2C6YA

Crystal structure of interleukin enhancer-binding factor 1 bound to dna
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords FORKHEAD BOX PROTEIN K2
publication title Crystal Structure of the Human Foxk1A-DNA Complex and its Implications on the Diverse Binding Specificity of Winged Helix/Forkhead Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2c6yA00
2HYGD 4L5IA 4LG0A 2Z9OA 1JE8A 3WE2A 1BI1A 4UUVA 2NNYA 4CYDA 2L01A 4LB5A 4L9TA 5DD4A 1C0WA 2PBIA 2NRAC 5J8FA 2VBXA 2Y75A 1AOYA 3Q9SA 2JTVA 2GZWA 2B0LA 4G7OF 1LDJA 5L3GA 1FBSA 2STTA 1LEBA 4RGUA 1ZRCA 2UXNA 3N97A 3ABUA 3T0YA 2PN6A 4EJTA 3J81Z 1R7JA 1PP8F 2NS0A 2UWMA 1YW8A 2FF4A 1RIOH 2MH2A 1S7AA 4YFXF 2LSOA 4A6EA 4MGRA 3U9GA 3FX3A 1IAWA 2BGCA 1PDNC 2EK5A 1SD7A 3LAJA 1ZRFA 1UHMA 3FMSA 3SZTA 3K69A 4XLNF 5LGTA 2VC1A 2HS5A 5H6QA 4MQ9F 2O3FA 1WSUA 2FOKA 4G7ZF 4A0ZA 2YPRA 2HEOA 4LGWA 1WKMA 3EDPA 2MBFA 2O03A 2P7CB 3JTHA 2FMYA 2FNPA 3GF2A 4LJZF 2DPUA 2RGVA 1ZG5A 3I71A 1KQ9A 3K0LA 4R79A 3PFIA 1WI9A 3FF5A 4XLPF 1XSDA 1KYZA 1ODDA 1CGPA 2M8EA 2IA1A 2H27A 3QAHA 1U5TB 4GXOA 1ZGJA 3KFWX 5LGUA 1FPQA 1FWZA 3WTSC 1OR7A 3BWGA 2XUBA 4M72A 3L00A 2DQRA 1YS7A 1FY7A 2J5OA 4G8XA 2HWVA 3ZN1A 5E1WA 3L7WA 3V4GA 1ZREA 4L9NA 5E18F 3H3ZA 5K5QA 2ZBKA 1FT9A 4E70A 4DQ2A 1W7PB 3TO7A 2WC2A 3F3XA 2IT0A 5CVUA 5DYMA 2FRHA 2GA2A 1MKMA 1J0RA 5EEHA 3DKWA 3V8LA 1LDKB 2PFBA 3KP2A 4BYYA 3TO6A 5L3FA 3TQNA 3E5QA 1FX7A 1Z9CA 2JPCA 3QP6A 2UXXA 4YFNF 4HW0A 2NNNA 2OA4A 2KRFA 1IN7A 2IP2A 5DUKA 4OIRF 3KP7A 1XN7A 4CGZA 1OYWA 1R5GA 1KU3A 5CVJA 3BP8A 3HTSB 3WTVC 1SD5A 4QWQA 4G6QA 5K5RA 4D0PA 4ESBA 1TQPA 3WTXC 2XRNA 4BQAA 4HF2A 3QU6A 2WTEA 2YSRA 3ZMDA 4XSZF 1TW3A 2EFWA 1UB9A 4NHJA 4KDPA 2CQKA 1UCRA 1W7PD 4P55A 4M9SA 1R1UA 2P6SA 1T39A 5ICGA 1MDMB 4NB5A 1YG2A 4AD9A 5HVQC 1E2XA 4KIBA 1O7FA 4F7ZA 3ZMVA 2HYFA 1IN5A 5JI6A 1MJ9A 4IRIA 1S8NA 4U0YA 1DP7P 4PGGA 3D0SA 2QWWA 3S2WA 1FZPB 4IXAA 2L54A 2A61A 1SFEA 1EH8A 2OU2A 1GXQA 2IA0A 3CO6C 3DFGA 3IKVA 1BIAA 1DPRA 2D45A 3LAPA 3LSTA 4ENJA 4HV5A 1S3JA 4HA8A 1J7KA 2JZYA 5A2QZ 1YQAA 1R00A 4WWCA 2K7LA 3WGGA 4GYIA 5LRRA 4L18B 3LA2A 2E7WA 4ZYGA 2ADUA 1XDUA 2TDXA 3WODF 2K27A 5FFXA 2DQLA 2BYVE 3PQKA 1ZAOA 1D3YA 3F6VA 1R23A 5CVVA 2Q8KA 3CUOA 3F72A 3V8KA 3DPLC 1K7AA 1I27A 2DAOA 5K5OA 3V8JA 3U1DA 3VFZA 3ZMZA 2ZXJA 1TNTA 2YX4A 4OU0A 3RI4A 2XV4S 1R1VA 4LG0B 4HAMA 1MJAA 3K1PA 5A2QK 4UVBA 1HW2A 3JTGA 3ERED 4Z2YA 1FYMA 2CYYA 4RGXA 2XAGA 3N4MA 4L0ZB 3RPUA 5HS8A 2RNJA 1O3SA 3TKYA 3QOPA 1I5ZA 1HKQA 3DF8A 2RN7A 2K4BA 3E5UA 1W4MA 3HOTA 4YIFA 3ZP5A 1HW1A 2QZ8A 3HYIA 5D8KB 3ZMUA 4N0BA 4EV0A 2Q0OA 3HHHA 4PGHA 5HDNA 4FX0A 2LNBA 1ZN2A 2XASA 2CSOA 3JAMK 1W5TA 2RDPA 5J8CA 1EH6A 4Q48A 1B6AA 1YYVA 3KP4A 5ILUA 5HDKA 1IN4A 2MH9A 1V4RA 3KZYA 3E6DA 2JT1A 3B73A 2HKOA 1MDMA 2BEOA 2JPBA 3CUQB 3TDUC 4OINF 3MZHA 1HSTA 3SZPA 4I2OA 5JFRA 3VODA 3F8BA 1QNTA 1SFUA 2O8XA 2FEZA 2PJPA 4N9HA 1B9NA 2LKPA 4FX4A 1IXRC 1FBQA 2O0YA 1ULYA 2Z33A 3FM3A 3WTYC 2KJCA 2WV0A 2MC3A 3WTUC 4ENNA 4GO1A 4MNUA 5HLHA 4S05A 1YIOA 4KYWA 3KETA 4KFCA 3QPTA 1ONVA 4UVAA 1U3EM 1XGMA 3I58A 5HS7A 2M45A 2JRTA 4JQFA 3GZ6A 1DUXC 2DU9A 3GEZA 3I64A 4GGGA 4P5OA 2OAZA 2YX7A 1J9IA 4A0YA 3I0TA 4L0YB 2PQ8A 2RVCA 1RUNA 5D5WB 4HYEA 1MJBA 2FMLA 3WG9A 4NQWA 3QPHA 3F22A 1GHCA 1FBUA 4HQMA 2ZNYA 2IW5A 4U88A 4U7DA 1T0FA 2DT5A 4M71A 4CO8A 1USSA 4L5JA 1HSJA 3P9CA 3WU1B 2VT3A 4I09A 1BIBA 1QPMA 4ZYHA 5E8IA 4I98B 2IA2A 3QU3A 4WXHA 3R0JA 2EFOA 2CG4A 4HX8A 4ENMA 2FBHA 2Y48A 2HZTA 2P5KA 1Q1HA 1Z05A 3IRQA 4M73A 2V9VA 1XSXA 3VOEA 1STZA 5BPIA 3KP3A 2MA3A 3K1MA 4P96A 4ENKA 3IHUA 4DNCA 1ZGAA 3D5LA 4RB1A 3KZZA 3TDZC 2E1CA 2W25A 4LD5A 1EV7A 3GYHX 1JHFA 2GWRA 2P4WA 3ECHA 4IHSA 4G6DA 1U6GA 1BI3A 3BOQA 2X0LA 1HW5A 3P9KA 2ZFWA 5D5UB 3IL2A 2H94A 3VB2A 4YG2F 1YLFA 1PP7U 1OKRA 3U2RA 2DO7A 2EA2A 3F23A 1T6SA 3C1DA 5DV5A 4A12A 2KIMA 3CUQA 1CF7B 5D4RA 4OOIA 4XSXF 1P92A 3JW4A 2YU3A 1BC8C 3GFLA 4WXCA 3MFKA 3NQOA 3GFJA 1W5SA 2Y0MA 3HUGA 1SFXA 1BC7C 3J81K 3QRFF 3HRSA 3WTWC 5ICEA 3HIFA 1P4WA 3V7RA 2ISYA 4ESFA 2VE9A 4RB0A 5BMZA 4ZYDA 2OZUA 5DEQA 3BJAA 5ILSA 4Q4ZF 4EJVA 4WF2A 3ZPLA 1LVAA 1D8KA 2MLKA 1KU7A 2O6GE 5CJ9A 3GO5A 3DP7A 5IT3A 4HLYA 3B02A 1RUOA 5DDGA 5E1ZB 3HSRA 5J6XA 3V7SA 5DCMB 4EM0B 2STWA 2V79A 3CUQC 2W57A 2VT2A 1J75A 4O6JA 2R3SA 3E6BA 1H0MA 4UV9A 3LQRA 1BM9A 1BI2A 4L9JA 1T38A 5DUIA 4CHUA 1FC3A 3G3ZA 2D2WA 4R1HA 1F1ZA 4YFKF 1HKSA 5LEJA 3KLNA 4UVCA 3LQQA 3ECOA 1SAXA 2M1BA 1YFHA 3KLOA 4BHBA 1Z6TA 2GXGA 3CO7C 4PCQA 5K1YA 2DPDA 4LLLA 1S6LA 4RS8A 2VXZA 3SHFA 5ED4A 3IWFA 1OYIA 2VODA 4Y13A 1IN6A 2V1XA 4M9ZA 4OMZA 3WE3A 2GAUA 4WX9A 5LHIA 2ISZA 4LK0F 2W24A 5JR3A 3REOA 2VC0A 1K79A 5IT9Z 3QP5A 3K1NA 4Q5SF 3NRVA 3T8RA 3I5UA 5FO5A 2E7XA 3RKWA 1G3WA 5JHUA 2G7UA 3RKXA 5BQTA 2XGXA 3ULQB 1ON2A 1P4XA 2CFXA 3BROA 1UFMA 2J5PA 3ZMSA 3E5XA 4I01A 5L3EA 3T5XA 2ELHA 4G9YA 2Q2EA 5E1XA 5KVRA 3P9IA 4AWXB 2HQRA 4ZZLA 4M6YA 4ON0A 4WK8F 1IRFA 5TJJA 2VBWA 3ZN0A 2L3DA 4KN4X 3PQJA 1KU2A 1FYLA 5HLIA 3TGNA 3VEPA 5IT9K 5AIPA 1CF7A 4JBAA 3HHGA 1K78B 4IF4A 1P2FA 2ZMEB 1WQ2A 4Y17A 1BBYA 3O3KA 1IXCA 4YIIA 4HDUA 1WWXA 4MTDA 4HOBA 1XSVA 2H09A 2K86A 3WGIA 3DV8A 3R4KA 1XMKA 3ABTA 5D5VB 1FNNA 1XGSA 4KMFA 2QQ9A 1TW2A 3J80Z 2V1DA 3F8FA 3COAC 3ML6A 3ISPA 1GXPA 1O3RA 1IW7F 4UNOA 1I1SA 4RAZA 5DCMA 4P9UA 5HOOA 2R7DA 5CLSA 4CZZA 4I02A 2XAFA 3FWEA 5F64A 3LFKA 2V1UA 5LGNA 1YO5C 3BJ6A 3WTZA 2G9WA 2HR3A 5F1RA 4RGSA 1REPC 2P5VA 5F6FA 2XIGA 3GWZA 3T8TA 3HRUA 2ESHA 4ZH4F 4HV6A 4IPAA 5D6EA 1TBXA 1H9TA 3J80K 3LWFA 3E3VA 3H3UA 5ERIA 3FMRA 2DI3A 3RYRA 4HDVA 2EWNA 1F9NA 3WU0A 2NAZA 3DPTA 2Z3YA 2Z5UA 3R61A 2VN2A 1RI7A 4EMSA 4ESJA 3G73A 5HS9A 4IHTA 3IKTA 2VE8A 2EB7A 1MZBA 4Q47A 4M6XA 3H92A 3RDIA 4EVIA 3MWMA 2FXAA 2M5WA 2EFQA 1DPUA 2QUFA 3KEOA 1MGTA 1I1GA 4MQVA 1O7LA 3HSFA 1HXDA 4JK1X 4BH9A 3LA3A 1HBXG 3MQ0A 1PUEE 1LB2A 1YW9A 1ZG1A 4LFUA 5DD8A 4R8HA 4ZZDA 4S04A 1U8RA 3EQLF 2A69F 1R1TA 1BOAA 2FSWA 3O2PE 5LLQA 2VONA 2OQRA 1SMYF 2EFNA 4BXUA 2GQQA 1SMTA 1FYKA 1V3FA 3MCZA 2XKPA 2FBKA 2LDUA 2CGPA 2C6YA 1K78A 1Z1DA 2BBYA 2ZMEA 2WWYA 1XGOA 2H6CA 1J5YA 2X4HA 4PZJA 1IUYA 3CJNA 3FXQA 1UHWA 1O3TA 2VOPA 2DLLA 4ZYEA 1LJ9A 2OD5A 4HF0A 1XCVA 5E8GA 1GVJA 2W85A 4KNYA 1E17A 2XAJA 1ZG3A 1U2WA 3FZVA 2R7FA 3TO9A 2VBYA 2GA1A 2AS5F 3LA7A 2DTRA 2EFPA 1R22A 3W6JB 4EM2A 1QQIA 3OV8A 3RTRA 5BOXA 1XCBA 4TV7A 3Q9VA 3HOSA 2EJRA 1TNSA 2XAQA 2HGCA 1P6RA 4OIPF 5DCFA 2HTJA 2ZNZA 3GW2A 4L9VA 2RC4A 4FT8A 1R36A 5JVTA 1XMAA 3W6KB 1IRGA 2M87A 4MHGA 3Q5FA 1DDNA 4EJWA 4G94A 5FFZA 2HQNA 2ETHA 2OZ6A 1IZ1A 5D5XB 1EH7A 5H6RA 3EYIA 4LLNA 2PEXA 1TQIA 2DK5A 1G3SA 3DXJF 1F4KA 1D8JA 1R5HA 4M74A 1JHHA 4K2EA 3P7NA 4XBFA 2DK8A 3GXOA 5LEKA 3OOPA 2XKOA 1QBJA 1KA8A 1USTA 2EV6A 4LLGF 4RB2C 2QVOA 3HTUA 4U0WA 3ZQ7A 3MZYA 2NYXA 2VBZA 3BPVA 5LHGA 4U7BA 4HF1A 1IXSB 1G4DA 2GXBA 2QBYA 1G3YA 5ILVA 2E1NA 5ICFA 1RZ4A 4MEYF 3IRRA 2A6HF 3SXYA 4QLCU 3E6MA 4OMYA 3EYYA 1SD6A 2XVCA 3GFMA 2EA4A 3M7GA 3WTTC 3DQVC 1RNLA 1T98A 3FHZA 3C3WA 2KJBA 4EJUA 2CO5A 1VTNC 2A07F 1JGSA 1OYYA 2A6EF 2RKHA 3F8NA 1L0OC 3C18A 1X3UA 2MLGA 5CYVA 3M8EA 1FSHA 4OIQF 3CLOA 4MEXF 4I7HA 1XD7A 1J2XA 1XGNA 2A68F 4KT5C 2QENA 3L2CA 1BI0A 5L3DA 2AXLA 4HX4A 1ZYRF 3M9AA 2FBIA 3F8CA 5ICCA 1IF1A 1L3LA 3JSOA 5AONA 2D1VA 4WXDA 5D4SA 4WCGA 4AIKA 2V6CA 2ZO4A 1B1BA 3MAJA 3GFIA 2PMHA 1ZRDA 2P7VB 3SQNA 2UZKA 2COMA 3K9TA 4LK1F 2F5DA 3KEQA 1KYWA 4ASNA 2OQGA 1KGSA 2ESNA 3R0AA 2XHKA 4EJOA 1TQMA 1A04A 1O57A 2HTSA 2F5FA 2KKOA 2A3SA 4A6DA 2IRFG 4M9XA 5LRSA 2CW0F 3RYPA 4IRGA 4XRFA 4IVNA 2QYOA 1B4AA 4CDGA 1BN5A 4U0VA 1D5VA 4N9IA 3F21A 2ZKZA 1JXSA 3JSPA 1J59A 3TOBA 2BE5F 1T2KA 2CWEA 1H9GA 2K02A 1MD0A 3BDDA 1FLIA 1NHAA 3WGHA 3ZMTA 2PG4A 2XROA 5D8LB 1ZLKA 2QQBA 4KIFA 4KN7X 3I53A 2EV0A 3R6SA 1TLHB 1BJAA 5BPDA 1LNWA 3J7AO 1HQCA 2K4JA 1Z6RA 4EGZA 2BV6A 5LHHA 3M8FA 1FP1D 4AVPA 1QO0D 4A5NA 4KICA 2QM3A 3BZ6A 5FLXZ 2EV5A 4OIOF 2MD5A 2Z99A 2F5EA 5D6FA 2PI0A 2HKXA 2YR2A 2FQ3A 1XDSA 1YW7A 3I59B 3F8MA 1QGPA 2IJLA 1ON1A 2L4MA 4HZFA 2P5LC 1LDDA 2L4AA 3FXRA 2P6TA 1QZYA 2KIUA 4HX7A 3MEXA 4KMUX 1AWCA 4EGYA 1ZARA 3RPQA 4LMYA 2HDCA 3IWZA 1I6XA 4GYGA 2F5CA 2QLZA 5FGMA 2IVMA 3K2ZA 4B8XA 5FLXK 1ZLJA 1KQ0A 3BJOA 2A5YB 3RJPA 1U5TA 2ACJA 1FP2A 2O61A 3GX4X 5E20A 2LF8A 5FD6A 1OPCA 4HLXA 2W84A 3I4PA 3KE2A 3IC7A 5FB2A 2KIFA 2FNAA 2RQPA 2XAHA 3I54A 4BAYA 1FOKA 4UXNA 4Y15A 2FE3A 3RKYA 2RV8A 3M1EA 4HQEA 2HFHA 1ZH5A 5CVRA 3KP6A 3JAMZ 4O3MA 3L9FA 4IJAA 2G7HA 3T1BA 4P9FA 3FMQA 3AAFA 3O6BB 2DW4A 1W7PA 4KIGA 3HRTA 3DEUA 4AIJA 5HLGA 3HRMA 2DBBA 2PMUA 5KK1A 1U78A 3R60A 4ETSA 2PLYA 3L09A 1ZHFA 4H0EA 1HKTA 3NEUA 5H20A 4BNCA 1U5TC 1Z91A 4B09A 1R58A 4KUMA 3BPXA 5E17F 3ROUA 3GUDA 2DFIA 3CDHA 4A5MA 4FHTA 4UHTA 4G7HF 1G3TA 3KCCA 4PDKA 1IN8A 1SD4A 1WRJA 4BHCA 2OBPA 2QBYB 2M30A 5EEGA 3ELKA 5HDGA 4BHPA 1B9MA 1S29A 3CTAA 5FD5A 4UV8A 4MTEA 5BS6A 3V7CA 1LEAA 2JSCA 1LQ1A 1YTYA 1FSEA 4RB3C 2D1HA 1XB4A 1TTYA 5AIQA 4A2UA 4AIHA 3FM5A 2FA5A 4LB6B 1QZZA 2P8TA 4RAYA 2IPQX 4CICA 4IRHA 3C7JA 3E97A 1YS6A 2ZJ2A 2FU4A 3I59A 3GVAA 1KQ8A 3TOAA 1O3QA 4RGRA 3BY6A 1OMIA 4KA4A 4O5VA 5CVIA 2LF7A 4EM1A 4A0XA 3KP5A 1B59A 4CXFA 3GZ5A 1G6NA 3E6CC 4I0AA 3EUHA 4EQQA 3EETA 2H6BA 2GIVA 4I0BA 1K6OA 1F5TA 3F6OA 5L3CA 1Y0UA 5LBQA 2F2EA 4HBLA 1Z7UA 2ZCWA 6PAXA 2QQAA 3RIRA 2VOOA 4GCVA 2HOEA 1S7OA 5L3BA 1KU9A 3FXUA 3GLXA 3HSEA 5TRDA 3SFZA 2L02A 1P4AA
chains in the Genus database with same CATH superfamily
2HYGD 4BJTA 4L5IA 5DS9A 2AHQA 4CZCA 5IYCJ 3GBGA 4LG0A 2M0CA 2Z9OA 3A01B 1I50J 1JE8A 2B63J 2M4KA 2E1MC 4A69C 2ME0A 1WJDA 3QPSA 1IUFA 3A4CA 3ASNH 5F0HA 4U87A 4II3A 3OYBA 1WH7A 3WE2A 4Y52J 1N25A 1BI1A 3RQ4A 2X6WA 3C2HA 4UUVA 1WVRA 1OFCX 1AU7A 2NNYA 2LK2A 1QVTA 3D5RC 4CYDA 2L01A 4LB5A 2KLOA 4L9TA 5DD4A 1C0WA 5E3MA 4RMNA 2JA7J 2BOLA 2EZIA 1VQ6I 1VFCA 2PBIA 1YIJI 3EUHC 5F08A 2NRAC 5J8FA 2VBXA 2V9KA 2CFOA 2Y75A 1AOYA 3Q9SA 5IYDJ 2JTVA 2GZWA 1FTZA 2B0LA 2XSJC 3K4JA 1SC7A 1LDJA 5L3GA 4G7OF 1FBSA 2ZB9A 2STTA 1LEBA 4RGUA 1ZRCA 3BQYA 5KCMA 2UXNA 4HNUA 5E3OA 3N97A 3C2BA 2ID3A 3QPLA 1TT0A 3OS2A 2FD5A 3ABUA 3T0YA 1X3WB 2PN6A 2YUSA 5KNLA 2KL4A 1ZK8A 4OAYA 4X0GA 4EJTA 4RBOA 3J81Z 1R7JA 1PP8F 5EZGA 2NS0A 2UWMA 1YW8A 2FF4A 1RIOH 4DBRA 3K70D 2MH2A 1MNMC 1S7AA 4YFXF 2W00A 2LSOA 4A6EA 3M3YJ 1ACIA 1VQ9I 4BDYA 4MGRA 3U9GA 1NH3A 3FX3A 1IAWA 3GTJJ 2IEKA 2BGCA 4HSTA 2EK5A 4PSXA 1SD7A 3LAJA 1PDNC 1ZRFA 4NBQA 2DCEA 1UHMA 4ZDPA 2LBFA 3L2QA 2F48A 3FMSA 3SZTA 2QEXI 4A3LJ 3K69A 2KHMA 4XLNF 1BR1A 3Q0WA 5LGTA 2VC1A 2HS5A 5CKTA 5H6QA 4MQ9F 2O3FA 1WSUA 2FOKA 4G7ZF 4A0ZA 2E2HJ 2YPRA 2HEOA 4LGWA 1WKMA 4F3QA 3EDPA 2QGUA 2MBFA 2O03A 2P7CB 3G2BA 3JTHA 2FMYA 3LSMA 3PSFA 2FNPA 3GF2A 4LJZF 2DPUA 2RGVA 1ZG5A 3I71A 1KQ9A 3K0LA 4R79A 3QYFA 3J7YJ 5FROA 2PJRB 9ANTA 3PFIA 1SFKA 3KYLA 1T95A 3OYGA 2DA5A 1WI9A 3FF5A 2BY3A 4XLPF 1XSDA 1S7EA 1KYZA 1ODDA 2DMQA 1IDZA 1CGPA 2M8EA 3IAM2 1VQKI 1SVOA 4RAFA 3H1CA 2IA1A 2H27A 3QAHA 1U5TB 3K7AJ 5M5XJ 3EPZA 2I8DA 2KMUA 3JRGA 1K6YA 2IS6A 4GXOA 4HEA2 2R5YB 1ZGJA 2M2EA 3KFWX 4F52A 5LGUA 1FPQA 1FWZA 3FK7A 3WTSC 1OR7A 3BWGA 2XUBA 1BA5A 4M72A 3CD6I 3L00A 2DQRA 1YS7A 1FY7A 2AXTC 2J5OA 4G8XA 5JLWA 5J47A 2HWVA 2DDAA 3ZN1A 1X2NA 2R5ZB 3A1YA 5E1WA 2IS2A 3L7WA 3V4GA 2R7RA 4ZYAA 3BLYA 3RZOJ 3IH3A 5EDNA 1ZREA 2ZC2A 4L9NA 1OCTC 5E18F 3H3ZA 3F9KA 5K5QA 3CC7I 2FJ1A 2DA3A 2EPFA 1S5LC 2VJIA 2R7XA 3DLAA 2RAEA 2LKSA 3L2WA 4UY8I 2HXOA 2ZBKA 1FT9A 3G1LA 4E70A 1Z3XA 1Z77A 5K7HA 4DQ2A 1W7PB 3G1MA 3TO7A 2WC2A 1MH3A 2NOJB 3F3XA 2IT0A 5CVUA 3GTQJ 3G1OA 3ZQFA 2R93J 5DYMA 4W97A 2FRHA 2GA2A 2PMZN 2V1NA 3PUBA 3A01A 1MKMA 4MFEA 1J0RA 4OAZA 1MMNA 2GBYA 2QKMB 3DKWA 5EEHA 4XOPA 1LDKB 3V8LA 3BR0A 2TCTA 3OSGA 2NVQJ 2FQ4A 2PFBA 3KP2A 4BYYA 1D1BA 3MKWB 3TO6A 5L3FA 3H9GA 3TQNA 3E5QA 1FX7A 1Z9CA 3PNTA 2JPCA 2HVQA 3QP6A 4D7NA 2UXXA 3HOYJ 4JYKA 4YFNF 5KAFC 4HW0A 1MMDA 2KDZA 3H35A 2NNNA 3OYFA 3LSGA 1GT0C 2LOOA 2OA4A 2KRFA 1IN7A 2IP2A 3ONQA 1JGGA 5DUKA 4OIRF 3KP7A 1XN7A 2XGCA 4F92B 1OR7C 4QPOA 4IHXA 2QA4I 1OYWA 1UG0A 1R5GA 4CGZA 1PUFA 1KU3A 5CVJA 3BP8A 1AA7A 3HTSB 3WTVC 1SD5A 2HI3A 3VYUB 4QWQA 3H36A 4G6QA 5K5RA 4D0PA 2JA5J 2CV2A 4ESBA 1TQPA 3WTXC 2XRNA 3PFYA 3AFHA 4BQAA 4HF2A 3SEQA 3QU6A 2WTEA 4D5FA 2YSRA 3ZMDA 1APLC 1T56A 1OJLA 2LLKA 1TW3A 4XSZF 4IQJA 1YOVB 1Y8QB 1UB9A 2MC4A 2EFWA 1NK2P 2L5QA 4KDPA 2CQKA 4B43A 4NHJA 1UCRA 2I5UA 1W7PD 1D0YA 4GRIA 1O4XA 3CCEI 3W3CA 1IJWC 4XNFA 4P55A 4M9SA 1R1UA 2P6SA 2EZKA 1ETQA 1T39A 5ICGA 3U1KA 1MDMB 3I55I 4NB5A 1YG2A 4AD9A 1Z21A 2CH0A 3BR1A 5HVQC 1AHDP 1E2XA 2JMWA 4RLFA 4KIBA 1O7FA 2COBA 5FKOA 1WJCA 3SDBA 4F7ZA 3ZMVA 4MIMA 2DFEA 4LOCA 2HYFA 1IN5A 4HPQA 5JI6A 2HOAA 3QYBA 2ZJQF 1MJ9A 3HJEA 3UR3C 4IRIA 1S8NA 2NVYJ 4U0YA 1B72B 1DP7P 1P9QC 4PGGA 1X19A 3GLLA 3D0SA 4C3IJ 3L1PA 2QWWA 2AQEA 3S2WA 2N8GA 1FZPB 4IXAA 2L54A 2Z1DA 3VPRA 3OWTA 1N75A 3QQAA 1DP3A 4B3AA 1YJ9I 2KFDA 2A61A 1WCMJ 1RRJA 1SFEA 1EH8A 2OU2A 5LD2C 1GXQA 1QU3A 4M3EA 2BXYA 5GAGJ 2IA0A 5B66C 3CO6C 3VDXA 2E1MB 2XSDC 1PJRA 3DFGA 2V4JC 4PJJA 4H4KC 1F36A 2FOWA 1BIAA 3IKVA 1HOMA 1DPRA 2D45A 2YS9A 3A0HC 5TRDA 3DPUA 3LAPA 2X9DA 3LSTA 1LFBA 2ZXIA 4ENJA 4HV5A 3LOCA 1S3JA 4HA8A 2BXZA 1J7KA 2JZYA 5A2QZ 1SVMA 1YQAA 2WY8Q 2PJRA 1R00A 2M0MA 3K2AA 1WFXA 4WWCA 2K7LA 1E3HA 3S3OA 3WGGA 3S2DJ 4XLCA 3DKYA 4PFPA 4GYIA 1MW7A 5LRRA 4L18B 2R0QC 3LA2A 5IPAA 4CCNA 2LC2A 2E7WA 2IGMA 4ZYGA 2F4MB 2KQRA 2HXIA 3AL0B 2W7NA 2ADUA 1XDUA 2TDXA 2W1OA 3WODF 2K27A 2D5VA 5FFXA 2DQLA 2BYVE 3PQKA 1ZAOA 1GDTA 1D3YA 3F6VA 1R23A 5CVVA 4NQWB 2Q8KA 3CUOA 3ZQQA 3F72A 2IGOA 2MD0A 3DPLC 3V8KA 1K7AA 3BTCA 1I27A 1Z0XA 2MSYA 3HOVJ 3IAS2 2E19A 1LKXA 2DAOA 5K5OA 4FQGA 3V8JA 3U1DA 2R7WA 2R5ZA 3VFZA 3ZMZA 2ZXJA 1TNTA 2YX4A 2MABA 4OU0A 3RI4A 1TWGJ 2XV4S 1R1VA 3NAUA 1LPQA 2O5RA 4LG0B 4HAMA 1MJAA 3K1PA 4JOMA 3BG5A 2P0WA 5A2QK 4UVBA 1HW2A 3JTGA 1JUSA 2R7OA 5C44J 1VI0A 4ITVA 5M3MJ 3ERED 2LKXA 1KONA 1ITYA 4D9JA 1VQ8I 4Z2YA 3DBRB 1FYMA 1E3PA 2CYYA 1A6QA 4RGXA 5M3FJ 2XAGA 3E1SA 2CJJA 3N4MA 3GTOJ 4L0ZB 2PMZA 1W36D 3RPUA 1YHQI 5HS8A 1UMQA 2RNJA 1WPKA 3CCYA 1JTYA 1O3SA 3PO2J 3CDLA 2VL8A 3TKYA 1V5FA 3QOPA 3G4SI 3TW6A 2VKDA 1I5ZA 1HKQA 5JHFA 1D5YA 3CP8A 3VWBA 3DF8A 2RN7A 2K4BA 3E5UA 2L9SA 3H5RA 1W4MA 2EZHA 3HOTA 4YIFA 3ZP5A 1HW1A 2QZ8A 3ABMH 2PX9A 3AKZA 3CJQB 3KZIC 3HYIA 5D8KB 3ZMUA 4N0BA 4EV0A 2Q0OA 3OYHA 3HHHA 4PGHA 5HDNA 4FX0A 2LNBA 4BU2A 1ZN2A 1Z7LA 2DJIA 2XASA 3ZQIA 4XQFA 2CSOA 3LFUA 3JAMK 1ETKA 1ENHA 1W5TA 2BHZA 2RDPA 5J8CA 1EH6A 4Q48A 1B6AA 1YYVA 2EH3A 3KP4A 3I3LA 4J01A 5ILUA 3BG6A 4XKBA 5CQEA 5HDKA 3K4NA 1IN4A 2MH9A 3WHCA 1QRYA 1V4RA 2ID6A 4HNVA 1ZTRA 3KZYA 3E6DA 2JT1A 3M4OJ 2DFHA 3B73A 2UUZA 3E0JB 2HKOA 1MDMA 4CUGA 1XG1A 2BEOA 2JPBA 1WJEA 4C2UA 2NVTJ 3CUQB 3S93A 1HF0A 3TDUC 4OINF 3CP2A 3HZJA 3BR2A 4Y3OA 4QTRA 3MZHA 1I6HJ 5DTDA 1HSTA 5EJCA 3SZPA 3FISA 4I2OA 1E0EA 1FMVA 5JFRA 1TC3C 1W0TA 4E4HA 3KYCB 3VODA 1VQPI 3F8BA 1QNTA 1SFUA 2O8XA 4PUSA 1XC5A 2FEZA 5HNHA 2PJPA 1OLTA 4N9HA 1B9NA 2LKPA 3GTPJ 4N4NB 4CH7A 1R71A 3DEWA 4FX4A 3S8PA 1IXRC 1FBQA 2O0YA 4E7ZA 1ULYA 4XKVA 2VKVA 5H2FC 5LFAA 2XAUA 2Z33A 1D1AA 2WB1N 3FM3A 3WTYC 2KJCA 5B1AH 2WV0A 3H9JA 3S1NJ 2MC3A 3WTUC 3WG7H 2XPWA 4ENNA 4CA0A 4GO1A 3HDDA 4MNUA 2K9MA 5HLHA 4S05A 2ZJPF 2L7MP 1YIOA 2DA1A 1IRXA 2WBMA 4UB8C 4KYWA 2KIQA 2DJNA 2XB5A 3KETA 4KFCA 2DOEA 3QPTA 1ONVA 4UVAA 3S2HJ 3I4MJ 2JA8J 2BY2A 2AO9A 5M5WJ 1U3EM 1VQ5I 1XGMA 2L7ZA 3B6AA 3I58A 5HS7A 4XRSG 1A31A 2HPMA 2M45A 2JRTA 4JQFA 3GZ6A 4JX4A 1GV5A 2DU9A 2VKHA 1DUXC 3GEZA 1MSFC 3W2WA 3I64A 4GGGA 4P5OA 2XB0X 2DODA 2OAZA 3TL4X 2YX7A 1J9IA 1FIAA 1HDPA 4IQ4A 4A0YA 3I0TA 4L0YB 1F43A 2PQ8A 2RVCA 1RUNA 4RM2A 3IP4B 5D5WB 4HYEA 1MJBA 2FMLA 1P7IA 3WG9A 1FOXA 4NQWA 2W82A 4XONA 2VJJA 3QPHA 3F22A 1GHCA 1FBUA 4HQMA 2ZNYA 2IW5A 4IL6C 4U88A 1T0FA 2DT5A 4U7DA 2HOSA 2HOTA 1I3QJ 3D5SC 4M71A 4IKFA 4DZPA 4CO8A 3K4CA 1MBKA 2Y69H 1USSA 1WHUA 2HPIA 3NWSA 3JRCA 2MGQA 4L5JA 4IO9F 1HSJA 3P9CA 3WU1B 3NARA 2VT3A 1X1BA 1YE9A 4I09A 5M5YJ 1BIBA 3JR9A 1ETYA 3SJMA 1QPMA 4ZYHA 5E8IA 3LSPA 4I98B 2IA2A 3QU3A 4WXHA 3R0JA 2EFOA 5F27A 2EILH 2CG4A 4HX8A 4ENMA 2FBHA 2Y48A 2HZTA 1OCPA 2P5KA 2HDWA 4M3GA 1Q1HA 1YX3A 2WAFA 1Z05A 4BACA 1VZ0A 3IRQA 4M73A 2V9VA 3CMMA 1XSXA 4AM3A 1VQMI 1JUMA 2K40A 3VOEA 1STZA 5BPIA 3KP3A 2MA3A 4JP0A 1PUFB 1UHSA 3K1MA 4V19K 4P96A 4YRVA 4ENKA 2HDDA 3IHUA 4DNCA 4ZDOA 2E35A 1ZGAA 3D5LA 3P5JA 4RB1A 3MN2A 3KZZA 3CESA 3TDZC 3FXOA 3H5NA 2E1CA 2W25A 2W4SA 3AL0C 3MD2A 3M8JA 4LD5A 1EV7A 4CYCA 3GYHX 2OF7A 3G6EI 1JHFA 4C2TA 2GWRA 1A36A 2P4WA 3ECHA 4IHSA 4G6DA 2R7UA 4A3DJ 5J4VA 2JQ7A 1U6GA 4AIDA 1BI3A 4W1UA 4E7IA 1T0FC 1UJ8A 4A3GJ 1FJLA 3BOQA 2X0LA 1HW5A 4HRIA 3AG4H 1QZEA 3P9KA 4X1EA 1ERDA 1BR2A 2ZFWA 1V5GA 2HU9A 5D5UB 3IL2A 1IG7A 2H94A 2Q2EB 2MFZA 3VB2A 3ABKH 4JX6A 1V5EA 1YLFA 4YG2F 4MFDA 3ASOH 1PP7U 2BHYA 2K85A 1OKRA 1OCOH 3U2RA 2Y0SN 2DO7A 2EA2A 4DGWB 3K4MA 4XK4A 2KRHA 3F23A 3K10A 2RNGA 5KAIC 1T6SA 2VJ4A 4DOZA 3L2VA 2OTJI 3C1DA 5DV5A 3ZQCA 3OYAA 4A12A 2KIMA 3CUQA 2IGNA 4BUPA 4UUSB 4DBQA 3CMAI 1CF7B 5D4RA 1Y1WJ 2BW3A 1IV8A 4OOIA 3JRFA 4XSXF 1P92A 3JW4A 2YU3A 4CCMA 1BC8C 3GFLA 4WXCA 3CMYA 1JI8A 4AVZA 2NVUB 2YU9J 3MFKA 2DOAA 3NQOA 2LP0A 3GFJA 2BVMA 1W5SA 1CQTA 4DZJA 2JJ7A 2Y0MA 3HUGA 1SFXA 4D7MA 1BC7C 2KT0A 2WB1A 2ECCA 3J81K 2P81A 1BL0A 3GTLJ 2HYJA 3IV5A 3HRSA 3QRFF 3WTWC 5FKLA 3BZKA 3MKYB 5ICEA 3HIFA 1P4WA 3FKIJ 3V7RA 2ISYA 1YITI 4ESFA 2VE9A 5EYRA 2DFFA 4RB0A 3LMMA 4BQNA 2X6OA 4E7KA 5BMZA 3W2AA 2K3FA 3BTJA 4ZYDA 2OZUA 5DEQA 3BJAA 2CMPA 5ILSA 4Q4ZF 1T08B 3AG1H 1ZKGA 1U0JA 2VI6A 4WF2A 4EJVA 3ZPLA 4IOCF 3S17J 1LVAA 1EA3A 1D8KA 2MLKA 5GTHC 1KU7A 2LRDA 3CJRB 2O6GE 5CJ9A 3DBHB 2HNHA 2E5NA 3GO5A 3DP7A 1VQ7I 5IT3A 4HLYA 3B02A 4NNJA 1RUOA 5DDGA 5E1ZB 2A6TA 3ESWB 3HSRA 5J6XA 3V7SA 4BGDA 3S1MJ 4BL0B 5DCMB 4EM0B 2BVLA 2STWA 2LR8A 2V79A 3CUQC 1MBJA 2VT2A 2W57A 1J75A 4O6JA 4KJZA 2JRMA 2R3SA 3E6BA 2GM4A 2WA0A 1H0MA 3WU2C 2X1DA 4UV9A 3SEZA 1ETVA 1RKWA 2IS4A 3LQRA 3HGYA 1BM9A 1Y56A 1X4OA 3L2UA 1BI2A 4L9JA 3DTIA 2XPVA 2ELJA 1T38A 5DUIA 4CHUA 1FC3A 3G3ZA 2D2WA 1GUUA 4R1HA 4CCKA 1N77A 4ZDLA 5C4JJ 1F1ZA 3ZCOA 1MMGA 4YFKF 3UKGA 1HKSA 5LEJA 3KLNA 4UVCA 3LQQA 5GAEJ 5J4YA 3ECOA 1SAXA 2M1BA 1YFHA 5GPCA 3KLOA 4BHBA 1BW6A 1Z6TA 2GXGA 1X1PA 3CO7C 2CW8A 4PCQA 5K1YA 2DPDA 4LLLA 1S6LA 1UZCA 4LG3A 4RS8A 2VXZA 2F4IA 2QF7A 4B1RA 1DGWY 3SHFA 4XRSA 2E34A 5ED4A 2VIXA 3IWFA 4GFBA 3PIPF 1OYIA 1G2HA 2VODA 2LMDA 2X51A 4Y13A 4B44A 1IN6A 3JRAA 2V1XA 1TWFJ 2NXNB 4M9ZA 4OMZA 1YRNA 2VJ5A 3WE3A 2GAUA 4WX9A 4A3EJ 5LHIA 3RSNA 2ISZA 1VF9A 1R49A 4LK0F 2W24A 4CSWA 3CMEI 5JR3A 3IUOA 3REOA 2VC0A 4BBRJ 1K79A 5IT9Z 4AU7A 3QP5A 3K1NA 4Q5SF 1ZR2A 3NRVA 3SFIA 2LYCA 3T8RA 2O7OA 3I5UA 2E1OA 1K4TA 1WZ2A 2A05A 5FO5A 4CCOA 2E7XA 3RKWA 4RAGA 1G3WA 5JHUA 2G7UA 3RKXA 2G0EA 5BQTA 2XGXA 1WJ5A 3ULQB 2X85A 3RPUD 3OR1C 1ON2A 1P4XA 3OSFA 2CFXA 3BROA 3ZRGA 2CUJA 1UFMA 3AG2H 1RESA 4NC7A 2J5PA 4DW6A 4KITB 3CLQA 3ZMSA 3E5XA 3EUKL 4I01A 4DYCA 5B5EC 5L3EA 3T5XA 2ELHA 4XIDA 4G9YA 2Q2EA 5E1XA 5KVRA 2Y0SA 3P9IA 2Y30A 4AWXB 2HQRA 4ZZLA 3ERMA 4M6YA 4ON0A 4A3KJ 4WK8F 4XKCA 1IRFA 5TJJA 2VBWA 4DIQA 3ZN0A 2Y31A 4IHYA 2L3DA 4KN4X 3PQJA 1KU2A 5FLMJ 1FYLA 2VQLA 5HLIA 3TGNA 3VEPA 5IT9K 1QHHD 4UUSA 1ZGWA 5AIPA 4XMYA 4XLAA 4JBAA 1CF7A 3HHGA 2W48A 1K78B 4IF4A 1P2FA 3DTEA 2ZMEB 1WQ2A 1X58A 4Y17A 3S16J 2Y9ZA 1BBYA 3HGGA 2KDOA 3O3KA 4BBSJ 1IXCA 2IAIA 4YIIA 3PM1A 5KHDA 3TEDA 4HDUA 1WWXA 1YJWI 4MTDA 1YI2I 4HOBA 3CC2I 1WGXA 3HPGA 1XSVA 4KT6A 2H09A 3MKZA 1LFUP 4II2A 3VYRB 3OYLA 5BNGA 4J19A 4XORA 3MZ8A 2CRGA 4QIWN 1GLNA 4RLQA 5F04A 2K86A 3WGIA 2WV1A 2DYRH 2L9RA 2XF5A 4BQQA 3HKZN 3DV8A 1TZLA 3HPHA 4NC6A 3R4KA 1MBGA 1XMKA 3ABTA 5D5VB 1EJ9A 1FNNA 1XGSA 4KMFA 3FIWA 1XTAA 1DQUA 3MVPA 3OYMA 2DA6A 2QQ9A 4CCJA 3OY9A 1TW2A 3OYCA 2WAQN 2KZGA 2VPRA 3J80Z 2V1DA 1MBEA 2NS8A 3F8FA 2XC7A 3COAC 3ML6A 3OL4A 3ISPA 1TWAJ 1GXPA 1O3RA 1IW7F 4UNOA 4AC0A 3Q0UA 2E71A 1I1SA 3S14J 1LVKA 4YELA 4RAZA 2CUFA 5DCMA 3CCUI 4P9UA 5HOOA 2R7DA 2IXSA 1DU6A 2XGEA 5CLSA 4CZZA 1FOYA 2RREA 3GTKJ 4I02A 1X2MA 2XAFA 1NG6A 3FWEA 4YIRX 5HNFA 5F64A 2Y2ZA 4KISA 3LFKA 2V1UA 5LGNA 3CF5F 1YO5C 3BJ6A 2M34A 4FASD 3WTZA 2ELKA 2G9WA 3BR5A 2HR3A 5F1RA 4RGSA 4EATA 1REPC 2P5VA 5F6FA 2XIGA 3GWZA 3T8TA 2K9NA 3HRUA 3S1RJ 2ESHA 4ZH4F 4HV6A 4IPAA 3K6GA 5D6EA 2BY0A 1TBXA 1GV2A 3F0CA 1H9TA 1G59A 3J80K 2ZSHB 3IH4A 3LWFA 3E3VA 3H3UA 3HXLA 5ERIA 3JRBA 3FMRA 2DI3A 5C4XJ 3OYNA 3RYRA 4FISA 1T8IA 2DMTA 1N78A 4HDVA 3NWTA 4FE7A 4N4OB 2EWNA 2DXIA 1F9NA 3UNGC 1U9OA 3LL7A 1RC9A 3WU0A 5F0CA 4CYCB 2M7AA 3E7LA 4MO7A 4PSWA 2NAZA 3DPTA 2Z3YA 5EF6A 2Z5UA 1RPWA 3R61A 2VN2A 4BJ5C 1RI7A 4EMSA 4ZTFA 4ESJA 3CCJI 3G73A 3BT9A 3HOUJ 3BQZA 3HB9A 4C2MJ 5HS9A 4IHTA 3IKTA 1D0ZA 4A93J 2KRCA 2VE8A 3S1QJ 1R5ID 1MZBA 2EB7A 4Q47A 4M6XA 3H92A 2QQ8A 3RDIA 4EVIA 3MWMA 2FXAA 3EUAA 2CUZA 3ABLH 2LD5A 2M5WA 2EFQA 2ICWG 2M4GA 4G12A 1DPUA 2QUFA 1B8IA 1EKEA 3KEOA 1MGTA 1A5JA 1I1GA 4MQVA 1VQ4I 4BJ6C 1O7LA 3OIOA 3HSFA 5DM7F 1HXDA 4Y33A 4JK1X 1V54H 3KIOA 1AKHB 1U8BA 2E2IJ 4BH9A 2F6CA 4NUBA 3LA3A 1HBXG 3MQ0A 2NS7A 3OYKA 3BTIA 1PUEE 1LB2A 4I76A 1RETA 1YW9A 1ZG1A 2OUMA 4LFUA 2CQNA 5DD8A 4R8HA 4ZZDA 4S04A 1U8RA 3EQLF 1JT0A 2A69F 1R1TA 2EIMH 2BW3B 1BOAA 4XOTA 1EF4A 1MNDA 2B7EA 2FSWA 1I39A 3O2PE 4HSRA 5LLQA 2VONA 5IOZA 2OQRA 1SMYF 4YEJA 2X1CA 4LIUA 2QKLB 2EFNA 2BY1A 4BXUA 3CDIA 4C9YA 3VSKA 2GQQA 1SMTA 1FYKA 1V3FA 3MCZA 3HUGB 2XKPA 3K4LA 2FBKA 1BJZA 4PJNA 4RM3A 4HNTA 2LDUA 2CGPA 2C6YA 1K78A 1Z1DA 2BBYA 2CQ7A 2ZMEA 4ZJZA 2WWYA 4BE1A 5GAHJ 1ZR4A 1VQNI 1XGOA 2H6CA 1J5YA 3A2KA 2X4HA 2HQ5A 4PZJA 5B1BH 1IUYA 4Y7NJ 4G6TB 1JKQC 2K9QA 3CJNA 3FXQA 1UHWA 2XRLA 1POGA 3JREA 1O3TA 1BR4A 2CW7A 3CC4I 1HC8A 2VOPA 2O8KA 2DLLA 4ZYEA 1LJ9A 2OD5A 4HF0A 4IHVA 1XCVA 2R4GA 2FX0A 5CQGA 4BQOA 5E8GA 1GVJA 2EIKH 2W85A 3QYEA 4KNYA 1E17A 3DKXA 2XAJA 1ZG3A 3HKZA 3ZQLA 1JT6A 1U2WA 3FZVA 3SYTA 1GVDA 3H0GJ 3CCRI 3WHBA 2R7FA 1IDYA 1MH4A 3TO9A 2VBYA 2GA1A 2AS5F 3HOZJ 3LA7A 2OJED 2K5CA 2LG4A 3S32A 2DTRA 4E7HA 2EFPA 2WAQA 1R22A 4A3BJ 4F55A 3W6JB 5TGTA 1ORKA 4EM2A 3CCSI 2VB6A 5FRNA 1QQIA 1WH5A 3OV8A 3RTRA 2WAEA 5BOXA 1LFPA 1XCBA 4TV7A 1WI3A 4F93B 3Q9VA 3HOSA 2H8RA 2EJRA 1TNSA 2XAQA 2HGCA 1P6RA 1X3ZB 4OIPF 5DCFA 2HTJA 1K83J 2ZNZA 3HOXJ 5J1RA 4P1WA 4V2GA 3FBIB 3GW2A 4L9VA 5IP9J 2RC4A 4FT8A 4Z6YA 1R36A 3DCFA 4M3BA 5JVTA 1XMAA 3BG7A 3W6KB 2GXAA 3FK6A 4J00A 2ZMEC 4F91B 1IRGA 2M87A 4MHGA 2JWTA 4D5CA 3Q5FA 1DDNA 1HA8A 4EJWA 4G94A 5FFZA 2JA2A 2OTLI 3FBNB 2DMUA 2R7QA 2HQNA 2ETHA 1XX5A 2OZ6A 1IZ1A 5D5XB 1EH7A 3FDYA 3OL3A 1NTCA 2VXDA 5H6RA 1YRNB 3EYIA 4LLNA 2IGKA 2PEXA 2QSGX 1TQIA 2DK5A 3CCMI 1G3SA 3B6CA 4XR6A 3PNYA 1H88C 2ZXHA 3DXJF 1F4KA 2R7ZJ 1WJFA 1D8JA 4A3JJ 2KISA 5B3SH 1DU0A 3HC7A 4CCLA 3SDGA 2JUCA 1MNEA 1R5HA 3M1CA 1JHHA 1FOWA 4M74A 4K2EA 2KZVA 3P7NA 4XBFA 2DK8A 3GXOA 2WY7Q 5LEKA 5JVGF 3OOPA 1W36C 1UAAA 2JA6J 2XKOA 4DJAA 2DYSH 1QBJA 1KA8A 1USTA 2FUG2 2EV6A 4LLGF 3J7ZI 3ZR8X 4RB2C 4BEHB 2CV1A 1DGRM 2QVOA 3GTMJ 1Z67A 3HG9A 1R6RA 3HTUA 4A3FJ 4U0WA 3ZQ7A 1FEXA 3MZYA 2NYXA 1RKTA 2VBZA 3BPVA 5LHGA 1MMAA 1Y8RB 4U7BA 4HF1A 4OWRB 1IXSB 3PO3J 1ETWA 5K7ZA 1G4DA 1AKHA 2GXBA 4C30A 2Y9YA 3BG3A 1JTXA 2QBYA 1V55H 2Z16A 3ZOBA 5J40A 1G3YA 1UELB 2VQGA 5ILVA 2E1NA 5ICFA 1XPXA 1RZ4A 3J7AY 4MEYF 2LVSA 3IRRA 3OOUA 3CJTB 3V42A 3BR3A 3O8HA 1XMXA 3DEEA 2H8WA 4AUXA 2A6HF 3SXYA 4QLCU 3E6MA 2L7KA 5GTIC 1JKRC 2KPMA 2R7VA 4OMYA 4FETA 3EYYA 1SD6A 2XVCA 2EQRA 2VQCA 3GFMA 2EA4A 3M7GA 1HCRA 2CU7A 3LSHA 3QODA 4B4CA 3WTTC 3DQVC 1SAUA 4L5EA 1RNLA 1T98A 5K7FA 3DBLB 4GDFA 4UUTA 4C3HJ 4PFOA 3FHZA 3C3WA 2KJBA 3ZGKA 4EJUA 2CO5A 1VTNC 2A07F 1JGSA 3IH2A 1P7JA 2L2OA 1LE8A 2MG4A 1OYYA 2A6EF 1RR7A 2RKHA 3F8NA 1L0OC 2VKEA 3C18A 4BE0A 1X3UA 2MLGA 2NOGA 3OYJA 4IHWA 1R4MB 2VLAA 5CYVA 3M8EA 2E60A 3RKQA 1FSHA 4OIQF 3CLOA 4MEXF 2V6EA 3VYSB 4I7HA 1FMWA 1XD7A 4Y4RA 4XN3A 1J2XA 1XGNA 2A68F 4KT5C 2QENA 1S9HA 3L2CA 1BI0A 1Y1VJ 5L3DA 2AXLA 4HX4A 5E79C 1ZYRF 2FBIA 3M9AA 2Q1ZB 4BE2A 2R7TA 3F8CA 5ICCA 2DA4A 4AYBN 3FHNA 2DA7A 1IF1A 1L3LA 2OPTA 3JSOA 5AONA 2D1VA 1ZELA 4WXDA 5D4SA 3CCVI 4WCGA 4B48A 4AIKA 4BY1J 2V6CA 2HZDA 1B1BA 2ZO4A 3C2GA 4XRMA 4M3DA 4M3FA 2MW8A 3MAJA 3GFIA 4DYRA 1R9TJ 2PMHA 1ZRDA 1BOBA 2P7VB 3SQNA 2I10A 5HLTA 2UZKA 3PSIA 2COMA 3VYTB 3K9TA 3MKLA 1TWHJ 4LK1F 3G71I 2F5DA 3KEQA 1KYWA 1D0XA 5CPRB 5EZHA 4ASNA 2OQGA 5E3NA 1KGSA 2ESNA 3R0AA 2XHKA 4EJOA 2HQAA 3BTLA 3HEFA 3DTKA 3JRHA 5E3LA 2OC6A 1TQMA 4BKXA 1A04A 3RQIA 1JJ6C 3KEYA 1O57A 2HTSA 3PUFA 2JVHA 4NDLA 2F5FA 2DDBA 2KKOA 2A3SA 4A6DA 5FJ8J 2NVXJ 2JK3A 3RZDJ 2IBDA 2IRFG 4IZZA 3I9V2 4PJ0C 3JRIA 4M9XA 4IOAF 2QSFX 5LRSA 1E3OC 2CW0F 1SANA 2VPLA 3RYPA 3K4KA 2LY2A 4IRGA 2HVSA 2E36A 4XRFA 3VSLA 4IVNA 1W1WE 2QYOA 3Q3SA 1B4AA 4BXFA 1JKPC 2K9LA 2L9NA 5FKKA 3FKJA 4CDGA 1BN5A 1IO2A 4U0VA 5J1YA 2QCOA 1D5VA 4N9IA 3F21A 4IX7A 3PL8A 3MMYB 2ZKZA 5FRMA 3TMOA 1JXSA 3JSPA 1J59A 3TOBA 4XKWA 2BE5F 1T2KA 2CWEA 3LSKA 4QPQA 1NK3P 1B8IB 5IP7J 3S3NA 1H9GA 2V7FA 2K02A 1MD0A 3BDDA 3LSIA 2JSPA 3OYEA 2VQHA 1NHAA 4A3IJ 1FLIA 4E7SA 5J1UA 3WGHA 3OS0A 3ZMTA 2L0KA 2K9SA 2PG4A 2GOMA 2XROA 5D8LB 5IYBJ 2F4OB 2QQBA 4BEHA 1ZLKA 4KIFA 4KN7X 3I53A 3A03A 2EV0A 4PJMA 3I4NJ 3A0BC 3R6SA 3H9QA 2X6YA 3PJRA 2CQQA 1TLHB 1BJAA 5BPDA 3CZ6A 2DN0A 2XF6A 5C3EJ 4UB6C 3I56I 1LNWA 3LNQA 4XN0A 3HBLA 4A3CJ 1K4SA 3DU5A 3J7AO 4B47A 1HQCA 1FTTA 2K4JA 3DWLE 2TRTA 1Z6RA 4EGZA 1VQLI 2BV6A 2MYSA 4NC8A 5LHHA 3M8FA 1FP1D 1Y6IA 4AVPA 1MIJA 4XLHA 2JVGA 3M07A 2E5ZA 5GADJ 2L7FP 2X48A 1QO0D 1SFOJ 4A5NA 4KICA 1FIPA 2EZLA 2QM3A 3BZ6A 3W2VA 5HODA 3QWLA 5FLXZ 3JRDA 2EV5A 4OIOF 2F5VA 5F0FA 2MD5A 1ZQ3P 3BC8A 3K70C 2Z99A 2F5EA 1A35A 5D6FA 3OYIA 5TISC 1MMSA 2PI0A 2HKXA 2YR2A 5EEAA 2FQ3A 4LIVA 1X1CA 1XDSA 1YW7A 3I59B 3F8MA 1QGPA 2DTZA 4EEFG 5FKNA 2IJLA 3BCAA 3N05A 3O8GA 4DYQA 1TL8A 1ON1A 2L4MA 4HZFA 2P5LC 1X4PA 4BS9A 1LDDA 2L4AA 1M1EB 2P6TA 3FXRA 5EGOB 1QZYA 1JKOC 1SEUA 1S72I 2LREA 2KIUA 4HX7A 3D1NI 2A5WA 3MEXA 1I3AA 2XF7A 4KMUX 1AWCA 1BW5A 2ZFUA 4EGYA 1ZARA 3RPQA 4LMYA 2HDCA 3IWZA 5IP6A 5DM6F 1X1DA 1I6XA 1MBFA 2DOFA 4MLOA 1RR8C 3GCMA 3PIOF 4GYGA 2F5CA 1W0UA 2QLZA 5FGMA 4ZC3A 1QVUA 2IVMA 2M7BA 4BY7J 1WJAA 4AYBA 1IV6A 1IGNA 4PJLA 2H1LA 3K2ZA 5EG0B 4B8XA 2H1KA 1QHGA 5FLXK 1ZLJA 2DA2A 1KQ0A 1VNDA 3BJOA 2A5YB 2QSHX 1OQYA 3RJPA 1U5TA 3BCBA 1VQOI 1G8XA 4RA2A 3W6VA 2ACJA 1FP2A 4ZTJA 2O61A 2R5YA 1D1CA 1Q1VA 4XL9A 3H5AA 4M6VA 1H89C 3GX4X 4E7JA 5E20A 3GMEA 3HM5A 2LF8A 2X6XA 5FD6A 1OPCA 4HLXA 2W84A 3I4PA 3KE2A 3IC7A 5FB2A 2EBIA 2EIJH 2KIFA 2FNAA 3TP0A 2GIZA 3JCUC 1K61A 1J09A 2RQPA 2CS3A 2XAHA 2OV7A 1MSEC 1IC8A 3I54A 4BAYA 1FOKA 4UXNA 3KPHA 4Y15A 2CUEA 2FE3A 1QPIA 3RKYA 3HL2A 2CQXA 4I6ZA 2RV8A 3M1EA 2BZTA 1TWCJ 4HQEA 3H3VK 2HFHA 1ZH5A 5CVRA 3KP6A 3JAMZ 1Y39A 4O3MA 1OISA 4B3XA 3L9FA 5GP9A 4IJAA 5JLXA 2G7HA 3T1BA 4P9FA 3DU6A 3FMQA 3AAFA 4IEJA 4BXXJ 3O6BB 2EINH 2DW4A 1W7PA 4XM3A 2R92J 3L2RA 4KIGA 1R4NB 3HRTA 2K3PA 3DEUA 3KYDB 4AIJA 5HLGA 1OCCH 3HRMA 1KZHA 2M3AA 1A6IA 2DBBA 2PMUA 3Q0VA 5KK1A 1U78A 2VASA 3R60A 4ETSA 4XLEA 3AG3H 1OCRH 2PLYA 2O9LA 2XDVA 3L09A 1ZHFA 1ETXA 4H0EA 1HKTA 3GZNB 3PNVA 2M9HA 2ZJRF 3BG9A 3NEUA 5H20A 4BNCA 1U5TC 1Z91A 4B09A 1R58A 4KUMA 3BPXA 5E17F 3ROUA 2DT7B 5J3LA 3GUDA 1WJBA 2DFIA 3CDHA 1H8AC 4A5MA 4FHTA 4UHTA 4G7HF 2XPUA 1G3TA 1SVLA 3ZQGA 2UV1A 1ETOA 3KCCA 3TP3A 4FTHA 4PDKA 1IN8A 3HOWJ 1SD4A 2JUGA 1WRJA 4BHCA 3CCLI 2LY9A 5IY5H 4D1QA 1NG7A 2OBPA 2QBYB 2M30A 5EEGA 5IOYA 3ELKA 5HDGA 4BHPA 1TT5B 1HDDC 1PVEA 1B9MA 1S29A 3CTAA 3DLLF 5FD5A 3FXLA 2ZSIB 3CCQI 2DMPA 4UV8A 4MTEA 3RCOA 5BS6A 3BR6A 3U21A 4HG2A 3V7CA 4FE4A 4C3JJ 4PK4A 1LEAA 4ABZA 2JSCA 4X6AJ 1LQ1A 2ME6A 1YTYA 1FSEA 4RB3C 3CQZJ 2D1HA 2LBFB 5FKMA 2WADA 3S15J 1LUJB 5F1JA 1XB4A 1TTYA 3LSJA 5AIQA 4A2UA 4AIHA 3FM5A 3FXKA 1QA6A 2FA5A 4LB6B 1QZZA 2ECBA 2P8TA 2ZXWH 1MBHA 3OIQA 4RAYA 2IPQX 4CICA 4IRHA 2E2JJ 2OCCH 2CV0A 4A3MJ 1LE8B 3OMYA 3C7JA 4XLFA 3E97A 2X1EA 1JUPA 1B72A 1T33A 1YX5A 2XGDA 1YS6A 3K4BA 1Z3YA 3X2QH 1IRZA 3S3MA 2ZJ2A 2FU4A 1YJNI 2GLOA 3I59A 4E7LA 4S0HB 3CF2A 3GVAA 4FCYA 1KQ8A 3QOEA 3TOAA 3OYDA 1O3QA 5GPAA 4RGRA 3BY6A 2M8GX 3FXMA 2V9PA 5EGOA 1OMIA 2LY1A 2RQQA 2AQFA 4XICA 4KA4A 3OR2C 4O5VA 3ZXSA 1UG2A 3KX2A 1OCZH 2KP6A 3TW7A 5CVIA 1XS9A 2LF7A 1X1AA 4EM1A 4A0XA 3KP5A 3OS1A 1W5CC 4I99C 1TP4A 1B59A 4BDZA 4CXFA 3GZ5A 2GOXB 3A02A 3FXJA 2IS1A 3GTGJ 1PYVA 1G6NA 2R7SA 3E6CC 4I0AA 2LTPA 3EUHA 3BZCA 2Z2SB 4EQQA 5EG0A 3EETA 2V26A 2DMNA 2H6BA 2GIVA 4I0BA 1HLVA 1K6OA 1F5TA 3F6OA 5L3CA 2B9SA 1Y0UA 3H0DA 5LBQA 2VUMJ 2F2EA 2L9VA 2JN6A 3ZQHA 1Y0NA 4ANJA 2HVRA 5FLVA 2LH9A 4HBLA 1Z7UA 2ZCWA 6PAXA 3LSRA 3SZGA 1JJ8C 2LFBA 4E6KG 2OCEA 2QQAA 3RIRA 2VOOA 4GCVA 4V2FA 4QSHA 2HOEA 3TBIA 4LITA 4JX5A 1S7OA 5L3BA 2DT6A 1KU9A 3FXUA 3OIPA 4RDUA 3GLXA 1U9NA 3HSEA 3SFZA 2L02A 1P4AA
chains in the Genus database with same CATH topology
2HYGD 4L5IA 4LG0A 2Z9OA 1JE8A 3WE2A 1BI1A 4UUVA 2NNYA 4CYDA 2L01A 4LB5A 4L9TA 5DD4A 1C0WA 2PBIA 2NRAC 5J8FA 2VBXA 2Y75A 1AOYA 3Q9SA 2JTVA 2GZWA 2B0LA 4G7OF 1LDJA 5L3GA 1FBSA 2STTA 1LEBA 4RGUA 1ZRCA 2UXNA 3N97A 3ABUA 3T0YA 2PN6A 4EJTA 3J81Z 1R7JA 1PP8F 2NS0A 2UWMA 1YW8A 2FF4A 1RIOH 2MH2A 1S7AA 4YFXF 2LSOA 4A6EA 4MGRA 3U9GA 3FX3A 1IAWA 2BGCA 1PDNC 2EK5A 1SD7A 3LAJA 1ZRFA 1UHMA 3FMSA 3SZTA 3K69A 4XLNF 5LGTA 2VC1A 2HS5A 5H6QA 4MQ9F 2O3FA 1WSUA 2FOKA 4G7ZF 4A0ZA 2YPRA 2HEOA 4LGWA 1WKMA 3EDPA 2MBFA 2O03A 2P7CB 3JTHA 2FMYA 2FNPA 3GF2A 4LJZF 2DPUA 2RGVA 1ZG5A 3I71A 1KQ9A 3K0LA 4R79A 3PFIA 1WI9A 3FF5A 4XLPF 1XSDA 1KYZA 1ODDA 1CGPA 2M8EA 2IA1A 2H27A 3QAHA 1U5TB 4GXOA 1ZGJA 3KFWX 5LGUA 1FPQA 1FWZA 3WTSC 1OR7A 3BWGA 2XUBA 4M72A 3L00A 2DQRA 1YS7A 1FY7A 2J5OA 4G8XA 2HWVA 3ZN1A 5E1WA 3L7WA 3V4GA 1ZREA 4L9NA 5E18F 3H3ZA 5K5QA 2ZBKA 1FT9A 4E70A 4DQ2A 1W7PB 3TO7A 2WC2A 3F3XA 2IT0A 5CVUA 5DYMA 2FRHA 2GA2A 1MKMA 1J0RA 5EEHA 3DKWA 3V8LA 1LDKB 2PFBA 3KP2A 4BYYA 3TO6A 5L3FA 3TQNA 3E5QA 1FX7A 1Z9CA 2JPCA 3QP6A 2UXXA 4YFNF 4HW0A 2NNNA 2OA4A 2KRFA 1IN7A 2IP2A 5DUKA 4OIRF 3KP7A 1XN7A 4CGZA 1OYWA 1R5GA 1KU3A 5CVJA 3BP8A 3HTSB 3WTVC 1SD5A 4QWQA 4G6QA 5K5RA 4D0PA 4ESBA 1TQPA 3WTXC 2XRNA 4BQAA 4HF2A 3QU6A 2WTEA 2YSRA 3ZMDA 4XSZF 1TW3A 2EFWA 1UB9A 4NHJA 4KDPA 2CQKA 1UCRA 1W7PD 4P55A 4M9SA 1R1UA 2P6SA 1T39A 5ICGA 1MDMB 4NB5A 1YG2A 4AD9A 5HVQC 1E2XA 4KIBA 1O7FA 4F7ZA 3ZMVA 2HYFA 1IN5A 5JI6A 1MJ9A 4IRIA 1S8NA 4U0YA 1DP7P 4PGGA 3D0SA 2QWWA 3S2WA 1FZPB 4IXAA 2L54A 2A61A 1SFEA 1EH8A 2OU2A 1GXQA 2IA0A 3CO6C 3DFGA 3IKVA 1BIAA 1DPRA 2D45A 3LAPA 3LSTA 4ENJA 4HV5A 1S3JA 4HA8A 1J7KA 2JZYA 5A2QZ 1YQAA 1R00A 4WWCA 2K7LA 3WGGA 4GYIA 5LRRA 4L18B 3LA2A 2E7WA 4ZYGA 2ADUA 1XDUA 2TDXA 3WODF 2K27A 5FFXA 2DQLA 2BYVE 3PQKA 1ZAOA 1D3YA 3F6VA 1R23A 5CVVA 2Q8KA 3CUOA 3F72A 3V8KA 3DPLC 1K7AA 1I27A 2DAOA 5K5OA 3V8JA 3U1DA 3VFZA 3ZMZA 2ZXJA 1TNTA 2YX4A 4OU0A 3RI4A 2XV4S 1R1VA 4LG0B 4HAMA 1MJAA 3K1PA 5A2QK 4UVBA 1HW2A 3JTGA 3ERED 4Z2YA 1FYMA 2CYYA 4RGXA 2XAGA 3N4MA 4L0ZB 3RPUA 5HS8A 2RNJA 1O3SA 3TKYA 3QOPA 1I5ZA 1HKQA 3DF8A 2RN7A 2K4BA 3E5UA 1W4MA 3HOTA 4YIFA 3ZP5A 1HW1A 2QZ8A 3HYIA 5D8KB 3ZMUA 4N0BA 4EV0A 2Q0OA 3HHHA 4PGHA 5HDNA 4FX0A 2LNBA 1ZN2A 2XASA 2CSOA 3JAMK 1W5TA 2RDPA 5J8CA 1EH6A 4Q48A 1B6AA 1YYVA 3KP4A 5ILUA 5HDKA 1IN4A 2MH9A 1V4RA 3KZYA 3E6DA 2JT1A 3B73A 2HKOA 1MDMA 2BEOA 2JPBA 3CUQB 3TDUC 4OINF 3MZHA 1HSTA 3SZPA 4I2OA 5JFRA 3VODA 3F8BA 1QNTA 1SFUA 2O8XA 2FEZA 2PJPA 4N9HA 1B9NA 2LKPA 4FX4A 1IXRC 1FBQA 2O0YA 1ULYA 2Z33A 3FM3A 3WTYC 2KJCA 2WV0A 2MC3A 3WTUC 4ENNA 4GO1A 4MNUA 5HLHA 4S05A 1YIOA 4KYWA 3KETA 4KFCA 3QPTA 1ONVA 4UVAA 1U3EM 1XGMA 3I58A 5HS7A 2M45A 2JRTA 4JQFA 3GZ6A 1DUXC 2DU9A 3GEZA 3I64A 4GGGA 4P5OA 2OAZA 2YX7A 1J9IA 4A0YA 3I0TA 4L0YB 2PQ8A 2RVCA 1RUNA 5D5WB 4HYEA 1MJBA 2FMLA 3WG9A 4NQWA 3QPHA 3F22A 1GHCA 1FBUA 4HQMA 2ZNYA 2IW5A 4U88A 4U7DA 1T0FA 2DT5A 4M71A 4CO8A 1USSA 4L5JA 1HSJA 3P9CA 3WU1B 2VT3A 4I09A 1BIBA 1QPMA 4ZYHA 5E8IA 4I98B 2IA2A 3QU3A 4WXHA 3R0JA 2EFOA 2CG4A 4HX8A 4ENMA 2FBHA 2Y48A 2HZTA 2P5KA 1Q1HA 1Z05A 3IRQA 4M73A 2V9VA 1XSXA 3VOEA 1STZA 5BPIA 3KP3A 2MA3A 3K1MA 4P96A 4ENKA 3IHUA 4DNCA 1ZGAA 3D5LA 4RB1A 3KZZA 3TDZC 2E1CA 2W25A 4LD5A 1EV7A 3GYHX 1JHFA 2GWRA 2P4WA 3ECHA 4IHSA 4G6DA 1U6GA 1BI3A 3BOQA 2X0LA 1HW5A 3P9KA 2ZFWA 5D5UB 3IL2A 2H94A 3VB2A 4YG2F 1YLFA 1PP7U 1OKRA 3U2RA 2DO7A 2EA2A 3F23A 1T6SA 3C1DA 5DV5A 4A12A 2KIMA 3CUQA 1CF7B 5D4RA 4OOIA 4XSXF 1P92A 3JW4A 2YU3A 1BC8C 3GFLA 4WXCA 3MFKA 3NQOA 3GFJA 1W5SA 2Y0MA 3HUGA 1SFXA 1BC7C 3J81K 3QRFF 3HRSA 3WTWC 5ICEA 3HIFA 1P4WA 3V7RA 2ISYA 4ESFA 2VE9A 4RB0A 5BMZA 4ZYDA 2OZUA 5DEQA 3BJAA 5ILSA 4Q4ZF 4EJVA 4WF2A 3ZPLA 1LVAA 1D8KA 2MLKA 1KU7A 2O6GE 5CJ9A 3GO5A 3DP7A 5IT3A 4HLYA 3B02A 1RUOA 5DDGA 5E1ZB 3HSRA 5J6XA 3V7SA 5DCMB 4EM0B 2STWA 2V79A 3CUQC 2W57A 2VT2A 1J75A 4O6JA 2R3SA 3E6BA 1H0MA 4UV9A 3LQRA 1BM9A 1BI2A 4L9JA 1T38A 5DUIA 4CHUA 1FC3A 3G3ZA 2D2WA 4R1HA 1F1ZA 4YFKF 1HKSA 5LEJA 3KLNA 4UVCA 3LQQA 3ECOA 1SAXA 2M1BA 1YFHA 3KLOA 4BHBA 1Z6TA 2GXGA 3CO7C 4PCQA 5K1YA 2DPDA 4LLLA 1S6LA 4RS8A 2VXZA 3SHFA 5ED4A 3IWFA 1OYIA 2VODA 4Y13A 1IN6A 2V1XA 4M9ZA 4OMZA 3WE3A 2GAUA 4WX9A 5LHIA 2ISZA 4LK0F 2W24A 5JR3A 3REOA 2VC0A 1K79A 5IT9Z 3QP5A 3K1NA 4Q5SF 3NRVA 3T8RA 3I5UA 5FO5A 2E7XA 3RKWA 1G3WA 5JHUA 2G7UA 3RKXA 5BQTA 2XGXA 3ULQB 1ON2A 1P4XA 2CFXA 3BROA 1UFMA 2J5PA 3ZMSA 3E5XA 4I01A 5L3EA 3T5XA 2ELHA 4G9YA 2Q2EA 5E1XA 5KVRA 3P9IA 4AWXB 2HQRA 4ZZLA 4M6YA 4ON0A 4WK8F 1IRFA 5TJJA 2VBWA 3ZN0A 2L3DA 4KN4X 3PQJA 1KU2A 1FYLA 5HLIA 3TGNA 3VEPA 5IT9K 5AIPA 1CF7A 4JBAA 3HHGA 1K78B 4IF4A 1P2FA 2ZMEB 1WQ2A 4Y17A 1BBYA 3O3KA 1IXCA 4YIIA 4HDUA 1WWXA 4MTDA 4HOBA 1XSVA 2H09A 2K86A 3WGIA 3DV8A 3R4KA 1XMKA 3ABTA 5D5VB 1FNNA 1XGSA 4KMFA 2QQ9A 1TW2A 3J80Z 2V1DA 3F8FA 3COAC 3ML6A 3ISPA 1GXPA 1O3RA 1IW7F 4UNOA 1I1SA 4RAZA 5DCMA 4P9UA 5HOOA 2R7DA 5CLSA 4CZZA 4I02A 2XAFA 3FWEA 5F64A 3LFKA 2V1UA 5LGNA 1YO5C 3BJ6A 3WTZA 2G9WA 2HR3A 5F1RA 4RGSA 1REPC 2P5VA 5F6FA 2XIGA 3GWZA 3T8TA 3HRUA 2ESHA 4ZH4F 4HV6A 4IPAA 5D6EA 1TBXA 1H9TA 3J80K 3LWFA 3E3VA 3H3UA 5ERIA 3FMRA 2DI3A 3RYRA 4HDVA 2EWNA 1F9NA 3WU0A 2NAZA 3DPTA 2Z3YA 2Z5UA 3R61A 2VN2A 1RI7A 4EMSA 4ESJA 3G73A 5HS9A 4IHTA 3IKTA 2VE8A 2EB7A 1MZBA 4Q47A 4M6XA 3H92A 3RDIA 4EVIA 3MWMA 2FXAA 2M5WA 2EFQA 1DPUA 2QUFA 3KEOA 1MGTA 1I1GA 4MQVA 1O7LA 3HSFA 1HXDA 4JK1X 4BH9A 3LA3A 1HBXG 3MQ0A 1PUEE 1LB2A 1YW9A 1ZG1A 4LFUA 5DD8A 4R8HA 4ZZDA 4S04A 1U8RA 3EQLF 2A69F 1R1TA 1BOAA 2FSWA 3O2PE 5LLQA 2VONA 2OQRA 1SMYF 2EFNA 4BXUA 2GQQA 1SMTA 1FYKA 1V3FA 3MCZA 2XKPA 2FBKA 2LDUA 2CGPA 2C6YA 1K78A 1Z1DA 2BBYA 2ZMEA 2WWYA 1XGOA 2H6CA 1J5YA 2X4HA 4PZJA 1IUYA 3CJNA 3FXQA 1UHWA 1O3TA 2VOPA 2DLLA 4ZYEA 1LJ9A 2OD5A 4HF0A 1XCVA 5E8GA 1GVJA 2W85A 4KNYA 1E17A 2XAJA 1ZG3A 1U2WA 3FZVA 2R7FA 3TO9A 2VBYA 2GA1A 2AS5F 3LA7A 2DTRA 2EFPA 1R22A 3W6JB 4EM2A 1QQIA 3OV8A 3RTRA 5BOXA 1XCBA 4TV7A 3Q9VA 3HOSA 2EJRA 1TNSA 2XAQA 2HGCA 1P6RA 4OIPF 5DCFA 2HTJA 2ZNZA 3GW2A 4L9VA 2RC4A 4FT8A 1R36A 5JVTA 1XMAA 3W6KB 1IRGA 2M87A 4MHGA 3Q5FA 1DDNA 4EJWA 4G94A 5FFZA 2HQNA 2ETHA 2OZ6A 1IZ1A 5D5XB 1EH7A 5H6RA 3EYIA 4LLNA 2PEXA 1TQIA 2DK5A 1G3SA 3DXJF 1F4KA 1D8JA 1R5HA 4M74A 1JHHA 4K2EA 3P7NA 4XBFA 2DK8A 3GXOA 5LEKA 3OOPA 2XKOA 1QBJA 1KA8A 1USTA 2EV6A 4LLGF 4RB2C 2QVOA 3HTUA 4U0WA 3ZQ7A 3MZYA 2NYXA 2VBZA 3BPVA 5LHGA 4U7BA 4HF1A 1IXSB 1G4DA 2GXBA 2QBYA 1G3YA 5ILVA 2E1NA 5ICFA 1RZ4A 4MEYF 3IRRA 2A6HF 3SXYA 4QLCU 3E6MA 4OMYA 3EYYA 1SD6A 2XVCA 3GFMA 2EA4A 3M7GA 3WTTC 3DQVC 1RNLA 1T98A 3FHZA 3C3WA 2KJBA 4EJUA 2CO5A 1VTNC 2A07F 1JGSA 1OYYA 2A6EF 2RKHA 3F8NA 1L0OC 3C18A 1X3UA 2MLGA 5CYVA 3M8EA 1FSHA 4OIQF 3CLOA 4MEXF 4I7HA 1XD7A 1J2XA 1XGNA 2A68F 4KT5C 2QENA 3L2CA 1BI0A 5L3DA 2AXLA 4HX4A 1ZYRF 3M9AA 2FBIA 3F8CA 5ICCA 1IF1A 1L3LA 3JSOA 5AONA 2D1VA 4WXDA 5D4SA 4WCGA 4AIKA 2V6CA 2ZO4A 1B1BA 3MAJA 3GFIA 2PMHA 1ZRDA 2P7VB 3SQNA 2UZKA 2COMA 3K9TA 4LK1F 2F5DA 3KEQA 1KYWA 4ASNA 2OQGA 1KGSA 2ESNA 3R0AA 2XHKA 4EJOA 1TQMA 1A04A 1O57A 2HTSA 2F5FA 2KKOA 2A3SA 4A6DA 2IRFG 4M9XA 5LRSA 2CW0F 3RYPA 4IRGA 4XRFA 4IVNA 2QYOA 1B4AA 4CDGA 1BN5A 4U0VA 1D5VA 4N9IA 3F21A 2ZKZA 1JXSA 3JSPA 1J59A 3TOBA 2BE5F 1T2KA 2CWEA 1H9GA 2K02A 1MD0A 3BDDA 1FLIA 1NHAA 3WGHA 3ZMTA 2PG4A 2XROA 5D8LB 1ZLKA 2QQBA 4KIFA 4KN7X 3I53A 2EV0A 3R6SA 1TLHB 1BJAA 5BPDA 1LNWA 3J7AO 1HQCA 2K4JA 1Z6RA 4EGZA 2BV6A 5LHHA 3M8FA 1FP1D 4AVPA 1QO0D 4A5NA 4KICA 2QM3A 3BZ6A 5FLXZ 2EV5A 4OIOF 2MD5A 2Z99A 2F5EA 5D6FA 2PI0A 2HKXA 2YR2A 2FQ3A 1XDSA 1YW7A 3I59B 3F8MA 1QGPA 2IJLA 1ON1A 2L4MA 4HZFA 2P5LC 1LDDA 2L4AA 3FXRA 2P6TA 1QZYA 2KIUA 4HX7A 3MEXA 4KMUX 1AWCA 4EGYA 1ZARA 3RPQA 4LMYA 2HDCA 3IWZA 1I6XA 4GYGA 2F5CA 2QLZA 5FGMA 2IVMA 3K2ZA 4B8XA 5FLXK 1ZLJA 1KQ0A 3BJOA 2A5YB 3RJPA 1U5TA 2ACJA 1FP2A 2O61A 3GX4X 5E20A 2LF8A 5FD6A 1OPCA 4HLXA 2W84A 3I4PA 3KE2A 3IC7A 5FB2A 2KIFA 2FNAA 2RQPA 2XAHA 3I54A 4BAYA 1FOKA 4UXNA 4Y15A 2FE3A 3RKYA 2RV8A 3M1EA 4HQEA 2HFHA 1ZH5A 5CVRA 3KP6A 3JAMZ 4O3MA 3L9FA 4IJAA 2G7HA 3T1BA 4P9FA 3FMQA 3AAFA 3O6BB 2DW4A 1W7PA 4KIGA 3HRTA 3DEUA 4AIJA 5HLGA 3HRMA 2DBBA 2PMUA 5KK1A 1U78A 3R60A 4ETSA 2PLYA 3L09A 1ZHFA 4H0EA 1HKTA 3NEUA 5H20A 4BNCA 1U5TC 1Z91A 4B09A 1R58A 4KUMA 3BPXA 5E17F 3ROUA 3GUDA 2DFIA 3CDHA 4A5MA 4FHTA 4UHTA 4G7HF 1G3TA 3KCCA 4PDKA 1IN8A 1SD4A 1WRJA 4BHCA 2OBPA 2QBYB 2M30A 5EEGA 3ELKA 5HDGA 4BHPA 1B9MA 1S29A 3CTAA 5FD5A 4UV8A 4MTEA 5BS6A 3V7CA 1LEAA 2JSCA 1LQ1A 1YTYA 1FSEA 4RB3C 2D1HA 1XB4A 1TTYA 5AIQA 4A2UA 4AIHA 3FM5A 2FA5A 4LB6B 1QZZA 2P8TA 4RAYA 2IPQX 4CICA 4IRHA 3C7JA 3E97A 1YS6A 2ZJ2A 2FU4A 3I59A 3GVAA 1KQ8A 3TOAA 1O3QA 4RGRA 3BY6A 1OMIA 4KA4A 4O5VA 5CVIA 2LF7A 4EM1A 4A0XA 3KP5A 1B59A 4CXFA 3GZ5A 1G6NA 3E6CC 4I0AA 3EUHA 4EQQA 3EETA 2H6BA 2GIVA 4I0BA 1K6OA 1F5TA 3F6OA 5L3CA 1Y0UA 5LBQA 2F2EA 4HBLA 1Z7UA 2ZCWA 6PAXA 2QQAA 3RIRA 2VOOA 4GCVA 2HOEA 1S7OA 5L3BA 1KU9A 3FXUA 3GLXA 3HSEA 5TRDA 3SFZA 2L02A 1P4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYG D;  4L5I A;  4LG0 A;  2Z9O A;  1JE8 A;  3WE2 A;  1BI1 A;  4UUV A;  2NNY A;  4CYD A;  2L01 A;  4LB5 A;  4L9T A;  5DD4 A;  1C0W A;  2PBI A;  2NRA C;  5J8F A;  2VBX A;  2Y75 A;  1AOY A;  3Q9S A;  2JTV A;  2GZW A;  2B0L A;  4G7O F;  1LDJ A;  5L3G A;  1FBS A;  2STT A;  1LEB A;  4RGU A;  1ZRC A;  2UXN A;  3N97 A;  3ABU A;  3T0Y A;  2PN6 A;  4EJT A;  3J81 Z;  1R7J A;  1PP8 F;  2NS0 A;  2UWM A;  1YW8 A;  2FF4 A;  1RIO H;  2MH2 A;  1S7A A;  4YFX F;  2LSO A;  4A6E A;  4MGR A;  3U9G A;  3FX3 A;  1IAW A;  2BGC A;  1PDN C;  2EK5 A;  1SD7 A;  3LAJ A;  1ZRF A;  1UHM A;  3FMS A;  3SZT A;  3K69 A;  4XLN F;  5LGT A;  2VC1 A;  2HS5 A;  5H6Q A;  4MQ9 F;  2O3F A;  1WSU A;  2FOK A;  4G7Z F;  4A0Z A;  2YPR A;  2HEO A;  4LGW A;  1WKM A;  3EDP A;  2MBF A;  2O03 A;  2P7C B;  3JTH A;  2FMY A;  2FNP A;  3GF2 A;  4LJZ F;  2DPU A;  2RGV A;  1ZG5 A;  3I71 A;  1KQ9 A;  3K0L A;  4R79 A;  3PFI A;  1WI9 A;  3FF5 A;  4XLP F;  1XSD A;  1KYZ A;  1ODD A;  1CGP A;  2M8E A;  2IA1 A;  2H27 A;  3QAH A;  1U5T B;  4GXO A;  1ZGJ A;  3KFW X;  5LGU A;  1FPQ A;  1FWZ A;  3WTS C;  1OR7 A;  3BWG A;  2XUB A;  4M72 A;  3L00 A;  2DQR A;  1YS7 A;  1FY7 A;  2J5O A;  4G8X A;  2HWV A;  3ZN1 A;  5E1W A;  3L7W A;  3V4G A;  1ZRE A;  4L9N A;  5E18 F;  3H3Z A;  5K5Q A;  2ZBK A;  1FT9 A;  4E70 A;  4DQ2 A;  1W7P B;  3TO7 A;  2WC2 A;  3F3X A;  2IT0 A;  5CVU A;  5DYM A;  2FRH A;  2GA2 A;  1MKM A;  1J0R A;  5EEH A;  3DKW A;  3V8L A;  1LDK B;  2PFB A;  3KP2 A;  4BYY A;  3TO6 A;  5L3F A;  3TQN A;  3E5Q A;  1FX7 A;  1Z9C A;  2JPC A;  3QP6 A;  2UXX A;  4YFN F;  4HW0 A;  2NNN A;  2OA4 A;  2KRF A;  1IN7 A;  2IP2 A;  5DUK A;  4OIR F;  3KP7 A;  1XN7 A;  4CGZ A;  1OYW A;  1R5G A;  1KU3 A;  5CVJ A;  3BP8 A;  3HTS B;  3WTV C;  1SD5 A;  4QWQ A;  4G6Q A;  5K5R A;  4D0P A;  4ESB A;  1TQP A;  3WTX C;  2XRN A;  4BQA A;  4HF2 A;  3QU6 A;  2WTE A;  2YSR A;  3ZMD A;  4XSZ F;  1TW3 A;  2EFW A;  1UB9 A;  4NHJ A;  4KDP A;  2CQK A;  1UCR A;  1W7P D;  4P55 A;  4M9S A;  1R1U A;  2P6S A;  1T39 A;  5ICG A;  1MDM B;  4NB5 A;  1YG2 A;  4AD9 A;  5HVQ C;  1E2X A;  4KIB A;  1O7F A;  4F7Z A;  3ZMV A;  2HYF A;  1IN5 A;  5JI6 A;  1MJ9 A;  4IRI A;  1S8N A;  4U0Y A;  1DP7 P;  4PGG A;  3D0S A;  2QWW A;  3S2W A;  1FZP B;  4IXA A;  2L54 A;  2A61 A;  1SFE A;  1EH8 A;  2OU2 A;  1GXQ A;  2IA0 A;  3CO6 C;  3DFG A;  3IKV A;  1BIA A;  1DPR A;  2D45 A;  3LAP A;  3LST A;  4ENJ A;  4HV5 A;  1S3J A;  4HA8 A;  1J7K A;  2JZY A;  5A2Q Z;  1YQA A;  1R00 A;  4WWC A;  2K7L A;  3WGG A;  4GYI A;  5LRR A;  4L18 B;  3LA2 A;  2E7W A;  4ZYG A;  2ADU A;  1XDU A;  2TDX A;  3WOD F;  2K27 A;  5FFX A;  2DQL A;  2BYV E;  3PQK A;  1ZAO A;  1D3Y A;  3F6V A;  1R23 A;  5CVV A;  2Q8K A;  3CUO A;  3F72 A;  3V8K A;  3DPL C;  1K7A A;  1I27 A;  2DAO A;  5K5O A;  3V8J A;  3U1D A;  3VFZ A;  3ZMZ A;  2ZXJ A;  1TNT A;  2YX4 A;  4OU0 A;  3RI4 A;  2XV4 S;  1R1V A;  4LG0 B;  4HAM A;  1MJA A;  3K1P A;  5A2Q K;  4UVB A;  1HW2 A;  3JTG A;  3ERE D;  4Z2Y A;  1FYM A;  2CYY A;  4RGX A;  2XAG A;  3N4M A;  4L0Z B;  3RPU A;  5HS8 A;  2RNJ A;  1O3S A;  3TKY A;  3QOP A;  1I5Z A;  1HKQ A;  3DF8 A;  2RN7 A;  2K4B A;  3E5U A;  1W4M A;  3HOT A;  4YIF A;  3ZP5 A;  1HW1 A;  2QZ8 A;  3HYI A;  5D8K B;  3ZMU A;  4N0B A;  4EV0 A;  2Q0O A;  3HHH A;  4PGH A;  5HDN A;  4FX0 A;  2LNB A;  1ZN2 A;  2XAS A;  2CSO A;  3JAM K;  1W5T A;  2RDP A;  5J8C A;  1EH6 A;  4Q48 A;  1B6A A;  1YYV A;  3KP4 A;  5ILU A;  5HDK A;  1IN4 A;  2MH9 A;  1V4R A;  3KZY A;  3E6D A;  2JT1 A;  3B73 A;  2HKO A;  1MDM A;  2BEO A;  2JPB A;  3CUQ B;  3TDU C;  4OIN F;  3MZH A;  1HST A;  3SZP A;  4I2O A;  5JFR A;  3VOD A;  3F8B A;  1QNT A;  1SFU A;  2O8X A;  2FEZ A;  2PJP A;  4N9H A;  1B9N A;  2LKP A;  4FX4 A;  1IXR C;  1FBQ A;  2O0Y A;  1ULY A;  2Z33 A;  3FM3 A;  3WTY C;  2KJC A;  2WV0 A;  2MC3 A;  3WTU C;  4ENN A;  4GO1 A;  4MNU A;  5HLH A;  4S05 A;  1YIO A;  4KYW A;  3KET A;  4KFC A;  3QPT A;  1ONV A;  4UVA A;  1U3E M;  1XGM A;  3I58 A;  5HS7 A;  2M45 A;  2JRT A;  4JQF A;  3GZ6 A;  1DUX C;  2DU9 A;  3GEZ A;  3I64 A;  4GGG A;  4P5O A;  2OAZ A;  2YX7 A;  1J9I A;  4A0Y A;  3I0T A;  4L0Y B;  2PQ8 A;  2RVC A;  1RUN A;  5D5W B;  4HYE A;  1MJB A;  2FML A;  3WG9 A;  4NQW A;  3QPH A;  3F22 A;  1GHC A;  1FBU A;  4HQM A;  2ZNY A;  2IW5 A;  4U88 A;  4U7D A;  1T0F A;  2DT5 A;  4M71 A;  4CO8 A;  1USS A;  4L5J A;  1HSJ A;  3P9C A;  3WU1 B;  2VT3 A;  4I09 A;  1BIB A;  1QPM A;  4ZYH A;  5E8I A;  4I98 B;  2IA2 A;  3QU3 A;  4WXH A;  3R0J A;  2EFO A;  2CG4 A;  4HX8 A;  4ENM A;  2FBH A;  2Y48 A;  2HZT A;  2P5K A;  1Q1H A;  1Z05 A;  3IRQ A;  4M73 A;  2V9V A;  1XSX A;  3VOE A;  1STZ A;  5BPI A;  3KP3 A;  2MA3 A;  3K1M A;  4P96 A;  4ENK A;  3IHU A;  4DNC A;  1ZGA A;  3D5L A;  4RB1 A;  3KZZ A;  3TDZ C;  2E1C A;  2W25 A;  4LD5 A;  1EV7 A;  3GYH X;  1JHF A;  2GWR A;  2P4W A;  3ECH A;  4IHS A;  4G6D A;  1U6G A;  1BI3 A;  3BOQ A;  2X0L A;  1HW5 A;  3P9K A;  2ZFW A;  5D5U B;  3IL2 A;  2H94 A;  3VB2 A;  4YG2 F;  1YLF A;  1PP7 U;  1OKR A;  3U2R A;  2DO7 A;  2EA2 A;  3F23 A;  1T6S A;  3C1D A;  5DV5 A;  4A12 A;  2KIM A;  3CUQ A;  1CF7 B;  5D4R A;  4OOI A;  4XSX F;  1P92 A;  3JW4 A;  2YU3 A;  1BC8 C;  3GFL A;  4WXC A;  3MFK A;  3NQO A;  3GFJ A;  1W5S A;  2Y0M A;  3HUG A;  1SFX A;  1BC7 C;  3J81 K;  3QRF F;  3HRS A;  3WTW C;  5ICE A;  3HIF A;  1P4W A;  3V7R A;  2ISY A;  4ESF A;  2VE9 A;  4RB0 A;  5BMZ A;  4ZYD A;  2OZU A;  5DEQ A;  3BJA A;  5ILS A;  4Q4Z F;  4EJV A;  4WF2 A;  3ZPL A;  1LVA A;  1D8K A;  2MLK A;  1KU7 A;  2O6G E;  5CJ9 A;  3GO5 A;  3DP7 A;  5IT3 A;  4HLY A;  3B02 A;  1RUO A;  5DDG A;  5E1Z B;  3HSR A;  5J6X A;  3V7S A;  5DCM B;  4EM0 B;  2STW A;  2V79 A;  3CUQ C;  2W57 A;  2VT2 A;  1J75 A;  4O6J A;  2R3S A;  3E6B A;  1H0M A;  4UV9 A;  3LQR A;  1BM9 A;  1BI2 A;  4L9J A;  1T38 A;  5DUI A;  4CHU A;  1FC3 A;  3G3Z A;  2D2W A;  4R1H A;  1F1Z A;  4YFK F;  1HKS A;  5LEJ A;  3KLN A;  4UVC A;  3LQQ A;  3ECO A;  1SAX A;  2M1B A;  1YFH A;  3KLO A;  4BHB A;  1Z6T A;  2GXG A;  3CO7 C;  4PCQ A;  5K1Y A;  2DPD A;  4LLL A;  1S6L A;  4RS8 A;  2VXZ A;  3SHF A;  5ED4 A;  3IWF A;  1OYI A;  2VOD A;  4Y13 A;  1IN6 A;  2V1X A;  4M9Z A;  4OMZ A;  3WE3 A;  2GAU A;  4WX9 A;  5LHI A;  2ISZ A;  4LK0 F;  2W24 A;  5JR3 A;  3REO A;  2VC0 A;  1K79 A;  5IT9 Z;  3QP5 A;  3K1N A;  4Q5S F;  3NRV A;  3T8R A;  3I5U A;  5FO5 A;  2E7X A;  3RKW A;  1G3W A;  5JHU A;  2G7U A;  3RKX A;  5BQT A;  2XGX A;  3ULQ B;  1ON2 A;  1P4X A;  2CFX A;  3BRO A;  1UFM A;  2J5P A;  3ZMS A;  3E5X A;  4I01 A;  5L3E A;  3T5X A;  2ELH A;  4G9Y A;  2Q2E A;  5E1X A;  5KVR A;  3P9I A;  4AWX B;  2HQR A;  4ZZL A;  4M6Y A;  4ON0 A;  4WK8 F;  1IRF A;  5TJJ A;  2VBW A;  3ZN0 A;  2L3D A;  4KN4 X;  3PQJ A;  1KU2 A;  1FYL A;  5HLI A;  3TGN A;  3VEP A;  5IT9 K;  5AIP A;  1CF7 A;  4JBA A;  3HHG A;  1K78 B;  4IF4 A;  1P2F A;  2ZME B;  1WQ2 A;  4Y17 A;  1BBY A;  3O3K A;  1IXC A;  4YII A;  4HDU A;  1WWX A;  4MTD A;  4HOB A;  1XSV A;  2H09 A;  2K86 A;  3WGI A;  3DV8 A;  3R4K A;  1XMK A;  3ABT A;  5D5V B;  1FNN A;  1XGS A;  4KMF A;  2QQ9 A;  1TW2 A;  3J80 Z;  2V1D A;  3F8F A;  3COA C;  3ML6 A;  3ISP A;  1GXP A;  1O3R A;  1IW7 F;  4UNO A;  1I1S A;  4RAZ A;  5DCM A;  4P9U A;  5HOO A;  2R7D A;  5CLS A;  4CZZ A;  4I02 A;  2XAF A;  3FWE A;  5F64 A;  3LFK A;  2V1U A;  5LGN A;  1YO5 C;  3BJ6 A;  3WTZ A;  2G9W A;  2HR3 A;  5F1R A;  4RGS A;  1REP C;  2P5V A;  5F6F A;  2XIG A;  3GWZ A;  3T8T A;  3HRU A;  2ESH A;  4ZH4 F;  4HV6 A;  4IPA A;  5D6E A;  1TBX A;  1H9T A;  3J80 K;  3LWF A;  3E3V A;  3H3U A;  5ERI A;  3FMR A;  2DI3 A;  3RYR A;  4HDV A;  2EWN A;  1F9N A;  3WU0 A;  2NAZ A;  3DPT A;  2Z3Y A;  2Z5U A;  3R61 A;  2VN2 A;  1RI7 A;  4EMS A;  4ESJ A;  3G73 A;  5HS9 A;  4IHT A;  3IKT A;  2VE8 A;  2EB7 A;  1MZB A;  4Q47 A;  4M6X A;  3H92 A;  3RDI A;  4EVI A;  3MWM A;  2FXA A;  2M5W A;  2EFQ A;  1DPU A;  2QUF A;  3KEO A;  1MGT A;  1I1G A;  4MQV A;  1O7L A;  3HSF A;  1HXD A;  4JK1 X;  4BH9 A;  3LA3 A;  1HBX G;  3MQ0 A;  1PUE E;  1LB2 A;  1YW9 A;  1ZG1 A;  4LFU A;  5DD8 A;  4R8H A;  4ZZD A;  4S04 A;  1U8R A;  3EQL F;  2A69 F;  1R1T A;  1BOA A;  2FSW A;  3O2P E;  5LLQ A;  2VON A;  2OQR A;  1SMY F;  2EFN A;  4BXU A;  2GQQ A;  1SMT A;  1FYK A;  1V3F A;  3MCZ A;  2XKP A;  2FBK A;  2LDU A;  2CGP A;  2C6Y A;  1K78 A;  1Z1D A;  2BBY A;  2ZME A;  2WWY A;  1XGO A;  2H6C A;  1J5Y A;  2X4H A;  4PZJ A;  1IUY A;  3CJN A;  3FXQ A;  1UHW A;  1O3T A;  2VOP A;  2DLL A;  4ZYE A;  1LJ9 A;  2OD5 A;  4HF0 A;  1XCV A;  5E8G A;  1GVJ A;  2W85 A;  4KNY A;  1E17 A;  2XAJ A;  1ZG3 A;  1U2W A;  3FZV A;  2R7F A;  3TO9 A;  2VBY A;  2GA1 A;  2AS5 F;  3LA7 A;  2DTR A;  2EFP A;  1R22 A;  3W6J B;  4EM2 A;  1QQI A;  3OV8 A;  3RTR A;  5BOX A;  1XCB A;  4TV7 A;  3Q9V A;  3HOS A;  2EJR A;  1TNS A;  2XAQ A;  2HGC A;  1P6R A;  4OIP F;  5DCF A;  2HTJ A;  2ZNZ A;  3GW2 A;  4L9V A;  2RC4 A;  4FT8 A;  1R36 A;  5JVT A;  1XMA A;  3W6K B;  1IRG A;  2M87 A;  4MHG A;  3Q5F A;  1DDN A;  4EJW A;  4G94 A;  5FFZ A;  2HQN A;  2ETH A;  2OZ6 A;  1IZ1 A;  5D5X B;  1EH7 A;  5H6R A;  3EYI A;  4LLN A;  2PEX A;  1TQI A;  2DK5 A;  1G3S A;  3DXJ F;  1F4K A;  1D8J A;  1R5H A;  4M74 A;  1JHH A;  4K2E A;  3P7N A;  4XBF A;  2DK8 A;  3GXO A;  5LEK A;  3OOP A;  2XKO A;  1QBJ A;  1KA8 A;  1UST A;  2EV6 A;  4LLG F;  4RB2 C;  2QVO A;  3HTU A;  4U0W A;  3ZQ7 A;  3MZY A;  2NYX A;  2VBZ A;  3BPV A;  5LHG A;  4U7B A;  4HF1 A;  1IXS B;  1G4D A;  2GXB A;  2QBY A;  1G3Y A;  5ILV A;  2E1N A;  5ICF A;  1RZ4 A;  4MEY F;  3IRR A;  2A6H F;  3SXY A;  4QLC U;  3E6M A;  4OMY A;  3EYY A;  1SD6 A;  2XVC A;  3GFM A;  2EA4 A;  3M7G A;  3WTT C;  3DQV C;  1RNL A;  1T98 A;  3FHZ A;  3C3W A;  2KJB A;  4EJU A;  2CO5 A;  1VTN C;  2A07 F;  1JGS A;  1OYY A;  2A6E F;  2RKH A;  3F8N A;  1L0O C;  3C18 A;  1X3U A;  2MLG A;  5CYV A;  3M8E A;  1FSH A;  4OIQ F;  3CLO A;  4MEX F;  4I7H A;  1XD7 A;  1J2X A;  1XGN A;  2A68 F;  4KT5 C;  2QEN A;  3L2C A;  1BI0 A;  5L3D A;  2AXL A;  4HX4 A;  1ZYR F;  3M9A A;  2FBI A;  3F8C A;  5ICC A;  1IF1 A;  1L3L A;  3JSO A;  5AON A;  2D1V A;  4WXD A;  5D4S A;  4WCG A;  4AIK A;  2V6C A;  2ZO4 A;  1B1B A;  3MAJ A;  3GFI A;  2PMH A;  1ZRD A;  2P7V B;  3SQN A;  2UZK A;  2COM A;  3K9T A;  4LK1 F;  2F5D A;  3KEQ A;  1KYW A;  4ASN A;  2OQG A;  1KGS A;  2ESN A;  3R0A A;  2XHK A;  4EJO A;  1TQM A;  1A04 A;  1O57 A;  2HTS A;  2F5F A;  2KKO A;  2A3S A;  4A6D A;  2IRF G;  4M9X A;  5LRS A;  2CW0 F;  3RYP A;  4IRG A;  4XRF A;  4IVN A;  2QYO A;  1B4A A;  4CDG A;  1BN5 A;  4U0V A;  1D5V A;  4N9I A;  3F21 A;  2ZKZ A;  1JXS A;  3JSP A;  1J59 A;  3TOB A;  2BE5 F;  1T2K A;  2CWE A;  1H9G A;  2K02 A;  1MD0 A;  3BDD A;  1FLI A;  1NHA A;  3WGH A;  3ZMT A;  2PG4 A;  2XRO A;  5D8L B;  1ZLK A;  2QQB A;  4KIF A;  4KN7 X;  3I53 A;  2EV0 A;  3R6S A;  1TLH B;  1BJA A;  5BPD A;  1LNW A;  3J7A O;  1HQC A;  2K4J A;  1Z6R A;  4EGZ A;  2BV6 A;  5LHH A;  3M8F A;  1FP1 D;  4AVP A;  1QO0 D;  4A5N A;  4KIC A;  2QM3 A;  3BZ6 A;  5FLX Z;  2EV5 A;  4OIO F;  2MD5 A;  2Z99 A;  2F5E A;  5D6F A;  2PI0 A;  2HKX A;  2YR2 A;  2FQ3 A;  1XDS A;  1YW7 A;  3I59 B;  3F8M A;  1QGP A;  2IJL A;  1ON1 A;  2L4M A;  4HZF A;  2P5L C;  1LDD A;  2L4A A;  3FXR A;  2P6T A;  1QZY A;  2KIU A;  4HX7 A;  3MEX A;  4KMU X;  1AWC A;  4EGY A;  1ZAR A;  3RPQ A;  4LMY A;  2HDC A;  3IWZ A;  1I6X A;  4GYG A;  2F5C A;  2QLZ A;  5FGM A;  2IVM A;  3K2Z A;  4B8X A;  5FLX K;  1ZLJ A;  1KQ0 A;  3BJO A;  2A5Y B;  3RJP A;  1U5T A;  2ACJ A;  1FP2 A;  2O61 A;  3GX4 X;  5E20 A;  2LF8 A;  5FD6 A;  1OPC A;  4HLX A;  2W84 A;  3I4P A;  3KE2 A;  3IC7 A;  5FB2 A;  2KIF A;  2FNA A;  2RQP A;  2XAH A;  3I54 A;  4BAY A;  1FOK A;  4UXN A;  4Y15 A;  2FE3 A;  3RKY A;  2RV8 A;  3M1E A;  4HQE A;  2HFH A;  1ZH5 A;  5CVR A;  3KP6 A;  3JAM Z;  4O3M A;  3L9F A;  4IJA A;  2G7H A;  3T1B A;  4P9F A;  3FMQ A;  3AAF A;  3O6B B;  2DW4 A;  1W7P A;  4KIG A;  3HRT A;  3DEU A;  4AIJ A;  5HLG A;  3HRM A;  2DBB A;  2PMU A;  5KK1 A;  1U78 A;  3R60 A;  4ETS A;  2PLY A;  3L09 A;  1ZHF A;  4H0E A;  1HKT A;  3NEU A;  5H20 A;  4BNC A;  1U5T C;  1Z91 A;  4B09 A;  1R58 A;  4KUM A;  3BPX A;  5E17 F;  3ROU A;  3GUD A;  2DFI A;  3CDH A;  4A5M A;  4FHT A;  4UHT A;  4G7H F;  1G3T A;  3KCC A;  4PDK A;  1IN8 A;  1SD4 A;  1WRJ A;  4BHC A;  2OBP A;  2QBY B;  2M30 A;  5EEG A;  3ELK A;  5HDG A;  4BHP A;  1B9M A;  1S29 A;  3CTA A;  5FD5 A;  4UV8 A;  4MTE A;  5BS6 A;  3V7C A;  1LEA A;  2JSC A;  1LQ1 A;  1YTY A;  1FSE A;  4RB3 C;  2D1H A;  1XB4 A;  1TTY A;  5AIQ A;  4A2U A;  4AIH A;  3FM5 A;  2FA5 A;  4LB6 B;  1QZZ A;  2P8T A;  4RAY A;  2IPQ X;  4CIC A;  4IRH A;  3C7J A;  3E97 A;  1YS6 A;  2ZJ2 A;  2FU4 A;  3I59 A;  3GVA A;  1KQ8 A;  3TOA A;  1O3Q A;  4RGR A;  3BY6 A;  1OMI A;  4KA4 A;  4O5V A;  5CVI A;  2LF7 A;  4EM1 A;  4A0X A;  3KP5 A;  1B59 A;  4CXF A;  3GZ5 A;  1G6N A;  3E6C C;  4I0A A;  3EUH A;  4EQQ A;  3EET A;  2H6B A;  2GIV A;  4I0B A;  1K6O A;  1F5T A;  3F6O A;  5L3C A;  1Y0U A;  5LBQ A;  2F2E A;  4HBL A;  1Z7U A;  2ZCW A;  6PAX A;  2QQA A;  3RIR A;  2VOO A;  4GCV A;  2HOE A;  1S7O A;  5L3B A;  1KU9 A;  3FXU A;  3GLX A;  3HSE A;  5TRD A;  3SFZ A;  2L02 A;  1P4A A; 
#chains in the Genus database with same CATH topology
 2HYG D;  4BJT A;  4L5I A;  5DS9 A;  2AHQ A;  4CZC A;  5IYC J;  3GBG A;  4LG0 A;  2M0C A;  2Z9O A;  3A01 B;  1I50 J;  1JE8 A;  2B63 J;  2M4K A;  2E1M C;  4A69 C;  2ME0 A;  1WJD A;  3QPS A;  1IUF A;  3A4C A;  3ASN H;  5F0H A;  4U87 A;  4II3 A;  3OYB A;  1WH7 A;  3WE2 A;  4Y52 J;  1N25 A;  1BI1 A;  3RQ4 A;  2X6W A;  3C2H A;  4UUV A;  1WVR A;  1OFC X;  1AU7 A;  2NNY A;  2LK2 A;  1QVT A;  3D5R C;  4CYD A;  2L01 A;  4LB5 A;  2KLO A;  4L9T A;  5DD4 A;  1C0W A;  5E3M A;  4RMN A;  2JA7 J;  2BOL A;  2EZI A;  1VQ6 I;  1VFC A;  2PBI A;  1YIJ I;  3EUH C;  5F08 A;  2NRA C;  5J8F A;  2VBX A;  2V9K A;  2CFO A;  2Y75 A;  1AOY A;  3Q9S A;  5IYD J;  2JTV A;  2GZW A;  1FTZ A;  2B0L A;  2XSJ C;  3K4J A;  1SC7 A;  1LDJ A;  5L3G A;  4G7O F;  1FBS A;  2ZB9 A;  2STT A;  1LEB A;  4RGU A;  1ZRC A;  3BQY A;  5KCM A;  2UXN A;  4HNU A;  5E3O A;  3N97 A;  3C2B A;  2ID3 A;  3QPL A;  1TT0 A;  3OS2 A;  2FD5 A;  3ABU A;  3T0Y A;  1X3W B;  2PN6 A;  2YUS A;  5KNL A;  2KL4 A;  1ZK8 A;  4OAY A;  4X0G A;  4EJT A;  4RBO A;  3J81 Z;  1R7J A;  1PP8 F;  5EZG A;  2NS0 A;  2UWM A;  1YW8 A;  2FF4 A;  1RIO H;  4DBR A;  3K70 D;  2MH2 A;  1MNM C;  1S7A A;  4YFX F;  2W00 A;  2LSO A;  4A6E A;  3M3Y J;  1ACI A;  1VQ9 I;  4BDY A;  4MGR A;  3U9G A;  1NH3 A;  3FX3 A;  1IAW A;  3GTJ J;  2IEK A;  2BGC A;  4HST A;  2EK5 A;  4PSX A;  1SD7 A;  3LAJ A;  1PDN C;  1ZRF A;  4NBQ A;  2DCE A;  1UHM A;  4ZDP A;  2LBF A;  3L2Q A;  2F48 A;  3FMS A;  3SZT A;  2QEX I;  4A3L J;  3K69 A;  2KHM A;  4XLN F;  1BR1 A;  3Q0W A;  5LGT A;  2VC1 A;  2HS5 A;  5CKT A;  5H6Q A;  4MQ9 F;  2O3F A;  1WSU A;  2FOK A;  4G7Z F;  4A0Z A;  2E2H J;  2YPR A;  2HEO A;  4LGW A;  1WKM A;  4F3Q A;  3EDP A;  2QGU A;  2MBF A;  2O03 A;  2P7C B;  3G2B A;  3JTH A;  2FMY A;  3LSM A;  3PSF A;  2FNP A;  3GF2 A;  4LJZ F;  2DPU A;  2RGV A;  1ZG5 A;  3I71 A;  1KQ9 A;  3K0L A;  4R79 A;  3QYF A;  3J7Y J;  5FRO A;  2PJR B;  9ANT A;  3PFI A;  1SFK A;  3KYL A;  1T95 A;  3OYG A;  2DA5 A;  1WI9 A;  3FF5 A;  2BY3 A;  4XLP F;  1XSD A;  1S7E A;  1KYZ A;  1ODD A;  2DMQ A;  1IDZ A;  1CGP A;  2M8E A;  3IAM 2;  1VQK I;  1SVO A;  4RAF A;  3H1C A;  2IA1 A;  2H27 A;  3QAH A;  1U5T B;  3K7A J;  5M5X J;  3EPZ A;  2I8D A;  2KMU A;  3JRG A;  1K6Y A;  2IS6 A;  4GXO A;  4HEA 2;  2R5Y B;  1ZGJ A;  2M2E A;  3KFW X;  4F52 A;  5LGU A;  1FPQ A;  1FWZ A;  3FK7 A;  3WTS C;  1OR7 A;  3BWG A;  2XUB A;  1BA5 A;  4M72 A;  3CD6 I;  3L00 A;  2DQR A;  1YS7 A;  1FY7 A;  2AXT C;  2J5O A;  4G8X A;  5JLW A;  5J47 A;  2HWV A;  2DDA A;  3ZN1 A;  1X2N A;  2R5Z B;  3A1Y A;  5E1W A;  2IS2 A;  3L7W A;  3V4G A;  2R7R A;  4ZYA A;  3BLY A;  3RZO J;  3IH3 A;  5EDN A;  1ZRE A;  2ZC2 A;  4L9N A;  1OCT C;  5E18 F;  3H3Z A;  3F9K A;  5K5Q A;  3CC7 I;  2FJ1 A;  2DA3 A;  2EPF A;  1S5L C;  2VJI A;  2R7X A;  3DLA A;  2RAE A;  2LKS A;  3L2W A;  4UY8 I;  2HXO A;  2ZBK A;  1FT9 A;  3G1L A;  4E70 A;  1Z3X A;  1Z77 A;  5K7H A;  4DQ2 A;  1W7P B;  3G1M A;  3TO7 A;  2WC2 A;  1MH3 A;  2NOJ B;  3F3X A;  2IT0 A;  5CVU A;  3GTQ J;  3G1O A;  3ZQF A;  2R93 J;  5DYM A;  4W97 A;  2FRH A;  2GA2 A;  2PMZ N;  2V1N A;  3PUB A;  3A01 A;  1MKM A;  4MFE A;  1J0R A;  4OAZ A;  1MMN A;  2GBY A;  2QKM B;  3DKW A;  5EEH A;  4XOP A;  1LDK B;  3V8L A;  3BR0 A;  2TCT A;  3OSG A;  2NVQ J;  2FQ4 A;  2PFB A;  3KP2 A;  4BYY A;  1D1B A;  3MKW B;  3TO6 A;  5L3F A;  3H9G A;  3TQN A;  3E5Q A;  1FX7 A;  1Z9C A;  3PNT A;  2JPC A;  2HVQ A;  3QP6 A;  4D7N A;  2UXX A;  3HOY J;  4JYK A;  4YFN F;  5KAF C;  4HW0 A;  1MMD A;  2KDZ A;  3H35 A;  2NNN A;  3OYF A;  3LSG A;  1GT0 C;  2LOO A;  2OA4 A;  2KRF A;  1IN7 A;  2IP2 A;  3ONQ A;  1JGG A;  5DUK A;  4OIR F;  3KP7 A;  1XN7 A;  2XGC A;  4F92 B;  1OR7 C;  4QPO A;  4IHX A;  2QA4 I;  1OYW A;  1UG0 A;  1R5G A;  4CGZ A;  1PUF A;  1KU3 A;  5CVJ A;  3BP8 A;  1AA7 A;  3HTS B;  3WTV C;  1SD5 A;  2HI3 A;  3VYU B;  4QWQ A;  3H36 A;  4G6Q A;  5K5R A;  4D0P A;  2JA5 J;  2CV2 A;  4ESB A;  1TQP A;  3WTX C;  2XRN A;  3PFY A;  3AFH A;  4BQA A;  4HF2 A;  3SEQ A;  3QU6 A;  2WTE A;  4D5F A;  2YSR A;  3ZMD A;  1APL C;  1T56 A;  1OJL A;  2LLK A;  1TW3 A;  4XSZ F;  4IQJ A;  1YOV B;  1Y8Q B;  1UB9 A;  2MC4 A;  2EFW A;  1NK2 P;  2L5Q A;  4KDP A;  2CQK A;  4B43 A;  4NHJ A;  1UCR A;  2I5U A;  1W7P D;  1D0Y A;  4GRI A;  1O4X A;  3CCE I;  3W3C A;  1IJW C;  4XNF A;  4P55 A;  4M9S A;  1R1U A;  2P6S A;  2EZK A;  1ETQ A;  1T39 A;  5ICG A;  3U1K A;  1MDM B;  3I55 I;  4NB5 A;  1YG2 A;  4AD9 A;  1Z21 A;  2CH0 A;  3BR1 A;  5HVQ C;  1AHD P;  1E2X A;  2JMW A;  4RLF A;  4KIB A;  1O7F A;  2COB A;  5FKO A;  1WJC A;  3SDB A;  4F7Z A;  3ZMV A;  4MIM A;  2DFE A;  4LOC A;  2HYF A;  1IN5 A;  4HPQ A;  5JI6 A;  2HOA A;  3QYB A;  2ZJQ F;  1MJ9 A;  3HJE A;  3UR3 C;  4IRI A;  1S8N A;  2NVY J;  4U0Y A;  1B72 B;  1DP7 P;  1P9Q C;  4PGG A;  1X19 A;  3GLL A;  3D0S A;  4C3I J;  3L1P A;  2QWW A;  2AQE A;  3S2W A;  2N8G A;  1FZP B;  4IXA A;  2L54 A;  2Z1D A;  3VPR A;  3OWT A;  1N75 A;  3QQA A;  1DP3 A;  4B3A A;  1YJ9 I;  2KFD A;  2A61 A;  1WCM J;  1RRJ A;  1SFE A;  1EH8 A;  2OU2 A;  5LD2 C;  1GXQ A;  1QU3 A;  4M3E A;  2BXY A;  5GAG J;  2IA0 A;  5B66 C;  3CO6 C;  3VDX A;  2E1M B;  2XSD C;  1PJR A;  3DFG A;  2V4J C;  4PJJ A;  4H4K C;  1F36 A;  2FOW A;  1BIA A;  3IKV A;  1HOM A;  1DPR A;  2D45 A;  2YS9 A;  3A0H C;  5TRD A;  3DPU A;  3LAP A;  2X9D A;  3LST A;  1LFB A;  2ZXI A;  4ENJ A;  4HV5 A;  3LOC A;  1S3J A;  4HA8 A;  2BXZ A;  1J7K A;  2JZY A;  5A2Q Z;  1SVM A;  1YQA A;  2WY8 Q;  2PJR A;  1R00 A;  2M0M A;  3K2A A;  1WFX A;  4WWC A;  2K7L A;  1E3H A;  3S3O A;  3WGG A;  3S2D J;  4XLC A;  3DKY A;  4PFP A;  4GYI A;  1MW7 A;  5LRR A;  4L18 B;  2R0Q C;  3LA2 A;  5IPA A;  4CCN A;  2LC2 A;  2E7W A;  2IGM A;  4ZYG A;  2F4M B;  2KQR A;  2HXI A;  3AL0 B;  2W7N A;  2ADU A;  1XDU A;  2TDX A;  2W1O A;  3WOD F;  2K27 A;  2D5V A;  5FFX A;  2DQL A;  2BYV E;  3PQK A;  1ZAO A;  1GDT A;  1D3Y A;  3F6V A;  1R23 A;  5CVV A;  4NQW B;  2Q8K A;  3CUO A;  3ZQQ A;  3F72 A;  2IGO A;  2MD0 A;  3DPL C;  3V8K A;  1K7A A;  3BTC A;  1I27 A;  1Z0X A;  2MSY A;  3HOV J;  3IAS 2;  2E19 A;  1LKX A;  2DAO A;  5K5O A;  4FQG A;  3V8J A;  3U1D A;  2R7W A;  2R5Z A;  3VFZ A;  3ZMZ A;  2ZXJ A;  1TNT A;  2YX4 A;  2MAB A;  4OU0 A;  3RI4 A;  1TWG J;  2XV4 S;  1R1V A;  3NAU A;  1LPQ A;  2O5R A;  4LG0 B;  4HAM A;  1MJA A;  3K1P A;  4JOM A;  3BG5 A;  2P0W A;  5A2Q K;  4UVB A;  1HW2 A;  3JTG A;  1JUS A;  2R7O A;  5C44 J;  1VI0 A;  4ITV A;  5M3M J;  3ERE D;  2LKX A;  1KON A;  1ITY A;  4D9J A;  1VQ8 I;  4Z2Y A;  3DBR B;  1FYM A;  1E3P A;  2CYY A;  1A6Q A;  4RGX A;  5M3F J;  2XAG A;  3E1S A;  2CJJ A;  3N4M A;  3GTO J;  4L0Z B;  2PMZ A;  1W36 D;  3RPU A;  1YHQ I;  5HS8 A;  1UMQ A;  2RNJ A;  1WPK A;  3CCY A;  1JTY A;  1O3S A;  3PO2 J;  3CDL A;  2VL8 A;  3TKY A;  1V5F A;  3QOP A;  3G4S I;  3TW6 A;  2VKD A;  1I5Z A;  1HKQ A;  5JHF A;  1D5Y A;  3CP8 A;  3VWB A;  3DF8 A;  2RN7 A;  2K4B A;  3E5U A;  2L9S A;  3H5R A;  1W4M A;  2EZH A;  3HOT A;  4YIF A;  3ZP5 A;  1HW1 A;  2QZ8 A;  3ABM H;  2PX9 A;  3AKZ A;  3CJQ B;  3KZI C;  3HYI A;  5D8K B;  3ZMU A;  4N0B A;  4EV0 A;  2Q0O A;  3OYH A;  3HHH A;  4PGH A;  5HDN A;  4FX0 A;  2LNB A;  4BU2 A;  1ZN2 A;  1Z7L A;  2DJI A;  2XAS A;  3ZQI A;  4XQF A;  2CSO A;  3LFU A;  3JAM K;  1ETK A;  1ENH A;  1W5T A;  2BHZ A;  2RDP A;  5J8C A;  1EH6 A;  4Q48 A;  1B6A A;  1YYV A;  2EH3 A;  3KP4 A;  3I3L A;  4J01 A;  5ILU A;  3BG6 A;  4XKB A;  5CQE A;  5HDK A;  3K4N A;  1IN4 A;  2MH9 A;  3WHC A;  1QRY A;  1V4R A;  2ID6 A;  4HNV A;  1ZTR A;  3KZY A;  3E6D A;  2JT1 A;  3M4O J;  2DFH A;  3B73 A;  2UUZ A;  3E0J B;  2HKO A;  1MDM A;  4CUG A;  1XG1 A;  2BEO A;  2JPB A;  1WJE A;  4C2U A;  2NVT J;  3CUQ B;  3S93 A;  1HF0 A;  3TDU C;  4OIN F;  3CP2 A;  3HZJ A;  3BR2 A;  4Y3O A;  4QTR A;  3MZH A;  1I6H J;  5DTD A;  1HST A;  5EJC A;  3SZP A;  3FIS A;  4I2O A;  1E0E A;  1FMV A;  5JFR A;  1TC3 C;  1W0T A;  4E4H A;  3KYC B;  3VOD A;  1VQP I;  3F8B A;  1QNT A;  1SFU A;  2O8X A;  4PUS A;  1XC5 A;  2FEZ A;  5HNH A;  2PJP A;  1OLT A;  4N9H A;  1B9N A;  2LKP A;  3GTP J;  4N4N B;  4CH7 A;  1R71 A;  3DEW A;  4FX4 A;  3S8P A;  1IXR C;  1FBQ A;  2O0Y A;  4E7Z A;  1ULY A;  4XKV A;  2VKV A;  5H2F C;  5LFA A;  2XAU A;  2Z33 A;  1D1A A;  2WB1 N;  3FM3 A;  3WTY C;  2KJC A;  5B1A H;  2WV0 A;  3H9J A;  3S1N J;  2MC3 A;  3WTU C;  3WG7 H;  2XPW A;  4ENN A;  4CA0 A;  4GO1 A;  3HDD A;  4MNU A;  2K9M A;  5HLH A;  4S05 A;  2ZJP F;  2L7M P;  1YIO A;  2DA1 A;  1IRX A;  2WBM A;  4UB8 C;  4KYW A;  2KIQ A;  2DJN A;  2XB5 A;  3KET A;  4KFC A;  2DOE A;  3QPT A;  1ONV A;  4UVA A;  3S2H J;  3I4M J;  2JA8 J;  2BY2 A;  2AO9 A;  5M5W J;  1U3E M;  1VQ5 I;  1XGM A;  2L7Z A;  3B6A A;  3I58 A;  5HS7 A;  4XRS G;  1A31 A;  2HPM A;  2M45 A;  2JRT A;  4JQF A;  3GZ6 A;  4JX4 A;  1GV5 A;  2DU9 A;  2VKH A;  1DUX C;  3GEZ A;  1MSF C;  3W2W A;  3I64 A;  4GGG A;  4P5O A;  2XB0 X;  2DOD A;  2OAZ A;  3TL4 X;  2YX7 A;  1J9I A;  1FIA A;  1HDP A;  4IQ4 A;  4A0Y A;  3I0T A;  4L0Y B;  1F43 A;  2PQ8 A;  2RVC A;  1RUN A;  4RM2 A;  3IP4 B;  5D5W B;  4HYE A;  1MJB A;  2FML A;  1P7I A;  3WG9 A;  1FOX A;  4NQW A;  2W82 A;  4XON A;  2VJJ A;  3QPH A;  3F22 A;  1GHC A;  1FBU A;  4HQM A;  2ZNY A;  2IW5 A;  4IL6 C;  4U88 A;  1T0F A;  2DT5 A;  4U7D A;  2HOS A;  2HOT A;  1I3Q J;  3D5S C;  4M71 A;  4IKF A;  4DZP A;  4CO8 A;  3K4C A;  1MBK A;  2Y69 H;  1USS A;  1WHU A;  2HPI A;  3NWS A;  3JRC A;  2MGQ A;  4L5J A;  4IO9 F;  1HSJ A;  3P9C A;  3WU1 B;  3NAR A;  2VT3 A;  1X1B A;  1YE9 A;  4I09 A;  5M5Y J;  1BIB A;  3JR9 A;  1ETY A;  3SJM A;  1QPM A;  4ZYH A;  5E8I A;  3LSP A;  4I98 B;  2IA2 A;  3QU3 A;  4WXH A;  3R0J A;  2EFO A;  5F27 A;  2EIL H;  2CG4 A;  4HX8 A;  4ENM A;  2FBH A;  2Y48 A;  2HZT A;  1OCP A;  2P5K A;  2HDW A;  4M3G A;  1Q1H A;  1YX3 A;  2WAF A;  1Z05 A;  4BAC A;  1VZ0 A;  3IRQ A;  4M73 A;  2V9V A;  3CMM A;  1XSX A;  4AM3 A;  1VQM I;  1JUM A;  2K40 A;  3VOE A;  1STZ A;  5BPI A;  3KP3 A;  2MA3 A;  4JP0 A;  1PUF B;  1UHS A;  3K1M A;  4V19 K;  4P96 A;  4YRV A;  4ENK A;  2HDD A;  3IHU A;  4DNC A;  4ZDO A;  2E35 A;  1ZGA A;  3D5L A;  3P5J A;  4RB1 A;  3MN2 A;  3KZZ A;  3CES A;  3TDZ C;  3FXO A;  3H5N A;  2E1C A;  2W25 A;  2W4S A;  3AL0 C;  3MD2 A;  3M8J A;  4LD5 A;  1EV7 A;  4CYC A;  3GYH X;  2OF7 A;  3G6E I;  1JHF A;  4C2T A;  2GWR A;  1A36 A;  2P4W A;  3ECH A;  4IHS A;  4G6D A;  2R7U A;  4A3D J;  5J4V A;  2JQ7 A;  1U6G A;  4AID A;  1BI3 A;  4W1U A;  4E7I A;  1T0F C;  1UJ8 A;  4A3G J;  1FJL A;  3BOQ A;  2X0L A;  1HW5 A;  4HRI A;  3AG4 H;  1QZE A;  3P9K A;  4X1E A;  1ERD A;  1BR2 A;  2ZFW A;  1V5G A;  2HU9 A;  5D5U B;  3IL2 A;  1IG7 A;  2H94 A;  2Q2E B;  2MFZ A;  3VB2 A;  3ABK H;  4JX6 A;  1V5E A;  1YLF A;  4YG2 F;  4MFD A;  3ASO H;  1PP7 U;  2BHY A;  2K85 A;  1OKR A;  1OCO H;  3U2R A;  2Y0S N;  2DO7 A;  2EA2 A;  4DGW B;  3K4M A;  4XK4 A;  2KRH A;  3F23 A;  3K10 A;  2RNG A;  5KAI C;  1T6S A;  2VJ4 A;  4DOZ A;  3L2V A;  2OTJ I;  3C1D A;  5DV5 A;  3ZQC A;  3OYA A;  4A12 A;  2KIM A;  3CUQ A;  2IGN A;  4BUP A;  4UUS B;  4DBQ A;  3CMA I;  1CF7 B;  5D4R A;  1Y1W J;  2BW3 A;  1IV8 A;  4OOI A;  3JRF A;  4XSX F;  1P92 A;  3JW4 A;  2YU3 A;  4CCM A;  1BC8 C;  3GFL A;  4WXC A;  3CMY A;  1JI8 A;  4AVZ A;  2NVU B;  2YU9 J;  3MFK A;  2DOA A;  3NQO A;  2LP0 A;  3GFJ A;  2BVM A;  1W5S A;  1CQT A;  4DZJ A;  2JJ7 A;  2Y0M A;  3HUG A;  1SFX A;  4D7M A;  1BC7 C;  2KT0 A;  2WB1 A;  2ECC A;  3J81 K;  2P81 A;  1BL0 A;  3GTL J;  2HYJ A;  3IV5 A;  3HRS A;  3QRF F;  3WTW C;  5FKL A;  3BZK A;  3MKY B;  5ICE A;  3HIF A;  1P4W A;  3FKI J;  3V7R A;  2ISY A;  1YIT I;  4ESF A;  2VE9 A;  5EYR A;  2DFF A;  4RB0 A;  3LMM A;  4BQN A;  2X6O A;  4E7K A;  5BMZ A;  3W2A A;  2K3F A;  3BTJ A;  4ZYD A;  2OZU A;  5DEQ A;  3BJA A;  2CMP A;  5ILS A;  4Q4Z F;  1T08 B;  3AG1 H;  1ZKG A;  1U0J A;  2VI6 A;  4WF2 A;  4EJV A;  3ZPL A;  4IOC F;  3S17 J;  1LVA A;  1EA3 A;  1D8K A;  2MLK A;  5GTH C;  1KU7 A;  2LRD A;  3CJR B;  2O6G E;  5CJ9 A;  3DBH B;  2HNH A;  2E5N A;  3GO5 A;  3DP7 A;  1VQ7 I;  5IT3 A;  4HLY A;  3B02 A;  4NNJ A;  1RUO A;  5DDG A;  5E1Z B;  2A6T A;  3ESW B;  3HSR A;  5J6X A;  3V7S A;  4BGD A;  3S1M J;  4BL0 B;  5DCM B;  4EM0 B;  2BVL A;  2STW A;  2LR8 A;  2V79 A;  3CUQ C;  1MBJ A;  2VT2 A;  2W57 A;  1J75 A;  4O6J A;  4KJZ A;  2JRM A;  2R3S A;  3E6B A;  2GM4 A;  2WA0 A;  1H0M A;  3WU2 C;  2X1D A;  4UV9 A;  3SEZ A;  1ETV A;  1RKW A;  2IS4 A;  3LQR A;  3HGY A;  1BM9 A;  1Y56 A;  1X4O A;  3L2U A;  1BI2 A;  4L9J A;  3DTI A;  2XPV A;  2ELJ A;  1T38 A;  5DUI A;  4CHU A;  1FC3 A;  3G3Z A;  2D2W A;  1GUU A;  4R1H A;  4CCK A;  1N77 A;  4ZDL A;  5C4J J;  1F1Z A;  3ZCO A;  1MMG A;  4YFK F;  3UKG A;  1HKS A;  5LEJ A;  3KLN A;  4UVC A;  3LQQ A;  5GAE J;  5J4Y A;  3ECO A;  1SAX A;  2M1B A;  1YFH A;  5GPC A;  3KLO A;  4BHB A;  1BW6 A;  1Z6T A;  2GXG A;  1X1P A;  3CO7 C;  2CW8 A;  4PCQ A;  5K1Y A;  2DPD A;  4LLL A;  1S6L A;  1UZC A;  4LG3 A;  4RS8 A;  2VXZ A;  2F4I A;  2QF7 A;  4B1R A;  1DGW Y;  3SHF A;  4XRS A;  2E34 A;  5ED4 A;  2VIX A;  3IWF A;  4GFB A;  3PIP F;  1OYI A;  1G2H A;  2VOD A;  2LMD A;  2X51 A;  4Y13 A;  4B44 A;  1IN6 A;  3JRA A;  2V1X A;  1TWF J;  2NXN B;  4M9Z A;  4OMZ A;  1YRN A;  2VJ5 A;  3WE3 A;  2GAU A;  4WX9 A;  4A3E J;  5LHI A;  3RSN A;  2ISZ A;  1VF9 A;  1R49 A;  4LK0 F;  2W24 A;  4CSW A;  3CME I;  5JR3 A;  3IUO A;  3REO A;  2VC0 A;  4BBR J;  1K79 A;  5IT9 Z;  4AU7 A;  3QP5 A;  3K1N A;  4Q5S F;  1ZR2 A;  3NRV A;  3SFI A;  2LYC A;  3T8R A;  2O7O A;  3I5U A;  2E1O A;  1K4T A;  1WZ2 A;  2A05 A;  5FO5 A;  4CCO A;  2E7X A;  3RKW A;  4RAG A;  1G3W A;  5JHU A;  2G7U A;  3RKX A;  2G0E A;  5BQT A;  2XGX A;  1WJ5 A;  3ULQ B;  2X85 A;  3RPU D;  3OR1 C;  1ON2 A;  1P4X A;  3OSF A;  2CFX A;  3BRO A;  3ZRG A;  2CUJ A;  1UFM A;  3AG2 H;  1RES A;  4NC7 A;  2J5P A;  4DW6 A;  4KIT B;  3CLQ A;  3ZMS A;  3E5X A;  3EUK L;  4I01 A;  4DYC A;  5B5E C;  5L3E A;  3T5X A;  2ELH A;  4XID A;  4G9Y A;  2Q2E A;  5E1X A;  5KVR A;  2Y0S A;  3P9I A;  2Y30 A;  4AWX B;  2HQR A;  4ZZL A;  3ERM A;  4M6Y A;  4ON0 A;  4A3K J;  4WK8 F;  4XKC A;  1IRF A;  5TJJ A;  2VBW A;  4DIQ A;  3ZN0 A;  2Y31 A;  4IHY A;  2L3D A;  4KN4 X;  3PQJ A;  1KU2 A;  5FLM J;  1FYL A;  2VQL A;  5HLI A;  3TGN A;  3VEP A;  5IT9 K;  1QHH D;  4UUS A;  1ZGW A;  5AIP A;  4XMY A;  4XLA A;  4JBA A;  1CF7 A;  3HHG A;  2W48 A;  1K78 B;  4IF4 A;  1P2F A;  3DTE A;  2ZME B;  1WQ2 A;  1X58 A;  4Y17 A;  3S16 J;  2Y9Z A;  1BBY A;  3HGG A;  2KDO A;  3O3K A;  4BBS J;  1IXC A;  2IAI A;  4YII A;  3PM1 A;  5KHD A;  3TED A;  4HDU A;  1WWX A;  1YJW I;  4MTD A;  1YI2 I;  4HOB A;  3CC2 I;  1WGX A;  3HPG A;  1XSV A;  4KT6 A;  2H09 A;  3MKZ A;  1LFU P;  4II2 A;  3VYR B;  3OYL A;  5BNG A;  4J19 A;  4XOR A;  3MZ8 A;  2CRG A;  4QIW N;  1GLN A;  4RLQ A;  5F04 A;  2K86 A;  3WGI A;  2WV1 A;  2DYR H;  2L9R A;  2XF5 A;  4BQQ A;  3HKZ N;  3DV8 A;  1TZL A;  3HPH A;  4NC6 A;  3R4K A;  1MBG A;  1XMK A;  3ABT A;  5D5V B;  1EJ9 A;  1FNN A;  1XGS A;  4KMF A;  3FIW A;  1XTA A;  1DQU A;  3MVP A;  3OYM A;  2DA6 A;  2QQ9 A;  4CCJ A;  3OY9 A;  1TW2 A;  3OYC A;  2WAQ N;  2KZG A;  2VPR A;  3J80 Z;  2V1D A;  1MBE A;  2NS8 A;  3F8F A;  2XC7 A;  3COA C;  3ML6 A;  3OL4 A;  3ISP A;  1TWA J;  1GXP A;  1O3R A;  1IW7 F;  4UNO A;  4AC0 A;  3Q0U A;  2E71 A;  1I1S A;  3S14 J;  1LVK A;  4YEL A;  4RAZ A;  2CUF A;  5DCM A;  3CCU I;  4P9U A;  5HOO A;  2R7D A;  2IXS A;  1DU6 A;  2XGE A;  5CLS A;  4CZZ A;  1FOY A;  2RRE A;  3GTK J;  4I02 A;  1X2M A;  2XAF A;  1NG6 A;  3FWE A;  4YIR X;  5HNF A;  5F64 A;  2Y2Z A;  4KIS A;  3LFK A;  2V1U A;  5LGN A;  3CF5 F;  1YO5 C;  3BJ6 A;  2M34 A;  4FAS D;  3WTZ A;  2ELK A;  2G9W A;  3BR5 A;  2HR3 A;  5F1R A;  4RGS A;  4EAT A;  1REP C;  2P5V A;  5F6F A;  2XIG A;  3GWZ A;  3T8T A;  2K9N A;  3HRU A;  3S1R J;  2ESH A;  4ZH4 F;  4HV6 A;  4IPA A;  3K6G A;  5D6E A;  2BY0 A;  1TBX A;  1GV2 A;  3F0C A;  1H9T A;  1G59 A;  3J80 K;  2ZSH B;  3IH4 A;  3LWF A;  3E3V A;  3H3U A;  3HXL A;  5ERI A;  3JRB A;  3FMR A;  2DI3 A;  5C4X J;  3OYN A;  3RYR A;  4FIS A;  1T8I A;  2DMT A;  1N78 A;  4HDV A;  3NWT A;  4FE7 A;  4N4O B;  2EWN A;  2DXI A;  1F9N A;  3UNG C;  1U9O A;  3LL7 A;  1RC9 A;  3WU0 A;  5F0C A;  4CYC B;  2M7A A;  3E7L A;  4MO7 A;  4PSW A;  2NAZ A;  3DPT A;  2Z3Y A;  5EF6 A;  2Z5U A;  1RPW A;  3R61 A;  2VN2 A;  4BJ5 C;  1RI7 A;  4EMS A;  4ZTF A;  4ESJ A;  3CCJ I;  3G73 A;  3BT9 A;  3HOU J;  3BQZ A;  3HB9 A;  4C2M J;  5HS9 A;  4IHT A;  3IKT A;  1D0Z A;  4A93 J;  2KRC A;  2VE8 A;  3S1Q J;  1R5I D;  1MZB A;  2EB7 A;  4Q47 A;  4M6X A;  3H92 A;  2QQ8 A;  3RDI A;  4EVI A;  3MWM A;  2FXA A;  3EUA A;  2CUZ A;  3ABL H;  2LD5 A;  2M5W A;  2EFQ A;  2ICW G;  2M4G A;  4G12 A;  1DPU A;  2QUF A;  1B8I A;  1EKE A;  3KEO A;  1MGT A;  1A5J A;  1I1G A;  4MQV A;  1VQ4 I;  4BJ6 C;  1O7L A;  3OIO A;  3HSF A;  5DM7 F;  1HXD A;  4Y33 A;  4JK1 X;  1V54 H;  3KIO A;  1AKH B;  1U8B A;  2E2I J;  4BH9 A;  2F6C A;  4NUB A;  3LA3 A;  1HBX G;  3MQ0 A;  2NS7 A;  3OYK A;  3BTI A;  1PUE E;  1LB2 A;  4I76 A;  1RET A;  1YW9 A;  1ZG1 A;  2OUM A;  4LFU A;  2CQN A;  5DD8 A;  4R8H A;  4ZZD A;  4S04 A;  1U8R A;  3EQL F;  1JT0 A;  2A69 F;  1R1T A;  2EIM H;  2BW3 B;  1BOA A;  4XOT A;  1EF4 A;  1MND A;  2B7E A;  2FSW A;  1I39 A;  3O2P E;  4HSR A;  5LLQ A;  2VON A;  5IOZ A;  2OQR A;  1SMY F;  4YEJ A;  2X1C A;  4LIU A;  2QKL B;  2EFN A;  2BY1 A;  4BXU A;  3CDI A;  4C9Y A;  3VSK A;  2GQQ A;  1SMT A;  1FYK A;  1V3F A;  3MCZ A;  3HUG B;  2XKP A;  3K4L A;  2FBK A;  1BJZ A;  4PJN A;  4RM3 A;  4HNT A;  2LDU A;  2CGP A;  2C6Y A;  1K78 A;  1Z1D A;  2BBY A;  2CQ7 A;  2ZME A;  4ZJZ A;  2WWY A;  4BE1 A;  5GAH J;  1ZR4 A;  1VQN I;  1XGO A;  2H6C A;  1J5Y A;  3A2K A;  2X4H A;  2HQ5 A;  4PZJ A;  5B1B H;  1IUY A;  4Y7N J;  4G6T B;  1JKQ C;  2K9Q A;  3CJN A;  3FXQ A;  1UHW A;  2XRL A;  1POG A;  3JRE A;  1O3T A;  1BR4 A;  2CW7 A;  3CC4 I;  1HC8 A;  2VOP A;  2O8K A;  2DLL A;  4ZYE A;  1LJ9 A;  2OD5 A;  4HF0 A;  4IHV A;  1XCV A;  2R4G A;  2FX0 A;  5CQG A;  4BQO A;  5E8G A;  1GVJ A;  2EIK H;  2W85 A;  3QYE A;  4KNY A;  1E17 A;  3DKX A;  2XAJ A;  1ZG3 A;  3HKZ A;  3ZQL A;  1JT6 A;  1U2W A;  3FZV A;  3SYT A;  1GVD A;  3H0G J;  3CCR I;  3WHB A;  2R7F A;  1IDY A;  1MH4 A;  3TO9 A;  2VBY A;  2GA1 A;  2AS5 F;  3HOZ J;  3LA7 A;  2OJE D;  2K5C A;  2LG4 A;  3S32 A;  2DTR A;  4E7H A;  2EFP A;  2WAQ A;  1R22 A;  4A3B J;  4F55 A;  3W6J B;  5TGT A;  1ORK A;  4EM2 A;  3CCS I;  2VB6 A;  5FRN A;  1QQI A;  1WH5 A;  3OV8 A;  3RTR A;  2WAE A;  5BOX A;  1LFP A;  1XCB A;  4TV7 A;  1WI3 A;  4F93 B;  3Q9V A;  3HOS A;  2H8R A;  2EJR A;  1TNS A;  2XAQ A;  2HGC A;  1P6R A;  1X3Z B;  4OIP F;  5DCF A;  2HTJ A;  1K83 J;  2ZNZ A;  3HOX J;  5J1R A;  4P1W A;  4V2G A;  3FBI B;  3GW2 A;  4L9V A;  5IP9 J;  2RC4 A;  4FT8 A;  4Z6Y A;  1R36 A;  3DCF A;  4M3B A;  5JVT A;  1XMA A;  3BG7 A;  3W6K B;  2GXA A;  3FK6 A;  4J00 A;  2ZME C;  4F91 B;  1IRG A;  2M87 A;  4MHG A;  2JWT A;  4D5C A;  3Q5F A;  1DDN A;  1HA8 A;  4EJW A;  4G94 A;  5FFZ A;  2JA2 A;  2OTL I;  3FBN B;  2DMU A;  2R7Q A;  2HQN A;  2ETH A;  1XX5 A;  2OZ6 A;  1IZ1 A;  5D5X B;  1EH7 A;  3FDY A;  3OL3 A;  1NTC A;  2VXD A;  5H6R A;  1YRN B;  3EYI A;  4LLN A;  2IGK A;  2PEX A;  2QSG X;  1TQI A;  2DK5 A;  3CCM I;  1G3S A;  3B6C A;  4XR6 A;  3PNY A;  1H88 C;  2ZXH A;  3DXJ F;  1F4K A;  2R7Z J;  1WJF A;  1D8J A;  4A3J J;  2KIS A;  5B3S H;  1DU0 A;  3HC7 A;  4CCL A;  3SDG A;  2JUC A;  1MNE A;  1R5H A;  3M1C A;  1JHH A;  1FOW A;  4M74 A;  4K2E A;  2KZV A;  3P7N A;  4XBF A;  2DK8 A;  3GXO A;  2WY7 Q;  5LEK A;  5JVG F;  3OOP A;  1W36 C;  1UAA A;  2JA6 J;  2XKO A;  4DJA A;  2DYS H;  1QBJ A;  1KA8 A;  1UST A;  2FUG 2;  2EV6 A;  4LLG F;  3J7Z I;  3ZR8 X;  4RB2 C;  4BEH B;  2CV1 A;  1DGR M;  2QVO A;  3GTM J;  1Z67 A;  3HG9 A;  1R6R A;  3HTU A;  4A3F J;  4U0W A;  3ZQ7 A;  1FEX A;  3MZY A;  2NYX A;  1RKT A;  2VBZ A;  3BPV A;  5LHG A;  1MMA A;  1Y8R B;  4U7B A;  4HF1 A;  4OWR B;  1IXS B;  3PO3 J;  1ETW A;  5K7Z A;  1G4D A;  1AKH A;  2GXB A;  4C30 A;  2Y9Y A;  3BG3 A;  1JTX A;  2QBY A;  1V55 H;  2Z16 A;  3ZOB A;  5J40 A;  1G3Y A;  1UEL B;  2VQG A;  5ILV A;  2E1N A;  5ICF A;  1XPX A;  1RZ4 A;  3J7A Y;  4MEY F;  2LVS A;  3IRR A;  3OOU A;  3CJT B;  3V42 A;  3BR3 A;  3O8H A;  1XMX A;  3DEE A;  2H8W A;  4AUX A;  2A6H F;  3SXY A;  4QLC U;  3E6M A;  2L7K A;  5GTI C;  1JKR C;  2KPM A;  2R7V A;  4OMY A;  4FET A;  3EYY A;  1SD6 A;  2XVC A;  2EQR A;  2VQC A;  3GFM A;  2EA4 A;  3M7G A;  1HCR A;  2CU7 A;  3LSH A;  3QOD A;  4B4C A;  3WTT C;  3DQV C;  1SAU A;  4L5E A;  1RNL A;  1T98 A;  5K7F A;  3DBL B;  4GDF A;  4UUT A;  4C3H J;  4PFO A;  3FHZ A;  3C3W A;  2KJB A;  3ZGK A;  4EJU A;  2CO5 A;  1VTN C;  2A07 F;  1JGS A;  3IH2 A;  1P7J A;  2L2O A;  1LE8 A;  2MG4 A;  1OYY A;  2A6E F;  1RR7 A;  2RKH A;  3F8N A;  1L0O C;  2VKE A;  3C18 A;  4BE0 A;  1X3U A;  2MLG A;  2NOG A;  3OYJ A;  4IHW A;  1R4M B;  2VLA A;  5CYV A;  3M8E A;  2E60 A;  3RKQ A;  1FSH A;  4OIQ F;  3CLO A;  4MEX F;  2V6E A;  3VYS B;  4I7H A;  1FMW A;  1XD7 A;  4Y4R A;  4XN3 A;  1J2X A;  1XGN A;  2A68 F;  4KT5 C;  2QEN A;  1S9H A;  3L2C A;  1BI0 A;  1Y1V J;  5L3D A;  2AXL A;  4HX4 A;  5E79 C;  1ZYR F;  2FBI A;  3M9A A;  2Q1Z B;  4BE2 A;  2R7T A;  3F8C A;  5ICC A;  2DA4 A;  4AYB N;  3FHN A;  2DA7 A;  1IF1 A;  1L3L A;  2OPT A;  3JSO A;  5AON A;  2D1V A;  1ZEL A;  4WXD A;  5D4S A;  3CCV I;  4WCG A;  4B48 A;  4AIK A;  4BY1 J;  2V6C A;  2HZD A;  1B1B A;  2ZO4 A;  3C2G A;  4XRM A;  4M3D A;  4M3F A;  2MW8 A;  3MAJ A;  3GFI A;  4DYR A;  1R9T J;  2PMH A;  1ZRD A;  1BOB A;  2P7V B;  3SQN A;  2I10 A;  5HLT A;  2UZK A;  3PSI A;  2COM A;  3VYT B;  3K9T A;  3MKL A;  1TWH J;  4LK1 F;  3G71 I;  2F5D A;  3KEQ A;  1KYW A;  1D0X A;  5CPR B;  5EZH A;  4ASN A;  2OQG A;  5E3N A;  1KGS A;  2ESN A;  3R0A A;  2XHK A;  4EJO A;  2HQA A;  3BTL A;  3HEF A;  3DTK A;  3JRH A;  5E3L A;  2OC6 A;  1TQM A;  4BKX A;  1A04 A;  3RQI A;  1JJ6 C;  3KEY A;  1O57 A;  2HTS A;  3PUF A;  2JVH A;  4NDL A;  2F5F A;  2DDB A;  2KKO A;  2A3S A;  4A6D A;  5FJ8 J;  2NVX J;  2JK3 A;  3RZD J;  2IBD A;  2IRF G;  4IZZ A;  3I9V 2;  4PJ0 C;  3JRI A;  4M9X A;  4IOA F;  2QSF X;  5LRS A;  1E3O C;  2CW0 F;  1SAN A;  2VPL A;  3RYP A;  3K4K A;  2LY2 A;  4IRG A;  2HVS A;  2E36 A;  4XRF A;  3VSL A;  4IVN A;  1W1W E;  2QYO A;  3Q3S A;  1B4A A;  4BXF A;  1JKP C;  2K9L A;  2L9N A;  5FKK A;  3FKJ A;  4CDG A;  1BN5 A;  1IO2 A;  4U0V A;  5J1Y A;  2QCO A;  1D5V A;  4N9I A;  3F21 A;  4IX7 A;  3PL8 A;  3MMY B;  2ZKZ A;  5FRM A;  3TMO A;  1JXS A;  3JSP A;  1J59 A;  3TOB A;  4XKW A;  2BE5 F;  1T2K A;  2CWE A;  3LSK A;  4QPQ A;  1NK3 P;  1B8I B;  5IP7 J;  3S3N A;  1H9G A;  2V7F A;  2K02 A;  1MD0 A;  3BDD A;  3LSI A;  2JSP A;  3OYE A;  2VQH A;  1NHA A;  4A3I J;  1FLI A;  4E7S A;  5J1U A;  3WGH A;  3OS0 A;  3ZMT A;  2L0K A;  2K9S A;  2PG4 A;  2GOM A;  2XRO A;  5D8L B;  5IYB J;  2F4O B;  2QQB A;  4BEH A;  1ZLK A;  4KIF A;  4KN7 X;  3I53 A;  3A03 A;  2EV0 A;  4PJM A;  3I4N J;  3A0B C;  3R6S A;  3H9Q A;  2X6Y A;  3PJR A;  2CQQ A;  1TLH B;  1BJA A;  5BPD A;  3CZ6 A;  2DN0 A;  2XF6 A;  5C3E J;  4UB6 C;  3I56 I;  1LNW A;  3LNQ A;  4XN0 A;  3HBL A;  4A3C J;  1K4S A;  3DU5 A;  3J7A O;  4B47 A;  1HQC A;  1FTT A;  2K4J A;  3DWL E;  2TRT A;  1Z6R A;  4EGZ A;  1VQL I;  2BV6 A;  2MYS A;  4NC8 A;  5LHH A;  3M8F A;  1FP1 D;  1Y6I A;  4AVP A;  1MIJ A;  4XLH A;  2JVG A;  3M07 A;  2E5Z A;  5GAD J;  2L7F P;  2X48 A;  1QO0 D;  1SFO J;  4A5N A;  4KIC A;  1FIP A;  2EZL A;  2QM3 A;  3BZ6 A;  3W2V A;  5HOD A;  3QWL A;  5FLX Z;  3JRD A;  2EV5 A;  4OIO F;  2F5V A;  5F0F A;  2MD5 A;  1ZQ3 P;  3BC8 A;  3K70 C;  2Z99 A;  2F5E A;  1A35 A;  5D6F A;  3OYI A;  5TIS C;  1MMS A;  2PI0 A;  2HKX A;  2YR2 A;  5EEA A;  2FQ3 A;  4LIV A;  1X1C A;  1XDS A;  1YW7 A;  3I59 B;  3F8M A;  1QGP A;  2DTZ A;  4EEF G;  5FKN A;  2IJL A;  3BCA A;  3N05 A;  3O8G A;  4DYQ A;  1TL8 A;  1ON1 A;  2L4M A;  4HZF A;  2P5L C;  1X4P A;  4BS9 A;  1LDD A;  2L4A A;  1M1E B;  2P6T A;  3FXR A;  5EGO B;  1QZY A;  1JKO C;  1SEU A;  1S72 I;  2LRE A;  2KIU A;  4HX7 A;  3D1N I;  2A5W A;  3MEX A;  1I3A A;  2XF7 A;  4KMU X;  1AWC A;  1BW5 A;  2ZFU A;  4EGY A;  1ZAR A;  3RPQ A;  4LMY A;  2HDC A;  3IWZ A;  5IP6 A;  5DM6 F;  1X1D A;  1I6X A;  1MBF A;  2DOF A;  4MLO A;  1RR8 C;  3GCM A;  3PIO F;  4GYG A;  2F5C A;  1W0U A;  2QLZ A;  5FGM A;  4ZC3 A;  1QVU A;  2IVM A;  2M7B A;  4BY7 J;  1WJA A;  4AYB A;  1IV6 A;  1IGN A;  4PJL A;  2H1L A;  3K2Z A;  5EG0 B;  4B8X A;  2H1K A;  1QHG A;  5FLX K;  1ZLJ A;  2DA2 A;  1KQ0 A;  1VND A;  3BJO A;  2A5Y B;  2QSH X;  1OQY A;  3RJP A;  1U5T A;  3BCB A;  1VQO I;  1G8X A;  4RA2 A;  3W6V A;  2ACJ A;  1FP2 A;  4ZTJ A;  2O61 A;  2R5Y A;  1D1C A;  1Q1V A;  4XL9 A;  3H5A A;  4M6V A;  1H89 C;  3GX4 X;  4E7J A;  5E20 A;  3GME A;  3HM5 A;  2LF8 A;  2X6X A;  5FD6 A;  1OPC A;  4HLX A;  2W84 A;  3I4P A;  3KE2 A;  3IC7 A;  5FB2 A;  2EBI A;  2EIJ H;  2KIF A;  2FNA A;  3TP0 A;  2GIZ A;  3JCU C;  1K61 A;  1J09 A;  2RQP A;  2CS3 A;  2XAH A;  2OV7 A;  1MSE C;  1IC8 A;  3I54 A;  4BAY A;  1FOK A;  4UXN A;  3KPH A;  4Y15 A;  2CUE A;  2FE3 A;  1QPI A;  3RKY A;  3HL2 A;  2CQX A;  4I6Z A;  2RV8 A;  3M1E A;  2BZT A;  1TWC J;  4HQE A;  3H3V K;  2HFH A;  1ZH5 A;  5CVR A;  3KP6 A;  3JAM Z;  1Y39 A;  4O3M A;  1OIS A;  4B3X A;  3L9F A;  5GP9 A;  4IJA A;  5JLX A;  2G7H A;  3T1B A;  4P9F A;  3DU6 A;  3FMQ A;  3AAF A;  4IEJ A;  4BXX J;  3O6B B;  2EIN H;  2DW4 A;  1W7P A;  4XM3 A;  2R92 J;  3L2R A;  4KIG A;  1R4N B;  3HRT A;  2K3P A;  3DEU A;  3KYD B;  4AIJ A;  5HLG A;  1OCC H;  3HRM A;  1KZH A;  2M3A A;  1A6I A;  2DBB A;  2PMU A;  3Q0V A;  5KK1 A;  1U78 A;  2VAS A;  3R60 A;  4ETS A;  4XLE A;  3AG3 H;  1OCR H;  2PLY A;  2O9L A;  2XDV A;  3L09 A;  1ZHF A;  1ETX A;  4H0E A;  1HKT A;  3GZN B;  3PNV A;  2M9H A;  2ZJR F;  3BG9 A;  3NEU A;  5H20 A;  4BNC A;  1U5T C;  1Z91 A;  4B09 A;  1R58 A;  4KUM A;  3BPX A;  5E17 F;  3ROU A;  2DT7 B;  5J3L A;  3GUD A;  1WJB A;  2DFI A;  3CDH A;  1H8A C;  4A5M A;  4FHT A;  4UHT A;  4G7H F;  2XPU A;  1G3T A;  1SVL A;  3ZQG A;  2UV1 A;  1ETO A;  3KCC A;  3TP3 A;  4FTH A;  4PDK A;  1IN8 A;  3HOW J;  1SD4 A;  2JUG A;  1WRJ A;  4BHC A;  3CCL I;  2LY9 A;  5IY5 H;  4D1Q A;  1NG7 A;  2OBP A;  2QBY B;  2M30 A;  5EEG A;  5IOY A;  3ELK A;  5HDG A;  4BHP A;  1TT5 B;  1HDD C;  1PVE A;  1B9M A;  1S29 A;  3CTA A;  3DLL F;  5FD5 A;  3FXL A;  2ZSI B;  3CCQ I;  2DMP A;  4UV8 A;  4MTE A;  3RCO A;  5BS6 A;  3BR6 A;  3U21 A;  4HG2 A;  3V7C A;  4FE4 A;  4C3J J;  4PK4 A;  1LEA A;  4ABZ A;  2JSC A;  4X6A J;  1LQ1 A;  2ME6 A;  1YTY A;  1FSE A;  4RB3 C;  3CQZ J;  2D1H A;  2LBF B;  5FKM A;  2WAD A;  3S15 J;  1LUJ B;  5F1J A;  1XB4 A;  1TTY A;  3LSJ A;  5AIQ A;  4A2U A;  4AIH A;  3FM5 A;  3FXK A;  1QA6 A;  2FA5 A;  4LB6 B;  1QZZ A;  2ECB A;  2P8T A;  2ZXW H;  1MBH A;  3OIQ A;  4RAY A;  2IPQ X;  4CIC A;  4IRH A;  2E2J J;  2OCC H;  2CV0 A;  4A3M J;  1LE8 B;  3OMY A;  3C7J A;  4XLF A;  3E97 A;  2X1E A;  1JUP A;  1B72 A;  1T33 A;  1YX5 A;  2XGD A;  1YS6 A;  3K4B A;  1Z3Y A;  3X2Q H;  1IRZ A;  3S3M A;  2ZJ2 A;  2FU4 A;  1YJN I;  2GLO A;  3I59 A;  4E7L A;  4S0H B;  3CF2 A;  3GVA A;  4FCY A;  1KQ8 A;  3QOE A;  3TOA A;  3OYD A;  1O3Q A;  5GPA A;  4RGR A;  3BY6 A;  2M8G X;  3FXM A;  2V9P A;  5EGO A;  1OMI A;  2LY1 A;  2RQQ A;  2AQF A;  4XIC A;  4KA4 A;  3OR2 C;  4O5V A;  3ZXS A;  1UG2 A;  3KX2 A;  1OCZ H;  2KP6 A;  3TW7 A;  5CVI A;  1XS9 A;  2LF7 A;  1X1A A;  4EM1 A;  4A0X A;  3KP5 A;  3OS1 A;  1W5C C;  4I99 C;  1TP4 A;  1B59 A;  4BDZ A;  4CXF A;  3GZ5 A;  2GOX B;  3A02 A;  3FXJ A;  2IS1 A;  3GTG J;  1PYV A;  1G6N A;  2R7S A;  3E6C C;  4I0A A;  2LTP A;  3EUH A;  3BZC A;  2Z2S B;  4EQQ A;  5EG0 A;  3EET A;  2V26 A;  2DMN A;  2H6B A;  2GIV A;  4I0B A;  1HLV A;  1K6O A;  1F5T A;  3F6O A;  5L3C A;  2B9S A;  1Y0U A;  3H0D A;  5LBQ A;  2VUM J;  2F2E A;  2L9V A;  2JN6 A;  3ZQH A;  1Y0N A;  4ANJ A;  2HVR A;  5FLV A;  2LH9 A;  4HBL A;  1Z7U A;  2ZCW A;  6PAX A;  3LSR A;  3SZG A;  1JJ8 C;  2LFB A;  4E6K G;  2OCE A;  2QQA A;  3RIR A;  2VOO A;  4GCV A;  4V2F A;  4QSH A;  2HOE A;  3TBI A;  4LIT A;  4JX5 A;  1S7O A;  5L3B A;  2DT6 A;  1KU9 A;  3FXU A;  3OIP A;  4RDU A;  3GLX A;  1U9N A;  3HSE A;  3SFZ A;  2L02 A;  1P4A A; 
#chains in the Genus database with same CATH homology
 2HYG D;  4L5I A;  4LG0 A;  2Z9O A;  1JE8 A;  3WE2 A;  1BI1 A;  4UUV A;  2NNY A;  4CYD A;  2L01 A;  4LB5 A;  4L9T A;  5DD4 A;  1C0W A;  2PBI A;  2NRA C;  5J8F A;  2VBX A;  2Y75 A;  1AOY A;  3Q9S A;  2JTV A;  2GZW A;  2B0L A;  4G7O F;  1LDJ A;  5L3G A;  1FBS A;  2STT A;  1LEB A;  4RGU A;  1ZRC A;  2UXN A;  3N97 A;  3ABU A;  3T0Y A;  2PN6 A;  4EJT A;  3J81 Z;  1R7J A;  1PP8 F;  2NS0 A;  2UWM A;  1YW8 A;  2FF4 A;  1RIO H;  2MH2 A;  1S7A A;  4YFX F;  2LSO A;  4A6E A;  4MGR A;  3U9G A;  3FX3 A;  1IAW A;  2BGC A;  1PDN C;  2EK5 A;  1SD7 A;  3LAJ A;  1ZRF A;  1UHM A;  3FMS A;  3SZT A;  3K69 A;  4XLN F;  5LGT A;  2VC1 A;  2HS5 A;  5H6Q A;  4MQ9 F;  2O3F A;  1WSU A;  2FOK A;  4G7Z F;  4A0Z A;  2YPR A;  2HEO A;  4LGW A;  1WKM A;  3EDP A;  2MBF A;  2O03 A;  2P7C B;  3JTH A;  2FMY A;  2FNP A;  3GF2 A;  4LJZ F;  2DPU A;  2RGV A;  1ZG5 A;  3I71 A;  1KQ9 A;  3K0L A;  4R79 A;  3PFI A;  1WI9 A;  3FF5 A;  4XLP F;  1XSD A;  1KYZ A;  1ODD A;  1CGP A;  2M8E A;  2IA1 A;  2H27 A;  3QAH A;  1U5T B;  4GXO A;  1ZGJ A;  3KFW X;  5LGU A;  1FPQ A;  1FWZ A;  3WTS C;  1OR7 A;  3BWG A;  2XUB A;  4M72 A;  3L00 A;  2DQR A;  1YS7 A;  1FY7 A;  2J5O A;  4G8X A;  2HWV A;  3ZN1 A;  5E1W A;  3L7W A;  3V4G A;  1ZRE A;  4L9N A;  5E18 F;  3H3Z A;  5K5Q A;  2ZBK A;  1FT9 A;  4E70 A;  4DQ2 A;  1W7P B;  3TO7 A;  2WC2 A;  3F3X A;  2IT0 A;  5CVU A;  5DYM A;  2FRH A;  2GA2 A;  1MKM A;  1J0R A;  5EEH A;  3DKW A;  3V8L A;  1LDK B;  2PFB A;  3KP2 A;  4BYY A;  3TO6 A;  5L3F A;  3TQN A;  3E5Q A;  1FX7 A;  1Z9C A;  2JPC A;  3QP6 A;  2UXX A;  4YFN F;  4HW0 A;  2NNN A;  2OA4 A;  2KRF A;  1IN7 A;  2IP2 A;  5DUK A;  4OIR F;  3KP7 A;  1XN7 A;  4CGZ A;  1OYW A;  1R5G A;  1KU3 A;  5CVJ A;  3BP8 A;  3HTS B;  3WTV C;  1SD5 A;  4QWQ A;  4G6Q A;  5K5R A;  4D0P A;  4ESB A;  1TQP A;  3WTX C;  2XRN A;  4BQA A;  4HF2 A;  3QU6 A;  2WTE A;  2YSR A;  3ZMD A;  4XSZ F;  1TW3 A;  2EFW A;  1UB9 A;  4NHJ A;  4KDP A;  2CQK A;  1UCR A;  1W7P D;  4P55 A;  4M9S A;  1R1U A;  2P6S A;  1T39 A;  5ICG A;  1MDM B;  4NB5 A;  1YG2 A;  4AD9 A;  5HVQ C;  1E2X A;  4KIB A;  1O7F A;  4F7Z A;  3ZMV A;  2HYF A;  1IN5 A;  5JI6 A;  1MJ9 A;  4IRI A;  1S8N A;  4U0Y A;  1DP7 P;  4PGG A;  3D0S A;  2QWW A;  3S2W A;  1FZP B;  4IXA A;  2L54 A;  2A61 A;  1SFE A;  1EH8 A;  2OU2 A;  1GXQ A;  2IA0 A;  3CO6 C;  3DFG A;  3IKV A;  1BIA A;  1DPR A;  2D45 A;  3LAP A;  3LST A;  4ENJ A;  4HV5 A;  1S3J A;  4HA8 A;  1J7K A;  2JZY A;  5A2Q Z;  1YQA A;  1R00 A;  4WWC A;  2K7L A;  3WGG A;  4GYI A;  5LRR A;  4L18 B;  3LA2 A;  2E7W A;  4ZYG A;  2ADU A;  1XDU A;  2TDX A;  3WOD F;  2K27 A;  5FFX A;  2DQL A;  2BYV E;  3PQK A;  1ZAO A;  1D3Y A;  3F6V A;  1R23 A;  5CVV A;  2Q8K A;  3CUO A;  3F72 A;  3V8K A;  3DPL C;  1K7A A;  1I27 A;  2DAO A;  5K5O A;  3V8J A;  3U1D A;  3VFZ A;  3ZMZ A;  2ZXJ A;  1TNT A;  2YX4 A;  4OU0 A;  3RI4 A;  2XV4 S;  1R1V A;  4LG0 B;  4HAM A;  1MJA A;  3K1P A;  5A2Q K;  4UVB A;  1HW2 A;  3JTG A;  3ERE D;  4Z2Y A;  1FYM A;  2CYY A;  4RGX A;  2XAG A;  3N4M A;  4L0Z B;  3RPU A;  5HS8 A;  2RNJ A;  1O3S A;  3TKY A;  3QOP A;  1I5Z A;  1HKQ A;  3DF8 A;  2RN7 A;  2K4B A;  3E5U A;  1W4M A;  3HOT A;  4YIF A;  3ZP5 A;  1HW1 A;  2QZ8 A;  3HYI A;  5D8K B;  3ZMU A;  4N0B A;  4EV0 A;  2Q0O A;  3HHH A;  4PGH A;  5HDN A;  4FX0 A;  2LNB A;  1ZN2 A;  2XAS A;  2CSO A;  3JAM K;  1W5T A;  2RDP A;  5J8C A;  1EH6 A;  4Q48 A;  1B6A A;  1YYV A;  3KP4 A;  5ILU A;  5HDK A;  1IN4 A;  2MH9 A;  1V4R A;  3KZY A;  3E6D A;  2JT1 A;  3B73 A;  2HKO A;  1MDM A;  2BEO A;  2JPB A;  3CUQ B;  3TDU C;  4OIN F;  3MZH A;  1HST A;  3SZP A;  4I2O A;  5JFR A;  3VOD A;  3F8B A;  1QNT A;  1SFU A;  2O8X A;  2FEZ A;  2PJP A;  4N9H A;  1B9N A;  2LKP A;  4FX4 A;  1IXR C;  1FBQ A;  2O0Y A;  1ULY A;  2Z33 A;  3FM3 A;  3WTY C;  2KJC A;  2WV0 A;  2MC3 A;  3WTU C;  4ENN A;  4GO1 A;  4MNU A;  5HLH A;  4S05 A;  1YIO A;  4KYW A;  3KET A;  4KFC A;  3QPT A;  1ONV A;  4UVA A;  1U3E M;  1XGM A;  3I58 A;  5HS7 A;  2M45 A;  2JRT A;  4JQF A;  3GZ6 A;  1DUX C;  2DU9 A;  3GEZ A;  3I64 A;  4GGG A;  4P5O A;  2OAZ A;  2YX7 A;  1J9I A;  4A0Y A;  3I0T A;  4L0Y B;  2PQ8 A;  2RVC A;  1RUN A;  5D5W B;  4HYE A;  1MJB A;  2FML A;  3WG9 A;  4NQW A;  3QPH A;  3F22 A;  1GHC A;  1FBU A;  4HQM A;  2ZNY A;  2IW5 A;  4U88 A;  4U7D A;  1T0F A;  2DT5 A;  4M71 A;  4CO8 A;  1USS A;  4L5J A;  1HSJ A;  3P9C A;  3WU1 B;  2VT3 A;  4I09 A;  1BIB A;  1QPM A;  4ZYH A;  5E8I A;  4I98 B;  2IA2 A;  3QU3 A;  4WXH A;  3R0J A;  2EFO A;  2CG4 A;  4HX8 A;  4ENM A;  2FBH A;  2Y48 A;  2HZT A;  2P5K A;  1Q1H A;  1Z05 A;  3IRQ A;  4M73 A;  2V9V A;  1XSX A;  3VOE A;  1STZ A;  5BPI A;  3KP3 A;  2MA3 A;  3K1M A;  4P96 A;  4ENK A;  3IHU A;  4DNC A;  1ZGA A;  3D5L A;  4RB1 A;  3KZZ A;  3TDZ C;  2E1C A;  2W25 A;  4LD5 A;  1EV7 A;  3GYH X;  1JHF A;  2GWR A;  2P4W A;  3ECH A;  4IHS A;  4G6D A;  1U6G A;  1BI3 A;  3BOQ A;  2X0L A;  1HW5 A;  3P9K A;  2ZFW A;  5D5U B;  3IL2 A;  2H94 A;  3VB2 A;  4YG2 F;  1YLF A;  1PP7 U;  1OKR A;  3U2R A;  2DO7 A;  2EA2 A;  3F23 A;  1T6S A;  3C1D A;  5DV5 A;  4A12 A;  2KIM A;  3CUQ A;  1CF7 B;  5D4R A;  4OOI A;  4XSX F;  1P92 A;  3JW4 A;  2YU3 A;  1BC8 C;  3GFL A;  4WXC A;  3MFK A;  3NQO A;  3GFJ A;  1W5S A;  2Y0M A;  3HUG A;  1SFX A;  1BC7 C;  3J81 K;  3QRF F;  3HRS A;  3WTW C;  5ICE A;  3HIF A;  1P4W A;  3V7R A;  2ISY A;  4ESF A;  2VE9 A;  4RB0 A;  5BMZ A;  4ZYD A;  2OZU A;  5DEQ A;  3BJA A;  5ILS A;  4Q4Z F;  4EJV A;  4WF2 A;  3ZPL A;  1LVA A;  1D8K A;  2MLK A;  1KU7 A;  2O6G E;  5CJ9 A;  3GO5 A;  3DP7 A;  5IT3 A;  4HLY A;  3B02 A;  1RUO A;  5DDG A;  5E1Z B;  3HSR A;  5J6X A;  3V7S A;  5DCM B;  4EM0 B;  2STW A;  2V79 A;  3CUQ C;  2W57 A;  2VT2 A;  1J75 A;  4O6J A;  2R3S A;  3E6B A;  1H0M A;  4UV9 A;  3LQR A;  1BM9 A;  1BI2 A;  4L9J A;  1T38 A;  5DUI A;  4CHU A;  1FC3 A;  3G3Z A;  2D2W A;  4R1H A;  1F1Z A;  4YFK F;  1HKS A;  5LEJ A;  3KLN A;  4UVC A;  3LQQ A;  3ECO A;  1SAX A;  2M1B A;  1YFH A;  3KLO A;  4BHB A;  1Z6T A;  2GXG A;  3CO7 C;  4PCQ A;  5K1Y A;  2DPD A;  4LLL A;  1S6L A;  4RS8 A;  2VXZ A;  3SHF A;  5ED4 A;  3IWF A;  1OYI A;  2VOD A;  4Y13 A;  1IN6 A;  2V1X A;  4M9Z A;  4OMZ A;  3WE3 A;  2GAU A;  4WX9 A;  5LHI A;  2ISZ A;  4LK0 F;  2W24 A;  5JR3 A;  3REO A;  2VC0 A;  1K79 A;  5IT9 Z;  3QP5 A;  3K1N A;  4Q5S F;  3NRV A;  3T8R A;  3I5U A;  5FO5 A;  2E7X A;  3RKW A;  1G3W A;  5JHU A;  2G7U A;  3RKX A;  5BQT A;  2XGX A;  3ULQ B;  1ON2 A;  1P4X A;  2CFX A;  3BRO A;  1UFM A;  2J5P A;  3ZMS A;  3E5X A;  4I01 A;  5L3E A;  3T5X A;  2ELH A;  4G9Y A;  2Q2E A;  5E1X A;  5KVR A;  3P9I A;  4AWX B;  2HQR A;  4ZZL A;  4M6Y A;  4ON0 A;  4WK8 F;  1IRF A;  5TJJ A;  2VBW A;  3ZN0 A;  2L3D A;  4KN4 X;  3PQJ A;  1KU2 A;  1FYL A;  5HLI A;  3TGN A;  3VEP A;  5IT9 K;  5AIP A;  1CF7 A;  4JBA A;  3HHG A;  1K78 B;  4IF4 A;  1P2F A;  2ZME B;  1WQ2 A;  4Y17 A;  1BBY A;  3O3K A;  1IXC A;  4YII A;  4HDU A;  1WWX A;  4MTD A;  4HOB A;  1XSV A;  2H09 A;  2K86 A;  3WGI A;  3DV8 A;  3R4K A;  1XMK A;  3ABT A;  5D5V B;  1FNN A;  1XGS A;  4KMF A;  2QQ9 A;  1TW2 A;  3J80 Z;  2V1D A;  3F8F A;  3COA C;  3ML6 A;  3ISP A;  1GXP A;  1O3R A;  1IW7 F;  4UNO A;  1I1S A;  4RAZ A;  5DCM A;  4P9U A;  5HOO A;  2R7D A;  5CLS A;  4CZZ A;  4I02 A;  2XAF A;  3FWE A;  5F64 A;  3LFK A;  2V1U A;  5LGN A;  1YO5 C;  3BJ6 A;  3WTZ A;  2G9W A;  2HR3 A;  5F1R A;  4RGS A;  1REP C;  2P5V A;  5F6F A;  2XIG A;  3GWZ A;  3T8T A;  3HRU A;  2ESH A;  4ZH4 F;  4HV6 A;  4IPA A;  5D6E A;  1TBX A;  1H9T A;  3J80 K;  3LWF A;  3E3V A;  3H3U A;  5ERI A;  3FMR A;  2DI3 A;  3RYR A;  4HDV A;  2EWN A;  1F9N A;  3WU0 A;  2NAZ A;  3DPT A;  2Z3Y A;  2Z5U A;  3R61 A;  2VN2 A;  1RI7 A;  4EMS A;  4ESJ A;  3G73 A;  5HS9 A;  4IHT A;  3IKT A;  2VE8 A;  2EB7 A;  1MZB A;  4Q47 A;  4M6X A;  3H92 A;  3RDI A;  4EVI A;  3MWM A;  2FXA A;  2M5W A;  2EFQ A;  1DPU A;  2QUF A;  3KEO A;  1MGT A;  1I1G A;  4MQV A;  1O7L A;  3HSF A;  1HXD A;  4JK1 X;  4BH9 A;  3LA3 A;  1HBX G;  3MQ0 A;  1PUE E;  1LB2 A;  1YW9 A;  1ZG1 A;  4LFU A;  5DD8 A;  4R8H A;  4ZZD A;  4S04 A;  1U8R A;  3EQL F;  2A69 F;  1R1T A;  1BOA A;  2FSW A;  3O2P E;  5LLQ A;  2VON A;  2OQR A;  1SMY F;  2EFN A;  4BXU A;  2GQQ A;  1SMT A;  1FYK A;  1V3F A;  3MCZ A;  2XKP A;  2FBK A;  2LDU A;  2CGP A;  2C6Y A;  1K78 A;  1Z1D A;  2BBY A;  2ZME A;  2WWY A;  1XGO A;  2H6C A;  1J5Y A;  2X4H A;  4PZJ A;  1IUY A;  3CJN A;  3FXQ A;  1UHW A;  1O3T A;  2VOP A;  2DLL A;  4ZYE A;  1LJ9 A;  2OD5 A;  4HF0 A;  1XCV A;  5E8G A;  1GVJ A;  2W85 A;  4KNY A;  1E17 A;  2XAJ A;  1ZG3 A;  1U2W A;  3FZV A;  2R7F A;  3TO9 A;  2VBY A;  2GA1 A;  2AS5 F;  3LA7 A;  2DTR A;  2EFP A;  1R22 A;  3W6J B;  4EM2 A;  1QQI A;  3OV8 A;  3RTR A;  5BOX A;  1XCB A;  4TV7 A;  3Q9V A;  3HOS A;  2EJR A;  1TNS A;  2XAQ A;  2HGC A;  1P6R A;  4OIP F;  5DCF A;  2HTJ A;  2ZNZ A;  3GW2 A;  4L9V A;  2RC4 A;  4FT8 A;  1R36 A;  5JVT A;  1XMA A;  3W6K B;  1IRG A;  2M87 A;  4MHG A;  3Q5F A;  1DDN A;  4EJW A;  4G94 A;  5FFZ A;  2HQN A;  2ETH A;  2OZ6 A;  1IZ1 A;  5D5X B;  1EH7 A;  5H6R A;  3EYI A;  4LLN A;  2PEX A;  1TQI A;  2DK5 A;  1G3S A;  3DXJ F;  1F4K A;  1D8J A;  1R5H A;  4M74 A;  1JHH A;  4K2E A;  3P7N A;  4XBF A;  2DK8 A;  3GXO A;  5LEK A;  3OOP A;  2XKO A;  1QBJ A;  1KA8 A;  1UST A;  2EV6 A;  4LLG F;  4RB2 C;  2QVO A;  3HTU A;  4U0W A;  3ZQ7 A;  3MZY A;  2NYX A;  2VBZ A;  3BPV A;  5LHG A;  4U7B A;  4HF1 A;  1IXS B;  1G4D A;  2GXB A;  2QBY A;  1G3Y A;  5ILV A;  2E1N A;  5ICF A;  1RZ4 A;  4MEY F;  3IRR A;  2A6H F;  3SXY A;  4QLC U;  3E6M A;  4OMY A;  3EYY A;  1SD6 A;  2XVC A;  3GFM A;  2EA4 A;  3M7G A;  3WTT C;  3DQV C;  1RNL A;  1T98 A;  3FHZ A;  3C3W A;  2KJB A;  4EJU A;  2CO5 A;  1VTN C;  2A07 F;  1JGS A;  1OYY A;  2A6E F;  2RKH A;  3F8N A;  1L0O C;  3C18 A;  1X3U A;  2MLG A;  5CYV A;  3M8E A;  1FSH A;  4OIQ F;  3CLO A;  4MEX F;  4I7H A;  1XD7 A;  1J2X A;  1XGN A;  2A68 F;  4KT5 C;  2QEN A;  3L2C A;  1BI0 A;  5L3D A;  2AXL A;  4HX4 A;  1ZYR F;  3M9A A;  2FBI A;  3F8C A;  5ICC A;  1IF1 A;  1L3L A;  3JSO A;  5AON A;  2D1V A;  4WXD A;  5D4S A;  4WCG A;  4AIK A;  2V6C A;  2ZO4 A;  1B1B A;  3MAJ A;  3GFI A;  2PMH A;  1ZRD A;  2P7V B;  3SQN A;  2UZK A;  2COM A;  3K9T A;  4LK1 F;  2F5D A;  3KEQ A;  1KYW A;  4ASN A;  2OQG A;  1KGS A;  2ESN A;  3R0A A;  2XHK A;  4EJO A;  1TQM A;  1A04 A;  1O57 A;  2HTS A;  2F5F A;  2KKO A;  2A3S A;  4A6D A;  2IRF G;  4M9X A;  5LRS A;  2CW0 F;  3RYP A;  4IRG A;  4XRF A;  4IVN A;  2QYO A;  1B4A A;  4CDG A;  1BN5 A;  4U0V A;  1D5V A;  4N9I A;  3F21 A;  2ZKZ A;  1JXS A;  3JSP A;  1J59 A;  3TOB A;  2BE5 F;  1T2K A;  2CWE A;  1H9G A;  2K02 A;  1MD0 A;  3BDD A;  1FLI A;  1NHA A;  3WGH A;  3ZMT A;  2PG4 A;  2XRO A;  5D8L B;  1ZLK A;  2QQB A;  4KIF A;  4KN7 X;  3I53 A;  2EV0 A;  3R6S A;  1TLH B;  1BJA A;  5BPD A;  1LNW A;  3J7A O;  1HQC A;  2K4J A;  1Z6R A;  4EGZ A;  2BV6 A;  5LHH A;  3M8F A;  1FP1 D;  4AVP A;  1QO0 D;  4A5N A;  4KIC A;  2QM3 A;  3BZ6 A;  5FLX Z;  2EV5 A;  4OIO F;  2MD5 A;  2Z99 A;  2F5E A;  5D6F A;  2PI0 A;  2HKX A;  2YR2 A;  2FQ3 A;  1XDS A;  1YW7 A;  3I59 B;  3F8M A;  1QGP A;  2IJL A;  1ON1 A;  2L4M A;  4HZF A;  2P5L C;  1LDD A;  2L4A A;  3FXR A;  2P6T A;  1QZY A;  2KIU A;  4HX7 A;  3MEX A;  4KMU X;  1AWC A;  4EGY A;  1ZAR A;  3RPQ A;  4LMY A;  2HDC A;  3IWZ A;  1I6X A;  4GYG A;  2F5C A;  2QLZ A;  5FGM A;  2IVM A;  3K2Z A;  4B8X A;  5FLX K;  1ZLJ A;  1KQ0 A;  3BJO A;  2A5Y B;  3RJP A;  1U5T A;  2ACJ A;  1FP2 A;  2O61 A;  3GX4 X;  5E20 A;  2LF8 A;  5FD6 A;  1OPC A;  4HLX A;  2W84 A;  3I4P A;  3KE2 A;  3IC7 A;  5FB2 A;  2KIF A;  2FNA A;  2RQP A;  2XAH A;  3I54 A;  4BAY A;  1FOK A;  4UXN A;  4Y15 A;  2FE3 A;  3RKY A;  2RV8 A;  3M1E A;  4HQE A;  2HFH A;  1ZH5 A;  5CVR A;  3KP6 A;  3JAM Z;  4O3M A;  3L9F A;  4IJA A;  2G7H A;  3T1B A;  4P9F A;  3FMQ A;  3AAF A;  3O6B B;  2DW4 A;  1W7P A;  4KIG A;  3HRT A;  3DEU A;  4AIJ A;  5HLG A;  3HRM A;  2DBB A;  2PMU A;  5KK1 A;  1U78 A;  3R60 A;  4ETS A;  2PLY A;  3L09 A;  1ZHF A;  4H0E A;  1HKT A;  3NEU A;  5H20 A;  4BNC A;  1U5T C;  1Z91 A;  4B09 A;  1R58 A;  4KUM A;  3BPX A;  5E17 F;  3ROU A;  3GUD A;  2DFI A;  3CDH A;  4A5M A;  4FHT A;  4UHT A;  4G7H F;  1G3T A;  3KCC A;  4PDK A;  1IN8 A;  1SD4 A;  1WRJ A;  4BHC A;  2OBP A;  2QBY B;  2M30 A;  5EEG A;  3ELK A;  5HDG A;  4BHP A;  1B9M A;  1S29 A;  3CTA A;  5FD5 A;  4UV8 A;  4MTE A;  5BS6 A;  3V7C A;  1LEA A;  2JSC A;  1LQ1 A;  1YTY A;  1FSE A;  4RB3 C;  2D1H A;  1XB4 A;  1TTY A;  5AIQ A;  4A2U A;  4AIH A;  3FM5 A;  2FA5 A;  4LB6 B;  1QZZ A;  2P8T A;  4RAY A;  2IPQ X;  4CIC A;  4IRH A;  3C7J A;  3E97 A;  1YS6 A;  2ZJ2 A;  2FU4 A;  3I59 A;  3GVA A;  1KQ8 A;  3TOA A;  1O3Q A;  4RGR A;  3BY6 A;  1OMI A;  4KA4 A;  4O5V A;  5CVI A;  2LF7 A;  4EM1 A;  4A0X A;  3KP5 A;  1B59 A;  4CXF A;  3GZ5 A;  1G6N A;  3E6C C;  4I0A A;  3EUH A;  4EQQ A;  3EET A;  2H6B A;  2GIV A;  4I0B A;  1K6O A;  1F5T A;  3F6O A;  5L3C A;  1Y0U A;  5LBQ A;  2F2E A;  4HBL A;  1Z7U A;  2ZCW A;  6PAX A;  2QQA A;  3RIR A;  2VOO A;  4GCV A;  2HOE A;  1S7O A;  5L3B A;  1KU9 A;  3FXU A;  3GLX A;  3HSE A;  5TRD A;  3SFZ A;  2L02 A;  1P4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...