4J00A

Crystal structure of fischerella transcription factor hetr complexed with 24mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
297
structure length
297
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
total genus 62
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A02
4YRVA 3QODA 4HRIA 4J00A 4IZZA 3QOEA 4J01A
chains in the Genus database with same CATH superfamily
4F92B 2B63J 2CFOA 3RKWA 2XKPA 2Q2EA 4E7SA 5HS9A 2X4HA 2M1BA 1IJWC 5E20A 4A3BJ 1EKEA 5EG0A 1BOAA 3DCFA 3I53A 2QENA 3T8RA 3JRCA 2LF8A 1ZG1A 2A69F 4JX5A 2IW5A 1JT0A 2BXZA 5LRSA 3WGIA 2KIQA 3M1EA 1BI1A 2LOOA 2ZMEC 2WAEA 2E2IJ 4BQAA 3WG7H 2IGMA 1KU9A 3QPTA 4PDKA 2A61A 3V42A 1KU7A 2R92J 3G4SI 4WX9A 1QU3A 3MZYA 1R7JA 1X3UA 5GP9A 4P96A 2E7WA 3ABKH 3HPHA 2IS4A 1DP7P 1B4AA 3FBIB 2GIZA 3PO2J 1VF9A 1R1UA 5FRNA 2M3AA 3JR9A 2CUJA 2V9KA 3SZPA 1IW7F 1WJ5A 3IWZA 5H6RA 4EGZA 4I98B 1ETQA 4ESBA 4BDYA 2I10A 2ELKA 1H9GA 2L01A 4N0BA 4B1RA 1LDJA 4HX4A 4EJVA 1IV6A 2LKSA 4IZZA 3RZOJ 3I59B 3VSLA 2R5ZA 4EM1A 2ESNA 3BC8A 4PCQA 5HNFA 1FTTA 3I71A 1B1BA 4R1HA 3KX2A 2EIKH 2D2WA 4HZFA 1I39A 1R1TA 3S1NJ 4A12A 1BIBA 2R3SA 4BH9A 2W7NA 4WXHA 3GZ6A 3HKZN 1XMKA 1QQIA 5BQTA 1MNMC 4DYCA 3L1PA 1LB2A 3CC4I 4CA0A 1YHQI 1D8JA 1IO2A 2FOWA 4JQFA 2ZNZA 2R5YB 4OIOF 1SVOA 4C2UA 5DUKA 2V79A 5IP9J 1J09A 1RC9A 4JX4A 5E3OA 1MDMB 2Y9ZA 2K9SA 1ORKA 1VQ9I 5HDNA 1T56A 5LFAA 1VQPI 5E79C 2DI3A 3WU2C 2ZMEB 2L4MA 5IYDJ 4HW0A 1TWGJ 4E7ZA 3QODA 3R4KA 5FKNA 3QOEA 2OTLI 2HQAA 1U5TA 2Y2ZA 5ICFA 1ZGWA 3DBLB 1R22A 4ZH4F 2X6YA 1X1PA 2VN2A 3K1NA 5FROA 4BL0B 2L7KA 3EUHC 3DWLE 4LG0A 2CMPA 5IOZA 3GX4X 4LD5A 1Z77A 3NRVA 1ZRDA 4A3KJ 2H94A 1ZARA 3ASNH 5DV5A 3I58A 1A36A 2FE3A 1X4OA 5E1WA 3MN2A 3EETA 4J01A 1WH7A 5CVIA 1EA3A 3NWTA 4E7LA 5DUIA 4GYIA 2VC1A 1IRGA 4AYBA 4ENKA 1LJ9A 1YTYA 3D5SC 1IG7A 1USSA 4A3IJ 2RN7A 4ZTFA 2CRGA 1OYWA 3I64A 2VOPA 5IT9Z 2OF7A 2BZTA 2IEKA 1FOKA 3ABLH 4ZJZA 3UR3C 1FYLA 2HVRA 3CMMA 4NQWA 3NQOA 3PFIA 1ZR4A 3A01B 3UKGA 1JI8A 3A0BC 3IAM2 2VJIA 5LRRA 4HLYA 1REPC 3DPUA 2L4AA 4I0BA 3QWLA 3PIPF 3IH2A 2GA1A 4IF4A 2UZKA 1W0TA 1Z3YA 2X1EA 2VQCA 4C3IJ 2C6YA 4DOZA 3IRRA 2IS6A 3HGGA 3RYRA 4B44A 4FETA 3JRBA 4CZZA 1E2XA 3CMEI 4BE1A 3IKVA 1Z1DA 3ESWB 1O4XA 5CYVA 3RPUA 2A6EF 3BQYA 2H6CA 5DCMA 2JN6A 2PQ8A 3ZQCA 1Y56A 5EGOA 1G3TA 2IT0A 1IV8A 2XDVA 4GCVA 1V5EA 2OU2A 1BN5A 3IL2A 4HBLA 1YFHA 2V7FA 2ICWG 1BR4A 2BV6A 3AFHA 2E36A 4EQQA 2QGUA 3K4CA 5DM7F 4J19A 2P8TA 4EJWA 1R71A 3K4JA 2OV7A 2IS2A 2XAFA 5EF6A 1XGSA 5J4VA 4MIMA 5L3DA 3SQNA 3MZHA 5CLSA 4BXUA 1RETA 1K4TA 2BW3A 1QPIA 4EV0A 3DEWA 3OL3A 3HM5A 3IUOA 3IP4B 4O3MA 1ACIA 3G1LA 5DDGA 1U9OA 2HNHA 1X58A 3T5XA 3HRUA 1XMXA 1U0JA 3BPVA 2PLYA 3SFZA 4RA2A 1GVJA 4P9UA 3CJQB 3H5RA 2DFIA 2M8GX 2OAZA 2GM4A 5C4XJ 1YOVB 4CZCA 4MO7A 4BEHB 1I3QJ 1OCPA 3K4MA 3RZDJ 2EZLA 2LREA 3JAMZ 2M45A 3F23A 2JRMA 1VFCA 5LEKA 2CH0A 2P6TA 3L7WA 1WJBA 3ZQIA 3S1QJ 3AL0C 3GUDA 3BG6A 3SJMA 1NG7A 2JTVA 2IP2A 3FK6A 3FWEA 1U9NA 4XSXF 2A05A 2PG4A 4IHYA 2RNGA 2QLZA 3SYTA 1YJ9I 2EA4A 2E5NA 1H9TA 3HIFA 5LHIA 1DUXC 2TDXA 3F6OA 2HZDA 5LEJA 2H1KA 4PUSA 3J81Z 1ZAOA 2ME0A 4PSXA 1FBUA 4BQNA 3TP3A 3HJEA 2JWTA 3FKJA 4HOBA 4W97A 2ECBA 1ON2A 2L9SA 1P6RA 4H0EA 1TL8A 2GLOA 3TL4X 3GFIA 1L0OC 1Y1WJ 3BDDA 3N4MA 2YX7A 4LLLA 4NNJA 3KE2A 2X48A 3ERMA 2EINH 3VYUB 1F36A 2LC2A 5ICCA 4DGWB 1BW6A 1UG2A 2H1LA 3JTGA 1IXCA 1XPXA 2XAQA 3MFKA 5J8FA 1TLHB 3CP2A 3GWZA 4V2GA 2Y0MA 3GZ5A 1EJ9A 4OIRF 1RRJA 2JRTA 2VXDA 4LGWA 3PIOF 1F5TA 3BR6A 2XAGA 3WTVC 1W7PD 3L2VA 4HF2A 1FTZA 2EV6A 2K7LA 1IRZA 1R23A 2MYSA 1AOYA 4UUSB 5FKKA 3E3VA 3F21A 3BR1A 2F5CA 2DK8A 1WZ2A 1LE8B 4HV6A 3I55I 3I59A 3I3LA 3NWSA 3OYJA 4LB5A 1IUFA 4JP0A 1X1BA 3TW6A 5BPIA 2VUMJ 1EH8A 3MKZA 5E3LA 4U0YA 3OOPA 2IXSA 3E5UA 3FMQA 2QBYA 2MC4A 2V1DA 1SFKA 3EQLF 1WJAA 2W24A 4M6VA 3RQIA 4CUGA 2CWEA 4EM0B 1C0WA 5HDKA 5K7ZA 1Z05A 1T6SA 2L5QA 3OYAA 2LLKA 4OAZA 2R5YA 4UUTA 1LVKA 4I7HA 3M4OJ 1MBHA 1MDMA 3FDYA 4XSZF 2DJIA 3RKYA 3C7JA 4BJ5C 2AS5F 4XICA 2ZMEA 4E6KG 1FOWA 1JUMA 2VQLA 2FQ4A 1XCVA 3BG9A 1B72B 3O2PE 3V7CA 4RAZA 4BY1J 3K7AJ 1JHFA 5C4JJ 1MBKA 2EV5A 2QZ8A 2LNBA 3BT9A 1KYZA 1T33A 1O3QA 3G71I 3LSIA 1ZQ3P 4XBFA 1MSFC 2FJ1A 1IAWA 3HSEA 3FMSA 1WJFA 3KCCA 2JUGA 2O9LA 4MLOA 4GO1A 3CCRI 1OCZH 3CCEI 3WG9A 3WHCA 3KYDB 4L0ZB 2CFXA 2O5RA 2RQQA 2XHKA 2H09A 2K9NA 4RDUA 1E0EA 5EZGA 2KZVA 4QIWN 2WY8Q 3V4GA 4KITB 4CHUA 3CUQB 2L7MP 5B5EC 2X1DA 1DU6A 2MC3A 1VQ6I 1MBEA 4XM3A 3BTIA 1ETYA 3LA7A 2VT2A 3L09A 3OL4A 2XVCA 1P2FA 3FXKA 3R61A 4IQ4A 4IEJA 1I1SA 1MKMA 3OOUA 4Y7NJ 3PJRA 5HS7A 1SMYF 3TP0A 1U3EM 2MG4A 4O6JA 4BJ6C 4RBOA 3BTCA 5F04A 4LG3A 3V8LA 1YX3A 4CCOA 2EILH 2MABA 4CICA 3D5RC 5L3FA 4HQEA 3WU0A 4OIQF 3CZ6A 1MBGA 3R0AA 1P4XA 3CP8A 4G94A 3PSFA 4LMYA 1MBJA 3JW4A 3TOAA 2HGCA 1Z0XA 1K78B 5J47A 5E3MA 3MWMA 5C44J 3S2HJ 1D0YA 2RNJA 1SD4A 4S04A 2GIVA 5FKOA 2E2JJ 2JVGA 4U0WA 1UB9A 3BQZA 3GFMA 2K40A 3DLAA 4LLGF 4O5VA 2LMDA 3EUHA 4M9XA 2OA4A 3OS1A 3OYIA 3OWTA 3CUOA 1AA7A 2DMPA 1A04A 3GTOJ 4PJMA 4A6EA 2X51A 3QQAA 2JT1A 2JA2A 2V6EA 5F0HA 4BACA 1B6AA 5D6FA 3K1MA 3CMYA 3ZQHA 3L2RA 1J0RA 2KDZA 4FCYA 1TQPA 1D1CA 3GTLJ 1DDNA 3H3VK 2PJPA 2EA2A 4BNCA 5JVTA 4A69C 1YJNI 3NARA 3HBLA 4EJOA 4XKBA 3H0DA 2XGXA 1T8IA 1AWCA 4OIPF 5M3FJ 1FT9A 1JXSA 4I99C 2EK5A 4A3FJ 1T39A 2ZXJA 3DTKA 2VI6A 1RI7A 3SZTA 2HYGD 2DMUA 1MSEC 4BEHA 4M3EA 1Q1VA 2CW7A 1PUFA 3QOPA 3C2GA 1FIAA 2DPDA 1NHAA 2VB6A 3PUFA 1BJAA 2DA7A 2WY7Q 2KDOA 2FNAA 2Z9OA 2Y0SA 4L9JA 2MSYA 3BZKA 3ABUA 1TWCJ 3W2WA 2H6BA 2K3PA 1MH4A 2QM3A 3LQRA 1RKWA 1WRJA 2ECCA 1DP3A 3CESA 3VSKA 4ZYDA 2O8XA 5M5WJ 3OR1C 3MAJA 4ESFA 2PJRB 1UJ8A 3I9V2 4NC8A 5CVVA 4DYQA 5GTHC 2NRAC 2F5EA 3ERED 4AUXA 3R6SA 2KP6A 2CV2A 3H36A 3KZZA 3MQ0A 4PGGA 5GPAA 1MMAA 4M72A 4G7HF 2QQ8A 5KVRA 1S7OA 5F1RA 2WBMA 3S2WA 3WGGA 1MMGA 3WTUC 4P1WA 1K61A 4YG2F 2JA5J 3B6CA 1TC3C 5HLIA 1RZ4A 5IP6A 3W2AA 5F0CA 1SFEA 4Q48A 2DA1A 2VC0A 3GBGA 3PO3J 1LUJB 1MJ9A 2BOLA 1STZA 2WC2A 4MEXF 3JRAA 1WI3A 2DTZA 4WF2A 4IOCF 4LB6B 1P4WA 2Z5UA 2HTJA 4NC7A 2ADUA 2V6CA 5IT9K 4E4HA 3TOBA 1JTYA 1HCRA 1AKHB 3CDHA 1U2WA 1Z7LA 3DF8A 4A3LJ 1BOBA 1R6RA 3WTZA 3H5NA 5GPCA 3Q9VA 1D5VA 2K02A 3CDIA 3P7NA 5GAHJ 4C9YA 1PP7U 5H20A 3F0CA 1X1CA 4Y33A 2PMHA 2XRNA 2QEXI 4BJTA 4MFEA 4ZDLA 1IC8A 3O8HA 5E1ZB 4M3GA 4UNOA 2DA5A 1Z91A 3FX3A 4IVNA 2Z16A 2XKOA 2QQAA 1OKRA 2BY1A 4BKXA 5LGUA 4I0AA 2LY1A 1O7LA 4BUPA 3H3ZA 1HW5A 2IA0A 3V8KA 2HU9A 3IH4A 1T08B 1LKXA 1ZREA 2JPCA 2O7OA 2GA2A 4M73A 4PFOA 2W48A 2HZTA 3QU3A 2D5VA 2OQRA 4OU0A 1PUEE 1A31A 2RV8A 2WV0A 4CCJA 1QHHD 1UMQA 4OAYA 3I54A 1W1WE 4MQVA 2WWYA 1ZK8A 1X1DA 4G7OF 2VL8A 3W6KB 2NVUB 1W36D 3G1OA 2E1MC 1XDSA 4MNUA 3K0LA 1R36A 1WHUA 2DQLA 1Y0NA 2D1VA 4OINF 5TRDA 5IT3A 3MCZA 2HYJA 2IPQX 1ZRCA 5B66C 3LFUA 4RLQA 2ZXWH 5CVUA 4ASNA 1P92A 4EMSA 2NVTJ 2V26A 1V5FA 3OS0A 2F2EA 2YR2A 4RM2A 1X2MA 3HZJA 2PMZA 4ZTJA 4X6AJ 3K4LA 2NNYA 3VYSB 3DEUA 3HSFA 4E7IA 3ISPA 1PDNC 3DU5A 5DTDA 4HAMA 2DDBA 4V19K 2BBYA 1ONVA 1Z9CA 3H9QA 2DA6A 2QF7A 3QPHA 1W7PB 2XPVA 4FISA 5IYCJ 4RLFA 3OR2C 3GFJA 1FC3A 3KP2A 4F91B 2QWWA 3BCAA 5ICGA 4AIHA 3JAMK 4FX0A 1WSUA 1HQCA 2N8GA 4XLEA 2X6WA 2LG4A 4HSTA 3LL7A 2HFHA 2NOJB 3ZMZA 5CJ9A 4L9TA 2H8RA 3OSGA 1ZR2A 1HBXG 2DW4A 1MZBA 5H2FC 2A07F 1EF4A 3MEXA 2NS7A 2ZO4A 4BAYA 2GXAA 2CSOA 2JJ7A 4F93B 2CUFA 3IWFA 3FXMA 3ZQ7A 1QZYA 1R9TJ 1J5YA 3GFLA 3J81K 5FFXA 3IV5A 3IRQA 2DMNA 2CYYA 2JSPA 1FOYA 1B8IB 4M3FA 1N77A 4IOAF 3N97A 3VYTB 3RYPA 3HL2A 4KMFA 3JSOA 2CW8A 1Z6TA 1G3SA 1FZPB 2E1MB 3WE3A 2VPRA 4P9FA 1YITI 4L18B 3KPHA 2VBZA 2VPLA 3PQKA 1YI2I 1QRYA 4FTHA 2IA1A 4DZJA 3GYHX 1MD0A 2VASA 1NK2P 2ZXHA 5KK1A 3PM1A 2R7RA 3OY9A 1M1EB 4NHJA 2EH3A 3E6CC 4IHTA 5TISC 2YU9J 3ABMH 3FXUA 2R7UA 1G6NA 3V7SA 3HRSA 4C2TA 2ZJ2A 1FNNA 5JI6A 3HKZA 3KZYA 2DTRA 1ZRFA 5F0FA 4P5OA 2I5UA 1VNDA 1GXQA 4PGHA 1RUOA 4LIVA 4F3QA 5DD4A 2DCEA 1WCMJ 2KRFA 2L54A 1QO0D 3OS2A 4PJ0C 2KIFA 3VODA 2IGNA 4YIIA 3RDIA 2L9RA 4M9ZA 1BI2A 4A0ZA 1DGWY 2KLOA 3MKLA 2HTSA 3G6EI 1SVMA 4XRFA 4HLXA 3N05A 2WB1N 1MIJA 1JKPC 2FUG2 3RPQA 2JQ7A 5DYMA 1OCCH 1YS6A 4CCNA 1O57A 1XGNA 2W1OA 3K10A 5M5XJ 1RR8C 4BY7J 3ZQFA 3KZIC 3S17J 4L5IA 2FA5A 3A2KA 2R7OA 3DPTA 3BR3A 1X3ZB 4AYBN 4D5FA 1NG6A 2H27A 3GTKJ 2PJRA 1RR7A 3HG9A 1OYYA 3PNYA 4Y15A 1B9MA 1KQ8A 2DOAA 4ENMA 4C30A 2CQNA 4JX6A 3W6JB 3E97A 2FF4A 3DBRB 4N9IA 5CQEA 5FGMA 1ZELA 4G12A 5B3SH 3FBNB 2KKOA 1V55H 2XSJC 3AG2H 1B59A 4A3DJ 2Y75A 2VKHA 5JR3A 4C3JJ 2HKXA 1XCBA 3CTAA 3VEPA 4A0XA 3HOTA 1OFCX 3ZQQA 2UV1A 5F1JA 3WODF 3LMMA 4ETSA 3CCMI 2X6OA 2ME6A 5M3MJ 5BS6A 1V3FA 1AKHA 2W57A 2A5YB 3K2AA 2DA2A 4L5JA 2KFDA 4HA8A 1WGXA 2LVSA 2DT5A 2QA4I 1IN7A 1VI0A 4Q4ZF 1TW3A 2OJED 2VKVA 3AG3H 3QP6A 3FXOA 1WJCA 1SFXA 4NBQA 3GVAA 2GZWA 3HC7A 4DJAA 2KIUA 4KN7X 3IKTA 3BLYA 2XF7A 2QYOA 2X6XA 3KP6A 3ZR8X 3U1KA 4GFBA 3HTSB 1SAUA 3J7AO 1JUSA 1X3WB 2DA4A 2P0WA 1BJZA 4A3GJ 3E5XA 4DW6A 4IX7A 2VBYA 1HF0A 1YYVA 1A6QA 3ZPLA 2WAQA 3OYDA 2BVLA 1VQ4I 2ZFWA 3PNTA 4OMYA 1ULYA 5EEAA 1YW8A 2D1HA 2J5OA 1O3RA 3RPUD 1XTAA 4FASD 3F8BA 3L9FA 4BBSJ 2DODA 4A3CJ 2HR3A 4Z6YA 3GO5A 1IDZA 5JHFA 1D3YA 3J7YJ 3BTLA 3J7ZI 3HDDA 1MGTA 3H1CA 3HTUA 3S8PA 3H3UA 1DPRA 2FBKA 2R7FA 4Y3OA 1ERDA 2NS8A 3CCVI 4AVPA 4I76A 4ZDOA 2F4MB 5M5YJ 3F8MA 2LDUA 4D7MA 3KEQA 1MJBA 2JZYA 2FSWA 1HW2A 2IBDA 3LWFA 4RGRA 1GLNA 2FMYA 3CF5F 4ESJA 1W36C 2DOFA 4YIRX 5CKTA 1ZN2A 4C2MJ 2L3DA 1GHCA 4RAFA 4L9VA 4QPQA 3LSTA 1JUPA 3C3WA 4BQQA 1GVDA 2RKHA 1KGSA 4I02A 3BTJA 3FXJA 4DBRA 3LSKA 2B0LA 2AO9A 1R4MB 1RESA 4XOPA 1CF7B 1W7PA 3OSFA 1I50J 1O7FA 3DPLC 1MMDA 4KA4A 1U8RA 5KHDA 1HDPA 3E6DA 4ITVA 2E5ZA 3EYYA 4HNVA 3JRFA 2HQRA 4NDLA 2X85A 4II3A 4MHGA 3JSPA 6PAXA 2DMQA 3U9GA 2A5WA 3ECHA 4OMZA 3A02A 1YQAA 2OUMA 2UXXA 1R1VA 3OIOA 4I2OA 3RI4A 1JHHA 4KJZA 2CJJA 2CU7A 2XB0X 3U21A 2X0LA 2XSDC 1B8IA 3HOVJ 3WTXC 3CO6C 5GAEJ 4M71A 4IRHA 4G6DA 2TRTA 3BR5A 1D0ZA 3O6BB 3CUQC 2RAEA 1DPUA 2IRFG 3M07A 5EDNA 1H0MA 2ISYA 2EZIA 1Y8QB 2DFEA 5GADJ 1OR7C 3NAUA 2LYCA 2COBA 4CYDA 3HYIA 2O6GE 3BROA 4HPQA 4OOIA 2G7HA 4AIJA 4RGUA 4EGYA 2IA2A 1LNWA 1N75A 2ID6A 4B47A 1GXPA 4YFXF 1TWAJ 4IPAA 2Q1ZB 3LA2A 2GBYA 1IRXA 2K85A 4KICA 5CVJA 3JRDA 2ACJA 2OTJI 2XF6A 5ILUA 2W85A 2PEXA 3AG4H 1SFUA 3SXYA 2A3SA 3C2HA 2P7CB 2L02A 2CQ7A 2ZSHB 1JTXA 3D0SA 3BR2A 2F5DA 2VBXA 2NVXJ 3P9CA 2M30A 1WWXA 1FIPA 3OYCA 1R5ID 2DDAA 4MTDA 1J75A 1E3PA 4CH7A 5FJ8J 4RB0A 5FRMA 5LD2C 1G2HA 4XKVA 1BM9A 1HKTA 2E34A 2W25A 1MMSA 3VOEA 1V54H 1SD7A 2A6HF 3A1YA 4N9HA 4ZYHA 5J3LA 2E1NA 3BOQA 3VFZA 3TEDA 1K79A 3I4PA 5IYBJ 4CCKA 3WHBA 3I56I 4LOCA 5KAIC 3ASOH 2FU4A 3B02A 2DA3A 2O61A 2BHZA 1S3JA 1K6OA 2QSHX 3E0JB 2EJRA 4GXOA 3LQQA 3VPRA 3IH3A 2UWMA 3FZVA 1FOXA 3KP4A 4IO9F 3X2QH 2JK3A 4IHXA 3SEQA 1H8AC 2IJLA 2W00A 4IKFA 1VQ8I 3PNVA 3MVPA 5K5OA 3A4CA 3RQ4A 2GXBA 5CQGA 3MKWB 2KT0A 2R7DA 3KLOA 2X9DA 3OIPA 4XKCA 3VYRB 5K5RA 1Y6IA 1ZGJA 1I6HJ 5F27A 2MGQA 3SFIA 2F48A 4R79A 4YEJA 1CGPA 3R60A 3KLNA 3ML6A 2KPMA 4BGDA 1NH3A 3GEZA 4XL9A 5ERIA 3OYHA 1UHSA 5FO5A 1JE8A 1ZHFA 3PL8A 1GUUA 1WPKA 1T98A 3A01A 3TO7A 5IY5H 2IGKA 3OYMA 4Y4RA 1DU0A 3W6VA 5H6QA 3KEOA 4D5CA 3H35A 2Z3YA 4XN3A 4S05A 2E2HJ 4FX4A 1NTCA 2KMUA 3OYLA 4ENJA 1ETKA 3K69A 4FT8A 5F64A 5JFRA 3C1DA 2QVOA 3RCOA 2FXAA 1KZHA 3PSIA 2M0MA 2MD5A 2HS5A 1QHGA 1DQUA 5D5WB 3A0HC 4EATA 2DK5A 1IF1A 4UHTA 3C2BA 4UB6C 1D0XA 3GMEA 4G6QA 5AIPA 3VWBA 4E7KA 2LFBA 4Q47A 4LK1F 1BR2A 3QP5A 3QU6A 2NS0A 4GGGA 3S1MJ 1J2XA 3BG3A 2JPBA 2GOXB 2NYXA 3HOZJ 2OC6A 1S9HA 1TZLA 5DEQA 5F08A 2R5ZB 2VOOA 3G1MA 4IHSA 2PN6A 1HW1A 1LEBA 1OQYA 4MQ9F 4G9YA 1TQIA 1YE9A 4XLAA 3P9KA 2G0EA 2ZFUA 5J6XA 2MLGA 3CMAI 1APLC 4KFCA 2R7XA 4E70A 2VJ5A 5A2QZ 3H0GJ 3F6VA 3I5UA 1LDKB 4RAYA 2KIMA 1K6YA 2HEOA 4A3EJ 3LSJA 1BC7C 2HVSA 1Z6RA 2Y30A 2VODA 1Z7UA 4EJUA 3GTQJ 5ED4A 2NNNA 2YS9A 3DTIA 1V4RA 1TBXA 2BY2A 4IRGA 2P5LC 1RKTA 2L7FP 2M7BA 4L9NA 1IXRC 2FBIA 3HHHA 1YO5C 4KT5C 4AVZA 2M87A 1P4AA 4HV5A 4DQ2A 2HDCA 2MW8A 1VQLI 2RGVA 2VQGA 5J1YA 3CJNA 3HOYJ 3JRHA 3OYFA 1L3LA 4RMNA 4HF0A 1T0FC 5D5VB 2B9SA 2P5KA 2JMWA 2XGEA 4F7ZA 1EH6A 5JHUA 4RB2C 1SVLA 4LG0B 2Q8KA 2M4KA 2KJBA 1D1BA 2K4JA 1XSVA 1U6GA 2HPMA 3QPSA 1ETOA 1AHDP 2K27A 2XROA 4YFNF 1TNTA 3UNGC 1FP2A 2DT6A 3CDLA 4OWRB 3PFYA 4RB3C 1FSHA 4CCMA 3F8NA 2J5PA 2R7SA 1TQMA 1J7KA 3E1SA 4QPOA 2NXNB 3GW2A 2GAUA 1N25A 1RNLA 3FK7A 2YX4A 5E8IA 5FLXZ 1CF7A 5J1RA 2XAHA 2HWVA 3QRFF 4I09A 2EIMH 5F6FA 2FX0A 3H5AA 3S93A 4JK1X 2OCCH 4KYWA 2OPTA 3T1BA 1KONA 4AC0A 4DZPA 2CUEA 2CV0A 3ONQA 2WA0A 1JKRC 4AIKA 1EV7A 1OCRH 4F55A 3S15J 3JRIA 2GWRA 4GDFA 1HSTA 2E1OA 2FRHA 2ZJQF 4B48A 4DNCA 5E1XA 4EEFG 4HDVA 3DXJF 4XRMA 2XGDA 2XC7A 3DLLF 4ZYGA 1HC8A 3S16J 1WH5A 1IRFA 3HPGA 3TQNA 2OZ6A 4UUSA 2M4GA 2OQGA 4B4CA 2PX9A 4FQGA 4XORA 4QTRA 1JGSA 2VT3A 5JLWA 2K9QA 4KNYA 2HXIA 1LE8A 3GLXA 3WE2A 2EPFA 1BI3A 4IHVA 2H8WA 3ZN1A 2EFQA 1T2KA 1UAAA 2EWNA 3GTMJ 3H92A 1JGGA 3CCUI 2PBIA 3F9KA 2LY9A 1I1GA 2QKMB 4Y13A 1J9IA 1FWZA 5L3EA 3U1DA 2Z33A 4A5MA 4HF1A 4Q5SF 3LSMA 4M3DA 1R49A 1X1AA 3HOWJ 4ZYEA 3DV8A 3SEZA 1V5GA 3E5QA 2RC4A 1WQ2A 2Q0OA 3L2QA 5BNGA 3V7RA 4XIDA 2L7ZA 3BJOA 3LSRA 3L2CA 1MMNA 4UUVA 4BE0A 4PJLA 2VJ4A 2HQ5A 4EVIA 1OCTC 4CXFA 2Z99A 5D8LB 1FJLA 3E7LA 3CLQA 4IJAA 2LKPA 3JTHA 4LITA 4XLFA 2JA6J 1KQ9A 4XMYA 1B72A 3WTYC 4ABZA 5LGTA 3ZQGA 1B9NA 2VKEA 3W2VA 3R0JA 1LDDA 5HLTA 1S5LC 2AQFA 4B3AA 1IUYA 5L3BA 2DJNA 4J00A 4LK0F 3P9IA 3BJ6A 5ILSA 2HOAA 2LK2A 1S7EA 1TP4A 2KHMA 5IPAA 2M8EA 3KP5A 2ZXIA 2EFPA 4KIGA 2PMZN 4BQOA 4LLNA 4HQMA 3J7AY 2RDPA 3U2RA 1W5TA 3H9GA 2P4WA 3KETA 1VQ7I 2ZC2A 4U7DA 4AWXB 2JUCA 3KEYA 4H4KC 4MTEA 3HOXJ 3CUQA 2O3FA 3LAPA 2MH9A 2W84A 3ZGKA 3ZMSA 2EFNA 2E7XA 2MBFA 2RVCA 1OR7A 1ETVA 3CCLI 3BY6A 4HNUA 1OCOH 5CVRA 3RTRA 5E3NA 2LF7A 1RIOH 1YX5A 4KDPA 1QA6A 1FP1D 4LFUA 2QSFX 4XK4A 1RUNA 2STWA 4G6TB 2QQ9A 1AU7A 2ISZA 3FMRA 1ETWA 4WK8F 2VLAA 4XLPF 4KUMA 2CQXA 3EPZA 3PQJA 3K70D 5LGNA 5DS9A 1R00A 2E35A 2PFBA 3TDZC 2CGPA 2LH9A 2EBIA 1XSDA 2DYSH 1XMAA 4Y52J 5K7FA 3LSPA 4HX7A 3EYIA 2QUFA 3BP8A 3RKQA 5FFZA 3MMYB 3G3ZA 4DBQA 5HOOA 3FXRA 1BIAA 1K78A 4YIFA 1P7JA 2AXLA 2HKOA 1GV2A 1VTNC 2L9NA 4JYKA 4A93J 3K6GA 3DKWA 2MLKA 1K7AA 1FMWA 3HUGB 3OYGA 5JVGF 3HXLA 4D0PA 3E6MA 2HOEA 4IXAA 1UCRA 5D5UB 5BOXA 3M8JA 3QPLA 3J80Z 4G8XA 3TGNA 3K1PA 5EZHA 2DAOA 4BYYA 3HRTA 5FD6A 1DGRM 2DPUA 3BZCA 1F4KA 2STTA 2EV0A 1OPCA 4NUBA 5DM6F 3I4MJ 2Z1DA 2WADA 1UHMA 1NK3P 2F5FA 2O0YA 1G8XA 2HDWA 1PP8F 2AHQA 3ZP5A 1VQOI 5HNHA 2QBYB 3PUBA 1O3SA 2JA8J 3W3CA 3CQZJ 1XN7A 2FNPA 2ELHA 3QYBA 1SMTA 3Q0UA 3ZCOA 3ZOBA 4P55A 4IQJA 4QLCU 2F4IA 2F4OB 1ZTRA 3Q0VA 1Y39A 2V1UA 1JJ8C 2ESHA 1QNTA 3JREA 1S72I 1MW7A 3ECOA 3DEEA 5D6EA 1W4MA 3EUAA 4V2FA 1G4DA 2RREA 2CG4A 4XQFA 5HLGA 4HNTA 1BW5A 5EJCA 1POGA 2JA7J 1VQ5I 2BY0A 1F43A 3D1NI 3Q9SA 2WB1A 3CCYA 2Z2SB 1IGNA 3I4NJ 4PSWA 2CO5A 3DP7A 3FHZA 1KYWA 2E71A 2DXIA 2V1XA 1TWHJ 2VJJA 3TMOA 3S3OA 2L0KA 1KU2A 1P7IA 3ZMTA 4XLHA 4EM2A 3CCSI 1IDYA 4GYGA 1I6XA 2IAIA 1ZYRF 5K5QA 3KP3A 2COMA 3H9JA 1HLVA 1VQNI 3GLLA 2OBPA 1XX5A 3M8EA 2IS1A 4ZC3A 1ZLJA 2PI0A 4RB1A 3VB2A 2A6TA 4JBAA 1G3WA 5KNLA 2I8DA 5AONA 5J4YA 2M0CA 2M9HA 2LKXA 1SEUA 2ELJA 4CDGA 1X4PA 1KA8A 2O03A 2M5WA 3S3MA 3B73A 3HOSA 1K4SA 2M34A 1ETXA 4A3MJ 3M3YJ 2WV1A 1YW9A 4XRSA 3I0TA 2L2OA 4EJTA 1TW2A 2FBHA 4FHTA 4LIUA 3LSGA 3KIOA 2FOKA 3ZRGA 3S3NA 3HOUJ 2HXOA 1S7AA 1SD6A 2R93J 2AQEA 3BZ6A 3Q3SA 2KRHA 4Y17A 2R7ZJ 3QYFA 2HI3A 1YIOA 3CCQI 1T0FA 4QSHA 3MZ8A 2K9LA 3ULQB 2BVMA 1LFPA 3B6AA 1SFOJ 5L3CA 4MGRA 2OZUA 2W82A 3BG5A 3CJRB 1W5SA 4KIFA 3TO6A 1YW7A 2CQQA 2EZKA 3FM3A 4E7JA 1YRNB 2LSOA 4WXCA 1UG0A 4CYCB 4BU2A 4BBRJ 1I5ZA 1F1ZA 2BY3A 2DO7A 1TT5B 2XRLA 4G7ZF 4CCLA 2VQHA 2WAQN 1R58A 3M1CA 4X1EA 2CS3A 1LPQA 3AAFA 2R7WA 1A6IA 3OYEA 4IHWA 1JT6A 1O3TA 2LRDA 4XLCA 4HX8A 1VQMI 4HSRA 2YUSA 4B09A 3GCMA 5E18F 3M7GA 3COAC 1QZEA 1QVUA 4RGSA 3FXLA 1I3AA 5FD5A 3LSHA 4ZDPA 5GTIC 2M7AA 4CSWA 5FLMJ 1XS9A 5K1YA 2KL4A 4TV7A 4CGZA 2P7VB 2DLLA 1Y0UA 3ZN0A 1HDDC 9ANTA 1HA8A 2Y69H 4LJZF 5A2QK 3DTEA 1LQ1A 2R4GA 3GZNB 2VE8A 2DMTA 3GTJJ 3DKXA 1PYVA 5BPDA 4BHPA 1OYIA 5HDGA 1PUFB 3V8JA 1IXSB 4PJJA 2WAFA 4D1QA 2F5VA 4X0GA 5B1AH 3CO7C 3K2ZA 4GRIA 3FISA 1F9NA 5CPRB 1X19A 1PVEA 1UZCA 3P5JA 3S14J 2IVMA 2ZJRF 2EQRA 2KZGA 2XASA 3SDGA 4XRSG 5ILVA 1FMVA 1LFUP 3BJAA 2DYRH 1FX7A 3FKIJ 3S2DJ 4A2UA 4II2A 4D9JA 1TNSA 2NOGA 1FYMA 1ZH5A 5D4RA 5HLHA 1Q1HA 2XPWA 4RGXA 2BYVE 5LBQA 2YPRA 4HEA2 5AIQA 2NVQJ 2MH2A 3K9TA 2K9MA 3KYCB 3FIWA 1SC7A 1IN5A 1MNEA 1GV5A 1Z67A 3S1RJ 3HEFA 4FE4A 2XUBA 2FEZA 2Y48A 2G9WA 2ZKZA 1CQTA 1TT0A 1S8NA 2FQ3A 3A03A 4XNFA 1XSXA 4E7HA 2XB5A 1JKQC 3DQVC 3KYLA 2E1CA 2KQRA 2QCOA 5D5XB 5K7HA 3K70C 1HXDA 2MFZA 3F72A 5HODA 5FLXK 1BI0A 3TBIA 2P6SA 4HYEA 2VE9A 3O3KA 3ROUA 2ZJPF 2GXGA 3CJTB 3OV8A 1XG1A 2KISA 2PMUA 4BDZA 3HUGA 4RAGA 4Z2YA 3D5LA 3EDPA 5J8CA 3FF5A 3F8CA 2K3FA 2LD5A 5TJJA 2LY2A 2B7EA 3KFWX 3RKXA 5HS8A 2HOSA 3DKYA 3CF2A 2FD5A 5D8KB 2DQRA 1T95A 1HKSA 2NAZA 3WU1B 1FSEA 3AL0B 1G59A 4ZZLA 1ZG5A 3F3XA 1BR1A 2JSCA 3HSRA 2V9PA 1WJEA 2LBFB 2L9VA 2EFOA 1A35A 4KISA 4ENNA 4B43A 1KU3A 4XONA 1FBSA 4B8XA 2GOMA 2V1NA 1LEAA 1I27A 4U7BA 3L2UA 1E17A 1SANA 1IN6A 4XN0A 2KJCA 2UUZA 2XAUA 2ZBKA 4M74A 1QPMA 4AD9A 1YLFA 5ICEA 1E3OC 1RPWA 1BBYA 1YS7A 5HVQC 1WI9A 2IGOA 4A0YA 4W1UA 1MNDA 4PZJA 3WGHA 3KP7A 2KRCA 1HSJA 2EFWA 3HB9A 3L00A 1XB4A 1D8KA 4KN4X 1R5HA 2D45A 1ZKGA 1ITYA 4L0YB 4BE2A 1OJLA 2CUZA 4YRVA 5EYRA 4ZZDA 1WVRA 4WWCA 1ZLKA 2Q2EB 3SHFA 4HG2A 1YG2A 2BXYA 2DOEA 2LP0A 3WTTC 1T38A 4PK4A 2HOTA 1IN4A 3HHGA 2XIGA 1H89C 1FLIA 5DD8A 5EG0B 2ZSIB 2BHYA 5C3EJ 4L5EA 2V4JC 1ENHA 4PFPA 1W0UA 2QSGX 2YU3A 5E17F 5FKLA 2R0QC 4R8HA 4C3HJ 3K4BA 5JLXA 2YSRA 3WTWC 3CCJI 1UFMA 3IC7A 3M9AA 3MKYB 1U5TC 4UB8C 1OMIA 1MBFA 1QGPA 4PJNA 2DN0A 4KMUX 5J1UA 1JKOC 1WFXA 2ETHA 3TDUC 3AG1H 1K83J 3FHNA 5DCFA 4ANJA 5LLQA 1OLTA 3SZGA 3Q0WA 3Q5FA 1IN8A 1QZZA 3C18A 3L2WA 3GTPJ 4AM3A 1BA5A 4HDUA 4A5NA 2GQQA 1WJDA 2P81A 2VONA 3T8TA 2NVYJ 2OCEA 1HOMA 2XF5A 5J40A 2X1CA 1SAXA 3CC2I 1UELB 4RM3A 3QYEA 1ON1A 4ON0A 1UHWA 2DBBA 3OIQA 3WTSC 4DYRA 5FKMA 2CQKA 2CW0F 3OYKA 3K4KA 1YRNA 1Z3XA 4XKWA 4CYCA 1E3HA 4HRIA 3HGYA 1Z21A 4M9SA 4XOTA 1VZ0A 1OISA 4UY8I 2ZNYA 4A6DA 3RSNA 3DFGA 3S32A 1TTYA 2K86A 1IZ1A 2ID3A 4CO8A 2VIXA 4N4OB 5EEHA 3RJPA 4M6XA 3TKYA 3J80K 2EIJH 4KT6A 2HDDA 1BL0A 3GTGJ 1D1AA 1U5TB 3FM5A 4YELA 2LR8A 4QWQA 4S0HB 2Y0SN 4ZYAA 2W4SA 1XD7A 5IP7J 1A5JA 1USTA 1ODDA 4BS9A 3LA3A 3VDXA 2OD5A 2UXNA 3G2BA 3LNQA 2VXZA 3SDBA 1H88C 1W5CC 2DT7B 2MA3A 1GT0C 4DIQA 1MJAA 3ZMVA 5FB2A 4JOMA 5LHGA 3LAJA 2K5CA 1Y8RB 1U78A 3BR0A 4AU7A 4XLNF 4M3BA 1JJ6C 1U8BA 2EB7A 4M6YA 4U87A 4IRIA 2VKDA 3TW7A 2DFFA 3OYBA 2BGCA 4I01A 2QKLB 4U0VA 4NC6A 2HPIA 5BMZA 4MEYF 4UV8A 5FLVA 3ZQLA 3FXQA 3BCBA 3LFKA 4RS8A 4I6ZA 2Y9YA 3HRMA 3OYNA 4NQWB 3E6BA 5GAGJ 2R7TA 4XR6A 2G7UA 4BXXJ 5LHHA 4N4NB 2LTPA 5L3GA 2RQPA 5D4SA 2BEOA 1J59A 3TO9A 3JRGA 4KIBA 3AKZA 1R4NB 1KQ0A 1XGMA 2HVQA 3F22A 1D5YA 3BWGA 3IAS2 2ZB9A 3BPXA 1FBQA 2EZHA 2XAJA 2BE5F 2XPUA 3T0YA 3ABTA 1VQKI 1N78A 2CV1A 2DFHA 4WCGA 2P5VA 1P9QC 4K2EA 5DCMB 1S29A 2FMLA 4U88A 4UV9A 5EGOB 1LVAA 1XDUA 1MH3A 3ZMDA 5E8GA 3REOA 3CLOA 3MD2A 2HQNA 3ELKA 3BG7A 1TWFJ 1ZGAA 2V9VA 3QAHA 4UXNA 4UVCA 5B1BH 3M8FA 3IHUA 4D7NA 3O8GA 1SD5A 2E60A 1S6LA 1BC8C 4YFKF 3EUKL 2QQBA 2WTEA 5TGTA 3DU6A 1LFBA 1R5GA 1XGOA 3GF2A 1FEXA 1Y1VJ 2K4BA 2MD0A 2DU9A 1PJRA 2BW3B 3CC7I 3OMYA 4UVBA 3G73A 4UVAA 1XC5A 1ZG3A 2AXTC 4F52A 1X2NA 2LBFA 4BHCA 1FPQA 4A3JJ 2M2EA 2TCTA 4BHBA 3K4NA 2O8KA 2R7VA 2JVHA 2VBWA 1QVTA 3ZMUA 3RIRA 4B3XA 4BXFA 3NEUA 3ZXSA 2HYFA 5KAFC 4WXDA 4FE7A 4MFDA 4IL6C 4NB5A 2XV4S 1GDTA 3LOCA 3GXOA 3JCUC 2F6CA 2E19A 2XGCA 4AIDA 3CD6I 1YIJI 3DBHB 1HKQA 5IOYA 1YJWI 2R7QA 2Y31A 3F8FA 1EH7A 2ZCWA 1FY7A 1WKMA 1FYKA 1QBJA 1G3YA 5KCMA 5EEGA 2A68F
chains in the Genus database with same CATH topology
4F92B 2CFOA 2I8DA 5KNLA 2ELJA 4E7SA 1OR7C 2LYCA 1X4PA 4XKBA 3H0DA 3S3MA 4HPQA 3HOSA 1N75A 3DTKA 4B47A 2Q1ZB 1IRXA 4BEHA 2L2OA 2XF6A 2CW7A 4LIUA 3C2GA 3LSGA 2VB6A 3ZRGA 3S3NA 2WY7Q 2KDOA 3C2HA 2Y0SA 2AQEA 2KRHA 2LOOA 2ZSHB 3QYFA 2WAEA 2IGMA 3OYCA 3W2WA 3V42A 2K9LA 1QU3A 4CH7A 2BVMA 1LFPA 2K3PA 5FRMA 5LD2C 1DP3A 4XKVA 3CESA 2W82A 3VSKA 3HPHA 3CJRB 2IS4A 3OR1C 2PJRB 3FBIB 3A1YA 4E7JA 3I9V2 4NC8A 1UG0A 4BU2A 5FRNA 4CCKA 2M3AA 2CV2A 2KP6A 2CUJA 2V9KA 4CCLA 1MMAA 1WJ5A 2VQHA 3M1CA 2CS3A 3E0JB 2WBMA 4BDYA 2R7WA 3OYEA 2UWMA 1MMGA 4P1WA 2LRDA 4XLCA 4IZZA 3VSLA 4HSRA 3BC8A 3SEQA 3W2AA 5HNFA 2W00A 4IKFA 3PNVA 3A4CA 3GBGA 3RQ4A 3LSHA 5CQGA 4ZDPA 3KX2A 3MKWB 2M7AA 3OIPA 4CSWA 4XKCA 3VYRB 2BOLA 1Y6IA 2KL4A 4R79A 4YEJA 1D0ZA 2W7NA 2KPMA 4BGDA 4NC7A 1HA8A 4XL9A 3DTEA 4E4HA 2R4GA 4CA0A 3OYHA 3PL8A 3DKXA 1PYVA 1Z7LA 4JQFA 4C2UA 1BOBA 1R6RA 3H5NA 2IGKA 1J09A 3OYMA 4PJJA 2WAFA 4Y4RA 4C9YA 2F5VA 4D1QA 4X0GA 1X1CA 4Y33A 3H35A 4GRIA 5LFAA 4XN3A 4BJTA 4ZDLA 5CPRB 1X19A 2KMUA 3OYLA 4E7ZA 3QODA 2Z16A 3QOEA 3RCOA 2HQAA 2LY1A 4BUPA 1FMVA 3PSIA 2M0MA 1QHGA 1DQUA 2HU9A 1LKXA 2X6YA 4II2A 4D9JA 4EATA 5FROA 4BL0B 1D0XA 2L7KA 3EUHC 3DWLE 3VWBA 2CMPA 4PFOA 4E7KA 1BR2A 4HEA2 2K9MA 1X4OA 2GOXB 1MNEA 4J01A 2OC6A 4CCJA 1S9HA 1TZLA 1EA3A 1QHHD 4OAYA 3NWTA 4E7LA 1YE9A 1X1DA 4XLAA 1TT0A 4AYBA 2ZFUA 2VL8A 3D5SC 4XNFA 4E7HA 1W36D 2E1MC 3DQVC 4ZTFA 3KYLA 2R7XA 2KQRA 2VJ5A 3K70C 2MFZA 1LDKB 3LFUA 4RLQA 3TBIA 1K6YA 4ZJZA 3UR3C 2HVRA 2HVSA 3CMMA 2V26A 1V5FA 3OS0A 4BDZA 4RM2A 2PMZA 1JI8A 3D5LA 3DTIA 3IAM2 2VJIA 4ZTJA 3DPUA 2M7BA 3K4LA 2LY2A 3VYSB 1Z3YA 4E7IA 2X1EA 2VQCA 3DKYA 3DU5A 4AVZA 4DOZA 3CF2A 2IS6A 1T95A 4B44A 4FETA 3H9QA 2VQGA 3AL0B 4RLFA 3OR2C 1G59A 4F91B 3OYFA 4BE1A 4RMNA 3BCAA 1BR1A 1T0FC 1WJEA 2LBFB 4XLEA 2X6WA 2LG4A 4HSTA 4KISA 3LL7A 2NOJB 1Y56A 4B43A 4XONA 2GOMA 2V1NA 2XDVA 1V5EA 2M4KA 1D1BA 4U7BA 3L2UA 2HPMA 4XN0A 2UUZA 2XAUA 2V7FA 1BR4A 3UNGC 3AFHA 2DT6A 4OWRB 3PFYA 5HVQC 3K4CA 4CCMA 2IGOA 2R7SA 4F93B 1MNDA 3K4JA 2OV7A 3E1SA 4QPOA 2IS2A 2KRCA 2JSPA 1N77A 3VYTB 3HL2A 2CW8A 2BW3A 3S93A 3OL3A 2CUZA 2E1MB 3H5AA 4YRVA 3IUOA 4BE2A 3IP4B 2VPLA 1KONA 2HNHA 2Q2EB 4HG2A 2CV0A 3ONQA 2WA0A 1U0JA 4PK4A 4F55A 3CJQB 2VASA 3H5RA 2ZXHA 2ZSIB 4CZCA 4B48A 4BEHB 2R7RA 3OY9A 3K4MA 2V4JC 2LREA 2XC7A 4PFPA 2R7UA 3HPGA 2M4GA 4XORA 2CH0A 4C2TA 3K4BA 1WJBA 3HKZA 3AL0C 3BG6A 1NG7A 3MKYB 4P5OA 1UAAA 4PJNA 2RNGA 3SYTA 4LIVA 3F9KA 4F3QA 1WFXA 2E5NA 2DCEA 2QKMB 3FHNA 2HZDA 4ANJA 3OS2A 2IGNA 4PUSA 1OLTA 3SZGA 4PSXA 1DGWY 2KLOA 3LSMA 4BQNA 3L2WA 3FKJA 1X1AA 3N05A 3SEZA 1V5GA 1WJDA 2L9SA 2FUG2 3L2QA 3TL4X 1MMNA 4NNJA 4PJLA 4CCNA 4BE0A 2W1OA 3K10A 2XF5A 2VJ4A 2X1CA 2LC2A 3VYUB 4DGWB 1UELB 4XLFA 4LITA 4RM3A 3QYEA 4XMYA 3A2KA 2R7OA 3OIQA 3DPTA 3CP2A 3OYKA 1NG6A 3W2VA 2PJRA 3K4KA 1Z3XA 2VXDA 3HG9A 4XKWA 5HLTA 2AQFA 3PNYA 4HRIA 4J00A 3L2VA 1Z21A 2DOAA 4XOTA 1VZ0A 4C30A 3RSNA 2KHMA 2MYSA 3S32A 5CQEA 2ZXIA 1ZELA 2VIXA 4BQOA 4N4OB 3FBNB 3J7AY 2XSJC 3H9GA 3I3LA 3NWSA 3OYJA 1X1BA 2VKHA 3KEYA 4H4KC 4KT6A 1D1AA 3MKZA 3HOTA 2IXSA 3ZQQA 4YELA 3ZGKA 2UV1A 4ZYAA 2MC4A 2W4SA 1SFKA 3LMMA 4HNUA 1WJAA 3RTRA 4BS9A 4CUGA 1YX5A 3VDXA 3G2BA 2VXZA 3SDBA 4G6TB 2L5QA 3OYAA 2DT7B 4DIQA 4OAZA 4JOMA 1LVKA 2VLAA 3EPZA 2K5CA 3FDYA 3K70D 2DJIA 4AU7A 4BJ5C 2LH9A 1WJCA 3HC7A 4E6KG 4U87A 4DJAA 2VKDA 2VQLA 3BLYA 3OYBA 2XF7A 2X6XA 3MMYB 2QKLB 3ZR8X 4DBQA 2HPIA 5HOOA 1SAUA 2P0WA 3BCBA 4IX7A 3LSIA 2L9NA 3OYNA 3K6GA 2WAQA 4NQWB 3OYDA 2BVLA 1FMWA 3HUGB 2R7TA 3OYGA 3PNTA 4XR6A 3HXLA 1WJFA 2JUGA 4N4NB 3RPUD 4FASD 3M8JA 3AKZA 4MLOA 2HVQA 5JHFA 3IAS2 1DGRM 2O5RA 2RQQA 1E0EA 4NUBA 3S8PA 2KZVA 2Z1DA 2WY8Q 2WADA 1N78A 4KITB 2CV1A 4Y3OA 1G8XA 1ERDA 2X1DA 2HDWA 1P9QC 4ZDOA 4XM3A 5HNHA 3PUBA 3W3CA 3OL4A 4IQ4A 3QYBA 3OOUA 3MD2A 1GLNA 1W36C 3PJRA 3BG7A 3ZCOA 5CKTA 4IQJA 4BJ6C 2F4IA 2E60A 4LG3A 4QPQA 1YX3A 4BQQA 3EUKL 4CCOA 2MABA 5TGTA 3DU6A 4DBRA 3D5RC 3LSKA 3CZ6A 1MW7A 4XOPA 2MD0A 3CP8A 3PSFA 3DEEA 1PJRA 2BW3B 3DPLC 1MMDA 3OMYA 5KHDA 3EUAA 4F52A 2RREA 4XQFA 4HNTA 2LBFA 4ITVA 1D0YA 2E5ZA 3K4NA 2JVGA 2R7VA 2X85A 4II3A 2WB1A 2Z2SB 2JVHA 4PSWA 3DLAA 4B3XA 4BXFA 2A5WA 3ZXSA 2DXIA 2OUMA 2VJJA 3OS1A 3OYIA 3OWTA 3TMOA 1AA7A 3S3OA 2F6CA 4KJZA 4XLHA 4PJMA 3U21A 2X51A 2R7QA 2JA2A 2V6EA 4BACA 3H9JA 2IS1A 3L2RA 4ZC3A 5KCMA 1D1CA 2A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRV A;  3QOD A;  4HRI A;  4J00 A;  4IZZ A;  3QOE A;  4J01 A; 
#chains in the Genus database with same CATH topology
 4F92 B;  2B63 J;  2CFO A;  3RKW A;  2XKP A;  2Q2E A;  4E7S A;  5HS9 A;  2X4H A;  2M1B A;  1IJW C;  5E20 A;  4A3B J;  1EKE A;  5EG0 A;  1BOA A;  3DCF A;  3I53 A;  2QEN A;  3T8R A;  3JRC A;  2LF8 A;  1ZG1 A;  2A69 F;  4JX5 A;  2IW5 A;  1JT0 A;  2BXZ A;  5LRS A;  3WGI A;  2KIQ A;  3M1E A;  1BI1 A;  2LOO A;  2ZME C;  2WAE A;  2E2I J;  4BQA A;  3WG7 H;  2IGM A;  1KU9 A;  3QPT A;  4PDK A;  2A61 A;  3V42 A;  1KU7 A;  2R92 J;  3G4S I;  4WX9 A;  1QU3 A;  3MZY A;  1R7J A;  1X3U A;  5GP9 A;  4P96 A;  2E7W A;  3ABK H;  3HPH A;  2IS4 A;  1DP7 P;  1B4A A;  3FBI B;  2GIZ A;  3PO2 J;  1VF9 A;  1R1U A;  5FRN A;  2M3A A;  3JR9 A;  2CUJ A;  2V9K A;  3SZP A;  1IW7 F;  1WJ5 A;  3IWZ A;  5H6R A;  4EGZ A;  4I98 B;  1ETQ A;  4ESB A;  4BDY A;  2I10 A;  2ELK A;  1H9G A;  2L01 A;  4N0B A;  4B1R A;  1LDJ A;  4HX4 A;  4EJV A;  1IV6 A;  2LKS A;  4IZZ A;  3RZO J;  3I59 B;  3VSL A;  2R5Z A;  4EM1 A;  2ESN A;  3BC8 A;  4PCQ A;  5HNF A;  1FTT A;  3I71 A;  1B1B A;  4R1H A;  3KX2 A;  2EIK H;  2D2W A;  4HZF A;  1I39 A;  1R1T A;  3S1N J;  4A12 A;  1BIB A;  2R3S A;  4BH9 A;  2W7N A;  4WXH A;  3GZ6 A;  3HKZ N;  1XMK A;  1QQI A;  5BQT A;  1MNM C;  4DYC A;  3L1P A;  1LB2 A;  3CC4 I;  4CA0 A;  1YHQ I;  1D8J A;  1IO2 A;  2FOW A;  4JQF A;  2ZNZ A;  2R5Y B;  4OIO F;  1SVO A;  4C2U A;  5DUK A;  2V79 A;  5IP9 J;  1J09 A;  1RC9 A;  4JX4 A;  5E3O A;  1MDM B;  2Y9Z A;  2K9S A;  1ORK A;  1VQ9 I;  5HDN A;  1T56 A;  5LFA A;  1VQP I;  5E79 C;  2DI3 A;  3WU2 C;  2ZME B;  2L4M A;  5IYD J;  4HW0 A;  1TWG J;  4E7Z A;  3QOD A;  3R4K A;  5FKN A;  3QOE A;  2OTL I;  2HQA A;  1U5T A;  2Y2Z A;  5ICF A;  1ZGW A;  3DBL B;  1R22 A;  4ZH4 F;  2X6Y A;  1X1P A;  2VN2 A;  3K1N A;  5FRO A;  4BL0 B;  2L7K A;  3EUH C;  3DWL E;  4LG0 A;  2CMP A;  5IOZ A;  3GX4 X;  4LD5 A;  1Z77 A;  3NRV A;  1ZRD A;  4A3K J;  2H94 A;  1ZAR A;  3ASN H;  5DV5 A;  3I58 A;  1A36 A;  2FE3 A;  1X4O A;  5E1W A;  3MN2 A;  3EET A;  4J01 A;  1WH7 A;  5CVI A;  1EA3 A;  3NWT A;  4E7L A;  5DUI A;  4GYI A;  2VC1 A;  1IRG A;  4AYB A;  4ENK A;  1LJ9 A;  1YTY A;  3D5S C;  1IG7 A;  1USS A;  4A3I J;  2RN7 A;  4ZTF A;  2CRG A;  1OYW A;  3I64 A;  2VOP A;  5IT9 Z;  2OF7 A;  2BZT A;  2IEK A;  1FOK A;  3ABL H;  4ZJZ A;  3UR3 C;  1FYL A;  2HVR A;  3CMM A;  4NQW A;  3NQO A;  3PFI A;  1ZR4 A;  3A01 B;  3UKG A;  1JI8 A;  3A0B C;  3IAM 2;  2VJI A;  5LRR A;  4HLY A;  1REP C;  3DPU A;  2L4A A;  4I0B A;  3QWL A;  3PIP F;  3IH2 A;  2GA1 A;  4IF4 A;  2UZK A;  1W0T A;  1Z3Y A;  2X1E A;  2VQC A;  4C3I J;  2C6Y A;  4DOZ A;  3IRR A;  2IS6 A;  3HGG A;  3RYR A;  4B44 A;  4FET A;  3JRB A;  4CZZ A;  1E2X A;  3CME I;  4BE1 A;  3IKV A;  1Z1D A;  3ESW B;  1O4X A;  5CYV A;  3RPU A;  2A6E F;  3BQY A;  2H6C A;  5DCM A;  2JN6 A;  2PQ8 A;  3ZQC A;  1Y56 A;  5EGO A;  1G3T A;  2IT0 A;  1IV8 A;  2XDV A;  4GCV A;  1V5E A;  2OU2 A;  1BN5 A;  3IL2 A;  4HBL A;  1YFH A;  2V7F A;  2ICW G;  1BR4 A;  2BV6 A;  3AFH A;  2E36 A;  4EQQ A;  2QGU A;  3K4C A;  5DM7 F;  4J19 A;  2P8T A;  4EJW A;  1R71 A;  3K4J A;  2OV7 A;  2IS2 A;  2XAF A;  5EF6 A;  1XGS A;  5J4V A;  4MIM A;  5L3D A;  3SQN A;  3MZH A;  5CLS A;  4BXU A;  1RET A;  1K4T A;  2BW3 A;  1QPI A;  4EV0 A;  3DEW A;  3OL3 A;  3HM5 A;  3IUO A;  3IP4 B;  4O3M A;  1ACI A;  3G1L A;  5DDG A;  1U9O A;  2HNH A;  1X58 A;  3T5X A;  3HRU A;  1XMX A;  1U0J A;  3BPV A;  2PLY A;  3SFZ A;  4RA2 A;  1GVJ A;  4P9U A;  3CJQ B;  3H5R A;  2DFI A;  2M8G X;  2OAZ A;  2GM4 A;  5C4X J;  1YOV B;  4CZC A;  4MO7 A;  4BEH B;  1I3Q J;  1OCP A;  3K4M A;  3RZD J;  2EZL A;  2LRE A;  3JAM Z;  2M45 A;  3F23 A;  2JRM A;  1VFC A;  5LEK A;  2CH0 A;  2P6T A;  3L7W A;  1WJB A;  3ZQI A;  3S1Q J;  3AL0 C;  3GUD A;  3BG6 A;  3SJM A;  1NG7 A;  2JTV A;  2IP2 A;  3FK6 A;  3FWE A;  1U9N A;  4XSX F;  2A05 A;  2PG4 A;  4IHY A;  2RNG A;  2QLZ A;  3SYT A;  1YJ9 I;  2EA4 A;  2E5N A;  1H9T A;  3HIF A;  5LHI A;  1DUX C;  2TDX A;  3F6O A;  2HZD A;  5LEJ A;  2H1K A;  4PUS A;  3J81 Z;  1ZAO A;  2ME0 A;  4PSX A;  1FBU A;  4BQN A;  3TP3 A;  3HJE A;  2JWT A;  3FKJ A;  4HOB A;  4W97 A;  2ECB A;  1ON2 A;  2L9S A;  1P6R A;  4H0E A;  1TL8 A;  2GLO A;  3TL4 X;  3GFI A;  1L0O C;  1Y1W J;  3BDD A;  3N4M A;  2YX7 A;  4LLL A;  4NNJ A;  3KE2 A;  2X48 A;  3ERM A;  2EIN H;  3VYU B;  1F36 A;  2LC2 A;  5ICC A;  4DGW B;  1BW6 A;  1UG2 A;  2H1L A;  3JTG A;  1IXC A;  1XPX A;  2XAQ A;  3MFK A;  5J8F A;  1TLH B;  3CP2 A;  3GWZ A;  4V2G A;  2Y0M A;  3GZ5 A;  1EJ9 A;  4OIR F;  1RRJ A;  2JRT A;  2VXD A;  4LGW A;  3PIO F;  1F5T A;  3BR6 A;  2XAG A;  3WTV C;  1W7P D;  3L2V A;  4HF2 A;  1FTZ A;  2EV6 A;  2K7L A;  1IRZ A;  1R23 A;  2MYS A;  1AOY A;  4UUS B;  5FKK A;  3E3V A;  3F21 A;  3BR1 A;  2F5C A;  2DK8 A;  1WZ2 A;  1LE8 B;  4HV6 A;  3I55 I;  3I59 A;  3I3L A;  3NWS A;  3OYJ A;  4LB5 A;  1IUF A;  4JP0 A;  1X1B A;  3TW6 A;  5BPI A;  2VUM J;  1EH8 A;  3MKZ A;  5E3L A;  4U0Y A;  3OOP A;  2IXS A;  3E5U A;  3FMQ A;  2QBY A;  2MC4 A;  2V1D A;  1SFK A;  3EQL F;  1WJA A;  2W24 A;  4M6V A;  3RQI A;  4CUG A;  2CWE A;  4EM0 B;  1C0W A;  5HDK A;  5K7Z A;  1Z05 A;  1T6S A;  2L5Q A;  3OYA A;  2LLK A;  4OAZ A;  2R5Y A;  4UUT A;  1LVK A;  4I7H A;  3M4O J;  1MBH A;  1MDM A;  3FDY A;  4XSZ F;  2DJI A;  3RKY A;  3C7J A;  4BJ5 C;  2AS5 F;  4XIC A;  2ZME A;  4E6K G;  1FOW A;  1JUM A;  2VQL A;  2FQ4 A;  1XCV A;  3BG9 A;  1B72 B;  3O2P E;  3V7C A;  4RAZ A;  4BY1 J;  3K7A J;  1JHF A;  5C4J J;  1MBK A;  2EV5 A;  2QZ8 A;  2LNB A;  3BT9 A;  1KYZ A;  1T33 A;  1O3Q A;  3G71 I;  3LSI A;  1ZQ3 P;  4XBF A;  1MSF C;  2FJ1 A;  1IAW A;  3HSE A;  3FMS A;  1WJF A;  3KCC A;  2JUG A;  2O9L A;  4MLO A;  4GO1 A;  3CCR I;  1OCZ H;  3CCE I;  3WG9 A;  3WHC A;  3KYD B;  4L0Z B;  2CFX A;  2O5R A;  2RQQ A;  2XHK A;  2H09 A;  2K9N A;  4RDU A;  1E0E A;  5EZG A;  2KZV A;  4QIW N;  2WY8 Q;  3V4G A;  4KIT B;  4CHU A;  3CUQ B;  2L7M P;  5B5E C;  2X1D A;  1DU6 A;  2MC3 A;  1VQ6 I;  1MBE A;  4XM3 A;  3BTI A;  1ETY A;  3LA7 A;  2VT2 A;  3L09 A;  3OL4 A;  2XVC A;  1P2F A;  3FXK A;  3R61 A;  4IQ4 A;  4IEJ A;  1I1S A;  1MKM A;  3OOU A;  4Y7N J;  3PJR A;  5HS7 A;  1SMY F;  3TP0 A;  1U3E M;  2MG4 A;  4O6J A;  4BJ6 C;  4RBO A;  3BTC A;  5F04 A;  4LG3 A;  3V8L A;  1YX3 A;  4CCO A;  2EIL H;  2MAB A;  4CIC A;  3D5R C;  5L3F A;  4HQE A;  3WU0 A;  4OIQ F;  3CZ6 A;  1MBG A;  3R0A A;  1P4X A;  3CP8 A;  4G94 A;  3PSF A;  4LMY A;  1MBJ A;  3JW4 A;  3TOA A;  2HGC A;  1Z0X A;  1K78 B;  5J47 A;  5E3M A;  3MWM A;  5C44 J;  3S2H J;  1D0Y A;  2RNJ A;  1SD4 A;  4S04 A;  2GIV A;  5FKO A;  2E2J J;  2JVG A;  4U0W A;  1UB9 A;  3BQZ A;  3GFM A;  2K40 A;  3DLA A;  4LLG F;  4O5V A;  2LMD A;  3EUH A;  4M9X A;  2OA4 A;  3OS1 A;  3OYI A;  3OWT A;  3CUO A;  1AA7 A;  2DMP A;  1A04 A;  3GTO J;  4PJM A;  4A6E A;  2X51 A;  3QQA A;  2JT1 A;  2JA2 A;  2V6E A;  5F0H A;  4BAC A;  1B6A A;  5D6F A;  3K1M A;  3CMY A;  3ZQH A;  3L2R A;  1J0R A;  2KDZ A;  4FCY A;  1TQP A;  1D1C A;  3GTL J;  1DDN A;  3H3V K;  2PJP A;  2EA2 A;  4BNC A;  5JVT A;  4A69 C;  1YJN I;  3NAR A;  3HBL A;  4EJO A;  4XKB A;  3H0D A;  2XGX A;  1T8I A;  1AWC A;  4OIP F;  5M3F J;  1FT9 A;  1JXS A;  4I99 C;  2EK5 A;  4A3F J;  1T39 A;  2ZXJ A;  3DTK A;  2VI6 A;  1RI7 A;  3SZT A;  2HYG D;  2DMU A;  1MSE C;  4BEH A;  4M3E A;  1Q1V A;  2CW7 A;  1PUF A;  3QOP A;  3C2G A;  1FIA A;  2DPD A;  1NHA A;  2VB6 A;  3PUF A;  1BJA A;  2DA7 A;  2WY7 Q;  2KDO A;  2FNA A;  2Z9O A;  2Y0S A;  4L9J A;  2MSY A;  3BZK A;  3ABU A;  1TWC J;  3W2W A;  2H6B A;  2K3P A;  1MH4 A;  2QM3 A;  3LQR A;  1RKW A;  1WRJ A;  2ECC A;  1DP3 A;  3CES A;  3VSK A;  4ZYD A;  2O8X A;  5M5W J;  3OR1 C;  3MAJ A;  4ESF A;  2PJR B;  1UJ8 A;  3I9V 2;  4NC8 A;  5CVV A;  4DYQ A;  5GTH C;  2NRA C;  2F5E A;  3ERE D;  4AUX A;  3R6S A;  2KP6 A;  2CV2 A;  3H36 A;  3KZZ A;  3MQ0 A;  4PGG A;  5GPA A;  1MMA A;  4M72 A;  4G7H F;  2QQ8 A;  5KVR A;  1S7O A;  5F1R A;  2WBM A;  3S2W A;  3WGG A;  1MMG A;  3WTU C;  4P1W A;  1K61 A;  4YG2 F;  2JA5 J;  3B6C A;  1TC3 C;  5HLI A;  1RZ4 A;  5IP6 A;  3W2A A;  5F0C A;  1SFE A;  4Q48 A;  2DA1 A;  2VC0 A;  3GBG A;  3PO3 J;  1LUJ B;  1MJ9 A;  2BOL A;  1STZ A;  2WC2 A;  4MEX F;  3JRA A;  1WI3 A;  2DTZ A;  4WF2 A;  4IOC F;  4LB6 B;  1P4W A;  2Z5U A;  2HTJ A;  4NC7 A;  2ADU A;  2V6C A;  5IT9 K;  4E4H A;  3TOB A;  1JTY A;  1HCR A;  1AKH B;  3CDH A;  1U2W A;  1Z7L A;  3DF8 A;  4A3L J;  1BOB A;  1R6R A;  3WTZ A;  3H5N A;  5GPC A;  3Q9V A;  1D5V A;  2K02 A;  3CDI A;  3P7N A;  5GAH J;  4C9Y A;  1PP7 U;  5H20 A;  3F0C A;  1X1C A;  4Y33 A;  2PMH A;  2XRN A;  2QEX I;  4BJT A;  4MFE A;  4ZDL A;  1IC8 A;  3O8H A;  5E1Z B;  4M3G A;  4UNO A;  2DA5 A;  1Z91 A;  3FX3 A;  4IVN A;  2Z16 A;  2XKO A;  2QQA A;  1OKR A;  2BY1 A;  4BKX A;  5LGU A;  4I0A A;  2LY1 A;  1O7L A;  4BUP A;  3H3Z A;  1HW5 A;  2IA0 A;  3V8K A;  2HU9 A;  3IH4 A;  1T08 B;  1LKX A;  1ZRE A;  2JPC A;  2O7O A;  2GA2 A;  4M73 A;  4PFO A;  2W48 A;  2HZT A;  3QU3 A;  2D5V A;  2OQR A;  4OU0 A;  1PUE E;  1A31 A;  2RV8 A;  2WV0 A;  4CCJ A;  1QHH D;  1UMQ A;  4OAY A;  3I54 A;  1W1W E;  4MQV A;  2WWY A;  1ZK8 A;  1X1D A;  4G7O F;  2VL8 A;  3W6K B;  2NVU B;  1W36 D;  3G1O A;  2E1M C;  1XDS A;  4MNU A;  3K0L A;  1R36 A;  1WHU A;  2DQL A;  1Y0N A;  2D1V A;  4OIN F;  5TRD A;  5IT3 A;  3MCZ A;  2HYJ A;  2IPQ X;  1ZRC A;  5B66 C;  3LFU A;  4RLQ A;  2ZXW H;  5CVU A;  4ASN A;  1P92 A;  4EMS A;  2NVT J;  2V26 A;  1V5F A;  3OS0 A;  2F2E A;  2YR2 A;  4RM2 A;  1X2M A;  3HZJ A;  2PMZ A;  4ZTJ A;  4X6A J;  3K4L A;  2NNY A;  3VYS B;  3DEU A;  3HSF A;  4E7I A;  3ISP A;  1PDN C;  3DU5 A;  5DTD A;  4HAM A;  2DDB A;  4V19 K;  2BBY A;  1ONV A;  1Z9C A;  3H9Q A;  2DA6 A;  2QF7 A;  3QPH A;  1W7P B;  2XPV A;  4FIS A;  5IYC J;  4RLF A;  3OR2 C;  3GFJ A;  1FC3 A;  3KP2 A;  4F91 B;  2QWW A;  3BCA A;  5ICG A;  4AIH A;  3JAM K;  4FX0 A;  1WSU A;  1HQC A;  2N8G A;  4XLE A;  2X6W A;  2LG4 A;  4HST A;  3LL7 A;  2HFH A;  2NOJ B;  3ZMZ A;  5CJ9 A;  4L9T A;  2H8R A;  3OSG A;  1ZR2 A;  1HBX G;  2DW4 A;  1MZB A;  5H2F C;  2A07 F;  1EF4 A;  3MEX A;  2NS7 A;  2ZO4 A;  4BAY A;  2GXA A;  2CSO A;  2JJ7 A;  4F93 B;  2CUF A;  3IWF A;  3FXM A;  3ZQ7 A;  1QZY A;  1R9T J;  1J5Y A;  3GFL A;  3J81 K;  5FFX A;  3IV5 A;  3IRQ A;  2DMN A;  2CYY A;  2JSP A;  1FOY A;  1B8I B;  4M3F A;  1N77 A;  4IOA F;  3N97 A;  3VYT B;  3RYP A;  3HL2 A;  4KMF A;  3JSO A;  2CW8 A;  1Z6T A;  1G3S A;  1FZP B;  2E1M B;  3WE3 A;  2VPR A;  4P9F A;  1YIT I;  4L18 B;  3KPH A;  2VBZ A;  2VPL A;  3PQK A;  1YI2 I;  1QRY A;  4FTH A;  2IA1 A;  4DZJ A;  3GYH X;  1MD0 A;  2VAS A;  1NK2 P;  2ZXH A;  5KK1 A;  3PM1 A;  2R7R A;  3OY9 A;  1M1E B;  4NHJ A;  2EH3 A;  3E6C C;  4IHT A;  5TIS C;  2YU9 J;  3ABM H;  3FXU A;  2R7U A;  1G6N A;  3V7S A;  3HRS A;  4C2T A;  2ZJ2 A;  1FNN A;  5JI6 A;  3HKZ A;  3KZY A;  2DTR A;  1ZRF A;  5F0F A;  4P5O A;  2I5U A;  1VND A;  1GXQ A;  4PGH A;  1RUO A;  4LIV A;  4F3Q A;  5DD4 A;  2DCE A;  1WCM J;  2KRF A;  2L54 A;  1QO0 D;  3OS2 A;  4PJ0 C;  2KIF A;  3VOD A;  2IGN A;  4YII A;  3RDI A;  2L9R A;  4M9Z A;  1BI2 A;  4A0Z A;  1DGW Y;  2KLO A;  3MKL A;  2HTS A;  3G6E I;  1SVM A;  4XRF A;  4HLX A;  3N05 A;  2WB1 N;  1MIJ A;  1JKP C;  2FUG 2;  3RPQ A;  2JQ7 A;  5DYM A;  1OCC H;  1YS6 A;  4CCN A;  1O57 A;  1XGN A;  2W1O A;  3K10 A;  5M5X J;  1RR8 C;  4BY7 J;  3ZQF A;  3KZI C;  3S17 J;  4L5I A;  2FA5 A;  3A2K A;  2R7O A;  3DPT A;  3BR3 A;  1X3Z B;  4AYB N;  4D5F A;  1NG6 A;  2H27 A;  3GTK J;  2PJR A;  1RR7 A;  3HG9 A;  1OYY A;  3PNY A;  4Y15 A;  1B9M A;  1KQ8 A;  2DOA A;  4ENM A;  4C30 A;  2CQN A;  4JX6 A;  3W6J B;  3E97 A;  2FF4 A;  3DBR B;  4N9I A;  5CQE A;  5FGM A;  1ZEL A;  4G12 A;  5B3S H;  3FBN B;  2KKO A;  1V55 H;  2XSJ C;  3AG2 H;  1B59 A;  4A3D J;  2Y75 A;  2VKH A;  5JR3 A;  4C3J J;  2HKX A;  1XCB A;  3CTA A;  3VEP A;  4A0X A;  3HOT A;  1OFC X;  3ZQQ A;  2UV1 A;  5F1J A;  3WOD F;  3LMM A;  4ETS A;  3CCM I;  2X6O A;  2ME6 A;  5M3M J;  5BS6 A;  1V3F A;  1AKH A;  2W57 A;  2A5Y B;  3K2A A;  2DA2 A;  4L5J A;  2KFD A;  4HA8 A;  1WGX A;  2LVS A;  2DT5 A;  2QA4 I;  1IN7 A;  1VI0 A;  4Q4Z F;  1TW3 A;  2OJE D;  2VKV A;  3AG3 H;  3QP6 A;  3FXO A;  1WJC A;  1SFX A;  4NBQ A;  3GVA A;  2GZW A;  3HC7 A;  4DJA A;  2KIU A;  4KN7 X;  3IKT A;  3BLY A;  2XF7 A;  2QYO A;  2X6X A;  3KP6 A;  3ZR8 X;  3U1K A;  4GFB A;  3HTS B;  1SAU A;  3J7A O;  1JUS A;  1X3W B;  2DA4 A;  2P0W A;  1BJZ A;  4A3G J;  3E5X A;  4DW6 A;  4IX7 A;  2VBY A;  1HF0 A;  1YYV A;  1A6Q A;  3ZPL A;  2WAQ A;  3OYD A;  2BVL A;  1VQ4 I;  2ZFW A;  3PNT A;  4OMY A;  1ULY A;  5EEA A;  1YW8 A;  2D1H A;  2J5O A;  1O3R A;  3RPU D;  1XTA A;  4FAS D;  3F8B A;  3L9F A;  4BBS J;  2DOD A;  4A3C J;  2HR3 A;  4Z6Y A;  3GO5 A;  1IDZ A;  5JHF A;  1D3Y A;  3J7Y J;  3BTL A;  3J7Z I;  3HDD A;  1MGT A;  3H1C A;  3HTU A;  3S8P A;  3H3U A;  1DPR A;  2FBK A;  2R7F A;  4Y3O A;  1ERD A;  2NS8 A;  3CCV I;  4AVP A;  4I76 A;  4ZDO A;  2F4M B;  5M5Y J;  3F8M A;  2LDU A;  4D7M A;  3KEQ A;  1MJB A;  2JZY A;  2FSW A;  1HW2 A;  2IBD A;  3LWF A;  4RGR A;  1GLN A;  2FMY A;  3CF5 F;  4ESJ A;  1W36 C;  2DOF A;  4YIR X;  5CKT A;  1ZN2 A;  4C2M J;  2L3D A;  1GHC A;  4RAF A;  4L9V A;  4QPQ A;  3LST A;  1JUP A;  3C3W A;  4BQQ A;  1GVD A;  2RKH A;  1KGS A;  4I02 A;  3BTJ A;  3FXJ A;  4DBR A;  3LSK A;  2B0L A;  2AO9 A;  1R4M B;  1RES A;  4XOP A;  1CF7 B;  1W7P A;  3OSF A;  1I50 J;  1O7F A;  3DPL C;  1MMD A;  4KA4 A;  1U8R A;  5KHD A;  1HDP A;  3E6D A;  4ITV A;  2E5Z A;  3EYY A;  4HNV A;  3JRF A;  2HQR A;  4NDL A;  2X85 A;  4II3 A;  4MHG A;  3JSP A;  6PAX A;  2DMQ A;  3U9G A;  2A5W A;  3ECH A;  4OMZ A;  3A02 A;  1YQA A;  2OUM A;  2UXX A;  1R1V A;  3OIO A;  4I2O A;  3RI4 A;  1JHH A;  4KJZ A;  2CJJ A;  2CU7 A;  2XB0 X;  3U21 A;  2X0L A;  2XSD C;  1B8I A;  3HOV J;  3WTX C;  3CO6 C;  5GAE J;  4M71 A;  4IRH A;  4G6D A;  2TRT A;  3BR5 A;  1D0Z A;  3O6B B;  3CUQ C;  2RAE A;  1DPU A;  2IRF G;  3M07 A;  5EDN A;  1H0M A;  2ISY A;  2EZI A;  1Y8Q B;  2DFE A;  5GAD J;  1OR7 C;  3NAU A;  2LYC A;  2COB A;  4CYD A;  3HYI A;  2O6G E;  3BRO A;  4HPQ A;  4OOI A;  2G7H A;  4AIJ A;  4RGU A;  4EGY A;  2IA2 A;  1LNW A;  1N75 A;  2ID6 A;  4B47 A;  1GXP A;  4YFX F;  1TWA J;  4IPA A;  2Q1Z B;  3LA2 A;  2GBY A;  1IRX A;  2K85 A;  4KIC A;  5CVJ A;  3JRD A;  2ACJ A;  2OTJ I;  2XF6 A;  5ILU A;  2W85 A;  2PEX A;  3AG4 H;  1SFU A;  3SXY A;  2A3S A;  3C2H A;  2P7C B;  2L02 A;  2CQ7 A;  2ZSH B;  1JTX A;  3D0S A;  3BR2 A;  2F5D A;  2VBX A;  2NVX J;  3P9C A;  2M30 A;  1WWX A;  1FIP A;  3OYC A;  1R5I D;  2DDA A;  4MTD A;  1J75 A;  1E3P A;  4CH7 A;  5FJ8 J;  4RB0 A;  5FRM A;  5LD2 C;  1G2H A;  4XKV A;  1BM9 A;  1HKT A;  2E34 A;  2W25 A;  1MMS A;  3VOE A;  1V54 H;  1SD7 A;  2A6H F;  3A1Y A;  4N9H A;  4ZYH A;  5J3L A;  2E1N A;  3BOQ A;  3VFZ A;  3TED A;  1K79 A;  3I4P A;  5IYB J;  4CCK A;  3WHB A;  3I56 I;  4LOC A;  5KAI C;  3ASO H;  2FU4 A;  3B02 A;  2DA3 A;  2O61 A;  2BHZ A;  1S3J A;  1K6O A;  2QSH X;  3E0J B;  2EJR A;  4GXO A;  3LQQ A;  3VPR A;  3IH3 A;  2UWM A;  3FZV A;  1FOX A;  3KP4 A;  4IO9 F;  3X2Q H;  2JK3 A;  4IHX A;  3SEQ A;  1H8A C;  2IJL A;  2W00 A;  4IKF A;  1VQ8 I;  3PNV A;  3MVP A;  5K5O A;  3A4C A;  3RQ4 A;  2GXB A;  5CQG A;  3MKW B;  2KT0 A;  2R7D A;  3KLO A;  2X9D A;  3OIP A;  4XKC A;  3VYR B;  5K5R A;  1Y6I A;  1ZGJ A;  1I6H J;  5F27 A;  2MGQ A;  3SFI A;  2F48 A;  4R79 A;  4YEJ A;  1CGP A;  3R60 A;  3KLN A;  3ML6 A;  2KPM A;  4BGD A;  1NH3 A;  3GEZ A;  4XL9 A;  5ERI A;  3OYH A;  1UHS A;  5FO5 A;  1JE8 A;  1ZHF A;  3PL8 A;  1GUU A;  1WPK A;  1T98 A;  3A01 A;  3TO7 A;  5IY5 H;  2IGK A;  3OYM A;  4Y4R A;  1DU0 A;  3W6V A;  5H6Q A;  3KEO A;  4D5C A;  3H35 A;  2Z3Y A;  4XN3 A;  4S05 A;  2E2H J;  4FX4 A;  1NTC A;  2KMU A;  3OYL A;  4ENJ A;  1ETK A;  3K69 A;  4FT8 A;  5F64 A;  5JFR A;  3C1D A;  2QVO A;  3RCO A;  2FXA A;  1KZH A;  3PSI A;  2M0M A;  2MD5 A;  2HS5 A;  1QHG A;  1DQU A;  5D5W B;  3A0H C;  4EAT A;  2DK5 A;  1IF1 A;  4UHT A;  3C2B A;  4UB6 C;  1D0X A;  3GME A;  4G6Q A;  5AIP A;  3VWB A;  4E7K A;  2LFB A;  4Q47 A;  4LK1 F;  1BR2 A;  3QP5 A;  3QU6 A;  2NS0 A;  4GGG A;  3S1M J;  1J2X A;  3BG3 A;  2JPB A;  2GOX B;  2NYX A;  3HOZ J;  2OC6 A;  1S9H A;  1TZL A;  5DEQ A;  5F08 A;  2R5Z B;  2VOO A;  3G1M A;  4IHS A;  2PN6 A;  1HW1 A;  1LEB A;  1OQY A;  4MQ9 F;  4G9Y A;  1TQI A;  1YE9 A;  4XLA A;  3P9K A;  2G0E A;  2ZFU A;  5J6X A;  2MLG A;  3CMA I;  1APL C;  4KFC A;  2R7X A;  4E70 A;  2VJ5 A;  5A2Q Z;  3H0G J;  3F6V A;  3I5U A;  1LDK B;  4RAY A;  2KIM A;  1K6Y A;  2HEO A;  4A3E J;  3LSJ A;  1BC7 C;  2HVS A;  1Z6R A;  2Y30 A;  2VOD A;  1Z7U A;  4EJU A;  3GTQ J;  5ED4 A;  2NNN A;  2YS9 A;  3DTI A;  1V4R A;  1TBX A;  2BY2 A;  4IRG A;  2P5L C;  1RKT A;  2L7F P;  2M7B A;  4L9N A;  1IXR C;  2FBI A;  3HHH A;  1YO5 C;  4KT5 C;  4AVZ A;  2M87 A;  1P4A A;  4HV5 A;  4DQ2 A;  2HDC A;  2MW8 A;  1VQL I;  2RGV A;  2VQG A;  5J1Y A;  3CJN A;  3HOY J;  3JRH A;  3OYF A;  1L3L A;  4RMN A;  4HF0 A;  1T0F C;  5D5V B;  2B9S A;  2P5K A;  2JMW A;  2XGE A;  4F7Z A;  1EH6 A;  5JHU A;  4RB2 C;  1SVL A;  4LG0 B;  2Q8K A;  2M4K A;  2KJB A;  1D1B A;  2K4J A;  1XSV A;  1U6G A;  2HPM A;  3QPS A;  1ETO A;  1AHD P;  2K27 A;  2XRO A;  4YFN F;  1TNT A;  3UNG C;  1FP2 A;  2DT6 A;  3CDL A;  4OWR B;  3PFY A;  4RB3 C;  1FSH A;  4CCM A;  3F8N A;  2J5P A;  2R7S A;  1TQM A;  1J7K A;  3E1S A;  4QPO A;  2NXN B;  3GW2 A;  2GAU A;  1N25 A;  1RNL A;  3FK7 A;  2YX4 A;  5E8I A;  5FLX Z;  1CF7 A;  5J1R A;  2XAH A;  2HWV A;  3QRF F;  4I09 A;  2EIM H;  5F6F A;  2FX0 A;  3H5A A;  3S93 A;  4JK1 X;  2OCC H;  4KYW A;  2OPT A;  3T1B A;  1KON A;  4AC0 A;  4DZP A;  2CUE A;  2CV0 A;  3ONQ A;  2WA0 A;  1JKR C;  4AIK A;  1EV7 A;  1OCR H;  4F55 A;  3S15 J;  3JRI A;  2GWR A;  4GDF A;  1HST A;  2E1O A;  2FRH A;  2ZJQ F;  4B48 A;  4DNC A;  5E1X A;  4EEF G;  4HDV A;  3DXJ F;  4XRM A;  2XGD A;  2XC7 A;  3DLL F;  4ZYG A;  1HC8 A;  3S16 J;  1WH5 A;  1IRF A;  3HPG A;  3TQN A;  2OZ6 A;  4UUS A;  2M4G A;  2OQG A;  4B4C A;  2PX9 A;  4FQG A;  4XOR A;  4QTR A;  1JGS A;  2VT3 A;  5JLW A;  2K9Q A;  4KNY A;  2HXI A;  1LE8 A;  3GLX A;  3WE2 A;  2EPF A;  1BI3 A;  4IHV A;  2H8W A;  3ZN1 A;  2EFQ A;  1T2K A;  1UAA A;  2EWN A;  3GTM J;  3H92 A;  1JGG A;  3CCU I;  2PBI A;  3F9K A;  2LY9 A;  1I1G A;  2QKM B;  4Y13 A;  1J9I A;  1FWZ A;  5L3E A;  3U1D A;  2Z33 A;  4A5M A;  4HF1 A;  4Q5S F;  3LSM A;  4M3D A;  1R49 A;  1X1A A;  3HOW J;  4ZYE A;  3DV8 A;  3SEZ A;  1V5G A;  3E5Q A;  2RC4 A;  1WQ2 A;  2Q0O A;  3L2Q A;  5BNG A;  3V7R A;  4XID A;  2L7Z A;  3BJO A;  3LSR A;  3L2C A;  1MMN A;  4UUV A;  4BE0 A;  4PJL A;  2VJ4 A;  2HQ5 A;  4EVI A;  1OCT C;  4CXF A;  2Z99 A;  5D8L B;  1FJL A;  3E7L A;  3CLQ A;  4IJA A;  2LKP A;  3JTH A;  4LIT A;  4XLF A;  2JA6 J;  1KQ9 A;  4XMY A;  1B72 A;  3WTY C;  4ABZ A;  5LGT A;  3ZQG A;  1B9N A;  2VKE A;  3W2V A;  3R0J A;  1LDD A;  5HLT A;  1S5L C;  2AQF A;  4B3A A;  1IUY A;  5L3B A;  2DJN A;  4J00 A;  4LK0 F;  3P9I A;  3BJ6 A;  5ILS A;  2HOA A;  2LK2 A;  1S7E A;  1TP4 A;  2KHM A;  5IPA A;  2M8E A;  3KP5 A;  2ZXI A;  2EFP A;  4KIG A;  2PMZ N;  4BQO A;  4LLN A;  4HQM A;  3J7A Y;  2RDP A;  3U2R A;  1W5T A;  3H9G A;  2P4W A;  3KET A;  1VQ7 I;  2ZC2 A;  4U7D A;  4AWX B;  2JUC A;  3KEY A;  4H4K C;  4MTE A;  3HOX J;  3CUQ A;  2O3F A;  3LAP A;  2MH9 A;  2W84 A;  3ZGK A;  3ZMS A;  2EFN A;  2E7X A;  2MBF A;  2RVC A;  1OR7 A;  1ETV A;  3CCL I;  3BY6 A;  4HNU A;  1OCO H;  5CVR A;  3RTR A;  5E3N A;  2LF7 A;  1RIO H;  1YX5 A;  4KDP A;  1QA6 A;  1FP1 D;  4LFU A;  2QSF X;  4XK4 A;  1RUN A;  2STW A;  4G6T B;  2QQ9 A;  1AU7 A;  2ISZ A;  3FMR A;  1ETW A;  4WK8 F;  2VLA A;  4XLP F;  4KUM A;  2CQX A;  3EPZ A;  3PQJ A;  3K70 D;  5LGN A;  5DS9 A;  1R00 A;  2E35 A;  2PFB A;  3TDZ C;  2CGP A;  2LH9 A;  2EBI A;  1XSD A;  2DYS H;  1XMA A;  4Y52 J;  5K7F A;  3LSP A;  4HX7 A;  3EYI A;  2QUF A;  3BP8 A;  3RKQ A;  5FFZ A;  3MMY B;  3G3Z A;  4DBQ A;  5HOO A;  3FXR A;  1BIA A;  1K78 A;  4YIF A;  1P7J A;  2AXL A;  2HKO A;  1GV2 A;  1VTN C;  2L9N A;  4JYK A;  4A93 J;  3K6G A;  3DKW A;  2MLK A;  1K7A A;  1FMW A;  3HUG B;  3OYG A;  5JVG F;  3HXL A;  4D0P A;  3E6M A;  2HOE A;  4IXA A;  1UCR A;  5D5U B;  5BOX A;  3M8J A;  3QPL A;  3J80 Z;  4G8X A;  3TGN A;  3K1P A;  5EZH A;  2DAO A;  4BYY A;  3HRT A;  5FD6 A;  1DGR M;  2DPU A;  3BZC A;  1F4K A;  2STT A;  2EV0 A;  1OPC A;  4NUB A;  5DM6 F;  3I4M J;  2Z1D A;  2WAD A;  1UHM A;  1NK3 P;  2F5F A;  2O0Y A;  1G8X A;  2HDW A;  1PP8 F;  2AHQ A;  3ZP5 A;  1VQO I;  5HNH A;  2QBY B;  3PUB A;  1O3S A;  2JA8 J;  3W3C A;  3CQZ J;  1XN7 A;  2FNP A;  2ELH A;  3QYB A;  1SMT A;  3Q0U A;  3ZCO A;  3ZOB A;  4P55 A;  4IQJ A;  4QLC U;  2F4I A;  2F4O B;  1ZTR A;  3Q0V A;  1Y39 A;  2V1U A;  1JJ8 C;  2ESH A;  1QNT A;  3JRE A;  1S72 I;  1MW7 A;  3ECO A;  3DEE A;  5D6E A;  1W4M A;  3EUA A;  4V2F A;  1G4D A;  2RRE A;  2CG4 A;  4XQF A;  5HLG A;  4HNT A;  1BW5 A;  5EJC A;  1POG A;  2JA7 J;  1VQ5 I;  2BY0 A;  1F43 A;  3D1N I;  3Q9S A;  2WB1 A;  3CCY A;  2Z2S B;  1IGN A;  3I4N J;  4PSW A;  2CO5 A;  3DP7 A;  3FHZ A;  1KYW A;  2E71 A;  2DXI A;  2V1X A;  1TWH J;  2VJJ A;  3TMO A;  3S3O A;  2L0K A;  1KU2 A;  1P7I A;  3ZMT A;  4XLH A;  4EM2 A;  3CCS I;  1IDY A;  4GYG A;  1I6X A;  2IAI A;  1ZYR F;  5K5Q A;  3KP3 A;  2COM A;  3H9J A;  1HLV A;  1VQN I;  3GLL A;  2OBP A;  1XX5 A;  3M8E A;  2IS1 A;  4ZC3 A;  1ZLJ A;  2PI0 A;  4RB1 A;  3VB2 A;  2A6T A;  4JBA A;  1G3W A;  5KNL A;  2I8D A;  5AON A;  5J4Y A;  2M0C A;  2M9H A;  2LKX A;  1SEU A;  2ELJ A;  4CDG A;  1X4P A;  1KA8 A;  2O03 A;  2M5W A;  3S3M A;  3B73 A;  3HOS A;  1K4S A;  2M34 A;  1ETX A;  4A3M J;  3M3Y J;  2WV1 A;  1YW9 A;  4XRS A;  3I0T A;  2L2O A;  4EJT A;  1TW2 A;  2FBH A;  4FHT A;  4LIU A;  3LSG A;  3KIO A;  2FOK A;  3ZRG A;  3S3N A;  3HOU J;  2HXO A;  1S7A A;  1SD6 A;  2R93 J;  2AQE A;  3BZ6 A;  3Q3S A;  2KRH A;  4Y17 A;  2R7Z J;  3QYF A;  2HI3 A;  1YIO A;  3CCQ I;  1T0F A;  4QSH A;  3MZ8 A;  2K9L A;  3ULQ B;  2BVM A;  1LFP A;  3B6A A;  1SFO J;  5L3C A;  4MGR A;  2OZU A;  2W82 A;  3BG5 A;  3CJR B;  1W5S A;  4KIF A;  3TO6 A;  1YW7 A;  2CQQ A;  2EZK A;  3FM3 A;  4E7J A;  1YRN B;  2LSO A;  4WXC A;  1UG0 A;  4CYC B;  4BU2 A;  4BBR J;  1I5Z A;  1F1Z A;  2BY3 A;  2DO7 A;  1TT5 B;  2XRL A;  4G7Z F;  4CCL A;  2VQH A;  2WAQ N;  1R58 A;  3M1C A;  4X1E A;  2CS3 A;  1LPQ A;  3AAF A;  2R7W A;  1A6I A;  3OYE A;  4IHW A;  1JT6 A;  1O3T A;  2LRD A;  4XLC A;  4HX8 A;  1VQM I;  4HSR A;  2YUS A;  4B09 A;  3GCM A;  5E18 F;  3M7G A;  3COA C;  1QZE A;  1QVU A;  4RGS A;  3FXL A;  1I3A A;  5FD5 A;  3LSH A;  4ZDP A;  5GTI C;  2M7A A;  4CSW A;  5FLM J;  1XS9 A;  5K1Y A;  2KL4 A;  4TV7 A;  4CGZ A;  2P7V B;  2DLL A;  1Y0U A;  3ZN0 A;  1HDD C;  9ANT A;  1HA8 A;  2Y69 H;  4LJZ F;  5A2Q K;  3DTE A;  1LQ1 A;  2R4G A;  3GZN B;  2VE8 A;  2DMT A;  3GTJ J;  3DKX A;  1PYV A;  5BPD A;  4BHP A;  1OYI A;  5HDG A;  1PUF B;  3V8J A;  1IXS B;  4PJJ A;  2WAF A;  4D1Q A;  2F5V A;  4X0G A;  5B1A H;  3CO7 C;  3K2Z A;  4GRI A;  3FIS A;  1F9N A;  5CPR B;  1X19 A;  1PVE A;  1UZC A;  3P5J A;  3S14 J;  2IVM A;  2ZJR F;  2EQR A;  2KZG A;  2XAS A;  3SDG A;  4XRS G;  5ILV A;  1FMV A;  1LFU P;  3BJA A;  2DYR H;  1FX7 A;  3FKI J;  3S2D J;  4A2U A;  4II2 A;  4D9J A;  1TNS A;  2NOG A;  1FYM A;  1ZH5 A;  5D4R A;  5HLH A;  1Q1H A;  2XPW A;  4RGX A;  2BYV E;  5LBQ A;  2YPR A;  4HEA 2;  5AIQ A;  2NVQ J;  2MH2 A;  3K9T A;  2K9M A;  3KYC B;  3FIW A;  1SC7 A;  1IN5 A;  1MNE A;  1GV5 A;  1Z67 A;  3S1R J;  3HEF A;  4FE4 A;  2XUB A;  2FEZ A;  2Y48 A;  2G9W A;  2ZKZ A;  1CQT A;  1TT0 A;  1S8N A;  2FQ3 A;  3A03 A;  4XNF A;  1XSX A;  4E7H A;  2XB5 A;  1JKQ C;  3DQV C;  3KYL A;  2E1C A;  2KQR A;  2QCO A;  5D5X B;  5K7H A;  3K70 C;  1HXD A;  2MFZ A;  3F72 A;  5HOD A;  5FLX K;  1BI0 A;  3TBI A;  2P6S A;  4HYE A;  2VE9 A;  3O3K A;  3ROU A;  2ZJP F;  2GXG A;  3CJT B;  3OV8 A;  1XG1 A;  2KIS A;  2PMU A;  4BDZ A;  3HUG A;  4RAG A;  4Z2Y A;  3D5L A;  3EDP A;  5J8C A;  3FF5 A;  3F8C A;  2K3F A;  2LD5 A;  5TJJ A;  2LY2 A;  2B7E A;  3KFW X;  3RKX A;  5HS8 A;  2HOS A;  3DKY A;  3CF2 A;  2FD5 A;  5D8K B;  2DQR A;  1T95 A;  1HKS A;  2NAZ A;  3WU1 B;  1FSE A;  3AL0 B;  1G59 A;  4ZZL A;  1ZG5 A;  3F3X A;  1BR1 A;  2JSC A;  3HSR A;  2V9P A;  1WJE A;  2LBF B;  2L9V A;  2EFO A;  1A35 A;  4KIS A;  4ENN A;  4B43 A;  1KU3 A;  4XON A;  1FBS A;  4B8X A;  2GOM A;  2V1N A;  1LEA A;  1I27 A;  4U7B A;  3L2U A;  1E17 A;  1SAN A;  1IN6 A;  4XN0 A;  2KJC A;  2UUZ A;  2XAU A;  2ZBK A;  4M74 A;  1QPM A;  4AD9 A;  1YLF A;  5ICE A;  1E3O C;  1RPW A;  1BBY A;  1YS7 A;  5HVQ C;  1WI9 A;  2IGO A;  4A0Y A;  4W1U A;  1MND A;  4PZJ A;  3WGH A;  3KP7 A;  2KRC A;  1HSJ A;  2EFW A;  3HB9 A;  3L00 A;  1XB4 A;  1D8K A;  4KN4 X;  1R5H A;  2D45 A;  1ZKG A;  1ITY A;  4L0Y B;  4BE2 A;  1OJL A;  2CUZ A;  4YRV A;  5EYR A;  4ZZD A;  1WVR A;  4WWC A;  1ZLK A;  2Q2E B;  3SHF A;  4HG2 A;  1YG2 A;  2BXY A;  2DOE A;  2LP0 A;  3WTT C;  1T38 A;  4PK4 A;  2HOT A;  1IN4 A;  3HHG A;  2XIG A;  1H89 C;  1FLI A;  5DD8 A;  5EG0 B;  2ZSI B;  2BHY A;  5C3E J;  4L5E A;  2V4J C;  1ENH A;  4PFP A;  1W0U A;  2QSG X;  2YU3 A;  5E17 F;  5FKL A;  2R0Q C;  4R8H A;  4C3H J;  3K4B A;  5JLX A;  2YSR A;  3WTW C;  3CCJ I;  1UFM A;  3IC7 A;  3M9A A;  3MKY B;  1U5T C;  4UB8 C;  1OMI A;  1MBF A;  1QGP A;  4PJN A;  2DN0 A;  4KMU X;  5J1U A;  1JKO C;  1WFX A;  2ETH A;  3TDU C;  3AG1 H;  1K83 J;  3FHN A;  5DCF A;  4ANJ A;  5LLQ A;  1OLT A;  3SZG A;  3Q0W A;  3Q5F A;  1IN8 A;  1QZZ A;  3C18 A;  3L2W A;  3GTP J;  4AM3 A;  1BA5 A;  4HDU A;  4A5N A;  2GQQ A;  1WJD A;  2P81 A;  2VON A;  3T8T A;  2NVY J;  2OCE A;  1HOM A;  2XF5 A;  5J40 A;  2X1C A;  1SAX A;  3CC2 I;  1UEL B;  4RM3 A;  3QYE A;  1ON1 A;  4ON0 A;  1UHW A;  2DBB A;  3OIQ A;  3WTS C;  4DYR A;  5FKM A;  2CQK A;  2CW0 F;  3OYK A;  3K4K A;  1YRN A;  1Z3X A;  4XKW A;  4CYC A;  1E3H A;  4HRI A;  3HGY A;  1Z21 A;  4M9S A;  4XOT A;  1VZ0 A;  1OIS A;  4UY8 I;  2ZNY A;  4A6D A;  3RSN A;  3DFG A;  3S32 A;  1TTY A;  2K86 A;  1IZ1 A;  2ID3 A;  4CO8 A;  2VIX A;  4N4O B;  5EEH A;  3RJP A;  4M6X A;  3TKY A;  3J80 K;  2EIJ H;  4KT6 A;  2HDD A;  1BL0 A;  3GTG J;  1D1A A;  1U5T B;  3FM5 A;  4YEL A;  2LR8 A;  4QWQ A;  4S0H B;  2Y0S N;  4ZYA A;  2W4S A;  1XD7 A;  5IP7 J;  1A5J A;  1UST A;  1ODD A;  4BS9 A;  3LA3 A;  3VDX A;  2OD5 A;  2UXN A;  3G2B A;  3LNQ A;  2VXZ A;  3SDB A;  1H88 C;  1W5C C;  2DT7 B;  2MA3 A;  1GT0 C;  4DIQ A;  1MJA A;  3ZMV A;  5FB2 A;  4JOM A;  5LHG A;  3LAJ A;  2K5C A;  1Y8R B;  1U78 A;  3BR0 A;  4AU7 A;  4XLN F;  4M3B A;  1JJ6 C;  1U8B A;  2EB7 A;  4M6Y A;  4U87 A;  4IRI A;  2VKD A;  3TW7 A;  2DFF A;  3OYB A;  2BGC A;  4I01 A;  2QKL B;  4U0V A;  4NC6 A;  2HPI A;  5BMZ A;  4MEY F;  4UV8 A;  5FLV A;  3ZQL A;  3FXQ A;  3BCB A;  3LFK A;  4RS8 A;  4I6Z A;  2Y9Y A;  3HRM A;  3OYN A;  4NQW B;  3E6B A;  5GAG J;  2R7T A;  4XR6 A;  2G7U A;  4BXX J;  5LHH A;  4N4N B;  2LTP A;  5L3G A;  2RQP A;  5D4S A;  2BEO A;  1J59 A;  3TO9 A;  3JRG A;  4KIB A;  3AKZ A;  1R4N B;  1KQ0 A;  1XGM A;  2HVQ A;  3F22 A;  1D5Y A;  3BWG A;  3IAS 2;  2ZB9 A;  3BPX A;  1FBQ A;  2EZH A;  2XAJ A;  2BE5 F;  2XPU A;  3T0Y A;  3ABT A;  1VQK I;  1N78 A;  2CV1 A;  2DFH A;  4WCG A;  2P5V A;  1P9Q C;  4K2E A;  5DCM B;  1S29 A;  2FML A;  4U88 A;  4UV9 A;  5EGO B;  1LVA A;  1XDU A;  1MH3 A;  3ZMD A;  5E8G A;  3REO A;  3CLO A;  3MD2 A;  2HQN A;  3ELK A;  3BG7 A;  1TWF J;  1ZGA A;  2V9V A;  3QAH A;  4UXN A;  4UVC A;  5B1B H;  3M8F A;  3IHU A;  4D7N A;  3O8G A;  1SD5 A;  2E60 A;  1S6L A;  1BC8 C;  4YFK F;  3EUK L;  2QQB A;  2WTE A;  5TGT A;  3DU6 A;  1LFB A;  1R5G A;  1XGO A;  3GF2 A;  1FEX A;  1Y1V J;  2K4B A;  2MD0 A;  2DU9 A;  1PJR A;  2BW3 B;  3CC7 I;  3OMY A;  4UVB A;  3G73 A;  4UVA A;  1XC5 A;  1ZG3 A;  2AXT C;  4F52 A;  1X2N A;  2LBF A;  4BHC A;  1FPQ A;  4A3J J;  2M2E A;  2TCT A;  4BHB A;  3K4N A;  2O8K A;  2R7V A;  2JVH A;  2VBW A;  1QVT A;  3ZMU A;  3RIR A;  4B3X A;  4BXF A;  3NEU A;  3ZXS A;  2HYF A;  5KAF C;  4WXD A;  4FE7 A;  4MFD A;  4IL6 C;  4NB5 A;  2XV4 S;  1GDT A;  3LOC A;  3GXO A;  3JCU C;  2F6C A;  2E19 A;  2XGC A;  4AID A;  3CD6 I;  1YIJ I;  3DBH B;  1HKQ A;  5IOY A;  1YJW I;  2R7Q A;  2Y31 A;  3F8F A;  1EH7 A;  2ZCW A;  1FY7 A;  1WKM A;  1FYK A;  1QBJ A;  1G3Y A;  5KCM A;  5EEG A;  2A68 F; 
#chains in the Genus database with same CATH homology
 4F92 B;  2CFO A;  2I8D A;  5KNL A;  2ELJ A;  4E7S A;  1OR7 C;  2LYC A;  1X4P A;  4XKB A;  3H0D A;  3S3M A;  4HPQ A;  3HOS A;  1N75 A;  3DTK A;  4B47 A;  2Q1Z B;  1IRX A;  4BEH A;  2L2O A;  2XF6 A;  2CW7 A;  4LIU A;  3C2G A;  3LSG A;  2VB6 A;  3ZRG A;  3S3N A;  2WY7 Q;  2KDO A;  3C2H A;  2Y0S A;  2AQE A;  2KRH A;  2LOO A;  2ZSH B;  3QYF A;  2WAE A;  2IGM A;  3OYC A;  3W2W A;  3V42 A;  2K9L A;  1QU3 A;  4CH7 A;  2BVM A;  1LFP A;  2K3P A;  5FRM A;  5LD2 C;  1DP3 A;  4XKV A;  3CES A;  2W82 A;  3VSK A;  3HPH A;  3CJR B;  2IS4 A;  3OR1 C;  2PJR B;  3FBI B;  3A1Y A;  4E7J A;  3I9V 2;  4NC8 A;  1UG0 A;  4BU2 A;  5FRN A;  4CCK A;  2M3A A;  2CV2 A;  2KP6 A;  2CUJ A;  2V9K A;  4CCL A;  1MMA A;  1WJ5 A;  2VQH A;  3M1C A;  2CS3 A;  3E0J B;  2WBM A;  4BDY A;  2R7W A;  3OYE A;  2UWM A;  1MMG A;  4P1W A;  2LRD A;  4XLC A;  4IZZ A;  3VSL A;  4HSR A;  3BC8 A;  3SEQ A;  3W2A A;  5HNF A;  2W00 A;  4IKF A;  3PNV A;  3A4C A;  3GBG A;  3RQ4 A;  3LSH A;  5CQG A;  4ZDP A;  3KX2 A;  3MKW B;  2M7A A;  3OIP A;  4CSW A;  4XKC A;  3VYR B;  2BOL A;  1Y6I A;  2KL4 A;  4R79 A;  4YEJ A;  1D0Z A;  2W7N A;  2KPM A;  4BGD A;  4NC7 A;  1HA8 A;  4XL9 A;  3DTE A;  4E4H A;  2R4G A;  4CA0 A;  3OYH A;  3PL8 A;  3DKX A;  1PYV A;  1Z7L A;  4JQF A;  4C2U A;  1BOB A;  1R6R A;  3H5N A;  2IGK A;  1J09 A;  3OYM A;  4PJJ A;  2WAF A;  4Y4R A;  4C9Y A;  2F5V A;  4D1Q A;  4X0G A;  1X1C A;  4Y33 A;  3H35 A;  4GRI A;  5LFA A;  4XN3 A;  4BJT A;  4ZDL A;  5CPR B;  1X19 A;  2KMU A;  3OYL A;  4E7Z A;  3QOD A;  2Z16 A;  3QOE A;  3RCO A;  2HQA A;  2LY1 A;  4BUP A;  1FMV A;  3PSI A;  2M0M A;  1QHG A;  1DQU A;  2HU9 A;  1LKX A;  2X6Y A;  4II2 A;  4D9J A;  4EAT A;  5FRO A;  4BL0 B;  1D0X A;  2L7K A;  3EUH C;  3DWL E;  3VWB A;  2CMP A;  4PFO A;  4E7K A;  1BR2 A;  4HEA 2;  2K9M A;  1X4O A;  2GOX B;  1MNE A;  4J01 A;  2OC6 A;  4CCJ A;  1S9H A;  1TZL A;  1EA3 A;  1QHH D;  4OAY A;  3NWT A;  4E7L A;  1YE9 A;  1X1D A;  4XLA A;  1TT0 A;  4AYB A;  2ZFU A;  2VL8 A;  3D5S C;  4XNF A;  4E7H A;  1W36 D;  2E1M C;  3DQV C;  4ZTF A;  3KYL A;  2R7X A;  2KQR A;  2VJ5 A;  3K70 C;  2MFZ A;  1LDK B;  3LFU A;  4RLQ A;  3TBI A;  1K6Y A;  4ZJZ A;  3UR3 C;  2HVR A;  2HVS A;  3CMM A;  2V26 A;  1V5F A;  3OS0 A;  4BDZ A;  4RM2 A;  2PMZ A;  1JI8 A;  3D5L A;  3DTI A;  3IAM 2;  2VJI A;  4ZTJ A;  3DPU A;  2M7B A;  3K4L A;  2LY2 A;  3VYS B;  1Z3Y A;  4E7I A;  2X1E A;  2VQC A;  3DKY A;  3DU5 A;  4AVZ A;  4DOZ A;  3CF2 A;  2IS6 A;  1T95 A;  4B44 A;  4FET A;  3H9Q A;  2VQG A;  3AL0 B;  4RLF A;  3OR2 C;  1G59 A;  4F91 B;  3OYF A;  4BE1 A;  4RMN A;  3BCA A;  1BR1 A;  1T0F C;  1WJE A;  2LBF B;  4XLE A;  2X6W A;  2LG4 A;  4HST A;  4KIS A;  3LL7 A;  2NOJ B;  1Y56 A;  4B43 A;  4XON A;  2GOM A;  2V1N A;  2XDV A;  1V5E A;  2M4K A;  1D1B A;  4U7B A;  3L2U A;  2HPM A;  4XN0 A;  2UUZ A;  2XAU A;  2V7F A;  1BR4 A;  3UNG C;  3AFH A;  2DT6 A;  4OWR B;  3PFY A;  5HVQ C;  3K4C A;  4CCM A;  2IGO A;  2R7S A;  4F93 B;  1MND A;  3K4J A;  2OV7 A;  3E1S A;  4QPO A;  2IS2 A;  2KRC A;  2JSP A;  1N77 A;  3VYT B;  3HL2 A;  2CW8 A;  2BW3 A;  3S93 A;  3OL3 A;  2CUZ A;  2E1M B;  3H5A A;  4YRV A;  3IUO A;  4BE2 A;  3IP4 B;  2VPL A;  1KON A;  2HNH A;  2Q2E B;  4HG2 A;  2CV0 A;  3ONQ A;  2WA0 A;  1U0J A;  4PK4 A;  4F55 A;  3CJQ B;  2VAS A;  3H5R A;  2ZXH A;  2ZSI B;  4CZC A;  4B48 A;  4BEH B;  2R7R A;  3OY9 A;  3K4M A;  2V4J C;  2LRE A;  2XC7 A;  4PFP A;  2R7U A;  3HPG A;  2M4G A;  4XOR A;  2CH0 A;  4C2T A;  3K4B A;  1WJB A;  3HKZ A;  3AL0 C;  3BG6 A;  1NG7 A;  3MKY B;  4P5O A;  1UAA A;  4PJN A;  2RNG A;  3SYT A;  4LIV A;  3F9K A;  4F3Q A;  1WFX A;  2E5N A;  2DCE A;  2QKM B;  3FHN A;  2HZD A;  4ANJ A;  3OS2 A;  2IGN A;  4PUS A;  1OLT A;  3SZG A;  4PSX A;  1DGW Y;  2KLO A;  3LSM A;  4BQN A;  3L2W A;  3FKJ A;  1X1A A;  3N05 A;  3SEZ A;  1V5G A;  1WJD A;  2L9S A;  2FUG 2;  3L2Q A;  3TL4 X;  1MMN A;  4NNJ A;  4PJL A;  4CCN A;  4BE0 A;  2W1O A;  3K10 A;  2XF5 A;  2VJ4 A;  2X1C A;  2LC2 A;  3VYU B;  4DGW B;  1UEL B;  4XLF A;  4LIT A;  4RM3 A;  3QYE A;  4XMY A;  3A2K A;  2R7O A;  3OIQ A;  3DPT A;  3CP2 A;  3OYK A;  1NG6 A;  3W2V A;  2PJR A;  3K4K A;  1Z3X A;  2VXD A;  3HG9 A;  4XKW A;  5HLT A;  2AQF A;  3PNY A;  4HRI A;  4J00 A;  3L2V A;  1Z21 A;  2DOA A;  4XOT A;  1VZ0 A;  4C30 A;  3RSN A;  2KHM A;  2MYS A;  3S32 A;  5CQE A;  2ZXI A;  1ZEL A;  2VIX A;  4BQO A;  4N4O B;  3FBN B;  3J7A Y;  2XSJ C;  3H9G A;  3I3L A;  3NWS A;  3OYJ A;  1X1B A;  2VKH A;  3KEY A;  4H4K C;  4KT6 A;  1D1A A;  3MKZ A;  3HOT A;  2IXS A;  3ZQQ A;  4YEL A;  3ZGK A;  2UV1 A;  4ZYA A;  2MC4 A;  2W4S A;  1SFK A;  3LMM A;  4HNU A;  1WJA A;  3RTR A;  4BS9 A;  4CUG A;  1YX5 A;  3VDX A;  3G2B A;  2VXZ A;  3SDB A;  4G6T B;  2L5Q A;  3OYA A;  2DT7 B;  4DIQ A;  4OAZ A;  4JOM A;  1LVK A;  2VLA A;  3EPZ A;  2K5C A;  3FDY A;  3K70 D;  2DJI A;  4AU7 A;  4BJ5 C;  2LH9 A;  1WJC A;  3HC7 A;  4E6K G;  4U87 A;  4DJA A;  2VKD A;  2VQL A;  3BLY A;  3OYB A;  2XF7 A;  2X6X A;  3MMY B;  2QKL B;  3ZR8 X;  4DBQ A;  2HPI A;  5HOO A;  1SAU A;  2P0W A;  3BCB A;  4IX7 A;  3LSI A;  2L9N A;  3OYN A;  3K6G A;  2WAQ A;  4NQW B;  3OYD A;  2BVL A;  1FMW A;  3HUG B;  2R7T A;  3OYG A;  3PNT A;  4XR6 A;  3HXL A;  1WJF A;  2JUG A;  4N4N B;  3RPU D;  4FAS D;  3M8J A;  3AKZ A;  4MLO A;  2HVQ A;  5JHF A;  3IAS 2;  1DGR M;  2O5R A;  2RQQ A;  1E0E A;  4NUB A;  3S8P A;  2KZV A;  2Z1D A;  2WY8 Q;  2WAD A;  1N78 A;  4KIT B;  2CV1 A;  4Y3O A;  1G8X A;  1ERD A;  2X1D A;  2HDW A;  1P9Q C;  4ZDO A;  4XM3 A;  5HNH A;  3PUB A;  3W3C A;  3OL4 A;  4IQ4 A;  3QYB A;  3OOU A;  3MD2 A;  1GLN A;  1W36 C;  3PJR A;  3BG7 A;  3ZCO A;  5CKT A;  4IQJ A;  4BJ6 C;  2F4I A;  2E60 A;  4LG3 A;  4QPQ A;  1YX3 A;  4BQQ A;  3EUK L;  4CCO A;  2MAB A;  5TGT A;  3DU6 A;  4DBR A;  3D5R C;  3LSK A;  3CZ6 A;  1MW7 A;  4XOP A;  2MD0 A;  3CP8 A;  3PSF A;  3DEE A;  1PJR A;  2BW3 B;  3DPL C;  1MMD A;  3OMY A;  5KHD A;  3EUA A;  4F52 A;  2RRE A;  4XQF A;  4HNT A;  2LBF A;  4ITV A;  1D0Y A;  2E5Z A;  3K4N A;  2JVG A;  2R7V A;  2X85 A;  4II3 A;  2WB1 A;  2Z2S B;  2JVH A;  4PSW A;  3DLA A;  4B3X A;  4BXF A;  2A5W A;  3ZXS A;  2DXI A;  2OUM A;  2VJJ A;  3OS1 A;  3OYI A;  3OWT A;  3TMO A;  1AA7 A;  3S3O A;  2F6C A;  4KJZ A;  4XLH A;  4PJM A;  3U21 A;  2X51 A;  2R7Q A;  2JA2 A;  2V6E A;  4BAC A;  3H9J A;  2IS1 A;  3L2R A;  4ZC3 A;  5KCM A;  1D1C A;  2A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...