2C6YA

Crystal structure of interleukin enhancer-binding factor 1 bound to dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORKHEAD BOX PROTEIN K2
publication title Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2c6yA00
4WXCA 1WQ2A 1MJAA 3F8CA 4XRFA 1PDNC 3EDPA 3IL2A 1JXSA 1W7PA 1IXRC 1HW1A 2HS5A 3EUHA 2Z99A 3LFKA 4I01A 2PJPA 4L9VA 1ZGJA 2ZNZA 2FU4A 1KGSA 4G9YA 1GXPA 2BV6A 2XAGA 4K2EA 1QNTA 1F1ZA 1DDNA 3OOPA 4ZH4F 3IRRA 2O0YA 2H09A 5AONA 1H9GA 3ZPLA 1UCRA 2L3DA 3F72A 3WGGA 1CF7B 2RGVA 4GGGA 4HX4A 4JBAA 1ZAOA 3JSOA 1KU2A 2FXAA 4BHBA 1IW7F 1WRJA 5ILVA 2HGCA 4HF2A 1IN7A 3NEUA 2Z9OA 4UVBA 3IKVA 4DNCA 2EFWA 1T0FA 1AOYA 5CVJA 3GFLA 2ESHA 1ZYRF 5AIPA 1ZRDA 1XGSA 1MKMA 3WU1B 2V1DA 3TO7A 5JFRA 4U0WA 2G7HA 2GAUA 1RI7A 4A2UA 3GZ6A 4M71A 2HTSA 4BQAA 5DUKA 5L3CA 1P4XA 5ED4A 5LGTA 4EM2A 3HUGA 3I71A 1T38A 2ZO4A 2L02A 1QZYA 5FD6A 4M6YA 1G3YA 5A2QK 2W85A 1UHMA 4EJTA 4OMYA 2ZCWA 1Z91A 2D1VA 4YFKF 2VE9A 1G3TA 1OKRA 1Z9CA 2HKOA 4IRHA 2GXGA 3WTXC 1R7JA 1ZLKA 1R5GA 4LG0A 4HDVA 4MEYF 3VEPA 5TRDA 2HQRA 5ICGA 2AS5F 5DYMA 1AWCA 1TQPA 1O3QA 4AIHA 1PP7U 1KQ0A 2H94A 2XAQA 2H6CA 4ENMA 2M45A 3ZMZA 2ETHA 3LQRA 2CSOA 1K6OA 1FX7A 2XKPA 4HDUA 2PBIA 3GXOA 5DEQA 2QQAA 1HSJA 2KIFA 3DV8A 1MJ9A 2Z3YA 1J75A 2EB7A 1T2KA 3MZHA 2QWWA 3WTTC 1YS7A 1B1BA 1F9NA 3ECHA 1YYVA 3TDZC 1OR7A 1SMYF 1TNSA 3DQVC 3GF2A 2XROA 2FF4A 2F5CA 4RB0A 1YLFA 4BYYA 3O6BB 2VT2A 3DF8A 4P96A 5HDNA 3BWGA 1FBQA 2IJLA 2RDPA 4L5IA 4MQ9F 5DV5A 2HFHA 2VN2A 1XGNA 4OINF 4HQEA 2DPUA 2MBFA 1D5VA 3ZMSA 3LQQA 2MLGA 1FWZA 4OOIA 4HA8A 1WSUA 4TV7A 3DEUA 3U9GA 3SFZA 2O03A 2W25A 3WTUC 3J80K 1R1TA 5BPDA 5CVVA 4P9UA 1L3LA 4M6XA 2AXLA 4RS8A 4BH9A 3FXQA 2YX7A 4EJUA 1KYZA 1XDUA 3K69A 2YU3A 2WWYA 3IWZA 5H6RA 4ASNA 4LK1F 2Y0MA 1G4DA 4LLLA 2LKPA 4YIIA 3K1MA 3L00A 1XN7A 4KMFA 3MQ0A 3ZMUA 2EJRA 3E6MA 5K1YA 5LHGA 1L0OC 4GCVA 1IZ1A 2ISYA 4IF4A 2OBPA 3J81Z 1KU3A 4R79A 3GFJA 4QWQA 1D3YA 3BPXA 1K78A 3ZN1A 2F5FA 3IC7A 2L54A 2KIMA 5DD4A 1FP2A 2QZ8A 4XBFA 2J5OA 2YSRA 4N9HA 3WTZA 3ABTA 5E18F 3DPTA 2X0LA 4IRIA 2M1BA 3V7SA 1A04A 2CFXA 3M7GA 1GHCA 3ZMTA 2MA3A 3E5UA 4GXOA 2D45A 3G73A 4L0ZB 2GA1A 4HZFA 3HSRA 4UXNA 1QBJA 3LA2A 1Z6RA 5J8CA 1B9NA 3VODA 1EH8A 3C1DA 2RV8A 5CLSA 2OQRA 2BGCA 4NB5A 5LHHA 5BPIA 1U3EM 2QUFA 3U1DA 3PFIA 4RB2C 3QRFF 1IN4A 2VE8A 5CVRA 4Z2YA 1ONVA 2PQ8A 3E6BA 3L09A 5KK1A 2RKHA 3I59A 3TO9A 1BBYA 1R1VA 3DXJF 5HOOA 1J9IA 3IKTA 4XLNF 2A5YB 2K4BA 3V8LA 2K86A 1YQAA 1FT9A 1JGSA 3IRQA 1H9TA 1T39A 2E1CA 3IWFA 2A61A 4XSXF 2JT1A 3WTYC 2ACJA 2FBIA 2CW0F 4F7ZA 3HHHA 3M1EA 2VBZA 2XHKA 2XAHA 4ZZDA 2LDUA 1UHWA 3S2WA 2G7UA 3HOSA 2QYOA 2DPDA 5E17F 1PUEE 1FBUA 3L9FA 4S05A 4UV8A 1USSA 1Y0UA 3FX3A 4U7BA 5HLIA 2HZTA 4HYEA 3FF5A 5FO5A 1D8KA 5LGNA 1KA8A 2KKOA 3ZMVA 2FRHA 1BN5A 4Y17A 5F64A 3LWFA 2QVOA 5K5OA 4ESFA 2QLZA 4KICA 5ICCA 1SMTA 3F8BA 3GLXA 4UVCA 2XAFA 2NNYA 1B59A 2XASA 4DQ2A 3KEQA 3ZP5A 1O3SA 4RAYA 4AD9A 1I6XA 5A2QZ 2R7DA 1EH6A 2IVMA 3WTVC 4IHTA 3IHUA 4LK0F 4M9SA 2CO5A 2A6EF 1HW2A 1B9MA 3RPUA 3C7JA 4I02A 1STZA 1UFMA 2P4WA 3RKYA 1J59A 1E2XA 2CGPA 3JSPA 3F22A 1ZG1A 1I5ZA 2DK8A 5CYVA 1IXCA 4M74A 4U0VA 4Y13A 3BJOA 2ZMEB 3WGHA 1ZG5A 1U2WA 4GYGA 4IPAA 5JHUA 2GXBA 2MD5A 3F21A 3H3ZA 3FMQA 1P2FA 3PQJA 5ERIA 2P8TA 5D8KB 4FT8A 4BNCA 4KUMA 4GYIA 4HLXA 1XCBA 3P9KA 1E17A 5KVRA 1BIAA 3KFWX 4G94A 3QP5A 4EMSA 4U0YA 2IP2A 1O3TA 3GZ5A 3V8JA 4LGWA 3Q9SA 1IUYA 4WCGA 2BE5F 5LHIA 2ZBKA 1K7AA 2HYFA 5DD8A 5D5UB 3F8NA 4A5MA 2QQ9A 5CJ9A 2IA1A 3ULQB 5L3FA 3HTUA 5DCMB 3HYIA 4I09A 2RN7A 4FX0A 2LF8A 4UVAA 2OU2A 4MQVA 1W5SA 1XMKA 2V1XA 1U6GA 1S29A 5IT9Z 2A6HF 4IXAA 1BC8C 2XRNA 4KN4X 4HX7A 1MDMA 2RQPA 4Y15A 3QOPA 2YR2A 4LFUA 2IA0A 2ZKZA 3GFMA 1ZLJA 1XMAA 1QGPA 4PCQA 4CZZA 4HLYA 5TJJA 2E1NA 1DUXC 5BOXA 1XSXA 1U5TC 4FX4A 4EJOA 2PLYA 1KU7A 2PI0A 4I7HA 2DAOA 3QP6A 3QAHA 5E1ZB 3Q5FA 3LAJA 1P4WA 1WI9A 3F8FA 1LDKB 4LD5A 2LSOA 3K0LA 2FBHA 3V4GA 1F4KA 2UZKA 1IN5A 1OYYA 3FMRA 1FC3A 5JI6A 4EM1A 3M8FA 4E70A 5D6EA 5F6FA 2VT3A 1P4AA 1R1UA 2QBYA 2XKOA 3BROA 2MC3A 4HX8A 3B02A 4LMYA 5ILSA 1LVAA 5JR3A 4ZYGA 1DP7P 4CXFA 1GVJA 3EYIA 2PFBA 1HXDA 1ZRCA 4LB5A 2JPCA 1K79A 5IT3A 2ZJ2A 1S3JA 4Q48A 4NQWA 1O3RA 3FXRA 3GUDA 3CUQC 2D1HA 3GX4X 2OD5A 3NQOA 3W6JB 5D5XB 2M87A 4AWXB 5F1RA 1HBXG 3RKXA 1LEBA 1HW5A 1U5TB 3KP4A 1JE8A 3COAC 2HOEA 3FM5A 1HKSA 1MZBA 4R1HA 5HS9A 1FYMA 3O2PE 1XGOA 4FHTA 2QM3A 3WU0A 1ON1A 4A0ZA 2GZWA 3ZMDA 3KEOA 1QO0D 2JSCA 4R8HA 1FZPB 2ADUA 3OV8A 3TO6A 1ZH5A 1IRFA 5K5QA 3ZQ7A 2B0LA 1T6SA 3RI4A 4RGRA 1HKQA 1ODDA 5HS8A 4XLPF 2BBYA 4MNUA 2HR3A 3FMSA 4KT5C 2MH2A 3V7CA 5E20A 3KP6A 2RNJA 4G8XA 3JW4A 2V79A 4EQQA 3I0TA 4KN7X 2VONA 1DPUA 3CUQB 1TBXA 1SFEA 1CF7A 2K4JA 5E8GA 4A6EA 1LQ1A 4G7HF 4KIFA 4IHSA 2M30A 5DDGA 4HBLA 4Q5SF 1B4AA 1W4MA 3HRMA 2DT5A 3GYHX 1G3WA 3J7AO 2YPRA 4L5JA 2M8EA 1J7KA 5FB2A 3HSFA 3QU6A 4WXDA 1Q1HA 2COMA 4ENNA 2QENA 1C0WA 2LF7A 1YW9A 4KIGA 3T5XA 2KIUA 5L3DA 2QQBA 3T8RA 5HS7A 3U2RA 4OIOF 3CLOA 3KLNA 2ZXJA 3KLOA 4RB1A 3DKWA 1R00A 2A68F 1TW2A 1ZN2A 3ECOA 1HSTA 1QZZA 1W5TA 2VBWA 4HF0A 4KYWA 4LLGF 1BI0A 2PEXA 1LDDA 4ESJA 2DBBA 1OYWA 4YFNF 3TOAA 4ZYDA 3F3XA 3GEZA 2XVCA 4KMUX 3WGIA 2DW4A 5LRRA 1XB4A 2HKXA 2CYYA 1LEAA 1S6LA 1OYIA 2D2WA 2PMHA 4UNOA 4JQFA 2CWEA 4ZZLA 4AIKA 4OMZA 4XSZF 4BHPA 3CO7C 3E97A 5LLQA 2WV0A 2DQLA 2WC2A 5FGMA 5D4RA 1Z05A 2UWMA 1W7PB 2P5VA 2VBYA 2VC0A 4KIBA 5EEHA 2M5WA 3I64A 2FBKA 3LA7A 4OIQF 3K1NA 5FLXK 1W7PD 3HOTA 1R36A 1R58A 4EGYA 3BDDA 1O7FA 4MHGA 2F5EA 4WX9A 4P55A 1Z1DA 2OA4A 2VOOA 1TW3A 1IRGA 2BEOA 3EETA 1ZREA 2KRFA 5E1XA 4H0EA 3BJAA 3MEXA 4O5VA 5JVTA 4OU0A 5H20A 1GXQA 2IPQX 2OZUA 3CUOA 2TDXA 3MFKA 4B09A 3FZVA 2HWVA 1ULYA 3GW2A 3WODF 3TDUC 4HV6A 3R6SA 3V7RA 2FNPA 2ZNYA 3D0SA 1G3SA 1KQ9A 4EVIA 5LEJA 2DK5A 3E6DA 3K9TA 2K27A 3KZZA 3JTHA 1BIBA 3E6CC 2X4HA 5FFZA 1TTYA 4EV0A 3NRVA 5LEKA 4YIFA 1SFXA 3GO5A 1J5YA 2Q8KA 3T8TA 3T0YA 2VC1A 2J5PA 4NHJA 5ICFA 5K5RA 1SD7A 3W6KB 4ZYHA 3QPHA 3H3UA 4IRGA 2YX4A 1V3FA 2V6CA 1RZ4A 5LBQA 1HQCA 5LRSA 3Q9VA 3RJPA 1SD4A 3RTRA 2ESNA 4WF2A 5E8IA 1SAXA 2HDCA 1S7AA 5D5VB 4PGHA 4CYDA 1SD5A 4G6DA 2MLKA 2NNNA 5ICEA 5D5WB 3J81K 4LG0B 4L9TA 3CJNA 5HDGA 2DFIA 4KNYA 2Z5UA 1S8NA 1YW7A 4MTDA 3JTGA 3FM3A 5AIQA 4HQMA 2IA2A 4QLCU 1R23A 5HLHA 2UXNA 3I54A 2P7CB 3CO6C 3LAPA 2R7FA 3O3KA 2P7VB 1YG2A 2JTVA 3L2CA 2C6YA 2K02A 3I5UA 2Q2EA 4BHCA 3KE2A 4I0AA 2EFQA 4OIRF 2EV5A 4CGZA 4HF1A 4N0BA 3E5XA 3E5QA 2GWRA 3P9CA 1OMIA 2RC4A 1RUNA 3ABUA 3RYPA 2W24A 1P92A 4P9FA 4L9JA 2UXXA 3KP3A 5D6FA 2FNAA 2FQ3A 1SD6A 4A0YA 1DPRA 3SZPA 3KP2A 4MEXF 3RPQA 5L3EA 1TLHB 2EFNA 2LNBA 2VOPA 2FOKA 4HOBA 1BJAA 2EFPA 3D5LA 2OQGA 4AIJA 1D8JA 2GIVA 2DTRA 1ZG3A 3P9IA 1EV7A 3CDHA 3F6VA 3RIRA 3LSTA 5L3GA 3FWEA 2IW5A 2FMLA 5BQTA 2PMUA 4LB6B 3HRTA 3M9AA 3ISPA 1I1SA 3BOQA 4WK8F 3J80Z 4L9NA 2ELHA 4AVPA 3F6OA 3I58A 5H6QA 2FE3A 2KJCA 2XUBA 4RGSA 4CICA 1XDSA 1RIOH 4A0XA 5E1WA 2PN6A 1FY7A 3G3ZA 3MZYA 1TQIA 3HTSB 1FNNA 4OIPF 3DPLC 4M72A 4U88A 4RAZA 2NAZA 2FA5A 2W84A 1KQ8A 3M8EA 2XIGA 3ML6A 3WE3A 3K1PA 3R0JA 3FHZA 2FMYA 4ON0A 5D8LB 1ZGAA 4UUVA 3PQKA 1K78B 4CO8A 2NYXA 2DU9A 2DQRA 3WTSC 3QU3A 4I0BA 4A12A 2ZFWA 3GWZA 4IVNA 3SZTA 1FYKA 3MAJA 1IN6A 3JAMK 1FLIA 5L3BA 1XSDA 2FEZA 2EWNA 4ESBA 3V8KA 3F23A 2W57A 2CQKA 3RYRA 5BMZA 1BC7C 2O8XA 4PGGA 1IN8A 1FP1D 3F8MA 2ZMEA 2F5DA 2KJBA 4O3MA 4ENKA 4EM0B 4G7OF 1FBSA 3TQNA 2HQNA 5J8FA 3EYYA 4PZJA 1BOAA 3REOA 2L4MA 4PDKA 2XGXA 1RUOA 2FSWA 1KYWA 1MD0A 4UHTA 4WXHA 1R5HA 3ZN0A 5DUIA 3N97A 5FLXZ 1LNWA 1KU9A 3RKWA 2A07F 5LGUA 2Z33A 2F2EA 2DO7A 3TKYA 3I59B 1HKTA 1MGTA 1QPMA 2HEOA 5DCFA 3DFGA 2NS0A 1OPCA 1H0MA 1NHAA 1T98A 5DCMA 2K7LA 3SQNA 2GQQA 1SFUA 2EA2A 3TOBA 4L18B 3FXUA 2O61A 4HV5A 2OAZA 2H27A 5IT9K 4I98B 1O7LA 4M9ZA 3QPTA 3RDIA 4S04A 1I1GA 1V4RA 2A3SA 2STTA 4EGZA 4LJZF 2DI3A 3VB2A 1JHFA 4B8XA 2R3SA 1BI3A 1F5TA 4CHUA 2RVCA 3WTWC 1S7OA 2EFOA 4G7ZF 3C3WA 3EQLF 2V1UA 2JZYA 3R0AA 2CG4A 1IAWA 1ON2A 3MWMA 3MCZA 2BYVE 1TNTA 1Z6TA 1YW8A 4KDPA 1FPQA 4KFCA 3HSEA 1VTNC 3ELKA 1X3UA 2O3FA 4L0YB 1Z7UA 1TQMA 2L01A 3KETA 1JHHA 3KP7A 4YG2F 4P5OA 2WTEA 4N9IA 2EV0A 3R61A 1WWXA 1XSVA 4MTEA 4LLNA 2P5LC 2JRTA 3H92A 2IRFG 4M73A 4EJVA 3BY6A 5EEGA 4RGXA 3E3VA 1BM9A 4UV9A 1YIOA 1MJBA 4BAYA 4ENJA 3BPVA 3KZYA 1BI2A 2EV6A 3HIFA 1ZHFA 1YO5C 2P6TA 3R4KA 1U5TA 1YTYA 4HAMA 1XCVA 1YFHA 1O57A 1PP8F 1R22A 3DP7A 3AAFA 2ISZA 2STWA 3GFIA 1B6AA 2XAJA 5ILUA 3K2ZA 2HYGD 3N4MA 4D0PA 2G9WA 5HLGA 3P7NA 2Y75A 1FSEA 2HTJA 1LB2A 3KCCA 1UB9A 2MH9A 2O6GE 1MDMB 3WG9A 2Y48A 1U8RA 4U7DA 2H6BA 1BI1A 2VBXA 3BZ6A 5CVIA 2VXZA 2Q0OA 4CDGA 4HW0A 1WKMA 1XD7A 5CVUA 3I53A 1REPC 2EA4A 3CUQA 3VOEA 3ERED 4G6QA 3BJ6A 4JK1X 1U78A 4A6DA 4O6JA 3ROUA 1XGMA 3LA3A 4WWCA 5J6XA 3B73A 5BS6A 4RB3C 4KA4A 2VODA 2XV4S 5FD5A 4YFXF 3HHGA 4Q4ZF 1IXSB 3SHFA 2JPBA 4I2OA 4ETSA 3T1BA 3HRSA 3C18A 1LDJA 4Q47A 2A69F 5D4SA 1LJ9A 2NRAC 4A5NA 6PAXA 3BP8A 1FYLA 2V9VA 3CTAA 2QBYB 2E7XA 1ZARA 3SXYA 5HDKA 3I4PA 4ZYEA 3VFZA 1RNLA 1G6NA 5HVQC 4BXUA 1USTA 2P5KA 3JAMZ 2IT0A 3L7WA 4RGUA 1FOKA 4GO1A 3KP5A 3R60A 1QQIA 1J2XA 2L4AA 3HRUA 5FFXA 4M9XA 1EH7A 1CGPA 3TGNA 2P6SA 2EK5A 1P6RA 1J0RA 1FSHA 2GA2A 2E7WA 4EJWA 2DLLA 1IF1A 2OZ6A 1I27A 1YS6A 4IJAA 3WE2A 3GVAA 1ZRFA 2PG4A 4MGRA
chains in the Genus database with same CATH superfamily
4BXXJ 4JX6A 4WXCA 1WQ2A 2XGDA 1VQ7I 2MGQA 1MJAA 2X1DA 3F8CA 4HNVA 2R5YB 2CQ7A 4XRFA 3H3VK 1PDNC 4JOMA 3EDPA 4HSTA 3IL2A 1JXSA 1W7PA 1IXRC 3D5SC 4N4NB 4RDUA 1HW1A 2HS5A 4BJTA 3EUHA 3HOUJ 2Z99A 3LFKA 3ZQGA 1MIJA 2DTZA 4I01A 2PJPA 2CQXA 4L9VA 1ZGJA 2LY1A 2ZNZA 2FU4A 1KGSA 4M6VA 4G9YA 3CMAI 4J00A 1GXPA 2JUCA 2BV6A 3K10A 1MBHA 2XAGA 1ZGWA 4ZC3A 4BY1J 4ABZA 4K2EA 1QNTA 1F1ZA 2OCCH 1NH3A 1IC8A 1DDNA 2CV1A 3OOPA 1FTTA 2ECBA 4ZH4F 3IRRA 2O0YA 2H09A 5AONA 1H9GA 1Z21A 3ZPLA 3EPZA 1UCRA 3GCMA 2R7OA 2L3DA 3F72A 4NDLA 3WGGA 2ECCA 4CA0A 3HBLA 1CF7B 5DTDA 1JKPC 1EA3A 2RGVA 4GGGA 3LSKA 4HX4A 4JBAA 1ZAOA 3JSOA 1KU2A 1WZ2A 2FXAA 4BHBA 3BZKA 4PJMA 2XC7A 1IW7F 1WRJA 2K3FA 5ILVA 2HGCA 4PSXA 4HF2A 2EBIA 2HYJA 1IN7A 2IAIA 4E4HA 3OYMA 3ABLH 2Y2ZA 3NEUA 3IKVA 4UVBA 1D1AA 2Z9OA 4DNCA 2DMNA 2L7FP 2R7SA 4ZDOA 2EFWA 1T0FA 1AOYA 3OR1C 5CVJA 3GFLA 1APLC 2ESHA 2HDDA 1ZYRF 2QQ8A 3SZGA 5AIPA 1ZRDA 1XGSA 1MKMA 3WU1B 2V1DA 3TO7A 3KYLA 3P5JA 3LSMA 3ASNH 1EJ9A 5JFRA 3FIWA 4XMYA 4U0WA 2IS2A 2G7HA 2GAUA 1RI7A 4A2UA 1MMAA 3ZGKA 3GZ6A 4M71A 1BA5A 1Y39A 2HTSA 4BQAA 5DUKA 5HNHA 4FTHA 2DT7B 2DDAA 5L3CA 4IX7A 5GPCA 1P4XA 4CZCA 3I4NJ 4BQQA 5ED4A 2XF5A 2HOAA 3G71I 4D9JA 3CESA 5LGTA 4IOCF 1YRNB 2ID6A 5F08A 3S32A 5C4XJ 1HA8A 1N75A 4EM2A 3HUGA 5HODA 1XC5A 1QHHD 3I71A 1T38A 2ZO4A 2W00A 2L02A 1QZYA 1MH4A 5FD6A 4M6YA 2KRCA 5E3MA 1G3YA 5A2QK 2W85A 1UHMA 2L7KA 4EJTA 3OYDA 4OMYA 2ZCWA 2OV7A 1JUPA 1Z91A 2D1VA 4YFKF 2VE9A 1G3TA 2YU9J 1OKRA 1WJAA 1Z9CA 3KX2A 2HKOA 4IRHA 1P7JA 2GXGA 3WTXC 3QPLA 4M3EA 1R7JA 1ZLKA 5LFAA 1R5GA 4LG0A 4HDVA 4BQOA 1XG1A 4PJ0C 4XM3A 4MEYF 1T56A 3VEPA 5TRDA 2HQRA 1BR4A 1I3AA 2O7OA 1D0XA 2BXYA 5ICGA 2AS5F 5DYMA 3CF5F 2LY2A 3GZNB 1YI2I 1AWCA 4IL6C 1TQPA 1O3QA 4AIHA 3LFUA 1PP7U 2LG4A 3A01A 4AM3A 2R7TA 1KQ0A 2H94A 1AKHB 2XAQA 2NVYJ 3CDLA 2H6CA 4ENMA 2AQEA 2M45A 3ZMZA 1WJFA 2ETHA 2AXTC 2E1OA 2EILH 3LQRA 2CSOA 1K6OA 1FX7A 4PUSA 3ZXSA 2XKPA 4HDUA 1V54H 2LC2A 2IGMA 2XB5A 2MSYA 2PBIA 4XLAA 2PJRB 4F3QA 3BG3A 3GXOA 5DEQA 2QQAA 4J01A 1HSJA 2KIFA 1FOYA 1WJCA 2R7XA 3DV8A 1MJ9A 1WI3A 4D5CA 2Z3YA 1J75A 1HLVA 4E7KA 2LTPA 2V1NA 1MNEA 5J1UA 1VQMI 2EB7A 3CCQI 1IDYA 2XPWA 1LFPA 2K3PA 1T2KA 3MZHA 4B1RA 2QWWA 3WTTC 3BTLA 1YS7A 1B1BA 1F9NA 2M7BA 2M7AA 2L5QA 3ECHA 1YYVA 2A05A 3TDZC 3C2BA 4A3JJ 1OR7A 4UUSA 1SMYF 3CLQA 2VJIA 1TNSA 3DQVC 3GF2A 2XROA 2DA7A 1X2MA 4RA2A 2GM4A 2FF4A 2F5CA 1JTXA 1V5FA 1YLFA 4RB0A 4BYYA 3O6BB 2JWTA 2UUZA 2HXIA 2VT2A 3HKZA 3PJRA 3DF8A 3K4MA 4C30A 3MKZA 4P96A 5HDNA 2NOGA 4A3CJ 4E7HA 3KIOA 3FXJA 2ZFUA 1VNDA 2L2OA 3BWGA 3TW6A 1FBQA 3OR2C 2IJLA 2RDPA 4L5IA 4MQ9F 1CQTA 5DV5A 2HFHA 4X1EA 4W97A 1ZTRA 2VN2A 1XGNA 4OINF 4HQEA 2JVHA 4OWRB 2MBFA 2DPUA 1D5VA 3ZMSA 3BTCA 1OCCH 3LQQA 3L2QA 2F5VA 5E3NA 2VASA 5CQEA 4UY8I 1K4TA 2MLGA 3RQIA 1FWZA 4OOIA 2H8RA 3EUKL 4HA8A 4GDFA 1WSUA 3FXOA 4TV7A 4FE7A 2WAEA 3DEUA 3VYSB 3U9GA 2GLOA 1FOWA 3SFZA 2Y69H 2O03A 1X4OA 2W25A 3WTUC 3CP2A 4IOAF 3J80K 2HZDA 1R1TA 3H1CA 5BPDA 1Y0NA 5CVVA 2JSPA 4P9UA 1L3LA 2X6YA 2KT0A 2AXLA 3FKIJ 4M6XA 1R4MB 1A6QA 1MBEA 4II3A 4RS8A 4BH9A 4UB8C 2MFZA 3FXQA 1B72A 2VKHA 4RBOA 2Q1ZB 2YX7A 4EJUA 1KYZA 3BG5A 1XDUA 3K69A 2YU3A 2WWYA 3IWZA 5H6RA 1U9OA 4ASNA 2NVXJ 4LK1F 3TMOA 3JREA 1ETWA 4BKXA 5B66C 2Y0MA 1G4DA 1FEXA 4LLLA 2VQLA 4C2TA 1R5ID 2CJJA 2LKPA 4YIIA 3K1MA 4LG3A 4XKVA 3UNGC 3L00A 1XN7A 4KMFA 3MQ0A 3ZMUA 5IP7J 4LITA 2KRHA 2EJRA 1DQUA 4PFOA 3E6MA 5K1YA 5LHGA 1L0OC 4GCVA 1IZ1A 2ISYA 4IF4A 1MSEC 3LOCA 2OBPA 3BR1A 3J81Z 1KU3A 3OYKA 5IYBJ 3GFJA 4QWQA 4R79A 3O8GA 1A36A 1D3YA 3BPXA 3J7ZI 1K78A 3ZN1A 2F5FA 3C2HA 1AU7A 5FJ8J 3IC7A 2L54A 3CJTB 3H9GA 2KIMA 2XRLA 5DD4A 1FP2A 3K2AA 2QZ8A 2X6WA 2IS1A 4XBFA 4NUBA 2J5OA 2DYRH 2YSRA 1QZEA 3I3LA 4DBQA 4N9HA 1VQPI 1RC9A 2MW8A 3WTZA 1YX5A 3DTKA 1MMDA 2NS8A 3OS0A 3ABTA 5E18F 4RMNA 3DPTA 2X0LA 5EZHA 1MMSA 4F91B 2Q2EB 4IRIA 3PSFA 1VQ5I 2M1BA 3V7SA 2QA4I 1A04A 2CFXA 2E71A 3ZQQA 1E3HA 2HDWA 1JT0A 3M7GA 4HSRA 3W2VA 1GHCA 3ZMTA 2MA3A 4NBQA 3E5UA 4GXOA 2LMDA 2D45A 2Y0SA 2D5VA 3G73A 2CW8A 2E19A 4L0ZB 2GA1A 4HZFA 4BUPA 2Y0SN 3DU5A 3HSRA 4UXNA 3RQ4A 1QBJA 5J1YA 3BR0A 3HZJA 1Z6RA 3LA2A 4NNJA 5J8CA 1B9NA 3S3OA 3VODA 3S1NJ 1EH8A 3C1DA 2RV8A 5CLSA 2WB1N 2OQRA 2VJ4A 2BGCA 4NB5A 2X9DA 4C9YA 4XKBA 4BE2A 2DFHA 3CQZJ 5LHHA 5BPIA 1WJBA 1U3EM 2QUFA 1VQLI 2QF7A 3U1DA 3BCBA 3PFIA 4RB2C 1X4PA 3QRFF 4XICA 3DU6A 3S8PA 1IN4A 2VE8A 3CMEI 2VKEA 1I6HJ 5CVRA 4Z2YA 5GAEJ 1PJRA 2LR8A 3BG7A 4BL0B 2M0MA 4B48A 5K7FA 1ZK8A 1ONVA 2PQ8A 3E6BA 3L09A 5KK1A 5M3MJ 3TBIA 2RKHA 3I59A 3TO9A 3IUOA 1BBYA 2MYSA 2R93J 3OYAA 4FETA 1R1VA 3DXJF 5HOOA 1J9IA 2L7MP 3A0BC 4XLNF 3IKTA 1E3PA 2A5YB 2K4BA 1TT0A 2OUMA 1ETXA 2FUG2 2L7ZA 3V8LA 2K86A 1YQAA 1FT9A 2XF6A 1JGSA 3IRQA 3GMEA 2B9SA 2EIMH 1H9TA 1T39A 4PSWA 2E1CA 3IWFA 4QIWN 2RNGA 3DTIA 2LBFB 3GTJJ 2A61A 2BY1A 2DODA 2JT1A 4XSXF 3TP3A 3WTYC 1IDZA 2ACJA 2FBIA 2CW0F 4F7ZA 3HHHA 3M1EA 5F1JA 1ZR2A 1FTZA 3DKXA 3DEWA 2K5CA 3W2AA 2F4IA 2VL8A 1FJLA 2VBZA 2XSJC 2XHKA 3S17J 2XAHA 4ZZDA 2LDUA 1UHWA 3D5RC 3S2WA 5FKOA 1QPIA 3B6CA 4PJLA 9ANTA 3QWLA 1S7EA 3U21A 2G7UA 3HOSA 2QYOA 2DPDA 2M4GA 5E17F 1B8IA 1PUEE 1FBUA 3L9FA 4S05A 4UV8A 1Y1WJ 1W5CC 1USSA 1Y0UA 2EZKA 3FX3A 2X48A 4U7BA 3LSPA 2A5WA 5HLIA 2HZTA 5JLWA 3DKYA 3HJEA 1N78A 3FK7A 4HYEA 3IV5A 3FF5A 5FO5A 1D8KA 2COBA 1WCMJ 2QGUA 5LGNA 3OYCA 1KA8A 2BVLA 2KKOA 4IHYA 3ZMVA 1E3OC 2FRHA 3BT9A 1BN5A 2EZLA 4Y17A 5F64A 3LWFA 2QVOA 5K5OA 4ESFA 2QLZA 1V5EA 4KICA 1FIPA 4V2GA 3H36A 3GTLJ 2DCEA 5ICCA 1SMTA 3Q3SA 5EGOB 1D0YA 1FMVA 1R9TJ 3IAS2 1WVRA 3F8BA 3GLXA 3LMMA 2XAFA 4UVCA 1B59A 3X2QH 2NNYA 2XASA 1D1BA 3KEQA 4DQ2A 3ZP5A 1TWGJ 1O3SA 4RAYA 3BG6A 4AD9A 2R5ZB 1I6XA 1G2HA 5A2QZ 2R7DA 1EH6A 2IVMA 4DOZA 2EZIA 4BGDA 5IOYA 3WTVC 3S3MA 2KHMA 4IHTA 3IHUA 4LK0F 5C3EJ 3Q0WA 3BR2A 3GTQJ 4M9SA 2CO5A 2A6EF 1HW2A 1B9MA 3RPUA 3C7JA 4I02A 4RAFA 1STZA 1UFMA 2JA7J 2P4WA 3RKYA 1J59A 1E2XA 2CGPA 3JSPA 3F22A 1ZG1A 1I5ZA 3H9JA 2DK8A 2CUZA 5CYVA 1IXCA 4M74A 2IGOA 4U0VA 2R7WA 4Y13A 5IP6A 3BJOA 2ZMEB 3PFYA 1V55H 1PUFA 3CCUI 1OQYA 3ABMH 2V9KA 3WGHA 2BY3A 4DZJA 1ZG5A 1U2WA 2K40A 3CCMI 4GYGA 1DU0A 4IPAA 3A01B 2VI6A 5JHUA 2GXBA 2MD5A 3FXLA 2I10A 3F21A 5GPAA 3H3ZA 2H1KA 2VKDA 3FMQA 3KYCB 2BW3A 1P2FA 3PQJA 5ERIA 2P8TA 3OOUA 5D8KB 4FT8A 2QEXI 4BNCA 4KUMA 2E5NA 2G0EA 4B4CA 4GYIA 1YJ9I 4HLXA 2BVMA 1XCBA 2CUFA 3P9KA 1E17A 3BQYA 5KVRA 4BE1A 4BBRJ 1BIAA 5HLTA 2CV2A 3KFWX 4G94A 3QP5A 4EMSA 1JTYA 3FKJA 4U0YA 4IO9F 2OTLI 4MLOA 2IP2A 1O3TA 2R7VA 3GZ5A 1Z3YA 3ERMA 2VXDA 2CUEA 1WH7A 2JA2A 3V8JA 4LGWA 4CCKA 3I4MJ 3Q9SA 1IUYA 4WCGA 2BE5F 5LHIA 2ZBKA 1K7AA 2HYFA 3NARA 2XDVA 5DD8A 3MD2A 4CCJA 5D5UB 4UUSB 3F8NA 4XKWA 2KL4A 2NVTJ 4A5MA 2HU9A 1IV8A 2QQ9A 5CJ9A 2ELJA 2IA1A 3ULQB 5L3FA 3HTUA 2FQ4A 5DCMB 3CMYA 3I9V2 3HYIA 4I09A 3GTMJ 2RN7A 4FX0A 2LF8A 2IS4A 4UVAA 2I8DA 2OU2A 4MQVA 1UHSA 2R0QC 1SVMA 2LVSA 3OSFA 3KEYA 1W5SA 1XMKA 3N05A 2V1XA 1LE8B 5B3SH 4DYRA 1U6GA 1S29A 5IT9Z 4V2FA 1R49A 2KISA 2A6HF 2EIKH 4IXAA 1BC8C 2HVSA 2XRNA 2OC6A 4KN4X 4HX7A 5B5EC 1MDMA 2RQPA 3JR9A 4D1QA 3JRAA 4Y15A 3MMYB 3QOPA 2YR2A 3ABKH 4LFUA 5J1RA 2E2IJ 3C2GA 2IA0A 2ZKZA 4D7NA 3VYUB 1JJ6C 3GFMA 1BW5A 1LUJB 1ZLJA 3OYHA 5EZGA 1XMAA 1AHDP 5GAGJ 1QGPA 4PCQA 2N8GA 4CZZA 4HLYA 3MKYB 5TJJA 3PIPF 3LSIA 3DWLE 2W4SA 2LRDA 1SANA 2M34A 4E6KG 2O8KA 1X1DA 3HPHA 2HOTA 2E1NA 1QA6A 3QQAA 2L9NA 1DUXC 5BOXA 1XSXA 1U5TC 4B47A 2V7FA 4FX4A 2MD0A 1K83J 4QPOA 4EJOA 1KU7A 2PLYA 2PI0A 4I7HA 4M3DA 1D0ZA 2DAOA 2E1MC 3QP6A 3SEQA 2DMQA 2JQ7A 1U8BA 2HI3A 3QAHA 1BR1A 5E1ZB 1OCRH 3Q5FA 3LAJA 4CYCA 4UB6C 1HDDC 2GOXB 3ZQIA 4C3JJ 1P4WA 1WI9A 4ZJZA 3F8FA 2L0KA 1YJNI 1JJ8C 1LDKB 5H2FC 3QOEA 4LD5A 2LSOA 3K0LA 2FBHA 3V4GA 1F4KA 3S15J 2UZKA 2CQNA 1ETQA 3BR5A 3OYIA 2GXAA 4HRIA 1IN5A 1OYYA 3FMRA 4J19A 1FC3A 5JI6A 3F9KA 4EM1A 3UR3C 3M8FA 1XS9A 5KAIC 1IO2A 1BJZA 4E70A 5D6EA 1BR2A 5F6FA 2VT3A 3WHCA 1P4AA 1R1UA 5IP9J 2QBYA 2XKOA 3BROA 4BEHA 2MC3A 3PO3J 1WJ5A 2DT6A 2TRTA 4HX8A 3B02A 4LMYA 2YUSA 1LVAA 5ILSA 3ZOBA 3FBNB 5JR3A 3MN2A 4ZYGA 1DP7P 1WHUA 4CXFA 1ETKA 1GVJA 3EYIA 5M3FJ 4BQNA 2X51A 2PFBA 1HXDA 1ZRCA 1NTCA 2HNHA 4LB5A 2JPCA 1K79A 1NK3P 5IT3A 2ZJ2A 1S3JA 4Q48A 4B3XA 4NQWA 1O3RA 3FXRA 3GUDA 3FHNA 4C2MJ 1T8IA 5EG0B 2M2EA 3CUQC 4G6TB 2D1HA 3O8HA 3GX4X 2OD5A 5FKNA 2HQAA 2V9PA 3NQOA 3W6JB 5D5XB 4A3BJ 4KT6A 3LL7A 3PO2J 4IZZA 2M87A 1X1PA 2CRGA 3QODA 4AWXB 1UJ8A 2F4OB 5F1RA 1HBXG 1HC8A 1AA7A 2ZXWH 3RKXA 1LEBA 1HW5A 1U5TB 1Z0XA 3KP4A 1JE8A 1ITYA 3COAC 2E1MB 2HOEA 3JRIA 3FM5A 2WAQA 1HKSA 1MZBA 3SJMA 4R1HA 5HS9A 1FYMA 3O2PE 1XGOA 4FHTA 1Y56A 3CP8A 2QM3A 4XORA 1VFCA 2R7UA 5IY5H 3WU0A 5KCMA 3OWTA 3PIOF 1ON1A 3ZCOA 1T95A 4JYKA 2R5YA 5J40A 3J7YJ 4A0ZA 2GZWA 3AG2H 2ELKA 3ZMDA 2F4MB 3TW7A 3KEOA 1QO0D 2JSCA 1I50J 1PVEA 4R8HA 1OJLA 1FZPB 2ADUA 1UAAA 3OV8A 3TO6A 1RRJA 1ZH5A 1IRFA 2AO9A 2K9LA 3A02A 3MVPA 3HKZN 5K5QA 3ZQ7A 5E79C 5KAFC 1BL0A 2B0LA 1Z3XA 4BACA 1T6SA 4JX5A 3RI4A 4RGRA 1SVOA 1HKQA 1ODDA 2KDOA 3H0GJ 5FKLA 3CC4I 5M5YJ 5HS8A 4XLPF 4I6ZA 2BBYA 1NG7A 3LSRA 4MNUA 4DGWB 2HR3A 2EIJH 2LY9A 3FMSA 2VPRA 3DPUA 4KT5C 2JA5J 2MH2A 3V7CA 1MBKA 5E20A 2KMUA 3KP6A 2RNJA 4E7IA 1H88C 4G8XA 2KLOA 2CUJA 3MKLA 3JW4A 2V79A 4EQQA 2XF7A 1GV5A 3I0TA 4KN7X 3Q0VA 2VONA 1DPUA 3CUQB 2AHQA 1TBXA 3VYRB 1SFEA 1CF7A 2K4JA 2BY2A 5E8GA 4ZDPA 2IS6A 4A6EA 1TT5B 2W1OA 3OIQA 4KIFA 2DYSH 4QSHA 4YEJA 5E3LA 2M30A 4G7HF 4IHSA 5FLVA 2GIZA 5DDGA 3VYTB 2VKVA 1RETA 3LSJA 4HBLA 4Q5SF 1B4AA 3DCFA 1W4MA 3HRMA 2DT5A 3GYHX 1G3WA 1RR7A 2DA6A 3J7AO 2YPRA 2LYCA 2M8EA 1J7KA 2P0WA 4L5JA 4AYBA 5FB2A 3E7LA 3HSFA 4AUXA 3QU6A 3UKGA 4WXDA 1Q1HA 2NXNB 5IOZA 3H5NA 2QCOA 2COMA 4ENNA 4RM3A 3OIOA 2DMUA 2QENA 1C0WA 3HOZJ 1WH5A 5HNFA 2LF7A 1YW9A 2R4GA 4KIGA 3T5XA 1QHGA 2KIUA 3EUHC 5L3DA 2QQBA 4II2A 2E2HJ 1VQNI 3PNVA 3NWSA 1K4SA 4D5FA 1Y8RB 3LSHA 3IAM2 4DYQA 3FK6A 2ZJPF 3T8RA 5HS7A 4F92B 3ZQFA 3U2RA 4E7ZA 1BOBA 1U9NA 3GBGA 4OIOF 4C2UA 1OCTC 2XGCA 3CLOA 3OL3A 3KLNA 2ZXJA 3KLOA 4RB1A 3DKWA 1LKXA 1R00A 2A68F 1TW2A 2HVQA 1YRNA 3K6GA 1ZN2A 3ECOA 1HSTA 1QZZA 1VQ6I 1YHQI 1W5TA 5FKKA 2LH9A 2VBWA 4LOCA 4HF0A 2Y9YA 3LSGA 4NC6A 3RKQA 2KQRA 2JK3A 5FKMA 3OIPA 4LLGF 3FXKA 2JRMA 4KYWA 1BI0A 2PEXA 1I39A 1LDDA 4ESJA 2BXZA 2DBBA 1OYWA 4DYCA 3BTJA 4F93B 4HNUA 4YFNF 4XIDA 2OJED 3HOYJ 1YITI 3TOAA 5JVGF 4ZYDA 3F3XA 1Q1VA 3OY9A 3GEZA 2XVCA 4KMUX 2DW4A 3WGIA 5LRRA 1XB4A 2HKXA 2CYYA 3SDBA 3A4CA 1T0FC 1LEAA 1S6LA 1OYIA 2D2WA 2PMHA 3DTEA 3KPHA 1NG6A 4JQFA 4UNOA 2K85A 2CWEA 4XRSG 1VQ9I 1MW7A 4ZZLA 3G2BA 2L9RA 5KNLA 4AIKA 4OMZA 4XSZF 3ZRGA 1VQ8I 2XSDC 4LIVA 4BHPA 1SFOJ 1LFUP 1TP4A 3BTIA 3CO7C 2ICWG 3E97A 5LLQA 3DBLB 4JX4A 4DIQA 3CCJI 2WV0A 1AKHA 2DQLA 2WC2A 5FGMA 4OAZA 5D4RA 1Z05A 2UWMA 1M1EB 5DM6F 1W7PB 3B6AA 2P5VA 2VBYA 5J4VA 2VC0A 4KIBA 5EEHA 2BZTA 2PJRA 2ME6A 2M5WA 2WY8Q 4XN3A 4XL9A 3I64A 1HCRA 3NAUA 2FBKA 3DBRB 3LA7A 4OIQF 3K1NA 5FLXK 4PFPA 1Y1VJ 1XMXA 1W7PD 3HOTA 1R36A 1R58A 4U87A 4EGYA 3BDDA 1O7FA 2KDZA 1EKEA 1RKTA 2M3AA 1D5YA 1XPXA 2H1LA 4BJ6C 2HVRA 4MHGA 2UV1A 2CS3A 2F5EA 3PUFA 4WX9A 5GTHC 3OYJA 4P55A 2V4JC 1Z1DA 2OA4A 2VOOA 5K7HA 1TW3A 4ZTFA 1IRGA 3HB9A 2BEOA 3HPGA 3EETA 4PJNA 3MKWB 3F0CA 2LKSA 1ZREA 2KRFA 5E1XA 5GP9A 4BDZA 4H0EA 3BJAA 2ZMEC 2FX0A 3MEXA 4O5VA 4GRIA 5JVTA 2VJ5A 4HNTA 4OU0A 2KZGA 3JRGA 5H20A 1GXQA 2IPQX 2OZUA 3CUOA 2TDXA 3A03A 4A3DJ 3VSKA 3MFKA 4B09A 1DGRM 3PL8A 4V19K 4DW6A 3FZVA 2HWVA 1ULYA 3BCAA 3GW2A 1UZCA 3WODF 3PNTA 3TDUC 2VJJA 4HV6A 3R6SA 3V7RA 2FNPA 2ZNYA 3D0SA 4YELA 1G3SA 2DJNA 1KQ9A 4EVIA 3I55I 2BY0A 2DFFA 5LEJA 2DK5A 5DM7F 1GUUA 3E6DA 4IQJA 3K9TA 2PX9A 2K27A 3KZZA 3JTHA 2CQQA 2IBDA 1UMQA 3AG4H 3AL0B 1BIBA 2L9SA 3E6CC 2X4HA 5FFZA 1TTYA 4EV0A 3NRVA 2F6CA 3IH4A 5LEKA 2K9QA 2DMTA 4YIFA 1W36C 1SFXA 3GO5A 4YIRX 1J5YA 2KP6A 3G1OA 2JUGA 2Q8KA 3FISA 3T8TA 1X3ZB 2ZB9A 3T0YA 4H4KC 2VC1A 2J5PA 1S72I 4NHJA 4NC7A 3GTKJ 2E35A 5ICFA 1TWFJ 4DBRA 5K5RA 1SD7A 1JGGA 3W6KB 1U0JA 4ZYHA 3QPHA 3H3UA 3H5AA 4IRGA 4PJJA 4AC0A 1W0UA 1OR7C 1A6IA 4RAGA 4AIDA 5JLXA 2OPTA 2YX4A 3BLYA 1V3FA 2V6CA 3CCRI 2XPUA 1RZ4A 3HUGB 1ETYA 5LBQA 1HQCA 5LRSA 3Q9VA 1JI8A 3RJPA 1SD4A 3PM1A 4A3FJ 4FCYA 2K9MA 3RTRA 3VWBA 4BEHB 3CD6I 2ESNA 1MMNA 4WF2A 5E8IA 4D7MA 1SAXA 3S2DJ 2HDCA 2ZJQF 2V6EA 1S7AA 5B1BH 5D5VB 4PGHA 4CYDA 2MG4A 5J3LA 1SD5A 4G6DA 3D1NI 4XR6A 2MLKA 2NNNA 2X85A 1XX5A 5ICEA 4Y52J 5F0HA 5D5WB 3J81K 4AVZA 3RZOJ 1OCZH 4LG0B 2WADA 4L9TA 2DN0A 3CJNA 5IYCJ 5HDGA 2KIQA 3S93A 3SYTA 1QU3A 3HC7A 2DFIA 1IRXA 1JUMA 2DOAA 3DLAA 4KNYA 3J7AY 2Z5UA 1Z7LA 2B63J 1GDTA 4ZDLA 1S8NA 4XKCA 1YW7A 4MTDA 3JTGA 3K4NA 1JT6A 3FM3A 5AIQA 4HQMA 2IA2A 4S0HB 4QLCU 1R23A 4CCNA 5HLHA 2VB6A 1IV6A 2UXNA 3I54A 2P7CB 3CO6C 3LAPA 2R7FA 3O3KA 2P7VB 1YG2A 2JTVA 2W48A 3L2CA 2C6YA 2HPMA 2K02A 3I5UA 2Q2EA 1G59A 2TCTA 4BHCA 3KE2A 4I0AA 1X58A 2WA0A 2NVQJ 2EFQA 2BHYA 4IHXA 4OIRF 4QPQA 2EV5A 4CGZA 1WGXA 1MMGA 4G12A 2WAFA 4HF1A 4N0BA 2YS9A 3SDGA 3E5XA 3K4KA 3E5QA 2GWRA 3P9CA 3GTOJ 1OMIA 3AFHA 2RC4A 2NVUB 3TP0A 1RUNA 3OYGA 5F04A 3BR3A 2LOOA 1RKWA 2DXIA 3ABUA 3HOWJ 4A3LJ 1MBJA 2QKMB 4M3FA 3RYPA 1LPQA 3L2UA 1W36D 2W24A 3K70D 1P92A 3K4BA 4L9JA 4P9FA 2FOWA 2UXXA 2VIXA 3KP3A 5D6FA 3TEDA 3M8JA 4BY7J 3SEZA 2FNAA 2FQ3A 3L2VA 3OYNA 3H0DA 3M1CA 4B3AA 3I56I 1SD6A 3HOXJ 2X1EA 4A0YA 4XLHA 1DPRA 3HDDA 1S9HA 2XAUA 3KP2A 3SZPA 4BDYA 4MEXF 3K7AJ 4XRMA 4PK4A 3QYEA 3RPQA 4CCMA 5L3EA 1TLHB 3AG1H 1VQKI 2EFNA 2PMZA 4Y4RA 2LFBA 2LNBA 2VOPA 1UELB 2FOKA 4HOBA 3HEFA 1Z77A 2PMZN 1BJAA 1TWAJ 3DEEA 3PSIA 2EFPA 3D5LA 2KFDA 2LP0A 3HGYA 4YRVA 3HM5A 2OQGA 2GOMA 4AIJA 1D8JA 2GIVA 2DTRA 1ZG3A 3P9IA 1EV7A 3IH2A 3CDHA 3F6VA 3RIRA 3LSTA 5L3GA 3FWEA 5F0FA 2IW5A 3VPRA 2FMLA 1ZELA 5BQTA 2PMUA 4LB6B 3HRTA 1KZHA 4XQFA 1DU6A 3M9AA 4OAYA 3ISPA 1I1SA 1N25A 3BOQA 3CCVI 2DA2A 4WK8F 1UG0A 2IGKA 3J80Z 4M3GA 4L9NA 4XLEA 2V26A 2ELHA 2ZC2A 2WY7Q 1OISA 4AVPA 2LBFA 3F6OA 5TISC 4F55A 2OF7A 3I58A 3G6EI 5FRMA 5H6QA 2FE3A 2KJCA 2DFEA 4RLFA 2P81A 1B72B 2XUBA 2DOFA 2BOLA 4RGSA 1LFBA 4CICA 1XDSA 2DJIA 1RIOH 4A0XA 5E1WA 5IPAA 3H9QA 4A3KJ 2CFOA 3RCOA 3S2HJ 2DA3A 2PN6A 2B7EA 1VI0A 2JN6A 2JJ7A 1FY7A 4F52A 3G3ZA 2X1CA 3MZYA 1TQIA 3WU2C 5J47A 3HTSB 1NK2P 1FNNA 2E5ZA 4OIPF 5C4JJ 1K6YA 5BNGA 3PUBA 1EF4A 3DPLC 4Z6YA 1RR8C 1T08B 4M72A 4U88A 4RAZA 2NAZA 3GLLA 4EEFG 2FA5A 2W84A 1KQ8A 3M8EA 1OCOH 2XIGA 1ZR4A 3ML6A 2E2JJ 3WE3A 3K1PA 4XRSA 2Z16A 3L1PA 3AG3H 3R0JA 2FJ1A 2AQFA 3CCLI 3FHZA 1VQ4I 2M9HA 2CMPA 2FMYA 4XLCA 4ON0A 5D8LB 1ZGAA 3PNYA 3A1YA 4UUVA 3PQKA 1MSFC 1QRYA 1K78B 2EZHA 1TL8A 5GTIC 1X1BA 4XN0A 3CCSI 5EGOA 4CO8A 3A0HC 4MFEA 2NYXA 2DU9A 2DQRA 2QSHX 3G1LA 3CCYA 3NWTA 3QU3A 4I0BA 4C3IJ 3WTSC 4MFDA 4A12A 3M07A 2ZFWA 2R5ZA 5FRNA 3GWZA 4IVNA 3SZTA 1FYKA 3MAJA 1IN6A 1HDPA 3JAMK 1SVLA 1FLIA 4BXFA 3CF2A 1H89C 2W7NA 4DJAA 5L3BA 5EJCA 3SFIA 3JRBA 1XSDA 2FEZA 4KJZA 2EWNA 4ESBA 3WG7H 3V8KA 3F23A 2W57A 2CQKA 3RYRA 5BMZA 2NOJB 2ZJRF 2JMWA 2F48A 2KZVA 2GBYA 1BC7C 1XTAA 1IG7A 1W1WE 3QYBA 2O8XA 4EATA 2BHZA 2K9NA 4PGGA 1LVKA 1IN8A 2R7ZJ 1FP1D 3F8MA 3W3CA 1QVTA 4A69C 2H8WA 4CH7A 2ZMEA 3OYEA 2F5DA 2KJBA 1S5LC 2VQCA 4O3MA 2Y30A 4ENKA 2MC4A 3VSLA 1FOXA 2R92J 4XK4A 4EM0B 1IJWC 4FASD 3OS2A 4A3IJ 3K4CA 4GFBA 4G7OF 4IKFA 2L9VA 2WAQN 1W0TA 1FBSA 1BW6A 3HL2A 1R71A 3CC7I 1I3QJ 3TQNA 1F43A 2HQNA 5J8FA 1YJWI 3EYYA 4PZJA 4W1UA 4MIMA 1BOAA 2JVGA 3ESWB 3REOA 2L4MA 4PDKA 1RPWA 2XGXA 2VPLA 1RUOA 5IYDJ 2FSWA 1KYWA 2EH3A 1MD0A 4NC8A 1HOMA 4UHTA 3OYBA 4M3BA 4WXHA 3QPSA 1R5HA 3ZN0A 4RM2A 5DUIA 3N97A 5FLXZ 4ZTJA 1LNWA 3CJRB 4JP0A 1JKOC 3G4SI 4KISA 3IH3A 1KU9A 1X19A 1JUSA 3RKWA 2A07F 5LGUA 2Z33A 2F2EA 5JHFA 2DO7A 3TKYA 3I59B 1HKTA 1MGTA 1D1CA 1QPMA 5DCFA 2HEOA 1P9QC 3DFGA 3BC8A 2NS0A 2ID3A 1OPCA 2ZXIA 4ITVA 1H0MA 1NHAA 1T98A 4XOPA 1OLTA 5DCMA 2K7LA 1N77A 1H8AC 1E0EA 2ME0A 2IXSA 4FE4A 3SQNA 2GQQA 1SFUA 2EA2A 2MABA 2X6OA 3TOBA 4L18B 3FXUA 3IP4B 2O61A 4HV5A 3JRFA 2OAZA 1R4NB 3HGGA 1LE8A 3S1QJ 4A3EJ 2H27A 2OTJI 5IT9K 4XOTA 3ZQLA 2CU7A 4I98B 1O7LA 1YOVB 4M9ZA 2VQHA 3QPTA 3RDIA 2E60A 2RAEA 1K61A 3CJQB 4S04A 2DMPA 3AKZA 5F0CA 1I1GA 1V4RA 2A3SA 2O9LA 2STTA 4EGZA 4LJZF 2DI3A 5CKTA 3KZIC 3VB2A 3W6VA 1JHFA 4B8XA 2R3SA 1BI3A 1LQ1A 3CC2I 1B8IB 1P7IA 1ETOA 1F5TA 4CHUA 1VF9A 2RVCA 3WTWC 3DBHB 1S7OA 2EFOA 4AYBN 4G7ZF 3C3WA 3OS1A 3EQLF 2V1UA 2JZYA 3ASOH 3CMMA 5DS9A 2A6TA 3R0AA 2CG4A 4I99C 4X6AJ 1IAWA 3OSGA 1ON2A 3EUAA 5FROA 3ZR8X 1YE9A 2LKXA 3MWMA 1F36A 2EQRA 3MCZA 3JRCA 2BYVE 3OYFA 1PYVA 4A93J 1TNTA 1Z6TA 1YW8A 4KDPA 3S3NA 1FPQA 4KFCA 2ZSIB 4N4OB 3HSEA 1VTNC 1GVDA 1SFKA 2Y9ZA 3ELKA 1X3UA 3GTPJ 2O3FA 2DA5A 1TWCJ 2K9SA 1X1AA 4AU7A 2O5RA 3OMYA 1SEUA 1DP3A 3ONQA 5CQGA 5GADJ 5GAHJ 3L2RA 4E7SA 4BJ5C 4E7LA 3BQZA 4L0YB 5TGTA 1Z7UA 1J09A 4KITB 1TQMA 1JKRC 2L01A 1Y8QB 3KETA 1JHHA 3JRHA 1ZQ3P 1TZLA 3KP7A 2HOSA 2CV0A 3U1KA 1QVUA 4YG2F 4P5OA 2E34A 1OFCX 2WTEA 3WHBA 3ZQHA 4N9IA 5EF6A 3Q0UA 2EV0A 3R61A 1YX3A 2Z1DA 1WWXA 1XSVA 4MTEA 3RZDJ 4LLNA 2P5LC 2JRTA 1PUFB 4RLQA 5EDNA 1GV2A 3RPUD 3H92A 3QYFA 2RREA 2IRFG 4M73A 4EJVA 1JKQC 2HQ5A 4A3MJ 1GLNA 4IQ4A 3BY6A 5EEGA 4RGXA 4B43A 3E3VA 1BM9A 5EG0A 3AL0C 3BZCA 4UV9A 2QSFX 1YIOA 2BW3B 3FBIB 1MJBA 3M3YJ 3OYLA 4BAYA 3HOVJ 4UUTA 4ENJA 3BPVA 4A3GJ 1GT0C 3KZYA 3L2WA 1BI2A 2EV6A 3HIFA 1ZHFA 2E36A 4Y3OA 3LNQA 2XB0X 4HEA2 2QSGX 1MNDA 1YO5C 1X1CA 3ZQCA 2X6XA 2P6TA 2DDBA 1WFXA 4BBSJ 2DA4A 3R4KA 3CZ6A 1U5TA 3RSNA 4I76A 1YTYA 4HAMA 2VQGA 1TWHJ 1XCVA 1YFHA 1O57A 1PP8F 2JA6J 1R22A 5KHDA 5M5WJ 4L5EA 2R7QA 3DP7A 3E0JB 1O4XA 4CCOA 1Z67A 2KPMA 2WB1A 3AAFA 1ETVA 2ISZA 1ORKA 2STWA 3GFIA 1FMWA 1SAUA 4Y7NJ 5K7ZA 3S1MJ 1B6AA 2XAJA 5FLMJ 5ILUA 3K2ZA 1RESA 2OCEA 2VUMJ 5J4YA 2HYGD 3GTGJ 3N4MA 3BR6A 1TC3C 4D0PA 1G8XA 4X0GA 3JRDA 4Y33A 2G9WA 2M8GX 3P7NA 5HLGA 3HG9A 2EPFA 2Y75A 4BS9A 1FSEA 1ENHA 2HTJA 5M5XJ 2W82A 1LB2A 5CPRB 3KCCA 2I5UA 3K4JA 1WJEA 3FXMA 3TL4X 2VLAA 1POGA 1UB9A 2MH9A 3BG9A 4XNFA 1MDMB 2O6GE 3WG9A 3G1MA 2Y48A 1VQOI 1U8RA 3H35A 4U7DA 4E7JA 2LLKA 1WJDA 2H6BA 4IHVA 1BI1A 3S16J 3W2WA 1X3WB 2VBXA 1MH3A 2EINH 3BZ6A 1DGWY 1A35A 3H5RA 3MZ8A 5CVIA 2VXZA 2Q0OA 4P1WA 4CDGA 3VDXA 3CDIA 3HXLA 1SC7A 4XLFA 5C44J 4CCLA 1A31A 2IGNA 4HG2A 2Z2SB 4HW0A 1WKMA 3M4OJ 1XD7A 3E1SA 4DZPA 5CVUA 3I53A 1REPC 2WV1A 2M0CA 2ZSHB 3DLLF 2EA4A 1A5JA 3CUQA 2LREA 2HXOA 5LD2C 1KONA 2WBMA 3VOEA 3ERED 4G6QA 3OL4A 3BJ6A 4CYCB 2M4KA 3K70C 4JK1X 3JCUC 1U78A 4A6DA 4O6JA 3ROUA 1XGMA 3LA3A 2DA1A 4MO7A 4WWCA 5J6XA 3B73A 5BS6A 4RB3C 4KA4A 2LD5A 2VODA 2XV4S 5FD5A 4YFXF 1FIAA 3HHGA 4Q4ZF 3CCEI 1IXSB 3SHFA 4BE0A 2JPBA 4FQGA 4I2OA 4ETSA 3T1BA 3HRSA 3C18A 1LDJA 4HPQA 2DOEA 4Q47A 1IRZA 2A69F 5D4SA 2FD5A 1LJ9A 2NRAC 1VZ0A 4A5NA 2CW7A 6PAXA 3BP8A 1FYLA 4C3HJ 4ANJA 4BU2A 2V9VA 2IEKA 3CTAA 4IEJA 2QBYB 2E7XA 5EEAA 1ZARA 4B44A 3SXYA 2Y31A 5HDKA 4ZYAA 3I4PA 4FISA 4ZYEA 3VFZA 2CH0A 1RNLA 3S14J 1V5GA 1G6NA 4IHWA 2LK2A 5EYRA 2JA8J 1Y6IA 5HVQC 4LIUA 4BXUA 4QTRA 1USTA 2P5KA 2R7RA 3JAMZ 2IT0A 3L7WA 4NQWB 4RGUA 1FOKA 1ZKGA 4GO1A 3KP5A 5B1AH 3R60A 1IUFA 1QQIA 3A2KA 1J2XA 2L4AA 1ACIA 3HRUA 1OCPA 5FFXA 4M9XA 1EH7A 1MNMC 1CGPA 3TGNA 4CUGA 2P6SA 2EK5A 1P6RA 1T33A 1J0RA 5F27A 2GA2A 1FSHA 2E7WA 4EJWA 2DLLA 1X2NA 2NS7A 3K4LA 3S1RJ 1IF1A 2OZ6A 1I27A 1YS6A 1YIJI 1ERDA 4IJAA 3WE2A 2ZXHA 1R6RA 5E3OA 4XONA 3GVAA 1ZRFA 1IGNA 3V42A 1HF0A 3KYDB 1WPKA 1MBGA 2XGEA 1MBFA 2XPVA 4CSWA 2QKLB 2RQQA 2HPIA 1UG2A 2PG4A 3FDYA 4MGRA
chains in the Genus database with same CATH topology
4WXCA 1WQ2A 1MJAA 3F8CA 4XRFA 1PDNC 3EDPA 3IL2A 1JXSA 1W7PA 1IXRC 1HW1A 2HS5A 3EUHA 2Z99A 3LFKA 4I01A 2PJPA 4L9VA 1ZGJA 2ZNZA 2FU4A 1KGSA 4G9YA 1GXPA 2BV6A 2XAGA 4K2EA 1QNTA 1F1ZA 1DDNA 3OOPA 4ZH4F 3IRRA 2O0YA 2H09A 5AONA 1H9GA 3ZPLA 1UCRA 2L3DA 3F72A 3WGGA 1CF7B 2RGVA 4GGGA 4HX4A 4JBAA 1ZAOA 3JSOA 1KU2A 2FXAA 4BHBA 1IW7F 1WRJA 5ILVA 2HGCA 4HF2A 1IN7A 3NEUA 2Z9OA 4UVBA 3IKVA 4DNCA 2EFWA 1T0FA 1AOYA 5CVJA 3GFLA 2ESHA 1ZYRF 5AIPA 1ZRDA 1XGSA 1MKMA 3WU1B 2V1DA 3TO7A 5JFRA 4U0WA 2G7HA 2GAUA 1RI7A 4A2UA 3GZ6A 4M71A 2HTSA 4BQAA 5DUKA 5L3CA 1P4XA 5ED4A 5LGTA 4EM2A 3HUGA 3I71A 1T38A 2ZO4A 2L02A 1QZYA 5FD6A 4M6YA 1G3YA 5A2QK 2W85A 1UHMA 4EJTA 4OMYA 2ZCWA 1Z91A 2D1VA 4YFKF 2VE9A 1G3TA 1OKRA 1Z9CA 2HKOA 4IRHA 2GXGA 3WTXC 1R7JA 1ZLKA 1R5GA 4LG0A 4HDVA 4MEYF 3VEPA 5TRDA 2HQRA 5ICGA 2AS5F 5DYMA 1AWCA 1TQPA 1O3QA 4AIHA 1PP7U 1KQ0A 2H94A 2XAQA 2H6CA 4ENMA 2M45A 3ZMZA 2ETHA 3LQRA 2CSOA 1K6OA 1FX7A 2XKPA 4HDUA 2PBIA 3GXOA 5DEQA 2QQAA 1HSJA 2KIFA 3DV8A 1MJ9A 2Z3YA 1J75A 2EB7A 1T2KA 3MZHA 2QWWA 3WTTC 1YS7A 1B1BA 1F9NA 3ECHA 1YYVA 3TDZC 1OR7A 1SMYF 1TNSA 3DQVC 3GF2A 2XROA 2FF4A 2F5CA 4RB0A 1YLFA 4BYYA 3O6BB 2VT2A 3DF8A 4P96A 5HDNA 3BWGA 1FBQA 2IJLA 2RDPA 4L5IA 4MQ9F 5DV5A 2HFHA 2VN2A 1XGNA 4OINF 4HQEA 2DPUA 2MBFA 1D5VA 3ZMSA 3LQQA 2MLGA 1FWZA 4OOIA 4HA8A 1WSUA 4TV7A 3DEUA 3U9GA 3SFZA 2O03A 2W25A 3WTUC 3J80K 1R1TA 5BPDA 5CVVA 4P9UA 1L3LA 4M6XA 2AXLA 4RS8A 4BH9A 3FXQA 2YX7A 4EJUA 1KYZA 1XDUA 3K69A 2YU3A 2WWYA 3IWZA 5H6RA 4ASNA 4LK1F 2Y0MA 1G4DA 4LLLA 2LKPA 4YIIA 3K1MA 3L00A 1XN7A 4KMFA 3MQ0A 3ZMUA 2EJRA 3E6MA 5K1YA 5LHGA 1L0OC 4GCVA 1IZ1A 2ISYA 4IF4A 2OBPA 3J81Z 1KU3A 4R79A 3GFJA 4QWQA 1D3YA 3BPXA 1K78A 3ZN1A 2F5FA 3IC7A 2L54A 2KIMA 5DD4A 1FP2A 2QZ8A 4XBFA 2J5OA 2YSRA 4N9HA 3WTZA 3ABTA 5E18F 3DPTA 2X0LA 4IRIA 2M1BA 3V7SA 1A04A 2CFXA 3M7GA 1GHCA 3ZMTA 2MA3A 3E5UA 4GXOA 2D45A 3G73A 4L0ZB 2GA1A 4HZFA 3HSRA 4UXNA 1QBJA 3LA2A 1Z6RA 5J8CA 1B9NA 3VODA 1EH8A 3C1DA 2RV8A 5CLSA 2OQRA 2BGCA 4NB5A 5LHHA 5BPIA 1U3EM 2QUFA 3U1DA 3PFIA 4RB2C 3QRFF 1IN4A 2VE8A 5CVRA 4Z2YA 1ONVA 2PQ8A 3E6BA 3L09A 5KK1A 2RKHA 3I59A 3TO9A 1BBYA 1R1VA 3DXJF 5HOOA 1J9IA 3IKTA 4XLNF 2A5YB 2K4BA 3V8LA 2K86A 1YQAA 1FT9A 1JGSA 3IRQA 1H9TA 1T39A 2E1CA 3IWFA 2A61A 4XSXF 2JT1A 3WTYC 2ACJA 2FBIA 2CW0F 4F7ZA 3HHHA 3M1EA 2VBZA 2XHKA 2XAHA 4ZZDA 2LDUA 1UHWA 3S2WA 2G7UA 3HOSA 2QYOA 2DPDA 5E17F 1PUEE 1FBUA 3L9FA 4S05A 4UV8A 1USSA 1Y0UA 3FX3A 4U7BA 5HLIA 2HZTA 4HYEA 3FF5A 5FO5A 1D8KA 5LGNA 1KA8A 2KKOA 3ZMVA 2FRHA 1BN5A 4Y17A 5F64A 3LWFA 2QVOA 5K5OA 4ESFA 2QLZA 4KICA 5ICCA 1SMTA 3F8BA 3GLXA 4UVCA 2XAFA 2NNYA 1B59A 2XASA 4DQ2A 3KEQA 3ZP5A 1O3SA 4RAYA 4AD9A 1I6XA 5A2QZ 2R7DA 1EH6A 2IVMA 3WTVC 4IHTA 3IHUA 4LK0F 4M9SA 2CO5A 2A6EF 1HW2A 1B9MA 3RPUA 3C7JA 4I02A 1STZA 1UFMA 2P4WA 3RKYA 1J59A 1E2XA 2CGPA 3JSPA 3F22A 1ZG1A 1I5ZA 2DK8A 5CYVA 1IXCA 4M74A 4U0VA 4Y13A 3BJOA 2ZMEB 3WGHA 1ZG5A 1U2WA 4GYGA 4IPAA 5JHUA 2GXBA 2MD5A 3F21A 3H3ZA 3FMQA 1P2FA 3PQJA 5ERIA 2P8TA 5D8KB 4FT8A 4BNCA 4KUMA 4GYIA 4HLXA 1XCBA 3P9KA 1E17A 5KVRA 1BIAA 3KFWX 4G94A 3QP5A 4EMSA 4U0YA 2IP2A 1O3TA 3GZ5A 3V8JA 4LGWA 3Q9SA 1IUYA 4WCGA 2BE5F 5LHIA 2ZBKA 1K7AA 2HYFA 5DD8A 5D5UB 3F8NA 4A5MA 2QQ9A 5CJ9A 2IA1A 3ULQB 5L3FA 3HTUA 5DCMB 3HYIA 4I09A 2RN7A 4FX0A 2LF8A 4UVAA 2OU2A 4MQVA 1W5SA 1XMKA 2V1XA 1U6GA 1S29A 5IT9Z 2A6HF 4IXAA 1BC8C 2XRNA 4KN4X 4HX7A 1MDMA 2RQPA 4Y15A 3QOPA 2YR2A 4LFUA 2IA0A 2ZKZA 3GFMA 1ZLJA 1XMAA 1QGPA 4PCQA 4CZZA 4HLYA 5TJJA 2E1NA 1DUXC 5BOXA 1XSXA 1U5TC 4FX4A 4EJOA 2PLYA 1KU7A 2PI0A 4I7HA 2DAOA 3QP6A 3QAHA 5E1ZB 3Q5FA 3LAJA 1P4WA 1WI9A 3F8FA 1LDKB 4LD5A 2LSOA 3K0LA 2FBHA 3V4GA 1F4KA 2UZKA 1IN5A 1OYYA 3FMRA 1FC3A 5JI6A 4EM1A 3M8FA 4E70A 5D6EA 5F6FA 2VT3A 1P4AA 1R1UA 2QBYA 2XKOA 3BROA 2MC3A 4HX8A 3B02A 4LMYA 5ILSA 1LVAA 5JR3A 4ZYGA 1DP7P 4CXFA 1GVJA 3EYIA 2PFBA 1HXDA 1ZRCA 4LB5A 2JPCA 1K79A 5IT3A 2ZJ2A 1S3JA 4Q48A 4NQWA 1O3RA 3FXRA 3GUDA 3CUQC 2D1HA 3GX4X 2OD5A 3NQOA 3W6JB 5D5XB 2M87A 4AWXB 5F1RA 1HBXG 3RKXA 1LEBA 1HW5A 1U5TB 3KP4A 1JE8A 3COAC 2HOEA 3FM5A 1HKSA 1MZBA 4R1HA 5HS9A 1FYMA 3O2PE 1XGOA 4FHTA 2QM3A 3WU0A 1ON1A 4A0ZA 2GZWA 3ZMDA 3KEOA 1QO0D 2JSCA 4R8HA 1FZPB 2ADUA 3OV8A 3TO6A 1ZH5A 1IRFA 5K5QA 3ZQ7A 2B0LA 1T6SA 3RI4A 4RGRA 1HKQA 1ODDA 5HS8A 4XLPF 2BBYA 4MNUA 2HR3A 3FMSA 4KT5C 2MH2A 3V7CA 5E20A 3KP6A 2RNJA 4G8XA 3JW4A 2V79A 4EQQA 3I0TA 4KN7X 2VONA 1DPUA 3CUQB 1TBXA 1SFEA 1CF7A 2K4JA 5E8GA 4A6EA 1LQ1A 4G7HF 4KIFA 4IHSA 2M30A 5DDGA 4HBLA 4Q5SF 1B4AA 1W4MA 3HRMA 2DT5A 3GYHX 1G3WA 3J7AO 2YPRA 4L5JA 2M8EA 1J7KA 5FB2A 3HSFA 3QU6A 4WXDA 1Q1HA 2COMA 4ENNA 2QENA 1C0WA 2LF7A 1YW9A 4KIGA 3T5XA 2KIUA 5L3DA 2QQBA 3T8RA 5HS7A 3U2RA 4OIOF 3CLOA 3KLNA 2ZXJA 3KLOA 4RB1A 3DKWA 1R00A 2A68F 1TW2A 1ZN2A 3ECOA 1HSTA 1QZZA 1W5TA 2VBWA 4HF0A 4KYWA 4LLGF 1BI0A 2PEXA 1LDDA 4ESJA 2DBBA 1OYWA 4YFNF 3TOAA 4ZYDA 3F3XA 3GEZA 2XVCA 4KMUX 3WGIA 2DW4A 5LRRA 1XB4A 2HKXA 2CYYA 1LEAA 1S6LA 1OYIA 2D2WA 2PMHA 4UNOA 4JQFA 2CWEA 4ZZLA 4AIKA 4OMZA 4XSZF 4BHPA 3CO7C 3E97A 5LLQA 2WV0A 2DQLA 2WC2A 5FGMA 5D4RA 1Z05A 2UWMA 1W7PB 2P5VA 2VBYA 2VC0A 4KIBA 5EEHA 2M5WA 3I64A 2FBKA 3LA7A 4OIQF 3K1NA 5FLXK 1W7PD 3HOTA 1R36A 1R58A 4EGYA 3BDDA 1O7FA 4MHGA 2F5EA 4WX9A 4P55A 1Z1DA 2OA4A 2VOOA 1TW3A 1IRGA 2BEOA 3EETA 1ZREA 2KRFA 5E1XA 4H0EA 3BJAA 3MEXA 4O5VA 5JVTA 4OU0A 5H20A 1GXQA 2IPQX 2OZUA 3CUOA 2TDXA 3MFKA 4B09A 3FZVA 2HWVA 1ULYA 3GW2A 3WODF 3TDUC 4HV6A 3R6SA 3V7RA 2FNPA 2ZNYA 3D0SA 1G3SA 1KQ9A 4EVIA 5LEJA 2DK5A 3E6DA 3K9TA 2K27A 3KZZA 3JTHA 1BIBA 3E6CC 2X4HA 5FFZA 1TTYA 4EV0A 3NRVA 5LEKA 4YIFA 1SFXA 3GO5A 1J5YA 2Q8KA 3T8TA 3T0YA 2VC1A 2J5PA 4NHJA 5ICFA 5K5RA 1SD7A 3W6KB 4ZYHA 3QPHA 3H3UA 4IRGA 2YX4A 1V3FA 2V6CA 1RZ4A 5LBQA 1HQCA 5LRSA 3Q9VA 3RJPA 1SD4A 3RTRA 2ESNA 4WF2A 5E8IA 1SAXA 2HDCA 1S7AA 5D5VB 4PGHA 4CYDA 1SD5A 4G6DA 2MLKA 2NNNA 5ICEA 5D5WB 3J81K 4LG0B 4L9TA 3CJNA 5HDGA 2DFIA 4KNYA 2Z5UA 1S8NA 1YW7A 4MTDA 3JTGA 3FM3A 5AIQA 4HQMA 2IA2A 4QLCU 1R23A 5HLHA 2UXNA 3I54A 2P7CB 3CO6C 3LAPA 2R7FA 3O3KA 2P7VB 1YG2A 2JTVA 3L2CA 2C6YA 2K02A 3I5UA 2Q2EA 4BHCA 3KE2A 4I0AA 2EFQA 4OIRF 2EV5A 4CGZA 4HF1A 4N0BA 3E5XA 3E5QA 2GWRA 3P9CA 1OMIA 2RC4A 1RUNA 3ABUA 3RYPA 2W24A 1P92A 4P9FA 4L9JA 2UXXA 3KP3A 5D6FA 2FNAA 2FQ3A 1SD6A 4A0YA 1DPRA 3SZPA 3KP2A 4MEXF 3RPQA 5L3EA 1TLHB 2EFNA 2LNBA 2VOPA 2FOKA 4HOBA 1BJAA 2EFPA 3D5LA 2OQGA 4AIJA 1D8JA 2GIVA 2DTRA 1ZG3A 3P9IA 1EV7A 3CDHA 3F6VA 3RIRA 3LSTA 5L3GA 3FWEA 2IW5A 2FMLA 5BQTA 2PMUA 4LB6B 3HRTA 3M9AA 3ISPA 1I1SA 3BOQA 4WK8F 3J80Z 4L9NA 2ELHA 4AVPA 3F6OA 3I58A 5H6QA 2FE3A 2KJCA 2XUBA 4RGSA 4CICA 1XDSA 1RIOH 4A0XA 5E1WA 2PN6A 1FY7A 3G3ZA 3MZYA 1TQIA 3HTSB 1FNNA 4OIPF 3DPLC 4M72A 4U88A 4RAZA 2NAZA 2FA5A 2W84A 1KQ8A 3M8EA 2XIGA 3ML6A 3WE3A 3K1PA 3R0JA 3FHZA 2FMYA 4ON0A 5D8LB 1ZGAA 4UUVA 3PQKA 1K78B 4CO8A 2NYXA 2DU9A 2DQRA 3WTSC 3QU3A 4I0BA 4A12A 2ZFWA 3GWZA 4IVNA 3SZTA 1FYKA 3MAJA 1IN6A 3JAMK 1FLIA 5L3BA 1XSDA 2FEZA 2EWNA 4ESBA 3V8KA 3F23A 2W57A 2CQKA 3RYRA 5BMZA 1BC7C 2O8XA 4PGGA 1IN8A 1FP1D 3F8MA 2ZMEA 2F5DA 2KJBA 4O3MA 4ENKA 4EM0B 4G7OF 1FBSA 3TQNA 2HQNA 5J8FA 3EYYA 4PZJA 1BOAA 3REOA 2L4MA 4PDKA 2XGXA 1RUOA 2FSWA 1KYWA 1MD0A 4UHTA 4WXHA 1R5HA 3ZN0A 5DUIA 3N97A 5FLXZ 1LNWA 1KU9A 3RKWA 2A07F 5LGUA 2Z33A 2F2EA 2DO7A 3TKYA 3I59B 1HKTA 1MGTA 1QPMA 2HEOA 5DCFA 3DFGA 2NS0A 1OPCA 1H0MA 1NHAA 1T98A 5DCMA 2K7LA 3SQNA 2GQQA 1SFUA 2EA2A 3TOBA 4L18B 3FXUA 2O61A 4HV5A 2OAZA 2H27A 5IT9K 4I98B 1O7LA 4M9ZA 3QPTA 3RDIA 4S04A 1I1GA 1V4RA 2A3SA 2STTA 4EGZA 4LJZF 2DI3A 3VB2A 1JHFA 4B8XA 2R3SA 1BI3A 1F5TA 4CHUA 2RVCA 3WTWC 1S7OA 2EFOA 4G7ZF 3C3WA 3EQLF 2V1UA 2JZYA 3R0AA 2CG4A 1IAWA 1ON2A 3MWMA 3MCZA 2BYVE 1TNTA 1Z6TA 1YW8A 4KDPA 1FPQA 4KFCA 3HSEA 1VTNC 3ELKA 1X3UA 2O3FA 4L0YB 1Z7UA 1TQMA 2L01A 3KETA 1JHHA 3KP7A 4YG2F 4P5OA 2WTEA 4N9IA 2EV0A 3R61A 1WWXA 1XSVA 4MTEA 4LLNA 2P5LC 2JRTA 3H92A 2IRFG 4M73A 4EJVA 3BY6A 5EEGA 4RGXA 3E3VA 1BM9A 4UV9A 1YIOA 1MJBA 4BAYA 4ENJA 3BPVA 3KZYA 1BI2A 2EV6A 3HIFA 1ZHFA 1YO5C 2P6TA 3R4KA 1U5TA 1YTYA 4HAMA 1XCVA 1YFHA 1O57A 1PP8F 1R22A 3DP7A 3AAFA 2ISZA 2STWA 3GFIA 1B6AA 2XAJA 5ILUA 3K2ZA 2HYGD 3N4MA 4D0PA 2G9WA 5HLGA 3P7NA 2Y75A 1FSEA 2HTJA 1LB2A 3KCCA 1UB9A 2MH9A 2O6GE 1MDMB 3WG9A 2Y48A 1U8RA 4U7DA 2H6BA 1BI1A 2VBXA 3BZ6A 5CVIA 2VXZA 2Q0OA 4CDGA 4HW0A 1WKMA 1XD7A 5CVUA 3I53A 1REPC 2EA4A 3CUQA 3VOEA 3ERED 4G6QA 3BJ6A 4JK1X 1U78A 4A6DA 4O6JA 3ROUA 1XGMA 3LA3A 4WWCA 5J6XA 3B73A 5BS6A 4RB3C 4KA4A 2VODA 2XV4S 5FD5A 4YFXF 3HHGA 4Q4ZF 1IXSB 3SHFA 2JPBA 4I2OA 4ETSA 3T1BA 3HRSA 3C18A 1LDJA 4Q47A 2A69F 5D4SA 1LJ9A 2NRAC 4A5NA 6PAXA 3BP8A 1FYLA 2V9VA 3CTAA 2QBYB 2E7XA 1ZARA 3SXYA 5HDKA 3I4PA 4ZYEA 3VFZA 1RNLA 1G6NA 5HVQC 4BXUA 1USTA 2P5KA 3JAMZ 2IT0A 3L7WA 4RGUA 1FOKA 4GO1A 3KP5A 3R60A 1QQIA 1J2XA 2L4AA 3HRUA 5FFXA 4M9XA 1EH7A 1CGPA 3TGNA 2P6SA 2EK5A 1P6RA 1J0RA 1FSHA 2GA2A 2E7WA 4EJWA 2DLLA 1IF1A 2OZ6A 1I27A 1YS6A 4IJAA 3WE2A 3GVAA 1ZRFA 2PG4A 4MGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXC A;  1WQ2 A;  1MJA A;  3F8C A;  4XRF A;  1PDN C;  3EDP A;  3IL2 A;  1JXS A;  1W7P A;  1IXR C;  1HW1 A;  2HS5 A;  3EUH A;  2Z99 A;  3LFK A;  4I01 A;  2PJP A;  4L9V A;  1ZGJ A;  2ZNZ A;  2FU4 A;  1KGS A;  4G9Y A;  1GXP A;  2BV6 A;  2XAG A;  4K2E A;  1QNT A;  1F1Z A;  1DDN A;  3OOP A;  4ZH4 F;  3IRR A;  2O0Y A;  2H09 A;  5AON A;  1H9G A;  3ZPL A;  1UCR A;  2L3D A;  3F72 A;  3WGG A;  1CF7 B;  2RGV A;  4GGG A;  4HX4 A;  4JBA A;  1ZAO A;  3JSO A;  1KU2 A;  2FXA A;  4BHB A;  1IW7 F;  1WRJ A;  5ILV A;  2HGC A;  4HF2 A;  1IN7 A;  3NEU A;  2Z9O A;  4UVB A;  3IKV A;  4DNC A;  2EFW A;  1T0F A;  1AOY A;  5CVJ A;  3GFL A;  2ESH A;  1ZYR F;  5AIP A;  1ZRD A;  1XGS A;  1MKM A;  3WU1 B;  2V1D A;  3TO7 A;  5JFR A;  4U0W A;  2G7H A;  2GAU A;  1RI7 A;  4A2U A;  3GZ6 A;  4M71 A;  2HTS A;  4BQA A;  5DUK A;  5L3C A;  1P4X A;  5ED4 A;  5LGT A;  4EM2 A;  3HUG A;  3I71 A;  1T38 A;  2ZO4 A;  2L02 A;  1QZY A;  5FD6 A;  4M6Y A;  1G3Y A;  5A2Q K;  2W85 A;  1UHM A;  4EJT A;  4OMY A;  2ZCW A;  1Z91 A;  2D1V A;  4YFK F;  2VE9 A;  1G3T A;  1OKR A;  1Z9C A;  2HKO A;  4IRH A;  2GXG A;  3WTX C;  1R7J A;  1ZLK A;  1R5G A;  4LG0 A;  4HDV A;  4MEY F;  3VEP A;  5TRD A;  2HQR A;  5ICG A;  2AS5 F;  5DYM A;  1AWC A;  1TQP A;  1O3Q A;  4AIH A;  1PP7 U;  1KQ0 A;  2H94 A;  2XAQ A;  2H6C A;  4ENM A;  2M45 A;  3ZMZ A;  2ETH A;  3LQR A;  2CSO A;  1K6O A;  1FX7 A;  2XKP A;  4HDU A;  2PBI A;  3GXO A;  5DEQ A;  2QQA A;  1HSJ A;  2KIF A;  3DV8 A;  1MJ9 A;  2Z3Y A;  1J75 A;  2EB7 A;  1T2K A;  3MZH A;  2QWW A;  3WTT C;  1YS7 A;  1B1B A;  1F9N A;  3ECH A;  1YYV A;  3TDZ C;  1OR7 A;  1SMY F;  1TNS A;  3DQV C;  3GF2 A;  2XRO A;  2FF4 A;  2F5C A;  4RB0 A;  1YLF A;  4BYY A;  3O6B B;  2VT2 A;  3DF8 A;  4P96 A;  5HDN A;  3BWG A;  1FBQ A;  2IJL A;  2RDP A;  4L5I A;  4MQ9 F;  5DV5 A;  2HFH A;  2VN2 A;  1XGN A;  4OIN F;  4HQE A;  2DPU A;  2MBF A;  1D5V A;  3ZMS A;  3LQQ A;  2MLG A;  1FWZ A;  4OOI A;  4HA8 A;  1WSU A;  4TV7 A;  3DEU A;  3U9G A;  3SFZ A;  2O03 A;  2W25 A;  3WTU C;  3J80 K;  1R1T A;  5BPD A;  5CVV A;  4P9U A;  1L3L A;  4M6X A;  2AXL A;  4RS8 A;  4BH9 A;  3FXQ A;  2YX7 A;  4EJU A;  1KYZ A;  1XDU A;  3K69 A;  2YU3 A;  2WWY A;  3IWZ A;  5H6R A;  4ASN A;  4LK1 F;  2Y0M A;  1G4D A;  4LLL A;  2LKP A;  4YII A;  3K1M A;  3L00 A;  1XN7 A;  4KMF A;  3MQ0 A;  3ZMU A;  2EJR A;  3E6M A;  5K1Y A;  5LHG A;  1L0O C;  4GCV A;  1IZ1 A;  2ISY A;  4IF4 A;  2OBP A;  3J81 Z;  1KU3 A;  4R79 A;  3GFJ A;  4QWQ A;  1D3Y A;  3BPX A;  1K78 A;  3ZN1 A;  2F5F A;  3IC7 A;  2L54 A;  2KIM A;  5DD4 A;  1FP2 A;  2QZ8 A;  4XBF A;  2J5O A;  2YSR A;  4N9H A;  3WTZ A;  3ABT A;  5E18 F;  3DPT A;  2X0L A;  4IRI A;  2M1B A;  3V7S A;  1A04 A;  2CFX A;  3M7G A;  1GHC A;  3ZMT A;  2MA3 A;  3E5U A;  4GXO A;  2D45 A;  3G73 A;  4L0Z B;  2GA1 A;  4HZF A;  3HSR A;  4UXN A;  1QBJ A;  3LA2 A;  1Z6R A;  5J8C A;  1B9N A;  3VOD A;  1EH8 A;  3C1D A;  2RV8 A;  5CLS A;  2OQR A;  2BGC A;  4NB5 A;  5LHH A;  5BPI A;  1U3E M;  2QUF A;  3U1D A;  3PFI A;  4RB2 C;  3QRF F;  1IN4 A;  2VE8 A;  5CVR A;  4Z2Y A;  1ONV A;  2PQ8 A;  3E6B A;  3L09 A;  5KK1 A;  2RKH A;  3I59 A;  3TO9 A;  1BBY A;  1R1V A;  3DXJ F;  5HOO A;  1J9I A;  3IKT A;  4XLN F;  2A5Y B;  2K4B A;  3V8L A;  2K86 A;  1YQA A;  1FT9 A;  1JGS A;  3IRQ A;  1H9T A;  1T39 A;  2E1C A;  3IWF A;  2A61 A;  4XSX F;  2JT1 A;  3WTY C;  2ACJ A;  2FBI A;  2CW0 F;  4F7Z A;  3HHH A;  3M1E A;  2VBZ A;  2XHK A;  2XAH A;  4ZZD A;  2LDU A;  1UHW A;  3S2W A;  2G7U A;  3HOS A;  2QYO A;  2DPD A;  5E17 F;  1PUE E;  1FBU A;  3L9F A;  4S05 A;  4UV8 A;  1USS A;  1Y0U A;  3FX3 A;  4U7B A;  5HLI A;  2HZT A;  4HYE A;  3FF5 A;  5FO5 A;  1D8K A;  5LGN A;  1KA8 A;  2KKO A;  3ZMV A;  2FRH A;  1BN5 A;  4Y17 A;  5F64 A;  3LWF A;  2QVO A;  5K5O A;  4ESF A;  2QLZ A;  4KIC A;  5ICC A;  1SMT A;  3F8B A;  3GLX A;  4UVC A;  2XAF A;  2NNY A;  1B59 A;  2XAS A;  4DQ2 A;  3KEQ A;  3ZP5 A;  1O3S A;  4RAY A;  4AD9 A;  1I6X A;  5A2Q Z;  2R7D A;  1EH6 A;  2IVM A;  3WTV C;  4IHT A;  3IHU A;  4LK0 F;  4M9S A;  2CO5 A;  2A6E F;  1HW2 A;  1B9M A;  3RPU A;  3C7J A;  4I02 A;  1STZ A;  1UFM A;  2P4W A;  3RKY A;  1J59 A;  1E2X A;  2CGP A;  3JSP A;  3F22 A;  1ZG1 A;  1I5Z A;  2DK8 A;  5CYV A;  1IXC A;  4M74 A;  4U0V A;  4Y13 A;  3BJO A;  2ZME B;  3WGH A;  1ZG5 A;  1U2W A;  4GYG A;  4IPA A;  5JHU A;  2GXB A;  2MD5 A;  3F21 A;  3H3Z A;  3FMQ A;  1P2F A;  3PQJ A;  5ERI A;  2P8T A;  5D8K B;  4FT8 A;  4BNC A;  4KUM A;  4GYI A;  4HLX A;  1XCB A;  3P9K A;  1E17 A;  5KVR A;  1BIA A;  3KFW X;  4G94 A;  3QP5 A;  4EMS A;  4U0Y A;  2IP2 A;  1O3T A;  3GZ5 A;  3V8J A;  4LGW A;  3Q9S A;  1IUY A;  4WCG A;  2BE5 F;  5LHI A;  2ZBK A;  1K7A A;  2HYF A;  5DD8 A;  5D5U B;  3F8N A;  4A5M A;  2QQ9 A;  5CJ9 A;  2IA1 A;  3ULQ B;  5L3F A;  3HTU A;  5DCM B;  3HYI A;  4I09 A;  2RN7 A;  4FX0 A;  2LF8 A;  4UVA A;  2OU2 A;  4MQV A;  1W5S A;  1XMK A;  2V1X A;  1U6G A;  1S29 A;  5IT9 Z;  2A6H F;  4IXA A;  1BC8 C;  2XRN A;  4KN4 X;  4HX7 A;  1MDM A;  2RQP A;  4Y15 A;  3QOP A;  2YR2 A;  4LFU A;  2IA0 A;  2ZKZ A;  3GFM A;  1ZLJ A;  1XMA A;  1QGP A;  4PCQ A;  4CZZ A;  4HLY A;  5TJJ A;  2E1N A;  1DUX C;  5BOX A;  1XSX A;  1U5T C;  4FX4 A;  4EJO A;  2PLY A;  1KU7 A;  2PI0 A;  4I7H A;  2DAO A;  3QP6 A;  3QAH A;  5E1Z B;  3Q5F A;  3LAJ A;  1P4W A;  1WI9 A;  3F8F A;  1LDK B;  4LD5 A;  2LSO A;  3K0L A;  2FBH A;  3V4G A;  1F4K A;  2UZK A;  1IN5 A;  1OYY A;  3FMR A;  1FC3 A;  5JI6 A;  4EM1 A;  3M8F A;  4E70 A;  5D6E A;  5F6F A;  2VT3 A;  1P4A A;  1R1U A;  2QBY A;  2XKO A;  3BRO A;  2MC3 A;  4HX8 A;  3B02 A;  4LMY A;  5ILS A;  1LVA A;  5JR3 A;  4ZYG A;  1DP7 P;  4CXF A;  1GVJ A;  3EYI A;  2PFB A;  1HXD A;  1ZRC A;  4LB5 A;  2JPC A;  1K79 A;  5IT3 A;  2ZJ2 A;  1S3J A;  4Q48 A;  4NQW A;  1O3R A;  3FXR A;  3GUD A;  3CUQ C;  2D1H A;  3GX4 X;  2OD5 A;  3NQO A;  3W6J B;  5D5X B;  2M87 A;  4AWX B;  5F1R A;  1HBX G;  3RKX A;  1LEB A;  1HW5 A;  1U5T B;  3KP4 A;  1JE8 A;  3COA C;  2HOE A;  3FM5 A;  1HKS A;  1MZB A;  4R1H A;  5HS9 A;  1FYM A;  3O2P E;  1XGO A;  4FHT A;  2QM3 A;  3WU0 A;  1ON1 A;  4A0Z A;  2GZW A;  3ZMD A;  3KEO A;  1QO0 D;  2JSC A;  4R8H A;  1FZP B;  2ADU A;  3OV8 A;  3TO6 A;  1ZH5 A;  1IRF A;  5K5Q A;  3ZQ7 A;  2B0L A;  1T6S A;  3RI4 A;  4RGR A;  1HKQ A;  1ODD A;  5HS8 A;  4XLP F;  2BBY A;  4MNU A;  2HR3 A;  3FMS A;  4KT5 C;  2MH2 A;  3V7C A;  5E20 A;  3KP6 A;  2RNJ A;  4G8X A;  3JW4 A;  2V79 A;  4EQQ A;  3I0T A;  4KN7 X;  2VON A;  1DPU A;  3CUQ B;  1TBX A;  1SFE A;  1CF7 A;  2K4J A;  5E8G A;  4A6E A;  1LQ1 A;  4G7H F;  4KIF A;  4IHS A;  2M30 A;  5DDG A;  4HBL A;  4Q5S F;  1B4A A;  1W4M A;  3HRM A;  2DT5 A;  3GYH X;  1G3W A;  3J7A O;  2YPR A;  4L5J A;  2M8E A;  1J7K A;  5FB2 A;  3HSF A;  3QU6 A;  4WXD A;  1Q1H A;  2COM A;  4ENN A;  2QEN A;  1C0W A;  2LF7 A;  1YW9 A;  4KIG A;  3T5X A;  2KIU A;  5L3D A;  2QQB A;  3T8R A;  5HS7 A;  3U2R A;  4OIO F;  3CLO A;  3KLN A;  2ZXJ A;  3KLO A;  4RB1 A;  3DKW A;  1R00 A;  2A68 F;  1TW2 A;  1ZN2 A;  3ECO A;  1HST A;  1QZZ A;  1W5T A;  2VBW A;  4HF0 A;  4KYW A;  4LLG F;  1BI0 A;  2PEX A;  1LDD A;  4ESJ A;  2DBB A;  1OYW A;  4YFN F;  3TOA A;  4ZYD A;  3F3X A;  3GEZ A;  2XVC A;  4KMU X;  3WGI A;  2DW4 A;  5LRR A;  1XB4 A;  2HKX A;  2CYY A;  1LEA A;  1S6L A;  1OYI A;  2D2W A;  2PMH A;  4UNO A;  4JQF A;  2CWE A;  4ZZL A;  4AIK A;  4OMZ A;  4XSZ F;  4BHP A;  3CO7 C;  3E97 A;  5LLQ A;  2WV0 A;  2DQL A;  2WC2 A;  5FGM A;  5D4R A;  1Z05 A;  2UWM A;  1W7P B;  2P5V A;  2VBY A;  2VC0 A;  4KIB A;  5EEH A;  2M5W A;  3I64 A;  2FBK A;  3LA7 A;  4OIQ F;  3K1N A;  5FLX K;  1W7P D;  3HOT A;  1R36 A;  1R58 A;  4EGY A;  3BDD A;  1O7F A;  4MHG A;  2F5E A;  4WX9 A;  4P55 A;  1Z1D A;  2OA4 A;  2VOO A;  1TW3 A;  1IRG A;  2BEO A;  3EET A;  1ZRE A;  2KRF A;  5E1X A;  4H0E A;  3BJA A;  3MEX A;  4O5V A;  5JVT A;  4OU0 A;  5H20 A;  1GXQ A;  2IPQ X;  2OZU A;  3CUO A;  2TDX A;  3MFK A;  4B09 A;  3FZV A;  2HWV A;  1ULY A;  3GW2 A;  3WOD F;  3TDU C;  4HV6 A;  3R6S A;  3V7R A;  2FNP A;  2ZNY A;  3D0S A;  1G3S A;  1KQ9 A;  4EVI A;  5LEJ A;  2DK5 A;  3E6D A;  3K9T A;  2K27 A;  3KZZ A;  3JTH A;  1BIB A;  3E6C C;  2X4H A;  5FFZ A;  1TTY A;  4EV0 A;  3NRV A;  5LEK A;  4YIF A;  1SFX A;  3GO5 A;  1J5Y A;  2Q8K A;  3T8T A;  3T0Y A;  2VC1 A;  2J5P A;  4NHJ A;  5ICF A;  5K5R A;  1SD7 A;  3W6K B;  4ZYH A;  3QPH A;  3H3U A;  4IRG A;  2YX4 A;  1V3F A;  2V6C A;  1RZ4 A;  5LBQ A;  1HQC A;  5LRS A;  3Q9V A;  3RJP A;  1SD4 A;  3RTR A;  2ESN A;  4WF2 A;  5E8I A;  1SAX A;  2HDC A;  1S7A A;  5D5V B;  4PGH A;  4CYD A;  1SD5 A;  4G6D A;  2MLK A;  2NNN A;  5ICE A;  5D5W B;  3J81 K;  4LG0 B;  4L9T A;  3CJN A;  5HDG A;  2DFI A;  4KNY A;  2Z5U A;  1S8N A;  1YW7 A;  4MTD A;  3JTG A;  3FM3 A;  5AIQ A;  4HQM A;  2IA2 A;  4QLC U;  1R23 A;  5HLH A;  2UXN A;  3I54 A;  2P7C B;  3CO6 C;  3LAP A;  2R7F A;  3O3K A;  2P7V B;  1YG2 A;  2JTV A;  3L2C A;  2C6Y A;  2K02 A;  3I5U A;  2Q2E A;  4BHC A;  3KE2 A;  4I0A A;  2EFQ A;  4OIR F;  2EV5 A;  4CGZ A;  4HF1 A;  4N0B A;  3E5X A;  3E5Q A;  2GWR A;  3P9C A;  1OMI A;  2RC4 A;  1RUN A;  3ABU A;  3RYP A;  2W24 A;  1P92 A;  4P9F A;  4L9J A;  2UXX A;  3KP3 A;  5D6F A;  2FNA A;  2FQ3 A;  1SD6 A;  4A0Y A;  1DPR A;  3SZP A;  3KP2 A;  4MEX F;  3RPQ A;  5L3E A;  1TLH B;  2EFN A;  2LNB A;  2VOP A;  2FOK A;  4HOB A;  1BJA A;  2EFP A;  3D5L A;  2OQG A;  4AIJ A;  1D8J A;  2GIV A;  2DTR A;  1ZG3 A;  3P9I A;  1EV7 A;  3CDH A;  3F6V A;  3RIR A;  3LST A;  5L3G A;  3FWE A;  2IW5 A;  2FML A;  5BQT A;  2PMU A;  4LB6 B;  3HRT A;  3M9A A;  3ISP A;  1I1S A;  3BOQ A;  4WK8 F;  3J80 Z;  4L9N A;  2ELH A;  4AVP A;  3F6O A;  3I58 A;  5H6Q A;  2FE3 A;  2KJC A;  2XUB A;  4RGS A;  4CIC A;  1XDS A;  1RIO H;  4A0X A;  5E1W A;  2PN6 A;  1FY7 A;  3G3Z A;  3MZY A;  1TQI A;  3HTS B;  1FNN A;  4OIP F;  3DPL C;  4M72 A;  4U88 A;  4RAZ A;  2NAZ A;  2FA5 A;  2W84 A;  1KQ8 A;  3M8E A;  2XIG A;  3ML6 A;  3WE3 A;  3K1P A;  3R0J A;  3FHZ A;  2FMY A;  4ON0 A;  5D8L B;  1ZGA A;  4UUV A;  3PQK A;  1K78 B;  4CO8 A;  2NYX A;  2DU9 A;  2DQR A;  3WTS C;  3QU3 A;  4I0B A;  4A12 A;  2ZFW A;  3GWZ A;  4IVN A;  3SZT A;  1FYK A;  3MAJ A;  1IN6 A;  3JAM K;  1FLI A;  5L3B A;  1XSD A;  2FEZ A;  2EWN A;  4ESB A;  3V8K A;  3F23 A;  2W57 A;  2CQK A;  3RYR A;  5BMZ A;  1BC7 C;  2O8X A;  4PGG A;  1IN8 A;  1FP1 D;  3F8M A;  2ZME A;  2F5D A;  2KJB A;  4O3M A;  4ENK A;  4EM0 B;  4G7O F;  1FBS A;  3TQN A;  2HQN A;  5J8F A;  3EYY A;  4PZJ A;  1BOA A;  3REO A;  2L4M A;  4PDK A;  2XGX A;  1RUO A;  2FSW A;  1KYW A;  1MD0 A;  4UHT A;  4WXH A;  1R5H A;  3ZN0 A;  5DUI A;  3N97 A;  5FLX Z;  1LNW A;  1KU9 A;  3RKW A;  2A07 F;  5LGU A;  2Z33 A;  2F2E A;  2DO7 A;  3TKY A;  3I59 B;  1HKT A;  1MGT A;  1QPM A;  2HEO A;  5DCF A;  3DFG A;  2NS0 A;  1OPC A;  1H0M A;  1NHA A;  1T98 A;  5DCM A;  2K7L A;  3SQN A;  2GQQ A;  1SFU A;  2EA2 A;  3TOB A;  4L18 B;  3FXU A;  2O61 A;  4HV5 A;  2OAZ A;  2H27 A;  5IT9 K;  4I98 B;  1O7L A;  4M9Z A;  3QPT A;  3RDI A;  4S04 A;  1I1G A;  1V4R A;  2A3S A;  2STT A;  4EGZ A;  4LJZ F;  2DI3 A;  3VB2 A;  1JHF A;  4B8X A;  2R3S A;  1BI3 A;  1F5T A;  4CHU A;  2RVC A;  3WTW C;  1S7O A;  2EFO A;  4G7Z F;  3C3W A;  3EQL F;  2V1U A;  2JZY A;  3R0A A;  2CG4 A;  1IAW A;  1ON2 A;  3MWM A;  3MCZ A;  2BYV E;  1TNT A;  1Z6T A;  1YW8 A;  4KDP A;  1FPQ A;  4KFC A;  3HSE A;  1VTN C;  3ELK A;  1X3U A;  2O3F A;  4L0Y B;  1Z7U A;  1TQM A;  2L01 A;  3KET A;  1JHH A;  3KP7 A;  4YG2 F;  4P5O A;  2WTE A;  4N9I A;  2EV0 A;  3R61 A;  1WWX A;  1XSV A;  4MTE A;  4LLN A;  2P5L C;  2JRT A;  3H92 A;  2IRF G;  4M73 A;  4EJV A;  3BY6 A;  5EEG A;  4RGX A;  3E3V A;  1BM9 A;  4UV9 A;  1YIO A;  1MJB A;  4BAY A;  4ENJ A;  3BPV A;  3KZY A;  1BI2 A;  2EV6 A;  3HIF A;  1ZHF A;  1YO5 C;  2P6T A;  3R4K A;  1U5T A;  1YTY A;  4HAM A;  1XCV A;  1YFH A;  1O57 A;  1PP8 F;  1R22 A;  3DP7 A;  3AAF A;  2ISZ A;  2STW A;  3GFI A;  1B6A A;  2XAJ A;  5ILU A;  3K2Z A;  2HYG D;  3N4M A;  4D0P A;  2G9W A;  5HLG A;  3P7N A;  2Y75 A;  1FSE A;  2HTJ A;  1LB2 A;  3KCC A;  1UB9 A;  2MH9 A;  2O6G E;  1MDM B;  3WG9 A;  2Y48 A;  1U8R A;  4U7D A;  2H6B A;  1BI1 A;  2VBX A;  3BZ6 A;  5CVI A;  2VXZ A;  2Q0O A;  4CDG A;  4HW0 A;  1WKM A;  1XD7 A;  5CVU A;  3I53 A;  1REP C;  2EA4 A;  3CUQ A;  3VOE A;  3ERE D;  4G6Q A;  3BJ6 A;  4JK1 X;  1U78 A;  4A6D A;  4O6J A;  3ROU A;  1XGM A;  3LA3 A;  4WWC A;  5J6X A;  3B73 A;  5BS6 A;  4RB3 C;  4KA4 A;  2VOD A;  2XV4 S;  5FD5 A;  4YFX F;  3HHG A;  4Q4Z F;  1IXS B;  3SHF A;  2JPB A;  4I2O A;  4ETS A;  3T1B A;  3HRS A;  3C18 A;  1LDJ A;  4Q47 A;  2A69 F;  5D4S A;  1LJ9 A;  2NRA C;  4A5N A;  6PAX A;  3BP8 A;  1FYL A;  2V9V A;  3CTA A;  2QBY B;  2E7X A;  1ZAR A;  3SXY A;  5HDK A;  3I4P A;  4ZYE A;  3VFZ A;  1RNL A;  1G6N A;  5HVQ C;  4BXU A;  1UST A;  2P5K A;  3JAM Z;  2IT0 A;  3L7W A;  4RGU A;  1FOK A;  4GO1 A;  3KP5 A;  3R60 A;  1QQI A;  1J2X A;  2L4A A;  3HRU A;  5FFX A;  4M9X A;  1EH7 A;  1CGP A;  3TGN A;  2P6S A;  2EK5 A;  1P6R A;  1J0R A;  1FSH A;  2GA2 A;  2E7W A;  4EJW A;  2DLL A;  1IF1 A;  2OZ6 A;  1I27 A;  1YS6 A;  4IJA A;  3WE2 A;  3GVA A;  1ZRF A;  2PG4 A;  4MGR A; 
#chains in the Genus database with same CATH topology
 4BXX J;  4JX6 A;  4WXC A;  1WQ2 A;  2XGD A;  1VQ7 I;  2MGQ A;  1MJA A;  2X1D A;  3F8C A;  4HNV A;  2R5Y B;  2CQ7 A;  4XRF A;  3H3V K;  1PDN C;  4JOM A;  3EDP A;  4HST A;  3IL2 A;  1JXS A;  1W7P A;  1IXR C;  3D5S C;  4N4N B;  4RDU A;  1HW1 A;  2HS5 A;  4BJT A;  3EUH A;  3HOU J;  2Z99 A;  3LFK A;  3ZQG A;  1MIJ A;  2DTZ A;  4I01 A;  2PJP A;  2CQX A;  4L9V A;  1ZGJ A;  2LY1 A;  2ZNZ A;  2FU4 A;  1KGS A;  4M6V A;  4G9Y A;  3CMA I;  4J00 A;  1GXP A;  2JUC A;  2BV6 A;  3K10 A;  1MBH A;  2XAG A;  1ZGW A;  4ZC3 A;  4BY1 J;  4ABZ A;  4K2E A;  1QNT A;  1F1Z A;  2OCC H;  1NH3 A;  1IC8 A;  1DDN A;  2CV1 A;  3OOP A;  1FTT A;  2ECB A;  4ZH4 F;  3IRR A;  2O0Y A;  2H09 A;  5AON A;  1H9G A;  1Z21 A;  3ZPL A;  3EPZ A;  1UCR A;  3GCM A;  2R7O A;  2L3D A;  3F72 A;  4NDL A;  3WGG A;  2ECC A;  4CA0 A;  3HBL A;  1CF7 B;  5DTD A;  1JKP C;  1EA3 A;  2RGV A;  4GGG A;  3LSK A;  4HX4 A;  4JBA A;  1ZAO A;  3JSO A;  1KU2 A;  1WZ2 A;  2FXA A;  4BHB A;  3BZK A;  4PJM A;  2XC7 A;  1IW7 F;  1WRJ A;  2K3F A;  5ILV A;  2HGC A;  4PSX A;  4HF2 A;  2EBI A;  2HYJ A;  1IN7 A;  2IAI A;  4E4H A;  3OYM A;  3ABL H;  2Y2Z A;  3NEU A;  3IKV A;  4UVB A;  1D1A A;  2Z9O A;  4DNC A;  2DMN A;  2L7F P;  2R7S A;  4ZDO A;  2EFW A;  1T0F A;  1AOY A;  3OR1 C;  5CVJ A;  3GFL A;  1APL C;  2ESH A;  2HDD A;  1ZYR F;  2QQ8 A;  3SZG A;  5AIP A;  1ZRD A;  1XGS A;  1MKM A;  3WU1 B;  2V1D A;  3TO7 A;  3KYL A;  3P5J A;  3LSM A;  3ASN H;  1EJ9 A;  5JFR A;  3FIW A;  4XMY A;  4U0W A;  2IS2 A;  2G7H A;  2GAU A;  1RI7 A;  4A2U A;  1MMA A;  3ZGK A;  3GZ6 A;  4M71 A;  1BA5 A;  1Y39 A;  2HTS A;  4BQA A;  5DUK A;  5HNH A;  4FTH A;  2DT7 B;  2DDA A;  5L3C A;  4IX7 A;  5GPC A;  1P4X A;  4CZC A;  3I4N J;  4BQQ A;  5ED4 A;  2XF5 A;  2HOA A;  3G71 I;  4D9J A;  3CES A;  5LGT A;  4IOC F;  1YRN B;  2ID6 A;  5F08 A;  3S32 A;  5C4X J;  1HA8 A;  1N75 A;  4EM2 A;  3HUG A;  5HOD A;  1XC5 A;  1QHH D;  3I71 A;  1T38 A;  2ZO4 A;  2W00 A;  2L02 A;  1QZY A;  1MH4 A;  5FD6 A;  4M6Y A;  2KRC A;  5E3M A;  1G3Y A;  5A2Q K;  2W85 A;  1UHM A;  2L7K A;  4EJT A;  3OYD A;  4OMY A;  2ZCW A;  2OV7 A;  1JUP A;  1Z91 A;  2D1V A;  4YFK F;  2VE9 A;  1G3T A;  2YU9 J;  1OKR A;  1WJA A;  1Z9C A;  3KX2 A;  2HKO A;  4IRH A;  1P7J A;  2GXG A;  3WTX C;  3QPL A;  4M3E A;  1R7J A;  1ZLK A;  5LFA A;  1R5G A;  4LG0 A;  4HDV A;  4BQO A;  1XG1 A;  4PJ0 C;  4XM3 A;  4MEY F;  1T56 A;  3VEP A;  5TRD A;  2HQR A;  1BR4 A;  1I3A A;  2O7O A;  1D0X A;  2BXY A;  5ICG A;  2AS5 F;  5DYM A;  3CF5 F;  2LY2 A;  3GZN B;  1YI2 I;  1AWC A;  4IL6 C;  1TQP A;  1O3Q A;  4AIH A;  3LFU A;  1PP7 U;  2LG4 A;  3A01 A;  4AM3 A;  2R7T A;  1KQ0 A;  2H94 A;  1AKH B;  2XAQ A;  2NVY J;  3CDL A;  2H6C A;  4ENM A;  2AQE A;  2M45 A;  3ZMZ A;  1WJF A;  2ETH A;  2AXT C;  2E1O A;  2EIL H;  3LQR A;  2CSO A;  1K6O A;  1FX7 A;  4PUS A;  3ZXS A;  2XKP A;  4HDU A;  1V54 H;  2LC2 A;  2IGM A;  2XB5 A;  2MSY A;  2PBI A;  4XLA A;  2PJR B;  4F3Q A;  3BG3 A;  3GXO A;  5DEQ A;  2QQA A;  4J01 A;  1HSJ A;  2KIF A;  1FOY A;  1WJC A;  2R7X A;  3DV8 A;  1MJ9 A;  1WI3 A;  4D5C A;  2Z3Y A;  1J75 A;  1HLV A;  4E7K A;  2LTP A;  2V1N A;  1MNE A;  5J1U A;  1VQM I;  2EB7 A;  3CCQ I;  1IDY A;  2XPW A;  1LFP A;  2K3P A;  1T2K A;  3MZH A;  4B1R A;  2QWW A;  3WTT C;  3BTL A;  1YS7 A;  1B1B A;  1F9N A;  2M7B A;  2M7A A;  2L5Q A;  3ECH A;  1YYV A;  2A05 A;  3TDZ C;  3C2B A;  4A3J J;  1OR7 A;  4UUS A;  1SMY F;  3CLQ A;  2VJI A;  1TNS A;  3DQV C;  3GF2 A;  2XRO A;  2DA7 A;  1X2M A;  4RA2 A;  2GM4 A;  2FF4 A;  2F5C A;  1JTX A;  1V5F A;  1YLF A;  4RB0 A;  4BYY A;  3O6B B;  2JWT A;  2UUZ A;  2HXI A;  2VT2 A;  3HKZ A;  3PJR A;  3DF8 A;  3K4M A;  4C30 A;  3MKZ A;  4P96 A;  5HDN A;  2NOG A;  4A3C J;  4E7H A;  3KIO A;  3FXJ A;  2ZFU A;  1VND A;  2L2O A;  3BWG A;  3TW6 A;  1FBQ A;  3OR2 C;  2IJL A;  2RDP A;  4L5I A;  4MQ9 F;  1CQT A;  5DV5 A;  2HFH A;  4X1E A;  4W97 A;  1ZTR A;  2VN2 A;  1XGN A;  4OIN F;  4HQE A;  2JVH A;  4OWR B;  2MBF A;  2DPU A;  1D5V A;  3ZMS A;  3BTC A;  1OCC H;  3LQQ A;  3L2Q A;  2F5V A;  5E3N A;  2VAS A;  5CQE A;  4UY8 I;  1K4T A;  2MLG A;  3RQI A;  1FWZ A;  4OOI A;  2H8R A;  3EUK L;  4HA8 A;  4GDF A;  1WSU A;  3FXO A;  4TV7 A;  4FE7 A;  2WAE A;  3DEU A;  3VYS B;  3U9G A;  2GLO A;  1FOW A;  3SFZ A;  2Y69 H;  2O03 A;  1X4O A;  2W25 A;  3WTU C;  3CP2 A;  4IOA F;  3J80 K;  2HZD A;  1R1T A;  3H1C A;  5BPD A;  1Y0N A;  5CVV A;  2JSP A;  4P9U A;  1L3L A;  2X6Y A;  2KT0 A;  2AXL A;  3FKI J;  4M6X A;  1R4M B;  1A6Q A;  1MBE A;  4II3 A;  4RS8 A;  4BH9 A;  4UB8 C;  2MFZ A;  3FXQ A;  1B72 A;  2VKH A;  4RBO A;  2Q1Z B;  2YX7 A;  4EJU A;  1KYZ A;  3BG5 A;  1XDU A;  3K69 A;  2YU3 A;  2WWY A;  3IWZ A;  5H6R A;  1U9O A;  4ASN A;  2NVX J;  4LK1 F;  3TMO A;  3JRE A;  1ETW A;  4BKX A;  5B66 C;  2Y0M A;  1G4D A;  1FEX A;  4LLL A;  2VQL A;  4C2T A;  1R5I D;  2CJJ A;  2LKP A;  4YII A;  3K1M A;  4LG3 A;  4XKV A;  3UNG C;  3L00 A;  1XN7 A;  4KMF A;  3MQ0 A;  3ZMU A;  5IP7 J;  4LIT A;  2KRH A;  2EJR A;  1DQU A;  4PFO A;  3E6M A;  5K1Y A;  5LHG A;  1L0O C;  4GCV A;  1IZ1 A;  2ISY A;  4IF4 A;  1MSE C;  3LOC A;  2OBP A;  3BR1 A;  3J81 Z;  1KU3 A;  3OYK A;  5IYB J;  3GFJ A;  4QWQ A;  4R79 A;  3O8G A;  1A36 A;  1D3Y A;  3BPX A;  3J7Z I;  1K78 A;  3ZN1 A;  2F5F A;  3C2H A;  1AU7 A;  5FJ8 J;  3IC7 A;  2L54 A;  3CJT B;  3H9G A;  2KIM A;  2XRL A;  5DD4 A;  1FP2 A;  3K2A A;  2QZ8 A;  2X6W A;  2IS1 A;  4XBF A;  4NUB A;  2J5O A;  2DYR H;  2YSR A;  1QZE A;  3I3L A;  4DBQ A;  4N9H A;  1VQP I;  1RC9 A;  2MW8 A;  3WTZ A;  1YX5 A;  3DTK A;  1MMD A;  2NS8 A;  3OS0 A;  3ABT A;  5E18 F;  4RMN A;  3DPT A;  2X0L A;  5EZH A;  1MMS A;  4F91 B;  2Q2E B;  4IRI A;  3PSF A;  1VQ5 I;  2M1B A;  3V7S A;  2QA4 I;  1A04 A;  2CFX A;  2E71 A;  3ZQQ A;  1E3H A;  2HDW A;  1JT0 A;  3M7G A;  4HSR A;  3W2V A;  1GHC A;  3ZMT A;  2MA3 A;  4NBQ A;  3E5U A;  4GXO A;  2LMD A;  2D45 A;  2Y0S A;  2D5V A;  3G73 A;  2CW8 A;  2E19 A;  4L0Z B;  2GA1 A;  4HZF A;  4BUP A;  2Y0S N;  3DU5 A;  3HSR A;  4UXN A;  3RQ4 A;  1QBJ A;  5J1Y A;  3BR0 A;  3HZJ A;  1Z6R A;  3LA2 A;  4NNJ A;  5J8C A;  1B9N A;  3S3O A;  3VOD A;  3S1N J;  1EH8 A;  3C1D A;  2RV8 A;  5CLS A;  2WB1 N;  2OQR A;  2VJ4 A;  2BGC A;  4NB5 A;  2X9D A;  4C9Y A;  4XKB A;  4BE2 A;  2DFH A;  3CQZ J;  5LHH A;  5BPI A;  1WJB A;  1U3E M;  2QUF A;  1VQL I;  2QF7 A;  3U1D A;  3BCB A;  3PFI A;  4RB2 C;  1X4P A;  3QRF F;  4XIC A;  3DU6 A;  3S8P A;  1IN4 A;  2VE8 A;  3CME I;  2VKE A;  1I6H J;  5CVR A;  4Z2Y A;  5GAE J;  1PJR A;  2LR8 A;  3BG7 A;  4BL0 B;  2M0M A;  4B48 A;  5K7F A;  1ZK8 A;  1ONV A;  2PQ8 A;  3E6B A;  3L09 A;  5KK1 A;  5M3M J;  3TBI A;  2RKH A;  3I59 A;  3TO9 A;  3IUO A;  1BBY A;  2MYS A;  2R93 J;  3OYA A;  4FET A;  1R1V A;  3DXJ F;  5HOO A;  1J9I A;  2L7M P;  3A0B C;  4XLN F;  3IKT A;  1E3P A;  2A5Y B;  2K4B A;  1TT0 A;  2OUM A;  1ETX A;  2FUG 2;  2L7Z A;  3V8L A;  2K86 A;  1YQA A;  1FT9 A;  2XF6 A;  1JGS A;  3IRQ A;  3GME A;  2B9S A;  2EIM H;  1H9T A;  1T39 A;  4PSW A;  2E1C A;  3IWF A;  4QIW N;  2RNG A;  3DTI A;  2LBF B;  3GTJ J;  2A61 A;  2BY1 A;  2DOD A;  2JT1 A;  4XSX F;  3TP3 A;  3WTY C;  1IDZ A;  2ACJ A;  2FBI A;  2CW0 F;  4F7Z A;  3HHH A;  3M1E A;  5F1J A;  1ZR2 A;  1FTZ A;  3DKX A;  3DEW A;  2K5C A;  3W2A A;  2F4I A;  2VL8 A;  1FJL A;  2VBZ A;  2XSJ C;  2XHK A;  3S17 J;  2XAH A;  4ZZD A;  2LDU A;  1UHW A;  3D5R C;  3S2W A;  5FKO A;  1QPI A;  3B6C A;  4PJL A;  9ANT A;  3QWL A;  1S7E A;  3U21 A;  2G7U A;  3HOS A;  2QYO A;  2DPD A;  2M4G A;  5E17 F;  1B8I A;  1PUE E;  1FBU A;  3L9F A;  4S05 A;  4UV8 A;  1Y1W J;  1W5C C;  1USS A;  1Y0U A;  2EZK A;  3FX3 A;  2X48 A;  4U7B A;  3LSP A;  2A5W A;  5HLI A;  2HZT A;  5JLW A;  3DKY A;  3HJE A;  1N78 A;  3FK7 A;  4HYE A;  3IV5 A;  3FF5 A;  5FO5 A;  1D8K A;  2COB A;  1WCM J;  2QGU A;  5LGN A;  3OYC A;  1KA8 A;  2BVL A;  2KKO A;  4IHY A;  3ZMV A;  1E3O C;  2FRH A;  3BT9 A;  1BN5 A;  2EZL A;  4Y17 A;  5F64 A;  3LWF A;  2QVO A;  5K5O A;  4ESF A;  2QLZ A;  1V5E A;  4KIC A;  1FIP A;  4V2G A;  3H36 A;  3GTL J;  2DCE A;  5ICC A;  1SMT A;  3Q3S A;  5EGO B;  1D0Y A;  1FMV A;  1R9T J;  3IAS 2;  1WVR A;  3F8B A;  3GLX A;  3LMM A;  2XAF A;  4UVC A;  1B59 A;  3X2Q H;  2NNY A;  2XAS A;  1D1B A;  3KEQ A;  4DQ2 A;  3ZP5 A;  1TWG J;  1O3S A;  4RAY A;  3BG6 A;  4AD9 A;  2R5Z B;  1I6X A;  1G2H A;  5A2Q Z;  2R7D A;  1EH6 A;  2IVM A;  4DOZ A;  2EZI A;  4BGD A;  5IOY A;  3WTV C;  3S3M A;  2KHM A;  4IHT A;  3IHU A;  4LK0 F;  5C3E J;  3Q0W A;  3BR2 A;  3GTQ J;  4M9S A;  2CO5 A;  2A6E F;  1HW2 A;  1B9M A;  3RPU A;  3C7J A;  4I02 A;  4RAF A;  1STZ A;  1UFM A;  2JA7 J;  2P4W A;  3RKY A;  1J59 A;  1E2X A;  2CGP A;  3JSP A;  3F22 A;  1ZG1 A;  1I5Z A;  3H9J A;  2DK8 A;  2CUZ A;  5CYV A;  1IXC A;  4M74 A;  2IGO A;  4U0V A;  2R7W A;  4Y13 A;  5IP6 A;  3BJO A;  2ZME B;  3PFY A;  1V55 H;  1PUF A;  3CCU I;  1OQY A;  3ABM H;  2V9K A;  3WGH A;  2BY3 A;  4DZJ A;  1ZG5 A;  1U2W A;  2K40 A;  3CCM I;  4GYG A;  1DU0 A;  4IPA A;  3A01 B;  2VI6 A;  5JHU A;  2GXB A;  2MD5 A;  3FXL A;  2I10 A;  3F21 A;  5GPA A;  3H3Z A;  2H1K A;  2VKD A;  3FMQ A;  3KYC B;  2BW3 A;  1P2F A;  3PQJ A;  5ERI A;  2P8T A;  3OOU A;  5D8K B;  4FT8 A;  2QEX I;  4BNC A;  4KUM A;  2E5N A;  2G0E A;  4B4C A;  4GYI A;  1YJ9 I;  4HLX A;  2BVM A;  1XCB A;  2CUF A;  3P9K A;  1E17 A;  3BQY A;  5KVR A;  4BE1 A;  4BBR J;  1BIA A;  5HLT A;  2CV2 A;  3KFW X;  4G94 A;  3QP5 A;  4EMS A;  1JTY A;  3FKJ A;  4U0Y A;  4IO9 F;  2OTL I;  4MLO A;  2IP2 A;  1O3T A;  2R7V A;  3GZ5 A;  1Z3Y A;  3ERM A;  2VXD A;  2CUE A;  1WH7 A;  2JA2 A;  3V8J A;  4LGW A;  4CCK A;  3I4M J;  3Q9S A;  1IUY A;  4WCG A;  2BE5 F;  5LHI A;  2ZBK A;  1K7A A;  2HYF A;  3NAR A;  2XDV A;  5DD8 A;  3MD2 A;  4CCJ A;  5D5U B;  4UUS B;  3F8N A;  4XKW A;  2KL4 A;  2NVT J;  4A5M A;  2HU9 A;  1IV8 A;  2QQ9 A;  5CJ9 A;  2ELJ A;  2IA1 A;  3ULQ B;  5L3F A;  3HTU A;  2FQ4 A;  5DCM B;  3CMY A;  3I9V 2;  3HYI A;  4I09 A;  3GTM J;  2RN7 A;  4FX0 A;  2LF8 A;  2IS4 A;  4UVA A;  2I8D A;  2OU2 A;  4MQV A;  1UHS A;  2R0Q C;  1SVM A;  2LVS A;  3OSF A;  3KEY A;  1W5S A;  1XMK A;  3N05 A;  2V1X A;  1LE8 B;  5B3S H;  4DYR A;  1U6G A;  1S29 A;  5IT9 Z;  4V2F A;  1R49 A;  2KIS A;  2A6H F;  2EIK H;  4IXA A;  1BC8 C;  2HVS A;  2XRN A;  2OC6 A;  4KN4 X;  4HX7 A;  5B5E C;  1MDM A;  2RQP A;  3JR9 A;  4D1Q A;  3JRA A;  4Y15 A;  3MMY B;  3QOP A;  2YR2 A;  3ABK H;  4LFU A;  5J1R A;  2E2I J;  3C2G A;  2IA0 A;  2ZKZ A;  4D7N A;  3VYU B;  1JJ6 C;  3GFM A;  1BW5 A;  1LUJ B;  1ZLJ A;  3OYH A;  5EZG A;  1XMA A;  1AHD P;  5GAG J;  1QGP A;  4PCQ A;  2N8G A;  4CZZ A;  4HLY A;  3MKY B;  5TJJ A;  3PIP F;  3LSI A;  3DWL E;  2W4S A;  2LRD A;  1SAN A;  2M34 A;  4E6K G;  2O8K A;  1X1D A;  3HPH A;  2HOT A;  2E1N A;  1QA6 A;  3QQA A;  2L9N A;  1DUX C;  5BOX A;  1XSX A;  1U5T C;  4B47 A;  2V7F A;  4FX4 A;  2MD0 A;  1K83 J;  4QPO A;  4EJO A;  1KU7 A;  2PLY A;  2PI0 A;  4I7H A;  4M3D A;  1D0Z A;  2DAO A;  2E1M C;  3QP6 A;  3SEQ A;  2DMQ A;  2JQ7 A;  1U8B A;  2HI3 A;  3QAH A;  1BR1 A;  5E1Z B;  1OCR H;  3Q5F A;  3LAJ A;  4CYC A;  4UB6 C;  1HDD C;  2GOX B;  3ZQI A;  4C3J J;  1P4W A;  1WI9 A;  4ZJZ A;  3F8F A;  2L0K A;  1YJN I;  1JJ8 C;  1LDK B;  5H2F C;  3QOE A;  4LD5 A;  2LSO A;  3K0L A;  2FBH A;  3V4G A;  1F4K A;  3S15 J;  2UZK A;  2CQN A;  1ETQ A;  3BR5 A;  3OYI A;  2GXA A;  4HRI A;  1IN5 A;  1OYY A;  3FMR A;  4J19 A;  1FC3 A;  5JI6 A;  3F9K A;  4EM1 A;  3UR3 C;  3M8F A;  1XS9 A;  5KAI C;  1IO2 A;  1BJZ A;  4E70 A;  5D6E A;  1BR2 A;  5F6F A;  2VT3 A;  3WHC A;  1P4A A;  1R1U A;  5IP9 J;  2QBY A;  2XKO A;  3BRO A;  4BEH A;  2MC3 A;  3PO3 J;  1WJ5 A;  2DT6 A;  2TRT A;  4HX8 A;  3B02 A;  4LMY A;  2YUS A;  1LVA A;  5ILS A;  3ZOB A;  3FBN B;  5JR3 A;  3MN2 A;  4ZYG A;  1DP7 P;  1WHU A;  4CXF A;  1ETK A;  1GVJ A;  3EYI A;  5M3F J;  4BQN A;  2X51 A;  2PFB A;  1HXD A;  1ZRC A;  1NTC A;  2HNH A;  4LB5 A;  2JPC A;  1K79 A;  1NK3 P;  5IT3 A;  2ZJ2 A;  1S3J A;  4Q48 A;  4B3X A;  4NQW A;  1O3R A;  3FXR A;  3GUD A;  3FHN A;  4C2M J;  1T8I A;  5EG0 B;  2M2E A;  3CUQ C;  4G6T B;  2D1H A;  3O8H A;  3GX4 X;  2OD5 A;  5FKN A;  2HQA A;  2V9P A;  3NQO A;  3W6J B;  5D5X B;  4A3B J;  4KT6 A;  3LL7 A;  3PO2 J;  4IZZ A;  2M87 A;  1X1P A;  2CRG A;  3QOD A;  4AWX B;  1UJ8 A;  2F4O B;  5F1R A;  1HBX G;  1HC8 A;  1AA7 A;  2ZXW H;  3RKX A;  1LEB A;  1HW5 A;  1U5T B;  1Z0X A;  3KP4 A;  1JE8 A;  1ITY A;  3COA C;  2E1M B;  2HOE A;  3JRI A;  3FM5 A;  2WAQ A;  1HKS A;  1MZB A;  3SJM A;  4R1H A;  5HS9 A;  1FYM A;  3O2P E;  1XGO A;  4FHT A;  1Y56 A;  3CP8 A;  2QM3 A;  4XOR A;  1VFC A;  2R7U A;  5IY5 H;  3WU0 A;  5KCM A;  3OWT A;  3PIO F;  1ON1 A;  3ZCO A;  1T95 A;  4JYK A;  2R5Y A;  5J40 A;  3J7Y J;  4A0Z A;  2GZW A;  3AG2 H;  2ELK A;  3ZMD A;  2F4M B;  3TW7 A;  3KEO A;  1QO0 D;  2JSC A;  1I50 J;  1PVE A;  4R8H A;  1OJL A;  1FZP B;  2ADU A;  1UAA A;  3OV8 A;  3TO6 A;  1RRJ A;  1ZH5 A;  1IRF A;  2AO9 A;  2K9L A;  3A02 A;  3MVP A;  3HKZ N;  5K5Q A;  3ZQ7 A;  5E79 C;  5KAF C;  1BL0 A;  2B0L A;  1Z3X A;  4BAC A;  1T6S A;  4JX5 A;  3RI4 A;  4RGR A;  1SVO A;  1HKQ A;  1ODD A;  2KDO A;  3H0G J;  5FKL A;  3CC4 I;  5M5Y J;  5HS8 A;  4XLP F;  4I6Z A;  2BBY A;  1NG7 A;  3LSR A;  4MNU A;  4DGW B;  2HR3 A;  2EIJ H;  2LY9 A;  3FMS A;  2VPR A;  3DPU A;  4KT5 C;  2JA5 J;  2MH2 A;  3V7C A;  1MBK A;  5E20 A;  2KMU A;  3KP6 A;  2RNJ A;  4E7I A;  1H88 C;  4G8X A;  2KLO A;  2CUJ A;  3MKL A;  3JW4 A;  2V79 A;  4EQQ A;  2XF7 A;  1GV5 A;  3I0T A;  4KN7 X;  3Q0V A;  2VON A;  1DPU A;  3CUQ B;  2AHQ A;  1TBX A;  3VYR B;  1SFE A;  1CF7 A;  2K4J A;  2BY2 A;  5E8G A;  4ZDP A;  2IS6 A;  4A6E A;  1TT5 B;  2W1O A;  3OIQ A;  4KIF A;  2DYS H;  4QSH A;  4YEJ A;  5E3L A;  2M30 A;  4G7H F;  4IHS A;  5FLV A;  2GIZ A;  5DDG A;  3VYT B;  2VKV A;  1RET A;  3LSJ A;  4HBL A;  4Q5S F;  1B4A A;  3DCF A;  1W4M A;  3HRM A;  2DT5 A;  3GYH X;  1G3W A;  1RR7 A;  2DA6 A;  3J7A O;  2YPR A;  2LYC A;  2M8E A;  1J7K A;  2P0W A;  4L5J A;  4AYB A;  5FB2 A;  3E7L A;  3HSF A;  4AUX A;  3QU6 A;  3UKG A;  4WXD A;  1Q1H A;  2NXN B;  5IOZ A;  3H5N A;  2QCO A;  2COM A;  4ENN A;  4RM3 A;  3OIO A;  2DMU A;  2QEN A;  1C0W A;  3HOZ J;  1WH5 A;  5HNF A;  2LF7 A;  1YW9 A;  2R4G A;  4KIG A;  3T5X A;  1QHG A;  2KIU A;  3EUH C;  5L3D A;  2QQB A;  4II2 A;  2E2H J;  1VQN I;  3PNV A;  3NWS A;  1K4S A;  4D5F A;  1Y8R B;  3LSH A;  3IAM 2;  4DYQ A;  3FK6 A;  2ZJP F;  3T8R A;  5HS7 A;  4F92 B;  3ZQF A;  3U2R A;  4E7Z A;  1BOB A;  1U9N A;  3GBG A;  4OIO F;  4C2U A;  1OCT C;  2XGC A;  3CLO A;  3OL3 A;  3KLN A;  2ZXJ A;  3KLO A;  4RB1 A;  3DKW A;  1LKX A;  1R00 A;  2A68 F;  1TW2 A;  2HVQ A;  1YRN A;  3K6G A;  1ZN2 A;  3ECO A;  1HST A;  1QZZ A;  1VQ6 I;  1YHQ I;  1W5T A;  5FKK A;  2LH9 A;  2VBW A;  4LOC A;  4HF0 A;  2Y9Y A;  3LSG A;  4NC6 A;  3RKQ A;  2KQR A;  2JK3 A;  5FKM A;  3OIP A;  4LLG F;  3FXK A;  2JRM A;  4KYW A;  1BI0 A;  2PEX A;  1I39 A;  1LDD A;  4ESJ A;  2BXZ A;  2DBB A;  1OYW A;  4DYC A;  3BTJ A;  4F93 B;  4HNU A;  4YFN F;  4XID A;  2OJE D;  3HOY J;  1YIT I;  3TOA A;  5JVG F;  4ZYD A;  3F3X A;  1Q1V A;  3OY9 A;  3GEZ A;  2XVC A;  4KMU X;  2DW4 A;  3WGI A;  5LRR A;  1XB4 A;  2HKX A;  2CYY A;  3SDB A;  3A4C A;  1T0F C;  1LEA A;  1S6L A;  1OYI A;  2D2W A;  2PMH A;  3DTE A;  3KPH A;  1NG6 A;  4JQF A;  4UNO A;  2K85 A;  2CWE A;  4XRS G;  1VQ9 I;  1MW7 A;  4ZZL A;  3G2B A;  2L9R A;  5KNL A;  4AIK A;  4OMZ A;  4XSZ F;  3ZRG A;  1VQ8 I;  2XSD C;  4LIV A;  4BHP A;  1SFO J;  1LFU P;  1TP4 A;  3BTI A;  3CO7 C;  2ICW G;  3E97 A;  5LLQ A;  3DBL B;  4JX4 A;  4DIQ A;  3CCJ I;  2WV0 A;  1AKH A;  2DQL A;  2WC2 A;  5FGM A;  4OAZ A;  5D4R A;  1Z05 A;  2UWM A;  1M1E B;  5DM6 F;  1W7P B;  3B6A A;  2P5V A;  2VBY A;  5J4V A;  2VC0 A;  4KIB A;  5EEH A;  2BZT A;  2PJR A;  2ME6 A;  2M5W A;  2WY8 Q;  4XN3 A;  4XL9 A;  3I64 A;  1HCR A;  3NAU A;  2FBK A;  3DBR B;  3LA7 A;  4OIQ F;  3K1N A;  5FLX K;  4PFP A;  1Y1V J;  1XMX A;  1W7P D;  3HOT A;  1R36 A;  1R58 A;  4U87 A;  4EGY A;  3BDD A;  1O7F A;  2KDZ A;  1EKE A;  1RKT A;  2M3A A;  1D5Y A;  1XPX A;  2H1L A;  4BJ6 C;  2HVR A;  4MHG A;  2UV1 A;  2CS3 A;  2F5E A;  3PUF A;  4WX9 A;  5GTH C;  3OYJ A;  4P55 A;  2V4J C;  1Z1D A;  2OA4 A;  2VOO A;  5K7H A;  1TW3 A;  4ZTF A;  1IRG A;  3HB9 A;  2BEO A;  3HPG A;  3EET A;  4PJN A;  3MKW B;  3F0C A;  2LKS A;  1ZRE A;  2KRF A;  5E1X A;  5GP9 A;  4BDZ A;  4H0E A;  3BJA A;  2ZME C;  2FX0 A;  3MEX A;  4O5V A;  4GRI A;  5JVT A;  2VJ5 A;  4HNT A;  4OU0 A;  2KZG A;  3JRG A;  5H20 A;  1GXQ A;  2IPQ X;  2OZU A;  3CUO A;  2TDX A;  3A03 A;  4A3D J;  3VSK A;  3MFK A;  4B09 A;  1DGR M;  3PL8 A;  4V19 K;  4DW6 A;  3FZV A;  2HWV A;  1ULY A;  3BCA A;  3GW2 A;  1UZC A;  3WOD F;  3PNT A;  3TDU C;  2VJJ A;  4HV6 A;  3R6S A;  3V7R A;  2FNP A;  2ZNY A;  3D0S A;  4YEL A;  1G3S A;  2DJN A;  1KQ9 A;  4EVI A;  3I55 I;  2BY0 A;  2DFF A;  5LEJ A;  2DK5 A;  5DM7 F;  1GUU A;  3E6D A;  4IQJ A;  3K9T A;  2PX9 A;  2K27 A;  3KZZ A;  3JTH A;  2CQQ A;  2IBD A;  1UMQ A;  3AG4 H;  3AL0 B;  1BIB A;  2L9S A;  3E6C C;  2X4H A;  5FFZ A;  1TTY A;  4EV0 A;  3NRV A;  2F6C A;  3IH4 A;  5LEK A;  2K9Q A;  2DMT A;  4YIF A;  1W36 C;  1SFX A;  3GO5 A;  4YIR X;  1J5Y A;  2KP6 A;  3G1O A;  2JUG A;  2Q8K A;  3FIS A;  3T8T A;  1X3Z B;  2ZB9 A;  3T0Y A;  4H4K C;  2VC1 A;  2J5P A;  1S72 I;  4NHJ A;  4NC7 A;  3GTK J;  2E35 A;  5ICF A;  1TWF J;  4DBR A;  5K5R A;  1SD7 A;  1JGG A;  3W6K B;  1U0J A;  4ZYH A;  3QPH A;  3H3U A;  3H5A A;  4IRG A;  4PJJ A;  4AC0 A;  1W0U A;  1OR7 C;  1A6I A;  4RAG A;  4AID A;  5JLX A;  2OPT A;  2YX4 A;  3BLY A;  1V3F A;  2V6C A;  3CCR I;  2XPU A;  1RZ4 A;  3HUG B;  1ETY A;  5LBQ A;  1HQC A;  5LRS A;  3Q9V A;  1JI8 A;  3RJP A;  1SD4 A;  3PM1 A;  4A3F J;  4FCY A;  2K9M A;  3RTR A;  3VWB A;  4BEH B;  3CD6 I;  2ESN A;  1MMN A;  4WF2 A;  5E8I A;  4D7M A;  1SAX A;  3S2D J;  2HDC A;  2ZJQ F;  2V6E A;  1S7A A;  5B1B H;  5D5V B;  4PGH A;  4CYD A;  2MG4 A;  5J3L A;  1SD5 A;  4G6D A;  3D1N I;  4XR6 A;  2MLK A;  2NNN A;  2X85 A;  1XX5 A;  5ICE A;  4Y52 J;  5F0H A;  5D5W B;  3J81 K;  4AVZ A;  3RZO J;  1OCZ H;  4LG0 B;  2WAD A;  4L9T A;  2DN0 A;  3CJN A;  5IYC J;  5HDG A;  2KIQ A;  3S93 A;  3SYT A;  1QU3 A;  3HC7 A;  2DFI A;  1IRX A;  1JUM A;  2DOA A;  3DLA A;  4KNY A;  3J7A Y;  2Z5U A;  1Z7L A;  2B63 J;  1GDT A;  4ZDL A;  1S8N A;  4XKC A;  1YW7 A;  4MTD A;  3JTG A;  3K4N A;  1JT6 A;  3FM3 A;  5AIQ A;  4HQM A;  2IA2 A;  4S0H B;  4QLC U;  1R23 A;  4CCN A;  5HLH A;  2VB6 A;  1IV6 A;  2UXN A;  3I54 A;  2P7C B;  3CO6 C;  3LAP A;  2R7F A;  3O3K A;  2P7V B;  1YG2 A;  2JTV A;  2W48 A;  3L2C A;  2C6Y A;  2HPM A;  2K02 A;  3I5U A;  2Q2E A;  1G59 A;  2TCT A;  4BHC A;  3KE2 A;  4I0A A;  1X58 A;  2WA0 A;  2NVQ J;  2EFQ A;  2BHY A;  4IHX A;  4OIR F;  4QPQ A;  2EV5 A;  4CGZ A;  1WGX A;  1MMG A;  4G12 A;  2WAF A;  4HF1 A;  4N0B A;  2YS9 A;  3SDG A;  3E5X A;  3K4K A;  3E5Q A;  2GWR A;  3P9C A;  3GTO J;  1OMI A;  3AFH A;  2RC4 A;  2NVU B;  3TP0 A;  1RUN A;  3OYG A;  5F04 A;  3BR3 A;  2LOO A;  1RKW A;  2DXI A;  3ABU A;  3HOW J;  4A3L J;  1MBJ A;  2QKM B;  4M3F A;  3RYP A;  1LPQ A;  3L2U A;  1W36 D;  2W24 A;  3K70 D;  1P92 A;  3K4B A;  4L9J A;  4P9F A;  2FOW A;  2UXX A;  2VIX A;  3KP3 A;  5D6F A;  3TED A;  3M8J A;  4BY7 J;  3SEZ A;  2FNA A;  2FQ3 A;  3L2V A;  3OYN A;  3H0D A;  3M1C A;  4B3A A;  3I56 I;  1SD6 A;  3HOX J;  2X1E A;  4A0Y A;  4XLH A;  1DPR A;  3HDD A;  1S9H A;  2XAU A;  3KP2 A;  3SZP A;  4BDY A;  4MEX F;  3K7A J;  4XRM A;  4PK4 A;  3QYE A;  3RPQ A;  4CCM A;  5L3E A;  1TLH B;  3AG1 H;  1VQK I;  2EFN A;  2PMZ A;  4Y4R A;  2LFB A;  2LNB A;  2VOP A;  1UEL B;  2FOK A;  4HOB A;  3HEF A;  1Z77 A;  2PMZ N;  1BJA A;  1TWA J;  3DEE A;  3PSI A;  2EFP A;  3D5L A;  2KFD A;  2LP0 A;  3HGY A;  4YRV A;  3HM5 A;  2OQG A;  2GOM A;  4AIJ A;  1D8J A;  2GIV A;  2DTR A;  1ZG3 A;  3P9I A;  1EV7 A;  3IH2 A;  3CDH A;  3F6V A;  3RIR A;  3LST A;  5L3G A;  3FWE A;  5F0F A;  2IW5 A;  3VPR A;  2FML A;  1ZEL A;  5BQT A;  2PMU A;  4LB6 B;  3HRT A;  1KZH A;  4XQF A;  1DU6 A;  3M9A A;  4OAY A;  3ISP A;  1I1S A;  1N25 A;  3BOQ A;  3CCV I;  2DA2 A;  4WK8 F;  1UG0 A;  2IGK A;  3J80 Z;  4M3G A;  4L9N A;  4XLE A;  2V26 A;  2ELH A;  2ZC2 A;  2WY7 Q;  1OIS A;  4AVP A;  2LBF A;  3F6O A;  5TIS C;  4F55 A;  2OF7 A;  3I58 A;  3G6E I;  5FRM A;  5H6Q A;  2FE3 A;  2KJC A;  2DFE A;  4RLF A;  2P81 A;  1B72 B;  2XUB A;  2DOF A;  2BOL A;  4RGS A;  1LFB A;  4CIC A;  1XDS A;  2DJI A;  1RIO H;  4A0X A;  5E1W A;  5IPA A;  3H9Q A;  4A3K J;  2CFO A;  3RCO A;  3S2H J;  2DA3 A;  2PN6 A;  2B7E A;  1VI0 A;  2JN6 A;  2JJ7 A;  1FY7 A;  4F52 A;  3G3Z A;  2X1C A;  3MZY A;  1TQI A;  3WU2 C;  5J47 A;  3HTS B;  1NK2 P;  1FNN A;  2E5Z A;  4OIP F;  5C4J J;  1K6Y A;  5BNG A;  3PUB A;  1EF4 A;  3DPL C;  4Z6Y A;  1RR8 C;  1T08 B;  4M72 A;  4U88 A;  4RAZ A;  2NAZ A;  3GLL A;  4EEF G;  2FA5 A;  2W84 A;  1KQ8 A;  3M8E A;  1OCO H;  2XIG A;  1ZR4 A;  3ML6 A;  2E2J J;  3WE3 A;  3K1P A;  4XRS A;  2Z16 A;  3L1P A;  3AG3 H;  3R0J A;  2FJ1 A;  2AQF A;  3CCL I;  3FHZ A;  1VQ4 I;  2M9H A;  2CMP A;  2FMY A;  4XLC A;  4ON0 A;  5D8L B;  1ZGA A;  3PNY A;  3A1Y A;  4UUV A;  3PQK A;  1MSF C;  1QRY A;  1K78 B;  2EZH A;  1TL8 A;  5GTI C;  1X1B A;  4XN0 A;  3CCS I;  5EGO A;  4CO8 A;  3A0H C;  4MFE A;  2NYX A;  2DU9 A;  2DQR A;  2QSH X;  3G1L A;  3CCY A;  3NWT A;  3QU3 A;  4I0B A;  4C3I J;  3WTS C;  4MFD A;  4A12 A;  3M07 A;  2ZFW A;  2R5Z A;  5FRN A;  3GWZ A;  4IVN A;  3SZT A;  1FYK A;  3MAJ A;  1IN6 A;  1HDP A;  3JAM K;  1SVL A;  1FLI A;  4BXF A;  3CF2 A;  1H89 C;  2W7N A;  4DJA A;  5L3B A;  5EJC A;  3SFI A;  3JRB A;  1XSD A;  2FEZ A;  4KJZ A;  2EWN A;  4ESB A;  3WG7 H;  3V8K A;  3F23 A;  2W57 A;  2CQK A;  3RYR A;  5BMZ A;  2NOJ B;  2ZJR F;  2JMW A;  2F48 A;  2KZV A;  2GBY A;  1BC7 C;  1XTA A;  1IG7 A;  1W1W E;  3QYB A;  2O8X A;  4EAT A;  2BHZ A;  2K9N A;  4PGG A;  1LVK A;  1IN8 A;  2R7Z J;  1FP1 D;  3F8M A;  3W3C A;  1QVT A;  4A69 C;  2H8W A;  4CH7 A;  2ZME A;  3OYE A;  2F5D A;  2KJB A;  1S5L C;  2VQC A;  4O3M A;  2Y30 A;  4ENK A;  2MC4 A;  3VSL A;  1FOX A;  2R92 J;  4XK4 A;  4EM0 B;  1IJW C;  4FAS D;  3OS2 A;  4A3I J;  3K4C A;  4GFB A;  4G7O F;  4IKF A;  2L9V A;  2WAQ N;  1W0T A;  1FBS A;  1BW6 A;  3HL2 A;  1R71 A;  3CC7 I;  1I3Q J;  3TQN A;  1F43 A;  2HQN A;  5J8F A;  1YJW I;  3EYY A;  4PZJ A;  4W1U A;  4MIM A;  1BOA A;  2JVG A;  3ESW B;  3REO A;  2L4M A;  4PDK A;  1RPW A;  2XGX A;  2VPL A;  1RUO A;  5IYD J;  2FSW A;  1KYW A;  2EH3 A;  1MD0 A;  4NC8 A;  1HOM A;  4UHT A;  3OYB A;  4M3B A;  4WXH A;  3QPS A;  1R5H A;  3ZN0 A;  4RM2 A;  5DUI A;  3N97 A;  5FLX Z;  4ZTJ A;  1LNW A;  3CJR B;  4JP0 A;  1JKO C;  3G4S I;  4KIS A;  3IH3 A;  1KU9 A;  1X19 A;  1JUS A;  3RKW A;  2A07 F;  5LGU A;  2Z33 A;  2F2E A;  5JHF A;  2DO7 A;  3TKY A;  3I59 B;  1HKT A;  1MGT A;  1D1C A;  1QPM A;  5DCF A;  2HEO A;  1P9Q C;  3DFG A;  3BC8 A;  2NS0 A;  2ID3 A;  1OPC A;  2ZXI A;  4ITV A;  1H0M A;  1NHA A;  1T98 A;  4XOP A;  1OLT A;  5DCM A;  2K7L A;  1N77 A;  1H8A C;  1E0E A;  2ME0 A;  2IXS A;  4FE4 A;  3SQN A;  2GQQ A;  1SFU A;  2EA2 A;  2MAB A;  2X6O A;  3TOB A;  4L18 B;  3FXU A;  3IP4 B;  2O61 A;  4HV5 A;  3JRF A;  2OAZ A;  1R4N B;  3HGG A;  1LE8 A;  3S1Q J;  4A3E J;  2H27 A;  2OTJ I;  5IT9 K;  4XOT A;  3ZQL A;  2CU7 A;  4I98 B;  1O7L A;  1YOV B;  4M9Z A;  2VQH A;  3QPT A;  3RDI A;  2E60 A;  2RAE A;  1K61 A;  3CJQ B;  4S04 A;  2DMP A;  3AKZ A;  5F0C A;  1I1G A;  1V4R A;  2A3S A;  2O9L A;  2STT A;  4EGZ A;  4LJZ F;  2DI3 A;  5CKT A;  3KZI C;  3VB2 A;  3W6V A;  1JHF A;  4B8X A;  2R3S A;  1BI3 A;  1LQ1 A;  3CC2 I;  1B8I B;  1P7I A;  1ETO A;  1F5T A;  4CHU A;  1VF9 A;  2RVC A;  3WTW C;  3DBH B;  1S7O A;  2EFO A;  4AYB N;  4G7Z F;  3C3W A;  3OS1 A;  3EQL F;  2V1U A;  2JZY A;  3ASO H;  3CMM A;  5DS9 A;  2A6T A;  3R0A A;  2CG4 A;  4I99 C;  4X6A J;  1IAW A;  3OSG A;  1ON2 A;  3EUA A;  5FRO A;  3ZR8 X;  1YE9 A;  2LKX A;  3MWM A;  1F36 A;  2EQR A;  3MCZ A;  3JRC A;  2BYV E;  3OYF A;  1PYV A;  4A93 J;  1TNT A;  1Z6T A;  1YW8 A;  4KDP A;  3S3N A;  1FPQ A;  4KFC A;  2ZSI B;  4N4O B;  3HSE A;  1VTN C;  1GVD A;  1SFK A;  2Y9Z A;  3ELK A;  1X3U A;  3GTP J;  2O3F A;  2DA5 A;  1TWC J;  2K9S A;  1X1A A;  4AU7 A;  2O5R A;  3OMY A;  1SEU A;  1DP3 A;  3ONQ A;  5CQG A;  5GAD J;  5GAH J;  3L2R A;  4E7S A;  4BJ5 C;  4E7L A;  3BQZ A;  4L0Y B;  5TGT A;  1Z7U A;  1J09 A;  4KIT B;  1TQM A;  1JKR C;  2L01 A;  1Y8Q B;  3KET A;  1JHH A;  3JRH A;  1ZQ3 P;  1TZL A;  3KP7 A;  2HOS A;  2CV0 A;  3U1K A;  1QVU A;  4YG2 F;  4P5O A;  2E34 A;  1OFC X;  2WTE A;  3WHB A;  3ZQH A;  4N9I A;  5EF6 A;  3Q0U A;  2EV0 A;  3R61 A;  1YX3 A;  2Z1D A;  1WWX A;  1XSV A;  4MTE A;  3RZD J;  4LLN A;  2P5L C;  2JRT A;  1PUF B;  4RLQ A;  5EDN A;  1GV2 A;  3RPU D;  3H92 A;  3QYF A;  2RRE A;  2IRF G;  4M73 A;  4EJV A;  1JKQ C;  2HQ5 A;  4A3M J;  1GLN A;  4IQ4 A;  3BY6 A;  5EEG A;  4RGX A;  4B43 A;  3E3V A;  1BM9 A;  5EG0 A;  3AL0 C;  3BZC A;  4UV9 A;  2QSF X;  1YIO A;  2BW3 B;  3FBI B;  1MJB A;  3M3Y J;  3OYL A;  4BAY A;  3HOV J;  4UUT A;  4ENJ A;  3BPV A;  4A3G J;  1GT0 C;  3KZY A;  3L2W A;  1BI2 A;  2EV6 A;  3HIF A;  1ZHF A;  2E36 A;  4Y3O A;  3LNQ A;  2XB0 X;  4HEA 2;  2QSG X;  1MND A;  1YO5 C;  1X1C A;  3ZQC A;  2X6X A;  2P6T A;  2DDB A;  1WFX A;  4BBS J;  2DA4 A;  3R4K A;  3CZ6 A;  1U5T A;  3RSN A;  4I76 A;  1YTY A;  4HAM A;  2VQG A;  1TWH J;  1XCV A;  1YFH A;  1O57 A;  1PP8 F;  2JA6 J;  1R22 A;  5KHD A;  5M5W J;  4L5E A;  2R7Q A;  3DP7 A;  3E0J B;  1O4X A;  4CCO A;  1Z67 A;  2KPM A;  2WB1 A;  3AAF A;  1ETV A;  2ISZ A;  1ORK A;  2STW A;  3GFI A;  1FMW A;  1SAU A;  4Y7N J;  5K7Z A;  3S1M J;  1B6A A;  2XAJ A;  5FLM J;  5ILU A;  3K2Z A;  1RES A;  2OCE A;  2VUM J;  5J4Y A;  2HYG D;  3GTG J;  3N4M A;  3BR6 A;  1TC3 C;  4D0P A;  1G8X A;  4X0G A;  3JRD A;  4Y33 A;  2G9W A;  2M8G X;  3P7N A;  5HLG A;  3HG9 A;  2EPF A;  2Y75 A;  4BS9 A;  1FSE A;  1ENH A;  2HTJ A;  5M5X J;  2W82 A;  1LB2 A;  5CPR B;  3KCC A;  2I5U A;  3K4J A;  1WJE A;  3FXM A;  3TL4 X;  2VLA A;  1POG A;  1UB9 A;  2MH9 A;  3BG9 A;  4XNF A;  1MDM B;  2O6G E;  3WG9 A;  3G1M A;  2Y48 A;  1VQO I;  1U8R A;  3H35 A;  4U7D A;  4E7J A;  2LLK A;  1WJD A;  2H6B A;  4IHV A;  1BI1 A;  3S16 J;  3W2W A;  1X3W B;  2VBX A;  1MH3 A;  2EIN H;  3BZ6 A;  1DGW Y;  1A35 A;  3H5R A;  3MZ8 A;  5CVI A;  2VXZ A;  2Q0O A;  4P1W A;  4CDG A;  3VDX A;  3CDI A;  3HXL A;  1SC7 A;  4XLF A;  5C44 J;  4CCL A;  1A31 A;  2IGN A;  4HG2 A;  2Z2S B;  4HW0 A;  1WKM A;  3M4O J;  1XD7 A;  3E1S A;  4DZP A;  5CVU A;  3I53 A;  1REP C;  2WV1 A;  2M0C A;  2ZSH B;  3DLL F;  2EA4 A;  1A5J A;  3CUQ A;  2LRE A;  2HXO A;  5LD2 C;  1KON A;  2WBM A;  3VOE A;  3ERE D;  4G6Q A;  3OL4 A;  3BJ6 A;  4CYC B;  2M4K A;  3K70 C;  4JK1 X;  3JCU C;  1U78 A;  4A6D A;  4O6J A;  3ROU A;  1XGM A;  3LA3 A;  2DA1 A;  4MO7 A;  4WWC A;  5J6X A;  3B73 A;  5BS6 A;  4RB3 C;  4KA4 A;  2LD5 A;  2VOD A;  2XV4 S;  5FD5 A;  4YFX F;  1FIA A;  3HHG A;  4Q4Z F;  3CCE I;  1IXS B;  3SHF A;  4BE0 A;  2JPB A;  4FQG A;  4I2O A;  4ETS A;  3T1B A;  3HRS A;  3C18 A;  1LDJ A;  4HPQ A;  2DOE A;  4Q47 A;  1IRZ A;  2A69 F;  5D4S A;  2FD5 A;  1LJ9 A;  2NRA C;  1VZ0 A;  4A5N A;  2CW7 A;  6PAX A;  3BP8 A;  1FYL A;  4C3H J;  4ANJ A;  4BU2 A;  2V9V A;  2IEK A;  3CTA A;  4IEJ A;  2QBY B;  2E7X A;  5EEA A;  1ZAR A;  4B44 A;  3SXY A;  2Y31 A;  5HDK A;  4ZYA A;  3I4P A;  4FIS A;  4ZYE A;  3VFZ A;  2CH0 A;  1RNL A;  3S14 J;  1V5G A;  1G6N A;  4IHW A;  2LK2 A;  5EYR A;  2JA8 J;  1Y6I A;  5HVQ C;  4LIU A;  4BXU A;  4QTR A;  1UST A;  2P5K A;  2R7R A;  3JAM Z;  2IT0 A;  3L7W A;  4NQW B;  4RGU A;  1FOK A;  1ZKG A;  4GO1 A;  3KP5 A;  5B1A H;  3R60 A;  1IUF A;  1QQI A;  3A2K A;  1J2X A;  2L4A A;  1ACI A;  3HRU A;  1OCP A;  5FFX A;  4M9X A;  1EH7 A;  1MNM C;  1CGP A;  3TGN A;  4CUG A;  2P6S A;  2EK5 A;  1P6R A;  1T33 A;  1J0R A;  5F27 A;  2GA2 A;  1FSH A;  2E7W A;  4EJW A;  2DLL A;  1X2N A;  2NS7 A;  3K4L A;  3S1R J;  1IF1 A;  2OZ6 A;  1I27 A;  1YS6 A;  1YIJ I;  1ERD A;  4IJA A;  3WE2 A;  2ZXH A;  1R6R A;  5E3O A;  4XON A;  3GVA A;  1ZRF A;  1IGN A;  3V42 A;  1HF0 A;  3KYD B;  1WPK A;  1MBG A;  2XGE A;  1MBF A;  2XPV A;  4CSW A;  2QKL B;  2RQQ A;  2HPI A;  1UG2 A;  2PG4 A;  3FDY A;  4MGR A; 
#chains in the Genus database with same CATH homology
 4WXC A;  1WQ2 A;  1MJA A;  3F8C A;  4XRF A;  1PDN C;  3EDP A;  3IL2 A;  1JXS A;  1W7P A;  1IXR C;  1HW1 A;  2HS5 A;  3EUH A;  2Z99 A;  3LFK A;  4I01 A;  2PJP A;  4L9V A;  1ZGJ A;  2ZNZ A;  2FU4 A;  1KGS A;  4G9Y A;  1GXP A;  2BV6 A;  2XAG A;  4K2E A;  1QNT A;  1F1Z A;  1DDN A;  3OOP A;  4ZH4 F;  3IRR A;  2O0Y A;  2H09 A;  5AON A;  1H9G A;  3ZPL A;  1UCR A;  2L3D A;  3F72 A;  3WGG A;  1CF7 B;  2RGV A;  4GGG A;  4HX4 A;  4JBA A;  1ZAO A;  3JSO A;  1KU2 A;  2FXA A;  4BHB A;  1IW7 F;  1WRJ A;  5ILV A;  2HGC A;  4HF2 A;  1IN7 A;  3NEU A;  2Z9O A;  4UVB A;  3IKV A;  4DNC A;  2EFW A;  1T0F A;  1AOY A;  5CVJ A;  3GFL A;  2ESH A;  1ZYR F;  5AIP A;  1ZRD A;  1XGS A;  1MKM A;  3WU1 B;  2V1D A;  3TO7 A;  5JFR A;  4U0W A;  2G7H A;  2GAU A;  1RI7 A;  4A2U A;  3GZ6 A;  4M71 A;  2HTS A;  4BQA A;  5DUK A;  5L3C A;  1P4X A;  5ED4 A;  5LGT A;  4EM2 A;  3HUG A;  3I71 A;  1T38 A;  2ZO4 A;  2L02 A;  1QZY A;  5FD6 A;  4M6Y A;  1G3Y A;  5A2Q K;  2W85 A;  1UHM A;  4EJT A;  4OMY A;  2ZCW A;  1Z91 A;  2D1V A;  4YFK F;  2VE9 A;  1G3T A;  1OKR A;  1Z9C A;  2HKO A;  4IRH A;  2GXG A;  3WTX C;  1R7J A;  1ZLK A;  1R5G A;  4LG0 A;  4HDV A;  4MEY F;  3VEP A;  5TRD A;  2HQR A;  5ICG A;  2AS5 F;  5DYM A;  1AWC A;  1TQP A;  1O3Q A;  4AIH A;  1PP7 U;  1KQ0 A;  2H94 A;  2XAQ A;  2H6C A;  4ENM A;  2M45 A;  3ZMZ A;  2ETH A;  3LQR A;  2CSO A;  1K6O A;  1FX7 A;  2XKP A;  4HDU A;  2PBI A;  3GXO A;  5DEQ A;  2QQA A;  1HSJ A;  2KIF A;  3DV8 A;  1MJ9 A;  2Z3Y A;  1J75 A;  2EB7 A;  1T2K A;  3MZH A;  2QWW A;  3WTT C;  1YS7 A;  1B1B A;  1F9N A;  3ECH A;  1YYV A;  3TDZ C;  1OR7 A;  1SMY F;  1TNS A;  3DQV C;  3GF2 A;  2XRO A;  2FF4 A;  2F5C A;  4RB0 A;  1YLF A;  4BYY A;  3O6B B;  2VT2 A;  3DF8 A;  4P96 A;  5HDN A;  3BWG A;  1FBQ A;  2IJL A;  2RDP A;  4L5I A;  4MQ9 F;  5DV5 A;  2HFH A;  2VN2 A;  1XGN A;  4OIN F;  4HQE A;  2DPU A;  2MBF A;  1D5V A;  3ZMS A;  3LQQ A;  2MLG A;  1FWZ A;  4OOI A;  4HA8 A;  1WSU A;  4TV7 A;  3DEU A;  3U9G A;  3SFZ A;  2O03 A;  2W25 A;  3WTU C;  3J80 K;  1R1T A;  5BPD A;  5CVV A;  4P9U A;  1L3L A;  4M6X A;  2AXL A;  4RS8 A;  4BH9 A;  3FXQ A;  2YX7 A;  4EJU A;  1KYZ A;  1XDU A;  3K69 A;  2YU3 A;  2WWY A;  3IWZ A;  5H6R A;  4ASN A;  4LK1 F;  2Y0M A;  1G4D A;  4LLL A;  2LKP A;  4YII A;  3K1M A;  3L00 A;  1XN7 A;  4KMF A;  3MQ0 A;  3ZMU A;  2EJR A;  3E6M A;  5K1Y A;  5LHG A;  1L0O C;  4GCV A;  1IZ1 A;  2ISY A;  4IF4 A;  2OBP A;  3J81 Z;  1KU3 A;  4R79 A;  3GFJ A;  4QWQ A;  1D3Y A;  3BPX A;  1K78 A;  3ZN1 A;  2F5F A;  3IC7 A;  2L54 A;  2KIM A;  5DD4 A;  1FP2 A;  2QZ8 A;  4XBF A;  2J5O A;  2YSR A;  4N9H A;  3WTZ A;  3ABT A;  5E18 F;  3DPT A;  2X0L A;  4IRI A;  2M1B A;  3V7S A;  1A04 A;  2CFX A;  3M7G A;  1GHC A;  3ZMT A;  2MA3 A;  3E5U A;  4GXO A;  2D45 A;  3G73 A;  4L0Z B;  2GA1 A;  4HZF A;  3HSR A;  4UXN A;  1QBJ A;  3LA2 A;  1Z6R A;  5J8C A;  1B9N A;  3VOD A;  1EH8 A;  3C1D A;  2RV8 A;  5CLS A;  2OQR A;  2BGC A;  4NB5 A;  5LHH A;  5BPI A;  1U3E M;  2QUF A;  3U1D A;  3PFI A;  4RB2 C;  3QRF F;  1IN4 A;  2VE8 A;  5CVR A;  4Z2Y A;  1ONV A;  2PQ8 A;  3E6B A;  3L09 A;  5KK1 A;  2RKH A;  3I59 A;  3TO9 A;  1BBY A;  1R1V A;  3DXJ F;  5HOO A;  1J9I A;  3IKT A;  4XLN F;  2A5Y B;  2K4B A;  3V8L A;  2K86 A;  1YQA A;  1FT9 A;  1JGS A;  3IRQ A;  1H9T A;  1T39 A;  2E1C A;  3IWF A;  2A61 A;  4XSX F;  2JT1 A;  3WTY C;  2ACJ A;  2FBI A;  2CW0 F;  4F7Z A;  3HHH A;  3M1E A;  2VBZ A;  2XHK A;  2XAH A;  4ZZD A;  2LDU A;  1UHW A;  3S2W A;  2G7U A;  3HOS A;  2QYO A;  2DPD A;  5E17 F;  1PUE E;  1FBU A;  3L9F A;  4S05 A;  4UV8 A;  1USS A;  1Y0U A;  3FX3 A;  4U7B A;  5HLI A;  2HZT A;  4HYE A;  3FF5 A;  5FO5 A;  1D8K A;  5LGN A;  1KA8 A;  2KKO A;  3ZMV A;  2FRH A;  1BN5 A;  4Y17 A;  5F64 A;  3LWF A;  2QVO A;  5K5O A;  4ESF A;  2QLZ A;  4KIC A;  5ICC A;  1SMT A;  3F8B A;  3GLX A;  4UVC A;  2XAF A;  2NNY A;  1B59 A;  2XAS A;  4DQ2 A;  3KEQ A;  3ZP5 A;  1O3S A;  4RAY A;  4AD9 A;  1I6X A;  5A2Q Z;  2R7D A;  1EH6 A;  2IVM A;  3WTV C;  4IHT A;  3IHU A;  4LK0 F;  4M9S A;  2CO5 A;  2A6E F;  1HW2 A;  1B9M A;  3RPU A;  3C7J A;  4I02 A;  1STZ A;  1UFM A;  2P4W A;  3RKY A;  1J59 A;  1E2X A;  2CGP A;  3JSP A;  3F22 A;  1ZG1 A;  1I5Z A;  2DK8 A;  5CYV A;  1IXC A;  4M74 A;  4U0V A;  4Y13 A;  3BJO A;  2ZME B;  3WGH A;  1ZG5 A;  1U2W A;  4GYG A;  4IPA A;  5JHU A;  2GXB A;  2MD5 A;  3F21 A;  3H3Z A;  3FMQ A;  1P2F A;  3PQJ A;  5ERI A;  2P8T A;  5D8K B;  4FT8 A;  4BNC A;  4KUM A;  4GYI A;  4HLX A;  1XCB A;  3P9K A;  1E17 A;  5KVR A;  1BIA A;  3KFW X;  4G94 A;  3QP5 A;  4EMS A;  4U0Y A;  2IP2 A;  1O3T A;  3GZ5 A;  3V8J A;  4LGW A;  3Q9S A;  1IUY A;  4WCG A;  2BE5 F;  5LHI A;  2ZBK A;  1K7A A;  2HYF A;  5DD8 A;  5D5U B;  3F8N A;  4A5M A;  2QQ9 A;  5CJ9 A;  2IA1 A;  3ULQ B;  5L3F A;  3HTU A;  5DCM B;  3HYI A;  4I09 A;  2RN7 A;  4FX0 A;  2LF8 A;  4UVA A;  2OU2 A;  4MQV A;  1W5S A;  1XMK A;  2V1X A;  1U6G A;  1S29 A;  5IT9 Z;  2A6H F;  4IXA A;  1BC8 C;  2XRN A;  4KN4 X;  4HX7 A;  1MDM A;  2RQP A;  4Y15 A;  3QOP A;  2YR2 A;  4LFU A;  2IA0 A;  2ZKZ A;  3GFM A;  1ZLJ A;  1XMA A;  1QGP A;  4PCQ A;  4CZZ A;  4HLY A;  5TJJ A;  2E1N A;  1DUX C;  5BOX A;  1XSX A;  1U5T C;  4FX4 A;  4EJO A;  2PLY A;  1KU7 A;  2PI0 A;  4I7H A;  2DAO A;  3QP6 A;  3QAH A;  5E1Z B;  3Q5F A;  3LAJ A;  1P4W A;  1WI9 A;  3F8F A;  1LDK B;  4LD5 A;  2LSO A;  3K0L A;  2FBH A;  3V4G A;  1F4K A;  2UZK A;  1IN5 A;  1OYY A;  3FMR A;  1FC3 A;  5JI6 A;  4EM1 A;  3M8F A;  4E70 A;  5D6E A;  5F6F A;  2VT3 A;  1P4A A;  1R1U A;  2QBY A;  2XKO A;  3BRO A;  2MC3 A;  4HX8 A;  3B02 A;  4LMY A;  5ILS A;  1LVA A;  5JR3 A;  4ZYG A;  1DP7 P;  4CXF A;  1GVJ A;  3EYI A;  2PFB A;  1HXD A;  1ZRC A;  4LB5 A;  2JPC A;  1K79 A;  5IT3 A;  2ZJ2 A;  1S3J A;  4Q48 A;  4NQW A;  1O3R A;  3FXR A;  3GUD A;  3CUQ C;  2D1H A;  3GX4 X;  2OD5 A;  3NQO A;  3W6J B;  5D5X B;  2M87 A;  4AWX B;  5F1R A;  1HBX G;  3RKX A;  1LEB A;  1HW5 A;  1U5T B;  3KP4 A;  1JE8 A;  3COA C;  2HOE A;  3FM5 A;  1HKS A;  1MZB A;  4R1H A;  5HS9 A;  1FYM A;  3O2P E;  1XGO A;  4FHT A;  2QM3 A;  3WU0 A;  1ON1 A;  4A0Z A;  2GZW A;  3ZMD A;  3KEO A;  1QO0 D;  2JSC A;  4R8H A;  1FZP B;  2ADU A;  3OV8 A;  3TO6 A;  1ZH5 A;  1IRF A;  5K5Q A;  3ZQ7 A;  2B0L A;  1T6S A;  3RI4 A;  4RGR A;  1HKQ A;  1ODD A;  5HS8 A;  4XLP F;  2BBY A;  4MNU A;  2HR3 A;  3FMS A;  4KT5 C;  2MH2 A;  3V7C A;  5E20 A;  3KP6 A;  2RNJ A;  4G8X A;  3JW4 A;  2V79 A;  4EQQ A;  3I0T A;  4KN7 X;  2VON A;  1DPU A;  3CUQ B;  1TBX A;  1SFE A;  1CF7 A;  2K4J A;  5E8G A;  4A6E A;  1LQ1 A;  4G7H F;  4KIF A;  4IHS A;  2M30 A;  5DDG A;  4HBL A;  4Q5S F;  1B4A A;  1W4M A;  3HRM A;  2DT5 A;  3GYH X;  1G3W A;  3J7A O;  2YPR A;  4L5J A;  2M8E A;  1J7K A;  5FB2 A;  3HSF A;  3QU6 A;  4WXD A;  1Q1H A;  2COM A;  4ENN A;  2QEN A;  1C0W A;  2LF7 A;  1YW9 A;  4KIG A;  3T5X A;  2KIU A;  5L3D A;  2QQB A;  3T8R A;  5HS7 A;  3U2R A;  4OIO F;  3CLO A;  3KLN A;  2ZXJ A;  3KLO A;  4RB1 A;  3DKW A;  1R00 A;  2A68 F;  1TW2 A;  1ZN2 A;  3ECO A;  1HST A;  1QZZ A;  1W5T A;  2VBW A;  4HF0 A;  4KYW A;  4LLG F;  1BI0 A;  2PEX A;  1LDD A;  4ESJ A;  2DBB A;  1OYW A;  4YFN F;  3TOA A;  4ZYD A;  3F3X A;  3GEZ A;  2XVC A;  4KMU X;  3WGI A;  2DW4 A;  5LRR A;  1XB4 A;  2HKX A;  2CYY A;  1LEA A;  1S6L A;  1OYI A;  2D2W A;  2PMH A;  4UNO A;  4JQF A;  2CWE A;  4ZZL A;  4AIK A;  4OMZ A;  4XSZ F;  4BHP A;  3CO7 C;  3E97 A;  5LLQ A;  2WV0 A;  2DQL A;  2WC2 A;  5FGM A;  5D4R A;  1Z05 A;  2UWM A;  1W7P B;  2P5V A;  2VBY A;  2VC0 A;  4KIB A;  5EEH A;  2M5W A;  3I64 A;  2FBK A;  3LA7 A;  4OIQ F;  3K1N A;  5FLX K;  1W7P D;  3HOT A;  1R36 A;  1R58 A;  4EGY A;  3BDD A;  1O7F A;  4MHG A;  2F5E A;  4WX9 A;  4P55 A;  1Z1D A;  2OA4 A;  2VOO A;  1TW3 A;  1IRG A;  2BEO A;  3EET A;  1ZRE A;  2KRF A;  5E1X A;  4H0E A;  3BJA A;  3MEX A;  4O5V A;  5JVT A;  4OU0 A;  5H20 A;  1GXQ A;  2IPQ X;  2OZU A;  3CUO A;  2TDX A;  3MFK A;  4B09 A;  3FZV A;  2HWV A;  1ULY A;  3GW2 A;  3WOD F;  3TDU C;  4HV6 A;  3R6S A;  3V7R A;  2FNP A;  2ZNY A;  3D0S A;  1G3S A;  1KQ9 A;  4EVI A;  5LEJ A;  2DK5 A;  3E6D A;  3K9T A;  2K27 A;  3KZZ A;  3JTH A;  1BIB A;  3E6C C;  2X4H A;  5FFZ A;  1TTY A;  4EV0 A;  3NRV A;  5LEK A;  4YIF A;  1SFX A;  3GO5 A;  1J5Y A;  2Q8K A;  3T8T A;  3T0Y A;  2VC1 A;  2J5P A;  4NHJ A;  5ICF A;  5K5R A;  1SD7 A;  3W6K B;  4ZYH A;  3QPH A;  3H3U A;  4IRG A;  2YX4 A;  1V3F A;  2V6C A;  1RZ4 A;  5LBQ A;  1HQC A;  5LRS A;  3Q9V A;  3RJP A;  1SD4 A;  3RTR A;  2ESN A;  4WF2 A;  5E8I A;  1SAX A;  2HDC A;  1S7A A;  5D5V B;  4PGH A;  4CYD A;  1SD5 A;  4G6D A;  2MLK A;  2NNN A;  5ICE A;  5D5W B;  3J81 K;  4LG0 B;  4L9T A;  3CJN A;  5HDG A;  2DFI A;  4KNY A;  2Z5U A;  1S8N A;  1YW7 A;  4MTD A;  3JTG A;  3FM3 A;  5AIQ A;  4HQM A;  2IA2 A;  4QLC U;  1R23 A;  5HLH A;  2UXN A;  3I54 A;  2P7C B;  3CO6 C;  3LAP A;  2R7F A;  3O3K A;  2P7V B;  1YG2 A;  2JTV A;  3L2C A;  2C6Y A;  2K02 A;  3I5U A;  2Q2E A;  4BHC A;  3KE2 A;  4I0A A;  2EFQ A;  4OIR F;  2EV5 A;  4CGZ A;  4HF1 A;  4N0B A;  3E5X A;  3E5Q A;  2GWR A;  3P9C A;  1OMI A;  2RC4 A;  1RUN A;  3ABU A;  3RYP A;  2W24 A;  1P92 A;  4P9F A;  4L9J A;  2UXX A;  3KP3 A;  5D6F A;  2FNA A;  2FQ3 A;  1SD6 A;  4A0Y A;  1DPR A;  3SZP A;  3KP2 A;  4MEX F;  3RPQ A;  5L3E A;  1TLH B;  2EFN A;  2LNB A;  2VOP A;  2FOK A;  4HOB A;  1BJA A;  2EFP A;  3D5L A;  2OQG A;  4AIJ A;  1D8J A;  2GIV A;  2DTR A;  1ZG3 A;  3P9I A;  1EV7 A;  3CDH A;  3F6V A;  3RIR A;  3LST A;  5L3G A;  3FWE A;  2IW5 A;  2FML A;  5BQT A;  2PMU A;  4LB6 B;  3HRT A;  3M9A A;  3ISP A;  1I1S A;  3BOQ A;  4WK8 F;  3J80 Z;  4L9N A;  2ELH A;  4AVP A;  3F6O A;  3I58 A;  5H6Q A;  2FE3 A;  2KJC A;  2XUB A;  4RGS A;  4CIC A;  1XDS A;  1RIO H;  4A0X A;  5E1W A;  2PN6 A;  1FY7 A;  3G3Z A;  3MZY A;  1TQI A;  3HTS B;  1FNN A;  4OIP F;  3DPL C;  4M72 A;  4U88 A;  4RAZ A;  2NAZ A;  2FA5 A;  2W84 A;  1KQ8 A;  3M8E A;  2XIG A;  3ML6 A;  3WE3 A;  3K1P A;  3R0J A;  3FHZ A;  2FMY A;  4ON0 A;  5D8L B;  1ZGA A;  4UUV A;  3PQK A;  1K78 B;  4CO8 A;  2NYX A;  2DU9 A;  2DQR A;  3WTS C;  3QU3 A;  4I0B A;  4A12 A;  2ZFW A;  3GWZ A;  4IVN A;  3SZT A;  1FYK A;  3MAJ A;  1IN6 A;  3JAM K;  1FLI A;  5L3B A;  1XSD A;  2FEZ A;  2EWN A;  4ESB A;  3V8K A;  3F23 A;  2W57 A;  2CQK A;  3RYR A;  5BMZ A;  1BC7 C;  2O8X A;  4PGG A;  1IN8 A;  1FP1 D;  3F8M A;  2ZME A;  2F5D A;  2KJB A;  4O3M A;  4ENK A;  4EM0 B;  4G7O F;  1FBS A;  3TQN A;  2HQN A;  5J8F A;  3EYY A;  4PZJ A;  1BOA A;  3REO A;  2L4M A;  4PDK A;  2XGX A;  1RUO A;  2FSW A;  1KYW A;  1MD0 A;  4UHT A;  4WXH A;  1R5H A;  3ZN0 A;  5DUI A;  3N97 A;  5FLX Z;  1LNW A;  1KU9 A;  3RKW A;  2A07 F;  5LGU A;  2Z33 A;  2F2E A;  2DO7 A;  3TKY A;  3I59 B;  1HKT A;  1MGT A;  1QPM A;  2HEO A;  5DCF A;  3DFG A;  2NS0 A;  1OPC A;  1H0M A;  1NHA A;  1T98 A;  5DCM A;  2K7L A;  3SQN A;  2GQQ A;  1SFU A;  2EA2 A;  3TOB A;  4L18 B;  3FXU A;  2O61 A;  4HV5 A;  2OAZ A;  2H27 A;  5IT9 K;  4I98 B;  1O7L A;  4M9Z A;  3QPT A;  3RDI A;  4S04 A;  1I1G A;  1V4R A;  2A3S A;  2STT A;  4EGZ A;  4LJZ F;  2DI3 A;  3VB2 A;  1JHF A;  4B8X A;  2R3S A;  1BI3 A;  1F5T A;  4CHU A;  2RVC A;  3WTW C;  1S7O A;  2EFO A;  4G7Z F;  3C3W A;  3EQL F;  2V1U A;  2JZY A;  3R0A A;  2CG4 A;  1IAW A;  1ON2 A;  3MWM A;  3MCZ A;  2BYV E;  1TNT A;  1Z6T A;  1YW8 A;  4KDP A;  1FPQ A;  4KFC A;  3HSE A;  1VTN C;  3ELK A;  1X3U A;  2O3F A;  4L0Y B;  1Z7U A;  1TQM A;  2L01 A;  3KET A;  1JHH A;  3KP7 A;  4YG2 F;  4P5O A;  2WTE A;  4N9I A;  2EV0 A;  3R61 A;  1WWX A;  1XSV A;  4MTE A;  4LLN A;  2P5L C;  2JRT A;  3H92 A;  2IRF G;  4M73 A;  4EJV A;  3BY6 A;  5EEG A;  4RGX A;  3E3V A;  1BM9 A;  4UV9 A;  1YIO A;  1MJB A;  4BAY A;  4ENJ A;  3BPV A;  3KZY A;  1BI2 A;  2EV6 A;  3HIF A;  1ZHF A;  1YO5 C;  2P6T A;  3R4K A;  1U5T A;  1YTY A;  4HAM A;  1XCV A;  1YFH A;  1O57 A;  1PP8 F;  1R22 A;  3DP7 A;  3AAF A;  2ISZ A;  2STW A;  3GFI A;  1B6A A;  2XAJ A;  5ILU A;  3K2Z A;  2HYG D;  3N4M A;  4D0P A;  2G9W A;  5HLG A;  3P7N A;  2Y75 A;  1FSE A;  2HTJ A;  1LB2 A;  3KCC A;  1UB9 A;  2MH9 A;  2O6G E;  1MDM B;  3WG9 A;  2Y48 A;  1U8R A;  4U7D A;  2H6B A;  1BI1 A;  2VBX A;  3BZ6 A;  5CVI A;  2VXZ A;  2Q0O A;  4CDG A;  4HW0 A;  1WKM A;  1XD7 A;  5CVU A;  3I53 A;  1REP C;  2EA4 A;  3CUQ A;  3VOE A;  3ERE D;  4G6Q A;  3BJ6 A;  4JK1 X;  1U78 A;  4A6D A;  4O6J A;  3ROU A;  1XGM A;  3LA3 A;  4WWC A;  5J6X A;  3B73 A;  5BS6 A;  4RB3 C;  4KA4 A;  2VOD A;  2XV4 S;  5FD5 A;  4YFX F;  3HHG A;  4Q4Z F;  1IXS B;  3SHF A;  2JPB A;  4I2O A;  4ETS A;  3T1B A;  3HRS A;  3C18 A;  1LDJ A;  4Q47 A;  2A69 F;  5D4S A;  1LJ9 A;  2NRA C;  4A5N A;  6PAX A;  3BP8 A;  1FYL A;  2V9V A;  3CTA A;  2QBY B;  2E7X A;  1ZAR A;  3SXY A;  5HDK A;  3I4P A;  4ZYE A;  3VFZ A;  1RNL A;  1G6N A;  5HVQ C;  4BXU A;  1UST A;  2P5K A;  3JAM Z;  2IT0 A;  3L7W A;  4RGU A;  1FOK A;  4GO1 A;  3KP5 A;  3R60 A;  1QQI A;  1J2X A;  2L4A A;  3HRU A;  5FFX A;  4M9X A;  1EH7 A;  1CGP A;  3TGN A;  2P6S A;  2EK5 A;  1P6R A;  1J0R A;  1FSH A;  2GA2 A;  2E7W A;  4EJW A;  2DLL A;  1IF1 A;  2OZ6 A;  1I27 A;  1YS6 A;  4IJA A;  3WE2 A;  3GVA A;  1ZRF A;  2PG4 A;  4MGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...