4J00A

Crystal structure of fischerella transcription factor hetr complexed with 24mer dna target
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
297
structure length
297
Chain Sequence
SNDVDLIKRLGPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEKYPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKEHQMPLSEALAEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRAWADKYHQDDGVPVVLQMVFGKKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcription Factor HetR
publication title Structures of complexes comprised of Fischerella transcription factor HetR with Anabaena DNA targets.
pubmed doi rcsb
source organism Fischerella thermalis
total genus 62
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03574 Peptidase_S48 Peptidase family S48
A PF18460 HetR_C Heterocyst differentiation regulator C-terminal Hood domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1670 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A03
1.10.10.1680 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4j00A02
4IZZA 3QODA 3QOEA 4YRVA 4J01A 4J00A 4HRIA
chains in the Genus database with same CATH superfamily
3BTJA 4BAYA 1X3UA 3FHNA 5BMZA 1M1EB 4Y15A 2PG4A 2VODA 2V9VA 4KN7X 1KYWA 1F36A 1YQAA 3BPVA 1ETXA 3TEDA 3SEZA 3JRIA 4KJZA 4I0BA 4KNYA 3RPQA 2VKEA 2IAIA 1P4WA 2EFWA 2CV2A 1QA6A 3W6KB 4XRSG 5L3BA 1E2XA 3RIRA 2F5EA 2VJIA 1WWXA 5HODA 3SDGA 1OISA 4BDZA 2DTZA 2XRLA 1A5JA 4OMYA 3ZXSA 3V8KA 2L9NA 5IP6A 1N25A 2VASA 1KQ9A 4W97A 5GAGJ 2FMYA 3I4PA 2ID6A 3H3UA 4ZTJA 2G0EA 4HV6A 2ISZA 5BS6A 2VB6A 4RGXA 1JHFA 1WKMA 1MDMB 1JKPC 4NHJA 1JHHA 3LSIA 4YIRX 4E7JA 2DYRH 1NK2P 2LKPA 2CU7A 4BE0A 2E71A 4G7OF 5E1WA 2JPCA 3GMEA 2GAUA 2L9RA 3T1BA 5JVGF 4Q5SF 5GP9A 2VOPA 2NS8A 4XIDA 2K3FA 4UY8I 5ERIA 3BG6A 3HOTA 1O3RA 5J4VA 4RAZA 2B7EA 5D8LB 2O61A 1T08B 3A1YA 2XAJA 3KX2A 1X1BA 2IGNA 4XNFA 1H8AC 2R5YB 3ONQA 4FTHA 2EFPA 4MIMA 5FKOA 4IO9F 1KGSA 2JZYA 3AAFA 2EIKH 3BG9A 2EIMH 1U3EM 2XPUA 2Z5UA 2L4MA 5E3LA 3TP0A 1ZR4A 3BQZA 2M34A 2CH0A 2M9HA 1X19A 2IPQX 5E8IA 1EV7A 1Y8QB 2VLAA 5D8KB 2CWEA 1QZYA 1VQMI 3KYCB 2XAUA 4CDGA 3HHHA 2WY7Q 2XKPA 1CGPA 2IRFG 4XLNF 2JQ7A 4M3GA 2DDBA 4BGDA 4O3MA 5HOOA 1FY7A 3BTLA 5KK1A 1QVTA 1Z67A 3QWLA 2DPDA 1MNMC 1SFUA 3KZYA 3WHCA 2E36A 1BM9A 4GCVA 4E4HA 1IN8A 4U88A 5HS9A 3I53A 4XKWA 4OIQF 3LSJA 4RGSA 2VN2A 5F0FA 2A6HF 1BI2A 5L3CA 2JUCA 3JRBA 1VQ4I 4A3BJ 4DJAA 1T33A 2GXAA 1DUXC 2QZ8A 4U0YA 5TJJA 2LNBA 5TRDA 4A3LJ 3K1MA 5K1YA 4BU2A 1RR7A 5CVVA 5F1JA 1D0ZA 2RDPA 5B3SH 3L09A 2ZBKA 4DNCA 2DMPA 3LWFA 1MMAA 5ILUA 3L2QA 4C2UA 3COAC 4RB0A 4ENJA 3M8FA 3K4BA 1HC8A 3FF5A 4GYGA 4XKVA 2FUG2 3F8CA 1V5GA 3HEFA 2MYSA 4U7DA 4HNVA 1P92A 4AM3A 1ITYA 2BVLA 1T8IA 3EUAA 4HG2A 2E1MB 1AOYA 2FX0A 3FISA 3C7JA 2DYSH 1OCRH 4LD5A 2ZXHA 2KJCA 3KP2A 3MKWB 4HDVA 4ZYEA 2CQXA 4KA4A 1LVKA 1JI8A 2QBYA 3S1RJ 4LJZF 2DMUA 5D5UB 4WX9A 5DD4A 1R9TJ 2W82A 3VWBA 3CLOA 4NC7A 3E7LA 1BC8C 5K5RA 3GXOA 3HC7A 2GLOA 1SD4A 5A2QK 1XMXA 2BXYA 3TMOA 1TTYA 2P0WA 2VJ5A 3KP6A 4WXDA 1JKRC 1MBJA 2XGXA 5D6EA 2HS5A 3IHUA 2DK8A 2HOEA 3CDLA 3R6SA 2A05A 2A5YB 2CW7A 4CZZA 3O8HA 2PI0A 2P5VA 1B9MA 3CCMI 1IXCA 1MH4A 3I55I 4IHXA 1I50J 3WU1B 1U5TC 1IZ1A 3V42A 3ABMH 3BCAA 1K6YA 1LEBA 1ENHA 1ETQA 2K40A 1MNDA 2L0KA 1S7EA 4HYEA 3OYMA 4LIVA 2OA4A 3QRFF 2ELHA 1ETVA 4WWCA 3LQRA 1XN7A 4G6QA 2MBFA 3HRMA 4PJJA 3DKYA 4DBRA 1PUFA 1C0WA 1MMSA 1F5TA 3BQYA 4O6JA 3V7RA 2NRAC 4I0AA 1IGNA 3I59B 1VF9A 2MGQA 4LK0F 5AIPA 1TQMA 1K7AA 1SFEA 2ZFWA 4F7ZA 4EJUA 3K10A 1QBJA 2XDVA 2ZXJA 1GT0C 2X1DA 2KZVA 1WJ5A 4E7ZA 5E3NA 1K78B 3DU6A 2YS9A 4XRFA 1ETKA 4KT5C 5JLWA 2IVMA 4PGGA 3I56I 1J9IA 3C2HA 4CYCB 3ZP5A 5B5EC 4CICA 3K2AA 1OJLA 1FP1D 2R7QA 4BJ6C 1X1PA 3ZCOA 1LPQA 4UVAA 4EMSA 5FB2A 1AHDP 4L9NA 5D5VB 4G6TB 1HF0A 2FNPA 2JA8J 1JJ6C 3CO6C 2E5NA 2DT6A 2DOFA 3QQAA 4UVBA 2Y75A 5EGOA 3S93A 3GX4X 1GDTA 1J0RA 2UWMA 1FEXA 2X1EA 3BROA 1IUYA 4DYCA 1D1CA 3GTLJ 3PUFA 2P7CB 2K27A 2Q2EB 3BWGA 1R5GA 1XCBA 5D4SA 5CYVA 1B1BA 3FXOA 3VSLA 5DCMA 4IHVA 3WU2C 1SVLA 4A0XA 4C9YA 4ENMA 1VQPI 1WZ2A 1R7JA 2AO9A 1P6RA 3ABLH 1R23A 4FHTA 1DPRA 3EPZA 3VSKA 2LREA 3HOSA 2BHZA 4V2FA 4ZTFA 3M4OJ 5IT9K 1YW8A 2ZJRF 3DEWA 2DJIA 2XRNA 4UNOA 1JKOC 1Y56A 1ETYA 2O5RA 5IY5H 4HAMA 5HDNA 2E19A 4XL9A 1O7FA 5CPRB 2BVMA 1MKMA 2HTJA 3OYCA 3PFYA 4EQQA 4A5NA 4I2OA 2LSOA 3KP7A 4XONA 4OINF 2KKOA 3KEQA 4XLHA 4MEYF 2M4KA 1XMAA 1XMKA 2VBWA 3NARA 1J2XA 3ZQQA 3F8FA 1R4MB 2GXGA 5CVUA 4L5JA 1REPC 2MLKA 1J5YA 1SAXA 2L7FP 2VKDA 5LFAA 3HRUA 3S2HJ 5CVIA 1TT0A 1XG1A 2Y69H 4PFOA 1YJ9I 3HPHA 5A2QZ 4RAFA 5LGNA 5F6FA 4UUTA 5E1ZB 3CMEI 3CO7C 1MZBA 1YFHA 4KIBA 2ZJPF 1RR8C 4EJTA 2VC1A 1K4SA 1ZKGA 5BPIA 1LNWA 1YG2A 2GWRA 3DCFA 3WTWC 4EGZA 3U1DA 2DCEA 4A3JJ 3GO5A 4XLPF 1WHUA 2K9MA 1X3WB 1ZGJA 4XLAA 5E20A 1T56A 1OYWA 1PDNC 3DTKA 3M9AA 4L9VA 1HBXG 2XC7A 2CUEA 2M0CA 1K79A 2NVYJ 1QO0D 5GAEJ 5J8FA 4YRVA 3J7AO 3MCZA 2F5VA 4DBQA 4XN0A 5HVQC 5J8CA 4HZFA 2OU2A 4NDLA 3HM5A 4Y7NJ 2Y2ZA 1R4NB 4I02A 4IHWA 2LTPA 4HF1A 3QODA 2XSDC 3K4MA 3AG4H 4RGRA 3DTEA 4WXHA 1D8KA 2VKHA 2ELJA 2PJRA 2H27A 2E1OA 2X6YA 2XASA 2E1MC 5HNHA 1LFBA 2HXOA 3R60A 3L00A 4XSXF 3G1MA 1A31A 4Y3OA 5HLTA 3X2QH 2O8KA 2MH9A 4ETSA 3F0CA 3DEUA 2NNYA 1MNEA 2E1CA 4UV8A 3CP2A 3HUGA 4A6DA 5M5WJ 1G4DA 1G8XA 2EFNA 4NC8A 4CCKA 4AIDA 4P1WA 1DP7P 5DS9A 1T6SA 3HPGA 3GEZA 3Q3SA 1Y0NA 4PJLA 2WY8Q 2O8XA 3ZMTA 4D5CA 2ECBA 2QVOA 1P7JA 4A69C 3RKXA 4CYDA 1IN7A 1UFMA 1I39A 1XSVA 2EFQA 1D5YA 4IZZA 2HFHA 1HW5A 1WCMJ 4C30A 3EQLF 2QEXI 1W5CC 1Y1WJ 2DI3A 1FTTA 3DXJF 4F52A 3K6GA 2ISYA 1TNTA 1H9GA 3W2VA 1P7IA 2JVHA 4ZDPA 4AYBN 4G8XA 1IRXA 4B44A 1DGRM 2LY9A 3BJOA 4KN4X 1EH7A 4OWRB 5IT9Z 1K83J 1WGXA 4S04A 4QTRA 3H1CA 2RKHA 4I6ZA 4P96A 2V6CA 1WJDA 1X3ZB 2QCOA 3ZQHA 5K7ZA 4Q47A 1K4TA 2DFHA 4M6XA 1LQ1A 2MA3A 1VZ0A 3ISPA 5CVJA 3HXLA 2LKXA 4HQMA 5BNGA 1RRJA 5JHFA 2BY2A 4MTDA 3OYFA 3IP4B 2ME6A 3VFZA 2CQ7A 2WADA 1ON2A 2I5UA 1S9HA 2Z9OA 2X85A 4LGWA 2FQ4A 2R7XA 3T0YA 2HVSA 2ID3A 2QGUA 2O0YA 1LKXA 1POGA 1TP4A 2EJRA 4N0BA 3IH2A 2R0QC 1O7LA 3KE2A 2IEKA 2V79A 4ZDLA 4RMNA 1CF7B 1Z3YA 1R1UA 3PL8A 2LC2A 2QENA 5D5WB 2LF8A 1H9TA 4LG3A 2FSWA 4M6VA 4HX7A 4I76A 1ZELA 1IRFA 4PGHA 1AKHA 4A2UA 1BL0A 1IAWA 2DT7B 4U0WA 2JMWA 5IYDJ 2KP6A 3S3NA 5FD5A 2QYOA 4J19A 2HGCA 2LBFB 2LFBA 3HOVJ 3HKZA 2M5WA 4BHBA 3GTMJ 2JK3A 2KMUA 1SMYF 4A3MJ 2NOGA 4JK1X 3L2RA 2QWWA 2EQRA 2L9SA 3CUQC 3OR2C 1IC8A 1KQ8A 4BBRJ 3Q5FA 1FT9A 5C44J 2J5PA 2A07F 2BY0A 3OYEA 3P9CA 3HJEA 2VT3A 1KU3A 1WI9A 1BR4A 2JVGA 2OF7A 3OYIA 4BKXA 3OYNA 1U9OA 3TO6A 5F0HA 1LFUP 2W25A 3VYTB 3BCBA 1RUOA 3Q9VA 2H6BA 1MSFC 3ASOH 4X1EA 3LFUA 3PIPF 2OAZA 5LGTA 1KA8A 2M8GX 2GIVA 5H6RA 1U8RA 2ELKA 2K9QA 3OWTA 4XICA 2L7MP 2R92J 1ERDA 2XF7A 2LD5A 4RGUA 1Z6TA 4BQNA 1ZREA 1ZN2A 4GXOA 1FOYA 3F72A 1IV6A 1WJBA 3UR3C 2CFXA 4ZYGA 5E18F 3G2BA 3SZPA 3OYHA 3BOQA 2R5YA 3I4MJ 1TNSA 3ZN0A 1QPMA 1IO2A 3B6CA 3E5XA 1Z6RA 1B8IB 1OR7A 3BR1A 2XF5A 1BA5A 4A5MA 3BTIA 2VKVA 3E97A 3O6BB 1KU7A 3E5UA 1GUUA 1ACIA 3MFKA 1O4XA 1Y0UA 2FRHA 1LFPA 5H6QA 1J7KA 3CESA 2B63J 2GA2A 5CLSA 1SEUA 4FX0A 3MKLA 4V2GA 2BY1A 2LY2A 4OU0A 1DDNA 1ZRFA 2PMZN 3HYIA 3OYBA 2PFBA 3IH4A 2UV1A 1O3SA 2A3SA 2M7BA 1GLNA 2QF7A 3R0JA 3LSMA 1K6OA 4JX5A 1P9QC 1R5HA 2FJ1A 3E0JB 1WH5A 4BXUA 1TW3A 2UZKA 1QZEA 1Y6IA 1HLVA 4IRGA 1BJAA 2PMUA 1S72I 4JP0A 1JUSA 1KU9A 2H6CA 4KMUX 5IYCJ 4L18B 2W7NA 1FBQA 1FIAA 1VQ9I 2HOTA 4ABZA 2ZC2A 1YYVA 3RYRA 1RNLA 1W5TA 2TDXA 4A6EA 3C2BA 2JA7J 1BI0A 1WJFA 4RLFA 1T38A 3H0DA 1SD6A 1SANA 2DFIA 3BDDA 5EZHA 3Q0UA 5M5YJ 1Z7LA 3RZDJ 1U5TB 1BI1A 3E6MA 3LA7A 1FOWA 1HCRA 2CMPA 1NHAA 3C2GA 5HNFA 1X1AA 4BJ5C 1W36C 1VQOI 4JBAA 2XGDA 3KEOA 2XAFA 3L2VA 4E7HA 1UAAA 1FNNA 2XF6A 5FKMA 4G6DA 1X2NA 4QWQA 5B66C 3J7AY 1I6HJ 4ZH4F 4P5OA 3G6EI 1W36D 3UNGC 3OSFA 1JT6A 3IAM2 4CCMA 5DDGA 3S32A 5DM7F 1R71A 1QGPA 1JJ8C 3FXQA 3TQNA 1G3SA 5CQGA 4Z2YA 4LB5A 4A12A 2R7OA 2JA2A 3WTYC 4YFNF 1MW7A 3KCCA 3ULQB 2CO5A 4PZJA 3K69A 4D9JA 3IKVA 1YHQI 2KRCA 1ZRCA 3CF2A 3EUKL 4KITB 4E7LA 1YRNB 3UKGA 3T8RA 3HRTA 2IS1A 3BLYA 3M3YJ 1FBUA 1Z91A 4E7KA 2KL4A 2HKOA 4L9TA 4XOTA 5BQTA 5EG0B 3CCLI 2DFEA 3ELKA 4KICA 4IXAA 2WAQN 3F9KA 4DOZA 2DLLA 3GFLA 1IJWC 1ZLKA 2GQQA 4OIPF 4XOPA 4BXFA 5FKNA 4JYKA 5EYRA 4N9HA 1UHWA 3LQQA 4NBQA 2HDDA 3BR3A 5JLXA 3HBLA 4BQQA 4KT6A 3ZQGA 2EV5A 2OZUA 2K02A 5DV5A 1HKSA 1JTXA 1UELB 2OUMA 3ASNH 5J3LA 3ZOBA 4XLCA 2CV0A 2DAOA 4RLQA 4PFPA 1YLFA 3U1KA 3I59A 2ZSHB 3QPHA 1F1ZA 1FOXA 2LR8A 4M73A 2BW3B 3SZTA 2JA6J 1FP2A 2LG4A 3LL7A 2G9WA 1MJ9A 3H0GJ 3TW7A 3D1NI 2D45A 3BR6A 2HTSA 4XQFA 2F4MB 2FBIA 2X0LA 3W2WA 2KLOA 3FHZA 1K78A 2E34A 3F8BA 2LMDA 1MMDA 3R4KA 5F0CA 1Z77A 2YPRA 4CYCA 2VOOA 3JREA 3SYTA 3HL2A 2R7SA 4WCGA 4C3HJ 4B8XA 5LRRA 4KIFA 4G9YA 4A93J 3QPSA 1LE8B 4XSZF 1WI3A 2O9LA 3HOZJ 1LJ9A 2ZSIB 3HGYA 4LMYA 4RM2A 2Q2EA 3BT9A 1BN5A 3OYKA 2ACJA 1X1DA 1G3TA 4MO7A 5FFXA 4Y33A 1ZQ3P 2K86A 1E3PA 1BIAA 4L5IA 1FYLA 1VI0A 3FM5A 4IEJA 1OMIA 2CSOA 5B1BH 2DT5A 2K7LA 3QOPA 2X6WA 1XB4A 3R61A 4G7HF 1B72A 1L0OC 4LG0B 5DYMA 4XR6A 4UHTA 2WAFA 3LA3A 4G94A 4BXXJ 3DBHB 2WB1N 4XK4A 2EB7A 2VBYA 3I0TA 4GGGA 3KIOA 3E6BA 4LLNA 3PNVA 4FCYA 2DMQA 2V4JC 3QP6A 5M3MJ 3D0SA 1BW6A 3SQNA 4II3A 2CQNA 2R7RA 3MQ0A 3PSIA 1LDDA 2CW8A 4E7SA 3ECHA 3CCUI 3OIQA 3V8LA 4BE1A 1DU0A 4XRSA 5L3GA 9ANTA 3OOPA 2ZB9A 4JOMA 4NNJA 1O3QA 2R5ZB 3LSHA 3DLLF 2EZLA 1VNDA 4XLEA 4ESJA 3KFWX 2IGOA 3F8NA 3G73A 4KMFA 4B47A 2UXNA 1EH8A 1A04A 1JUPA 4M3BA 4HRIA 2PBIA 4KIGA 4MHGA 3IAS2 2HVRA 2P6TA 2E7XA 5L3EA 1XD7A 2X1CA 4E7IA 1A36A 2DTRA 4EJOA 1G6NA 3Q9SA 2DU9A 3GTOJ 4K2EA 3ABUA 3FWEA 2HPMA 1IXSB 2LOOA 3HIFA 4J01A 3RYPA 5LHGA 2OV7A 4BACA 5IP9J 1QRYA 2CW0F 1T0FC 1QHHD 2HU9A 3WTXC 3QU6A 2EBIA 3HRSA 1JXSA 2V7FA 2P5KA 3IKTA 4FQGA 3DPUA 2BBYA 5EJCA 3F23A 4XN3A 2M2EA 1HSTA 3N4MA 1YIOA 3E6CC 3CUOA 4Z6YA 3G1LA 4DGWB 3AG2H 5FFZA 4Y52J 2EZIA 2MH2A 4ENNA 2KIQA 2KIMA 2YU9J 2D1HA 2EINH 2HYJA 1XTAA 1TC3C 3BZKA 3NQOA 1OCZH 3U21A 4D5FA 4IQJA 2FD5A 5KAFC 3KEYA 1W0TA 3LSKA 2A5WA 1QZZA 2XPVA 5C4JJ 1WQ2A 4Y13A 2RNGA 1WJAA 2YUSA 3ABKH 3K4NA 4RAYA 3SJMA 3IRRA 4C2MJ 4MEXF 3GTJJ 2XAGA 1ZR2A 3E6DA 2IGMA 1ZGWA 2MG4A 1FBSA 1MD0A 2IW5A 2KISA 3DU5A 3WGHA 1UHMA 3DEEA 1VQ7I 4CO8A 1KU2A 4M9XA 1J09A 2HQNA 2X9DA 2OCEA 3BR2A 2VQGA 1Z1DA 3WG9A 1Y1VJ 1IRZA 3FXLA 3WHBA 4XBFA 1F43A 5ED4A 3K2ZA 3M8JA 4FX4A 1U8BA 4BL0B 2DJNA 1T2KA 1LEAA 5JHUA 1QHGA 2A6EF 5M3FJ 1NTCA 2OCCH 4H4KC 4UB8C 4KFCA 1Z21A 1D5VA 3L2UA 5IYBJ 3JSPA 2VI6A 4UUSB 1X4PA 5E79C 2IP2A 2QQBA 4PJ0C 3ABTA 5C3EJ 4CHUA 4OAZA 1TL8A 3CUQB 4OIRF 5BPDA 4AWXB 4IL6C 4M6YA 2B0LA 4HF0A 4A3IJ 3LSGA 2XAQA 2LDUA 4QSHA 3HSEA 1XGOA 4LOCA 3A0BC 3JW4A 2PJPA 2KRFA 3BG5A 1OYIA 4E6KG 1KYZA 2DODA 4OOIA 4RB2C 4BJTA 3L2CA 2V1NA 3LNQA 2AHQA 4W1UA 1CF7A 3BR5A 2HI3A 3KP3A 3KP4A 1NK3P 2NS7A 2DW4A 3N05A 1IRGA 3A4CA 1ZGAA 2P5LC 2FU4A 2NVUB 2XIGA 1A6IA 5HDKA 3ZRGA 4FASD 5FLXK 3A02A 4BHPA 1WRJA 2I10A 3H9GA 3K4CA 2HQ5A 2LY1A 3EUHC 2XB0X 4AC0A 1RIOH 5EZGA 2JSCA 3JTHA 1WFXA 2FF4A 2FXAA 2LBFA 5JI6A 5JVTA 4CA0A 1D1AA 5HLGA 1T39A 2KJBA 3GFJA 2CGPA 2H09A 3GF2A 5TGTA 3FXRA 4FISA 2F5CA 3F8MA 2VQLA 1I1GA 2A6TA 2KT0A 3WODF 4HF2A 4OIOF 1I3QJ 2CUZA 2ECCA 3H35A 3VYRB 2ZKZA 1ZG5A 1MBEA 1Z9CA 2QM3A 3TO9A 3ZR8X 4ZYAA 4HX8A 3CDHA 4QIWN 3TGNA 3J80Z 2ZMEB 4Q48A 5ILVA 1X4OA 3H5AA 1QU3A 2VT2A 3KYDB 4A3FJ 2OTLI 4H0EA 1U6GA 5J6XA 2XVCA 1Q1HA 3K4LA 5AIQA 2DFFA 2XGCA 2F4IA 4X0GA 2ME0A 2XPWA 5FRNA 1E3HA 2ZJ2A 4AD9A 2HEOA 2JN6A 3GFMA 5H20A 3I9V2 2VC0A 1SFOJ 1R1TA 1X2MA 2MSYA 1NH3A 3CCQI 3FXKA 3PQJA 2EV0A 2F2EA 1B59A 5B1AH 4AYBA 4BS9A 2VPRA 1ETOA 5TISC 2QQ9A 3LSPA 3HSFA 3RJPA 1TWHJ 2LKSA 3NWTA 5EF6A 1YO5C 4CZCA 1SFKA 5L3DA 1FWZA 3IRQA 1B8IA 5M5XJ 3J81K 3B73A 3I5UA 3S2WA 3BG3A 4RA2A 1U78A 2Z1DA 3Q0WA 1Y39A 3A01B 4WF2A 3NEUA 5K5QA 5AONA 3CDIA 5FLVA 4YFXF 2BYVE 2H1KA 4FETA 3G3ZA 4F55A 3RKWA 1SC7A 4PSXA 3FK6A 2EA4A 2RAEA 3WTTC 3FK7A 3RKQA 3W3CA 2M30A 2K85A 4MLOA 2ICWG 4P9FA 4WXCA 3CTAA 2HYFA 2M8EA 1TW2A 4HEA2 1IW7F 2DMTA 2W00A 4YIIA 1LUJB 3OR1C 4YELA 2Q0OA 5KCMA 1ZAOA 2EWNA 1TWCJ 1KONA 1RC9A 3RQ4A 1TWFJ 1GV2A 3WTZA 4B1RA 2EPFA 2IS4A 3PQKA 3OMYA 2ZXWH 3CC2I 3SHFA 2PEXA 2NVTJ 2JRMA 3CZ6A 1TQIA 1OKRA 1W7PB 2CQQA 3DV8A 1XGSA 1XPXA 2K4JA 1ZTRA 5HS7A 5DM6F 2R7VA 4AIJA 3S15J 3OYLA 3VODA 1ZG3A 2EILH 4IOCF 1FPQA 4OAYA 2K9LA 1S5LC 2KPMA 5FLXZ 1YW7A 3MD2A 1EJ9A 1U5TA 3ZPLA 3FMRA 1S7OA 1T0FA 4BHCA 2LP0A 2HKXA 2XUBA 4C3IJ 3OL4A 1T95A 2OD5A 1G3WA 4KISA 2H1LA 2D1VA 2HZTA 1JUMA 1Q1VA 3TOBA 3NRVA 3LAJA 2N8GA 4II2A 2JPBA 1FC3A 2Y30A 2R7DA 4S05A 2Y9ZA 2MFZA 2K9SA 5BOXA 3KETA 2L3DA 2KIFA 4E70A 3K70C 4N4NB 2ZNYA 1RKTA 3WE3A 2WAEA 2OZ6A 1IN4A 2VJJA 5LEJA 3JTGA 1HDDC 4C2TA 2HOSA 3QP5A 2VPLA 2V1UA 3CQZJ 5LRSA 3L2WA 3QYFA 3ML6A 3D5RC 4HOBA 2KFDA 4ZC3A 3K70D 2LYCA 3GWZA 3PO2J 1UG2A 2AXTC 3CMAI 5LLQA 3CJQB 2XSJC 3E3VA 1S8NA 3WU0A 1YRNA 2CQKA 3BTCA 1MMNA 1BBYA 5HDGA 2FQ3A 5ICFA 3E5QA 3H5NA 2DN0A 4XMYA 2X48A 3I58A 4IOAF 4JX6A 1HW2A 1Z7UA 2PMHA 2DA2A 1MSEC 1MDMA 1S6LA 2X6XA 3OYGA 2NNNA 4RM3A 3HOUJ 1BR2A 3MZHA 2PJRB 3G1OA 1XSXA 1QVUA 2XB5A 2VXZA 1TZLA 1UMQA 4FE7A 1HKTA 3RQIA 2Q1ZB 2Z16A 3PIOF 1VQLI 3KLOA 2KHMA 2D5VA 2WTEA 1FIPA 3QAHA 2HDWA 2Y31A 3TL4X 4BH9A 3S1QJ 2JUGA 3J81Z 5LHIA 3HZJA 5E1XA 4ESBA 4HSTA 1YS7A 4Y4RA 3CMMA 2BW3A 2NOJB 3CC7I 2ZCWA 2L7KA 2I8DA 3K1PA 2C6YA 3F21A 1BC7C 5DUIA 3H5RA 3CD6I 1U0JA 3ZMUA 4HDUA 2TCTA 2MABA 3DBRB 3FKIJ 2PMZA 3GYHX 3OIOA 2DOEA 2VUMJ 2W48A 4FE4A 1UCRA 3TP3A 3P5JA 2FNAA 5E3MA 3S2DJ 3H36A 4KDPA 1JT0A 3TKYA 2ZMEC 3W2AA 3CC4I 1P4XA 2IS2A 1W0UA 3OS1A 2XAHA 5CKTA 3I4NJ 1IDZA 5L3FA 4B09A 2LVSA 4YIFA 5HLHA 1I3AA 1FLIA 1LE8A 1A6QA 3SEQA 3G71I 2PX9A 4BYYA 1NG6A 4NQWB 4ZYDA 1GXQA 2NAZA 4BQAA 1OCOH 3JR9A 4BUPA 2X51A 5D4RA 2BHYA 3GW2A 5F08A 3AKZA 4CCNA 1FTZA 1IF1A 2V9PA 3IWFA 2QLZA 3HSRA 1MJAA 4RS8A 3U9GA 5GADJ 3NAUA 4RBOA 3MKYB 3BC8A 3FKJA 3Q0VA 1D1BA 2Z99A 4BEHB 3BP8A 4HQEA 3D5LA 1ZYRF 4LG0A 3K0LA 5J47A 1MIJA 1N75A 1S29A 2F48A 4RDUA 2H8RA 2L02A 2KDOA 2RVCA 1P2FA 1MMGA 2EZKA 1AA7A 2IA2A 3KPHA 5LD2C 4P9UA 3HOXJ 3CCEI 1X1CA 1HXDA 2DBBA 2WA0A 1R36A 5EEGA 2ESNA 3LSTA 3SDBA 2RQQA 3TBIA 4ZDOA 2FMLA 3GTKJ 1OCTC 3WTUC 2IJLA 3J7YJ 2JWTA 1WH7A 4XLFA 4YG2F 5DCFA 3A03A 2QQAA 3K7AJ 4O5VA 4ON0A 1FYMA 2HDCA 2R5ZA 1IN6A 1AKHB 2Y0MA 1MJBA 4LK1F 2GIZA 4ZYHA 2RC4A 1VQNI 3K9TA 5CVRA 1SMTA 2WAQA 3F22A 3OSGA 3ZMDA 1H88C 1ETWA 5ICGA 1BOBA 4LITA 2CUJA 1GVJA 2KDZA 2R93J 1I27A 3PM1A 2E60A 3WGGA 4EM0B 4IKFA 1V3FA 1W5SA 3FBNB 3CCRI 1W4MA 2Z3YA 5J1YA 5KNLA 1W7PD 2JRTA 2F4OB 2LH9A 3DFGA 1S3JA 2F5FA 4Q4ZF 3CLQA 2O6GE 3FZVA 1FSHA 3W6JB 2XKOA 3FBIB 2VE9A 3S3MA 4EEFG 4AVZA 4BDYA 1IDYA 1U2WA 1STZA 3DKWA 4AUXA 2H8WA 2CYYA 3IH3A 2HPIA 2STTA 3CJNA 2R7ZJ 3MWMA 3F6OA 6PAXA 2P4WA 3EETA 4YFKF 5LBQA 2ESHA 1AWCA 4A3DJ 2BXZA 4M72A 3BZCA 2NYXA 2W85A 3WG7H 4V19K 4X6AJ 2HOAA 3RCOA 1ZRDA 2HXIA 1P4AA 3M1EA 2GBYA 3DWLE 2EV6A 3RKYA 4ASNA 2BZTA 5LHHA 3OYAA 2IS6A 1QNTA 2YX7A 1YIJI 2E2IJ 5DUKA 2A69F 1IG7A 1FYKA 5K7FA 3TW6A 3S3OA 4LB6B 3JCUC 5FO5A 1JE8A 3RPUD 4L0YB 1ZK8A 1ZH5A 5ICEA 1SVMA 2DMNA 3H9JA 4ENKA 2WC2A 5F64A 4DYQA 3S17J 4HLXA 1KZHA 3L1PA 3DLAA 3CCYA 3K4KA 1SD5A 1V54H 2VBXA 2LK2A 2QUFA 2KRHA 3M07A 5ILSA 3W6VA 5LGUA 3DPTA 2DA7A 3FX3A 2V1XA 3GVAA 2CFOA 5EDNA 3D5SC 1EA3A 2VE8A 2VIXA 1HSJA 5DEQA 3T5XA 4F91B 1V4RA 1ONVA 3DQVC 4NB5A 2IXSA 3F3XA 2WB1A 1H0MA 4UUSA 5DTDA 2HYGD 3VYUB 3HB9A 3O3KA 3T8TA 4F93B 3JAMZ 2M4GA 3M8EA 4EJWA 4I99C 1R00A 5E17F 4R8HA 2P81A 3CUQA 4EM1A 4U87A 4UB6C 2IT0A 3I64A 1QQIA 4L9JA 2HQRA 4M74A 4AIKA 1JGGA 1W1WE 2AQEA 5E3OA 2UXXA 3LSRA 1I6XA 1HOMA 2X4HA 1LB2A 2PLYA 3GZNB 2LRDA 2V9KA 2JTVA 2V26A 1MBFA 3EYIA 1V5FA 1JTYA 2LF7A 2W4SA 3GZ6A 5GTIC 1E17A 1R49A 5GAHJ 3OV8A 2R7TA 1PYVA 4JX4A 2JT1A 1O3TA 2ZNZA 1BW5A 4AU7A 4LIUA 1WJCA 2YSRA 3PO3J 1BOAA 2L2OA 2K5CA 3ZQIA 2FBHA 1RESA 4HPQA 4P55A 2M3AA 4M71A 2RN7A 3K4JA 2NXNB 1MBGA 2A61A 1PVEA 3P7NA 1UG0A 4IVNA 1XGNA 2F5DA 3RI4A 2Y48A 2L01A 2W57A 2MW8A 1VQ8I 1ZHFA 5GTHC 2GM4A 2CJJA 5FKLA 1VFCA 2YR2A 1VQ6I 3MZYA 1VQ5I 2M0MA 1H89C 2CS3A 1YW9A 2COBA 4IHTA 3P9IA 1YOVB 1YITI 3IUOA 3MVPA 1U9NA 1Z05A 4IHSA 4I09A 3EDPA 4NC6A 1DGWY 1BR1A 2HQAA 4XM3A 4RB3C 2QKMB 4ESFA 2J5OA 2LLKA 2QSFX 2QQ8A 3V7SA 5E8GA 5FJ8J 2ZMEA 1SAUA 1TT5B 3MEXA 1ZLJA 4QPOA 3ZQFA 3ZN1A 3BPXA 4F92B 2HR3A 4CUGA 3QYEA 3J80K 3HHGA 4KYWA 1V5EA 4Y17A 4D7MA 1YJWI 4G12A 1IV8A 4CCOA 1RKWA 1HA8A 3GLXA 3SXYA 2F6CA 3DF8A 4CSWA 3H92A 2MD0A 3O8GA 2FBKA 3C18A 2Z33A 3PNYA 1GHCA 3CJRB 4M3FA 5HS8A 1OFCX 2JJ7A 4M9SA 1FSEA 3ESWB 2AXLA 1ODDA 2P6SA 2P8TA 4PJMA 5FKKA 1GXPA 1V55H 4B4CA 3P9KA 2UUZA 1CQTA 3FIWA 4UVCA 3JSOA 2DPUA 3S16J 3NWSA 2IA0A 2DA6A 1GVDA 3JRFA 3AFHA 4DIQA 3A01A 5KAIC 1HQCA 2VL8A 1XS9A 3S1NJ 1PP7U 3HOWJ 1USSA 4UUVA 2Q8KA 3FXUA 1FMVA 3I3LA 5J40A 2EZHA 5GPAA 2IA1A 4A0YA 3BY6A 4PSWA 5FGMA 4HNTA 5F1RA 3RZOJ 3BR0A 5FD6A 2FOKA 1OPCA 3TDZC 4HV5A 1OQYA 4IPAA 2E1NA 5FLMJ 1VQKI 1YS6A 2GA1A 4DW6A 1YX5A 3ZMSA 1OCCH 4GDFA 2DDAA 4LLGF 4M3DA 1I5ZA 1UZCA 4MQ9F 4PCQA 4D1QA 5GPCA 2E35A 2H94A 3ROUA 2L5QA 4MGRA 2XROA 2QSHX 3B6AA 3SZGA 3ERMA 1FMWA 1SFXA 2OPTA 3ZGKA 2FA5A 4L0ZB 1EF4A 2NVXJ 2KZGA 2CV1A 4U7BA 1ON1A 2MLGA 3S14J 4XRMA 3WTVC 1KQ0A 2E5ZA 3I71A 4MQVA 3VEPA 3JRDA 1OR7C 1B72B 2GZWA 1ULYA 3S8PA 1W7PA 3CCSI 2OQGA 3FXMA 2W84A 1R6RA 1D0XA 5D6FA 1XDSA 2RNJA 2NVQJ 4R79A 3DPLC 3GTQJ 1DP3A 3AL0B 2OJED 3RSNA 4MFEA 3A0HC 3J7ZI 1UHSA 3OYDA 2R4GA 1TLHB 3A2KA 2DQRA 4A3CJ 1YX3A 5K5OA 4DYRA 4HNUA 2BGCA 2QA4I 3ZQLA 4HA8A 4KUMA 3GTGJ 2QBYB 1BJZA 5H2FC 1HDPA 1X58A 1XGMA 5CJ9A 5F04A 3PNTA 4LFUA 2CRGA 1YI2I 3GLLA 5EEHA 2K3PA 1TWGJ 3OS0A 1DQUA 3BG7A 5IOYA 4A3GJ 5IT3A 2E7WA 4FT8A 4M9ZA 2K4BA 3OL3A 3MN2A 4ZZLA 1EH6A 3V4GA 2L54A 4I98B 5DD8A 3RPUA 2DA1A 2KIUA 3TOAA 1WJEA 3SFZA 1XC5A 2XGEA 1L3LA 3WE2A 1BIBA 4GO1A 4D0PA 1D3YA 5JR3A 2CUFA 3H3ZA 3FMSA 1E3OC 1RETA 4YEJA 4BY1J 4OMZA 2WV1A 5IOZA 2Z2SB 2RQPA 4S0HB 4HW0A 1IXRC 3M1CA 4BE2A 4BNCA 1MGTA 4TV7A 4EJVA 3IV5A 1PUFB 3EYYA 2DA4A 4CGZA 2VBZA 2TRTA 2WBMA 1T98A 3N97A 3CMYA 2GOXB 3S1MJ 3GUDA 2VQCA 4F3QA 1D8JA 2M1BA 3PFIA 4B43A 3GZ5A 4MFDA 1LDJA 5IPAA 1OLTA 1R5ID 1EKEA 4U0VA 1G59A 4XORA 2IGKA 3BZ6A 3M7GA 3FDYA 3E1SA 5D5XB 3OOUA 1Z3XA 1XCVA 3HTSB 2AS5F 2EK5A 2O7OA 3G4SI 3VPRA 3I54A 1N77A 3OS2A 1O57A 4JQFA 1JKQC 3CP8A 5K7HA 3AG3H 3AG1H 2VJ4A 1QPIA 4B3XA 3LOCA 2PN6A 2JSPA 5J1UA 2R7FA 4C3JJ 4IHYA 2EH3A 4M3EA 4AIHA 2EIJH 4XKCA 4XKBA 5EGOB 4MNUA 3H9QA 3HTUA 2DK5A 3TDUC 4D7NA 4IRIA 1OCPA 1FZPB 2G7UA 2M45A 2X6OA 3QU3A 3L9FA 3MAJA 3GCMA 5KVRA 2V1DA 2ZO4A 1S7AA 5DCMB 2ZXIA 1F4KA 2BE5F 4HX4A 4NQWA 2OBPA 3BJAA 1R22A 1ZG1A 2BY3A 5FROA 1Z0XA 2HNHA 4GRIA 5C4XJ 1RUNA 2PQ8A 2DO7A 2R7WA 3FXJA 5FRMA 2V6EA 2M7AA 5IP7J 2WWYA 1WPKA 3JRGA 2AQFA 2XV4S 3CJTB 3DBLB 2GOMA 2EA2A 3OIPA 4UV9A 2BOLA 2O03A 1LVAA 2CG4A 4BEHA 1XSDA 2K9NA 3V8JA 2BEOA 2OC6A 1E0EA 4MTEA 4B3AA 1RI7A 3PUBA 4PUSA 1PJRA 3FM3A 4PDKA 3QOEA 2O3FA 4IQ4A 2DA3A 4ANJA 2HZDA 3GFIA 4IF4A 1GV5A 1JGSA 3VDXA 1YE9A 5J4YA 3SFIA 3H3VK 3MKZA 2L9VA 1BI3A 4B48A 2RV8A 2Y0SA 2A68F 5CQEA 1FX7A 2STWA 3QPTA 3DTIA 1DU6A 3LMMA 4DQ2A 1D0YA 3IWZA 2G7HA 1B9NA 1G2HA 5J1RA 2L4AA 1FOKA 3CCJI 2BV6A 2Y0SN 3HDDA 3ZQ7A 4CCLA 2VONA 1OYYA 2DA5A 4HBLA 4G7ZF 2QSGX 1MH3A 3B02A 2MC3A 2FEZA 3F6VA 3QPLA 1HKQA 4EM2A 4I7HA 4BY7J 4ITVA 5EG0A 1A35A 5HLIA 4A0ZA 3CF5F 1R58A 2ETHA 2W1OA 3MMYB 3OYJA 4A3KJ 2MD5A 4R1HA 3HKZN 2FE3A 2HWVA 2VXDA 3KP5A 2RREA 1VTNC 4UXNA 4BQOA 3JRAA 2E2HJ 3TO7A 2MC4A 3HGGA 3AL0C 2R7UA 1R1VA 1G3YA 2E2JJ 1RPWA 1PP8F 1SD7A 5ICCA 1J59A 1I1SA 3GBGA 3L7WA 4QPQA 1MBHA 3IL2A 1TWAJ 3VOEA 1IN5A 1B4AA 4IRHA 3HUGB 4QLCU 3PSFA 3RTRA 3PJRA 3R0AA 2P7VB 3K1NA 4CCJA 3GTPJ 1SVOA 2RGVA 4EVIA 4GFBA 3KZZA 1TBXA 2YU3A 1Y8RB 4HSRA 3BJ6A 1DPUA 1J75A 4J00A 2D2WA 4NUBA 4DZPA 2ZFUA 3KYLA 4IX7A 4RB1A 3ZQCA 1UJ8A 3O2PE 2HVQA 1TQPA 1USTA 2WV0A 4LLLA 2XHKA 3ECOA 3QYBA 2B9SA 1FJLA 4ZJZA 1NG7A 2ADUA 3WTSC 4CXFA 3DP7A 1XX5A 1IUFA 3ERED 1F9NA 1HW1A 1LDKB 2Y9YA 4DZJA 1B6AA 2W24A 4EATA 1AU7A 3VB2A 1UB9A 4EGYA 3LA2A 4PJNA 1N78A 1WSUA 4CH7A 3MZ8A 3ZMZA 1APLC 3C3WA 3FMQA 2OTJI 4WK8F 4HLYA 2DXIA 3HG9A 1YTYA 2GXBA 2COMA 3EUHA 2DQLA 5F27A 3V7CA 2DOAA 2YX4A 3KZIC 1WVRA 2NS0A 1ORKA 2EFOA 3RDIA 3WGIA 2ZJQF 4IJAA 5JFRA 1K61A 3U2RA 3VYSB 2L7ZA 1XDUA 4RAGA 2R3SA 3IC7A 1MBKA 5KHDA 2FOWA 4A3EJ 4PK4A 1PUEE 1ZARA 3OY9A 4AVPA 3HOYJ 4GYIA 3JAMK 3JRHA 5EEAA 3DKXA 3CCVI 3REOA 4ZZDA 2IBDA 4BBSJ 3LAPA 2M87A 4N4OB 2KQRA 4I01A 1RZ4A 4EV0A 4L5EA 3KLNA 3C1DA 2JA5J 2VQHA 3ZMVA 5LEKA 1YJNI 2OQRA 4N9IA 2QKLB 3JRCA 3LFKA
chains in the Genus database with same CATH topology
2L2OA 2K5CA 3A4CA 4HPQA 1ZELA 3FHNA 3ZRGA 2M3AA 4FASD 3K4JA 2DT7B 2KP6A 3S3NA 1UG0A 3H9GA 3K4CA 2LY1A 3EUHC 2LBFB 3SEZA 4KJZA 1WFXA 2LBFA 3HKZA 4CA0A 1D1AA 2KMUA 5TGTA 3L2RA 2CV2A 2M0MA 2L9SA 2CS3A 3OR2C 2VQLA 2A6TA 3IUOA 2CUZA 3H35A 3VYRB 3OYEA 2VJIA 1BR4A 3ZR8X 2JVGA 4ZYAA 4BDZA 1DGWY 1BR1A 3OYIA 3ZXSA 2HQAA 4XM3A 3OYNA 2L9NA 2QKMB 2VASA 3VYTB 3BCBA 1X4OA 4ZTJA 3H5AA 1QU3A 1SAUA 2VB6A 4QPOA 3LFUA 3LSIA 4E7JA 4F92B 4CUGA 3QYEA 4BE0A 1V5EA 3OWTA 3K4LA 4CCOA 1ERDA 2XF7A 2F4IA 1HA8A 4X0GA 5FRNA 2F6CA 3BG6A 4CSWA 3HOTA 4BQNA 3I9V2 2MD0A 1WJBA 3PNYA 3A1YA 3UR3C 3CJRB 3KX2A 1X1BA 2IGNA 4XNFA 3G2BA 3ONQA 3OYHA 4AYBA 4BS9A 4PJMA 3NWTA 2UUZA 2XF5A 4CZCA 1SFKA 2CH0A 3NWSA 1X19A 2Z1DA 2VLAA 3AFHA 1LFPA 4DIQA 2XAUA 2VL8A 3CESA 2WY7Q 4FETA 4F55A 4BGDA 1FMVA 3I3LA 4PSXA 5HOOA 2LY2A 4PSWA 4HNTA 3W3CA 3OYBA 4E4HA 4MLOA 2UV1A 2M7BA 4HEA2 4XKWA 1GLNA 1YX5A 2W00A 3LSMA 1P9QC 3E0JB 3OR1C 4D1QA 4YELA 1Y6IA 2L5QA 5KCMA 1KONA 3RQ4A 4DJAA 3SZGA 1FMWA 2IS4A 3ZGKA 2W7NA 3OMYA 2CV1A 4U7BA 4BU2A 3CZ6A 2E5ZA 1D0ZA 1WJFA 1OR7C 4RLFA 3S8PA 3H0DA 1MMAA 2R7VA 1R6RA 3L2QA 4C2UA 3OYLA 4OAYA 1Z7LA 2K9LA 2KPMA 3MD2A 1D0XA 3K4BA 2CMPA 3C2GA 5HNFA 1X1AA 4XKVA 4BJ5C 4R79A 2FUG2 3DPLC 1W36C 1V5GA 1DP3A 2MYSA 3AL0B 1UAAA 4E7HA 3L2VA 3RSNA 3OL4A 2XF6A 1T95A 2BVLA 4KISA 3J7AY 3EUAA 3OYDA 4P5OA 4HG2A 2E1MB 1W36D 3UNGC 2R4GA 3A2KA 3IAM2 4II2A 1YX3A 4CCMA 4HNUA 3S32A 2MFZA 2ZXHA 3MKWB 3K70C 4N4NB 1JI8A 1LVKA 5CQGA 3PNTA 2WAEA 2VJJA 2JA2A 2R7OA 4C2TA 1MW7A 2VPLA 2K3PA 3L2WA 2W82A 3VWBA 3OS0A 4NC7A 1DQUA 3BG7A 3QYFA 4ZC3A 3D5RC 3K70D 4D9JA 3HC7A 2LYCA 2KRCA 3OL3A 3CF2A 3CJQB 3EUKL 3TMOA 4KITB 4E7LA 2XSJC 2P0WA 2VJ5A 2IS1A 3BLYA 1WJEA 1MMNA 4E7KA 2KL4A 2CW7A 4XOTA 3H5NA 4XMYA 4DOZA 4YEJA 3F9KA 3V42A 3BCAA 4XOPA 1K6YA 2Z2SB 4BXFA 2X6XA 3OYGA 1MNDA 4RM3A 3M1CA 3OYMA 4LIVA 4BE2A 1BR2A 2PJRB 4BQQA 4KT6A 2VXZA 4PJJA 1TZLA 3DKYA 4DBRA 2WBMA 2Q1ZB 2Z16A 2GOXB 2KHMA 2VQCA 4F3QA 2HDWA 1UELB 2OUMA 2CV0A 3TL4X 4XLCA 2JUGA 4RLQA 4PFPA 2ZSHB 4B43A 4HSTA 4Y4RA 2BW3B 1OLTA 2LG4A 3CMMA 2BW3A 3K10A 3LL7A 1G59A 2NOJB 4XORA 2IGKA 2XDVA 3FDYA 2L7KA 2KZVA 3E1SA 2I8DA 1WJ5A 2X1DA 3DU6A 4E7ZA 4XQFA 3OOUA 3W2WA 2KLOA 3H5RA 1U0JA 1Z3XA 2MABA 2PMZA 1MMDA 3C2HA 1N77A 3OS2A 4JQFA 3SYTA 2R7QA 3CP8A 4BJ6C 3HL2A 3ZCOA 2R7SA 2VJ4A 4G6TB 4B3XA 2JSPA 3W2AA 2IS2A 3OS1A 5CKTA 2E5NA 2DT6A 4XKCA 4XKBA 3H9QA 3S93A 2UWMA 2X1EA 1D1CA 2ZSIB 3SEQA 1NG6A 2Q2EB 4NQWB 4RM2A 2ZXIA 3VSLA 4BUPA 2X51A 4C9YA 3OYKA 5FROA 2HNHA 4GRIA 1X1DA 3EPZA 3AKZA 2R7WA 4Y33A 3VSKA 2LREA 3HOSA 4CCNA 5FRMA 4ZTFA 2V6EA 2M7AA 2DJIA 2X6WA 3MKYB 3BC8A 1Y56A 2O5RA 3FKJA 2AQFA 1D1BA 2GOMA 4BEHB 4XR6A 3OIPA 2WAFA 2BOLA 3D5LA 4XL9A 5CPRB 2BVMA 4BEHA 3OYCA 1N75A 3PFYA 2KDOA 1E0EA 2OC6A 4XONA 1MMGA 3PNVA 2V4JC 1AA7A 3PUBA 4PUSA 4XLHA 1PJRA 2M4KA 5LD2C 3ZQQA 1X1CA 3QOEA 4II3A 4IQ4A 2R7RA 4ANJA 2WA0A 2HZDA 3PSIA 2CW8A 2VKDA 4E7SA 5LFAA 3VDXA 3SDBA 1YE9A 3OIQA 4BE1A 1TT0A 2RQQA 4PFOA 3TBIA 4ZDOA 3HPHA 3MKZA 4B48A 2Y0SA 5CQEA 4JOMA 4NNJA 4XLFA 3DTIA 3LMMA 3LSHA 1D0YA 4XLEA 2IGOA 4B47A 4HRIA 2DCEA 2WAQA 1BOBA 4LITA 2K9MA 3IAS2 2CUJA 4CCLA 4XLAA 2HVRA 4E7IA 2X1CA 2E60A 4IKFA 3DTKA 2XC7A 4ITVA 3FBNB 2HPMA 2LOOA 4YRVA 4J01A 2F5VA 5KNLA 2W1OA 2OV7A 3MMYB 4DBQA 3OYJA 4XN0A 5HVQC 4BACA 1T0FC 2HU9A 1QHHD 2LH9A 2VXDA 2RREA 4BQOA 2V7FA 3QODA 3K4MA 2MC4A 3AL0C 2R7UA 3DTEA 3DPUA 2VKHA 3FBIB 2ELJA 4XN3A 3S3MA 2PJRA 4AVZA 2X6YA 4BDYA 2E1MC 5HNHA 3GBGA 4QPQA 2HPIA 4Y3OA 5HLTA 4DGWB 1MNEA 3HUGB 3PSFA 3RTRA 3PJRA 3CP2A 4CCJA 3U21A 4IQJA 1G8XA 4NC8A 4CCKA 3KEYA 3RCOA 4P1WA 4HSRA 3LSKA 3HPGA 2A5WA 4J00A 2RNGA 3DWLE 1WJAA 2WY8Q 3K4NA 4NUBA 4PJLA 3OYAA 2ZFUA 3KYLA 4IX7A 2IS6A 2IGMA 2HVQA 3S3OA 3DU5A 3RPUD 3DEEA 4IZZA 3H9JA 3QYBA 1J09A 4ZJZA 1NG7A 4C30A 2VQGA 4F52A 3DLAA 3K6GA 3W2VA 3K4KA 2JVHA 3M8JA 4ZDPA 4BL0B 1IRXA 1LDKB 4B44A 1DGRM 2KRHA 4EATA 1QHGA 3DPTA 4H4KC 1Z21A 4OWRB 4PJNA 3L2UA 2CFOA 1N78A 3D5SC 4CH7A 1EA3A 2VIXA 1WJDA 4F91B 2DXIA 3HG9A 3DQVC 2IXSA 1X4PA 2WB1A 2DOAA 3VYUB 1VZ0A 4F93B 2M4GA 3HXLA 4OAZA 5JHFA 3OYFA 3IP4B 3VYSB 4U87A 2WADA 3LSGA 5KHDA 1S9HA 4PK4A 2X85A 3OY9A 2R7XA 2AQEA 2HVSA 3DKXA 1LKXA 4E6KG 2LRDA 2V9KA 2V26A 1V5FA 2W4SA 4ZDLA 4N4OB 2KQRA 4RMNA 4BJTA 2V1NA 2R7TA 1PYVA 1Z3YA 4AU7A 2VQHA 4LIUA 1WJCA 3PL8A 2LC2A 2QKLB 3N05A 4LG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZZ A;  3QOD A;  3QOE A;  4YRV A;  4J01 A;  4J00 A;  4HRI A; 
#chains in the Genus database with same CATH topology
 3BTJ A;  4BAY A;  1X3U A;  3FHN A;  5BMZ A;  1M1E B;  4Y15 A;  2PG4 A;  2VOD A;  2V9V A;  4KN7 X;  1KYW A;  1F36 A;  1YQA A;  3BPV A;  1ETX A;  3TED A;  3SEZ A;  3JRI A;  4KJZ A;  4I0B A;  4KNY A;  3RPQ A;  2VKE A;  2IAI A;  1P4W A;  2EFW A;  2CV2 A;  1QA6 A;  3W6K B;  4XRS G;  5L3B A;  1E2X A;  3RIR A;  2F5E A;  2VJI A;  1WWX A;  5HOD A;  3SDG A;  1OIS A;  4BDZ A;  2DTZ A;  2XRL A;  1A5J A;  4OMY A;  3ZXS A;  3V8K A;  2L9N A;  5IP6 A;  1N25 A;  2VAS A;  1KQ9 A;  4W97 A;  5GAG J;  2FMY A;  3I4P A;  2ID6 A;  3H3U A;  4ZTJ A;  2G0E A;  4HV6 A;  2ISZ A;  5BS6 A;  2VB6 A;  4RGX A;  1JHF A;  1WKM A;  1MDM B;  1JKP C;  4NHJ A;  1JHH A;  3LSI A;  4YIR X;  4E7J A;  2DYR H;  1NK2 P;  2LKP A;  2CU7 A;  4BE0 A;  2E71 A;  4G7O F;  5E1W A;  2JPC A;  3GME A;  2GAU A;  2L9R A;  3T1B A;  5JVG F;  4Q5S F;  5GP9 A;  2VOP A;  2NS8 A;  4XID A;  2K3F A;  4UY8 I;  5ERI A;  3BG6 A;  3HOT A;  1O3R A;  5J4V A;  4RAZ A;  2B7E A;  5D8L B;  2O61 A;  1T08 B;  3A1Y A;  2XAJ A;  3KX2 A;  1X1B A;  2IGN A;  4XNF A;  1H8A C;  2R5Y B;  3ONQ A;  4FTH A;  2EFP A;  4MIM A;  5FKO A;  4IO9 F;  1KGS A;  2JZY A;  3AAF A;  2EIK H;  3BG9 A;  2EIM H;  1U3E M;  2XPU A;  2Z5U A;  2L4M A;  5E3L A;  3TP0 A;  1ZR4 A;  3BQZ A;  2M34 A;  2CH0 A;  2M9H A;  1X19 A;  2IPQ X;  5E8I A;  1EV7 A;  1Y8Q B;  2VLA A;  5D8K B;  2CWE A;  1QZY A;  1VQM I;  3KYC B;  2XAU A;  4CDG A;  3HHH A;  2WY7 Q;  2XKP A;  1CGP A;  2IRF G;  4XLN F;  2JQ7 A;  4M3G A;  2DDB A;  4BGD A;  4O3M A;  5HOO A;  1FY7 A;  3BTL A;  5KK1 A;  1QVT A;  1Z67 A;  3QWL A;  2DPD A;  1MNM C;  1SFU A;  3KZY A;  3WHC A;  2E36 A;  1BM9 A;  4GCV A;  4E4H A;  1IN8 A;  4U88 A;  5HS9 A;  3I53 A;  4XKW A;  4OIQ F;  3LSJ A;  4RGS A;  2VN2 A;  5F0F A;  2A6H F;  1BI2 A;  5L3C A;  2JUC A;  3JRB A;  1VQ4 I;  4A3B J;  4DJA A;  1T33 A;  2GXA A;  1DUX C;  2QZ8 A;  4U0Y A;  5TJJ A;  2LNB A;  5TRD A;  4A3L J;  3K1M A;  5K1Y A;  4BU2 A;  1RR7 A;  5CVV A;  5F1J A;  1D0Z A;  2RDP A;  5B3S H;  3L09 A;  2ZBK A;  4DNC A;  2DMP A;  3LWF A;  1MMA A;  5ILU A;  3L2Q A;  4C2U A;  3COA C;  4RB0 A;  4ENJ A;  3M8F A;  3K4B A;  1HC8 A;  3FF5 A;  4GYG A;  4XKV A;  2FUG 2;  3F8C A;  1V5G A;  3HEF A;  2MYS A;  4U7D A;  4HNV A;  1P92 A;  4AM3 A;  1ITY A;  2BVL A;  1T8I A;  3EUA A;  4HG2 A;  2E1M B;  1AOY A;  2FX0 A;  3FIS A;  3C7J A;  2DYS H;  1OCR H;  4LD5 A;  2ZXH A;  2KJC A;  3KP2 A;  3MKW B;  4HDV A;  4ZYE A;  2CQX A;  4KA4 A;  1LVK A;  1JI8 A;  2QBY A;  3S1R J;  4LJZ F;  2DMU A;  5D5U B;  4WX9 A;  5DD4 A;  1R9T J;  2W82 A;  3VWB A;  3CLO A;  4NC7 A;  3E7L A;  1BC8 C;  5K5R A;  3GXO A;  3HC7 A;  2GLO A;  1SD4 A;  5A2Q K;  1XMX A;  2BXY A;  3TMO A;  1TTY A;  2P0W A;  2VJ5 A;  3KP6 A;  4WXD A;  1JKR C;  1MBJ A;  2XGX A;  5D6E A;  2HS5 A;  3IHU A;  2DK8 A;  2HOE A;  3CDL A;  3R6S A;  2A05 A;  2A5Y B;  2CW7 A;  4CZZ A;  3O8H A;  2PI0 A;  2P5V A;  1B9M A;  3CCM I;  1IXC A;  1MH4 A;  3I55 I;  4IHX A;  1I50 J;  3WU1 B;  1U5T C;  1IZ1 A;  3V42 A;  3ABM H;  3BCA A;  1K6Y A;  1LEB A;  1ENH A;  1ETQ A;  2K40 A;  1MND A;  2L0K A;  1S7E A;  4HYE A;  3OYM A;  4LIV A;  2OA4 A;  3QRF F;  2ELH A;  1ETV A;  4WWC A;  3LQR A;  1XN7 A;  4G6Q A;  2MBF A;  3HRM A;  4PJJ A;  3DKY A;  4DBR A;  1PUF A;  1C0W A;  1MMS A;  1F5T A;  3BQY A;  4O6J A;  3V7R A;  2NRA C;  4I0A A;  1IGN A;  3I59 B;  1VF9 A;  2MGQ A;  4LK0 F;  5AIP A;  1TQM A;  1K7A A;  1SFE A;  2ZFW A;  4F7Z A;  4EJU A;  3K10 A;  1QBJ A;  2XDV A;  2ZXJ A;  1GT0 C;  2X1D A;  2KZV A;  1WJ5 A;  4E7Z A;  5E3N A;  1K78 B;  3DU6 A;  2YS9 A;  4XRF A;  1ETK A;  4KT5 C;  5JLW A;  2IVM A;  4PGG A;  3I56 I;  1J9I A;  3C2H A;  4CYC B;  3ZP5 A;  5B5E C;  4CIC A;  3K2A A;  1OJL A;  1FP1 D;  2R7Q A;  4BJ6 C;  1X1P A;  3ZCO A;  1LPQ A;  4UVA A;  4EMS A;  5FB2 A;  1AHD P;  4L9N A;  5D5V B;  4G6T B;  1HF0 A;  2FNP A;  2JA8 J;  1JJ6 C;  3CO6 C;  2E5N A;  2DT6 A;  2DOF A;  3QQA A;  4UVB A;  2Y75 A;  5EGO A;  3S93 A;  3GX4 X;  1GDT A;  1J0R A;  2UWM A;  1FEX A;  2X1E A;  3BRO A;  1IUY A;  4DYC A;  1D1C A;  3GTL J;  3PUF A;  2P7C B;  2K27 A;  2Q2E B;  3BWG A;  1R5G A;  1XCB A;  5D4S A;  5CYV A;  1B1B A;  3FXO A;  3VSL A;  5DCM A;  4IHV A;  3WU2 C;  1SVL A;  4A0X A;  4C9Y A;  4ENM A;  1VQP I;  1WZ2 A;  1R7J A;  2AO9 A;  1P6R A;  3ABL H;  1R23 A;  4FHT A;  1DPR A;  3EPZ A;  3VSK A;  2LRE A;  3HOS A;  2BHZ A;  4V2F A;  4ZTF A;  3M4O J;  5IT9 K;  1YW8 A;  2ZJR F;  3DEW A;  2DJI A;  2XRN A;  4UNO A;  1JKO C;  1Y56 A;  1ETY A;  2O5R A;  5IY5 H;  4HAM A;  5HDN A;  2E19 A;  4XL9 A;  1O7F A;  5CPR B;  2BVM A;  1MKM A;  2HTJ A;  3OYC A;  3PFY A;  4EQQ A;  4A5N A;  4I2O A;  2LSO A;  3KP7 A;  4XON A;  4OIN F;  2KKO A;  3KEQ A;  4XLH A;  4MEY F;  2M4K A;  1XMA A;  1XMK A;  2VBW A;  3NAR A;  1J2X A;  3ZQQ A;  3F8F A;  1R4M B;  2GXG A;  5CVU A;  4L5J A;  1REP C;  2MLK A;  1J5Y A;  1SAX A;  2L7F P;  2VKD A;  5LFA A;  3HRU A;  3S2H J;  5CVI A;  1TT0 A;  1XG1 A;  2Y69 H;  4PFO A;  1YJ9 I;  3HPH A;  5A2Q Z;  4RAF A;  5LGN A;  5F6F A;  4UUT A;  5E1Z B;  3CME I;  3CO7 C;  1MZB A;  1YFH A;  4KIB A;  2ZJP F;  1RR8 C;  4EJT A;  2VC1 A;  1K4S A;  1ZKG A;  5BPI A;  1LNW A;  1YG2 A;  2GWR A;  3DCF A;  3WTW C;  4EGZ A;  3U1D A;  2DCE A;  4A3J J;  3GO5 A;  4XLP F;  1WHU A;  2K9M A;  1X3W B;  1ZGJ A;  4XLA A;  5E20 A;  1T56 A;  1OYW A;  1PDN C;  3DTK A;  3M9A A;  4L9V A;  1HBX G;  2XC7 A;  2CUE A;  2M0C A;  1K79 A;  2NVY J;  1QO0 D;  5GAE J;  5J8F A;  4YRV A;  3J7A O;  3MCZ A;  2F5V A;  4DBQ A;  4XN0 A;  5HVQ C;  5J8C A;  4HZF A;  2OU2 A;  4NDL A;  3HM5 A;  4Y7N J;  2Y2Z A;  1R4N B;  4I02 A;  4IHW A;  2LTP A;  4HF1 A;  3QOD A;  2XSD C;  3K4M A;  3AG4 H;  4RGR A;  3DTE A;  4WXH A;  1D8K A;  2VKH A;  2ELJ A;  2PJR A;  2H27 A;  2E1O A;  2X6Y A;  2XAS A;  2E1M C;  5HNH A;  1LFB A;  2HXO A;  3R60 A;  3L00 A;  4XSX F;  3G1M A;  1A31 A;  4Y3O A;  5HLT A;  3X2Q H;  2O8K A;  2MH9 A;  4ETS A;  3F0C A;  3DEU A;  2NNY A;  1MNE A;  2E1C A;  4UV8 A;  3CP2 A;  3HUG A;  4A6D A;  5M5W J;  1G4D A;  1G8X A;  2EFN A;  4NC8 A;  4CCK A;  4AID A;  4P1W A;  1DP7 P;  5DS9 A;  1T6S A;  3HPG A;  3GEZ A;  3Q3S A;  1Y0N A;  4PJL A;  2WY8 Q;  2O8X A;  3ZMT A;  4D5C A;  2ECB A;  2QVO A;  1P7J A;  4A69 C;  3RKX A;  4CYD A;  1IN7 A;  1UFM A;  1I39 A;  1XSV A;  2EFQ A;  1D5Y A;  4IZZ A;  2HFH A;  1HW5 A;  1WCM J;  4C30 A;  3EQL F;  2QEX I;  1W5C C;  1Y1W J;  2DI3 A;  1FTT A;  3DXJ F;  4F52 A;  3K6G A;  2ISY A;  1TNT A;  1H9G A;  3W2V A;  1P7I A;  2JVH A;  4ZDP A;  4AYB N;  4G8X A;  1IRX A;  4B44 A;  1DGR M;  2LY9 A;  3BJO A;  4KN4 X;  1EH7 A;  4OWR B;  5IT9 Z;  1K83 J;  1WGX A;  4S04 A;  4QTR A;  3H1C A;  2RKH A;  4I6Z A;  4P96 A;  2V6C A;  1WJD A;  1X3Z B;  2QCO A;  3ZQH A;  5K7Z A;  4Q47 A;  1K4T A;  2DFH A;  4M6X A;  1LQ1 A;  2MA3 A;  1VZ0 A;  3ISP A;  5CVJ A;  3HXL A;  2LKX A;  4HQM A;  5BNG A;  1RRJ A;  5JHF A;  2BY2 A;  4MTD A;  3OYF A;  3IP4 B;  2ME6 A;  3VFZ A;  2CQ7 A;  2WAD A;  1ON2 A;  2I5U A;  1S9H A;  2Z9O A;  2X85 A;  4LGW A;  2FQ4 A;  2R7X A;  3T0Y A;  2HVS A;  2ID3 A;  2QGU A;  2O0Y A;  1LKX A;  1POG A;  1TP4 A;  2EJR A;  4N0B A;  3IH2 A;  2R0Q C;  1O7L A;  3KE2 A;  2IEK A;  2V79 A;  4ZDL A;  4RMN A;  1CF7 B;  1Z3Y A;  1R1U A;  3PL8 A;  2LC2 A;  2QEN A;  5D5W B;  2LF8 A;  1H9T A;  4LG3 A;  2FSW A;  4M6V A;  4HX7 A;  4I76 A;  1ZEL A;  1IRF A;  4PGH A;  1AKH A;  4A2U A;  1BL0 A;  1IAW A;  2DT7 B;  4U0W A;  2JMW A;  5IYD J;  2KP6 A;  3S3N A;  5FD5 A;  2QYO A;  4J19 A;  2HGC A;  2LBF B;  2LFB A;  3HOV J;  3HKZ A;  2M5W A;  4BHB A;  3GTM J;  2JK3 A;  2KMU A;  1SMY F;  4A3M J;  2NOG A;  4JK1 X;  3L2R A;  2QWW A;  2EQR A;  2L9S A;  3CUQ C;  3OR2 C;  1IC8 A;  1KQ8 A;  4BBR J;  3Q5F A;  1FT9 A;  5C44 J;  2J5P A;  2A07 F;  2BY0 A;  3OYE A;  3P9C A;  3HJE A;  2VT3 A;  1KU3 A;  1WI9 A;  1BR4 A;  2JVG A;  2OF7 A;  3OYI A;  4BKX A;  3OYN A;  1U9O A;  3TO6 A;  5F0H A;  1LFU P;  2W25 A;  3VYT B;  3BCB A;  1RUO A;  3Q9V A;  2H6B A;  1MSF C;  3ASO H;  4X1E A;  3LFU A;  3PIP F;  2OAZ A;  5LGT A;  1KA8 A;  2M8G X;  2GIV A;  5H6R A;  1U8R A;  2ELK A;  2K9Q A;  3OWT A;  4XIC A;  2L7M P;  2R92 J;  1ERD A;  2XF7 A;  2LD5 A;  4RGU A;  1Z6T A;  4BQN A;  1ZRE A;  1ZN2 A;  4GXO A;  1FOY A;  3F72 A;  1IV6 A;  1WJB A;  3UR3 C;  2CFX A;  4ZYG A;  5E18 F;  3G2B A;  3SZP A;  3OYH A;  3BOQ A;  2R5Y A;  3I4M J;  1TNS A;  3ZN0 A;  1QPM A;  1IO2 A;  3B6C A;  3E5X A;  1Z6R A;  1B8I B;  1OR7 A;  3BR1 A;  2XF5 A;  1BA5 A;  4A5M A;  3BTI A;  2VKV A;  3E97 A;  3O6B B;  1KU7 A;  3E5U A;  1GUU A;  1ACI A;  3MFK A;  1O4X A;  1Y0U A;  2FRH A;  1LFP A;  5H6Q A;  1J7K A;  3CES A;  2B63 J;  2GA2 A;  5CLS A;  1SEU A;  4FX0 A;  3MKL A;  4V2G A;  2BY1 A;  2LY2 A;  4OU0 A;  1DDN A;  1ZRF A;  2PMZ N;  3HYI A;  3OYB A;  2PFB A;  3IH4 A;  2UV1 A;  1O3S A;  2A3S A;  2M7B A;  1GLN A;  2QF7 A;  3R0J A;  3LSM A;  1K6O A;  4JX5 A;  1P9Q C;  1R5H A;  2FJ1 A;  3E0J B;  1WH5 A;  4BXU A;  1TW3 A;  2UZK A;  1QZE A;  1Y6I A;  1HLV A;  4IRG A;  1BJA A;  2PMU A;  1S72 I;  4JP0 A;  1JUS A;  1KU9 A;  2H6C A;  4KMU X;  5IYC J;  4L18 B;  2W7N A;  1FBQ A;  1FIA A;  1VQ9 I;  2HOT A;  4ABZ A;  2ZC2 A;  1YYV A;  3RYR A;  1RNL A;  1W5T A;  2TDX A;  4A6E A;  3C2B A;  2JA7 J;  1BI0 A;  1WJF A;  4RLF A;  1T38 A;  3H0D A;  1SD6 A;  1SAN A;  2DFI A;  3BDD A;  5EZH A;  3Q0U A;  5M5Y J;  1Z7L A;  3RZD J;  1U5T B;  1BI1 A;  3E6M A;  3LA7 A;  1FOW A;  1HCR A;  2CMP A;  1NHA A;  3C2G A;  5HNF A;  1X1A A;  4BJ5 C;  1W36 C;  1VQO I;  4JBA A;  2XGD A;  3KEO A;  2XAF A;  3L2V A;  4E7H A;  1UAA A;  1FNN A;  2XF6 A;  5FKM A;  4G6D A;  1X2N A;  4QWQ A;  5B66 C;  3J7A Y;  1I6H J;  4ZH4 F;  4P5O A;  3G6E I;  1W36 D;  3UNG C;  3OSF A;  1JT6 A;  3IAM 2;  4CCM A;  5DDG A;  3S32 A;  5DM7 F;  1R71 A;  1QGP A;  1JJ8 C;  3FXQ A;  3TQN A;  1G3S A;  5CQG A;  4Z2Y A;  4LB5 A;  4A12 A;  2R7O A;  2JA2 A;  3WTY C;  4YFN F;  1MW7 A;  3KCC A;  3ULQ B;  2CO5 A;  4PZJ A;  3K69 A;  4D9J A;  3IKV A;  1YHQ I;  2KRC A;  1ZRC A;  3CF2 A;  3EUK L;  4KIT B;  4E7L A;  1YRN B;  3UKG A;  3T8R A;  3HRT A;  2IS1 A;  3BLY A;  3M3Y J;  1FBU A;  1Z91 A;  4E7K A;  2KL4 A;  2HKO A;  4L9T A;  4XOT A;  5BQT A;  5EG0 B;  3CCL I;  2DFE A;  3ELK A;  4KIC A;  4IXA A;  2WAQ N;  3F9K A;  4DOZ A;  2DLL A;  3GFL A;  1IJW C;  1ZLK A;  2GQQ A;  4OIP F;  4XOP A;  4BXF A;  5FKN A;  4JYK A;  5EYR A;  4N9H A;  1UHW A;  3LQQ A;  4NBQ A;  2HDD A;  3BR3 A;  5JLX A;  3HBL A;  4BQQ A;  4KT6 A;  3ZQG A;  2EV5 A;  2OZU A;  2K02 A;  5DV5 A;  1HKS A;  1JTX A;  1UEL B;  2OUM A;  3ASN H;  5J3L A;  3ZOB A;  4XLC A;  2CV0 A;  2DAO A;  4RLQ A;  4PFP A;  1YLF A;  3U1K A;  3I59 A;  2ZSH B;  3QPH A;  1F1Z A;  1FOX A;  2LR8 A;  4M73 A;  2BW3 B;  3SZT A;  2JA6 J;  1FP2 A;  2LG4 A;  3LL7 A;  2G9W A;  1MJ9 A;  3H0G J;  3TW7 A;  3D1N I;  2D45 A;  3BR6 A;  2HTS A;  4XQF A;  2F4M B;  2FBI A;  2X0L A;  3W2W A;  2KLO A;  3FHZ A;  1K78 A;  2E34 A;  3F8B A;  2LMD A;  1MMD A;  3R4K A;  5F0C A;  1Z77 A;  2YPR A;  4CYC A;  2VOO A;  3JRE A;  3SYT A;  3HL2 A;  2R7S A;  4WCG A;  4C3H J;  4B8X A;  5LRR A;  4KIF A;  4G9Y A;  4A93 J;  3QPS A;  1LE8 B;  4XSZ F;  1WI3 A;  2O9L A;  3HOZ J;  1LJ9 A;  2ZSI B;  3HGY A;  4LMY A;  4RM2 A;  2Q2E A;  3BT9 A;  1BN5 A;  3OYK A;  2ACJ A;  1X1D A;  1G3T A;  4MO7 A;  5FFX A;  4Y33 A;  1ZQ3 P;  2K86 A;  1E3P A;  1BIA A;  4L5I A;  1FYL A;  1VI0 A;  3FM5 A;  4IEJ A;  1OMI A;  2CSO A;  5B1B H;  2DT5 A;  2K7L A;  3QOP A;  2X6W A;  1XB4 A;  3R61 A;  4G7H F;  1B72 A;  1L0O C;  4LG0 B;  5DYM A;  4XR6 A;  4UHT A;  2WAF A;  3LA3 A;  4G94 A;  4BXX J;  3DBH B;  2WB1 N;  4XK4 A;  2EB7 A;  2VBY A;  3I0T A;  4GGG A;  3KIO A;  3E6B A;  4LLN A;  3PNV A;  4FCY A;  2DMQ A;  2V4J C;  3QP6 A;  5M3M J;  3D0S A;  1BW6 A;  3SQN A;  4II3 A;  2CQN A;  2R7R A;  3MQ0 A;  3PSI A;  1LDD A;  2CW8 A;  4E7S A;  3ECH A;  3CCU I;  3OIQ A;  3V8L A;  4BE1 A;  1DU0 A;  4XRS A;  5L3G A;  9ANT A;  3OOP A;  2ZB9 A;  4JOM A;  4NNJ A;  1O3Q A;  2R5Z B;  3LSH A;  3DLL F;  2EZL A;  1VND A;  4XLE A;  4ESJ A;  3KFW X;  2IGO A;  3F8N A;  3G73 A;  4KMF A;  4B47 A;  2UXN A;  1EH8 A;  1A04 A;  1JUP A;  4M3B A;  4HRI A;  2PBI A;  4KIG A;  4MHG A;  3IAS 2;  2HVR A;  2P6T A;  2E7X A;  5L3E A;  1XD7 A;  2X1C A;  4E7I A;  1A36 A;  2DTR A;  4EJO A;  1G6N A;  3Q9S A;  2DU9 A;  3GTO J;  4K2E A;  3ABU A;  3FWE A;  2HPM A;  1IXS B;  2LOO A;  3HIF A;  4J01 A;  3RYP A;  5LHG A;  2OV7 A;  4BAC A;  5IP9 J;  1QRY A;  2CW0 F;  1T0F C;  1QHH D;  2HU9 A;  3WTX C;  3QU6 A;  2EBI A;  3HRS A;  1JXS A;  2V7F A;  2P5K A;  3IKT A;  4FQG A;  3DPU A;  2BBY A;  5EJC A;  3F23 A;  4XN3 A;  2M2E A;  1HST A;  3N4M A;  1YIO A;  3E6C C;  3CUO A;  4Z6Y A;  3G1L A;  4DGW B;  3AG2 H;  5FFZ A;  4Y52 J;  2EZI A;  2MH2 A;  4ENN A;  2KIQ A;  2KIM A;  2YU9 J;  2D1H A;  2EIN H;  2HYJ A;  1XTA A;  1TC3 C;  3BZK A;  3NQO A;  1OCZ H;  3U21 A;  4D5F A;  4IQJ A;  2FD5 A;  5KAF C;  3KEY A;  1W0T A;  3LSK A;  2A5W A;  1QZZ A;  2XPV A;  5C4J J;  1WQ2 A;  4Y13 A;  2RNG A;  1WJA A;  2YUS A;  3ABK H;  3K4N A;  4RAY A;  3SJM A;  3IRR A;  4C2M J;  4MEX F;  3GTJ J;  2XAG A;  1ZR2 A;  3E6D A;  2IGM A;  1ZGW A;  2MG4 A;  1FBS A;  1MD0 A;  2IW5 A;  2KIS A;  3DU5 A;  3WGH A;  1UHM A;  3DEE A;  1VQ7 I;  4CO8 A;  1KU2 A;  4M9X A;  1J09 A;  2HQN A;  2X9D A;  2OCE A;  3BR2 A;  2VQG A;  1Z1D A;  3WG9 A;  1Y1V J;  1IRZ A;  3FXL A;  3WHB A;  4XBF A;  1F43 A;  5ED4 A;  3K2Z A;  3M8J A;  4FX4 A;  1U8B A;  4BL0 B;  2DJN A;  1T2K A;  1LEA A;  5JHU A;  1QHG A;  2A6E F;  5M3F J;  1NTC A;  2OCC H;  4H4K C;  4UB8 C;  4KFC A;  1Z21 A;  1D5V A;  3L2U A;  5IYB J;  3JSP A;  2VI6 A;  4UUS B;  1X4P A;  5E79 C;  2IP2 A;  2QQB A;  4PJ0 C;  3ABT A;  5C3E J;  4CHU A;  4OAZ A;  1TL8 A;  3CUQ B;  4OIR F;  5BPD A;  4AWX B;  4IL6 C;  4M6Y A;  2B0L A;  4HF0 A;  4A3I J;  3LSG A;  2XAQ A;  2LDU A;  4QSH A;  3HSE A;  1XGO A;  4LOC A;  3A0B C;  3JW4 A;  2PJP A;  2KRF A;  3BG5 A;  1OYI A;  4E6K G;  1KYZ A;  2DOD A;  4OOI A;  4RB2 C;  4BJT A;  3L2C A;  2V1N A;  3LNQ A;  2AHQ A;  4W1U A;  1CF7 A;  3BR5 A;  2HI3 A;  3KP3 A;  3KP4 A;  1NK3 P;  2NS7 A;  2DW4 A;  3N05 A;  1IRG A;  3A4C A;  1ZGA A;  2P5L C;  2FU4 A;  2NVU B;  2XIG A;  1A6I A;  5HDK A;  3ZRG A;  4FAS D;  5FLX K;  3A02 A;  4BHP A;  1WRJ A;  2I10 A;  3H9G A;  3K4C A;  2HQ5 A;  2LY1 A;  3EUH C;  2XB0 X;  4AC0 A;  1RIO H;  5EZG A;  2JSC A;  3JTH A;  1WFX A;  2FF4 A;  2FXA A;  2LBF A;  5JI6 A;  5JVT A;  4CA0 A;  1D1A A;  5HLG A;  1T39 A;  2KJB A;  3GFJ A;  2CGP A;  2H09 A;  3GF2 A;  5TGT A;  3FXR A;  4FIS A;  2F5C A;  3F8M A;  2VQL A;  1I1G A;  2A6T A;  2KT0 A;  3WOD F;  4HF2 A;  4OIO F;  1I3Q J;  2CUZ A;  2ECC A;  3H35 A;  3VYR B;  2ZKZ A;  1ZG5 A;  1MBE A;  1Z9C A;  2QM3 A;  3TO9 A;  3ZR8 X;  4ZYA A;  4HX8 A;  3CDH A;  4QIW N;  3TGN A;  3J80 Z;  2ZME B;  4Q48 A;  5ILV A;  1X4O A;  3H5A A;  1QU3 A;  2VT2 A;  3KYD B;  4A3F J;  2OTL I;  4H0E A;  1U6G A;  5J6X A;  2XVC A;  1Q1H A;  3K4L A;  5AIQ A;  2DFF A;  2XGC A;  2F4I A;  4X0G A;  2ME0 A;  2XPW A;  5FRN A;  1E3H A;  2ZJ2 A;  4AD9 A;  2HEO A;  2JN6 A;  3GFM A;  5H20 A;  3I9V 2;  2VC0 A;  1SFO J;  1R1T A;  1X2M A;  2MSY A;  1NH3 A;  3CCQ I;  3FXK A;  3PQJ A;  2EV0 A;  2F2E A;  1B59 A;  5B1A H;  4AYB A;  4BS9 A;  2VPR A;  1ETO A;  5TIS C;  2QQ9 A;  3LSP A;  3HSF A;  3RJP A;  1TWH J;  2LKS A;  3NWT A;  5EF6 A;  1YO5 C;  4CZC A;  1SFK A;  5L3D A;  1FWZ A;  3IRQ A;  1B8I A;  5M5X J;  3J81 K;  3B73 A;  3I5U A;  3S2W A;  3BG3 A;  4RA2 A;  1U78 A;  2Z1D A;  3Q0W A;  1Y39 A;  3A01 B;  4WF2 A;  3NEU A;  5K5Q A;  5AON A;  3CDI A;  5FLV A;  4YFX F;  2BYV E;  2H1K A;  4FET A;  3G3Z A;  4F55 A;  3RKW A;  1SC7 A;  4PSX A;  3FK6 A;  2EA4 A;  2RAE A;  3WTT C;  3FK7 A;  3RKQ A;  3W3C A;  2M30 A;  2K85 A;  4MLO A;  2ICW G;  4P9F A;  4WXC A;  3CTA A;  2HYF A;  2M8E A;  1TW2 A;  4HEA 2;  1IW7 F;  2DMT A;  2W00 A;  4YII A;  1LUJ B;  3OR1 C;  4YEL A;  2Q0O A;  5KCM A;  1ZAO A;  2EWN A;  1TWC J;  1KON A;  1RC9 A;  3RQ4 A;  1TWF J;  1GV2 A;  3WTZ A;  4B1R A;  2EPF A;  2IS4 A;  3PQK A;  3OMY A;  2ZXW H;  3CC2 I;  3SHF A;  2PEX A;  2NVT J;  2JRM A;  3CZ6 A;  1TQI A;  1OKR A;  1W7P B;  2CQQ A;  3DV8 A;  1XGS A;  1XPX A;  2K4J A;  1ZTR A;  5HS7 A;  5DM6 F;  2R7V A;  4AIJ A;  3S15 J;  3OYL A;  3VOD A;  1ZG3 A;  2EIL H;  4IOC F;  1FPQ A;  4OAY A;  2K9L A;  1S5L C;  2KPM A;  5FLX Z;  1YW7 A;  3MD2 A;  1EJ9 A;  1U5T A;  3ZPL A;  3FMR A;  1S7O A;  1T0F A;  4BHC A;  2LP0 A;  2HKX A;  2XUB A;  4C3I J;  3OL4 A;  1T95 A;  2OD5 A;  1G3W A;  4KIS A;  2H1L A;  2D1V A;  2HZT A;  1JUM A;  1Q1V A;  3TOB A;  3NRV A;  3LAJ A;  2N8G A;  4II2 A;  2JPB A;  1FC3 A;  2Y30 A;  2R7D A;  4S05 A;  2Y9Z A;  2MFZ A;  2K9S A;  5BOX A;  3KET A;  2L3D A;  2KIF A;  4E70 A;  3K70 C;  4N4N B;  2ZNY A;  1RKT A;  3WE3 A;  2WAE A;  2OZ6 A;  1IN4 A;  2VJJ A;  5LEJ A;  3JTG A;  1HDD C;  4C2T A;  2HOS A;  3QP5 A;  2VPL A;  2V1U A;  3CQZ J;  5LRS A;  3L2W A;  3QYF A;  3ML6 A;  3D5R C;  4HOB A;  2KFD A;  4ZC3 A;  3K70 D;  2LYC A;  3GWZ A;  3PO2 J;  1UG2 A;  2AXT C;  3CMA I;  5LLQ A;  3CJQ B;  2XSJ C;  3E3V A;  1S8N A;  3WU0 A;  1YRN A;  2CQK A;  3BTC A;  1MMN A;  1BBY A;  5HDG A;  2FQ3 A;  5ICF A;  3E5Q A;  3H5N A;  2DN0 A;  4XMY A;  2X48 A;  3I58 A;  4IOA F;  4JX6 A;  1HW2 A;  1Z7U A;  2PMH A;  2DA2 A;  1MSE C;  1MDM A;  1S6L A;  2X6X A;  3OYG A;  2NNN A;  4RM3 A;  3HOU J;  1BR2 A;  3MZH A;  2PJR B;  3G1O A;  1XSX A;  1QVU A;  2XB5 A;  2VXZ A;  1TZL A;  1UMQ A;  4FE7 A;  1HKT A;  3RQI A;  2Q1Z B;  2Z16 A;  3PIO F;  1VQL I;  3KLO A;  2KHM A;  2D5V A;  2WTE A;  1FIP A;  3QAH A;  2HDW A;  2Y31 A;  3TL4 X;  4BH9 A;  3S1Q J;  2JUG A;  3J81 Z;  5LHI A;  3HZJ A;  5E1X A;  4ESB A;  4HST A;  1YS7 A;  4Y4R A;  3CMM A;  2BW3 A;  2NOJ B;  3CC7 I;  2ZCW A;  2L7K A;  2I8D A;  3K1P A;  2C6Y A;  3F21 A;  1BC7 C;  5DUI A;  3H5R A;  3CD6 I;  1U0J A;  3ZMU A;  4HDU A;  2TCT A;  2MAB A;  3DBR B;  3FKI J;  2PMZ A;  3GYH X;  3OIO A;  2DOE A;  2VUM J;  2W48 A;  4FE4 A;  1UCR A;  3TP3 A;  3P5J A;  2FNA A;  5E3M A;  3S2D J;  3H36 A;  4KDP A;  1JT0 A;  3TKY A;  2ZME C;  3W2A A;  3CC4 I;  1P4X A;  2IS2 A;  1W0U A;  3OS1 A;  2XAH A;  5CKT A;  3I4N J;  1IDZ A;  5L3F A;  4B09 A;  2LVS A;  4YIF A;  5HLH A;  1I3A A;  1FLI A;  1LE8 A;  1A6Q A;  3SEQ A;  3G71 I;  2PX9 A;  4BYY A;  1NG6 A;  4NQW B;  4ZYD A;  1GXQ A;  2NAZ A;  4BQA A;  1OCO H;  3JR9 A;  4BUP A;  2X51 A;  5D4R A;  2BHY A;  3GW2 A;  5F08 A;  3AKZ A;  4CCN A;  1FTZ A;  1IF1 A;  2V9P A;  3IWF A;  2QLZ A;  3HSR A;  1MJA A;  4RS8 A;  3U9G A;  5GAD J;  3NAU A;  4RBO A;  3MKY B;  3BC8 A;  3FKJ A;  3Q0V A;  1D1B A;  2Z99 A;  4BEH B;  3BP8 A;  4HQE A;  3D5L A;  1ZYR F;  4LG0 A;  3K0L A;  5J47 A;  1MIJ A;  1N75 A;  1S29 A;  2F48 A;  4RDU A;  2H8R A;  2L02 A;  2KDO A;  2RVC A;  1P2F A;  1MMG A;  2EZK A;  1AA7 A;  2IA2 A;  3KPH A;  5LD2 C;  4P9U A;  3HOX J;  3CCE I;  1X1C A;  1HXD A;  2DBB A;  2WA0 A;  1R36 A;  5EEG A;  2ESN A;  3LST A;  3SDB A;  2RQQ A;  3TBI A;  4ZDO A;  2FML A;  3GTK J;  1OCT C;  3WTU C;  2IJL A;  3J7Y J;  2JWT A;  1WH7 A;  4XLF A;  4YG2 F;  5DCF A;  3A03 A;  2QQA A;  3K7A J;  4O5V A;  4ON0 A;  1FYM A;  2HDC A;  2R5Z A;  1IN6 A;  1AKH B;  2Y0M A;  1MJB A;  4LK1 F;  2GIZ A;  4ZYH A;  2RC4 A;  1VQN I;  3K9T A;  5CVR A;  1SMT A;  2WAQ A;  3F22 A;  3OSG A;  3ZMD A;  1H88 C;  1ETW A;  5ICG A;  1BOB A;  4LIT A;  2CUJ A;  1GVJ A;  2KDZ A;  2R93 J;  1I27 A;  3PM1 A;  2E60 A;  3WGG A;  4EM0 B;  4IKF A;  1V3F A;  1W5S A;  3FBN B;  3CCR I;  1W4M A;  2Z3Y A;  5J1Y A;  5KNL A;  1W7P D;  2JRT A;  2F4O B;  2LH9 A;  3DFG A;  1S3J A;  2F5F A;  4Q4Z F;  3CLQ A;  2O6G E;  3FZV A;  1FSH A;  3W6J B;  2XKO A;  3FBI B;  2VE9 A;  3S3M A;  4EEF G;  4AVZ A;  4BDY A;  1IDY A;  1U2W A;  1STZ A;  3DKW A;  4AUX A;  2H8W A;  2CYY A;  3IH3 A;  2HPI A;  2STT A;  3CJN A;  2R7Z J;  3MWM A;  3F6O A;  6PAX A;  2P4W A;  3EET A;  4YFK F;  5LBQ A;  2ESH A;  1AWC A;  4A3D J;  2BXZ A;  4M72 A;  3BZC A;  2NYX A;  2W85 A;  3WG7 H;  4V19 K;  4X6A J;  2HOA A;  3RCO A;  1ZRD A;  2HXI A;  1P4A A;  3M1E A;  2GBY A;  3DWL E;  2EV6 A;  3RKY A;  4ASN A;  2BZT A;  5LHH A;  3OYA A;  2IS6 A;  1QNT A;  2YX7 A;  1YIJ I;  2E2I J;  5DUK A;  2A69 F;  1IG7 A;  1FYK A;  5K7F A;  3TW6 A;  3S3O A;  4LB6 B;  3JCU C;  5FO5 A;  1JE8 A;  3RPU D;  4L0Y B;  1ZK8 A;  1ZH5 A;  5ICE A;  1SVM A;  2DMN A;  3H9J A;  4ENK A;  2WC2 A;  5F64 A;  4DYQ A;  3S17 J;  4HLX A;  1KZH A;  3L1P A;  3DLA A;  3CCY A;  3K4K A;  1SD5 A;  1V54 H;  2VBX A;  2LK2 A;  2QUF A;  2KRH A;  3M07 A;  5ILS A;  3W6V A;  5LGU A;  3DPT A;  2DA7 A;  3FX3 A;  2V1X A;  3GVA A;  2CFO A;  5EDN A;  3D5S C;  1EA3 A;  2VE8 A;  2VIX A;  1HSJ A;  5DEQ A;  3T5X A;  4F91 B;  1V4R A;  1ONV A;  3DQV C;  4NB5 A;  2IXS A;  3F3X A;  2WB1 A;  1H0M A;  4UUS A;  5DTD A;  2HYG D;  3VYU B;  3HB9 A;  3O3K A;  3T8T A;  4F93 B;  3JAM Z;  2M4G A;  3M8E A;  4EJW A;  4I99 C;  1R00 A;  5E17 F;  4R8H A;  2P81 A;  3CUQ A;  4EM1 A;  4U87 A;  4UB6 C;  2IT0 A;  3I64 A;  1QQI A;  4L9J A;  2HQR A;  4M74 A;  4AIK A;  1JGG A;  1W1W E;  2AQE A;  5E3O A;  2UXX A;  3LSR A;  1I6X A;  1HOM A;  2X4H A;  1LB2 A;  2PLY A;  3GZN B;  2LRD A;  2V9K A;  2JTV A;  2V26 A;  1MBF A;  3EYI A;  1V5F A;  1JTY A;  2LF7 A;  2W4S A;  3GZ6 A;  5GTI C;  1E17 A;  1R49 A;  5GAH J;  3OV8 A;  2R7T A;  1PYV A;  4JX4 A;  2JT1 A;  1O3T A;  2ZNZ A;  1BW5 A;  4AU7 A;  4LIU A;  1WJC A;  2YSR A;  3PO3 J;  1BOA A;  2L2O A;  2K5C A;  3ZQI A;  2FBH A;  1RES A;  4HPQ A;  4P55 A;  2M3A A;  4M71 A;  2RN7 A;  3K4J A;  2NXN B;  1MBG A;  2A61 A;  1PVE A;  3P7N A;  1UG0 A;  4IVN A;  1XGN A;  2F5D A;  3RI4 A;  2Y48 A;  2L01 A;  2W57 A;  2MW8 A;  1VQ8 I;  1ZHF A;  5GTH C;  2GM4 A;  2CJJ A;  5FKL A;  1VFC A;  2YR2 A;  1VQ6 I;  3MZY A;  1VQ5 I;  2M0M A;  1H89 C;  2CS3 A;  1YW9 A;  2COB A;  4IHT A;  3P9I A;  1YOV B;  1YIT I;  3IUO A;  3MVP A;  1U9N A;  1Z05 A;  4IHS A;  4I09 A;  3EDP A;  4NC6 A;  1DGW Y;  1BR1 A;  2HQA A;  4XM3 A;  4RB3 C;  2QKM B;  4ESF A;  2J5O A;  2LLK A;  2QSF X;  2QQ8 A;  3V7S A;  5E8G A;  5FJ8 J;  2ZME A;  1SAU A;  1TT5 B;  3MEX A;  1ZLJ A;  4QPO A;  3ZQF A;  3ZN1 A;  3BPX A;  4F92 B;  2HR3 A;  4CUG A;  3QYE A;  3J80 K;  3HHG A;  4KYW A;  1V5E A;  4Y17 A;  4D7M A;  1YJW I;  4G12 A;  1IV8 A;  4CCO A;  1RKW A;  1HA8 A;  3GLX A;  3SXY A;  2F6C A;  3DF8 A;  4CSW A;  3H92 A;  2MD0 A;  3O8G A;  2FBK A;  3C18 A;  2Z33 A;  3PNY A;  1GHC A;  3CJR B;  4M3F A;  5HS8 A;  1OFC X;  2JJ7 A;  4M9S A;  1FSE A;  3ESW B;  2AXL A;  1ODD A;  2P6S A;  2P8T A;  4PJM A;  5FKK A;  1GXP A;  1V55 H;  4B4C A;  3P9K A;  2UUZ A;  1CQT A;  3FIW A;  4UVC A;  3JSO A;  2DPU A;  3S16 J;  3NWS A;  2IA0 A;  2DA6 A;  1GVD A;  3JRF A;  3AFH A;  4DIQ A;  3A01 A;  5KAI C;  1HQC A;  2VL8 A;  1XS9 A;  3S1N J;  1PP7 U;  3HOW J;  1USS A;  4UUV A;  2Q8K A;  3FXU A;  1FMV A;  3I3L A;  5J40 A;  2EZH A;  5GPA A;  2IA1 A;  4A0Y A;  3BY6 A;  4PSW A;  5FGM A;  4HNT A;  5F1R A;  3RZO J;  3BR0 A;  5FD6 A;  2FOK A;  1OPC A;  3TDZ C;  4HV5 A;  1OQY A;  4IPA A;  2E1N A;  5FLM J;  1VQK I;  1YS6 A;  2GA1 A;  4DW6 A;  1YX5 A;  3ZMS A;  1OCC H;  4GDF A;  2DDA A;  4LLG F;  4M3D A;  1I5Z A;  1UZC A;  4MQ9 F;  4PCQ A;  4D1Q A;  5GPC A;  2E35 A;  2H94 A;  3ROU A;  2L5Q A;  4MGR A;  2XRO A;  2QSH X;  3B6A A;  3SZG A;  3ERM A;  1FMW A;  1SFX A;  2OPT A;  3ZGK A;  2FA5 A;  4L0Z B;  1EF4 A;  2NVX J;  2KZG A;  2CV1 A;  4U7B A;  1ON1 A;  2MLG A;  3S14 J;  4XRM A;  3WTV C;  1KQ0 A;  2E5Z A;  3I71 A;  4MQV A;  3VEP A;  3JRD A;  1OR7 C;  1B72 B;  2GZW A;  1ULY A;  3S8P A;  1W7P A;  3CCS I;  2OQG A;  3FXM A;  2W84 A;  1R6R A;  1D0X A;  5D6F A;  1XDS A;  2RNJ A;  2NVQ J;  4R79 A;  3DPL C;  3GTQ J;  1DP3 A;  3AL0 B;  2OJE D;  3RSN A;  4MFE A;  3A0H C;  3J7Z I;  1UHS A;  3OYD A;  2R4G A;  1TLH B;  3A2K A;  2DQR A;  4A3C J;  1YX3 A;  5K5O A;  4DYR A;  4HNU A;  2BGC A;  2QA4 I;  3ZQL A;  4HA8 A;  4KUM A;  3GTG J;  2QBY B;  1BJZ A;  5H2F C;  1HDP A;  1X58 A;  1XGM A;  5CJ9 A;  5F04 A;  3PNT A;  4LFU A;  2CRG A;  1YI2 I;  3GLL A;  5EEH A;  2K3P A;  1TWG J;  3OS0 A;  1DQU A;  3BG7 A;  5IOY A;  4A3G J;  5IT3 A;  2E7W A;  4FT8 A;  4M9Z A;  2K4B A;  3OL3 A;  3MN2 A;  4ZZL A;  1EH6 A;  3V4G A;  2L54 A;  4I98 B;  5DD8 A;  3RPU A;  2DA1 A;  2KIU A;  3TOA A;  1WJE A;  3SFZ A;  1XC5 A;  2XGE A;  1L3L A;  3WE2 A;  1BIB A;  4GO1 A;  4D0P A;  1D3Y A;  5JR3 A;  2CUF A;  3H3Z A;  3FMS A;  1E3O C;  1RET A;  4YEJ A;  4BY1 J;  4OMZ A;  2WV1 A;  5IOZ A;  2Z2S B;  2RQP A;  4S0H B;  4HW0 A;  1IXR C;  3M1C A;  4BE2 A;  4BNC A;  1MGT A;  4TV7 A;  4EJV A;  3IV5 A;  1PUF B;  3EYY A;  2DA4 A;  4CGZ A;  2VBZ A;  2TRT A;  2WBM A;  1T98 A;  3N97 A;  3CMY A;  2GOX B;  3S1M J;  3GUD A;  2VQC A;  4F3Q A;  1D8J A;  2M1B A;  3PFI A;  4B43 A;  3GZ5 A;  4MFD A;  1LDJ A;  5IPA A;  1OLT A;  1R5I D;  1EKE A;  4U0V A;  1G59 A;  4XOR A;  2IGK A;  3BZ6 A;  3M7G A;  3FDY A;  3E1S A;  5D5X B;  3OOU A;  1Z3X A;  1XCV A;  3HTS B;  2AS5 F;  2EK5 A;  2O7O A;  3G4S I;  3VPR A;  3I54 A;  1N77 A;  3OS2 A;  1O57 A;  4JQF A;  1JKQ C;  3CP8 A;  5K7H A;  3AG3 H;  3AG1 H;  2VJ4 A;  1QPI A;  4B3X A;  3LOC A;  2PN6 A;  2JSP A;  5J1U A;  2R7F A;  4C3J J;  4IHY A;  2EH3 A;  4M3E A;  4AIH A;  2EIJ H;  4XKC A;  4XKB A;  5EGO B;  4MNU A;  3H9Q A;  3HTU A;  2DK5 A;  3TDU C;  4D7N A;  4IRI A;  1OCP A;  1FZP B;  2G7U A;  2M45 A;  2X6O A;  3QU3 A;  3L9F A;  3MAJ A;  3GCM A;  5KVR A;  2V1D A;  2ZO4 A;  1S7A A;  5DCM B;  2ZXI A;  1F4K A;  2BE5 F;  4HX4 A;  4NQW A;  2OBP A;  3BJA A;  1R22 A;  1ZG1 A;  2BY3 A;  5FRO A;  1Z0X A;  2HNH A;  4GRI A;  5C4X J;  1RUN A;  2PQ8 A;  2DO7 A;  2R7W A;  3FXJ A;  5FRM A;  2V6E A;  2M7A A;  5IP7 J;  2WWY A;  1WPK A;  3JRG A;  2AQF A;  2XV4 S;  3CJT B;  3DBL B;  2GOM A;  2EA2 A;  3OIP A;  4UV9 A;  2BOL A;  2O03 A;  1LVA A;  2CG4 A;  4BEH A;  1XSD A;  2K9N A;  3V8J A;  2BEO A;  2OC6 A;  1E0E A;  4MTE A;  4B3A A;  1RI7 A;  3PUB A;  4PUS A;  1PJR A;  3FM3 A;  4PDK A;  3QOE A;  2O3F A;  4IQ4 A;  2DA3 A;  4ANJ A;  2HZD A;  3GFI A;  4IF4 A;  1GV5 A;  1JGS A;  3VDX A;  1YE9 A;  5J4Y A;  3SFI A;  3H3V K;  3MKZ A;  2L9V A;  1BI3 A;  4B48 A;  2RV8 A;  2Y0S A;  2A68 F;  5CQE A;  1FX7 A;  2STW A;  3QPT A;  3DTI A;  1DU6 A;  3LMM A;  4DQ2 A;  1D0Y A;  3IWZ A;  2G7H A;  1B9N A;  1G2H A;  5J1R A;  2L4A A;  1FOK A;  3CCJ I;  2BV6 A;  2Y0S N;  3HDD A;  3ZQ7 A;  4CCL A;  2VON A;  1OYY A;  2DA5 A;  4HBL A;  4G7Z F;  2QSG X;  1MH3 A;  3B02 A;  2MC3 A;  2FEZ A;  3F6V A;  3QPL A;  1HKQ A;  4EM2 A;  4I7H A;  4BY7 J;  4ITV A;  5EG0 A;  1A35 A;  5HLI A;  4A0Z A;  3CF5 F;  1R58 A;  2ETH A;  2W1O A;  3MMY B;  3OYJ A;  4A3K J;  2MD5 A;  4R1H A;  3HKZ N;  2FE3 A;  2HWV A;  2VXD A;  3KP5 A;  2RRE A;  1VTN C;  4UXN A;  4BQO A;  3JRA A;  2E2H J;  3TO7 A;  2MC4 A;  3HGG A;  3AL0 C;  2R7U A;  1R1V A;  1G3Y A;  2E2J J;  1RPW A;  1PP8 F;  1SD7 A;  5ICC A;  1J59 A;  1I1S A;  3GBG A;  3L7W A;  4QPQ A;  1MBH A;  3IL2 A;  1TWA J;  3VOE A;  1IN5 A;  1B4A A;  4IRH A;  3HUG B;  4QLC U;  3PSF A;  3RTR A;  3PJR A;  3R0A A;  2P7V B;  3K1N A;  4CCJ A;  3GTP J;  1SVO A;  2RGV A;  4EVI A;  4GFB A;  3KZZ A;  1TBX A;  2YU3 A;  1Y8R B;  4HSR A;  3BJ6 A;  1DPU A;  1J75 A;  4J00 A;  2D2W A;  4NUB A;  4DZP A;  2ZFU A;  3KYL A;  4IX7 A;  4RB1 A;  3ZQC A;  1UJ8 A;  3O2P E;  2HVQ A;  1TQP A;  1UST A;  2WV0 A;  4LLL A;  2XHK A;  3ECO A;  3QYB A;  2B9S A;  1FJL A;  4ZJZ A;  1NG7 A;  2ADU A;  3WTS C;  4CXF A;  3DP7 A;  1XX5 A;  1IUF A;  3ERE D;  1F9N A;  1HW1 A;  1LDK B;  2Y9Y A;  4DZJ A;  1B6A A;  2W24 A;  4EAT A;  1AU7 A;  3VB2 A;  1UB9 A;  4EGY A;  3LA2 A;  4PJN A;  1N78 A;  1WSU A;  4CH7 A;  3MZ8 A;  3ZMZ A;  1APL C;  3C3W A;  3FMQ A;  2OTJ I;  4WK8 F;  4HLY A;  2DXI A;  3HG9 A;  1YTY A;  2GXB A;  2COM A;  3EUH A;  2DQL A;  5F27 A;  3V7C A;  2DOA A;  2YX4 A;  3KZI C;  1WVR A;  2NS0 A;  1ORK A;  2EFO A;  3RDI A;  3WGI A;  2ZJQ F;  4IJA A;  5JFR A;  1K61 A;  3U2R A;  3VYS B;  2L7Z A;  1XDU A;  4RAG A;  2R3S A;  3IC7 A;  1MBK A;  5KHD A;  2FOW A;  4A3E J;  4PK4 A;  1PUE E;  1ZAR A;  3OY9 A;  4AVP A;  3HOY J;  4GYI A;  3JAM K;  3JRH A;  5EEA A;  3DKX A;  3CCV I;  3REO A;  4ZZD A;  2IBD A;  4BBS J;  3LAP A;  2M87 A;  4N4O B;  2KQR A;  4I01 A;  1RZ4 A;  4EV0 A;  4L5E A;  3KLN A;  3C1D A;  2JA5 J;  2VQH A;  3ZMV A;  5LEK A;  1YJN I;  2OQR A;  4N9I A;  2QKL B;  3JRC A;  3LFK A; 
#chains in the Genus database with same CATH homology
 2L2O A;  2K5C A;  3A4C A;  4HPQ A;  1ZEL A;  3FHN A;  3ZRG A;  2M3A A;  4FAS D;  3K4J A;  2DT7 B;  2KP6 A;  3S3N A;  1UG0 A;  3H9G A;  3K4C A;  2LY1 A;  3EUH C;  2LBF B;  3SEZ A;  4KJZ A;  1WFX A;  2LBF A;  3HKZ A;  4CA0 A;  1D1A A;  2KMU A;  5TGT A;  3L2R A;  2CV2 A;  2M0M A;  2L9S A;  2CS3 A;  3OR2 C;  2VQL A;  2A6T A;  3IUO A;  2CUZ A;  3H35 A;  3VYR B;  3OYE A;  2VJI A;  1BR4 A;  3ZR8 X;  2JVG A;  4ZYA A;  4BDZ A;  1DGW Y;  1BR1 A;  3OYI A;  3ZXS A;  2HQA A;  4XM3 A;  3OYN A;  2L9N A;  2QKM B;  2VAS A;  3VYT B;  3BCB A;  1X4O A;  4ZTJ A;  3H5A A;  1QU3 A;  1SAU A;  2VB6 A;  4QPO A;  3LFU A;  3LSI A;  4E7J A;  4F92 B;  4CUG A;  3QYE A;  4BE0 A;  1V5E A;  3OWT A;  3K4L A;  4CCO A;  1ERD A;  2XF7 A;  2F4I A;  1HA8 A;  4X0G A;  5FRN A;  2F6C A;  3BG6 A;  4CSW A;  3HOT A;  4BQN A;  3I9V 2;  2MD0 A;  1WJB A;  3PNY A;  3A1Y A;  3UR3 C;  3CJR B;  3KX2 A;  1X1B A;  2IGN A;  4XNF A;  3G2B A;  3ONQ A;  3OYH A;  4AYB A;  4BS9 A;  4PJM A;  3NWT A;  2UUZ A;  2XF5 A;  4CZC A;  1SFK A;  2CH0 A;  3NWS A;  1X19 A;  2Z1D A;  2VLA A;  3AFH A;  1LFP A;  4DIQ A;  2XAU A;  2VL8 A;  3CES A;  2WY7 Q;  4FET A;  4F55 A;  4BGD A;  1FMV A;  3I3L A;  4PSX A;  5HOO A;  2LY2 A;  4PSW A;  4HNT A;  3W3C A;  3OYB A;  4E4H A;  4MLO A;  2UV1 A;  2M7B A;  4HEA 2;  4XKW A;  1GLN A;  1YX5 A;  2W00 A;  3LSM A;  1P9Q C;  3E0J B;  3OR1 C;  4D1Q A;  4YEL A;  1Y6I A;  2L5Q A;  5KCM A;  1KON A;  3RQ4 A;  4DJA A;  3SZG A;  1FMW A;  2IS4 A;  3ZGK A;  2W7N A;  3OMY A;  2CV1 A;  4U7B A;  4BU2 A;  3CZ6 A;  2E5Z A;  1D0Z A;  1WJF A;  1OR7 C;  4RLF A;  3S8P A;  3H0D A;  1MMA A;  2R7V A;  1R6R A;  3L2Q A;  4C2U A;  3OYL A;  4OAY A;  1Z7L A;  2K9L A;  2KPM A;  3MD2 A;  1D0X A;  3K4B A;  2CMP A;  3C2G A;  5HNF A;  1X1A A;  4XKV A;  4BJ5 C;  4R79 A;  2FUG 2;  3DPL C;  1W36 C;  1V5G A;  1DP3 A;  2MYS A;  3AL0 B;  1UAA A;  4E7H A;  3L2V A;  3RSN A;  3OL4 A;  2XF6 A;  1T95 A;  2BVL A;  4KIS A;  3J7A Y;  3EUA A;  3OYD A;  4P5O A;  4HG2 A;  2E1M B;  1W36 D;  3UNG C;  2R4G A;  3A2K A;  3IAM 2;  4II2 A;  1YX3 A;  4CCM A;  4HNU A;  3S32 A;  2MFZ A;  2ZXH A;  3MKW B;  3K70 C;  4N4N B;  1JI8 A;  1LVK A;  5CQG A;  3PNT A;  2WAE A;  2VJJ A;  2JA2 A;  2R7O A;  4C2T A;  1MW7 A;  2VPL A;  2K3P A;  3L2W A;  2W82 A;  3VWB A;  3OS0 A;  4NC7 A;  1DQU A;  3BG7 A;  3QYF A;  4ZC3 A;  3D5R C;  3K70 D;  4D9J A;  3HC7 A;  2LYC A;  2KRC A;  3OL3 A;  3CF2 A;  3CJQ B;  3EUK L;  3TMO A;  4KIT B;  4E7L A;  2XSJ C;  2P0W A;  2VJ5 A;  2IS1 A;  3BLY A;  1WJE A;  1MMN A;  4E7K A;  2KL4 A;  2CW7 A;  4XOT A;  3H5N A;  4XMY A;  4DOZ A;  4YEJ A;  3F9K A;  3V42 A;  3BCA A;  4XOP A;  1K6Y A;  2Z2S B;  4BXF A;  2X6X A;  3OYG A;  1MND A;  4RM3 A;  3M1C A;  3OYM A;  4LIV A;  4BE2 A;  1BR2 A;  2PJR B;  4BQQ A;  4KT6 A;  2VXZ A;  4PJJ A;  1TZL A;  3DKY A;  4DBR A;  2WBM A;  2Q1Z B;  2Z16 A;  2GOX B;  2KHM A;  2VQC A;  4F3Q A;  2HDW A;  1UEL B;  2OUM A;  2CV0 A;  3TL4 X;  4XLC A;  2JUG A;  4RLQ A;  4PFP A;  2ZSH B;  4B43 A;  4HST A;  4Y4R A;  2BW3 B;  1OLT A;  2LG4 A;  3CMM A;  2BW3 A;  3K10 A;  3LL7 A;  1G59 A;  2NOJ B;  4XOR A;  2IGK A;  2XDV A;  3FDY A;  2L7K A;  2KZV A;  3E1S A;  2I8D A;  1WJ5 A;  2X1D A;  3DU6 A;  4E7Z A;  4XQF A;  3OOU A;  3W2W A;  2KLO A;  3H5R A;  1U0J A;  1Z3X A;  2MAB A;  2PMZ A;  1MMD A;  3C2H A;  1N77 A;  3OS2 A;  4JQF A;  3SYT A;  2R7Q A;  3CP8 A;  4BJ6 C;  3HL2 A;  3ZCO A;  2R7S A;  2VJ4 A;  4G6T B;  4B3X A;  2JSP A;  3W2A A;  2IS2 A;  3OS1 A;  5CKT A;  2E5N A;  2DT6 A;  4XKC A;  4XKB A;  3H9Q A;  3S93 A;  2UWM A;  2X1E A;  1D1C A;  2ZSI B;  3SEQ A;  1NG6 A;  2Q2E B;  4NQW B;  4RM2 A;  2ZXI A;  3VSL A;  4BUP A;  2X51 A;  4C9Y A;  3OYK A;  5FRO A;  2HNH A;  4GRI A;  1X1D A;  3EPZ A;  3AKZ A;  2R7W A;  4Y33 A;  3VSK A;  2LRE A;  3HOS A;  4CCN A;  5FRM A;  4ZTF A;  2V6E A;  2M7A A;  2DJI A;  2X6W A;  3MKY B;  3BC8 A;  1Y56 A;  2O5R A;  3FKJ A;  2AQF A;  1D1B A;  2GOM A;  4BEH B;  4XR6 A;  3OIP A;  2WAF A;  2BOL A;  3D5L A;  4XL9 A;  5CPR B;  2BVM A;  4BEH A;  3OYC A;  1N75 A;  3PFY A;  2KDO A;  1E0E A;  2OC6 A;  4XON A;  1MMG A;  3PNV A;  2V4J C;  1AA7 A;  3PUB A;  4PUS A;  4XLH A;  1PJR A;  2M4K A;  5LD2 C;  3ZQQ A;  1X1C A;  3QOE A;  4II3 A;  4IQ4 A;  2R7R A;  4ANJ A;  2WA0 A;  2HZD A;  3PSI A;  2CW8 A;  2VKD A;  4E7S A;  5LFA A;  3VDX A;  3SDB A;  1YE9 A;  3OIQ A;  4BE1 A;  1TT0 A;  2RQQ A;  4PFO A;  3TBI A;  4ZDO A;  3HPH A;  3MKZ A;  4B48 A;  2Y0S A;  5CQE A;  4JOM A;  4NNJ A;  4XLF A;  3DTI A;  3LMM A;  3LSH A;  1D0Y A;  4XLE A;  2IGO A;  4B47 A;  4HRI A;  2DCE A;  2WAQ A;  1BOB A;  4LIT A;  2K9M A;  3IAS 2;  2CUJ A;  4CCL A;  4XLA A;  2HVR A;  4E7I A;  2X1C A;  2E60 A;  4IKF A;  3DTK A;  2XC7 A;  4ITV A;  3FBN B;  2HPM A;  2LOO A;  4YRV A;  4J01 A;  2F5V A;  5KNL A;  2W1O A;  2OV7 A;  3MMY B;  4DBQ A;  3OYJ A;  4XN0 A;  5HVQ C;  4BAC A;  1T0F C;  2HU9 A;  1QHH D;  2LH9 A;  2VXD A;  2RRE A;  4BQO A;  2V7F A;  3QOD A;  3K4M A;  2MC4 A;  3AL0 C;  2R7U A;  3DTE A;  3DPU A;  2VKH A;  3FBI B;  2ELJ A;  4XN3 A;  3S3M A;  2PJR A;  4AVZ A;  2X6Y A;  4BDY A;  2E1M C;  5HNH A;  3GBG A;  4QPQ A;  2HPI A;  4Y3O A;  5HLT A;  4DGW B;  1MNE A;  3HUG B;  3PSF A;  3RTR A;  3PJR A;  3CP2 A;  4CCJ A;  3U21 A;  4IQJ A;  1G8X A;  4NC8 A;  4CCK A;  3KEY A;  3RCO A;  4P1W A;  4HSR A;  3LSK A;  3HPG A;  2A5W A;  4J00 A;  2RNG A;  3DWL E;  1WJA A;  2WY8 Q;  3K4N A;  4NUB A;  4PJL A;  3OYA A;  2ZFU A;  3KYL A;  4IX7 A;  2IS6 A;  2IGM A;  2HVQ A;  3S3O A;  3DU5 A;  3RPU D;  3DEE A;  4IZZ A;  3H9J A;  3QYB A;  1J09 A;  4ZJZ A;  1NG7 A;  4C30 A;  2VQG A;  4F52 A;  3DLA A;  3K6G A;  3W2V A;  3K4K A;  2JVH A;  3M8J A;  4ZDP A;  4BL0 B;  1IRX A;  1LDK B;  4B44 A;  1DGR M;  2KRH A;  4EAT A;  1QHG A;  3DPT A;  4H4K C;  1Z21 A;  4OWR B;  4PJN A;  3L2U A;  2CFO A;  1N78 A;  3D5S C;  4CH7 A;  1EA3 A;  2VIX A;  1WJD A;  4F91 B;  2DXI A;  3HG9 A;  3DQV C;  2IXS A;  1X4P A;  2WB1 A;  2DOA A;  3VYU B;  1VZ0 A;  4F93 B;  2M4G A;  3HXL A;  4OAZ A;  5JHF A;  3OYF A;  3IP4 B;  3VYS B;  4U87 A;  2WAD A;  3LSG A;  5KHD A;  1S9H A;  4PK4 A;  2X85 A;  3OY9 A;  2R7X A;  2AQE A;  2HVS A;  3DKX A;  1LKX A;  4E6K G;  2LRD A;  2V9K A;  2V26 A;  1V5F A;  2W4S A;  4ZDL A;  4N4O B;  2KQR A;  4RMN A;  4BJT A;  2V1N A;  2R7T A;  1PYV A;  1Z3Y A;  4AU7 A;  2VQH A;  4LIU A;  1WJC A;  3PL8 A;  2LC2 A;  2QKL B;  3N05 A;  4LG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...