2CUJA

Solution structure of swirm domain of mouse transcriptional adaptor 2-like
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GSSGSSGIDSGLSPSVLMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional adaptor 2-like
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
source organism Mus musculus
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cujA01
2AQEA 2AQFA 2CUJA 2ELJA 2DCEA
chains in the Genus database with same CATH superfamily
3JRGA 3HUGA 4MO7A 3I3LA 4C3JJ 2EIMH 3BZ6A 2L4AA 3E1SA 2XAQA 1WI9A 3KEYA 3DBHB 3LSPA 1E3PA 4MEYF 1YITI 2EZKA 3M7GA 4F93B 3L2RA 3HPGA 5FLMJ 4E7ZA 3ZQLA 4EJUA 2OC6A 3F8MA 1KQ0A 1KYZA 5C4JJ 2E2HJ 1J09A 3PIOF 3VB2A 3VWBA 4LLLA 2A6HF 3J7AY 2CQXA 1LVAA 3E5QA 2XAHA 3P7NA 5IPAA 3CP2A 5CPRB 1H9TA 3E6MA 2V1NA 2HOEA 4XKCA 3ZP5A 3F0CA 1YIOA 2ZMEA 4E7HA 2IS6A 2ME0A 1TZLA 1YE9A 3H9JA 4XLNF 2L01A 3K4CA 3O6BB 5J1YA 1A36A 3OIOA 2L02A 4GXOA 2HYFA 2K86A 3AL0B 2DW4A 2DA7A 1NK3P 2CQQA 2HEOA 1TLHB 1T56A 5E17F 3R0AA 5EEGA 5BNGA 1VQ4I 1YX3A 1XMAA 2G9WA 3K4LA 1LUJB 2A68F 2WY7Q 1SEUA 4KIBA 4R8HA 1WJBA 1GV2A 2KQRA 4QIWN 1XMXA 3HOZJ 5IYCJ 4U7DA 4B3XA 4M74A 5FB2A 2M9HA 3KX2A 1YIJI 2QM3A 1TNSA 1MJAA 4RA2A 1POGA 1S7EA 3DWLE 2CUZA 2WAFA 5K7ZA 2HFHA 3V8LA 2NAZA 2W48A 3K0LA 2XRLA 2D45A 4XR6A 4II3A 3J7ZI 2JRTA 1LDDA 2IS2A 3FHZA 1OCPA 2W00A 2O6GE 2A05A 1NHAA 2QYOA 2GXGA 2GOXB 1SVOA 4QPOA 4S0HB 1A04A 4CCJA 2X51A 1MMNA 1N78A 2VB6A 3RDIA 4AD9A 4FQGA 2R7WA 3L09A 1WSUA 1I6HJ 2LD5A 3LSJA 1SD6A 4EM1A 2BY2A 2E5NA 4D7NA 1HKQA 2VL8A 3GFJA 1GHCA 5BMZA 5AIPA 3HYIA 3V8KA 1EF4A 3P9IA 1IDYA 3TP0A 4TV7A 3FISA 3H5AA 1BBYA 2BBYA 2DODA 1YG2A 3ZQHA 1JT0A 4B43A 4ETSA 1OISA 1YJNI 4BNCA 1EV7A 3HOYJ 3EUAA 2L5QA 1R4MB 2LF7A 2KL4A 1PYVA 1TWCJ 3K1PA 2IA0A 1ON2A 3GYHX 4NDLA 2K3PA 4NQWA 2QBYA 3FZVA 1ETYA 1WI3A 4BU2A 5IY5H 4QSHA 3F23A 1MMAA 2V79A 5KVRA 4BUPA 2R93J 1PUFB 3PO2J 1QZZA 3H3ZA 9ANTA 3HGGA 5J8CA 2ZO4A 3FXLA 4M9ZA 1GT0C 1VQOI 3DKYA 2OCEA 4A3MJ 5L3FA 2M7AA 3SZPA 1MMSA 4DNCA 1RUOA 3LA2A 5GPAA 4A69C 1D1AA 4BQOA 2GLOA 4PSWA 3V42A 2AHQA 4BQAA 3DKWA 2D1HA 4ZZLA 1PVEA 1UCRA 5DCMA 2HOSA 4HRIA 3KEQA 5GAGJ 2OUMA 5M3MJ 1LKXA 2WBMA 3MN2A 3QOPA 5K5OA 4WF2A 3HG9A 4FHTA 5IP9J 1MNDA 2OZUA 3H0GJ 1X3UA 2OTJI 4BKXA 3FXOA 3H5NA 4M6VA 3OS1A 1T08B 2FBIA 5HNFA 2E2IJ 4GFBA 3WU2C 3ONQA 5HDKA 4CSWA 2ID6A 2OA4A 4MGRA 3CC2I 2DOAA 1JTXA 4RM3A 3PQJA 3OYEA 1QVTA 1X4PA 3CO7C 4R79A 1QGPA 2ECCA 3MCZA 4HV6A 4UUTA 3NWTA 2R7TA 3M9AA 4AIDA 1X19A 3DPLC 3ZMSA 3F22A 2DQRA 2DYSH 4AVZA 3ZQQA 1ZG1A 3HOWJ 3KLNA 3BPVA 4KIFA 2EWNA 4U0WA 3RPUD 2KZVA 4I2OA 5D5UB 3FWEA 2VPLA 1D5YA 1AHDP 2BGCA 2FU4A 1K7AA 1DU6A 1W7PA 1XX5A 1FSEA 1JUPA 5FKMA 1IC8A 4U0VA 2JA2A 4A0YA 4YELA 5FLXK 4BHCA 3AG3H 3HZJA 5E1ZB 2KIQA 4A0XA 5IT3A 2EILH 1I6XA 2J5OA 2DMUA 3MD2A 3CCJI 2CU7A 4RAFA 2MYSA 1JKOC 4ZYGA 2QF7A 2BEOA 4M6XA 3TEDA 2KPMA 1F5TA 2HI3A 3SZTA 5D5VB 1PJRA 2X4HA 1TBXA 2G7UA 2CW8A 1IAWA 2LBFA 4XQFA 2CW0F 3GW2A 1LDKB 3IHUA 1VZ0A 3WGGA 1U0JA 4ZTJA 2L3DA 5EG0A 5IYDJ 5J47A 5EZGA 2BW3A 4L9JA 4B48A 5DDGA 3S16J 2VQLA 2EZHA 4LD5A 3DBLB 1T2KA 1ZG5A 1D1CA 3DBRB 2KDOA 3HEFA 1OYWA 1IRZA 2VN2A 3OYLA 3DU6A 3IP4B 3KEOA 3VSKA 3M1CA 4S04A 3CC4I 4XRMA 3BG6A 4XSXF 2XF6A 2EINH 2V1UA 1QPIA 1ERDA 1Z0XA 4FE4A 2W82A 3IUOA 4Y13A 3B6CA 3A02A 1E17A 2H1KA 2V1XA 3K4NA 1S5LC 2XAJA 1S6LA 2DFHA 4NC6A 2FBHA 4NUBA 3W2VA 1MSFC 2XSDC 4V19K 2DA4A 3JTGA 1YI2I 2M45A 3CMEI 3SYTA 4RB2C 5EZHA 2ZJPF 2CV2A 2P8TA 1RESA 1Y1WJ 2CQNA 3FK6A 2OD5A 3BTIA 3TMOA 2QVOA 3I55I 4ANJA 4WXDA 2XAGA 2VJJA 4P96A 3DEWA 4D9JA 4YEJA 1O3SA 3HSEA 1U2WA 1U8BA 3WGHA 1MNMC 3SQNA 1V55H 2DJNA 3LFUA 3J7AO 1MMGA 5DTDA 3FMQA 4YRVA 4C9YA 5JLWA 3E97A 2QA4I 1TWGJ 1Z21A 3LWFA 3E6BA 2DA5A 1AKHB 4IHWA 2BXZA 5GTHC 2IJLA 3MKLA 3CDLA 2QSFX 3BWGA 1T0FC 1OJLA 2MC4A 4JP0A 4OWRB 3FK7A 1S8NA 1LE8A 2KP6A 3BJOA 4UVCA 3TDUC 5L3BA 3P5JA 3G3ZA 5IOZA 3C2GA 2LKSA 3OYJA 4XRSA 3M8JA 4LG0B 3H92A 2GXAA 3GTKJ 5TJJA 1F1ZA 2M0CA 1HC8A 1BI1A 2YX4A 5LGNA 2GM4A 4M3BA 1JHHA 2YSRA 3OL3A 1N25A 5KNLA 2NOJB 2NNNA 3QYBA 1E2XA 4ZYHA 4OINF 3G1MA 3IAS2 2ETHA 1R71A 1STZA 1R22A 2NXNB 1J2XA 5AONA 3TO9A 2EIJH 2YU9J 2Y0SA 4MFEA 3BPXA 4HBLA 5ICCA 1KQ8A 4U7BA 4L5IA 5LHIA 3HRMA 1IRGA 1W0TA 3SEQA 4HEA2 4RAZA 4G7OF 5CQEA 1ZYRF 2ZNZA 2QQ9A 1S3JA 2OAZA 4EGYA 4M71A 4N9HA 2OJED 3J81Z 1ZRFA 3KIOA 2VIXA 2DN0A 3ESWB 2BZTA 1I1SA 1FLIA 1SANA 3BG3A 1Z3XA 3K4MA 2XB0X 3CJNA 4XNFA 3B73A 4O5VA 3BC8A 1WRJA 3PNTA 3TP3A 4D5FA 1PP8F 1A6IA 1G3WA 3CCUI 2ELJA 5F27A 2XGDA 4EJTA 1LNWA 2OU2A 2XF7A 4DOZA 5M3FJ 2ICWG 2X85A 3MKYB 3G1OA 1T0FA 2M2EA 4F92B 4HDVA 3DV8A 2M8GX 4IXAA 2MLKA 2RDPA 1AA7A 4PJNA 2UZKA 3G73A 1R49A 1ETQA 4JX4A 1X58A 4M3GA 4BXFA 5EEAA 5JI6A 1IUYA 1ZARA 2EZLA 5F1RA 4UV8A 1IRXA 3ZMTA 3KZZA 3JAMZ 3LSRA 4BXXJ 4OAZA 4Y17A 3DP7A 3Q9VA 5ICEA 3HRUA 1T39A 3MMYB 2CMPA 2R5YA 3V7CA 1YJWI 1F36A 4OIQF 1A31A 1OKRA 2OTLI 1V3FA 1Y39A 5FRNA 3R4KA 3WTYC 4M3DA 2BE5F 3ZMZA 4LIVA 3CJQB 3M07A 3DLLF 2W84A 2ACJA 1ZQ3P 3OYGA 3GVAA 1DPRA 1MDMA 2KMUA 2L2OA 1DDNA 1JHFA 1IV6A 1ETKA 3G1LA 3D5SC 3DF8A 2VE8A 4A6DA 2K9SA 1SAXA 3HSRA 4KN4X 3K4BA 4UV9A 3MZYA 5DD8A 5E8IA 3WTUC 4XM3A 4LB6B 2RN7A 2MD5A 1IN6A 4J01A 3GXOA 3I64A 1PP7U 3CDIA 1SVMA 3V7RA 4EJOA 2R7XA 4BEHA 3GLXA 1FIPA 4NC7A 3HUGB 2YS9A 3FXRA 4M6YA 1EH7A 4G6TB 3CCSI 4AWXB 2DLLA 1V54H 2ISYA 2V4JC 2V6CA 2Y9ZA 1X1AA 1HOMA 3FKJA 3U2RA 1Y1VJ 4S05A 3ELKA 3CJTB 2H6CA 2KIUA 4PJLA 3TBIA 3K7AJ 3ML6A 3OL4A 2DK5A 3T0YA 4YIRX 2IW5A 3T8TA 2NRAC 1ZAOA 3I59A 4R1HA 3CZ6A 2FBKA 2P7VB 3S14J 2DU9A 2XGXA 1VQ8I 4RLQA 2FMLA 1SMTA 1J0RA 3LSKA 3G4SI 3RZOJ 2IS1A 1A5JA 4RLFA 2GWRA 5EEHA 4IRHA 3DPTA 5E1XA 3GFIA 3FKIJ 2MH2A 2CO5A 3ASNH 3I54A 3S1MJ 3WGIA 2X1CA 4XN0A 1K78A 2DFIA 2NS8A 4U88A 2VKEA 4LIUA 2GBYA 2Y48A 2MGQA 3EDPA 3ABLH 2ZKZA 3Q3SA 1Q1VA 4NB5A 2PEXA 1W4MA 3B6AA 4IOAF 4IHYA 4BHBA 4LITA 2Y0SN 2V9VA 2VBXA 5AIQA 4DBRA 1WJCA 2H1LA 2Q2EB 5GP9A 1L3LA 3VSLA 1KU9A 1XMKA 2W25A 4HOBA 3L2VA 3REOA 3JTHA 3PIPF 1T8IA 1LJ9A 4ZH4F 2MABA 3H5RA 1W7PD 1WJFA 4OIOF 4RB0A 1R1TA 3FXKA 2K9MA 3ZN0A 2PJRA 3PFYA 5D5WB 2NVTJ 2V9KA 4DZJA 2QKLB 3HC7A 4L9TA 2KHMA 1W36C 5F6FA 3V4GA 2VBYA 5BPDA 4HX4A 3QPLA 3WU0A 1HXDA 5IP7J 4HG2A 2B7EA 3E3VA 4B44A 1CGPA 3V7SA 2FJ1A 2E19A 5J40A 4ENMA 4ENKA 1HQCA 3DEEA 3RKQA 1MD0A 2MH9A 3OSGA 5HLGA 2DOFA 4HLXA 2DTZA 4I99C 2FXAA 1VQLI 2KIFA 4C3IJ 5E3LA 5J3LA 4EVIA 3CCQI 4ZZDA 2LDUA 1P4WA 2JPBA 1FMVA 2YR2A 4XOPA 4Y15A 5HLHA 1ULYA 2JA6J 3EUHC 2MBFA 4I09A 2OPTA 1CQTA 3FXUA 2ZFWA 2CGPA 2PQ8A 4BDYA 1MBKA 5F08A 2IA1A 3TKYA 1FT9A 2EV0A 3LAJA 3R61A 3I58A 3KYLA 2VQHA 5LHHA 5J8FA 3SJMA 4AYBA 4I76A 5HVQC 2JUCA 3E7LA 1QO0D 2P6TA 4BH9A 3IRRA 2CQ7A 4XKVA 2M34A 3GMEA 2IGOA 1F43A 2DA1A 2R0QC 2YUSA 1Z6RA 2M87A 3W2WA 5K5RA 2OF7A 1RETA 5DCMB 4A3FJ 1Z67A 1XSXA 3OIQA 3OYDA 3VYUB 3A4CA 2XPWA 1OFCX 2ZXHA 4PJJA 4U87A 5ERIA 3CCRI 4DBQA 3C2BA 1R5GA 4A3DJ 1RR8C 2HOAA 3J80K 1E3HA 4CO8A 2BV6A 3R6SA 2IGNA 2KT0A 1WFXA 4IHXA 3JRAA 5F0CA 3HOUJ 1TQIA 4UVAA 2A5WA 2XAFA 5KCMA 5J4YA 4EQQA 1ZH5A 3I9V2 3HTSB 3GTOJ 2FE3A 2R7OA 2MLGA 3ASOH 2FNAA 3WE2A 2DFEA 4KFCA 2E1MC 1C0WA 1KA8A 2EFPA 3GFLA 1FSHA 1ZREA 1BC8C 4FCYA 2DMTA 3FBIB 2ME6A 3F8BA 1HLVA 5FLXZ 5FFZA 1IN5A 1RC9A 3EUHA 2WB1A 3U21A 3H35A 1YO5C 1IUFA 4KN7X 3NARA 2CYYA 3IH3A 4AM3A 2JVHA 2X1EA 4PDKA 4WK8F 2BOLA 3KETA 2E2JJ 3F21A 1VTNC 1DP3A 3UR3C 2GXBA 3PO3J 3T5XA 3TOBA 2RNJA 2OQGA 4RB1A 3A01A 4HF1A 1WCMJ 2D5VA 2ID3A 4AU7A 1VQPI 3CP8A 3IKVA 1JJ8C 1ZG3A 1DQUA 4F55A 2K85A 1VNDA 1HDPA 2G7HA 2DI3A 2JMWA 1K6YA 1U5TB 2Z9OA 2N8GA 1TW2A 1RUNA 3T8RA 3WG7H 1OQYA 5FJ8J 1MBFA 3LFKA 1R1UA 1FZPB 2O0YA 5ILSA 1JT6A 2LBFB 1J7KA 1Z05A 1GVDA 1YW8A 3AG1H 2JQ7A 3ZN1A 3HOVJ 4ITVA 1Y0NA 2DT7B 4MQ9F 1DP7P 2HQAA 1VQ6I 2GIZA 3I0TA 1H9GA 4IEJA 4CYCA 2X48A 1P4AA 1OR7C 4IX7A 2HQNA 1OCTC 1M1EB 2GIVA 2M4KA 2ZSIB 3RZDJ 4B3AA 3JRBA 1JGSA 1R1VA 2W4SA 1XG1A 4ZJZA 2J5PA 3CCLI 3CMAI 2HXOA 4M9XA 4EMSA 2XPUA 1J9IA 1XDUA 2VOOA 3B02A 3HSFA 3TQNA 5E3NA 2LF8A 4CUGA 1KU2A 1QHGA 4RS8A 4HNTA 4D1QA 5IT9Z 1ZTRA 3K1MA 1YW9A 4BDZA 3Q0VA 1DGRM 3BCBA 4UY8I 2VXZA 4X6AJ 2UV1A 4ZDPA 1BOBA 3ZQIA 2F4IA 5KAIC 4JYKA 4FASD 4HX8A 1MMDA 3HRTA 3OYCA 4M3FA 1K79A 2ESHA 5GPCA 1Y6IA 4DZPA 1XCVA 4XLAA 3PSFA 2JZYA 1U78A 4NHJA 2NYXA 3IC7A 3Q0WA 1G6NA 1KU7A 2LY2A 2JPCA 4XLFA 4P55A 1IXRC 1IF1A 1RIOH 1GXPA 3FXQA 3LQRA 4UHTA 5IYBJ 3SDBA 2QEXI 5F0FA 5DUIA 2DTRA 1B72A 4B1RA 4A3LJ 3I4PA 4E7KA 4AYBN 2W57A 5HODA 1HA8A 2LMDA 4DQ2A 1ZLKA 2VE9A 1A35A 3SFZA 4G94A 1N75A 5LHGA 4OU0A 4E4HA 1VQ5I 3EETA 3OS2A 2UUZA 3AL0C 2DJIA 2COBA 3LA7A 2OQRA 4DJAA 4G6DA 2HDDA 2LK2A 2R7FA 4O3MA 1MNEA 4DW6A 3K2ZA 4EATA 1BR1A 5KAFC 2VLAA 3QRFF 1ZGJA 4ASNA 3QU6A 2XF5A 5LEKA 5C3EJ 2ISZA 4OIRF 1HKSA 1EJ9A 1RZ4A 2M8EA 3KPHA 2DK8A 2AXLA 2IRFG 2CUEA 3GO5A 2Y9YA 4IHSA 3H0DA 1EH8A 3MFKA 2AS5F 4ZDLA 4BJ5C 3E6CC 2AQEA 5FROA 1FOYA 1XN7A 5H6QA 1XS9A 4M3EA 1HW1A 2MA3A 1SVLA 2ZC2A 2VC0A 1FOWA 1QVUA 1ON1A 2WB1N 1KGSA 4XRSG 4E7SA 2XSJC 2IP2A 4RDUA 5HDNA 5CVRA 2K40A 1Z77A 4KITB 3NQOA 5B1BH 2L7KA 1I1GA 3PL8A 4XBFA 2VI6A 2Y69H 5EGOB 1BA5A 2EFOA 1P7JA 2X9DA 2R7SA 2OZ6A 4OAYA 4YIIA 4MTEA 3DEUA 5E8GA 1WGXA 4BE1A 2AXTC 5DYMA 4A3EJ 4AVPA 3HTUA 3OYBA 3K10A 4ZTFA 1KONA 1XGOA 2XASA 3ZPLA 4I98B 1B6AA 1JI8A 2LSOA 4BL0B 2EV6A 1P6RA 3VYSB 5F1JA 3K1NA 5LGTA 5HLTA 4A12A 1HF0A 1B8IB 5FLVA 2X0LA 4BE2A 1HSTA 2FUG2 5GAEJ 3SEZA 1VQNI 1YHQI 2DYRH 1EKEA 4N4OB 2DDAA 4QPQA 1IV8A 2R5ZB 4ENJA 5FFXA 4C3HJ 2DT6A 2RREA 3O8HA 2KZGA 1MJBA 4D7MA 3COAC 4IF4A 4A3JJ 3SXYA 4BJ6C 1X1PA 3RCOA 1BI2A 2ZJQF 4XRFA 2MG4A 1NH3A 2DPUA 3M1EA 1B1BA 2HDWA 2LKPA 1TWAJ 1WPKA 3QAHA 4L9VA 1H0MA 1FP1D 1UZCA 3HXLA 1B4AA 5F64A 1VQKI 2PMHA 1V5FA 3AFHA 1VI0A 2B63J 3RYPA 4FETA 3WU1B 3LAPA 2QSGX 5DV5A 2L9VA 2QENA 1RRJA 3CUQB 5D8LB 1APLC 4KT6A 3HM5A 2FSWA 2WY8Q 4ZYDA 4YFXF 4P5OA 1ETOA 5DUKA 4OMZA 5D4RA 2R7ZJ 4KICA 1Z7LA 1ORKA 3ROUA 4C2TA 2R7QA 3NRVA 2CJJA 4G8XA 4HV5A 2M7BA 3UKGA 3W2AA 2LVSA 1IGNA 4I6ZA 4IZZA 2CQKA 4GRIA 2HZTA 2RGVA 4ESJA 3M3YJ 2JVGA 3TL4X 1BR2A 3QPHA 2EFNA 1D8JA 1YFHA 1QZYA 5J4VA 2DA3A 4IQJA 1K6OA 3ZMUA 1F4KA 3BR6A 4OIPF 2ZFUA 3LL7A 4AIJA 2F5CA 3I53A 4FISA 2PX9A 3RTRA 5L3CA 2PLYA 4O6JA 3CJRB 1GLNA 4ENNA 2VT3A 1R7JA 2EFWA 1XGNA 5LFAA 4HX7A 3BROA 4Z6YA 3FHNA 4KT5C 4B47A 3OYNA 3LSTA 3I59B 1SD4A 3PQKA 2R3SA 3RQIA 4CCKA 2UXXA 1PUFA 1FEXA 4P1WA 1ETWA 2BHZA 4DGWB 1H89C 1W5TA 4Y7NJ 2F48A 4I01A 4IRIA 1YRNB 2D1VA 3MKWB 2VJ5A 3K70D 2Q0OA 4RBOA 3JRFA 2BY1A 4XLPF 2ELKA 2DDBA 2Y2ZA 2UXNA 4HF0A 3ABTA 2RC4A 2FA5A 2K4BA 5HLIA 4CICA 1W5SA 4BY1J 1K61A 4K2EA 4PCQA 1XPXA 4IHTA 1VQMI 5CVUA 2STWA 1DGWY 2EH3A 3RKXA 1LDJA 1LFBA 1T33A 2F5VA 2DA6A 4F52A 1G3TA 4NNJA 2TDXA 3L1PA 3QYEA 5E79C 3KYCB 5TRDA 1SC7A 3FM5A 3Q0UA 4F91B 4JX6A 5J1RA 3ECOA 1I5ZA 3OWTA 3BTLA 2BVLA 3IH2A 4RGUA 1BW6A 1MH3A 4C2UA 3CF2A 2OCCH 1KYWA 2CFXA 1W5CC 1U3EM 2C6YA 4UUSB 3F6OA 2XVCA 4QTRA 1WJ5A 3E5XA 4UB6C 5JHFA 1MBGA 2PJRB 3H3VK 3HOSA 3LA3A 2YU3A 2HPMA 1V4RA 2VODA 2O9LA 2HGCA 1SD7A 3BG9A 3U1KA 4N0BA 1YLFA 3CD6I 1J5YA 4XLCA 5D5XB 1QBJA 2EQRA 5ILUA 1B9MA 2EA4A 5L3DA 1CF7B 1HSJA 2EA2A 2W1OA 1S72I 1S9HA 2Y30A 3BR5A 1Z91A 2E36A 5L3EA 3GTQJ 3GTJJ 5CVIA 3OOUA 4BAYA 2V1DA 2R7RA 4II2A 4XSZF 2XGCA 3V8JA 5E3MA 1MKMA 1O3QA 1USSA 1WWXA 3HBLA 1BJZA 2IXSA 4C2MJ 2H94A 1D0ZA 2V9PA 2LC2A 4EM2A 3PUFA 4MFDA 1BL0A 3BLYA 4CDGA 3BR2A 3ZMDA 4AIKA 2G0EA 3P9CA 1Z3YA 2ZB9A 3QP5A 3S3OA 1VF9A 4A3GJ 4L0ZB 4BS9A 1B9NA 3QPSA 1QU3A 2M3AA 4WXHA 3JRIA 1FTZA 3J80Z 1TC3C 2F5FA 2ZXWH 4IL6C 2L9RA 1J59A 4KUMA 2HYJA 4I0BA 5J6XA 3A2KA 2R4GA 3MVPA 2K4JA 2FRHA 3BQYA 2ZBKA 1BW5A 1P4XA 4I7HA 5J1UA 2MW8A 2L4MA 2O3FA 2MSYA 3J7YJ 5FRMA 1BM9A 1O3TA 3WTXC 1TNTA 3AG4H 3RKYA 4Q5SF 3WTTC 3F8FA 4IOCF 1HDDC 3CDHA 3IKTA 1W0UA 2W85A 3CC7I 3NAUA 3WTSC 1FOXA 3K2AA 4YFNF 3I4NJ 4V2FA 4XMYA 1BI3A 2F2EA 4BE0A 5FKLA 4HSRA 5IP6A 2JT1A 2HWVA 4E70A 3HPHA 1I27A 2LFBA 3S3NA 4G7HF 3DKXA 2WAEA 4P9FA 3KP3A 3WTVC 5A2QK 4A3CJ 2FQ4A 2E1NA 2ZMEB 3S17J 1BOAA 3TW6A 4ZYEA 1YOVB 2B9SA 2HQRA 4RGSA 3F8CA 2Z5UA 1FNNA 1AKHA 2QWWA 1YS6A 2CUJA 2H6BA 1G3YA 2LY1A 1RPWA 1RNLA 3Q9SA 1ZR2A 3H9QA 2RKHA 2WV1A 4HYEA 3AAFA 1USTA 5ICGA 5D6FA 2XUBA 1UAAA 4KIGA 3M8FA 3WG9A 5JFRA 1IG7A 4LG0A 5FO5A 3JRHA 3OV8A 4AUXA 4LLGF 1P92A 1ACIA 1V5GA 5KHDA 1YS7A 2LREA 3AKZA 2NVXJ 2Z33A 3HGYA 2BY3A 4BHPA 5TISC 2Z1DA 3K4JA 2MD0A 1OCOH 4Q47A 2CUFA 3BJAA 5KK1A 1ZKGA 2P4WA 1K83J 1WJAA 4LB5A 3IWZA 4JOMA 1HCRA 1RR7A 2X6WA 2DCEA 4BQNA 1QNTA 2TCTA 3G2BA 2DOEA 1ZRDA 2FMYA 1O7LA 2M30A 2PJPA 4Y52J 3CESA 5LLQA 3HOTA 3W6KB 2O8KA 3PFIA 2CV0A 2HZDA 1JUMA 4W1UA 4FX4A 1XCBA 2W24A 3FXMA 1Q1HA 1O7FA 2RQQA 2AO9A 3FF5A 3KE2A 1MBHA 3VDXA 2Z99A 1FOKA 3IRQA 1H88C 1MBJA 1LFPA 1H8AC 5EYRA 5JHUA 1OLTA 1NTCA 2Z3YA 3BR3A 4PFPA 3VPRA 3OYMA 1SAUA 4CXFA 1JUSA 1I50J 4CZZA 4KDPA 4M72A 1FWZA 3JSPA 3GF2A 2DO7A 3VOEA 1YQAA 3PJRA 5M5WJ 3ERED 2COMA 2DQLA 5E18F 2E7XA 4ON0A 2VC1A 1SD5A 3QODA 1LQ1A 2O03A 2Q1ZB 3GCMA 3F8NA 2HPIA 3NEUA 4XORA 2IA2A 2A69F 4M73A 3CO6C 3WTZA 3CCVI 4PFOA 1YTYA 4NQWB 2QBYB 2X6OA 4WXCA 3JR9A 2K3FA 1IRFA 4CA0A 1S7AA 3E5UA 1ZHFA 3S2WA 4L5JA 3OR2C 1UG0A 3F3XA 3S2DJ 2WWYA 2MC3A 4ABZA 4WCGA 2VKVA 1YJ9I 1GUUA 3CCMI 1FJLA 4D0PA 5HOOA 4L0YB 3OYIA 2LOOA 1XGSA 3JAMK 4MNUA 2HTJA 5LRSA 4XL9A 3WE3A 4MQVA 2LTPA 3VODA 3I56I 1FMWA 4EGZA 2A5YB 4UB8C 1TTYA 2HXIA 5JLXA 4HA8A 2QCOA 1ETXA 1UFMA 1X2MA 5FKKA 4A0ZA 1REPC 1TL8A 1YW7A 2HYGD 2DAOA 5LBQA 3PNVA 3BOQA 3RSNA 5C4XJ 3P9KA 3O3KA 3S1NJ 2KKOA 2ESNA 2H27A 2ZNYA 4PGGA 4D5CA 3ABUA 3JRDA 1FPQA 3S32A 5CLSA 2HDCA 3HKZA 4CGZA 2P5LC 1LPQA 1W7PB 4N4NB 4A3BJ 2I5UA 3IL2A 1IXSB 5F04A 3CLQA 2E1OA 2XKOA 3OYAA 5ICFA 3CQZJ 3H9GA 5CKTA 4CCNA 2CS3A 1TWHJ 2AQFA 3AG2H 2O61A 5BS6A 1IZ1A 1DPUA 2EJRA 2FX0A 3R0JA 3N4MA 4HSTA 5H20A 2D2WA 2Z2SB 3DTIA 2DFFA 2H8RA 3A1YA 4BBSJ 4IPAA 4KJZA 3GZ6A 5H2FC 1YYVA 1I39A 2A6EF 2GQQA 2P6SA 3BG7A 4RAYA 1HW2A 1HKTA 3F72A 1TQPA 3TO7A 1UHSA 5K7HA 1QA6A 3LMMA 1WH5A 2I8DA 5H6RA 2ZCWA 3KZIC 4RGRA 1G4DA 2IGKA 2JA7J 4GGGA 1LB2A 1P7IA 2IAIA 1Y8RB 4WX9A 3KP2A 2IBDA 1UMQA 2OBPA 3O8GA 3GEZA 5EG0B 1EH6A 1Z9CA 3SDGA 2BW3B 4MTDA 2LKXA 1X1CA 1BJAA 4CHUA 3I71A 3C18A 4XICA 1WH7A 3LSHA 2JUGA 2BHYA 2Q2EA 2L7MP 1FBQA 2R7DA 2A6TA 5DM7F 4BYYA 3GTMJ 4LK1F 4G6QA 4DYRA 2QZ8A 3WTWC 1IN8A 5C44J 5B66C 2JTVA 3OYHA 4E7JA 1R5HA 4MIMA 4JQFA 4H0EA 1R36A 3OIPA 3JRCA 3KP5A 2IEKA 3ZQFA 2HU9A 4U0YA 4GYIA 1SFXA 1PDNC 1JXSA 5M5XJ 3L9FA 3FMRA 3TGNA 4UNOA 2F5DA 2QLZA 2NS7A 1EA3A 4QLCU 2GAUA 5FKNA 1I3QJ 4KISA 3VYRB 4GYGA 1UB9A 1OYYA 3N05A 1T38A 1BN5A 4HQEA 3HJEA 1AOYA 3ZXSA 5GADJ 4N9IA 1RKWA 5DEQA 4CH7A 1IO2A 2RNGA 2VXDA 2LR8A 4XLHA 1ZR4A 4HLYA 4XK4A 2BY0A 4UVBA 2HVRA 4L9NA 3GFMA 3OYKA 3D1NI 1NG7A 4RM2A 1TW3A 1XTAA 2E1CA 6PAXA 3PSIA 1FTTA 3GUDA 4EJWA 2CRGA 2QGUA 3DFGA 4LMYA 2NS0A 2X1DA 3L00A 2KDZA 1D0XA 4FT8A 4PJMA 2JJ7A 3FBNB 4CCOA 1OR7A 3TW7A 2VKHA 1ZRCA 1BIBA 1T95A 1TQMA 2YPRA 4RAGA 3LOCA 3D5RC 2QSHX 2IT0A 2QQAA 3BDDA 2K02A 2GA2A 1LEBA 3SFIA 3D0SA 3S1RJ 2TRTA 1LE8B 5BQTA 2P81A 1JGGA 2L9NA 2PFBA 1L0OC 3HHGA 4B8XA 5IOYA 2LYCA 3H3UA 3HB9A 5DCFA 3QP6A 3KYDB 2RAEA 3BR0A 3PM1A 2PMZA 1WJEA 2VJIA 4A5NA 1U5TC 3L7WA 5M5YJ 1LVKA 4Q4ZF 5GAHJ 1QRYA 4XONA 4F3QA 2JRMA 3S1QJ 1D5VA 1RI7A 1Y56A 5D6EA 3JCUC 3QYFA 2XHKA 2CW7A 2VPRA 3U9GA 3BTJA 4RB3C 4HAMA 5E3OA 4HF2A 1XC5A 1JKRC 2E5ZA 4EV0A 1X3ZB 2K7LA 2HVQA 4XKWA 1BI0A 1IW7F 4QWQA 4FE7A 3W6VA 3A03A 2ZXIA 3G71I 2L0KA 3HKZN 1XSVA 3MKZA 1Y8QB 1R23A 1XB4A 3TDZC 4MLOA 2P5VA 4NBQA 5B3SH 4HW0A 5FD5A 2XAUA 3MZHA 4B4CA 3GZ5A 2L7FP 1WHUA 2M0MA 3FXJA 4JBAA 1GVJA 4LG3A 1OMIA 3ZR8X 2V6EA 2M4GA 4PUSA 3GLLA 1IDZA 5B1AH 3ZQGA 3MWMA 4LK0F 3RPQA 3G6EI 4E7LA 3IV5A 4A3KJ 3L2QA 1UG2A 4I0AA 1X3WB 2KRFA 3E0JB 4HNUA 2IGMA 1X1DA 4MEXF 3DCFA 3BT9A 4BY7J 2P5KA 3C1DA 3ERMA 3JSOA 3RQ4A 3GBGA 1XSDA 1DUXC 2KFDA 5K7FA 1S7OA 3CCYA 1TT0A 4ESBA 3HOXJ 3E6DA 3QPTA 2H8WA 1SMYF 5JVGF 1R6RA 1ZLJA 4KA4A 3KCCA 1JTYA 1D8KA 3IAM2 5GTIC 2EIKH 2B0LA 4UUVA 1U6GA 1U9NA 1U5TA 4H4KC 3ZMVA 1Z7UA 4DYCA 3HDDA 5FKOA 5HS8A 3ABKH 4IJAA 2R5YB 2ZJRF 4DYQA 2M5WA 4A2UA 1XGMA 2FOKA 2VBWA 2K9LA 2PN6A 2WTEA 3U1DA 2XIGA 2X6YA 1D3YA 3LQQA 3A0HC 5EDNA 2EFQA 2F6CA 2A3SA 4ZC3A 1G8XA 1FBSA 3FDYA 2GZWA 3DQVC 3LSMA 3S8PA 2DBBA 3HHHA 4X0GA 1MDMB 1J75A 3CMYA 3IH4A 3OS0A 2KIMA 3W3CA 3OSFA 2Y75A 4W97A 1I3AA 2PI0A 3GTPJ 1E0EA 4YFKF 1OYIA 1O57A 2CWEA 3BCAA 3NWSA 4F7ZA 3L2UA 5K1YA 2BYVE 1FYLA 4BEHB 1G59A 2Y0MA 1X2NA 1Z6TA 3EUKL 2Y31A 2L7ZA 3ULQB 2VQGA 4HQMA 3X2QH 5A2QZ 2W7NA 1ONVA 1SFEA 1ITYA 2ZSHB 5LD2C 2BXYA 2QQ8A 3BJ6A 3RYRA 1FYMA 3QU3A 1QQIA 5IT9K 1KQ9A 1GV5A 1IJWC 1FYKA 3HRSA 2XV4S 2P0WA 3ZGKA 2GOMA 2EBIA 3I5UA 4B09A 4LFUA 3KP7A 4HNVA 3PUBA 4A3IJ 2I10A 1UHMA 1RKTA 1AWCA 3T1BA 2K5CA 5FGMA 1W36D 4PGHA 1WVRA 3FMSA 2PMZN 2WAQA 3OYFA 1K78B 3LSIA 2K27A 4ZDOA 5CQGA 5DM6F 1XD7A 2IVMA 4AIHA 2V7FA 4PJ0C 3Q5FA 4IQ4A 3A0BC 2GA1A 3GTLJ 1OCCH 4E7IA 2WADA 4L5EA 5JVTA 5CVJA 2EB7A 2PMUA 2R7UA 3FM3A 3OOPA 5LEJA 3VEPA 1T6SA 1VQ9I 3CF5F 2A07F 2DA2A 3L2WA 5K5QA 4IKFA 3ECHA 3KFWX 1FIAA 4ZYAA 4A93J 3R60A 3KLOA 2DMQA 2XKPA 4FX0A 1R4NB 1JKPC 3CMMA 1T98A 4J00A 3GTGJ 2VUMJ 2EV5A 3GWZA 2WC2A 2H09A 2IPQX 3RJPA 2WV0A 3LNQA 2R92J 4BACA 4XIDA 4I02A 1YX5A 1JKQC 4XOTA 2EPFA 2HKXA 3OMYA 4G7ZF 3CUQC 3KZYA 5E1WA 4NC8A 1OPCA 2F4MB 4CCLA 3DU5A 5EGOA 2L9SA 3S93A 3BZKA 4CCMA 3OR1C 4GCVA 1G3SA 3MQ0A 4Q48A 3TO6A 3WHBA 1KZHA 1MIJA 2E7WA 5E20A 1HBXG 1D1BA 2FF4A 4MHGA 1TP4A 1NK2P 1SFKA 2FOWA 4RGXA 3LSGA 2QUFA 3H1CA 5HDGA 4LOCA 5CJ9A 1LEAA 4BQQA 1JE8A 2VASA 2L54A 1U9OA 2BVMA 2HNHA 2RVCA 5CYVA 1FBUA 1ZGWA 4BBRJ 1B8IA 2IS4A 1R5ID 4EEFG 2VBZA 1WQ2A 3PNYA 3F6VA 3JREA 2R5ZA 4G12A 5EJCA 5ILVA 1N77A 4EJVA 4BGDA 2LH9A 2ZJ2A 2LLKA 2XGEA 3ZCOA 2F5EA 4UXNA 4A5MA 3L2CA 1G2HA 2STTA 3UNGC 5ED4A 3CLOA 4Y4RA 1E3OC 3D5LA 2ZXJA 5TGTA 1OCRH 2E60A 3EQLF 1D0YA 1TT5B 3BG5A 2XROA 1FP2A 2CG4A 3QOEA 2VOPA 2VJ4A 5CVVA 2JK3A 4AC0A 2E71A 1VFCA 2CV1A 2K9NA 3RI4A 5L3GA 2EK5A 3CUQA 4YIFA 4OOIA 1HW5A 1ODDA 5D8KB 1NG6A 1X4OA 1KU3A 1MSEC 5LGUA 3CTAA 2WA0A 1IN7A 2RQPA 3DXJF 3IWFA 2LY9A 2O8XA 4LJZF 3EYYA 4CZCA 3GX4X 4Z2YA 1GXQA 1ZELA 3MEXA 3ISPA 2DMPA 3MZ8A 2DPDA 2JA8J 1R9TJ 1R58A 1BR4A 2LRDA 3W6JB 4WWCA 1S29A 1FX7A 2DT5A 5DS9A 2JSCA 5BPIA 3M4OJ 3N97A 3EYIA 3CUOA 2JWTA 3RKWA 4JK1X 2WAQN 1VQ7I 4HPQA 3TOAA 2JN6A 3ZQCA 2E35A 2FNPA 1Y0UA 3F9KA 1V5EA 2MFZA 1ETVA 3S15J 2XB5A 3A01B 1SFOJ 1OCZH 1ZGAA 1P2FA 5JR3A 1WKMA 3CCEI 2Z16A 3RPUA 2YX7A 2HTSA 2R7VA 3I4MJ 4ESFA 1IN4A 1QPMA 5F0HA 3K6GA 1WJDA 2JSPA 3O2PE 4IRGA 1YRNA 4RMNA 4PK4A 1K4TA 4C30A 2LNBA 3WHCA 3M8EA 1IXCA 2JA5J 2HOTA 2KJBA 3KP4A 2NVUB 4M9SA 3DPUA 2NNYA 2XRNA 3BQZA 3VYTB 5EF6A 3C3WA 1GDTA 4DIQA 2LP0A 3FX3A 4L18B 2P7CB 1DU0A 3OY9A 1UJ8A 4CYCB 3WODF 1LFUP 3BP8A 1FY7A 2KRCA 5FD6A 2CSOA 3S3MA 1P9QC 4GO1A 4KMFA 3VFZA 2HQ5A 4X1EA 3HL2A 4KNYA 4BXUA 2E1MB 4FTHA 2DXIA 2O7OA 2EZIA 2A61A 3ZRGA 4XN3A 2VONA 4HZFA 1ZN2A 1MW7A 4EM0B 4BJTA 3DLAA 1WZ2A 4KMUX 3BY6A 1R00A 4IO9F 1W1WE 4IVNA 2Q8KA 4UUSA 3QQAA 2E34A 3BR1A 1FC3A 1Z1DA 2XPVA 3ZQ7A 4E6KG 4YG2F 4IHVA 3GZNB 2PG4A 2ELHA 2HR3A 1SFUA 3SZGA 3H36A 1MBEA 3DTEA 1O4XA 1BC7C 3HIFA 5D4SA 2HKOA 4HDUA 1X1BA 4A6EA 3J81K 3K70C 1U8RA 1CF7A 1XDSA 2RV8A 4JX5A 3BTCA 4Y33A 3RIRA 1BIAA 4XKBA 2VKDA 2QQBA 5HS9A 1MZBA 2ADUA 2FQ3A 3FIWA 5HS7A 1UHWA 2FEZA 3EPZA 1B72B 1MH4A 1JJ6C 2PBIA 2HS5A 2KLOA 2OV7A 3DTKA 3K4KA 2K9QA 2NOGA 3C2HA 4LGWA 2ZMEC 2XC7A 2VQCA 2VT2A 1QHHD 2NVYJ 2KISA 2V26A 3JW4A 2KJCA 2UWMA 1PUEE 2LG4A 3QWLA 2CH0A 3ABMH 2DMNA 4KYWA 3S2HJ 2HVSA 5HNHA 4LLNA 4GDFA 3ZOBA 2QKMB 1MGTA 2CFOA 1K4SA 1ENHA 2NVQJ 1AU7A 4OMYA 1O3RA 3BZCA 4XLEA 3K69A 1TWFJ 2X6XA 5BOXA 4PSXA 3SHFA 1ZK8A 2F4OB 2O5RA 2ECBA 5LRRA 1QZEA 4CYDA 2KRHA 1B59A 2FD5A 4G9YA 4Y3OA 5B5EC 1MJ9A 1UELB 3K9TA 5DD4A 1A6QA 4J19A 3MAJA 2XDVA 3C7JA 3KP6A 1F9NA 4V2GA 4P9UA 4PZJA 2M1BA
chains in the Genus database with same CATH topology
2PMZA 1WJEA 4PJLA 3TBIA 2VJIA 3I3LA 3E1SA 3OL4A 4P1WA 3KEYA 1LVKA 4DGWB 4XONA 4F3QA 1Y56A 3MKWB 3CZ6A 2VJ5A 4F93B 3QYFA 3L2RA 2CW7A 3HPGA 4RLQA 4E7ZA 3K70D 2OC6A 3LSKA 1J09A 2E5ZA 2IS1A 3VWBA 4RLFA 2HVQA 4XKWA 3J7AY 3CP2A 3DPTA 1DGWY 5CPRB 2ZXIA 2V1NA 4XKCA 3MKZA 4E7HA 2IS6A 4MLOA 2F5VA 2X1CA 4XN0A 1TZLA 1YE9A 2XAUA 3H9JA 4F52A 4NNJA 3K4CA 4LIUA 3QYEA 2M0MA 4LG3A 3AL0B 3ZR8X 2V6EA 2M4GA 4PUSA 4F91B 4LITA 3OWTA 4E7LA 2BVLA 4DBRA 1YX3A 3L2QA 4C2UA 1WJCA 2Q2EB 3CF2A 3E0JB 3VSLA 4HNUA 2IGMA 1X1DA 3K4LA 3L2VA 2WY7Q 2MABA 1WJ5A 3GBGA 3RQ4A 1WJBA 5JHFA 2PJRB 2KQRA 3H5RA 3HOSA 2HPMA 1WJFA 1TT0A 4B3XA 3KX2A 1R6RA 2K9MA 3IAM2 4XLCA 2PJRA 3PFYA 3DWLE 2CUZA 2V9KA 2WAFA 2W1OA 2QKLB 1S9HA 3HC7A 2KHMA 4H4KC 1W36C 3OOUA 4XR6A 4II3A 2R7RA 4II2A 2IS2A 4HG2A 2K9LA 2W00A 4B44A 2X6YA 2GOXB 2IXSA 4QPOA 1D0ZA 4CCJA 2X51A 3DEEA 1MMNA 2LC2A 1N78A 2VB6A 2F6CA 2R7WA 4ZC3A 1G8XA 3BLYA 3FDYA 3DQVC 3LSMA 3S8PA 4X0GA 2E5NA 2VL8A 1Z3YA 3OS0A 3S3OA 4XOPA 1FMVA 3W3CA 4BS9A 3EUHC 1QU3A 3H5AA 2M3AA 4B43A 1E0EA 4BDYA 3BCAA 3L2UA 3NWSA 3EUAA 2L5QA 4BEHB 1G59A 3A2KA 2KL4A 2R4GA 1PYVA 3EUKL 3KYLA 2VQHA 4AYBA 2VQGA 5HVQC 2W7NA 2K3PA 2ZSHB 4XKVA 5LD2C 4BU2A 5FRMA 2IGOA 1MMAA 3W2WA 4BUPA 3OIQA 3OYDA 3VYUB 3A4CA 2P0WA 3DKYA 3ZGKA 2GOMA 2M7AA 2ZXHA 4PJJA 4U87A 1D1AA 4BQOA 4DBQA 4PSWA 3V42A 4XMYA 4BE0A 4HSRA 3PUBA 2IGNA 4HRIA 1WFXA 2K5CA 3HPHA 1W36D 3S3NA 2OUMA 2A5WA 3DKXA 2WAEA 5KCMA 1LKXA 2WBMA 3I9V2 2R7OA 3HG9A 1MNDA 2WAQA 3OYFA 3LSIA 2E1MC 4ZDOA 5CQGA 3H5NA 3OS1A 5HNFA 2V7FA 3FBIB 4IQ4A 3ONQA 4CSWA 4E7IA 2CUJA 2LY1A 2WADA 2DOAA 2WB1A 3U21A 4RM3A 3H35A 3OYEA 2R7UA 3H9QA 1X4PA 4R79A 2JVHA 2X1EA 2BOLA 3NWTA 2R7TA 1DP3A 1X19A 3DPLC 3UR3C 3L2WA 1UAAA 4AVZA 3ZQQA 4IKFA 4ZYAA 3RPUD 2KZVA 2VPLA 1V5GA 5KHDA 2LREA 3AKZA 3CMMA 4J00A 4AU7A 2Z1DA 3CP8A 1DQUA 3K4JA 2MD0A 4F55A 2JA2A 4YELA 4BACA 1K6YA 1YX5A 1WJAA 4XOTA 3OMYA 4JOMA 2X6WA 3MD2A 4NC8A 2DCEA 4BQNA 2LBFB 4CCLA 2MYSA 3DU5A 3G2BA 2L9SA 3S93A 4CCMA 3OR1C 3CESA 2KPMA 4ITVA 2DT7B 2HQAA 3HOTA 1PJRA 1D1BA 1OR7C 2CW8A 4IX7A 2LBFA 2M4KA 4XQFA 1SFKA 2ZSIB 2CV0A 2HZDA 1LDKB 3LSGA 1VZ0A 1U0JA 4ZTJA 2W4SA 4ZJZA 4BQQA 2VASA 2RQQA 2BW3A 2BVMA 2HNHA 3VDXA 4B48A 2VQLA 1LFPA 1D1CA 1OLTA 2KDOA 4PFPA 3OYLA 3OYMA 1SAUA 3DU6A 3IP4B 3VSKA 4CUGA 3M1CA 1QHGA 3PNYA 3BG6A 4HNTA 4D1QA 2XF6A 4BDZA 3PJRA 1DGRM 3BCBA 2VXZA 1ERDA 1N77A 4BGDA 2UV1A 2LH9A 4ZDPA 1BOBA 3ZCOA 3QODA 2W82A 2Q1ZB 2F4IA 3IUOA 2HPIA 4XORA 3UNGC 4FASD 1MMDA 3K4NA 4PFOA 4NQWB 3OYCA 4CA0A 1Y6IA 4Y4RA 4NUBA 3D5LA 3PSFA 4XLAA 5TGTA 3W2VA 3OR2C 1UG0A 2E60A 2IS4A 1D0YA 3QOEA 2VJ4A 2LY2A 4XLFA 2CV1A 3SYTA 2CV2A 3SDBA 5HOOA 3TMOA 4ANJA 4E7KA 1HA8A 2VJJA 3OYIA 1NG6A 2LOOA 1X4OA 2WA0A 4D9JA 4YEJA 1N75A 4XL9A 4E4HA 4CZCA 3OS2A 2UUZA 3AL0C 2DJIA 3LFUA 1MMGA 4DJAA 1FMWA 4YRVA 1ZELA 4C9YA 1MNEA 4EATA 1Z21A 1BR1A 2VLAA 2XF5A 1BR4A 2LRDA 1T0FC 2MC4A 4OWRB 3PNVA 2KP6A 3RSNA 3H0DA 3C2GA 4HPQA 4ZDLA 4BJ5C 2AQEA 3F9KA 5FROA 3OYJA 1V5EA 2MFZA 3M8JA 3S32A 3HKZA 2Z16A 4N4NB 2R7VA 3OL3A 3OYAA 5KNLA 3K6GA 1WJDA 2JSPA 2NOJB 3H9GA 5CKTA 4CCNA 2CS3A 3QYBA 2AQFA 4RMNA 4PK4A 4E7SA 2XSJC 4C30A 3IAS2 2Y0SA 4KITB 4HSTA 2Z2SB 3DPUA 3DTIA 4U7BA 2L7KA 3A1YA 3PL8A 4KJZA 3SEQA 3VYTB 4HEA2 4DIQA 3BG7A 5CQEA 2R7SA 4OAYA 3OY9A 4BE1A 3LMMA 2I8DA 2KRCA 2IGKA 3S3MA 3OYBA 1P9QC 3K10A 4ZTFA 1KONA 3HL2A 2E1MB 2DXIA 2VIXA 1JI8A 2BW3B 4BL0B 3VYSB 3ZRGA 5HLTA 4XN3A 1Z3XA 1X1CA 3K4MA 4XNFA 3BC8A 3LSHA 3PNTA 1MW7A 4BE2A 2FUG2 2JUGA 3DLAA 4BJTA 3SEZA 2A6TA 2ELJA 4N4OB 4QPQA 2XF7A 4DOZA 2X85A 3MKYB 2DT6A 2RREA 4E6KG 4F92B 3OYHA 4E7JA 4JQFA 3SZGA 3DTEA 3OIPA 4BJ6C 1AA7A 4PJNA 3RCOA 2HU9A 1X1BA 4BXFA 3K70C 2HDWA 1IRXA 1EA3A 3HXLA 4OAZA 4Y33A 3VYRB 4KISA 1V5FA 4XKBA 3AFHA 2VKDA 3N05A 4FETA 3MMYB 2CMPA 3EPZA 3ZXSA 4KT6A 4CH7A 2RNGA 2VXDA 2WY8Q 4XLHA 4P5OA 5FRNA 2KLOA 2OV7A 3DTKA 3K4KA 1Z7LA 3C2HA 2HVRA 4C2TA 2R7QA 4LIVA 2XC7A 2VQCA 3CJQB 1QHHD 3OYKA 1NG7A 2M7BA 4RM2A 3W2AA 2V26A 3OYGA 4IZZA 2UWMA 4GRIA 3PSIA 2LG4A 2CH0A 2KMUA 2L2OA 2HVSA 5HNHA 2JVGA 3TL4X 3D5SC 1BR2A 2QKMB 2CFOA 2X1DA 1D0XA 4PJMA 4IQJA 3K4BA 3FBNB 4CCOA 2VKHA 2ZFUA 3LL7A 4XM3A 4J01A 1T95A 4XLEA 2X6XA 3RTRA 4PSXA 3D5RC 4BEHA 3CJRB 2O5RA 2R7XA 1GLNA 4NC7A 5LFAA 3HUGB 2KRHA 3FHNA 4Y3OA 2L9NA 4B47A 4G6TB 3OYNA 1UELB 2LYCA 2V4JC 1X1AA 2XDVA 3FKJA 4CCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2AQF A;  2CUJ A;  2ELJ A;  2DCE A; 
#chains in the Genus database with same CATH topology
 3JRG A;  3HUG A;  4MO7 A;  3I3L A;  4C3J J;  2EIM H;  3BZ6 A;  2L4A A;  3E1S A;  2XAQ A;  1WI9 A;  3KEY A;  3DBH B;  3LSP A;  1E3P A;  4MEY F;  1YIT I;  2EZK A;  3M7G A;  4F93 B;  3L2R A;  3HPG A;  5FLM J;  4E7Z A;  3ZQL A;  4EJU A;  2OC6 A;  3F8M A;  1KQ0 A;  1KYZ A;  5C4J J;  2E2H J;  1J09 A;  3PIO F;  3VB2 A;  3VWB A;  4LLL A;  2A6H F;  3J7A Y;  2CQX A;  1LVA A;  3E5Q A;  2XAH A;  3P7N A;  5IPA A;  3CP2 A;  5CPR B;  1H9T A;  3E6M A;  2V1N A;  2HOE A;  4XKC A;  3ZP5 A;  3F0C A;  1YIO A;  2ZME A;  4E7H A;  2IS6 A;  2ME0 A;  1TZL A;  1YE9 A;  3H9J A;  4XLN F;  2L01 A;  3K4C A;  3O6B B;  5J1Y A;  1A36 A;  3OIO A;  2L02 A;  4GXO A;  2HYF A;  2K86 A;  3AL0 B;  2DW4 A;  2DA7 A;  1NK3 P;  2CQQ A;  2HEO A;  1TLH B;  1T56 A;  5E17 F;  3R0A A;  5EEG A;  5BNG A;  1VQ4 I;  1YX3 A;  1XMA A;  2G9W A;  3K4L A;  1LUJ B;  2A68 F;  2WY7 Q;  1SEU A;  4KIB A;  4R8H A;  1WJB A;  1GV2 A;  2KQR A;  4QIW N;  1XMX A;  3HOZ J;  5IYC J;  4U7D A;  4B3X A;  4M74 A;  5FB2 A;  2M9H A;  3KX2 A;  1YIJ I;  2QM3 A;  1TNS A;  1MJA A;  4RA2 A;  1POG A;  1S7E A;  3DWL E;  2CUZ A;  2WAF A;  5K7Z A;  2HFH A;  3V8L A;  2NAZ A;  2W48 A;  3K0L A;  2XRL A;  2D45 A;  4XR6 A;  4II3 A;  3J7Z I;  2JRT A;  1LDD A;  2IS2 A;  3FHZ A;  1OCP A;  2W00 A;  2O6G E;  2A05 A;  1NHA A;  2QYO A;  2GXG A;  2GOX B;  1SVO A;  4QPO A;  4S0H B;  1A04 A;  4CCJ A;  2X51 A;  1MMN A;  1N78 A;  2VB6 A;  3RDI A;  4AD9 A;  4FQG A;  2R7W A;  3L09 A;  1WSU A;  1I6H J;  2LD5 A;  3LSJ A;  1SD6 A;  4EM1 A;  2BY2 A;  2E5N A;  4D7N A;  1HKQ A;  2VL8 A;  3GFJ A;  1GHC A;  5BMZ A;  5AIP A;  3HYI A;  3V8K A;  1EF4 A;  3P9I A;  1IDY A;  3TP0 A;  4TV7 A;  3FIS A;  3H5A A;  1BBY A;  2BBY A;  2DOD A;  1YG2 A;  3ZQH A;  1JT0 A;  4B43 A;  4ETS A;  1OIS A;  1YJN I;  4BNC A;  1EV7 A;  3HOY J;  3EUA A;  2L5Q A;  1R4M B;  2LF7 A;  2KL4 A;  1PYV A;  1TWC J;  3K1P A;  2IA0 A;  1ON2 A;  3GYH X;  4NDL A;  2K3P A;  4NQW A;  2QBY A;  3FZV A;  1ETY A;  1WI3 A;  4BU2 A;  5IY5 H;  4QSH A;  3F23 A;  1MMA A;  2V79 A;  5KVR A;  4BUP A;  2R93 J;  1PUF B;  3PO2 J;  1QZZ A;  3H3Z A;  9ANT A;  3HGG A;  5J8C A;  2ZO4 A;  3FXL A;  4M9Z A;  1GT0 C;  1VQO I;  3DKY A;  2OCE A;  4A3M J;  5L3F A;  2M7A A;  3SZP A;  1MMS A;  4DNC A;  1RUO A;  3LA2 A;  5GPA A;  4A69 C;  1D1A A;  4BQO A;  2GLO A;  4PSW A;  3V42 A;  2AHQ A;  4BQA A;  3DKW A;  2D1H A;  4ZZL A;  1PVE A;  1UCR A;  5DCM A;  2HOS A;  4HRI A;  3KEQ A;  5GAG J;  2OUM A;  5M3M J;  1LKX A;  2WBM A;  3MN2 A;  3QOP A;  5K5O A;  4WF2 A;  3HG9 A;  4FHT A;  5IP9 J;  1MND A;  2OZU A;  3H0G J;  1X3U A;  2OTJ I;  4BKX A;  3FXO A;  3H5N A;  4M6V A;  3OS1 A;  1T08 B;  2FBI A;  5HNF A;  2E2I J;  4GFB A;  3WU2 C;  3ONQ A;  5HDK A;  4CSW A;  2ID6 A;  2OA4 A;  4MGR A;  3CC2 I;  2DOA A;  1JTX A;  4RM3 A;  3PQJ A;  3OYE A;  1QVT A;  1X4P A;  3CO7 C;  4R79 A;  1QGP A;  2ECC A;  3MCZ A;  4HV6 A;  4UUT A;  3NWT A;  2R7T A;  3M9A A;  4AID A;  1X19 A;  3DPL C;  3ZMS A;  3F22 A;  2DQR A;  2DYS H;  4AVZ A;  3ZQQ A;  1ZG1 A;  3HOW J;  3KLN A;  3BPV A;  4KIF A;  2EWN A;  4U0W A;  3RPU D;  2KZV A;  4I2O A;  5D5U B;  3FWE A;  2VPL A;  1D5Y A;  1AHD P;  2BGC A;  2FU4 A;  1K7A A;  1DU6 A;  1W7P A;  1XX5 A;  1FSE A;  1JUP A;  5FKM A;  1IC8 A;  4U0V A;  2JA2 A;  4A0Y A;  4YEL A;  5FLX K;  4BHC A;  3AG3 H;  3HZJ A;  5E1Z B;  2KIQ A;  4A0X A;  5IT3 A;  2EIL H;  1I6X A;  2J5O A;  2DMU A;  3MD2 A;  3CCJ I;  2CU7 A;  4RAF A;  2MYS A;  1JKO C;  4ZYG A;  2QF7 A;  2BEO A;  4M6X A;  3TED A;  2KPM A;  1F5T A;  2HI3 A;  3SZT A;  5D5V B;  1PJR A;  2X4H A;  1TBX A;  2G7U A;  2CW8 A;  1IAW A;  2LBF A;  4XQF A;  2CW0 F;  3GW2 A;  1LDK B;  3IHU A;  1VZ0 A;  3WGG A;  1U0J A;  4ZTJ A;  2L3D A;  5EG0 A;  5IYD J;  5J47 A;  5EZG A;  2BW3 A;  4L9J A;  4B48 A;  5DDG A;  3S16 J;  2VQL A;  2EZH A;  4LD5 A;  3DBL B;  1T2K A;  1ZG5 A;  1D1C A;  3DBR B;  2KDO A;  3HEF A;  1OYW A;  1IRZ A;  2VN2 A;  3OYL A;  3DU6 A;  3IP4 B;  3KEO A;  3VSK A;  3M1C A;  4S04 A;  3CC4 I;  4XRM A;  3BG6 A;  4XSX F;  2XF6 A;  2EIN H;  2V1U A;  1QPI A;  1ERD A;  1Z0X A;  4FE4 A;  2W82 A;  3IUO A;  4Y13 A;  3B6C A;  3A02 A;  1E17 A;  2H1K A;  2V1X A;  3K4N A;  1S5L C;  2XAJ A;  1S6L A;  2DFH A;  4NC6 A;  2FBH A;  4NUB A;  3W2V A;  1MSF C;  2XSD C;  4V19 K;  2DA4 A;  3JTG A;  1YI2 I;  2M45 A;  3CME I;  3SYT A;  4RB2 C;  5EZH A;  2ZJP F;  2CV2 A;  2P8T A;  1RES A;  1Y1W J;  2CQN A;  3FK6 A;  2OD5 A;  3BTI A;  3TMO A;  2QVO A;  3I55 I;  4ANJ A;  4WXD A;  2XAG A;  2VJJ A;  4P96 A;  3DEW A;  4D9J A;  4YEJ A;  1O3S A;  3HSE A;  1U2W A;  1U8B A;  3WGH A;  1MNM C;  3SQN A;  1V55 H;  2DJN A;  3LFU A;  3J7A O;  1MMG A;  5DTD A;  3FMQ A;  4YRV A;  4C9Y A;  5JLW A;  3E97 A;  2QA4 I;  1TWG J;  1Z21 A;  3LWF A;  3E6B A;  2DA5 A;  1AKH B;  4IHW A;  2BXZ A;  5GTH C;  2IJL A;  3MKL A;  3CDL A;  2QSF X;  3BWG A;  1T0F C;  1OJL A;  2MC4 A;  4JP0 A;  4OWR B;  3FK7 A;  1S8N A;  1LE8 A;  2KP6 A;  3BJO A;  4UVC A;  3TDU C;  5L3B A;  3P5J A;  3G3Z A;  5IOZ A;  3C2G A;  2LKS A;  3OYJ A;  4XRS A;  3M8J A;  4LG0 B;  3H92 A;  2GXA A;  3GTK J;  5TJJ A;  1F1Z A;  2M0C A;  1HC8 A;  1BI1 A;  2YX4 A;  5LGN A;  2GM4 A;  4M3B A;  1JHH A;  2YSR A;  3OL3 A;  1N25 A;  5KNL A;  2NOJ B;  2NNN A;  3QYB A;  1E2X A;  4ZYH A;  4OIN F;  3G1M A;  3IAS 2;  2ETH A;  1R71 A;  1STZ A;  1R22 A;  2NXN B;  1J2X A;  5AON A;  3TO9 A;  2EIJ H;  2YU9 J;  2Y0S A;  4MFE A;  3BPX A;  4HBL A;  5ICC A;  1KQ8 A;  4U7B A;  4L5I A;  5LHI A;  3HRM A;  1IRG A;  1W0T A;  3SEQ A;  4HEA 2;  4RAZ A;  4G7O F;  5CQE A;  1ZYR F;  2ZNZ A;  2QQ9 A;  1S3J A;  2OAZ A;  4EGY A;  4M71 A;  4N9H A;  2OJE D;  3J81 Z;  1ZRF A;  3KIO A;  2VIX A;  2DN0 A;  3ESW B;  2BZT A;  1I1S A;  1FLI A;  1SAN A;  3BG3 A;  1Z3X A;  3K4M A;  2XB0 X;  3CJN A;  4XNF A;  3B73 A;  4O5V A;  3BC8 A;  1WRJ A;  3PNT A;  3TP3 A;  4D5F A;  1PP8 F;  1A6I A;  1G3W A;  3CCU I;  2ELJ A;  5F27 A;  2XGD A;  4EJT A;  1LNW A;  2OU2 A;  2XF7 A;  4DOZ A;  5M3F J;  2ICW G;  2X85 A;  3MKY B;  3G1O A;  1T0F A;  2M2E A;  4F92 B;  4HDV A;  3DV8 A;  2M8G X;  4IXA A;  2MLK A;  2RDP A;  1AA7 A;  4PJN A;  2UZK A;  3G73 A;  1R49 A;  1ETQ A;  4JX4 A;  1X58 A;  4M3G A;  4BXF A;  5EEA A;  5JI6 A;  1IUY A;  1ZAR A;  2EZL A;  5F1R A;  4UV8 A;  1IRX A;  3ZMT A;  3KZZ A;  3JAM Z;  3LSR A;  4BXX J;  4OAZ A;  4Y17 A;  3DP7 A;  3Q9V A;  5ICE A;  3HRU A;  1T39 A;  3MMY B;  2CMP A;  2R5Y A;  3V7C A;  1YJW I;  1F36 A;  4OIQ F;  1A31 A;  1OKR A;  2OTL I;  1V3F A;  1Y39 A;  5FRN A;  3R4K A;  3WTY C;  4M3D A;  2BE5 F;  3ZMZ A;  4LIV A;  3CJQ B;  3M07 A;  3DLL F;  2W84 A;  2ACJ A;  1ZQ3 P;  3OYG A;  3GVA A;  1DPR A;  1MDM A;  2KMU A;  2L2O A;  1DDN A;  1JHF A;  1IV6 A;  1ETK A;  3G1L A;  3D5S C;  3DF8 A;  2VE8 A;  4A6D A;  2K9S A;  1SAX A;  3HSR A;  4KN4 X;  3K4B A;  4UV9 A;  3MZY A;  5DD8 A;  5E8I A;  3WTU C;  4XM3 A;  4LB6 B;  2RN7 A;  2MD5 A;  1IN6 A;  4J01 A;  3GXO A;  3I64 A;  1PP7 U;  3CDI A;  1SVM A;  3V7R A;  4EJO A;  2R7X A;  4BEH A;  3GLX A;  1FIP A;  4NC7 A;  3HUG B;  2YS9 A;  3FXR A;  4M6Y A;  1EH7 A;  4G6T B;  3CCS I;  4AWX B;  2DLL A;  1V54 H;  2ISY A;  2V4J C;  2V6C A;  2Y9Z A;  1X1A A;  1HOM A;  3FKJ A;  3U2R A;  1Y1V J;  4S05 A;  3ELK A;  3CJT B;  2H6C A;  2KIU A;  4PJL A;  3TBI A;  3K7A J;  3ML6 A;  3OL4 A;  2DK5 A;  3T0Y A;  4YIR X;  2IW5 A;  3T8T A;  2NRA C;  1ZAO A;  3I59 A;  4R1H A;  3CZ6 A;  2FBK A;  2P7V B;  3S14 J;  2DU9 A;  2XGX A;  1VQ8 I;  4RLQ A;  2FML A;  1SMT A;  1J0R A;  3LSK A;  3G4S I;  3RZO J;  2IS1 A;  1A5J A;  4RLF A;  2GWR A;  5EEH A;  4IRH A;  3DPT A;  5E1X A;  3GFI A;  3FKI J;  2MH2 A;  2CO5 A;  3ASN H;  3I54 A;  3S1M J;  3WGI A;  2X1C A;  4XN0 A;  1K78 A;  2DFI A;  2NS8 A;  4U88 A;  2VKE A;  4LIU A;  2GBY A;  2Y48 A;  2MGQ A;  3EDP A;  3ABL H;  2ZKZ A;  3Q3S A;  1Q1V A;  4NB5 A;  2PEX A;  1W4M A;  3B6A A;  4IOA F;  4IHY A;  4BHB A;  4LIT A;  2Y0S N;  2V9V A;  2VBX A;  5AIQ A;  4DBR A;  1WJC A;  2H1L A;  2Q2E B;  5GP9 A;  1L3L A;  3VSL A;  1KU9 A;  1XMK A;  2W25 A;  4HOB A;  3L2V A;  3REO A;  3JTH A;  3PIP F;  1T8I A;  1LJ9 A;  4ZH4 F;  2MAB A;  3H5R A;  1W7P D;  1WJF A;  4OIO F;  4RB0 A;  1R1T A;  3FXK A;  2K9M A;  3ZN0 A;  2PJR A;  3PFY A;  5D5W B;  2NVT J;  2V9K A;  4DZJ A;  2QKL B;  3HC7 A;  4L9T A;  2KHM A;  1W36 C;  5F6F A;  3V4G A;  2VBY A;  5BPD A;  4HX4 A;  3QPL A;  3WU0 A;  1HXD A;  5IP7 J;  4HG2 A;  2B7E A;  3E3V A;  4B44 A;  1CGP A;  3V7S A;  2FJ1 A;  2E19 A;  5J40 A;  4ENM A;  4ENK A;  1HQC A;  3DEE A;  3RKQ A;  1MD0 A;  2MH9 A;  3OSG A;  5HLG A;  2DOF A;  4HLX A;  2DTZ A;  4I99 C;  2FXA A;  1VQL I;  2KIF A;  4C3I J;  5E3L A;  5J3L A;  4EVI A;  3CCQ I;  4ZZD A;  2LDU A;  1P4W A;  2JPB A;  1FMV A;  2YR2 A;  4XOP A;  4Y15 A;  5HLH A;  1ULY A;  2JA6 J;  3EUH C;  2MBF A;  4I09 A;  2OPT A;  1CQT A;  3FXU A;  2ZFW A;  2CGP A;  2PQ8 A;  4BDY A;  1MBK A;  5F08 A;  2IA1 A;  3TKY A;  1FT9 A;  2EV0 A;  3LAJ A;  3R61 A;  3I58 A;  3KYL A;  2VQH A;  5LHH A;  5J8F A;  3SJM A;  4AYB A;  4I76 A;  5HVQ C;  2JUC A;  3E7L A;  1QO0 D;  2P6T A;  4BH9 A;  3IRR A;  2CQ7 A;  4XKV A;  2M34 A;  3GME A;  2IGO A;  1F43 A;  2DA1 A;  2R0Q C;  2YUS A;  1Z6R A;  2M87 A;  3W2W A;  5K5R A;  2OF7 A;  1RET A;  5DCM B;  4A3F J;  1Z67 A;  1XSX A;  3OIQ A;  3OYD A;  3VYU B;  3A4C A;  2XPW A;  1OFC X;  2ZXH A;  4PJJ A;  4U87 A;  5ERI A;  3CCR I;  4DBQ A;  3C2B A;  1R5G A;  4A3D J;  1RR8 C;  2HOA A;  3J80 K;  1E3H A;  4CO8 A;  2BV6 A;  3R6S A;  2IGN A;  2KT0 A;  1WFX A;  4IHX A;  3JRA A;  5F0C A;  3HOU J;  1TQI A;  4UVA A;  2A5W A;  2XAF A;  5KCM A;  5J4Y A;  4EQQ A;  1ZH5 A;  3I9V 2;  3HTS B;  3GTO J;  2FE3 A;  2R7O A;  2MLG A;  3ASO H;  2FNA A;  3WE2 A;  2DFE A;  4KFC A;  2E1M C;  1C0W A;  1KA8 A;  2EFP A;  3GFL A;  1FSH A;  1ZRE A;  1BC8 C;  4FCY A;  2DMT A;  3FBI B;  2ME6 A;  3F8B A;  1HLV A;  5FLX Z;  5FFZ A;  1IN5 A;  1RC9 A;  3EUH A;  2WB1 A;  3U21 A;  3H35 A;  1YO5 C;  1IUF A;  4KN7 X;  3NAR A;  2CYY A;  3IH3 A;  4AM3 A;  2JVH A;  2X1E A;  4PDK A;  4WK8 F;  2BOL A;  3KET A;  2E2J J;  3F21 A;  1VTN C;  1DP3 A;  3UR3 C;  2GXB A;  3PO3 J;  3T5X A;  3TOB A;  2RNJ A;  2OQG A;  4RB1 A;  3A01 A;  4HF1 A;  1WCM J;  2D5V A;  2ID3 A;  4AU7 A;  1VQP I;  3CP8 A;  3IKV A;  1JJ8 C;  1ZG3 A;  1DQU A;  4F55 A;  2K85 A;  1VND A;  1HDP A;  2G7H A;  2DI3 A;  2JMW A;  1K6Y A;  1U5T B;  2Z9O A;  2N8G A;  1TW2 A;  1RUN A;  3T8R A;  3WG7 H;  1OQY A;  5FJ8 J;  1MBF A;  3LFK A;  1R1U A;  1FZP B;  2O0Y A;  5ILS A;  1JT6 A;  2LBF B;  1J7K A;  1Z05 A;  1GVD A;  1YW8 A;  3AG1 H;  2JQ7 A;  3ZN1 A;  3HOV J;  4ITV A;  1Y0N A;  2DT7 B;  4MQ9 F;  1DP7 P;  2HQA A;  1VQ6 I;  2GIZ A;  3I0T A;  1H9G A;  4IEJ A;  4CYC A;  2X48 A;  1P4A A;  1OR7 C;  4IX7 A;  2HQN A;  1OCT C;  1M1E B;  2GIV A;  2M4K A;  2ZSI B;  3RZD J;  4B3A A;  3JRB A;  1JGS A;  1R1V A;  2W4S A;  1XG1 A;  4ZJZ A;  2J5P A;  3CCL I;  3CMA I;  2HXO A;  4M9X A;  4EMS A;  2XPU A;  1J9I A;  1XDU A;  2VOO A;  3B02 A;  3HSF A;  3TQN A;  5E3N A;  2LF8 A;  4CUG A;  1KU2 A;  1QHG A;  4RS8 A;  4HNT A;  4D1Q A;  5IT9 Z;  1ZTR A;  3K1M A;  1YW9 A;  4BDZ A;  3Q0V A;  1DGR M;  3BCB A;  4UY8 I;  2VXZ A;  4X6A J;  2UV1 A;  4ZDP A;  1BOB A;  3ZQI A;  2F4I A;  5KAI C;  4JYK A;  4FAS D;  4HX8 A;  1MMD A;  3HRT A;  3OYC A;  4M3F A;  1K79 A;  2ESH A;  5GPC A;  1Y6I A;  4DZP A;  1XCV A;  4XLA A;  3PSF A;  2JZY A;  1U78 A;  4NHJ A;  2NYX A;  3IC7 A;  3Q0W A;  1G6N A;  1KU7 A;  2LY2 A;  2JPC A;  4XLF A;  4P55 A;  1IXR C;  1IF1 A;  1RIO H;  1GXP A;  3FXQ A;  3LQR A;  4UHT A;  5IYB J;  3SDB A;  2QEX I;  5F0F A;  5DUI A;  2DTR A;  1B72 A;  4B1R A;  4A3L J;  3I4P A;  4E7K A;  4AYB N;  2W57 A;  5HOD A;  1HA8 A;  2LMD A;  4DQ2 A;  1ZLK A;  2VE9 A;  1A35 A;  3SFZ A;  4G94 A;  1N75 A;  5LHG A;  4OU0 A;  4E4H A;  1VQ5 I;  3EET A;  3OS2 A;  2UUZ A;  3AL0 C;  2DJI A;  2COB A;  3LA7 A;  2OQR A;  4DJA A;  4G6D A;  2HDD A;  2LK2 A;  2R7F A;  4O3M A;  1MNE A;  4DW6 A;  3K2Z A;  4EAT A;  1BR1 A;  5KAF C;  2VLA A;  3QRF F;  1ZGJ A;  4ASN A;  3QU6 A;  2XF5 A;  5LEK A;  5C3E J;  2ISZ A;  4OIR F;  1HKS A;  1EJ9 A;  1RZ4 A;  2M8E A;  3KPH A;  2DK8 A;  2AXL A;  2IRF G;  2CUE A;  3GO5 A;  2Y9Y A;  4IHS A;  3H0D A;  1EH8 A;  3MFK A;  2AS5 F;  4ZDL A;  4BJ5 C;  3E6C C;  2AQE A;  5FRO A;  1FOY A;  1XN7 A;  5H6Q A;  1XS9 A;  4M3E A;  1HW1 A;  2MA3 A;  1SVL A;  2ZC2 A;  2VC0 A;  1FOW A;  1QVU A;  1ON1 A;  2WB1 N;  1KGS A;  4XRS G;  4E7S A;  2XSJ C;  2IP2 A;  4RDU A;  5HDN A;  5CVR A;  2K40 A;  1Z77 A;  4KIT B;  3NQO A;  5B1B H;  2L7K A;  1I1G A;  3PL8 A;  4XBF A;  2VI6 A;  2Y69 H;  5EGO B;  1BA5 A;  2EFO A;  1P7J A;  2X9D A;  2R7S A;  2OZ6 A;  4OAY A;  4YII A;  4MTE A;  3DEU A;  5E8G A;  1WGX A;  4BE1 A;  2AXT C;  5DYM A;  4A3E J;  4AVP A;  3HTU A;  3OYB A;  3K10 A;  4ZTF A;  1KON A;  1XGO A;  2XAS A;  3ZPL A;  4I98 B;  1B6A A;  1JI8 A;  2LSO A;  4BL0 B;  2EV6 A;  1P6R A;  3VYS B;  5F1J A;  3K1N A;  5LGT A;  5HLT A;  4A12 A;  1HF0 A;  1B8I B;  5FLV A;  2X0L A;  4BE2 A;  1HST A;  2FUG 2;  5GAE J;  3SEZ A;  1VQN I;  1YHQ I;  2DYR H;  1EKE A;  4N4O B;  2DDA A;  4QPQ A;  1IV8 A;  2R5Z B;  4ENJ A;  5FFX A;  4C3H J;  2DT6 A;  2RRE A;  3O8H A;  2KZG A;  1MJB A;  4D7M A;  3COA C;  4IF4 A;  4A3J J;  3SXY A;  4BJ6 C;  1X1P A;  3RCO A;  1BI2 A;  2ZJQ F;  4XRF A;  2MG4 A;  1NH3 A;  2DPU A;  3M1E A;  1B1B A;  2HDW A;  2LKP A;  1TWA J;  1WPK A;  3QAH A;  4L9V A;  1H0M A;  1FP1 D;  1UZC A;  3HXL A;  1B4A A;  5F64 A;  1VQK I;  2PMH A;  1V5F A;  3AFH A;  1VI0 A;  2B63 J;  3RYP A;  4FET A;  3WU1 B;  3LAP A;  2QSG X;  5DV5 A;  2L9V A;  2QEN A;  1RRJ A;  3CUQ B;  5D8L B;  1APL C;  4KT6 A;  3HM5 A;  2FSW A;  2WY8 Q;  4ZYD A;  4YFX F;  4P5O A;  1ETO A;  5DUK A;  4OMZ A;  5D4R A;  2R7Z J;  4KIC A;  1Z7L A;  1ORK A;  3ROU A;  4C2T A;  2R7Q A;  3NRV A;  2CJJ A;  4G8X A;  4HV5 A;  2M7B A;  3UKG A;  3W2A A;  2LVS A;  1IGN A;  4I6Z A;  4IZZ A;  2CQK A;  4GRI A;  2HZT A;  2RGV A;  4ESJ A;  3M3Y J;  2JVG A;  3TL4 X;  1BR2 A;  3QPH A;  2EFN A;  1D8J A;  1YFH A;  1QZY A;  5J4V A;  2DA3 A;  4IQJ A;  1K6O A;  3ZMU A;  1F4K A;  3BR6 A;  4OIP F;  2ZFU A;  3LL7 A;  4AIJ A;  2F5C A;  3I53 A;  4FIS A;  2PX9 A;  3RTR A;  5L3C A;  2PLY A;  4O6J A;  3CJR B;  1GLN A;  4ENN A;  2VT3 A;  1R7J A;  2EFW A;  1XGN A;  5LFA A;  4HX7 A;  3BRO A;  4Z6Y A;  3FHN A;  4KT5 C;  4B47 A;  3OYN A;  3LST A;  3I59 B;  1SD4 A;  3PQK A;  2R3S A;  3RQI A;  4CCK A;  2UXX A;  1PUF A;  1FEX A;  4P1W A;  1ETW A;  2BHZ A;  4DGW B;  1H89 C;  1W5T A;  4Y7N J;  2F48 A;  4I01 A;  4IRI A;  1YRN B;  2D1V A;  3MKW B;  2VJ5 A;  3K70 D;  2Q0O A;  4RBO A;  3JRF A;  2BY1 A;  4XLP F;  2ELK A;  2DDB A;  2Y2Z A;  2UXN A;  4HF0 A;  3ABT A;  2RC4 A;  2FA5 A;  2K4B A;  5HLI A;  4CIC A;  1W5S A;  4BY1 J;  1K61 A;  4K2E A;  4PCQ A;  1XPX A;  4IHT A;  1VQM I;  5CVU A;  2STW A;  1DGW Y;  2EH3 A;  3RKX A;  1LDJ A;  1LFB A;  1T33 A;  2F5V A;  2DA6 A;  4F52 A;  1G3T A;  4NNJ A;  2TDX A;  3L1P A;  3QYE A;  5E79 C;  3KYC B;  5TRD A;  1SC7 A;  3FM5 A;  3Q0U A;  4F91 B;  4JX6 A;  5J1R A;  3ECO A;  1I5Z A;  3OWT A;  3BTL A;  2BVL A;  3IH2 A;  4RGU A;  1BW6 A;  1MH3 A;  4C2U A;  3CF2 A;  2OCC H;  1KYW A;  2CFX A;  1W5C C;  1U3E M;  2C6Y A;  4UUS B;  3F6O A;  2XVC A;  4QTR A;  1WJ5 A;  3E5X A;  4UB6 C;  5JHF A;  1MBG A;  2PJR B;  3H3V K;  3HOS A;  3LA3 A;  2YU3 A;  2HPM A;  1V4R A;  2VOD A;  2O9L A;  2HGC A;  1SD7 A;  3BG9 A;  3U1K A;  4N0B A;  1YLF A;  3CD6 I;  1J5Y A;  4XLC A;  5D5X B;  1QBJ A;  2EQR A;  5ILU A;  1B9M A;  2EA4 A;  5L3D A;  1CF7 B;  1HSJ A;  2EA2 A;  2W1O A;  1S72 I;  1S9H A;  2Y30 A;  3BR5 A;  1Z91 A;  2E36 A;  5L3E A;  3GTQ J;  3GTJ J;  5CVI A;  3OOU A;  4BAY A;  2V1D A;  2R7R A;  4II2 A;  4XSZ F;  2XGC A;  3V8J A;  5E3M A;  1MKM A;  1O3Q A;  1USS A;  1WWX A;  3HBL A;  1BJZ A;  2IXS A;  4C2M J;  2H94 A;  1D0Z A;  2V9P A;  2LC2 A;  4EM2 A;  3PUF A;  4MFD A;  1BL0 A;  3BLY A;  4CDG A;  3BR2 A;  3ZMD A;  4AIK A;  2G0E A;  3P9C A;  1Z3Y A;  2ZB9 A;  3QP5 A;  3S3O A;  1VF9 A;  4A3G J;  4L0Z B;  4BS9 A;  1B9N A;  3QPS A;  1QU3 A;  2M3A A;  4WXH A;  3JRI A;  1FTZ A;  3J80 Z;  1TC3 C;  2F5F A;  2ZXW H;  4IL6 C;  2L9R A;  1J59 A;  4KUM A;  2HYJ A;  4I0B A;  5J6X A;  3A2K A;  2R4G A;  3MVP A;  2K4J A;  2FRH A;  3BQY A;  2ZBK A;  1BW5 A;  1P4X A;  4I7H A;  5J1U A;  2MW8 A;  2L4M A;  2O3F A;  2MSY A;  3J7Y J;  5FRM A;  1BM9 A;  1O3T A;  3WTX C;  1TNT A;  3AG4 H;  3RKY A;  4Q5S F;  3WTT C;  3F8F A;  4IOC F;  1HDD C;  3CDH A;  3IKT A;  1W0U A;  2W85 A;  3CC7 I;  3NAU A;  3WTS C;  1FOX A;  3K2A A;  4YFN F;  3I4N J;  4V2F A;  4XMY A;  1BI3 A;  2F2E A;  4BE0 A;  5FKL A;  4HSR A;  5IP6 A;  2JT1 A;  2HWV A;  4E70 A;  3HPH A;  1I27 A;  2LFB A;  3S3N A;  4G7H F;  3DKX A;  2WAE A;  4P9F A;  3KP3 A;  3WTV C;  5A2Q K;  4A3C J;  2FQ4 A;  2E1N A;  2ZME B;  3S17 J;  1BOA A;  3TW6 A;  4ZYE A;  1YOV B;  2B9S A;  2HQR A;  4RGS A;  3F8C A;  2Z5U A;  1FNN A;  1AKH A;  2QWW A;  1YS6 A;  2CUJ A;  2H6B A;  1G3Y A;  2LY1 A;  1RPW A;  1RNL A;  3Q9S A;  1ZR2 A;  3H9Q A;  2RKH A;  2WV1 A;  4HYE A;  3AAF A;  1UST A;  5ICG A;  5D6F A;  2XUB A;  1UAA A;  4KIG A;  3M8F A;  3WG9 A;  5JFR A;  1IG7 A;  4LG0 A;  5FO5 A;  3JRH A;  3OV8 A;  4AUX A;  4LLG F;  1P92 A;  1ACI A;  1V5G A;  5KHD A;  1YS7 A;  2LRE A;  3AKZ A;  2NVX J;  2Z33 A;  3HGY A;  2BY3 A;  4BHP A;  5TIS C;  2Z1D A;  3K4J A;  2MD0 A;  1OCO H;  4Q47 A;  2CUF A;  3BJA A;  5KK1 A;  1ZKG A;  2P4W A;  1K83 J;  1WJA A;  4LB5 A;  3IWZ A;  4JOM A;  1HCR A;  1RR7 A;  2X6W A;  2DCE A;  4BQN A;  1QNT A;  2TCT A;  3G2B A;  2DOE A;  1ZRD A;  2FMY A;  1O7L A;  2M30 A;  2PJP A;  4Y52 J;  3CES A;  5LLQ A;  3HOT A;  3W6K B;  2O8K A;  3PFI A;  2CV0 A;  2HZD A;  1JUM A;  4W1U A;  4FX4 A;  1XCB A;  2W24 A;  3FXM A;  1Q1H A;  1O7F A;  2RQQ A;  2AO9 A;  3FF5 A;  3KE2 A;  1MBH A;  3VDX A;  2Z99 A;  1FOK A;  3IRQ A;  1H88 C;  1MBJ A;  1LFP A;  1H8A C;  5EYR A;  5JHU A;  1OLT A;  1NTC A;  2Z3Y A;  3BR3 A;  4PFP A;  3VPR A;  3OYM A;  1SAU A;  4CXF A;  1JUS A;  1I50 J;  4CZZ A;  4KDP A;  4M72 A;  1FWZ A;  3JSP A;  3GF2 A;  2DO7 A;  3VOE A;  1YQA A;  3PJR A;  5M5W J;  3ERE D;  2COM A;  2DQL A;  5E18 F;  2E7X A;  4ON0 A;  2VC1 A;  1SD5 A;  3QOD A;  1LQ1 A;  2O03 A;  2Q1Z B;  3GCM A;  3F8N A;  2HPI A;  3NEU A;  4XOR A;  2IA2 A;  2A69 F;  4M73 A;  3CO6 C;  3WTZ A;  3CCV I;  4PFO A;  1YTY A;  4NQW B;  2QBY B;  2X6O A;  4WXC A;  3JR9 A;  2K3F A;  1IRF A;  4CA0 A;  1S7A A;  3E5U A;  1ZHF A;  3S2W A;  4L5J A;  3OR2 C;  1UG0 A;  3F3X A;  3S2D J;  2WWY A;  2MC3 A;  4ABZ A;  4WCG A;  2VKV A;  1YJ9 I;  1GUU A;  3CCM I;  1FJL A;  4D0P A;  5HOO A;  4L0Y B;  3OYI A;  2LOO A;  1XGS A;  3JAM K;  4MNU A;  2HTJ A;  5LRS A;  4XL9 A;  3WE3 A;  4MQV A;  2LTP A;  3VOD A;  3I56 I;  1FMW A;  4EGZ A;  2A5Y B;  4UB8 C;  1TTY A;  2HXI A;  5JLX A;  4HA8 A;  2QCO A;  1ETX A;  1UFM A;  1X2M A;  5FKK A;  4A0Z A;  1REP C;  1TL8 A;  1YW7 A;  2HYG D;  2DAO A;  5LBQ A;  3PNV A;  3BOQ A;  3RSN A;  5C4X J;  3P9K A;  3O3K A;  3S1N J;  2KKO A;  2ESN A;  2H27 A;  2ZNY A;  4PGG A;  4D5C A;  3ABU A;  3JRD A;  1FPQ A;  3S32 A;  5CLS A;  2HDC A;  3HKZ A;  4CGZ A;  2P5L C;  1LPQ A;  1W7P B;  4N4N B;  4A3B J;  2I5U A;  3IL2 A;  1IXS B;  5F04 A;  3CLQ A;  2E1O A;  2XKO A;  3OYA A;  5ICF A;  3CQZ J;  3H9G A;  5CKT A;  4CCN A;  2CS3 A;  1TWH J;  2AQF A;  3AG2 H;  2O61 A;  5BS6 A;  1IZ1 A;  1DPU A;  2EJR A;  2FX0 A;  3R0J A;  3N4M A;  4HST A;  5H20 A;  2D2W A;  2Z2S B;  3DTI A;  2DFF A;  2H8R A;  3A1Y A;  4BBS J;  4IPA A;  4KJZ A;  3GZ6 A;  5H2F C;  1YYV A;  1I39 A;  2A6E F;  2GQQ A;  2P6S A;  3BG7 A;  4RAY A;  1HW2 A;  1HKT A;  3F72 A;  1TQP A;  3TO7 A;  1UHS A;  5K7H A;  1QA6 A;  3LMM A;  1WH5 A;  2I8D A;  5H6R A;  2ZCW A;  3KZI C;  4RGR A;  1G4D A;  2IGK A;  2JA7 J;  4GGG A;  1LB2 A;  1P7I A;  2IAI A;  1Y8R B;  4WX9 A;  3KP2 A;  2IBD A;  1UMQ A;  2OBP A;  3O8G A;  3GEZ A;  5EG0 B;  1EH6 A;  1Z9C A;  3SDG A;  2BW3 B;  4MTD A;  2LKX A;  1X1C A;  1BJA A;  4CHU A;  3I71 A;  3C18 A;  4XIC A;  1WH7 A;  3LSH A;  2JUG A;  2BHY A;  2Q2E A;  2L7M P;  1FBQ A;  2R7D A;  2A6T A;  5DM7 F;  4BYY A;  3GTM J;  4LK1 F;  4G6Q A;  4DYR A;  2QZ8 A;  3WTW C;  1IN8 A;  5C44 J;  5B66 C;  2JTV A;  3OYH A;  4E7J A;  1R5H A;  4MIM A;  4JQF A;  4H0E A;  1R36 A;  3OIP A;  3JRC A;  3KP5 A;  2IEK A;  3ZQF A;  2HU9 A;  4U0Y A;  4GYI A;  1SFX A;  1PDN C;  1JXS A;  5M5X J;  3L9F A;  3FMR A;  3TGN A;  4UNO A;  2F5D A;  2QLZ A;  2NS7 A;  1EA3 A;  4QLC U;  2GAU A;  5FKN A;  1I3Q J;  4KIS A;  3VYR B;  4GYG A;  1UB9 A;  1OYY A;  3N05 A;  1T38 A;  1BN5 A;  4HQE A;  3HJE A;  1AOY A;  3ZXS A;  5GAD J;  4N9I A;  1RKW A;  5DEQ A;  4CH7 A;  1IO2 A;  2RNG A;  2VXD A;  2LR8 A;  4XLH A;  1ZR4 A;  4HLY A;  4XK4 A;  2BY0 A;  4UVB A;  2HVR A;  4L9N A;  3GFM A;  3OYK A;  3D1N I;  1NG7 A;  4RM2 A;  1TW3 A;  1XTA A;  2E1C A;  6PAX A;  3PSI A;  1FTT A;  3GUD A;  4EJW A;  2CRG A;  2QGU A;  3DFG A;  4LMY A;  2NS0 A;  2X1D A;  3L00 A;  2KDZ A;  1D0X A;  4FT8 A;  4PJM A;  2JJ7 A;  3FBN B;  4CCO A;  1OR7 A;  3TW7 A;  2VKH A;  1ZRC A;  1BIB A;  1T95 A;  1TQM A;  2YPR A;  4RAG A;  3LOC A;  3D5R C;  2QSH X;  2IT0 A;  2QQA A;  3BDD A;  2K02 A;  2GA2 A;  1LEB A;  3SFI A;  3D0S A;  3S1R J;  2TRT A;  1LE8 B;  5BQT A;  2P81 A;  1JGG A;  2L9N A;  2PFB A;  1L0O C;  3HHG A;  4B8X A;  5IOY A;  2LYC A;  3H3U A;  3HB9 A;  5DCF A;  3QP6 A;  3KYD B;  2RAE A;  3BR0 A;  3PM1 A;  2PMZ A;  1WJE A;  2VJI A;  4A5N A;  1U5T C;  3L7W A;  5M5Y J;  1LVK A;  4Q4Z F;  5GAH J;  1QRY A;  4XON A;  4F3Q A;  2JRM A;  3S1Q J;  1D5V A;  1RI7 A;  1Y56 A;  5D6E A;  3JCU C;  3QYF A;  2XHK A;  2CW7 A;  2VPR A;  3U9G A;  3BTJ A;  4RB3 C;  4HAM A;  5E3O A;  4HF2 A;  1XC5 A;  1JKR C;  2E5Z A;  4EV0 A;  1X3Z B;  2K7L A;  2HVQ A;  4XKW A;  1BI0 A;  1IW7 F;  4QWQ A;  4FE7 A;  3W6V A;  3A03 A;  2ZXI A;  3G71 I;  2L0K A;  3HKZ N;  1XSV A;  3MKZ A;  1Y8Q B;  1R23 A;  1XB4 A;  3TDZ C;  4MLO A;  2P5V A;  4NBQ A;  5B3S H;  4HW0 A;  5FD5 A;  2XAU A;  3MZH A;  4B4C A;  3GZ5 A;  2L7F P;  1WHU A;  2M0M A;  3FXJ A;  4JBA A;  1GVJ A;  4LG3 A;  1OMI A;  3ZR8 X;  2V6E A;  2M4G A;  4PUS A;  3GLL A;  1IDZ A;  5B1A H;  3ZQG A;  3MWM A;  4LK0 F;  3RPQ A;  3G6E I;  4E7L A;  3IV5 A;  4A3K J;  3L2Q A;  1UG2 A;  4I0A A;  1X3W B;  2KRF A;  3E0J B;  4HNU A;  2IGM A;  1X1D A;  4MEX F;  3DCF A;  3BT9 A;  4BY7 J;  2P5K A;  3C1D A;  3ERM A;  3JSO A;  3RQ4 A;  3GBG A;  1XSD A;  1DUX C;  2KFD A;  5K7F A;  1S7O A;  3CCY A;  1TT0 A;  4ESB A;  3HOX J;  3E6D A;  3QPT A;  2H8W A;  1SMY F;  5JVG F;  1R6R A;  1ZLJ A;  4KA4 A;  3KCC A;  1JTY A;  1D8K A;  3IAM 2;  5GTI C;  2EIK H;  2B0L A;  4UUV A;  1U6G A;  1U9N A;  1U5T A;  4H4K C;  3ZMV A;  1Z7U A;  4DYC A;  3HDD A;  5FKO A;  5HS8 A;  3ABK H;  4IJA A;  2R5Y B;  2ZJR F;  4DYQ A;  2M5W A;  4A2U A;  1XGM A;  2FOK A;  2VBW A;  2K9L A;  2PN6 A;  2WTE A;  3U1D A;  2XIG A;  2X6Y A;  1D3Y A;  3LQQ A;  3A0H C;  5EDN A;  2EFQ A;  2F6C A;  2A3S A;  4ZC3 A;  1G8X A;  1FBS A;  3FDY A;  2GZW A;  3DQV C;  3LSM A;  3S8P A;  2DBB A;  3HHH A;  4X0G A;  1MDM B;  1J75 A;  3CMY A;  3IH4 A;  3OS0 A;  2KIM A;  3W3C A;  3OSF A;  2Y75 A;  4W97 A;  1I3A A;  2PI0 A;  3GTP J;  1E0E A;  4YFK F;  1OYI A;  1O57 A;  2CWE A;  3BCA A;  3NWS A;  4F7Z A;  3L2U A;  5K1Y A;  2BYV E;  1FYL A;  4BEH B;  1G59 A;  2Y0M A;  1X2N A;  1Z6T A;  3EUK L;  2Y31 A;  2L7Z A;  3ULQ B;  2VQG A;  4HQM A;  3X2Q H;  5A2Q Z;  2W7N A;  1ONV A;  1SFE A;  1ITY A;  2ZSH B;  5LD2 C;  2BXY A;  2QQ8 A;  3BJ6 A;  3RYR A;  1FYM A;  3QU3 A;  1QQI A;  5IT9 K;  1KQ9 A;  1GV5 A;  1IJW C;  1FYK A;  3HRS A;  2XV4 S;  2P0W A;  3ZGK A;  2GOM A;  2EBI A;  3I5U A;  4B09 A;  4LFU A;  3KP7 A;  4HNV A;  3PUB A;  4A3I J;  2I10 A;  1UHM A;  1RKT A;  1AWC A;  3T1B A;  2K5C A;  5FGM A;  1W36 D;  4PGH A;  1WVR A;  3FMS A;  2PMZ N;  2WAQ A;  3OYF A;  1K78 B;  3LSI A;  2K27 A;  4ZDO A;  5CQG A;  5DM6 F;  1XD7 A;  2IVM A;  4AIH A;  2V7F A;  4PJ0 C;  3Q5F A;  4IQ4 A;  3A0B C;  2GA1 A;  3GTL J;  1OCC H;  4E7I A;  2WAD A;  4L5E A;  5JVT A;  5CVJ A;  2EB7 A;  2PMU A;  2R7U A;  3FM3 A;  3OOP A;  5LEJ A;  3VEP A;  1T6S A;  1VQ9 I;  3CF5 F;  2A07 F;  2DA2 A;  3L2W A;  5K5Q A;  4IKF A;  3ECH A;  3KFW X;  1FIA A;  4ZYA A;  4A93 J;  3R60 A;  3KLO A;  2DMQ A;  2XKP A;  4FX0 A;  1R4N B;  1JKP C;  3CMM A;  1T98 A;  4J00 A;  3GTG J;  2VUM J;  2EV5 A;  3GWZ A;  2WC2 A;  2H09 A;  2IPQ X;  3RJP A;  2WV0 A;  3LNQ A;  2R92 J;  4BAC A;  4XID A;  4I02 A;  1YX5 A;  1JKQ C;  4XOT A;  2EPF A;  2HKX A;  3OMY A;  4G7Z F;  3CUQ C;  3KZY A;  5E1W A;  4NC8 A;  1OPC A;  2F4M B;  4CCL A;  3DU5 A;  5EGO A;  2L9S A;  3S93 A;  3BZK A;  4CCM A;  3OR1 C;  4GCV A;  1G3S A;  3MQ0 A;  4Q48 A;  3TO6 A;  3WHB A;  1KZH A;  1MIJ A;  2E7W A;  5E20 A;  1HBX G;  1D1B A;  2FF4 A;  4MHG A;  1TP4 A;  1NK2 P;  1SFK A;  2FOW A;  4RGX A;  3LSG A;  2QUF A;  3H1C A;  5HDG A;  4LOC A;  5CJ9 A;  1LEA A;  4BQQ A;  1JE8 A;  2VAS A;  2L54 A;  1U9O A;  2BVM A;  2HNH A;  2RVC A;  5CYV A;  1FBU A;  1ZGW A;  4BBR J;  1B8I A;  2IS4 A;  1R5I D;  4EEF G;  2VBZ A;  1WQ2 A;  3PNY A;  3F6V A;  3JRE A;  2R5Z A;  4G12 A;  5EJC A;  5ILV A;  1N77 A;  4EJV A;  4BGD A;  2LH9 A;  2ZJ2 A;  2LLK A;  2XGE A;  3ZCO A;  2F5E A;  4UXN A;  4A5M A;  3L2C A;  1G2H A;  2STT A;  3UNG C;  5ED4 A;  3CLO A;  4Y4R A;  1E3O C;  3D5L A;  2ZXJ A;  5TGT A;  1OCR H;  2E60 A;  3EQL F;  1D0Y A;  1TT5 B;  3BG5 A;  2XRO A;  1FP2 A;  2CG4 A;  3QOE A;  2VOP A;  2VJ4 A;  5CVV A;  2JK3 A;  4AC0 A;  2E71 A;  1VFC A;  2CV1 A;  2K9N A;  3RI4 A;  5L3G A;  2EK5 A;  3CUQ A;  4YIF A;  4OOI A;  1HW5 A;  1ODD A;  5D8K B;  1NG6 A;  1X4O A;  1KU3 A;  1MSE C;  5LGU A;  3CTA A;  2WA0 A;  1IN7 A;  2RQP A;  3DXJ F;  3IWF A;  2LY9 A;  2O8X A;  4LJZ F;  3EYY A;  4CZC A;  3GX4 X;  4Z2Y A;  1GXQ A;  1ZEL A;  3MEX A;  3ISP A;  2DMP A;  3MZ8 A;  2DPD A;  2JA8 J;  1R9T J;  1R58 A;  1BR4 A;  2LRD A;  3W6J B;  4WWC A;  1S29 A;  1FX7 A;  2DT5 A;  5DS9 A;  2JSC A;  5BPI A;  3M4O J;  3N97 A;  3EYI A;  3CUO A;  2JWT A;  3RKW A;  4JK1 X;  2WAQ N;  1VQ7 I;  4HPQ A;  3TOA A;  2JN6 A;  3ZQC A;  2E35 A;  2FNP A;  1Y0U A;  3F9K A;  1V5E A;  2MFZ A;  1ETV A;  3S15 J;  2XB5 A;  3A01 B;  1SFO J;  1OCZ H;  1ZGA A;  1P2F A;  5JR3 A;  1WKM A;  3CCE I;  2Z16 A;  3RPU A;  2YX7 A;  2HTS A;  2R7V A;  3I4M J;  4ESF A;  1IN4 A;  1QPM A;  5F0H A;  3K6G A;  1WJD A;  2JSP A;  3O2P E;  4IRG A;  1YRN A;  4RMN A;  4PK4 A;  1K4T A;  4C30 A;  2LNB A;  3WHC A;  3M8E A;  1IXC A;  2JA5 J;  2HOT A;  2KJB A;  3KP4 A;  2NVU B;  4M9S A;  3DPU A;  2NNY A;  2XRN A;  3BQZ A;  3VYT B;  5EF6 A;  3C3W A;  1GDT A;  4DIQ A;  2LP0 A;  3FX3 A;  4L18 B;  2P7C B;  1DU0 A;  3OY9 A;  1UJ8 A;  4CYC B;  3WOD F;  1LFU P;  3BP8 A;  1FY7 A;  2KRC A;  5FD6 A;  2CSO A;  3S3M A;  1P9Q C;  4GO1 A;  4KMF A;  3VFZ A;  2HQ5 A;  4X1E A;  3HL2 A;  4KNY A;  4BXU A;  2E1M B;  4FTH A;  2DXI A;  2O7O A;  2EZI A;  2A61 A;  3ZRG A;  4XN3 A;  2VON A;  4HZF A;  1ZN2 A;  1MW7 A;  4EM0 B;  4BJT A;  3DLA A;  1WZ2 A;  4KMU X;  3BY6 A;  1R00 A;  4IO9 F;  1W1W E;  4IVN A;  2Q8K A;  4UUS A;  3QQA A;  2E34 A;  3BR1 A;  1FC3 A;  1Z1D A;  2XPV A;  3ZQ7 A;  4E6K G;  4YG2 F;  4IHV A;  3GZN B;  2PG4 A;  2ELH A;  2HR3 A;  1SFU A;  3SZG A;  3H36 A;  1MBE A;  3DTE A;  1O4X A;  1BC7 C;  3HIF A;  5D4S A;  2HKO A;  4HDU A;  1X1B A;  4A6E A;  3J81 K;  3K70 C;  1U8R A;  1CF7 A;  1XDS A;  2RV8 A;  4JX5 A;  3BTC A;  4Y33 A;  3RIR A;  1BIA A;  4XKB A;  2VKD A;  2QQB A;  5HS9 A;  1MZB A;  2ADU A;  2FQ3 A;  3FIW A;  5HS7 A;  1UHW A;  2FEZ A;  3EPZ A;  1B72 B;  1MH4 A;  1JJ6 C;  2PBI A;  2HS5 A;  2KLO A;  2OV7 A;  3DTK A;  3K4K A;  2K9Q A;  2NOG A;  3C2H A;  4LGW A;  2ZME C;  2XC7 A;  2VQC A;  2VT2 A;  1QHH D;  2NVY J;  2KIS A;  2V26 A;  3JW4 A;  2KJC A;  2UWM A;  1PUE E;  2LG4 A;  3QWL A;  2CH0 A;  3ABM H;  2DMN A;  4KYW A;  3S2H J;  2HVS A;  5HNH A;  4LLN A;  4GDF A;  3ZOB A;  2QKM B;  1MGT A;  2CFO A;  1K4S A;  1ENH A;  2NVQ J;  1AU7 A;  4OMY A;  1O3R A;  3BZC A;  4XLE A;  3K69 A;  1TWF J;  2X6X A;  5BOX A;  4PSX A;  3SHF A;  1ZK8 A;  2F4O B;  2O5R A;  2ECB A;  5LRR A;  1QZE A;  4CYD A;  2KRH A;  1B59 A;  2FD5 A;  4G9Y A;  4Y3O A;  5B5E C;  1MJ9 A;  1UEL B;  3K9T A;  5DD4 A;  1A6Q A;  4J19 A;  3MAJ A;  2XDV A;  3C7J A;  3KP6 A;  1F9N A;  4V2G A;  4P9U A;  4PZJ A;  2M1B A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  1WJE A;  4PJL A;  3TBI A;  2VJI A;  3I3L A;  3E1S A;  3OL4 A;  4P1W A;  3KEY A;  1LVK A;  4DGW B;  4XON A;  4F3Q A;  1Y56 A;  3MKW B;  3CZ6 A;  2VJ5 A;  4F93 B;  3QYF A;  3L2R A;  2CW7 A;  3HPG A;  4RLQ A;  4E7Z A;  3K70 D;  2OC6 A;  3LSK A;  1J09 A;  2E5Z A;  2IS1 A;  3VWB A;  4RLF A;  2HVQ A;  4XKW A;  3J7A Y;  3CP2 A;  3DPT A;  1DGW Y;  5CPR B;  2ZXI A;  2V1N A;  4XKC A;  3MKZ A;  4E7H A;  2IS6 A;  4MLO A;  2F5V A;  2X1C A;  4XN0 A;  1TZL A;  1YE9 A;  2XAU A;  3H9J A;  4F52 A;  4NNJ A;  3K4C A;  4LIU A;  3QYE A;  2M0M A;  4LG3 A;  3AL0 B;  3ZR8 X;  2V6E A;  2M4G A;  4PUS A;  4F91 B;  4LIT A;  3OWT A;  4E7L A;  2BVL A;  4DBR A;  1YX3 A;  3L2Q A;  4C2U A;  1WJC A;  2Q2E B;  3CF2 A;  3E0J B;  3VSL A;  4HNU A;  2IGM A;  1X1D A;  3K4L A;  3L2V A;  2WY7 Q;  2MAB A;  1WJ5 A;  3GBG A;  3RQ4 A;  1WJB A;  5JHF A;  2PJR B;  2KQR A;  3H5R A;  3HOS A;  2HPM A;  1WJF A;  1TT0 A;  4B3X A;  3KX2 A;  1R6R A;  2K9M A;  3IAM 2;  4XLC A;  2PJR A;  3PFY A;  3DWL E;  2CUZ A;  2V9K A;  2WAF A;  2W1O A;  2QKL B;  1S9H A;  3HC7 A;  2KHM A;  4H4K C;  1W36 C;  3OOU A;  4XR6 A;  4II3 A;  2R7R A;  4II2 A;  2IS2 A;  4HG2 A;  2K9L A;  2W00 A;  4B44 A;  2X6Y A;  2GOX B;  2IXS A;  4QPO A;  1D0Z A;  4CCJ A;  2X51 A;  3DEE A;  1MMN A;  2LC2 A;  1N78 A;  2VB6 A;  2F6C A;  2R7W A;  4ZC3 A;  1G8X A;  3BLY A;  3FDY A;  3DQV C;  3LSM A;  3S8P A;  4X0G A;  2E5N A;  2VL8 A;  1Z3Y A;  3OS0 A;  3S3O A;  4XOP A;  1FMV A;  3W3C A;  4BS9 A;  3EUH C;  1QU3 A;  3H5A A;  2M3A A;  4B43 A;  1E0E A;  4BDY A;  3BCA A;  3L2U A;  3NWS A;  3EUA A;  2L5Q A;  4BEH B;  1G59 A;  3A2K A;  2KL4 A;  2R4G A;  1PYV A;  3EUK L;  3KYL A;  2VQH A;  4AYB A;  2VQG A;  5HVQ C;  2W7N A;  2K3P A;  2ZSH B;  4XKV A;  5LD2 C;  4BU2 A;  5FRM A;  2IGO A;  1MMA A;  3W2W A;  4BUP A;  3OIQ A;  3OYD A;  3VYU B;  3A4C A;  2P0W A;  3DKY A;  3ZGK A;  2GOM A;  2M7A A;  2ZXH A;  4PJJ A;  4U87 A;  1D1A A;  4BQO A;  4DBQ A;  4PSW A;  3V42 A;  4XMY A;  4BE0 A;  4HSR A;  3PUB A;  2IGN A;  4HRI A;  1WFX A;  2K5C A;  3HPH A;  1W36 D;  3S3N A;  2OUM A;  2A5W A;  3DKX A;  2WAE A;  5KCM A;  1LKX A;  2WBM A;  3I9V 2;  2R7O A;  3HG9 A;  1MND A;  2WAQ A;  3OYF A;  3LSI A;  2E1M C;  4ZDO A;  5CQG A;  3H5N A;  3OS1 A;  5HNF A;  2V7F A;  3FBI B;  4IQ4 A;  3ONQ A;  4CSW A;  4E7I A;  2CUJ A;  2LY1 A;  2WAD A;  2DOA A;  2WB1 A;  3U21 A;  4RM3 A;  3H35 A;  3OYE A;  2R7U A;  3H9Q A;  1X4P A;  4R79 A;  2JVH A;  2X1E A;  2BOL A;  3NWT A;  2R7T A;  1DP3 A;  1X19 A;  3DPL C;  3UR3 C;  3L2W A;  1UAA A;  4AVZ A;  3ZQQ A;  4IKF A;  4ZYA A;  3RPU D;  2KZV A;  2VPL A;  1V5G A;  5KHD A;  2LRE A;  3AKZ A;  3CMM A;  4J00 A;  4AU7 A;  2Z1D A;  3CP8 A;  1DQU A;  3K4J A;  2MD0 A;  4F55 A;  2JA2 A;  4YEL A;  4BAC A;  1K6Y A;  1YX5 A;  1WJA A;  4XOT A;  3OMY A;  4JOM A;  2X6W A;  3MD2 A;  4NC8 A;  2DCE A;  4BQN A;  2LBF B;  4CCL A;  2MYS A;  3DU5 A;  3G2B A;  2L9S A;  3S93 A;  4CCM A;  3OR1 C;  3CES A;  2KPM A;  4ITV A;  2DT7 B;  2HQA A;  3HOT A;  1PJR A;  1D1B A;  1OR7 C;  2CW8 A;  4IX7 A;  2LBF A;  2M4K A;  4XQF A;  1SFK A;  2ZSI B;  2CV0 A;  2HZD A;  1LDK B;  3LSG A;  1VZ0 A;  1U0J A;  4ZTJ A;  2W4S A;  4ZJZ A;  4BQQ A;  2VAS A;  2RQQ A;  2BW3 A;  2BVM A;  2HNH A;  3VDX A;  4B48 A;  2VQL A;  1LFP A;  1D1C A;  1OLT A;  2KDO A;  4PFP A;  3OYL A;  3OYM A;  1SAU A;  3DU6 A;  3IP4 B;  3VSK A;  4CUG A;  3M1C A;  1QHG A;  3PNY A;  3BG6 A;  4HNT A;  4D1Q A;  2XF6 A;  4BDZ A;  3PJR A;  1DGR M;  3BCB A;  2VXZ A;  1ERD A;  1N77 A;  4BGD A;  2UV1 A;  2LH9 A;  4ZDP A;  1BOB A;  3ZCO A;  3QOD A;  2W82 A;  2Q1Z B;  2F4I A;  3IUO A;  2HPI A;  4XOR A;  3UNG C;  4FAS D;  1MMD A;  3K4N A;  4PFO A;  4NQW B;  3OYC A;  4CA0 A;  1Y6I A;  4Y4R A;  4NUB A;  3D5L A;  3PSF A;  4XLA A;  5TGT A;  3W2V A;  3OR2 C;  1UG0 A;  2E60 A;  2IS4 A;  1D0Y A;  3QOE A;  2VJ4 A;  2LY2 A;  4XLF A;  2CV1 A;  3SYT A;  2CV2 A;  3SDB A;  5HOO A;  3TMO A;  4ANJ A;  4E7K A;  1HA8 A;  2VJJ A;  3OYI A;  1NG6 A;  2LOO A;  1X4O A;  2WA0 A;  4D9J A;  4YEJ A;  1N75 A;  4XL9 A;  4E4H A;  4CZC A;  3OS2 A;  2UUZ A;  3AL0 C;  2DJI A;  3LFU A;  1MMG A;  4DJA A;  1FMW A;  4YRV A;  1ZEL A;  4C9Y A;  1MNE A;  4EAT A;  1Z21 A;  1BR1 A;  2VLA A;  2XF5 A;  1BR4 A;  2LRD A;  1T0F C;  2MC4 A;  4OWR B;  3PNV A;  2KP6 A;  3RSN A;  3H0D A;  3C2G A;  4HPQ A;  4ZDL A;  4BJ5 C;  2AQE A;  3F9K A;  5FRO A;  3OYJ A;  1V5E A;  2MFZ A;  3M8J A;  3S32 A;  3HKZ A;  2Z16 A;  4N4N B;  2R7V A;  3OL3 A;  3OYA A;  5KNL A;  3K6G A;  1WJD A;  2JSP A;  2NOJ B;  3H9G A;  5CKT A;  4CCN A;  2CS3 A;  3QYB A;  2AQF A;  4RMN A;  4PK4 A;  4E7S A;  2XSJ C;  4C30 A;  3IAS 2;  2Y0S A;  4KIT B;  4HST A;  2Z2S B;  3DPU A;  3DTI A;  4U7B A;  2L7K A;  3A1Y A;  3PL8 A;  4KJZ A;  3SEQ A;  3VYT B;  4HEA 2;  4DIQ A;  3BG7 A;  5CQE A;  2R7S A;  4OAY A;  3OY9 A;  4BE1 A;  3LMM A;  2I8D A;  2KRC A;  2IGK A;  3S3M A;  3OYB A;  1P9Q C;  3K10 A;  4ZTF A;  1KON A;  3HL2 A;  2E1M B;  2DXI A;  2VIX A;  1JI8 A;  2BW3 B;  4BL0 B;  3VYS B;  3ZRG A;  5HLT A;  4XN3 A;  1Z3X A;  1X1C A;  3K4M A;  4XNF A;  3BC8 A;  3LSH A;  3PNT A;  1MW7 A;  4BE2 A;  2FUG 2;  2JUG A;  3DLA A;  4BJT A;  3SEZ A;  2A6T A;  2ELJ A;  4N4O B;  4QPQ A;  2XF7 A;  4DOZ A;  2X85 A;  3MKY B;  2DT6 A;  2RRE A;  4E6K G;  4F92 B;  3OYH A;  4E7J A;  4JQF A;  3SZG A;  3DTE A;  3OIP A;  4BJ6 C;  1AA7 A;  4PJN A;  3RCO A;  2HU9 A;  1X1B A;  4BXF A;  3K70 C;  2HDW A;  1IRX A;  1EA3 A;  3HXL A;  4OAZ A;  4Y33 A;  3VYR B;  4KIS A;  1V5F A;  4XKB A;  3AFH A;  2VKD A;  3N05 A;  4FET A;  3MMY B;  2CMP A;  3EPZ A;  3ZXS A;  4KT6 A;  4CH7 A;  2RNG A;  2VXD A;  2WY8 Q;  4XLH A;  4P5O A;  5FRN A;  2KLO A;  2OV7 A;  3DTK A;  3K4K A;  1Z7L A;  3C2H A;  2HVR A;  4C2T A;  2R7Q A;  4LIV A;  2XC7 A;  2VQC A;  3CJQ B;  1QHH D;  3OYK A;  1NG7 A;  2M7B A;  4RM2 A;  3W2A A;  2V26 A;  3OYG A;  4IZZ A;  2UWM A;  4GRI A;  3PSI A;  2LG4 A;  2CH0 A;  2KMU A;  2L2O A;  2HVS A;  5HNH A;  2JVG A;  3TL4 X;  3D5S C;  1BR2 A;  2QKM B;  2CFO A;  2X1D A;  1D0X A;  4PJM A;  4IQJ A;  3K4B A;  3FBN B;  4CCO A;  2VKH A;  2ZFU A;  3LL7 A;  4XM3 A;  4J01 A;  1T95 A;  4XLE A;  2X6X A;  3RTR A;  4PSX A;  3D5R C;  4BEH A;  3CJR B;  2O5R A;  2R7X A;  1GLN A;  4NC7 A;  5LFA A;  3HUG B;  2KRH A;  3FHN A;  4Y3O A;  2L9N A;  4B47 A;  4G6T B;  3OYN A;  1UEL B;  2LYC A;  2V4J C;  1X1A A;  2XDV A;  3FKJ A;  4CCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...