4RAF A;  3HOW J;  3UR3 C;  2VJI A;  1XSX A;  2CG4 A;  1FIA A;  2L7Z A;  4I6Z A;  1XGN A;  3I3L A;  2B7E A;  2CQN A;  5M5X J;  2ZO4 A;  5CPR B;  1MZB A;  3MKZ A;  1XDU A;  3IRQ A;  1P7I A;  3CCV I;  2P8T A;  2BOL A;  4JK1 X;  1HCR A;  2L0K A;  4I0A A;  5FLX K;  2ZJ2 A;  2K9L A;  5GTI C;  3P7N A;  3L1P A;  3TQN A;  1LKX A;  2F5V A;  1IRX A;  1SD6 A;  3ASN H;  2O03 A;  2NVY J;  4W97 A;  2QA4 I;  4KJZ A;  2CUJ A;  1S72 I;  2YPR A;  3MZ8 A;  4IF4 A;  3NEU A;  1BC7 C;  1SVL A;  2MAB A;  3S15 J;  2BGC A;  2LF8 A;  4FQG A;  4ZZD A;  1X3U A;  4O5V A;  3I59 A;  5IY5 H;  2R7F A;  3WTY C;  3FHN A;  1NHA A;  4IEJ A;  5CQG A;  2NOJ B;  3W3C A;  1MBG A;  2PX9 A;  1P6R A;  2EQR A;  1DDN A;  4D7M A;  1AOY A;  1XTA A;  1VQ4 I;  3RDI A;  2RKH A;  2KDZ A;  4NC7 A;  1JI8 A;  2CU7 A;  2ICW G;  5TGT A;  1VZ0 A;  5H6Q A;  2QEX I;  3RQI A;  3BOQ A;  4KIS A;  5EGO A;  3ZQI A;  2CFX A;  1U9N A;  3MEX A;  3WU2 C;  2V9K A;  4IVN A;  3V42 A;  2F4O B;  1HLV A;  5K7H A;  5EDN A;  2EFN A;  4HQM A;  2QSG X;  1X3Z B;  3FZV A;  2DCE A;  2CUZ A;  2JK3 A;  4UV9 A;  2FQ4 A;  3FXO A;  5IOZ A;  2DW4 A;  5FLV A;  1IXC A;  3ELK A;  5F6F A;  2FQ3 A;  2QGU A;  5F0C A;  2R7Q A;  1LPQ A;  2R7T A;  3FK6 A;  4BS9 A;  2GBY A;  3GEZ A;  4PSW A;  3TBI A;  3D0S A;  2GWR A;  3C18 A;  1FOK A;  3BRO A;  2MC3 A;  4D5C A;  5IP6 A;  2XGE A;  4BH9 A;  2HVS A;  2LY1 A;  2CH0 A;  4EJO A;  3WGH A;  4MTD A;  2DAO A;  3M1C A;  1KU7 A;  2DK5 A;  4GDF A;  4BEH A;  2VKE A;  2YU3 A;  3COA C;  1OKR A;  2CW8 A;  4Q48 A;  3OL4 A;  1WVR A;  2JZY A;  2O7O A;  5K5Q A;  1CF7 B;  2EWN A;  1ON2 A;  2EZH A;  4RGS A;  3WGG A;  3ZMZ A;  1QQI A;  4PFO A;  4JX6 A;  2AO9 A;  1MKM A;  2IGN A;  2V7F A;  3CCY A;  3LNQ A;  5CKT A;  3JRB A;  2A6H F;  1QRY A;  5GPA A;  1WJA A;  3H3V K;  1CF7 A;  2DT6 A;  1G3W A;  4ETS A;  5DEQ A;  1SFX A;  3DTI A;  1BOB A;  2JN6 A;  1JUP A;  2R4G A;  1PDN C;  2AS5 F;  3OS1 A;  4YIR X;  2WV1 A;  3HXL A;  2CQQ A;  1LFU P;  1UG0 A;  5L3E A;  5DDG A;  1FSE A;  1MBE A;  3LFU A;  2PJR B;  3IH2 A;  3BR2 A;  4KIC A;  3RPU D;  2X1E A;  4U0V A;  2F48 A;  2B9S A;  3DPT A;  2BY3 A;  1RUN A;  4LG0 A;  3U9G A;  3G2B A;  2L7M P;  2P0W A;  1IJW C;  3B6A A;  1HKQ A;  1SD5 A;  1IGN A;  2E7W A;  1G3S A;  3KZZ A;  2Q2E B;  3K69 A;  4OAZ A;  2PJR A;  1R4M B;  2LVS A;  2O5R A;  3KFW X;  3QPH A;  2NS0 A;  3S16 J;  1D3Y A;  4XKV A;  4EM1 A;  1U78 A;  4P9U A;  1MBK A;  2LKP A;  2WY7 Q;  4RB2 C;  1JHH A;  1PP8 F;  1WHU A;  3LQR A;  2FU4 A;  3OY9 A;  2VKH A;  3T8T A;  4AUX A;  2HS5 A;  3I4N J;  4R8H A;  4EAT A;  2Q2E A;  3HM5 A;  1HW5 A;  2VXZ A;  2OTL I;  5K7F A;  1XS9 A;  4IQ4 A;  3OYA A;  4KDP A;  3I4M J;  2GM4 A;  4XOT A;  2UXN A;  1TWH J;  2QZ8 A;  5L3C A;  1QVT A;  2PEX A;  2ZCW A;  2HYJ A;  5BNG A;  1G6N A;  1WQ2 A;  2WC2 A;  3K6G A;  4F92 B;  3JTG A;  5A2Q K;  1XX5 A;  3I53 A;  4XKB A;  1T39 A;  1GHC A;  3HG9 A;  4IHV A;  2LTP A;  3PNV A;  2OZ6 A;  2FJ1 A;  3CUO A;  2CV0 A;  3Q9S A;  3OIQ A;  5IYC J;  2MYS A;  1FJL A;  4AID A;  1STZ A;  4EM0 B;  4M72 A;  2ZME A;  4LB6 B;  3GTO J;  2WAF A;  2M7A A;  2VPL A;  4PJM A;  3FXK A;  2UWM A;  3IV5 A;  1YIT I;  4U0Y A;  2NVX J;  3UNG C;  3C1D A;  3PSI A;  3LSK A;  1MSF C;  3DQV C;  4AVZ A;  2DA3 A;  1REP C;  1IN8 A;  2M0C A;  3VYU B;  4IHX A;  3KLN A;  3CTA A;  2ZXH A;  4AYB A;  1R5I D;  2J5P A;  3PNY A;  3K0L A;  3G71 I;  4CCK A;  3ZRG A;  3CUQ C;  1MBF A;  1PP7 U;  2E71 A;  2WY8 Q;  4L9J A;  1IRF A;  2IW5 A;  4XL9 A;  2ZXI A;  1ETK A;  2A68 F;  2RNG A;  5LBQ A;  1RUO A;  1ON1 A;  1X4P A;  3QOD A;  2HGC A;  5F0H A;  1Z7U A;  5ICE A;  2VI6 A;  4HNU A;  1HW2 A;  2BW3 A;  4BHP A;  2XAG A;  5C3E J;  1ETY A;  1DU0 A;  5FB2 A;  2ISY A;  1XGS A;  2X6W A;  3OYG A;  1H8A C;  2OJE D;  1VQ9 I;  2OC6 A;  3E5U A;  3B02 A;  4I7H A;  3N4M A;  3H5R A;  3CMM A;  4G6Q A;  1K4S A;  4UHT A;  1I6X A;  4JX4 A;  1TQM A;  4DQ2 A;  1TP4 A;  1TT5 B;  2OF7 A;  2KFD A;  3OYF A;  2VOO A;  2E60 A;  4UNO A;  1O3R A;  4IO9 F;  4AU7 A;  4KT5 C;  1JGG A;  2QKM B;  4JBA A;  1H9G A;  4RBO A;  5IT3 A;  2IGM A;  2WB1 A;  2HEO A;  3WG9 A;  3VOE A;  3SZT A;  1ZLJ A;  2PJP A;  2KL4 A;  3HKZ N;  4IKF A;  1BM9 A;  1V5E A;  4M6X A;  3SYT A;  4YG2 F;  2K3F A;  2M4G A;  2DDA A;  3BR1 A;  3OS2 A;  2B63 J;  3F8F A;  1MD0 A;  4G9Y A;  4A3F J;  2XAH A;  3F8M A;  4M3B A;  1YW7 A;  4NNJ A;  3GTJ J;  1W7P A;  3ABL H;  4WX9 A;  3GLX A;  4OIO F;  4D9J A;  4ENK A;  3WU0 A;  2MC4 A;  2VB6 A;  3FBN B;  1RIO H;  1JKO C;  4B47 A;  3OV8 A;  3WTT C;  3K7A J;  2BV6 A;  3CMY A;  1BW5 A;  2XB5 A;  1VQK I;  4NHJ A;  1F1Z A;  4BGD A;  3B6C A;  1VFC A;  5KAI C;  3T1B A;  2JVG A;  4V2G A;  3CJT B;  1I1S A;  4KIB A;  4FET A;  5IT9 K;  4TV7 A;  2VPR A;  4A69 C;  2UZK A;  1J09 A;  4BE2 A;  1Z6T A;  3R60 A;  5J8C A;  2YU9 J;  1IUY A;  3HZJ A;  5K1Y A;  4CXF A;  2WAE A; 
#chains in the Genus database with same CATH homology
 2P6S A;  4DNC A;  4OIP F;  1ODD A;  3LST A;  3HHG A;  3GZ5 A;  5L3D A;  5FGM A;  3I4P A;  4MTE A;  2Y0M A;  2F5C A;  3C3W A;  1D8K A;  2L54 A;  2ZXJ A;  4L5I A;  5FFX A;  1USS A;  4U7D A;  4YFK F;  3T5X A;  2G7H A;  1YFH A;  2P5L C;  3W6K B;  4BNC A;  4OOI A;  2Y75 A;  5BPD A;  4ESB A;  2F5F A;  2GA2 A;  4HZF A;  1J0R A;  3IHU A;  2W25 A;  1ZN2 A;  1T38 A;  1V4R A;  2IA2 A;  2CYY A;  4ENN A;  2XUB A;  1Z1D A;  2VBW A;  4A2U A;  3QRF F;  2Z99 A;  1O3T A;  2XVC A;  4FT8 A;  1D5V A;  2JPC A;  2WTE A;  1GXP A;  3MZH A;  5JVT A;  4XLP F;  1U8R A;  3E6C C;  4GYG A;  4M71 A;  3J7A O;  1BN5 A;  3DFG A;  4EJT A;  5E1Z B;  5ICG A;  1DPR A;  1W5S A;  2EV0 A;  2MH2 A;  1KYW A;  4N9I A;  4L0Z B;  2DQR A;  3EDP A;  4XSZ F;  4GYI A;  4QLC U;  5LRR A;  3G73 A;  5TJJ A;  1RZ4 A;  2YR2 A;  2JSC A;  2ZFW A;  3QP6 A;  3H3Z A;  4PGH A;  5F64 A;  2G7U A;  1J9I A;  2W57 A;  2O8X A;  2H27 A;  2H6B A;  3KET A;  4RB0 A;  2XAS A;  3JW4 A;  4RGX A;  4OIQ F;  1UHW A;  3PQK A;  3RPU A;  4R1H A;  5CVV A;  1IN6 A;  5D6F A;  1CGP A;  1SD4 A;  4HF1 A;  5KVR A;  3WGI A;  2L4M A;  4M74 A;  3GXO A;  3EQL F;  3L09 A;  2HR3 A;  1ZLK A;  2A5Y B;  4XBF A;  2FBI A;  3BDD A;  3KP3 A;  4M6Y A;  3RKW A;  1U5T C;  4M9X A;  2L01 A;  3V4G A;  2HKO A;  4YIF A;  2H09 A;  1V3F A;  2XAQ A;  1FT9 A;  4HA8 A;  4AD9 A;  5LHI A;  1OYY A;  1S3J A;  4FHT A;  2XRN A;  1B4A A;  4WWC A;  2M30 A;  1ZHF A;  1T2K A;  1XSD A;  1P4W A;  4AIK A;  2P5K A;  2Z9O A;  5JI6 A;  4WK8 F;  5DCF A;  2K02 A;  2LF7 A;  2D1H A;  2YX7 A;  1R58 A;  2YX4 A;  2R7D A;  4ZZL A;  1OR7 A;  2KRF A;  4O6J A;  5E20 A;  3KLO A;  3CLO A;  2W24 A;  3O2P E;  4Q5S F;  5E1W A;  1FYL A;  1WSU A;  3GVA A;  1MJ9 A;  2NRA C;  2DO7 A;  2NAZ A;  2FE3 A;  3RTR A;  2JTV A;  4HDV A;  3RPQ A;  2K4B A;  1YTY A;  1ZGA A;  5HDN A;  3SQN A;  2R3S A;  1W7P D;  3L7W A;  4U88 A;  2ZBK A;  2KKO A;  4KMF A;  3KP4 A;  2QBY B;  1XCB A;  4I02 A;  4ZYE A;  3FX3 A;  1R1V A;  2GXB A;  1WRJ A;  2JT1 A;  1YG2 A;  1TW2 A;  5D4R A;  4S05 A;  3GUD A;  4IRH A;  5HVQ C;  5FD5 A;  2HOE A;  5D6E A;  1LDK B;  2LDU A;  2VE8 A;  4EVI A;  2XKO A;  3MQ0 A;  1ZG5 A;  5CJ9 A;  5EEG A;  4MGR A;  3HUG A;  4I98 B;  4HLX A;  2XAJ A;  3LFK A;  3J80 Z;  3GFL A;  3SXY A;  2VC0 A;  2A3S A;  2E1N A;  2XRO A;  1XCV A;  5HLI A;  5ICC A;  3I59 B;  2HQN A;  3I58 A;  3E6D A;  1J5Y A;  3BY6 A;  3I5U A;  1R00 A;  1R36 A;  3EYI A;  2GAU A;  1A04 A;  4CZZ A;  2FBH A;  3HOT A;  2OU2 A;  1Z05 A;  1S8N A;  4G7H F;  1FYK A;  4KYW A;  3E6M A;  2F2E A;  3FMQ A;  3JSP A;  2OA4 A;  4HDU A;  4RAY A;  3BJA A;  3R0J A;  3KZY A;  3M1E A;  4ESF A;  4LJZ F;  5E8I A;  3F8N A;  4NQW A;  3I64 A;  4A0Y A;  4FX0 A;  2NNY A;  1KQ9 A;  2EFO A;  1K78 A;  2QQ9 A;  3BJ6 A;  4F7Z A;  5D8K B;  2EA4 A;  4G8X A;  2QUF A;  2OD5 A;  4HLY A;  1DP7 P;  4I01 A;  4BHC A;  1IRG A;  4EJV A;  3G3Z A;  4L5J A;  2ZNY A;  4HX7 A;  4ZYG A;  3ROU A;  2OZU A;  2MLG A;  4K2E A;  5AIQ A;  4MQ9 F;  3IKT A;  2FRH A;  4ZYH A;  4A6E A;  1QBJ A;  4A5M A;  3HRS A;  4CHU A;  1KYZ A;  5JR3 A;  4JQF A;  4LG0 B;  4IRI A;  3F6V A;  2K4J A;  3DXJ F;  1EH7 A;  2FNP A;  3GO5 A;  4EJU A;  3T0Y A;  4L0Y B;  3ISP A;  4ESJ A;  2E1C A;  4LFU A;  5AIP A;  3WTV C;  1IN7 A;  3QU3 A;  3DPL C;  5DCM A;  1XDS A;  1TTY A;  3Q9V A;  1FP1 D;  3EET A;  2QVO A;  4M9Z A;  4YFX F;  1TLH B;  2HYF A;  1YLF A;  3ZMT A;  1OMI A;  4UUV A;  1W4M A;  4IJA A;  2PMH A;  3Q5F A;  2STT A;  2VBZ A;  2ZME B;  1I5Z A;  1BI1 A;  4D0P A;  5CYV A;  1ZGJ A;  4RS8 A;  4IPA A;  3V7S A;  1LQ1 A;  2RQP A;  5HLH A;  2EFW A;  3K1P A;  2HDC A;  4M9S A;  3RJP A;  5J8F A;  1Y0U A;  3RIR A;  1C0W A;  1LDD A;  1KU9 A;  3LWF A;  2H94 A;  1L3L A;  3ULQ B;  1BIA A;  3GWZ A;  3ZMD A;  1FZP B;  1O3S A;  4P9F A;  1QPM A;  2W84 A;  3NRV A;  3BPV A;  4GXO A;  5CVU A;  3LAP A;  3TDZ C;  1F5T A;  3KCC A;  3PFI A;  1UHM A;  1R1U A;  5FO5 A;  2PLY A;  2VOP A;  4XSX F;  5LLQ A;  2KJB A;  4AWX B;  4GGG A;  1Q1H A;  2H6C A;  1FYM A;  5D5U B;  3CDH A;  3IWZ A;  1W7P B;  5LRS A;  1XMA A;  2OBP A;  4ZYD A;  3MFK A;  5LGN A;  2ZNZ A;  1XGM A;  3F23 A;  4EQQ A;  3K2Z A;  2L4A A;  4LLG F;  5CVR A;  2HFH A;  5LGU A;  4OMY A;  4HOB A;  4G6D A;  1P4X A;  5CLS A;  4ASN A;  3V7C A;  2G9W A;  1MGT A;  2P7C B;  4CGZ A;  4I2O A;  1O3Q A;  1MJA A;  1K79 A;  1QNT A;  1UB9 A;  3TGN A;  3WTX C;  4I09 A;  1MDM A;  1R7J A;  1MJB A;  2HTS A;  4GCV A;  3JAM Z;  2P4W A;  1ZAO A;  3J80 K;  4IXA A;  1K7A A;  1KU2 A;  3BWG A;  4PDK A;  4KA4 A;  4PZJ A;  1J7K A;  2GIV A;  2V1X A;  3GZ6 A;  2NNN A;  1BIB A;  4Y17 A;  3QOP A;  1BI3 A;  3LAJ A;  4NB5 A;  4UVB A;  1YS6 A;  3VEP A;  1BJA A;  4N0B A;  1R23 A;  3HRU A;  3M8F A;  5JHU A;  4OIR F;  2ADU A;  4Y15 A;  5E1X A;  1KQ8 A;  3H3U A;  1YQA A;  5E18 F;  1YW8 A;  3PQJ A;  5ILU A;  3ABU A;  3MAJ A;  3ZMU A;  1LDJ A;  3DF8 A;  4M73 A;  3I54 A;  4XLN F;  2PG4 A;  2ISZ A;  1F4K A;  2WV0 A;  2Z33 A;  2QWW A;  1B9N A;  2ACJ A;  5D5V B;  3HSR A;  3I71 A;  3TOB A;  3CJN A;  4CO8 A;  5K5O A;  5K5R A;  3C7J A;  3GX4 X;  4BAY A;  4PGG A;  1U5T A;  3HRT A;  2FF4 A;  2O0Y A;  3DKW A;  2X4H A;  3RI4 A;  4A6D A;  5KK1 A;  3DP7 A;  1TW3 A;  2IJL A;  2ELH A;  1UCR A;  2DI3 A;  3TO9 A;  1JXS A;  4LD5 A;  4LMY A;  4L9V A;  5BOX A;  3GFJ A;  2WWY A;  4YII A;  2W85 A;  2VT2 A;  4WXH A;  1BI2 A;  3O6B B;  1FBQ A;  1T6S A;  4CYD A;  1UST A;  2V79 A;  4GO1 A;  3KP7 A;  1ZRC A;  1TQI A;  4AVP A;  2PQ8 A;  3V8L A;  4EGY A;  2ETH A;  1HQC A;  1ULY A;  3RKX A;  2HYG D;  3E6B A;  3WE3 A;  2IT0 A;  4KFC A;  3MZY A;  3VOD A;  1B59 A;  4ENJ A;  2FSW A;  2M87 A;  4MQV A;  3F3X A;  2TDX A;  2IP2 A;  3BP8 A;  3V7R A;  5D8L B;  4LLL A;  1ZG3 A;  2D2W A;  2DLL A;  2L3D A;  1EV7 A;  1IW7 F;  5HOO A;  2DQL A;  1DUX C;  2Y48 A;  5LGT A;  2EK5 A;  4HV5 A;  4QWQ A;  3WOD F;  4A5N A;  1XGO A;  5A2Q Z;  2DU9 A;  2IA0 A;  2A69 F;  4BHB A;  4IHS A;  2PFB A;  4WCG A;  4HV6 A;  4ON0 A;  5FD6 A;  2QYO A;  1P2F A;  3HTS B;  1HKS A;  2P7V B;  5L3B A;  1QZZ A;  3FM3 A;  1E2X A;  2DBB A;  2K86 A;  4L9T A;  2DT5 A;  3R4K A;  2D45 A;  4L9N A;  4IHT A;  3HSE A;  2HZT A;  2RDP A;  2UXX A;  4CIC A;  1ZG1 A;  2V1D A;  4Q4Z F;  4EJW A;  2XAF A;  1P4A A;  2KIF A;  3V8J A;  1B1B A;  5LEJ A;  1SFE A;  2MD5 A;  5BS6 A;  3ECO A;  2MBF A;  2ESH A;  5HS9 A;  4KIG A;  3N97 A;  3JSO A;  3JTH A;  3ZN1 A;  1OYW A;  3FXU A;  2RGV A;  3K1M A;  3WTU C;  4G94 A;  2K27 A;  1SMT A;  1J75 A;  4RGR A;  2VBY A;  2Q0O A;  3HSF A;  4N9H A;  1FX7 A;  4A0X A;  5L3F A;  3B73 A;  2A61 A;  1J2X A;  1KA8 A;  1Z9C A;  1AWC A;  1LNW A;  3GYH X;  3RYP A;  4Y13 A;  4G7O F;  5HDG A;  4AIJ A;  2YSR A;  4OMZ A;  1KGS A;  1SMY F;  1YW9 A;  3U1D A;  3REO A;  3TO7 A;  4MNU A;  3SFZ A;  1IXS B;  2ZKZ A;  1FC3 A;  3R6S A;  1FBU A;  3MCZ A;  4A0Z A;  3FF5 A;  2VOD A;  4ENM A;  2FML A;  2HWV A;  3QU6 A;  4KMU X;  4P55 A;  4KN7 X;  3BPX A;  2FEZ A;  2QLZ A;  2QQA A;  4BYY A;  2P6T A;  4IRG A;  1KQ0 A;  4G7Z F;  2O61 A;  2EV5 A;  1K78 B;  3O3K A;  3HHH A;  2M45 A;  1I1G A;  3IKV A;  5AON A;  4Z2Y A;  3P9K A;  5BQT A;  2VE9 A;  2IPQ X;  3WTS C;  1K6O A;  3AAF A;  1R5H A;  3FHZ A;  1YO5 C;  3E3V A;  3E5X A;  2VT3 A;  2Z3Y A;  1FP2 A;  4PCQ A;  1WWX A;  1ZAR A;  2VBX A;  1XB4 A;  3ABT A;  1H9T A;  4H0E A;  3FMS A;  4HX8 A;  2CQK A;  3F8C A;  2X0L A;  1O7L A;  2PI0 A;  4UVA A;  4OU0 A;  3BJO A;  4KN4 X;  1J59 A;  4XRF A;  1SD7 A;  2XIG A;  4EGZ A;  4I0B A;  3P9C A;  1G4D A;  3S2W A;  2IA1 A;  3CO6 C;  3CUQ B;  5D5W B;  2FNA A;  2RVC A;  5DCM B;  5ERI A;  2XGX A;  5LEK A;  1LJ9 A;  2OAZ A;  1HST A;  2OQR A;  2F5D A;  3CUQ A;  5BPI A;  4KUM A;  1FBS A;  4Q47 A;  3J81 Z;  1LB2 A;  1KU3 A;  3FWE A;  4U0W A;  3FMR A;  1GVJ A;  4MEX F;  1G3T A;  1GXQ A;  2RNJ A;  5J6X A;  2VN2 A;  3E97 A;  3K1N A;  2KIM A;  1ZRE A;  1Z91 A;  3HYI A;  4WXD A;  2L02 A;  2FA5 A;  3CO7 C;  5F1R A;  3D5L A;  2DFI A;  2V6C A;  3ZMS A;  1QGP A;  4MEY F;  3WTW C;  1P92 A;  2STW A;  4EV0 A;  5E8G A;  5EEH A;  1IN4 A;  2RC4 A;  4ZH4 F;  3IRR A;  3L00 A;  2XKP A;  1QO0 D;  3H92 A;  3GFI A;  1JE8 A;  3ZMV A;  1FY7 A;  3KP5 A;  3ZPL A;  4U7B A;  4RAZ A;  5H20 A;  3F8B A;  4HQE A;  3LA3 A;  2XV4 S;  3T8R A;  2IRF G;  2MA3 A;  1JHF A;  3QAH A;  2K7L A;  1R22 A;  3R61 A;  4P5O A;  5DUI A;  2OQG A;  1H0M A;  2F5E A;  3NQO A;  3EYY A;  1O57 A;  4LGW A;  2B0L A;  2Q8K A;  1U6G A;  4RB1 A;  1YS7 A;  3E5Q A;  2AXL A;  3LA2 A;  1ZH5 A;  1F9N A;  2QQB A;  1S6L A;  2A07 F;  2EFP A;  4EM2 A;  3VB2 A;  3RYR A;  5DYM A;  1FPQ A;  2M1B A;  1MDM B;  3TOA A;  1BC8 C;  4CDG A;  2IVM A;  3KP6 A;  4LB5 A;  3M7G A;  4HAM A;  5FFZ A;  2LSO A;  2V9V A;  3FXQ A;  1EH8 A;  4UV8 A;  2GZW A;  2FMY A;  3KEO A;  2NYX A;  1E17 A;  2QEN A;  3BZ6 A;  3GF2 A;  2EV6 A;  1IAW A;  3ZN0 A;  2CGP A;  3ERE D;  1IN5 A;  2EFQ A;  2MH9 A;  3KP2 A;  3IL2 A;  3HOS A;  2BYV E;  4BXU A;  2GXG A;  3OOP A;  1ZRD A;  1WI9 A;  1HSJ A;  1D8J A;  3FM5 A;  5H6R A;  4B8X A;  2RN7 A;  5LHH A;  2J5O A;  5FLX Z;  3I0T A;  2HKX A;  2CWE A;  1PUE E;  1T0F A;  2M5W A;  1XSV A;  3EUH A;  1T98 A;  3SHF A;  2DK8 A;  1R1T A;  3P9I A;  4OIN F;  3M9A A;  1HBX G;  3HTU A;  4R79 A;  5JFR A;  3W6J B;  1HW1 A;  2E7X A;  2EA2 A;  1TQP A;  4HBL A;  1I27 A;  3HIF A;  1OPC A;  1HKT A;  5E17 F;  1S29 A;  4UXN A;  1W5T A;  1DPU A;  2HTJ A;  3ZQ7 A;  1U5T B;  4O3M A;  1TNT A;  4B09 A;  2CSO A;  1EH6 A;  2FBK A;  3TKY A;  3IC7 A;  1G3Y A;  1ZRF A;  2BEO A;  2V1U A;  2GQQ A;  4HX4 A;  4LLN A;  4LK1 F;  1YYV A;  2FXA A;  1FWZ A;  4L18 B;  3TDU C;  1Z6R A;  3K9T A;  2LNB A;  3GFM A;  3IWF A;  1FLI A;  4KNY A;  1S7O A;  2DTR A;  3M8E A;  5LHG A;  2CW0 F;  3WE2 A;  3F22 A;  2HQR A;  3WTZ A;  1VTN C;  5ILV A;  5HDK A;  2KIU A;  5HS7 A;  4WXC A;  3F6O A;  2CO5 A;  1HXD A;  4EMS A;  4BQA A;  1L0O C;  1TBX A;  1QZY A;  3J81 K;  1FNN A;  1IXR C;  2MLK A;  3R0A A;  2JRT A;  1RI7 A;  2P5V A;  4RGU A;  1B6A A;  1LEB A;  1S7A A;  1LVA A;  4UVC A;  4AIH A;  3QPT A;  1OYI A;  3DEU A;  3FXR A;  2M8E A;  2ESN A;  4KIF A;  3U2R A;  1BBY A;  4HYE A;  3ML6 A;  5HLG A;  1BOA A;  3LA7 A;  4HF2 A;  4FX4 A;  5HS8 A;  5CVI A;  5D4S A;  2DPU A;  1RNL A;  2A6E F;  3VFZ A;  2EJR A;  1XMK A;  1FSH A;  3F72 A;  1IZ1 A;  1LEA A;  4LK0 F;  2VC1 A;  3LQQ A;  5DD4 A;  2PMU A;  3DV8 A;  3L2C A;  2RV8 A;  4HF0 A;  1SAX A;  4E70 A;  1WKM A;  3HRM A;  4MHG A;  2PN6 A;  3F21 A;  5ED4 A;  2VON A;  3RKY A;  3ZP5 A;  1O7F A;  5L3G A;  4S04 A;  1ONV A;  2D1V A;  1B9M A;  5DD8 A;  2O6G E;  2FOK A;  1SFU A;  3WU1 B;  5DUK A;  1BI0 A;  5ILS A;  1XN7 A;  2DPD A;  1ZYR F;  2C6Y A;  5CVJ A;  1R5G A;  4A12 A;  3V8K A;  2XHK A;  6PAX A;  1IF1 A;  5BMZ A;  2PBI A;  2O3F A;  2BBY A;  1YIO A;  1TNS A;  2Z5U A;  2QM3 A;  3TO6 A;  1UFM A;  3MWM A;  4YFN F;  3SZP A;  4HW0 A;  2BE5 F;  3ECH A;  3L9F A;  1U3E M;  4P96 A;  5DV5 A;  1XD7 A;  3QP5 A;  4WF2 A;  1JGS A;  3KEQ A;  2KJC A;  5TRD A;  5ICF A;  3KE2 A;  2QBY A;  3GW2 A;  1U2W A;  2GA1 A;  3JAM K;  2COM A;  2EB7 A;  2JPB A;  5IT9 Z;  4RB3 C;  5D5X B;  1XSX A;  2CG4 A;  1XGN A;  2ZO4 A;  1MZB A;  1XDU A;  3IRQ A;  2P8T A;  4JK1 X;  4I0A A;  5FLX K;  2ZJ2 A;  3P7N A;  3TQN A;  1SD6 A;  2O03 A;  2YPR A;  4IF4 A;  3NEU A;  1BC7 C;  2BGC A;  2LF8 A;  4ZZD A;  1X3U A;  4O5V A;  3I59 A;  2R7F A;  3WTY C;  1NHA A;  1P6R A;  1DDN A;  1AOY A;  3RDI A;  2RKH A;  5H6Q A;  3BOQ A;  2CFX A;  3MEX A;  4IVN A;  2EFN A;  4HQM A;  3FZV A;  4UV9 A;  2DW4 A;  1IXC A;  3ELK A;  5F6F A;  2FQ3 A;  3GEZ A;  3D0S A;  2GWR A;  3C18 A;  1FOK A;  3BRO A;  2MC3 A;  4BH9 A;  4EJO A;  3WGH A;  4MTD A;  2DAO A;  1KU7 A;  2DK5 A;  2YU3 A;  3COA C;  1OKR A;  4Q48 A;  2JZY A;  1CF7 B;  5K5Q A;  2EWN A;  1ON2 A;  4RGS A;  3WGG A;  3ZMZ A;  1QQI A;  1MKM A;  2A6H F;  1CF7 A;  1G3W A;  4ETS A;  5DEQ A;  1SFX A;  1PDN C;  2AS5 F;  5L3E A;  5DDG A;  1FSE A;  4KIC A;  4U0V A;  3DPT A;  1RUN A;  4LG0 A;  3U9G A;  1HKQ A;  1SD5 A;  2E7W A;  1G3S A;  3KZZ A;  3K69 A;  3KFW X;  3QPH A;  2NS0 A;  1D3Y A;  4EM1 A;  1U78 A;  4P9U A;  2LKP A;  4RB2 C;  1JHH A;  1PP8 F;  3LQR A;  2FU4 A;  3T8T A;  2HS5 A;  4R8H A;  2Q2E A;  1HW5 A;  2VXZ A;  4KDP A;  2UXN A;  2QZ8 A;  5L3C A;  2PEX A;  2ZCW A;  1G6N A;  1WQ2 A;  2WC2 A;  3JTG A;  5A2Q K;  3I53 A;  1T39 A;  1GHC A;  2OZ6 A;  3CUO A;  3Q9S A;  1STZ A;  4EM0 B;  4M72 A;  2ZME A;  4LB6 B;  2UWM A;  4U0Y A;  3C1D A;  3DQV C;  1REP C;  1IN8 A;  3KLN A;  3CTA A;  2J5P A;  3K0L A;  3CUQ C;  1PP7 U;  4L9J A;  1IRF A;  2IW5 A;  5LBQ A;  2A68 F;  1RUO A;  1ON1 A;  2HGC A;  1Z7U A;  5ICE A;  1HW2 A;  4BHP A;  2XAG A;  5FB2 A;  2ISY A;  1XGS A;  3E5U A;  3B02 A;  4I7H A;  3N4M A;  4G6Q A;  4UHT A;  1I6X A;  1TQM A;  4DQ2 A;  2VOO A;  4UNO A;  1O3R A;  4KT5 C;  4JBA A;  1H9G A;  5IT3 A;  2HEO A;  3WG9 A;  3VOE A;  3SZT A;  1ZLJ A;  2PJP A;  1BM9 A;  4M6X A;  4YG2 F;  3F8F A;  1MD0 A;  4G9Y A;  2XAH A;  3F8M A;  1YW7 A;  1W7P A;  4WX9 A;  3GLX A;  4OIO F;  4ENK A;  3WU0 A;  1RIO H;  3OV8 A;  3WTT C;  2BV6 A;  4NHJ A;  1F1Z A;  3T1B A;  1I1S A;  4KIB A;  5IT9 K;  4TV7 A;  2UZK A;  1Z6T A;  3R60 A;  5J8C A;  1IUY A;  5K1Y A;  4CXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...