3K0LA

Crystal structure of putative marr family transcriptional regulator from acinetobacter sp. adp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k0lA00
2M87A 3DEUA 4OMYA 1I5ZA 1HKTA 2HR3A 2Y0MA 3FXRA 3VEPA 5LRSA 5FD5A 1ZH5A 1WKMA 3NRVA 3TO6A 5DCFA 3FF5A 4EQQA 4KN7X 2EA2A 3J81K 2QVOA 3K1PA 5DYMA 1JXSA 3PQJA 5H20A 5H6RA 2XKOA 3LA7A 1MJBA 2QBYB 2H6BA 1R00A 3ZQ7A 4Y17A 3ZP5A 4WCGA 1MJAA 4LK1F 2DQRA 4MQ9F 1GXQA 4A6EA 4WWCA 1Z6RA 4O3MA 4ESJA 5BQTA 4HZFA 2OD5A 1ZLJA 1IAWA 4QWQA 2UWMA 1FSHA 1FP2A 2F5FA 2ISZA 3T8RA 4L0YB 2RVCA 3KP2A 1HW1A 4LB6B 2L4AA 1J7KA 1FBSA 3QP6A 1G4DA 4IHTA 4D0PA 5J6XA 1S3JA 2FNAA 1ODDA 2V1UA 3KLNA 3CJNA 3GVAA 5D5UB 4IF4A 2EV5A 1HSTA 4NB5A 5HOOA 1QGPA 3WGIA 1J2XA 1D3YA 1V3FA 3BY6A 1Z91A 2IT0A 5JHUA 2O8XA 3RKWA 2WC2A 3ISPA 3R0JA 3F6VA 4IRGA 4ENMA 2DAOA 2QWWA 3I5UA 5CVUA 1XDUA 2HTJA 1TTYA 2EFNA 3REOA 3CO6C 4MTEA 1T0FA 5HS7A 4CYDA 4G7OF 3ELKA 2NNYA 2EFWA 1TQMA 1F9NA 3P9IA 4HQEA 3MZYA 3F8FA 4S04A 1IF1A 3F8NA 3Q9SA 4XSZF 5EEGA 3TQNA 4B09A 2IJLA 2IVMA 4AVPA 5A2QZ 2XIGA 5BS6A 2Q2EA 3DQVC 4Q48A 2GA1A 3FWEA 4BXUA 2FA5A 1IRFA 4RGUA 3DPTA 4L9VA 4I01A 3QAHA 5HDNA 1VTNC 4ZH4F 5BPDA 3CDHA 2P5LC 2KKOA 2FE3A 1YIOA 2JRTA 4BAYA 1S7OA 2DW4A 1WQ2A 1B59A 2EFOA 1RUNA 3L09A 1ONVA 3H3UA 1SD7A 3EQLF 4G9YA 5E1XA 3I54A 3J81Z 5LHGA 4ASNA 4EJOA 4EVIA 2IA2A 1FBUA 2A07F 1KQ8A 1FP1D 3GXOA 3HSEA 5F6FA 3HTSB 2MD5A 5HDGA 3MAJA 3GO5A 1LB2A 2Q0OA 4BYYA 3E5UA 5D8KB 2EJRA 1REPC 4EM1A 2ZCWA 4UVBA 5CVIA 3HOTA 1FWZA 4XLPF 2OZUA 3GFJA 1CF7A 2YX7A 3FMQA 4JBAA 4WXHA 4UNOA 2G7HA 2EWNA 4KIGA 2D45A 4YFNF 1HBXG 5LBQA 3IKTA 4UVCA 3EUHA 4L18B 4GYIA 1MJ9A 3VFZA 1J59A 1ZN2A 2BV6A 2COMA 3BWGA 3R0AA 3FZVA 3JW4A 1S7AA 3LAJA 2RGVA 3HRMA 1LVAA 4A0YA 2QLZA 3ZPLA 4Q47A 1L0OC 3WTUC 1XCBA 4BHBA 1YO5C 1PDNC 4HYEA 3KZZA 2PLYA 5L3CA 2ADUA 2FMLA 3M8FA 2D1VA 2JPBA 1FLIA 3V8KA 4RGXA 4XLNF 2VBZA 2CG4A 4M9XA 1S8NA 3Q5FA 4WXCA 3EYIA 2K4JA 1BBYA 4CHUA 3K0LA 4O6JA 1ON2A 5D6EA 2XKPA 2VBWA 2HOEA 3MQ0A 1R23A 4KN4X 4KMUX 3FHZA 2KIUA 1JGSA 3L9FA 4A12A 1XD7A 4A5NA 1G3YA 1EH7A 5CVJA 1MDMA 2E1NA 5DV5A 4EM0B 3V7RA 1CF7B 1FZPB 2FQ3A 5K5RA 5D4RA 3IHUA 4IPAA 2F2EA 5AIPA 4CICA 4RB2C 4P9UA 4L9JA 2JZYA 4LK0F 2W84A 3I53A 1K7AA 2A3SA 4Z2YA 4A2UA 1BIBA 4AWXB 1YLFA 2HWVA 4L5JA 4L5IA 1BM9A 3VB2A 3C1DA 5LRRA 3COAC 1DP7P 3FXQA 4HX4A 1QBJA 1R5GA 3LA2A 5ICEA 2LF7A 1USSA 1MGTA 2OU2A 4U7DA 2EFPA 4A0XA 1I6XA 4H0EA 3J7AO 4ETSA 4JQFA 2FSWA 1LDDA 1YS7A 2MC3A 2NRAC 2X0LA 1YYVA 2JSCA 5FFXA 4G94A 3GUDA 2M30A 1BN5A 4MEXF 1MDMB 1XGOA 5ED4A 5FGMA 1F4KA 1K78A 2M8EA 4ZZLA 2E1CA 4KUMA 5ERIA 1FOKA 4K2EA 4MGRA 4P5OA 2WTEA 3IWFA 1C0WA 4NQWA 2VODA 2P4WA 3KEOA 4PDKA 3E6BA 3WGHA 1SFEA 2M1BA 2BGCA 2H09A 2RV8A 3PQKA 3GZ5A 4N9IA 2MA3A 2CQKA 3CO7C 2XAQA 5EEHA 4LFUA 1P4AA 2DBBA 1P4XA 3RI4A 4MQVA 3TDZC 4A6DA 2A5YB 2XROA 1Z7UA 1FNNA 1P6RA 3DKWA 3RIRA 2NNNA 3CLOA 1H0MA 1Z9CA 2GXGA 4RAZA 1QO0D 3WTXC 4N9HA 3DPLC 1S6LA 3V8JA 2V9VA 1XCVA 1TQIA 5LGNA 4XBFA 2EB7A 3F6OA 1IRGA 2V1XA 3DXJF 4MEYF 3K1NA 5FLXK 3GZ6A 5E8GA 3WTZA 1P2FA 4GO1A 4LGWA 2VE8A 3V7SA 2QENA 5F64A 1FYLA 1U5TA 1K78B 3WG9A 4YFKF 3O2PE 1AWCA 2XAFA 1DPUA 5K1YA 5L3GA 2FEZA 2H94A 2PJPA 3F21A 5D5XB 3HOSA 1OYIA 1O3TA 1DUXC 4AIKA 5ILVA 2V6CA 1QQIA 4UUVA 3C7JA 2OQRA 3P9CA 5E1WA 4KDPA 5L3FA 2FNPA 3RYRA 4LLGF 4B8XA 4OIOF 1SMTA 3OV8A 4HV5A 1SFUA 3LQQA 3G3ZA 1HQCA 3RKXA 2UXNA 2Q8KA 3V4GA 5HLGA 3KZYA 2XHKA 3RKYA 4LLLA 1UHMA 2M45A 3MWMA 4ON0A 3ULQB 4P9FA 1LDKB 1G3SA 1BC7C 4ZYHA 1FYMA 6PAXA 5ILUA 2E7XA 3QRFF 1OPCA 3L2CA 3R61A 2P8TA 1LJ9A 2VC1A 1U5TB 4G8XA 1IZ1A 1QNTA 1SD5A 5LGUA 4HF2A 1B1BA 3HYIA 4R79A 2GA2A 3DP7A 4KFCA 1OYWA 4R1HA 2DK5A 2ZMEA 1H9GA 2FOKA 4YG2F 2VOOA 3PFIA 3M9AA 1T2KA 5LHIA 2HKXA 2LF8A 2QZ8A 1QZYA 3GEZA 5ICCA 2VOPA 5HS9A 5FLXZ 3F3XA 3I4PA 4KNYA 2XAHA 3GYHX 3KEQA 3EDPA 3IKVA 2GIVA 2DPUA 3WTWC 1BIAA 4CDGA 1OKRA 4RB3C 2F5EA 3I59A 1IN8A 1HSJA 2O0YA 4OINF 3TO7A 3HSFA 2Y75A 2TDXA 1IXCA 5AONA 2CWEA 5KVRA 1G3TA 4BNCA 2Y48A 1W5TA 4KA4A 2E7WA 4G6QA 3W6KB 2VBYA 2D1HA 5J8FA 2LKPA 3ZMUA 4PGHA 1LEBA 3BPXA 1Z05A 1XGSA 3ZN1A 1SFXA 1Y0UA 5D4SA 2ELHA 2LNBA 1ZRDA 2FRHA 2IW5A 2XGXA 2GAUA 3GW2A 2GWRA 2IA0A 3SZPA 4I2OA 3BJOA 2DT5A 2O6GE 2IRFG 1U2WA 3ZMZA 2P7VB 4LLNA 1KGSA 1XB4A 2WWYA 2VN2A 2GQQA 1ZRCA 5LEKA 5LGTA 2ZMEB 4U0WA 3LSTA 2RQPA 2P5VA 2PBIA 2QQBA 2A69F 2NYXA 5BMZA 5HVQC 4ZZDA 5E17F 3WODF 2ZXJA 3I64A 5L3EA 1YTYA 2CGPA 2PQ8A 1W5SA 2W24A 4WK8F 2YU3A 4FT8A 3F8BA 3I59B 4HDVA 5JI6A 2BE5F 5IT9K 3LAPA 3F8CA 1H9TA 4LG0A 2L4MA 4L0ZB 3I71A 2Z33A 2PMHA 2YSRA 1OYYA 3IRQA 2R7FA 1X3UA 3QU3A 2Z99A 3TO9A 3KP4A 2ZO4A 2G9WA 1XGMA 1R58A 3E6CC 2FBIA 2W57A 1CGPA 4WX9A 4AIJA 4OU0A 5IT3A 4MTDA 3CUQA 2ZNYA 2HDCA 3HTUA 4HLYA 2MBFA 2Z5UA 5CJ9A 4PCQA 1BI2A 3GWZA 1R1VA 2AXLA 2A68F 1NHAA 2CYYA 5FB2A 2VC0A 5K5OA 1LDJA 4OIQF 4KYWA 4HX8A 1FC3A 3KP5A 4ZYEA 3GFMA 1U8RA 4L9TA 4HBLA 4A5MA 2HZTA 2P6SA 2FMYA 3DF8A 3N4MA 1O3SA 4ZYDA 1BI1A 3HHHA 4PGGA 1K6OA 3SQNA 1O3RA 1ZGAA 3KFWX 3FX3A 1KU3A 5K5QA 3K1MA 4LG0B 1DPRA 2BYVE 2JTVA 3E6MA 3LA3A 1SD6A 2HEOA 3U2RA 1O3QA 1UHWA 3KP3A 2CO5A 1TW3A 2XUBA 2EV6A 3FXUA 1JHHA 1J75A 1O7FA 2ESNA 4HLXA 4RGRA 1LEAA 2L02A 4EMSA 4ZYGA 3LQRA 1E2XA 2YR2A 1PUEE 4Q4ZF 3CUQB 2A6EF 3BDDA 5F1RA 5J8CA 1HKQA 1G6NA 4M9SA 4UHTA 4EV0A 2XV4S 5D5WB 3VOEA 2QQ9A 3JAMK 5IT9Z 1U5TC 3NQOA 1ZRFA 1I1SA 3WGGA 4BQAA 2XAGA 1A04A 5CYVA 3K9TA 2W25A 1YFHA 3SXYA 2KJCA 3M7GA 4HQMA 1IXSB 3R4KA 4EJVA 1FX7A 3ZN0A 2J5PA 3MFKA 1R7JA 3H3ZA 3TOAA 3QOPA 3F22A 3KCCA 2JPCA 2W85A 2M5WA 4EGZA 3HRTA 1ULYA 2UZKA 3LWFA 1TNSA 1O57A 1R1UA 3AAFA 1FBQA 2J5OA 1L3LA 1YS6A 3D0SA 1J9IA 1SAXA 4FHTA 1PP7U 1W7PD 4M71A 5E8IA 3FM5A 3P9KA 4U7BA 1R22A 2JT1A 2L54A 3HHGA 1USTA 3ERED 5LHHA 3EETA 1SD4A 1UB9A 1GVJA 2R7DA 1YG2A 1XMKA 2K7LA 3BJAA 4LD5A 2QUFA 3M1EA 1RUOA 3W6JB 3F8MA 3DV8A 4GGGA 1G3WA 2VE9A 5HLHA 2DFIA 2O61A 5DUKA 3RDIA 2IA1A 3RYPA 3TKYA 1ZG1A 1QZZA 3GX4X 5ICFA 2BBYA 4JK1X 4G7HF 4DQ2A 1ON1A 5DEQA 3MEXA 2P7CB 2L3DA 2XRNA 1RZ4A 3R6SA 3Q9VA 2PFBA 2PMUA 2EFQA 4LJZF 3WTTC 5E20A 2DQLA 2CFXA 1RNLA 1FY7A 3E5XA 3KP7A 3HUGA 4U88A 3BP8A 2KRFA 3I0TA 2QYOA 4NHJA 2R3SA 3H92A 2Z9OA 4ESFA 3DFGA 3RPQA 1ZARA 1T38A 1QPMA 2ETHA 3E5QA 3O6BB 2L01A 4I02A 2RC4A 5L3BA 4U0YA 3GF2A 4RB1A 5D6FA 1RI7A 3L7WA 3JAMZ 4A0ZA 1W4MA 1W7PA 1ZHFA 3F72A 2P5KA 3QPTA 4KICA 2CW0F 2KIMA 3BPVA 1KQ9A 5H6QA 4BH9A 5AIQA 2HGCA 5E18F 1JE8A 5HLIA 2HKOA 3F23A 4F7ZA 5DCMA 3CTAA 2NAZA 5LLQA 3P7NA 2A6HF 4FX4A 3WTSC 3TOBA 1MKMA 3JSOA 3U9GA 4CXFA 1ZG3A 3TGNA 3QPHA 2RN7A 4IHSA 4IXAA 1K79A 5TJJA 2VBXA 2QQAA 1XN7A 2XVCA 4HA8A 4ESBA 1TNTA 3E97A 4ENKA 3V8LA 1TW2A 1HXDA 2DLLA 1EH8A 5HDKA 3IWZA 1E17A 2K02A 2MLGA 1FYKA 1BI0A 4UXNA 1YW7A 1R1TA 2H6CA 1GHCA 3E3VA 4N0BA 3ECHA 2HS5A 5ICGA 1KYWA 1S29A 3M8EA 4IVNA 1U78A 1FSEA 2ISYA 3SZTA 3T0YA 4AIHA 4YIFA 1TQPA 1HKSA 4I98B 1Q1HA 1U6GA 5D8LB 3LFKA 1OR7A 4RS8A 1XMAA 2RKHA 1W7PB 3EYYA 3R60A 3HIFA 1IW7F 1ZREA 1TLHB 2YPRA 3O3KA 3I58A 2DI3A 2F5DA 2FXAA 2ZBKA 5D5VB 3ZMSA 1F1ZA 5TRDA 4CGZA 3GFLA 2ESHA 4DNCA 5DCMB 2ZKZA 1OMIA 4OIRF 1ZGJA 2HQNA 4BHCA 4M6XA 3B02A 4I0AA 4EJWA 4HF0A 2FBHA 3GLXA 2ZNZA 4O5VA 2DO7A 3CUQC 2YX4A 1D8KA 1I27A 1SMYF 3FMRA 1HW5A 1KA8A 2OAZA 4L9NA 1XGNA 1KYZA 1MZBA 4M6YA 4KIFA 3ABTA 2DU9A 3KP6A 3K2ZA 2HFHA 3ECOA 5FFZA 4MNUA 3J80K 1LNWA 2WV0A 1BI3A 3ROUA 2K4BA 3U1DA 4M74A 1FPQA 3MZHA 4I7HA 3HRSA 3SHFA 2Z3YA 1IUYA 3BROA 2GZWA 4RGSA 2PEXA 3IL2A 3T5XA 5DD8A 1Z1DA 4MHGA 4G6DA 4EJTA 4M72A 2RNJA 3T8TA 5E1ZB 3HRUA 4CZZA 2D2WA 4GYGA 4GXOA 4QLCU 1B4AA 2BEOA 2ZFWA 1T6SA 5DUIA 4LB5A 4IJAA 2G7UA 1B9NA 1J0RA 2FU4A 4YIIA 1UCRA 4AD9A 1EV7A 1R5HA 2VONA 3QU6A 1WI9A 4BHPA 1PP8F 4M9ZA 3WE2A 4PZJA 4ENJA 5CVRA 4XRFA 1EH6A 3RPUA 3SFZA 3RTRA 2EA4A 4EM2A 3WU1B 3ABUA 5FD6A 2F5CA 1GXPA 1IN7A 1KU2A 3WE3A 3VODA 4U0VA 3K69A 3BOQA 3E6DA 3MCZA 3JTHA 5LEJA 2KJBA 4OMZA 1WRJA 5HS8A 1XSDA 5FO5A 4XSXF 2AS5F 5JVTA 2HYFA 2HQRA 3CUOA 1D5VA 2A61A 2RDPA 1KQ0A 4HX7A 4Q5SF 1FT9A 4EJUA 4S05A 2MH9A 3GFIA 5CLSA 1BOAA 2X4HA 4OIPF 2IP2A 2ACJA 1AOYA 3OOPA 5BOXA 5DD4A 2MH2A 4WF2A 3J80Z 5BPIA 4OOIA 3B73A 3T1BA 3FM3A 2DPDA 3RJPA 3L00A 1MD0A 4HW0A 4Y13A 4KMFA 3IC7A 5JR3A 1YQAA 2DK8A 4RB0A 3TDUC 4ENNA 1STZA 3JSPA 4HV6A 2K86A 1UFMA 1D8JA 2O03A 4KT5C 1TBXA 3C3WA 2ZJ2A 2EV0A 4P96A 2DTRA 4TV7A 5KK1A 3QP5A 4UVAA 2PG4A 2XAJA 3NEUA 3BZ6A 2V79A 2NS0A 1T98A 4GCVA 1XSXA 1RIOH 1YW9A 4LMYA 2EK5A 1B6AA 4I0BA 1WSUA 1Z6TA 1BC8C 3D5LA 3JTGA 4UV8A 3WTVC 2VT3A 3ZMVA 3N97A 3V7CA 1LQ1A 3WTYC 1IN4A 3FMSA 1ZLKA 3KETA 3IRRA 3KE2A 2H27A 4IRIA 2VT2A 2P6TA 1F5TA 1P4WA 1U3EM 2VXZA 2V1DA 2FBKA 5L3DA 4CO8A 2LSOA 4HF1A 1BJAA 1J5YA 2OA4A 2B0LA 2CSOA 1WWXA 2QM3A 3BJ6A 1IN6A 3S2WA 1I1GA 1IN5A 5ILSA 1ZG5A 2K27A 4R8HA 4RAYA 1XDSA 4HDUA 4E70A 1ZAOA 4P55A 2OQGA 4KIBA 2FF4A 3HSRA 4WXDA 3ZMTA 2STTA 1DDNA 1P92A 2MLKA 2KIFA 1IXRC 3ZMDA 5CVVA 1T39A 2QBYA 1R36A 4M73A 2PI0A 4YFXF 2STWA 4EGYA 1B9MA 1XSVA 4HOBA 2LDUA 4FX0A 3C18A 2HYGD 5JFRA 1O7LA 2UXXA 3WU0A 1KU9A 4I09A 2C6YA 5DDGA 2HTSA 4Y15A 1KU7A 1HW2A 2GXBA 1ZYRF 2OZ6A 1YW8A 1JHFA 4HAMA 3G73A 2XASA 2IPQX 4IRHA 5A2QK 2OBPA 4G7ZF 3ML6A 1V4RA 2O3FA 4UV9A 2PN6A 3KLOA
chains in the Genus database with same CATH superfamily
2M87A 5IP6A 1W1WE 3DEUA 3AL0B 1DGWY 4OMYA 1I5ZA 1HKTA 3DTEA 2HR3A 2Y0MA 3FXRA 1YOVB 3VEPA 4LIUA 1R49A 2IGOA 2V1NA 5LRSA 2HQ5A 3FXMA 5FD5A 4BGDA 4E7JA 2MSYA 3W2WA 1ZH5A 3ERMA 5GTIC 1WKMA 3NARA 3LSJA 4ZTFA 2EZKA 4BQOA 4ZTJA 1Y1VJ 1DU0A 3HOVJ 2KL4A 3NRVA 3TO6A 5DCFA 3HZJA 3AG3H 1VQOI 1SFOJ 3FF5A 1MW7A 4EQQA 3CCVI 4KN7X 2EA2A 3HBLA 3J81K 2QVOA 3K1PA 1S7EA 5DYMA 4AU7A 3PQJA 3RKQA 1JXSA 5H20A 5H6RA 2XKOA 3LA7A 2BW3A 1MJBA 2QBYB 2H6BA 2E2JJ 1R00A 2MG4A 3ZQ7A 4Y17A 4BE0A 3ZP5A 4WCGA 1MJAA 5EEAA 4LK1F 2DQRA 4MQ9F 3JRFA 2OJED 3CCMI 1YIJI 1GXQA 3JCUC 4A6EA 4WWCA 1Z6RA 4O3MA 2IEKA 4ESJA 5BQTA 4GDFA 4DBQA 4HZFA 2OD5A 2WAEA 1ZLJA 1IAWA 4QWQA 2UWMA 1U0JA 1FSHA 1BOBA 4PSXA 1FP2A 1X4OA 2F5FA 2ISZA 5J3LA 3T8RA 4L0YB 1X58A 4D5CA 3G2BA 2RVCA 3ZR8X 3I55I 3KP2A 3PUFA 1HW1A 1ZQ3P 4LB6B 2L4AA 1J7KA 1FBSA 3QP6A 3ASOH 1G4DA 3SDGA 2M9HA 4IHTA 4D0PA 2W1OA 3S1MJ 5J6XA 1S3JA 2FNAA 1ODDA 3DKXA 2E1MC 2BVMA 3OY9A 2LC2A 5JHFA 1IG7A 1TZLA 2V1UA 2E19A 3KLNA 1Z7LA 3CJNA 2W4SA 3GVAA 5D5UB 1X2NA 2HNHA 2EV5A 2V4JC 2DFHA 2E71A 2ZXIA 4IF4A 2VJJA 3C2GA 2FX0A 2BXZA 1HSTA 4NB5A 2DT6A 2WY8Q 4LITA 2NVYJ 3EUAA 2E2HJ 5HOOA 1QGPA 5KAIC 3WGIA 1J2XA 3SFIA 4BBRJ 5IPAA 5F1JA 1D3YA 2PJRA 1V3FA 2F5VA 2LBFA 1ACIA 3BY6A 1Z91A 2IT0A 5JHUA 1D0XA 2O8XA 3RKWA 2CUJA 2WC2A 4YEJA 3ISPA 1FTTA 3R0JA 3F6VA 4IRGA 4YELA 4ENMA 2DAOA 3JREA 1SAUA 2L9RA 3QOEA 3K6GA 2QWWA 3I5UA 5EGOA 2HPIA 5CVUA 1XDUA 4F93B 2HTJA 2X51A 3JRGA 1GVDA 1TTYA 2EINH 2RAEA 2EFNA 3REOA 1F43A 2KFDA 3CO6C 4MTEA 3MD2A 3ZQQA 1T0FA 5HS7A 4CYDA 4G7OF 3ELKA 3S8PA 5CQGA 2NNYA 2EFWA 1TQMA 1F9NA 1QHGA 3P9IA 4DOZA 4HQEA 2BW3B 1DP3A 3MZYA 3F8FA 2MD0A 4S04A 1IF1A 4JOMA 3F8NA 3H5RA 3Q9SA 2XGCA 4XSZF 5EEGA 3TQNA 4B09A 2IJLA 2IS1A 1S9HA 1Z3XA 1JKPC 2IVMA 4AVPA 3IH2A 1E0EA 5A2QZ 1R4NB 2XIGA 3CZ6A 4DW6A 5BS6A 2CMPA 2Q2EA 1TWHJ 2LLKA 3DQVC 1QHHD 4Q48A 2CU7A 2GA1A 3FWEA 1VQ9I 4BXUA 2FA5A 1IRFA 3IH3A 1A6QA 4RGUA 4BE1A 3DPTA 4L9VA 2CRGA 4Y4RA 1X1BA 4I01A 3QAHA 5HDNA 1VTNC 4HEA2 1BR1A 3FBNB 5GADJ 4ZH4F 5BPDA 3CDHA 4UB6C 2P5LC 2KKOA 4OWRB 2FE3A 4FCYA 1YIOA 2KIQA 2ZFUA 2JRTA 2VJ4A 4BAYA 1S7OA 2DW4A 1WQ2A 1B59A 2EFOA 1I3QJ 3DU6A 1RUNA 3L09A 5FKKA 1ONVA 3H3UA 3G1OA 3VYTB 1SD7A 2TCTA 3PO3J 3EQLF 4G9YA 5E1XA 2OPTA 1NG7A 4M3GA 4V19K 1TC3C 3I54A 1VQKI 3J81Z 3G71I 5LHGA 2DYRH 3E0JB 4ASNA 4EJOA 4EVIA 1WH5A 5GAEJ 2IA2A 1FBUA 2A07F 2IAIA 4RA2A 2PJRB 2HOAA 3C2BA 3W6VA 1KQ8A 4ZJZA 5HODA 3OYDA 2LBFB 1FP1D 1XG1A 1LFUP 3GXOA 1R5ID 3HSEA 5F6FA 4N4NB 3HTSB 2MD5A 5HDGA 4XLFA 3GMEA 1HCRA 4C2UA 1WJFA 3MAJA 3GO5A 1LB2A 2Q0OA 4BYYA 3E5UA 3OL3A 4B47A 4ZDPA 5EGOB 4F91B 2LY9A 5D8KB 2EJRA 2HYJA 1REPC 2LG4A 4EEFG 4B3AA 4EM1A 1X2MA 2R7UA 1UG0A 2ZCWA 3O8GA 4UVBA 4BJ5C 2VXDA 2Z1DA 5E3LA 1VQMI 1O4XA 5CVIA 2KRCA 1S5LC 3HOTA 1FWZA 3JR9A 4XLPF 2OZUA 2M0CA 1V55H 3GFJA 4MFEA 2K9LA 4XICA 1CF7A 2YX7A 1MMSA 3FMQA 4JBAA 4WXHA 4UNOA 2QA4I 2G7HA 3S1RJ 4ANJA 2EWNA 1JJ6C 4KIGA 2D45A 1IJWC 4YFNF 5FLVA 4A3GJ 3SYTA 3U1KA 4S0HB 1HBXG 1GDTA 1G8XA 5LBQA 4XK4A 3IKTA 4UVCA 2M34A 5FJ8J 2ZJRF 2GIZA 2YUSA 3EUHA 5FROA 2ECCA 2Z16A 3K10A 4C2MJ 4L18B 2JUGA 3NWTA 4GYIA 1MJ9A 3VFZA 1POGA 1J59A 2LFBA 1MBKA 1ZN2A 2BV6A 3OR2C 4BDYA 2COMA 1IO2A 3BWGA 5C4XJ 2BY1A 2KDZA 1WHUA 1WFXA 3R0AA 3FZVA 4UB8C 4A3EJ 3JW4A 1S7AA 3LAJA 1W36C 2W00A 2RGVA 3HRMA 1LVAA 4A0YA 5F27A 1FOWA 3OYGA 4XRSG 2QLZA 2VPRA 1UG2A 3PM1A 4AYBA 5B1AH 3ZPLA 4Q47A 3D1NI 1L0OC 4FE4A 3WTUC 3QYEA 5EG0A 3I4MJ 1XCBA 4BHBA 3DKYA 3I4NJ 1YO5C 3SDBA 1PDNC 1EF4A 5EJCA 4HYEA 3KZZA 2PLYA 3HPHA 2ADUA 5L3CA 1WJCA 2HXOA 3LNQA 2FMLA 4PJNA 3M8FA 1UAAA 4D1QA 4XR6A 3GTOJ 3IAS2 2O9LA 2D1VA 2JPBA 1LFBA 1FLIA 3V8KA 2H8WA 2CQQA 4RGXA 3LSKA 4XLNF 2VBZA 2CG4A 3A0HC 4M9XA 1S8NA 1JTYA 4A3BJ 4D9JA 3Q5FA 1TWAJ 1ETXA 4WXCA 4G12A 3EYIA 1WVRA 2K4JA 1BBYA 4CHUA 3VDXA 3K0LA 3AL0C 4O6JA 1ON2A 5D6EA 3HOXJ 2XKPA 2VBWA 2IS2A 2HOEA 2E35A 3ZQCA 3MQ0A 1R23A 4KN4X 2HOSA 1HLVA 4KMUX 3FHZA 4CZCA 2KIUA 1JGSA 3GBGA 3CC7I 3L9FA 4A12A 2QKMB 3GCMA 1XD7A 3DBRB 4A5NA 2ELKA 2KZVA 1G3YA 1EH7A 2EIMH 2K9QA 5CVJA 3L2QA 2ZJQF 4IL6C 1MDMA 2E1NA 1MMAA 5DV5A 9ANTA 3HM5A 4EM0B 3BG6A 3V7RA 1CF7B 1FZPB 4ZC3A 2FQ3A 1PUFB 4XQFA 1HC8A 4IO9F 1MBEA 3PSFA 5K5RA 3VPRA 5D4RA 4Z6YA 5IYCJ 2NOGA 3QYFA 4BL0B 2QKLB 3IHUA 4IPAA 2F2EA 3K4MA 5AIPA 5GP9A 1B8IA 4CICA 4RB2C 4YRVA 4P9UA 4L9JA 2IGNA 3BCAA 2KMUA 3ESWB 3OIOA 2CUEA 2JZYA 3Q0UA 4X1EA 1ZK8A 4IOAF 2CQXA 2L2OA 4D7NA 4LK0F 2W84A 5FKLA 3GZNB 2VKDA 3I53A 1K7AA 1PJRA 2A3SA 4JX5A 2DN0A 2EZIA 4Z2YA 5F0CA 4A2UA 1BIBA 4AWXB 1YLFA 2HWVA 5M3FJ 1ZELA 4L5JA 4L5IA 1BM9A 4G6TB 4IQ4A 2GM4A 2L9SA 2NOJB 4CSWA 4BE2A 3PFYA 3VB2A 5IOZA 3C1DA 1TT5B 5EG0B 2LTPA 3LSHA 4XONA 5LRRA 3COAC 1DP7P 3FXQA 4HX4A 1QBJA 1R5GA 3LA2A 5ICEA 2LF7A 1GV5A 5BNGA 1USSA 1MGTA 2R7OA 2OU2A 4U7DA 4PFOA 1TP4A 3LSRA 3OS1A 2CV0A 2EFPA 3RZDJ 2QSGX 4A0XA 1I6XA 3BR1A 4H0EA 3J7AO 4ETSA 4JQFA 1RRJA 3QWLA 1AKHA 2FSWA 3CCLI 1LDDA 1YS7A 1OCPA 2MC3A 1UJ8A 5KAFC 3JRCA 3J7ZI 3D5SC 1QRYA 2NRAC 3LSPA 2X0LA 2DFEA 2ID3A 1VNDA 2M7BA 1YRNA 1I39A 1YYVA 2JSCA 2JA6J 3BLYA 3HOYJ 2GOXB 2XDVA 3IP4B 5FFXA 5KNLA 2CS3A 2CV2A 3AG2H 3LFUA 4G94A 3GUDA 2EZHA 2VQGA 1FMVA 2M30A 3HPGA 2P81A 2F6CA 1ETWA 3QPSA 1BN5A 1A31A 4MEXF 2JVHA 1MDMB 1XGOA 5ED4A 2VKVA 3BTCA 5FGMA 1F4KA 2JQ7A 1K78A 2M8EA 1BR4A 4ZZLA 3L2WA 3UR3C 2E1CA 3LSMA 4KUMA 5ERIA 4OAZA 1FOKA 2JSPA 4K2EA 2DA2A 4MGRA 4XL9A 4P5OA 2WTEA 5TISC 3IWFA 1E3PA 1B8IB 2A6TA 2LKXA 1C0WA 1RC9A 4NQWA 2VODA 2P4WA 3KEOA 4PDKA 3E6BA 2ELJA 5FKMA 3WGHA 4V2GA 1SFEA 2M1BA 2BGCA 2H09A 2JA7J 5KCMA 2RV8A 5F04A 5E3NA 3PQKA 3GZ5A 4N9IA 2MA3A 2CQKA 2HQAA 2BXYA 3CO7C 1CQTA 2AQFA 2XAQA 5EEHA 4LFUA 1P4AA 2DBBA 2EBIA 4CUGA 1P4XA 3RI4A 1VQ8I 1PYVA 4MQVA 2L7ZA 3HGYA 3TDZC 5EYRA 4A6DA 2W7NA 3S17J 2R7TA 2A5YB 2XROA 5FRMA 1Z7UA 3JRAA 1FNNA 1P6RA 3DKWA 3RIRA 2NNNA 2F4IA 5GAGJ 1XS9A 3CLOA 3CMYA 1H0MA 1JJ8C 1Z9CA 2L7MP 2ME0A 2GXGA 3H35A 4RAZA 1QO0D 3BZCA 3WTXC 2QGUA 3CCYA 4N9HA 1X1PA 4PJMA 1BL0A 3DPLC 4C9YA 4BXXJ 3RSNA 1Z3YA 1S6LA 1ETQA 3V8JA 2V9VA 3M1CA 1XCVA 4A3FJ 3TBIA 1TQIA 2LMDA 5LGNA 4UUSA 1IGNA 2X1DA 4XBFA 3SJMA 2EB7A 1HOMA 3DLAA 4U87A 1T56A 4B1RA 4XM3A 3CMMA 1MIJA 5CKTA 1YRNB 3F6OA 4NC7A 4XLAA 5B66C 1IRGA 3LOCA 2V1XA 3DXJF 2R0QC 4MEYF 3TMOA 3KEYA 2Y9ZA 2DA5A 3G1LA 3MN2A 1V5FA 3K1NA 1D5YA 5FLXK 4E7IA 1N77A 4C2TA 3GZ6A 5E8GA 5K7FA 1JUSA 3BR3A 2X6WA 3WTZA 1P2FA 4GO1A 3X2QH 2X6YA 3GTPJ 4A69C 1V5GA 4LGWA 3S2HJ 2VE8A 3V7SA 2QENA 1A6IA 2XAUA 1BW5A 5F64A 1FYLA 1U5TA 3SEQA 1K78B 3WG9A 1Y56A 4YFKF 3HG9A 3O2PE 1H88C 2XAFA 1AWCA 1T0FC 1DPUA 2B9SA 5K1YA 4A93J 5L3GA 3CJQB 1GLNA 4RM2A 2FEZA 2H94A 3WG7H 1ZGWA 2PJPA 4NDLA 3F21A 3CLQA 1NH3A 3I56I 4NQWB 5D5XB 2JUCA 3UKGA 3KYCB 3HOSA 1OYIA 3OR1C 4J00A 2HU9A 1SC7A 1O3TA 1DUXC 4AIKA 5ILVA 4XOTA 2V6CA 3PSIA 4CYCB 1QQIA 4UUVA 3C7JA 3HB9A 2OQRA 2XF6A 4M3EA 4A3CJ 3P9CA 4F3QA 1S72I 3BG5A 4I99C 5J47A 5E1WA 3GTGJ 4KDPA 5L3FA 2FNPA 3RYRA 4LLGF 2KT0A 4B8XA 2DMPA 5HNHA 4OIOF 2HVQA 1SMTA 3OV8A 4QPQA 4HV5A 3DWLE 1SFUA 2A5WA 2FD5A 2LOOA 2R5ZA 3FXKA 3LQQA 3G3ZA 3WHBA 1BJZA 1HQCA 3RKXA 2UXNA 2Q8KA 4M6VA 2IS6A 3V4GA 5HLGA 4II2A 1ORKA 5FLMJ 3KZYA 2WB1A 2XHKA 3RKYA 4LLLA 1UHMA 2BY2A 2M45A 2LY1A 3MWMA 4RMNA 4XOPA 4ON0A 4BQNA 3BG9A 4HNUA 2XPVA 4YIRX 2BHYA 3ULQB 4P1WA 2E34A 4IZZA 2M4KA 4P9FA 4AM3A 1LDKB 1G3SA 1BC7C 4XN0A 4ZYHA 1FYMA 1FIAA 2KDOA 2K5CA 3OYHA 3H1CA 6PAXA 5ILUA 3F9KA 4C3JJ 2E7XA 3QRFF 4ABZA 1OPCA 3L2CA 3R61A 5DTDA 3S14J 2P8TA 5GPCA 1LJ9A 2VC1A 4RAGA 1U5TB 4G8XA 1IZ1A 1HDPA 1QNTA 1SD5A 4NNJA 5LGUA 3A0BC 3AG4H 4HF2A 1MNEA 2PX9A 4ITVA 3K4JA 1LFPA 1B1BA 3HYIA 2X1CA 4R79A 2GA2A 3DP7A 3B6AA 4II3A 4F55A 4KFCA 2X6OA 5IY5H 1OYWA 4R1HA 3K70C 3RQIA 2DK5A 1U9NA 3L2VA 2ZMEA 3LSGA 3OYBA 1H9GA 2FOKA 4YG2F 3ZGKA 1RR8C 2ICWG 3E1SA 3ABKH 2Y2ZA 2VOOA 3PFIA 1OCZH 3M9AA 3CMAI 1T2KA 3EUHC 4W97A 4BS9A 2HKXA 5LHIA 2FQ4A 2VQLA 2LF8A 2QZ8A 1XC5A 1QZYA 2X48A 2AHQA 4DYQA 3FK7A 3DCFA 3GEZA 5ICCA 2VOPA 5HS9A 5FLXZ 3F3XA 3OSGA 3CJTB 3I4PA 4KNYA 2XAHA 3GYHX 3KEQA 5EF6A 3EDPA 3IKVA 1AU7A 2HDWA 2GIVA 2DPUA 3WTWC 3CP2A 1BIAA 4CDGA 1OKRA 4RB3C 3IUOA 2F5EA 2R5ZB 3I59A 1IN8A 2AQEA 2JN6A 1DQUA 1HSJA 2O0YA 4OINF 3TO7A 3HSFA 2Y75A 2TDXA 2XB0X 4MO7A 4XLHA 1IXCA 5AONA 2CWEA 3HKZA 2JA5J 5KVRA 1G3TA 3HEFA 2LR8A 2LVSA 4BNCA 2DMQA 3OIPA 1UZCA 2Y48A 2DCEA 4FASD 1W5TA 4KA4A 3TEDA 2E7WA 4G6QA 2I10A 3W6KB 2VBYA 2DDBA 2VKEA 2D1HA 1LE8A 1ZTRA 1WH7A 2JMWA 5J8FA 2LKPA 3ZMUA 4CH7A 4PGHA 4DYCA 1LEBA 3H9JA 2IGMA 3BPXA 1Z05A 4W1UA 2QCOA 1XGSA 3DLLF 3ZN1A 4A3MJ 1SFXA 1Y0UA 5D4SA 4AYBN 2ELHA 4ZDLA 5EZGA 2LNBA 4KJZA 3CCEI 2X85A 1ZRDA 2FRHA 2IW5A 1V54H 2XGXA 2GAUA 3Q0VA 3S32A 4IHVA 1Z67A 1FIPA 3GW2A 2V6EA 1OFCX 4DGWB 2GXAA 3CQZJ 3GTKJ 2GWRA 1FEXA 4MIMA 2IA0A 3E7LA 3ABMH 3SZPA 3WHCA 4I2OA 3BJOA 4FTHA 2DT5A 2O6GE 1HF0A 2IRFG 3H9QA 1LPQA 2IGKA 1U2WA 3ZMZA 4C3IJ 1JKRC 2P7VB 3K4KA 4HSTA 4GFBA 4LLNA 1NK3P 2VIXA 2CV1A 1KGSA 1XB4A 2WADA 3JRBA 2N8GA 2WWYA 3CF5F 2VN2A 4XNFA 4CCOA 3Q0WA 2GQQA 1ZRCA 5LEKA 5LGTA 2ZMEB 2K9MA 4U0WA 5GAHJ 3LSTA 1YJNI 2FUG2 2RQPA 3BR2A 3ZQFA 2GLOA 2P5VA 2V9KA 4MFDA 2PBIA 2QQBA 1HA8A 1TWFJ 4BQQA 1E3OC 2WAFA 2A69F 2NYXA 5BMZA 4IEJA 5HVQC 2K3PA 2ZXHA 4QTRA 3ZQLA 4ZZDA 4B4CA 5E17F 3HL2A 3WODF 2JJ7A 4UUTA 3N05A 2ZXJA 1JUMA 3I64A 2VPLA 2KZGA 5L3EA 2OCEA 4HNTA 1YTYA 2CGPA 2PQ8A 1SFKA 2P0WA 1T33A 4A3JJ 1W5SA 2W24A 2DOFA 4WK8F 2YU3A 5M5YJ 1ZR2A 2Q2EB 3DEWA 4FT8A 4UY8I 3F8BA 3I59B 2WA0A 4HDVA 1I3AA 1WJDA 3K7AJ 2BE5F 5JI6A 1ERDA 5IT9K 2DMNA 3LAPA 3F8CA 3BG3A 1H9TA 4LG0A 3FIWA 3CESA 2B63J 2L4MA 4L0ZB 3I71A 2Z33A 1WGXA 2V7FA 4MLOA 2PMHA 4Y3OA 2YSRA 1OYYA 1X1DA 3BTIA 4KT6A 2E2IJ 3IRQA 2R7FA 1P7IA 1X3UA 3QU3A 5FKOA 1R6RA 3AG1H 3EUKL 1GUUA 3HC7A 1LE8B 2VI6A 2Z99A 1Y39A 3TO9A 3KP4A 1MMDA 2ZO4A 2G9WA 1XGMA 2ECBA 2PMZA 1R58A 1VF9A 1MH4A 2E5ZA 2R7SA 3E6CC 2FBIA 1XX5A 1FOYA 2W57A 2DMTA 2W48A 3ABLH 1CGPA 1BA5A 4WX9A 1APLC 3HDDA 4AIJA 4OU0A 5IT3A 1FMWA 1ZR4A 2O8KA 3K4LA 1ETKA 4KISA 5GPAA 4MTDA 3CUQA 2NVUB 2R7QA 2UUZA 2ZNYA 2DODA 1IV6A 1UELB 2HDCA 4DYRA 3HTUA 5HLTA 4HLYA 2MBFA 1D0ZA 3PIPF 2Z5UA 5CJ9A 2DA6A 4PCQA 2LY2A 3ZQIA 1WZ2A 1BI2A 4B43A 3GWZA 1R1VA 1X19A 4KITB 3S3NA 4OAYA 1W36D 2AXLA 4L5EA 2A68F 1NHAA 2CYYA 3PUBA 5FB2A 2VC0A 5K5OA 1LDJA 4DIQA 1WJEA 1WJ5A 4OIQF 4KYWA 2EH3A 1MH3A 2E5NA 1FC3A 2MC4A 3HJEA 3KP5A 4HX8A 4ZYEA 2K9NA 3GFMA 2AXTC 2B7EA 3PJRA 2E60A 1U8RA 4L9TA 2CH0A 4HBLA 4A5MA 2BOLA 2HZTA 2P6SA 3UNGC 1KZHA 5JLXA 4PJ0C 3PIOF 2FMYA 3M8JA 3DF8A 3N4MA 1O3SA 3P5JA 4ZYDA 1BI1A 3WU2C 3HHHA 4PGGA 1K6OA 1Z77A 3SQNA 3HOWJ 1O3RA 1ZGAA 3KFWX 3FX3A 1KU3A 5K5QA 3K1MA 4LG0B 1DPRA 1Z21A 2BYVE 4FQGA 2JTVA 2X9DA 2VJ5A 3E6MA 3LA3A 4E7ZA 1SD6A 4I76A 4XRSA 2HEOA 3U2RA 1ETOA 2FJ1A 1O3QA 1UHWA 3KP3A 2WY7Q 1MMNA 1G59A 2CO5A 1TW3A 2XUBA 2EV6A 2AO9A 3FXUA 1JHHA 3OYFA 1OQYA 1J75A 1SVMA 1O7FA 4JX4A 5CQEA 1BR2A 4J19A 4AUXA 1H89C 2ESNA 2FOWA 2L9VA 4HLXA 4RGRA 1LEAA 2L02A 3MVPA 3PNTA 3IAM2 3OOUA 1G2HA 4EMSA 4ZYGA 3FKIJ 3OS2A 3LQRA 3CCUI 2UV1A 1E2XA 2L5QA 2YR2A 1PUEE 5B3SH 4Q4ZF 2D5VA 2ZSIB 1QVUA 1X1CA 3CUQB 2H8RA 2A6EF 2VJIA 3BDDA 2G0EA 2EIKH 5F1RA 2L9NA 5J8CA 1HKQA 2GOMA 1G6NA 4M9SA 4LOCA 4UHTA 1NK2P 4EV0A 2DOEA 2OTLI 4Y52J 2NVXJ 2XV4S 5D5WB 3OYAA 3VOEA 2W82A 1T8IA 1I50J 1QVTA 2QQ9A 3JAMK 2M4GA 1A36A 5IT9Z 1U5TC 3NQOA 3FKJA 1H8AC 1ZRFA 1I1SA 2K40A 3WGGA 3BR5A 3OMYA 1I6HJ 4BQAA 3KPHA 2XAGA 2DA3A 5C44J 1A04A 3BCBA 5CYVA 3K9TA 2W25A 1Y8QB 3S93A 1YFHA 5E79C 4BEHA 3SXYA 2KJCA 3M7GA 4BJ6C 4HQMA 1IXSB 2OTJI 2LKSA 2HZDA 3R4KA 3MKYB 3MMYB 1T08B 4EJVA 1FX7A 2R7XA 1MSEC 5F0HA 3S16J 1D1BA 4H4KC 2MABA 3ZN0A 2J5PA 2MGQA 3MFKA 1R7JA 3H3ZA 3TOAA 3QOPA 3F22A 3RCOA 3KCCA 2JPCA 2W85A 2M5WA 4F92B 2KHMA 1RR7A 1WPKA 5GTHC 3S2DJ 3ZXSA 4EGZA 3HRTA 1ULYA 2CJJA 4JX6A 4BUPA 2UZKA 3LWFA 2I5UA 1TNSA 2WAQN 3H0DA 1J09A 1O57A 2K3FA 1R1UA 3AAFA 4PJJA 1FBQA 2J5OA 1L3LA 1YS6A 3VYSB 2KQRA 3U21A 2R7WA 3D0SA 1D1CA 2R92J 5IYDJ 1J9IA 1OCRH 1SAXA 1GT0C 3J7AY 4FHTA 1M1EB 1JT0A 5DM7F 1PP7U 1W7PD 4M71A 5E8IA 3CCSI 2LD5A 3FM5A 3VWBA 3BR6A 3RZOJ 3P9KA 3JRIA 1AA7A 3OIQA 2M2EA 4LIVA 2YS9A 4U7BA 1R22A 2JT1A 2L54A 3HHGA 1VQ4I 3TL4X 2OCCH 1JKOC 1USTA 4HPQA 1EA3A 1ETVA 4M3FA 3A03A 3ZQGA 3ERED 3H3VK 1IDYA 5LHHA 3EETA 1SD4A 1X3WB 1UB9A 1GVJA 1EJ9A 4XKWA 2R7DA 5LD2C 1YG2A 2LREA 1K61A 1XMKA 2K7LA 3BJAA 4LD5A 2QUFA 4RAFA 3M1EA 1RUOA 3I9V2 3W6JB 1YX5A 1HDDC 3F8MA 2EZLA 5H2FC 5FKNA 1AKHB 1OCCH 1R9TJ 3DV8A 3ONQA 3LSIA 1VQPI 5TGTA 4GGGA 1G3WA 5IYBJ 2VE9A 5HLHA 2DFIA 2O61A 5DUKA 5B5EC 3RDIA 2KPMA 2IA1A 3RYPA 3TKYA 4CCJA 2O5RA 1ZG1A 2R7VA 1VQLI 4IHXA 2O7OA 1QZZA 3GX4X 5ICFA 2BBYA 2WB1N 4JK1X 4G7HF 3TW7A 4XORA 1ON1A 4DQ2A 4BEHB 2TRTA 3MEXA 5DEQA 3A02A 4XIDA 2P7CB 2L3DA 1JKQC 2XRNA 2XPUA 1RZ4A 5J40A 3R6SA 3OYMA 3Q9VA 2PFBA 2PMUA 2EFQA 2F4OB 2ZMEC 1W0TA 4LJZF 3WTTC 5E20A 2DQLA 2YU9J 2CFXA 2DA1A 1RNLA 1KONA 1FY7A 2KP6A 4RM3A 3DTKA 2WAQA 3E5XA 1K4SA 5E3MA 4J01A 1SVOA 3KP7A 2XPWA 3HUGA 4U88A 3BP8A 4C3HJ 2KRFA 3I0TA 2QYOA 4NHJA 2R3SA 3H92A 2Z9OA 4ESFA 3DFGA 3RPQA 1ZARA 1T38A 1QPMA 3OYLA 2ETHA 3E5QA 3O6BB 2DDAA 1MBJA 4FETA 4CA0A 2L01A 4I02A 2RC4A 5L3BA 2HOTA 1Y0NA 1N25A 4U0YA 2BY3A 3GF2A 4RB1A 2WBMA 2CQ7A 4M3BA 5D6FA 3VSLA 1RI7A 1SVLA 3L1PA 1VQ7I 3L7WA 2VL8A 3JAMZ 4IX7A 2COBA 1RPWA 4A0ZA 1W4MA 2Y0SA 1W7PA 4D7MA 1ZHFA 3F72A 2P5KA 1TL8A 3QPTA 4KICA 2RNGA 2CW0F 2KIMA 3BPVA 2RQQA 1KQ9A 2VB6A 2NVQJ 5H6QA 3A4CA 4B44A 5C3EJ 1RESA 4BH9A 2EILH 5F08A 3NWSA 5AIQA 2HGCA 1YITI 5E18F 1JE8A 4XKVA 2BHZA 4E7SA 2HI3A 2KRHA 2HKOA 5HLIA 3F23A 4F7ZA 2VQHA 5DCMA 2R5YA 3CTAA 3DTIA 1JUPA 2NAZA 5LLQA 2QQ8A 3P7NA 2A6HF 4FX4A 3WTSC 3TOBA 1D0YA 1MKMA 3G6EI 3JSOA 3U9GA 1SEUA 1T95A 4CXFA 3S1NJ 4UUSB 1ZG3A 2MFZA 3TGNA 3ZQHA 3QPHA 2RN7A 4IHSA 1N75A 4IXAA 2LP0A 3V42A 1K79A 4HNVA 3VYUB 5TJJA 2VBXA 3KIOA 1WJAA 3HKZN 2QQAA 2LK2A 3RQ4A 1XN7A 3W2AA 2XVCA 4HA8A 1VQ5I 1RKTA 3DEEA 4ESBA 3CCRI 2OV7A 3QQAA 5HNFA 1Y1WJ 5J4VA 4Y7NJ 1TNTA 1LVKA 3E97A 4ENKA 4C30A 1K83J 3V8LA 3A01A 2BVLA 3A1YA 1TW2A 1HXDA 4PUSA 1X4PA 2DLLA 1EH8A 5HDKA 3IWZA 1E17A 2K02A 2MLGA 3CF2A 1YJWI 4V2FA 1FYKA 1N78A 1BI0A 4UXNA 1YW7A 1R1TA 2H6CA 1A35A 2HVSA 1GHCA 3E3VA 2ZXWH 4B48A 4N0BA 3ECHA 1K4TA 3HUGB 4DZJA 1Y6IA 4BDZA 2DMUA 2HS5A 1OCOH 5ICGA 3QODA 1KYWA 2DJIA 2DT7B 1S29A 3Q3SA 3M8EA 4IVNA 1U78A 1FSEA 3NAUA 2ISYA 3SZTA 3T0YA 4AIHA 4XRMA 3SEZA 2M0MA 4YIFA 1TQPA 1HKSA 5IP7J 4I98B 1Q1HA 1U6GA 4A3LJ 5D8LB 3FDYA 4GRIA 1RETA 3LFKA 1OR7A 4RS8A 2LH9A 1XMAA 2RKHA 1W7PB 3EYYA 3R60A 2F4MB 3HIFA 1IW7F 2HXIA 3BC8A 1ZREA 1TLHB 2YPRA 3O3KA 3I58A 2DI3A 1B72A 2Y9YA 2F5DA 2FXAA 3BG7A 2ZBKA 3SZGA 1ZKGA 3K4BA 3ZMSA 5D5VB 1F1ZA 5TRDA 1Z0XA 4CGZA 3GFLA 1WCMJ 2ESHA 4DNCA 4AIDA 5DCMB 2R5YB 2ME6A 2ZKZA 2NXNB 1OMIA 4OIRF 1ZGJA 2HQNA 4BHCA 4XLEA 3JRDA 4M6XA 3B02A 3CMEI 3FK6A 4I0AA 4EJWA 1X3ZB 4HF0A 4JP0A 2FBHA 2M8GX 3K70D 2X1EA 3GLXA 1A5JA 5F0FA 2ZNZA 4O5VA 2DO7A 3CUQC 2YX4A 1D8KA 1I27A 1SMYF 1XTAA 3FMRA 5J1UA 3ZCOA 1Y8RB 1HW5A 1KA8A 2OAZA 4L9NA 3DBLB 1XGNA 3B6CA 1KYZA 2R4GA 1MZBA 3A01B 3AKZA 4M6YA 2H1KA 1WJBA 2Q1ZB 3H5NA 2Z2SB 3MKLA 4KIFA 2CUZA 3K4NA 2PMZN 1JGGA 3PNYA 3ABTA 3RPUD 2DU9A 1GV2A 3KP6A 1WI3A 4FE7A 2CW8A 3K2ZA 2K85A 1TT0A 1R71A 3HXLA 2HFHA 2QEXI 3ECOA 3QPLA 5FFZA 4MNUA 3J80K 3GTJJ 1LNWA 2WV0A 2XC7A 1BI3A 2XGEA 3D5RC 3BR0A 3ROUA 2K4BA 4RDUA 3U1DA 3TP3A 3GTQJ 1X1AA 4M74A 1VQ6I 1FPQA 2R7RA 3MZHA 4I7HA 3HRSA 3SHFA 1NG6A 2Z3YA 5M5XJ 1IUYA 3BROA 2GZWA 4RGSA 2PEXA 3IL2A 2QSFX 1RKWA 3T5XA 5DD8A 2LYCA 4RLQA 2JVGA 1Z1DA 4MHGA 2L7KA 4BXFA 4G6DA 3BTLA 1QZEA 1FTZA 4EJTA 3QYBA 3OL4A 4M72A 1JI8A 4HG2A 2RNJA 3T8TA 2H1LA 4CCKA 1B72B 4BY1J 5E1ZB 3VSKA 3HRUA 2ZB9A 2DYSH 4CZZA 2D2WA 4GYGA 4GXOA 4EATA 4QLCU 1B4AA 5M3MJ 5K7HA 4IOCF 2QSHX 4XN3A 1OISA 3LMMA 5EDNA 2BEOA 2ZFWA 1T6SA 4QIWN 3M3YJ 3OSFA 4DBRA 5DUIA 5IP9J 4LB5A 4IJAA 1PUFA 2G7UA 5IOYA 1OCTC 1B9NA 1J0RA 4XMYA 2FU4A 2CQNA 4YIIA 1UCRA 2WV1A 4AD9A 3HGGA 1EV7A 3OYKA 1VI0A 4PSWA 4PK4A 1LUJB 3AFHA 1R5HA 2VONA 4Y33A 3QU6A 1WI9A 3HOUJ 4BHPA 1PP8F 2VKHA 3O8HA 5EZHA 1BW6A 4M9ZA 4E6KG 4BKXA 2OC6A 1VQNI 3WE2A 4PZJA 4ENJA 4E7HA 5CVRA 3PO2J 2ZSHB 4XRFA 1EH6A 3BTJA 3C2HA 3S3MA 2DA4A 1P9QC 3RPUA 3SFZA 4NC8A 3DU5A 3PNVA 3RTRA 3H0GJ 2EA4A 4EM2A 2EQRA 3WU1B 3ABUA 5FD6A 2F5CA 4QSHA 2DOAA 3CC2I 2BY0A 1GXPA 1IN7A 1KU2A 1U9OA 2VASA 3WE3A 3VODA 3M4OJ 3OYJA 2A05A 5CPRB 3K4CA 2KLOA 4U0VA 3K69A 4E4HA 1IUFA 3BOQA 4N4OB 2DXIA 2Y69H 3E6DA 3F0CA 3JTHA 3MCZA 4BACA 2VLAA 3OYIA 4DZPA 2Y30A 5LEJA 2E1MB 1W5CC 2KJBA 4OMZA 2XF7A 5J1RA 1WRJA 3FISA 2I8DA 1QPIA 5HS8A 1XSDA 5B1BH 4ZYAA 5FO5A 1UMQA 2DJNA 4XSXF 3W2VA 2NVTJ 1UHSA 3OS0A 2AS5F 1ETYA 5JVTA 2HYFA 4JYKA 2HQRA 3CUOA 1D5VA 1MNDA 3CCJI 3MKWB 3CD6I 2A61A 2RDPA 1KQ0A 2ID6A 4HX7A 4F52A 4Q5SF 1FT9A 4EJUA 3OYEA 4S05A 1DGRM 1QU3A 2MH9A 2JRMA 3GFIA 5CLSA 1BOAA 4E7KA 2X4HA 4OIPF 2IBDA 3PL8A 4XKCA 3CDLA 4QPOA 5FRNA 2IP2A 3H36A 4IHYA 3FHNA 3L2UA 2ACJA 3OOPA 2L0KA 4B3XA 1AOYA 3KX2A 2NS8A 5BOXA 3CC4I 5DD4A 2MH2A 4WF2A 3J80Z 5BPIA 4OOIA 3B73A 3T1BA 3FM3A 3FXLA 5JVGF 2DPDA 2JA2A 3RJPA 5JLWA 3L00A 4NC6A 2RREA 4BJTA 2XF5A 1MD0A 4HW0A 4Y13A 4KMFA 4A3IJ 2IS4A 3IC7A 3KZIC 3IH4A 1VZ0A 5JR3A 1YQAA 1IDZA 2DK8A 4RB0A 3TDUC 1PVEA 1STZA 4ENNA 1FJLA 3FBIB 3EPZA 3JSPA 2OF7A 4HV6A 2BZTA 2K86A 3BT9A 1UFMA 1D8JA 4PFPA 2O03A 4KT5C 2DFFA 5J4YA 1TBXA 4M3DA 3S1QJ 2R93J 4HSRA 5E3OA 4HRIA 3J7YJ 3C3WA 2ZJ2A 2EV0A 4P96A 2DTRA 4TV7A 4X0GA 3FXOA 4XKBA 2F48A 2OUMA 5KK1A 3QP5A 3TP0A 4UVAA 4FISA 2VQCA 2L7FP 3CCQI 3S15J 2PG4A 2KISA 3HOZJ 5M5WJ 2XAJA 3NEUA 3BZ6A 1SANA 2V79A 2NS0A 1T98A 2HPMA 4GCVA 1V5EA 3OWTA 1XSXA 2IXSA 3BZKA 1XPXA 1RIOH 1ITYA 1YW9A 4LMYA 2EK5A 1B6AA 4I0BA 1TWCJ 3LL7A 1WSUA 1Z6TA 3A2KA 1BC8C 2JA8J 4I6ZA 3D5LA 3DPUA 4A3KJ 3JTGA 4UV8A 1IC8A 1YE9A 2K9SA 2E1OA 2Y31A 3BQZA 1QA6A 3WTVC 3MZ8A 2VT3A 3G4SI 3ZRGA 1NTCA 3ZMVA 2EPFA 1VFCA 4ZDOA 1YX3A 3N97A 1MNMC 3V7CA 1LQ1A 4CCMA 3WTYC 1IN4A 2JWTA 2GBYA 3FMSA 1ZLKA 3KETA 3IRRA 2HDDA 3KE2A 2H27A 4IRIA 2R7ZJ 1JT6A 2CFOA 2VT2A 3H9GA 3H5AA 2X6XA 1YHQI 2P6TA 1F5TA 1P4WA 1U3EM 5DS9A 2VXZA 2V1DA 2NS7A 2FBKA 5L3DA 4CO8A 2LSOA 4HF1A 1BJAA 4BBSJ 1IRXA 1E3HA 2OA4A 1J5YA 1F36A 2B0LA 1DU6A 3CDIA 2HVRA 2CSOA 1WWXA 2QM3A 1MMGA 3BJ6A 3DBHB 4AC0A 1XMXA 1IN6A 3S2WA 3OYNA 1I1GA 1IN5A 2QF7A 5ILSA 4A3DJ 1ZG5A 1Q1VA 2K27A 4DJAA 4R8HA 3W3CA 2MW8A 1JTXA 3BQYA 4RAYA 1XDSA 2Y0SN 4NUBA 1MBFA 3GTMJ 3L2RA 4IKFA 4HDUA 1K6YA 4E70A 1ZAOA 3M07A 4P55A 2OQGA 4KIBA 2V26A 3K2AA 2FF4A 3HSRA 1D1AA 4LG3A 4WXDA 1IV8A 3ZMTA 1OLTA 2STTA 1U8BA 3S3OA 2CW7A 4CYCA 1DDNA 5KHDA 1W0UA 1P92A 4PJLA 2MLKA 1MSFC 2KIFA 4RBOA 3KYDB 1IXRC 4BU2A 3ZMDA 5CVVA 3GLLA 1T39A 2XB5A 2QBYA 4D5FA 2ZC2A 1R36A 3OYCA 4M73A 5DM6F 1OJLA 2E36A 2PI0A 4AVZA 4YFXF 3MKZA 2STWA 1IRZA 4EGYA 4NBQA 1EKEA 1B9MA 4IHWA 1XSVA 3TW6A 4RLFA 1MBHA 3CP8A 3G1MA 2XSJC 5K7ZA 1YJ9I 1AHDP 4HOBA 1MBGA 2XRLA 2M7AA 2JK3A 2LDUA 3CJRB 2M3AA 3ZOBA 4FX0A 2DA7A 3C18A 3ASNH 4IQJA 2CUFA 2HYGD 5JFRA 1O7LA 4CCNA 2UXXA 3WU0A 4X6AJ 5J1YA 1KU9A 5LFAA 4I09A 2C6YA 5DDGA 2HTSA 4Y15A 1KU7A 1HW2A 2XSDC 4CCLA 2GXBA 2LRDA 2EIJH 1FOXA 3FXJA 2ZJPF 1ZYRF 1P7JA 3JRHA 2OZ6A 1YW8A 2V9PA 1OR7C 1JHFA 4HAMA 3KYLA 2MYSA 1LKXA 4BY7J 4E7LA 2VUMJ 3G73A 2XASA 2IPQX 1YI2I 4IRHA 2XGDA 5C4JJ 4XLCA 2DTZA 3IV5A 5A2QK 2OBPA 3I3LA 4G7ZF 1ENHA 1R4MB 3ML6A 1V4RA 3GTLJ 2O3FA 3VYRB 4UV9A 1TWGJ 2PN6A 3KLOA
chains in the Genus database with same CATH topology
2M87A 3DEUA 4OMYA 1I5ZA 1HKTA 2HR3A 2Y0MA 3FXRA 3VEPA 5LRSA 5FD5A 1ZH5A 1WKMA 3NRVA 3TO6A 5DCFA 3FF5A 4EQQA 4KN7X 2EA2A 3J81K 2QVOA 3K1PA 5DYMA 1JXSA 3PQJA 5H20A 5H6RA 2XKOA 3LA7A 1MJBA 2QBYB 2H6BA 1R00A 3ZQ7A 4Y17A 3ZP5A 4WCGA 1MJAA 4LK1F 2DQRA 4MQ9F 1GXQA 4A6EA 4WWCA 1Z6RA 4O3MA 4ESJA 5BQTA 4HZFA 2OD5A 1ZLJA 1IAWA 4QWQA 2UWMA 1FSHA 1FP2A 2F5FA 2ISZA 3T8RA 4L0YB 2RVCA 3KP2A 1HW1A 4LB6B 2L4AA 1J7KA 1FBSA 3QP6A 1G4DA 4IHTA 4D0PA 5J6XA 1S3JA 2FNAA 1ODDA 2V1UA 3KLNA 3CJNA 3GVAA 5D5UB 4IF4A 2EV5A 1HSTA 4NB5A 5HOOA 1QGPA 3WGIA 1J2XA 1D3YA 1V3FA 3BY6A 1Z91A 2IT0A 5JHUA 2O8XA 3RKWA 2WC2A 3ISPA 3R0JA 3F6VA 4IRGA 4ENMA 2DAOA 2QWWA 3I5UA 5CVUA 1XDUA 2HTJA 1TTYA 2EFNA 3REOA 3CO6C 4MTEA 1T0FA 5HS7A 4CYDA 4G7OF 3ELKA 2NNYA 2EFWA 1TQMA 1F9NA 3P9IA 4HQEA 3MZYA 3F8FA 4S04A 1IF1A 3F8NA 3Q9SA 4XSZF 5EEGA 3TQNA 4B09A 2IJLA 2IVMA 4AVPA 5A2QZ 2XIGA 5BS6A 2Q2EA 3DQVC 4Q48A 2GA1A 3FWEA 4BXUA 2FA5A 1IRFA 4RGUA 3DPTA 4L9VA 4I01A 3QAHA 5HDNA 1VTNC 4ZH4F 5BPDA 3CDHA 2P5LC 2KKOA 2FE3A 1YIOA 2JRTA 4BAYA 1S7OA 2DW4A 1WQ2A 1B59A 2EFOA 1RUNA 3L09A 1ONVA 3H3UA 1SD7A 3EQLF 4G9YA 5E1XA 3I54A 3J81Z 5LHGA 4ASNA 4EJOA 4EVIA 2IA2A 1FBUA 2A07F 1KQ8A 1FP1D 3GXOA 3HSEA 5F6FA 3HTSB 2MD5A 5HDGA 3MAJA 3GO5A 1LB2A 2Q0OA 4BYYA 3E5UA 5D8KB 2EJRA 1REPC 4EM1A 2ZCWA 4UVBA 5CVIA 3HOTA 1FWZA 4XLPF 2OZUA 3GFJA 1CF7A 2YX7A 3FMQA 4JBAA 4WXHA 4UNOA 2G7HA 2EWNA 4KIGA 2D45A 4YFNF 1HBXG 5LBQA 3IKTA 4UVCA 3EUHA 4L18B 4GYIA 1MJ9A 3VFZA 1J59A 1ZN2A 2BV6A 2COMA 3BWGA 3R0AA 3FZVA 3JW4A 1S7AA 3LAJA 2RGVA 3HRMA 1LVAA 4A0YA 2QLZA 3ZPLA 4Q47A 1L0OC 3WTUC 1XCBA 4BHBA 1YO5C 1PDNC 4HYEA 3KZZA 2PLYA 5L3CA 2ADUA 2FMLA 3M8FA 2D1VA 2JPBA 1FLIA 3V8KA 4RGXA 4XLNF 2VBZA 2CG4A 4M9XA 1S8NA 3Q5FA 4WXCA 3EYIA 2K4JA 1BBYA 4CHUA 3K0LA 4O6JA 1ON2A 5D6EA 2XKPA 2VBWA 2HOEA 3MQ0A 1R23A 4KN4X 4KMUX 3FHZA 2KIUA 1JGSA 3L9FA 4A12A 1XD7A 4A5NA 1G3YA 1EH7A 5CVJA 1MDMA 2E1NA 5DV5A 4EM0B 3V7RA 1CF7B 1FZPB 2FQ3A 5K5RA 5D4RA 3IHUA 4IPAA 2F2EA 5AIPA 4CICA 4RB2C 4P9UA 4L9JA 2JZYA 4LK0F 2W84A 3I53A 1K7AA 2A3SA 4Z2YA 4A2UA 1BIBA 4AWXB 1YLFA 2HWVA 4L5JA 4L5IA 1BM9A 3VB2A 3C1DA 5LRRA 3COAC 1DP7P 3FXQA 4HX4A 1QBJA 1R5GA 3LA2A 5ICEA 2LF7A 1USSA 1MGTA 2OU2A 4U7DA 2EFPA 4A0XA 1I6XA 4H0EA 3J7AO 4ETSA 4JQFA 2FSWA 1LDDA 1YS7A 2MC3A 2NRAC 2X0LA 1YYVA 2JSCA 5FFXA 4G94A 3GUDA 2M30A 1BN5A 4MEXF 1MDMB 1XGOA 5ED4A 5FGMA 1F4KA 1K78A 2M8EA 4ZZLA 2E1CA 4KUMA 5ERIA 1FOKA 4K2EA 4MGRA 4P5OA 2WTEA 3IWFA 1C0WA 4NQWA 2VODA 2P4WA 3KEOA 4PDKA 3E6BA 3WGHA 1SFEA 2M1BA 2BGCA 2H09A 2RV8A 3PQKA 3GZ5A 4N9IA 2MA3A 2CQKA 3CO7C 2XAQA 5EEHA 4LFUA 1P4AA 2DBBA 1P4XA 3RI4A 4MQVA 3TDZC 4A6DA 2A5YB 2XROA 1Z7UA 1FNNA 1P6RA 3DKWA 3RIRA 2NNNA 3CLOA 1H0MA 1Z9CA 2GXGA 4RAZA 1QO0D 3WTXC 4N9HA 3DPLC 1S6LA 3V8JA 2V9VA 1XCVA 1TQIA 5LGNA 4XBFA 2EB7A 3F6OA 1IRGA 2V1XA 3DXJF 4MEYF 3K1NA 5FLXK 3GZ6A 5E8GA 3WTZA 1P2FA 4GO1A 4LGWA 2VE8A 3V7SA 2QENA 5F64A 1FYLA 1U5TA 1K78B 3WG9A 4YFKF 3O2PE 1AWCA 2XAFA 1DPUA 5K1YA 5L3GA 2FEZA 2H94A 2PJPA 3F21A 5D5XB 3HOSA 1OYIA 1O3TA 1DUXC 4AIKA 5ILVA 2V6CA 1QQIA 4UUVA 3C7JA 2OQRA 3P9CA 5E1WA 4KDPA 5L3FA 2FNPA 3RYRA 4LLGF 4B8XA 4OIOF 1SMTA 3OV8A 4HV5A 1SFUA 3LQQA 3G3ZA 1HQCA 3RKXA 2UXNA 2Q8KA 3V4GA 5HLGA 3KZYA 2XHKA 3RKYA 4LLLA 1UHMA 2M45A 3MWMA 4ON0A 3ULQB 4P9FA 1LDKB 1G3SA 1BC7C 4ZYHA 1FYMA 6PAXA 5ILUA 2E7XA 3QRFF 1OPCA 3L2CA 3R61A 2P8TA 1LJ9A 2VC1A 1U5TB 4G8XA 1IZ1A 1QNTA 1SD5A 5LGUA 4HF2A 1B1BA 3HYIA 4R79A 2GA2A 3DP7A 4KFCA 1OYWA 4R1HA 2DK5A 2ZMEA 1H9GA 2FOKA 4YG2F 2VOOA 3PFIA 3M9AA 1T2KA 5LHIA 2HKXA 2LF8A 2QZ8A 1QZYA 3GEZA 5ICCA 2VOPA 5HS9A 5FLXZ 3F3XA 3I4PA 4KNYA 2XAHA 3GYHX 3KEQA 3EDPA 3IKVA 2GIVA 2DPUA 3WTWC 1BIAA 4CDGA 1OKRA 4RB3C 2F5EA 3I59A 1IN8A 1HSJA 2O0YA 4OINF 3TO7A 3HSFA 2Y75A 2TDXA 1IXCA 5AONA 2CWEA 5KVRA 1G3TA 4BNCA 2Y48A 1W5TA 4KA4A 2E7WA 4G6QA 3W6KB 2VBYA 2D1HA 5J8FA 2LKPA 3ZMUA 4PGHA 1LEBA 3BPXA 1Z05A 1XGSA 3ZN1A 1SFXA 1Y0UA 5D4SA 2ELHA 2LNBA 1ZRDA 2FRHA 2IW5A 2XGXA 2GAUA 3GW2A 2GWRA 2IA0A 3SZPA 4I2OA 3BJOA 2DT5A 2O6GE 2IRFG 1U2WA 3ZMZA 2P7VB 4LLNA 1KGSA 1XB4A 2WWYA 2VN2A 2GQQA 1ZRCA 5LEKA 5LGTA 2ZMEB 4U0WA 3LSTA 2RQPA 2P5VA 2PBIA 2QQBA 2A69F 2NYXA 5BMZA 5HVQC 4ZZDA 5E17F 3WODF 2ZXJA 3I64A 5L3EA 1YTYA 2CGPA 2PQ8A 1W5SA 2W24A 4WK8F 2YU3A 4FT8A 3F8BA 3I59B 4HDVA 5JI6A 2BE5F 5IT9K 3LAPA 3F8CA 1H9TA 4LG0A 2L4MA 4L0ZB 3I71A 2Z33A 2PMHA 2YSRA 1OYYA 3IRQA 2R7FA 1X3UA 3QU3A 2Z99A 3TO9A 3KP4A 2ZO4A 2G9WA 1XGMA 1R58A 3E6CC 2FBIA 2W57A 1CGPA 4WX9A 4AIJA 4OU0A 5IT3A 4MTDA 3CUQA 2ZNYA 2HDCA 3HTUA 4HLYA 2MBFA 2Z5UA 5CJ9A 4PCQA 1BI2A 3GWZA 1R1VA 2AXLA 2A68F 1NHAA 2CYYA 5FB2A 2VC0A 5K5OA 1LDJA 4OIQF 4KYWA 4HX8A 1FC3A 3KP5A 4ZYEA 3GFMA 1U8RA 4L9TA 4HBLA 4A5MA 2HZTA 2P6SA 2FMYA 3DF8A 3N4MA 1O3SA 4ZYDA 1BI1A 3HHHA 4PGGA 1K6OA 3SQNA 1O3RA 1ZGAA 3KFWX 3FX3A 1KU3A 5K5QA 3K1MA 4LG0B 1DPRA 2BYVE 2JTVA 3E6MA 3LA3A 1SD6A 2HEOA 3U2RA 1O3QA 1UHWA 3KP3A 2CO5A 1TW3A 2XUBA 2EV6A 3FXUA 1JHHA 1J75A 1O7FA 2ESNA 4HLXA 4RGRA 1LEAA 2L02A 4EMSA 4ZYGA 3LQRA 1E2XA 2YR2A 1PUEE 4Q4ZF 3CUQB 2A6EF 3BDDA 5F1RA 5J8CA 1HKQA 1G6NA 4M9SA 4UHTA 4EV0A 2XV4S 5D5WB 3VOEA 2QQ9A 3JAMK 5IT9Z 1U5TC 3NQOA 1ZRFA 1I1SA 3WGGA 4BQAA 2XAGA 1A04A 5CYVA 3K9TA 2W25A 1YFHA 3SXYA 2KJCA 3M7GA 4HQMA 1IXSB 3R4KA 4EJVA 1FX7A 3ZN0A 2J5PA 3MFKA 1R7JA 3H3ZA 3TOAA 3QOPA 3F22A 3KCCA 2JPCA 2W85A 2M5WA 4EGZA 3HRTA 1ULYA 2UZKA 3LWFA 1TNSA 1O57A 1R1UA 3AAFA 1FBQA 2J5OA 1L3LA 1YS6A 3D0SA 1J9IA 1SAXA 4FHTA 1PP7U 1W7PD 4M71A 5E8IA 3FM5A 3P9KA 4U7BA 1R22A 2JT1A 2L54A 3HHGA 1USTA 3ERED 5LHHA 3EETA 1SD4A 1UB9A 1GVJA 2R7DA 1YG2A 1XMKA 2K7LA 3BJAA 4LD5A 2QUFA 3M1EA 1RUOA 3W6JB 3F8MA 3DV8A 4GGGA 1G3WA 2VE9A 5HLHA 2DFIA 2O61A 5DUKA 3RDIA 2IA1A 3RYPA 3TKYA 1ZG1A 1QZZA 3GX4X 5ICFA 2BBYA 4JK1X 4G7HF 4DQ2A 1ON1A 5DEQA 3MEXA 2P7CB 2L3DA 2XRNA 1RZ4A 3R6SA 3Q9VA 2PFBA 2PMUA 2EFQA 4LJZF 3WTTC 5E20A 2DQLA 2CFXA 1RNLA 1FY7A 3E5XA 3KP7A 3HUGA 4U88A 3BP8A 2KRFA 3I0TA 2QYOA 4NHJA 2R3SA 3H92A 2Z9OA 4ESFA 3DFGA 3RPQA 1ZARA 1T38A 1QPMA 2ETHA 3E5QA 3O6BB 2L01A 4I02A 2RC4A 5L3BA 4U0YA 3GF2A 4RB1A 5D6FA 1RI7A 3L7WA 3JAMZ 4A0ZA 1W4MA 1W7PA 1ZHFA 3F72A 2P5KA 3QPTA 4KICA 2CW0F 2KIMA 3BPVA 1KQ9A 5H6QA 4BH9A 5AIQA 2HGCA 5E18F 1JE8A 5HLIA 2HKOA 3F23A 4F7ZA 5DCMA 3CTAA 2NAZA 5LLQA 3P7NA 2A6HF 4FX4A 3WTSC 3TOBA 1MKMA 3JSOA 3U9GA 4CXFA 1ZG3A 3TGNA 3QPHA 2RN7A 4IHSA 4IXAA 1K79A 5TJJA 2VBXA 2QQAA 1XN7A 2XVCA 4HA8A 4ESBA 1TNTA 3E97A 4ENKA 3V8LA 1TW2A 1HXDA 2DLLA 1EH8A 5HDKA 3IWZA 1E17A 2K02A 2MLGA 1FYKA 1BI0A 4UXNA 1YW7A 1R1TA 2H6CA 1GHCA 3E3VA 4N0BA 3ECHA 2HS5A 5ICGA 1KYWA 1S29A 3M8EA 4IVNA 1U78A 1FSEA 2ISYA 3SZTA 3T0YA 4AIHA 4YIFA 1TQPA 1HKSA 4I98B 1Q1HA 1U6GA 5D8LB 3LFKA 1OR7A 4RS8A 1XMAA 2RKHA 1W7PB 3EYYA 3R60A 3HIFA 1IW7F 1ZREA 1TLHB 2YPRA 3O3KA 3I58A 2DI3A 2F5DA 2FXAA 2ZBKA 5D5VB 3ZMSA 1F1ZA 5TRDA 4CGZA 3GFLA 2ESHA 4DNCA 5DCMB 2ZKZA 1OMIA 4OIRF 1ZGJA 2HQNA 4BHCA 4M6XA 3B02A 4I0AA 4EJWA 4HF0A 2FBHA 3GLXA 2ZNZA 4O5VA 2DO7A 3CUQC 2YX4A 1D8KA 1I27A 1SMYF 3FMRA 1HW5A 1KA8A 2OAZA 4L9NA 1XGNA 1KYZA 1MZBA 4M6YA 4KIFA 3ABTA 2DU9A 3KP6A 3K2ZA 2HFHA 3ECOA 5FFZA 4MNUA 3J80K 1LNWA 2WV0A 1BI3A 3ROUA 2K4BA 3U1DA 4M74A 1FPQA 3MZHA 4I7HA 3HRSA 3SHFA 2Z3YA 1IUYA 3BROA 2GZWA 4RGSA 2PEXA 3IL2A 3T5XA 5DD8A 1Z1DA 4MHGA 4G6DA 4EJTA 4M72A 2RNJA 3T8TA 5E1ZB 3HRUA 4CZZA 2D2WA 4GYGA 4GXOA 4QLCU 1B4AA 2BEOA 2ZFWA 1T6SA 5DUIA 4LB5A 4IJAA 2G7UA 1B9NA 1J0RA 2FU4A 4YIIA 1UCRA 4AD9A 1EV7A 1R5HA 2VONA 3QU6A 1WI9A 4BHPA 1PP8F 4M9ZA 3WE2A 4PZJA 4ENJA 5CVRA 4XRFA 1EH6A 3RPUA 3SFZA 3RTRA 2EA4A 4EM2A 3WU1B 3ABUA 5FD6A 2F5CA 1GXPA 1IN7A 1KU2A 3WE3A 3VODA 4U0VA 3K69A 3BOQA 3E6DA 3MCZA 3JTHA 5LEJA 2KJBA 4OMZA 1WRJA 5HS8A 1XSDA 5FO5A 4XSXF 2AS5F 5JVTA 2HYFA 2HQRA 3CUOA 1D5VA 2A61A 2RDPA 1KQ0A 4HX7A 4Q5SF 1FT9A 4EJUA 4S05A 2MH9A 3GFIA 5CLSA 1BOAA 2X4HA 4OIPF 2IP2A 2ACJA 1AOYA 3OOPA 5BOXA 5DD4A 2MH2A 4WF2A 3J80Z 5BPIA 4OOIA 3B73A 3T1BA 3FM3A 2DPDA 3RJPA 3L00A 1MD0A 4HW0A 4Y13A 4KMFA 3IC7A 5JR3A 1YQAA 2DK8A 4RB0A 3TDUC 4ENNA 1STZA 3JSPA 4HV6A 2K86A 1UFMA 1D8JA 2O03A 4KT5C 1TBXA 3C3WA 2ZJ2A 2EV0A 4P96A 2DTRA 4TV7A 5KK1A 3QP5A 4UVAA 2PG4A 2XAJA 3NEUA 3BZ6A 2V79A 2NS0A 1T98A 4GCVA 1XSXA 1RIOH 1YW9A 4LMYA 2EK5A 1B6AA 4I0BA 1WSUA 1Z6TA 1BC8C 3D5LA 3JTGA 4UV8A 3WTVC 2VT3A 3ZMVA 3N97A 3V7CA 1LQ1A 3WTYC 1IN4A 3FMSA 1ZLKA 3KETA 3IRRA 3KE2A 2H27A 4IRIA 2VT2A 2P6TA 1F5TA 1P4WA 1U3EM 2VXZA 2V1DA 2FBKA 5L3DA 4CO8A 2LSOA 4HF1A 1BJAA 1J5YA 2OA4A 2B0LA 2CSOA 1WWXA 2QM3A 3BJ6A 1IN6A 3S2WA 1I1GA 1IN5A 5ILSA 1ZG5A 2K27A 4R8HA 4RAYA 1XDSA 4HDUA 4E70A 1ZAOA 4P55A 2OQGA 4KIBA 2FF4A 3HSRA 4WXDA 3ZMTA 2STTA 1DDNA 1P92A 2MLKA 2KIFA 1IXRC 3ZMDA 5CVVA 1T39A 2QBYA 1R36A 4M73A 2PI0A 4YFXF 2STWA 4EGYA 1B9MA 1XSVA 4HOBA 2LDUA 4FX0A 3C18A 2HYGD 5JFRA 1O7LA 2UXXA 3WU0A 1KU9A 4I09A 2C6YA 5DDGA 2HTSA 4Y15A 1KU7A 1HW2A 2GXBA 1ZYRF 2OZ6A 1YW8A 1JHFA 4HAMA 3G73A 2XASA 2IPQX 4IRHA 5A2QK 2OBPA 4G7ZF 3ML6A 1V4RA 2O3FA 4UV9A 2PN6A 3KLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M87 A;  3DEU A;  4OMY A;  1I5Z A;  1HKT A;  2HR3 A;  2Y0M A;  3FXR A;  3VEP A;  5LRS A;  5FD5 A;  1ZH5 A;  1WKM A;  3NRV A;  3TO6 A;  5DCF A;  3FF5 A;  4EQQ A;  4KN7 X;  2EA2 A;  3J81 K;  2QVO A;  3K1P A;  5DYM A;  1JXS A;  3PQJ A;  5H20 A;  5H6R A;  2XKO A;  3LA7 A;  1MJB A;  2QBY B;  2H6B A;  1R00 A;  3ZQ7 A;  4Y17 A;  3ZP5 A;  4WCG A;  1MJA A;  4LK1 F;  2DQR A;  4MQ9 F;  1GXQ A;  4A6E A;  4WWC A;  1Z6R A;  4O3M A;  4ESJ A;  5BQT A;  4HZF A;  2OD5 A;  1ZLJ A;  1IAW A;  4QWQ A;  2UWM A;  1FSH A;  1FP2 A;  2F5F A;  2ISZ A;  3T8R A;  4L0Y B;  2RVC A;  3KP2 A;  1HW1 A;  4LB6 B;  2L4A A;  1J7K A;  1FBS A;  3QP6 A;  1G4D A;  4IHT A;  4D0P A;  5J6X A;  1S3J A;  2FNA A;  1ODD A;  2V1U A;  3KLN A;  3CJN A;  3GVA A;  5D5U B;  4IF4 A;  2EV5 A;  1HST A;  4NB5 A;  5HOO A;  1QGP A;  3WGI A;  1J2X A;  1D3Y A;  1V3F A;  3BY6 A;  1Z91 A;  2IT0 A;  5JHU A;  2O8X A;  3RKW A;  2WC2 A;  3ISP A;  3R0J A;  3F6V A;  4IRG A;  4ENM A;  2DAO A;  2QWW A;  3I5U A;  5CVU A;  1XDU A;  2HTJ A;  1TTY A;  2EFN A;  3REO A;  3CO6 C;  4MTE A;  1T0F A;  5HS7 A;  4CYD A;  4G7O F;  3ELK A;  2NNY A;  2EFW A;  1TQM A;  1F9N A;  3P9I A;  4HQE A;  3MZY A;  3F8F A;  4S04 A;  1IF1 A;  3F8N A;  3Q9S A;  4XSZ F;  5EEG A;  3TQN A;  4B09 A;  2IJL A;  2IVM A;  4AVP A;  5A2Q Z;  2XIG A;  5BS6 A;  2Q2E A;  3DQV C;  4Q48 A;  2GA1 A;  3FWE A;  4BXU A;  2FA5 A;  1IRF A;  4RGU A;  3DPT A;  4L9V A;  4I01 A;  3QAH A;  5HDN A;  1VTN C;  4ZH4 F;  5BPD A;  3CDH A;  2P5L C;  2KKO A;  2FE3 A;  1YIO A;  2JRT A;  4BAY A;  1S7O A;  2DW4 A;  1WQ2 A;  1B59 A;  2EFO A;  1RUN A;  3L09 A;  1ONV A;  3H3U A;  1SD7 A;  3EQL F;  4G9Y A;  5E1X A;  3I54 A;  3J81 Z;  5LHG A;  4ASN A;  4EJO A;  4EVI A;  2IA2 A;  1FBU A;  2A07 F;  1KQ8 A;  1FP1 D;  3GXO A;  3HSE A;  5F6F A;  3HTS B;  2MD5 A;  5HDG A;  3MAJ A;  3GO5 A;  1LB2 A;  2Q0O A;  4BYY A;  3E5U A;  5D8K B;  2EJR A;  1REP C;  4EM1 A;  2ZCW A;  4UVB A;  5CVI A;  3HOT A;  1FWZ A;  4XLP F;  2OZU A;  3GFJ A;  1CF7 A;  2YX7 A;  3FMQ A;  4JBA A;  4WXH A;  4UNO A;  2G7H A;  2EWN A;  4KIG A;  2D45 A;  4YFN F;  1HBX G;  5LBQ A;  3IKT A;  4UVC A;  3EUH A;  4L18 B;  4GYI A;  1MJ9 A;  3VFZ A;  1J59 A;  1ZN2 A;  2BV6 A;  2COM A;  3BWG A;  3R0A A;  3FZV A;  3JW4 A;  1S7A A;  3LAJ A;  2RGV A;  3HRM A;  1LVA A;  4A0Y A;  2QLZ A;  3ZPL A;  4Q47 A;  1L0O C;  3WTU C;  1XCB A;  4BHB A;  1YO5 C;  1PDN C;  4HYE A;  3KZZ A;  2PLY A;  5L3C A;  2ADU A;  2FML A;  3M8F A;  2D1V A;  2JPB A;  1FLI A;  3V8K A;  4RGX A;  4XLN F;  2VBZ A;  2CG4 A;  4M9X A;  1S8N A;  3Q5F A;  4WXC A;  3EYI A;  2K4J A;  1BBY A;  4CHU A;  3K0L A;  4O6J A;  1ON2 A;  5D6E A;  2XKP A;  2VBW A;  2HOE A;  3MQ0 A;  1R23 A;  4KN4 X;  4KMU X;  3FHZ A;  2KIU A;  1JGS A;  3L9F A;  4A12 A;  1XD7 A;  4A5N A;  1G3Y A;  1EH7 A;  5CVJ A;  1MDM A;  2E1N A;  5DV5 A;  4EM0 B;  3V7R A;  1CF7 B;  1FZP B;  2FQ3 A;  5K5R A;  5D4R A;  3IHU A;  4IPA A;  2F2E A;  5AIP A;  4CIC A;  4RB2 C;  4P9U A;  4L9J A;  2JZY A;  4LK0 F;  2W84 A;  3I53 A;  1K7A A;  2A3S A;  4Z2Y A;  4A2U A;  1BIB A;  4AWX B;  1YLF A;  2HWV A;  4L5J A;  4L5I A;  1BM9 A;  3VB2 A;  3C1D A;  5LRR A;  3COA C;  1DP7 P;  3FXQ A;  4HX4 A;  1QBJ A;  1R5G A;  3LA2 A;  5ICE A;  2LF7 A;  1USS A;  1MGT A;  2OU2 A;  4U7D A;  2EFP A;  4A0X A;  1I6X A;  4H0E A;  3J7A O;  4ETS A;  4JQF A;  2FSW A;  1LDD A;  1YS7 A;  2MC3 A;  2NRA C;  2X0L A;  1YYV A;  2JSC A;  5FFX A;  4G94 A;  3GUD A;  2M30 A;  1BN5 A;  4MEX F;  1MDM B;  1XGO A;  5ED4 A;  5FGM A;  1F4K A;  1K78 A;  2M8E A;  4ZZL A;  2E1C A;  4KUM A;  5ERI A;  1FOK A;  4K2E A;  4MGR A;  4P5O A;  2WTE A;  3IWF A;  1C0W A;  4NQW A;  2VOD A;  2P4W A;  3KEO A;  4PDK A;  3E6B A;  3WGH A;  1SFE A;  2M1B A;  2BGC A;  2H09 A;  2RV8 A;  3PQK A;  3GZ5 A;  4N9I A;  2MA3 A;  2CQK A;  3CO7 C;  2XAQ A;  5EEH A;  4LFU A;  1P4A A;  2DBB A;  1P4X A;  3RI4 A;  4MQV A;  3TDZ C;  4A6D A;  2A5Y B;  2XRO A;  1Z7U A;  1FNN A;  1P6R A;  3DKW A;  3RIR A;  2NNN A;  3CLO A;  1H0M A;  1Z9C A;  2GXG A;  4RAZ A;  1QO0 D;  3WTX C;  4N9H A;  3DPL C;  1S6L A;  3V8J A;  2V9V A;  1XCV A;  1TQI A;  5LGN A;  4XBF A;  2EB7 A;  3F6O A;  1IRG A;  2V1X A;  3DXJ F;  4MEY F;  3K1N A;  5FLX K;  3GZ6 A;  5E8G A;  3WTZ A;  1P2F A;  4GO1 A;  4LGW A;  2VE8 A;  3V7S A;  2QEN A;  5F64 A;  1FYL A;  1U5T A;  1K78 B;  3WG9 A;  4YFK F;  3O2P E;  1AWC A;  2XAF A;  1DPU A;  5K1Y A;  5L3G A;  2FEZ A;  2H94 A;  2PJP A;  3F21 A;  5D5X B;  3HOS A;  1OYI A;  1O3T A;  1DUX C;  4AIK A;  5ILV A;  2V6C A;  1QQI A;  4UUV A;  3C7J A;  2OQR A;  3P9C A;  5E1W A;  4KDP A;  5L3F A;  2FNP A;  3RYR A;  4LLG F;  4B8X A;  4OIO F;  1SMT A;  3OV8 A;  4HV5 A;  1SFU A;  3LQQ A;  3G3Z A;  1HQC A;  3RKX A;  2UXN A;  2Q8K A;  3V4G A;  5HLG A;  3KZY A;  2XHK A;  3RKY A;  4LLL A;  1UHM A;  2M45 A;  3MWM A;  4ON0 A;  3ULQ B;  4P9F A;  1LDK B;  1G3S A;  1BC7 C;  4ZYH A;  1FYM A;  6PAX A;  5ILU A;  2E7X A;  3QRF F;  1OPC A;  3L2C A;  3R61 A;  2P8T A;  1LJ9 A;  2VC1 A;  1U5T B;  4G8X A;  1IZ1 A;  1QNT A;  1SD5 A;  5LGU A;  4HF2 A;  1B1B A;  3HYI A;  4R79 A;  2GA2 A;  3DP7 A;  4KFC A;  1OYW A;  4R1H A;  2DK5 A;  2ZME A;  1H9G A;  2FOK A;  4YG2 F;  2VOO A;  3PFI A;  3M9A A;  1T2K A;  5LHI A;  2HKX A;  2LF8 A;  2QZ8 A;  1QZY A;  3GEZ A;  5ICC A;  2VOP A;  5HS9 A;  5FLX Z;  3F3X A;  3I4P A;  4KNY A;  2XAH A;  3GYH X;  3KEQ A;  3EDP A;  3IKV A;  2GIV A;  2DPU A;  3WTW C;  1BIA A;  4CDG A;  1OKR A;  4RB3 C;  2F5E A;  3I59 A;  1IN8 A;  1HSJ A;  2O0Y A;  4OIN F;  3TO7 A;  3HSF A;  2Y75 A;  2TDX A;  1IXC A;  5AON A;  2CWE A;  5KVR A;  1G3T A;  4BNC A;  2Y48 A;  1W5T A;  4KA4 A;  2E7W A;  4G6Q A;  3W6K B;  2VBY A;  2D1H A;  5J8F A;  2LKP A;  3ZMU A;  4PGH A;  1LEB A;  3BPX A;  1Z05 A;  1XGS A;  3ZN1 A;  1SFX A;  1Y0U A;  5D4S A;  2ELH A;  2LNB A;  1ZRD A;  2FRH A;  2IW5 A;  2XGX A;  2GAU A;  3GW2 A;  2GWR A;  2IA0 A;  3SZP A;  4I2O A;  3BJO A;  2DT5 A;  2O6G E;  2IRF G;  1U2W A;  3ZMZ A;  2P7V B;  4LLN A;  1KGS A;  1XB4 A;  2WWY A;  2VN2 A;  2GQQ A;  1ZRC A;  5LEK A;  5LGT A;  2ZME B;  4U0W A;  3LST A;  2RQP A;  2P5V A;  2PBI A;  2QQB A;  2A69 F;  2NYX A;  5BMZ A;  5HVQ C;  4ZZD A;  5E17 F;  3WOD F;  2ZXJ A;  3I64 A;  5L3E A;  1YTY A;  2CGP A;  2PQ8 A;  1W5S A;  2W24 A;  4WK8 F;  2YU3 A;  4FT8 A;  3F8B A;  3I59 B;  4HDV A;  5JI6 A;  2BE5 F;  5IT9 K;  3LAP A;  3F8C A;  1H9T A;  4LG0 A;  2L4M A;  4L0Z B;  3I71 A;  2Z33 A;  2PMH A;  2YSR A;  1OYY A;  3IRQ A;  2R7F A;  1X3U A;  3QU3 A;  2Z99 A;  3TO9 A;  3KP4 A;  2ZO4 A;  2G9W A;  1XGM A;  1R58 A;  3E6C C;  2FBI A;  2W57 A;  1CGP A;  4WX9 A;  4AIJ A;  4OU0 A;  5IT3 A;  4MTD A;  3CUQ A;  2ZNY A;  2HDC A;  3HTU A;  4HLY A;  2MBF A;  2Z5U A;  5CJ9 A;  4PCQ A;  1BI2 A;  3GWZ A;  1R1V A;  2AXL A;  2A68 F;  1NHA A;  2CYY A;  5FB2 A;  2VC0 A;  5K5O A;  1LDJ A;  4OIQ F;  4KYW A;  4HX8 A;  1FC3 A;  3KP5 A;  4ZYE A;  3GFM A;  1U8R A;  4L9T A;  4HBL A;  4A5M A;  2HZT A;  2P6S A;  2FMY A;  3DF8 A;  3N4M A;  1O3S A;  4ZYD A;  1BI1 A;  3HHH A;  4PGG A;  1K6O A;  3SQN A;  1O3R A;  1ZGA A;  3KFW X;  3FX3 A;  1KU3 A;  5K5Q A;  3K1M A;  4LG0 B;  1DPR A;  2BYV E;  2JTV A;  3E6M A;  3LA3 A;  1SD6 A;  2HEO A;  3U2R A;  1O3Q A;  1UHW A;  3KP3 A;  2CO5 A;  1TW3 A;  2XUB A;  2EV6 A;  3FXU A;  1JHH A;  1J75 A;  1O7F A;  2ESN A;  4HLX A;  4RGR A;  1LEA A;  2L02 A;  4EMS A;  4ZYG A;  3LQR A;  1E2X A;  2YR2 A;  1PUE E;  4Q4Z F;  3CUQ B;  2A6E F;  3BDD A;  5F1R A;  5J8C A;  1HKQ A;  1G6N A;  4M9S A;  4UHT A;  4EV0 A;  2XV4 S;  5D5W B;  3VOE A;  2QQ9 A;  3JAM K;  5IT9 Z;  1U5T C;  3NQO A;  1ZRF A;  1I1S A;  3WGG A;  4BQA A;  2XAG A;  1A04 A;  5CYV A;  3K9T A;  2W25 A;  1YFH A;  3SXY A;  2KJC A;  3M7G A;  4HQM A;  1IXS B;  3R4K A;  4EJV A;  1FX7 A;  3ZN0 A;  2J5P A;  3MFK A;  1R7J A;  3H3Z A;  3TOA A;  3QOP A;  3F22 A;  3KCC A;  2JPC A;  2W85 A;  2M5W A;  4EGZ A;  3HRT A;  1ULY A;  2UZK A;  3LWF A;  1TNS A;  1O57 A;  1R1U A;  3AAF A;  1FBQ A;  2J5O A;  1L3L A;  1YS6 A;  3D0S A;  1J9I A;  1SAX A;  4FHT A;  1PP7 U;  1W7P D;  4M71 A;  5E8I A;  3FM5 A;  3P9K A;  4U7B A;  1R22 A;  2JT1 A;  2L54 A;  3HHG A;  1UST A;  3ERE D;  5LHH A;  3EET A;  1SD4 A;  1UB9 A;  1GVJ A;  2R7D A;  1YG2 A;  1XMK A;  2K7L A;  3BJA A;  4LD5 A;  2QUF A;  3M1E A;  1RUO A;  3W6J B;  3F8M A;  3DV8 A;  4GGG A;  1G3W A;  2VE9 A;  5HLH A;  2DFI A;  2O61 A;  5DUK A;  3RDI A;  2IA1 A;  3RYP A;  3TKY A;  1ZG1 A;  1QZZ A;  3GX4 X;  5ICF A;  2BBY A;  4JK1 X;  4G7H F;  4DQ2 A;  1ON1 A;  5DEQ A;  3MEX A;  2P7C B;  2L3D A;  2XRN A;  1RZ4 A;  3R6S A;  3Q9V A;  2PFB A;  2PMU A;  2EFQ A;  4LJZ F;  3WTT C;  5E20 A;  2DQL A;  2CFX A;  1RNL A;  1FY7 A;  3E5X A;  3KP7 A;  3HUG A;  4U88 A;  3BP8 A;  2KRF A;  3I0T A;  2QYO A;  4NHJ A;  2R3S A;  3H92 A;  2Z9O A;  4ESF A;  3DFG A;  3RPQ A;  1ZAR A;  1T38 A;  1QPM A;  2ETH A;  3E5Q A;  3O6B B;  2L01 A;  4I02 A;  2RC4 A;  5L3B A;  4U0Y A;  3GF2 A;  4RB1 A;  5D6F A;  1RI7 A;  3L7W A;  3JAM Z;  4A0Z A;  1W4M A;  1W7P A;  1ZHF A;  3F72 A;  2P5K A;  3QPT A;  4KIC A;  2CW0 F;  2KIM A;  3BPV A;  1KQ9 A;  5H6Q A;  4BH9 A;  5AIQ A;  2HGC A;  5E18 F;  1JE8 A;  5HLI A;  2HKO A;  3F23 A;  4F7Z A;  5DCM A;  3CTA A;  2NAZ A;  5LLQ A;  3P7N A;  2A6H F;  4FX4 A;  3WTS C;  3TOB A;  1MKM A;  3JSO A;  3U9G A;  4CXF A;  1ZG3 A;  3TGN A;  3QPH A;  2RN7 A;  4IHS A;  4IXA A;  1K79 A;  5TJJ A;  2VBX A;  2QQA A;  1XN7 A;  2XVC A;  4HA8 A;  4ESB A;  1TNT A;  3E97 A;  4ENK A;  3V8L A;  1TW2 A;  1HXD A;  2DLL A;  1EH8 A;  5HDK A;  3IWZ A;  1E17 A;  2K02 A;  2MLG A;  1FYK A;  1BI0 A;  4UXN A;  1YW7 A;  1R1T A;  2H6C A;  1GHC A;  3E3V A;  4N0B A;  3ECH A;  2HS5 A;  5ICG A;  1KYW A;  1S29 A;  3M8E A;  4IVN A;  1U78 A;  1FSE A;  2ISY A;  3SZT A;  3T0Y A;  4AIH A;  4YIF A;  1TQP A;  1HKS A;  4I98 B;  1Q1H A;  1U6G A;  5D8L B;  3LFK A;  1OR7 A;  4RS8 A;  1XMA A;  2RKH A;  1W7P B;  3EYY A;  3R60 A;  3HIF A;  1IW7 F;  1ZRE A;  1TLH B;  2YPR A;  3O3K A;  3I58 A;  2DI3 A;  2F5D A;  2FXA A;  2ZBK A;  5D5V B;  3ZMS A;  1F1Z A;  5TRD A;  4CGZ A;  3GFL A;  2ESH A;  4DNC A;  5DCM B;  2ZKZ A;  1OMI A;  4OIR F;  1ZGJ A;  2HQN A;  4BHC A;  4M6X A;  3B02 A;  4I0A A;  4EJW A;  4HF0 A;  2FBH A;  3GLX A;  2ZNZ A;  4O5V A;  2DO7 A;  3CUQ C;  2YX4 A;  1D8K A;  1I27 A;  1SMY F;  3FMR A;  1HW5 A;  1KA8 A;  2OAZ A;  4L9N A;  1XGN A;  1KYZ A;  1MZB A;  4M6Y A;  4KIF A;  3ABT A;  2DU9 A;  3KP6 A;  3K2Z A;  2HFH A;  3ECO A;  5FFZ A;  4MNU A;  3J80 K;  1LNW A;  2WV0 A;  1BI3 A;  3ROU A;  2K4B A;  3U1D A;  4M74 A;  1FPQ A;  3MZH A;  4I7H A;  3HRS A;  3SHF A;  2Z3Y A;  1IUY A;  3BRO A;  2GZW A;  4RGS A;  2PEX A;  3IL2 A;  3T5X A;  5DD8 A;  1Z1D A;  4MHG A;  4G6D A;  4EJT A;  4M72 A;  2RNJ A;  3T8T A;  5E1Z B;  3HRU A;  4CZZ A;  2D2W A;  4GYG A;  4GXO A;  4QLC U;  1B4A A;  2BEO A;  2ZFW A;  1T6S A;  5DUI A;  4LB5 A;  4IJA A;  2G7U A;  1B9N A;  1J0R A;  2FU4 A;  4YII A;  1UCR A;  4AD9 A;  1EV7 A;  1R5H A;  2VON A;  3QU6 A;  1WI9 A;  4BHP A;  1PP8 F;  4M9Z A;  3WE2 A;  4PZJ A;  4ENJ A;  5CVR A;  4XRF A;  1EH6 A;  3RPU A;  3SFZ A;  3RTR A;  2EA4 A;  4EM2 A;  3WU1 B;  3ABU A;  5FD6 A;  2F5C A;  1GXP A;  1IN7 A;  1KU2 A;  3WE3 A;  3VOD A;  4U0V A;  3K69 A;  3BOQ A;  3E6D A;  3MCZ A;  3JTH A;  5LEJ A;  2KJB A;  4OMZ A;  1WRJ A;  5HS8 A;  1XSD A;  5FO5 A;  4XSX F;  2AS5 F;  5JVT A;  2HYF A;  2HQR A;  3CUO A;  1D5V A;  2A61 A;  2RDP A;  1KQ0 A;  4HX7 A;  4Q5S F;  1FT9 A;  4EJU A;  4S05 A;  2MH9 A;  3GFI A;  5CLS A;  1BOA A;  2X4H A;  4OIP F;  2IP2 A;  2ACJ A;  1AOY A;  3OOP A;  5BOX A;  5DD4 A;  2MH2 A;  4WF2 A;  3J80 Z;  5BPI A;  4OOI A;  3B73 A;  3T1B A;  3FM3 A;  2DPD A;  3RJP A;  3L00 A;  1MD0 A;  4HW0 A;  4Y13 A;  4KMF A;  3IC7 A;  5JR3 A;  1YQA A;  2DK8 A;  4RB0 A;  3TDU C;  4ENN A;  1STZ A;  3JSP A;  4HV6 A;  2K86 A;  1UFM A;  1D8J A;  2O03 A;  4KT5 C;  1TBX A;  3C3W A;  2ZJ2 A;  2EV0 A;  4P96 A;  2DTR A;  4TV7 A;  5KK1 A;  3QP5 A;  4UVA A;  2PG4 A;  2XAJ A;  3NEU A;  3BZ6 A;  2V79 A;  2NS0 A;  1T98 A;  4GCV A;  1XSX A;  1RIO H;  1YW9 A;  4LMY A;  2EK5 A;  1B6A A;  4I0B A;  1WSU A;  1Z6T A;  1BC8 C;  3D5L A;  3JTG A;  4UV8 A;  3WTV C;  2VT3 A;  3ZMV A;  3N97 A;  3V7C A;  1LQ1 A;  3WTY C;  1IN4 A;  3FMS A;  1ZLK A;  3KET A;  3IRR A;  3KE2 A;  2H27 A;  4IRI A;  2VT2 A;  2P6T A;  1F5T A;  1P4W A;  1U3E M;  2VXZ A;  2V1D A;  2FBK A;  5L3D A;  4CO8 A;  2LSO A;  4HF1 A;  1BJA A;  1J5Y A;  2OA4 A;  2B0L A;  2CSO A;  1WWX A;  2QM3 A;  3BJ6 A;  1IN6 A;  3S2W A;  1I1G A;  1IN5 A;  5ILS A;  1ZG5 A;  2K27 A;  4R8H A;  4RAY A;  1XDS A;  4HDU A;  4E70 A;  1ZAO A;  4P55 A;  2OQG A;  4KIB A;  2FF4 A;  3HSR A;  4WXD A;  3ZMT A;  2STT A;  1DDN A;  1P92 A;  2MLK A;  2KIF A;  1IXR C;  3ZMD A;  5CVV A;  1T39 A;  2QBY A;  1R36 A;  4M73 A;  2PI0 A;  4YFX F;  2STW A;  4EGY A;  1B9M A;  1XSV A;  4HOB A;  2LDU A;  4FX0 A;  3C18 A;  2HYG D;  5JFR A;  1O7L A;  2UXX A;  3WU0 A;  1KU9 A;  4I09 A;  2C6Y A;  5DDG A;  2HTS A;  4Y15 A;  1KU7 A;  1HW2 A;  2GXB A;  1ZYR F;  2OZ6 A;  1YW8 A;  1JHF A;  4HAM A;  3G73 A;  2XAS A;  2IPQ X;  4IRH A;  5A2Q K;  2OBP A;  4G7Z F;  3ML6 A;  1V4R A;  2O3F A;  4UV9 A;  2PN6 A;  3KLO A; 
#chains in the Genus database with same CATH topology
 2M87 A;  5IP6 A;  1W1W E;  3DEU A;  3AL0 B;  1DGW Y;  4OMY A;  1I5Z A;  1HKT A;  3DTE A;  2HR3 A;  2Y0M A;  3FXR A;  1YOV B;  3VEP A;  4LIU A;  1R49 A;  2IGO A;  2V1N A;  5LRS A;  2HQ5 A;  3FXM A;  5FD5 A;  4BGD A;  4E7J A;  2MSY A;  3W2W A;  1ZH5 A;  3ERM A;  5GTI C;  1WKM A;  3NAR A;  3LSJ A;  4ZTF A;  2EZK A;  4BQO A;  4ZTJ A;  1Y1V J;  1DU0 A;  3HOV J;  2KL4 A;  3NRV A;  3TO6 A;  5DCF A;  3HZJ A;  3AG3 H;  1VQO I;  1SFO J;  3FF5 A;  1MW7 A;  4EQQ A;  3CCV I;  4KN7 X;  2EA2 A;  3HBL A;  3J81 K;  2QVO A;  3K1P A;  1S7E A;  5DYM A;  4AU7 A;  3PQJ A;  3RKQ A;  1JXS A;  5H20 A;  5H6R A;  2XKO A;  3LA7 A;  2BW3 A;  1MJB A;  2QBY B;  2H6B A;  2E2J J;  1R00 A;  2MG4 A;  3ZQ7 A;  4Y17 A;  4BE0 A;  3ZP5 A;  4WCG A;  1MJA A;  5EEA A;  4LK1 F;  2DQR A;  4MQ9 F;  3JRF A;  2OJE D;  3CCM I;  1YIJ I;  1GXQ A;  3JCU C;  4A6E A;  4WWC A;  1Z6R A;  4O3M A;  2IEK A;  4ESJ A;  5BQT A;  4GDF A;  4DBQ A;  4HZF A;  2OD5 A;  2WAE A;  1ZLJ A;  1IAW A;  4QWQ A;  2UWM A;  1U0J A;  1FSH A;  1BOB A;  4PSX A;  1FP2 A;  1X4O A;  2F5F A;  2ISZ A;  5J3L A;  3T8R A;  4L0Y B;  1X58 A;  4D5C A;  3G2B A;  2RVC A;  3ZR8 X;  3I55 I;  3KP2 A;  3PUF A;  1HW1 A;  1ZQ3 P;  4LB6 B;  2L4A A;  1J7K A;  1FBS A;  3QP6 A;  3ASO H;  1G4D A;  3SDG A;  2M9H A;  4IHT A;  4D0P A;  2W1O A;  3S1M J;  5J6X A;  1S3J A;  2FNA A;  1ODD A;  3DKX A;  2E1M C;  2BVM A;  3OY9 A;  2LC2 A;  5JHF A;  1IG7 A;  1TZL A;  2V1U A;  2E19 A;  3KLN A;  1Z7L A;  3CJN A;  2W4S A;  3GVA A;  5D5U B;  1X2N A;  2HNH A;  2EV5 A;  2V4J C;  2DFH A;  2E71 A;  2ZXI A;  4IF4 A;  2VJJ A;  3C2G A;  2FX0 A;  2BXZ A;  1HST A;  4NB5 A;  2DT6 A;  2WY8 Q;  4LIT A;  2NVY J;  3EUA A;  2E2H J;  5HOO A;  1QGP A;  5KAI C;  3WGI A;  1J2X A;  3SFI A;  4BBR J;  5IPA A;  5F1J A;  1D3Y A;  2PJR A;  1V3F A;  2F5V A;  2LBF A;  1ACI A;  3BY6 A;  1Z91 A;  2IT0 A;  5JHU A;  1D0X A;  2O8X A;  3RKW A;  2CUJ A;  2WC2 A;  4YEJ A;  3ISP A;  1FTT A;  3R0J A;  3F6V A;  4IRG A;  4YEL A;  4ENM A;  2DAO A;  3JRE A;  1SAU A;  2L9R A;  3QOE A;  3K6G A;  2QWW A;  3I5U A;  5EGO A;  2HPI A;  5CVU A;  1XDU A;  4F93 B;  2HTJ A;  2X51 A;  3JRG A;  1GVD A;  1TTY A;  2EIN H;  2RAE A;  2EFN A;  3REO A;  1F43 A;  2KFD A;  3CO6 C;  4MTE A;  3MD2 A;  3ZQQ A;  1T0F A;  5HS7 A;  4CYD A;  4G7O F;  3ELK A;  3S8P A;  5CQG A;  2NNY A;  2EFW A;  1TQM A;  1F9N A;  1QHG A;  3P9I A;  4DOZ A;  4HQE A;  2BW3 B;  1DP3 A;  3MZY A;  3F8F A;  2MD0 A;  4S04 A;  1IF1 A;  4JOM A;  3F8N A;  3H5R A;  3Q9S A;  2XGC A;  4XSZ F;  5EEG A;  3TQN A;  4B09 A;  2IJL A;  2IS1 A;  1S9H A;  1Z3X A;  1JKP C;  2IVM A;  4AVP A;  3IH2 A;  1E0E A;  5A2Q Z;  1R4N B;  2XIG A;  3CZ6 A;  4DW6 A;  5BS6 A;  2CMP A;  2Q2E A;  1TWH J;  2LLK A;  3DQV C;  1QHH D;  4Q48 A;  2CU7 A;  2GA1 A;  3FWE A;  1VQ9 I;  4BXU A;  2FA5 A;  1IRF A;  3IH3 A;  1A6Q A;  4RGU A;  4BE1 A;  3DPT A;  4L9V A;  2CRG A;  4Y4R A;  1X1B A;  4I01 A;  3QAH A;  5HDN A;  1VTN C;  4HEA 2;  1BR1 A;  3FBN B;  5GAD J;  4ZH4 F;  5BPD A;  3CDH A;  4UB6 C;  2P5L C;  2KKO A;  4OWR B;  2FE3 A;  4FCY A;  1YIO A;  2KIQ A;  2ZFU A;  2JRT A;  2VJ4 A;  4BAY A;  1S7O A;  2DW4 A;  1WQ2 A;  1B59 A;  2EFO A;  1I3Q J;  3DU6 A;  1RUN A;  3L09 A;  5FKK A;  1ONV A;  3H3U A;  3G1O A;  3VYT B;  1SD7 A;  2TCT A;  3PO3 J;  3EQL F;  4G9Y A;  5E1X A;  2OPT A;  1NG7 A;  4M3G A;  4V19 K;  1TC3 C;  3I54 A;  1VQK I;  3J81 Z;  3G71 I;  5LHG A;  2DYR H;  3E0J B;  4ASN A;  4EJO A;  4EVI A;  1WH5 A;  5GAE J;  2IA2 A;  1FBU A;  2A07 F;  2IAI A;  4RA2 A;  2PJR B;  2HOA A;  3C2B A;  3W6V A;  1KQ8 A;  4ZJZ A;  5HOD A;  3OYD A;  2LBF B;  1FP1 D;  1XG1 A;  1LFU P;  3GXO A;  1R5I D;  3HSE A;  5F6F A;  4N4N B;  3HTS B;  2MD5 A;  5HDG A;  4XLF A;  3GME A;  1HCR A;  4C2U A;  1WJF A;  3MAJ A;  3GO5 A;  1LB2 A;  2Q0O A;  4BYY A;  3E5U A;  3OL3 A;  4B47 A;  4ZDP A;  5EGO B;  4F91 B;  2LY9 A;  5D8K B;  2EJR A;  2HYJ A;  1REP C;  2LG4 A;  4EEF G;  4B3A A;  4EM1 A;  1X2M A;  2R7U A;  1UG0 A;  2ZCW A;  3O8G A;  4UVB A;  4BJ5 C;  2VXD A;  2Z1D A;  5E3L A;  1VQM I;  1O4X A;  5CVI A;  2KRC A;  1S5L C;  3HOT A;  1FWZ A;  3JR9 A;  4XLP F;  2OZU A;  2M0C A;  1V55 H;  3GFJ A;  4MFE A;  2K9L A;  4XIC A;  1CF7 A;  2YX7 A;  1MMS A;  3FMQ A;  4JBA A;  4WXH A;  4UNO A;  2QA4 I;  2G7H A;  3S1R J;  4ANJ A;  2EWN A;  1JJ6 C;  4KIG A;  2D45 A;  1IJW C;  4YFN F;  5FLV A;  4A3G J;  3SYT A;  3U1K A;  4S0H B;  1HBX G;  1GDT A;  1G8X A;  5LBQ A;  4XK4 A;  3IKT A;  4UVC A;  2M34 A;  5FJ8 J;  2ZJR F;  2GIZ A;  2YUS A;  3EUH A;  5FRO A;  2ECC A;  2Z16 A;  3K10 A;  4C2M J;  4L18 B;  2JUG A;  3NWT A;  4GYI A;  1MJ9 A;  3VFZ A;  1POG A;  1J59 A;  2LFB A;  1MBK A;  1ZN2 A;  2BV6 A;  3OR2 C;  4BDY A;  2COM A;  1IO2 A;  3BWG A;  5C4X J;  2BY1 A;  2KDZ A;  1WHU A;  1WFX A;  3R0A A;  3FZV A;  4UB8 C;  4A3E J;  3JW4 A;  1S7A A;  3LAJ A;  1W36 C;  2W00 A;  2RGV A;  3HRM A;  1LVA A;  4A0Y A;  5F27 A;  1FOW A;  3OYG A;  4XRS G;  2QLZ A;  2VPR A;  1UG2 A;  3PM1 A;  4AYB A;  5B1A H;  3ZPL A;  4Q47 A;  3D1N I;  1L0O C;  4FE4 A;  3WTU C;  3QYE A;  5EG0 A;  3I4M J;  1XCB A;  4BHB A;  3DKY A;  3I4N J;  1YO5 C;  3SDB A;  1PDN C;  1EF4 A;  5EJC A;  4HYE A;  3KZZ A;  2PLY A;  3HPH A;  2ADU A;  5L3C A;  1WJC A;  2HXO A;  3LNQ A;  2FML A;  4PJN A;  3M8F A;  1UAA A;  4D1Q A;  4XR6 A;  3GTO J;  3IAS 2;  2O9L A;  2D1V A;  2JPB A;  1LFB A;  1FLI A;  3V8K A;  2H8W A;  2CQQ A;  4RGX A;  3LSK A;  4XLN F;  2VBZ A;  2CG4 A;  3A0H C;  4M9X A;  1S8N A;  1JTY A;  4A3B J;  4D9J A;  3Q5F A;  1TWA J;  1ETX A;  4WXC A;  4G12 A;  3EYI A;  1WVR A;  2K4J A;  1BBY A;  4CHU A;  3VDX A;  3K0L A;  3AL0 C;  4O6J A;  1ON2 A;  5D6E A;  3HOX J;  2XKP A;  2VBW A;  2IS2 A;  2HOE A;  2E35 A;  3ZQC A;  3MQ0 A;  1R23 A;  4KN4 X;  2HOS A;  1HLV A;  4KMU X;  3FHZ A;  4CZC A;  2KIU A;  1JGS A;  3GBG A;  3CC7 I;  3L9F A;  4A12 A;  2QKM B;  3GCM A;  1XD7 A;  3DBR B;  4A5N A;  2ELK A;  2KZV A;  1G3Y A;  1EH7 A;  2EIM H;  2K9Q A;  5CVJ A;  3L2Q A;  2ZJQ F;  4IL6 C;  1MDM A;  2E1N A;  1MMA A;  5DV5 A;  9ANT A;  3HM5 A;  4EM0 B;  3BG6 A;  3V7R A;  1CF7 B;  1FZP B;  4ZC3 A;  2FQ3 A;  1PUF B;  4XQF A;  1HC8 A;  4IO9 F;  1MBE A;  3PSF A;  5K5R A;  3VPR A;  5D4R A;  4Z6Y A;  5IYC J;  2NOG A;  3QYF A;  4BL0 B;  2QKL B;  3IHU A;  4IPA A;  2F2E A;  3K4M A;  5AIP A;  5GP9 A;  1B8I A;  4CIC A;  4RB2 C;  4YRV A;  4P9U A;  4L9J A;  2IGN A;  3BCA A;  2KMU A;  3ESW B;  3OIO A;  2CUE A;  2JZY A;  3Q0U A;  4X1E A;  1ZK8 A;  4IOA F;  2CQX A;  2L2O A;  4D7N A;  4LK0 F;  2W84 A;  5FKL A;  3GZN B;  2VKD A;  3I53 A;  1K7A A;  1PJR A;  2A3S A;  4JX5 A;  2DN0 A;  2EZI A;  4Z2Y A;  5F0C A;  4A2U A;  1BIB A;  4AWX B;  1YLF A;  2HWV A;  5M3F J;  1ZEL A;  4L5J A;  4L5I A;  1BM9 A;  4G6T B;  4IQ4 A;  2GM4 A;  2L9S A;  2NOJ B;  4CSW A;  4BE2 A;  3PFY A;  3VB2 A;  5IOZ A;  3C1D A;  1TT5 B;  5EG0 B;  2LTP A;  3LSH A;  4XON A;  5LRR A;  3COA C;  1DP7 P;  3FXQ A;  4HX4 A;  1QBJ A;  1R5G A;  3LA2 A;  5ICE A;  2LF7 A;  1GV5 A;  5BNG A;  1USS A;  1MGT A;  2R7O A;  2OU2 A;  4U7D A;  4PFO A;  1TP4 A;  3LSR A;  3OS1 A;  2CV0 A;  2EFP A;  3RZD J;  2QSG X;  4A0X A;  1I6X A;  3BR1 A;  4H0E A;  3J7A O;  4ETS A;  4JQF A;  1RRJ A;  3QWL A;  1AKH A;  2FSW A;  3CCL I;  1LDD A;  1YS7 A;  1OCP A;  2MC3 A;  1UJ8 A;  5KAF C;  3JRC A;  3J7Z I;  3D5S C;  1QRY A;  2NRA C;  3LSP A;  2X0L A;  2DFE A;  2ID3 A;  1VND A;  2M7B A;  1YRN A;  1I39 A;  1YYV A;  2JSC A;  2JA6 J;  3BLY A;  3HOY J;  2GOX B;  2XDV A;  3IP4 B;  5FFX A;  5KNL A;  2CS3 A;  2CV2 A;  3AG2 H;  3LFU A;  4G94 A;  3GUD A;  2EZH A;  2VQG A;  1FMV A;  2M30 A;  3HPG A;  2P81 A;  2F6C A;  1ETW A;  3QPS A;  1BN5 A;  1A31 A;  4MEX F;  2JVH A;  1MDM B;  1XGO A;  5ED4 A;  2VKV A;  3BTC A;  5FGM A;  1F4K A;  2JQ7 A;  1K78 A;  2M8E A;  1BR4 A;  4ZZL A;  3L2W A;  3UR3 C;  2E1C A;  3LSM A;  4KUM A;  5ERI A;  4OAZ A;  1FOK A;  2JSP A;  4K2E A;  2DA2 A;  4MGR A;  4XL9 A;  4P5O A;  2WTE A;  5TIS C;  3IWF A;  1E3P A;  1B8I B;  2A6T A;  2LKX A;  1C0W A;  1RC9 A;  4NQW A;  2VOD A;  2P4W A;  3KEO A;  4PDK A;  3E6B A;  2ELJ A;  5FKM A;  3WGH A;  4V2G A;  1SFE A;  2M1B A;  2BGC A;  2H09 A;  2JA7 J;  5KCM A;  2RV8 A;  5F04 A;  5E3N A;  3PQK A;  3GZ5 A;  4N9I A;  2MA3 A;  2CQK A;  2HQA A;  2BXY A;  3CO7 C;  1CQT A;  2AQF A;  2XAQ A;  5EEH A;  4LFU A;  1P4A A;  2DBB A;  2EBI A;  4CUG A;  1P4X A;  3RI4 A;  1VQ8 I;  1PYV A;  4MQV A;  2L7Z A;  3HGY A;  3TDZ C;  5EYR A;  4A6D A;  2W7N A;  3S17 J;  2R7T A;  2A5Y B;  2XRO A;  5FRM A;  1Z7U A;  3JRA A;  1FNN A;  1P6R A;  3DKW A;  3RIR A;  2NNN A;  2F4I A;  5GAG J;  1XS9 A;  3CLO A;  3CMY A;  1H0M A;  1JJ8 C;  1Z9C A;  2L7M P;  2ME0 A;  2GXG A;  3H35 A;  4RAZ A;  1QO0 D;  3BZC A;  3WTX C;  2QGU A;  3CCY A;  4N9H A;  1X1P A;  4PJM A;  1BL0 A;  3DPL C;  4C9Y A;  4BXX J;  3RSN A;  1Z3Y A;  1S6L A;  1ETQ A;  3V8J A;  2V9V A;  3M1C A;  1XCV A;  4A3F J;  3TBI A;  1TQI A;  2LMD A;  5LGN A;  4UUS A;  1IGN A;  2X1D A;  4XBF A;  3SJM A;  2EB7 A;  1HOM A;  3DLA A;  4U87 A;  1T56 A;  4B1R A;  4XM3 A;  3CMM A;  1MIJ A;  5CKT A;  1YRN B;  3F6O A;  4NC7 A;  4XLA A;  5B66 C;  1IRG A;  3LOC A;  2V1X A;  3DXJ F;  2R0Q C;  4MEY F;  3TMO A;  3KEY A;  2Y9Z A;  2DA5 A;  3G1L A;  3MN2 A;  1V5F A;  3K1N A;  1D5Y A;  5FLX K;  4E7I A;  1N77 A;  4C2T A;  3GZ6 A;  5E8G A;  5K7F A;  1JUS A;  3BR3 A;  2X6W A;  3WTZ A;  1P2F A;  4GO1 A;  3X2Q H;  2X6Y A;  3GTP J;  4A69 C;  1V5G A;  4LGW A;  3S2H J;  2VE8 A;  3V7S A;  2QEN A;  1A6I A;  2XAU A;  1BW5 A;  5F64 A;  1FYL A;  1U5T A;  3SEQ A;  1K78 B;  3WG9 A;  1Y56 A;  4YFK F;  3HG9 A;  3O2P E;  1H88 C;  2XAF A;  1AWC A;  1T0F C;  1DPU A;  2B9S A;  5K1Y A;  4A93 J;  5L3G A;  3CJQ B;  1GLN A;  4RM2 A;  2FEZ A;  2H94 A;  3WG7 H;  1ZGW A;  2PJP A;  4NDL A;  3F21 A;  3CLQ A;  1NH3 A;  3I56 I;  4NQW B;  5D5X B;  2JUC A;  3UKG A;  3KYC B;  3HOS A;  1OYI A;  3OR1 C;  4J00 A;  2HU9 A;  1SC7 A;  1O3T A;  1DUX C;  4AIK A;  5ILV A;  4XOT A;  2V6C A;  3PSI A;  4CYC B;  1QQI A;  4UUV A;  3C7J A;  3HB9 A;  2OQR A;  2XF6 A;  4M3E A;  4A3C J;  3P9C A;  4F3Q A;  1S72 I;  3BG5 A;  4I99 C;  5J47 A;  5E1W A;  3GTG J;  4KDP A;  5L3F A;  2FNP A;  3RYR A;  4LLG F;  2KT0 A;  4B8X A;  2DMP A;  5HNH A;  4OIO F;  2HVQ A;  1SMT A;  3OV8 A;  4QPQ A;  4HV5 A;  3DWL E;  1SFU A;  2A5W A;  2FD5 A;  2LOO A;  2R5Z A;  3FXK A;  3LQQ A;  3G3Z A;  3WHB A;  1BJZ A;  1HQC A;  3RKX A;  2UXN A;  2Q8K A;  4M6V A;  2IS6 A;  3V4G A;  5HLG A;  4II2 A;  1ORK A;  5FLM J;  3KZY A;  2WB1 A;  2XHK A;  3RKY A;  4LLL A;  1UHM A;  2BY2 A;  2M45 A;  2LY1 A;  3MWM A;  4RMN A;  4XOP A;  4ON0 A;  4BQN A;  3BG9 A;  4HNU A;  2XPV A;  4YIR X;  2BHY A;  3ULQ B;  4P1W A;  2E34 A;  4IZZ A;  2M4K A;  4P9F A;  4AM3 A;  1LDK B;  1G3S A;  1BC7 C;  4XN0 A;  4ZYH A;  1FYM A;  1FIA A;  2KDO A;  2K5C A;  3OYH A;  3H1C A;  6PAX A;  5ILU A;  3F9K A;  4C3J J;  2E7X A;  3QRF F;  4ABZ A;  1OPC A;  3L2C A;  3R61 A;  5DTD A;  3S14 J;  2P8T A;  5GPC A;  1LJ9 A;  2VC1 A;  4RAG A;  1U5T B;  4G8X A;  1IZ1 A;  1HDP A;  1QNT A;  1SD5 A;  4NNJ A;  5LGU A;  3A0B C;  3AG4 H;  4HF2 A;  1MNE A;  2PX9 A;  4ITV A;  3K4J A;  1LFP A;  1B1B A;  3HYI A;  2X1C A;  4R79 A;  2GA2 A;  3DP7 A;  3B6A A;  4II3 A;  4F55 A;  4KFC A;  2X6O A;  5IY5 H;  1OYW A;  4R1H A;  3K70 C;  3RQI A;  2DK5 A;  1U9N A;  3L2V A;  2ZME A;  3LSG A;  3OYB A;  1H9G A;  2FOK A;  4YG2 F;  3ZGK A;  1RR8 C;  2ICW G;  3E1S A;  3ABK H;  2Y2Z A;  2VOO A;  3PFI A;  1OCZ H;  3M9A A;  3CMA I;  1T2K A;  3EUH C;  4W97 A;  4BS9 A;  2HKX A;  5LHI A;  2FQ4 A;  2VQL A;  2LF8 A;  2QZ8 A;  1XC5 A;  1QZY A;  2X48 A;  2AHQ A;  4DYQ A;  3FK7 A;  3DCF A;  3GEZ A;  5ICC A;  2VOP A;  5HS9 A;  5FLX Z;  3F3X A;  3OSG A;  3CJT B;  3I4P A;  4KNY A;  2XAH A;  3GYH X;  3KEQ A;  5EF6 A;  3EDP A;  3IKV A;  1AU7 A;  2HDW A;  2GIV A;  2DPU A;  3WTW C;  3CP2 A;  1BIA A;  4CDG A;  1OKR A;  4RB3 C;  3IUO A;  2F5E A;  2R5Z B;  3I59 A;  1IN8 A;  2AQE A;  2JN6 A;  1DQU A;  1HSJ A;  2O0Y A;  4OIN F;  3TO7 A;  3HSF A;  2Y75 A;  2TDX A;  2XB0 X;  4MO7 A;  4XLH A;  1IXC A;  5AON A;  2CWE A;  3HKZ A;  2JA5 J;  5KVR A;  1G3T A;  3HEF A;  2LR8 A;  2LVS A;  4BNC A;  2DMQ A;  3OIP A;  1UZC A;  2Y48 A;  2DCE A;  4FAS D;  1W5T A;  4KA4 A;  3TED A;  2E7W A;  4G6Q A;  2I10 A;  3W6K B;  2VBY A;  2DDB A;  2VKE A;  2D1H A;  1LE8 A;  1ZTR A;  1WH7 A;  2JMW A;  5J8F A;  2LKP A;  3ZMU A;  4CH7 A;  4PGH A;  4DYC A;  1LEB A;  3H9J A;  2IGM A;  3BPX A;  1Z05 A;  4W1U A;  2QCO A;  1XGS A;  3DLL F;  3ZN1 A;  4A3M J;  1SFX A;  1Y0U A;  5D4S A;  4AYB N;  2ELH A;  4ZDL A;  5EZG A;  2LNB A;  4KJZ A;  3CCE I;  2X85 A;  1ZRD A;  2FRH A;  2IW5 A;  1V54 H;  2XGX A;  2GAU A;  3Q0V A;  3S32 A;  4IHV A;  1Z67 A;  1FIP A;  3GW2 A;  2V6E A;  1OFC X;  4DGW B;  2GXA A;  3CQZ J;  3GTK J;  2GWR A;  1FEX A;  4MIM A;  2IA0 A;  3E7L A;  3ABM H;  3SZP A;  3WHC A;  4I2O A;  3BJO A;  4FTH A;  2DT5 A;  2O6G E;  1HF0 A;  2IRF G;  3H9Q A;  1LPQ A;  2IGK A;  1U2W A;  3ZMZ A;  4C3I J;  1JKR C;  2P7V B;  3K4K A;  4HST A;  4GFB A;  4LLN A;  1NK3 P;  2VIX A;  2CV1 A;  1KGS A;  1XB4 A;  2WAD A;  3JRB A;  2N8G A;  2WWY A;  3CF5 F;  2VN2 A;  4XNF A;  4CCO A;  3Q0W A;  2GQQ A;  1ZRC A;  5LEK A;  5LGT A;  2ZME B;  2K9M A;  4U0W A;  5GAH J;  3LST A;  1YJN I;  2FUG 2;  2RQP A;  3BR2 A;  3ZQF A;  2GLO A;  2P5V A;  2V9K A;  4MFD A;  2PBI A;  2QQB A;  1HA8 A;  1TWF J;  4BQQ A;  1E3O C;  2WAF A;  2A69 F;  2NYX A;  5BMZ A;  4IEJ A;  5HVQ C;  2K3P A;  2ZXH A;  4QTR A;  3ZQL A;  4ZZD A;  4B4C A;  5E17 F;  3HL2 A;  3WOD F;  2JJ7 A;  4UUT A;  3N05 A;  2ZXJ A;  1JUM A;  3I64 A;  2VPL A;  2KZG A;  5L3E A;  2OCE A;  4HNT A;  1YTY A;  2CGP A;  2PQ8 A;  1SFK A;  2P0W A;  1T33 A;  4A3J J;  1W5S A;  2W24 A;  2DOF A;  4WK8 F;  2YU3 A;  5M5Y J;  1ZR2 A;  2Q2E B;  3DEW A;  4FT8 A;  4UY8 I;  3F8B A;  3I59 B;  2WA0 A;  4HDV A;  1I3A A;  1WJD A;  3K7A J;  2BE5 F;  5JI6 A;  1ERD A;  5IT9 K;  2DMN A;  3LAP A;  3F8C A;  3BG3 A;  1H9T A;  4LG0 A;  3FIW A;  3CES A;  2B63 J;  2L4M A;  4L0Z B;  3I71 A;  2Z33 A;  1WGX A;  2V7F A;  4MLO A;  2PMH A;  4Y3O A;  2YSR A;  1OYY A;  1X1D A;  3BTI A;  4KT6 A;  2E2I J;  3IRQ A;  2R7F A;  1P7I A;  1X3U A;  3QU3 A;  5FKO A;  1R6R A;  3AG1 H;  3EUK L;  1GUU A;  3HC7 A;  1LE8 B;  2VI6 A;  2Z99 A;  1Y39 A;  3TO9 A;  3KP4 A;  1MMD A;  2ZO4 A;  2G9W A;  1XGM A;  2ECB A;  2PMZ A;  1R58 A;  1VF9 A;  1MH4 A;  2E5Z A;  2R7S A;  3E6C C;  2FBI A;  1XX5 A;  1FOY A;  2W57 A;  2DMT A;  2W48 A;  3ABL H;  1CGP A;  1BA5 A;  4WX9 A;  1APL C;  3HDD A;  4AIJ A;  4OU0 A;  5IT3 A;  1FMW A;  1ZR4 A;  2O8K A;  3K4L A;  1ETK A;  4KIS A;  5GPA A;  4MTD A;  3CUQ A;  2NVU B;  2R7Q A;  2UUZ A;  2ZNY A;  2DOD A;  1IV6 A;  1UEL B;  2HDC A;  4DYR A;  3HTU A;  5HLT A;  4HLY A;  2MBF A;  1D0Z A;  3PIP F;  2Z5U A;  5CJ9 A;  2DA6 A;  4PCQ A;  2LY2 A;  3ZQI A;  1WZ2 A;  1BI2 A;  4B43 A;  3GWZ A;  1R1V A;  1X19 A;  4KIT B;  3S3N A;  4OAY A;  1W36 D;  2AXL A;  4L5E A;  2A68 F;  1NHA A;  2CYY A;  3PUB A;  5FB2 A;  2VC0 A;  5K5O A;  1LDJ A;  4DIQ A;  1WJE A;  1WJ5 A;  4OIQ F;  4KYW A;  2EH3 A;  1MH3 A;  2E5N A;  1FC3 A;  2MC4 A;  3HJE A;  3KP5 A;  4HX8 A;  4ZYE A;  2K9N A;  3GFM A;  2AXT C;  2B7E A;  3PJR A;  2E60 A;  1U8R A;  4L9T A;  2CH0 A;  4HBL A;  4A5M A;  2BOL A;  2HZT A;  2P6S A;  3UNG C;  1KZH A;  5JLX A;  4PJ0 C;  3PIO F;  2FMY A;  3M8J A;  3DF8 A;  3N4M A;  1O3S A;  3P5J A;  4ZYD A;  1BI1 A;  3WU2 C;  3HHH A;  4PGG A;  1K6O A;  1Z77 A;  3SQN A;  3HOW J;  1O3R A;  1ZGA A;  3KFW X;  3FX3 A;  1KU3 A;  5K5Q A;  3K1M A;  4LG0 B;  1DPR A;  1Z21 A;  2BYV E;  4FQG A;  2JTV A;  2X9D A;  2VJ5 A;  3E6M A;  3LA3 A;  4E7Z A;  1SD6 A;  4I76 A;  4XRS A;  2HEO A;  3U2R A;  1ETO A;  2FJ1 A;  1O3Q A;  1UHW A;  3KP3 A;  2WY7 Q;  1MMN A;  1G59 A;  2CO5 A;  1TW3 A;  2XUB A;  2EV6 A;  2AO9 A;  3FXU A;  1JHH A;  3OYF A;  1OQY A;  1J75 A;  1SVM A;  1O7F A;  4JX4 A;  5CQE A;  1BR2 A;  4J19 A;  4AUX A;  1H89 C;  2ESN A;  2FOW A;  2L9V A;  4HLX A;  4RGR A;  1LEA A;  2L02 A;  3MVP A;  3PNT A;  3IAM 2;  3OOU A;  1G2H A;  4EMS A;  4ZYG A;  3FKI J;  3OS2 A;  3LQR A;  3CCU I;  2UV1 A;  1E2X A;  2L5Q A;  2YR2 A;  1PUE E;  5B3S H;  4Q4Z F;  2D5V A;  2ZSI B;  1QVU A;  1X1C A;  3CUQ B;  2H8R A;  2A6E F;  2VJI A;  3BDD A;  2G0E A;  2EIK H;  5F1R A;  2L9N A;  5J8C A;  1HKQ A;  2GOM A;  1G6N A;  4M9S A;  4LOC A;  4UHT A;  1NK2 P;  4EV0 A;  2DOE A;  2OTL I;  4Y52 J;  2NVX J;  2XV4 S;  5D5W B;  3OYA A;  3VOE A;  2W82 A;  1T8I A;  1I50 J;  1QVT A;  2QQ9 A;  3JAM K;  2M4G A;  1A36 A;  5IT9 Z;  1U5T C;  3NQO A;  3FKJ A;  1H8A C;  1ZRF A;  1I1S A;  2K40 A;  3WGG A;  3BR5 A;  3OMY A;  1I6H J;  4BQA A;  3KPH A;  2XAG A;  2DA3 A;  5C44 J;  1A04 A;  3BCB A;  5CYV A;  3K9T A;  2W25 A;  1Y8Q B;  3S93 A;  1YFH A;  5E79 C;  4BEH A;  3SXY A;  2KJC A;  3M7G A;  4BJ6 C;  4HQM A;  1IXS B;  2OTJ I;  2LKS A;  2HZD A;  3R4K A;  3MKY B;  3MMY B;  1T08 B;  4EJV A;  1FX7 A;  2R7X A;  1MSE C;  5F0H A;  3S16 J;  1D1B A;  4H4K C;  2MAB A;  3ZN0 A;  2J5P A;  2MGQ A;  3MFK A;  1R7J A;  3H3Z A;  3TOA A;  3QOP A;  3F22 A;  3RCO A;  3KCC A;  2JPC A;  2W85 A;  2M5W A;  4F92 B;  2KHM A;  1RR7 A;  1WPK A;  5GTH C;  3S2D J;  3ZXS A;  4EGZ A;  3HRT A;  1ULY A;  2CJJ A;  4JX6 A;  4BUP A;  2UZK A;  3LWF A;  2I5U A;  1TNS A;  2WAQ N;  3H0D A;  1J09 A;  1O57 A;  2K3F A;  1R1U A;  3AAF A;  4PJJ A;  1FBQ A;  2J5O A;  1L3L A;  1YS6 A;  3VYS B;  2KQR A;  3U21 A;  2R7W A;  3D0S A;  1D1C A;  2R92 J;  5IYD J;  1J9I A;  1OCR H;  1SAX A;  1GT0 C;  3J7A Y;  4FHT A;  1M1E B;  1JT0 A;  5DM7 F;  1PP7 U;  1W7P D;  4M71 A;  5E8I A;  3CCS I;  2LD5 A;  3FM5 A;  3VWB A;  3BR6 A;  3RZO J;  3P9K A;  3JRI A;  1AA7 A;  3OIQ A;  2M2E A;  4LIV A;  2YS9 A;  4U7B A;  1R22 A;  2JT1 A;  2L54 A;  3HHG A;  1VQ4 I;  3TL4 X;  2OCC H;  1JKO C;  1UST A;  4HPQ A;  1EA3 A;  1ETV A;  4M3F A;  3A03 A;  3ZQG A;  3ERE D;  3H3V K;  1IDY A;  5LHH A;  3EET A;  1SD4 A;  1X3W B;  1UB9 A;  1GVJ A;  1EJ9 A;  4XKW A;  2R7D A;  5LD2 C;  1YG2 A;  2LRE A;  1K61 A;  1XMK A;  2K7L A;  3BJA A;  4LD5 A;  2QUF A;  4RAF A;  3M1E A;  1RUO A;  3I9V 2;  3W6J B;  1YX5 A;  1HDD C;  3F8M A;  2EZL A;  5H2F C;  5FKN A;  1AKH B;  1OCC H;  1R9T J;  3DV8 A;  3ONQ A;  3LSI A;  1VQP I;  5TGT A;  4GGG A;  1G3W A;  5IYB J;  2VE9 A;  5HLH A;  2DFI A;  2O61 A;  5DUK A;  5B5E C;  3RDI A;  2KPM A;  2IA1 A;  3RYP A;  3TKY A;  4CCJ A;  2O5R A;  1ZG1 A;  2R7V A;  1VQL I;  4IHX A;  2O7O A;  1QZZ A;  3GX4 X;  5ICF A;  2BBY A;  2WB1 N;  4JK1 X;  4G7H F;  3TW7 A;  4XOR A;  1ON1 A;  4DQ2 A;  4BEH B;  2TRT A;  3MEX A;  5DEQ A;  3A02 A;  4XID A;  2P7C B;  2L3D A;  1JKQ C;  2XRN A;  2XPU A;  1RZ4 A;  5J40 A;  3R6S A;  3OYM A;  3Q9V A;  2PFB A;  2PMU A;  2EFQ A;  2F4O B;  2ZME C;  1W0T A;  4LJZ F;  3WTT C;  5E20 A;  2DQL A;  2YU9 J;  2CFX A;  2DA1 A;  1RNL A;  1KON A;  1FY7 A;  2KP6 A;  4RM3 A;  3DTK A;  2WAQ A;  3E5X A;  1K4S A;  5E3M A;  4J01 A;  1SVO A;  3KP7 A;  2XPW A;  3HUG A;  4U88 A;  3BP8 A;  4C3H J;  2KRF A;  3I0T A;  2QYO A;  4NHJ A;  2R3S A;  3H92 A;  2Z9O A;  4ESF A;  3DFG A;  3RPQ A;  1ZAR A;  1T38 A;  1QPM A;  3OYL A;  2ETH A;  3E5Q A;  3O6B B;  2DDA A;  1MBJ A;  4FET A;  4CA0 A;  2L01 A;  4I02 A;  2RC4 A;  5L3B A;  2HOT A;  1Y0N A;  1N25 A;  4U0Y A;  2BY3 A;  3GF2 A;  4RB1 A;  2WBM A;  2CQ7 A;  4M3B A;  5D6F A;  3VSL A;  1RI7 A;  1SVL A;  3L1P A;  1VQ7 I;  3L7W A;  2VL8 A;  3JAM Z;  4IX7 A;  2COB A;  1RPW A;  4A0Z A;  1W4M A;  2Y0S A;  1W7P A;  4D7M A;  1ZHF A;  3F72 A;  2P5K A;  1TL8 A;  3QPT A;  4KIC A;  2RNG A;  2CW0 F;  2KIM A;  3BPV A;  2RQQ A;  1KQ9 A;  2VB6 A;  2NVQ J;  5H6Q A;  3A4C A;  4B44 A;  5C3E J;  1RES A;  4BH9 A;  2EIL H;  5F08 A;  3NWS A;  5AIQ A;  2HGC A;  1YIT I;  5E18 F;  1JE8 A;  4XKV A;  2BHZ A;  4E7S A;  2HI3 A;  2KRH A;  2HKO A;  5HLI A;  3F23 A;  4F7Z A;  2VQH A;  5DCM A;  2R5Y A;  3CTA A;  3DTI A;  1JUP A;  2NAZ A;  5LLQ A;  2QQ8 A;  3P7N A;  2A6H F;  4FX4 A;  3WTS C;  3TOB A;  1D0Y A;  1MKM A;  3G6E I;  3JSO A;  3U9G A;  1SEU A;  1T95 A;  4CXF A;  3S1N J;  4UUS B;  1ZG3 A;  2MFZ A;  3TGN A;  3ZQH A;  3QPH A;  2RN7 A;  4IHS A;  1N75 A;  4IXA A;  2LP0 A;  3V42 A;  1K79 A;  4HNV A;  3VYU B;  5TJJ A;  2VBX A;  3KIO A;  1WJA A;  3HKZ N;  2QQA A;  2LK2 A;  3RQ4 A;  1XN7 A;  3W2A A;  2XVC A;  4HA8 A;  1VQ5 I;  1RKT A;  3DEE A;  4ESB A;  3CCR I;  2OV7 A;  3QQA A;  5HNF A;  1Y1W J;  5J4V A;  4Y7N J;  1TNT A;  1LVK A;  3E97 A;  4ENK A;  4C30 A;  1K83 J;  3V8L A;  3A01 A;  2BVL A;  3A1Y A;  1TW2 A;  1HXD A;  4PUS A;  1X4P A;  2DLL A;  1EH8 A;  5HDK A;  3IWZ A;  1E17 A;  2K02 A;  2MLG A;  3CF2 A;  1YJW I;  4V2F A;  1FYK A;  1N78 A;  1BI0 A;  4UXN A;  1YW7 A;  1R1T A;  2H6C A;  1A35 A;  2HVS A;  1GHC A;  3E3V A;  2ZXW H;  4B48 A;  4N0B A;  3ECH A;  1K4T A;  3HUG B;  4DZJ A;  1Y6I A;  4BDZ A;  2DMU A;  2HS5 A;  1OCO H;  5ICG A;  3QOD A;  1KYW A;  2DJI A;  2DT7 B;  1S29 A;  3Q3S A;  3M8E A;  4IVN A;  1U78 A;  1FSE A;  3NAU A;  2ISY A;  3SZT A;  3T0Y A;  4AIH A;  4XRM A;  3SEZ A;  2M0M A;  4YIF A;  1TQP A;  1HKS A;  5IP7 J;  4I98 B;  1Q1H A;  1U6G A;  4A3L J;  5D8L B;  3FDY A;  4GRI A;  1RET A;  3LFK A;  1OR7 A;  4RS8 A;  2LH9 A;  1XMA A;  2RKH A;  1W7P B;  3EYY A;  3R60 A;  2F4M B;  3HIF A;  1IW7 F;  2HXI A;  3BC8 A;  1ZRE A;  1TLH B;  2YPR A;  3O3K A;  3I58 A;  2DI3 A;  1B72 A;  2Y9Y A;  2F5D A;  2FXA A;  3BG7 A;  2ZBK A;  3SZG A;  1ZKG A;  3K4B A;  3ZMS A;  5D5V B;  1F1Z A;  5TRD A;  1Z0X A;  4CGZ A;  3GFL A;  1WCM J;  2ESH A;  4DNC A;  4AID A;  5DCM B;  2R5Y B;  2ME6 A;  2ZKZ A;  2NXN B;  1OMI A;  4OIR F;  1ZGJ A;  2HQN A;  4BHC A;  4XLE A;  3JRD A;  4M6X A;  3B02 A;  3CME I;  3FK6 A;  4I0A A;  4EJW A;  1X3Z B;  4HF0 A;  4JP0 A;  2FBH A;  2M8G X;  3K70 D;  2X1E A;  3GLX A;  1A5J A;  5F0F A;  2ZNZ A;  4O5V A;  2DO7 A;  3CUQ C;  2YX4 A;  1D8K A;  1I27 A;  1SMY F;  1XTA A;  3FMR A;  5J1U A;  3ZCO A;  1Y8R B;  1HW5 A;  1KA8 A;  2OAZ A;  4L9N A;  3DBL B;  1XGN A;  3B6C A;  1KYZ A;  2R4G A;  1MZB A;  3A01 B;  3AKZ A;  4M6Y A;  2H1K A;  1WJB A;  2Q1Z B;  3H5N A;  2Z2S B;  3MKL A;  4KIF A;  2CUZ A;  3K4N A;  2PMZ N;  1JGG A;  3PNY A;  3ABT A;  3RPU D;  2DU9 A;  1GV2 A;  3KP6 A;  1WI3 A;  4FE7 A;  2CW8 A;  3K2Z A;  2K85 A;  1TT0 A;  1R71 A;  3HXL A;  2HFH A;  2QEX I;  3ECO A;  3QPL A;  5FFZ A;  4MNU A;  3J80 K;  3GTJ J;  1LNW A;  2WV0 A;  2XC7 A;  1BI3 A;  2XGE A;  3D5R C;  3BR0 A;  3ROU A;  2K4B A;  4RDU A;  3U1D A;  3TP3 A;  3GTQ J;  1X1A A;  4M74 A;  1VQ6 I;  1FPQ A;  2R7R A;  3MZH A;  4I7H A;  3HRS A;  3SHF A;  1NG6 A;  2Z3Y A;  5M5X J;  1IUY A;  3BRO A;  2GZW A;  4RGS A;  2PEX A;  3IL2 A;  2QSF X;  1RKW A;  3T5X A;  5DD8 A;  2LYC A;  4RLQ A;  2JVG A;  1Z1D A;  4MHG A;  2L7K A;  4BXF A;  4G6D A;  3BTL A;  1QZE A;  1FTZ A;  4EJT A;  3QYB A;  3OL4 A;  4M72 A;  1JI8 A;  4HG2 A;  2RNJ A;  3T8T A;  2H1L A;  4CCK A;  1B72 B;  4BY1 J;  5E1Z B;  3VSK A;  3HRU A;  2ZB9 A;  2DYS H;  4CZZ A;  2D2W A;  4GYG A;  4GXO A;  4EAT A;  4QLC U;  1B4A A;  5M3M J;  5K7H A;  4IOC F;  2QSH X;  4XN3 A;  1OIS A;  3LMM A;  5EDN A;  2BEO A;  2ZFW A;  1T6S A;  4QIW N;  3M3Y J;  3OSF A;  4DBR A;  5DUI A;  5IP9 J;  4LB5 A;  4IJA A;  1PUF A;  2G7U A;  5IOY A;  1OCT C;  1B9N A;  1J0R A;  4XMY A;  2FU4 A;  2CQN A;  4YII A;  1UCR A;  2WV1 A;  4AD9 A;  3HGG A;  1EV7 A;  3OYK A;  1VI0 A;  4PSW A;  4PK4 A;  1LUJ B;  3AFH A;  1R5H A;  2VON A;  4Y33 A;  3QU6 A;  1WI9 A;  3HOU J;  4BHP A;  1PP8 F;  2VKH A;  3O8H A;  5EZH A;  1BW6 A;  4M9Z A;  4E6K G;  4BKX A;  2OC6 A;  1VQN I;  3WE2 A;  4PZJ A;  4ENJ A;  4E7H A;  5CVR A;  3PO2 J;  2ZSH B;  4XRF A;  1EH6 A;  3BTJ A;  3C2H A;  3S3M A;  2DA4 A;  1P9Q C;  3RPU A;  3SFZ A;  4NC8 A;  3DU5 A;  3PNV A;  3RTR A;  3H0G J;  2EA4 A;  4EM2 A;  2EQR A;  3WU1 B;  3ABU A;  5FD6 A;  2F5C A;  4QSH A;  2DOA A;  3CC2 I;  2BY0 A;  1GXP A;  1IN7 A;  1KU2 A;  1U9O A;  2VAS A;  3WE3 A;  3VOD A;  3M4O J;  3OYJ A;  2A05 A;  5CPR B;  3K4C A;  2KLO A;  4U0V A;  3K69 A;  4E4H A;  1IUF A;  3BOQ A;  4N4O B;  2DXI A;  2Y69 H;  3E6D A;  3F0C A;  3JTH A;  3MCZ A;  4BAC A;  2VLA A;  3OYI A;  4DZP A;  2Y30 A;  5LEJ A;  2E1M B;  1W5C C;  2KJB A;  4OMZ A;  2XF7 A;  5J1R A;  1WRJ A;  3FIS A;  2I8D A;  1QPI A;  5HS8 A;  1XSD A;  5B1B H;  4ZYA A;  5FO5 A;  1UMQ A;  2DJN A;  4XSX F;  3W2V A;  2NVT J;  1UHS A;  3OS0 A;  2AS5 F;  1ETY A;  5JVT A;  2HYF A;  4JYK A;  2HQR A;  3CUO A;  1D5V A;  1MND A;  3CCJ I;  3MKW B;  3CD6 I;  2A61 A;  2RDP A;  1KQ0 A;  2ID6 A;  4HX7 A;  4F52 A;  4Q5S F;  1FT9 A;  4EJU A;  3OYE A;  4S05 A;  1DGR M;  1QU3 A;  2MH9 A;  2JRM A;  3GFI A;  5CLS A;  1BOA A;  4E7K A;  2X4H A;  4OIP F;  2IBD A;  3PL8 A;  4XKC A;  3CDL A;  4QPO A;  5FRN A;  2IP2 A;  3H36 A;  4IHY A;  3FHN A;  3L2U A;  2ACJ A;  3OOP A;  2L0K A;  4B3X A;  1AOY A;  3KX2 A;  2NS8 A;  5BOX A;  3CC4 I;  5DD4 A;  2MH2 A;  4WF2 A;  3J80 Z;  5BPI A;  4OOI A;  3B73 A;  3T1B A;  3FM3 A;  3FXL A;  5JVG F;  2DPD A;  2JA2 A;  3RJP A;  5JLW A;  3L00 A;  4NC6 A;  2RRE A;  4BJT A;  2XF5 A;  1MD0 A;  4HW0 A;  4Y13 A;  4KMF A;  4A3I J;  2IS4 A;  3IC7 A;  3KZI C;  3IH4 A;  1VZ0 A;  5JR3 A;  1YQA A;  1IDZ A;  2DK8 A;  4RB0 A;  3TDU C;  1PVE A;  1STZ A;  4ENN A;  1FJL A;  3FBI B;  3EPZ A;  3JSP A;  2OF7 A;  4HV6 A;  2BZT A;  2K86 A;  3BT9 A;  1UFM A;  1D8J A;  4PFP A;  2O03 A;  4KT5 C;  2DFF A;  5J4Y A;  1TBX A;  4M3D A;  3S1Q J;  2R93 J;  4HSR A;  5E3O A;  4HRI A;  3J7Y J;  3C3W A;  2ZJ2 A;  2EV0 A;  4P96 A;  2DTR A;  4TV7 A;  4X0G A;  3FXO A;  4XKB A;  2F48 A;  2OUM A;  5KK1 A;  3QP5 A;  3TP0 A;  4UVA A;  4FIS A;  2VQC A;  2L7F P;  3CCQ I;  3S15 J;  2PG4 A;  2KIS A;  3HOZ J;  5M5W J;  2XAJ A;  3NEU A;  3BZ6 A;  1SAN A;  2V79 A;  2NS0 A;  1T98 A;  2HPM A;  4GCV A;  1V5E A;  3OWT A;  1XSX A;  2IXS A;  3BZK A;  1XPX A;  1RIO H;  1ITY A;  1YW9 A;  4LMY A;  2EK5 A;  1B6A A;  4I0B A;  1TWC J;  3LL7 A;  1WSU A;  1Z6T A;  3A2K A;  1BC8 C;  2JA8 J;  4I6Z A;  3D5L A;  3DPU A;  4A3K J;  3JTG A;  4UV8 A;  1IC8 A;  1YE9 A;  2K9S A;  2E1O A;  2Y31 A;  3BQZ A;  1QA6 A;  3WTV C;  3MZ8 A;  2VT3 A;  3G4S I;  3ZRG A;  1NTC A;  3ZMV A;  2EPF A;  1VFC A;  4ZDO A;  1YX3 A;  3N97 A;  1MNM C;  3V7C A;  1LQ1 A;  4CCM A;  3WTY C;  1IN4 A;  2JWT A;  2GBY A;  3FMS A;  1ZLK A;  3KET A;  3IRR A;  2HDD A;  3KE2 A;  2H27 A;  4IRI A;  2R7Z J;  1JT6 A;  2CFO A;  2VT2 A;  3H9G A;  3H5A A;  2X6X A;  1YHQ I;  2P6T A;  1F5T A;  1P4W A;  1U3E M;  5DS9 A;  2VXZ A;  2V1D A;  2NS7 A;  2FBK A;  5L3D A;  4CO8 A;  2LSO A;  4HF1 A;  1BJA A;  4BBS J;  1IRX A;  1E3H A;  2OA4 A;  1J5Y A;  1F36 A;  2B0L A;  1DU6 A;  3CDI A;  2HVR A;  2CSO A;  1WWX A;  2QM3 A;  1MMG A;  3BJ6 A;  3DBH B;  4AC0 A;  1XMX A;  1IN6 A;  3S2W A;  3OYN A;  1I1G A;  1IN5 A;  2QF7 A;  5ILS A;  4A3D J;  1ZG5 A;  1Q1V A;  2K27 A;  4DJA A;  4R8H A;  3W3C A;  2MW8 A;  1JTX A;  3BQY A;  4RAY A;  1XDS A;  2Y0S N;  4NUB A;  1MBF A;  3GTM J;  3L2R A;  4IKF A;  4HDU A;  1K6Y A;  4E70 A;  1ZAO A;  3M07 A;  4P55 A;  2OQG A;  4KIB A;  2V26 A;  3K2A A;  2FF4 A;  3HSR A;  1D1A A;  4LG3 A;  4WXD A;  1IV8 A;  3ZMT A;  1OLT A;  2STT A;  1U8B A;  3S3O A;  2CW7 A;  4CYC A;  1DDN A;  5KHD A;  1W0U A;  1P92 A;  4PJL A;  2MLK A;  1MSF C;  2KIF A;  4RBO A;  3KYD B;  1IXR C;  4BU2 A;  3ZMD A;  5CVV A;  3GLL A;  1T39 A;  2XB5 A;  2QBY A;  4D5F A;  2ZC2 A;  1R36 A;  3OYC A;  4M73 A;  5DM6 F;  1OJL A;  2E36 A;  2PI0 A;  4AVZ A;  4YFX F;  3MKZ A;  2STW A;  1IRZ A;  4EGY A;  4NBQ A;  1EKE A;  1B9M A;  4IHW A;  1XSV A;  3TW6 A;  4RLF A;  1MBH A;  3CP8 A;  3G1M A;  2XSJ C;  5K7Z A;  1YJ9 I;  1AHD P;  4HOB A;  1MBG A;  2XRL A;  2M7A A;  2JK3 A;  2LDU A;  3CJR B;  2M3A A;  3ZOB A;  4FX0 A;  2DA7 A;  3C18 A;  3ASN H;  4IQJ A;  2CUF A;  2HYG D;  5JFR A;  1O7L A;  4CCN A;  2UXX A;  3WU0 A;  4X6A J;  5J1Y A;  1KU9 A;  5LFA A;  4I09 A;  2C6Y A;  5DDG A;  2HTS A;  4Y15 A;  1KU7 A;  1HW2 A;  2XSD C;  4CCL A;  2GXB A;  2LRD A;  2EIJ H;  1FOX A;  3FXJ A;  2ZJP F;  1ZYR F;  1P7J A;  3JRH A;  2OZ6 A;  1YW8 A;  2V9P A;  1OR7 C;  1JHF A;  4HAM A;  3KYL A;  2MYS A;  1LKX A;  4BY7 J;  4E7L A;  2VUM J;  3G73 A;  2XAS A;  2IPQ X;  1YI2 I;  4IRH A;  2XGD A;  5C4J J;  4XLC A;  2DTZ A;  3IV5 A;  5A2Q K;  2OBP A;  3I3L A;  4G7Z F;  1ENH A;  1R4M B;  3ML6 A;  1V4R A;  3GTL J;  2O3F A;  3VYR B;  4UV9 A;  1TWG J;  2PN6 A;  3KLO A; 
#chains in the Genus database with same CATH homology
 2M87 A;  3DEU A;  4OMY A;  1I5Z A;  1HKT A;  2HR3 A;  2Y0M A;  3FXR A;  3VEP A;  5LRS A;  5FD5 A;  1ZH5 A;  1WKM A;  3NRV A;  3TO6 A;  5DCF A;  3FF5 A;  4EQQ A;  4KN7 X;  2EA2 A;  3J81 K;  2QVO A;  3K1P A;  5DYM A;  1JXS A;  3PQJ A;  5H20 A;  5H6R A;  2XKO A;  3LA7 A;  1MJB A;  2QBY B;  2H6B A;  1R00 A;  3ZQ7 A;  4Y17 A;  3ZP5 A;  4WCG A;  1MJA A;  4LK1 F;  2DQR A;  4MQ9 F;  1GXQ A;  4A6E A;  4WWC A;  1Z6R A;  4O3M A;  4ESJ A;  5BQT A;  4HZF A;  2OD5 A;  1ZLJ A;  1IAW A;  4QWQ A;  2UWM A;  1FSH A;  1FP2 A;  2F5F A;  2ISZ A;  3T8R A;  4L0Y B;  2RVC A;  3KP2 A;  1HW1 A;  4LB6 B;  2L4A A;  1J7K A;  1FBS A;  3QP6 A;  1G4D A;  4IHT A;  4D0P A;  5J6X A;  1S3J A;  2FNA A;  1ODD A;  2V1U A;  3KLN A;  3CJN A;  3GVA A;  5D5U B;  4IF4 A;  2EV5 A;  1HST A;  4NB5 A;  5HOO A;  1QGP A;  3WGI A;  1J2X A;  1D3Y A;  1V3F A;  3BY6 A;  1Z91 A;  2IT0 A;  5JHU A;  2O8X A;  3RKW A;  2WC2 A;  3ISP A;  3R0J A;  3F6V A;  4IRG A;  4ENM A;  2DAO A;  2QWW A;  3I5U A;  5CVU A;  1XDU A;  2HTJ A;  1TTY A;  2EFN A;  3REO A;  3CO6 C;  4MTE A;  1T0F A;  5HS7 A;  4CYD A;  4G7O F;  3ELK A;  2NNY A;  2EFW A;  1TQM A;  1F9N A;  3P9I A;  4HQE A;  3MZY A;  3F8F A;  4S04 A;  1IF1 A;  3F8N A;  3Q9S A;  4XSZ F;  5EEG A;  3TQN A;  4B09 A;  2IJL A;  2IVM A;  4AVP A;  5A2Q Z;  2XIG A;  5BS6 A;  2Q2E A;  3DQV C;  4Q48 A;  2GA1 A;  3FWE A;  4BXU A;  2FA5 A;  1IRF A;  4RGU A;  3DPT A;  4L9V A;  4I01 A;  3QAH A;  5HDN A;  1VTN C;  4ZH4 F;  5BPD A;  3CDH A;  2P5L C;  2KKO A;  2FE3 A;  1YIO A;  2JRT A;  4BAY A;  1S7O A;  2DW4 A;  1WQ2 A;  1B59 A;  2EFO A;  1RUN A;  3L09 A;  1ONV A;  3H3U A;  1SD7 A;  3EQL F;  4G9Y A;  5E1X A;  3I54 A;  3J81 Z;  5LHG A;  4ASN A;  4EJO A;  4EVI A;  2IA2 A;  1FBU A;  2A07 F;  1KQ8 A;  1FP1 D;  3GXO A;  3HSE A;  5F6F A;  3HTS B;  2MD5 A;  5HDG A;  3MAJ A;  3GO5 A;  1LB2 A;  2Q0O A;  4BYY A;  3E5U A;  5D8K B;  2EJR A;  1REP C;  4EM1 A;  2ZCW A;  4UVB A;  5CVI A;  3HOT A;  1FWZ A;  4XLP F;  2OZU A;  3GFJ A;  1CF7 A;  2YX7 A;  3FMQ A;  4JBA A;  4WXH A;  4UNO A;  2G7H A;  2EWN A;  4KIG A;  2D45 A;  4YFN F;  1HBX G;  5LBQ A;  3IKT A;  4UVC A;  3EUH A;  4L18 B;  4GYI A;  1MJ9 A;  3VFZ A;  1J59 A;  1ZN2 A;  2BV6 A;  2COM A;  3BWG A;  3R0A A;  3FZV A;  3JW4 A;  1S7A A;  3LAJ A;  2RGV A;  3HRM A;  1LVA A;  4A0Y A;  2QLZ A;  3ZPL A;  4Q47 A;  1L0O C;  3WTU C;  1XCB A;  4BHB A;  1YO5 C;  1PDN C;  4HYE A;  3KZZ A;  2PLY A;  5L3C A;  2ADU A;  2FML A;  3M8F A;  2D1V A;  2JPB A;  1FLI A;  3V8K A;  4RGX A;  4XLN F;  2VBZ A;  2CG4 A;  4M9X A;  1S8N A;  3Q5F A;  4WXC A;  3EYI A;  2K4J A;  1BBY A;  4CHU A;  3K0L A;  4O6J A;  1ON2 A;  5D6E A;  2XKP A;  2VBW A;  2HOE A;  3MQ0 A;  1R23 A;  4KN4 X;  4KMU X;  3FHZ A;  2KIU A;  1JGS A;  3L9F A;  4A12 A;  1XD7 A;  4A5N A;  1G3Y A;  1EH7 A;  5CVJ A;  1MDM A;  2E1N A;  5DV5 A;  4EM0 B;  3V7R A;  1CF7 B;  1FZP B;  2FQ3 A;  5K5R A;  5D4R A;  3IHU A;  4IPA A;  2F2E A;  5AIP A;  4CIC A;  4RB2 C;  4P9U A;  4L9J A;  2JZY A;  4LK0 F;  2W84 A;  3I53 A;  1K7A A;  2A3S A;  4Z2Y A;  4A2U A;  1BIB A;  4AWX B;  1YLF A;  2HWV A;  4L5J A;  4L5I A;  1BM9 A;  3VB2 A;  3C1D A;  5LRR A;  3COA C;  1DP7 P;  3FXQ A;  4HX4 A;  1QBJ A;  1R5G A;  3LA2 A;  5ICE A;  2LF7 A;  1USS A;  1MGT A;  2OU2 A;  4U7D A;  2EFP A;  4A0X A;  1I6X A;  4H0E A;  3J7A O;  4ETS A;  4JQF A;  2FSW A;  1LDD A;  1YS7 A;  2MC3 A;  2NRA C;  2X0L A;  1YYV A;  2JSC A;  5FFX A;  4G94 A;  3GUD A;  2M30 A;  1BN5 A;  4MEX F;  1MDM B;  1XGO A;  5ED4 A;  5FGM A;  1F4K A;  1K78 A;  2M8E A;  4ZZL A;  2E1C A;  4KUM A;  5ERI A;  1FOK A;  4K2E A;  4MGR A;  4P5O A;  2WTE A;  3IWF A;  1C0W A;  4NQW A;  2VOD A;  2P4W A;  3KEO A;  4PDK A;  3E6B A;  3WGH A;  1SFE A;  2M1B A;  2BGC A;  2H09 A;  2RV8 A;  3PQK A;  3GZ5 A;  4N9I A;  2MA3 A;  2CQK A;  3CO7 C;  2XAQ A;  5EEH A;  4LFU A;  1P4A A;  2DBB A;  1P4X A;  3RI4 A;  4MQV A;  3TDZ C;  4A6D A;  2A5Y B;  2XRO A;  1Z7U A;  1FNN A;  1P6R A;  3DKW A;  3RIR A;  2NNN A;  3CLO A;  1H0M A;  1Z9C A;  2GXG A;  4RAZ A;  1QO0 D;  3WTX C;  4N9H A;  3DPL C;  1S6L A;  3V8J A;  2V9V A;  1XCV A;  1TQI A;  5LGN A;  4XBF A;  2EB7 A;  3F6O A;  1IRG A;  2V1X A;  3DXJ F;  4MEY F;  3K1N A;  5FLX K;  3GZ6 A;  5E8G A;  3WTZ A;  1P2F A;  4GO1 A;  4LGW A;  2VE8 A;  3V7S A;  2QEN A;  5F64 A;  1FYL A;  1U5T A;  1K78 B;  3WG9 A;  4YFK F;  3O2P E;  1AWC A;  2XAF A;  1DPU A;  5K1Y A;  5L3G A;  2FEZ A;  2H94 A;  2PJP A;  3F21 A;  5D5X B;  3HOS A;  1OYI A;  1O3T A;  1DUX C;  4AIK A;  5ILV A;  2V6C A;  1QQI A;  4UUV A;  3C7J A;  2OQR A;  3P9C A;  5E1W A;  4KDP A;  5L3F A;  2FNP A;  3RYR A;  4LLG F;  4B8X A;  4OIO F;  1SMT A;  3OV8 A;  4HV5 A;  1SFU A;  3LQQ A;  3G3Z A;  1HQC A;  3RKX A;  2UXN A;  2Q8K A;  3V4G A;  5HLG A;  3KZY A;  2XHK A;  3RKY A;  4LLL A;  1UHM A;  2M45 A;  3MWM A;  4ON0 A;  3ULQ B;  4P9F A;  1LDK B;  1G3S A;  1BC7 C;  4ZYH A;  1FYM A;  6PAX A;  5ILU A;  2E7X A;  3QRF F;  1OPC A;  3L2C A;  3R61 A;  2P8T A;  1LJ9 A;  2VC1 A;  1U5T B;  4G8X A;  1IZ1 A;  1QNT A;  1SD5 A;  5LGU A;  4HF2 A;  1B1B A;  3HYI A;  4R79 A;  2GA2 A;  3DP7 A;  4KFC A;  1OYW A;  4R1H A;  2DK5 A;  2ZME A;  1H9G A;  2FOK A;  4YG2 F;  2VOO A;  3PFI A;  3M9A A;  1T2K A;  5LHI A;  2HKX A;  2LF8 A;  2QZ8 A;  1QZY A;  3GEZ A;  5ICC A;  2VOP A;  5HS9 A;  5FLX Z;  3F3X A;  3I4P A;  4KNY A;  2XAH A;  3GYH X;  3KEQ A;  3EDP A;  3IKV A;  2GIV A;  2DPU A;  3WTW C;  1BIA A;  4CDG A;  1OKR A;  4RB3 C;  2F5E A;  3I59 A;  1IN8 A;  1HSJ A;  2O0Y A;  4OIN F;  3TO7 A;  3HSF A;  2Y75 A;  2TDX A;  1IXC A;  5AON A;  2CWE A;  5KVR A;  1G3T A;  4BNC A;  2Y48 A;  1W5T A;  4KA4 A;  2E7W A;  4G6Q A;  3W6K B;  2VBY A;  2D1H A;  5J8F A;  2LKP A;  3ZMU A;  4PGH A;  1LEB A;  3BPX A;  1Z05 A;  1XGS A;  3ZN1 A;  1SFX A;  1Y0U A;  5D4S A;  2ELH A;  2LNB A;  1ZRD A;  2FRH A;  2IW5 A;  2XGX A;  2GAU A;  3GW2 A;  2GWR A;  2IA0 A;  3SZP A;  4I2O A;  3BJO A;  2DT5 A;  2O6G E;  2IRF G;  1U2W A;  3ZMZ A;  2P7V B;  4LLN A;  1KGS A;  1XB4 A;  2WWY A;  2VN2 A;  2GQQ A;  1ZRC A;  5LEK A;  5LGT A;  2ZME B;  4U0W A;  3LST A;  2RQP A;  2P5V A;  2PBI A;  2QQB A;  2A69 F;  2NYX A;  5BMZ A;  5HVQ C;  4ZZD A;  5E17 F;  3WOD F;  2ZXJ A;  3I64 A;  5L3E A;  1YTY A;  2CGP A;  2PQ8 A;  1W5S A;  2W24 A;  4WK8 F;  2YU3 A;  4FT8 A;  3F8B A;  3I59 B;  4HDV A;  5JI6 A;  2BE5 F;  5IT9 K;  3LAP A;  3F8C A;  1H9T A;  4LG0 A;  2L4M A;  4L0Z B;  3I71 A;  2Z33 A;  2PMH A;  2YSR A;  1OYY A;  3IRQ A;  2R7F A;  1X3U A;  3QU3 A;  2Z99 A;  3TO9 A;  3KP4 A;  2ZO4 A;  2G9W A;  1XGM A;  1R58 A;  3E6C C;  2FBI A;  2W57 A;  1CGP A;  4WX9 A;  4AIJ A;  4OU0 A;  5IT3 A;  4MTD A;  3CUQ A;  2ZNY A;  2HDC A;  3HTU A;  4HLY A;  2MBF A;  2Z5U A;  5CJ9 A;  4PCQ A;  1BI2 A;  3GWZ A;  1R1V A;  2AXL A;  2A68 F;  1NHA A;  2CYY A;  5FB2 A;  2VC0 A;  5K5O A;  1LDJ A;  4OIQ F;  4KYW A;  4HX8 A;  1FC3 A;  3KP5 A;  4ZYE A;  3GFM A;  1U8R A;  4L9T A;  4HBL A;  4A5M A;  2HZT A;  2P6S A;  2FMY A;  3DF8 A;  3N4M A;  1O3S A;  4ZYD A;  1BI1 A;  3HHH A;  4PGG A;  1K6O A;  3SQN A;  1O3R A;  1ZGA A;  3KFW X;  3FX3 A;  1KU3 A;  5K5Q A;  3K1M A;  4LG0 B;  1DPR A;  2BYV E;  2JTV A;  3E6M A;  3LA3 A;  1SD6 A;  2HEO A;  3U2R A;  1O3Q A;  1UHW A;  3KP3 A;  2CO5 A;  1TW3 A;  2XUB A;  2EV6 A;  3FXU A;  1JHH A;  1J75 A;  1O7F A;  2ESN A;  4HLX A;  4RGR A;  1LEA A;  2L02 A;  4EMS A;  4ZYG A;  3LQR A;  1E2X A;  2YR2 A;  1PUE E;  4Q4Z F;  3CUQ B;  2A6E F;  3BDD A;  5F1R A;  5J8C A;  1HKQ A;  1G6N A;  4M9S A;  4UHT A;  4EV0 A;  2XV4 S;  5D5W B;  3VOE A;  2QQ9 A;  3JAM K;  5IT9 Z;  1U5T C;  3NQO A;  1ZRF A;  1I1S A;  3WGG A;  4BQA A;  2XAG A;  1A04 A;  5CYV A;  3K9T A;  2W25 A;  1YFH A;  3SXY A;  2KJC A;  3M7G A;  4HQM A;  1IXS B;  3R4K A;  4EJV A;  1FX7 A;  3ZN0 A;  2J5P A;  3MFK A;  1R7J A;  3H3Z A;  3TOA A;  3QOP A;  3F22 A;  3KCC A;  2JPC A;  2W85 A;  2M5W A;  4EGZ A;  3HRT A;  1ULY A;  2UZK A;  3LWF A;  1TNS A;  1O57 A;  1R1U A;  3AAF A;  1FBQ A;  2J5O A;  1L3L A;  1YS6 A;  3D0S A;  1J9I A;  1SAX A;  4FHT A;  1PP7 U;  1W7P D;  4M71 A;  5E8I A;  3FM5 A;  3P9K A;  4U7B A;  1R22 A;  2JT1 A;  2L54 A;  3HHG A;  1UST A;  3ERE D;  5LHH A;  3EET A;  1SD4 A;  1UB9 A;  1GVJ A;  2R7D A;  1YG2 A;  1XMK A;  2K7L A;  3BJA A;  4LD5 A;  2QUF A;  3M1E A;  1RUO A;  3W6J B;  3F8M A;  3DV8 A;  4GGG A;  1G3W A;  2VE9 A;  5HLH A;  2DFI A;  2O61 A;  5DUK A;  3RDI A;  2IA1 A;  3RYP A;  3TKY A;  1ZG1 A;  1QZZ A;  3GX4 X;  5ICF A;  2BBY A;  4JK1 X;  4G7H F;  4DQ2 A;  1ON1 A;  5DEQ A;  3MEX A;  2P7C B;  2L3D A;  2XRN A;  1RZ4 A;  3R6S A;  3Q9V A;  2PFB A;  2PMU A;  2EFQ A;  4LJZ F;  3WTT C;  5E20 A;  2DQL A;  2CFX A;  1RNL A;  1FY7 A;  3E5X A;  3KP7 A;  3HUG A;  4U88 A;  3BP8 A;  2KRF A;  3I0T A;  2QYO A;  4NHJ A;  2R3S A;  3H92 A;  2Z9O A;  4ESF A;  3DFG A;  3RPQ A;  1ZAR A;  1T38 A;  1QPM A;  2ETH A;  3E5Q A;  3O6B B;  2L01 A;  4I02 A;  2RC4 A;  5L3B A;  4U0Y A;  3GF2 A;  4RB1 A;  5D6F A;  1RI7 A;  3L7W A;  3JAM Z;  4A0Z A;  1W4M A;  1W7P A;  1ZHF A;  3F72 A;  2P5K A;  3QPT A;  4KIC A;  2CW0 F;  2KIM A;  3BPV A;  1KQ9 A;  5H6Q A;  4BH9 A;  5AIQ A;  2HGC A;  5E18 F;  1JE8 A;  5HLI A;  2HKO A;  3F23 A;  4F7Z A;  5DCM A;  3CTA A;  2NAZ A;  5LLQ A;  3P7N A;  2A6H F;  4FX4 A;  3WTS C;  3TOB A;  1MKM A;  3JSO A;  3U9G A;  4CXF A;  1ZG3 A;  3TGN A;  3QPH A;  2RN7 A;  4IHS A;  4IXA A;  1K79 A;  5TJJ A;  2VBX A;  2QQA A;  1XN7 A;  2XVC A;  4HA8 A;  4ESB A;  1TNT A;  3E97 A;  4ENK A;  3V8L A;  1TW2 A;  1HXD A;  2DLL A;  1EH8 A;  5HDK A;  3IWZ A;  1E17 A;  2K02 A;  2MLG A;  1FYK A;  1BI0 A;  4UXN A;  1YW7 A;  1R1T A;  2H6C A;  1GHC A;  3E3V A;  4N0B A;  3ECH A;  2HS5 A;  5ICG A;  1KYW A;  1S29 A;  3M8E A;  4IVN A;  1U78 A;  1FSE A;  2ISY A;  3SZT A;  3T0Y A;  4AIH A;  4YIF A;  1TQP A;  1HKS A;  4I98 B;  1Q1H A;  1U6G A;  5D8L B;  3LFK A;  1OR7 A;  4RS8 A;  1XMA A;  2RKH A;  1W7P B;  3EYY A;  3R60 A;  3HIF A;  1IW7 F;  1ZRE A;  1TLH B;  2YPR A;  3O3K A;  3I58 A;  2DI3 A;  2F5D A;  2FXA A;  2ZBK A;  5D5V B;  3ZMS A;  1F1Z A;  5TRD A;  4CGZ A;  3GFL A;  2ESH A;  4DNC A;  5DCM B;  2ZKZ A;  1OMI A;  4OIR F;  1ZGJ A;  2HQN A;  4BHC A;  4M6X A;  3B02 A;  4I0A A;  4EJW A;  4HF0 A;  2FBH A;  3GLX A;  2ZNZ A;  4O5V A;  2DO7 A;  3CUQ C;  2YX4 A;  1D8K A;  1I27 A;  1SMY F;  3FMR A;  1HW5 A;  1KA8 A;  2OAZ A;  4L9N A;  1XGN A;  1KYZ A;  1MZB A;  4M6Y A;  4KIF A;  3ABT A;  2DU9 A;  3KP6 A;  3K2Z A;  2HFH A;  3ECO A;  5FFZ A;  4MNU A;  3J80 K;  1LNW A;  2WV0 A;  1BI3 A;  3ROU A;  2K4B A;  3U1D A;  4M74 A;  1FPQ A;  3MZH A;  4I7H A;  3HRS A;  3SHF A;  2Z3Y A;  1IUY A;  3BRO A;  2GZW A;  4RGS A;  2PEX A;  3IL2 A;  3T5X A;  5DD8 A;  1Z1D A;  4MHG A;  4G6D A;  4EJT A;  4M72 A;  2RNJ A;  3T8T A;  5E1Z B;  3HRU A;  4CZZ A;  2D2W A;  4GYG A;  4GXO A;  4QLC U;  1B4A A;  2BEO A;  2ZFW A;  1T6S A;  5DUI A;  4LB5 A;  4IJA A;  2G7U A;  1B9N A;  1J0R A;  2FU4 A;  4YII A;  1UCR A;  4AD9 A;  1EV7 A;  1R5H A;  2VON A;  3QU6 A;  1WI9 A;  4BHP A;  1PP8 F;  4M9Z A;  3WE2 A;  4PZJ A;  4ENJ A;  5CVR A;  4XRF A;  1EH6 A;  3RPU A;  3SFZ A;  3RTR A;  2EA4 A;  4EM2 A;  3WU1 B;  3ABU A;  5FD6 A;  2F5C A;  1GXP A;  1IN7 A;  1KU2 A;  3WE3 A;  3VOD A;  4U0V A;  3K69 A;  3BOQ A;  3E6D A;  3MCZ A;  3JTH A;  5LEJ A;  2KJB A;  4OMZ A;  1WRJ A;  5HS8 A;  1XSD A;  5FO5 A;  4XSX F;  2AS5 F;  5JVT A;  2HYF A;  2HQR A;  3CUO A;  1D5V A;  2A61 A;  2RDP A;  1KQ0 A;  4HX7 A;  4Q5S F;  1FT9 A;  4EJU A;  4S05 A;  2MH9 A;  3GFI A;  5CLS A;  1BOA A;  2X4H A;  4OIP F;  2IP2 A;  2ACJ A;  1AOY A;  3OOP A;  5BOX A;  5DD4 A;  2MH2 A;  4WF2 A;  3J80 Z;  5BPI A;  4OOI A;  3B73 A;  3T1B A;  3FM3 A;  2DPD A;  3RJP A;  3L00 A;  1MD0 A;  4HW0 A;  4Y13 A;  4KMF A;  3IC7 A;  5JR3 A;  1YQA A;  2DK8 A;  4RB0 A;  3TDU C;  4ENN A;  1STZ A;  3JSP A;  4HV6 A;  2K86 A;  1UFM A;  1D8J A;  2O03 A;  4KT5 C;  1TBX A;  3C3W A;  2ZJ2 A;  2EV0 A;  4P96 A;  2DTR A;  4TV7 A;  5KK1 A;  3QP5 A;  4UVA A;  2PG4 A;  2XAJ A;  3NEU A;  3BZ6 A;  2V79 A;  2NS0 A;  1T98 A;  4GCV A;  1XSX A;  1RIO H;  1YW9 A;  4LMY A;  2EK5 A;  1B6A A;  4I0B A;  1WSU A;  1Z6T A;  1BC8 C;  3D5L A;  3JTG A;  4UV8 A;  3WTV C;  2VT3 A;  3ZMV A;  3N97 A;  3V7C A;  1LQ1 A;  3WTY C;  1IN4 A;  3FMS A;  1ZLK A;  3KET A;  3IRR A;  3KE2 A;  2H27 A;  4IRI A;  2VT2 A;  2P6T A;  1F5T A;  1P4W A;  1U3E M;  2VXZ A;  2V1D A;  2FBK A;  5L3D A;  4CO8 A;  2LSO A;  4HF1 A;  1BJA A;  1J5Y A;  2OA4 A;  2B0L A;  2CSO A;  1WWX A;  2QM3 A;  3BJ6 A;  1IN6 A;  3S2W A;  1I1G A;  1IN5 A;  5ILS A;  1ZG5 A;  2K27 A;  4R8H A;  4RAY A;  1XDS A;  4HDU A;  4E70 A;  1ZAO A;  4P55 A;  2OQG A;  4KIB A;  2FF4 A;  3HSR A;  4WXD A;  3ZMT A;  2STT A;  1DDN A;  1P92 A;  2MLK A;  2KIF A;  1IXR C;  3ZMD A;  5CVV A;  1T39 A;  2QBY A;  1R36 A;  4M73 A;  2PI0 A;  4YFX F;  2STW A;  4EGY A;  1B9M A;  1XSV A;  4HOB A;  2LDU A;  4FX0 A;  3C18 A;  2HYG D;  5JFR A;  1O7L A;  2UXX A;  3WU0 A;  1KU9 A;  4I09 A;  2C6Y A;  5DDG A;  2HTS A;  4Y15 A;  1KU7 A;  1HW2 A;  2GXB A;  1ZYR F;  2OZ6 A;  1YW8 A;  1JHF A;  4HAM A;  3G73 A;  2XAS A;  2IPQ X;  4IRH A;  5A2Q K;  2OBP A;  4G7Z F;  3ML6 A;  1V4R A;  2O3F A;  4UV9 A;  2PN6 A;  3KLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...