2CUJA

Solution structure of swirm domain of mouse transcriptional adaptor 2-like
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
108
structure length
108
Chain Sequence
GSSGSSGIDSGLSPSVLMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional adaptor 2-like
publication title Structural and Functional Differences of SWIRM Domain Subtypes
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 17
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cujA01
2AQEA 2CUJA 2DCEA 2ELJA 2AQFA
chains in the Genus database with same CATH superfamily
1QNTA 3O6BB 3G71I 3OOPA 4CZCA 1JUMA 4CGZA 3EPZA 4XRFA 1IRFA 1P4WA 2EIKH 1JGGA 3LFUA 4C9YA 4B8XA 4WK8F 3L1PA 3K6GA 1YOVB 4AIKA 2X6YA 2K4BA 1QBJA 4MEYF 5J8FA 1V5FA 4M3DA 2OZ6A 4EJUA 2EFQA 1YIJI 3L7WA 3JRAA 1HBXG 3FK6A 4JBAA 3CJNA 2ZXHA 3K1NA 4BHBA 5A2QZ 2CH0A 1LJ9A 2DMUA 1VQ6I 3A0HC 1UCRA 2A05A 1BI3A 1ZKGA 3EDPA 4BE2A 5IP9J 4ZDLA 2IGMA 2KDOA 2LP0A 1RI7A 2L3DA 3R0AA 2X4HA 5IYCJ 2F5EA 3K7AJ 2DT6A 2FOWA 2VT2A 2K7LA 1I5ZA 4YIRX 3ECHA 5JFRA 4PSWA 4DQ2A 3ZP5A 3QPTA 2CW8A 2GLOA 3MD2A 3WTZA 3FBNB 2NXNB 2QQ9A 2BYVE 1JKOC 4YIFA 3HOXJ 4ZYGA 4ENKA 3U1KA 1FJLA 3CCQI 2Y31A 2IP2A 4Q47A 2EINH 1HDPA 2IGNA 4ANJA 4IEJA 1OMIA 1XC5A 2HZTA 4K2EA 4AU7A 3OYKA 4HF1A 3C18A 3KEYA 1X3ZB 4PK4A 4BJ5C 2IT0A 4HV6A 2XAHA 1RETA 3KIOA 5M5YJ 5AIQA 2XKPA 1HW2A 1QPIA 1U8BA 2R7FA 2BW3B 1G3WA 4HV5A 4QPOA 1IUFA 2E7XA 2DDAA 1UMQA 2LSOA 4EVIA 2BY1A 4XK4A 4RAZA 2EZHA 2HOAA 4OAZA 4D7MA 3S1QJ 5F1JA 4OU0A 2I5UA 4JOMA 3ECOA 4A3EJ 5K7ZA 4L0ZB 2COMA 2DA3A 1BR2A 2IXSA 2LLKA 1WSUA 3HOVJ 5LGTA 4L9VA 3ZGKA 3GVAA 4ENMA 1YW9A 3NQOA 4UVAA 1HF0A 2DMTA 2HVRA 2QSFX 4M3BA 2VXZA 3R4KA 3ZQLA 3K10A 3E97A 2WV1A 1EA3A 2VOPA 2FU4A 1ONVA 2OAZA 2VONA 3BG6A 1N75A 3O8GA 2HDCA 4X6AJ 2RV8A 4PJLA 3WHBA 2EA2A 2X85A 1X2MA 3DTEA 1JE8A 4Y15A 2HFHA 3E1SA 2L7FP 4LD5A 1MNMC 5FROA 1TWGJ 4BXXJ 1XDUA 1ZK8A 1ULYA 2GA2A 1U2WA 4OOIA 4ZYEA 3HEFA 5GAHJ 2QYOA 3GLXA 4B3AA 4UNOA 3LSRA 3CCRI 2UV1A 1JGSA 1ZTRA 5H2FC 3JREA 2VB6A 2W4SA 2VUMJ 3F0CA 2YU9J 3PNYA 1ZQ3P 2CQQA 3K4MA 1DU0A 3KEQA 4B3XA 5GTIC 5EF6A 2R92J 3ESWB 1KQ0A 5IT3A 3Q9SA 4O6JA 1KQ9A 2ID6A 1G3TA 1ZYRF 2TRTA 2W24A 1MJBA 2NS8A 3U1DA 4HRIA 3J80Z 2J5PA 4BE0A 1IXCA 2CO5A 2Q8KA 3CCVI 1NK3P 3NAUA 5IT9K 1WJCA 4FASD 4XR6A 2O03A 1D8JA 2MYSA 4Y52J 4CCKA 1KZHA 2L01A 5DM6F 1MSEC 5TGTA 4X0GA 1IDZA 2HNHA 1NTCA 5K1YA 1WCMJ 2KT0A 2V1XA 3PQKA 2Y0MA 2F48A 3AFHA 1XSXA 3V7RA 2BY0A 4BE1A 3I59A 2DXIA 2H09A 5CKTA 1X19A 1DDNA 4I0AA 3PM1A 4DGWB 3CCEI 3WGIA 3IUOA 5EGOB 1JUPA 2JA2A 1IRXA 4M6XA 3T0YA 4NC7A 2RAEA 1YLFA 2XASA 2XUBA 4U0VA 3KLOA 3BY6A 3NARA 1FOXA 3I4NJ 2JWTA 1RKWA 3LL7A 4A3JJ 1ERDA 2MW8A 2R5YA 1K4SA 1APLC 3P5JA 2VOOA 3QYBA 2CUFA 1W7PB 2RQPA 3A0BC 4HEA2 1U9OA 3S8PA 4BQOA 1BC8C 2DK8A 4BGDA 1V4RA 3W2WA 1OCZH 4ZZLA 4ON0A 3A03A 3G73A 4B09A 4FX0A 2X6XA 1CF7A 1FTZA 3MKYB 3VYRB 2VI6A 2JPBA 3AL0C 2DFHA 1J75A 3DEUA 3N05A 1IZ1A 4HSRA 4KIFA 1LUJB 3RQ4A 4M9XA 1WGXA 3OL3A 2E19A 3TP0A 1WH5A 3GZ5A 2DA5A 1BR4A 2WC2A 3K4CA 2OQRA 1IV8A 1T33A 2HZDA 4MFEA 1VQ7I 1W5TA 1FYLA 4HDVA 3GFIA 2HDWA 2KIFA 3WE2A 1IGNA 3GZNB 3QODA 1MBFA 1FLIA 1EKEA 2BXYA 3IWFA 1HC8A 2HTJA 2HQNA 4XRSA 4PJMA 1XMKA 2C6YA 3GTLJ 2G7UA 4LG0B 3H0GJ 2HYFA 2LVSA 1O7LA 3F8NA 1X2NA 2DYRH 1E2XA 1MNEA 2O8KA 2R4GA 4HNVA 4R8HA 3BJAA 1D0YA 1X3WB 2NAZA 1I1SA 2R7OA 3L2RA 4CCMA 3U9GA 1BIAA 1OISA 1T56A 1FEXA 3GTGJ 2FUG2 1XGOA 2G9WA 2WTEA 2P5KA 3CF2A 3HPHA 1R9TJ 1SFXA 2CUEA 5H6QA 4A3CJ 4IHXA 4A3BJ 2ZJRF 4FE4A 4BS9A 4IO9F 1Y1VJ 3IKVA 1MIJA 3VSLA 4M72A 5C4XJ 1V5GA 2EK5A 4YFXF 4KJZA 5LGNA 1CGPA 1D1BA 1EH6A 2LY1A 3HSEA 3GFMA 4HX7A 3CUQA 2HGCA 2NYXA 3V4GA 1R7JA 2DA2A 3HOWJ 1R1UA 2X6WA 2HQ5A 4RB1A 2PMZA 1PP7U 2R93J 3BT9A 1BI1A 2FQ3A 1XMAA 2D5VA 4ZTJA 3KCCA 3ZQQA 2IVMA 1OYIA 2EJRA 3BZCA 4RB0A 1AKHB 5B5EC 4C2TA 4N0BA 2MBFA 4M9ZA 2XHKA 3IWZA 4DZPA 5HODA 3JRGA 3ABTA 3CF5F 3LSTA 4U87A 3JW4A 1VQ9I 4UY8I 1YJNI 1BI2A 3FX3A 1YHQI 2MABA 5FLVA 4V2GA 5FJ8J 3DKYA 4MEXF 4CHUA 1X1PA 1OLTA 5F27A 1R5ID 2F6CA 3CD6I 3REOA 2H94A 1X3UA 3S14J 2XB5A 1DQUA 2TDXA 4XORA 3VOEA 1SVOA 1Y1WJ 3GXOA 3FHZA 4UVBA 4G7HF 1HQCA 1ZG5A 3OYDA 3S2WA 3GWZA 2E1OA 2OQGA 2FNAA 3DTKA 2OZUA 4MFDA 1W1WE 1MW7A 2CW0F 3T8TA 3M4OJ 4XNFA 5JVTA 3H0DA 1OR7C 5GADJ 2MD0A 2DQLA 2O3FA 3HTUA 2WADA 4ESBA 1AU7A 3UKGA 4BXUA 2A69F 2IA0A 4G8XA 5JR3A 3OYMA 4KIBA 5D8LB 1OKRA 2CGPA 4IHWA 2HU9A 2YX7A 5DDGA 3CMMA 5GPCA 1Z9CA 4I6ZA 1KU7A 1G6NA 1U9NA 4Y13A 1EV7A 4A3DJ 1ETVA 1IXSB 5IPAA 1ZHFA 1WJBA 1IW7F 1X4OA 2DMNA 2F5VA 3CZ6A 1U5TA 3M9AA 2ADUA 3QOEA 3KP2A 2M45A 2Y9ZA 3GW2A 2CQ7A 3I3LA 4XQFA 5F0FA 4D5CA 1ZG3A 4M9SA 1QZEA 3S16J 2CW7A 2X9DA 3ABKH 2HI3A 4Y17A 3V8KA 4Q5SF 3HIFA 4KITB 4L9NA 1WJEA 4WF2A 5AONA 3DBLB 2Q2EB 5LBQA 3K70C 3DKXA 2LK2A 3F8MA 1V54H 1F5TA 2R7ZJ 4QSHA 3FXOA 1TT0A 3FXJA 3GZ6A 2O61A 4LJZF 1POGA 1XD7A 1SAXA 3J7ZI 3AG1H 4NQWA 4PJJA 4J01A 2WB1A 4P55A 1QPMA 3CCMI 5F0HA 4LFUA 3MAJA 4Z2YA 3RYRA 3LQQA 3ASNH 2CQNA 2HTSA 5M5WJ 1K4TA 5E17F 1EF4A 3IH3A 5HVQC 3ZMUA 3VODA 1X1CA 1Z6TA 4KA4A 3ULQB 2VQGA 3QYFA 3F22A 2X6OA 3T1BA 2HKXA 1SMYF 2DMQA 1U78A 1VQ4I 3CC2I 1KYWA 1WVRA 1LKXA 3K69A 3ZQGA 4CZZA 1LVAA 4GCVA 1FPQA 3K2AA 1IC8A 3QAHA 1H9GA 3PJRA 3BPVA 1VZ0A 4I98B 2IS6A 2RGVA 1BA5A 2PX9A 4PFOA 1B72B 2K3PA 3HJEA 4PDKA 4Y3OA 1Z05A 5B1BH 2XAJA 2F5FA 3GTOJ 1TQPA 3NWTA 3Q0WA 1W0UA 3Q9VA 4F3QA 4C2UA 3EUAA 2M4KA 3KLNA 3H3VK 5IY5H 2ELKA 3K0LA 2P6TA 2JK3A 4EJVA 2F2EA 4U7BA 1FSHA 2V9KA 3CCJI 2UUZA 3SZTA 4E6KG 3HKZA 4QWQA 1R1VA 4L9JA 3A01B 5LRRA 4CDGA 2P7CB 3S32A 1XB4A 3EUHA 4IRHA 1FIAA 2P0WA 3OY9A 2VPRA 2RNJA 3HRUA 2CSOA 3H3UA 5LRSA 1OCPA 2P5LC 5FD6A 3GFLA 4U88A 5HS8A 2J5OA 2VL8A 4KN4X 3QWLA 3NEUA 4E7JA 3MZ8A 1MGTA 3CJRB 1GXQA 3LSMA 2F4MB 2L9NA 3I59B 1TNSA 3D5RC 3SJMA 2H1LA 2KRFA 2CU7A 1FOYA 4C3IJ 3SHFA 3AKZA 3LNQA 4A0YA 2IPQX 1STZA 3VWBA 1MMDA 2E1MB 3Q3SA 4CYDA 5DM7F 1JHFA 2O6GE 2YSRA 2VN2A 3E5XA 1T98A 1USTA 4MLOA 2NOGA 2KJCA 2ZKZA 4UUSA 2XKOA 4W97A 3KP3A 1XN7A 3BP8A 5HDGA 5ILSA 4MHGA 5GAEJ 2EZIA 2QUFA 4IRGA 5AIPA 4BQNA 1AOYA 1LEAA 5FRNA 1XG1A 3DCFA 2MA3A 3OIOA 3ZMZA 3E6DA 5DCMA 2DA4A 1SC7A 2HXOA 2P81A 3HOZJ 1YRNA 3WGHA 3RYPA 2UZKA 4A6EA 2OTJI 1IDYA 1WZ2A 4E7IA 3D5SC 3OYIA 4CICA 3FHNA 2PQ8A 1XTAA 4RLFA 5ICEA 4RB3C 1ZN2A 4JP0A 1TQMA 4AYBA 1J5YA 2DT5A 5HNFA 4PUSA 1RC9A 1X1BA 2VE8A 3MKLA 4DNCA 4ZYDA 2X1DA 1FP1D 4JX6A 1JTXA 2HYGD 2WAFA 2KP6A 2VT3A 3FF5A 4XICA 2A5WA 3GMEA 1TWHJ 4AVZA 2QZ8A 3W2VA 3TP3A 3I4MJ 2E1NA 2H1KA 4UHTA 4ESFA 2EQRA 3GTKJ 3DP7A 4GXOA 1ZG1A 3EYIA 1ODDA 3I56I 2FF4A 1FMWA 3HYIA 2ZSIB 4P1WA 3CCLI 4LB5A 4F93B 3IHUA 5TJJA 1R4MB 3I53A 1WI9A 4MQVA 5FLXK 2Y0SN 2PEXA 4UV8A 2UWMA 3G6EI 1I6HJ 1YE9A 1BJZA 2XB0X 1HOMA 4LLNA 1MZBA 2EH3A 3FK7A 4I2OA 2AXTC 3EETA 4G6TB 1RZ4A 4EJTA 2HVSA 3BDDA 1JXSA 2ACJA 5ILVA 2VQLA 3HHHA 3TDUC 2E5NA 4BQQA 2VJ4A 1YW8A 2VBYA 2COBA 2PLYA 1B8IA 2JTVA 1N25A 5CVJA 3HM5A 3OSGA 2AQFA 4BBRJ 5E3OA 1K83J 3HHGA 2EIMH 2XIGA 5EG0A 1VQ5I 5E8GA 1FBSA 2CQKA 1JHHA 3BROA 2M5WA 1BW5A 3FZVA 3C1DA 2BEOA 2P4WA 4RAFA 4HZFA 3FXMA 3PNVA 4D1QA 5JI6A 3L09A 1VTNC 1IG7A 2DDBA 1T2KA 1B9MA 2RDPA 4GO1A 3ZQ7A 4KUMA 3MEXA 5DV5A 4KN7X 4CYCB 3OYNA 1JKQC 5KCMA 2EZLA 3UNGC 2E36A 2E2JJ 2O0YA 1XGNA 1VNDA 2ZJ2A 2MGQA 3BTIA 2KZGA 5J4YA 2IRFG 3ZOBA 1WJFA 3SDBA 1HDDC 1BM9A 1KONA 4R79A 2WAEA 3LA2A 3OYLA 2ZFWA 4XRMA 4KMFA 2ZMEA 2NOJB 1FOWA 4M74A 3F72A 3PFIA 3DTIA 4M73A 4QIWN 1SEUA 3GO5A 2V1DA 2HOTA 1Q1HA 3OV8A 3BR6A 2X51A 5FKKA 5FO5A 1MKMA 4XOTA 2DN0A 2LG4A 3BZ6A 5DD8A 2H27A 1FY7A 3L2QA 2WAQA 3KP7A 4OMZA 3FMSA 3BWGA 4B1RA 4M6YA 2Y2ZA 4LG3A 1D0ZA 4EMSA 5LEKA 4B43A 1YTYA 4DIQA 1X1DA 4XLHA 2UXNA 3LSKA 2GXAA 1SANA 3HUGA 4GYGA 3V42A 1S3JA 1I39A 3O2PE 2MLGA 4BUPA 5K5QA 3HOTA 1YITI 2ZC2A 1H89C 2PG4A 3R0JA 2XGCA 1DU6A 4A69C 4FCYA 4LGWA 4CSWA 1Q1VA 4S04A 2PJPA 2F4OB 2PMHA 1EH8A 3DPLC 1NG6A 1Z7UA 1D1CA 3PSFA 1U5TB 3D0SA 4RGUA 3JSPA 3DLLF 4ETSA 4RM3A 1AA7A 3FM5A 1QHHD 3H9QA 3MVPA 4XN0A 1VQPI 2VBXA 1OQYA 5E8IA 1H9TA 1TWFJ 4D7NA 3PUFA 2DFEA 4RGRA 3QPLA 4XKWA 2YUSA 1W36D 3MFKA 1H0MA 4CCNA 4HLXA 1OR7A 3JSOA 1F36A 4QTRA 2JA5J 3E5UA 3KFWX 2NVQJ 2JN6A 1KA8A 1ON2A 2ISYA 3GCMA 3VFZA 1UJ8A 2DQRA 2L4MA 5F0CA 4F91B 1ZLKA 1U8RA 1IJWC 4XLPF 4BEHB 3A1YA 3OOUA 2DFFA 4RA2A 3FISA 4A0ZA 1KU9A 2FMYA 3DF8A 1JI8A 2VJIA 2CJJA 1I27A 4BY1J 1TNTA 1K78A 1ETXA 4KT6A 5B3SH 5CPRB 1Z67A 1NK2P 1MJ9A 1D0XA 3RTRA 3KYLA 1PUFA 3PO2J 1YG2A 1IN8A 3V7SA 1ZRFA 2DOEA 1SD6A 4HQMA 4RAGA 2RN7A 3GYHX 1SVMA 2DO7A 3TL4X 2XRNA 1OCOH 4L9TA 2G0EA 3H5AA 2MFZA 4A0XA 2LNBA 3TDZC 3F8FA 3B6AA 3DU5A 4WXHA 3FBIB 2N8GA 4Z6YA 4IRIA 2AO9A 2EIJH 2A07F 4ABZA 2OC6A 1ZR4A 4UVCA 5JVGF 4ASNA 4BYYA 3GBGA 2DODA 2ECBA 3SEQA 2FBIA 4FX4A 4IXAA 3MN2A 2BBYA 5F64A 4LITA 2CQXA 3EUKL 1IN4A 1HSTA 5J3LA 1IN7A 2R7SA 4PGHA 1HKQA 2KKOA 2FBHA 3F3XA 1SD4A 5GPAA 2KFDA 4C3JJ 1PVEA 3TKYA 2M87A 2XPVA 1RKTA 5JHUA 2FNPA 4M3GA 2R5ZB 2D1HA 5F04A 3LFKA 4LB6B 1A5JA 1MBKA 3IRRA 1XGMA 3H9JA 4UUTA 4IKFA 4CA0A 2OA4A 2W25A 5IOYA 2PI0A 2FBKA 2RREA 1ETOA 3AG2H 1O3QA 3R60A 4ZJZA 5F1RA 4DOZA 3IAS2 1ETWA 3KEOA 4EJOA 2PJRB 2DTZA 4KIGA 5CYVA 4XLCA 3M7GA 1ORKA 3DU6A 1J9IA 1MDMB 2KJBA 1LEBA 1IV6A 3IC7A 3JRFA 4DJAA 1MBHA 2RQQA 3G3ZA 1QO0D 1GDTA 3QP5A 1ITYA 2AHQA 4D9JA 4KYWA 2IBDA 1F1ZA 2UXXA 2F5CA 2A6HF 2NVXJ 1FC3A 3KZYA 1QQIA 1Z91A 3X2QH 3P9KA 1VQOI 2EV5A 3WGGA 2V79A 1EH7A 5DCFA 3FXRA 3K4LA 3OWTA 3JCUC 4ZH4F 2ZCWA 1YJ9I 3C7JA 4UUVA 1JKPC 2QLZA 5EZGA 3DPUA 4OWRB 5ICGA 3K4NA 2O9LA 4F55A 2YPRA 2OF7A 1K7AA 2EB7A 3AG3H 4UXNA 3V7CA 5H20A 3W6JB 1Z6RA 2K9MA 2ZXWH 3RPQA 5BPDA 5CQEA 1P4AA 1Z3XA 3H5NA 2CWEA 3U21A 3BG5A 4A3KJ 3RZDJ 1HW1A 2L7MP 2M4GA 2HOSA 3CCYA 4L0YB 1BI0A 1J2XA 3A02A 3HSFA 4DYCA 4E7KA 3MZHA 3HB9A 3SFZA 3VB2A 4G7ZF 2LBFA 3QU6A 3IKTA 1BL0A 3QU3A 4LK0F 3PQJA 3PIOF 2M2EA 1TW3A 2DA6A 5JHFA 4GYIA 3OYBA 1Y0UA 2KPMA 4DW6A 2K4JA 2M8EA 4ZYHA 1KGSA 1UHSA 2LY9A 1OPCA 3HPGA 2PMZN 5M3FJ 2LF8A 1R36A 1UG0A 3IL2A 1R4NB 3CLOA 5DUIA 3MKZA 4ZYAA 1J59A 2VJJA 3TO9A 5B66C 5HLIA 4G9YA 2XC7A 1RUOA 2VBZA 3IV5A 5GTHC 3RPUD 3N4MA 1XCBA 4XN3A 5CVRA 5HLHA 2XAFA 1S72I 2G7HA 4M6VA 3DFGA 3MZYA 1B8IB 2I8DA 2NVTJ 2DA7A 2D2WA 3OIPA 1LPQA 2P7VB 3SZGA 3HGGA 5BPIA 3HTSB 3M1CA 4O5VA 2VIXA 1XGSA 1JT6A 2JVGA 3RDIA 1P7IA 4XM3A 2B7EA 4EM0B 4GGGA 5C3EJ 3CCSI 2V6EA 1TC3C 5KAIC 1ACIA 4FT8A 2OU2A 2JT1A 3IH2A 2IS2A 4A3GJ 3FXQA 5LGUA 5DS9A 3RIRA 1T39A 3C3WA 2EFPA 2M9HA 2BY2A 5E1WA 1LE8A 1WJ5A 2FE3A 4NBQA 4BDYA 2A61A 3KP6A 4BQAA 2I10A 5JLXA 1VQNI 5J1RA 3WG9A 1UG2A 2ZMEB 3WG7H 4DYRA 1TWAJ 3ZPLA 2XAGA 1QVUA 1MMSA 5K7FA 5BQTA 4A3LJ 3O3KA 4NNJA 5HLTA 3HRSA 5DD4A 1PJRA 4PJ0C 1MJAA 3WE3A 4V19K 2OUMA 1S5LC 3E6BA 4N4OB 1EJ9A 2DA1A 4PGGA 4NB5A 3D1NI 4NHJA 3H3ZA 1P92A 2HR3A 1W5SA 4AUXA 5CVVA 2FOKA 4OMYA 3DEEA 5KAFC 1UHWA 2JUCA 2ESHA 3CLQA 1OCCH 4IZZA 1WKMA 3TEDA 3NWSA 2W00A 3BG9A 1ZGAA 4MTDA 3I58A 1XDSA 2LD5A 2KL4A 5FRMA 4BU2A 1S6LA 5K5OA 2KIUA 5EJCA 5KVRA 1J09A 3CC4I 2AS5F 4BY7J 1P6RA 2E5ZA 2WB1N 3KP5A 5KK1A 2VQHA 3VEPA 2GXGA 3OYHA 2QBYA 1SVLA 2VQCA 3RKQA 2W85A 1FMVA 2IA2A 3BCBA 5IYBJ 1F9NA 5IYDJ 2LF7A 1W4MA 3WTUC 1REPC 3ASOH 4I0BA 1ZAOA 2BY3A 2KQRA 2Z3YA 5EEHA 1MD0A 5E3NA 3ERED 3B02A 2BW3A 1ZH5A 3H1CA 2EPFA 1W0TA 4BKXA 3F6OA 4KDPA 5D4SA 2DMPA 2Q1ZB 5LEJA 4NUBA 4XLFA 1A31A 4OIQF 2FJ1A 4E7SA 2QQ8A 2IS1A 4W1UA 3HRMA 3CMYA 1FBQA 2R7VA 2XF7A 3H9GA 3ZQHA 1Y8RB 3BC8A 3I55I 2A5YB 2BVMA 3MQ0A 3BR5A 1XPXA 3ZMSA 3V8JA 1VI0A 2CYYA 1A04A 5CQGA 4BNCA 4RGSA 4ZDPA 2BHZA 5BNGA 2W1OA 3M8JA 1A6QA 4YELA 1YYVA 3HL2A 5K7HA 1V5EA 2OTLI 2YR2A 3WODF 1D5YA 5L3BA 2ELJA 3ZR8X 2CRGA 2GIVA 3TGNA 1G8XA 3CO7C 2ZNYA 3S2HJ 1YW7A 1XSDA 4OIPF 1N77A 2A6TA 1XSVA 3FMRA 2QM3A 1GXPA 5J6XA 4Y7NJ 1G3YA 1QGPA 3DBRB 1E17A 2IJLA 2K3FA 4EGZA 5L3EA 4M3FA 3HDDA 3ONQA 1K6YA 1HXDA 2ZXIA 3Q0UA 2HPIA 2W82A 5J40A 1ETQA 5D8KB 5L3FA 3QP6A 5D6FA 1ZR2A 2E1MC 1P9QC 1DP3A 1LFUP 2VKDA 5CJ9A 3FDYA 4N9HA 3GTPJ 1FYMA 5LHIA 2E2HJ 3RPUA 3Q0VA 1PYVA 2JZYA 2OCEA 5IT9Z 2K5CA 2VJ5A 2QGUA 4HX8A 2GM4A 4WXCA 5M5XJ 1M1EB 4G12A 1L3LA 5LLQA 1F43A 3S1RJ 1IUYA 4GDFA 5KNLA 2IGOA 5HS7A 3CO6C 4RDUA 4ZTFA 2ZNZA 3PFYA 3H36A 1V3FA 2DPUA 1GUUA 1R23A 4ZC3A 4HNTA 1BN5A 4U0YA 2AXLA 1SD7A 1KU3A 1BW6A 3CP2A 3IP4B 4I02A 5ERIA 2JSPA 3OSFA 4ZZDA 4UB8C 4A3FJ 4A3MJ 1RNLA 4AIJA 2ETHA 1OJLA 5E1ZB 4YG2F 3HRTA 1HSJA 1BBYA 2IA1A 3SFIA 1T8IA 1GLNA 3OYGA 2CV1A 5IP7J 4F7ZA 3WHCA 1U3EM 1QZYA 3M3YJ 5EGOA 3D5LA 1NH3A 2K27A 3WU1B 2F4IA 2R5YB 5E18F 3WU0A 5E1XA 2FEZA 4AYBN 3F6VA 2BOLA 5IP6A 2KISA 1G59A 4I99C 5J8CA 1IO2A 4HW0A 1YX3A 1UZCA 2LC2A 3FM3A 3T8RA 3IRQA 1CF7B 1SD5A 3S17J 2ZXJA 2QCOA 2JVHA 4PSXA 4IHVA 5J1UA 2BGCA 2BV6A 3HOSA 4MNUA 4E7LA 2RC4A 4EM1A 1GV2A 1LFBA 3LSJA 4PZJA 1B4AA 2XF6A 1SFOJ 3P7NA 3K70D 4C3HJ 2BE5F 2LDUA 2VC1A 3W6VA 2MD5A 3CUOA 2JA7J 2WA0A 1YS7A 1SFEA 4LMYA 5M3MJ 4CXFA 2MH9A 3DEWA 3E7LA 4DBQA 3IH4A 2WBMA 1IN6A 3M8FA 5FFXA 2KIMA 1BJAA 2L5QA 5D5WB 4RAYA 4OIOF 2ELHA 3S15J 2V9VA 2MG4A 4LG0A 4A93J 1A36A 2V4JC 1T6SA 4G7OF 2WY8Q 4IVNA 3F21A 3QQAA 4F52A 2EILH 1HA8A 3HGYA 2Z1DA 2W57A 5FGMA 4HNUA 3GTJJ 2QVOA 3C2BA 2QSGX 3NRVA 1Z21A 2DW4A 1FT9A 1I6XA 1D3YA 4HX4A 3J81K 4HSTA 2K85A 1TZLA 3ABUA 5EEGA 3SZPA 2CFOA 4ITVA 3CUQB 5FKLA 3BQYA 4IQ4A 4Q4ZF 2K02A 2V1UA 3KP4A 2ME0A 3B6CA 2L4AA 5FB2A 3S1MJ 2B9SA 1G3SA 5DYMA 4HA8A 5K5RA 3VDXA 1LDKB 4FETA 3W6KB 4P5OA 4B44A 2XSDC 3LMMA 3H92A 1ZRDA 2HS5A 3KYCB 2OCCH 4OIRF 4IQJA 3FXKA 3I5UA 2ZJPF 5J1YA 3CTAA 1K79A 3GLLA 3BTCA 3S3NA 4HG2A 2R7TA 1S7OA 2DCEA 2E1CA 1IAWA 4I76A 1TQIA 3P9CA 2KRHA 4JK1X 1ZELA 3M07A 6PAXA 3BTLA 4G6QA 4OINF 3PIPF 4ENJA 2KDZA 1PUEE 1JKRC 2L9SA 2KRCA 2WAQN 1Z0XA 3OYAA 2L02A 2NVUB 3GUDA 4EM2A 5CVIA 1ZREA 2HVQA 4IOAF 3I4PA 3I71A 3KPHA 3FXUA 2WV0A 3ML6A 5D4RA 4ENNA 2M34A 4EEFG 5EDNA 1GHCA 3G1OA 2H8RA 3FWEA 4DZJA 3WTXC 4IOCF 3L2UA 1U5TC 2P8TA 2OV7A 4M71A 3G1LA 4HOBA 2V9PA 4I09A 3PUBA 4XKCA 2WY7Q 3MCZA 2L2OA 2O7OA 3CESA 3LOCA 2L0KA 3GFJA 1WFXA 1FZPB 3A4CA 4QPQA 3TO7A 2KLOA 4MO7A 5ICCA 3LSGA 3F8CA 1K61A 3BQZA 5HLGA 1L0OC 1S7EA 2IS4A 3L2VA 1ON1A 5D5UB 2PMUA 1HW5A 2DYSH 5EEAA 4Q48A 1VQ8I 3E3VA 2XF5A 5C4JJ 3G1MA 5DUKA 4XLAA 1OFCX 3ZXSA 5DEQA 2IEKA 3LAPA 4TV7A 3DBHB 1MNDA 4UB6C 2HQRA 3CP8A 3U2RA 2R7QA 1S9HA 1I50J 5FD5A 2XGEA 2VE9A 2GOXB 2QBYB 4AIHA 2Y75A 2OJED 2L9RA 1R71A 5E3MA 3DXJF 1NG7A 3I54A 3PL8A 2R3SA 3ZCOA 4J19A 4PCQA 3EQLF 4EATA 1MBEA 4NQWB 3WTTC 3H5RA 1R22A 2LREA 2Q2EA 2JSCA 2LFBA 3K4KA 3R61A 3TO6A 3BOQA 2O8XA 2STWA 4WX9A 2X0LA 5ED4A 1O57A 4FHTA 4R1HA 1DGWY 2V1NA 3FMQA 3ZRGA 1T0FC 2CS3A 1ZGWA 2JPCA 4WCGA 5LFAA 5E79C 4XKVA 2XROA 4A5MA 2RKHA 1B6AA 1ZRCA 3CJQB 1QVTA 1WJAA 2NVYJ 2M0MA 3QOPA 4BL0B 1JJ6C 2JA6J 4E7HA 3CQZJ 3WU2C 1R6RA 3CDLA 3K4BA 3BLYA 2YX4A 2K40A 5FLMJ 3OYFA 1QRYA 5F6FA 3QRFF 3GTMJ 2Q0OA 4MTEA 1TL8A 3PNTA 3BG7A 2LMDA 2LTPA 5KHDA 1BOAA 1WWXA 4B4CA 4XRSG 1J0RA 2GA1A 2DAOA 4Y33A 3HG9A 3EUHC 4A6DA 2PBIA 2E71A 2RVCA 3DPTA 3HC7A 3KZIC 1A6IA 4L5IA 4AD9A 1TWCJ 3AG4H 3ZQIA 4QLCU 1C0WA 4KMUX 1LB2A 2DJIA 2IW5A 3JRBA 1B72A 2DPDA 2FX0A 3ROUA 2HWVA 2MLKA 3OL4A 3TQNA 2KMUA 3J7AO 2GAUA 1SMTA 2VC0A 1TTYA 2V6CA 2QEXI 1B9NA 3RI4A 3F23A 2HYJA 2BVLA 4IX7A 2E7WA 2IGKA 3KZZA 2K9SA 3C2HA 5D5XB 1WPKA 2HXIA 1B59A 1KU2A 4EQQA 2F5DA 3OR1C 4P96A 2X1CA 2R7XA 5HDKA 3A01A 2D1VA 4H4KC 3GTQJ 1WHUA 4XLEA 4RM2A 1HLVA 2VXDA 2B0LA 2QWWA 3QYEA 1JJ8C 4BDZA 3E6CC 2Y9YA 1QU3A 4XLNF 1VQKI 1E0EA 1VQLI 1ZARA 2Z16A 2EFWA 1VF9A 2XSJC 1RUNA 1QHGA 4G6DA 1TLHB 1IF1A 2MH2A 1XX5A 1FX7A 4ZDOA 2PFBA 3M8EA 4M3EA 4DYQA 2Y30A 4L5EA 3CDHA 1TT5B 4XOPA 4UUSB 3ZMTA 3TW7A 4I7HA 3GEZA 1H88C 3BJ6A 5GAGJ 3BR0A 2R7UA 4CO8A 3FIWA 3JAMK 1I3QJ 2YS9A 3VPRA 4JQFA 2A3SA 5DCMB 1YS6A 1YRNB 2W7NA 3K2ZA 2ZBKA 3K4JA 1PP8F 2DOFA 2EV6A 4N4NB 4IJAA 4PFPA 1TW2A 2FA5A 4A3IJ 1BOBA 1YI2I 4LIVA 1IRGA 2QQAA 4LK1F 1HKSA 3LA3A 1MMAA 4YEJA 1MMNA 3JTHA 4BHCA 2CV2A 3ERMA 4XIDA 2QKLB 3ISPA 2DFIA 5F08A 1FNNA 3TMOA 3KX2A 1SFUA 3BG3A 4RGXA 1P2FA 3L2WA 3I64A 2CUJA 3HOUJ 2NRAC 2Z9OA 1DPRA 2VKHA 1USSA 3SEZA 2DBBA 2JRMA 3BJOA 3A2KA 4F92B 2QKMB 1OYWA 4L5JA 3OYCA 1U6GA 2XGDA 1T08B 4HPQA 2M30A 2DTRA 2M1BA 1FOKA 4XBFA 4BHPA 2L9VA 3LSHA 3E0JB 4B48A 4KICA 1P7JA 1LFPA 4XMYA 1DPUA 4OAYA 5FLXZ 1R49A 2XPWA 1YFHA 3HOYJ 1MSFC 2CFXA 2Z2SB 1S7AA 3DWLE 3AL0B 2GXBA 4FE7A 4HYEA 3ABMH 1Z1DA 3WTVC 2M7AA 4CCLA 5JLWA 4KT5C 4JX4A 2P5VA 1O7FA 2M7BA 2KHMA 3V8LA 5D5VB 3GX4X 2KZVA 1FSEA 3B73A 5EG0B 2ZMEC 3J81Z 1MMGA 1UB9A 1B1BA 4YFNF 2ZFUA 3CMEI 2Z99A 4IHYA 4U7DA 3ZN0A 2DI3A 2RNGA 4ESJA 2ZO4A 1VQMI 3R6SA 3MKWB 4NDLA 1ENHA 1O4XA 4P9UA 3E5QA 5EYRA 4BAYA 2HPMA 5J4VA 4RBOA 5HS9A 2E2IJ 5CLSA 3RQIA 4IHTA 1XCVA 1GVDA 3HXLA 3OS1A 5GP9A 2BXZA 2EV0A 1RR8C 2JJ7A 2K86A 1AWCA 2OPTA 2PN6A 1SFKA 1YO5C 1ETKA 4C30A 2JQ7A 4CUGA 1RRJA 3SYTA 1UHMA 3LAJA 3CDIA 3RJPA 1WRJA 2MC4A 2W48A 1A35A 4CYCA 3QPSA 3VYSB 4J00A 3K1MA 4D0PA 4XSZF 2LKSA 2TCTA 1N78A 1ETYA 2EFNA 2DK5A 1Z77A 1YX5A 1QA6A 5A2QK 2V7FA 1X1AA 2GZWA 1W7PD 1YIOA 2LRDA 1CQTA 1PDNC 2VKEA 4UV9A 4BBSJ 3I9V2 3DLAA 1X4PA 4II3A 1O3RA 1IN5A 1OCTC 2DLLA 2HQAA 4S05A 3OYEA 2FD5A 3WTSC 3HBLA 3I0TA 5D6EA 3S3MA 3BZKA 3K9TA 1GV5A 5ICFA 1K6OA 3EYYA 2GIZA 3SDGA 2OD5A 1WH7A 2P6SA 2L7KA 3JTGA 1MBGA 1R5HA 3HUGB 4GRIA 3JRIA 2FSWA 4MQ9F 2ZSHB 3RCOA 4II2A 4MGRA 3MMYB 4HF0A 2LKPA 9ANTA 4AM3A 3KYDB 4PJNA 2VBWA 2M8GX 4DBRA 3HSRA 3TW6A 4A5NA 4L18B 1FP2A 4A2UA 1UELB 3FKJA 5ILUA 1WQ2A 5IOZA 2JUGA 2BZTA 3LSIA 4CH7A 1ZGJA 4B47A 3BCAA 5DTDA 1Y8QB 4YFKF 3TOAA 1Y39A 1TP4A 4EGYA 5BMZA 3O8HA 1MH3A 4EJWA 3HZJA 4NC8A 1F4KA 4I01A 4U0WA 2A68F 3ZQCA 3BR2A 3WTWC 1DUXC 2YU3A 4KFCA 3UR3C 4GFBA 3RKYA 1Y6IA 2EWNA 3M1EA 1E3HA 5LHGA 2XPUA 3S2DJ 5CVUA 3ELKA 4HAMA 4X1EA 3S3OA 2CG4A 5BOXA 2LOOA 1H8AC 1U0JA 3OIQA 1W5CC 2L54A 5E3LA 1S8NA 2DJNA 3LSPA 1K78B 2GOMA 4KNYA 1FTTA 4P9FA 4CCOA 2DT7B 4HLYA 1PUFB 1Y0NA 2E34A 4BEHA 4HBLA 4D5FA 1R1TA 3OS0A 2E60A 2XAUA 4RLQA 3S93A 2LKXA 2M0CA 4JYKA 2W84A 2XDVA 1OYYA 4IF4A 1NHAA 3ZN1A 2FMLA 2GWRA 1UAAA 3E6MA 1Z7LA 1FBUA 2QA4I 3C2GA 3RSNA 1IXRC 1RR7A 3HKZN 3JRDA 1J7KA 2QQBA 3T5XA 4XL9A 2LYCA 2H8WA 4RS8A 2XVCA 3PSIA 3KE2A 5EZHA 2NS0A 4AIDA 4C2MJ 4WWCA 5TRDA 2JRTA 4YRVA 4YIIA 3FKIJ 1T38A 2ZB9A 1O3SA 1T0FA 1X58A 2Z33A 3CCUI 2R7WA 2R7RA 2VPLA 3J80K 3QPHA 2NS7A 1JUSA 3ZQFA 3L2CA 1DGRM 2ICWG 2ISZA 2O5RA 2LH9A 2VLAA 2JMWA 4LLGF 4RB2C 4XKBA 4MIMA 5FFZA 2R5ZA 5L3CA 4A12A 1GT0C 1FYKA 3PO3J 4WXDA 1T95A 1E3PA 2ID3A 2LY2A 1YQAA 2B63J 2FQ4A 5LHHA 3DKWA 1D1AA 5BS6A 3LWFA 4LLLA 2R7DA 3DQVC 3OR2C 3JRCA 4IHSA 4BACA 1RESA 4JX5A 1R5GA 3TBIA 3SXYA 1BR1A 3COAC 1R00A 1V55H 3Q5FA 3DV8A 1JT0A 2K9LA 1G4DA 4HDUA 1I1GA 5L3DA 2H6BA 1O3TA 5C44J 2K9QA 3OMYA 1FWZA 2CUZA 1WJDA 2DU9A 3J7YJ 3CMAI 4BJ6C 2PJRA 2H6CA 4FQGA 3VSKA 2ESNA 3IAM2 2A6EF 2MSYA 3SQNA 1MDMA 4AC0A 3ABLH 3ZMDA 2QF7A 3K1PA 3LA7A 3G2BA 3LQRA 3FXLA 4IL6C 3VYTB 1XMXA 1LQ1A 1LDJA 3RZOJ 2HOEA 3N97A 3G4SI 2VASA 3W3CA 2K9NA 1XS9A 2CMPA 1AHDP 1W7PA 1KQ8A 4BH9A 2XV4S 3OYJA 4EV0A 1HCRA 3S1NJ 1GVJA 4O3MA 2D45A 3JAMZ 2HKOA 2M3AA 4E7ZA 1RIOH 4KISA 1YJWI 2WWYA 4G94A 2EBIA 1VFCA 1P4XA 2AQEA 3BPXA 4N9IA 2X48A 4H0EA 4Y4RA 1UFMA 2GBYA 5HNHA 2V26A 1ZLJA 3BR1A 2Z5UA 2ME6A 1MBJA 3BTJA 1OCRH 5FKMA 4BXFA 1JTYA 1WI3A 1Y56A 3MWMA 1W36C 2L7ZA 2DOAA 3CJTB 1BIBA 1I3AA 3F9KA 3KETA 1LNWA 5L3GA 1DP7P 2LR8A 2EFOA 3ZMVA 2E35A 4IPAA 1D5VA 2XAQA 3CUQC 3AAFA 2LBFB 1KYZA 1LDDA 5HDNA 2CV0A 1D8KA 4E70A 3L9FA 5B1AH 1LVKA 3CC7I 3H35A 2QENA 5FKOA 4RMNA 4HF2A 1E3OC 5H6RA 1BC7C 2IAIA 3GF2A 2OBPA 2KIQA 3JR9A 2HEOA 4AVPA 1MH4A 1QZZA 3JRHA 2HDDA 1Z3YA 2FXAA 2NNYA 2GQQA 4XONA 3VYUB 2Y48A 3WTYC 4FTHA 1IRZA 2EZKA 2XGXA 3RKXA 2JA8J 2QSHX 4S0HB 3BR3A 4XSXF 2VODA 5LD2C 4AWXB 2BHYA 4V2FA 2VKVA 2ECCA 1FIPA 3OS2A 2Y69H 2Y0SA 5E20A 3W2AA 5FKNA 4E4HA 5J47A 2FRHA 1HKTA 2MC3A 4LOCA 2EA4A 5TISC 3P9IA 5HOOA 3J7AY 4LIUA 2XRLA 1RPWA 3RKWA 1SAUA 1TBXA 1AKHA 4CCJA 4BJTA 3L00A 1S29A 3F8BA 2ZJQF 2X1EA 2STTA 1LE8B 2R0QC 4NC6A 3TOBA 2NNNA 4HQEA 1R58A 4FISA 1G2HA
chains in the Genus database with same CATH topology
2X1CA 2R7XA 4CZCA 1WJ5A 3S32A 4BDYA 3EPZA 4H4KC 3LFUA 4XLEA 4RM2A 4C9YA 2P0WA 2VXDA 3OY9A 3QYEA 4BDZA 3K6GA 1QU3A 2X6YA 2VL8A 1E0EA 1V5FA 4E7JA 2Z16A 3CJRB 3LSMA 2L9NA 2XSJC 3D5RC 1QHGA 2ZXHA 4NNJA 5HLTA 2CH0A 1PJRA 3AKZA 4ZDOA 4BE2A 2OUMA 3VWBA 1MMDA 2E1MB 4N4OB 4ZDLA 2IGMA 2KDOA 4XOPA 4MLOA 2DT6A 2R7UA 3DEEA 4IZZA 3NWSA 4PSWA 2W00A 4JQFA 4BQNA 2CW8A 3MD2A 3FBNB 5FRNA 2W7NA 3K4JA 2KL4A 5FRMA 4BU2A 4N4NB 4PFPA 4ANJA 1J09A 2IGNA 2E5ZA 4AU7A 2VQHA 3OYKA 1BOBA 3D5SC 3OYHA 4LIVA 3FHNA 3KEYA 4PK4A 3OYIA 4E7IA 2VQCA 4BJ5C 1MMAA 4RLFA 4YEJA 1FMVA 1MMNA 2CV2A 3BCBA 2BW3B 4AYBA 5HNFA 4PUSA 1X1BA 4QPOA 2QKLB 2KQRA 3TMOA 3KX2A 2BW3A 2X1DA 2WAFA 2KP6A 4OAZA 3L2WA 2CUJA 2A5WA 4JOMA 2VKHA 4AVZA 1BR2A 2IXSA 3SEZA 3A2KA 4F92B 2Q1ZB 3W2VA 3ZGKA 2QKMB 3OYCA 4NUBA 4XLFA 4HPQA 4E7SA 2IS1A 2HVRA 2R7VA 2VXZA 1FMWA 2ZSIB 2XF7A 4P1WA 3K10A 3H9GA 4F93B 3LSHA 3E0JB 4B48A 3BC8A 1LFPA 4XMYA 1EA3A 4OAYA 2BVMA 2UWMA 1YE9A 3BG6A 1N75A 2Z2SB 5CQGA 3DWLE 3AL0B 4PJLA 4ZDPA 4G6TB 2X85A 3DTEA 2W1OA 2HVSA 3M8JA 3E1SA 4YELA 2M7AA 2VQLA 3HL2A 4CCLA 1V5EA 2E5NA 5FROA 4BQQA 2VJ4A 2M7BA 2ELJA 3ZR8X 2KHMA 2KZVA 1G8XA 1MMGA 2ZFUA 2AQFA 2UV1A 2A6TA 1N77A 2RNGA 2VB6A 2W4SA 3MKWB 3PNYA 3K4MA 2HPMA 4B3XA 3ONQA 1K6YA 2ZXIA 3HXLA 2HPIA 2W82A 3PNVA 3OS1A 4D1QA 2E1MC 1P9QC 1DP3A 4HRIA 2VKDA 1SFKA 4BE0A 3FDYA 4C30A 4CUGA 3OYNA 5KCMA 3SYTA 1PYVA 3UNGC 1WJCA 2MC4A 2K5CA 2VJ5A 4XR6A 4FASD 2MYSA 4CCKA 1WJFA 3SDBA 3VYSB 4J00A 1KONA 4R79A 2WAEA 3OYLA 1N78A 2NOJB 5TGTA 5KNLA 4X0GA 1YX5A 2HNHA 2IGOA 2V7FA 1X1AA 2LRDA 3DTIA 4ZTFA 3PFYA 4ZC3A 3AFHA 4HNTA 2DXIA 4BE1A 3I9V2 3DLAA 1X4PA 3CP2A 4II3A 3IP4B 5CKTA 1X19A 2JSPA 2HQAA 3OYEA 2X51A 4XOTA 2LG4A 4DGWB 3S3MA 3L2QA 2WAQA 3IUOA 1GLNA 3OYGA 2JA2A 2CV1A 1IRXA 2L7KA 4NC7A 4LG3A 1D0ZA 3HUGB 3D5LA 4GRIA 4B43A 4DIQA 1X1DA 2F4IA 2ZSHB 4XLHA 4II2A 3RCOA 3LSKA 3LL7A 1ERDA 3MMYB 3V42A 2BOLA 4BUPA 1G59A 3HOTA 3QYBA 4HEA2 1YX3A 4PJNA 3S8PA 2LC2A 4BQOA 4CSWA 4BGDA 4DBRA 3W2WA 3DPLC 1NG6A 1D1CA 3PSFA 4PSXA 2JVHA 1UELB 2X6XA 3FKJA 3HOSA 4RM3A 2JUGA 4CH7A 3LSIA 3MKYB 4B47A 1AA7A 3BCAA 1QHHD 3H9QA 4XN0A 3VYRB 4E7LA 3AL0C 3N05A 4HSRA 4NC8A 2XF6A 3RQ4A 3K70D 3OL3A 1W36D 4XKWA 3UR3C 4CCNA 1BR4A 3K4CA 2WA0A 1Y6IA 2HZDA 3S3OA 2HDWA 2LOOA 4DBQA 4F91B 3QODA 1U0JA 3OIQA 4BEHB 2WBMA 3A1YA 2GOMA 3OOUA 4CCOA 2DT7B 4PJMA 1JI8A 2VJIA 2L5QA 4BEHA 4KT6A 3OS0A 5CPRB 2E60A 1MNEA 2XAUA 4RLQA 1D0XA 2R4GA 3RTRA 3S93A 3KYLA 2V4JC 1D0YA 2R7OA 2XDVA 3L2RA 4CCMA 2WY8Q 1UAAA 1HA8A 1Z7LA 4F52A 2FUG2 3TL4X 3CF2A 2Z1DA 3HPHA 3H5AA 3C2GA 2MFZA 3RSNA 4HNUA 4XL9A 3DU5A 1Z21A 2LYCA 3FBIB 4HSTA 4BS9A 1TZLA 3VSLA 1V5GA 2CFOA 4ITVA 2OC6A 4IQ4A 3PSIA 4KJZA 3GBGA 1D1BA 2LY1A 3SEQA 4YRVA 3VDXA 1LDKB 4FETA 4P5OA 4B44A 2X6WA 3LMMA 4LITA 2PMZA 3EUKL 2R7WA 2R7SA 2R7RA 2VPLA 4IQJA 4ZTJA 1DGRM 3ZQQA 3S3NA 4HG2A 2R7TA 2DCEA 2O5RA 4C2TA 2LH9A 2KRHA 2VLAA 1ZELA 3H9JA 4XKBA 4IKFA 4U87A 4CA0A 2L9SA 2KRCA 1T95A 3OYAA 2LY2A 2MABA 1D1AA 2HVQA 3DKYA 3DQVC 2RREA 1OLTA 3OR2C 2F6CA 4BACA 4ZJZA 3TBIA 1DQUA 4XORA 1BR1A 4DOZA 3IAS2 2K9LA 2PJRB 3L2UA 3OMYA 2CUZA 2OV7A 4XLCA 1WJDA 3DU6A 3OYDA 3DTKA 3PUBA 4XKCA 4BJ6C 2PJRA 2WY7Q 2L2OA 1MW7A 3VSKA 3CESA 3IAM2 4DJAA 4XNFA 3H0DA 1OR7C 2RQQA 2MD0A 1WFXA 3G2BA 3A4CA 4QPQA 2WADA 2KLOA 4D9JA 3LSGA 3VYTB 2IS4A 3OYMA 3L2VA 2VASA 3W3CA 2HU9A 3K4LA 3CMMA 2XF5A 2CMPA 3OWTA 3OYJA 4XLAA 3ZXSA 2M3AA 1MNDA 3DPUA 4E7ZA 4KISA 4OWRB 3CP8A 1WJBA 1X4OA 2F5VA 2R7QA 3CZ6A 1S9HA 3QOEA 3K4NA 2AQEA 4F55A 3I3LA 2GOXB 4XQFA 4Y4RA 5HNHA 2V26A 2K9MA 2CW7A 5CQEA 1Z3XA 1NG7A 4BXFA 4KITB 3PL8A 1WJEA 1Y56A 3H5NA 3K70C 2Q2EB 3ZCOA 3U21A 3DKXA 1W36C 2DOAA 4EATA 3F9KA 4NQWB 2M4GA 3H5RA 1TT0A 2LREA 3K4KA 4PJJA 4J01A 4E7KA 2LBFB 1DGWY 2V1NA 2WB1A 3ZRGA 1T0FC 2CS3A 2CV0A 5LFAA 4XKVA 2LBFA 1LVKA 3H35A 4RMNA 3CJQB 5JHFA 5HVQC 1WJAA 3OYBA 2KPMA 2M0MA 4BL0B 4E7HA 1X1CA 1R6RA 2VQGA 3K4BA 3BLYA 3QYFA 3OYFA 3HPGA 1Z3YA 4XONA 3VYUB 1UG0A 3PNTA 3BG7A 1LKXA 5KHDA 3MKZA 4ZYAA 2VJJA 2XC7A 4Y33A 3RPUD 3PJRA 4XN3A 3HG9A 3EUHC 5LD2C 1VZ0A 3HC7A 2IS6A 3DPTA 4PFOA 2K3PA 4Y3OA 3OS2A 2I8DA 2Y0SA 3W2AA 4E4HA 3NWTA 3OIPA 2DJIA 3SZGA 4F3QA 4C2UA 3OL4A 2KMUA 3EUAA 3M1CA 2M4KA 2VIXA 5HOOA 3J7AY 2JVGA 4LIUA 4IX7A 2BVLA 4U7BA 2IGKA 4XM3A 3C2HA 1SAUA 2V6EA 4CCJA 4BJTA 2V9KA 2UUZA 4E6KG 3HKZA 2X1EA 2IS2A 3OR1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2CUJ A;  2DCE A;  2ELJ A;  2AQF A; 
#chains in the Genus database with same CATH topology
 1QNT A;  3O6B B;  3G71 I;  3OOP A;  4CZC A;  1JUM A;  4CGZ A;  3EPZ A;  4XRF A;  1IRF A;  1P4W A;  2EIK H;  1JGG A;  3LFU A;  4C9Y A;  4B8X A;  4WK8 F;  3L1P A;  3K6G A;  1YOV B;  4AIK A;  2X6Y A;  2K4B A;  1QBJ A;  4MEY F;  5J8F A;  1V5F A;  4M3D A;  2OZ6 A;  4EJU A;  2EFQ A;  1YIJ I;  3L7W A;  3JRA A;  1HBX G;  3FK6 A;  4JBA A;  3CJN A;  2ZXH A;  3K1N A;  4BHB A;  5A2Q Z;  2CH0 A;  1LJ9 A;  2DMU A;  1VQ6 I;  3A0H C;  1UCR A;  2A05 A;  1BI3 A;  1ZKG A;  3EDP A;  4BE2 A;  5IP9 J;  4ZDL A;  2IGM A;  2KDO A;  2LP0 A;  1RI7 A;  2L3D A;  3R0A A;  2X4H A;  5IYC J;  2F5E A;  3K7A J;  2DT6 A;  2FOW A;  2VT2 A;  2K7L A;  1I5Z A;  4YIR X;  3ECH A;  5JFR A;  4PSW A;  4DQ2 A;  3ZP5 A;  3QPT A;  2CW8 A;  2GLO A;  3MD2 A;  3WTZ A;  3FBN B;  2NXN B;  2QQ9 A;  2BYV E;  1JKO C;  4YIF A;  3HOX J;  4ZYG A;  4ENK A;  3U1K A;  1FJL A;  3CCQ I;  2Y31 A;  2IP2 A;  4Q47 A;  2EIN H;  1HDP A;  2IGN A;  4ANJ A;  4IEJ A;  1OMI A;  1XC5 A;  2HZT A;  4K2E A;  4AU7 A;  3OYK A;  4HF1 A;  3C18 A;  3KEY A;  1X3Z B;  4PK4 A;  4BJ5 C;  2IT0 A;  4HV6 A;  2XAH A;  1RET A;  3KIO A;  5M5Y J;  5AIQ A;  2XKP A;  1HW2 A;  1QPI A;  1U8B A;  2R7F A;  2BW3 B;  1G3W A;  4HV5 A;  4QPO A;  1IUF A;  2E7X A;  2DDA A;  1UMQ A;  2LSO A;  4EVI A;  2BY1 A;  4XK4 A;  4RAZ A;  2EZH A;  2HOA A;  4OAZ A;  4D7M A;  3S1Q J;  5F1J A;  4OU0 A;  2I5U A;  4JOM A;  3ECO A;  4A3E J;  5K7Z A;  4L0Z B;  2COM A;  2DA3 A;  1BR2 A;  2IXS A;  2LLK A;  1WSU A;  3HOV J;  5LGT A;  4L9V A;  3ZGK A;  3GVA A;  4ENM A;  1YW9 A;  3NQO A;  4UVA A;  1HF0 A;  2DMT A;  2HVR A;  2QSF X;  4M3B A;  2VXZ A;  3R4K A;  3ZQL A;  3K10 A;  3E97 A;  2WV1 A;  1EA3 A;  2VOP A;  2FU4 A;  1ONV A;  2OAZ A;  2VON A;  3BG6 A;  1N75 A;  3O8G A;  2HDC A;  4X6A J;  2RV8 A;  4PJL A;  3WHB A;  2EA2 A;  2X85 A;  1X2M A;  3DTE A;  1JE8 A;  4Y15 A;  2HFH A;  3E1S A;  2L7F P;  4LD5 A;  1MNM C;  5FRO A;  1TWG J;  4BXX J;  1XDU A;  1ZK8 A;  1ULY A;  2GA2 A;  1U2W A;  4OOI A;  4ZYE A;  3HEF A;  5GAH J;  2QYO A;  3GLX A;  4B3A A;  4UNO A;  3LSR A;  3CCR I;  2UV1 A;  1JGS A;  1ZTR A;  5H2F C;  3JRE A;  2VB6 A;  2W4S A;  2VUM J;  3F0C A;  2YU9 J;  3PNY A;  1ZQ3 P;  2CQQ A;  3K4M A;  1DU0 A;  3KEQ A;  4B3X A;  5GTI C;  5EF6 A;  2R92 J;  3ESW B;  1KQ0 A;  5IT3 A;  3Q9S A;  4O6J A;  1KQ9 A;  2ID6 A;  1G3T A;  1ZYR F;  2TRT A;  2W24 A;  1MJB A;  2NS8 A;  3U1D A;  4HRI A;  3J80 Z;  2J5P A;  4BE0 A;  1IXC A;  2CO5 A;  2Q8K A;  3CCV I;  1NK3 P;  3NAU A;  5IT9 K;  1WJC A;  4FAS D;  4XR6 A;  2O03 A;  1D8J A;  2MYS A;  4Y52 J;  4CCK A;  1KZH A;  2L01 A;  5DM6 F;  1MSE C;  5TGT A;  4X0G A;  1IDZ A;  2HNH A;  1NTC A;  5K1Y A;  1WCM J;  2KT0 A;  2V1X A;  3PQK A;  2Y0M A;  2F48 A;  3AFH A;  1XSX A;  3V7R A;  2BY0 A;  4BE1 A;  3I59 A;  2DXI A;  2H09 A;  5CKT A;  1X19 A;  1DDN A;  4I0A A;  3PM1 A;  4DGW B;  3CCE I;  3WGI A;  3IUO A;  5EGO B;  1JUP A;  2JA2 A;  1IRX A;  4M6X A;  3T0Y A;  4NC7 A;  2RAE A;  1YLF A;  2XAS A;  2XUB A;  4U0V A;  3KLO A;  3BY6 A;  3NAR A;  1FOX A;  3I4N J;  2JWT A;  1RKW A;  3LL7 A;  4A3J J;  1ERD A;  2MW8 A;  2R5Y A;  1K4S A;  1APL C;  3P5J A;  2VOO A;  3QYB A;  2CUF A;  1W7P B;  2RQP A;  3A0B C;  4HEA 2;  1U9O A;  3S8P A;  4BQO A;  1BC8 C;  2DK8 A;  4BGD A;  1V4R A;  3W2W A;  1OCZ H;  4ZZL A;  4ON0 A;  3A03 A;  3G73 A;  4B09 A;  4FX0 A;  2X6X A;  1CF7 A;  1FTZ A;  3MKY B;  3VYR B;  2VI6 A;  2JPB A;  3AL0 C;  2DFH A;  1J75 A;  3DEU A;  3N05 A;  1IZ1 A;  4HSR A;  4KIF A;  1LUJ B;  3RQ4 A;  4M9X A;  1WGX A;  3OL3 A;  2E19 A;  3TP0 A;  1WH5 A;  3GZ5 A;  2DA5 A;  1BR4 A;  2WC2 A;  3K4C A;  2OQR A;  1IV8 A;  1T33 A;  2HZD A;  4MFE A;  1VQ7 I;  1W5T A;  1FYL A;  4HDV A;  3GFI A;  2HDW A;  2KIF A;  3WE2 A;  1IGN A;  3GZN B;  3QOD A;  1MBF A;  1FLI A;  1EKE A;  2BXY A;  3IWF A;  1HC8 A;  2HTJ A;  2HQN A;  4XRS A;  4PJM A;  1XMK A;  2C6Y A;  3GTL J;  2G7U A;  4LG0 B;  3H0G J;  2HYF A;  2LVS A;  1O7L A;  3F8N A;  1X2N A;  2DYR H;  1E2X A;  1MNE A;  2O8K A;  2R4G A;  4HNV A;  4R8H A;  3BJA A;  1D0Y A;  1X3W B;  2NAZ A;  1I1S A;  2R7O A;  3L2R A;  4CCM A;  3U9G A;  1BIA A;  1OIS A;  1T56 A;  1FEX A;  3GTG J;  2FUG 2;  1XGO A;  2G9W A;  2WTE A;  2P5K A;  3CF2 A;  3HPH A;  1R9T J;  1SFX A;  2CUE A;  5H6Q A;  4A3C J;  4IHX A;  4A3B J;  2ZJR F;  4FE4 A;  4BS9 A;  4IO9 F;  1Y1V J;  3IKV A;  1MIJ A;  3VSL A;  4M72 A;  5C4X J;  1V5G A;  2EK5 A;  4YFX F;  4KJZ A;  5LGN A;  1CGP A;  1D1B A;  1EH6 A;  2LY1 A;  3HSE A;  3GFM A;  4HX7 A;  3CUQ A;  2HGC A;  2NYX A;  3V4G A;  1R7J A;  2DA2 A;  3HOW J;  1R1U A;  2X6W A;  2HQ5 A;  4RB1 A;  2PMZ A;  1PP7 U;  2R93 J;  3BT9 A;  1BI1 A;  2FQ3 A;  1XMA A;  2D5V A;  4ZTJ A;  3KCC A;  3ZQQ A;  2IVM A;  1OYI A;  2EJR A;  3BZC A;  4RB0 A;  1AKH B;  5B5E C;  4C2T A;  4N0B A;  2MBF A;  4M9Z A;  2XHK A;  3IWZ A;  4DZP A;  5HOD A;  3JRG A;  3ABT A;  3CF5 F;  3LST A;  4U87 A;  3JW4 A;  1VQ9 I;  4UY8 I;  1YJN I;  1BI2 A;  3FX3 A;  1YHQ I;  2MAB A;  5FLV A;  4V2G A;  5FJ8 J;  3DKY A;  4MEX F;  4CHU A;  1X1P A;  1OLT A;  5F27 A;  1R5I D;  2F6C A;  3CD6 I;  3REO A;  2H94 A;  1X3U A;  3S14 J;  2XB5 A;  1DQU A;  2TDX A;  4XOR A;  3VOE A;  1SVO A;  1Y1W J;  3GXO A;  3FHZ A;  4UVB A;  4G7H F;  1HQC A;  1ZG5 A;  3OYD A;  3S2W A;  3GWZ A;  2E1O A;  2OQG A;  2FNA A;  3DTK A;  2OZU A;  4MFD A;  1W1W E;  1MW7 A;  2CW0 F;  3T8T A;  3M4O J;  4XNF A;  5JVT A;  3H0D A;  1OR7 C;  5GAD J;  2MD0 A;  2DQL A;  2O3F A;  3HTU A;  2WAD A;  4ESB A;  1AU7 A;  3UKG A;  4BXU A;  2A69 F;  2IA0 A;  4G8X A;  5JR3 A;  3OYM A;  4KIB A;  5D8L B;  1OKR A;  2CGP A;  4IHW A;  2HU9 A;  2YX7 A;  5DDG A;  3CMM A;  5GPC A;  1Z9C A;  4I6Z A;  1KU7 A;  1G6N A;  1U9N A;  4Y13 A;  1EV7 A;  4A3D J;  1ETV A;  1IXS B;  5IPA A;  1ZHF A;  1WJB A;  1IW7 F;  1X4O A;  2DMN A;  2F5V A;  3CZ6 A;  1U5T A;  3M9A A;  2ADU A;  3QOE A;  3KP2 A;  2M45 A;  2Y9Z A;  3GW2 A;  2CQ7 A;  3I3L A;  4XQF A;  5F0F A;  4D5C A;  1ZG3 A;  4M9S A;  1QZE A;  3S16 J;  2CW7 A;  2X9D A;  3ABK H;  2HI3 A;  4Y17 A;  3V8K A;  4Q5S F;  3HIF A;  4KIT B;  4L9N A;  1WJE A;  4WF2 A;  5AON A;  3DBL B;  2Q2E B;  5LBQ A;  3K70 C;  3DKX A;  2LK2 A;  3F8M A;  1V54 H;  1F5T A;  2R7Z J;  4QSH A;  3FXO A;  1TT0 A;  3FXJ A;  3GZ6 A;  2O61 A;  4LJZ F;  1POG A;  1XD7 A;  1SAX A;  3J7Z I;  3AG1 H;  4NQW A;  4PJJ A;  4J01 A;  2WB1 A;  4P55 A;  1QPM A;  3CCM I;  5F0H A;  4LFU A;  3MAJ A;  4Z2Y A;  3RYR A;  3LQQ A;  3ASN H;  2CQN A;  2HTS A;  5M5W J;  1K4T A;  5E17 F;  1EF4 A;  3IH3 A;  5HVQ C;  3ZMU A;  3VOD A;  1X1C A;  1Z6T A;  4KA4 A;  3ULQ B;  2VQG A;  3QYF A;  3F22 A;  2X6O A;  3T1B A;  2HKX A;  1SMY F;  2DMQ A;  1U78 A;  1VQ4 I;  3CC2 I;  1KYW A;  1WVR A;  1LKX A;  3K69 A;  3ZQG A;  4CZZ A;  1LVA A;  4GCV A;  1FPQ A;  3K2A A;  1IC8 A;  3QAH A;  1H9G A;  3PJR A;  3BPV A;  1VZ0 A;  4I98 B;  2IS6 A;  2RGV A;  1BA5 A;  2PX9 A;  4PFO A;  1B72 B;  2K3P A;  3HJE A;  4PDK A;  4Y3O A;  1Z05 A;  5B1B H;  2XAJ A;  2F5F A;  3GTO J;  1TQP A;  3NWT A;  3Q0W A;  1W0U A;  3Q9V A;  4F3Q A;  4C2U A;  3EUA A;  2M4K A;  3KLN A;  3H3V K;  5IY5 H;  2ELK A;  3K0L A;  2P6T A;  2JK3 A;  4EJV A;  2F2E A;  4U7B A;  1FSH A;  2V9K A;  3CCJ I;  2UUZ A;  3SZT A;  4E6K G;  3HKZ A;  4QWQ A;  1R1V A;  4L9J A;  3A01 B;  5LRR A;  4CDG A;  2P7C B;  3S32 A;  1XB4 A;  3EUH A;  4IRH A;  1FIA A;  2P0W A;  3OY9 A;  2VPR A;  2RNJ A;  3HRU A;  2CSO A;  3H3U A;  5LRS A;  1OCP A;  2P5L C;  5FD6 A;  3GFL A;  4U88 A;  5HS8 A;  2J5O A;  2VL8 A;  4KN4 X;  3QWL A;  3NEU A;  4E7J A;  3MZ8 A;  1MGT A;  3CJR B;  1GXQ A;  3LSM A;  2F4M B;  2L9N A;  3I59 B;  1TNS A;  3D5R C;  3SJM A;  2H1L A;  2KRF A;  2CU7 A;  1FOY A;  4C3I J;  3SHF A;  3AKZ A;  3LNQ A;  4A0Y A;  2IPQ X;  1STZ A;  3VWB A;  1MMD A;  2E1M B;  3Q3S A;  4CYD A;  5DM7 F;  1JHF A;  2O6G E;  2YSR A;  2VN2 A;  3E5X A;  1T98 A;  1UST A;  4MLO A;  2NOG A;  2KJC A;  2ZKZ A;  4UUS A;  2XKO A;  4W97 A;  3KP3 A;  1XN7 A;  3BP8 A;  5HDG A;  5ILS A;  4MHG A;  5GAE J;  2EZI A;  2QUF A;  4IRG A;  5AIP A;  4BQN A;  1AOY A;  1LEA A;  5FRN A;  1XG1 A;  3DCF A;  2MA3 A;  3OIO A;  3ZMZ A;  3E6D A;  5DCM A;  2DA4 A;  1SC7 A;  2HXO A;  2P81 A;  3HOZ J;  1YRN A;  3WGH A;  3RYP A;  2UZK A;  4A6E A;  2OTJ I;  1IDY A;  1WZ2 A;  4E7I A;  3D5S C;  3OYI A;  4CIC A;  3FHN A;  2PQ8 A;  1XTA A;  4RLF A;  5ICE A;  4RB3 C;  1ZN2 A;  4JP0 A;  1TQM A;  4AYB A;  1J5Y A;  2DT5 A;  5HNF A;  4PUS A;  1RC9 A;  1X1B A;  2VE8 A;  3MKL A;  4DNC A;  4ZYD A;  2X1D A;  1FP1 D;  4JX6 A;  1JTX A;  2HYG D;  2WAF A;  2KP6 A;  2VT3 A;  3FF5 A;  4XIC A;  2A5W A;  3GME A;  1TWH J;  4AVZ A;  2QZ8 A;  3W2V A;  3TP3 A;  3I4M J;  2E1N A;  2H1K A;  4UHT A;  4ESF A;  2EQR A;  3GTK J;  3DP7 A;  4GXO A;  1ZG1 A;  3EYI A;  1ODD A;  3I56 I;  2FF4 A;  1FMW A;  3HYI A;  2ZSI B;  4P1W A;  3CCL I;  4LB5 A;  4F93 B;  3IHU A;  5TJJ A;  1R4M B;  3I53 A;  1WI9 A;  4MQV A;  5FLX K;  2Y0S N;  2PEX A;  4UV8 A;  2UWM A;  3G6E I;  1I6H J;  1YE9 A;  1BJZ A;  2XB0 X;  1HOM A;  4LLN A;  1MZB A;  2EH3 A;  3FK7 A;  4I2O A;  2AXT C;  3EET A;  4G6T B;  1RZ4 A;  4EJT A;  2HVS A;  3BDD A;  1JXS A;  2ACJ A;  5ILV A;  2VQL A;  3HHH A;  3TDU C;  2E5N A;  4BQQ A;  2VJ4 A;  1YW8 A;  2VBY A;  2COB A;  2PLY A;  1B8I A;  2JTV A;  1N25 A;  5CVJ A;  3HM5 A;  3OSG A;  2AQF A;  4BBR J;  5E3O A;  1K83 J;  3HHG A;  2EIM H;  2XIG A;  5EG0 A;  1VQ5 I;  5E8G A;  1FBS A;  2CQK A;  1JHH A;  3BRO A;  2M5W A;  1BW5 A;  3FZV A;  3C1D A;  2BEO A;  2P4W A;  4RAF A;  4HZF A;  3FXM A;  3PNV A;  4D1Q A;  5JI6 A;  3L09 A;  1VTN C;  1IG7 A;  2DDB A;  1T2K A;  1B9M A;  2RDP A;  4GO1 A;  3ZQ7 A;  4KUM A;  3MEX A;  5DV5 A;  4KN7 X;  4CYC B;  3OYN A;  1JKQ C;  5KCM A;  2EZL A;  3UNG C;  2E36 A;  2E2J J;  2O0Y A;  1XGN A;  1VND A;  2ZJ2 A;  2MGQ A;  3BTI A;  2KZG A;  5J4Y A;  2IRF G;  3ZOB A;  1WJF A;  3SDB A;  1HDD C;  1BM9 A;  1KON A;  4R79 A;  2WAE A;  3LA2 A;  3OYL A;  2ZFW A;  4XRM A;  4KMF A;  2ZME A;  2NOJ B;  1FOW A;  4M74 A;  3F72 A;  3PFI A;  3DTI A;  4M73 A;  4QIW N;  1SEU A;  3GO5 A;  2V1D A;  2HOT A;  1Q1H A;  3OV8 A;  3BR6 A;  2X51 A;  5FKK A;  5FO5 A;  1MKM A;  4XOT A;  2DN0 A;  2LG4 A;  3BZ6 A;  5DD8 A;  2H27 A;  1FY7 A;  3L2Q A;  2WAQ A;  3KP7 A;  4OMZ A;  3FMS A;  3BWG A;  4B1R A;  4M6Y A;  2Y2Z A;  4LG3 A;  1D0Z A;  4EMS A;  5LEK A;  4B43 A;  1YTY A;  4DIQ A;  1X1D A;  4XLH A;  2UXN A;  3LSK A;  2GXA A;  1SAN A;  3HUG A;  4GYG A;  3V42 A;  1S3J A;  1I39 A;  3O2P E;  2MLG A;  4BUP A;  5K5Q A;  3HOT A;  1YIT I;  2ZC2 A;  1H89 C;  2PG4 A;  3R0J A;  2XGC A;  1DU6 A;  4A69 C;  4FCY A;  4LGW A;  4CSW A;  1Q1V A;  4S04 A;  2PJP A;  2F4O B;  2PMH A;  1EH8 A;  3DPL C;  1NG6 A;  1Z7U A;  1D1C A;  3PSF A;  1U5T B;  3D0S A;  4RGU A;  3JSP A;  3DLL F;  4ETS A;  4RM3 A;  1AA7 A;  3FM5 A;  1QHH D;  3H9Q A;  3MVP A;  4XN0 A;  1VQP I;  2VBX A;  1OQY A;  5E8I A;  1H9T A;  1TWF J;  4D7N A;  3PUF A;  2DFE A;  4RGR A;  3QPL A;  4XKW A;  2YUS A;  1W36 D;  3MFK A;  1H0M A;  4CCN A;  4HLX A;  1OR7 A;  3JSO A;  1F36 A;  4QTR A;  2JA5 J;  3E5U A;  3KFW X;  2NVQ J;  2JN6 A;  1KA8 A;  1ON2 A;  2ISY A;  3GCM A;  3VFZ A;  1UJ8 A;  2DQR A;  2L4M A;  5F0C A;  4F91 B;  1ZLK A;  1U8R A;  1IJW C;  4XLP F;  4BEH B;  3A1Y A;  3OOU A;  2DFF A;  4RA2 A;  3FIS A;  4A0Z A;  1KU9 A;  2FMY A;  3DF8 A;  1JI8 A;  2VJI A;  2CJJ A;  1I27 A;  4BY1 J;  1TNT A;  1K78 A;  1ETX A;  4KT6 A;  5B3S H;  5CPR B;  1Z67 A;  1NK2 P;  1MJ9 A;  1D0X A;  3RTR A;  3KYL A;  1PUF A;  3PO2 J;  1YG2 A;  1IN8 A;  3V7S A;  1ZRF A;  2DOE A;  1SD6 A;  4HQM A;  4RAG A;  2RN7 A;  3GYH X;  1SVM A;  2DO7 A;  3TL4 X;  2XRN A;  1OCO H;  4L9T A;  2G0E A;  3H5A A;  2MFZ A;  4A0X A;  2LNB A;  3TDZ C;  3F8F A;  3B6A A;  3DU5 A;  4WXH A;  3FBI B;  2N8G A;  4Z6Y A;  4IRI A;  2AO9 A;  2EIJ H;  2A07 F;  4ABZ A;  2OC6 A;  1ZR4 A;  4UVC A;  5JVG F;  4ASN A;  4BYY A;  3GBG A;  2DOD A;  2ECB A;  3SEQ A;  2FBI A;  4FX4 A;  4IXA A;  3MN2 A;  2BBY A;  5F64 A;  4LIT A;  2CQX A;  3EUK L;  1IN4 A;  1HST A;  5J3L A;  1IN7 A;  2R7S A;  4PGH A;  1HKQ A;  2KKO A;  2FBH A;  3F3X A;  1SD4 A;  5GPA A;  2KFD A;  4C3J J;  1PVE A;  3TKY A;  2M87 A;  2XPV A;  1RKT A;  5JHU A;  2FNP A;  4M3G A;  2R5Z B;  2D1H A;  5F04 A;  3LFK A;  4LB6 B;  1A5J A;  1MBK A;  3IRR A;  1XGM A;  3H9J A;  4UUT A;  4IKF A;  4CA0 A;  2OA4 A;  2W25 A;  5IOY A;  2PI0 A;  2FBK A;  2RRE A;  1ETO A;  3AG2 H;  1O3Q A;  3R60 A;  4ZJZ A;  5F1R A;  4DOZ A;  3IAS 2;  1ETW A;  3KEO A;  4EJO A;  2PJR B;  2DTZ A;  4KIG A;  5CYV A;  4XLC A;  3M7G A;  1ORK A;  3DU6 A;  1J9I A;  1MDM B;  2KJB A;  1LEB A;  1IV6 A;  3IC7 A;  3JRF A;  4DJA A;  1MBH A;  2RQQ A;  3G3Z A;  1QO0 D;  1GDT A;  3QP5 A;  1ITY A;  2AHQ A;  4D9J A;  4KYW A;  2IBD A;  1F1Z A;  2UXX A;  2F5C A;  2A6H F;  2NVX J;  1FC3 A;  3KZY A;  1QQI A;  1Z91 A;  3X2Q H;  3P9K A;  1VQO I;  2EV5 A;  3WGG A;  2V79 A;  1EH7 A;  5DCF A;  3FXR A;  3K4L A;  3OWT A;  3JCU C;  4ZH4 F;  2ZCW A;  1YJ9 I;  3C7J A;  4UUV A;  1JKP C;  2QLZ A;  5EZG A;  3DPU A;  4OWR B;  5ICG A;  3K4N A;  2O9L A;  4F55 A;  2YPR A;  2OF7 A;  1K7A A;  2EB7 A;  3AG3 H;  4UXN A;  3V7C A;  5H20 A;  3W6J B;  1Z6R A;  2K9M A;  2ZXW H;  3RPQ A;  5BPD A;  5CQE A;  1P4A A;  1Z3X A;  3H5N A;  2CWE A;  3U21 A;  3BG5 A;  4A3K J;  3RZD J;  1HW1 A;  2L7M P;  2M4G A;  2HOS A;  3CCY A;  4L0Y B;  1BI0 A;  1J2X A;  3A02 A;  3HSF A;  4DYC A;  4E7K A;  3MZH A;  3HB9 A;  3SFZ A;  3VB2 A;  4G7Z F;  2LBF A;  3QU6 A;  3IKT A;  1BL0 A;  3QU3 A;  4LK0 F;  3PQJ A;  3PIO F;  2M2E A;  1TW3 A;  2DA6 A;  5JHF A;  4GYI A;  3OYB A;  1Y0U A;  2KPM A;  4DW6 A;  2K4J A;  2M8E A;  4ZYH A;  1KGS A;  1UHS A;  2LY9 A;  1OPC A;  3HPG A;  2PMZ N;  5M3F J;  2LF8 A;  1R36 A;  1UG0 A;  3IL2 A;  1R4N B;  3CLO A;  5DUI A;  3MKZ A;  4ZYA A;  1J59 A;  2VJJ A;  3TO9 A;  5B66 C;  5HLI A;  4G9Y A;  2XC7 A;  1RUO A;  2VBZ A;  3IV5 A;  5GTH C;  3RPU D;  3N4M A;  1XCB A;  4XN3 A;  5CVR A;  5HLH A;  2XAF A;  1S72 I;  2G7H A;  4M6V A;  3DFG A;  3MZY A;  1B8I B;  2I8D A;  2NVT J;  2DA7 A;  2D2W A;  3OIP A;  1LPQ A;  2P7V B;  3SZG A;  3HGG A;  5BPI A;  3HTS B;  3M1C A;  4O5V A;  2VIX A;  1XGS A;  1JT6 A;  2JVG A;  3RDI A;  1P7I A;  4XM3 A;  2B7E A;  4EM0 B;  4GGG A;  5C3E J;  3CCS I;  2V6E A;  1TC3 C;  5KAI C;  1ACI A;  4FT8 A;  2OU2 A;  2JT1 A;  3IH2 A;  2IS2 A;  4A3G J;  3FXQ A;  5LGU A;  5DS9 A;  3RIR A;  1T39 A;  3C3W A;  2EFP A;  2M9H A;  2BY2 A;  5E1W A;  1LE8 A;  1WJ5 A;  2FE3 A;  4NBQ A;  4BDY A;  2A61 A;  3KP6 A;  4BQA A;  2I10 A;  5JLX A;  1VQN I;  5J1R A;  3WG9 A;  1UG2 A;  2ZME B;  3WG7 H;  4DYR A;  1TWA J;  3ZPL A;  2XAG A;  1QVU A;  1MMS A;  5K7F A;  5BQT A;  4A3L J;  3O3K A;  4NNJ A;  5HLT A;  3HRS A;  5DD4 A;  1PJR A;  4PJ0 C;  1MJA A;  3WE3 A;  4V19 K;  2OUM A;  1S5L C;  3E6B A;  4N4O B;  1EJ9 A;  2DA1 A;  4PGG A;  4NB5 A;  3D1N I;  4NHJ A;  3H3Z A;  1P92 A;  2HR3 A;  1W5S A;  4AUX A;  5CVV A;  2FOK A;  4OMY A;  3DEE A;  5KAF C;  1UHW A;  2JUC A;  2ESH A;  3CLQ A;  1OCC H;  4IZZ A;  1WKM A;  3TED A;  3NWS A;  2W00 A;  3BG9 A;  1ZGA A;  4MTD A;  3I58 A;  1XDS A;  2LD5 A;  2KL4 A;  5FRM A;  4BU2 A;  1S6L A;  5K5O A;  2KIU A;  5EJC A;  5KVR A;  1J09 A;  3CC4 I;  2AS5 F;  4BY7 J;  1P6R A;  2E5Z A;  2WB1 N;  3KP5 A;  5KK1 A;  2VQH A;  3VEP A;  2GXG A;  3OYH A;  2QBY A;  1SVL A;  2VQC A;  3RKQ A;  2W85 A;  1FMV A;  2IA2 A;  3BCB A;  5IYB J;  1F9N A;  5IYD J;  2LF7 A;  1W4M A;  3WTU C;  1REP C;  3ASO H;  4I0B A;  1ZAO A;  2BY3 A;  2KQR A;  2Z3Y A;  5EEH A;  1MD0 A;  5E3N A;  3ERE D;  3B02 A;  2BW3 A;  1ZH5 A;  3H1C A;  2EPF A;  1W0T A;  4BKX A;  3F6O A;  4KDP A;  5D4S A;  2DMP A;  2Q1Z B;  5LEJ A;  4NUB A;  4XLF A;  1A31 A;  4OIQ F;  2FJ1 A;  4E7S A;  2QQ8 A;  2IS1 A;  4W1U A;  3HRM A;  3CMY A;  1FBQ A;  2R7V A;  2XF7 A;  3H9G A;  3ZQH A;  1Y8R B;  3BC8 A;  3I55 I;  2A5Y B;  2BVM A;  3MQ0 A;  3BR5 A;  1XPX A;  3ZMS A;  3V8J A;  1VI0 A;  2CYY A;  1A04 A;  5CQG A;  4BNC A;  4RGS A;  4ZDP A;  2BHZ A;  5BNG A;  2W1O A;  3M8J A;  1A6Q A;  4YEL A;  1YYV A;  3HL2 A;  5K7H A;  1V5E A;  2OTL I;  2YR2 A;  3WOD F;  1D5Y A;  5L3B A;  2ELJ A;  3ZR8 X;  2CRG A;  2GIV A;  3TGN A;  1G8X A;  3CO7 C;  2ZNY A;  3S2H J;  1YW7 A;  1XSD A;  4OIP F;  1N77 A;  2A6T A;  1XSV A;  3FMR A;  2QM3 A;  1GXP A;  5J6X A;  4Y7N J;  1G3Y A;  1QGP A;  3DBR B;  1E17 A;  2IJL A;  2K3F A;  4EGZ A;  5L3E A;  4M3F A;  3HDD A;  3ONQ A;  1K6Y A;  1HXD A;  2ZXI A;  3Q0U A;  2HPI A;  2W82 A;  5J40 A;  1ETQ A;  5D8K B;  5L3F A;  3QP6 A;  5D6F A;  1ZR2 A;  2E1M C;  1P9Q C;  1DP3 A;  1LFU P;  2VKD A;  5CJ9 A;  3FDY A;  4N9H A;  3GTP J;  1FYM A;  5LHI A;  2E2H J;  3RPU A;  3Q0V A;  1PYV A;  2JZY A;  2OCE A;  5IT9 Z;  2K5C A;  2VJ5 A;  2QGU A;  4HX8 A;  2GM4 A;  4WXC A;  5M5X J;  1M1E B;  4G12 A;  1L3L A;  5LLQ A;  1F43 A;  3S1R J;  1IUY A;  4GDF A;  5KNL A;  2IGO A;  5HS7 A;  3CO6 C;  4RDU A;  4ZTF A;  2ZNZ A;  3PFY A;  3H36 A;  1V3F A;  2DPU A;  1GUU A;  1R23 A;  4ZC3 A;  4HNT A;  1BN5 A;  4U0Y A;  2AXL A;  1SD7 A;  1KU3 A;  1BW6 A;  3CP2 A;  3IP4 B;  4I02 A;  5ERI A;  2JSP A;  3OSF A;  4ZZD A;  4UB8 C;  4A3F J;  4A3M J;  1RNL A;  4AIJ A;  2ETH A;  1OJL A;  5E1Z B;  4YG2 F;  3HRT A;  1HSJ A;  1BBY A;  2IA1 A;  3SFI A;  1T8I A;  1GLN A;  3OYG A;  2CV1 A;  5IP7 J;  4F7Z A;  3WHC A;  1U3E M;  1QZY A;  3M3Y J;  5EGO A;  3D5L A;  1NH3 A;  2K27 A;  3WU1 B;  2F4I A;  2R5Y B;  5E18 F;  3WU0 A;  5E1X A;  2FEZ A;  4AYB N;  3F6V A;  2BOL A;  5IP6 A;  2KIS A;  1G59 A;  4I99 C;  5J8C A;  1IO2 A;  4HW0 A;  1YX3 A;  1UZC A;  2LC2 A;  3FM3 A;  3T8R A;  3IRQ A;  1CF7 B;  1SD5 A;  3S17 J;  2ZXJ A;  2QCO A;  2JVH A;  4PSX A;  4IHV A;  5J1U A;  2BGC A;  2BV6 A;  3HOS A;  4MNU A;  4E7L A;  2RC4 A;  4EM1 A;  1GV2 A;  1LFB A;  3LSJ A;  4PZJ A;  1B4A A;  2XF6 A;  1SFO J;  3P7N A;  3K70 D;  4C3H J;  2BE5 F;  2LDU A;  2VC1 A;  3W6V A;  2MD5 A;  3CUO A;  2JA7 J;  2WA0 A;  1YS7 A;  1SFE A;  4LMY A;  5M3M J;  4CXF A;  2MH9 A;  3DEW A;  3E7L A;  4DBQ A;  3IH4 A;  2WBM A;  1IN6 A;  3M8F A;  5FFX A;  2KIM A;  1BJA A;  2L5Q A;  5D5W B;  4RAY A;  4OIO F;  2ELH A;  3S15 J;  2V9V A;  2MG4 A;  4LG0 A;  4A93 J;  1A36 A;  2V4J C;  1T6S A;  4G7O F;  2WY8 Q;  4IVN A;  3F21 A;  3QQA A;  4F52 A;  2EIL H;  1HA8 A;  3HGY A;  2Z1D A;  2W57 A;  5FGM A;  4HNU A;  3GTJ J;  2QVO A;  3C2B A;  2QSG X;  3NRV A;  1Z21 A;  2DW4 A;  1FT9 A;  1I6X A;  1D3Y A;  4HX4 A;  3J81 K;  4HST A;  2K85 A;  1TZL A;  3ABU A;  5EEG A;  3SZP A;  2CFO A;  4ITV A;  3CUQ B;  5FKL A;  3BQY A;  4IQ4 A;  4Q4Z F;  2K02 A;  2V1U A;  3KP4 A;  2ME0 A;  3B6C A;  2L4A A;  5FB2 A;  3S1M J;  2B9S A;  1G3S A;  5DYM A;  4HA8 A;  5K5R A;  3VDX A;  1LDK B;  4FET A;  3W6K B;  4P5O A;  4B44 A;  2XSD C;  3LMM A;  3H92 A;  1ZRD A;  2HS5 A;  3KYC B;  2OCC H;  4OIR F;  4IQJ A;  3FXK A;  3I5U A;  2ZJP F;  5J1Y A;  3CTA A;  1K79 A;  3GLL A;  3BTC A;  3S3N A;  4HG2 A;  2R7T A;  1S7O A;  2DCE A;  2E1C A;  1IAW A;  4I76 A;  1TQI A;  3P9C A;  2KRH A;  4JK1 X;  1ZEL A;  3M07 A;  6PAX A;  3BTL A;  4G6Q A;  4OIN F;  3PIP F;  4ENJ A;  2KDZ A;  1PUE E;  1JKR C;  2L9S A;  2KRC A;  2WAQ N;  1Z0X A;  3OYA A;  2L02 A;  2NVU B;  3GUD A;  4EM2 A;  5CVI A;  1ZRE A;  2HVQ A;  4IOA F;  3I4P A;  3I71 A;  3KPH A;  3FXU A;  2WV0 A;  3ML6 A;  5D4R A;  4ENN A;  2M34 A;  4EEF G;  5EDN A;  1GHC A;  3G1O A;  2H8R A;  3FWE A;  4DZJ A;  3WTX C;  4IOC F;  3L2U A;  1U5T C;  2P8T A;  2OV7 A;  4M71 A;  3G1L A;  4HOB A;  2V9P A;  4I09 A;  3PUB A;  4XKC A;  2WY7 Q;  3MCZ A;  2L2O A;  2O7O A;  3CES A;  3LOC A;  2L0K A;  3GFJ A;  1WFX A;  1FZP B;  3A4C A;  4QPQ A;  3TO7 A;  2KLO A;  4MO7 A;  5ICC A;  3LSG A;  3F8C A;  1K61 A;  3BQZ A;  5HLG A;  1L0O C;  1S7E A;  2IS4 A;  3L2V A;  1ON1 A;  5D5U B;  2PMU A;  1HW5 A;  2DYS H;  5EEA A;  4Q48 A;  1VQ8 I;  3E3V A;  2XF5 A;  5C4J J;  3G1M A;  5DUK A;  4XLA A;  1OFC X;  3ZXS A;  5DEQ A;  2IEK A;  3LAP A;  4TV7 A;  3DBH B;  1MND A;  4UB6 C;  2HQR A;  3CP8 A;  3U2R A;  2R7Q A;  1S9H A;  1I50 J;  5FD5 A;  2XGE A;  2VE9 A;  2GOX B;  2QBY B;  4AIH A;  2Y75 A;  2OJE D;  2L9R A;  1R71 A;  5E3M A;  3DXJ F;  1NG7 A;  3I54 A;  3PL8 A;  2R3S A;  3ZCO A;  4J19 A;  4PCQ A;  3EQL F;  4EAT A;  1MBE A;  4NQW B;  3WTT C;  3H5R A;  1R22 A;  2LRE A;  2Q2E A;  2JSC A;  2LFB A;  3K4K A;  3R61 A;  3TO6 A;  3BOQ A;  2O8X A;  2STW A;  4WX9 A;  2X0L A;  5ED4 A;  1O57 A;  4FHT A;  4R1H A;  1DGW Y;  2V1N A;  3FMQ A;  3ZRG A;  1T0F C;  2CS3 A;  1ZGW A;  2JPC A;  4WCG A;  5LFA A;  5E79 C;  4XKV A;  2XRO A;  4A5M A;  2RKH A;  1B6A A;  1ZRC A;  3CJQ B;  1QVT A;  1WJA A;  2NVY J;  2M0M A;  3QOP A;  4BL0 B;  1JJ6 C;  2JA6 J;  4E7H A;  3CQZ J;  3WU2 C;  1R6R A;  3CDL A;  3K4B A;  3BLY A;  2YX4 A;  2K40 A;  5FLM J;  3OYF A;  1QRY A;  5F6F A;  3QRF F;  3GTM J;  2Q0O A;  4MTE A;  1TL8 A;  3PNT A;  3BG7 A;  2LMD A;  2LTP A;  5KHD A;  1BOA A;  1WWX A;  4B4C A;  4XRS G;  1J0R A;  2GA1 A;  2DAO A;  4Y33 A;  3HG9 A;  3EUH C;  4A6D A;  2PBI A;  2E71 A;  2RVC A;  3DPT A;  3HC7 A;  3KZI C;  1A6I A;  4L5I A;  4AD9 A;  1TWC J;  3AG4 H;  3ZQI A;  4QLC U;  1C0W A;  4KMU X;  1LB2 A;  2DJI A;  2IW5 A;  3JRB A;  1B72 A;  2DPD A;  2FX0 A;  3ROU A;  2HWV A;  2MLK A;  3OL4 A;  3TQN A;  2KMU A;  3J7A O;  2GAU A;  1SMT A;  2VC0 A;  1TTY A;  2V6C A;  2QEX I;  1B9N A;  3RI4 A;  3F23 A;  2HYJ A;  2BVL A;  4IX7 A;  2E7W A;  2IGK A;  3KZZ A;  2K9S A;  3C2H A;  5D5X B;  1WPK A;  2HXI A;  1B59 A;  1KU2 A;  4EQQ A;  2F5D A;  3OR1 C;  4P96 A;  2X1C A;  2R7X A;  5HDK A;  3A01 A;  2D1V A;  4H4K C;  3GTQ J;  1WHU A;  4XLE A;  4RM2 A;  1HLV A;  2VXD A;  2B0L A;  2QWW A;  3QYE A;  1JJ8 C;  4BDZ A;  3E6C C;  2Y9Y A;  1QU3 A;  4XLN F;  1VQK I;  1E0E A;  1VQL I;  1ZAR A;  2Z16 A;  2EFW A;  1VF9 A;  2XSJ C;  1RUN A;  1QHG A;  4G6D A;  1TLH B;  1IF1 A;  2MH2 A;  1XX5 A;  1FX7 A;  4ZDO A;  2PFB A;  3M8E A;  4M3E A;  4DYQ A;  2Y30 A;  4L5E A;  3CDH A;  1TT5 B;  4XOP A;  4UUS B;  3ZMT A;  3TW7 A;  4I7H A;  3GEZ A;  1H88 C;  3BJ6 A;  5GAG J;  3BR0 A;  2R7U A;  4CO8 A;  3FIW A;  3JAM K;  1I3Q J;  2YS9 A;  3VPR A;  4JQF A;  2A3S A;  5DCM B;  1YS6 A;  1YRN B;  2W7N A;  3K2Z A;  2ZBK A;  3K4J A;  1PP8 F;  2DOF A;  2EV6 A;  4N4N B;  4IJA A;  4PFP A;  1TW2 A;  2FA5 A;  4A3I J;  1BOB A;  1YI2 I;  4LIV A;  1IRG A;  2QQA A;  4LK1 F;  1HKS A;  3LA3 A;  1MMA A;  4YEJ A;  1MMN A;  3JTH A;  4BHC A;  2CV2 A;  3ERM A;  4XID A;  2QKL B;  3ISP A;  2DFI A;  5F08 A;  1FNN A;  3TMO A;  3KX2 A;  1SFU A;  3BG3 A;  4RGX A;  1P2F A;  3L2W A;  3I64 A;  2CUJ A;  3HOU J;  2NRA C;  2Z9O A;  1DPR A;  2VKH A;  1USS A;  3SEZ A;  2DBB A;  2JRM A;  3BJO A;  3A2K A;  4F92 B;  2QKM B;  1OYW A;  4L5J A;  3OYC A;  1U6G A;  2XGD A;  1T08 B;  4HPQ A;  2M30 A;  2DTR A;  2M1B A;  1FOK A;  4XBF A;  4BHP A;  2L9V A;  3LSH A;  3E0J B;  4B48 A;  4KIC A;  1P7J A;  1LFP A;  4XMY A;  1DPU A;  4OAY A;  5FLX Z;  1R49 A;  2XPW A;  1YFH A;  3HOY J;  1MSF C;  2CFX A;  2Z2S B;  1S7A A;  3DWL E;  3AL0 B;  2GXB A;  4FE7 A;  4HYE A;  3ABM H;  1Z1D A;  3WTV C;  2M7A A;  4CCL A;  5JLW A;  4KT5 C;  4JX4 A;  2P5V A;  1O7F A;  2M7B A;  2KHM A;  3V8L A;  5D5V B;  3GX4 X;  2KZV A;  1FSE A;  3B73 A;  5EG0 B;  2ZME C;  3J81 Z;  1MMG A;  1UB9 A;  1B1B A;  4YFN F;  2ZFU A;  3CME I;  2Z99 A;  4IHY A;  4U7D A;  3ZN0 A;  2DI3 A;  2RNG A;  4ESJ A;  2ZO4 A;  1VQM I;  3R6S A;  3MKW B;  4NDL A;  1ENH A;  1O4X A;  4P9U A;  3E5Q A;  5EYR A;  4BAY A;  2HPM A;  5J4V A;  4RBO A;  5HS9 A;  2E2I J;  5CLS A;  3RQI A;  4IHT A;  1XCV A;  1GVD A;  3HXL A;  3OS1 A;  5GP9 A;  2BXZ A;  2EV0 A;  1RR8 C;  2JJ7 A;  2K86 A;  1AWC A;  2OPT A;  2PN6 A;  1SFK A;  1YO5 C;  1ETK A;  4C30 A;  2JQ7 A;  4CUG A;  1RRJ A;  3SYT A;  1UHM A;  3LAJ A;  3CDI A;  3RJP A;  1WRJ A;  2MC4 A;  2W48 A;  1A35 A;  4CYC A;  3QPS A;  3VYS B;  4J00 A;  3K1M A;  4D0P A;  4XSZ F;  2LKS A;  2TCT A;  1N78 A;  1ETY A;  2EFN A;  2DK5 A;  1Z77 A;  1YX5 A;  1QA6 A;  5A2Q K;  2V7F A;  1X1A A;  2GZW A;  1W7P D;  1YIO A;  2LRD A;  1CQT A;  1PDN C;  2VKE A;  4UV9 A;  4BBS J;  3I9V 2;  3DLA A;  1X4P A;  4II3 A;  1O3R A;  1IN5 A;  1OCT C;  2DLL A;  2HQA A;  4S05 A;  3OYE A;  2FD5 A;  3WTS C;  3HBL A;  3I0T A;  5D6E A;  3S3M A;  3BZK A;  3K9T A;  1GV5 A;  5ICF A;  1K6O A;  3EYY A;  2GIZ A;  3SDG A;  2OD5 A;  1WH7 A;  2P6S A;  2L7K A;  3JTG A;  1MBG A;  1R5H A;  3HUG B;  4GRI A;  3JRI A;  2FSW A;  4MQ9 F;  2ZSH B;  3RCO A;  4II2 A;  4MGR A;  3MMY B;  4HF0 A;  2LKP A;  9ANT A;  4AM3 A;  3KYD B;  4PJN A;  2VBW A;  2M8G X;  4DBR A;  3HSR A;  3TW6 A;  4A5N A;  4L18 B;  1FP2 A;  4A2U A;  1UEL B;  3FKJ A;  5ILU A;  1WQ2 A;  5IOZ A;  2JUG A;  2BZT A;  3LSI A;  4CH7 A;  1ZGJ A;  4B47 A;  3BCA A;  5DTD A;  1Y8Q B;  4YFK F;  3TOA A;  1Y39 A;  1TP4 A;  4EGY A;  5BMZ A;  3O8H A;  1MH3 A;  4EJW A;  3HZJ A;  4NC8 A;  1F4K A;  4I01 A;  4U0W A;  2A68 F;  3ZQC A;  3BR2 A;  3WTW C;  1DUX C;  2YU3 A;  4KFC A;  3UR3 C;  4GFB A;  3RKY A;  1Y6I A;  2EWN A;  3M1E A;  1E3H A;  5LHG A;  2XPU A;  3S2D J;  5CVU A;  3ELK A;  4HAM A;  4X1E A;  3S3O A;  2CG4 A;  5BOX A;  2LOO A;  1H8A C;  1U0J A;  3OIQ A;  1W5C C;  2L54 A;  5E3L A;  1S8N A;  2DJN A;  3LSP A;  1K78 B;  2GOM A;  4KNY A;  1FTT A;  4P9F A;  4CCO A;  2DT7 B;  4HLY A;  1PUF B;  1Y0N A;  2E34 A;  4BEH A;  4HBL A;  4D5F A;  1R1T A;  3OS0 A;  2E60 A;  2XAU A;  4RLQ A;  3S93 A;  2LKX A;  2M0C A;  4JYK A;  2W84 A;  2XDV A;  1OYY A;  4IF4 A;  1NHA A;  3ZN1 A;  2FML A;  2GWR A;  1UAA A;  3E6M A;  1Z7L A;  1FBU A;  2QA4 I;  3C2G A;  3RSN A;  1IXR C;  1RR7 A;  3HKZ N;  3JRD A;  1J7K A;  2QQB A;  3T5X A;  4XL9 A;  2LYC A;  2H8W A;  4RS8 A;  2XVC A;  3PSI A;  3KE2 A;  5EZH A;  2NS0 A;  4AID A;  4C2M J;  4WWC A;  5TRD A;  2JRT A;  4YRV A;  4YII A;  3FKI J;  1T38 A;  2ZB9 A;  1O3S A;  1T0F A;  1X58 A;  2Z33 A;  3CCU I;  2R7W A;  2R7R A;  2VPL A;  3J80 K;  3QPH A;  2NS7 A;  1JUS A;  3ZQF A;  3L2C A;  1DGR M;  2ICW G;  2ISZ A;  2O5R A;  2LH9 A;  2VLA A;  2JMW A;  4LLG F;  4RB2 C;  4XKB A;  4MIM A;  5FFZ A;  2R5Z A;  5L3C A;  4A12 A;  1GT0 C;  1FYK A;  3PO3 J;  4WXD A;  1T95 A;  1E3P A;  2ID3 A;  2LY2 A;  1YQA A;  2B63 J;  2FQ4 A;  5LHH A;  3DKW A;  1D1A A;  5BS6 A;  3LWF A;  4LLL A;  2R7D A;  3DQV C;  3OR2 C;  3JRC A;  4IHS A;  4BAC A;  1RES A;  4JX5 A;  1R5G A;  3TBI A;  3SXY A;  1BR1 A;  3COA C;  1R00 A;  1V55 H;  3Q5F A;  3DV8 A;  1JT0 A;  2K9L A;  1G4D A;  4HDU A;  1I1G A;  5L3D A;  2H6B A;  1O3T A;  5C44 J;  2K9Q A;  3OMY A;  1FWZ A;  2CUZ A;  1WJD A;  2DU9 A;  3J7Y J;  3CMA I;  4BJ6 C;  2PJR A;  2H6C A;  4FQG A;  3VSK A;  2ESN A;  3IAM 2;  2A6E F;  2MSY A;  3SQN A;  1MDM A;  4AC0 A;  3ABL H;  3ZMD A;  2QF7 A;  3K1P A;  3LA7 A;  3G2B A;  3LQR A;  3FXL A;  4IL6 C;  3VYT B;  1XMX A;  1LQ1 A;  1LDJ A;  3RZO J;  2HOE A;  3N97 A;  3G4S I;  2VAS A;  3W3C A;  2K9N A;  1XS9 A;  2CMP A;  1AHD P;  1W7P A;  1KQ8 A;  4BH9 A;  2XV4 S;  3OYJ A;  4EV0 A;  1HCR A;  3S1N J;  1GVJ A;  4O3M A;  2D45 A;  3JAM Z;  2HKO A;  2M3A A;  4E7Z A;  1RIO H;  4KIS A;  1YJW I;  2WWY A;  4G94 A;  2EBI A;  1VFC A;  1P4X A;  2AQE A;  3BPX A;  4N9I A;  2X48 A;  4H0E A;  4Y4R A;  1UFM A;  2GBY A;  5HNH A;  2V26 A;  1ZLJ A;  3BR1 A;  2Z5U A;  2ME6 A;  1MBJ A;  3BTJ A;  1OCR H;  5FKM A;  4BXF A;  1JTY A;  1WI3 A;  1Y56 A;  3MWM A;  1W36 C;  2L7Z A;  2DOA A;  3CJT B;  1BIB A;  1I3A A;  3F9K A;  3KET A;  1LNW A;  5L3G A;  1DP7 P;  2LR8 A;  2EFO A;  3ZMV A;  2E35 A;  4IPA A;  1D5V A;  2XAQ A;  3CUQ C;  3AAF A;  2LBF B;  1KYZ A;  1LDD A;  5HDN A;  2CV0 A;  1D8K A;  4E70 A;  3L9F A;  5B1A H;  1LVK A;  3CC7 I;  3H35 A;  2QEN A;  5FKO A;  4RMN A;  4HF2 A;  1E3O C;  5H6R A;  1BC7 C;  2IAI A;  3GF2 A;  2OBP A;  2KIQ A;  3JR9 A;  2HEO A;  4AVP A;  1MH4 A;  1QZZ A;  3JRH A;  2HDD A;  1Z3Y A;  2FXA A;  2NNY A;  2GQQ A;  4XON A;  3VYU B;  2Y48 A;  3WTY C;  4FTH A;  1IRZ A;  2EZK A;  2XGX A;  3RKX A;  2JA8 J;  2QSH X;  4S0H B;  3BR3 A;  4XSX F;  2VOD A;  5LD2 C;  4AWX B;  2BHY A;  4V2F A;  2VKV A;  2ECC A;  1FIP A;  3OS2 A;  2Y69 H;  2Y0S A;  5E20 A;  3W2A A;  5FKN A;  4E4H A;  5J47 A;  2FRH A;  1HKT A;  2MC3 A;  4LOC A;  2EA4 A;  5TIS C;  3P9I A;  5HOO A;  3J7A Y;  4LIU A;  2XRL A;  1RPW A;  3RKW A;  1SAU A;  1TBX A;  1AKH A;  4CCJ A;  4BJT A;  3L00 A;  1S29 A;  3F8B A;  2ZJQ F;  2X1E A;  2STT A;  1LE8 B;  2R0Q C;  4NC6 A;  3TOB A;  2NNN A;  4HQE A;  1R58 A;  4FIS A;  1G2H A; 
#chains in the Genus database with same CATH homology
 2X1C A;  2R7X A;  4CZC A;  1WJ5 A;  3S32 A;  4BDY A;  3EPZ A;  4H4K C;  3LFU A;  4XLE A;  4RM2 A;  4C9Y A;  2P0W A;  2VXD A;  3OY9 A;  3QYE A;  4BDZ A;  3K6G A;  1QU3 A;  2X6Y A;  2VL8 A;  1E0E A;  1V5F A;  4E7J A;  2Z16 A;  3CJR B;  3LSM A;  2L9N A;  2XSJ C;  3D5R C;  1QHG A;  2ZXH A;  4NNJ A;  5HLT A;  2CH0 A;  1PJR A;  3AKZ A;  4ZDO A;  4BE2 A;  2OUM A;  3VWB A;  1MMD A;  2E1M B;  4N4O B;  4ZDL A;  2IGM A;  2KDO A;  4XOP A;  4MLO A;  2DT6 A;  2R7U A;  3DEE A;  4IZZ A;  3NWS A;  4PSW A;  2W00 A;  4JQF A;  4BQN A;  2CW8 A;  3MD2 A;  3FBN B;  5FRN A;  2W7N A;  3K4J A;  2KL4 A;  5FRM A;  4BU2 A;  4N4N B;  4PFP A;  4ANJ A;  1J09 A;  2IGN A;  2E5Z A;  4AU7 A;  2VQH A;  3OYK A;  1BOB A;  3D5S C;  3OYH A;  4LIV A;  3FHN A;  3KEY A;  4PK4 A;  3OYI A;  4E7I A;  2VQC A;  4BJ5 C;  1MMA A;  4RLF A;  4YEJ A;  1FMV A;  1MMN A;  2CV2 A;  3BCB A;  2BW3 B;  4AYB A;  5HNF A;  4PUS A;  1X1B A;  4QPO A;  2QKL B;  2KQR A;  3TMO A;  3KX2 A;  2BW3 A;  2X1D A;  2WAF A;  2KP6 A;  4OAZ A;  3L2W A;  2CUJ A;  2A5W A;  4JOM A;  2VKH A;  4AVZ A;  1BR2 A;  2IXS A;  3SEZ A;  3A2K A;  4F92 B;  2Q1Z B;  3W2V A;  3ZGK A;  2QKM B;  3OYC A;  4NUB A;  4XLF A;  4HPQ A;  4E7S A;  2IS1 A;  2HVR A;  2R7V A;  2VXZ A;  1FMW A;  2ZSI B;  2XF7 A;  4P1W A;  3K10 A;  3H9G A;  4F93 B;  3LSH A;  3E0J B;  4B48 A;  3BC8 A;  1LFP A;  4XMY A;  1EA3 A;  4OAY A;  2BVM A;  2UWM A;  1YE9 A;  3BG6 A;  1N75 A;  2Z2S B;  5CQG A;  3DWL E;  3AL0 B;  4PJL A;  4ZDP A;  4G6T B;  2X85 A;  3DTE A;  2W1O A;  2HVS A;  3M8J A;  3E1S A;  4YEL A;  2M7A A;  2VQL A;  3HL2 A;  4CCL A;  1V5E A;  2E5N A;  5FRO A;  4BQQ A;  2VJ4 A;  2M7B A;  2ELJ A;  3ZR8 X;  2KHM A;  2KZV A;  1G8X A;  1MMG A;  2ZFU A;  2AQF A;  2UV1 A;  2A6T A;  1N77 A;  2RNG A;  2VB6 A;  2W4S A;  3MKW B;  3PNY A;  3K4M A;  2HPM A;  4B3X A;  3ONQ A;  1K6Y A;  2ZXI A;  3HXL A;  2HPI A;  2W82 A;  3PNV A;  3OS1 A;  4D1Q A;  2E1M C;  1P9Q C;  1DP3 A;  4HRI A;  2VKD A;  1SFK A;  4BE0 A;  3FDY A;  4C30 A;  4CUG A;  3OYN A;  5KCM A;  3SYT A;  1PYV A;  3UNG C;  1WJC A;  2MC4 A;  2K5C A;  2VJ5 A;  4XR6 A;  4FAS D;  2MYS A;  4CCK A;  1WJF A;  3SDB A;  3VYS B;  4J00 A;  1KON A;  4R79 A;  2WAE A;  3OYL A;  1N78 A;  2NOJ B;  5TGT A;  5KNL A;  4X0G A;  1YX5 A;  2HNH A;  2IGO A;  2V7F A;  1X1A A;  2LRD A;  3DTI A;  4ZTF A;  3PFY A;  4ZC3 A;  3AFH A;  4HNT A;  2DXI A;  4BE1 A;  3I9V 2;  3DLA A;  1X4P A;  3CP2 A;  4II3 A;  3IP4 B;  5CKT A;  1X19 A;  2JSP A;  2HQA A;  3OYE A;  2X51 A;  4XOT A;  2LG4 A;  4DGW B;  3S3M A;  3L2Q A;  2WAQ A;  3IUO A;  1GLN A;  3OYG A;  2JA2 A;  2CV1 A;  1IRX A;  2L7K A;  4NC7 A;  4LG3 A;  1D0Z A;  3HUG B;  3D5L A;  4GRI A;  4B43 A;  4DIQ A;  1X1D A;  2F4I A;  2ZSH B;  4XLH A;  4II2 A;  3RCO A;  3LSK A;  3LL7 A;  1ERD A;  3MMY B;  3V42 A;  2BOL A;  4BUP A;  1G59 A;  3HOT A;  3QYB A;  4HEA 2;  1YX3 A;  4PJN A;  3S8P A;  2LC2 A;  4BQO A;  4CSW A;  4BGD A;  4DBR A;  3W2W A;  3DPL C;  1NG6 A;  1D1C A;  3PSF A;  4PSX A;  2JVH A;  1UEL B;  2X6X A;  3FKJ A;  3HOS A;  4RM3 A;  2JUG A;  4CH7 A;  3LSI A;  3MKY B;  4B47 A;  1AA7 A;  3BCA A;  1QHH D;  3H9Q A;  4XN0 A;  3VYR B;  4E7L A;  3AL0 C;  3N05 A;  4HSR A;  4NC8 A;  2XF6 A;  3RQ4 A;  3K70 D;  3OL3 A;  1W36 D;  4XKW A;  3UR3 C;  4CCN A;  1BR4 A;  3K4C A;  2WA0 A;  1Y6I A;  2HZD A;  3S3O A;  2HDW A;  2LOO A;  4DBQ A;  4F91 B;  3QOD A;  1U0J A;  3OIQ A;  4BEH B;  2WBM A;  3A1Y A;  2GOM A;  3OOU A;  4CCO A;  2DT7 B;  4PJM A;  1JI8 A;  2VJI A;  2L5Q A;  4BEH A;  4KT6 A;  3OS0 A;  5CPR B;  2E60 A;  1MNE A;  2XAU A;  4RLQ A;  1D0X A;  2R4G A;  3RTR A;  3S93 A;  3KYL A;  2V4J C;  1D0Y A;  2R7O A;  2XDV A;  3L2R A;  4CCM A;  2WY8 Q;  1UAA A;  1HA8 A;  1Z7L A;  4F52 A;  2FUG 2;  3TL4 X;  3CF2 A;  2Z1D A;  3HPH A;  3H5A A;  3C2G A;  2MFZ A;  3RSN A;  4HNU A;  4XL9 A;  3DU5 A;  1Z21 A;  2LYC A;  3FBI B;  4HST A;  4BS9 A;  1TZL A;  3VSL A;  1V5G A;  2CFO A;  4ITV A;  2OC6 A;  4IQ4 A;  3PSI A;  4KJZ A;  3GBG A;  1D1B A;  2LY1 A;  3SEQ A;  4YRV A;  3VDX A;  1LDK B;  4FET A;  4P5O A;  4B44 A;  2X6W A;  3LMM A;  4LIT A;  2PMZ A;  3EUK L;  2R7W A;  2R7S A;  2R7R A;  2VPL A;  4IQJ A;  4ZTJ A;  1DGR M;  3ZQQ A;  3S3N A;  4HG2 A;  2R7T A;  2DCE A;  2O5R A;  4C2T A;  2LH9 A;  2KRH A;  2VLA A;  1ZEL A;  3H9J A;  4XKB A;  4IKF A;  4U87 A;  4CA0 A;  2L9S A;  2KRC A;  1T95 A;  3OYA A;  2LY2 A;  2MAB A;  1D1A A;  2HVQ A;  3DKY A;  3DQV C;  2RRE A;  1OLT A;  3OR2 C;  2F6C A;  4BAC A;  4ZJZ A;  3TBI A;  1DQU A;  4XOR A;  1BR1 A;  4DOZ A;  3IAS 2;  2K9L A;  2PJR B;  3L2U A;  3OMY A;  2CUZ A;  2OV7 A;  4XLC A;  1WJD A;  3DU6 A;  3OYD A;  3DTK A;  3PUB A;  4XKC A;  4BJ6 C;  2PJR A;  2WY7 Q;  2L2O A;  1MW7 A;  3VSK A;  3CES A;  3IAM 2;  4DJA A;  4XNF A;  3H0D A;  1OR7 C;  2RQQ A;  2MD0 A;  1WFX A;  3G2B A;  3A4C A;  4QPQ A;  2WAD A;  2KLO A;  4D9J A;  3LSG A;  3VYT B;  2IS4 A;  3OYM A;  3L2V A;  2VAS A;  3W3C A;  2HU9 A;  3K4L A;  3CMM A;  2XF5 A;  2CMP A;  3OWT A;  3OYJ A;  4XLA A;  3ZXS A;  2M3A A;  1MND A;  3DPU A;  4E7Z A;  4KIS A;  4OWR B;  3CP8 A;  1WJB A;  1X4O A;  2F5V A;  2R7Q A;  3CZ6 A;  1S9H A;  3QOE A;  3K4N A;  2AQE A;  4F55 A;  3I3L A;  2GOX B;  4XQF A;  4Y4R A;  5HNH A;  2V26 A;  2K9M A;  2CW7 A;  5CQE A;  1Z3X A;  1NG7 A;  4BXF A;  4KIT B;  3PL8 A;  1WJE A;  1Y56 A;  3H5N A;  3K70 C;  2Q2E B;  3ZCO A;  3U21 A;  3DKX A;  1W36 C;  2DOA A;  4EAT A;  3F9K A;  4NQW B;  2M4G A;  3H5R A;  1TT0 A;  2LRE A;  3K4K A;  4PJJ A;  4J01 A;  4E7K A;  2LBF B;  1DGW Y;  2V1N A;  2WB1 A;  3ZRG A;  1T0F C;  2CS3 A;  2CV0 A;  5LFA A;  4XKV A;  2LBF A;  1LVK A;  3H35 A;  4RMN A;  3CJQ B;  5JHF A;  5HVQ C;  1WJA A;  3OYB A;  2KPM A;  2M0M A;  4BL0 B;  4E7H A;  1X1C A;  1R6R A;  2VQG A;  3K4B A;  3BLY A;  3QYF A;  3OYF A;  3HPG A;  1Z3Y A;  4XON A;  3VYU B;  1UG0 A;  3PNT A;  3BG7 A;  1LKX A;  5KHD A;  3MKZ A;  4ZYA A;  2VJJ A;  2XC7 A;  4Y33 A;  3RPU D;  3PJR A;  4XN3 A;  3HG9 A;  3EUH C;  5LD2 C;  1VZ0 A;  3HC7 A;  2IS6 A;  3DPT A;  4PFO A;  2K3P A;  4Y3O A;  3OS2 A;  2I8D A;  2Y0S A;  3W2A A;  4E4H A;  3NWT A;  3OIP A;  2DJI A;  3SZG A;  4F3Q A;  4C2U A;  3OL4 A;  2KMU A;  3EUA A;  3M1C A;  2M4K A;  2VIX A;  5HOO A;  3J7A Y;  2JVG A;  4LIU A;  4IX7 A;  2BVL A;  4U7B A;  2IGK A;  4XM3 A;  3C2H A;  1SAU A;  2V6E A;  4CCJ A;  4BJT A;  2V9K A;  2UUZ A;  4E6K G;  3HKZ A;  2X1E A;  2IS2 A;  3OR1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...