4WK8F

Foxp3 forms a domain-swapped dimer to bridge dna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
RPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*AP*GP*GP*AP*AP*AP*AP*TP*TP*TP*GP*TP*TP*TP*C
publication title DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 80
sequence length 80
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4wk8F00
2P5VA 2EV5A 2IA0A 3B02A 1XCVA 1YS6A 1B9NA 3GLXA 2CYYA 5BMZA 4JQFA 3I59B 4QWQA 5FFZA 1IRGA 4P9UA 3NQOA 3SFZA 5HLGA 3E5UA 3IRRA 5FFXA 2CO5A 1ZAOA 1Q1HA 2DW4A 3MZHA 1K7AA 3K2ZA 5D8KB 2P5KA 2R3SA 3GFIA 1MKMA 2ZNZA 2OQRA 5F1RA 3KEQA 3EETA 1JGSA 1GHCA 2QBYA 2HDCA 1S3JA 2HWVA 4A0XA 1JE8A 3F8BA 2O8XA 2XHKA 5E1ZB 3V7RA 1HW1A 4EM0B 1OR7A 2GA1A 5DDGA 3RYPA 4Y13A 4ESJA 3M8EA 4AWXB 2UXXA 3WTTC 4UVAA 2VN2A 3RI4A 2QYOA 3WODF 1K78A 1FX7A 2K4JA 3KZZA 3HRMA 3VFZA 5BOXA 1I27A 3PFIA 5AIQA 1HKSA 5ICEA 3M9AA 4LFUA 2QVOA 4R1HA 2O03A 1KU7A 3O6BB 2JPBA 4OIPF 1QO0D 2WC2A 1KU9A 4I2OA 1USTA 1ZREA 2NNNA 3HUGA 3N4MA 4G6DA 1ZRDA 2GQQA 3MQ0A 1IXCA 1IN5A 3E5XA 4I98B 4WK8F 3S2WA 5D5UB 4IF4A 2VOPA 4OIOF 4LB5A 4ENJA 5LGNA 1BI3A 1KA8A 4HYEA 2KIMA 2QQAA 2A69F 3EYYA 1T6SA 1IXRC 1U5TC 3RTRA 2DQRA 2L3DA 4M9XA 4RB1A 1FWZA 2DU9A 5LGUA 3WGHA 2QWWA 3ZMZA 2G9WA 4XLNF 3C7JA 3GF2A 4P5OA 2VE9A 3GFLA 2W57A 2LF8A 4I01A 1WKMA 3IL2A 2BEOA 1R00A 3F72A 1ON1A 1TW2A 2F5FA 4EMSA 2OAZA 3T0YA 3BDDA 4BHCA 1YLFA 4XSXF 3LAJA 4G9YA 4PZJA 4PDKA 4HDUA 1IAWA 5DCMB 3TDUC 2FOKA 1J9IA 2VBYA 1QZZA 4HA8A 2FBHA 2RN7A 4HZFA 2ZMEA 3J81Z 4KICA 1OYYA 5DUIA 5ICGA 2VT3A 3BJAA 4A0YA 3JTGA 3ECOA 2RVCA 5CVVA 5E18F 2EWNA 4G6QA 4U88A 2HOEA 5ICCA 3KP2A 1MJAA 3LWFA 3M8FA 3F8FA 4WCGA 3R60A 4IPAA 5IT9K 2C6YA 4A5NA 4D0PA 2RNJA 2E7XA 3R61A 2HZTA 2XAGA 1IN4A 1BIBA 1YTYA 2G7UA 3ZN0A 3JSOA 3ZMDA 3C1DA 2FXAA 1O3SA 3GEZA 1G3YA 3GZ5A 2XKOA 2CGPA 2K4BA 2VODA 2XAFA 1X3UA 4GYIA 3N97A 3SXYA 5FD5A 2Q2EA 1HQCA 3BWGA 3WTVC 1XMKA 4EM2A 1MDMB 5JI6A 2BYVE 5E8IA 3V7SA 4OINF 4AIKA 1FYMA 1YQAA 3CUQA 3I71A 1E2XA 1SD7A 4UV8A 4IXAA 2IW5A 3QPHA 4HDVA 2O3FA 1RNLA 2XAHA 2CFXA 1IW7F 3IWZA 2EB7A 4MEXF 4ASNA 2Z3YA 1PUEE 3O3KA 1ZARA 1ZGJA 1G6NA 1PP8F 1H9TA 2IVMA 1YW8A 2D45A 5LHHA 4CICA 3QP5A 5A2QZ 2XUBA 4DNCA 2O6GE 2L54A 2DAOA 2MH2A 2MH9A 2PMHA 4UVBA 2MA3A 2V79A 3IC7A 3WTXC 2NS0A 4XLPF 3R0JA 1DP7P 2O61A 1FPQA 1R5GA 4R8HA 2Q8KA 2HQNA 4CHUA 3KP4A 1FZPB 6PAXA 1MGTA 4KT5C 3CUOA 2ESHA 4NB5A 2GAUA 3BZ6A 4G8XA 3K1NA 1KU3A 2XV4S 2ZNYA 1S7AA 1W7PA 3DXJF 2EV0A 3REOA 3FMSA 1FC3A 1XN7A 4AIHA 3QU6A 4BNCA 4EJVA 2P8TA 2W84A 4RB0A 5HLIA 5FLXZ 5JFRA 1TQIA 2A6EF 1YS7A 2PEXA 1IXSB 4JK1X 1A04A 4XSZF 3F3XA 4HW0A 3BY6A 2F5EA 3W6JB 2V6CA 1QQIA 2DT5A 1BI1A 2OZ6A 3ULQB 2YPRA 4KMUX 1FP1D 4ZH4F 2XGXA 4EJOA 5DCFA 2HKOA 3VB2A 3PQJA 3KZYA 4F7ZA 2ZO4A 4XRFA 1J7KA 4LLGF 2KKOA 1BI2A 2FQ3A 3HSEA 4HX7A 5D5VB 3BROA 1P4AA 1PP7U 3KLOA 4I0BA 3K69A 2H27A 2D2WA 3DP7A 2M30A 4U7BA 3F21A 1W7PB 2OQGA 2CWEA 1KU2A 3KETA 1D8KA 4BXUA 4NQWA 4ESBA 1LJ9A 4N9HA 3RJPA 3K0LA 1AWCA 3MZYA 5KVRA 4U0WA 4FT8A 2IRFG 4P96A 4KN4X 3CO6C 2H09A 2WWYA 2XIGA 4HOBA 1W7PD 1XSVA 1FBSA 1LDKB 2IP2A 3P9CA 4O5VA 1Z05A 5CVRA 3U1DA 4HAMA 3BPXA 1D8JA 5HS8A 2ISYA 1CF7B 2HGCA 3DEUA 2E1NA 2RQPA 1P6RA 1XSXA 4UXNA 4G7ZF 3B73A 5FGMA 2JT1A 4P55A 1JHHA 5AIPA 2P7CB 2ISZA 3FZVA 3WE2A 3BJOA 2A5YB 4RGUA 2FEZA 2MC3A 3I58A 3T5XA 4IHSA 1BOAA 4JBAA 3JSPA 4TV7A 3ML6A 2Y75A 2K27A 4CGZA 1U2WA 2O0YA 2P7VB 3FF5A 3QOPA 1XB4A 3M1EA 2L02A 2PBIA 2DK8A 3E97A 2AS5F 3EQLF 1QNTA 2VC0A 3JTHA 5HLHA 2X0LA 4N9IA 3QAHA 1ZRFA 3J81K 2LSOA 2EA2A 2VXZA 3FXQA 2FRHA 4S04A 3SHFA 1ZH5A 4IRHA 3IHUA 3C3WA 1TW3A 2L4AA 2HS5A 2UXNA 3FM3A 5L3EA 3T8RA 4OMYA 5E1XA 3WG9A 4I7HA 1E17A 5K1YA 4M71A 1S29A 2HYGD 3T1BA 4L9NA 3P9KA 3ELKA 1LB2A 4HV5A 3TOBA 3V4GA 1R36A 2FBIA 4L5IA 4Q48A 3GO5A 2PI0A 4RGSA 4A5MA 3J80Z 4YG2F 1O7FA 1DPUA 3KE2A 2IT0A 1L3LA 5BPDA 1GVJA 4R79A 5BPIA 1G3TA 2HYFA 4HBLA 2W24A 1USSA 2EA4A 4H0EA 1GXQA 2B0LA 5ILVA 1F9NA 1YYVA 2XKPA 4IRGA 4G7OF 3ZMUA 2DO7A 1GXPA 1QGPA 2A68F 1TQPA 4ESFA 4RB3C 4M72A 3F8NA 3TDZC 1P4WA 3LA3A 4L9JA 2DK5A 2HQRA 1U6GA 5D6EA 2EFWA 2QBYB 3COAC 4M9SA 2KRFA 2XRNA 2VBZA 4EQQA 3VODA 1YG2A 4L9VA 2ESNA 4FX0A 3MEXA 2XROA 2EFQA 1ZHFA 5F64A 3ZMTA 1T2KA 1EH7A 4GCVA 3E6DA 3ABTA 2FU4A 4LLLA 4NHJA 5H20A 4U0YA 2OU2A 2ZFWA 3ZPLA 5J6XA 4PGHA 1ODDA 3QRFF 1K78B 2RKHA 1IN7A 4WXHA 3IKTA 2HR3A 5LGTA 3IKVA 3WTYC 5A2QK 3V8KA 5HDGA 1T39A 2QZ8A 2QQBA 4M73A 1XGOA 4U0VA 2ETHA 2A07F 1TLHB 2LF7A 2Y0MA 3FHZA 2R7FA 3K1PA 3KP3A 4HQMA 1TTYA 1B59A 2EFOA 4A2UA 4YFNF 2YSRA 5CJ9A 4AVPA 2VONA 2AXLA 4FHTA 2XVCA 5CVIA 2M8EA 3LFKA 4KUMA 4BQAA 1R5HA 2G7HA 3Q9SA 5KK1A 3WTWC 4KN7X 4L9TA 1FP2A 1XGMA 3E6MA 2F2EA 3WE3A 1NHAA 2VT2A 3E6CC 4I02A 3DFGA 4UUVA 4KNYA 3RDIA 4CO8A 1D5VA 2VBXA 1O3QA 5D6FA 3W6KB 1K6OA 3FXUA 2KJBA 3KP5A 1OMIA 3IWFA 1QBJA 5FLXK 3Q5FA 2EV6A 2CQKA 1MZBA 3J7AO 1XGNA 1REPC 4CZZA 5LHIA 2DPUA 4LJZF 1HW2A 2ZBKA 4ZYDA 3QPTA 3F8CA 1FBUA 3TO9A 1I1SA 1C0WA 1B9MA 2KJCA 3HOTA 2P6TA 4MTDA 3NRVA 3RKXA 3GFJA 4G7HF 1DUXC 4A6EA 1H9GA 4OU0A 2ZMEB 5CYVA 1P92A 5HS7A 1KQ8A 2QQ9A 3SZPA 1XSDA 3NEUA 3BJ6A 4MEYF 3MFKA 1XMAA 1O7LA 1I5ZA 2STWA 1I1GA 2RC4A 1U5TA 4MGRA 1HBXG 5LEJA 5TRDA 4IJAA 4A12A 2VC1A 4L18B 5BS6A 2STTA 4ZZLA 3ECHA 4HLYA 2KIUA 1J2XA 3K9TA 3P7NA 4MHGA 4OIRF 2KIFA 2OZUA 3V8JA 2QENA 4KMFA 2FF4A 1LDDA 5K5OA 3CDHA 2OA4A 3EYIA 1KGSA 4IVNA 1S6LA 4AIJA 1W5SA 2E1CA 1J75A 1KYZA 5LBQA 1B1BA 1WI9A 3ABUA 3GFMA 3FMRA 4BH9A 2M1BA 4BHBA 4AD9A 1R1TA 3R4KA 5L3GA 5K5RA 1BJAA 1R1UA 1O3RA 4ETSA 2DI3A 1SFEA 5CLSA 3CUQB 1L0OC 5DV5A 3SQNA 2DFIA 1EH8A 2M45A 1FBQA 5LRSA 4RAZA 1P4XA 2A61A 4RB2C 5L3FA 1IN6A 3I5UA 2VE8A 3WTZA 4Q47A 3DF8A 5ILSA 1BC7C 2YU3A 1HSTA 1R7JA 4I0AA 3KCCA 4K2EA 1OYIA 2BE5F 1G3SA 1MD0A 4M6XA 1IRFA 1RZ4A 1Z9CA 3LQQA 2CG4A 1HW5A 1G4DA 3TO7A 1F5TA 2GZWA 2FMYA 2PMUA 1RI7A 3RKYA 2F5CA 2V9VA 1FSHA 1R1VA 2GWRA 1AOYA 3GYHX 3HRSA 1PDNC 5LLQA 3I59A 4HF2A 4ZYEA 4WXDA 4ZYGA 3OOPA 2X4HA 4IHTA 1P2FA 5J8CA 2WTEA 1O3TA 1LDJA 3MWMA 1KQ9A 1RIOH 1TNTA 5E8GA 1I6XA 1LNWA 5L3DA 1XDSA 1T98A 2K86A 4EV0A 3D0SA 3ZN1A 1RUNA 2ZKZA 1HXDA 3I64A 1SD6A 1FOKA 3KP6A 4OOIA 4FX4A 1ZRCA 2PQ8A 4YFXF 3SZTA 1ZLJA 2ACJA 1WQ2A 4EM1A 3D5LA 1ZG1A 3OV8A 5HDKA 4EVIA 1WSUA 2F5DA 3ROUA 1SFUA 5D8LB 2Z33A 1HKQA 4EJUA 3GWZA 3GZ6A 4I09A 5TJJA 3E3VA 3E5QA 4WWCA 3HYIA 4O3MA 1LQ1A 5ICFA 5ERIA 4MQVA 1TNSA 4KIBA 3TGNA 2V1DA 3O2PE 4LGWA 3V8LA 3JAMZ 3ZP5A 1XDUA 3GVAA 2HKXA 5H6QA 4HX8A 2DTRA 2NNYA 1ZG3A 2HTSA 5D5XB 1FYKA 4CYDA 4P9FA 4WX9A 2PFBA 2XASA 3IRQA 2ZXJA 2GIVA 2L4MA 3GUDA 3AAFA 4BAYA 1FSEA 3KP7A 5HDNA 1BN5A 5LRRA 3HSFA 2VOOA 1STZA 4ON0A 1UHWA 5H6RA 3I0TA 2NYXA 4RGRA 2MLKA 2V1XA 3FMQA 5DYMA 1Z1DA 1O57A 1UHMA 5E1WA 3HTSB 1ZN2A 3HHGA 4M6YA 3HRUA 1EV7A 4OMZA 3TO6A 3EDPA 5ED4A 2LKPA 4Q4ZF 3T8TA 5HS9A 4ZZDA 3KFWX 4KFCA 3WTUC 1YW7A 1Y0UA 3HHHA 3KEOA 4MNUA 4EJWA 2XAJA 5HVQC 2XAQA 4ENMA 3P9IA 1FT9A 4XBFA 1U8RA 3ZMSA 1T38A 1KQ0A 2JSCA 3VEPA 4MQ9F 1FNNA 5DCMA 2Z5UA 1U78A 2QM3A 3H3ZA 3G73A 1WWXA 1F1ZA 2ELHA 2M87A 4BHPA 1FY7A 3WU1B 3PQKA 5F6FA 3WU0A 2GXBA 2Y48A 4M9ZA 2BV6A 2GA2A 1IN8A 1ULYA 2EFNA 3I54A 4UNOA 2COMA 1V4RA 2MD5A 5FD6A 4O6JA 1J0RA 1UFMA 3DPTA 3CUQC 3R0AA 3ZMVA 2LNBA 3LA7A 3LA2A 5DD4A 3ISPA 2QLZA 4N0BA 4KIGA 3BP8A 1B6AA 4PCQA 1D3YA 1J59A 1IF1A 1ON2A 2V1UA 3K1MA 1H0MA 4GYGA 1SD4A 2WV0A 5FO5A 1SFXA 1XGSA 2Z99A 3U9GA 1MJBA 3RYRA 3EUHA 3TKYA 4PGGA 2TDXA 4RS8A 1TQMA 5D4SA 4ENKA 4HF0A 3JW4A 4YFKF 4HV6A 1WRJA 1MDMA 2Q0OA 4YIFA 1RUOA 4Q5SF 3I4PA 3FM5A 2UZKA 1ZLKA 3RPUA 2UWMA 3MAJA 5LHGA 3F22A 3U2RA 4LK1F 5DUKA 2HFHA 5L3BA 3L9FA 1VTNC 2EK5A 3E6BA 3GW2A 2YX7A 2IA1A 5ILUA 3LSTA 1FYLA 1OKRA 5BQTA 5CVJA 3F23A 1Z91A 1SAXA 2D1HA 4LLNA 4A0ZA 4EGYA 2IJLA 5E20A 2J5OA 4OIQF 1HSJA 1XD7A 3F8MA 2FNAA 1R23A 5J8FA 4A6DA 4DQ2A 1Z7UA 4RAYA 2JZYA 3HTUA 2IPQX 3DV8A 2P5LC 2BBYA 2DLLA 3H92A 3BOQA 4Y17A 3FX3A 1G3WA 4LB6B 1LEAA 3QU3A 3CO7C 3GXOA 1JXSA 4GXOA 2M5WA 1UCRA 4KA4A 1UB9A 1EH6A 1FLIA 2CW0F 4Z2YA 3TQNA 4UHTA 2VBWA 2RGVA 1BBYA 3V7CA 4UVCA 1S7OA 4Y15A 1LEBA 2HEOA 2LDUA 2FSWA 5EEHA 5DD8A 3RKWA 4L0YB 3CJNA 1IUYA 4L0ZB 2RV8A 4UV9A 3LQRA 2FNPA 2JRTA 2W25A 5K5QA 2K02A 1YW9A 3DQVC 3HSRA 3ZQ7A 1QPMA 2FBKA 5CVUA 4ZYHA 2PG4A 1U3EM 2HTJA 1YIOA 2E7WA 2H6BA 1JHFA 4KIFA 3GX4X 5L3CA 1B4AA 1W5TA 2PJPA 5JVTA 5EEGA 1QZYA 3CTAA 4GO1A 1W4MA 5HOOA 2H94A 3F6OA 1V3FA 2DBBA 3WGGA 1R22A 3Q9VA 1YFHA 1J5YA 1ZYRF 4HLXA 4GGGA 3VOEA 3H3UA 2EJRA 4QLCU 5FB2A 4LG0A 2ADUA 1BIAA 3WTSC 4CDGA 1ZG5A 1OPCA 1SMYF 3JAMK 1ZGAA 2DPDA 4B09A 1LVAA 4LMYA 1K79A 2J5PA 2R7DA 5IT9Z 1ONVA 2EFPA 3R6SA 1XCBA 5JR3A 4BYYA 3HRTA 3L00A 5IT3A 3ERED 4HQEA 4WXCA 3BPVA 1R58A 3CLOA 4HX4A 2ZCWA 2P6SA 1U5TB 2FA5A 3FWEA 1DPRA 1OYWA 1TBXA 4E70A 1KYWA 2RDPA 2D1VA 5D5WB 4LD5A 3HOSA 4U7DA 4IRIA 2CSOA 1BI0A 1CF7A 2FMLA 1HKTA 2H6CA 4EJTA 2BGCA 1SMTA 4KYWA 1IZ1A 2P4WA 2YR2A 4M74A 2FE3A 1T0FA 2W85A 1BC8C 3F6VA 5D4RA 3C18A 2PN6A 3L09A 4HF1A 4KDPA 3KLNA 3L2CA 3DPLC 4G94A 5E17F 2ZJ2A 4YIIA 2JTVA 3J80K 4RGXA 1BM9A 2OD5A 5LEKA 3WGIA 5AONA 4LK0F 4CXFA 2YX4A 3FXRA 2L01A 3M7GA 1MJ9A 2PLYA 5DEQA 3MCZA 4LG0B 4WF2A 2K7LA 2A3SA 4L5JA 2QUFA 4EGZA 2IA2A 3RIRA 2Z9OA 1S8NA 2A6HF 3L7WA 2DQLA 2NRAC 3DKWA 1DDNA 1Z6RA 2NAZA 1Z6TA 3RPQA 4ENNA 1SD5A 5JHUA 4S05A 3HIFA 1CGPA 3G3ZA 3QP6A 3TOAA 3LAPA 1YO5C 2JPCA 2MBFA 2MLGA 3I53A 4B8XA 1F4KA 2GXGA 4MTEA 2OBPA
chains in the Genus database with same CATH superfamily
2P5VA 2EV5A 2IA0A 2ZXIA 3B02A 1XCVA 3AL0B 2AQEA 1YS6A 2R5ZB 4DOZA 1B9NA 3QWLA 2RNGA 4XM3A 2LD5A 3GLXA 2CYYA 3KYLA 2V4JC 4JQFA 5BMZA 2R0QC 3I59B 4QWQA 5FFZA 1IRGA 4P9UA 3NQOA 2QCOA 3L2QA 2KISA 3SFZA 5CKTA 5HLGA 1WJDA 2WY7Q 2IGKA 3E5UA 3IRRA 2ME0A 5FFXA 2CO5A 1ZAOA 2X1DA 5EJCA 4A3LJ 3F0CA 4Y3OA 1Q1HA 2DW4A 2M3AA 2CW8A 3BR0A 3MZHA 4FTHA 1K7AA 3K2ZA 5D8KB 5TGTA 2P5KA 2R3SA 1F43A 3GFIA 5E3LA 5GTHC 2F48A 1MKMA 2ZNZA 5C4JJ 2OQRA 2L9SA 1G8XA 3MZ8A 5F1RA 3LMMA 1MMGA 4I99C 3KEQA 3EETA 1JGSA 1GHCA 2Y30A 2QBYA 3OYNA 1CQTA 2LH9A 3RKQA 2HDCA 5CQGA 3N05A 1S3JA 3GTPJ 2HWVA 4A0XA 1JE8A 2Z2SB 3F8BA 3MKWB 3CCSI 2O8XA 2XHKA 3S1NJ 5E1ZB 3AG3H 3V7RA 3PL8A 1HW1A 4CCMA 4EM0B 3M4OJ 1P9QC 1OR7A 2M0MA 1PVEA 2GA1A 5DDGA 2GM4A 1LUJB 3RYPA 3HGYA 3CCLI 4Y13A 4ESJA 2JK3A 3M8EA 2BVLA 4AWXB 2UXXA 1UG0A 4B43A 3WTTC 4UVAA 2VN2A 2QSHX 2HVQA 3RI4A 2QYOA 2X1EA 3BZCA 3WODF 1K78A 5F0FA 1FX7A 2E35A 2X6OA 2K4JA 1MBHA 3KZZA 2EILH 2HXOA 3D5SC 3HRMA 4AYBN 3VFZA 5J47A 4RAGA 5BOXA 1I27A 5DTDA 3PFIA 2QSFX 5AIQA 1HKSA 5ICEA 3M9AA 9ANTA 2K9QA 2QVOA 4LFUA 2K3FA 1JTXA 4R1HA 2O03A 1KU7A 3O6BB 2IXSA 2JPBA 2O8KA 2RAEA 1GT0C 4OIPF 2VKDA 1ZGWA 1QO0D 1JUSA 3RCOA 2WC2A 1KU9A 2Y69H 1B8IA 4I2OA 3CC7I 1USTA 1ZREA 3DWLE 2KL4A 1JUMA 4ZC3A 2PMZA 4XIDA 1RKTA 4XRSG 2DA7A 5IP6A 2NNNA 3HUGA 4DJAA 3DBHB 3N4MA 2ID6A 4XOPA 4NNJA 1YRNA 4G6DA 1ZRDA 2GQQA 3FXOA 3MQ0A 1ZELA 4XN0A 1IXCA 1IN5A 3E5XA 4I98B 1ZTRA 1FIAA 4WK8F 1XG1A 2WADA 4M3DA 3IV5A 4FCYA 2A5WA 3S2WA 3Q0VA 4D7NA 2E1MB 4IF4A 5D5UB 1MNDA 4D5CA 3S1MJ 2WAQN 2VOPA 3W6VA 4OIOF 4M6VA 4LB5A 4ENJA 5LGNA 1BI3A 1GV5A 2DFEA 1KA8A 4HYEA 2KIMA 4BQNA 2QQAA 2A69F 3HBLA 5TISC 1HF0A 3EYYA 1T6SA 2JA8J 1IXRC 4Y33A 1W36D 3K7AJ 1U5TC 3RTRA 2DQRA 4DGWB 2L3DA 4M9XA 4RB1A 2H1KA 2RREA 3A4CA 1FWZA 2DU9A 3WGHA 1GVDA 2E36A 2LY2A 5LGUA 3A0HC 3I9V2 2QWWA 4PFPA 3ZMZA 4A3EJ 2G9WA 3BR3A 2AO9A 3PIOF 1ERDA 1FTTA 4XLNF 3C7JA 3GF2A 4P5OA 2VE9A 3GFLA 2W57A 2LF8A 2OJED 2ZJQF 1DGRM 4I01A 1WKMA 2HZDA 1MBKA 1FOWA 4M3GA 2VASA 1ENHA 3IL2A 2PJRA 2BEOA 1PJRA 1BR4A 1R00A 3F72A 2H8WA 3OYLA 1ON1A 3FIWA 1TW2A 4IHWA 2F5FA 4EMSA 2OAZA 2XF7A 2PX9A 2HOSA 2LG4A 4X1EA 3BDDA 3T0YA 4BHCA 1YLFA 4XSXF 3VPRA 3LAJA 1JI8A 2L7KA 2WB1A 4G9YA 2JSPA 2X1CA 4PZJA 2LMDA 3DTEA 4PDKA 3H5NA 4QPQA 5IYDJ 2DN0A 4HDUA 1UG2A 4DYRA 1IAWA 2VPRA 5DCMB 3TDUC 1SANA 2FOKA 2V9KA 4V2FA 1J9IA 1JTYA 1IV6A 2VBYA 1QZZA 2DOAA 4HA8A 2E60A 3X2QH 2FBHA 3ZQHA 2Y0SN 3WG7H 2RN7A 4HZFA 2ZMEA 3J81Z 2DTZA 3M3YJ 4KICA 4BKXA 1ZR4A 1OYYA 4BL0B 5DUIA 5ICGA 2VT3A 3BJAA 4A0YA 3JTGA 3ECOA 1FJLA 3G71I 5J40A 2RVCA 5CVVA 5E18F 3ERMA 2LTPA 2EWNA 2VJ4A 4G6QA 3BR5A 3A0BC 4U88A 2HOEA 3G1MA 1W5CC 5ICCA 2X6XA 5B66C 3KP2A 2XGEA 4UY8I 1MBGA 3GTJJ 1YRNB 5C4XJ 2VKVA 2CS3A 1JGGA 5FRNA 5J1YA 1MJAA 3EUKL 3G1OA 3LWFA 4RBOA 3M8FA 3CF5F 2K9LA 3F8FA 3SJMA 1ITYA 3K4MA 4WCGA 1YX5A 1PUFA 3R60A 1BL0A 3GTGJ 4IPAA 5IT9K 2C6YA 4A5NA 4D0PA 2RNJA 3HG9A 2E7XA 5F27A 3R61A 1Y8RB 2HZTA 2XAGA 1X58A 2CMPA 1IN4A 1BIBA 1YTYA 2G7UA 3ZN0A 1XTAA 3JSOA 3OL3A 2CUFA 1O4XA 3CD6I 4BDYA 3ZMDA 3C1DA 4PJLA 2FXAA 4LG3A 1O3SA 3GEZA 4V19K 1G3YA 3GZ5A 2XKOA 1PYVA 1JUPA 2CGPA 4BJ5C 2K4BA 2B9SA 1NG6A 3AKZA 3CDIA 2VODA 2XAFA 1X3UA 4GYIA 3OY9A 3N97A 3SXYA 2G0EA 3BG3A 2PJRB 2BOLA 5FD5A 2K5CA 1WJCA 1V5GA 2Q2EA 4BEHA 1BR1A 1HQCA 3BWGA 2QA4I 1I6HJ 4JX6A 3WTVC 5GADJ 1WZ2A 1XMKA 5FROA 4EM2A 2BW3B 1MDMB 3AL0C 3SDGA 4EEFG 1WCMJ 2DOEA 4Y7NJ 5JI6A 1MH3A 2BYVE 2EIMH 3JRDA 1BOBA 1WH7A 1LE8A 5E8IA 1B72B 4KISA 3V7SA 4OINF 1TP4A 4AIKA 1FYMA 3BR6A 1YQAA 3CUQA 3I71A 2MABA 2R5YB 1E2XA 3HEFA 1OJLA 1SD7A 4UV8A 4IXAA 2VJ5A 3G1LA 2IW5A 3QPHA 4HDVA 2O3FA 1RRJA 1RNLA 3A2KA 2XAHA 3KYCB 2CFXA 3JRHA 1IW7F 1MNMC 3H9QA 3IWZA 3O8GA 2EB7A 3ZCOA 2BY1A 3K10A 4MEXF 4AIDA 4C9YA 5GAHJ 3K4BA 3RPUD 4ASNA 4ZDLA 4UB6C 2Z3YA 1PUEE 3O3KA 3MKLA 2B63J 1WJBA 4XKVA 1ZARA 1ZGJA 5EGOA 2W82A 1LVKA 1G6NA 1PP8F 2K40A 2N8GA 2ZFUA 4UUSB 2DCEA 4BBRJ 2WA0A 2FQ4A 1H9TA 2IVMA 1YW8A 2DODA 2R4GA 4XKCA 2D45A 2NVQJ 5LHHA 1ETYA 1IV8A 4CCOA 4CICA 3QP5A 2XUBA 4DNCA 5A2QZ 2GLOA 2I8DA 2O6GE 2L54A 2WV1A 2DAOA 2FD5A 2MH2A 2MH9A 2PMHA 1X4OA 3K4LA 4UVBA 2CV2A 2MA3A 2L9VA 2V79A 3IC7A 3WTXC 2JA6J 2NS0A 1FOYA 3VSKA 2OTJI 4CYCB 2W1OA 4XLPF 3R0JA 4A3FJ 1DP7P 2O61A 1FPQA 5IOYA 2JVHA 1R5GA 4R8HA 2Q8KA 5K7FA 3GTKJ 2HQNA 2ZB9A 4CHUA 3KP4A 2HOTA 1VQ7I 1JT6A 1FZPB 6PAXA 3JRGA 1MGTA 4KT5C 3CUOA 4ANJA 2ESHA 4NB5A 4YEJA 2GAUA 4AYBA 2AQFA 2GXAA 3BZ6A 4G6TB 2DJNA 4G8XA 2CRGA 1WGXA 1QZEA 3K1NA 3CCQI 1KU3A 2JMWA 1NG7A 2XV4S 2ZNYA 1W0TA 1S7AA 2DA1A 1W7PA 4XQFA 2LY9A 3DXJF 2EV0A 2BHYA 4F55A 3REOA 3FMSA 1N25A 1IJWC 4XONA 1JKPC 4Y4RA 1FC3A 1XN7A 2NS8A 1W36C 1UELB 4BXXJ 2LY1A 1OCRH 5B1BH 2VQLA 1WI3A 2OCEA 2MC4A 4B4CA 4AIHA 4U87A 3QU6A 4BNCA 4EJVA 1XC5A 2E1MC 3CCUI 2P8TA 2W84A 4RB0A 3C2HA 5HLIA 5FLXZ 1W1WE 3DEEA 2P81A 5JFRA 2Q1ZB 1WH5A 4B44A 1MIJA 3TEDA 1TQIA 1GLNA 2OCCH 3GLLA 2A6EF 3D5RC 3DPUA 3I3LA 1RR7A 3RQ4A 4MLOA 1YS7A 3J7AY 2PEXA 5DM7F 3K4CA 1IXSB 4JK1X 2XRLA 4E7JA 1A04A 4XSZF 4DIQA 3ZQGA 3L1PA 3F3XA 5KCMA 2WAQA 1RC9A 4HW0A 3M07A 3BY6A 3PFYA 2ECCA 2F5EA 1X1DA 3W6JB 2LFBA 2V6CA 1T08B 3K4JA 1QQIA 1D5YA 2DT5A 1BI1A 3DEWA 2OZ6A 3ULQB 4ZTJA 3DCFA 2LYCA 3ZQIA 3JRCA 2YPRA 1AA7A 3KZIC 2EQRA 3D1NI 4KMUX 3RSNA 2ID3A 4XLFA 3BQYA 3FBNB 1FP1D 4ZH4F 2XGXA 3HJEA 4EJOA 1UAAA 2DJIA 5DCFA 2HKOA 3HL2A 4F92B 3VB2A 4BJTA 3PQJA 3KZYA 2O9LA 3DLLF 4F7ZA 3RZDJ 1SAUA 4LIVA 1VNDA 2ZO4A 3HOYJ 1WJAA 1TWHJ 4XRFA 1J7KA 2E5NA 3S17J 4LLGF 2JA2A 2KKOA 1BI2A 1VQPI 2FQ3A 1I50J 3HSEA 3QPLA 4HX7A 1ETKA 5D5VB 3BROA 1P4AA 1PP7U 3KLOA 4BQOA 1K6YA 1YHQI 4I0BA 3K69A 2H27A 1WJ5A 2D2WA 2FOWA 1A36A 4IZZA 3QODA 3DP7A 2M30A 1BR2A 4U7BA 1R5ID 3F21A 2L7ZA 2BY0A 1ETVA 1W7PB 3PIPF 2OQGA 2CWEA 4ZYAA 2Y0SA 3MKZA 1KU2A 3ASNH 1VQ8I 3KETA 4ABZA 1D8KA 4BXUA 4NQWA 4ESBA 1ETOA 1LJ9A 5EYRA 4N9HA 3RJPA 3K0LA 1AWCA 1SC7A 3MZYA 3AG1H 1TT0A 5KVRA 4U0WA 4FT8A 2IRFG 4P96A 1X1CA 4KN4X 3CO6C 2H09A 5EDNA 5BNGA 3L2WA 2WWYA 2XIGA 4HOBA 3JREA 1W7PD 1XSVA 4S0HB 4NUBA 1FBSA 1LDKB 5B3SH 2ICWG 2R7SA 4DW6A 5IP9J 2IP2A 2E2JJ 5KAIC 3P9CA 4O5VA 4CZCA 3S1QJ 4BU2A 4A69C 1Z05A 1WJEA 5CVRA 3U1DA 4HAMA 2VLAA 3BPXA 1D8JA 1NTCA 5HS8A 2Z1DA 2ISYA 1CF7B 2HGCA 4JX4A 4XRMA 2IGOA 3DEUA 3G6EI 2E1NA 1X3WB 2RQPA 1P6RA 2VJIA 1XSXA 4UXNA 4G7ZF 4Y52J 3B6AA 1ORKA 3CCYA 2LR8A 3B73A 3FXMA 5FGMA 3BLYA 2JT1A 4P55A 2EZIA 3IH2A 2R7VA 1JHHA 3FKIJ 2OUMA 4MIMA 4XKBA 5AIPA 4RLFA 2P7CB 3NARA 1VQLI 2B7EA 4FQGA 3EUHC 4A3GJ 2A6TA 2ISZA 2XAUA 3FZVA 3CLQA 3WE2A 3BJOA 4QIWN 2FUG2 2A5YB 4RGUA 3CMEI 2FEZA 2MC3A 3I58A 4M3EA 2X85A 3T5XA 4IHSA 1X1AA 1VQKI 4HEA2 1BOAA 4JBAA 3CMMA 4A3KJ 3JSPA 3ZQLA 4TV7A 4RDUA 2DDAA 1K4TA 3SYTA 5IPAA 4I6ZA 2DA4A 3LSGA 2Y75A 3ML6A 5GAGJ 3DTIA 3PM1A 2K27A 4C30A 1IGNA 4CGZA 2Y2ZA 1U2WA 2O0YA 2P7VB 3FF5A 3QOPA 1XB4A 3QQAA 3M1EA 2R7OA 2L02A 1WFXA 2KLOA 2PBIA 1IRZA 3H5RA 2DK8A 3E97A 1SEUA 3EQLF 2AS5F 1QNTA 3LSRA 2V6EA 2QKLB 3IP4B 4NC6A 2VC0A 2VKEA 3JTHA 5HLHA 2X0LA 3ABMH 4N9IA 3QAHA 4XICA 1ZRFA 3J81K 2DYRH 2HI3A 2LSOA 2DMQA 1D1BA 1EJ9A 2EA2A 2VXZA 3FXQA 4BY7J 4CH7A 3GTOJ 2EZKA 2FRHA 4S04A 3SHFA 3OSFA 1ZH5A 4IRHA 3IHUA 2M2EA 3C3WA 1TW3A 3S14J 2L4AA 2HS5A 2O7OA 2UXNA 3FM3A 5L3EA 3T8RA 4OMYA 3TW6A 5E1XA 3WG9A 4I7HA 2V7FA 1E17A 5K1YA 4G12A 4M71A 1S29A 5EF6A 1S9HA 2HYGD 3T1BA 4ZDPA 4L9NA 2BVMA 2DA6A 3ELKA 3P9KA 1ZR2A 2ZSIB 3L2UA 1LB2A 1YIJI 3EPZA 4HV5A 3TOBA 3V4GA 1R36A 2FBIA 3HM5A 4L5IA 4Q48A 4CUGA 3H0DA 3BZKA 4DBQA 4ZTFA 2I5UA 2K9MA 3I56I 3GO5A 5J1UA 2LKSA 1E3HA 4F93B 5GPCA 5J3LA 2JUCA 2YUSA 2PI0A 1QRYA 4RGSA 4A5MA 3S16J 3J80Z 4YG2F 2BZTA 1O7FA 2IS2A 1BA5A 1DPUA 3KE2A 2IT0A 3BT9A 4PSWA 1QU3A 1L3LA 4A3IJ 5BPDA 3FXJA 3MD2A 1GVJA 4R79A 2KFDA 3ZR8X 2K9NA 5BPIA 2X6YA 3H35A 5FJ8J 1G3TA 3OR1C 2HYFA 2EH3A 2D5VA 3PO2J 4HBLA 5H2FC 4A3JJ 3OYDA 2W24A 1USSA 2EA4A 4H0EA 2UV1A 3SEQA 1RPWA 1GXQA 2ECBA 1FMWA 2B0LA 4C3HJ 2BHZA 5ILVA 3JRBA 1F9NA 1YYVA 2XKPA 4BACA 2ZJRF 2W4SA 3KPHA 2LREA 4IRGA 4G7OF 3ZMUA 4HNVA 2DO7A 1GXPA 3OS1A 1QGPA 2F4MB 2A68F 5CPRB 1TQPA 4ESFA 4RB3C 3KEYA 4XORA 1U0JA 3FKJA 4M72A 3F8NA 3TDZC 1P4WA 3LA3A 4L9JA 1X3ZB 4B3AA 1GDTA 2DK5A 3H9JA 3H1CA 5EEAA 4KITB 2HQRA 3WHBA 1U6GA 2NVTJ 5D6EA 2EFWA 3I4MJ 2QBYB 2LBFA 4D5FA 4B47A 1U9NA 2CQXA 2DFHA 3BG6A 3COAC 3OYHA 4M9SA 2KRFA 2XRNA 2QQ8A 2VBZA 2HVSA 4NC8A 3FISA 4J01A 4EQQA 4BE2A 3VODA 1YG2A 4L9VA 2M7AA 4XMYA 2ESNA 4FX0A 3MEXA 3BCBA 1VQOI 2XROA 5IP7J 2EFQA 1ZHFA 5F64A 1TWAJ 3LOCA 3ZMTA 3OMYA 1T2KA 3VSLA 1EH7A 4GCVA 3E6DA 4A3BJ 3MVPA 3ABTA 2FU4A 2GOXB 4LLLA 4NHJA 3UNGC 5H20A 4U0YA 2OU2A 2ZFWA 4RA2A 3ZPLA 2ZXWH 5J6XA 4PGHA 1ODDA 1W0UA 1A35A 3QRFF 1K78B 2Y9YA 3AG4H 2X51A 2RKHA 2EBIA 1IN7A 3C2BA 2F4IA 4WXHA 2F5VA 3IKTA 1Y1VJ 4CCNA 1MBJA 3I55I 2HR3A 1VQ9I 5LGTA 3IKVA 3WTYC 1Z77A 3ABKH 3WHCA 5A2QK 3V8KA 5HDGA 3UKGA 1Y8QB 4BDZA 3LL7A 1Y56A 1T39A 5FLMJ 4AM3A 2QZ8A 2QQBA 4M73A 2E5ZA 1XGOA 4U0VA 2VQCA 2HU9A 3WU2C 2ETHA 3OYIA 1S72I 1APLC 4C2MJ 2A07F 2EPFA 1TLHB 2VXDA 5EZGA 3DBRB 1B8IB 2CJJA 2LF7A 2Y0MA 3FHZA 3I4NJ 2R7FA 2R7QA 3K1PA 2XGCA 3KP3A 1TTYA 1B59A 4HQMA 4XLAA 2EFOA 4A2UA 4YFNF 3OYBA 2YSRA 2CUZA 5CJ9A 4NDLA 1SFKA 3W2VA 4AVPA 2AXLA 3HUGB 4FHTA 5J1RA 2XVCA 3TBIA 5CVIA 3J7ZI 2VONA 5GPAA 2M8EA 3LFKA 4KUMA 4BXFA 1R5HA 4BQAA 2G7HA 3Q9SA 4AVZA 5KK1A 4OAYA 3WTWC 4KN7X 4L9TA 4IL6C 1FP2A 1XGMA 3KIOA 3E6MA 2F2EA 2VPLA 2ZJPF 3WE3A 1NHAA 2VT2A 4B48A 3E6CC 4I02A 2L5QA 3DFGA 4UUVA 1HOMA 1IO2A 2W7NA 4E7SA 4KNYA 3RDIA 4CO8A 4E4HA 5CQEA 3OYMA 1D5VA 2CU7A 2VBXA 1O3QA 2IGMA 5D6FA 3W6KB 4RM3A 1K6OA 1Y6IA 2LP0A 3FXUA 1Z21A 4JYKA 2KJBA 3KP5A 2E71A 1OMIA 2DYSH 1JKOC 2XB0X 3IWFA 5F08A 1YJNI 1QBJA 1VF9A 5KAFC 5FLXK 3Q5FA 2EV6A 2X48A 2CQKA 1MZBA 1N75A 4CCKA 3G4SI 3IAS2 2IS6A 4A93J 3J7AO 4J19A 1HDDC 1XGNA 3PUFA 1DGWY 1FIPA 4YRVA 1REPC 4CZZA 4IQ4A 5LHIA 2DPUA 1QVUA 3BTJA 4LJZF 3A03A 1HW2A 3CCJI 2L7FP 3FK7A 3OWTA 2WAFA 2H1LA 2E19A 2ZBKA 4ZYDA 3QPTA 3F8CA 1FBUA 3TO9A 1I1SA 1C0WA 2NS7A 1T0FC 1B9MA 2KJCA 2ZXHA 2LC2A 1HA8A 3HOTA 5E3OA 3K6GA 2P6TA 3CDLA 4MTDA 3NRVA 3RKXA 3GFJA 2JRMA 4JOMA 2IGNA 2QF7A 2KRCA 4G7HF 1DUXC 4A6EA 2OPTA 1H8AC 1H9GA 4OU0A 3PO3J 3BG7A 4BE1A 3JRIA 1FOXA 4QTRA 2ZMEB 4OAZA 5CYVA 2NVUB 1P92A 5HS7A 1VQNI 2MFZA 3CJTB 3FDYA 3PNVA 1RR8C 2QQ9A 1KQ8A 3SZPA 1XSDA 3NEUA 3ABLH 2HXIA 5F0HA 3BJ6A 4MEYF 3KYDB 3MFKA 1XMAA 1O7LA 1I5ZA 2STWA 4BGDA 1I1GA 2RC4A 1U5TA 2DT6A 4MGRA 1HBXG 5LEJA 2E2HJ 2AHQA 2LVSA 3HOXJ 1D0ZA 2RQQA 3MN2A 2L2OA 2ME6A 3NWSA 5HODA 3CC4I 5TRDA 1MSFC 4IJAA 4RLQA 2VC1A 1V55H 1WJFA 4A12A 4L18B 5BS6A 2STTA 4ZZLA 2IAIA 3ECHA 1PUFB 3S93A 3OR2C 4HLYA 2CQ7A 4QSHA 2KIUA 1J2XA 3K9TA 3P7NA 1I3QJ 1X4PA 4ITVA 4II2A 2VB6A 4MHGA 4H4KC 4OIRF 2KIFA 2OZUA 3V8JA 5EG0A 2QENA 3HKZN 4KMFA 2FF4A 1LDDA 5K5OA 2XB5A 3CDHA 4HNTA 2CUJA 2OA4A 4HSRA 3EYIA 4XLHA 4IHVA 3P5JA 2R92J 1KGSA 3OSGA 4IVNA 5M5XJ 4NC7A 3M1CA 3LSIA 4UB8C 5C44J 2Y9ZA 1NH3A 1S6LA 2K3PA 4AIJA 3W2AA 4W1UA 1W5SA 2E1CA 2VI6A 3IH3A 1J75A 1KYZA 4RMNA 2CQQA 1Q1VA 1NK2P 2EIJH 2GBYA 4FASD 3BTLA 1LKXA 5LBQA 1H89C 3TP0A 5FKNA 1B1BA 1WI9A 2Q2EB 4BEHB 3ABUA 2XPUA 3GFMA 3FMRA 4BH9A 2E34A 2M1BA 3M8JA 2VQGA 2KDZA 4IEJA 4BHBA 1N77A 5HNFA 2JA7J 4AD9A 1R1TA 3QYEA 3R4KA 5L3GA 5K5RA 1BJAA 2L9RA 1R1UA 1O3RA 4ETSA 2DI3A 1LE8B 1E0EA 3PSIA 2DOFA 5K7ZA 3KX2A 1SFEA 1X1BA 2DMPA 1YX3A 5CLSA 3CUQB 1BC7C 1SFOJ 4PJNA 1L0OC 2XGDA 2EZHA 5DV5A 3SQNA 1AHDP 2DFIA 1EH8A 2HYJA 2M45A 3A01A 1FBQA 5LRSA 5C3EJ 2XDVA 4RAZA 1IUFA 1MMNA 1P4XA 2A61A 4RB2C 5L3FA 4XL9A 1IN6A 4IQJA 3OL4A 3MKYB 4GFBA 1S5LC 2JVGA 2KIQA 1WPKA 3H5AA 3I5UA 2BXYA 4ZJZA 2F4OB 2VE8A 3WTZA 5GTIC 2R93J 4Q47A 3OYGA 1QA6A 2KPMA 3DF8A 5ILSA 2YU3A 4AUXA 1HSTA 4B1RA 1R7JA 5DM6F 4I0AA 5EGOB 3KCCA 4BY1J 4K2EA 1OYIA 2BE5F 1G3SA 1MD0A 3ONQA 4M6XA 1VQ5I 1IRFA 1RZ4A 3DU5A 4E7LA 1OR7C 2HOAA 2CW7A 3ZGKA 2BY3A 1Z9CA 3LQQA 5J4VA 1N78A 2CG4A 2XF6A 1HW5A 5E79C 2CV0A 3S3NA 1G4DA 3B6CA 3TO7A 1F5TA 2GZWA 3DKXA 2FMYA 2PMUA 4II3A 1RI7A 3RKYA 1Y1WJ 1XX5A 2F5CA 2NVXJ 3L2VA 2V9VA 1FSHA 1R1VA 2GWRA 3UR3C 3GYHX 1AOYA 2NXNB 4LOCA 1T56A 5B1AH 3HRSA 2R7XA 1TL8A 1PDNC 5LLQA 2L9NA 2M0CA 3I59A 2XPVA 4ZYEA 1A31A 4HF2A 1DQUA 4WXDA 1XMXA 4ZYGA 3OOPA 2X4HA 3ZXSA 4IHTA 1P2FA 3OYJA 2QGUA 5J8CA 2WTEA 3DBLB 1X2NA 1O3TA 4BE0A 1LDJA 1IDYA 2OC6A 4V2GA 3MWMA 1KQ9A 1RIOH 1TNTA 5E8GA 1I6XA 5JLXA 1LNWA 2TCTA 4QPOA 4E7KA 1P7IA 5L3DA 1XDSA 1T98A 2K86A 4EV0A 3RZOJ 3A1YA 3D0SA 3ZN1A 1RUNA 4ZDOA 2ZKZA 5IYBJ 1HXDA 1MMDA 1S7EA 2CFOA 3I64A 1SD6A 1FOKA 2IBDA 3KP6A 2JUGA 4OOIA 2IS1A 4FX4A 1ZRCA 2PQ8A 1FTZA 4YFXF 1UJ8A 2KP6A 3SZTA 1ZLJA 2ACJA 1WQ2A 4EM1A 3D5LA 1ZG1A 3OV8A 3K70D 5HDKA 2XSDC 3JR9A 4EVIA 3H9GA 3QYBA 1Z3YA 1WSUA 2F5DA 3ROUA 3V42A 1SFUA 4PUSA 1BW6A 4PJ0C 5D8LB 3ZRGA 2Z33A 1VFCA 1OCCH 4N4OB 2QEXI 4A3CJ 1HKQA 4EJUA 2KZGA 3GWZA 3GZ6A 1IDZA 3JRFA 4I09A 1H88C 5TJJA 3E3VA 1OCTC 4YIRX 3E5QA 4DZPA 1R9TJ 3LSHA 4XN3A 4WWCA 3HZJA 3HYIA 3VYSB 4O3MA 2KT0A 2LLKA 1LQ1A 5ICFA 1WHUA 4MQVA 1TNSA 4KIBA 5ERIA 3TGNA 1LFPA 4HG2A 2V1DA 3VYTB 1OCZH 3LSMA 5IOZA 3K4NA 3O2PE 4LGWA 3V8LA 3EUAA 3JAMZ 2OV7A 3ZP5A 3GMEA 3IAM2 1XDUA 3GVAA 2HKXA 2M8GX 5H6QA 3IUOA 3Q0UA 4HX8A 3DTKA 2DTRA 2NNYA 1ZG3A 2HTSA 3H36A 4XNFA 5D5XB 1IRXA 1FYKA 2JA5J 2HVRA 4CYDA 4P9FA 4WX9A 4RAFA 2PFBA 4XLCA 2XASA 3IRQA 2ZXJA 2GIVA 4PSXA 1AU7A 4E6KG 2CQNA 2L4MA 2L7MP 3GUDA 3AAFA 4BAYA 2ZMEC 1FSEA 3KP7A 3CJRB 5HDNA 4M3BA 1BN5A 5LRRA 3HSFA 2VOOA 2KRHA 3PNTA 2M4KA 3VYRB 1STZA 2CH0A 3ZOBA 1UMQA 5F04A 4ON0A 2JWTA 1UHWA 5H6RA 3I0TA 2NYXA 4RGRA 2MLKA 2V1XA 3FMQA 2WAEA 4OWRB 4UUTA 1LFUP 5DYMA 3MMYB 4A3DJ 1Z1DA 1O57A 1UHMA 5E1WA 2EZLA 2VL8A 3HTSB 3AFHA 1ZN2A 1QPIA 3PJRA 2I10A 3HHGA 4NQWB 4M6YA 3BC8A 1OFCX 3HRUA 1EV7A 4IOCF 1R4MB 4OMZA 2NVYJ 3TO6A 1J09A 5GAEJ 3EDPA 3S8PA 5ED4A 2LKPA 4Q4ZF 3T8TA 1Y39A 3SDBA 1R6RA 5JHFA 3OIOA 1I3AA 5HS9A 1ETWA 4ZZDA 3KFWX 4KFCA 2VQHA 1AKHA 4PJJA 3WTUC 1YW7A 2MD0A 2X6WA 3S2HJ 1Y0UA 3HHHA 3KEOA 4MNUA 3W3CA 1K61A 2Z16A 2DXIA 3FXKA 4EJWA 5FKMA 2XAJA 4BS9A 4JP0A 2V9PA 4LITA 5HVQC 2XAQA 2HNHA 3DLAA 4ENMA 3P9IA 1FT9A 1MBEA 4XBFA 2M4GA 1U8RA 3ZMSA 1T38A 4N4NB 1KQ0A 2JSCA 3VEPA 4MQ9F 1FNNA 1A5JA 5DCMA 3ZQCA 3G2BA 1DP3A 2Z5UA 5KHDA 1U78A 2QM3A 4E7IA 2VJJA 3FXLA 1TWGJ 1G59A 3H3ZA 3G73A 3HKZA 1WWXA 1F1ZA 2ELHA 2OF7A 3BR2A 4HSTA 3SEZA 2M87A 4BHPA 4JX5A 1FY7A 3WU1B 3PQKA 5F6FA 3WU0A 2GXBA 1HC8A 2Y48A 2LK2A 5LFAA 2ZC2A 1OCPA 2JN6A 1JKQC 4M9ZA 2BV6A 1Y0NA 1MNEA 1QHHD 2GA2A 1MW7A 1IN8A 1ULYA 2IEKA 4IKFA 2EINH 2EFNA 1T95A 2WY8Q 4C3JJ 5M3FJ 3I54A 1RESA 1OCOH 4UNOA 4MO7A 2COMA 1V4RA 2XC7A 2MD5A 5FD6A 2EIKH 2MG4A 1SVOA 4O6JA 2HDDA 1J0RA 5B5EC 1UFMA 3DPTA 2JJ7A 4CA0A 5IY5H 3CUQC 1BW5A 2ELKA 3R0AA 3ZMVA 2LNBA 1TZLA 3DKYA 3HOVJ 4CSWA 3LA7A 3LA2A 2W00A 1KZHA 3ISPA 5DD4A 2QLZA 4N0BA 3K4KA 4KIGA 1ZKGA 3OYCA 3K2AA 1BJZA 1U9OA 3BP8A 1P7JA 1B6AA 3HPGA 4PCQA 4J00A 1D3YA 1J59A 4XRSA 2MSYA 1IF1A 1ON2A 1OQYA 2V1UA 3K1MA 1X2MA 2DA3A 3CMYA 2NOGA 2XPWA 1H0MA 2DFFA 4GYGA 1SD4A 2WV0A 5FO5A 1SFXA 3FHNA 1T8IA 1EA3A 1XGSA 4BUPA 2Z99A 1MMAA 3U9GA 1MJBA 3RYRA 1AKHB 1HLVA 3Q0WA 3EUHA 3TKYA 3CMAI 4PGGA 2GIZA 2TDXA 4RS8A 1TQMA 5GP9A 5D4SA 3CCMI 2GOMA 4HF0A 4ENKA 2CUEA 1SVLA 3JW4A 1JJ8C 1F36A 4YFKF 4HV6A 1WRJA 3A02A 2BW3A 1RKWA 2Q0OA 4YIFA 1MDMA 1JKRC 1RUOA 4Q5SF 4DZJA 3I4PA 3FM5A 2YS9A 4D9JA 1VQ4I 1Z3XA 2VUMJ 2UZKA 3IH4A 5LD2C 5K7HA 1ZLKA 3RPUA 5M3MJ 1V5EA 4D1QA 1B72A 2UWMA 4X6AJ 3MAJA 1Z67A 1LPQA 5LHGA 1ETXA 3F22A 2F6CA 2W48A 3U2RA 3W2WA 4F91B 4LK1F 5DUKA 2HFHA 5HNHA 2R5YA 5L3BA 3L9FA 1VTNC 2DMTA 2EK5A 4CCJA 3E6BA 3GW2A 2YX7A 2IA1A 5ILUA 3LSTA 3K70C 1FYLA 1OKRA 3PSFA 2R7WA 3F9KA 1QVTA 3LSJA 1K4SA 5FKOA 5CVJA 5BQTA 1ACIA 2R7TA 3F23A 1Z91A 3ESWB 3HGGA 4MFEA 1SAXA 4RM2A 2D1HA 3PNYA 3FBIB 2VIXA 4LLNA 1DU0A 4A0ZA 3E7LA 2AXTC 3TW7A 1VI0A 4F52A 3NWTA 4C3IJ 4EGYA 3LNQA 1OISA 2IJLA 4X0GA 3GTLJ 1U8BA 5E20A 2J5OA 4C2TA 1ZK8A 4OIQF 3OYFA 1YE9A 3HOUJ 3BG5A 4UUSA 2VKHA 1HSJA 3GTMJ 1XD7A 3F8MA 3TL4X 4IHXA 2FNAA 1R23A 2BXZA 1YOVB 5J8FA 4A6DA 4DQ2A 2H8RA 2LBFB 1Z7UA 4RAYA 2MGQA 4XK4A 5IYCJ 4E7HA 1MH4A 2JZYA 3HTUA 1X19A 2IPQX 2V1NA 4XR6A 1VZ0A 3DV8A 3NAUA 2Y31A 1M1EB 3RQIA 1JT0A 2P5LC 5FKKA 2BBYA 2DLLA 4I76A 4CYCA 3H92A 3BOQA 2UUZA 4Y17A 3FX3A 2XF5A 1G3WA 4LB6B 3OS0A 1LEAA 3QU3A 3CO7C 2HQAA 3GXOA 1JXSA 3FK6A 4GXOA 2M5WA 3OYEA 3QYFA 5JLWA 1UCRA 4KA4A 1UB9A 1EH6A 4AC0A 2CW0F 1FLIA 4Z2YA 3TMOA 3TQNA 2DA5A 3CP2A 4UHTA 2VBWA 2RGVA 4L5EA 1BBYA 2KZVA 2XSJC 4XOTA 2HQ5A 4UVCA 4XKWA 3V7CA 1S7OA 4Y15A 1LEBA 1Z7LA 2MYSA 2LRDA 2HEOA 2LDUA 2FSWA 5EEHA 4GRIA 5DD8A 3OIQA 2OTLI 1V54H 3HC7A 1E3PA 2K85A 1D0YA 3CJQB 3CCVI 4DYQA 3LSKA 3RKWA 2YU9J 1GUUA 4L0YB 3CJNA 1IUYA 3H0GJ 2QKMB 2HDWA 3BQZA 4DYCA 4L0ZB 2RV8A 1VQMI 4UV9A 3GZNB 4EATA 5M5WJ 2NOJB 4AU7A 4Z6YA 3E1SA 4E7ZA 3LQRA 1V5FA 2FNPA 2JRTA 2W25A 5K5QA 2K02A 3AG2H 1YW9A 3DQVC 3J7YJ 1JJ6C 3HSRA 2COBA 3ZQ7A 3S15J 3OIPA 4PJMA 1ZQ3P 2WBMA 1QPMA 2FBKA 3BR1A 5DS9A 5CVUA 3CZ6A 4ZYHA 1MSEC 2PG4A 4A3MJ 1U3EM 2HTJA 1R4NB 1YIOA 2E7WA 2H6BA 1FMVA 1JHFA 1K83J 3OS2A 4KIFA 3LSPA 3GX4X 1D1AA 5L3CA 2M9HA 3HB9A 1EF4A 1B4AA 2E1OA 3CF2A 1TWFJ 3BCAA 1FEXA 1W5TA 2PJPA 1ETQA 2KHMA 4B3XA 5EEGA 1QZYA 5JVTA 4FE7A 1YJ9I 2HPIA 5FLVA 4IOAF 3CTAA 4GO1A 1W4MA 2DMUA 5HOOA 2O5RA 2E2IJ 2H94A 3CP8A 2PMZN 1R71A 3F6OA 1V3FA 2DBBA 2ZSHB 3WGGA 1R22A 3Q9VA 3QOEA 3OOUA 1YFHA 1G2HA 1J5YA 3HOWJ 1LFBA 2LOOA 1GV2A 1ZYRF 4IO9F 1I39A 4GGGA 4HLXA 3VOEA 3H3UA 4HPQA 2EJRA 4QLCU 5FB2A 5J4YA 4LG0A 3OYKA 3VYUB 2ADUA 1BIAA 4FETA 3WTSC 4CDGA 1ZG5A 1KONA 2DMNA 1OPCA 3ZQFA 1SMYF 3L2RA 3JAMK 1ZGAA 3GBGA 2DPDA 3U21A 4B09A 1LVAA 2X9DA 4LMYA 1K79A 2QSGX 3SFIA 2J5PA 2R7DA 5IT9Z 3ASOH 1ONVA 1IC8A 3CCEI 1VQ6I 2EFPA 3CQZJ 3R6SA 1XCBA 1IG7A 5E3MA 5JR3A 4BYYA 3HRTA 3L00A 1T33A 5IT3A 2P0WA 3ERED 2CV1A 4FISA 4W97A 4DBRA 4P1WA 1HDPA 4HQEA 1YI2I 4WXCA 3BPVA 1R58A 3CLOA 4HX4A 4BJ6C 2ZCWA 2P6SA 1U5TB 5KNLA 3GTQJ 2FA5A 3FWEA 2DA2A 3S3OA 1NK3P 1RETA 1DPRA 1OYWA 1A6IA 1TBXA 4PFOA 3VDXA 4E70A 1KYWA 2RDPA 4IHYA 2D1VA 5D5WB 4LD5A 3HOSA 4U7DA 4IRIA 3S2DJ 2CSOA 1DU6A 1A6QA 1BI0A 3HDDA 2WB1N 2FX0A 4D7MA 3BTIA 1CF7A 2FMLA 1HKTA 2H6CA 4EJTA 4HRIA 3HOZJ 2BGCA 1SMTA 4KYWA 1IZ1A 2P4WA 2YR2A 3DU6A 4M74A 2LKXA 5F0CA 2FE3A 1E3OC 2MW8A 2JQ7A 1T0FA 1EKEA 5EG0B 1QHGA 1R49A 2KDOA 2W85A 1XS9A 5FKLA 1BC8C 2R5ZA 3F6VA 2R7ZJ 5D4RA 3C18A 2PN6A 3C2GA 3GCMA 1X1PA 3L09A 1YITI 4HF1A 3Q3SA 2L0KA 4KJZA 4NBQA 4KDPA 4XLEA 3KLNA 3L2CA 1WVRA 3DPLC 4G94A 2HPMA 3CC2I 4IX7A 4BBSJ 5E17F 5EZHA 3ZQQA 1MMSA 2ZJ2A 4YIIA 2JTVA 3J80K 5E3NA 1YJWI 1HCRA 4CCLA 4RGXA 1BM9A 2OD5A 5LEKA 4KT6A 2M34A 3WGIA 2R7UA 3LFUA 4LIUA 5AONA 4LK0F 4CXFA 2TRTA 1TWCJ 2YX4A 4PK4A 3FXRA 2L01A 4YELA 3M7GA 3S32A 1MJ9A 2KQRA 5FRMA 2PLYA 3VWBA 3JRAA 5DEQA 3MCZA 4LG0B 3CCRI 5M5YJ 3E0JB 3BTCA 4WF2A 2K7LA 3OYAA 2A3SA 4L5JA 1OLTA 5HLTA 3S1RJ 3SZGA 2QUFA 4F3QA 4EGZA 3HXLA 1D1CA 2R7RA 3A01B 3HPHA 2V26A 2IA2A 1MBFA 3RIRA 1UZCA 3U1KA 2Z9OA 3PUBA 4C2UA 3JCUC 3TP3A 1S8NA 2A05A 2A6HF 3L7WA 4M3FA 2DQLA 2NRAC 3H3VK 1UHSA 4BQQA 2DDBA 3DKWA 1DDNA 2M7BA 2KMUA 3O8HA 4FE4A 1XPXA 1Z6RA 2NAZA 1Z6TA 1SVMA 3BG9A 3RPQA 2BY2A 4ENNA 1SD5A 4MFDA 1POGA 1Z0XA 5JVGF 3CESA 2IS4A 5F1JA 1D0XA 5JHUA 4S05A 3HIFA 1CGPA 3G3ZA 3QP6A 3TOAA 2ELJA 1TC3C 3LAPA 1YO5C 2JPCA 2MBFA 3QPSA 2MLGA 2FJ1A 2K9SA 3I53A 4B8XA 1TT5B 1F4KA 4GDFA 2DT7B 2GXGA 4HNUA 4MTEA 2OBPA 3S3MA
chains in the Genus database with same CATH topology
2P5VA 2EV5A 2IA0A 3B02A 1XCVA 1YS6A 1B9NA 3GLXA 2CYYA 5BMZA 4JQFA 3I59B 4QWQA 5FFZA 1IRGA 4P9UA 3NQOA 3SFZA 5HLGA 3E5UA 3IRRA 5FFXA 2CO5A 1ZAOA 1Q1HA 2DW4A 3MZHA 1K7AA 3K2ZA 5D8KB 2P5KA 2R3SA 3GFIA 1MKMA 2ZNZA 2OQRA 5F1RA 3KEQA 3EETA 1JGSA 1GHCA 2QBYA 2HDCA 1S3JA 2HWVA 4A0XA 1JE8A 3F8BA 2O8XA 2XHKA 5E1ZB 3V7RA 1HW1A 4EM0B 1OR7A 2GA1A 5DDGA 3RYPA 4Y13A 4ESJA 3M8EA 4AWXB 2UXXA 3WTTC 4UVAA 2VN2A 3RI4A 2QYOA 3WODF 1K78A 1FX7A 2K4JA 3KZZA 3HRMA 3VFZA 5BOXA 1I27A 3PFIA 5AIQA 1HKSA 5ICEA 3M9AA 4LFUA 2QVOA 4R1HA 2O03A 1KU7A 3O6BB 2JPBA 4OIPF 1QO0D 2WC2A 1KU9A 4I2OA 1USTA 1ZREA 2NNNA 3HUGA 3N4MA 4G6DA 1ZRDA 2GQQA 3MQ0A 1IXCA 1IN5A 3E5XA 4I98B 4WK8F 3S2WA 5D5UB 4IF4A 2VOPA 4OIOF 4LB5A 4ENJA 5LGNA 1BI3A 1KA8A 4HYEA 2KIMA 2QQAA 2A69F 3EYYA 1T6SA 1IXRC 1U5TC 3RTRA 2DQRA 2L3DA 4M9XA 4RB1A 1FWZA 2DU9A 5LGUA 3WGHA 2QWWA 3ZMZA 2G9WA 4XLNF 3C7JA 3GF2A 4P5OA 2VE9A 3GFLA 2W57A 2LF8A 4I01A 1WKMA 3IL2A 2BEOA 1R00A 3F72A 1ON1A 1TW2A 2F5FA 4EMSA 2OAZA 3T0YA 3BDDA 4BHCA 1YLFA 4XSXF 3LAJA 4G9YA 4PZJA 4PDKA 4HDUA 1IAWA 5DCMB 3TDUC 2FOKA 1J9IA 2VBYA 1QZZA 4HA8A 2FBHA 2RN7A 4HZFA 2ZMEA 3J81Z 4KICA 1OYYA 5DUIA 5ICGA 2VT3A 3BJAA 4A0YA 3JTGA 3ECOA 2RVCA 5CVVA 5E18F 2EWNA 4G6QA 4U88A 2HOEA 5ICCA 3KP2A 1MJAA 3LWFA 3M8FA 3F8FA 4WCGA 3R60A 4IPAA 5IT9K 2C6YA 4A5NA 4D0PA 2RNJA 2E7XA 3R61A 2HZTA 2XAGA 1IN4A 1BIBA 1YTYA 2G7UA 3ZN0A 3JSOA 3ZMDA 3C1DA 2FXAA 1O3SA 3GEZA 1G3YA 3GZ5A 2XKOA 2CGPA 2K4BA 2VODA 2XAFA 1X3UA 4GYIA 3N97A 3SXYA 5FD5A 2Q2EA 1HQCA 3BWGA 3WTVC 1XMKA 4EM2A 1MDMB 5JI6A 2BYVE 5E8IA 3V7SA 4OINF 4AIKA 1FYMA 1YQAA 3CUQA 3I71A 1E2XA 1SD7A 4UV8A 4IXAA 2IW5A 3QPHA 4HDVA 2O3FA 1RNLA 2XAHA 2CFXA 1IW7F 3IWZA 2EB7A 4MEXF 4ASNA 2Z3YA 1PUEE 3O3KA 1ZARA 1ZGJA 1G6NA 1PP8F 1H9TA 2IVMA 1YW8A 2D45A 5LHHA 4CICA 3QP5A 5A2QZ 2XUBA 4DNCA 2O6GE 2L54A 2DAOA 2MH2A 2MH9A 2PMHA 4UVBA 2MA3A 2V79A 3IC7A 3WTXC 2NS0A 4XLPF 3R0JA 1DP7P 2O61A 1FPQA 1R5GA 4R8HA 2Q8KA 2HQNA 4CHUA 3KP4A 1FZPB 6PAXA 1MGTA 4KT5C 3CUOA 2ESHA 4NB5A 2GAUA 3BZ6A 4G8XA 3K1NA 1KU3A 2XV4S 2ZNYA 1S7AA 1W7PA 3DXJF 2EV0A 3REOA 3FMSA 1FC3A 1XN7A 4AIHA 3QU6A 4BNCA 4EJVA 2P8TA 2W84A 4RB0A 5HLIA 5FLXZ 5JFRA 1TQIA 2A6EF 1YS7A 2PEXA 1IXSB 4JK1X 1A04A 4XSZF 3F3XA 4HW0A 3BY6A 2F5EA 3W6JB 2V6CA 1QQIA 2DT5A 1BI1A 2OZ6A 3ULQB 2YPRA 4KMUX 1FP1D 4ZH4F 2XGXA 4EJOA 5DCFA 2HKOA 3VB2A 3PQJA 3KZYA 4F7ZA 2ZO4A 4XRFA 1J7KA 4LLGF 2KKOA 1BI2A 2FQ3A 3HSEA 4HX7A 5D5VB 3BROA 1P4AA 1PP7U 3KLOA 4I0BA 3K69A 2H27A 2D2WA 3DP7A 2M30A 4U7BA 3F21A 1W7PB 2OQGA 2CWEA 1KU2A 3KETA 1D8KA 4BXUA 4NQWA 4ESBA 1LJ9A 4N9HA 3RJPA 3K0LA 1AWCA 3MZYA 5KVRA 4U0WA 4FT8A 2IRFG 4P96A 4KN4X 3CO6C 2H09A 2WWYA 2XIGA 4HOBA 1W7PD 1XSVA 1FBSA 1LDKB 2IP2A 3P9CA 4O5VA 1Z05A 5CVRA 3U1DA 4HAMA 3BPXA 1D8JA 5HS8A 2ISYA 1CF7B 2HGCA 3DEUA 2E1NA 2RQPA 1P6RA 1XSXA 4UXNA 4G7ZF 3B73A 5FGMA 2JT1A 4P55A 1JHHA 5AIPA 2P7CB 2ISZA 3FZVA 3WE2A 3BJOA 2A5YB 4RGUA 2FEZA 2MC3A 3I58A 3T5XA 4IHSA 1BOAA 4JBAA 3JSPA 4TV7A 3ML6A 2Y75A 2K27A 4CGZA 1U2WA 2O0YA 2P7VB 3FF5A 3QOPA 1XB4A 3M1EA 2L02A 2PBIA 2DK8A 3E97A 2AS5F 3EQLF 1QNTA 2VC0A 3JTHA 5HLHA 2X0LA 4N9IA 3QAHA 1ZRFA 3J81K 2LSOA 2EA2A 2VXZA 3FXQA 2FRHA 4S04A 3SHFA 1ZH5A 4IRHA 3IHUA 3C3WA 1TW3A 2L4AA 2HS5A 2UXNA 3FM3A 5L3EA 3T8RA 4OMYA 5E1XA 3WG9A 4I7HA 1E17A 5K1YA 4M71A 1S29A 2HYGD 3T1BA 4L9NA 3P9KA 3ELKA 1LB2A 4HV5A 3TOBA 3V4GA 1R36A 2FBIA 4L5IA 4Q48A 3GO5A 2PI0A 4RGSA 4A5MA 3J80Z 4YG2F 1O7FA 1DPUA 3KE2A 2IT0A 1L3LA 5BPDA 1GVJA 4R79A 5BPIA 1G3TA 2HYFA 4HBLA 2W24A 1USSA 2EA4A 4H0EA 1GXQA 2B0LA 5ILVA 1F9NA 1YYVA 2XKPA 4IRGA 4G7OF 3ZMUA 2DO7A 1GXPA 1QGPA 2A68F 1TQPA 4ESFA 4RB3C 4M72A 3F8NA 3TDZC 1P4WA 3LA3A 4L9JA 2DK5A 2HQRA 1U6GA 5D6EA 2EFWA 2QBYB 3COAC 4M9SA 2KRFA 2XRNA 2VBZA 4EQQA 3VODA 1YG2A 4L9VA 2ESNA 4FX0A 3MEXA 2XROA 2EFQA 1ZHFA 5F64A 3ZMTA 1T2KA 1EH7A 4GCVA 3E6DA 3ABTA 2FU4A 4LLLA 4NHJA 5H20A 4U0YA 2OU2A 2ZFWA 3ZPLA 5J6XA 4PGHA 1ODDA 3QRFF 1K78B 2RKHA 1IN7A 4WXHA 3IKTA 2HR3A 5LGTA 3IKVA 3WTYC 5A2QK 3V8KA 5HDGA 1T39A 2QZ8A 2QQBA 4M73A 1XGOA 4U0VA 2ETHA 2A07F 1TLHB 2LF7A 2Y0MA 3FHZA 2R7FA 3K1PA 3KP3A 4HQMA 1TTYA 1B59A 2EFOA 4A2UA 4YFNF 2YSRA 5CJ9A 4AVPA 2VONA 2AXLA 4FHTA 2XVCA 5CVIA 2M8EA 3LFKA 4KUMA 4BQAA 1R5HA 2G7HA 3Q9SA 5KK1A 3WTWC 4KN7X 4L9TA 1FP2A 1XGMA 3E6MA 2F2EA 3WE3A 1NHAA 2VT2A 3E6CC 4I02A 3DFGA 4UUVA 4KNYA 3RDIA 4CO8A 1D5VA 2VBXA 1O3QA 5D6FA 3W6KB 1K6OA 3FXUA 2KJBA 3KP5A 1OMIA 3IWFA 1QBJA 5FLXK 3Q5FA 2EV6A 2CQKA 1MZBA 3J7AO 1XGNA 1REPC 4CZZA 5LHIA 2DPUA 4LJZF 1HW2A 2ZBKA 4ZYDA 3QPTA 3F8CA 1FBUA 3TO9A 1I1SA 1C0WA 1B9MA 2KJCA 3HOTA 2P6TA 4MTDA 3NRVA 3RKXA 3GFJA 4G7HF 1DUXC 4A6EA 1H9GA 4OU0A 2ZMEB 5CYVA 1P92A 5HS7A 1KQ8A 2QQ9A 3SZPA 1XSDA 3NEUA 3BJ6A 4MEYF 3MFKA 1XMAA 1O7LA 1I5ZA 2STWA 1I1GA 2RC4A 1U5TA 4MGRA 1HBXG 5LEJA 5TRDA 4IJAA 4A12A 2VC1A 4L18B 5BS6A 2STTA 4ZZLA 3ECHA 4HLYA 2KIUA 1J2XA 3K9TA 3P7NA 4MHGA 4OIRF 2KIFA 2OZUA 3V8JA 2QENA 4KMFA 2FF4A 1LDDA 5K5OA 3CDHA 2OA4A 3EYIA 1KGSA 4IVNA 1S6LA 4AIJA 1W5SA 2E1CA 1J75A 1KYZA 5LBQA 1B1BA 1WI9A 3ABUA 3GFMA 3FMRA 4BH9A 2M1BA 4BHBA 4AD9A 1R1TA 3R4KA 5L3GA 5K5RA 1BJAA 1R1UA 1O3RA 4ETSA 2DI3A 1SFEA 5CLSA 3CUQB 1L0OC 5DV5A 3SQNA 2DFIA 1EH8A 2M45A 1FBQA 5LRSA 4RAZA 1P4XA 2A61A 4RB2C 5L3FA 1IN6A 3I5UA 2VE8A 3WTZA 4Q47A 3DF8A 5ILSA 1BC7C 2YU3A 1HSTA 1R7JA 4I0AA 3KCCA 4K2EA 1OYIA 2BE5F 1G3SA 1MD0A 4M6XA 1IRFA 1RZ4A 1Z9CA 3LQQA 2CG4A 1HW5A 1G4DA 3TO7A 1F5TA 2GZWA 2FMYA 2PMUA 1RI7A 3RKYA 2F5CA 2V9VA 1FSHA 1R1VA 2GWRA 1AOYA 3GYHX 3HRSA 1PDNC 5LLQA 3I59A 4HF2A 4ZYEA 4WXDA 4ZYGA 3OOPA 2X4HA 4IHTA 1P2FA 5J8CA 2WTEA 1O3TA 1LDJA 3MWMA 1KQ9A 1RIOH 1TNTA 5E8GA 1I6XA 1LNWA 5L3DA 1XDSA 1T98A 2K86A 4EV0A 3D0SA 3ZN1A 1RUNA 2ZKZA 1HXDA 3I64A 1SD6A 1FOKA 3KP6A 4OOIA 4FX4A 1ZRCA 2PQ8A 4YFXF 3SZTA 1ZLJA 2ACJA 1WQ2A 4EM1A 3D5LA 1ZG1A 3OV8A 5HDKA 4EVIA 1WSUA 2F5DA 3ROUA 1SFUA 5D8LB 2Z33A 1HKQA 4EJUA 3GWZA 3GZ6A 4I09A 5TJJA 3E3VA 3E5QA 4WWCA 3HYIA 4O3MA 1LQ1A 5ICFA 5ERIA 4MQVA 1TNSA 4KIBA 3TGNA 2V1DA 3O2PE 4LGWA 3V8LA 3JAMZ 3ZP5A 1XDUA 3GVAA 2HKXA 5H6QA 4HX8A 2DTRA 2NNYA 1ZG3A 2HTSA 5D5XB 1FYKA 4CYDA 4P9FA 4WX9A 2PFBA 2XASA 3IRQA 2ZXJA 2GIVA 2L4MA 3GUDA 3AAFA 4BAYA 1FSEA 3KP7A 5HDNA 1BN5A 5LRRA 3HSFA 2VOOA 1STZA 4ON0A 1UHWA 5H6RA 3I0TA 2NYXA 4RGRA 2MLKA 2V1XA 3FMQA 5DYMA 1Z1DA 1O57A 1UHMA 5E1WA 3HTSB 1ZN2A 3HHGA 4M6YA 3HRUA 1EV7A 4OMZA 3TO6A 3EDPA 5ED4A 2LKPA 4Q4ZF 3T8TA 5HS9A 4ZZDA 3KFWX 4KFCA 3WTUC 1YW7A 1Y0UA 3HHHA 3KEOA 4MNUA 4EJWA 2XAJA 5HVQC 2XAQA 4ENMA 3P9IA 1FT9A 4XBFA 1U8RA 3ZMSA 1T38A 1KQ0A 2JSCA 3VEPA 4MQ9F 1FNNA 5DCMA 2Z5UA 1U78A 2QM3A 3H3ZA 3G73A 1WWXA 1F1ZA 2ELHA 2M87A 4BHPA 1FY7A 3WU1B 3PQKA 5F6FA 3WU0A 2GXBA 2Y48A 4M9ZA 2BV6A 2GA2A 1IN8A 1ULYA 2EFNA 3I54A 4UNOA 2COMA 1V4RA 2MD5A 5FD6A 4O6JA 1J0RA 1UFMA 3DPTA 3CUQC 3R0AA 3ZMVA 2LNBA 3LA7A 3LA2A 5DD4A 3ISPA 2QLZA 4N0BA 4KIGA 3BP8A 1B6AA 4PCQA 1D3YA 1J59A 1IF1A 1ON2A 2V1UA 3K1MA 1H0MA 4GYGA 1SD4A 2WV0A 5FO5A 1SFXA 1XGSA 2Z99A 3U9GA 1MJBA 3RYRA 3EUHA 3TKYA 4PGGA 2TDXA 4RS8A 1TQMA 5D4SA 4ENKA 4HF0A 3JW4A 4YFKF 4HV6A 1WRJA 1MDMA 2Q0OA 4YIFA 1RUOA 4Q5SF 3I4PA 3FM5A 2UZKA 1ZLKA 3RPUA 2UWMA 3MAJA 5LHGA 3F22A 3U2RA 4LK1F 5DUKA 2HFHA 5L3BA 3L9FA 1VTNC 2EK5A 3E6BA 3GW2A 2YX7A 2IA1A 5ILUA 3LSTA 1FYLA 1OKRA 5BQTA 5CVJA 3F23A 1Z91A 1SAXA 2D1HA 4LLNA 4A0ZA 4EGYA 2IJLA 5E20A 2J5OA 4OIQF 1HSJA 1XD7A 3F8MA 2FNAA 1R23A 5J8FA 4A6DA 4DQ2A 1Z7UA 4RAYA 2JZYA 3HTUA 2IPQX 3DV8A 2P5LC 2BBYA 2DLLA 3H92A 3BOQA 4Y17A 3FX3A 1G3WA 4LB6B 1LEAA 3QU3A 3CO7C 3GXOA 1JXSA 4GXOA 2M5WA 1UCRA 4KA4A 1UB9A 1EH6A 1FLIA 2CW0F 4Z2YA 3TQNA 4UHTA 2VBWA 2RGVA 1BBYA 3V7CA 4UVCA 1S7OA 4Y15A 1LEBA 2HEOA 2LDUA 2FSWA 5EEHA 5DD8A 3RKWA 4L0YB 3CJNA 1IUYA 4L0ZB 2RV8A 4UV9A 3LQRA 2FNPA 2JRTA 2W25A 5K5QA 2K02A 1YW9A 3DQVC 3HSRA 3ZQ7A 1QPMA 2FBKA 5CVUA 4ZYHA 2PG4A 1U3EM 2HTJA 1YIOA 2E7WA 2H6BA 1JHFA 4KIFA 3GX4X 5L3CA 1B4AA 1W5TA 2PJPA 5JVTA 5EEGA 1QZYA 3CTAA 4GO1A 1W4MA 5HOOA 2H94A 3F6OA 1V3FA 2DBBA 3WGGA 1R22A 3Q9VA 1YFHA 1J5YA 1ZYRF 4HLXA 4GGGA 3VOEA 3H3UA 2EJRA 4QLCU 5FB2A 4LG0A 2ADUA 1BIAA 3WTSC 4CDGA 1ZG5A 1OPCA 1SMYF 3JAMK 1ZGAA 2DPDA 4B09A 1LVAA 4LMYA 1K79A 2J5PA 2R7DA 5IT9Z 1ONVA 2EFPA 3R6SA 1XCBA 5JR3A 4BYYA 3HRTA 3L00A 5IT3A 3ERED 4HQEA 4WXCA 3BPVA 1R58A 3CLOA 4HX4A 2ZCWA 2P6SA 1U5TB 2FA5A 3FWEA 1DPRA 1OYWA 1TBXA 4E70A 1KYWA 2RDPA 2D1VA 5D5WB 4LD5A 3HOSA 4U7DA 4IRIA 2CSOA 1BI0A 1CF7A 2FMLA 1HKTA 2H6CA 4EJTA 2BGCA 1SMTA 4KYWA 1IZ1A 2P4WA 2YR2A 4M74A 2FE3A 1T0FA 2W85A 1BC8C 3F6VA 5D4RA 3C18A 2PN6A 3L09A 4HF1A 4KDPA 3KLNA 3L2CA 3DPLC 4G94A 5E17F 2ZJ2A 4YIIA 2JTVA 3J80K 4RGXA 1BM9A 2OD5A 5LEKA 3WGIA 5AONA 4LK0F 4CXFA 2YX4A 3FXRA 2L01A 3M7GA 1MJ9A 2PLYA 5DEQA 3MCZA 4LG0B 4WF2A 2K7LA 2A3SA 4L5JA 2QUFA 4EGZA 2IA2A 3RIRA 2Z9OA 1S8NA 2A6HF 3L7WA 2DQLA 2NRAC 3DKWA 1DDNA 1Z6RA 2NAZA 1Z6TA 3RPQA 4ENNA 1SD5A 5JHUA 4S05A 3HIFA 1CGPA 3G3ZA 3QP6A 3TOAA 3LAPA 1YO5C 2JPCA 2MBFA 2MLGA 3I53A 4B8XA 1F4KA 2GXGA 4MTEA 2OBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5V A;  2EV5 A;  2IA0 A;  3B02 A;  1XCV A;  1YS6 A;  1B9N A;  3GLX A;  2CYY A;  5BMZ A;  4JQF A;  3I59 B;  4QWQ A;  5FFZ A;  1IRG A;  4P9U A;  3NQO A;  3SFZ A;  5HLG A;  3E5U A;  3IRR A;  5FFX A;  2CO5 A;  1ZAO A;  1Q1H A;  2DW4 A;  3MZH A;  1K7A A;  3K2Z A;  5D8K B;  2P5K A;  2R3S A;  3GFI A;  1MKM A;  2ZNZ A;  2OQR A;  5F1R A;  3KEQ A;  3EET A;  1JGS A;  1GHC A;  2QBY A;  2HDC A;  1S3J A;  2HWV A;  4A0X A;  1JE8 A;  3F8B A;  2O8X A;  2XHK A;  5E1Z B;  3V7R A;  1HW1 A;  4EM0 B;  1OR7 A;  2GA1 A;  5DDG A;  3RYP A;  4Y13 A;  4ESJ A;  3M8E A;  4AWX B;  2UXX A;  3WTT C;  4UVA A;  2VN2 A;  3RI4 A;  2QYO A;  3WOD F;  1K78 A;  1FX7 A;  2K4J A;  3KZZ A;  3HRM A;  3VFZ A;  5BOX A;  1I27 A;  3PFI A;  5AIQ A;  1HKS A;  5ICE A;  3M9A A;  4LFU A;  2QVO A;  4R1H A;  2O03 A;  1KU7 A;  3O6B B;  2JPB A;  4OIP F;  1QO0 D;  2WC2 A;  1KU9 A;  4I2O A;  1UST A;  1ZRE A;  2NNN A;  3HUG A;  3N4M A;  4G6D A;  1ZRD A;  2GQQ A;  3MQ0 A;  1IXC A;  1IN5 A;  3E5X A;  4I98 B;  4WK8 F;  3S2W A;  5D5U B;  4IF4 A;  2VOP A;  4OIO F;  4LB5 A;  4ENJ A;  5LGN A;  1BI3 A;  1KA8 A;  4HYE A;  2KIM A;  2QQA A;  2A69 F;  3EYY A;  1T6S A;  1IXR C;  1U5T C;  3RTR A;  2DQR A;  2L3D A;  4M9X A;  4RB1 A;  1FWZ A;  2DU9 A;  5LGU A;  3WGH A;  2QWW A;  3ZMZ A;  2G9W A;  4XLN F;  3C7J A;  3GF2 A;  4P5O A;  2VE9 A;  3GFL A;  2W57 A;  2LF8 A;  4I01 A;  1WKM A;  3IL2 A;  2BEO A;  1R00 A;  3F72 A;  1ON1 A;  1TW2 A;  2F5F A;  4EMS A;  2OAZ A;  3T0Y A;  3BDD A;  4BHC A;  1YLF A;  4XSX F;  3LAJ A;  4G9Y A;  4PZJ A;  4PDK A;  4HDU A;  1IAW A;  5DCM B;  3TDU C;  2FOK A;  1J9I A;  2VBY A;  1QZZ A;  4HA8 A;  2FBH A;  2RN7 A;  4HZF A;  2ZME A;  3J81 Z;  4KIC A;  1OYY A;  5DUI A;  5ICG A;  2VT3 A;  3BJA A;  4A0Y A;  3JTG A;  3ECO A;  2RVC A;  5CVV A;  5E18 F;  2EWN A;  4G6Q A;  4U88 A;  2HOE A;  5ICC A;  3KP2 A;  1MJA A;  3LWF A;  3M8F A;  3F8F A;  4WCG A;  3R60 A;  4IPA A;  5IT9 K;  2C6Y A;  4A5N A;  4D0P A;  2RNJ A;  2E7X A;  3R61 A;  2HZT A;  2XAG A;  1IN4 A;  1BIB A;  1YTY A;  2G7U A;  3ZN0 A;  3JSO A;  3ZMD A;  3C1D A;  2FXA A;  1O3S A;  3GEZ A;  1G3Y A;  3GZ5 A;  2XKO A;  2CGP A;  2K4B A;  2VOD A;  2XAF A;  1X3U A;  4GYI A;  3N97 A;  3SXY A;  5FD5 A;  2Q2E A;  1HQC A;  3BWG A;  3WTV C;  1XMK A;  4EM2 A;  1MDM B;  5JI6 A;  2BYV E;  5E8I A;  3V7S A;  4OIN F;  4AIK A;  1FYM A;  1YQA A;  3CUQ A;  3I71 A;  1E2X A;  1SD7 A;  4UV8 A;  4IXA A;  2IW5 A;  3QPH A;  4HDV A;  2O3F A;  1RNL A;  2XAH A;  2CFX A;  1IW7 F;  3IWZ A;  2EB7 A;  4MEX F;  4ASN A;  2Z3Y A;  1PUE E;  3O3K A;  1ZAR A;  1ZGJ A;  1G6N A;  1PP8 F;  1H9T A;  2IVM A;  1YW8 A;  2D45 A;  5LHH A;  4CIC A;  3QP5 A;  5A2Q Z;  2XUB A;  4DNC A;  2O6G E;  2L54 A;  2DAO A;  2MH2 A;  2MH9 A;  2PMH A;  4UVB A;  2MA3 A;  2V79 A;  3IC7 A;  3WTX C;  2NS0 A;  4XLP F;  3R0J A;  1DP7 P;  2O61 A;  1FPQ A;  1R5G A;  4R8H A;  2Q8K A;  2HQN A;  4CHU A;  3KP4 A;  1FZP B;  6PAX A;  1MGT A;  4KT5 C;  3CUO A;  2ESH A;  4NB5 A;  2GAU A;  3BZ6 A;  4G8X A;  3K1N A;  1KU3 A;  2XV4 S;  2ZNY A;  1S7A A;  1W7P A;  3DXJ F;  2EV0 A;  3REO A;  3FMS A;  1FC3 A;  1XN7 A;  4AIH A;  3QU6 A;  4BNC A;  4EJV A;  2P8T A;  2W84 A;  4RB0 A;  5HLI A;  5FLX Z;  5JFR A;  1TQI A;  2A6E F;  1YS7 A;  2PEX A;  1IXS B;  4JK1 X;  1A04 A;  4XSZ F;  3F3X A;  4HW0 A;  3BY6 A;  2F5E A;  3W6J B;  2V6C A;  1QQI A;  2DT5 A;  1BI1 A;  2OZ6 A;  3ULQ B;  2YPR A;  4KMU X;  1FP1 D;  4ZH4 F;  2XGX A;  4EJO A;  5DCF A;  2HKO A;  3VB2 A;  3PQJ A;  3KZY A;  4F7Z A;  2ZO4 A;  4XRF A;  1J7K A;  4LLG F;  2KKO A;  1BI2 A;  2FQ3 A;  3HSE A;  4HX7 A;  5D5V B;  3BRO A;  1P4A A;  1PP7 U;  3KLO A;  4I0B A;  3K69 A;  2H27 A;  2D2W A;  3DP7 A;  2M30 A;  4U7B A;  3F21 A;  1W7P B;  2OQG A;  2CWE A;  1KU2 A;  3KET A;  1D8K A;  4BXU A;  4NQW A;  4ESB A;  1LJ9 A;  4N9H A;  3RJP A;  3K0L A;  1AWC A;  3MZY A;  5KVR A;  4U0W A;  4FT8 A;  2IRF G;  4P96 A;  4KN4 X;  3CO6 C;  2H09 A;  2WWY A;  2XIG A;  4HOB A;  1W7P D;  1XSV A;  1FBS A;  1LDK B;  2IP2 A;  3P9C A;  4O5V A;  1Z05 A;  5CVR A;  3U1D A;  4HAM A;  3BPX A;  1D8J A;  5HS8 A;  2ISY A;  1CF7 B;  2HGC A;  3DEU A;  2E1N A;  2RQP A;  1P6R A;  1XSX A;  4UXN A;  4G7Z F;  3B73 A;  5FGM A;  2JT1 A;  4P55 A;  1JHH A;  5AIP A;  2P7C B;  2ISZ A;  3FZV A;  3WE2 A;  3BJO A;  2A5Y B;  4RGU A;  2FEZ A;  2MC3 A;  3I58 A;  3T5X A;  4IHS A;  1BOA A;  4JBA A;  3JSP A;  4TV7 A;  3ML6 A;  2Y75 A;  2K27 A;  4CGZ A;  1U2W A;  2O0Y A;  2P7V B;  3FF5 A;  3QOP A;  1XB4 A;  3M1E A;  2L02 A;  2PBI A;  2DK8 A;  3E97 A;  2AS5 F;  3EQL F;  1QNT A;  2VC0 A;  3JTH A;  5HLH A;  2X0L A;  4N9I A;  3QAH A;  1ZRF A;  3J81 K;  2LSO A;  2EA2 A;  2VXZ A;  3FXQ A;  2FRH A;  4S04 A;  3SHF A;  1ZH5 A;  4IRH A;  3IHU A;  3C3W A;  1TW3 A;  2L4A A;  2HS5 A;  2UXN A;  3FM3 A;  5L3E A;  3T8R A;  4OMY A;  5E1X A;  3WG9 A;  4I7H A;  1E17 A;  5K1Y A;  4M71 A;  1S29 A;  2HYG D;  3T1B A;  4L9N A;  3P9K A;  3ELK A;  1LB2 A;  4HV5 A;  3TOB A;  3V4G A;  1R36 A;  2FBI A;  4L5I A;  4Q48 A;  3GO5 A;  2PI0 A;  4RGS A;  4A5M A;  3J80 Z;  4YG2 F;  1O7F A;  1DPU A;  3KE2 A;  2IT0 A;  1L3L A;  5BPD A;  1GVJ A;  4R79 A;  5BPI A;  1G3T A;  2HYF A;  4HBL A;  2W24 A;  1USS A;  2EA4 A;  4H0E A;  1GXQ A;  2B0L A;  5ILV A;  1F9N A;  1YYV A;  2XKP A;  4IRG A;  4G7O F;  3ZMU A;  2DO7 A;  1GXP A;  1QGP A;  2A68 F;  1TQP A;  4ESF A;  4RB3 C;  4M72 A;  3F8N A;  3TDZ C;  1P4W A;  3LA3 A;  4L9J A;  2DK5 A;  2HQR A;  1U6G A;  5D6E A;  2EFW A;  2QBY B;  3COA C;  4M9S A;  2KRF A;  2XRN A;  2VBZ A;  4EQQ A;  3VOD A;  1YG2 A;  4L9V A;  2ESN A;  4FX0 A;  3MEX A;  2XRO A;  2EFQ A;  1ZHF A;  5F64 A;  3ZMT A;  1T2K A;  1EH7 A;  4GCV A;  3E6D A;  3ABT A;  2FU4 A;  4LLL A;  4NHJ A;  5H20 A;  4U0Y A;  2OU2 A;  2ZFW A;  3ZPL A;  5J6X A;  4PGH A;  1ODD A;  3QRF F;  1K78 B;  2RKH A;  1IN7 A;  4WXH A;  3IKT A;  2HR3 A;  5LGT A;  3IKV A;  3WTY C;  5A2Q K;  3V8K A;  5HDG A;  1T39 A;  2QZ8 A;  2QQB A;  4M73 A;  1XGO A;  4U0V A;  2ETH A;  2A07 F;  1TLH B;  2LF7 A;  2Y0M A;  3FHZ A;  2R7F A;  3K1P A;  3KP3 A;  4HQM A;  1TTY A;  1B59 A;  2EFO A;  4A2U A;  4YFN F;  2YSR A;  5CJ9 A;  4AVP A;  2VON A;  2AXL A;  4FHT A;  2XVC A;  5CVI A;  2M8E A;  3LFK A;  4KUM A;  4BQA A;  1R5H A;  2G7H A;  3Q9S A;  5KK1 A;  3WTW C;  4KN7 X;  4L9T A;  1FP2 A;  1XGM A;  3E6M A;  2F2E A;  3WE3 A;  1NHA A;  2VT2 A;  3E6C C;  4I02 A;  3DFG A;  4UUV A;  4KNY A;  3RDI A;  4CO8 A;  1D5V A;  2VBX A;  1O3Q A;  5D6F A;  3W6K B;  1K6O A;  3FXU A;  2KJB A;  3KP5 A;  1OMI A;  3IWF A;  1QBJ A;  5FLX K;  3Q5F A;  2EV6 A;  2CQK A;  1MZB A;  3J7A O;  1XGN A;  1REP C;  4CZZ A;  5LHI A;  2DPU A;  4LJZ F;  1HW2 A;  2ZBK A;  4ZYD A;  3QPT A;  3F8C A;  1FBU A;  3TO9 A;  1I1S A;  1C0W A;  1B9M A;  2KJC A;  3HOT A;  2P6T A;  4MTD A;  3NRV A;  3RKX A;  3GFJ A;  4G7H F;  1DUX C;  4A6E A;  1H9G A;  4OU0 A;  2ZME B;  5CYV A;  1P92 A;  5HS7 A;  1KQ8 A;  2QQ9 A;  3SZP A;  1XSD A;  3NEU A;  3BJ6 A;  4MEY F;  3MFK A;  1XMA A;  1O7L A;  1I5Z A;  2STW A;  1I1G A;  2RC4 A;  1U5T A;  4MGR A;  1HBX G;  5LEJ A;  5TRD A;  4IJA A;  4A12 A;  2VC1 A;  4L18 B;  5BS6 A;  2STT A;  4ZZL A;  3ECH A;  4HLY A;  2KIU A;  1J2X A;  3K9T A;  3P7N A;  4MHG A;  4OIR F;  2KIF A;  2OZU A;  3V8J A;  2QEN A;  4KMF A;  2FF4 A;  1LDD A;  5K5O A;  3CDH A;  2OA4 A;  3EYI A;  1KGS A;  4IVN A;  1S6L A;  4AIJ A;  1W5S A;  2E1C A;  1J75 A;  1KYZ A;  5LBQ A;  1B1B A;  1WI9 A;  3ABU A;  3GFM A;  3FMR A;  4BH9 A;  2M1B A;  4BHB A;  4AD9 A;  1R1T A;  3R4K A;  5L3G A;  5K5R A;  1BJA A;  1R1U A;  1O3R A;  4ETS A;  2DI3 A;  1SFE A;  5CLS A;  3CUQ B;  1L0O C;  5DV5 A;  3SQN A;  2DFI A;  1EH8 A;  2M45 A;  1FBQ A;  5LRS A;  4RAZ A;  1P4X A;  2A61 A;  4RB2 C;  5L3F A;  1IN6 A;  3I5U A;  2VE8 A;  3WTZ A;  4Q47 A;  3DF8 A;  5ILS A;  1BC7 C;  2YU3 A;  1HST A;  1R7J A;  4I0A A;  3KCC A;  4K2E A;  1OYI A;  2BE5 F;  1G3S A;  1MD0 A;  4M6X A;  1IRF A;  1RZ4 A;  1Z9C A;  3LQQ A;  2CG4 A;  1HW5 A;  1G4D A;  3TO7 A;  1F5T A;  2GZW A;  2FMY A;  2PMU A;  1RI7 A;  3RKY A;  2F5C A;  2V9V A;  1FSH A;  1R1V A;  2GWR A;  1AOY A;  3GYH X;  3HRS A;  1PDN C;  5LLQ A;  3I59 A;  4HF2 A;  4ZYE A;  4WXD A;  4ZYG A;  3OOP A;  2X4H A;  4IHT A;  1P2F A;  5J8C A;  2WTE A;  1O3T A;  1LDJ A;  3MWM A;  1KQ9 A;  1RIO H;  1TNT A;  5E8G A;  1I6X A;  1LNW A;  5L3D A;  1XDS A;  1T98 A;  2K86 A;  4EV0 A;  3D0S A;  3ZN1 A;  1RUN A;  2ZKZ A;  1HXD A;  3I64 A;  1SD6 A;  1FOK A;  3KP6 A;  4OOI A;  4FX4 A;  1ZRC A;  2PQ8 A;  4YFX F;  3SZT A;  1ZLJ A;  2ACJ A;  1WQ2 A;  4EM1 A;  3D5L A;  1ZG1 A;  3OV8 A;  5HDK A;  4EVI A;  1WSU A;  2F5D A;  3ROU A;  1SFU A;  5D8L B;  2Z33 A;  1HKQ A;  4EJU A;  3GWZ A;  3GZ6 A;  4I09 A;  5TJJ A;  3E3V A;  3E5Q A;  4WWC A;  3HYI A;  4O3M A;  1LQ1 A;  5ICF A;  5ERI A;  4MQV A;  1TNS A;  4KIB A;  3TGN A;  2V1D A;  3O2P E;  4LGW A;  3V8L A;  3JAM Z;  3ZP5 A;  1XDU A;  3GVA A;  2HKX A;  5H6Q A;  4HX8 A;  2DTR A;  2NNY A;  1ZG3 A;  2HTS A;  5D5X B;  1FYK A;  4CYD A;  4P9F A;  4WX9 A;  2PFB A;  2XAS A;  3IRQ A;  2ZXJ A;  2GIV A;  2L4M A;  3GUD A;  3AAF A;  4BAY A;  1FSE A;  3KP7 A;  5HDN A;  1BN5 A;  5LRR A;  3HSF A;  2VOO A;  1STZ A;  4ON0 A;  1UHW A;  5H6R A;  3I0T A;  2NYX A;  4RGR A;  2MLK A;  2V1X A;  3FMQ A;  5DYM A;  1Z1D A;  1O57 A;  1UHM A;  5E1W A;  3HTS B;  1ZN2 A;  3HHG A;  4M6Y A;  3HRU A;  1EV7 A;  4OMZ A;  3TO6 A;  3EDP A;  5ED4 A;  2LKP A;  4Q4Z F;  3T8T A;  5HS9 A;  4ZZD A;  3KFW X;  4KFC A;  3WTU C;  1YW7 A;  1Y0U A;  3HHH A;  3KEO A;  4MNU A;  4EJW A;  2XAJ A;  5HVQ C;  2XAQ A;  4ENM A;  3P9I A;  1FT9 A;  4XBF A;  1U8R A;  3ZMS A;  1T38 A;  1KQ0 A;  2JSC A;  3VEP A;  4MQ9 F;  1FNN A;  5DCM A;  2Z5U A;  1U78 A;  2QM3 A;  3H3Z A;  3G73 A;  1WWX A;  1F1Z A;  2ELH A;  2M87 A;  4BHP A;  1FY7 A;  3WU1 B;  3PQK A;  5F6F A;  3WU0 A;  2GXB A;  2Y48 A;  4M9Z A;  2BV6 A;  2GA2 A;  1IN8 A;  1ULY A;  2EFN A;  3I54 A;  4UNO A;  2COM A;  1V4R A;  2MD5 A;  5FD6 A;  4O6J A;  1J0R A;  1UFM A;  3DPT A;  3CUQ C;  3R0A A;  3ZMV A;  2LNB A;  3LA7 A;  3LA2 A;  5DD4 A;  3ISP A;  2QLZ A;  4N0B A;  4KIG A;  3BP8 A;  1B6A A;  4PCQ A;  1D3Y A;  1J59 A;  1IF1 A;  1ON2 A;  2V1U A;  3K1M A;  1H0M A;  4GYG A;  1SD4 A;  2WV0 A;  5FO5 A;  1SFX A;  1XGS A;  2Z99 A;  3U9G A;  1MJB A;  3RYR A;  3EUH A;  3TKY A;  4PGG A;  2TDX A;  4RS8 A;  1TQM A;  5D4S A;  4ENK A;  4HF0 A;  3JW4 A;  4YFK F;  4HV6 A;  1WRJ A;  1MDM A;  2Q0O A;  4YIF A;  1RUO A;  4Q5S F;  3I4P A;  3FM5 A;  2UZK A;  1ZLK A;  3RPU A;  2UWM A;  3MAJ A;  5LHG A;  3F22 A;  3U2R A;  4LK1 F;  5DUK A;  2HFH A;  5L3B A;  3L9F A;  1VTN C;  2EK5 A;  3E6B A;  3GW2 A;  2YX7 A;  2IA1 A;  5ILU A;  3LST A;  1FYL A;  1OKR A;  5BQT A;  5CVJ A;  3F23 A;  1Z91 A;  1SAX A;  2D1H A;  4LLN A;  4A0Z A;  4EGY A;  2IJL A;  5E20 A;  2J5O A;  4OIQ F;  1HSJ A;  1XD7 A;  3F8M A;  2FNA A;  1R23 A;  5J8F A;  4A6D A;  4DQ2 A;  1Z7U A;  4RAY A;  2JZY A;  3HTU A;  2IPQ X;  3DV8 A;  2P5L C;  2BBY A;  2DLL A;  3H92 A;  3BOQ A;  4Y17 A;  3FX3 A;  1G3W A;  4LB6 B;  1LEA A;  3QU3 A;  3CO7 C;  3GXO A;  1JXS A;  4GXO A;  2M5W A;  1UCR A;  4KA4 A;  1UB9 A;  1EH6 A;  1FLI A;  2CW0 F;  4Z2Y A;  3TQN A;  4UHT A;  2VBW A;  2RGV A;  1BBY A;  3V7C A;  4UVC A;  1S7O A;  4Y15 A;  1LEB A;  2HEO A;  2LDU A;  2FSW A;  5EEH A;  5DD8 A;  3RKW A;  4L0Y B;  3CJN A;  1IUY A;  4L0Z B;  2RV8 A;  4UV9 A;  3LQR A;  2FNP A;  2JRT A;  2W25 A;  5K5Q A;  2K02 A;  1YW9 A;  3DQV C;  3HSR A;  3ZQ7 A;  1QPM A;  2FBK A;  5CVU A;  4ZYH A;  2PG4 A;  1U3E M;  2HTJ A;  1YIO A;  2E7W A;  2H6B A;  1JHF A;  4KIF A;  3GX4 X;  5L3C A;  1B4A A;  1W5T A;  2PJP A;  5JVT A;  5EEG A;  1QZY A;  3CTA A;  4GO1 A;  1W4M A;  5HOO A;  2H94 A;  3F6O A;  1V3F A;  2DBB A;  3WGG A;  1R22 A;  3Q9V A;  1YFH A;  1J5Y A;  1ZYR F;  4HLX A;  4GGG A;  3VOE A;  3H3U A;  2EJR A;  4QLC U;  5FB2 A;  4LG0 A;  2ADU A;  1BIA A;  3WTS C;  4CDG A;  1ZG5 A;  1OPC A;  1SMY F;  3JAM K;  1ZGA A;  2DPD A;  4B09 A;  1LVA A;  4LMY A;  1K79 A;  2J5P A;  2R7D A;  5IT9 Z;  1ONV A;  2EFP A;  3R6S A;  1XCB A;  5JR3 A;  4BYY A;  3HRT A;  3L00 A;  5IT3 A;  3ERE D;  4HQE A;  4WXC A;  3BPV A;  1R58 A;  3CLO A;  4HX4 A;  2ZCW A;  2P6S A;  1U5T B;  2FA5 A;  3FWE A;  1DPR A;  1OYW A;  1TBX A;  4E70 A;  1KYW A;  2RDP A;  2D1V A;  5D5W B;  4LD5 A;  3HOS A;  4U7D A;  4IRI A;  2CSO A;  1BI0 A;  1CF7 A;  2FML A;  1HKT A;  2H6C A;  4EJT A;  2BGC A;  1SMT A;  4KYW A;  1IZ1 A;  2P4W A;  2YR2 A;  4M74 A;  2FE3 A;  1T0F A;  2W85 A;  1BC8 C;  3F6V A;  5D4R A;  3C18 A;  2PN6 A;  3L09 A;  4HF1 A;  4KDP A;  3KLN A;  3L2C A;  3DPL C;  4G94 A;  5E17 F;  2ZJ2 A;  4YII A;  2JTV A;  3J80 K;  4RGX A;  1BM9 A;  2OD5 A;  5LEK A;  3WGI A;  5AON A;  4LK0 F;  4CXF A;  2YX4 A;  3FXR A;  2L01 A;  3M7G A;  1MJ9 A;  2PLY A;  5DEQ A;  3MCZ A;  4LG0 B;  4WF2 A;  2K7L A;  2A3S A;  4L5J A;  2QUF A;  4EGZ A;  2IA2 A;  3RIR A;  2Z9O A;  1S8N A;  2A6H F;  3L7W A;  2DQL A;  2NRA C;  3DKW A;  1DDN A;  1Z6R A;  2NAZ A;  1Z6T A;  3RPQ A;  4ENN A;  1SD5 A;  5JHU A;  4S05 A;  3HIF A;  1CGP A;  3G3Z A;  3QP6 A;  3TOA A;  3LAP A;  1YO5 C;  2JPC A;  2MBF A;  2MLG A;  3I53 A;  4B8X A;  1F4K A;  2GXG A;  4MTE A;  2OBP A; 
#chains in the Genus database with same CATH topology
 2P5V A;  2EV5 A;  2IA0 A;  2ZXI A;  3B02 A;  1XCV A;  3AL0 B;  2AQE A;  1YS6 A;  2R5Z B;  4DOZ A;  1B9N A;  3QWL A;  2RNG A;  4XM3 A;  2LD5 A;  3GLX A;  2CYY A;  3KYL A;  2V4J C;  4JQF A;  5BMZ A;  2R0Q C;  3I59 B;  4QWQ A;  5FFZ A;  1IRG A;  4P9U A;  3NQO A;  2QCO A;  3L2Q A;  2KIS A;  3SFZ A;  5CKT A;  5HLG A;  1WJD A;  2WY7 Q;  2IGK A;  3E5U A;  3IRR A;  2ME0 A;  5FFX A;  2CO5 A;  1ZAO A;  2X1D A;  5EJC A;  4A3L J;  3F0C A;  4Y3O A;  1Q1H A;  2DW4 A;  2M3A A;  2CW8 A;  3BR0 A;  3MZH A;  4FTH A;  1K7A A;  3K2Z A;  5D8K B;  5TGT A;  2P5K A;  2R3S A;  1F43 A;  3GFI A;  5E3L A;  5GTH C;  2F48 A;  1MKM A;  2ZNZ A;  5C4J J;  2OQR A;  2L9S A;  1G8X A;  3MZ8 A;  5F1R A;  3LMM A;  1MMG A;  4I99 C;  3KEQ A;  3EET A;  1JGS A;  1GHC A;  2Y30 A;  2QBY A;  3OYN A;  1CQT A;  2LH9 A;  3RKQ A;  2HDC A;  5CQG A;  3N05 A;  1S3J A;  3GTP J;  2HWV A;  4A0X A;  1JE8 A;  2Z2S B;  3F8B A;  3MKW B;  3CCS I;  2O8X A;  2XHK A;  3S1N J;  5E1Z B;  3AG3 H;  3V7R A;  3PL8 A;  1HW1 A;  4CCM A;  4EM0 B;  3M4O J;  1P9Q C;  1OR7 A;  2M0M A;  1PVE A;  2GA1 A;  5DDG A;  2GM4 A;  1LUJ B;  3RYP A;  3HGY A;  3CCL I;  4Y13 A;  4ESJ A;  2JK3 A;  3M8E A;  2BVL A;  4AWX B;  2UXX A;  1UG0 A;  4B43 A;  3WTT C;  4UVA A;  2VN2 A;  2QSH X;  2HVQ A;  3RI4 A;  2QYO A;  2X1E A;  3BZC A;  3WOD F;  1K78 A;  5F0F A;  1FX7 A;  2E35 A;  2X6O A;  2K4J A;  1MBH A;  3KZZ A;  2EIL H;  2HXO A;  3D5S C;  3HRM A;  4AYB N;  3VFZ A;  5J47 A;  4RAG A;  5BOX A;  1I27 A;  5DTD A;  3PFI A;  2QSF X;  5AIQ A;  1HKS A;  5ICE A;  3M9A A;  9ANT A;  2K9Q A;  2QVO A;  4LFU A;  2K3F A;  1JTX A;  4R1H A;  2O03 A;  1KU7 A;  3O6B B;  2IXS A;  2JPB A;  2O8K A;  2RAE A;  1GT0 C;  4OIP F;  2VKD A;  1ZGW A;  1QO0 D;  1JUS A;  3RCO A;  2WC2 A;  1KU9 A;  2Y69 H;  1B8I A;  4I2O A;  3CC7 I;  1UST A;  1ZRE A;  3DWL E;  2KL4 A;  1JUM A;  4ZC3 A;  2PMZ A;  4XID A;  1RKT A;  4XRS G;  2DA7 A;  5IP6 A;  2NNN A;  3HUG A;  4DJA A;  3DBH B;  3N4M A;  2ID6 A;  4XOP A;  4NNJ A;  1YRN A;  4G6D A;  1ZRD A;  2GQQ A;  3FXO A;  3MQ0 A;  1ZEL A;  4XN0 A;  1IXC A;  1IN5 A;  3E5X A;  4I98 B;  1ZTR A;  1FIA A;  4WK8 F;  1XG1 A;  2WAD A;  4M3D A;  3IV5 A;  4FCY A;  2A5W A;  3S2W A;  3Q0V A;  4D7N A;  2E1M B;  4IF4 A;  5D5U B;  1MND A;  4D5C A;  3S1M J;  2WAQ N;  2VOP A;  3W6V A;  4OIO F;  4M6V A;  4LB5 A;  4ENJ A;  5LGN A;  1BI3 A;  1GV5 A;  2DFE A;  1KA8 A;  4HYE A;  2KIM A;  4BQN A;  2QQA A;  2A69 F;  3HBL A;  5TIS C;  1HF0 A;  3EYY A;  1T6S A;  2JA8 J;  1IXR C;  4Y33 A;  1W36 D;  3K7A J;  1U5T C;  3RTR A;  2DQR A;  4DGW B;  2L3D A;  4M9X A;  4RB1 A;  2H1K A;  2RRE A;  3A4C A;  1FWZ A;  2DU9 A;  3WGH A;  1GVD A;  2E36 A;  2LY2 A;  5LGU A;  3A0H C;  3I9V 2;  2QWW A;  4PFP A;  3ZMZ A;  4A3E J;  2G9W A;  3BR3 A;  2AO9 A;  3PIO F;  1ERD A;  1FTT A;  4XLN F;  3C7J A;  3GF2 A;  4P5O A;  2VE9 A;  3GFL A;  2W57 A;  2LF8 A;  2OJE D;  2ZJQ F;  1DGR M;  4I01 A;  1WKM A;  2HZD A;  1MBK A;  1FOW A;  4M3G A;  2VAS A;  1ENH A;  3IL2 A;  2PJR A;  2BEO A;  1PJR A;  1BR4 A;  1R00 A;  3F72 A;  2H8W A;  3OYL A;  1ON1 A;  3FIW A;  1TW2 A;  4IHW A;  2F5F A;  4EMS A;  2OAZ A;  2XF7 A;  2PX9 A;  2HOS A;  2LG4 A;  4X1E A;  3BDD A;  3T0Y A;  4BHC A;  1YLF A;  4XSX F;  3VPR A;  3LAJ A;  1JI8 A;  2L7K A;  2WB1 A;  4G9Y A;  2JSP A;  2X1C A;  4PZJ A;  2LMD A;  3DTE A;  4PDK A;  3H5N A;  4QPQ A;  5IYD J;  2DN0 A;  4HDU A;  1UG2 A;  4DYR A;  1IAW A;  2VPR A;  5DCM B;  3TDU C;  1SAN A;  2FOK A;  2V9K A;  4V2F A;  1J9I A;  1JTY A;  1IV6 A;  2VBY A;  1QZZ A;  2DOA A;  4HA8 A;  2E60 A;  3X2Q H;  2FBH A;  3ZQH A;  2Y0S N;  3WG7 H;  2RN7 A;  4HZF A;  2ZME A;  3J81 Z;  2DTZ A;  3M3Y J;  4KIC A;  4BKX A;  1ZR4 A;  1OYY A;  4BL0 B;  5DUI A;  5ICG A;  2VT3 A;  3BJA A;  4A0Y A;  3JTG A;  3ECO A;  1FJL A;  3G71 I;  5J40 A;  2RVC A;  5CVV A;  5E18 F;  3ERM A;  2LTP A;  2EWN A;  2VJ4 A;  4G6Q A;  3BR5 A;  3A0B C;  4U88 A;  2HOE A;  3G1M A;  1W5C C;  5ICC A;  2X6X A;  5B66 C;  3KP2 A;  2XGE A;  4UY8 I;  1MBG A;  3GTJ J;  1YRN B;  5C4X J;  2VKV A;  2CS3 A;  1JGG A;  5FRN A;  5J1Y A;  1MJA A;  3EUK L;  3G1O A;  3LWF A;  4RBO A;  3M8F A;  3CF5 F;  2K9L A;  3F8F A;  3SJM A;  1ITY A;  3K4M A;  4WCG A;  1YX5 A;  1PUF A;  3R60 A;  1BL0 A;  3GTG J;  4IPA A;  5IT9 K;  2C6Y A;  4A5N A;  4D0P A;  2RNJ A;  3HG9 A;  2E7X A;  5F27 A;  3R61 A;  1Y8R B;  2HZT A;  2XAG A;  1X58 A;  2CMP A;  1IN4 A;  1BIB A;  1YTY A;  2G7U A;  3ZN0 A;  1XTA A;  3JSO A;  3OL3 A;  2CUF A;  1O4X A;  3CD6 I;  4BDY A;  3ZMD A;  3C1D A;  4PJL A;  2FXA A;  4LG3 A;  1O3S A;  3GEZ A;  4V19 K;  1G3Y A;  3GZ5 A;  2XKO A;  1PYV A;  1JUP A;  2CGP A;  4BJ5 C;  2K4B A;  2B9S A;  1NG6 A;  3AKZ A;  3CDI A;  2VOD A;  2XAF A;  1X3U A;  4GYI A;  3OY9 A;  3N97 A;  3SXY A;  2G0E A;  3BG3 A;  2PJR B;  2BOL A;  5FD5 A;  2K5C A;  1WJC A;  1V5G A;  2Q2E A;  4BEH A;  1BR1 A;  1HQC A;  3BWG A;  2QA4 I;  1I6H J;  4JX6 A;  3WTV C;  5GAD J;  1WZ2 A;  1XMK A;  5FRO A;  4EM2 A;  2BW3 B;  1MDM B;  3AL0 C;  3SDG A;  4EEF G;  1WCM J;  2DOE A;  4Y7N J;  5JI6 A;  1MH3 A;  2BYV E;  2EIM H;  3JRD A;  1BOB A;  1WH7 A;  1LE8 A;  5E8I A;  1B72 B;  4KIS A;  3V7S A;  4OIN F;  1TP4 A;  4AIK A;  1FYM A;  3BR6 A;  1YQA A;  3CUQ A;  3I71 A;  2MAB A;  2R5Y B;  1E2X A;  3HEF A;  1OJL A;  1SD7 A;  4UV8 A;  4IXA A;  2VJ5 A;  3G1L A;  2IW5 A;  3QPH A;  4HDV A;  2O3F A;  1RRJ A;  1RNL A;  3A2K A;  2XAH A;  3KYC B;  2CFX A;  3JRH A;  1IW7 F;  1MNM C;  3H9Q A;  3IWZ A;  3O8G A;  2EB7 A;  3ZCO A;  2BY1 A;  3K10 A;  4MEX F;  4AID A;  4C9Y A;  5GAH J;  3K4B A;  3RPU D;  4ASN A;  4ZDL A;  4UB6 C;  2Z3Y A;  1PUE E;  3O3K A;  3MKL A;  2B63 J;  1WJB A;  4XKV A;  1ZAR A;  1ZGJ A;  5EGO A;  2W82 A;  1LVK A;  1G6N A;  1PP8 F;  2K40 A;  2N8G A;  2ZFU A;  4UUS B;  2DCE A;  4BBR J;  2WA0 A;  2FQ4 A;  1H9T A;  2IVM A;  1YW8 A;  2DOD A;  2R4G A;  4XKC A;  2D45 A;  2NVQ J;  5LHH A;  1ETY A;  1IV8 A;  4CCO A;  4CIC A;  3QP5 A;  2XUB A;  4DNC A;  5A2Q Z;  2GLO A;  2I8D A;  2O6G E;  2L54 A;  2WV1 A;  2DAO A;  2FD5 A;  2MH2 A;  2MH9 A;  2PMH A;  1X4O A;  3K4L A;  4UVB A;  2CV2 A;  2MA3 A;  2L9V A;  2V79 A;  3IC7 A;  3WTX C;  2JA6 J;  2NS0 A;  1FOY A;  3VSK A;  2OTJ I;  4CYC B;  2W1O A;  4XLP F;  3R0J A;  4A3F J;  1DP7 P;  2O61 A;  1FPQ A;  5IOY A;  2JVH A;  1R5G A;  4R8H A;  2Q8K A;  5K7F A;  3GTK J;  2HQN A;  2ZB9 A;  4CHU A;  3KP4 A;  2HOT A;  1VQ7 I;  1JT6 A;  1FZP B;  6PAX A;  3JRG A;  1MGT A;  4KT5 C;  3CUO A;  4ANJ A;  2ESH A;  4NB5 A;  4YEJ A;  2GAU A;  4AYB A;  2AQF A;  2GXA A;  3BZ6 A;  4G6T B;  2DJN A;  4G8X A;  2CRG A;  1WGX A;  1QZE A;  3K1N A;  3CCQ I;  1KU3 A;  2JMW A;  1NG7 A;  2XV4 S;  2ZNY A;  1W0T A;  1S7A A;  2DA1 A;  1W7P A;  4XQF A;  2LY9 A;  3DXJ F;  2EV0 A;  2BHY A;  4F55 A;  3REO A;  3FMS A;  1N25 A;  1IJW C;  4XON A;  1JKP C;  4Y4R A;  1FC3 A;  1XN7 A;  2NS8 A;  1W36 C;  1UEL B;  4BXX J;  2LY1 A;  1OCR H;  5B1B H;  2VQL A;  1WI3 A;  2OCE A;  2MC4 A;  4B4C A;  4AIH A;  4U87 A;  3QU6 A;  4BNC A;  4EJV A;  1XC5 A;  2E1M C;  3CCU I;  2P8T A;  2W84 A;  4RB0 A;  3C2H A;  5HLI A;  5FLX Z;  1W1W E;  3DEE A;  2P81 A;  5JFR A;  2Q1Z B;  1WH5 A;  4B44 A;  1MIJ A;  3TED A;  1TQI A;  1GLN A;  2OCC H;  3GLL A;  2A6E F;  3D5R C;  3DPU A;  3I3L A;  1RR7 A;  3RQ4 A;  4MLO A;  1YS7 A;  3J7A Y;  2PEX A;  5DM7 F;  3K4C A;  1IXS B;  4JK1 X;  2XRL A;  4E7J A;  1A04 A;  4XSZ F;  4DIQ A;  3ZQG A;  3L1P A;  3F3X A;  5KCM A;  2WAQ A;  1RC9 A;  4HW0 A;  3M07 A;  3BY6 A;  3PFY A;  2ECC A;  2F5E A;  1X1D A;  3W6J B;  2LFB A;  2V6C A;  1T08 B;  3K4J A;  1QQI A;  1D5Y A;  2DT5 A;  1BI1 A;  3DEW A;  2OZ6 A;  3ULQ B;  4ZTJ A;  3DCF A;  2LYC A;  3ZQI A;  3JRC A;  2YPR A;  1AA7 A;  3KZI C;  2EQR A;  3D1N I;  4KMU X;  3RSN A;  2ID3 A;  4XLF A;  3BQY A;  3FBN B;  1FP1 D;  4ZH4 F;  2XGX A;  3HJE A;  4EJO A;  1UAA A;  2DJI A;  5DCF A;  2HKO A;  3HL2 A;  4F92 B;  3VB2 A;  4BJT A;  3PQJ A;  3KZY A;  2O9L A;  3DLL F;  4F7Z A;  3RZD J;  1SAU A;  4LIV A;  1VND A;  2ZO4 A;  3HOY J;  1WJA A;  1TWH J;  4XRF A;  1J7K A;  2E5N A;  3S17 J;  4LLG F;  2JA2 A;  2KKO A;  1BI2 A;  1VQP I;  2FQ3 A;  1I50 J;  3HSE A;  3QPL A;  4HX7 A;  1ETK A;  5D5V B;  3BRO A;  1P4A A;  1PP7 U;  3KLO A;  4BQO A;  1K6Y A;  1YHQ I;  4I0B A;  3K69 A;  2H27 A;  1WJ5 A;  2D2W A;  2FOW A;  1A36 A;  4IZZ A;  3QOD A;  3DP7 A;  2M30 A;  1BR2 A;  4U7B A;  1R5I D;  3F21 A;  2L7Z A;  2BY0 A;  1ETV A;  1W7P B;  3PIP F;  2OQG A;  2CWE A;  4ZYA A;  2Y0S A;  3MKZ A;  1KU2 A;  3ASN H;  1VQ8 I;  3KET A;  4ABZ A;  1D8K A;  4BXU A;  4NQW A;  4ESB A;  1ETO A;  1LJ9 A;  5EYR A;  4N9H A;  3RJP A;  3K0L A;  1AWC A;  1SC7 A;  3MZY A;  3AG1 H;  1TT0 A;  5KVR A;  4U0W A;  4FT8 A;  2IRF G;  4P96 A;  1X1C A;  4KN4 X;  3CO6 C;  2H09 A;  5EDN A;  5BNG A;  3L2W A;  2WWY A;  2XIG A;  4HOB A;  3JRE A;  1W7P D;  1XSV A;  4S0H B;  4NUB A;  1FBS A;  1LDK B;  5B3S H;  2ICW G;  2R7S A;  4DW6 A;  5IP9 J;  2IP2 A;  2E2J J;  5KAI C;  3P9C A;  4O5V A;  4CZC A;  3S1Q J;  4BU2 A;  4A69 C;  1Z05 A;  1WJE A;  5CVR A;  3U1D A;  4HAM A;  2VLA A;  3BPX A;  1D8J A;  1NTC A;  5HS8 A;  2Z1D A;  2ISY A;  1CF7 B;  2HGC A;  4JX4 A;  4XRM A;  2IGO A;  3DEU A;  3G6E I;  2E1N A;  1X3W B;  2RQP A;  1P6R A;  2VJI A;  1XSX A;  4UXN A;  4G7Z F;  4Y52 J;  3B6A A;  1ORK A;  3CCY A;  2LR8 A;  3B73 A;  3FXM A;  5FGM A;  3BLY A;  2JT1 A;  4P55 A;  2EZI A;  3IH2 A;  2R7V A;  1JHH A;  3FKI J;  2OUM A;  4MIM A;  4XKB A;  5AIP A;  4RLF A;  2P7C B;  3NAR A;  1VQL I;  2B7E A;  4FQG A;  3EUH C;  4A3G J;  2A6T A;  2ISZ A;  2XAU A;  3FZV A;  3CLQ A;  3WE2 A;  3BJO A;  4QIW N;  2FUG 2;  2A5Y B;  4RGU A;  3CME I;  2FEZ A;  2MC3 A;  3I58 A;  4M3E A;  2X85 A;  3T5X A;  4IHS A;  1X1A A;  1VQK I;  4HEA 2;  1BOA A;  4JBA A;  3CMM A;  4A3K J;  3JSP A;  3ZQL A;  4TV7 A;  4RDU A;  2DDA A;  1K4T A;  3SYT A;  5IPA A;  4I6Z A;  2DA4 A;  3LSG A;  2Y75 A;  3ML6 A;  5GAG J;  3DTI A;  3PM1 A;  2K27 A;  4C30 A;  1IGN A;  4CGZ A;  2Y2Z A;  1U2W A;  2O0Y A;  2P7V B;  3FF5 A;  3QOP A;  1XB4 A;  3QQA A;  3M1E A;  2R7O A;  2L02 A;  1WFX A;  2KLO A;  2PBI A;  1IRZ A;  3H5R A;  2DK8 A;  3E97 A;  1SEU A;  3EQL F;  2AS5 F;  1QNT A;  3LSR A;  2V6E A;  2QKL B;  3IP4 B;  4NC6 A;  2VC0 A;  2VKE A;  3JTH A;  5HLH A;  2X0L A;  3ABM H;  4N9I A;  3QAH A;  4XIC A;  1ZRF A;  3J81 K;  2DYR H;  2HI3 A;  2LSO A;  2DMQ A;  1D1B A;  1EJ9 A;  2EA2 A;  2VXZ A;  3FXQ A;  4BY7 J;  4CH7 A;  3GTO J;  2EZK A;  2FRH A;  4S04 A;  3SHF A;  3OSF A;  1ZH5 A;  4IRH A;  3IHU A;  2M2E A;  3C3W A;  1TW3 A;  3S14 J;  2L4A A;  2HS5 A;  2O7O A;  2UXN A;  3FM3 A;  5L3E A;  3T8R A;  4OMY A;  3TW6 A;  5E1X A;  3WG9 A;  4I7H A;  2V7F A;  1E17 A;  5K1Y A;  4G12 A;  4M71 A;  1S29 A;  5EF6 A;  1S9H A;  2HYG D;  3T1B A;  4ZDP A;  4L9N A;  2BVM A;  2DA6 A;  3ELK A;  3P9K A;  1ZR2 A;  2ZSI B;  3L2U A;  1LB2 A;  1YIJ I;  3EPZ A;  4HV5 A;  3TOB A;  3V4G A;  1R36 A;  2FBI A;  3HM5 A;  4L5I A;  4Q48 A;  4CUG A;  3H0D A;  3BZK A;  4DBQ A;  4ZTF A;  2I5U A;  2K9M A;  3I56 I;  3GO5 A;  5J1U A;  2LKS A;  1E3H A;  4F93 B;  5GPC A;  5J3L A;  2JUC A;  2YUS A;  2PI0 A;  1QRY A;  4RGS A;  4A5M A;  3S16 J;  3J80 Z;  4YG2 F;  2BZT A;  1O7F A;  2IS2 A;  1BA5 A;  1DPU A;  3KE2 A;  2IT0 A;  3BT9 A;  4PSW A;  1QU3 A;  1L3L A;  4A3I J;  5BPD A;  3FXJ A;  3MD2 A;  1GVJ A;  4R79 A;  2KFD A;  3ZR8 X;  2K9N A;  5BPI A;  2X6Y A;  3H35 A;  5FJ8 J;  1G3T A;  3OR1 C;  2HYF A;  2EH3 A;  2D5V A;  3PO2 J;  4HBL A;  5H2F C;  4A3J J;  3OYD A;  2W24 A;  1USS A;  2EA4 A;  4H0E A;  2UV1 A;  3SEQ A;  1RPW A;  1GXQ A;  2ECB A;  1FMW A;  2B0L A;  4C3H J;  2BHZ A;  5ILV A;  3JRB A;  1F9N A;  1YYV A;  2XKP A;  4BAC A;  2ZJR F;  2W4S A;  3KPH A;  2LRE A;  4IRG A;  4G7O F;  3ZMU A;  4HNV A;  2DO7 A;  1GXP A;  3OS1 A;  1QGP A;  2F4M B;  2A68 F;  5CPR B;  1TQP A;  4ESF A;  4RB3 C;  3KEY A;  4XOR A;  1U0J A;  3FKJ A;  4M72 A;  3F8N A;  3TDZ C;  1P4W A;  3LA3 A;  4L9J A;  1X3Z B;  4B3A A;  1GDT A;  2DK5 A;  3H9J A;  3H1C A;  5EEA A;  4KIT B;  2HQR A;  3WHB A;  1U6G A;  2NVT J;  5D6E A;  2EFW A;  3I4M J;  2QBY B;  2LBF A;  4D5F A;  4B47 A;  1U9N A;  2CQX A;  2DFH A;  3BG6 A;  3COA C;  3OYH A;  4M9S A;  2KRF A;  2XRN A;  2QQ8 A;  2VBZ A;  2HVS A;  4NC8 A;  3FIS A;  4J01 A;  4EQQ A;  4BE2 A;  3VOD A;  1YG2 A;  4L9V A;  2M7A A;  4XMY A;  2ESN A;  4FX0 A;  3MEX A;  3BCB A;  1VQO I;  2XRO A;  5IP7 J;  2EFQ A;  1ZHF A;  5F64 A;  1TWA J;  3LOC A;  3ZMT A;  3OMY A;  1T2K A;  3VSL A;  1EH7 A;  4GCV A;  3E6D A;  4A3B J;  3MVP A;  3ABT A;  2FU4 A;  2GOX B;  4LLL A;  4NHJ A;  3UNG C;  5H20 A;  4U0Y A;  2OU2 A;  2ZFW A;  4RA2 A;  3ZPL A;  2ZXW H;  5J6X A;  4PGH A;  1ODD A;  1W0U A;  1A35 A;  3QRF F;  1K78 B;  2Y9Y A;  3AG4 H;  2X51 A;  2RKH A;  2EBI A;  1IN7 A;  3C2B A;  2F4I A;  4WXH A;  2F5V A;  3IKT A;  1Y1V J;  4CCN A;  1MBJ A;  3I55 I;  2HR3 A;  1VQ9 I;  5LGT A;  3IKV A;  3WTY C;  1Z77 A;  3ABK H;  3WHC A;  5A2Q K;  3V8K A;  5HDG A;  3UKG A;  1Y8Q B;  4BDZ A;  3LL7 A;  1Y56 A;  1T39 A;  5FLM J;  4AM3 A;  2QZ8 A;  2QQB A;  4M73 A;  2E5Z A;  1XGO A;  4U0V A;  2VQC A;  2HU9 A;  3WU2 C;  2ETH A;  3OYI A;  1S72 I;  1APL C;  4C2M J;  2A07 F;  2EPF A;  1TLH B;  2VXD A;  5EZG A;  3DBR B;  1B8I B;  2CJJ A;  2LF7 A;  2Y0M A;  3FHZ A;  3I4N J;  2R7F A;  2R7Q A;  3K1P A;  2XGC A;  3KP3 A;  1TTY A;  1B59 A;  4HQM A;  4XLA A;  2EFO A;  4A2U A;  4YFN F;  3OYB A;  2YSR A;  2CUZ A;  5CJ9 A;  4NDL A;  1SFK A;  3W2V A;  4AVP A;  2AXL A;  3HUG B;  4FHT A;  5J1R A;  2XVC A;  3TBI A;  5CVI A;  3J7Z I;  2VON A;  5GPA A;  2M8E A;  3LFK A;  4KUM A;  4BXF A;  1R5H A;  4BQA A;  2G7H A;  3Q9S A;  4AVZ A;  5KK1 A;  4OAY A;  3WTW C;  4KN7 X;  4L9T A;  4IL6 C;  1FP2 A;  1XGM A;  3KIO A;  3E6M A;  2F2E A;  2VPL A;  2ZJP F;  3WE3 A;  1NHA A;  2VT2 A;  4B48 A;  3E6C C;  4I02 A;  2L5Q A;  3DFG A;  4UUV A;  1HOM A;  1IO2 A;  2W7N A;  4E7S A;  4KNY A;  3RDI A;  4CO8 A;  4E4H A;  5CQE A;  3OYM A;  1D5V A;  2CU7 A;  2VBX A;  1O3Q A;  2IGM A;  5D6F A;  3W6K B;  4RM3 A;  1K6O A;  1Y6I A;  2LP0 A;  3FXU A;  1Z21 A;  4JYK A;  2KJB A;  3KP5 A;  2E71 A;  1OMI A;  2DYS H;  1JKO C;  2XB0 X;  3IWF A;  5F08 A;  1YJN I;  1QBJ A;  1VF9 A;  5KAF C;  5FLX K;  3Q5F A;  2EV6 A;  2X48 A;  2CQK A;  1MZB A;  1N75 A;  4CCK A;  3G4S I;  3IAS 2;  2IS6 A;  4A93 J;  3J7A O;  4J19 A;  1HDD C;  1XGN A;  3PUF A;  1DGW Y;  1FIP A;  4YRV A;  1REP C;  4CZZ A;  4IQ4 A;  5LHI A;  2DPU A;  1QVU A;  3BTJ A;  4LJZ F;  3A03 A;  1HW2 A;  3CCJ I;  2L7F P;  3FK7 A;  3OWT A;  2WAF A;  2H1L A;  2E19 A;  2ZBK A;  4ZYD A;  3QPT A;  3F8C A;  1FBU A;  3TO9 A;  1I1S A;  1C0W A;  2NS7 A;  1T0F C;  1B9M A;  2KJC A;  2ZXH A;  2LC2 A;  1HA8 A;  3HOT A;  5E3O A;  3K6G A;  2P6T A;  3CDL A;  4MTD A;  3NRV A;  3RKX A;  3GFJ A;  2JRM A;  4JOM A;  2IGN A;  2QF7 A;  2KRC A;  4G7H F;  1DUX C;  4A6E A;  2OPT A;  1H8A C;  1H9G A;  4OU0 A;  3PO3 J;  3BG7 A;  4BE1 A;  3JRI A;  1FOX A;  4QTR A;  2ZME B;  4OAZ A;  5CYV A;  2NVU B;  1P92 A;  5HS7 A;  1VQN I;  2MFZ A;  3CJT B;  3FDY A;  3PNV A;  1RR8 C;  2QQ9 A;  1KQ8 A;  3SZP A;  1XSD A;  3NEU A;  3ABL H;  2HXI A;  5F0H A;  3BJ6 A;  4MEY F;  3KYD B;  3MFK A;  1XMA A;  1O7L A;  1I5Z A;  2STW A;  4BGD A;  1I1G A;  2RC4 A;  1U5T A;  2DT6 A;  4MGR A;  1HBX G;  5LEJ A;  2E2H J;  2AHQ A;  2LVS A;  3HOX J;  1D0Z A;  2RQQ A;  3MN2 A;  2L2O A;  2ME6 A;  3NWS A;  5HOD A;  3CC4 I;  5TRD A;  1MSF C;  4IJA A;  4RLQ A;  2VC1 A;  1V55 H;  1WJF A;  4A12 A;  4L18 B;  5BS6 A;  2STT A;  4ZZL A;  2IAI A;  3ECH A;  1PUF B;  3S93 A;  3OR2 C;  4HLY A;  2CQ7 A;  4QSH A;  2KIU A;  1J2X A;  3K9T A;  3P7N A;  1I3Q J;  1X4P A;  4ITV A;  4II2 A;  2VB6 A;  4MHG A;  4H4K C;  4OIR F;  2KIF A;  2OZU A;  3V8J A;  5EG0 A;  2QEN A;  3HKZ N;  4KMF A;  2FF4 A;  1LDD A;  5K5O A;  2XB5 A;  3CDH A;  4HNT A;  2CUJ A;  2OA4 A;  4HSR A;  3EYI A;  4XLH A;  4IHV A;  3P5J A;  2R92 J;  1KGS A;  3OSG A;  4IVN A;  5M5X J;  4NC7 A;  3M1C A;  3LSI A;  4UB8 C;  5C44 J;  2Y9Z A;  1NH3 A;  1S6L A;  2K3P A;  4AIJ A;  3W2A A;  4W1U A;  1W5S A;  2E1C A;  2VI6 A;  3IH3 A;  1J75 A;  1KYZ A;  4RMN A;  2CQQ A;  1Q1V A;  1NK2 P;  2EIJ H;  2GBY A;  4FAS D;  3BTL A;  1LKX A;  5LBQ A;  1H89 C;  3TP0 A;  5FKN A;  1B1B A;  1WI9 A;  2Q2E B;  4BEH B;  3ABU A;  2XPU A;  3GFM A;  3FMR A;  4BH9 A;  2E34 A;  2M1B A;  3M8J A;  2VQG A;  2KDZ A;  4IEJ A;  4BHB A;  1N77 A;  5HNF A;  2JA7 J;  4AD9 A;  1R1T A;  3QYE A;  3R4K A;  5L3G A;  5K5R A;  1BJA A;  2L9R A;  1R1U A;  1O3R A;  4ETS A;  2DI3 A;  1LE8 B;  1E0E A;  3PSI A;  2DOF A;  5K7Z A;  3KX2 A;  1SFE A;  1X1B A;  2DMP A;  1YX3 A;  5CLS A;  3CUQ B;  1BC7 C;  1SFO J;  4PJN A;  1L0O C;  2XGD A;  2EZH A;  5DV5 A;  3SQN A;  1AHD P;  2DFI A;  1EH8 A;  2HYJ A;  2M45 A;  3A01 A;  1FBQ A;  5LRS A;  5C3E J;  2XDV A;  4RAZ A;  1IUF A;  1MMN A;  1P4X A;  2A61 A;  4RB2 C;  5L3F A;  4XL9 A;  1IN6 A;  4IQJ A;  3OL4 A;  3MKY B;  4GFB A;  1S5L C;  2JVG A;  2KIQ A;  1WPK A;  3H5A A;  3I5U A;  2BXY A;  4ZJZ A;  2F4O B;  2VE8 A;  3WTZ A;  5GTI C;  2R93 J;  4Q47 A;  3OYG A;  1QA6 A;  2KPM A;  3DF8 A;  5ILS A;  2YU3 A;  4AUX A;  1HST A;  4B1R A;  1R7J A;  5DM6 F;  4I0A A;  5EGO B;  3KCC A;  4BY1 J;  4K2E A;  1OYI A;  2BE5 F;  1G3S A;  1MD0 A;  3ONQ A;  4M6X A;  1VQ5 I;  1IRF A;  1RZ4 A;  3DU5 A;  4E7L A;  1OR7 C;  2HOA A;  2CW7 A;  3ZGK A;  2BY3 A;  1Z9C A;  3LQQ A;  5J4V A;  1N78 A;  2CG4 A;  2XF6 A;  1HW5 A;  5E79 C;  2CV0 A;  3S3N A;  1G4D A;  3B6C A;  3TO7 A;  1F5T A;  2GZW A;  3DKX A;  2FMY A;  2PMU A;  4II3 A;  1RI7 A;  3RKY A;  1Y1W J;  1XX5 A;  2F5C A;  2NVX J;  3L2V A;  2V9V A;  1FSH A;  1R1V A;  2GWR A;  3UR3 C;  3GYH X;  1AOY A;  2NXN B;  4LOC A;  1T56 A;  5B1A H;  3HRS A;  2R7X A;  1TL8 A;  1PDN C;  5LLQ A;  2L9N A;  2M0C A;  3I59 A;  2XPV A;  4ZYE A;  1A31 A;  4HF2 A;  1DQU A;  4WXD A;  1XMX A;  4ZYG A;  3OOP A;  2X4H A;  3ZXS A;  4IHT A;  1P2F A;  3OYJ A;  2QGU A;  5J8C A;  2WTE A;  3DBL B;  1X2N A;  1O3T A;  4BE0 A;  1LDJ A;  1IDY A;  2OC6 A;  4V2G A;  3MWM A;  1KQ9 A;  1RIO H;  1TNT A;  5E8G A;  1I6X A;  5JLX A;  1LNW A;  2TCT A;  4QPO A;  4E7K A;  1P7I A;  5L3D A;  1XDS A;  1T98 A;  2K86 A;  4EV0 A;  3RZO J;  3A1Y A;  3D0S A;  3ZN1 A;  1RUN A;  4ZDO A;  2ZKZ A;  5IYB J;  1HXD A;  1MMD A;  1S7E A;  2CFO A;  3I64 A;  1SD6 A;  1FOK A;  2IBD A;  3KP6 A;  2JUG A;  4OOI A;  2IS1 A;  4FX4 A;  1ZRC A;  2PQ8 A;  1FTZ A;  4YFX F;  1UJ8 A;  2KP6 A;  3SZT A;  1ZLJ A;  2ACJ A;  1WQ2 A;  4EM1 A;  3D5L A;  1ZG1 A;  3OV8 A;  3K70 D;  5HDK A;  2XSD C;  3JR9 A;  4EVI A;  3H9G A;  3QYB A;  1Z3Y A;  1WSU A;  2F5D A;  3ROU A;  3V42 A;  1SFU A;  4PUS A;  1BW6 A;  4PJ0 C;  5D8L B;  3ZRG A;  2Z33 A;  1VFC A;  1OCC H;  4N4O B;  2QEX I;  4A3C J;  1HKQ A;  4EJU A;  2KZG A;  3GWZ A;  3GZ6 A;  1IDZ A;  3JRF A;  4I09 A;  1H88 C;  5TJJ A;  3E3V A;  1OCT C;  4YIR X;  3E5Q A;  4DZP A;  1R9T J;  3LSH A;  4XN3 A;  4WWC A;  3HZJ A;  3HYI A;  3VYS B;  4O3M A;  2KT0 A;  2LLK A;  1LQ1 A;  5ICF A;  1WHU A;  4MQV A;  1TNS A;  4KIB A;  5ERI A;  3TGN A;  1LFP A;  4HG2 A;  2V1D A;  3VYT B;  1OCZ H;  3LSM A;  5IOZ A;  3K4N A;  3O2P E;  4LGW A;  3V8L A;  3EUA A;  3JAM Z;  2OV7 A;  3ZP5 A;  3GME A;  3IAM 2;  1XDU A;  3GVA A;  2HKX A;  2M8G X;  5H6Q A;  3IUO A;  3Q0U A;  4HX8 A;  3DTK A;  2DTR A;  2NNY A;  1ZG3 A;  2HTS A;  3H36 A;  4XNF A;  5D5X B;  1IRX A;  1FYK A;  2JA5 J;  2HVR A;  4CYD A;  4P9F A;  4WX9 A;  4RAF A;  2PFB A;  4XLC A;  2XAS A;  3IRQ A;  2ZXJ A;  2GIV A;  4PSX A;  1AU7 A;  4E6K G;  2CQN A;  2L4M A;  2L7M P;  3GUD A;  3AAF A;  4BAY A;  2ZME C;  1FSE A;  3KP7 A;  3CJR B;  5HDN A;  4M3B A;  1BN5 A;  5LRR A;  3HSF A;  2VOO A;  2KRH A;  3PNT A;  2M4K A;  3VYR B;  1STZ A;  2CH0 A;  3ZOB A;  1UMQ A;  5F04 A;  4ON0 A;  2JWT A;  1UHW A;  5H6R A;  3I0T A;  2NYX A;  4RGR A;  2MLK A;  2V1X A;  3FMQ A;  2WAE A;  4OWR B;  4UUT A;  1LFU P;  5DYM A;  3MMY B;  4A3D J;  1Z1D A;  1O57 A;  1UHM A;  5E1W A;  2EZL A;  2VL8 A;  3HTS B;  3AFH A;  1ZN2 A;  1QPI A;  3PJR A;  2I10 A;  3HHG A;  4NQW B;  4M6Y A;  3BC8 A;  1OFC X;  3HRU A;  1EV7 A;  4IOC F;  1R4M B;  4OMZ A;  2NVY J;  3TO6 A;  1J09 A;  5GAE J;  3EDP A;  3S8P A;  5ED4 A;  2LKP A;  4Q4Z F;  3T8T A;  1Y39 A;  3SDB A;  1R6R A;  5JHF A;  3OIO A;  1I3A A;  5HS9 A;  1ETW A;  4ZZD A;  3KFW X;  4KFC A;  2VQH A;  1AKH A;  4PJJ A;  3WTU C;  1YW7 A;  2MD0 A;  2X6W A;  3S2H J;  1Y0U A;  3HHH A;  3KEO A;  4MNU A;  3W3C A;  1K61 A;  2Z16 A;  2DXI A;  3FXK A;  4EJW A;  5FKM A;  2XAJ A;  4BS9 A;  4JP0 A;  2V9P A;  4LIT A;  5HVQ C;  2XAQ A;  2HNH A;  3DLA A;  4ENM A;  3P9I A;  1FT9 A;  1MBE A;  4XBF A;  2M4G A;  1U8R A;  3ZMS A;  1T38 A;  4N4N B;  1KQ0 A;  2JSC A;  3VEP A;  4MQ9 F;  1FNN A;  1A5J A;  5DCM A;  3ZQC A;  3G2B A;  1DP3 A;  2Z5U A;  5KHD A;  1U78 A;  2QM3 A;  4E7I A;  2VJJ A;  3FXL A;  1TWG J;  1G59 A;  3H3Z A;  3G73 A;  3HKZ A;  1WWX A;  1F1Z A;  2ELH A;  2OF7 A;  3BR2 A;  4HST A;  3SEZ A;  2M87 A;  4BHP A;  4JX5 A;  1FY7 A;  3WU1 B;  3PQK A;  5F6F A;  3WU0 A;  2GXB A;  1HC8 A;  2Y48 A;  2LK2 A;  5LFA A;  2ZC2 A;  1OCP A;  2JN6 A;  1JKQ C;  4M9Z A;  2BV6 A;  1Y0N A;  1MNE A;  1QHH D;  2GA2 A;  1MW7 A;  1IN8 A;  1ULY A;  2IEK A;  4IKF A;  2EIN H;  2EFN A;  1T95 A;  2WY8 Q;  4C3J J;  5M3F J;  3I54 A;  1RES A;  1OCO H;  4UNO A;  4MO7 A;  2COM A;  1V4R A;  2XC7 A;  2MD5 A;  5FD6 A;  2EIK H;  2MG4 A;  1SVO A;  4O6J A;  2HDD A;  1J0R A;  5B5E C;  1UFM A;  3DPT A;  2JJ7 A;  4CA0 A;  5IY5 H;  3CUQ C;  1BW5 A;  2ELK A;  3R0A A;  3ZMV A;  2LNB A;  1TZL A;  3DKY A;  3HOV J;  4CSW A;  3LA7 A;  3LA2 A;  2W00 A;  1KZH A;  3ISP A;  5DD4 A;  2QLZ A;  4N0B A;  3K4K A;  4KIG A;  1ZKG A;  3OYC A;  3K2A A;  1BJZ A;  1U9O A;  3BP8 A;  1P7J A;  1B6A A;  3HPG A;  4PCQ A;  4J00 A;  1D3Y A;  1J59 A;  4XRS A;  2MSY A;  1IF1 A;  1ON2 A;  1OQY A;  2V1U A;  3K1M A;  1X2M A;  2DA3 A;  3CMY A;  2NOG A;  2XPW A;  1H0M A;  2DFF A;  4GYG A;  1SD4 A;  2WV0 A;  5FO5 A;  1SFX A;  3FHN A;  1T8I A;  1EA3 A;  1XGS A;  4BUP A;  2Z99 A;  1MMA A;  3U9G A;  1MJB A;  3RYR A;  1AKH B;  1HLV A;  3Q0W A;  3EUH A;  3TKY A;  3CMA I;  4PGG A;  2GIZ A;  2TDX A;  4RS8 A;  1TQM A;  5GP9 A;  5D4S A;  3CCM I;  2GOM A;  4HF0 A;  4ENK A;  2CUE A;  1SVL A;  3JW4 A;  1JJ8 C;  1F36 A;  4YFK F;  4HV6 A;  1WRJ A;  3A02 A;  2BW3 A;  1RKW A;  2Q0O A;  4YIF A;  1MDM A;  1JKR C;  1RUO A;  4Q5S F;  4DZJ A;  3I4P A;  3FM5 A;  2YS9 A;  4D9J A;  1VQ4 I;  1Z3X A;  2VUM J;  2UZK A;  3IH4 A;  5LD2 C;  5K7H A;  1ZLK A;  3RPU A;  5M3M J;  1V5E A;  4D1Q A;  1B72 A;  2UWM A;  4X6A J;  3MAJ A;  1Z67 A;  1LPQ A;  5LHG A;  1ETX A;  3F22 A;  2F6C A;  2W48 A;  3U2R A;  3W2W A;  4F91 B;  4LK1 F;  5DUK A;  2HFH A;  5HNH A;  2R5Y A;  5L3B A;  3L9F A;  1VTN C;  2DMT A;  2EK5 A;  4CCJ A;  3E6B A;  3GW2 A;  2YX7 A;  2IA1 A;  5ILU A;  3LST A;  3K70 C;  1FYL A;  1OKR A;  3PSF A;  2R7W A;  3F9K A;  1QVT A;  3LSJ A;  1K4S A;  5FKO A;  5CVJ A;  5BQT A;  1ACI A;  2R7T A;  3F23 A;  1Z91 A;  3ESW B;  3HGG A;  4MFE A;  1SAX A;  4RM2 A;  2D1H A;  3PNY A;  3FBI B;  2VIX A;  4LLN A;  1DU0 A;  4A0Z A;  3E7L A;  2AXT C;  3TW7 A;  1VI0 A;  4F52 A;  3NWT A;  4C3I J;  4EGY A;  3LNQ A;  1OIS A;  2IJL A;  4X0G A;  3GTL J;  1U8B A;  5E20 A;  2J5O A;  4C2T A;  1ZK8 A;  4OIQ F;  3OYF A;  1YE9 A;  3HOU J;  3BG5 A;  4UUS A;  2VKH A;  1HSJ A;  3GTM J;  1XD7 A;  3F8M A;  3TL4 X;  4IHX A;  2FNA A;  1R23 A;  2BXZ A;  1YOV B;  5J8F A;  4A6D A;  4DQ2 A;  2H8R A;  2LBF B;  1Z7U A;  4RAY A;  2MGQ A;  4XK4 A;  5IYC J;  4E7H A;  1MH4 A;  2JZY A;  3HTU A;  1X19 A;  2IPQ X;  2V1N A;  4XR6 A;  1VZ0 A;  3DV8 A;  3NAU A;  2Y31 A;  1M1E B;  3RQI A;  1JT0 A;  2P5L C;  5FKK A;  2BBY A;  2DLL A;  4I76 A;  4CYC A;  3H92 A;  3BOQ A;  2UUZ A;  4Y17 A;  3FX3 A;  2XF5 A;  1G3W A;  4LB6 B;  3OS0 A;  1LEA A;  3QU3 A;  3CO7 C;  2HQA A;  3GXO A;  1JXS A;  3FK6 A;  4GXO A;  2M5W A;  3OYE A;  3QYF A;  5JLW A;  1UCR A;  4KA4 A;  1UB9 A;  1EH6 A;  4AC0 A;  2CW0 F;  1FLI A;  4Z2Y A;  3TMO A;  3TQN A;  2DA5 A;  3CP2 A;  4UHT A;  2VBW A;  2RGV A;  4L5E A;  1BBY A;  2KZV A;  2XSJ C;  4XOT A;  2HQ5 A;  4UVC A;  4XKW A;  3V7C A;  1S7O A;  4Y15 A;  1LEB A;  1Z7L A;  2MYS A;  2LRD A;  2HEO A;  2LDU A;  2FSW A;  5EEH A;  4GRI A;  5DD8 A;  3OIQ A;  2OTL I;  1V54 H;  3HC7 A;  1E3P A;  2K85 A;  1D0Y A;  3CJQ B;  3CCV I;  4DYQ A;  3LSK A;  3RKW A;  2YU9 J;  1GUU A;  4L0Y B;  3CJN A;  1IUY A;  3H0G J;  2QKM B;  2HDW A;  3BQZ A;  4DYC A;  4L0Z B;  2RV8 A;  1VQM I;  4UV9 A;  3GZN B;  4EAT A;  5M5W J;  2NOJ B;  4AU7 A;  4Z6Y A;  3E1S A;  4E7Z A;  3LQR A;  1V5F A;  2FNP A;  2JRT A;  2W25 A;  5K5Q A;  2K02 A;  3AG2 H;  1YW9 A;  3DQV C;  3J7Y J;  1JJ6 C;  3HSR A;  2COB A;  3ZQ7 A;  3S15 J;  3OIP A;  4PJM A;  1ZQ3 P;  2WBM A;  1QPM A;  2FBK A;  3BR1 A;  5DS9 A;  5CVU A;  3CZ6 A;  4ZYH A;  1MSE C;  2PG4 A;  4A3M J;  1U3E M;  2HTJ A;  1R4N B;  1YIO A;  2E7W A;  2H6B A;  1FMV A;  1JHF A;  1K83 J;  3OS2 A;  4KIF A;  3LSP A;  3GX4 X;  1D1A A;  5L3C A;  2M9H A;  3HB9 A;  1EF4 A;  1B4A A;  2E1O A;  3CF2 A;  1TWF J;  3BCA A;  1FEX A;  1W5T A;  2PJP A;  1ETQ A;  2KHM A;  4B3X A;  5EEG A;  1QZY A;  5JVT A;  4FE7 A;  1YJ9 I;  2HPI A;  5FLV A;  4IOA F;  3CTA A;  4GO1 A;  1W4M A;  2DMU A;  5HOO A;  2O5R A;  2E2I J;  2H94 A;  3CP8 A;  2PMZ N;  1R71 A;  3F6O A;  1V3F A;  2DBB A;  2ZSH B;  3WGG A;  1R22 A;  3Q9V A;  3QOE A;  3OOU A;  1YFH A;  1G2H A;  1J5Y A;  3HOW J;  1LFB A;  2LOO A;  1GV2 A;  1ZYR F;  4IO9 F;  1I39 A;  4GGG A;  4HLX A;  3VOE A;  3H3U A;  4HPQ A;  2EJR A;  4QLC U;  5FB2 A;  5J4Y A;  4LG0 A;  3OYK A;  3VYU B;  2ADU A;  1BIA A;  4FET A;  3WTS C;  4CDG A;  1ZG5 A;  1KON A;  2DMN A;  1OPC A;  3ZQF A;  1SMY F;  3L2R A;  3JAM K;  1ZGA A;  3GBG A;  2DPD A;  3U21 A;  4B09 A;  1LVA A;  2X9D A;  4LMY A;  1K79 A;  2QSG X;  3SFI A;  2J5P A;  2R7D A;  5IT9 Z;  3ASO H;  1ONV A;  1IC8 A;  3CCE I;  1VQ6 I;  2EFP A;  3CQZ J;  3R6S A;  1XCB A;  1IG7 A;  5E3M A;  5JR3 A;  4BYY A;  3HRT A;  3L00 A;  1T33 A;  5IT3 A;  2P0W A;  3ERE D;  2CV1 A;  4FIS A;  4W97 A;  4DBR A;  4P1W A;  1HDP A;  4HQE A;  1YI2 I;  4WXC A;  3BPV A;  1R58 A;  3CLO A;  4HX4 A;  4BJ6 C;  2ZCW A;  2P6S A;  1U5T B;  5KNL A;  3GTQ J;  2FA5 A;  3FWE A;  2DA2 A;  3S3O A;  1NK3 P;  1RET A;  1DPR A;  1OYW A;  1A6I A;  1TBX A;  4PFO A;  3VDX A;  4E70 A;  1KYW A;  2RDP A;  4IHY A;  2D1V A;  5D5W B;  4LD5 A;  3HOS A;  4U7D A;  4IRI A;  3S2D J;  2CSO A;  1DU6 A;  1A6Q A;  1BI0 A;  3HDD A;  2WB1 N;  2FX0 A;  4D7M A;  3BTI A;  1CF7 A;  2FML A;  1HKT A;  2H6C A;  4EJT A;  4HRI A;  3HOZ J;  2BGC A;  1SMT A;  4KYW A;  1IZ1 A;  2P4W A;  2YR2 A;  3DU6 A;  4M74 A;  2LKX A;  5F0C A;  2FE3 A;  1E3O C;  2MW8 A;  2JQ7 A;  1T0F A;  1EKE A;  5EG0 B;  1QHG A;  1R49 A;  2KDO A;  2W85 A;  1XS9 A;  5FKL A;  1BC8 C;  2R5Z A;  3F6V A;  2R7Z J;  5D4R A;  3C18 A;  2PN6 A;  3C2G A;  3GCM A;  1X1P A;  3L09 A;  1YIT I;  4HF1 A;  3Q3S A;  2L0K A;  4KJZ A;  4NBQ A;  4KDP A;  4XLE A;  3KLN A;  3L2C A;  1WVR A;  3DPL C;  4G94 A;  2HPM A;  3CC2 I;  4IX7 A;  4BBS J;  5E17 F;  5EZH A;  3ZQQ A;  1MMS A;  2ZJ2 A;  4YII A;  2JTV A;  3J80 K;  5E3N A;  1YJW I;  1HCR A;  4CCL A;  4RGX A;  1BM9 A;  2OD5 A;  5LEK A;  4KT6 A;  2M34 A;  3WGI A;  2R7U A;  3LFU A;  4LIU A;  5AON A;  4LK0 F;  4CXF A;  2TRT A;  1TWC J;  2YX4 A;  4PK4 A;  3FXR A;  2L01 A;  4YEL A;  3M7G A;  3S32 A;  1MJ9 A;  2KQR A;  5FRM A;  2PLY A;  3VWB A;  3JRA A;  5DEQ A;  3MCZ A;  4LG0 B;  3CCR I;  5M5Y J;  3E0J B;  3BTC A;  4WF2 A;  2K7L A;  3OYA A;  2A3S A;  4L5J A;  1OLT A;  5HLT A;  3S1R J;  3SZG A;  2QUF A;  4F3Q A;  4EGZ A;  3HXL A;  1D1C A;  2R7R A;  3A01 B;  3HPH A;  2V26 A;  2IA2 A;  1MBF A;  3RIR A;  1UZC A;  3U1K A;  2Z9O A;  3PUB A;  4C2U A;  3JCU C;  3TP3 A;  1S8N A;  2A05 A;  2A6H F;  3L7W A;  4M3F A;  2DQL A;  2NRA C;  3H3V K;  1UHS A;  4BQQ A;  2DDB A;  3DKW A;  1DDN A;  2M7B A;  2KMU A;  3O8H A;  4FE4 A;  1XPX A;  1Z6R A;  2NAZ A;  1Z6T A;  1SVM A;  3BG9 A;  3RPQ A;  2BY2 A;  4ENN A;  1SD5 A;  4MFD A;  1POG A;  1Z0X A;  5JVG F;  3CES A;  2IS4 A;  5F1J A;  1D0X A;  5JHU A;  4S05 A;  3HIF A;  1CGP A;  3G3Z A;  3QP6 A;  3TOA A;  2ELJ A;  1TC3 C;  3LAP A;  1YO5 C;  2JPC A;  2MBF A;  3QPS A;  2MLG A;  2FJ1 A;  2K9S A;  3I53 A;  4B8X A;  1TT5 B;  1F4K A;  4GDF A;  2DT7 B;  2GXG A;  4HNU A;  4MTE A;  2OBP A;  3S3M A; 
#chains in the Genus database with same CATH homology
 2P5V A;  2EV5 A;  2IA0 A;  3B02 A;  1XCV A;  1YS6 A;  1B9N A;  3GLX A;  2CYY A;  5BMZ A;  4JQF A;  3I59 B;  4QWQ A;  5FFZ A;  1IRG A;  4P9U A;  3NQO A;  3SFZ A;  5HLG A;  3E5U A;  3IRR A;  5FFX A;  2CO5 A;  1ZAO A;  1Q1H A;  2DW4 A;  3MZH A;  1K7A A;  3K2Z A;  5D8K B;  2P5K A;  2R3S A;  3GFI A;  1MKM A;  2ZNZ A;  2OQR A;  5F1R A;  3KEQ A;  3EET A;  1JGS A;  1GHC A;  2QBY A;  2HDC A;  1S3J A;  2HWV A;  4A0X A;  1JE8 A;  3F8B A;  2O8X A;  2XHK A;  5E1Z B;  3V7R A;  1HW1 A;  4EM0 B;  1OR7 A;  2GA1 A;  5DDG A;  3RYP A;  4Y13 A;  4ESJ A;  3M8E A;  4AWX B;  2UXX A;  3WTT C;  4UVA A;  2VN2 A;  3RI4 A;  2QYO A;  3WOD F;  1K78 A;  1FX7 A;  2K4J A;  3KZZ A;  3HRM A;  3VFZ A;  5BOX A;  1I27 A;  3PFI A;  5AIQ A;  1HKS A;  5ICE A;  3M9A A;  4LFU A;  2QVO A;  4R1H A;  2O03 A;  1KU7 A;  3O6B B;  2JPB A;  4OIP F;  1QO0 D;  2WC2 A;  1KU9 A;  4I2O A;  1UST A;  1ZRE A;  2NNN A;  3HUG A;  3N4M A;  4G6D A;  1ZRD A;  2GQQ A;  3MQ0 A;  1IXC A;  1IN5 A;  3E5X A;  4I98 B;  4WK8 F;  3S2W A;  5D5U B;  4IF4 A;  2VOP A;  4OIO F;  4LB5 A;  4ENJ A;  5LGN A;  1BI3 A;  1KA8 A;  4HYE A;  2KIM A;  2QQA A;  2A69 F;  3EYY A;  1T6S A;  1IXR C;  1U5T C;  3RTR A;  2DQR A;  2L3D A;  4M9X A;  4RB1 A;  1FWZ A;  2DU9 A;  5LGU A;  3WGH A;  2QWW A;  3ZMZ A;  2G9W A;  4XLN F;  3C7J A;  3GF2 A;  4P5O A;  2VE9 A;  3GFL A;  2W57 A;  2LF8 A;  4I01 A;  1WKM A;  3IL2 A;  2BEO A;  1R00 A;  3F72 A;  1ON1 A;  1TW2 A;  2F5F A;  4EMS A;  2OAZ A;  3T0Y A;  3BDD A;  4BHC A;  1YLF A;  4XSX F;  3LAJ A;  4G9Y A;  4PZJ A;  4PDK A;  4HDU A;  1IAW A;  5DCM B;  3TDU C;  2FOK A;  1J9I A;  2VBY A;  1QZZ A;  4HA8 A;  2FBH A;  2RN7 A;  4HZF A;  2ZME A;  3J81 Z;  4KIC A;  1OYY A;  5DUI A;  5ICG A;  2VT3 A;  3BJA A;  4A0Y A;  3JTG A;  3ECO A;  2RVC A;  5CVV A;  5E18 F;  2EWN A;  4G6Q A;  4U88 A;  2HOE A;  5ICC A;  3KP2 A;  1MJA A;  3LWF A;  3M8F A;  3F8F A;  4WCG A;  3R60 A;  4IPA A;  5IT9 K;  2C6Y A;  4A5N A;  4D0P A;  2RNJ A;  2E7X A;  3R61 A;  2HZT A;  2XAG A;  1IN4 A;  1BIB A;  1YTY A;  2G7U A;  3ZN0 A;  3JSO A;  3ZMD A;  3C1D A;  2FXA A;  1O3S A;  3GEZ A;  1G3Y A;  3GZ5 A;  2XKO A;  2CGP A;  2K4B A;  2VOD A;  2XAF A;  1X3U A;  4GYI A;  3N97 A;  3SXY A;  5FD5 A;  2Q2E A;  1HQC A;  3BWG A;  3WTV C;  1XMK A;  4EM2 A;  1MDM B;  5JI6 A;  2BYV E;  5E8I A;  3V7S A;  4OIN F;  4AIK A;  1FYM A;  1YQA A;  3CUQ A;  3I71 A;  1E2X A;  1SD7 A;  4UV8 A;  4IXA A;  2IW5 A;  3QPH A;  4HDV A;  2O3F A;  1RNL A;  2XAH A;  2CFX A;  1IW7 F;  3IWZ A;  2EB7 A;  4MEX F;  4ASN A;  2Z3Y A;  1PUE E;  3O3K A;  1ZAR A;  1ZGJ A;  1G6N A;  1PP8 F;  1H9T A;  2IVM A;  1YW8 A;  2D45 A;  5LHH A;  4CIC A;  3QP5 A;  5A2Q Z;  2XUB A;  4DNC A;  2O6G E;  2L54 A;  2DAO A;  2MH2 A;  2MH9 A;  2PMH A;  4UVB A;  2MA3 A;  2V79 A;  3IC7 A;  3WTX C;  2NS0 A;  4XLP F;  3R0J A;  1DP7 P;  2O61 A;  1FPQ A;  1R5G A;  4R8H A;  2Q8K A;  2HQN A;  4CHU A;  3KP4 A;  1FZP B;  6PAX A;  1MGT A;  4KT5 C;  3CUO A;  2ESH A;  4NB5 A;  2GAU A;  3BZ6 A;  4G8X A;  3K1N A;  1KU3 A;  2XV4 S;  2ZNY A;  1S7A A;  1W7P A;  3DXJ F;  2EV0 A;  3REO A;  3FMS A;  1FC3 A;  1XN7 A;  4AIH A;  3QU6 A;  4BNC A;  4EJV A;  2P8T A;  2W84 A;  4RB0 A;  5HLI A;  5FLX Z;  5JFR A;  1TQI A;  2A6E F;  1YS7 A;  2PEX A;  1IXS B;  4JK1 X;  1A04 A;  4XSZ F;  3F3X A;  4HW0 A;  3BY6 A;  2F5E A;  3W6J B;  2V6C A;  1QQI A;  2DT5 A;  1BI1 A;  2OZ6 A;  3ULQ B;  2YPR A;  4KMU X;  1FP1 D;  4ZH4 F;  2XGX A;  4EJO A;  5DCF A;  2HKO A;  3VB2 A;  3PQJ A;  3KZY A;  4F7Z A;  2ZO4 A;  4XRF A;  1J7K A;  4LLG F;  2KKO A;  1BI2 A;  2FQ3 A;  3HSE A;  4HX7 A;  5D5V B;  3BRO A;  1P4A A;  1PP7 U;  3KLO A;  4I0B A;  3K69 A;  2H27 A;  2D2W A;  3DP7 A;  2M30 A;  4U7B A;  3F21 A;  1W7P B;  2OQG A;  2CWE A;  1KU2 A;  3KET A;  1D8K A;  4BXU A;  4NQW A;  4ESB A;  1LJ9 A;  4N9H A;  3RJP A;  3K0L A;  1AWC A;  3MZY A;  5KVR A;  4U0W A;  4FT8 A;  2IRF G;  4P96 A;  4KN4 X;  3CO6 C;  2H09 A;  2WWY A;  2XIG A;  4HOB A;  1W7P D;  1XSV A;  1FBS A;  1LDK B;  2IP2 A;  3P9C A;  4O5V A;  1Z05 A;  5CVR A;  3U1D A;  4HAM A;  3BPX A;  1D8J A;  5HS8 A;  2ISY A;  1CF7 B;  2HGC A;  3DEU A;  2E1N A;  2RQP A;  1P6R A;  1XSX A;  4UXN A;  4G7Z F;  3B73 A;  5FGM A;  2JT1 A;  4P55 A;  1JHH A;  5AIP A;  2P7C B;  2ISZ A;  3FZV A;  3WE2 A;  3BJO A;  2A5Y B;  4RGU A;  2FEZ A;  2MC3 A;  3I58 A;  3T5X A;  4IHS A;  1BOA A;  4JBA A;  3JSP A;  4TV7 A;  3ML6 A;  2Y75 A;  2K27 A;  4CGZ A;  1U2W A;  2O0Y A;  2P7V B;  3FF5 A;  3QOP A;  1XB4 A;  3M1E A;  2L02 A;  2PBI A;  2DK8 A;  3E97 A;  2AS5 F;  3EQL F;  1QNT A;  2VC0 A;  3JTH A;  5HLH A;  2X0L A;  4N9I A;  3QAH A;  1ZRF A;  3J81 K;  2LSO A;  2EA2 A;  2VXZ A;  3FXQ A;  2FRH A;  4S04 A;  3SHF A;  1ZH5 A;  4IRH A;  3IHU A;  3C3W A;  1TW3 A;  2L4A A;  2HS5 A;  2UXN A;  3FM3 A;  5L3E A;  3T8R A;  4OMY A;  5E1X A;  3WG9 A;  4I7H A;  1E17 A;  5K1Y A;  4M71 A;  1S29 A;  2HYG D;  3T1B A;  4L9N A;  3P9K A;  3ELK A;  1LB2 A;  4HV5 A;  3TOB A;  3V4G A;  1R36 A;  2FBI A;  4L5I A;  4Q48 A;  3GO5 A;  2PI0 A;  4RGS A;  4A5M A;  3J80 Z;  4YG2 F;  1O7F A;  1DPU A;  3KE2 A;  2IT0 A;  1L3L A;  5BPD A;  1GVJ A;  4R79 A;  5BPI A;  1G3T A;  2HYF A;  4HBL A;  2W24 A;  1USS A;  2EA4 A;  4H0E A;  1GXQ A;  2B0L A;  5ILV A;  1F9N A;  1YYV A;  2XKP A;  4IRG A;  4G7O F;  3ZMU A;  2DO7 A;  1GXP A;  1QGP A;  2A68 F;  1TQP A;  4ESF A;  4RB3 C;  4M72 A;  3F8N A;  3TDZ C;  1P4W A;  3LA3 A;  4L9J A;  2DK5 A;  2HQR A;  1U6G A;  5D6E A;  2EFW A;  2QBY B;  3COA C;  4M9S A;  2KRF A;  2XRN A;  2VBZ A;  4EQQ A;  3VOD A;  1YG2 A;  4L9V A;  2ESN A;  4FX0 A;  3MEX A;  2XRO A;  2EFQ A;  1ZHF A;  5F64 A;  3ZMT A;  1T2K A;  1EH7 A;  4GCV A;  3E6D A;  3ABT A;  2FU4 A;  4LLL A;  4NHJ A;  5H20 A;  4U0Y A;  2OU2 A;  2ZFW A;  3ZPL A;  5J6X A;  4PGH A;  1ODD A;  3QRF F;  1K78 B;  2RKH A;  1IN7 A;  4WXH A;  3IKT A;  2HR3 A;  5LGT A;  3IKV A;  3WTY C;  5A2Q K;  3V8K A;  5HDG A;  1T39 A;  2QZ8 A;  2QQB A;  4M73 A;  1XGO A;  4U0V A;  2ETH A;  2A07 F;  1TLH B;  2LF7 A;  2Y0M A;  3FHZ A;  2R7F A;  3K1P A;  3KP3 A;  4HQM A;  1TTY A;  1B59 A;  2EFO A;  4A2U A;  4YFN F;  2YSR A;  5CJ9 A;  4AVP A;  2VON A;  2AXL A;  4FHT A;  2XVC A;  5CVI A;  2M8E A;  3LFK A;  4KUM A;  4BQA A;  1R5H A;  2G7H A;  3Q9S A;  5KK1 A;  3WTW C;  4KN7 X;  4L9T A;  1FP2 A;  1XGM A;  3E6M A;  2F2E A;  3WE3 A;  1NHA A;  2VT2 A;  3E6C C;  4I02 A;  3DFG A;  4UUV A;  4KNY A;  3RDI A;  4CO8 A;  1D5V A;  2VBX A;  1O3Q A;  5D6F A;  3W6K B;  1K6O A;  3FXU A;  2KJB A;  3KP5 A;  1OMI A;  3IWF A;  1QBJ A;  5FLX K;  3Q5F A;  2EV6 A;  2CQK A;  1MZB A;  3J7A O;  1XGN A;  1REP C;  4CZZ A;  5LHI A;  2DPU A;  4LJZ F;  1HW2 A;  2ZBK A;  4ZYD A;  3QPT A;  3F8C A;  1FBU A;  3TO9 A;  1I1S A;  1C0W A;  1B9M A;  2KJC A;  3HOT A;  2P6T A;  4MTD A;  3NRV A;  3RKX A;  3GFJ A;  4G7H F;  1DUX C;  4A6E A;  1H9G A;  4OU0 A;  2ZME B;  5CYV A;  1P92 A;  5HS7 A;  1KQ8 A;  2QQ9 A;  3SZP A;  1XSD A;  3NEU A;  3BJ6 A;  4MEY F;  3MFK A;  1XMA A;  1O7L A;  1I5Z A;  2STW A;  1I1G A;  2RC4 A;  1U5T A;  4MGR A;  1HBX G;  5LEJ A;  5TRD A;  4IJA A;  4A12 A;  2VC1 A;  4L18 B;  5BS6 A;  2STT A;  4ZZL A;  3ECH A;  4HLY A;  2KIU A;  1J2X A;  3K9T A;  3P7N A;  4MHG A;  4OIR F;  2KIF A;  2OZU A;  3V8J A;  2QEN A;  4KMF A;  2FF4 A;  1LDD A;  5K5O A;  3CDH A;  2OA4 A;  3EYI A;  1KGS A;  4IVN A;  1S6L A;  4AIJ A;  1W5S A;  2E1C A;  1J75 A;  1KYZ A;  5LBQ A;  1B1B A;  1WI9 A;  3ABU A;  3GFM A;  3FMR A;  4BH9 A;  2M1B A;  4BHB A;  4AD9 A;  1R1T A;  3R4K A;  5L3G A;  5K5R A;  1BJA A;  1R1U A;  1O3R A;  4ETS A;  2DI3 A;  1SFE A;  5CLS A;  3CUQ B;  1L0O C;  5DV5 A;  3SQN A;  2DFI A;  1EH8 A;  2M45 A;  1FBQ A;  5LRS A;  4RAZ A;  1P4X A;  2A61 A;  4RB2 C;  5L3F A;  1IN6 A;  3I5U A;  2VE8 A;  3WTZ A;  4Q47 A;  3DF8 A;  5ILS A;  1BC7 C;  2YU3 A;  1HST A;  1R7J A;  4I0A A;  3KCC A;  4K2E A;  1OYI A;  2BE5 F;  1G3S A;  1MD0 A;  4M6X A;  1IRF A;  1RZ4 A;  1Z9C A;  3LQQ A;  2CG4 A;  1HW5 A;  1G4D A;  3TO7 A;  1F5T A;  2GZW A;  2FMY A;  2PMU A;  1RI7 A;  3RKY A;  2F5C A;  2V9V A;  1FSH A;  1R1V A;  2GWR A;  1AOY A;  3GYH X;  3HRS A;  1PDN C;  5LLQ A;  3I59 A;  4HF2 A;  4ZYE A;  4WXD A;  4ZYG A;  3OOP A;  2X4H A;  4IHT A;  1P2F A;  5J8C A;  2WTE A;  1O3T A;  1LDJ A;  3MWM A;  1KQ9 A;  1RIO H;  1TNT A;  5E8G A;  1I6X A;  1LNW A;  5L3D A;  1XDS A;  1T98 A;  2K86 A;  4EV0 A;  3D0S A;  3ZN1 A;  1RUN A;  2ZKZ A;  1HXD A;  3I64 A;  1SD6 A;  1FOK A;  3KP6 A;  4OOI A;  4FX4 A;  1ZRC A;  2PQ8 A;  4YFX F;  3SZT A;  1ZLJ A;  2ACJ A;  1WQ2 A;  4EM1 A;  3D5L A;  1ZG1 A;  3OV8 A;  5HDK A;  4EVI A;  1WSU A;  2F5D A;  3ROU A;  1SFU A;  5D8L B;  2Z33 A;  1HKQ A;  4EJU A;  3GWZ A;  3GZ6 A;  4I09 A;  5TJJ A;  3E3V A;  3E5Q A;  4WWC A;  3HYI A;  4O3M A;  1LQ1 A;  5ICF A;  5ERI A;  4MQV A;  1TNS A;  4KIB A;  3TGN A;  2V1D A;  3O2P E;  4LGW A;  3V8L A;  3JAM Z;  3ZP5 A;  1XDU A;  3GVA A;  2HKX A;  5H6Q A;  4HX8 A;  2DTR A;  2NNY A;  1ZG3 A;  2HTS A;  5D5X B;  1FYK A;  4CYD A;  4P9F A;  4WX9 A;  2PFB A;  2XAS A;  3IRQ A;  2ZXJ A;  2GIV A;  2L4M A;  3GUD A;  3AAF A;  4BAY A;  1FSE A;  3KP7 A;  5HDN A;  1BN5 A;  5LRR A;  3HSF A;  2VOO A;  1STZ A;  4ON0 A;  1UHW A;  5H6R A;  3I0T A;  2NYX A;  4RGR A;  2MLK A;  2V1X A;  3FMQ A;  5DYM A;  1Z1D A;  1O57 A;  1UHM A;  5E1W A;  3HTS B;  1ZN2 A;  3HHG A;  4M6Y A;  3HRU A;  1EV7 A;  4OMZ A;  3TO6 A;  3EDP A;  5ED4 A;  2LKP A;  4Q4Z F;  3T8T A;  5HS9 A;  4ZZD A;  3KFW X;  4KFC A;  3WTU C;  1YW7 A;  1Y0U A;  3HHH A;  3KEO A;  4MNU A;  4EJW A;  2XAJ A;  5HVQ C;  2XAQ A;  4ENM A;  3P9I A;  1FT9 A;  4XBF A;  1U8R A;  3ZMS A;  1T38 A;  1KQ0 A;  2JSC A;  3VEP A;  4MQ9 F;  1FNN A;  5DCM A;  2Z5U A;  1U78 A;  2QM3 A;  3H3Z A;  3G73 A;  1WWX A;  1F1Z A;  2ELH A;  2M87 A;  4BHP A;  1FY7 A;  3WU1 B;  3PQK A;  5F6F A;  3WU0 A;  2GXB A;  2Y48 A;  4M9Z A;  2BV6 A;  2GA2 A;  1IN8 A;  1ULY A;  2EFN A;  3I54 A;  4UNO A;  2COM A;  1V4R A;  2MD5 A;  5FD6 A;  4O6J A;  1J0R A;  1UFM A;  3DPT A;  3CUQ C;  3R0A A;  3ZMV A;  2LNB A;  3LA7 A;  3LA2 A;  5DD4 A;  3ISP A;  2QLZ A;  4N0B A;  4KIG A;  3BP8 A;  1B6A A;  4PCQ A;  1D3Y A;  1J59 A;  1IF1 A;  1ON2 A;  2V1U A;  3K1M A;  1H0M A;  4GYG A;  1SD4 A;  2WV0 A;  5FO5 A;  1SFX A;  1XGS A;  2Z99 A;  3U9G A;  1MJB A;  3RYR A;  3EUH A;  3TKY A;  4PGG A;  2TDX A;  4RS8 A;  1TQM A;  5D4S A;  4ENK A;  4HF0 A;  3JW4 A;  4YFK F;  4HV6 A;  1WRJ A;  1MDM A;  2Q0O A;  4YIF A;  1RUO A;  4Q5S F;  3I4P A;  3FM5 A;  2UZK A;  1ZLK A;  3RPU A;  2UWM A;  3MAJ A;  5LHG A;  3F22 A;  3U2R A;  4LK1 F;  5DUK A;  2HFH A;  5L3B A;  3L9F A;  1VTN C;  2EK5 A;  3E6B A;  3GW2 A;  2YX7 A;  2IA1 A;  5ILU A;  3LST A;  1FYL A;  1OKR A;  5BQT A;  5CVJ A;  3F23 A;  1Z91 A;  1SAX A;  2D1H A;  4LLN A;  4A0Z A;  4EGY A;  2IJL A;  5E20 A;  2J5O A;  4OIQ F;  1HSJ A;  1XD7 A;  3F8M A;  2FNA A;  1R23 A;  5J8F A;  4A6D A;  4DQ2 A;  1Z7U A;  4RAY A;  2JZY A;  3HTU A;  2IPQ X;  3DV8 A;  2P5L C;  2BBY A;  2DLL A;  3H92 A;  3BOQ A;  4Y17 A;  3FX3 A;  1G3W A;  4LB6 B;  1LEA A;  3QU3 A;  3CO7 C;  3GXO A;  1JXS A;  4GXO A;  2M5W A;  1UCR A;  4KA4 A;  1UB9 A;  1EH6 A;  1FLI A;  2CW0 F;  4Z2Y A;  3TQN A;  4UHT A;  2VBW A;  2RGV A;  1BBY A;  3V7C A;  4UVC A;  1S7O A;  4Y15 A;  1LEB A;  2HEO A;  2LDU A;  2FSW A;  5EEH A;  5DD8 A;  3RKW A;  4L0Y B;  3CJN A;  1IUY A;  4L0Z B;  2RV8 A;  4UV9 A;  3LQR A;  2FNP A;  2JRT A;  2W25 A;  5K5Q A;  2K02 A;  1YW9 A;  3DQV C;  3HSR A;  3ZQ7 A;  1QPM A;  2FBK A;  5CVU A;  4ZYH A;  2PG4 A;  1U3E M;  2HTJ A;  1YIO A;  2E7W A;  2H6B A;  1JHF A;  4KIF A;  3GX4 X;  5L3C A;  1B4A A;  1W5T A;  2PJP A;  5JVT A;  5EEG A;  1QZY A;  3CTA A;  4GO1 A;  1W4M A;  5HOO A;  2H94 A;  3F6O A;  1V3F A;  2DBB A;  3WGG A;  1R22 A;  3Q9V A;  1YFH A;  1J5Y A;  1ZYR F;  4HLX A;  4GGG A;  3VOE A;  3H3U A;  2EJR A;  4QLC U;  5FB2 A;  4LG0 A;  2ADU A;  1BIA A;  3WTS C;  4CDG A;  1ZG5 A;  1OPC A;  1SMY F;  3JAM K;  1ZGA A;  2DPD A;  4B09 A;  1LVA A;  4LMY A;  1K79 A;  2J5P A;  2R7D A;  5IT9 Z;  1ONV A;  2EFP A;  3R6S A;  1XCB A;  5JR3 A;  4BYY A;  3HRT A;  3L00 A;  5IT3 A;  3ERE D;  4HQE A;  4WXC A;  3BPV A;  1R58 A;  3CLO A;  4HX4 A;  2ZCW A;  2P6S A;  1U5T B;  2FA5 A;  3FWE A;  1DPR A;  1OYW A;  1TBX A;  4E70 A;  1KYW A;  2RDP A;  2D1V A;  5D5W B;  4LD5 A;  3HOS A;  4U7D A;  4IRI A;  2CSO A;  1BI0 A;  1CF7 A;  2FML A;  1HKT A;  2H6C A;  4EJT A;  2BGC A;  1SMT A;  4KYW A;  1IZ1 A;  2P4W A;  2YR2 A;  4M74 A;  2FE3 A;  1T0F A;  2W85 A;  1BC8 C;  3F6V A;  5D4R A;  3C18 A;  2PN6 A;  3L09 A;  4HF1 A;  4KDP A;  3KLN A;  3L2C A;  3DPL C;  4G94 A;  5E17 F;  2ZJ2 A;  4YII A;  2JTV A;  3J80 K;  4RGX A;  1BM9 A;  2OD5 A;  5LEK A;  3WGI A;  5AON A;  4LK0 F;  4CXF A;  2YX4 A;  3FXR A;  2L01 A;  3M7G A;  1MJ9 A;  2PLY A;  5DEQ A;  3MCZ A;  4LG0 B;  4WF2 A;  2K7L A;  2A3S A;  4L5J A;  2QUF A;  4EGZ A;  2IA2 A;  3RIR A;  2Z9O A;  1S8N A;  2A6H F;  3L7W A;  2DQL A;  2NRA C;  3DKW A;  1DDN A;  1Z6R A;  2NAZ A;  1Z6T A;  3RPQ A;  4ENN A;  1SD5 A;  5JHU A;  4S05 A;  3HIF A;  1CGP A;  3G3Z A;  3QP6 A;  3TOA A;  3LAP A;  1YO5 C;  2JPC A;  2MBF A;  2MLG A;  3I53 A;  4B8X A;  1F4K A;  2GXG A;  4MTE A;  2OBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...