2CUJA

Solution structure of swirm domain of mouse transcriptional adaptor 2-like
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GSSGSSGIDSGLSPSVLMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords transcriptional adaptor 2-like
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cujA01
2CUJA 2AQFA 2DCEA 2ELJA 2AQEA
chains in the Genus database with same CATH superfamily
4E7HA 2FOKA 4XSZF 3U21A 4YIFA 2D5VA 2R7XA 2BBYA 1RIOH 2DA7A 3VDXA 3LSRA 4NBQA 2LF7A 4PCQA 1TWHJ 1RR7A 3A1YA 3I0TA 1X3ZB 1T2KA 2Z2SB 3BR5A 1D5YA 1LFBA 5ICCA 1AKHB 2M0CA 2HWVA 4BNCA 1UMQA 3CCRI 2XPWA 1F43A 2OU2A 4HLYA 4E7JA 5CLSA 4HDVA 1VFCA 4ZYAA 4XN0A 3MKZA 1ZLKA 4GDFA 3SFZA 5D5WB 2K9MA 2R4GA 2CQ7A 3I53A 2F5CA 2FBKA 2RQQA 2EA2A 2XF7A 4U7BA 2MABA 2HKXA 3AG2H 2HQNA 3DLAA 1VQOI 1N77A 1BW6A 1PP7U 3G73A 4M73A 3FKIJ 1BIAA 4LD5A 2DBBA 3TGNA 4AIDA 2CUZA 3I59B 1FEXA 1I5ZA 3HOXJ 1YRNA 2HDWA 3BWGA 2X0LA 3QPTA 5F64A 4G7OF 2OAZA 3ZOBA 3HRMA 4JQFA 5KVRA 1NTCA 2Y48A 5EGOB 3B6AA 4CHUA 1P7JA 4L5JA 4XKVA 5AIPA 4DJAA 5B3SH 3GFMA 5KHDA 1XCBA 3JRBA 4WK8F 4I99C 2XRNA 1FYLA 5B5EC 4HPQA 3I4MJ 2DK5A 3IWZA 3KX2A 2JUGA 3V7CA 3IAS2 4FE7A 1F9NA 2KPMA 4EQQA 4EJUA 1PUFB 4L0YB 2BY1A 3WTXC 4KN4X 4D0PA 1JUPA 3TO6A 3DPLC 3ZRGA 3MAJA 2Y30A 4BHPA 3E6DA 1BJAA 2BXZA 2ELJA 2Y0MA 3CMAI 3ZQCA 1BIBA 2XAGA 2ESHA 2PBIA 3GZNB 4Y4RA 5H20A 3VEPA 5EF6A 3RKQA 4C2UA 1VQLI 4YFNF 1HA8A 1IGNA 3FMQA 4M9ZA 4RGSA 2XGEA 3SDBA 2L54A 1IRGA 1X4OA 1SVMA 1ZRFA 2EIKH 2V7FA 5LGNA 3IKTA 3FHZA 1IG7A 2QZ8A 2FBHA 1W5SA 2BOLA 2G7HA 2K40A 4L9VA 1LVKA 4FHTA 2K9NA 1JTXA 2EZIA 3PL8A 3MFKA 5FKLA 4E7KA 1FYKA 1EA3A 3L00A 1YIOA 3E1SA 1KU7A 3ESWB 1A6IA 2KIFA 1MMDA 4H0EA 4C2TA 2UUZA 5TISC 3VFZA 5FROA 1EJ9A 4JX6A 5FKNA 2QBYA 3H3VK 3K1MA 5JR3A 3JRCA 3SFIA 2FEZA 2ID6A 1BJZA 3CP8A 3RTRA 4I2OA 4RAYA 2ZO4A 3ZMTA 1P9QC 1UHMA 3JTGA 2R93J 1FSEA 4DYCA 3HOSA 4V19K 2W84A 2NOJB 3I55I 3AFHA 1SVOA 1AOYA 1FJLA 3WU0A 4HDUA 1R1VA 3ASOH 4XLNF 1QNTA 5AONA 2DDBA 1HF0A 4WXCA 4M71A 3SDGA 2YPRA 3HB9A 3TP3A 3BP8A 3BDDA 2GLOA 1IUYA 3K6GA 3S3OA 3CCUI 2X48A 2HYJA 1KQ9A 3JW4A 3BR1A 5FKOA 5F0HA 2XAUA 3TKYA 1W0TA 3CCVI 1SAUA 4EJWA 4XN3A 1SC7A 4BH9A 2UWMA 5HS7A 2L4AA 2DCEA 5F04A 3OIOA 2DMPA 1ZRDA 2F6CA 3DCFA 1NG7A 1IJWC 1WQ2A 1LDDA 4EJTA 1W4MA 2LP0A 4G7HF 2VKHA 3SZTA 2GAUA 1BL0A 1WGXA 5JLWA 2K85A 1ETQA 2IJLA 3CJNA 3BQYA 3DTKA 4FX4A 3S1QJ 5D8LB 2P0WA 5FLXZ 5J1YA 1SAXA 3VODA 1LE8A 1TL8A 2DQRA 3GX4X 2EILH 1T0FA 2GXAA 1E0EA 2VKEA 5E3NA 2CW7A 4RS8A 3O6BB 2PFBA 1SANA 1B6AA 1CF7B 3E5QA 3B6CA 4LFUA 3CCEI 1O3QA 2HYFA 2CFXA 2VXZA 4CH7A 2HDDA 3WTVC 3KP2A 1J5YA 3KP4A 4XRSG 5FRNA 1B72A 4HQMA 3A01A 5J6XA 2VT3A 3PNYA 2EFQA 2WAQN 3EETA 3GMEA 2DYSH 3LNQA 2VL8A 3MZHA 3IH3A 1D0YA 1XMXA 3DKWA 1H0MA 3RKXA 3TO7A 2BV6A 4AIJA 1MDMB 4KDPA 4M6VA 1TLHB 4RAGA 4BGDA 2IXSA 3L2RA 3E6BA 3L2WA 3CP2A 5F0FA 5H6QA 1MBEA 2IS4A 3ROUA 3ZQHA 2EJRA 4HA8A 1DU6A 1YW8A 2OCEA 1IRXA 2QYOA 2QQ8A 2X1EA 1REPC 4KIFA 3F6VA 1TBXA 4RB3C 4FT8A 2LLKA 1A36A 3C2GA 5LHHA 1Z7LA 2CQNA 1OCCH 1TTYA 3GEZA 1HXDA 5L3EA 4XOPA 4I09A 3WTYC 2W25A 1WFXA 4KT5C 1GXPA 3F9KA 4Y17A 1MNDA 4UY8I 4L18B 3VYTB 2WY7Q 3WTSC 5B1BH 4Y13A 3MQ0A 4I0AA 1GVJA 3LWFA 5L3CA 1XSVA 2H27A 1R58A 2VBZA 1ZREA 4NC7A 1MW7A 5CVUA 3JTHA 3A4CA 4L5EA 4N9HA 1AWCA 4V2FA 1W7PD 1XGMA 3GVAA 1WJBA 2UXXA 3CUOA 3V4GA 3QWLA 3S2DJ 3H0GJ 4F93B 2BY2A 4I98B 2LVSA 5KAFC 1FSHA 2CQQA 3L2CA 2XGXA 4XK4A 1WI9A 2IPQX 3VOEA 3HEFA 4UHTA 4II2A 2XF6A 3FZVA 2KL4A 2L0KA 2BW3A 3HRTA 2IS1A 2GA2A 1PP8F 4Q47A 1Y6IA 4KUMA 3S8PA 1WJAA 2FJ1A 1SD6A 3M8JA 3RSNA 1K83J 3SJMA 2RC4A 1FX7A 1N75A 3WHBA 3G1MA 4A6DA 2QCOA 3E3VA 4RLQA 5DUIA 3N05A 2DDAA 5D5XB 4HV6A 4HF2A 2JA7J 2ID3A 1VQMI 2BYVE 3DEEA 3QU6A 4UB8C 2D1HA 1FT9A 2IVMA 3H3UA 1U0JA 2PG4A 4RBOA 2HTJA 3S1MJ 2CU7A 3GBGA 1LNWA 3L1PA 3C18A 2Q0OA 2A07F 1FPQA 2M2EA 1FIPA 4D7NA 3RPUD 2IA0A 2JZYA 4IPAA 3K4JA 4KIBA 2ZMEC 1LEBA 4AM3A 3LSPA 4BU2A 3TO9A 1QPIA 2WY8Q 5TJJA 2K9LA 2MFZA 3K1NA 5HLGA 3W2AA 2W57A 1YITI 2MYSA 1BR1A 1U9NA 3T1BA 1UB9A 2Q1ZB 1YJ9I 4Q4ZF 3CCMI 1BN5A 2FQ3A 2J5PA 2R7OA 1QVUA 2L3DA 4B47A 2I5UA 5CKTA 4NDLA 1MNEA 1O57A 4GRIA 4XLCA 1T39A 4G6DA 3ZMZA 5C4JJ 1GT0C 4KNYA 2ISYA 5F08A 2KKOA 3PFYA 1JI8A 1E3HA 3RDIA 2XHKA 3K4KA 3NAUA 2BW3B 4A69C 5L3GA 1P2FA 1RC9A 2OQRA 4XR6A 2WAEA 2Q2EA 4OIRF 2ME6A 3FMSA 1MMAA 5E1WA 3EYIA 4AC0A 4CCLA 3W6JB 2KDOA 1FOYA 2EZHA 4UVCA 4E7ZA 4DZPA 4MEXF 2XSDC 3NARA 1YRNB 1BI2A 4CYCB 1R5HA 2NVYJ 1IN8A 4I7HA 2RVCA 3SYTA 4A3IJ 2PJRA 2DA5A 3M9AA 3M7GA 1FBSA 3D5SC 2HEOA 4HZFA 3HM5A 1R1UA 1U9OA 2HKOA 2LC2A 5D8KB 2YX4A 3ZQFA 3PQKA 1V55H 2L9SA 3OIQA 5IOYA 2H1KA 3GF2A 3HOVJ 3FHNA 5ILVA 2E34A 3BZCA 1YX5A 3DTEA 1O7FA 1I6HJ 3H0DA 1HW5A 1Z77A 3ECOA 1BM9A 2XIGA 5LEKA 3LSJA 3DBLB 1SFXA 2ICWG 3QP6A 2ZNYA 1B4AA 3J80Z 1LKXA 1IXCA 4XMYA 3D1NI 3DPUA 5D6EA 1Z05A 4Y7NJ 1D1CA 3JRAA 3DQVC 2Y9YA 3DXJF 1EH6A 2LTPA 4PK4A 3SEZA 4XLFA 3DKXA 2KT0A 1XD7A 2Y0SN 2JN6A 3H3ZA 3G4SI 3RQIA 1IAWA 2KHMA 1MIJA 1BC8C 2CV0A 1XGNA 4I02A 4HQEA 4NNJA 3IKVA 3OYLA 5L3DA 3RPUA 4XLAA 4N4NB 3BTJA 4BS9A 5IT3A 5K5QA 1ON2A 4CCMA 1Z0XA 3DBHB 3S32A 2NVTJ 1XS9A 2D1VA 2HQRA 1WJDA 3JR9A 3A02A 1T8IA 2XGCA 2M5WA 1MGTA 2XRLA 2KIMA 5M5XJ 1G3TA 3K2ZA 2XAFA 3MZ8A 1GXQA 2LY9A 4FTHA 2DOFA 3HIFA 2ZBKA 3FISA 4EATA 2H8WA 1WH7A 3DF8A 3GTLJ 2O61A 3IH2A 2R0QC 1T08B 1OISA 3BPXA 3LFKA 4WXHA 3A0BC 3SZPA 3OOUA 5D4SA 4RB2C 3AG1H 1MBFA 4UV9A 3RCOA 3JRFA 1BW5A 1P6RA 1W7PB 3WODF 5CQGA 4KJZA 3OYCA 1KU3A 3WTWC 2A5WA 3L09A 5E17F 3BTCA 3I71A 3LMMA 3KP5A 2IP2A 4G7ZF 2E2HJ 2OPTA 3OYIA 1VI0A 4CCKA 4L9JA 2VONA 2L9NA 1N25A 5M3MJ 2BXYA 4PJLA 2O8KA 3DBRB 5K7ZA 4ENJA 2CMPA 5HVQC 2COMA 4C3IJ 4PJ0C 2ZXHA 3Q0WA 3QOPA 4PGHA 5LHIA 2HZDA 1A04A 1WPKA 2LYCA 3JRDA 2W1OA 2KIUA 2LBFA 2KRHA 1L3LA 2LKPA 3OYNA 3TW6A 2P81A 2GXGA 1B1BA 3MVPA 4ASNA 2F4OB 5B1AH 3BG5A 2JA8J 1K78B 1OQYA 3EDPA 4XONA 4E6KG 3CTAA 2VJIA 2CGPA 2XPVA 2GXBA 2GOMA 1ETOA 2FXAA 3VPRA 3IUOA 1MMNA 5EEHA 3P9CA 3Q5FA 2HOEA 3CF2A 3VSKA 4BBSJ 2Z3YA 4GYIA 1SFKA 4KT6A 4RGUA 1LFUP 1Z1DA 3WTZA 4RB1A 3HXLA 4Y52J 2IGKA 5ILSA 2WAQA 2IEKA 4IZZA 1DP7P 2VXDA 2M8GX 3L2VA 2ZSIB 2VI6A 2R5ZB 4UNOA 1IN7A 1MBKA 2A3SA 3E5UA 4IL6C 1W7PA 4AYBN 5B66C 4E7IA 3PUBA 4UUVA 1WKMA 1ZN2A 3IH4A 3GTQJ 3IAM2 3W2VA 3I4PA 1GV5A 1D3YA 5IYDJ 3A01B 1DGWY 1UELB 1I39A 3KZZA 1BI3A 2EA4A 3K7AJ 2IGNA 3BG3A 4IOCF 2H8RA 1HLVA 2NS8A 4O3MA 3FM3A 1TC3C 3MCZA 2CV1A 4F7ZA 3KYCB 1R5ID 2LG4A 3CUQA 2RNJA 2W85A 3ZPLA 4D7MA 2IW5A 3IHUA 4FASD 2E60A 3V7RA 1Z3YA 1LDJA 2PI0A 1Y39A 2L7MP 5EZGA 4XL9A 4F91B 2CUFA 4M9XA 2PX9A 5IYCJ 1Y0UA 2ZNZA 3O2PE 2R7RA 1TW2A 1UG0A 2WC2A 1KGSA 1X1DA 2XSJC 1KQ8A 1WWXA 3K70C 1XGSA 2IGOA 1F4KA 1G3SA 4BY7J 3LAJA 2A61A 4AWXB 5TRDA 3OSGA 3BG7A 2X1CA 2P6TA 4ZYDA 2Y31A 4LLGF 1N78A 4U0VA 4J00A 4I0BA 2DPUA 1YS6A 4BXXJ 1D8KA 2MA3A 4C9YA 2KFDA 4HX7A 4EMSA 2FD5A 2Z5UA 3I4NJ 2K9SA 3KLNA 2DA6A 1BBYA 2EK5A 1OJLA 1QZEA 2M1BA 1SD4A 1T38A 3FK7A 3DU5A 5K1YA 3DPTA 3HZJA 1QHHD 4G12A 1VQ6I 1MMSA 4UV8A 4F92B 3AG4H 1QZZA 4X6AJ 1QRYA 1R5GA 1XMKA 1ZH5A 1ETWA 2ETHA 5ERIA 2JA5J 4N4OB 2VQCA 3NWSA 4GFBA 2DMUA 3LQQA 4B1RA 4Q48A 1ZAOA 4F52A 3N4MA 2M4KA 1PVEA 1ZGAA 2K5CA 1HKTA 2VKVA 3WTUC 3I9V2 5HODA 3CCQI 2JPBA 5M5YJ 4IHWA 1TNSA 2YX7A 5HDNA 1HC8A 2MW8A 4OU0A 5HS8A 1R22A 4OAZA 5FD5A 3OS2A 3CUQC 1OCPA 3HRUA 3OS1A 5HDGA 2O7OA 5D6FA 1ETVA 4HSRA 3TMOA 1HKSA 2L9VA 3Q0UA 1I1GA 2P5LC 1NK2P 3WU2C 3K4CA 3E6MA 2L7KA 2O0YA 1HCRA 3KEOA 4P1WA 3SZGA 3CC7I 1EV7A 3M1EA 2M9HA 1FP2A 3EUHC 3CDIA 4RA2A 3CD6I 5BNGA 3ECHA 3GXOA 4XBFA 3ZR8X 3RYRA 3IV5A 3PNVA 2F5EA 2OZ6A 3BROA 5GPCA 4P96A 4W1UA 3QPLA 4BDZA 3OYEA 3HUGA 3E5XA 4O6JA 2R7DA 2JJ7A 3GLXA 1HW1A 5J3LA 4YG2F 1OCZH 3ZMSA 1V3FA 5L3FA 5E20A 4L9NA 2E1NA 5M3FJ 2TRTA 3WGGA 5DCFA 3NQOA 4C3HJ 3PO2J 2EINH 5FRMA 3KPHA 1K79A 5D5VB 3F8NA 2XC7A 1P4WA 2R7TA 3HRSA 5ICEA 3COAC 4I76A 2W00A 2EIJH 1SD7A 2OUMA 3C3WA 1TT0A 1UG2A 2P8TA 1FIAA 3ZCOA 1XDSA 2V1XA 3BOQA 3KEYA 1K7AA 1VQKI 3BC8A 1I50J 3LFUA 2RKHA 2Q8KA 1S72I 2PMZN 3DP7A 5LHGA 3ZQIA 3J81Z 3J7YJ 4A3BJ 4ANJA 1FMVA 5DYMA 4ESFA 1JUMA 2BY3A 1TWCJ 1OLTA 2E1MB 1XCVA 4NC8A 3PIPF 2V6EA 3KEQA 1OYIA 4PFOA 1OR7A 2K4JA 3ZN0A 3BJAA 2IRFG 2W48A 2HPMA 4IHXA 2FNAA 2FQ4A 3KLOA 4WCGA 2QM3A 1VQ5I 4MTEA 1FP1D 3BJ6A 1XB4A 2DT6A 4IRHA 5E79C 1GLNA 4IQJA 2XGDA 2E19A 4IRGA 1R6RA 2QSGX 3MWMA 3S17J 2DOAA 3Q3SA 1Z9CA 2KZVA 1MH4A 2DI3A 2HU9A 3MN2A 3REOA 3W2WA 3ABTA 4ZYEA 1MD0A 1A35A 4MFEA 4MO7A 1DQUA 3DEUA 1ERDA 4L0ZB 2CSOA 3V8JA 3OMYA 2L4MA 2NRAC 4CCOA 1MKMA 3ZGKA 3K70D 1J7KA 4HF0A 3KIOA 5E3OA 1Z7UA 2DODA 2LF8A 4ZTJA 1KYZA 2KQRA 4UVBA 1S9HA 4BBRJ 4P9UA 5DS9A 4EM2A 1XC5A 1FLIA 1R4MB 2ESNA 4BE1A 4LITA 3BZKA 1W36C 3S3NA 1VQ4I 2XDVA 2B7EA 1IN4A 4W97A 3CMMA 3Q9SA 1ITYA 3GTKJ 1G8XA 1WHUA 1YG2A 4CO8A 4GYGA 2C6YA 1HW2A 1W0UA 2A5YB 1B8IA 4LJZF 5JLXA 4BQNA 2JSCA 1K4TA 2DFHA 1X19A 3DEWA 3M1CA 2FX0A 2Z1DA 1PUFA 4CUGA 3L2UA 2K9QA 5D5UB 2X1DA 1JKOC 1E3OC 1IXRC 3LSGA 1Y0NA 5DM6F 2ELHA 1G2HA 1ZG3A 4J19A 3GCMA 2HVSA 3QYBA 2V4JC 1ACIA 2LKXA 1JXSA 4Z2YA 1VF9A 5FO5A 3CCLI 3OYJA 1R49A 2EZKA 5E8IA 1JE8A 2R5YB 3QPHA 1D0XA 2DA4A 5K5RA 4K2EA 1GV2A 2HTSA 1S5LC 4MFDA 5IY5H 3HOYJ 5GAGJ 3RKYA 4WXDA 1XX5A 2E2JJ 5CJ9A 2CFOA 4ENNA 4EGZA 1G59A 2HDCA 1V54H 1DP3A 3EUKL 1OFCX 2CH0A 2JVHA 2OCCH 5BS6A 1UHWA 2IT0A 2RN7A 4ZDLA 3WE2A 2DT5A 3F8FA 1S7EA 1XTAA 3GYHX 3JSOA 3FXLA 1VNDA 2LK2A 3K1PA 3FX3A 2JQ7A 2X85A 1XDUA 4G94A 4BL0B 2BY0A 3GLLA 4HRIA 5BOXA 5F1RA 1KU2A 2LFBA 5EDNA 2JWTA 4RAZA 5JVTA 3FM5A 2EZLA 4B8XA 5CVIA 3TL4X 1E2XA 4IVNA 1SFEA 3PSFA 4RGXA 4U88A 3B02A 4G8XA 2DMQA 2EV6A 1IF1A 1S8NA 3EQLF 3ZXSA 4YRVA 1T56A 3I5UA 4LB5A 4LLNA 2O3FA 3D0SA 2NS0A 2BHYA 5A2QK 1B59A 3K4LA 4AD9A 3ABLH 3J7AO 1TW3A 1JKQC 1GHCA 2TDXA 4B09A 2XAQA 4JOMA 3CESA 2EFPA 2QUFA 2XUBA 4IX7A 3WU1B 1ETXA 4M3FA 5DD8A 1PYVA 1LFPA 3FK6A 3BCBA 3K4MA 3T8TA 2H94A 1BC7C 3H1CA 5IP9J 1ZG1A 5KK1A 1Z6RA 2ECBA 3E97A 5LRRA 2VBWA 1LDKB 3CMEI 4BQOA 4LG3A 3R0AA 4B44A 3ASNH 3ZQGA 3GUDA 3QP5A 3OYBA 2L9RA 3KCCA 3TOBA 3GFJA 4M6YA 4N0BA 2ISZA 2NS7A 4XRMA 1HSTA 2OF7A 4DYQA 3HTUA 1HSJA 3S93A 2OC6A 3FF5A 4IEJA 2JTVA 4BACA 4N9IA 5HDKA 2X6OA 3C2HA 4BHBA 2M87A 3CJRB 2FU4A 4DNCA 2F4IA 5GP9A 3U1DA 1QZYA 1BR2A 4MGRA 2VBXA 4PGGA 5FFXA 2KJCA 3ELKA 4OOIA 3HBLA 4HG2A 2VN2A 2ACJA 2IA2A 4ENKA 1V5EA 2STWA 3F8MA 5K7HA 4HF1A 4Q5SF 2A6TA 4KMFA 2DTZA 2VE8A 3KFWX 3RI4A 3JAMK 1ZR4A 2GWRA 1LE8B 4RM2A 5E1ZB 2MG4A 1ENHA 5L3BA 4OAYA 9ANTA 2KLOA 5DV5A 4YFKF 3L2QA 1QO0D 2DK8A 1IDYA 4U7DA 2EIMH 2VODA 3ZQLA 3F6OA 3V8LA 3U2RA 1FBUA 3FWEA 3DLLF 2XKOA 3FXKA 2G9WA 4AVPA 1QGPA 4U0YA 2HOTA 1WJCA 2LREA 4MTDA 1WSUA 4LK0F 1J9IA 1MH3A 4GO1A 2HVRA 4YEJA 3SXYA 5A2QZ 1R23A 3M4OJ 1RUNA 2RNGA 4OWRB 4M3EA 2GQQA 1PJRA 2K27A 1S7OA 4DYRA 5LLQA 3OV8A 3KE2A 2RDPA 3S1NJ 3P9IA 1X58A 2K3FA 1MBJA 3L9FA 4EM1A 2K86A 1LPQA 3Q0VA 1IRZA 4B43A 3G3ZA 3PUFA 1H8AC 3AG3H 1Y8RB 5J1UA 3QPSA 1U5TB 2EB7A 3J7AY 5LBQA 2QQBA 1YIJI 2HXIA 1U8RA 3ERED 2EV0A 3ABUA 3FIWA 1X2MA 5EEGA 2CQXA 3WG9A 4BXUA 5HNFA 3PO3J 2M3AA 1HBXG 4PSWA 3V7SA 4KISA 3PQJA 5HS9A 3CDLA 3G1LA 2Z33A 3OSFA 5IT9Z 1KYWA 2M7BA 3H92A 1D1AA 2HOAA 4ESJA 4S0HB 1NG6A 2ZFWA 1TZLA 3A0HC 3GW2A 1ZGJA 1MJBA 2VJJA 2ZFUA 5BMZA 1J09A 4M3GA 3LSKA 2W7NA 2XPUA 4PUSA 4IO9F 3HDDA 5IOZA 3J81K 3I3LA 1P92A 1AKHA 3IC7A 2R7QA 1O3RA 4CCJA 5ED4A 1NHAA 3NWTA 3BTLA 3UR3C 4M3DA 5BQTA 2Y0SA 4FE4A 1IW7F 2KISA 2N8GA 2NVUB 1T0FC 3F8CA 2X51A 2Z16A 1X1AA 3O3KA 4C2MJ 4E70A 2NVXJ 1KONA 2DT7B 3LSMA 3RJPA 3DU6A 3R0JA 3KYLA 3QAHA 4HNUA 3CJTB 2E1CA 1WJ5A 5JHFA 4MQVA 3FXOA 2E36A 1ORKA 4C30A 3MMYB 3PJRA 3I59A 3IRQA 3JREA 1OCTC 4A93J 3BT9A 1HQCA 2EFOA 3M3YJ 4PJMA 1R1TA 2ZXJA 1X3WB 2KMUA 1M1EB 4QWQA 1J75A 3FDYA 1VQ9I 2I8DA 5TGTA 5FJ8J 3TW7A 4PSXA 1YOVB 1DGRM 4DOZA 3WGHA 3F8BA 1U5TA 2MLKA 5HLHA 1R9TJ 1RRJA 4DQ2A 5GADJ 2O9LA 2WTEA 2LY1A 3HPGA 1SFOJ 2AXLA 5E8GA 1U8BA 5IP6A 1I27A 2LKSA 4EV0A 4AU7A 1QVTA 4QPOA 2AXTC 2DAOA 2P6SA 4JX4A 3TQNA 1W36D 3LSIA 3EUAA 1IC8A 3KP6A 1LEAA 1YE9A 2DU9A 4A2UA 5E3MA 1LVAA 2WADA 2B0LA 4D1QA 4V2GA 3ERMA 4OINF 1ETKA 1Y1VJ 2XF5A 5H2FC 5GAEJ 4A3JJ 4YFXF 2F48A 2ELKA 2E5ZA 4HLXA 2QSFX 3KP7A 4PJJA 2V9KA 1FWZA 3FKJA 3S3MA 4A3EJ 2Z99A 1LQ1A 5IT9K 4JP0A 4B48A 4IXAA 2G7UA 2YR2A 4JYKA 5LGUA 4OIPF 3HSRA 2DMTA 4ZYGA 1YO5C 2R7ZJ 2PJPA 4G6TB 3M07A 2TCTA 5E1XA 2E1MC 2COBA 1GUUA 2Q2EB 3CLQA 2BHZA 1SEUA 1JT6A 1XMAA 5IYBJ 2MD0A 1JGSA 2WWYA 3T0YA 3MKLA 3C2BA 1J59A 1V5GA 2BEOA 4A3CJ 3MD2A 2CRGA 2VT2A 1JKPC 5IPAA 4XRFA 1RI7A 2NNNA 2V26A 2PN6A 1JJ8C 3HHHA 2HFHA 1MMGA 4QTRA 3GTOJ 1S3JA 2RQPA 1FNNA 2HQAA 5GTHC 2QBYB 3I64A 1ZHFA 3OIPA 4X0GA 2EFNA 4QPQA 2PLYA 3OYGA 2YUSA 2J5OA 1OCOH 5KAIC 4FETA 2X6XA 1R00A 3ABKH 2WB1N 4XLEA 2D2WA 5JI6A 2CJJA 4OMYA 3K10A 1QBJA 2O8XA 2EFWA 2FF4A 1DPRA 2CUJA 4HX4A 3I54A 3DTIA 2V1UA 1YS7A 4WX9A 5J4VA 1BR4A 3GTGJ 2CW0F 3HGYA 3P9KA 3R61A 2JA2A 2DXIA 3K2AA 2GIZA 1BA5A 1ZRCA 1ZR2A 4M74A 4KMUX 3CF5F 2R5YA 4CZCA 2OA4A 2CW8A 4ZJZA 1RKWA 3QOEA 1G3YA 4MQ9F 3RYPA 3JRIA 2H6BA 2F5VA 4Y3OA 1R36A 2P7VB 2VC0A 5DEQA 3GFLA 4KA4A 2A69F 2FE3A 2KJBA 1V4RA 3TDZC 1YFHA 3CO7C 4ESBA 4EJOA 2YU9J 3IWFA 2NOGA 3ZP5A 3GZ6A 3H5RA 2ZMEA 1A31A 2HNHA 4GGGA 4KYWA 1W1WE 3HOTA 4J01A 5K5OA 5J47A 4XRSA 2E5NA 2F5FA 3ONQA 2E1OA 5J8CA 3J80K 1RZ4A 4EVIA 1O3SA 3C1DA 1T98A 1KQ0A 2FUG2 2IBDA 2FMLA 3GFIA 3G1OA 4HX8A 2YU3A 2DQLA 2XB5A 4RDUA 4IOAF 1TQMA 3MKWB 1POGA 2HI3A 2EH3A 3H5AA 4S04A 1JJ6C 4A5NA 2PQ8A 2ZJPF 1X2NA 1EF4A 2FMYA 1EKEA 2EWNA 5CPRB 1FBQA 5HNHA 1O7LA 2R92J 2ECCA 4P55A 1YHQI 1FMWA 2X9DA 4IQ4A 4F3QA 1MDMA 3H9JA 4B4CA 2ZC2A 4NQWB 1ETYA 4ZDPA 1B72B 4HYEA 2HS5A 4AYBA 2VASA 1TWFJ 3OYDA 3AKZA 3C7JA 1ZKGA 2M0MA 3CCYA 1YJWI 3VB2A 4AIHA 3LSTA 1XSDA 1ZYRF 2OBPA 1U2WA 3F21A 1LB2A 2FNPA 1ZQ3P 5M5WJ 3R6SA 1UJ8A 5JHUA 3J7ZI 4A5MA 1IZ1A 4ON0A 3P5JA 3BPVA 1X3UA 3H9GA 1TWGJ 1TNTA 2LD5A 1JT0A 4BHCA 1D1BA 3WGIA 2VLAA 3KZYA 2A68F 3L7WA 3F72A 2IS6A 4R1HA 3EPZA 3FMRA 1MBHA 1KU9A 3F0CA 2ZMEB 1J2XA 3SHFA 2QQ9A 2QKLB 2VJ4A 1ZG5A 3KZIC 3CO6C 4BQAA 3AL0B 1NH3A 2R7VA 2R7UA 5GAHJ 2FA5A 3CCSI 4XOTA 1XPXA 4DZJA 2XROA 3LAPA 1YW9A 2PMUA 5DD4A 4BKXA 1GDTA 3HKZA 5J4YA 4OIOF 1FOXA 2HYGD 2KRFA 3OR1C 3P7NA 2DN0A 4KIGA 4O5VA 4XKBA 5J40A 5FD6A 3I56I 3G6EI 1TP4A 4A3LJ 1TT5B 1YX3A 3G2BA 4LK1F 3W3CA 3ZMVA 4EEFG 4RAFA 1DPUA 2L5QA 1FYMA 3TP0A 1FTTA 1UHSA 2F2EA 3HC7A 3NRVA 2UZKA 1KZHA 1RNLA 3K4NA 2QVOA 2R5ZA 3BG6A 3FXMA 2QENA 2FSWA 5LRSA 1L0OC 4XICA 2BVLA 2HOSA 3DFGA 1K6OA 2MLGA 1OKRA 3OL3A 3HYIA 4FISA 4NQWA 3CCJI 1BOBA 4CGZA 2XB0X 2OTLI 3SQNA 2W4SA 3BR3A 1JTYA 5H6RA 1RR8C 2Y69H 4IRIA 5GPAA 2GZWA 1Y8QB 2MGQA 1X1CA 3JSPA 1GVDA 1UZCA 2EQRA 3TEDA 4ZZDA 2IS2A 4DBQA 4XKWA 1ZK8A 4BYYA 5FLVA 3D5LA 3VSLA 2QGUA 3ZQQA 5JVGF 1YI2I 1T33A 3WG7H 3PSIA 2GA1A 1HDDC 1SMYF 2WV1A 1IN6A 1EH8A 2LH9A 1MJAA 3OYAA 4A3MJ 5EZHA 4BXFA 3RZDJ 5J8FA 4XKCA 2LR8A 4CCNA 1S29A 4AVZA 3DKYA 2DFFA 4CYDA 3DV8A 4LLLA 2DA3A 3TDUC 2WV0A 3LA2A 5K7FA 1Z91A 1YLFA 4CSWA 2DJNA 1BOAA 1OPCA 2MH2A 3F23A 2PMZA 2DW4A 1Q1HA 4UUTA 2FOWA 3LSHA 1Y1WJ 2E7XA 4QIWN 2JA6J 4BDYA 4UXNA 3V42A 2E7WA 5FB2A 2AQFA 4LMYA 5EEAA 1WCMJ 4XNFA 4UUSA 1K61A 3RPQA 3OYHA 2JVGA 1ZLJA 2K4BA 2OD5A 5FLXK 3HPHA 1FOKA 1VZ0A 3DWLE 4PZJA 1ULYA 2M30A 4LIUA 3FBIB 3OR2C 2VB6A 3F3XA 4ETSA 1YJNI 4B3AA 2M4GA 3KP3A 4RLFA 4HEA2 5FGMA 4MIMA 4YIRX 3B73A 5CVRA 3RZOJ 2ZSHB 4RGRA 3BLYA 1R71A 4G6QA 3S2HJ 4HNVA 2OQGA 4AIKA 2JUCA 3HHGA 2CUEA 4Z6YA 1FZPB 5DUKA 3OYMA 1DU0A 1B9MA 2DLLA 4CZZA 2V1DA 2L02A 3BY6A 2GM4A 4MEYF 4YELA 3K9TA 1XN7A 2VUMJ 4XORA 2P5KA 2PJRB 1IO2A 3HKZN 3AAFA 3CC2I 3QYFA 3BR0A 2I10A 3TBIA 5EG0A 4A3DJ 4EJVA 3HOWJ 2VJ5A 2M34A 4S05A 2CO5A 1H88C 2QWWA 2XASA 1RETA 2L2OA 5C3EJ 2ZCWA 4CYCA 1UAAA 3T5XA 3CZ6A 1O3TA 2X4HA 3E0JB 4HSTA 2OZUA 1U6GA 4QSHA 3S15J 2OTJI 1G4DA 5CYVA 4ZYHA 2YS9A 4DW6A 5F27A 4P9FA 3FXUA 5LFAA 2XAHA 4XLHA 1W5CC 2OV7A 5CQEA 2VBYA 1USTA 2WA0A 1YTYA 3GTPJ 3LOCA 2QQAA 3A03A 1OMIA 4NUBA 2H6CA 1WI3A 4IKFA 3RQ4A 4FCYA 3OOPA 3HTSB 4ZZLA 1VQNI 4OIQF 3HSEA 1YYVA 1IN5A 5AIQA 2BVMA 4CA0A 2M45A 5E18F 4Y15A 3EYYA 2W82A 5DM7F 2Y9ZA 1P4AA 1A5JA 3PNTA 4ITVA 3KYDB 2V79A 2KIQA 1OYYA 2ZKZA 3I58A 3AL0C 4II3A 4HOBA 2B9SA 2Y75A 4E4HA 1PDNC 4GCVA 1T6SA 2CG4A 4LB6B 4U87A 3FXQA 3ML6A 3WE3A 1HOMA 1WJFA 2P5VA 2DFIA 2UXNA 5FKMA 2PMHA 1QHGA 1Q1VA 1A6QA 3CC4I 2VPLA 4C3JJ 3FBNB 1F1ZA 2CV2A 3HGGA 2E71A 3O8GA 3S1RJ 5ILUA 4DBRA 4BE2A 1F36A 3HOUJ 1I1SA 1IDZA 2MH9A 1Z67A 1S7AA 3HOZJ 3IP4B 2G0EA 3HL2A 3OWTA 2DA2A 3BQZA 4HAMA 4KICA 1MBGA 2VOPA 5JFRA 2X6YA 1TWAJ 5C4XJ 4BJ6C 1AHDP 2LRDA 1RUOA 3BJOA 1IXSB 2YSRA 2CQKA 1HDPA 2AS5F 2BE5F 2NXNB 1SFUA 4I01A 3VYSB 1PUEE 1V5FA 4BAYA 1E3PA 2IAIA 1I3QJ 2VC1A 5HLTA 1NK3P 4RMNA 2ZXWH 1ODDA 2NNYA 2A05A 4NHJA 4EM0B 3E7LA 4Y33A 5CVJA 2DMNA 1FC3A 3V8KA 4D5CA 1SD5A 2H09A 2VKDA 5F1JA 1TQIA 3F22A 3ZMDA 3WTTC 2MSYA 2E35A 3M8EA 4M72A 5C44J 1K78A 1U3EM 1MSFC 3GO5A 4ZC3A 5BPDA 4LG0A 4BJ5C 1OCRH 4JX5A 2M7AA 3OS0A 1WH5A 3X2QH 1S6LA 2O6GE 2L7FP 4XSXF 2VIXA 2VE9A 1ZARA 1I3AA 4HBLA 2LBFB 5DCMB 2Z9OA 2WBMA 5LEJA 2R7WA 1UFMA 5F6FA 5FKKA 1BI0A 1ON1A 2D45A 4LOCA 2JT1A 3ISPA 3QRFF 4A3FJ 5EYRA 2V6CA 4H4KC 3U9GA 3JCUC 2HR3A 2ZJRF 2HVQA 2QLZA 1AU7A 1B9NA 2JMWA 1STZA 1QA6A 3H5NA 4I6ZA 1SVLA 4R79A 4BUPA 1B8IB 2PEXA 3GTJJ 2K02A 2K3PA 2K7LA 2XVCA 5CVVA 3VWBA 1D8JA 4ABZA 4IHYA 2AHQA 3K69A 4D9JA 2FRHA 3FXRA 1D5VA 2BZTA 2OJED 3S2WA 4HW0A 1WRJA 4BQQA 1APLC 3A2KA 1RPWA 1XG1A 5EJCA 1QPMA 4KITB 2DOEA 1H9TA 3T8RA 2MC4A 3U1KA 2JK3A 1OR7C 5HLIA 3H9QA 1DDNA 1X4PA 1WVRA 2RGVA 3CUQB 4XM3A 1T95A 1G6NA 1RKTA 3CLOA 1Z21A 2QF7A 3QQAA 2HXOA 5DDGA 4A3GJ 3GZ5A 4DGWB 2QEXI 3ABMH 1CGPA 5LD2C 1X1PA 5FFZA 1AA7A 4MNUA 4D5FA 3OYFA 3GWZA 4G9YA 3K4BA 4OMZA 2RAEA 1KA8A 3CJQB 4PDKA 3H35A 4CXFA 1MZBA 4BEHB 4IHSA 3R60A 1SMTA 2E2IJ 2B63J 3PIOF 1DUXC 3LQRA 4CICA 5ICGA 2JSPA 4LG0B 4F55A 3CDHA 3OYKA 3UNGC 3UKGA 4M6XA 4RB0A 3TOAA 3HG9A 1IV8A 1I6XA 3K0LA 1X1BA 1JHFA 1VQPI 2GBYA 1QQIA 5DCMA 3BG9A 2F5DA 2L7ZA 4IF4A 4M3BA 1IRFA 2W24A 3FXJA 4E7SA 5KNLA 1FTZA 2VQHA 1CF7A 2ZXIA 1LJ9A 1HKQA 2VPRA 1OYWA 5D4RA 3OL4A 4TV7A 3GTMJ 1YQAA 4BE0A 2O5RA 4MLOA 2ADUA 4DIQA 2KP6A 1P4XA 2HZTA 1UCRA 4NB5A 1BI1A 2X6WA 1D0ZA 2V9VA 3LA7A 4JBAA 3MKYB 4BJTA 1Z6TA 5E3LA 3S14J 2QSHX 1W5TA 3W6KB 3CQZJ 2R3SA 2EV5A 2JRMA 3Q9VA 2F4MB 1G3WA 5FLMJ 1IUFA 1JUSA 4HNTA 2R7FA 3BTIA 3LL7A 3N97A 5HOOA 3E6CC 2QA4I 2JRTA 4WWCA 1WZ2A 3S16J 2ZJ2A 2GIVA 3LA3A 3BR6A 3MEXA 2L01A 2DA1A 4ENMA 2P7CB 4LGWA 4WF2A 1E17A 2H1LA 4A0ZA 1F5TA 2A6EF 1P7IA 3M8FA 4R8HA 3ULQB 4AUXA 2AO9A 3OY9A 4XIDA 2STTA 3JRGA 2JPCA 1RESA 2VQLA 2LMDA 3IL2A 5BPIA 1ZGWA 3VYUB 4A0XA 2LOOA 1R4NB 3SEQA 4BEHA 2KZGA 2LY2A 1FOWA 5GTIC 2VOOA 3WHCA 4B3XA 3PFIA 4UVAA 1K4SA 1CQTA 2CS3A 1VQ8I 1Z3XA 2XAJA 2DO7A 3H36A 1JKRC 3ZMUA 1U78A 5DTDA 1IV6A 4MHGA 2NAZA 2FBIA 3IRRA 4ZH4F 3CMYA 4A12A 2HGCA 2EBIA 1EH7A 1H9GA 2LDUA 1XGOA 4KN7X 4LIVA 5LGTA 5J1RA 3G71I 2DPDA 4KFCA 1JHHA 2DTRA 1VTNC 2BGCA 5ICFA 1WJEA 4ZTFA 4ZDOA 3BR2A 1VQ7I 1XSXA 5IP7J 2CYYA 2KDZA 4FQGA 4L5IA 3RIRA 3QU3A 2A6HF 4UB6C 4U0WA 2MD5A 1USSA 4UUSB 2LNBA 4JK1X 3RKWA 2DJIA 2ME0A 2XKPA 2IA1A 1FY7A 1C0WA 1QU3A 1ZTRA 2IGMA 4RM3A 4PFPA 3PM1A 3HUGB 3KETA 1LUJB 4BY1J 3ZN1A 3HSFA 1R7JA 3NEUA 4M9SA 1U5TC 4FX0A 2Y2ZA 6PAXA 2O03A 4A3KJ 2EPFA 4YIIA 4HV5A 3R4KA 3QODA 4XLPF 4EGYA 2QKMB 2WAFA 4IHVA 2VQGA 2V9PA 3JAMZ 2NVQJ 4A6EA 3O8HA 2NYXA 1O4XA 5KCMA 2HPIA 1MJ9A 4P5OA 2LSOA 2MBFA 2V1NA 3BZ6A 2KRCA 1MSEC 3D5RC 5EGOA 4E7LA 3W6VA 5F0CA 2HQ5A 4A0YA 2GOXB 1YW7A 2R7SA 1JGGA 1ZELA 2WB1A 2CWEA 4GXOA 4NC6A 3QYEA 1K6YA 3VYRB 3BCAA 2ZJQF 4QLCU 1MNMC 1H89C 2DFEA 3JRHA 4X1EA 5EG0B 4IHTA 1Y56A 3HJEA 3MZYA 2M8EA 2P4WA 1ONVA 2AQEA 3EUHA 2RV8A 4XQFA 2MC3A 1TQPA 3ZQ7A 2UV1A 2RREA 4L9TA 2XV4S 1J0RA 4PJNA 2ZB9A 4CDGA 4IJAA 2DYRH
chains in the Genus database with same CATH topology
3D5LA 4E7HA 4XLAA 2R7XA 3U21A 1PYVA 4N4NB 1LFPA 3K4MA 3BCBA 3VSLA 3ZQQA 4BS9A 4CCMA 3S32A 3PSIA 3VDXA 1WJDA 3A1YA 2LH9A 3OYAA 2Z2SB 4BXFA 1LDKB 4XKCA 4CCNA 4BQOA 4LG3A 3DKYA 4AVZA 4B44A 3OYBA 4CSWA 4EATA 4E7JA 2PMZA 3S93A 3LSHA 2OC6A 4ZYAA 4XN0A 3OOUA 3MKZA 4BDYA 3V42A 2K9MA 2R4GA 3RCOA 2AQFA 4BACA 2RQQA 4U7BA 2XF7A 2MABA 3C2HA 4XNFA 3DLAA 5CQGA 4KJZA 3OYCA 1N77A 3CJRB 3OYHA 2JVGA 2F4IA 2A5WA 2CUZA 3LMMA 3HPHA 1BR2A 1VZ0A 3DWLE 2HDWA 4LIUA 3OYIA 3FBIB 3OR2C 4CCKA 2VB6A 4JQFA 4HG2A 2M4GA 2L9NA 1V5EA 4RLFA 4HEA2 4XKVA 4PJLA 4DJAA 2A6TA 2CMPA 5HVQC 5KHDA 2ZSHB 3BLYA 2ZXHA 4RM2A 4HPQA 2HZDA 2LYCA 3OYMA 2W1OA 2LBFA 4OAYA 2KLOA 3KX2A 2JUGA 2KRHA 3IAS2 3L2QA 3OYNA 2KPMA 4YELA 4XORA 3ZRGA 3DPLC 2PJRB 4XONA 4E6KG 3QYFA 2VJIA 2ELJA 3TBIA 2GOMA 1WJCA 2LREA 3IUOA 1MMNA 4Y4RA 2VJ5A 2HVRA 4C2UA 4YEJA 3CF2A 3VSKA 1HA8A 2RNGA 4OWRB 3SDBA 1PJRA 2L2OA 1SFKA 4KT6A 1UAAA 3CZ6A 1X4OA 3HXLA 2V7FA 2IGKA 3E0JB 2WAQA 4HSTA 4IZZA 2VXDA 3L2VA 2ZSIB 2BOLA 4B43A 1LVKA 4E7IA 5LFAA 3PUBA 3PL8A 4XLHA 2OV7A 5CQEA 4E7KA 2WA0A 3IAM2 3W2VA 3J7AY 1EA3A 4NUBA 1DGWY 1UELB 4IKFA 3RQ4A 5HNFA 3E1SA 2IGNA 2M3AA 4PSWA 4KISA 1MMDA 4C2TA 2UUZA 2M7BA 2BVMA 2CV1A 5FROA 1D1AA 4CA0A 1NG6A 2W82A 2LG4A 1TZLA 3PNTA 4ITVA 2VJJA 2ZFUA 1J09A 3LSKA 2W7NA 4PUSA 4FASD 2E60A 3CP8A 3RTRA 3AL0C 4II3A 1Z3YA 4E4HA 3I3LA 2R7QA 4CCJA 4U87A 4XL9A 1P9QC 4F91B 3NWTA 3HOSA 1WJFA 2NOJB 3UR3C 3AFHA 2R7RA 2Y0SA 1UG0A 1QHGA 1X1DA 2XSJC 3K70C 2VPLA 2IGOA 1T0FC 3FBNB 2CV2A 2X51A 3K6GA 3S3OA 4DBRA 2Z16A 1X1AA 4BE2A 3BG7A 2X1CA 1KONA 2DT7B 3IP4B 3LSMA 3DU6A 3KYLA 1N78A 3HL2A 4HNUA 3OWTA 4J00A 1WJ5A 2XAUA 5JHFA 4C9YA 1SAUA 2X6YA 4C30A 3MMYB 4XN3A 3PJRA 4BJ6C 2UWMA 2LRDA 2DCEA 2F6CA 4PJMA 1NG7A 3DU5A 2KMUA 3DPTA 3FDYA 3VYSB 2VKHA 1V5FA 2I8DA 5TGTA 1QHHD 5HLTA 4PSXA 4F92B 1DGRM 3DTKA 4RMNA 4DOZA 2P0WA 4N4OB 2VQCA 3NWSA 4Y33A 2LY1A 4F52A 1E0EA 3HPGA 2M4KA 2CW7A 2K5CA 2VKDA 4AU7A 3I9V2 4QPOA 1W36D 3LSIA 3EUAA 4OAZA 2VXZA 4ZC3A 3OS2A 4BJ5C 4CH7A 2M7AA 3OS0A 3OS1A 1YE9A 2VIXA 5FRNA 2WADA 4HSRA 2LBFB 3TMOA 4D1QA 3PNYA 2XF5A 2WBMA 2R7WA 2VL8A 3K4CA 2L7KA 1D0YA 2E5ZA 4P1WA 3SZGA 4PJJA 2V9KA 3FKJA 3S3MA 4H4KC 3EUHC 4B48A 2HVQA 3ZR8X 4BGDA 2IXSA 3L2RA 3H5NA 3PNVA 3L2WA 4R79A 3CP2A 4BUPA 4G6TB 2IS4A 2K3PA 2E1MC 2Q2EB 4BDZA 3OYEA 3VWBA 1IRXA 2MD0A 4D9JA 2X1EA 4BQQA 3A2KA 1V5GA 3MD2A 4KITB 2MC4A 2V26A 1Z7LA 3C2GA 1OR7C 1MMGA 5FRMA 3H9QA 1X4PA 2HQAA 4XM3A 4XOPA 1T95A 2XC7A 2R7TA 3OIPA 1WFXA 3F9KA 1Z21A 4X0GA 4QPQA 1MNDA 3OYGA 4DGWB 2W00A 5LD2C 3VYTB 2OUMA 1AA7A 4FETA 2X6XA 2WY7Q 3OYFA 1TT0A 3K4BA 4XLEA 3CJQB 3H35A 3ZCOA 3KEYA 4BEHB 3K10A 3BC8A 3LFUA 4NC7A 1MW7A 3A4CA 2CUJA 2JSPA 4F55A 3DTIA 1FMVA 4ANJA 3OYKA 3UNGC 1WJBA 1BR4A 1OLTA 3HG9A 2E1MB 1X1BA 2JA2A 4F93B 2DXIA 4NC8A 2V6EA 4PFOA 4CZCA 4E7SA 2CW8A 5KNLA 2HPMA 2VQHA 4ZJZA 2ZXIA 3QOEA 4II2A 2XF6A 2KL4A 3OL4A 2BW3A 2IS1A 2DT6A 4BE0A 2O5RA 4MLOA 2F5VA 4Y3OA 1GLNA 4DIQA 4IQJA 2KP6A 1Y6IA 3S8PA 2X6WA 1D0ZA 1R6RA 1WJAA 3MKYB 3M8JA 3RSNA 4BJTA 2DOAA 1N75A 2KZVA 3H5RA 2HNHA 4RLQA 2HU9A 3W2WA 3HOTA 4J01A 3N05A 2E5NA 1DQUA 3ONQA 1ERDA 3OMYA 4CCOA 3ZGKA 3K70D 4HNTA 3DEEA 3LL7A 1U0JA 5HOOA 2FUG2 3GBGA 4ZTJA 2KQRA 1S9HA 3RPUD 3MKWB 3K4JA 3H5AA 3OY9A 4BE1A 4LITA 4BU2A 5CPRB 2VQLA 2WY8Q 1W36C 5HNHA 2K9LA 3VYUB 2LOOA 3S3NA 3SEQA 4BEHA 2XDVA 2MFZA 3W2AA 2LY2A 3CMMA 2MYSA 1BR1A 4B3XA 1FMWA 2CS3A 1Z3XA 1G8XA 4IQ4A 4F3QA 2Q1ZB 3H9JA 4NQWB 4ZDPA 2R7OA 4AYBA 4B47A 4BQNA 2VASA 3OYDA 5CKTA 3AKZA 1MNEA 4LIVA 2M0MA 1X19A 4XLCA 4GRIA 3M1CA 2Z1DA 4CUGA 3L2UA 3PFYA 1WJEA 4ZTFA 1JI8A 2X1DA 4ZDOA 3LSGA 3K4KA 2BW3B 2HVSA 3QYBA 2V4JC 3H9GA 4XR6A 2WAEA 2DJIA 1D1BA 3OYJA 1MMAA 2IGMA 4PFPA 4RM3A 2VLAA 1QU3A 3HUGB 4CCLA 2KDOA 1D0XA 4E7ZA 2IS6A 3EPZA 2QKLB 2VJ4A 3SYTA 2PJRA 3AL0B 2R7VA 2R7UA 2CFOA 1G59A 4XOTA 3QODA 3D5SC 2QKMB 2WAFA 3EUKL 2CH0A 2JVHA 2VQGA 1DP3A 3HKZA 2LC2A 4XKBA 4ZDLA 3OR1C 2L9SA 3OIQA 5KCMA 2HPIA 3FHNA 4P5OA 1YX3A 3G2BA 3W3CA 1YX5A 3DTEA 2X85A 2V1NA 4BL0B 2KRCA 3H0DA 2L5QA 4HRIA 3D5RC 4E7LA 3HC7A 2R7SA 2GOXB 1ZELA 2WB1A 3K4NA 3TL4X 3BG6A 1LKXA 3PSFA 4XMYA 3DPUA 3QYEA 1K6YA 3VYRB 3BCAA 1D1CA 2BVLA 3DQVC 3ZXSA 4YRVA 3OL3A 4PK4A 1Y56A 3SEZA 4XLFA 1BOBA 3K4LA 3DKXA 2AQEA 2W4SA 4XQFA 2CV0A 2KHMA 1X1CA 2UV1A 2RREA 4JOMA 3CESA 4NNJA 4PJNA 4IX7A 2IS2A 4DBQA 4XKWA 3OYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUJ A;  2AQF A;  2DCE A;  2ELJ A;  2AQE A; 
#chains in the Genus database with same CATH topology
 4E7H A;  2FOK A;  4XSZ F;  3U21 A;  4YIF A;  2D5V A;  2R7X A;  2BBY A;  1RIO H;  2DA7 A;  3VDX A;  3LSR A;  4NBQ A;  2LF7 A;  4PCQ A;  1TWH J;  1RR7 A;  3A1Y A;  3I0T A;  1X3Z B;  1T2K A;  2Z2S B;  3BR5 A;  1D5Y A;  1LFB A;  5ICC A;  1AKH B;  2M0C A;  2HWV A;  4BNC A;  1UMQ A;  3CCR I;  2XPW A;  1F43 A;  2OU2 A;  4HLY A;  4E7J A;  5CLS A;  4HDV A;  1VFC A;  4ZYA A;  4XN0 A;  3MKZ A;  1ZLK A;  4GDF A;  3SFZ A;  5D5W B;  2K9M A;  2R4G A;  2CQ7 A;  3I53 A;  2F5C A;  2FBK A;  2RQQ A;  2EA2 A;  2XF7 A;  4U7B A;  2MAB A;  2HKX A;  3AG2 H;  2HQN A;  3DLA A;  1VQO I;  1N77 A;  1BW6 A;  1PP7 U;  3G73 A;  4M73 A;  3FKI J;  1BIA A;  4LD5 A;  2DBB A;  3TGN A;  4AID A;  2CUZ A;  3I59 B;  1FEX A;  1I5Z A;  3HOX J;  1YRN A;  2HDW A;  3BWG A;  2X0L A;  3QPT A;  5F64 A;  4G7O F;  2OAZ A;  3ZOB A;  3HRM A;  4JQF A;  5KVR A;  1NTC A;  2Y48 A;  5EGO B;  3B6A A;  4CHU A;  1P7J A;  4L5J A;  4XKV A;  5AIP A;  4DJA A;  5B3S H;  3GFM A;  5KHD A;  1XCB A;  3JRB A;  4WK8 F;  4I99 C;  2XRN A;  1FYL A;  5B5E C;  4HPQ A;  3I4M J;  2DK5 A;  3IWZ A;  3KX2 A;  2JUG A;  3V7C A;  3IAS 2;  4FE7 A;  1F9N A;  2KPM A;  4EQQ A;  4EJU A;  1PUF B;  4L0Y B;  2BY1 A;  3WTX C;  4KN4 X;  4D0P A;  1JUP A;  3TO6 A;  3DPL C;  3ZRG A;  3MAJ A;  2Y30 A;  4BHP A;  3E6D A;  1BJA A;  2BXZ A;  2ELJ A;  2Y0M A;  3CMA I;  3ZQC A;  1BIB A;  2XAG A;  2ESH A;  2PBI A;  3GZN B;  4Y4R A;  5H20 A;  3VEP A;  5EF6 A;  3RKQ A;  4C2U A;  1VQL I;  4YFN F;  1HA8 A;  1IGN A;  3FMQ A;  4M9Z A;  4RGS A;  2XGE A;  3SDB A;  2L54 A;  1IRG A;  1X4O A;  1SVM A;  1ZRF A;  2EIK H;  2V7F A;  5LGN A;  3IKT A;  3FHZ A;  1IG7 A;  2QZ8 A;  2FBH A;  1W5S A;  2BOL A;  2G7H A;  2K40 A;  4L9V A;  1LVK A;  4FHT A;  2K9N A;  1JTX A;  2EZI A;  3PL8 A;  3MFK A;  5FKL A;  4E7K A;  1FYK A;  1EA3 A;  3L00 A;  1YIO A;  3E1S A;  1KU7 A;  3ESW B;  1A6I A;  2KIF A;  1MMD A;  4H0E A;  4C2T A;  2UUZ A;  5TIS C;  3VFZ A;  5FRO A;  1EJ9 A;  4JX6 A;  5FKN A;  2QBY A;  3H3V K;  3K1M A;  5JR3 A;  3JRC A;  3SFI A;  2FEZ A;  2ID6 A;  1BJZ A;  3CP8 A;  3RTR A;  4I2O A;  4RAY A;  2ZO4 A;  3ZMT A;  1P9Q C;  1UHM A;  3JTG A;  2R93 J;  1FSE A;  4DYC A;  3HOS A;  4V19 K;  2W84 A;  2NOJ B;  3I55 I;  3AFH A;  1SVO A;  1AOY A;  1FJL A;  3WU0 A;  4HDU A;  1R1V A;  3ASO H;  4XLN F;  1QNT A;  5AON A;  2DDB A;  1HF0 A;  4WXC A;  4M71 A;  3SDG A;  2YPR A;  3HB9 A;  3TP3 A;  3BP8 A;  3BDD A;  2GLO A;  1IUY A;  3K6G A;  3S3O A;  3CCU I;  2X48 A;  2HYJ A;  1KQ9 A;  3JW4 A;  3BR1 A;  5FKO A;  5F0H A;  2XAU A;  3TKY A;  1W0T A;  3CCV I;  1SAU A;  4EJW A;  4XN3 A;  1SC7 A;  4BH9 A;  2UWM A;  5HS7 A;  2L4A A;  2DCE A;  5F04 A;  3OIO A;  2DMP A;  1ZRD A;  2F6C A;  3DCF A;  1NG7 A;  1IJW C;  1WQ2 A;  1LDD A;  4EJT A;  1W4M A;  2LP0 A;  4G7H F;  2VKH A;  3SZT A;  2GAU A;  1BL0 A;  1WGX A;  5JLW A;  2K85 A;  1ETQ A;  2IJL A;  3CJN A;  3BQY A;  3DTK A;  4FX4 A;  3S1Q J;  5D8L B;  2P0W A;  5FLX Z;  5J1Y A;  1SAX A;  3VOD A;  1LE8 A;  1TL8 A;  2DQR A;  3GX4 X;  2EIL H;  1T0F A;  2GXA A;  1E0E A;  2VKE A;  5E3N A;  2CW7 A;  4RS8 A;  3O6B B;  2PFB A;  1SAN A;  1B6A A;  1CF7 B;  3E5Q A;  3B6C A;  4LFU A;  3CCE I;  1O3Q A;  2HYF A;  2CFX A;  2VXZ A;  4CH7 A;  2HDD A;  3WTV C;  3KP2 A;  1J5Y A;  3KP4 A;  4XRS G;  5FRN A;  1B72 A;  4HQM A;  3A01 A;  5J6X A;  2VT3 A;  3PNY A;  2EFQ A;  2WAQ N;  3EET A;  3GME A;  2DYS H;  3LNQ A;  2VL8 A;  3MZH A;  3IH3 A;  1D0Y A;  1XMX A;  3DKW A;  1H0M A;  3RKX A;  3TO7 A;  2BV6 A;  4AIJ A;  1MDM B;  4KDP A;  4M6V A;  1TLH B;  4RAG A;  4BGD A;  2IXS A;  3L2R A;  3E6B A;  3L2W A;  3CP2 A;  5F0F A;  5H6Q A;  1MBE A;  2IS4 A;  3ROU A;  3ZQH A;  2EJR A;  4HA8 A;  1DU6 A;  1YW8 A;  2OCE A;  1IRX A;  2QYO A;  2QQ8 A;  2X1E A;  1REP C;  4KIF A;  3F6V A;  1TBX A;  4RB3 C;  4FT8 A;  2LLK A;  1A36 A;  3C2G A;  5LHH A;  1Z7L A;  2CQN A;  1OCC H;  1TTY A;  3GEZ A;  1HXD A;  5L3E A;  4XOP A;  4I09 A;  3WTY C;  2W25 A;  1WFX A;  4KT5 C;  1GXP A;  3F9K A;  4Y17 A;  1MND A;  4UY8 I;  4L18 B;  3VYT B;  2WY7 Q;  3WTS C;  5B1B H;  4Y13 A;  3MQ0 A;  4I0A A;  1GVJ A;  3LWF A;  5L3C A;  1XSV A;  2H27 A;  1R58 A;  2VBZ A;  1ZRE A;  4NC7 A;  1MW7 A;  5CVU A;  3JTH A;  3A4C A;  4L5E A;  4N9H A;  1AWC A;  4V2F A;  1W7P D;  1XGM A;  3GVA A;  1WJB A;  2UXX A;  3CUO A;  3V4G A;  3QWL A;  3S2D J;  3H0G J;  4F93 B;  2BY2 A;  4I98 B;  2LVS A;  5KAF C;  1FSH A;  2CQQ A;  3L2C A;  2XGX A;  4XK4 A;  1WI9 A;  2IPQ X;  3VOE A;  3HEF A;  4UHT A;  4II2 A;  2XF6 A;  3FZV A;  2KL4 A;  2L0K A;  2BW3 A;  3HRT A;  2IS1 A;  2GA2 A;  1PP8 F;  4Q47 A;  1Y6I A;  4KUM A;  3S8P A;  1WJA A;  2FJ1 A;  1SD6 A;  3M8J A;  3RSN A;  1K83 J;  3SJM A;  2RC4 A;  1FX7 A;  1N75 A;  3WHB A;  3G1M A;  4A6D A;  2QCO A;  3E3V A;  4RLQ A;  5DUI A;  3N05 A;  2DDA A;  5D5X B;  4HV6 A;  4HF2 A;  2JA7 J;  2ID3 A;  1VQM I;  2BYV E;  3DEE A;  3QU6 A;  4UB8 C;  2D1H A;  1FT9 A;  2IVM A;  3H3U A;  1U0J A;  2PG4 A;  4RBO A;  2HTJ A;  3S1M J;  2CU7 A;  3GBG A;  1LNW A;  3L1P A;  3C18 A;  2Q0O A;  2A07 F;  1FPQ A;  2M2E A;  1FIP A;  4D7N A;  3RPU D;  2IA0 A;  2JZY A;  4IPA A;  3K4J A;  4KIB A;  2ZME C;  1LEB A;  4AM3 A;  3LSP A;  4BU2 A;  3TO9 A;  1QPI A;  2WY8 Q;  5TJJ A;  2K9L A;  2MFZ A;  3K1N A;  5HLG A;  3W2A A;  2W57 A;  1YIT I;  2MYS A;  1BR1 A;  1U9N A;  3T1B A;  1UB9 A;  2Q1Z B;  1YJ9 I;  4Q4Z F;  3CCM I;  1BN5 A;  2FQ3 A;  2J5P A;  2R7O A;  1QVU A;  2L3D A;  4B47 A;  2I5U A;  5CKT A;  4NDL A;  1MNE A;  1O57 A;  4GRI A;  4XLC A;  1T39 A;  4G6D A;  3ZMZ A;  5C4J J;  1GT0 C;  4KNY A;  2ISY A;  5F08 A;  2KKO A;  3PFY A;  1JI8 A;  1E3H A;  3RDI A;  2XHK A;  3K4K A;  3NAU A;  2BW3 B;  4A69 C;  5L3G A;  1P2F A;  1RC9 A;  2OQR A;  4XR6 A;  2WAE A;  2Q2E A;  4OIR F;  2ME6 A;  3FMS A;  1MMA A;  5E1W A;  3EYI A;  4AC0 A;  4CCL A;  3W6J B;  2KDO A;  1FOY A;  2EZH A;  4UVC A;  4E7Z A;  4DZP A;  4MEX F;  2XSD C;  3NAR A;  1YRN B;  1BI2 A;  4CYC B;  1R5H A;  2NVY J;  1IN8 A;  4I7H A;  2RVC A;  3SYT A;  4A3I J;  2PJR A;  2DA5 A;  3M9A A;  3M7G A;  1FBS A;  3D5S C;  2HEO A;  4HZF A;  3HM5 A;  1R1U A;  1U9O A;  2HKO A;  2LC2 A;  5D8K B;  2YX4 A;  3ZQF A;  3PQK A;  1V55 H;  2L9S A;  3OIQ A;  5IOY A;  2H1K A;  3GF2 A;  3HOV J;  3FHN A;  5ILV A;  2E34 A;  3BZC A;  1YX5 A;  3DTE A;  1O7F A;  1I6H J;  3H0D A;  1HW5 A;  1Z77 A;  3ECO A;  1BM9 A;  2XIG A;  5LEK A;  3LSJ A;  3DBL B;  1SFX A;  2ICW G;  3QP6 A;  2ZNY A;  1B4A A;  3J80 Z;  1LKX A;  1IXC A;  4XMY A;  3D1N I;  3DPU A;  5D6E A;  1Z05 A;  4Y7N J;  1D1C A;  3JRA A;  3DQV C;  2Y9Y A;  3DXJ F;  1EH6 A;  2LTP A;  4PK4 A;  3SEZ A;  4XLF A;  3DKX A;  2KT0 A;  1XD7 A;  2Y0S N;  2JN6 A;  3H3Z A;  3G4S I;  3RQI A;  1IAW A;  2KHM A;  1MIJ A;  1BC8 C;  2CV0 A;  1XGN A;  4I02 A;  4HQE A;  4NNJ A;  3IKV A;  3OYL A;  5L3D A;  3RPU A;  4XLA A;  4N4N B;  3BTJ A;  4BS9 A;  5IT3 A;  5K5Q A;  1ON2 A;  4CCM A;  1Z0X A;  3DBH B;  3S32 A;  2NVT J;  1XS9 A;  2D1V A;  2HQR A;  1WJD A;  3JR9 A;  3A02 A;  1T8I A;  2XGC A;  2M5W A;  1MGT A;  2XRL A;  2KIM A;  5M5X J;  1G3T A;  3K2Z A;  2XAF A;  3MZ8 A;  1GXQ A;  2LY9 A;  4FTH A;  2DOF A;  3HIF A;  2ZBK A;  3FIS A;  4EAT A;  2H8W A;  1WH7 A;  3DF8 A;  3GTL J;  2O61 A;  3IH2 A;  2R0Q C;  1T08 B;  1OIS A;  3BPX A;  3LFK A;  4WXH A;  3A0B C;  3SZP A;  3OOU A;  5D4S A;  4RB2 C;  3AG1 H;  1MBF A;  4UV9 A;  3RCO A;  3JRF A;  1BW5 A;  1P6R A;  1W7P B;  3WOD F;  5CQG A;  4KJZ A;  3OYC A;  1KU3 A;  3WTW C;  2A5W A;  3L09 A;  5E17 F;  3BTC A;  3I71 A;  3LMM A;  3KP5 A;  2IP2 A;  4G7Z F;  2E2H J;  2OPT A;  3OYI A;  1VI0 A;  4CCK A;  4L9J A;  2VON A;  2L9N A;  1N25 A;  5M3M J;  2BXY A;  4PJL A;  2O8K A;  3DBR B;  5K7Z A;  4ENJ A;  2CMP A;  5HVQ C;  2COM A;  4C3I J;  4PJ0 C;  2ZXH A;  3Q0W A;  3QOP A;  4PGH A;  5LHI A;  2HZD A;  1A04 A;  1WPK A;  2LYC A;  3JRD A;  2W1O A;  2KIU A;  2LBF A;  2KRH A;  1L3L A;  2LKP A;  3OYN A;  3TW6 A;  2P81 A;  2GXG A;  1B1B A;  3MVP A;  4ASN A;  2F4O B;  5B1A H;  3BG5 A;  2JA8 J;  1K78 B;  1OQY A;  3EDP A;  4XON A;  4E6K G;  3CTA A;  2VJI A;  2CGP A;  2XPV A;  2GXB A;  2GOM A;  1ETO A;  2FXA A;  3VPR A;  3IUO A;  1MMN A;  5EEH A;  3P9C A;  3Q5F A;  2HOE A;  3CF2 A;  3VSK A;  4BBS J;  2Z3Y A;  4GYI A;  1SFK A;  4KT6 A;  4RGU A;  1LFU P;  1Z1D A;  3WTZ A;  4RB1 A;  3HXL A;  4Y52 J;  2IGK A;  5ILS A;  2WAQ A;  2IEK A;  4IZZ A;  1DP7 P;  2VXD A;  2M8G X;  3L2V A;  2ZSI B;  2VI6 A;  2R5Z B;  4UNO A;  1IN7 A;  1MBK A;  2A3S A;  3E5U A;  4IL6 C;  1W7P A;  4AYB N;  5B66 C;  4E7I A;  3PUB A;  4UUV A;  1WKM A;  1ZN2 A;  3IH4 A;  3GTQ J;  3IAM 2;  3W2V A;  3I4P A;  1GV5 A;  1D3Y A;  5IYD J;  3A01 B;  1DGW Y;  1UEL B;  1I39 A;  3KZZ A;  1BI3 A;  2EA4 A;  3K7A J;  2IGN A;  3BG3 A;  4IOC F;  2H8R A;  1HLV A;  2NS8 A;  4O3M A;  3FM3 A;  1TC3 C;  3MCZ A;  2CV1 A;  4F7Z A;  3KYC B;  1R5I D;  2LG4 A;  3CUQ A;  2RNJ A;  2W85 A;  3ZPL A;  4D7M A;  2IW5 A;  3IHU A;  4FAS D;  2E60 A;  3V7R A;  1Z3Y A;  1LDJ A;  2PI0 A;  1Y39 A;  2L7M P;  5EZG A;  4XL9 A;  4F91 B;  2CUF A;  4M9X A;  2PX9 A;  5IYC J;  1Y0U A;  2ZNZ A;  3O2P E;  2R7R A;  1TW2 A;  1UG0 A;  2WC2 A;  1KGS A;  1X1D A;  2XSJ C;  1KQ8 A;  1WWX A;  3K70 C;  1XGS A;  2IGO A;  1F4K A;  1G3S A;  4BY7 J;  3LAJ A;  2A61 A;  4AWX B;  5TRD A;  3OSG A;  3BG7 A;  2X1C A;  2P6T A;  4ZYD A;  2Y31 A;  4LLG F;  1N78 A;  4U0V A;  4J00 A;  4I0B A;  2DPU A;  1YS6 A;  4BXX J;  1D8K A;  2MA3 A;  4C9Y A;  2KFD A;  4HX7 A;  4EMS A;  2FD5 A;  2Z5U A;  3I4N J;  2K9S A;  3KLN A;  2DA6 A;  1BBY A;  2EK5 A;  1OJL A;  1QZE A;  2M1B A;  1SD4 A;  1T38 A;  3FK7 A;  3DU5 A;  5K1Y A;  3DPT A;  3HZJ A;  1QHH D;  4G12 A;  1VQ6 I;  1MMS A;  4UV8 A;  4F92 B;  3AG4 H;  1QZZ A;  4X6A J;  1QRY A;  1R5G A;  1XMK A;  1ZH5 A;  1ETW A;  2ETH A;  5ERI A;  2JA5 J;  4N4O B;  2VQC A;  3NWS A;  4GFB A;  2DMU A;  3LQQ A;  4B1R A;  4Q48 A;  1ZAO A;  4F52 A;  3N4M A;  2M4K A;  1PVE A;  1ZGA A;  2K5C A;  1HKT A;  2VKV A;  3WTU C;  3I9V 2;  5HOD A;  3CCQ I;  2JPB A;  5M5Y J;  4IHW A;  1TNS A;  2YX7 A;  5HDN A;  1HC8 A;  2MW8 A;  4OU0 A;  5HS8 A;  1R22 A;  4OAZ A;  5FD5 A;  3OS2 A;  3CUQ C;  1OCP A;  3HRU A;  3OS1 A;  5HDG A;  2O7O A;  5D6F A;  1ETV A;  4HSR A;  3TMO A;  1HKS A;  2L9V A;  3Q0U A;  1I1G A;  2P5L C;  1NK2 P;  3WU2 C;  3K4C A;  3E6M A;  2L7K A;  2O0Y A;  1HCR A;  3KEO A;  4P1W A;  3SZG A;  3CC7 I;  1EV7 A;  3M1E A;  2M9H A;  1FP2 A;  3EUH C;  3CDI A;  4RA2 A;  3CD6 I;  5BNG A;  3ECH A;  3GXO A;  4XBF A;  3ZR8 X;  3RYR A;  3IV5 A;  3PNV A;  2F5E A;  2OZ6 A;  3BRO A;  5GPC A;  4P96 A;  4W1U A;  3QPL A;  4BDZ A;  3OYE A;  3HUG A;  3E5X A;  4O6J A;  2R7D A;  2JJ7 A;  3GLX A;  1HW1 A;  5J3L A;  4YG2 F;  1OCZ H;  3ZMS A;  1V3F A;  5L3F A;  5E20 A;  4L9N A;  2E1N A;  5M3F J;  2TRT A;  3WGG A;  5DCF A;  3NQO A;  4C3H J;  3PO2 J;  2EIN H;  5FRM A;  3KPH A;  1K79 A;  5D5V B;  3F8N A;  2XC7 A;  1P4W A;  2R7T A;  3HRS A;  5ICE A;  3COA C;  4I76 A;  2W00 A;  2EIJ H;  1SD7 A;  2OUM A;  3C3W A;  1TT0 A;  1UG2 A;  2P8T A;  1FIA A;  3ZCO A;  1XDS A;  2V1X A;  3BOQ A;  3KEY A;  1K7A A;  1VQK I;  3BC8 A;  1I50 J;  3LFU A;  2RKH A;  2Q8K A;  1S72 I;  2PMZ N;  3DP7 A;  5LHG A;  3ZQI A;  3J81 Z;  3J7Y J;  4A3B J;  4ANJ A;  1FMV A;  5DYM A;  4ESF A;  1JUM A;  2BY3 A;  1TWC J;  1OLT A;  2E1M B;  1XCV A;  4NC8 A;  3PIP F;  2V6E A;  3KEQ A;  1OYI A;  4PFO A;  1OR7 A;  2K4J A;  3ZN0 A;  3BJA A;  2IRF G;  2W48 A;  2HPM A;  4IHX A;  2FNA A;  2FQ4 A;  3KLO A;  4WCG A;  2QM3 A;  1VQ5 I;  4MTE A;  1FP1 D;  3BJ6 A;  1XB4 A;  2DT6 A;  4IRH A;  5E79 C;  1GLN A;  4IQJ A;  2XGD A;  2E19 A;  4IRG A;  1R6R A;  2QSG X;  3MWM A;  3S17 J;  2DOA A;  3Q3S A;  1Z9C A;  2KZV A;  1MH4 A;  2DI3 A;  2HU9 A;  3MN2 A;  3REO A;  3W2W A;  3ABT A;  4ZYE A;  1MD0 A;  1A35 A;  4MFE A;  4MO7 A;  1DQU A;  3DEU A;  1ERD A;  4L0Z B;  2CSO A;  3V8J A;  3OMY A;  2L4M A;  2NRA C;  4CCO A;  1MKM A;  3ZGK A;  3K70 D;  1J7K A;  4HF0 A;  3KIO A;  5E3O A;  1Z7U A;  2DOD A;  2LF8 A;  4ZTJ A;  1KYZ A;  2KQR A;  4UVB A;  1S9H A;  4BBR J;  4P9U A;  5DS9 A;  4EM2 A;  1XC5 A;  1FLI A;  1R4M B;  2ESN A;  4BE1 A;  4LIT A;  3BZK A;  1W36 C;  3S3N A;  1VQ4 I;  2XDV A;  2B7E A;  1IN4 A;  4W97 A;  3CMM A;  3Q9S A;  1ITY A;  3GTK J;  1G8X A;  1WHU A;  1YG2 A;  4CO8 A;  4GYG A;  2C6Y A;  1HW2 A;  1W0U A;  2A5Y B;  1B8I A;  4LJZ F;  5JLX A;  4BQN A;  2JSC A;  1K4T A;  2DFH A;  1X19 A;  3DEW A;  3M1C A;  2FX0 A;  2Z1D A;  1PUF A;  4CUG A;  3L2U A;  2K9Q A;  5D5U B;  2X1D A;  1JKO C;  1E3O C;  1IXR C;  3LSG A;  1Y0N A;  5DM6 F;  2ELH A;  1G2H A;  1ZG3 A;  4J19 A;  3GCM A;  2HVS A;  3QYB A;  2V4J C;  1ACI A;  2LKX A;  1JXS A;  4Z2Y A;  1VF9 A;  5FO5 A;  3CCL I;  3OYJ A;  1R49 A;  2EZK A;  5E8I A;  1JE8 A;  2R5Y B;  3QPH A;  1D0X A;  2DA4 A;  5K5R A;  4K2E A;  1GV2 A;  2HTS A;  1S5L C;  4MFD A;  5IY5 H;  3HOY J;  5GAG J;  3RKY A;  4WXD A;  1XX5 A;  2E2J J;  5CJ9 A;  2CFO A;  4ENN A;  4EGZ A;  1G59 A;  2HDC A;  1V54 H;  1DP3 A;  3EUK L;  1OFC X;  2CH0 A;  2JVH A;  2OCC H;  5BS6 A;  1UHW A;  2IT0 A;  2RN7 A;  4ZDL A;  3WE2 A;  2DT5 A;  3F8F A;  1S7E A;  1XTA A;  3GYH X;  3JSO A;  3FXL A;  1VND A;  2LK2 A;  3K1P A;  3FX3 A;  2JQ7 A;  2X85 A;  1XDU A;  4G94 A;  4BL0 B;  2BY0 A;  3GLL A;  4HRI A;  5BOX A;  5F1R A;  1KU2 A;  2LFB A;  5EDN A;  2JWT A;  4RAZ A;  5JVT A;  3FM5 A;  2EZL A;  4B8X A;  5CVI A;  3TL4 X;  1E2X A;  4IVN A;  1SFE A;  3PSF A;  4RGX A;  4U88 A;  3B02 A;  4G8X A;  2DMQ A;  2EV6 A;  1IF1 A;  1S8N A;  3EQL F;  3ZXS A;  4YRV A;  1T56 A;  3I5U A;  4LB5 A;  4LLN A;  2O3F A;  3D0S A;  2NS0 A;  2BHY A;  5A2Q K;  1B59 A;  3K4L A;  4AD9 A;  3ABL H;  3J7A O;  1TW3 A;  1JKQ C;  1GHC A;  2TDX A;  4B09 A;  2XAQ A;  4JOM A;  3CES A;  2EFP A;  2QUF A;  2XUB A;  4IX7 A;  3WU1 B;  1ETX A;  4M3F A;  5DD8 A;  1PYV A;  1LFP A;  3FK6 A;  3BCB A;  3K4M A;  3T8T A;  2H94 A;  1BC7 C;  3H1C A;  5IP9 J;  1ZG1 A;  5KK1 A;  1Z6R A;  2ECB A;  3E97 A;  5LRR A;  2VBW A;  1LDK B;  3CME I;  4BQO A;  4LG3 A;  3R0A A;  4B44 A;  3ASN H;  3ZQG A;  3GUD A;  3QP5 A;  3OYB A;  2L9R A;  3KCC A;  3TOB A;  3GFJ A;  4M6Y A;  4N0B A;  2ISZ A;  2NS7 A;  4XRM A;  1HST A;  2OF7 A;  4DYQ A;  3HTU A;  1HSJ A;  3S93 A;  2OC6 A;  3FF5 A;  4IEJ A;  2JTV A;  4BAC A;  4N9I A;  5HDK A;  2X6O A;  3C2H A;  4BHB A;  2M87 A;  3CJR B;  2FU4 A;  4DNC A;  2F4I A;  5GP9 A;  3U1D A;  1QZY A;  1BR2 A;  4MGR A;  2VBX A;  4PGG A;  5FFX A;  2KJC A;  3ELK A;  4OOI A;  3HBL A;  4HG2 A;  2VN2 A;  2ACJ A;  2IA2 A;  4ENK A;  1V5E A;  2STW A;  3F8M A;  5K7H A;  4HF1 A;  4Q5S F;  2A6T A;  4KMF A;  2DTZ A;  2VE8 A;  3KFW X;  3RI4 A;  3JAM K;  1ZR4 A;  2GWR A;  1LE8 B;  4RM2 A;  5E1Z B;  2MG4 A;  1ENH A;  5L3B A;  4OAY A;  9ANT A;  2KLO A;  5DV5 A;  4YFK F;  3L2Q A;  1QO0 D;  2DK8 A;  1IDY A;  4U7D A;  2EIM H;  2VOD A;  3ZQL A;  3F6O A;  3V8L A;  3U2R A;  1FBU A;  3FWE A;  3DLL F;  2XKO A;  3FXK A;  2G9W A;  4AVP A;  1QGP A;  4U0Y A;  2HOT A;  1WJC A;  2LRE A;  4MTD A;  1WSU A;  4LK0 F;  1J9I A;  1MH3 A;  4GO1 A;  2HVR A;  4YEJ A;  3SXY A;  5A2Q Z;  1R23 A;  3M4O J;  1RUN A;  2RNG A;  4OWR B;  4M3E A;  2GQQ A;  1PJR A;  2K27 A;  1S7O A;  4DYR A;  5LLQ A;  3OV8 A;  3KE2 A;  2RDP A;  3S1N J;  3P9I A;  1X58 A;  2K3F A;  1MBJ A;  3L9F A;  4EM1 A;  2K86 A;  1LPQ A;  3Q0V A;  1IRZ A;  4B43 A;  3G3Z A;  3PUF A;  1H8A C;  3AG3 H;  1Y8R B;  5J1U A;  3QPS A;  1U5T B;  2EB7 A;  3J7A Y;  5LBQ A;  2QQB A;  1YIJ I;  2HXI A;  1U8R A;  3ERE D;  2EV0 A;  3ABU A;  3FIW A;  1X2M A;  5EEG A;  2CQX A;  3WG9 A;  4BXU A;  5HNF A;  3PO3 J;  2M3A A;  1HBX G;  4PSW A;  3V7S A;  4KIS A;  3PQJ A;  5HS9 A;  3CDL A;  3G1L A;  2Z33 A;  3OSF A;  5IT9 Z;  1KYW A;  2M7B A;  3H92 A;  1D1A A;  2HOA A;  4ESJ A;  4S0H B;  1NG6 A;  2ZFW A;  1TZL A;  3A0H C;  3GW2 A;  1ZGJ A;  1MJB A;  2VJJ A;  2ZFU A;  5BMZ A;  1J09 A;  4M3G A;  3LSK A;  2W7N A;  2XPU A;  4PUS A;  4IO9 F;  3HDD A;  5IOZ A;  3J81 K;  3I3L A;  1P92 A;  1AKH A;  3IC7 A;  2R7Q A;  1O3R A;  4CCJ A;  5ED4 A;  1NHA A;  3NWT A;  3BTL A;  3UR3 C;  4M3D A;  5BQT A;  2Y0S A;  4FE4 A;  1IW7 F;  2KIS A;  2N8G A;  2NVU B;  1T0F C;  3F8C A;  2X51 A;  2Z16 A;  1X1A A;  3O3K A;  4C2M J;  4E70 A;  2NVX J;  1KON A;  2DT7 B;  3LSM A;  3RJP A;  3DU6 A;  3R0J A;  3KYL A;  3QAH A;  4HNU A;  3CJT B;  2E1C A;  1WJ5 A;  5JHF A;  4MQV A;  3FXO A;  2E36 A;  1ORK A;  4C30 A;  3MMY B;  3PJR A;  3I59 A;  3IRQ A;  3JRE A;  1OCT C;  4A93 J;  3BT9 A;  1HQC A;  2EFO A;  3M3Y J;  4PJM A;  1R1T A;  2ZXJ A;  1X3W B;  2KMU A;  1M1E B;  4QWQ A;  1J75 A;  3FDY A;  1VQ9 I;  2I8D A;  5TGT A;  5FJ8 J;  3TW7 A;  4PSX A;  1YOV B;  1DGR M;  4DOZ A;  3WGH A;  3F8B A;  1U5T A;  2MLK A;  5HLH A;  1R9T J;  1RRJ A;  4DQ2 A;  5GAD J;  2O9L A;  2WTE A;  2LY1 A;  3HPG A;  1SFO J;  2AXL A;  5E8G A;  1U8B A;  5IP6 A;  1I27 A;  2LKS A;  4EV0 A;  4AU7 A;  1QVT A;  4QPO A;  2AXT C;  2DAO A;  2P6S A;  4JX4 A;  3TQN A;  1W36 D;  3LSI A;  3EUA A;  1IC8 A;  3KP6 A;  1LEA A;  1YE9 A;  2DU9 A;  4A2U A;  5E3M A;  1LVA A;  2WAD A;  2B0L A;  4D1Q A;  4V2G A;  3ERM A;  4OIN F;  1ETK A;  1Y1V J;  2XF5 A;  5H2F C;  5GAE J;  4A3J J;  4YFX F;  2F48 A;  2ELK A;  2E5Z A;  4HLX A;  2QSF X;  3KP7 A;  4PJJ A;  2V9K A;  1FWZ A;  3FKJ A;  3S3M A;  4A3E J;  2Z99 A;  1LQ1 A;  5IT9 K;  4JP0 A;  4B48 A;  4IXA A;  2G7U A;  2YR2 A;  4JYK A;  5LGU A;  4OIP F;  3HSR A;  2DMT A;  4ZYG A;  1YO5 C;  2R7Z J;  2PJP A;  4G6T B;  3M07 A;  2TCT A;  5E1X A;  2E1M C;  2COB A;  1GUU A;  2Q2E B;  3CLQ A;  2BHZ A;  1SEU A;  1JT6 A;  1XMA A;  5IYB J;  2MD0 A;  1JGS A;  2WWY A;  3T0Y A;  3MKL A;  3C2B A;  1J59 A;  1V5G A;  2BEO A;  4A3C J;  3MD2 A;  2CRG A;  2VT2 A;  1JKP C;  5IPA A;  4XRF A;  1RI7 A;  2NNN A;  2V26 A;  2PN6 A;  1JJ8 C;  3HHH A;  2HFH A;  1MMG A;  4QTR A;  3GTO J;  1S3J A;  2RQP A;  1FNN A;  2HQA A;  5GTH C;  2QBY B;  3I64 A;  1ZHF A;  3OIP A;  4X0G A;  2EFN A;  4QPQ A;  2PLY A;  3OYG A;  2YUS A;  2J5O A;  1OCO H;  5KAI C;  4FET A;  2X6X A;  1R00 A;  3ABK H;  2WB1 N;  4XLE A;  2D2W A;  5JI6 A;  2CJJ A;  4OMY A;  3K10 A;  1QBJ A;  2O8X A;  2EFW A;  2FF4 A;  1DPR A;  2CUJ A;  4HX4 A;  3I54 A;  3DTI A;  2V1U A;  1YS7 A;  4WX9 A;  5J4V A;  1BR4 A;  3GTG J;  2CW0 F;  3HGY A;  3P9K A;  3R61 A;  2JA2 A;  2DXI A;  3K2A A;  2GIZ A;  1BA5 A;  1ZRC A;  1ZR2 A;  4M74 A;  4KMU X;  3CF5 F;  2R5Y A;  4CZC A;  2OA4 A;  2CW8 A;  4ZJZ A;  1RKW A;  3QOE A;  1G3Y A;  4MQ9 F;  3RYP A;  3JRI A;  2H6B A;  2F5V A;  4Y3O A;  1R36 A;  2P7V B;  2VC0 A;  5DEQ A;  3GFL A;  4KA4 A;  2A69 F;  2FE3 A;  2KJB A;  1V4R A;  3TDZ C;  1YFH A;  3CO7 C;  4ESB A;  4EJO A;  2YU9 J;  3IWF A;  2NOG A;  3ZP5 A;  3GZ6 A;  3H5R A;  2ZME A;  1A31 A;  2HNH A;  4GGG A;  4KYW A;  1W1W E;  3HOT A;  4J01 A;  5K5O A;  5J47 A;  4XRS A;  2E5N A;  2F5F A;  3ONQ A;  2E1O A;  5J8C A;  3J80 K;  1RZ4 A;  4EVI A;  1O3S A;  3C1D A;  1T98 A;  1KQ0 A;  2FUG 2;  2IBD A;  2FML A;  3GFI A;  3G1O A;  4HX8 A;  2YU3 A;  2DQL A;  2XB5 A;  4RDU A;  4IOA F;  1TQM A;  3MKW B;  1POG A;  2HI3 A;  2EH3 A;  3H5A A;  4S04 A;  1JJ6 C;  4A5N A;  2PQ8 A;  2ZJP F;  1X2N A;  1EF4 A;  2FMY A;  1EKE A;  2EWN A;  5CPR B;  1FBQ A;  5HNH A;  1O7L A;  2R92 J;  2ECC A;  4P55 A;  1YHQ I;  1FMW A;  2X9D A;  4IQ4 A;  4F3Q A;  1MDM A;  3H9J A;  4B4C A;  2ZC2 A;  4NQW B;  1ETY A;  4ZDP A;  1B72 B;  4HYE A;  2HS5 A;  4AYB A;  2VAS A;  1TWF J;  3OYD A;  3AKZ A;  3C7J A;  1ZKG A;  2M0M A;  3CCY A;  1YJW I;  3VB2 A;  4AIH A;  3LST A;  1XSD A;  1ZYR F;  2OBP A;  1U2W A;  3F21 A;  1LB2 A;  2FNP A;  1ZQ3 P;  5M5W J;  3R6S A;  1UJ8 A;  5JHU A;  3J7Z I;  4A5M A;  1IZ1 A;  4ON0 A;  3P5J A;  3BPV A;  1X3U A;  3H9G A;  1TWG J;  1TNT A;  2LD5 A;  1JT0 A;  4BHC A;  1D1B A;  3WGI A;  2VLA A;  3KZY A;  2A68 F;  3L7W A;  3F72 A;  2IS6 A;  4R1H A;  3EPZ A;  3FMR A;  1MBH A;  1KU9 A;  3F0C A;  2ZME B;  1J2X A;  3SHF A;  2QQ9 A;  2QKL B;  2VJ4 A;  1ZG5 A;  3KZI C;  3CO6 C;  4BQA A;  3AL0 B;  1NH3 A;  2R7V A;  2R7U A;  5GAH J;  2FA5 A;  3CCS I;  4XOT A;  1XPX A;  4DZJ A;  2XRO A;  3LAP A;  1YW9 A;  2PMU A;  5DD4 A;  4BKX A;  1GDT A;  3HKZ A;  5J4Y A;  4OIO F;  1FOX A;  2HYG D;  2KRF A;  3OR1 C;  3P7N A;  2DN0 A;  4KIG A;  4O5V A;  4XKB A;  5J40 A;  5FD6 A;  3I56 I;  3G6E I;  1TP4 A;  4A3L J;  1TT5 B;  1YX3 A;  3G2B A;  4LK1 F;  3W3C A;  3ZMV A;  4EEF G;  4RAF A;  1DPU A;  2L5Q A;  1FYM A;  3TP0 A;  1FTT A;  1UHS A;  2F2E A;  3HC7 A;  3NRV A;  2UZK A;  1KZH A;  1RNL A;  3K4N A;  2QVO A;  2R5Z A;  3BG6 A;  3FXM A;  2QEN A;  2FSW A;  5LRS A;  1L0O C;  4XIC A;  2BVL A;  2HOS A;  3DFG A;  1K6O A;  2MLG A;  1OKR A;  3OL3 A;  3HYI A;  4FIS A;  4NQW A;  3CCJ I;  1BOB A;  4CGZ A;  2XB0 X;  2OTL I;  3SQN A;  2W4S A;  3BR3 A;  1JTY A;  5H6R A;  1RR8 C;  2Y69 H;  4IRI A;  5GPA A;  2GZW A;  1Y8Q B;  2MGQ A;  1X1C A;  3JSP A;  1GVD A;  1UZC A;  2EQR A;  3TED A;  4ZZD A;  2IS2 A;  4DBQ A;  4XKW A;  1ZK8 A;  4BYY A;  5FLV A;  3D5L A;  3VSL A;  2QGU A;  3ZQQ A;  5JVG F;  1YI2 I;  1T33 A;  3WG7 H;  3PSI A;  2GA1 A;  1HDD C;  1SMY F;  2WV1 A;  1IN6 A;  1EH8 A;  2LH9 A;  1MJA A;  3OYA A;  4A3M J;  5EZH A;  4BXF A;  3RZD J;  5J8F A;  4XKC A;  2LR8 A;  4CCN A;  1S29 A;  4AVZ A;  3DKY A;  2DFF A;  4CYD A;  3DV8 A;  4LLL A;  2DA3 A;  3TDU C;  2WV0 A;  3LA2 A;  5K7F A;  1Z91 A;  1YLF A;  4CSW A;  2DJN A;  1BOA A;  1OPC A;  2MH2 A;  3F23 A;  2PMZ A;  2DW4 A;  1Q1H A;  4UUT A;  2FOW A;  3LSH A;  1Y1W J;  2E7X A;  4QIW N;  2JA6 J;  4BDY A;  4UXN A;  3V42 A;  2E7W A;  5FB2 A;  2AQF A;  4LMY A;  5EEA A;  1WCM J;  4XNF A;  4UUS A;  1K61 A;  3RPQ A;  3OYH A;  2JVG A;  1ZLJ A;  2K4B A;  2OD5 A;  5FLX K;  3HPH A;  1FOK A;  1VZ0 A;  3DWL E;  4PZJ A;  1ULY A;  2M30 A;  4LIU A;  3FBI B;  3OR2 C;  2VB6 A;  3F3X A;  4ETS A;  1YJN I;  4B3A A;  2M4G A;  3KP3 A;  4RLF A;  4HEA 2;  5FGM A;  4MIM A;  4YIR X;  3B73 A;  5CVR A;  3RZO J;  2ZSH B;  4RGR A;  3BLY A;  1R71 A;  4G6Q A;  3S2H J;  4HNV A;  2OQG A;  4AIK A;  2JUC A;  3HHG A;  2CUE A;  4Z6Y A;  1FZP B;  5DUK A;  3OYM A;  1DU0 A;  1B9M A;  2DLL A;  4CZZ A;  2V1D A;  2L02 A;  3BY6 A;  2GM4 A;  4MEY F;  4YEL A;  3K9T A;  1XN7 A;  2VUM J;  4XOR A;  2P5K A;  2PJR B;  1IO2 A;  3HKZ N;  3AAF A;  3CC2 I;  3QYF A;  3BR0 A;  2I10 A;  3TBI A;  5EG0 A;  4A3D J;  4EJV A;  3HOW J;  2VJ5 A;  2M34 A;  4S05 A;  2CO5 A;  1H88 C;  2QWW A;  2XAS A;  1RET A;  2L2O A;  5C3E J;  2ZCW A;  4CYC A;  1UAA A;  3T5X A;  3CZ6 A;  1O3T A;  2X4H A;  3E0J B;  4HST A;  2OZU A;  1U6G A;  4QSH A;  3S15 J;  2OTJ I;  1G4D A;  5CYV A;  4ZYH A;  2YS9 A;  4DW6 A;  5F27 A;  4P9F A;  3FXU A;  5LFA A;  2XAH A;  4XLH A;  1W5C C;  2OV7 A;  5CQE A;  2VBY A;  1UST A;  2WA0 A;  1YTY A;  3GTP J;  3LOC A;  2QQA A;  3A03 A;  1OMI A;  4NUB A;  2H6C A;  1WI3 A;  4IKF A;  3RQ4 A;  4FCY A;  3OOP A;  3HTS B;  4ZZL A;  1VQN I;  4OIQ F;  3HSE A;  1YYV A;  1IN5 A;  5AIQ A;  2BVM A;  4CA0 A;  2M45 A;  5E18 F;  4Y15 A;  3EYY A;  2W82 A;  5DM7 F;  2Y9Z A;  1P4A A;  1A5J A;  3PNT A;  4ITV A;  3KYD B;  2V79 A;  2KIQ A;  1OYY A;  2ZKZ A;  3I58 A;  3AL0 C;  4II3 A;  4HOB A;  2B9S A;  2Y75 A;  4E4H A;  1PDN C;  4GCV A;  1T6S A;  2CG4 A;  4LB6 B;  4U87 A;  3FXQ A;  3ML6 A;  3WE3 A;  1HOM A;  1WJF A;  2P5V A;  2DFI A;  2UXN A;  5FKM A;  2PMH A;  1QHG A;  1Q1V A;  1A6Q A;  3CC4 I;  2VPL A;  4C3J J;  3FBN B;  1F1Z A;  2CV2 A;  3HGG A;  2E71 A;  3O8G A;  3S1R J;  5ILU A;  4DBR A;  4BE2 A;  1F36 A;  3HOU J;  1I1S A;  1IDZ A;  2MH9 A;  1Z67 A;  1S7A A;  3HOZ J;  3IP4 B;  2G0E A;  3HL2 A;  3OWT A;  2DA2 A;  3BQZ A;  4HAM A;  4KIC A;  1MBG A;  2VOP A;  5JFR A;  2X6Y A;  1TWA J;  5C4X J;  4BJ6 C;  1AHD P;  2LRD A;  1RUO A;  3BJO A;  1IXS B;  2YSR A;  2CQK A;  1HDP A;  2AS5 F;  2BE5 F;  2NXN B;  1SFU A;  4I01 A;  3VYS B;  1PUE E;  1V5F A;  4BAY A;  1E3P A;  2IAI A;  1I3Q J;  2VC1 A;  5HLT A;  1NK3 P;  4RMN A;  2ZXW H;  1ODD A;  2NNY A;  2A05 A;  4NHJ A;  4EM0 B;  3E7L A;  4Y33 A;  5CVJ A;  2DMN A;  1FC3 A;  3V8K A;  4D5C A;  1SD5 A;  2H09 A;  2VKD A;  5F1J A;  1TQI A;  3F22 A;  3ZMD A;  3WTT C;  2MSY A;  2E35 A;  3M8E A;  4M72 A;  5C44 J;  1K78 A;  1U3E M;  1MSF C;  3GO5 A;  4ZC3 A;  5BPD A;  4LG0 A;  4BJ5 C;  1OCR H;  4JX5 A;  2M7A A;  3OS0 A;  1WH5 A;  3X2Q H;  1S6L A;  2O6G E;  2L7F P;  4XSX F;  2VIX A;  2VE9 A;  1ZAR A;  1I3A A;  4HBL A;  2LBF B;  5DCM B;  2Z9O A;  2WBM A;  5LEJ A;  2R7W A;  1UFM A;  5F6F A;  5FKK A;  1BI0 A;  1ON1 A;  2D45 A;  4LOC A;  2JT1 A;  3ISP A;  3QRF F;  4A3F J;  5EYR A;  2V6C A;  4H4K C;  3U9G A;  3JCU C;  2HR3 A;  2ZJR F;  2HVQ A;  2QLZ A;  1AU7 A;  1B9N A;  2JMW A;  1STZ A;  1QA6 A;  3H5N A;  4I6Z A;  1SVL A;  4R79 A;  4BUP A;  1B8I B;  2PEX A;  3GTJ J;  2K02 A;  2K3P A;  2K7L A;  2XVC A;  5CVV A;  3VWB A;  1D8J A;  4ABZ A;  4IHY A;  2AHQ A;  3K69 A;  4D9J A;  2FRH A;  3FXR A;  1D5V A;  2BZT A;  2OJE D;  3S2W A;  4HW0 A;  1WRJ A;  4BQQ A;  1APL C;  3A2K A;  1RPW A;  1XG1 A;  5EJC A;  1QPM A;  4KIT B;  2DOE A;  1H9T A;  3T8R A;  2MC4 A;  3U1K A;  2JK3 A;  1OR7 C;  5HLI A;  3H9Q A;  1DDN A;  1X4P A;  1WVR A;  2RGV A;  3CUQ B;  4XM3 A;  1T95 A;  1G6N A;  1RKT A;  3CLO A;  1Z21 A;  2QF7 A;  3QQA A;  2HXO A;  5DDG A;  4A3G J;  3GZ5 A;  4DGW B;  2QEX I;  3ABM H;  1CGP A;  5LD2 C;  1X1P A;  5FFZ A;  1AA7 A;  4MNU A;  4D5F A;  3OYF A;  3GWZ A;  4G9Y A;  3K4B A;  4OMZ A;  2RAE A;  1KA8 A;  3CJQ B;  4PDK A;  3H35 A;  4CXF A;  1MZB A;  4BEH B;  4IHS A;  3R60 A;  1SMT A;  2E2I J;  2B63 J;  3PIO F;  1DUX C;  3LQR A;  4CIC A;  5ICG A;  2JSP A;  4LG0 B;  4F55 A;  3CDH A;  3OYK A;  3UNG C;  3UKG A;  4M6X A;  4RB0 A;  3TOA A;  3HG9 A;  1IV8 A;  1I6X A;  3K0L A;  1X1B A;  1JHF A;  1VQP I;  2GBY A;  1QQI A;  5DCM A;  3BG9 A;  2F5D A;  2L7Z A;  4IF4 A;  4M3B A;  1IRF A;  2W24 A;  3FXJ A;  4E7S A;  5KNL A;  1FTZ A;  2VQH A;  1CF7 A;  2ZXI A;  1LJ9 A;  1HKQ A;  2VPR A;  1OYW A;  5D4R A;  3OL4 A;  4TV7 A;  3GTM J;  1YQA A;  4BE0 A;  2O5R A;  4MLO A;  2ADU A;  4DIQ A;  2KP6 A;  1P4X A;  2HZT A;  1UCR A;  4NB5 A;  1BI1 A;  2X6W A;  1D0Z A;  2V9V A;  3LA7 A;  4JBA A;  3MKY B;  4BJT A;  1Z6T A;  5E3L A;  3S14 J;  2QSH X;  1W5T A;  3W6K B;  3CQZ J;  2R3S A;  2EV5 A;  2JRM A;  3Q9V A;  2F4M B;  1G3W A;  5FLM J;  1IUF A;  1JUS A;  4HNT A;  2R7F A;  3BTI A;  3LL7 A;  3N97 A;  5HOO A;  3E6C C;  2QA4 I;  2JRT A;  4WWC A;  1WZ2 A;  3S16 J;  2ZJ2 A;  2GIV A;  3LA3 A;  3BR6 A;  3MEX A;  2L01 A;  2DA1 A;  4ENM A;  2P7C B;  4LGW A;  4WF2 A;  1E17 A;  2H1L A;  4A0Z A;  1F5T A;  2A6E F;  1P7I A;  3M8F A;  4R8H A;  3ULQ B;  4AUX A;  2AO9 A;  3OY9 A;  4XID A;  2STT A;  3JRG A;  2JPC A;  1RES A;  2VQL A;  2LMD A;  3IL2 A;  5BPI A;  1ZGW A;  3VYU B;  4A0X A;  2LOO A;  1R4N B;  3SEQ A;  4BEH A;  2KZG A;  2LY2 A;  1FOW A;  5GTI C;  2VOO A;  3WHC A;  4B3X A;  3PFI A;  4UVA A;  1K4S A;  1CQT A;  2CS3 A;  1VQ8 I;  1Z3X A;  2XAJ A;  2DO7 A;  3H36 A;  1JKR C;  3ZMU A;  1U78 A;  5DTD A;  1IV6 A;  4MHG A;  2NAZ A;  2FBI A;  3IRR A;  4ZH4 F;  3CMY A;  4A12 A;  2HGC A;  2EBI A;  1EH7 A;  1H9G A;  2LDU A;  1XGO A;  4KN7 X;  4LIV A;  5LGT A;  5J1R A;  3G71 I;  2DPD A;  4KFC A;  1JHH A;  2DTR A;  1VTN C;  2BGC A;  5ICF A;  1WJE A;  4ZTF A;  4ZDO A;  3BR2 A;  1VQ7 I;  1XSX A;  5IP7 J;  2CYY A;  2KDZ A;  4FQG A;  4L5I A;  3RIR A;  3QU3 A;  2A6H F;  4UB6 C;  4U0W A;  2MD5 A;  1USS A;  4UUS B;  2LNB A;  4JK1 X;  3RKW A;  2DJI A;  2ME0 A;  2XKP A;  2IA1 A;  1FY7 A;  1C0W A;  1QU3 A;  1ZTR A;  2IGM A;  4RM3 A;  4PFP A;  3PM1 A;  3HUG B;  3KET A;  1LUJ B;  4BY1 J;  3ZN1 A;  3HSF A;  1R7J A;  3NEU A;  4M9S A;  1U5T C;  4FX0 A;  2Y2Z A;  6PAX A;  2O03 A;  4A3K J;  2EPF A;  4YII A;  4HV5 A;  3R4K A;  3QOD A;  4XLP F;  4EGY A;  2QKM B;  2WAF A;  4IHV A;  2VQG A;  2V9P A;  3JAM Z;  2NVQ J;  4A6E A;  3O8H A;  2NYX A;  1O4X A;  5KCM A;  2HPI A;  1MJ9 A;  4P5O A;  2LSO A;  2MBF A;  2V1N A;  3BZ6 A;  2KRC A;  1MSE C;  3D5R C;  5EGO A;  4E7L A;  3W6V A;  5F0C A;  2HQ5 A;  4A0Y A;  2GOX B;  1YW7 A;  2R7S A;  1JGG A;  1ZEL A;  2WB1 A;  2CWE A;  4GXO A;  4NC6 A;  3QYE A;  1K6Y A;  3VYR B;  3BCA A;  2ZJQ F;  4QLC U;  1MNM C;  1H89 C;  2DFE A;  3JRH A;  4X1E A;  5EG0 B;  4IHT A;  1Y56 A;  3HJE A;  3MZY A;  2M8E A;  2P4W A;  1ONV A;  2AQE A;  3EUH A;  2RV8 A;  4XQF A;  2MC3 A;  1TQP A;  3ZQ7 A;  2UV1 A;  2RRE A;  4L9T A;  2XV4 S;  1J0R A;  4PJN A;  2ZB9 A;  4CDG A;  4IJA A;  2DYR H; 
#chains in the Genus database with same CATH homology
 3D5L A;  4E7H A;  4XLA A;  2R7X A;  3U21 A;  1PYV A;  4N4N B;  1LFP A;  3K4M A;  3BCB A;  3VSL A;  3ZQQ A;  4BS9 A;  4CCM A;  3S32 A;  3PSI A;  3VDX A;  1WJD A;  3A1Y A;  2LH9 A;  3OYA A;  2Z2S B;  4BXF A;  1LDK B;  4XKC A;  4CCN A;  4BQO A;  4LG3 A;  3DKY A;  4AVZ A;  4B44 A;  3OYB A;  4CSW A;  4EAT A;  4E7J A;  2PMZ A;  3S93 A;  3LSH A;  2OC6 A;  4ZYA A;  4XN0 A;  3OOU A;  3MKZ A;  4BDY A;  3V42 A;  2K9M A;  2R4G A;  3RCO A;  2AQF A;  4BAC A;  2RQQ A;  4U7B A;  2XF7 A;  2MAB A;  3C2H A;  4XNF A;  3DLA A;  5CQG A;  4KJZ A;  3OYC A;  1N77 A;  3CJR B;  3OYH A;  2JVG A;  2F4I A;  2A5W A;  2CUZ A;  3LMM A;  3HPH A;  1BR2 A;  1VZ0 A;  3DWL E;  2HDW A;  4LIU A;  3OYI A;  3FBI B;  3OR2 C;  4CCK A;  2VB6 A;  4JQF A;  4HG2 A;  2M4G A;  2L9N A;  1V5E A;  4RLF A;  4HEA 2;  4XKV A;  4PJL A;  4DJA A;  2A6T A;  2CMP A;  5HVQ C;  5KHD A;  2ZSH B;  3BLY A;  2ZXH A;  4RM2 A;  4HPQ A;  2HZD A;  2LYC A;  3OYM A;  2W1O A;  2LBF A;  4OAY A;  2KLO A;  3KX2 A;  2JUG A;  2KRH A;  3IAS 2;  3L2Q A;  3OYN A;  2KPM A;  4YEL A;  4XOR A;  3ZRG A;  3DPL C;  2PJR B;  4XON A;  4E6K G;  3QYF A;  2VJI A;  2ELJ A;  3TBI A;  2GOM A;  1WJC A;  2LRE A;  3IUO A;  1MMN A;  4Y4R A;  2VJ5 A;  2HVR A;  4C2U A;  4YEJ A;  3CF2 A;  3VSK A;  1HA8 A;  2RNG A;  4OWR B;  3SDB A;  1PJR A;  2L2O A;  1SFK A;  4KT6 A;  1UAA A;  3CZ6 A;  1X4O A;  3HXL A;  2V7F A;  2IGK A;  3E0J B;  2WAQ A;  4HST A;  4IZZ A;  2VXD A;  3L2V A;  2ZSI B;  2BOL A;  4B43 A;  1LVK A;  4E7I A;  5LFA A;  3PUB A;  3PL8 A;  4XLH A;  2OV7 A;  5CQE A;  4E7K A;  2WA0 A;  3IAM 2;  3W2V A;  3J7A Y;  1EA3 A;  4NUB A;  1DGW Y;  1UEL B;  4IKF A;  3RQ4 A;  5HNF A;  3E1S A;  2IGN A;  2M3A A;  4PSW A;  4KIS A;  1MMD A;  4C2T A;  2UUZ A;  2M7B A;  2BVM A;  2CV1 A;  5FRO A;  1D1A A;  4CA0 A;  1NG6 A;  2W82 A;  2LG4 A;  1TZL A;  3PNT A;  4ITV A;  2VJJ A;  2ZFU A;  1J09 A;  3LSK A;  2W7N A;  4PUS A;  4FAS D;  2E60 A;  3CP8 A;  3RTR A;  3AL0 C;  4II3 A;  1Z3Y A;  4E4H A;  3I3L A;  2R7Q A;  4CCJ A;  4U87 A;  4XL9 A;  1P9Q C;  4F91 B;  3NWT A;  3HOS A;  1WJF A;  2NOJ B;  3UR3 C;  3AFH A;  2R7R A;  2Y0S A;  1UG0 A;  1QHG A;  1X1D A;  2XSJ C;  3K70 C;  2VPL A;  2IGO A;  1T0F C;  3FBN B;  2CV2 A;  2X51 A;  3K6G A;  3S3O A;  4DBR A;  2Z16 A;  1X1A A;  4BE2 A;  3BG7 A;  2X1C A;  1KON A;  2DT7 B;  3IP4 B;  3LSM A;  3DU6 A;  3KYL A;  1N78 A;  3HL2 A;  4HNU A;  3OWT A;  4J00 A;  1WJ5 A;  2XAU A;  5JHF A;  4C9Y A;  1SAU A;  2X6Y A;  4C30 A;  3MMY B;  4XN3 A;  3PJR A;  4BJ6 C;  2UWM A;  2LRD A;  2DCE A;  2F6C A;  4PJM A;  1NG7 A;  3DU5 A;  2KMU A;  3DPT A;  3FDY A;  3VYS B;  2VKH A;  1V5F A;  2I8D A;  5TGT A;  1QHH D;  5HLT A;  4PSX A;  4F92 B;  1DGR M;  3DTK A;  4RMN A;  4DOZ A;  2P0W A;  4N4O B;  2VQC A;  3NWS A;  4Y33 A;  2LY1 A;  4F52 A;  1E0E A;  3HPG A;  2M4K A;  2CW7 A;  2K5C A;  2VKD A;  4AU7 A;  3I9V 2;  4QPO A;  1W36 D;  3LSI A;  3EUA A;  4OAZ A;  2VXZ A;  4ZC3 A;  3OS2 A;  4BJ5 C;  4CH7 A;  2M7A A;  3OS0 A;  3OS1 A;  1YE9 A;  2VIX A;  5FRN A;  2WAD A;  4HSR A;  2LBF B;  3TMO A;  4D1Q A;  3PNY A;  2XF5 A;  2WBM A;  2R7W A;  2VL8 A;  3K4C A;  2L7K A;  1D0Y A;  2E5Z A;  4P1W A;  3SZG A;  4PJJ A;  2V9K A;  3FKJ A;  3S3M A;  4H4K C;  3EUH C;  4B48 A;  2HVQ A;  3ZR8 X;  4BGD A;  2IXS A;  3L2R A;  3H5N A;  3PNV A;  3L2W A;  4R79 A;  3CP2 A;  4BUP A;  4G6T B;  2IS4 A;  2K3P A;  2E1M C;  2Q2E B;  4BDZ A;  3OYE A;  3VWB A;  1IRX A;  2MD0 A;  4D9J A;  2X1E A;  4BQQ A;  3A2K A;  1V5G A;  3MD2 A;  4KIT B;  2MC4 A;  2V26 A;  1Z7L A;  3C2G A;  1OR7 C;  1MMG A;  5FRM A;  3H9Q A;  1X4P A;  2HQA A;  4XM3 A;  4XOP A;  1T95 A;  2XC7 A;  2R7T A;  3OIP A;  1WFX A;  3F9K A;  1Z21 A;  4X0G A;  4QPQ A;  1MND A;  3OYG A;  4DGW B;  2W00 A;  5LD2 C;  3VYT B;  2OUM A;  1AA7 A;  4FET A;  2X6X A;  2WY7 Q;  3OYF A;  1TT0 A;  3K4B A;  4XLE A;  3CJQ B;  3H35 A;  3ZCO A;  3KEY A;  4BEH B;  3K10 A;  3BC8 A;  3LFU A;  4NC7 A;  1MW7 A;  3A4C A;  2CUJ A;  2JSP A;  4F55 A;  3DTI A;  1FMV A;  4ANJ A;  3OYK A;  3UNG C;  1WJB A;  1BR4 A;  1OLT A;  3HG9 A;  2E1M B;  1X1B A;  2JA2 A;  4F93 B;  2DXI A;  4NC8 A;  2V6E A;  4PFO A;  4CZC A;  4E7S A;  2CW8 A;  5KNL A;  2HPM A;  2VQH A;  4ZJZ A;  2ZXI A;  3QOE A;  4II2 A;  2XF6 A;  2KL4 A;  3OL4 A;  2BW3 A;  2IS1 A;  2DT6 A;  4BE0 A;  2O5R A;  4MLO A;  2F5V A;  4Y3O A;  1GLN A;  4DIQ A;  4IQJ A;  2KP6 A;  1Y6I A;  3S8P A;  2X6W A;  1D0Z A;  1R6R A;  1WJA A;  3MKY B;  3M8J A;  3RSN A;  4BJT A;  2DOA A;  1N75 A;  2KZV A;  3H5R A;  2HNH A;  4RLQ A;  2HU9 A;  3W2W A;  3HOT A;  4J01 A;  3N05 A;  2E5N A;  1DQU A;  3ONQ A;  1ERD A;  3OMY A;  4CCO A;  3ZGK A;  3K70 D;  4HNT A;  3DEE A;  3LL7 A;  1U0J A;  5HOO A;  2FUG 2;  3GBG A;  4ZTJ A;  2KQR A;  1S9H A;  3RPU D;  3MKW B;  3K4J A;  3H5A A;  3OY9 A;  4BE1 A;  4LIT A;  4BU2 A;  5CPR B;  2VQL A;  2WY8 Q;  1W36 C;  5HNH A;  2K9L A;  3VYU B;  2LOO A;  3S3N A;  3SEQ A;  4BEH A;  2XDV A;  2MFZ A;  3W2A A;  2LY2 A;  3CMM A;  2MYS A;  1BR1 A;  4B3X A;  1FMW A;  2CS3 A;  1Z3X A;  1G8X A;  4IQ4 A;  4F3Q A;  2Q1Z B;  3H9J A;  4NQW B;  4ZDP A;  2R7O A;  4AYB A;  4B47 A;  4BQN A;  2VAS A;  3OYD A;  5CKT A;  3AKZ A;  1MNE A;  4LIV A;  2M0M A;  1X19 A;  4XLC A;  4GRI A;  3M1C A;  2Z1D A;  4CUG A;  3L2U A;  3PFY A;  1WJE A;  4ZTF A;  1JI8 A;  2X1D A;  4ZDO A;  3LSG A;  3K4K A;  2BW3 B;  2HVS A;  3QYB A;  2V4J C;  3H9G A;  4XR6 A;  2WAE A;  2DJI A;  1D1B A;  3OYJ A;  1MMA A;  2IGM A;  4PFP A;  4RM3 A;  2VLA A;  1QU3 A;  3HUG B;  4CCL A;  2KDO A;  1D0X A;  4E7Z A;  2IS6 A;  3EPZ A;  2QKL B;  2VJ4 A;  3SYT A;  2PJR A;  3AL0 B;  2R7V A;  2R7U A;  2CFO A;  1G59 A;  4XOT A;  3QOD A;  3D5S C;  2QKM B;  2WAF A;  3EUK L;  2CH0 A;  2JVH A;  2VQG A;  1DP3 A;  3HKZ A;  2LC2 A;  4XKB A;  4ZDL A;  3OR1 C;  2L9S A;  3OIQ A;  5KCM A;  2HPI A;  3FHN A;  4P5O A;  1YX3 A;  3G2B A;  3W3C A;  1YX5 A;  3DTE A;  2X85 A;  2V1N A;  4BL0 B;  2KRC A;  3H0D A;  2L5Q A;  4HRI A;  3D5R C;  4E7L A;  3HC7 A;  2R7S A;  2GOX B;  1ZEL A;  2WB1 A;  3K4N A;  3TL4 X;  3BG6 A;  1LKX A;  3PSF A;  4XMY A;  3DPU A;  3QYE A;  1K6Y A;  3VYR B;  3BCA A;  1D1C A;  2BVL A;  3DQV C;  3ZXS A;  4YRV A;  3OL3 A;  4PK4 A;  1Y56 A;  3SEZ A;  4XLF A;  1BOB A;  3K4L A;  3DKX A;  2AQE A;  2W4S A;  4XQF A;  2CV0 A;  2KHM A;  1X1C A;  2UV1 A;  2RRE A;  4JOM A;  3CES A;  4NNJ A;  4PJN A;  4IX7 A;  2IS2 A;  4DBQ A;  4XKW A;  3OYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...