3K0LA

Crystal structure of putative marr family transcriptional regulator from acinetobacter sp. adp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator from Acinetobacter sp. ADP
rcsb
source organism Acinetobacter sp. adp1
molecule tags Transcription regulator
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k0lA00
1Y0UA 1FOKA 1OR7A 4GCVA 4UNOA 4I0AA 2HOEA 1IF1A 3RIRA 4I01A 2DPUA 1FNNA 4HBLA 4A0YA 2K7LA 3LA7A 4EJOA 1WWXA 2Q2EA 5LRSA 1GHCA 3GFMA 4A0ZA 4YIIA 2DLLA 2VBZA 1BIAA 1PP7U 1ZRCA 3WTTC 2FU4A 4MHGA 2HTJA 3WGGA 2P8TA 3C1DA 2BGCA 3TOBA 2YSRA 3G3ZA 3EDPA 5CVUA 4ZZLA 1XGMA 1TW2A 1YG2A 4OU0A 3CO6C 1J0RA 5BPIA 1J59A 1X3UA 5CJ9A 1H9TA 3DP7A 3M9AA 4MNUA 3ABTA 4IF4A 2G7UA 5DCFA 1WKMA 4EJVA 3F8MA 3I59A 2IT0A 3RKXA 5K5RA 3DFGA 4QWQA 3E6DA 2P7VB 4EM0B 4PCQA 3B73A 3MQ0A 4DNCA 5DD8A 2RN7A 2VBXA 1U5TA 1J5YA 5BS6A 4U0YA 3Q9VA 4U7BA 1XGOA 4EQQA 2H6BA 5ED4A 5D5UB 3WTVC 4ENNA 5FO5A 1R1VA 2ESNA 2ZNYA 4LLNA 3BJAA 2DU9A 1ZH5A 1WI9A 1OMIA 3GVAA 3MAJA 3FXRA 4N0BA 2VT3A 3J81K 2MLGA 1IAWA 1Z6TA 2A6EF 3I0TA 2V1DA 2Q8KA 4HF0A 2QBYA 2W57A 1IZ1A 2COMA 1W5SA 4MEYF 2HFHA 1W5TA 4OIOF 3NRVA 2DI3A 1H0MA 2L4MA 4H0EA 2CFXA 3GF2A 5CVVA 5H20A 4RS8A 1IN7A 1JGSA 5D5WB 2M5WA 2QVOA 2RV8A 3U2RA 2JPBA 3ZMVA 3GW2A 2CGPA 3E97A 1SMYF 1BBYA 2OQGA 2XHKA 3HSRA 2V6CA 2ELHA 1IUYA 1RUOA 2R7FA 1UHMA 1R1UA 2PBIA 2O0YA 1SD5A 2FMLA 4OIPF 1XGSA 4O5VA 3GX4X 1DPUA 3R0AA 3VOEA 1K79A 3ZQ7A 3PQJA 4FT8A 1UCRA 2MH9A 1YTYA 1YW8A 2P6TA 1WQ2A 5IT9K 2F5FA 3GWZA 5H6RA 2KRFA 5LEJA 3RYPA 1G6NA 2ADUA 3MWMA 5TRDA 1FYMA 2IW5A 3HSFA 3I54A 2DQRA 2XAGA 4CXFA 2EB7A 3IC7A 3SXYA 3M8EA 3LAJA 4FX0A 1O3QA 4KFCA 5HS8A 2VE8A 1FWZA 3HRUA 4PDKA 3GEZA 1XDUA 1XGNA 3JSOA 4GO1A 4ENKA 2WWYA 1ZAOA 4XSZF 3RPQA 2BV6A 5LBQA 2MC3A 1F1ZA 4B09A 5LLQA 3F8BA 3E3VA 1ZLKA 2D2WA 5ILSA 1GXQA 3HUGA 4ESFA 3KP6A 3P9CA 2OD5A 1QPMA 3Q9SA 2XASA 2VOOA 3I53A 1W7PB 4MTEA 2Q0OA 1DP7P 3BDDA 3TQNA 5A2QZ 2O03A 2RNJA 3R0JA 2IPQX 1KQ9A 5F1RA 3BP8A 4A0XA 3ZN1A 1FSHA 4KIGA 3KP7A 2P5KA 1SD6A 1JHFA 3R6SA 1G3TA 2KJCA 5FD5A 3G73A 1B4AA 1UB9A 5BMZA 4BHPA 2K02A 3JAMZ 3DXJF 1S3JA 1F5TA 4WCGA 4LK0F 2A07F 4ENMA 3BOQA 2K4JA 2AXLA 2FE3A 1I5ZA 4U0WA 1AWCA 4AIJA 4OIQF 3GFIA 4EJTA 4WK8F 2V79A 3C18A 4L18B 1S7OA 3P9KA 4Y13A 4MTDA 2OZ6A 2WV0A 5K5QA 2HTSA 2P6SA 4UUVA 5DYMA 1QGPA 2XIGA 5BOXA 2XKOA 4OOIA 2QZ8A 1O7FA 3LA3A 1LB2A 3DV8A 3R60A 3FM5A 1KGSA 3KFWX 4KN4X 3LQQA 3HRSA 1IN4A 3TGNA 5CLSA 5J8CA 3RKWA 2W25A 1J7KA 2DT5A 5HS7A 2DFIA 4JK1X 1MDMB 4HX4A 4U88A 2O61A 3QAHA 3CUQB 1HSTA 2L4AA 4EJUA 5D5VB 3LAPA 3J80Z 3W6JB 3L2CA 5L3DA 4XLPF 4HF1A 4KUMA 2QYOA 1EH8A 2XGXA 4ETSA 3IKVA 4O6JA 3TO9A 1IRFA 4QLCU 1HQCA 2XUBA 5FFXA 2K4BA 2NNNA 2VE9A 1O3RA 3KP5A 1ZG5A 2FQ3A 1ONVA 3B02A 3TO6A 2VODA 3RI4A 4EGYA 2RDPA 1WSUA 2VBYA 4CGZA 3I64A 1TW3A 1SAXA 1BOAA 4HX8A 1G3WA 2KIMA 4JBAA 1ULYA 3F8NA 5FB2A 2LNBA 4UHTA 2DBBA 1T6SA 4WXCA 4G7ZF 1P4AA 1XSXA 1ODDA 4G9YA 1ZGAA 4G7OF 4HA8A 1CGPA 1YIOA 1Z1DA 2QQBA 1C0WA 4WX9A 2J5OA 1MJBA 4ZZDA 3BJOA 1PDNC 4AIHA 1B1BA 4N9HA 1ZYRF 5HDKA 3E5XA 2XAFA 2UZKA 2F5CA 3ML6A 3WG9A 3K1NA 4WXDA 1SD4A 3WU0A 3E5UA 3K1MA 1ZHFA 2DO7A 3L9FA 4OIRF 3D0SA 1QO0D 2Y48A 1IW7F 5J8FA 1BI2A 2Z99A 4IPAA 2B0LA 4CZZA 2VC1A 3F6VA 3WTXC 3OV8A 3REOA 1I1GA 4M9SA 4KYWA 1I27A 2KIFA 1W4MA 1BI0A 5DV5A 3LQRA 3IWFA 5ICEA 1VTNC 1MD0A 1XMAA 5D6EA 2QQAA 3ELKA 5BQTA 3EYIA 1Z7UA 4ESBA 2A3SA 2CG4A 2YU3A 2BBYA 2L3DA 1KYZA 1HBXG 4LD5A 2EV0A 1QZZA 5L3BA 2W85A 2F5EA 1KU2A 1BI3A 3I5UA 3V7RA 3M8FA 3HOTA 2EJRA 3L00A 4GYIA 3DF8A 4YFKF 3K9TA 3GLXA 2PG4A 4HLYA 3CUOA 1LEAA 2VN2A 3CJNA 2XAHA 2RGVA 4EM1A 4R8HA 4L9JA 5LGUA 4DQ2A 4P9UA 4KNYA 1QBJA 3EYYA 2R3SA 4LG0A 3MFKA 3F8FA 1OYIA 1IN5A 4LFUA 2P5VA 1KQ0A 1HSJA 2WTEA 3WODF 4MGRA 4IXAA 2W84A 2PMHA 1YW7A 2O8XA 1KU3A 2NNYA 1D8JA 2GIVA 2IA1A 3CLOA 3D5LA 5HLHA 3T5XA 3E6MA 5F6FA 2H94A 3WE3A 1MJAA 2X0LA 1MKMA 3W6KB 1RNLA 3I58A 1HKQA 3V8LA 4LK1F 2QQ9A 5IT3A 1XB4A 1FX7A 1YYVA 1ON2A 4ON0A 3F3XA 4RB0A 4JQFA 2VOPA 4Y15A 2DQLA 1RI7A 3J80K 4PGHA 3HRMA 4P5OA 4L5JA 4L9VA 4IRIA 3ZMZA 1IXCA 3BY6A 4KIBA 4KN7X 3GXOA 2IA2A 5JHUA 1P4XA 3GZ5A 1YLFA 4GXOA 5ICFA 1IN8A 3DQVC 4HF2A 2RKHA 4OMYA 1D8KA 2Z33A 5FFZA 3V8KA 3BJ6A 2DPDA 1REPC 2F2EA 4YIFA 5AIPA 1T2KA 5K5OA 2JTVA 4M72A 1LNWA 1ZARA 4LGWA 1BI1A 4Q5SF 1O3TA 5LHGA 2ISZA 2QENA 5E8GA 3WTUC 1XDSA 2NRAC 1UFMA 4KDPA 1TQIA 3V4GA 3ISPA 1G3SA 4AIKA 3DPLC 1JHHA 4EJWA 2Y75A 1FP2A 2NAZA 2EV5A 4RAYA 3ZMDA 4FX4A 1EH6A 2KJBA 1BM9A 2IJLA 1TNTA 2PI0A 4UVAA 4L0ZB 1XCVA 2E1CA 2ZMEA 4M73A 3N4MA 2XAQA 4PZJA 5CVRA 1SFXA 1JXSA 2DTRA 3K0LA 3ECHA 5JFRA 1PUEE 3WGHA 3I59B 3FMSA 1EH7A 3F22A 2FNAA 1LDKB 1YQAA 1MDMA 1T98A 1K78A 3TO7A 4BYYA 2FEZA 2IVMA 1U5TB 2GAUA 2YX7A 3GFJA 2OA4A 4B8XA 1FT9A 3HSEA 2IA0A 1DUXC 5BPDA 3ROUA 2PN6A 4O3MA 4GGGA 1HKTA 3FX3A 4OMZA 5D5XB 1F4KA 4OINF 3VB2A 1HXDA 1XSDA 1CF7A 2HDCA 4WWCA 2C6YA 1PP8F 3LA2A 5DCMA 4HLXA 1R5GA 3IL2A 2QBYB 1S7AA 1SD7A 3KEOA 3KE2A 1LDDA 2XV4S 2XROA 4I98B 5JR3A 1QZYA 2DAOA 4LMYA 4Q48A 3ERED 5AIQA 1IRGA 2XVCA 4ESJA 3KP4A 4LB5A 4YFNF 3COAC 2YR2A 2EFOA 3SZTA 5FLXZ 4PGGA 4G6DA 4HOBA 2ZXJA 3HHHA 2QWWA 3C7JA 2A6HF 4RGRA 3M7GA 1S29A 4AVPA 5H6QA 3O2PE 4G7HF 2L01A 4A2UA 4HDUA 2HKOA 1KA8A 4F7ZA 3FWEA 3LSTA 3F21A 1KYWA 1O57A 1ZG3A 3V8JA 4L9TA 3T8RA 4EGZA 1U2WA 1FY7A 4ZH4F 4RGSA 1U8RA 2EWNA 4M9XA 2HQRA 4KA4A 4UVCA 3K2ZA 1B6AA 5JI6A 5L3FA 2QM3A 2VC0A 2LKPA 1ZRFA 3QRFF 4UV9A 2RQPA 1ZN2A 5D8LB 1S8NA 2P4WA 1D3YA 3O3KA 1R5HA 2UWMA 4BHCA 1F9NA 5L3EA 4Y17A 2PJPA 2IP2A 2GA1A 1HW2A 1OPCA 2Z3YA 3OOPA 1HW1A 1A04A 2RVCA 4NB5A 2TDXA 1R7JA 4WF2A 2UXXA 4L0YB 3E6CC 3KP3A 2P5LC 2ZO4A 3QP5A 4BH9A 3TDZC 1P2FA 2WC2A 1R00A 3MEXA 3U9GA 1SMTA 2E7XA 2EFWA 4CICA 4GYGA 4A12A 3R4KA 1BC7C 2EA4A 2QLZA 1MJ9A 2CO5A 4MQ9F 4IHSA 1T39A 2FMYA 3K1PA 1L3LA 2RC4A 1GXPA 1LVAA 4HZFA 2P7CB 5EEGA 2G7HA 2LDUA 3TOAA 3QU3A 1G3YA 1RIOH 2FBHA 4L9NA 2XRNA 1TTYA 4EV0A 1YW9A 4Q4ZF 4BXUA 1OYYA 3EETA 3KLNA 3WGIA 3BPVA 4RB1A 1ZG1A 2GZWA 2J5PA 5KVRA 1DDNA 2GA2A 2PEXA 2ZBKA 3WU1B 5F64A 3JW4A 4U0VA 5K1YA 2NS0A 3GO5A 4BHBA 1RZ4A 1OKRA 3CDHA 2ACJA 1B9MA 1BJAA 5D4RA 2LSOA 3N97A 3JTHA 4ZYGA 1Z9CA 3PFIA 2JT1A 4BAYA 4M74A 4EMSA 1YS6A 3LWFA 5A2QK 4M6YA 1I1SA 1TLHB 2GWRA 3P9IA 1LJ9A 1YFHA 1E2XA 2CYYA 1ZLJA 5LEKA 3I71A 3KEQA 3FXQA 4YG2F 2M87A 4M71A 2STWA 5E17F 2PQ8A 2OU2A 1BIBA 2H09A 3U1DA 3HOSA 3JAMK 1V4RA 2Z9OA 4HV5A 1FBUA 5AONA 1TNSA 3ZMUA 1V3FA 4YFXF 2FSWA 3E6BA 4L5IA 2FBIA 4KIFA 3HTSB 1LQ1A 2O6GE 4HX7A 3QPTA 5FLXK 1TQMA 4XBFA 2OAZA 2HKXA 2IRFG 5D8KB 2MBFA 1GVJA 4R79A 5L3GA 3TDUC 4CO8A 3O6BB 2BE5F 2MD5A 1B59A 1XD7A 3GFLA 1K7AA 1G4DA 3TKYA 1JE8A 2OBPA 3FMQA 1P6RA 2EFQA 3JSPA 1USSA 3ZMSA 5HLGA 3QU6A 4UV8A 5D4SA 5HOOA 5E20A 1U3EM 1OYWA 1XSVA 3PQKA 3J7AO 2DK8A 4P55A 3ZP5A 1T0FA 1ZREA 2KIUA 1ZGJA 2NYXA 1BC8C 2A61A 3H3ZA 2LF7A 1IXRC 4TV7A 1HW5A 2E7WA 2VT2A 1KU9A 3FZVA 5CVJA 2ETHA 1KU7A 3FF5A 1FYKA 5E1WA 4CHUA 2V1UA 3T1BA 5FGMA 2H6CA 3AAFA 2OZUA 5E8IA 3V7CA 3HHGA 4K2EA 1LDJA 1W7PA 3WTZA 1IXSB 4KT5C 3L09A 4I0BA 1FC3A 1XN7A 1R1TA 2HYGD 3HRTA 2CWEA 3RDIA 3I4PA 2A5YB 2E1NA 5JVTA 3NEUA 2GXBA 3T0YA 2FRHA 2QUFA 2D1VA 1STZA 2JZYA 4WXHA 3BROA 2G9WA 4S05A 4G94A 2HS5A 2JSCA 2HEOA 4G6QA 4XSXF 2YX4A 2D45A 3RJPA 3V7SA 4R1HA 3VODA 2FBKA 4EM2A 1H9GA 2MH2A 4M9ZA 1J9IA 3MZYA 2YPRA 4ZYEA 3MZHA 4FHTA 3F72A 1EV7A 1HKSA 1FLIA 4UVBA 2LF8A 1ZRDA 4AWXB 4A5MA 3BPXA 4MQVA 3L7WA 4N9IA 4LG0B 1L0OC 4KMFA 3SQNA 3BWGA 1I6XA 2A68F 4A6EA 3ULQB 1Z91A 2FOKA 1Z6RA 3SHFA 5L3CA 3RTRA 2H27A 1R58A 4KICA 3Q5FA 1T38A 2HR3A 1P4WA 2CSOA 1J75A 5DD4A 1FZPB 3WE2A 2VBWA 1U78A 4BNCA 3CUQA 5ERIA 3VEPA 3IRQA 1IN6A 3F6OA 2OQRA 2PFBA 2PLYA 3H3UA 4U7DA 3MCZA 1SFEA 4KMUX 2FXAA 1FBSA 1U6GA 5CYVA 3DPTA 4IHTA 3ABUA 2KKOA 2A69F 4E70A 5LRRA 1AOYA 1R22A 4AD9A 2M8EA 2STTA 1SFUA 4HQEA 1FP1D 3HIFA 3QPHA 2R7DA 4HYEA 2DW4A 4ASNA 5LHIA 1FPQA 3QOPA 4S04A 3VFZA 3FMRA 2FA5A 2UXNA 3IHUA 4I09A 1TQPA 2K86A 1UHWA 2ZKZA 4XRFA 1K6OA 2L54A 4IJAA 3FM3A 2MA3A 6PAXA 2EA2A 1WRJA 4RGXA 1D5VA 2Y0MA 4IVNA 1FSEA 3CTAA 4ZYHA 4A5NA 4LB6B 4HV6A 5DEQA 3F23A 4RB3C 2HGCA 3R61A 5D6FA 2HWVA 2EFPA 3P7NA 4MEXF 4D0PA 4HQMA 4HAMA 2MLKA 1W7PD 2JRTA 1ON1A 5E18F 3FXUA 3IKTA 5DDGA 4NQWA 4UXNA 2ISYA 1MZBA 5KK1A 1TBXA 2ZMEB 2CW0F 1BN5A 5J6XA 5EEHA 3WTSC 3LFKA 2F5DA 5CVIA 2XKPA 2AS5F 3CO7C 4LLLA 1RUNA 5ILUA 2ZNZA 4P9FA 5ILVA 1YO5C 5HDGA 1P92A 1K78B 2FF4A 3J81Z 4BQAA 1U5TC 3KZYA 4ZYDA 3KETA 2ESHA 2K27A 3RPUA 2O3FA 1O7LA 3BZ6A 4CDGA 1O3SA 4RB2C 5ICCA 2HYFA 1E17A 3EQLF 4I7HA 3ZMTA 2EK5A 1S6LA 1USTA 1MGTA 2BYVE 1Z05A 2Z5UA 2M45A 2ZJ2A 5ICGA 3EUHA 1CF7B 3FHZA 1YS7A 2XAJA 3E5QA 4G8XA 3K69A 1J2XA 5DCMB 2DK5A 2M30A 3HYIA 4LJZF 4LLGF 2HZTA 3RKYA 5LGNA 3GZ6A 2M1BA 1R23A 2BEOA 3IRRA 3WTWC 3S2WA 2CQKA 4IRGA 3M1EA 4CYDA 2FNPA 1B9NA 3DEUA 4Q47A 3F8CA 1Q1HA 3WTYC 3SFZA 1NHAA 3DKWA 3RYRA 3KLOA 5HVQC 2ZCWA 5HDNA 5IT9Z 3ECOA 1XMKA 2EV6A 4Z2YA 4NHJA 5LHHA 1KQ8A 1DPRA 3ZPLA 4XLNF 3IWZA 4HW0A 2X4HA 4P96A 1QQIA 4HDVA 4IRHA 5HS9A 4M6XA 4I02A 5FD6A 5E1XA 1R36A 5LGTA 2ZFWA 1QNTA 3H92A 3GUDA 5E1ZB 2EFNA 4I2OA 1FBQA 2V9VA 3KP2A 1LEBA 4RAZA 3KCCA 2D1HA 2GQQA 1FYLA 2PMUA 5HLIA 2JPCA 1XCBA 2GXGA 3CUQC 3T8TA 4EVIA 2HQNA 4A6DA 3QP6A 3KZZA 2L02A 3C3WA 3HTUA 3JTGA 4ENJA 2W24A 2V1XA 3SZPA 5DUKA 2VONA 5DUIA 5TJJA 3ZN0A 4RGUA 3GYHX 3NQOA 2VXZA
chains in the Genus database with same CATH superfamily
3HJEA 1Y0UA 3MKWB 1YX3A 3K4MA 1OR7A 4GCVA 1FOKA 4UNOA 4I0AA 2HOEA 3RCOA 1IF1A 3BCAA 2A5WA 3QPSA 4M3BA 2M8GX 3RIRA 4I01A 4I6ZA 2DPUA 4BS9A 1FNNA 4NBQA 2EBIA 4HBLA 2DOAA 2K7LA 3M8JA 4A0YA 3LA7A 4EJOA 1WWXA 4A93J 4BDZA 1W1WE 2Q2EA 3PO2J 1BA5A 2CQQA 5LRSA 1GHCA 3GFMA 4A0ZA 2M7AA 4C2TA 1V54H 4YIIA 3CMAI 3H3VK 2DLLA 2E35A 1BIAA 2BY0A 1D0ZA 2VBZA 3DBRB 3PNVA 1PP7U 2V9PA 1ZRCA 4II2A 2FU4A 3WTTC 4MHGA 1TWHJ 4CCJA 3EUKL 4E7JA 3K70C 2HTJA 3WGGA 4D1QA 2P8TA 3DLAA 3KYDB 5KCMA 3C1DA 5GAGJ 2BGCA 3TOBA 2YSRA 3G3ZA 3EDPA 2NVUB 3RQIA 5CVUA 2QSHX 4ZZLA 1XGMA 1TW2A 1YG2A 4OU0A 3CO6C 2XB5A 1ZQ3P 1J0RA 2HOSA 5EF6A 4ZDOA 4HSTA 1XG1A 4PFPA 1VNDA 1JTYA 5BPIA 1J59A 1IG7A 1X3UA 5CJ9A 4DBQA 2X6YA 1H9TA 3DP7A 1MBGA 3M9AA 4MNUA 4AYBN 3ABTA 4IF4A 2G7UA 5DCFA 1WKMA 4EJVA 3F8MA 3HB9A 3I59A 1Z7LA 3PNTA 2HYJA 2IT0A 3RKXA 1JJ6C 1FTZA 5K5RA 3DFGA 1GLNA 2JK3A 4QWQA 3E6DA 3I55I 2P7VB 2QA4I 1QHHD 1YRNA 4EM0B 2XPVA 4BDYA 4PCQA 2W7NA 2M4KA 3B73A 3MQ0A 4UB8C 4DNCA 5DD8A 2GXAA 2RN7A 3AL0C 2VBXA 1U5TA 1XC5A 1J5YA 5BS6A 2G0EA 4U0YA 3ABKH 3Q9VA 4U7BA 1XGOA 2F4OB 4EQQA 4IZZA 2H6BA 5ED4A 5D5UB 3WTVC 4ENNA 5FO5A 4RM3A 1K6YA 1IDYA 3KIOA 1R1VA 1T95A 2ESNA 2ZNYA 4LLNA 3BJAA 2DU9A 1ZH5A 3TP3A 2LLKA 1PUFA 1WI9A 1OMIA 3GVAA 3MAJA 2O9LA 3FXRA 4N0BA 2VT3A 2DXIA 3J81K 2MLGA 5FLMJ 1IAWA 3QODA 1Z6TA 1G4DA 1J09A 1X58A 2A6EF 2GBYA 3I0TA 3DKYA 5EGOB 1K61A 2QSFX 3BR2A 1ZELA 2V1DA 1U9OA 3K4BA 2Q8KA 4FCYA 4HF0A 2QBYA 2W57A 3A03A 1IZ1A 2COMA 1W5SA 4MEYF 4E7HA 2HFHA 1W5TA 3DBHB 4OIOF 3NRVA 2DI3A 4XLAA 1H0MA 2L4MA 3DEEA 3PIPF 4H0EA 2CFXA 2JN6A 4HG2A 3CJTB 3GF2A 2M3AA 4BQQA 1TWGJ 5CVVA 5H20A 4RS8A 1IN7A 1JGSA 1VQ9I 3HC7A 2LP0A 5D5WB 4AM3A 2M5WA 3AG1H 4BL0B 5KNLA 2QVOA 3EUHC 4S0HB 2E1OA 3TBIA 3BR3A 2R7QA 2RV8A 3BG9A 3U2RA 2JPBA 3ZMVA 3O8GA 3GW2A 4E7LA 5IY5H 2CGPA 2R5YA 3AG4H 1EA3A 3E97A 1SMYF 1BBYA 2VB6A 3NAUA 2COBA 2LD5A 2OQGA 2XHKA 1NH3A 2VASA 3HSRA 2V6CA 2JQ7A 2ELHA 3FXOA 2WY8Q 1I39A 1IUYA 1RUOA 2R7FA 1UHMA 1R1UA 2PBIA 2DMPA 2O0YA 1SD5A 2FMLA 4OIPF 1XGSA 4O5VA 1RPWA 3GX4X 1DPUA 4XN0A 3R0AA 3SZGA 3VOEA 1K79A 2KIQA 3ERMA 3ZQ7A 3OYHA 4IOCF 2DDBA 3PQJA 4XICA 4FT8A 1VZ0A 1UCRA 2CQXA 2MH9A 1YTYA 1YW8A 4DJAA 3BQZA 1MMNA 2HOTA 2P6TA 1WQ2A 3PSIA 2AQFA 5IT9K 3ZCOA 4V2GA 1ETOA 1E3OC 2F5FA 2DMTA 3BTLA 3GWZA 5LFAA 1YI2I 5H6RA 2KRFA 4G12A 3BR5A 4XKBA 2EZLA 5E3LA 5LEJA 3AG2H 4U87A 3RYPA 1G6NA 2ADUA 3MWMA 3UR3C 5TRDA 2IW5A 1MMDA 2HI3A 1FYMA 3HSFA 2L7MP 4ANJA 1Y6IA 2EIMH 2VJJA 3GTOJ 3I54A 2DQRA 2K9LA 2NVYJ 5IP6A 3GTPJ 2XAGA 4CXFA 2JRMA 2EB7A 4F92B 3IC7A 3DCFA 3SXYA 3HPHA 1RC9A 3M8EA 3H36A 4FX0A 3LAJA 4DW6A 2CS3A 5CQEA 1O3QA 2DFFA 1TC3C 4KFCA 3W2WA 5HS8A 1OISA 1OJLA 2WY7Q 2CW8A 2VE8A 1FWZA 3HRUA 1GV2A 4PDKA 2AO9A 1LFUP 5CKTA 3GEZA 3JRBA 4X1EA 4CSWA 1JUPA 3A4CA 4PJLA 5FJ8J 1XDUA 1XGNA 1SAUA 3CF5F 3K6GA 3JSOA 3JREA 2JSPA 1LVKA 5B1AH 4GO1A 2O7OA 4XLCA 1MH3A 2WWYA 4ENKA 1ZAOA 2DYSH 4XSZF 3RPQA 4BE0A 2JVHA 2XSJC 3LL7A 2BV6A 5LBQA 2MC3A 1F1ZA 4B09A 4LOCA 1WJCA 2F5VA 3F8BA 5LLQA 2L9SA 3E3VA 1ZLKA 2D2WA 5ILSA 4QTRA 1MSEC 1CQTA 4B44A 1GXQA 3HUGA 4ESFA 1NG6A 3KP6A 3P9CA 5M5YJ 1LFPA 2M0CA 4UUSA 2OD5A 2XB0X 3ESWB 4IEJA 1DU6A 5EJCA 1JKQC 1QPMA 3Q9SA 2XASA 2VOOA 3I53A 1W7PB 4MTEA 1SVOA 3M1CA 2Q0OA 2CUZA 3BDDA 2ID3A 3TQNA 3H9QA 5A2QZ 1DP7P 2DFEA 2O03A 2RNJA 3R0JA 2PMZA 2IPQX 2HNHA 1TL8A 2LFBA 2EQRA 2V6EA 1KQ9A 5F1RA 2GLOA 1X3WB 2X6WA 3BP8A 4A0XA 4L5EA 3OS0A 3ZN1A 3Q0WA 1FSHA 4KIGA 3QQAA 3KP7A 1APLC 3CP2A 2P5KA 1SD6A 2M0MA 3WHCA 1JHFA 3R6SA 3S3NA 2VJ5A 3PNYA 1KZHA 1G3TA 2KJCA 5FD5A 3G73A 1B4AA 1UB9A 5BMZA 4BHPA 3C2HA 3OIPA 3W2VA 3SJMA 3A2KA 4W97A 3RZOJ 2FD5A 2K02A 3JAMZ 4V2FA 3DXJF 1S3JA 4IO9F 3HZJA 1F5TA 4WCGA 3U1KA 1B8IA 3LSIA 2FOWA 4LK0F 4ZDPA 2A07F 4ENMA 2LY2A 5B1BH 3BOQA 4ITVA 1WJFA 2K4JA 1KONA 2AXLA 1T08B 2FE3A 1I5ZA 4U0WA 1AWCA 1UJ8A 1YITI 4AIJA 3MZ8A 2DMQA 3CF2A 4OIQF 3GFIA 4EJTA 4WK8F 5E3NA 2V79A 3C18A 4L18B 2HVQA 1AKHA 1I6HJ 3JRGA 4MFDA 1S7OA 3GZNB 3P9KA 2JUGA 4Y13A 2B9SA 2L5QA 2F6CA 4HRIA 1QRYA 3IH4A 4MTDA 2OZ6A 2LBFA 5HODA 3EUAA 2WV0A 3V42A 4M3DA 5K5QA 4YRVA 1ACIA 2HTSA 2P6SA 4UUVA 3HOZJ 5DYMA 2H8RA 1QGPA 2ME0A 3H9JA 4NC8A 4DOZA 2R7SA 4M3EA 2XIGA 5BOXA 2XKOA 4OOIA 1Z77A 2QZ8A 1O7FA 2TRTA 3D5RC 3LA3A 5GTHC 5J1RA 3DV8A 3R60A 1LB2A 3FM5A 1KGSA 3KFWX 4KN4X 1VQNI 2VQCA 4JYKA 3LQQA 3HRSA 1IN4A 3TGNA 5CLSA 4X6AJ 4YEJA 2R7XA 5EYRA 1OCPA 5J8CA 3RKWA 2VJ4A 2W25A 1J7KA 2WAQA 2DT5A 5HS7A 1PVEA 2DFIA 4JK1X 1MDMB 2KL4A 4HX4A 4U88A 2O61A 3QAHA 3CUQB 1OFCX 4XOPA 1HSTA 3OY9A 4BE2A 3G2BA 2L4AA 4XKWA 4EJUA 1BR4A 5D5VB 1MBJA 3LAPA 3J80Z 3W6JB 3L2CA 5L3DA 4XLPF 4HF1A 4KUMA 2QYOA 1EH8A 4RAGA 2XGXA 4ETSA 2Q1ZB 3IKVA 4CCNA 4M3GA 1BR1A 4O6JA 3B6CA 3KYCB 3TO9A 3GTGJ 1IRFA 2EINH 3FBIB 3CJRB 1HQCA 4QLCU 3BC8A 2XUBA 5FFXA 2VPRA 2V1NA 2K4BA 5TGTA 2NNNA 4D5FA 2VE9A 1O3RA 1Y1VJ 1SC7A 3KP5A 4C3HJ 3AKZA 4C2MJ 1Y8RB 1ERDA 5FLVA 1P9QC 3GTQJ 1ZG5A 2DOFA 5EG0B 2DFHA 2FQ3A 2WV1A 1ONVA 3A0HC 3B02A 3TO6A 2KDOA 2VODA 4AC0A 2VKEA 3RI4A 4EGYA 2LKXA 3GCMA 1TWCJ 2RDPA 3JRAA 2MFZA 2HZDA 2H1LA 1WSUA 2VBYA 4CGZA 3I64A 1TW3A 1SAXA 3MMYB 3OYNA 4A3FJ 1BOAA 1LE8A 4HX8A 1X19A 1G3WA 2KIMA 4BE1A 3TW6A 4JBAA 1YJNI 1ULYA 1RR7A 1VQKI 2ZB9A 4XM3A 3F8NA 3FXKA 5FB2A 3W6VA 1NG7A 2LNBA 3LSJA 4UHTA 2IS2A 2DBBA 1N78A 1T6SA 2XGEA 4WXCA 3NWSA 4G7ZF 1P4AA 1XSXA 1ODDA 4G9YA 1DU0A 1ZGAA 5GP9A 4G7OF 4HA8A 1CGPA 1YIOA 2CMPA 3OL3A 1Z1DA 2MG4A 2W82A 2QQBA 2BVMA 3LNQA 1C0WA 2WA0A 3CP8A 2E2HJ 3DEWA 3OYMA 1G2HA 2M34A 4WX9A 2J5OA 3OYGA 1Y39A 5DM7F 1MJBA 3DPUA 3SEZA 4FASD 4ZZDA 1TT5B 3BJOA 1PDNC 4AIHA 2KRCA 1B1BA 2CU7A 4MLOA 1X3ZB 3Q0UA 4N9HA 4MFEA 1ZYRF 4CCLA 5HDKA 3OYBA 3E5XA 5K7FA 2XAFA 2UZKA 2F5CA 5M5XJ 3ML6A 3WG9A 3K1NA 4WXDA 4IOAF 1SD4A 4J01A 4NQWB 3WU0A 1R4NB 3E5UA 4XRSA 3IAM2 3K1MA 1ZHFA 2DO7A 3L9FA 4OIRF 3ZRGA 3D0SA 1QO0D 3AL0B 3FHNA 3RSNA 2LG4A 5FKMA 2HQ5A 4QSHA 3K10A 2Y48A 1IW7F 2K9MA 2I10A 4DZJA 4PJJA 5J8FA 3IAS2 1BI2A 3ASNH 2Z99A 4IPAA 2ECCA 2B0LA 2Y69H 1VI0A 4RAFA 4CZZA 1SVLA 2VC1A 3F6VA 3WTXC 3LSKA 3OV8A 3REOA 1I1GA 4LITA 4M9SA 1A36A 3S1NJ 4KYWA 1I27A 2KIFA 4I76A 3OIOA 2ZJRF 1W4MA 1BI0A 5DV5A 2ZJQF 3LQRA 3IWFA 5ICEA 1VTNC 4N4NB 1MD0A 2VJIA 1XMAA 1G8XA 5D6EA 2QQAA 3ELKA 1QHGA 1MIJA 1T33A 5BQTA 1EKEA 2A05A 3EYIA 1Z7UA 4ESBA 4IQ4A 3CCJI 5KHDA 2A3SA 2CG4A 2K9QA 2YU3A 2BBYA 2L3DA 3MKLA 3O8HA 1KYZA 1SFOJ 5B66C 1WZ2A 1HBXG 1WHUA 4LD5A 5GAHJ 2EV0A 1PJRA 1QZZA 4Y4RA 5L3BA 1ENHA 1VQMI 3VYRB 4XIDA 5JVGF 4D7NA 2W85A 2JJ7A 2F5EA 3L2VA 1KU2A 3LSRA 1BI3A 3VYUB 1BOBA 1P7IA 2JUCA 3G4SI 3I5UA 3V7RA 2Z2SB 2K9NA 3M8FA 1ZR2A 1WJEA 3HOTA 1WJ5A 2YUSA 4CYCB 3D1NI 3GTMJ 2EJRA 2Y0SA 3L00A 4A3KJ 3HEFA 1IJWC 4GYIA 2OPTA 3DF8A 2K85A 4YFKF 3ABLH 3K9TA 3I56I 2BW3A 3GLXA 2PG4A 4HNUA 4HLYA 3S17J 3CUOA 1LEAA 1WFXA 2EZKA 3PO3J 3CC7I 2VN2A 3CJNA 1R6RA 2XAHA 2BHYA 4M3FA 2RGVA 3S2HJ 4EM1A 4R8HA 4L9JA 3KYLA 2RNGA 2FUG2 4II3A 3FKIJ 4DYRA 5LGUA 4DQ2A 1T56A 3HOWJ 1EF4A 4P9UA 4KNYA 1MNDA 3OS2A 1XS9A 1QBJA 3EYYA 1OCZH 2R3SA 4LG0A 1RRJA 2JVGA 3MFKA 3F8FA 1OYIA 1K4SA 1IN5A 4LFUA 1FTTA 2P5VA 4XRSG 2ID6A 1KQ0A 2W00A 5FRMA 2X51A 2NOJB 3ZQFA 1JKOC 1HSJA 2WTEA 3WODF 4MGRA 3OOUA 3HOVJ 4IXAA 2W84A 1HF0A 2PMHA 3M4OJ 2QGUA 2L9RA 1YW7A 3RZDJ 3A1YA 5LD2C 3GMEA 2O8XA 2K3FA 1KU3A 2NVQJ 2NNYA 4PJNA 4XRMA 1D8JA 2GIVA 2HQAA 2IA1A 3CLOA 3D5LA 4HNVA 5HLHA 4NNJA 4CCMA 2R93J 2JMWA 3E6MA 3T5XA 5F6FA 2H94A 3WE3A 1MJAA 2X0LA 1NK2P 2R7WA 3FK7A 3HOUJ 5DS9A 1MKMA 1O4XA 3W6KB 1RNLA 4PSXA 3I58A 1HKQA 3WHBA 3S3MA 2ZXIA 1JUMA 3V8LA 2EZHA 2M7BA 4LK1F 2IGMA 2QQ9A 5IT3A 1XB4A 5C4JJ 1FX7A 4FTHA 1YYVA 2UUZA 3F9KA 1ON2A 1S5LC 4ON0A 3F3XA 3D5SC 3KX2A 4RB0A 2KZVA 4JQFA 2VOPA 4Y15A 2DQLA 2JA8J 1RI7A 2CJJA 5FRNA 3G1OA 4RMNA 2DMUA 3HRMA 4PGHA 3J80K 4P5OA 4L5JA 4L9VA 4IRIA 1HC8A 3ZMZA 2DOEA 1IXCA 3BY6A 4KIBA 4KN7X 3U21A 2IXSA 4A3EJ 2EPFA 3OSGA 3AG3H 3GXOA 3TW7A 3L2WA 2IA2A 5JHUA 4AIDA 1P4XA 3GZ5A 1YLFA 4GXOA 4HEA2 4RA2A 5ICFA 1IN8A 3DQVC 4HF2A 2RKHA 3S1MJ 2W4SA 4OMYA 1D8KA 2Z33A 2PJRB 2VPLA 5FFZA 2NS7A 3V8KA 3BJ6A 2DPDA 2LKSA 2QKLB 1REPC 2F2EA 1Q1VA 4ABZA 2XSDC 1VQ7I 4YIFA 4C9YA 5AIPA 1T2KA 1MBHA 4KISA 2DT6A 5K5OA 2IGKA 4MO7A 1LKXA 2WBMA 2JTVA 2LREA 2BZTA 4M72A 1LNWA 1ZARA 1JUSA 1YJ9I 3TEDA 5H2FC 4LGWA 5E3MA 2F48A 1BI1A 2R5ZA 4BQOA 5GPAA 4Q5SF 1O3TA 5LHGA 2ISZA 1S7EA 3HKZN 2LK2A 3J7YJ 4EEFG 1MNMC 1R71A 2QENA 5E8GA 3S32A 3WTUC 4IX7A 1XDSA 2BVLA 2NRAC 1UFMA 4KDPA 1Y0NA 5HLTA 2LRDA 1TQIA 3V4GA 3IP4B 3ISPA 4GDFA 1G3SA 4A69C 5FKOA 4AIKA 3DPLC 1JHHA 4EJWA 2HU9A 2GIZA 2Y75A 2HXOA 3PSFA 1HDDC 3BG6A 1YHQI 3A0BC 4XQFA 1FP2A 2NAZA 2EV5A 4RAYA 3ZMDA 4CZCA 3MD2A 4ZJZA 3IV5A 4FX4A 3KPHA 4DGWB 1EH6A 2KJBA 1BM9A 2IJLA 1TNTA 2PI0A 4JX4A 2NVXJ 1R49A 1AA7A 4UVAA 4L0ZB 2CW7A 1XCVA 1N25A 2E1CA 4XONA 2ZMEA 4M73A 3PFYA 3N4MA 2IS4A 2XAQA 4PZJA 4IHWA 5CVRA 1SFXA 1JXSA 1E0EA 4KITB 2LY9A 2DTRA 3K0LA 3ECHA 5JFRA 3ONQA 5IYDJ 1U0JA 1PUEE 2L0KA 5C4XJ 3WGHA 3A01A 3I59B 3FMSA 1EH7A 3F22A 3S14J 2QQ8A 3BTJA 2FNAA 1LDKB 1YQAA 4OAYA 2P81A 1MDMA 3CDLA 4BQNA 1T98A 1K78A 1YRNB 3TO7A 2M2EA 3IH3A 4BYYA 4BXXJ 2FEZA 3BR6A 2IVMA 3CMMA 1W0UA 1U5TB 2GAUA 4A3CJ 4YIRX 2YX7A 1JJ8C 3GFJA 2OA4A 2V4JC 3JRCA 2YU9J 3P5JA 2LH9A 4B8XA 3S1QJ 1FT9A 1Z3YA 3HSEA 5F04A 2IA0A 4E7SA 3ABMH 2MYSA 5BPDA 1DUXC 2K5CA 3ROUA 2X85A 2PN6A 1PUFB 4O3MA 4GGGA 3C2BA 5J1UA 1Z0XA 1HKTA 3FX3A 1U8BA 3G71I 2CQNA 2NS8A 4OMZA 1X4OA 2JA5J 5D5XB 3M07A 1F4KA 4OINF 3PL8A 2WAFA 2Y31A 3VB2A 1HXDA 1XSDA 1CF7A 1IV6A 2HDCA 3I4MJ 4WWCA 2C6YA 3H0DA 3ZQIA 1PP8F 3LA2A 5DCMA 4FQGA 4HLXA 1R5GA 3IL2A 2QBYB 1S7AA 2GOMA 2I8DA 1MBEA 1SD7A 1H88C 2M9HA 3KEOA 3CCMI 4ZC3A 3KE2A 5FKLA 1LDDA 2XV4S 2XROA 1TT0A 1PYVA 3BCBA 4HPQA 4I98B 5JR3A 3ZQHA 5J1YA 3ZXSA 1SFKA 1YOVB 2IEKA 1UMQA 1QZYA 2DAOA 4LMYA 3MKYB 4EATA 3DBLB 4Q48A 4C30A 3ERED 5AIQA 1MMSA 1IRGA 1OLTA 2XVCA 4ESJA 1VQ5I 3KP4A 1X1CA 4LB5A 1WJBA 3QYBA 4NC6A 2KRHA 3I3LA 3VSLA 4YFNF 3CC2I 5FKNA 3COAC 2YR2A 4F93B 2EFOA 3SZTA 5FLXZ 4PGGA 4G6DA 1B72A 1GVDA 1A31A 3H5NA 4HOBA 2OTJI 4Y52J 2ZXJA 3HHHA 1ETQA 4XORA 2QWWA 3FKJA 4UUTA 1UAAA 3C7JA 4B4CA 3OYLA 3UKGA 3WU2C 2A6HF 2LMDA 2CQ7A 4UY8I 4MIMA 4RGRA 1VF9A 3M7GA 2UV1A 1S29A 3GTJJ 2LVSA 4AVPA 4OWRB 2E1MC 4Z6YA 2E2IJ 2LOOA 5H6QA 4HNTA 3OYIA 2F4IA 3O2PE 4G7HF 2L01A 3C2GA 1OCCH 1GV5A 2HDWA 4A2UA 1W0TA 4HDUA 2HKOA 1KA8A 4F7ZA 3FWEA 3LSTA 3F21A 1KYWA 4BJ6C 1JT6A 1O57A 2LR8A 3CLQA 5GAEJ 2KZGA 4M6VA 1ZG3A 3V8JA 3DU5A 4RDUA 2E2JJ 4L9TA 3T8RA 1K4TA 4EGZA 2KFDA 4BJ5C 1U2WA 3QOEA 2PMZN 3GBGA 1FY7A 4ZH4F 4RGSA 2RREA 1U8RA 1BL0A 1LFBA 2EWNA 4M9XA 5IP9J 1D0YA 2HQRA 2OCEA 4KA4A 1IRXA 4BEHA 4UVCA 2D5VA 3K2ZA 1YIJI 1B6AA 5JLXA 5JI6A 5L3FA 1X4PA 1S9HA 4E7IA 2QM3A 2VC0A 4LIVA 2E36A 4PJ0C 2LKPA 1RKWA 1JI8A 1ZRFA 3QRFF 4UV9A 4KJZA 2RQPA 3BG5A 1ZN2A 2Y9ZA 4V19K 4GRIA 3OYKA 2DDAA 5D8LB 1FMVA 3IH2A 1S8NA 2P4WA 1D3YA 5JLWA 3EPZA 3O3KA 2V26A 2XF6A 2WADA 1R5HA 2UWMA 1WPKA 4BHCA 5IOYA 2E5ZA 2MGQA 1WVRA 3VSKA 5CPRB 1F9NA 3HUGB 5L3EA 1ZR4A 4Y17A 4UUSB 1FOWA 3DTEA 2PJPA 1FEXA 2IP2A 2GA1A 4XKCA 5GADJ 3HG9A 3DKXA 4D9JA 4E6KG 1OPCA 1MBFA 1HW2A 1F43A 1MH4A 2Z3YA 3OOPA 1A04A 1HW1A 3TL4X 2RVCA 2R7VA 1MW7A 4NB5A 2TDXA 1R7JA 3KZIC 1WGXA 4WF2A 1UELB 2UXXA 4L0YB 3E6CC 3KP3A 2P5LC 3FXMA 1W36D 2ZO4A 1MBKA 3QP5A 3TDZC 4BH9A 4QPQA 1P2FA 2FJ1A 2WC2A 4C3IJ 4YELA 5KAFC 1X1PA 1R00A 5EDNA 3MEXA 2ZFUA 4H4KC 3VPRA 5DM6F 3U9GA 1SMTA 2E7XA 5EZGA 4B1RA 2VI6A 2EFWA 3W2AA 5IPAA 4CICA 4GYGA 2VKDA 4A12A 1VQ6I 1DGWY 3R4KA 3I4NJ 1BC7C 2EA4A 2QLZA 4IQJA 3CMEI 1MJ9A 2W1OA 3L2QA 2CO5A 3ZQCA 4MQ9F 4IHSA 3ZQQA 1T39A 2P0WA 3ZQGA 2FMYA 2Z1DA 1D1CA 3K1PA 1L3LA 2RC4A 1GXPA 2AXTC 1LVAA 4HZFA 3OSFA 1QA6A 1V5GA 1B8IB 2IGNA 2P7CB 3DU6A 2VL8A 5EEGA 4GFBA 2I5UA 1EJ9A 3BR1A 9ANTA 2G7HA 1I50J 3BR0A 2X9DA 2LDUA 4XMYA 3TOAA 3QU3A 3HOYJ 4DIQA 4XLFA 5CQGA 1G3YA 1RIOH 2FBHA 4L9NA 3DLLF 2XRNA 3CESA 1TTYA 4EV0A 1AKHB 1YW9A 3LOCA 4Q4ZF 4BXUA 1V55H 1OYYA 1VQLI 1VQ8I 1E3PA 3EETA 2F4MB 3KLNA 3WGIA 2LBFB 3BPVA 2OC6A 4RBOA 2QF7A 2EILH 4RB1A 2ZMEC 3H1CA 3ZOBA 3K4JA 3LSHA 1ZG1A 3K4NA 3H35A 2GZWA 3VWBA 2J5PA 2O5RA 5KVRA 1XPXA 2GA2A 1W36C 3IUOA 1DDNA 2PEXA 4E7KA 1ITYA 2ZBKA 4AVZA 3WU1B 3CCEI 1XMXA 2RQQA 1TWAJ 3JW4A 5F64A 1T8IA 3J7AY 1RETA 5F0CA 4U0VA 5IYCJ 5K1YA 2XGDA 2NS0A 3GO5A 4BHBA 1IO2A 1RZ4A 1OKRA 3CDHA 2E71A 2ACJA 1B9MA 1BJAA 5D4RA 1GDTA 2LSOA 5EGOA 3N97A 3JTHA 2VXDA 4JP0A 4AYBA 1ETWA 4A3IJ 3ZR8X 4ZYGA 4PK4A 1Z9CA 3PFIA 2DA3A 2DTZA 3SYTA 2VKVA 2JT1A 1LPQA 2N8GA 3LSPA 3PUBA 4BAYA 4M74A 1VFCA 2R92J 3BTCA 3X2QH 5M5WJ 4EMSA 2B63J 2CFOA 1YS6A 2DODA 5TISC 2Z16A 3LWFA 5A2QK 1FIAA 4M6YA 3KEYA 1I1SA 4ZDLA 1TLHB 3RQ4A 2GWRA 3P9IA 1LJ9A 4XLEA 3FIWA 1YFHA 3DTIA 1E2XA 5KAIC 3BZCA 2CYYA 1ZLJA 3E0JB 1GUUA 1MSFC 2QSGX 5LEKA 4CA0A 2ZXHA 2EIKH 3I71A 3Q3SA 3KEQA 3FXQA 4YG2F 2HPMA 2M87A 2IGOA 1WCMJ 1H8AC 4M71A 2STWA 5E17F 2R7OA 2PQ8A 2OU2A 1JGGA 3S93A 1BIBA 2E34A 5GPCA 2H09A 2NOGA 3PM1A 5IYBJ 1V5EA 4XN3A 5FROA 2OV7A 3U1DA 2FQ4A 3HOSA 3JAMK 1V4RA 4BACA 2Z9OA 4HV5A 1D1BA 2XGCA 1FBUA 2IBDA 5AONA 1YX5A 3A02A 3SDGA 1TNSA 2X1CA 1RR8C 3ZMUA 1V3FA 3HXLA 4YFXF 2FSWA 3HGYA 3E6BA 1R4MB 1LE8B 4BJTA 3LSGA 4L5IA 4B3XA 1DQUA 2FBIA 4KIFA 3HTSB 1LQ1A 3GLLA 2O6GE 4HX7A 3QPTA 5FLXK 3DTKA 1OCRH 2JA2A 1TQMA 4XBFA 2OAZA 2HKXA 2IRFG 5D8KB 2MBFA 1GVJA 4R79A 2EZIA 5L3GA 4ZYAA 4FE7A 3TDUC 2ICWG 3QWLA 4CO8A 3O6BB 2BE5F 2WB1N 3OR1C 2MD5A 2DA4A 1R5ID 1B59A 3OR2C 2XC7A 1V5FA 2ZC2A 4E4HA 1XD7A 1BW6A 1Z67A 3CDIA 3GFLA 3H9GA 3TKYA 1K7AA 1Y56A 3BLYA 4Y7NJ 1JE8A 2OBPA 3FMQA 1P6RA 1HDPA 2EFQA 1USSA 3ZMSA 3JSPA 2VQGA 5HLGA 3VDXA 3QU6A 4UV8A 2MABA 3HGGA 3RPUD 2VLAA 2ZJPF 1U9NA 3K2AA 4F91B 2ZSHB 1HCRA 5E79C 3UNGC 5E20A 5D4SA 5HOOA 3CCRI 1U3EM 1OYWA 1XSVA 3PQKA 3J7AO 2DK8A 4BY1J 2CV1A 4BUPA 4P55A 3B6AA 3ZP5A 5HNHA 2R7RA 1T0FA 3HKZA 1UZCA 2ECBA 1ZREA 2KIUA 1VQOI 2MC4A 1ZGJA 1S72I 1QZEA 2NYXA 3FK6A 4CCKA 1BC8C 2CH0A 2EIJH 2A61A 2KISA 3TP0A 3H3ZA 1ZK8A 5BNGA 2XF5A 2LF7A 1IXRC 4TV7A 2JA7J 1HW5A 3MVPA 3G1MA 2E7WA 1ZGWA 4PSWA 2VT2A 1KU9A 4Y33A 2DYRH 3N05A 3FZVA 5CVJA 3QYEA 3OYCA 2ETHA 1KU7A 3FF5A 3RKQA 1FYKA 2YS9A 2BY3A 5E1WA 4CHUA 1N77A 2Y0SN 2V1UA 1D1AA 3T1BA 5FGMA 2H6CA 3ZGKA 2AQEA 4JX6A 3AAFA 2OZUA 5E8IA 3V7CA 3HHGA 5J4YA 4K2EA 1JKPC 1LDJA 1W7PA 3WTZA 4AU7A 4F55A 1IXSB 2VUMJ 4KT5C 3L09A 2DA7A 4J00A 4I0BA 5B5EC 1A6QA 1NTCA 1IV8A 2BY1A 2L2OA 1FC3A 1XN7A 4NC7A 3OYEA 1R1TA 2NVTJ 1Y8QB 2HYGD 3HRTA 2CWEA 3I9V2 3PUFA 3RDIA 2CUFA 2OJED 2MD0A 2LY1A 2OF7A 2XRLA 4XR6A 3I4PA 5EZHA 3OS1A 2A5YB 3K4LA 2DCEA 2E1NA 5JVTA 3NEUA 1ZTRA 2GXBA 3BTIA 3CCQI 1SEUA 3T0YA 3CD6I 4A3DJ 2IS6A 3QPLA 2FRHA 3PJRA 2QUFA 2D1VA 1STZA 2IAIA 2JZYA 1P7JA 4WXHA 5K7HA 4C2UA 1X2MA 3BROA 3OYJA 2KLOA 2G9WA 3E7LA 4S05A 2Q2EB 4G94A 2HS5A 2JSCA 4LIUA 2HEOA 4G6QA 4XSXF 3HBLA 2YX4A 3G1LA 1W5CC 1BW5A 3S2DJ 2D45A 2VQLA 3RJPA 3V7SA 4R1HA 3VODA 4CUGA 2FBKA 4EM2A 1H9GA 2MH2A 4M9ZA 1J9IA 3MZYA 2QEXI 2KP6A 2B7EA 1JT0A 5F0FA 3VYSB 2YPRA 4ZYEA 2FX0A 1IGNA 3MZHA 2BW3B 4FHTA 3HL2A 2VKHA 1YJWI 3F72A 1EV7A 1HKSA 2LC2A 4IHVA 1FLIA 2XAUA 4UVBA 3H0GJ 2LF8A 1H89C 4UB6C 4J19A 1ZRDA 1Z21A 2JWTA 4AWXB 4D5CA 2DA5A 2ME6A 2E1MB 4A5MA 3BPXA 5B3SH 2NXNB 4MQVA 2R0QC 3L7WA 4F3QA 4N9IA 4LG0B 1L0OC 4KMFA 3SQNA 3BWGA 1FOXA 1I6XA 1YE9A 3LFUA 2A68F 4A6EA 3LMMA 3ULQB 3JRDA 2OTLI 1Z91A 2EH3A 1RESA 2FOKA 5F1JA 1Z6RA 1X1DA 3SHFA 5K7ZA 5L3CA 4RM2A 3RTRA 3L2RA 1R58A 2H27A 4KICA 3Q5FA 1T38A 2HR3A 2ZXWH 1P4WA 5J47A 2CSOA 1J75A 2PX9A 3S8PA 5DD4A 1FZPB 4A3LJ 1FMWA 2VBWA 3WE2A 3CCLI 1U78A 2XPWA 4BNCA 4B48A 3CUQA 2BHZA 3NARA 5ERIA 3S3OA 3VEPA 3IRQA 1XTAA 1IN6A 1TP4A 4HSRA 3F6OA 4G6TB 1Y1WJ 2OQRA 2PFBA 3CCUI 1NK3P 2PLYA 3H3UA 4U7DA 3BG3A 3MCZA 1GT0C 1SFEA 3JRFA 2DA1A 4KMUX 1FOYA 2FXAA 2ELKA 2X6OA 2R7ZJ 1E3HA 1FBSA 1U6GA 3L1PA 5CYVA 2K40A 3E1SA 4NUBA 1I3AA 3DPTA 4KT6A 3S1RJ 4IHTA 3ABUA 1IUFA 2KKOA 2HDDA 2A69F 3GTLJ 3PIOF 1POGA 2X48A 4E70A 3H5AA 5LRRA 2R7UA 4BU2A 4AUXA 4D7MA 3HDDA 1R22A 1AOYA 3GTKJ 4BXFA 1HA8A 4AD9A 2M8EA 2STTA 3MKZA 2E60A 3CCYA 4E7ZA 2HXIA 1SFUA 4HQEA 4QPOA 4FETA 1FP1D 3HIFA 1ETKA 3QPHA 2R7TA 2R7DA 4HYEA 2DW4A 4ASNA 2ZSIB 5LHIA 5EG0A 1FPQA 3QOPA 4S04A 4XL9A 2VIXA 2GOXB 4LG3A 1VQPI 3FXJA 2HPIA 2A6TA 1WI3A 3BZKA 4FE4A 4PJMA 3QYFA 3VFZA 2IS1A 4ZTJA 2Y2ZA 3CZ6A 3FMRA 1UG2A 2FA5A 2UXNA 3IHUA 5C3EJ 4I09A 1TQPA 3AFHA 2R5YB 2K86A 1UHWA 2OUMA 2ZKZA 4XRFA 1K6OA 3CMYA 5DTDA 4X0GA 2L54A 4IJAA 1OR7C 3FM3A 2MA3A 6PAXA 2EA2A 1WRJA 4RGXA 1D5VA 2Y0MA 4IVNA 4XKVA 2R5ZB 1FSEA 2KQRA 2CV0A 3CTAA 3OYFA 4F52A 1TWFJ 4A5NA 4ZYHA 1I3QJ 2DJNA 4LB6B 4B3AA 1BR2A 2DA2A 4HV6A 5DEQA 4XOTA 3F23A 1AHDP 3FBNB 1UG0A 4RB3C 2BXZA 1MMAA 2HGCA 4P1WA 4ZTFA 4OAZA 2L7ZA 3R61A 5D6FA 2HWVA 5J3LA 2EFPA 3P7NA 3VYTB 1IC8A 4MEXF 4D0PA 1QVUA 3CJQB 4HQMA 4HAMA 4FISA 1IDZA 2MLKA 1W7PD 2JRTA 1ON1A 5E18F 3FXUA 4BBSJ 3IKTA 1QVTA 2K3PA 5DDGA 1Z3XA 4NQWA 4UXNA 2ISYA 3ASOH 3BG7A 1MZBA 2LTPA 2MSYA 2JA6J 5KK1A 1TBXA 3OYAA 1DGRM 4B47A 2ZMEB 2CW0F 1A35A 4A3BJ 3JRHA 1BN5A 5J6XA 5EEHA 2L9VA 3WTSC 3LFKA 2DN0A 2F5DA 3OL4A 2BOLA 4QIWN 5CVIA 2XKPA 2CUEA 4A3GJ 4JX5A 2WAEA 2AS5F 1TZLA 3A01B 3G6EI 3JCUC 2HVSA 3TMOA 3NWTA 3OYDA 3CO7C 4A3JJ 1X2NA 4LLLA 1RUNA 5ILUA 1T0FC 2ZNZA 4P9FA 1OCTC 5ILVA 3JRIA 1BJZA 2X6XA 4B43A 1YO5C 3CCVI 3LSMA 5HDGA 1P92A 1K78B 4IL6C 1LUJB 3HOXJ 2FF4A 3FDYA 1WH7A 3J81Z 5E3OA 5F08A 4BQAA 1U5TC 3KZYA 5J4VA 1G59A 4BKXA 4ZYDA 3KETA 2ESHA 3OMYA 1JTXA 2CV2A 2KT0A 2K27A 3RPUA 2O3FA 1O7LA 3BZ6A 4CDGA 5M3MJ 1O3SA 4RB2C 4DZPA 5ICCA 3FXLA 5JHFA 2HYFA 1E17A 3EQLF 5EEAA 4I7HA 3ZMTA 2DT7B 3HPGA 4IHYA 2RAEA 2E19A 2KPMA 4IHXA 2EK5A 4XLHA 4CCOA 2M4GA 1S6LA 1USTA 1MGTA 2BYVE 1Z05A 2Z5UA 2ZJ2A 2M45A 2XF7A 3H5RA 4XNFA 5ICGA 1AU7A 3EUHA 1CF7B 5F0HA 3FHZA 1YS7A 2Y9YA 2XAJA 3E5QA 4G8XA 3W3CA 1FJLA 3K4KA 2KDZA 1ETXA 2DA6A 2X1DA 1J2XA 3K69A 5DCMB 2DK5A 1VQ4I 2M30A 2R4GA 3HYIA 5HNFA 4LJZF 4LLGF 2L9NA 2L7KA 4CYCA 2HVRA 3DWLE 1SVMA 2BY2A 1XX5A 2HZTA 2LYCA 3RKYA 3WG7H 4DBRA 2TCTA 5LGNA 3GZ6A 2M1BA 2O8KA 1R23A 4NDLA 1JKRC 1A6IA 2CUJA 2BEOA 2VQHA 2XPUA 3IRRA 2H8WA 1FIPA 3WTWC 2W48A 3S2WA 1R9TJ 4IKFA 2CQKA 4IRGA 3M1EA 3SEQA 3Q0VA 4CYDA 3SDBA 2FNPA 3JR9A 1B9NA 2KMUA 1X1BA 1ETVA 4C3JJ 3DEUA 4BBRJ 5GTIC 4Q47A 2WAQN 3F8CA 1Q1HA 4A3MJ 3WTYC 4XK4A 1ETYA 4RLFA 3CQZJ 3SFZA 4DYCA 1NHAA 3DKWA 2HOAA 1B72B 3RYRA 3KLOA 5HVQC 1MMGA 2ZCWA 1WH5A 5HDNA 5IT9Z 3ECOA 1DP3A 1HOMA 1MNEA 1XMKA 4RLQA 2EV6A 4Z2YA 4NHJA 3OWTA 5LHHA 1KQ8A 1DPRA 3ZPLA 4XLNF 5J40A 3OIQA 3IWZA 1ZKGA 1QPIA 4HW0A 2X4HA 4P96A 1D0XA 5IP7J 1WJDA 4BY7J 2L7FP 1QQIA 5F27A 5FKKA 4HDVA 5C44J 3FISA 2AHQA 4IRHA 5HS9A 4PUSA 3CC4I 1SANA 1WJAA 2DJIA 2K9SA 2QCOA 1RKTA 3MN2A 2E5NA 2V9KA 4I02A 4M6XA 4CH7A 5E1XA 1R36A 4DYQA 5FD6A 3CCSI 5LGTA 2ZFWA 1QNTA 2QKMB 3H92A 3K4CA 3GUDA 5E1ZB 4BGDA 2EFNA 1UHSA 1M1EB 4I2OA 1FBQA 4I99C 2KHMA 2V7FA 2V9VA 3KP2A 1LEBA 4RAZA 3KCCA 2D1HA 3BQYA 2GQQA 1FYLA 2PMUA 3HM5A 4W1UA 5HLIA 3L2UA 2JPCA 1XCBA 4Y3OA 2GXGA 5M3FJ 2XDVA 2X1EA 2ELJA 2GM4A 3CUQC 3K7AJ 3K70D 2WB1A 1ORKA 2OCCH 3M3YJ 3T8TA 4BEHB 4EVIA 2HQNA 4JOMA 4A6DA 3S16J 4N4OB 3QP6A 4PFOA 3KZZA 1OCOH 2L02A 1QU3A 3C3WA 1OQYA 2DMNA 3SFIA 5IOZA 3HTUA 3JTGA 3J7ZI 2Y30A 1IRZA 4ENJA 2CRGA 1F36A 2W24A 2V1XA 1X1AA 3BT9A 3SZPA 1D5YA 5DUKA 2PJRA 3F0CA 1A5JA 2VONA 1K83J 2H1KA 5DUIA 5TJJA 3ZQLA 3ZN0A 1N75A 4RGUA 3GYHX 2BXYA 3S15J 2MW8A 1HLVA 3NQOA 2VXZA
chains in the Genus database with same CATH topology
1Y0UA 1FOKA 1OR7A 4GCVA 4UNOA 4I0AA 2HOEA 1IF1A 3RIRA 4I01A 2DPUA 1FNNA 4HBLA 4A0YA 2K7LA 3LA7A 4EJOA 1WWXA 2Q2EA 5LRSA 1GHCA 3GFMA 4A0ZA 4YIIA 2DLLA 2VBZA 1BIAA 1PP7U 1ZRCA 3WTTC 2FU4A 4MHGA 2HTJA 3WGGA 2P8TA 3C1DA 2BGCA 3TOBA 2YSRA 3G3ZA 3EDPA 5CVUA 4ZZLA 1XGMA 1TW2A 1YG2A 4OU0A 3CO6C 1J0RA 5BPIA 1J59A 1X3UA 5CJ9A 1H9TA 3DP7A 3M9AA 4MNUA 3ABTA 4IF4A 2G7UA 5DCFA 1WKMA 4EJVA 3F8MA 3I59A 2IT0A 3RKXA 5K5RA 3DFGA 4QWQA 3E6DA 2P7VB 4EM0B 4PCQA 3B73A 3MQ0A 4DNCA 5DD8A 2RN7A 2VBXA 1U5TA 1J5YA 5BS6A 4U0YA 3Q9VA 4U7BA 1XGOA 4EQQA 2H6BA 5ED4A 5D5UB 3WTVC 4ENNA 5FO5A 1R1VA 2ESNA 2ZNYA 4LLNA 3BJAA 2DU9A 1ZH5A 1WI9A 1OMIA 3GVAA 3MAJA 3FXRA 4N0BA 2VT3A 3J81K 2MLGA 1IAWA 1Z6TA 2A6EF 3I0TA 2V1DA 2Q8KA 4HF0A 2QBYA 2W57A 1IZ1A 2COMA 1W5SA 4MEYF 2HFHA 1W5TA 4OIOF 3NRVA 2DI3A 1H0MA 2L4MA 4H0EA 2CFXA 3GF2A 5CVVA 5H20A 4RS8A 1IN7A 1JGSA 5D5WB 2M5WA 2QVOA 2RV8A 3U2RA 2JPBA 3ZMVA 3GW2A 2CGPA 3E97A 1SMYF 1BBYA 2OQGA 2XHKA 3HSRA 2V6CA 2ELHA 1IUYA 1RUOA 2R7FA 1UHMA 1R1UA 2PBIA 2O0YA 1SD5A 2FMLA 4OIPF 1XGSA 4O5VA 3GX4X 1DPUA 3R0AA 3VOEA 1K79A 3ZQ7A 3PQJA 4FT8A 1UCRA 2MH9A 1YTYA 1YW8A 2P6TA 1WQ2A 5IT9K 2F5FA 3GWZA 5H6RA 2KRFA 5LEJA 3RYPA 1G6NA 2ADUA 3MWMA 5TRDA 1FYMA 2IW5A 3HSFA 3I54A 2DQRA 2XAGA 4CXFA 2EB7A 3IC7A 3SXYA 3M8EA 3LAJA 4FX0A 1O3QA 4KFCA 5HS8A 2VE8A 1FWZA 3HRUA 4PDKA 3GEZA 1XDUA 1XGNA 3JSOA 4GO1A 4ENKA 2WWYA 1ZAOA 4XSZF 3RPQA 2BV6A 5LBQA 2MC3A 1F1ZA 4B09A 5LLQA 3F8BA 3E3VA 1ZLKA 2D2WA 5ILSA 1GXQA 3HUGA 4ESFA 3KP6A 3P9CA 2OD5A 1QPMA 3Q9SA 2XASA 2VOOA 3I53A 1W7PB 4MTEA 2Q0OA 1DP7P 3BDDA 3TQNA 5A2QZ 2O03A 2RNJA 3R0JA 2IPQX 1KQ9A 5F1RA 3BP8A 4A0XA 3ZN1A 1FSHA 4KIGA 3KP7A 2P5KA 1SD6A 1JHFA 3R6SA 1G3TA 2KJCA 5FD5A 3G73A 1B4AA 1UB9A 5BMZA 4BHPA 2K02A 3JAMZ 3DXJF 1S3JA 1F5TA 4WCGA 4LK0F 2A07F 4ENMA 3BOQA 2K4JA 2AXLA 2FE3A 1I5ZA 4U0WA 1AWCA 4AIJA 4OIQF 3GFIA 4EJTA 4WK8F 2V79A 3C18A 4L18B 1S7OA 3P9KA 4Y13A 4MTDA 2OZ6A 2WV0A 5K5QA 2HTSA 2P6SA 4UUVA 5DYMA 1QGPA 2XIGA 5BOXA 2XKOA 4OOIA 2QZ8A 1O7FA 3LA3A 1LB2A 3DV8A 3R60A 3FM5A 1KGSA 3KFWX 4KN4X 3LQQA 3HRSA 1IN4A 3TGNA 5CLSA 5J8CA 3RKWA 2W25A 1J7KA 2DT5A 5HS7A 2DFIA 4JK1X 1MDMB 4HX4A 4U88A 2O61A 3QAHA 3CUQB 1HSTA 2L4AA 4EJUA 5D5VB 3LAPA 3J80Z 3W6JB 3L2CA 5L3DA 4XLPF 4HF1A 4KUMA 2QYOA 1EH8A 2XGXA 4ETSA 3IKVA 4O6JA 3TO9A 1IRFA 4QLCU 1HQCA 2XUBA 5FFXA 2K4BA 2NNNA 2VE9A 1O3RA 3KP5A 1ZG5A 2FQ3A 1ONVA 3B02A 3TO6A 2VODA 3RI4A 4EGYA 2RDPA 1WSUA 2VBYA 4CGZA 3I64A 1TW3A 1SAXA 1BOAA 4HX8A 1G3WA 2KIMA 4JBAA 1ULYA 3F8NA 5FB2A 2LNBA 4UHTA 2DBBA 1T6SA 4WXCA 4G7ZF 1P4AA 1XSXA 1ODDA 4G9YA 1ZGAA 4G7OF 4HA8A 1CGPA 1YIOA 1Z1DA 2QQBA 1C0WA 4WX9A 2J5OA 1MJBA 4ZZDA 3BJOA 1PDNC 4AIHA 1B1BA 4N9HA 1ZYRF 5HDKA 3E5XA 2XAFA 2UZKA 2F5CA 3ML6A 3WG9A 3K1NA 4WXDA 1SD4A 3WU0A 3E5UA 3K1MA 1ZHFA 2DO7A 3L9FA 4OIRF 3D0SA 1QO0D 2Y48A 1IW7F 5J8FA 1BI2A 2Z99A 4IPAA 2B0LA 4CZZA 2VC1A 3F6VA 3WTXC 3OV8A 3REOA 1I1GA 4M9SA 4KYWA 1I27A 2KIFA 1W4MA 1BI0A 5DV5A 3LQRA 3IWFA 5ICEA 1VTNC 1MD0A 1XMAA 5D6EA 2QQAA 3ELKA 5BQTA 3EYIA 1Z7UA 4ESBA 2A3SA 2CG4A 2YU3A 2BBYA 2L3DA 1KYZA 1HBXG 4LD5A 2EV0A 1QZZA 5L3BA 2W85A 2F5EA 1KU2A 1BI3A 3I5UA 3V7RA 3M8FA 3HOTA 2EJRA 3L00A 4GYIA 3DF8A 4YFKF 3K9TA 3GLXA 2PG4A 4HLYA 3CUOA 1LEAA 2VN2A 3CJNA 2XAHA 2RGVA 4EM1A 4R8HA 4L9JA 5LGUA 4DQ2A 4P9UA 4KNYA 1QBJA 3EYYA 2R3SA 4LG0A 3MFKA 3F8FA 1OYIA 1IN5A 4LFUA 2P5VA 1KQ0A 1HSJA 2WTEA 3WODF 4MGRA 4IXAA 2W84A 2PMHA 1YW7A 2O8XA 1KU3A 2NNYA 1D8JA 2GIVA 2IA1A 3CLOA 3D5LA 5HLHA 3T5XA 3E6MA 5F6FA 2H94A 3WE3A 1MJAA 2X0LA 1MKMA 3W6KB 1RNLA 3I58A 1HKQA 3V8LA 4LK1F 2QQ9A 5IT3A 1XB4A 1FX7A 1YYVA 1ON2A 4ON0A 3F3XA 4RB0A 4JQFA 2VOPA 4Y15A 2DQLA 1RI7A 3J80K 4PGHA 3HRMA 4P5OA 4L5JA 4L9VA 4IRIA 3ZMZA 1IXCA 3BY6A 4KIBA 4KN7X 3GXOA 2IA2A 5JHUA 1P4XA 3GZ5A 1YLFA 4GXOA 5ICFA 1IN8A 3DQVC 4HF2A 2RKHA 4OMYA 1D8KA 2Z33A 5FFZA 3V8KA 3BJ6A 2DPDA 1REPC 2F2EA 4YIFA 5AIPA 1T2KA 5K5OA 2JTVA 4M72A 1LNWA 1ZARA 4LGWA 1BI1A 4Q5SF 1O3TA 5LHGA 2ISZA 2QENA 5E8GA 3WTUC 1XDSA 2NRAC 1UFMA 4KDPA 1TQIA 3V4GA 3ISPA 1G3SA 4AIKA 3DPLC 1JHHA 4EJWA 2Y75A 1FP2A 2NAZA 2EV5A 4RAYA 3ZMDA 4FX4A 1EH6A 2KJBA 1BM9A 2IJLA 1TNTA 2PI0A 4UVAA 4L0ZB 1XCVA 2E1CA 2ZMEA 4M73A 3N4MA 2XAQA 4PZJA 5CVRA 1SFXA 1JXSA 2DTRA 3K0LA 3ECHA 5JFRA 1PUEE 3WGHA 3I59B 3FMSA 1EH7A 3F22A 2FNAA 1LDKB 1YQAA 1MDMA 1T98A 1K78A 3TO7A 4BYYA 2FEZA 2IVMA 1U5TB 2GAUA 2YX7A 3GFJA 2OA4A 4B8XA 1FT9A 3HSEA 2IA0A 1DUXC 5BPDA 3ROUA 2PN6A 4O3MA 4GGGA 1HKTA 3FX3A 4OMZA 5D5XB 1F4KA 4OINF 3VB2A 1HXDA 1XSDA 1CF7A 2HDCA 4WWCA 2C6YA 1PP8F 3LA2A 5DCMA 4HLXA 1R5GA 3IL2A 2QBYB 1S7AA 1SD7A 3KEOA 3KE2A 1LDDA 2XV4S 2XROA 4I98B 5JR3A 1QZYA 2DAOA 4LMYA 4Q48A 3ERED 5AIQA 1IRGA 2XVCA 4ESJA 3KP4A 4LB5A 4YFNF 3COAC 2YR2A 2EFOA 3SZTA 5FLXZ 4PGGA 4G6DA 4HOBA 2ZXJA 3HHHA 2QWWA 3C7JA 2A6HF 4RGRA 3M7GA 1S29A 4AVPA 5H6QA 3O2PE 4G7HF 2L01A 4A2UA 4HDUA 2HKOA 1KA8A 4F7ZA 3FWEA 3LSTA 3F21A 1KYWA 1O57A 1ZG3A 3V8JA 4L9TA 3T8RA 4EGZA 1U2WA 1FY7A 4ZH4F 4RGSA 1U8RA 2EWNA 4M9XA 2HQRA 4KA4A 4UVCA 3K2ZA 1B6AA 5JI6A 5L3FA 2QM3A 2VC0A 2LKPA 1ZRFA 3QRFF 4UV9A 2RQPA 1ZN2A 5D8LB 1S8NA 2P4WA 1D3YA 3O3KA 1R5HA 2UWMA 4BHCA 1F9NA 5L3EA 4Y17A 2PJPA 2IP2A 2GA1A 1HW2A 1OPCA 2Z3YA 3OOPA 1HW1A 1A04A 2RVCA 4NB5A 2TDXA 1R7JA 4WF2A 2UXXA 4L0YB 3E6CC 3KP3A 2P5LC 2ZO4A 3QP5A 4BH9A 3TDZC 1P2FA 2WC2A 1R00A 3MEXA 3U9GA 1SMTA 2E7XA 2EFWA 4CICA 4GYGA 4A12A 3R4KA 1BC7C 2EA4A 2QLZA 1MJ9A 2CO5A 4MQ9F 4IHSA 1T39A 2FMYA 3K1PA 1L3LA 2RC4A 1GXPA 1LVAA 4HZFA 2P7CB 5EEGA 2G7HA 2LDUA 3TOAA 3QU3A 1G3YA 1RIOH 2FBHA 4L9NA 2XRNA 1TTYA 4EV0A 1YW9A 4Q4ZF 4BXUA 1OYYA 3EETA 3KLNA 3WGIA 3BPVA 4RB1A 1ZG1A 2GZWA 2J5PA 5KVRA 1DDNA 2GA2A 2PEXA 2ZBKA 3WU1B 5F64A 3JW4A 4U0VA 5K1YA 2NS0A 3GO5A 4BHBA 1RZ4A 1OKRA 3CDHA 2ACJA 1B9MA 1BJAA 5D4RA 2LSOA 3N97A 3JTHA 4ZYGA 1Z9CA 3PFIA 2JT1A 4BAYA 4M74A 4EMSA 1YS6A 3LWFA 5A2QK 4M6YA 1I1SA 1TLHB 2GWRA 3P9IA 1LJ9A 1YFHA 1E2XA 2CYYA 1ZLJA 5LEKA 3I71A 3KEQA 3FXQA 4YG2F 2M87A 4M71A 2STWA 5E17F 2PQ8A 2OU2A 1BIBA 2H09A 3U1DA 3HOSA 3JAMK 1V4RA 2Z9OA 4HV5A 1FBUA 5AONA 1TNSA 3ZMUA 1V3FA 4YFXF 2FSWA 3E6BA 4L5IA 2FBIA 4KIFA 3HTSB 1LQ1A 2O6GE 4HX7A 3QPTA 5FLXK 1TQMA 4XBFA 2OAZA 2HKXA 2IRFG 5D8KB 2MBFA 1GVJA 4R79A 5L3GA 3TDUC 4CO8A 3O6BB 2BE5F 2MD5A 1B59A 1XD7A 3GFLA 1K7AA 1G4DA 3TKYA 1JE8A 2OBPA 3FMQA 1P6RA 2EFQA 3JSPA 1USSA 3ZMSA 5HLGA 3QU6A 4UV8A 5D4SA 5HOOA 5E20A 1U3EM 1OYWA 1XSVA 3PQKA 3J7AO 2DK8A 4P55A 3ZP5A 1T0FA 1ZREA 2KIUA 1ZGJA 2NYXA 1BC8C 2A61A 3H3ZA 2LF7A 1IXRC 4TV7A 1HW5A 2E7WA 2VT2A 1KU9A 3FZVA 5CVJA 2ETHA 1KU7A 3FF5A 1FYKA 5E1WA 4CHUA 2V1UA 3T1BA 5FGMA 2H6CA 3AAFA 2OZUA 5E8IA 3V7CA 3HHGA 4K2EA 1LDJA 1W7PA 3WTZA 1IXSB 4KT5C 3L09A 4I0BA 1FC3A 1XN7A 1R1TA 2HYGD 3HRTA 2CWEA 3RDIA 3I4PA 2A5YB 2E1NA 5JVTA 3NEUA 2GXBA 3T0YA 2FRHA 2QUFA 2D1VA 1STZA 2JZYA 4WXHA 3BROA 2G9WA 4S05A 4G94A 2HS5A 2JSCA 2HEOA 4G6QA 4XSXF 2YX4A 2D45A 3RJPA 3V7SA 4R1HA 3VODA 2FBKA 4EM2A 1H9GA 2MH2A 4M9ZA 1J9IA 3MZYA 2YPRA 4ZYEA 3MZHA 4FHTA 3F72A 1EV7A 1HKSA 1FLIA 4UVBA 2LF8A 1ZRDA 4AWXB 4A5MA 3BPXA 4MQVA 3L7WA 4N9IA 4LG0B 1L0OC 4KMFA 3SQNA 3BWGA 1I6XA 2A68F 4A6EA 3ULQB 1Z91A 2FOKA 1Z6RA 3SHFA 5L3CA 3RTRA 2H27A 1R58A 4KICA 3Q5FA 1T38A 2HR3A 1P4WA 2CSOA 1J75A 5DD4A 1FZPB 3WE2A 2VBWA 1U78A 4BNCA 3CUQA 5ERIA 3VEPA 3IRQA 1IN6A 3F6OA 2OQRA 2PFBA 2PLYA 3H3UA 4U7DA 3MCZA 1SFEA 4KMUX 2FXAA 1FBSA 1U6GA 5CYVA 3DPTA 4IHTA 3ABUA 2KKOA 2A69F 4E70A 5LRRA 1AOYA 1R22A 4AD9A 2M8EA 2STTA 1SFUA 4HQEA 1FP1D 3HIFA 3QPHA 2R7DA 4HYEA 2DW4A 4ASNA 5LHIA 1FPQA 3QOPA 4S04A 3VFZA 3FMRA 2FA5A 2UXNA 3IHUA 4I09A 1TQPA 2K86A 1UHWA 2ZKZA 4XRFA 1K6OA 2L54A 4IJAA 3FM3A 2MA3A 6PAXA 2EA2A 1WRJA 4RGXA 1D5VA 2Y0MA 4IVNA 1FSEA 3CTAA 4ZYHA 4A5NA 4LB6B 4HV6A 5DEQA 3F23A 4RB3C 2HGCA 3R61A 5D6FA 2HWVA 2EFPA 3P7NA 4MEXF 4D0PA 4HQMA 4HAMA 2MLKA 1W7PD 2JRTA 1ON1A 5E18F 3FXUA 3IKTA 5DDGA 4NQWA 4UXNA 2ISYA 1MZBA 5KK1A 1TBXA 2ZMEB 2CW0F 1BN5A 5J6XA 5EEHA 3WTSC 3LFKA 2F5DA 5CVIA 2XKPA 2AS5F 3CO7C 4LLLA 1RUNA 5ILUA 2ZNZA 4P9FA 5ILVA 1YO5C 5HDGA 1P92A 1K78B 2FF4A 3J81Z 4BQAA 1U5TC 3KZYA 4ZYDA 3KETA 2ESHA 2K27A 3RPUA 2O3FA 1O7LA 3BZ6A 4CDGA 1O3SA 4RB2C 5ICCA 2HYFA 1E17A 3EQLF 4I7HA 3ZMTA 2EK5A 1S6LA 1USTA 1MGTA 2BYVE 1Z05A 2Z5UA 2M45A 2ZJ2A 5ICGA 3EUHA 1CF7B 3FHZA 1YS7A 2XAJA 3E5QA 4G8XA 3K69A 1J2XA 5DCMB 2DK5A 2M30A 3HYIA 4LJZF 4LLGF 2HZTA 3RKYA 5LGNA 3GZ6A 2M1BA 1R23A 2BEOA 3IRRA 3WTWC 3S2WA 2CQKA 4IRGA 3M1EA 4CYDA 2FNPA 1B9NA 3DEUA 4Q47A 3F8CA 1Q1HA 3WTYC 3SFZA 1NHAA 3DKWA 3RYRA 3KLOA 5HVQC 2ZCWA 5HDNA 5IT9Z 3ECOA 1XMKA 2EV6A 4Z2YA 4NHJA 5LHHA 1KQ8A 1DPRA 3ZPLA 4XLNF 3IWZA 4HW0A 2X4HA 4P96A 1QQIA 4HDVA 4IRHA 5HS9A 4M6XA 4I02A 5FD6A 5E1XA 1R36A 5LGTA 2ZFWA 1QNTA 3H92A 3GUDA 5E1ZB 2EFNA 4I2OA 1FBQA 2V9VA 3KP2A 1LEBA 4RAZA 3KCCA 2D1HA 2GQQA 1FYLA 2PMUA 5HLIA 2JPCA 1XCBA 2GXGA 3CUQC 3T8TA 4EVIA 2HQNA 4A6DA 3QP6A 3KZZA 2L02A 3C3WA 3HTUA 3JTGA 4ENJA 2W24A 2V1XA 3SZPA 5DUKA 2VONA 5DUIA 5TJJA 3ZN0A 4RGUA 3GYHX 3NQOA 2VXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0U A;  1FOK A;  1OR7 A;  4GCV A;  4UNO A;  4I0A A;  2HOE A;  1IF1 A;  3RIR A;  4I01 A;  2DPU A;  1FNN A;  4HBL A;  4A0Y A;  2K7L A;  3LA7 A;  4EJO A;  1WWX A;  2Q2E A;  5LRS A;  1GHC A;  3GFM A;  4A0Z A;  4YII A;  2DLL A;  2VBZ A;  1BIA A;  1PP7 U;  1ZRC A;  3WTT C;  2FU4 A;  4MHG A;  2HTJ A;  3WGG A;  2P8T A;  3C1D A;  2BGC A;  3TOB A;  2YSR A;  3G3Z A;  3EDP A;  5CVU A;  4ZZL A;  1XGM A;  1TW2 A;  1YG2 A;  4OU0 A;  3CO6 C;  1J0R A;  5BPI A;  1J59 A;  1X3U A;  5CJ9 A;  1H9T A;  3DP7 A;  3M9A A;  4MNU A;  3ABT A;  4IF4 A;  2G7U A;  5DCF A;  1WKM A;  4EJV A;  3F8M A;  3I59 A;  2IT0 A;  3RKX A;  5K5R A;  3DFG A;  4QWQ A;  3E6D A;  2P7V B;  4EM0 B;  4PCQ A;  3B73 A;  3MQ0 A;  4DNC A;  5DD8 A;  2RN7 A;  2VBX A;  1U5T A;  1J5Y A;  5BS6 A;  4U0Y A;  3Q9V A;  4U7B A;  1XGO A;  4EQQ A;  2H6B A;  5ED4 A;  5D5U B;  3WTV C;  4ENN A;  5FO5 A;  1R1V A;  2ESN A;  2ZNY A;  4LLN A;  3BJA A;  2DU9 A;  1ZH5 A;  1WI9 A;  1OMI A;  3GVA A;  3MAJ A;  3FXR A;  4N0B A;  2VT3 A;  3J81 K;  2MLG A;  1IAW A;  1Z6T A;  2A6E F;  3I0T A;  2V1D A;  2Q8K A;  4HF0 A;  2QBY A;  2W57 A;  1IZ1 A;  2COM A;  1W5S A;  4MEY F;  2HFH A;  1W5T A;  4OIO F;  3NRV A;  2DI3 A;  1H0M A;  2L4M A;  4H0E A;  2CFX A;  3GF2 A;  5CVV A;  5H20 A;  4RS8 A;  1IN7 A;  1JGS A;  5D5W B;  2M5W A;  2QVO A;  2RV8 A;  3U2R A;  2JPB A;  3ZMV A;  3GW2 A;  2CGP A;  3E97 A;  1SMY F;  1BBY A;  2OQG A;  2XHK A;  3HSR A;  2V6C A;  2ELH A;  1IUY A;  1RUO A;  2R7F A;  1UHM A;  1R1U A;  2PBI A;  2O0Y A;  1SD5 A;  2FML A;  4OIP F;  1XGS A;  4O5V A;  3GX4 X;  1DPU A;  3R0A A;  3VOE A;  1K79 A;  3ZQ7 A;  3PQJ A;  4FT8 A;  1UCR A;  2MH9 A;  1YTY A;  1YW8 A;  2P6T A;  1WQ2 A;  5IT9 K;  2F5F A;  3GWZ A;  5H6R A;  2KRF A;  5LEJ A;  3RYP A;  1G6N A;  2ADU A;  3MWM A;  5TRD A;  1FYM A;  2IW5 A;  3HSF A;  3I54 A;  2DQR A;  2XAG A;  4CXF A;  2EB7 A;  3IC7 A;  3SXY A;  3M8E A;  3LAJ A;  4FX0 A;  1O3Q A;  4KFC A;  5HS8 A;  2VE8 A;  1FWZ A;  3HRU A;  4PDK A;  3GEZ A;  1XDU A;  1XGN A;  3JSO A;  4GO1 A;  4ENK A;  2WWY A;  1ZAO A;  4XSZ F;  3RPQ A;  2BV6 A;  5LBQ A;  2MC3 A;  1F1Z A;  4B09 A;  5LLQ A;  3F8B A;  3E3V A;  1ZLK A;  2D2W A;  5ILS A;  1GXQ A;  3HUG A;  4ESF A;  3KP6 A;  3P9C A;  2OD5 A;  1QPM A;  3Q9S A;  2XAS A;  2VOO A;  3I53 A;  1W7P B;  4MTE A;  2Q0O A;  1DP7 P;  3BDD A;  3TQN A;  5A2Q Z;  2O03 A;  2RNJ A;  3R0J A;  2IPQ X;  1KQ9 A;  5F1R A;  3BP8 A;  4A0X A;  3ZN1 A;  1FSH A;  4KIG A;  3KP7 A;  2P5K A;  1SD6 A;  1JHF A;  3R6S A;  1G3T A;  2KJC A;  5FD5 A;  3G73 A;  1B4A A;  1UB9 A;  5BMZ A;  4BHP A;  2K02 A;  3JAM Z;  3DXJ F;  1S3J A;  1F5T A;  4WCG A;  4LK0 F;  2A07 F;  4ENM A;  3BOQ A;  2K4J A;  2AXL A;  2FE3 A;  1I5Z A;  4U0W A;  1AWC A;  4AIJ A;  4OIQ F;  3GFI A;  4EJT A;  4WK8 F;  2V79 A;  3C18 A;  4L18 B;  1S7O A;  3P9K A;  4Y13 A;  4MTD A;  2OZ6 A;  2WV0 A;  5K5Q A;  2HTS A;  2P6S A;  4UUV A;  5DYM A;  1QGP A;  2XIG A;  5BOX A;  2XKO A;  4OOI A;  2QZ8 A;  1O7F A;  3LA3 A;  1LB2 A;  3DV8 A;  3R60 A;  3FM5 A;  1KGS A;  3KFW X;  4KN4 X;  3LQQ A;  3HRS A;  1IN4 A;  3TGN A;  5CLS A;  5J8C A;  3RKW A;  2W25 A;  1J7K A;  2DT5 A;  5HS7 A;  2DFI A;  4JK1 X;  1MDM B;  4HX4 A;  4U88 A;  2O61 A;  3QAH A;  3CUQ B;  1HST A;  2L4A A;  4EJU A;  5D5V B;  3LAP A;  3J80 Z;  3W6J B;  3L2C A;  5L3D A;  4XLP F;  4HF1 A;  4KUM A;  2QYO A;  1EH8 A;  2XGX A;  4ETS A;  3IKV A;  4O6J A;  3TO9 A;  1IRF A;  4QLC U;  1HQC A;  2XUB A;  5FFX A;  2K4B A;  2NNN A;  2VE9 A;  1O3R A;  3KP5 A;  1ZG5 A;  2FQ3 A;  1ONV A;  3B02 A;  3TO6 A;  2VOD A;  3RI4 A;  4EGY A;  2RDP A;  1WSU A;  2VBY A;  4CGZ A;  3I64 A;  1TW3 A;  1SAX A;  1BOA A;  4HX8 A;  1G3W A;  2KIM A;  4JBA A;  1ULY A;  3F8N A;  5FB2 A;  2LNB A;  4UHT A;  2DBB A;  1T6S A;  4WXC A;  4G7Z F;  1P4A A;  1XSX A;  1ODD A;  4G9Y A;  1ZGA A;  4G7O F;  4HA8 A;  1CGP A;  1YIO A;  1Z1D A;  2QQB A;  1C0W A;  4WX9 A;  2J5O A;  1MJB A;  4ZZD A;  3BJO A;  1PDN C;  4AIH A;  1B1B A;  4N9H A;  1ZYR F;  5HDK A;  3E5X A;  2XAF A;  2UZK A;  2F5C A;  3ML6 A;  3WG9 A;  3K1N A;  4WXD A;  1SD4 A;  3WU0 A;  3E5U A;  3K1M A;  1ZHF A;  2DO7 A;  3L9F A;  4OIR F;  3D0S A;  1QO0 D;  2Y48 A;  1IW7 F;  5J8F A;  1BI2 A;  2Z99 A;  4IPA A;  2B0L A;  4CZZ A;  2VC1 A;  3F6V A;  3WTX C;  3OV8 A;  3REO A;  1I1G A;  4M9S A;  4KYW A;  1I27 A;  2KIF A;  1W4M A;  1BI0 A;  5DV5 A;  3LQR A;  3IWF A;  5ICE A;  1VTN C;  1MD0 A;  1XMA A;  5D6E A;  2QQA A;  3ELK A;  5BQT A;  3EYI A;  1Z7U A;  4ESB A;  2A3S A;  2CG4 A;  2YU3 A;  2BBY A;  2L3D A;  1KYZ A;  1HBX G;  4LD5 A;  2EV0 A;  1QZZ A;  5L3B A;  2W85 A;  2F5E A;  1KU2 A;  1BI3 A;  3I5U A;  3V7R A;  3M8F A;  3HOT A;  2EJR A;  3L00 A;  4GYI A;  3DF8 A;  4YFK F;  3K9T A;  3GLX A;  2PG4 A;  4HLY A;  3CUO A;  1LEA A;  2VN2 A;  3CJN A;  2XAH A;  2RGV A;  4EM1 A;  4R8H A;  4L9J A;  5LGU A;  4DQ2 A;  4P9U A;  4KNY A;  1QBJ A;  3EYY A;  2R3S A;  4LG0 A;  3MFK A;  3F8F A;  1OYI A;  1IN5 A;  4LFU A;  2P5V A;  1KQ0 A;  1HSJ A;  2WTE A;  3WOD F;  4MGR A;  4IXA A;  2W84 A;  2PMH A;  1YW7 A;  2O8X A;  1KU3 A;  2NNY A;  1D8J A;  2GIV A;  2IA1 A;  3CLO A;  3D5L A;  5HLH A;  3T5X A;  3E6M A;  5F6F A;  2H94 A;  3WE3 A;  1MJA A;  2X0L A;  1MKM A;  3W6K B;  1RNL A;  3I58 A;  1HKQ A;  3V8L A;  4LK1 F;  2QQ9 A;  5IT3 A;  1XB4 A;  1FX7 A;  1YYV A;  1ON2 A;  4ON0 A;  3F3X A;  4RB0 A;  4JQF A;  2VOP A;  4Y15 A;  2DQL A;  1RI7 A;  3J80 K;  4PGH A;  3HRM A;  4P5O A;  4L5J A;  4L9V A;  4IRI A;  3ZMZ A;  1IXC A;  3BY6 A;  4KIB A;  4KN7 X;  3GXO A;  2IA2 A;  5JHU A;  1P4X A;  3GZ5 A;  1YLF A;  4GXO A;  5ICF A;  1IN8 A;  3DQV C;  4HF2 A;  2RKH A;  4OMY A;  1D8K A;  2Z33 A;  5FFZ A;  3V8K A;  3BJ6 A;  2DPD A;  1REP C;  2F2E A;  4YIF A;  5AIP A;  1T2K A;  5K5O A;  2JTV A;  4M72 A;  1LNW A;  1ZAR A;  4LGW A;  1BI1 A;  4Q5S F;  1O3T A;  5LHG A;  2ISZ A;  2QEN A;  5E8G A;  3WTU C;  1XDS A;  2NRA C;  1UFM A;  4KDP A;  1TQI A;  3V4G A;  3ISP A;  1G3S A;  4AIK A;  3DPL C;  1JHH A;  4EJW A;  2Y75 A;  1FP2 A;  2NAZ A;  2EV5 A;  4RAY A;  3ZMD A;  4FX4 A;  1EH6 A;  2KJB A;  1BM9 A;  2IJL A;  1TNT A;  2PI0 A;  4UVA A;  4L0Z B;  1XCV A;  2E1C A;  2ZME A;  4M73 A;  3N4M A;  2XAQ A;  4PZJ A;  5CVR A;  1SFX A;  1JXS A;  2DTR A;  3K0L A;  3ECH A;  5JFR A;  1PUE E;  3WGH A;  3I59 B;  3FMS A;  1EH7 A;  3F22 A;  2FNA A;  1LDK B;  1YQA A;  1MDM A;  1T98 A;  1K78 A;  3TO7 A;  4BYY A;  2FEZ A;  2IVM A;  1U5T B;  2GAU A;  2YX7 A;  3GFJ A;  2OA4 A;  4B8X A;  1FT9 A;  3HSE A;  2IA0 A;  1DUX C;  5BPD A;  3ROU A;  2PN6 A;  4O3M A;  4GGG A;  1HKT A;  3FX3 A;  4OMZ A;  5D5X B;  1F4K A;  4OIN F;  3VB2 A;  1HXD A;  1XSD A;  1CF7 A;  2HDC A;  4WWC A;  2C6Y A;  1PP8 F;  3LA2 A;  5DCM A;  4HLX A;  1R5G A;  3IL2 A;  2QBY B;  1S7A A;  1SD7 A;  3KEO A;  3KE2 A;  1LDD A;  2XV4 S;  2XRO A;  4I98 B;  5JR3 A;  1QZY A;  2DAO A;  4LMY A;  4Q48 A;  3ERE D;  5AIQ A;  1IRG A;  2XVC A;  4ESJ A;  3KP4 A;  4LB5 A;  4YFN F;  3COA C;  2YR2 A;  2EFO A;  3SZT A;  5FLX Z;  4PGG A;  4G6D A;  4HOB A;  2ZXJ A;  3HHH A;  2QWW A;  3C7J A;  2A6H F;  4RGR A;  3M7G A;  1S29 A;  4AVP A;  5H6Q A;  3O2P E;  4G7H F;  2L01 A;  4A2U A;  4HDU A;  2HKO A;  1KA8 A;  4F7Z A;  3FWE A;  3LST A;  3F21 A;  1KYW A;  1O57 A;  1ZG3 A;  3V8J A;  4L9T A;  3T8R A;  4EGZ A;  1U2W A;  1FY7 A;  4ZH4 F;  4RGS A;  1U8R A;  2EWN A;  4M9X A;  2HQR A;  4KA4 A;  4UVC A;  3K2Z A;  1B6A A;  5JI6 A;  5L3F A;  2QM3 A;  2VC0 A;  2LKP A;  1ZRF A;  3QRF F;  4UV9 A;  2RQP A;  1ZN2 A;  5D8L B;  1S8N A;  2P4W A;  1D3Y A;  3O3K A;  1R5H A;  2UWM A;  4BHC A;  1F9N A;  5L3E A;  4Y17 A;  2PJP A;  2IP2 A;  2GA1 A;  1HW2 A;  1OPC A;  2Z3Y A;  3OOP A;  1HW1 A;  1A04 A;  2RVC A;  4NB5 A;  2TDX A;  1R7J A;  4WF2 A;  2UXX A;  4L0Y B;  3E6C C;  3KP3 A;  2P5L C;  2ZO4 A;  3QP5 A;  4BH9 A;  3TDZ C;  1P2F A;  2WC2 A;  1R00 A;  3MEX A;  3U9G A;  1SMT A;  2E7X A;  2EFW A;  4CIC A;  4GYG A;  4A12 A;  3R4K A;  1BC7 C;  2EA4 A;  2QLZ A;  1MJ9 A;  2CO5 A;  4MQ9 F;  4IHS A;  1T39 A;  2FMY A;  3K1P A;  1L3L A;  2RC4 A;  1GXP A;  1LVA A;  4HZF A;  2P7C B;  5EEG A;  2G7H A;  2LDU A;  3TOA A;  3QU3 A;  1G3Y A;  1RIO H;  2FBH A;  4L9N A;  2XRN A;  1TTY A;  4EV0 A;  1YW9 A;  4Q4Z F;  4BXU A;  1OYY A;  3EET A;  3KLN A;  3WGI A;  3BPV A;  4RB1 A;  1ZG1 A;  2GZW A;  2J5P A;  5KVR A;  1DDN A;  2GA2 A;  2PEX A;  2ZBK A;  3WU1 B;  5F64 A;  3JW4 A;  4U0V A;  5K1Y A;  2NS0 A;  3GO5 A;  4BHB A;  1RZ4 A;  1OKR A;  3CDH A;  2ACJ A;  1B9M A;  1BJA A;  5D4R A;  2LSO A;  3N97 A;  3JTH A;  4ZYG A;  1Z9C A;  3PFI A;  2JT1 A;  4BAY A;  4M74 A;  4EMS A;  1YS6 A;  3LWF A;  5A2Q K;  4M6Y A;  1I1S A;  1TLH B;  2GWR A;  3P9I A;  1LJ9 A;  1YFH A;  1E2X A;  2CYY A;  1ZLJ A;  5LEK A;  3I71 A;  3KEQ A;  3FXQ A;  4YG2 F;  2M87 A;  4M71 A;  2STW A;  5E17 F;  2PQ8 A;  2OU2 A;  1BIB A;  2H09 A;  3U1D A;  3HOS A;  3JAM K;  1V4R A;  2Z9O A;  4HV5 A;  1FBU A;  5AON A;  1TNS A;  3ZMU A;  1V3F A;  4YFX F;  2FSW A;  3E6B A;  4L5I A;  2FBI A;  4KIF A;  3HTS B;  1LQ1 A;  2O6G E;  4HX7 A;  3QPT A;  5FLX K;  1TQM A;  4XBF A;  2OAZ A;  2HKX A;  2IRF G;  5D8K B;  2MBF A;  1GVJ A;  4R79 A;  5L3G A;  3TDU C;  4CO8 A;  3O6B B;  2BE5 F;  2MD5 A;  1B59 A;  1XD7 A;  3GFL A;  1K7A A;  1G4D A;  3TKY A;  1JE8 A;  2OBP A;  3FMQ A;  1P6R A;  2EFQ A;  3JSP A;  1USS A;  3ZMS A;  5HLG A;  3QU6 A;  4UV8 A;  5D4S A;  5HOO A;  5E20 A;  1U3E M;  1OYW A;  1XSV A;  3PQK A;  3J7A O;  2DK8 A;  4P55 A;  3ZP5 A;  1T0F A;  1ZRE A;  2KIU A;  1ZGJ A;  2NYX A;  1BC8 C;  2A61 A;  3H3Z A;  2LF7 A;  1IXR C;  4TV7 A;  1HW5 A;  2E7W A;  2VT2 A;  1KU9 A;  3FZV A;  5CVJ A;  2ETH A;  1KU7 A;  3FF5 A;  1FYK A;  5E1W A;  4CHU A;  2V1U A;  3T1B A;  5FGM A;  2H6C A;  3AAF A;  2OZU A;  5E8I A;  3V7C A;  3HHG A;  4K2E A;  1LDJ A;  1W7P A;  3WTZ A;  1IXS B;  4KT5 C;  3L09 A;  4I0B A;  1FC3 A;  1XN7 A;  1R1T A;  2HYG D;  3HRT A;  2CWE A;  3RDI A;  3I4P A;  2A5Y B;  2E1N A;  5JVT A;  3NEU A;  2GXB A;  3T0Y A;  2FRH A;  2QUF A;  2D1V A;  1STZ A;  2JZY A;  4WXH A;  3BRO A;  2G9W A;  4S05 A;  4G94 A;  2HS5 A;  2JSC A;  2HEO A;  4G6Q A;  4XSX F;  2YX4 A;  2D45 A;  3RJP A;  3V7S A;  4R1H A;  3VOD A;  2FBK A;  4EM2 A;  1H9G A;  2MH2 A;  4M9Z A;  1J9I A;  3MZY A;  2YPR A;  4ZYE A;  3MZH A;  4FHT A;  3F72 A;  1EV7 A;  1HKS A;  1FLI A;  4UVB A;  2LF8 A;  1ZRD A;  4AWX B;  4A5M A;  3BPX A;  4MQV A;  3L7W A;  4N9I A;  4LG0 B;  1L0O C;  4KMF A;  3SQN A;  3BWG A;  1I6X A;  2A68 F;  4A6E A;  3ULQ B;  1Z91 A;  2FOK A;  1Z6R A;  3SHF A;  5L3C A;  3RTR A;  2H27 A;  1R58 A;  4KIC A;  3Q5F A;  1T38 A;  2HR3 A;  1P4W A;  2CSO A;  1J75 A;  5DD4 A;  1FZP B;  3WE2 A;  2VBW A;  1U78 A;  4BNC A;  3CUQ A;  5ERI A;  3VEP A;  3IRQ A;  1IN6 A;  3F6O A;  2OQR A;  2PFB A;  2PLY A;  3H3U A;  4U7D A;  3MCZ A;  1SFE A;  4KMU X;  2FXA A;  1FBS A;  1U6G A;  5CYV A;  3DPT A;  4IHT A;  3ABU A;  2KKO A;  2A69 F;  4E70 A;  5LRR A;  1AOY A;  1R22 A;  4AD9 A;  2M8E A;  2STT A;  1SFU A;  4HQE A;  1FP1 D;  3HIF A;  3QPH A;  2R7D A;  4HYE A;  2DW4 A;  4ASN A;  5LHI A;  1FPQ A;  3QOP A;  4S04 A;  3VFZ A;  3FMR A;  2FA5 A;  2UXN A;  3IHU A;  4I09 A;  1TQP A;  2K86 A;  1UHW A;  2ZKZ A;  4XRF A;  1K6O A;  2L54 A;  4IJA A;  3FM3 A;  2MA3 A;  6PAX A;  2EA2 A;  1WRJ A;  4RGX A;  1D5V A;  2Y0M A;  4IVN A;  1FSE A;  3CTA A;  4ZYH A;  4A5N A;  4LB6 B;  4HV6 A;  5DEQ A;  3F23 A;  4RB3 C;  2HGC A;  3R61 A;  5D6F A;  2HWV A;  2EFP A;  3P7N A;  4MEX F;  4D0P A;  4HQM A;  4HAM A;  2MLK A;  1W7P D;  2JRT A;  1ON1 A;  5E18 F;  3FXU A;  3IKT A;  5DDG A;  4NQW A;  4UXN A;  2ISY A;  1MZB A;  5KK1 A;  1TBX A;  2ZME B;  2CW0 F;  1BN5 A;  5J6X A;  5EEH A;  3WTS C;  3LFK A;  2F5D A;  5CVI A;  2XKP A;  2AS5 F;  3CO7 C;  4LLL A;  1RUN A;  5ILU A;  2ZNZ A;  4P9F A;  5ILV A;  1YO5 C;  5HDG A;  1P92 A;  1K78 B;  2FF4 A;  3J81 Z;  4BQA A;  1U5T C;  3KZY A;  4ZYD A;  3KET A;  2ESH A;  2K27 A;  3RPU A;  2O3F A;  1O7L A;  3BZ6 A;  4CDG A;  1O3S A;  4RB2 C;  5ICC A;  2HYF A;  1E17 A;  3EQL F;  4I7H A;  3ZMT A;  2EK5 A;  1S6L A;  1UST A;  1MGT A;  2BYV E;  1Z05 A;  2Z5U A;  2M45 A;  2ZJ2 A;  5ICG A;  3EUH A;  1CF7 B;  3FHZ A;  1YS7 A;  2XAJ A;  3E5Q A;  4G8X A;  3K69 A;  1J2X A;  5DCM B;  2DK5 A;  2M30 A;  3HYI A;  4LJZ F;  4LLG F;  2HZT A;  3RKY A;  5LGN A;  3GZ6 A;  2M1B A;  1R23 A;  2BEO A;  3IRR A;  3WTW C;  3S2W A;  2CQK A;  4IRG A;  3M1E A;  4CYD A;  2FNP A;  1B9N A;  3DEU A;  4Q47 A;  3F8C A;  1Q1H A;  3WTY C;  3SFZ A;  1NHA A;  3DKW A;  3RYR A;  3KLO A;  5HVQ C;  2ZCW A;  5HDN A;  5IT9 Z;  3ECO A;  1XMK A;  2EV6 A;  4Z2Y A;  4NHJ A;  5LHH A;  1KQ8 A;  1DPR A;  3ZPL A;  4XLN F;  3IWZ A;  4HW0 A;  2X4H A;  4P96 A;  1QQI A;  4HDV A;  4IRH A;  5HS9 A;  4M6X A;  4I02 A;  5FD6 A;  5E1X A;  1R36 A;  5LGT A;  2ZFW A;  1QNT A;  3H92 A;  3GUD A;  5E1Z B;  2EFN A;  4I2O A;  1FBQ A;  2V9V A;  3KP2 A;  1LEB A;  4RAZ A;  3KCC A;  2D1H A;  2GQQ A;  1FYL A;  2PMU A;  5HLI A;  2JPC A;  1XCB A;  2GXG A;  3CUQ C;  3T8T A;  4EVI A;  2HQN A;  4A6D A;  3QP6 A;  3KZZ A;  2L02 A;  3C3W A;  3HTU A;  3JTG A;  4ENJ A;  2W24 A;  2V1X A;  3SZP A;  5DUK A;  2VON A;  5DUI A;  5TJJ A;  3ZN0 A;  4RGU A;  3GYH X;  3NQO A;  2VXZ A; 
#chains in the Genus database with same CATH topology
 3HJE A;  1Y0U A;  3MKW B;  1YX3 A;  3K4M A;  1OR7 A;  4GCV A;  1FOK A;  4UNO A;  4I0A A;  2HOE A;  3RCO A;  1IF1 A;  3BCA A;  2A5W A;  3QPS A;  4M3B A;  2M8G X;  3RIR A;  4I01 A;  4I6Z A;  2DPU A;  4BS9 A;  1FNN A;  4NBQ A;  2EBI A;  4HBL A;  2DOA A;  2K7L A;  3M8J A;  4A0Y A;  3LA7 A;  4EJO A;  1WWX A;  4A93 J;  4BDZ A;  1W1W E;  2Q2E A;  3PO2 J;  1BA5 A;  2CQQ A;  5LRS A;  1GHC A;  3GFM A;  4A0Z A;  2M7A A;  4C2T A;  1V54 H;  4YII A;  3CMA I;  3H3V K;  2DLL A;  2E35 A;  1BIA A;  2BY0 A;  1D0Z A;  2VBZ A;  3DBR B;  3PNV A;  1PP7 U;  2V9P A;  1ZRC A;  4II2 A;  2FU4 A;  3WTT C;  4MHG A;  1TWH J;  4CCJ A;  3EUK L;  4E7J A;  3K70 C;  2HTJ A;  3WGG A;  4D1Q A;  2P8T A;  3DLA A;  3KYD B;  5KCM A;  3C1D A;  5GAG J;  2BGC A;  3TOB A;  2YSR A;  3G3Z A;  3EDP A;  2NVU B;  3RQI A;  5CVU A;  2QSH X;  4ZZL A;  1XGM A;  1TW2 A;  1YG2 A;  4OU0 A;  3CO6 C;  2XB5 A;  1ZQ3 P;  1J0R A;  2HOS A;  5EF6 A;  4ZDO A;  4HST A;  1XG1 A;  4PFP A;  1VND A;  1JTY A;  5BPI A;  1J59 A;  1IG7 A;  1X3U A;  5CJ9 A;  4DBQ A;  2X6Y A;  1H9T A;  3DP7 A;  1MBG A;  3M9A A;  4MNU A;  4AYB N;  3ABT A;  4IF4 A;  2G7U A;  5DCF A;  1WKM A;  4EJV A;  3F8M A;  3HB9 A;  3I59 A;  1Z7L A;  3PNT A;  2HYJ A;  2IT0 A;  3RKX A;  1JJ6 C;  1FTZ A;  5K5R A;  3DFG A;  1GLN A;  2JK3 A;  4QWQ A;  3E6D A;  3I55 I;  2P7V B;  2QA4 I;  1QHH D;  1YRN A;  4EM0 B;  2XPV A;  4BDY A;  4PCQ A;  2W7N A;  2M4K A;  3B73 A;  3MQ0 A;  4UB8 C;  4DNC A;  5DD8 A;  2GXA A;  2RN7 A;  3AL0 C;  2VBX A;  1U5T A;  1XC5 A;  1J5Y A;  5BS6 A;  2G0E A;  4U0Y A;  3ABK H;  3Q9V A;  4U7B A;  1XGO A;  2F4O B;  4EQQ A;  4IZZ A;  2H6B A;  5ED4 A;  5D5U B;  3WTV C;  4ENN A;  5FO5 A;  4RM3 A;  1K6Y A;  1IDY A;  3KIO A;  1R1V A;  1T95 A;  2ESN A;  2ZNY A;  4LLN A;  3BJA A;  2DU9 A;  1ZH5 A;  3TP3 A;  2LLK A;  1PUF A;  1WI9 A;  1OMI A;  3GVA A;  3MAJ A;  2O9L A;  3FXR A;  4N0B A;  2VT3 A;  2DXI A;  3J81 K;  2MLG A;  5FLM J;  1IAW A;  3QOD A;  1Z6T A;  1G4D A;  1J09 A;  1X58 A;  2A6E F;  2GBY A;  3I0T A;  3DKY A;  5EGO B;  1K61 A;  2QSF X;  3BR2 A;  1ZEL A;  2V1D A;  1U9O A;  3K4B A;  2Q8K A;  4FCY A;  4HF0 A;  2QBY A;  2W57 A;  3A03 A;  1IZ1 A;  2COM A;  1W5S A;  4MEY F;  4E7H A;  2HFH A;  1W5T A;  3DBH B;  4OIO F;  3NRV A;  2DI3 A;  4XLA A;  1H0M A;  2L4M A;  3DEE A;  3PIP F;  4H0E A;  2CFX A;  2JN6 A;  4HG2 A;  3CJT B;  3GF2 A;  2M3A A;  4BQQ A;  1TWG J;  5CVV A;  5H20 A;  4RS8 A;  1IN7 A;  1JGS A;  1VQ9 I;  3HC7 A;  2LP0 A;  5D5W B;  4AM3 A;  2M5W A;  3AG1 H;  4BL0 B;  5KNL A;  2QVO A;  3EUH C;  4S0H B;  2E1O A;  3TBI A;  3BR3 A;  2R7Q A;  2RV8 A;  3BG9 A;  3U2R A;  2JPB A;  3ZMV A;  3O8G A;  3GW2 A;  4E7L A;  5IY5 H;  2CGP A;  2R5Y A;  3AG4 H;  1EA3 A;  3E97 A;  1SMY F;  1BBY A;  2VB6 A;  3NAU A;  2COB A;  2LD5 A;  2OQG A;  2XHK A;  1NH3 A;  2VAS A;  3HSR A;  2V6C A;  2JQ7 A;  2ELH A;  3FXO A;  2WY8 Q;  1I39 A;  1IUY A;  1RUO A;  2R7F A;  1UHM A;  1R1U A;  2PBI A;  2DMP A;  2O0Y A;  1SD5 A;  2FML A;  4OIP F;  1XGS A;  4O5V A;  1RPW A;  3GX4 X;  1DPU A;  4XN0 A;  3R0A A;  3SZG A;  3VOE A;  1K79 A;  2KIQ A;  3ERM A;  3ZQ7 A;  3OYH A;  4IOC F;  2DDB A;  3PQJ A;  4XIC A;  4FT8 A;  1VZ0 A;  1UCR A;  2CQX A;  2MH9 A;  1YTY A;  1YW8 A;  4DJA A;  3BQZ A;  1MMN A;  2HOT A;  2P6T A;  1WQ2 A;  3PSI A;  2AQF A;  5IT9 K;  3ZCO A;  4V2G A;  1ETO A;  1E3O C;  2F5F A;  2DMT A;  3BTL A;  3GWZ A;  5LFA A;  1YI2 I;  5H6R A;  2KRF A;  4G12 A;  3BR5 A;  4XKB A;  2EZL A;  5E3L A;  5LEJ A;  3AG2 H;  4U87 A;  3RYP A;  1G6N A;  2ADU A;  3MWM A;  3UR3 C;  5TRD A;  2IW5 A;  1MMD A;  2HI3 A;  1FYM A;  3HSF A;  2L7M P;  4ANJ A;  1Y6I A;  2EIM H;  2VJJ A;  3GTO J;  3I54 A;  2DQR A;  2K9L A;  2NVY J;  5IP6 A;  3GTP J;  2XAG A;  4CXF A;  2JRM A;  2EB7 A;  4F92 B;  3IC7 A;  3DCF A;  3SXY A;  3HPH A;  1RC9 A;  3M8E A;  3H36 A;  4FX0 A;  3LAJ A;  4DW6 A;  2CS3 A;  5CQE A;  1O3Q A;  2DFF A;  1TC3 C;  4KFC A;  3W2W A;  5HS8 A;  1OIS A;  1OJL A;  2WY7 Q;  2CW8 A;  2VE8 A;  1FWZ A;  3HRU A;  1GV2 A;  4PDK A;  2AO9 A;  1LFU P;  5CKT A;  3GEZ A;  3JRB A;  4X1E A;  4CSW A;  1JUP A;  3A4C A;  4PJL A;  5FJ8 J;  1XDU A;  1XGN A;  1SAU A;  3CF5 F;  3K6G A;  3JSO A;  3JRE A;  2JSP A;  1LVK A;  5B1A H;  4GO1 A;  2O7O A;  4XLC A;  1MH3 A;  2WWY A;  4ENK A;  1ZAO A;  2DYS H;  4XSZ F;  3RPQ A;  4BE0 A;  2JVH A;  2XSJ C;  3LL7 A;  2BV6 A;  5LBQ A;  2MC3 A;  1F1Z A;  4B09 A;  4LOC A;  1WJC A;  2F5V A;  3F8B A;  5LLQ A;  2L9S A;  3E3V A;  1ZLK A;  2D2W A;  5ILS A;  4QTR A;  1MSE C;  1CQT A;  4B44 A;  1GXQ A;  3HUG A;  4ESF A;  1NG6 A;  3KP6 A;  3P9C A;  5M5Y J;  1LFP A;  2M0C A;  4UUS A;  2OD5 A;  2XB0 X;  3ESW B;  4IEJ A;  1DU6 A;  5EJC A;  1JKQ C;  1QPM A;  3Q9S A;  2XAS A;  2VOO A;  3I53 A;  1W7P B;  4MTE A;  1SVO A;  3M1C A;  2Q0O A;  2CUZ A;  3BDD A;  2ID3 A;  3TQN A;  3H9Q A;  5A2Q Z;  1DP7 P;  2DFE A;  2O03 A;  2RNJ A;  3R0J A;  2PMZ A;  2IPQ X;  2HNH A;  1TL8 A;  2LFB A;  2EQR A;  2V6E A;  1KQ9 A;  5F1R A;  2GLO A;  1X3W B;  2X6W A;  3BP8 A;  4A0X A;  4L5E A;  3OS0 A;  3ZN1 A;  3Q0W A;  1FSH A;  4KIG A;  3QQA A;  3KP7 A;  1APL C;  3CP2 A;  2P5K A;  1SD6 A;  2M0M A;  3WHC A;  1JHF A;  3R6S A;  3S3N A;  2VJ5 A;  3PNY A;  1KZH A;  1G3T A;  2KJC A;  5FD5 A;  3G73 A;  1B4A A;  1UB9 A;  5BMZ A;  4BHP A;  3C2H A;  3OIP A;  3W2V A;  3SJM A;  3A2K A;  4W97 A;  3RZO J;  2FD5 A;  2K02 A;  3JAM Z;  4V2F A;  3DXJ F;  1S3J A;  4IO9 F;  3HZJ A;  1F5T A;  4WCG A;  3U1K A;  1B8I A;  3LSI A;  2FOW A;  4LK0 F;  4ZDP A;  2A07 F;  4ENM A;  2LY2 A;  5B1B H;  3BOQ A;  4ITV A;  1WJF A;  2K4J A;  1KON A;  2AXL A;  1T08 B;  2FE3 A;  1I5Z A;  4U0W A;  1AWC A;  1UJ8 A;  1YIT I;  4AIJ A;  3MZ8 A;  2DMQ A;  3CF2 A;  4OIQ F;  3GFI A;  4EJT A;  4WK8 F;  5E3N A;  2V79 A;  3C18 A;  4L18 B;  2HVQ A;  1AKH A;  1I6H J;  3JRG A;  4MFD A;  1S7O A;  3GZN B;  3P9K A;  2JUG A;  4Y13 A;  2B9S A;  2L5Q A;  2F6C A;  4HRI A;  1QRY A;  3IH4 A;  4MTD A;  2OZ6 A;  2LBF A;  5HOD A;  3EUA A;  2WV0 A;  3V42 A;  4M3D A;  5K5Q A;  4YRV A;  1ACI A;  2HTS A;  2P6S A;  4UUV A;  3HOZ J;  5DYM A;  2H8R A;  1QGP A;  2ME0 A;  3H9J A;  4NC8 A;  4DOZ A;  2R7S A;  4M3E A;  2XIG A;  5BOX A;  2XKO A;  4OOI A;  1Z77 A;  2QZ8 A;  1O7F A;  2TRT A;  3D5R C;  3LA3 A;  5GTH C;  5J1R A;  3DV8 A;  3R60 A;  1LB2 A;  3FM5 A;  1KGS A;  3KFW X;  4KN4 X;  1VQN I;  2VQC A;  4JYK A;  3LQQ A;  3HRS A;  1IN4 A;  3TGN A;  5CLS A;  4X6A J;  4YEJ A;  2R7X A;  5EYR A;  1OCP A;  5J8C A;  3RKW A;  2VJ4 A;  2W25 A;  1J7K A;  2WAQ A;  2DT5 A;  5HS7 A;  1PVE A;  2DFI A;  4JK1 X;  1MDM B;  2KL4 A;  4HX4 A;  4U88 A;  2O61 A;  3QAH A;  3CUQ B;  1OFC X;  4XOP A;  1HST A;  3OY9 A;  4BE2 A;  3G2B A;  2L4A A;  4XKW A;  4EJU A;  1BR4 A;  5D5V B;  1MBJ A;  3LAP A;  3J80 Z;  3W6J B;  3L2C A;  5L3D A;  4XLP F;  4HF1 A;  4KUM A;  2QYO A;  1EH8 A;  4RAG A;  2XGX A;  4ETS A;  2Q1Z B;  3IKV A;  4CCN A;  4M3G A;  1BR1 A;  4O6J A;  3B6C A;  3KYC B;  3TO9 A;  3GTG J;  1IRF A;  2EIN H;  3FBI B;  3CJR B;  1HQC A;  4QLC U;  3BC8 A;  2XUB A;  5FFX A;  2VPR A;  2V1N A;  2K4B A;  5TGT A;  2NNN A;  4D5F A;  2VE9 A;  1O3R A;  1Y1V J;  1SC7 A;  3KP5 A;  4C3H J;  3AKZ A;  4C2M J;  1Y8R B;  1ERD A;  5FLV A;  1P9Q C;  3GTQ J;  1ZG5 A;  2DOF A;  5EG0 B;  2DFH A;  2FQ3 A;  2WV1 A;  1ONV A;  3A0H C;  3B02 A;  3TO6 A;  2KDO A;  2VOD A;  4AC0 A;  2VKE A;  3RI4 A;  4EGY A;  2LKX A;  3GCM A;  1TWC J;  2RDP A;  3JRA A;  2MFZ A;  2HZD A;  2H1L A;  1WSU A;  2VBY A;  4CGZ A;  3I64 A;  1TW3 A;  1SAX A;  3MMY B;  3OYN A;  4A3F J;  1BOA A;  1LE8 A;  4HX8 A;  1X19 A;  1G3W A;  2KIM A;  4BE1 A;  3TW6 A;  4JBA A;  1YJN I;  1ULY A;  1RR7 A;  1VQK I;  2ZB9 A;  4XM3 A;  3F8N A;  3FXK A;  5FB2 A;  3W6V A;  1NG7 A;  2LNB A;  3LSJ A;  4UHT A;  2IS2 A;  2DBB A;  1N78 A;  1T6S A;  2XGE A;  4WXC A;  3NWS A;  4G7Z F;  1P4A A;  1XSX A;  1ODD A;  4G9Y A;  1DU0 A;  1ZGA A;  5GP9 A;  4G7O F;  4HA8 A;  1CGP A;  1YIO A;  2CMP A;  3OL3 A;  1Z1D A;  2MG4 A;  2W82 A;  2QQB A;  2BVM A;  3LNQ A;  1C0W A;  2WA0 A;  3CP8 A;  2E2H J;  3DEW A;  3OYM A;  1G2H A;  2M34 A;  4WX9 A;  2J5O A;  3OYG A;  1Y39 A;  5DM7 F;  1MJB A;  3DPU A;  3SEZ A;  4FAS D;  4ZZD A;  1TT5 B;  3BJO A;  1PDN C;  4AIH A;  2KRC A;  1B1B A;  2CU7 A;  4MLO A;  1X3Z B;  3Q0U A;  4N9H A;  4MFE A;  1ZYR F;  4CCL A;  5HDK A;  3OYB A;  3E5X A;  5K7F A;  2XAF A;  2UZK A;  2F5C A;  5M5X J;  3ML6 A;  3WG9 A;  3K1N A;  4WXD A;  4IOA F;  1SD4 A;  4J01 A;  4NQW B;  3WU0 A;  1R4N B;  3E5U A;  4XRS A;  3IAM 2;  3K1M A;  1ZHF A;  2DO7 A;  3L9F A;  4OIR F;  3ZRG A;  3D0S A;  1QO0 D;  3AL0 B;  3FHN A;  3RSN A;  2LG4 A;  5FKM A;  2HQ5 A;  4QSH A;  3K10 A;  2Y48 A;  1IW7 F;  2K9M A;  2I10 A;  4DZJ A;  4PJJ A;  5J8F A;  3IAS 2;  1BI2 A;  3ASN H;  2Z99 A;  4IPA A;  2ECC A;  2B0L A;  2Y69 H;  1VI0 A;  4RAF A;  4CZZ A;  1SVL A;  2VC1 A;  3F6V A;  3WTX C;  3LSK A;  3OV8 A;  3REO A;  1I1G A;  4LIT A;  4M9S A;  1A36 A;  3S1N J;  4KYW A;  1I27 A;  2KIF A;  4I76 A;  3OIO A;  2ZJR F;  1W4M A;  1BI0 A;  5DV5 A;  2ZJQ F;  3LQR A;  3IWF A;  5ICE A;  1VTN C;  4N4N B;  1MD0 A;  2VJI A;  1XMA A;  1G8X A;  5D6E A;  2QQA A;  3ELK A;  1QHG A;  1MIJ A;  1T33 A;  5BQT A;  1EKE A;  2A05 A;  3EYI A;  1Z7U A;  4ESB A;  4IQ4 A;  3CCJ I;  5KHD A;  2A3S A;  2CG4 A;  2K9Q A;  2YU3 A;  2BBY A;  2L3D A;  3MKL A;  3O8H A;  1KYZ A;  1SFO J;  5B66 C;  1WZ2 A;  1HBX G;  1WHU A;  4LD5 A;  5GAH J;  2EV0 A;  1PJR A;  1QZZ A;  4Y4R A;  5L3B A;  1ENH A;  1VQM I;  3VYR B;  4XID A;  5JVG F;  4D7N A;  2W85 A;  2JJ7 A;  2F5E A;  3L2V A;  1KU2 A;  3LSR A;  1BI3 A;  3VYU B;  1BOB A;  1P7I A;  2JUC A;  3G4S I;  3I5U A;  3V7R A;  2Z2S B;  2K9N A;  3M8F A;  1ZR2 A;  1WJE A;  3HOT A;  1WJ5 A;  2YUS A;  4CYC B;  3D1N I;  3GTM J;  2EJR A;  2Y0S A;  3L00 A;  4A3K J;  3HEF A;  1IJW C;  4GYI A;  2OPT A;  3DF8 A;  2K85 A;  4YFK F;  3ABL H;  3K9T A;  3I56 I;  2BW3 A;  3GLX A;  2PG4 A;  4HNU A;  4HLY A;  3S17 J;  3CUO A;  1LEA A;  1WFX A;  2EZK A;  3PO3 J;  3CC7 I;  2VN2 A;  3CJN A;  1R6R A;  2XAH A;  2BHY A;  4M3F A;  2RGV A;  3S2H J;  4EM1 A;  4R8H A;  4L9J A;  3KYL A;  2RNG A;  2FUG 2;  4II3 A;  3FKI J;  4DYR A;  5LGU A;  4DQ2 A;  1T56 A;  3HOW J;  1EF4 A;  4P9U A;  4KNY A;  1MND A;  3OS2 A;  1XS9 A;  1QBJ A;  3EYY A;  1OCZ H;  2R3S A;  4LG0 A;  1RRJ A;  2JVG A;  3MFK A;  3F8F A;  1OYI A;  1K4S A;  1IN5 A;  4LFU A;  1FTT A;  2P5V A;  4XRS G;  2ID6 A;  1KQ0 A;  2W00 A;  5FRM A;  2X51 A;  2NOJ B;  3ZQF A;  1JKO C;  1HSJ A;  2WTE A;  3WOD F;  4MGR A;  3OOU A;  3HOV J;  4IXA A;  2W84 A;  1HF0 A;  2PMH A;  3M4O J;  2QGU A;  2L9R A;  1YW7 A;  3RZD J;  3A1Y A;  5LD2 C;  3GME A;  2O8X A;  2K3F A;  1KU3 A;  2NVQ J;  2NNY A;  4PJN A;  4XRM A;  1D8J A;  2GIV A;  2HQA A;  2IA1 A;  3CLO A;  3D5L A;  4HNV A;  5HLH A;  4NNJ A;  4CCM A;  2R93 J;  2JMW A;  3E6M A;  3T5X A;  5F6F A;  2H94 A;  3WE3 A;  1MJA A;  2X0L A;  1NK2 P;  2R7W A;  3FK7 A;  3HOU J;  5DS9 A;  1MKM A;  1O4X A;  3W6K B;  1RNL A;  4PSX A;  3I58 A;  1HKQ A;  3WHB A;  3S3M A;  2ZXI A;  1JUM A;  3V8L A;  2EZH A;  2M7B A;  4LK1 F;  2IGM A;  2QQ9 A;  5IT3 A;  1XB4 A;  5C4J J;  1FX7 A;  4FTH A;  1YYV A;  2UUZ A;  3F9K A;  1ON2 A;  1S5L C;  4ON0 A;  3F3X A;  3D5S C;  3KX2 A;  4RB0 A;  2KZV A;  4JQF A;  2VOP A;  4Y15 A;  2DQL A;  2JA8 J;  1RI7 A;  2CJJ A;  5FRN A;  3G1O A;  4RMN A;  2DMU A;  3HRM A;  4PGH A;  3J80 K;  4P5O A;  4L5J A;  4L9V A;  4IRI A;  1HC8 A;  3ZMZ A;  2DOE A;  1IXC A;  3BY6 A;  4KIB A;  4KN7 X;  3U21 A;  2IXS A;  4A3E J;  2EPF A;  3OSG A;  3AG3 H;  3GXO A;  3TW7 A;  3L2W A;  2IA2 A;  5JHU A;  4AID A;  1P4X A;  3GZ5 A;  1YLF A;  4GXO A;  4HEA 2;  4RA2 A;  5ICF A;  1IN8 A;  3DQV C;  4HF2 A;  2RKH A;  3S1M J;  2W4S A;  4OMY A;  1D8K A;  2Z33 A;  2PJR B;  2VPL A;  5FFZ A;  2NS7 A;  3V8K A;  3BJ6 A;  2DPD A;  2LKS A;  2QKL B;  1REP C;  2F2E A;  1Q1V A;  4ABZ A;  2XSD C;  1VQ7 I;  4YIF A;  4C9Y A;  5AIP A;  1T2K A;  1MBH A;  4KIS A;  2DT6 A;  5K5O A;  2IGK A;  4MO7 A;  1LKX A;  2WBM A;  2JTV A;  2LRE A;  2BZT A;  4M72 A;  1LNW A;  1ZAR A;  1JUS A;  1YJ9 I;  3TED A;  5H2F C;  4LGW A;  5E3M A;  2F48 A;  1BI1 A;  2R5Z A;  4BQO A;  5GPA A;  4Q5S F;  1O3T A;  5LHG A;  2ISZ A;  1S7E A;  3HKZ N;  2LK2 A;  3J7Y J;  4EEF G;  1MNM C;  1R71 A;  2QEN A;  5E8G A;  3S32 A;  3WTU C;  4IX7 A;  1XDS A;  2BVL A;  2NRA C;  1UFM A;  4KDP A;  1Y0N A;  5HLT A;  2LRD A;  1TQI A;  3V4G A;  3IP4 B;  3ISP A;  4GDF A;  1G3S A;  4A69 C;  5FKO A;  4AIK A;  3DPL C;  1JHH A;  4EJW A;  2HU9 A;  2GIZ A;  2Y75 A;  2HXO A;  3PSF A;  1HDD C;  3BG6 A;  1YHQ I;  3A0B C;  4XQF A;  1FP2 A;  2NAZ A;  2EV5 A;  4RAY A;  3ZMD A;  4CZC A;  3MD2 A;  4ZJZ A;  3IV5 A;  4FX4 A;  3KPH A;  4DGW B;  1EH6 A;  2KJB A;  1BM9 A;  2IJL A;  1TNT A;  2PI0 A;  4JX4 A;  2NVX J;  1R49 A;  1AA7 A;  4UVA A;  4L0Z B;  2CW7 A;  1XCV A;  1N25 A;  2E1C A;  4XON A;  2ZME A;  4M73 A;  3PFY A;  3N4M A;  2IS4 A;  2XAQ A;  4PZJ A;  4IHW A;  5CVR A;  1SFX A;  1JXS A;  1E0E A;  4KIT B;  2LY9 A;  2DTR A;  3K0L A;  3ECH A;  5JFR A;  3ONQ A;  5IYD J;  1U0J A;  1PUE E;  2L0K A;  5C4X J;  3WGH A;  3A01 A;  3I59 B;  3FMS A;  1EH7 A;  3F22 A;  3S14 J;  2QQ8 A;  3BTJ A;  2FNA A;  1LDK B;  1YQA A;  4OAY A;  2P81 A;  1MDM A;  3CDL A;  4BQN A;  1T98 A;  1K78 A;  1YRN B;  3TO7 A;  2M2E A;  3IH3 A;  4BYY A;  4BXX J;  2FEZ A;  3BR6 A;  2IVM A;  3CMM A;  1W0U A;  1U5T B;  2GAU A;  4A3C J;  4YIR X;  2YX7 A;  1JJ8 C;  3GFJ A;  2OA4 A;  2V4J C;  3JRC A;  2YU9 J;  3P5J A;  2LH9 A;  4B8X A;  3S1Q J;  1FT9 A;  1Z3Y A;  3HSE A;  5F04 A;  2IA0 A;  4E7S A;  3ABM H;  2MYS A;  5BPD A;  1DUX C;  2K5C A;  3ROU A;  2X85 A;  2PN6 A;  1PUF B;  4O3M A;  4GGG A;  3C2B A;  5J1U A;  1Z0X A;  1HKT A;  3FX3 A;  1U8B A;  3G71 I;  2CQN A;  2NS8 A;  4OMZ A;  1X4O A;  2JA5 J;  5D5X B;  3M07 A;  1F4K A;  4OIN F;  3PL8 A;  2WAF A;  2Y31 A;  3VB2 A;  1HXD A;  1XSD A;  1CF7 A;  1IV6 A;  2HDC A;  3I4M J;  4WWC A;  2C6Y A;  3H0D A;  3ZQI A;  1PP8 F;  3LA2 A;  5DCM A;  4FQG A;  4HLX A;  1R5G A;  3IL2 A;  2QBY B;  1S7A A;  2GOM A;  2I8D A;  1MBE A;  1SD7 A;  1H88 C;  2M9H A;  3KEO A;  3CCM I;  4ZC3 A;  3KE2 A;  5FKL A;  1LDD A;  2XV4 S;  2XRO A;  1TT0 A;  1PYV A;  3BCB A;  4HPQ A;  4I98 B;  5JR3 A;  3ZQH A;  5J1Y A;  3ZXS A;  1SFK A;  1YOV B;  2IEK A;  1UMQ A;  1QZY A;  2DAO A;  4LMY A;  3MKY B;  4EAT A;  3DBL B;  4Q48 A;  4C30 A;  3ERE D;  5AIQ A;  1MMS A;  1IRG A;  1OLT A;  2XVC A;  4ESJ A;  1VQ5 I;  3KP4 A;  1X1C A;  4LB5 A;  1WJB A;  3QYB A;  4NC6 A;  2KRH A;  3I3L A;  3VSL A;  4YFN F;  3CC2 I;  5FKN A;  3COA C;  2YR2 A;  4F93 B;  2EFO A;  3SZT A;  5FLX Z;  4PGG A;  4G6D A;  1B72 A;  1GVD A;  1A31 A;  3H5N A;  4HOB A;  2OTJ I;  4Y52 J;  2ZXJ A;  3HHH A;  1ETQ A;  4XOR A;  2QWW A;  3FKJ A;  4UUT A;  1UAA A;  3C7J A;  4B4C A;  3OYL A;  3UKG A;  3WU2 C;  2A6H F;  2LMD A;  2CQ7 A;  4UY8 I;  4MIM A;  4RGR A;  1VF9 A;  3M7G A;  2UV1 A;  1S29 A;  3GTJ J;  2LVS A;  4AVP A;  4OWR B;  2E1M C;  4Z6Y A;  2E2I J;  2LOO A;  5H6Q A;  4HNT A;  3OYI A;  2F4I A;  3O2P E;  4G7H F;  2L01 A;  3C2G A;  1OCC H;  1GV5 A;  2HDW A;  4A2U A;  1W0T A;  4HDU A;  2HKO A;  1KA8 A;  4F7Z A;  3FWE A;  3LST A;  3F21 A;  1KYW A;  4BJ6 C;  1JT6 A;  1O57 A;  2LR8 A;  3CLQ A;  5GAE J;  2KZG A;  4M6V A;  1ZG3 A;  3V8J A;  3DU5 A;  4RDU A;  2E2J J;  4L9T A;  3T8R A;  1K4T A;  4EGZ A;  2KFD A;  4BJ5 C;  1U2W A;  3QOE A;  2PMZ N;  3GBG A;  1FY7 A;  4ZH4 F;  4RGS A;  2RRE A;  1U8R A;  1BL0 A;  1LFB A;  2EWN A;  4M9X A;  5IP9 J;  1D0Y A;  2HQR A;  2OCE A;  4KA4 A;  1IRX A;  4BEH A;  4UVC A;  2D5V A;  3K2Z A;  1YIJ I;  1B6A A;  5JLX A;  5JI6 A;  5L3F A;  1X4P A;  1S9H A;  4E7I A;  2QM3 A;  2VC0 A;  4LIV A;  2E36 A;  4PJ0 C;  2LKP A;  1RKW A;  1JI8 A;  1ZRF A;  3QRF F;  4UV9 A;  4KJZ A;  2RQP A;  3BG5 A;  1ZN2 A;  2Y9Z A;  4V19 K;  4GRI A;  3OYK A;  2DDA A;  5D8L B;  1FMV A;  3IH2 A;  1S8N A;  2P4W A;  1D3Y A;  5JLW A;  3EPZ A;  3O3K A;  2V26 A;  2XF6 A;  2WAD A;  1R5H A;  2UWM A;  1WPK A;  4BHC A;  5IOY A;  2E5Z A;  2MGQ A;  1WVR A;  3VSK A;  5CPR B;  1F9N A;  3HUG B;  5L3E A;  1ZR4 A;  4Y17 A;  4UUS B;  1FOW A;  3DTE A;  2PJP A;  1FEX A;  2IP2 A;  2GA1 A;  4XKC A;  5GAD J;  3HG9 A;  3DKX A;  4D9J A;  4E6K G;  1OPC A;  1MBF A;  1HW2 A;  1F43 A;  1MH4 A;  2Z3Y A;  3OOP A;  1A04 A;  1HW1 A;  3TL4 X;  2RVC A;  2R7V A;  1MW7 A;  4NB5 A;  2TDX A;  1R7J A;  3KZI C;  1WGX A;  4WF2 A;  1UEL B;  2UXX A;  4L0Y B;  3E6C C;  3KP3 A;  2P5L C;  3FXM A;  1W36 D;  2ZO4 A;  1MBK A;  3QP5 A;  3TDZ C;  4BH9 A;  4QPQ A;  1P2F A;  2FJ1 A;  2WC2 A;  4C3I J;  4YEL A;  5KAF C;  1X1P A;  1R00 A;  5EDN A;  3MEX A;  2ZFU A;  4H4K C;  3VPR A;  5DM6 F;  3U9G A;  1SMT A;  2E7X A;  5EZG A;  4B1R A;  2VI6 A;  2EFW A;  3W2A A;  5IPA A;  4CIC A;  4GYG A;  2VKD A;  4A12 A;  1VQ6 I;  1DGW Y;  3R4K A;  3I4N J;  1BC7 C;  2EA4 A;  2QLZ A;  4IQJ A;  3CME I;  1MJ9 A;  2W1O A;  3L2Q A;  2CO5 A;  3ZQC A;  4MQ9 F;  4IHS A;  3ZQQ A;  1T39 A;  2P0W A;  3ZQG A;  2FMY A;  2Z1D A;  1D1C A;  3K1P A;  1L3L A;  2RC4 A;  1GXP A;  2AXT C;  1LVA A;  4HZF A;  3OSF A;  1QA6 A;  1V5G A;  1B8I B;  2IGN A;  2P7C B;  3DU6 A;  2VL8 A;  5EEG A;  4GFB A;  2I5U A;  1EJ9 A;  3BR1 A;  9ANT A;  2G7H A;  1I50 J;  3BR0 A;  2X9D A;  2LDU A;  4XMY A;  3TOA A;  3QU3 A;  3HOY J;  4DIQ A;  4XLF A;  5CQG A;  1G3Y A;  1RIO H;  2FBH A;  4L9N A;  3DLL F;  2XRN A;  3CES A;  1TTY A;  4EV0 A;  1AKH B;  1YW9 A;  3LOC A;  4Q4Z F;  4BXU A;  1V55 H;  1OYY A;  1VQL I;  1VQ8 I;  1E3P A;  3EET A;  2F4M B;  3KLN A;  3WGI A;  2LBF B;  3BPV A;  2OC6 A;  4RBO A;  2QF7 A;  2EIL H;  4RB1 A;  2ZME C;  3H1C A;  3ZOB A;  3K4J A;  3LSH A;  1ZG1 A;  3K4N A;  3H35 A;  2GZW A;  3VWB A;  2J5P A;  2O5R A;  5KVR A;  1XPX A;  2GA2 A;  1W36 C;  3IUO A;  1DDN A;  2PEX A;  4E7K A;  1ITY A;  2ZBK A;  4AVZ A;  3WU1 B;  3CCE I;  1XMX A;  2RQQ A;  1TWA J;  3JW4 A;  5F64 A;  1T8I A;  3J7A Y;  1RET A;  5F0C A;  4U0V A;  5IYC J;  5K1Y A;  2XGD A;  2NS0 A;  3GO5 A;  4BHB A;  1IO2 A;  1RZ4 A;  1OKR A;  3CDH A;  2E71 A;  2ACJ A;  1B9M A;  1BJA A;  5D4R A;  1GDT A;  2LSO A;  5EGO A;  3N97 A;  3JTH A;  2VXD A;  4JP0 A;  4AYB A;  1ETW A;  4A3I J;  3ZR8 X;  4ZYG A;  4PK4 A;  1Z9C A;  3PFI A;  2DA3 A;  2DTZ A;  3SYT A;  2VKV A;  2JT1 A;  1LPQ A;  2N8G A;  3LSP A;  3PUB A;  4BAY A;  4M74 A;  1VFC A;  2R92 J;  3BTC A;  3X2Q H;  5M5W J;  4EMS A;  2B63 J;  2CFO A;  1YS6 A;  2DOD A;  5TIS C;  2Z16 A;  3LWF A;  5A2Q K;  1FIA A;  4M6Y A;  3KEY A;  1I1S A;  4ZDL A;  1TLH B;  3RQ4 A;  2GWR A;  3P9I A;  1LJ9 A;  4XLE A;  3FIW A;  1YFH A;  3DTI A;  1E2X A;  5KAI C;  3BZC A;  2CYY A;  1ZLJ A;  3E0J B;  1GUU A;  1MSF C;  2QSG X;  5LEK A;  4CA0 A;  2ZXH A;  2EIK H;  3I71 A;  3Q3S A;  3KEQ A;  3FXQ A;  4YG2 F;  2HPM A;  2M87 A;  2IGO A;  1WCM J;  1H8A C;  4M71 A;  2STW A;  5E17 F;  2R7O A;  2PQ8 A;  2OU2 A;  1JGG A;  3S93 A;  1BIB A;  2E34 A;  5GPC A;  2H09 A;  2NOG A;  3PM1 A;  5IYB J;  1V5E A;  4XN3 A;  5FRO A;  2OV7 A;  3U1D A;  2FQ4 A;  3HOS A;  3JAM K;  1V4R A;  4BAC A;  2Z9O A;  4HV5 A;  1D1B A;  2XGC A;  1FBU A;  2IBD A;  5AON A;  1YX5 A;  3A02 A;  3SDG A;  1TNS A;  2X1C A;  1RR8 C;  3ZMU A;  1V3F A;  3HXL A;  4YFX F;  2FSW A;  3HGY A;  3E6B A;  1R4M B;  1LE8 B;  4BJT A;  3LSG A;  4L5I A;  4B3X A;  1DQU A;  2FBI A;  4KIF A;  3HTS B;  1LQ1 A;  3GLL A;  2O6G E;  4HX7 A;  3QPT A;  5FLX K;  3DTK A;  1OCR H;  2JA2 A;  1TQM A;  4XBF A;  2OAZ A;  2HKX A;  2IRF G;  5D8K B;  2MBF A;  1GVJ A;  4R79 A;  2EZI A;  5L3G A;  4ZYA A;  4FE7 A;  3TDU C;  2ICW G;  3QWL A;  4CO8 A;  3O6B B;  2BE5 F;  2WB1 N;  3OR1 C;  2MD5 A;  2DA4 A;  1R5I D;  1B59 A;  3OR2 C;  2XC7 A;  1V5F A;  2ZC2 A;  4E4H A;  1XD7 A;  1BW6 A;  1Z67 A;  3CDI A;  3GFL A;  3H9G A;  3TKY A;  1K7A A;  1Y56 A;  3BLY A;  4Y7N J;  1JE8 A;  2OBP A;  3FMQ A;  1P6R A;  1HDP A;  2EFQ A;  1USS A;  3ZMS A;  3JSP A;  2VQG A;  5HLG A;  3VDX A;  3QU6 A;  4UV8 A;  2MAB A;  3HGG A;  3RPU D;  2VLA A;  2ZJP F;  1U9N A;  3K2A A;  4F91 B;  2ZSH B;  1HCR A;  5E79 C;  3UNG C;  5E20 A;  5D4S A;  5HOO A;  3CCR I;  1U3E M;  1OYW A;  1XSV A;  3PQK A;  3J7A O;  2DK8 A;  4BY1 J;  2CV1 A;  4BUP A;  4P55 A;  3B6A A;  3ZP5 A;  5HNH A;  2R7R A;  1T0F A;  3HKZ A;  1UZC A;  2ECB A;  1ZRE A;  2KIU A;  1VQO I;  2MC4 A;  1ZGJ A;  1S72 I;  1QZE A;  2NYX A;  3FK6 A;  4CCK A;  1BC8 C;  2CH0 A;  2EIJ H;  2A61 A;  2KIS A;  3TP0 A;  3H3Z A;  1ZK8 A;  5BNG A;  2XF5 A;  2LF7 A;  1IXR C;  4TV7 A;  2JA7 J;  1HW5 A;  3MVP A;  3G1M A;  2E7W A;  1ZGW A;  4PSW A;  2VT2 A;  1KU9 A;  4Y33 A;  2DYR H;  3N05 A;  3FZV A;  5CVJ A;  3QYE A;  3OYC A;  2ETH A;  1KU7 A;  3FF5 A;  3RKQ A;  1FYK A;  2YS9 A;  2BY3 A;  5E1W A;  4CHU A;  1N77 A;  2Y0S N;  2V1U A;  1D1A A;  3T1B A;  5FGM A;  2H6C A;  3ZGK A;  2AQE A;  4JX6 A;  3AAF A;  2OZU A;  5E8I A;  3V7C A;  3HHG A;  5J4Y A;  4K2E A;  1JKP C;  1LDJ A;  1W7P A;  3WTZ A;  4AU7 A;  4F55 A;  1IXS B;  2VUM J;  4KT5 C;  3L09 A;  2DA7 A;  4J00 A;  4I0B A;  5B5E C;  1A6Q A;  1NTC A;  1IV8 A;  2BY1 A;  2L2O A;  1FC3 A;  1XN7 A;  4NC7 A;  3OYE A;  1R1T A;  2NVT J;  1Y8Q B;  2HYG D;  3HRT A;  2CWE A;  3I9V 2;  3PUF A;  3RDI A;  2CUF A;  2OJE D;  2MD0 A;  2LY1 A;  2OF7 A;  2XRL A;  4XR6 A;  3I4P A;  5EZH A;  3OS1 A;  2A5Y B;  3K4L A;  2DCE A;  2E1N A;  5JVT A;  3NEU A;  1ZTR A;  2GXB A;  3BTI A;  3CCQ I;  1SEU A;  3T0Y A;  3CD6 I;  4A3D J;  2IS6 A;  3QPL A;  2FRH A;  3PJR A;  2QUF A;  2D1V A;  1STZ A;  2IAI A;  2JZY A;  1P7J A;  4WXH A;  5K7H A;  4C2U A;  1X2M A;  3BRO A;  3OYJ A;  2KLO A;  2G9W A;  3E7L A;  4S05 A;  2Q2E B;  4G94 A;  2HS5 A;  2JSC A;  4LIU A;  2HEO A;  4G6Q A;  4XSX F;  3HBL A;  2YX4 A;  3G1L A;  1W5C C;  1BW5 A;  3S2D J;  2D45 A;  2VQL A;  3RJP A;  3V7S A;  4R1H A;  3VOD A;  4CUG A;  2FBK A;  4EM2 A;  1H9G A;  2MH2 A;  4M9Z A;  1J9I A;  3MZY A;  2QEX I;  2KP6 A;  2B7E A;  1JT0 A;  5F0F A;  3VYS B;  2YPR A;  4ZYE A;  2FX0 A;  1IGN A;  3MZH A;  2BW3 B;  4FHT A;  3HL2 A;  2VKH A;  1YJW I;  3F72 A;  1EV7 A;  1HKS A;  2LC2 A;  4IHV A;  1FLI A;  2XAU A;  4UVB A;  3H0G J;  2LF8 A;  1H89 C;  4UB6 C;  4J19 A;  1ZRD A;  1Z21 A;  2JWT A;  4AWX B;  4D5C A;  2DA5 A;  2ME6 A;  2E1M B;  4A5M A;  3BPX A;  5B3S H;  2NXN B;  4MQV A;  2R0Q C;  3L7W A;  4F3Q A;  4N9I A;  4LG0 B;  1L0O C;  4KMF A;  3SQN A;  3BWG A;  1FOX A;  1I6X A;  1YE9 A;  3LFU A;  2A68 F;  4A6E A;  3LMM A;  3ULQ B;  3JRD A;  2OTL I;  1Z91 A;  2EH3 A;  1RES A;  2FOK A;  5F1J A;  1Z6R A;  1X1D A;  3SHF A;  5K7Z A;  5L3C A;  4RM2 A;  3RTR A;  3L2R A;  1R58 A;  2H27 A;  4KIC A;  3Q5F A;  1T38 A;  2HR3 A;  2ZXW H;  1P4W A;  5J47 A;  2CSO A;  1J75 A;  2PX9 A;  3S8P A;  5DD4 A;  1FZP B;  4A3L J;  1FMW A;  2VBW A;  3WE2 A;  3CCL I;  1U78 A;  2XPW A;  4BNC A;  4B48 A;  3CUQ A;  2BHZ A;  3NAR A;  5ERI A;  3S3O A;  3VEP A;  3IRQ A;  1XTA A;  1IN6 A;  1TP4 A;  4HSR A;  3F6O A;  4G6T B;  1Y1W J;  2OQR A;  2PFB A;  3CCU I;  1NK3 P;  2PLY A;  3H3U A;  4U7D A;  3BG3 A;  3MCZ A;  1GT0 C;  1SFE A;  3JRF A;  2DA1 A;  4KMU X;  1FOY A;  2FXA A;  2ELK A;  2X6O A;  2R7Z J;  1E3H A;  1FBS A;  1U6G A;  3L1P A;  5CYV A;  2K40 A;  3E1S A;  4NUB A;  1I3A A;  3DPT A;  4KT6 A;  3S1R J;  4IHT A;  3ABU A;  1IUF A;  2KKO A;  2HDD A;  2A69 F;  3GTL J;  3PIO F;  1POG A;  2X48 A;  4E70 A;  3H5A A;  5LRR A;  2R7U A;  4BU2 A;  4AUX A;  4D7M A;  3HDD A;  1R22 A;  1AOY A;  3GTK J;  4BXF A;  1HA8 A;  4AD9 A;  2M8E A;  2STT A;  3MKZ A;  2E60 A;  3CCY A;  4E7Z A;  2HXI A;  1SFU A;  4HQE A;  4QPO A;  4FET A;  1FP1 D;  3HIF A;  1ETK A;  3QPH A;  2R7T A;  2R7D A;  4HYE A;  2DW4 A;  4ASN A;  2ZSI B;  5LHI A;  5EG0 A;  1FPQ A;  3QOP A;  4S04 A;  4XL9 A;  2VIX A;  2GOX B;  4LG3 A;  1VQP I;  3FXJ A;  2HPI A;  2A6T A;  1WI3 A;  3BZK A;  4FE4 A;  4PJM A;  3QYF A;  3VFZ A;  2IS1 A;  4ZTJ A;  2Y2Z A;  3CZ6 A;  3FMR A;  1UG2 A;  2FA5 A;  2UXN A;  3IHU A;  5C3E J;  4I09 A;  1TQP A;  3AFH A;  2R5Y B;  2K86 A;  1UHW A;  2OUM A;  2ZKZ A;  4XRF A;  1K6O A;  3CMY A;  5DTD A;  4X0G A;  2L54 A;  4IJA A;  1OR7 C;  3FM3 A;  2MA3 A;  6PAX A;  2EA2 A;  1WRJ A;  4RGX A;  1D5V A;  2Y0M A;  4IVN A;  4XKV A;  2R5Z B;  1FSE A;  2KQR A;  2CV0 A;  3CTA A;  3OYF A;  4F52 A;  1TWF J;  4A5N A;  4ZYH A;  1I3Q J;  2DJN A;  4LB6 B;  4B3A A;  1BR2 A;  2DA2 A;  4HV6 A;  5DEQ A;  4XOT A;  3F23 A;  1AHD P;  3FBN B;  1UG0 A;  4RB3 C;  2BXZ A;  1MMA A;  2HGC A;  4P1W A;  4ZTF A;  4OAZ A;  2L7Z A;  3R61 A;  5D6F A;  2HWV A;  5J3L A;  2EFP A;  3P7N A;  3VYT B;  1IC8 A;  4MEX F;  4D0P A;  1QVU A;  3CJQ B;  4HQM A;  4HAM A;  4FIS A;  1IDZ A;  2MLK A;  1W7P D;  2JRT A;  1ON1 A;  5E18 F;  3FXU A;  4BBS J;  3IKT A;  1QVT A;  2K3P A;  5DDG A;  1Z3X A;  4NQW A;  4UXN A;  2ISY A;  3ASO H;  3BG7 A;  1MZB A;  2LTP A;  2MSY A;  2JA6 J;  5KK1 A;  1TBX A;  3OYA A;  1DGR M;  4B47 A;  2ZME B;  2CW0 F;  1A35 A;  4A3B J;  3JRH A;  1BN5 A;  5J6X A;  5EEH A;  2L9V A;  3WTS C;  3LFK A;  2DN0 A;  2F5D A;  3OL4 A;  2BOL A;  4QIW N;  5CVI A;  2XKP A;  2CUE A;  4A3G J;  4JX5 A;  2WAE A;  2AS5 F;  1TZL A;  3A01 B;  3G6E I;  3JCU C;  2HVS A;  3TMO A;  3NWT A;  3OYD A;  3CO7 C;  4A3J J;  1X2N A;  4LLL A;  1RUN A;  5ILU A;  1T0F C;  2ZNZ A;  4P9F A;  1OCT C;  5ILV A;  3JRI A;  1BJZ A;  2X6X A;  4B43 A;  1YO5 C;  3CCV I;  3LSM A;  5HDG A;  1P92 A;  1K78 B;  4IL6 C;  1LUJ B;  3HOX J;  2FF4 A;  3FDY A;  1WH7 A;  3J81 Z;  5E3O A;  5F08 A;  4BQA A;  1U5T C;  3KZY A;  5J4V A;  1G59 A;  4BKX A;  4ZYD A;  3KET A;  2ESH A;  3OMY A;  1JTX A;  2CV2 A;  2KT0 A;  2K27 A;  3RPU A;  2O3F A;  1O7L A;  3BZ6 A;  4CDG A;  5M3M J;  1O3S A;  4RB2 C;  4DZP A;  5ICC A;  3FXL A;  5JHF A;  2HYF A;  1E17 A;  3EQL F;  5EEA A;  4I7H A;  3ZMT A;  2DT7 B;  3HPG A;  4IHY A;  2RAE A;  2E19 A;  2KPM A;  4IHX A;  2EK5 A;  4XLH A;  4CCO A;  2M4G A;  1S6L A;  1UST A;  1MGT A;  2BYV E;  1Z05 A;  2Z5U A;  2ZJ2 A;  2M45 A;  2XF7 A;  3H5R A;  4XNF A;  5ICG A;  1AU7 A;  3EUH A;  1CF7 B;  5F0H A;  3FHZ A;  1YS7 A;  2Y9Y A;  2XAJ A;  3E5Q A;  4G8X A;  3W3C A;  1FJL A;  3K4K A;  2KDZ A;  1ETX A;  2DA6 A;  2X1D A;  1J2X A;  3K69 A;  5DCM B;  2DK5 A;  1VQ4 I;  2M30 A;  2R4G A;  3HYI A;  5HNF A;  4LJZ F;  4LLG F;  2L9N A;  2L7K A;  4CYC A;  2HVR A;  3DWL E;  1SVM A;  2BY2 A;  1XX5 A;  2HZT A;  2LYC A;  3RKY A;  3WG7 H;  4DBR A;  2TCT A;  5LGN A;  3GZ6 A;  2M1B A;  2O8K A;  1R23 A;  4NDL A;  1JKR C;  1A6I A;  2CUJ A;  2BEO A;  2VQH A;  2XPU A;  3IRR A;  2H8W A;  1FIP A;  3WTW C;  2W48 A;  3S2W A;  1R9T J;  4IKF A;  2CQK A;  4IRG A;  3M1E A;  3SEQ A;  3Q0V A;  4CYD A;  3SDB A;  2FNP A;  3JR9 A;  1B9N A;  2KMU A;  1X1B A;  1ETV A;  4C3J J;  3DEU A;  4BBR J;  5GTI C;  4Q47 A;  2WAQ N;  3F8C A;  1Q1H A;  4A3M J;  3WTY C;  4XK4 A;  1ETY A;  4RLF A;  3CQZ J;  3SFZ A;  4DYC A;  1NHA A;  3DKW A;  2HOA A;  1B72 B;  3RYR A;  3KLO A;  5HVQ C;  1MMG A;  2ZCW A;  1WH5 A;  5HDN A;  5IT9 Z;  3ECO A;  1DP3 A;  1HOM A;  1MNE A;  1XMK A;  4RLQ A;  2EV6 A;  4Z2Y A;  4NHJ A;  3OWT A;  5LHH A;  1KQ8 A;  1DPR A;  3ZPL A;  4XLN F;  5J40 A;  3OIQ A;  3IWZ A;  1ZKG A;  1QPI A;  4HW0 A;  2X4H A;  4P96 A;  1D0X A;  5IP7 J;  1WJD A;  4BY7 J;  2L7F P;  1QQI A;  5F27 A;  5FKK A;  4HDV A;  5C44 J;  3FIS A;  2AHQ A;  4IRH A;  5HS9 A;  4PUS A;  3CC4 I;  1SAN A;  1WJA A;  2DJI A;  2K9S A;  2QCO A;  1RKT A;  3MN2 A;  2E5N A;  2V9K A;  4I02 A;  4M6X A;  4CH7 A;  5E1X A;  1R36 A;  4DYQ A;  5FD6 A;  3CCS I;  5LGT A;  2ZFW A;  1QNT A;  2QKM B;  3H92 A;  3K4C A;  3GUD A;  5E1Z B;  4BGD A;  2EFN A;  1UHS A;  1M1E B;  4I2O A;  1FBQ A;  4I99 C;  2KHM A;  2V7F A;  2V9V A;  3KP2 A;  1LEB A;  4RAZ A;  3KCC A;  2D1H A;  3BQY A;  2GQQ A;  1FYL A;  2PMU A;  3HM5 A;  4W1U A;  5HLI A;  3L2U A;  2JPC A;  1XCB A;  4Y3O A;  2GXG A;  5M3F J;  2XDV A;  2X1E A;  2ELJ A;  2GM4 A;  3CUQ C;  3K7A J;  3K70 D;  2WB1 A;  1ORK A;  2OCC H;  3M3Y J;  3T8T A;  4BEH B;  4EVI A;  2HQN A;  4JOM A;  4A6D A;  3S16 J;  4N4O B;  3QP6 A;  4PFO A;  3KZZ A;  1OCO H;  2L02 A;  1QU3 A;  3C3W A;  1OQY A;  2DMN A;  3SFI A;  5IOZ A;  3HTU A;  3JTG A;  3J7Z I;  2Y30 A;  1IRZ A;  4ENJ A;  2CRG A;  1F36 A;  2W24 A;  2V1X A;  1X1A A;  3BT9 A;  3SZP A;  1D5Y A;  5DUK A;  2PJR A;  3F0C A;  1A5J A;  2VON A;  1K83 J;  2H1K A;  5DUI A;  5TJJ A;  3ZQL A;  3ZN0 A;  1N75 A;  4RGU A;  3GYH X;  2BXY A;  3S15 J;  2MW8 A;  1HLV A;  3NQO A;  2VXZ A; 
#chains in the Genus database with same CATH homology
 1Y0U A;  1FOK A;  1OR7 A;  4GCV A;  4UNO A;  4I0A A;  2HOE A;  1IF1 A;  3RIR A;  4I01 A;  2DPU A;  1FNN A;  4HBL A;  4A0Y A;  2K7L A;  3LA7 A;  4EJO A;  1WWX A;  2Q2E A;  5LRS A;  1GHC A;  3GFM A;  4A0Z A;  4YII A;  2DLL A;  2VBZ A;  1BIA A;  1PP7 U;  1ZRC A;  3WTT C;  2FU4 A;  4MHG A;  2HTJ A;  3WGG A;  2P8T A;  3C1D A;  2BGC A;  3TOB A;  2YSR A;  3G3Z A;  3EDP A;  5CVU A;  4ZZL A;  1XGM A;  1TW2 A;  1YG2 A;  4OU0 A;  3CO6 C;  1J0R A;  5BPI A;  1J59 A;  1X3U A;  5CJ9 A;  1H9T A;  3DP7 A;  3M9A A;  4MNU A;  3ABT A;  4IF4 A;  2G7U A;  5DCF A;  1WKM A;  4EJV A;  3F8M A;  3I59 A;  2IT0 A;  3RKX A;  5K5R A;  3DFG A;  4QWQ A;  3E6D A;  2P7V B;  4EM0 B;  4PCQ A;  3B73 A;  3MQ0 A;  4DNC A;  5DD8 A;  2RN7 A;  2VBX A;  1U5T A;  1J5Y A;  5BS6 A;  4U0Y A;  3Q9V A;  4U7B A;  1XGO A;  4EQQ A;  2H6B A;  5ED4 A;  5D5U B;  3WTV C;  4ENN A;  5FO5 A;  1R1V A;  2ESN A;  2ZNY A;  4LLN A;  3BJA A;  2DU9 A;  1ZH5 A;  1WI9 A;  1OMI A;  3GVA A;  3MAJ A;  3FXR A;  4N0B A;  2VT3 A;  3J81 K;  2MLG A;  1IAW A;  1Z6T A;  2A6E F;  3I0T A;  2V1D A;  2Q8K A;  4HF0 A;  2QBY A;  2W57 A;  1IZ1 A;  2COM A;  1W5S A;  4MEY F;  2HFH A;  1W5T A;  4OIO F;  3NRV A;  2DI3 A;  1H0M A;  2L4M A;  4H0E A;  2CFX A;  3GF2 A;  5CVV A;  5H20 A;  4RS8 A;  1IN7 A;  1JGS A;  5D5W B;  2M5W A;  2QVO A;  2RV8 A;  3U2R A;  2JPB A;  3ZMV A;  3GW2 A;  2CGP A;  3E97 A;  1SMY F;  1BBY A;  2OQG A;  2XHK A;  3HSR A;  2V6C A;  2ELH A;  1IUY A;  1RUO A;  2R7F A;  1UHM A;  1R1U A;  2PBI A;  2O0Y A;  1SD5 A;  2FML A;  4OIP F;  1XGS A;  4O5V A;  3GX4 X;  1DPU A;  3R0A A;  3VOE A;  1K79 A;  3ZQ7 A;  3PQJ A;  4FT8 A;  1UCR A;  2MH9 A;  1YTY A;  1YW8 A;  2P6T A;  1WQ2 A;  5IT9 K;  2F5F A;  3GWZ A;  5H6R A;  2KRF A;  5LEJ A;  3RYP A;  1G6N A;  2ADU A;  3MWM A;  5TRD A;  1FYM A;  2IW5 A;  3HSF A;  3I54 A;  2DQR A;  2XAG A;  4CXF A;  2EB7 A;  3IC7 A;  3SXY A;  3M8E A;  3LAJ A;  4FX0 A;  1O3Q A;  4KFC A;  5HS8 A;  2VE8 A;  1FWZ A;  3HRU A;  4PDK A;  3GEZ A;  1XDU A;  1XGN A;  3JSO A;  4GO1 A;  4ENK A;  2WWY A;  1ZAO A;  4XSZ F;  3RPQ A;  2BV6 A;  5LBQ A;  2MC3 A;  1F1Z A;  4B09 A;  5LLQ A;  3F8B A;  3E3V A;  1ZLK A;  2D2W A;  5ILS A;  1GXQ A;  3HUG A;  4ESF A;  3KP6 A;  3P9C A;  2OD5 A;  1QPM A;  3Q9S A;  2XAS A;  2VOO A;  3I53 A;  1W7P B;  4MTE A;  2Q0O A;  1DP7 P;  3BDD A;  3TQN A;  5A2Q Z;  2O03 A;  2RNJ A;  3R0J A;  2IPQ X;  1KQ9 A;  5F1R A;  3BP8 A;  4A0X A;  3ZN1 A;  1FSH A;  4KIG A;  3KP7 A;  2P5K A;  1SD6 A;  1JHF A;  3R6S A;  1G3T A;  2KJC A;  5FD5 A;  3G73 A;  1B4A A;  1UB9 A;  5BMZ A;  4BHP A;  2K02 A;  3JAM Z;  3DXJ F;  1S3J A;  1F5T A;  4WCG A;  4LK0 F;  2A07 F;  4ENM A;  3BOQ A;  2K4J A;  2AXL A;  2FE3 A;  1I5Z A;  4U0W A;  1AWC A;  4AIJ A;  4OIQ F;  3GFI A;  4EJT A;  4WK8 F;  2V79 A;  3C18 A;  4L18 B;  1S7O A;  3P9K A;  4Y13 A;  4MTD A;  2OZ6 A;  2WV0 A;  5K5Q A;  2HTS A;  2P6S A;  4UUV A;  5DYM A;  1QGP A;  2XIG A;  5BOX A;  2XKO A;  4OOI A;  2QZ8 A;  1O7F A;  3LA3 A;  1LB2 A;  3DV8 A;  3R60 A;  3FM5 A;  1KGS A;  3KFW X;  4KN4 X;  3LQQ A;  3HRS A;  1IN4 A;  3TGN A;  5CLS A;  5J8C A;  3RKW A;  2W25 A;  1J7K A;  2DT5 A;  5HS7 A;  2DFI A;  4JK1 X;  1MDM B;  4HX4 A;  4U88 A;  2O61 A;  3QAH A;  3CUQ B;  1HST A;  2L4A A;  4EJU A;  5D5V B;  3LAP A;  3J80 Z;  3W6J B;  3L2C A;  5L3D A;  4XLP F;  4HF1 A;  4KUM A;  2QYO A;  1EH8 A;  2XGX A;  4ETS A;  3IKV A;  4O6J A;  3TO9 A;  1IRF A;  4QLC U;  1HQC A;  2XUB A;  5FFX A;  2K4B A;  2NNN A;  2VE9 A;  1O3R A;  3KP5 A;  1ZG5 A;  2FQ3 A;  1ONV A;  3B02 A;  3TO6 A;  2VOD A;  3RI4 A;  4EGY A;  2RDP A;  1WSU A;  2VBY A;  4CGZ A;  3I64 A;  1TW3 A;  1SAX A;  1BOA A;  4HX8 A;  1G3W A;  2KIM A;  4JBA A;  1ULY A;  3F8N A;  5FB2 A;  2LNB A;  4UHT A;  2DBB A;  1T6S A;  4WXC A;  4G7Z F;  1P4A A;  1XSX A;  1ODD A;  4G9Y A;  1ZGA A;  4G7O F;  4HA8 A;  1CGP A;  1YIO A;  1Z1D A;  2QQB A;  1C0W A;  4WX9 A;  2J5O A;  1MJB A;  4ZZD A;  3BJO A;  1PDN C;  4AIH A;  1B1B A;  4N9H A;  1ZYR F;  5HDK A;  3E5X A;  2XAF A;  2UZK A;  2F5C A;  3ML6 A;  3WG9 A;  3K1N A;  4WXD A;  1SD4 A;  3WU0 A;  3E5U A;  3K1M A;  1ZHF A;  2DO7 A;  3L9F A;  4OIR F;  3D0S A;  1QO0 D;  2Y48 A;  1IW7 F;  5J8F A;  1BI2 A;  2Z99 A;  4IPA A;  2B0L A;  4CZZ A;  2VC1 A;  3F6V A;  3WTX C;  3OV8 A;  3REO A;  1I1G A;  4M9S A;  4KYW A;  1I27 A;  2KIF A;  1W4M A;  1BI0 A;  5DV5 A;  3LQR A;  3IWF A;  5ICE A;  1VTN C;  1MD0 A;  1XMA A;  5D6E A;  2QQA A;  3ELK A;  5BQT A;  3EYI A;  1Z7U A;  4ESB A;  2A3S A;  2CG4 A;  2YU3 A;  2BBY A;  2L3D A;  1KYZ A;  1HBX G;  4LD5 A;  2EV0 A;  1QZZ A;  5L3B A;  2W85 A;  2F5E A;  1KU2 A;  1BI3 A;  3I5U A;  3V7R A;  3M8F A;  3HOT A;  2EJR A;  3L00 A;  4GYI A;  3DF8 A;  4YFK F;  3K9T A;  3GLX A;  2PG4 A;  4HLY A;  3CUO A;  1LEA A;  2VN2 A;  3CJN A;  2XAH A;  2RGV A;  4EM1 A;  4R8H A;  4L9J A;  5LGU A;  4DQ2 A;  4P9U A;  4KNY A;  1QBJ A;  3EYY A;  2R3S A;  4LG0 A;  3MFK A;  3F8F A;  1OYI A;  1IN5 A;  4LFU A;  2P5V A;  1KQ0 A;  1HSJ A;  2WTE A;  3WOD F;  4MGR A;  4IXA A;  2W84 A;  2PMH A;  1YW7 A;  2O8X A;  1KU3 A;  2NNY A;  1D8J A;  2GIV A;  2IA1 A;  3CLO A;  3D5L A;  5HLH A;  3T5X A;  3E6M A;  5F6F A;  2H94 A;  3WE3 A;  1MJA A;  2X0L A;  1MKM A;  3W6K B;  1RNL A;  3I58 A;  1HKQ A;  3V8L A;  4LK1 F;  2QQ9 A;  5IT3 A;  1XB4 A;  1FX7 A;  1YYV A;  1ON2 A;  4ON0 A;  3F3X A;  4RB0 A;  4JQF A;  2VOP A;  4Y15 A;  2DQL A;  1RI7 A;  3J80 K;  4PGH A;  3HRM A;  4P5O A;  4L5J A;  4L9V A;  4IRI A;  3ZMZ A;  1IXC A;  3BY6 A;  4KIB A;  4KN7 X;  3GXO A;  2IA2 A;  5JHU A;  1P4X A;  3GZ5 A;  1YLF A;  4GXO A;  5ICF A;  1IN8 A;  3DQV C;  4HF2 A;  2RKH A;  4OMY A;  1D8K A;  2Z33 A;  5FFZ A;  3V8K A;  3BJ6 A;  2DPD A;  1REP C;  2F2E A;  4YIF A;  5AIP A;  1T2K A;  5K5O A;  2JTV A;  4M72 A;  1LNW A;  1ZAR A;  4LGW A;  1BI1 A;  4Q5S F;  1O3T A;  5LHG A;  2ISZ A;  2QEN A;  5E8G A;  3WTU C;  1XDS A;  2NRA C;  1UFM A;  4KDP A;  1TQI A;  3V4G A;  3ISP A;  1G3S A;  4AIK A;  3DPL C;  1JHH A;  4EJW A;  2Y75 A;  1FP2 A;  2NAZ A;  2EV5 A;  4RAY A;  3ZMD A;  4FX4 A;  1EH6 A;  2KJB A;  1BM9 A;  2IJL A;  1TNT A;  2PI0 A;  4UVA A;  4L0Z B;  1XCV A;  2E1C A;  2ZME A;  4M73 A;  3N4M A;  2XAQ A;  4PZJ A;  5CVR A;  1SFX A;  1JXS A;  2DTR A;  3K0L A;  3ECH A;  5JFR A;  1PUE E;  3WGH A;  3I59 B;  3FMS A;  1EH7 A;  3F22 A;  2FNA A;  1LDK B;  1YQA A;  1MDM A;  1T98 A;  1K78 A;  3TO7 A;  4BYY A;  2FEZ A;  2IVM A;  1U5T B;  2GAU A;  2YX7 A;  3GFJ A;  2OA4 A;  4B8X A;  1FT9 A;  3HSE A;  2IA0 A;  1DUX C;  5BPD A;  3ROU A;  2PN6 A;  4O3M A;  4GGG A;  1HKT A;  3FX3 A;  4OMZ A;  5D5X B;  1F4K A;  4OIN F;  3VB2 A;  1HXD A;  1XSD A;  1CF7 A;  2HDC A;  4WWC A;  2C6Y A;  1PP8 F;  3LA2 A;  5DCM A;  4HLX A;  1R5G A;  3IL2 A;  2QBY B;  1S7A A;  1SD7 A;  3KEO A;  3KE2 A;  1LDD A;  2XV4 S;  2XRO A;  4I98 B;  5JR3 A;  1QZY A;  2DAO A;  4LMY A;  4Q48 A;  3ERE D;  5AIQ A;  1IRG A;  2XVC A;  4ESJ A;  3KP4 A;  4LB5 A;  4YFN F;  3COA C;  2YR2 A;  2EFO A;  3SZT A;  5FLX Z;  4PGG A;  4G6D A;  4HOB A;  2ZXJ A;  3HHH A;  2QWW A;  3C7J A;  2A6H F;  4RGR A;  3M7G A;  1S29 A;  4AVP A;  5H6Q A;  3O2P E;  4G7H F;  2L01 A;  4A2U A;  4HDU A;  2HKO A;  1KA8 A;  4F7Z A;  3FWE A;  3LST A;  3F21 A;  1KYW A;  1O57 A;  1ZG3 A;  3V8J A;  4L9T A;  3T8R A;  4EGZ A;  1U2W A;  1FY7 A;  4ZH4 F;  4RGS A;  1U8R A;  2EWN A;  4M9X A;  2HQR A;  4KA4 A;  4UVC A;  3K2Z A;  1B6A A;  5JI6 A;  5L3F A;  2QM3 A;  2VC0 A;  2LKP A;  1ZRF A;  3QRF F;  4UV9 A;  2RQP A;  1ZN2 A;  5D8L B;  1S8N A;  2P4W A;  1D3Y A;  3O3K A;  1R5H A;  2UWM A;  4BHC A;  1F9N A;  5L3E A;  4Y17 A;  2PJP A;  2IP2 A;  2GA1 A;  1HW2 A;  1OPC A;  2Z3Y A;  3OOP A;  1HW1 A;  1A04 A;  2RVC A;  4NB5 A;  2TDX A;  1R7J A;  4WF2 A;  2UXX A;  4L0Y B;  3E6C C;  3KP3 A;  2P5L C;  2ZO4 A;  3QP5 A;  4BH9 A;  3TDZ C;  1P2F A;  2WC2 A;  1R00 A;  3MEX A;  3U9G A;  1SMT A;  2E7X A;  2EFW A;  4CIC A;  4GYG A;  4A12 A;  3R4K A;  1BC7 C;  2EA4 A;  2QLZ A;  1MJ9 A;  2CO5 A;  4MQ9 F;  4IHS A;  1T39 A;  2FMY A;  3K1P A;  1L3L A;  2RC4 A;  1GXP A;  1LVA A;  4HZF A;  2P7C B;  5EEG A;  2G7H A;  2LDU A;  3TOA A;  3QU3 A;  1G3Y A;  1RIO H;  2FBH A;  4L9N A;  2XRN A;  1TTY A;  4EV0 A;  1YW9 A;  4Q4Z F;  4BXU A;  1OYY A;  3EET A;  3KLN A;  3WGI A;  3BPV A;  4RB1 A;  1ZG1 A;  2GZW A;  2J5P A;  5KVR A;  1DDN A;  2GA2 A;  2PEX A;  2ZBK A;  3WU1 B;  5F64 A;  3JW4 A;  4U0V A;  5K1Y A;  2NS0 A;  3GO5 A;  4BHB A;  1RZ4 A;  1OKR A;  3CDH A;  2ACJ A;  1B9M A;  1BJA A;  5D4R A;  2LSO A;  3N97 A;  3JTH A;  4ZYG A;  1Z9C A;  3PFI A;  2JT1 A;  4BAY A;  4M74 A;  4EMS A;  1YS6 A;  3LWF A;  5A2Q K;  4M6Y A;  1I1S A;  1TLH B;  2GWR A;  3P9I A;  1LJ9 A;  1YFH A;  1E2X A;  2CYY A;  1ZLJ A;  5LEK A;  3I71 A;  3KEQ A;  3FXQ A;  4YG2 F;  2M87 A;  4M71 A;  2STW A;  5E17 F;  2PQ8 A;  2OU2 A;  1BIB A;  2H09 A;  3U1D A;  3HOS A;  3JAM K;  1V4R A;  2Z9O A;  4HV5 A;  1FBU A;  5AON A;  1TNS A;  3ZMU A;  1V3F A;  4YFX F;  2FSW A;  3E6B A;  4L5I A;  2FBI A;  4KIF A;  3HTS B;  1LQ1 A;  2O6G E;  4HX7 A;  3QPT A;  5FLX K;  1TQM A;  4XBF A;  2OAZ A;  2HKX A;  2IRF G;  5D8K B;  2MBF A;  1GVJ A;  4R79 A;  5L3G A;  3TDU C;  4CO8 A;  3O6B B;  2BE5 F;  2MD5 A;  1B59 A;  1XD7 A;  3GFL A;  1K7A A;  1G4D A;  3TKY A;  1JE8 A;  2OBP A;  3FMQ A;  1P6R A;  2EFQ A;  3JSP A;  1USS A;  3ZMS A;  5HLG A;  3QU6 A;  4UV8 A;  5D4S A;  5HOO A;  5E20 A;  1U3E M;  1OYW A;  1XSV A;  3PQK A;  3J7A O;  2DK8 A;  4P55 A;  3ZP5 A;  1T0F A;  1ZRE A;  2KIU A;  1ZGJ A;  2NYX A;  1BC8 C;  2A61 A;  3H3Z A;  2LF7 A;  1IXR C;  4TV7 A;  1HW5 A;  2E7W A;  2VT2 A;  1KU9 A;  3FZV A;  5CVJ A;  2ETH A;  1KU7 A;  3FF5 A;  1FYK A;  5E1W A;  4CHU A;  2V1U A;  3T1B A;  5FGM A;  2H6C A;  3AAF A;  2OZU A;  5E8I A;  3V7C A;  3HHG A;  4K2E A;  1LDJ A;  1W7P A;  3WTZ A;  1IXS B;  4KT5 C;  3L09 A;  4I0B A;  1FC3 A;  1XN7 A;  1R1T A;  2HYG D;  3HRT A;  2CWE A;  3RDI A;  3I4P A;  2A5Y B;  2E1N A;  5JVT A;  3NEU A;  2GXB A;  3T0Y A;  2FRH A;  2QUF A;  2D1V A;  1STZ A;  2JZY A;  4WXH A;  3BRO A;  2G9W A;  4S05 A;  4G94 A;  2HS5 A;  2JSC A;  2HEO A;  4G6Q A;  4XSX F;  2YX4 A;  2D45 A;  3RJP A;  3V7S A;  4R1H A;  3VOD A;  2FBK A;  4EM2 A;  1H9G A;  2MH2 A;  4M9Z A;  1J9I A;  3MZY A;  2YPR A;  4ZYE A;  3MZH A;  4FHT A;  3F72 A;  1EV7 A;  1HKS A;  1FLI A;  4UVB A;  2LF8 A;  1ZRD A;  4AWX B;  4A5M A;  3BPX A;  4MQV A;  3L7W A;  4N9I A;  4LG0 B;  1L0O C;  4KMF A;  3SQN A;  3BWG A;  1I6X A;  2A68 F;  4A6E A;  3ULQ B;  1Z91 A;  2FOK A;  1Z6R A;  3SHF A;  5L3C A;  3RTR A;  2H27 A;  1R58 A;  4KIC A;  3Q5F A;  1T38 A;  2HR3 A;  1P4W A;  2CSO A;  1J75 A;  5DD4 A;  1FZP B;  3WE2 A;  2VBW A;  1U78 A;  4BNC A;  3CUQ A;  5ERI A;  3VEP A;  3IRQ A;  1IN6 A;  3F6O A;  2OQR A;  2PFB A;  2PLY A;  3H3U A;  4U7D A;  3MCZ A;  1SFE A;  4KMU X;  2FXA A;  1FBS A;  1U6G A;  5CYV A;  3DPT A;  4IHT A;  3ABU A;  2KKO A;  2A69 F;  4E70 A;  5LRR A;  1AOY A;  1R22 A;  4AD9 A;  2M8E A;  2STT A;  1SFU A;  4HQE A;  1FP1 D;  3HIF A;  3QPH A;  2R7D A;  4HYE A;  2DW4 A;  4ASN A;  5LHI A;  1FPQ A;  3QOP A;  4S04 A;  3VFZ A;  3FMR A;  2FA5 A;  2UXN A;  3IHU A;  4I09 A;  1TQP A;  2K86 A;  1UHW A;  2ZKZ A;  4XRF A;  1K6O A;  2L54 A;  4IJA A;  3FM3 A;  2MA3 A;  6PAX A;  2EA2 A;  1WRJ A;  4RGX A;  1D5V A;  2Y0M A;  4IVN A;  1FSE A;  3CTA A;  4ZYH A;  4A5N A;  4LB6 B;  4HV6 A;  5DEQ A;  3F23 A;  4RB3 C;  2HGC A;  3R61 A;  5D6F A;  2HWV A;  2EFP A;  3P7N A;  4MEX F;  4D0P A;  4HQM A;  4HAM A;  2MLK A;  1W7P D;  2JRT A;  1ON1 A;  5E18 F;  3FXU A;  3IKT A;  5DDG A;  4NQW A;  4UXN A;  2ISY A;  1MZB A;  5KK1 A;  1TBX A;  2ZME B;  2CW0 F;  1BN5 A;  5J6X A;  5EEH A;  3WTS C;  3LFK A;  2F5D A;  5CVI A;  2XKP A;  2AS5 F;  3CO7 C;  4LLL A;  1RUN A;  5ILU A;  2ZNZ A;  4P9F A;  5ILV A;  1YO5 C;  5HDG A;  1P92 A;  1K78 B;  2FF4 A;  3J81 Z;  4BQA A;  1U5T C;  3KZY A;  4ZYD A;  3KET A;  2ESH A;  2K27 A;  3RPU A;  2O3F A;  1O7L A;  3BZ6 A;  4CDG A;  1O3S A;  4RB2 C;  5ICC A;  2HYF A;  1E17 A;  3EQL F;  4I7H A;  3ZMT A;  2EK5 A;  1S6L A;  1UST A;  1MGT A;  2BYV E;  1Z05 A;  2Z5U A;  2M45 A;  2ZJ2 A;  5ICG A;  3EUH A;  1CF7 B;  3FHZ A;  1YS7 A;  2XAJ A;  3E5Q A;  4G8X A;  3K69 A;  1J2X A;  5DCM B;  2DK5 A;  2M30 A;  3HYI A;  4LJZ F;  4LLG F;  2HZT A;  3RKY A;  5LGN A;  3GZ6 A;  2M1B A;  1R23 A;  2BEO A;  3IRR A;  3WTW C;  3S2W A;  2CQK A;  4IRG A;  3M1E A;  4CYD A;  2FNP A;  1B9N A;  3DEU A;  4Q47 A;  3F8C A;  1Q1H A;  3WTY C;  3SFZ A;  1NHA A;  3DKW A;  3RYR A;  3KLO A;  5HVQ C;  2ZCW A;  5HDN A;  5IT9 Z;  3ECO A;  1XMK A;  2EV6 A;  4Z2Y A;  4NHJ A;  5LHH A;  1KQ8 A;  1DPR A;  3ZPL A;  4XLN F;  3IWZ A;  4HW0 A;  2X4H A;  4P96 A;  1QQI A;  4HDV A;  4IRH A;  5HS9 A;  4M6X A;  4I02 A;  5FD6 A;  5E1X A;  1R36 A;  5LGT A;  2ZFW A;  1QNT A;  3H92 A;  3GUD A;  5E1Z B;  2EFN A;  4I2O A;  1FBQ A;  2V9V A;  3KP2 A;  1LEB A;  4RAZ A;  3KCC A;  2D1H A;  2GQQ A;  1FYL A;  2PMU A;  5HLI A;  2JPC A;  1XCB A;  2GXG A;  3CUQ C;  3T8T A;  4EVI A;  2HQN A;  4A6D A;  3QP6 A;  3KZZ A;  2L02 A;  3C3W A;  3HTU A;  3JTG A;  4ENJ A;  2W24 A;  2V1X A;  3SZP A;  5DUK A;  2VON A;  5DUI A;  5TJJ A;  3ZN0 A;  4RGU A;  3GYH X;  3NQO A;  2VXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...