4J00A

Crystal structure of fischerella transcription factor hetr complexed with 24mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
297
structure length
297
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
total genus 62
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A02
3QODA 3QOEA 4YRVA 4J00A 4HRIA 4IZZA 4J01A
chains in the Genus database with same CATH superfamily
1OISA 1FOXA 2J5PA 4XOTA 4KN7X 3IRQA 3GTOJ 1R5GA 1S6LA 2GOMA 3F0CA 4M73A 3SFIA 3ASNH 1OCZH 3HRUA 2QM3A 3OYHA 1ZG5A 1ZR2A 4N4OB 3JW4A 1UG0A 4AYBN 3RQIA 4KISA 3IH2A 2FNPA 1HBXG 2ZSIB 2L7ZA 4LMYA 4YFKF 1E3HA 2WB1A 2V1XA 4A3JJ 1VQ7I 4E7KA 1EV7A 2DOAA 1RRJA 1OCOH 2BVMA 4OIQF 2ECBA 2DMQA 3F22A 5DCFA 3M1EA 3KP7A 1X58A 3BR1A 4GYIA 5BQTA 3FBNB 3DU5A 2NXNB 4A3FJ 2KRFA 1FJLA 3ZPLA 1BOAA 4DBRA 3EUHA 3Q0WA 4HNVA 4XIDA 4LLNA 3OYCA 1Y8RB 3ZQ7A 1LEBA 2JT1A 1T08B 2DA3A 1N75A 5BMZA 2VBYA 3QP5A 3HPGA 1WPKA 1D0ZA 2XGXA 5E18F 1YI2I 1VFCA 2O9LA 1TW2A 2OD5A 1A36A 3CTAA 5FKOA 3CZ6A 2VJJA 3HKZA 4II2A 4BQQA 3OS0A 3LA3A 3GVAA 1MZBA 4WXHA 1HDDC 4PK4A 1P7IA 2QBYA 2R7UA 2M0MA 5B5EC 3LFKA 2DTZA 3HB9A 1K61A 3HOUJ 1LJ9A 4M3DA 2IGMA 2QSHX 1OPCA 2DOEA 1IRZA 3I4MJ 1MD0A 4G6QA 2QBYB 1GT0C 3S8PA 4CUGA 2QSFX 1BI0A 5JFRA 1X4OA 2L9SA 2L5QA 2H1KA 1W0UA 3G6EI 4AIJA 4E7LA 3BJOA 4LIUA 1E17A 1FSHA 2NVXJ 2ETHA 5DEQA 3BZ6A 1NTCA 3S1NJ 4LD5A 3ZQFA 1ERDA 1A6QA 3Q9SA 2D1VA 4LGWA 1QBJA 5EG0A 1T0FC 1SD4A 2E60A 2PQ8A 3A0HC 5F0HA 2XGCA 3O3KA 1UMQA 4OOIA 1YS6A 2Y69H 4RDUA 1ZREA 2MSYA 3HKZN 4PJ0C 2H8RA 3OOUA 3H5RA 1U78A 3ZP5A 3CCMI 3QRFF 4BHPA 2DN0A 2PX9A 5H2FC 4AWXB 1I1SA 2L0KA 2TCTA 3S2DJ 4D7NA 5JHUA 3O2PE 3KP2A 5GAHJ 4OIOF 3OS1A 5EEGA 2V7FA 3WU1B 2FXAA 2NRAC 4M9SA 2O61A 3FXLA 3HGGA 4RAFA 5K7ZA 1AWCA 5L3EA 3LSMA 4RGUA 3JSPA 2FJ1A 1BC7C 5IT9K 2HDDA 3E6DA 5GAEJ 2ZFWA 3GTLJ 3RZOJ 4LIVA 2RGVA 3B6AA 3H35A 1H89C 3ABUA 1I3AA 2DCEA 3BOQA 1YX5A 2KHMA 4M74A 4R1HA 2K40A 1NK2P 2OQGA 2W85A 3ZMSA 1W7PB 2YS9A 1BN5A 3C7JA 1MBJA 2CO5A 3VSKA 3KP6A 1TQIA 4HAMA 3OY9A 4FASD 5KAIC 1I39A 3BG5A 3HIFA 3IAM2 1IRGA 1MSFC 5LHGA 3K70C 3I53A 4QTRA 2O3FA 1I1GA 1K78A 3JTGA 4G6DA 4IXAA 2GA1A 5DTDA 4BGDA 4CCKA 1WJCA 1TT0A 4HBLA 1FZPB 2FQ3A 3MD2A 2A6HF 1G2HA 2HNHA 4CCNA 5FFXA 4S0HB 5GAGJ 2E7XA 5EGOB 3OYLA 1U9OA 5HNFA 2QZ8A 2VONA 2IW5A 3OYJA 1CGPA 5CLSA 1IO2A 2WA0A 4HV5A 3I4NJ 1VI0A 4E7JA 2BW3B 2M9HA 2ZXWH 2Z3YA 2NNYA 1T2KA 1PP8F 4OMYA 1MNEA 2AQEA 2BZTA 2P7VB 4PFPA 1FX7A 4FETA 5AONA 1SFKA 1XMKA 2EPFA 2PBIA 5J1UA 2MYSA 3WGIA 1EA3A 2HZDA 3J7AO 1U5TC 3CC4I 4RLFA 5J6XA 1ZAOA 4RGSA 3N97A 3EDPA 2ICWG 2GZWA 3NQOA 2L4AA 3EYIA 1SFOJ 4EGYA 4V19K 3REOA 1KYZA 4HYEA 4L9NA 1OCRH 3MQ0A 3CCQI 1O4XA 4JYKA 1PJRA 2FQ4A 2RQQA 2XIGA 1IXRC 2BV6A 4IOAF 2OCEA 2HQAA 4QWQA 3GTMJ 4MHGA 5ICGA 1OCPA 3DTKA 4PUSA 2VIXA 1LE8A 2EQRA 3A02A 3I64A 4OIRF 1ZGJA 2CMPA 2X48A 3NEUA 3ZXSA 4A3GJ 3PIPF 3AG3H 1P4AA 2FMYA 3BG6A 4KJZA 3IP4B 3HJEA 4FX0A 5HODA 1E3PA 2O7OA 1HKTA 4XORA 3TO6A 2HEOA 1P4WA 3H9GA 3IV5A 2P4WA 3GBGA 2V79A 5TGTA 2XASA 4V2FA 3JRDA 2V26A 3P9IA 1WKMA 2NOGA 4DZJA 4E4HA 2HQRA 2KMUA 2OUMA 4JX6A 4BUPA 1RUNA 5F08A 2JVHA 2ZXIA 1JTXA 3JRGA 3AL0B 1O3QA 2YR2A 1ORKA 2VOPA 1SANA 4BNCA 1SD6A 1WCMJ 4M6XA 2KJCA 3D5RC 3ZMVA 4AUXA 4Y13A 2OJED 2KRCA 4RLQA 1QHGA 3DEEA 3RQ4A 2HDCA 3OR2C 2DLLA 4FX4A 2LBFA 1QVTA 4Y15A 4OAYA 5IYCJ 4XLFA 5J4VA 4XL9A 3VPRA 4CCOA 1JKQC 1WJDA 1HC8A 3VSLA 1MKMA 3MKWB 4ZYGA 1BW5A 2KIMA 5M5XJ 4I2OA 3PNYA 2AS5F 2AO9A 1FLIA 4P5OA 5J1YA 2ZMEC 1S72I 3ULQB 3M7GA 2COBA 1VQ5I 3F8CA 4F3QA 3IC7A 4F93B 3FBIB 2LY9A 4ZZDA 2HPIA 1O7FA 1SFEA 4BQNA 3UNGC 4DBQA 3HOVJ 3T1BA 1J9IA 2GIVA 4BJTA 2M3AA 3EPZA 4PCQA 2LBFB 1L0OC 2XAFA 4O5VA 5EYRA 2FNAA 2IGOA 1BR1A 3JREA 3VEPA 3TW7A 1ODDA 4HSRA 1NHAA 1QA6A 4TV7A 1T95A 1XGSA 3R0JA 2XRNA 4XLNF 2BW3A 5FKMA 5FD6A 3M3YJ 3OYNA 4CXFA 1DU0A 3BR3A 4M6YA 3A01A 4IHTA 1ETQA 3WGHA 1ZKGA 2P0WA 5B1AH 1TZLA 2DA2A 3DCFA 1IF1A 3J7AY 2IA1A 5LGNA 1UELB 2X51A 4IL6C 3HUGA 3I55I 5FFZA 2DODA 4W97A 2OTJI 1K83J 4G6TB 4XLEA 2E2HJ 1RR8C 2LF8A 3FK6A 1FTZA 1IDYA 4XLHA 4WXCA 3GTPJ 3LFUA 3MCZA 4QSHA 4AU7A 1HW2A 1YRNA 4HDUA 2F5DA 4UVCA 4I7HA 3S1RJ 4XSZF 3TP3A 1WRJA 3S17J 3AG2H 2LP0A 2QGUA 1ZLJA 3WTWC 5B1BH 2JUGA 1KU3A 1XGOA 1TQPA 3K4KA 3GO5A 3IKTA 2VC0A 2DT6A 3DLAA 5FLMJ 4XLAA 1V5EA 3V7RA 2EK5A 2KRHA 1YHQI 2M8GX 1MMSA 3HRTA 3IH3A 1SEUA 2CWEA 3D5LA 1ITYA 3I0TA 5IP7J 3VYUB 2HVQA 4PFOA 3KETA 3CCEI 3M8FA 3G2BA 3SZPA 5J3LA 3RDIA 2DA7A 4IKFA 1N25A 5ICFA 3KLOA 1V3FA 2NVYJ 3SJMA 3HXLA 2LC2A 2XAGA 4MTEA 1ZTRA 1T38A 4Q5SF 2IBDA 4XRMA 1XTAA 4N9HA 1B8IB 1K6OA 3RIRA 4XBFA 5HOOA 2CW7A 2JA8J 4LITA 3HSEA 4B1RA 2M4GA 4IPAA 2EFNA 1H9GA 1V5FA 4RB2C 2L02A 4P96A 3AAFA 1JT6A 2XRLA 3W6KB 1ZQ3P 1W4MA 4XNFA 4LB6B 2VB6A 3QWLA 4M71A 4HNTA 3E5XA 3H5AA 3K10A 5FLXZ 1IJWC 4B8XA 2GAUA 2PEXA 2V6CA 3CJTB 2DFEA 1GV5A 3FX3A 2KIQA 3K70D 1MJ9A 1LUJB 1T0FA 4IJAA 3NWSA 4D5FA 3TBIA 3U21A 2ZB9A 2HOSA 2NVTJ 3F8FA 1F9NA 2AXTC 3GLXA 3ISPA 1FYKA 2CUFA 4XMYA 5D4RA 3JRAA 5HLGA 1U3EM 4IQ4A 2ZJPF 1ZK8A 1YJ9I 4ENMA 3ZMTA 1FNNA 3WE3A 2XAQA 2DAOA 3CCRI 1B72B 3QP6A 2MLKA 1D1BA 5J8FA 2DPDA 2JRTA 2HU9A 1AKHB 2IS2A 4RGRA 3H92A 2VC1A 1S3JA 4ZYDA 4QPQA 2STWA 1ZN2A 2MC3A 3BY6A 3K7AJ 4RM2A 4M3FA 1DU6A 3RKYA 2W84A 2QENA 3H5NA 4E7IA 2NS8A 4Y4RA 3BPVA 1LFBA 2M30A 1XDSA 3CDIA 1OR7A 4BY1J 2PG4A 1R22A 4EM1A 3M9AA 2NS0A 2P7CB 3K1PA 3L2VA 3V4GA 4CCLA 3ERMA 4CZZA 3FXUA 2OU2A 3JAMK 5D8LB 1IXCA 1LNWA 5CVIA 4NB5A 4C2MJ 1K78B 1MMDA 1YLFA 2PI0A 3K0LA 4PDKA 3K4NA 1R58A 1RNLA 4FHTA 2E1OA 4D9JA 2KT0A 1ZGWA 2M87A 2K86A 4Q47A 1XSDA 2CQXA 1Q1VA 1SVMA 2LY1A 4Y33A 1MH4A 2JA6J 1P4XA 1BL0A 4QLCU 1D0XA 3I9V2 3CUQC 4FE7A 1EH8A 2A61A 1FPQA 1XS9A 3QU3A 4RGXA 4I6ZA 2PN6A 3PO3J 4DYCA 4RB1A 4A0YA 1MSEC 4PSXA 1MGTA 1WH7A 5HLIA 5EF6A 1L3LA 2DBBA 5IT9Z 3L2RA 2MD0A 4Q48A 1KU9A 4UUTA 3K9TA 1APLC 1MJBA 4F92B 4XSXF 1SAXA 2VQHA 2XF5A 1MMNA 1U8RA 5H6QA 3SHFA 2UXNA 2IRFG 4EJTA 1NG7A 3CF2A 2M7BA 2JRMA 3JR9A 3R0AA 2GOXB 4C3JJ 3QPHA 2FU4A 4EEFG 2COMA 4AD9A 3WTSC 5K5RA 3O8GA 1W1WE 3SDBA 5JHFA 4WK8F 1QU3A 1Z9CA 4CCMA 5EJCA 2F5CA 4LG0A 5L3FA 2OF7A 1VQ6I 3PSIA 5EZGA 4V2GA 3I58A 1KYWA 3BR5A 2JA2A 2YU3A 3PQKA 2D45A 2EIMH 2VLAA 1IW7F 2P5VA 2FRHA 5CPRB 2KZGA 1M1EB 4A0XA 1GXPA 1RR7A 3TDUC 2IJLA 2BBYA 1K4SA 1U5TA 2OZUA 2RV8A 2F5FA 3TKYA 2MC4A 5FJ8J 2IPQX 1F5TA 4Q4ZF 2TRTA 3E5QA 3JRHA 2O03A 2VOOA 4J19A 4M9XA 2E5ZA 3J7YJ 2OBPA 1LDKB 1I5ZA 3I56I 3ASOH 2O8XA 2XSJC 2DA4A 2XV4S 1OFCX 2HPMA 2DPUA 3ECHA 4Y7NJ 3GMEA 1IRXA 2XGEA 4OAZA 3KYDB 2NVUB 1TWAJ 5IP9J 2DMUA 1BBYA 4IRGA 4XK4A 5DD8A 4HDVA 5DM6F 2Y48A 1MBKA 4RB3C 1GV2A 4OWRB 1TTYA 2VASA 4BXXJ 3C2BA 3R61A 1XGMA 4CYCB 1ETKA 1E2XA 3HHHA 3LMMA 3PM1A 1O7LA 2DW4A 3B73A 5M3MJ 4HLXA 3S32A 4YG2F 4DYQA 3J80K 1TC3C 3LQQA 1H8AC 4NNJA 5D6FA 2PMHA 3DQVC 3NRVA 1BI3A 1PUEE 3OYKA 1Y8QB 3UKGA 3BDDA 2R4GA 2ZJRF 2QKMB 1WH5A 3QPLA 5KAFC 2DJNA 5J4YA 1VQMI 4PJLA 5CJ9A 4I98B 2VJIA 5FRNA 3L2QA 4YIIA 1NG6A 2KDZA 5L3BA 2KIFA 2QKLB 2JSPA 5FKLA 2GM4A 1J09A 4Z2YA 4A69C 3LSRA 1W36D 2A5YB 3T0YA 3WTXC 3K1MA 2DI3A 4OU0A 4IVNA 1RC9A 2OCCH 1HLVA 1SFUA 1RETA 5JLXA 1J75A 1R1UA 4I0BA 1V4RA 2EH3A 4I76A 2XKOA 1G8XA 1MBGA 1B1BA 1ETWA 3TO7A 4B47A 3V42A 3VYSB 3KYLA 3LL7A 1ZRDA 1IUFA 2ISYA 4BE1A 3ZQHA 1HW1A 2IGKA 4CSWA 1XN7A 3Q0VA 2VBXA 1WJFA 3HPHA 4KT5C 2BE5F 1V55H 1A6IA 4CH7A 2M2EA 4UY8I 3QODA 4UVBA 4D1QA 1WHUA 1RUOA 1UCRA 3DKWA 1ETYA 1G59A 1Y1VJ 4PGHA 2LKPA 4ENJA 2FOWA 2VL8A 4MQVA 3KP4A 4MNUA 2DQLA 2ISZA 3X2QH 2H94A 3QU6A 2R5YA 2LDUA 1B72A 3DPUA 3RCOA 1Q1HA 3H3UA 2V1UA 3N4MA 1O57A 3HEFA 1T8IA 5GPAA 1D3YA 1A04A 2OV7A 3FM5A 2Y9ZA 2CFXA 1ZGAA 5IY5H 4XOPA 1LDJA 3NAUA 5BOXA 1QGPA 1DP3A 5LHIA 3CO7C 3A0BC 2ELJA 1WI9A 4BYYA 3R4KA 3BG9A 3AG1H 5AIPA 1DGWY 4G94A 4AVPA 2DTRA 5E20A 2I10A 4HEA2 2W48A 1LVKA 5A2QZ 3MMYB 3RKWA 3OYGA 3GUDA 3FK7A 1MMAA 1TWGJ 3BJAA 4XKWA 4U88A 2FSWA 1ETOA 2K3FA 2OQRA 1Y56A 3RKXA 1J0RA 1R23A 2LFBA 2P5KA 2JWTA 2ZNZA 3W2WA 5BPDA 3F72A 3MAJA 4HA8A 2H09A 3L2UA 4P9UA 2QA4I 1MNMC 2L3DA 4XM3A 2R7VA 2G0EA 3CDLA 2M34A 5H20A 3JRCA 5C3EJ 4HG2A 1TWFJ 4HX8A 5DCMB 3I54A 1D8JA 2VE9A 2DMPA 4IQJA 1RIOH 2EB7A 2V1DA 3E3VA 3JSOA 2V4JC 3Q3SA 3K6GA 2R0QC 3QYEA 1BM9A 4FE4A 5LRSA 1GDTA 1LFPA 2W24A 2LD5A 2M4KA 1USSA 3BWGA 3ROUA 4XKVA 3RPUD 3VODA 4HF0A 2NOJB 4AIKA 4I09A 3QQAA 4MO7A 3HL2A 5ED4A 2MH9A 5LGTA 2Z1DA 3F8MA 4A5MA 2DT5A 2DK8A 1B9NA 2QYOA 4C3IJ 1XMAA 2QQ9A 3LSGA 1R49A 2WC2A 2M1BA 5FKKA 2XAHA 3CJQB 3KPHA 4ZZLA 4DNCA 1CF7A 3RJPA 3HOWJ 1FY7A 3W2AA 3KEQA 2UV1A 3DBRB 1VQ4I 3PNTA 1Z3YA 3PO2J 5IP6A 4UVAA 3HRMA 5B66C 1OYYA 2GQQA 3A03A 1VF9A 1D5YA 1NK3P 2QCOA 2E19A 3W2VA 1PVEA 2Q1ZB 4KNYA 2E71A 1R4NB 5M3FJ 4XRSG 2UZKA 4PZJA 1FOWA 1ZELA 4M72A 3GTJJ 1K79A 2K27A 5C44J 3FXQA 1G6NA 2VXZA 2XSDC 4G7OF 3T5XA 1J7KA 2ZFUA 3LA7A 1FP2A 1PUFA 3HDDA 4IRIA 1MIJA 4M3GA 3A01B 1Z3XA 4ZC3A 2EA4A 2CQNA 2L9NA 3BTJA 3CC2I 3LQRA 1UB9A 3BZKA 4KDPA 1K6YA 2RREA 1X1CA 1YQAA 3LOCA 3RPQA 1QPIA 2NVQJ 2L7FP 1PP7U 3ZQCA 2K5CA 3J7ZI 2STTA 1VQ8I 3E5UA 4HRIA 1JUPA 3L9FA 1QZZA 3G1LA 2DDAA 3TO9A 3OWTA 2X9DA 3BR0A 2G9WA 1D5VA 1U9NA 3QYBA 1HF0A 5GPCA 4Y3OA 2X6WA 1XB4A 4ENKA 2JTVA 4HW0A 4RB0A 1WJ5A 1G3YA 4J01A 2IAIA 2MFZA 3U2RA 3FMQA 5D4SA 2GXAA 4IHWA 2CV0A 1J2XA 1FMWA 2NAZA 3PJRA 2CW0F 2RKHA 2IEKA 1W0TA 3LWFA 3CCVI 1V5GA 3P9CA 3K1NA 4U0VA 2ESNA 4CICA 2YUSA 2EZKA 5HS8A 3V7CA 2XB0X 2XROA 1AOYA 4DIQA 1F36A 5E1WA 3OYAA 1X4PA 1A31A 2V9VA 3DTIA 4BAYA 1Z6RA 2Y31A 3DTEA 2ZCWA 2QQ8A 4E7SA 4LG0B 4X6AJ 2G7UA 5EDNA 3D1NI 1H0MA 2ZXHA 3R60A 3I3LA 2Y30A 3HC7A 2DA6A 4MIMA 2OZ6A 3S2WA 4A3MJ 3KZIC 4QPOA 4CA0A 2CV2A 1YYVA 3ONQA 4FISA 1D8KA 3DFGA 3H36A 4N0BA 5F6FA 3QOEA 2KPMA 2RVCA 4KN4X 3SEZA 3I59B 5ILSA 2ELHA 2GIZA 3L2CA 1JGGA 3KZZA 2FMLA 3ABMH 3F6OA 1SD5A 1F1ZA 2IA2A 2LK2A 2XVCA 4HQEA 4GDFA 5JLWA 1PUFB 1JJ8C 5IPAA 2J5OA 2WADA 4E70A 3HZJA 4XN0A 1TQMA 2NS7A 3FDYA 2EFQA 5E3MA 3OIQA 1B4AA 2FX0A 4LLLA 3S3OA 1LKXA 3DPTA 5KCMA 3AL0C 1ZG3A 4YFXF 3ZN1A 1UFMA 2H27A 3OV8A 2FBKA 3ZRGA 4ESFA 3C2HA 1ON2A 1MH3A 3O8HA 1YITI 4E7HA 1ZRFA 3ABTA 3J81Z 1ETXA 3C18A 2VKEA 3CD6I 4NQWB 4YFNF 3DWLE 2DMNA 1JE8A 1JKRC 2LH9A 5FROA 2K02A 1TWCJ 1IV8A 1K4TA 1VQ9I 1VNDA 4RAZA 2O0YA 5LGUA 2P6SA 4IHXA 5KVRA 1H9TA 2GXGA 4RMNA 2CQKA 2ZKZA 3WE2A 2Z16A 4N9IA 1WFXA 1LFUP 1UZCA 1WWXA 1R00A 2MG4A 1I6XA 3PNVA 1P9QC 4KITB 3GCMA 2GLOA 3F8BA 2UUZA 2VI6A 4A6EA 1ZHFA 2D2WA 2VPRA 2KIUA 1Z21A 1VQKI 3KP3A 4O6JA 1Y0UA 1E0EA 2XF6A 5DDGA 5EG0B 2GBYA 2GA2A 3CCLI 2RNGA 1REPC 1YS7A 5FKNA 3CMMA 3ZN0A 2CUJA 2XAJA 3FMRA 3IWZA 2BY0A 2H1LA 3WHCA 4KMFA 3T8RA 4M9ZA 3B6CA 5A2QK 1D1AA 2EJRA 4A3CJ 4DQ2A 1BIAA 4JX4A 1X1PA 1KU7A 1GUUA 2UWMA 2RDPA 2VKVA 2CG4A 5CVJA 3LA2A 3K2AA 4BXUA 4J00A 2TDXA 4ENNA 2IA0A 1Z6TA 1Z0XA 3DKYA 4U7BA 3WTVC 5CQEA 5GTIC 3E0JB 4D7MA 1T6SA 2DXIA 2IXSA 1IN8A 2Y75A 3ZMZA 1JKOC 5K5OA 5D5UB 2CV1A 4HSTA 4JX5A 2E1CA 2HTJA 2X1EA 3L1PA 2HDWA 3OYMA 3BTIA 2EFWA 1JHHA 4AC0A 2EFPA 1HXDA 1QVUA 5CVVA 5EEHA 3CO6C 1R71A 2DU9A 4DGWB 2F4MB 3M4OJ 1BR4A 5ILVA 2O8KA 1MMGA 2HTSA 1ZYRF 5L3DA 2VQCA 4ANJA 3OR1C 4A12A 2AHQA 2VPLA 3ABKH 3HOXJ 3VDXA 2L7KA 1SMYF 3HSRA 2A69F 3S14J 4IX7A 1UG2A 4FQGA 2WAEA 2E34A 2WTEA 4RM3A 4IHVA 4WCGA 1KQ8A 2CUZA 5C4JJ 4G7ZF 4U87A 9ANTA 4L0ZB 1SD7A 4KMUX 2ZMEA 4OIPF 3EETA 2HQNA 1KGSA 2HKOA 3U1KA 3AKZA 5GADJ 4NBQA 3W6VA 2O6GE 3E6BA 3W6JB 3Q5FA 1JGSA 3BC8A 1GVDA 1BIBA 3OYBA 2M7AA 1D0YA 2PMZA 1DGRM 2MW8A 3ZR8X 4MTDA 3CMEI 5IOYA 2FE3A 4LOCA 3LNQA 2PMUA 1U6GA 2ZJ2A 1G3WA 3FF5A 4BQOA 3L2WA 2A07F 3S93A 3RYRA 5GTHC 5E79C 4GXOA 5H6RA 4DJAA 1YIJI 4A2UA 3PL8A 2H6BA 4ZH4F 1TBXA 3CF5F 4I0AA 4EJWA 3FIWA 1WJBA 3CMYA 3GZNB 2ADUA 3SZGA 3I5UA 2LNBA 2R7DA 4QIWN 2WWYA 2A5WA 2QLZA 1DP7P 3MKYB 1O3TA 2RN7A 5E3NA 2HYJA 4KIGA 3WGGA 5BS6A 1VTNC 4HF2A 2ME6A 2LMDA 3HSFA 3QPSA 4A3EJ 2W57A 4HOBA 4IZZA 1MDMA 4C2TA 3HBLA 2F48A 1UHSA 2W7NA 3DKXA 3RYPA 2VT3A 5F64A 1EKEA 5ILUA 2LY2A 4WXDA 2VKDA 5LLQA 2HI3A 3LSHA 4L9JA 1YO5C 4DOZA 4CYDA 2H6CA 4IHSA 5LBQA 4GYGA 2F4OB 2HS5A 3CP8A 4C30A 1ZLKA 5F1JA 1IUYA 4B44A 1AHDP 2R5ZA 4ZYEA 3GXOA 1TWHJ 2IP2A 3S1QJ 3CJRB 4A0ZA 2FEZA 2B63J 2OA4A 2MLGA 3OSGA 3FXMA 5BNGA 2Z33A 2JZYA 3RTRA 4XRFA 2EBIA 1UHMA 3CCSI 3EUAA 1TNTA 5TJJA 3MEXA 1MBEA 1SMTA 4EJOA 3C2GA 2X6OA 4MEXF 4HF1A 2CYYA 1OCTC 1P92A 1EH7A 2MABA 3H9QA 3HHGA 1BW6A 3FHNA 1VQLI 4P9FA 3DF8A 1X2MA 2HOEA 3H1CA 5JR3A 3K4JA 3CCJI 2X6XA 4ZDPA 3C3WA 2WAQA 1GVJA 2X85A 2V9PA 2GWRA 3H3ZA 2B9SA 3H9JA 4Y17A 3H3VK 2BGCA 1ZH5A 3ABLH 4F55A 1X1AA 1S5LC 2YSRA 2LRDA 1YRNB 1OR7C 3ZQGA 5D5VB 3EYYA 5EEAA 2VBZA 3DBHB 3ERED 4B4CA 2QSGX 4JK1X 1LQ1A 1XCBA 3HUGB 3TP0A 3MKLA 2JVGA 4JP0A 4DZPA 4YIFA 2F5EA 2XHKA 5F0FA 5FRMA 1IC8A 4BBRJ 2Y0SN 3OOPA 3OIOA 1LE8B 5HLHA 2ELKA 1XPXA 5HDGA 3BT9A 1JT0A 2R7FA 4EM2A 4BEHB 3GZ5A 4XONA 2X0LA 5E1XA 1XG1A 2RAEA 3PQJA 2EWNA 4P1WA 2K9LA 5F04A 4EMSA 3KEOA 4HPQA 4IRHA 1IG7A 3DPLC 2LYCA 3K4LA 3SXYA 5FB2A 1YJWI 3P5JA 1FBUA 2XUBA 2KJBA 2HXOA 3OYFA 4M3BA 3GLLA 3G1OA 4X0GA 1LB2A 4CZCA 2CQQA 3G1MA 3MKZA 1ACIA 5J1RA 4EQQA 3HG9A 4AVZA 4XICA 3GTKJ 1ZARA 5TISC 1IN4A 2HQ5A 4A3DJ 4XQFA 1XGNA 1X1BA 1V54H 3MZHA 2K9MA 5E3LA 2L4MA 2CSOA 4LFUA 2M45A 3KZYA 1TL8A 3KP5A 5M5WJ 4CGZA 1Z67A 3TL4X 1Y6IA 1XC5A 2MA3A 1R5ID 2HKXA 3CCYA 3ECOA 3SFZA 3GF2A 1DPUA 4U0WA 3MVPA 2I5UA 3ML6A 4KIBA 4ZDLA 2Q0OA 4II3A 2QWWA 2Y9YA 5CKTA 4ZYAA 3FISA 4A6DA 1RKWA 4A5NA 5TRDA 2FUG2 3KFWX 1SC7A 3LSJA 2K3PA 2QQAA 1HKQA 1F43A 2HGCA 2Y2ZA 3CESA 3WG7H 3EUHC 1KONA 4U7DA 2CS3A 2WV0A 2HOTA 5GP9A 3TOAA 3HYIA 4IOCF 3CMAI 4X1EA 2IVMA 2BY1A 1WVRA 1EF4A 3FHZA 3HGYA 2B7EA 4BE0A 1F4KA 3E6MA 5DCMA 2WV1A 2ZSHB 4F91B 4B48A 5F1RA 2XC7A 2ESHA 2IS6A 2JK3A 3A4CA 3R6SA 3BP8A 1UAAA 2L54A 1XSXA 5KK1A 1O3SA 4EM0B 5K7HA 1GLNA 3JAMZ 3PIOF 3I59A 3QOPA 3CUOA 3QPTA 4A93J 1QRYA 2HYGD 4A3IJ 4CYCA 2KZVA 2CGPA 4MFDA 4R8HA 1OMIA 3JTHA 2IS4A 2QEXI 4OMZA 3HRSA 2Z2SB 1ZR4A 1B9MA 1WGXA 2GXBA 5JVGF 3MN2A 3IH4A 5LRRA 3L00A 3K4BA 1KZHA 3UR3C 4WF2A 3IRRA 4B3XA 5LFAA 2WB1N 4BACA 2XPVA 4ESBA 1FYLA 2ZMEB 1XCVA 1G4DA 4G8XA 2C6YA 2AXLA 5D8KB 5D6EA 2OC6A 1WSUA 4LB5A 2DA5A 5D5WB 2YPRA 4IHYA 1PDNC 2WY8Q 4YRVA 1Y39A 3IUOA 1QO0D 4UB8C 4B09A 5IT3A 3RKQA 2LG4A 1MBHA 2VJ4A 5DUKA 4RAGA 2R7OA 2Q2EA 4KUMA 2OPTA 5HLTA 3CLQA 2N8GA 3FKIJ 2KQRA 3IL2A 3HOSA 1MW7A 5HNHA 1CF7B 4A3LJ 2WY7Q 1FSEA 2YU9J 3E7LA 1OCCH 6PAXA 3BZCA 3GFLA 3FWEA 4L18B 2A6EF 3OYEA 2ID6A 3NARA 2JA7J 5EGOA 4Y52J 3KLNA 1WI3A 2BXYA 4BJ6C 1B6AA 3HTSB 3HTUA 2VUMJ 2LTPA 3DXJF 3VYTB 1TP4A 1FBQA 1JJ6C 5CVUA 3CLOA 2ZC2A 3DBLB 3L09A 3J81K 4YEJA 1BC8C 1FEXA 2P5LC 4BDZA 4G7HF 4UV8A 4S05A 2JQ7A 2K4JA 1IAWA 5FD5A 4DW6A 2FD5A 4KIFA 2MBFA 2FBIA 4WX9A 3DV8A 1IN7A 5F0CA 3WHBA 2PMZN 2R3SA 3CUQA 4UB6C 1UHWA 2EV0A 3BQZA 5E17F 5DUIA 3B02A 4GGGA 1R36A 1D1CA 1G3TA 1Y0NA 2BOLA 2Z9OA 3HOZJ 4D0PA 2LSOA 1QNTA 3DEUA 5CVRA 3TGNA 3OMYA 4D5CA 3KCCA 3L7WA 1X19A 2NYXA 1SFXA 1A35A 1GXQA 2LOOA 3OYDA 2R93J 4L5EA 2R92J 2DQRA 4RAYA 1JTYA 2LVSA 1R1TA 1I6HJ 2K9NA 1ON1A 1H88C 2L2OA 1R6RA 2QVOA 1I3QJ 2JUCA 2VBWA 1RPWA 2Q8KA 1HCRA 3BG3A 2HVRA 1IDZA 4L9VA 4NC6A 3U9GA 4KT6A 4BBSJ 5JI6A 1HQCA 2K85A 3K2ZA 1QPMA 1JXSA 1BJAA 3SQNA 2Y0SA 2PJRA 4LK1F 2HR3A 2XF7A 3KIOA 1MBFA 4LK0F 1S9HA 1HDPA 3KE2A 3BTCA 3GEZA 2EFOA 3MFKA 3ZQQA 1BJZA 4MGRA 2ECCA 2FA5A 3V7SA 3G3ZA 4F52A 2VN2A 4XN3A 1P2FA 2ZNYA 5LEJA 3LAJA 1FOKA 2EZLA 4I02A 4IF4A 2A05A 3FMSA 5M5YJ 1FTTA 1TW3A 2PFBA 3FXKA 3KYCB 2AQFA 5IYBJ 2EIKH 2JN6A 5ICEA 5HS9A 1KQ0A 5E1ZB 1C0WA 2HFHA 5B3SH 4N4NB 4Z6YA 1FYMA 2KDOA 3MWMA 4C2UA 5K1YA 2ZJQF 1OJLA 2E7WA 2KFDA 1U0JA 2EV6A 4BJ5C 4LJZF 4XR6A 1Z7LA 2E1MC 4NQWA 1TLHB 3G4SI 2YX7A 3BROA 1JI8A 3FXJA 4ABZA 2L9RA 2RQPA 4IO9F 1BR2A 1Z05A 5HS7A 1SAUA 1YOVB 2DFIA 2HYFA 4JOMA 3PSFA 1LDDA 1XX5A 4JQFA 3OS2A 3GTGJ 1SVOA 2CU7A 2V6EA 2EINH 2W1OA 2LF7A 5LEKA 4UUVA 4HX7A 1BI1A 4A3KJ 4I01A 4EJVA 2QF7A 3QAHA 3NWTA 1IN5A 1DDNA 1J5YA 2G7HA 2MGQA 3K4MA 3GZ6A 1STZA 3GFMA 1ULYA 4L5JA 1EJ9A 5C4XJ 1R4MB 1Z77A 3S3NA 4XLPF 2M0CA 3ZQIA 5JVTA 4ON0A 3BR2A 4NDLA 1U2WA 2XDVA 3WU2C 5KHDA 5E3OA 1YE9A 2YX4A 2DA1A 1JHFA 1A5JA 2W4SA 3GYHX 4HV6A 3DLLF 3GTQJ 5L3GA 3E6CC 4MEYF 2DYSH 3IAS2 3ZMDA 5EZHA 3V8LA 2FF4A 1X3ZB 2JPBA 3C1DA 5HDNA 3CUQB 2VE8A 3H0DA 3OSFA 4ZTFA 2VJ5A 2VT2A 3A1YA 3RPUA 4L5IA 3F9KA 2XKPA 2DFFA 4H0EA 4PJJA 1W5TA 2OAZA 4HZFA 3BQYA 5J40A 4NHJA 1HSTA 2E5NA 3F21A 4BU2A 2JJ7A 1R1VA 1BI2A 1WJAA 2K9SA 3CJNA 1IV6A 3ELKA 5K7FA 3E97A 3P7NA 2ID3A 2L01A 1VQPI 2M5WA 1S7AA 5HDKA 2JMWA 3ZOBA 4M3EA 4H4KC 2PLYA 1AA7A 4HX4A 4NUBA 4ASNA 2EA2A 2UXXA 1YX3A 3F8NA 3PFYA 2D1HA 2E35A 3OIPA 1PYVA 4AIDA 3A2KA 4PJNA 3CP2A 1N78A 4NC7A 2KKOA 4EATA 3F6VA 4IEJA 2R7WA 1B59A 5E8GA 1MJAA 1KQ9A 4XKCA 3WTZA 3D5SC 1NH3A 3TEDA 2XGDA 5D5XB 1HKSA 3S2HJ 2VQLA 3MZYA 2H8WA 4ZTJA 4I99C 1HOMA 1FIPA 3BCBA 3G71I 1Y1WJ 4AIHA 2EILH 3LSTA 2F6CA 3LSIA 3WG9A 4UUSA 2E2IJ 5KNLA 4EV0A 2E1MB 5BPIA 5FGMA 3J80Z 3PFIA 4A3BJ 1DPRA 2R5ZB 1YW7A 1IXSB 2M8EA 4RS8A 4RBOA 1R7JA 1VQNI 2V9KA 5CYVA 1AU7A 2A3SA 2DYRH 2W82A 3S15J 4CHUA 3P9KA 2DDBA 4XLCA 3VFZA 1XD7A 2RC4A 4HNUA 4ZDOA 3K69A 3M07A 3TDZC 2DMTA 4ITVA 3WODF 1DUXC 3SYTA 2A68F 4F7ZA 1S7OA 3Q9VA 3OYIA 2VODA 3FXOA 1E3OC 4E6KG 3E1SA 4XKBA 1YW8A 4BQAA 1P7JA 2OTLI 2V1NA 1DQUA 4DYRA 3COAC 2CH0A 2LLKA 2HVSA 1HA8A 2VKHA 2HOAA 3LAPA 4EGZA 4M6VA 2LREA 2P8TA 2WAQN 1VQOI 1T56A 2P81A 1LEAA 1RZ4A 2LKSA 1O3RA 2IGNA 4C9YA 1WZ2A 2HZTA 4LLGF 2Z99A 2K7LA 3MZ8A 2X1DA 1K7AA 1BA5A 4S04A 1JUMA 1BOBA 3DU6A 3ZMUA 4P55A 4PSWA 4WWCA 4GO1A 2BYVE 4FT8A 3IHUA 4JBAA 3GFJA 3I4PA 2VXDA 3PUFA 4ZJZA 4KYWA 2CW8A 4B43A 1MDMB 2D5VA 1YG2A 5J8CA 3JRIA 3BTLA 3SZTA 2R7RA 3JRFA 1W7PD 2R5YB 3RI4A 1W5SA 2R7XA 3BCAA 3TOBA 3GX4X 1JUSA 2XB5A 4W1UA 3FZVA 3U1DA 1QZYA 1U5TB 2LKXA 4U0YA 5CQGA 5E8IA 1R9TJ 1S8NA 3S3MA 1FOYA 5DS9A 1X3UA 4BDYA 2ACJA 3HM5A 4BL0B 2B0LA 4UV9A 2R7QA 1KA8A 3N05A 3WTYC 3S16J 2O5RA 1QQIA 1FIAA 2HXIA 2JA5J 1G3SA 2WBMA 1TNSA 5HVQC 4MFEA 2XAUA 2QQBA 3CQZJ 4G9YA 3PUBA 3D0SA 3WTUC 1POGA 3Q0UA 1ZG1A 4B3AA 3W3CA 2E2JJ 2KLOA 1IZ1A 2HWVA 2EIJH 3K4CA 4YIRX 4EJUA 1MNDA 4L9TA 3GWZA 5K5QA 3HOYJ 3I71A 2Q2EB 2EZHA 3OL3A 3AFHA 1TT5B 5LHHA 2DOFA 3KX2A 2ZBKA 4CDGA 4KFCA 1OLTA 1IN6A 5FO5A 1WJEA 1W5CC 4G12A 3IKVA 4HQMA 1I50J 2CRGA 2X4HA 2WAFA 3O6BB 4GRIA 4CCJA 4YELA 1FBSA 1IGNA 3VWBA 2F2EA 2MD5A 4MQ9F 3ZGKA 1ZRCA 4AYBA 1VZ0A 1Z91A 3M1CA 2E1NA 4BE2A 4HLYA 3CC7I 3EUKL 4LG3A 4BH9A 2BHYA 2Z5UA 3JRBA 3FM3A 3DP7A 5ICCA 4O3MA 3RSNA 3BR6A 4EVIA 5LD2C 1P6RA 1JKPC 1YW9A 3EQLF 1ONVA 3BG7A 1N77A 4FCYA 1X2NA 4KA4A 4FTHA 1XDUA 1OYIA 1T98A 2JSCA 4BHBA 1IRFA 2FOKA 3FXRA 1R5HA 2CUEA 1UJ8A 5DD4A 1HW5A 2X6YA 5DYMA 1XMXA 3VB2A 1CQTA 4AM3A 1OQYA 2K9QA 4BS9A 3DEWA 4OINF 3FKJA 1B8IA 4R79A 1J59A 1USTA 2BY3A 1XSVA 2EV5A 2DJIA 2DK5A 4RA2A 4NC8A 4UXNA 5AIQA 2R7ZJ 3V8JA 2BVLA 3AG4H 2DFHA 2KL4A 3H0GJ 2MH2A 1S29A 3RZDJ 2ZO4A 4BY7J 3CDHA 2RNJA 2Y0MA 3TMOA 2F4IA 1T39A 3SEQA 3TW6A 1YFHA 1ENHA 1RESA 2PJPA 3KEYA 5ERIA 1YTYA 1FP1D 3QYFA 3WU0A 3VYRB 2R7TA 4PGGA 2I8DA 3BLYA 3T8TA 1S7EA 2BY2A 3F23A 1FWZA 1X3WB 3CCUI 1U8BA 3LSPA 2K4BA 4ESJA 1OYWA 2A6TA 1EH6A 1QZEA 3F3XA 4ZYHA 2KISA 2PJRB 1X1DA 1SVLA 2JPCA 2ZXJA 1QHHD 2CQ7A 1YIOA 1Z1DA 2X1CA 1HSJA 1FMVA 3JCUC 4XRSA 2F5VA 4BEHA 4UUSB 4L0YB 4K2EA 2BXZA 1FC3A 1LVAA 3LSKA 4C3HJ 5J47A 1GHCA 5F27A 5L3CA 1LPQA 2KP6A 4PJMA 3ZQLA 1AKHA 1ETVA 2QUFA 1WQ2A 2E36A 2XPUA 5FLVA 3GW2A 3M8EA 3BJ6A 3WTTC 3ZCOA 3GFIA 2CFOA 3S1MJ 2VQGA 2IT0A 1T33A 4UNOA 3V8KA 2P6TA 2CJJA 3SDGA 2EZIA 1W7PA 2LR8A 4KICA 3TQNA 1W36C 2DT7B 3BPXA 1RI7A 1Z7UA 1OKRA 4CO8A 4GCVA 4MLOA 2W00A 2NNNA 5IOZA 2BEOA 3OL4A 2IS1A 3M8JA 1KU2A 1YJNI 3HOTA 2DO7A 3IWFA 2ME0A 4GFBA 5DV5A 5DM7F 4BHCA 2BHZA 4BKXA 2R7SA 1FT9A 2W25A 4ETSA 3ESWB 2XPWA 4UHTA 5FLXK 5IYDJ 4BXFA 2L9VA 3VOEA 2L7MP 1RKTA 3G73A 1I27A 2FBHA 4E7ZA
chains in the Genus database with same CATH topology
4NQWB 2L2OA 1R6RA 3DWLE 4XOTA 2LH9A 5FROA 4RM2A 2HVRA 2GOMA 3H5NA 4E7IA 4KT6A 4Y4RA 3OYHA 4N4OB 4RMNA 1UG0A 2Z16A 1WFXA 4KISA 2ZSIB 3L2VA 2Y0SA 4CCLA 2PJRA 3PNVA 1P9QC 4KITB 2WB1A 2UUZA 2XF7A 4E7KA 1S9HA 2DOAA 1MMDA 2BVMA 3ZQQA 3K4NA 1Z21A 4D9JA 4F52A 1E0EA 2XF6A 4XN3A 3FBNB 2LY1A 2RNGA 3DU5A 4Y33A 3CMMA 2CUJA 4DBRA 1D0XA 3I9V2 3OYCA 1N75A 2AQFA 3HPGA 1D0ZA 1D1AA 4PSXA 4N4NB 3CZ6A 2KDOA 4C2UA 3L2RA 2MD0A 2VJJA 3HKZA 4II2A 4BQQA 2UWMA 3OS0A 4PK4A 1U0JA 4BJ5C 4F92B 4J00A 2R7UA 4XR6A 2VQHA 1Z7LA 2E1MC 1MMNA 2M0MA 2XF5A 3DKYA 4U7BA 5CQEA 3E0JB 1JI8A 2DXIA 2IXSA 1NG7A 3CF2A 1BR2A 2M7BA 2CV1A 1SAUA 4HSTA 2GOXB 2IGMA 2X1EA 4JOMA 2HDWA 3PSFA 3OYMA 4JQFA 3OS2A 3S8PA 4CUGA 2V6EA 3SDBA 4DGWB 2W1OA 5JHFA 1BR4A 1X4OA 1QU3A 1MMGA 2L9SA 4CCMA 2L5QA 2VQCA 3NWTA 4ANJA 3OR1C 3PSIA 3K4MA 2VPLA 4E7LA 2JA2A 4LIUA 3VDXA 2VLAA 2L7KA 4IX7A 3S3NA 5CPRB 2WAEA 1ERDA 4RM3A 2XDVA 2CUZA 5KHDA 4U87A 2MC4A 1T0FC 1YE9A 2E60A 2W4SA 3IAS2 2E5ZA 1LDKB 2XSJC 3H0DA 3OOUA 3H5RA 3AKZA 4ZTFA 2VJ5A 2HPMA 3A1YA 3BC8A 1IRXA 3F9KA 4OAZA 3OYBA 2M7AA 1D0YA 2PMZA 1DGRM 4PJJA 3ZR8X 2E5NA 4OWRB 4BU2A 2VASA 3OS1A 4BQOA 3L2WA 1WJAA 3LMMA 3S93A 2V7FA 3S32A 4DJAA 4NNJA 3LSMA 3PL8A 3DQVC 3OYKA 4H4KC 1AA7A 1WJBA 4NUBA 2R4GA 1YX3A 2QKMB 4LIVA 3SZGA 3H35A 4PJLA 3PFYA 3OIPA 2A5WA 2DCEA 1YX5A 2KHMA 3MKYB 1PYVA 3A2KA 4PJNA 3CP2A 1N78A 2VJIA 4NC7A 5FRNA 3L2QA 4EATA 2R7WA 1NG6A 3VSKA 2QKLB 3OY9A 4IZZA 2JSPA 4XKCA 4FASD 3D5SC 3IAM2 1J09A 4C2TA 3K70C 2VQLA 1W36D 4ZTJA 2W7NA 3DKXA 3BCBA 2LY2A 2F6CA 4BGDA 4CCKA 1WJCA 1TT0A 2VKDA 3LSIA 5KNLA 3MD2A 2E1MB 3LSHA 2HNHA 4CCNA 4DOZA 1G8XA 3OYLA 3CP8A 4C30A 5HNFA 4B47A 3V42A 3VYSB 3OYJA 4B44A 3KYLA 3LL7A 2WA0A 2V9KA 4BE1A 4E7JA 2BW3B 2IGKA 4CSWA 3CJRB 1MNEA 2AQEA 4PFPA 3HPHA 1WJFA 4FETA 2W82A 1SFKA 4CH7A 3RTRA 2MYSA 3QODA 3EUAA 4XLCA 4D1QA 1EA3A 2HZDA 4ZDOA 4HNUA 1G59A 4RLFA 4ITVA 3C2GA 2VL8A 3SYTA 3OYIA 2MABA 3H9QA 3E1SA 4E6KG 4XKBA 3FHNA 3DPUA 3RCOA 3K4JA 2V1NA 1DQUA 2X6XA 4ZDPA 1PJRA 2RQQA 2CH0A 2WAQA 2HVSA 2OV7A 2X85A 2VKHA 1HA8A 3H9JA 2HQAA 2LREA 4XOPA 2IGNA 3DTKA 4C9YA 4F55A 1DP3A 1X1AA 4PUSA 2VIXA 2LRDA 1OR7C 2X1DA 2ELJA 3ZXSA 2CMPA 1DGWY 3BG6A 4KJZA 3IP4B 1BOBA 3DU6A 3HUGB 2JVGA 4XORA 4PSWA 3H9GA 4HEA2 1LVKA 3MMYB 3GBGA 5TGTA 3OYGA 1MMAA 4XKWA 5FRMA 2V26A 2VXDA 4ZJZA 1Y56A 2CW8A 4B43A 4E4HA 2KMUA 4BUPA 2OUMA 2JVHA 2ZXIA 3W2WA 3AL0B 4BEHB 2R7RA 3L2UA 4XONA 4XM3A 2R7VA 4P1WA 2K9LA 2R7XA 3D5RC 3BCAA 4HG2A 4HPQA 3DPLC 2LYCA 3K4LA 4IQJA 2KRCA 3OYFA 2V4JC 4X0GA 3K6GA 4CZCA 5CQGA 4RLQA 1QHGA 3DEEA 3QYEA 3RQ4A 3MKZA 3OR2C 3HG9A 1LFPA 4AVZA 3S3MA 2LBFA 4OAYA 4XQFA 2M4KA 4BDYA 1X1BA 4BL0B 2K9MA 2R7QA 3N05A 4XKVA 4XLFA 3RPUD 2O5RA 4XL9A 2NOJB 4CCOA 3TL4X 1Y6IA 1WJDA 2WBMA 3VSLA 3HL2A 5HVQC 3MKWB 2XAUA 2Z1DA 3PNYA 3PUBA 4ZDLA 4II3A 4P5OA 5CKTA 4ZYAA 3LSGA 3W3CA 3CJQB 2KLOA 2FUG2 4F3QA 4F93B 3K4CA 2K3PA 3FBIB 3W2AA 1MNDA 2UV1A 3PNTA 1Z3YA 2HPIA 2Q2EB 4BQNA 3CESA 3OL3A 3UNGC 4DBQA 3AFHA 3EUHC 1KONA 3W2VA 3KX2A 2Q1ZB 4BJTA 2M3AA 1OLTA 3EPZA 2CS3A 1WJEA 2LBFB 2WAFA 4GRIA 4CCJA 1ZELA 4YELA 2IGOA 1BR1A 3VWBA 2VXZA 4HSRA 4BE0A 1T95A 3ZGKA 4AYBA 2ZFUA 1VZ0A 2ZSHB 4F91B 2BW3A 4B48A 1Z3XA 4ZC3A 3M1CA 2XC7A 4BE2A 2IS6A 3A4CA 3OYNA 2L9NA 3EUKL 4LG3A 1UAAA 1GLNA 3RSNA 1K6YA 2P0WA 1X1CA 1TZLA 2RREA 5LD2C 3J7AY 3BG7A 1N77A 2X51A 1UELB 2K5CA 2KZVA 4G6TB 4XLEA 4HRIA 2IS4A 3OWTA 4XLHA 3LFUA 2Z2SB 3QYBA 4AU7A 2X6YA 4Y3OA 2X6WA 3K4BA 3UR3C 4BS9A 4B3XA 5LFAA 4BACA 3FKJA 4R79A 1WJ5A 4J01A 2MFZA 2JUGA 2DJIA 2CV0A 1FMWA 3K4KA 4NC8A 3PJRA 2BVLA 2OC6A 2KL4A 1V5GA 2DT6A 3DLAA 4XLAA 1V5EA 2F4IA 3TMOA 2KRHA 2WY8Q 3SEQA 4YRVA 3IUOA 3D5LA 3KEYA 4DIQA 2LG4A 1X4PA 2HVQA 3QYFA 2VJ4A 4PFOA 3VYRB 3VYUB 3OYAA 2R7OA 2R7TA 2I8DA 3BLYA 3G2BA 3DTIA 5HLTA 3DTEA 2KQRA 4IKFA 4E7SA 3HOSA 1MW7A 5HNHA 2A6TA 3HXLA 2ZXHA 1X1DA 3I3LA 2WY7Q 2LC2A 2PJRB 1QHHD 2X1CA 3HC7A 1FMVA 2F5VA 4BEHA 3LSKA 3OYEA 5HOOA 2CW7A 4LITA 2KP6A 4QPOA 4PJMA 4BJ6C 4CA0A 2CV2A 3ONQA 2M4GA 3VYTB 1V5FA 3QOEA 2KPMA 3ZCOA 4YEJA 2CFOA 3SEZA 2VQGA 4XNFA 2VB6A 4BDZA 4HNTA 3K10A 3H5AA 1W36C 2DT7B 3K70D 3NWSA 3TBIA 4MLOA 2WADA 2W00A 4XN0A 3U21A 3FDYA 3OL4A 2IS1A 3OIQA 3M8JA 1D1CA 4XMYA 2BOLA 3HOTA 3S3OA 1LKXA 3DPTA 5KCMA 4IQ4A 3AL0C 2R7SA 3OMYA 1X19A 3ZRGA 1D1BA 3C2HA 4BXFA 2HU9A 2LOOA 3OYDA 2IS2A 4E7HA 4QPQA 4E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOD A;  3QOE A;  4YRV A;  4J00 A;  4HRI A;  4IZZ A;  4J01 A; 
#chains in the Genus database with same CATH topology
 1OIS A;  1FOX A;  2J5P A;  4XOT A;  4KN7 X;  3IRQ A;  3GTO J;  1R5G A;  1S6L A;  2GOM A;  3F0C A;  4M73 A;  3SFI A;  3ASN H;  1OCZ H;  3HRU A;  2QM3 A;  3OYH A;  1ZG5 A;  1ZR2 A;  4N4O B;  3JW4 A;  1UG0 A;  4AYB N;  3RQI A;  4KIS A;  3IH2 A;  2FNP A;  1HBX G;  2ZSI B;  2L7Z A;  4LMY A;  4YFK F;  1E3H A;  2WB1 A;  2V1X A;  4A3J J;  1VQ7 I;  4E7K A;  1EV7 A;  2DOA A;  1RRJ A;  1OCO H;  2BVM A;  4OIQ F;  2ECB A;  2DMQ A;  3F22 A;  5DCF A;  3M1E A;  3KP7 A;  1X58 A;  3BR1 A;  4GYI A;  5BQT A;  3FBN B;  3DU5 A;  2NXN B;  4A3F J;  2KRF A;  1FJL A;  3ZPL A;  1BOA A;  4DBR A;  3EUH A;  3Q0W A;  4HNV A;  4XID A;  4LLN A;  3OYC A;  1Y8R B;  3ZQ7 A;  1LEB A;  2JT1 A;  1T08 B;  2DA3 A;  1N75 A;  5BMZ A;  2VBY A;  3QP5 A;  3HPG A;  1WPK A;  1D0Z A;  2XGX A;  5E18 F;  1YI2 I;  1VFC A;  2O9L A;  1TW2 A;  2OD5 A;  1A36 A;  3CTA A;  5FKO A;  3CZ6 A;  2VJJ A;  3HKZ A;  4II2 A;  4BQQ A;  3OS0 A;  3LA3 A;  3GVA A;  1MZB A;  4WXH A;  1HDD C;  4PK4 A;  1P7I A;  2QBY A;  2R7U A;  2M0M A;  5B5E C;  3LFK A;  2DTZ A;  3HB9 A;  1K61 A;  3HOU J;  1LJ9 A;  4M3D A;  2IGM A;  2QSH X;  1OPC A;  2DOE A;  1IRZ A;  3I4M J;  1MD0 A;  4G6Q A;  2QBY B;  1GT0 C;  3S8P A;  4CUG A;  2QSF X;  1BI0 A;  5JFR A;  1X4O A;  2L9S A;  2L5Q A;  2H1K A;  1W0U A;  3G6E I;  4AIJ A;  4E7L A;  3BJO A;  4LIU A;  1E17 A;  1FSH A;  2NVX J;  2ETH A;  5DEQ A;  3BZ6 A;  1NTC A;  3S1N J;  4LD5 A;  3ZQF A;  1ERD A;  1A6Q A;  3Q9S A;  2D1V A;  4LGW A;  1QBJ A;  5EG0 A;  1T0F C;  1SD4 A;  2E60 A;  2PQ8 A;  3A0H C;  5F0H A;  2XGC A;  3O3K A;  1UMQ A;  4OOI A;  1YS6 A;  2Y69 H;  4RDU A;  1ZRE A;  2MSY A;  3HKZ N;  4PJ0 C;  2H8R A;  3OOU A;  3H5R A;  1U78 A;  3ZP5 A;  3CCM I;  3QRF F;  4BHP A;  2DN0 A;  2PX9 A;  5H2F C;  4AWX B;  1I1S A;  2L0K A;  2TCT A;  3S2D J;  4D7N A;  5JHU A;  3O2P E;  3KP2 A;  5GAH J;  4OIO F;  3OS1 A;  5EEG A;  2V7F A;  3WU1 B;  2FXA A;  2NRA C;  4M9S A;  2O61 A;  3FXL A;  3HGG A;  4RAF A;  5K7Z A;  1AWC A;  5L3E A;  3LSM A;  4RGU A;  3JSP A;  2FJ1 A;  1BC7 C;  5IT9 K;  2HDD A;  3E6D A;  5GAE J;  2ZFW A;  3GTL J;  3RZO J;  4LIV A;  2RGV A;  3B6A A;  3H35 A;  1H89 C;  3ABU A;  1I3A A;  2DCE A;  3BOQ A;  1YX5 A;  2KHM A;  4M74 A;  4R1H A;  2K40 A;  1NK2 P;  2OQG A;  2W85 A;  3ZMS A;  1W7P B;  2YS9 A;  1BN5 A;  3C7J A;  1MBJ A;  2CO5 A;  3VSK A;  3KP6 A;  1TQI A;  4HAM A;  3OY9 A;  4FAS D;  5KAI C;  1I39 A;  3BG5 A;  3HIF A;  3IAM 2;  1IRG A;  1MSF C;  5LHG A;  3K70 C;  3I53 A;  4QTR A;  2O3F A;  1I1G A;  1K78 A;  3JTG A;  4G6D A;  4IXA A;  2GA1 A;  5DTD A;  4BGD A;  4CCK A;  1WJC A;  1TT0 A;  4HBL A;  1FZP B;  2FQ3 A;  3MD2 A;  2A6H F;  1G2H A;  2HNH A;  4CCN A;  5FFX A;  4S0H B;  5GAG J;  2E7X A;  5EGO B;  3OYL A;  1U9O A;  5HNF A;  2QZ8 A;  2VON A;  2IW5 A;  3OYJ A;  1CGP A;  5CLS A;  1IO2 A;  2WA0 A;  4HV5 A;  3I4N J;  1VI0 A;  4E7J A;  2BW3 B;  2M9H A;  2ZXW H;  2Z3Y A;  2NNY A;  1T2K A;  1PP8 F;  4OMY A;  1MNE A;  2AQE A;  2BZT A;  2P7V B;  4PFP A;  1FX7 A;  4FET A;  5AON A;  1SFK A;  1XMK A;  2EPF A;  2PBI A;  5J1U A;  2MYS A;  3WGI A;  1EA3 A;  2HZD A;  3J7A O;  1U5T C;  3CC4 I;  4RLF A;  5J6X A;  1ZAO A;  4RGS A;  3N97 A;  3EDP A;  2ICW G;  2GZW A;  3NQO A;  2L4A A;  3EYI A;  1SFO J;  4EGY A;  4V19 K;  3REO A;  1KYZ A;  4HYE A;  4L9N A;  1OCR H;  3MQ0 A;  3CCQ I;  1O4X A;  4JYK A;  1PJR A;  2FQ4 A;  2RQQ A;  2XIG A;  1IXR C;  2BV6 A;  4IOA F;  2OCE A;  2HQA A;  4QWQ A;  3GTM J;  4MHG A;  5ICG A;  1OCP A;  3DTK A;  4PUS A;  2VIX A;  1LE8 A;  2EQR A;  3A02 A;  3I64 A;  4OIR F;  1ZGJ A;  2CMP A;  2X48 A;  3NEU A;  3ZXS A;  4A3G J;  3PIP F;  3AG3 H;  1P4A A;  2FMY A;  3BG6 A;  4KJZ A;  3IP4 B;  3HJE A;  4FX0 A;  5HOD A;  1E3P A;  2O7O A;  1HKT A;  4XOR A;  3TO6 A;  2HEO A;  1P4W A;  3H9G A;  3IV5 A;  2P4W A;  3GBG A;  2V79 A;  5TGT A;  2XAS A;  4V2F A;  3JRD A;  2V26 A;  3P9I A;  1WKM A;  2NOG A;  4DZJ A;  4E4H A;  2HQR A;  2KMU A;  2OUM A;  4JX6 A;  4BUP A;  1RUN A;  5F08 A;  2JVH A;  2ZXI A;  1JTX A;  3JRG A;  3AL0 B;  1O3Q A;  2YR2 A;  1ORK A;  2VOP A;  1SAN A;  4BNC A;  1SD6 A;  1WCM J;  4M6X A;  2KJC A;  3D5R C;  3ZMV A;  4AUX A;  4Y13 A;  2OJE D;  2KRC A;  4RLQ A;  1QHG A;  3DEE A;  3RQ4 A;  2HDC A;  3OR2 C;  2DLL A;  4FX4 A;  2LBF A;  1QVT A;  4Y15 A;  4OAY A;  5IYC J;  4XLF A;  5J4V A;  4XL9 A;  3VPR A;  4CCO A;  1JKQ C;  1WJD A;  1HC8 A;  3VSL A;  1MKM A;  3MKW B;  4ZYG A;  1BW5 A;  2KIM A;  5M5X J;  4I2O A;  3PNY A;  2AS5 F;  2AO9 A;  1FLI A;  4P5O A;  5J1Y A;  2ZME C;  1S72 I;  3ULQ B;  3M7G A;  2COB A;  1VQ5 I;  3F8C A;  4F3Q A;  3IC7 A;  4F93 B;  3FBI B;  2LY9 A;  4ZZD A;  2HPI A;  1O7F A;  1SFE A;  4BQN A;  3UNG C;  4DBQ A;  3HOV J;  3T1B A;  1J9I A;  2GIV A;  4BJT A;  2M3A A;  3EPZ A;  4PCQ A;  2LBF B;  1L0O C;  2XAF A;  4O5V A;  5EYR A;  2FNA A;  2IGO A;  1BR1 A;  3JRE A;  3VEP A;  3TW7 A;  1ODD A;  4HSR A;  1NHA A;  1QA6 A;  4TV7 A;  1T95 A;  1XGS A;  3R0J A;  2XRN A;  4XLN F;  2BW3 A;  5FKM A;  5FD6 A;  3M3Y J;  3OYN A;  4CXF A;  1DU0 A;  3BR3 A;  4M6Y A;  3A01 A;  4IHT A;  1ETQ A;  3WGH A;  1ZKG A;  2P0W A;  5B1A H;  1TZL A;  2DA2 A;  3DCF A;  1IF1 A;  3J7A Y;  2IA1 A;  5LGN A;  1UEL B;  2X51 A;  4IL6 C;  3HUG A;  3I55 I;  5FFZ A;  2DOD A;  4W97 A;  2OTJ I;  1K83 J;  4G6T B;  4XLE A;  2E2H J;  1RR8 C;  2LF8 A;  3FK6 A;  1FTZ A;  1IDY A;  4XLH A;  4WXC A;  3GTP J;  3LFU A;  3MCZ A;  4QSH A;  4AU7 A;  1HW2 A;  1YRN A;  4HDU A;  2F5D A;  4UVC A;  4I7H A;  3S1R J;  4XSZ F;  3TP3 A;  1WRJ A;  3S17 J;  3AG2 H;  2LP0 A;  2QGU A;  1ZLJ A;  3WTW C;  5B1B H;  2JUG A;  1KU3 A;  1XGO A;  1TQP A;  3K4K A;  3GO5 A;  3IKT A;  2VC0 A;  2DT6 A;  3DLA A;  5FLM J;  4XLA A;  1V5E A;  3V7R A;  2EK5 A;  2KRH A;  1YHQ I;  2M8G X;  1MMS A;  3HRT A;  3IH3 A;  1SEU A;  2CWE A;  3D5L A;  1ITY A;  3I0T A;  5IP7 J;  3VYU B;  2HVQ A;  4PFO A;  3KET A;  3CCE I;  3M8F A;  3G2B A;  3SZP A;  5J3L A;  3RDI A;  2DA7 A;  4IKF A;  1N25 A;  5ICF A;  3KLO A;  1V3F A;  2NVY J;  3SJM A;  3HXL A;  2LC2 A;  2XAG A;  4MTE A;  1ZTR A;  1T38 A;  4Q5S F;  2IBD A;  4XRM A;  1XTA A;  4N9H A;  1B8I B;  1K6O A;  3RIR A;  4XBF A;  5HOO A;  2CW7 A;  2JA8 J;  4LIT A;  3HSE A;  4B1R A;  2M4G A;  4IPA A;  2EFN A;  1H9G A;  1V5F A;  4RB2 C;  2L02 A;  4P96 A;  3AAF A;  1JT6 A;  2XRL A;  3W6K B;  1ZQ3 P;  1W4M A;  4XNF A;  4LB6 B;  2VB6 A;  3QWL A;  4M71 A;  4HNT A;  3E5X A;  3H5A A;  3K10 A;  5FLX Z;  1IJW C;  4B8X A;  2GAU A;  2PEX A;  2V6C A;  3CJT B;  2DFE A;  1GV5 A;  3FX3 A;  2KIQ A;  3K70 D;  1MJ9 A;  1LUJ B;  1T0F A;  4IJA A;  3NWS A;  4D5F A;  3TBI A;  3U21 A;  2ZB9 A;  2HOS A;  2NVT J;  3F8F A;  1F9N A;  2AXT C;  3GLX A;  3ISP A;  1FYK A;  2CUF A;  4XMY A;  5D4R A;  3JRA A;  5HLG A;  1U3E M;  4IQ4 A;  2ZJP F;  1ZK8 A;  1YJ9 I;  4ENM A;  3ZMT A;  1FNN A;  3WE3 A;  2XAQ A;  2DAO A;  3CCR I;  1B72 B;  3QP6 A;  2MLK A;  1D1B A;  5J8F A;  2DPD A;  2JRT A;  2HU9 A;  1AKH B;  2IS2 A;  4RGR A;  3H92 A;  2VC1 A;  1S3J A;  4ZYD A;  4QPQ A;  2STW A;  1ZN2 A;  2MC3 A;  3BY6 A;  3K7A J;  4RM2 A;  4M3F A;  1DU6 A;  3RKY A;  2W84 A;  2QEN A;  3H5N A;  4E7I A;  2NS8 A;  4Y4R A;  3BPV A;  1LFB A;  2M30 A;  1XDS A;  3CDI A;  1OR7 A;  4BY1 J;  2PG4 A;  1R22 A;  4EM1 A;  3M9A A;  2NS0 A;  2P7C B;  3K1P A;  3L2V A;  3V4G A;  4CCL A;  3ERM A;  4CZZ A;  3FXU A;  2OU2 A;  3JAM K;  5D8L B;  1IXC A;  1LNW A;  5CVI A;  4NB5 A;  4C2M J;  1K78 B;  1MMD A;  1YLF A;  2PI0 A;  3K0L A;  4PDK A;  3K4N A;  1R58 A;  1RNL A;  4FHT A;  2E1O A;  4D9J A;  2KT0 A;  1ZGW A;  2M87 A;  2K86 A;  4Q47 A;  1XSD A;  2CQX A;  1Q1V A;  1SVM A;  2LY1 A;  4Y33 A;  1MH4 A;  2JA6 J;  1P4X A;  1BL0 A;  4QLC U;  1D0X A;  3I9V 2;  3CUQ C;  4FE7 A;  1EH8 A;  2A61 A;  1FPQ A;  1XS9 A;  3QU3 A;  4RGX A;  4I6Z A;  2PN6 A;  3PO3 J;  4DYC A;  4RB1 A;  4A0Y A;  1MSE C;  4PSX A;  1MGT A;  1WH7 A;  5HLI A;  5EF6 A;  1L3L A;  2DBB A;  5IT9 Z;  3L2R A;  2MD0 A;  4Q48 A;  1KU9 A;  4UUT A;  3K9T A;  1APL C;  1MJB A;  4F92 B;  4XSX F;  1SAX A;  2VQH A;  2XF5 A;  1MMN A;  1U8R A;  5H6Q A;  3SHF A;  2UXN A;  2IRF G;  4EJT A;  1NG7 A;  3CF2 A;  2M7B A;  2JRM A;  3JR9 A;  3R0A A;  2GOX B;  4C3J J;  3QPH A;  2FU4 A;  4EEF G;  2COM A;  4AD9 A;  3WTS C;  5K5R A;  3O8G A;  1W1W E;  3SDB A;  5JHF A;  4WK8 F;  1QU3 A;  1Z9C A;  4CCM A;  5EJC A;  2F5C A;  4LG0 A;  5L3F A;  2OF7 A;  1VQ6 I;  3PSI A;  5EZG A;  4V2G A;  3I58 A;  1KYW A;  3BR5 A;  2JA2 A;  2YU3 A;  3PQK A;  2D45 A;  2EIM H;  2VLA A;  1IW7 F;  2P5V A;  2FRH A;  5CPR B;  2KZG A;  1M1E B;  4A0X A;  1GXP A;  1RR7 A;  3TDU C;  2IJL A;  2BBY A;  1K4S A;  1U5T A;  2OZU A;  2RV8 A;  2F5F A;  3TKY A;  2MC4 A;  5FJ8 J;  2IPQ X;  1F5T A;  4Q4Z F;  2TRT A;  3E5Q A;  3JRH A;  2O03 A;  2VOO A;  4J19 A;  4M9X A;  2E5Z A;  3J7Y J;  2OBP A;  1LDK B;  1I5Z A;  3I56 I;  3ASO H;  2O8X A;  2XSJ C;  2DA4 A;  2XV4 S;  1OFC X;  2HPM A;  2DPU A;  3ECH A;  4Y7N J;  3GME A;  1IRX A;  2XGE A;  4OAZ A;  3KYD B;  2NVU B;  1TWA J;  5IP9 J;  2DMU A;  1BBY A;  4IRG A;  4XK4 A;  5DD8 A;  4HDV A;  5DM6 F;  2Y48 A;  1MBK A;  4RB3 C;  1GV2 A;  4OWR B;  1TTY A;  2VAS A;  4BXX J;  3C2B A;  3R61 A;  1XGM A;  4CYC B;  1ETK A;  1E2X A;  3HHH A;  3LMM A;  3PM1 A;  1O7L A;  2DW4 A;  3B73 A;  5M3M J;  4HLX A;  3S32 A;  4YG2 F;  4DYQ A;  3J80 K;  1TC3 C;  3LQQ A;  1H8A C;  4NNJ A;  5D6F A;  2PMH A;  3DQV C;  3NRV A;  1BI3 A;  1PUE E;  3OYK A;  1Y8Q B;  3UKG A;  3BDD A;  2R4G A;  2ZJR F;  2QKM B;  1WH5 A;  3QPL A;  5KAF C;  2DJN A;  5J4Y A;  1VQM I;  4PJL A;  5CJ9 A;  4I98 B;  2VJI A;  5FRN A;  3L2Q A;  4YII A;  1NG6 A;  2KDZ A;  5L3B A;  2KIF A;  2QKL B;  2JSP A;  5FKL A;  2GM4 A;  1J09 A;  4Z2Y A;  4A69 C;  3LSR A;  1W36 D;  2A5Y B;  3T0Y A;  3WTX C;  3K1M A;  2DI3 A;  4OU0 A;  4IVN A;  1RC9 A;  2OCC H;  1HLV A;  1SFU A;  1RET A;  5JLX A;  1J75 A;  1R1U A;  4I0B A;  1V4R A;  2EH3 A;  4I76 A;  2XKO A;  1G8X A;  1MBG A;  1B1B A;  1ETW A;  3TO7 A;  4B47 A;  3V42 A;  3VYS B;  3KYL A;  3LL7 A;  1ZRD A;  1IUF A;  2ISY A;  4BE1 A;  3ZQH A;  1HW1 A;  2IGK A;  4CSW A;  1XN7 A;  3Q0V A;  2VBX A;  1WJF A;  3HPH A;  4KT5 C;  2BE5 F;  1V55 H;  1A6I A;  4CH7 A;  2M2E A;  4UY8 I;  3QOD A;  4UVB A;  4D1Q A;  1WHU A;  1RUO A;  1UCR A;  3DKW A;  1ETY A;  1G59 A;  1Y1V J;  4PGH A;  2LKP A;  4ENJ A;  2FOW A;  2VL8 A;  4MQV A;  3KP4 A;  4MNU A;  2DQL A;  2ISZ A;  3X2Q H;  2H94 A;  3QU6 A;  2R5Y A;  2LDU A;  1B72 A;  3DPU A;  3RCO A;  1Q1H A;  3H3U A;  2V1U A;  3N4M A;  1O57 A;  3HEF A;  1T8I A;  5GPA A;  1D3Y A;  1A04 A;  2OV7 A;  3FM5 A;  2Y9Z A;  2CFX A;  1ZGA A;  5IY5 H;  4XOP A;  1LDJ A;  3NAU A;  5BOX A;  1QGP A;  1DP3 A;  5LHI A;  3CO7 C;  3A0B C;  2ELJ A;  1WI9 A;  4BYY A;  3R4K A;  3BG9 A;  3AG1 H;  5AIP A;  1DGW Y;  4G94 A;  4AVP A;  2DTR A;  5E20 A;  2I10 A;  4HEA 2;  2W48 A;  1LVK A;  5A2Q Z;  3MMY B;  3RKW A;  3OYG A;  3GUD A;  3FK7 A;  1MMA A;  1TWG J;  3BJA A;  4XKW A;  4U88 A;  2FSW A;  1ETO A;  2K3F A;  2OQR A;  1Y56 A;  3RKX A;  1J0R A;  1R23 A;  2LFB A;  2P5K A;  2JWT A;  2ZNZ A;  3W2W A;  5BPD A;  3F72 A;  3MAJ A;  4HA8 A;  2H09 A;  3L2U A;  4P9U A;  2QA4 I;  1MNM C;  2L3D A;  4XM3 A;  2R7V A;  2G0E A;  3CDL A;  2M34 A;  5H20 A;  3JRC A;  5C3E J;  4HG2 A;  1TWF J;  4HX8 A;  5DCM B;  3I54 A;  1D8J A;  2VE9 A;  2DMP A;  4IQJ A;  1RIO H;  2EB7 A;  2V1D A;  3E3V A;  3JSO A;  2V4J C;  3Q3S A;  3K6G A;  2R0Q C;  3QYE A;  1BM9 A;  4FE4 A;  5LRS A;  1GDT A;  1LFP A;  2W24 A;  2LD5 A;  2M4K A;  1USS A;  3BWG A;  3ROU A;  4XKV A;  3RPU D;  3VOD A;  4HF0 A;  2NOJ B;  4AIK A;  4I09 A;  3QQA A;  4MO7 A;  3HL2 A;  5ED4 A;  2MH9 A;  5LGT A;  2Z1D A;  3F8M A;  4A5M A;  2DT5 A;  2DK8 A;  1B9N A;  2QYO A;  4C3I J;  1XMA A;  2QQ9 A;  3LSG A;  1R49 A;  2WC2 A;  2M1B A;  5FKK A;  2XAH A;  3CJQ B;  3KPH A;  4ZZL A;  4DNC A;  1CF7 A;  3RJP A;  3HOW J;  1FY7 A;  3W2A A;  3KEQ A;  2UV1 A;  3DBR B;  1VQ4 I;  3PNT A;  1Z3Y A;  3PO2 J;  5IP6 A;  4UVA A;  3HRM A;  5B66 C;  1OYY A;  2GQQ A;  3A03 A;  1VF9 A;  1D5Y A;  1NK3 P;  2QCO A;  2E19 A;  3W2V A;  1PVE A;  2Q1Z B;  4KNY A;  2E71 A;  1R4N B;  5M3F J;  4XRS G;  2UZK A;  4PZJ A;  1FOW A;  1ZEL A;  4M72 A;  3GTJ J;  1K79 A;  2K27 A;  5C44 J;  3FXQ A;  1G6N A;  2VXZ A;  2XSD C;  4G7O F;  3T5X A;  1J7K A;  2ZFU A;  3LA7 A;  1FP2 A;  1PUF A;  3HDD A;  4IRI A;  1MIJ A;  4M3G A;  3A01 B;  1Z3X A;  4ZC3 A;  2EA4 A;  2CQN A;  2L9N A;  3BTJ A;  3CC2 I;  3LQR A;  1UB9 A;  3BZK A;  4KDP A;  1K6Y A;  2RRE A;  1X1C A;  1YQA A;  3LOC A;  3RPQ A;  1QPI A;  2NVQ J;  2L7F P;  1PP7 U;  3ZQC A;  2K5C A;  3J7Z I;  2STT A;  1VQ8 I;  3E5U A;  4HRI A;  1JUP A;  3L9F A;  1QZZ A;  3G1L A;  2DDA A;  3TO9 A;  3OWT A;  2X9D A;  3BR0 A;  2G9W A;  1D5V A;  1U9N A;  3QYB A;  1HF0 A;  5GPC A;  4Y3O A;  2X6W A;  1XB4 A;  4ENK A;  2JTV A;  4HW0 A;  4RB0 A;  1WJ5 A;  1G3Y A;  4J01 A;  2IAI A;  2MFZ A;  3U2R A;  3FMQ A;  5D4S A;  2GXA A;  4IHW A;  2CV0 A;  1J2X A;  1FMW A;  2NAZ A;  3PJR A;  2CW0 F;  2RKH A;  2IEK A;  1W0T A;  3LWF A;  3CCV I;  1V5G A;  3P9C A;  3K1N A;  4U0V A;  2ESN A;  4CIC A;  2YUS A;  2EZK A;  5HS8 A;  3V7C A;  2XB0 X;  2XRO A;  1AOY A;  4DIQ A;  1F36 A;  5E1W A;  3OYA A;  1X4P A;  1A31 A;  2V9V A;  3DTI A;  4BAY A;  1Z6R A;  2Y31 A;  3DTE A;  2ZCW A;  2QQ8 A;  4E7S A;  4LG0 B;  4X6A J;  2G7U A;  5EDN A;  3D1N I;  1H0M A;  2ZXH A;  3R60 A;  3I3L A;  2Y30 A;  3HC7 A;  2DA6 A;  4MIM A;  2OZ6 A;  3S2W A;  4A3M J;  3KZI C;  4QPO A;  4CA0 A;  2CV2 A;  1YYV A;  3ONQ A;  4FIS A;  1D8K A;  3DFG A;  3H36 A;  4N0B A;  5F6F A;  3QOE A;  2KPM A;  2RVC A;  4KN4 X;  3SEZ A;  3I59 B;  5ILS A;  2ELH A;  2GIZ A;  3L2C A;  1JGG A;  3KZZ A;  2FML A;  3ABM H;  3F6O A;  1SD5 A;  1F1Z A;  2IA2 A;  2LK2 A;  2XVC A;  4HQE A;  4GDF A;  5JLW A;  1PUF B;  1JJ8 C;  5IPA A;  2J5O A;  2WAD A;  4E70 A;  3HZJ A;  4XN0 A;  1TQM A;  2NS7 A;  3FDY A;  2EFQ A;  5E3M A;  3OIQ A;  1B4A A;  2FX0 A;  4LLL A;  3S3O A;  1LKX A;  3DPT A;  5KCM A;  3AL0 C;  1ZG3 A;  4YFX F;  3ZN1 A;  1UFM A;  2H27 A;  3OV8 A;  2FBK A;  3ZRG A;  4ESF A;  3C2H A;  1ON2 A;  1MH3 A;  3O8H A;  1YIT I;  4E7H A;  1ZRF A;  3ABT A;  3J81 Z;  1ETX A;  3C18 A;  2VKE A;  3CD6 I;  4NQW B;  4YFN F;  3DWL E;  2DMN A;  1JE8 A;  1JKR C;  2LH9 A;  5FRO A;  2K02 A;  1TWC J;  1IV8 A;  1K4T A;  1VQ9 I;  1VND A;  4RAZ A;  2O0Y A;  5LGU A;  2P6S A;  4IHX A;  5KVR A;  1H9T A;  2GXG A;  4RMN A;  2CQK A;  2ZKZ A;  3WE2 A;  2Z16 A;  4N9I A;  1WFX A;  1LFU P;  1UZC A;  1WWX A;  1R00 A;  2MG4 A;  1I6X A;  3PNV A;  1P9Q C;  4KIT B;  3GCM A;  2GLO A;  3F8B A;  2UUZ A;  2VI6 A;  4A6E A;  1ZHF A;  2D2W A;  2VPR A;  2KIU A;  1Z21 A;  1VQK I;  3KP3 A;  4O6J A;  1Y0U A;  1E0E A;  2XF6 A;  5DDG A;  5EG0 B;  2GBY A;  2GA2 A;  3CCL I;  2RNG A;  1REP C;  1YS7 A;  5FKN A;  3CMM A;  3ZN0 A;  2CUJ A;  2XAJ A;  3FMR A;  3IWZ A;  2BY0 A;  2H1L A;  3WHC A;  4KMF A;  3T8R A;  4M9Z A;  3B6C A;  5A2Q K;  1D1A A;  2EJR A;  4A3C J;  4DQ2 A;  1BIA A;  4JX4 A;  1X1P A;  1KU7 A;  1GUU A;  2UWM A;  2RDP A;  2VKV A;  2CG4 A;  5CVJ A;  3LA2 A;  3K2A A;  4BXU A;  4J00 A;  2TDX A;  4ENN A;  2IA0 A;  1Z6T A;  1Z0X A;  3DKY A;  4U7B A;  3WTV C;  5CQE A;  5GTI C;  3E0J B;  4D7M A;  1T6S A;  2DXI A;  2IXS A;  1IN8 A;  2Y75 A;  3ZMZ A;  1JKO C;  5K5O A;  5D5U B;  2CV1 A;  4HST A;  4JX5 A;  2E1C A;  2HTJ A;  2X1E A;  3L1P A;  2HDW A;  3OYM A;  3BTI A;  2EFW A;  1JHH A;  4AC0 A;  2EFP A;  1HXD A;  1QVU A;  5CVV A;  5EEH A;  3CO6 C;  1R71 A;  2DU9 A;  4DGW B;  2F4M B;  3M4O J;  1BR4 A;  5ILV A;  2O8K A;  1MMG A;  2HTS A;  1ZYR F;  5L3D A;  2VQC A;  4ANJ A;  3OR1 C;  4A12 A;  2AHQ A;  2VPL A;  3ABK H;  3HOX J;  3VDX A;  2L7K A;  1SMY F;  3HSR A;  2A69 F;  3S14 J;  4IX7 A;  1UG2 A;  4FQG A;  2WAE A;  2E34 A;  2WTE A;  4RM3 A;  4IHV A;  4WCG A;  1KQ8 A;  2CUZ A;  5C4J J;  4G7Z F;  4U87 A;  9ANT A;  4L0Z B;  1SD7 A;  4KMU X;  2ZME A;  4OIP F;  3EET A;  2HQN A;  1KGS A;  2HKO A;  3U1K A;  3AKZ A;  5GAD J;  4NBQ A;  3W6V A;  2O6G E;  3E6B A;  3W6J B;  3Q5F A;  1JGS A;  3BC8 A;  1GVD A;  1BIB A;  3OYB A;  2M7A A;  1D0Y A;  2PMZ A;  1DGR M;  2MW8 A;  3ZR8 X;  4MTD A;  3CME I;  5IOY A;  2FE3 A;  4LOC A;  3LNQ A;  2PMU A;  1U6G A;  2ZJ2 A;  1G3W A;  3FF5 A;  4BQO A;  3L2W A;  2A07 F;  3S93 A;  3RYR A;  5GTH C;  5E79 C;  4GXO A;  5H6R A;  4DJA A;  1YIJ I;  4A2U A;  3PL8 A;  2H6B A;  4ZH4 F;  1TBX A;  3CF5 F;  4I0A A;  4EJW A;  3FIW A;  1WJB A;  3CMY A;  3GZN B;  2ADU A;  3SZG A;  3I5U A;  2LNB A;  2R7D A;  4QIW N;  2WWY A;  2A5W A;  2QLZ A;  1DP7 P;  3MKY B;  1O3T A;  2RN7 A;  5E3N A;  2HYJ A;  4KIG A;  3WGG A;  5BS6 A;  1VTN C;  4HF2 A;  2ME6 A;  2LMD A;  3HSF A;  3QPS A;  4A3E J;  2W57 A;  4HOB A;  4IZZ A;  1MDM A;  4C2T A;  3HBL A;  2F48 A;  1UHS A;  2W7N A;  3DKX A;  3RYP A;  2VT3 A;  5F64 A;  1EKE A;  5ILU A;  2LY2 A;  4WXD A;  2VKD A;  5LLQ A;  2HI3 A;  3LSH A;  4L9J A;  1YO5 C;  4DOZ A;  4CYD A;  2H6C A;  4IHS A;  5LBQ A;  4GYG A;  2F4O B;  2HS5 A;  3CP8 A;  4C30 A;  1ZLK A;  5F1J A;  1IUY A;  4B44 A;  1AHD P;  2R5Z A;  4ZYE A;  3GXO A;  1TWH J;  2IP2 A;  3S1Q J;  3CJR B;  4A0Z A;  2FEZ A;  2B63 J;  2OA4 A;  2MLG A;  3OSG A;  3FXM A;  5BNG A;  2Z33 A;  2JZY A;  3RTR A;  4XRF A;  2EBI A;  1UHM A;  3CCS I;  3EUA A;  1TNT A;  5TJJ A;  3MEX A;  1MBE A;  1SMT A;  4EJO A;  3C2G A;  2X6O A;  4MEX F;  4HF1 A;  2CYY A;  1OCT C;  1P92 A;  1EH7 A;  2MAB A;  3H9Q A;  3HHG A;  1BW6 A;  3FHN A;  1VQL I;  4P9F A;  3DF8 A;  1X2M A;  2HOE A;  3H1C A;  5JR3 A;  3K4J A;  3CCJ I;  2X6X A;  4ZDP A;  3C3W A;  2WAQ A;  1GVJ A;  2X85 A;  2V9P A;  2GWR A;  3H3Z A;  2B9S A;  3H9J A;  4Y17 A;  3H3V K;  2BGC A;  1ZH5 A;  3ABL H;  4F55 A;  1X1A A;  1S5L C;  2YSR A;  2LRD A;  1YRN B;  1OR7 C;  3ZQG A;  5D5V B;  3EYY A;  5EEA A;  2VBZ A;  3DBH B;  3ERE D;  4B4C A;  2QSG X;  4JK1 X;  1LQ1 A;  1XCB A;  3HUG B;  3TP0 A;  3MKL A;  2JVG A;  4JP0 A;  4DZP A;  4YIF A;  2F5E A;  2XHK A;  5F0F A;  5FRM A;  1IC8 A;  4BBR J;  2Y0S N;  3OOP A;  3OIO A;  1LE8 B;  5HLH A;  2ELK A;  1XPX A;  5HDG A;  3BT9 A;  1JT0 A;  2R7F A;  4EM2 A;  4BEH B;  3GZ5 A;  4XON A;  2X0L A;  5E1X A;  1XG1 A;  2RAE A;  3PQJ A;  2EWN A;  4P1W A;  2K9L A;  5F04 A;  4EMS A;  3KEO A;  4HPQ A;  4IRH A;  1IG7 A;  3DPL C;  2LYC A;  3K4L A;  3SXY A;  5FB2 A;  1YJW I;  3P5J A;  1FBU A;  2XUB A;  2KJB A;  2HXO A;  3OYF A;  4M3B A;  3GLL A;  3G1O A;  4X0G A;  1LB2 A;  4CZC A;  2CQQ A;  3G1M A;  3MKZ A;  1ACI A;  5J1R A;  4EQQ A;  3HG9 A;  4AVZ A;  4XIC A;  3GTK J;  1ZAR A;  5TIS C;  1IN4 A;  2HQ5 A;  4A3D J;  4XQF A;  1XGN A;  1X1B A;  1V54 H;  3MZH A;  2K9M A;  5E3L A;  2L4M A;  2CSO A;  4LFU A;  2M45 A;  3KZY A;  1TL8 A;  3KP5 A;  5M5W J;  4CGZ A;  1Z67 A;  3TL4 X;  1Y6I A;  1XC5 A;  2MA3 A;  1R5I D;  2HKX A;  3CCY A;  3ECO A;  3SFZ A;  3GF2 A;  1DPU A;  4U0W A;  3MVP A;  2I5U A;  3ML6 A;  4KIB A;  4ZDL A;  2Q0O A;  4II3 A;  2QWW A;  2Y9Y A;  5CKT A;  4ZYA A;  3FIS A;  4A6D A;  1RKW A;  4A5N A;  5TRD A;  2FUG 2;  3KFW X;  1SC7 A;  3LSJ A;  2K3P A;  2QQA A;  1HKQ A;  1F43 A;  2HGC A;  2Y2Z A;  3CES A;  3WG7 H;  3EUH C;  1KON A;  4U7D A;  2CS3 A;  2WV0 A;  2HOT A;  5GP9 A;  3TOA A;  3HYI A;  4IOC F;  3CMA I;  4X1E A;  2IVM A;  2BY1 A;  1WVR A;  1EF4 A;  3FHZ A;  3HGY A;  2B7E A;  4BE0 A;  1F4K A;  3E6M A;  5DCM A;  2WV1 A;  2ZSH B;  4F91 B;  4B48 A;  5F1R A;  2XC7 A;  2ESH A;  2IS6 A;  2JK3 A;  3A4C A;  3R6S A;  3BP8 A;  1UAA A;  2L54 A;  1XSX A;  5KK1 A;  1O3S A;  4EM0 B;  5K7H A;  1GLN A;  3JAM Z;  3PIO F;  3I59 A;  3QOP A;  3CUO A;  3QPT A;  4A93 J;  1QRY A;  2HYG D;  4A3I J;  4CYC A;  2KZV A;  2CGP A;  4MFD A;  4R8H A;  1OMI A;  3JTH A;  2IS4 A;  2QEX I;  4OMZ A;  3HRS A;  2Z2S B;  1ZR4 A;  1B9M A;  1WGX A;  2GXB A;  5JVG F;  3MN2 A;  3IH4 A;  5LRR A;  3L00 A;  3K4B A;  1KZH A;  3UR3 C;  4WF2 A;  3IRR A;  4B3X A;  5LFA A;  2WB1 N;  4BAC A;  2XPV A;  4ESB A;  1FYL A;  2ZME B;  1XCV A;  1G4D A;  4G8X A;  2C6Y A;  2AXL A;  5D8K B;  5D6E A;  2OC6 A;  1WSU A;  4LB5 A;  2DA5 A;  5D5W B;  2YPR A;  4IHY A;  1PDN C;  2WY8 Q;  4YRV A;  1Y39 A;  3IUO A;  1QO0 D;  4UB8 C;  4B09 A;  5IT3 A;  3RKQ A;  2LG4 A;  1MBH A;  2VJ4 A;  5DUK A;  4RAG A;  2R7O A;  2Q2E A;  4KUM A;  2OPT A;  5HLT A;  3CLQ A;  2N8G A;  3FKI J;  2KQR A;  3IL2 A;  3HOS A;  1MW7 A;  5HNH A;  1CF7 B;  4A3L J;  2WY7 Q;  1FSE A;  2YU9 J;  3E7L A;  1OCC H;  6PAX A;  3BZC A;  3GFL A;  3FWE A;  4L18 B;  2A6E F;  3OYE A;  2ID6 A;  3NAR A;  2JA7 J;  5EGO A;  4Y52 J;  3KLN A;  1WI3 A;  2BXY A;  4BJ6 C;  1B6A A;  3HTS B;  3HTU A;  2VUM J;  2LTP A;  3DXJ F;  3VYT B;  1TP4 A;  1FBQ A;  1JJ6 C;  5CVU A;  3CLO A;  2ZC2 A;  3DBL B;  3L09 A;  3J81 K;  4YEJ A;  1BC8 C;  1FEX A;  2P5L C;  4BDZ A;  4G7H F;  4UV8 A;  4S05 A;  2JQ7 A;  2K4J A;  1IAW A;  5FD5 A;  4DW6 A;  2FD5 A;  4KIF A;  2MBF A;  2FBI A;  4WX9 A;  3DV8 A;  1IN7 A;  5F0C A;  3WHB A;  2PMZ N;  2R3S A;  3CUQ A;  4UB6 C;  1UHW A;  2EV0 A;  3BQZ A;  5E17 F;  5DUI A;  3B02 A;  4GGG A;  1R36 A;  1D1C A;  1G3T A;  1Y0N A;  2BOL A;  2Z9O A;  3HOZ J;  4D0P A;  2LSO A;  1QNT A;  3DEU A;  5CVR A;  3TGN A;  3OMY A;  4D5C A;  3KCC A;  3L7W A;  1X19 A;  2NYX A;  1SFX A;  1A35 A;  1GXQ A;  2LOO A;  3OYD A;  2R93 J;  4L5E A;  2R92 J;  2DQR A;  4RAY A;  1JTY A;  2LVS A;  1R1T A;  1I6H J;  2K9N A;  1ON1 A;  1H88 C;  2L2O A;  1R6R A;  2QVO A;  1I3Q J;  2JUC A;  2VBW A;  1RPW A;  2Q8K A;  1HCR A;  3BG3 A;  2HVR A;  1IDZ A;  4L9V A;  4NC6 A;  3U9G A;  4KT6 A;  4BBS J;  5JI6 A;  1HQC A;  2K85 A;  3K2Z A;  1QPM A;  1JXS A;  1BJA A;  3SQN A;  2Y0S A;  2PJR A;  4LK1 F;  2HR3 A;  2XF7 A;  3KIO A;  1MBF A;  4LK0 F;  1S9H A;  1HDP A;  3KE2 A;  3BTC A;  3GEZ A;  2EFO A;  3MFK A;  3ZQQ A;  1BJZ A;  4MGR A;  2ECC A;  2FA5 A;  3V7S A;  3G3Z A;  4F52 A;  2VN2 A;  4XN3 A;  1P2F A;  2ZNY A;  5LEJ A;  3LAJ A;  1FOK A;  2EZL A;  4I02 A;  4IF4 A;  2A05 A;  3FMS A;  5M5Y J;  1FTT A;  1TW3 A;  2PFB A;  3FXK A;  3KYC B;  2AQF A;  5IYB J;  2EIK H;  2JN6 A;  5ICE A;  5HS9 A;  1KQ0 A;  5E1Z B;  1C0W A;  2HFH A;  5B3S H;  4N4N B;  4Z6Y A;  1FYM A;  2KDO A;  3MWM A;  4C2U A;  5K1Y A;  2ZJQ F;  1OJL A;  2E7W A;  2KFD A;  1U0J A;  2EV6 A;  4BJ5 C;  4LJZ F;  4XR6 A;  1Z7L A;  2E1M C;  4NQW A;  1TLH B;  3G4S I;  2YX7 A;  3BRO A;  1JI8 A;  3FXJ A;  4ABZ A;  2L9R A;  2RQP A;  4IO9 F;  1BR2 A;  1Z05 A;  5HS7 A;  1SAU A;  1YOV B;  2DFI A;  2HYF A;  4JOM A;  3PSF A;  1LDD A;  1XX5 A;  4JQF A;  3OS2 A;  3GTG J;  1SVO A;  2CU7 A;  2V6E A;  2EIN H;  2W1O A;  2LF7 A;  5LEK A;  4UUV A;  4HX7 A;  1BI1 A;  4A3K J;  4I01 A;  4EJV A;  2QF7 A;  3QAH A;  3NWT A;  1IN5 A;  1DDN A;  1J5Y A;  2G7H A;  2MGQ A;  3K4M A;  3GZ6 A;  1STZ A;  3GFM A;  1ULY A;  4L5J A;  1EJ9 A;  5C4X J;  1R4M B;  1Z77 A;  3S3N A;  4XLP F;  2M0C A;  3ZQI A;  5JVT A;  4ON0 A;  3BR2 A;  4NDL A;  1U2W A;  2XDV A;  3WU2 C;  5KHD A;  5E3O A;  1YE9 A;  2YX4 A;  2DA1 A;  1JHF A;  1A5J A;  2W4S A;  3GYH X;  4HV6 A;  3DLL F;  3GTQ J;  5L3G A;  3E6C C;  4MEY F;  2DYS H;  3IAS 2;  3ZMD A;  5EZH A;  3V8L A;  2FF4 A;  1X3Z B;  2JPB A;  3C1D A;  5HDN A;  3CUQ B;  2VE8 A;  3H0D A;  3OSF A;  4ZTF A;  2VJ5 A;  2VT2 A;  3A1Y A;  3RPU A;  4L5I A;  3F9K A;  2XKP A;  2DFF A;  4H0E A;  4PJJ A;  1W5T A;  2OAZ A;  4HZF A;  3BQY A;  5J40 A;  4NHJ A;  1HST A;  2E5N A;  3F21 A;  4BU2 A;  2JJ7 A;  1R1V A;  1BI2 A;  1WJA A;  2K9S A;  3CJN A;  1IV6 A;  3ELK A;  5K7F A;  3E97 A;  3P7N A;  2ID3 A;  2L01 A;  1VQP I;  2M5W A;  1S7A A;  5HDK A;  2JMW A;  3ZOB A;  4M3E A;  4H4K C;  2PLY A;  1AA7 A;  4HX4 A;  4NUB A;  4ASN A;  2EA2 A;  2UXX A;  1YX3 A;  3F8N A;  3PFY A;  2D1H A;  2E35 A;  3OIP A;  1PYV A;  4AID A;  3A2K A;  4PJN A;  3CP2 A;  1N78 A;  4NC7 A;  2KKO A;  4EAT A;  3F6V A;  4IEJ A;  2R7W A;  1B59 A;  5E8G A;  1MJA A;  1KQ9 A;  4XKC A;  3WTZ A;  3D5S C;  1NH3 A;  3TED A;  2XGD A;  5D5X B;  1HKS A;  3S2H J;  2VQL A;  3MZY A;  2H8W A;  4ZTJ A;  4I99 C;  1HOM A;  1FIP A;  3BCB A;  3G71 I;  1Y1W J;  4AIH A;  2EIL H;  3LST A;  2F6C A;  3LSI A;  3WG9 A;  4UUS A;  2E2I J;  5KNL A;  4EV0 A;  2E1M B;  5BPI A;  5FGM A;  3J80 Z;  3PFI A;  4A3B J;  1DPR A;  2R5Z B;  1YW7 A;  1IXS B;  2M8E A;  4RS8 A;  4RBO A;  1R7J A;  1VQN I;  2V9K A;  5CYV A;  1AU7 A;  2A3S A;  2DYR H;  2W82 A;  3S15 J;  4CHU A;  3P9K A;  2DDB A;  4XLC A;  3VFZ A;  1XD7 A;  2RC4 A;  4HNU A;  4ZDO A;  3K69 A;  3M07 A;  3TDZ C;  2DMT A;  4ITV A;  3WOD F;  1DUX C;  3SYT A;  2A68 F;  4F7Z A;  1S7O A;  3Q9V A;  3OYI A;  2VOD A;  3FXO A;  1E3O C;  4E6K G;  3E1S A;  4XKB A;  1YW8 A;  4BQA A;  1P7J A;  2OTL I;  2V1N A;  1DQU A;  4DYR A;  3COA C;  2CH0 A;  2LLK A;  2HVS A;  1HA8 A;  2VKH A;  2HOA A;  3LAP A;  4EGZ A;  4M6V A;  2LRE A;  2P8T A;  2WAQ N;  1VQO I;  1T56 A;  2P81 A;  1LEA A;  1RZ4 A;  2LKS A;  1O3R A;  2IGN A;  4C9Y A;  1WZ2 A;  2HZT A;  4LLG F;  2Z99 A;  2K7L A;  3MZ8 A;  2X1D A;  1K7A A;  1BA5 A;  4S04 A;  1JUM A;  1BOB A;  3DU6 A;  3ZMU A;  4P55 A;  4PSW A;  4WWC A;  4GO1 A;  2BYV E;  4FT8 A;  3IHU A;  4JBA A;  3GFJ A;  3I4P A;  2VXD A;  3PUF A;  4ZJZ A;  4KYW A;  2CW8 A;  4B43 A;  1MDM B;  2D5V A;  1YG2 A;  5J8C A;  3JRI A;  3BTL A;  3SZT A;  2R7R A;  3JRF A;  1W7P D;  2R5Y B;  3RI4 A;  1W5S A;  2R7X A;  3BCA A;  3TOB A;  3GX4 X;  1JUS A;  2XB5 A;  4W1U A;  3FZV A;  3U1D A;  1QZY A;  1U5T B;  2LKX A;  4U0Y A;  5CQG A;  5E8I A;  1R9T J;  1S8N A;  3S3M A;  1FOY A;  5DS9 A;  1X3U A;  4BDY A;  2ACJ A;  3HM5 A;  4BL0 B;  2B0L A;  4UV9 A;  2R7Q A;  1KA8 A;  3N05 A;  3WTY C;  3S16 J;  2O5R A;  1QQI A;  1FIA A;  2HXI A;  2JA5 J;  1G3S A;  2WBM A;  1TNS A;  5HVQ C;  4MFE A;  2XAU A;  2QQB A;  3CQZ J;  4G9Y A;  3PUB A;  3D0S A;  3WTU C;  1POG A;  3Q0U A;  1ZG1 A;  4B3A A;  3W3C A;  2E2J J;  2KLO A;  1IZ1 A;  2HWV A;  2EIJ H;  3K4C A;  4YIR X;  4EJU A;  1MND A;  4L9T A;  3GWZ A;  5K5Q A;  3HOY J;  3I71 A;  2Q2E B;  2EZH A;  3OL3 A;  3AFH A;  1TT5 B;  5LHH A;  2DOF A;  3KX2 A;  2ZBK A;  4CDG A;  4KFC A;  1OLT A;  1IN6 A;  5FO5 A;  1WJE A;  1W5C C;  4G12 A;  3IKV A;  4HQM A;  1I50 J;  2CRG A;  2X4H A;  2WAF A;  3O6B B;  4GRI A;  4CCJ A;  4YEL A;  1FBS A;  1IGN A;  3VWB A;  2F2E A;  2MD5 A;  4MQ9 F;  3ZGK A;  1ZRC A;  4AYB A;  1VZ0 A;  1Z91 A;  3M1C A;  2E1N A;  4BE2 A;  4HLY A;  3CC7 I;  3EUK L;  4LG3 A;  4BH9 A;  2BHY A;  2Z5U A;  3JRB A;  3FM3 A;  3DP7 A;  5ICC A;  4O3M A;  3RSN A;  3BR6 A;  4EVI A;  5LD2 C;  1P6R A;  1JKP C;  1YW9 A;  3EQL F;  1ONV A;  3BG7 A;  1N77 A;  4FCY A;  1X2N A;  4KA4 A;  4FTH A;  1XDU A;  1OYI A;  1T98 A;  2JSC A;  4BHB A;  1IRF A;  2FOK A;  3FXR A;  1R5H A;  2CUE A;  1UJ8 A;  5DD4 A;  1HW5 A;  2X6Y A;  5DYM A;  1XMX A;  3VB2 A;  1CQT A;  4AM3 A;  1OQY A;  2K9Q A;  4BS9 A;  3DEW A;  4OIN F;  3FKJ A;  1B8I A;  4R79 A;  1J59 A;  1UST A;  2BY3 A;  1XSV A;  2EV5 A;  2DJI A;  2DK5 A;  4RA2 A;  4NC8 A;  4UXN A;  5AIQ A;  2R7Z J;  3V8J A;  2BVL A;  3AG4 H;  2DFH A;  2KL4 A;  3H0G J;  2MH2 A;  1S29 A;  3RZD J;  2ZO4 A;  4BY7 J;  3CDH A;  2RNJ A;  2Y0M A;  3TMO A;  2F4I A;  1T39 A;  3SEQ A;  3TW6 A;  1YFH A;  1ENH A;  1RES A;  2PJP A;  3KEY A;  5ERI A;  1YTY A;  1FP1 D;  3QYF A;  3WU0 A;  3VYR B;  2R7T A;  4PGG A;  2I8D A;  3BLY A;  3T8T A;  1S7E A;  2BY2 A;  3F23 A;  1FWZ A;  1X3W B;  3CCU I;  1U8B A;  3LSP A;  2K4B A;  4ESJ A;  1OYW A;  2A6T A;  1EH6 A;  1QZE A;  3F3X A;  4ZYH A;  2KIS A;  2PJR B;  1X1D A;  1SVL A;  2JPC A;  2ZXJ A;  1QHH D;  2CQ7 A;  1YIO A;  1Z1D A;  2X1C A;  1HSJ A;  1FMV A;  3JCU C;  4XRS A;  2F5V A;  4BEH A;  4UUS B;  4L0Y B;  4K2E A;  2BXZ A;  1FC3 A;  1LVA A;  3LSK A;  4C3H J;  5J47 A;  1GHC A;  5F27 A;  5L3C A;  1LPQ A;  2KP6 A;  4PJM A;  3ZQL A;  1AKH A;  1ETV A;  2QUF A;  1WQ2 A;  2E36 A;  2XPU A;  5FLV A;  3GW2 A;  3M8E A;  3BJ6 A;  3WTT C;  3ZCO A;  3GFI A;  2CFO A;  3S1M J;  2VQG A;  2IT0 A;  1T33 A;  4UNO A;  3V8K A;  2P6T A;  2CJJ A;  3SDG A;  2EZI A;  1W7P A;  2LR8 A;  4KIC A;  3TQN A;  1W36 C;  2DT7 B;  3BPX A;  1RI7 A;  1Z7U A;  1OKR A;  4CO8 A;  4GCV A;  4MLO A;  2W00 A;  2NNN A;  5IOZ A;  2BEO A;  3OL4 A;  2IS1 A;  3M8J A;  1KU2 A;  1YJN I;  3HOT A;  2DO7 A;  3IWF A;  2ME0 A;  4GFB A;  5DV5 A;  5DM7 F;  4BHC A;  2BHZ A;  4BKX A;  2R7S A;  1FT9 A;  2W25 A;  4ETS A;  3ESW B;  2XPW A;  4UHT A;  5FLX K;  5IYD J;  4BXF A;  2L9V A;  3VOE A;  2L7M P;  1RKT A;  3G73 A;  1I27 A;  2FBH A;  4E7Z A; 
#chains in the Genus database with same CATH homology
 4NQW B;  2L2O A;  1R6R A;  3DWL E;  4XOT A;  2LH9 A;  5FRO A;  4RM2 A;  2HVR A;  2GOM A;  3H5N A;  4E7I A;  4KT6 A;  4Y4R A;  3OYH A;  4N4O B;  4RMN A;  1UG0 A;  2Z16 A;  1WFX A;  4KIS A;  2ZSI B;  3L2V A;  2Y0S A;  4CCL A;  2PJR A;  3PNV A;  1P9Q C;  4KIT B;  2WB1 A;  2UUZ A;  2XF7 A;  4E7K A;  1S9H A;  2DOA A;  1MMD A;  2BVM A;  3ZQQ A;  3K4N A;  1Z21 A;  4D9J A;  4F52 A;  1E0E A;  2XF6 A;  4XN3 A;  3FBN B;  2LY1 A;  2RNG A;  3DU5 A;  4Y33 A;  3CMM A;  2CUJ A;  4DBR A;  1D0X A;  3I9V 2;  3OYC A;  1N75 A;  2AQF A;  3HPG A;  1D0Z A;  1D1A A;  4PSX A;  4N4N B;  3CZ6 A;  2KDO A;  4C2U A;  3L2R A;  2MD0 A;  2VJJ A;  3HKZ A;  4II2 A;  4BQQ A;  2UWM A;  3OS0 A;  4PK4 A;  1U0J A;  4BJ5 C;  4F92 B;  4J00 A;  2R7U A;  4XR6 A;  2VQH A;  1Z7L A;  2E1M C;  1MMN A;  2M0M A;  2XF5 A;  3DKY A;  4U7B A;  5CQE A;  3E0J B;  1JI8 A;  2DXI A;  2IXS A;  1NG7 A;  3CF2 A;  1BR2 A;  2M7B A;  2CV1 A;  1SAU A;  4HST A;  2GOX B;  2IGM A;  2X1E A;  4JOM A;  2HDW A;  3PSF A;  3OYM A;  4JQF A;  3OS2 A;  3S8P A;  4CUG A;  2V6E A;  3SDB A;  4DGW B;  2W1O A;  5JHF A;  1BR4 A;  1X4O A;  1QU3 A;  1MMG A;  2L9S A;  4CCM A;  2L5Q A;  2VQC A;  3NWT A;  4ANJ A;  3OR1 C;  3PSI A;  3K4M A;  2VPL A;  4E7L A;  2JA2 A;  4LIU A;  3VDX A;  2VLA A;  2L7K A;  4IX7 A;  3S3N A;  5CPR B;  2WAE A;  1ERD A;  4RM3 A;  2XDV A;  2CUZ A;  5KHD A;  4U87 A;  2MC4 A;  1T0F C;  1YE9 A;  2E60 A;  2W4S A;  3IAS 2;  2E5Z A;  1LDK B;  2XSJ C;  3H0D A;  3OOU A;  3H5R A;  3AKZ A;  4ZTF A;  2VJ5 A;  2HPM A;  3A1Y A;  3BC8 A;  1IRX A;  3F9K A;  4OAZ A;  3OYB A;  2M7A A;  1D0Y A;  2PMZ A;  1DGR M;  4PJJ A;  3ZR8 X;  2E5N A;  4OWR B;  4BU2 A;  2VAS A;  3OS1 A;  4BQO A;  3L2W A;  1WJA A;  3LMM A;  3S93 A;  2V7F A;  3S32 A;  4DJA A;  4NNJ A;  3LSM A;  3PL8 A;  3DQV C;  3OYK A;  4H4K C;  1AA7 A;  1WJB A;  4NUB A;  2R4G A;  1YX3 A;  2QKM B;  4LIV A;  3SZG A;  3H35 A;  4PJL A;  3PFY A;  3OIP A;  2A5W A;  2DCE A;  1YX5 A;  2KHM A;  3MKY B;  1PYV A;  3A2K A;  4PJN A;  3CP2 A;  1N78 A;  2VJI A;  4NC7 A;  5FRN A;  3L2Q A;  4EAT A;  2R7W A;  1NG6 A;  3VSK A;  2QKL B;  3OY9 A;  4IZZ A;  2JSP A;  4XKC A;  4FAS D;  3D5S C;  3IAM 2;  1J09 A;  4C2T A;  3K70 C;  2VQL A;  1W36 D;  4ZTJ A;  2W7N A;  3DKX A;  3BCB A;  2LY2 A;  2F6C A;  4BGD A;  4CCK A;  1WJC A;  1TT0 A;  2VKD A;  3LSI A;  5KNL A;  3MD2 A;  2E1M B;  3LSH A;  2HNH A;  4CCN A;  4DOZ A;  1G8X A;  3OYL A;  3CP8 A;  4C30 A;  5HNF A;  4B47 A;  3V42 A;  3VYS B;  3OYJ A;  4B44 A;  3KYL A;  3LL7 A;  2WA0 A;  2V9K A;  4BE1 A;  4E7J A;  2BW3 B;  2IGK A;  4CSW A;  3CJR B;  1MNE A;  2AQE A;  4PFP A;  3HPH A;  1WJF A;  4FET A;  2W82 A;  1SFK A;  4CH7 A;  3RTR A;  2MYS A;  3QOD A;  3EUA A;  4XLC A;  4D1Q A;  1EA3 A;  2HZD A;  4ZDO A;  4HNU A;  1G59 A;  4RLF A;  4ITV A;  3C2G A;  2VL8 A;  3SYT A;  3OYI A;  2MAB A;  3H9Q A;  3E1S A;  4E6K G;  4XKB A;  3FHN A;  3DPU A;  3RCO A;  3K4J A;  2V1N A;  1DQU A;  2X6X A;  4ZDP A;  1PJR A;  2RQQ A;  2CH0 A;  2WAQ A;  2HVS A;  2OV7 A;  2X85 A;  2VKH A;  1HA8 A;  3H9J A;  2HQA A;  2LRE A;  4XOP A;  2IGN A;  3DTK A;  4C9Y A;  4F55 A;  1DP3 A;  1X1A A;  4PUS A;  2VIX A;  2LRD A;  1OR7 C;  2X1D A;  2ELJ A;  3ZXS A;  2CMP A;  1DGW Y;  3BG6 A;  4KJZ A;  3IP4 B;  1BOB A;  3DU6 A;  3HUG B;  2JVG A;  4XOR A;  4PSW A;  3H9G A;  4HEA 2;  1LVK A;  3MMY B;  3GBG A;  5TGT A;  3OYG A;  1MMA A;  4XKW A;  5FRM A;  2V26 A;  2VXD A;  4ZJZ A;  1Y56 A;  2CW8 A;  4B43 A;  4E4H A;  2KMU A;  4BUP A;  2OUM A;  2JVH A;  2ZXI A;  3W2W A;  3AL0 B;  4BEH B;  2R7R A;  3L2U A;  4XON A;  4XM3 A;  2R7V A;  4P1W A;  2K9L A;  2R7X A;  3D5R C;  3BCA A;  4HG2 A;  4HPQ A;  3DPL C;  2LYC A;  3K4L A;  4IQJ A;  2KRC A;  3OYF A;  2V4J C;  4X0G A;  3K6G A;  4CZC A;  5CQG A;  4RLQ A;  1QHG A;  3DEE A;  3QYE A;  3RQ4 A;  3MKZ A;  3OR2 C;  3HG9 A;  1LFP A;  4AVZ A;  3S3M A;  2LBF A;  4OAY A;  4XQF A;  2M4K A;  4BDY A;  1X1B A;  4BL0 B;  2K9M A;  2R7Q A;  3N05 A;  4XKV A;  4XLF A;  3RPU D;  2O5R A;  4XL9 A;  2NOJ B;  4CCO A;  3TL4 X;  1Y6I A;  1WJD A;  2WBM A;  3VSL A;  3HL2 A;  5HVQ C;  3MKW B;  2XAU A;  2Z1D A;  3PNY A;  3PUB A;  4ZDL A;  4II3 A;  4P5O A;  5CKT A;  4ZYA A;  3LSG A;  3W3C A;  3CJQ B;  2KLO A;  2FUG 2;  4F3Q A;  4F93 B;  3K4C A;  2K3P A;  3FBI B;  3W2A A;  1MND A;  2UV1 A;  3PNT A;  1Z3Y A;  2HPI A;  2Q2E B;  4BQN A;  3CES A;  3OL3 A;  3UNG C;  4DBQ A;  3AFH A;  3EUH C;  1KON A;  3W2V A;  3KX2 A;  2Q1Z B;  4BJT A;  2M3A A;  1OLT A;  3EPZ A;  2CS3 A;  1WJE A;  2LBF B;  2WAF A;  4GRI A;  4CCJ A;  1ZEL A;  4YEL A;  2IGO A;  1BR1 A;  3VWB A;  2VXZ A;  4HSR A;  4BE0 A;  1T95 A;  3ZGK A;  4AYB A;  2ZFU A;  1VZ0 A;  2ZSH B;  4F91 B;  2BW3 A;  4B48 A;  1Z3X A;  4ZC3 A;  3M1C A;  2XC7 A;  4BE2 A;  2IS6 A;  3A4C A;  3OYN A;  2L9N A;  3EUK L;  4LG3 A;  1UAA A;  1GLN A;  3RSN A;  1K6Y A;  2P0W A;  1X1C A;  1TZL A;  2RRE A;  5LD2 C;  3J7A Y;  3BG7 A;  1N77 A;  2X51 A;  1UEL B;  2K5C A;  2KZV A;  4G6T B;  4XLE A;  4HRI A;  2IS4 A;  3OWT A;  4XLH A;  3LFU A;  2Z2S B;  3QYB A;  4AU7 A;  2X6Y A;  4Y3O A;  2X6W A;  3K4B A;  3UR3 C;  4BS9 A;  4B3X A;  5LFA A;  4BAC A;  3FKJ A;  4R79 A;  1WJ5 A;  4J01 A;  2MFZ A;  2JUG A;  2DJI A;  2CV0 A;  1FMW A;  3K4K A;  4NC8 A;  3PJR A;  2BVL A;  2OC6 A;  2KL4 A;  1V5G A;  2DT6 A;  3DLA A;  4XLA A;  1V5E A;  2F4I A;  3TMO A;  2KRH A;  2WY8 Q;  3SEQ A;  4YRV A;  3IUO A;  3D5L A;  3KEY A;  4DIQ A;  2LG4 A;  1X4P A;  2HVQ A;  3QYF A;  2VJ4 A;  4PFO A;  3VYR B;  3VYU B;  3OYA A;  2R7O A;  2R7T A;  2I8D A;  3BLY A;  3G2B A;  3DTI A;  5HLT A;  3DTE A;  2KQR A;  4IKF A;  4E7S A;  3HOS A;  1MW7 A;  5HNH A;  2A6T A;  3HXL A;  2ZXH A;  1X1D A;  3I3L A;  2WY7 Q;  2LC2 A;  2PJR B;  1QHH D;  2X1C A;  3HC7 A;  1FMV A;  2F5V A;  4BEH A;  3LSK A;  3OYE A;  5HOO A;  2CW7 A;  4LIT A;  2KP6 A;  4QPO A;  4PJM A;  4BJ6 C;  4CA0 A;  2CV2 A;  3ONQ A;  2M4G A;  3VYT B;  1V5F A;  3QOE A;  2KPM A;  3ZCO A;  4YEJ A;  2CFO A;  3SEZ A;  2VQG A;  4XNF A;  2VB6 A;  4BDZ A;  4HNT A;  3K10 A;  3H5A A;  1W36 C;  2DT7 B;  3K70 D;  3NWS A;  3TBI A;  4MLO A;  2WAD A;  2W00 A;  4XN0 A;  3U21 A;  3FDY A;  3OL4 A;  2IS1 A;  3OIQ A;  3M8J A;  1D1C A;  4XMY A;  2BOL A;  3HOT A;  3S3O A;  1LKX A;  3DPT A;  5KCM A;  4IQ4 A;  3AL0 C;  2R7S A;  3OMY A;  1X19 A;  3ZRG A;  1D1B A;  3C2H A;  4BXF A;  2HU9 A;  2LOO A;  3OYD A;  2IS2 A;  4E7H A;  4QPQ A;  4E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...