3K0LA

Crystal structure of putative marr family transcriptional regulator from acinetobacter sp. adp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
molecule keywords Repressor protein
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k0lA00
3DFGA 4Y17A 5FGMA 2M1BA 2QENA 1SAXA 1J7KA 1H0MA 5KK1A 2F2EA 2K4JA 3QPHA 4MNUA 3B02A 2ZMEA 3H3ZA 3BDDA 2FMLA 2XAFA 3R6SA 4L0ZB 3O2PE 4UV8A 2L54A 2XROA 1YYVA 3K1MA 2LSOA 3K1PA 1RIOH 1LVAA 4YFKF 3MFKA 2NAZA 2ZMEB 2ETHA 5LHIA 4GO1A 2H27A 2W25A 2QBYB 1XD7A 1OKRA 5E1WA 1H9TA 4ENKA 2CGPA 3WTUC 3LAJA 2JPBA 2RN7A 1ZRCA 3E5XA 4XLNF 1S7OA 4G7HF 3TOBA 5D5VB 4RB0A 2BGCA 1HW2A 3HYIA 1TQPA 3R0JA 1P2FA 1ZG3A 4L0YB 2V1DA 3ZN0A 1USTA 1U3EM 5HDKA 3IKTA 4BH9A 3CUQB 3C1DA 3QAHA 3QP6A 3BZ6A 1FNNA 4MEXF 3F6OA 4WXDA 5JR3A 1W5SA 3JSPA 3GZ5A 1TQMA 1RUOA 3HRMA 3ZMZA 3I71A 1XSXA 4CHUA 2JSCA 2QVOA 2V79A 4ZZLA 4ASNA 2V6CA 2MH9A 4KMFA 3FM3A 2H94A 4QWQA 4YFXF 1ZH5A 2GWRA 4TV7A 4EJTA 2J5PA 2FSWA 1K78A 1Z6RA 1Z1DA 4A6EA 4I7HA 5CLSA 4CXFA 5IT9Z 2IT0A 3RKXA 4OIQF 2DTRA 4LK1F 1HBXG 1YIOA 1FSEA 1YQAA 1U5TA 2ESNA 1BI2A 1JHHA 4HOBA 3T0YA 3JSOA 5E1XA 2ZKZA 1D8JA 1X3UA 3V8KA 5D4RA 1ON2A 3IWFA 3WTSC 3N4MA 2QZ8A 5CVVA 2ZCWA 3ZMDA 3NEUA 3W6JB 3SZTA 3GWZA 2G7HA 1QNTA 2XAHA 3FXUA 3FMSA 1ZG1A 4Z2YA 3T8RA 5J8FA 2K02A 3KZYA 3U2RA 4ESBA 2DO7A 3CLOA 5A2QK 4MQVA 3E6MA 2CO5A 5D5XB 5BMZA 2A6EF 3E6BA 1K7AA 4EJWA 3VOEA 1W7PA 5K5QA 4ZZDA 2V9VA 2X0LA 4NB5A 2D2WA 4G8XA 4Y15A 2GZWA 4ZYDA 4XLPF 3TO7A 1FY7A 4L9VA 1MGTA 5H6QA 2EA4A 2ESHA 1XDUA 5JHUA 1SMYF 3TDZC 3JTHA 4KIBA 1XB4A 4MEYF 3H92A 4M73A 2W57A 1OPCA 3T5XA 4RB2C 3FWEA 2DU9A 5BQTA 1ZGJA 4P9FA 4G7ZF 5HOOA 5E1ZB 1OR7A 2A69F 1LEAA 3HTUA 1YW8A 1LJ9A 4BYYA 2XGXA 3GX4X 4S04A 4JBAA 2GXBA 3BWGA 1IN8A 1SD5A 3ZMTA 2E7WA 4KT5C 1P4WA 4B09A 5HS8A 3JTGA 3DEUA 3BJAA 4HA8A 1V4RA 2XIGA 2ZNZA 3GFJA 4EM0B 4ENNA 3QRFF 1KQ9A 1XGSA 3GYHX 3LA2A 1QGPA 1MJAA 2P5LC 3M7GA 1REPC 4WX9A 3E3VA 4LMYA 4L9JA 5L3DA 1XGOA 2L02A 2QUFA 4HQMA 1KYWA 1CGPA 3GXOA 5L3GA 2QM3A 1TNSA 4RAYA 3MEXA 2ZO4A 3IL2A 4CGZA 4I98B 1Q1HA 1RZ4A 2QYOA 4U88A 3CUQA 2G7UA 3TGNA 4HLXA 1XSDA 4A0XA 4FHTA 2KIFA 1QO0D 2RQPA 1ZLKA 2OA4A 4G6QA 4KMUX 1FYMA 2PMHA 4AIHA 4U7DA 5E8GA 5L3FA 3REOA 2G9WA 1D3YA 1PP7U 5DV5A 4PGHA 2FOKA 1I27A 2ZXJA 4U0VA 1RUNA 3F3XA 4LLGF 3I53A 4ZYGA 2NNYA 4HF1A 2W85A 2MH2A 4DQ2A 2VOOA 5H20A 5LGTA 2VN2A 3HHGA 1K78B 2UZKA 3KP7A 4A6DA 4LK0F 5ICEA 3ML6A 4L9TA 3U1DA 2QQAA 3FMRA 4EMSA 4AWXB 4M74A 4KN4X 1P6RA 4BQAA 1U5TB 1XSVA 2XAGA 2ISZA 3G73A 1R5GA 3ABTA 2A07F 5FO5A 3SFZA 3EDPA 2K27A 1FZPB 2EFNA 4IRGA 2PBIA 1O3TA 2J5OA 1Z6TA 2DI3A 2P5VA 3LFKA 3R61A 1P4XA 1R36A 2HOEA 1MDMA 4OMYA 5FD5A 5LRSA 1J75A 2JTVA 2LDUA 5HLHA 1KQ0A 1R1UA 1ZGAA 1XCBA 2XVCA 3QP5A 3SQNA 2BYVE 1I1SA 3BOQA 3ULQB 3NRVA 1QZYA 2Q8KA 1BIBA 1IRFA 1FOKA 4L5JA 5TJJA 2UWMA 1XGNA 3ZMVA 2K86A 2VBWA 4NQWA 3V8JA 2GAUA 3KEOA 1T98A 1HQCA 1B9MA 1ULYA 3GZ6A 1R22A 3RJPA 3RI4A 1NHAA 3KP5A 3LA7A 1SFUA 4HAMA 3WTXC 2IJLA 1JHFA 1BC7C 4HF0A 5D8LB 3E5UA 1WI9A 1Y0UA 4MHGA 1KQ8A 2OD5A 3BY6A 2XKPA 3GF2A 5LHGA 4AD9A 3RKWA 3WU1B 2Y0MA 1J2XA 2PG4A 2E1CA 1J0RA 2Z99A 2A68F 1G6NA 1SFEA 2OU2A 1TNTA 3I59A 3L09A 3TO9A 1MJBA 1WSUA 1KU9A 1BI3A 3NQOA 4G7OF 2VODA 2UXNA 4F7ZA 1LDDA 2PFBA 3M9AA 2OZ6A 1EV7A 2FMYA 3OV8A 3ELKA 2K4BA 2O3FA 3WGIA 1EH6A 5K5RA 5HDGA 2P6SA 3I64A 1XGMA 3C18A 2AS5F 2IVMA 3RIRA 2DQLA 2ADUA 1EH8A 1FWZA 2Z5UA 1S6LA 4MGRA 2FEZA 4MQ9F 1BM9A 2EFOA 2M30A 2C6YA 1V3FA 4HYEA 2A5YB 2HYGD 1FX7A 4OIPF 3GEZA 1FLIA 3T1BA 2STWA 3MQ0A 3HHHA 1MKMA 3LWFA 1U6GA 2DBBA 2RC4A 1F1ZA 2EFWA 2VC1A 5DCFA 3CDHA 2RKHA 3S2WA 4OINF 1IN5A 3FMQA 2GIVA 4UXNA 4HLYA 1MD0A 3R0AA 3E5QA 2IPQX 4IXAA 3KLOA 3RKYA 5E18F 2IRFG 4ON0A 1GHCA 2CYYA 1ZG5A 2CFXA 4EJVA 2DK5A 3HRUA 2ELHA 3TOAA 4IPAA 1ZREA 5L3CA 2HZTA 1TTYA 4GYIA 2FQ3A 4P96A 2O6GE 3ERED 3ABUA 4CICA 3IWZA 2XAJA 3ISPA 1B59A 5ICFA 2FU4A 5DCMB 1S29A 3ZMUA 1IRGA 1UFMA 1FT9A 3K69A 1RI7A 4UVBA 2HQRA 3PQJA 1F5TA 4EV0A 2F5DA 4RB3C 1SMTA 3QOPA 3Q9SA 3HOSA 5DCMA 3WTWC 5DUIA 1I6XA 1PDNC 2CWEA 3KP6A 3L00A 2VONA 3ZP5A 3KE2A 4PGGA 4HF2A 2ZNYA 2ZBKA 2WWYA 1UHWA 4YIIA 4GXOA 4IHTA 1IN4A 1FBUA 1B4AA 1IW7F 3DV8A 4KIFA 1YTYA 1OMIA 5HS9A 1LB2A 5E8IA 1WQ2A 2L3DA 5ILUA 3WTTC 4UV9A 1W4MA 5CVIA 2MC3A 3T8TA 5DD4A 1HSJA 4A5MA 5BPIA 5CJ9A 2VE9A 3ZN1A 3F8FA 3BROA 2HYFA 5J6XA 4H0EA 4CDGA 4IJAA 5L3EA 1LDJA 4WXCA 1CF7A 4XSXF 3F8MA 4GGGA 5ICCA 4EJOA 3JW4A 5DYMA 1LDKB 5D5UB 4HZFA 3SXYA 5ILSA 3F8NA 1Z7UA 2DW4A 2PI0A 5D4SA 1LQ1A 3LQQA 1BC8C 4OIOF 1BI1A 3FM5A 2KIUA 1K79A 1CF7B 3C7JA 5ILVA 4HDVA 2GA2A 5TRDA 1STZA 2QWWA 2BEOA 1H9GA 1VTNC 3GW2A 3I59B 3KFWX 2BBYA 3FXQA 2QLZA 5K5OA 3EUHA 3Q9VA 1UHMA 2EWNA 1KGSA 3FX3A 4FT8A 3WTYC 4LB6B 3V7RA 3GFIA 2A6HF 2HDCA 5CVRA 1GXPA 2XAQA 2D1VA 4Q4ZF 4G9YA 4OMZA 3I0TA 1P4AA 1J5YA 2NNNA 2PEXA 1OYYA 5FLXK 1QBJA 2COMA 4A2UA 1FP1D 1K6OA 1FPQA 1T0FA 4A0YA 3MZHA 2HTSA 1HKQA 2EV6A 2Y75A 3WG9A 5D8KB 2RVCA 2O03A 3RYRA 5D6FA 4N0BA 3LSTA 4RGSA 1QPMA 4M6YA 4QLCU 3CO7C 1B9NA 3D0SA 3IC7A 5FLXZ 3V7SA 2FXAA 3K0LA 3HSFA 3KCCA 2PQ8A 4AIJA 5LGNA 4LFUA 2LF7A 2VT2A 4D0PA 4R1HA 1JXSA 1ZN2A 4RGRA 4JK1X 1XN7A 2IA2A 3KZZA 2VE8A 5ICGA 1Z9CA 1R58A 3W6KB 4HW0A 3F72A 4Q48A 2L4AA 4HQEA 4I2OA 1LEBA 2FNPA 1L3LA 1IN6A 4YG2F 4LLLA 1DPRA 4ESJA 4BNCA 4NHJA 4G6DA 4I02A 3CTAA 1TQIA 1IN7A 3WTZA 4KICA 3KP2A 4XSZF 1SD6A 1ON1A 3QPTA 4ETSA 3GVAA 4RGUA 2MD5A 4HV6A 1W7PD 2VBZA 4P55A 4R8HA 3TQNA 5LEJA 4KA4A 2P8TA 1KA8A 1R1TA 2A61A 1G3WA 2R7FA 1ZRFA 2OAZA 3LA3A 2IA0A 3F6VA 3CUQC 3VB2A 2W24A 1QQIA 4HX4A 3MZYA 2D1HA 1FYKA 2M8EA 1FBSA 1R23A 1U2WA 3J81K 5ERIA 2L4MA 4LJZF 1Z05A 5FD6A 3HTSB 2CQKA 4BHBA 4ZYHA 3RPQA 3COAC 4HX8A 2HEOA 2B0LA 1IXSB 2L01A 4LGWA 5F6FA 3VODA 2MA3A 2DFIA 4WF2A 1KYZA 2IW5A 3EYYA 5FFXA 2DAOA 4O6JA 2OBPA 1DDNA 5IT9K 4WWCA 3CUOA 2CW0F 5AIPA 2BE5F 1ZRDA 2JZYA 1T39A 4R79A 1SFXA 3WGGA 2H6BA 2E7XA 3V7CA 2RGVA 4EJUA 5LBQA 2ZJ2A 4GYGA 1AOYA 1IF1A 1HW5A 4IVNA 3DQVC 3KP3A 3GUDA 1XMAA 1YW9A 2IP2A 2Z33A 1UB9A 2QQ9A 3L7WA 3EQLF 5ED4A 4KIGA 2YX4A 3DP7A 2EK5A 5AONA 1B1BA 1L0OC 1GVJA 4DNCA 1BI0A 3O6BB 2XHKA 3TKYA 2FNAA 1S8NA 3RTRA 2YSRA 5HLIA 1OYWA 4IF4A 5LLQA 1FYLA 5HLGA 4BAYA 3WE2A 3K1NA 4EM1A 4CYDA 2Y48A 1O3RA 5LHHA 2FE3A 3BJ6A 2O61A 1SD4A 2HTJA 2M87A 1IXCA 1ODDA 4Q47A 2DK8A 1HKSA 2IA1A 5JI6A 4A5NA 1ZHFA 3HRTA 1ZAOA 4FX4A 3GFMA 2HQNA 3J80Z 4BHCA 1O7FA 4AIKA 3M8FA 4O5VA 5CYVA 4JQFA 3R60A 3WE3A 3QU6A 2P7VB 3GO5A 2FBKA 4UHTA 5JFRA 3DXJF 4UUVA 1D5VA 2NS0A 2KRFA 3P9IA 1WRJA 3R4KA 5AIQA 1O7LA 4M71A 3E97A 4CO8A 3P9KA 2HS5A 4ESFA 2QQBA 3M8EA 4MTEA 2F5FA 5HVQC 1JE8A 3HOTA 5CVUA 4L18B 1LNWA 5HDNA 2F5EA 6PAXA 2PMUA 4K2EA 4A12A 1TLHB 4EGYA 3PFIA 2KKOA 3KP4A 4ZH4F 2PLYA 3ECHA 2WTEA 3F8CA 3N97A 4FX0A 1TW2A 2VXZA 3L2CA 3F23A 1DUXC 3FZVA 5F1RA 1DPUA 1BN5A 1OYIA 1Z91A 4IHSA 3IRRA 2PJPA 1F4KA 4LLNA 3ECOA 1R00A 2YR2A 3K9TA 1R7JA 1WWXA 5HS7A 2E1NA 1BJAA 2D45A 4RGXA 3WTVC 1YO5C 1FC3A 2EB7A 5K1YA 3D5LA 3F21A 3KEQA 1FP2A 3SZPA 3WU0A 2NYXA 3BP8A 4WXHA 5F64A 4KYWA 5A2QZ 2UXXA 4Q5SF 2EFQA 1F9NA 2HKXA 3FHZA 3HUGA 3DPTA 1YG2A 3VEPA 2DPDA 3H3UA 4LG0A 2Q0OA 1U5TC 3ZPLA 1FSHA 1TBXA 3WGHA 4PZJA 5H6RA 4U7BA 2STTA 2CSOA 4OOIA 1P92A 4HV5A 4U0WA 3J81Z 3IKVA 3CO6C 4BXUA 3V8LA 1YW7A 4KFCA 2GXGA 1GXQA 1O3SA 5KVRA 4LG0B 1IAWA 3M1EA 1UCRA 4BHPA 1JGSA 3EYIA 2YU3A 1AWCA 1ONVA 1IXRC 3IHUA 1J59A 2P6TA 3FXRA 1YS6A 1XCVA 4B8XA 1ZYRF 4PDKA 1W5TA 2MLGA 1IUYA 2OZUA 5L3BA 4UVCA 1J9IA 3O3KA 5E20A 2XUBA 3RYPA 5FFZA 2K7LA 3Q5FA 2VC0A 2BV6A 2RDPA 4A0ZA 2KIMA 1FBQA 2VBYA 3BJOA 4N9IA 4P5OA 1KU7A 3PQKA 1G3TA 1PUEE 4WK8F 1KU2A 3HRSA 3VFZA 5BS6A 3E6DA 2AXLA 2DT5A 3U9GA 2TDXA 4I01A 4HDUA 4M72A 2LNBA 3DPLC 2Q2EA 4YFNF 2MBFA 2H09A 2GQQA 5DEQA 4XBFA 1A04A 1HSTA 5DDGA 4KNYA 4O3MA 5LRRA 2WC2A 1T38A 4N9HA 2EV0A 2KJBA 3RDIA 4EM2A 2W84A 1T6SA 5DUKA 2FRHA 2DQRA 5LEKA 4M9ZA 1O57A 2HFHA 4M6XA 3DF8A 4I0BA 1YFHA 2ZFWA 5D5WB 3B73A 3I4PA 1WKMA 1G4DA 1PP8F 3ROUA 4RAZA 3C3WA 1I5ZA 2JRTA 3OOPA 1E17A 4I09A 2P7CB 5BPDA 3QU3A 5E17F 5BOXA 1YS7A 3I58A 3V4GA 2R3SA 5CVJA 1XMKA 2F5CA 4RB1A 1TW3A 3GFLA 2OQGA 3ZQ7A 4U0YA 3L9FA 2O8XA 3BPXA 2RNJA 4P9UA 2CG4A 4M9SA 3MAJA 4EGZA 4WCGA 2VBXA 3E6CC 2NRAC 3J7AO 5J8CA 4LB5A 4UVAA 2V1XA 2EV5A 4YIFA 3MWMA 2QBYA 3AAFA 3LAPA 3RPUA 1U8RA 4I0AA 4KUMA 1RNLA 2KJCA 2ACJA 4IRHA 1QZZA 1BOAA 3JAMK 3ZMSA 2JPCA 4HBLA 2Z9OA 4ZYEA 1HW1A 4IRIA 2Z3YA 1C0WA 2M45A 4OU0A 4EVIA 5JVTA 4G94A 1SD7A 4LD5A 1B6AA 3TO6A 3I5UA 2R7DA 4ENJA 1XDSA 2XV4S 1USSA 4UNOA 2HGCA 4OIRF 3FF5A 1G3YA 5FB2A 2PN6A 3MCZA 2ISYA 5DD8A 2FA5A 3SHFA 4CZZA 1ZARA 4E70A 2EJRA 3EETA 3BPVA 4AVPA 4L5IA 2GA1A 1YLFA 2EFPA 2HWVA 2LKPA 1HXDA 1KU3A 2M5WA 2YPRA 4HX7A 3P7NA 1O3QA 2YX7A 1BIAA 1S3JA 3LQRA 2WV0A 4ENMA 2OQRA 2XASA 4KDPA 4RS8A 4PCQA 3DKWA 2DPUA 3G3ZA 1MDMB 2RV8A 1T2KA 2P5KA 3J80K 2XKOA 2V1UA 2HR3A 1MJ9A 4L9NA 1DP7P 1U78A 2MLKA 4S05A 4KN7X 1E2XA 2XRNA 5EEHA 1W7PB 2FBIA 2VT3A 5IT3A 3P9CA 1IZ1A 3HSEA 5D6EA 2FF4A 3KLNA 2O0YA 3F22A 1MZBA 4XRFA 3JAMZ 2FBHA 3K2ZA 3CJNA 2P4WA 4Y13A 2X4HA 2EA2A 3I54A 1D8KA 4M9XA 1HKTA 1R1VA 2HKOA 3KETA 3HSRA 5EEGA 3WODF 4GCVA 2VOPA 1ZLJA 4EQQA 1G3SA 2A3SA 3IRQA 2JT1A 1R5HA 5LGUA 1S7AA 2DLLA 1BBYA 1EH7A 2LF8A 3HIFA 3F8BA 3TDUC 3GLXA 1I1GA 2H6CA 4MTDA
chains in the Genus database with same CATH superfamily
3DFGA 4Y17A 2K3PA 5FGMA 4B1RA 2M1BA 2X48A 2QENA 5FKKA 1SAXA 1J7KA 1MNEA 1TWAJ 1G2HA 1H0MA 3PO2J 4LIUA 3DTKA 5KK1A 3VSLA 2F2EA 1YRNB 1EJ9A 2K4JA 3QPHA 4MNUA 3B02A 3WU2C 2X1DA 1YOVB 2ZMEA 3H3ZA 2KP6A 4BY1J 3BDDA 2FMLA 2XAFA 4BQOA 3R6SA 3RZDJ 4L0ZB 1FTZA 2GM4A 3O2PE 4IHWA 4KISA 4UV8A 2L54A 2XROA 1YYVA 3OOUA 3K1MA 2CUEA 2LSOA 2NVTJ 1DQUA 2M7AA 3K1PA 1RIOH 1D1AA 1E0EA 1LVAA 4YFKF 3MFKA 1P7JA 2HOSA 4NBQA 2NAZA 2KISA 4C3IJ 2ZMEB 4IL6C 2ETHA 5LHIA 2NXNB 4GO1A 2H27A 2ZXHA 2W25A 4JOMA 3X2QH 2QBYB 1XD7A 1OKRA 5E1WA 1H9TA 4ENKA 2CGPA 3WTUC 2QSFX 3LAJA 2JPBA 1FIPA 1NG7A 2EIMH 2RN7A 1ZR4A 1ZRCA 1WGXA 3E5XA 4XLNF 1S7OA 4G7HF 2L0KA 3OIPA 3TOBA 3LSMA 2JQ7A 5D5VB 2MABA 4RB0A 2BGCA 1HW2A 3HYIA 1TQPA 4F93B 3R0JA 4JP0A 3OL4A 3VYRB 5C44J 1P2FA 3FXKA 2R7RA 1ZG3A 3ABMH 1OCTC 2K9LA 2VB6A 5J47A 1XG1A 4L0YB 2V1DA 3ZN0A 1USTA 1VQLI 1U3EM 4E6KG 4V19K 4MFDA 4M6VA 2DMPA 5HDKA 1W0TA 3IKTA 4BH9A 2Y9ZA 3CUQB 3C1DA 3NWSA 2EZIA 3QAHA 3QP6A 3S14J 3U21A 3HOZJ 2LVSA 3BZ6A 1FNNA 2XGDA 4XOTA 2AXTC 4MEXF 2VKHA 3F6OA 3IH3A 5EDNA 4WXDA 5JR3A 1JI8A 2B9SA 1W5SA 2L9RA 3JSPA 3GZ5A 1TQMA 4MO7A 1RUOA 2QSHX 2Y31A 2VL8A 3ABKH 3HRMA 2XPVA 3FKIJ 4DZJA 3H36A 2DODA 3CCRI 5BNGA 1X58A 4IO9F 3ZMZA 2ICWG 4HNVA 3I71A 1XSXA 3A01A 4UY8I 4CHUA 2JSCA 2QVOA 2V79A 4ZZLA 4ASNA 2V6CA 2MH9A 1GV2A 1YI2I 4KMFA 3FM3A 2H94A 4QWQA 4II3A 4YFXF 3OMYA 1TWCJ 2LFBA 3AG2H 1ZH5A 2LY1A 2GWRA 3M07A 4TV7A 4EJTA 2J5PA 2COBA 2FSWA 3F0CA 2GIZA 1E3PA 2KFDA 1K78A 5J40A 3FBNB 2EZHA 1WJAA 1Z6RA 1Z1DA 4A6EA 4I7HA 5CLSA 4CXFA 5IT9Z 2IT0A 3PL8A 3RKXA 3M1CA 1X4PA 4HNTA 1ACIA 4OIQF 1AHDP 2DTRA 4LK1F 1HBXG 1YIOA 1FSEA 4P1WA 1BA5A 2VPRA 3K70C 1YQAA 4BQNA 1U5TA 2ESNA 1BI2A 3LSIA 1JHHA 4CCMA 3CCUI 4HOBA 3T0YA 2V7FA 3GTQJ 3JSOA 4ZDLA 3SDGA 2LR8A 3RZOJ 1N75A 5E1XA 2ZKZA 3SZGA 1D8JA 1X3UA 3V8KA 3S1RJ 2CUFA 5D4RA 1ON2A 3IWFA 4BBSJ 3WTSC 3N4MA 2X1EA 3H1CA 1OLTA 2QZ8A 5CVVA 2R7UA 2ZCWA 1FMWA 3ZMDA 4XLFA 3MKZA 2ELKA 2EINH 1LFPA 2XF7A 3NEUA 1FTTA 3W6JB 4NC7A 3CJQB 4D7MA 3LSKA 4DBQA 4IQJA 3SZTA 2R7VA 1QRYA 3GWZA 1QNTA 2G7HA 2M4KA 4B47A 2XAHA 4B3XA 3WG7H 3FXUA 4DYQA 3FMSA 1ZG1A 1H8AC 1Y8QB 4Z2YA 3T8RA 4BEHA 4CCOA 2K02A 5J8FA 3CCSI 3O8HA 3KZYA 1R4MB 3U2RA 4ESBA 2DO7A 4XM3A 4XMYA 1V5FA 5GADJ 5FLVA 3CLOA 4E7KA 4PFPA 5A2QK 4MQVA 3E6MA 2CO5A 2PMZA 3OYIA 4A3JJ 5D5XB 1YHQI 1JTXA 5BMZA 2A6EF 3E6BA 1K7AA 1UJ8A 1K4SA 3B6CA 4EJWA 3VOEA 1X1PA 3MD2A 1W7PA 5K5QA 4A93J 2ME6A 4ZZDA 5C3EJ 2V9VA 2X0LA 3QYFA 4NB5A 3VYSB 1BR4A 1YX3A 2D2WA 4G8XA 2V26A 3SDBA 3OS0A 4RAFA 4Y15A 1A6IA 1U9OA 4BE1A 1ZGWA 2GZWA 4ZYDA 3SEZA 4XLPF 1ZTRA 3TO7A 4ZDOA 4DW6A 1FY7A 4L9VA 1MGTA 3PSFA 5H6QA 1GVDA 1Y39A 2EA4A 3C2BA 2ESHA 1XDUA 2VQGA 5JHUA 1SMYF 3TDZC 1WJBA 3ZGKA 2GLOA 3JTHA 4N4NB 4KIBA 1R9TJ 2E36A 1ETOA 3PNYA 1XB4A 4MEYF 2QEXI 3H92A 4M73A 5KCMA 2W57A 1OPCA 3AG1H 1ORKA 1GV5A 2X6YA 4BXFA 4LOCA 3T5XA 4RB2C 3FWEA 2DU9A 5BQTA 1IUFA 4KT6A 1ZGJA 1MMGA 2IGNA 4P9FA 4G7ZF 2Q2EB 1JKQC 2BY3A 2TCTA 1OCZH 2PX9A 5HOOA 5E1ZB 2B63J 1OR7A 2EZKA 3BCBA 1NH3A 5DTDA 2A69F 1FOXA 1LEAA 3OYJA 4BUPA 3HTUA 5GAHJ 4YIRX 2DMQA 1YW8A 1LJ9A 3W2VA 4BYYA 4HG2A 1WJEA 2XGXA 3GX4X 4S04A 4JBAA 4FTHA 2GXBA 3BWGA 1IN8A 4PJLA 3AL0C 2JA8J 1SD5A 2P0WA 3HGYA 3G6EI 1VQNI 3BTLA 3ZMTA 4BDZA 1A6QA 2A05A 2VQHA 2E7WA 4XL9A 5CKTA 2X85A 3VSKA 4KT5C 3KYDB 5FKNA 1MNMC 2HDDA 1P4WA 4QIWN 4LIVA 1GT0C 3BZKA 4B09A 5HS8A 1VFCA 3OYCA 3JTGA 3DEUA 1V5EA 2RQQA 3BJAA 4HA8A 3A4CA 4KJZA 1V4RA 2XIGA 2ZNZA 1W36C 3BR2A 2EILH 3GFJA 4EM0B 3HPHA 1WHUA 2OV7A 3MVPA 4ENNA 1RRJA 2YU9J 3DLLF 3QRFF 1KQ9A 1XGSA 3GYHX 3BG3A 3I4NJ 3LA2A 1QGPA 2HQ5A 1MJAA 2HVRA 3QPLA 3I4MJ 2P5LC 3S17J 4IOAF 3M7GA 1REPC 2CU7A 4C3JJ 4WX9A 3E3VA 4LMYA 5JHFA 4L9JA 5IY5H 5B1AH 2M7BA 3HBLA 2LMDA 2DFFA 5L3DA 1XGOA 2L02A 2JVHA 2QUFA 4HQMA 1KYWA 3OYAA 1Z3YA 1CGPA 5EYRA 3L2WA 3GXOA 5L3GA 2QM3A 3KZIC 1TNSA 4RAYA 5IP9J 3MEXA 2ZO4A 3IL2A 1R71A 4CGZA 3HGGA 4I98B 1Q1HA 1TT0A 1YJWI 1RZ4A 1JKPC 2QYOA 1FOYA 2HVSA 2OCCH 5M5XJ 1AU7A 4A3LJ 2K9SA 4U88A 1LPQA 2BZTA 3S32A 3RPUD 3CUQA 2G7UA 2RREA 5CPRB 3TGNA 3BZCA 3JRIA 1HDDC 4HLXA 2DFHA 1XSDA 4A0XA 4FHTA 2R7WA 3L2QA 2KIFA 2RAEA 1QO0D 2RQPA 1ZLKA 3L2VA 2OA4A 2I10A 2HQAA 3I9V2 4NC6A 1VQ6I 3D1NI 4G6QA 4KMUX 1FYMA 2DDBA 3HOUJ 1JUSA 2PMHA 4AIHA 4MLOA 1IDZA 5FRMA 3U1KA 5K7HA 4B44A 4U7DA 5FKOA 2Q1ZB 3CC4I 4Y52J 5E8GA 5L3FA 1ENHA 3REOA 2G9WA 1MH3A 1D3YA 9ANTA 1PP7U 4E7SA 3IAS2 4BBRJ 1N25A 3HG9A 4PGHA 5DV5A 2FOKA 1I27A 2ZXJA 3RSNA 4U0VA 3JRAA 1RUNA 2OPTA 3F3XA 4CA0A 1QPIA 4LLGF 2HOTA 1ITYA 3I53A 2UUZA 2DOFA 3ZR8X 1FMVA 4ZYGA 2NNYA 4HF1A 4G6TB 2OUMA 2DMTA 1BR2A 2W85A 3JRGA 5IOYA 2EBIA 2MH2A 4DQ2A 2VOOA 5H20A 3CCLI 5LGTA 2VN2A 2CJJA 3OYHA 3SEQA 3HHGA 1MBHA 1K78B 2UZKA 3KP7A 1WH5A 4A6DA 4LK0F 4C3HJ 2WAFA 2DYRH 5ICEA 4NDLA 2LRDA 3BG6A 3ML6A 4OAZA 2NOJB 4RDUA 4L9TA 3U1DA 2QQAA 2OCEA 2W4SA 3E7LA 3QQAA 1JKRC 3FMRA 3FISA 4EMSA 2E1MC 1Z3XA 3TW7A 4AWXB 4M74A 3BCAA 3LNQA 2DA4A 4KN4X 3CMEI 1IGNA 1P6RA 5F27A 4BQAA 1U5TB 1JTYA 2IGMA 1XSVA 4C2MJ 2XAGA 4PFOA 1UMQA 1I39A 1KONA 2BW3B 3Q0UA 4XICA 2ISZA 3G73A 3G4SI 5J1RA 1R5GA 3ABTA 2A07F 2FX0A 5FO5A 2VKVA 3SFZA 2E60A 3EDPA 3DCFA 1TWFJ 2CQ7A 1DGRM 2K27A 2VJ4A 1FZPB 2EFNA 4IRGA 2PBIA 1O3TA 1ETWA 3H0DA 2J5OA 3CCYA 1Z6TA 2BY0A 2DI3A 3LOCA 3C2HA 4E7IA 2P5VA 5HODA 2N8GA 4IZZA 3LFKA 3KIOA 3R61A 1P4XA 1R36A 2HOEA 1MDMA 4AUXA 5B66C 4IQ4A 1D1BA 4OMYA 1UAAA 5FD5A 5IYBJ 2M0MA 5LRSA 1SVLA 2DT7B 1J75A 5JLWA 2VJ5A 3IAM2 3FBIB 4B48A 1VI0A 2JTVA 4BXXJ 1HA8A 2HNHA 1Y8RB 2LDUA 2AQEA 3S1NJ 2NS8A 1SVMA 3C2GA 5HLHA 1KQ0A 3SJMA 1R1UA 4BEHB 1ZGAA 2FJ1A 4NQWB 3PUBA 3H3VK 1XCBA 2XVCA 3QP5A 3SQNA 4F52A 3FXLA 2BYVE 1I1SA 3BOQA 3ULQB 3S2DJ 3PFYA 2E1OA 1SANA 3NRVA 1KZHA 4CCJA 3HC7A 1SFKA 1QZYA 2Q8KA 1PVEA 2CW8A 1BIBA 1IRFA 1FOKA 2LKXA 4L5JA 3FXJA 1Z21A 2R7TA 5TJJA 3AG3H 2UWMA 2ID6A 1XGNA 1R6RA 3ZMVA 2K86A 2VBWA 5M5WJ 4ZTJA 4NQWA 3V8JA 2GAUA 1MSEC 2KIQA 1XPXA 1E3HA 5K7FA 3KEOA 3GTLJ 1T98A 1HQCA 1B9MA 1ULYA 3GZ6A 2V9KA 3K7AJ 3S3NA 3BG7A 1R22A 4BE0A 2BXYA 2HVQA 2CW7A 3RJPA 3RI4A 1FEXA 3RQ4A 1W0UA 4FETA 1NHAA 3KP5A 3LA7A 2KDOA 1SFUA 2Z2SB 3A0HC 2KDZA 4A3IJ 4HAMA 5E3NA 3WTXC 2IJLA 1JHFA 1BC7C 4HF0A 5D8LB 3E5UA 1WI9A 1I50J 1Y0UA 3HM5A 2XGEA 4MHGA 3GMEA 2K40A 1SEUA 3TL4X 2ZFUA 1KQ8A 3OYGA 3FK7A 2OD5A 3BY6A 3G2BA 4M3EA 4BJTA 1BOBA 3HKZA 2XKPA 4L5EA 1TWGJ 2XAUA 4RM3A 3K6GA 4LITA 3GF2A 5LHGA 4AD9A 2Z1DA 3RKWA 3WU1B 2X6XA 3JRBA 2Y0MA 3OYFA 3OSGA 4M3DA 2CQNA 1J2XA 2PG4A 2QKMB 3G1LA 4AIDA 2E1CA 2QSGX 4FE7A 1J0RA 3QPSA 2Z99A 2A68F 1G6NA 1SFEA 3OIOA 2XC7A 2OU2A 1TNTA 3I59A 3L09A 4XNFA 4QPOA 1WH7A 4C30A 1MJBA 3TO9A 1BL0A 1WSUA 3VWBA 4XLAA 1KU9A 2IBDA 3CCMI 1BI3A 3NQOA 4G7OF 2VODA 1WI3A 2UXNA 1MH4A 1MBJA 2KL4A 4F7ZA 4EATA 3KYLA 2LP0A 2XDVA 3G71I 3FK6A 1LDDA 2PFBA 2HPIA 3E0JB 3S15J 2MD0A 3M9AA 2OZ6A 3BQYA 2KT0A 1EV7A 3GTJJ 2FMYA 3OV8A 2FOWA 3ELKA 4XONA 1LUJB 2K4BA 1YJNI 3PUFA 2O3FA 3BR5A 3HZJA 3WGIA 3CCJI 2R5YB 1A36A 4X1EA 3K70D 1EH6A 5K5RA 5HDGA 2P6SA 3I64A 3JRCA 1XGMA 3C18A 2JA7J 2AS5F 4FISA 2BVMA 1FOWA 1X19A 2IVMA 3RIRA 1K61A 3H9JA 2DQLA 1F43A 2ADUA 1EH8A 1FWZA 2Z5UA 1S6LA 4MGRA 1FIAA 2FEZA 1YIJI 2DA3A 4IOCF 4MQ9F 1BM9A 2EFOA 2M30A 2C6YA 1V3FA 4HYEA 2A5YB 2HU9A 2HYGD 1FX7A 4OIPF 3GEZA 4NNJA 1FLIA 3T1BA 4A3FJ 2MGQA 2STWA 3MQ0A 3HHHA 1MKMA 3LWFA 2MYSA 1U6GA 2DBBA 4Y3OA 5M5YJ 2RC4A 1X2NA 1F1ZA 2EFWA 2H8RA 3L2RA 1VF9A 2VC1A 5DCFA 3CDHA 4XLHA 2H8WA 3UKGA 2JA2A 2MFZA 3H5AA 3CC7I 2RKHA 3S2WA 3GTGJ 1ETXA 1X2MA 4OINF 1IN5A 2BHZA 1R4NB 2DMUA 2M34A 3FMQA 2GIVA 4UXNA 4HLYA 1MIJA 1VQ8I 1MD0A 2XSJC 2BY1A 4YELA 3R0AA 3E5QA 2IPQX 4DYRA 4IXAA 5DM7F 2Z16A 1J09A 3KLOA 3RKYA 5E18F 2IRFG 4ON0A 1GHCA 2CYYA 3BR1A 3CF2A 1ZG5A 2CFXA 2DTZA 1MMAA 3D5RC 3K10A 4EJVA 2DK5A 3ASOH 3HRUA 3DBRB 3ZXSA 2ELHA 1S7EA 3TOAA 4IPAA 1ZREA 5L3CA 2R7QA 2HZTA 1TTYA 4GYIA 2FQ3A 3ZCOA 4P96A 3EUKL 2KPMA 1MBKA 3ERED 5EZHA 3ABUA 2JN6A 3QOEA 4CICA 2O6GE 3Q0VA 1HOMA 4A3CJ 3IWZA 2XAJA 3ISPA 2EPFA 2HXOA 4PJJA 1B59A 4A3KJ 5ICFA 2FU4A 5DCMB 1S29A 1H88C 3ZMUA 1IRGA 1UFMA 2M8GX 1FT9A 3K69A 1RI7A 4M3BA 4UVBA 1LFBA 2CQXA 3PSIA 2WBMA 3HEFA 2HQRA 4I99C 2F48A 3PQJA 1F5TA 4D5CA 2XPWA 4EV0A 3LL7A 4NC8A 2F5DA 4Y33A 4RB3C 3L1PA 1SMTA 3QOPA 4CZCA 1IRZA 3Q9SA 1T08B 4CCLA 2GOXB 5C4XJ 3PO3J 3HOSA 5DCMA 3WTWC 5DUIA 1I6XA 1PDNC 4A3DJ 2CWEA 4RA2A 3KP6A 2TRTA 3L00A 2VONA 1X1BA 2KZVA 1H89C 3ZP5A 1Y1VJ 3CLQA 2GBYA 1X4OA 2KRCA 1V54H 1YE9A 3KE2A 4PGGA 4HF2A 3LFUA 2ZNYA 2ZBKA 5J3LA 2WWYA 1UHWA 4ITVA 4YIIA 4BKXA 4GXOA 4IHTA 1IN4A 1FBUA 2DCEA 1W36D 4E7HA 1B4AA 5F0FA 1IW7F 4RMNA 3DV8A 1EKEA 1ETYA 4KIFA 5K7ZA 1YTYA 1X3WB 2CUZA 2XGCA 1OMIA 5HS9A 1LB2A 5E8IA 3VYTB 3D5SC 1WQ2A 2L3DA 4A69C 5ILUA 2IS1A 3WTTC 3BC8A 1TL8A 4U87A 4UV9A 1W4MA 1GLNA 1I3AA 4N4OB 5CVIA 1UG0A 2MC3A 3T8TA 5DD4A 1HSJA 4A5MA 5BPIA 2JA5J 5CJ9A 4F3QA 2DN0A 2VE9A 3ZN1A 1UHSA 3F8FA 4CYCB 4ZC3A 1FJLA 1MSFC 2XPUA 3H5NA 2JK3A 1W1WE 3BROA 3VPRA 2X9DA 2HYFA 3GLLA 5J6XA 4H0EA 3K4MA 4CDGA 5E79C 3K4CA 4IJAA 5L3EA 1LFUP 1LDJA 1B72A 4WXCA 4XSXF 3F8MA 1CF7A 3G1MA 1WZ2A 3ERMA 4GGGA 3JRDA 2NOGA 5ICCA 2DYSH 4XN3A 3JW4A 4EJOA 2ZC2A 1D5YA 5DYMA 3HL2A 1LDKB 5D5UB 4HZFA 3SXYA 2R5YA 2W7NA 5C4JJ 1Y56A 5ILSA 2HYJA 1CQTA 2OF7A 3F8NA 1Z7UA 2DW4A 2PI0A 2NVUB 5D4SA 3ZQCA 1LQ1A 2BHYA 2FUG2 1NTCA 1F36A 5KAFC 3LQQA 2DA2A 1BC8C 4OIOF 1BI1A 3J7ZI 3FM5A 2KIUA 1K79A 1CF7B 3CQZJ 2XF5A 3C7JA 2W82A 5ILVA 4HDVA 2GA2A 4XIDA 5TRDA 1STZA 3CC2I 2CFOA 2QWWA 4XRSG 1WJCA 2W48A 2BEOA 4XKBA 1RKWA 3H0GJ 3JREA 1IV6A 2CQQA 3NARA 2JUGA 1H9GA 3W3CA 1VTNC 1OISA 3GW2A 2K9NA 1N78A 2VQLA 3I59B 2WAQN 3KFWX 3OL3A 2BBYA 2QA4I 3FXQA 2QLZA 4XK4A 5HNHA 3BTJA 3EUHA 5K5OA 3Q9VA 3CDIA 1UHMA 2R7OA 4GRIA 2EWNA 2BXZA 1KGSA 3FX3A 4UB8C 5B3SH 5FKLA 3OR1C 4FT8A 3WTYC 2E1MB 4LB6B 3V7RA 4W1UA 3M4OJ 3GFIA 2A6HF 2E71A 3SYTA 3CJRB 2HDCA 2FQ4A 5CVRA 2I5UA 1GXPA 2O8KA 2XAQA 2D1VA 4AYBA 4Q4ZF 4HSTA 4G9YA 4OMZA 3I0TA 5CQGA 1JT0A 4ZYAA 1P4AA 1J5YA 3AFHA 3ZQIA 2NNNA 1IO2A 3PJRA 5GP9A 2PEXA 1SFOJ 2WY8Q 2CS3A 2LK2A 4I76A 3CCVI 2O9LA 1OYYA 5FLXK 1QBJA 2COMA 4A2UA 1D0YA 1FP1D 1K6OA 3PIOF 2DMNA 2DFEA 3K4LA 1FPQA 3LSPA 1T0FA 4Y4RA 5TGTA 4BACA 4A0YA 2R7XA 3MZHA 2HTSA 2Y9YA 1HLVA 1AKHA 1HKQA 2EV6A 2E35A 2Y75A 2LBFA 2E5ZA 1VQKI 3WG9A 4GFBA 4C9YA 2JJ7A 2JMWA 1LVKA 1S5LC 2I8DA 5D8KB 2RVCA 1D0ZA 2O03A 3RYRA 5D6FA 2ZXIA 4N0BA 3LSTA 1POGA 4RGSA 1BR1A 1QPMA 1P7IA 3AG4H 4S0HB 4M6YA 2A6TA 3DTEA 4QLCU 1B9NA 3CO7C 3D0SA 4E7JA 3IC7A 2MG4A 5FLXZ 3V7SA 2FXAA 2XB0X 3IH2A 3K0LA 3HSFA 1ETVA 1TP4A 3KCCA 5IPAA 2PQ8A 3FXOA 4AIJA 3CCQI 1AKHB 2WADA 5LGNA 4LFUA 2LF7A 2NVYJ 4BL0B 2DA1A 2VT2A 4D0PA 2NVXJ 4R1HA 2LC2A 5EGOA 4B3AA 4BDYA 1ZELA 2VI6A 3TMOA 4A3MJ 1JT6A 2ZB9A 1JXSA 1ZN2A 4HSRA 4RGRA 2KZGA 4JK1X 1XN7A 2IA2A 2KLOA 3BG9A 4XOPA 3LSJA 3W2WA 5KNLA 3IP4B 3KZZA 3ZQLA 3A2KA 2VE8A 5ICGA 1WVRA 1Z9CA 2WB1A 1G59A 4DOZA 4J00A 2L7KA 1R58A 3PM1A 4J19A 2BY2A 3W6KB 2DOAA 1X1AA 1RETA 4HW0A 2M3AA 2VIXA 3P5JA 3F72A 3GTOJ 4Q48A 1WJDA 4CCNA 2L4AA 2CV0A 4HQEA 4I2OA 1X3ZB 1APLC 1QA6A 1LEBA 5E3MA 2FNPA 1L3LA 1TWHJ 3LSHA 2F4IA 4MIMA 1IN6A 1OFCX 2XF6A 4YG2F 4QPQA 4LLLA 1DPRA 1WFXA 3FXMA 4ESJA 2OTLI 4BNCA 2CUJA 1A31A 1K4TA 4C2TA 3HDDA 3H9GA 1MMNA 4NHJA 4G6DA 2CRGA 3HOVJ 3HJEA 4I02A 1RR8C 3CTAA 3MN2A 1TQIA 5DM6F 5J4YA 1IN7A 3WTZA 3RQIA 4KICA 3KP2A 5LD2C 4XSZF 1SD6A 2JUCA 3E1SA 1MMDA 1OCOH 2DOEA 1ON1A 1UZCA 3QPTA 3IV5A 4ETSA 3GVAA 2Y0SA 3BQZA 2MD5A 3DPUA 4HV6A 4RGUA 3KPHA 1W7PD 2VBZA 4P55A 2QKLB 4R8HA 3TQNA 1GUUA 2A5WA 5LEJA 3FKJA 4KA4A 2P8TA 3S16J 5DS9A 2JSPA 1KA8A 3KEYA 2HOAA 1R1TA 2A61A 3S8PA 1G3WA 3TP3A 2R7FA 4Y7NJ 3H9QA 2R92J 1ZRFA 1XTAA 3VYUB 2OAZA 5EF6A 4CYCA 3LA3A 3TP0A 2IA0A 4DJAA 1ETQA 5B1BH 3F6VA 5FRNA 2WAEA 2QF7A 2ZSHB 3CUQC 2K3FA 3VB2A 1TZLA 2W24A 1QQIA 3OYMA 3BR0A 3MZYA 4HX4A 2W00A 5F04A 4UUSB 2IEKA 1U9NA 2D1HA 1FYKA 4I6ZA 2M8EA 2LLKA 1FBSA 2D5VA 4XLEA 1R23A 1U2WA 2Y30A 3J81K 3H35A 3OYLA 4V2GA 5ERIA 3OYBA 2L4MA 2K85A 4LJZF 1IG7A 1Z05A 5FD6A 3HTSB 2CQKA 1T56A 4BHBA 2KHMA 4ZYHA 3MKWB 2L5QA 2L2OA 2LTPA 4ZJZA 4A3GJ 5IOZA 3RPQA 3COAC 2ZJRF 4HX8A 2HEOA 2XSDC 2B0LA 1IXSB 2IXSA 2L01A 2LY2A 4LGWA 1XX5A 2MA3A 5F6FA 2L9NA 2F6CA 3VODA 3HOYJ 4D7NA 2DFIA 4WF2A 1KYZA 4EEFG 2DXIA 2IW5A 3EYYA 4PK4A 4UUSA 2KMUA 5FFXA 4XN0A 2DAOA 4O6JA 5F08A 2OBPA 1DDNA 5IT9K 4WWCA 3CUOA 2CW0F 5AIPA 2EIKH 2BE5F 2JZYA 1ZRDA 1T39A 4R79A 4RLQA 1SFXA 3WGGA 3RCOA 2YUSA 1OCCH 2H1LA 2H6BA 1MBGA 2E7XA 3CP2A 3V7CA 1R49A 2RGVA 4EJUA 3UR3C 5LBQA 2ZJ2A 3MZ8A 4GYGA 2V1NA 1AOYA 1IF1A 1HW5A 4IVNA 5J1UA 3DQVC 3KP3A 3GUDA 5FROA 1K6YA 1XMAA 1YW9A 2RNGA 2IP2A 2Z33A 1UB9A 3S2HJ 2ELJA 2ME0A 1PJRA 1OR7C 4PSWA 2QQ9A 2KRHA 3L7WA 3EQLF 5ED4A 1Y1WJ 4KIGA 2YX4A 3DP7A 2EK5A 5AONA 1QVUA 1B1BA 1L0OC 1GVJA 4DNCA 1BI0A 3O6BB 3L2UA 1IJWC 2LOOA 3ONQA 4MFEA 4HRIA 3ZQGA 1JKOC 2XHKA 2V4JC 3N05A 3TKYA 3NAUA 5EZGA 2FNAA 1S8NA 4XORA 2YSRA 3RTRA 5HLIA 1OYWA 2G0EA 4IF4A 3DEEA 5LLQA 1FYLA 3ZOBA 5HLGA 5M3MJ 3HOXJ 4BAYA 4QTRA 2NS7A 3WE2A 2M2EA 3K1NA 4EM1A 3JCUC 5EJCA 2ZJPF 4CYDA 3OY9A 2Y48A 5FKMA 2IGKA 2LBFB 1O3RA 5LHHA 2FE3A 2MC4A 4PJ0C 5CQEA 1YX5A 1D1CA 3AL0B 1TT5B 4ANJA 2M4GA 3BJ6A 2O61A 1SD4A 1XS9A 2HTJA 2M87A 1A5JA 3LMMA 5IP7J 1ETKA 1IXCA 2LYCA 1TC3C 1ODDA 4Q47A 2DK8A 1DGWY 2E19A 2WV1A 3S1MJ 1HKSA 2IA1A 5GTHC 5JI6A 2LH9A 4V2FA 4A5NA 5EEAA 1ZHFA 3HRTA 3CMMA 1ZAOA 4FX4A 3GFMA 2HQNA 3J80Z 4BHCA 3OR2C 1O7FA 2F4MB 4AIKA 1PUFA 3M8FA 4O5VA 5CYVA 4JQFA 4E4HA 4Z6YA 3QWLA 2O5RA 3R60A 3WE3A 3QU6A 2P7VB 3GO5A 2FBKA 1Z67A 4UHTA 5JFRA 3OYDA 3DXJF 3ABLH 5KHDA 3DEWA 5IP6A 4UUVA 1GDTA 2L7FP 3CF5F 1D5VA 4ABZA 3O8GA 2NS0A 4KITB 4D1QA 2CMPA 2KRFA 3F9KA 3P9IA 1WRJA 3R4KA 5AIQA 1JJ8C 1O7LA 4M71A 3E97A 4CO8A 1NK3P 3P9KA 2IGOA 2HS5A 4ESFA 2QQBA 3M8EA 1RKTA 5JVGF 4MTEA 4PJMA 2F5FA 2L9VA 5HVQC 3K4NA 3HOTA 1JE8A 3CJTB 5CVUA 2ECBA 2VKEA 4L18B 1LNWA 3K2AA 1VNDA 5HDNA 2F5EA 4CSWA 3OIQA 2PMUA 3BR6A 4K2EA 4XQFA 6PAXA 4A12A 5HNFA 1RESA 1TLHB 4EGYA 4RBOA 3PFIA 3A03A 4GDFA 2KKOA 1BJZA 3DBLB 3ESWB 2R5ZB 1S9HA 3KP4A 2V9PA 1QHHD 2WB1N 4ZH4F 2PLYA 3EUAA 3ECHA 2WTEA 3F8CA 4ZDPA 4XRMA 3N97A 3DU5A 4FX0A 2CV2A 2EH3A 1TW2A 2VXZA 5E3LA 3RKQA 3BR3A 1IC8A 2H1KA 3L2CA 3TW6A 1S72I 3F23A 4FQGA 3SFIA 5HLTA 1V5GA 1E3OC 1YJ9I 1JUPA 1DUXC 3FZVA 3W2AA 2VJJA 5F1RA 3QYBA 1DPUA 1BN5A 1OYIA 1Z91A 4XR6A 2E34A 4IHSA 1VQMI 2UV1A 2R5ZA 1Q1VA 3IUOA 3IRRA 3OSFA 2OC6A 2PJPA 3W6VA 1B8IA 1F4KA 2GOMA 4LLNA 3ECOA 1R00A 2XB5A 4IKFA 3GTMJ 3CESA 2ZMEC 3DLAA 2YR2A 3K9TA 1R7JA 4QSHA 4JX5A 1WWXA 5HS7A 2E1NA 1BJAA 4RM2A 1ERDA 4BJ6C 5F0CA 5JLXA 2D45A 1X1CA 3H5RA 2WA0A 4DIQA 4RGXA 4RLFA 2VJIA 4B43A 3WTVC 3V42A 1FC3A 1YO5C 2EB7A 2LY9A 1RR7A 1V55H 5K1YA 3D5LA 3F21A 3KEQA 1FP2A 3SZPA 4FE4A 3WU0A 2E2HJ 2NYXA 1AA7A 3BP8A 4WXHA 5F64A 4KYWA 5A2QZ 2UXXA 4Q5SF 2VPLA 2EFQA 1F9NA 3BTCA 3BT9A 2MSYA 4AC0A 2HKXA 2PMZN 4G12A 3FHZA 4NUBA 3WHBA 4AU7A 2R4GA 1I6HJ 3HUGA 3DPTA 5B5EC 1YG2A 3VEPA 2DPDA 3H3UA 3EPZA 4LG0A 3FDYA 4DZPA 2Q0OA 3ZQQA 1U5TC 3ZPLA 3GBGA 1FSHA 3DU6A 4D5FA 1TBXA 1Z0XA 2JWTA 3WGHA 1D0XA 4PZJA 5H6RA 1SC7A 4LG3A 4BQQA 1UG2A 4PUSA 4U7BA 2CSOA 1G8XA 2QCOA 1P92A 4HV5A 4M3FA 3GZNB 4OOIA 4U0WA 4DGWB 3J81Z 2CH0A 4YRVA 3IKVA 3CO6C 1BW5A 4BXUA 2BVLA 1Z77A 3V8LA 1WJFA 4DBRA 1YW7A 3HPGA 4KFCA 2GXGA 1NG6A 1GXQA 4CUGA 1O3SA 2M0CA 5KVRA 4LG0B 2L7MP 1IAWA 1LE8B 3M1EA 1UCRA 4IHVA 4BHPA 3CP8A 4JX6A 2JVGA 1JGSA 3EYIA 2YU3A 5EG0B 3J7YJ 4H4KC 2VUMJ 1AWCA 5GPAA 1ONVA 1IXRC 3IHUA 1J59A 2JA6J 2P6TA 3FXRA 1YS6A 1XCVA 4B8XA 2EZLA 2K5CA 1ZYRF 4IX7A 4PDKA 1W5TA 1BW6A 2MLGA 2O7OA 1IUYA 2OZUA 4IEJA 5L3BA 4UVCA 1J9IA 1B72B 3O3KA 2LREA 5E20A 2XUBA 3RYPA 4BJ5C 5FFZA 4AM3A 2K7LA 3Q5FA 2VC0A 2BV6A 2RDPA 4A0ZA 2KIMA 4AVZA 1FBQA 2VBYA 3BJOA 4N9IA 1IRXA 4P5OA 1Z7LA 3A1YA 1KU7A 2E2IJ 3PQKA 1G3TA 4CCKA 1PUEE 4WK8F 1KU2A 3S1QJ 3HRSA 3VFZA 4AYBN 5BS6A 3S3MA 2XRLA 2DJIA 2R0QC 2F5VA 1X1DA 3BLYA 3E6DA 1HCRA 3GTPJ 2AXLA 2DT5A 3U9GA 2TDXA 4I01A 3MKYB 4HDUA 4M72A 1YRNA 2LNBA 3DPLC 2Q2EA 4YFNF 2X51A 2E2JJ 3CZ6A 4E7ZA 1P9QC 2MBFA 1ZKGA 4UUTA 2H09A 2GQQA 2WY7Q 5DEQA 4HPQA 4XBFA 1A04A 1HSTA 5DDGA 4KNYA 2JRMA 1T33A 2DDAA 5LRRA 2QQ8A 4O3MA 2WC2A 1T38A 4N9HA 4IHYA 2EV0A 2KJBA 3RDIA 4BS9A 1M1EB 2R7ZJ 1PYVA 4EM2A 2W84A 1T6SA 5DUKA 2VASA 4M3GA 2FRHA 2DQRA 5LEKA 1OJLA 3OS1A 3ASNH 3Q0WA 3MMYB 4M9ZA 3HXLA 3J7AY 1MBFA 3M8JA 1LKXA 4UB6C 1MBEA 3AKZA 1DU0A 1QZEA 1O57A 5GPCA 2HFHA 3VDXA 3ZQHA 3CDLA 4M6XA 3DF8A 1WJ5A 4I0BA 1YFHA 2ZFWA 2EIJH 5D5WB 3B73A 4JYKA 3I4PA 2IAIA 1WKMA 4XKVA 1PP8F 1G4DA 2PJRB 3ROUA 4RAZA 1IV8A 3C3WA 1I5ZA 4F55A 1Y0NA 1ZQ3P 2JRTA 3OOPA 1E17A 1VQPI 4PJNA 4I09A 2X1CA 3UNGC 4ZTFA 2P7CB 1WCMJ 3DKYA 5BPDA 3K4BA 3QU3A 5FLMJ 2LD5A 2K9MA 5E17F 2DJNA 3B6AA 3BG5A 3OYKA 5BOXA 1YS7A 1ZR2A 1U0JA 2L7ZA 3I58A 2DT6A 2ZJQF 4XKWA 3S3OA 1EF4A 4OAYA 1YITI 3V4GA 3I3LA 2R3SA 5CVJA 1N77A 3JR9A 4OWRB 4HEA2 1XMKA 2F5CA 4RB1A 1PUFB 1TW3A 3GFLA 1JJ6C 2OQGA 2YS9A 3ZQ7A 3TEDA 3JRHA 4X0GA 4U0YA 3L9FA 4DYCA 2O8XA 3BPXA 2RNJA 2PJRA 4P9UA 2CG4A 4M9SA 2R93J 3MAJA 4F92B 4EGZA 4WCGA 1DP3A 3I55I 1QHGA 1VQ7I 3M3YJ 3FHNA 1Y6IA 2VBXA 5GAGJ 3E6CC 2NRAC 4XRSA 3J7AO 5J8CA 4LB5A 4UVAA 2B7EA 2ECCA 3LSRA 2V1XA 2EV5A 4YIFA 5TISC 3MWMA 2QBYA 3KYCB 3CD6I 3FIWA 2W1OA 2P81A 3AAFA 2QGUA 3LAPA 2OJED 3RPUA 2X6OA 1K83J 1U8RA 4I0AA 4KUMA 4BGDA 3NWTA 1RNLA 5EGOB 2Y69H 3A01B 1OCPA 2KJCA 5IYCJ 3PNVA 2ACJA 4IRHA 1QZZA 1BOAA 3JAMK 4D9JA 3ZMSA 5GAEJ 2JPCA 4HBLA 2Z9OA 4ZYEA 2R7SA 1HW1A 4A3EJ 4IRIA 2Z3YA 1C0WA 3TBIA 2AO9A 3GTKJ 2M45A 2DA5A 4OU0A 4EVIA 1SVOA 2L9SA 2Y0SN 5LFAA 2Y2ZA 5JVTA 5F0HA 1ZK8A 4G94A 3ZQFA 1SD7A 4LD5A 1B6AA 4BY7J 2HPMA 2ZSIB 3DBHB 2EQRA 1QU3A 3TO6A 3I5UA 2R7DA 4W97A 4ENJA 1XDSA 2XV4S 4XLCA 2IS2A 1USSA 3I56I 4FCYA 3A0BC 3HUGB 2X6WA 2HGCA 4UNOA 4OIRF 1NK2P 3FF5A 1I3QJ 5J4VA 2DA7A 4XKCA 1G3YA 5FB2A 2PN6A 2OTJI 1B8IB 3DKXA 3CCEI 3MCZA 2ISYA 5DD8A 2FA5A 1OQYA 3PIPF 3ZRGA 3SHFA 1A35A 4CZZA 1HC8A 3KX2A 2V6EA 1ZARA 3EUHC 4E70A 3OYEA 1T95A 4HNUA 3OS2A 3WHCA 2EJRA 3GCMA 1JUMA 3EETA 3BPVA 3DTIA 4AVPA 4L5IA 5M3FJ 2GA1A 2ID3A 1YLFA 2EFPA 3G1OA 1U8BA 3QODA 2HWVA 2LKPA 1IDYA 3CMYA 1HXDA 3DWLE 3K4KA 4A3BJ 1KU3A 2M5WA 2YPRA 4HX7A 1VQ4I 1MMSA 3P7NA 1O3QA 2YX7A 2HDWA 1BIAA 3Q3SA 2ZXWH 5H2FC 2BW3A 1RC9A 1S3JA 3LQRA 1MNDA 2E5NA 2WV0A 3HB9A 4ENMA 2OQRA 3OWTA 2XASA 5J1YA 4KDPA 4RAGA 1MW7A 4PCQA 4RS8A 1WPKA 3DKWA 3K4JA 3LSGA 2IS6A 2MW8A 3JRFA 4E7LA 1T0FC 2VXDA 2NVQJ 2DPUA 3G3ZA 4BE2A 2RV8A 2P5KA 1T2KA 3J80K 1MDMB 2XKOA 5F1JA 2V1UA 1QVTA 1RPWA 2HR3A 2HZDA 1MJ9A 1O4XA 1HDPA 1OCRH 2HXIA 4L9NA 5KAIC 1DP7P 1VQ9I 2IS4A 1U78A 1EA3A 2MLKA 2STTA 4S05A 5E3OA 4KN7X 1E2XA 2LKSA 2XRNA 3A02A 5EEHA 3S93A 1W7PB 2AHQA 4X6AJ 2FBIA 2VT3A 5IT3A 1T8IA 2DA6A 3P9CA 4PSXA 3HSEA 1IZ1A 2FD5A 5D6EA 2LG4A 1SAUA 2FF4A 5IYDJ 3KLNA 2O0YA 3F22A 3MKLA 1MZBA 1VZ0A 2WAQA 4XRFA 2VQCA 4FASD 2VKDA 3JAMZ 2FBHA 3K2ZA 1R5ID 3HKZN 1LE8A 1HF0A 3CJNA 2P4WA 4IHXA 2CV1A 5FJ8J 2GXAA 4Y13A 2X4HA 2HI3A 4II2A 5EG0A 2EA2A 3I54A 3BTIA 1D8KA 4M9XA 1HKTA 1R1VA 2HKOA 3KETA 4J01A 3IH4A 3HOWJ 4B4CA 3HSRA 5EEGA 3WODF 4GCVA 1XC5A 4BU2A 3CMAI 4C2UA 2VOPA 1ZLJA 2VLAA 1XMXA 2K9QA 3OYNA 1W5CC 2M9HA 4EQQA 1JGGA 1G3SA 2BOLA 2A3SA 2F4OB 3IRQA 1VQOI 1DU6A 2KQRA 2JT1A 3PNTA 1R5HA 5LGUA 1S7AA 2DLLA 1BBYA 4JX4A 5GTIC 2AQFA 4F91B 1EH7A 1VQ5I 2LF8A 4CH7A 3HIFA 1UELB 3F8BA 3TDUC 3GLXA 1I1GA 2H6CA 4YEJA 4MTDA 3QYEA
chains in the Genus database with same CATH topology
3DFGA 4Y17A 5FGMA 2M1BA 2QENA 1SAXA 1J7KA 1H0MA 5KK1A 2F2EA 2K4JA 3QPHA 4MNUA 3B02A 2ZMEA 3H3ZA 3BDDA 2FMLA 2XAFA 3R6SA 4L0ZB 3O2PE 4UV8A 2L54A 2XROA 1YYVA 3K1MA 2LSOA 3K1PA 1RIOH 1LVAA 4YFKF 3MFKA 2NAZA 2ZMEB 2ETHA 5LHIA 4GO1A 2H27A 2W25A 2QBYB 1XD7A 1OKRA 5E1WA 1H9TA 4ENKA 2CGPA 3WTUC 3LAJA 2JPBA 2RN7A 1ZRCA 3E5XA 4XLNF 1S7OA 4G7HF 3TOBA 5D5VB 4RB0A 2BGCA 1HW2A 3HYIA 1TQPA 3R0JA 1P2FA 1ZG3A 4L0YB 2V1DA 3ZN0A 1USTA 1U3EM 5HDKA 3IKTA 4BH9A 3CUQB 3C1DA 3QAHA 3QP6A 3BZ6A 1FNNA 4MEXF 3F6OA 4WXDA 5JR3A 1W5SA 3JSPA 3GZ5A 1TQMA 1RUOA 3HRMA 3ZMZA 3I71A 1XSXA 4CHUA 2JSCA 2QVOA 2V79A 4ZZLA 4ASNA 2V6CA 2MH9A 4KMFA 3FM3A 2H94A 4QWQA 4YFXF 1ZH5A 2GWRA 4TV7A 4EJTA 2J5PA 2FSWA 1K78A 1Z6RA 1Z1DA 4A6EA 4I7HA 5CLSA 4CXFA 5IT9Z 2IT0A 3RKXA 4OIQF 2DTRA 4LK1F 1HBXG 1YIOA 1FSEA 1YQAA 1U5TA 2ESNA 1BI2A 1JHHA 4HOBA 3T0YA 3JSOA 5E1XA 2ZKZA 1D8JA 1X3UA 3V8KA 5D4RA 1ON2A 3IWFA 3WTSC 3N4MA 2QZ8A 5CVVA 2ZCWA 3ZMDA 3NEUA 3W6JB 3SZTA 3GWZA 2G7HA 1QNTA 2XAHA 3FXUA 3FMSA 1ZG1A 4Z2YA 3T8RA 5J8FA 2K02A 3KZYA 3U2RA 4ESBA 2DO7A 3CLOA 5A2QK 4MQVA 3E6MA 2CO5A 5D5XB 5BMZA 2A6EF 3E6BA 1K7AA 4EJWA 3VOEA 1W7PA 5K5QA 4ZZDA 2V9VA 2X0LA 4NB5A 2D2WA 4G8XA 4Y15A 2GZWA 4ZYDA 4XLPF 3TO7A 1FY7A 4L9VA 1MGTA 5H6QA 2EA4A 2ESHA 1XDUA 5JHUA 1SMYF 3TDZC 3JTHA 4KIBA 1XB4A 4MEYF 3H92A 4M73A 2W57A 1OPCA 3T5XA 4RB2C 3FWEA 2DU9A 5BQTA 1ZGJA 4P9FA 4G7ZF 5HOOA 5E1ZB 1OR7A 2A69F 1LEAA 3HTUA 1YW8A 1LJ9A 4BYYA 2XGXA 3GX4X 4S04A 4JBAA 2GXBA 3BWGA 1IN8A 1SD5A 3ZMTA 2E7WA 4KT5C 1P4WA 4B09A 5HS8A 3JTGA 3DEUA 3BJAA 4HA8A 1V4RA 2XIGA 2ZNZA 3GFJA 4EM0B 4ENNA 3QRFF 1KQ9A 1XGSA 3GYHX 3LA2A 1QGPA 1MJAA 2P5LC 3M7GA 1REPC 4WX9A 3E3VA 4LMYA 4L9JA 5L3DA 1XGOA 2L02A 2QUFA 4HQMA 1KYWA 1CGPA 3GXOA 5L3GA 2QM3A 1TNSA 4RAYA 3MEXA 2ZO4A 3IL2A 4CGZA 4I98B 1Q1HA 1RZ4A 2QYOA 4U88A 3CUQA 2G7UA 3TGNA 4HLXA 1XSDA 4A0XA 4FHTA 2KIFA 1QO0D 2RQPA 1ZLKA 2OA4A 4G6QA 4KMUX 1FYMA 2PMHA 4AIHA 4U7DA 5E8GA 5L3FA 3REOA 2G9WA 1D3YA 1PP7U 5DV5A 4PGHA 2FOKA 1I27A 2ZXJA 4U0VA 1RUNA 3F3XA 4LLGF 3I53A 4ZYGA 2NNYA 4HF1A 2W85A 2MH2A 4DQ2A 2VOOA 5H20A 5LGTA 2VN2A 3HHGA 1K78B 2UZKA 3KP7A 4A6DA 4LK0F 5ICEA 3ML6A 4L9TA 3U1DA 2QQAA 3FMRA 4EMSA 4AWXB 4M74A 4KN4X 1P6RA 4BQAA 1U5TB 1XSVA 2XAGA 2ISZA 3G73A 1R5GA 3ABTA 2A07F 5FO5A 3SFZA 3EDPA 2K27A 1FZPB 2EFNA 4IRGA 2PBIA 1O3TA 2J5OA 1Z6TA 2DI3A 2P5VA 3LFKA 3R61A 1P4XA 1R36A 2HOEA 1MDMA 4OMYA 5FD5A 5LRSA 1J75A 2JTVA 2LDUA 5HLHA 1KQ0A 1R1UA 1ZGAA 1XCBA 2XVCA 3QP5A 3SQNA 2BYVE 1I1SA 3BOQA 3ULQB 3NRVA 1QZYA 2Q8KA 1BIBA 1IRFA 1FOKA 4L5JA 5TJJA 2UWMA 1XGNA 3ZMVA 2K86A 2VBWA 4NQWA 3V8JA 2GAUA 3KEOA 1T98A 1HQCA 1B9MA 1ULYA 3GZ6A 1R22A 3RJPA 3RI4A 1NHAA 3KP5A 3LA7A 1SFUA 4HAMA 3WTXC 2IJLA 1JHFA 1BC7C 4HF0A 5D8LB 3E5UA 1WI9A 1Y0UA 4MHGA 1KQ8A 2OD5A 3BY6A 2XKPA 3GF2A 5LHGA 4AD9A 3RKWA 3WU1B 2Y0MA 1J2XA 2PG4A 2E1CA 1J0RA 2Z99A 2A68F 1G6NA 1SFEA 2OU2A 1TNTA 3I59A 3L09A 3TO9A 1MJBA 1WSUA 1KU9A 1BI3A 3NQOA 4G7OF 2VODA 2UXNA 4F7ZA 1LDDA 2PFBA 3M9AA 2OZ6A 1EV7A 2FMYA 3OV8A 3ELKA 2K4BA 2O3FA 3WGIA 1EH6A 5K5RA 5HDGA 2P6SA 3I64A 1XGMA 3C18A 2AS5F 2IVMA 3RIRA 2DQLA 2ADUA 1EH8A 1FWZA 2Z5UA 1S6LA 4MGRA 2FEZA 4MQ9F 1BM9A 2EFOA 2M30A 2C6YA 1V3FA 4HYEA 2A5YB 2HYGD 1FX7A 4OIPF 3GEZA 1FLIA 3T1BA 2STWA 3MQ0A 3HHHA 1MKMA 3LWFA 1U6GA 2DBBA 2RC4A 1F1ZA 2EFWA 2VC1A 5DCFA 3CDHA 2RKHA 3S2WA 4OINF 1IN5A 3FMQA 2GIVA 4UXNA 4HLYA 1MD0A 3R0AA 3E5QA 2IPQX 4IXAA 3KLOA 3RKYA 5E18F 2IRFG 4ON0A 1GHCA 2CYYA 1ZG5A 2CFXA 4EJVA 2DK5A 3HRUA 2ELHA 3TOAA 4IPAA 1ZREA 5L3CA 2HZTA 1TTYA 4GYIA 2FQ3A 4P96A 2O6GE 3ERED 3ABUA 4CICA 3IWZA 2XAJA 3ISPA 1B59A 5ICFA 2FU4A 5DCMB 1S29A 3ZMUA 1IRGA 1UFMA 1FT9A 3K69A 1RI7A 4UVBA 2HQRA 3PQJA 1F5TA 4EV0A 2F5DA 4RB3C 1SMTA 3QOPA 3Q9SA 3HOSA 5DCMA 3WTWC 5DUIA 1I6XA 1PDNC 2CWEA 3KP6A 3L00A 2VONA 3ZP5A 3KE2A 4PGGA 4HF2A 2ZNYA 2ZBKA 2WWYA 1UHWA 4YIIA 4GXOA 4IHTA 1IN4A 1FBUA 1B4AA 1IW7F 3DV8A 4KIFA 1YTYA 1OMIA 5HS9A 1LB2A 5E8IA 1WQ2A 2L3DA 5ILUA 3WTTC 4UV9A 1W4MA 5CVIA 2MC3A 3T8TA 5DD4A 1HSJA 4A5MA 5BPIA 5CJ9A 2VE9A 3ZN1A 3F8FA 3BROA 2HYFA 5J6XA 4H0EA 4CDGA 4IJAA 5L3EA 1LDJA 4WXCA 1CF7A 4XSXF 3F8MA 4GGGA 5ICCA 4EJOA 3JW4A 5DYMA 1LDKB 5D5UB 4HZFA 3SXYA 5ILSA 3F8NA 1Z7UA 2DW4A 2PI0A 5D4SA 1LQ1A 3LQQA 1BC8C 4OIOF 1BI1A 3FM5A 2KIUA 1K79A 1CF7B 3C7JA 5ILVA 4HDVA 2GA2A 5TRDA 1STZA 2QWWA 2BEOA 1H9GA 1VTNC 3GW2A 3I59B 3KFWX 2BBYA 3FXQA 2QLZA 5K5OA 3EUHA 3Q9VA 1UHMA 2EWNA 1KGSA 3FX3A 4FT8A 3WTYC 4LB6B 3V7RA 3GFIA 2A6HF 2HDCA 5CVRA 1GXPA 2XAQA 2D1VA 4Q4ZF 4G9YA 4OMZA 3I0TA 1P4AA 1J5YA 2NNNA 2PEXA 1OYYA 5FLXK 1QBJA 2COMA 4A2UA 1FP1D 1K6OA 1FPQA 1T0FA 4A0YA 3MZHA 2HTSA 1HKQA 2EV6A 2Y75A 3WG9A 5D8KB 2RVCA 2O03A 3RYRA 5D6FA 4N0BA 3LSTA 4RGSA 1QPMA 4M6YA 4QLCU 3CO7C 1B9NA 3D0SA 3IC7A 5FLXZ 3V7SA 2FXAA 3K0LA 3HSFA 3KCCA 2PQ8A 4AIJA 5LGNA 4LFUA 2LF7A 2VT2A 4D0PA 4R1HA 1JXSA 1ZN2A 4RGRA 4JK1X 1XN7A 2IA2A 3KZZA 2VE8A 5ICGA 1Z9CA 1R58A 3W6KB 4HW0A 3F72A 4Q48A 2L4AA 4HQEA 4I2OA 1LEBA 2FNPA 1L3LA 1IN6A 4YG2F 4LLLA 1DPRA 4ESJA 4BNCA 4NHJA 4G6DA 4I02A 3CTAA 1TQIA 1IN7A 3WTZA 4KICA 3KP2A 4XSZF 1SD6A 1ON1A 3QPTA 4ETSA 3GVAA 4RGUA 2MD5A 4HV6A 1W7PD 2VBZA 4P55A 4R8HA 3TQNA 5LEJA 4KA4A 2P8TA 1KA8A 1R1TA 2A61A 1G3WA 2R7FA 1ZRFA 2OAZA 3LA3A 2IA0A 3F6VA 3CUQC 3VB2A 2W24A 1QQIA 4HX4A 3MZYA 2D1HA 1FYKA 2M8EA 1FBSA 1R23A 1U2WA 3J81K 5ERIA 2L4MA 4LJZF 1Z05A 5FD6A 3HTSB 2CQKA 4BHBA 4ZYHA 3RPQA 3COAC 4HX8A 2HEOA 2B0LA 1IXSB 2L01A 4LGWA 5F6FA 3VODA 2MA3A 2DFIA 4WF2A 1KYZA 2IW5A 3EYYA 5FFXA 2DAOA 4O6JA 2OBPA 1DDNA 5IT9K 4WWCA 3CUOA 2CW0F 5AIPA 2BE5F 1ZRDA 2JZYA 1T39A 4R79A 1SFXA 3WGGA 2H6BA 2E7XA 3V7CA 2RGVA 4EJUA 5LBQA 2ZJ2A 4GYGA 1AOYA 1IF1A 1HW5A 4IVNA 3DQVC 3KP3A 3GUDA 1XMAA 1YW9A 2IP2A 2Z33A 1UB9A 2QQ9A 3L7WA 3EQLF 5ED4A 4KIGA 2YX4A 3DP7A 2EK5A 5AONA 1B1BA 1L0OC 1GVJA 4DNCA 1BI0A 3O6BB 2XHKA 3TKYA 2FNAA 1S8NA 3RTRA 2YSRA 5HLIA 1OYWA 4IF4A 5LLQA 1FYLA 5HLGA 4BAYA 3WE2A 3K1NA 4EM1A 4CYDA 2Y48A 1O3RA 5LHHA 2FE3A 3BJ6A 2O61A 1SD4A 2HTJA 2M87A 1IXCA 1ODDA 4Q47A 2DK8A 1HKSA 2IA1A 5JI6A 4A5NA 1ZHFA 3HRTA 1ZAOA 4FX4A 3GFMA 2HQNA 3J80Z 4BHCA 1O7FA 4AIKA 3M8FA 4O5VA 5CYVA 4JQFA 3R60A 3WE3A 3QU6A 2P7VB 3GO5A 2FBKA 4UHTA 5JFRA 3DXJF 4UUVA 1D5VA 2NS0A 2KRFA 3P9IA 1WRJA 3R4KA 5AIQA 1O7LA 4M71A 3E97A 4CO8A 3P9KA 2HS5A 4ESFA 2QQBA 3M8EA 4MTEA 2F5FA 5HVQC 1JE8A 3HOTA 5CVUA 4L18B 1LNWA 5HDNA 2F5EA 6PAXA 2PMUA 4K2EA 4A12A 1TLHB 4EGYA 3PFIA 2KKOA 3KP4A 4ZH4F 2PLYA 3ECHA 2WTEA 3F8CA 3N97A 4FX0A 1TW2A 2VXZA 3L2CA 3F23A 1DUXC 3FZVA 5F1RA 1DPUA 1BN5A 1OYIA 1Z91A 4IHSA 3IRRA 2PJPA 1F4KA 4LLNA 3ECOA 1R00A 2YR2A 3K9TA 1R7JA 1WWXA 5HS7A 2E1NA 1BJAA 2D45A 4RGXA 3WTVC 1YO5C 1FC3A 2EB7A 5K1YA 3D5LA 3F21A 3KEQA 1FP2A 3SZPA 3WU0A 2NYXA 3BP8A 4WXHA 5F64A 4KYWA 5A2QZ 2UXXA 4Q5SF 2EFQA 1F9NA 2HKXA 3FHZA 3HUGA 3DPTA 1YG2A 3VEPA 2DPDA 3H3UA 4LG0A 2Q0OA 1U5TC 3ZPLA 1FSHA 1TBXA 3WGHA 4PZJA 5H6RA 4U7BA 2STTA 2CSOA 4OOIA 1P92A 4HV5A 4U0WA 3J81Z 3IKVA 3CO6C 4BXUA 3V8LA 1YW7A 4KFCA 2GXGA 1GXQA 1O3SA 5KVRA 4LG0B 1IAWA 3M1EA 1UCRA 4BHPA 1JGSA 3EYIA 2YU3A 1AWCA 1ONVA 1IXRC 3IHUA 1J59A 2P6TA 3FXRA 1YS6A 1XCVA 4B8XA 1ZYRF 4PDKA 1W5TA 2MLGA 1IUYA 2OZUA 5L3BA 4UVCA 1J9IA 3O3KA 5E20A 2XUBA 3RYPA 5FFZA 2K7LA 3Q5FA 2VC0A 2BV6A 2RDPA 4A0ZA 2KIMA 1FBQA 2VBYA 3BJOA 4N9IA 4P5OA 1KU7A 3PQKA 1G3TA 1PUEE 4WK8F 1KU2A 3HRSA 3VFZA 5BS6A 3E6DA 2AXLA 2DT5A 3U9GA 2TDXA 4I01A 4HDUA 4M72A 2LNBA 3DPLC 2Q2EA 4YFNF 2MBFA 2H09A 2GQQA 5DEQA 4XBFA 1A04A 1HSTA 5DDGA 4KNYA 4O3MA 5LRRA 2WC2A 1T38A 4N9HA 2EV0A 2KJBA 3RDIA 4EM2A 2W84A 1T6SA 5DUKA 2FRHA 2DQRA 5LEKA 4M9ZA 1O57A 2HFHA 4M6XA 3DF8A 4I0BA 1YFHA 2ZFWA 5D5WB 3B73A 3I4PA 1WKMA 1G4DA 1PP8F 3ROUA 4RAZA 3C3WA 1I5ZA 2JRTA 3OOPA 1E17A 4I09A 2P7CB 5BPDA 3QU3A 5E17F 5BOXA 1YS7A 3I58A 3V4GA 2R3SA 5CVJA 1XMKA 2F5CA 4RB1A 1TW3A 3GFLA 2OQGA 3ZQ7A 4U0YA 3L9FA 2O8XA 3BPXA 2RNJA 4P9UA 2CG4A 4M9SA 3MAJA 4EGZA 4WCGA 2VBXA 3E6CC 2NRAC 3J7AO 5J8CA 4LB5A 4UVAA 2V1XA 2EV5A 4YIFA 3MWMA 2QBYA 3AAFA 3LAPA 3RPUA 1U8RA 4I0AA 4KUMA 1RNLA 2KJCA 2ACJA 4IRHA 1QZZA 1BOAA 3JAMK 3ZMSA 2JPCA 4HBLA 2Z9OA 4ZYEA 1HW1A 4IRIA 2Z3YA 1C0WA 2M45A 4OU0A 4EVIA 5JVTA 4G94A 1SD7A 4LD5A 1B6AA 3TO6A 3I5UA 2R7DA 4ENJA 1XDSA 2XV4S 1USSA 4UNOA 2HGCA 4OIRF 3FF5A 1G3YA 5FB2A 2PN6A 3MCZA 2ISYA 5DD8A 2FA5A 3SHFA 4CZZA 1ZARA 4E70A 2EJRA 3EETA 3BPVA 4AVPA 4L5IA 2GA1A 1YLFA 2EFPA 2HWVA 2LKPA 1HXDA 1KU3A 2M5WA 2YPRA 4HX7A 3P7NA 1O3QA 2YX7A 1BIAA 1S3JA 3LQRA 2WV0A 4ENMA 2OQRA 2XASA 4KDPA 4RS8A 4PCQA 3DKWA 2DPUA 3G3ZA 1MDMB 2RV8A 1T2KA 2P5KA 3J80K 2XKOA 2V1UA 2HR3A 1MJ9A 4L9NA 1DP7P 1U78A 2MLKA 4S05A 4KN7X 1E2XA 2XRNA 5EEHA 1W7PB 2FBIA 2VT3A 5IT3A 3P9CA 1IZ1A 3HSEA 5D6EA 2FF4A 3KLNA 2O0YA 3F22A 1MZBA 4XRFA 3JAMZ 2FBHA 3K2ZA 3CJNA 2P4WA 4Y13A 2X4HA 2EA2A 3I54A 1D8KA 4M9XA 1HKTA 1R1VA 2HKOA 3KETA 3HSRA 5EEGA 3WODF 4GCVA 2VOPA 1ZLJA 4EQQA 1G3SA 2A3SA 3IRQA 2JT1A 1R5HA 5LGUA 1S7AA 2DLLA 1BBYA 1EH7A 2LF8A 3HIFA 3F8BA 3TDUC 3GLXA 1I1GA 2H6CA 4MTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DFG A;  4Y17 A;  5FGM A;  2M1B A;  2QEN A;  1SAX A;  1J7K A;  1H0M A;  5KK1 A;  2F2E A;  2K4J A;  3QPH A;  4MNU A;  3B02 A;  2ZME A;  3H3Z A;  3BDD A;  2FML A;  2XAF A;  3R6S A;  4L0Z B;  3O2P E;  4UV8 A;  2L54 A;  2XRO A;  1YYV A;  3K1M A;  2LSO A;  3K1P A;  1RIO H;  1LVA A;  4YFK F;  3MFK A;  2NAZ A;  2ZME B;  2ETH A;  5LHI A;  4GO1 A;  2H27 A;  2W25 A;  2QBY B;  1XD7 A;  1OKR A;  5E1W A;  1H9T A;  4ENK A;  2CGP A;  3WTU C;  3LAJ A;  2JPB A;  2RN7 A;  1ZRC A;  3E5X A;  4XLN F;  1S7O A;  4G7H F;  3TOB A;  5D5V B;  4RB0 A;  2BGC A;  1HW2 A;  3HYI A;  1TQP A;  3R0J A;  1P2F A;  1ZG3 A;  4L0Y B;  2V1D A;  3ZN0 A;  1UST A;  1U3E M;  5HDK A;  3IKT A;  4BH9 A;  3CUQ B;  3C1D A;  3QAH A;  3QP6 A;  3BZ6 A;  1FNN A;  4MEX F;  3F6O A;  4WXD A;  5JR3 A;  1W5S A;  3JSP A;  3GZ5 A;  1TQM A;  1RUO A;  3HRM A;  3ZMZ A;  3I71 A;  1XSX A;  4CHU A;  2JSC A;  2QVO A;  2V79 A;  4ZZL A;  4ASN A;  2V6C A;  2MH9 A;  4KMF A;  3FM3 A;  2H94 A;  4QWQ A;  4YFX F;  1ZH5 A;  2GWR A;  4TV7 A;  4EJT A;  2J5P A;  2FSW A;  1K78 A;  1Z6R A;  1Z1D A;  4A6E A;  4I7H A;  5CLS A;  4CXF A;  5IT9 Z;  2IT0 A;  3RKX A;  4OIQ F;  2DTR A;  4LK1 F;  1HBX G;  1YIO A;  1FSE A;  1YQA A;  1U5T A;  2ESN A;  1BI2 A;  1JHH A;  4HOB A;  3T0Y A;  3JSO A;  5E1X A;  2ZKZ A;  1D8J A;  1X3U A;  3V8K A;  5D4R A;  1ON2 A;  3IWF A;  3WTS C;  3N4M A;  2QZ8 A;  5CVV A;  2ZCW A;  3ZMD A;  3NEU A;  3W6J B;  3SZT A;  3GWZ A;  2G7H A;  1QNT A;  2XAH A;  3FXU A;  3FMS A;  1ZG1 A;  4Z2Y A;  3T8R A;  5J8F A;  2K02 A;  3KZY A;  3U2R A;  4ESB A;  2DO7 A;  3CLO A;  5A2Q K;  4MQV A;  3E6M A;  2CO5 A;  5D5X B;  5BMZ A;  2A6E F;  3E6B A;  1K7A A;  4EJW A;  3VOE A;  1W7P A;  5K5Q A;  4ZZD A;  2V9V A;  2X0L A;  4NB5 A;  2D2W A;  4G8X A;  4Y15 A;  2GZW A;  4ZYD A;  4XLP F;  3TO7 A;  1FY7 A;  4L9V A;  1MGT A;  5H6Q A;  2EA4 A;  2ESH A;  1XDU A;  5JHU A;  1SMY F;  3TDZ C;  3JTH A;  4KIB A;  1XB4 A;  4MEY F;  3H92 A;  4M73 A;  2W57 A;  1OPC A;  3T5X A;  4RB2 C;  3FWE A;  2DU9 A;  5BQT A;  1ZGJ A;  4P9F A;  4G7Z F;  5HOO A;  5E1Z B;  1OR7 A;  2A69 F;  1LEA A;  3HTU A;  1YW8 A;  1LJ9 A;  4BYY A;  2XGX A;  3GX4 X;  4S04 A;  4JBA A;  2GXB A;  3BWG A;  1IN8 A;  1SD5 A;  3ZMT A;  2E7W A;  4KT5 C;  1P4W A;  4B09 A;  5HS8 A;  3JTG A;  3DEU A;  3BJA A;  4HA8 A;  1V4R A;  2XIG A;  2ZNZ A;  3GFJ A;  4EM0 B;  4ENN A;  3QRF F;  1KQ9 A;  1XGS A;  3GYH X;  3LA2 A;  1QGP A;  1MJA A;  2P5L C;  3M7G A;  1REP C;  4WX9 A;  3E3V A;  4LMY A;  4L9J A;  5L3D A;  1XGO A;  2L02 A;  2QUF A;  4HQM A;  1KYW A;  1CGP A;  3GXO A;  5L3G A;  2QM3 A;  1TNS A;  4RAY A;  3MEX A;  2ZO4 A;  3IL2 A;  4CGZ A;  4I98 B;  1Q1H A;  1RZ4 A;  2QYO A;  4U88 A;  3CUQ A;  2G7U A;  3TGN A;  4HLX A;  1XSD A;  4A0X A;  4FHT A;  2KIF A;  1QO0 D;  2RQP A;  1ZLK A;  2OA4 A;  4G6Q A;  4KMU X;  1FYM A;  2PMH A;  4AIH A;  4U7D A;  5E8G A;  5L3F A;  3REO A;  2G9W A;  1D3Y A;  1PP7 U;  5DV5 A;  4PGH A;  2FOK A;  1I27 A;  2ZXJ A;  4U0V A;  1RUN A;  3F3X A;  4LLG F;  3I53 A;  4ZYG A;  2NNY A;  4HF1 A;  2W85 A;  2MH2 A;  4DQ2 A;  2VOO A;  5H20 A;  5LGT A;  2VN2 A;  3HHG A;  1K78 B;  2UZK A;  3KP7 A;  4A6D A;  4LK0 F;  5ICE A;  3ML6 A;  4L9T A;  3U1D A;  2QQA A;  3FMR A;  4EMS A;  4AWX B;  4M74 A;  4KN4 X;  1P6R A;  4BQA A;  1U5T B;  1XSV A;  2XAG A;  2ISZ A;  3G73 A;  1R5G A;  3ABT A;  2A07 F;  5FO5 A;  3SFZ A;  3EDP A;  2K27 A;  1FZP B;  2EFN A;  4IRG A;  2PBI A;  1O3T A;  2J5O A;  1Z6T A;  2DI3 A;  2P5V A;  3LFK A;  3R61 A;  1P4X A;  1R36 A;  2HOE A;  1MDM A;  4OMY A;  5FD5 A;  5LRS A;  1J75 A;  2JTV A;  2LDU A;  5HLH A;  1KQ0 A;  1R1U A;  1ZGA A;  1XCB A;  2XVC A;  3QP5 A;  3SQN A;  2BYV E;  1I1S A;  3BOQ A;  3ULQ B;  3NRV A;  1QZY A;  2Q8K A;  1BIB A;  1IRF A;  1FOK A;  4L5J A;  5TJJ A;  2UWM A;  1XGN A;  3ZMV A;  2K86 A;  2VBW A;  4NQW A;  3V8J A;  2GAU A;  3KEO A;  1T98 A;  1HQC A;  1B9M A;  1ULY A;  3GZ6 A;  1R22 A;  3RJP A;  3RI4 A;  1NHA A;  3KP5 A;  3LA7 A;  1SFU A;  4HAM A;  3WTX C;  2IJL A;  1JHF A;  1BC7 C;  4HF0 A;  5D8L B;  3E5U A;  1WI9 A;  1Y0U A;  4MHG A;  1KQ8 A;  2OD5 A;  3BY6 A;  2XKP A;  3GF2 A;  5LHG A;  4AD9 A;  3RKW A;  3WU1 B;  2Y0M A;  1J2X A;  2PG4 A;  2E1C A;  1J0R A;  2Z99 A;  2A68 F;  1G6N A;  1SFE A;  2OU2 A;  1TNT A;  3I59 A;  3L09 A;  3TO9 A;  1MJB A;  1WSU A;  1KU9 A;  1BI3 A;  3NQO A;  4G7O F;  2VOD A;  2UXN A;  4F7Z A;  1LDD A;  2PFB A;  3M9A A;  2OZ6 A;  1EV7 A;  2FMY A;  3OV8 A;  3ELK A;  2K4B A;  2O3F A;  3WGI A;  1EH6 A;  5K5R A;  5HDG A;  2P6S A;  3I64 A;  1XGM A;  3C18 A;  2AS5 F;  2IVM A;  3RIR A;  2DQL A;  2ADU A;  1EH8 A;  1FWZ A;  2Z5U A;  1S6L A;  4MGR A;  2FEZ A;  4MQ9 F;  1BM9 A;  2EFO A;  2M30 A;  2C6Y A;  1V3F A;  4HYE A;  2A5Y B;  2HYG D;  1FX7 A;  4OIP F;  3GEZ A;  1FLI A;  3T1B A;  2STW A;  3MQ0 A;  3HHH A;  1MKM A;  3LWF A;  1U6G A;  2DBB A;  2RC4 A;  1F1Z A;  2EFW A;  2VC1 A;  5DCF A;  3CDH A;  2RKH A;  3S2W A;  4OIN F;  1IN5 A;  3FMQ A;  2GIV A;  4UXN A;  4HLY A;  1MD0 A;  3R0A A;  3E5Q A;  2IPQ X;  4IXA A;  3KLO A;  3RKY A;  5E18 F;  2IRF G;  4ON0 A;  1GHC A;  2CYY A;  1ZG5 A;  2CFX A;  4EJV A;  2DK5 A;  3HRU A;  2ELH A;  3TOA A;  4IPA A;  1ZRE A;  5L3C A;  2HZT A;  1TTY A;  4GYI A;  2FQ3 A;  4P96 A;  2O6G E;  3ERE D;  3ABU A;  4CIC A;  3IWZ A;  2XAJ A;  3ISP A;  1B59 A;  5ICF A;  2FU4 A;  5DCM B;  1S29 A;  3ZMU A;  1IRG A;  1UFM A;  1FT9 A;  3K69 A;  1RI7 A;  4UVB A;  2HQR A;  3PQJ A;  1F5T A;  4EV0 A;  2F5D A;  4RB3 C;  1SMT A;  3QOP A;  3Q9S A;  3HOS A;  5DCM A;  3WTW C;  5DUI A;  1I6X A;  1PDN C;  2CWE A;  3KP6 A;  3L00 A;  2VON A;  3ZP5 A;  3KE2 A;  4PGG A;  4HF2 A;  2ZNY A;  2ZBK A;  2WWY A;  1UHW A;  4YII A;  4GXO A;  4IHT A;  1IN4 A;  1FBU A;  1B4A A;  1IW7 F;  3DV8 A;  4KIF A;  1YTY A;  1OMI A;  5HS9 A;  1LB2 A;  5E8I A;  1WQ2 A;  2L3D A;  5ILU A;  3WTT C;  4UV9 A;  1W4M A;  5CVI A;  2MC3 A;  3T8T A;  5DD4 A;  1HSJ A;  4A5M A;  5BPI A;  5CJ9 A;  2VE9 A;  3ZN1 A;  3F8F A;  3BRO A;  2HYF A;  5J6X A;  4H0E A;  4CDG A;  4IJA A;  5L3E A;  1LDJ A;  4WXC A;  1CF7 A;  4XSX F;  3F8M A;  4GGG A;  5ICC A;  4EJO A;  3JW4 A;  5DYM A;  1LDK B;  5D5U B;  4HZF A;  3SXY A;  5ILS A;  3F8N A;  1Z7U A;  2DW4 A;  2PI0 A;  5D4S A;  1LQ1 A;  3LQQ A;  1BC8 C;  4OIO F;  1BI1 A;  3FM5 A;  2KIU A;  1K79 A;  1CF7 B;  3C7J A;  5ILV A;  4HDV A;  2GA2 A;  5TRD A;  1STZ A;  2QWW A;  2BEO A;  1H9G A;  1VTN C;  3GW2 A;  3I59 B;  3KFW X;  2BBY A;  3FXQ A;  2QLZ A;  5K5O A;  3EUH A;  3Q9V A;  1UHM A;  2EWN A;  1KGS A;  3FX3 A;  4FT8 A;  3WTY C;  4LB6 B;  3V7R A;  3GFI A;  2A6H F;  2HDC A;  5CVR A;  1GXP A;  2XAQ A;  2D1V A;  4Q4Z F;  4G9Y A;  4OMZ A;  3I0T A;  1P4A A;  1J5Y A;  2NNN A;  2PEX A;  1OYY A;  5FLX K;  1QBJ A;  2COM A;  4A2U A;  1FP1 D;  1K6O A;  1FPQ A;  1T0F A;  4A0Y A;  3MZH A;  2HTS A;  1HKQ A;  2EV6 A;  2Y75 A;  3WG9 A;  5D8K B;  2RVC A;  2O03 A;  3RYR A;  5D6F A;  4N0B A;  3LST A;  4RGS A;  1QPM A;  4M6Y A;  4QLC U;  3CO7 C;  1B9N A;  3D0S A;  3IC7 A;  5FLX Z;  3V7S A;  2FXA A;  3K0L A;  3HSF A;  3KCC A;  2PQ8 A;  4AIJ A;  5LGN A;  4LFU A;  2LF7 A;  2VT2 A;  4D0P A;  4R1H A;  1JXS A;  1ZN2 A;  4RGR A;  4JK1 X;  1XN7 A;  2IA2 A;  3KZZ A;  2VE8 A;  5ICG A;  1Z9C A;  1R58 A;  3W6K B;  4HW0 A;  3F72 A;  4Q48 A;  2L4A A;  4HQE A;  4I2O A;  1LEB A;  2FNP A;  1L3L A;  1IN6 A;  4YG2 F;  4LLL A;  1DPR A;  4ESJ A;  4BNC A;  4NHJ A;  4G6D A;  4I02 A;  3CTA A;  1TQI A;  1IN7 A;  3WTZ A;  4KIC A;  3KP2 A;  4XSZ F;  1SD6 A;  1ON1 A;  3QPT A;  4ETS A;  3GVA A;  4RGU A;  2MD5 A;  4HV6 A;  1W7P D;  2VBZ A;  4P55 A;  4R8H A;  3TQN A;  5LEJ A;  4KA4 A;  2P8T A;  1KA8 A;  1R1T A;  2A61 A;  1G3W A;  2R7F A;  1ZRF A;  2OAZ A;  3LA3 A;  2IA0 A;  3F6V A;  3CUQ C;  3VB2 A;  2W24 A;  1QQI A;  4HX4 A;  3MZY A;  2D1H A;  1FYK A;  2M8E A;  1FBS A;  1R23 A;  1U2W A;  3J81 K;  5ERI A;  2L4M A;  4LJZ F;  1Z05 A;  5FD6 A;  3HTS B;  2CQK A;  4BHB A;  4ZYH A;  3RPQ A;  3COA C;  4HX8 A;  2HEO A;  2B0L A;  1IXS B;  2L01 A;  4LGW A;  5F6F A;  3VOD A;  2MA3 A;  2DFI A;  4WF2 A;  1KYZ A;  2IW5 A;  3EYY A;  5FFX A;  2DAO A;  4O6J A;  2OBP A;  1DDN A;  5IT9 K;  4WWC A;  3CUO A;  2CW0 F;  5AIP A;  2BE5 F;  1ZRD A;  2JZY A;  1T39 A;  4R79 A;  1SFX A;  3WGG A;  2H6B A;  2E7X A;  3V7C A;  2RGV A;  4EJU A;  5LBQ A;  2ZJ2 A;  4GYG A;  1AOY A;  1IF1 A;  1HW5 A;  4IVN A;  3DQV C;  3KP3 A;  3GUD A;  1XMA A;  1YW9 A;  2IP2 A;  2Z33 A;  1UB9 A;  2QQ9 A;  3L7W A;  3EQL F;  5ED4 A;  4KIG A;  2YX4 A;  3DP7 A;  2EK5 A;  5AON A;  1B1B A;  1L0O C;  1GVJ A;  4DNC A;  1BI0 A;  3O6B B;  2XHK A;  3TKY A;  2FNA A;  1S8N A;  3RTR A;  2YSR A;  5HLI A;  1OYW A;  4IF4 A;  5LLQ A;  1FYL A;  5HLG A;  4BAY A;  3WE2 A;  3K1N A;  4EM1 A;  4CYD A;  2Y48 A;  1O3R A;  5LHH A;  2FE3 A;  3BJ6 A;  2O61 A;  1SD4 A;  2HTJ A;  2M87 A;  1IXC A;  1ODD A;  4Q47 A;  2DK8 A;  1HKS A;  2IA1 A;  5JI6 A;  4A5N A;  1ZHF A;  3HRT A;  1ZAO A;  4FX4 A;  3GFM A;  2HQN A;  3J80 Z;  4BHC A;  1O7F A;  4AIK A;  3M8F A;  4O5V A;  5CYV A;  4JQF A;  3R60 A;  3WE3 A;  3QU6 A;  2P7V B;  3GO5 A;  2FBK A;  4UHT A;  5JFR A;  3DXJ F;  4UUV A;  1D5V A;  2NS0 A;  2KRF A;  3P9I A;  1WRJ A;  3R4K A;  5AIQ A;  1O7L A;  4M71 A;  3E97 A;  4CO8 A;  3P9K A;  2HS5 A;  4ESF A;  2QQB A;  3M8E A;  4MTE A;  2F5F A;  5HVQ C;  1JE8 A;  3HOT A;  5CVU A;  4L18 B;  1LNW A;  5HDN A;  2F5E A;  6PAX A;  2PMU A;  4K2E A;  4A12 A;  1TLH B;  4EGY A;  3PFI A;  2KKO A;  3KP4 A;  4ZH4 F;  2PLY A;  3ECH A;  2WTE A;  3F8C A;  3N97 A;  4FX0 A;  1TW2 A;  2VXZ A;  3L2C A;  3F23 A;  1DUX C;  3FZV A;  5F1R A;  1DPU A;  1BN5 A;  1OYI A;  1Z91 A;  4IHS A;  3IRR A;  2PJP A;  1F4K A;  4LLN A;  3ECO A;  1R00 A;  2YR2 A;  3K9T A;  1R7J A;  1WWX A;  5HS7 A;  2E1N A;  1BJA A;  2D45 A;  4RGX A;  3WTV C;  1YO5 C;  1FC3 A;  2EB7 A;  5K1Y A;  3D5L A;  3F21 A;  3KEQ A;  1FP2 A;  3SZP A;  3WU0 A;  2NYX A;  3BP8 A;  4WXH A;  5F64 A;  4KYW A;  5A2Q Z;  2UXX A;  4Q5S F;  2EFQ A;  1F9N A;  2HKX A;  3FHZ A;  3HUG A;  3DPT A;  1YG2 A;  3VEP A;  2DPD A;  3H3U A;  4LG0 A;  2Q0O A;  1U5T C;  3ZPL A;  1FSH A;  1TBX A;  3WGH A;  4PZJ A;  5H6R A;  4U7B A;  2STT A;  2CSO A;  4OOI A;  1P92 A;  4HV5 A;  4U0W A;  3J81 Z;  3IKV A;  3CO6 C;  4BXU A;  3V8L A;  1YW7 A;  4KFC A;  2GXG A;  1GXQ A;  1O3S A;  5KVR A;  4LG0 B;  1IAW A;  3M1E A;  1UCR A;  4BHP A;  1JGS A;  3EYI A;  2YU3 A;  1AWC A;  1ONV A;  1IXR C;  3IHU A;  1J59 A;  2P6T A;  3FXR A;  1YS6 A;  1XCV A;  4B8X A;  1ZYR F;  4PDK A;  1W5T A;  2MLG A;  1IUY A;  2OZU A;  5L3B A;  4UVC A;  1J9I A;  3O3K A;  5E20 A;  2XUB A;  3RYP A;  5FFZ A;  2K7L A;  3Q5F A;  2VC0 A;  2BV6 A;  2RDP A;  4A0Z A;  2KIM A;  1FBQ A;  2VBY A;  3BJO A;  4N9I A;  4P5O A;  1KU7 A;  3PQK A;  1G3T A;  1PUE E;  4WK8 F;  1KU2 A;  3HRS A;  3VFZ A;  5BS6 A;  3E6D A;  2AXL A;  2DT5 A;  3U9G A;  2TDX A;  4I01 A;  4HDU A;  4M72 A;  2LNB A;  3DPL C;  2Q2E A;  4YFN F;  2MBF A;  2H09 A;  2GQQ A;  5DEQ A;  4XBF A;  1A04 A;  1HST A;  5DDG A;  4KNY A;  4O3M A;  5LRR A;  2WC2 A;  1T38 A;  4N9H A;  2EV0 A;  2KJB A;  3RDI A;  4EM2 A;  2W84 A;  1T6S A;  5DUK A;  2FRH A;  2DQR A;  5LEK A;  4M9Z A;  1O57 A;  2HFH A;  4M6X A;  3DF8 A;  4I0B A;  1YFH A;  2ZFW A;  5D5W B;  3B73 A;  3I4P A;  1WKM A;  1G4D A;  1PP8 F;  3ROU A;  4RAZ A;  3C3W A;  1I5Z A;  2JRT A;  3OOP A;  1E17 A;  4I09 A;  2P7C B;  5BPD A;  3QU3 A;  5E17 F;  5BOX A;  1YS7 A;  3I58 A;  3V4G A;  2R3S A;  5CVJ A;  1XMK A;  2F5C A;  4RB1 A;  1TW3 A;  3GFL A;  2OQG A;  3ZQ7 A;  4U0Y A;  3L9F A;  2O8X A;  3BPX A;  2RNJ A;  4P9U A;  2CG4 A;  4M9S A;  3MAJ A;  4EGZ A;  4WCG A;  2VBX A;  3E6C C;  2NRA C;  3J7A O;  5J8C A;  4LB5 A;  4UVA A;  2V1X A;  2EV5 A;  4YIF A;  3MWM A;  2QBY A;  3AAF A;  3LAP A;  3RPU A;  1U8R A;  4I0A A;  4KUM A;  1RNL A;  2KJC A;  2ACJ A;  4IRH A;  1QZZ A;  1BOA A;  3JAM K;  3ZMS A;  2JPC A;  4HBL A;  2Z9O A;  4ZYE A;  1HW1 A;  4IRI A;  2Z3Y A;  1C0W A;  2M45 A;  4OU0 A;  4EVI A;  5JVT A;  4G94 A;  1SD7 A;  4LD5 A;  1B6A A;  3TO6 A;  3I5U A;  2R7D A;  4ENJ A;  1XDS A;  2XV4 S;  1USS A;  4UNO A;  2HGC A;  4OIR F;  3FF5 A;  1G3Y A;  5FB2 A;  2PN6 A;  3MCZ A;  2ISY A;  5DD8 A;  2FA5 A;  3SHF A;  4CZZ A;  1ZAR A;  4E70 A;  2EJR A;  3EET A;  3BPV A;  4AVP A;  4L5I A;  2GA1 A;  1YLF A;  2EFP A;  2HWV A;  2LKP A;  1HXD A;  1KU3 A;  2M5W A;  2YPR A;  4HX7 A;  3P7N A;  1O3Q A;  2YX7 A;  1BIA A;  1S3J A;  3LQR A;  2WV0 A;  4ENM A;  2OQR A;  2XAS A;  4KDP A;  4RS8 A;  4PCQ A;  3DKW A;  2DPU A;  3G3Z A;  1MDM B;  2RV8 A;  1T2K A;  2P5K A;  3J80 K;  2XKO A;  2V1U A;  2HR3 A;  1MJ9 A;  4L9N A;  1DP7 P;  1U78 A;  2MLK A;  4S05 A;  4KN7 X;  1E2X A;  2XRN A;  5EEH A;  1W7P B;  2FBI A;  2VT3 A;  5IT3 A;  3P9C A;  1IZ1 A;  3HSE A;  5D6E A;  2FF4 A;  3KLN A;  2O0Y A;  3F22 A;  1MZB A;  4XRF A;  3JAM Z;  2FBH A;  3K2Z A;  3CJN A;  2P4W A;  4Y13 A;  2X4H A;  2EA2 A;  3I54 A;  1D8K A;  4M9X A;  1HKT A;  1R1V A;  2HKO A;  3KET A;  3HSR A;  5EEG A;  3WOD F;  4GCV A;  2VOP A;  1ZLJ A;  4EQQ A;  1G3S A;  2A3S A;  3IRQ A;  2JT1 A;  1R5H A;  5LGU A;  1S7A A;  2DLL A;  1BBY A;  1EH7 A;  2LF8 A;  3HIF A;  3F8B A;  3TDU C;  3GLX A;  1I1G A;  2H6C A;  4MTD A; 
#chains in the Genus database with same CATH topology
 3DFG A;  4Y17 A;  2K3P A;  5FGM A;  4B1R A;  2M1B A;  2X48 A;  2QEN A;  5FKK A;  1SAX A;  1J7K A;  1MNE A;  1TWA J;  1G2H A;  1H0M A;  3PO2 J;  4LIU A;  3DTK A;  5KK1 A;  3VSL A;  2F2E A;  1YRN B;  1EJ9 A;  2K4J A;  3QPH A;  4MNU A;  3B02 A;  3WU2 C;  2X1D A;  1YOV B;  2ZME A;  3H3Z A;  2KP6 A;  4BY1 J;  3BDD A;  2FML A;  2XAF A;  4BQO A;  3R6S A;  3RZD J;  4L0Z B;  1FTZ A;  2GM4 A;  3O2P E;  4IHW A;  4KIS A;  4UV8 A;  2L54 A;  2XRO A;  1YYV A;  3OOU A;  3K1M A;  2CUE A;  2LSO A;  2NVT J;  1DQU A;  2M7A A;  3K1P A;  1RIO H;  1D1A A;  1E0E A;  1LVA A;  4YFK F;  3MFK A;  1P7J A;  2HOS A;  4NBQ A;  2NAZ A;  2KIS A;  4C3I J;  2ZME B;  4IL6 C;  2ETH A;  5LHI A;  2NXN B;  4GO1 A;  2H27 A;  2ZXH A;  2W25 A;  4JOM A;  3X2Q H;  2QBY B;  1XD7 A;  1OKR A;  5E1W A;  1H9T A;  4ENK A;  2CGP A;  3WTU C;  2QSF X;  3LAJ A;  2JPB A;  1FIP A;  1NG7 A;  2EIM H;  2RN7 A;  1ZR4 A;  1ZRC A;  1WGX A;  3E5X A;  4XLN F;  1S7O A;  4G7H F;  2L0K A;  3OIP A;  3TOB A;  3LSM A;  2JQ7 A;  5D5V B;  2MAB A;  4RB0 A;  2BGC A;  1HW2 A;  3HYI A;  1TQP A;  4F93 B;  3R0J A;  4JP0 A;  3OL4 A;  3VYR B;  5C44 J;  1P2F A;  3FXK A;  2R7R A;  1ZG3 A;  3ABM H;  1OCT C;  2K9L A;  2VB6 A;  5J47 A;  1XG1 A;  4L0Y B;  2V1D A;  3ZN0 A;  1UST A;  1VQL I;  1U3E M;  4E6K G;  4V19 K;  4MFD A;  4M6V A;  2DMP A;  5HDK A;  1W0T A;  3IKT A;  4BH9 A;  2Y9Z A;  3CUQ B;  3C1D A;  3NWS A;  2EZI A;  3QAH A;  3QP6 A;  3S14 J;  3U21 A;  3HOZ J;  2LVS A;  3BZ6 A;  1FNN A;  2XGD A;  4XOT A;  2AXT C;  4MEX F;  2VKH A;  3F6O A;  3IH3 A;  5EDN A;  4WXD A;  5JR3 A;  1JI8 A;  2B9S A;  1W5S A;  2L9R A;  3JSP A;  3GZ5 A;  1TQM A;  4MO7 A;  1RUO A;  2QSH X;  2Y31 A;  2VL8 A;  3ABK H;  3HRM A;  2XPV A;  3FKI J;  4DZJ A;  3H36 A;  2DOD A;  3CCR I;  5BNG A;  1X58 A;  4IO9 F;  3ZMZ A;  2ICW G;  4HNV A;  3I71 A;  1XSX A;  3A01 A;  4UY8 I;  4CHU A;  2JSC A;  2QVO A;  2V79 A;  4ZZL A;  4ASN A;  2V6C A;  2MH9 A;  1GV2 A;  1YI2 I;  4KMF A;  3FM3 A;  2H94 A;  4QWQ A;  4II3 A;  4YFX F;  3OMY A;  1TWC J;  2LFB A;  3AG2 H;  1ZH5 A;  2LY1 A;  2GWR A;  3M07 A;  4TV7 A;  4EJT A;  2J5P A;  2COB A;  2FSW A;  3F0C A;  2GIZ A;  1E3P A;  2KFD A;  1K78 A;  5J40 A;  3FBN B;  2EZH A;  1WJA A;  1Z6R A;  1Z1D A;  4A6E A;  4I7H A;  5CLS A;  4CXF A;  5IT9 Z;  2IT0 A;  3PL8 A;  3RKX A;  3M1C A;  1X4P A;  4HNT A;  1ACI A;  4OIQ F;  1AHD P;  2DTR A;  4LK1 F;  1HBX G;  1YIO A;  1FSE A;  4P1W A;  1BA5 A;  2VPR A;  3K70 C;  1YQA A;  4BQN A;  1U5T A;  2ESN A;  1BI2 A;  3LSI A;  1JHH A;  4CCM A;  3CCU I;  4HOB A;  3T0Y A;  2V7F A;  3GTQ J;  3JSO A;  4ZDL A;  3SDG A;  2LR8 A;  3RZO J;  1N75 A;  5E1X A;  2ZKZ A;  3SZG A;  1D8J A;  1X3U A;  3V8K A;  3S1R J;  2CUF A;  5D4R A;  1ON2 A;  3IWF A;  4BBS J;  3WTS C;  3N4M A;  2X1E A;  3H1C A;  1OLT A;  2QZ8 A;  5CVV A;  2R7U A;  2ZCW A;  1FMW A;  3ZMD A;  4XLF A;  3MKZ A;  2ELK A;  2EIN H;  1LFP A;  2XF7 A;  3NEU A;  1FTT A;  3W6J B;  4NC7 A;  3CJQ B;  4D7M A;  3LSK A;  4DBQ A;  4IQJ A;  3SZT A;  2R7V A;  1QRY A;  3GWZ A;  1QNT A;  2G7H A;  2M4K A;  4B47 A;  2XAH A;  4B3X A;  3WG7 H;  3FXU A;  4DYQ A;  3FMS A;  1ZG1 A;  1H8A C;  1Y8Q B;  4Z2Y A;  3T8R A;  4BEH A;  4CCO A;  2K02 A;  5J8F A;  3CCS I;  3O8H A;  3KZY A;  1R4M B;  3U2R A;  4ESB A;  2DO7 A;  4XM3 A;  4XMY A;  1V5F A;  5GAD J;  5FLV A;  3CLO A;  4E7K A;  4PFP A;  5A2Q K;  4MQV A;  3E6M A;  2CO5 A;  2PMZ A;  3OYI A;  4A3J J;  5D5X B;  1YHQ I;  1JTX A;  5BMZ A;  2A6E F;  3E6B A;  1K7A A;  1UJ8 A;  1K4S A;  3B6C A;  4EJW A;  3VOE A;  1X1P A;  3MD2 A;  1W7P A;  5K5Q A;  4A93 J;  2ME6 A;  4ZZD A;  5C3E J;  2V9V A;  2X0L A;  3QYF A;  4NB5 A;  3VYS B;  1BR4 A;  1YX3 A;  2D2W A;  4G8X A;  2V26 A;  3SDB A;  3OS0 A;  4RAF A;  4Y15 A;  1A6I A;  1U9O A;  4BE1 A;  1ZGW A;  2GZW A;  4ZYD A;  3SEZ A;  4XLP F;  1ZTR A;  3TO7 A;  4ZDO A;  4DW6 A;  1FY7 A;  4L9V A;  1MGT A;  3PSF A;  5H6Q A;  1GVD A;  1Y39 A;  2EA4 A;  3C2B A;  2ESH A;  1XDU A;  2VQG A;  5JHU A;  1SMY F;  3TDZ C;  1WJB A;  3ZGK A;  2GLO A;  3JTH A;  4N4N B;  4KIB A;  1R9T J;  2E36 A;  1ETO A;  3PNY A;  1XB4 A;  4MEY F;  2QEX I;  3H92 A;  4M73 A;  5KCM A;  2W57 A;  1OPC A;  3AG1 H;  1ORK A;  1GV5 A;  2X6Y A;  4BXF A;  4LOC A;  3T5X A;  4RB2 C;  3FWE A;  2DU9 A;  5BQT A;  1IUF A;  4KT6 A;  1ZGJ A;  1MMG A;  2IGN A;  4P9F A;  4G7Z F;  2Q2E B;  1JKQ C;  2BY3 A;  2TCT A;  1OCZ H;  2PX9 A;  5HOO A;  5E1Z B;  2B63 J;  1OR7 A;  2EZK A;  3BCB A;  1NH3 A;  5DTD A;  2A69 F;  1FOX A;  1LEA A;  3OYJ A;  4BUP A;  3HTU A;  5GAH J;  4YIR X;  2DMQ A;  1YW8 A;  1LJ9 A;  3W2V A;  4BYY A;  4HG2 A;  1WJE A;  2XGX A;  3GX4 X;  4S04 A;  4JBA A;  4FTH A;  2GXB A;  3BWG A;  1IN8 A;  4PJL A;  3AL0 C;  2JA8 J;  1SD5 A;  2P0W A;  3HGY A;  3G6E I;  1VQN I;  3BTL A;  3ZMT A;  4BDZ A;  1A6Q A;  2A05 A;  2VQH A;  2E7W A;  4XL9 A;  5CKT A;  2X85 A;  3VSK A;  4KT5 C;  3KYD B;  5FKN A;  1MNM C;  2HDD A;  1P4W A;  4QIW N;  4LIV A;  1GT0 C;  3BZK A;  4B09 A;  5HS8 A;  1VFC A;  3OYC A;  3JTG A;  3DEU A;  1V5E A;  2RQQ A;  3BJA A;  4HA8 A;  3A4C A;  4KJZ A;  1V4R A;  2XIG A;  2ZNZ A;  1W36 C;  3BR2 A;  2EIL H;  3GFJ A;  4EM0 B;  3HPH A;  1WHU A;  2OV7 A;  3MVP A;  4ENN A;  1RRJ A;  2YU9 J;  3DLL F;  3QRF F;  1KQ9 A;  1XGS A;  3GYH X;  3BG3 A;  3I4N J;  3LA2 A;  1QGP A;  2HQ5 A;  1MJA A;  2HVR A;  3QPL A;  3I4M J;  2P5L C;  3S17 J;  4IOA F;  3M7G A;  1REP C;  2CU7 A;  4C3J J;  4WX9 A;  3E3V A;  4LMY A;  5JHF A;  4L9J A;  5IY5 H;  5B1A H;  2M7B A;  3HBL A;  2LMD A;  2DFF A;  5L3D A;  1XGO A;  2L02 A;  2JVH A;  2QUF A;  4HQM A;  1KYW A;  3OYA A;  1Z3Y A;  1CGP A;  5EYR A;  3L2W A;  3GXO A;  5L3G A;  2QM3 A;  3KZI C;  1TNS A;  4RAY A;  5IP9 J;  3MEX A;  2ZO4 A;  3IL2 A;  1R71 A;  4CGZ A;  3HGG A;  4I98 B;  1Q1H A;  1TT0 A;  1YJW I;  1RZ4 A;  1JKP C;  2QYO A;  1FOY A;  2HVS A;  2OCC H;  5M5X J;  1AU7 A;  4A3L J;  2K9S A;  4U88 A;  1LPQ A;  2BZT A;  3S32 A;  3RPU D;  3CUQ A;  2G7U A;  2RRE A;  5CPR B;  3TGN A;  3BZC A;  3JRI A;  1HDD C;  4HLX A;  2DFH A;  1XSD A;  4A0X A;  4FHT A;  2R7W A;  3L2Q A;  2KIF A;  2RAE A;  1QO0 D;  2RQP A;  1ZLK A;  3L2V A;  2OA4 A;  2I10 A;  2HQA A;  3I9V 2;  4NC6 A;  1VQ6 I;  3D1N I;  4G6Q A;  4KMU X;  1FYM A;  2DDB A;  3HOU J;  1JUS A;  2PMH A;  4AIH A;  4MLO A;  1IDZ A;  5FRM A;  3U1K A;  5K7H A;  4B44 A;  4U7D A;  5FKO A;  2Q1Z B;  3CC4 I;  4Y52 J;  5E8G A;  5L3F A;  1ENH A;  3REO A;  2G9W A;  1MH3 A;  1D3Y A;  9ANT A;  1PP7 U;  4E7S A;  3IAS 2;  4BBR J;  1N25 A;  3HG9 A;  4PGH A;  5DV5 A;  2FOK A;  1I27 A;  2ZXJ A;  3RSN A;  4U0V A;  3JRA A;  1RUN A;  2OPT A;  3F3X A;  4CA0 A;  1QPI A;  4LLG F;  2HOT A;  1ITY A;  3I53 A;  2UUZ A;  2DOF A;  3ZR8 X;  1FMV A;  4ZYG A;  2NNY A;  4HF1 A;  4G6T B;  2OUM A;  2DMT A;  1BR2 A;  2W85 A;  3JRG A;  5IOY A;  2EBI A;  2MH2 A;  4DQ2 A;  2VOO A;  5H20 A;  3CCL I;  5LGT A;  2VN2 A;  2CJJ A;  3OYH A;  3SEQ A;  3HHG A;  1MBH A;  1K78 B;  2UZK A;  3KP7 A;  1WH5 A;  4A6D A;  4LK0 F;  4C3H J;  2WAF A;  2DYR H;  5ICE A;  4NDL A;  2LRD A;  3BG6 A;  3ML6 A;  4OAZ A;  2NOJ B;  4RDU A;  4L9T A;  3U1D A;  2QQA A;  2OCE A;  2W4S A;  3E7L A;  3QQA A;  1JKR C;  3FMR A;  3FIS A;  4EMS A;  2E1M C;  1Z3X A;  3TW7 A;  4AWX B;  4M74 A;  3BCA A;  3LNQ A;  2DA4 A;  4KN4 X;  3CME I;  1IGN A;  1P6R A;  5F27 A;  4BQA A;  1U5T B;  1JTY A;  2IGM A;  1XSV A;  4C2M J;  2XAG A;  4PFO A;  1UMQ A;  1I39 A;  1KON A;  2BW3 B;  3Q0U A;  4XIC A;  2ISZ A;  3G73 A;  3G4S I;  5J1R A;  1R5G A;  3ABT A;  2A07 F;  2FX0 A;  5FO5 A;  2VKV A;  3SFZ A;  2E60 A;  3EDP A;  3DCF A;  1TWF J;  2CQ7 A;  1DGR M;  2K27 A;  2VJ4 A;  1FZP B;  2EFN A;  4IRG A;  2PBI A;  1O3T A;  1ETW A;  3H0D A;  2J5O A;  3CCY A;  1Z6T A;  2BY0 A;  2DI3 A;  3LOC A;  3C2H A;  4E7I A;  2P5V A;  5HOD A;  2N8G A;  4IZZ A;  3LFK A;  3KIO A;  3R61 A;  1P4X A;  1R36 A;  2HOE A;  1MDM A;  4AUX A;  5B66 C;  4IQ4 A;  1D1B A;  4OMY A;  1UAA A;  5FD5 A;  5IYB J;  2M0M A;  5LRS A;  1SVL A;  2DT7 B;  1J75 A;  5JLW A;  2VJ5 A;  3IAM 2;  3FBI B;  4B48 A;  1VI0 A;  2JTV A;  4BXX J;  1HA8 A;  2HNH A;  1Y8R B;  2LDU A;  2AQE A;  3S1N J;  2NS8 A;  1SVM A;  3C2G A;  5HLH A;  1KQ0 A;  3SJM A;  1R1U A;  4BEH B;  1ZGA A;  2FJ1 A;  4NQW B;  3PUB A;  3H3V K;  1XCB A;  2XVC A;  3QP5 A;  3SQN A;  4F52 A;  3FXL A;  2BYV E;  1I1S A;  3BOQ A;  3ULQ B;  3S2D J;  3PFY A;  2E1O A;  1SAN A;  3NRV A;  1KZH A;  4CCJ A;  3HC7 A;  1SFK A;  1QZY A;  2Q8K A;  1PVE A;  2CW8 A;  1BIB A;  1IRF A;  1FOK A;  2LKX A;  4L5J A;  3FXJ A;  1Z21 A;  2R7T A;  5TJJ A;  3AG3 H;  2UWM A;  2ID6 A;  1XGN A;  1R6R A;  3ZMV A;  2K86 A;  2VBW A;  5M5W J;  4ZTJ A;  4NQW A;  3V8J A;  2GAU A;  1MSE C;  2KIQ A;  1XPX A;  1E3H A;  5K7F A;  3KEO A;  3GTL J;  1T98 A;  1HQC A;  1B9M A;  1ULY A;  3GZ6 A;  2V9K A;  3K7A J;  3S3N A;  3BG7 A;  1R22 A;  4BE0 A;  2BXY A;  2HVQ A;  2CW7 A;  3RJP A;  3RI4 A;  1FEX A;  3RQ4 A;  1W0U A;  4FET A;  1NHA A;  3KP5 A;  3LA7 A;  2KDO A;  1SFU A;  2Z2S B;  3A0H C;  2KDZ A;  4A3I J;  4HAM A;  5E3N A;  3WTX C;  2IJL A;  1JHF A;  1BC7 C;  4HF0 A;  5D8L B;  3E5U A;  1WI9 A;  1I50 J;  1Y0U A;  3HM5 A;  2XGE A;  4MHG A;  3GME A;  2K40 A;  1SEU A;  3TL4 X;  2ZFU A;  1KQ8 A;  3OYG A;  3FK7 A;  2OD5 A;  3BY6 A;  3G2B A;  4M3E A;  4BJT A;  1BOB A;  3HKZ A;  2XKP A;  4L5E A;  1TWG J;  2XAU A;  4RM3 A;  3K6G A;  4LIT A;  3GF2 A;  5LHG A;  4AD9 A;  2Z1D A;  3RKW A;  3WU1 B;  2X6X A;  3JRB A;  2Y0M A;  3OYF A;  3OSG A;  4M3D A;  2CQN A;  1J2X A;  2PG4 A;  2QKM B;  3G1L A;  4AID A;  2E1C A;  2QSG X;  4FE7 A;  1J0R A;  3QPS A;  2Z99 A;  2A68 F;  1G6N A;  1SFE A;  3OIO A;  2XC7 A;  2OU2 A;  1TNT A;  3I59 A;  3L09 A;  4XNF A;  4QPO A;  1WH7 A;  4C30 A;  1MJB A;  3TO9 A;  1BL0 A;  1WSU A;  3VWB A;  4XLA A;  1KU9 A;  2IBD A;  3CCM I;  1BI3 A;  3NQO A;  4G7O F;  2VOD A;  1WI3 A;  2UXN A;  1MH4 A;  1MBJ A;  2KL4 A;  4F7Z A;  4EAT A;  3KYL A;  2LP0 A;  2XDV A;  3G71 I;  3FK6 A;  1LDD A;  2PFB A;  2HPI A;  3E0J B;  3S15 J;  2MD0 A;  3M9A A;  2OZ6 A;  3BQY A;  2KT0 A;  1EV7 A;  3GTJ J;  2FMY A;  3OV8 A;  2FOW A;  3ELK A;  4XON A;  1LUJ B;  2K4B A;  1YJN I;  3PUF A;  2O3F A;  3BR5 A;  3HZJ A;  3WGI A;  3CCJ I;  2R5Y B;  1A36 A;  4X1E A;  3K70 D;  1EH6 A;  5K5R A;  5HDG A;  2P6S A;  3I64 A;  3JRC A;  1XGM A;  3C18 A;  2JA7 J;  2AS5 F;  4FIS A;  2BVM A;  1FOW A;  1X19 A;  2IVM A;  3RIR A;  1K61 A;  3H9J A;  2DQL A;  1F43 A;  2ADU A;  1EH8 A;  1FWZ A;  2Z5U A;  1S6L A;  4MGR A;  1FIA A;  2FEZ A;  1YIJ I;  2DA3 A;  4IOC F;  4MQ9 F;  1BM9 A;  2EFO A;  2M30 A;  2C6Y A;  1V3F A;  4HYE A;  2A5Y B;  2HU9 A;  2HYG D;  1FX7 A;  4OIP F;  3GEZ A;  4NNJ A;  1FLI A;  3T1B A;  4A3F J;  2MGQ A;  2STW A;  3MQ0 A;  3HHH A;  1MKM A;  3LWF A;  2MYS A;  1U6G A;  2DBB A;  4Y3O A;  5M5Y J;  2RC4 A;  1X2N A;  1F1Z A;  2EFW A;  2H8R A;  3L2R A;  1VF9 A;  2VC1 A;  5DCF A;  3CDH A;  4XLH A;  2H8W A;  3UKG A;  2JA2 A;  2MFZ A;  3H5A A;  3CC7 I;  2RKH A;  3S2W A;  3GTG J;  1ETX A;  1X2M A;  4OIN F;  1IN5 A;  2BHZ A;  1R4N B;  2DMU A;  2M34 A;  3FMQ A;  2GIV A;  4UXN A;  4HLY A;  1MIJ A;  1VQ8 I;  1MD0 A;  2XSJ C;  2BY1 A;  4YEL A;  3R0A A;  3E5Q A;  2IPQ X;  4DYR A;  4IXA A;  5DM7 F;  2Z16 A;  1J09 A;  3KLO A;  3RKY A;  5E18 F;  2IRF G;  4ON0 A;  1GHC A;  2CYY A;  3BR1 A;  3CF2 A;  1ZG5 A;  2CFX A;  2DTZ A;  1MMA A;  3D5R C;  3K10 A;  4EJV A;  2DK5 A;  3ASO H;  3HRU A;  3DBR B;  3ZXS A;  2ELH A;  1S7E A;  3TOA A;  4IPA A;  1ZRE A;  5L3C A;  2R7Q A;  2HZT A;  1TTY A;  4GYI A;  2FQ3 A;  3ZCO A;  4P96 A;  3EUK L;  2KPM A;  1MBK A;  3ERE D;  5EZH A;  3ABU A;  2JN6 A;  3QOE A;  4CIC A;  2O6G E;  3Q0V A;  1HOM A;  4A3C J;  3IWZ A;  2XAJ A;  3ISP A;  2EPF A;  2HXO A;  4PJJ A;  1B59 A;  4A3K J;  5ICF A;  2FU4 A;  5DCM B;  1S29 A;  1H88 C;  3ZMU A;  1IRG A;  1UFM A;  2M8G X;  1FT9 A;  3K69 A;  1RI7 A;  4M3B A;  4UVB A;  1LFB A;  2CQX A;  3PSI A;  2WBM A;  3HEF A;  2HQR A;  4I99 C;  2F48 A;  3PQJ A;  1F5T A;  4D5C A;  2XPW A;  4EV0 A;  3LL7 A;  4NC8 A;  2F5D A;  4Y33 A;  4RB3 C;  3L1P A;  1SMT A;  3QOP A;  4CZC A;  1IRZ A;  3Q9S A;  1T08 B;  4CCL A;  2GOX B;  5C4X J;  3PO3 J;  3HOS A;  5DCM A;  3WTW C;  5DUI A;  1I6X A;  1PDN C;  4A3D J;  2CWE A;  4RA2 A;  3KP6 A;  2TRT A;  3L00 A;  2VON A;  1X1B A;  2KZV A;  1H89 C;  3ZP5 A;  1Y1V J;  3CLQ A;  2GBY A;  1X4O A;  2KRC A;  1V54 H;  1YE9 A;  3KE2 A;  4PGG A;  4HF2 A;  3LFU A;  2ZNY A;  2ZBK A;  5J3L A;  2WWY A;  1UHW A;  4ITV A;  4YII A;  4BKX A;  4GXO A;  4IHT A;  1IN4 A;  1FBU A;  2DCE A;  1W36 D;  4E7H A;  1B4A A;  5F0F A;  1IW7 F;  4RMN A;  3DV8 A;  1EKE A;  1ETY A;  4KIF A;  5K7Z A;  1YTY A;  1X3W B;  2CUZ A;  2XGC A;  1OMI A;  5HS9 A;  1LB2 A;  5E8I A;  3VYT B;  3D5S C;  1WQ2 A;  2L3D A;  4A69 C;  5ILU A;  2IS1 A;  3WTT C;  3BC8 A;  1TL8 A;  4U87 A;  4UV9 A;  1W4M A;  1GLN A;  1I3A A;  4N4O B;  5CVI A;  1UG0 A;  2MC3 A;  3T8T A;  5DD4 A;  1HSJ A;  4A5M A;  5BPI A;  2JA5 J;  5CJ9 A;  4F3Q A;  2DN0 A;  2VE9 A;  3ZN1 A;  1UHS A;  3F8F A;  4CYC B;  4ZC3 A;  1FJL A;  1MSF C;  2XPU A;  3H5N A;  2JK3 A;  1W1W E;  3BRO A;  3VPR A;  2X9D A;  2HYF A;  3GLL A;  5J6X A;  4H0E A;  3K4M A;  4CDG A;  5E79 C;  3K4C A;  4IJA A;  5L3E A;  1LFU P;  1LDJ A;  1B72 A;  4WXC A;  4XSX F;  3F8M A;  1CF7 A;  3G1M A;  1WZ2 A;  3ERM A;  4GGG A;  3JRD A;  2NOG A;  5ICC A;  2DYS H;  4XN3 A;  3JW4 A;  4EJO A;  2ZC2 A;  1D5Y A;  5DYM A;  3HL2 A;  1LDK B;  5D5U B;  4HZF A;  3SXY A;  2R5Y A;  2W7N A;  5C4J J;  1Y56 A;  5ILS A;  2HYJ A;  1CQT A;  2OF7 A;  3F8N A;  1Z7U A;  2DW4 A;  2PI0 A;  2NVU B;  5D4S A;  3ZQC A;  1LQ1 A;  2BHY A;  2FUG 2;  1NTC A;  1F36 A;  5KAF C;  3LQQ A;  2DA2 A;  1BC8 C;  4OIO F;  1BI1 A;  3J7Z I;  3FM5 A;  2KIU A;  1K79 A;  1CF7 B;  3CQZ J;  2XF5 A;  3C7J A;  2W82 A;  5ILV A;  4HDV A;  2GA2 A;  4XID A;  5TRD A;  1STZ A;  3CC2 I;  2CFO A;  2QWW A;  4XRS G;  1WJC A;  2W48 A;  2BEO A;  4XKB A;  1RKW A;  3H0G J;  3JRE A;  1IV6 A;  2CQQ A;  3NAR A;  2JUG A;  1H9G A;  3W3C A;  1VTN C;  1OIS A;  3GW2 A;  2K9N A;  1N78 A;  2VQL A;  3I59 B;  2WAQ N;  3KFW X;  3OL3 A;  2BBY A;  2QA4 I;  3FXQ A;  2QLZ A;  4XK4 A;  5HNH A;  3BTJ A;  3EUH A;  5K5O A;  3Q9V A;  3CDI A;  1UHM A;  2R7O A;  4GRI A;  2EWN A;  2BXZ A;  1KGS A;  3FX3 A;  4UB8 C;  5B3S H;  5FKL A;  3OR1 C;  4FT8 A;  3WTY C;  2E1M B;  4LB6 B;  3V7R A;  4W1U A;  3M4O J;  3GFI A;  2A6H F;  2E71 A;  3SYT A;  3CJR B;  2HDC A;  2FQ4 A;  5CVR A;  2I5U A;  1GXP A;  2O8K A;  2XAQ A;  2D1V A;  4AYB A;  4Q4Z F;  4HST A;  4G9Y A;  4OMZ A;  3I0T A;  5CQG A;  1JT0 A;  4ZYA A;  1P4A A;  1J5Y A;  3AFH A;  3ZQI A;  2NNN A;  1IO2 A;  3PJR A;  5GP9 A;  2PEX A;  1SFO J;  2WY8 Q;  2CS3 A;  2LK2 A;  4I76 A;  3CCV I;  2O9L A;  1OYY A;  5FLX K;  1QBJ A;  2COM A;  4A2U A;  1D0Y A;  1FP1 D;  1K6O A;  3PIO F;  2DMN A;  2DFE A;  3K4L A;  1FPQ A;  3LSP A;  1T0F A;  4Y4R A;  5TGT A;  4BAC A;  4A0Y A;  2R7X A;  3MZH A;  2HTS A;  2Y9Y A;  1HLV A;  1AKH A;  1HKQ A;  2EV6 A;  2E35 A;  2Y75 A;  2LBF A;  2E5Z A;  1VQK I;  3WG9 A;  4GFB A;  4C9Y A;  2JJ7 A;  2JMW A;  1LVK A;  1S5L C;  2I8D A;  5D8K B;  2RVC A;  1D0Z A;  2O03 A;  3RYR A;  5D6F A;  2ZXI A;  4N0B A;  3LST A;  1POG A;  4RGS A;  1BR1 A;  1QPM A;  1P7I A;  3AG4 H;  4S0H B;  4M6Y A;  2A6T A;  3DTE A;  4QLC U;  1B9N A;  3CO7 C;  3D0S A;  4E7J A;  3IC7 A;  2MG4 A;  5FLX Z;  3V7S A;  2FXA A;  2XB0 X;  3IH2 A;  3K0L A;  3HSF A;  1ETV A;  1TP4 A;  3KCC A;  5IPA A;  2PQ8 A;  3FXO A;  4AIJ A;  3CCQ I;  1AKH B;  2WAD A;  5LGN A;  4LFU A;  2LF7 A;  2NVY J;  4BL0 B;  2DA1 A;  2VT2 A;  4D0P A;  2NVX J;  4R1H A;  2LC2 A;  5EGO A;  4B3A A;  4BDY A;  1ZEL A;  2VI6 A;  3TMO A;  4A3M J;  1JT6 A;  2ZB9 A;  1JXS A;  1ZN2 A;  4HSR A;  4RGR A;  2KZG A;  4JK1 X;  1XN7 A;  2IA2 A;  2KLO A;  3BG9 A;  4XOP A;  3LSJ A;  3W2W A;  5KNL A;  3IP4 B;  3KZZ A;  3ZQL A;  3A2K A;  2VE8 A;  5ICG A;  1WVR A;  1Z9C A;  2WB1 A;  1G59 A;  4DOZ A;  4J00 A;  2L7K A;  1R58 A;  3PM1 A;  4J19 A;  2BY2 A;  3W6K B;  2DOA A;  1X1A A;  1RET A;  4HW0 A;  2M3A A;  2VIX A;  3P5J A;  3F72 A;  3GTO J;  4Q48 A;  1WJD A;  4CCN A;  2L4A A;  2CV0 A;  4HQE A;  4I2O A;  1X3Z B;  1APL C;  1QA6 A;  1LEB A;  5E3M A;  2FNP A;  1L3L A;  1TWH J;  3LSH A;  2F4I A;  4MIM A;  1IN6 A;  1OFC X;  2XF6 A;  4YG2 F;  4QPQ A;  4LLL A;  1DPR A;  1WFX A;  3FXM A;  4ESJ A;  2OTL I;  4BNC A;  2CUJ A;  1A31 A;  1K4T A;  4C2T A;  3HDD A;  3H9G A;  1MMN A;  4NHJ A;  4G6D A;  2CRG A;  3HOV J;  3HJE A;  4I02 A;  1RR8 C;  3CTA A;  3MN2 A;  1TQI A;  5DM6 F;  5J4Y A;  1IN7 A;  3WTZ A;  3RQI A;  4KIC A;  3KP2 A;  5LD2 C;  4XSZ F;  1SD6 A;  2JUC A;  3E1S A;  1MMD A;  1OCO H;  2DOE A;  1ON1 A;  1UZC A;  3QPT A;  3IV5 A;  4ETS A;  3GVA A;  2Y0S A;  3BQZ A;  2MD5 A;  3DPU A;  4HV6 A;  4RGU A;  3KPH A;  1W7P D;  2VBZ A;  4P55 A;  2QKL B;  4R8H A;  3TQN A;  1GUU A;  2A5W A;  5LEJ A;  3FKJ A;  4KA4 A;  2P8T A;  3S16 J;  5DS9 A;  2JSP A;  1KA8 A;  3KEY A;  2HOA A;  1R1T A;  2A61 A;  3S8P A;  1G3W A;  3TP3 A;  2R7F A;  4Y7N J;  3H9Q A;  2R92 J;  1ZRF A;  1XTA A;  3VYU B;  2OAZ A;  5EF6 A;  4CYC A;  3LA3 A;  3TP0 A;  2IA0 A;  4DJA A;  1ETQ A;  5B1B H;  3F6V A;  5FRN A;  2WAE A;  2QF7 A;  2ZSH B;  3CUQ C;  2K3F A;  3VB2 A;  1TZL A;  2W24 A;  1QQI A;  3OYM A;  3BR0 A;  3MZY A;  4HX4 A;  2W00 A;  5F04 A;  4UUS B;  2IEK A;  1U9N A;  2D1H A;  1FYK A;  4I6Z A;  2M8E A;  2LLK A;  1FBS A;  2D5V A;  4XLE A;  1R23 A;  1U2W A;  2Y30 A;  3J81 K;  3H35 A;  3OYL A;  4V2G A;  5ERI A;  3OYB A;  2L4M A;  2K85 A;  4LJZ F;  1IG7 A;  1Z05 A;  5FD6 A;  3HTS B;  2CQK A;  1T56 A;  4BHB A;  2KHM A;  4ZYH A;  3MKW B;  2L5Q A;  2L2O A;  2LTP A;  4ZJZ A;  4A3G J;  5IOZ A;  3RPQ A;  3COA C;  2ZJR F;  4HX8 A;  2HEO A;  2XSD C;  2B0L A;  1IXS B;  2IXS A;  2L01 A;  2LY2 A;  4LGW A;  1XX5 A;  2MA3 A;  5F6F A;  2L9N A;  2F6C A;  3VOD A;  3HOY J;  4D7N A;  2DFI A;  4WF2 A;  1KYZ A;  4EEF G;  2DXI A;  2IW5 A;  3EYY A;  4PK4 A;  4UUS A;  2KMU A;  5FFX A;  4XN0 A;  2DAO A;  4O6J A;  5F08 A;  2OBP A;  1DDN A;  5IT9 K;  4WWC A;  3CUO A;  2CW0 F;  5AIP A;  2EIK H;  2BE5 F;  2JZY A;  1ZRD A;  1T39 A;  4R79 A;  4RLQ A;  1SFX A;  3WGG A;  3RCO A;  2YUS A;  1OCC H;  2H1L A;  2H6B A;  1MBG A;  2E7X A;  3CP2 A;  3V7C A;  1R49 A;  2RGV A;  4EJU A;  3UR3 C;  5LBQ A;  2ZJ2 A;  3MZ8 A;  4GYG A;  2V1N A;  1AOY A;  1IF1 A;  1HW5 A;  4IVN A;  5J1U A;  3DQV C;  3KP3 A;  3GUD A;  5FRO A;  1K6Y A;  1XMA A;  1YW9 A;  2RNG A;  2IP2 A;  2Z33 A;  1UB9 A;  3S2H J;  2ELJ A;  2ME0 A;  1PJR A;  1OR7 C;  4PSW A;  2QQ9 A;  2KRH A;  3L7W A;  3EQL F;  5ED4 A;  1Y1W J;  4KIG A;  2YX4 A;  3DP7 A;  2EK5 A;  5AON A;  1QVU A;  1B1B A;  1L0O C;  1GVJ A;  4DNC A;  1BI0 A;  3O6B B;  3L2U A;  1IJW C;  2LOO A;  3ONQ A;  4MFE A;  4HRI A;  3ZQG A;  1JKO C;  2XHK A;  2V4J C;  3N05 A;  3TKY A;  3NAU A;  5EZG A;  2FNA A;  1S8N A;  4XOR A;  2YSR A;  3RTR A;  5HLI A;  1OYW A;  2G0E A;  4IF4 A;  3DEE A;  5LLQ A;  1FYL A;  3ZOB A;  5HLG A;  5M3M J;  3HOX J;  4BAY A;  4QTR A;  2NS7 A;  3WE2 A;  2M2E A;  3K1N A;  4EM1 A;  3JCU C;  5EJC A;  2ZJP F;  4CYD A;  3OY9 A;  2Y48 A;  5FKM A;  2IGK A;  2LBF B;  1O3R A;  5LHH A;  2FE3 A;  2MC4 A;  4PJ0 C;  5CQE A;  1YX5 A;  1D1C A;  3AL0 B;  1TT5 B;  4ANJ A;  2M4G A;  3BJ6 A;  2O61 A;  1SD4 A;  1XS9 A;  2HTJ A;  2M87 A;  1A5J A;  3LMM A;  5IP7 J;  1ETK A;  1IXC A;  2LYC A;  1TC3 C;  1ODD A;  4Q47 A;  2DK8 A;  1DGW Y;  2E19 A;  2WV1 A;  3S1M J;  1HKS A;  2IA1 A;  5GTH C;  5JI6 A;  2LH9 A;  4V2F A;  4A5N A;  5EEA A;  1ZHF A;  3HRT A;  3CMM A;  1ZAO A;  4FX4 A;  3GFM A;  2HQN A;  3J80 Z;  4BHC A;  3OR2 C;  1O7F A;  2F4M B;  4AIK A;  1PUF A;  3M8F A;  4O5V A;  5CYV A;  4JQF A;  4E4H A;  4Z6Y A;  3QWL A;  2O5R A;  3R60 A;  3WE3 A;  3QU6 A;  2P7V B;  3GO5 A;  2FBK A;  1Z67 A;  4UHT A;  5JFR A;  3OYD A;  3DXJ F;  3ABL H;  5KHD A;  3DEW A;  5IP6 A;  4UUV A;  1GDT A;  2L7F P;  3CF5 F;  1D5V A;  4ABZ A;  3O8G A;  2NS0 A;  4KIT B;  4D1Q A;  2CMP A;  2KRF A;  3F9K A;  3P9I A;  1WRJ A;  3R4K A;  5AIQ A;  1JJ8 C;  1O7L A;  4M71 A;  3E97 A;  4CO8 A;  1NK3 P;  3P9K A;  2IGO A;  2HS5 A;  4ESF A;  2QQB A;  3M8E A;  1RKT A;  5JVG F;  4MTE A;  4PJM A;  2F5F A;  2L9V A;  5HVQ C;  3K4N A;  3HOT A;  1JE8 A;  3CJT B;  5CVU A;  2ECB A;  2VKE A;  4L18 B;  1LNW A;  3K2A A;  1VND A;  5HDN A;  2F5E A;  4CSW A;  3OIQ A;  2PMU A;  3BR6 A;  4K2E A;  4XQF A;  6PAX A;  4A12 A;  5HNF A;  1RES A;  1TLH B;  4EGY A;  4RBO A;  3PFI A;  3A03 A;  4GDF A;  2KKO A;  1BJZ A;  3DBL B;  3ESW B;  2R5Z B;  1S9H A;  3KP4 A;  2V9P A;  1QHH D;  2WB1 N;  4ZH4 F;  2PLY A;  3EUA A;  3ECH A;  2WTE A;  3F8C A;  4ZDP A;  4XRM A;  3N97 A;  3DU5 A;  4FX0 A;  2CV2 A;  2EH3 A;  1TW2 A;  2VXZ A;  5E3L A;  3RKQ A;  3BR3 A;  1IC8 A;  2H1K A;  3L2C A;  3TW6 A;  1S72 I;  3F23 A;  4FQG A;  3SFI A;  5HLT A;  1V5G A;  1E3O C;  1YJ9 I;  1JUP A;  1DUX C;  3FZV A;  3W2A A;  2VJJ A;  5F1R A;  3QYB A;  1DPU A;  1BN5 A;  1OYI A;  1Z91 A;  4XR6 A;  2E34 A;  4IHS A;  1VQM I;  2UV1 A;  2R5Z A;  1Q1V A;  3IUO A;  3IRR A;  3OSF A;  2OC6 A;  2PJP A;  3W6V A;  1B8I A;  1F4K A;  2GOM A;  4LLN A;  3ECO A;  1R00 A;  2XB5 A;  4IKF A;  3GTM J;  3CES A;  2ZME C;  3DLA A;  2YR2 A;  3K9T A;  1R7J A;  4QSH A;  4JX5 A;  1WWX A;  5HS7 A;  2E1N A;  1BJA A;  4RM2 A;  1ERD A;  4BJ6 C;  5F0C A;  5JLX A;  2D45 A;  1X1C A;  3H5R A;  2WA0 A;  4DIQ A;  4RGX A;  4RLF A;  2VJI A;  4B43 A;  3WTV C;  3V42 A;  1FC3 A;  1YO5 C;  2EB7 A;  2LY9 A;  1RR7 A;  1V55 H;  5K1Y A;  3D5L A;  3F21 A;  3KEQ A;  1FP2 A;  3SZP A;  4FE4 A;  3WU0 A;  2E2H J;  2NYX A;  1AA7 A;  3BP8 A;  4WXH A;  5F64 A;  4KYW A;  5A2Q Z;  2UXX A;  4Q5S F;  2VPL A;  2EFQ A;  1F9N A;  3BTC A;  3BT9 A;  2MSY A;  4AC0 A;  2HKX A;  2PMZ N;  4G12 A;  3FHZ A;  4NUB A;  3WHB A;  4AU7 A;  2R4G A;  1I6H J;  3HUG A;  3DPT A;  5B5E C;  1YG2 A;  3VEP A;  2DPD A;  3H3U A;  3EPZ A;  4LG0 A;  3FDY A;  4DZP A;  2Q0O A;  3ZQQ A;  1U5T C;  3ZPL A;  3GBG A;  1FSH A;  3DU6 A;  4D5F A;  1TBX A;  1Z0X A;  2JWT A;  3WGH A;  1D0X A;  4PZJ A;  5H6R A;  1SC7 A;  4LG3 A;  4BQQ A;  1UG2 A;  4PUS A;  4U7B A;  2CSO A;  1G8X A;  2QCO A;  1P92 A;  4HV5 A;  4M3F A;  3GZN B;  4OOI A;  4U0W A;  4DGW B;  3J81 Z;  2CH0 A;  4YRV A;  3IKV A;  3CO6 C;  1BW5 A;  4BXU A;  2BVL A;  1Z77 A;  3V8L A;  1WJF A;  4DBR A;  1YW7 A;  3HPG A;  4KFC A;  2GXG A;  1NG6 A;  1GXQ A;  4CUG A;  1O3S A;  2M0C A;  5KVR A;  4LG0 B;  2L7M P;  1IAW A;  1LE8 B;  3M1E A;  1UCR A;  4IHV A;  4BHP A;  3CP8 A;  4JX6 A;  2JVG A;  1JGS A;  3EYI A;  2YU3 A;  5EG0 B;  3J7Y J;  4H4K C;  2VUM J;  1AWC A;  5GPA A;  1ONV A;  1IXR C;  3IHU A;  1J59 A;  2JA6 J;  2P6T A;  3FXR A;  1YS6 A;  1XCV A;  4B8X A;  2EZL A;  2K5C A;  1ZYR F;  4IX7 A;  4PDK A;  1W5T A;  1BW6 A;  2MLG A;  2O7O A;  1IUY A;  2OZU A;  4IEJ A;  5L3B A;  4UVC A;  1J9I A;  1B72 B;  3O3K A;  2LRE A;  5E20 A;  2XUB A;  3RYP A;  4BJ5 C;  5FFZ A;  4AM3 A;  2K7L A;  3Q5F A;  2VC0 A;  2BV6 A;  2RDP A;  4A0Z A;  2KIM A;  4AVZ A;  1FBQ A;  2VBY A;  3BJO A;  4N9I A;  1IRX A;  4P5O A;  1Z7L A;  3A1Y A;  1KU7 A;  2E2I J;  3PQK A;  1G3T A;  4CCK A;  1PUE E;  4WK8 F;  1KU2 A;  3S1Q J;  3HRS A;  3VFZ A;  4AYB N;  5BS6 A;  3S3M A;  2XRL A;  2DJI A;  2R0Q C;  2F5V A;  1X1D A;  3BLY A;  3E6D A;  1HCR A;  3GTP J;  2AXL A;  2DT5 A;  3U9G A;  2TDX A;  4I01 A;  3MKY B;  4HDU A;  4M72 A;  1YRN A;  2LNB A;  3DPL C;  2Q2E A;  4YFN F;  2X51 A;  2E2J J;  3CZ6 A;  4E7Z A;  1P9Q C;  2MBF A;  1ZKG A;  4UUT A;  2H09 A;  2GQQ A;  2WY7 Q;  5DEQ A;  4HPQ A;  4XBF A;  1A04 A;  1HST A;  5DDG A;  4KNY A;  2JRM A;  1T33 A;  2DDA A;  5LRR A;  2QQ8 A;  4O3M A;  2WC2 A;  1T38 A;  4N9H A;  4IHY A;  2EV0 A;  2KJB A;  3RDI A;  4BS9 A;  1M1E B;  2R7Z J;  1PYV A;  4EM2 A;  2W84 A;  1T6S A;  5DUK A;  2VAS A;  4M3G A;  2FRH A;  2DQR A;  5LEK A;  1OJL A;  3OS1 A;  3ASN H;  3Q0W A;  3MMY B;  4M9Z A;  3HXL A;  3J7A Y;  1MBF A;  3M8J A;  1LKX A;  4UB6 C;  1MBE A;  3AKZ A;  1DU0 A;  1QZE A;  1O57 A;  5GPC A;  2HFH A;  3VDX A;  3ZQH A;  3CDL A;  4M6X A;  3DF8 A;  1WJ5 A;  4I0B A;  1YFH A;  2ZFW A;  2EIJ H;  5D5W B;  3B73 A;  4JYK A;  3I4P A;  2IAI A;  1WKM A;  4XKV A;  1PP8 F;  1G4D A;  2PJR B;  3ROU A;  4RAZ A;  1IV8 A;  3C3W A;  1I5Z A;  4F55 A;  1Y0N A;  1ZQ3 P;  2JRT A;  3OOP A;  1E17 A;  1VQP I;  4PJN A;  4I09 A;  2X1C A;  3UNG C;  4ZTF A;  2P7C B;  1WCM J;  3DKY A;  5BPD A;  3K4B A;  3QU3 A;  5FLM J;  2LD5 A;  2K9M A;  5E17 F;  2DJN A;  3B6A A;  3BG5 A;  3OYK A;  5BOX A;  1YS7 A;  1ZR2 A;  1U0J A;  2L7Z A;  3I58 A;  2DT6 A;  2ZJQ F;  4XKW A;  3S3O A;  1EF4 A;  4OAY A;  1YIT I;  3V4G A;  3I3L A;  2R3S A;  5CVJ A;  1N77 A;  3JR9 A;  4OWR B;  4HEA 2;  1XMK A;  2F5C A;  4RB1 A;  1PUF B;  1TW3 A;  3GFL A;  1JJ6 C;  2OQG A;  2YS9 A;  3ZQ7 A;  3TED A;  3JRH A;  4X0G A;  4U0Y A;  3L9F A;  4DYC A;  2O8X A;  3BPX A;  2RNJ A;  2PJR A;  4P9U A;  2CG4 A;  4M9S A;  2R93 J;  3MAJ A;  4F92 B;  4EGZ A;  4WCG A;  1DP3 A;  3I55 I;  1QHG A;  1VQ7 I;  3M3Y J;  3FHN A;  1Y6I A;  2VBX A;  5GAG J;  3E6C C;  2NRA C;  4XRS A;  3J7A O;  5J8C A;  4LB5 A;  4UVA A;  2B7E A;  2ECC A;  3LSR A;  2V1X A;  2EV5 A;  4YIF A;  5TIS C;  3MWM A;  2QBY A;  3KYC B;  3CD6 I;  3FIW A;  2W1O A;  2P81 A;  3AAF A;  2QGU A;  3LAP A;  2OJE D;  3RPU A;  2X6O A;  1K83 J;  1U8R A;  4I0A A;  4KUM A;  4BGD A;  3NWT A;  1RNL A;  5EGO B;  2Y69 H;  3A01 B;  1OCP A;  2KJC A;  5IYC J;  3PNV A;  2ACJ A;  4IRH A;  1QZZ A;  1BOA A;  3JAM K;  4D9J A;  3ZMS A;  5GAE J;  2JPC A;  4HBL A;  2Z9O A;  4ZYE A;  2R7S A;  1HW1 A;  4A3E J;  4IRI A;  2Z3Y A;  1C0W A;  3TBI A;  2AO9 A;  3GTK J;  2M45 A;  2DA5 A;  4OU0 A;  4EVI A;  1SVO A;  2L9S A;  2Y0S N;  5LFA A;  2Y2Z A;  5JVT A;  5F0H A;  1ZK8 A;  4G94 A;  3ZQF A;  1SD7 A;  4LD5 A;  1B6A A;  4BY7 J;  2HPM A;  2ZSI B;  3DBH B;  2EQR A;  1QU3 A;  3TO6 A;  3I5U A;  2R7D A;  4W97 A;  4ENJ A;  1XDS A;  2XV4 S;  4XLC A;  2IS2 A;  1USS A;  3I56 I;  4FCY A;  3A0B C;  3HUG B;  2X6W A;  2HGC A;  4UNO A;  4OIR F;  1NK2 P;  3FF5 A;  1I3Q J;  5J4V A;  2DA7 A;  4XKC A;  1G3Y A;  5FB2 A;  2PN6 A;  2OTJ I;  1B8I B;  3DKX A;  3CCE I;  3MCZ A;  2ISY A;  5DD8 A;  2FA5 A;  1OQY A;  3PIP F;  3ZRG A;  3SHF A;  1A35 A;  4CZZ A;  1HC8 A;  3KX2 A;  2V6E A;  1ZAR A;  3EUH C;  4E70 A;  3OYE A;  1T95 A;  4HNU A;  3OS2 A;  3WHC A;  2EJR A;  3GCM A;  1JUM A;  3EET A;  3BPV A;  3DTI A;  4AVP A;  4L5I A;  5M3F J;  2GA1 A;  2ID3 A;  1YLF A;  2EFP A;  3G1O A;  1U8B A;  3QOD A;  2HWV A;  2LKP A;  1IDY A;  3CMY A;  1HXD A;  3DWL E;  3K4K A;  4A3B J;  1KU3 A;  2M5W A;  2YPR A;  4HX7 A;  1VQ4 I;  1MMS A;  3P7N A;  1O3Q A;  2YX7 A;  2HDW A;  1BIA A;  3Q3S A;  2ZXW H;  5H2F C;  2BW3 A;  1RC9 A;  1S3J A;  3LQR A;  1MND A;  2E5N A;  2WV0 A;  3HB9 A;  4ENM A;  2OQR A;  3OWT A;  2XAS A;  5J1Y A;  4KDP A;  4RAG A;  1MW7 A;  4PCQ A;  4RS8 A;  1WPK A;  3DKW A;  3K4J A;  3LSG A;  2IS6 A;  2MW8 A;  3JRF A;  4E7L A;  1T0F C;  2VXD A;  2NVQ J;  2DPU A;  3G3Z A;  4BE2 A;  2RV8 A;  2P5K A;  1T2K A;  3J80 K;  1MDM B;  2XKO A;  5F1J A;  2V1U A;  1QVT A;  1RPW A;  2HR3 A;  2HZD A;  1MJ9 A;  1O4X A;  1HDP A;  1OCR H;  2HXI A;  4L9N A;  5KAI C;  1DP7 P;  1VQ9 I;  2IS4 A;  1U78 A;  1EA3 A;  2MLK A;  2STT A;  4S05 A;  5E3O A;  4KN7 X;  1E2X A;  2LKS A;  2XRN A;  3A02 A;  5EEH A;  3S93 A;  1W7P B;  2AHQ A;  4X6A J;  2FBI A;  2VT3 A;  5IT3 A;  1T8I A;  2DA6 A;  3P9C A;  4PSX A;  3HSE A;  1IZ1 A;  2FD5 A;  5D6E A;  2LG4 A;  1SAU A;  2FF4 A;  5IYD J;  3KLN A;  2O0Y A;  3F22 A;  3MKL A;  1MZB A;  1VZ0 A;  2WAQ A;  4XRF A;  2VQC A;  4FAS D;  2VKD A;  3JAM Z;  2FBH A;  3K2Z A;  1R5I D;  3HKZ N;  1LE8 A;  1HF0 A;  3CJN A;  2P4W A;  4IHX A;  2CV1 A;  5FJ8 J;  2GXA A;  4Y13 A;  2X4H A;  2HI3 A;  4II2 A;  5EG0 A;  2EA2 A;  3I54 A;  3BTI A;  1D8K A;  4M9X A;  1HKT A;  1R1V A;  2HKO A;  3KET A;  4J01 A;  3IH4 A;  3HOW J;  4B4C A;  3HSR A;  5EEG A;  3WOD F;  4GCV A;  1XC5 A;  4BU2 A;  3CMA I;  4C2U A;  2VOP A;  1ZLJ A;  2VLA A;  1XMX A;  2K9Q A;  3OYN A;  1W5C C;  2M9H A;  4EQQ A;  1JGG A;  1G3S A;  2BOL A;  2A3S A;  2F4O B;  3IRQ A;  1VQO I;  1DU6 A;  2KQR A;  2JT1 A;  3PNT A;  1R5H A;  5LGU A;  1S7A A;  2DLL A;  1BBY A;  4JX4 A;  5GTI C;  2AQF A;  4F91 B;  1EH7 A;  1VQ5 I;  2LF8 A;  4CH7 A;  3HIF A;  1UEL B;  3F8B A;  3TDU C;  3GLX A;  1I1G A;  2H6C A;  4YEJ A;  4MTD A;  3QYE A; 
#chains in the Genus database with same CATH homology
 3DFG A;  4Y17 A;  5FGM A;  2M1B A;  2QEN A;  1SAX A;  1J7K A;  1H0M A;  5KK1 A;  2F2E A;  2K4J A;  3QPH A;  4MNU A;  3B02 A;  2ZME A;  3H3Z A;  3BDD A;  2FML A;  2XAF A;  3R6S A;  4L0Z B;  3O2P E;  4UV8 A;  2L54 A;  2XRO A;  1YYV A;  3K1M A;  2LSO A;  3K1P A;  1RIO H;  1LVA A;  4YFK F;  3MFK A;  2NAZ A;  2ZME B;  2ETH A;  5LHI A;  4GO1 A;  2H27 A;  2W25 A;  2QBY B;  1XD7 A;  1OKR A;  5E1W A;  1H9T A;  4ENK A;  2CGP A;  3WTU C;  3LAJ A;  2JPB A;  2RN7 A;  1ZRC A;  3E5X A;  4XLN F;  1S7O A;  4G7H F;  3TOB A;  5D5V B;  4RB0 A;  2BGC A;  1HW2 A;  3HYI A;  1TQP A;  3R0J A;  1P2F A;  1ZG3 A;  4L0Y B;  2V1D A;  3ZN0 A;  1UST A;  1U3E M;  5HDK A;  3IKT A;  4BH9 A;  3CUQ B;  3C1D A;  3QAH A;  3QP6 A;  3BZ6 A;  1FNN A;  4MEX F;  3F6O A;  4WXD A;  5JR3 A;  1W5S A;  3JSP A;  3GZ5 A;  1TQM A;  1RUO A;  3HRM A;  3ZMZ A;  3I71 A;  1XSX A;  4CHU A;  2JSC A;  2QVO A;  2V79 A;  4ZZL A;  4ASN A;  2V6C A;  2MH9 A;  4KMF A;  3FM3 A;  2H94 A;  4QWQ A;  4YFX F;  1ZH5 A;  2GWR A;  4TV7 A;  4EJT A;  2J5P A;  2FSW A;  1K78 A;  1Z6R A;  1Z1D A;  4A6E A;  4I7H A;  5CLS A;  4CXF A;  5IT9 Z;  2IT0 A;  3RKX A;  4OIQ F;  2DTR A;  4LK1 F;  1HBX G;  1YIO A;  1FSE A;  1YQA A;  1U5T A;  2ESN A;  1BI2 A;  1JHH A;  4HOB A;  3T0Y A;  3JSO A;  5E1X A;  2ZKZ A;  1D8J A;  1X3U A;  3V8K A;  5D4R A;  1ON2 A;  3IWF A;  3WTS C;  3N4M A;  2QZ8 A;  5CVV A;  2ZCW A;  3ZMD A;  3NEU A;  3W6J B;  3SZT A;  3GWZ A;  2G7H A;  1QNT A;  2XAH A;  3FXU A;  3FMS A;  1ZG1 A;  4Z2Y A;  3T8R A;  5J8F A;  2K02 A;  3KZY A;  3U2R A;  4ESB A;  2DO7 A;  3CLO A;  5A2Q K;  4MQV A;  3E6M A;  2CO5 A;  5D5X B;  5BMZ A;  2A6E F;  3E6B A;  1K7A A;  4EJW A;  3VOE A;  1W7P A;  5K5Q A;  4ZZD A;  2V9V A;  2X0L A;  4NB5 A;  2D2W A;  4G8X A;  4Y15 A;  2GZW A;  4ZYD A;  4XLP F;  3TO7 A;  1FY7 A;  4L9V A;  1MGT A;  5H6Q A;  2EA4 A;  2ESH A;  1XDU A;  5JHU A;  1SMY F;  3TDZ C;  3JTH A;  4KIB A;  1XB4 A;  4MEY F;  3H92 A;  4M73 A;  2W57 A;  1OPC A;  3T5X A;  4RB2 C;  3FWE A;  2DU9 A;  5BQT A;  1ZGJ A;  4P9F A;  4G7Z F;  5HOO A;  5E1Z B;  1OR7 A;  2A69 F;  1LEA A;  3HTU A;  1YW8 A;  1LJ9 A;  4BYY A;  2XGX A;  3GX4 X;  4S04 A;  4JBA A;  2GXB A;  3BWG A;  1IN8 A;  1SD5 A;  3ZMT A;  2E7W A;  4KT5 C;  1P4W A;  4B09 A;  5HS8 A;  3JTG A;  3DEU A;  3BJA A;  4HA8 A;  1V4R A;  2XIG A;  2ZNZ A;  3GFJ A;  4EM0 B;  4ENN A;  3QRF F;  1KQ9 A;  1XGS A;  3GYH X;  3LA2 A;  1QGP A;  1MJA A;  2P5L C;  3M7G A;  1REP C;  4WX9 A;  3E3V A;  4LMY A;  4L9J A;  5L3D A;  1XGO A;  2L02 A;  2QUF A;  4HQM A;  1KYW A;  1CGP A;  3GXO A;  5L3G A;  2QM3 A;  1TNS A;  4RAY A;  3MEX A;  2ZO4 A;  3IL2 A;  4CGZ A;  4I98 B;  1Q1H A;  1RZ4 A;  2QYO A;  4U88 A;  3CUQ A;  2G7U A;  3TGN A;  4HLX A;  1XSD A;  4A0X A;  4FHT A;  2KIF A;  1QO0 D;  2RQP A;  1ZLK A;  2OA4 A;  4G6Q A;  4KMU X;  1FYM A;  2PMH A;  4AIH A;  4U7D A;  5E8G A;  5L3F A;  3REO A;  2G9W A;  1D3Y A;  1PP7 U;  5DV5 A;  4PGH A;  2FOK A;  1I27 A;  2ZXJ A;  4U0V A;  1RUN A;  3F3X A;  4LLG F;  3I53 A;  4ZYG A;  2NNY A;  4HF1 A;  2W85 A;  2MH2 A;  4DQ2 A;  2VOO A;  5H20 A;  5LGT A;  2VN2 A;  3HHG A;  1K78 B;  2UZK A;  3KP7 A;  4A6D A;  4LK0 F;  5ICE A;  3ML6 A;  4L9T A;  3U1D A;  2QQA A;  3FMR A;  4EMS A;  4AWX B;  4M74 A;  4KN4 X;  1P6R A;  4BQA A;  1U5T B;  1XSV A;  2XAG A;  2ISZ A;  3G73 A;  1R5G A;  3ABT A;  2A07 F;  5FO5 A;  3SFZ A;  3EDP A;  2K27 A;  1FZP B;  2EFN A;  4IRG A;  2PBI A;  1O3T A;  2J5O A;  1Z6T A;  2DI3 A;  2P5V A;  3LFK A;  3R61 A;  1P4X A;  1R36 A;  2HOE A;  1MDM A;  4OMY A;  5FD5 A;  5LRS A;  1J75 A;  2JTV A;  2LDU A;  5HLH A;  1KQ0 A;  1R1U A;  1ZGA A;  1XCB A;  2XVC A;  3QP5 A;  3SQN A;  2BYV E;  1I1S A;  3BOQ A;  3ULQ B;  3NRV A;  1QZY A;  2Q8K A;  1BIB A;  1IRF A;  1FOK A;  4L5J A;  5TJJ A;  2UWM A;  1XGN A;  3ZMV A;  2K86 A;  2VBW A;  4NQW A;  3V8J A;  2GAU A;  3KEO A;  1T98 A;  1HQC A;  1B9M A;  1ULY A;  3GZ6 A;  1R22 A;  3RJP A;  3RI4 A;  1NHA A;  3KP5 A;  3LA7 A;  1SFU A;  4HAM A;  3WTX C;  2IJL A;  1JHF A;  1BC7 C;  4HF0 A;  5D8L B;  3E5U A;  1WI9 A;  1Y0U A;  4MHG A;  1KQ8 A;  2OD5 A;  3BY6 A;  2XKP A;  3GF2 A;  5LHG A;  4AD9 A;  3RKW A;  3WU1 B;  2Y0M A;  1J2X A;  2PG4 A;  2E1C A;  1J0R A;  2Z99 A;  2A68 F;  1G6N A;  1SFE A;  2OU2 A;  1TNT A;  3I59 A;  3L09 A;  3TO9 A;  1MJB A;  1WSU A;  1KU9 A;  1BI3 A;  3NQO A;  4G7O F;  2VOD A;  2UXN A;  4F7Z A;  1LDD A;  2PFB A;  3M9A A;  2OZ6 A;  1EV7 A;  2FMY A;  3OV8 A;  3ELK A;  2K4B A;  2O3F A;  3WGI A;  1EH6 A;  5K5R A;  5HDG A;  2P6S A;  3I64 A;  1XGM A;  3C18 A;  2AS5 F;  2IVM A;  3RIR A;  2DQL A;  2ADU A;  1EH8 A;  1FWZ A;  2Z5U A;  1S6L A;  4MGR A;  2FEZ A;  4MQ9 F;  1BM9 A;  2EFO A;  2M30 A;  2C6Y A;  1V3F A;  4HYE A;  2A5Y B;  2HYG D;  1FX7 A;  4OIP F;  3GEZ A;  1FLI A;  3T1B A;  2STW A;  3MQ0 A;  3HHH A;  1MKM A;  3LWF A;  1U6G A;  2DBB A;  2RC4 A;  1F1Z A;  2EFW A;  2VC1 A;  5DCF A;  3CDH A;  2RKH A;  3S2W A;  4OIN F;  1IN5 A;  3FMQ A;  2GIV A;  4UXN A;  4HLY A;  1MD0 A;  3R0A A;  3E5Q A;  2IPQ X;  4IXA A;  3KLO A;  3RKY A;  5E18 F;  2IRF G;  4ON0 A;  1GHC A;  2CYY A;  1ZG5 A;  2CFX A;  4EJV A;  2DK5 A;  3HRU A;  2ELH A;  3TOA A;  4IPA A;  1ZRE A;  5L3C A;  2HZT A;  1TTY A;  4GYI A;  2FQ3 A;  4P96 A;  2O6G E;  3ERE D;  3ABU A;  4CIC A;  3IWZ A;  2XAJ A;  3ISP A;  1B59 A;  5ICF A;  2FU4 A;  5DCM B;  1S29 A;  3ZMU A;  1IRG A;  1UFM A;  1FT9 A;  3K69 A;  1RI7 A;  4UVB A;  2HQR A;  3PQJ A;  1F5T A;  4EV0 A;  2F5D A;  4RB3 C;  1SMT A;  3QOP A;  3Q9S A;  3HOS A;  5DCM A;  3WTW C;  5DUI A;  1I6X A;  1PDN C;  2CWE A;  3KP6 A;  3L00 A;  2VON A;  3ZP5 A;  3KE2 A;  4PGG A;  4HF2 A;  2ZNY A;  2ZBK A;  2WWY A;  1UHW A;  4YII A;  4GXO A;  4IHT A;  1IN4 A;  1FBU A;  1B4A A;  1IW7 F;  3DV8 A;  4KIF A;  1YTY A;  1OMI A;  5HS9 A;  1LB2 A;  5E8I A;  1WQ2 A;  2L3D A;  5ILU A;  3WTT C;  4UV9 A;  1W4M A;  5CVI A;  2MC3 A;  3T8T A;  5DD4 A;  1HSJ A;  4A5M A;  5BPI A;  5CJ9 A;  2VE9 A;  3ZN1 A;  3F8F A;  3BRO A;  2HYF A;  5J6X A;  4H0E A;  4CDG A;  4IJA A;  5L3E A;  1LDJ A;  4WXC A;  1CF7 A;  4XSX F;  3F8M A;  4GGG A;  5ICC A;  4EJO A;  3JW4 A;  5DYM A;  1LDK B;  5D5U B;  4HZF A;  3SXY A;  5ILS A;  3F8N A;  1Z7U A;  2DW4 A;  2PI0 A;  5D4S A;  1LQ1 A;  3LQQ A;  1BC8 C;  4OIO F;  1BI1 A;  3FM5 A;  2KIU A;  1K79 A;  1CF7 B;  3C7J A;  5ILV A;  4HDV A;  2GA2 A;  5TRD A;  1STZ A;  2QWW A;  2BEO A;  1H9G A;  1VTN C;  3GW2 A;  3I59 B;  3KFW X;  2BBY A;  3FXQ A;  2QLZ A;  5K5O A;  3EUH A;  3Q9V A;  1UHM A;  2EWN A;  1KGS A;  3FX3 A;  4FT8 A;  3WTY C;  4LB6 B;  3V7R A;  3GFI A;  2A6H F;  2HDC A;  5CVR A;  1GXP A;  2XAQ A;  2D1V A;  4Q4Z F;  4G9Y A;  4OMZ A;  3I0T A;  1P4A A;  1J5Y A;  2NNN A;  2PEX A;  1OYY A;  5FLX K;  1QBJ A;  2COM A;  4A2U A;  1FP1 D;  1K6O A;  1FPQ A;  1T0F A;  4A0Y A;  3MZH A;  2HTS A;  1HKQ A;  2EV6 A;  2Y75 A;  3WG9 A;  5D8K B;  2RVC A;  2O03 A;  3RYR A;  5D6F A;  4N0B A;  3LST A;  4RGS A;  1QPM A;  4M6Y A;  4QLC U;  3CO7 C;  1B9N A;  3D0S A;  3IC7 A;  5FLX Z;  3V7S A;  2FXA A;  3K0L A;  3HSF A;  3KCC A;  2PQ8 A;  4AIJ A;  5LGN A;  4LFU A;  2LF7 A;  2VT2 A;  4D0P A;  4R1H A;  1JXS A;  1ZN2 A;  4RGR A;  4JK1 X;  1XN7 A;  2IA2 A;  3KZZ A;  2VE8 A;  5ICG A;  1Z9C A;  1R58 A;  3W6K B;  4HW0 A;  3F72 A;  4Q48 A;  2L4A A;  4HQE A;  4I2O A;  1LEB A;  2FNP A;  1L3L A;  1IN6 A;  4YG2 F;  4LLL A;  1DPR A;  4ESJ A;  4BNC A;  4NHJ A;  4G6D A;  4I02 A;  3CTA A;  1TQI A;  1IN7 A;  3WTZ A;  4KIC A;  3KP2 A;  4XSZ F;  1SD6 A;  1ON1 A;  3QPT A;  4ETS A;  3GVA A;  4RGU A;  2MD5 A;  4HV6 A;  1W7P D;  2VBZ A;  4P55 A;  4R8H A;  3TQN A;  5LEJ A;  4KA4 A;  2P8T A;  1KA8 A;  1R1T A;  2A61 A;  1G3W A;  2R7F A;  1ZRF A;  2OAZ A;  3LA3 A;  2IA0 A;  3F6V A;  3CUQ C;  3VB2 A;  2W24 A;  1QQI A;  4HX4 A;  3MZY A;  2D1H A;  1FYK A;  2M8E A;  1FBS A;  1R23 A;  1U2W A;  3J81 K;  5ERI A;  2L4M A;  4LJZ F;  1Z05 A;  5FD6 A;  3HTS B;  2CQK A;  4BHB A;  4ZYH A;  3RPQ A;  3COA C;  4HX8 A;  2HEO A;  2B0L A;  1IXS B;  2L01 A;  4LGW A;  5F6F A;  3VOD A;  2MA3 A;  2DFI A;  4WF2 A;  1KYZ A;  2IW5 A;  3EYY A;  5FFX A;  2DAO A;  4O6J A;  2OBP A;  1DDN A;  5IT9 K;  4WWC A;  3CUO A;  2CW0 F;  5AIP A;  2BE5 F;  1ZRD A;  2JZY A;  1T39 A;  4R79 A;  1SFX A;  3WGG A;  2H6B A;  2E7X A;  3V7C A;  2RGV A;  4EJU A;  5LBQ A;  2ZJ2 A;  4GYG A;  1AOY A;  1IF1 A;  1HW5 A;  4IVN A;  3DQV C;  3KP3 A;  3GUD A;  1XMA A;  1YW9 A;  2IP2 A;  2Z33 A;  1UB9 A;  2QQ9 A;  3L7W A;  3EQL F;  5ED4 A;  4KIG A;  2YX4 A;  3DP7 A;  2EK5 A;  5AON A;  1B1B A;  1L0O C;  1GVJ A;  4DNC A;  1BI0 A;  3O6B B;  2XHK A;  3TKY A;  2FNA A;  1S8N A;  3RTR A;  2YSR A;  5HLI A;  1OYW A;  4IF4 A;  5LLQ A;  1FYL A;  5HLG A;  4BAY A;  3WE2 A;  3K1N A;  4EM1 A;  4CYD A;  2Y48 A;  1O3R A;  5LHH A;  2FE3 A;  3BJ6 A;  2O61 A;  1SD4 A;  2HTJ A;  2M87 A;  1IXC A;  1ODD A;  4Q47 A;  2DK8 A;  1HKS A;  2IA1 A;  5JI6 A;  4A5N A;  1ZHF A;  3HRT A;  1ZAO A;  4FX4 A;  3GFM A;  2HQN A;  3J80 Z;  4BHC A;  1O7F A;  4AIK A;  3M8F A;  4O5V A;  5CYV A;  4JQF A;  3R60 A;  3WE3 A;  3QU6 A;  2P7V B;  3GO5 A;  2FBK A;  4UHT A;  5JFR A;  3DXJ F;  4UUV A;  1D5V A;  2NS0 A;  2KRF A;  3P9I A;  1WRJ A;  3R4K A;  5AIQ A;  1O7L A;  4M71 A;  3E97 A;  4CO8 A;  3P9K A;  2HS5 A;  4ESF A;  2QQB A;  3M8E A;  4MTE A;  2F5F A;  5HVQ C;  1JE8 A;  3HOT A;  5CVU A;  4L18 B;  1LNW A;  5HDN A;  2F5E A;  6PAX A;  2PMU A;  4K2E A;  4A12 A;  1TLH B;  4EGY A;  3PFI A;  2KKO A;  3KP4 A;  4ZH4 F;  2PLY A;  3ECH A;  2WTE A;  3F8C A;  3N97 A;  4FX0 A;  1TW2 A;  2VXZ A;  3L2C A;  3F23 A;  1DUX C;  3FZV A;  5F1R A;  1DPU A;  1BN5 A;  1OYI A;  1Z91 A;  4IHS A;  3IRR A;  2PJP A;  1F4K A;  4LLN A;  3ECO A;  1R00 A;  2YR2 A;  3K9T A;  1R7J A;  1WWX A;  5HS7 A;  2E1N A;  1BJA A;  2D45 A;  4RGX A;  3WTV C;  1YO5 C;  1FC3 A;  2EB7 A;  5K1Y A;  3D5L A;  3F21 A;  3KEQ A;  1FP2 A;  3SZP A;  3WU0 A;  2NYX A;  3BP8 A;  4WXH A;  5F64 A;  4KYW A;  5A2Q Z;  2UXX A;  4Q5S F;  2EFQ A;  1F9N A;  2HKX A;  3FHZ A;  3HUG A;  3DPT A;  1YG2 A;  3VEP A;  2DPD A;  3H3U A;  4LG0 A;  2Q0O A;  1U5T C;  3ZPL A;  1FSH A;  1TBX A;  3WGH A;  4PZJ A;  5H6R A;  4U7B A;  2STT A;  2CSO A;  4OOI A;  1P92 A;  4HV5 A;  4U0W A;  3J81 Z;  3IKV A;  3CO6 C;  4BXU A;  3V8L A;  1YW7 A;  4KFC A;  2GXG A;  1GXQ A;  1O3S A;  5KVR A;  4LG0 B;  1IAW A;  3M1E A;  1UCR A;  4BHP A;  1JGS A;  3EYI A;  2YU3 A;  1AWC A;  1ONV A;  1IXR C;  3IHU A;  1J59 A;  2P6T A;  3FXR A;  1YS6 A;  1XCV A;  4B8X A;  1ZYR F;  4PDK A;  1W5T A;  2MLG A;  1IUY A;  2OZU A;  5L3B A;  4UVC A;  1J9I A;  3O3K A;  5E20 A;  2XUB A;  3RYP A;  5FFZ A;  2K7L A;  3Q5F A;  2VC0 A;  2BV6 A;  2RDP A;  4A0Z A;  2KIM A;  1FBQ A;  2VBY A;  3BJO A;  4N9I A;  4P5O A;  1KU7 A;  3PQK A;  1G3T A;  1PUE E;  4WK8 F;  1KU2 A;  3HRS A;  3VFZ A;  5BS6 A;  3E6D A;  2AXL A;  2DT5 A;  3U9G A;  2TDX A;  4I01 A;  4HDU A;  4M72 A;  2LNB A;  3DPL C;  2Q2E A;  4YFN F;  2MBF A;  2H09 A;  2GQQ A;  5DEQ A;  4XBF A;  1A04 A;  1HST A;  5DDG A;  4KNY A;  4O3M A;  5LRR A;  2WC2 A;  1T38 A;  4N9H A;  2EV0 A;  2KJB A;  3RDI A;  4EM2 A;  2W84 A;  1T6S A;  5DUK A;  2FRH A;  2DQR A;  5LEK A;  4M9Z A;  1O57 A;  2HFH A;  4M6X A;  3DF8 A;  4I0B A;  1YFH A;  2ZFW A;  5D5W B;  3B73 A;  3I4P A;  1WKM A;  1G4D A;  1PP8 F;  3ROU A;  4RAZ A;  3C3W A;  1I5Z A;  2JRT A;  3OOP A;  1E17 A;  4I09 A;  2P7C B;  5BPD A;  3QU3 A;  5E17 F;  5BOX A;  1YS7 A;  3I58 A;  3V4G A;  2R3S A;  5CVJ A;  1XMK A;  2F5C A;  4RB1 A;  1TW3 A;  3GFL A;  2OQG A;  3ZQ7 A;  4U0Y A;  3L9F A;  2O8X A;  3BPX A;  2RNJ A;  4P9U A;  2CG4 A;  4M9S A;  3MAJ A;  4EGZ A;  4WCG A;  2VBX A;  3E6C C;  2NRA C;  3J7A O;  5J8C A;  4LB5 A;  4UVA A;  2V1X A;  2EV5 A;  4YIF A;  3MWM A;  2QBY A;  3AAF A;  3LAP A;  3RPU A;  1U8R A;  4I0A A;  4KUM A;  1RNL A;  2KJC A;  2ACJ A;  4IRH A;  1QZZ A;  1BOA A;  3JAM K;  3ZMS A;  2JPC A;  4HBL A;  2Z9O A;  4ZYE A;  1HW1 A;  4IRI A;  2Z3Y A;  1C0W A;  2M45 A;  4OU0 A;  4EVI A;  5JVT A;  4G94 A;  1SD7 A;  4LD5 A;  1B6A A;  3TO6 A;  3I5U A;  2R7D A;  4ENJ A;  1XDS A;  2XV4 S;  1USS A;  4UNO A;  2HGC A;  4OIR F;  3FF5 A;  1G3Y A;  5FB2 A;  2PN6 A;  3MCZ A;  2ISY A;  5DD8 A;  2FA5 A;  3SHF A;  4CZZ A;  1ZAR A;  4E70 A;  2EJR A;  3EET A;  3BPV A;  4AVP A;  4L5I A;  2GA1 A;  1YLF A;  2EFP A;  2HWV A;  2LKP A;  1HXD A;  1KU3 A;  2M5W A;  2YPR A;  4HX7 A;  3P7N A;  1O3Q A;  2YX7 A;  1BIA A;  1S3J A;  3LQR A;  2WV0 A;  4ENM A;  2OQR A;  2XAS A;  4KDP A;  4RS8 A;  4PCQ A;  3DKW A;  2DPU A;  3G3Z A;  1MDM B;  2RV8 A;  1T2K A;  2P5K A;  3J80 K;  2XKO A;  2V1U A;  2HR3 A;  1MJ9 A;  4L9N A;  1DP7 P;  1U78 A;  2MLK A;  4S05 A;  4KN7 X;  1E2X A;  2XRN A;  5EEH A;  1W7P B;  2FBI A;  2VT3 A;  5IT3 A;  3P9C A;  1IZ1 A;  3HSE A;  5D6E A;  2FF4 A;  3KLN A;  2O0Y A;  3F22 A;  1MZB A;  4XRF A;  3JAM Z;  2FBH A;  3K2Z A;  3CJN A;  2P4W A;  4Y13 A;  2X4H A;  2EA2 A;  3I54 A;  1D8K A;  4M9X A;  1HKT A;  1R1V A;  2HKO A;  3KET A;  3HSR A;  5EEG A;  3WOD F;  4GCV A;  2VOP A;  1ZLJ A;  4EQQ A;  1G3S A;  2A3S A;  3IRQ A;  2JT1 A;  1R5H A;  5LGU A;  1S7A A;  2DLL A;  1BBY A;  1EH7 A;  2LF8 A;  3HIF A;  3F8B A;  3TDU C;  3GLX A;  1I1G A;  2H6C A;  4MTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...