4NC7A

N-terminal domain of delta-subunit of rna polymerase complexed with i3c and nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc7A00
2M4KA 4NC7A 4NC8A 2KRCA
chains in the Genus database with same CATH superfamily
1IC8A 1TP4A 3QP5A 1ZQ3P 3F9KA 2MH2A 2NVQJ 4E70A 3PO2J 1MH3A 3GWZA 1W36D 1BM9A 2HWVA 2FBKA 4ESJA 1UHSA 4XOTA 2WAQN 2EK5A 4FT8A 3IUOA 4IEJA 4HX8A 4NQWB 5K7ZA 2X0LA 1W36C 1IXSB 4B47A 3IKTA 1QQIA 4RGSA 5CVRA 2IGNA 4U87A 3K2ZA 2FRHA 1ULYA 4XLCA 3HC7A 1W1WE 5F0FA 1FWZA 2ESHA 3DV8A 1F36A 4GCVA 2QYOA 4B44A 2BHYA 5CKTA 4Y4RA 4EGZA 2FBHA 2WY8Q 4YEJA 2W7NA 3V8JA 2QBYA 3HEFA 4L0ZB 1LDJA 3KCCA 1MNMC 3WGGA 1YW8A 3F21A 4BJ5C 2HQAA 2W82A 4MQVA 1XPXA 4BQQA 1ONVA 4XN0A 4WCGA 1QVUA 2FU4A 1VZ0A 3JTGA 3V7RA 3KP2A 2V1UA 1I39A 2M4GA 2VBXA 3G1LA 4IRHA 4CCNA 3D1NI 3OL3A 2LKXA 2BV6A 2EV5A 4NDLA 5EJCA 1CF7B 3ZPLA 2V1NA 1WCMJ 3ZOBA 2R5YA 2QENA 2RQPA 2V7FA 2M7AA 3PO3J 4GYGA 1MZBA 2LH9A 5JVGF 3ASOH 1P7IA 2J5PA 3GYHX 3FDYA 1KU2A 2D45A 4RGXA 1I27A 1SD6A 1DP7P 5E3LA 3DKXA 1R6RA 1XSVA 2KJCA 3S1RJ 2Z33A 1G2HA 3EPZA 2MLGA 4G9YA 2DTRA 1FOKA 5GTIC 1R5HA 1N75A 3H0DA 1ZGJA 3OOPA 4AIDA 1JKPC 1XG1A 4F93B 4MQ9F 5HLIA 1FMVA 2X6XA 2L9VA 4WXCA 2OBPA 2DT7B 1RPWA 3KFWX 4HNVA 1R23A 4U0YA 2FOWA 3PNYA 3LA3A 1LVAA 2BW3A 2UUZA 1Y6IA 3HUGA 4A3KJ 1EA3A 3BG5A 1MSFC 2LG4A 1V3FA 2L2OA 2JK3A 2P4WA 4XSZF 1B9MA 2EIMH 2ZKZA 3CCRI 3TP0A 4KT6A 1SVLA 5E1XA 3DKWA 3TOBA 1JI8A 1MNDA 4R8HA 4FX4A 2DQRA 1Z1DA 2ECBA 2HDWA 3DBHB 3GUDA 4IOAF 2WB1N 3H92A 1BW5A 5K7HA 2EJRA 1OCTC 1FIPA 3IWFA 4Q48A 4X1EA 5LRSA 1Y1WJ 3KETA 4I98B 2FEZA 3GTLJ 2VQGA 3LA7A 3IH2A 1YQAA 4NC6A 4BXXJ 3OYBA 1Z67A 1YHQI 3CP8A 1ZH5A 3HGGA 1BA5A 4AIHA 1V5EA 1WI9A 3S1MJ 3ZMDA 1JUSA 1NG6A 2D1HA 3L09A 2JA2A 3DU5A 3K10A 1KU9A 2WAEA 4Q47A 5E3MA 5F1JA 3JRDA 1IZ1A 2GA1A 1IDYA 4K2EA 5EGOB 1YG2A 2LREA 4L18B 4B4CA 1RRJA 2CFXA 1L3LA 1WHUA 2DK8A 3P7NA 5TISC 2KRCA 3HSFA 2E60A 2MSYA 2DK5A 4PCQA 3LQRA 1WJFA 2DA2A 1FBQA 2AS5F 4FTHA 2XV4S 2QQAA 1X3UA 1X1BA 1VQMI 1G3WA 3QU3A 4A3BJ 1IV6A 3V4GA 1RR7A 5CJ9A 3QPHA 2VJIA 3BZKA 4V19K 1SD7A 4BE2A 5LEKA 5IOZA 3O6BB 3J81K 3HOXJ 1DUXC 1IUYA 4QTRA 3CO6C 4YIFA 3LSKA 4QLCU 1LE8B 1R49A 2GBYA 3L7WA 2K3FA 3MAJA 4FCYA 1X1DA 2YUSA 3R6SA 3L2VA 1HKQA 2K7LA 1HKSA 3CDIA 4E7LA 1D1CA 2V79A 2A07F 3DCFA 4E4HA 1RNLA 5IPAA 4ZDPA 4FQGA 3FXUA 1KQ9A 3TW6A 3OY9A 4QSHA 3OYLA 3S1QJ 2KQRA 4D9JA 3S3OA 2R7XA 2JTVA 4ZZLA 1T2KA 3CMYA 3TO7A 1HW5A 1RETA 4RB3C 1BJAA 1ETVA 2E1MC 4ZZDA 1SMTA 4EM1A 3PSIA 1IN5A 4IZZA 4XLFA 2RNJA 2DN0A 2BBYA 3CF5F 1I3QJ 2EFPA 2M4KA 3CJQB 3G2BA 3ECOA 1WFXA 2H6BA 3JSPA 1T39A 3K4CA 2CSOA 2IS1A 1NTCA 3RCOA 3LFUA 3CJNA 2VPRA 1JE8A 1TQIA 3WODF 2XASA 3G71I 2PLYA 4DNCA 2DA6A 5HLTA 2VOOA 1PP8F 1ZG3A 2MG4A 3D5SC 3FX3A 1MH4A 3K1NA 3KIOA 1IXRC 4KFCA 4UVBA 3V7SA 5LFAA 2Y30A 2W00A 2O03A 3NRVA 2V6EA 1J9IA 4IHVA 3KPHA 2R93J 1Z3XA 4IOCF 2KZVA 2LLKA 2M30A 3JCUC 5J1UA 1FBUA 1Q1HA 2W24A 1OCCH 2AQFA 5TRDA 4Z2YA 4UNOA 4B09A 3MKZA 5J4VA 1HBXG 5FFXA 4JX5A 3KX2A 3DP7A 3ZP5A 1MBEA 2PMZA 2HXIA 4HNUA 3IWZA 4BHCA 2X1CA 4ENKA 4RB0A 1WJCA 1MDMB 2QCOA 3CMEI 4ESBA 3FMQA 1RESA 1MMDA 1ODDA 3W2AA 4QIWN 3HRMA 1S7EA 3B02A 4AVZA 2H94A 3HL2A 2COBA 5EEHA 4ZDOA 2DBBA 3ABMH 3FXKA 2F5EA 5K5RA 3CUOA 3BWGA 1Z21A 2K4JA 2GXGA 3K1MA 2NNYA 4M74A 2OTLI 2XAHA 3TEDA 1IGNA 3DPUA 2WC2A 5GP9A 1LDDA 2XPVA 2MC3A 3KZIC 2KFDA 3HM5A 2H8WA 3COAC 2LVSA 2LF7A 5HDNA 3WU1B 2E2HJ 4BBSJ 3HHGA 3H0GJ 1WJ5A 3PFYA 3V8LA 2QEXI 4RBOA 1KA8A 4W1UA 1W7PB 4KYWA 1YJWI 1ENHA 2M7BA 2XB5A 3HYIA 5ICCA 3QOEA 2VC1A 2QKMB 3SYTA 1MJBA 2GIZA 2EA4A 4N4NB 1JGSA 3W6VA 5FROA 3Q0UA 1Y8RB 2K3PA 3DFGA 4G7HF 4HDUA 3MD2A 1X2NA 1JXSA 3DLLF 1S8NA 3LL7A 4HZFA 4A0YA 3K9TA 2CS3A 1JKQC 1L0OC 1H88C 1HSTA 4II2A 5E20A 4LITA 2RREA 4YELA 2ZSHB 1ZHFA 4CXFA 1P4WA 2Z16A 1TWHJ 4XRSG 4EJWA 2XAJA 5TGTA 3A01B 3HOYJ 3TOAA 1B59A 2LY1A 5D5UB 2VJ4A 2YX4A 2GXAA 1DU6A 2IGMA 4II3A 2FE3A 2BE5F 3AFHA 2B9SA 4UVCA 2VPLA 2LDUA 2Q2EA 3SZPA 1ZN2A 2M5WA 5JLWA 3A0BC 2HEOA 3K4KA 2CO5A 2GA2A 2W4SA 3H3UA 5DD8A 3BTLA 5FLVA 2FNPA 1B72A 3TQNA 2Z3YA 1DQUA 4BQOA 1OYIA 3FXQA 1WJBA 4BL0B 2G7UA 3RIRA 2KIQA 3VYSB 2VIXA 4PFPA 1YRNB 5J8FA 4U7BA 1BR1A 1VQ8I 2ZCWA 3CUQC 2DJNA 2NOJB 3MKWB 2PJRA 4NHJA 1S7OA 3RZOJ 1OLTA 4LIUA 4Y52J 2JZYA 3F8CA 1SVMA 2QUFA 3F8BA 3ZRGA 3OYEA 3AAFA 2IA1A 3SFZA 3ZN0A 3ABKH 1QHGA 1XMKA 1UZCA 3KLNA 1QZEA 5H6QA 3Q0WA 1P7JA 3HKZA 1TW3A 4CHUA 1XB4A 2DPDA 3HXLA 1TW2A 2LNBA 2F5VA 5HOOA 2NS8A 1HCRA 5DM7F 2DA5A 2GXBA 1MBGA 2IGKA 1GVDA 1STZA 3OYKA 3DXJF 2VQLA 3FKIJ 2DFFA 5H20A 2GIVA 4PUSA 1MBHA 3QOPA 4F3QA 1QA6A 4MGRA 3HIFA 4A12A 4NC7A 3CUQA 4BE0A 2CWEA 4A0XA 3C2BA 1X1AA 2LR8A 1A31A 3DTIA 4LB5A 3E5UA 4LLNA 1VQNI 2K27A 3BZ6A 2PMHA 3IH4A 5B1BH 4X0GA 4UV9A 1WJDA 4CH7A 5DYMA 1FP1D 5EG0A 4L9TA 2VKEA 5BOXA 4JP0A 3KYCB 1UJ8A 4KITB 5E79C 1B8IB 3AG4H 3DLAA 3QU6A 2VBZA 3LQQA 1XTAA 1E3OC 4IVNA 3CJRB 2ZB9A 3KE2A 4JYKA 3GEZA 4BQNA 3CCQI 5FKNA 4CCKA 1SEUA 4M71A 1SAUA 5DCMA 1KGSA 2OAZA 1G59A 4AYBN 2OQGA 2L01A 1I1GA 4DZJA 2O7OA 4CGZA 4MEYF 2XAGA 3JRFA 4MTDA 2HQ5A 2K40A 1LEAA 3OS0A 2DODA 2RVCA 3GZ5A 3B6CA 4M6XA 1HSJA 3ISPA 4RAZA 2BOLA 3TMOA 5ICGA 2XKPA 3JW4A 4M73A 1ZYRF 1HA8A 2DW4A 1UMQA 2TCTA 2RC4A 5LGNA 3K1PA 1G8XA 2ZFUA 2A6HF 3KEOA 1ORKA 2Y0SA 1O3RA 2LKPA 4MLOA 2FJ1A 2OF7A 3BR6A 3MVPA 4P55A 3K70D 3AL0B 3M8FA 3SDGA 2LRDA 3OYNA 3QPSA 4M6VA 3EYYA 3GTPJ 3K70C 2IPQX 2FXAA 2ZC2A 3EUHC 2RAEA 4IHTA 1FBSA 3E97A 1WSUA 4LMYA 2Y75A 2Q0OA 4A6DA 5ILSA 2ISYA 3LAPA 4LG0A 1K6YA 3ONQA 4DYCA 3BTIA 4DJAA 2CW0F 2Z1DA 3CCMI 1LEBA 2AHQA 4BKXA 3GTJJ 2XF7A 2H1LA 3QP6A 4PJ0C 1W0TA 4HLYA 4LG3A 3P5JA 2H1KA 3DKYA 5H6RA 3G73A 1QGPA 5CQEA 2VUMJ 4DBRA 5ILVA 1D0YA 1SMYF 2K9SA 4HSRA 4HG2A 4I99C 5KAFC 2D2WA 3MKYB 4N9HA 2W85A 4N0BA 4XKWA 3S15J 4U0WA 3JTHA 1A5JA 3FWEA 4HF2A 3VPRA 1FP2A 1LJ9A 1XSXA 3U9GA 1M1EB 3LNQA 3R0JA 3EUHA 4P96A 2VB6A 2DMPA 1S6LA 4MO7A 2XHKA 2ELJA 1KU3A 2JUGA 2L5QA 2JSPA 4EMSA 2XGDA 2G0EA 2Z2SB 2DCEA 3C18A 5H2FC 5BMZA 4G6QA 3MMYB 1EH6A 3ZQQA 1R4NB 3BP8A 3BROA 2E1OA 2EZLA 3MZ8A 3PUBA 2M8GX 3I55I 3D5RC 2RGVA 3WTVC 2W1OA 4M3BA 3WU0A 5LRRA 2ADUA 4Y17A 2WAQA 4A5MA 1R1UA 4EM0B 4EV0A 5IYDJ 1ACIA 1QZYA 1FYMA 3GFLA 2P5LC 1B9NA 2OA4A 3BCAA 3KEYA 3LSRA 4B1RA 2DT5A 2STTA 3OIPA 3T5XA 2HDDA 3U1DA 1F1ZA 3VDXA 3S2HJ 2R7UA 1TWFJ 3LA2A 3N97A 3H1CA 4PSXA 1FSEA 1HLVA 1T33A 3CCJI 3KP5A 1U9OA 2BHZA 1WPKA 2IS4A 3V42A 5IYBJ 5D6EA 2JQ7A 2LTPA 3M1EA 2DAOA 1E3HA 4CSWA 2JJ7A 4HF0A 4YFXF 1ERDA 1KQ8A 5DM6F 1BIAA 2JWTA 1SFUA 1E3PA 2JN6A 3F3XA 4HA8A 2IEKA 2FQ4A 4ENMA 3WTZA 2EINH 3ZQHA 2RV8A 3CTAA 2P8TA 1TT0A 1PVEA 1YI2I 3GTGJ 3V7CA 3LSIA 2CQNA 4E7ZA 2XB0X 3AG1H 3WE2A 1YLFA 3PSFA 1ZGAA 4RMNA 2X1EA 3A1YA 3VSLA 2HU9A 3E5QA 2VQHA 1V54H 1XGOA 4OAYA 3I64A 3OIQA 1QNTA 4XKBA 2EH3A 3S2WA 2CGPA 1LFPA 4WF2A 2WWYA 1JHHA 3O2PE 1Y39A 2EA2A 2VQCA 2VN2A 1WH5A 2ACJA 3OYIA 1VF9A 2KIUA 1TC3C 4CCJA 3NAUA 2YU9J 1XMXA 2M2EA 5CVUA 2N8GA 5FD5A 3VWBA 4RLFA 4AIKA 2DDAA 4GRIA 3DEWA 2HVQA 2X48A 2IA2A 5HNHA 3WTYC 3A4CA 2VT2A 1XN7A 1SC7A 1SD4A 4EATA 2X6OA 3HG9A 2BY0A 2WB1A 2IGOA 3OMYA 2UWMA 2KDOA 2MD0A 3HUGB 4BEHB 1QU3A 1Z6TA 1BJZA 2GZWA 3E5XA 3A2KA 4W97A 2V1DA 4B43A 2K4BA 2V26A 4KIBA 2BZTA 5J4YA 3O8GA 4KUMA 3JR9A 1LDKB 1DU0A 2PQ8A 3RQ4A 5IOYA 2C6YA 2LK2A 1CQTA 1VQ7I 3MFKA 1SFKA 6PAXA 1OJLA 3CJTB 2HYFA 5GAHJ 4XLHA 5FLXK 3RKQA 4PSWA 1SANA 1REPC 3H5NA 4R79A 3M3YJ 3JRIA 2KL4A 4KT5C 3OWTA 3VFZA 2P5VA 2Q1ZB 4L9NA 2EQRA 3R61A 4LK0F 4UV8A 4ZJZA 2R0QC 1X4OA 2MYSA 1S29A 4CZCA 1X1PA 1ZG1A 3HSEA 5L3DA 5J1YA 1R4MB 4A3LJ 4ZYHA 5J1RA 3ASNH 1WJAA 5HS8A 2BVLA 1CF7A 2KRHA 3TBIA 4P9UA 1IF1A 3KZYA 3BG6A 3ZQIA 2ESNA 2EFWA 3FK6A 4BU2A 1GV5A 1J09A 2V4JC 3BC8A 3ZMTA 2M0MA 3ZQFA 2F2EA 4UUSA 4C3JJ 1HW1A 2A3SA 1F9NA 2DOFA 3NEUA 3DU6A 1FPQA 2VJ5A 4B48A 1ZG5A 1LNWA 3BR2A 4F7ZA 1D5YA 5EZGA 4E7SA 1GHCA 1I5ZA 5HDGA 3O3KA 4ENJA 1K79A 2WTEA 4CDGA 4D1QA 4O5VA 1MIJA 4KMFA 2VOPA 2K9NA 4L5EA 3TDZC 2HKXA 1ZKGA 4D5CA 5L3CA 3EUKL 3MZYA 3CO7C 1OCPA 5CQGA 3CCLI 1JHFA 3CDLA 3K0LA 1JUMA 1LVKA 3TO6A 1HDPA 1LKXA 1WQ2A 3HOWJ 3KEQA 3EDPA 1YW7A 4XK4A 4L5JA 1FEXA 1SVOA 1Y0UA 2JA8J 1RR8C 2BY1A 4YG2F 2KMUA 2KT0A 3DEEA 5FKLA 2V6CA 3UR3C 2LFBA 4G94A 1SFXA 5F1RA 1FT9A 4J19A 1U8BA 4HPQA 3I4MJ 3F8NA 5GADJ 3H36A 1S7AA 3J81Z 4BAYA 4GFBA 1HF0A 5ICEA 1KYZA 3F22A 3OYJA 3W3CA 5FRMA 2R7TA 4KICA 4FHTA 2CFOA 5J40A 2HOTA 1LUJB 3F72A 4OOIA 1U3EM 4MFEA 2VC0A 3KLOA 2OCEA 3BR5A 5LHGA 5EGOA 2FOKA 2M45A 1WH7A 3ZXSA 2VONA 1EV7A 4IRGA 3L2RA 2O3FA 1D0XA 2DA3A 2DPUA 1N78A 4HEA2 4PFOA 3BCBA 4HQEA 1J5YA 5D4SA 2FF4A 2M8EA 2G9WA 2DLLA 2CUEA 4RLQA 4XKVA 1OCZH 4CO8A 2UXNA 3CCEI 2QWWA 1T95A 3LSHA 1ON2A 3FKJA 1T98A 2IBDA 4DQ2A 3GZNB 2NOGA 3JRBA 1LPQA 4BXFA 2VXZA 3E0JB 5IT9K 1RI7A 3Q5FA 1R71A 4E7JA 1LE8A 2L0KA 1FJLA 1IRXA 4RA2A 5DDGA 2XSJC 3BTCA 5E1WA 1Z7UA 1VQ4I 1MMAA 4IXAA 5JLXA 2HKOA 4A5NA 2HVSA 4BHBA 5EEAA 1LFBA 2EV6A 4M3GA 2MLKA 2NYXA 1HKTA 3DBRB 3T1BA 1QO0D 1NH3A 4PJNA 2WA0A 4FX0A 2IA0A 2FNAA 2V9KA 3KZZA 5J47A 4XIDA 3HJEA 5K7FA 4C3IJ 2CW8A 2HS5A 1O3TA 2KISA 4EJOA 4HNTA 2DMQA 1J75A 1DGRM 4HQMA 1S5LC 4OAZA 3BPXA 4XRMA 4G6TB 3DWLE 2K9MA 4AVPA 2BY2A 1V5GA 2QKLB 4DYQA 1WKMA 2HVRA 2Y9ZA 1FTZA 2ETHA 3CF2A 4QWQA 4ENNA 3HSRA 2EILH 2ZBKA 4A0ZA 2AQEA 2PMUA 5F08A 4UUTA 2VT3A 2R3SA 1XGMA 3CQZJ 2E5NA 3W6KB 5IY5H 3ROUA 1BI3A 1EH8A 1P2FA 3JRHA 2QSFX 2CQXA 2W57A 4XORA 5HS9A 3RSNA 1H9TA 1W7PD 4HW0A 4C9YA 3FXOA 2L7ZA 2A5YB 2HTSA 3GFMA 5DEQA 5EDNA 2ELHA 2ZNZA 2E2JJ 2BGCA 2YU3A 1ZGWA 3E1SA 5JHUA 4DOZA 1WWXA 1MDMA 3PQJA 1FNNA 3K4LA 4UUVA 5LBQA 3ZMZA 4XM3A 3SFIA 4CUGA 2MBFA 1F43A 5F6FA 4LFUA 4L9JA 4NB5A 4RAYA 1PUFA 1ZRFA 2M0CA 3I59B 1MBKA 4XKCA 1W4MA 4ANJA 4HRIA 2PMZN 4XICA 1B4AA 1K78B 2EZHA 5HNFA 4F92B 1B72B 4I09A 2FA5A 3F0CA 3EYIA 3IHUA 2H8RA 1IJWC 4CZZA 4M9ZA 3OV8A 3SEZA 3HBLA 4Q4ZF 1JGGA 1XD7A 5LHHA 2O8XA 1UG0A 4C2UA 4RDUA 2V9PA 1BC7C 1IN6A 3RJPA 2PJRB 1IXCA 5TJJA 4MFDA 1RKTA 1IRFA 3SHFA 5KK1A 4I02A 3CMAI 1ZARA 3HRUA 1I1SA 4C3HJ 5GPCA 4IHSA 1T38A 3ZCOA 2ZXIA 3MN2A 2L9NA 4DZPA 4BH9A 3I54A 1FYKA 3I58A 5FLMJ 4V2FA 1ZK8A 2OZUA 4NBQA 2JPCA 1QZZA 3SDBA 2XSDC 2EIKH 1R1VA 3OYAA 2IRFG 4I2OA 1NG7A 3L2CA 2O6GE 4JX4A 1AWCA 3CD6I 3X2QH 2GLOA 4A3DJ 4KMUX 2QQ8A 2DMNA 3A02A 4LJZF 2LY2A 3F23A 5M5WJ 5AONA 2NRAC 2KIMA 4HV6A 4Y7NJ 3I56I 5LD2C 5FRNA 1VQPI 2A68F 1IRGA 2EBIA 3VYRB 4B3AA 1O57A 1Z3YA 4JOMA 1G3SA 3ZQCA 3RPUD 1YS6A 3A01A 2IP2A 4DW6A 2MW8A 3CUQB 1YYVA 3Q0VA 2L4AA 1OCOH 5B3SH 2JRTA 1UHWA 4XLEA 5DCFA 4ABZA 2P7CB 4KJZA 1MKMA 3WU2C 2R7VA 4G12A 4PDKA 4ZYGA 5EYRA 2DTZA 2KP6A 4ESFA 3J80K 3L00A 3I71A 1R36A 2AO9A 4HX7A 5EG0B 1R58A 5A2QK 2LSOA 4KA4A 2ZXWH 1XCBA 1BI1A 5HS7A 1TQMA 2EFQA 4AYBA 2XF5A 2K5CA 2OQRA 1I50J 2Y31A 2CMPA 2BVMA 2HOSA 2OTJI 3H5AA 4M6YA 2QZ8A 2BXYA 3NWTA 3I9V2 5M3MJ 2QA4I 1U8RA 3LWFA 4RAGA 1YRNA 2KLOA 4UB6C 1K83J 2XPWA 5E8GA 2FD5A 5BPIA 2PI0A 1FZPB 5DCMB 2KPMA 2ZMEB 3BR1A 2X1DA 1T0FC 1O4XA 3SZTA 4A69C 3ZGKA 2Y48A 2VKHA 2CV0A 2CQKA 2F5FA 4I76A 1PYVA 2HYGD 3CC7I 4BY1J 2EV0A 1I6HJ 1IO2A 1JTYA 1XMAA 1QPMA 4BUPA 4N9IA 5KNLA 4C2MJ 2K86A 1R22A 1YE9A 1D1AA 4BACA 3HDDA 1IG7A 3L2QA 4GXOA 2NVXJ 3IRQA 4OMZA 5LGTA 2I8DA 3BR3A 4D7NA 1VQ5I 2QF7A 3PL8A 1GVJA 3Q9SA 2M34A 2AXLA 5DS9A 1OKRA 2COMA 4TV7A 3T8TA 3J7YJ 4BQAA 2VI6A 5C44J 3WHCA 4AU7A 4KDPA 2PN6A 1D8JA 1MJAA 2ZO4A 4OIQF 2YR2A 4U88A 3QYEA 4EGYA 2VKVA 4XMYA 5K5QA 1SFEA 1A36A 1D5VA 4LG0B 3REOA 2R7FA 2EWNA 4NNJA 1ITYA 1T0FA 3WE3A 4LLGF 4XN3A 5J6XA 2R5ZA 1APLC 1D0ZA 3QWLA 3CCUI 1LFUP 1OQYA 1B6AA 1V4RA 5HODA 4FE7A 4QPOA 5CLSA 3FXMA 4S05A 3W2WA 2VBWA 5ERIA 1AKHB 3E7LA 2CW7A 4V2GA 2DMTA 4EJUA 1U5TC 2NXNB 3AL0C 1FMWA 1IDZA 3JREA 1YS7A 2P0WA 3DQVC 1YJNI 2L02A 1ETWA 3GFJA 5D5VB 2XKOA 2KJBA 4IRIA 5F0CA 3K4JA 1Y1VJ 2VBYA 2KKOA 5B5EC 2XC7A 4M3EA 3RKXA 1PJRA 1ZR2A 1W0UA 3D5LA 5F04A 1DGWY 3HTSB 4J01A 2M1BA 2JA7J 1A04A 3C7JA 3IL2A 1VQKI 1BW6A 3RYPA 1NK3P 1F5TA 3BY6A 1TQPA 1YIOA 3FBIB 4Z6YA 2TRTA 4PGGA 1E0EA 4J00A 2VASA 5F27A 3QPLA 3E3VA 4I0BA 2F5DA 1BOAA 1XGNA 2VKDA 4LOCA 4WXHA 3S32A 1V55H 4ETSA 4GDFA 1HQCA 2O61A 3KP7A 4PZJA 1MBJA 2Y2ZA 1ZAOA 3KP3A 5HVQC 5M3FJ 1K4SA 1IUFA 1BBYA 2XGCA 1UAAA 4AC0A 1YJ9I 3U1KA 3IKVA 2UV1A 1U5TA 1Z05A 1DPRA 2ELKA 2F48A 4FETA 1VQ9I 2X6WA 1BI2A 1BOBA 4UXNA 3L1PA 3P9KA 3PNTA 5IYCJ 4FE4A 3HOZJ 1N77A 3K4BA 2OJED 1KYWA 3FXLA 4YRVA 5F0HA 3VYUB 1EJ9A 2Y0SN 1P6RA 4BDYA 3H3ZA 3M7GA 4Y3OA 4OIOF 2DA1A 3DPLC 3B73A 1ETYA 4P9FA 5GAEJ 2E19A 3EQLF 1HOMA 4CYCB 3HPHA 1T56A 2A6TA 4U0VA 2TDXA 4JBAA 3TL4X 1K61A 4A3CJ 1H9GA 4AWXB 1LQ1A 5FKMA 3NWSA 4ZH4F 1O3QA 2EZIA 1XDSA 3OL4A 4Y15A 1G4DA 2JA5J 3GXOA 3LSGA 1G3TA 1JUPA 4WWCA 4BS9A 4RM2A 3VB2A 4IKFA 4PJJA 1IN4A 4IQ4A 3LSMA 2GOMA 1ZLKA 2FUG2 3AG3H 1R9TJ 3F8FA 1Q1VA 2HZTA 2XIGA 3PNVA 2HI3A 2HYJA 2KDZA 2PFBA 1BI0A 5L3EA 4BBRJ 3M07A 1IV8A 3J7AY 4DBQA 3BJ6A 2LY9A 2DJIA 3SZGA 3VODA 2OCCH 1GUUA 3N4MA 1X4PA 2MFZA 2RQQA 1HXDA 3HHHA 3JAMK 3KYDB 4IHYA 2P6SA 2IT0A 2LBFA 4A3GJ 2DYSH 4OINF 4H0EA 2B0LA 3E6CC 5CPRB 2QBYB 2K85A 2BXZA 3GVAA 3JRGA 3RDIA 4G7ZF 2VODA 4O3MA 3PQKA 1SAXA 1U9NA 1X3WB 1NK2P 2CU7A 2G7HA 4U7DA 5KVRA 3F6OA 2L9RA 3CDHA 2R7QA 5BQTA 3GFIA 3M1CA 3SQNA 2DYRH 3FIWA 2QLZA 4HSTA 4WX9A 3OYMA 4OWRB 1USTA 4N4OB 2R5YB 4RB1A 4CICA 2W48A 4IO9F 5C4XJ 4UVAA 3KP6A 3G3ZA 1GLNA 2Z5UA 4HLXA 1MNEA 5IP9J 3GW2A 2F4OB 4P1WA 5AIQA 2ZXJA 4BNCA 1VQOI 2H09A 4AM3A 5BNGA 2H27A 4YFNF 5KCMA 5IP6A 5D6FA 4NC8A 2CV1A 4M3DA 4PGHA 4ASNA 4G8XA 3T0YA 1TNTA 2NS7A 4CYDA 2LC2A 1VQ6I 5CVVA 2IVMA 1B1BA 3LSPA 3QAHA 1QHHD 2Y0MA 1K6OA 2LF8A 3QYFA 2CUJA 1GV2A 3A03A 2RN7A 2BW3B 4C30A 5LEJA 3H3VK 2DA7A 3B6AA 2OU2A 1ZRCA 4OIRF 4E7HA 3PIOF 2XVCA 3OSGA 4NQWA 4A3JJ 2JT1A 3ABLH 4ZTJA 2A5WA 2X6YA 1ETOA 2IJLA 3SXYA 5K1YA 1RIOH 1OCRH 2E35A 2R7ZJ 5E3NA 3FM5A 1YX5A 1H89C 3CCYA 3BJAA 2KRFA 4XL9A 2RKHA 2A6EF 1AOYA 2PBIA 3GLLA 5FLXZ 4CCLA 2O0YA 1ZREA 1XX5A 3S93A 3FF5A 4A93J 2DMUA 2GWRA 4UUSB 3QODA 3RPQA 3CESA 1YW9A 5LLQA 1HDDC 2WY7Q 2ZSIB 4MTEA 4X6AJ 1TBXA 5M5YJ 1H0MA 2M9HA 3ZMSA 3H9GA 2ZJRF 3U2RA 3ECHA 3FZVA 4F55A 3ELKA 2JA6J 1JKRC 3BLYA 3MEXA 2WAFA 1EF4A 3FM3A 2HXOA 4I0AA 4WK8F 2CH0A 3WTXC 3TO9A 2Z9OA 2VJJA 1JTXA 4BEHA 1BC8C 2HDCA 2XAQA 1UELB 4LLLA 1ETKA 1TWGJ 2MGQA 2HGCA 3S1NJ 3TDUC 1XGSA 4EJVA 2VLAA 3BT9A 3FBNB 4M9XA 2EFOA 2A69F 1R7JA 1TLHB 3OYDA 2K9QA 3LFKA 1Y8QB 1QPIA 2R92J 4MHGA 2K02A 4A3MJ 2WV1A 1J7KA 1UHMA 3BPVA 4JK1X 5DV5A 2PEXA 3O8HA 1TZLA 4BYYA 1V5FA 1NHAA 3HTUA 4XBFA 4QPQA 5EEGA 1IAWA 1CGPA 2Z99A 3EUAA 2AXTC 1BL0A 1BIBA 1X19A 2OV7A 5IP7J 2OD5A 1R00A 2CUZA 2OZ6A 3HZJA 4XSXF 4CCOA 3I53A 3OOUA 2DT6A 3HGYA 3J7ZI 2E1CA 2LP0A 2FSWA 3NQOA 1EKEA 1ZTRA 4RAFA 3JSOA 3MZHA 4M72A 1O3SA 3BQZA 5E1ZB 2DOAA 1RC9A 4BXUA 3E6DA 3H5RA 1XCVA 4RM3A 4WXDA 5FKOA 3HOVJ 4MNUA 9ANTA 1XDUA 3TKYA 4UHTA 3VEPA 4HDVA 3OIOA 3BG9A 1TWCJ 4FASD 1SD5A 3UKGA 5FB2A 4A3FJ 1C0WA 3H9QA 5C4JJ 1D1BA 3HOUJ 4AD9A 2O9LA 4IPAA 3ERED 4BJTA 5E17F 1X58A 1OYWA 3KP4A 3ZR8X 5HLHA 4G7OF 2R4GA 3FXJA 4B3XA 2ZXHA 4XRFA 4KNYA 1A6QA 3IH3A 4ZYDA 5JR3A 3HRSA 5ED4A 1ON1A 2Y9YA 2EB7A 3I5UA 3S17J 1JT0A 3OS1A 3GTMJ 3GO5A 3DEUA 1W5CC 3OSFA 4ZYAA 5AIPA 3J7AO 1A35A 1J2XA 4XLAA 1POGA 1WJEA 2QVOA 2O8KA 3QPTA 4RGUA 2A05A 2HTJA 3BJOA 3S2DJ 4O6JA 3AKZA 4EJTA 4EVIA 1R5ID 1TT5B 4HAMA 3ZQLA 4MIMA 1DDNA 2UXXA 1OFCX 2P6TA 1R1TA 1HW2A 1JJ8C 1XC5A 3IC7A 5JFRA 2E1MB 1KZHA 4D5FA 4BJ6C 3LAJA 2EIJH 1X3ZB 3S3NA 1G6NA 4UB8C 1FC3A 1XS9A 4IJAA 2FMLA 3WHBA 5ICFA 5IT9Z 4XOPA 3GMEA 4R1HA 3BTJA 3ZQ7A 4BDZA 2XDVA 2P5KA 1H8AC 3ML6A 2XRNA 2DFIA 4C2TA 4Y13A 3LOCA 5M5XJ 1G3YA 3HRTA 4PK4A 1J59A 1ETXA 2LOOA 1T08B 4YFKF 4IX7A 3V8KA 1FYLA 1F4KA 2P81A 4JQFA 1I3AA 2ICWG 5F64A 2IXSA 2MD5A 3C2HA 4BHPA 3M9AA 3FMSA 3M4OJ 2X9DA 3I4NJ 4L0YB 1W5TA 2XF6A 4L9VA 2Q8KA 4UY8I 4EM2A 2LYCA 3S14J 2R7WA 2EPFA 4BGDA 4A2UA 1T6SA 3TGNA 5FKKA 2ID3A 4ZC3A 3GTOJ 1QVTA 3D0SA 5FJ8J 4DGWB 1IN8A 3PIPF 4LB6B 4HF1A 1X1CA 5GTHC 5IT3A 5L3FA 1AU7A 5E3OA 3GX4X 3IP4B 2J5OA 3CMMA 2DDBA 2W25A 4F91B 5KAIC 2DA4A 2XAFA 2NS0A 4G6DA 1PUFB 1R5GA 1S72I 2E7WA 3RTRA 1BR2A 3W6JB 2X4HA 1KQ0A 2WV0A 4PJLA 2XUBA 4I6ZA 1Z9CA 3SJMA 2DQLA 5ILUA 3G6EI 1UG2A 2QM3A 1BR4A 2RNGA 3HPGA 3MWMA 1VTNC 3SEQA 1VQLI 1AA7A 2BYVE 1WI3A 3ZMVA 5FO5A 3JRCA 1TWAJ 1O7FA 2Q2EB 3BR0A 4BE1A 4A3IJ 2ZJQF 1ZELA 1U2WA 3RZDJ 4KN7X 2DU9A 3FXRA 3H9JA 4EQQA 1FLIA 1P9QC 2L54A 5D8KB 2R7RA 3S8PA 2NAZA 3PM1A 4DYRA 1MMNA 2ZNYA 1E17A 1Y0NA 1S9HA 3VYTB 2JSCA 3Q9VA 1A6IA 5D5XB 1Y56A 1PDNC 3BOQA 3F6VA 1UFMA 1FTTA 2HQRA 4GO1A 5B1AH 2ECCA 3BZCA 3NARA 1MBFA 4CA0A 1U0JA 5K5OA 4Y33A 3CLOA 5EZHA 5J3LA 2VE9A 2CYYA 4HV5A 5J8CA 1TTYA 2XPUA 2PJPA 3PFIA 5LGUA 4HBLA 2YS9A 1OISA 1Z91A 2L7KA 2ME6A 1GXPA 1KU7A 4GYIA 3DPTA 1W7PA 1IW7F 2F4IA 4ZYEA 3WTSC 1WZ2A 2HZDA 3S3MA 1WGXA 1EH7A 2ZFWA 3GCMA 3T8RA 4L5IA 3HOSA 5D5WB 2X51A 1RUOA 1ETQA 1OR7C 1DP3A 3WGIA 3CC4I 2IS2A 5DTDA 3HB9A 3I0TA 2EFNA 2LD5A 2O5RA 3L2WA 2K9LA 3LSTA 2ZJPF 4A6EA 2VE8A 3I59A 2L4MA 5D4RA 4D0PA 4KIFA 3L2UA 2XGXA 5FGMA 3EETA 1K78A 3S16J 2HNHA 4RGRA 3IAM2 4IF4A 1OPCA 1I6XA 4IL6C 1MSEC 2HR3A 1FSHA 4OIPF 3GTQJ 1W5SA 4LIVA 1FX7A 3K4MA 2FBIA 2L7MP 5KHDA 5E18F 2L3DA 3OYCA 1VFCA 2LKSA 2PG4A 2R7DA 3CP2A 1QBJA 3VOEA 2CQ7A 2HOEA 2EZKA 3TP3A 2JPBA 1FOXA 2MC4A 3G1OA 2E71A 1WRJA 4XLNF 1O7LA 2RDPA 1UB9A 1ZLJA 1Z6RA 3GLXA 3M8EA 5E8IA 3J80Z 3ZMUA 1Z7LA 2GOXB 1MW7A 2VXDA 5A2QZ 1LB2A 1OR7A 4BY7J 2D1VA 4ZDLA 1HC8A 3WTWC 2QQ9A 5GAGJ 2HPMA 3G1MA 3CCSI 3KYLA 1YX3A 2M87A 4S0HB 2YPRA 1DPUA 3UNGC 3ABTA 4P5OA 4Q5SF 3OYGA 3CC2I 1D8KA 3W2VA 3K6GA 1JJ6C 2FX0A 2IW5A 3ERMA 1J0RA 2W84A 5BPDA 4IHWA 4LGWA 2WADA 1IN7A 3WTTC 2PX9A 3LSJA 3F8MA 5BS6A 2MA3A 2ZMEC 1ZR4A 2R7OA 3ESWB 3OYFA 3K7AJ 3RQIA 3QQAA 4IHXA 2DOEA 1MJ9A 3C1DA 2E7XA 2YSRA 3RPUA 2D5VA 3WGHA 4A3EJ 4ZTFA 1GXQA 2L9SA 4ITVA 4OMYA 4XNFA 1VNDA 2GQQA 5C3EJ 1YOVB 3E6BA 3GZ6A 2DO7A 3IV5A 2R5ZB 2NVTJ 1IRZA 2GM4A 3ABUA 3CLQA 4E6KG 3DTKA 5FFZA 5JHFA 2QQBA 3PUFA 3CCVI 3C3WA 3PJRA 1AHDP 3BDDA 3HKZN 4I01A 4E7IA 1RZ4A 1SFOJ 2HQNA 1X2MA 2E34A 2GAUA 3QYBA 3E6MA 2DI3A 3FK7A 2STWA 5DUIA 2B7EA 4XLPF 2ZMEA 2E2IJ 3MQ0A 3OYHA 2JRMA 5DUKA 2OPTA 2MABA 5CYVA 4F52A 2KIFA 2Y69H 4KIGA 3WTUC 4XONA 2DFEA 4KN4X 4D7MA 3FHZA 3RI4A 2V9VA 3OS2A 3IRRA 3GBGA 4OU0A 2A61A 3K69A 1PP7U 1JKOC 4YIRX 2I5UA 1B8IA 3DBLB 1KONA 4XR6A 2F5CA 3Q3SA 4XQFA 2OC6A 2HFHA 4KISA 5D8LB 4B8XA 1BN5A 2R7SA 1MD0A 1P92A 1U5TB 2FQ3A 3WG7H 1FOWA 3HOTA 3P9IA 4S04A 1K4TA 2E5ZA 2BEOA 1YTYA 3R4KA 3A0HC 3R0AA 5HDKA 4JX6A 5HLGA 1PUEE 2KHMA 4H4KC 4EEFG 5JI6A 3R60A 4MEXF 2ZJ2A 1YFHA 2M3AA 3FISA 2WBMA 1E2XA 2VL8A 1OYYA 4PJMA 2CG4A 4AIJA 3K2AA 2E1NA 4DIQA 1GT0C 1QRYA 3P9CA 2NVUB 5DD4A 4YIIA 2UZKA 1K7AA 3WG9A 1P4AA 3RYRA 5B66C 2NNNA 3MCZA 1YIJI 4XRSA 5CVIA 2NVYJ 3H35A 3L9FA 5FD6A 1AKHA 1U6GA 1Z77A 5JVTA 1ZRDA 4AUXA 4RB2C 2LMDA 4GGGA 3DTEA 3TW7A 4LD5A 2IS6A 4FISA 1D3YA 1FIAA 5EF6A 3OR2C 2JVHA 4M3FA 2F6CA 3MKLA 2F4MB 2FMYA 2HOAA 5CVJA 1RUNA 4HYEA 2CV2A 2XROA 2LBFB 3QRFF 2H6CA 3ZQGA 1U78A 2YX7A 1Z0XA 3JRAA 2B63J 3VSKA 2JUCA 1TL8A 2IAIA 5GPAA 2CJJA 3RKWA 3GTKJ 3M8JA 3C2GA 3BG3A 1RKWA 4I7HA 3ZN1A 3FHNA 2BY3A 1OMIA 2L7FP 3N05A 3U21A 5L3GA 1S3JA 2MH9A 1T8IA 1FY7A 2XAUA 2JMWA 2JVGA 2XGEA 3G4SI 2DXIA 3BQYA 3CZ6A 2I10A 4LK1F 1MGTA 1UCRA 5LHIA 4ON0A 2QGUA 4HX4A 3OR1C 2DFHA 2CUFA 5L3BA 3RKYA 3ULQB 2CRGA 3GF2A 3JAMZ 4HOBA 3LMMA 1JT6A 1WVRA 2ID6A 1N25A 4IQJA 1MMGA 2QSHX 1TNSA 1P4XA 2X85A 1YO5C 2OUMA 3DF8A 3IAS2 4E7KA 3FMRA 2QSGX 4CCMA 4RS8A 4M9SA 2ISZA 2E36A 2KZGA 2ME0A 2CQQA 1VI0A 2HPIA 1XSDA 4NUBA 4CYCA 3K4NA 1FOYA 1GDTA 1USSA 3BG7A 3I3LA 1YITI 2V1XA 3I4PA 1MMSA 2P7VB 2XRLA 3AG2H
chains in the Genus database with same CATH topology
1SAUA 3K4LA 1G59A 3F9KA 3H9QA 4XM3A 4CUGA 1W36D 1D1BA 4XOTA 3IUOA 4NQWB 4BJTA 4XKCA 1W36C 3ZR8X 4B47A 4ANJA 3OS0A 4HRIA 2R4GA 4B3XA 2IGNA 2ZXHA 4U87A 5HNFA 2BOLA 3TMOA 4F92B 4XLCA 3HC7A 1HA8A 4B44A 1G8XA 2ZFUA 5CKTA 3OS1A 2Y0SA 4Y4RA 3SEZA 2WY8Q 4YEJA 4ZYAA 2W7NA 4MLOA 4XLAA 1UG0A 3K70D 4C2UA 1WJEA 3AL0B 2LRDA 4BJ5C 2PJRB 2HQAA 2W82A 3OYNA 4BQQA 4XN0A 3K70C 1VZ0A 3EUHC 3ZCOA 3AKZA 2M4GA 2ZXIA 2L9NA 4CCNA 3OL3A 2V1NA 1K6YA 2E1MB 3ONQA 3SDBA 4BJ6C 3OYAA 2V7FA 2M7AA 4DJAA 1NG7A 2LH9A 2Z1DA 3S3NA 3FDYA 2XF7A 4XOPA 4LG3A 2LY2A 3DKYA 3DKXA 1R6RA 4BDZA 2XDVA 5CQEA 3EPZA 4DBRA 5LD2C 1D0YA 5FRNA 4HSRA 4HG2A 4C2TA 3MKYB 1N75A 3VYRB 3H0DA 4XKWA 1Z3YA 4JOMA 4PK4A 3RPUD 4F93B 1FMVA 2X6XA 2LOOA 2DT7B 4IX7A 4XLEA 3PNYA 4JQFA 2BW3A 4KJZA 2UUZA 2VB6A 1Y6IA 2R7VA 2IXSA 2L5QA 1EA3A 2ELJA 2JUGA 2JSPA 2LG4A 2L2OA 2KP6A 2Z2SB 2DCEA 3C2HA 3MMYB 3ZQQA 2XF6A 3PUBA 4KT6A 4AYBA 3D5RC 2XF5A 1JI8A 1MNDA 2K5CA 2LYCA 2W1OA 2R7WA 4BGDA 2HDWA 2CMPA 2BVMA 3H5AA 2WAQA 3NWTA 4ZC3A 3I9V2 4DGWB 2KLOA 3BCAA 3KEYA 1X1CA 2KPMA 2VQGA 3IP4B 3CMMA 3OIPA 2X1DA 1T0FC 4F91B 3OYBA 3CP8A 3ZGKA 2VKHA 3VDXA 2CV0A 1V5EA 2R7UA 3RTRA 1BR2A 1PYVA 4PSXA 1NG6A 2JA2A 3DU5A 3K10A 4PJLA 2WAEA 2IS4A 3V42A 1BR4A 2RNGA 4BUPA 3HPGA 5KNLA 3SEQA 2LREA 4CSWA 1YE9A 1D1AA 4BACA 3L2QA 1AA7A 1ERDA 2I8DA 2KRCA 2E60A 2Q2EB 4BE1A 1ZELA 3PL8A 1WJFA 3H9JA 1P9QC 4AU7A 2R7RA 3S8PA 1X1BA 1MMNA 3QYEA 1TT0A 1S9HA 3VYTB 2VJIA 4XMYA 3LSIA 4E7ZA 4BE2A 1Y56A 4NNJA 3PSFA 4RMNA 2X1EA 3A1YA 3VSLA 2HU9A 4XN3A 2VQHA 4CA0A 1U0JA 3LSKA 1D0ZA 4OAYA 3OIQA 4XKBA 4QPOA 4Y33A 1X1DA 1LFPA 3L2VA 3W2WA 2CW7A 4E7LA 3AL0C 2VQCA 1D1CA 1FMWA 3OYIA 2L7KA 2P0WA 3DQVC 3DPTA 4CCJA 4E4HA 2F4IA 2HZDA 3S3MA 4ZDPA 3K4JA 3OY9A 3VWBA 2XC7A 4RLFA 3OYLA 1PJRA 3HOSA 3D5LA 4GRIA 2KQRA 1DGWY 2HVQA 2X51A 4D9JA 5HNHA 3S3OA 1OR7C 4J01A 2R7XA 3A4CA 1DP3A 2IS2A 4EATA 3HG9A 2E1MC 2WB1A 2IGOA 3OMYA 3PSIA 2UWMA 2KDOA 2MD0A 2O5RA 3HUGB 2K9LA 4XLFA 4BEHB 3L2WA 4IZZA 1QU3A 3A2KA 3FBIB 1E0EA 2M4KA 3CJQB 3G2BA 2VASA 4B43A 3L2UA 4J00A 2V26A 2HNHA 1WFXA 1LDKB 3IAM2 3K4CA 2IS1A 2VKDA 3S32A 3RCOA 3RQ4A 3LFUA 5HVQC 1SFKA 5HLTA 4LIVA 3K4MA 5KHDA 1UAAA 4XLHA 4PSWA 3D5SC 3OYCA 3H5NA 4R79A 2UV1A 2KL4A 3OWTA 3CP2A 2Q1ZB 4FETA 5LFAA 2X6WA 2MC4A 2W00A 4ZJZA 1BOBA 2V6EA 3PNTA 1X4OA 2MYSA 1N77A 3K4BA 4CZCA 1Z3XA 4YRVA 2KZVA 3VYUB 1Z7LA 2GOXB 1MW7A 1WJAA 2VXDA 2BVLA 4BDYA 2AQFA 4Y3OA 4ZDLA 3DPLC 2KRHA 3TBIA 3MKZA 2HPMA 3HPHA 2A6TA 3BG6A 3TL4X 3KX2A 3KYLA 3NWSA 1YX3A 2PMZA 4BU2A 3OL4A 3UNGC 4P5OA 4HNUA 1J09A 2V4JC 2X1CA 3LSGA 3OYGA 3BC8A 4BS9A 1WJCA 2M0MA 3W2VA 3K6GA 4RM2A 4IKFA 4PJJA 4IQ4A 3LSMA 1MMDA 2GOMA 2WADA 3W2AA 2FUG2 3DU6A 2R7OA 3OYFA 2VJ5A 4B48A 3PNVA 4AVZA 3HL2A 4E7SA 4ZDOA 3J7AY 4DBQA 4ZTFA 2DJIA 2L9SA 4D1QA 4ITVA 3SZGA 1Z21A 4XNFA 1X4PA 2MFZA 2RQQA 3EUKL 5CQGA 3DPUA 2LBFA 1LVKA 5CPRB 1LKXA 4E6KG 3DTKA 5JHFA 1WJ5A 3PFYA 3PJRA 2KMUA 3DEEA 4E7IA 2R7QA 3UR3C 2M7BA 3M1CA 4HSTA 3OYMA 3QYBA 4OWRB 3QOEA 4N4OB 2QKMB 4HPQA 3SYTA 4N4NB 1GLNA 5FROA 1MNEA 2K3PA 3OYHA 3MD2A 3OYJA 2MABA 4P1WA 3W3CA 5FRMA 2R7TA 4F52A 2CFOA 3LL7A 5KCMA 4XONA 4NC8A 2CV1A 2CS3A 4II2A 3OS2A 3GBGA 4LITA 2RREA 4YELA 2ZSHB 2LC2A 2Z16A 1KONA 5TGTA 4XR6A 3ZXSA 2LY1A 2VJ4A 1QHHD 2IGMA 3L2RA 4II3A 2OC6A 4XQFA 3QYFA 3AFHA 2CUJA 1D0XA 4KISA 2VPLA 2R7SA 1N78A 4HEA2 3HOTA 4PFOA 2BW3B 3BCBA 4C30A 2E5ZA 3K4KA 4E7HA 2W4SA 4RLQA 4XKVA 2KHMA 4H4KC 4ZTJA 2A5WA 1T95A 2X6YA 2M3AA 3LSHA 3FKJA 2WBMA 1DQUA 2VL8A 4BQOA 4PJMA 4BL0B 1WJBA 1YX5A 4BXFA 4DIQA 2VXZA 3E0JB 3VYSB 4E7JA 4XL9A 2VIXA 4PFPA 1IRXA 2XSJC 4U7BA 1BR1A 2NOJB 4CCLA 1MMAA 3S93A 3MKWB 2PJRA 3H35A 1OLTA 2HVSA 3QODA 3CESA 4LIUA 3DTEA 2WY7Q 2IS6A 2ZSIB 4PJNA 3ZRGA 3OYEA 3OR2C 2JVHA 2WA0A 3H9GA 4F55A 2V9KA 2F6CA 3BLYA 1QHGA 2WAFA 3HKZA 2CV2A 2CH0A 2LBFB 3HXLA 2CW8A 2VJJA 3VSKA 4BEHA 4HNTA 1UELB 2F5VA 5HOOA 1DGRM 4OAZA 2IGKA 4G6TB 3OYKA 3M8JA 3DWLE 2VQLA 3C2GA 2VLAA 3FBNB 2K9MA 3FHNA 3N05A 4PUSA 3U21A 3OYDA 1V5GA 2XAUA 2QKLB 4F3QA 2HVRA 2JVGA 4NC7A 2DXIA 4BE0A 3CZ6A 1TZLA 1X1AA 1V5FA 3CF2A 3DTIA 3OR1C 4QPQA 3EUAA 2AQEA 3LMMA 4X0GA 1X19A 2OV7A 4IQJA 1MMGA 2CUZA 1WJDA 4CCOA 4CH7A 2X85A 2E5NA 3OOUA 2DT6A 2OUMA 3IAS2 4KITB 4E7KA 3RSNA 4XORA 4CCMA 3DLAA 2DOAA 4C9YA 2HPIA 3H5RA 4NUBA 3CJRB 3K4NA 4RM3A 3BG7A 3I3LA 4BQNA 4CCKA 3E1SA 4FASD 4DOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M4K A;  4NC7 A;  4NC8 A;  2KRC A; 
#chains in the Genus database with same CATH topology
 1IC8 A;  1TP4 A;  3QP5 A;  1ZQ3 P;  3F9K A;  2MH2 A;  2NVQ J;  4E70 A;  3PO2 J;  1MH3 A;  3GWZ A;  1W36 D;  1BM9 A;  2HWV A;  2FBK A;  4ESJ A;  1UHS A;  4XOT A;  2WAQ N;  2EK5 A;  4FT8 A;  3IUO A;  4IEJ A;  4HX8 A;  4NQW B;  5K7Z A;  2X0L A;  1W36 C;  1IXS B;  4B47 A;  3IKT A;  1QQI A;  4RGS A;  5CVR A;  2IGN A;  4U87 A;  3K2Z A;  2FRH A;  1ULY A;  4XLC A;  3HC7 A;  1W1W E;  5F0F A;  1FWZ A;  2ESH A;  3DV8 A;  1F36 A;  4GCV A;  2QYO A;  4B44 A;  2BHY A;  5CKT A;  4Y4R A;  4EGZ A;  2FBH A;  2WY8 Q;  4YEJ A;  2W7N A;  3V8J A;  2QBY A;  3HEF A;  4L0Z B;  1LDJ A;  3KCC A;  1MNM C;  3WGG A;  1YW8 A;  3F21 A;  4BJ5 C;  2HQA A;  2W82 A;  4MQV A;  1XPX A;  4BQQ A;  1ONV A;  4XN0 A;  4WCG A;  1QVU A;  2FU4 A;  1VZ0 A;  3JTG A;  3V7R A;  3KP2 A;  2V1U A;  1I39 A;  2M4G A;  2VBX A;  3G1L A;  4IRH A;  4CCN A;  3D1N I;  3OL3 A;  2LKX A;  2BV6 A;  2EV5 A;  4NDL A;  5EJC A;  1CF7 B;  3ZPL A;  2V1N A;  1WCM J;  3ZOB A;  2R5Y A;  2QEN A;  2RQP A;  2V7F A;  2M7A A;  3PO3 J;  4GYG A;  1MZB A;  2LH9 A;  5JVG F;  3ASO H;  1P7I A;  2J5P A;  3GYH X;  3FDY A;  1KU2 A;  2D45 A;  4RGX A;  1I27 A;  1SD6 A;  1DP7 P;  5E3L A;  3DKX A;  1R6R A;  1XSV A;  2KJC A;  3S1R J;  2Z33 A;  1G2H A;  3EPZ A;  2MLG A;  4G9Y A;  2DTR A;  1FOK A;  5GTI C;  1R5H A;  1N75 A;  3H0D A;  1ZGJ A;  3OOP A;  4AID A;  1JKP C;  1XG1 A;  4F93 B;  4MQ9 F;  5HLI A;  1FMV A;  2X6X A;  2L9V A;  4WXC A;  2OBP A;  2DT7 B;  1RPW A;  3KFW X;  4HNV A;  1R23 A;  4U0Y A;  2FOW A;  3PNY A;  3LA3 A;  1LVA A;  2BW3 A;  2UUZ A;  1Y6I A;  3HUG A;  4A3K J;  1EA3 A;  3BG5 A;  1MSF C;  2LG4 A;  1V3F A;  2L2O A;  2JK3 A;  2P4W A;  4XSZ F;  1B9M A;  2EIM H;  2ZKZ A;  3CCR I;  3TP0 A;  4KT6 A;  1SVL A;  5E1X A;  3DKW A;  3TOB A;  1JI8 A;  1MND A;  4R8H A;  4FX4 A;  2DQR A;  1Z1D A;  2ECB A;  2HDW A;  3DBH B;  3GUD A;  4IOA F;  2WB1 N;  3H92 A;  1BW5 A;  5K7H A;  2EJR A;  1OCT C;  1FIP A;  3IWF A;  4Q48 A;  4X1E A;  5LRS A;  1Y1W J;  3KET A;  4I98 B;  2FEZ A;  3GTL J;  2VQG A;  3LA7 A;  3IH2 A;  1YQA A;  4NC6 A;  4BXX J;  3OYB A;  1Z67 A;  1YHQ I;  3CP8 A;  1ZH5 A;  3HGG A;  1BA5 A;  4AIH A;  1V5E A;  1WI9 A;  3S1M J;  3ZMD A;  1JUS A;  1NG6 A;  2D1H A;  3L09 A;  2JA2 A;  3DU5 A;  3K10 A;  1KU9 A;  2WAE A;  4Q47 A;  5E3M A;  5F1J A;  3JRD A;  1IZ1 A;  2GA1 A;  1IDY A;  4K2E A;  5EGO B;  1YG2 A;  2LRE A;  4L18 B;  4B4C A;  1RRJ A;  2CFX A;  1L3L A;  1WHU A;  2DK8 A;  3P7N A;  5TIS C;  2KRC A;  3HSF A;  2E60 A;  2MSY A;  2DK5 A;  4PCQ A;  3LQR A;  1WJF A;  2DA2 A;  1FBQ A;  2AS5 F;  4FTH A;  2XV4 S;  2QQA A;  1X3U A;  1X1B A;  1VQM I;  1G3W A;  3QU3 A;  4A3B J;  1IV6 A;  3V4G A;  1RR7 A;  5CJ9 A;  3QPH A;  2VJI A;  3BZK A;  4V19 K;  1SD7 A;  4BE2 A;  5LEK A;  5IOZ A;  3O6B B;  3J81 K;  3HOX J;  1DUX C;  1IUY A;  4QTR A;  3CO6 C;  4YIF A;  3LSK A;  4QLC U;  1LE8 B;  1R49 A;  2GBY A;  3L7W A;  2K3F A;  3MAJ A;  4FCY A;  1X1D A;  2YUS A;  3R6S A;  3L2V A;  1HKQ A;  2K7L A;  1HKS A;  3CDI A;  4E7L A;  1D1C A;  2V79 A;  2A07 F;  3DCF A;  4E4H A;  1RNL A;  5IPA A;  4ZDP A;  4FQG A;  3FXU A;  1KQ9 A;  3TW6 A;  3OY9 A;  4QSH A;  3OYL A;  3S1Q J;  2KQR A;  4D9J A;  3S3O A;  2R7X A;  2JTV A;  4ZZL A;  1T2K A;  3CMY A;  3TO7 A;  1HW5 A;  1RET A;  4RB3 C;  1BJA A;  1ETV A;  2E1M C;  4ZZD A;  1SMT A;  4EM1 A;  3PSI A;  1IN5 A;  4IZZ A;  4XLF A;  2RNJ A;  2DN0 A;  2BBY A;  3CF5 F;  1I3Q J;  2EFP A;  2M4K A;  3CJQ B;  3G2B A;  3ECO A;  1WFX A;  2H6B A;  3JSP A;  1T39 A;  3K4C A;  2CSO A;  2IS1 A;  1NTC A;  3RCO A;  3LFU A;  3CJN A;  2VPR A;  1JE8 A;  1TQI A;  3WOD F;  2XAS A;  3G71 I;  2PLY A;  4DNC A;  2DA6 A;  5HLT A;  2VOO A;  1PP8 F;  1ZG3 A;  2MG4 A;  3D5S C;  3FX3 A;  1MH4 A;  3K1N A;  3KIO A;  1IXR C;  4KFC A;  4UVB A;  3V7S A;  5LFA A;  2Y30 A;  2W00 A;  2O03 A;  3NRV A;  2V6E A;  1J9I A;  4IHV A;  3KPH A;  2R93 J;  1Z3X A;  4IOC F;  2KZV A;  2LLK A;  2M30 A;  3JCU C;  5J1U A;  1FBU A;  1Q1H A;  2W24 A;  1OCC H;  2AQF A;  5TRD A;  4Z2Y A;  4UNO A;  4B09 A;  3MKZ A;  5J4V A;  1HBX G;  5FFX A;  4JX5 A;  3KX2 A;  3DP7 A;  3ZP5 A;  1MBE A;  2PMZ A;  2HXI A;  4HNU A;  3IWZ A;  4BHC A;  2X1C A;  4ENK A;  4RB0 A;  1WJC A;  1MDM B;  2QCO A;  3CME I;  4ESB A;  3FMQ A;  1RES A;  1MMD A;  1ODD A;  3W2A A;  4QIW N;  3HRM A;  1S7E A;  3B02 A;  4AVZ A;  2H94 A;  3HL2 A;  2COB A;  5EEH A;  4ZDO A;  2DBB A;  3ABM H;  3FXK A;  2F5E A;  5K5R A;  3CUO A;  3BWG A;  1Z21 A;  2K4J A;  2GXG A;  3K1M A;  2NNY A;  4M74 A;  2OTL I;  2XAH A;  3TED A;  1IGN A;  3DPU A;  2WC2 A;  5GP9 A;  1LDD A;  2XPV A;  2MC3 A;  3KZI C;  2KFD A;  3HM5 A;  2H8W A;  3COA C;  2LVS A;  2LF7 A;  5HDN A;  3WU1 B;  2E2H J;  4BBS J;  3HHG A;  3H0G J;  1WJ5 A;  3PFY A;  3V8L A;  2QEX I;  4RBO A;  1KA8 A;  4W1U A;  1W7P B;  4KYW A;  1YJW I;  1ENH A;  2M7B A;  2XB5 A;  3HYI A;  5ICC A;  3QOE A;  2VC1 A;  2QKM B;  3SYT A;  1MJB A;  2GIZ A;  2EA4 A;  4N4N B;  1JGS A;  3W6V A;  5FRO A;  3Q0U A;  1Y8R B;  2K3P A;  3DFG A;  4G7H F;  4HDU A;  3MD2 A;  1X2N A;  1JXS A;  3DLL F;  1S8N A;  3LL7 A;  4HZF A;  4A0Y A;  3K9T A;  2CS3 A;  1JKQ C;  1L0O C;  1H88 C;  1HST A;  4II2 A;  5E20 A;  4LIT A;  2RRE A;  4YEL A;  2ZSH B;  1ZHF A;  4CXF A;  1P4W A;  2Z16 A;  1TWH J;  4XRS G;  4EJW A;  2XAJ A;  5TGT A;  3A01 B;  3HOY J;  3TOA A;  1B59 A;  2LY1 A;  5D5U B;  2VJ4 A;  2YX4 A;  2GXA A;  1DU6 A;  2IGM A;  4II3 A;  2FE3 A;  2BE5 F;  3AFH A;  2B9S A;  4UVC A;  2VPL A;  2LDU A;  2Q2E A;  3SZP A;  1ZN2 A;  2M5W A;  5JLW A;  3A0B C;  2HEO A;  3K4K A;  2CO5 A;  2GA2 A;  2W4S A;  3H3U A;  5DD8 A;  3BTL A;  5FLV A;  2FNP A;  1B72 A;  3TQN A;  2Z3Y A;  1DQU A;  4BQO A;  1OYI A;  3FXQ A;  1WJB A;  4BL0 B;  2G7U A;  3RIR A;  2KIQ A;  3VYS B;  2VIX A;  4PFP A;  1YRN B;  5J8F A;  4U7B A;  1BR1 A;  1VQ8 I;  2ZCW A;  3CUQ C;  2DJN A;  2NOJ B;  3MKW B;  2PJR A;  4NHJ A;  1S7O A;  3RZO J;  1OLT A;  4LIU A;  4Y52 J;  2JZY A;  3F8C A;  1SVM A;  2QUF A;  3F8B A;  3ZRG A;  3OYE A;  3AAF A;  2IA1 A;  3SFZ A;  3ZN0 A;  3ABK H;  1QHG A;  1XMK A;  1UZC A;  3KLN A;  1QZE A;  5H6Q A;  3Q0W A;  1P7J A;  3HKZ A;  1TW3 A;  4CHU A;  1XB4 A;  2DPD A;  3HXL A;  1TW2 A;  2LNB A;  2F5V A;  5HOO A;  2NS8 A;  1HCR A;  5DM7 F;  2DA5 A;  2GXB A;  1MBG A;  2IGK A;  1GVD A;  1STZ A;  3OYK A;  3DXJ F;  2VQL A;  3FKI J;  2DFF A;  5H20 A;  2GIV A;  4PUS A;  1MBH A;  3QOP A;  4F3Q A;  1QA6 A;  4MGR A;  3HIF A;  4A12 A;  4NC7 A;  3CUQ A;  4BE0 A;  2CWE A;  4A0X A;  3C2B A;  1X1A A;  2LR8 A;  1A31 A;  3DTI A;  4LB5 A;  3E5U A;  4LLN A;  1VQN I;  2K27 A;  3BZ6 A;  2PMH A;  3IH4 A;  5B1B H;  4X0G A;  4UV9 A;  1WJD A;  4CH7 A;  5DYM A;  1FP1 D;  5EG0 A;  4L9T A;  2VKE A;  5BOX A;  4JP0 A;  3KYC B;  1UJ8 A;  4KIT B;  5E79 C;  1B8I B;  3AG4 H;  3DLA A;  3QU6 A;  2VBZ A;  3LQQ A;  1XTA A;  1E3O C;  4IVN A;  3CJR B;  2ZB9 A;  3KE2 A;  4JYK A;  3GEZ A;  4BQN A;  3CCQ I;  5FKN A;  4CCK A;  1SEU A;  4M71 A;  1SAU A;  5DCM A;  1KGS A;  2OAZ A;  1G59 A;  4AYB N;  2OQG A;  2L01 A;  1I1G A;  4DZJ A;  2O7O A;  4CGZ A;  4MEY F;  2XAG A;  3JRF A;  4MTD A;  2HQ5 A;  2K40 A;  1LEA A;  3OS0 A;  2DOD A;  2RVC A;  3GZ5 A;  3B6C A;  4M6X A;  1HSJ A;  3ISP A;  4RAZ A;  2BOL A;  3TMO A;  5ICG A;  2XKP A;  3JW4 A;  4M73 A;  1ZYR F;  1HA8 A;  2DW4 A;  1UMQ A;  2TCT A;  2RC4 A;  5LGN A;  3K1P A;  1G8X A;  2ZFU A;  2A6H F;  3KEO A;  1ORK A;  2Y0S A;  1O3R A;  2LKP A;  4MLO A;  2FJ1 A;  2OF7 A;  3BR6 A;  3MVP A;  4P55 A;  3K70 D;  3AL0 B;  3M8F A;  3SDG A;  2LRD A;  3OYN A;  3QPS A;  4M6V A;  3EYY A;  3GTP J;  3K70 C;  2IPQ X;  2FXA A;  2ZC2 A;  3EUH C;  2RAE A;  4IHT A;  1FBS A;  3E97 A;  1WSU A;  4LMY A;  2Y75 A;  2Q0O A;  4A6D A;  5ILS A;  2ISY A;  3LAP A;  4LG0 A;  1K6Y A;  3ONQ A;  4DYC A;  3BTI A;  4DJA A;  2CW0 F;  2Z1D A;  3CCM I;  1LEB A;  2AHQ A;  4BKX A;  3GTJ J;  2XF7 A;  2H1L A;  3QP6 A;  4PJ0 C;  1W0T A;  4HLY A;  4LG3 A;  3P5J A;  2H1K A;  3DKY A;  5H6R A;  3G73 A;  1QGP A;  5CQE A;  2VUM J;  4DBR A;  5ILV A;  1D0Y A;  1SMY F;  2K9S A;  4HSR A;  4HG2 A;  4I99 C;  5KAF C;  2D2W A;  3MKY B;  4N9H A;  2W85 A;  4N0B A;  4XKW A;  3S15 J;  4U0W A;  3JTH A;  1A5J A;  3FWE A;  4HF2 A;  3VPR A;  1FP2 A;  1LJ9 A;  1XSX A;  3U9G A;  1M1E B;  3LNQ A;  3R0J A;  3EUH A;  4P96 A;  2VB6 A;  2DMP A;  1S6L A;  4MO7 A;  2XHK A;  2ELJ A;  1KU3 A;  2JUG A;  2L5Q A;  2JSP A;  4EMS A;  2XGD A;  2G0E A;  2Z2S B;  2DCE A;  3C18 A;  5H2F C;  5BMZ A;  4G6Q A;  3MMY B;  1EH6 A;  3ZQQ A;  1R4N B;  3BP8 A;  3BRO A;  2E1O A;  2EZL A;  3MZ8 A;  3PUB A;  2M8G X;  3I55 I;  3D5R C;  2RGV A;  3WTV C;  2W1O A;  4M3B A;  3WU0 A;  5LRR A;  2ADU A;  4Y17 A;  2WAQ A;  4A5M A;  1R1U A;  4EM0 B;  4EV0 A;  5IYD J;  1ACI A;  1QZY A;  1FYM A;  3GFL A;  2P5L C;  1B9N A;  2OA4 A;  3BCA A;  3KEY A;  3LSR A;  4B1R A;  2DT5 A;  2STT A;  3OIP A;  3T5X A;  2HDD A;  3U1D A;  1F1Z A;  3VDX A;  3S2H J;  2R7U A;  1TWF J;  3LA2 A;  3N97 A;  3H1C A;  4PSX A;  1FSE A;  1HLV A;  1T33 A;  3CCJ I;  3KP5 A;  1U9O A;  2BHZ A;  1WPK A;  2IS4 A;  3V42 A;  5IYB J;  5D6E A;  2JQ7 A;  2LTP A;  3M1E A;  2DAO A;  1E3H A;  4CSW A;  2JJ7 A;  4HF0 A;  4YFX F;  1ERD A;  1KQ8 A;  5DM6 F;  1BIA A;  2JWT A;  1SFU A;  1E3P A;  2JN6 A;  3F3X A;  4HA8 A;  2IEK A;  2FQ4 A;  4ENM A;  3WTZ A;  2EIN H;  3ZQH A;  2RV8 A;  3CTA A;  2P8T A;  1TT0 A;  1PVE A;  1YI2 I;  3GTG J;  3V7C A;  3LSI A;  2CQN A;  4E7Z A;  2XB0 X;  3AG1 H;  3WE2 A;  1YLF A;  3PSF A;  1ZGA A;  4RMN A;  2X1E A;  3A1Y A;  3VSL A;  2HU9 A;  3E5Q A;  2VQH A;  1V54 H;  1XGO A;  4OAY A;  3I64 A;  3OIQ A;  1QNT A;  4XKB A;  2EH3 A;  3S2W A;  2CGP A;  1LFP A;  4WF2 A;  2WWY A;  1JHH A;  3O2P E;  1Y39 A;  2EA2 A;  2VQC A;  2VN2 A;  1WH5 A;  2ACJ A;  3OYI A;  1VF9 A;  2KIU A;  1TC3 C;  4CCJ A;  3NAU A;  2YU9 J;  1XMX A;  2M2E A;  5CVU A;  2N8G A;  5FD5 A;  3VWB A;  4RLF A;  4AIK A;  2DDA A;  4GRI A;  3DEW A;  2HVQ A;  2X48 A;  2IA2 A;  5HNH A;  3WTY C;  3A4C A;  2VT2 A;  1XN7 A;  1SC7 A;  1SD4 A;  4EAT A;  2X6O A;  3HG9 A;  2BY0 A;  2WB1 A;  2IGO A;  3OMY A;  2UWM A;  2KDO A;  2MD0 A;  3HUG B;  4BEH B;  1QU3 A;  1Z6T A;  1BJZ A;  2GZW A;  3E5X A;  3A2K A;  4W97 A;  2V1D A;  4B43 A;  2K4B A;  2V26 A;  4KIB A;  2BZT A;  5J4Y A;  3O8G A;  4KUM A;  3JR9 A;  1LDK B;  1DU0 A;  2PQ8 A;  3RQ4 A;  5IOY A;  2C6Y A;  2LK2 A;  1CQT A;  1VQ7 I;  3MFK A;  1SFK A;  6PAX A;  1OJL A;  3CJT B;  2HYF A;  5GAH J;  4XLH A;  5FLX K;  3RKQ A;  4PSW A;  1SAN A;  1REP C;  3H5N A;  4R79 A;  3M3Y J;  3JRI A;  2KL4 A;  4KT5 C;  3OWT A;  3VFZ A;  2P5V A;  2Q1Z B;  4L9N A;  2EQR A;  3R61 A;  4LK0 F;  4UV8 A;  4ZJZ A;  2R0Q C;  1X4O A;  2MYS A;  1S29 A;  4CZC A;  1X1P A;  1ZG1 A;  3HSE A;  5L3D A;  5J1Y A;  1R4M B;  4A3L J;  4ZYH A;  5J1R A;  3ASN H;  1WJA A;  5HS8 A;  2BVL A;  1CF7 A;  2KRH A;  3TBI A;  4P9U A;  1IF1 A;  3KZY A;  3BG6 A;  3ZQI A;  2ESN A;  2EFW A;  3FK6 A;  4BU2 A;  1GV5 A;  1J09 A;  2V4J C;  3BC8 A;  3ZMT A;  2M0M A;  3ZQF A;  2F2E A;  4UUS A;  4C3J J;  1HW1 A;  2A3S A;  1F9N A;  2DOF A;  3NEU A;  3DU6 A;  1FPQ A;  2VJ5 A;  4B48 A;  1ZG5 A;  1LNW A;  3BR2 A;  4F7Z A;  1D5Y A;  5EZG A;  4E7S A;  1GHC A;  1I5Z A;  5HDG A;  3O3K A;  4ENJ A;  1K79 A;  2WTE A;  4CDG A;  4D1Q A;  4O5V A;  1MIJ A;  4KMF A;  2VOP A;  2K9N A;  4L5E A;  3TDZ C;  2HKX A;  1ZKG A;  4D5C A;  5L3C A;  3EUK L;  3MZY A;  3CO7 C;  1OCP A;  5CQG A;  3CCL I;  1JHF A;  3CDL A;  3K0L A;  1JUM A;  1LVK A;  3TO6 A;  1HDP A;  1LKX A;  1WQ2 A;  3HOW J;  3KEQ A;  3EDP A;  1YW7 A;  4XK4 A;  4L5J A;  1FEX A;  1SVO A;  1Y0U A;  2JA8 J;  1RR8 C;  2BY1 A;  4YG2 F;  2KMU A;  2KT0 A;  3DEE A;  5FKL A;  2V6C A;  3UR3 C;  2LFB A;  4G94 A;  1SFX A;  5F1R A;  1FT9 A;  4J19 A;  1U8B A;  4HPQ A;  3I4M J;  3F8N A;  5GAD J;  3H36 A;  1S7A A;  3J81 Z;  4BAY A;  4GFB A;  1HF0 A;  5ICE A;  1KYZ A;  3F22 A;  3OYJ A;  3W3C A;  5FRM A;  2R7T A;  4KIC A;  4FHT A;  2CFO A;  5J40 A;  2HOT A;  1LUJ B;  3F72 A;  4OOI A;  1U3E M;  4MFE A;  2VC0 A;  3KLO A;  2OCE A;  3BR5 A;  5LHG A;  5EGO A;  2FOK A;  2M45 A;  1WH7 A;  3ZXS A;  2VON A;  1EV7 A;  4IRG A;  3L2R A;  2O3F A;  1D0X A;  2DA3 A;  2DPU A;  1N78 A;  4HEA 2;  4PFO A;  3BCB A;  4HQE A;  1J5Y A;  5D4S A;  2FF4 A;  2M8E A;  2G9W A;  2DLL A;  2CUE A;  4RLQ A;  4XKV A;  1OCZ H;  4CO8 A;  2UXN A;  3CCE I;  2QWW A;  1T95 A;  3LSH A;  1ON2 A;  3FKJ A;  1T98 A;  2IBD A;  4DQ2 A;  3GZN B;  2NOG A;  3JRB A;  1LPQ A;  4BXF A;  2VXZ A;  3E0J B;  5IT9 K;  1RI7 A;  3Q5F A;  1R71 A;  4E7J A;  1LE8 A;  2L0K A;  1FJL A;  1IRX A;  4RA2 A;  5DDG A;  2XSJ C;  3BTC A;  5E1W A;  1Z7U A;  1VQ4 I;  1MMA A;  4IXA A;  5JLX A;  2HKO A;  4A5N A;  2HVS A;  4BHB A;  5EEA A;  1LFB A;  2EV6 A;  4M3G A;  2MLK A;  2NYX A;  1HKT A;  3DBR B;  3T1B A;  1QO0 D;  1NH3 A;  4PJN A;  2WA0 A;  4FX0 A;  2IA0 A;  2FNA A;  2V9K A;  3KZZ A;  5J47 A;  4XID A;  3HJE A;  5K7F A;  4C3I J;  2CW8 A;  2HS5 A;  1O3T A;  2KIS A;  4EJO A;  4HNT A;  2DMQ A;  1J75 A;  1DGR M;  4HQM A;  1S5L C;  4OAZ A;  3BPX A;  4XRM A;  4G6T B;  3DWL E;  2K9M A;  4AVP A;  2BY2 A;  1V5G A;  2QKL B;  4DYQ A;  1WKM A;  2HVR A;  2Y9Z A;  1FTZ A;  2ETH A;  3CF2 A;  4QWQ A;  4ENN A;  3HSR A;  2EIL H;  2ZBK A;  4A0Z A;  2AQE A;  2PMU A;  5F08 A;  4UUT A;  2VT3 A;  2R3S A;  1XGM A;  3CQZ J;  2E5N A;  3W6K B;  5IY5 H;  3ROU A;  1BI3 A;  1EH8 A;  1P2F A;  3JRH A;  2QSF X;  2CQX A;  2W57 A;  4XOR A;  5HS9 A;  3RSN A;  1H9T A;  1W7P D;  4HW0 A;  4C9Y A;  3FXO A;  2L7Z A;  2A5Y B;  2HTS A;  3GFM A;  5DEQ A;  5EDN A;  2ELH A;  2ZNZ A;  2E2J J;  2BGC A;  2YU3 A;  1ZGW A;  3E1S A;  5JHU A;  4DOZ A;  1WWX A;  1MDM A;  3PQJ A;  1FNN A;  3K4L A;  4UUV A;  5LBQ A;  3ZMZ A;  4XM3 A;  3SFI A;  4CUG A;  2MBF A;  1F43 A;  5F6F A;  4LFU A;  4L9J A;  4NB5 A;  4RAY A;  1PUF A;  1ZRF A;  2M0C A;  3I59 B;  1MBK A;  4XKC A;  1W4M A;  4ANJ A;  4HRI A;  2PMZ N;  4XIC A;  1B4A A;  1K78 B;  2EZH A;  5HNF A;  4F92 B;  1B72 B;  4I09 A;  2FA5 A;  3F0C A;  3EYI A;  3IHU A;  2H8R A;  1IJW C;  4CZZ A;  4M9Z A;  3OV8 A;  3SEZ A;  3HBL A;  4Q4Z F;  1JGG A;  1XD7 A;  5LHH A;  2O8X A;  1UG0 A;  4C2U A;  4RDU A;  2V9P A;  1BC7 C;  1IN6 A;  3RJP A;  2PJR B;  1IXC A;  5TJJ A;  4MFD A;  1RKT A;  1IRF A;  3SHF A;  5KK1 A;  4I02 A;  3CMA I;  1ZAR A;  3HRU A;  1I1S A;  4C3H J;  5GPC A;  4IHS A;  1T38 A;  3ZCO A;  2ZXI A;  3MN2 A;  2L9N A;  4DZP A;  4BH9 A;  3I54 A;  1FYK A;  3I58 A;  5FLM J;  4V2F A;  1ZK8 A;  2OZU A;  4NBQ A;  2JPC A;  1QZZ A;  3SDB A;  2XSD C;  2EIK H;  1R1V A;  3OYA A;  2IRF G;  4I2O A;  1NG7 A;  3L2C A;  2O6G E;  4JX4 A;  1AWC A;  3CD6 I;  3X2Q H;  2GLO A;  4A3D J;  4KMU X;  2QQ8 A;  2DMN A;  3A02 A;  4LJZ F;  2LY2 A;  3F23 A;  5M5W J;  5AON A;  2NRA C;  2KIM A;  4HV6 A;  4Y7N J;  3I56 I;  5LD2 C;  5FRN A;  1VQP I;  2A68 F;  1IRG A;  2EBI A;  3VYR B;  4B3A A;  1O57 A;  1Z3Y A;  4JOM A;  1G3S A;  3ZQC A;  3RPU D;  1YS6 A;  3A01 A;  2IP2 A;  4DW6 A;  2MW8 A;  3CUQ B;  1YYV A;  3Q0V A;  2L4A A;  1OCO H;  5B3S H;  2JRT A;  1UHW A;  4XLE A;  5DCF A;  4ABZ A;  2P7C B;  4KJZ A;  1MKM A;  3WU2 C;  2R7V A;  4G12 A;  4PDK A;  4ZYG A;  5EYR A;  2DTZ A;  2KP6 A;  4ESF A;  3J80 K;  3L00 A;  3I71 A;  1R36 A;  2AO9 A;  4HX7 A;  5EG0 B;  1R58 A;  5A2Q K;  2LSO A;  4KA4 A;  2ZXW H;  1XCB A;  1BI1 A;  5HS7 A;  1TQM A;  2EFQ A;  4AYB A;  2XF5 A;  2K5C A;  2OQR A;  1I50 J;  2Y31 A;  2CMP A;  2BVM A;  2HOS A;  2OTJ I;  3H5A A;  4M6Y A;  2QZ8 A;  2BXY A;  3NWT A;  3I9V 2;  5M3M J;  2QA4 I;  1U8R A;  3LWF A;  4RAG A;  1YRN A;  2KLO A;  4UB6 C;  1K83 J;  2XPW A;  5E8G A;  2FD5 A;  5BPI A;  2PI0 A;  1FZP B;  5DCM B;  2KPM A;  2ZME B;  3BR1 A;  2X1D A;  1T0F C;  1O4X A;  3SZT A;  4A69 C;  3ZGK A;  2Y48 A;  2VKH A;  2CV0 A;  2CQK A;  2F5F A;  4I76 A;  1PYV A;  2HYG D;  3CC7 I;  4BY1 J;  2EV0 A;  1I6H J;  1IO2 A;  1JTY A;  1XMA A;  1QPM A;  4BUP A;  4N9I A;  5KNL A;  4C2M J;  2K86 A;  1R22 A;  1YE9 A;  1D1A A;  4BAC A;  3HDD A;  1IG7 A;  3L2Q A;  4GXO A;  2NVX J;  3IRQ A;  4OMZ A;  5LGT A;  2I8D A;  3BR3 A;  4D7N A;  1VQ5 I;  2QF7 A;  3PL8 A;  1GVJ A;  3Q9S A;  2M34 A;  2AXL A;  5DS9 A;  1OKR A;  2COM A;  4TV7 A;  3T8T A;  3J7Y J;  4BQA A;  2VI6 A;  5C44 J;  3WHC A;  4AU7 A;  4KDP A;  2PN6 A;  1D8J A;  1MJA A;  2ZO4 A;  4OIQ F;  2YR2 A;  4U88 A;  3QYE A;  4EGY A;  2VKV A;  4XMY A;  5K5Q A;  1SFE A;  1A36 A;  1D5V A;  4LG0 B;  3REO A;  2R7F A;  2EWN A;  4NNJ A;  1ITY A;  1T0F A;  3WE3 A;  4LLG F;  4XN3 A;  5J6X A;  2R5Z A;  1APL C;  1D0Z A;  3QWL A;  3CCU I;  1LFU P;  1OQY A;  1B6A A;  1V4R A;  5HOD A;  4FE7 A;  4QPO A;  5CLS A;  3FXM A;  4S05 A;  3W2W A;  2VBW A;  5ERI A;  1AKH B;  3E7L A;  2CW7 A;  4V2G A;  2DMT A;  4EJU A;  1U5T C;  2NXN B;  3AL0 C;  1FMW A;  1IDZ A;  3JRE A;  1YS7 A;  2P0W A;  3DQV C;  1YJN I;  2L02 A;  1ETW A;  3GFJ A;  5D5V B;  2XKO A;  2KJB A;  4IRI A;  5F0C A;  3K4J A;  1Y1V J;  2VBY A;  2KKO A;  5B5E C;  2XC7 A;  4M3E A;  3RKX A;  1PJR A;  1ZR2 A;  1W0U A;  3D5L A;  5F04 A;  1DGW Y;  3HTS B;  4J01 A;  2M1B A;  2JA7 J;  1A04 A;  3C7J A;  3IL2 A;  1VQK I;  1BW6 A;  3RYP A;  1NK3 P;  1F5T A;  3BY6 A;  1TQP A;  1YIO A;  3FBI B;  4Z6Y A;  2TRT A;  4PGG A;  1E0E A;  4J00 A;  2VAS A;  5F27 A;  3QPL A;  3E3V A;  4I0B A;  2F5D A;  1BOA A;  1XGN A;  2VKD A;  4LOC A;  4WXH A;  3S32 A;  1V55 H;  4ETS A;  4GDF A;  1HQC A;  2O61 A;  3KP7 A;  4PZJ A;  1MBJ A;  2Y2Z A;  1ZAO A;  3KP3 A;  5HVQ C;  5M3F J;  1K4S A;  1IUF A;  1BBY A;  2XGC A;  1UAA A;  4AC0 A;  1YJ9 I;  3U1K A;  3IKV A;  2UV1 A;  1U5T A;  1Z05 A;  1DPR A;  2ELK A;  2F48 A;  4FET A;  1VQ9 I;  2X6W A;  1BI2 A;  1BOB A;  4UXN A;  3L1P A;  3P9K A;  3PNT A;  5IYC J;  4FE4 A;  3HOZ J;  1N77 A;  3K4B A;  2OJE D;  1KYW A;  3FXL A;  4YRV A;  5F0H A;  3VYU B;  1EJ9 A;  2Y0S N;  1P6R A;  4BDY A;  3H3Z A;  3M7G A;  4Y3O A;  4OIO F;  2DA1 A;  3DPL C;  3B73 A;  1ETY A;  4P9F A;  5GAE J;  2E19 A;  3EQL F;  1HOM A;  4CYC B;  3HPH A;  1T56 A;  2A6T A;  4U0V A;  2TDX A;  4JBA A;  3TL4 X;  1K61 A;  4A3C J;  1H9G A;  4AWX B;  1LQ1 A;  5FKM A;  3NWS A;  4ZH4 F;  1O3Q A;  2EZI A;  1XDS A;  3OL4 A;  4Y15 A;  1G4D A;  2JA5 J;  3GXO A;  3LSG A;  1G3T A;  1JUP A;  4WWC A;  4BS9 A;  4RM2 A;  3VB2 A;  4IKF A;  4PJJ A;  1IN4 A;  4IQ4 A;  3LSM A;  2GOM A;  1ZLK A;  2FUG 2;  3AG3 H;  1R9T J;  3F8F A;  1Q1V A;  2HZT A;  2XIG A;  3PNV A;  2HI3 A;  2HYJ A;  2KDZ A;  2PFB A;  1BI0 A;  5L3E A;  4BBR J;  3M07 A;  1IV8 A;  3J7A Y;  4DBQ A;  3BJ6 A;  2LY9 A;  2DJI A;  3SZG A;  3VOD A;  2OCC H;  1GUU A;  3N4M A;  1X4P A;  2MFZ A;  2RQQ A;  1HXD A;  3HHH A;  3JAM K;  3KYD B;  4IHY A;  2P6S A;  2IT0 A;  2LBF A;  4A3G J;  2DYS H;  4OIN F;  4H0E A;  2B0L A;  3E6C C;  5CPR B;  2QBY B;  2K85 A;  2BXZ A;  3GVA A;  3JRG A;  3RDI A;  4G7Z F;  2VOD A;  4O3M A;  3PQK A;  1SAX A;  1U9N A;  1X3W B;  1NK2 P;  2CU7 A;  2G7H A;  4U7D A;  5KVR A;  3F6O A;  2L9R A;  3CDH A;  2R7Q A;  5BQT A;  3GFI A;  3M1C A;  3SQN A;  2DYR H;  3FIW A;  2QLZ A;  4HST A;  4WX9 A;  3OYM A;  4OWR B;  1UST A;  4N4O B;  2R5Y B;  4RB1 A;  4CIC A;  2W48 A;  4IO9 F;  5C4X J;  4UVA A;  3KP6 A;  3G3Z A;  1GLN A;  2Z5U A;  4HLX A;  1MNE A;  5IP9 J;  3GW2 A;  2F4O B;  4P1W A;  5AIQ A;  2ZXJ A;  4BNC A;  1VQO I;  2H09 A;  4AM3 A;  5BNG A;  2H27 A;  4YFN F;  5KCM A;  5IP6 A;  5D6F A;  4NC8 A;  2CV1 A;  4M3D A;  4PGH A;  4ASN A;  4G8X A;  3T0Y A;  1TNT A;  2NS7 A;  4CYD A;  2LC2 A;  1VQ6 I;  5CVV A;  2IVM A;  1B1B A;  3LSP A;  3QAH A;  1QHH D;  2Y0M A;  1K6O A;  2LF8 A;  3QYF A;  2CUJ A;  1GV2 A;  3A03 A;  2RN7 A;  2BW3 B;  4C30 A;  5LEJ A;  3H3V K;  2DA7 A;  3B6A A;  2OU2 A;  1ZRC A;  4OIR F;  4E7H A;  3PIO F;  2XVC A;  3OSG A;  4NQW A;  4A3J J;  2JT1 A;  3ABL H;  4ZTJ A;  2A5W A;  2X6Y A;  1ETO A;  2IJL A;  3SXY A;  5K1Y A;  1RIO H;  1OCR H;  2E35 A;  2R7Z J;  5E3N A;  3FM5 A;  1YX5 A;  1H89 C;  3CCY A;  3BJA A;  2KRF A;  4XL9 A;  2RKH A;  2A6E F;  1AOY A;  2PBI A;  3GLL A;  5FLX Z;  4CCL A;  2O0Y A;  1ZRE A;  1XX5 A;  3S93 A;  3FF5 A;  4A93 J;  2DMU A;  2GWR A;  4UUS B;  3QOD A;  3RPQ A;  3CES A;  1YW9 A;  5LLQ A;  1HDD C;  2WY7 Q;  2ZSI B;  4MTE A;  4X6A J;  1TBX A;  5M5Y J;  1H0M A;  2M9H A;  3ZMS A;  3H9G A;  2ZJR F;  3U2R A;  3ECH A;  3FZV A;  4F55 A;  3ELK A;  2JA6 J;  1JKR C;  3BLY A;  3MEX A;  2WAF A;  1EF4 A;  3FM3 A;  2HXO A;  4I0A A;  4WK8 F;  2CH0 A;  3WTX C;  3TO9 A;  2Z9O A;  2VJJ A;  1JTX A;  4BEH A;  1BC8 C;  2HDC A;  2XAQ A;  1UEL B;  4LLL A;  1ETK A;  1TWG J;  2MGQ A;  2HGC A;  3S1N J;  3TDU C;  1XGS A;  4EJV A;  2VLA A;  3BT9 A;  3FBN B;  4M9X A;  2EFO A;  2A69 F;  1R7J A;  1TLH B;  3OYD A;  2K9Q A;  3LFK A;  1Y8Q B;  1QPI A;  2R92 J;  4MHG A;  2K02 A;  4A3M J;  2WV1 A;  1J7K A;  1UHM A;  3BPV A;  4JK1 X;  5DV5 A;  2PEX A;  3O8H A;  1TZL A;  4BYY A;  1V5F A;  1NHA A;  3HTU A;  4XBF A;  4QPQ A;  5EEG A;  1IAW A;  1CGP A;  2Z99 A;  3EUA A;  2AXT C;  1BL0 A;  1BIB A;  1X19 A;  2OV7 A;  5IP7 J;  2OD5 A;  1R00 A;  2CUZ A;  2OZ6 A;  3HZJ A;  4XSX F;  4CCO A;  3I53 A;  3OOU A;  2DT6 A;  3HGY A;  3J7Z I;  2E1C A;  2LP0 A;  2FSW A;  3NQO A;  1EKE A;  1ZTR A;  4RAF A;  3JSO A;  3MZH A;  4M72 A;  1O3S A;  3BQZ A;  5E1Z B;  2DOA A;  1RC9 A;  4BXU A;  3E6D A;  3H5R A;  1XCV A;  4RM3 A;  4WXD A;  5FKO A;  3HOV J;  4MNU A;  9ANT A;  1XDU A;  3TKY A;  4UHT A;  3VEP A;  4HDV A;  3OIO A;  3BG9 A;  1TWC J;  4FAS D;  1SD5 A;  3UKG A;  5FB2 A;  4A3F J;  1C0W A;  3H9Q A;  5C4J J;  1D1B A;  3HOU J;  4AD9 A;  2O9L A;  4IPA A;  3ERE D;  4BJT A;  5E17 F;  1X58 A;  1OYW A;  3KP4 A;  3ZR8 X;  5HLH A;  4G7O F;  2R4G A;  3FXJ A;  4B3X A;  2ZXH A;  4XRF A;  4KNY A;  1A6Q A;  3IH3 A;  4ZYD A;  5JR3 A;  3HRS A;  5ED4 A;  1ON1 A;  2Y9Y A;  2EB7 A;  3I5U A;  3S17 J;  1JT0 A;  3OS1 A;  3GTM J;  3GO5 A;  3DEU A;  1W5C C;  3OSF A;  4ZYA A;  5AIP A;  3J7A O;  1A35 A;  1J2X A;  4XLA A;  1POG A;  1WJE A;  2QVO A;  2O8K A;  3QPT A;  4RGU A;  2A05 A;  2HTJ A;  3BJO A;  3S2D J;  4O6J A;  3AKZ A;  4EJT A;  4EVI A;  1R5I D;  1TT5 B;  4HAM A;  3ZQL A;  4MIM A;  1DDN A;  2UXX A;  1OFC X;  2P6T A;  1R1T A;  1HW2 A;  1JJ8 C;  1XC5 A;  3IC7 A;  5JFR A;  2E1M B;  1KZH A;  4D5F A;  4BJ6 C;  3LAJ A;  2EIJ H;  1X3Z B;  3S3N A;  1G6N A;  4UB8 C;  1FC3 A;  1XS9 A;  4IJA A;  2FML A;  3WHB A;  5ICF A;  5IT9 Z;  4XOP A;  3GME A;  4R1H A;  3BTJ A;  3ZQ7 A;  4BDZ A;  2XDV A;  2P5K A;  1H8A C;  3ML6 A;  2XRN A;  2DFI A;  4C2T A;  4Y13 A;  3LOC A;  5M5X J;  1G3Y A;  3HRT A;  4PK4 A;  1J59 A;  1ETX A;  2LOO A;  1T08 B;  4YFK F;  4IX7 A;  3V8K A;  1FYL A;  1F4K A;  2P81 A;  4JQF A;  1I3A A;  2ICW G;  5F64 A;  2IXS A;  2MD5 A;  3C2H A;  4BHP A;  3M9A A;  3FMS A;  3M4O J;  2X9D A;  3I4N J;  4L0Y B;  1W5T A;  2XF6 A;  4L9V A;  2Q8K A;  4UY8 I;  4EM2 A;  2LYC A;  3S14 J;  2R7W A;  2EPF A;  4BGD A;  4A2U A;  1T6S A;  3TGN A;  5FKK A;  2ID3 A;  4ZC3 A;  3GTO J;  1QVT A;  3D0S A;  5FJ8 J;  4DGW B;  1IN8 A;  3PIP F;  4LB6 B;  4HF1 A;  1X1C A;  5GTH C;  5IT3 A;  5L3F A;  1AU7 A;  5E3O A;  3GX4 X;  3IP4 B;  2J5O A;  3CMM A;  2DDB A;  2W25 A;  4F91 B;  5KAI C;  2DA4 A;  2XAF A;  2NS0 A;  4G6D A;  1PUF B;  1R5G A;  1S72 I;  2E7W A;  3RTR A;  1BR2 A;  3W6J B;  2X4H A;  1KQ0 A;  2WV0 A;  4PJL A;  2XUB A;  4I6Z A;  1Z9C A;  3SJM A;  2DQL A;  5ILU A;  3G6E I;  1UG2 A;  2QM3 A;  1BR4 A;  2RNG A;  3HPG A;  3MWM A;  1VTN C;  3SEQ A;  1VQL I;  1AA7 A;  2BYV E;  1WI3 A;  3ZMV A;  5FO5 A;  3JRC A;  1TWA J;  1O7F A;  2Q2E B;  3BR0 A;  4BE1 A;  4A3I J;  2ZJQ F;  1ZEL A;  1U2W A;  3RZD J;  4KN7 X;  2DU9 A;  3FXR A;  3H9J A;  4EQQ A;  1FLI A;  1P9Q C;  2L54 A;  5D8K B;  2R7R A;  3S8P A;  2NAZ A;  3PM1 A;  4DYR A;  1MMN A;  2ZNY A;  1E17 A;  1Y0N A;  1S9H A;  3VYT B;  2JSC A;  3Q9V A;  1A6I A;  5D5X B;  1Y56 A;  1PDN C;  3BOQ A;  3F6V A;  1UFM A;  1FTT A;  2HQR A;  4GO1 A;  5B1A H;  2ECC A;  3BZC A;  3NAR A;  1MBF A;  4CA0 A;  1U0J A;  5K5O A;  4Y33 A;  3CLO A;  5EZH A;  5J3L A;  2VE9 A;  2CYY A;  4HV5 A;  5J8C A;  1TTY A;  2XPU A;  2PJP A;  3PFI A;  5LGU A;  4HBL A;  2YS9 A;  1OIS A;  1Z91 A;  2L7K A;  2ME6 A;  1GXP A;  1KU7 A;  4GYI A;  3DPT A;  1W7P A;  1IW7 F;  2F4I A;  4ZYE A;  3WTS C;  1WZ2 A;  2HZD A;  3S3M A;  1WGX A;  1EH7 A;  2ZFW A;  3GCM A;  3T8R A;  4L5I A;  3HOS A;  5D5W B;  2X51 A;  1RUO A;  1ETQ A;  1OR7 C;  1DP3 A;  3WGI A;  3CC4 I;  2IS2 A;  5DTD A;  3HB9 A;  3I0T A;  2EFN A;  2LD5 A;  2O5R A;  3L2W A;  2K9L A;  3LST A;  2ZJP F;  4A6E A;  2VE8 A;  3I59 A;  2L4M A;  5D4R A;  4D0P A;  4KIF A;  3L2U A;  2XGX A;  5FGM A;  3EET A;  1K78 A;  3S16 J;  2HNH A;  4RGR A;  3IAM 2;  4IF4 A;  1OPC A;  1I6X A;  4IL6 C;  1MSE C;  2HR3 A;  1FSH A;  4OIP F;  3GTQ J;  1W5S A;  4LIV A;  1FX7 A;  3K4M A;  2FBI A;  2L7M P;  5KHD A;  5E18 F;  2L3D A;  3OYC A;  1VFC A;  2LKS A;  2PG4 A;  2R7D A;  3CP2 A;  1QBJ A;  3VOE A;  2CQ7 A;  2HOE A;  2EZK A;  3TP3 A;  2JPB A;  1FOX A;  2MC4 A;  3G1O A;  2E71 A;  1WRJ A;  4XLN F;  1O7L A;  2RDP A;  1UB9 A;  1ZLJ A;  1Z6R A;  3GLX A;  3M8E A;  5E8I A;  3J80 Z;  3ZMU A;  1Z7L A;  2GOX B;  1MW7 A;  2VXD A;  5A2Q Z;  1LB2 A;  1OR7 A;  4BY7 J;  2D1V A;  4ZDL A;  1HC8 A;  3WTW C;  2QQ9 A;  5GAG J;  2HPM A;  3G1M A;  3CCS I;  3KYL A;  1YX3 A;  2M87 A;  4S0H B;  2YPR A;  1DPU A;  3UNG C;  3ABT A;  4P5O A;  4Q5S F;  3OYG A;  3CC2 I;  1D8K A;  3W2V A;  3K6G A;  1JJ6 C;  2FX0 A;  2IW5 A;  3ERM A;  1J0R A;  2W84 A;  5BPD A;  4IHW A;  4LGW A;  2WAD A;  1IN7 A;  3WTT C;  2PX9 A;  3LSJ A;  3F8M A;  5BS6 A;  2MA3 A;  2ZME C;  1ZR4 A;  2R7O A;  3ESW B;  3OYF A;  3K7A J;  3RQI A;  3QQA A;  4IHX A;  2DOE A;  1MJ9 A;  3C1D A;  2E7X A;  2YSR A;  3RPU A;  2D5V A;  3WGH A;  4A3E J;  4ZTF A;  1GXQ A;  2L9S A;  4ITV A;  4OMY A;  4XNF A;  1VND A;  2GQQ A;  5C3E J;  1YOV B;  3E6B A;  3GZ6 A;  2DO7 A;  3IV5 A;  2R5Z B;  2NVT J;  1IRZ A;  2GM4 A;  3ABU A;  3CLQ A;  4E6K G;  3DTK A;  5FFZ A;  5JHF A;  2QQB A;  3PUF A;  3CCV I;  3C3W A;  3PJR A;  1AHD P;  3BDD A;  3HKZ N;  4I01 A;  4E7I A;  1RZ4 A;  1SFO J;  2HQN A;  1X2M A;  2E34 A;  2GAU A;  3QYB A;  3E6M A;  2DI3 A;  3FK7 A;  2STW A;  5DUI A;  2B7E A;  4XLP F;  2ZME A;  2E2I J;  3MQ0 A;  3OYH A;  2JRM A;  5DUK A;  2OPT A;  2MAB A;  5CYV A;  4F52 A;  2KIF A;  2Y69 H;  4KIG A;  3WTU C;  4XON A;  2DFE A;  4KN4 X;  4D7M A;  3FHZ A;  3RI4 A;  2V9V A;  3OS2 A;  3IRR A;  3GBG A;  4OU0 A;  2A61 A;  3K69 A;  1PP7 U;  1JKO C;  4YIR X;  2I5U A;  1B8I A;  3DBL B;  1KON A;  4XR6 A;  2F5C A;  3Q3S A;  4XQF A;  2OC6 A;  2HFH A;  4KIS A;  5D8L B;  4B8X A;  1BN5 A;  2R7S A;  1MD0 A;  1P92 A;  1U5T B;  2FQ3 A;  3WG7 H;  1FOW A;  3HOT A;  3P9I A;  4S04 A;  1K4T A;  2E5Z A;  2BEO A;  1YTY A;  3R4K A;  3A0H C;  3R0A A;  5HDK A;  4JX6 A;  5HLG A;  1PUE E;  2KHM A;  4H4K C;  4EEF G;  5JI6 A;  3R60 A;  4MEX F;  2ZJ2 A;  1YFH A;  2M3A A;  3FIS A;  2WBM A;  1E2X A;  2VL8 A;  1OYY A;  4PJM A;  2CG4 A;  4AIJ A;  3K2A A;  2E1N A;  4DIQ A;  1GT0 C;  1QRY A;  3P9C A;  2NVU B;  5DD4 A;  4YII A;  2UZK A;  1K7A A;  3WG9 A;  1P4A A;  3RYR A;  5B66 C;  2NNN A;  3MCZ A;  1YIJ I;  4XRS A;  5CVI A;  2NVY J;  3H35 A;  3L9F A;  5FD6 A;  1AKH A;  1U6G A;  1Z77 A;  5JVT A;  1ZRD A;  4AUX A;  4RB2 C;  2LMD A;  4GGG A;  3DTE A;  3TW7 A;  4LD5 A;  2IS6 A;  4FIS A;  1D3Y A;  1FIA A;  5EF6 A;  3OR2 C;  2JVH A;  4M3F A;  2F6C A;  3MKL A;  2F4M B;  2FMY A;  2HOA A;  5CVJ A;  1RUN A;  4HYE A;  2CV2 A;  2XRO A;  2LBF B;  3QRF F;  2H6C A;  3ZQG A;  1U78 A;  2YX7 A;  1Z0X A;  3JRA A;  2B63 J;  3VSK A;  2JUC A;  1TL8 A;  2IAI A;  5GPA A;  2CJJ A;  3RKW A;  3GTK J;  3M8J A;  3C2G A;  3BG3 A;  1RKW A;  4I7H A;  3ZN1 A;  3FHN A;  2BY3 A;  1OMI A;  2L7F P;  3N05 A;  3U21 A;  5L3G A;  1S3J A;  2MH9 A;  1T8I A;  1FY7 A;  2XAU A;  2JMW A;  2JVG A;  2XGE A;  3G4S I;  2DXI A;  3BQY A;  3CZ6 A;  2I10 A;  4LK1 F;  1MGT A;  1UCR A;  5LHI A;  4ON0 A;  2QGU A;  4HX4 A;  3OR1 C;  2DFH A;  2CUF A;  5L3B A;  3RKY A;  3ULQ B;  2CRG A;  3GF2 A;  3JAM Z;  4HOB A;  3LMM A;  1JT6 A;  1WVR A;  2ID6 A;  1N25 A;  4IQJ A;  1MMG A;  2QSH X;  1TNS A;  1P4X A;  2X85 A;  1YO5 C;  2OUM A;  3DF8 A;  3IAS 2;  4E7K A;  3FMR A;  2QSG X;  4CCM A;  4RS8 A;  4M9S A;  2ISZ A;  2E36 A;  2KZG A;  2ME0 A;  2CQQ A;  1VI0 A;  2HPI A;  1XSD A;  4NUB A;  4CYC A;  3K4N A;  1FOY A;  1GDT A;  1USS A;  3BG7 A;  3I3L A;  1YIT I;  2V1X A;  3I4P A;  1MMS A;  2P7V B;  2XRL A;  3AG2 H; 
#chains in the Genus database with same CATH homology
 1SAU A;  3K4L A;  1G59 A;  3F9K A;  3H9Q A;  4XM3 A;  4CUG A;  1W36 D;  1D1B A;  4XOT A;  3IUO A;  4NQW B;  4BJT A;  4XKC A;  1W36 C;  3ZR8 X;  4B47 A;  4ANJ A;  3OS0 A;  4HRI A;  2R4G A;  4B3X A;  2IGN A;  2ZXH A;  4U87 A;  5HNF A;  2BOL A;  3TMO A;  4F92 B;  4XLC A;  3HC7 A;  1HA8 A;  4B44 A;  1G8X A;  2ZFU A;  5CKT A;  3OS1 A;  2Y0S A;  4Y4R A;  3SEZ A;  2WY8 Q;  4YEJ A;  4ZYA A;  2W7N A;  4MLO A;  4XLA A;  1UG0 A;  3K70 D;  4C2U A;  1WJE A;  3AL0 B;  2LRD A;  4BJ5 C;  2PJR B;  2HQA A;  2W82 A;  3OYN A;  4BQQ A;  4XN0 A;  3K70 C;  1VZ0 A;  3EUH C;  3ZCO A;  3AKZ A;  2M4G A;  2ZXI A;  2L9N A;  4CCN A;  3OL3 A;  2V1N A;  1K6Y A;  2E1M B;  3ONQ A;  3SDB A;  4BJ6 C;  3OYA A;  2V7F A;  2M7A A;  4DJA A;  1NG7 A;  2LH9 A;  2Z1D A;  3S3N A;  3FDY A;  2XF7 A;  4XOP A;  4LG3 A;  2LY2 A;  3DKY A;  3DKX A;  1R6R A;  4BDZ A;  2XDV A;  5CQE A;  3EPZ A;  4DBR A;  5LD2 C;  1D0Y A;  5FRN A;  4HSR A;  4HG2 A;  4C2T A;  3MKY B;  1N75 A;  3VYR B;  3H0D A;  4XKW A;  1Z3Y A;  4JOM A;  4PK4 A;  3RPU D;  4F93 B;  1FMV A;  2X6X A;  2LOO A;  2DT7 B;  4IX7 A;  4XLE A;  3PNY A;  4JQF A;  2BW3 A;  4KJZ A;  2UUZ A;  2VB6 A;  1Y6I A;  2R7V A;  2IXS A;  2L5Q A;  1EA3 A;  2ELJ A;  2JUG A;  2JSP A;  2LG4 A;  2L2O A;  2KP6 A;  2Z2S B;  2DCE A;  3C2H A;  3MMY B;  3ZQQ A;  2XF6 A;  3PUB A;  4KT6 A;  4AYB A;  3D5R C;  2XF5 A;  1JI8 A;  1MND A;  2K5C A;  2LYC A;  2W1O A;  2R7W A;  4BGD A;  2HDW A;  2CMP A;  2BVM A;  3H5A A;  2WAQ A;  3NWT A;  4ZC3 A;  3I9V 2;  4DGW B;  2KLO A;  3BCA A;  3KEY A;  1X1C A;  2KPM A;  2VQG A;  3IP4 B;  3CMM A;  3OIP A;  2X1D A;  1T0F C;  4F91 B;  3OYB A;  3CP8 A;  3ZGK A;  2VKH A;  3VDX A;  2CV0 A;  1V5E A;  2R7U A;  3RTR A;  1BR2 A;  1PYV A;  4PSX A;  1NG6 A;  2JA2 A;  3DU5 A;  3K10 A;  4PJL A;  2WAE A;  2IS4 A;  3V42 A;  1BR4 A;  2RNG A;  4BUP A;  3HPG A;  5KNL A;  3SEQ A;  2LRE A;  4CSW A;  1YE9 A;  1D1A A;  4BAC A;  3L2Q A;  1AA7 A;  1ERD A;  2I8D A;  2KRC A;  2E60 A;  2Q2E B;  4BE1 A;  1ZEL A;  3PL8 A;  1WJF A;  3H9J A;  1P9Q C;  4AU7 A;  2R7R A;  3S8P A;  1X1B A;  1MMN A;  3QYE A;  1TT0 A;  1S9H A;  3VYT B;  2VJI A;  4XMY A;  3LSI A;  4E7Z A;  4BE2 A;  1Y56 A;  4NNJ A;  3PSF A;  4RMN A;  2X1E A;  3A1Y A;  3VSL A;  2HU9 A;  4XN3 A;  2VQH A;  4CA0 A;  1U0J A;  3LSK A;  1D0Z A;  4OAY A;  3OIQ A;  4XKB A;  4QPO A;  4Y33 A;  1X1D A;  1LFP A;  3L2V A;  3W2W A;  2CW7 A;  4E7L A;  3AL0 C;  2VQC A;  1D1C A;  1FMW A;  3OYI A;  2L7K A;  2P0W A;  3DQV C;  3DPT A;  4CCJ A;  4E4H A;  2F4I A;  2HZD A;  3S3M A;  4ZDP A;  3K4J A;  3OY9 A;  3VWB A;  2XC7 A;  4RLF A;  3OYL A;  1PJR A;  3HOS A;  3D5L A;  4GRI A;  2KQR A;  1DGW Y;  2HVQ A;  2X51 A;  4D9J A;  5HNH A;  3S3O A;  1OR7 C;  4J01 A;  2R7X A;  3A4C A;  1DP3 A;  2IS2 A;  4EAT A;  3HG9 A;  2E1M C;  2WB1 A;  2IGO A;  3OMY A;  3PSI A;  2UWM A;  2KDO A;  2MD0 A;  2O5R A;  3HUG B;  2K9L A;  4XLF A;  4BEH B;  3L2W A;  4IZZ A;  1QU3 A;  3A2K A;  3FBI B;  1E0E A;  2M4K A;  3CJQ B;  3G2B A;  2VAS A;  4B43 A;  3L2U A;  4J00 A;  2V26 A;  2HNH A;  1WFX A;  1LDK B;  3IAM 2;  3K4C A;  2IS1 A;  2VKD A;  3S32 A;  3RCO A;  3RQ4 A;  3LFU A;  5HVQ C;  1SFK A;  5HLT A;  4LIV A;  3K4M A;  5KHD A;  1UAA A;  4XLH A;  4PSW A;  3D5S C;  3OYC A;  3H5N A;  4R79 A;  2UV1 A;  2KL4 A;  3OWT A;  3CP2 A;  2Q1Z B;  4FET A;  5LFA A;  2X6W A;  2MC4 A;  2W00 A;  4ZJZ A;  1BOB A;  2V6E A;  3PNT A;  1X4O A;  2MYS A;  1N77 A;  3K4B A;  4CZC A;  1Z3X A;  4YRV A;  2KZV A;  3VYU B;  1Z7L A;  2GOX B;  1MW7 A;  1WJA A;  2VXD A;  2BVL A;  4BDY A;  2AQF A;  4Y3O A;  4ZDL A;  3DPL C;  2KRH A;  3TBI A;  3MKZ A;  2HPM A;  3HPH A;  2A6T A;  3BG6 A;  3TL4 X;  3KX2 A;  3KYL A;  3NWS A;  1YX3 A;  2PMZ A;  4BU2 A;  3OL4 A;  3UNG C;  4P5O A;  4HNU A;  1J09 A;  2V4J C;  2X1C A;  3LSG A;  3OYG A;  3BC8 A;  4BS9 A;  1WJC A;  2M0M A;  3W2V A;  3K6G A;  4RM2 A;  4IKF A;  4PJJ A;  4IQ4 A;  3LSM A;  1MMD A;  2GOM A;  2WAD A;  3W2A A;  2FUG 2;  3DU6 A;  2R7O A;  3OYF A;  2VJ5 A;  4B48 A;  3PNV A;  4AVZ A;  3HL2 A;  4E7S A;  4ZDO A;  3J7A Y;  4DBQ A;  4ZTF A;  2DJI A;  2L9S A;  4D1Q A;  4ITV A;  3SZG A;  1Z21 A;  4XNF A;  1X4P A;  2MFZ A;  2RQQ A;  3EUK L;  5CQG A;  3DPU A;  2LBF A;  1LVK A;  5CPR B;  1LKX A;  4E6K G;  3DTK A;  5JHF A;  1WJ5 A;  3PFY A;  3PJR A;  2KMU A;  3DEE A;  4E7I A;  2R7Q A;  3UR3 C;  2M7B A;  3M1C A;  4HST A;  3OYM A;  3QYB A;  4OWR B;  3QOE A;  4N4O B;  2QKM B;  4HPQ A;  3SYT A;  4N4N B;  1GLN A;  5FRO A;  1MNE A;  2K3P A;  3OYH A;  3MD2 A;  3OYJ A;  2MAB A;  4P1W A;  3W3C A;  5FRM A;  2R7T A;  4F52 A;  2CFO A;  3LL7 A;  5KCM A;  4XON A;  4NC8 A;  2CV1 A;  2CS3 A;  4II2 A;  3OS2 A;  3GBG A;  4LIT A;  2RRE A;  4YEL A;  2ZSH B;  2LC2 A;  2Z16 A;  1KON A;  5TGT A;  4XR6 A;  3ZXS A;  2LY1 A;  2VJ4 A;  1QHH D;  2IGM A;  3L2R A;  4II3 A;  2OC6 A;  4XQF A;  3QYF A;  3AFH A;  2CUJ A;  1D0X A;  4KIS A;  2VPL A;  2R7S A;  1N78 A;  4HEA 2;  3HOT A;  4PFO A;  2BW3 B;  3BCB A;  4C30 A;  2E5Z A;  3K4K A;  4E7H A;  2W4S A;  4RLQ A;  4XKV A;  2KHM A;  4H4K C;  4ZTJ A;  2A5W A;  1T95 A;  2X6Y A;  2M3A A;  3LSH A;  3FKJ A;  2WBM A;  1DQU A;  2VL8 A;  4BQO A;  4PJM A;  4BL0 B;  1WJB A;  1YX5 A;  4BXF A;  4DIQ A;  2VXZ A;  3E0J B;  3VYS B;  4E7J A;  4XL9 A;  2VIX A;  4PFP A;  1IRX A;  2XSJ C;  4U7B A;  1BR1 A;  2NOJ B;  4CCL A;  1MMA A;  3S93 A;  3MKW B;  2PJR A;  3H35 A;  1OLT A;  2HVS A;  3QOD A;  3CES A;  4LIU A;  3DTE A;  2WY7 Q;  2IS6 A;  2ZSI B;  4PJN A;  3ZRG A;  3OYE A;  3OR2 C;  2JVH A;  2WA0 A;  3H9G A;  4F55 A;  2V9K A;  2F6C A;  3BLY A;  1QHG A;  2WAF A;  3HKZ A;  2CV2 A;  2CH0 A;  2LBF B;  3HXL A;  2CW8 A;  2VJJ A;  3VSK A;  4BEH A;  4HNT A;  1UEL B;  2F5V A;  5HOO A;  1DGR M;  4OAZ A;  2IGK A;  4G6T B;  3OYK A;  3M8J A;  3DWL E;  2VQL A;  3C2G A;  2VLA A;  3FBN B;  2K9M A;  3FHN A;  3N05 A;  4PUS A;  3U21 A;  3OYD A;  1V5G A;  2XAU A;  2QKL B;  4F3Q A;  2HVR A;  2JVG A;  4NC7 A;  2DXI A;  4BE0 A;  3CZ6 A;  1TZL A;  1X1A A;  1V5F A;  3CF2 A;  3DTI A;  3OR1 C;  4QPQ A;  3EUA A;  2AQE A;  3LMM A;  4X0G A;  1X19 A;  2OV7 A;  4IQJ A;  1MMG A;  2CUZ A;  1WJD A;  4CCO A;  4CH7 A;  2X85 A;  2E5N A;  3OOU A;  2DT6 A;  2OUM A;  3IAS 2;  4KIT B;  4E7K A;  3RSN A;  4XOR A;  4CCM A;  3DLA A;  2DOA A;  4C9Y A;  2HPI A;  3H5R A;  4NUB A;  3CJR B;  3K4N A;  4RM3 A;  3BG7 A;  3I3L A;  4BQN A;  4CCK A;  3E1S A;  4FAS D;  4DOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...