2CUJA

Solution structure of swirm domain of mouse transcriptional adaptor 2-like
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGIDSGLSPSVLMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional adaptor 2-like
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cujA01
2AQEA 2CUJA 2DCEA 2AQFA 2ELJA
chains in the Genus database with same CATH superfamily
3EYIA 3HSFA 1XGMA 3L2QA 1H9TA 2ZO4A 3B6AA 5F6FA 1LUJB 2D45A 1I27A 3H36A 2EBIA 1LVKA 2YPRA 3S8PA 5BPDA 3FXMA 1Y0NA 5EF6A 2B63J 3KYDB 3S14J 2LY2A 4I02A 1F36A 2LYCA 3BP8A 2OU2A 4PGHA 5D5VB 3HDDA 4C9YA 4IRHA 5J8CA 5HLIA 1M1EB 1BW6A 2QENA 4KISA 4ZTFA 1MBFA 2K27A 2B0LA 2HTJA 5H6QA 3LSHA 3HUGB 2P5KA 2FQ3A 3FK7A 5FROA 1ZAOA 5FLXZ 1PUFA 3BC8A 2NVXJ 1FY7A 1D1BA 3HC7A 3T8TA 2L3DA 1OCTC 1TQIA 4G7HF 1R00A 3KEYA 2LRDA 3RKXA 3DBLB 2IVMA 3OYKA 2RGVA 2P8TA 3DV8A 1DDNA 3OYIA 2BY2A 2K9NA 2MH2A 4L5JA 2JTVA 1RR8C 2OTJI 4ZC3A 3FMRA 3CQZJ 5IY5H 3WE3A 4YFNF 2YU3A 3K70D 3CP2A 2KPMA 1C0WA 1OYWA 1JUSA 2ZXJA 2HR3A 4B43A 5EG0A 4II3A 4FTHA 3S3NA 1HSTA 1O7FA 2GOMA 4WWCA 3I59A 2QLZA 1EH7A 1S5LC 5E8GA 3JREA 1V3FA 4MNUA 2Y0MA 3CMMA 3W2WA 1U9OA 3QP5A 2JSPA 2UXNA 2FSWA 1QVTA 5BOXA 5AIPA 2DYRH 1ZG1A 5DD4A 3CESA 2V9PA 4F91B 4A5NA 1BI0A 1LE8B 2JMWA 2VODA 1RESA 2JSCA 5HODA 1VQ5I 3S32A 1ZH5A 4EJUA 1AKHB 1GT0C 2OD5A 3MWMA 5J1YA 1FSEA 1FOKA 1H9GA 4CXFA 1DU6A 3S17J 5EZHA 4YELA 1Z21A 2CO5A 2PN6A 3ERMA 1ETOA 3CC2I 4JX6A 2XKOA 2KIQA 1HW1A 5CLSA 4LGWA 2LD5A 3DWLE 4ASNA 2G7UA 1BA5A 3DFGA 1GVDA 2VE8A 1XGNA 2O7OA 2D5VA 3LSGA 1STZA 3GZNB 4P9FA 3ZQLA 2F2EA 2DFIA 1ONVA 2DLLA 1XX5A 1FTTA 1JT0A 3PO3J 4Z2YA 1ZTRA 2CUFA 4L9NA 2DT6A 1Q1VA 2RAEA 1QPMA 1UFMA 2XAJA 3WHCA 1MJBA 2K3PA 3E6CC 4ZH4F 3PFYA 4EVIA 1N77A 1LKXA 5F0FA 3FMQA 1XC5A 1RZ4A 4UNOA 2ECBA 3CLQA 1A04A 3HIFA 3ZRGA 4IHTA 2XF7A 4Z6YA 2VQHA 3CCJI 4CDGA 1Z6TA 2QBYB 4CZZA 3A1YA 3OS0A 3TKYA 1BW5A 1WKMA 3QRFF 4ZZDA 4OWRB 2VQLA 3L00A 1OYYA 3ABLH 4CICA 5FJ8J 2OQRA 1PYVA 2R7OA 2VC1A 3M8FA 2UV1A 4OU0A 3KEQA 3KPHA 1YLFA 4ZDPA 4B3AA 1FOXA 4LLGF 1O4XA 3KX2A 5DUKA 3OR1C 5D6FA 3HXLA 1G3WA 1Y8QB 4PZJA 2MBFA 3Q0WA 2JVGA 3JRIA 2PFBA 2DT5A 5K7HA 1VQLI 3AG1H 4HPQA 3KZZA 2FEZA 4Y17A 2Z9OA 1OYIA 1UHMA 4C2UA 3LQRA 1JGGA 4X6AJ 2MG4A 3EPZA 3HBLA 2VBWA 2P7VB 1WJCA 3DP7A 3OS1A 1K6YA 2LVSA 4M9ZA 3BR3A 1ZK8A 1S3JA 1IW7F 3U2RA 3GTLJ 1UG0A 2FU4A 2MC3A 3Q3SA 5L3CA 2L7KA 1MMSA 4B8XA 5LFAA 2WWYA 2VLAA 4N4NB 3CP8A 3BDDA 2RC4A 4HV6A 3TO9A 2FOKA 2DTRA 4XLEA 2BY3A 1T95A 2PMZN 4I2OA 4CYCB 4AD9A 2QQ8A 4BE0A 4WCGA 3BY6A 4L5IA 4M6XA 5D5UB 4MHGA 5J1RA 1R6RA 1LDJA 2CRGA 3GFIA 1RI7A 1R9TJ 3TW6A 4BEHB 2OAZA 4L5EA 3LSIA 1GV2A 2XPVA 5A2QK 2R4GA 3OV8A 1R1UA 2J5PA 1GV5A 2JPBA 4M74A 4XL9A 2KJCA 2PJRA 5CYVA 2MH9A 4DYQA 3G71I 1ZR4A 1FEXA 2FXAA 3HRSA 3BWGA 3DBHB 3CDIA 3S1MJ 4LG0A 1LEBA 1E2XA 4M6YA 1QBJA 4A3DJ 4HQMA 2JRTA 3W2AA 3KP7A 4OAYA 1IO2A 2ZJ2A 1TWGJ 2HVRA 1Z67A 1YX3A 3IAM2 3WTUC 1XSXA 1TWAJ 4CZCA 1HCRA 3OOUA 2ZB9A 3RZDJ 3KYLA 3IKVA 4IRIA 2LBFA 3HRUA 3I54A 4RLQA 2JK3A 4A3IJ 1DP3A 2KHMA 1JJ8C 3V8KA 5A2QZ 2F4IA 2IA0A 1YI2I 4L18B 3A03A 2M1BA 3GO5A 3QU6A 1SAXA 3DPLC 5D5XB 5CJ9A 3OSGA 2V9KA 2XDVA 5D4RA 4GDFA 2GAUA 2CWEA 3HM5A 2A6TA 4CCOA 2K7LA 4R8HA 4M3FA 2NNYA 3GF2A 3WU0A 1SC7A 3VYRB 3RPUA 4AU7A 4HQEA 3PIOF 3F6OA 1GXPA 2VXZA 2PMZA 2YX7A 3JAMK 1QHGA 1CQTA 5IYDJ 1MDMB 4KT6A 1TQMA 1R7JA 2CFOA 4NQWB 1R22A 3KYCB 3IL2A 4XRSG 1ZYRF 2R7TA 2X6YA 4EEFG 4U7DA 2JWTA 2NNNA 2PBIA 4XKCA 2Y31A 2DFFA 3BROA 2Q1ZB 5LEJA 3C18A 1I39A 2BW3B 1XMXA 1JT6A 2NS8A 2CW7A 4D7MA 3FM3A 3OYGA 1GDTA 4PJ0C 2W00A 3ABKH 1IRXA 2Z1DA 3TP3A 4UB8C 1IN8A 4U0WA 3LA2A 4XR6A 3JAMZ 2XVCA 2DMQA 2E5NA 3JTGA 3CUQC 2LKSA 3RYPA 2JA7J 2WY8Q 2DOFA 4BL0B 2IT0A 1ACIA 2XPWA 2R0QC 1KZHA 5HDKA 5TRDA 1AHDP 4KIGA 4IZZA 2CQXA 3E5UA 4XRMA 1I3AA 3DBRB 4I76A 1SAUA 5E3OA 3M7GA 4I7HA 2W4SA 2HKXA 1YIOA 3F8FA 4OIQF 4RS8A 3CCLI 3GTOJ 2BBYA 3CDLA 1R5GA 4MFDA 2KMUA 2W85A 3I5UA 1HF0A 5JHFA 1JHFA 4QLCU 4IQJA 3LNQA 3M07A 1JI8A 3FX3A 1SVOA 1XN7A 4C2MJ 2EFOA 4L0YB 2CYYA 3AKZA 3WU2C 1P7JA 4ABZA 5ILUA 2TCTA 4BQAA 1AU7A 3HOYJ 1OCRH 5E1ZB 5J40A 1OLTA 5FRMA 2E1CA 2W1OA 2Y75A 5L3FA 3GMEA 1IDZA 5FGMA 2XSJC 4GGGA 1ETYA 4B44A 3JRBA 1IN7A 2KIMA 5ERIA 4G6DA 1JKRC 3FXUA 1U8RA 2VOOA 1SANA 5J4VA 1SVLA 3RQ4A 5F04A 1I50J 1W7PD 3QU3A 4BACA 3T5XA 3VEPA 2X6OA 4ENJA 4A0YA 5BMZA 2RNGA 2X6XA 5HS9A 1WHUA 4B47A 4S0HB 1LE8A 1HKTA 4HV5A 2XASA 1T6SA 3BLYA 4YFKF 4X1EA 1USTA 3WGHA 4LJZF 1OISA 4GCVA 1ZLJA 1K4SA 1UJ8A 4EJVA 4AYBN 5LHGA 2R5ZB 3GVAA 1AKHA 3CO7C 4OIPF 5FO5A 2VONA 1ON2A 1X1AA 4EMSA 1B8IB 2R92J 1IV6A 4JP0A 1UAAA 1S6LA 1VQ6I 1OR7C 1TL8A 2OV7A 3MD2A 3CF5F 4RGRA 2XRLA 4N0BA 4KN7X 1TW2A 2O9LA 4G7ZF 2OCCH 4A3EJ 3U21A 5EZGA 4F92B 3OL3A 1SFEA 2DDBA 3CUQA 5IOYA 2AS5F 1ITYA 2M45A 3RPQA 2RKHA 2HQ5A 1FPQA 2K9MA 2VKHA 4JBAA 3ZXSA 3WTZA 3SDBA 2CS3A 2M5WA 1H89C 3K2ZA 3LFKA 3AG2H 3BTJA 3HOTA 1TTYA 3S2HJ 1X19A 2CU7A 2VKDA 2KRHA 2JA5J 1U78A 5CVUA 3K9TA 3WTVC 4QWQA 1JTYA 4RMNA 2XV4S 2WAEA 2XRNA 1KU3A 2XUBA 3OY9A 1ZGWA 1OKRA 2QQBA 5IP7J 3H5NA 2VIXA 1VTNC 3OYHA 1X4OA 1PJRA 1QRYA 2QKLB 3HEFA 4BQNA 1MGTA 2FNAA 1AWCA 3IWZA 5F1RA 4HF0A 2M30A 1DUXC 2KRCA 4FCYA 1HW5A 3I55I 2JA6J 5K5OA 3SJMA 5ICCA 2PG4A 3F8BA 1RUNA 1IAWA 2V1XA 3HSRA 1UHWA 2W7NA 1U5TB 1DQUA 2DN0A 1KYWA 2RQPA 1D0YA 2V1DA 5M5XJ 4ZDLA 1A35A 2CG4A 3OS2A 2QZ8A 4PJJA 2OF7A 1ODDA 1Z7LA 5L3DA 3AAFA 1ZRCA 1YRNB 4RGUA 2D1VA 1AA7A 2DA1A 2NYXA 2HOSA 2ACJA 3ZMDA 5ICGA 2K40A 3K69A 2DA6A 4AYBA 1WGXA 5JVTA 2I10A 1ULYA 5FKOA 2KIFA 2HYGD 1SFXA 1ORKA 5FKKA 1OR7A 1TNSA 2HDCA 2FA5A 1T38A 2L5QA 4WXCA 1Y0UA 2Z33A 3ZMVA 4DNCA 3I56I 2KJBA 4JK1X 1FX7A 2I8DA 1WZ2A 1PP8F 1NK3P 3H5RA 3WTSC 4UVCA 2JN6A 2R7FA 3F22A 4F52A 4CYCA 1P4WA 2F5DA 1XSDA 1YW7A 2WB1A 1DPUA 2KZGA 4BDYA 2GIZA 1WH5A 4EJTA 1BOBA 4G6TB 1IDYA 4BEHA 1D1CA 2O3FA 2XF5A 1LQ1A 2VBZA 5B3SH 4BNCA 2Q2EB 4L9VA 3QQAA 5TJJA 3MQ0A 1BM9A 1JUMA 1GXQA 1U3EM 3QYBA 4KYWA 4BAYA 3F23A 2XAUA 4FETA 1BC7C 3HHGA 3I4PA 3OYLA 3SXYA 3TL4X 2L9RA 1YO5C 2ID6A 5GPAA 3S3OA 4AWXB 2HNHA 3IH4A 3V8LA 4BXFA 1MNDA 2IAIA 1MBJA 3CO6C 3KP4A 3CZ6A 2EILH 4XNFA 3W2VA 3B02A 4YIFA 5M5YJ 1POGA 2CUJA 4XSXF 1N25A 2W25A 2VT3A 2M8EA 5FFXA 2G7HA 3GFMA 1ZGAA 4DOZA 3J81K 1X1CA 3WG7H 3GX4X 1ETQA 2V6EA 2IA2A 4I98B 1SEUA 2QQAA 1BL0A 4ZTJA 2EA4A 5F0CA 2BVMA 1ERDA 4UV8A 1DGRM 4HX7A 4ON0A 3WTWC 3RZOJ 4M3EA 1IJWC 2PLYA 5M5WJ 3WGIA 2VQCA 3LSRA 4KDPA 4L9TA 1D5VA 2R5YB 2VOPA 1FT9A 5FLVA 3TO6A 1KGSA 2K86A 2WV0A 3VODA 2OTLI 1QA6A 4OINF 2MABA 5HS8A 2XGXA 2FOWA 2F5EA 2VKEA 3J81Z 2LNBA 5J6XA 1MDMA 3JCUC 4MQ9F 5M3MJ 2M0CA 5DEQA 1BBYA 2MA3A 1RR7A 4NQWA 2VBYA 4RB2C 9ANTA 4WX9A 3H5AA 1XSVA 3ABMH 1FIAA 2GBYA 3F9KA 2ISZA 2RN7A 4HLXA 3NEUA 2QKMB 4LFUA 3ZQHA 2CGPA 3OYJA 3IKTA 2XGEA 5JHUA 3ZOBA 4R79A 1DGWY 3D1NI 1JUPA 3IP4B 2A07F 1VQ9I 3DF8A 2BW3A 3Q0VA 1SFKA 2DCEA 2JZYA 4CH7A 2QEXI 4ZZLA 4XQFA 2HGCA 2X1DA 3HHHA 3OYFA 2QF7A 5DYMA 2CH0A 3E7LA 3FXJA 4RAFA 2FF4A 2VJ4A 4GXOA 2A5YB 3EUHC 2E5ZA 3GLXA 4XK4A 3R0AA 4CCMA 1CGPA 5D4SA 5KNLA 1LFPA 5KCMA 3JRHA 2DBBA 2EIKH 1EJ9A 3HSEA 1T2KA 1BJZA 2FBIA 1YX5A 4FQGA 1WJ5A 3CCMI 1G6NA 4PJNA 4D9JA 4A93J 2KDOA 1TBXA 1R1TA 1QGPA 3LOCA 2QSFX 1YW8A 3N97A 1J5YA 3L2VA 3UR3C 5LEKA 3T0YA 3KZYA 3BZCA 4XOPA 3WE2A 4E7JA 3K6GA 4P1WA 1NK2P 4P55A 1HA8A 1LNWA 4XORA 3H1CA 1I3QJ 1SD6A 5GP9A 2PEXA 1R5ID 2M7BA 2VC0A 3CCQI 5H20A 3CCRI 2EFNA 3F21A 1DU0A 4UVAA 2H94A 1NG6A 4HDUA 1X1PA 3NWTA 1T98A 2ZKZA 3I4NJ 1ZELA 3P9IA 1JXSA 4A3LJ 2QA4I 2HVSA 1Z3YA 2BGCA 3DPUA 1ZKGA 3SZTA 1KYZA 3V4GA 3HZJA 4G94A 2YX4A 3AG4H 4I99C 4UUTA 5LHIA 4JOMA 2QQ9A 3D5SC 1MW7A 2MLGA 4Y3OA 2D2WA 1UCRA 4P96A 3ULQB 3D5LA 3WODF 1U5TC 2ECCA 2L9SA 1K6OA 1Q1HA 2X1CA 4DYCA 5HS7A 2A05A 3HOSA 2WAQA 1ZRDA 5IOZA 5FD5A 3SEQA 3U9GA 2YS9A 3ELKA 3PJRA 3AFHA 2HPIA 2A61A 5HLTA 2DA3A 3I4MJ 1RPWA 2R5ZA 1S7OA 2G9WA 3BT9A 4IHYA 3L2UA 2H27A 4IXAA 1B8IA 1YE9A 4RB0A 1PDNC 2HXOA 2DOAA 1F43A 2QM3A 3I71A 2DXIA 2R3SA 3EUHA 3V7CA 2GZWA 2UXXA 4IKFA 4YRVA 1JKOC 2KP6A 3BTCA 5JI6A 1K83J 2GOXB 3K4BA 5H2FC 4A3CJ 6PAXA 1BI1A 2E71A 2LH9A 3VYSB 4G7OF 5CVVA 1IXRC 4LITA 4GO1A 4MO7A 1RKWA 4NUBA 3S16J 1X58A 2V26A 4UV9A 1IXSB 1D3YA 2DA5A 3I0TA 4IQ4A 2MYSA 2ZFWA 3Q9VA 4HW0A 1P92A 1YJWI 2E36A 3NAUA 3LSMA 3FDYA 1XS9A 5CVIA 3L2WA 2JUGA 2H6CA 4NDLA 5LLQA 3O8GA 3EETA 4Y52J 3UKGA 3BTLA 4N9HA 1FMWA 4IJAA 1UHSA 4Y33A 2JA2A 4HX8A 1FZPB 4FHTA 2XB5A 1N78A 3E1SA 4WK8F 3QPTA 2N8GA 3IRQA 3IC7A 2HVQA 2Y0SA 3BQYA 3L1PA 4ZYAA 3N05A 2CW8A 1O57A 4D0PA 4O3MA 3PM1A 1U5TA 3RSNA 3OL4A 3JTHA 3K0LA 3ZMSA 1E0EA 2L4MA 2AQFA 1TWFJ 4KJZA 1Y1WJ 2EV5A 3ESWB 2Z3YA 3CJQB 1TP4A 2LDUA 2MSYA 3ECOA 2FE3A 1XDUA 2ZCWA 2R7DA 3BR1A 4U87A 3ZQFA 5B5EC 3JRGA 3RPUD 2E2IJ 5DDGA 3NWSA 3JSPA 4BJ5C 4EV0A 5C3EJ 5K5QA 2DA7A 3PIPF 3WGGA 2IA1A 2UZKA 2FX0A 4LB5A 3ISPA 1H88C 4CCJA 4XICA 3TO7A 4XSZF 1F4KA 4CCNA 2IS4A 2LP0A 2OPTA 2XF6A 3BR2A 4KFCA 4MTDA 2DMUA 2HOAA 4EGYA 1U6GA 2VPRA 3L7WA 3GFJA 4HA8A 5KK1A 1S7EA 4E70A 4A12A 4KNYA 1T0FA 1MBHA 1TW3A 4R1HA 1HXDA 4CYDA 3QOEA 2P6SA 3LMMA 4MQVA 1HC8A 5HNHA 1RUOA 2H09A 3C2BA 4A2UA 2KFDA 2EINH 4KMFA 3ABUA 3AL0B 2Q2EA 3DLAA 2KRFA 3MFKA 1QHHD 2NS7A 4K2EA 3HGGA 3N4MA 3DTIA 1F9NA 1HDPA 4FISA 3OYEA 2WC2A 1BIAA 1MBKA 4OOIA 3S1NJ 1BR4A 1HOMA 2IGMA 2STTA 4O5VA 2X51A 3FKIJ 2XROA 2V7FA 5C44J 3AG3H 2X1EA 1XDSA 4E7ZA 2DYSH 3FBNB 4ZYGA 4LG3A 3CLOA 2E60A 4PDKA 1UMQA 5DCMB 2KZVA 5EEAA 3VPRA 1E3PA 1XD7A 2E1MB 4IPAA 2ZBKA 1YHQI 4KUMA 1FYLA 3HG9A 4IHWA 3PSIA 1LEAA 4PSXA 2RNJA 2ZSHB 3LL7A 4OAZA 5B66C 3ZN1A 3E5QA 1VI0A 2CFXA 1W1WE 4LK1F 3A01B 2O61A 1IC8A 4AVPA 5GAEJ 2GXGA 4ESFA 3OWTA 4ZDOA 3QP6A 4WXDA 4AVZA 5FKLA 2NAZA 1VZ0A 2E35A 2J5OA 3RKWA 2V6CA 4A0ZA 2X6WA 3MKZA 2COBA 1MH3A 4LB6B 3DLLF 2XGCA 2W84A 3H9GA 1WJEA 4BHPA 2QWWA 5EYRA 4GYGA 3J7YJ 2KIUA 1W4MA 4PGGA 3PNTA 4UVBA 2ZNYA 3GZ5A 4UXNA 2W57A 1S29A 1Z05A 3MAJA 4WXHA 5EEGA 3VSLA 2CV1A 1O3SA 2LF8A 2LC2A 2DODA 2ETHA 2HTSA 1T39A 2XAGA 1WH7A 1E17A 2CQNA 4G12A 1TT0A 4I09A 4PCQA 4OIRF 2OZUA 1Y56A 3B6CA 3IH2A 3GXOA 2UWMA 3TDUC 1VNDA 3J7ZI 1REPC 5K7FA 1JKPC 3K4CA 1HDDC 5LRRA 4BJTA 1FYKA 3HGYA 3GWZA 1QZEA 2WADA 2WV1A 1QQIA 3KP2A 3KP5A 4QTRA 1K7AA 3HOXJ 3GTMJ 2Y48A 3PQKA 5FD6A 4IOAF 1I6HJ 4AIDA 3RYRA 2X85A 5HLGA 1XPXA 4AIKA 4FX0A 3B73A 5C4JJ 3LSJA 2ICWG 3HUGA 5IT9K 3BJOA 1N75A 1WPKA 4IHSA 5BQTA 3KLOA 2FRHA 2FQ4A 3QODA 4CHUA 2DO7A 2R7QA 3O8HA 1NTCA 2ZFUA 4KITB 3H35A 1PUFB 4KT5C 2A6EF 2ZJQF 2IGOA 1YJ9I 4BY7J 4PK4A 2DK8A 2F4OB 4I01A 4OIOF 5M3FJ 2O8XA 3K4LA 3PNVA 3TP0A 2GM4A 1LVAA 3MKWB 2DK5A 1IV8A 2LF7A 4BBSJ 3ZR8X 2Y9YA 3RJPA 5FB2A 1QPIA 3HOZJ 1BJAA 3IUOA 4MGRA 1MMGA 2W82A 4A6EA 4C3HJ 2M0MA 5IT3A 3JSOA 1MNEA 1O7LA 5CVRA 3M3YJ 5E3MA 1XMKA 3R4KA 4HSRA 2A3SA 2AXLA 3BPVA 4IRGA 3L09A 3I53A 1D5YA 5J3LA 1W36C 5IT9Z 1SFUA 4LIVA 1H8AC 4IHXA 4RM2A 3OOPA 1JKQC 1YQAA 3KLNA 1NHAA 4NHJA 2NOJB 4YG2F 4RAZA 4DQ2A 5FRNA 5B1BH 5LHHA 1KQ9A 2F5FA 4DGWB 5LGTA 4CCKA 2HOEA 3P5JA 2ELHA 1P4XA 2L2OA 3HOVJ 3A02A 4EJOA 2CJJA 1MZBA 2GA1A 4UB6C 3T8RA 4Y15A 2LMDA 3NQOA 3E6DA 3GUDA 1R58A 1TQPA 1A6IA 5E18F 2GIVA 1MJ9A 4P9UA 1FTZA 1Z3XA 2HOTA 4C30A 1S9HA 2HS5A 4P5OA 4RM3A 4E7KA 1ETXA 2JA8J 3TOBA 1RETA 1IRFA 2EK5A 2WB1N 2IJLA 3CCUI 2CUEA 3ZQQA 2VJJA 1I1SA 2K4JA 2ZXHA 4MFEA 4XLHA 3VOEA 3OYDA 5JFRA 2KLOA 1ZG3A 3CMYA 4A3MJ 2OUMA 4M3DA 1W5TA 1UELB 1GUUA 5J47A 2ZMEB 1D0XA 5FKMA 2BEOA 3HOUJ 3RQIA 3HOWJ 4BXUA 4A3GJ 4DYRA 4E7SA 2P5VA 4U7BA 1MMNA 1PVEA 2HZTA 3TOAA 3M4OJ 4IL6C 2QBYA 1FJLA 1TC3C 2L4AA 4V2FA 2GQQA 4BS9A 3SZGA 3M1CA 4UHTA 5JLXA 1P6RA 4BUPA 3GTGJ 3LAJA 4QSHA 3FXLA 3ZQCA 1IUFA 2L01A 1NG7A 2JRMA 5F1JA 3D5RC 2LR8A 4CO8A 4HZFA 2L9NA 3CD6I 4AIJA 1YJNI 2DU9A 1I5ZA 2CUZA 4A3KJ 4H4KC 2M3AA 3F0CA 3C3WA 3BR0A 3IHUA 1K79A 4EM1A 2EV0A 2P4WA 3VDXA 3RDIA 3A4CA 2ZJRF 2B9SA 3BCAA 2NRAC 2PMUA 5HDGA 2VBXA 2E1MC 1XB4A 3QPHA 2Q0OA 4XRFA 1WRJA 3RIRA 4A3JJ 2TDXA 4KN4X 2IEKA 1P2FA 2MLKA 1F1ZA 2X0LA 3V7RA 2A5WA 1R5HA 1D8JA 2DW4A 2M4KA 3GBGA 2ZJPF 2FJ1A 3GTJJ 1Z77A 5J8FA 4M9XA 4YEJA 4IHVA 1OCOH 3ZQIA 3GTPJ 2E1OA 3QPLA 3CTAA 5JVGF 1DPRA 5J4YA 4CA0A 2PX9A 2ZXWH 3MKLA 4BJ6C 1B59A 4NC7A 2YUSA 3QYEA 2BHYA 2O0YA 1YG2A 2ZSIB 3P7NA 2RQQA 3QOPA 4HAMA 4QPQA 2GA2A 3BTIA 4CSWA 2KT0A 2R7RA 3BPXA 5EDNA 2OC6A 4D5FA 1XG1A 1O3QA 4EGZA 3DQVC 1F5TA 2E34A 3EUKL 3PQJA 1ZRFA 5LGNA 2JQ7A 3G1LA 5BS6A 3RI4A 3VB2A 2HI3A 2P0WA 4FE4A 1EF4A 4D7NA 2R7XA 1V5EA 1Z91A 3E6BA 5HNFA 2ELJA 5H6RA 4XLCA 4BU2A 3K4KA 1S8NA 2BYVE 5ICEA 2OBPA 3OIQA 2OQGA 2M87A 3VWBA 2CQQA 3IV5A 2ME0A 2BZTA 2ID3A 3MZ8A 5DUIA 1R4NB 2NOGA 3DKYA 5DS9A 2QVOA 1IN6A 2AXTC 2KISA 2QYOA 1D1AA 1U9NA 2HXIA 4BGDA 3RKQA 3ZMUA 1A31A 5DD8A 3X2QH 2IGKA 3LSKA 3S2DJ 3QWLA 1XMAA 3FWEA 3LSTA 2GXBA 2FBHA 1JGSA 4M71A 2NS0A 4ITVA 1IRGA 3OMYA 2WA0A 3QAHA 4QPOA 5DCMA 3O2PE 3BZ6A 4XBFA 4B48A 2Z5UA 4A0XA 2CSOA 3OR2C 4AC0A 3C1DA 4M6VA 1G59A 4QIWN 2IP2A 4BE2A 2A68F 4NNJA 1YOVB 5CVJA 3SEZA 3A01A 4YFXF 2EA2A 3QPSA 3U1DA 3G4SI 4DJAA 2LFBA 2LOOA 3W6VA 1ZHFA 2CQKA 4B4CA 1G3SA 4KICA 4XKBA 5GTIC 3PNYA 5J1UA 4RBOA 4CGZA 2K9QA 4B09A 2R7VA 2ADUA 1XGSA 3S93A 3GYHX 2VL8A 3TW7A 2A69F 3CC4I 3ERED 3S1RJ 3EQLF 4HOBA 3RKYA 1LFBA 3OIOA 3CCSI 1MSFC 3ML6A 3O6BB 4HX4A 2QGUA 4GYIA 3O3KA 3H9JA 2HQNA 3MVPA 3VFZA 1MH4A 3EUAA 2K5CA 3CJRB 2WAQN 1B72B 4BKXA 2HFHA 2KL4A 2BOLA 2BV6A 5B1AH 3MMYB 3W3CA 5FLMJ 3WTXC 4AM3A 3FHNA 4E4HA 2IS1A 3K10A 2VQGA 2MC4A 1FOYA 3SFZA 3BR5A 1VQ7I 1BI3A 4IOCF 2L0KA 3HB9A 4OMZA 4LLNA 3C2HA 3BR6A 3G2BA 4Q47A 1J0RA 1KONA 2V1NA 4XLPF 3V7SA 2K9LA 2LTPA 2Q8KA 1ZLKA 5LD2C 2OCEA 4RA2A 3ZGKA 4Q5SF 3EDPA 1FLIA 3H3UA 5E3NA 5L3BA 2GXAA 3E97A 1YS7A 4FASD 4XRSA 4MIMA 3CJTB 1I6XA 3F8CA 5DM7F 1X4PA 3F72A 1T8IA 2ISYA 3RCOA 1TNTA 4Q48A 2HDDA 1MMDA 2K85A 2DQRA 2X9DA 4ESBA 5KAIC 3DCFA 3DXJF 3G6EI 2ZMEC 2DI3A 1A5JA 1BN5A 2RV8A 2F48A 4S04A 1RRJA 1B1BA 1HKSA 2DMTA 5K1YA 1QO0D 2MGQA 3NRVA 3TGNA 4JX5A 4ENNA 2QSHX 2WBMA 3D0SA 1Y1VJ 3E3VA 4E7LA 1HBXG 1KU2A 3TBIA 2P7CB 3PUBA 4HF1A 2JVHA 4G9YA 1MBGA 4Y7NJ 1WI9A 3KP3A 3SDGA 2EZLA 4E7IA 1HW2A 1S72I 1B9MA 3JRFA 2I5UA 2Y0SN 2W24A 3K70C 3BG7A 5E3LA 3P9KA 3ZCOA 1CF7B 1X3ZB 3L2CA 4W97A 3U1KA 4ESJA 4LLLA 1XCVA 1FC3A 2EFPA 5EJCA 2BXYA 4JYKA 3BZKA 5L3GA 3G73A 3TDZC 3FKJA 2DMPA 1IGNA 1GLNA 2JJ7A 5IYBJ 2HEOA 4XN3A 3ONQA 3A0BC 2V4JC 3FXKA 1MIJA 5D8LB 3FXOA 3RTRA 1ETWA 4J01A 2YR2A 3F8NA 4MEYF 2HQRA 2L7FP 4B1RA 1FIPA 3Q9SA 1WSUA 1WVRA 3GLLA 1OJLA 3FF5A 1T56A 4ZYEA 2K9SA 3QYFA 5DTDA 2Z2SB 3ZN0A 4HSTA 1FWZA 2NVTJ 3HKZN 1R49A 2EH3A 3L9FA 4NC6A 2LY9A 2R7SA 4C3JJ 5JLWA 3CCVI 4H0EA 1G4DA 3K1NA 1SD5A 5FFZA 5C4XJ 5CQEA 4FT8A 1LPQA 1ZREA 2KDZA 3S1QJ 3W6JB 1AOYA 4I0BA 3LSPA 4O6JA 1RKTA 2Y9ZA 4EATA 2OJED 4PJMA 1T0FC 1HLVA 2DTZA 3H0DA 2L54A 2VI6A 1YW9A 3CUQB 4XOTA 2EZIA 1FYMA 4IO9F 3VYUB 3S15J 1S7AA 2JPCA 1QVUA 3KP6A 4XLFA 1RNLA 2ZMEA 3CUOA 3ASNH 1ZARA 1W5CC 1QZYA 1VQNI 5BPIA 2HU9A 1IRZA 4M3BA 4G8XA 4RGSA 2JT1A 1ETVA 1B4AA 1O3RA 2F4MB 2K4BA 2LK2A 2EIJH 2FMLA 1WJAA 2O8KA 1IF1A 5GPCA 4F3QA 2VJ5A 3Q0UA 4EJWA 3G1OA 1XCBA 2CQ7A 4CCLA 3JRAA 1LJ9A 1G3TA 2P81A 2NVQJ 5D6EA 3MEXA 2JUCA 3ZP5A 2C6YA 3KIOA 5DM6F 4KIBA 2H8RA 4A3BJ 3BCBA 2L7MP 4PFOA 4CUGA 4D5CA 4A6DA 2FMYA 3BG6A 3BG3A 1J7KA 3OYBA 4S05A 2M8GX 5ICFA 1MKMA 1IN5A 4XKWA 5IP9J 1EV7A 1SD7A 2MFZA 1ZQ3P 1YRNA 1W7PB 4PUSA 5GADJ 4BHCA 2HPMA 2R7UA 4ZJZA 3J7AO 1RC9A 4B3XA 3C7JA 2LKPA 1XTAA 1VFCA 3WG9A 4ETSA 1APLC 1WJFA 3F3XA 1X2MA 3FXRA 4BY1J 1R23A 2Y30A 2PJPA 2RDPA 3HKZA 3MZYA 2GWRA 2E2JJ 2FUG2 4HLYA 2VJIA 2E1NA 2DPDA 4UUSB 4IVNA 1A36A 2YU9J 4J19A 1RIOH 1VF9A 1T33A 2F5VA 2BY0A 1P4AA 1K78B 3OYNA 5EGOB 2V9VA 2XPUA 1X1BA 1LFUP 2IRFG 2VKVA 3HYIA 5KAFC 4ZYHA 1OPCA 4M72A 5TGTA 1VQ4I 4RLFA 4A69C 2DA4A 2COMA 5IYCJ 5KHDA 4FX4A 2ME6A 3MKYB 1FMVA 1IZ1A 1TWHJ 3FM5A 4LK0F 1SFOJ 3S2WA 1P7IA 2EQRA 2X48A 1ZR2A 3I64A 1U8BA 2XSDC 5K5RA 3DU6A 2HYJA 4A3FJ 3OSFA 2FD5A 3K4NA 2X4HA 3ECHA 3F8MA 2OZ6A 4ANJA 5EEHA 4XIDA 1PP7U 5AONA 3LWFA 4MTEA 2NVYJ 3SFIA 1TZLA 1U2WA 2QSGX 2E19A 2H1LA 3R0JA 1V55H 4IF4A 4TV7A 3C2GA 2ESHA 2VXDA 4HNTA 1ZN2A 2EV6A 4E7HA 4XLAA 5ED4A 2DFEA 3K2AA 1W0UA 3PUFA 3OIPA 1OMIA 2BHZA 3I9V2 4DIQA 4J00A 3OYMA 3H3VK 3LFUA 2XIGA 4JX4A 2DQLA 3BQZA 4RAGA 1HKQA 1L3LA 1OFCX 3WU1B 4DZPA 1MJAA 4V2GA 2R5YA 3HTSB 5CPRB 3DKXA 4HYEA 4BE1A 1YIJI 4C2TA 2M7AA 2ESNA 3EYYA 2EJRA 3PFIA 1BIBA 2Y69H 2UUZA 3BJ6A 1G3YA 1J75A 1ZG5A 2IXSA 1VQMI 1J59A 2EZKA 2BXZA 1I1GA 3PL8A 2Z16A 3H9QA 2OA4A 2DOEA 4OMYA 1J2XA 4BHBA 2CW0F 1B72A 3J80K 1OCZH 2RREA 3HRMA 3R60A 5GAHJ 2XHKA 4I6ZA 1QZZA 4BDZA 4F93B 2XKPA 1R4MB 1SMTA 2BY1A 3E5XA 3SZPA 1BR1A 2HQAA 1SMYF 2K3FA 3ZQGA 4HEA2 4MLOA 3S3MA 3SHFA 3JR9A 5E1WA 4AUXA 4DBRA 1D8KA 2IS2A 1KA8A 2EFWA 3LQQA 1TT5B 2VASA 4RB3C 4HF2A 2FBKA 2L9VA 1B6AA 3DEEA 3T1BA 2BVLA 1OCPA 4C3IJ 2LREA 1TLHB 4NBQA 1V4RA 1V5FA 3BOQA 1Y8RB 1EH6A 3NARA 2AHQA 4EQQA 3IAS2 3GTKJ 2Y2ZA 1VQ8I 2VPLA 4LD5A 1X1DA 3SYTA 2DA2A 2H8WA 1WQ2A 2RVCA 1V54H 1ZGJA 1LB2A 2O5RA 1ETKA 3J80Z 3H92A 3TMOA 5CQGA 2DT7B 4F7ZA 3TEDA 1KU7A 3BG9A 3M9AA 3E0JB 3K1PA 3CCYA 1MMAA 1SD4A 1X2NA 5E79C 4DZJA 3UNGC 5HLHA 4U0YA 1IN4A 2ZC2A 3FHZA 1Z6RA 4HG2A 4L9JA 3IWFA 1Z7UA 1YFHA 4M9SA 3CF2A 1BR2A 4BH9A 3OYAA 2XB0X 4BXXJ 2HDWA 5DV5A 3R61A 3JRDA 2TRTA 2FNPA 1IXCA 5GTHC 1W36D 3HPHA 2IBDA 1Y6IA 5EG0B 2CMPA 2PMHA 2WTEA 4EM2A 3CJNA 1FOWA 4N4OB 3ASOH 3FXQA 3I59B 2XAFA 3MCZA 3VSKA 1YITI 1KQ0A 4FE7A 3BG5A 1CF7A 2H6BA 5L3EA 1NH3A 3R6SA 4RGXA 1UZCA 3DTKA 4UUVA 4F55A 1WFXA 5KVRA 2BE5F 5K7ZA 2NVUB 2W48A 1FBUA 3ABTA 4BBRJ 1E3OC 4XM3A 3ZMZA 1MSEC 2EFQA 2CV0A 2IPQX 1JJ6C 2PQ8A 1MBEA 2NXNB 1UG2A 1ENHA 2G0EA 3HJEA 1LDKB 1Y39A 1V5GA 2ELKA 1BI2A 1KU9A 5F08A 1FBQA 1QU3A 1WI3A 2YSRA 3FBIB 3I58A 2KKOA 3ZQ7A 3L2RA 2P5LC 4XLNF 3M8EA 4LOCA 1MD0A 2XGDA 2F6CA 4KA4A 2LG4A 2LSOA 1G2HA 4BQQA 3K7AJ 1FP2A 5HVQC 4BQOA 5ILVA 3LAPA 4M73A 5CKTA 3ZMTA 1WJDA 4KIFA 5AIQA 3W6KB 1OCCH 1P9QC 1E3HA 4NB5A 2VN2A 3MN2A 4MEXF 2KQRA 3GEZA 2M34A 1BC8C 2LKXA 3V42A 3ZPLA 1U0JA 4AIHA 4BYYA 1LDDA 4IEJA 1B9NA 4L0ZB 2M4GA 3P9CA 3DTEA 2QUFA 3PSFA 1YTYA 5JR3A 3M1EA 3LA3A 4Q4ZF 2MD0A 1EKEA 4DW6A 2HYFA 3BJAA 2M9HA 3KE2A 2XAHA 2DJIA 2MD5A 4E6KG 3AL0C 2CV2A 3J7AY 3IRRA 3WTTC 5HDNA 5E8IA 2LLKA 2E7WA 1J09A 5GAGJ 1PUEE 2MW8A 4ENKA 2IGNA 4HRIA 1ON1A 2F5CA 1QNTA 4XN0A 2VUMJ 4LMYA 2R93J 2DAOA 2K02A 3ROUA 3DU5A 1HSJA 4G6QA 3CCEI 3DEWA 3HTUA 4RDUA 4II2A 5E1XA 2V1UA 3CDHA 4N9IA 2E7XA 5D5WB 3GFLA 3K1MA 5ILSA 4RAYA 2B7EA 2Z99A 1USSA 4A5MA 1JHHA 5D8KB 1WWXA 2LY1A 4YIIA 1JE8A 1Z0XA 3CMAI 5BNGA 1OQYA 3CC7I 3FMSA 3GW2A 1FNNA 3HRTA 2XC7A 4YIRX 2XAQA 1W7PA 2H1KA 3COAC 3A0HC 2EIMH 2IW5A 3A2KA 4WF2A 1GVJA 2WAFA 1Z1DA 4IX7A 4UY8I 1L0OC 2GLOA 3CMEI 2VB6A 1WJBA 1KQ8A 3K4JA 4HDVA 5F27A 5F0HA 4ZYDA 1IG7A 2PI0A 2P6TA 1J9IA 2AQEA 2EB7A 2HWVA 1X3WB 4HNUA 4UUSA 1MNMC 3GTQJ 5LGUA 1R71A 1EA3A 1VQPI 4KMUX 3LA7A 1K78A 3E6MA 3H3ZA 1UB9A 2STWA 1JTXA 5EGOA 2EZHA 2ZNZA 3OYCA 4GRIA 1K4TA 4LIUA 2VT2A 4X0GA 1FSHA 1WCMJ 2PJRB 1EH8A 1W5SA 1YYVA 4EM0B 4D1QA 5HOOA 4XKVA 2DFHA 2IS6A 4XMYA 4PJLA 4PSWA 4LG0B 2HZDA 3IH3A 2ZXIA 2L7ZA 2V79A 3DPTA 3FISA 3H0GJ 3F6VA 5LRSA 3HL2A 2R7ZJ 1D0ZA 1IUYA 1SVMA 3G1MA 3KETA 2DDAA 2DJNA 1FBSA 3FK6A 3K4MA 4I0AA 3FZVA 4ENMA 1G8XA 3G3ZA 4GFBA 3PO2J 1T08B 4V19K 5E17F 5E20A 2LBFB 1GHCA 2L02A 3M8JA 3FIWA 4RB1A 1FP1D 4HBLA 2M2EA 3I3LA 2O03A 3GCMA 1VQKI 1K61A 4U88A 1YS6A 2E2HJ 1HQCA 3TQNA 3JRCA 3MZHA 1H0MA 4DBQA 2DMNA 1W0TA 4U0VA 2R7WA 1O3TA 2AO9A 3DEUA 2EPFA 5IPAA 2QCOA 3SQNA 3DKWA 3KCCA 2D1HA 4Y13A 1BOAA 1Z9CA 3WTYC 1VQOI 1TWCJ 3JW4A 4W1UA 3V8JA 2HKOA 2DPUA 5LBQA 5DCFA 4XONA 1A6QA 3KFWX 3KZIC 3WHBA 2EWNA 3HPGA 4PFPA 2O6GE 5F64A 2A6HF 1XGOA 3KEOA 3REOA 5FLXK 1R1VA 2WY7Q 3GZ6A 4Y4RA 4HNVA 5TISC 3VYTB 4JQFA 1X3UA 4NC8A 5IP6A 5FKNA 2VE9A 3Q5FA 1R36A 4M3GA 1DP7P
chains in the Genus database with same CATH topology
1Y56A 3L2QA 2W7NA 3BCBA 4PFOA 4CUGA 2UWMA 1LVKA 1DQUA 3BG6A 3K4CA 3S8PA 4BJTA 3OYBA 1D0YA 2WADA 4ZDLA 4XKWA 2LY2A 3OS2A 2MFZA 4PJJA 1Z7LA 2LYCA 4PUSA 2HPMA 2R7UA 4C9YA 2X85A 4ZJZA 1AA7A 4KISA 4B3XA 4ZTFA 1WJFA 3LSHA 1N75A 3HUGB 4AYBA 5FROA 3QODA 3BC8A 2R7QA 1D1BA 2ZFUA 3HC7A 3HKZA 4KITB 3H35A 2L5QA 2FUG2 2IGOA 2VJIA 3KEYA 4PK4A 2LRDA 3K4LA 3PNVA 3OYKA 2I8DA 3MKWB 3H5RA 3OYIA 2F5VA 4F52A 4ZC3A 3ZR8X 3OYNA 3IUOA 1X1BA 3K70D 2WB1A 1MMGA 2W82A 3CP2A 2M0MA 1MNEA 2KPMA 5TGTA 4BDYA 4RLFA 4HSRA 1BOBA 4B43A 4G6TB 4BEHA 1D1CA 4II3A 2XF5A 3S3NA 5KHDA 2GOMA 3MKYB 1FMVA 1W36C 2Q2EB 4LIVA 4RM2A 3CMMA 3W2WA 3QYBA 2JSPA 2XAUA 4FETA 2NOJB 3OYLA 3DU6A 3TL4X 5FRNA 3CESA 4F91B 3S3OA 3K4NA 4DGWB 4CCKA 2HNHA 4BXFA 1MNDA 3CZ6A 4XNFA 3S32A 4ANJA 3W2VA 2L2OA 1TZLA 2CUJA 4YELA 1Z21A 3C2GA 2VXDA 4HNTA 4DOZA 1X1CA 4E7HA 1Z3XA 3DWLE 4C30A 4XLAA 2V6EA 1S9HA 4P5OA 4RM3A 4E7KA 4ZTJA 3OIPA 3LSGA 3ZQQA 2BVMA 2VJJA 3I9V2 4DIQA 4J00A 1ERDA 2ZXHA 3OYMA 1DGRM 4XLHA 3OYDA 3LFUA 2KLOA 2DT6A 2OUMA 1UELB 2K3PA 2VQCA 1D0XA 3PFYA 1N77A 1LKXA 4E7SA 4U7BA 1MMNA 5CPRB 3DKXA 3ZRGA 4BE1A 2XF7A 4C2TA 2M7AA 2VQHA 2UUZA 4BS9A 2IXSA 2MABA 3A1YA 3M1CA 3SZGA 3OS0A 4BUPA 3PL8A 2Z16A 3H9QA 4OWRB 2VQLA 1PYVA 2R7OA 1NG7A 2UV1A 3D5RC 2RREA 3H5AA 4BDZA 4F93B 2L9NA 4ZDPA 1BR1A 2HQAA 3F9KA 3KX2A 3OR1C 2QKMB 2CUZA 3HXLA 4H4KC 2M3AA 4HEA2 4MLOA 3OYJA 3S3MA 2JVGA 3VDXA 4R79A 1DGWY 4DBRA 3IP4B 2IS2A 3A4CA 2BW3A 3BCAA 4HPQA 1SFKA 2VASA 2DCEA 2E1MC 4CH7A 4XQFA 2X1DA 3DEEA 3OYFA 2BVLA 4C2UA 2LREA 2CH0A 3EPZA 1V5FA 2A5WA 1WJCA 2VJ4A 3EUHC 3OS1A 1K6YA 2E5ZA 4CCMA 3IAS2 2M4KA 3GBGA 5KNLA 1LFPA 5KCMA 1UG0A 2VPLA 4YEJA 2L7KA 1YX5A 1X1DA 3SYTA 1WJ5A 4CA0A 4BJ6C 5LFAA 4NC7A 4PJNA 4D9JA 2KDOA 3QYEA 2O5RA 2VLAA 2ZSIB 4N4NB 3CP8A 2DT7B 5CQGA 3TMOA 2RQQA 4QPQA 3E0JB 3L2VA 3UR3C 1MMAA 4XLEA 4CSWA 2R7RA 4XOPA 3UNGC 4E7JA 3K6GA 1T95A 4P1WA 1HA8A 4HG2A 2OC6A 4XORA 4BE0A 3DQVC 2M7BA 3EUKL 3CF2A 1BR2A 3OYAA 1R6RA 2HDWA 1NG6A 3NWTA 1W36D 2P0WA 3HPHA 4BEHB 1ZELA 1Y6IA 2R7XA 2CMPA 3LSIA 2HVSA 1Z3YA 1V5EA 2R4GA 4N4OB 3VSKA 3DPUA 5HNFA 2ELJA 4XL9A 4XLCA 4BU2A 3K4KA 2PJRA 3OIQA 3DTKA 4F55A 1WFXA 3VWBA 4JOMA 3D5SC 1MW7A 4XM3A 4Y3OA 3DKYA 2CV0A 3D5LA 1D1AA 4BGDA 2L9SA 3W2AA 2X1CA 4OAYA 1LDKB 3HOSA 1V5GA 2IGKA 3LSKA 2HVRA 1YX3A 2WAQA 3IAM2 4CZCA 3SEQA 3OOUA 1QU3A 3KYLA 3FBIB 3AFHA 3PJRA 2HPIA 5HLTA 3L2RA 4ITVA 2LBFA 4RLQA 1DP3A 2F6CA 2KHMA 2WA0A 3OMYA 2LG4A 4QPOA 3L2UA 4BQQA 2F4IA 4B48A 4BQOA 5HVQC 1YE9A 5CKTA 1WJDA 3OR2C 1P9QC 2DOAA 3DPLC 2V9KA 2XDVA 1G59A 2DXIA 4BE2A 2KQRA 4NNJA 4IKFA 4YRVA 2KP6A 3SEZA 3V42A 1U0JA 2GOXB 3K4BA 2A6TA 4CCOA 2LH9A 4DJAA 2M4GA 2LOOA 3DTEA 3VYSB 3PSFA 4XKBA 3PNYA 2R7VA 2MD0A 4LITA 3S93A 3VYRB 4NUBA 2VL8A 2V26A 2DJIA 4AU7A 4IQ4A 4E6KG 3AL0C 2CV2A 3J7AY 2MYSA 2VXZA 2PMZA 1J09A 4HRIA 3LSMA 2IGNA 1QHGA 3H9JA 3FDYA 4XN0A 4KT6A 3EUAA 3L2WA 2K5CA 3CJRB 2CFOA 2JUGA 4NQWB 2KL4A 2BOLA 3DU5A 3MMYB 3W3CA 3FHNA 4E4HA 2R7TA 2X6YA 1FMWA 4II2A 2IS1A 4Y33A 2JA2A 3K10A 2VQGA 2MC4A 4XKCA 1N78A 3E1SA 2Q1ZB 2BW3B 2HVQA 2Y0SA 3C2HA 3G2BA 2LY1A 2CW7A 1KONA 4ZYAA 2V1NA 3OYGA 3N05A 2CW8A 2K9LA 2W00A 5LD2C 3RSNA 3OL4A 1IRXA 2Z1DA 3ZGKA 1E0EA 2AQFA 4KJZA 4XR6A 2XC7A 2E5NA 3CJQB 4FASD 3A2KA 2WY8Q 4BL0B 1X4PA 2WAFA 3RCOA 4U87A 4IX7A 1MMDA 3RPUD 2VB6A 1WJBA 3NWSA 4IZZA 4BJ5C 1SAUA 3K4JA 2W4SA 2AQEA 4HNUA 4CCJA 4CCNA 2IS4A 2KMUA 1EA3A 2XF6A 2WBMA 5JHFA 4E7LA 4IQJA 3TBIA 3PUBA 1JI8A 2JVHA 3OYCA 4GRIA 4LIUA 4X0GA 3AKZA 4E7IA 3QOEA 3LMMA 3K70C 2PJRB 3BG7A 5HNHA 3ZCOA 4D1QA 1OLTA 5HOOA 5FRMA 2W1OA 4XKVA 2IS6A 4XMYA 4PJLA 2XSJC 4PSWA 4B44A 3AL0B 3DLAA 2HZDA 3FKJA 2ZXIA 1QHHD 3DPTA 1GLNA 3HL2A 3DTIA 1D0ZA 3OYEA 4XN3A 3ONQA 3RQ4A 1BR4A 2V4JC 3K4MA 4BACA 3RTRA 2IGMA 2RNGA 2X6XA 1G8XA 2X51A 4B47A 4J01A 2V7FA 3BLYA 2X1EA 4E7ZA 2LBFB 3FBNB 3M8JA 4LG3A 2E60A 3QYFA 2KZVA 2Z2SB 2E1MB 4HSTA 1X1AA 3I3LA 1UAAA 2R7SA 3HG9A 1OR7C 2OV7A 3MD2A 3PSIA 4PSXA 2ZSHB 5CQEA 3LL7A 4DBQA 4OAZA 3U21A 4F92B 3OL3A 4EATA 2R7WA 4PJMA 1T0FC 3H0DA 3OWTA 4ZDOA 2K9MA 2VKHA 4XOTA 3ZXSA 4AVZA 3SDBA 2CS3A 1VZ0A 3VYUB 4XLFA 2X6WA 3MKZA 3HOTA 2HU9A 4XONA 1X19A 2VKDA 3H9GA 1WJEA 2KRHA 3HPGA 4PFPA 3PNTA 4RMNA 1WJAA 2WAEA 3OY9A 3VSLA 3H5NA 2CV1A 2VIXA 4F3QA 2LC2A 2VJ5A 2WY7Q 3OYHA 4Y4RA 1X4OA 1PJRA 3VYTB 2QKLB 4JQFA 4NC8A 4CCLA 4BQNA 1TT0A 2KRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2CUJ A;  2DCE A;  2AQF A;  2ELJ A; 
#chains in the Genus database with same CATH topology
 3EYI A;  3HSF A;  1XGM A;  3L2Q A;  1H9T A;  2ZO4 A;  3B6A A;  5F6F A;  1LUJ B;  2D45 A;  1I27 A;  3H36 A;  2EBI A;  1LVK A;  2YPR A;  3S8P A;  5BPD A;  3FXM A;  1Y0N A;  5EF6 A;  2B63 J;  3KYD B;  3S14 J;  2LY2 A;  4I02 A;  1F36 A;  2LYC A;  3BP8 A;  2OU2 A;  4PGH A;  5D5V B;  3HDD A;  4C9Y A;  4IRH A;  5J8C A;  5HLI A;  1M1E B;  1BW6 A;  2QEN A;  4KIS A;  4ZTF A;  1MBF A;  2K27 A;  2B0L A;  2HTJ A;  5H6Q A;  3LSH A;  3HUG B;  2P5K A;  2FQ3 A;  3FK7 A;  5FRO A;  1ZAO A;  5FLX Z;  1PUF A;  3BC8 A;  2NVX J;  1FY7 A;  1D1B A;  3HC7 A;  3T8T A;  2L3D A;  1OCT C;  1TQI A;  4G7H F;  1R00 A;  3KEY A;  2LRD A;  3RKX A;  3DBL B;  2IVM A;  3OYK A;  2RGV A;  2P8T A;  3DV8 A;  1DDN A;  3OYI A;  2BY2 A;  2K9N A;  2MH2 A;  4L5J A;  2JTV A;  1RR8 C;  2OTJ I;  4ZC3 A;  3FMR A;  3CQZ J;  5IY5 H;  3WE3 A;  4YFN F;  2YU3 A;  3K70 D;  3CP2 A;  2KPM A;  1C0W A;  1OYW A;  1JUS A;  2ZXJ A;  2HR3 A;  4B43 A;  5EG0 A;  4II3 A;  4FTH A;  3S3N A;  1HST A;  1O7F A;  2GOM A;  4WWC A;  3I59 A;  2QLZ A;  1EH7 A;  1S5L C;  5E8G A;  3JRE A;  1V3F A;  4MNU A;  2Y0M A;  3CMM A;  3W2W A;  1U9O A;  3QP5 A;  2JSP A;  2UXN A;  2FSW A;  1QVT A;  5BOX A;  5AIP A;  2DYR H;  1ZG1 A;  5DD4 A;  3CES A;  2V9P A;  4F91 B;  4A5N A;  1BI0 A;  1LE8 B;  2JMW A;  2VOD A;  1RES A;  2JSC A;  5HOD A;  1VQ5 I;  3S32 A;  1ZH5 A;  4EJU A;  1AKH B;  1GT0 C;  2OD5 A;  3MWM A;  5J1Y A;  1FSE A;  1FOK A;  1H9G A;  4CXF A;  1DU6 A;  3S17 J;  5EZH A;  4YEL A;  1Z21 A;  2CO5 A;  2PN6 A;  3ERM A;  1ETO A;  3CC2 I;  4JX6 A;  2XKO A;  2KIQ A;  1HW1 A;  5CLS A;  4LGW A;  2LD5 A;  3DWL E;  4ASN A;  2G7U A;  1BA5 A;  3DFG A;  1GVD A;  2VE8 A;  1XGN A;  2O7O A;  2D5V A;  3LSG A;  1STZ A;  3GZN B;  4P9F A;  3ZQL A;  2F2E A;  2DFI A;  1ONV A;  2DLL A;  1XX5 A;  1FTT A;  1JT0 A;  3PO3 J;  4Z2Y A;  1ZTR A;  2CUF A;  4L9N A;  2DT6 A;  1Q1V A;  2RAE A;  1QPM A;  1UFM A;  2XAJ A;  3WHC A;  1MJB A;  2K3P A;  3E6C C;  4ZH4 F;  3PFY A;  4EVI A;  1N77 A;  1LKX A;  5F0F A;  3FMQ A;  1XC5 A;  1RZ4 A;  4UNO A;  2ECB A;  3CLQ A;  1A04 A;  3HIF A;  3ZRG A;  4IHT A;  2XF7 A;  4Z6Y A;  2VQH A;  3CCJ I;  4CDG A;  1Z6T A;  2QBY B;  4CZZ A;  3A1Y A;  3OS0 A;  3TKY A;  1BW5 A;  1WKM A;  3QRF F;  4ZZD A;  4OWR B;  2VQL A;  3L00 A;  1OYY A;  3ABL H;  4CIC A;  5FJ8 J;  2OQR A;  1PYV A;  2R7O A;  2VC1 A;  3M8F A;  2UV1 A;  4OU0 A;  3KEQ A;  3KPH A;  1YLF A;  4ZDP A;  4B3A A;  1FOX A;  4LLG F;  1O4X A;  3KX2 A;  5DUK A;  3OR1 C;  5D6F A;  3HXL A;  1G3W A;  1Y8Q B;  4PZJ A;  2MBF A;  3Q0W A;  2JVG A;  3JRI A;  2PFB A;  2DT5 A;  5K7H A;  1VQL I;  3AG1 H;  4HPQ A;  3KZZ A;  2FEZ A;  4Y17 A;  2Z9O A;  1OYI A;  1UHM A;  4C2U A;  3LQR A;  1JGG A;  4X6A J;  2MG4 A;  3EPZ A;  3HBL A;  2VBW A;  2P7V B;  1WJC A;  3DP7 A;  3OS1 A;  1K6Y A;  2LVS A;  4M9Z A;  3BR3 A;  1ZK8 A;  1S3J A;  1IW7 F;  3U2R A;  3GTL J;  1UG0 A;  2FU4 A;  2MC3 A;  3Q3S A;  5L3C A;  2L7K A;  1MMS A;  4B8X A;  5LFA A;  2WWY A;  2VLA A;  4N4N B;  3CP8 A;  3BDD A;  2RC4 A;  4HV6 A;  3TO9 A;  2FOK A;  2DTR A;  4XLE A;  2BY3 A;  1T95 A;  2PMZ N;  4I2O A;  4CYC B;  4AD9 A;  2QQ8 A;  4BE0 A;  4WCG A;  3BY6 A;  4L5I A;  4M6X A;  5D5U B;  4MHG A;  5J1R A;  1R6R A;  1LDJ A;  2CRG A;  3GFI A;  1RI7 A;  1R9T J;  3TW6 A;  4BEH B;  2OAZ A;  4L5E A;  3LSI A;  1GV2 A;  2XPV A;  5A2Q K;  2R4G A;  3OV8 A;  1R1U A;  2J5P A;  1GV5 A;  2JPB A;  4M74 A;  4XL9 A;  2KJC A;  2PJR A;  5CYV A;  2MH9 A;  4DYQ A;  3G71 I;  1ZR4 A;  1FEX A;  2FXA A;  3HRS A;  3BWG A;  3DBH B;  3CDI A;  3S1M J;  4LG0 A;  1LEB A;  1E2X A;  4M6Y A;  1QBJ A;  4A3D J;  4HQM A;  2JRT A;  3W2A A;  3KP7 A;  4OAY A;  1IO2 A;  2ZJ2 A;  1TWG J;  2HVR A;  1Z67 A;  1YX3 A;  3IAM 2;  3WTU C;  1XSX A;  1TWA J;  4CZC A;  1HCR A;  3OOU A;  2ZB9 A;  3RZD J;  3KYL A;  3IKV A;  4IRI A;  2LBF A;  3HRU A;  3I54 A;  4RLQ A;  2JK3 A;  4A3I J;  1DP3 A;  2KHM A;  1JJ8 C;  3V8K A;  5A2Q Z;  2F4I A;  2IA0 A;  1YI2 I;  4L18 B;  3A03 A;  2M1B A;  3GO5 A;  3QU6 A;  1SAX A;  3DPL C;  5D5X B;  5CJ9 A;  3OSG A;  2V9K A;  2XDV A;  5D4R A;  4GDF A;  2GAU A;  2CWE A;  3HM5 A;  2A6T A;  4CCO A;  2K7L A;  4R8H A;  4M3F A;  2NNY A;  3GF2 A;  3WU0 A;  1SC7 A;  3VYR B;  3RPU A;  4AU7 A;  4HQE A;  3PIO F;  3F6O A;  1GXP A;  2VXZ A;  2PMZ A;  2YX7 A;  3JAM K;  1QHG A;  1CQT A;  5IYD J;  1MDM B;  4KT6 A;  1TQM A;  1R7J A;  2CFO A;  4NQW B;  1R22 A;  3KYC B;  3IL2 A;  4XRS G;  1ZYR F;  2R7T A;  2X6Y A;  4EEF G;  4U7D A;  2JWT A;  2NNN A;  2PBI A;  4XKC A;  2Y31 A;  2DFF A;  3BRO A;  2Q1Z B;  5LEJ A;  3C18 A;  1I39 A;  2BW3 B;  1XMX A;  1JT6 A;  2NS8 A;  2CW7 A;  4D7M A;  3FM3 A;  3OYG A;  1GDT A;  4PJ0 C;  2W00 A;  3ABK H;  1IRX A;  2Z1D A;  3TP3 A;  4UB8 C;  1IN8 A;  4U0W A;  3LA2 A;  4XR6 A;  3JAM Z;  2XVC A;  2DMQ A;  2E5N A;  3JTG A;  3CUQ C;  2LKS A;  3RYP A;  2JA7 J;  2WY8 Q;  2DOF A;  4BL0 B;  2IT0 A;  1ACI A;  2XPW A;  2R0Q C;  1KZH A;  5HDK A;  5TRD A;  1AHD P;  4KIG A;  4IZZ A;  2CQX A;  3E5U A;  4XRM A;  1I3A A;  3DBR B;  4I76 A;  1SAU A;  5E3O A;  3M7G A;  4I7H A;  2W4S A;  2HKX A;  1YIO A;  3F8F A;  4OIQ F;  4RS8 A;  3CCL I;  3GTO J;  2BBY A;  3CDL A;  1R5G A;  4MFD A;  2KMU A;  2W85 A;  3I5U A;  1HF0 A;  5JHF A;  1JHF A;  4QLC U;  4IQJ A;  3LNQ A;  3M07 A;  1JI8 A;  3FX3 A;  1SVO A;  1XN7 A;  4C2M J;  2EFO A;  4L0Y B;  2CYY A;  3AKZ A;  3WU2 C;  1P7J A;  4ABZ A;  5ILU A;  2TCT A;  4BQA A;  1AU7 A;  3HOY J;  1OCR H;  5E1Z B;  5J40 A;  1OLT A;  5FRM A;  2E1C A;  2W1O A;  2Y75 A;  5L3F A;  3GME A;  1IDZ A;  5FGM A;  2XSJ C;  4GGG A;  1ETY A;  4B44 A;  3JRB A;  1IN7 A;  2KIM A;  5ERI A;  4G6D A;  1JKR C;  3FXU A;  1U8R A;  2VOO A;  1SAN A;  5J4V A;  1SVL A;  3RQ4 A;  5F04 A;  1I50 J;  1W7P D;  3QU3 A;  4BAC A;  3T5X A;  3VEP A;  2X6O A;  4ENJ A;  4A0Y A;  5BMZ A;  2RNG A;  2X6X A;  5HS9 A;  1WHU A;  4B47 A;  4S0H B;  1LE8 A;  1HKT A;  4HV5 A;  2XAS A;  1T6S A;  3BLY A;  4YFK F;  4X1E A;  1UST A;  3WGH A;  4LJZ F;  1OIS A;  4GCV A;  1ZLJ A;  1K4S A;  1UJ8 A;  4EJV A;  4AYB N;  5LHG A;  2R5Z B;  3GVA A;  1AKH A;  3CO7 C;  4OIP F;  5FO5 A;  2VON A;  1ON2 A;  1X1A A;  4EMS A;  1B8I B;  2R92 J;  1IV6 A;  4JP0 A;  1UAA A;  1S6L A;  1VQ6 I;  1OR7 C;  1TL8 A;  2OV7 A;  3MD2 A;  3CF5 F;  4RGR A;  2XRL A;  4N0B A;  4KN7 X;  1TW2 A;  2O9L A;  4G7Z F;  2OCC H;  4A3E J;  3U21 A;  5EZG A;  4F92 B;  3OL3 A;  1SFE A;  2DDB A;  3CUQ A;  5IOY A;  2AS5 F;  1ITY A;  2M45 A;  3RPQ A;  2RKH A;  2HQ5 A;  1FPQ A;  2K9M A;  2VKH A;  4JBA A;  3ZXS A;  3WTZ A;  3SDB A;  2CS3 A;  2M5W A;  1H89 C;  3K2Z A;  3LFK A;  3AG2 H;  3BTJ A;  3HOT A;  1TTY A;  3S2H J;  1X19 A;  2CU7 A;  2VKD A;  2KRH A;  2JA5 J;  1U78 A;  5CVU A;  3K9T A;  3WTV C;  4QWQ A;  1JTY A;  4RMN A;  2XV4 S;  2WAE A;  2XRN A;  1KU3 A;  2XUB A;  3OY9 A;  1ZGW A;  1OKR A;  2QQB A;  5IP7 J;  3H5N A;  2VIX A;  1VTN C;  3OYH A;  1X4O A;  1PJR A;  1QRY A;  2QKL B;  3HEF A;  4BQN A;  1MGT A;  2FNA A;  1AWC A;  3IWZ A;  5F1R A;  4HF0 A;  2M30 A;  1DUX C;  2KRC A;  4FCY A;  1HW5 A;  3I55 I;  2JA6 J;  5K5O A;  3SJM A;  5ICC A;  2PG4 A;  3F8B A;  1RUN A;  1IAW A;  2V1X A;  3HSR A;  1UHW A;  2W7N A;  1U5T B;  1DQU A;  2DN0 A;  1KYW A;  2RQP A;  1D0Y A;  2V1D A;  5M5X J;  4ZDL A;  1A35 A;  2CG4 A;  3OS2 A;  2QZ8 A;  4PJJ A;  2OF7 A;  1ODD A;  1Z7L A;  5L3D A;  3AAF A;  1ZRC A;  1YRN B;  4RGU A;  2D1V A;  1AA7 A;  2DA1 A;  2NYX A;  2HOS A;  2ACJ A;  3ZMD A;  5ICG A;  2K40 A;  3K69 A;  2DA6 A;  4AYB A;  1WGX A;  5JVT A;  2I10 A;  1ULY A;  5FKO A;  2KIF A;  2HYG D;  1SFX A;  1ORK A;  5FKK A;  1OR7 A;  1TNS A;  2HDC A;  2FA5 A;  1T38 A;  2L5Q A;  4WXC A;  1Y0U A;  2Z33 A;  3ZMV A;  4DNC A;  3I56 I;  2KJB A;  4JK1 X;  1FX7 A;  2I8D A;  1WZ2 A;  1PP8 F;  1NK3 P;  3H5R A;  3WTS C;  4UVC A;  2JN6 A;  2R7F A;  3F22 A;  4F52 A;  4CYC A;  1P4W A;  2F5D A;  1XSD A;  1YW7 A;  2WB1 A;  1DPU A;  2KZG A;  4BDY A;  2GIZ A;  1WH5 A;  4EJT A;  1BOB A;  4G6T B;  1IDY A;  4BEH A;  1D1C A;  2O3F A;  2XF5 A;  1LQ1 A;  2VBZ A;  5B3S H;  4BNC A;  2Q2E B;  4L9V A;  3QQA A;  5TJJ A;  3MQ0 A;  1BM9 A;  1JUM A;  1GXQ A;  1U3E M;  3QYB A;  4KYW A;  4BAY A;  3F23 A;  2XAU A;  4FET A;  1BC7 C;  3HHG A;  3I4P A;  3OYL A;  3SXY A;  3TL4 X;  2L9R A;  1YO5 C;  2ID6 A;  5GPA A;  3S3O A;  4AWX B;  2HNH A;  3IH4 A;  3V8L A;  4BXF A;  1MND A;  2IAI A;  1MBJ A;  3CO6 C;  3KP4 A;  3CZ6 A;  2EIL H;  4XNF A;  3W2V A;  3B02 A;  4YIF A;  5M5Y J;  1POG A;  2CUJ A;  4XSX F;  1N25 A;  2W25 A;  2VT3 A;  2M8E A;  5FFX A;  2G7H A;  3GFM A;  1ZGA A;  4DOZ A;  3J81 K;  1X1C A;  3WG7 H;  3GX4 X;  1ETQ A;  2V6E A;  2IA2 A;  4I98 B;  1SEU A;  2QQA A;  1BL0 A;  4ZTJ A;  2EA4 A;  5F0C A;  2BVM A;  1ERD A;  4UV8 A;  1DGR M;  4HX7 A;  4ON0 A;  3WTW C;  3RZO J;  4M3E A;  1IJW C;  2PLY A;  5M5W J;  3WGI A;  2VQC A;  3LSR A;  4KDP A;  4L9T A;  1D5V A;  2R5Y B;  2VOP A;  1FT9 A;  5FLV A;  3TO6 A;  1KGS A;  2K86 A;  2WV0 A;  3VOD A;  2OTL I;  1QA6 A;  4OIN F;  2MAB A;  5HS8 A;  2XGX A;  2FOW A;  2F5E A;  2VKE A;  3J81 Z;  2LNB A;  5J6X A;  1MDM A;  3JCU C;  4MQ9 F;  5M3M J;  2M0C A;  5DEQ A;  1BBY A;  2MA3 A;  1RR7 A;  4NQW A;  2VBY A;  4RB2 C;  9ANT A;  4WX9 A;  3H5A A;  1XSV A;  3ABM H;  1FIA A;  2GBY A;  3F9K A;  2ISZ A;  2RN7 A;  4HLX A;  3NEU A;  2QKM B;  4LFU A;  3ZQH A;  2CGP A;  3OYJ A;  3IKT A;  2XGE A;  5JHU A;  3ZOB A;  4R79 A;  1DGW Y;  3D1N I;  1JUP A;  3IP4 B;  2A07 F;  1VQ9 I;  3DF8 A;  2BW3 A;  3Q0V A;  1SFK A;  2DCE A;  2JZY A;  4CH7 A;  2QEX I;  4ZZL A;  4XQF A;  2HGC A;  2X1D A;  3HHH A;  3OYF A;  2QF7 A;  5DYM A;  2CH0 A;  3E7L A;  3FXJ A;  4RAF A;  2FF4 A;  2VJ4 A;  4GXO A;  2A5Y B;  3EUH C;  2E5Z A;  3GLX A;  4XK4 A;  3R0A A;  4CCM A;  1CGP A;  5D4S A;  5KNL A;  1LFP A;  5KCM A;  3JRH A;  2DBB A;  2EIK H;  1EJ9 A;  3HSE A;  1T2K A;  1BJZ A;  2FBI A;  1YX5 A;  4FQG A;  1WJ5 A;  3CCM I;  1G6N A;  4PJN A;  4D9J A;  4A93 J;  2KDO A;  1TBX A;  1R1T A;  1QGP A;  3LOC A;  2QSF X;  1YW8 A;  3N97 A;  1J5Y A;  3L2V A;  3UR3 C;  5LEK A;  3T0Y A;  3KZY A;  3BZC A;  4XOP A;  3WE2 A;  4E7J A;  3K6G A;  4P1W A;  1NK2 P;  4P55 A;  1HA8 A;  1LNW A;  4XOR A;  3H1C A;  1I3Q J;  1SD6 A;  5GP9 A;  2PEX A;  1R5I D;  2M7B A;  2VC0 A;  3CCQ I;  5H20 A;  3CCR I;  2EFN A;  3F21 A;  1DU0 A;  4UVA A;  2H94 A;  1NG6 A;  4HDU A;  1X1P A;  3NWT A;  1T98 A;  2ZKZ A;  3I4N J;  1ZEL A;  3P9I A;  1JXS A;  4A3L J;  2QA4 I;  2HVS A;  1Z3Y A;  2BGC A;  3DPU A;  1ZKG A;  3SZT A;  1KYZ A;  3V4G A;  3HZJ A;  4G94 A;  2YX4 A;  3AG4 H;  4I99 C;  4UUT A;  5LHI A;  4JOM A;  2QQ9 A;  3D5S C;  1MW7 A;  2MLG A;  4Y3O A;  2D2W A;  1UCR A;  4P96 A;  3ULQ B;  3D5L A;  3WOD F;  1U5T C;  2ECC A;  2L9S A;  1K6O A;  1Q1H A;  2X1C A;  4DYC A;  5HS7 A;  2A05 A;  3HOS A;  2WAQ A;  1ZRD A;  5IOZ A;  5FD5 A;  3SEQ A;  3U9G A;  2YS9 A;  3ELK A;  3PJR A;  3AFH A;  2HPI A;  2A61 A;  5HLT A;  2DA3 A;  3I4M J;  1RPW A;  2R5Z A;  1S7O A;  2G9W A;  3BT9 A;  4IHY A;  3L2U A;  2H27 A;  4IXA A;  1B8I A;  1YE9 A;  4RB0 A;  1PDN C;  2HXO A;  2DOA A;  1F43 A;  2QM3 A;  3I71 A;  2DXI A;  2R3S A;  3EUH A;  3V7C A;  2GZW A;  2UXX A;  4IKF A;  4YRV A;  1JKO C;  2KP6 A;  3BTC A;  5JI6 A;  1K83 J;  2GOX B;  3K4B A;  5H2F C;  4A3C J;  6PAX A;  1BI1 A;  2E71 A;  2LH9 A;  3VYS B;  4G7O F;  5CVV A;  1IXR C;  4LIT A;  4GO1 A;  4MO7 A;  1RKW A;  4NUB A;  3S16 J;  1X58 A;  2V26 A;  4UV9 A;  1IXS B;  1D3Y A;  2DA5 A;  3I0T A;  4IQ4 A;  2MYS A;  2ZFW A;  3Q9V A;  4HW0 A;  1P92 A;  1YJW I;  2E36 A;  3NAU A;  3LSM A;  3FDY A;  1XS9 A;  5CVI A;  3L2W A;  2JUG A;  2H6C A;  4NDL A;  5LLQ A;  3O8G A;  3EET A;  4Y52 J;  3UKG A;  3BTL A;  4N9H A;  1FMW A;  4IJA A;  1UHS A;  4Y33 A;  2JA2 A;  4HX8 A;  1FZP B;  4FHT A;  2XB5 A;  1N78 A;  3E1S A;  4WK8 F;  3QPT A;  2N8G A;  3IRQ A;  3IC7 A;  2HVQ A;  2Y0S A;  3BQY A;  3L1P A;  4ZYA A;  3N05 A;  2CW8 A;  1O57 A;  4D0P A;  4O3M A;  3PM1 A;  1U5T A;  3RSN A;  3OL4 A;  3JTH A;  3K0L A;  3ZMS A;  1E0E A;  2L4M A;  2AQF A;  1TWF J;  4KJZ A;  1Y1W J;  2EV5 A;  3ESW B;  2Z3Y A;  3CJQ B;  1TP4 A;  2LDU A;  2MSY A;  3ECO A;  2FE3 A;  1XDU A;  2ZCW A;  2R7D A;  3BR1 A;  4U87 A;  3ZQF A;  5B5E C;  3JRG A;  3RPU D;  2E2I J;  5DDG A;  3NWS A;  3JSP A;  4BJ5 C;  4EV0 A;  5C3E J;  5K5Q A;  2DA7 A;  3PIP F;  3WGG A;  2IA1 A;  2UZK A;  2FX0 A;  4LB5 A;  3ISP A;  1H88 C;  4CCJ A;  4XIC A;  3TO7 A;  4XSZ F;  1F4K A;  4CCN A;  2IS4 A;  2LP0 A;  2OPT A;  2XF6 A;  3BR2 A;  4KFC A;  4MTD A;  2DMU A;  2HOA A;  4EGY A;  1U6G A;  2VPR A;  3L7W A;  3GFJ A;  4HA8 A;  5KK1 A;  1S7E A;  4E70 A;  4A12 A;  4KNY A;  1T0F A;  1MBH A;  1TW3 A;  4R1H A;  1HXD A;  4CYD A;  3QOE A;  2P6S A;  3LMM A;  4MQV A;  1HC8 A;  5HNH A;  1RUO A;  2H09 A;  3C2B A;  4A2U A;  2KFD A;  2EIN H;  4KMF A;  3ABU A;  3AL0 B;  2Q2E A;  3DLA A;  2KRF A;  3MFK A;  1QHH D;  2NS7 A;  4K2E A;  3HGG A;  3N4M A;  3DTI A;  1F9N A;  1HDP A;  4FIS A;  3OYE A;  2WC2 A;  1BIA A;  1MBK A;  4OOI A;  3S1N J;  1BR4 A;  1HOM A;  2IGM A;  2STT A;  4O5V A;  2X51 A;  3FKI J;  2XRO A;  2V7F A;  5C44 J;  3AG3 H;  2X1E A;  1XDS A;  4E7Z A;  2DYS H;  3FBN B;  4ZYG A;  4LG3 A;  3CLO A;  2E60 A;  4PDK A;  1UMQ A;  5DCM B;  2KZV A;  5EEA A;  3VPR A;  1E3P A;  1XD7 A;  2E1M B;  4IPA A;  2ZBK A;  1YHQ I;  4KUM A;  1FYL A;  3HG9 A;  4IHW A;  3PSI A;  1LEA A;  4PSX A;  2RNJ A;  2ZSH B;  3LL7 A;  4OAZ A;  5B66 C;  3ZN1 A;  3E5Q A;  1VI0 A;  2CFX A;  1W1W E;  4LK1 F;  3A01 B;  2O61 A;  1IC8 A;  4AVP A;  5GAE J;  2GXG A;  4ESF A;  3OWT A;  4ZDO A;  3QP6 A;  4WXD A;  4AVZ A;  5FKL A;  2NAZ A;  1VZ0 A;  2E35 A;  2J5O A;  3RKW A;  2V6C A;  4A0Z A;  2X6W A;  3MKZ A;  2COB A;  1MH3 A;  4LB6 B;  3DLL F;  2XGC A;  2W84 A;  3H9G A;  1WJE A;  4BHP A;  2QWW A;  5EYR A;  4GYG A;  3J7Y J;  2KIU A;  1W4M A;  4PGG A;  3PNT A;  4UVB A;  2ZNY A;  3GZ5 A;  4UXN A;  2W57 A;  1S29 A;  1Z05 A;  3MAJ A;  4WXH A;  5EEG A;  3VSL A;  2CV1 A;  1O3S A;  2LF8 A;  2LC2 A;  2DOD A;  2ETH A;  2HTS A;  1T39 A;  2XAG A;  1WH7 A;  1E17 A;  2CQN A;  4G12 A;  1TT0 A;  4I09 A;  4PCQ A;  4OIR F;  2OZU A;  1Y56 A;  3B6C A;  3IH2 A;  3GXO A;  2UWM A;  3TDU C;  1VND A;  3J7Z I;  1REP C;  5K7F A;  1JKP C;  3K4C A;  1HDD C;  5LRR A;  4BJT A;  1FYK A;  3HGY A;  3GWZ A;  1QZE A;  2WAD A;  2WV1 A;  1QQI A;  3KP2 A;  3KP5 A;  4QTR A;  1K7A A;  3HOX J;  3GTM J;  2Y48 A;  3PQK A;  5FD6 A;  4IOA F;  1I6H J;  4AID A;  3RYR A;  2X85 A;  5HLG A;  1XPX A;  4AIK A;  4FX0 A;  3B73 A;  5C4J J;  3LSJ A;  2ICW G;  3HUG A;  5IT9 K;  3BJO A;  1N75 A;  1WPK A;  4IHS A;  5BQT A;  3KLO A;  2FRH A;  2FQ4 A;  3QOD A;  4CHU A;  2DO7 A;  2R7Q A;  3O8H A;  1NTC A;  2ZFU A;  4KIT B;  3H35 A;  1PUF B;  4KT5 C;  2A6E F;  2ZJQ F;  2IGO A;  1YJ9 I;  4BY7 J;  4PK4 A;  2DK8 A;  2F4O B;  4I01 A;  4OIO F;  5M3F J;  2O8X A;  3K4L A;  3PNV A;  3TP0 A;  2GM4 A;  1LVA A;  3MKW B;  2DK5 A;  1IV8 A;  2LF7 A;  4BBS J;  3ZR8 X;  2Y9Y A;  3RJP A;  5FB2 A;  1QPI A;  3HOZ J;  1BJA A;  3IUO A;  4MGR A;  1MMG A;  2W82 A;  4A6E A;  4C3H J;  2M0M A;  5IT3 A;  3JSO A;  1MNE A;  1O7L A;  5CVR A;  3M3Y J;  5E3M A;  1XMK A;  3R4K A;  4HSR A;  2A3S A;  2AXL A;  3BPV A;  4IRG A;  3L09 A;  3I53 A;  1D5Y A;  5J3L A;  1W36 C;  5IT9 Z;  1SFU A;  4LIV A;  1H8A C;  4IHX A;  4RM2 A;  3OOP A;  1JKQ C;  1YQA A;  3KLN A;  1NHA A;  4NHJ A;  2NOJ B;  4YG2 F;  4RAZ A;  4DQ2 A;  5FRN A;  5B1B H;  5LHH A;  1KQ9 A;  2F5F A;  4DGW B;  5LGT A;  4CCK A;  2HOE A;  3P5J A;  2ELH A;  1P4X A;  2L2O A;  3HOV J;  3A02 A;  4EJO A;  2CJJ A;  1MZB A;  2GA1 A;  4UB6 C;  3T8R A;  4Y15 A;  2LMD A;  3NQO A;  3E6D A;  3GUD A;  1R58 A;  1TQP A;  1A6I A;  5E18 F;  2GIV A;  1MJ9 A;  4P9U A;  1FTZ A;  1Z3X A;  2HOT A;  4C30 A;  1S9H A;  2HS5 A;  4P5O A;  4RM3 A;  4E7K A;  1ETX A;  2JA8 J;  3TOB A;  1RET A;  1IRF A;  2EK5 A;  2WB1 N;  2IJL A;  3CCU I;  2CUE A;  3ZQQ A;  2VJJ A;  1I1S A;  2K4J A;  2ZXH A;  4MFE A;  4XLH A;  3VOE A;  3OYD A;  5JFR A;  2KLO A;  1ZG3 A;  3CMY A;  4A3M J;  2OUM A;  4M3D A;  1W5T A;  1UEL B;  1GUU A;  5J47 A;  2ZME B;  1D0X A;  5FKM A;  2BEO A;  3HOU J;  3RQI A;  3HOW J;  4BXU A;  4A3G J;  4DYR A;  4E7S A;  2P5V A;  4U7B A;  1MMN A;  1PVE A;  2HZT A;  3TOA A;  3M4O J;  4IL6 C;  2QBY A;  1FJL A;  1TC3 C;  2L4A A;  4V2F A;  2GQQ A;  4BS9 A;  3SZG A;  3M1C A;  4UHT A;  5JLX A;  1P6R A;  4BUP A;  3GTG J;  3LAJ A;  4QSH A;  3FXL A;  3ZQC A;  1IUF A;  2L01 A;  1NG7 A;  2JRM A;  5F1J A;  3D5R C;  2LR8 A;  4CO8 A;  4HZF A;  2L9N A;  3CD6 I;  4AIJ A;  1YJN I;  2DU9 A;  1I5Z A;  2CUZ A;  4A3K J;  4H4K C;  2M3A A;  3F0C A;  3C3W A;  3BR0 A;  3IHU A;  1K79 A;  4EM1 A;  2EV0 A;  2P4W A;  3VDX A;  3RDI A;  3A4C A;  2ZJR F;  2B9S A;  3BCA A;  2NRA C;  2PMU A;  5HDG A;  2VBX A;  2E1M C;  1XB4 A;  3QPH A;  2Q0O A;  4XRF A;  1WRJ A;  3RIR A;  4A3J J;  2TDX A;  4KN4 X;  2IEK A;  1P2F A;  2MLK A;  1F1Z A;  2X0L A;  3V7R A;  2A5W A;  1R5H A;  1D8J A;  2DW4 A;  2M4K A;  3GBG A;  2ZJP F;  2FJ1 A;  3GTJ J;  1Z77 A;  5J8F A;  4M9X A;  4YEJ A;  4IHV A;  1OCO H;  3ZQI A;  3GTP J;  2E1O A;  3QPL A;  3CTA A;  5JVG F;  1DPR A;  5J4Y A;  4CA0 A;  2PX9 A;  2ZXW H;  3MKL A;  4BJ6 C;  1B59 A;  4NC7 A;  2YUS A;  3QYE A;  2BHY A;  2O0Y A;  1YG2 A;  2ZSI B;  3P7N A;  2RQQ A;  3QOP A;  4HAM A;  4QPQ A;  2GA2 A;  3BTI A;  4CSW A;  2KT0 A;  2R7R A;  3BPX A;  5EDN A;  2OC6 A;  4D5F A;  1XG1 A;  1O3Q A;  4EGZ A;  3DQV C;  1F5T A;  2E34 A;  3EUK L;  3PQJ A;  1ZRF A;  5LGN A;  2JQ7 A;  3G1L A;  5BS6 A;  3RI4 A;  3VB2 A;  2HI3 A;  2P0W A;  4FE4 A;  1EF4 A;  4D7N A;  2R7X A;  1V5E A;  1Z91 A;  3E6B A;  5HNF A;  2ELJ A;  5H6R A;  4XLC A;  4BU2 A;  3K4K A;  1S8N A;  2BYV E;  5ICE A;  2OBP A;  3OIQ A;  2OQG A;  2M87 A;  3VWB A;  2CQQ A;  3IV5 A;  2ME0 A;  2BZT A;  2ID3 A;  3MZ8 A;  5DUI A;  1R4N B;  2NOG A;  3DKY A;  5DS9 A;  2QVO A;  1IN6 A;  2AXT C;  2KIS A;  2QYO A;  1D1A A;  1U9N A;  2HXI A;  4BGD A;  3RKQ A;  3ZMU A;  1A31 A;  5DD8 A;  3X2Q H;  2IGK A;  3LSK A;  3S2D J;  3QWL A;  1XMA A;  3FWE A;  3LST A;  2GXB A;  2FBH A;  1JGS A;  4M71 A;  2NS0 A;  4ITV A;  1IRG A;  3OMY A;  2WA0 A;  3QAH A;  4QPO A;  5DCM A;  3O2P E;  3BZ6 A;  4XBF A;  4B48 A;  2Z5U A;  4A0X A;  2CSO A;  3OR2 C;  4AC0 A;  3C1D A;  4M6V A;  1G59 A;  4QIW N;  2IP2 A;  4BE2 A;  2A68 F;  4NNJ A;  1YOV B;  5CVJ A;  3SEZ A;  3A01 A;  4YFX F;  2EA2 A;  3QPS A;  3U1D A;  3G4S I;  4DJA A;  2LFB A;  2LOO A;  3W6V A;  1ZHF A;  2CQK A;  4B4C A;  1G3S A;  4KIC A;  4XKB A;  5GTI C;  3PNY A;  5J1U A;  4RBO A;  4CGZ A;  2K9Q A;  4B09 A;  2R7V A;  2ADU A;  1XGS A;  3S93 A;  3GYH X;  2VL8 A;  3TW7 A;  2A69 F;  3CC4 I;  3ERE D;  3S1R J;  3EQL F;  4HOB A;  3RKY A;  1LFB A;  3OIO A;  3CCS I;  1MSF C;  3ML6 A;  3O6B B;  4HX4 A;  2QGU A;  4GYI A;  3O3K A;  3H9J A;  2HQN A;  3MVP A;  3VFZ A;  1MH4 A;  3EUA A;  2K5C A;  3CJR B;  2WAQ N;  1B72 B;  4BKX A;  2HFH A;  2KL4 A;  2BOL A;  2BV6 A;  5B1A H;  3MMY B;  3W3C A;  5FLM J;  3WTX C;  4AM3 A;  3FHN A;  4E4H A;  2IS1 A;  3K10 A;  2VQG A;  2MC4 A;  1FOY A;  3SFZ A;  3BR5 A;  1VQ7 I;  1BI3 A;  4IOC F;  2L0K A;  3HB9 A;  4OMZ A;  4LLN A;  3C2H A;  3BR6 A;  3G2B A;  4Q47 A;  1J0R A;  1KON A;  2V1N A;  4XLP F;  3V7S A;  2K9L A;  2LTP A;  2Q8K A;  1ZLK A;  5LD2 C;  2OCE A;  4RA2 A;  3ZGK A;  4Q5S F;  3EDP A;  1FLI A;  3H3U A;  5E3N A;  5L3B A;  2GXA A;  3E97 A;  1YS7 A;  4FAS D;  4XRS A;  4MIM A;  3CJT B;  1I6X A;  3F8C A;  5DM7 F;  1X4P A;  3F72 A;  1T8I A;  2ISY A;  3RCO A;  1TNT A;  4Q48 A;  2HDD A;  1MMD A;  2K85 A;  2DQR A;  2X9D A;  4ESB A;  5KAI C;  3DCF A;  3DXJ F;  3G6E I;  2ZME C;  2DI3 A;  1A5J A;  1BN5 A;  2RV8 A;  2F48 A;  4S04 A;  1RRJ A;  1B1B A;  1HKS A;  2DMT A;  5K1Y A;  1QO0 D;  2MGQ A;  3NRV A;  3TGN A;  4JX5 A;  4ENN A;  2QSH X;  2WBM A;  3D0S A;  1Y1V J;  3E3V A;  4E7L A;  1HBX G;  1KU2 A;  3TBI A;  2P7C B;  3PUB A;  4HF1 A;  2JVH A;  4G9Y A;  1MBG A;  4Y7N J;  1WI9 A;  3KP3 A;  3SDG A;  2EZL A;  4E7I A;  1HW2 A;  1S72 I;  1B9M A;  3JRF A;  2I5U A;  2Y0S N;  2W24 A;  3K70 C;  3BG7 A;  5E3L A;  3P9K A;  3ZCO A;  1CF7 B;  1X3Z B;  3L2C A;  4W97 A;  3U1K A;  4ESJ A;  4LLL A;  1XCV A;  1FC3 A;  2EFP A;  5EJC A;  2BXY A;  4JYK A;  3BZK A;  5L3G A;  3G73 A;  3TDZ C;  3FKJ A;  2DMP A;  1IGN A;  1GLN A;  2JJ7 A;  5IYB J;  2HEO A;  4XN3 A;  3ONQ A;  3A0B C;  2V4J C;  3FXK A;  1MIJ A;  5D8L B;  3FXO A;  3RTR A;  1ETW A;  4J01 A;  2YR2 A;  3F8N A;  4MEY F;  2HQR A;  2L7F P;  4B1R A;  1FIP A;  3Q9S A;  1WSU A;  1WVR A;  3GLL A;  1OJL A;  3FF5 A;  1T56 A;  4ZYE A;  2K9S A;  3QYF A;  5DTD A;  2Z2S B;  3ZN0 A;  4HST A;  1FWZ A;  2NVT J;  3HKZ N;  1R49 A;  2EH3 A;  3L9F A;  4NC6 A;  2LY9 A;  2R7S A;  4C3J J;  5JLW A;  3CCV I;  4H0E A;  1G4D A;  3K1N A;  1SD5 A;  5FFZ A;  5C4X J;  5CQE A;  4FT8 A;  1LPQ A;  1ZRE A;  2KDZ A;  3S1Q J;  3W6J B;  1AOY A;  4I0B A;  3LSP A;  4O6J A;  1RKT A;  2Y9Z A;  4EAT A;  2OJE D;  4PJM A;  1T0F C;  1HLV A;  2DTZ A;  3H0D A;  2L54 A;  2VI6 A;  1YW9 A;  3CUQ B;  4XOT A;  2EZI A;  1FYM A;  4IO9 F;  3VYU B;  3S15 J;  1S7A A;  2JPC A;  1QVU A;  3KP6 A;  4XLF A;  1RNL A;  2ZME A;  3CUO A;  3ASN H;  1ZAR A;  1W5C C;  1QZY A;  1VQN I;  5BPI A;  2HU9 A;  1IRZ A;  4M3B A;  4G8X A;  4RGS A;  2JT1 A;  1ETV A;  1B4A A;  1O3R A;  2F4M B;  2K4B A;  2LK2 A;  2EIJ H;  2FML A;  1WJA A;  2O8K A;  1IF1 A;  5GPC A;  4F3Q A;  2VJ5 A;  3Q0U A;  4EJW A;  3G1O A;  1XCB A;  2CQ7 A;  4CCL A;  3JRA A;  1LJ9 A;  1G3T A;  2P81 A;  2NVQ J;  5D6E A;  3MEX A;  2JUC A;  3ZP5 A;  2C6Y A;  3KIO A;  5DM6 F;  4KIB A;  2H8R A;  4A3B J;  3BCB A;  2L7M P;  4PFO A;  4CUG A;  4D5C A;  4A6D A;  2FMY A;  3BG6 A;  3BG3 A;  1J7K A;  3OYB A;  4S05 A;  2M8G X;  5ICF A;  1MKM A;  1IN5 A;  4XKW A;  5IP9 J;  1EV7 A;  1SD7 A;  2MFZ A;  1ZQ3 P;  1YRN A;  1W7P B;  4PUS A;  5GAD J;  4BHC A;  2HPM A;  2R7U A;  4ZJZ A;  3J7A O;  1RC9 A;  4B3X A;  3C7J A;  2LKP A;  1XTA A;  1VFC A;  3WG9 A;  4ETS A;  1APL C;  1WJF A;  3F3X A;  1X2M A;  3FXR A;  4BY1 J;  1R23 A;  2Y30 A;  2PJP A;  2RDP A;  3HKZ A;  3MZY A;  2GWR A;  2E2J J;  2FUG 2;  4HLY A;  2VJI A;  2E1N A;  2DPD A;  4UUS B;  4IVN A;  1A36 A;  2YU9 J;  4J19 A;  1RIO H;  1VF9 A;  1T33 A;  2F5V A;  2BY0 A;  1P4A A;  1K78 B;  3OYN A;  5EGO B;  2V9V A;  2XPU A;  1X1B A;  1LFU P;  2IRF G;  2VKV A;  3HYI A;  5KAF C;  4ZYH A;  1OPC A;  4M72 A;  5TGT A;  1VQ4 I;  4RLF A;  4A69 C;  2DA4 A;  2COM A;  5IYC J;  5KHD A;  4FX4 A;  2ME6 A;  3MKY B;  1FMV A;  1IZ1 A;  1TWH J;  3FM5 A;  4LK0 F;  1SFO J;  3S2W A;  1P7I A;  2EQR A;  2X48 A;  1ZR2 A;  3I64 A;  1U8B A;  2XSD C;  5K5R A;  3DU6 A;  2HYJ A;  4A3F J;  3OSF A;  2FD5 A;  3K4N A;  2X4H A;  3ECH A;  3F8M A;  2OZ6 A;  4ANJ A;  5EEH A;  4XID A;  1PP7 U;  5AON A;  3LWF A;  4MTE A;  2NVY J;  3SFI A;  1TZL A;  1U2W A;  2QSG X;  2E19 A;  2H1L A;  3R0J A;  1V55 H;  4IF4 A;  4TV7 A;  3C2G A;  2ESH A;  2VXD A;  4HNT A;  1ZN2 A;  2EV6 A;  4E7H A;  4XLA A;  5ED4 A;  2DFE A;  3K2A A;  1W0U A;  3PUF A;  3OIP A;  1OMI A;  2BHZ A;  3I9V 2;  4DIQ A;  4J00 A;  3OYM A;  3H3V K;  3LFU A;  2XIG A;  4JX4 A;  2DQL A;  3BQZ A;  4RAG A;  1HKQ A;  1L3L A;  1OFC X;  3WU1 B;  4DZP A;  1MJA A;  4V2G A;  2R5Y A;  3HTS B;  5CPR B;  3DKX A;  4HYE A;  4BE1 A;  1YIJ I;  4C2T A;  2M7A A;  2ESN A;  3EYY A;  2EJR A;  3PFI A;  1BIB A;  2Y69 H;  2UUZ A;  3BJ6 A;  1G3Y A;  1J75 A;  1ZG5 A;  2IXS A;  1VQM I;  1J59 A;  2EZK A;  2BXZ A;  1I1G A;  3PL8 A;  2Z16 A;  3H9Q A;  2OA4 A;  2DOE A;  4OMY A;  1J2X A;  4BHB A;  2CW0 F;  1B72 A;  3J80 K;  1OCZ H;  2RRE A;  3HRM A;  3R60 A;  5GAH J;  2XHK A;  4I6Z A;  1QZZ A;  4BDZ A;  4F93 B;  2XKP A;  1R4M B;  1SMT A;  2BY1 A;  3E5X A;  3SZP A;  1BR1 A;  2HQA A;  1SMY F;  2K3F A;  3ZQG A;  4HEA 2;  4MLO A;  3S3M A;  3SHF A;  3JR9 A;  5E1W A;  4AUX A;  4DBR A;  1D8K A;  2IS2 A;  1KA8 A;  2EFW A;  3LQQ A;  1TT5 B;  2VAS A;  4RB3 C;  4HF2 A;  2FBK A;  2L9V A;  1B6A A;  3DEE A;  3T1B A;  2BVL A;  1OCP A;  4C3I J;  2LRE A;  1TLH B;  4NBQ A;  1V4R A;  1V5F A;  3BOQ A;  1Y8R B;  1EH6 A;  3NAR A;  2AHQ A;  4EQQ A;  3IAS 2;  3GTK J;  2Y2Z A;  1VQ8 I;  2VPL A;  4LD5 A;  1X1D A;  3SYT A;  2DA2 A;  2H8W A;  1WQ2 A;  2RVC A;  1V54 H;  1ZGJ A;  1LB2 A;  2O5R A;  1ETK A;  3J80 Z;  3H92 A;  3TMO A;  5CQG A;  2DT7 B;  4F7Z A;  3TED A;  1KU7 A;  3BG9 A;  3M9A A;  3E0J B;  3K1P A;  3CCY A;  1MMA A;  1SD4 A;  1X2N A;  5E79 C;  4DZJ A;  3UNG C;  5HLH A;  4U0Y A;  1IN4 A;  2ZC2 A;  3FHZ A;  1Z6R A;  4HG2 A;  4L9J A;  3IWF A;  1Z7U A;  1YFH A;  4M9S A;  3CF2 A;  1BR2 A;  4BH9 A;  3OYA A;  2XB0 X;  4BXX J;  2HDW A;  5DV5 A;  3R61 A;  3JRD A;  2TRT A;  2FNP A;  1IXC A;  5GTH C;  1W36 D;  3HPH A;  2IBD A;  1Y6I A;  5EG0 B;  2CMP A;  2PMH A;  2WTE A;  4EM2 A;  3CJN A;  1FOW A;  4N4O B;  3ASO H;  3FXQ A;  3I59 B;  2XAF A;  3MCZ A;  3VSK A;  1YIT I;  1KQ0 A;  4FE7 A;  3BG5 A;  1CF7 A;  2H6B A;  5L3E A;  1NH3 A;  3R6S A;  4RGX A;  1UZC A;  3DTK A;  4UUV A;  4F55 A;  1WFX A;  5KVR A;  2BE5 F;  5K7Z A;  2NVU B;  2W48 A;  1FBU A;  3ABT A;  4BBR J;  1E3O C;  4XM3 A;  3ZMZ A;  1MSE C;  2EFQ A;  2CV0 A;  2IPQ X;  1JJ6 C;  2PQ8 A;  1MBE A;  2NXN B;  1UG2 A;  1ENH A;  2G0E A;  3HJE A;  1LDK B;  1Y39 A;  1V5G A;  2ELK A;  1BI2 A;  1KU9 A;  5F08 A;  1FBQ A;  1QU3 A;  1WI3 A;  2YSR A;  3FBI B;  3I58 A;  2KKO A;  3ZQ7 A;  3L2R A;  2P5L C;  4XLN F;  3M8E A;  4LOC A;  1MD0 A;  2XGD A;  2F6C A;  4KA4 A;  2LG4 A;  2LSO A;  1G2H A;  4BQQ A;  3K7A J;  1FP2 A;  5HVQ C;  4BQO A;  5ILV A;  3LAP A;  4M73 A;  5CKT A;  3ZMT A;  1WJD A;  4KIF A;  5AIQ A;  3W6K B;  1OCC H;  1P9Q C;  1E3H A;  4NB5 A;  2VN2 A;  3MN2 A;  4MEX F;  2KQR A;  3GEZ A;  2M34 A;  1BC8 C;  2LKX A;  3V42 A;  3ZPL A;  1U0J A;  4AIH A;  4BYY A;  1LDD A;  4IEJ A;  1B9N A;  4L0Z B;  2M4G A;  3P9C A;  3DTE A;  2QUF A;  3PSF A;  1YTY A;  5JR3 A;  3M1E A;  3LA3 A;  4Q4Z F;  2MD0 A;  1EKE A;  4DW6 A;  2HYF A;  3BJA A;  2M9H A;  3KE2 A;  2XAH A;  2DJI A;  2MD5 A;  4E6K G;  3AL0 C;  2CV2 A;  3J7A Y;  3IRR A;  3WTT C;  5HDN A;  5E8I A;  2LLK A;  2E7W A;  1J09 A;  5GAG J;  1PUE E;  2MW8 A;  4ENK A;  2IGN A;  4HRI A;  1ON1 A;  2F5C A;  1QNT A;  4XN0 A;  2VUM J;  4LMY A;  2R93 J;  2DAO A;  2K02 A;  3ROU A;  3DU5 A;  1HSJ A;  4G6Q A;  3CCE I;  3DEW A;  3HTU A;  4RDU A;  4II2 A;  5E1X A;  2V1U A;  3CDH A;  4N9I A;  2E7X A;  5D5W B;  3GFL A;  3K1M A;  5ILS A;  4RAY A;  2B7E A;  2Z99 A;  1USS A;  4A5M A;  1JHH A;  5D8K B;  1WWX A;  2LY1 A;  4YII A;  1JE8 A;  1Z0X A;  3CMA I;  5BNG A;  1OQY A;  3CC7 I;  3FMS A;  3GW2 A;  1FNN A;  3HRT A;  2XC7 A;  4YIR X;  2XAQ A;  1W7P A;  2H1K A;  3COA C;  3A0H C;  2EIM H;  2IW5 A;  3A2K A;  4WF2 A;  1GVJ A;  2WAF A;  1Z1D A;  4IX7 A;  4UY8 I;  1L0O C;  2GLO A;  3CME I;  2VB6 A;  1WJB A;  1KQ8 A;  3K4J A;  4HDV A;  5F27 A;  5F0H A;  4ZYD A;  1IG7 A;  2PI0 A;  2P6T A;  1J9I A;  2AQE A;  2EB7 A;  2HWV A;  1X3W B;  4HNU A;  4UUS A;  1MNM C;  3GTQ J;  5LGU A;  1R71 A;  1EA3 A;  1VQP I;  4KMU X;  3LA7 A;  1K78 A;  3E6M A;  3H3Z A;  1UB9 A;  2STW A;  1JTX A;  5EGO A;  2EZH A;  2ZNZ A;  3OYC A;  4GRI A;  1K4T A;  4LIU A;  2VT2 A;  4X0G A;  1FSH A;  1WCM J;  2PJR B;  1EH8 A;  1W5S A;  1YYV A;  4EM0 B;  4D1Q A;  5HOO A;  4XKV A;  2DFH A;  2IS6 A;  4XMY A;  4PJL A;  4PSW A;  4LG0 B;  2HZD A;  3IH3 A;  2ZXI A;  2L7Z A;  2V79 A;  3DPT A;  3FIS A;  3H0G J;  3F6V A;  5LRS A;  3HL2 A;  2R7Z J;  1D0Z A;  1IUY A;  1SVM A;  3G1M A;  3KET A;  2DDA A;  2DJN A;  1FBS A;  3FK6 A;  3K4M A;  4I0A A;  3FZV A;  4ENM A;  1G8X A;  3G3Z A;  4GFB A;  3PO2 J;  1T08 B;  4V19 K;  5E17 F;  5E20 A;  2LBF B;  1GHC A;  2L02 A;  3M8J A;  3FIW A;  4RB1 A;  1FP1 D;  4HBL A;  2M2E A;  3I3L A;  2O03 A;  3GCM A;  1VQK I;  1K61 A;  4U88 A;  1YS6 A;  2E2H J;  1HQC A;  3TQN A;  3JRC A;  3MZH A;  1H0M A;  4DBQ A;  2DMN A;  1W0T A;  4U0V A;  2R7W A;  1O3T A;  2AO9 A;  3DEU A;  2EPF A;  5IPA A;  2QCO A;  3SQN A;  3DKW A;  3KCC A;  2D1H A;  4Y13 A;  1BOA A;  1Z9C A;  3WTY C;  1VQO I;  1TWC J;  3JW4 A;  4W1U A;  3V8J A;  2HKO A;  2DPU A;  5LBQ A;  5DCF A;  4XON A;  1A6Q A;  3KFW X;  3KZI C;  3WHB A;  2EWN A;  3HPG A;  4PFP A;  2O6G E;  5F64 A;  2A6H F;  1XGO A;  3KEO A;  3REO A;  5FLX K;  1R1V A;  2WY7 Q;  3GZ6 A;  4Y4R A;  4HNV A;  5TIS C;  3VYT B;  4JQF A;  1X3U A;  4NC8 A;  5IP6 A;  5FKN A;  2VE9 A;  3Q5F A;  1R36 A;  4M3G A;  1DP7 P; 
#chains in the Genus database with same CATH homology
 1Y56 A;  3L2Q A;  2W7N A;  3BCB A;  4PFO A;  4CUG A;  2UWM A;  1LVK A;  1DQU A;  3BG6 A;  3K4C A;  3S8P A;  4BJT A;  3OYB A;  1D0Y A;  2WAD A;  4ZDL A;  4XKW A;  2LY2 A;  3OS2 A;  2MFZ A;  4PJJ A;  1Z7L A;  2LYC A;  4PUS A;  2HPM A;  2R7U A;  4C9Y A;  2X85 A;  4ZJZ A;  1AA7 A;  4KIS A;  4B3X A;  4ZTF A;  1WJF A;  3LSH A;  1N75 A;  3HUG B;  4AYB A;  5FRO A;  3QOD A;  3BC8 A;  2R7Q A;  1D1B A;  2ZFU A;  3HC7 A;  3HKZ A;  4KIT B;  3H35 A;  2L5Q A;  2FUG 2;  2IGO A;  2VJI A;  3KEY A;  4PK4 A;  2LRD A;  3K4L A;  3PNV A;  3OYK A;  2I8D A;  3MKW B;  3H5R A;  3OYI A;  2F5V A;  4F52 A;  4ZC3 A;  3ZR8 X;  3OYN A;  3IUO A;  1X1B A;  3K70 D;  2WB1 A;  1MMG A;  2W82 A;  3CP2 A;  2M0M A;  1MNE A;  2KPM A;  5TGT A;  4BDY A;  4RLF A;  4HSR A;  1BOB A;  4B43 A;  4G6T B;  4BEH A;  1D1C A;  4II3 A;  2XF5 A;  3S3N A;  5KHD A;  2GOM A;  3MKY B;  1FMV A;  1W36 C;  2Q2E B;  4LIV A;  4RM2 A;  3CMM A;  3W2W A;  3QYB A;  2JSP A;  2XAU A;  4FET A;  2NOJ B;  3OYL A;  3DU6 A;  3TL4 X;  5FRN A;  3CES A;  4F91 B;  3S3O A;  3K4N A;  4DGW B;  4CCK A;  2HNH A;  4BXF A;  1MND A;  3CZ6 A;  4XNF A;  3S32 A;  4ANJ A;  3W2V A;  2L2O A;  1TZL A;  2CUJ A;  4YEL A;  1Z21 A;  3C2G A;  2VXD A;  4HNT A;  4DOZ A;  1X1C A;  4E7H A;  1Z3X A;  3DWL E;  4C30 A;  4XLA A;  2V6E A;  1S9H A;  4P5O A;  4RM3 A;  4E7K A;  4ZTJ A;  3OIP A;  3LSG A;  3ZQQ A;  2BVM A;  2VJJ A;  3I9V 2;  4DIQ A;  4J00 A;  1ERD A;  2ZXH A;  3OYM A;  1DGR M;  4XLH A;  3OYD A;  3LFU A;  2KLO A;  2DT6 A;  2OUM A;  1UEL B;  2K3P A;  2VQC A;  1D0X A;  3PFY A;  1N77 A;  1LKX A;  4E7S A;  4U7B A;  1MMN A;  5CPR B;  3DKX A;  3ZRG A;  4BE1 A;  2XF7 A;  4C2T A;  2M7A A;  2VQH A;  2UUZ A;  4BS9 A;  2IXS A;  2MAB A;  3A1Y A;  3M1C A;  3SZG A;  3OS0 A;  4BUP A;  3PL8 A;  2Z16 A;  3H9Q A;  4OWR B;  2VQL A;  1PYV A;  2R7O A;  1NG7 A;  2UV1 A;  3D5R C;  2RRE A;  3H5A A;  4BDZ A;  4F93 B;  2L9N A;  4ZDP A;  1BR1 A;  2HQA A;  3F9K A;  3KX2 A;  3OR1 C;  2QKM B;  2CUZ A;  3HXL A;  4H4K C;  2M3A A;  4HEA 2;  4MLO A;  3OYJ A;  3S3M A;  2JVG A;  3VDX A;  4R79 A;  1DGW Y;  4DBR A;  3IP4 B;  2IS2 A;  3A4C A;  2BW3 A;  3BCA A;  4HPQ A;  1SFK A;  2VAS A;  2DCE A;  2E1M C;  4CH7 A;  4XQF A;  2X1D A;  3DEE A;  3OYF A;  2BVL A;  4C2U A;  2LRE A;  2CH0 A;  3EPZ A;  1V5F A;  2A5W A;  1WJC A;  2VJ4 A;  3EUH C;  3OS1 A;  1K6Y A;  2E5Z A;  4CCM A;  3IAS 2;  2M4K A;  3GBG A;  5KNL A;  1LFP A;  5KCM A;  1UG0 A;  2VPL A;  4YEJ A;  2L7K A;  1YX5 A;  1X1D A;  3SYT A;  1WJ5 A;  4CA0 A;  4BJ6 C;  5LFA A;  4NC7 A;  4PJN A;  4D9J A;  2KDO A;  3QYE A;  2O5R A;  2VLA A;  2ZSI B;  4N4N B;  3CP8 A;  2DT7 B;  5CQG A;  3TMO A;  2RQQ A;  4QPQ A;  3E0J B;  3L2V A;  3UR3 C;  1MMA A;  4XLE A;  4CSW A;  2R7R A;  4XOP A;  3UNG C;  4E7J A;  3K6G A;  1T95 A;  4P1W A;  1HA8 A;  4HG2 A;  2OC6 A;  4XOR A;  4BE0 A;  3DQV C;  2M7B A;  3EUK L;  3CF2 A;  1BR2 A;  3OYA A;  1R6R A;  2HDW A;  1NG6 A;  3NWT A;  1W36 D;  2P0W A;  3HPH A;  4BEH B;  1ZEL A;  1Y6I A;  2R7X A;  2CMP A;  3LSI A;  2HVS A;  1Z3Y A;  1V5E A;  2R4G A;  4N4O B;  3VSK A;  3DPU A;  5HNF A;  2ELJ A;  4XL9 A;  4XLC A;  4BU2 A;  3K4K A;  2PJR A;  3OIQ A;  3DTK A;  4F55 A;  1WFX A;  3VWB A;  4JOM A;  3D5S C;  1MW7 A;  4XM3 A;  4Y3O A;  3DKY A;  2CV0 A;  3D5L A;  1D1A A;  4BGD A;  2L9S A;  3W2A A;  2X1C A;  4OAY A;  1LDK B;  3HOS A;  1V5G A;  2IGK A;  3LSK A;  2HVR A;  1YX3 A;  2WAQ A;  3IAM 2;  4CZC A;  3SEQ A;  3OOU A;  1QU3 A;  3KYL A;  3FBI B;  3AFH A;  3PJR A;  2HPI A;  5HLT A;  3L2R A;  4ITV A;  2LBF A;  4RLQ A;  1DP3 A;  2F6C A;  2KHM A;  2WA0 A;  3OMY A;  2LG4 A;  4QPO A;  3L2U A;  4BQQ A;  2F4I A;  4B48 A;  4BQO A;  5HVQ C;  1YE9 A;  5CKT A;  1WJD A;  3OR2 C;  1P9Q C;  2DOA A;  3DPL C;  2V9K A;  2XDV A;  1G59 A;  2DXI A;  4BE2 A;  2KQR A;  4NNJ A;  4IKF A;  4YRV A;  2KP6 A;  3SEZ A;  3V42 A;  1U0J A;  2GOX B;  3K4B A;  2A6T A;  4CCO A;  2LH9 A;  4DJA A;  2M4G A;  2LOO A;  3DTE A;  3VYS B;  3PSF A;  4XKB A;  3PNY A;  2R7V A;  2MD0 A;  4LIT A;  3S93 A;  3VYR B;  4NUB A;  2VL8 A;  2V26 A;  2DJI A;  4AU7 A;  4IQ4 A;  4E6K G;  3AL0 C;  2CV2 A;  3J7A Y;  2MYS A;  2VXZ A;  2PMZ A;  1J09 A;  4HRI A;  3LSM A;  2IGN A;  1QHG A;  3H9J A;  3FDY A;  4XN0 A;  4KT6 A;  3EUA A;  3L2W A;  2K5C A;  3CJR B;  2CFO A;  2JUG A;  4NQW B;  2KL4 A;  2BOL A;  3DU5 A;  3MMY B;  3W3C A;  3FHN A;  4E4H A;  2R7T A;  2X6Y A;  1FMW A;  4II2 A;  2IS1 A;  4Y33 A;  2JA2 A;  3K10 A;  2VQG A;  2MC4 A;  4XKC A;  1N78 A;  3E1S A;  2Q1Z B;  2BW3 B;  2HVQ A;  2Y0S A;  3C2H A;  3G2B A;  2LY1 A;  2CW7 A;  1KON A;  4ZYA A;  2V1N A;  3OYG A;  3N05 A;  2CW8 A;  2K9L A;  2W00 A;  5LD2 C;  3RSN A;  3OL4 A;  1IRX A;  2Z1D A;  3ZGK A;  1E0E A;  2AQF A;  4KJZ A;  4XR6 A;  2XC7 A;  2E5N A;  3CJQ B;  4FAS D;  3A2K A;  2WY8 Q;  4BL0 B;  1X4P A;  2WAF A;  3RCO A;  4U87 A;  4IX7 A;  1MMD A;  3RPU D;  2VB6 A;  1WJB A;  3NWS A;  4IZZ A;  4BJ5 C;  1SAU A;  3K4J A;  2W4S A;  2AQE A;  4HNU A;  4CCJ A;  4CCN A;  2IS4 A;  2KMU A;  1EA3 A;  2XF6 A;  2WBM A;  5JHF A;  4E7L A;  4IQJ A;  3TBI A;  3PUB A;  1JI8 A;  2JVH A;  3OYC A;  4GRI A;  4LIU A;  4X0G A;  3AKZ A;  4E7I A;  3QOE A;  3LMM A;  3K70 C;  2PJR B;  3BG7 A;  5HNH A;  3ZCO A;  4D1Q A;  1OLT A;  5HOO A;  5FRM A;  2W1O A;  4XKV A;  2IS6 A;  4XMY A;  4PJL A;  2XSJ C;  4PSW A;  4B44 A;  3AL0 B;  3DLA A;  2HZD A;  3FKJ A;  2ZXI A;  1QHH D;  3DPT A;  1GLN A;  3HL2 A;  3DTI A;  1D0Z A;  3OYE A;  4XN3 A;  3ONQ A;  3RQ4 A;  1BR4 A;  2V4J C;  3K4M A;  4BAC A;  3RTR A;  2IGM A;  2RNG A;  2X6X A;  1G8X A;  2X51 A;  4B47 A;  4J01 A;  2V7F A;  3BLY A;  2X1E A;  4E7Z A;  2LBF B;  3FBN B;  3M8J A;  4LG3 A;  2E60 A;  3QYF A;  2KZV A;  2Z2S B;  2E1M B;  4HST A;  1X1A A;  3I3L A;  1UAA A;  2R7S A;  3HG9 A;  1OR7 C;  2OV7 A;  3MD2 A;  3PSI A;  4PSX A;  2ZSH B;  5CQE A;  3LL7 A;  4DBQ A;  4OAZ A;  3U21 A;  4F92 B;  3OL3 A;  4EAT A;  2R7W A;  4PJM A;  1T0F C;  3H0D A;  3OWT A;  4ZDO A;  2K9M A;  2VKH A;  4XOT A;  3ZXS A;  4AVZ A;  3SDB A;  2CS3 A;  1VZ0 A;  3VYU B;  4XLF A;  2X6W A;  3MKZ A;  3HOT A;  2HU9 A;  4XON A;  1X19 A;  2VKD A;  3H9G A;  1WJE A;  2KRH A;  3HPG A;  4PFP A;  3PNT A;  4RMN A;  1WJA A;  2WAE A;  3OY9 A;  3VSL A;  3H5N A;  2CV1 A;  2VIX A;  4F3Q A;  2LC2 A;  2VJ5 A;  2WY7 Q;  3OYH A;  4Y4R A;  1X4O A;  1PJR A;  3VYT B;  2QKL B;  4JQF A;  4NC8 A;  4CCL A;  4BQN A;  1TT0 A;  2KRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...