4NC7A

N-terminal domain of delta-subunit of rna polymerase complexed with i3c and nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc7A00
4NC8A 2KRCA 4NC7A 2M4KA
chains in the Genus database with same CATH superfamily
4MNUA 2ZJPF 1W36D 1I6HJ 2IXSA 2K02A 3HG9A 5DV5A 5FLMJ 1MD0A 3G1OA 1ZG3A 5TRDA 2CJJA 1XN7A 2DCEA 3CLOA 3F6OA 3O8GA 1TNTA 2BEOA 2KQRA 5D5XB 1D3YA 4BXFA 3QOPA 1BR4A 1ITYA 1HDPA 4UNOA 1XCVA 1QBJA 2CW7A 1LQ1A 4RGSA 2XF7A 1P4AA 5E1XA 2HVQA 3CCVI 4I98B 5ICCA 3BC8A 4HPQA 2H94A 1KZHA 1VQPI 3BJOA 4A3BJ 1D8JA 3SZTA 1MKMA 1T33A 3MFKA 2K4BA 1EF4A 4HX7A 2D1VA 2JWTA 4OWRB 4ZC3A 2R93J 3WE3A 2Y2ZA 3K0LA 2W57A 2XPWA 3OYBA 1P7JA 3DKXA 5HVQC 5CQGA 3QP6A 4EM2A 1VFCA 2Y75A 2MW8A 4DYRA 2ZSIB 3QODA 3PUBA 3J7YJ 5E3LA 3H0DA 2QWWA 1TQIA 4XONA 5CQEA 1ZARA 3CF2A 4OIRF 4N0BA 2DFEA 2DO7A 3GTQJ 1XG1A 2D1HA 4ZZDA 2PN6A 4AYBA 1K79A 3ERED 2ZJQF 4IHYA 1P92A 5J6XA 5LFAA 1D0ZA 2KL4A 1X1CA 1QVUA 2DFHA 2K4JA 2V9VA 3COAC 3RKYA 1RIOH 3TDZC 4IHWA 2EZHA 1IXSB 5GAEJ 2MLGA 3I3LA 3ZP5A 3H9JA 2IRFG 3JRIA 3C2BA 2DFFA 2KJBA 1OYWA 1ETVA 3DKWA 2GQQA 5H6RA 3GZ6A 1WJAA 2PEXA 1YTYA 1TTYA 2EQRA 3BWGA 3OYGA 3IWFA 5IT9Z 2DU9A 2EBIA 2RV8A 1MH3A 2BE5F 3BG9A 3KCCA 2K40A 4N4OB 4MO7A 4KN4X 1XPXA 1HW5A 4N9HA 2QQ8A 1NG6A 1R1UA 5FGMA 5D4SA 4LFUA 1SFEA 2VXDA 2DW4A 5JFRA 1D0YA 3HTUA 2ZFWA 5FFXA 4ESJA 1BN5A 1POGA 2CMPA 3WU0A 2XGEA 5CVUA 5CLSA 3LAPA 4A6EA 4EQQA 5FKLA 4XLHA 2CUZA 3OYKA 3K9TA 1HKQA 4I02A 1LDKB 4S05A 1K6OA 3OR1C 1UB9A 1WJFA 2GWRA 2M8GX 3CDLA 3LA7A 3RQ4A 1TL8A 2WV0A 3I64A 2F4OB 5FLXZ 2LG4A 3R0AA 4XICA 2FUG2 4XLEA 3G4SI 1W5SA 3BR2A 1A6QA 1NH3A 1H0MA 1VZ0A 3C2HA 3F8CA 2BW3A 3LSJA 4C3JJ 1SMTA 3HRUA 3DPLC 1R4MB 2ZSHB 3SFIA 4DGWB 3JREA 2M2EA 4PJ0C 5KAFC 3P9IA 2EPFA 2OQRA 1VQNI 1JT6A 1ENHA 1XGOA 2L01A 3WTZA 3ZN1A 3NAUA 3LSTA 3CCJI 1FBUA 3U9GA 3L2CA 1HC8A 1EH6A 1JHHA 1LFPA 5F04A 4J19A 4L18B 2WADA 2A61A 1ETXA 2HZTA 2WWYA 1X4PA 5IT9K 1U78A 3N4MA 2DAOA 4WX9A 3FM3A 1W7PB 3EETA 3ZCOA 4NC7A 1YX5A 4DIQA 1SFXA 3CCEI 5J1YA 3K70C 3SYTA 2X1DA 2YR2A 1R23A 2ZNZA 4D0PA 1X2NA 4ENJA 4A3KJ 2GA2A 4R79A 2Z99A 4LIVA 3RIRA 3I59B 2L5QA 3VPRA 2OA4A 1QPIA 1VQ9I 4X6AJ 1JKPC 3VB2A 3TP3A 5FKMA 3CDIA 3CO6C 5DDGA 5K5RA 2EB7A 4E7ZA 3SJMA 4FHTA 4ZYGA 1Y0UA 2MD0A 3OYJA 2CQ7A 2HI3A 5EEHA 5KK1A 3WODF 3CQZJ 4L5EA 2ID3A 2IBDA 4OIOF 4F93B 5F64A 5FLXK 3W2WA 1JJ6C 2WB1N 3FDYA 2WY7Q 4I7HA 4CGZA 1WH7A 1IRXA 2DMNA 2DLLA 4DW6A 1G59A 3U21A 3DBHB 5JVTA 3QYBA 5HNFA 3BROA 4L9JA 3AAFA 5E3NA 3FHNA 4BUPA 1F4KA 1NHAA 1G2HA 3VYTB 4ZTJA 1SMYF 1YW8A 3MKLA 3PNYA 3F8FA 1RESA 1SEUA 3TBIA 5ICEA 2G7UA 3TKYA 5EGOA 1MNMC 2BY1A 3DP7A 4ENKA 1USSA 1TZLA 3KYCB 2XPVA 2FBIA 4JX5A 1Z1DA 2L02A 1F9NA 2YUSA 3D0SA 3RJPA 2HQ5A 3UKGA 2DMQA 1OR7C 2HXIA 2WAQN 5B5EC 1B9NA 1ZGJA 4MGRA 1LDJA 4KN7X 1KA8A 3OYDA 5DD4A 2DTZA 3I4PA 3GVAA 2COBA 4ZZLA 1XMKA 2DOAA 2LC2A 2KIQA 2RNGA 3K7AJ 5J8FA 1MMGA 2FBHA 1MMAA 1U5TB 3OYEA 1A04A 2ID6A 2RQPA 3HRMA 2MA3A 4IHVA 2VBZA 3PM1A 2GZWA 2JA5J 2GAUA 1W5TA 2HZDA 4IPAA 2DQRA 3A01A 1ORKA 3ULQB 1VQ4I 4UXNA 2DA5A 3DEUA 3M8EA 5H2FC 2ZBKA 3A02A 2E19A 2XGDA 1Z7LA 2DBBA 2FQ3A 2JQ7A 1IRGA 1S7EA 4BQOA 1ZAOA 5L3CA 4RBOA 4XKVA 4E7LA 2R3SA 2X1EA 3PUFA 1YRNA 4RS8A 3S1NJ 4WXDA 2NXNB 4C3HJ 1EKEA 1UHMA 1F1ZA 2FF4A 3TL4X 1BL0A 2OV7A 3EPZA 4OOIA 4XLAA 4D1QA 1HXDA 2DT5A 4P9UA 4A5NA 2X4HA 4BJ5C 1LVAA 2Z16A 1YIOA 2P0WA 3ECHA 1MBFA 3E5UA 1TW3A 3TGNA 3BR1A 3RYRA 5BPDA 3HPGA 3QU6A 1ZR4A 2CS3A 3BTIA 4M3GA 4L9TA 4BAYA 1I50J 4YIFA 3H0GJ 1X3WB 2KFDA 2Q1ZB 2V6EA 3MVPA 4B3AA 1UHWA 4IZZA 2Y0SA 4OAZA 1Q1HA 3O2PE 5EDNA 2E1NA 1XS9A 2V6CA 1KQ0A 2IJLA 5ED4A 1XB4A 1FIAA 5HS9A 1GV2A 3ABUA 5K7FA 5DCFA 1ON2A 3BJ6A 1XSVA 2HEOA 1B4AA 5TGTA 2ICWG 4OMZA 1Y1VJ 4IRIA 1X1PA 2JK3A 3KPHA 2V1DA 3M9AA 4HSTA 3K70D 4DYCA 2F5EA 1NG7A 2B9SA 2DDBA 2XV4S 1W0UA 3D5SC 3HJEA 4BE0A 5F0FA 4GXOA 1YE9A 4A0ZA 1FSEA 2JMWA 2K9QA 4PJNA 5M3FJ 3CCSI 2HOEA 1G3TA 4ZDOA 1SAXA 1OCRH 2XRLA 2CQQA 1YJNI 3M8FA 1KU3A 1LEAA 5DCMB 1FNNA 1AA7A 1LE8B 3I9V2 5LRRA 2EV6A 2IS1A 4ANJA 4LOCA 4AUXA 3FXRA 3JRCA 2BY2A 1USTA 2RGVA 2P5KA 3MKZA 3E97A 2IEKA 4MFDA 1Z0XA 1BJZA 2DA7A 3HHHA 3ELKA 2WC2A 2TDXA 2XGXA 4BY7J 4CCOA 2C6YA 3CCYA 4KISA 3TOAA 1OMIA 2VQHA 2FMLA 4V2FA 4GDFA 3KLOA 3I0TA 1LKXA 3WTXC 3VFZA 2P81A 3DCFA 3EUHC 1DGWY 2ETHA 2VKHA 1WH5A 4XK4A 1YQAA 4U7DA 3I4MJ 3E6BA 5M5YJ 1IUFA 3KETA 2K3PA 4AM3A 2DMUA 2JUCA 1S72I 1WJEA 1U5TC 3CJRB 3F3XA 5JLWA 4CHUA 3H3VK 1YG2A 2KLOA 3HSEA 1SFKA 3FXLA 5H20A 3RPUA 4EGYA 1J2XA 2IGKA 3HKZN 4DYQA 4RB1A 3ZQIA 2L3DA 1HOMA 1VQOI 4LK1F 2FU4A 2ELJA 4B3XA 2KIFA 1FPQA 1MDMB 1PP7U 2B63J 1OYIA 2VE9A 4QWQA 2O6GE 3QPLA 3BR3A 5B66C 1FWZA 4Q5SF 3A4CA 3FM5A 4QPQA 2W48A 2K9LA 1UMQA 2WBMA 5KVRA 1OR7A 5IYCJ 2E2HJ 3FK7A 3H5NA 4PJLA 1XC5A 2DA1A 2R5ZB 2VJIA 4G94A 4UUTA 2CH0A 2R7TA 2R7SA 2MGQA 3S1MJ 2X85A 2VQCA 1TWHJ 1T0FC 3OYIA 3CCRI 1VQ5I 3QP5A 2R7VA 2EINH 5GAHJ 2WAFA 1K4SA 1BI0A 2LKXA 4HOBA 3CCUI 3WG7H 1NK3P 1UFMA 2IA1A 1KQ9A 3GW2A 4XOPA 2EFNA 1FMVA 3ZQQA 2XPUA 4HLXA 2M34A 1IDYA 2XB0X 1JUSA 4PSXA 4RB2C 3JSPA 1FOKA 2OZ6A 5EG0A 5K5QA 2LD5A 2QUFA 1XDSA 3D5LA 3ABKH 1RI7A 4B8XA 2UZKA 1V54H 3LOCA 4NQWB 3MZ8A 3KZZA 5K5OA 2IS2A 4RAYA 2Y31A 3OYAA 3SEQA 2NOGA 4MQ9F 3K1PA 2IT0A 2MBFA 2LTPA 2PMZA 3WGIA 1ZKGA 2LFBA 2LY2A 4HZFA 2FOWA 2LREA 2XC7A 5M5WJ 4ZH4F 1SFOJ 4BL0B 2DPDA 3HGYA 3HL2A 2V79A 1S3JA 3E6CC 1RZ4A 1PUFB 3K4LA 1SANA 2VJ5A 3PNTA 2X6OA 3CMEI 5C4XJ 4XRSA 1HKSA 1S5LC 1NTCA 1HSTA 3ZGKA 1W7PA 1K4TA 3CLQA 1A6IA 1WSUA 3BDDA 1DU0A 4GYGA 2HKXA 1YJWI 1OQYA 2ESHA 2V9PA 1R00A 1RNLA 2M0MA 4E7IA 5D8KB 2VJJA 1GUUA 2M7BA 4BHCA 2X1CA 1MNDA 5J8CA 3B02A 5EEGA 2G9WA 4XM3A 4BQNA 2EZIA 3OS0A 3D1NI 1BC8C 4UV9A 3GO5A 2VT3A 4IOCF 1V55H 4JBAA 1OCPA 1AKHB 3M4OJ 3OIOA 3QAHA 5JHFA 4G9YA 4IHSA 3QPHA 1VQ6I 3DF8A 4IRHA 2B7EA 2QENA 3V7CA 2O03A 2ZXIA 3CUQB 1TLHB 3JRAA 2HOSA 2FRHA 4CH7A 5HNHA 2STWA 2CGPA 3HDDA 3FXKA 4Z2YA 1VQ7I 2V1XA 2AXTC 4ZJZA 2Z5UA 4CCNA 2FQ4A 3H36A 4M3DA 2NRAC 4KJZA 2L54A 2YX7A 3W2VA 3S3MA 2RQQA 1A36A 2IS4A 5E79C 4CDGA 1XTAA 3BTCA 4PCQA 2W00A 4C2TA 4M9XA 5LEJA 3BPVA 1Z9CA 4DJAA 5E3OA 3ASNH 4BNCA 2TRTA 5BS6A 2LKPA 4Y15A 1XMAA 3N97A 3PIOF 3FHZA 2RC4A 2PMHA 4XL9A 3KEYA 1RUOA 3SXYA 3EUHA 5CVRA 1KGSA 2BVLA 4XRSG 2ZMEB 1J09A 5EJCA 1VNDA 2EFPA 1ZHFA 2IGOA 4U7BA 2JA8J 2STTA 1G3WA 3W6JB 3CF5F 1QQIA 3K10A 2HR3A 1U5TA 3WTWC 2XSJC 1I3AA 3L2WA 4RGXA 3GBGA 3WTTC 3GTKJ 2FSWA 3OMYA 2HPMA 5CYVA 1IJWC 2DOFA 4II2A 4DOZA 4EM1A 1FP2A 3LA2A 2VONA 4AIJA 2HQNA 1KYZA 3ML6A 4RLQA 3WU1B 1DDNA 2GOXB 4AIKA 1RR7A 1S7AA 2QBYB 4NHJA 5HS8A 5DUIA 1T98A 3FBNB 4EJUA 4BHPA 4XRMA 2ZJRF 4R8HA 3WG9A 1MMNA 3GXOA 4HA8A 3VSLA 2EWNA 2K9MA 1ZLJA 3WHBA 1YW9A 4HYEA 2O0YA 1JKRC 1P7IA 2H1KA 1MZBA 2XAQA 4A3CJ 2VODA 5GTHC 3V7RA 4PDKA 3K2ZA 1FOWA 2KJCA 2VC0A 5IYDJ 1E2XA 3ZRGA 2DK5A 1T0FA 4BU2A 3MZYA 1VI0A 3OV8A 1O3QA 1Y39A 1ZR2A 3DEWA 2DFIA 2VL8A 1FZPB 4A69C 2LYCA 1JUMA 2H8WA 3JR9A 3H3UA 3FKIJ 3V8KA 1MIJA 2WAQA 1H9GA 2DT7B 3E5QA 3S1QJ 5ERIA 2JRTA 2HWVA 1U3EM 2LRDA 3DPTA 3CDHA 1S9HA 2EV0A 5E1WA 2L9SA 5D5VB 2QEXI 2E1CA 3REOA 3I54A 4LJZF 5B1AH 2AQFA 2FOKA 1R4NB 1YI2I 3BT9A 3I56I 4WCGA 4KMFA 2LF7A 3JAMZ 1OCOH 4M72A 3F21A 2X9DA 3GF2A 4OMYA 4HG2A 4YIRX 1T6SA 4LG0B 2HQAA 4BE1A 5L3EA 2PX9A 3S15J 2FE3A 2QLZA 1XGMA 3GZNB 1Z3XA 3DU6A 5C44J 3CUQC 1ZRFA 4QSHA 4E4HA 4PUSA 1MSEC 1U2WA 1XSDA 1FC3A 3ZQLA 1ZTRA 5DCMA 2OZUA 5J1RA 4EGZA 4M9SA 4BDZA 5IOYA 2HFHA 3F0CA 1LE8A 4RA2A 3WU2C 1Y1WJ 1FYLA 1PUEE 2BXYA 1JXSA 4M71A 3OYNA 2KPMA 3PO2J 1LFUP 2OD5A 2M45A 2VBWA 2MSYA 5GAGJ 1R6RA 3E6MA 3CCMI 1TP4A 2JVHA 1IF1A 1JKQC 4N9IA 3FX3A 4F55A 3RPQA 2WA0A 4JYKA 2R7ZJ 1YJ9I 4P96A 4CZCA 1OYYA 3BPXA 2VOOA 3PSFA 2KISA 4A93J 1G8XA 3A0HC 3FISA 1QNTA 2ZMEC 4YFKF 2X6WA 1OCZH 2EFQA 2XAJA 3H5AA 1ZLKA 5TISC 2UWMA 5J4VA 4CO8A 1DGRM 4JX4A 2R7OA 1U8RA 1TWCJ 3JAMK 1RUNA 2M3AA 1U6GA 3CO7C 4NBQA 2OCEA 4BBSJ 1K83J 1Z6TA 4IEJA 1PVEA 2CG4A 2LMDA 4NNJA 3ZQ7A 1IRZA 3CCQI 1J9IA 1RETA 4BXXJ 1FSHA 2ACJA 2E2JJ 1VF9A 2P6SA 2NVQJ 2E7WA 2F5VA 3BTLA 2HPIA 2Q8KA 1IRFA 3RZDJ 3KZYA 1MJ9A 2R5ZA 3TW7A 2MYSA 3PNVA 5DTDA 3OL4A 3JRDA 1BIBA 3CMAI 1K61A 4LB5A 3FF5A 2LY1A 4XSXF 1LEBA 1BA5A 4KYWA 1WVRA 1Y6IA 4EEFG 1EJ9A 3L2QA 1TNSA 4W1UA 4IRGA 4ITVA 3OYHA 3Q5FA 3CMMA 2Y9YA 1L0OC 4NUBA 4BE2A 2HS5A 2VASA 3VYSB 2VT2A 1PYVA 2UUZA 3E7LA 4AIDA 2DPUA 4P9FA 4MFEA 2VJ4A 1S29A 4IHTA 2F48A 2A6HF 3KZIC 5CVJA 1JJ8C 4L5IA 3FXQA 3K2AA 2Z2SB 2NAZA 5KCMA 2O9LA 3W6KB 4GFBA 2D2WA 1TWAJ 1QZEA 3HOVJ 1J5YA 3BZ6A 2LKSA 4NQWA 5FFZA 4BJ6C 2L7MP 5BNGA 3JTHA 2KMUA 3QWLA 2XF6A 3WE2A 3FXOA 1U9OA 5GADJ 3HOZJ 3HKZA 4BEHA 2JVGA 4GO1A 4PFOA 3P9CA 4D7MA 1YX3A 3FXJA 3LNQA 2LP0A 1PUFA 3R6SA 2QZ8A 2EIKH 3VYRB 2L2OA 3MWMA 2BGCA 2IS6A 1X58A 1IGNA 2HDCA 3KEOA 3OOPA 4M3EA 2NVUB 1WI9A 3HOSA 4PZJA 5F27A 1YYVA 1DUXC 2OAZA 3J7ZI 1MBJA 4A3IJ 5FRMA 1TQMA 2L9RA 3NWTA 3ONQA 3OSFA 1APLC 3GTMJ 2BXZA 1ZK8A 2JA6J 2M4KA 3O8HA 4I76A 3VYUB 2EFWA 3RZOJ 4EVIA 2X48A 4ZYEA 5J47A 5DM6F 5E17F 4UB6C 3IAM2 2VQGA 4AVZA 1XD7A 1ZELA 5BMZA 1K7AA 4QIWN 1OFCX 3J7AY 3FZVA 2FJ1A 1H89C 3OL3A 2RN7A 3H35A 4BYYA 2ZXHA 2HOTA 5IP7J 3R60A 2XAUA 2OC6A 4QLCU 5F08A 2KIUA 3L2VA 3Q9VA 2D5VA 5K1YA 4IO9F 1I1GA 2F4MB 1YFHA 3MD2A 3ZMSA 3OYMA 3CJQB 1BIAA 2LY9A 3K1MA 4XN0A 1TT0A 1W1WE 5JHUA 2AQEA 3CUQA 1SD5A 2IW5A 2MG4A 4RMNA 1WHUA 3PIPF 1PJRA 2XHKA 4LB6B 3B6AA 3VDXA 1R36A 3KYDB 1CF7B 2I8DA 4HRIA 3IH4A 1P9QC 1M1EB 1J59A 1T95A 4TV7A 3MKWB 2CFOA 3L1PA 1JHFA 3LMMA 2VKDA 2V1NA 2GLOA 2EZKA 5EZHA 3DBRB 1UELB 3G73A 2E1MB 3WGHA 4LITA 1MJAA 4HX4A 2W24A 4XORA 4U0WA 4BH9A 2M1BA 2V9KA 2PBIA 3CC2I 2O8XA 5B1BH 4AIHA 1BOAA 4RM3A 3RYPA 2W85A 1IW7F 2EFOA 3H9GA 3A03A 3ZMZA 3ABTA 4J00A 4A3EJ 1S7OA 1TT5B 4LLLA 1QO0D 2HVSA 2ZMEA 1ZG1A 2X0LA 2QSGX 2ECCA 2QGUA 3HIFA 4OINF 1JE8A 3KFWX 4M9ZA 5ILUA 1ZH5A 5FD6A 3Q0VA 2VBYA 5CVIA 3EYIA 3UNGC 3G6EI 1I3QJ 4KUMA 3NEUA 3PQKA 3TMOA 1GVDA 4EATA 1Z77A 2Z3YA 5LGUA 3I53A 3GFIA 3IUOA 4WF2A 2QBYA 2UXXA 3S14J 2E5ZA 1WFXA 5L3FA 2MC4A 2XKPA 6PAXA 1WI3A 2XB5A 2RDPA 2KDOA 1WRJA 4AYBN 3I55I 4FX0A 1WJ5A 4A3FJ 4M3FA 2A5YB 3JRFA 2CW8A 3X2QH 2W84A 3S93A 2HQRA 3EUKL 3WTSC 1HA8A 3DWLE 4JP0A 2OCCH 1HBXG 4I2OA 2DODA 2XVCA 3J7AO 3O3KA 3LAJA 1ETYA 2W82A 4ENNA 3W6VA 4R1HA 2R7UA 2E60A 1CQTA 1MH4A 3BG5A 5DD8A 4XMYA 3K69A 4XIDA 3OY9A 4I0AA 4DZPA 2OJED 1VQLI 1R5ID 4A3JJ 2B0LA 3DQVC 4F7ZA 4L9NA 2R0QC 1IN5A 5JVGF 1A5JA 3VSKA 2RKHA 2EA4A 4XLCA 3L9FA 4CCLA 1R5GA 2QSFX 3A1YA 2JJ7A 4LG0A 2AS5F 3GTGJ 1WZ2A 5CKTA 2PMUA 4K2EA 2FNPA 2Y30A 1BC7C 4I0BA 1HCRA 3S8PA 3RPUD 1XSXA 3AG3H 5HLIA 1MMDA 5TJJA 3CD6I 1ETOA 1VTNC 3Q3SA 4Y52J 5EYRA 2ZFUA 3ZQFA 4HNVA 3K4KA 2NVYJ 2FNAA 3BY6A 4E7JA 2ECBA 2BY0A 2JT1A 1HSJA 4U0YA 3I5UA 2E1MC 1R49A 4YG2F 2LDUA 4Y17A 4L0YB 1O4XA 3S32A 3HTSB 1V5GA 2DTRA 3M7GA 2F2EA 4FASD 3RDIA 2ELKA 2F4IA 3P7NA 4RAZA 1Y0NA 1S8NA 1MW7A 4S04A 2DA3A 3ZOBA 3GLLA 3AG4H 4A3GJ 4RDUA 4ZYHA 3S2HJ 2JTVA 1IXRC 1J75A 2NNNA 2GBYA 2GM4A 1D8KA 2W7NA 2Y9ZA 3OOUA 3MZHA 2KZVA 1GXPA 1ZGAA 3F9KA 5LRSA 3KP7A 3S1RJ 5E3MA 4BQAA 4IX7A 2HYJA 1E3OC 2VPLA 2L7KA 4NC8A 2MLKA 4FT8A 3GEZA 4OAYA 2EA2A 1X2MA 1WCMJ 1G3SA 3S2DJ 3BOQA 4HBLA 2D45A 2DT6A 2HNHA 1AU7A 2ESNA 1DPRA 1QHHD 1SAUA 2F5DA 4MLOA 4XOTA 1U0JA 3ASOH 5GPAA 4KT6A 5DEQA 3JTGA 3BR0A 3HBLA 3BR5A 1KU2A 1IN8A 4B1RA 2XRNA 3SFZA 4AC0A 1DU6A 4I6ZA 3IHUA 4Y33A 4KFCA 2QKMB 2FD5A 3VOEA 4C9YA 1LVKA 3IL2A 4IQJA 4HF0A 2JPBA 1W7PD 2CV1A 4F92B 1FTZA 4XLFA 2DQLA 3AKZA 2VN2A 3BQYA 5IPAA 2L9NA 4I99C 2AO9A 2LBFB 3RQIA 2DXIA 2XIGA 5K7HA 3EYYA 3OS2A 1ZRDA 1W36C 1MBHA 3IKTA 2HDDA 5D6FA 1P4XA 4MTDA 4XKCA 4D5FA 4EJOA 1QPMA 1X19A 1ZN2A 2KRFA 2DA4A 4XN3A 3WHCA 2FMYA 5L3GA 1R1TA 2QCOA 1C0WA 3LSHA 5F0CA 3CC4I 1FMWA 5HLTA 3L2UA 3Q9SA 3I59A 4BY1J 5D8LB 5ICGA 3AL0B 4LK0F 1EA3A 4EJVA 4YEJA 1ZRCA 3ABMH 1B9MA 4CYDA 4ASNA 1IDZA 3F22A 3NRVA 4PK4A 3HSRA 2PG4A 3MCZA 4FE7A 4YFXF 1ZQ3P 2L7ZA 3T0YA 3ZMTA 1N25A 1YS6A 3ZMUA 3VEPA 1R5HA 2DI3A 4G7ZF 5KHDA 4RB0A 3C3WA 1SVMA 2I10A 4DBRA 2AXLA 4BJTA 4HNTA 1D1CA 2EJRA 3DPUA 1ZREA 4BXUA 3SHFA 3BCBA 3H9QA 3GTJJ 4E7KA 3G3ZA 5LHHA 3F6VA 4V19K 1IC8A 3QRFF 4KA4A 4A3LJ 4M3BA 2K85A 4ZYAA 5F1JA 2YPRA 2A6TA 2LOOA 4C2MJ 2LNBA 4UB8C 4HLYA 4HDUA 1BI2A 1PP8F 3LFKA 3QOEA 3SDBA 3MQ0A 4G12A 4XLNF 2CUJA 4DBQA 1Q1VA 1J0RA 2DOEA 2E36A 4D5CA 4HAMA 5CVVA 2NNYA 1KU9A 2E1OA 5IY5H 2DA2A 5ILSA 2BHYA 2O61A 2GXGA 1CF7A 5JR3A 2OU2A 2H8RA 2KIMA 3IRRA 1G6NA 2XF5A 3ERMA 3G1MA 2PI0A 2Z9OA 2LH9A 4HW0A 4CCKA 3BTJA 2K9SA 5KNLA 3M07A 2KRCA 3QYEA 2H6BA 2PFBA 4A6DA 1N78A 3IP4B 4ZYDA 3OIQA 1E3HA 2N8GA 1MNEA 4U87A 2XKOA 1T39A 1R22A 5LGTA 1RRJA 3DU5A 4CCMA 1O7LA 1ZYRF 1X1BA 1XGNA 1WJBA 4MQVA 1B72B 3Q0WA 3LQRA 1JGSA 1T56A 2K27A 4YFNF 4G6QA 3T8RA 1SC7A 5C4JJ 2WB1A 2L0KA 1SD4A 5BQTA 2ZKZA 3QPTA 4KIBA 4WWCA 1E0EA 3EDPA 2NS7A 4KMUX 3WGGA 5GP9A 1Z3YA 4JX6A 1BW5A 2L7FP 3FK6A 5JI6A 1OKRA 1BW6A 1U9NA 3GFMA 1ETQA 2BYVE 1QZYA 1F5TA 2P4WA 3HRSA 3GLXA 5JLXA 5M3MJ 2WV1A 1D5VA 1UCRA 3MMYB 1T38A 1IV6A 4UV8A 3IRQA 2DJIA 2A6EF 1QGPA 4B4CA 2ZCWA 4Y3OA 3HC7A 2VUMJ 1V5FA 2ZXJA 3DLAA 4JOMA 3DEEA 4AVPA 3G1LA 4LD5A 1CGPA 1VQ8I 1V4RA 5HDNA 1OCTC 2GA1A 1Z91A 2R7DA 3CJTB 3OWTA 5LHGA 2QQBA 4MHGA 4XQFA 1N77A 4YIIA 3DTKA 5HOOA 1TC3C 1YOVB 2I5UA 2Y48A 3OYFA 1JGGA 1RPWA 3AL0C 1B8IB 3DBLB 4FE4A 3ZQGA 5LGNA 3ZXSA 4YRVA 3GCMA 3M3YJ 3K4BA 4F91B 2UV1A 3IC7A 2HYGD 1T8IA 2OTJI 3KP6A 2OQGA 2FA5A 2ZXWH 2K9NA 3ZR8X 2HGCA 3H5RA 4HNUA 3TEDA 3TOBA 4WXHA 4UVCA 1FIPA 1XGSA 2RVCA 2A3SA 4BBRJ 5HLGA 2DA6A 4MEYF 2DMPA 2L9VA 1QVTA 1MGTA 2H1LA 4ZDPA 3JRHA 5ILVA 2FBKA 2J5PA 1XMXA 5FLVA 4P1WA 5FRNA 3KX2A 3VODA 1BI1A 4C2UA 1V3FA 2BBYA 3O6BB 3HOTA 2NVXJ 4E7SA 2H6CA 4QTRA 1P2FA 1Z67A 2F5FA 2O7OA 2V7FA 5CJ9A 3JRBA 1O3RA 4WK8F 3GTOJ 5E8GA 1OISA 2ZO4A 4A0YA 3V8LA 3HB9A 4I01A 2CV0A 2MH9A 2YU9J 3AG2H 2R5YB 2LF8A 1QZZA 4IF4A 2E71A 3FXMA 4HF2A 2A68F 1LNWA 5FKNA 2NS0A 1W5CC 4UVAA 1DP3A 3B73A 1VQMI 2P8TA 4Y4RA 2VE8A 3RKWA 5EZGA 1RC9A 4EM0B 3R4KA 2QM3A 2NYXA 2VI6A 1D5YA 2ZJ2A 4XSZF 1GDTA 1H8AC 2A07F 1WQ2A 2P5LC 5E8IA 2GXAA 1DQUA 1JI8A 2PMZN 3OS1A 2ME0A 3TDUC 4BS9A 1FBQA 3QYFA 1IZ1A 4CA0A 4ON0A 5FO5A 4UUSB 5HDKA 5F6FA 2A05A 5HS7A 4D9JA 2QSHX 2IVMA 4MTEA 5FJ8J 1TWGJ 2YS9A 2QVOA 3ZQCA 3L7WA 4H4KC 1MDMA 3C1DA 1B6AA 3HXLA 2M4GA 2OUMA 3C2GA 4MIMA 1IG7A 5DYMA 3E1SA 4IOAF 5LHIA 4U88A 3BCAA 3FMSA 4XKWA 5HODA 1KQ8A 2M87A 2IP2A 3HOXJ 4OIQF 1DPUA 3F23A 3DLLF 3H1CA 2FX0A 4ESFA 1MJBA 5FKKA 3OIPA 3JSOA 2W4SA 4DZJA 3K4NA 1FYMA 4X0GA 3A0BC 3HOYJ 1E3PA 3KIOA 4P55A 3ESWB 1IXCA 3K6GA 3RKQA 2Q0OA 2VKEA 3AG1H 4XLPF 2ISZA 3OSGA 1HLVA 3K4MA 2O5RA 3LSGA 1QA6A 3KLNA 3T5XA 1DP7P 3HOUJ 3BZCA 2EK5A 2EZLA 3S17J 5AONA 2JRMA 5EG0B 1K78B 2DYSH 1BJAA 3UR3C 3FMQA 4A3DJ 5CPRB 5L3BA 1FOXA 2Q2EB 2E2IJ 1EV7A 1X3ZB 4XNFA 2ME6A 1RKWA 2GOMA 2E34A 1O7FA 3G71I 2DN0A 2K86A 3WTVC 3BZKA 4AD9A 2LBFA 4PFPA 1YO5C 5J4YA 3GUDA 3JCUC 2Z33A 4M6YA 2F5CA 2Y69H 3P9KA 2OPTA 4XR6A 5EEAA 3L2RA 3S3OA 1SFUA 3HSFA 1WGXA 2ADUA 3NQOA 1ZGWA 2PLYA 2PJRB 3PO3J 3CTAA 1V5EA 3FXUA 4AU7A 3GYHX 4CCJA 2CO5A 2DK8A 2GIVA 3CMYA 2OTLI 3PFYA 4E7HA 4MEXF 2MH2A 2R7RA 3GFJA 1P4WA 2E5NA 5D4RA 2X51A 2HU9A 4BQQA 3KYLA 5F0HA 1MSFC 3C18A 4GCVA 3ZQHA 1S6LA 1ACIA 4CYCB 3ZMVA 1YW7A 5DS9A 1I1SA 2K5CA 2H09A 5FROA 2R4GA 2XSDC 1IN7A 3IV5A 3BG3A 1OJLA 3J81Z 5E1ZB 2EH3A 4OIPF 4UUVA 3GTPJ 4HX8A 5AIQA 1F43A 1AKHA 2CW0F 1REPC 4EJTA 2ZC2A 3W3CA 3F8NA 3V7SA 3ZPLA 2LLKA 3IH3A 5DM7F 4II3A 1YLFA 5LLQA 1XCBA 2W1OA 3KP2A 1WPKA 4N4NB 2KT0A 3GZ5A 2HDWA 2KDZA 3E3VA 4J01A 1P6RA 4NDLA 4IL6C 4JQFA 2G0EA 3HUGB 4EV0A 1FBSA 1HDDC 3TW6A 2QF7A 2EV5A 2V4JC 1D0XA 5IP6A 1Z7UA 3S16J 2V26A 1A35A 2M0CA 3GX4X 4HF1A 1X4OA 4KITB 1L3LA 2P7CB 3TO9A 1ULYA 5J3LA 4ABZA 1ZG5A 1Z05A 1W4MA 1HKTA 3D5RC 1HF0A 3BG6A 3CC7I 3M1EA 4FISA 4Y7NJ 1R9TJ 2VQLA 1AHDP 1MMSA 2M5WA 2W25A 2DYRH 4QPOA 1BR2A 2WAEA 4IVNA 5F1RA 1TW2A 4Q48A 5HDGA 1YIJI 1LPQA 3ZN0A 4HQEA 3HGGA 4HQMA 2A5WA 3J81K 2L4AA 1FLIA 2ZB9A 1LDDA 3CP8A 3BR6A 1B72A 4OU0A 1IUYA 3R0JA 3RKXA 2BHZA 4IJAA 4Z6YA 4FETA 4HV6A 3MN2A 4B43A 1GHCA 3HHGA 1WKMA 3MKYB 3ECOA 3QQAA 3LSPA 4G6DA 4LLNA 1LFBA 4NB5A 2F6CA 4EMSA 1UAAA 2KKOA 2TCTA 1QRYA 2EILH 2CV2A 1ERDA 4LG3A 3CUOA 4GYIA 4G6TB 2JA2A 2JUGA 4U0VA 4BACA 2NS8A 4RLFA 4C3IJ 3LSKA 1E17A 2P5VA 3U1DA 1WJCA 3CJNA 4P5OA 3Q0UA 3RSNA 3TO6A 1NK2P 3KP5A 3LWFA 1O3TA 1YS7A 3P5JA 4F3QA 1UHSA 2KHMA 2CQXA 3EUAA 2DJNA 1KU7A 1JTYA 2QYOA 4KICA 1IO2A 1KONA 4O3MA 1FYKA 2BOLA 1LUJB 1FTTA 3GWZA 4FTHA 3FBIB 1R71A 1N75A 4G7HF 3E0JB 5BPIA 4IQ4A 5LEKA 3DTIA 1EH7A 3BG7A 1IN6A 1D1BA 3H3ZA 2COMA 1B8IA 1XX5A 3L00A 3LL7A 4PSWA 2X6YA 4G8XA 1BR1A 2P7VB 1OCCH 3BQZA 1X1AA 4ETSA 1UG0A 2WTEA 2E7XA 2VB6A 2M9HA 5D6EA 3S2WA 1HW1A 3NARA 1X3UA 1MBGA 3PSIA 2CSOA 3F72A 3JRGA 5A2QZ 1GT0C 3E6DA 1OPCA 2AHQA 2OBPA 3PQJA 4LGWA 4E6KG 2YU3A 2NOJB 5HLHA 3RCOA 4KDPA 4BHBA 1BI3A 2LR8A 2BV6A 3WTYC 2O8KA 4XKBA 1VQKI 1STZA 2PJPA 3I71A 3T8TA 1B1BA 3ZMDA 4PGGA 1GLNA 2XAGA 4RGRA 5J1UA 4HSRA 3DXJF 4ESBA 2CFXA 4PJMA 3OYCA 4A3MJ 2FEZA 3IAS2 4FCYA 4DQ2A 1SD7A 3CZ6A 2R5YA 2M7AA 2RAEA 5B3SH 1UG2A 3V4GA 2H27A 3HM5A 3J80Z 1SVLA 2MC3A 3LSIA 1J7KA 1G3YA 3R61A 3W2AA 5K7ZA 5KAIC 3S3NA 3V8JA 3F8MA 2IA0A 1EH8A 1H88C 1I6XA 2VPRA 4M6VA 4L0ZB 2XAHA 4XBFA 3VWBA 3KE2A 3AFHA 5J40A 1TWFJ 2DDAA 4FQGA 4X1EA 1PDNC 3ABLH 3HPHA 3LSRA 4AWXB 1WJDA 3KP4A 4UUSA 2BZTA 2VKVA 1T08B 3GMEA 1ETWA 5A2QK 4HEA2 5FKOA 2IGNA 1JUPA 3IKVA 2XROA 2M30A 3ROUA 2ZNYA 2IPQX 3HZJA 2VIXA 4DNCA 5LD2C 3B6CA 4Q4ZF 3RTRA 2DMTA 4ZDLA 3HOWJ 3DTEA 1G4DA 1SD6A 3QU3A 1GXQA 2BY3A 5EF6A 1R7JA 2R7FA 4IXAA 1SVOA 3SQNA 4B44A 3E5XA 1JT0A 2BW3B 3CP2A 4CXFA 2RNJA 1MBKA 3LFUA 2KZGA 3SZGA 3M8JA 4XRFA 2LVSA 5D5WB 2Y0MA 3LSMA 1AOYA 4PGHA 2PQ8A 2CRGA 3C7JA 2L4MA 1FEXA 3QPSA 4A0XA 3CESA 2P6TA 3ISPA 1T2KA 3F8BA 3J80K 2K7LA 4IKFA 2CQKA 4S0HB 3DFGA 5L3DA 3OR2C 4H0EA 1K6YA 3IH2A 5DUKA 5D5UB 4BGDA 2GIZA 3SZPA 4M73A 2R7XA 4WXCA 1K78A 3HRTA 3N05A 2R7QA 2IGMA 3BJAA 3M1CA 1YHQI 4CUGA 2Q2EA 1XDUA 2WY8Q 4C30A 2QQAA 1HW2A 1FOYA 2GXBA 1Z21A 5H6QA 2V1UA 4BEHB 3KP3A 5LBQA 4CICA 2OF7A 2NVTJ 1Y8QB 3GTLJ 3HEFA 1X1DA 1UZCA 2CQNA 2VC1A 3I58A 4UVBA 3TQNA 4PJJA 3TO7A 3FWEA 2ELHA 3G2BA 3U1KA 4V2GA 1IN4A 4W97A 1O57A 2HVRA 2IAIA 4KIFA 5IYBJ 2J5OA 1YITI 1AWCA 1RR8C 2PJRA 1IAWA 4YELA 4F52A 1FT9A 1B59A 1FY7A 5E20A 3NWSA 2XAFA 2HKOA 1BBYA 4KIGA 4O6JA 2EIJH 3PFIA 1QU3A 4UHTA 4BDYA 2XGCA 3FIWA 4RAGA 4L9VA 5FB2A 1LJ9A 1FX7A 5IT3A 1ON1A 4Y13A 1GVJA 1R58A 2EIMH 2JZYA 4LMYA 1TBXA 4RB3C 4CYCA 1O3SA 2ISYA 1QHGA 4M6XA 3L09A 1KYWA 2CUEA 4RGUA 3A2KA 1GV5A 4LLGF 3DV8A 4HV5A 2R7WA 2IA2A 2CWEA 3RI4A 2MFZA 4JK1X 2XDVA 1HQCA 2CU7A 2M8EA 2LSOA 5ICFA 3HYIA 4FX4A 5EGOB 5E18F 3IWZA 2BVMA 2VOPA 1Z6RA 2CUFA 3DKYA 4GGGA 1MBEA 3T1BA 2RREA 1W0TA 1I5ZA 3H92A 1Y8RB 2Y0SN 3MAJA 2QA4I 1ODDA 4ZTFA 2JA7J 4M74A 5BOXA 4I09A 1RKTA 2YSRA 2UXNA 2A69F 1ONVA 1I27A 1TQPA 2LK2A 2R92J 3MEXA 4RAFA 2KRHA 3HUGA 1BM9A 4A2UA 1H9TA 4O5VA 1UJ8A 5FD5A 3LQQA 4D7NA 3JW4A 5C3EJ 2MD5A 1IV8A 2VLAA 4B09A 2CYYA 3SEZA 2MABA 4IHXA 3OYLA 3PL8A 2HYFA 4KT5C 4KNYA 4A5MA 3CCLI 2E35A 2HXOA 3LA3A 3A01B 5IP9J 9ANTA 3GFLA 3TP0A 3WTUC 2FXAA 2JPCA 2QQ9A 5AIPA 1OLTA 4LIUA 5GPCA 2G7HA 4HDVA 3BP8A 1YRNB 1JTXA 3FMRA 1FP1D 2X6XA 3BLYA 1BOBA 2VBXA 4CSWA 1LB2A 4L5JA 3PJRA 4Q47A 2JSPA 4ENMA 4UY8I 4G7OF 4A12A 1U8BA 4NC6A 5GTIC 5IOZA 1FJLA 2YX4A 3I4NJ 4CZZA 3FKJA 3K4CA 2JSCA 1I39A 4BKXA 1Y56A 4B47A 4E70A 2KP6A 2HTJA 2HTSA 2VXZA 3EQLF 4EJWA 2XUBA 4GRIA 3U2RA 1F36A 2O3FA 1A31A 2XASA 3K4JA 3KEQA 4RM2A 2K3FA 5M5XJ 2QKLB 2Z1DA 3SDGA 4B48A 1WWXA 3K1NA 1ETKA 2HOAA 1D1AA 1R1VA 3V42A 1JKOC 2JN6A
chains in the Genus database with same CATH topology
1WJ5A 1W36D 4NQWB 2IXSA 2IS2A 3HG9A 3OYAA 4XNFA 3SEQA 2GOMA 2PMZA 2CW8A 2LY2A 2LREA 2XC7A 4BL0B 3S93A 3EUKL 1HA8A 2LBFA 3HL2A 4PFPA 3DWLE 3K4LA 2DCEA 4BXFA 2KQRA 4XR6A 3L2RA 3S3OA 2VJ5A 3PNTA 1BR4A 2PJRB 2W82A 2R7UA 2E60A 2CW7A 1V5EA 4AU7A 3ZGKA 4CCJA 4XMYA 2XF7A 3OY9A 3PFYA 2HVQA 4E7HA 2R7RA 3BC8A 2E5NA 4HPQA 3DQVC 2X51A 2HU9A 2M0MA 4BQQA 3KYLA 4E7IA 3VSKA 2VJJA 4OWRB 4ZC3A 2M7BA 2X1CA 1MNDA 4XLCA 4CCLA 2K5CA 3OYBA 4XM3A 3DKXA 4BQNA 3OS0A 5HVQC 3A1YA 5CQGA 5FROA 2R4GA 5CKTA 2ZSIB 3QODA 3PUBA 3H0DA 5JHFA 4XONA 5CQEA 3CF2A 3S8PA 3RPUD 3W3CA 2ZXIA 1MMDA 4II3A 4CH7A 5HNHA 4AYBA 2ZFUA 2W1OA 3K4KA 4N4NB 4ZJZA 2HDWA 5LFAA 1D0ZA 4CCNA 2KL4A 1X1CA 4E7JA 4KJZA 4J01A 2E1MC 4JQFA 3W2VA 3S3MA 3HUGB 2RQQA 3S32A 2IS4A 1V5GA 3I3LA 2W00A 3H9JA 4C2TA 2V4JC 1D0XA 4DJAA 2V26A 4FASD 2F4IA 1X4OA 4KITB 1MW7A 1WJAA 3OYGA 3D5RC 4XL9A 3BG6A 2W7NA 3OOUA 2KZVA 3KEYA 2VQLA 2BVLA 1J09A 4N4OB 3F9KA 2IGOA 4QPOA 4U7BA 1BR2A 2WAEA 1NG6A 4IX7A 2VXDA 3K10A 2VPLA 2L7KA 4NC8A 1D0YA 2XSJC 4OAYA 2A5WA 3L2WA 3GBGA 2CMPA 3OMYA 2HPMA 2DT6A 2HNHA 4II2A 3CP8A 1QHHD 1SAUA 4DOZA 4MLOA 4XOTA 4XLHA 2CUZA 3OYKA 4FETA 4RLQA 4B43A 1LDKB 1U0JA 2GOXB 3OR1C 4KT6A 1WJFA 3FBNB 3RQ4A 3MKYB 1MMNA 3VSLA 2K9MA 2LG4A 2F6CA 2FUG2 4XLEA 4Y33A 1UAAA 2QKMB 1VZ0A 3C2HA 2BW3A 2CV2A 1ERDA 4C9YA 1LVKA 4LG3A 4IQJA 3DPLC 2ZSHB 2CV1A 4F92B 4G6TB 4DGWB 2JA2A 2JUGA 4BACA 4XLFA 4RLFA 3AKZA 3LSKA 1WJCA 4P5OA 2L9NA 3RSNA 3ZRGA 2LBFB 4BU2A 2DXIA 3OS2A 1W36C 1LFPA 2WADA 2VL8A 4F3QA 1X4PA 2LYCA 2KHMA 4XKCA 3EUAA 2WAQA 2DT7B 1KONA 1X19A 2BOLA 3ZCOA 2LRDA 3DPTA 4NC7A 1S9HA 3FBIB 1YX5A 4XN3A 2L9SA 4DIQA 1N75A 3E0JB 3K70C 4IQ4A 3SYTA 2X1DA 3LSHA 3DTIA 3BG7A 1D1BA 2AQFA 4R79A 1FMWA 4LIVA 2L5QA 5HLTA 3L2UA 3LL7A 4PSWA 2X6YA 1BR1A 3AL0B 1X1AA 1EA3A 1UG0A 4HG2A 2HQAA 4YEJA 2VB6A 4E7ZA 4BE1A 2MD0A 3OYJA 3PSIA 1Z3XA 3DU6A 4PK4A 4E6KG 4E4HA 4PUSA 2NOJB 4F93B 3RCOA 3W2WA 5KHDA 3FDYA 2WY7Q 4XKBA 4BDZA 1IRXA 4DBRA 4BJTA 4HNTA 1D1CA 3DPUA 3BCBA 3H9QA 1GLNA 4E7KA 1G59A 4HSRA 3U21A 3QYBA 5HNFA 2KPMA 3OYNA 3FHNA 1R6RA 4BUPA 4PJMA 2JVHA 4ZYAA 3OYCA 3IAS2 2A6TA 3VYTB 4ZTJA 4F55A 2LOOA 2WA0A 3PNYA 3CZ6A 2M7AA 3TBIA 3QOEA 3SDBA 4CZCA 1TZLA 2CUJA 4DBQA 3PSFA 3LSIA 1G8XA 3W2AA 1OR7C 3S3NA 2X6WA 3H5AA 3OYDA 2UWMA 2XF5A 3VWBA 2LH9A 1DGRM 3AFHA 4CCKA 2R7OA 2DOAA 2LC2A 2RNGA 3HPHA 1MMGA 5KNLA 1MMAA 1WJDA 2KRCA 3QYEA 2M3AA 3OYEA 1N78A 3IP4B 3OIQA 1MNEA 4U87A 2HZDA 4HEA2 3DU5A 4CCMA 2IGNA 1X1BA 1WJBA 4NNJA 2VIXA 5LD2C 1Z7LA 3RTRA 4BQOA 2WB1A 4XKVA 4ZDLA 4E7LA 2F5VA 3DTEA 2X1EA 2HPIA 1E0EA 2MYSA 4B44A 3PNVA 3TL4X 2BW3B 2OV7A 3EPZA 3OL4A 4XLAA 4D1QA 3CP2A 2LY1A 1Z3YA 3LFUA 4BJ5C 2Z16A 1Y6IA 3SZGA 3M8JA 2P0WA 3LSMA 3L2QA 4ITVA 3OYHA 3HPGA 3CMMA 3MMYB 3CESA 2CS3A 4NUBA 4BE2A 2VASA 2V6EA 2Q1ZB 2DJIA 1PYVA 3VYSB 4IKFA 3OR2C 1K6YA 2UUZA 4IZZA 2Y0SA 4BGDA 4Y3OA 3HC7A 1V5FA 2VJ4A 3DLAA 4JOMA 3DEEA 4OAZA 2R7XA 3N05A 2R7QA 2Z2SB 5KCMA 2IGMA 3M1CA 3OWTA 4CUGA 4XQFA 1N77A 2WY8Q 4C30A 4BJ6C 3DTKA 5HOOA 1Z21A 2KMUA 2XF6A 4BEHB 5TGTA 3OYFA 3HKZA 4BEHA 3AL0C 2JVGA 4PFOA 4YRVA 3ZXSA 1X1DA 3K4BA 4F91B 1YX3A 2UV1A 4PJJA 3G2BA 4HSTA 3K70D 2IS6A 3VYRB 2L2OA 2HVRA 1NG7A 3ZR8X 3H5RA 3D5SC 4HNUA 4BE0A 2PJRA 1YE9A 3HOSA 4YELA 4F52A 4ZDOA 4PJNA 3NWSA 5FRMA 3NWTA 3ONQA 4ZDPA 2M4KA 3VYUB 4BDYA 1QU3A 4P1WA 5FRNA 3KX2A 3IAM2 2VQGA 1AA7A 4AVZA 3I9V2 4C2UA 1ZELA 2IS1A 4ANJA 3HOTA 3J7AY 1QHGA 4E7SA 3OL3A 3H35A 2ZXHA 3MKZA 3A2KA 2V7FA 2XAUA 2R7WA 2OC6A 4CCOA 2MFZA 3L2VA 2XDVA 2CV0A 4KISA 2VQHA 3MD2A 3OYMA 3CJQB 4XN0A 1TT0A 1LKXA 2BVMA 2AQEA 3DKYA 1DP3A 2RREA 3EUHC 4Y4RA 1DGWY 2VKHA 4RMNA 4ZTFA 1PJRA 3VDXA 2K3PA 2I8DA 4HRIA 1P9QC 1WJEA 2KRHA 1T95A 3CJRB 1DQUA 2CFOA 3MKWB 1JI8A 2KLOA 3LMMA 2VKDA 3OS1A 1SFKA 2V1NA 4BS9A 1UELB 2E1MB 3QYFA 4CA0A 2IGKA 2VLAA 3SEZA 4LITA 2MABA 3OYLA 3PL8A 4XORA 4D9JA 2ELJA 4B3XA 2V9KA 4H4KC 4RM3A 3HXLA 2M4GA 3H9GA 2OUMA 3C2GA 4J00A 3A4CA 3E1SA 4QPQA 1OLTA 3BCAA 4XKWA 2HVSA 2K9LA 2WBMA 4LIUA 3H5NA 4PJLA 2X6XA 2VJIA 3BLYA 1BOBA 3OIPA 2W4SA 4CSWA 2CH0A 2R7TA 3PJRA 2R7SA 2JSPA 3K4NA 4X0GA 2X85A 3UNGC 2VQCA 1T0FC 3OYIA 2R7VA 3K6GA 2WAFA 3FKJA 3TMOA 3K4CA 1Y56A 4B47A 2KP6A 2VXZA 4EATA 4GRIA 3K4MA 2O5RA 3LSGA 4XOPA 1FMVA 3ZQQA 3K4JA 3IUOA 4RM2A 4PSXA 2QKLB 2Z1DA 2E5ZA 4B48A 1WFXA 2MC4A 1D1AA 2KDOA 3UR3C 3V42A 5CPRB 3D5LA 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC8 A;  2KRC A;  4NC7 A;  2M4K A; 
#chains in the Genus database with same CATH topology
 4MNU A;  2ZJP F;  1W36 D;  1I6H J;  2IXS A;  2K02 A;  3HG9 A;  5DV5 A;  5FLM J;  1MD0 A;  3G1O A;  1ZG3 A;  5TRD A;  2CJJ A;  1XN7 A;  2DCE A;  3CLO A;  3F6O A;  3O8G A;  1TNT A;  2BEO A;  2KQR A;  5D5X B;  1D3Y A;  4BXF A;  3QOP A;  1BR4 A;  1ITY A;  1HDP A;  4UNO A;  1XCV A;  1QBJ A;  2CW7 A;  1LQ1 A;  4RGS A;  2XF7 A;  1P4A A;  5E1X A;  2HVQ A;  3CCV I;  4I98 B;  5ICC A;  3BC8 A;  4HPQ A;  2H94 A;  1KZH A;  1VQP I;  3BJO A;  4A3B J;  1D8J A;  3SZT A;  1MKM A;  1T33 A;  3MFK A;  2K4B A;  1EF4 A;  4HX7 A;  2D1V A;  2JWT A;  4OWR B;  4ZC3 A;  2R93 J;  3WE3 A;  2Y2Z A;  3K0L A;  2W57 A;  2XPW A;  3OYB A;  1P7J A;  3DKX A;  5HVQ C;  5CQG A;  3QP6 A;  4EM2 A;  1VFC A;  2Y75 A;  2MW8 A;  4DYR A;  2ZSI B;  3QOD A;  3PUB A;  3J7Y J;  5E3L A;  3H0D A;  2QWW A;  1TQI A;  4XON A;  5CQE A;  1ZAR A;  3CF2 A;  4OIR F;  4N0B A;  2DFE A;  2DO7 A;  3GTQ J;  1XG1 A;  2D1H A;  4ZZD A;  2PN6 A;  4AYB A;  1K79 A;  3ERE D;  2ZJQ F;  4IHY A;  1P92 A;  5J6X A;  5LFA A;  1D0Z A;  2KL4 A;  1X1C A;  1QVU A;  2DFH A;  2K4J A;  2V9V A;  3COA C;  3RKY A;  1RIO H;  3TDZ C;  4IHW A;  2EZH A;  1IXS B;  5GAE J;  2MLG A;  3I3L A;  3ZP5 A;  3H9J A;  2IRF G;  3JRI A;  3C2B A;  2DFF A;  2KJB A;  1OYW A;  1ETV A;  3DKW A;  2GQQ A;  5H6R A;  3GZ6 A;  1WJA A;  2PEX A;  1YTY A;  1TTY A;  2EQR A;  3BWG A;  3OYG A;  3IWF A;  5IT9 Z;  2DU9 A;  2EBI A;  2RV8 A;  1MH3 A;  2BE5 F;  3BG9 A;  3KCC A;  2K40 A;  4N4O B;  4MO7 A;  4KN4 X;  1XPX A;  1HW5 A;  4N9H A;  2QQ8 A;  1NG6 A;  1R1U A;  5FGM A;  5D4S A;  4LFU A;  1SFE A;  2VXD A;  2DW4 A;  5JFR A;  1D0Y A;  3HTU A;  2ZFW A;  5FFX A;  4ESJ A;  1BN5 A;  1POG A;  2CMP A;  3WU0 A;  2XGE A;  5CVU A;  5CLS A;  3LAP A;  4A6E A;  4EQQ A;  5FKL A;  4XLH A;  2CUZ A;  3OYK A;  3K9T A;  1HKQ A;  4I02 A;  1LDK B;  4S05 A;  1K6O A;  3OR1 C;  1UB9 A;  1WJF A;  2GWR A;  2M8G X;  3CDL A;  3LA7 A;  3RQ4 A;  1TL8 A;  2WV0 A;  3I64 A;  2F4O B;  5FLX Z;  2LG4 A;  3R0A A;  4XIC A;  2FUG 2;  4XLE A;  3G4S I;  1W5S A;  3BR2 A;  1A6Q A;  1NH3 A;  1H0M A;  1VZ0 A;  3C2H A;  3F8C A;  2BW3 A;  3LSJ A;  4C3J J;  1SMT A;  3HRU A;  3DPL C;  1R4M B;  2ZSH B;  3SFI A;  4DGW B;  3JRE A;  2M2E A;  4PJ0 C;  5KAF C;  3P9I A;  2EPF A;  2OQR A;  1VQN I;  1JT6 A;  1ENH A;  1XGO A;  2L01 A;  3WTZ A;  3ZN1 A;  3NAU A;  3LST A;  3CCJ I;  1FBU A;  3U9G A;  3L2C A;  1HC8 A;  1EH6 A;  1JHH A;  1LFP A;  5F04 A;  4J19 A;  4L18 B;  2WAD A;  2A61 A;  1ETX A;  2HZT A;  2WWY A;  1X4P A;  5IT9 K;  1U78 A;  3N4M A;  2DAO A;  4WX9 A;  3FM3 A;  1W7P B;  3EET A;  3ZCO A;  4NC7 A;  1YX5 A;  4DIQ A;  1SFX A;  3CCE I;  5J1Y A;  3K70 C;  3SYT A;  2X1D A;  2YR2 A;  1R23 A;  2ZNZ A;  4D0P A;  1X2N A;  4ENJ A;  4A3K J;  2GA2 A;  4R79 A;  2Z99 A;  4LIV A;  3RIR A;  3I59 B;  2L5Q A;  3VPR A;  2OA4 A;  1QPI A;  1VQ9 I;  4X6A J;  1JKP C;  3VB2 A;  3TP3 A;  5FKM A;  3CDI A;  3CO6 C;  5DDG A;  5K5R A;  2EB7 A;  4E7Z A;  3SJM A;  4FHT A;  4ZYG A;  1Y0U A;  2MD0 A;  3OYJ A;  2CQ7 A;  2HI3 A;  5EEH A;  5KK1 A;  3WOD F;  3CQZ J;  4L5E A;  2ID3 A;  2IBD A;  4OIO F;  4F93 B;  5F64 A;  5FLX K;  3W2W A;  1JJ6 C;  2WB1 N;  3FDY A;  2WY7 Q;  4I7H A;  4CGZ A;  1WH7 A;  1IRX A;  2DMN A;  2DLL A;  4DW6 A;  1G59 A;  3U21 A;  3DBH B;  5JVT A;  3QYB A;  5HNF A;  3BRO A;  4L9J A;  3AAF A;  5E3N A;  3FHN A;  4BUP A;  1F4K A;  1NHA A;  1G2H A;  3VYT B;  4ZTJ A;  1SMY F;  1YW8 A;  3MKL A;  3PNY A;  3F8F A;  1RES A;  1SEU A;  3TBI A;  5ICE A;  2G7U A;  3TKY A;  5EGO A;  1MNM C;  2BY1 A;  3DP7 A;  4ENK A;  1USS A;  1TZL A;  3KYC B;  2XPV A;  2FBI A;  4JX5 A;  1Z1D A;  2L02 A;  1F9N A;  2YUS A;  3D0S A;  3RJP A;  2HQ5 A;  3UKG A;  2DMQ A;  1OR7 C;  2HXI A;  2WAQ N;  5B5E C;  1B9N A;  1ZGJ A;  4MGR A;  1LDJ A;  4KN7 X;  1KA8 A;  3OYD A;  5DD4 A;  2DTZ A;  3I4P A;  3GVA A;  2COB A;  4ZZL A;  1XMK A;  2DOA A;  2LC2 A;  2KIQ A;  2RNG A;  3K7A J;  5J8F A;  1MMG A;  2FBH A;  1MMA A;  1U5T B;  3OYE A;  1A04 A;  2ID6 A;  2RQP A;  3HRM A;  2MA3 A;  4IHV A;  2VBZ A;  3PM1 A;  2GZW A;  2JA5 J;  2GAU A;  1W5T A;  2HZD A;  4IPA A;  2DQR A;  3A01 A;  1ORK A;  3ULQ B;  1VQ4 I;  4UXN A;  2DA5 A;  3DEU A;  3M8E A;  5H2F C;  2ZBK A;  3A02 A;  2E19 A;  2XGD A;  1Z7L A;  2DBB A;  2FQ3 A;  2JQ7 A;  1IRG A;  1S7E A;  4BQO A;  1ZAO A;  5L3C A;  4RBO A;  4XKV A;  4E7L A;  2R3S A;  2X1E A;  3PUF A;  1YRN A;  4RS8 A;  3S1N J;  4WXD A;  2NXN B;  4C3H J;  1EKE A;  1UHM A;  1F1Z A;  2FF4 A;  3TL4 X;  1BL0 A;  2OV7 A;  3EPZ A;  4OOI A;  4XLA A;  4D1Q A;  1HXD A;  2DT5 A;  4P9U A;  4A5N A;  2X4H A;  4BJ5 C;  1LVA A;  2Z16 A;  1YIO A;  2P0W A;  3ECH A;  1MBF A;  3E5U A;  1TW3 A;  3TGN A;  3BR1 A;  3RYR A;  5BPD A;  3HPG A;  3QU6 A;  1ZR4 A;  2CS3 A;  3BTI A;  4M3G A;  4L9T A;  4BAY A;  1I50 J;  4YIF A;  3H0G J;  1X3W B;  2KFD A;  2Q1Z B;  2V6E A;  3MVP A;  4B3A A;  1UHW A;  4IZZ A;  2Y0S A;  4OAZ A;  1Q1H A;  3O2P E;  5EDN A;  2E1N A;  1XS9 A;  2V6C A;  1KQ0 A;  2IJL A;  5ED4 A;  1XB4 A;  1FIA A;  5HS9 A;  1GV2 A;  3ABU A;  5K7F A;  5DCF A;  1ON2 A;  3BJ6 A;  1XSV A;  2HEO A;  1B4A A;  5TGT A;  2ICW G;  4OMZ A;  1Y1V J;  4IRI A;  1X1P A;  2JK3 A;  3KPH A;  2V1D A;  3M9A A;  4HST A;  3K70 D;  4DYC A;  2F5E A;  1NG7 A;  2B9S A;  2DDB A;  2XV4 S;  1W0U A;  3D5S C;  3HJE A;  4BE0 A;  5F0F A;  4GXO A;  1YE9 A;  4A0Z A;  1FSE A;  2JMW A;  2K9Q A;  4PJN A;  5M3F J;  3CCS I;  2HOE A;  1G3T A;  4ZDO A;  1SAX A;  1OCR H;  2XRL A;  2CQQ A;  1YJN I;  3M8F A;  1KU3 A;  1LEA A;  5DCM B;  1FNN A;  1AA7 A;  1LE8 B;  3I9V 2;  5LRR A;  2EV6 A;  2IS1 A;  4ANJ A;  4LOC A;  4AUX A;  3FXR A;  3JRC A;  2BY2 A;  1UST A;  2RGV A;  2P5K A;  3MKZ A;  3E97 A;  2IEK A;  4MFD A;  1Z0X A;  1BJZ A;  2DA7 A;  3HHH A;  3ELK A;  2WC2 A;  2TDX A;  2XGX A;  4BY7 J;  4CCO A;  2C6Y A;  3CCY A;  4KIS A;  3TOA A;  1OMI A;  2VQH A;  2FML A;  4V2F A;  4GDF A;  3KLO A;  3I0T A;  1LKX A;  3WTX C;  3VFZ A;  2P81 A;  3DCF A;  3EUH C;  1DGW Y;  2ETH A;  2VKH A;  1WH5 A;  4XK4 A;  1YQA A;  4U7D A;  3I4M J;  3E6B A;  5M5Y J;  1IUF A;  3KET A;  2K3P A;  4AM3 A;  2DMU A;  2JUC A;  1S72 I;  1WJE A;  1U5T C;  3CJR B;  3F3X A;  5JLW A;  4CHU A;  3H3V K;  1YG2 A;  2KLO A;  3HSE A;  1SFK A;  3FXL A;  5H20 A;  3RPU A;  4EGY A;  1J2X A;  2IGK A;  3HKZ N;  4DYQ A;  4RB1 A;  3ZQI A;  2L3D A;  1HOM A;  1VQO I;  4LK1 F;  2FU4 A;  2ELJ A;  4B3X A;  2KIF A;  1FPQ A;  1MDM B;  1PP7 U;  2B63 J;  1OYI A;  2VE9 A;  4QWQ A;  2O6G E;  3QPL A;  3BR3 A;  5B66 C;  1FWZ A;  4Q5S F;  3A4C A;  3FM5 A;  4QPQ A;  2W48 A;  2K9L A;  1UMQ A;  2WBM A;  5KVR A;  1OR7 A;  5IYC J;  2E2H J;  3FK7 A;  3H5N A;  4PJL A;  1XC5 A;  2DA1 A;  2R5Z B;  2VJI A;  4G94 A;  4UUT A;  2CH0 A;  2R7T A;  2R7S A;  2MGQ A;  3S1M J;  2X85 A;  2VQC A;  1TWH J;  1T0F C;  3OYI A;  3CCR I;  1VQ5 I;  3QP5 A;  2R7V A;  2EIN H;  5GAH J;  2WAF A;  1K4S A;  1BI0 A;  2LKX A;  4HOB A;  3CCU I;  3WG7 H;  1NK3 P;  1UFM A;  2IA1 A;  1KQ9 A;  3GW2 A;  4XOP A;  2EFN A;  1FMV A;  3ZQQ A;  2XPU A;  4HLX A;  2M34 A;  1IDY A;  2XB0 X;  1JUS A;  4PSX A;  4RB2 C;  3JSP A;  1FOK A;  2OZ6 A;  5EG0 A;  5K5Q A;  2LD5 A;  2QUF A;  1XDS A;  3D5L A;  3ABK H;  1RI7 A;  4B8X A;  2UZK A;  1V54 H;  3LOC A;  4NQW B;  3MZ8 A;  3KZZ A;  5K5O A;  2IS2 A;  4RAY A;  2Y31 A;  3OYA A;  3SEQ A;  2NOG A;  4MQ9 F;  3K1P A;  2IT0 A;  2MBF A;  2LTP A;  2PMZ A;  3WGI A;  1ZKG A;  2LFB A;  2LY2 A;  4HZF A;  2FOW A;  2LRE A;  2XC7 A;  5M5W J;  4ZH4 F;  1SFO J;  4BL0 B;  2DPD A;  3HGY A;  3HL2 A;  2V79 A;  1S3J A;  3E6C C;  1RZ4 A;  1PUF B;  3K4L A;  1SAN A;  2VJ5 A;  3PNT A;  2X6O A;  3CME I;  5C4X J;  4XRS A;  1HKS A;  1S5L C;  1NTC A;  1HST A;  3ZGK A;  1W7P A;  1K4T A;  3CLQ A;  1A6I A;  1WSU A;  3BDD A;  1DU0 A;  4GYG A;  2HKX A;  1YJW I;  1OQY A;  2ESH A;  2V9P A;  1R00 A;  1RNL A;  2M0M A;  4E7I A;  5D8K B;  2VJJ A;  1GUU A;  2M7B A;  4BHC A;  2X1C A;  1MND A;  5J8C A;  3B02 A;  5EEG A;  2G9W A;  4XM3 A;  4BQN A;  2EZI A;  3OS0 A;  3D1N I;  1BC8 C;  4UV9 A;  3GO5 A;  2VT3 A;  4IOC F;  1V55 H;  4JBA A;  1OCP A;  1AKH B;  3M4O J;  3OIO A;  3QAH A;  5JHF A;  4G9Y A;  4IHS A;  3QPH A;  1VQ6 I;  3DF8 A;  4IRH A;  2B7E A;  2QEN A;  3V7C A;  2O03 A;  2ZXI A;  3CUQ B;  1TLH B;  3JRA A;  2HOS A;  2FRH A;  4CH7 A;  5HNH A;  2STW A;  2CGP A;  3HDD A;  3FXK A;  4Z2Y A;  1VQ7 I;  2V1X A;  2AXT C;  4ZJZ A;  2Z5U A;  4CCN A;  2FQ4 A;  3H36 A;  4M3D A;  2NRA C;  4KJZ A;  2L54 A;  2YX7 A;  3W2V A;  3S3M A;  2RQQ A;  1A36 A;  2IS4 A;  5E79 C;  4CDG A;  1XTA A;  3BTC A;  4PCQ A;  2W00 A;  4C2T A;  4M9X A;  5LEJ A;  3BPV A;  1Z9C A;  4DJA A;  5E3O A;  3ASN H;  4BNC A;  2TRT A;  5BS6 A;  2LKP A;  4Y15 A;  1XMA A;  3N97 A;  3PIO F;  3FHZ A;  2RC4 A;  2PMH A;  4XL9 A;  3KEY A;  1RUO A;  3SXY A;  3EUH A;  5CVR A;  1KGS A;  2BVL A;  4XRS G;  2ZME B;  1J09 A;  5EJC A;  1VND A;  2EFP A;  1ZHF A;  2IGO A;  4U7B A;  2JA8 J;  2STT A;  1G3W A;  3W6J B;  3CF5 F;  1QQI A;  3K10 A;  2HR3 A;  1U5T A;  3WTW C;  2XSJ C;  1I3A A;  3L2W A;  4RGX A;  3GBG A;  3WTT C;  3GTK J;  2FSW A;  3OMY A;  2HPM A;  5CYV A;  1IJW C;  2DOF A;  4II2 A;  4DOZ A;  4EM1 A;  1FP2 A;  3LA2 A;  2VON A;  4AIJ A;  2HQN A;  1KYZ A;  3ML6 A;  4RLQ A;  3WU1 B;  1DDN A;  2GOX B;  4AIK A;  1RR7 A;  1S7A A;  2QBY B;  4NHJ A;  5HS8 A;  5DUI A;  1T98 A;  3FBN B;  4EJU A;  4BHP A;  4XRM A;  2ZJR F;  4R8H A;  3WG9 A;  1MMN A;  3GXO A;  4HA8 A;  3VSL A;  2EWN A;  2K9M A;  1ZLJ A;  3WHB A;  1YW9 A;  4HYE A;  2O0Y A;  1JKR C;  1P7I A;  2H1K A;  1MZB A;  2XAQ A;  4A3C J;  2VOD A;  5GTH C;  3V7R A;  4PDK A;  3K2Z A;  1FOW A;  2KJC A;  2VC0 A;  5IYD J;  1E2X A;  3ZRG A;  2DK5 A;  1T0F A;  4BU2 A;  3MZY A;  1VI0 A;  3OV8 A;  1O3Q A;  1Y39 A;  1ZR2 A;  3DEW A;  2DFI A;  2VL8 A;  1FZP B;  4A69 C;  2LYC A;  1JUM A;  2H8W A;  3JR9 A;  3H3U A;  3FKI J;  3V8K A;  1MIJ A;  2WAQ A;  1H9G A;  2DT7 B;  3E5Q A;  3S1Q J;  5ERI A;  2JRT A;  2HWV A;  1U3E M;  2LRD A;  3DPT A;  3CDH A;  1S9H A;  2EV0 A;  5E1W A;  2L9S A;  5D5V B;  2QEX I;  2E1C A;  3REO A;  3I54 A;  4LJZ F;  5B1A H;  2AQF A;  2FOK A;  1R4N B;  1YI2 I;  3BT9 A;  3I56 I;  4WCG A;  4KMF A;  2LF7 A;  3JAM Z;  1OCO H;  4M72 A;  3F21 A;  2X9D A;  3GF2 A;  4OMY A;  4HG2 A;  4YIR X;  1T6S A;  4LG0 B;  2HQA A;  4BE1 A;  5L3E A;  2PX9 A;  3S15 J;  2FE3 A;  2QLZ A;  1XGM A;  3GZN B;  1Z3X A;  3DU6 A;  5C44 J;  3CUQ C;  1ZRF A;  4QSH A;  4E4H A;  4PUS A;  1MSE C;  1U2W A;  1XSD A;  1FC3 A;  3ZQL A;  1ZTR A;  5DCM A;  2OZU A;  5J1R A;  4EGZ A;  4M9S A;  4BDZ A;  5IOY A;  2HFH A;  3F0C A;  1LE8 A;  4RA2 A;  3WU2 C;  1Y1W J;  1FYL A;  1PUE E;  2BXY A;  1JXS A;  4M71 A;  3OYN A;  2KPM A;  3PO2 J;  1LFU P;  2OD5 A;  2M45 A;  2VBW A;  2MSY A;  5GAG J;  1R6R A;  3E6M A;  3CCM I;  1TP4 A;  2JVH A;  1IF1 A;  1JKQ C;  4N9I A;  3FX3 A;  4F55 A;  3RPQ A;  2WA0 A;  4JYK A;  2R7Z J;  1YJ9 I;  4P96 A;  4CZC A;  1OYY A;  3BPX A;  2VOO A;  3PSF A;  2KIS A;  4A93 J;  1G8X A;  3A0H C;  3FIS A;  1QNT A;  2ZME C;  4YFK F;  2X6W A;  1OCZ H;  2EFQ A;  2XAJ A;  3H5A A;  1ZLK A;  5TIS C;  2UWM A;  5J4V A;  4CO8 A;  1DGR M;  4JX4 A;  2R7O A;  1U8R A;  1TWC J;  3JAM K;  1RUN A;  2M3A A;  1U6G A;  3CO7 C;  4NBQ A;  2OCE A;  4BBS J;  1K83 J;  1Z6T A;  4IEJ A;  1PVE A;  2CG4 A;  2LMD A;  4NNJ A;  3ZQ7 A;  1IRZ A;  3CCQ I;  1J9I A;  1RET A;  4BXX J;  1FSH A;  2ACJ A;  2E2J J;  1VF9 A;  2P6S A;  2NVQ J;  2E7W A;  2F5V A;  3BTL A;  2HPI A;  2Q8K A;  1IRF A;  3RZD J;  3KZY A;  1MJ9 A;  2R5Z A;  3TW7 A;  2MYS A;  3PNV A;  5DTD A;  3OL4 A;  3JRD A;  1BIB A;  3CMA I;  1K61 A;  4LB5 A;  3FF5 A;  2LY1 A;  4XSX F;  1LEB A;  1BA5 A;  4KYW A;  1WVR A;  1Y6I A;  4EEF G;  1EJ9 A;  3L2Q A;  1TNS A;  4W1U A;  4IRG A;  4ITV A;  3OYH A;  3Q5F A;  3CMM A;  2Y9Y A;  1L0O C;  4NUB A;  4BE2 A;  2HS5 A;  2VAS A;  3VYS B;  2VT2 A;  1PYV A;  2UUZ A;  3E7L A;  4AID A;  2DPU A;  4P9F A;  4MFE A;  2VJ4 A;  1S29 A;  4IHT A;  2F48 A;  2A6H F;  3KZI C;  5CVJ A;  1JJ8 C;  4L5I A;  3FXQ A;  3K2A A;  2Z2S B;  2NAZ A;  5KCM A;  2O9L A;  3W6K B;  4GFB A;  2D2W A;  1TWA J;  1QZE A;  3HOV J;  1J5Y A;  3BZ6 A;  2LKS A;  4NQW A;  5FFZ A;  4BJ6 C;  2L7M P;  5BNG A;  3JTH A;  2KMU A;  3QWL A;  2XF6 A;  3WE2 A;  3FXO A;  1U9O A;  5GAD J;  3HOZ J;  3HKZ A;  4BEH A;  2JVG A;  4GO1 A;  4PFO A;  3P9C A;  4D7M A;  1YX3 A;  3FXJ A;  3LNQ A;  2LP0 A;  1PUF A;  3R6S A;  2QZ8 A;  2EIK H;  3VYR B;  2L2O A;  3MWM A;  2BGC A;  2IS6 A;  1X58 A;  1IGN A;  2HDC A;  3KEO A;  3OOP A;  4M3E A;  2NVU B;  1WI9 A;  3HOS A;  4PZJ A;  5F27 A;  1YYV A;  1DUX C;  2OAZ A;  3J7Z I;  1MBJ A;  4A3I J;  5FRM A;  1TQM A;  2L9R A;  3NWT A;  3ONQ A;  3OSF A;  1APL C;  3GTM J;  2BXZ A;  1ZK8 A;  2JA6 J;  2M4K A;  3O8H A;  4I76 A;  3VYU B;  2EFW A;  3RZO J;  4EVI A;  2X48 A;  4ZYE A;  5J47 A;  5DM6 F;  5E17 F;  4UB6 C;  3IAM 2;  2VQG A;  4AVZ A;  1XD7 A;  1ZEL A;  5BMZ A;  1K7A A;  4QIW N;  1OFC X;  3J7A Y;  3FZV A;  2FJ1 A;  1H89 C;  3OL3 A;  2RN7 A;  3H35 A;  4BYY A;  2ZXH A;  2HOT A;  5IP7 J;  3R60 A;  2XAU A;  2OC6 A;  4QLC U;  5F08 A;  2KIU A;  3L2V A;  3Q9V A;  2D5V A;  5K1Y A;  4IO9 F;  1I1G A;  2F4M B;  1YFH A;  3MD2 A;  3ZMS A;  3OYM A;  3CJQ B;  1BIA A;  2LY9 A;  3K1M A;  4XN0 A;  1TT0 A;  1W1W E;  5JHU A;  2AQE A;  3CUQ A;  1SD5 A;  2IW5 A;  2MG4 A;  4RMN A;  1WHU A;  3PIP F;  1PJR A;  2XHK A;  4LB6 B;  3B6A A;  3VDX A;  1R36 A;  3KYD B;  1CF7 B;  2I8D A;  4HRI A;  3IH4 A;  1P9Q C;  1M1E B;  1J59 A;  1T95 A;  4TV7 A;  3MKW B;  2CFO A;  3L1P A;  1JHF A;  3LMM A;  2VKD A;  2V1N A;  2GLO A;  2EZK A;  5EZH A;  3DBR B;  1UEL B;  3G73 A;  2E1M B;  3WGH A;  4LIT A;  1MJA A;  4HX4 A;  2W24 A;  4XOR A;  4U0W A;  4BH9 A;  2M1B A;  2V9K A;  2PBI A;  3CC2 I;  2O8X A;  5B1B H;  4AIH A;  1BOA A;  4RM3 A;  3RYP A;  2W85 A;  1IW7 F;  2EFO A;  3H9G A;  3A03 A;  3ZMZ A;  3ABT A;  4J00 A;  4A3E J;  1S7O A;  1TT5 B;  4LLL A;  1QO0 D;  2HVS A;  2ZME A;  1ZG1 A;  2X0L A;  2QSG X;  2ECC A;  2QGU A;  3HIF A;  4OIN F;  1JE8 A;  3KFW X;  4M9Z A;  5ILU A;  1ZH5 A;  5FD6 A;  3Q0V A;  2VBY A;  5CVI A;  3EYI A;  3UNG C;  3G6E I;  1I3Q J;  4KUM A;  3NEU A;  3PQK A;  3TMO A;  1GVD A;  4EAT A;  1Z77 A;  2Z3Y A;  5LGU A;  3I53 A;  3GFI A;  3IUO A;  4WF2 A;  2QBY A;  2UXX A;  3S14 J;  2E5Z A;  1WFX A;  5L3F A;  2MC4 A;  2XKP A;  6PAX A;  1WI3 A;  2XB5 A;  2RDP A;  2KDO A;  1WRJ A;  4AYB N;  3I55 I;  4FX0 A;  1WJ5 A;  4A3F J;  4M3F A;  2A5Y B;  3JRF A;  2CW8 A;  3X2Q H;  2W84 A;  3S93 A;  2HQR A;  3EUK L;  3WTS C;  1HA8 A;  3DWL E;  4JP0 A;  2OCC H;  1HBX G;  4I2O A;  2DOD A;  2XVC A;  3J7A O;  3O3K A;  3LAJ A;  1ETY A;  2W82 A;  4ENN A;  3W6V A;  4R1H A;  2R7U A;  2E60 A;  1CQT A;  1MH4 A;  3BG5 A;  5DD8 A;  4XMY A;  3K69 A;  4XID A;  3OY9 A;  4I0A A;  4DZP A;  2OJE D;  1VQL I;  1R5I D;  4A3J J;  2B0L A;  3DQV C;  4F7Z A;  4L9N A;  2R0Q C;  1IN5 A;  5JVG F;  1A5J A;  3VSK A;  2RKH A;  2EA4 A;  4XLC A;  3L9F A;  4CCL A;  1R5G A;  2QSF X;  3A1Y A;  2JJ7 A;  4LG0 A;  2AS5 F;  3GTG J;  1WZ2 A;  5CKT A;  2PMU A;  4K2E A;  2FNP A;  2Y30 A;  1BC7 C;  4I0B A;  1HCR A;  3S8P A;  3RPU D;  1XSX A;  3AG3 H;  5HLI A;  1MMD A;  5TJJ A;  3CD6 I;  1ETO A;  1VTN C;  3Q3S A;  4Y52 J;  5EYR A;  2ZFU A;  3ZQF A;  4HNV A;  3K4K A;  2NVY J;  2FNA A;  3BY6 A;  4E7J A;  2ECB A;  2BY0 A;  2JT1 A;  1HSJ A;  4U0Y A;  3I5U A;  2E1M C;  1R49 A;  4YG2 F;  2LDU A;  4Y17 A;  4L0Y B;  1O4X A;  3S32 A;  3HTS B;  1V5G A;  2DTR A;  3M7G A;  2F2E A;  4FAS D;  3RDI A;  2ELK A;  2F4I A;  3P7N A;  4RAZ A;  1Y0N A;  1S8N A;  1MW7 A;  4S04 A;  2DA3 A;  3ZOB A;  3GLL A;  3AG4 H;  4A3G J;  4RDU A;  4ZYH A;  3S2H J;  2JTV A;  1IXR C;  1J75 A;  2NNN A;  2GBY A;  2GM4 A;  1D8K A;  2W7N A;  2Y9Z A;  3OOU A;  3MZH A;  2KZV A;  1GXP A;  1ZGA A;  3F9K A;  5LRS A;  3KP7 A;  3S1R J;  5E3M A;  4BQA A;  4IX7 A;  2HYJ A;  1E3O C;  2VPL A;  2L7K A;  4NC8 A;  2MLK A;  4FT8 A;  3GEZ A;  4OAY A;  2EA2 A;  1X2M A;  1WCM J;  1G3S A;  3S2D J;  3BOQ A;  4HBL A;  2D45 A;  2DT6 A;  2HNH A;  1AU7 A;  2ESN A;  1DPR A;  1QHH D;  1SAU A;  2F5D A;  4MLO A;  4XOT A;  1U0J A;  3ASO H;  5GPA A;  4KT6 A;  5DEQ A;  3JTG A;  3BR0 A;  3HBL A;  3BR5 A;  1KU2 A;  1IN8 A;  4B1R A;  2XRN A;  3SFZ A;  4AC0 A;  1DU6 A;  4I6Z A;  3IHU A;  4Y33 A;  4KFC A;  2QKM B;  2FD5 A;  3VOE A;  4C9Y A;  1LVK A;  3IL2 A;  4IQJ A;  4HF0 A;  2JPB A;  1W7P D;  2CV1 A;  4F92 B;  1FTZ A;  4XLF A;  2DQL A;  3AKZ A;  2VN2 A;  3BQY A;  5IPA A;  2L9N A;  4I99 C;  2AO9 A;  2LBF B;  3RQI A;  2DXI A;  2XIG A;  5K7H A;  3EYY A;  3OS2 A;  1ZRD A;  1W36 C;  1MBH A;  3IKT A;  2HDD A;  5D6F A;  1P4X A;  4MTD A;  4XKC A;  4D5F A;  4EJO A;  1QPM A;  1X19 A;  1ZN2 A;  2KRF A;  2DA4 A;  4XN3 A;  3WHC A;  2FMY A;  5L3G A;  1R1T A;  2QCO A;  1C0W A;  3LSH A;  5F0C A;  3CC4 I;  1FMW A;  5HLT A;  3L2U A;  3Q9S A;  3I59 A;  4BY1 J;  5D8L B;  5ICG A;  3AL0 B;  4LK0 F;  1EA3 A;  4EJV A;  4YEJ A;  1ZRC A;  3ABM H;  1B9M A;  4CYD A;  4ASN A;  1IDZ A;  3F22 A;  3NRV A;  4PK4 A;  3HSR A;  2PG4 A;  3MCZ A;  4FE7 A;  4YFX F;  1ZQ3 P;  2L7Z A;  3T0Y A;  3ZMT A;  1N25 A;  1YS6 A;  3ZMU A;  3VEP A;  1R5H A;  2DI3 A;  4G7Z F;  5KHD A;  4RB0 A;  3C3W A;  1SVM A;  2I10 A;  4DBR A;  2AXL A;  4BJT A;  4HNT A;  1D1C A;  2EJR A;  3DPU A;  1ZRE A;  4BXU A;  3SHF A;  3BCB A;  3H9Q A;  3GTJ J;  4E7K A;  3G3Z A;  5LHH A;  3F6V A;  4V19 K;  1IC8 A;  3QRF F;  4KA4 A;  4A3L J;  4M3B A;  2K85 A;  4ZYA A;  5F1J A;  2YPR A;  2A6T A;  2LOO A;  4C2M J;  2LNB A;  4UB8 C;  4HLY A;  4HDU A;  1BI2 A;  1PP8 F;  3LFK A;  3QOE A;  3SDB A;  3MQ0 A;  4G12 A;  4XLN F;  2CUJ A;  4DBQ A;  1Q1V A;  1J0R A;  2DOE A;  2E36 A;  4D5C A;  4HAM A;  5CVV A;  2NNY A;  1KU9 A;  2E1O A;  5IY5 H;  2DA2 A;  5ILS A;  2BHY A;  2O61 A;  2GXG A;  1CF7 A;  5JR3 A;  2OU2 A;  2H8R A;  2KIM A;  3IRR A;  1G6N A;  2XF5 A;  3ERM A;  3G1M A;  2PI0 A;  2Z9O A;  2LH9 A;  4HW0 A;  4CCK A;  3BTJ A;  2K9S A;  5KNL A;  3M07 A;  2KRC A;  3QYE A;  2H6B A;  2PFB A;  4A6D A;  1N78 A;  3IP4 B;  4ZYD A;  3OIQ A;  1E3H A;  2N8G A;  1MNE A;  4U87 A;  2XKO A;  1T39 A;  1R22 A;  5LGT A;  1RRJ A;  3DU5 A;  4CCM A;  1O7L A;  1ZYR F;  1X1B A;  1XGN A;  1WJB A;  4MQV A;  1B72 B;  3Q0W A;  3LQR A;  1JGS A;  1T56 A;  2K27 A;  4YFN F;  4G6Q A;  3T8R A;  1SC7 A;  5C4J J;  2WB1 A;  2L0K A;  1SD4 A;  5BQT A;  2ZKZ A;  3QPT A;  4KIB A;  4WWC A;  1E0E A;  3EDP A;  2NS7 A;  4KMU X;  3WGG A;  5GP9 A;  1Z3Y A;  4JX6 A;  1BW5 A;  2L7F P;  3FK6 A;  5JI6 A;  1OKR A;  1BW6 A;  1U9N A;  3GFM A;  1ETQ A;  2BYV E;  1QZY A;  1F5T A;  2P4W A;  3HRS A;  3GLX A;  5JLX A;  5M3M J;  2WV1 A;  1D5V A;  1UCR A;  3MMY B;  1T38 A;  1IV6 A;  4UV8 A;  3IRQ A;  2DJI A;  2A6E F;  1QGP A;  4B4C A;  2ZCW A;  4Y3O A;  3HC7 A;  2VUM J;  1V5F A;  2ZXJ A;  3DLA A;  4JOM A;  3DEE A;  4AVP A;  3G1L A;  4LD5 A;  1CGP A;  1VQ8 I;  1V4R A;  5HDN A;  1OCT C;  2GA1 A;  1Z91 A;  2R7D A;  3CJT B;  3OWT A;  5LHG A;  2QQB A;  4MHG A;  4XQF A;  1N77 A;  4YII A;  3DTK A;  5HOO A;  1TC3 C;  1YOV B;  2I5U A;  2Y48 A;  3OYF A;  1JGG A;  1RPW A;  3AL0 C;  1B8I B;  3DBL B;  4FE4 A;  3ZQG A;  5LGN A;  3ZXS A;  4YRV A;  3GCM A;  3M3Y J;  3K4B A;  4F91 B;  2UV1 A;  3IC7 A;  2HYG D;  1T8I A;  2OTJ I;  3KP6 A;  2OQG A;  2FA5 A;  2ZXW H;  2K9N A;  3ZR8 X;  2HGC A;  3H5R A;  4HNU A;  3TED A;  3TOB A;  4WXH A;  4UVC A;  1FIP A;  1XGS A;  2RVC A;  2A3S A;  4BBR J;  5HLG A;  2DA6 A;  4MEY F;  2DMP A;  2L9V A;  1QVT A;  1MGT A;  2H1L A;  4ZDP A;  3JRH A;  5ILV A;  2FBK A;  2J5P A;  1XMX A;  5FLV A;  4P1W A;  5FRN A;  3KX2 A;  3VOD A;  1BI1 A;  4C2U A;  1V3F A;  2BBY A;  3O6B B;  3HOT A;  2NVX J;  4E7S A;  2H6C A;  4QTR A;  1P2F A;  1Z67 A;  2F5F A;  2O7O A;  2V7F A;  5CJ9 A;  3JRB A;  1O3R A;  4WK8 F;  3GTO J;  5E8G A;  1OIS A;  2ZO4 A;  4A0Y A;  3V8L A;  3HB9 A;  4I01 A;  2CV0 A;  2MH9 A;  2YU9 J;  3AG2 H;  2R5Y B;  2LF8 A;  1QZZ A;  4IF4 A;  2E71 A;  3FXM A;  4HF2 A;  2A68 F;  1LNW A;  5FKN A;  2NS0 A;  1W5C C;  4UVA A;  1DP3 A;  3B73 A;  1VQM I;  2P8T A;  4Y4R A;  2VE8 A;  3RKW A;  5EZG A;  1RC9 A;  4EM0 B;  3R4K A;  2QM3 A;  2NYX A;  2VI6 A;  1D5Y A;  2ZJ2 A;  4XSZ F;  1GDT A;  1H8A C;  2A07 F;  1WQ2 A;  2P5L C;  5E8I A;  2GXA A;  1DQU A;  1JI8 A;  2PMZ N;  3OS1 A;  2ME0 A;  3TDU C;  4BS9 A;  1FBQ A;  3QYF A;  1IZ1 A;  4CA0 A;  4ON0 A;  5FO5 A;  4UUS B;  5HDK A;  5F6F A;  2A05 A;  5HS7 A;  4D9J A;  2QSH X;  2IVM A;  4MTE A;  5FJ8 J;  1TWG J;  2YS9 A;  2QVO A;  3ZQC A;  3L7W A;  4H4K C;  1MDM A;  3C1D A;  1B6A A;  3HXL A;  2M4G A;  2OUM A;  3C2G A;  4MIM A;  1IG7 A;  5DYM A;  3E1S A;  4IOA F;  5LHI A;  4U88 A;  3BCA A;  3FMS A;  4XKW A;  5HOD A;  1KQ8 A;  2M87 A;  2IP2 A;  3HOX J;  4OIQ F;  1DPU A;  3F23 A;  3DLL F;  3H1C A;  2FX0 A;  4ESF A;  1MJB A;  5FKK A;  3OIP A;  3JSO A;  2W4S A;  4DZJ A;  3K4N A;  1FYM A;  4X0G A;  3A0B C;  3HOY J;  1E3P A;  3KIO A;  4P55 A;  3ESW B;  1IXC A;  3K6G A;  3RKQ A;  2Q0O A;  2VKE A;  3AG1 H;  4XLP F;  2ISZ A;  3OSG A;  1HLV A;  3K4M A;  2O5R A;  3LSG A;  1QA6 A;  3KLN A;  3T5X A;  1DP7 P;  3HOU J;  3BZC A;  2EK5 A;  2EZL A;  3S17 J;  5AON A;  2JRM A;  5EG0 B;  1K78 B;  2DYS H;  1BJA A;  3UR3 C;  3FMQ A;  4A3D J;  5CPR B;  5L3B A;  1FOX A;  2Q2E B;  2E2I J;  1EV7 A;  1X3Z B;  4XNF A;  2ME6 A;  1RKW A;  2GOM A;  2E34 A;  1O7F A;  3G71 I;  2DN0 A;  2K86 A;  3WTV C;  3BZK A;  4AD9 A;  2LBF A;  4PFP A;  1YO5 C;  5J4Y A;  3GUD A;  3JCU C;  2Z33 A;  4M6Y A;  2F5C A;  2Y69 H;  3P9K A;  2OPT A;  4XR6 A;  5EEA A;  3L2R A;  3S3O A;  1SFU A;  3HSF A;  1WGX A;  2ADU A;  3NQO A;  1ZGW A;  2PLY A;  2PJR B;  3PO3 J;  3CTA A;  1V5E A;  3FXU A;  4AU7 A;  3GYH X;  4CCJ A;  2CO5 A;  2DK8 A;  2GIV A;  3CMY A;  2OTL I;  3PFY A;  4E7H A;  4MEX F;  2MH2 A;  2R7R A;  3GFJ A;  1P4W A;  2E5N A;  5D4R A;  2X51 A;  2HU9 A;  4BQQ A;  3KYL A;  5F0H A;  1MSF C;  3C18 A;  4GCV A;  3ZQH A;  1S6L A;  1ACI A;  4CYC B;  3ZMV A;  1YW7 A;  5DS9 A;  1I1S A;  2K5C A;  2H09 A;  5FRO A;  2R4G A;  2XSD C;  1IN7 A;  3IV5 A;  3BG3 A;  1OJL A;  3J81 Z;  5E1Z B;  2EH3 A;  4OIP F;  4UUV A;  3GTP J;  4HX8 A;  5AIQ A;  1F43 A;  1AKH A;  2CW0 F;  1REP C;  4EJT A;  2ZC2 A;  3W3C A;  3F8N A;  3V7S A;  3ZPL A;  2LLK A;  3IH3 A;  5DM7 F;  4II3 A;  1YLF A;  5LLQ A;  1XCB A;  2W1O A;  3KP2 A;  1WPK A;  4N4N B;  2KT0 A;  3GZ5 A;  2HDW A;  2KDZ A;  3E3V A;  4J01 A;  1P6R A;  4NDL A;  4IL6 C;  4JQF A;  2G0E A;  3HUG B;  4EV0 A;  1FBS A;  1HDD C;  3TW6 A;  2QF7 A;  2EV5 A;  2V4J C;  1D0X A;  5IP6 A;  1Z7U A;  3S16 J;  2V26 A;  1A35 A;  2M0C A;  3GX4 X;  4HF1 A;  1X4O A;  4KIT B;  1L3L A;  2P7C B;  3TO9 A;  1ULY A;  5J3L A;  4ABZ A;  1ZG5 A;  1Z05 A;  1W4M A;  1HKT A;  3D5R C;  1HF0 A;  3BG6 A;  3CC7 I;  3M1E A;  4FIS A;  4Y7N J;  1R9T J;  2VQL A;  1AHD P;  1MMS A;  2M5W A;  2W25 A;  2DYR H;  4QPO A;  1BR2 A;  2WAE A;  4IVN A;  5F1R A;  1TW2 A;  4Q48 A;  5HDG A;  1YIJ I;  1LPQ A;  3ZN0 A;  4HQE A;  3HGG A;  4HQM A;  2A5W A;  3J81 K;  2L4A A;  1FLI A;  2ZB9 A;  1LDD A;  3CP8 A;  3BR6 A;  1B72 A;  4OU0 A;  1IUY A;  3R0J A;  3RKX A;  2BHZ A;  4IJA A;  4Z6Y A;  4FET A;  4HV6 A;  3MN2 A;  4B43 A;  1GHC A;  3HHG A;  1WKM A;  3MKY B;  3ECO A;  3QQA A;  3LSP A;  4G6D A;  4LLN A;  1LFB A;  4NB5 A;  2F6C A;  4EMS A;  1UAA A;  2KKO A;  2TCT A;  1QRY A;  2EIL H;  2CV2 A;  1ERD A;  4LG3 A;  3CUO A;  4GYI A;  4G6T B;  2JA2 A;  2JUG A;  4U0V A;  4BAC A;  2NS8 A;  4RLF A;  4C3I J;  3LSK A;  1E17 A;  2P5V A;  3U1D A;  1WJC A;  3CJN A;  4P5O A;  3Q0U A;  3RSN A;  3TO6 A;  1NK2 P;  3KP5 A;  3LWF A;  1O3T A;  1YS7 A;  3P5J A;  4F3Q A;  1UHS A;  2KHM A;  2CQX A;  3EUA A;  2DJN A;  1KU7 A;  1JTY A;  2QYO A;  4KIC A;  1IO2 A;  1KON A;  4O3M A;  1FYK A;  2BOL A;  1LUJ B;  1FTT A;  3GWZ A;  4FTH A;  3FBI B;  1R71 A;  1N75 A;  4G7H F;  3E0J B;  5BPI A;  4IQ4 A;  5LEK A;  3DTI A;  1EH7 A;  3BG7 A;  1IN6 A;  1D1B A;  3H3Z A;  2COM A;  1B8I A;  1XX5 A;  3L00 A;  3LL7 A;  4PSW A;  2X6Y A;  4G8X A;  1BR1 A;  2P7V B;  1OCC H;  3BQZ A;  1X1A A;  4ETS A;  1UG0 A;  2WTE A;  2E7X A;  2VB6 A;  2M9H A;  5D6E A;  3S2W A;  1HW1 A;  3NAR A;  1X3U A;  1MBG A;  3PSI A;  2CSO A;  3F72 A;  3JRG A;  5A2Q Z;  1GT0 C;  3E6D A;  1OPC A;  2AHQ A;  2OBP A;  3PQJ A;  4LGW A;  4E6K G;  2YU3 A;  2NOJ B;  5HLH A;  3RCO A;  4KDP A;  4BHB A;  1BI3 A;  2LR8 A;  2BV6 A;  3WTY C;  2O8K A;  4XKB A;  1VQK I;  1STZ A;  2PJP A;  3I71 A;  3T8T A;  1B1B A;  3ZMD A;  4PGG A;  1GLN A;  2XAG A;  4RGR A;  5J1U A;  4HSR A;  3DXJ F;  4ESB A;  2CFX A;  4PJM A;  3OYC A;  4A3M J;  2FEZ A;  3IAS 2;  4FCY A;  4DQ2 A;  1SD7 A;  3CZ6 A;  2R5Y A;  2M7A A;  2RAE A;  5B3S H;  1UG2 A;  3V4G A;  2H27 A;  3HM5 A;  3J80 Z;  1SVL A;  2MC3 A;  3LSI A;  1J7K A;  1G3Y A;  3R61 A;  3W2A A;  5K7Z A;  5KAI C;  3S3N A;  3V8J A;  3F8M A;  2IA0 A;  1EH8 A;  1H88 C;  1I6X A;  2VPR A;  4M6V A;  4L0Z B;  2XAH A;  4XBF A;  3VWB A;  3KE2 A;  3AFH A;  5J40 A;  1TWF J;  2DDA A;  4FQG A;  4X1E A;  1PDN C;  3ABL H;  3HPH A;  3LSR A;  4AWX B;  1WJD A;  3KP4 A;  4UUS A;  2BZT A;  2VKV A;  1T08 B;  3GME A;  1ETW A;  5A2Q K;  4HEA 2;  5FKO A;  2IGN A;  1JUP A;  3IKV A;  2XRO A;  2M30 A;  3ROU A;  2ZNY A;  2IPQ X;  3HZJ A;  2VIX A;  4DNC A;  5LD2 C;  3B6C A;  4Q4Z F;  3RTR A;  2DMT A;  4ZDL A;  3HOW J;  3DTE A;  1G4D A;  1SD6 A;  3QU3 A;  1GXQ A;  2BY3 A;  5EF6 A;  1R7J A;  2R7F A;  4IXA A;  1SVO A;  3SQN A;  4B44 A;  3E5X A;  1JT0 A;  2BW3 B;  3CP2 A;  4CXF A;  2RNJ A;  1MBK A;  3LFU A;  2KZG A;  3SZG A;  3M8J A;  4XRF A;  2LVS A;  5D5W B;  2Y0M A;  3LSM A;  1AOY A;  4PGH A;  2PQ8 A;  2CRG A;  3C7J A;  2L4M A;  1FEX A;  3QPS A;  4A0X A;  3CES A;  2P6T A;  3ISP A;  1T2K A;  3F8B A;  3J80 K;  2K7L A;  4IKF A;  2CQK A;  4S0H B;  3DFG A;  5L3D A;  3OR2 C;  4H0E A;  1K6Y A;  3IH2 A;  5DUK A;  5D5U B;  4BGD A;  2GIZ A;  3SZP A;  4M73 A;  2R7X A;  4WXC A;  1K78 A;  3HRT A;  3N05 A;  2R7Q A;  2IGM A;  3BJA A;  3M1C A;  1YHQ I;  4CUG A;  2Q2E A;  1XDU A;  2WY8 Q;  4C30 A;  2QQA A;  1HW2 A;  1FOY A;  2GXB A;  1Z21 A;  5H6Q A;  2V1U A;  4BEH B;  3KP3 A;  5LBQ A;  4CIC A;  2OF7 A;  2NVT J;  1Y8Q B;  3GTL J;  3HEF A;  1X1D A;  1UZC A;  2CQN A;  2VC1 A;  3I58 A;  4UVB A;  3TQN A;  4PJJ A;  3TO7 A;  3FWE A;  2ELH A;  3G2B A;  3U1K A;  4V2G A;  1IN4 A;  4W97 A;  1O57 A;  2HVR A;  2IAI A;  4KIF A;  5IYB J;  2J5O A;  1YIT I;  1AWC A;  1RR8 C;  2PJR A;  1IAW A;  4YEL A;  4F52 A;  1FT9 A;  1B59 A;  1FY7 A;  5E20 A;  3NWS A;  2XAF A;  2HKO A;  1BBY A;  4KIG A;  4O6J A;  2EIJ H;  3PFI A;  1QU3 A;  4UHT A;  4BDY A;  2XGC A;  3FIW A;  4RAG A;  4L9V A;  5FB2 A;  1LJ9 A;  1FX7 A;  5IT3 A;  1ON1 A;  4Y13 A;  1GVJ A;  1R58 A;  2EIM H;  2JZY A;  4LMY A;  1TBX A;  4RB3 C;  4CYC A;  1O3S A;  2ISY A;  1QHG A;  4M6X A;  3L09 A;  1KYW A;  2CUE A;  4RGU A;  3A2K A;  1GV5 A;  4LLG F;  3DV8 A;  4HV5 A;  2R7W A;  2IA2 A;  2CWE A;  3RI4 A;  2MFZ A;  4JK1 X;  2XDV A;  1HQC A;  2CU7 A;  2M8E A;  2LSO A;  5ICF A;  3HYI A;  4FX4 A;  5EGO B;  5E18 F;  3IWZ A;  2BVM A;  2VOP A;  1Z6R A;  2CUF A;  3DKY A;  4GGG A;  1MBE A;  3T1B A;  2RRE A;  1W0T A;  1I5Z A;  3H92 A;  1Y8R B;  2Y0S N;  3MAJ A;  2QA4 I;  1ODD A;  4ZTF A;  2JA7 J;  4M74 A;  5BOX A;  4I09 A;  1RKT A;  2YSR A;  2UXN A;  2A69 F;  1ONV A;  1I27 A;  1TQP A;  2LK2 A;  2R92 J;  3MEX A;  4RAF A;  2KRH A;  3HUG A;  1BM9 A;  4A2U A;  1H9T A;  4O5V A;  1UJ8 A;  5FD5 A;  3LQQ A;  4D7N A;  3JW4 A;  5C3E J;  2MD5 A;  1IV8 A;  2VLA A;  4B09 A;  2CYY A;  3SEZ A;  2MAB A;  4IHX A;  3OYL A;  3PL8 A;  2HYF A;  4KT5 C;  4KNY A;  4A5M A;  3CCL I;  2E35 A;  2HXO A;  3LA3 A;  3A01 B;  5IP9 J;  9ANT A;  3GFL A;  3TP0 A;  3WTU C;  2FXA A;  2JPC A;  2QQ9 A;  5AIP A;  1OLT A;  4LIU A;  5GPC A;  2G7H A;  4HDV A;  3BP8 A;  1YRN B;  1JTX A;  3FMR A;  1FP1 D;  2X6X A;  3BLY A;  1BOB A;  2VBX A;  4CSW A;  1LB2 A;  4L5J A;  3PJR A;  4Q47 A;  2JSP A;  4ENM A;  4UY8 I;  4G7O F;  4A12 A;  1U8B A;  4NC6 A;  5GTI C;  5IOZ A;  1FJL A;  2YX4 A;  3I4N J;  4CZZ A;  3FKJ A;  3K4C A;  2JSC A;  1I39 A;  4BKX A;  1Y56 A;  4B47 A;  4E70 A;  2KP6 A;  2HTJ A;  2HTS A;  2VXZ A;  3EQL F;  4EJW A;  2XUB A;  4GRI A;  3U2R A;  1F36 A;  2O3F A;  1A31 A;  2XAS A;  3K4J A;  3KEQ A;  4RM2 A;  2K3F A;  5M5X J;  2QKL B;  2Z1D A;  3SDG A;  4B48 A;  1WWX A;  3K1N A;  1ETK A;  2HOA A;  1D1A A;  1R1V A;  3V42 A;  1JKO C;  2JN6 A; 
#chains in the Genus database with same CATH homology
 1WJ5 A;  1W36 D;  4NQW B;  2IXS A;  2IS2 A;  3HG9 A;  3OYA A;  4XNF A;  3SEQ A;  2GOM A;  2PMZ A;  2CW8 A;  2LY2 A;  2LRE A;  2XC7 A;  4BL0 B;  3S93 A;  3EUK L;  1HA8 A;  2LBF A;  3HL2 A;  4PFP A;  3DWL E;  3K4L A;  2DCE A;  4BXF A;  2KQR A;  4XR6 A;  3L2R A;  3S3O A;  2VJ5 A;  3PNT A;  1BR4 A;  2PJR B;  2W82 A;  2R7U A;  2E60 A;  2CW7 A;  1V5E A;  4AU7 A;  3ZGK A;  4CCJ A;  4XMY A;  2XF7 A;  3OY9 A;  3PFY A;  2HVQ A;  4E7H A;  2R7R A;  3BC8 A;  2E5N A;  4HPQ A;  3DQV C;  2X51 A;  2HU9 A;  2M0M A;  4BQQ A;  3KYL A;  4E7I A;  3VSK A;  2VJJ A;  4OWR B;  4ZC3 A;  2M7B A;  2X1C A;  1MND A;  4XLC A;  4CCL A;  2K5C A;  3OYB A;  4XM3 A;  3DKX A;  4BQN A;  3OS0 A;  5HVQ C;  3A1Y A;  5CQG A;  5FRO A;  2R4G A;  5CKT A;  2ZSI B;  3QOD A;  3PUB A;  3H0D A;  5JHF A;  4XON A;  5CQE A;  3CF2 A;  3S8P A;  3RPU D;  3W3C A;  2ZXI A;  1MMD A;  4II3 A;  4CH7 A;  5HNH A;  4AYB A;  2ZFU A;  2W1O A;  3K4K A;  4N4N B;  4ZJZ A;  2HDW A;  5LFA A;  1D0Z A;  4CCN A;  2KL4 A;  1X1C A;  4E7J A;  4KJZ A;  4J01 A;  2E1M C;  4JQF A;  3W2V A;  3S3M A;  3HUG B;  2RQQ A;  3S32 A;  2IS4 A;  1V5G A;  3I3L A;  2W00 A;  3H9J A;  4C2T A;  2V4J C;  1D0X A;  4DJA A;  2V26 A;  4FAS D;  2F4I A;  1X4O A;  4KIT B;  1MW7 A;  1WJA A;  3OYG A;  3D5R C;  4XL9 A;  3BG6 A;  2W7N A;  3OOU A;  2KZV A;  3KEY A;  2VQL A;  2BVL A;  1J09 A;  4N4O B;  3F9K A;  2IGO A;  4QPO A;  4U7B A;  1BR2 A;  2WAE A;  1NG6 A;  4IX7 A;  2VXD A;  3K10 A;  2VPL A;  2L7K A;  4NC8 A;  1D0Y A;  2XSJ C;  4OAY A;  2A5W A;  3L2W A;  3GBG A;  2CMP A;  3OMY A;  2HPM A;  2DT6 A;  2HNH A;  4II2 A;  3CP8 A;  1QHH D;  1SAU A;  4DOZ A;  4MLO A;  4XOT A;  4XLH A;  2CUZ A;  3OYK A;  4FET A;  4RLQ A;  4B43 A;  1LDK B;  1U0J A;  2GOX B;  3OR1 C;  4KT6 A;  1WJF A;  3FBN B;  3RQ4 A;  3MKY B;  1MMN A;  3VSL A;  2K9M A;  2LG4 A;  2F6C A;  2FUG 2;  4XLE A;  4Y33 A;  1UAA A;  2QKM B;  1VZ0 A;  3C2H A;  2BW3 A;  2CV2 A;  1ERD A;  4C9Y A;  1LVK A;  4LG3 A;  4IQJ A;  3DPL C;  2ZSH B;  2CV1 A;  4F92 B;  4G6T B;  4DGW B;  2JA2 A;  2JUG A;  4BAC A;  4XLF A;  4RLF A;  3AKZ A;  3LSK A;  1WJC A;  4P5O A;  2L9N A;  3RSN A;  3ZRG A;  2LBF B;  4BU2 A;  2DXI A;  3OS2 A;  1W36 C;  1LFP A;  2WAD A;  2VL8 A;  4F3Q A;  1X4P A;  2LYC A;  2KHM A;  4XKC A;  3EUA A;  2WAQ A;  2DT7 B;  1KON A;  1X19 A;  2BOL A;  3ZCO A;  2LRD A;  3DPT A;  4NC7 A;  1S9H A;  3FBI B;  1YX5 A;  4XN3 A;  2L9S A;  4DIQ A;  1N75 A;  3E0J B;  3K70 C;  4IQ4 A;  3SYT A;  2X1D A;  3LSH A;  3DTI A;  3BG7 A;  1D1B A;  2AQF A;  4R79 A;  1FMW A;  4LIV A;  2L5Q A;  5HLT A;  3L2U A;  3LL7 A;  4PSW A;  2X6Y A;  1BR1 A;  3AL0 B;  1X1A A;  1EA3 A;  1UG0 A;  4HG2 A;  2HQA A;  4YEJ A;  2VB6 A;  4E7Z A;  4BE1 A;  2MD0 A;  3OYJ A;  3PSI A;  1Z3X A;  3DU6 A;  4PK4 A;  4E6K G;  4E4H A;  4PUS A;  2NOJ B;  4F93 B;  3RCO A;  3W2W A;  5KHD A;  3FDY A;  2WY7 Q;  4XKB A;  4BDZ A;  1IRX A;  4DBR A;  4BJT A;  4HNT A;  1D1C A;  3DPU A;  3BCB A;  3H9Q A;  1GLN A;  4E7K A;  1G59 A;  4HSR A;  3U21 A;  3QYB A;  5HNF A;  2KPM A;  3OYN A;  3FHN A;  1R6R A;  4BUP A;  4PJM A;  2JVH A;  4ZYA A;  3OYC A;  3IAS 2;  2A6T A;  3VYT B;  4ZTJ A;  4F55 A;  2LOO A;  2WA0 A;  3PNY A;  3CZ6 A;  2M7A A;  3TBI A;  3QOE A;  3SDB A;  4CZC A;  1TZL A;  2CUJ A;  4DBQ A;  3PSF A;  3LSI A;  1G8X A;  3W2A A;  1OR7 C;  3S3N A;  2X6W A;  3H5A A;  3OYD A;  2UWM A;  2XF5 A;  3VWB A;  2LH9 A;  1DGR M;  3AFH A;  4CCK A;  2R7O A;  2DOA A;  2LC2 A;  2RNG A;  3HPH A;  1MMG A;  5KNL A;  1MMA A;  1WJD A;  2KRC A;  3QYE A;  2M3A A;  3OYE A;  1N78 A;  3IP4 B;  3OIQ A;  1MNE A;  4U87 A;  2HZD A;  4HEA 2;  3DU5 A;  4CCM A;  2IGN A;  1X1B A;  1WJB A;  4NNJ A;  2VIX A;  5LD2 C;  1Z7L A;  3RTR A;  4BQO A;  2WB1 A;  4XKV A;  4ZDL A;  4E7L A;  2F5V A;  3DTE A;  2X1E A;  2HPI A;  1E0E A;  2MYS A;  4B44 A;  3PNV A;  3TL4 X;  2BW3 B;  2OV7 A;  3EPZ A;  3OL4 A;  4XLA A;  4D1Q A;  3CP2 A;  2LY1 A;  1Z3Y A;  3LFU A;  4BJ5 C;  2Z16 A;  1Y6I A;  3SZG A;  3M8J A;  2P0W A;  3LSM A;  3L2Q A;  4ITV A;  3OYH A;  3HPG A;  3CMM A;  3MMY B;  3CES A;  2CS3 A;  4NUB A;  4BE2 A;  2VAS A;  2V6E A;  2Q1Z B;  2DJI A;  1PYV A;  3VYS B;  4IKF A;  3OR2 C;  1K6Y A;  2UUZ A;  4IZZ A;  2Y0S A;  4BGD A;  4Y3O A;  3HC7 A;  1V5F A;  2VJ4 A;  3DLA A;  4JOM A;  3DEE A;  4OAZ A;  2R7X A;  3N05 A;  2R7Q A;  2Z2S B;  5KCM A;  2IGM A;  3M1C A;  3OWT A;  4CUG A;  4XQF A;  1N77 A;  2WY8 Q;  4C30 A;  4BJ6 C;  3DTK A;  5HOO A;  1Z21 A;  2KMU A;  2XF6 A;  4BEH B;  5TGT A;  3OYF A;  3HKZ A;  4BEH A;  3AL0 C;  2JVG A;  4PFO A;  4YRV A;  3ZXS A;  1X1D A;  3K4B A;  4F91 B;  1YX3 A;  2UV1 A;  4PJJ A;  3G2B A;  4HST A;  3K70 D;  2IS6 A;  3VYR B;  2L2O A;  2HVR A;  1NG7 A;  3ZR8 X;  3H5R A;  3D5S C;  4HNU A;  4BE0 A;  2PJR A;  1YE9 A;  3HOS A;  4YEL A;  4F52 A;  4ZDO A;  4PJN A;  3NWS A;  5FRM A;  3NWT A;  3ONQ A;  4ZDP A;  2M4K A;  3VYU B;  4BDY A;  1QU3 A;  4P1W A;  5FRN A;  3KX2 A;  3IAM 2;  2VQG A;  1AA7 A;  4AVZ A;  3I9V 2;  4C2U A;  1ZEL A;  2IS1 A;  4ANJ A;  3HOT A;  3J7A Y;  1QHG A;  4E7S A;  3OL3 A;  3H35 A;  2ZXH A;  3MKZ A;  3A2K A;  2V7F A;  2XAU A;  2R7W A;  2OC6 A;  4CCO A;  2MFZ A;  3L2V A;  2XDV A;  2CV0 A;  4KIS A;  2VQH A;  3MD2 A;  3OYM A;  3CJQ B;  4XN0 A;  1TT0 A;  1LKX A;  2BVM A;  2AQE A;  3DKY A;  1DP3 A;  2RRE A;  3EUH C;  4Y4R A;  1DGW Y;  2VKH A;  4RMN A;  4ZTF A;  1PJR A;  3VDX A;  2K3P A;  2I8D A;  4HRI A;  1P9Q C;  1WJE A;  2KRH A;  1T95 A;  3CJR B;  1DQU A;  2CFO A;  3MKW B;  1JI8 A;  2KLO A;  3LMM A;  2VKD A;  3OS1 A;  1SFK A;  2V1N A;  4BS9 A;  1UEL B;  2E1M B;  3QYF A;  4CA0 A;  2IGK A;  2VLA A;  3SEZ A;  4LIT A;  2MAB A;  3OYL A;  3PL8 A;  4XOR A;  4D9J A;  2ELJ A;  4B3X A;  2V9K A;  4H4K C;  4RM3 A;  3HXL A;  2M4G A;  3H9G A;  2OUM A;  3C2G A;  4J00 A;  3A4C A;  3E1S A;  4QPQ A;  1OLT A;  3BCA A;  4XKW A;  2HVS A;  2K9L A;  2WBM A;  4LIU A;  3H5N A;  4PJL A;  2X6X A;  2VJI A;  3BLY A;  1BOB A;  3OIP A;  2W4S A;  4CSW A;  2CH0 A;  2R7T A;  3PJR A;  2R7S A;  2JSP A;  3K4N A;  4X0G A;  2X85 A;  3UNG C;  2VQC A;  1T0F C;  3OYI A;  2R7V A;  3K6G A;  2WAF A;  3FKJ A;  3TMO A;  3K4C A;  1Y56 A;  4B47 A;  2KP6 A;  2VXZ A;  4EAT A;  4GRI A;  3K4M A;  2O5R A;  3LSG A;  4XOP A;  1FMV A;  3ZQQ A;  3K4J A;  3IUO A;  4RM2 A;  4PSX A;  2QKL B;  2Z1D A;  2E5Z A;  4B48 A;  1WFX A;  2MC4 A;  1D1A A;  2KDO A;  3UR3 C;  3V42 A;  5CPR B;  3D5L A;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...