4L9NA

Crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
137
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 52
structure length 137
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9nA00
3KETA 2CYYA 5ILVA 5ED4A 3J80K 2EJRA 1D5VA 4CDGA 1G3TA 1W4MA 2NNNA 1RI7A 3ZQ7A 2OD5A 3P7NA 1R5GA 3R61A 2IA0A 1TLHB 1V3FA 1SD4A 3C1DA 3CUOA 4EJTA 3WE3A 3R60A 3L2CA 3KEOA 1TTYA 4YIIA 4I2OA 3FM5A 4WXHA 3F8FA 2QWWA 2XAGA 2HQNA 5HVQC 2M45A 4LB5A 1W7PA 3EETA 2BV6A 5KVRA 4N0BA 3DV8A 3HSRA 4BYYA 2RDPA 3DXJF 1YG2A 4A5NA 1MDMB 3DF8A 2Z9OA 4KYWA 1DUXC 1H9TA 4ZYHA 2MBFA 3HRTA 4EGZA 2DLLA 4A5MA 2LF8A 5E8GA 3RIRA 1P6RA 4KICA 4AWXB 3IRRA 1KQ0A 1J7KA 2FF4A 5E1WA 1J9IA 2VBZA 1OPCA 4MGRA 2FNPA 1I1SA 2GXGA 3R4KA 5J8CA 4CZZA 4EJOA 2ZKZA 2A68F 4WK8F 1FP1D 4Q4ZF 3E6DA 1IUYA 2O6GE 4FX0A 5DCFA 2OA4A 5HDGA 2RV8A 4L9JA 4M74A 1Z6RA 2HWVA 1YS6A 5LLQA 1FLIA 4I01A 3K1NA 5ILSA 4MEYF 4G7ZF 3ZMSA 3RYPA 1L3LA 4G9YA 1QNTA 2XAHA 2OAZA 3OOPA 2YU3A 2WC2A 2KKOA 4TV7A 1FY7A 5CYVA 4M9XA 4HF0A 1ONVA 1J75A 1T98A 2DBBA 2ACJA 1U3EM 3Q5FA 2MH2A 4GYGA 1KYZA 4RGXA 3V7RA 2OU2A 4M9SA 2QQAA 2K02A 5TJJA 2WWYA 1W7PD 5L3DA 3QU6A 2ELHA 4M71A 4O6JA 4Q47A 2G9WA 2P6SA 2P5KA 1UHWA 4LK1F 4UHTA 1YW8A 2VODA 5A2QK 5BOXA 2V9VA 4R1HA 4UUVA 1ODDA 1IZ1A 1LDJA 1UFMA 2HR3A 2EWNA 2VT3A 3F23A 2VOPA 3MFKA 1MGTA 1LB2A 2NRAC 2IT0A 1IN7A 4F7ZA 3IWZA 4KT5C 1G3WA 3AAFA 1HKQA 3V7CA 3R0JA 4G6DA 2ISZA 3ULQB 1DP7P 1XGNA 1T6SA 4PDKA 1QQIA 2YR2A 2ADUA 1TBXA 2EB7A 3DKWA 2ZXJA 2Y48A 3TQNA 3DPTA 4NQWA 4KIGA 1FZPB 2HOEA 3V4GA 3L00A 3F8CA 5JI6A 3TO7A 2E1CA 4LGWA 4L9NA 3I59B 4WCGA 2O61A 2ISYA 3ZPLA 2H27A 2QQ9A 5CLSA 2OZUA 4G8XA 3C3WA 2H6BA 3LFKA 2W24A 5DUKA 3F8BA 1CF7A 2HKXA 4AIKA 3LA7A 3F21A 1RUOA 1KQ9A 1FP2A 5ICFA 5LGTA 5AIPA 2DW4A 5DYMA 3KZYA 5L3GA 1YS7A 5ILUA 2A07F 1P4AA 2EA2A 1U5TA 1R36A 2MC3A 2KIUA 1S29A 5BS6A 1AWCA 2FMLA 1GVJA 2JT1A 3CO7C 2DAOA 2TDXA 3D5LA 4BH9A 1CGPA 3ZN0A 4ENJA 2O03A 3EYIA 2XV4S 3JSPA 4R8HA 2MLGA 2E1NA 2D45A 2IRFG 4RB0A 4QLCU 4RGRA 1R22A 1XSDA 1LDDA 4MQVA 1R58A 5DCMA 2RVCA 4HQMA 1Y0UA 3BJ6A 1D3YA 1YIOA 1IN4A 3TKYA 3Q9VA 3HSFA 3O2PE 4EGYA 1F4KA 4G6QA 2VOOA 4RB1A 4H0EA 1SD5A 3P9CA 3V8JA 5HOOA 1Q1HA 2UXXA 1B9MA 1KU3A 4WWCA 3MWMA 1W5TA 2IW5A 1OYWA 4HAMA 1Z6TA 1R1TA 3CUQA 2GXBA 1HXDA 1MJBA 2FQ3A 2P7VB 3BJAA 2XAFA 2A69F 2A3SA 3KP6A 2FOKA 3WTSC 4HW0A 3GLXA 4U0YA 4B09A 5KK1A 6PAXA 4BNCA 2AS5F 4U7DA 3GEZA 2OQGA 5FGMA 2XAJA 4RAZA 1R1UA 1FOKA 2BEOA 1BM9A 3GF2A 1QZZA 4ENNA 1T39A 1K6OA 3ECOA 3JSOA 1DPRA 3J80Z 3RKWA 3WTZA 2JTVA 3WGGA 3ABTA 5K1YA 2W25A 2GIVA 1LJ9A 4OIOF 1YTYA 2M5WA 1IF1A 5D5XB 1FWZA 5LEKA 3KP4A 3RDIA 3TO9A 2XVCA 1B9NA 1T38A 3GZ5A 3N4MA 3I54A 4EJVA 5D5VB 1QPMA 1U78A 4WX9A 1HKSA 4YFXF 3E6BA 1SD6A 2FE3A 4IRGA 3M8EA 4S04A 3HHHA 5LRRA 1REPC 3BWGA 3F3XA 4FHTA 4KDPA 4OIRF 3R6SA 3HYIA 4UV9A 1SAXA 4YG2F 3ZMZA 1IRFA 1XSXA 1Z05A 3HTUA 1FX7A 5E1XA 2VXZA 2EV5A 3I0TA 4ZH4F 1S3JA 1U6GA 3B02A 3JAMZ 5BMZA 5JR3A 5LEJA 1O3QA 1XCVA 1BI2A 1S8NA 3HSEA 2H94A 3TDZC 3E6MA 3FWEA 4BAYA 1XB4A 1MJ9A 3K1PA 3DFGA 4E70A 5H6RA 1TNTA 4MNUA 4P96A 1I6XA 2V6CA 2P4WA 1K78A 2XKPA 1ZRCA 2W57A 1ZHFA 2YX7A 4GXOA 1XN7A 2L02A 1FBUA 1UCRA 5HS9A 3OV8A 1SFEA 2P7CB 2EFNA 3QOPA 5K5RA 2PMUA 1R1VA 4QWQA 2QVOA 4AIHA 1ZYRF 4HV5A 3U9GA 4BHPA 4EJUA 3DP7A 3K69A 3WTXC 3GVAA 1SFXA 4CO8A 4HDUA 5DEQA 2MLKA 1WI9A 3JTHA 4A12A 3MQ0A 1O3RA 1IN8A 4IVNA 3S2WA 1ZLJA 1BI3A 4BXUA 2V1UA 5ERIA 1C0WA 3C7JA 3MZHA 4WF2A 4ZYDA 4GYIA 3O3KA 1YLFA 1ZGAA 2BBYA 4N9HA 2RC4A 3M7GA 2A6HF 3QAHA 3D0SA 1JHFA 4XRFA 2ZCWA 1SD7A 1ZAOA 1S7AA 1J0RA 2JPBA 3N97A 3V7SA 3I5UA 2G7HA 2GA1A 1WRJA 4HX4A 4DQ2A 1G4DA 3GFLA 2O0YA 4MQ9F 2COMA 2JZYA 1J2XA 1O7FA 4L18B 5DD4A 5LHIA 4ZYGA 5CVRA 4HA8A 2B0LA 2VC1A 3CO6C 2GWRA 4HOBA 4RGUA 3KFWX 3TOAA 3MZYA 4IF4A 5E1ZB 4KMFA 1ZH5A 4XSZF 1JHHA 4P9UA 3H92A 1H9GA 3HUGA 2GA2A 5HDNA 4WXDA 2UWMA 2D1HA 5ICGA 2X4HA 1HBXG 5F1RA 4A2UA 4A6EA 4RAYA 1I27A 1OYIA 2PBIA 2PMHA 1MZBA 2V79A 5CVJA 3L7WA 2UZKA 1XDSA 4HLXA 2O8XA 4LLNA 4IRIA 2ETHA 4KN4X 3E97A 1FYLA 4L0YB 4KIBA 4HYEA 1HW1A 3BZ6A 2MA3A 3WODF 1LEAA 3GWZA 2PN6A 5IT9K 3K1MA 2RQPA 3DPLC 2STWA 1MDMA 4LJZF 2DQLA 5CVUA 2QBYB 3KP3A 1J59A 2CSOA 4M9ZA 4EVIA 2FNAA 4P55A 4RS8A 1DDNA 2O3FA 4KUMA 2EFWA 3BP8A 3CJNA 5LHHA 1IN6A 4LMYA 1PUEE 1F9NA 2HGCA 1E2XA 1FYKA 2DK8A 1H0MA 1HW5A 2ESNA 1ULYA 1TNSA 3QP5A 3LA2A 4M6YA 1XGMA 3EQLF 5K5OA 3LQQA 4YFKF 3WTUC 5DDGA 2D1VA 3LAPA 2NS0A 3NEUA 2EFQA 2A61A 4OINF 2XIGA 4IJAA 2VE8A 3C18A 3HRSA 3R0AA 3ELKA 2UXNA 4ESJA 5DCMB 4O3MA 3BROA 2Q8KA 3ISPA 2A5YB 4LD5A 1B6AA 4L5JA 3HOSA 2DFIA 4WXCA 2V1DA 5D6FA 1XMKA 3W6JB 3L9FA 3G3ZA 3T8TA 4M73A 5E17F 5D5UB 2EV6A 2CFXA 3WG9A 3J81K 3SFZA 2IA1A 1LNWA 1XMAA 4HBLA 4IHSA 3QP6A 3RKYA 2RGVA 3IWFA 3GFMA 1LEBA 2ZMEB 3FMSA 3I58A 4KIFA 3TGNA 5IT3A 5FLXK 1MJAA 1YYVA 4A0YA 2XHKA 3FF5A 1LQ1A 3HIFA 2M8EA 1KQ8A 1BIAA 1KA8A 5BPDA 1XCBA 2FBIA 2LKPA 2FBKA 3G73A 1ZLKA 2M1BA 1IW7F 1GXQA 1HSTA 1TQPA 2HZTA 2ESHA 3LA3A 1IXCA 4EMSA 4EQQA 2QLZA 2K4JA 3K2ZA 4ENKA 2PEXA 4LG0B 3BPXA 4OMYA 1W5SA 5L3CA 2K27A 4ZZLA 4MHGA 3EYYA 2KJBA 3BJOA 3SZPA 4UVAA 2FXAA 1EV7A 1FBQA 2OBPA 1KU7A 3ECHA 4AD9A 1FPQA 3E5QA 4U7BA 3RI4A 3K9TA 1BI1A 2P8TA 2DQRA 4HQEA 1JE8A 1D8JA 2CGPA 2JRTA 2H6CA 2CG4A 3TOBA 4YIFA 4IXAA 5E20A 2XASA 4BHCA 3PQJA 1YFHA 4HV6A 3IKVA 4HF1A 1OKRA 3M1EA 1OYYA 4D0PA 4Q48A 3RKXA 3GFJA 2PQ8A 4RB3C 4I02A 1O3SA 3KZZA 1ZARA 2RKHA 2IP2A 2LSOA 2Z33A 3KP2A 2QYOA 1O3TA 1XDUA 4KNYA 1BBYA 4Y15A 4HDVA 4I09A 1PDNC 5L3BA 2DK5A 1GXPA 1IRGA 2AXLA 4I7HA 1KU9A 2IVMA 2VT2A 2XAQA 2M30A 3RTRA 4AVPA 1O7LA 3TO6A 3WE2A 3V8LA 4EV0A 1UB9A 1BJAA 2QM3A 2VBXA 5H20A 2LF7A 5D6EA 2V1XA 2L4AA 3BOQA 3WGHA 2BE5F 2PG4A 4LLLA 4JBAA 4L9TA 2F5FA 1B4AA 4CXFA 3WTTC 5FO5A 2KJCA 1ZRFA 4HX8A 3QPTA 2FSWA 2FRHA 3GX4X 1A04A 1O57A 1Z1DA 1XSVA 4IPAA 1W7PB 1JXSA 3KLNA 3REOA 3VB2A 1D8KA 3VOEA 1VTNC 1QZYA 4Z2YA 4RB2C 4OMZA 1QO0D 4JK1X 2M87A 3FXRA 1EH6A 3V8KA 3GUDA 5HS7A 5J8FA 2K86A 4U88A 4I0BA 1KGSA 4L0ZB 2DTRA 2XUBA 4UNOA 5K5QA 3I64A 3E5XA 5DD8A 1HQCA 1FC3A 5LBQA 3FMQA 2HTSA 4EM1A 1STZA 5H6QA 2DO7A 3H3UA 3IRQA 1PP8F 1SFUA 3E6CC 1ZGJA 2VBYA 2GAUA 3SQNA 1G3SA 4LLGF 2QZ8A 1I5ZA 3ZN1A 2VONA 3M8FA 2YX4A 5CVVA 2F5EA 3U2RA 4IRHA 3PFIA 3VODA 4YFNF 1R23A 5D8LB 1FSHA 4S05A 2DPDA 4RGSA 1S7OA 4B8XA 3ERED 5HLIA 1PP7U 1OMIA 2GZWA 5HS8A 4KN7X 3WTWC 4AIJA 1Z7UA 1BOAA 1FSEA 2L54A 4UXNA 5L3FA 3IKTA 3CTAA 2K7LA 1R7JA 3ROUA 2OQRA 2Z5UA 4XSXF 1G3YA 5EEGA 3LQRA 5CVIA 4EJWA 2W84A 4ZZDA 1B59A 2R3SA 2EK5A 4ESBA 1UHMA 4P5OA 5BQTA 1LVAA 2F5CA 4R79A 2CQKA 1K79A 1ZG3A 1USSA 5DV5A 4PGHA 4U0WA 5D4RA 1OR7A 3JAMK 2E7XA 5IT9Z 5E8IA 2P5VA 2XGXA 5F64A 4P9FA 1ZN2A 1USTA 3P9KA 1RIOH 5AIQA 5A2QZ 1HW2A 2CO5A 3GFIA 3HRMA 2EV0A 3GZ6A 1HSJA 3LWFA 3RJPA 2P6TA 4BQAA 3EUHA 5TRDA 2D2WA 2MH9A 4KFCA 2ZO4A 1R5HA 2RN7A 3ABUA 3VEPA 2P5LC 1EH8A 3FX3A 2DI3A 2F5DA 3F22A 4A0XA 4BHBA 1YW9A 2X0LA 4MTEA 2ZJ2A 2L01A 4UV8A 5HLHA 1ON1A 4XLNF 1J5YA 3SHFA 3BPVA 4L5IA 3ZMTA 2HQRA 3FXQA 1MKMA 1R00A 1ZRDA 1E17A 2QENA 4GGGA 2IJLA 3KEQA 4OIQF 4HZFA 1SMTA 1X3UA 2BGCA 5LGUA 4ENMA 4HX7A 1I1GA 2STTA 1ZG1A 3TDUC 3J81Z 4U0VA 3IC7A 4EM0B 4A0ZA 2EFPA 3E3VA 4LK0F 3COAC 2VC0A 1CF7B 3Q9SA 5LGNA 5DUIA 3I4PA 5FLXZ 3NRVA 1U5TB 4M72A 2FU4A 4M6XA 2L3DA 4G7OF 2VBWA 2FEZA 4PCQA 1P2FA 1TW2A 5ICEA 2NAZA 3W6KB 1DPUA 2JPCA 3ZMDA 1BC7C 1JGSA 2RNJA 5FFXA 3MEXA 3VFZA 3T1BA 3DEUA 1MD0A 1ON2A 3F72A 4GCVA 1U8RA 1IAWA 5LHGA 2J5PA 4I0AA 3HRUA 3SXYA 1S6LA 2K4BA 3KP5A 3GO5A 4G94A 2J5OA 2XROA 2HDCA 5D5WB 3T8RA 1FT9A 3FHZA 4G7HF 2PJPA 3QPHA 3U1DA 1FYMA 4OOIA 3SZTA 2OZ6A 4UVBA 2IPQX 1F5TA 4HF2A 5JFRA 3MCZA 4DNCA 1HKTA 5F6FA 3I53A 4ESFA 2NNYA 3E5UA 3KLOA 5JHUA 4Y17A 3CUQB 4CICA 3FZVA 2Z99A 5AONA 1P4WA 4I98B 1SMYF 1QGPA 4FX4A 1IN5A 1TW3A 3K0LA 3WTYC 4OU0A 4PZJA 1U5TC 2Z3YA 3WU0A 2MD5A 2QBYA 4KMUX 3IHUA 1BI0A 2E7WA 1P92A 3GW2A 3FXUA 2JSCA 1XD7A 1FBSA 3HTSB 1BIBA 4CGZA 1L0OC 2HKOA 2PLYA 2HEOA 4Q5SF 2GQQA 2HS5A 3ZP5A 3ML6A 1ZREA 5FD5A 4EM2A 2KRFA 2W85A 2L4MA 5D4SA 3RPQA 5LRSA 1T0FA 3PQKA 4L9VA 3KP7A 5D8KB 1TQMA 2IA2A 3EDPA 1RUNA 3DQVC 3F8MA 3QU3A 2C6YA 1RNLA 2VN2A 5E18F 3HOTA 1EH7A 2R7FA 3L09A 4JQFA 1Z9CA 3CDHA 1G6NA 3HHGA 1YW7A 4O5VA 3WU1B 4ETSA 1TQIA 1T2KA 2FBHA 3CUQC 5EEHA 5ICCA 5HLGA 1IXSB 3F6VA 2KIMA 4XBFA 2WV0A 5HDKA 1WKMA 5FB2A 1KYWA 3F8NA 3I59A 2F2EA 2ZBKA 1YQAA 3T0YA 4K2EA 3MAJA 2ZMEA 2DPUA 1GHCA 2NYXA 2Y75A 2CW0F 4HLYA 2ZFWA 4Y13A 1U2WA 3O6BB 3JW4A 1WQ2A 2QQBA 2PFBA 4A6DA 1AOYA 4FT8A 1XGOA 3P9IA 1K78B 2YPRA 4PGGA 2LDUA 4N9IA 4NB5A 2WTEA 4CHUA 3I71A 2LNBA 1LDKB 3H3ZA 3RYRA 3FM3A 2DU9A 2XRNA 4ASNA 5CJ9A 2KIFA 5FD6A 3NQOA 2BYVE 3LSTA 3T5XA 4LG0A 5L3EA 3LAJA 1KU2A 3BY6A 2HTJA 1P4XA 1WWXA 5BPIA 3J7AO 4ON0A 1V4RA 2HYGD 2XKOA 1RZ4A 1IXRC 3JTGA 1B1BA 4XLPF 2HFHA 2CWEA 2Y0MA 3B73A 3GYHX 2R7DA 4LFUA 4CYDA 3KCCA 3KE2A 4IHTA 3GXOA 1K7AA 1F1ZA 4GO1A 2A6EF 2G7UA 1BN5A 5JVTA 1Z91A 3M9AA 1WSUA 1ZG5A 4LB6B 4MTDA 3WGIA 2EFOA 1FNNA 4KA4A 2YSRA 3ZMUA 2EA4A 3QRFF 1XGSA 2HYFA 2DT5A 3CLOA 2Q0OA 3BDDA 5J6XA 2Q2EA 4UVCA 4ZYEA 2PI0A 1QBJA 2ZNYA 1NHAA 3RPUA 2QUFA 1YO5C 1BC8C 3FMRA 2H09A 2ZNZA 4MEXF 4NHJA 3IL2A 2VE9A 4OIPF 2FMYA 3F6OA 5FFZA 2FA5A 3ZMVA 3WTVC
chains in the Genus database with same CATH superfamily
3KETA 2CYYA 4S0HB 4F52A 2KISA 5ILVA 1XS9A 2MC4A 3OYAA 5ED4A 2WB1A 1DQUA 4RLQA 3J80K 2EJRA 1D5VA 1VQ8I 4CDGA 1N78A 4YEJA 2ME6A 3BG5A 3LSHA 3HUGB 4IL6C 1G3TA 1W4MA 2NNNA 1RI7A 3ZQ7A 2OD5A 3P7NA 5HODA 4RBOA 1F36A 1R5GA 3R61A 2IA0A 1TLHB 1ZQ3P 1V3FA 1SD4A 3C1DA 2VKVA 2KLOA 3CUOA 4EJTA 3ZQCA 1YIJI 3WE3A 3R60A 3L2CA 3KEOA 1YE9A 2X85A 4E7ZA 2R5ZB 1TTYA 1P7JA 4YIIA 4PJNA 4I2OA 1I3AA 3OY9A 4A3FJ 3QQAA 1UG2A 3FM5A 4WXHA 3F8FA 3Q3SA 2QWWA 5C4JJ 2L7ZA 2XAGA 1WJFA 5DM6F 5GAHJ 3IUOA 2HQNA 5HVQC 3K4JA 1NK3P 2M45A 3GTMJ 3H9QA 3G6EI 4LB5A 3GTGJ 2E2IJ 3HG9A 4ZDOA 1W7PA 1GV2A 5F08A 5DM7F 1T8IA 3EETA 2BV6A 3DPUA 5KVRA 4N0BA 3DV8A 3HSRA 4BYYA 3CF5F 2RDPA 2L0KA 3DXJF 3U21A 1MMSA 1MNDA 1YG2A 4A5NA 1MDMB 2XF7A 3UKGA 3DF8A 4XQFA 2Z9OA 4XICA 4KYWA 1DUXC 2CUEA 3A0HC 4RM3A 1UHSA 2KRHA 1H9TA 4ZYHA 1M1EB 2MBFA 2XB5A 2GIZA 3HRTA 1JJ8C 3JREA 2OC6A 4EGZA 2DLLA 4A5MA 3RKQA 2LF8A 3OYLA 5E8GA 3RIRA 4D7MA 2X9DA 1DU0A 1KONA 3JRGA 2MGQA 2X51A 1P6RA 1WJBA 4KICA 5H2FC 2F5VA 4AWXB 1DU6A 3IRRA 2VB6A 1KQ0A 1J7KA 4OAZA 1SAUA 1D0XA 3QODA 2FF4A 5E1WA 3G71I 1J9IA 2EIMH 1OPCA 2VBZA 4AYBN 4Y7NJ 2XDVA 2FNPA 4MGRA 4IKFA 1I1SA 2QQ8A 2E34A 2GXGA 2VASA 3R4KA 5J8CA 2LREA 2IEKA 4KISA 4CZZA 4EJOA 5BNGA 1PVEA 2ZKZA 2W4SA 4E6KG 5IPAA 3S93A 1SFOJ 4NC7A 2A68F 4JOMA 4WK8F 1FP1D 3OYDA 1G59A 3HM5A 5K7ZA 5EGOB 3RPUD 2KIQA 4Q4ZF 3E6DA 1IUYA 4PJLA 2O6GE 4FX0A 5DCFA 5FLVA 2OA4A 5HDGA 2RV8A 4L9JA 4M74A 2NOJB 1Z6RA 2HWVA 1Z7LA 1UZCA 3B6CA 1YS6A 1SVMA 5LLQA 1FLIA 1R6RA 2EZLA 4AYBA 4E7SA 1T95A 4I01A 1RETA 1HDDC 1D0ZA 3K1NA 4HPQA 2ICWG 5ILSA 2NXNB 4MEYF 4G7ZF 3ZMSA 3RYPA 3OS0A 2QGUA 3BG9A 1WCMJ 1MBFA 1L3LA 4G9YA 4J01A 3L2QA 1QNTA 1NG7A 1D5YA 2XAHA 2OAZA 3S3NA 3OOPA 4BDYA 2DMUA 2YU3A 2WC2A 2KKOA 4TV7A 1FY7A 4C3JJ 3DBLB 3OIOA 3BQZA 5CYVA 4M6VA 4AIDA 1Z0XA 4M9XA 4HF0A 1ONVA 3VYRB 5KAIC 1T98A 1J75A 3BTCA 2KP6A 1XMXA 4DYRA 3IP4B 1T08B 2DBBA 2ACJA 1U3EM 3Q5FA 2CS3A 2MH2A 1MBHA 3OIPA 1H88C 2Y9YA 4G12A 4GYGA 1KYZA 4RGXA 2JMWA 3HPHA 3V7RA 2HYJA 2OU2A 4M9SA 1P7IA 4OAYA 4IX7A 2COBA 2QQAA 2K02A 4BACA 5TJJA 1OISA 2WWYA 1Y8RB 3IH3A 2L9SA 4HRIA 4ABZA 1W7PD 3LSKA 5L3DA 1HDPA 3HOUJ 4XK4A 3QU6A 2ELHA 3DEEA 1MMNA 1TZLA 2DYSH 1R9TJ 4X6AJ 2L9NA 2IGNA 4M71A 4O6JA 2KDZA 4Q47A 2G9WA 2P6SA 2LD5A 3CCEI 1HF0A 4BBRJ 3IAS2 2GM4A 2P5KA 1UHWA 4LK1F 4UHTA 1YW8A 4V19K 3ZQGA 2DODA 2VODA 3GTQJ 3H5NA 5A2QK 4F91B 1NTCA 2LLKA 5BOXA 2M2EA 2V9VA 1P9QC 4R1HA 4UUVA 1ODDA 1IZ1A 4V2GA 1LDJA 3K10A 1UFMA 1EKEA 2HR3A 2DMNA 1Z3YA 2L2OA 3BZKA 3D1NI 4DGWB 2PX9A 1VQOI 3G1MA 3VWBA 3AL0B 4E7LA 2EWNA 4M3DA 3RCOA 2NS8A 2VT3A 3F23A 2E1OA 1LFPA 4ZC3A 2VOPA 3MFKA 4C2UA 9ANTA 2DA3A 1MGTA 1LB2A 2M7AA 4FE4A 3DKYA 3L2RA 5F27A 1S9HA 3PL8A 2NRAC 1OQYA 2IT0A 1IN7A 4F7ZA 4PJ0C 2DMPA 5J1YA 3IWZA 4KT5C 1G3WA 5E3NA 3AAFA 1HKQA 3V7CA 4N4OB 3R0JA 4G6DA 1H8AC 2ISZA 3W2WA 4KJZA 1JT6A 4GFBA 1VZ0A 2DFEA 4PK4A 2IS1A 3ULQB 4QSHA 3TW7A 1DP7P 1XGNA 1T6SA 2ZFUA 4PDKA 1YRNB 1QQIA 2GBYA 4N4NB 1DGRM 2Y69H 2YR2A 2ZJPF 4BBSJ 2ADUA 1TBXA 2EB7A 3C2BA 3DKWA 4IHVA 2ZXJA 2Y48A 3TQNA 3DPTA 4NQWA 4KIGA 1FZPB 1B8IB 2HOEA 3HPGA 4BKXA 3QPLA 3WG7H 4A3MJ 3V4GA 3L00A 1TWFJ 1WH5A 2BY2A 2FX0A 3F8CA 5JI6A 3OR2C 5IOYA 3TO7A 2E1CA 4D7NA 3G2BA 4LGWA 3OL3A 3OYNA 3ZQLA 3PUFA 4MO7A 2XSJC 4L9NA 2JA8J 1MIJA 3I59B 3VYTB 3CMAI 1ETQA 2WAQN 5E79C 4WCGA 2O61A 2ISYA 5HNFA 3ZPLA 3KYCB 4MLOA 2H27A 2R7XA 2QQ9A 5CLSA 1PYVA 5E3LA 1I3QJ 4CCOA 3M07A 3KX2A 2OZUA 4G8XA 2R7SA 1ACIA 3C3WA 2H6BA 3LFKA 1W36D 2W24A 5DUKA 1PUFB 2OUMA 3F8BA 1CF7A 5JLWA 5E3MA 2H8RA 2HKXA 4AIKA 3LA7A 3F21A 1RUOA 3K70D 1KQ9A 3WHCA 1FP2A 1YX3A 5ICFA 3H5RA 4XKBA 2LK2A 5EJCA 1QRYA 3GBGA 5LGTA 2CW7A 2DW4A 5AIPA 5DYMA 2O8KA 1UELB 3KZYA 5L3GA 2R93J 3HOWJ 1YS7A 5ILUA 3I3LA 2A07F 1P4AA 2EA2A 1U5TA 2Z1DA 4CH7A 3ASNH 1R36A 2DA4A 4BE2A 3MD2A 4XKVA 5IY5H 2WAQA 3OOUA 2MC3A 2LH9A 3MZ8A 3K4MA 1G2HA 2KIUA 4E7JA 3BR3A 1S29A 5BS6A 3OYFA 2NVXJ 1AWCA 2FMLA 2V9PA 3H1CA 2HOSA 4PSWA 1GVJA 2JT1A 5GAEJ 1SVLA 1U9NA 3CO7C 1LKXA 5J4YA 2K3FA 4D1QA 2DAOA 2TDXA 4XMYA 1D0YA 3D5LA 4BH9A 3K4KA 4Z6YA 2W00A 1CGPA 5B5EC 2KPMA 3ZN0A 2Y0SN 5C3EJ 4ENJA 2O03A 5K7HA 2XV4S 3EYIA 3JSPA 2GLOA 4R8HA 2MLGA 2E1NA 2D45A 1HA8A 2IRFG 3CJRB 3HDDA 4RB0A 2HDWA 4QLCU 2QA4I 4RGRA 1R22A 2HU9A 3OYHA 1XSDA 1LDDA 1BA5A 2BW3A 2H8WA 4MQVA 1R58A 5DCMA 2G0EA 2RVCA 3E7LA 4HQMA 1Y0UA 1ZGWA 3BJ6A 3ERMA 2XGCA 1D3YA 2NVTJ 1YIOA 1IN4A 2TRTA 1SANA 2B63J 3TKYA 2O7OA 3Q9VA 4B47A 3HSFA 3O2PE 4M3EA 1YJNI 4EGYA 2OJED 3BT9A 1F4KA 4G6QA 2ZXHA 1JI8A 3WHBA 1IUFA 5LD2C 2VOOA 4RB1A 4H0EA 5JLXA 1SD5A 4B44A 3P9CA 3NARA 5IYBJ 2X1DA 3V8JA 5HOOA 1Q1HA 2UXXA 1B9MA 1KU3A 4WWCA 2DXIA 3MWMA 1W5TA 2ME0A 2IBDA 2IW5A 1OYWA 4HAMA 4XN3A 1Z6TA 1R1TA 3CUQA 4BY7J 2I10A 1IG7A 1A31A 1NK2P 4DBQA 2GXBA 1HXDA 4RAFA 1MJBA 3HZJA 2FQ3A 2P7VB 3BJAA 3CC4I 2Q2EB 3ONQA 2XAFA 2A69F 1BR2A 3GLLA 3LL7A 2A3SA 2H1KA 1QVUA 3KP6A 2FOKA 1X1BA 3WTSC 4HW0A 3GLXA 4U0YA 4B09A 5KK1A 6PAXA 2VI6A 3TP0A 4BNCA 4A3EJ 2AS5F 4U7DA 3GEZA 2E60A 2OQGA 4NDLA 5FGMA 3G1LA 2E35A 2PMZN 1X1PA 3H3VK 2XAJA 4RAZA 2RREA 2CW8A 1R1UA 2K5CA 1FOKA 2BEOA 3V42A 1BM9A 3GF2A 1QZZA 1Z77A 3CMMA 5C4XJ 4ENNA 4BE0A 1T39A 3S17J 2DFHA 2YS9A 3BTJA 3TP3A 1K6OA 1QZEA 4Y4RA 3ECOA 3JSOA 1DPRA 3ABKH 2VJIA 3J80Z 3RKWA 3WTZA 2JTVA 3WGGA 4D9JA 1VQPI 3ABTA 2XC7A 5K1YA 2W25A 1E3OC 2GIVA 3LSMA 1LJ9A 5FKOA 4OIOF 1YTYA 2M5WA 2KZGA 3PNVA 1IF1A 5D5XB 1FWZA 5LEKA 3KP4A 4FE7A 3RDIA 3TO9A 2XVCA 1B9NA 1T38A 3GZ5A 4UUSB 3N4MA 3CMEI 3I54A 1VQKI 4EJVA 5D5VB 1QPMA 3LSIA 1U78A 4WX9A 2MD0A 1HKSA 3MVPA 4YFXF 3O8HA 2VJ4A 3HGYA 1TL8A 3E6BA 3KEYA 1SD6A 2B7EA 2BOLA 2FE3A 4IRGA 3AG1H 3M8EA 2JA2A 3HHHA 2K85A 3NWSA 4V2FA 4S04A 5LRRA 3GZNB 1REPC 4BXXJ 3BWGA 4BL0B 3F3XA 4FHTA 4KDPA 5IOZA 3JRIA 1MMDA 4OIRF 1IJWC 2X48A 1IDZA 1IGNA 3R6SA 3HYIA 4UV9A 1SAXA 3OSFA 2O9LA 4YG2F 2L7MP 3ZMZA 2ZXIA 1IRFA 2EH3A 1XSXA 2WB1N 4RDUA 4JX5A 2DA2A 1Z05A 2CUZA 1FOWA 4F3QA 2CJJA 3HTUA 1FX7A 3FK6A 5E1XA 1JGGA 2VXZA 1VQLI 2EV5A 3I0TA 5FKKA 4ZH4F 3IH2A 1S3JA 4DOZA 1U6GA 3B02A 3PNYA 1GV5A 3JAMZ 4UUTA 1D1BA 2KFDA 3HBLA 3VDXA 3IV5A 5BMZA 1TWHJ 4QPOA 1ZR4A 2NVYJ 4HSTA 5JR3A 5LEJA 3L2UA 3RZDJ 1O3QA 1XCVA 2JRMA 1BI2A 3GMEA 1S8NA 3CCQI 3OYIA 3HSEA 2H94A 3TDZC 3E6MA 3FWEA 4BAYA 1XB4A 1MJ9A 1I6HJ 3K1PA 3DFGA 1PJRA 4E70A 1VQNI 5H6RA 1TNTA 3M4OJ 4MNUA 4P96A 2EZHA 2DYRH 1I6XA 1OLTA 2Y2ZA 2V6CA 2P4WA 1OCRH 1S72I 4PJJA 1K78A 1RPWA 2XKPA 1ZRCA 2W57A 3GTLJ 1ZHFA 1S7EA 2CUFA 2YX7A 4GXOA 1BR4A 2K3PA 1XN7A 2L02A 4ZYAA 2UV1A 2MFZA 1FBUA 2WY7Q 1UCRA 5HS9A 3OV8A 4F93B 1A6QA 1SFEA 5B66C 2P7CB 2EFNA 3QOPA 4RLFA 1RESA 5K5RA 2PMUA 3I9V2 2FJ1A 1R1VA 1WJEA 4QWQA 2QVOA 4MFDA 4AIHA 1ZYRF 3GCMA 2EZIA 4HV5A 4JX6A 4QPQA 3U9GA 4BHPA 2E71A 3DTEA 4XLAA 4EJUA 1FTZA 2LRDA 3DP7A 3K69A 3WTXC 3GVAA 2OTJI 1SFXA 5FKMA 2VXDA 4CO8A 5DEQA 4HDUA 3HGGA 2MLKA 3KPHA 1WI9A 3JTHA 2AHQA 4A12A 3MQ0A 3RQIA 1O3RA 3ZGKA 1IN8A 4IVNA 1R5ID 4AU7A 4L5EA 1Z67A 3ZR8X 2R7RA 3LSRA 2JUGA 4GRIA 3S2WA 1ZLJA 1OCZH 1BI3A 2TCTA 3S2DJ 2EINH 1OCPA 4BXUA 2V1UA 1OR7C 5ERIA 2JUCA 1C0WA 2L9VA 3C7JA 3MZHA 4XOTA 4WF2A 4ZYDA 4GYIA 3O3KA 3H36A 3K4NA 1YLFA 4IQ4A 1ZGAA 2BBYA 4N9HA 2RC4A 3M7GA 2A6HF 3QAHA 1A5JA 3D0SA 3K2AA 1JHFA 4XRFA 2LR8A 2X1EA 2ZCWA 1SD7A 1ZAOA 1S7AA 1J0RA 2AO9A 2JPBA 3DWLE 3N97A 4BQNA 2XPWA 5DS9A 3V7SA 3I5UA 4CYCA 4XLHA 1G8XA 2G7HA 2WAFA 4BUPA 2QSGX 2GA1A 1WRJA 1VQ4I 2BY0A 3AKZA 4F92B 4HX4A 4DQ2A 1RC9A 1MBEA 3GFLA 2O0YA 4MQ9F 1G4DA 2COMA 2JZYA 3EUHC 2E5ZA 1QPIA 1BW5A 1J2XA 1O7FA 4L18B 2X1CA 3HJEA 5DD4A 5LHIA 3A2KA 2W1OA 4B4CA 3HEFA 4EATA 4ZYGA 3PJRA 5CVRA 2V1NA 2M3AA 4HA8A 2B0LA 2VC1A 3DEWA 4BQOA 3CO6C 5M5WJ 2GWRA 4HOBA 2DMTA 4RGUA 3KFWX 2VQLA 4PUSA 3TOAA 5FRNA 3MZYA 3M3YJ 4IHXA 4IF4A 5E1ZB 4KMFA 3K4BA 1ZH5A 4XSZF 1JHHA 2L7FP 4P9UA 3H92A 1H89C 2DJIA 1H9GA 3CC7I 3VYSB 1FOXA 3A02A 4BJTA 3HUGA 5CKTA 2HXIA 5C44J 2GA2A 4YELA 5HDNA 4WXDA 3OYJA 3FXJA 1X4PA 3H9GA 3QYFA 2D1HA 2UWMA 2VLAA 4PJMA 2JQ7A 4FQGA 5ICGA 4E7HA 3CDLA 2X4HA 1WJAA 1HBXG 5F1RA 4A2UA 4A6EA 1VQ6I 4YIRX 4RAYA 1I27A 1OYIA 2PBIA 2PMHA 1MZBA 2V79A 3JRDA 2CQ7A 5CVJA 3L7WA 2UZKA 1XDSA 3ZQIA 1MH4A 4BY1J 2BVLA 5CPRB 4HLXA 4FISA 2O8XA 3J7YJ 4LLNA 4IRIA 2ETHA 1MNEA 4KN4X 4CSWA 3E97A 1ZELA 1FYLA 1VI0A 4L0YB 4KIBA 3HB9A 4HYEA 3BR5A 1HW1A 3BZ6A 1TC3C 1LFBA 2MA3A 3S2HJ 4E4HA 3WODF 2JJ7A 1LEAA 2E1MB 3GWZA 3MMYB 2PN6A 3ABLH 3TEDA 1NG6A 2W7NA 2JA5J 3J7AY 5IT9K 5EYRA 3K1MA 2ELJA 2RQPA 3DPLC 3SZGA 5M5XJ 2STWA 1MDMA 3CD6I 2V6EA 3FIWA 4LJZF 2DQLA 1TP4A 5CVUA 2QBYB 3KP3A 1J59A 4PFOA 2CSOA 4M9ZA 4EVIA 3S14J 3CP8A 3OS1A 2FNAA 4P55A 4RS8A 1U8BA 1DDNA 2O3FA 5F0HA 3J7ZI 3RZOJ 4KUMA 3A01A 2ID3A 2EFWA 3BP8A 3CJNA 1IO2A 3DBRB 5LHHA 5GAGJ 1IN6A 5GADJ 4B3AA 3HC7A 1MBGA 4LMYA 1YJWI 1JT0A 1PUEE 3GTPJ 1F9NA 3OWTA 3CQZJ 2HGCA 1E2XA 1FYKA 2VKEA 4HNVA 3DTKA 2DK8A 4LITA 4Y3OA 1H0MA 1HW5A 1OFCX 2ESNA 1ULYA 1R4NB 5KNLA 1XTAA 1TNSA 3PNTA 4XLFA 4CCJA 3CCRI 3QP5A 1X1AA 2R7QA 3LA2A 4M6YA 3ZXSA 5EZHA 3MKYB 3K4LA 1XGMA 3EQLF 4W1UA 5K5OA 3LQQA 2VJJA 4YFKF 3WTUC 5J3LA 2BZTA 5DDGA 2D1VA 3LAPA 3DCFA 1IRZA 2NS0A 3DBHB 3NEUA 1OJLA 2EFQA 1JKRC 2A61A 4RAGA 1VQ5I 4OINF 2EZKA 1WPKA 2XIGA 4IJAA 3TMOA 2KZVA 2VPLA 3EPZA 2VE8A 2CH0A 3C18A 3HRSA 3R0AA 3ELKA 2UXNA 4ESJA 1ITYA 5DCMB 1K4SA 4O3MA 3GTOJ 3BROA 1ETWA 2Q8KA 3ISPA 5GTIC 1B72B 1MH3A 2HOTA 2A5YB 3S16J 4LD5A 1B6AA 2LY9A 4L5JA 3HOSA 5IYDJ 3CCMI 2DMQA 4I76A 3CF2A 2DFIA 4WXCA 3VYUB 1WJDA 2V1DA 2VKHA 5D6FA 3OYBA 1XMKA 2DOEA 3W6JB 3L9FA 4FTHA 2WA0A 3S1QJ 3G3ZA 3T8TA 4M73A 5E17F 5D5UB 2EV6A 2CFXA 3QOEA 2KL4A 5FKNA 3WG9A 4I6ZA 3J81K 3SFZA 3BTLA 4M3FA 1ZK8A 2IA1A 5GP9A 1LNWA 3OYCA 1XMAA 1FIPA 4HBLA 1V5GA 3QP6A 5IP7J 4IHSA 1R71A 2E1MC 3PO2J 3RKYA 4CCMA 2RGVA 3IWFA 3GFMA 3PSIA 1LEBA 2ZMEB 4A3IJ 1HC8A 2R7ZJ 3CJQB 3H9JA 4QIWN 3FMSA 3I58A 3LOCA 4KIFA 3TGNA 3F9KA 4CCKA 1BJZA 5IT3A 3G4SI 5FLXK 2MABA 2M7BA 1LE8A 3BZCA 1A6IA 1MJAA 1YYVA 4A0YA 5CQGA 2XHKA 5IP6A 3FF5A 4B3XA 3CP2A 1LQ1A 3HIFA 2R5YB 2E2HJ 2OCEA 3DTIA 2M8EA 4LIVA 3QYEA 1KQ8A 1BIAA 3DLAA 1GT0C 4BE1A 1KA8A 5BPDA 1XCBA 1N77A 4C3IJ 2LBFA 2FBIA 2LKPA 3AL0C 3H0DA 2FBKA 1I50J 3S1MJ 4B1RA 3G73A 3C2GA 1ZLKA 2M1BA 5J40A 1IW7F 2NVQJ 1GXQA 1HSTA 4BEHA 3HOYJ 1TQPA 2HZTA 4C3HJ 2ESHA 3ESWB 3LA3A 3M1CA 3H5AA 1IXCA 4EMSA 4EQQA 2QLZA 3KYDB 2K4JA 5F0CA 3K2ZA 4RA2A 4ENKA 2PEXA 4PSXA 4BDZA 3RSNA 3D5RC 4LG0B 2M9HA 3BPXA 5M3MJ 3W2AA 1T0FC 4OMYA 3LMMA 3UNGC 1W5SA 2NVUB 2IGOA 5L3CA 1A36A 2DDAA 1QVTA 4W97A 3SEZA 2K27A 4ZZLA 3JCUC 3CLQA 2HPMA 4MHGA 2CQXA 1S5LC 3EYYA 2KJBA 3BJOA 3SZPA 2R0QC 4UVAA 2PJRB 2FXAA 1EV7A 1FBQA 1LVKA 2OBPA 4HSRA 1KU7A 3ECHA 4M3GA 1X58A 4AD9A 3PUBA 1FPQA 3E5QA 4U7BA 4DZPA 3RI4A 3K9TA 1BI1A 5KAFC 1HLVA 2Y9ZA 4CA0A 2P8TA 2DQRA 5B1BH 3DU6A 4HQEA 1JE8A 2DTZA 1D8JA 2CGPA 2JRTA 3SDGA 2HZDA 2H6CA 2CG4A 3JRHA 2DA1A 3TOBA 4YIFA 4IXAA 5E20A 2XASA 4BHCA 3PQJA 1YFHA 1YRNA 2D5VA 4HV6A 1Y56A 2MW8A 3IKVA 2LTPA 2Y31A 4HF1A 3FXOA 4LIUA 3KIOA 1OKRA 3M1EA 1OYYA 3P5JA 4Q48A 4D0PA 5FKLA 3RKXA 3GFJA 2PQ8A 3QYBA 2CV1A 2DDBA 1JTYA 1B8IA 1XC5A 4UY8I 2ZMEC 4RB3C 4I02A 4XKWA 5J1UA 1O3SA 3KZZA 1ZARA 2RKHA 4RMNA 1K61A 5IYCJ 2IP2A 2YU9J 2LSOA 2HXOA 3EUAA 2XPVA 2Z33A 3KP2A 4CZCA 2QYOA 1O3TA 4ZTJA 2LP0A 1XDUA 2XRLA 4I99C 4KNYA 2WY8Q 3FBNB 1BBYA 4Y15A 4HDVA 4I09A 1LFUP 1PDNC 5L3BA 1QU3A 2DK5A 1Y8QB 4ZTFA 1GXPA 1IRGA 2AXLA 4I7HA 3BQYA 2BY1A 3LSGA 1YI2I 2LVSA 1KU9A 4J19A 2QKLB 1E3PA 2IVMA 1Z21A 3H35A 2VT2A 4E7IA 2VQHA 4QTRA 2XAQA 2M30A 3OMYA 3L2WA 4XN0A 3RTRA 1K83J 3Q0UA 4AVPA 1O7LA 4C2MJ 3TO6A 1YITI 3WE2A 3FISA 3V8LA 3U1KA 4EV0A 1UB9A 1BJAA 2QM3A 1N75A 3VSLA 1WGXA 2VBXA 5H20A 3DLLF 1ZR2A 2E36A 2DA6A 2LF7A 2LFBA 3OSGA 5D6EA 3CDIA 2V1XA 2L4AA 3BOQA 2CQQA 3WGHA 1W1WE 2BE5F 2PG4A 2IS2A 2JA6J 3CZ6A 2AQFA 4LLLA 2V9KA 4JBAA 1UJ8A 4L9TA 2F5FA 1B4AA 4CXFA 2VIXA 3WTTC 3S3OA 5FO5A 4FCYA 2KJCA 1ZRFA 1GUUA 1QHHD 4HX8A 3QPTA 3VSKA 2FSWA 5F04A 4II2A 4DYQA 3JRFA 2FRHA 3GX4X 1A04A 1Y1VJ 4AUXA 1O57A 3FK7A 1Z1DA 2IS6A 1XSVA 4IPAA 2LMDA 5EZGA 1W7PB 3LFUA 3CCLI 2CU7A 4UB6C 1JXSA 3VPRA 3KLNA 3REOA 3TBIA 2EIKH 3VB2A 3FDYA 2L9RA 3JRBA 1D8KA 3VOEA 2WV1A 2DOAA 1VTNC 5F0FA 3CCSI 1QZYA 4Z2YA 3S15J 4RB2C 4IZZA 4OMZA 1QO0D 2BY3A 4JK1X 2M87A 3FXRA 1EH6A 3V8KA 2K9SA 3SYTA 3GUDA 1V5EA 5HS7A 3NAUA 2GOXB 4IEJA 3OIQA 2FQ4A 4FETA 5J8FA 5K7FA 2K86A 4U88A 4I0BA 1KGSA 4L0ZB 1RR8C 4JYKA 3MKWB 2L7KA 3M8JA 2DTRA 2FUG2 3QPSA 1MW7A 2XUBA 2JWTA 4UNOA 5K5QA 3I64A 1FTTA 3E5XA 2CQNA 5DD8A 3OYGA 3S1RJ 1HQCA 1FC3A 3PFYA 5LBQA 3FXMA 1RKWA 4BU2A 2QEXI 3FMQA 2HTSA 4EM1A 1WHUA 1STZA 2XB0X 3KYLA 2R7VA 2F4MB 1IV8A 4B43A 5H6QA 1BL0A 2CFOA 2DO7A 2EQRA 2ID6A 2M4GA 3HOVJ 4A3BJ 3H3UA 2M4KA 3IRQA 3QWLA 1PP8F 1YHQI 4KT6A 4C30A 1SFUA 3E6CC 2XF5A 4X1EA 1U0JA 1ZGJA 2VBYA 3BG3A 2GAUA 3SQNA 1HOMA 3A1YA 5EG0A 2CV0A 4AC0A 1G3SA 4LLGF 2QZ8A 1I5ZA 3ZN1A 2UUZA 1AA7A 4MIMA 2VONA 3M8FA 2KHMA 2F6CA 3A4CA 5EEAA 2YX4A 5CVVA 2F5EA 1FMVA 3U2RA 2WAEA 2F4IA 4IRHA 3PFIA 1ZKGA 3VODA 2WBMA 3ZCOA 4CCNA 3DKXA 4YFNF 1R23A 4XLCA 3PO3J 2DT7B 5D8LB 1FSHA 1VF9A 2Z16A 3AG3H 4S05A 2R7OA 2BVMA 2BXZA 4XKCA 3ZOBA 4KITB 4Y52J 3AG4H 2CV2A 3SDBA 2DPDA 4RGSA 1S7OA 4B8XA 4XRMA 3ERED 5HLIA 1EA3A 1OMIA 2GZWA 3BLYA 1PP7U 3ZQHA 3O8GA 5HS8A 4KN7X 3WTWC 4UB8C 4IQJA 1Y6IA 4AIJA 1Z7UA 4AVZA 2Z2SB 1BOAA 1FSEA 2L54A 4UXNA 1EJ9A 5L3FA 3IKTA 2M34A 3OL4A 4M3BA 4UUSA 2HNHA 3CTAA 2K7LA 3SEQA 1JTXA 1NH3A 2P0WA 1R7JA 3ROUA 5FRMA 1WI3A 1BR1A 1SC7A 2IXSA 2OQRA 2Z5UA 4XSXF 4ITVA 2ZJQF 1G3YA 1T56A 5EEGA 3LQRA 4JP0A 1POGA 5CVIA 1LPQA 1JKPC 4EJWA 5JVGF 2W84A 1T33A 4ZZDA 1B59A 2RQQA 1RKTA 2R3SA 2M8GX 2MG4A 3BR6A 4XORA 3E0JB 4A3KJ 5B1AH 4F55A 2EK5A 4ESBA 1UHMA 4P5OA 5BQTA 1LVAA 1ETOA 4A69C 3SJMA 1WJ5A 2F5CA 4R79A 2CQKA 4HEA2 4CCLA 1IC8A 1K79A 1ZG3A 1USSA 2DA5A 5DV5A 4PGHA 3AFHA 2I5UA 4U0WA 2K9LA 2QKMB 5D4RA 1OR7A 3JAMK 3PM1A 4P1WA 2IAIA 2E7XA 5IT9Z 5E8IA 2HQAA 2WADA 2P5VA 5HLTA 3A01B 2XGXA 4XRSA 5F64A 3PSFA 4P9FA 1X2NA 3E1SA 1Q1VA 1ZN2A 1USTA 1AHDP 3P9KA 1RIOH 5AIQA 5A2QZ 1A35A 1AKHA 1HW2A 1X1CA 2CO5A 3ZQFA 1KZHA 1TWGJ 4II3A 4XL9A 3GFIA 3HRMA 2VKDA 2EV0A 3HOXJ 3GZ6A 1X3WB 4IHWA 3BCAA 1D1AA 1HSJA 1X1DA 3LWFA 3RJPA 1N25A 2P6TA 2IS4A 2EIJH 3ASOH 2EILH 3BR0A 4BQAA 1FMWA 4U87A 3EUHA 1GVDA 1V55H 5GPAA 5TRDA 2D2WA 1VQ7I 2MH9A 4KFCA 2ZO4A 1R5HA 3B6AA 4XOPA 2RN7A 3ABUA 3VEPA 2P5LC 1E0EA 4PFPA 2GXAA 1EH8A 3FX3A 2VUMJ 1JUPA 2DI3A 3JR9A 1FIAA 2F5DA 4DJAA 2OCCH 1J09A 3F22A 4A0XA 4BHBA 2A6TA 1YW9A 1WFXA 2O5RA 2X0LA 4MTEA 4A3GJ 4XNFA 4NNJA 2QF7A 2ZJ2A 1OCTC 4DZJA 4FASD 4LG3A 2L01A 4XLEA 1MMGA 1CQTA 4HNUA 2KQRA 3HXLA 4BQQA 5LFAA 1MSFC 4IHYA 2A5WA 1R49A 4UV8A 2R5ZA 5HLHA 1ON1A 3LNQA 4XLNF 1J5YA 3SHFA 2EPFA 5F1JA 4NQWB 3BPVA 2X6YA 1MNMC 4L5IA 3ZMTA 2HQRA 3FXQA 3IAM2 2K9MA 1MKMA 1R00A 1ZRDA 4XR6A 4JX4A 2A05A 1E17A 3WU2C 2QENA 2QSFX 2HDDA 4GGGA 2IJLA 3ZQQA 3KEQA 1IDYA 1W36C 3W6VA 4OIQF 4HZFA 3L1PA 1VQMI 1SMTA 2N8GA 1ETKA 1V5FA 1X3UA 2DA7A 2OF7A 2BGCA 5LGUA 3K70C 4ENMA 4HX7A 2FD5A 1I1GA 2XF6A 2STTA 1ZG1A 3TDUC 3J81Z 3GTJJ 4U0VA 2DFFA 3IC7A 3K6GA 1LE8B 3BG6A 4CUGA 4EM0B 2VL8A 2EBIA 2ZC2A 2EFPA 3E3VA 3BG7A 4LK0F 4A0ZA 3CMYA 2VC0A 3COAC 2HOAA 1CF7B 2JSPA 2I8DA 3Q9SA 3RQ4A 2LOOA 5LGNA 2M0CA 5EF6A 4ZDLA 5DUIA 1XG1A 4AM3A 3I4PA 1JKOC 5FLXZ 2E2JJ 3NRVA 1U5TB 4M72A 3S32A 2FU4A 4M6XA 2L5QA 2L3DA 2NOGA 2LBFB 4G7OF 2VBWA 3OR1C 1Y39A 4Y33A 2DT6A 2FEZA 4PCQA 1P2FA 1TW2A 5ICEA 4XONA 2NAZA 2CMPA 2Y30A 2XAUA 4BEHB 3W6KB 1DPUA 1QA6A 2JPCA 3ZMDA 1VNDA 3LSJA 2ECBA 1BC7C 1JGSA 5KHDA 2RNJA 5FFXA 1W0TA 1BOBA 3MEXA 1MMAA 2DCEA 2ZB9A 3VFZA 3T1BA 2XSDC 3DEUA 5EGOA 3D5SC 2KT0A 1MD0A 5CQEA 1ON2A 3F72A 3HL2A 2VQGA 1D1CA 4GCVA 5IP9J 2LC2A 2X6WA 1U8RA 2LKXA 2JVHA 3A03A 1IAWA 5LHGA 4IOAF 2QCOA 2J5PA 4I0AA 4BGDA 3HRUA 3SXYA 2OPTA 1S6LA 2K4BA 3PIPF 2BW3B 2KRCA 5J1RA 3KP5A 4A3DJ 3GO5A 4G94A 2J5OA 2XROA 2YUSA 2HDCA 5D5WB 3T8RA 3LSPA 1FT9A 3NWTA 3FHZA 4G7HF 2PJPA 1GLNA 3GTKJ 3QPHA 3U1DA 1HCRA 1FYMA 4OOIA 3PIOF 1XPXA 3SZTA 1ETVA 2OZ6A 4UVBA 2IPQX 5FJ8J 2KMUA 1YOVB 2QSHX 1F5TA 2K9NA 4LOCA 2GOMA 2JN6A 1AU7A 1VQ9I 4HF2A 5JFRA 3MCZA 4DNCA 1HKTA 5F6FA 3I53A 4ZDPA 4ESFA 1WH7A 4EEFG 1X19A 2NNYA 3E5UA 2H1LA 3KLOA 5JHUA 4Y17A 4GDFA 3CUQB 5GPCA 5E3OA 3CC2I 4CICA 1X4OA 2X6XA 1Z3XA 3FZVA 3BC8A 2Z99A 5AONA 1P4WA 5KCMA 1IRXA 4I98B 2K9QA 2BHZA 1TT5B 1FOYA 1SMYF 2JA7J 3KZIC 1QGPA 4ZJZA 4HNTA 4FX4A 1LUJB 2FOWA 3Q0VA 1IN5A 1TW3A 3Q0WA 3K0LA 3WTYC 2B9SA 1W5CC 4OU0A 4PZJA 1U5TC 1K4TA 2Z3YA 3WU0A 2LYCA 3I4MJ 1Y1WJ 4NBQA 2MD5A 2QBYA 4KMUX 2LG4A 1DGWY 2CUJA 3I4NJ 3IHUA 3EUKL 4BXFA 1BI0A 5DTDA 1ENHA 3CESA 3K7AJ 2E7WA 1P92A 3C2HA 3GW2A 3FXUA 2JSCA 3BR2A 1XD7A 1VFCA 3I55I 1FBSA 2HQ5A 3HTSB 1BIBA 4CGZA 3G1OA 5TISC 1L0OC 2HKOA 4NUBA 4BJ5C 2PLYA 2HEOA 4E7KA 4Q5SF 2GQQA 2HS5A 3ZP5A 2R4GA 5EDNA 1MBJA 3ML6A 1U9OA 3CCVI 2ZXWH 1ZREA 2F48A 1IV6A 2ZSHB 3HOZJ 3JRAA 5FD5A 4EM2A 2KRFA 1JKQC 2W85A 5FLMJ 2L4MA 1DP3A 5D4SA 3RPQA 1JUMA 5LRSA 1T0FA 2DOFA 3PQKA 3F0CA 4L9VA 4BS9A 3X2QH 1FJLA 3KP7A 1JJ6C 5D8KB 2R7TA 1ORKA 1TQMA 2IA2A 3EDPA 2K40A 1RUNA 3DQVC 3OS2A 1GDTA 3F8MA 3QU3A 1O4XA 1OCCH 4A3LJ 2C6YA 2E5NA 1RNLA 1WZ2A 2VN2A 5E18F 3HOTA 1EH7A 2VPRA 3A0BC 2OTLI 2R7FA 2RNGA 3L09A 2OV7A 4JQFA 1Z9CA 3CDHA 1B72A 1QHGA 3OYEA 1G6NA 3HHGA 1YW7A 4O5VA 4IO9F 4DW6A 4G6TB 2JK3A 1UAAA 3WU1B 4ETSA 5HNHA 5TGTA 1TQIA 1MSEC 1T2KA 3CCUI 1WJCA 2FBHA 3CUQC 5EEHA 2LKSA 5ICCA 5HLGA 2XGDA 2CRGA 1IXSB 2NS7A 2Y0SA 3F6VA 2KIMA 4C2TA 2DJNA 4XBFA 2XPUA 4IOCF 3BR1A 2WV0A 5HDKA 2R7WA 1WKMA 5FB2A 1KYWA 3F8NA 3I59A 2F2EA 2ZBKA 5M5YJ 1YQAA 1E3HA 3T0YA 3TW6A 3CJTB 4K2EA 2ZJRF 3MAJA 2ZMEA 4YRVA 4X0GA 2DPUA 2LY1A 1GHCA 2NYXA 1EF4A 2Y75A 4A3JJ 2CW0F 3CCYA 3OYMA 2ZFWA 4HLYA 4Y13A 3IH4A 2KDOA 1U2WA 4MFEA 3O6BB 1PUFA 3JW4A 2BHYA 4DYCA 2VQCA 2ECCA 5EG0B 1WQ2A 2QQBA 2PFBA 2W82A 4A6DA 5J4VA 4FT8A 1AOYA 2AQEA 1XGOA 1RRJA 1TWAJ 2R5YA 4ANJA 3SFIA 3TL4X 2Q1ZB 2IGKA 2V4JC 3P9IA 1K78B 2YPRA 4PGGA 2LDUA 3FHNA 2ELKA 1FEXA 4N9IA 4NB5A 2WTEA 5J47A 3MN2A 2DN0A 3JRCA 1V54H 3CCJI 1SFKA 4BJ6C 1TT0A 4CHUA 3I71A 2LNBA 1LDKB 1TWCJ 3H3ZA 3RYRA 3FM3A 3K4CA 4HG2A 2DU9A 2XRNA 3ABMH 4A3CJ 1APLC 1Y0NA 4H4KC 3S1NJ 1ETYA 1UG0A 3DU5A 1X2MA 4ASNA 1YX5A 5CJ9A 2HVRA 4OWRB 1F43A 4D5FA 2HVQA 2JVGA 2KIFA 5FD6A 3NQOA 3BCBA 1X3ZB 2BYVE 3LSTA 3FXKA 3T5XA 3HKZN 3OYKA 4LG0A 1ETXA 5L3EA 3W2VA 3LAJA 2MSYA 1KU2A 1YJ9I 3I56I 3BY6A 3H0GJ 2F4OB 2RAEA 2HTJA 4XRSG 3FBIB 2E19A 1P4XA 3MKZA 1WWXA 2PJRA 2V7FA 5BPIA 3J7AO 2PMZA 4ON0A 3N05A 1V4RA 2HYGD 2XKOA 1K6YA 1RZ4A 1JUSA 4XM3A 1IXRC 2IGMA 3JTGA 1B1BA 1BW6A 2VJ5A 2AXTC 4XLPF 2M0MA 2HFHA 2V26A 2P81A 2XGEA 2W48A 3FKJA 2CWEA 2Y0MA 2MYSA 1SEUA 3B73A 1RR7A 3GYHX 2R7DA 4LFUA 4CYDA 3S8PA 3KCCA 5B3SH 3KE2A 2ZSIB 1SVOA 1I39A 5JHFA 4IHTA 3GXOA 3HKZA 1OCOH 3S3MA 1F1ZA 1K7AA 4GO1A 3FXLA 2R7UA 2A6EF 2G7UA 1UMQA 1BN5A 5JVTA 1Z91A 3M9AA 1WVRA 1WSUA 1ERDA 3FKIJ 4RM2A 2LY2A 1ZG5A 2HVSA 4LB6B 4J00A 4C9YA 4MTDA 3WGIA 2EFOA 4CYCB 1FNNA 4KA4A 2YSRA 3ZMUA 3AG2H 4D5CA 5GTHC 2EA4A 4B48A 2HPIA 4DIQA 3QRFF 1XGSA 4A93J 2HYFA 4NC6A 1ZTRA 2DT5A 2R92J 2HI3A 3MKLA 3CLOA 5M3FJ 2Q0OA 3BDDA 3UR3C 5J6XA 2X6OA 2Q2EA 4NC8A 4UVCA 3W3CA 4ZYEA 1R4MB 4XIDA 1AKHB 2PI0A 3L2VA 2BXYA 5FROA 1QBJA 2ZNYA 1NHAA 3BTIA 2QUFA 3RPUA 1YO5C 3FMRA 1W0UA 2H09A 2ZNZA 4MEXF 1BC8C 1XX5A 4NHJA 3IL2A 2VE9A 4OIPF 1MBKA 2FMYA 3F6OA 3ZRGA 4DBRA 5FFZA 2FA5A 3ZMVA 3WTVC
chains in the Genus database with same CATH topology
3KETA 2CYYA 5ILVA 5ED4A 3J80K 2EJRA 1D5VA 4CDGA 1G3TA 1W4MA 2NNNA 1RI7A 3ZQ7A 2OD5A 3P7NA 1R5GA 3R61A 2IA0A 1TLHB 1V3FA 1SD4A 3C1DA 3CUOA 4EJTA 3WE3A 3R60A 3L2CA 3KEOA 1TTYA 4YIIA 4I2OA 3FM5A 4WXHA 3F8FA 2QWWA 2XAGA 2HQNA 5HVQC 2M45A 4LB5A 1W7PA 3EETA 2BV6A 5KVRA 4N0BA 3DV8A 3HSRA 4BYYA 2RDPA 3DXJF 1YG2A 4A5NA 1MDMB 3DF8A 2Z9OA 4KYWA 1DUXC 1H9TA 4ZYHA 2MBFA 3HRTA 4EGZA 2DLLA 4A5MA 2LF8A 5E8GA 3RIRA 1P6RA 4KICA 4AWXB 3IRRA 1KQ0A 1J7KA 2FF4A 5E1WA 1J9IA 2VBZA 1OPCA 4MGRA 2FNPA 1I1SA 2GXGA 3R4KA 5J8CA 4CZZA 4EJOA 2ZKZA 2A68F 4WK8F 1FP1D 4Q4ZF 3E6DA 1IUYA 2O6GE 4FX0A 5DCFA 2OA4A 5HDGA 2RV8A 4L9JA 4M74A 1Z6RA 2HWVA 1YS6A 5LLQA 1FLIA 4I01A 3K1NA 5ILSA 4MEYF 4G7ZF 3ZMSA 3RYPA 1L3LA 4G9YA 1QNTA 2XAHA 2OAZA 3OOPA 2YU3A 2WC2A 2KKOA 4TV7A 1FY7A 5CYVA 4M9XA 4HF0A 1ONVA 1J75A 1T98A 2DBBA 2ACJA 1U3EM 3Q5FA 2MH2A 4GYGA 1KYZA 4RGXA 3V7RA 2OU2A 4M9SA 2QQAA 2K02A 5TJJA 2WWYA 1W7PD 5L3DA 3QU6A 2ELHA 4M71A 4O6JA 4Q47A 2G9WA 2P6SA 2P5KA 1UHWA 4LK1F 4UHTA 1YW8A 2VODA 5A2QK 5BOXA 2V9VA 4R1HA 4UUVA 1ODDA 1IZ1A 1LDJA 1UFMA 2HR3A 2EWNA 2VT3A 3F23A 2VOPA 3MFKA 1MGTA 1LB2A 2NRAC 2IT0A 1IN7A 4F7ZA 3IWZA 4KT5C 1G3WA 3AAFA 1HKQA 3V7CA 3R0JA 4G6DA 2ISZA 3ULQB 1DP7P 1XGNA 1T6SA 4PDKA 1QQIA 2YR2A 2ADUA 1TBXA 2EB7A 3DKWA 2ZXJA 2Y48A 3TQNA 3DPTA 4NQWA 4KIGA 1FZPB 2HOEA 3V4GA 3L00A 3F8CA 5JI6A 3TO7A 2E1CA 4LGWA 4L9NA 3I59B 4WCGA 2O61A 2ISYA 3ZPLA 2H27A 2QQ9A 5CLSA 2OZUA 4G8XA 3C3WA 2H6BA 3LFKA 2W24A 5DUKA 3F8BA 1CF7A 2HKXA 4AIKA 3LA7A 3F21A 1RUOA 1KQ9A 1FP2A 5ICFA 5LGTA 5AIPA 2DW4A 5DYMA 3KZYA 5L3GA 1YS7A 5ILUA 2A07F 1P4AA 2EA2A 1U5TA 1R36A 2MC3A 2KIUA 1S29A 5BS6A 1AWCA 2FMLA 1GVJA 2JT1A 3CO7C 2DAOA 2TDXA 3D5LA 4BH9A 1CGPA 3ZN0A 4ENJA 2O03A 3EYIA 2XV4S 3JSPA 4R8HA 2MLGA 2E1NA 2D45A 2IRFG 4RB0A 4QLCU 4RGRA 1R22A 1XSDA 1LDDA 4MQVA 1R58A 5DCMA 2RVCA 4HQMA 1Y0UA 3BJ6A 1D3YA 1YIOA 1IN4A 3TKYA 3Q9VA 3HSFA 3O2PE 4EGYA 1F4KA 4G6QA 2VOOA 4RB1A 4H0EA 1SD5A 3P9CA 3V8JA 5HOOA 1Q1HA 2UXXA 1B9MA 1KU3A 4WWCA 3MWMA 1W5TA 2IW5A 1OYWA 4HAMA 1Z6TA 1R1TA 3CUQA 2GXBA 1HXDA 1MJBA 2FQ3A 2P7VB 3BJAA 2XAFA 2A69F 2A3SA 3KP6A 2FOKA 3WTSC 4HW0A 3GLXA 4U0YA 4B09A 5KK1A 6PAXA 4BNCA 2AS5F 4U7DA 3GEZA 2OQGA 5FGMA 2XAJA 4RAZA 1R1UA 1FOKA 2BEOA 1BM9A 3GF2A 1QZZA 4ENNA 1T39A 1K6OA 3ECOA 3JSOA 1DPRA 3J80Z 3RKWA 3WTZA 2JTVA 3WGGA 3ABTA 5K1YA 2W25A 2GIVA 1LJ9A 4OIOF 1YTYA 2M5WA 1IF1A 5D5XB 1FWZA 5LEKA 3KP4A 3RDIA 3TO9A 2XVCA 1B9NA 1T38A 3GZ5A 3N4MA 3I54A 4EJVA 5D5VB 1QPMA 1U78A 4WX9A 1HKSA 4YFXF 3E6BA 1SD6A 2FE3A 4IRGA 3M8EA 4S04A 3HHHA 5LRRA 1REPC 3BWGA 3F3XA 4FHTA 4KDPA 4OIRF 3R6SA 3HYIA 4UV9A 1SAXA 4YG2F 3ZMZA 1IRFA 1XSXA 1Z05A 3HTUA 1FX7A 5E1XA 2VXZA 2EV5A 3I0TA 4ZH4F 1S3JA 1U6GA 3B02A 3JAMZ 5BMZA 5JR3A 5LEJA 1O3QA 1XCVA 1BI2A 1S8NA 3HSEA 2H94A 3TDZC 3E6MA 3FWEA 4BAYA 1XB4A 1MJ9A 3K1PA 3DFGA 4E70A 5H6RA 1TNTA 4MNUA 4P96A 1I6XA 2V6CA 2P4WA 1K78A 2XKPA 1ZRCA 2W57A 1ZHFA 2YX7A 4GXOA 1XN7A 2L02A 1FBUA 1UCRA 5HS9A 3OV8A 1SFEA 2P7CB 2EFNA 3QOPA 5K5RA 2PMUA 1R1VA 4QWQA 2QVOA 4AIHA 1ZYRF 4HV5A 3U9GA 4BHPA 4EJUA 3DP7A 3K69A 3WTXC 3GVAA 1SFXA 4CO8A 4HDUA 5DEQA 2MLKA 1WI9A 3JTHA 4A12A 3MQ0A 1O3RA 1IN8A 4IVNA 3S2WA 1ZLJA 1BI3A 4BXUA 2V1UA 5ERIA 1C0WA 3C7JA 3MZHA 4WF2A 4ZYDA 4GYIA 3O3KA 1YLFA 1ZGAA 2BBYA 4N9HA 2RC4A 3M7GA 2A6HF 3QAHA 3D0SA 1JHFA 4XRFA 2ZCWA 1SD7A 1ZAOA 1S7AA 1J0RA 2JPBA 3N97A 3V7SA 3I5UA 2G7HA 2GA1A 1WRJA 4HX4A 4DQ2A 1G4DA 3GFLA 2O0YA 4MQ9F 2COMA 2JZYA 1J2XA 1O7FA 4L18B 5DD4A 5LHIA 4ZYGA 5CVRA 4HA8A 2B0LA 2VC1A 3CO6C 2GWRA 4HOBA 4RGUA 3KFWX 3TOAA 3MZYA 4IF4A 5E1ZB 4KMFA 1ZH5A 4XSZF 1JHHA 4P9UA 3H92A 1H9GA 3HUGA 2GA2A 5HDNA 4WXDA 2UWMA 2D1HA 5ICGA 2X4HA 1HBXG 5F1RA 4A2UA 4A6EA 4RAYA 1I27A 1OYIA 2PBIA 2PMHA 1MZBA 2V79A 5CVJA 3L7WA 2UZKA 1XDSA 4HLXA 2O8XA 4LLNA 4IRIA 2ETHA 4KN4X 3E97A 1FYLA 4L0YB 4KIBA 4HYEA 1HW1A 3BZ6A 2MA3A 3WODF 1LEAA 3GWZA 2PN6A 5IT9K 3K1MA 2RQPA 3DPLC 2STWA 1MDMA 4LJZF 2DQLA 5CVUA 2QBYB 3KP3A 1J59A 2CSOA 4M9ZA 4EVIA 2FNAA 4P55A 4RS8A 1DDNA 2O3FA 4KUMA 2EFWA 3BP8A 3CJNA 5LHHA 1IN6A 4LMYA 1PUEE 1F9NA 2HGCA 1E2XA 1FYKA 2DK8A 1H0MA 1HW5A 2ESNA 1ULYA 1TNSA 3QP5A 3LA2A 4M6YA 1XGMA 3EQLF 5K5OA 3LQQA 4YFKF 3WTUC 5DDGA 2D1VA 3LAPA 2NS0A 3NEUA 2EFQA 2A61A 4OINF 2XIGA 4IJAA 2VE8A 3C18A 3HRSA 3R0AA 3ELKA 2UXNA 4ESJA 5DCMB 4O3MA 3BROA 2Q8KA 3ISPA 2A5YB 4LD5A 1B6AA 4L5JA 3HOSA 2DFIA 4WXCA 2V1DA 5D6FA 1XMKA 3W6JB 3L9FA 3G3ZA 3T8TA 4M73A 5E17F 5D5UB 2EV6A 2CFXA 3WG9A 3J81K 3SFZA 2IA1A 1LNWA 1XMAA 4HBLA 4IHSA 3QP6A 3RKYA 2RGVA 3IWFA 3GFMA 1LEBA 2ZMEB 3FMSA 3I58A 4KIFA 3TGNA 5IT3A 5FLXK 1MJAA 1YYVA 4A0YA 2XHKA 3FF5A 1LQ1A 3HIFA 2M8EA 1KQ8A 1BIAA 1KA8A 5BPDA 1XCBA 2FBIA 2LKPA 2FBKA 3G73A 1ZLKA 2M1BA 1IW7F 1GXQA 1HSTA 1TQPA 2HZTA 2ESHA 3LA3A 1IXCA 4EMSA 4EQQA 2QLZA 2K4JA 3K2ZA 4ENKA 2PEXA 4LG0B 3BPXA 4OMYA 1W5SA 5L3CA 2K27A 4ZZLA 4MHGA 3EYYA 2KJBA 3BJOA 3SZPA 4UVAA 2FXAA 1EV7A 1FBQA 2OBPA 1KU7A 3ECHA 4AD9A 1FPQA 3E5QA 4U7BA 3RI4A 3K9TA 1BI1A 2P8TA 2DQRA 4HQEA 1JE8A 1D8JA 2CGPA 2JRTA 2H6CA 2CG4A 3TOBA 4YIFA 4IXAA 5E20A 2XASA 4BHCA 3PQJA 1YFHA 4HV6A 3IKVA 4HF1A 1OKRA 3M1EA 1OYYA 4D0PA 4Q48A 3RKXA 3GFJA 2PQ8A 4RB3C 4I02A 1O3SA 3KZZA 1ZARA 2RKHA 2IP2A 2LSOA 2Z33A 3KP2A 2QYOA 1O3TA 1XDUA 4KNYA 1BBYA 4Y15A 4HDVA 4I09A 1PDNC 5L3BA 2DK5A 1GXPA 1IRGA 2AXLA 4I7HA 1KU9A 2IVMA 2VT2A 2XAQA 2M30A 3RTRA 4AVPA 1O7LA 3TO6A 3WE2A 3V8LA 4EV0A 1UB9A 1BJAA 2QM3A 2VBXA 5H20A 2LF7A 5D6EA 2V1XA 2L4AA 3BOQA 3WGHA 2BE5F 2PG4A 4LLLA 4JBAA 4L9TA 2F5FA 1B4AA 4CXFA 3WTTC 5FO5A 2KJCA 1ZRFA 4HX8A 3QPTA 2FSWA 2FRHA 3GX4X 1A04A 1O57A 1Z1DA 1XSVA 4IPAA 1W7PB 1JXSA 3KLNA 3REOA 3VB2A 1D8KA 3VOEA 1VTNC 1QZYA 4Z2YA 4RB2C 4OMZA 1QO0D 4JK1X 2M87A 3FXRA 1EH6A 3V8KA 3GUDA 5HS7A 5J8FA 2K86A 4U88A 4I0BA 1KGSA 4L0ZB 2DTRA 2XUBA 4UNOA 5K5QA 3I64A 3E5XA 5DD8A 1HQCA 1FC3A 5LBQA 3FMQA 2HTSA 4EM1A 1STZA 5H6QA 2DO7A 3H3UA 3IRQA 1PP8F 1SFUA 3E6CC 1ZGJA 2VBYA 2GAUA 3SQNA 1G3SA 4LLGF 2QZ8A 1I5ZA 3ZN1A 2VONA 3M8FA 2YX4A 5CVVA 2F5EA 3U2RA 4IRHA 3PFIA 3VODA 4YFNF 1R23A 5D8LB 1FSHA 4S05A 2DPDA 4RGSA 1S7OA 4B8XA 3ERED 5HLIA 1PP7U 1OMIA 2GZWA 5HS8A 4KN7X 3WTWC 4AIJA 1Z7UA 1BOAA 1FSEA 2L54A 4UXNA 5L3FA 3IKTA 3CTAA 2K7LA 1R7JA 3ROUA 2OQRA 2Z5UA 4XSXF 1G3YA 5EEGA 3LQRA 5CVIA 4EJWA 2W84A 4ZZDA 1B59A 2R3SA 2EK5A 4ESBA 1UHMA 4P5OA 5BQTA 1LVAA 2F5CA 4R79A 2CQKA 1K79A 1ZG3A 1USSA 5DV5A 4PGHA 4U0WA 5D4RA 1OR7A 3JAMK 2E7XA 5IT9Z 5E8IA 2P5VA 2XGXA 5F64A 4P9FA 1ZN2A 1USTA 3P9KA 1RIOH 5AIQA 5A2QZ 1HW2A 2CO5A 3GFIA 3HRMA 2EV0A 3GZ6A 1HSJA 3LWFA 3RJPA 2P6TA 4BQAA 3EUHA 5TRDA 2D2WA 2MH9A 4KFCA 2ZO4A 1R5HA 2RN7A 3ABUA 3VEPA 2P5LC 1EH8A 3FX3A 2DI3A 2F5DA 3F22A 4A0XA 4BHBA 1YW9A 2X0LA 4MTEA 2ZJ2A 2L01A 4UV8A 5HLHA 1ON1A 4XLNF 1J5YA 3SHFA 3BPVA 4L5IA 3ZMTA 2HQRA 3FXQA 1MKMA 1R00A 1ZRDA 1E17A 2QENA 4GGGA 2IJLA 3KEQA 4OIQF 4HZFA 1SMTA 1X3UA 2BGCA 5LGUA 4ENMA 4HX7A 1I1GA 2STTA 1ZG1A 3TDUC 3J81Z 4U0VA 3IC7A 4EM0B 4A0ZA 2EFPA 3E3VA 4LK0F 3COAC 2VC0A 1CF7B 3Q9SA 5LGNA 5DUIA 3I4PA 5FLXZ 3NRVA 1U5TB 4M72A 2FU4A 4M6XA 2L3DA 4G7OF 2VBWA 2FEZA 4PCQA 1P2FA 1TW2A 5ICEA 2NAZA 3W6KB 1DPUA 2JPCA 3ZMDA 1BC7C 1JGSA 2RNJA 5FFXA 3MEXA 3VFZA 3T1BA 3DEUA 1MD0A 1ON2A 3F72A 4GCVA 1U8RA 1IAWA 5LHGA 2J5PA 4I0AA 3HRUA 3SXYA 1S6LA 2K4BA 3KP5A 3GO5A 4G94A 2J5OA 2XROA 2HDCA 5D5WB 3T8RA 1FT9A 3FHZA 4G7HF 2PJPA 3QPHA 3U1DA 1FYMA 4OOIA 3SZTA 2OZ6A 4UVBA 2IPQX 1F5TA 4HF2A 5JFRA 3MCZA 4DNCA 1HKTA 5F6FA 3I53A 4ESFA 2NNYA 3E5UA 3KLOA 5JHUA 4Y17A 3CUQB 4CICA 3FZVA 2Z99A 5AONA 1P4WA 4I98B 1SMYF 1QGPA 4FX4A 1IN5A 1TW3A 3K0LA 3WTYC 4OU0A 4PZJA 1U5TC 2Z3YA 3WU0A 2MD5A 2QBYA 4KMUX 3IHUA 1BI0A 2E7WA 1P92A 3GW2A 3FXUA 2JSCA 1XD7A 1FBSA 3HTSB 1BIBA 4CGZA 1L0OC 2HKOA 2PLYA 2HEOA 4Q5SF 2GQQA 2HS5A 3ZP5A 3ML6A 1ZREA 5FD5A 4EM2A 2KRFA 2W85A 2L4MA 5D4SA 3RPQA 5LRSA 1T0FA 3PQKA 4L9VA 3KP7A 5D8KB 1TQMA 2IA2A 3EDPA 1RUNA 3DQVC 3F8MA 3QU3A 2C6YA 1RNLA 2VN2A 5E18F 3HOTA 1EH7A 2R7FA 3L09A 4JQFA 1Z9CA 3CDHA 1G6NA 3HHGA 1YW7A 4O5VA 3WU1B 4ETSA 1TQIA 1T2KA 2FBHA 3CUQC 5EEHA 5ICCA 5HLGA 1IXSB 3F6VA 2KIMA 4XBFA 2WV0A 5HDKA 1WKMA 5FB2A 1KYWA 3F8NA 3I59A 2F2EA 2ZBKA 1YQAA 3T0YA 4K2EA 3MAJA 2ZMEA 2DPUA 1GHCA 2NYXA 2Y75A 2CW0F 4HLYA 2ZFWA 4Y13A 1U2WA 3O6BB 3JW4A 1WQ2A 2QQBA 2PFBA 4A6DA 1AOYA 4FT8A 1XGOA 3P9IA 1K78B 2YPRA 4PGGA 2LDUA 4N9IA 4NB5A 2WTEA 4CHUA 3I71A 2LNBA 1LDKB 3H3ZA 3RYRA 3FM3A 2DU9A 2XRNA 4ASNA 5CJ9A 2KIFA 5FD6A 3NQOA 2BYVE 3LSTA 3T5XA 4LG0A 5L3EA 3LAJA 1KU2A 3BY6A 2HTJA 1P4XA 1WWXA 5BPIA 3J7AO 4ON0A 1V4RA 2HYGD 2XKOA 1RZ4A 1IXRC 3JTGA 1B1BA 4XLPF 2HFHA 2CWEA 2Y0MA 3B73A 3GYHX 2R7DA 4LFUA 4CYDA 3KCCA 3KE2A 4IHTA 3GXOA 1K7AA 1F1ZA 4GO1A 2A6EF 2G7UA 1BN5A 5JVTA 1Z91A 3M9AA 1WSUA 1ZG5A 4LB6B 4MTDA 3WGIA 2EFOA 1FNNA 4KA4A 2YSRA 3ZMUA 2EA4A 3QRFF 1XGSA 2HYFA 2DT5A 3CLOA 2Q0OA 3BDDA 5J6XA 2Q2EA 4UVCA 4ZYEA 2PI0A 1QBJA 2ZNYA 1NHAA 3RPUA 2QUFA 1YO5C 1BC8C 3FMRA 2H09A 2ZNZA 4MEXF 4NHJA 3IL2A 2VE9A 4OIPF 2FMYA 3F6OA 5FFZA 2FA5A 3ZMVA 3WTVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KET A;  2CYY A;  5ILV A;  5ED4 A;  3J80 K;  2EJR A;  1D5V A;  4CDG A;  1G3T A;  1W4M A;  2NNN A;  1RI7 A;  3ZQ7 A;  2OD5 A;  3P7N A;  1R5G A;  3R61 A;  2IA0 A;  1TLH B;  1V3F A;  1SD4 A;  3C1D A;  3CUO A;  4EJT A;  3WE3 A;  3R60 A;  3L2C A;  3KEO A;  1TTY A;  4YII A;  4I2O A;  3FM5 A;  4WXH A;  3F8F A;  2QWW A;  2XAG A;  2HQN A;  5HVQ C;  2M45 A;  4LB5 A;  1W7P A;  3EET A;  2BV6 A;  5KVR A;  4N0B A;  3DV8 A;  3HSR A;  4BYY A;  2RDP A;  3DXJ F;  1YG2 A;  4A5N A;  1MDM B;  3DF8 A;  2Z9O A;  4KYW A;  1DUX C;  1H9T A;  4ZYH A;  2MBF A;  3HRT A;  4EGZ A;  2DLL A;  4A5M A;  2LF8 A;  5E8G A;  3RIR A;  1P6R A;  4KIC A;  4AWX B;  3IRR A;  1KQ0 A;  1J7K A;  2FF4 A;  5E1W A;  1J9I A;  2VBZ A;  1OPC A;  4MGR A;  2FNP A;  1I1S A;  2GXG A;  3R4K A;  5J8C A;  4CZZ A;  4EJO A;  2ZKZ A;  2A68 F;  4WK8 F;  1FP1 D;  4Q4Z F;  3E6D A;  1IUY A;  2O6G E;  4FX0 A;  5DCF A;  2OA4 A;  5HDG A;  2RV8 A;  4L9J A;  4M74 A;  1Z6R A;  2HWV A;  1YS6 A;  5LLQ A;  1FLI A;  4I01 A;  3K1N A;  5ILS A;  4MEY F;  4G7Z F;  3ZMS A;  3RYP A;  1L3L A;  4G9Y A;  1QNT A;  2XAH A;  2OAZ A;  3OOP A;  2YU3 A;  2WC2 A;  2KKO A;  4TV7 A;  1FY7 A;  5CYV A;  4M9X A;  4HF0 A;  1ONV A;  1J75 A;  1T98 A;  2DBB A;  2ACJ A;  1U3E M;  3Q5F A;  2MH2 A;  4GYG A;  1KYZ A;  4RGX A;  3V7R A;  2OU2 A;  4M9S A;  2QQA A;  2K02 A;  5TJJ A;  2WWY A;  1W7P D;  5L3D A;  3QU6 A;  2ELH A;  4M71 A;  4O6J A;  4Q47 A;  2G9W A;  2P6S A;  2P5K A;  1UHW A;  4LK1 F;  4UHT A;  1YW8 A;  2VOD A;  5A2Q K;  5BOX A;  2V9V A;  4R1H A;  4UUV A;  1ODD A;  1IZ1 A;  1LDJ A;  1UFM A;  2HR3 A;  2EWN A;  2VT3 A;  3F23 A;  2VOP A;  3MFK A;  1MGT A;  1LB2 A;  2NRA C;  2IT0 A;  1IN7 A;  4F7Z A;  3IWZ A;  4KT5 C;  1G3W A;  3AAF A;  1HKQ A;  3V7C A;  3R0J A;  4G6D A;  2ISZ A;  3ULQ B;  1DP7 P;  1XGN A;  1T6S A;  4PDK A;  1QQI A;  2YR2 A;  2ADU A;  1TBX A;  2EB7 A;  3DKW A;  2ZXJ A;  2Y48 A;  3TQN A;  3DPT A;  4NQW A;  4KIG A;  1FZP B;  2HOE A;  3V4G A;  3L00 A;  3F8C A;  5JI6 A;  3TO7 A;  2E1C A;  4LGW A;  4L9N A;  3I59 B;  4WCG A;  2O61 A;  2ISY A;  3ZPL A;  2H27 A;  2QQ9 A;  5CLS A;  2OZU A;  4G8X A;  3C3W A;  2H6B A;  3LFK A;  2W24 A;  5DUK A;  3F8B A;  1CF7 A;  2HKX A;  4AIK A;  3LA7 A;  3F21 A;  1RUO A;  1KQ9 A;  1FP2 A;  5ICF A;  5LGT A;  5AIP A;  2DW4 A;  5DYM A;  3KZY A;  5L3G A;  1YS7 A;  5ILU A;  2A07 F;  1P4A A;  2EA2 A;  1U5T A;  1R36 A;  2MC3 A;  2KIU A;  1S29 A;  5BS6 A;  1AWC A;  2FML A;  1GVJ A;  2JT1 A;  3CO7 C;  2DAO A;  2TDX A;  3D5L A;  4BH9 A;  1CGP A;  3ZN0 A;  4ENJ A;  2O03 A;  3EYI A;  2XV4 S;  3JSP A;  4R8H A;  2MLG A;  2E1N A;  2D45 A;  2IRF G;  4RB0 A;  4QLC U;  4RGR A;  1R22 A;  1XSD A;  1LDD A;  4MQV A;  1R58 A;  5DCM A;  2RVC A;  4HQM A;  1Y0U A;  3BJ6 A;  1D3Y A;  1YIO A;  1IN4 A;  3TKY A;  3Q9V A;  3HSF A;  3O2P E;  4EGY A;  1F4K A;  4G6Q A;  2VOO A;  4RB1 A;  4H0E A;  1SD5 A;  3P9C A;  3V8J A;  5HOO A;  1Q1H A;  2UXX A;  1B9M A;  1KU3 A;  4WWC A;  3MWM A;  1W5T A;  2IW5 A;  1OYW A;  4HAM A;  1Z6T A;  1R1T A;  3CUQ A;  2GXB A;  1HXD A;  1MJB A;  2FQ3 A;  2P7V B;  3BJA A;  2XAF A;  2A69 F;  2A3S A;  3KP6 A;  2FOK A;  3WTS C;  4HW0 A;  3GLX A;  4U0Y A;  4B09 A;  5KK1 A;  6PAX A;  4BNC A;  2AS5 F;  4U7D A;  3GEZ A;  2OQG A;  5FGM A;  2XAJ A;  4RAZ A;  1R1U A;  1FOK A;  2BEO A;  1BM9 A;  3GF2 A;  1QZZ A;  4ENN A;  1T39 A;  1K6O A;  3ECO A;  3JSO A;  1DPR A;  3J80 Z;  3RKW A;  3WTZ A;  2JTV A;  3WGG A;  3ABT A;  5K1Y A;  2W25 A;  2GIV A;  1LJ9 A;  4OIO F;  1YTY A;  2M5W A;  1IF1 A;  5D5X B;  1FWZ A;  5LEK A;  3KP4 A;  3RDI A;  3TO9 A;  2XVC A;  1B9N A;  1T38 A;  3GZ5 A;  3N4M A;  3I54 A;  4EJV A;  5D5V B;  1QPM A;  1U78 A;  4WX9 A;  1HKS A;  4YFX F;  3E6B A;  1SD6 A;  2FE3 A;  4IRG A;  3M8E A;  4S04 A;  3HHH A;  5LRR A;  1REP C;  3BWG A;  3F3X A;  4FHT A;  4KDP A;  4OIR F;  3R6S A;  3HYI A;  4UV9 A;  1SAX A;  4YG2 F;  3ZMZ A;  1IRF A;  1XSX A;  1Z05 A;  3HTU A;  1FX7 A;  5E1X A;  2VXZ A;  2EV5 A;  3I0T A;  4ZH4 F;  1S3J A;  1U6G A;  3B02 A;  3JAM Z;  5BMZ A;  5JR3 A;  5LEJ A;  1O3Q A;  1XCV A;  1BI2 A;  1S8N A;  3HSE A;  2H94 A;  3TDZ C;  3E6M A;  3FWE A;  4BAY A;  1XB4 A;  1MJ9 A;  3K1P A;  3DFG A;  4E70 A;  5H6R A;  1TNT A;  4MNU A;  4P96 A;  1I6X A;  2V6C A;  2P4W A;  1K78 A;  2XKP A;  1ZRC A;  2W57 A;  1ZHF A;  2YX7 A;  4GXO A;  1XN7 A;  2L02 A;  1FBU A;  1UCR A;  5HS9 A;  3OV8 A;  1SFE A;  2P7C B;  2EFN A;  3QOP A;  5K5R A;  2PMU A;  1R1V A;  4QWQ A;  2QVO A;  4AIH A;  1ZYR F;  4HV5 A;  3U9G A;  4BHP A;  4EJU A;  3DP7 A;  3K69 A;  3WTX C;  3GVA A;  1SFX A;  4CO8 A;  4HDU A;  5DEQ A;  2MLK A;  1WI9 A;  3JTH A;  4A12 A;  3MQ0 A;  1O3R A;  1IN8 A;  4IVN A;  3S2W A;  1ZLJ A;  1BI3 A;  4BXU A;  2V1U A;  5ERI A;  1C0W A;  3C7J A;  3MZH A;  4WF2 A;  4ZYD A;  4GYI A;  3O3K A;  1YLF A;  1ZGA A;  2BBY A;  4N9H A;  2RC4 A;  3M7G A;  2A6H F;  3QAH A;  3D0S A;  1JHF A;  4XRF A;  2ZCW A;  1SD7 A;  1ZAO A;  1S7A A;  1J0R A;  2JPB A;  3N97 A;  3V7S A;  3I5U A;  2G7H A;  2GA1 A;  1WRJ A;  4HX4 A;  4DQ2 A;  1G4D A;  3GFL A;  2O0Y A;  4MQ9 F;  2COM A;  2JZY A;  1J2X A;  1O7F A;  4L18 B;  5DD4 A;  5LHI A;  4ZYG A;  5CVR A;  4HA8 A;  2B0L A;  2VC1 A;  3CO6 C;  2GWR A;  4HOB A;  4RGU A;  3KFW X;  3TOA A;  3MZY A;  4IF4 A;  5E1Z B;  4KMF A;  1ZH5 A;  4XSZ F;  1JHH A;  4P9U A;  3H92 A;  1H9G A;  3HUG A;  2GA2 A;  5HDN A;  4WXD A;  2UWM A;  2D1H A;  5ICG A;  2X4H A;  1HBX G;  5F1R A;  4A2U A;  4A6E A;  4RAY A;  1I27 A;  1OYI A;  2PBI A;  2PMH A;  1MZB A;  2V79 A;  5CVJ A;  3L7W A;  2UZK A;  1XDS A;  4HLX A;  2O8X A;  4LLN A;  4IRI A;  2ETH A;  4KN4 X;  3E97 A;  1FYL A;  4L0Y B;  4KIB A;  4HYE A;  1HW1 A;  3BZ6 A;  2MA3 A;  3WOD F;  1LEA A;  3GWZ A;  2PN6 A;  5IT9 K;  3K1M A;  2RQP A;  3DPL C;  2STW A;  1MDM A;  4LJZ F;  2DQL A;  5CVU A;  2QBY B;  3KP3 A;  1J59 A;  2CSO A;  4M9Z A;  4EVI A;  2FNA A;  4P55 A;  4RS8 A;  1DDN A;  2O3F A;  4KUM A;  2EFW A;  3BP8 A;  3CJN A;  5LHH A;  1IN6 A;  4LMY A;  1PUE E;  1F9N A;  2HGC A;  1E2X A;  1FYK A;  2DK8 A;  1H0M A;  1HW5 A;  2ESN A;  1ULY A;  1TNS A;  3QP5 A;  3LA2 A;  4M6Y A;  1XGM A;  3EQL F;  5K5O A;  3LQQ A;  4YFK F;  3WTU C;  5DDG A;  2D1V A;  3LAP A;  2NS0 A;  3NEU A;  2EFQ A;  2A61 A;  4OIN F;  2XIG A;  4IJA A;  2VE8 A;  3C18 A;  3HRS A;  3R0A A;  3ELK A;  2UXN A;  4ESJ A;  5DCM B;  4O3M A;  3BRO A;  2Q8K A;  3ISP A;  2A5Y B;  4LD5 A;  1B6A A;  4L5J A;  3HOS A;  2DFI A;  4WXC A;  2V1D A;  5D6F A;  1XMK A;  3W6J B;  3L9F A;  3G3Z A;  3T8T A;  4M73 A;  5E17 F;  5D5U B;  2EV6 A;  2CFX A;  3WG9 A;  3J81 K;  3SFZ A;  2IA1 A;  1LNW A;  1XMA A;  4HBL A;  4IHS A;  3QP6 A;  3RKY A;  2RGV A;  3IWF A;  3GFM A;  1LEB A;  2ZME B;  3FMS A;  3I58 A;  4KIF A;  3TGN A;  5IT3 A;  5FLX K;  1MJA A;  1YYV A;  4A0Y A;  2XHK A;  3FF5 A;  1LQ1 A;  3HIF A;  2M8E A;  1KQ8 A;  1BIA A;  1KA8 A;  5BPD A;  1XCB A;  2FBI A;  2LKP A;  2FBK A;  3G73 A;  1ZLK A;  2M1B A;  1IW7 F;  1GXQ A;  1HST A;  1TQP A;  2HZT A;  2ESH A;  3LA3 A;  1IXC A;  4EMS A;  4EQQ A;  2QLZ A;  2K4J A;  3K2Z A;  4ENK A;  2PEX A;  4LG0 B;  3BPX A;  4OMY A;  1W5S A;  5L3C A;  2K27 A;  4ZZL A;  4MHG A;  3EYY A;  2KJB A;  3BJO A;  3SZP A;  4UVA A;  2FXA A;  1EV7 A;  1FBQ A;  2OBP A;  1KU7 A;  3ECH A;  4AD9 A;  1FPQ A;  3E5Q A;  4U7B A;  3RI4 A;  3K9T A;  1BI1 A;  2P8T A;  2DQR A;  4HQE A;  1JE8 A;  1D8J A;  2CGP A;  2JRT A;  2H6C A;  2CG4 A;  3TOB A;  4YIF A;  4IXA A;  5E20 A;  2XAS A;  4BHC A;  3PQJ A;  1YFH A;  4HV6 A;  3IKV A;  4HF1 A;  1OKR A;  3M1E A;  1OYY A;  4D0P A;  4Q48 A;  3RKX A;  3GFJ A;  2PQ8 A;  4RB3 C;  4I02 A;  1O3S A;  3KZZ A;  1ZAR A;  2RKH A;  2IP2 A;  2LSO A;  2Z33 A;  3KP2 A;  2QYO A;  1O3T A;  1XDU A;  4KNY A;  1BBY A;  4Y15 A;  4HDV A;  4I09 A;  1PDN C;  5L3B A;  2DK5 A;  1GXP A;  1IRG A;  2AXL A;  4I7H A;  1KU9 A;  2IVM A;  2VT2 A;  2XAQ A;  2M30 A;  3RTR A;  4AVP A;  1O7L A;  3TO6 A;  3WE2 A;  3V8L A;  4EV0 A;  1UB9 A;  1BJA A;  2QM3 A;  2VBX A;  5H20 A;  2LF7 A;  5D6E A;  2V1X A;  2L4A A;  3BOQ A;  3WGH A;  2BE5 F;  2PG4 A;  4LLL A;  4JBA A;  4L9T A;  2F5F A;  1B4A A;  4CXF A;  3WTT C;  5FO5 A;  2KJC A;  1ZRF A;  4HX8 A;  3QPT A;  2FSW A;  2FRH A;  3GX4 X;  1A04 A;  1O57 A;  1Z1D A;  1XSV A;  4IPA A;  1W7P B;  1JXS A;  3KLN A;  3REO A;  3VB2 A;  1D8K A;  3VOE A;  1VTN C;  1QZY A;  4Z2Y A;  4RB2 C;  4OMZ A;  1QO0 D;  4JK1 X;  2M87 A;  3FXR A;  1EH6 A;  3V8K A;  3GUD A;  5HS7 A;  5J8F A;  2K86 A;  4U88 A;  4I0B A;  1KGS A;  4L0Z B;  2DTR A;  2XUB A;  4UNO A;  5K5Q A;  3I64 A;  3E5X A;  5DD8 A;  1HQC A;  1FC3 A;  5LBQ A;  3FMQ A;  2HTS A;  4EM1 A;  1STZ A;  5H6Q A;  2DO7 A;  3H3U A;  3IRQ A;  1PP8 F;  1SFU A;  3E6C C;  1ZGJ A;  2VBY A;  2GAU A;  3SQN A;  1G3S A;  4LLG F;  2QZ8 A;  1I5Z A;  3ZN1 A;  2VON A;  3M8F A;  2YX4 A;  5CVV A;  2F5E A;  3U2R A;  4IRH A;  3PFI A;  3VOD A;  4YFN F;  1R23 A;  5D8L B;  1FSH A;  4S05 A;  2DPD A;  4RGS A;  1S7O A;  4B8X A;  3ERE D;  5HLI A;  1PP7 U;  1OMI A;  2GZW A;  5HS8 A;  4KN7 X;  3WTW C;  4AIJ A;  1Z7U A;  1BOA A;  1FSE A;  2L54 A;  4UXN A;  5L3F A;  3IKT A;  3CTA A;  2K7L A;  1R7J A;  3ROU A;  2OQR A;  2Z5U A;  4XSX F;  1G3Y A;  5EEG A;  3LQR A;  5CVI A;  4EJW A;  2W84 A;  4ZZD A;  1B59 A;  2R3S A;  2EK5 A;  4ESB A;  1UHM A;  4P5O A;  5BQT A;  1LVA A;  2F5C A;  4R79 A;  2CQK A;  1K79 A;  1ZG3 A;  1USS A;  5DV5 A;  4PGH A;  4U0W A;  5D4R A;  1OR7 A;  3JAM K;  2E7X A;  5IT9 Z;  5E8I A;  2P5V A;  2XGX A;  5F64 A;  4P9F A;  1ZN2 A;  1UST A;  3P9K A;  1RIO H;  5AIQ A;  5A2Q Z;  1HW2 A;  2CO5 A;  3GFI A;  3HRM A;  2EV0 A;  3GZ6 A;  1HSJ A;  3LWF A;  3RJP A;  2P6T A;  4BQA A;  3EUH A;  5TRD A;  2D2W A;  2MH9 A;  4KFC A;  2ZO4 A;  1R5H A;  2RN7 A;  3ABU A;  3VEP A;  2P5L C;  1EH8 A;  3FX3 A;  2DI3 A;  2F5D A;  3F22 A;  4A0X A;  4BHB A;  1YW9 A;  2X0L A;  4MTE A;  2ZJ2 A;  2L01 A;  4UV8 A;  5HLH A;  1ON1 A;  4XLN F;  1J5Y A;  3SHF A;  3BPV A;  4L5I A;  3ZMT A;  2HQR A;  3FXQ A;  1MKM A;  1R00 A;  1ZRD A;  1E17 A;  2QEN A;  4GGG A;  2IJL A;  3KEQ A;  4OIQ F;  4HZF A;  1SMT A;  1X3U A;  2BGC A;  5LGU A;  4ENM A;  4HX7 A;  1I1G A;  2STT A;  1ZG1 A;  3TDU C;  3J81 Z;  4U0V A;  3IC7 A;  4EM0 B;  4A0Z A;  2EFP A;  3E3V A;  4LK0 F;  3COA C;  2VC0 A;  1CF7 B;  3Q9S A;  5LGN A;  5DUI A;  3I4P A;  5FLX Z;  3NRV A;  1U5T B;  4M72 A;  2FU4 A;  4M6X A;  2L3D A;  4G7O F;  2VBW A;  2FEZ A;  4PCQ A;  1P2F A;  1TW2 A;  5ICE A;  2NAZ A;  3W6K B;  1DPU A;  2JPC A;  3ZMD A;  1BC7 C;  1JGS A;  2RNJ A;  5FFX A;  3MEX A;  3VFZ A;  3T1B A;  3DEU A;  1MD0 A;  1ON2 A;  3F72 A;  4GCV A;  1U8R A;  1IAW A;  5LHG A;  2J5P A;  4I0A A;  3HRU A;  3SXY A;  1S6L A;  2K4B A;  3KP5 A;  3GO5 A;  4G94 A;  2J5O A;  2XRO A;  2HDC A;  5D5W B;  3T8R A;  1FT9 A;  3FHZ A;  4G7H F;  2PJP A;  3QPH A;  3U1D A;  1FYM A;  4OOI A;  3SZT A;  2OZ6 A;  4UVB A;  2IPQ X;  1F5T A;  4HF2 A;  5JFR A;  3MCZ A;  4DNC A;  1HKT A;  5F6F A;  3I53 A;  4ESF A;  2NNY A;  3E5U A;  3KLO A;  5JHU A;  4Y17 A;  3CUQ B;  4CIC A;  3FZV A;  2Z99 A;  5AON A;  1P4W A;  4I98 B;  1SMY F;  1QGP A;  4FX4 A;  1IN5 A;  1TW3 A;  3K0L A;  3WTY C;  4OU0 A;  4PZJ A;  1U5T C;  2Z3Y A;  3WU0 A;  2MD5 A;  2QBY A;  4KMU X;  3IHU A;  1BI0 A;  2E7W A;  1P92 A;  3GW2 A;  3FXU A;  2JSC A;  1XD7 A;  1FBS A;  3HTS B;  1BIB A;  4CGZ A;  1L0O C;  2HKO A;  2PLY A;  2HEO A;  4Q5S F;  2GQQ A;  2HS5 A;  3ZP5 A;  3ML6 A;  1ZRE A;  5FD5 A;  4EM2 A;  2KRF A;  2W85 A;  2L4M A;  5D4S A;  3RPQ A;  5LRS A;  1T0F A;  3PQK A;  4L9V A;  3KP7 A;  5D8K B;  1TQM A;  2IA2 A;  3EDP A;  1RUN A;  3DQV C;  3F8M A;  3QU3 A;  2C6Y A;  1RNL A;  2VN2 A;  5E18 F;  3HOT A;  1EH7 A;  2R7F A;  3L09 A;  4JQF A;  1Z9C A;  3CDH A;  1G6N A;  3HHG A;  1YW7 A;  4O5V A;  3WU1 B;  4ETS A;  1TQI A;  1T2K A;  2FBH A;  3CUQ C;  5EEH A;  5ICC A;  5HLG A;  1IXS B;  3F6V A;  2KIM A;  4XBF A;  2WV0 A;  5HDK A;  1WKM A;  5FB2 A;  1KYW A;  3F8N A;  3I59 A;  2F2E A;  2ZBK A;  1YQA A;  3T0Y A;  4K2E A;  3MAJ A;  2ZME A;  2DPU A;  1GHC A;  2NYX A;  2Y75 A;  2CW0 F;  4HLY A;  2ZFW A;  4Y13 A;  1U2W A;  3O6B B;  3JW4 A;  1WQ2 A;  2QQB A;  2PFB A;  4A6D A;  1AOY A;  4FT8 A;  1XGO A;  3P9I A;  1K78 B;  2YPR A;  4PGG A;  2LDU A;  4N9I A;  4NB5 A;  2WTE A;  4CHU A;  3I71 A;  2LNB A;  1LDK B;  3H3Z A;  3RYR A;  3FM3 A;  2DU9 A;  2XRN A;  4ASN A;  5CJ9 A;  2KIF A;  5FD6 A;  3NQO A;  2BYV E;  3LST A;  3T5X A;  4LG0 A;  5L3E A;  3LAJ A;  1KU2 A;  3BY6 A;  2HTJ A;  1P4X A;  1WWX A;  5BPI A;  3J7A O;  4ON0 A;  1V4R A;  2HYG D;  2XKO A;  1RZ4 A;  1IXR C;  3JTG A;  1B1B A;  4XLP F;  2HFH A;  2CWE A;  2Y0M A;  3B73 A;  3GYH X;  2R7D A;  4LFU A;  4CYD A;  3KCC A;  3KE2 A;  4IHT A;  3GXO A;  1K7A A;  1F1Z A;  4GO1 A;  2A6E F;  2G7U A;  1BN5 A;  5JVT A;  1Z91 A;  3M9A A;  1WSU A;  1ZG5 A;  4LB6 B;  4MTD A;  3WGI A;  2EFO A;  1FNN A;  4KA4 A;  2YSR A;  3ZMU A;  2EA4 A;  3QRF F;  1XGS A;  2HYF A;  2DT5 A;  3CLO A;  2Q0O A;  3BDD A;  5J6X A;  2Q2E A;  4UVC A;  4ZYE A;  2PI0 A;  1QBJ A;  2ZNY A;  1NHA A;  3RPU A;  2QUF A;  1YO5 C;  1BC8 C;  3FMR A;  2H09 A;  2ZNZ A;  4MEX F;  4NHJ A;  3IL2 A;  2VE9 A;  4OIP F;  2FMY A;  3F6O A;  5FFZ A;  2FA5 A;  3ZMV A;  3WTV C; 
#chains in the Genus database with same CATH topology
 3KET A;  2CYY A;  4S0H B;  4F52 A;  2KIS A;  5ILV A;  1XS9 A;  2MC4 A;  3OYA A;  5ED4 A;  2WB1 A;  1DQU A;  4RLQ A;  3J80 K;  2EJR A;  1D5V A;  1VQ8 I;  4CDG A;  1N78 A;  4YEJ A;  2ME6 A;  3BG5 A;  3LSH A;  3HUG B;  4IL6 C;  1G3T A;  1W4M A;  2NNN A;  1RI7 A;  3ZQ7 A;  2OD5 A;  3P7N A;  5HOD A;  4RBO A;  1F36 A;  1R5G A;  3R61 A;  2IA0 A;  1TLH B;  1ZQ3 P;  1V3F A;  1SD4 A;  3C1D A;  2VKV A;  2KLO A;  3CUO A;  4EJT A;  3ZQC A;  1YIJ I;  3WE3 A;  3R60 A;  3L2C A;  3KEO A;  1YE9 A;  2X85 A;  4E7Z A;  2R5Z B;  1TTY A;  1P7J A;  4YII A;  4PJN A;  4I2O A;  1I3A A;  3OY9 A;  4A3F J;  3QQA A;  1UG2 A;  3FM5 A;  4WXH A;  3F8F A;  3Q3S A;  2QWW A;  5C4J J;  2L7Z A;  2XAG A;  1WJF A;  5DM6 F;  5GAH J;  3IUO A;  2HQN A;  5HVQ C;  3K4J A;  1NK3 P;  2M45 A;  3GTM J;  3H9Q A;  3G6E I;  4LB5 A;  3GTG J;  2E2I J;  3HG9 A;  4ZDO A;  1W7P A;  1GV2 A;  5F08 A;  5DM7 F;  1T8I A;  3EET A;  2BV6 A;  3DPU A;  5KVR A;  4N0B A;  3DV8 A;  3HSR A;  4BYY A;  3CF5 F;  2RDP A;  2L0K A;  3DXJ F;  3U21 A;  1MMS A;  1MND A;  1YG2 A;  4A5N A;  1MDM B;  2XF7 A;  3UKG A;  3DF8 A;  4XQF A;  2Z9O A;  4XIC A;  4KYW A;  1DUX C;  2CUE A;  3A0H C;  4RM3 A;  1UHS A;  2KRH A;  1H9T A;  4ZYH A;  1M1E B;  2MBF A;  2XB5 A;  2GIZ A;  3HRT A;  1JJ8 C;  3JRE A;  2OC6 A;  4EGZ A;  2DLL A;  4A5M A;  3RKQ A;  2LF8 A;  3OYL A;  5E8G A;  3RIR A;  4D7M A;  2X9D A;  1DU0 A;  1KON A;  3JRG A;  2MGQ A;  2X51 A;  1P6R A;  1WJB A;  4KIC A;  5H2F C;  2F5V A;  4AWX B;  1DU6 A;  3IRR A;  2VB6 A;  1KQ0 A;  1J7K A;  4OAZ A;  1SAU A;  1D0X A;  3QOD A;  2FF4 A;  5E1W A;  3G71 I;  1J9I A;  2EIM H;  1OPC A;  2VBZ A;  4AYB N;  4Y7N J;  2XDV A;  2FNP A;  4MGR A;  4IKF A;  1I1S A;  2QQ8 A;  2E34 A;  2GXG A;  2VAS A;  3R4K A;  5J8C A;  2LRE A;  2IEK A;  4KIS A;  4CZZ A;  4EJO A;  5BNG A;  1PVE A;  2ZKZ A;  2W4S A;  4E6K G;  5IPA A;  3S93 A;  1SFO J;  4NC7 A;  2A68 F;  4JOM A;  4WK8 F;  1FP1 D;  3OYD A;  1G59 A;  3HM5 A;  5K7Z A;  5EGO B;  3RPU D;  2KIQ A;  4Q4Z F;  3E6D A;  1IUY A;  4PJL A;  2O6G E;  4FX0 A;  5DCF A;  5FLV A;  2OA4 A;  5HDG A;  2RV8 A;  4L9J A;  4M74 A;  2NOJ B;  1Z6R A;  2HWV A;  1Z7L A;  1UZC A;  3B6C A;  1YS6 A;  1SVM A;  5LLQ A;  1FLI A;  1R6R A;  2EZL A;  4AYB A;  4E7S A;  1T95 A;  4I01 A;  1RET A;  1HDD C;  1D0Z A;  3K1N A;  4HPQ A;  2ICW G;  5ILS A;  2NXN B;  4MEY F;  4G7Z F;  3ZMS A;  3RYP A;  3OS0 A;  2QGU A;  3BG9 A;  1WCM J;  1MBF A;  1L3L A;  4G9Y A;  4J01 A;  3L2Q A;  1QNT A;  1NG7 A;  1D5Y A;  2XAH A;  2OAZ A;  3S3N A;  3OOP A;  4BDY A;  2DMU A;  2YU3 A;  2WC2 A;  2KKO A;  4TV7 A;  1FY7 A;  4C3J J;  3DBL B;  3OIO A;  3BQZ A;  5CYV A;  4M6V A;  4AID A;  1Z0X A;  4M9X A;  4HF0 A;  1ONV A;  3VYR B;  5KAI C;  1T98 A;  1J75 A;  3BTC A;  2KP6 A;  1XMX A;  4DYR A;  3IP4 B;  1T08 B;  2DBB A;  2ACJ A;  1U3E M;  3Q5F A;  2CS3 A;  2MH2 A;  1MBH A;  3OIP A;  1H88 C;  2Y9Y A;  4G12 A;  4GYG A;  1KYZ A;  4RGX A;  2JMW A;  3HPH A;  3V7R A;  2HYJ A;  2OU2 A;  4M9S A;  1P7I A;  4OAY A;  4IX7 A;  2COB A;  2QQA A;  2K02 A;  4BAC A;  5TJJ A;  1OIS A;  2WWY A;  1Y8R B;  3IH3 A;  2L9S A;  4HRI A;  4ABZ A;  1W7P D;  3LSK A;  5L3D A;  1HDP A;  3HOU J;  4XK4 A;  3QU6 A;  2ELH A;  3DEE A;  1MMN A;  1TZL A;  2DYS H;  1R9T J;  4X6A J;  2L9N A;  2IGN A;  4M71 A;  4O6J A;  2KDZ A;  4Q47 A;  2G9W A;  2P6S A;  2LD5 A;  3CCE I;  1HF0 A;  4BBR J;  3IAS 2;  2GM4 A;  2P5K A;  1UHW A;  4LK1 F;  4UHT A;  1YW8 A;  4V19 K;  3ZQG A;  2DOD A;  2VOD A;  3GTQ J;  3H5N A;  5A2Q K;  4F91 B;  1NTC A;  2LLK A;  5BOX A;  2M2E A;  2V9V A;  1P9Q C;  4R1H A;  4UUV A;  1ODD A;  1IZ1 A;  4V2G A;  1LDJ A;  3K10 A;  1UFM A;  1EKE A;  2HR3 A;  2DMN A;  1Z3Y A;  2L2O A;  3BZK A;  3D1N I;  4DGW B;  2PX9 A;  1VQO I;  3G1M A;  3VWB A;  3AL0 B;  4E7L A;  2EWN A;  4M3D A;  3RCO A;  2NS8 A;  2VT3 A;  3F23 A;  2E1O A;  1LFP A;  4ZC3 A;  2VOP A;  3MFK A;  4C2U A;  9ANT A;  2DA3 A;  1MGT A;  1LB2 A;  2M7A A;  4FE4 A;  3DKY A;  3L2R A;  5F27 A;  1S9H A;  3PL8 A;  2NRA C;  1OQY A;  2IT0 A;  1IN7 A;  4F7Z A;  4PJ0 C;  2DMP A;  5J1Y A;  3IWZ A;  4KT5 C;  1G3W A;  5E3N A;  3AAF A;  1HKQ A;  3V7C A;  4N4O B;  3R0J A;  4G6D A;  1H8A C;  2ISZ A;  3W2W A;  4KJZ A;  1JT6 A;  4GFB A;  1VZ0 A;  2DFE A;  4PK4 A;  2IS1 A;  3ULQ B;  4QSH A;  3TW7 A;  1DP7 P;  1XGN A;  1T6S A;  2ZFU A;  4PDK A;  1YRN B;  1QQI A;  2GBY A;  4N4N B;  1DGR M;  2Y69 H;  2YR2 A;  2ZJP F;  4BBS J;  2ADU A;  1TBX A;  2EB7 A;  3C2B A;  3DKW A;  4IHV A;  2ZXJ A;  2Y48 A;  3TQN A;  3DPT A;  4NQW A;  4KIG A;  1FZP B;  1B8I B;  2HOE A;  3HPG A;  4BKX A;  3QPL A;  3WG7 H;  4A3M J;  3V4G A;  3L00 A;  1TWF J;  1WH5 A;  2BY2 A;  2FX0 A;  3F8C A;  5JI6 A;  3OR2 C;  5IOY A;  3TO7 A;  2E1C A;  4D7N A;  3G2B A;  4LGW A;  3OL3 A;  3OYN A;  3ZQL A;  3PUF A;  4MO7 A;  2XSJ C;  4L9N A;  2JA8 J;  1MIJ A;  3I59 B;  3VYT B;  3CMA I;  1ETQ A;  2WAQ N;  5E79 C;  4WCG A;  2O61 A;  2ISY A;  5HNF A;  3ZPL A;  3KYC B;  4MLO A;  2H27 A;  2R7X A;  2QQ9 A;  5CLS A;  1PYV A;  5E3L A;  1I3Q J;  4CCO A;  3M07 A;  3KX2 A;  2OZU A;  4G8X A;  2R7S A;  1ACI A;  3C3W A;  2H6B A;  3LFK A;  1W36 D;  2W24 A;  5DUK A;  1PUF B;  2OUM A;  3F8B A;  1CF7 A;  5JLW A;  5E3M A;  2H8R A;  2HKX A;  4AIK A;  3LA7 A;  3F21 A;  1RUO A;  3K70 D;  1KQ9 A;  3WHC A;  1FP2 A;  1YX3 A;  5ICF A;  3H5R A;  4XKB A;  2LK2 A;  5EJC A;  1QRY A;  3GBG A;  5LGT A;  2CW7 A;  2DW4 A;  5AIP A;  5DYM A;  2O8K A;  1UEL B;  3KZY A;  5L3G A;  2R93 J;  3HOW J;  1YS7 A;  5ILU A;  3I3L A;  2A07 F;  1P4A A;  2EA2 A;  1U5T A;  2Z1D A;  4CH7 A;  3ASN H;  1R36 A;  2DA4 A;  4BE2 A;  3MD2 A;  4XKV A;  5IY5 H;  2WAQ A;  3OOU A;  2MC3 A;  2LH9 A;  3MZ8 A;  3K4M A;  1G2H A;  2KIU A;  4E7J A;  3BR3 A;  1S29 A;  5BS6 A;  3OYF A;  2NVX J;  1AWC A;  2FML A;  2V9P A;  3H1C A;  2HOS A;  4PSW A;  1GVJ A;  2JT1 A;  5GAE J;  1SVL A;  1U9N A;  3CO7 C;  1LKX A;  5J4Y A;  2K3F A;  4D1Q A;  2DAO A;  2TDX A;  4XMY A;  1D0Y A;  3D5L A;  4BH9 A;  3K4K A;  4Z6Y A;  2W00 A;  1CGP A;  5B5E C;  2KPM A;  3ZN0 A;  2Y0S N;  5C3E J;  4ENJ A;  2O03 A;  5K7H A;  2XV4 S;  3EYI A;  3JSP A;  2GLO A;  4R8H A;  2MLG A;  2E1N A;  2D45 A;  1HA8 A;  2IRF G;  3CJR B;  3HDD A;  4RB0 A;  2HDW A;  4QLC U;  2QA4 I;  4RGR A;  1R22 A;  2HU9 A;  3OYH A;  1XSD A;  1LDD A;  1BA5 A;  2BW3 A;  2H8W A;  4MQV A;  1R58 A;  5DCM A;  2G0E A;  2RVC A;  3E7L A;  4HQM A;  1Y0U A;  1ZGW A;  3BJ6 A;  3ERM A;  2XGC A;  1D3Y A;  2NVT J;  1YIO A;  1IN4 A;  2TRT A;  1SAN A;  2B63 J;  3TKY A;  2O7O A;  3Q9V A;  4B47 A;  3HSF A;  3O2P E;  4M3E A;  1YJN I;  4EGY A;  2OJE D;  3BT9 A;  1F4K A;  4G6Q A;  2ZXH A;  1JI8 A;  3WHB A;  1IUF A;  5LD2 C;  2VOO A;  4RB1 A;  4H0E A;  5JLX A;  1SD5 A;  4B44 A;  3P9C A;  3NAR A;  5IYB J;  2X1D A;  3V8J A;  5HOO A;  1Q1H A;  2UXX A;  1B9M A;  1KU3 A;  4WWC A;  2DXI A;  3MWM A;  1W5T A;  2ME0 A;  2IBD A;  2IW5 A;  1OYW A;  4HAM A;  4XN3 A;  1Z6T A;  1R1T A;  3CUQ A;  4BY7 J;  2I10 A;  1IG7 A;  1A31 A;  1NK2 P;  4DBQ A;  2GXB A;  1HXD A;  4RAF A;  1MJB A;  3HZJ A;  2FQ3 A;  2P7V B;  3BJA A;  3CC4 I;  2Q2E B;  3ONQ A;  2XAF A;  2A69 F;  1BR2 A;  3GLL A;  3LL7 A;  2A3S A;  2H1K A;  1QVU A;  3KP6 A;  2FOK A;  1X1B A;  3WTS C;  4HW0 A;  3GLX A;  4U0Y A;  4B09 A;  5KK1 A;  6PAX A;  2VI6 A;  3TP0 A;  4BNC A;  4A3E J;  2AS5 F;  4U7D A;  3GEZ A;  2E60 A;  2OQG A;  4NDL A;  5FGM A;  3G1L A;  2E35 A;  2PMZ N;  1X1P A;  3H3V K;  2XAJ A;  4RAZ A;  2RRE A;  2CW8 A;  1R1U A;  2K5C A;  1FOK A;  2BEO A;  3V42 A;  1BM9 A;  3GF2 A;  1QZZ A;  1Z77 A;  3CMM A;  5C4X J;  4ENN A;  4BE0 A;  1T39 A;  3S17 J;  2DFH A;  2YS9 A;  3BTJ A;  3TP3 A;  1K6O A;  1QZE A;  4Y4R A;  3ECO A;  3JSO A;  1DPR A;  3ABK H;  2VJI A;  3J80 Z;  3RKW A;  3WTZ A;  2JTV A;  3WGG A;  4D9J A;  1VQP I;  3ABT A;  2XC7 A;  5K1Y A;  2W25 A;  1E3O C;  2GIV A;  3LSM A;  1LJ9 A;  5FKO A;  4OIO F;  1YTY A;  2M5W A;  2KZG A;  3PNV A;  1IF1 A;  5D5X B;  1FWZ A;  5LEK A;  3KP4 A;  4FE7 A;  3RDI A;  3TO9 A;  2XVC A;  1B9N A;  1T38 A;  3GZ5 A;  4UUS B;  3N4M A;  3CME I;  3I54 A;  1VQK I;  4EJV A;  5D5V B;  1QPM A;  3LSI A;  1U78 A;  4WX9 A;  2MD0 A;  1HKS A;  3MVP A;  4YFX F;  3O8H A;  2VJ4 A;  3HGY A;  1TL8 A;  3E6B A;  3KEY A;  1SD6 A;  2B7E A;  2BOL A;  2FE3 A;  4IRG A;  3AG1 H;  3M8E A;  2JA2 A;  3HHH A;  2K85 A;  3NWS A;  4V2F A;  4S04 A;  5LRR A;  3GZN B;  1REP C;  4BXX J;  3BWG A;  4BL0 B;  3F3X A;  4FHT A;  4KDP A;  5IOZ A;  3JRI A;  1MMD A;  4OIR F;  1IJW C;  2X48 A;  1IDZ A;  1IGN A;  3R6S A;  3HYI A;  4UV9 A;  1SAX A;  3OSF A;  2O9L A;  4YG2 F;  2L7M P;  3ZMZ A;  2ZXI A;  1IRF A;  2EH3 A;  1XSX A;  2WB1 N;  4RDU A;  4JX5 A;  2DA2 A;  1Z05 A;  2CUZ A;  1FOW A;  4F3Q A;  2CJJ A;  3HTU A;  1FX7 A;  3FK6 A;  5E1X A;  1JGG A;  2VXZ A;  1VQL I;  2EV5 A;  3I0T A;  5FKK A;  4ZH4 F;  3IH2 A;  1S3J A;  4DOZ A;  1U6G A;  3B02 A;  3PNY A;  1GV5 A;  3JAM Z;  4UUT A;  1D1B A;  2KFD A;  3HBL A;  3VDX A;  3IV5 A;  5BMZ A;  1TWH J;  4QPO A;  1ZR4 A;  2NVY J;  4HST A;  5JR3 A;  5LEJ A;  3L2U A;  3RZD J;  1O3Q A;  1XCV A;  2JRM A;  1BI2 A;  3GME A;  1S8N A;  3CCQ I;  3OYI A;  3HSE A;  2H94 A;  3TDZ C;  3E6M A;  3FWE A;  4BAY A;  1XB4 A;  1MJ9 A;  1I6H J;  3K1P A;  3DFG A;  1PJR A;  4E70 A;  1VQN I;  5H6R A;  1TNT A;  3M4O J;  4MNU A;  4P96 A;  2EZH A;  2DYR H;  1I6X A;  1OLT A;  2Y2Z A;  2V6C A;  2P4W A;  1OCR H;  1S72 I;  4PJJ A;  1K78 A;  1RPW A;  2XKP A;  1ZRC A;  2W57 A;  3GTL J;  1ZHF A;  1S7E A;  2CUF A;  2YX7 A;  4GXO A;  1BR4 A;  2K3P A;  1XN7 A;  2L02 A;  4ZYA A;  2UV1 A;  2MFZ A;  1FBU A;  2WY7 Q;  1UCR A;  5HS9 A;  3OV8 A;  4F93 B;  1A6Q A;  1SFE A;  5B66 C;  2P7C B;  2EFN A;  3QOP A;  4RLF A;  1RES A;  5K5R A;  2PMU A;  3I9V 2;  2FJ1 A;  1R1V A;  1WJE A;  4QWQ A;  2QVO A;  4MFD A;  4AIH A;  1ZYR F;  3GCM A;  2EZI A;  4HV5 A;  4JX6 A;  4QPQ A;  3U9G A;  4BHP A;  2E71 A;  3DTE A;  4XLA A;  4EJU A;  1FTZ A;  2LRD A;  3DP7 A;  3K69 A;  3WTX C;  3GVA A;  2OTJ I;  1SFX A;  5FKM A;  2VXD A;  4CO8 A;  5DEQ A;  4HDU A;  3HGG A;  2MLK A;  3KPH A;  1WI9 A;  3JTH A;  2AHQ A;  4A12 A;  3MQ0 A;  3RQI A;  1O3R A;  3ZGK A;  1IN8 A;  4IVN A;  1R5I D;  4AU7 A;  4L5E A;  1Z67 A;  3ZR8 X;  2R7R A;  3LSR A;  2JUG A;  4GRI A;  3S2W A;  1ZLJ A;  1OCZ H;  1BI3 A;  2TCT A;  3S2D J;  2EIN H;  1OCP A;  4BXU A;  2V1U A;  1OR7 C;  5ERI A;  2JUC A;  1C0W A;  2L9V A;  3C7J A;  3MZH A;  4XOT A;  4WF2 A;  4ZYD A;  4GYI A;  3O3K A;  3H36 A;  3K4N A;  1YLF A;  4IQ4 A;  1ZGA A;  2BBY A;  4N9H A;  2RC4 A;  3M7G A;  2A6H F;  3QAH A;  1A5J A;  3D0S A;  3K2A A;  1JHF A;  4XRF A;  2LR8 A;  2X1E A;  2ZCW A;  1SD7 A;  1ZAO A;  1S7A A;  1J0R A;  2AO9 A;  2JPB A;  3DWL E;  3N97 A;  4BQN A;  2XPW A;  5DS9 A;  3V7S A;  3I5U A;  4CYC A;  4XLH A;  1G8X A;  2G7H A;  2WAF A;  4BUP A;  2QSG X;  2GA1 A;  1WRJ A;  1VQ4 I;  2BY0 A;  3AKZ A;  4F92 B;  4HX4 A;  4DQ2 A;  1RC9 A;  1MBE A;  3GFL A;  2O0Y A;  4MQ9 F;  1G4D A;  2COM A;  2JZY A;  3EUH C;  2E5Z A;  1QPI A;  1BW5 A;  1J2X A;  1O7F A;  4L18 B;  2X1C A;  3HJE A;  5DD4 A;  5LHI A;  3A2K A;  2W1O A;  4B4C A;  3HEF A;  4EAT A;  4ZYG A;  3PJR A;  5CVR A;  2V1N A;  2M3A A;  4HA8 A;  2B0L A;  2VC1 A;  3DEW A;  4BQO A;  3CO6 C;  5M5W J;  2GWR A;  4HOB A;  2DMT A;  4RGU A;  3KFW X;  2VQL A;  4PUS A;  3TOA A;  5FRN A;  3MZY A;  3M3Y J;  4IHX A;  4IF4 A;  5E1Z B;  4KMF A;  3K4B A;  1ZH5 A;  4XSZ F;  1JHH A;  2L7F P;  4P9U A;  3H92 A;  1H89 C;  2DJI A;  1H9G A;  3CC7 I;  3VYS B;  1FOX A;  3A02 A;  4BJT A;  3HUG A;  5CKT A;  2HXI A;  5C44 J;  2GA2 A;  4YEL A;  5HDN A;  4WXD A;  3OYJ A;  3FXJ A;  1X4P A;  3H9G A;  3QYF A;  2D1H A;  2UWM A;  2VLA A;  4PJM A;  2JQ7 A;  4FQG A;  5ICG A;  4E7H A;  3CDL A;  2X4H A;  1WJA A;  1HBX G;  5F1R A;  4A2U A;  4A6E A;  1VQ6 I;  4YIR X;  4RAY A;  1I27 A;  1OYI A;  2PBI A;  2PMH A;  1MZB A;  2V79 A;  3JRD A;  2CQ7 A;  5CVJ A;  3L7W A;  2UZK A;  1XDS A;  3ZQI A;  1MH4 A;  4BY1 J;  2BVL A;  5CPR B;  4HLX A;  4FIS A;  2O8X A;  3J7Y J;  4LLN A;  4IRI A;  2ETH A;  1MNE A;  4KN4 X;  4CSW A;  3E97 A;  1ZEL A;  1FYL A;  1VI0 A;  4L0Y B;  4KIB A;  3HB9 A;  4HYE A;  3BR5 A;  1HW1 A;  3BZ6 A;  1TC3 C;  1LFB A;  2MA3 A;  3S2H J;  4E4H A;  3WOD F;  2JJ7 A;  1LEA A;  2E1M B;  3GWZ A;  3MMY B;  2PN6 A;  3ABL H;  3TED A;  1NG6 A;  2W7N A;  2JA5 J;  3J7A Y;  5IT9 K;  5EYR A;  3K1M A;  2ELJ A;  2RQP A;  3DPL C;  3SZG A;  5M5X J;  2STW A;  1MDM A;  3CD6 I;  2V6E A;  3FIW A;  4LJZ F;  2DQL A;  1TP4 A;  5CVU A;  2QBY B;  3KP3 A;  1J59 A;  4PFO A;  2CSO A;  4M9Z A;  4EVI A;  3S14 J;  3CP8 A;  3OS1 A;  2FNA A;  4P55 A;  4RS8 A;  1U8B A;  1DDN A;  2O3F A;  5F0H A;  3J7Z I;  3RZO J;  4KUM A;  3A01 A;  2ID3 A;  2EFW A;  3BP8 A;  3CJN A;  1IO2 A;  3DBR B;  5LHH A;  5GAG J;  1IN6 A;  5GAD J;  4B3A A;  3HC7 A;  1MBG A;  4LMY A;  1YJW I;  1JT0 A;  1PUE E;  3GTP J;  1F9N A;  3OWT A;  3CQZ J;  2HGC A;  1E2X A;  1FYK A;  2VKE A;  4HNV A;  3DTK A;  2DK8 A;  4LIT A;  4Y3O A;  1H0M A;  1HW5 A;  1OFC X;  2ESN A;  1ULY A;  1R4N B;  5KNL A;  1XTA A;  1TNS A;  3PNT A;  4XLF A;  4CCJ A;  3CCR I;  3QP5 A;  1X1A A;  2R7Q A;  3LA2 A;  4M6Y A;  3ZXS A;  5EZH A;  3MKY B;  3K4L A;  1XGM A;  3EQL F;  4W1U A;  5K5O A;  3LQQ A;  2VJJ A;  4YFK F;  3WTU C;  5J3L A;  2BZT A;  5DDG A;  2D1V A;  3LAP A;  3DCF A;  1IRZ A;  2NS0 A;  3DBH B;  3NEU A;  1OJL A;  2EFQ A;  1JKR C;  2A61 A;  4RAG A;  1VQ5 I;  4OIN F;  2EZK A;  1WPK A;  2XIG A;  4IJA A;  3TMO A;  2KZV A;  2VPL A;  3EPZ A;  2VE8 A;  2CH0 A;  3C18 A;  3HRS A;  3R0A A;  3ELK A;  2UXN A;  4ESJ A;  1ITY A;  5DCM B;  1K4S A;  4O3M A;  3GTO J;  3BRO A;  1ETW A;  2Q8K A;  3ISP A;  5GTI C;  1B72 B;  1MH3 A;  2HOT A;  2A5Y B;  3S16 J;  4LD5 A;  1B6A A;  2LY9 A;  4L5J A;  3HOS A;  5IYD J;  3CCM I;  2DMQ A;  4I76 A;  3CF2 A;  2DFI A;  4WXC A;  3VYU B;  1WJD A;  2V1D A;  2VKH A;  5D6F A;  3OYB A;  1XMK A;  2DOE A;  3W6J B;  3L9F A;  4FTH A;  2WA0 A;  3S1Q J;  3G3Z A;  3T8T A;  4M73 A;  5E17 F;  5D5U B;  2EV6 A;  2CFX A;  3QOE A;  2KL4 A;  5FKN A;  3WG9 A;  4I6Z A;  3J81 K;  3SFZ A;  3BTL A;  4M3F A;  1ZK8 A;  2IA1 A;  5GP9 A;  1LNW A;  3OYC A;  1XMA A;  1FIP A;  4HBL A;  1V5G A;  3QP6 A;  5IP7 J;  4IHS A;  1R71 A;  2E1M C;  3PO2 J;  3RKY A;  4CCM A;  2RGV A;  3IWF A;  3GFM A;  3PSI A;  1LEB A;  2ZME B;  4A3I J;  1HC8 A;  2R7Z J;  3CJQ B;  3H9J A;  4QIW N;  3FMS A;  3I58 A;  3LOC A;  4KIF A;  3TGN A;  3F9K A;  4CCK A;  1BJZ A;  5IT3 A;  3G4S I;  5FLX K;  2MAB A;  2M7B A;  1LE8 A;  3BZC A;  1A6I A;  1MJA A;  1YYV A;  4A0Y A;  5CQG A;  2XHK A;  5IP6 A;  3FF5 A;  4B3X A;  3CP2 A;  1LQ1 A;  3HIF A;  2R5Y B;  2E2H J;  2OCE A;  3DTI A;  2M8E A;  4LIV A;  3QYE A;  1KQ8 A;  1BIA A;  3DLA A;  1GT0 C;  4BE1 A;  1KA8 A;  5BPD A;  1XCB A;  1N77 A;  4C3I J;  2LBF A;  2FBI A;  2LKP A;  3AL0 C;  3H0D A;  2FBK A;  1I50 J;  3S1M J;  4B1R A;  3G73 A;  3C2G A;  1ZLK A;  2M1B A;  5J40 A;  1IW7 F;  2NVQ J;  1GXQ A;  1HST A;  4BEH A;  3HOY J;  1TQP A;  2HZT A;  4C3H J;  2ESH A;  3ESW B;  3LA3 A;  3M1C A;  3H5A A;  1IXC A;  4EMS A;  4EQQ A;  2QLZ A;  3KYD B;  2K4J A;  5F0C A;  3K2Z A;  4RA2 A;  4ENK A;  2PEX A;  4PSX A;  4BDZ A;  3RSN A;  3D5R C;  4LG0 B;  2M9H A;  3BPX A;  5M3M J;  3W2A A;  1T0F C;  4OMY A;  3LMM A;  3UNG C;  1W5S A;  2NVU B;  2IGO A;  5L3C A;  1A36 A;  2DDA A;  1QVT A;  4W97 A;  3SEZ A;  2K27 A;  4ZZL A;  3JCU C;  3CLQ A;  2HPM A;  4MHG A;  2CQX A;  1S5L C;  3EYY A;  2KJB A;  3BJO A;  3SZP A;  2R0Q C;  4UVA A;  2PJR B;  2FXA A;  1EV7 A;  1FBQ A;  1LVK A;  2OBP A;  4HSR A;  1KU7 A;  3ECH A;  4M3G A;  1X58 A;  4AD9 A;  3PUB A;  1FPQ A;  3E5Q A;  4U7B A;  4DZP A;  3RI4 A;  3K9T A;  1BI1 A;  5KAF C;  1HLV A;  2Y9Z A;  4CA0 A;  2P8T A;  2DQR A;  5B1B H;  3DU6 A;  4HQE A;  1JE8 A;  2DTZ A;  1D8J A;  2CGP A;  2JRT A;  3SDG A;  2HZD A;  2H6C A;  2CG4 A;  3JRH A;  2DA1 A;  3TOB A;  4YIF A;  4IXA A;  5E20 A;  2XAS A;  4BHC A;  3PQJ A;  1YFH A;  1YRN A;  2D5V A;  4HV6 A;  1Y56 A;  2MW8 A;  3IKV A;  2LTP A;  2Y31 A;  4HF1 A;  3FXO A;  4LIU A;  3KIO A;  1OKR A;  3M1E A;  1OYY A;  3P5J A;  4Q48 A;  4D0P A;  5FKL A;  3RKX A;  3GFJ A;  2PQ8 A;  3QYB A;  2CV1 A;  2DDB A;  1JTY A;  1B8I A;  1XC5 A;  4UY8 I;  2ZME C;  4RB3 C;  4I02 A;  4XKW A;  5J1U A;  1O3S A;  3KZZ A;  1ZAR A;  2RKH A;  4RMN A;  1K61 A;  5IYC J;  2IP2 A;  2YU9 J;  2LSO A;  2HXO A;  3EUA A;  2XPV A;  2Z33 A;  3KP2 A;  4CZC A;  2QYO A;  1O3T A;  4ZTJ A;  2LP0 A;  1XDU A;  2XRL A;  4I99 C;  4KNY A;  2WY8 Q;  3FBN B;  1BBY A;  4Y15 A;  4HDV A;  4I09 A;  1LFU P;  1PDN C;  5L3B A;  1QU3 A;  2DK5 A;  1Y8Q B;  4ZTF A;  1GXP A;  1IRG A;  2AXL A;  4I7H A;  3BQY A;  2BY1 A;  3LSG A;  1YI2 I;  2LVS A;  1KU9 A;  4J19 A;  2QKL B;  1E3P A;  2IVM A;  1Z21 A;  3H35 A;  2VT2 A;  4E7I A;  2VQH A;  4QTR A;  2XAQ A;  2M30 A;  3OMY A;  3L2W A;  4XN0 A;  3RTR A;  1K83 J;  3Q0U A;  4AVP A;  1O7L A;  4C2M J;  3TO6 A;  1YIT I;  3WE2 A;  3FIS A;  3V8L A;  3U1K A;  4EV0 A;  1UB9 A;  1BJA A;  2QM3 A;  1N75 A;  3VSL A;  1WGX A;  2VBX A;  5H20 A;  3DLL F;  1ZR2 A;  2E36 A;  2DA6 A;  2LF7 A;  2LFB A;  3OSG A;  5D6E A;  3CDI A;  2V1X A;  2L4A A;  3BOQ A;  2CQQ A;  3WGH A;  1W1W E;  2BE5 F;  2PG4 A;  2IS2 A;  2JA6 J;  3CZ6 A;  2AQF A;  4LLL A;  2V9K A;  4JBA A;  1UJ8 A;  4L9T A;  2F5F A;  1B4A A;  4CXF A;  2VIX A;  3WTT C;  3S3O A;  5FO5 A;  4FCY A;  2KJC A;  1ZRF A;  1GUU A;  1QHH D;  4HX8 A;  3QPT A;  3VSK A;  2FSW A;  5F04 A;  4II2 A;  4DYQ A;  3JRF A;  2FRH A;  3GX4 X;  1A04 A;  1Y1V J;  4AUX A;  1O57 A;  3FK7 A;  1Z1D A;  2IS6 A;  1XSV A;  4IPA A;  2LMD A;  5EZG A;  1W7P B;  3LFU A;  3CCL I;  2CU7 A;  4UB6 C;  1JXS A;  3VPR A;  3KLN A;  3REO A;  3TBI A;  2EIK H;  3VB2 A;  3FDY A;  2L9R A;  3JRB A;  1D8K A;  3VOE A;  2WV1 A;  2DOA A;  1VTN C;  5F0F A;  3CCS I;  1QZY A;  4Z2Y A;  3S15 J;  4RB2 C;  4IZZ A;  4OMZ A;  1QO0 D;  2BY3 A;  4JK1 X;  2M87 A;  3FXR A;  1EH6 A;  3V8K A;  2K9S A;  3SYT A;  3GUD A;  1V5E A;  5HS7 A;  3NAU A;  2GOX B;  4IEJ A;  3OIQ A;  2FQ4 A;  4FET A;  5J8F A;  5K7F A;  2K86 A;  4U88 A;  4I0B A;  1KGS A;  4L0Z B;  1RR8 C;  4JYK A;  3MKW B;  2L7K A;  3M8J A;  2DTR A;  2FUG 2;  3QPS A;  1MW7 A;  2XUB A;  2JWT A;  4UNO A;  5K5Q A;  3I64 A;  1FTT A;  3E5X A;  2CQN A;  5DD8 A;  3OYG A;  3S1R J;  1HQC A;  1FC3 A;  3PFY A;  5LBQ A;  3FXM A;  1RKW A;  4BU2 A;  2QEX I;  3FMQ A;  2HTS A;  4EM1 A;  1WHU A;  1STZ A;  2XB0 X;  3KYL A;  2R7V A;  2F4M B;  1IV8 A;  4B43 A;  5H6Q A;  1BL0 A;  2CFO A;  2DO7 A;  2EQR A;  2ID6 A;  2M4G A;  3HOV J;  4A3B J;  3H3U A;  2M4K A;  3IRQ A;  3QWL A;  1PP8 F;  1YHQ I;  4KT6 A;  4C30 A;  1SFU A;  3E6C C;  2XF5 A;  4X1E A;  1U0J A;  1ZGJ A;  2VBY A;  3BG3 A;  2GAU A;  3SQN A;  1HOM A;  3A1Y A;  5EG0 A;  2CV0 A;  4AC0 A;  1G3S A;  4LLG F;  2QZ8 A;  1I5Z A;  3ZN1 A;  2UUZ A;  1AA7 A;  4MIM A;  2VON A;  3M8F A;  2KHM A;  2F6C A;  3A4C A;  5EEA A;  2YX4 A;  5CVV A;  2F5E A;  1FMV A;  3U2R A;  2WAE A;  2F4I A;  4IRH A;  3PFI A;  1ZKG A;  3VOD A;  2WBM A;  3ZCO A;  4CCN A;  3DKX A;  4YFN F;  1R23 A;  4XLC A;  3PO3 J;  2DT7 B;  5D8L B;  1FSH A;  1VF9 A;  2Z16 A;  3AG3 H;  4S05 A;  2R7O A;  2BVM A;  2BXZ A;  4XKC A;  3ZOB A;  4KIT B;  4Y52 J;  3AG4 H;  2CV2 A;  3SDB A;  2DPD A;  4RGS A;  1S7O A;  4B8X A;  4XRM A;  3ERE D;  5HLI A;  1EA3 A;  1OMI A;  2GZW A;  3BLY A;  1PP7 U;  3ZQH A;  3O8G A;  5HS8 A;  4KN7 X;  3WTW C;  4UB8 C;  4IQJ A;  1Y6I A;  4AIJ A;  1Z7U A;  4AVZ A;  2Z2S B;  1BOA A;  1FSE A;  2L54 A;  4UXN A;  1EJ9 A;  5L3F A;  3IKT A;  2M34 A;  3OL4 A;  4M3B A;  4UUS A;  2HNH A;  3CTA A;  2K7L A;  3SEQ A;  1JTX A;  1NH3 A;  2P0W A;  1R7J A;  3ROU A;  5FRM A;  1WI3 A;  1BR1 A;  1SC7 A;  2IXS A;  2OQR A;  2Z5U A;  4XSX F;  4ITV A;  2ZJQ F;  1G3Y A;  1T56 A;  5EEG A;  3LQR A;  4JP0 A;  1POG A;  5CVI A;  1LPQ A;  1JKP C;  4EJW A;  5JVG F;  2W84 A;  1T33 A;  4ZZD A;  1B59 A;  2RQQ A;  1RKT A;  2R3S A;  2M8G X;  2MG4 A;  3BR6 A;  4XOR A;  3E0J B;  4A3K J;  5B1A H;  4F55 A;  2EK5 A;  4ESB A;  1UHM A;  4P5O A;  5BQT A;  1LVA A;  1ETO A;  4A69 C;  3SJM A;  1WJ5 A;  2F5C A;  4R79 A;  2CQK A;  4HEA 2;  4CCL A;  1IC8 A;  1K79 A;  1ZG3 A;  1USS A;  2DA5 A;  5DV5 A;  4PGH A;  3AFH A;  2I5U A;  4U0W A;  2K9L A;  2QKM B;  5D4R A;  1OR7 A;  3JAM K;  3PM1 A;  4P1W A;  2IAI A;  2E7X A;  5IT9 Z;  5E8I A;  2HQA A;  2WAD A;  2P5V A;  5HLT A;  3A01 B;  2XGX A;  4XRS A;  5F64 A;  3PSF A;  4P9F A;  1X2N A;  3E1S A;  1Q1V A;  1ZN2 A;  1UST A;  1AHD P;  3P9K A;  1RIO H;  5AIQ A;  5A2Q Z;  1A35 A;  1AKH A;  1HW2 A;  1X1C A;  2CO5 A;  3ZQF A;  1KZH A;  1TWG J;  4II3 A;  4XL9 A;  3GFI A;  3HRM A;  2VKD A;  2EV0 A;  3HOX J;  3GZ6 A;  1X3W B;  4IHW A;  3BCA A;  1D1A A;  1HSJ A;  1X1D A;  3LWF A;  3RJP A;  1N25 A;  2P6T A;  2IS4 A;  2EIJ H;  3ASO H;  2EIL H;  3BR0 A;  4BQA A;  1FMW A;  4U87 A;  3EUH A;  1GVD A;  1V55 H;  5GPA A;  5TRD A;  2D2W A;  1VQ7 I;  2MH9 A;  4KFC A;  2ZO4 A;  1R5H A;  3B6A A;  4XOP A;  2RN7 A;  3ABU A;  3VEP A;  2P5L C;  1E0E A;  4PFP A;  2GXA A;  1EH8 A;  3FX3 A;  2VUM J;  1JUP A;  2DI3 A;  3JR9 A;  1FIA A;  2F5D A;  4DJA A;  2OCC H;  1J09 A;  3F22 A;  4A0X A;  4BHB A;  2A6T A;  1YW9 A;  1WFX A;  2O5R A;  2X0L A;  4MTE A;  4A3G J;  4XNF A;  4NNJ A;  2QF7 A;  2ZJ2 A;  1OCT C;  4DZJ A;  4FAS D;  4LG3 A;  2L01 A;  4XLE A;  1MMG A;  1CQT A;  4HNU A;  2KQR A;  3HXL A;  4BQQ A;  5LFA A;  1MSF C;  4IHY A;  2A5W A;  1R49 A;  4UV8 A;  2R5Z A;  5HLH A;  1ON1 A;  3LNQ A;  4XLN F;  1J5Y A;  3SHF A;  2EPF A;  5F1J A;  4NQW B;  3BPV A;  2X6Y A;  1MNM C;  4L5I A;  3ZMT A;  2HQR A;  3FXQ A;  3IAM 2;  2K9M A;  1MKM A;  1R00 A;  1ZRD A;  4XR6 A;  4JX4 A;  2A05 A;  1E17 A;  3WU2 C;  2QEN A;  2QSF X;  2HDD A;  4GGG A;  2IJL A;  3ZQQ A;  3KEQ A;  1IDY A;  1W36 C;  3W6V A;  4OIQ F;  4HZF A;  3L1P A;  1VQM I;  1SMT A;  2N8G A;  1ETK A;  1V5F A;  1X3U A;  2DA7 A;  2OF7 A;  2BGC A;  5LGU A;  3K70 C;  4ENM A;  4HX7 A;  2FD5 A;  1I1G A;  2XF6 A;  2STT A;  1ZG1 A;  3TDU C;  3J81 Z;  3GTJ J;  4U0V A;  2DFF A;  3IC7 A;  3K6G A;  1LE8 B;  3BG6 A;  4CUG A;  4EM0 B;  2VL8 A;  2EBI A;  2ZC2 A;  2EFP A;  3E3V A;  3BG7 A;  4LK0 F;  4A0Z A;  3CMY A;  2VC0 A;  3COA C;  2HOA A;  1CF7 B;  2JSP A;  2I8D A;  3Q9S A;  3RQ4 A;  2LOO A;  5LGN A;  2M0C A;  5EF6 A;  4ZDL A;  5DUI A;  1XG1 A;  4AM3 A;  3I4P A;  1JKO C;  5FLX Z;  2E2J J;  3NRV A;  1U5T B;  4M72 A;  3S32 A;  2FU4 A;  4M6X A;  2L5Q A;  2L3D A;  2NOG A;  2LBF B;  4G7O F;  2VBW A;  3OR1 C;  1Y39 A;  4Y33 A;  2DT6 A;  2FEZ A;  4PCQ A;  1P2F A;  1TW2 A;  5ICE A;  4XON A;  2NAZ A;  2CMP A;  2Y30 A;  2XAU A;  4BEH B;  3W6K B;  1DPU A;  1QA6 A;  2JPC A;  3ZMD A;  1VND A;  3LSJ A;  2ECB A;  1BC7 C;  1JGS A;  5KHD A;  2RNJ A;  5FFX A;  1W0T A;  1BOB A;  3MEX A;  1MMA A;  2DCE A;  2ZB9 A;  3VFZ A;  3T1B A;  2XSD C;  3DEU A;  5EGO A;  3D5S C;  2KT0 A;  1MD0 A;  5CQE A;  1ON2 A;  3F72 A;  3HL2 A;  2VQG A;  1D1C A;  4GCV A;  5IP9 J;  2LC2 A;  2X6W A;  1U8R A;  2LKX A;  2JVH A;  3A03 A;  1IAW A;  5LHG A;  4IOA F;  2QCO A;  2J5P A;  4I0A A;  4BGD A;  3HRU A;  3SXY A;  2OPT A;  1S6L A;  2K4B A;  3PIP F;  2BW3 B;  2KRC A;  5J1R A;  3KP5 A;  4A3D J;  3GO5 A;  4G94 A;  2J5O A;  2XRO A;  2YUS A;  2HDC A;  5D5W B;  3T8R A;  3LSP A;  1FT9 A;  3NWT A;  3FHZ A;  4G7H F;  2PJP A;  1GLN A;  3GTK J;  3QPH A;  3U1D A;  1HCR A;  1FYM A;  4OOI A;  3PIO F;  1XPX A;  3SZT A;  1ETV A;  2OZ6 A;  4UVB A;  2IPQ X;  5FJ8 J;  2KMU A;  1YOV B;  2QSH X;  1F5T A;  2K9N A;  4LOC A;  2GOM A;  2JN6 A;  1AU7 A;  1VQ9 I;  4HF2 A;  5JFR A;  3MCZ A;  4DNC A;  1HKT A;  5F6F A;  3I53 A;  4ZDP A;  4ESF A;  1WH7 A;  4EEF G;  1X19 A;  2NNY A;  3E5U A;  2H1L A;  3KLO A;  5JHU A;  4Y17 A;  4GDF A;  3CUQ B;  5GPC A;  5E3O A;  3CC2 I;  4CIC A;  1X4O A;  2X6X A;  1Z3X A;  3FZV A;  3BC8 A;  2Z99 A;  5AON A;  1P4W A;  5KCM A;  1IRX A;  4I98 B;  2K9Q A;  2BHZ A;  1TT5 B;  1FOY A;  1SMY F;  2JA7 J;  3KZI C;  1QGP A;  4ZJZ A;  4HNT A;  4FX4 A;  1LUJ B;  2FOW A;  3Q0V A;  1IN5 A;  1TW3 A;  3Q0W A;  3K0L A;  3WTY C;  2B9S A;  1W5C C;  4OU0 A;  4PZJ A;  1U5T C;  1K4T A;  2Z3Y A;  3WU0 A;  2LYC A;  3I4M J;  1Y1W J;  4NBQ A;  2MD5 A;  2QBY A;  4KMU X;  2LG4 A;  1DGW Y;  2CUJ A;  3I4N J;  3IHU A;  3EUK L;  4BXF A;  1BI0 A;  5DTD A;  1ENH A;  3CES A;  3K7A J;  2E7W A;  1P92 A;  3C2H A;  3GW2 A;  3FXU A;  2JSC A;  3BR2 A;  1XD7 A;  1VFC A;  3I55 I;  1FBS A;  2HQ5 A;  3HTS B;  1BIB A;  4CGZ A;  3G1O A;  5TIS C;  1L0O C;  2HKO A;  4NUB A;  4BJ5 C;  2PLY A;  2HEO A;  4E7K A;  4Q5S F;  2GQQ A;  2HS5 A;  3ZP5 A;  2R4G A;  5EDN A;  1MBJ A;  3ML6 A;  1U9O A;  3CCV I;  2ZXW H;  1ZRE A;  2F48 A;  1IV6 A;  2ZSH B;  3HOZ J;  3JRA A;  5FD5 A;  4EM2 A;  2KRF A;  1JKQ C;  2W85 A;  5FLM J;  2L4M A;  1DP3 A;  5D4S A;  3RPQ A;  1JUM A;  5LRS A;  1T0F A;  2DOF A;  3PQK A;  3F0C A;  4L9V A;  4BS9 A;  3X2Q H;  1FJL A;  3KP7 A;  1JJ6 C;  5D8K B;  2R7T A;  1ORK A;  1TQM A;  2IA2 A;  3EDP A;  2K40 A;  1RUN A;  3DQV C;  3OS2 A;  1GDT A;  3F8M A;  3QU3 A;  1O4X A;  1OCC H;  4A3L J;  2C6Y A;  2E5N A;  1RNL A;  1WZ2 A;  2VN2 A;  5E18 F;  3HOT A;  1EH7 A;  2VPR A;  3A0B C;  2OTL I;  2R7F A;  2RNG A;  3L09 A;  2OV7 A;  4JQF A;  1Z9C A;  3CDH A;  1B72 A;  1QHG A;  3OYE A;  1G6N A;  3HHG A;  1YW7 A;  4O5V A;  4IO9 F;  4DW6 A;  4G6T B;  2JK3 A;  1UAA A;  3WU1 B;  4ETS A;  5HNH A;  5TGT A;  1TQI A;  1MSE C;  1T2K A;  3CCU I;  1WJC A;  2FBH A;  3CUQ C;  5EEH A;  2LKS A;  5ICC A;  5HLG A;  2XGD A;  2CRG A;  1IXS B;  2NS7 A;  2Y0S A;  3F6V A;  2KIM A;  4C2T A;  2DJN A;  4XBF A;  2XPU A;  4IOC F;  3BR1 A;  2WV0 A;  5HDK A;  2R7W A;  1WKM A;  5FB2 A;  1KYW A;  3F8N A;  3I59 A;  2F2E A;  2ZBK A;  5M5Y J;  1YQA A;  1E3H A;  3T0Y A;  3TW6 A;  3CJT B;  4K2E A;  2ZJR F;  3MAJ A;  2ZME A;  4YRV A;  4X0G A;  2DPU A;  2LY1 A;  1GHC A;  2NYX A;  1EF4 A;  2Y75 A;  4A3J J;  2CW0 F;  3CCY A;  3OYM A;  2ZFW A;  4HLY A;  4Y13 A;  3IH4 A;  2KDO A;  1U2W A;  4MFE A;  3O6B B;  1PUF A;  3JW4 A;  2BHY A;  4DYC A;  2VQC A;  2ECC A;  5EG0 B;  1WQ2 A;  2QQB A;  2PFB A;  2W82 A;  4A6D A;  5J4V A;  4FT8 A;  1AOY A;  2AQE A;  1XGO A;  1RRJ A;  1TWA J;  2R5Y A;  4ANJ A;  3SFI A;  3TL4 X;  2Q1Z B;  2IGK A;  2V4J C;  3P9I A;  1K78 B;  2YPR A;  4PGG A;  2LDU A;  3FHN A;  2ELK A;  1FEX A;  4N9I A;  4NB5 A;  2WTE A;  5J47 A;  3MN2 A;  2DN0 A;  3JRC A;  1V54 H;  3CCJ I;  1SFK A;  4BJ6 C;  1TT0 A;  4CHU A;  3I71 A;  2LNB A;  1LDK B;  1TWC J;  3H3Z A;  3RYR A;  3FM3 A;  3K4C A;  4HG2 A;  2DU9 A;  2XRN A;  3ABM H;  4A3C J;  1APL C;  1Y0N A;  4H4K C;  3S1N J;  1ETY A;  1UG0 A;  3DU5 A;  1X2M A;  4ASN A;  1YX5 A;  5CJ9 A;  2HVR A;  4OWR B;  1F43 A;  4D5F A;  2HVQ A;  2JVG A;  2KIF A;  5FD6 A;  3NQO A;  3BCB A;  1X3Z B;  2BYV E;  3LST A;  3FXK A;  3T5X A;  3HKZ N;  3OYK A;  4LG0 A;  1ETX A;  5L3E A;  3W2V A;  3LAJ A;  2MSY A;  1KU2 A;  1YJ9 I;  3I56 I;  3BY6 A;  3H0G J;  2F4O B;  2RAE A;  2HTJ A;  4XRS G;  3FBI B;  2E19 A;  1P4X A;  3MKZ A;  1WWX A;  2PJR A;  2V7F A;  5BPI A;  3J7A O;  2PMZ A;  4ON0 A;  3N05 A;  1V4R A;  2HYG D;  2XKO A;  1K6Y A;  1RZ4 A;  1JUS A;  4XM3 A;  1IXR C;  2IGM A;  3JTG A;  1B1B A;  1BW6 A;  2VJ5 A;  2AXT C;  4XLP F;  2M0M A;  2HFH A;  2V26 A;  2P81 A;  2XGE A;  2W48 A;  3FKJ A;  2CWE A;  2Y0M A;  2MYS A;  1SEU A;  3B73 A;  1RR7 A;  3GYH X;  2R7D A;  4LFU A;  4CYD A;  3S8P A;  3KCC A;  5B3S H;  3KE2 A;  2ZSI B;  1SVO A;  1I39 A;  5JHF A;  4IHT A;  3GXO A;  3HKZ A;  1OCO H;  3S3M A;  1F1Z A;  1K7A A;  4GO1 A;  3FXL A;  2R7U A;  2A6E F;  2G7U A;  1UMQ A;  1BN5 A;  5JVT A;  1Z91 A;  3M9A A;  1WVR A;  1WSU A;  1ERD A;  3FKI J;  4RM2 A;  2LY2 A;  1ZG5 A;  2HVS A;  4LB6 B;  4J00 A;  4C9Y A;  4MTD A;  3WGI A;  2EFO A;  4CYC B;  1FNN A;  4KA4 A;  2YSR A;  3ZMU A;  3AG2 H;  4D5C A;  5GTH C;  2EA4 A;  4B48 A;  2HPI A;  4DIQ A;  3QRF F;  1XGS A;  4A93 J;  2HYF A;  4NC6 A;  1ZTR A;  2DT5 A;  2R92 J;  2HI3 A;  3MKL A;  3CLO A;  5M3F J;  2Q0O A;  3BDD A;  3UR3 C;  5J6X A;  2X6O A;  2Q2E A;  4NC8 A;  4UVC A;  3W3C A;  4ZYE A;  1R4M B;  4XID A;  1AKH B;  2PI0 A;  3L2V A;  2BXY A;  5FRO A;  1QBJ A;  2ZNY A;  1NHA A;  3BTI A;  2QUF A;  3RPU A;  1YO5 C;  3FMR A;  1W0U A;  2H09 A;  2ZNZ A;  4MEX F;  1BC8 C;  1XX5 A;  4NHJ A;  3IL2 A;  2VE9 A;  4OIP F;  1MBK A;  2FMY A;  3F6O A;  3ZRG A;  4DBR A;  5FFZ A;  2FA5 A;  3ZMV A;  3WTV C; 
#chains in the Genus database with same CATH homology
 3KET A;  2CYY A;  5ILV A;  5ED4 A;  3J80 K;  2EJR A;  1D5V A;  4CDG A;  1G3T A;  1W4M A;  2NNN A;  1RI7 A;  3ZQ7 A;  2OD5 A;  3P7N A;  1R5G A;  3R61 A;  2IA0 A;  1TLH B;  1V3F A;  1SD4 A;  3C1D A;  3CUO A;  4EJT A;  3WE3 A;  3R60 A;  3L2C A;  3KEO A;  1TTY A;  4YII A;  4I2O A;  3FM5 A;  4WXH A;  3F8F A;  2QWW A;  2XAG A;  2HQN A;  5HVQ C;  2M45 A;  4LB5 A;  1W7P A;  3EET A;  2BV6 A;  5KVR A;  4N0B A;  3DV8 A;  3HSR A;  4BYY A;  2RDP A;  3DXJ F;  1YG2 A;  4A5N A;  1MDM B;  3DF8 A;  2Z9O A;  4KYW A;  1DUX C;  1H9T A;  4ZYH A;  2MBF A;  3HRT A;  4EGZ A;  2DLL A;  4A5M A;  2LF8 A;  5E8G A;  3RIR A;  1P6R A;  4KIC A;  4AWX B;  3IRR A;  1KQ0 A;  1J7K A;  2FF4 A;  5E1W A;  1J9I A;  2VBZ A;  1OPC A;  4MGR A;  2FNP A;  1I1S A;  2GXG A;  3R4K A;  5J8C A;  4CZZ A;  4EJO A;  2ZKZ A;  2A68 F;  4WK8 F;  1FP1 D;  4Q4Z F;  3E6D A;  1IUY A;  2O6G E;  4FX0 A;  5DCF A;  2OA4 A;  5HDG A;  2RV8 A;  4L9J A;  4M74 A;  1Z6R A;  2HWV A;  1YS6 A;  5LLQ A;  1FLI A;  4I01 A;  3K1N A;  5ILS A;  4MEY F;  4G7Z F;  3ZMS A;  3RYP A;  1L3L A;  4G9Y A;  1QNT A;  2XAH A;  2OAZ A;  3OOP A;  2YU3 A;  2WC2 A;  2KKO A;  4TV7 A;  1FY7 A;  5CYV A;  4M9X A;  4HF0 A;  1ONV A;  1J75 A;  1T98 A;  2DBB A;  2ACJ A;  1U3E M;  3Q5F A;  2MH2 A;  4GYG A;  1KYZ A;  4RGX A;  3V7R A;  2OU2 A;  4M9S A;  2QQA A;  2K02 A;  5TJJ A;  2WWY A;  1W7P D;  5L3D A;  3QU6 A;  2ELH A;  4M71 A;  4O6J A;  4Q47 A;  2G9W A;  2P6S A;  2P5K A;  1UHW A;  4LK1 F;  4UHT A;  1YW8 A;  2VOD A;  5A2Q K;  5BOX A;  2V9V A;  4R1H A;  4UUV A;  1ODD A;  1IZ1 A;  1LDJ A;  1UFM A;  2HR3 A;  2EWN A;  2VT3 A;  3F23 A;  2VOP A;  3MFK A;  1MGT A;  1LB2 A;  2NRA C;  2IT0 A;  1IN7 A;  4F7Z A;  3IWZ A;  4KT5 C;  1G3W A;  3AAF A;  1HKQ A;  3V7C A;  3R0J A;  4G6D A;  2ISZ A;  3ULQ B;  1DP7 P;  1XGN A;  1T6S A;  4PDK A;  1QQI A;  2YR2 A;  2ADU A;  1TBX A;  2EB7 A;  3DKW A;  2ZXJ A;  2Y48 A;  3TQN A;  3DPT A;  4NQW A;  4KIG A;  1FZP B;  2HOE A;  3V4G A;  3L00 A;  3F8C A;  5JI6 A;  3TO7 A;  2E1C A;  4LGW A;  4L9N A;  3I59 B;  4WCG A;  2O61 A;  2ISY A;  3ZPL A;  2H27 A;  2QQ9 A;  5CLS A;  2OZU A;  4G8X A;  3C3W A;  2H6B A;  3LFK A;  2W24 A;  5DUK A;  3F8B A;  1CF7 A;  2HKX A;  4AIK A;  3LA7 A;  3F21 A;  1RUO A;  1KQ9 A;  1FP2 A;  5ICF A;  5LGT A;  5AIP A;  2DW4 A;  5DYM A;  3KZY A;  5L3G A;  1YS7 A;  5ILU A;  2A07 F;  1P4A A;  2EA2 A;  1U5T A;  1R36 A;  2MC3 A;  2KIU A;  1S29 A;  5BS6 A;  1AWC A;  2FML A;  1GVJ A;  2JT1 A;  3CO7 C;  2DAO A;  2TDX A;  3D5L A;  4BH9 A;  1CGP A;  3ZN0 A;  4ENJ A;  2O03 A;  3EYI A;  2XV4 S;  3JSP A;  4R8H A;  2MLG A;  2E1N A;  2D45 A;  2IRF G;  4RB0 A;  4QLC U;  4RGR A;  1R22 A;  1XSD A;  1LDD A;  4MQV A;  1R58 A;  5DCM A;  2RVC A;  4HQM A;  1Y0U A;  3BJ6 A;  1D3Y A;  1YIO A;  1IN4 A;  3TKY A;  3Q9V A;  3HSF A;  3O2P E;  4EGY A;  1F4K A;  4G6Q A;  2VOO A;  4RB1 A;  4H0E A;  1SD5 A;  3P9C A;  3V8J A;  5HOO A;  1Q1H A;  2UXX A;  1B9M A;  1KU3 A;  4WWC A;  3MWM A;  1W5T A;  2IW5 A;  1OYW A;  4HAM A;  1Z6T A;  1R1T A;  3CUQ A;  2GXB A;  1HXD A;  1MJB A;  2FQ3 A;  2P7V B;  3BJA A;  2XAF A;  2A69 F;  2A3S A;  3KP6 A;  2FOK A;  3WTS C;  4HW0 A;  3GLX A;  4U0Y A;  4B09 A;  5KK1 A;  6PAX A;  4BNC A;  2AS5 F;  4U7D A;  3GEZ A;  2OQG A;  5FGM A;  2XAJ A;  4RAZ A;  1R1U A;  1FOK A;  2BEO A;  1BM9 A;  3GF2 A;  1QZZ A;  4ENN A;  1T39 A;  1K6O A;  3ECO A;  3JSO A;  1DPR A;  3J80 Z;  3RKW A;  3WTZ A;  2JTV A;  3WGG A;  3ABT A;  5K1Y A;  2W25 A;  2GIV A;  1LJ9 A;  4OIO F;  1YTY A;  2M5W A;  1IF1 A;  5D5X B;  1FWZ A;  5LEK A;  3KP4 A;  3RDI A;  3TO9 A;  2XVC A;  1B9N A;  1T38 A;  3GZ5 A;  3N4M A;  3I54 A;  4EJV A;  5D5V B;  1QPM A;  1U78 A;  4WX9 A;  1HKS A;  4YFX F;  3E6B A;  1SD6 A;  2FE3 A;  4IRG A;  3M8E A;  4S04 A;  3HHH A;  5LRR A;  1REP C;  3BWG A;  3F3X A;  4FHT A;  4KDP A;  4OIR F;  3R6S A;  3HYI A;  4UV9 A;  1SAX A;  4YG2 F;  3ZMZ A;  1IRF A;  1XSX A;  1Z05 A;  3HTU A;  1FX7 A;  5E1X A;  2VXZ A;  2EV5 A;  3I0T A;  4ZH4 F;  1S3J A;  1U6G A;  3B02 A;  3JAM Z;  5BMZ A;  5JR3 A;  5LEJ A;  1O3Q A;  1XCV A;  1BI2 A;  1S8N A;  3HSE A;  2H94 A;  3TDZ C;  3E6M A;  3FWE A;  4BAY A;  1XB4 A;  1MJ9 A;  3K1P A;  3DFG A;  4E70 A;  5H6R A;  1TNT A;  4MNU A;  4P96 A;  1I6X A;  2V6C A;  2P4W A;  1K78 A;  2XKP A;  1ZRC A;  2W57 A;  1ZHF A;  2YX7 A;  4GXO A;  1XN7 A;  2L02 A;  1FBU A;  1UCR A;  5HS9 A;  3OV8 A;  1SFE A;  2P7C B;  2EFN A;  3QOP A;  5K5R A;  2PMU A;  1R1V A;  4QWQ A;  2QVO A;  4AIH A;  1ZYR F;  4HV5 A;  3U9G A;  4BHP A;  4EJU A;  3DP7 A;  3K69 A;  3WTX C;  3GVA A;  1SFX A;  4CO8 A;  4HDU A;  5DEQ A;  2MLK A;  1WI9 A;  3JTH A;  4A12 A;  3MQ0 A;  1O3R A;  1IN8 A;  4IVN A;  3S2W A;  1ZLJ A;  1BI3 A;  4BXU A;  2V1U A;  5ERI A;  1C0W A;  3C7J A;  3MZH A;  4WF2 A;  4ZYD A;  4GYI A;  3O3K A;  1YLF A;  1ZGA A;  2BBY A;  4N9H A;  2RC4 A;  3M7G A;  2A6H F;  3QAH A;  3D0S A;  1JHF A;  4XRF A;  2ZCW A;  1SD7 A;  1ZAO A;  1S7A A;  1J0R A;  2JPB A;  3N97 A;  3V7S A;  3I5U A;  2G7H A;  2GA1 A;  1WRJ A;  4HX4 A;  4DQ2 A;  1G4D A;  3GFL A;  2O0Y A;  4MQ9 F;  2COM A;  2JZY A;  1J2X A;  1O7F A;  4L18 B;  5DD4 A;  5LHI A;  4ZYG A;  5CVR A;  4HA8 A;  2B0L A;  2VC1 A;  3CO6 C;  2GWR A;  4HOB A;  4RGU A;  3KFW X;  3TOA A;  3MZY A;  4IF4 A;  5E1Z B;  4KMF A;  1ZH5 A;  4XSZ F;  1JHH A;  4P9U A;  3H92 A;  1H9G A;  3HUG A;  2GA2 A;  5HDN A;  4WXD A;  2UWM A;  2D1H A;  5ICG A;  2X4H A;  1HBX G;  5F1R A;  4A2U A;  4A6E A;  4RAY A;  1I27 A;  1OYI A;  2PBI A;  2PMH A;  1MZB A;  2V79 A;  5CVJ A;  3L7W A;  2UZK A;  1XDS A;  4HLX A;  2O8X A;  4LLN A;  4IRI A;  2ETH A;  4KN4 X;  3E97 A;  1FYL A;  4L0Y B;  4KIB A;  4HYE A;  1HW1 A;  3BZ6 A;  2MA3 A;  3WOD F;  1LEA A;  3GWZ A;  2PN6 A;  5IT9 K;  3K1M A;  2RQP A;  3DPL C;  2STW A;  1MDM A;  4LJZ F;  2DQL A;  5CVU A;  2QBY B;  3KP3 A;  1J59 A;  2CSO A;  4M9Z A;  4EVI A;  2FNA A;  4P55 A;  4RS8 A;  1DDN A;  2O3F A;  4KUM A;  2EFW A;  3BP8 A;  3CJN A;  5LHH A;  1IN6 A;  4LMY A;  1PUE E;  1F9N A;  2HGC A;  1E2X A;  1FYK A;  2DK8 A;  1H0M A;  1HW5 A;  2ESN A;  1ULY A;  1TNS A;  3QP5 A;  3LA2 A;  4M6Y A;  1XGM A;  3EQL F;  5K5O A;  3LQQ A;  4YFK F;  3WTU C;  5DDG A;  2D1V A;  3LAP A;  2NS0 A;  3NEU A;  2EFQ A;  2A61 A;  4OIN F;  2XIG A;  4IJA A;  2VE8 A;  3C18 A;  3HRS A;  3R0A A;  3ELK A;  2UXN A;  4ESJ A;  5DCM B;  4O3M A;  3BRO A;  2Q8K A;  3ISP A;  2A5Y B;  4LD5 A;  1B6A A;  4L5J A;  3HOS A;  2DFI A;  4WXC A;  2V1D A;  5D6F A;  1XMK A;  3W6J B;  3L9F A;  3G3Z A;  3T8T A;  4M73 A;  5E17 F;  5D5U B;  2EV6 A;  2CFX A;  3WG9 A;  3J81 K;  3SFZ A;  2IA1 A;  1LNW A;  1XMA A;  4HBL A;  4IHS A;  3QP6 A;  3RKY A;  2RGV A;  3IWF A;  3GFM A;  1LEB A;  2ZME B;  3FMS A;  3I58 A;  4KIF A;  3TGN A;  5IT3 A;  5FLX K;  1MJA A;  1YYV A;  4A0Y A;  2XHK A;  3FF5 A;  1LQ1 A;  3HIF A;  2M8E A;  1KQ8 A;  1BIA A;  1KA8 A;  5BPD A;  1XCB A;  2FBI A;  2LKP A;  2FBK A;  3G73 A;  1ZLK A;  2M1B A;  1IW7 F;  1GXQ A;  1HST A;  1TQP A;  2HZT A;  2ESH A;  3LA3 A;  1IXC A;  4EMS A;  4EQQ A;  2QLZ A;  2K4J A;  3K2Z A;  4ENK A;  2PEX A;  4LG0 B;  3BPX A;  4OMY A;  1W5S A;  5L3C A;  2K27 A;  4ZZL A;  4MHG A;  3EYY A;  2KJB A;  3BJO A;  3SZP A;  4UVA A;  2FXA A;  1EV7 A;  1FBQ A;  2OBP A;  1KU7 A;  3ECH A;  4AD9 A;  1FPQ A;  3E5Q A;  4U7B A;  3RI4 A;  3K9T A;  1BI1 A;  2P8T A;  2DQR A;  4HQE A;  1JE8 A;  1D8J A;  2CGP A;  2JRT A;  2H6C A;  2CG4 A;  3TOB A;  4YIF A;  4IXA A;  5E20 A;  2XAS A;  4BHC A;  3PQJ A;  1YFH A;  4HV6 A;  3IKV A;  4HF1 A;  1OKR A;  3M1E A;  1OYY A;  4D0P A;  4Q48 A;  3RKX A;  3GFJ A;  2PQ8 A;  4RB3 C;  4I02 A;  1O3S A;  3KZZ A;  1ZAR A;  2RKH A;  2IP2 A;  2LSO A;  2Z33 A;  3KP2 A;  2QYO A;  1O3T A;  1XDU A;  4KNY A;  1BBY A;  4Y15 A;  4HDV A;  4I09 A;  1PDN C;  5L3B A;  2DK5 A;  1GXP A;  1IRG A;  2AXL A;  4I7H A;  1KU9 A;  2IVM A;  2VT2 A;  2XAQ A;  2M30 A;  3RTR A;  4AVP A;  1O7L A;  3TO6 A;  3WE2 A;  3V8L A;  4EV0 A;  1UB9 A;  1BJA A;  2QM3 A;  2VBX A;  5H20 A;  2LF7 A;  5D6E A;  2V1X A;  2L4A A;  3BOQ A;  3WGH A;  2BE5 F;  2PG4 A;  4LLL A;  4JBA A;  4L9T A;  2F5F A;  1B4A A;  4CXF A;  3WTT C;  5FO5 A;  2KJC A;  1ZRF A;  4HX8 A;  3QPT A;  2FSW A;  2FRH A;  3GX4 X;  1A04 A;  1O57 A;  1Z1D A;  1XSV A;  4IPA A;  1W7P B;  1JXS A;  3KLN A;  3REO A;  3VB2 A;  1D8K A;  3VOE A;  1VTN C;  1QZY A;  4Z2Y A;  4RB2 C;  4OMZ A;  1QO0 D;  4JK1 X;  2M87 A;  3FXR A;  1EH6 A;  3V8K A;  3GUD A;  5HS7 A;  5J8F A;  2K86 A;  4U88 A;  4I0B A;  1KGS A;  4L0Z B;  2DTR A;  2XUB A;  4UNO A;  5K5Q A;  3I64 A;  3E5X A;  5DD8 A;  1HQC A;  1FC3 A;  5LBQ A;  3FMQ A;  2HTS A;  4EM1 A;  1STZ A;  5H6Q A;  2DO7 A;  3H3U A;  3IRQ A;  1PP8 F;  1SFU A;  3E6C C;  1ZGJ A;  2VBY A;  2GAU A;  3SQN A;  1G3S A;  4LLG F;  2QZ8 A;  1I5Z A;  3ZN1 A;  2VON A;  3M8F A;  2YX4 A;  5CVV A;  2F5E A;  3U2R A;  4IRH A;  3PFI A;  3VOD A;  4YFN F;  1R23 A;  5D8L B;  1FSH A;  4S05 A;  2DPD A;  4RGS A;  1S7O A;  4B8X A;  3ERE D;  5HLI A;  1PP7 U;  1OMI A;  2GZW A;  5HS8 A;  4KN7 X;  3WTW C;  4AIJ A;  1Z7U A;  1BOA A;  1FSE A;  2L54 A;  4UXN A;  5L3F A;  3IKT A;  3CTA A;  2K7L A;  1R7J A;  3ROU A;  2OQR A;  2Z5U A;  4XSX F;  1G3Y A;  5EEG A;  3LQR A;  5CVI A;  4EJW A;  2W84 A;  4ZZD A;  1B59 A;  2R3S A;  2EK5 A;  4ESB A;  1UHM A;  4P5O A;  5BQT A;  1LVA A;  2F5C A;  4R79 A;  2CQK A;  1K79 A;  1ZG3 A;  1USS A;  5DV5 A;  4PGH A;  4U0W A;  5D4R A;  1OR7 A;  3JAM K;  2E7X A;  5IT9 Z;  5E8I A;  2P5V A;  2XGX A;  5F64 A;  4P9F A;  1ZN2 A;  1UST A;  3P9K A;  1RIO H;  5AIQ A;  5A2Q Z;  1HW2 A;  2CO5 A;  3GFI A;  3HRM A;  2EV0 A;  3GZ6 A;  1HSJ A;  3LWF A;  3RJP A;  2P6T A;  4BQA A;  3EUH A;  5TRD A;  2D2W A;  2MH9 A;  4KFC A;  2ZO4 A;  1R5H A;  2RN7 A;  3ABU A;  3VEP A;  2P5L C;  1EH8 A;  3FX3 A;  2DI3 A;  2F5D A;  3F22 A;  4A0X A;  4BHB A;  1YW9 A;  2X0L A;  4MTE A;  2ZJ2 A;  2L01 A;  4UV8 A;  5HLH A;  1ON1 A;  4XLN F;  1J5Y A;  3SHF A;  3BPV A;  4L5I A;  3ZMT A;  2HQR A;  3FXQ A;  1MKM A;  1R00 A;  1ZRD A;  1E17 A;  2QEN A;  4GGG A;  2IJL A;  3KEQ A;  4OIQ F;  4HZF A;  1SMT A;  1X3U A;  2BGC A;  5LGU A;  4ENM A;  4HX7 A;  1I1G A;  2STT A;  1ZG1 A;  3TDU C;  3J81 Z;  4U0V A;  3IC7 A;  4EM0 B;  4A0Z A;  2EFP A;  3E3V A;  4LK0 F;  3COA C;  2VC0 A;  1CF7 B;  3Q9S A;  5LGN A;  5DUI A;  3I4P A;  5FLX Z;  3NRV A;  1U5T B;  4M72 A;  2FU4 A;  4M6X A;  2L3D A;  4G7O F;  2VBW A;  2FEZ A;  4PCQ A;  1P2F A;  1TW2 A;  5ICE A;  2NAZ A;  3W6K B;  1DPU A;  2JPC A;  3ZMD A;  1BC7 C;  1JGS A;  2RNJ A;  5FFX A;  3MEX A;  3VFZ A;  3T1B A;  3DEU A;  1MD0 A;  1ON2 A;  3F72 A;  4GCV A;  1U8R A;  1IAW A;  5LHG A;  2J5P A;  4I0A A;  3HRU A;  3SXY A;  1S6L A;  2K4B A;  3KP5 A;  3GO5 A;  4G94 A;  2J5O A;  2XRO A;  2HDC A;  5D5W B;  3T8R A;  1FT9 A;  3FHZ A;  4G7H F;  2PJP A;  3QPH A;  3U1D A;  1FYM A;  4OOI A;  3SZT A;  2OZ6 A;  4UVB A;  2IPQ X;  1F5T A;  4HF2 A;  5JFR A;  3MCZ A;  4DNC A;  1HKT A;  5F6F A;  3I53 A;  4ESF A;  2NNY A;  3E5U A;  3KLO A;  5JHU A;  4Y17 A;  3CUQ B;  4CIC A;  3FZV A;  2Z99 A;  5AON A;  1P4W A;  4I98 B;  1SMY F;  1QGP A;  4FX4 A;  1IN5 A;  1TW3 A;  3K0L A;  3WTY C;  4OU0 A;  4PZJ A;  1U5T C;  2Z3Y A;  3WU0 A;  2MD5 A;  2QBY A;  4KMU X;  3IHU A;  1BI0 A;  2E7W A;  1P92 A;  3GW2 A;  3FXU A;  2JSC A;  1XD7 A;  1FBS A;  3HTS B;  1BIB A;  4CGZ A;  1L0O C;  2HKO A;  2PLY A;  2HEO A;  4Q5S F;  2GQQ A;  2HS5 A;  3ZP5 A;  3ML6 A;  1ZRE A;  5FD5 A;  4EM2 A;  2KRF A;  2W85 A;  2L4M A;  5D4S A;  3RPQ A;  5LRS A;  1T0F A;  3PQK A;  4L9V A;  3KP7 A;  5D8K B;  1TQM A;  2IA2 A;  3EDP A;  1RUN A;  3DQV C;  3F8M A;  3QU3 A;  2C6Y A;  1RNL A;  2VN2 A;  5E18 F;  3HOT A;  1EH7 A;  2R7F A;  3L09 A;  4JQF A;  1Z9C A;  3CDH A;  1G6N A;  3HHG A;  1YW7 A;  4O5V A;  3WU1 B;  4ETS A;  1TQI A;  1T2K A;  2FBH A;  3CUQ C;  5EEH A;  5ICC A;  5HLG A;  1IXS B;  3F6V A;  2KIM A;  4XBF A;  2WV0 A;  5HDK A;  1WKM A;  5FB2 A;  1KYW A;  3F8N A;  3I59 A;  2F2E A;  2ZBK A;  1YQA A;  3T0Y A;  4K2E A;  3MAJ A;  2ZME A;  2DPU A;  1GHC A;  2NYX A;  2Y75 A;  2CW0 F;  4HLY A;  2ZFW A;  4Y13 A;  1U2W A;  3O6B B;  3JW4 A;  1WQ2 A;  2QQB A;  2PFB A;  4A6D A;  1AOY A;  4FT8 A;  1XGO A;  3P9I A;  1K78 B;  2YPR A;  4PGG A;  2LDU A;  4N9I A;  4NB5 A;  2WTE A;  4CHU A;  3I71 A;  2LNB A;  1LDK B;  3H3Z A;  3RYR A;  3FM3 A;  2DU9 A;  2XRN A;  4ASN A;  5CJ9 A;  2KIF A;  5FD6 A;  3NQO A;  2BYV E;  3LST A;  3T5X A;  4LG0 A;  5L3E A;  3LAJ A;  1KU2 A;  3BY6 A;  2HTJ A;  1P4X A;  1WWX A;  5BPI A;  3J7A O;  4ON0 A;  1V4R A;  2HYG D;  2XKO A;  1RZ4 A;  1IXR C;  3JTG A;  1B1B A;  4XLP F;  2HFH A;  2CWE A;  2Y0M A;  3B73 A;  3GYH X;  2R7D A;  4LFU A;  4CYD A;  3KCC A;  3KE2 A;  4IHT A;  3GXO A;  1K7A A;  1F1Z A;  4GO1 A;  2A6E F;  2G7U A;  1BN5 A;  5JVT A;  1Z91 A;  3M9A A;  1WSU A;  1ZG5 A;  4LB6 B;  4MTD A;  3WGI A;  2EFO A;  1FNN A;  4KA4 A;  2YSR A;  3ZMU A;  2EA4 A;  3QRF F;  1XGS A;  2HYF A;  2DT5 A;  3CLO A;  2Q0O A;  3BDD A;  5J6X A;  2Q2E A;  4UVC A;  4ZYE A;  2PI0 A;  1QBJ A;  2ZNY A;  1NHA A;  3RPU A;  2QUF A;  1YO5 C;  1BC8 C;  3FMR A;  2H09 A;  2ZNZ A;  4MEX F;  4NHJ A;  3IL2 A;  2VE9 A;  4OIP F;  2FMY A;  3F6O A;  5FFZ A;  2FA5 A;  3ZMV A;  3WTV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...