4NC7A

N-terminal domain of delta-subunit of rna polymerase complexed with i3c and nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc7A00
2KRCA 4NC7A 2M4KA 4NC8A
chains in the Genus database with same CATH superfamily
1W0UA 4EM1A 2DMTA 1VQLI 3JRCA 1YIOA 2BXYA 2Z2SB 5J6XA 2R7VA 1U5TB 2ESNA 3M1EA 4IF4A 1VI0A 1ZTRA 1OYWA 1SD4A 3P9KA 4NDLA 1VQPI 1R6RA 1SANA 1I39A 1FP2A 4AM3A 3QPSA 3IUOA 1QZYA 4BACA 1X58A 2VBZA 1WKMA 3SEQA 1S6LA 3Q3SA 4BXFA 1ETWA 5KNLA 5DYMA 2E36A 4IQJA 1ZLKA 1LFBA 2E5NA 2LY2A 3TKYA 2ID3A 2LLKA 4XMYA 2DLLA 4GXOA 1Z21A 3QP6A 4DNCA 2ZXJA 1OLTA 2VI6A 4I0BA 2BW3B 3ZQFA 3ZMUA 1U5TA 4AU7A 5B1BH 1XD7A 3BP8A 3MN2A 3UKGA 3S2HJ 4D9JA 3JAMZ 4D5FA 2VASA 1HF0A 2KJBA 4MTDA 2EH3A 2HXIA 3E3VA 2JPCA 5LBQA 2K4JA 4CZCA 3VOEA 4A3BJ 2NS8A 3ZQIA 2EINH 4NNJA 3TDUC 2MD5A 1T0FA 3BOQA 3ZMDA 1WQ2A 2BW3A 2ZMEA 2FF4A 3EUHC 3LNQA 2M4GA 2NVTJ 2DU9A 3CF2A 1I1GA 3LSJA 1R4NB 1ZARA 5GAEJ 4L9VA 3ABMH 5H2FC 2LFBA 4C2MJ 4N0BA 1FZPB 3LOCA 2K85A 3CCMI 3U1DA 2IA1A 2V26A 1R1TA 1HA8A 2WB1N 4A0YA 4X0GA 1D8KA 4RB1A 1RESA 2A6HF 3K2ZA 3KP2A 9ANTA 1KYZA 4KJZA 4A5NA 4DOZA 2FRHA 1TZLA 3OR1C 2QUFA 4MTEA 5TJJA 3HRSA 5BPIA 1X1BA 4LLNA 4HNVA 2TCTA 2OF7A 2L9SA 1B4AA 4M71A 2Y9ZA 5L3FA 1TLHB 1D5YA 1T95A 2E35A 2Y48A 2FBHA 4L9NA 4KYWA 2O3FA 2QSGX 1WFXA 2M8GX 2Y30A 3ZQ7A 3A0HC 1YS7A 1JHHA 5DD8A 3BCBA 4M3GA 1UZCA 3GTQJ 1SD6A 5E18F 1IUYA 2DT5A 4KISA 3RKYA 1XMAA 1VTNC 4F91B 3TGNA 5HLGA 2MC3A 2L4MA 2FMLA 1E3HA 3OYCA 2FD5A 2M87A 3HOVJ 2LP0A 2M0CA 2P6SA 2L7FP 4ABZA 1HOMA 3LFKA 3WTVC 4EGYA 4YEJA 3KP5A 1G3WA 1R5HA 4BE1A 4L5EA 4F3QA 2CQXA 3TOAA 3CCEI 1REPC 2PMZA 5GPCA 4EJVA 4NB5A 4WXCA 3W2WA 4A3IJ 2HOSA 2PMZN 5LEKA 1ZYRF 2JN6A 3K4LA 5D5WB 1ONVA 1E3OC 2V6EA 2V7FA 1FWZA 3RKWA 2KFDA 2X0LA 3J7YJ 1LPQA 2QBYB 4BY1J 1YJWI 1AA7A 3EQLF 3O3KA 1QU3A 1G3SA 1DPRA 3E1SA 1EF4A 2E60A 2KHMA 2VKHA 2VPRA 4C3JJ 1ZG5A 1H8AC 2J5OA 5KAIC 2V9PA 2XVCA 3CMEI 2IGMA 2ZKZA 4XOTA 4M6XA 3GLLA 4QPQA 1FBQA 1K4TA 4LK0F 3Q0WA 4BQQA 3JRAA 2XGDA 3L7WA 5F08A 3I4MJ 5K7FA 4JP0A 4WK8F 4RB0A 3EUHA 2MYSA 1VQ5I 3RPUD 3W6JB 3H92A 1BOAA 4LB6B 3JRFA 1ETQA 2H94A 3QYBA 2HKXA 2M4KA 1MW7A 2L0KA 1QPMA 3SDBA 3HOSA 1Z1DA 3T8TA 3I56I 1X4PA 1I3QJ 5IT3A 1IF1A 3A2KA 3S1MJ 2W85A 3CCYA 4JX6A 4RMNA 3S3NA 2QZ8A 1J59A 3ABKH 5K5RA 1ZGJA 3GLXA 3C2HA 1R00A 5K5OA 1GHCA 4IKFA 1YRNB 1D0ZA 2PI0A 4DBRA 1V54H 5ICEA 2KKOA 3J7AO 3HYIA 3BJ6A 4QWQA 2NVUB 2F5EA 4WWCA 2WTEA 4O6JA 3EUAA 1RPWA 3KP4A 3LSKA 5H6RA 2P8TA 4JBAA 5LGNA 2VQHA 2X85A 2F4IA 2DJNA 1QA6A 2O5RA 3H5AA 2ME6A 1SC7A 3PJRA 3QYEA 3ASOH 2OQRA 2DDBA 4YIIA 1SD5A 2ELJA 1ZRDA 2F6CA 1G6NA 4UVAA 4MFDA 1OISA 2AXLA 3E5XA 4HBLA 3H9JA 3RTRA 4S04A 1WZ2A 4BDZA 4L0YB 4UUVA 2HOAA 1OCCH 3HBLA 3IKTA 1B59A 3BQZA 5H20A 3RPQA 4BKXA 4EJWA 1UHMA 4GGGA 3ZQGA 5FD6A 2OQGA 5B66C 3FXMA 5HLTA 3F9KA 5FGMA 3KP7A 5E1XA 2I10A 4PUSA 4CCLA 4B47A 1PDNC 2L9VA 2UUZA 1FT9A 2GAUA 3CO6C 1KU2A 2FA5A 5K5QA 2VB6A 3IAM2 5E3NA 4QPOA 1H89C 3SFZA 1USSA 3B73A 3DXJF 3M8EA 5E3OA 4OIQF 2YUSA 2ZSIB 2HVRA 3GF2A 2MA3A 5DEQA 2OBPA 4M9XA 1GVDA 1G2HA 3FXUA 4Y17A 4OOIA 3S14J 1P9QC 2OUMA 4UVBA 1D0YA 1I6HJ 1NG7A 2DQRA 4KNYA 2KRHA 1WJ5A 4IRGA 4PZJA 4IHSA 2ZFUA 3IH3A 5IYBJ 4P9UA 2MBFA 5HLHA 1BM9A 1KQ0A 1AHDP 1UMQA 1SEUA 4M74A 4V2FA 4BUPA 3LSTA 2R7ZJ 4IXAA 2HR3A 5IPAA 4EEFG 4DGWB 3O8GA 4B3XA 5HNFA 3GBGA 2XC7A 1MGTA 1LKXA 1XGSA 5AIPA 3VSLA 1P2FA 2CQNA 3NWSA 2WAEA 4DW6A 5EDNA 2K9LA 3LSMA 1QBJA 3ERMA 2FQ3A 2LMDA 2VOOA 1D3YA 3V4GA 2WADA 3IP4B 2EFOA 4J01A 1KGSA 3OWTA 1I3AA 1A6QA 2LD5A 1ZREA 3U2RA 2KRCA 1SAXA 3GCMA 2ISZA 5DCMB 4NHJA 3KEOA 3E0JB 1GT0C 2BBYA 3VWBA 1B9NA 3MKLA 3F8BA 3CJTB 1MJAA 1N75A 2JT1A 4S05A 1V5GA 2ZXHA 3L2WA 2GWRA 4EGZA 2JA5J 4OIPF 5E8IA 2NAZA 3D5RC 3KEYA 2F48A 1WPKA 4JX4A 4FX0A 2CSOA 1K7AA 3RJPA 1D1AA 1O3QA 3VYTB 5LGTA 1JTXA 3OYNA 4HQMA 2Y75A 5DCFA 5E1ZB 3WTTC 1FYKA 1YITI 5DCMA 1YG2A 4A3EJ 3IH4A 3MWMA 1O57A 2FOKA 3ASNH 5ICCA 3OIPA 3V7SA 1IRZA 5GP9A 1MH3A 2W57A 2K27A 3BZCA 3R4KA 5HVQC 3FDYA 1U78A 4G6DA 4K2EA 3JRDA 1T2KA 1JT6A 3P9CA 4IX7A 1R7JA 2CG4A 2DA7A 3U9GA 4DQ2A 4I2OA 1ZN2A 3HIFA 4U0WA 4OU0A 1XS9A 1EKEA 3L09A 3WE3A 4ZTJA 4Q47A 5F64A 3S1RJ 3PNYA 5H6QA 3H0DA 1ITYA 1R23A 3FMRA 5JHUA 5CPRB 3CCSI 1Z05A 1I5ZA 2WBMA 2L4AA 1D1CA 3ROUA 1Z9CA 2GM4A 5IY5H 1V5FA 2Q8KA 4G6TB 2DJIA 2JMWA 5E3LA 3DEUA 4ANJA 4RGXA 2VT2A 2A05A 3WHCA 2M8EA 4G6QA 1D8JA 1MMGA 1IG7A 3M9AA 4LG3A 1IDYA 4LLGF 3J81K 3OOPA 1TT0A 2UWMA 4ZZDA 2EFNA 1FTZA 2K5CA 4NC8A 3VYUB 1IJWC 4RAYA 5A2QK 4XKBA 1GUUA 4WXDA 4LK1F 4S0HB 5ED4A 3S32A 4B44A 1DUXC 4LIUA 1RR7A 3KYDB 4XLNF 4RGSA 5F1JA 4KMFA 3L2CA 1MKMA 1YW7A 1JUPA 4CCOA 5FROA 2FE3A 5DV5A 3HOZJ 3VSKA 3N05A 5J8FA 3K9TA 4MLOA 3LAJA 3TO9A 3KX2A 3GEZA 3KPHA 2JWTA 3GTOJ 2V6CA 2W48A 4ZJZA 4DIQA 3OL3A 2QKMB 1TP4A 3GX4X 4I0AA 2VXZA 4CYCB 4U87A 3BTIA 3WGHA 3LSHA 2EFWA 3WU0A 2CMPA 3CUQC 5LD2C 1NHAA 3S1QJ 4BY7J 3FF5A 4PSWA 2GZWA 2MH9A 2R92J 1AOYA 3PUFA 5M5XJ 3FX3A 2XB5A 2IS2A 5BS6A 4BL0B 1ETKA 2HTSA 4XKWA 3C7JA 3VB2A 4AWXB 3M1CA 2M7BA 4IO9F 1T33A 2FSWA 2VL8A 4E4HA 1OJLA 4JQFA 4F92B 4ESJA 3QU6A 5DD4A 4CDGA 4CYCA 1JXSA 1Y8QB 4E7HA 2L54A 1K6OA 1J09A 1Y0NA 1KU3A 3GFJA 1R71A 3AL0C 3VEPA 5EEHA 2EQRA 3BTJA 2X48A 4BHPA 2HOTA 1FIAA 4OWRB 3OIOA 3JRBA 4HV5A 1YW9A 2O7OA 1IO2A 1ZKGA 3PIOF 3ZMTA 2ZJQF 2VN2A 1YX3A 2CQKA 3A01B 3IHUA 2CUJA 4HAMA 1XMXA 1JKOC 1MBHA 3BG3A 3MVPA 1W5CC 2MD0A 4YFXF 5FB2A 2QLZA 3BWGA 2YPRA 3I58A 4Y13A 2E19A 3M8FA 4G7ZF 5FKLA 4FTHA 4L9TA 1UG0A 1SAUA 2P7CB 2YSRA 1S5LC 2LNBA 4RA2A 2HWVA 3MD2A 1MDMA 1OCRH 2KIMA 1HSTA 3FKJA 4MNUA 2IS4A 3LA7A 2RC4A 2A6TA 1ENHA 1E0EA 3Q0VA 1GDTA 4A5MA 4ZYDA 2EZHA 3CCUI 2Y9YA 3A01A 4PFPA 2BHYA 4XLPF 4BBRJ 1L3LA 4BS9A 2P5LC 2XAFA 4YIFA 1W1WE 3SJMA 2DFFA 3F6OA 1R49A 3FKIJ 2HQRA 1G8XA 2ZO4A 2W00A 3FXOA 4HZFA 4F55A 1Z6RA 5DM7F 5JHFA 3CCLI 1S7AA 3ZR8X 4ENMA 3JRGA 4Q48A 5BOXA 4P96A 4CSWA 4HNTA 4XRSA 4CH7A 1DP7P 3I3LA 3HG9A 4BJTA 2XSJC 3CC4I 2L5QA 2BVLA 2CUZA 3S1NJ 1RR8C 5IP7J 4BDYA 1U9OA 2EIMH 3HPGA 1VQ8I 3CUQA 3PL8A 3WU1B 2Y31A 1HBXG 4AC0A 4HDUA 1O3RA 3ABLH 3OYHA 5EJCA 3RZOJ 3E6BA 3QPHA 1KQ8A 1L0OC 3ELKA 2IPQX 2OPTA 4XNFA 2BOLA 4BEHA 3E5QA 3ZQQA 1K83J 1CF7A 1D5VA 4EQQA 3KETA 2J5PA 4Y52J 2LTPA 2QVOA 3L2UA 1SFKA 4YELA 1IW7F 1V4RA 5CKTA 3O8HA 4AUXA 3ZRGA 3GTLJ 1LB2A 2QF7A 1AU7A 3JRHA 5FKNA 1R9TJ 5J1RA 4FT8A 2QGUA 4R8HA 1PP7U 2W25A 3JCUC 4BGDA 4M6VA 2JTVA 1EA3A 2M9HA 4HF0A 2R7XA 1WCMJ 2F2EA 1WVRA 3V7RA 3QWLA 2A69F 3OYLA 4XONA 3QOPA 1YX5A 2EV0A 2EFPA 4M9SA 1YYVA 2D1HA 3BG9A 3DPTA 4D5CA 1FIPA 1TWHJ 3Q9VA 2IA0A 1A04A 2RREA 2CV2A 4N4OB 3C2GA 1B1BA 1H9GA 2Q1ZB 4D7MA 2HXOA 2R7WA 2E1OA 3BR2A 2VE9A 2WAQA 3K4CA 3M8JA 1JHFA 1YI2I 2HVQA 3HKZA 3O6BB 2WAQN 4QLCU 5JVGF 1MMNA 2L9RA 1T08B 2PFBA 5F27A 2K86A 3HKZN 1ZK8A 5GADJ 1F43A 3S16J 3K4NA 2HZDA 3MKWB 1J2XA 2YU9J 1ZG3A 3E6MA 3V8KA 1ZELA 3H9GA 2YU3A 2R3SA 4LOCA 4KUMA 1B8IB 5EEGA 3DLLF 1J9IA 2EWNA 1A5JA 2LC2A 3ZMZA 1RETA 4IHWA 3HHGA 2NOJB 3G1MA 5ILSA 1Z77A 4AVPA 4MO7A 3ZGKA 2FBKA 2ID6A 1BJAA 3JREA 2QQBA 1S7OA 3BZKA 4E7JA 1XC5A 2MH2A 3SHFA 2ZMEB 4OAYA 2DMQA 1ETVA 4HSTA 1I1SA 3JTGA 2R7QA 1ERDA 2VKDA 1O7LA 1B8IA 3BR3A 2X1CA 1VQ6I 2R7OA 5F0CA 4EJUA 3K4KA 4BHBA 4XM3A 3ZQHA 1U0JA 1DU6A 2XPVA 3GZNB 2DMPA 1F1ZA 4PSXA 4EVIA 3A02A 2BHZA 3J7AY 2XPUA 1ORKA 3I54A 3EYYA 3ML6A 4UV9A 2AS5F 1F4KA 3T0YA 1N77A 1IXSB 3H9QA 4N9IA 2QSHX 2OCEA 5LHHA 2EPFA 2RAEA 1QVUA 5L3BA 3SFIA 5CLSA 2MW8A 2WB1A 1AKHB 3OYEA 3AKZA 1GVJA 3WHBA 2OA4A 3OY9A 2ZJRF 3H3UA 1XCVA 2KDOA 1EJ9A 3HDDA 3GTKJ 2ZXIA 3ABUA 4BJ6C 1IRGA 3TOBA 2E7WA 2C6YA 5HNHA 3GTMJ 4KIFA 3RQIA 4E7ZA 1QNTA 2X51A 3S3MA 1SVOA 1SFXA 4AVZA 2KISA 2M30A 5ICGA 3E6CC 3CC7I 2STWA 3JTHA 2KL4A 4HF1A 3KLOA 1ZRCA 2B7EA 1F9NA 3ZQCA 3GFLA 3G4SI 3WGIA 3IL2A 2E2JJ 3TBIA 2EIKH 2UZKA 1AKHA 4B1RA 2LY1A 1B9MA 4II2A 4PJMA 4IQ4A 4JK1X 3FM5A 4A6EA 2XGCA 2ME0A 5EGOB 1TWFJ 3CMYA 4A3LJ 3V42A 3AAFA 2H8WA 2XIGA 2JSCA 2COBA 1IRXA 3CJRB 2AHQA 2KT0A 2V9VA 4FX4A 4O5VA 4C3IJ 2PX9A 1FJLA 4AD9A 4Y4RA 4Q5SF 1QHHD 2DT7B 3PM1A 4A3GJ 4IOAF 3GWZA 4F7ZA 4ZC3A 3KP6A 3WG7H 3RCOA 2KLOA 1XN7A 2W84A 1HC8A 4RS8A 3HEFA 1U2WA 3MKZA 2GIZA 4CHUA 5EGOA 5FJ8J 3ESWB 1FMVA 2RN7A 4HG2A 3M4OJ 2DTZA 2BV6A 3SZTA 3E97A 2L7KA 4PGHA 2JA2A 1WJBA 2XAUA 4KITB 3NAUA 5KCMA 2GA1A 1BR2A 1T38A 5F1RA 3BY6A 1O3TA 1QPIA 3VYSB 2Y0SA 1X1PA 3FMQA 3DU6A 1T98A 2Y0SN 4XK4A 1HLVA 4C2TA 1IDZA 2QYOA 2FNPA 1FSHA 2A5WA 3FK7A 1VQ4I 1PUFB 4KN4X 2QQAA 1PP8F 5LGUA 5L3DA 3WE2A 2HVSA 1BJZA 4DYRA 3DBRB 3G71I 5F04A 4MGRA 3WG9A 4MEXF 1FOWA 3PIPF 2GXAA 4EATA 2ACJA 1I6XA 2FJ1A 4KA4A 3LSRA 4A3CJ 2M7AA 1TQMA 2Z9OA 3MZHA 4I7HA 1ZGAA 2XKOA 3OYIA 2M5WA 3GW2A 1T8IA 3P9IA 3KZYA 1PUFA 1S72I 1BL0A 1POGA 1Z3XA 5M5WJ 4CCMA 5FLXK 2MSYA 1LDJA 4QIWN 3ZPLA 3HB9A 5DUIA 2P6TA 2OU2A 2Y69H 3LL7A 2D2WA 3BTLA 2PJRA 4IHXA 4FHTA 5HS7A 1JTYA 4UB6C 3DV8A 2CJJA 3G3ZA 1LE8A 5J1UA 3ZCOA 4WF2A 1RKTA 3HRMA 5LFAA 3HJEA 3KE2A 4PK4A 3Q5FA 1OCZH 1W0TA 1KYWA 3DF8A 2IA2A 3H3VK 4RLFA 2IW5A 1BC8C 2WWYA 4HSRA 2KIFA 2RVCA 4ITVA 1G3TA 4B3AA 4BXXJ 3K1NA 4B48A 5D4RA 3OYBA 3BJOA 4R79A 2VJ4A 4L9JA 4IRIA 4L5IA 1LVKA 1QHGA 1XDSA 2DOAA 2LBFA 2XDVA 3SXYA 1TW2A 2UXXA 2CQQA 3OYAA 4ESBA 3BR6A 4L0ZB 3RPUA 3G6EI 2PN6A 3DKYA 2E1CA 2DFEA 2EILH 4KIBA 2KZVA 3ERED 4ETSA 1UFMA 4E7LA 4AIHA 1YJ9I 1M1EB 3CJQB 2DPUA 2F5DA 4J00A 1X3WB 2EZKA 3LWFA 3QPTA 2DOEA 2V1NA 4A0XA 3F22A 1FP1D 3J80K 5E79C 2KJCA 3DP7A 5DS9A 1LEBA 3DLAA 1MZBA 4A12A 2R7SA 2UV1A 1UAAA 1DQUA 3SZPA 2FQ4A 4LIVA 4RAZA 2Z99A 3OIQA 3LA2A 4LITA 3TL4X 2IGOA 1U8BA 1Y1VJ 3TMOA 1Y6IA 2FNAA 3P5JA 4IJAA 3W6KB 4Y7NJ 3EUKL 2KIQA 3BDDA 4OMZA 3IAS2 4B43A 2ZCWA 1S3JA 4UNOA 1G4DA 2IRFG 1BN5A 3Q0UA 5M3MJ 3IRQA 2CW0F 1PYVA 2F4OB 1MBJA 3UNGC 4L18B 3T8RA 2TRTA 5JLXA 3FBNB 4BQAA 2R7DA 5AONA 2NVYJ 5JVTA 2TDXA 4G12A 2W82A 5M5YJ 5K7ZA 3RIRA 4KN7X 4DJAA 1NG6A 4U7BA 2GXBA 4UV8A 4MEYF 1Z6TA 4YFNF 1IN6A 3CZ6A 2CRGA 3PFIA 4M72A 4E7SA 1WI9A 4BJ5C 3HOYJ 3TEDA 4GFBA 2B9SA 2KZGA 4ZYHA 1BBYA 2M45A 3DBHB 1OPCA 2IS6A 2JJ7A 1SFOJ 5HLIA 5JFRA 4I76A 1BIAA 5HODA 4HRIA 2A5YB 3I71A 1ZQ3P 4CICA 3KYLA 1ZRFA 2CW7A 3OYFA 2K40A 1P6RA 1XX5A 3G1LA 4BHCA 4W1UA 5EG0A 4HLXA 5LHGA 1DPUA 5HS9A 3I55I 2HS5A 1HW2A 3MZYA 2PLYA 2A68F 3C3WA 2OZ6A 1OQYA 4UUTA 4CUGA 1X1CA 1FOYA 2DTRA 3OSGA 1MMDA 3QOEA 3KFWX 3OS0A 2R5YB 5FRMA 1OYIA 2JA6J 3ECOA 1QVTA 4AIJA 1APLC 5IT9K 3HGYA 5IYDJ 1V5EA 3GFMA 5D5UB 4E6KG 2E1MC 1P4XA 2KDZA 5ICFA 1ZR4A 1MMSA 5FLXZ 2DA1A 2NOGA 4LD5A 1CGPA 1UCRA 2M0MA 4OIOF 4MFEA 3K1PA 3CTAA 4DYCA 2AO9A 5E17F 4M3FA 4Y3OA 4JX5A 4LGWA 2JUCA 4EJTA 2GXGA 3MAJA 5D8LB 3K6GA 4Y15A 3WGGA 4XRFA 2R5YA 2JA8J 1YW8A 2LY9A 2FMYA 2IEKA 1B72A 2D5VA 3I4PA 4Z2YA 3L00A 2VE8A 2EFQA 3HUGB 2P5VA 5TISC 1HKTA 2ECCA 2L2OA 4O3MA 1YIJI 2CUEA 2JVHA 2FX0A 2VT3A 1O7FA 1MSFC 4LB5A 1U9NA 4U0YA 2DOFA 3ZMVA 5FLMJ 2HFHA 3HPHA 4XORA 5J3LA 5IOZA 3C18A 2JZYA 3RQ4A 4HQEA 4HX7A 1TNSA 2MLKA 2MGQA 3HC7A 2DCEA 3PSIA 3IC7A 2M1BA 3HUGA 4LLLA 4YRVA 2O8XA 4KDPA 5C44J 2VONA 3WTUC 3OYMA 2NS7A 4RB2C 1UHSA 2LF8A 2OC6A 4IRHA 1S7EA 3H35A 4M3EA 2WC2A 4N9HA 3PQJA 3TO6A 1R36A 4LG0A 3VFZA 4EMSA 2FXAA 5KVRA 3J80Z 4MQ9F 5EF6A 4G94A 5KHDA 5L3EA 4IOCF 4C3HJ 3HGGA 1TT5B 1HDDC 4CGZA 3R0AA 2VBYA 2D1VA 2L3DA 5EZGA 2FBIA 2GOMA 1A6IA 3EYIA 1ETXA 1K78B 2ETHA 4BE0A 1IXCA 1JUMA 1GV2A 1K6YA 1FNNA 4FASD 2E7XA 3GXOA 5F6FA 4Z6YA 1KU9A 2X6XA 5B1AH 4G7OF 2O0YA 4RAFA 1JE8A 1ZGWA 1DU0A 1R58A 4R1HA 3DEEA 2P0WA 2M3AA 1MDMB 3IKVA 2EJRA 5TRDA 1LVAA 2AXTC 1K61A 3W2AA 1FBSA 4I02A 4DZJA 1K78A 2DA5A 2IBDA 2XASA 3S3OA 2ELHA 3BC8A 2JVGA 2JA7J 4UHTA 2ELKA 1T6SA 1UHWA 2XGEA 4ON0A 2Z3YA 1YHQI 1QZEA 1MBEA 4HA8A 1G59A 2R7FA 1YJNI 1QZZA 2W24A 3MEXA 4XLFA 2XAHA 3QPLA 3S2WA 5J1YA 2LSOA 1WH5A 3DU5A 2QSFX 3NQOA 4XLCA 1YFHA 2KP6A 3KYCB 3GZ5A 2Z1DA 2XPWA 2CFOA 1XG1A 1J5YA 1ZG1A 2BZTA 1SFEA 1A36A 3JAMK 5LRRA 2DK8A 1R4MB 1X3ZB 1JGGA 4AYBA 4BQNA 2VIXA 1VF9A 3N97A 2XF5A 4XRSG 1W7PD 3R60A 1RI7A 2FUG2 2JSPA 3HRTA 4P5OA 4AYBN 4XICA 5ERIA 2DW4A 3C2BA 4TV7A 3W2VA 3CUQB 3BQYA 3FHZA 2CS3A 1IUFA 2YX7A 1XB4A 3GFIA 2VBXA 2VPLA 4BU2A 4XN3A 1OFCX 3F0CA 1PUEE 4ZTFA 1MSEC 2GA2A 4V2GA 2V1DA 4BEHB 3LA3A 1CF7B 1XGMA 1IV6A 5CYVA 3A4CA 3F8NA 2G7HA 1OYYA 2NNYA 2OV7A 4M73A 4ZZLA 1RRJA 3U21A 2QM3A 1WJFA 1RC9A 4H4KC 4I6ZA 1IGNA 2NNNA 3CDIA 2HU9A 1WH7A 5CQEA 3DPUA 1XGNA 2P4WA 3AL0B 3E6DA 3F8CA 2HZTA 3SDGA 3NRVA 4A3KJ 2CO5A 3K4MA 3CC2I 5LRSA 3B6AA 3CMAI 3ZQLA 1I27A 1KU7A 4XSZF 5E3MA 1TWCJ 1SMTA 1BI0A 2EA2A 1BA5A 1U5TC 2RV8A 2IJLA 3BZ6A 1Z67A 3F8MA 4WX9A 3J81Z 3HTUA 1WHUA 1IAWA 4HV6A 1IC8A 1DGWY 2JUGA 1RZ4A 2XF6A 2IGKA 3CJNA 3F72A 3MQ0A 4BYYA 2ISYA 5A2QZ 2OD5A 4HYEA 5L3GA 2HOEA 2V79A 2I8DA 4DZPA 3LSGA 4H0EA 2CW8A 3ONQA 3PSFA 3H1CA 2DA2A 2ECBA 1IN7A 1MNEA 2ZB9A 4RGUA 1JGSA 1VQ7I 1CQTA 2WV1A 4M3BA 4YG2F 3FIWA 2CU7A 1D0XA 3ZMSA 4OIRF 1BW6A 4V19K 1X1AA 3K2AA 2HDDA 4A93J 3B02A 1ON1A 2LOOA 5FD5A 2NS0A 3FISA 3FXKA 1R22A 4U88A 5D5VB 1VZ0A 1STZA 4HDVA 4YFKF 1X2MA 2CH0A 3L9FA 5D4SA 4AIDA 4KT6A 2IP2A 2HKOA 1JI8A 2YS9A 3MKYB 1GV5A 2EIJH 2L7MP 3NWTA 2FOWA 4EM0B 3CMMA 3BPVA 2CGPA 2XB0X 1U8RA 1XDUA 3CLQA 3PO3J 4A2UA 1B6AA 2QA4I 2DA6A 2IGNA 2VODA 1ULYA 2G0EA 3R61A 4XSXF 1DGRM 1HXDA 1S9HA 3F21A 1XCBA 4NQWA 3GTJJ 3ECHA 2WA0A 1QRYA 3OMYA 2E5ZA 2RNJA 1WGXA 3ZP5A 4X6AJ 1HW5A 4HEA2 5FKOA 3OV8A 3HRUA 1KZHA 3IWFA 2WV0A 3FK6A 1WWXA 3SEZA 1W36C 5B3SH 3H0GJ 1YOVB 2H1KA 3MFKA 1VFCA 3JSPA 3M3YJ 6PAXA 1BI3A 3CDHA 3QRFF 3I64A 1Y0UA 4F52A 2K02A 4I01A 2QQ9A 4FE7A 1JUSA 2F4MB 1JJ6C 2RNGA 2X9DA 5FFXA 3H3ZA 3E7LA 5FKKA 3H36A 1ETOA 4EM2A 1IV8A 1HSJA 4FQGA 4MHGA 4MIMA 2E1NA 5C4XJ 1FC3A 1YLFA 1WJCA 3UR3C 1R1VA 3R0JA 2LYCA 4M6YA 2K9SA 3HL2A 3N4MA 4X1EA 3JSOA 1R5GA 4EV0A 5GTIC 1ON2A 2M2EA 5BPDA 2H6CA 3RSNA 1NK3P 1SMYF 3CESA 2H1LA 2CV1A 2LF7A 2DDAA 1W36D 1SFUA 5ILVA 5J47A 2IXSA 2MFZA 4F93B 3A03A 2DI3A 3GTGJ 3R6SA 2IVMA 3TW6A 3J7ZI 3V8LA 3S93A 4RB3C 1O4XA 2BY0A 3OOUA 2OCCH 2H6BA 1F5TA 1XSXA 2M34A 2LVSA 1ETYA 2NYXA 3QP5A 4LJZF 1WJEA 1BR4A 3PNVA 3HOWJ 2LH9A 3EPZA 3OYGA 5FLVA 5HDKA 2XF7A 4GRIA 3FWEA 1J7KA 2V4JC 5EYRA 1NH3A 2RQPA 2KQRA 2WY8Q 2XGXA 3G2BA 4CO8A 4C9YA 1HW1A 4HF2A 2VOPA 1TBXA 4KT5C 2FEZA 2DT6A 5J4YA 2O8KA 4MQVA 1N25A 2F5FA 2HQ5A 1Q1VA 3G73A 1X3UA 3WTSC 1LFPA 3HSRA 3DKXA 3K69A 3TW7A 2COMA 5E1WA 2F5CA 3GVAA 2H09A 2LRDA 3BG6A 2XUBA 1D1BA 4E7IA 3DPLC 3K7AJ 4KICA 3BG5A 2DFHA 4FCYA 2CV0A 2A3SA 4JYKA 1WI3A 1UB9A 4I99C 1TWAJ 1BI1A 1V55H 2P81A 2HNHA 3CLOA 4CCJA 1VQKI 3PO2J 2IT0A 4IEJA 1UG2A 4D7NA 4NBQA 2DPDA 1MBGA 3MZ8A 1NK2P 1MBFA 3QODA 2DN0A 2GBYA 2V9KA 3O2PE 3HOUJ 4GDFA 4M9ZA 1SD7A 2LG4A 1Z3YA 2BE5F 4KFCA 2LREA 4U7DA 3I59B 3HXLA 1A35A 5LHIA 1IN4A 1DP3A 2ZNYA 1ZHFA 2GOXB 3CCQI 3D5SC 1OCPA 3LAPA 3LQRA 1S29A 2R7TA 2AQFA 3W6VA 3IRRA 3OR2C 1Y56A 1H0MA 2O9LA 3OS1A 1LJ9A 4GCVA 5GTHC 2P5KA 3T5XA 4P55A 3CCJI 1NTCA 3WU2C 3F8FA 2STTA 1KONA 4ASNA 3QYFA 3I59A 4B8XA 2W1OA 3ZN1A 5FFZA 3VDXA 3DTKA 5DM6F 2X6YA 4NC6A 5KK1A 3VODA 3GUDA 1QGPA 3ABTA 4HLYA 3ISPA 3CDLA 4A3FJ 1YS6A 3FXJA 2VLAA 3I4NJ 1H88C 3JR9A 2PJRB 2ADUA 1FSEA 1U6GA 1TTYA 2A61A 2XAQA 1LE8B 2EBIA 3D1NI 4CZZA 2IS1A 2DBBA 5DUKA 4BNCA 4A0ZA 1IZ1A 3IV5A 4FETA 2R7RA 1ACIA 3KLNA 4ZYEA 2A07F 2ESHA 3V7CA 1YO5C 2QBYA 2K9NA 1T39A 4PCQA 1ODDA 4OINF 2GLOA 2RGVA 1HQCA 2EB7A 2O61A 1MBKA 1FY7A 4E70A 4PFOA 3RYRA 2RQQA 2D45A 2HI3A 1X19A 2MLGA 3BR1A 2LBFB 5B5EC 2HQNA 2DYRH 3PFYA 3AFHA 3CUOA 4DBQA 3LMMA 1MMAA 2OTJI 1ZAOA 1A31A 3LQQA 2G9WA 2HEOA 2W7NA 2R0QC 2EV5A 2BXZA 1FBUA 1TW3A 1TL8A 3M07A 2VQGA 2EZIA 4PJNA 4DYQA 2PEXA 5C3EJ 2DA4A 2QCOA 3T1BA 2K9MA 3HSEA 1FX7A 2V1UA 3REOA 4IZZA 1E17A 2RKHA 2HQAA 2XSDC 1YRNA 2HYFA 2QQ8A 2DYSH 1X4OA 1MJ9A 4Y33A 1X2NA 3AG1H 3FXLA 3EETA 3L2RA 2HDWA 2VKVA 5F0HA 4D1QA 3OYKA 2LKPA 2KIUA 4OMYA 3M7GA 1MIJA 1TWGJ 5FRNA 2ZC2A 3OL4A 4CCKA 4XIDA 4UY8I 4HW0A 1AWCA 2XKPA 3VPRA 4I98B 2Z33A 1QQIA 2LKSA 3TDZC 2NXNB 3K70C 3ZOBA 2ZFWA 3ZN0A 4G8XA 3DBLB 4I09A 3LSPA 1IN8A 2OZUA 3DTIA 2AQEA 5CVRA 2KPMA 4FE4A 2L9NA 1C0WA 2K9QA 3IWZA 2HGCA 2RDPA 1YE9A 4XOPA 3RZDJ 3X2QH 3HSFA 4P1WA 3I53A 2QKLB 1Y8RB 4ENJA 4IHVA 4QSHA 2DAOA 4B4CA 4ZDLA 1XPXA 1FPQA 3C1DA 3NEUA 3OYDA 3DEWA 1GXQA 4WXHA 2OJED 5EG0B 1MNMC 1P92A 2CFXA 2VJ5A 4GO1A 4GYGA 2E2IJ 2R4GA 2Y2ZA 2N8GA 1FMWA 1WJDA 3K70D 5HDGA 1SVLA 4UVCA 1OR7C 2X1DA 4U0VA 2YR2A 5C4JJ 2K3FA 5D5XB 1WJAA 2BYVE 2L7ZA 1TQPA 3GTPJ 3L2VA 5DTDA 4IHTA 2Q2EB 3F23A 2O03A 4A3DJ 2XHKA 2ZJ2A 5FKMA 4A69C 4ZDOA 4J19A 3I9V2 3PQKA 1JKRC 4XL9A 3BR5A 4IPAA 3TQNA 2VXDA 1RUNA 3HM5A 1Z7UA 2R5ZB 3CP2A 1IXRC 4B09A 3BT9A 3S17J 1W4MA 2W4SA 2YX4A 2Z5UA 2MC4A 3H5NA 4JOMA 4BQOA 1P7JA 3OS2A 1XSDA 2EZLA 2XAGA 2ZXWH 1YTYA 1Y39A 1K79A 2JRTA 4XRMA 3K1MA 4BE2A 1HKSA 2LK2A 4LMYA 3FMSA 3JW4A 3D5LA 2Q2EA 3K0LA 3U1KA 4E7KA 1B72B 1OCTC 2NVQJ 2FU4A 1UJ8A 1H9TA 2R5ZA 4HOBA 3CQZJ 2ZBKA 2VQCA 1IRFA 1VQ9I 3ULQB 1VNDA 2V1XA 3HOXJ 1BC7C 5D6EA 3GO5A 2X4HA 1USTA 3WTXC 4UB8C 2BY2A 4A3MJ 3F6VA 3QAHA 3KEQA 5D6FA 1LQ1A 2HTJA 3BPXA 1GLNA 3K4JA 1I50J 1W5TA 2ICWG 1JKPC 1KA8A 2JRMA 1Y1WJ 1VQNI 1PJRA 1Z7LA 4OAZA 5JLWA 5TGTA 2XROA 1YQAA 3IH2A 2PQ8A 5BMZA 1W5SA 2VJJA 2JQ7A 1V3FA 3FM3A 4YIRX 2IAIA 3HZJA 3K10A 4ZYAA 1JT0A 2HYJA 3P7NA 2ZSHB 4CYDA 3A0BC 4HX4A 4LG0B 3AG3H 3FXQA 4ZH4F 2Z16A 5HDNA 1R5ID 1LDDA 3L1PA 2CWEA 2NRAC 4HNUA 3WTYC 1BW5A 1JKQC 3CCVI 1P4WA 2P7VB 4XBFA 3RKQA 4ESFA 2O6GE 2ZNZA 2VC1A 2DODA 1ZH5A 1DDNA 1P4AA 4NC7A 1HCRA 5J4VA 4HPQA 2GIVA 2LR8A 2WAFA 4G7HF 4IHYA 1TNTA 4WCGA 3LSIA 1EH8A 4Q4ZF 3FXRA 1MNDA 4II3A 2HPMA 1BI2A 1E2XA 1SVMA 1OR7A 1EV7A 1VQOI 1JJ8C 1XSVA 5IP6A 1MD0A 5D8KB 1OMIA 1OCOH 3CCRI 3JRIA 3KIOA 3OSFA 2DO7A 4PJLA 3RI4A 3H5RA 2E1MB 3LFUA 4IVNA 3WTZA 4EJOA 2MG4A 4UXNA 1HDPA 2XRNA 5LLQA 1J0RA 2XRLA 1WRJA 3D0SA 4A6DA 3TP3A 1FOKA 3HHHA 3WTWC 5CVIA 2EA4A 2R93J 2XV4S 2KRFA 5BQTA 5HS8A 3KZZA 4BAYA 1U3EM 2Y0MA 5M3FJ 2HYGD 3PNTA 2LDUA 2DQLA 2B63J 3KCCA 3FZVA 1EH6A 2UXNA 3S15J 3BJAA 3GYHX 1XTAA 5E20A 4D0PA 2MABA 1OKRA 3FBIB 3BLYA 3RDIA 2E71A 1BOBA 4XR6A 4BXUA 2E2HJ 4NUBA 3VYRB 1BR1A 2A6EF 4RLQA 2JK3A 2XAJA 3B6CA 5K1YA 1TC3C 3E5UA 5J40A 1VQMI 3I0TA 1FTTA 1LUJB 1XMKA 5L3CA 5DDGA 4AIKA 5HOOA 5J8CA 4P9FA 3MCZA 3SYTA 4RBOA 2HDCA 3BG7A 3SQNA 2EV6A 4RAGA 4XQFA 4XKCA 3ZXSA 4ENKA 2NVXJ 3CO7C 2I5UA 1LEAA 4ZYGA 1Z91A 5GPAA 2DMNA 5E8GA 3DCFA 4PJJA 2VUMJ 3CF5F 1BIBA 2F5VA 4C30A 3QU3A 3G1OA 1J75A 1FLIA 5ILUA 3QQAA 2DA3A 4M3DA 3WODF 1Q1HA 3S2DJ 2CYYA 4GYIA 5IT9Z 1TQIA 3GMEA 1WSUA 2DFIA 5CJ9A 5CVJA 1G3YA 2CUFA 3DTEA 2DXIA 3KP3A 2K4BA 3BROA 1FEXA 2Q0OA 1Z0XA 2QEXI 4UUSB 2WY7Q 2PJPA 1UELB 5BNGA 3V8JA 5K7HA 2VBWA 1E3PA 5CVUA 3HOTA 1IN5A 3BTCA 2PMUA 3BR0A 2OAZA 4XLAA 4RDUA 1HKQA 4C2UA 1N78A 5AIQA 4KIGA 4N4NB 2JPBA 3CD6I 2X6OA 5JI6A 4CXFA 1RNLA 4QTRA 1LFUP 2X6WA 3L2QA 1GXPA 2ZJPF 2B0LA 1W7PB 4PDKA 4CCNA 3W3CA 4RGRA 4G9YA 2BGCA 3SZGA 2VQLA 3A1YA 4L5JA 4W97A 4RM2A 3NARA 5CVVA 5FO5A 1T56A 4UUSA 2DMUA 2H8RA 3RYPA 2LKXA 3CP8A 1LDKB 2H27A 1LNWA 3EDPA 5CQGA 3PUBA 2QENA 5IYCJ 3DFGA 1P7IA 5IOYA 4PGGA 2EK5A 5LEJA 2BY3A 2G7UA 2K3PA 4ZDPA 3RKXA 4KMUX 3BCAA 4FISA 1T0FC 5KAFC 1W7PA 1EH7A 3DWLE 2PBIA 2QWWA 1S8NA 2ZMEC 3AG2H 3I5UA 2CQ7A 3S8PA 2BVMA 5JR3A 3AG4H 1RKWA 2VC0A 1RIOH 2VKEA 1O3SA 4XN0A 3OYJA 2GQQA 3TP0A 1FOXA 4PJ0C 2E34A 1FYLA 2BEOA 4IL6C 1F36A 4NQWB 5EZHA 1KQ9A 3MMYB 1ZLJA 4LFUA 1RUOA 1MJBA 2HPIA 5GAGJ 2L02A 5IP9J 4A3JJ 1K4SA 2L01A 5F0FA 3K4BA 3Q9SA 3KZIC 3GZ6A 4BH9A 1PVEA 3F3XA 2BY1A 5EEAA 1R1UA 3COAC 1QO0D 3HTSB 2X1EA 2PG4A 4XLEA 1FYMA 4HX8A 2DK5A 3FHNA 5GAHJ 3DQVC 2OTLI 2R7UA 4ENNA 2K7LA 1MH4A 3TO7A 4CA0A 4XKVA 4RM3A 1XGOA 3DKWA 4XLHA 4BBSJ 1ZR2A 2VJIA 1X1DA 2KMUA 2PMHA
chains in the Genus database with same CATH topology
2VLAA 2IS6A 4OWRB 2PJRB 2Z2SB 2R7VA 4HRIA 1R6RA 3KYLA 1YX3A 2IS1A 2CUJA 2CW7A 3OYFA 3IUOA 4BACA 2MD0A 2R7RA 4FETA 3SEQA 4BXFA 5KNLA 4IQJA 1UG0A 1SAUA 2E5NA 2LY2A 4CUGA 4XMYA 1X1CA 1Z21A 3MD2A 1MMDA 3QOEA 3OS0A 1OLTA 5FRMA 4PFOA 2IS4A 2BW3B 3FKJA 2RQQA 1X19A 2A6TA 4AU7A 1E0EA 2LBFB 1V5EA 4E6KG 4D9JA 2E1MC 4PFPA 2VASA 3PFYA 3AFHA 4DBQA 3LMMA 1MMAA 4BS9A 2M0MA 2KMUA 4CZCA 2W7NA 4Y3OA 1G8XA 4NNJA 3K6GA 2W00A 4F55A 2BW3A 5JHFA 3ZR8X 3EUHC 2M4GA 2VQGA 3CF2A 4PJNA 4CSWA 4HNTA 4CH7A 2K9MA 3I3LA 3HG9A 4BJTA 2XSJC 2L5QA 4IZZA 2BVLA 2CUZA 2HQAA 4BDYA 2V26A 3HUGB 1HA8A 3HPGA 2L2OA 2JVHA 4X0GA 1X4OA 3PL8A 4KJZA 4Y33A 4DOZA 1TZLA 2HDWA 3L2RA 3OR1C 4D1QA 3OYHA 3OYKA 3HPHA 4XORA 1X1BA 5FRNA 3OL4A 4XNFA 2BOLA 4BEHA 2L9SA 3ZQQA 4CCKA 3RQ4A 1T95A 3L2UA 3HC7A 2DCEA 3K70C 3PSIA 1SFKA 1WFXA 4YELA 4YRVA 5CKTA 3OYMA 3ZRGA 3BCBA 3DTIA 2AQEA 2KPMA 2OC6A 2L9NA 3H35A 4KISA 1YE9A 4XOPA 4F91B 4BGDA 4P1WA 2QKLB 5KHDA 1EA3A 2R7XA 3OYCA 3OYLA 4ZDLA 4XONA 1YX5A 3OYDA 4YEJA 3DPTA 2GOMA 4BE1A 4F3QA 4BE0A 2RREA 2CV2A 4N4OB 2PMZA 1K6YA 3C2GA 4FASD 3W2WA 2Q1ZB 3K4LA 2R7WA 2VJ5A 2V6EA 2X6XA 2V7FA 2R4GA 2WAQA 3K4CA 3M8JA 1FMWA 1AA7A 1WJDA 3K70D 2HVQA 3HKZA 1MMNA 1QU3A 1OR7C 2X1DA 3DEEA 2P0WA 2M3AA 1WJAA 3E1SA 2E60A 3L2VA 2KHMA 2VKHA 3W2AA 3K4NA 2HZDA 3MKWB 2Q2EB 1ZELA 3H9GA 4ZDOA 3I9V2 3S3OA 4XL9A 3BC8A 2VXDA 2JVGA 2LC2A 2IGMA 4XOTA 3CP2A 4QPQA 2NOJB 4BQQA 2W4SA 3ZGKA 1G59A 2MC4A 3H5NA 4JOMA 4XLFA 4BQOA 3OS2A 2MYSA 3RPUD 3DU5A 4XLCA 4E7JA 2KP6A 4BE2A 4OAYA 3QYBA 2M4KA 1MW7A 3D5LA 4HSTA 2Z1DA 2R7QA 3SDBA 3HOSA 4E7KA 1ERDA 1X4PA 2VKDA 3A2KA 2CFOA 2X1CA 4RMNA 3S3NA 2R7OA 3K4KA 4XM3A 4AYBA 1U0JA 3C2HA 2VIXA 2VQCA 4BQNA 2XF5A 4IKFA 2JSPA 2FUG2 1D0ZA 4P5OA 4DBRA 3W2VA 4PSXA 2CS3A 2VPLA 4BU2A 3J7AY 3EUAA 4XN3A 3LSKA 2VQHA 2X85A 1GLNA 4ZTFA 2F4IA 3K4JA 1N77A 2O5RA 4BEHB 3H5AA 3H9QA 3A4CA 1PJRA 3QYEA 3PJRA 2OV7A 2ELJA 1Z7LA 4OAZA 3U21A 5TGTA 2F6CA 1WJFA 4H4KC 2WB1A 3L2QA 3OYEA 3H9JA 3RTRA 3AKZA 2HU9A 2VJJA 4BDZA 3OY9A 5CQEA 3DPUA 3K10A 2KDOA 4ZYAA 3AL0B 2ZXIA 2ZSHB 4BJ6C 3K4MA 5HNHA 5HLTA 2Z16A 3F9KA 4E7ZA 3S3MA 2X51A 4AVZA 4PUSA 4CCLA 4B47A 2KL4A 4HNUA 2UUZA 2VB6A 3IAM2 4QPOA 3TBIA 4NC7A 1DGWY 2JUGA 2LY1A 2XF6A 4HPQA 4II2A 2IGKA 2ZSIB 4PJMA 2HVRA 4IQ4A 2WAFA 3LSIA 2I8DA 3LSGA 1MNDA 4II3A 3V42A 2HPMA 1P9QC 2OUMA 2CW8A 3ONQA 3PSFA 1D0YA 1IRXA 3CJRB 1MNEA 1NG7A 2KRHA 1D0XA 1WJ5A 4Y4RA 1QHHD 1X1AA 2ZFUA 4PJLA 2DT7B 3H5RA 2LOOA 2E1MB 3LFUA 4ZC3A 3RCOA 2KLOA 4BUPA 1VZ0A 4DGWB 4B3XA 2CH0A 5HNFA 3MKZA 4KT6A 3GBGA 2XC7A 1JI8A 3MKYB 1LKXA 1FMVA 4HG2A 3NWTA 2L7KA 3CMMA 3VSLA 2JA2A 3NWSA 2WAEA 1WJBA 2XAUA 4KITB 3PNTA 2K9LA 3LSMA 5KCMA 1BR2A 2IGNA 1DGRM 2MABA 1S9HA 3VYSB 2Y0SA 3FBIB 3BLYA 2WADA 3IP4B 3DU6A 1BOBA 4J01A 2WA0A 3OMYA 4XR6A 2E5ZA 3OWTA 4NUBA 3VYRB 4C2TA 1BR1A 2KRCA 4RLQA 2A5WA 4HEA2 3E0JB 3VWBA 2HVSA 1N75A 3SEZA 1W36C 1V5GA 2ZXHA 5HOOA 3L2WA 3SYTA 3D5RC 3KEYA 3BG7A 4F52A 4EATA 4XQFA 4XKCA 3ZXSA 1D1AA 3VYTB 2M7AA 2RNGA 3OYNA 4PJJA 3OYIA 2F5VA 4C30A 1Z3XA 4CCMA 3OIPA 1WJCA 3UR3C 2LYCA 5HVQC 3FDYA 3HL2A 3LL7A 2PJRA 3DTEA 2DXIA 4IX7A 3RSNA 3CESA 3ZCOA 2CV1A 5LFAA 4PK4A 2WY7Q 1W36D 1UELB 4RLFA 2IXSA 2MFZA 4F93B 4ZTJA 3PNYA 3H0DA 4HSRA 4ITVA 5CPRB 3HOTA 3S93A 4B48A 2WBMA 3OYBA 3OOUA 1D1CA 4R79A 2VJ4A 4XLAA 1N78A 4C2UA 1V5FA 4N4NB 1WJEA 1LVKA 1BR4A 1QHGA 2DOAA 3EPZA 2DJIA 2LBFA 2LH9A 2X6WA 3PNVA 4G6TB 2XDVA 4ANJA 3OYGA 4CCNA 3W3CA 3SZGA 2XF7A 2VQLA 4GRIA 1MMGA 3A1YA 2V4JC 3OYAA 4RM2A 2WY8Q 2KQRA 3G2BA 4LG3A 4C9YA 3DKYA 1TT0A 2UWMA 2KZVA 4E7LA 3CP8A 1LDKB 2DT6A 2K5CA 3CJQB 4NC8A 5CQGA 3PUBA 4J00A 3VYUB 1LFPA 4XKBA 3DKXA 2V1NA 3S32A 4B44A 2K3PA 4LIUA 4ZDPA 3BCAA 1T0FC 4CCOA 2LRDA 3BG6A 3DWLE 3DLAA 1D1BA 5FROA 4E7IA 3DPLC 2CV0A 2UV1A 1UAAA 1DQUA 2R7SA 3S8PA 2BVMA 4LIVA 3N05A 3VSKA 3OIQA 4LITA 3TL4X 4CCJA 2IGOA 4XN0A 2HNHA 4MLOA 3TMOA 3OYJA 3KX2A 1Y6IA 4ZJZA 4DIQA 3EUKL 4NQWB 3OL3A 2QKMB 3MMYB 3QODA 2VXZA 4U87A 2V9KA 3IAS2 3LSHA 4B43A 2HPIA 2LG4A 1Z3YA 2CMPA 2LREA 3HXLA 1PYVA 5LD2C 3K4BA 3UNGC 1DP3A 4PSWA 2GOXB 3D5SC 3FBNB 2IS2A 2R7TA 4BL0B 2AQFA 4XKWA 2W82A 2X1EA 1Y56A 3OR2C 3M1CA 2M7BA 4XLEA 3OS1A 3FHNA 2VL8A 4E4HA 4JQFA 4F92B 3DQVC 4DJAA 1NG6A 2R7UA 4U7BA 4CA0A 4XKVA 4E7HA 3CZ6A 4E7SA 1J09A 1KONA 4RM3A 4BJ5C 4XLHA 3QYFA 2W1OA 3AL0C 2VJIA 3VDXA 1X1DA 3DTKA 2X6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRC A;  4NC7 A;  2M4K A;  4NC8 A; 
#chains in the Genus database with same CATH topology
 1W0U A;  4EM1 A;  2DMT A;  1VQL I;  3JRC A;  1YIO A;  2BXY A;  2Z2S B;  5J6X A;  2R7V A;  1U5T B;  2ESN A;  3M1E A;  4IF4 A;  1VI0 A;  1ZTR A;  1OYW A;  1SD4 A;  3P9K A;  4NDL A;  1VQP I;  1R6R A;  1SAN A;  1I39 A;  1FP2 A;  4AM3 A;  3QPS A;  3IUO A;  1QZY A;  4BAC A;  1X58 A;  2VBZ A;  1WKM A;  3SEQ A;  1S6L A;  3Q3S A;  4BXF A;  1ETW A;  5KNL A;  5DYM A;  2E36 A;  4IQJ A;  1ZLK A;  1LFB A;  2E5N A;  2LY2 A;  3TKY A;  2ID3 A;  2LLK A;  4XMY A;  2DLL A;  4GXO A;  1Z21 A;  3QP6 A;  4DNC A;  2ZXJ A;  1OLT A;  2VI6 A;  4I0B A;  2BW3 B;  3ZQF A;  3ZMU A;  1U5T A;  4AU7 A;  5B1B H;  1XD7 A;  3BP8 A;  3MN2 A;  3UKG A;  3S2H J;  4D9J A;  3JAM Z;  4D5F A;  2VAS A;  1HF0 A;  2KJB A;  4MTD A;  2EH3 A;  2HXI A;  3E3V A;  2JPC A;  5LBQ A;  2K4J A;  4CZC A;  3VOE A;  4A3B J;  2NS8 A;  3ZQI A;  2EIN H;  4NNJ A;  3TDU C;  2MD5 A;  1T0F A;  3BOQ A;  3ZMD A;  1WQ2 A;  2BW3 A;  2ZME A;  2FF4 A;  3EUH C;  3LNQ A;  2M4G A;  2NVT J;  2DU9 A;  3CF2 A;  1I1G A;  3LSJ A;  1R4N B;  1ZAR A;  5GAE J;  4L9V A;  3ABM H;  5H2F C;  2LFB A;  4C2M J;  4N0B A;  1FZP B;  3LOC A;  2K85 A;  3CCM I;  3U1D A;  2IA1 A;  2V26 A;  1R1T A;  1HA8 A;  2WB1 N;  4A0Y A;  4X0G A;  1D8K A;  4RB1 A;  1RES A;  2A6H F;  3K2Z A;  3KP2 A;  9ANT A;  1KYZ A;  4KJZ A;  4A5N A;  4DOZ A;  2FRH A;  1TZL A;  3OR1 C;  2QUF A;  4MTE A;  5TJJ A;  3HRS A;  5BPI A;  1X1B A;  4LLN A;  4HNV A;  2TCT A;  2OF7 A;  2L9S A;  1B4A A;  4M71 A;  2Y9Z A;  5L3F A;  1TLH B;  1D5Y A;  1T95 A;  2E35 A;  2Y48 A;  2FBH A;  4L9N A;  4KYW A;  2O3F A;  2QSG X;  1WFX A;  2M8G X;  2Y30 A;  3ZQ7 A;  3A0H C;  1YS7 A;  1JHH A;  5DD8 A;  3BCB A;  4M3G A;  1UZC A;  3GTQ J;  1SD6 A;  5E18 F;  1IUY A;  2DT5 A;  4KIS A;  3RKY A;  1XMA A;  1VTN C;  4F91 B;  3TGN A;  5HLG A;  2MC3 A;  2L4M A;  2FML A;  1E3H A;  3OYC A;  2FD5 A;  2M87 A;  3HOV J;  2LP0 A;  2M0C A;  2P6S A;  2L7F P;  4ABZ A;  1HOM A;  3LFK A;  3WTV C;  4EGY A;  4YEJ A;  3KP5 A;  1G3W A;  1R5H A;  4BE1 A;  4L5E A;  4F3Q A;  2CQX A;  3TOA A;  3CCE I;  1REP C;  2PMZ A;  5GPC A;  4EJV A;  4NB5 A;  4WXC A;  3W2W A;  4A3I J;  2HOS A;  2PMZ N;  5LEK A;  1ZYR F;  2JN6 A;  3K4L A;  5D5W B;  1ONV A;  1E3O C;  2V6E A;  2V7F A;  1FWZ A;  3RKW A;  2KFD A;  2X0L A;  3J7Y J;  1LPQ A;  2QBY B;  4BY1 J;  1YJW I;  1AA7 A;  3EQL F;  3O3K A;  1QU3 A;  1G3S A;  1DPR A;  3E1S A;  1EF4 A;  2E60 A;  2KHM A;  2VKH A;  2VPR A;  4C3J J;  1ZG5 A;  1H8A C;  2J5O A;  5KAI C;  2V9P A;  2XVC A;  3CME I;  2IGM A;  2ZKZ A;  4XOT A;  4M6X A;  3GLL A;  4QPQ A;  1FBQ A;  1K4T A;  4LK0 F;  3Q0W A;  4BQQ A;  3JRA A;  2XGD A;  3L7W A;  5F08 A;  3I4M J;  5K7F A;  4JP0 A;  4WK8 F;  4RB0 A;  3EUH A;  2MYS A;  1VQ5 I;  3RPU D;  3W6J B;  3H92 A;  1BOA A;  4LB6 B;  3JRF A;  1ETQ A;  2H94 A;  3QYB A;  2HKX A;  2M4K A;  1MW7 A;  2L0K A;  1QPM A;  3SDB A;  3HOS A;  1Z1D A;  3T8T A;  3I56 I;  1X4P A;  1I3Q J;  5IT3 A;  1IF1 A;  3A2K A;  3S1M J;  2W85 A;  3CCY A;  4JX6 A;  4RMN A;  3S3N A;  2QZ8 A;  1J59 A;  3ABK H;  5K5R A;  1ZGJ A;  3GLX A;  3C2H A;  1R00 A;  5K5O A;  1GHC A;  4IKF A;  1YRN B;  1D0Z A;  2PI0 A;  4DBR A;  1V54 H;  5ICE A;  2KKO A;  3J7A O;  3HYI A;  3BJ6 A;  4QWQ A;  2NVU B;  2F5E A;  4WWC A;  2WTE A;  4O6J A;  3EUA A;  1RPW A;  3KP4 A;  3LSK A;  5H6R A;  2P8T A;  4JBA A;  5LGN A;  2VQH A;  2X85 A;  2F4I A;  2DJN A;  1QA6 A;  2O5R A;  3H5A A;  2ME6 A;  1SC7 A;  3PJR A;  3QYE A;  3ASO H;  2OQR A;  2DDB A;  4YII A;  1SD5 A;  2ELJ A;  1ZRD A;  2F6C A;  1G6N A;  4UVA A;  4MFD A;  1OIS A;  2AXL A;  3E5X A;  4HBL A;  3H9J A;  3RTR A;  4S04 A;  1WZ2 A;  4BDZ A;  4L0Y B;  4UUV A;  2HOA A;  1OCC H;  3HBL A;  3IKT A;  1B59 A;  3BQZ A;  5H20 A;  3RPQ A;  4BKX A;  4EJW A;  1UHM A;  4GGG A;  3ZQG A;  5FD6 A;  2OQG A;  5B66 C;  3FXM A;  5HLT A;  3F9K A;  5FGM A;  3KP7 A;  5E1X A;  2I10 A;  4PUS A;  4CCL A;  4B47 A;  1PDN C;  2L9V A;  2UUZ A;  1FT9 A;  2GAU A;  3CO6 C;  1KU2 A;  2FA5 A;  5K5Q A;  2VB6 A;  3IAM 2;  5E3N A;  4QPO A;  1H89 C;  3SFZ A;  1USS A;  3B73 A;  3DXJ F;  3M8E A;  5E3O A;  4OIQ F;  2YUS A;  2ZSI B;  2HVR A;  3GF2 A;  2MA3 A;  5DEQ A;  2OBP A;  4M9X A;  1GVD A;  1G2H A;  3FXU A;  4Y17 A;  4OOI A;  3S14 J;  1P9Q C;  2OUM A;  4UVB A;  1D0Y A;  1I6H J;  1NG7 A;  2DQR A;  4KNY A;  2KRH A;  1WJ5 A;  4IRG A;  4PZJ A;  4IHS A;  2ZFU A;  3IH3 A;  5IYB J;  4P9U A;  2MBF A;  5HLH A;  1BM9 A;  1KQ0 A;  1AHD P;  1UMQ A;  1SEU A;  4M74 A;  4V2F A;  4BUP A;  3LST A;  2R7Z J;  4IXA A;  2HR3 A;  5IPA A;  4EEF G;  4DGW B;  3O8G A;  4B3X A;  5HNF A;  3GBG A;  2XC7 A;  1MGT A;  1LKX A;  1XGS A;  5AIP A;  3VSL A;  1P2F A;  2CQN A;  3NWS A;  2WAE A;  4DW6 A;  5EDN A;  2K9L A;  3LSM A;  1QBJ A;  3ERM A;  2FQ3 A;  2LMD A;  2VOO A;  1D3Y A;  3V4G A;  2WAD A;  3IP4 B;  2EFO A;  4J01 A;  1KGS A;  3OWT A;  1I3A A;  1A6Q A;  2LD5 A;  1ZRE A;  3U2R A;  2KRC A;  1SAX A;  3GCM A;  2ISZ A;  5DCM B;  4NHJ A;  3KEO A;  3E0J B;  1GT0 C;  2BBY A;  3VWB A;  1B9N A;  3MKL A;  3F8B A;  3CJT B;  1MJA A;  1N75 A;  2JT1 A;  4S05 A;  1V5G A;  2ZXH A;  3L2W A;  2GWR A;  4EGZ A;  2JA5 J;  4OIP F;  5E8I A;  2NAZ A;  3D5R C;  3KEY A;  2F48 A;  1WPK A;  4JX4 A;  4FX0 A;  2CSO A;  1K7A A;  3RJP A;  1D1A A;  1O3Q A;  3VYT B;  5LGT A;  1JTX A;  3OYN A;  4HQM A;  2Y75 A;  5DCF A;  5E1Z B;  3WTT C;  1FYK A;  1YIT I;  5DCM A;  1YG2 A;  4A3E J;  3IH4 A;  3MWM A;  1O57 A;  2FOK A;  3ASN H;  5ICC A;  3OIP A;  3V7S A;  1IRZ A;  5GP9 A;  1MH3 A;  2W57 A;  2K27 A;  3BZC A;  3R4K A;  5HVQ C;  3FDY A;  1U78 A;  4G6D A;  4K2E A;  3JRD A;  1T2K A;  1JT6 A;  3P9C A;  4IX7 A;  1R7J A;  2CG4 A;  2DA7 A;  3U9G A;  4DQ2 A;  4I2O A;  1ZN2 A;  3HIF A;  4U0W A;  4OU0 A;  1XS9 A;  1EKE A;  3L09 A;  3WE3 A;  4ZTJ A;  4Q47 A;  5F64 A;  3S1R J;  3PNY A;  5H6Q A;  3H0D A;  1ITY A;  1R23 A;  3FMR A;  5JHU A;  5CPR B;  3CCS I;  1Z05 A;  1I5Z A;  2WBM A;  2L4A A;  1D1C A;  3ROU A;  1Z9C A;  2GM4 A;  5IY5 H;  1V5F A;  2Q8K A;  4G6T B;  2DJI A;  2JMW A;  5E3L A;  3DEU A;  4ANJ A;  4RGX A;  2VT2 A;  2A05 A;  3WHC A;  2M8E A;  4G6Q A;  1D8J A;  1MMG A;  1IG7 A;  3M9A A;  4LG3 A;  1IDY A;  4LLG F;  3J81 K;  3OOP A;  1TT0 A;  2UWM A;  4ZZD A;  2EFN A;  1FTZ A;  2K5C A;  4NC8 A;  3VYU B;  1IJW C;  4RAY A;  5A2Q K;  4XKB A;  1GUU A;  4WXD A;  4LK1 F;  4S0H B;  5ED4 A;  3S32 A;  4B44 A;  1DUX C;  4LIU A;  1RR7 A;  3KYD B;  4XLN F;  4RGS A;  5F1J A;  4KMF A;  3L2C A;  1MKM A;  1YW7 A;  1JUP A;  4CCO A;  5FRO A;  2FE3 A;  5DV5 A;  3HOZ J;  3VSK A;  3N05 A;  5J8F A;  3K9T A;  4MLO A;  3LAJ A;  3TO9 A;  3KX2 A;  3GEZ A;  3KPH A;  2JWT A;  3GTO J;  2V6C A;  2W48 A;  4ZJZ A;  4DIQ A;  3OL3 A;  2QKM B;  1TP4 A;  3GX4 X;  4I0A A;  2VXZ A;  4CYC B;  4U87 A;  3BTI A;  3WGH A;  3LSH A;  2EFW A;  3WU0 A;  2CMP A;  3CUQ C;  5LD2 C;  1NHA A;  3S1Q J;  4BY7 J;  3FF5 A;  4PSW A;  2GZW A;  2MH9 A;  2R92 J;  1AOY A;  3PUF A;  5M5X J;  3FX3 A;  2XB5 A;  2IS2 A;  5BS6 A;  4BL0 B;  1ETK A;  2HTS A;  4XKW A;  3C7J A;  3VB2 A;  4AWX B;  3M1C A;  2M7B A;  4IO9 F;  1T33 A;  2FSW A;  2VL8 A;  4E4H A;  1OJL A;  4JQF A;  4F92 B;  4ESJ A;  3QU6 A;  5DD4 A;  4CDG A;  4CYC A;  1JXS A;  1Y8Q B;  4E7H A;  2L54 A;  1K6O A;  1J09 A;  1Y0N A;  1KU3 A;  3GFJ A;  1R71 A;  3AL0 C;  3VEP A;  5EEH A;  2EQR A;  3BTJ A;  2X48 A;  4BHP A;  2HOT A;  1FIA A;  4OWR B;  3OIO A;  3JRB A;  4HV5 A;  1YW9 A;  2O7O A;  1IO2 A;  1ZKG A;  3PIO F;  3ZMT A;  2ZJQ F;  2VN2 A;  1YX3 A;  2CQK A;  3A01 B;  3IHU A;  2CUJ A;  4HAM A;  1XMX A;  1JKO C;  1MBH A;  3BG3 A;  3MVP A;  1W5C C;  2MD0 A;  4YFX F;  5FB2 A;  2QLZ A;  3BWG A;  2YPR A;  3I58 A;  4Y13 A;  2E19 A;  3M8F A;  4G7Z F;  5FKL A;  4FTH A;  4L9T A;  1UG0 A;  1SAU A;  2P7C B;  2YSR A;  1S5L C;  2LNB A;  4RA2 A;  2HWV A;  3MD2 A;  1MDM A;  1OCR H;  2KIM A;  1HST A;  3FKJ A;  4MNU A;  2IS4 A;  3LA7 A;  2RC4 A;  2A6T A;  1ENH A;  1E0E A;  3Q0V A;  1GDT A;  4A5M A;  4ZYD A;  2EZH A;  3CCU I;  2Y9Y A;  3A01 A;  4PFP A;  2BHY A;  4XLP F;  4BBR J;  1L3L A;  4BS9 A;  2P5L C;  2XAF A;  4YIF A;  1W1W E;  3SJM A;  2DFF A;  3F6O A;  1R49 A;  3FKI J;  2HQR A;  1G8X A;  2ZO4 A;  2W00 A;  3FXO A;  4HZF A;  4F55 A;  1Z6R A;  5DM7 F;  5JHF A;  3CCL I;  1S7A A;  3ZR8 X;  4ENM A;  3JRG A;  4Q48 A;  5BOX A;  4P96 A;  4CSW A;  4HNT A;  4XRS A;  4CH7 A;  1DP7 P;  3I3L A;  3HG9 A;  4BJT A;  2XSJ C;  3CC4 I;  2L5Q A;  2BVL A;  2CUZ A;  3S1N J;  1RR8 C;  5IP7 J;  4BDY A;  1U9O A;  2EIM H;  3HPG A;  1VQ8 I;  3CUQ A;  3PL8 A;  3WU1 B;  2Y31 A;  1HBX G;  4AC0 A;  4HDU A;  1O3R A;  3ABL H;  3OYH A;  5EJC A;  3RZO J;  3E6B A;  3QPH A;  1KQ8 A;  1L0O C;  3ELK A;  2IPQ X;  2OPT A;  4XNF A;  2BOL A;  4BEH A;  3E5Q A;  3ZQQ A;  1K83 J;  1CF7 A;  1D5V A;  4EQQ A;  3KET A;  2J5P A;  4Y52 J;  2LTP A;  2QVO A;  3L2U A;  1SFK A;  4YEL A;  1IW7 F;  1V4R A;  5CKT A;  3O8H A;  4AUX A;  3ZRG A;  3GTL J;  1LB2 A;  2QF7 A;  1AU7 A;  3JRH A;  5FKN A;  1R9T J;  5J1R A;  4FT8 A;  2QGU A;  4R8H A;  1PP7 U;  2W25 A;  3JCU C;  4BGD A;  4M6V A;  2JTV A;  1EA3 A;  2M9H A;  4HF0 A;  2R7X A;  1WCM J;  2F2E A;  1WVR A;  3V7R A;  3QWL A;  2A69 F;  3OYL A;  4XON A;  3QOP A;  1YX5 A;  2EV0 A;  2EFP A;  4M9S A;  1YYV A;  2D1H A;  3BG9 A;  3DPT A;  4D5C A;  1FIP A;  1TWH J;  3Q9V A;  2IA0 A;  1A04 A;  2RRE A;  2CV2 A;  4N4O B;  3C2G A;  1B1B A;  1H9G A;  2Q1Z B;  4D7M A;  2HXO A;  2R7W A;  2E1O A;  3BR2 A;  2VE9 A;  2WAQ A;  3K4C A;  3M8J A;  1JHF A;  1YI2 I;  2HVQ A;  3HKZ A;  3O6B B;  2WAQ N;  4QLC U;  5JVG F;  1MMN A;  2L9R A;  1T08 B;  2PFB A;  5F27 A;  2K86 A;  3HKZ N;  1ZK8 A;  5GAD J;  1F43 A;  3S16 J;  3K4N A;  2HZD A;  3MKW B;  1J2X A;  2YU9 J;  1ZG3 A;  3E6M A;  3V8K A;  1ZEL A;  3H9G A;  2YU3 A;  2R3S A;  4LOC A;  4KUM A;  1B8I B;  5EEG A;  3DLL F;  1J9I A;  2EWN A;  1A5J A;  2LC2 A;  3ZMZ A;  1RET A;  4IHW A;  3HHG A;  2NOJ B;  3G1M A;  5ILS A;  1Z77 A;  4AVP A;  4MO7 A;  3ZGK A;  2FBK A;  2ID6 A;  1BJA A;  3JRE A;  2QQB A;  1S7O A;  3BZK A;  4E7J A;  1XC5 A;  2MH2 A;  3SHF A;  2ZME B;  4OAY A;  2DMQ A;  1ETV A;  4HST A;  1I1S A;  3JTG A;  2R7Q A;  1ERD A;  2VKD A;  1O7L A;  1B8I A;  3BR3 A;  2X1C A;  1VQ6 I;  2R7O A;  5F0C A;  4EJU A;  3K4K A;  4BHB A;  4XM3 A;  3ZQH A;  1U0J A;  1DU6 A;  2XPV A;  3GZN B;  2DMP A;  1F1Z A;  4PSX A;  4EVI A;  3A02 A;  2BHZ A;  3J7A Y;  2XPU A;  1ORK A;  3I54 A;  3EYY A;  3ML6 A;  4UV9 A;  2AS5 F;  1F4K A;  3T0Y A;  1N77 A;  1IXS B;  3H9Q A;  4N9I A;  2QSH X;  2OCE A;  5LHH A;  2EPF A;  2RAE A;  1QVU A;  5L3B A;  3SFI A;  5CLS A;  2MW8 A;  2WB1 A;  1AKH B;  3OYE A;  3AKZ A;  1GVJ A;  3WHB A;  2OA4 A;  3OY9 A;  2ZJR F;  3H3U A;  1XCV A;  2KDO A;  1EJ9 A;  3HDD A;  3GTK J;  2ZXI A;  3ABU A;  4BJ6 C;  1IRG A;  3TOB A;  2E7W A;  2C6Y A;  5HNH A;  3GTM J;  4KIF A;  3RQI A;  4E7Z A;  1QNT A;  2X51 A;  3S3M A;  1SVO A;  1SFX A;  4AVZ A;  2KIS A;  2M30 A;  5ICG A;  3E6C C;  3CC7 I;  2STW A;  3JTH A;  2KL4 A;  4HF1 A;  3KLO A;  1ZRC A;  2B7E A;  1F9N A;  3ZQC A;  3GFL A;  3G4S I;  3WGI A;  3IL2 A;  2E2J J;  3TBI A;  2EIK H;  2UZK A;  1AKH A;  4B1R A;  2LY1 A;  1B9M A;  4II2 A;  4PJM A;  4IQ4 A;  4JK1 X;  3FM5 A;  4A6E A;  2XGC A;  2ME0 A;  5EGO B;  1TWF J;  3CMY A;  4A3L J;  3V42 A;  3AAF A;  2H8W A;  2XIG A;  2JSC A;  2COB A;  1IRX A;  3CJR B;  2AHQ A;  2KT0 A;  2V9V A;  4FX4 A;  4O5V A;  4C3I J;  2PX9 A;  1FJL A;  4AD9 A;  4Y4R A;  4Q5S F;  1QHH D;  2DT7 B;  3PM1 A;  4A3G J;  4IOA F;  3GWZ A;  4F7Z A;  4ZC3 A;  3KP6 A;  3WG7 H;  3RCO A;  2KLO A;  1XN7 A;  2W84 A;  1HC8 A;  4RS8 A;  3HEF A;  1U2W A;  3MKZ A;  2GIZ A;  4CHU A;  5EGO A;  5FJ8 J;  3ESW B;  1FMV A;  2RN7 A;  4HG2 A;  3M4O J;  2DTZ A;  2BV6 A;  3SZT A;  3E97 A;  2L7K A;  4PGH A;  2JA2 A;  1WJB A;  2XAU A;  4KIT B;  3NAU A;  5KCM A;  2GA1 A;  1BR2 A;  1T38 A;  5F1R A;  3BY6 A;  1O3T A;  1QPI A;  3VYS B;  2Y0S A;  1X1P A;  3FMQ A;  3DU6 A;  1T98 A;  2Y0S N;  4XK4 A;  1HLV A;  4C2T A;  1IDZ A;  2QYO A;  2FNP A;  1FSH A;  2A5W A;  3FK7 A;  1VQ4 I;  1PUF B;  4KN4 X;  2QQA A;  1PP8 F;  5LGU A;  5L3D A;  3WE2 A;  2HVS A;  1BJZ A;  4DYR A;  3DBR B;  3G71 I;  5F04 A;  4MGR A;  3WG9 A;  4MEX F;  1FOW A;  3PIP F;  2GXA A;  4EAT A;  2ACJ A;  1I6X A;  2FJ1 A;  4KA4 A;  3LSR A;  4A3C J;  2M7A A;  1TQM A;  2Z9O A;  3MZH A;  4I7H A;  1ZGA A;  2XKO A;  3OYI A;  2M5W A;  3GW2 A;  1T8I A;  3P9I A;  3KZY A;  1PUF A;  1S72 I;  1BL0 A;  1POG A;  1Z3X A;  5M5W J;  4CCM A;  5FLX K;  2MSY A;  1LDJ A;  4QIW N;  3ZPL A;  3HB9 A;  5DUI A;  2P6T A;  2OU2 A;  2Y69 H;  3LL7 A;  2D2W A;  3BTL A;  2PJR A;  4IHX A;  4FHT A;  5HS7 A;  1JTY A;  4UB6 C;  3DV8 A;  2CJJ A;  3G3Z A;  1LE8 A;  5J1U A;  3ZCO A;  4WF2 A;  1RKT A;  3HRM A;  5LFA A;  3HJE A;  3KE2 A;  4PK4 A;  3Q5F A;  1OCZ H;  1W0T A;  1KYW A;  3DF8 A;  2IA2 A;  3H3V K;  4RLF A;  2IW5 A;  1BC8 C;  2WWY A;  4HSR A;  2KIF A;  2RVC A;  4ITV A;  1G3T A;  4B3A A;  4BXX J;  3K1N A;  4B48 A;  5D4R A;  3OYB A;  3BJO A;  4R79 A;  2VJ4 A;  4L9J A;  4IRI A;  4L5I A;  1LVK A;  1QHG A;  1XDS A;  2DOA A;  2LBF A;  2XDV A;  3SXY A;  1TW2 A;  2UXX A;  2CQQ A;  3OYA A;  4ESB A;  3BR6 A;  4L0Z B;  3RPU A;  3G6E I;  2PN6 A;  3DKY A;  2E1C A;  2DFE A;  2EIL H;  4KIB A;  2KZV A;  3ERE D;  4ETS A;  1UFM A;  4E7L A;  4AIH A;  1YJ9 I;  1M1E B;  3CJQ B;  2DPU A;  2F5D A;  4J00 A;  1X3W B;  2EZK A;  3LWF A;  3QPT A;  2DOE A;  2V1N A;  4A0X A;  3F22 A;  1FP1 D;  3J80 K;  5E79 C;  2KJC A;  3DP7 A;  5DS9 A;  1LEB A;  3DLA A;  1MZB A;  4A12 A;  2R7S A;  2UV1 A;  1UAA A;  1DQU A;  3SZP A;  2FQ4 A;  4LIV A;  4RAZ A;  2Z99 A;  3OIQ A;  3LA2 A;  4LIT A;  3TL4 X;  2IGO A;  1U8B A;  1Y1V J;  3TMO A;  1Y6I A;  2FNA A;  3P5J A;  4IJA A;  3W6K B;  4Y7N J;  3EUK L;  2KIQ A;  3BDD A;  4OMZ A;  3IAS 2;  4B43 A;  2ZCW A;  1S3J A;  4UNO A;  1G4D A;  2IRF G;  1BN5 A;  3Q0U A;  5M3M J;  3IRQ A;  2CW0 F;  1PYV A;  2F4O B;  1MBJ A;  3UNG C;  4L18 B;  3T8R A;  2TRT A;  5JLX A;  3FBN B;  4BQA A;  2R7D A;  5AON A;  2NVY J;  5JVT A;  2TDX A;  4G12 A;  2W82 A;  5M5Y J;  5K7Z A;  3RIR A;  4KN7 X;  4DJA A;  1NG6 A;  4U7B A;  2GXB A;  4UV8 A;  4MEY F;  1Z6T A;  4YFN F;  1IN6 A;  3CZ6 A;  2CRG A;  3PFI A;  4M72 A;  4E7S A;  1WI9 A;  4BJ5 C;  3HOY J;  3TED A;  4GFB A;  2B9S A;  2KZG A;  4ZYH A;  1BBY A;  2M45 A;  3DBH B;  1OPC A;  2IS6 A;  2JJ7 A;  1SFO J;  5HLI A;  5JFR A;  4I76 A;  1BIA A;  5HOD A;  4HRI A;  2A5Y B;  3I71 A;  1ZQ3 P;  4CIC A;  3KYL A;  1ZRF A;  2CW7 A;  3OYF A;  2K40 A;  1P6R A;  1XX5 A;  3G1L A;  4BHC A;  4W1U A;  5EG0 A;  4HLX A;  5LHG A;  1DPU A;  5HS9 A;  3I55 I;  2HS5 A;  1HW2 A;  3MZY A;  2PLY A;  2A68 F;  3C3W A;  2OZ6 A;  1OQY A;  4UUT A;  4CUG A;  1X1C A;  1FOY A;  2DTR A;  3OSG A;  1MMD A;  3QOE A;  3KFW X;  3OS0 A;  2R5Y B;  5FRM A;  1OYI A;  2JA6 J;  3ECO A;  1QVT A;  4AIJ A;  1APL C;  5IT9 K;  3HGY A;  5IYD J;  1V5E A;  3GFM A;  5D5U B;  4E6K G;  2E1M C;  1P4X A;  2KDZ A;  5ICF A;  1ZR4 A;  1MMS A;  5FLX Z;  2DA1 A;  2NOG A;  4LD5 A;  1CGP A;  1UCR A;  2M0M A;  4OIO F;  4MFE A;  3K1P A;  3CTA A;  4DYC A;  2AO9 A;  5E17 F;  4M3F A;  4Y3O A;  4JX5 A;  4LGW A;  2JUC A;  4EJT A;  2GXG A;  3MAJ A;  5D8L B;  3K6G A;  4Y15 A;  3WGG A;  4XRF A;  2R5Y A;  2JA8 J;  1YW8 A;  2LY9 A;  2FMY A;  2IEK A;  1B72 A;  2D5V A;  3I4P A;  4Z2Y A;  3L00 A;  2VE8 A;  2EFQ A;  3HUG B;  2P5V A;  5TIS C;  1HKT A;  2ECC A;  2L2O A;  4O3M A;  1YIJ I;  2CUE A;  2JVH A;  2FX0 A;  2VT3 A;  1O7F A;  1MSF C;  4LB5 A;  1U9N A;  4U0Y A;  2DOF A;  3ZMV A;  5FLM J;  2HFH A;  3HPH A;  4XOR A;  5J3L A;  5IOZ A;  3C18 A;  2JZY A;  3RQ4 A;  4HQE A;  4HX7 A;  1TNS A;  2MLK A;  2MGQ A;  3HC7 A;  2DCE A;  3PSI A;  3IC7 A;  2M1B A;  3HUG A;  4LLL A;  4YRV A;  2O8X A;  4KDP A;  5C44 J;  2VON A;  3WTU C;  3OYM A;  2NS7 A;  4RB2 C;  1UHS A;  2LF8 A;  2OC6 A;  4IRH A;  1S7E A;  3H35 A;  4M3E A;  2WC2 A;  4N9H A;  3PQJ A;  3TO6 A;  1R36 A;  4LG0 A;  3VFZ A;  4EMS A;  2FXA A;  5KVR A;  3J80 Z;  4MQ9 F;  5EF6 A;  4G94 A;  5KHD A;  5L3E A;  4IOC F;  4C3H J;  3HGG A;  1TT5 B;  1HDD C;  4CGZ A;  3R0A A;  2VBY A;  2D1V A;  2L3D A;  5EZG A;  2FBI A;  2GOM A;  1A6I A;  3EYI A;  1ETX A;  1K78 B;  2ETH A;  4BE0 A;  1IXC A;  1JUM A;  1GV2 A;  1K6Y A;  1FNN A;  4FAS D;  2E7X A;  3GXO A;  5F6F A;  4Z6Y A;  1KU9 A;  2X6X A;  5B1A H;  4G7O F;  2O0Y A;  4RAF A;  1JE8 A;  1ZGW A;  1DU0 A;  1R58 A;  4R1H A;  3DEE A;  2P0W A;  2M3A A;  1MDM B;  3IKV A;  2EJR A;  5TRD A;  1LVA A;  2AXT C;  1K61 A;  3W2A A;  1FBS A;  4I02 A;  4DZJ A;  1K78 A;  2DA5 A;  2IBD A;  2XAS A;  3S3O A;  2ELH A;  3BC8 A;  2JVG A;  2JA7 J;  4UHT A;  2ELK A;  1T6S A;  1UHW A;  2XGE A;  4ON0 A;  2Z3Y A;  1YHQ I;  1QZE A;  1MBE A;  4HA8 A;  1G59 A;  2R7F A;  1YJN I;  1QZZ A;  2W24 A;  3MEX A;  4XLF A;  2XAH A;  3QPL A;  3S2W A;  5J1Y A;  2LSO A;  1WH5 A;  3DU5 A;  2QSF X;  3NQO A;  4XLC A;  1YFH A;  2KP6 A;  3KYC B;  3GZ5 A;  2Z1D A;  2XPW A;  2CFO A;  1XG1 A;  1J5Y A;  1ZG1 A;  2BZT A;  1SFE A;  1A36 A;  3JAM K;  5LRR A;  2DK8 A;  1R4M B;  1X3Z B;  1JGG A;  4AYB A;  4BQN A;  2VIX A;  1VF9 A;  3N97 A;  2XF5 A;  4XRS G;  1W7P D;  3R60 A;  1RI7 A;  2FUG 2;  2JSP A;  3HRT A;  4P5O A;  4AYB N;  4XIC A;  5ERI A;  2DW4 A;  3C2B A;  4TV7 A;  3W2V A;  3CUQ B;  3BQY A;  3FHZ A;  2CS3 A;  1IUF A;  2YX7 A;  1XB4 A;  3GFI A;  2VBX A;  2VPL A;  4BU2 A;  4XN3 A;  1OFC X;  3F0C A;  1PUE E;  4ZTF A;  1MSE C;  2GA2 A;  4V2G A;  2V1D A;  4BEH B;  3LA3 A;  1CF7 B;  1XGM A;  1IV6 A;  5CYV A;  3A4C A;  3F8N A;  2G7H A;  1OYY A;  2NNY A;  2OV7 A;  4M73 A;  4ZZL A;  1RRJ A;  3U21 A;  2QM3 A;  1WJF A;  1RC9 A;  4H4K C;  4I6Z A;  1IGN A;  2NNN A;  3CDI A;  2HU9 A;  1WH7 A;  5CQE A;  3DPU A;  1XGN A;  2P4W A;  3AL0 B;  3E6D A;  3F8C A;  2HZT A;  3SDG A;  3NRV A;  4A3K J;  2CO5 A;  3K4M A;  3CC2 I;  5LRS A;  3B6A A;  3CMA I;  3ZQL A;  1I27 A;  1KU7 A;  4XSZ F;  5E3M A;  1TWC J;  1SMT A;  1BI0 A;  2EA2 A;  1BA5 A;  1U5T C;  2RV8 A;  2IJL A;  3BZ6 A;  1Z67 A;  3F8M A;  4WX9 A;  3J81 Z;  3HTU A;  1WHU A;  1IAW A;  4HV6 A;  1IC8 A;  1DGW Y;  2JUG A;  1RZ4 A;  2XF6 A;  2IGK A;  3CJN A;  3F72 A;  3MQ0 A;  4BYY A;  2ISY A;  5A2Q Z;  2OD5 A;  4HYE A;  5L3G A;  2HOE A;  2V79 A;  2I8D A;  4DZP A;  3LSG A;  4H0E A;  2CW8 A;  3ONQ A;  3PSF A;  3H1C A;  2DA2 A;  2ECB A;  1IN7 A;  1MNE A;  2ZB9 A;  4RGU A;  1JGS A;  1VQ7 I;  1CQT A;  2WV1 A;  4M3B A;  4YG2 F;  3FIW A;  2CU7 A;  1D0X A;  3ZMS A;  4OIR F;  1BW6 A;  4V19 K;  1X1A A;  3K2A A;  2HDD A;  4A93 J;  3B02 A;  1ON1 A;  2LOO A;  5FD5 A;  2NS0 A;  3FIS A;  3FXK A;  1R22 A;  4U88 A;  5D5V B;  1VZ0 A;  1STZ A;  4HDV A;  4YFK F;  1X2M A;  2CH0 A;  3L9F A;  5D4S A;  4AID A;  4KT6 A;  2IP2 A;  2HKO A;  1JI8 A;  2YS9 A;  3MKY B;  1GV5 A;  2EIJ H;  2L7M P;  3NWT A;  2FOW A;  4EM0 B;  3CMM A;  3BPV A;  2CGP A;  2XB0 X;  1U8R A;  1XDU A;  3CLQ A;  3PO3 J;  4A2U A;  1B6A A;  2QA4 I;  2DA6 A;  2IGN A;  2VOD A;  1ULY A;  2G0E A;  3R61 A;  4XSX F;  1DGR M;  1HXD A;  1S9H A;  3F21 A;  1XCB A;  4NQW A;  3GTJ J;  3ECH A;  2WA0 A;  1QRY A;  3OMY A;  2E5Z A;  2RNJ A;  1WGX A;  3ZP5 A;  4X6A J;  1HW5 A;  4HEA 2;  5FKO A;  3OV8 A;  3HRU A;  1KZH A;  3IWF A;  2WV0 A;  3FK6 A;  1WWX A;  3SEZ A;  1W36 C;  5B3S H;  3H0G J;  1YOV B;  2H1K A;  3MFK A;  1VFC A;  3JSP A;  3M3Y J;  6PAX A;  1BI3 A;  3CDH A;  3QRF F;  3I64 A;  1Y0U A;  4F52 A;  2K02 A;  4I01 A;  2QQ9 A;  4FE7 A;  1JUS A;  2F4M B;  1JJ6 C;  2RNG A;  2X9D A;  5FFX A;  3H3Z A;  3E7L A;  5FKK A;  3H36 A;  1ETO A;  4EM2 A;  1IV8 A;  1HSJ A;  4FQG A;  4MHG A;  4MIM A;  2E1N A;  5C4X J;  1FC3 A;  1YLF A;  1WJC A;  3UR3 C;  1R1V A;  3R0J A;  2LYC A;  4M6Y A;  2K9S A;  3HL2 A;  3N4M A;  4X1E A;  3JSO A;  1R5G A;  4EV0 A;  5GTI C;  1ON2 A;  2M2E A;  5BPD A;  2H6C A;  3RSN A;  1NK3 P;  1SMY F;  3CES A;  2H1L A;  2CV1 A;  2LF7 A;  2DDA A;  1W36 D;  1SFU A;  5ILV A;  5J47 A;  2IXS A;  2MFZ A;  4F93 B;  3A03 A;  2DI3 A;  3GTG J;  3R6S A;  2IVM A;  3TW6 A;  3J7Z I;  3V8L A;  3S93 A;  4RB3 C;  1O4X A;  2BY0 A;  3OOU A;  2OCC H;  2H6B A;  1F5T A;  1XSX A;  2M34 A;  2LVS A;  1ETY A;  2NYX A;  3QP5 A;  4LJZ F;  1WJE A;  1BR4 A;  3PNV A;  3HOW J;  2LH9 A;  3EPZ A;  3OYG A;  5FLV A;  5HDK A;  2XF7 A;  4GRI A;  3FWE A;  1J7K A;  2V4J C;  5EYR A;  1NH3 A;  2RQP A;  2KQR A;  2WY8 Q;  2XGX A;  3G2B A;  4CO8 A;  4C9Y A;  1HW1 A;  4HF2 A;  2VOP A;  1TBX A;  4KT5 C;  2FEZ A;  2DT6 A;  5J4Y A;  2O8K A;  4MQV A;  1N25 A;  2F5F A;  2HQ5 A;  1Q1V A;  3G73 A;  1X3U A;  3WTS C;  1LFP A;  3HSR A;  3DKX A;  3K69 A;  3TW7 A;  2COM A;  5E1W A;  2F5C A;  3GVA A;  2H09 A;  2LRD A;  3BG6 A;  2XUB A;  1D1B A;  4E7I A;  3DPL C;  3K7A J;  4KIC A;  3BG5 A;  2DFH A;  4FCY A;  2CV0 A;  2A3S A;  4JYK A;  1WI3 A;  1UB9 A;  4I99 C;  1TWA J;  1BI1 A;  1V55 H;  2P81 A;  2HNH A;  3CLO A;  4CCJ A;  1VQK I;  3PO2 J;  2IT0 A;  4IEJ A;  1UG2 A;  4D7N A;  4NBQ A;  2DPD A;  1MBG A;  3MZ8 A;  1NK2 P;  1MBF A;  3QOD A;  2DN0 A;  2GBY A;  2V9K A;  3O2P E;  3HOU J;  4GDF A;  4M9Z A;  1SD7 A;  2LG4 A;  1Z3Y A;  2BE5 F;  4KFC A;  2LRE A;  4U7D A;  3I59 B;  3HXL A;  1A35 A;  5LHI A;  1IN4 A;  1DP3 A;  2ZNY A;  1ZHF A;  2GOX B;  3CCQ I;  3D5S C;  1OCP A;  3LAP A;  3LQR A;  1S29 A;  2R7T A;  2AQF A;  3W6V A;  3IRR A;  3OR2 C;  1Y56 A;  1H0M A;  2O9L A;  3OS1 A;  1LJ9 A;  4GCV A;  5GTH C;  2P5K A;  3T5X A;  4P55 A;  3CCJ I;  1NTC A;  3WU2 C;  3F8F A;  2STT A;  1KON A;  4ASN A;  3QYF A;  3I59 A;  4B8X A;  2W1O A;  3ZN1 A;  5FFZ A;  3VDX A;  3DTK A;  5DM6 F;  2X6Y A;  4NC6 A;  5KK1 A;  3VOD A;  3GUD A;  1QGP A;  3ABT A;  4HLY A;  3ISP A;  3CDL A;  4A3F J;  1YS6 A;  3FXJ A;  2VLA A;  3I4N J;  1H88 C;  3JR9 A;  2PJR B;  2ADU A;  1FSE A;  1U6G A;  1TTY A;  2A61 A;  2XAQ A;  1LE8 B;  2EBI A;  3D1N I;  4CZZ A;  2IS1 A;  2DBB A;  5DUK A;  4BNC A;  4A0Z A;  1IZ1 A;  3IV5 A;  4FET A;  2R7R A;  1ACI A;  3KLN A;  4ZYE A;  2A07 F;  2ESH A;  3V7C A;  1YO5 C;  2QBY A;  2K9N A;  1T39 A;  4PCQ A;  1ODD A;  4OIN F;  2GLO A;  2RGV A;  1HQC A;  2EB7 A;  2O61 A;  1MBK A;  1FY7 A;  4E70 A;  4PFO A;  3RYR A;  2RQQ A;  2D45 A;  2HI3 A;  1X19 A;  2MLG A;  3BR1 A;  2LBF B;  5B5E C;  2HQN A;  2DYR H;  3PFY A;  3AFH A;  3CUO A;  4DBQ A;  3LMM A;  1MMA A;  2OTJ I;  1ZAO A;  1A31 A;  3LQQ A;  2G9W A;  2HEO A;  2W7N A;  2R0Q C;  2EV5 A;  2BXZ A;  1FBU A;  1TW3 A;  1TL8 A;  3M07 A;  2VQG A;  2EZI A;  4PJN A;  4DYQ A;  2PEX A;  5C3E J;  2DA4 A;  2QCO A;  3T1B A;  2K9M A;  3HSE A;  1FX7 A;  2V1U A;  3REO A;  4IZZ A;  1E17 A;  2RKH A;  2HQA A;  2XSD C;  1YRN A;  2HYF A;  2QQ8 A;  2DYS H;  1X4O A;  1MJ9 A;  4Y33 A;  1X2N A;  3AG1 H;  3FXL A;  3EET A;  3L2R A;  2HDW A;  2VKV A;  5F0H A;  4D1Q A;  3OYK A;  2LKP A;  2KIU A;  4OMY A;  3M7G A;  1MIJ A;  1TWG J;  5FRN A;  2ZC2 A;  3OL4 A;  4CCK A;  4XID A;  4UY8 I;  4HW0 A;  1AWC A;  2XKP A;  3VPR A;  4I98 B;  2Z33 A;  1QQI A;  2LKS A;  3TDZ C;  2NXN B;  3K70 C;  3ZOB A;  2ZFW A;  3ZN0 A;  4G8X A;  3DBL B;  4I09 A;  3LSP A;  1IN8 A;  2OZU A;  3DTI A;  2AQE A;  5CVR A;  2KPM A;  4FE4 A;  2L9N A;  1C0W A;  2K9Q A;  3IWZ A;  2HGC A;  2RDP A;  1YE9 A;  4XOP A;  3RZD J;  3X2Q H;  3HSF A;  4P1W A;  3I53 A;  2QKL B;  1Y8R B;  4ENJ A;  4IHV A;  4QSH A;  2DAO A;  4B4C A;  4ZDL A;  1XPX A;  1FPQ A;  3C1D A;  3NEU A;  3OYD A;  3DEW A;  1GXQ A;  4WXH A;  2OJE D;  5EG0 B;  1MNM C;  1P92 A;  2CFX A;  2VJ5 A;  4GO1 A;  4GYG A;  2E2I J;  2R4G A;  2Y2Z A;  2N8G A;  1FMW A;  1WJD A;  3K70 D;  5HDG A;  1SVL A;  4UVC A;  1OR7 C;  2X1D A;  4U0V A;  2YR2 A;  5C4J J;  2K3F A;  5D5X B;  1WJA A;  2BYV E;  2L7Z A;  1TQP A;  3GTP J;  3L2V A;  5DTD A;  4IHT A;  2Q2E B;  3F23 A;  2O03 A;  4A3D J;  2XHK A;  2ZJ2 A;  5FKM A;  4A69 C;  4ZDO A;  4J19 A;  3I9V 2;  3PQK A;  1JKR C;  4XL9 A;  3BR5 A;  4IPA A;  3TQN A;  2VXD A;  1RUN A;  3HM5 A;  1Z7U A;  2R5Z B;  3CP2 A;  1IXR C;  4B09 A;  3BT9 A;  3S17 J;  1W4M A;  2W4S A;  2YX4 A;  2Z5U A;  2MC4 A;  3H5N A;  4JOM A;  4BQO A;  1P7J A;  3OS2 A;  1XSD A;  2EZL A;  2XAG A;  2ZXW H;  1YTY A;  1Y39 A;  1K79 A;  2JRT A;  4XRM A;  3K1M A;  4BE2 A;  1HKS A;  2LK2 A;  4LMY A;  3FMS A;  3JW4 A;  3D5L A;  2Q2E A;  3K0L A;  3U1K A;  4E7K A;  1B72 B;  1OCT C;  2NVQ J;  2FU4 A;  1UJ8 A;  1H9T A;  2R5Z A;  4HOB A;  3CQZ J;  2ZBK A;  2VQC A;  1IRF A;  1VQ9 I;  3ULQ B;  1VND A;  2V1X A;  3HOX J;  1BC7 C;  5D6E A;  3GO5 A;  2X4H A;  1UST A;  3WTX C;  4UB8 C;  2BY2 A;  4A3M J;  3F6V A;  3QAH A;  3KEQ A;  5D6F A;  1LQ1 A;  2HTJ A;  3BPX A;  1GLN A;  3K4J A;  1I50 J;  1W5T A;  2ICW G;  1JKP C;  1KA8 A;  2JRM A;  1Y1W J;  1VQN I;  1PJR A;  1Z7L A;  4OAZ A;  5JLW A;  5TGT A;  2XRO A;  1YQA A;  3IH2 A;  2PQ8 A;  5BMZ A;  1W5S A;  2VJJ A;  2JQ7 A;  1V3F A;  3FM3 A;  4YIR X;  2IAI A;  3HZJ A;  3K10 A;  4ZYA A;  1JT0 A;  2HYJ A;  3P7N A;  2ZSH B;  4CYD A;  3A0B C;  4HX4 A;  4LG0 B;  3AG3 H;  3FXQ A;  4ZH4 F;  2Z16 A;  5HDN A;  1R5I D;  1LDD A;  3L1P A;  2CWE A;  2NRA C;  4HNU A;  3WTY C;  1BW5 A;  1JKQ C;  3CCV I;  1P4W A;  2P7V B;  4XBF A;  3RKQ A;  4ESF A;  2O6G E;  2ZNZ A;  2VC1 A;  2DOD A;  1ZH5 A;  1DDN A;  1P4A A;  4NC7 A;  1HCR A;  5J4V A;  4HPQ A;  2GIV A;  2LR8 A;  2WAF A;  4G7H F;  4IHY A;  1TNT A;  4WCG A;  3LSI A;  1EH8 A;  4Q4Z F;  3FXR A;  1MND A;  4II3 A;  2HPM A;  1BI2 A;  1E2X A;  1SVM A;  1OR7 A;  1EV7 A;  1VQO I;  1JJ8 C;  1XSV A;  5IP6 A;  1MD0 A;  5D8K B;  1OMI A;  1OCO H;  3CCR I;  3JRI A;  3KIO A;  3OSF A;  2DO7 A;  4PJL A;  3RI4 A;  3H5R A;  2E1M B;  3LFU A;  4IVN A;  3WTZ A;  4EJO A;  2MG4 A;  4UXN A;  1HDP A;  2XRN A;  5LLQ A;  1J0R A;  2XRL A;  1WRJ A;  3D0S A;  4A6D A;  3TP3 A;  1FOK A;  3HHH A;  3WTW C;  5CVI A;  2EA4 A;  2R93 J;  2XV4 S;  2KRF A;  5BQT A;  5HS8 A;  3KZZ A;  4BAY A;  1U3E M;  2Y0M A;  5M3F J;  2HYG D;  3PNT A;  2LDU A;  2DQL A;  2B63 J;  3KCC A;  3FZV A;  1EH6 A;  2UXN A;  3S15 J;  3BJA A;  3GYH X;  1XTA A;  5E20 A;  4D0P A;  2MAB A;  1OKR A;  3FBI B;  3BLY A;  3RDI A;  2E71 A;  1BOB A;  4XR6 A;  4BXU A;  2E2H J;  4NUB A;  3VYR B;  1BR1 A;  2A6E F;  4RLQ A;  2JK3 A;  2XAJ A;  3B6C A;  5K1Y A;  1TC3 C;  3E5U A;  5J40 A;  1VQM I;  3I0T A;  1FTT A;  1LUJ B;  1XMK A;  5L3C A;  5DDG A;  4AIK A;  5HOO A;  5J8C A;  4P9F A;  3MCZ A;  3SYT A;  4RBO A;  2HDC A;  3BG7 A;  3SQN A;  2EV6 A;  4RAG A;  4XQF A;  4XKC A;  3ZXS A;  4ENK A;  2NVX J;  3CO7 C;  2I5U A;  1LEA A;  4ZYG A;  1Z91 A;  5GPA A;  2DMN A;  5E8G A;  3DCF A;  4PJJ A;  2VUM J;  3CF5 F;  1BIB A;  2F5V A;  4C30 A;  3QU3 A;  3G1O A;  1J75 A;  1FLI A;  5ILU A;  3QQA A;  2DA3 A;  4M3D A;  3WOD F;  1Q1H A;  3S2D J;  2CYY A;  4GYI A;  5IT9 Z;  1TQI A;  3GME A;  1WSU A;  2DFI A;  5CJ9 A;  5CVJ A;  1G3Y A;  2CUF A;  3DTE A;  2DXI A;  3KP3 A;  2K4B A;  3BRO A;  1FEX A;  2Q0O A;  1Z0X A;  2QEX I;  4UUS B;  2WY7 Q;  2PJP A;  1UEL B;  5BNG A;  3V8J A;  5K7H A;  2VBW A;  1E3P A;  5CVU A;  3HOT A;  1IN5 A;  3BTC A;  2PMU A;  3BR0 A;  2OAZ A;  4XLA A;  4RDU A;  1HKQ A;  4C2U A;  1N78 A;  5AIQ A;  4KIG A;  4N4N B;  2JPB A;  3CD6 I;  2X6O A;  5JI6 A;  4CXF A;  1RNL A;  4QTR A;  1LFU P;  2X6W A;  3L2Q A;  1GXP A;  2ZJP F;  2B0L A;  1W7P B;  4PDK A;  4CCN A;  3W3C A;  4RGR A;  4G9Y A;  2BGC A;  3SZG A;  2VQL A;  3A1Y A;  4L5J A;  4W97 A;  4RM2 A;  3NAR A;  5CVV A;  5FO5 A;  1T56 A;  4UUS A;  2DMU A;  2H8R A;  3RYP A;  2LKX A;  3CP8 A;  1LDK B;  2H27 A;  1LNW A;  3EDP A;  5CQG A;  3PUB A;  2QEN A;  5IYC J;  3DFG A;  1P7I A;  5IOY A;  4PGG A;  2EK5 A;  5LEJ A;  2BY3 A;  2G7U A;  2K3P A;  4ZDP A;  3RKX A;  4KMU X;  3BCA A;  4FIS A;  1T0F C;  5KAF C;  1W7P A;  1EH7 A;  3DWL E;  2PBI A;  2QWW A;  1S8N A;  2ZME C;  3AG2 H;  3I5U A;  2CQ7 A;  3S8P A;  2BVM A;  5JR3 A;  3AG4 H;  1RKW A;  2VC0 A;  1RIO H;  2VKE A;  1O3S A;  4XN0 A;  3OYJ A;  2GQQ A;  3TP0 A;  1FOX A;  4PJ0 C;  2E34 A;  1FYL A;  2BEO A;  4IL6 C;  1F36 A;  4NQW B;  5EZH A;  1KQ9 A;  3MMY B;  1ZLJ A;  4LFU A;  1RUO A;  1MJB A;  2HPI A;  5GAG J;  2L02 A;  5IP9 J;  4A3J J;  1K4S A;  2L01 A;  5F0F A;  3K4B A;  3Q9S A;  3KZI C;  3GZ6 A;  4BH9 A;  1PVE A;  3F3X A;  2BY1 A;  5EEA A;  1R1U A;  3COA C;  1QO0 D;  3HTS B;  2X1E A;  2PG4 A;  4XLE A;  1FYM A;  4HX8 A;  2DK5 A;  3FHN A;  5GAH J;  3DQV C;  2OTL I;  2R7U A;  4ENN A;  2K7L A;  1MH4 A;  3TO7 A;  4CA0 A;  4XKV A;  4RM3 A;  1XGO A;  3DKW A;  4XLH A;  4BBS J;  1ZR2 A;  2VJI A;  1X1D A;  2KMU A;  2PMH A; 
#chains in the Genus database with same CATH homology
 2VLA A;  2IS6 A;  4OWR B;  2PJR B;  2Z2S B;  2R7V A;  4HRI A;  1R6R A;  3KYL A;  1YX3 A;  2IS1 A;  2CUJ A;  2CW7 A;  3OYF A;  3IUO A;  4BAC A;  2MD0 A;  2R7R A;  4FET A;  3SEQ A;  4BXF A;  5KNL A;  4IQJ A;  1UG0 A;  1SAU A;  2E5N A;  2LY2 A;  4CUG A;  4XMY A;  1X1C A;  1Z21 A;  3MD2 A;  1MMD A;  3QOE A;  3OS0 A;  1OLT A;  5FRM A;  4PFO A;  2IS4 A;  2BW3 B;  3FKJ A;  2RQQ A;  1X19 A;  2A6T A;  4AU7 A;  1E0E A;  2LBF B;  1V5E A;  4E6K G;  4D9J A;  2E1M C;  4PFP A;  2VAS A;  3PFY A;  3AFH A;  4DBQ A;  3LMM A;  1MMA A;  4BS9 A;  2M0M A;  2KMU A;  4CZC A;  2W7N A;  4Y3O A;  1G8X A;  4NNJ A;  3K6G A;  2W00 A;  4F55 A;  2BW3 A;  5JHF A;  3ZR8 X;  3EUH C;  2M4G A;  2VQG A;  3CF2 A;  4PJN A;  4CSW A;  4HNT A;  4CH7 A;  2K9M A;  3I3L A;  3HG9 A;  4BJT A;  2XSJ C;  2L5Q A;  4IZZ A;  2BVL A;  2CUZ A;  2HQA A;  4BDY A;  2V26 A;  3HUG B;  1HA8 A;  3HPG A;  2L2O A;  2JVH A;  4X0G A;  1X4O A;  3PL8 A;  4KJZ A;  4Y33 A;  4DOZ A;  1TZL A;  2HDW A;  3L2R A;  3OR1 C;  4D1Q A;  3OYH A;  3OYK A;  3HPH A;  4XOR A;  1X1B A;  5FRN A;  3OL4 A;  4XNF A;  2BOL A;  4BEH A;  2L9S A;  3ZQQ A;  4CCK A;  3RQ4 A;  1T95 A;  3L2U A;  3HC7 A;  2DCE A;  3K70 C;  3PSI A;  1SFK A;  1WFX A;  4YEL A;  4YRV A;  5CKT A;  3OYM A;  3ZRG A;  3BCB A;  3DTI A;  2AQE A;  2KPM A;  2OC6 A;  2L9N A;  3H35 A;  4KIS A;  1YE9 A;  4XOP A;  4F91 B;  4BGD A;  4P1W A;  2QKL B;  5KHD A;  1EA3 A;  2R7X A;  3OYC A;  3OYL A;  4ZDL A;  4XON A;  1YX5 A;  3OYD A;  4YEJ A;  3DPT A;  2GOM A;  4BE1 A;  4F3Q A;  4BE0 A;  2RRE A;  2CV2 A;  4N4O B;  2PMZ A;  1K6Y A;  3C2G A;  4FAS D;  3W2W A;  2Q1Z B;  3K4L A;  2R7W A;  2VJ5 A;  2V6E A;  2X6X A;  2V7F A;  2R4G A;  2WAQ A;  3K4C A;  3M8J A;  1FMW A;  1AA7 A;  1WJD A;  3K70 D;  2HVQ A;  3HKZ A;  1MMN A;  1QU3 A;  1OR7 C;  2X1D A;  3DEE A;  2P0W A;  2M3A A;  1WJA A;  3E1S A;  2E60 A;  3L2V A;  2KHM A;  2VKH A;  3W2A A;  3K4N A;  2HZD A;  3MKW B;  2Q2E B;  1ZEL A;  3H9G A;  4ZDO A;  3I9V 2;  3S3O A;  4XL9 A;  3BC8 A;  2VXD A;  2JVG A;  2LC2 A;  2IGM A;  4XOT A;  3CP2 A;  4QPQ A;  2NOJ B;  4BQQ A;  2W4S A;  3ZGK A;  1G59 A;  2MC4 A;  3H5N A;  4JOM A;  4XLF A;  4BQO A;  3OS2 A;  2MYS A;  3RPU D;  3DU5 A;  4XLC A;  4E7J A;  2KP6 A;  4BE2 A;  4OAY A;  3QYB A;  2M4K A;  1MW7 A;  3D5L A;  4HST A;  2Z1D A;  2R7Q A;  3SDB A;  3HOS A;  4E7K A;  1ERD A;  1X4P A;  2VKD A;  3A2K A;  2CFO A;  2X1C A;  4RMN A;  3S3N A;  2R7O A;  3K4K A;  4XM3 A;  4AYB A;  1U0J A;  3C2H A;  2VIX A;  2VQC A;  4BQN A;  2XF5 A;  4IKF A;  2JSP A;  2FUG 2;  1D0Z A;  4P5O A;  4DBR A;  3W2V A;  4PSX A;  2CS3 A;  2VPL A;  4BU2 A;  3J7A Y;  3EUA A;  4XN3 A;  3LSK A;  2VQH A;  2X85 A;  1GLN A;  4ZTF A;  2F4I A;  3K4J A;  1N77 A;  2O5R A;  4BEH B;  3H5A A;  3H9Q A;  3A4C A;  1PJR A;  3QYE A;  3PJR A;  2OV7 A;  2ELJ A;  1Z7L A;  4OAZ A;  3U21 A;  5TGT A;  2F6C A;  1WJF A;  4H4K C;  2WB1 A;  3L2Q A;  3OYE A;  3H9J A;  3RTR A;  3AKZ A;  2HU9 A;  2VJJ A;  4BDZ A;  3OY9 A;  5CQE A;  3DPU A;  3K10 A;  2KDO A;  4ZYA A;  3AL0 B;  2ZXI A;  2ZSH B;  4BJ6 C;  3K4M A;  5HNH A;  5HLT A;  2Z16 A;  3F9K A;  4E7Z A;  3S3M A;  2X51 A;  4AVZ A;  4PUS A;  4CCL A;  4B47 A;  2KL4 A;  4HNU A;  2UUZ A;  2VB6 A;  3IAM 2;  4QPO A;  3TBI A;  4NC7 A;  1DGW Y;  2JUG A;  2LY1 A;  2XF6 A;  4HPQ A;  4II2 A;  2IGK A;  2ZSI B;  4PJM A;  2HVR A;  4IQ4 A;  2WAF A;  3LSI A;  2I8D A;  3LSG A;  1MND A;  4II3 A;  3V42 A;  2HPM A;  1P9Q C;  2OUM A;  2CW8 A;  3ONQ A;  3PSF A;  1D0Y A;  1IRX A;  3CJR B;  1MNE A;  1NG7 A;  2KRH A;  1D0X A;  1WJ5 A;  4Y4R A;  1QHH D;  1X1A A;  2ZFU A;  4PJL A;  2DT7 B;  3H5R A;  2LOO A;  2E1M B;  3LFU A;  4ZC3 A;  3RCO A;  2KLO A;  4BUP A;  1VZ0 A;  4DGW B;  4B3X A;  2CH0 A;  5HNF A;  3MKZ A;  4KT6 A;  3GBG A;  2XC7 A;  1JI8 A;  3MKY B;  1LKX A;  1FMV A;  4HG2 A;  3NWT A;  2L7K A;  3CMM A;  3VSL A;  2JA2 A;  3NWS A;  2WAE A;  1WJB A;  2XAU A;  4KIT B;  3PNT A;  2K9L A;  3LSM A;  5KCM A;  1BR2 A;  2IGN A;  1DGR M;  2MAB A;  1S9H A;  3VYS B;  2Y0S A;  3FBI B;  3BLY A;  2WAD A;  3IP4 B;  3DU6 A;  1BOB A;  4J01 A;  2WA0 A;  3OMY A;  4XR6 A;  2E5Z A;  3OWT A;  4NUB A;  3VYR B;  4C2T A;  1BR1 A;  2KRC A;  4RLQ A;  2A5W A;  4HEA 2;  3E0J B;  3VWB A;  2HVS A;  1N75 A;  3SEZ A;  1W36 C;  1V5G A;  2ZXH A;  5HOO A;  3L2W A;  3SYT A;  3D5R C;  3KEY A;  3BG7 A;  4F52 A;  4EAT A;  4XQF A;  4XKC A;  3ZXS A;  1D1A A;  3VYT B;  2M7A A;  2RNG A;  3OYN A;  4PJJ A;  3OYI A;  2F5V A;  4C30 A;  1Z3X A;  4CCM A;  3OIP A;  1WJC A;  3UR3 C;  2LYC A;  5HVQ C;  3FDY A;  3HL2 A;  3LL7 A;  2PJR A;  3DTE A;  2DXI A;  4IX7 A;  3RSN A;  3CES A;  3ZCO A;  2CV1 A;  5LFA A;  4PK4 A;  2WY7 Q;  1W36 D;  1UEL B;  4RLF A;  2IXS A;  2MFZ A;  4F93 B;  4ZTJ A;  3PNY A;  3H0D A;  4HSR A;  4ITV A;  5CPR B;  3HOT A;  3S93 A;  4B48 A;  2WBM A;  3OYB A;  3OOU A;  1D1C A;  4R79 A;  2VJ4 A;  4XLA A;  1N78 A;  4C2U A;  1V5F A;  4N4N B;  1WJE A;  1LVK A;  1BR4 A;  1QHG A;  2DOA A;  3EPZ A;  2DJI A;  2LBF A;  2LH9 A;  2X6W A;  3PNV A;  4G6T B;  2XDV A;  4ANJ A;  3OYG A;  4CCN A;  3W3C A;  3SZG A;  2XF7 A;  2VQL A;  4GRI A;  1MMG A;  3A1Y A;  2V4J C;  3OYA A;  4RM2 A;  2WY8 Q;  2KQR A;  3G2B A;  4LG3 A;  4C9Y A;  3DKY A;  1TT0 A;  2UWM A;  2KZV A;  4E7L A;  3CP8 A;  1LDK B;  2DT6 A;  2K5C A;  3CJQ B;  4NC8 A;  5CQG A;  3PUB A;  4J00 A;  3VYU B;  1LFP A;  4XKB A;  3DKX A;  2V1N A;  3S32 A;  4B44 A;  2K3P A;  4LIU A;  4ZDP A;  3BCA A;  1T0F C;  4CCO A;  2LRD A;  3BG6 A;  3DWL E;  3DLA A;  1D1B A;  5FRO A;  4E7I A;  3DPL C;  2CV0 A;  2UV1 A;  1UAA A;  1DQU A;  2R7S A;  3S8P A;  2BVM A;  4LIV A;  3N05 A;  3VSK A;  3OIQ A;  4LIT A;  3TL4 X;  4CCJ A;  2IGO A;  4XN0 A;  2HNH A;  4MLO A;  3TMO A;  3OYJ A;  3KX2 A;  1Y6I A;  4ZJZ A;  4DIQ A;  3EUK L;  4NQW B;  3OL3 A;  2QKM B;  3MMY B;  3QOD A;  2VXZ A;  4U87 A;  2V9K A;  3IAS 2;  3LSH A;  4B43 A;  2HPI A;  2LG4 A;  1Z3Y A;  2CMP A;  2LRE A;  3HXL A;  1PYV A;  5LD2 C;  3K4B A;  3UNG C;  1DP3 A;  4PSW A;  2GOX B;  3D5S C;  3FBN B;  2IS2 A;  2R7T A;  4BL0 B;  2AQF A;  4XKW A;  2W82 A;  2X1E A;  1Y56 A;  3OR2 C;  3M1C A;  2M7B A;  4XLE A;  3OS1 A;  3FHN A;  2VL8 A;  4E4H A;  4JQF A;  4F92 B;  3DQV C;  4DJA A;  1NG6 A;  2R7U A;  4U7B A;  4CA0 A;  4XKV A;  4E7H A;  3CZ6 A;  4E7S A;  1J09 A;  1KON A;  4RM3 A;  4BJ5 C;  4XLH A;  3QYF A;  2W1O A;  3AL0 C;  2VJI A;  3VDX A;  1X1D A;  3DTK A;  2X6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...