4J00A

Crystal structure of fischerella transcription factor hetr complexed with 24mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
297
structure length
297
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
total genus 62
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A02
4J01A 4J00A 3QOEA 4HRIA 3QODA 4IZZA 4YRVA
chains in the Genus database with same CATH superfamily
1U5TC 3WTWC 2DMUA 4EGZA 1UAAA 2QKLB 3OYEA 2PMZA 1QVUA 2BZTA 1K61A 3HOYJ 3P5JA 2CV1A 1VQMI 1NK2P 2ZJ2A 3CF5F 1AHDP 3OV8A 4DW6A 2A68F 4E7SA 2E35A 4BH9A 3JAMK 3M8JA 2ELHA 1ZGAA 3KX2A 1YG2A 2M0MA 2O0YA 1ULYA 2VJIA 4FISA 3L2VA 1YO5C 1JJ8C 3K4NA 2ISYA 3ASNH 4AM3A 2FQ3A 3KP4A 1T38A 2DMNA 4M71A 4A3KJ 1SFUA 1PUEE 4B43A 2Y9YA 3GWZA 3HOVJ 4XKCA 3FXUA 1ERDA 5D4RA 1XSDA 4ZH4F 1RR8C 3BZ6A 2KISA 4UB6C 1KYWA 2IBDA 2XF6A 2XPVA 2Q2EA 2VKDA 1MNDA 2EIMH 4WK8F 4IKFA 1PP8F 4M9SA 3WG7H 1QPMA 3LNQA 1X1CA 3JRIA 2DO7A 3CZ6A 1OLTA 4KJZA 1B72B 1QU3A 2EZHA 3HBLA 3TDZC 1OCOH 3Q0WA 2PI0A 2YPRA 4A2UA 2XUBA 4YG2F 1YI2I 2VB6A 3K0LA 4BQNA 1LFUP 2R7SA 3QPTA 3BC8A 2L7FP 3ZQQA 1I50J 1J09A 4TV7A 1TW3A 1XSXA 1MDMA 3LAJA 3DTEA 3PO2J 2LYCA 4KUMA 3K7AJ 1R5HA 3ABUA 4A6DA 4HNUA 5AIQA 1ZARA 5FFXA 1QHHD 1DUXC 2QQAA 5E1XA 2BBYA 2M8GX 4A3CJ 1JKQC 3WTYC 3CUQA 1NG6A 2W4SA 4KYWA 3V7RA 3W6JB 5LGNA 4G6TB 1OISA 1JE8A 1S8NA 3DKYA 3D5LA 2XASA 1WPKA 4NQWA 5E8IA 3ERED 4QWQA 4AIHA 3F6OA 1ZTRA 5GAEJ 2MA3A 2DDAA 3HGGA 3JSPA 2OBPA 4BY7J 5E1WA 1EA3A 4BXUA 4CH7A 3DKXA 2UWMA 3H0GJ 2FA5A 4U87A 1I3AA 2VQHA 1Z6RA 4WXCA 1FZPB 1T08B 2LKXA 2VPRA 5D8LB 2VI6A 1XCVA 1YX5A 2Z1DA 5F0CA 2R7UA 4IL6C 1RETA 1IXCA 2V26A 3DPLC 5CLSA 1Z05A 4A0XA 1CF7A 2CUJA 3I59A 4D9JA 3I71A 2ELJA 4XLNF 3TO7A 2Y9ZA 2HXOA 3OL3A 1QQIA 4D7MA 1Z67A 4V19K 4KICA 4U0WA 4Q4ZF 4HSRA 2UUZA 2ZSIB 3KP3A 3IP4B 2ECBA 1F5TA 4Q5SF 1J5YA 1E3HA 2LF8A 4QPOA 3L2UA 4HQEA 2O9LA 2JUGA 2F5CA 1SD5A 2B7EA 3CTAA 5ED4A 2KJCA 1T0FA 1R22A 3I9V2 4RAFA 4IO9F 2VC0A 2VONA 3IH2A 1RKWA 4M3FA 1HKSA 2ECCA 4DQ2A 2HFHA 2VE9A 3RPUD 1PYVA 3FDYA 4NB5A 1MBKA 1BR2A 2OQRA 3CQZJ 4C3IJ 4XLAA 5JHUA 1B1BA 3ZQIA 2WAFA 2XV4S 4BEHA 4F7ZA 1VI0A 2K85A 5E3NA 3LOCA 3OL4A 4ZYGA 3PUFA 3HHGA 1IN6A 4N0BA 2G9WA 4L9JA 4L9VA 3LFKA 2VBZA 4JK1X 2ZB9A 1U0JA 3BZKA 1GT0C 4NC6A 3GX4X 2VT3A 4O5VA 4CDGA 1GXPA 1EJ9A 2E5ZA 2DA2A 4XK4A 1LE8B 2A6HF 4ENJA 5DCMB 4ZZLA 1USTA 4OAZA 5AONA 2NOGA 4I98B 2HNHA 3HOSA 3CCQI 2LH9A 4UHTA 4HRIA 1H0MA 2E34A 4S04A 5IYBJ 2KFDA 2WAQA 4FETA 3DU5A 2EJRA 2AQEA 3GZ6A 2NXNB 4I6ZA 1JT0A 1ODDA 2DA5A 2EK5A 2O7OA 3BOQA 2EA2A 4D5CA 2YX4A 4KA4A 1RESA 4XRSG 2KMUA 3GFJA 4MO7A 2FF4A 3ONQA 3S93A 2DU9A 1S72I 2HTJA 1OCCH 1LE8A 2VXDA 2ZMEC 3BWGA 3S1QJ 1VQKI 3PNYA 3FKJA 5LHHA 1ZH5A 2HQNA 5LGUA 1BR4A 5HOOA 3FK7A 3PUBA 3I56I 1HDDC 2MABA 3PSIA 3BJAA 3K4BA 2CRGA 4LIVA 2Q2EB 3FIWA 3RSNA 4D5FA 1JTYA 3WE3A 1WJAA 4P96A 2M8EA 4G6QA 4ESBA 5E18F 2FUG2 3S2HJ 3KETA 4IRHA 4PK4A 1IG7A 3MZHA 1T98A 2DW4A 3FMQA 2R5YB 3IRQA 4MNUA 2G7UA 2EV5A 2BW3A 3Q0VA 5J1UA 1GVJA 2WC2A 2M5WA 3H92A 2XKOA 3GUDA 4ZYEA 5ERIA 1YJNI 3K10A 2LKSA 4B44A 5K5QA 2GXBA 2QEXI 4EGYA 1WI3A 1JKOC 3C2HA 2TRTA 2HZDA 4JOMA 1A6IA 2NNNA 2JUCA 5L3CA 1YRNB 2L01A 2EBIA 3GTQJ 3VYTB 1QZZA 2FX0A 2EPFA 3ZMDA 3QU6A 3JRGA 4UV8A 1WH5A 5ILUA 2ID3A 1UCRA 3SHFA 2IA0A 2LNBA 1IW7F 1KU2A 2YS9A 1ETYA 3R0JA 4AYBA 5E3MA 3EUAA 3IKTA 1HC8A 4Y3OA 2DFIA 3CCLI 3GFMA 2RVCA 2KIQA 3PSFA 2KZGA 2G7HA 3V7SA 2BY1A 2P81A 3K70C 2BHYA 2K9MA 3KP7A 6PAXA 4RGSA 1XC5A 2MW8A 2NYXA 4GGGA 2PG4A 3HIFA 4ZDLA 1RPWA 1W4MA 3A4CA 3CLOA 4RB0A 3M7GA 5L3BA 3ECOA 1HSJA 2ZJPF 2P7CB 4QPQA 5JR3A 5H20A 2YSRA 5DV5A 3RQ4A 1WJEA 1U8BA 4EJOA 2L9NA 1ZR4A 1GV2A 1POGA 3LSPA 1W0TA 4G7OF 4XIDA 1GV5A 2PJRA 1UJ8A 2WAEA 4IEJA 3T8TA 1FMVA 3I64A 2F5EA 3JTGA 1DP7P 5FRMA 2A69F 2KIUA 3DP7A 4UUTA 1U5TB 3CP2A 3LQRA 2E60A 4XSXF 1F43A 1QZYA 2WV0A 3C18A 1OYIA 5ICFA 4CYCA 2MYSA 2JRMA 2DA7A 2LBFA 2R5ZB 4U7DA 3ULQB 2XSDC 1FX7A 4XRMA 4A0ZA 3LSTA 4PJNA 4EV0A 3ZCOA 3RPUA 4OOIA 1TP4A 1OYYA 1UHMA 4EATA 3GLLA 2CUFA 4XONA 3ABMH 2LREA 2D5VA 2Y0SN 4NDLA 2P5VA 3DF8A 1HDPA 3N4MA 4ZYDA 2IP2A 2VC1A 4A93J 1A5JA 1L3LA 2HYJA 2X51A 2OJED 1I1GA 2TDXA 3SEZA 3ELKA 2H8WA 4L0YB 3PIPF 4ZDPA 2I10A 3H3ZA 3ZMZA 3QAHA 3KLOA 3OIQA 4FQGA 1WRJA 2VOPA 3JW4A 1IDYA 1QRYA 2Y2ZA 5F0HA 1IUFA 1OKRA 1VQPI 4FTHA 1VQLI 2K9QA 3AG1H 4BS9A 2C6YA 2XKPA 2HDCA 3DKWA 4KFCA 3HB9A 2CH0A 1REPC 1U9OA 3IUOA 3V7CA 4U7BA 2JJ7A 3K1PA 3IKVA 4CSWA 4I2OA 4PGHA 2WA0A 2X1DA 3S32A 4E7ZA 5K5OA 2DFEA 4CZZA 3EYIA 2VQCA 4M3GA 1W5TA 1G3SA 2NS0A 1AA7A 3L2WA 3EPZA 1VQ9I 2CQXA 1W5SA 3BR3A 4ITVA 1XMXA 5KAIC 2CV0A 1OMIA 2R7FA 4B3AA 1DPRA 2IS6A 4I7HA 2DA6A 2WADA 2VLAA 3VOEA 1SANA 2LSOA 2GXAA 1ETVA 3F21A 2BVLA 1D0XA 5D8KB 5CKTA 3I0TA 1O4XA 1FSHA 1YFHA 1HA8A 1R5ID 2XAQA 3TOAA 2M30A 3A01B 4IOCF 2QENA 3CDLA 1P2FA 2K9SA 3TKYA 3RIRA 3J80Z 2V1DA 2XGDA 3RCOA 2H1KA 2BY3A 2M2EA 1UELB 4R1HA 1FP2A 4PCQA 5GPAA 4IQJA 2VQGA 4XQFA 4G9YA 1DGRM 5K7HA 1DQUA 3VODA 1TTYA 1S7OA 2DA4A 5JVTA 1Z21A 3CCYA 2MC3A 1T6SA 3E97A 2FNAA 3V4GA 2FMLA 2NS8A 4CO8A 1MIJA 2Z9OA 3TW6A 1P4AA 4L5EA 4P9UA 2STTA 4BHPA 1ZYRF 3SEQA 2XROA 4OU0A 4LD5A 3QPLA 1K6YA 5GAHJ 2XIGA 3OY9A 2HQAA 2L9SA 2V4JC 5BOXA 4MTEA 2ELKA 3AG2H 1TT5B 3MAJA 4PGGA 3P9CA 4FX4A 3ABLH 3ZQ7A 3F23A 3FMRA 4IXAA 2XF7A 1B4AA 5C44J 4DYRA 3A03A 4LIUA 1XGSA 5H6QA 4X1EA 1XPXA 4HEA2 3EUHA 1VQNI 2OZ6A 5C4XJ 3J7ZI 1WH7A 3F3XA 2GA1A 2OD5A 3K2AA 2A05A 3BG5A 2DN0A 1FYKA 3Q0UA 4PJJA 2ZXIA 3CUQB 4Y15A 1IN8A 2E7XA 1NHAA 4RS8A 2R7QA 3BP8A 5CPRB 1TL8A 3G3ZA 1D0YA 1FNNA 3AFHA 1RUOA 3FF5A 2LMDA 5F0FA 1IGNA 2ZNZA 1J7KA 2F48A 4BBRJ 1OCZH 3E3VA 4GDFA 2DLLA 3N97A 5FLVA 1P7JA 1BW5A 4K2EA 1WWXA 1ON1A 4E7KA 3J7AO 3VPRA 3LSKA 2CO5A 1R4NB 1TNTA 1G59A 3WU1B 3T0YA 2B0LA 3KP6A 4C30A 4RAYA 1WKMA 1WHUA 3HTUA 1S9HA 1TQMA 3FBIB 4UVCA 3OOPA 4IRIA 4RLFA 2MLGA 1ZQ3P 5EYRA 1H89C 3M9AA 1Z1DA 3IL2A 1LVKA 4XICA 3HKZN 3OYCA 2QKMB 1UHWA 2HI3A 2OC6A 3HEFA 3GTJJ 1AKHA 2RREA 3HM5A 2IS2A 1R1TA 3BR5A 3I5UA 3V8JA 3EUHC 1J9IA 1FWZA 3P9KA 4XKWA 4AIDA 4B4CA 2CJJA 2DYSH 1PUFA 1FY7A 4Z2YA 2PJPA 2RKHA 3V42A 1NTCA 5M5YJ 2ZC2A 1R1VA 4I0BA 1Z3YA 3S15J 2L54A 2ZXHA 4A69C 1FOKA 2FOWA 4I99C 1YRNA 1GLNA 4ENKA 3HRSA 1U8RA 5FKNA 4MHGA 2L2OA 3ASOH 1S6LA 1MMGA 4PUSA 1I1SA 1TNSA 1TW2A 2QZ8A 5ILVA 1G2HA 2DA3A 2LTPA 3ML6A 2W82A 1TWCJ 1JTXA 3JTHA 2A6EF 3DEUA 3DLAA 3EETA 1IXSB 1N77A 3WU0A 3MKZA 1DPUA 1XTAA 3TP0A 1F36A 3BQZA 3S1RJ 3IH3A 1AKHB 5IT3A 2R5YA 4S05A 2KJBA 4IPAA 1TQIA 3RPQA 3WODF 1KQ0A 4O6JA 4HLYA 5BNGA 2BY2A 5CYVA 2DA1A 2P8TA 4PJ0C 2GOXB 3I4NJ 3B6AA 3TGNA 4G7HF 2FQ4A 2UXNA 4WF2A 1G3TA 2NVUB 4HG2A 1FOYA 4LG0A 2BYVE 4Q47A 2D1VA 2IA2A 1VF9A 4UV9A 1RRJA 2NNYA 5EEAA 4AIJA 4EM1A 3S17J 4XKBA 1RR7A 3K4CA 4YELA 4LG3A 4YFNF 1MZBA 2ICWG 3OSFA 1VZ0A 2JA7J 4CCJA 1H9TA 2KIFA 3HG9A 1QHGA 4DBQA 1ACIA 2HOAA 3BROA 4RB2C 3BJOA 3CUOA 1CQTA 3IWFA 5HDGA 3AL0C 3E5QA 4I01A 2K7LA 3M1CA 2DJIA 3HC7A 4IVNA 3SZGA 4Y52J 4OIPF 2VXZA 4DYCA 3TL4X 3OYDA 2ZJQF 4W97A 3HSFA 1D8KA 4XORA 3WE2A 3OYHA 2V7FA 2XRNA 5DCMA 3ZP5A 4E4HA 1KA8A 2GIVA 1IJWC 3EDPA 2YR2A 4DJAA 3WTUC 3SFIA 4A3JJ 2ZXWH 3BR0A 3DQVC 1FT9A 5D5VB 1JUMA 3QP5A 2J5PA 5BS6A 1HW5A 3KP5A 2RNJA 4B3XA 4HF1A 3HUGA 3FXQA 3QP6A 4HLXA 1Z0XA 2FE3A 3WG9A 3F8CA 4EEFG 2E2IJ 5L3GA 1GXQA 1IRGA 1R6RA 3ZMSA 5LGTA 1K6OA 2EQRA 1HCRA 4QSHA 5B1BH 2MGQA 2AS5F 1P6RA 4DZJA 3WGIA 4DZPA 1VTNC 3BG6A 3CLQA 3ZQLA 2JA2A 2HVSA 4ZDOA 4XRSA 2HZTA 1BBYA 2MSYA 1BC8C 3E0JB 2NVYJ 1E3PA 4BACA 2H1LA 1S7AA 4GYIA 4XKVA 3AG4H 3PIOF 3LA3A 4XBFA 3ZXSA 5JHFA 4EJUA 3F72A 4ZYHA 2Q0OA 4MIMA 1A35A 2HQRA 3OS0A 4P1WA 2FBHA 2CMPA 5GTHC 1SVLA 2EB7A 4UUSA 4AC0A 3BR2A 5JLXA 1TZLA 5B66C 2FBKA 2OA4A 1VQ4I 2GIZA 4CA0A 1LKXA 2EZIA 4F91B 1MJAA 2L7MP 3CO6C 1CF7B 2EV6A 1LFBA 3W2AA 1KGSA 4IHWA 4LMYA 2HR3A 3OYFA 1JKPC 1IF1A 2JMWA 3SDBA 3B73A 2N8GA 3E5XA 3RJPA 3H1CA 4BGDA 4R79A 5B5EC 3OYNA 2HKOA 2W24A 2JA6J 4BYYA 4RDUA 2Y75A 4KIFA 3HOXJ 4M6XA 1LQ1A 1LEAA 1UFMA 1X1PA 3PFIA 4NQWB 2HYFA 5TJJA 4BY1J 2OU2A 1UG0A 5KK1A 5LFAA 1WCMJ 1D8JA 2DMPA 1EH7A 1PP7U 3CUQC 4M72A 1AOYA 3K6GA 4Y7NJ 3NEUA 4MQVA 4ENNA 4UVAA 2PBIA 3A2KA 1V5GA 1FYLA 2XGCA 3UR3C 1AU7A 3AL0B 3OS2A 2GM4A 3AG3H 2R92J 2B63J 5ICEA 4ASNA 1Q1VA 2HDWA 1SMYF 5EZGA 3OS1A 1MDMB 2I8DA 1V4RA 1KZHA 5HDKA 2LR8A 5LLQA 4DIQA 4L0ZB 4G6DA 1NG7A 2IGNA 2JVHA 2XAFA 4M73A 1R23A 5F6FA 5KAFC 1MBHA 3KYDB 4L9TA 3U1KA 3PNVA 3MZ8A 2Y0MA 1WGXA 3PM1A 3ZPLA 1R9TJ 1SD4A 3O6BB 3SDGA 2D1HA 4C3HJ 4FX0A 4OWRB 5M5WJ 2X85A 4C9YA 3HPGA 1MH4A 5E3OA 4HV5A 4YRVA 2R7OA 3TO9A 3BZCA 4OIRF 2LOOA 3GYHX 5HNFA 2AXTC 3RQIA 3BG9A 3BTCA 4MFDA 4UUSB 3DEWA 1XSVA 5LBQA 3PL8A 1YW7A 1Y0UA 5F64A 1UG2A 1UZCA 1E3OC 1OR7A 3LSIA 2RAEA 1HXDA 1LDKB 2MBFA 1WJBA 3L00A 4BNCA 1KQ8A 5GPCA 2ME6A 5TGTA 3ZRGA 4KMUX 3VWBA 4ABZA 1U5TA 3G6EI 2DK5A 3F0CA 4IOAF 2VASA 4BAYA 2ZJRF 5LEJA 1DU6A 2R93J 1MKMA 2IEKA 4D0PA 3JRBA 3TBIA 1YS6A 1KQ9A 2MLKA 1IC8A 2RDPA 3F8NA 2E7WA 4X0GA 3QOPA 5E79C 3Q9VA 2COBA 5LRRA 1I5ZA 3C7JA 2Z3YA 3HKZA 4YIRX 1ZRFA 4KN7X 1MBGA 3H9QA 4JP0A 4KIGA 3RKXA 5DTDA 1Z9CA 2VN2A 1NH3A 2DMTA 2A5YB 1MJ9A 3IH4A 3WHBA 2X1CA 3VSLA 1W36C 1I6XA 2DOFA 2M9HA 2NS7A 1XGNA 4CICA 2CGPA 1SAUA 2IJLA 2QQ8A 1BW6A 2VJ4A 1JGSA 1SFXA 5KCMA 1HKQA 2W7NA 4PDKA 1ETWA 3P7NA 1J59A 1VQ7I 1BA5A 1D5VA 5IOZA 2FBIA 3DPTA 1IRFA 3L2QA 2EFWA 5FGMA 2R7ZJ 1T56A 5LRSA 2R7VA 3GZ5A 5FKMA 4IZZA 5J40A 4A12A 2ZO4A 3MMYB 3CMAI 4BE1A 1H9GA 1YE9A 1ZG1A 4EVIA 4CCMA 4XM3A 1ZLKA 4NUBA 1BIBA 2FU4A 2VKEA 2XB5A 2XDVA 4EM0B 4HSTA 3ROUA 3WTXC 1P92A 3ABTA 3EQLF 5BPIA 1FYMA 3K70D 3W6VA 3Q3SA 2F4MB 2VT2A 4FCYA 3U21A 3NWTA 3OYMA 5EEHA 3GW2A 2EIJH 1ON2A 4A3GJ 2ESHA 1O7LA 4CCKA 4XN0A 5DD8A 3H5RA 4FASD 5EDNA 5EGOA 2QQ9A 1ZGWA 2JPBA 3CJQB 4XLHA 4IX7A 2XAGA 1ORKA 5J6XA 2LF7A 1D1AA 2ME0A 2RGVA 1SD7A 1WJCA 2MD0A 2K86A 4A3IJ 2DTZA 2I5UA 2K27A 4E7JA 1K83J 4MGRA 2QVOA 3COAC 1SVMA 2L0KA 3M8EA 2XGEA 2IGKA 3G1OA 1K7AA 4RA2A 3W2VA 2KDOA 5H6RA 3MKWB 3MQ0A 3IAM2 4IJAA 3M07A 1W5CC 1RKTA 1IN7A 2WB1A 1XCBA 2AO9A 2GQQA 1R4MB 1IN4A 3BT9A 1BI3A 5F08A 5FD5A 2V6EA 1R36A 2A61A 3ISPA 3P9IA 1MSEC 1JT6A 2BVMA 4G94A 1BC7C 1VQOI 3DWLE 5EEGA 3RKWA 2STWA 1P7IA 1WJFA 3HOWJ 3LSHA 2UXXA 4L9NA 2IRFG 3CCJI 3LFUA 3L9FA 4HW0A 1APLC 4A5NA 3CMMA 2LG4A 3MZYA 1O3QA 2ADUA 2FXAA 4ON0A 1W7PA 2J5OA 2Q1ZB 4BL0B 1OCPA 1IRZA 1N25A 5J8FA 1CGPA 4PZJA 4I0AA 1QZEA 3L7WA 3M3YJ 4P5OA 3O8HA 1OQYA 3D5SC 1O3SA 5M3FJ 2IA1A 2CW8A 4N9IA 5IPAA 1SFKA 4F52A 2KRFA 2L5QA 1E2XA 3BG3A 4CCNA 3REOA 5DCFA 2FOKA 2NVXJ 1A31A 2EFPA 5DUKA 4HAMA 5IT9Z 2JPCA 3OYBA 1OR7C 4YIIA 4BQAA 2F4OB 5JI6A 1RZ4A 2CQNA 3B02A 2A3SA 1K79A 3GCMA 4BU2A 2V9PA 2M3AA 3K4MA 5CVUA 3S2WA 3SZTA 3LSGA 4DOZA 1S5LC 3U9GA 4EM2A 4F3QA 2O8KA 4NHJA 1FEXA 4XLCA 3KFWX 1XGOA 4DBRA 1TBXA 4DGWB 4U88A 4AUXA 2R4GA 1PJRA 4Y13A 3RKQA 3KEOA 4HQMA 4EJTA 2XC7A 4XNFA 3HYIA 1U6GA 2R7RA 2PLYA 1I3QJ 3SJMA 3E1SA 1ZRCA 2HVRA 4A6EA 4F92B 1SVOA 4BQQA 1XS9A 3LSRA 1ETKA 1KU7A 4WX9A 3GMEA 3B6CA 1ZG5A 2FMYA 3QYEA 3J81K 2QCOA 3I54A 3RZDJ 4BJ5C 3E6CC 4MLOA 2ZKZA 1S3JA 3FXJA 2KIMA 3KZYA 3NAUA 1U78A 2Y31A 3EYYA 2OAZA 2M34A 2P4WA 3QU3A 5DYMA 2X6OA 1T33A 1ONVA 3KZZA 1UB9A 2CG4A 1QVTA 3DBRB 3ZQFA 3BR6A 3D0SA 3GXOA 3CCUI 2LK2A 1K4SA 5J3LA 4HNTA 3HGYA 2ZFUA 3TP3A 3LAPA 5K7ZA 1ZGJA 3FXLA 2XGXA 3BTJA 2ID6A 5IYCJ 1FTZA 2L7ZA 3ESWB 1J2XA 3HRMA 2WWYA 3CCEI 2WV1A 2F2EA 4OMYA 5DD4A 5FD6A 4M6VA 3WTVC 1JJ6C 3FK6A 3ERMA 2COMA 3ZQGA 3OYJA 1PVEA 1SC7A 1T2KA 2OF7A 4KITB 2VJJA 4JX6A 2DXIA 1GVDA 2UV1A 3HXLA 5KNLA 4WXDA 2R7WA 1R00A 2VKHA 1VNDA 1SAXA 4N9HA 1P9QC 4WXHA 5L3EA 1MJBA 2DFHA 2RV8A 1FSEA 1Z77A 2DQLA 5D6FA 4PSXA 3AKZA 1LB2A 5FFZA 2E71A 1FTTA 5CVIA 2EZKA 2MH9A 1LDDA 2LFBA 3WU2C 1R1UA 4UVBA 1HW2A 4OMZA 3S8PA 2B9SA 5GTIC 4ZYAA 2L4MA 3CC2I 2W1OA 4FE7A 1BI1A 1QO0D 2OTLI 2O03A 2GOMA 2DOAA 4HV6A 5TRDA 4AVPA 1VQ8I 3CCMI 1J75A 4V2GA 3ZMTA 4PJMA 2ZFWA 2R5ZA 1BN5A 1V54H 1SFOJ 4XL9A 3FXRA 2R7XA 2IGMA 5HNHA 4G7ZF 1IAWA 2W25A 2E1NA 5FKLA 3UNGC 4BHBA 4BXFA 2E2HJ 2YU9J 2CWEA 1ETQA 3QRFF 3E6BA 2L7KA 1O3TA 2F6CA 5KVRA 1XG1A 3JRFA 2PJRB 1SD6A 2X48A 2BXZA 4M6YA 3VYRB 2FJ1A 1G3YA 4HF0A 2HS5A 1AWCA 3OR1C 2KQRA 3PNTA 1K4TA 3WGGA 2M1BA 1OCRH 5B1AH 2UZKA 2EFNA 2RNGA 5BMZA 1BM9A 3PO3J 3LWFA 3HJEA 2PX9A 2HVQA 3GFLA 4WCGA 3IHUA 4KT6A 3UKGA 1TQPA 3BY6A 2MD5A 3TEDA 3QYFA 4EQQA 1XDSA 2XHKA 3SYTA 2VBWA 2Q8KA 4B09A 3ZQCA 3OSGA 3DBHB 3JSOA 4PJLA 5CVRA 4A3DJ 2Z33A 1R71A 2W84A 1EKEA 1MMDA 2L9RA 2O5RA 3QPSA 2OUMA 1ETXA 3WTZA 2EWNA 4IHYA 2O61A 2HYGD 2LY9A 1I6HJ 1XN7A 2EIKH 5FROA 2V1UA 2NOJB 2M4KA 3LMMA 4XLEA 3DEEA 3BDDA 4CUGA 1W7PB 1ZKGA 2WBMA 1JUPA 2W48A 1W0UA 1WZ2A 1Z91A 1T8IA 4E7HA 1PDNC 3DTIA 2EZLA 1O57A 4BDYA 1PUFB 3JREA 1LPQA 1V5EA 2WAQN 1JXSA 1KYZA 1S29A 3OOUA 3FISA 3I4MJ 2BW3B 4AIKA 3KLNA 3DCFA 2ZCWA 4Y4RA 2DT5A 1X1AA 3JRAA 2K5CA 4FHTA 5K5RA 2Z2SB 4FE4A 3VYSB 3H5NA 1BJZA 4OIOF 3BCBA 1WJDA 4ZTFA 2KRCA 2HOTA 2QUFA 2KKOA 5FLMJ 3VSKA 1MSFC 5F1RA 5IP7J 1HBXG 2JT1A 2VPLA 3W2WA 2RQQA 9ANTA 3NQOA 2VBYA 3W6KB 2L9VA 5JVGF 3I3LA 5J1RA 3HZJA 3M8FA 2CSOA 2WB1N 3X2QH 5LHIA 4I76A 1DGWY 1Y56A 1ZN2A 1IV8A 1Y6IA 1IO2A 1X4PA 2Y30A 4KISA 5IYDJ 2HXIA 2DCEA 4LLLA 1FOXA 3F22A 4LLNA 4L5JA 1D0ZA 2EFOA 1T0FC 3MFKA 1YW8A 3MKYB 1Z3XA 2XSJC 1J0RA 4IHSA 4IRGA 4KN4X 4XOTA 2M7AA 2GXGA 4B48A 5FB2A 2E1OA 1YLFA 2E1MB 3L09A 1YS7A 3G1LA 4A0YA 3FWEA 3DV8A 3J7YJ 5J4VA 3C2GA 5FRNA 2FSWA 2W00A 2IPQX 1YJWI 5LD2C 2XB0X 3LA7A 3VB2A 3LL7A 3I58A 5E1ZB 4U0VA 2H27A 1XD7A 3CP8A 4MFEA 5IOYA 1HF0A 3GBGA 5EF6A 4ESFA 5C4JJ 3HL2A 2VODA 3N05A 1ETOA 5HS7A 2PMUA 4C2TA 2M87A 4P9FA 1YIJI 5ILSA 1D3YA 2IS1A 1ZHFA 1BI2A 2HPMA 1S7EA 1IRXA 1LJ9A 2DDBA 2IVMA 3F8MA 1KU3A 2DBBA 2R7DA 4CGZA 4RB1A 4EJVA 3K4JA 5B3SH 3FHNA 1BOBA 1P4WA 2JRTA 2ZBKA 3QPHA 4ENMA 2QSHX 4A3BJ 3BPVA 4GCVA 4GFBA 2QGUA 2IXSA 3MWMA 2XAJA 2BHZA 1TWFJ 3KYLA 3FM5A 2R3SA 3OYKA 5BPDA 2KRHA 3G2BA 2HQ5A 3OIPA 3GTLJ 4PFPA 5CQGA 2P6TA 3F9KA 5E8GA 3DFGA 2BE5F 2K4JA 5JFRA 5EG0B 3A01A 1FIAA 3SQNA 2VL8A 1XDUA 3PQJA 1XX5A 2DI3A 4N4OB 1HOMA 1EH8A 1YJ9I 2XVCA 4XLFA 1SEUA 3WGHA 1VQ5I 4JBAA 4ZC3A 2QF7A 1YQAA 4JYKA 3R6SA 2IGOA 2P5KA 4E6KG 4AWXB 4B1RA 1DDNA 4ZJZA 4HX8A 1LUJB 3TQNA 1BL0A 1TWAJ 1YITI 1YYVA 3G73A 4BE2A 2DYRH 2LP0A 3CC7I 2W57A 2LD5A 1N78A 2OCEA 3MCZA 3QYBA 2LY1A 3KE2A 4E70A 2JN6A 2JK3A 1E0EA 1BIAA 3S1MJ 1FIPA 2JA8J 1MBJA 5F27A 2MH2A 1KU9A 2VKVA 3S2DJ 3F8FA 5D5XB 2O6GE 5EG0A 2KP6A 2CUZA 1XGMA 2M0CA 3NARA 2DFFA 3I4PA 2W85A 2EV0A 1VQ6I 2X1EA 2YUSA 4P55A 5DDGA 2PN6A 1BOAA 4RMNA 1VFCA 3TDUC 1X58A 1Y1VJ 2YX7A 2CW0F 3I53A 1IZ1A 3CMYA 1B59A 3DTKA 1H8AC 1WQ2A 1JKRC 1LVAA 2FRHA 1HSTA 3S1NJ 5HS8A 3IC7A 3LSJA 2KLOA 3HTSB 5IP9J 4ZTJA 1MMAA 2X4HA 1H88C 1IDZA 3GLXA 4A3FJ 4LK0F 3JRCA 3E6DA 4F55A 2JZYA 5HS9A 3HSRA 2CV2A 2BXYA 2BGCA 1UMQA 3RDIA 1DU0A 1ZR2A 5HDNA 4BBSJ 1Y8QB 1JUSA 1Y0NA 4LLGF 2DAOA 3SFZA 4HYEA 3GF2A 2E5NA 1IUYA 2K02A 5F1JA 3CJNA 3BG7A 4HDUA 2DPUA 2A6TA 4II3A 3TO6A 4M3EA 3CO7C 3TOBA 4AVZA 1ZG3A 2V79A 3PFYA 4MTDA 2QSGX 3M1EA 3HOUJ 5LEKA 3KPHA 3U2RA 1B8IB 3BCAA 2EH3A 4XOPA 1G8XA 1W1WE 1MH3A 5HLGA 3WTSC 4IHVA 5IT9K 3T1BA 1FC3A 3H3UA 4LGWA 4YFKF 1RUNA 1OYWA 4AU7A 1X3UA 3EUKL 4RGXA 4QTRA 2M4GA 2RQPA 1TLHB 2ZSHB 2X6YA 4M74A 4KT5C 4HZFA 5FLXZ 3WTTC 2XPUA 5JLWA 3IV5A 3GTMJ 2EINH 5E17F 3FXOA 1E17A 3FBNB 3RTRA 1I27A 1UHSA 5HODA 2JTVA 2M45A 5E3LA 3DLLF 3SZPA 4RM3A 3A1YA 5AIPA 3U1DA 1T95A 2LDUA 2VIXA 2HDDA 3I55I 4YIFA 4FT8A 5HLIA 1X1DA 4A5MA 5LHGA 3RI4A 2E2JJ 1FBUA 3SXYA 5K1YA 2ACJA 1I39A 2O8XA 3ECHA 2PEXA 5H2FC 4C3JJ 4LOCA 3BLYA 4E7IA 3RZOJ 5A2QK 5D5WB 4G12A 4J19A 3KEYA 2OCCH 4MEYF 3MN2A 5CQEA 2CW7A 5IP6A 3Q9SA 2HPIA 2A07F 1ZK8A 5J47A 3J7AY 4O3MA 4RGUA 2VJ5A 5C3EJ 3VFZA 1FLIA 2P6SA 1M1EB 2ESNA 5J4YA 3HRTA 4RAGA 2KDZA 2K4BA 3WHCA 3OYIA 4UB8C 1OPCA 1U3EM 3QOEA 1GDTA 4M3DA 1R49A 5CVVA 1BR1A 1FPQA 5HVQC 4D1QA 2ISZA 2CQQA 2AXLA 1QGPA 2H6CA 2QSFX 1Y39A 3FMSA 3V8KA 4IHTA 1LFPA 2LKPA 4RB3C 4MEXF 2JVGA 2K3PA 1YOVB 1ZRDA 4W1UA 5L3FA 1OCTC 2AQFA 5L3DA 5DUIA 1ZAOA 2XRLA 3FKIJ 2CUEA 1X3WB 2DODA 4OINF 4CCOA 1F9NA 4R8HA 2LY2A 4BJTA 1RIOH 4C2UA 3K9TA 1YIOA 4HF2A 4A3EJ 4RBOA 4X6AJ 3BJ6A 3H35A 4YFXF 2V9KA 3MEXA 3L2CA 1X1BA 4B8XA 1FBSA 2Z16A 3K1NA 3LSMA 1Q1HA 4M9XA 3BTIA 2GAUA 2X6WA 2XAHA 3HOZJ 2F5FA 3PQKA 3JAMZ 2X0LA 2K40A 5GAGJ 1BI0A 2XAUA 2P5LC 2E19A 1LNWA 2Y69H 3GEZA 2GWRA 4RM2A 1JGGA 3GTOJ 1TT0A 3DU6A 5GADJ 1B8IA 2NRAC 1OFCX 2BEOA 4I02A 4GRIA 1T39A 2TCTA 1WSUA 2QWWA 1STZA 1MBEA 3M4OJ 1X4OA 1ZLJA 1B9MA 1LEBA 2K9LA 2JSCA 5M5XJ 4L5IA 4HOBA 5D5UB 5DEQA 1XMKA 2MFZA 3OWTA 3GFIA 2JWTA 3V8LA 4HNVA 2D2WA 3C1DA 4BXXJ 4RLQA 4KIBA 3A0HC 1IN5A 3CF2A 1WVRA 3CMEI 2WTEA 2RC4A 3R60A 4II2A 2QBYA 1P4XA 3ZOBA 4OAYA 3T5XA 3D1NI 2JA5J 3FZVA 2Z99A 3OR2C 4KDPA 2EILH 4JX4A 1FBQA 2E36A 5CJ9A 2QA4I 3HHHA 1XMAA 5F04A 2LLKA 3TW7A 4GYGA 5IY5H 3L1PA 2CYYA 2VE8A 3ZN0A 1HKTA 3H36A 4CYDA 4JX5A 2G0EA 1V3FA 4V2FA 2HOEA 1YX3A 4N4NB 4XR6A 2O3FA 4NC8A 1V55H 2GA2A 4MQ9F 2PFBA 5TISC 4XN3A 1MNMC 2JQ7A 3GTKJ 3S3OA 2DPDA 2H94A 3HDDA 1TWHJ 4AYBN 4UNOA 1ENHA 2V1NA 1X2MA 4GXOA 3IWZA 1QBJA 2HTSA 3KYCB 3DPUA 2IW5A 3ABKH 2R0QC 4IF4A 1A36A 1FMWA 2NAZA 2ZMEB 3ZR8X 2KT0A 4PFOA 1IXRC 3D5RC 3RKYA 4HDVA 4CCLA 3GZNB 5D4SA 2LVSA 4IQ4A 3K4LA 4J01A 1GHCA 3HUGB 4GO1A 2QYOA 4C2MJ 1A04A 2GBYA 2X6XA 3BR1A 1OJLA 1MGTA 5EJCA 3K1MA 2KPMA 3O8GA 2F4IA 3FHZA 3A02A 1BJAA 2OV7A 4WWCA 3QWLA 3NWSA 2LC2A 2RN7A 1U2WA 3CD6I 3VEPA 4H0EA 3G1MA 3H3VK 3F8BA 1QA6A 1R58A 1NK3P 2LBFB 2CU7A 5FJ8J 3OMYA 5ICGA 4CYCB 4M9ZA 4YEJA 2VOOA 1YTYA 2L4AA 2QM3A 1O3RA 3GTPJ 2FD5A 1C0WA 1WFXA 3W3CA 3BTLA 1MBFA 3RYRA 1B72A 4KNYA 1MW7A 3CC4I 3IAS2 3C2BA 2DK8A 2OQGA 2FEZA 2XPWA 5FKKA 3R0AA 3OYGA 4BDZA 4LG0B 2P7VB 1W7PD 5CVJA 2LRDA 2MC4A 1GUUA 3S14J 2Y0SA 3CCVI 3OIOA 2M7BA 5FKOA 2MG4A 4LK1F 3H0DA 3J81Z 1F4KA 4EJWA 2K3FA 2ZMEA 3VDXA 2L02A 4HX4A 4LJZF 4G8XA 4J00A 2V6CA 3OYAA 5J1YA 5HLHA 1V5FA 3G71I 1YW9A 3HRUA 3GO5A 4DNCA 5FLXK 5M3MJ 1JHFA 3TMOA 5HLTA 1HQCA 3CCSI 2KL4A 4L18B 3H9GA 2OZUA 1Z6TA 5E20A 2F5DA 1USSA 1G4DA 2P0WA 3AAFA 1TWGJ 4HBLA 2IS4A 3Q5FA 2PMZN 4D7NA 4ESJA 3DXJF 2H8RA 2EA4A 2DT6A 3BQYA 1G6NA 2XF5A 2V1XA 2BY0A 2K9NA 1FP1D 2Y48A 4LITA 4XSZF 2CS3A 1W36D 1B9NA 2E1CA 2L3DA 3T8RA 1RNLA 3ZN1A 1XB4A 2DOEA 4B47A 3R61A 3QQAA 4CZCA 3CESA 4M3BA 2GLOA 1K78A 2QBYB 3PJRA 5J8CA 2NVQJ 1F1ZA 3LQQA 3CJRB 3A0BC 1Y1WJ 4PSWA 1D1CA 3JRHA 3E5UA 2WY8Q 4BE0A 3O3KA 5FO5A 1WI9A 2HGCA 1TC3C 2PMHA 5D6EA 1QPIA 1A6QA 3MVPA 2NVTJ 1JHHA 4Y17A 4IHXA 4Q48A 2HKXA 1HLVA 5DS9A 3ZMUA 2PQ8A 3OYLA 3HSEA 1IV6A 3K69A 4KMFA 4HA8A 4S0HB 3MKLA 5EZHA 4LB6B 5BQTA 4DYQA 2OTJI 2F5VA 3LA2A 4BJ6C 2KZVA 1YHQI 2HWVA 2FNPA 2V9VA 2DJNA 3HOTA 4CXFA 2GZWA 3QODA 1WJ5A 3JCUC 4BHCA 2QQBA 2X9DA 4LFUA 4Z6YA 3G4SI 2VBXA 2DQRA 3CDHA 3RYPA 3S3MA 3DBLB 1L0OC 2E1MC 4H4KC 5EGOB 3R4KA 2ETHA 4U0YA 3KEQA 3F6VA 2CFXA 3KP2A 1SFEA 4BKXA 3CDIA 2H6BA 1Y8RB 3K2ZA 1KONA 4NC7A 2CQKA 3H9JA 2AHQA 4CHUA 4BUPA 5GP9A 1MMSA 3CJTB 4XMYA 3H5AA 2WY7Q 1ITYA 4BEHB 2OPTA 4QIWN 5K7FA 3FM3A 1Z7LA 2HU9A 1ZREA 3O2PE 3ZGKA 1R5GA 2KHMA 5ICCA 3GVAA 4BQOA 1U9NA 3HPHA 5KHDA 4UUVA 2HOSA 3MD2A 1EH6A 4LB5A 2R7TA 4NBQA 1FOWA 3ZQHA 4RGRA 3JR9A 2Z5UA 2ZXJA 3FXKA 4ANJA 3J80K 2QLZA 2YU3A 4F93B 2EFQA 5DM6F 3KIOA 3ZMVA 4UY8I 2CFOA 3C3WA 1JI8A 3E7LA 1MD0A 1SMTA 2DMQA 4E7LA 2IAIA 1RI7A 5A2QZ 1RC9A 2VUMJ 4EMSA 2A5WA 2JSPA 5DM7F 4ZZDA 3GTGJ 1X3ZB 1X19A 3K4KA 4HX7A 1FJLA 4ETSA 3S3NA 2ZNYA 1LDJA 2HEOA 3I59B 3L2RA 1HW1A 3JRDA 3FX3A 1QNTA 4HPQA 2BV6A 4JQFA 3FXMA 1D1BA 4UXNA 2VQLA 4A3MJ 1K78B 1EV7A 3S16J 3NRVA 2IT0A 4I09A 2BOLA 4XLPF 2H09A 3KCCA 1R7JA 1X2NA 4NNJA 3CCRI 3VYUB 3KZIC 4AD9A 2CQ7A 1Z7UA 1MNEA 1B6AA 1DP3A 1N75A 4RAZA 3IRRA 2DTRA 1MMNA 4XRFA 4QLCU 1D5YA 1EF4A 2DT7B 3E6MA 4Y33A 4A3LJ 1ZELA 3BPXA 1O7FA 4OIQF 1G3WA 2D45A
chains in the Genus database with same CATH topology
4AVZA 3PFYA 1WJFA 3LSHA 1UAAA 2QKLB 3OYEA 2PMZA 3BCAA 4XOPA 3LFUA 1G8XA 2CV1A 3CMMA 2LG4A 4E7KA 4BL0B 4E7SA 3LSKA 2Q1ZB 4AU7A 3M8JA 3EUKL 3KX2A 2M4GA 2M0MA 2VJIA 2ZSHB 3L2VA 1G59A 2X6YA 4P5OA 3K4NA 3D5SC 4C30A 2CW8A 1S9HA 4B43A 3FBIB 1SFKA 4XKCA 4F52A 1ERDA 3FBNB 3RTRA 2L5QA 4RLFA 2XF6A 2VKDA 4CCNA 4RM3A 1LVKA 3A1YA 1MNDA 4IKFA 1T95A 2VIXA 3OYCA 3OYBA 2QKMB 1OR7C 1X1CA 3CZ6A 1OLTA 1X1DA 4KJZA 1QU3A 2OC6A 4BU2A 2M3AA 3K4MA 2RREA 2IS2A 2VB6A 4DOZA 3LSGA 3EUHC 4BQNA 4F3QA 3BLYA 4E7IA 2R7SA 4XKWA 4XLCA 3BC8A 4DBRA 4DGWB 3ZQQA 3KEYA 1J09A 2R4GA 1PJRA 5CQEA 2CW7A 3V42A 2HPIA 2XC7A 4XNFA 3J7AY 3DTEA 1Z3YA 2LYCA 2VJ5A 2R7RA 2ZXHA 3E1SA 4HNUA 2HVRA 1GLNA 4F92B 3OYIA 4BQQA 2L2OA 1QHHD 3QOEA 1MMGA 4PUSA 5HVQC 1BR1A 4D1QA 1NG6A 2W4SA 2W82A 3QYEA 1LFPA 3DLAA 4G6TB 3DKYA 4BJ5C 2JVGA 1N77A 2K3PA 3D5LA 4MLOA 3MKZA 2AQFA 1EA3A 4CH7A 3DKXA 2UWMA 4U87A 2VQHA 4CCOA 2LY2A 4BJTA 4C2UA 4HNTA 2ZFUA 1YX5A 2GOXB 2Z1DA 2R7UA 3H35A 2V9KA 4HG2A 3DPLC 2V26A 2CUJA 1X1BA 4D9JA 2ELJA 3OL3A 2Z16A 3LSMA 4XKBA 3K4CA 3OYJA 2X6WA 4YELA 4LG3A 4HSRA 4KITB 2UUZA 2VJJA 2ZSIB 2DXIA 1VZ0A 4CCJA 2XAUA 2UV1A 3HXLA 3IP4B 4QPOA 3HG9A 5KNLA 2R7WA 2VKHA 3L2UA 1QHGA 4RM2A 4DBQA 2JUGA 1P9QC 1TT0A 3DU6A 4GRIA 3I9V2 4PSXA 3AKZA 3AL0C 3M1CA 2DJIA 3HC7A 3SZGA 1X4OA 2VXZA 3TL4X 3OYDA 3RPUD 1PYVA 2K9LA 3FDYA 4XORA 3OYHA 2V7FA 1BR2A 3S8PA 4E4HA 2MFZA 3OWTA 4ZYAA 4XLAA 4DJAA 2W1OA 2WAFA 4BEHA 3DQVC 4RLQA 3CF2A 2GOMA 3OL4A 2DOAA 4B3XA 4II2A 1U0JA 4OAYA 3OR2C 4PJMA 2E5ZA 1R6RA 4XL9A 2R7XA 2IGMA 5HNHA 4OAZA 3UNGC 2HNHA 3HOSA 4BXFA 3BG6A 2LH9A 4HRIA 2JA2A 2HVSA 4ZDOA 2L7KA 3E0JB 2F6CA 4BACA 2WAQA 4FETA 2PJRB 1YX3A 4N4NB 4XR6A 3DU5A 4XKVA 4NC8A 2AQEA 3ZXSA 3VYRB 4XN3A 5JHFA 3OR1C 2KQRA 3S3OA 3PNTA 2V1NA 4P1WA 2KMUA 2CMPA 3OS0A 3DPUA 3ONQA 2RNGA 3S93A 1TZLA 1FMWA 2HVQA 2VXDA 3PNYA 3FKJA 4CA0A 1LKXA 3ZR8X 4KT6A 4PFOA 4F91B 3D5RC 1BR4A 3QYFA 3PUBA 4CCLA 5HOOA 3W2AA 4IQ4A 3K4LA 4J01A 2MABA 3HUGB 3PSIA 3OYFA 3K4BA 3SYTA 4LIVA 2Q2EB 3RSNA 3SDBA 4PJLA 2X6XA 1WJAA 1MMDA 4BGDA 2KPMA 2O5RA 4R79A 3OYNA 2FUG2 2F4IA 2OUMA 4PK4A 2OV7A 3NWSA 5FROA 2LC2A 2NOJB 2M4KA 3LMMA 4XLEA 2BW3A 3DEEA 4CUGA 4NQWB 2WBMA 1UG0A 5LFAA 3K10A 4B44A 4E7HA 3DTIA 2LBFB 3K6GA 4BDYA 3OMYA 3C2HA 2HZDA 1V5EA 4JOMA 4YEJA 3OOUA 3A2KA 1V5GA 2BW3B 3VYTB 3UR3C 4Y4RA 3AL0B 3OS2A 1X1AA 1WFXA 2K5CA 3W3CA 2HDWA 4AYBA 2Z2SB 3OS1A 1MW7A 3EUAA 3VYSB 3IAS2 2I8DA 3H5NA 3OYGA 3BCBA 1WJDA 4Y3OA 4DIQA 4BDZA 2KRCA 1NG7A 2IGNA 2JVHA 4ZTFA 3PSFA 3VSKA 2LRDA 2MC4A 3PNVA 2VPLA 2Y0SA 3K70C 2K9MA 3W2WA 2RQQA 4OWRB 2M7BA 2X85A 4C9YA 3HPGA 4ZDLA 3A4CA 3H0DA 4YRVA 2R7OA 3I3LA 2LOOA 4J00A 3VDXA 4QPQA 5HNFA 3OYAA 1DGWY 1V5FA 1Y56A 1Y6IA 1WJEA 3RQ4A 1X4PA 2L9NA 3TMOA 5HLTA 3PL8A 4KISA 2KL4A 2DCEA 3H9GA 1D0ZA 3LSIA 1T0FC 2P0WA 1LDKB 3MKYB 1WJBA 1Z3XA 2XSJC 2PJRA 2WAEA 2IS4A 4XOTA 1FMVA 5TGTA 2M7AA 3ZRGA 5FRMA 3VWBA 4B48A 3CP2A 2E1MB 2DT6A 2E60A 2XF5A 2VASA 2MYSA 4LITA 3C2GA 2LBFA 5FRNA 2CS3A 2W00A 1W36D 5LD2C 3TBIA 3LL7A 4B47A 3CP8A 4CZCA 3CESA 3GBGA 4PJNA 3PJRA 3ZCOA 3CJRB 3HL2A 3N05A 4PSWA 4EATA 1D1CA 4XONA 4X0GA 2LREA 2IS1A 2WY8Q 4BE0A 2HPMA 3HKZA 2X51A 3H9QA 3SEZA 1IRXA 4ZDPA 3K4JA 3OIQA 3FHNA 1BOBA 3OYLA 2X1CA 3VSLA 1W36C 1SAUA 4BS9A 2IXSA 2CH0A 2VJ4A 3IUOA 2F5VA 5KCMA 4U7BA 4BJ6C 2KZVA 3KYLA 4CSWA 2W7NA 3OYKA 2KRHA 2WA0A 3G2BA 2X1DA 3S32A 3OIPA 4E7ZA 3DPTA 4PFPA 5CQGA 3HOTA 3F9KA 2VQCA 3L2QA 3QODA 1WJ5A 1AA7A 3L2WA 3EPZA 2VL8A 4ITVA 4N4OB 3S3MA 2R7VA 2E1MC 4IZZA 4XLFA 4H4KC 2CV0A 3MMYB 4BE1A 4ZC3A 2IS6A 1YE9A 4CCMA 4XM3A 2WADA 4NUBA 2VLAA 2IGOA 4E6KG 2XDVA 1KONA 4NC7A 4HSTA 2BVLA 3H9JA 4ZJZA 1D0XA 5CKTA 4BUPA 3K70D 4BE2A 1HA8A 3U21A 3NWTA 3OYMA 1N78A 4XMYA 3H5AA 2WY7Q 4BEHB 3QYBA 2LY1A 1Z7LA 2HU9A 3RCOA 4XN0A 3ZGKA 4CCKA 1E0EA 1UELB 2KHMA 4IQJA 2VQGA 3H5RA 4XQFA 4BQOA 1DGRM 3HPHA 4FASD 5KHDA 1DQUA 3MD2A 3CJQB 2R7TA 1Z21A 4XLHA 4ANJA 4IX7A 2KP6A 2CUZA 4F93B 1D1AA 2X1EA 2MD0A 1WJCA 3SEQA 2CFOA 4RMNA 1JI8A 1K6YA 3OY9A 4E7JA 4E7LA 2HQAA 2L9SA 3DTKA 2A5WA 2V4JC 2JSPA 2IGKA 1X19A 3K4KA 3W2VA 3S3NA 2KDOA 2KLOA 3L2RA 2XF7A 4ZTJA 3MKWB 1MMAA 4HPQA 4JQFA 1D1BA 3IAM2 2VQLA 2CV2A 4LIUA 4F55A 4HEA2 2BOLA 2WB1A 4NNJA 2V6EA 3VYUB 4PJJA 2ZXIA 1MNEA 2E5NA 1DP3A 1N75A 4C2TA 1MMNA 2R7QA 5CPRB 2BVMA 1D0YA 3AFHA 3DWLE 2DT7B 3BG7A 4Y33A 1ZELA 2A6TA 4II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J01 A;  4J00 A;  3QOE A;  4HRI A;  3QOD A;  4IZZ A;  4YRV A; 
#chains in the Genus database with same CATH topology
 1U5T C;  3WTW C;  2DMU A;  4EGZ A;  1UAA A;  2QKL B;  3OYE A;  2PMZ A;  1QVU A;  2BZT A;  1K61 A;  3HOY J;  3P5J A;  2CV1 A;  1VQM I;  1NK2 P;  2ZJ2 A;  3CF5 F;  1AHD P;  3OV8 A;  4DW6 A;  2A68 F;  4E7S A;  2E35 A;  4BH9 A;  3JAM K;  3M8J A;  2ELH A;  1ZGA A;  3KX2 A;  1YG2 A;  2M0M A;  2O0Y A;  1ULY A;  2VJI A;  4FIS A;  3L2V A;  1YO5 C;  1JJ8 C;  3K4N A;  2ISY A;  3ASN H;  4AM3 A;  2FQ3 A;  3KP4 A;  1T38 A;  2DMN A;  4M71 A;  4A3K J;  1SFU A;  1PUE E;  4B43 A;  2Y9Y A;  3GWZ A;  3HOV J;  4XKC A;  3FXU A;  1ERD A;  5D4R A;  1XSD A;  4ZH4 F;  1RR8 C;  3BZ6 A;  2KIS A;  4UB6 C;  1KYW A;  2IBD A;  2XF6 A;  2XPV A;  2Q2E A;  2VKD A;  1MND A;  2EIM H;  4WK8 F;  4IKF A;  1PP8 F;  4M9S A;  3WG7 H;  1QPM A;  3LNQ A;  1X1C A;  3JRI A;  2DO7 A;  3CZ6 A;  1OLT A;  4KJZ A;  1B72 B;  1QU3 A;  2EZH A;  3HBL A;  3TDZ C;  1OCO H;  3Q0W A;  2PI0 A;  2YPR A;  4A2U A;  2XUB A;  4YG2 F;  1YI2 I;  2VB6 A;  3K0L A;  4BQN A;  1LFU P;  2R7S A;  3QPT A;  3BC8 A;  2L7F P;  3ZQQ A;  1I50 J;  1J09 A;  4TV7 A;  1TW3 A;  1XSX A;  1MDM A;  3LAJ A;  3DTE A;  3PO2 J;  2LYC A;  4KUM A;  3K7A J;  1R5H A;  3ABU A;  4A6D A;  4HNU A;  5AIQ A;  1ZAR A;  5FFX A;  1QHH D;  1DUX C;  2QQA A;  5E1X A;  2BBY A;  2M8G X;  4A3C J;  1JKQ C;  3WTY C;  3CUQ A;  1NG6 A;  2W4S A;  4KYW A;  3V7R A;  3W6J B;  5LGN A;  4G6T B;  1OIS A;  1JE8 A;  1S8N A;  3DKY A;  3D5L A;  2XAS A;  1WPK A;  4NQW A;  5E8I A;  3ERE D;  4QWQ A;  4AIH A;  3F6O A;  1ZTR A;  5GAE J;  2MA3 A;  2DDA A;  3HGG A;  3JSP A;  2OBP A;  4BY7 J;  5E1W A;  1EA3 A;  4BXU A;  4CH7 A;  3DKX A;  2UWM A;  3H0G J;  2FA5 A;  4U87 A;  1I3A A;  2VQH A;  1Z6R A;  4WXC A;  1FZP B;  1T08 B;  2LKX A;  2VPR A;  5D8L B;  2VI6 A;  1XCV A;  1YX5 A;  2Z1D A;  5F0C A;  2R7U A;  4IL6 C;  1RET A;  1IXC A;  2V26 A;  3DPL C;  5CLS A;  1Z05 A;  4A0X A;  1CF7 A;  2CUJ A;  3I59 A;  4D9J A;  3I71 A;  2ELJ A;  4XLN F;  3TO7 A;  2Y9Z A;  2HXO A;  3OL3 A;  1QQI A;  4D7M A;  1Z67 A;  4V19 K;  4KIC A;  4U0W A;  4Q4Z F;  4HSR A;  2UUZ A;  2ZSI B;  3KP3 A;  3IP4 B;  2ECB A;  1F5T A;  4Q5S F;  1J5Y A;  1E3H A;  2LF8 A;  4QPO A;  3L2U A;  4HQE A;  2O9L A;  2JUG A;  2F5C A;  1SD5 A;  2B7E A;  3CTA A;  5ED4 A;  2KJC A;  1T0F A;  1R22 A;  3I9V 2;  4RAF A;  4IO9 F;  2VC0 A;  2VON A;  3IH2 A;  1RKW A;  4M3F A;  1HKS A;  2ECC A;  4DQ2 A;  2HFH A;  2VE9 A;  3RPU D;  1PYV A;  3FDY A;  4NB5 A;  1MBK A;  1BR2 A;  2OQR A;  3CQZ J;  4C3I J;  4XLA A;  5JHU A;  1B1B A;  3ZQI A;  2WAF A;  2XV4 S;  4BEH A;  4F7Z A;  1VI0 A;  2K85 A;  5E3N A;  3LOC A;  3OL4 A;  4ZYG A;  3PUF A;  3HHG A;  1IN6 A;  4N0B A;  2G9W A;  4L9J A;  4L9V A;  3LFK A;  2VBZ A;  4JK1 X;  2ZB9 A;  1U0J A;  3BZK A;  1GT0 C;  4NC6 A;  3GX4 X;  2VT3 A;  4O5V A;  4CDG A;  1GXP A;  1EJ9 A;  2E5Z A;  2DA2 A;  4XK4 A;  1LE8 B;  2A6H F;  4ENJ A;  5DCM B;  4ZZL A;  1UST A;  4OAZ A;  5AON A;  2NOG A;  4I98 B;  2HNH A;  3HOS A;  3CCQ I;  2LH9 A;  4UHT A;  4HRI A;  1H0M A;  2E34 A;  4S04 A;  5IYB J;  2KFD A;  2WAQ A;  4FET A;  3DU5 A;  2EJR A;  2AQE A;  3GZ6 A;  2NXN B;  4I6Z A;  1JT0 A;  1ODD A;  2DA5 A;  2EK5 A;  2O7O A;  3BOQ A;  2EA2 A;  4D5C A;  2YX4 A;  4KA4 A;  1RES A;  4XRS G;  2KMU A;  3GFJ A;  4MO7 A;  2FF4 A;  3ONQ A;  3S93 A;  2DU9 A;  1S72 I;  2HTJ A;  1OCC H;  1LE8 A;  2VXD A;  2ZME C;  3BWG A;  3S1Q J;  1VQK I;  3PNY A;  3FKJ A;  5LHH A;  1ZH5 A;  2HQN A;  5LGU A;  1BR4 A;  5HOO A;  3FK7 A;  3PUB A;  3I56 I;  1HDD C;  2MAB A;  3PSI A;  3BJA A;  3K4B A;  2CRG A;  4LIV A;  2Q2E B;  3FIW A;  3RSN A;  4D5F A;  1JTY A;  3WE3 A;  1WJA A;  4P96 A;  2M8E A;  4G6Q A;  4ESB A;  5E18 F;  2FUG 2;  3S2H J;  3KET A;  4IRH A;  4PK4 A;  1IG7 A;  3MZH A;  1T98 A;  2DW4 A;  3FMQ A;  2R5Y B;  3IRQ A;  4MNU A;  2G7U A;  2EV5 A;  2BW3 A;  3Q0V A;  5J1U A;  1GVJ A;  2WC2 A;  2M5W A;  3H92 A;  2XKO A;  3GUD A;  4ZYE A;  5ERI A;  1YJN I;  3K10 A;  2LKS A;  4B44 A;  5K5Q A;  2GXB A;  2QEX I;  4EGY A;  1WI3 A;  1JKO C;  3C2H A;  2TRT A;  2HZD A;  4JOM A;  1A6I A;  2NNN A;  2JUC A;  5L3C A;  1YRN B;  2L01 A;  2EBI A;  3GTQ J;  3VYT B;  1QZZ A;  2FX0 A;  2EPF A;  3ZMD A;  3QU6 A;  3JRG A;  4UV8 A;  1WH5 A;  5ILU A;  2ID3 A;  1UCR A;  3SHF A;  2IA0 A;  2LNB A;  1IW7 F;  1KU2 A;  2YS9 A;  1ETY A;  3R0J A;  4AYB A;  5E3M A;  3EUA A;  3IKT A;  1HC8 A;  4Y3O A;  2DFI A;  3CCL I;  3GFM A;  2RVC A;  2KIQ A;  3PSF A;  2KZG A;  2G7H A;  3V7S A;  2BY1 A;  2P81 A;  3K70 C;  2BHY A;  2K9M A;  3KP7 A;  6PAX A;  4RGS A;  1XC5 A;  2MW8 A;  2NYX A;  4GGG A;  2PG4 A;  3HIF A;  4ZDL A;  1RPW A;  1W4M A;  3A4C A;  3CLO A;  4RB0 A;  3M7G A;  5L3B A;  3ECO A;  1HSJ A;  2ZJP F;  2P7C B;  4QPQ A;  5JR3 A;  5H20 A;  2YSR A;  5DV5 A;  3RQ4 A;  1WJE A;  1U8B A;  4EJO A;  2L9N A;  1ZR4 A;  1GV2 A;  1POG A;  3LSP A;  1W0T A;  4G7O F;  4XID A;  1GV5 A;  2PJR A;  1UJ8 A;  2WAE A;  4IEJ A;  3T8T A;  1FMV A;  3I64 A;  2F5E A;  3JTG A;  1DP7 P;  5FRM A;  2A69 F;  2KIU A;  3DP7 A;  4UUT A;  1U5T B;  3CP2 A;  3LQR A;  2E60 A;  4XSX F;  1F43 A;  1QZY A;  2WV0 A;  3C18 A;  1OYI A;  5ICF A;  4CYC A;  2MYS A;  2JRM A;  2DA7 A;  2LBF A;  2R5Z B;  4U7D A;  3ULQ B;  2XSD C;  1FX7 A;  4XRM A;  4A0Z A;  3LST A;  4PJN A;  4EV0 A;  3ZCO A;  3RPU A;  4OOI A;  1TP4 A;  1OYY A;  1UHM A;  4EAT A;  3GLL A;  2CUF A;  4XON A;  3ABM H;  2LRE A;  2D5V A;  2Y0S N;  4NDL A;  2P5V A;  3DF8 A;  1HDP A;  3N4M A;  4ZYD A;  2IP2 A;  2VC1 A;  4A93 J;  1A5J A;  1L3L A;  2HYJ A;  2X51 A;  2OJE D;  1I1G A;  2TDX A;  3SEZ A;  3ELK A;  2H8W A;  4L0Y B;  3PIP F;  4ZDP A;  2I10 A;  3H3Z A;  3ZMZ A;  3QAH A;  3KLO A;  3OIQ A;  4FQG A;  1WRJ A;  2VOP A;  3JW4 A;  1IDY A;  1QRY A;  2Y2Z A;  5F0H A;  1IUF A;  1OKR A;  1VQP I;  4FTH A;  1VQL I;  2K9Q A;  3AG1 H;  4BS9 A;  2C6Y A;  2XKP A;  2HDC A;  3DKW A;  4KFC A;  3HB9 A;  2CH0 A;  1REP C;  1U9O A;  3IUO A;  3V7C A;  4U7B A;  2JJ7 A;  3K1P A;  3IKV A;  4CSW A;  4I2O A;  4PGH A;  2WA0 A;  2X1D A;  3S32 A;  4E7Z A;  5K5O A;  2DFE A;  4CZZ A;  3EYI A;  2VQC A;  4M3G A;  1W5T A;  1G3S A;  2NS0 A;  1AA7 A;  3L2W A;  3EPZ A;  1VQ9 I;  2CQX A;  1W5S A;  3BR3 A;  4ITV A;  1XMX A;  5KAI C;  2CV0 A;  1OMI A;  2R7F A;  4B3A A;  1DPR A;  2IS6 A;  4I7H A;  2DA6 A;  2WAD A;  2VLA A;  3VOE A;  1SAN A;  2LSO A;  2GXA A;  1ETV A;  3F21 A;  2BVL A;  1D0X A;  5D8K B;  5CKT A;  3I0T A;  1O4X A;  1FSH A;  1YFH A;  1HA8 A;  1R5I D;  2XAQ A;  3TOA A;  2M30 A;  3A01 B;  4IOC F;  2QEN A;  3CDL A;  1P2F A;  2K9S A;  3TKY A;  3RIR A;  3J80 Z;  2V1D A;  2XGD A;  3RCO A;  2H1K A;  2BY3 A;  2M2E A;  1UEL B;  4R1H A;  1FP2 A;  4PCQ A;  5GPA A;  4IQJ A;  2VQG A;  4XQF A;  4G9Y A;  1DGR M;  5K7H A;  1DQU A;  3VOD A;  1TTY A;  1S7O A;  2DA4 A;  5JVT A;  1Z21 A;  3CCY A;  2MC3 A;  1T6S A;  3E97 A;  2FNA A;  3V4G A;  2FML A;  2NS8 A;  4CO8 A;  1MIJ A;  2Z9O A;  3TW6 A;  1P4A A;  4L5E A;  4P9U A;  2STT A;  4BHP A;  1ZYR F;  3SEQ A;  2XRO A;  4OU0 A;  4LD5 A;  3QPL A;  1K6Y A;  5GAH J;  2XIG A;  3OY9 A;  2HQA A;  2L9S A;  2V4J C;  5BOX A;  4MTE A;  2ELK A;  3AG2 H;  1TT5 B;  3MAJ A;  4PGG A;  3P9C A;  4FX4 A;  3ABL H;  3ZQ7 A;  3F23 A;  3FMR A;  4IXA A;  2XF7 A;  1B4A A;  5C44 J;  4DYR A;  3A03 A;  4LIU A;  1XGS A;  5H6Q A;  4X1E A;  1XPX A;  4HEA 2;  3EUH A;  1VQN I;  2OZ6 A;  5C4X J;  3J7Z I;  1WH7 A;  3F3X A;  2GA1 A;  2OD5 A;  3K2A A;  2A05 A;  3BG5 A;  2DN0 A;  1FYK A;  3Q0U A;  4PJJ A;  2ZXI A;  3CUQ B;  4Y15 A;  1IN8 A;  2E7X A;  1NHA A;  4RS8 A;  2R7Q A;  3BP8 A;  5CPR B;  1TL8 A;  3G3Z A;  1D0Y A;  1FNN A;  3AFH A;  1RUO A;  3FF5 A;  2LMD A;  5F0F A;  1IGN A;  2ZNZ A;  1J7K A;  2F48 A;  4BBR J;  1OCZ H;  3E3V A;  4GDF A;  2DLL A;  3N97 A;  5FLV A;  1P7J A;  1BW5 A;  4K2E A;  1WWX A;  1ON1 A;  4E7K A;  3J7A O;  3VPR A;  3LSK A;  2CO5 A;  1R4N B;  1TNT A;  1G59 A;  3WU1 B;  3T0Y A;  2B0L A;  3KP6 A;  4C30 A;  4RAY A;  1WKM A;  1WHU A;  3HTU A;  1S9H A;  1TQM A;  3FBI B;  4UVC A;  3OOP A;  4IRI A;  4RLF A;  2MLG A;  1ZQ3 P;  5EYR A;  1H89 C;  3M9A A;  1Z1D A;  3IL2 A;  1LVK A;  4XIC A;  3HKZ N;  3OYC A;  2QKM B;  1UHW A;  2HI3 A;  2OC6 A;  3HEF A;  3GTJ J;  1AKH A;  2RRE A;  3HM5 A;  2IS2 A;  1R1T A;  3BR5 A;  3I5U A;  3V8J A;  3EUH C;  1J9I A;  1FWZ A;  3P9K A;  4XKW A;  4AID A;  4B4C A;  2CJJ A;  2DYS H;  1PUF A;  1FY7 A;  4Z2Y A;  2PJP A;  2RKH A;  3V42 A;  1NTC A;  5M5Y J;  2ZC2 A;  1R1V A;  4I0B A;  1Z3Y A;  3S15 J;  2L54 A;  2ZXH A;  4A69 C;  1FOK A;  2FOW A;  4I99 C;  1YRN A;  1GLN A;  4ENK A;  3HRS A;  1U8R A;  5FKN A;  4MHG A;  2L2O A;  3ASO H;  1S6L A;  1MMG A;  4PUS A;  1I1S A;  1TNS A;  1TW2 A;  2QZ8 A;  5ILV A;  1G2H A;  2DA3 A;  2LTP A;  3ML6 A;  2W82 A;  1TWC J;  1JTX A;  3JTH A;  2A6E F;  3DEU A;  3DLA A;  3EET A;  1IXS B;  1N77 A;  3WU0 A;  3MKZ A;  1DPU A;  1XTA A;  3TP0 A;  1F36 A;  3BQZ A;  3S1R J;  3IH3 A;  1AKH B;  5IT3 A;  2R5Y A;  4S05 A;  2KJB A;  4IPA A;  1TQI A;  3RPQ A;  3WOD F;  1KQ0 A;  4O6J A;  4HLY A;  5BNG A;  2BY2 A;  5CYV A;  2DA1 A;  2P8T A;  4PJ0 C;  2GOX B;  3I4N J;  3B6A A;  3TGN A;  4G7H F;  2FQ4 A;  2UXN A;  4WF2 A;  1G3T A;  2NVU B;  4HG2 A;  1FOY A;  4LG0 A;  2BYV E;  4Q47 A;  2D1V A;  2IA2 A;  1VF9 A;  4UV9 A;  1RRJ A;  2NNY A;  5EEA A;  4AIJ A;  4EM1 A;  3S17 J;  4XKB A;  1RR7 A;  3K4C A;  4YEL A;  4LG3 A;  4YFN F;  1MZB A;  2ICW G;  3OSF A;  1VZ0 A;  2JA7 J;  4CCJ A;  1H9T A;  2KIF A;  3HG9 A;  1QHG A;  4DBQ A;  1ACI A;  2HOA A;  3BRO A;  4RB2 C;  3BJO A;  3CUO A;  1CQT A;  3IWF A;  5HDG A;  3AL0 C;  3E5Q A;  4I01 A;  2K7L A;  3M1C A;  2DJI A;  3HC7 A;  4IVN A;  3SZG A;  4Y52 J;  4OIP F;  2VXZ A;  4DYC A;  3TL4 X;  3OYD A;  2ZJQ F;  4W97 A;  3HSF A;  1D8K A;  4XOR A;  3WE2 A;  3OYH A;  2V7F A;  2XRN A;  5DCM A;  3ZP5 A;  4E4H A;  1KA8 A;  2GIV A;  1IJW C;  3EDP A;  2YR2 A;  4DJA A;  3WTU C;  3SFI A;  4A3J J;  2ZXW H;  3BR0 A;  3DQV C;  1FT9 A;  5D5V B;  1JUM A;  3QP5 A;  2J5P A;  5BS6 A;  1HW5 A;  3KP5 A;  2RNJ A;  4B3X A;  4HF1 A;  3HUG A;  3FXQ A;  3QP6 A;  4HLX A;  1Z0X A;  2FE3 A;  3WG9 A;  3F8C A;  4EEF G;  2E2I J;  5L3G A;  1GXQ A;  1IRG A;  1R6R A;  3ZMS A;  5LGT A;  1K6O A;  2EQR A;  1HCR A;  4QSH A;  5B1B H;  2MGQ A;  2AS5 F;  1P6R A;  4DZJ A;  3WGI A;  4DZP A;  1VTN C;  3BG6 A;  3CLQ A;  3ZQL A;  2JA2 A;  2HVS A;  4ZDO A;  4XRS A;  2HZT A;  1BBY A;  2MSY A;  1BC8 C;  3E0J B;  2NVY J;  1E3P A;  4BAC A;  2H1L A;  1S7A A;  4GYI A;  4XKV A;  3AG4 H;  3PIO F;  3LA3 A;  4XBF A;  3ZXS A;  5JHF A;  4EJU A;  3F72 A;  4ZYH A;  2Q0O A;  4MIM A;  1A35 A;  2HQR A;  3OS0 A;  4P1W A;  2FBH A;  2CMP A;  5GTH C;  1SVL A;  2EB7 A;  4UUS A;  4AC0 A;  3BR2 A;  5JLX A;  1TZL A;  5B66 C;  2FBK A;  2OA4 A;  1VQ4 I;  2GIZ A;  4CA0 A;  1LKX A;  2EZI A;  4F91 B;  1MJA A;  2L7M P;  3CO6 C;  1CF7 B;  2EV6 A;  1LFB A;  3W2A A;  1KGS A;  4IHW A;  4LMY A;  2HR3 A;  3OYF A;  1JKP C;  1IF1 A;  2JMW A;  3SDB A;  3B73 A;  2N8G A;  3E5X A;  3RJP A;  3H1C A;  4BGD A;  4R79 A;  5B5E C;  3OYN A;  2HKO A;  2W24 A;  2JA6 J;  4BYY A;  4RDU A;  2Y75 A;  4KIF A;  3HOX J;  4M6X A;  1LQ1 A;  1LEA A;  1UFM A;  1X1P A;  3PFI A;  4NQW B;  2HYF A;  5TJJ A;  4BY1 J;  2OU2 A;  1UG0 A;  5KK1 A;  5LFA A;  1WCM J;  1D8J A;  2DMP A;  1EH7 A;  1PP7 U;  3CUQ C;  4M72 A;  1AOY A;  3K6G A;  4Y7N J;  3NEU A;  4MQV A;  4ENN A;  4UVA A;  2PBI A;  3A2K A;  1V5G A;  1FYL A;  2XGC A;  3UR3 C;  1AU7 A;  3AL0 B;  3OS2 A;  2GM4 A;  3AG3 H;  2R92 J;  2B63 J;  5ICE A;  4ASN A;  1Q1V A;  2HDW A;  1SMY F;  5EZG A;  3OS1 A;  1MDM B;  2I8D A;  1V4R A;  1KZH A;  5HDK A;  2LR8 A;  5LLQ A;  4DIQ A;  4L0Z B;  4G6D A;  1NG7 A;  2IGN A;  2JVH A;  2XAF A;  4M73 A;  1R23 A;  5F6F A;  5KAF C;  1MBH A;  3KYD B;  4L9T A;  3U1K A;  3PNV A;  3MZ8 A;  2Y0M A;  1WGX A;  3PM1 A;  3ZPL A;  1R9T J;  1SD4 A;  3O6B B;  3SDG A;  2D1H A;  4C3H J;  4FX0 A;  4OWR B;  5M5W J;  2X85 A;  4C9Y A;  3HPG A;  1MH4 A;  5E3O A;  4HV5 A;  4YRV A;  2R7O A;  3TO9 A;  3BZC A;  4OIR F;  2LOO A;  3GYH X;  5HNF A;  2AXT C;  3RQI A;  3BG9 A;  3BTC A;  4MFD A;  4UUS B;  3DEW A;  1XSV A;  5LBQ A;  3PL8 A;  1YW7 A;  1Y0U A;  5F64 A;  1UG2 A;  1UZC A;  1E3O C;  1OR7 A;  3LSI A;  2RAE A;  1HXD A;  1LDK B;  2MBF A;  1WJB A;  3L00 A;  4BNC A;  1KQ8 A;  5GPC A;  2ME6 A;  5TGT A;  3ZRG A;  4KMU X;  3VWB A;  4ABZ A;  1U5T A;  3G6E I;  2DK5 A;  3F0C A;  4IOA F;  2VAS A;  4BAY A;  2ZJR F;  5LEJ A;  1DU6 A;  2R93 J;  1MKM A;  2IEK A;  4D0P A;  3JRB A;  3TBI A;  1YS6 A;  1KQ9 A;  2MLK A;  1IC8 A;  2RDP A;  3F8N A;  2E7W A;  4X0G A;  3QOP A;  5E79 C;  3Q9V A;  2COB A;  5LRR A;  1I5Z A;  3C7J A;  2Z3Y A;  3HKZ A;  4YIR X;  1ZRF A;  4KN7 X;  1MBG A;  3H9Q A;  4JP0 A;  4KIG A;  3RKX A;  5DTD A;  1Z9C A;  2VN2 A;  1NH3 A;  2DMT A;  2A5Y B;  1MJ9 A;  3IH4 A;  3WHB A;  2X1C A;  3VSL A;  1W36 C;  1I6X A;  2DOF A;  2M9H A;  2NS7 A;  1XGN A;  4CIC A;  2CGP A;  1SAU A;  2IJL A;  2QQ8 A;  1BW6 A;  2VJ4 A;  1JGS A;  1SFX A;  5KCM A;  1HKQ A;  2W7N A;  4PDK A;  1ETW A;  3P7N A;  1J59 A;  1VQ7 I;  1BA5 A;  1D5V A;  5IOZ A;  2FBI A;  3DPT A;  1IRF A;  3L2Q A;  2EFW A;  5FGM A;  2R7Z J;  1T56 A;  5LRS A;  2R7V A;  3GZ5 A;  5FKM A;  4IZZ A;  5J40 A;  4A12 A;  2ZO4 A;  3MMY B;  3CMA I;  4BE1 A;  1H9G A;  1YE9 A;  1ZG1 A;  4EVI A;  4CCM A;  4XM3 A;  1ZLK A;  4NUB A;  1BIB A;  2FU4 A;  2VKE A;  2XB5 A;  2XDV A;  4EM0 B;  4HST A;  3ROU A;  3WTX C;  1P92 A;  3ABT A;  3EQL F;  5BPI A;  1FYM A;  3K70 D;  3W6V A;  3Q3S A;  2F4M B;  2VT2 A;  4FCY A;  3U21 A;  3NWT A;  3OYM A;  5EEH A;  3GW2 A;  2EIJ H;  1ON2 A;  4A3G J;  2ESH A;  1O7L A;  4CCK A;  4XN0 A;  5DD8 A;  3H5R A;  4FAS D;  5EDN A;  5EGO A;  2QQ9 A;  1ZGW A;  2JPB A;  3CJQ B;  4XLH A;  4IX7 A;  2XAG A;  1ORK A;  5J6X A;  2LF7 A;  1D1A A;  2ME0 A;  2RGV A;  1SD7 A;  1WJC A;  2MD0 A;  2K86 A;  4A3I J;  2DTZ A;  2I5U A;  2K27 A;  4E7J A;  1K83 J;  4MGR A;  2QVO A;  3COA C;  1SVM A;  2L0K A;  3M8E A;  2XGE A;  2IGK A;  3G1O A;  1K7A A;  4RA2 A;  3W2V A;  2KDO A;  5H6R A;  3MKW B;  3MQ0 A;  3IAM 2;  4IJA A;  3M07 A;  1W5C C;  1RKT A;  1IN7 A;  2WB1 A;  1XCB A;  2AO9 A;  2GQQ A;  1R4M B;  1IN4 A;  3BT9 A;  1BI3 A;  5F08 A;  5FD5 A;  2V6E A;  1R36 A;  2A61 A;  3ISP A;  3P9I A;  1MSE C;  1JT6 A;  2BVM A;  4G94 A;  1BC7 C;  1VQO I;  3DWL E;  5EEG A;  3RKW A;  2STW A;  1P7I A;  1WJF A;  3HOW J;  3LSH A;  2UXX A;  4L9N A;  2IRF G;  3CCJ I;  3LFU A;  3L9F A;  4HW0 A;  1APL C;  4A5N A;  3CMM A;  2LG4 A;  3MZY A;  1O3Q A;  2ADU A;  2FXA A;  4ON0 A;  1W7P A;  2J5O A;  2Q1Z B;  4BL0 B;  1OCP A;  1IRZ A;  1N25 A;  5J8F A;  1CGP A;  4PZJ A;  4I0A A;  1QZE A;  3L7W A;  3M3Y J;  4P5O A;  3O8H A;  1OQY A;  3D5S C;  1O3S A;  5M3F J;  2IA1 A;  2CW8 A;  4N9I A;  5IPA A;  1SFK A;  4F52 A;  2KRF A;  2L5Q A;  1E2X A;  3BG3 A;  4CCN A;  3REO A;  5DCF A;  2FOK A;  2NVX J;  1A31 A;  2EFP A;  5DUK A;  4HAM A;  5IT9 Z;  2JPC A;  3OYB A;  1OR7 C;  4YII A;  4BQA A;  2F4O B;  5JI6 A;  1RZ4 A;  2CQN A;  3B02 A;  2A3S A;  1K79 A;  3GCM A;  4BU2 A;  2V9P A;  2M3A A;  3K4M A;  5CVU A;  3S2W A;  3SZT A;  3LSG A;  4DOZ A;  1S5L C;  3U9G A;  4EM2 A;  4F3Q A;  2O8K A;  4NHJ A;  1FEX A;  4XLC A;  3KFW X;  1XGO A;  4DBR A;  1TBX A;  4DGW B;  4U88 A;  4AUX A;  2R4G A;  1PJR A;  4Y13 A;  3RKQ A;  3KEO A;  4HQM A;  4EJT A;  2XC7 A;  4XNF A;  3HYI A;  1U6G A;  2R7R A;  2PLY A;  1I3Q J;  3SJM A;  3E1S A;  1ZRC A;  2HVR A;  4A6E A;  4F92 B;  1SVO A;  4BQQ A;  1XS9 A;  3LSR A;  1ETK A;  1KU7 A;  4WX9 A;  3GME A;  3B6C A;  1ZG5 A;  2FMY A;  3QYE A;  3J81 K;  2QCO A;  3I54 A;  3RZD J;  4BJ5 C;  3E6C C;  4MLO A;  2ZKZ A;  1S3J A;  3FXJ A;  2KIM A;  3KZY A;  3NAU A;  1U78 A;  2Y31 A;  3EYY A;  2OAZ A;  2M34 A;  2P4W A;  3QU3 A;  5DYM A;  2X6O A;  1T33 A;  1ONV A;  3KZZ A;  1UB9 A;  2CG4 A;  1QVT A;  3DBR B;  3ZQF A;  3BR6 A;  3D0S A;  3GXO A;  3CCU I;  2LK2 A;  1K4S A;  5J3L A;  4HNT A;  3HGY A;  2ZFU A;  3TP3 A;  3LAP A;  5K7Z A;  1ZGJ A;  3FXL A;  2XGX A;  3BTJ A;  2ID6 A;  5IYC J;  1FTZ A;  2L7Z A;  3ESW B;  1J2X A;  3HRM A;  2WWY A;  3CCE I;  2WV1 A;  2F2E A;  4OMY A;  5DD4 A;  5FD6 A;  4M6V A;  3WTV C;  1JJ6 C;  3FK6 A;  3ERM A;  2COM A;  3ZQG A;  3OYJ A;  1PVE A;  1SC7 A;  1T2K A;  2OF7 A;  4KIT B;  2VJJ A;  4JX6 A;  2DXI A;  1GVD A;  2UV1 A;  3HXL A;  5KNL A;  4WXD A;  2R7W A;  1R00 A;  2VKH A;  1VND A;  1SAX A;  4N9H A;  1P9Q C;  4WXH A;  5L3E A;  1MJB A;  2DFH A;  2RV8 A;  1FSE A;  1Z77 A;  2DQL A;  5D6F A;  4PSX A;  3AKZ A;  1LB2 A;  5FFZ A;  2E71 A;  1FTT A;  5CVI A;  2EZK A;  2MH9 A;  1LDD A;  2LFB A;  3WU2 C;  1R1U A;  4UVB A;  1HW2 A;  4OMZ A;  3S8P A;  2B9S A;  5GTI C;  4ZYA A;  2L4M A;  3CC2 I;  2W1O A;  4FE7 A;  1BI1 A;  1QO0 D;  2OTL I;  2O03 A;  2GOM A;  2DOA A;  4HV6 A;  5TRD A;  4AVP A;  1VQ8 I;  3CCM I;  1J75 A;  4V2G A;  3ZMT A;  4PJM A;  2ZFW A;  2R5Z A;  1BN5 A;  1V54 H;  1SFO J;  4XL9 A;  3FXR A;  2R7X A;  2IGM A;  5HNH A;  4G7Z F;  1IAW A;  2W25 A;  2E1N A;  5FKL A;  3UNG C;  4BHB A;  4BXF A;  2E2H J;  2YU9 J;  2CWE A;  1ETQ A;  3QRF F;  3E6B A;  2L7K A;  1O3T A;  2F6C A;  5KVR A;  1XG1 A;  3JRF A;  2PJR B;  1SD6 A;  2X48 A;  2BXZ A;  4M6Y A;  3VYR B;  2FJ1 A;  1G3Y A;  4HF0 A;  2HS5 A;  1AWC A;  3OR1 C;  2KQR A;  3PNT A;  1K4T A;  3WGG A;  2M1B A;  1OCR H;  5B1A H;  2UZK A;  2EFN A;  2RNG A;  5BMZ A;  1BM9 A;  3PO3 J;  3LWF A;  3HJE A;  2PX9 A;  2HVQ A;  3GFL A;  4WCG A;  3IHU A;  4KT6 A;  3UKG A;  1TQP A;  3BY6 A;  2MD5 A;  3TED A;  3QYF A;  4EQQ A;  1XDS A;  2XHK A;  3SYT A;  2VBW A;  2Q8K A;  4B09 A;  3ZQC A;  3OSG A;  3DBH B;  3JSO A;  4PJL A;  5CVR A;  4A3D J;  2Z33 A;  1R71 A;  2W84 A;  1EKE A;  1MMD A;  2L9R A;  2O5R A;  3QPS A;  2OUM A;  1ETX A;  3WTZ A;  2EWN A;  4IHY A;  2O61 A;  2HYG D;  2LY9 A;  1I6H J;  1XN7 A;  2EIK H;  5FRO A;  2V1U A;  2NOJ B;  2M4K A;  3LMM A;  4XLE A;  3DEE A;  3BDD A;  4CUG A;  1W7P B;  1ZKG A;  2WBM A;  1JUP A;  2W48 A;  1W0U A;  1WZ2 A;  1Z91 A;  1T8I A;  4E7H A;  1PDN C;  3DTI A;  2EZL A;  1O57 A;  4BDY A;  1PUF B;  3JRE A;  1LPQ A;  1V5E A;  2WAQ N;  1JXS A;  1KYZ A;  1S29 A;  3OOU A;  3FIS A;  3I4M J;  2BW3 B;  4AIK A;  3KLN A;  3DCF A;  2ZCW A;  4Y4R A;  2DT5 A;  1X1A A;  3JRA A;  2K5C A;  4FHT A;  5K5R A;  2Z2S B;  4FE4 A;  3VYS B;  3H5N A;  1BJZ A;  4OIO F;  3BCB A;  1WJD A;  4ZTF A;  2KRC A;  2HOT A;  2QUF A;  2KKO A;  5FLM J;  3VSK A;  1MSF C;  5F1R A;  5IP7 J;  1HBX G;  2JT1 A;  2VPL A;  3W2W A;  2RQQ A;  9ANT A;  3NQO A;  2VBY A;  3W6K B;  2L9V A;  5JVG F;  3I3L A;  5J1R A;  3HZJ A;  3M8F A;  2CSO A;  2WB1 N;  3X2Q H;  5LHI A;  4I76 A;  1DGW Y;  1Y56 A;  1ZN2 A;  1IV8 A;  1Y6I A;  1IO2 A;  1X4P A;  2Y30 A;  4KIS A;  5IYD J;  2HXI A;  2DCE A;  4LLL A;  1FOX A;  3F22 A;  4LLN A;  4L5J A;  1D0Z A;  2EFO A;  1T0F C;  3MFK A;  1YW8 A;  3MKY B;  1Z3X A;  2XSJ C;  1J0R A;  4IHS A;  4IRG A;  4KN4 X;  4XOT A;  2M7A A;  2GXG A;  4B48 A;  5FB2 A;  2E1O A;  1YLF A;  2E1M B;  3L09 A;  1YS7 A;  3G1L A;  4A0Y A;  3FWE A;  3DV8 A;  3J7Y J;  5J4V A;  3C2G A;  5FRN A;  2FSW A;  2W00 A;  2IPQ X;  1YJW I;  5LD2 C;  2XB0 X;  3LA7 A;  3VB2 A;  3LL7 A;  3I58 A;  5E1Z B;  4U0V A;  2H27 A;  1XD7 A;  3CP8 A;  4MFE A;  5IOY A;  1HF0 A;  3GBG A;  5EF6 A;  4ESF A;  5C4J J;  3HL2 A;  2VOD A;  3N05 A;  1ETO A;  5HS7 A;  2PMU A;  4C2T A;  2M87 A;  4P9F A;  1YIJ I;  5ILS A;  1D3Y A;  2IS1 A;  1ZHF A;  1BI2 A;  2HPM A;  1S7E A;  1IRX A;  1LJ9 A;  2DDB A;  2IVM A;  3F8M A;  1KU3 A;  2DBB A;  2R7D A;  4CGZ A;  4RB1 A;  4EJV A;  3K4J A;  5B3S H;  3FHN A;  1BOB A;  1P4W A;  2JRT A;  2ZBK A;  3QPH A;  4ENM A;  2QSH X;  4A3B J;  3BPV A;  4GCV A;  4GFB A;  2QGU A;  2IXS A;  3MWM A;  2XAJ A;  2BHZ A;  1TWF J;  3KYL A;  3FM5 A;  2R3S A;  3OYK A;  5BPD A;  2KRH A;  3G2B A;  2HQ5 A;  3OIP A;  3GTL J;  4PFP A;  5CQG A;  2P6T A;  3F9K A;  5E8G A;  3DFG A;  2BE5 F;  2K4J A;  5JFR A;  5EG0 B;  3A01 A;  1FIA A;  3SQN A;  2VL8 A;  1XDU A;  3PQJ A;  1XX5 A;  2DI3 A;  4N4O B;  1HOM A;  1EH8 A;  1YJ9 I;  2XVC A;  4XLF A;  1SEU A;  3WGH A;  1VQ5 I;  4JBA A;  4ZC3 A;  2QF7 A;  1YQA A;  4JYK A;  3R6S A;  2IGO A;  2P5K A;  4E6K G;  4AWX B;  4B1R A;  1DDN A;  4ZJZ A;  4HX8 A;  1LUJ B;  3TQN A;  1BL0 A;  1TWA J;  1YIT I;  1YYV A;  3G73 A;  4BE2 A;  2DYR H;  2LP0 A;  3CC7 I;  2W57 A;  2LD5 A;  1N78 A;  2OCE A;  3MCZ A;  3QYB A;  2LY1 A;  3KE2 A;  4E70 A;  2JN6 A;  2JK3 A;  1E0E A;  1BIA A;  3S1M J;  1FIP A;  2JA8 J;  1MBJ A;  5F27 A;  2MH2 A;  1KU9 A;  2VKV A;  3S2D J;  3F8F A;  5D5X B;  2O6G E;  5EG0 A;  2KP6 A;  2CUZ A;  1XGM A;  2M0C A;  3NAR A;  2DFF A;  3I4P A;  2W85 A;  2EV0 A;  1VQ6 I;  2X1E A;  2YUS A;  4P55 A;  5DDG A;  2PN6 A;  1BOA A;  4RMN A;  1VFC A;  3TDU C;  1X58 A;  1Y1V J;  2YX7 A;  2CW0 F;  3I53 A;  1IZ1 A;  3CMY A;  1B59 A;  3DTK A;  1H8A C;  1WQ2 A;  1JKR C;  1LVA A;  2FRH A;  1HST A;  3S1N J;  5HS8 A;  3IC7 A;  3LSJ A;  2KLO A;  3HTS B;  5IP9 J;  4ZTJ A;  1MMA A;  2X4H A;  1H88 C;  1IDZ A;  3GLX A;  4A3F J;  4LK0 F;  3JRC A;  3E6D A;  4F55 A;  2JZY A;  5HS9 A;  3HSR A;  2CV2 A;  2BXY A;  2BGC A;  1UMQ A;  3RDI A;  1DU0 A;  1ZR2 A;  5HDN A;  4BBS J;  1Y8Q B;  1JUS A;  1Y0N A;  4LLG F;  2DAO A;  3SFZ A;  4HYE A;  3GF2 A;  2E5N A;  1IUY A;  2K02 A;  5F1J A;  3CJN A;  3BG7 A;  4HDU A;  2DPU A;  2A6T A;  4II3 A;  3TO6 A;  4M3E A;  3CO7 C;  3TOB A;  4AVZ A;  1ZG3 A;  2V79 A;  3PFY A;  4MTD A;  2QSG X;  3M1E A;  3HOU J;  5LEK A;  3KPH A;  3U2R A;  1B8I B;  3BCA A;  2EH3 A;  4XOP A;  1G8X A;  1W1W E;  1MH3 A;  5HLG A;  3WTS C;  4IHV A;  5IT9 K;  3T1B A;  1FC3 A;  3H3U A;  4LGW A;  4YFK F;  1RUN A;  1OYW A;  4AU7 A;  1X3U A;  3EUK L;  4RGX A;  4QTR A;  2M4G A;  2RQP A;  1TLH B;  2ZSH B;  2X6Y A;  4M74 A;  4KT5 C;  4HZF A;  5FLX Z;  3WTT C;  2XPU A;  5JLW A;  3IV5 A;  3GTM J;  2EIN H;  5E17 F;  3FXO A;  1E17 A;  3FBN B;  3RTR A;  1I27 A;  1UHS A;  5HOD A;  2JTV A;  2M45 A;  5E3L A;  3DLL F;  3SZP A;  4RM3 A;  3A1Y A;  5AIP A;  3U1D A;  1T95 A;  2LDU A;  2VIX A;  2HDD A;  3I55 I;  4YIF A;  4FT8 A;  5HLI A;  1X1D A;  4A5M A;  5LHG A;  3RI4 A;  2E2J J;  1FBU A;  3SXY A;  5K1Y A;  2ACJ A;  1I39 A;  2O8X A;  3ECH A;  2PEX A;  5H2F C;  4C3J J;  4LOC A;  3BLY A;  4E7I A;  3RZO J;  5A2Q K;  5D5W B;  4G12 A;  4J19 A;  3KEY A;  2OCC H;  4MEY F;  3MN2 A;  5CQE A;  2CW7 A;  5IP6 A;  3Q9S A;  2HPI A;  2A07 F;  1ZK8 A;  5J47 A;  3J7A Y;  4O3M A;  4RGU A;  2VJ5 A;  5C3E J;  3VFZ A;  1FLI A;  2P6S A;  1M1E B;  2ESN A;  5J4Y A;  3HRT A;  4RAG A;  2KDZ A;  2K4B A;  3WHC A;  3OYI A;  4UB8 C;  1OPC A;  1U3E M;  3QOE A;  1GDT A;  4M3D A;  1R49 A;  5CVV A;  1BR1 A;  1FPQ A;  5HVQ C;  4D1Q A;  2ISZ A;  2CQQ A;  2AXL A;  1QGP A;  2H6C A;  2QSF X;  1Y39 A;  3FMS A;  3V8K A;  4IHT A;  1LFP A;  2LKP A;  4RB3 C;  4MEX F;  2JVG A;  2K3P A;  1YOV B;  1ZRD A;  4W1U A;  5L3F A;  1OCT C;  2AQF A;  5L3D A;  5DUI A;  1ZAO A;  2XRL A;  3FKI J;  2CUE A;  1X3W B;  2DOD A;  4OIN F;  4CCO A;  1F9N A;  4R8H A;  2LY2 A;  4BJT A;  1RIO H;  4C2U A;  3K9T A;  1YIO A;  4HF2 A;  4A3E J;  4RBO A;  4X6A J;  3BJ6 A;  3H35 A;  4YFX F;  2V9K A;  3MEX A;  3L2C A;  1X1B A;  4B8X A;  1FBS A;  2Z16 A;  3K1N A;  3LSM A;  1Q1H A;  4M9X A;  3BTI A;  2GAU A;  2X6W A;  2XAH A;  3HOZ J;  2F5F A;  3PQK A;  3JAM Z;  2X0L A;  2K40 A;  5GAG J;  1BI0 A;  2XAU A;  2P5L C;  2E19 A;  1LNW A;  2Y69 H;  3GEZ A;  2GWR A;  4RM2 A;  1JGG A;  3GTO J;  1TT0 A;  3DU6 A;  5GAD J;  1B8I A;  2NRA C;  1OFC X;  2BEO A;  4I02 A;  4GRI A;  1T39 A;  2TCT A;  1WSU A;  2QWW A;  1STZ A;  1MBE A;  3M4O J;  1X4O A;  1ZLJ A;  1B9M A;  1LEB A;  2K9L A;  2JSC A;  5M5X J;  4L5I A;  4HOB A;  5D5U B;  5DEQ A;  1XMK A;  2MFZ A;  3OWT A;  3GFI A;  2JWT A;  3V8L A;  4HNV A;  2D2W A;  3C1D A;  4BXX J;  4RLQ A;  4KIB A;  3A0H C;  1IN5 A;  3CF2 A;  1WVR A;  3CME I;  2WTE A;  2RC4 A;  3R60 A;  4II2 A;  2QBY A;  1P4X A;  3ZOB A;  4OAY A;  3T5X A;  3D1N I;  2JA5 J;  3FZV A;  2Z99 A;  3OR2 C;  4KDP A;  2EIL H;  4JX4 A;  1FBQ A;  2E36 A;  5CJ9 A;  2QA4 I;  3HHH A;  1XMA A;  5F04 A;  2LLK A;  3TW7 A;  4GYG A;  5IY5 H;  3L1P A;  2CYY A;  2VE8 A;  3ZN0 A;  1HKT A;  3H36 A;  4CYD A;  4JX5 A;  2G0E A;  1V3F A;  4V2F A;  2HOE A;  1YX3 A;  4N4N B;  4XR6 A;  2O3F A;  4NC8 A;  1V55 H;  2GA2 A;  4MQ9 F;  2PFB A;  5TIS C;  4XN3 A;  1MNM C;  2JQ7 A;  3GTK J;  3S3O A;  2DPD A;  2H94 A;  3HDD A;  1TWH J;  4AYB N;  4UNO A;  1ENH A;  2V1N A;  1X2M A;  4GXO A;  3IWZ A;  1QBJ A;  2HTS A;  3KYC B;  3DPU A;  2IW5 A;  3ABK H;  2R0Q C;  4IF4 A;  1A36 A;  1FMW A;  2NAZ A;  2ZME B;  3ZR8 X;  2KT0 A;  4PFO A;  1IXR C;  3D5R C;  3RKY A;  4HDV A;  4CCL A;  3GZN B;  5D4S A;  2LVS A;  4IQ4 A;  3K4L A;  4J01 A;  1GHC A;  3HUG B;  4GO1 A;  2QYO A;  4C2M J;  1A04 A;  2GBY A;  2X6X A;  3BR1 A;  1OJL A;  1MGT A;  5EJC A;  3K1M A;  2KPM A;  3O8G A;  2F4I A;  3FHZ A;  3A02 A;  1BJA A;  2OV7 A;  4WWC A;  3QWL A;  3NWS A;  2LC2 A;  2RN7 A;  1U2W A;  3CD6 I;  3VEP A;  4H0E A;  3G1M A;  3H3V K;  3F8B A;  1QA6 A;  1R58 A;  1NK3 P;  2LBF B;  2CU7 A;  5FJ8 J;  3OMY A;  5ICG A;  4CYC B;  4M9Z A;  4YEJ A;  2VOO A;  1YTY A;  2L4A A;  2QM3 A;  1O3R A;  3GTP J;  2FD5 A;  1C0W A;  1WFX A;  3W3C A;  3BTL A;  1MBF A;  3RYR A;  1B72 A;  4KNY A;  1MW7 A;  3CC4 I;  3IAS 2;  3C2B A;  2DK8 A;  2OQG A;  2FEZ A;  2XPW A;  5FKK A;  3R0A A;  3OYG A;  4BDZ A;  4LG0 B;  2P7V B;  1W7P D;  5CVJ A;  2LRD A;  2MC4 A;  1GUU A;  3S14 J;  2Y0S A;  3CCV I;  3OIO A;  2M7B A;  5FKO A;  2MG4 A;  4LK1 F;  3H0D A;  3J81 Z;  1F4K A;  4EJW A;  2K3F A;  2ZME A;  3VDX A;  2L02 A;  4HX4 A;  4LJZ F;  4G8X A;  4J00 A;  2V6C A;  3OYA A;  5J1Y A;  5HLH A;  1V5F A;  3G71 I;  1YW9 A;  3HRU A;  3GO5 A;  4DNC A;  5FLX K;  5M3M J;  1JHF A;  3TMO A;  5HLT A;  1HQC A;  3CCS I;  2KL4 A;  4L18 B;  3H9G A;  2OZU A;  1Z6T A;  5E20 A;  2F5D A;  1USS A;  1G4D A;  2P0W A;  3AAF A;  1TWG J;  4HBL A;  2IS4 A;  3Q5F A;  2PMZ N;  4D7N A;  4ESJ A;  3DXJ F;  2H8R A;  2EA4 A;  2DT6 A;  3BQY A;  1G6N A;  2XF5 A;  2V1X A;  2BY0 A;  2K9N A;  1FP1 D;  2Y48 A;  4LIT A;  4XSZ F;  2CS3 A;  1W36 D;  1B9N A;  2E1C A;  2L3D A;  3T8R A;  1RNL A;  3ZN1 A;  1XB4 A;  2DOE A;  4B47 A;  3R61 A;  3QQA A;  4CZC A;  3CES A;  4M3B A;  2GLO A;  1K78 A;  2QBY B;  3PJR A;  5J8C A;  2NVQ J;  1F1Z A;  3LQQ A;  3CJR B;  3A0B C;  1Y1W J;  4PSW A;  1D1C A;  3JRH A;  3E5U A;  2WY8 Q;  4BE0 A;  3O3K A;  5FO5 A;  1WI9 A;  2HGC A;  1TC3 C;  2PMH A;  5D6E A;  1QPI A;  1A6Q A;  3MVP A;  2NVT J;  1JHH A;  4Y17 A;  4IHX A;  4Q48 A;  2HKX A;  1HLV A;  5DS9 A;  3ZMU A;  2PQ8 A;  3OYL A;  3HSE A;  1IV6 A;  3K69 A;  4KMF A;  4HA8 A;  4S0H B;  3MKL A;  5EZH A;  4LB6 B;  5BQT A;  4DYQ A;  2OTJ I;  2F5V A;  3LA2 A;  4BJ6 C;  2KZV A;  1YHQ I;  2HWV A;  2FNP A;  2V9V A;  2DJN A;  3HOT A;  4CXF A;  2GZW A;  3QOD A;  1WJ5 A;  3JCU C;  4BHC A;  2QQB A;  2X9D A;  4LFU A;  4Z6Y A;  3G4S I;  2VBX A;  2DQR A;  3CDH A;  3RYP A;  3S3M A;  3DBL B;  1L0O C;  2E1M C;  4H4K C;  5EGO B;  3R4K A;  2ETH A;  4U0Y A;  3KEQ A;  3F6V A;  2CFX A;  3KP2 A;  1SFE A;  4BKX A;  3CDI A;  2H6B A;  1Y8R B;  3K2Z A;  1KON A;  4NC7 A;  2CQK A;  3H9J A;  2AHQ A;  4CHU A;  4BUP A;  5GP9 A;  1MMS A;  3CJT B;  4XMY A;  3H5A A;  2WY7 Q;  1ITY A;  4BEH B;  2OPT A;  4QIW N;  5K7F A;  3FM3 A;  1Z7L A;  2HU9 A;  1ZRE A;  3O2P E;  3ZGK A;  1R5G A;  2KHM A;  5ICC A;  3GVA A;  4BQO A;  1U9N A;  3HPH A;  5KHD A;  4UUV A;  2HOS A;  3MD2 A;  1EH6 A;  4LB5 A;  2R7T A;  4NBQ A;  1FOW A;  3ZQH A;  4RGR A;  3JR9 A;  2Z5U A;  2ZXJ A;  3FXK A;  4ANJ A;  3J80 K;  2QLZ A;  2YU3 A;  4F93 B;  2EFQ A;  5DM6 F;  3KIO A;  3ZMV A;  4UY8 I;  2CFO A;  3C3W A;  1JI8 A;  3E7L A;  1MD0 A;  1SMT A;  2DMQ A;  4E7L A;  2IAI A;  1RI7 A;  5A2Q Z;  1RC9 A;  2VUM J;  4EMS A;  2A5W A;  2JSP A;  5DM7 F;  4ZZD A;  3GTG J;  1X3Z B;  1X19 A;  3K4K A;  4HX7 A;  1FJL A;  4ETS A;  3S3N A;  2ZNY A;  1LDJ A;  2HEO A;  3I59 B;  3L2R A;  1HW1 A;  3JRD A;  3FX3 A;  1QNT A;  4HPQ A;  2BV6 A;  4JQF A;  3FXM A;  1D1B A;  4UXN A;  2VQL A;  4A3M J;  1K78 B;  1EV7 A;  3S16 J;  3NRV A;  2IT0 A;  4I09 A;  2BOL A;  4XLP F;  2H09 A;  3KCC A;  1R7J A;  1X2N A;  4NNJ A;  3CCR I;  3VYU B;  3KZI C;  4AD9 A;  2CQ7 A;  1Z7U A;  1MNE A;  1B6A A;  1DP3 A;  1N75 A;  4RAZ A;  3IRR A;  2DTR A;  1MMN A;  4XRF A;  4QLC U;  1D5Y A;  1EF4 A;  2DT7 B;  3E6M A;  4Y33 A;  4A3L J;  1ZEL A;  3BPX A;  1O7F A;  4OIQ F;  1G3W A;  2D45 A; 
#chains in the Genus database with same CATH homology
 4AVZ A;  3PFY A;  1WJF A;  3LSH A;  1UAA A;  2QKL B;  3OYE A;  2PMZ A;  3BCA A;  4XOP A;  3LFU A;  1G8X A;  2CV1 A;  3CMM A;  2LG4 A;  4E7K A;  4BL0 B;  4E7S A;  3LSK A;  2Q1Z B;  4AU7 A;  3M8J A;  3EUK L;  3KX2 A;  2M4G A;  2M0M A;  2VJI A;  2ZSH B;  3L2V A;  1G59 A;  2X6Y A;  4P5O A;  3K4N A;  3D5S C;  4C30 A;  2CW8 A;  1S9H A;  4B43 A;  3FBI B;  1SFK A;  4XKC A;  4F52 A;  1ERD A;  3FBN B;  3RTR A;  2L5Q A;  4RLF A;  2XF6 A;  2VKD A;  4CCN A;  4RM3 A;  1LVK A;  3A1Y A;  1MND A;  4IKF A;  1T95 A;  2VIX A;  3OYC A;  3OYB A;  2QKM B;  1OR7 C;  1X1C A;  3CZ6 A;  1OLT A;  1X1D A;  4KJZ A;  1QU3 A;  2OC6 A;  4BU2 A;  2M3A A;  3K4M A;  2RRE A;  2IS2 A;  2VB6 A;  4DOZ A;  3LSG A;  3EUH C;  4BQN A;  4F3Q A;  3BLY A;  4E7I A;  2R7S A;  4XKW A;  4XLC A;  3BC8 A;  4DBR A;  4DGW B;  3ZQQ A;  3KEY A;  1J09 A;  2R4G A;  1PJR A;  5CQE A;  2CW7 A;  3V42 A;  2HPI A;  2XC7 A;  4XNF A;  3J7A Y;  3DTE A;  1Z3Y A;  2LYC A;  2VJ5 A;  2R7R A;  2ZXH A;  3E1S A;  4HNU A;  2HVR A;  1GLN A;  4F92 B;  3OYI A;  4BQQ A;  2L2O A;  1QHH D;  3QOE A;  1MMG A;  4PUS A;  5HVQ C;  1BR1 A;  4D1Q A;  1NG6 A;  2W4S A;  2W82 A;  3QYE A;  1LFP A;  3DLA A;  4G6T B;  3DKY A;  4BJ5 C;  2JVG A;  1N77 A;  2K3P A;  3D5L A;  4MLO A;  3MKZ A;  2AQF A;  1EA3 A;  4CH7 A;  3DKX A;  2UWM A;  4U87 A;  2VQH A;  4CCO A;  2LY2 A;  4BJT A;  4C2U A;  4HNT A;  2ZFU A;  1YX5 A;  2GOX B;  2Z1D A;  2R7U A;  3H35 A;  2V9K A;  4HG2 A;  3DPL C;  2V26 A;  2CUJ A;  1X1B A;  4D9J A;  2ELJ A;  3OL3 A;  2Z16 A;  3LSM A;  4XKB A;  3K4C A;  3OYJ A;  2X6W A;  4YEL A;  4LG3 A;  4HSR A;  4KIT B;  2UUZ A;  2VJJ A;  2ZSI B;  2DXI A;  1VZ0 A;  4CCJ A;  2XAU A;  2UV1 A;  3HXL A;  3IP4 B;  4QPO A;  3HG9 A;  5KNL A;  2R7W A;  2VKH A;  3L2U A;  1QHG A;  4RM2 A;  4DBQ A;  2JUG A;  1P9Q C;  1TT0 A;  3DU6 A;  4GRI A;  3I9V 2;  4PSX A;  3AKZ A;  3AL0 C;  3M1C A;  2DJI A;  3HC7 A;  3SZG A;  1X4O A;  2VXZ A;  3TL4 X;  3OYD A;  3RPU D;  1PYV A;  2K9L A;  3FDY A;  4XOR A;  3OYH A;  2V7F A;  1BR2 A;  3S8P A;  4E4H A;  2MFZ A;  3OWT A;  4ZYA A;  4XLA A;  4DJA A;  2W1O A;  2WAF A;  4BEH A;  3DQV C;  4RLQ A;  3CF2 A;  2GOM A;  3OL4 A;  2DOA A;  4B3X A;  4II2 A;  1U0J A;  4OAY A;  3OR2 C;  4PJM A;  2E5Z A;  1R6R A;  4XL9 A;  2R7X A;  2IGM A;  5HNH A;  4OAZ A;  3UNG C;  2HNH A;  3HOS A;  4BXF A;  3BG6 A;  2LH9 A;  4HRI A;  2JA2 A;  2HVS A;  4ZDO A;  2L7K A;  3E0J B;  2F6C A;  4BAC A;  2WAQ A;  4FET A;  2PJR B;  1YX3 A;  4N4N B;  4XR6 A;  3DU5 A;  4XKV A;  4NC8 A;  2AQE A;  3ZXS A;  3VYR B;  4XN3 A;  5JHF A;  3OR1 C;  2KQR A;  3S3O A;  3PNT A;  2V1N A;  4P1W A;  2KMU A;  2CMP A;  3OS0 A;  3DPU A;  3ONQ A;  2RNG A;  3S93 A;  1TZL A;  1FMW A;  2HVQ A;  2VXD A;  3PNY A;  3FKJ A;  4CA0 A;  1LKX A;  3ZR8 X;  4KT6 A;  4PFO A;  4F91 B;  3D5R C;  1BR4 A;  3QYF A;  3PUB A;  4CCL A;  5HOO A;  3W2A A;  4IQ4 A;  3K4L A;  4J01 A;  2MAB A;  3HUG B;  3PSI A;  3OYF A;  3K4B A;  3SYT A;  4LIV A;  2Q2E B;  3RSN A;  3SDB A;  4PJL A;  2X6X A;  1WJA A;  1MMD A;  4BGD A;  2KPM A;  2O5R A;  4R79 A;  3OYN A;  2FUG 2;  2F4I A;  2OUM A;  4PK4 A;  2OV7 A;  3NWS A;  5FRO A;  2LC2 A;  2NOJ B;  2M4K A;  3LMM A;  4XLE A;  2BW3 A;  3DEE A;  4CUG A;  4NQW B;  2WBM A;  1UG0 A;  5LFA A;  3K10 A;  4B44 A;  4E7H A;  3DTI A;  2LBF B;  3K6G A;  4BDY A;  3OMY A;  3C2H A;  2HZD A;  1V5E A;  4JOM A;  4YEJ A;  3OOU A;  3A2K A;  1V5G A;  2BW3 B;  3VYT B;  3UR3 C;  4Y4R A;  3AL0 B;  3OS2 A;  1X1A A;  1WFX A;  2K5C A;  3W3C A;  2HDW A;  4AYB A;  2Z2S B;  3OS1 A;  1MW7 A;  3EUA A;  3VYS B;  3IAS 2;  2I8D A;  3H5N A;  3OYG A;  3BCB A;  1WJD A;  4Y3O A;  4DIQ A;  4BDZ A;  2KRC A;  1NG7 A;  2IGN A;  2JVH A;  4ZTF A;  3PSF A;  3VSK A;  2LRD A;  2MC4 A;  3PNV A;  2VPL A;  2Y0S A;  3K70 C;  2K9M A;  3W2W A;  2RQQ A;  4OWR B;  2M7B A;  2X85 A;  4C9Y A;  3HPG A;  4ZDL A;  3A4C A;  3H0D A;  4YRV A;  2R7O A;  3I3L A;  2LOO A;  4J00 A;  3VDX A;  4QPQ A;  5HNF A;  3OYA A;  1DGW Y;  1V5F A;  1Y56 A;  1Y6I A;  1WJE A;  3RQ4 A;  1X4P A;  2L9N A;  3TMO A;  5HLT A;  3PL8 A;  4KIS A;  2KL4 A;  2DCE A;  3H9G A;  1D0Z A;  3LSI A;  1T0F C;  2P0W A;  1LDK B;  3MKY B;  1WJB A;  1Z3X A;  2XSJ C;  2PJR A;  2WAE A;  2IS4 A;  4XOT A;  1FMV A;  5TGT A;  2M7A A;  3ZRG A;  5FRM A;  3VWB A;  4B48 A;  3CP2 A;  2E1M B;  2DT6 A;  2E60 A;  2XF5 A;  2VAS A;  2MYS A;  4LIT A;  3C2G A;  2LBF A;  5FRN A;  2CS3 A;  2W00 A;  1W36 D;  5LD2 C;  3TBI A;  3LL7 A;  4B47 A;  3CP8 A;  4CZC A;  3CES A;  3GBG A;  4PJN A;  3PJR A;  3ZCO A;  3CJR B;  3HL2 A;  3N05 A;  4PSW A;  4EAT A;  1D1C A;  4XON A;  4X0G A;  2LRE A;  2IS1 A;  2WY8 Q;  4BE0 A;  2HPM A;  3HKZ A;  2X51 A;  3H9Q A;  3SEZ A;  1IRX A;  4ZDP A;  3K4J A;  3OIQ A;  3FHN A;  1BOB A;  3OYL A;  2X1C A;  3VSL A;  1W36 C;  1SAU A;  4BS9 A;  2IXS A;  2CH0 A;  2VJ4 A;  3IUO A;  2F5V A;  5KCM A;  4U7B A;  4BJ6 C;  2KZV A;  3KYL A;  4CSW A;  2W7N A;  3OYK A;  2KRH A;  2WA0 A;  3G2B A;  2X1D A;  3S32 A;  3OIP A;  4E7Z A;  3DPT A;  4PFP A;  5CQG A;  3HOT A;  3F9K A;  2VQC A;  3L2Q A;  3QOD A;  1WJ5 A;  1AA7 A;  3L2W A;  3EPZ A;  2VL8 A;  4ITV A;  4N4O B;  3S3M A;  2R7V A;  2E1M C;  4IZZ A;  4XLF A;  4H4K C;  2CV0 A;  3MMY B;  4BE1 A;  4ZC3 A;  2IS6 A;  1YE9 A;  4CCM A;  4XM3 A;  2WAD A;  4NUB A;  2VLA A;  2IGO A;  4E6K G;  2XDV A;  1KON A;  4NC7 A;  4HST A;  2BVL A;  3H9J A;  4ZJZ A;  1D0X A;  5CKT A;  4BUP A;  3K70 D;  4BE2 A;  1HA8 A;  3U21 A;  3NWT A;  3OYM A;  1N78 A;  4XMY A;  3H5A A;  2WY7 Q;  4BEH B;  3QYB A;  2LY1 A;  1Z7L A;  2HU9 A;  3RCO A;  4XN0 A;  3ZGK A;  4CCK A;  1E0E A;  1UEL B;  2KHM A;  4IQJ A;  2VQG A;  3H5R A;  4XQF A;  4BQO A;  1DGR M;  3HPH A;  4FAS D;  5KHD A;  1DQU A;  3MD2 A;  3CJQ B;  2R7T A;  1Z21 A;  4XLH A;  4ANJ A;  4IX7 A;  2KP6 A;  2CUZ A;  4F93 B;  1D1A A;  2X1E A;  2MD0 A;  1WJC A;  3SEQ A;  2CFO A;  4RMN A;  1JI8 A;  1K6Y A;  3OY9 A;  4E7J A;  4E7L A;  2HQA A;  2L9S A;  3DTK A;  2A5W A;  2V4J C;  2JSP A;  2IGK A;  1X19 A;  3K4K A;  3W2V A;  3S3N A;  2KDO A;  2KLO A;  3L2R A;  2XF7 A;  4ZTJ A;  3MKW B;  1MMA A;  4HPQ A;  4JQF A;  1D1B A;  3IAM 2;  2VQL A;  2CV2 A;  4LIU A;  4F55 A;  4HEA 2;  2BOL A;  2WB1 A;  4NNJ A;  2V6E A;  3VYU B;  4PJJ A;  2ZXI A;  1MNE A;  2E5N A;  1DP3 A;  1N75 A;  4C2T A;  1MMN A;  2R7Q A;  5CPR B;  2BVM A;  1D0Y A;  3AFH A;  3DWL E;  2DT7 B;  3BG7 A;  4Y33 A;  1ZEL A;  2A6T A;  4II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...