2CUJA

Solution structure of swirm domain of mouse transcriptional adaptor 2-like
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGIDSGLSPSVLMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional adaptor 2-like
molecule tags Transcription
source organism Mus musculus
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cujA01
2DCEA 2AQEA 2AQFA 2ELJA 2CUJA
chains in the Genus database with same CATH superfamily
1ZR4A 2CUZA 1X3WB 2FBKA 3GFLA 2OCEA 1BR1A 4UUTA 1XSDA 1UELB 1SVLA 4A3KJ 1GV2A 4BQQA 3K1NA 2CV1A 4XLCA 4Y4RA 5CVVA 4P96A 3IKTA 1H9GA 1T6SA 1QA6A 2EV6A 4V19K 4E7ZA 4E7HA 3AL0B 4A3LJ 1UHSA 4NC6A 2Q2EA 1A31A 1EH8A 3FMRA 2MLKA 4XN0A 4CGZA 3ERED 4KIBA 4N4NB 2O8KA 3WHCA 4F3QA 3DBRB 3F8CA 3GXOA 4F91B 1T08B 4B4CA 1LFPA 3ZGKA 1A6QA 1UAAA 3RQIA 1DGRM 2A69F 3R4KA 5ICGA 2NVYJ 1USTA 5K5RA 3Q0UA 4JX6A 3QYEA 2FBIA 4PDKA 4YIRX 4A3BJ 2R92J 4D5FA 3MZYA 3A0HC 3K4BA 1RRJA 2O7OA 2E1MB 4EGZA 2XUBA 2GQQA 4A6DA 5HLIA 1B72A 4YIIA 4I2OA 1U8RA 1JXSA 2P8TA 3E5QA 4O6JA 5DD8A 2GAUA 4XQFA 3IUOA 4BXFA 4BU2A 4RGSA 1ZKGA 4LLNA 3BR3A 5H20A 4CZZA 5D5VB 3CC2I 4NNJA 1PUEE 1Y1VJ 2NNNA 2D2WA 2O5RA 2FNAA 4AD9A 4EM2A 2JTVA 5CVIA 4I09A 1TT5B 1K78B 1D1BA 1NG7A 2BY2A 2KT0A 4OU0A 4FX4A 3F8BA 1O4XA 3ZP5A 2KRCA 1FSHA 2V7FA 2ELJA 3K4JA 4AUXA 3V8LA 4MGRA 1YLFA 2CH0A 4U88A 3REOA 1O7LA 1XG1A 1XGMA 5J47A 2IRFG 1HW1A 2CQXA 2UWMA 2EFWA 4IF4A 3NWSA 4BY7J 3I4NJ 1IRFA 2UZKA 2IGMA 4A5MA 4HX8A 3X2QH 5ERIA 3SFZA 1IW7F 2BY3A 5M3MJ 1JUSA 2IA1A 2DMQA 1X1CA 2P5LC 1HOMA 4LJZF 3OYAA 1W4MA 3LSMA 3O6BB 2L4MA 1YHQI 3ABUA 1KYZA 6PAXA 1OQYA 3U1DA 2V1NA 2DI3A 3LFUA 4IQ4A 2L5QA 3WTWC 2LKPA 3EYIA 3IRRA 2Z5UA 1W7PD 2NS0A 2VC0A 2LOOA 1LEAA 1SFEA 4HLYA 2LY1A 3GFIA 1MDMB 1LUJB 3GVAA 3M3YJ 3ISPA 2AXTC 2OZUA 2Y9ZA 1V5GA 3SEZA 2EH3A 1T56A 3GO5A 3CJRB 4HYEA 5TRDA 3S17J 5FLXK 3TO9A 1IRZA 1NG6A 4BACA 2WA0A 1ON1A 4I0AA 5LGUA 3K7AJ 1U5TC 1HLVA 1TL8A 4M3BA 3BR2A 2CQ7A 4PCQA 3MKYB 3O8GA 2GIVA 2KRFA 3J7YJ 1IG7A 4GRIA 2DDBA 3HUGB 2Y31A 4XR6A 3G4SI 2LMDA 1OYWA 3FK6A 2PQ8A 1WCMJ 3TP3A 2TCTA 1D8JA 3L2CA 4RBOA 4D9JA 2NS8A 1D1CA 1BBYA 5HLTA 1QVUA 5HVQC 4WF2A 3HOVJ 4B1RA 3FXQA 4B8XA 4MLOA 1P2FA 4BQNA 1IUYA 2L7ZA 1ERDA 4V2FA 1ZGAA 2ZNZA 5ILUA 4FE7A 2DOAA 1K61A 3KPHA 3RTRA 3I3LA 2DMPA 2M7BA 4ON0A 1I50J 1WJCA 2KJCA 2XVCA 4ZYAA 3Q9SA 3IH2A 3KIOA 4IZZA 5DD4A 3ABTA 3A1YA 2VQHA 4Y13A 1AHDP 1E0EA 1VQKI 1D3YA 1DUXC 2L9RA 1F36A 4YELA 4XRMA 1OCPA 1HQCA 5TGTA 3RYPA 2GOXB 2DA4A 1TW3A 4JK1X 2IJLA 5GAGJ 2XAJA 5FLMJ 4A12A 2O3FA 3GTOJ 2KP6A 1RUOA 3SFIA 1JKQC 2LREA 2BXZA 2RQQA 4BKXA 2E2IJ 2DK5A 3TW6A 3I58A 2MC3A 2CUJA 4EMSA 4ESJA 4BEHB 2FUG2 4UUSB 5DUIA 2NAZA 1YJ9I 3FXLA 2W25A 1R1UA 2K5CA 1Q1HA 5HDGA 3TO6A 1K7AA 3CCJI 2CYYA 1ETXA 2E1NA 2M1BA 5KAFC 2WB1A 4EM1A 1KONA 3TGNA 3LSTA 1YQAA 4F52A 3BJAA 3FXJA 4LOCA 4OMZA 4HSRA 4WK8F 2FD5A 2LY9A 4HF1A 3GTMJ 1FMWA 2XF6A 4I6ZA 4XONA 3O2PE 3HHHA 4FCYA 2PMUA 2X6OA 5FROA 1YFHA 3UKGA 1O3QA 4QSHA 3GBGA 3S32A 3E3VA 4MQVA 2X0LA 1YIOA 4GFBA 3AKZA 2O9LA 2A5YB 2W4SA 4RGUA 4RA2A 5FD5A 4LB6B 3I9V2 4G8XA 3LSJA 3OMYA 2A68F 2Y48A 1Z1DA 4M71A 4LLLA 4EVIA 4IKFA 1JGSA 2QCOA 3QP6A 1GDTA 2PI0A 2JWTA 2DLLA 3B6CA 2ISYA 2JVGA 2QQBA 3VSLA 4M3DA 3OL3A 2IT0A 3TO7A 3LQRA 4L5JA 1ETYA 2WAQN 4W97A 3PUFA 5JVTA 3KZZA 4Y3OA 1ZQ3P 4RB1A 1NHAA 2YS9A 2EINH 2LLKA 3IV5A 1BW5A 5DCMA 4IEJA 2ZXHA 1KQ0A 2M5WA 3HDDA 3H1CA 3QAHA 2W48A 3GZ6A 1DDNA 3G73A 1HSTA 4PJ0C 2CMPA 3GFJA 2DA2A 4ESBA 2BY0A 4G6TB 1OMIA 3OOUA 2KL4A 2GA2A 3OSGA 5BNGA 3H5AA 2LF8A 1ZELA 3EYYA 1MMAA 3CZ6A 2IW5A 1JKPC 4I99C 3JRHA 1E2XA 4A3DJ 3S8PA 4PGHA 1BOAA 3SQNA 3K4LA 4DYQA 1IV6A 2IGKA 3IL2A 1IN6A 4A0ZA 3OYJA 1PUFB 1REPC 3N4MA 4CCOA 1TTYA 5HNHA 2BW3B 1JJ6C 4BQAA 4OIQF 3L9FA 1Y6IA 3S3NA 3L2UA 4KT6A 1U9OA 1KGSA 2M4GA 3E0JB 1R9TJ 4EJWA 1FTTA 2JPBA 2V26A 3PNYA 3MEXA 4AYBN 2OD5A 2HWVA 3CLOA 3KP2A 3UR3C 1MGTA 3M4OJ 2J5PA 3O8HA 4FASD 3T8TA 5J1RA 4AC0A 1G3WA 3K1PA 1HSJA 5EGOA 5FFZA 3EQLF 2GZWA 3OYFA 2FOKA 2YR2A 1VQLI 3ML6A 2JUCA 2VKDA 2QBYB 3DKWA 2M0MA 4KFCA 2EZIA 5F1RA 2WTEA 1FY7A 3G1LA 3LSPA 2O8XA 2QEXI 3I56I 3LQQA 2IEKA 1A5JA 1EKEA 5KAIC 3R0AA 1Z21A 2NVXJ 2OU2A 3G3ZA 5FO5A 3C2HA 1U78A 3H3ZA 1R58A 2TDXA 2ZJPF 2OC6A 3WE3A 2P81A 1RZ4A 1TWAJ 4ANJA 2MD0A 3H9JA 1X58A 4WXCA 4NUBA 3ZN1A 2MD5A 1VQOI 5K1YA 2RVCA 3HZJA 5IT3A 3FMQA 3DBHB 3TBIA 1U5TB 2V9PA 3I53A 4HAMA 3OY9A 2VBYA 2ZCWA 2VJJA 2HI3A 3WTYC 2MLGA 2ZFUA 2XSJC 3LA3A 2DCEA 2STTA 1OR7A 3M9AA 2ZBKA 1YYVA 1D8KA 2K9SA 2DQLA 3L2RA 2H8RA 4NBQA 1VQMI 1DQUA 2HQNA 2XPVA 2RREA 2HZTA 2LDUA 1UFMA 3ECHA 1GVDA 2XGDA 4B43A 1MSEC 4BS9A 1P4AA 1V5FA 2P7VB 3GTJJ 2HOTA 3LSHA 3EETA 1BJAA 1KA8A 2LKSA 2CG4A 4GCVA 1BW6A 3U21A 1V4RA 2K9MA 3CESA 1HF0A 2FXAA 1H0MA 1G8XA 1S9HA 1QZEA 1HDDC 1N78A 4LG3A 2OTJI 4HZFA 4BJ5C 2M8GX 1ZYRF 3V4GA 1USSA 2Y9YA 4G6DA 2BBYA 1IUFA 1U3EM 4HF0A 4IHXA 3KP4A 2DFFA 1XDSA 3P9IA 2CV2A 4LK1F 4IX7A 5IT9K 2R7DA 2JN6A 2VE9A 1ZH5A 2ISZA 4KMUX 4UNOA 1QVTA 1Z6RA 1TW2A 2XIGA 3I4MJ 3TW7A 1MW7A 2BVMA 3H5NA 4OWRB 2M3AA 3TP0A 4I98B 3F0CA 2WAEA 4M6XA 5LFAA 4GGGA 2DTRA 3JAMZ 3QPTA 5JLWA 4R8HA 3ESWB 3JREA 5ICCA 1Y0NA 2BHZA 1VQ8I 4WX9A 2VI6A 1G2HA 4RAFA 3BOQA 3H92A 2XKOA 5GTHC 1YS6A 1RETA 3PSIA 3SYTA 2DOFA 3U1KA 3OSFA 1VFCA 5D5WB 2K02A 2ECCA 1P6RA 2EA2A 2STWA 2YU9J 1T0FA 2RGVA 1ZK8A 4P55A 2F5DA 3K4NA 1MH3A 4CCLA 5L3GA 2DPUA 2FSWA 3QU3A 4ZH4F 1WVRA 2IXSA 4PSWA 4EATA 1FOYA 2JPCA 4IHYA 3VYTB 4AYBA 5IOZA 4Z2YA 4M3GA 2CV0A 1FP2A 2H1LA 3HHGA 1FC3A 5EYRA 1W1WE 1JT0A 1UMQA 2QQ9A 2NVTJ 2BE5F 3WGGA 4L18B 1VQNI 4DW6A 1POGA 2XPUA 1Z91A 2A6EF 4CDGA 1SAUA 1R5HA 4XORA 4KICA 3HKZA 1X2NA 2L01A 4NDLA 2QUFA 2HXOA 3GWZA 3L00A 1YW8A 4I0BA 2KKOA 1HKQA 2RV8A 3EUHA 3CJNA 4DJAA 2CQQA 2MYSA 3L09A 3ZQIA 1ZARA 3DBLB 2OV7A 5L3DA 4V2GA 1FIPA 3G71I 2R5ZA 1WSUA 2XRLA 2Z9OA 4IRIA 1RNLA 1UHWA 5FD6A 2M0CA 5L3BA 3VYRB 3JTGA 3GZ5A 2R7XA 2R4GA 3I59A 3GTGJ 2Z1DA 3F6OA 5DEQA 3WTXC 1YO5C 1XGSA 4KN7X 1V5EA 2VN2A 2XAGA 4M72A 3W6KB 2LD5A 3CCUI 4RM3A 2VT2A 1RR8C 4FX0A 3HBLA 1P4XA 5J8FA 2CSOA 1SVMA 4QIWN 4A0YA 2R7VA 4BBSJ 2QQAA 3F3XA 3G2BA 4HDUA 5LGNA 1BL0A 1WH5A 1ZRDA 1PYVA 3D0SA 2VLAA 1ZLKA 2M9HA 3KP3A 4U0YA 5JR3A 2JZYA 2W24A 3SZPA 2HPIA 3SHFA 1FT9A 1D0ZA 2F5CA 4CYCA 4AVPA 4PJLA 3T5XA 3GMEA 3OYGA 2PJPA 2PG4A 2ZFWA 1LPQA 5GPAA 4RDUA 3BDDA 3N05A 2R5YB 3Q0WA 2VKHA 3B73A 2CO5A 4LITA 1W0UA 4M9SA 5FB2A 1YTYA 2WY8Q 1AA7A 5LEKA 4TV7A 2V9VA 1UZCA 1R49A 2DFHA 1YX3A 3CUQB 2WAQA 3AFHA 2HOSA 2H27A 2XAHA 1R71A 1Y0UA 2AS5F 1WQ2A 3G1OA 2VB6A 4B47A 2Y0SN 1FYKA 2CQNA 1ZG3A 1OCOH 5DS9A 2FMYA 3J81K 1IN7A 3EUKL 4RB0A 2KRHA 4IHWA 4A0XA 1G3TA 1WFXA 1TQMA 2L7FP 5DUKA 2HTJA 5J4VA 4U0VA 2UV1A 2LBFB 5LD2C 5CQEA 4JBAA 1YRNA 3DF8A 3LA7A 5DV5A 4Y7NJ 1SD6A 2RNGA 1R1TA 4CCNA 5E17F 3BJ6A 1STZA 2M30A 2HOEA 4IPAA 5TJJA 1P4WA 2CWEA 3DCFA 5B66C 4P5OA 1GVJA 3FXRA 5CPRB 2I5UA 1SC7A 2PMHA 3TEDA 5E1XA 3RJPA 1FNNA 1RESA 1UB9A 3GF2A 1LE8B 2QENA 1JE8A 2ZXJA 4NQWB 3Q3SA 4EM0B 1P7IA 2E71A 1I1GA 3PO3J 3JRAA 2P6TA 2V1XA 1IJWC 3ZPLA 3S2HJ 4Y15A 3MMYB 1I5ZA 3QYBA 5EEGA 1WJDA 2L7MP 4UVBA 3C3WA 2XAFA 5EZGA 3FXKA 5FKMA 2OJED 4CA0A 2JA6J 1CGPA 3M7GA 1YJNI 1JHFA 1ULYA 4ABZA 2QA4I 2BHYA 1LEBA 1KQ8A 3VDXA 2EFOA 3M8JA 3CMYA 1D5YA 2KISA 2A07F 2VQLA 1K4SA 1IGNA 3SJMA 5ILVA 3GCMA 3KLNA 3RQ4A 2YSRA 4HV5A 1ZHFA 2K4BA 4CYDA 3I54A 2L9SA 3BG6A 4HSTA 1OR7C 4BE2A 3DPLC 3OS0A 1IN8A 2XRNA 3OYLA 3QP5A 4RAZA 3CTAA 3BLYA 4ZDPA 1J7KA 5GAHJ 2ID3A 1J0RA 2EA4A 4C2UA 2IAIA 2K7LA 4XRSG 3WG9A 3QPSA 1MJAA 1MMNA 4YEJA 2K40A 2F2EA 3FK7A 4RMNA 4RM2A 2LF7A 2R7TA 3TL4X 4AWXB 2IS1A 2P5VA 5M3FJ 1U2WA 1IRXA 5BPIA 3K70C 1Y8QB 1FBQA 4C2MJ 1MDMA 1W5TA 3RCOA 4FISA 1K4TA 2FRHA 1YS7A 4BJ6C 4EJTA 4QPOA 2VJIA 3PJRA 1WJAA 4YFNF 1HBXG 1XSXA 2I10A 3P5JA 3BR6A 3P9CA 5JVGF 2CW0F 3I64A 1O3RA 1R7JA 3WTVC 2MC4A 1XN7A 3BY6A 3ZQ7A 4E7LA 1I3QJ 2EFNA 2G0EA 3TDZC 4ASNA 2EIJH 2L2OA 2EK5A 4KT5C 3RPUA 1FYLA 3HUGA 4KJZA 3C1DA 2DO7A 3E6MA 4HNTA 1DU0A 5DM6F 4UUVA 3ZQGA 3GYHX 1RC9A 1XGNA 4LK0F 3CC7I 1OPCA 2EIKH 4ZTFA 1Y56A 2HU9A 2VBWA 2B0LA 3I71A 4II3A 3TOAA 3CMEI 2YUSA 5L3CA 3IAS2 4L0ZB 1RPWA 2PJRB 1J5YA 1UHMA 2K9QA 3HRUA 1Y39A 3K2AA 1CF7B 3ZQCA 1ZREA 1X3ZB 1FOWA 1YX5A 2DT6A 1FBUA 4HBLA 4G7OF 1Y8RB 3CCLI 5FKOA 3CCYA 4PK4A 2P0WA 3IHUA 3F9KA 4PZJA 5IP7J 5KVRA 4A3EJ 2XPWA 1A35A 5A2QK 5FJ8J 3K70D 1PP7U 2XF5A 1QHHD 5B3SH 3HG9A 1BI3A 2AQEA 3HB9A 5LEJA 4BNCA 1FSEA 2OTLI 2ZSHB 2F48A 2OF7A 4XBFA 1T2KA 4BBRJ 1J9IA 2Q2EB 2GLOA 3DU5A 1F5TA 4XM3A 4B3XA 5B1BH 3E97A 4XLNF 2L9VA 4UVAA 2E1CA 1R22A 2DA6A 3HM5A 3RPQA 4HF2A 1T38A 1BI0A 2EQRA 4YRVA 4XMYA 4RGRA 5IYBJ 1Y1WJ 5JFRA 1N75A 2WV1A 3FIWA 3I0TA 3HOSA 2XHKA 2W1OA 3VYUB 4A5NA 3VSKA 1IN4A 1JKOC 3BC8A 1ZN2A 2UUZA 1XTAA 2HQAA 2NVUB 5EF6A 2JUGA 5E3NA 2MSYA 3J7AY 4PFPA 2EFPA 2OAZA 2FNPA 4UUSA 4A3IJ 1G59A 2WAFA 1S29A 4PSXA 2CUFA 3S1MJ 2XROA 1B72B 1TWFJ 1B4AA 1NH3A 2HR3A 4HA8A 1RR7A 3E6DA 4Y17A 3T0YA 5K5OA 3K4KA 2B7EA 3CLQA 2LP0A 2QSGX 4JP0A 5LRSA 5CLSA 1KU2A 4LG0B 4E6KG 4MFDA 2ME0A 2UXXA 1OCRH 4YFXF 3W6JB 3F21A 2E35A 2DU9A 2W57A 4J19A 1O3SA 3CCQI 4EJOA 1SD7A 1B8IB 3OIPA 3F23A 1F43A 3E7LA 2WADA 4PJMA 3TKYA 5F64A 3Q5FA 2HYGD 2K3PA 4DYRA 1JGGA 4L5EA 2CRGA 1LB2A 4BH9A 3RKQA 1RIOH 5B5EC 1DP7P 3HPHA 1JTYA 2QKMB 1IO2A 3AG2H 3V7RA 1OCZH 3DXJF 1F1ZA 3DU6A 3CCSI 2BXYA 1ON2A 4C2TA 1ZG1A 2PMZA 4RB3C 2MGQA 3GLLA 3OL4A 4BXUA 3CMAI 1F4KA 1X1BA 3AAFA 5LRRA 1RKTA 3MN2A 3RI4A 4PUSA 3FDYA 3KYLA 2FU4A 1A04A 2O0YA 5HLGA 4U7DA 4KN4X 4ENNA 3HRMA 2VBXA 1HCRA 1KYWA 2ZNYA 3BR0A 3VEPA 2JA2A 2Y0SA 4EQQA 4M3FA 4EEFG 3K9TA 2A05A 3FF5A 2HYJA 3HGYA 2Z3YA 4UB6C 5JI6A 2QSFX 2JA5J 1I39A 2EZKA 2LFBA 3Q0VA 2DA3A 4AIDA 3OS1A 1SFUA 3AG1H 2EPFA 2GIZA 3DP7A 1I6HJ 4MEYF 2AHQA 3KP5A 1GT0C 2DMUA 2FX0A 4D5CA 1MBKA 3ABKH 5LLQA 1FLIA 2HZDA 2WC2A 2BVLA 4GXOA 2DFIA 4Q47A 5LGTA 2GXGA 1LNWA 1P7JA 5FRNA 1Z7UA 4CUGA 5K5QA 2A6HF 3IP4B 3ZMSA 1TP4A 5F08A 2BW3A 3GTLJ 4YG2F 4A3MJ 1OJLA 5HNFA 2V6CA 3PNVA 1TZLA 1XX5A 2EV5A 2EZHA 4I02A 5CYVA 5DDGA 4XKBA 2M4KA 3RZDJ 2IVMA 3S2WA 4R79A 3IWFA 2X51A 2J5OA 3MKWB 5IPAA 3Q9VA 5KHDA 4FE4A 4AIJA 5C4XJ 5E20A 4GO1A 4WXDA 4A93J 1N25A 1LKXA 1MJ9A 2LK2A 1SANA 2L3DA 4JQFA 3CCRI 1S72I 2CUEA 2G9WA 2VPLA 2LTPA 5E8IA 2K3FA 3VFZA 2GA1A 1R4NB 1TBXA 3IWZA 2P4WA 3KEYA 4Q4ZF 3NQOA 1EF4A 3SDBA 1DU6A 4N9HA 1X1AA 1OCCH 3M8FA 1FX7A 3ABMH 2H6BA 2E1OA 3OOPA 3BTLA 5IOYA 4S04A 2YPRA 3QRFF 4XLFA 3F8FA 4P9UA 1TWCJ 1BM9A 1SD4A 4L9JA 2A5WA 2LNBA 2MA3A 5EDNA 3V7SA 5C44J 3ZRGA 2MH2A 3TDUC 4II2A 2X6WA 1LFUP 4F92B 3BZKA 5HDNA 5FRMA 2A61A 2W00A 2QKLB 4ENKA 1ETQA 3CMMA 2FBHA 3S14J 1N77A 4HRIA 1FEXA 1GXPA 1KQ9A 2B63J 4KNYA 2IS2A 3D5LA 5J1UA 1KU3A 2V1UA 3MKLA 3HGGA 2HS5A 4EGYA 4A2UA 3JSPA 4O5VA 3M1EA 4OIRF 3FM3A 3PSFA 3GUDA 3BZCA 2ZJQF 3MAJA 3PM1A 4IXAA 2A3SA 1WI3A 2K27A 5J8CA 1TLHB 3IH4A 2V79A 4U87A 3I4PA 5J6XA 3CCEI 5DCFA 1D5VA 3JRFA 2NXNB 1SAXA 2M45A 1X1DA 3CF5F 1BI1A 1U9NA 3ULQB 3DPTA 2DBBA 1HC8A 1ETKA 1E3OC 4DYCA 2NS7A 4IHSA 3RYRA 1I6XA 1QZZA 3OYNA 2H1KA 4CCJA 3HOYJ 4QTRA 4LLGF 4BYYA 2D1HA 1QGPA 5D6FA 3BTIA 2CQKA 3CC4I 2GBYA 5CVJA 1QU3A 4IRGA 2BY1A 2WWYA 3KEQA 4EV0A 4MTDA 3H0GJ 3V8KA 2EWNA 2OA4A 4AU7A 1R5ID 4HPQA 1WI9A 3A4CA 2V9KA 2ESHA 3AL0C 4XNFA 3JTHA 4HX7A 3LOCA 1I3AA 4UXNA 4Y33A 3ROUA 3C18A 4MEXF 3J80K 3RPUD 1FIAA 1ZLJA 4B09A 4MFEA 4XICA 1X1PA 2E34A 5GTIC 2HKOA 2HQRA 3H36A 3NRVA 2VXZA 2EILH 1S6LA 2VODA 2DT5A 4R1HA 1IF1A 4G6QA 2HTSA 1H9TA 2LRDA 1K79A 2V6EA 2Y2ZA 3FM5A 4P9FA 3VOEA 4CHUA 2FJ1A 2VQGA 2KMUA 5EEAA 3ASOH 1JUPA 3B6AA 1OFCX 2LR8A 2HVQA 3BTCA 3QOEA 3WGIA 3B02A 4F93B 2A6TA 3DTIA 3HKZN 1SFXA 3V42A 1TT0A 4OAYA 2RDPA 2CJJA 4AIKA 4OIPF 4G7ZF 5FGMA 1AKHB 2KPMA 3MKZA 3J80Z 3FX3A 1W7PB 2LC2A 4U7BA 3ZMZA 3H9GA 1G3YA 4LD5A 2ZMEA 1E17A 1V55H 2E36A 3FXOA 5BOXA 3WHBA 2L4AA 3OIOA 4ZDLA 3OYHA 4P1WA 4HQMA 2KIQA 2TRTA 4XK4A 5JHFA 1F9NA 1LDDA 1G3SA 1J59A 1BR2A 2JRMA 2QWWA 4Y52J 3F72A 2EZLA 1DPRA 5AIPA 1OYYA 1YW9A 2M87A 5B1AH 2W7NA 3T8RA 5EGOB 3CCMI 3KYCB 3V8JA 4PJNA 4MO7A 5D5UB 4G12A 4QLCU 2DYSH 2IA2A 4UV9A 1JI8A 2EJRA 4FTHA 4HW0A 4DNCA 4FQGA 2R3SA 3HIFA 2DDAA 5FLVA 2K4JA 2XGXA 3W2AA 2E5ZA 2M2EA 1QBJA 3IRQA 3SXYA 1KU7A 5HLHA 2XGCA 1U6GA 2CFOA 3CUOA 4LIUA 1FYMA 2OZ6A 4OAZA 2COBA 1VTNC 2MBFA 5CVUA 1ETVA 3TOBA 3DKYA 1S7EA 2GXAA 2ELHA 3F8NA 2V1DA 3KFWX 1K6YA 5K7ZA 2RNJA 4N0BA 4PFOA 1U5TA 2I8DA 2JSPA 5D8LB 2F4IA 4ZYDA 2M34A 4CICA 1H8AC 2LKXA 4AVZA 3OWTA 4EJVA 2L02A 1XSVA 4X6AJ 4DQ2A 3PIOF 3NWTA 3J7ZI 2VPRA 4CH7A 3CUQA 3OS2A 1FOKA 4IHTA 1JHHA 1S8NA 3OYMA 2VASA 3E1SA 3OYCA 3G6EI 3GTPJ 1VF9A 3A02A 5GP9A 3VWBA 4NB5A 1QPIA 1IXSB 3JW4A 4XOTA 1TNTA 4ZYGA 4KA4A 5AIQA 1SFOJ 2H09A 1WJEA 2NRAC 1ETWA 1IDYA 5FLXZ 1FJLA 1MBJA 3WU0A 3LA2A 1XDUA 2LY2A 4FHTA 2ELKA 2VL8A 1IXRC 4CSWA 3MVPA 5HS9A 5E18F 3DV8A 1VNDA 3JR9A 2L9NA 2R0QC 5HS7A 2XASA 2Z33A 3QYFA 3FBIB 2E2HJ 2IS4A 1B59A 3GLXA 1XGOA 3S1NJ 2WV0A 3TQNA 3NAUA 1K78A 1HW2A 1LDKB 3K4CA 4L0YB 1MNMC 2BV6A 4HG2A 4IL6C 2X1EA 3ZQFA 5EG0A 3AG4H 1LE8A 3A01B 4A3JJ 2IP2A 5J40A 5BQTA 2MABA 5EJCA 5KNLA 4ZDOA 3CP2A 1ZGWA 2RQPA 1UG2A 1FZPB 2DXIA 1W36C 3RZOJ 5FKLA 3HSEA 2IBDA 1MH4A 4RLFA 4B48A 1Z0XA 3TMOA 3FMSA 4ZZDA 1MJBA 1EJ9A 3FBNB 3DFGA 3LSIA 2KDOA 1L3LA 1YE9A 1WZ2A 3JCUC 2OPTA 2DOEA 3K0LA 2GM4A 4XLAA 3BJOA 1T39A 1IDZA 1QZYA 2W82A 2DW4A 4WCGA 2Y69H 1S7OA 3QU6A 3D1NI 1M1EB 4ENMA 2MW8A 4A3GJ 4HEA2 2DQRA 1MSFC 1MBHA 2GXBA 2HQ5A 5GAEJ 2F6CA 2K9LA 3FZVA 3S3OA 3UNGC 1ZR2A 3BZ6A 1DP3A 3HEFA 3QQAA 2P6SA 1T0FC 3ERMA 1XS9A 4L9NA 4XN3A 2XV4S 5D6EA 3H9QA 2DMTA 2OBPA 4BHPA 3FXUA 1X2MA 3ZQQA 1JJ8C 5HODA 3ONQA 1G6NA 1RKWA 1AWCA 3CJTB 1QHGA 3IAM2 3SEQA 2QSHX 2V4JC 1FP1D 1WJ5A 2VC1A 1WGXA 2G7UA 4UVCA 3VPRA 2AXLA 5C4JJ 4D1QA 3JRIA 3WE2A 1BC7C 2HFHA 5H6RA 2HDDA 1QRYA 2WY7Q 4HOBA 3ZCOA 3BQYA 1D1AA 4D7NA 4E7IA 4MIMA 4M74A 3I59B 4JX4A 5F1JA 3LMMA 4KUMA 4W1UA 5D4SA 3HJEA 4KMFA 3EUHC 1NTCA 1ORKA 3F22A 5CQGA 2IGNA 2RKHA 3BQZA 2EFQA 3M1CA 2FE3A 4LMYA 3GW2A 2L54A 4IOAF 2HNHA 3J81Z 5AONA 4M73A 1G4DA 2L7KA 3LSRA 3FKJA 2PMZN 3FWEA 1Z6TA 4YFKF 4CXFA 5EZHA 2NYXA 1B6AA 4Z6YA 4ZYHA 5GADJ 3ZQLA 2PEXA 4OINF 4H0EA 2COMA 3LAPA 5E3OA 4XRFA 4LGWA 4RAYA 4CYCB 5H6QA 1A6IA 3BG5A 4HLXA 1H89C 4E4HA 3EUAA 3GTKJ 2CGPA 3DPUA 2CS3A 2KDZA 1WKMA 1E3HA 3P9KA 1YJWI 2HEOA 1FPQA 2NOJB 3FHZA 3MCZA 2PJRA 5ILSA 5M5YJ 4Q5SF 1S5LC 3H3UA 4ZYEA 5JLXA 1OISA 1S7AA 1YIJI 1CF7A 4BL0B 5K7FA 2KHMA 4E7SA 2BOLA 2XKPA 1HKSA 1BIBA 4DOZA 1W5CC 2XF7A 2YX4A 2O6GE 1WRJA 2KQRA 2MFZA 2UXNA 4G7HF 2VBZA 2W85A 4M6VA 2VE8A 1WH7A 3D5SC 2VJ5A 3QPHA 4DZPA 3ZQHA 1MNEA 1LVKA 5IP6A 3E5XA 1VQ4I 3CQZJ 2X85A 4PJJA 4ZJZA 1PVEA 4BDYA 1K6OA 3MQ0A 3HOXJ 2VJ4A 3K2ZA 3ZMUA 4BXXJ 1IXCA 4L9VA 3R0JA 2O61A 3MWMA 3JSOA 2NVQJ 4UV8A 3DEUA 4KITB 4C3JJ 2EBIA 3IH3A 1HDPA 1I27A 3KCCA 3WODF 4A3CJ 3CD6I 1HW5A 3MFKA 4BE1A 3I55I 5DYMA 4UB8C 2DJNA 3QPLA 3GX4X 1R36A 2DK8A 3K10A 2D45A 3IKVA 5BS6A 2KIMA 3ZOBA 5IT9Z 2LSOA 4QWQA 1O3TA 1VQ9I 2FEZA 1LJ9A 2QM3A 2IS6A 4XKVA 4AIHA 3PQKA 3KX2A 3FISA 4ESFA 5E3LA 1HA8A 1ZGJA 1B9NA 2KIFA 4KDPA 5D8KB 1Q1VA 3JRCA 3DTKA 3OR2C 4IJAA 4QPQA 3CDHA 2JA7J 1T8IA 2JQ7A 4XKCA 1ZG5A 1B8IA 2R7WA 2QGUA 1E3PA 2DA5A 5DCMB 1JUMA 1DGWY 4KIGA 4HNVA 2DT7B 3KP6A 3W6VA 4CCMA 4FT8A 3HOTA 2VONA 1XC5A 3J7AO 2KLOA 1T33A 3KYDB 4CO8A 2GWRA 3A03A 4OIOF 5D4RA 3E6BA 3S93A 9ANTA 5HOOA 2R7RA 3G1MA 1H88C 4GYGA 3R61A 3LFKA 2R7SA 1NK3P 1BA5A 2IPQX 2R93J 2X6XA 2ZJ2A 3HYIA 4X1EA 2EV0A 4UHTA 4E7JA 4BQOA 3SZGA 2R7FA 3HOZJ 2Q1ZB 4J00A 2XB0X 1ZRFA 3RKYA 1D0YA 1K83J 3DWLE 3CO7C 3ZXSA 5FFXA 1SVOA 2EB7A 1W5SA 4BE0A 2XDVA 1XMXA 2MG4A 1ODDA 1QNTA 4BAYA 4BY1J 3DKXA 3DLLF 1AOYA 3VB2A 1Z3XA 1VI0A 3H35A 3ZMTA 2F5VA 5M5XJ 1XCBA 1YITI 4LB5A 3M8EA 1MBFA 2DN0A 3HL2A 2FQ4A 4HDVA 5EEHA 3S3MA 2K9NA 3WU2C 1R00A 4J01A 5J3LA 2AO9A 3NEUA 4L5IA 2Z16A 2KJBA 4ETSA 1Z67A 5A2QZ 2R7UA 4D7MA 2N8GA 1XD7A 3DQVC 4JX5A 1GUUA 1D0XA 5KK1A 2Q8KA 2DJIA 2VUMJ 2ID6A 2PN6A 1X4OA 2QBYA 2XB5A 5E79C 2ECBA 3KE2A 3RKXA 3WU1B 4A3FJ 1AU7A 2JK3A 4PGGA 4ENJA 2E60A 4BDZA 2WBMA 5FKKA 1C0WA 1VQPI 4IO9F 1X3UA 2RN7A 4M9ZA 4BJTA 4HV6A 2VIXA 3RIRA 2X4HA 3ZMVA 3BR5A 4KYWA 2IGOA 5E1ZB 3CJQB 2R7OA 3C7JA 2XAQA 2QQ8A 1XMKA 5F0CA 1A36A 1LFBA 3K6GA 4B3AA 3BPXA 1FTZA 4A6EA 2BYVE 4A69C 1BI2A 2Y0MA 3HRTA 3PNTA 3COAC 3BTJA 1Z05A 2ZMEC 3HRSA 4H4KC 4BEHA 3PFIA 2CU7A 1W0TA 4FETA 1SEUA 3ZN0A 2O03A 3L2VA 1IC8A 1SMYF 1IRGA 1BC8C 2HVSA 1B9MA 3ASNH 1FMVA 4OOIA 3GFMA 1O7FA 4N4OB 2CFXA 3R6SA 2XSDC 4RGXA 2K86A 1MMDA 3KZIC 4NC7A 2JA8J 2E5NA 2FOWA 1KZHA 1SMTA 3L2WA 2M7AA 5BPDA 5LBQA 3BCAA 3W2VA 4D0PA 5M5WJ 2HDCA 4XLHA 4AM3A 3LAJA 1U8BA 3BG3A 3PFYA 5J4YA 1LQ1A 3QOPA 1WHUA 2KZGA 2F4MB 4I76A 2VOPA 1ACIA 3GEZA 4NC8A 4WWCA 3LNQA 2R7QA 2ZXIA 3V7CA 4XLEA 2H8WA 2DTZA 5L3FA 1YI2I 1GXQA 3A0BC 1LDJA 2ESNA 2DAOA 1R23A 3WG7H 3L2QA 2DYRH 3BR1A 3S1QJ 4I01A 1WJBA 4MQ9F 2RAEA 2QVOA 1OKRA 4LG0A 3L7WA 3VYSB 3S1RJ 4BGDA 1L0OC 1YOVB 4XSXF 5IYCJ 3FHNA 5HS8A 1I1SA 2HVRA 4BUPA 5BMZA 1B1BA 4MNUA 3CUQC 2JSCA 4MTEA 4XLPF 3D5RC 1CQTA 2M8EA 2RC4A 1HXDA 3HC7A 3E5UA 5HDKA 1J09A 5E1WA 3PIPF 5F0FA 2F4OB 3HOUJ 1WPKA 4XIDA 3WTTC 3E6CC 5JHUA 4G94A 2ETHA 5GPCA 4N9IA 4XSZF 3ZR8X 4IQJA 4KISA 3K1MA 4C3HJ 2P7CB 3H5RA 2DFEA 3EPZA 1BIAA 4XKWA 4XOPA 3F6VA 3MD2A 2H94A 1ITYA 1V54H 2YU3A 1MBEA 3HXLA 5ICFA 2F5EA 2VQCA 1UG0A 1PUFA 1XB4A 3PUBA 3JRDA 2HXIA 3JAMK 2FF4A 2X1CA 2CW7A 2BGCA 4IOCF 1PP8F 3SDGA 1VQ5I 3HOWJ 1UCRA 1MMGA 3U2RA 3RSNA 2KZVA 3KZYA 1J75A 1MMSA 3R60A 1P92A 3KLOA 1ZTRA 4UY8I 1MD0A 3CF2A 1ENHA 4ITVA 5DTDA 3ABLH 3BG7A 4IHVA 5LHHA 3C2GA 3RDIA 2VKEA 3OR1C 1JTXA 2E7XA 2Z2SB 1T98A 3CCVI 2L0KA 1IN5A 3PO2J 3L1PA 1TQPA 1KU9A 2PFBA 3W2WA 3CDLA 1BR4A 2QYOA 1S3JA 4C9YA 1V3FA 1MKMA 3HSFA 3KEOA 1AKHA 3MZ8A 3P7NA 2HDWA 2ZMEB 2EIMH 3CDIA 5D5XB 2HYFA 3BP8A 2VT3A 2W84A 1EV7A 4RB2C 1Z7LA 3A2KA 4IRHA 1R1VA 2PLYA 2X9DA 1QQIA 3BT9A 1IAWA 3HTSB 3BPVA 2NNYA 3WTZA 4YIFA 3LL7A 5KCMA 4IVNA 4BHCA 3OV8A 1TWHJ 1XCVA 2Y75A 2XAUA 2ZB9A 3S15J 2F5FA 3K4MA 3W3CA 1VQ7I 2AQFA 5C3EJ 1HKTA 1O57A 5F6FA 5LHIA 3OYBA 1BJZA 2DA1A 2DPDA 4RAGA 3DLAA 5F0HA 3WTSC 1MBGA 3OIQA 3IC7A 2X48A 3LSKA 4M6YA 3GZNB 1SD5A 2FQ3A 1UJ8A 2HGCA 3KETA 1J2XA 2JT1A 1P9QC 2ZC2A 1IZ1A 4X0GA 1TC3C 2WB1N 5CKTA 3KP7A 2B9SA 5FKNA 3T1BA 4RS8A 2OUMA 4Q48A 2LBFA 2ZJRF 4EJUA 3OYKA 1XMAA 3MZHA 4DBRA 1APLC 2E19A 1YRNB 3H0DA 2PBIA 2D5VA 3RKWA 5IP9J 2H6CA 3HSRA 1RUNA 4U0WA 1NK2P 4DZJA 1VQ6I 1VZ0A 2OCCH 1OLTA 3JRGA 3QWLA 2ACJA 4B44A 1X19A 3U9GA 3BG9A 1FOXA 1R6RA 5IY5H 4L9TA 1PJRA 2MH9A 4NQWA 1LVAA 2QF7A 2DA7A 2KFDA 3I5UA 2ME6A 1EA3A 4C3IJ 1X4PA 1MZBA 1GV5A 2LVSA 4E70A 4S05A 4DIQA 1W36D 2BEOA 3M07A 1U0JA 5CVRA 1QO0D 2FMLA 4XRSA 2JJ7A 2E7WA 5F04A 3ECOA 3DEWA 4HNUA 2BZTA 3O3KA 4GDFA 2JRTA 3OYDA 3N97A 1GHCA 3BWGA 5E8GA 2KIUA 3LSGA 4CZCA 5J1YA 2FA5A 2DMNA 1XPXA 4CCKA 5EG0B 1MIJA 1BOBA 3ELKA 3HPGA 2OQGA 4OMYA 1QPMA 4BHBA 1BN5A 4F7ZA 3A01A 2VKVA 4XL9A 3NARA 3CO6C 2LG4A 1YW7A 4DBQA 4MHGA 2E2JJ 2ZXWH 4M3EA 3K69A 3ZMDA 2P5KA 3FKIJ 2JVHA 5CJ9A 2Y30A 3PL8A 3EDPA 3WTUC 1TWGJ 2ICWG 4K2EA 4KIFA 2NOGA 5ED4A 4DGWB 1ONVA 3WGHA 2IA0A 3AG3H 5H2FC 2HPMA 3DTEA 2VOOA 4ZC3A 1OYIA 1EH6A 3HTUA 2R5ZB 3OYEA 2XC7A 3CP8A 4ZZLA 4NHJA 4JOMA 3GTQJ 2R7ZJ 3DEEA 5F27A 1RI7A 2GOMA 4S0HB 3FXMA 4RLQA 4F55A 1ZRCA 5E3MA 2OQRA 5LHGA 4E7KA 1YG2A 1R4MB 2X1DA 4GYIA 3LWFA 3S16J 3SZTA 2QLZA 3S2DJ 4O3MA 2HOAA 2DODA 1GLNA 1Z3YA 1WJFA 1TNSA 2C6YA 3BROA 2Q0OA 1JKRC 3F8MA 2X6YA 3H3VK 1W7PA 3VODA 1MNDA 4JYKA 1FWZA 2K85A 1OCTC 1DPUA 5L3EA 2JMWA 4I7HA 2LH9A 2VXDA 4LIVA 4HQEA 2ZKZA 1EH7A 2ADUA 4G9YA 1TQIA 1ZAOA 4ZTJA 4LFUA 4C30A 3JRBA 5IYDJ 4M9XA 1R5GA 1Z77A 2XGEA 3C2BA 5K7HA 3BCBA 1Z9CA 2G7HA 5TISC 4WXHA 2CW8A 3QODA 1WWXA 2HKXA 1JT6A 2ZO4A 2PX9A 2D1VA 3OYIA 2E1MC 2ZSIB 1SFKA 5ICEA 4HX4A 1FBSA 1PDNC 3PQJA 2R5YA 1IV8A 2YX7A 2LYCA 1T95A 2Z99A 5DM7F 1ETOA 2QZ8A
chains in the Genus database with same CATH topology
2CUZA 3SYTA 3KEYA 4XKCA 3SDBA 2R7WA 1BR1A 1X1AA 1UELB 4BQQA 2CV1A 4XLCA 4Y4RA 1DGWY 4CCLA 3K4NA 2DT7B 4CCMA 4XLFA 3HOTA 4E7ZA 4E7HA 3AL0B 2IXSA 2KLOA 4PSWA 4EATA 2A5WA 3VYTB 4AYBA 3S93A 5HOOA 2R7RA 3ZRGA 2CV0A 4II2A 2X6WA 4F92B 4XN0A 5FRMA 2R7SA 4N4NB 2W00A 2QKLB 3CMMA 2X6XA 1SAUA 4F3QA 4XORA 4F91B 1N77A 4HRIA 3HKZA 4E7JA 4BQOA 1LFPA 3SZGA 3ZGKA 1UAAA 2IS2A 3D5LA 1DGRM 2Q1ZB 4J00A 4DJAA 2MYSA 3QYEA 1D0YA 3PSFA 3DWLE 3ZXSA 3K4BA 2OV7A 4BE0A 2XDVA 2E1MB 3DKXA 4U87A 1Z3XA 3H35A 2F5VA 3VYRB 2R7XA 3HL2A 2R4GA 1X1DA 3S3MA 4XQFA 3IUOA 2Z1DA 4BU2A 4BXFA 3DPTA 4J01A 1V5EA 2Z16A 2R7UA 4NNJA 4RM3A 3DQVC 2O5RA 1D0XA 2DJIA 3OYNA 4CCJA 1X4OA 1D1BA 1NG7A 2R7VA 3G2BA 2KRCA 2E60A 2ELJA 2V7FA 3K4JA 4BDZA 2WBMA 1QU3A 1PYVA 2VLAA 2CH0A 4BJTA 2VIXA 2IGOA 2HPIA 2R7OA 3CJQB 4AU7A 2UWMA 1D0ZA 3A4CA 4HPQA 2V9KA 3NWSA 4PJLA 3AL0C 3OYGA 4XNFA 2IGMA 3K6GA 4Y33A 3N05A 3RPUD 2VKHA 4LITA 3PNTA 2WY8Q 1AA7A 4H4KC 1X1CA 1YX3A 4BEHA 2VXZA 3OYAA 2WAQA 3AFHA 3LSMA 4FETA 3L2VA 4B47A 2V1NA 2VB6A 2LRDA 3LFUA 2HVSA 4IQ4A 2L5QA 1FMVA 2V6EA 4N4OB 2LOOA 3EUKL 2KRHA 2LY1A 2VQGA 2KMUA 1WFXA 1MMDA 2HVQA 3QOEA 4NC7A 2UV1A 1V5GA 2E5NA 2LBFB 4F93B 3SEZA 5LD2C 2A6TA 3DTIA 3CJRB 5CQEA 3L2WA 2M7AA 3V42A 1TT0A 3BCAA 4OAYA 3W2VA 2RNGA 1NG6A 4BACA 2WA0A 4CCNA 2KPMA 4XLHA 3MKZA 3PFYA 2LC2A 4U7BA 3MKYB 3H9GA 4P5OA 4GRIA 3HUGB 5CPRB 4ZDLA 4NC8A 4XR6A 2R7QA 3OYHA 4P1WA 2ZXIA 4XLEA 4QPQA 4NQWB 5JHFA 3L2QA 4D9JA 1BR2A 1D1CA 1WJBA 5HLTA 5HVQC 4MLOA 3VYSB 4BQNA 2W7NA 1ERDA 3MMYB 3QYBA 4BGDA 4PJNA 1WJDA 2DOAA 3FHNA 1JI8A 2HVRA 3RTRA 3I3LA 4BUPA 2M7BA 4CA0A 1WJCA 3D5RC 4ZYAA 3HC7A 3VDXA 4IZZA 3W2AA 3M8JA 1J09A 2E5ZA 3A1YA 2VQHA 2VQLA 1E0EA 2CFOA 3RQ4A 4YELA 4LIUA 4OAZA 3ZR8X 5TGTA 4IQJA 4KISA 2GOXB 3H5RA 2L9SA 3DKYA 3EPZA 3BG6A 4XKWA 4XOPA 4HSTA 3MD2A 1K6YA 1OR7C 3DPLC 2KP6A 4BE2A 4PFOA 3OS0A 2I8DA 3HXLA 3OYLA 2JSPA 2LREA 2F4IA 2VQCA 1UG0A 3BLYA 4ZDPA 2RQQA 3PUBA 4C2UA 4AVZA 2X1CA 3OWTA 2CW7A 3NWTA 2CUJA 1MMNA 4YEJA 4CH7A 4BEHB 2FUG2 3OS2A 3OYMA 1MMGA 2VASA 3E1SA 3OYCA 4RMNA 2K5CA 4RM2A 3RSNA 2KZVA 2R7TA 3VWBA 3TL4X 2IS1A 4XOTA 2WB1A 1IRXA 1KONA 1WJEA 3K70C 3CF2A 4ITVA 4F52A 3RCOA 3BG7A 2LY2A 3C2GA 4HSRA 3OR1C 4BJ6C 2Z2SB 1FMWA 2VL8A 4QPOA 2VJIA 4CSWA 3PJRA 2XF6A 1WJAA 4XONA 2L9NA 3W2WA 1BR4A 3QYFA 3FBIB 4C9YA 2IS4A 2MC4A 5FROA 4E7LA 3GBGA 3S32A 2HDWA 1LDKB 3K4CA 2L2OA 4HG2A 2X1EA 3AKZA 4KJZA 2W4SA 3I9V2 1Z7LA 4HNTA 3A2KA 3OMYA 2MABA 4ZTFA 4IKFA 1Y56A 5KNLA 4ZDOA 2HU9A 3CP2A 4II3A 2DXIA 3IAS2 1W36C 3LL7A 2JVGA 5KCMA 3VSLA 3OL3A 2PJRB 2XAUA 4RLFA 4B48A 3K4MA 3W3CA 3TMOA 3FBNB 4Y3OA 2AQFA 2DT6A 1YX5A 3LSIA 2KDOA 1YE9A 3OYBA 4PK4A 4XLAA 2P0WA 2ZXHA 3F9KA 3DLAA 3OIQA 3K70D 2XF5A 2CMPA 3LSKA 1QHHD 3HG9A 2W82A 2AQEA 2ZSHB 4G6TB 3OOUA 2KL4A 4HEA2 2Q2EB 1P9QC 3DU5A 4XM3A 4B3XA 4X0GA 5CKTA 2F6CA 3H5AA 2K9LA 1ZELA 3S3OA 2OUMA 3UNGC 1MMAA 2LBFA 3CZ6A 4YRVA 3OYKA 4XMYA 1DP3A 4DBRA 1T0FC 3S8PA 1N75A 4XN3A 3H0DA 3K4LA 3HOSA 2IGKA 3H9QA 2W1OA 3VYUB 3OYJA 3VSKA 3BC8A 3ZQQA 3ONQA 2UUZA 4CCOA 2HQAA 1QHGA 3IAM2 2BW3B 2JUGA 5HNHA 3SEQA 3J7AY 2V4JC 4PFPA 1WJ5A 1VZ0A 4D1QA 1OLTA 1G59A 2WAFA 4PSXA 1Y6IA 4B44A 1X19A 3S3NA 3L2UA 1R6RA 4KT6A 2WY7Q 1PJRA 2M4GA 3ZCOA 3E0JB 3K4KA 1D1AA 2V26A 1EA3A 4E7IA 3PNYA 3LMMA 1X4PA 3UR3C 4E6KG 3EUHC 4FASD 4DIQA 5CQGA 1W36D 2IGNA 1U0JA 3OYFA 3M1CA 3OIPA 2VKDA 2WADA 4PJMA 2M0MA 4HNUA 2HNHA 2K3PA 2L7KA 3OYDA 3FKJA 3HPHA 3LSGA 2QKMB 4CZCA 1Z21A 4CCKA 1BOBA 3DU6A 3HPGA 3C2HA 4C2TA 2OC6A 2PMZA 4XL9A 3OL4A 4ANJA 1X1BA 2MD0A 4E4HA 3EUAA 2LG4A 3H9JA 4DBQA 3DPUA 4NUBA 2CS3A 4PUSA 3FDYA 3KYLA 2NOJB 2JVHA 2PJRA 3PL8A 3TBIA 2JA2A 2Y0SA 4BL0B 3OY9A 2VJJA 2KHMA 4DGWB 2BOLA 4E7SA 2ZFUA 2HPMA 2XSJC 3DTEA 2DCEA 4DOZA 2XF7A 4ZC3A 2KQRA 2MFZA 3OYEA 2XC7A 3L2RA 1DQUA 3CP8A 2RREA 3OS1A 4B43A 4JOMA 4BS9A 3D5SC 3DEEA 2VJ5A 1V5FA 1MNEA 1LVKA 3LSHA 2GOMA 4RLQA 4F55A 2X85A 4PJJA 4ZJZA 3U21A 2K9MA 4BDYA 4E7KA 3CESA 2X1DA 2VJ4A 1G8XA 1S9HA 1N78A 4LG3A 2HZDA 4BJ5C 2BVLA 1GLNA 1Z3YA 1WJFA 2X6YA 5FRNA 4CUGA 4KITB 1MNDA 3IP4B 2LH9A 2VXDA 2CV2A 4LIVA 4IX7A 2BW3A 4BE1A 5HNFA 4ZTJA 3PNVA 1TZLA 4C30A 3K10A 4XKBA 2M4KA 1MW7A 2BVMA 3H5NA 4R79A 4OWRB 3BCBA 2X51A 2M3AA 3MKWB 2IS6A 5KHDA 5LFAA 2WAEA 2CW8A 3QODA 4XKVA 3KX2A 3OYIA 2E1MC 1LKXA 2ZSIB 1SFKA 1HA8A 4JQFA 2LYCA 1T95A 2VPLA 3DTKA 3PSIA 3OR2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCE A;  2AQE A;  2AQF A;  2ELJ A;  2CUJ A; 
#chains in the Genus database with same CATH topology
 1ZR4 A;  2CUZ A;  1X3W B;  2FBK A;  3GFL A;  2OCE A;  1BR1 A;  4UUT A;  1XSD A;  1UEL B;  1SVL A;  4A3K J;  1GV2 A;  4BQQ A;  3K1N A;  2CV1 A;  4XLC A;  4Y4R A;  5CVV A;  4P96 A;  3IKT A;  1H9G A;  1T6S A;  1QA6 A;  2EV6 A;  4V19 K;  4E7Z A;  4E7H A;  3AL0 B;  4A3L J;  1UHS A;  4NC6 A;  2Q2E A;  1A31 A;  1EH8 A;  3FMR A;  2MLK A;  4XN0 A;  4CGZ A;  3ERE D;  4KIB A;  4N4N B;  2O8K A;  3WHC A;  4F3Q A;  3DBR B;  3F8C A;  3GXO A;  4F91 B;  1T08 B;  4B4C A;  1LFP A;  3ZGK A;  1A6Q A;  1UAA A;  3RQI A;  1DGR M;  2A69 F;  3R4K A;  5ICG A;  2NVY J;  1UST A;  5K5R A;  3Q0U A;  4JX6 A;  3QYE A;  2FBI A;  4PDK A;  4YIR X;  4A3B J;  2R92 J;  4D5F A;  3MZY A;  3A0H C;  3K4B A;  1RRJ A;  2O7O A;  2E1M B;  4EGZ A;  2XUB A;  2GQQ A;  4A6D A;  5HLI A;  1B72 A;  4YII A;  4I2O A;  1U8R A;  1JXS A;  2P8T A;  3E5Q A;  4O6J A;  5DD8 A;  2GAU A;  4XQF A;  3IUO A;  4BXF A;  4BU2 A;  4RGS A;  1ZKG A;  4LLN A;  3BR3 A;  5H20 A;  4CZZ A;  5D5V B;  3CC2 I;  4NNJ A;  1PUE E;  1Y1V J;  2NNN A;  2D2W A;  2O5R A;  2FNA A;  4AD9 A;  4EM2 A;  2JTV A;  5CVI A;  4I09 A;  1TT5 B;  1K78 B;  1D1B A;  1NG7 A;  2BY2 A;  2KT0 A;  4OU0 A;  4FX4 A;  3F8B A;  1O4X A;  3ZP5 A;  2KRC A;  1FSH A;  2V7F A;  2ELJ A;  3K4J A;  4AUX A;  3V8L A;  4MGR A;  1YLF A;  2CH0 A;  4U88 A;  3REO A;  1O7L A;  1XG1 A;  1XGM A;  5J47 A;  2IRF G;  1HW1 A;  2CQX A;  2UWM A;  2EFW A;  4IF4 A;  3NWS A;  4BY7 J;  3I4N J;  1IRF A;  2UZK A;  2IGM A;  4A5M A;  4HX8 A;  3X2Q H;  5ERI A;  3SFZ A;  1IW7 F;  2BY3 A;  5M3M J;  1JUS A;  2IA1 A;  2DMQ A;  1X1C A;  2P5L C;  1HOM A;  4LJZ F;  3OYA A;  1W4M A;  3LSM A;  3O6B B;  2L4M A;  1YHQ I;  3ABU A;  1KYZ A;  6PAX A;  1OQY A;  3U1D A;  2V1N A;  2DI3 A;  3LFU A;  4IQ4 A;  2L5Q A;  3WTW C;  2LKP A;  3EYI A;  3IRR A;  2Z5U A;  1W7P D;  2NS0 A;  2VC0 A;  2LOO A;  1LEA A;  1SFE A;  4HLY A;  2LY1 A;  3GFI A;  1MDM B;  1LUJ B;  3GVA A;  3M3Y J;  3ISP A;  2AXT C;  2OZU A;  2Y9Z A;  1V5G A;  3SEZ A;  2EH3 A;  1T56 A;  3GO5 A;  3CJR B;  4HYE A;  5TRD A;  3S17 J;  5FLX K;  3TO9 A;  1IRZ A;  1NG6 A;  4BAC A;  2WA0 A;  1ON1 A;  4I0A A;  5LGU A;  3K7A J;  1U5T C;  1HLV A;  1TL8 A;  4M3B A;  3BR2 A;  2CQ7 A;  4PCQ A;  3MKY B;  3O8G A;  2GIV A;  2KRF A;  3J7Y J;  1IG7 A;  4GRI A;  2DDB A;  3HUG B;  2Y31 A;  4XR6 A;  3G4S I;  2LMD A;  1OYW A;  3FK6 A;  2PQ8 A;  1WCM J;  3TP3 A;  2TCT A;  1D8J A;  3L2C A;  4RBO A;  4D9J A;  2NS8 A;  1D1C A;  1BBY A;  5HLT A;  1QVU A;  5HVQ C;  4WF2 A;  3HOV J;  4B1R A;  3FXQ A;  4B8X A;  4MLO A;  1P2F A;  4BQN A;  1IUY A;  2L7Z A;  1ERD A;  4V2F A;  1ZGA A;  2ZNZ A;  5ILU A;  4FE7 A;  2DOA A;  1K61 A;  3KPH A;  3RTR A;  3I3L A;  2DMP A;  2M7B A;  4ON0 A;  1I50 J;  1WJC A;  2KJC A;  2XVC A;  4ZYA A;  3Q9S A;  3IH2 A;  3KIO A;  4IZZ A;  5DD4 A;  3ABT A;  3A1Y A;  2VQH A;  4Y13 A;  1AHD P;  1E0E A;  1VQK I;  1D3Y A;  1DUX C;  2L9R A;  1F36 A;  4YEL A;  4XRM A;  1OCP A;  1HQC A;  5TGT A;  3RYP A;  2GOX B;  2DA4 A;  1TW3 A;  4JK1 X;  2IJL A;  5GAG J;  2XAJ A;  5FLM J;  4A12 A;  2O3F A;  3GTO J;  2KP6 A;  1RUO A;  3SFI A;  1JKQ C;  2LRE A;  2BXZ A;  2RQQ A;  4BKX A;  2E2I J;  2DK5 A;  3TW6 A;  3I58 A;  2MC3 A;  2CUJ A;  4EMS A;  4ESJ A;  4BEH B;  2FUG 2;  4UUS B;  5DUI A;  2NAZ A;  1YJ9 I;  3FXL A;  2W25 A;  1R1U A;  2K5C A;  1Q1H A;  5HDG A;  3TO6 A;  1K7A A;  3CCJ I;  2CYY A;  1ETX A;  2E1N A;  2M1B A;  5KAF C;  2WB1 A;  4EM1 A;  1KON A;  3TGN A;  3LST A;  1YQA A;  4F52 A;  3BJA A;  3FXJ A;  4LOC A;  4OMZ A;  4HSR A;  4WK8 F;  2FD5 A;  2LY9 A;  4HF1 A;  3GTM J;  1FMW A;  2XF6 A;  4I6Z A;  4XON A;  3O2P E;  3HHH A;  4FCY A;  2PMU A;  2X6O A;  5FRO A;  1YFH A;  3UKG A;  1O3Q A;  4QSH A;  3GBG A;  3S32 A;  3E3V A;  4MQV A;  2X0L A;  1YIO A;  4GFB A;  3AKZ A;  2O9L A;  2A5Y B;  2W4S A;  4RGU A;  4RA2 A;  5FD5 A;  4LB6 B;  3I9V 2;  4G8X A;  3LSJ A;  3OMY A;  2A68 F;  2Y48 A;  1Z1D A;  4M71 A;  4LLL A;  4EVI A;  4IKF A;  1JGS A;  2QCO A;  3QP6 A;  1GDT A;  2PI0 A;  2JWT A;  2DLL A;  3B6C A;  2ISY A;  2JVG A;  2QQB A;  3VSL A;  4M3D A;  3OL3 A;  2IT0 A;  3TO7 A;  3LQR A;  4L5J A;  1ETY A;  2WAQ N;  4W97 A;  3PUF A;  5JVT A;  3KZZ A;  4Y3O A;  1ZQ3 P;  4RB1 A;  1NHA A;  2YS9 A;  2EIN H;  2LLK A;  3IV5 A;  1BW5 A;  5DCM A;  4IEJ A;  2ZXH A;  1KQ0 A;  2M5W A;  3HDD A;  3H1C A;  3QAH A;  2W48 A;  3GZ6 A;  1DDN A;  3G73 A;  1HST A;  4PJ0 C;  2CMP A;  3GFJ A;  2DA2 A;  4ESB A;  2BY0 A;  4G6T B;  1OMI A;  3OOU A;  2KL4 A;  2GA2 A;  3OSG A;  5BNG A;  3H5A A;  2LF8 A;  1ZEL A;  3EYY A;  1MMA A;  3CZ6 A;  2IW5 A;  1JKP C;  4I99 C;  3JRH A;  1E2X A;  4A3D J;  3S8P A;  4PGH A;  1BOA A;  3SQN A;  3K4L A;  4DYQ A;  1IV6 A;  2IGK A;  3IL2 A;  1IN6 A;  4A0Z A;  3OYJ A;  1PUF B;  1REP C;  3N4M A;  4CCO A;  1TTY A;  5HNH A;  2BW3 B;  1JJ6 C;  4BQA A;  4OIQ F;  3L9F A;  1Y6I A;  3S3N A;  3L2U A;  4KT6 A;  1U9O A;  1KGS A;  2M4G A;  3E0J B;  1R9T J;  4EJW A;  1FTT A;  2JPB A;  2V26 A;  3PNY A;  3MEX A;  4AYB N;  2OD5 A;  2HWV A;  3CLO A;  3KP2 A;  3UR3 C;  1MGT A;  3M4O J;  2J5P A;  3O8H A;  4FAS D;  3T8T A;  5J1R A;  4AC0 A;  1G3W A;  3K1P A;  1HSJ A;  5EGO A;  5FFZ A;  3EQL F;  2GZW A;  3OYF A;  2FOK A;  2YR2 A;  1VQL I;  3ML6 A;  2JUC A;  2VKD A;  2QBY B;  3DKW A;  2M0M A;  4KFC A;  2EZI A;  5F1R A;  2WTE A;  1FY7 A;  3G1L A;  3LSP A;  2O8X A;  2QEX I;  3I56 I;  3LQQ A;  2IEK A;  1A5J A;  1EKE A;  5KAI C;  3R0A A;  1Z21 A;  2NVX J;  2OU2 A;  3G3Z A;  5FO5 A;  3C2H A;  1U78 A;  3H3Z A;  1R58 A;  2TDX A;  2ZJP F;  2OC6 A;  3WE3 A;  2P81 A;  1RZ4 A;  1TWA J;  4ANJ A;  2MD0 A;  3H9J A;  1X58 A;  4WXC A;  4NUB A;  3ZN1 A;  2MD5 A;  1VQO I;  5K1Y A;  2RVC A;  3HZJ A;  5IT3 A;  3FMQ A;  3DBH B;  3TBI A;  1U5T B;  2V9P A;  3I53 A;  4HAM A;  3OY9 A;  2VBY A;  2ZCW A;  2VJJ A;  2HI3 A;  3WTY C;  2MLG A;  2ZFU A;  2XSJ C;  3LA3 A;  2DCE A;  2STT A;  1OR7 A;  3M9A A;  2ZBK A;  1YYV A;  1D8K A;  2K9S A;  2DQL A;  3L2R A;  2H8R A;  4NBQ A;  1VQM I;  1DQU A;  2HQN A;  2XPV A;  2RRE A;  2HZT A;  2LDU A;  1UFM A;  3ECH A;  1GVD A;  2XGD A;  4B43 A;  1MSE C;  4BS9 A;  1P4A A;  1V5F A;  2P7V B;  3GTJ J;  2HOT A;  3LSH A;  3EET A;  1BJA A;  1KA8 A;  2LKS A;  2CG4 A;  4GCV A;  1BW6 A;  3U21 A;  1V4R A;  2K9M A;  3CES A;  1HF0 A;  2FXA A;  1H0M A;  1G8X A;  1S9H A;  1QZE A;  1HDD C;  1N78 A;  4LG3 A;  2OTJ I;  4HZF A;  4BJ5 C;  2M8G X;  1ZYR F;  3V4G A;  1USS A;  2Y9Y A;  4G6D A;  2BBY A;  1IUF A;  1U3E M;  4HF0 A;  4IHX A;  3KP4 A;  2DFF A;  1XDS A;  3P9I A;  2CV2 A;  4LK1 F;  4IX7 A;  5IT9 K;  2R7D A;  2JN6 A;  2VE9 A;  1ZH5 A;  2ISZ A;  4KMU X;  4UNO A;  1QVT A;  1Z6R A;  1TW2 A;  2XIG A;  3I4M J;  3TW7 A;  1MW7 A;  2BVM A;  3H5N A;  4OWR B;  2M3A A;  3TP0 A;  4I98 B;  3F0C A;  2WAE A;  4M6X A;  5LFA A;  4GGG A;  2DTR A;  3JAM Z;  3QPT A;  5JLW A;  4R8H A;  3ESW B;  3JRE A;  5ICC A;  1Y0N A;  2BHZ A;  1VQ8 I;  4WX9 A;  2VI6 A;  1G2H A;  4RAF A;  3BOQ A;  3H92 A;  2XKO A;  5GTH C;  1YS6 A;  1RET A;  3PSI A;  3SYT A;  2DOF A;  3U1K A;  3OSF A;  1VFC A;  5D5W B;  2K02 A;  2ECC A;  1P6R A;  2EA2 A;  2STW A;  2YU9 J;  1T0F A;  2RGV A;  1ZK8 A;  4P55 A;  2F5D A;  3K4N A;  1MH3 A;  4CCL A;  5L3G A;  2DPU A;  2FSW A;  3QU3 A;  4ZH4 F;  1WVR A;  2IXS A;  4PSW A;  4EAT A;  1FOY A;  2JPC A;  4IHY A;  3VYT B;  4AYB A;  5IOZ A;  4Z2Y A;  4M3G A;  2CV0 A;  1FP2 A;  2H1L A;  3HHG A;  1FC3 A;  5EYR A;  1W1W E;  1JT0 A;  1UMQ A;  2QQ9 A;  2NVT J;  2BE5 F;  3WGG A;  4L18 B;  1VQN I;  4DW6 A;  1POG A;  2XPU A;  1Z91 A;  2A6E F;  4CDG A;  1SAU A;  1R5H A;  4XOR A;  4KIC A;  3HKZ A;  1X2N A;  2L01 A;  4NDL A;  2QUF A;  2HXO A;  3GWZ A;  3L00 A;  1YW8 A;  4I0B A;  2KKO A;  1HKQ A;  2RV8 A;  3EUH A;  3CJN A;  4DJA A;  2CQQ A;  2MYS A;  3L09 A;  3ZQI A;  1ZAR A;  3DBL B;  2OV7 A;  5L3D A;  4V2G A;  1FIP A;  3G71 I;  2R5Z A;  1WSU A;  2XRL A;  2Z9O A;  4IRI A;  1RNL A;  1UHW A;  5FD6 A;  2M0C A;  5L3B A;  3VYR B;  3JTG A;  3GZ5 A;  2R7X A;  2R4G A;  3I59 A;  3GTG J;  2Z1D A;  3F6O A;  5DEQ A;  3WTX C;  1YO5 C;  1XGS A;  4KN7 X;  1V5E A;  2VN2 A;  2XAG A;  4M72 A;  3W6K B;  2LD5 A;  3CCU I;  4RM3 A;  2VT2 A;  1RR8 C;  4FX0 A;  3HBL A;  1P4X A;  5J8F A;  2CSO A;  1SVM A;  4QIW N;  4A0Y A;  2R7V A;  4BBS J;  2QQA A;  3F3X A;  3G2B A;  4HDU A;  5LGN A;  1BL0 A;  1WH5 A;  1ZRD A;  1PYV A;  3D0S A;  2VLA A;  1ZLK A;  2M9H A;  3KP3 A;  4U0Y A;  5JR3 A;  2JZY A;  2W24 A;  3SZP A;  2HPI A;  3SHF A;  1FT9 A;  1D0Z A;  2F5C A;  4CYC A;  4AVP A;  4PJL A;  3T5X A;  3GME A;  3OYG A;  2PJP A;  2PG4 A;  2ZFW A;  1LPQ A;  5GPA A;  4RDU A;  3BDD A;  3N05 A;  2R5Y B;  3Q0W A;  2VKH A;  3B73 A;  2CO5 A;  4LIT A;  1W0U A;  4M9S A;  5FB2 A;  1YTY A;  2WY8 Q;  1AA7 A;  5LEK A;  4TV7 A;  2V9V A;  1UZC A;  1R49 A;  2DFH A;  1YX3 A;  3CUQ B;  2WAQ A;  3AFH A;  2HOS A;  2H27 A;  2XAH A;  1R71 A;  1Y0U A;  2AS5 F;  1WQ2 A;  3G1O A;  2VB6 A;  4B47 A;  2Y0S N;  1FYK A;  2CQN A;  1ZG3 A;  1OCO H;  5DS9 A;  2FMY A;  3J81 K;  1IN7 A;  3EUK L;  4RB0 A;  2KRH A;  4IHW A;  4A0X A;  1G3T A;  1WFX A;  1TQM A;  2L7F P;  5DUK A;  2HTJ A;  5J4V A;  4U0V A;  2UV1 A;  2LBF B;  5LD2 C;  5CQE A;  4JBA A;  1YRN A;  3DF8 A;  3LA7 A;  5DV5 A;  4Y7N J;  1SD6 A;  2RNG A;  1R1T A;  4CCN A;  5E17 F;  3BJ6 A;  1STZ A;  2M30 A;  2HOE A;  4IPA A;  5TJJ A;  1P4W A;  2CWE A;  3DCF A;  5B66 C;  4P5O A;  1GVJ A;  3FXR A;  5CPR B;  2I5U A;  1SC7 A;  2PMH A;  3TED A;  5E1X A;  3RJP A;  1FNN A;  1RES A;  1UB9 A;  3GF2 A;  1LE8 B;  2QEN A;  1JE8 A;  2ZXJ A;  4NQW B;  3Q3S A;  4EM0 B;  1P7I A;  2E71 A;  1I1G A;  3PO3 J;  3JRA A;  2P6T A;  2V1X A;  1IJW C;  3ZPL A;  3S2H J;  4Y15 A;  3MMY B;  1I5Z A;  3QYB A;  5EEG A;  1WJD A;  2L7M P;  4UVB A;  3C3W A;  2XAF A;  5EZG A;  3FXK A;  5FKM A;  2OJE D;  4CA0 A;  2JA6 J;  1CGP A;  3M7G A;  1YJN I;  1JHF A;  1ULY A;  4ABZ A;  2QA4 I;  2BHY A;  1LEB A;  1KQ8 A;  3VDX A;  2EFO A;  3M8J A;  3CMY A;  1D5Y A;  2KIS A;  2A07 F;  2VQL A;  1K4S A;  1IGN A;  3SJM A;  5ILV A;  3GCM A;  3KLN A;  3RQ4 A;  2YSR A;  4HV5 A;  1ZHF A;  2K4B A;  4CYD A;  3I54 A;  2L9S A;  3BG6 A;  4HST A;  1OR7 C;  4BE2 A;  3DPL C;  3OS0 A;  1IN8 A;  2XRN A;  3OYL A;  3QP5 A;  4RAZ A;  3CTA A;  3BLY A;  4ZDP A;  1J7K A;  5GAH J;  2ID3 A;  1J0R A;  2EA4 A;  4C2U A;  2IAI A;  2K7L A;  4XRS G;  3WG9 A;  3QPS A;  1MJA A;  1MMN A;  4YEJ A;  2K40 A;  2F2E A;  3FK7 A;  4RMN A;  4RM2 A;  2LF7 A;  2R7T A;  3TL4 X;  4AWX B;  2IS1 A;  2P5V A;  5M3F J;  1U2W A;  1IRX A;  5BPI A;  3K70 C;  1Y8Q B;  1FBQ A;  4C2M J;  1MDM A;  1W5T A;  3RCO A;  4FIS A;  1K4T A;  2FRH A;  1YS7 A;  4BJ6 C;  4EJT A;  4QPO A;  2VJI A;  3PJR A;  1WJA A;  4YFN F;  1HBX G;  1XSX A;  2I10 A;  3P5J A;  3BR6 A;  3P9C A;  5JVG F;  2CW0 F;  3I64 A;  1O3R A;  1R7J A;  3WTV C;  2MC4 A;  1XN7 A;  3BY6 A;  3ZQ7 A;  4E7L A;  1I3Q J;  2EFN A;  2G0E A;  3TDZ C;  4ASN A;  2EIJ H;  2L2O A;  2EK5 A;  4KT5 C;  3RPU A;  1FYL A;  3HUG A;  4KJZ A;  3C1D A;  2DO7 A;  3E6M A;  4HNT A;  1DU0 A;  5DM6 F;  4UUV A;  3ZQG A;  3GYH X;  1RC9 A;  1XGN A;  4LK0 F;  3CC7 I;  1OPC A;  2EIK H;  4ZTF A;  1Y56 A;  2HU9 A;  2VBW A;  2B0L A;  3I71 A;  4II3 A;  3TOA A;  3CME I;  2YUS A;  5L3C A;  3IAS 2;  4L0Z B;  1RPW A;  2PJR B;  1J5Y A;  1UHM A;  2K9Q A;  3HRU A;  1Y39 A;  3K2A A;  1CF7 B;  3ZQC A;  1ZRE A;  1X3Z B;  1FOW A;  1YX5 A;  2DT6 A;  1FBU A;  4HBL A;  4G7O F;  1Y8R B;  3CCL I;  5FKO A;  3CCY A;  4PK4 A;  2P0W A;  3IHU A;  3F9K A;  4PZJ A;  5IP7 J;  5KVR A;  4A3E J;  2XPW A;  1A35 A;  5A2Q K;  5FJ8 J;  3K70 D;  1PP7 U;  2XF5 A;  1QHH D;  5B3S H;  3HG9 A;  1BI3 A;  2AQE A;  3HB9 A;  5LEJ A;  4BNC A;  1FSE A;  2OTL I;  2ZSH B;  2F48 A;  2OF7 A;  4XBF A;  1T2K A;  4BBR J;  1J9I A;  2Q2E B;  2GLO A;  3DU5 A;  1F5T A;  4XM3 A;  4B3X A;  5B1B H;  3E97 A;  4XLN F;  2L9V A;  4UVA A;  2E1C A;  1R22 A;  2DA6 A;  3HM5 A;  3RPQ A;  4HF2 A;  1T38 A;  1BI0 A;  2EQR A;  4YRV A;  4XMY A;  4RGR A;  5IYB J;  1Y1W J;  5JFR A;  1N75 A;  2WV1 A;  3FIW A;  3I0T A;  3HOS A;  2XHK A;  2W1O A;  3VYU B;  4A5N A;  3VSK A;  1IN4 A;  1JKO C;  3BC8 A;  1ZN2 A;  2UUZ A;  1XTA A;  2HQA A;  2NVU B;  5EF6 A;  2JUG A;  5E3N A;  2MSY A;  3J7A Y;  4PFP A;  2EFP A;  2OAZ A;  2FNP A;  4UUS A;  4A3I J;  1G59 A;  2WAF A;  1S29 A;  4PSX A;  2CUF A;  3S1M J;  2XRO A;  1B72 B;  1TWF J;  1B4A A;  1NH3 A;  2HR3 A;  4HA8 A;  1RR7 A;  3E6D A;  4Y17 A;  3T0Y A;  5K5O A;  3K4K A;  2B7E A;  3CLQ A;  2LP0 A;  2QSG X;  4JP0 A;  5LRS A;  5CLS A;  1KU2 A;  4LG0 B;  4E6K G;  4MFD A;  2ME0 A;  2UXX A;  1OCR H;  4YFX F;  3W6J B;  3F21 A;  2E35 A;  2DU9 A;  2W57 A;  4J19 A;  1O3S A;  3CCQ I;  4EJO A;  1SD7 A;  1B8I B;  3OIP A;  3F23 A;  1F43 A;  3E7L A;  2WAD A;  4PJM A;  3TKY A;  5F64 A;  3Q5F A;  2HYG D;  2K3P A;  4DYR A;  1JGG A;  4L5E A;  2CRG A;  1LB2 A;  4BH9 A;  3RKQ A;  1RIO H;  5B5E C;  1DP7 P;  3HPH A;  1JTY A;  2QKM B;  1IO2 A;  3AG2 H;  3V7R A;  1OCZ H;  3DXJ F;  1F1Z A;  3DU6 A;  3CCS I;  2BXY A;  1ON2 A;  4C2T A;  1ZG1 A;  2PMZ A;  4RB3 C;  2MGQ A;  3GLL A;  3OL4 A;  4BXU A;  3CMA I;  1F4K A;  1X1B A;  3AAF A;  5LRR A;  1RKT A;  3MN2 A;  3RI4 A;  4PUS A;  3FDY A;  3KYL A;  2FU4 A;  1A04 A;  2O0Y A;  5HLG A;  4U7D A;  4KN4 X;  4ENN A;  3HRM A;  2VBX A;  1HCR A;  1KYW A;  2ZNY A;  3BR0 A;  3VEP A;  2JA2 A;  2Y0S A;  4EQQ A;  4M3F A;  4EEF G;  3K9T A;  2A05 A;  3FF5 A;  2HYJ A;  3HGY A;  2Z3Y A;  4UB6 C;  5JI6 A;  2QSF X;  2JA5 J;  1I39 A;  2EZK A;  2LFB A;  3Q0V A;  2DA3 A;  4AID A;  3OS1 A;  1SFU A;  3AG1 H;  2EPF A;  2GIZ A;  3DP7 A;  1I6H J;  4MEY F;  2AHQ A;  3KP5 A;  1GT0 C;  2DMU A;  2FX0 A;  4D5C A;  1MBK A;  3ABK H;  5LLQ A;  1FLI A;  2HZD A;  2WC2 A;  2BVL A;  4GXO A;  2DFI A;  4Q47 A;  5LGT A;  2GXG A;  1LNW A;  1P7J A;  5FRN A;  1Z7U A;  4CUG A;  5K5Q A;  2A6H F;  3IP4 B;  3ZMS A;  1TP4 A;  5F08 A;  2BW3 A;  3GTL J;  4YG2 F;  4A3M J;  1OJL A;  5HNF A;  2V6C A;  3PNV A;  1TZL A;  1XX5 A;  2EV5 A;  2EZH A;  4I02 A;  5CYV A;  5DDG A;  4XKB A;  2M4K A;  3RZD J;  2IVM A;  3S2W A;  4R79 A;  3IWF A;  2X51 A;  2J5O A;  3MKW B;  5IPA A;  3Q9V A;  5KHD A;  4FE4 A;  4AIJ A;  5C4X J;  5E20 A;  4GO1 A;  4WXD A;  4A93 J;  1N25 A;  1LKX A;  1MJ9 A;  2LK2 A;  1SAN A;  2L3D A;  4JQF A;  3CCR I;  1S72 I;  2CUE A;  2G9W A;  2VPL A;  2LTP A;  5E8I A;  2K3F A;  3VFZ A;  2GA1 A;  1R4N B;  1TBX A;  3IWZ A;  2P4W A;  3KEY A;  4Q4Z F;  3NQO A;  1EF4 A;  3SDB A;  1DU6 A;  4N9H A;  1X1A A;  1OCC H;  3M8F A;  1FX7 A;  3ABM H;  2H6B A;  2E1O A;  3OOP A;  3BTL A;  5IOY A;  4S04 A;  2YPR A;  3QRF F;  4XLF A;  3F8F A;  4P9U A;  1TWC J;  1BM9 A;  1SD4 A;  4L9J A;  2A5W A;  2LNB A;  2MA3 A;  5EDN A;  3V7S A;  5C44 J;  3ZRG A;  2MH2 A;  3TDU C;  4II2 A;  2X6W A;  1LFU P;  4F92 B;  3BZK A;  5HDN A;  5FRM A;  2A61 A;  2W00 A;  2QKL B;  4ENK A;  1ETQ A;  3CMM A;  2FBH A;  3S14 J;  1N77 A;  4HRI A;  1FEX A;  1GXP A;  1KQ9 A;  2B63 J;  4KNY A;  2IS2 A;  3D5L A;  5J1U A;  1KU3 A;  2V1U A;  3MKL A;  3HGG A;  2HS5 A;  4EGY A;  4A2U A;  3JSP A;  4O5V A;  3M1E A;  4OIR F;  3FM3 A;  3PSF A;  3GUD A;  3BZC A;  2ZJQ F;  3MAJ A;  3PM1 A;  4IXA A;  2A3S A;  1WI3 A;  2K27 A;  5J8C A;  1TLH B;  3IH4 A;  2V79 A;  4U87 A;  3I4P A;  5J6X A;  3CCE I;  5DCF A;  1D5V A;  3JRF A;  2NXN B;  1SAX A;  2M45 A;  1X1D A;  3CF5 F;  1BI1 A;  1U9N A;  3ULQ B;  3DPT A;  2DBB A;  1HC8 A;  1ETK A;  1E3O C;  4DYC A;  2NS7 A;  4IHS A;  3RYR A;  1I6X A;  1QZZ A;  3OYN A;  2H1K A;  4CCJ A;  3HOY J;  4QTR A;  4LLG F;  4BYY A;  2D1H A;  1QGP A;  5D6F A;  3BTI A;  2CQK A;  3CC4 I;  2GBY A;  5CVJ A;  1QU3 A;  4IRG A;  2BY1 A;  2WWY A;  3KEQ A;  4EV0 A;  4MTD A;  3H0G J;  3V8K A;  2EWN A;  2OA4 A;  4AU7 A;  1R5I D;  4HPQ A;  1WI9 A;  3A4C A;  2V9K A;  2ESH A;  3AL0 C;  4XNF A;  3JTH A;  4HX7 A;  3LOC A;  1I3A A;  4UXN A;  4Y33 A;  3ROU A;  3C18 A;  4MEX F;  3J80 K;  3RPU D;  1FIA A;  1ZLJ A;  4B09 A;  4MFE A;  4XIC A;  1X1P A;  2E34 A;  5GTI C;  2HKO A;  2HQR A;  3H36 A;  3NRV A;  2VXZ A;  2EIL H;  1S6L A;  2VOD A;  2DT5 A;  4R1H A;  1IF1 A;  4G6Q A;  2HTS A;  1H9T A;  2LRD A;  1K79 A;  2V6E A;  2Y2Z A;  3FM5 A;  4P9F A;  3VOE A;  4CHU A;  2FJ1 A;  2VQG A;  2KMU A;  5EEA A;  3ASO H;  1JUP A;  3B6A A;  1OFC X;  2LR8 A;  2HVQ A;  3BTC A;  3QOE A;  3WGI A;  3B02 A;  4F93 B;  2A6T A;  3DTI A;  3HKZ N;  1SFX A;  3V42 A;  1TT0 A;  4OAY A;  2RDP A;  2CJJ A;  4AIK A;  4OIP F;  4G7Z F;  5FGM A;  1AKH B;  2KPM A;  3MKZ A;  3J80 Z;  3FX3 A;  1W7P B;  2LC2 A;  4U7B A;  3ZMZ A;  3H9G A;  1G3Y A;  4LD5 A;  2ZME A;  1E17 A;  1V55 H;  2E36 A;  3FXO A;  5BOX A;  3WHB A;  2L4A A;  3OIO A;  4ZDL A;  3OYH A;  4P1W A;  4HQM A;  2KIQ A;  2TRT A;  4XK4 A;  5JHF A;  1F9N A;  1LDD A;  1G3S A;  1J59 A;  1BR2 A;  2JRM A;  2QWW A;  4Y52 J;  3F72 A;  2EZL A;  1DPR A;  5AIP A;  1OYY A;  1YW9 A;  2M87 A;  5B1A H;  2W7N A;  3T8R A;  5EGO B;  3CCM I;  3KYC B;  3V8J A;  4PJN A;  4MO7 A;  5D5U B;  4G12 A;  4QLC U;  2DYS H;  2IA2 A;  4UV9 A;  1JI8 A;  2EJR A;  4FTH A;  4HW0 A;  4DNC A;  4FQG A;  2R3S A;  3HIF A;  2DDA A;  5FLV A;  2K4J A;  2XGX A;  3W2A A;  2E5Z A;  2M2E A;  1QBJ A;  3IRQ A;  3SXY A;  1KU7 A;  5HLH A;  2XGC A;  1U6G A;  2CFO A;  3CUO A;  4LIU A;  1FYM A;  2OZ6 A;  4OAZ A;  2COB A;  1VTN C;  2MBF A;  5CVU A;  1ETV A;  3TOB A;  3DKY A;  1S7E A;  2GXA A;  2ELH A;  3F8N A;  2V1D A;  3KFW X;  1K6Y A;  5K7Z A;  2RNJ A;  4N0B A;  4PFO A;  1U5T A;  2I8D A;  2JSP A;  5D8L B;  2F4I A;  4ZYD A;  2M34 A;  4CIC A;  1H8A C;  2LKX A;  4AVZ A;  3OWT A;  4EJV A;  2L02 A;  1XSV A;  4X6A J;  4DQ2 A;  3PIO F;  3NWT A;  3J7Z I;  2VPR A;  4CH7 A;  3CUQ A;  3OS2 A;  1FOK A;  4IHT A;  1JHH A;  1S8N A;  3OYM A;  2VAS A;  3E1S A;  3OYC A;  3G6E I;  3GTP J;  1VF9 A;  3A02 A;  5GP9 A;  3VWB A;  4NB5 A;  1QPI A;  1IXS B;  3JW4 A;  4XOT A;  1TNT A;  4ZYG A;  4KA4 A;  5AIQ A;  1SFO J;  2H09 A;  1WJE A;  2NRA C;  1ETW A;  1IDY A;  5FLX Z;  1FJL A;  1MBJ A;  3WU0 A;  3LA2 A;  1XDU A;  2LY2 A;  4FHT A;  2ELK A;  2VL8 A;  1IXR C;  4CSW A;  3MVP A;  5HS9 A;  5E18 F;  3DV8 A;  1VND A;  3JR9 A;  2L9N A;  2R0Q C;  5HS7 A;  2XAS A;  2Z33 A;  3QYF A;  3FBI B;  2E2H J;  2IS4 A;  1B59 A;  3GLX A;  1XGO A;  3S1N J;  2WV0 A;  3TQN A;  3NAU A;  1K78 A;  1HW2 A;  1LDK B;  3K4C A;  4L0Y B;  1MNM C;  2BV6 A;  4HG2 A;  4IL6 C;  2X1E A;  3ZQF A;  5EG0 A;  3AG4 H;  1LE8 A;  3A01 B;  4A3J J;  2IP2 A;  5J40 A;  5BQT A;  2MAB A;  5EJC A;  5KNL A;  4ZDO A;  3CP2 A;  1ZGW A;  2RQP A;  1UG2 A;  1FZP B;  2DXI A;  1W36 C;  3RZO J;  5FKL A;  3HSE A;  2IBD A;  1MH4 A;  4RLF A;  4B48 A;  1Z0X A;  3TMO A;  3FMS A;  4ZZD A;  1MJB A;  1EJ9 A;  3FBN B;  3DFG A;  3LSI A;  2KDO A;  1L3L A;  1YE9 A;  1WZ2 A;  3JCU C;  2OPT A;  2DOE A;  3K0L A;  2GM4 A;  4XLA A;  3BJO A;  1T39 A;  1IDZ A;  1QZY A;  2W82 A;  2DW4 A;  4WCG A;  2Y69 H;  1S7O A;  3QU6 A;  3D1N I;  1M1E B;  4ENM A;  2MW8 A;  4A3G J;  4HEA 2;  2DQR A;  1MSF C;  1MBH A;  2GXB A;  2HQ5 A;  5GAE J;  2F6C A;  2K9L A;  3FZV A;  3S3O A;  3UNG C;  1ZR2 A;  3BZ6 A;  1DP3 A;  3HEF A;  3QQA A;  2P6S A;  1T0F C;  3ERM A;  1XS9 A;  4L9N A;  4XN3 A;  2XV4 S;  5D6E A;  3H9Q A;  2DMT A;  2OBP A;  4BHP A;  3FXU A;  1X2M A;  3ZQQ A;  1JJ8 C;  5HOD A;  3ONQ A;  1G6N A;  1RKW A;  1AWC A;  3CJT B;  1QHG A;  3IAM 2;  3SEQ A;  2QSH X;  2V4J C;  1FP1 D;  1WJ5 A;  2VC1 A;  1WGX A;  2G7U A;  4UVC A;  3VPR A;  2AXL A;  5C4J J;  4D1Q A;  3JRI A;  3WE2 A;  1BC7 C;  2HFH A;  5H6R A;  2HDD A;  1QRY A;  2WY7 Q;  4HOB A;  3ZCO A;  3BQY A;  1D1A A;  4D7N A;  4E7I A;  4MIM A;  4M74 A;  3I59 B;  4JX4 A;  5F1J A;  3LMM A;  4KUM A;  4W1U A;  5D4S A;  3HJE A;  4KMF A;  3EUH C;  1NTC A;  1ORK A;  3F22 A;  5CQG A;  2IGN A;  2RKH A;  3BQZ A;  2EFQ A;  3M1C A;  2FE3 A;  4LMY A;  3GW2 A;  2L54 A;  4IOA F;  2HNH A;  3J81 Z;  5AON A;  4M73 A;  1G4D A;  2L7K A;  3LSR A;  3FKJ A;  2PMZ N;  3FWE A;  1Z6T A;  4YFK F;  4CXF A;  5EZH A;  2NYX A;  1B6A A;  4Z6Y A;  4ZYH A;  5GAD J;  3ZQL A;  2PEX A;  4OIN F;  4H0E A;  2COM A;  3LAP A;  5E3O A;  4XRF A;  4LGW A;  4RAY A;  4CYC B;  5H6Q A;  1A6I A;  3BG5 A;  4HLX A;  1H89 C;  4E4H A;  3EUA A;  3GTK J;  2CGP A;  3DPU A;  2CS3 A;  2KDZ A;  1WKM A;  1E3H A;  3P9K A;  1YJW I;  2HEO A;  1FPQ A;  2NOJ B;  3FHZ A;  3MCZ A;  2PJR A;  5ILS A;  5M5Y J;  4Q5S F;  1S5L C;  3H3U A;  4ZYE A;  5JLX A;  1OIS A;  1S7A A;  1YIJ I;  1CF7 A;  4BL0 B;  5K7F A;  2KHM A;  4E7S A;  2BOL A;  2XKP A;  1HKS A;  1BIB A;  4DOZ A;  1W5C C;  2XF7 A;  2YX4 A;  2O6G E;  1WRJ A;  2KQR A;  2MFZ A;  2UXN A;  4G7H F;  2VBZ A;  2W85 A;  4M6V A;  2VE8 A;  1WH7 A;  3D5S C;  2VJ5 A;  3QPH A;  4DZP A;  3ZQH A;  1MNE A;  1LVK A;  5IP6 A;  3E5X A;  1VQ4 I;  3CQZ J;  2X85 A;  4PJJ A;  4ZJZ A;  1PVE A;  4BDY A;  1K6O A;  3MQ0 A;  3HOX J;  2VJ4 A;  3K2Z A;  3ZMU A;  4BXX J;  1IXC A;  4L9V A;  3R0J A;  2O61 A;  3MWM A;  3JSO A;  2NVQ J;  4UV8 A;  3DEU A;  4KIT B;  4C3J J;  2EBI A;  3IH3 A;  1HDP A;  1I27 A;  3KCC A;  3WOD F;  4A3C J;  3CD6 I;  1HW5 A;  3MFK A;  4BE1 A;  3I55 I;  5DYM A;  4UB8 C;  2DJN A;  3QPL A;  3GX4 X;  1R36 A;  2DK8 A;  3K10 A;  2D45 A;  3IKV A;  5BS6 A;  2KIM A;  3ZOB A;  5IT9 Z;  2LSO A;  4QWQ A;  1O3T A;  1VQ9 I;  2FEZ A;  1LJ9 A;  2QM3 A;  2IS6 A;  4XKV A;  4AIH A;  3PQK A;  3KX2 A;  3FIS A;  4ESF A;  5E3L A;  1HA8 A;  1ZGJ A;  1B9N A;  2KIF A;  4KDP A;  5D8K B;  1Q1V A;  3JRC A;  3DTK A;  3OR2 C;  4IJA A;  4QPQ A;  3CDH A;  2JA7 J;  1T8I A;  2JQ7 A;  4XKC A;  1ZG5 A;  1B8I A;  2R7W A;  2QGU A;  1E3P A;  2DA5 A;  5DCM B;  1JUM A;  1DGW Y;  4KIG A;  4HNV A;  2DT7 B;  3KP6 A;  3W6V A;  4CCM A;  4FT8 A;  3HOT A;  2VON A;  1XC5 A;  3J7A O;  2KLO A;  1T33 A;  3KYD B;  4CO8 A;  2GWR A;  3A03 A;  4OIO F;  5D4R A;  3E6B A;  3S93 A;  9ANT A;  5HOO A;  2R7R A;  3G1M A;  1H88 C;  4GYG A;  3R61 A;  3LFK A;  2R7S A;  1NK3 P;  1BA5 A;  2IPQ X;  2R93 J;  2X6X A;  2ZJ2 A;  3HYI A;  4X1E A;  2EV0 A;  4UHT A;  4E7J A;  4BQO A;  3SZG A;  2R7F A;  3HOZ J;  2Q1Z B;  4J00 A;  2XB0 X;  1ZRF A;  3RKY A;  1D0Y A;  1K83 J;  3DWL E;  3CO7 C;  3ZXS A;  5FFX A;  1SVO A;  2EB7 A;  1W5S A;  4BE0 A;  2XDV A;  1XMX A;  2MG4 A;  1ODD A;  1QNT A;  4BAY A;  4BY1 J;  3DKX A;  3DLL F;  1AOY A;  3VB2 A;  1Z3X A;  1VI0 A;  3H35 A;  3ZMT A;  2F5V A;  5M5X J;  1XCB A;  1YIT I;  4LB5 A;  3M8E A;  1MBF A;  2DN0 A;  3HL2 A;  2FQ4 A;  4HDV A;  5EEH A;  3S3M A;  2K9N A;  3WU2 C;  1R00 A;  4J01 A;  5J3L A;  2AO9 A;  3NEU A;  4L5I A;  2Z16 A;  2KJB A;  4ETS A;  1Z67 A;  5A2Q Z;  2R7U A;  4D7M A;  2N8G A;  1XD7 A;  3DQV C;  4JX5 A;  1GUU A;  1D0X A;  5KK1 A;  2Q8K A;  2DJI A;  2VUM J;  2ID6 A;  2PN6 A;  1X4O A;  2QBY A;  2XB5 A;  5E79 C;  2ECB A;  3KE2 A;  3RKX A;  3WU1 B;  4A3F J;  1AU7 A;  2JK3 A;  4PGG A;  4ENJ A;  2E60 A;  4BDZ A;  2WBM A;  5FKK A;  1C0W A;  1VQP I;  4IO9 F;  1X3U A;  2RN7 A;  4M9Z A;  4BJT A;  4HV6 A;  2VIX A;  3RIR A;  2X4H A;  3ZMV A;  3BR5 A;  4KYW A;  2IGO A;  5E1Z B;  3CJQ B;  2R7O A;  3C7J A;  2XAQ A;  2QQ8 A;  1XMK A;  5F0C A;  1A36 A;  1LFB A;  3K6G A;  4B3A A;  3BPX A;  1FTZ A;  4A6E A;  2BYV E;  4A69 C;  1BI2 A;  2Y0M A;  3HRT A;  3PNT A;  3COA C;  3BTJ A;  1Z05 A;  2ZME C;  3HRS A;  4H4K C;  4BEH A;  3PFI A;  2CU7 A;  1W0T A;  4FET A;  1SEU A;  3ZN0 A;  2O03 A;  3L2V A;  1IC8 A;  1SMY F;  1IRG A;  1BC8 C;  2HVS A;  1B9M A;  3ASN H;  1FMV A;  4OOI A;  3GFM A;  1O7F A;  4N4O B;  2CFX A;  3R6S A;  2XSD C;  4RGX A;  2K86 A;  1MMD A;  3KZI C;  4NC7 A;  2JA8 J;  2E5N A;  2FOW A;  1KZH A;  1SMT A;  3L2W A;  2M7A A;  5BPD A;  5LBQ A;  3BCA A;  3W2V A;  4D0P A;  5M5W J;  2HDC A;  4XLH A;  4AM3 A;  3LAJ A;  1U8B A;  3BG3 A;  3PFY A;  5J4Y A;  1LQ1 A;  3QOP A;  1WHU A;  2KZG A;  2F4M B;  4I76 A;  2VOP A;  1ACI A;  3GEZ A;  4NC8 A;  4WWC A;  3LNQ A;  2R7Q A;  2ZXI A;  3V7C A;  4XLE A;  2H8W A;  2DTZ A;  5L3F A;  1YI2 I;  1GXQ A;  3A0B C;  1LDJ A;  2ESN A;  2DAO A;  1R23 A;  3WG7 H;  3L2Q A;  2DYR H;  3BR1 A;  3S1Q J;  4I01 A;  1WJB A;  4MQ9 F;  2RAE A;  2QVO A;  1OKR A;  4LG0 A;  3L7W A;  3VYS B;  3S1R J;  4BGD A;  1L0O C;  1YOV B;  4XSX F;  5IYC J;  3FHN A;  5HS8 A;  1I1S A;  2HVR A;  4BUP A;  5BMZ A;  1B1B A;  4MNU A;  3CUQ C;  2JSC A;  4MTE A;  4XLP F;  3D5R C;  1CQT A;  2M8E A;  2RC4 A;  1HXD A;  3HC7 A;  3E5U A;  5HDK A;  1J09 A;  5E1W A;  3PIP F;  5F0F A;  2F4O B;  3HOU J;  1WPK A;  4XID A;  3WTT C;  3E6C C;  5JHU A;  4G94 A;  2ETH A;  5GPC A;  4N9I A;  4XSZ F;  3ZR8 X;  4IQJ A;  4KIS A;  3K1M A;  4C3H J;  2P7C B;  3H5R A;  2DFE A;  3EPZ A;  1BIA A;  4XKW A;  4XOP A;  3F6V A;  3MD2 A;  2H94 A;  1ITY A;  1V54 H;  2YU3 A;  1MBE A;  3HXL A;  5ICF A;  2F5E A;  2VQC A;  1UG0 A;  1PUF A;  1XB4 A;  3PUB A;  3JRD A;  2HXI A;  3JAM K;  2FF4 A;  2X1C A;  2CW7 A;  2BGC A;  4IOC F;  1PP8 F;  3SDG A;  1VQ5 I;  3HOW J;  1UCR A;  1MMG A;  3U2R A;  3RSN A;  2KZV A;  3KZY A;  1J75 A;  1MMS A;  3R60 A;  1P92 A;  3KLO A;  1ZTR A;  4UY8 I;  1MD0 A;  3CF2 A;  1ENH A;  4ITV A;  5DTD A;  3ABL H;  3BG7 A;  4IHV A;  5LHH A;  3C2G A;  3RDI A;  2VKE A;  3OR1 C;  1JTX A;  2E7X A;  2Z2S B;  1T98 A;  3CCV I;  2L0K A;  1IN5 A;  3PO2 J;  3L1P A;  1TQP A;  1KU9 A;  2PFB A;  3W2W A;  3CDL A;  1BR4 A;  2QYO A;  1S3J A;  4C9Y A;  1V3F A;  1MKM A;  3HSF A;  3KEO A;  1AKH A;  3MZ8 A;  3P7N A;  2HDW A;  2ZME B;  2EIM H;  3CDI A;  5D5X B;  2HYF A;  3BP8 A;  2VT3 A;  2W84 A;  1EV7 A;  4RB2 C;  1Z7L A;  3A2K A;  4IRH A;  1R1V A;  2PLY A;  2X9D A;  1QQI A;  3BT9 A;  1IAW A;  3HTS B;  3BPV A;  2NNY A;  3WTZ A;  4YIF A;  3LL7 A;  5KCM A;  4IVN A;  4BHC A;  3OV8 A;  1TWH J;  1XCV A;  2Y75 A;  2XAU A;  2ZB9 A;  3S15 J;  2F5F A;  3K4M A;  3W3C A;  1VQ7 I;  2AQF A;  5C3E J;  1HKT A;  1O57 A;  5F6F A;  5LHI A;  3OYB A;  1BJZ A;  2DA1 A;  2DPD A;  4RAG A;  3DLA A;  5F0H A;  3WTS C;  1MBG A;  3OIQ A;  3IC7 A;  2X48 A;  3LSK A;  4M6Y A;  3GZN B;  1SD5 A;  2FQ3 A;  1UJ8 A;  2HGC A;  3KET A;  1J2X A;  2JT1 A;  1P9Q C;  2ZC2 A;  1IZ1 A;  4X0G A;  1TC3 C;  2WB1 N;  5CKT A;  3KP7 A;  2B9S A;  5FKN A;  3T1B A;  4RS8 A;  2OUM A;  4Q48 A;  2LBF A;  2ZJR F;  4EJU A;  3OYK A;  1XMA A;  3MZH A;  4DBR A;  1APL C;  2E19 A;  1YRN B;  3H0D A;  2PBI A;  2D5V A;  3RKW A;  5IP9 J;  2H6C A;  3HSR A;  1RUN A;  4U0W A;  1NK2 P;  4DZJ A;  1VQ6 I;  1VZ0 A;  2OCC H;  1OLT A;  3JRG A;  3QWL A;  2ACJ A;  4B44 A;  1X19 A;  3U9G A;  3BG9 A;  1FOX A;  1R6R A;  5IY5 H;  4L9T A;  1PJR A;  2MH9 A;  4NQW A;  1LVA A;  2QF7 A;  2DA7 A;  2KFD A;  3I5U A;  2ME6 A;  1EA3 A;  4C3I J;  1X4P A;  1MZB A;  1GV5 A;  2LVS A;  4E70 A;  4S05 A;  4DIQ A;  1W36 D;  2BEO A;  3M07 A;  1U0J A;  5CVR A;  1QO0 D;  2FML A;  4XRS A;  2JJ7 A;  2E7W A;  5F04 A;  3ECO A;  3DEW A;  4HNU A;  2BZT A;  3O3K A;  4GDF A;  2JRT A;  3OYD A;  3N97 A;  1GHC A;  3BWG A;  5E8G A;  2KIU A;  3LSG A;  4CZC A;  5J1Y A;  2FA5 A;  2DMN A;  1XPX A;  4CCK A;  5EG0 B;  1MIJ A;  1BOB A;  3ELK A;  3HPG A;  2OQG A;  4OMY A;  1QPM A;  4BHB A;  1BN5 A;  4F7Z A;  3A01 A;  2VKV A;  4XL9 A;  3NAR A;  3CO6 C;  2LG4 A;  1YW7 A;  4DBQ A;  4MHG A;  2E2J J;  2ZXW H;  4M3E A;  3K69 A;  3ZMD A;  2P5K A;  3FKI J;  2JVH A;  5CJ9 A;  2Y30 A;  3PL8 A;  3EDP A;  3WTU C;  1TWG J;  2ICW G;  4K2E A;  4KIF A;  2NOG A;  5ED4 A;  4DGW B;  1ONV A;  3WGH A;  2IA0 A;  3AG3 H;  5H2F C;  2HPM A;  3DTE A;  2VOO A;  4ZC3 A;  1OYI A;  1EH6 A;  3HTU A;  2R5Z B;  3OYE A;  2XC7 A;  3CP8 A;  4ZZL A;  4NHJ A;  4JOM A;  3GTQ J;  2R7Z J;  3DEE A;  5F27 A;  1RI7 A;  2GOM A;  4S0H B;  3FXM A;  4RLQ A;  4F55 A;  1ZRC A;  5E3M A;  2OQR A;  5LHG A;  4E7K A;  1YG2 A;  1R4M B;  2X1D A;  4GYI A;  3LWF A;  3S16 J;  3SZT A;  2QLZ A;  3S2D J;  4O3M A;  2HOA A;  2DOD A;  1GLN A;  1Z3Y A;  1WJF A;  1TNS A;  2C6Y A;  3BRO A;  2Q0O A;  1JKR C;  3F8M A;  2X6Y A;  3H3V K;  1W7P A;  3VOD A;  1MND A;  4JYK A;  1FWZ A;  2K85 A;  1OCT C;  1DPU A;  5L3E A;  2JMW A;  4I7H A;  2LH9 A;  2VXD A;  4LIV A;  4HQE A;  2ZKZ A;  1EH7 A;  2ADU A;  4G9Y A;  1TQI A;  1ZAO A;  4ZTJ A;  4LFU A;  4C30 A;  3JRB A;  5IYD J;  4M9X A;  1R5G A;  1Z77 A;  2XGE A;  3C2B A;  5K7H A;  3BCB A;  1Z9C A;  2G7H A;  5TIS C;  4WXH A;  2CW8 A;  3QOD A;  1WWX A;  2HKX A;  1JT6 A;  2ZO4 A;  2PX9 A;  2D1V A;  3OYI A;  2E1M C;  2ZSI B;  1SFK A;  5ICE A;  4HX4 A;  1FBS A;  1PDN C;  3PQJ A;  2R5Y A;  1IV8 A;  2YX7 A;  2LYC A;  1T95 A;  2Z99 A;  5DM7 F;  1ETO A;  2QZ8 A; 
#chains in the Genus database with same CATH homology
 2CUZ A;  3SYT A;  3KEY A;  4XKC A;  3SDB A;  2R7W A;  1BR1 A;  1X1A A;  1UEL B;  4BQQ A;  2CV1 A;  4XLC A;  4Y4R A;  1DGW Y;  4CCL A;  3K4N A;  2DT7 B;  4CCM A;  4XLF A;  3HOT A;  4E7Z A;  4E7H A;  3AL0 B;  2IXS A;  2KLO A;  4PSW A;  4EAT A;  2A5W A;  3VYT B;  4AYB A;  3S93 A;  5HOO A;  2R7R A;  3ZRG A;  2CV0 A;  4II2 A;  2X6W A;  4F92 B;  4XN0 A;  5FRM A;  2R7S A;  4N4N B;  2W00 A;  2QKL B;  3CMM A;  2X6X A;  1SAU A;  4F3Q A;  4XOR A;  4F91 B;  1N77 A;  4HRI A;  3HKZ A;  4E7J A;  4BQO A;  1LFP A;  3SZG A;  3ZGK A;  1UAA A;  2IS2 A;  3D5L A;  1DGR M;  2Q1Z B;  4J00 A;  4DJA A;  2MYS A;  3QYE A;  1D0Y A;  3PSF A;  3DWL E;  3ZXS A;  3K4B A;  2OV7 A;  4BE0 A;  2XDV A;  2E1M B;  3DKX A;  4U87 A;  1Z3X A;  3H35 A;  2F5V A;  3VYR B;  2R7X A;  3HL2 A;  2R4G A;  1X1D A;  3S3M A;  4XQF A;  3IUO A;  2Z1D A;  4BU2 A;  4BXF A;  3DPT A;  4J01 A;  1V5E A;  2Z16 A;  2R7U A;  4NNJ A;  4RM3 A;  3DQV C;  2O5R A;  1D0X A;  2DJI A;  3OYN A;  4CCJ A;  1X4O A;  1D1B A;  1NG7 A;  2R7V A;  3G2B A;  2KRC A;  2E60 A;  2ELJ A;  2V7F A;  3K4J A;  4BDZ A;  2WBM A;  1QU3 A;  1PYV A;  2VLA A;  2CH0 A;  4BJT A;  2VIX A;  2IGO A;  2HPI A;  2R7O A;  3CJQ B;  4AU7 A;  2UWM A;  1D0Z A;  3A4C A;  4HPQ A;  2V9K A;  3NWS A;  4PJL A;  3AL0 C;  3OYG A;  4XNF A;  2IGM A;  3K6G A;  4Y33 A;  3N05 A;  3RPU D;  2VKH A;  4LIT A;  3PNT A;  2WY8 Q;  1AA7 A;  4H4K C;  1X1C A;  1YX3 A;  4BEH A;  2VXZ A;  3OYA A;  2WAQ A;  3AFH A;  3LSM A;  4FET A;  3L2V A;  4B47 A;  2V1N A;  2VB6 A;  2LRD A;  3LFU A;  2HVS A;  4IQ4 A;  2L5Q A;  1FMV A;  2V6E A;  4N4O B;  2LOO A;  3EUK L;  2KRH A;  2LY1 A;  2VQG A;  2KMU A;  1WFX A;  1MMD A;  2HVQ A;  3QOE A;  4NC7 A;  2UV1 A;  1V5G A;  2E5N A;  2LBF B;  4F93 B;  3SEZ A;  5LD2 C;  2A6T A;  3DTI A;  3CJR B;  5CQE A;  3L2W A;  2M7A A;  3V42 A;  1TT0 A;  3BCA A;  4OAY A;  3W2V A;  2RNG A;  1NG6 A;  4BAC A;  2WA0 A;  4CCN A;  2KPM A;  4XLH A;  3MKZ A;  3PFY A;  2LC2 A;  4U7B A;  3MKY B;  3H9G A;  4P5O A;  4GRI A;  3HUG B;  5CPR B;  4ZDL A;  4NC8 A;  4XR6 A;  2R7Q A;  3OYH A;  4P1W A;  2ZXI A;  4XLE A;  4QPQ A;  4NQW B;  5JHF A;  3L2Q A;  4D9J A;  1BR2 A;  1D1C A;  1WJB A;  5HLT A;  5HVQ C;  4MLO A;  3VYS B;  4BQN A;  2W7N A;  1ERD A;  3MMY B;  3QYB A;  4BGD A;  4PJN A;  1WJD A;  2DOA A;  3FHN A;  1JI8 A;  2HVR A;  3RTR A;  3I3L A;  4BUP A;  2M7B A;  4CA0 A;  1WJC A;  3D5R C;  4ZYA A;  3HC7 A;  3VDX A;  4IZZ A;  3W2A A;  3M8J A;  1J09 A;  2E5Z A;  3A1Y A;  2VQH A;  2VQL A;  1E0E A;  2CFO A;  3RQ4 A;  4YEL A;  4LIU A;  4OAZ A;  3ZR8 X;  5TGT A;  4IQJ A;  4KIS A;  2GOX B;  3H5R A;  2L9S A;  3DKY A;  3EPZ A;  3BG6 A;  4XKW A;  4XOP A;  4HST A;  3MD2 A;  1K6Y A;  1OR7 C;  3DPL C;  2KP6 A;  4BE2 A;  4PFO A;  3OS0 A;  2I8D A;  3HXL A;  3OYL A;  2JSP A;  2LRE A;  2F4I A;  2VQC A;  1UG0 A;  3BLY A;  4ZDP A;  2RQQ A;  3PUB A;  4C2U A;  4AVZ A;  2X1C A;  3OWT A;  2CW7 A;  3NWT A;  2CUJ A;  1MMN A;  4YEJ A;  4CH7 A;  4BEH B;  2FUG 2;  3OS2 A;  3OYM A;  1MMG A;  2VAS A;  3E1S A;  3OYC A;  4RMN A;  2K5C A;  4RM2 A;  3RSN A;  2KZV A;  2R7T A;  3VWB A;  3TL4 X;  2IS1 A;  4XOT A;  2WB1 A;  1IRX A;  1KON A;  1WJE A;  3K70 C;  3CF2 A;  4ITV A;  4F52 A;  3RCO A;  3BG7 A;  2LY2 A;  3C2G A;  4HSR A;  3OR1 C;  4BJ6 C;  2Z2S B;  1FMW A;  2VL8 A;  4QPO A;  2VJI A;  4CSW A;  3PJR A;  2XF6 A;  1WJA A;  4XON A;  2L9N A;  3W2W A;  1BR4 A;  3QYF A;  3FBI B;  4C9Y A;  2IS4 A;  2MC4 A;  5FRO A;  4E7L A;  3GBG A;  3S32 A;  2HDW A;  1LDK B;  3K4C A;  2L2O A;  4HG2 A;  2X1E A;  3AKZ A;  4KJZ A;  2W4S A;  3I9V 2;  1Z7L A;  4HNT A;  3A2K A;  3OMY A;  2MAB A;  4ZTF A;  4IKF A;  1Y56 A;  5KNL A;  4ZDO A;  2HU9 A;  3CP2 A;  4II3 A;  2DXI A;  3IAS 2;  1W36 C;  3LL7 A;  2JVG A;  5KCM A;  3VSL A;  3OL3 A;  2PJR B;  2XAU A;  4RLF A;  4B48 A;  3K4M A;  3W3C A;  3TMO A;  3FBN B;  4Y3O A;  2AQF A;  2DT6 A;  1YX5 A;  3LSI A;  2KDO A;  1YE9 A;  3OYB A;  4PK4 A;  4XLA A;  2P0W A;  2ZXH A;  3F9K A;  3DLA A;  3OIQ A;  3K70 D;  2XF5 A;  2CMP A;  3LSK A;  1QHH D;  3HG9 A;  2W82 A;  2AQE A;  2ZSH B;  4G6T B;  3OOU A;  2KL4 A;  4HEA 2;  2Q2E B;  1P9Q C;  3DU5 A;  4XM3 A;  4B3X A;  4X0G A;  5CKT A;  2F6C A;  3H5A A;  2K9L A;  1ZEL A;  3S3O A;  2OUM A;  3UNG C;  1MMA A;  2LBF A;  3CZ6 A;  4YRV A;  3OYK A;  4XMY A;  1DP3 A;  4DBR A;  1T0F C;  3S8P A;  1N75 A;  4XN3 A;  3H0D A;  3K4L A;  3HOS A;  2IGK A;  3H9Q A;  2W1O A;  3VYU B;  3OYJ A;  3VSK A;  3BC8 A;  3ZQQ A;  3ONQ A;  2UUZ A;  4CCO A;  2HQA A;  1QHG A;  3IAM 2;  2BW3 B;  2JUG A;  5HNH A;  3SEQ A;  3J7A Y;  2V4J C;  4PFP A;  1WJ5 A;  1VZ0 A;  4D1Q A;  1OLT A;  1G59 A;  2WAF A;  4PSX A;  1Y6I A;  4B44 A;  1X19 A;  3S3N A;  3L2U A;  1R6R A;  4KT6 A;  2WY7 Q;  1PJR A;  2M4G A;  3ZCO A;  3E0J B;  3K4K A;  1D1A A;  2V26 A;  1EA3 A;  4E7I A;  3PNY A;  3LMM A;  1X4P A;  3UR3 C;  4E6K G;  3EUH C;  4FAS D;  4DIQ A;  5CQG A;  1W36 D;  2IGN A;  1U0J A;  3OYF A;  3M1C A;  3OIP A;  2VKD A;  2WAD A;  4PJM A;  2M0M A;  4HNU A;  2HNH A;  2K3P A;  2L7K A;  3OYD A;  3FKJ A;  3HPH A;  3LSG A;  2QKM B;  4CZC A;  1Z21 A;  4CCK A;  1BOB A;  3DU6 A;  3HPG A;  3C2H A;  4C2T A;  2OC6 A;  2PMZ A;  4XL9 A;  3OL4 A;  4ANJ A;  1X1B A;  2MD0 A;  4E4H A;  3EUA A;  2LG4 A;  3H9J A;  4DBQ A;  3DPU A;  4NUB A;  2CS3 A;  4PUS A;  3FDY A;  3KYL A;  2NOJ B;  2JVH A;  2PJR A;  3PL8 A;  3TBI A;  2JA2 A;  2Y0S A;  4BL0 B;  3OY9 A;  2VJJ A;  2KHM A;  4DGW B;  2BOL A;  4E7S A;  2ZFU A;  2HPM A;  2XSJ C;  3DTE A;  2DCE A;  4DOZ A;  2XF7 A;  4ZC3 A;  2KQR A;  2MFZ A;  3OYE A;  2XC7 A;  3L2R A;  1DQU A;  3CP8 A;  2RRE A;  3OS1 A;  4B43 A;  4JOM A;  4BS9 A;  3D5S C;  3DEE A;  2VJ5 A;  1V5F A;  1MNE A;  1LVK A;  3LSH A;  2GOM A;  4RLQ A;  4F55 A;  2X85 A;  4PJJ A;  4ZJZ A;  3U21 A;  2K9M A;  4BDY A;  4E7K A;  3CES A;  2X1D A;  2VJ4 A;  1G8X A;  1S9H A;  1N78 A;  4LG3 A;  2HZD A;  4BJ5 C;  2BVL A;  1GLN A;  1Z3Y A;  1WJF A;  2X6Y A;  5FRN A;  4CUG A;  4KIT B;  1MND A;  3IP4 B;  2LH9 A;  2VXD A;  2CV2 A;  4LIV A;  4IX7 A;  2BW3 A;  4BE1 A;  5HNF A;  4ZTJ A;  3PNV A;  1TZL A;  4C30 A;  3K10 A;  4XKB A;  2M4K A;  1MW7 A;  2BVM A;  3H5N A;  4R79 A;  4OWR B;  3BCB A;  2X51 A;  2M3A A;  3MKW B;  2IS6 A;  5KHD A;  5LFA A;  2WAE A;  2CW8 A;  3QOD A;  4XKV A;  3KX2 A;  3OYI A;  2E1M C;  1LKX A;  2ZSI B;  1SFK A;  1HA8 A;  4JQF A;  2LYC A;  1T95 A;  2VPL A;  3DTK A;  3PSI A;  3OR2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...