4L9NA

Crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
137
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 52
structure length 137
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9nA00
4G94A 1R36A 1Z91A 3LA7A 1I1GA 3IRQA 3CUOA 5ED4A 1LDJA 4ESBA 2JZYA 4OIRF 1IN5A 3LA3A 3HYIA 4I2OA 4LB6B 1O3QA 5DCMA 1MDMA 4EQQA 3WGGA 5L3EA 2HZTA 4G6QA 1FP1D 2BBYA 5E20A 1KA8A 3R4KA 3T1BA 2DPDA 4E70A 3B73A 2EA4A 1JE8A 4Y17A 5IT3A 3G73A 4M6YA 3K0LA 1FYKA 1ZGJA 2O03A 1BC7C 1HSJA 5ICFA 5ILSA 1HKSA 1O7LA 2HFHA 4KUMA 4A6EA 2XAGA 1QBJA 2QQ9A 4L9TA 2QM3A 2VONA 2LSOA 1S7AA 5L3DA 4HF0A 4EM1A 2EJRA 3JTGA 3LSTA 3ZMSA 4MQ9F 3DFGA 1TTYA 2W85A 3M9AA 3IKVA 2D2WA 1J5YA 5CVJA 3P9KA 4Q4ZF 2FBIA 2Y0MA 4GCVA 2VT2A 1U3EM 2MA3A 2KJCA 3U9GA 3EQLF 1CGPA 4U7BA 1ODDA 2O6GE 1HQCA 2TDXA 1O3SA 2M8EA 3KLOA 5LRRA 1RI7A 4MGRA 2PLYA 4KFCA 3HSRA 5JI6A 5BOXA 4O6JA 3ZMUA 4D0PA 4XSZF 3I59B 3R0AA 4M6XA 2EFOA 2VXZA 4CDGA 3H3UA 3FF5A 5ICCA 4UUVA 4L5JA 2DLLA 4I98B 2V1XA 4KICA 2VBXA 3KP3A 5JFRA 3AAFA 1OYWA 3Q9SA 3ISPA 5D8LB 3DQVC 2EWNA 5DUKA 2LF7A 5ILUA 3LQRA 4NQWA 2QQAA 1R22A 1FYLA 5BQTA 1ZN2A 3JW4A 3R6SA 3BROA 4RGRA 2HTSA 4L9VA 4M74A 5A2QZ 5DUIA 4RB2C 1QQIA 1O7FA 4P96A 3KP6A 4CICA 3E5XA 3VB2A 4IF4A 4OIQF 5F6FA 4GYGA 3L00A 1ZHFA 2YR2A 1HKTA 1R1TA 2A6EF 3Q5FA 3HOSA 3GLXA 2E1NA 2DFIA 4PGGA 3BPVA 4KDPA 4LGWA 4LLNA 5JR3A 1BOAA 2CYYA 2HEOA 1PUEE 4LK0F 1ULYA 2H09A 1QO0D 1XDSA 3L2CA 1OYIA 2IVMA 3JSOA 3RDIA 3CJNA 4BHCA 1TLHB 2XVCA 3I0TA 1YW7A 5AIQA 1IRFA 2O61A 3GWZA 3WTWC 2MH2A 3BJOA 1YO5C 4UVCA 3PQJA 3V8JA 1P6RA 3TDUC 3F21A 1FP2A 4G8XA 3HIFA 3QOPA 2VODA 3VFZA 1Z7UA 4IHTA 3D0SA 3RTRA 2A61A 3FMQA 4OINF 1KU9A 1YS7A 1IF1A 2W57A 4I0AA 1QZZA 3I59A 4AD9A 5ICGA 4HQMA 3ROUA 2FU4A 5LGUA 1C0WA 4GO1A 5E8GA 2UZKA 1YYVA 5FLXZ 5H20A 1YG2A 4UNOA 3TKYA 2XKOA 3K1MA 1YW8A 4L18B 4MEYF 3BJ6A 4I0BA 5DEQA 3ZP5A 3GVAA 5D5XB 2F5EA 4NB5A 1HXDA 2FEZA 4EV0A 3O6BB 2DW4A 1F1ZA 2FNPA 2W84A 1V4RA 1T2KA 4XSXF 5CLSA 3WGHA 3JTHA 4MEXF 1FBUA 1USTA 2V1UA 3N4MA 3K1PA 3FXUA 3GFLA 4RS8A 4UV9A 1ONVA 1HW5A 4AIKA 1MZBA 4GYIA 3ERED 3KEQA 3IL2A 2DQLA 1WQ2A 2QWWA 5LGTA 1K78B 2RNJA 2HS5A 2E1CA 3HRUA 1XGNA 2CSOA 1LNWA 2JTVA 1YW9A 3TOBA 2P5LC 2VE8A 4RB0A 1Z1DA 2Z9OA 3ZMVA 1RNLA 2GQQA 1FWZA 2ETHA 2WWYA 1BBYA 4HW0A 5A2QK 5BPIA 3B02A 2K7LA 3J81Z 2JSCA 3EDPA 1XN7A 2ZMEA 3SFZA 2L54A 4B09A 3VEPA 2XV4S 4OMZA 4Y13A 1TQMA 5LHIA 1REPC 5LHGA 3T8TA 1MJ9A 3IRRA 4O3MA 2L01A 3RPUA 3DPTA 2DAOA 5CJ9A 3T5XA 4YG2F 4I09A 3CUQB 4AVPA 4O5VA 5DD8A 3FM3A 4ZYHA 1XGSA 1R23A 2H6BA 2FBHA 4CXFA 2HKOA 4G7HF 4BNCA 3RPQA 5HDKA 2HGCA 5AIPA 3GF2A 3TQNA 1AWCA 4FHTA 1LJ9A 4EGYA 1PP7U 1XDUA 1BI2A 2MLGA 5ICEA 1FLIA 2HKXA 1K7AA 1KU7A 4TV7A 3KZZA 2X0LA 3IKTA 3WTVC 1IXRC 3I58A 4A0ZA 4ZYDA 1XCVA 2O0YA 1FNNA 4PCQA 3DF8A 2XRNA 5HOOA 2LF8A 1W4MA 3DV8A 2XKPA 5FLXK 4M73A 1WRJA 2EV5A 3IWZA 1GHCA 2V9VA 2MD5A 5D4RA 1DUXC 2A68F 2ZCWA 5KVRA 2QYOA 4KA4A 1RUNA 3KETA 2P6SA 3F8MA 3V8KA 3PQKA 1K79A 4KIFA 4G6DA 4WCGA 3WG9A 3ZMTA 5K5RA 3WTXC 3FM5A 2K27A 3K1NA 5E18F 3M7GA 2PEXA 2DPUA 2UXNA 2G9WA 1H0MA 3ABTA 1R5HA 3T8RA 3GEZA 3Q9VA 3R60A 3MQ0A 2E7WA 5DYMA 3I64A 4KIBA 4IXAA 1OYYA 3BJAA 3REOA 2H27A 3RIRA 1BI0A 3R0JA 4HV5A 4YIIA 1KYZA 4DNCA 3GUDA 4EJVA 3I53A 4OIPF 4MNUA 3C1DA 3O3KA 1I1SA 2MLKA 4EGZA 1KU3A 1QZYA 4R8HA 4WX9A 4LG0A 2NYXA 4HBLA 2JPBA 2EB7A 1HW1A 4EJTA 1KU2A 2MBFA 2P5VA 1D3YA 3S2WA 2PBIA 4HX4A 2BE5F 2XUBA 4WXDA 2QZ8A 4H0EA 4IRGA 1J9IA 1IN4A 3JSPA 3KP7A 4AIHA 1YLFA 5LEJA 2ELHA 3F8CA 3FHZA 4KYWA 3RYPA 4LB5A 3QP6A 1IRGA 4IRHA 3J81K 1J2XA 3DEUA 1FZPB 4G7ZF 1MJAA 2A6HF 1ON2A 1ZYRF 5BS6A 5HDGA 4YFXF 2M5WA 3CUQC 2XAJA 3OV8A 1CF7B 1JHFA 3ZMDA 5HDNA 3J80K 1WKMA 4JQFA 4L9NA 3F22A 4Q48A 1TNTA 5TJJA 1SMYF 4MTEA 3ZN1A 3HRTA 3MCZA 1FYMA 4LLGF 4R1HA 3MZHA 2FNAA 4KMUX 4MHGA 1HBXG 4HDVA 1LDKB 4BAYA 2CFXA 2MC3A 1ZREA 5K5QA 4HX7A 2PMHA 2PG4A 3E5QA 2IJLA 2HYFA 2XROA 2OU2A 3MFKA 5IT9K 3MWMA 2OQRA 2NNNA 1R58A 3HSFA 4L5IA 4UVAA 2ISYA 2LNBA 3NRVA 2P5KA 3FMRA 4AIJA 4JBAA 1RIOH 2HWVA 4WWCA 2IA2A 5HLGA 4EVIA 2MH9A 2Z33A 3DXJF 4M71A 3M8EA 3V8LA 1D8JA 1S6LA 4A2UA 3E97A 2DO7A 3TGNA 4YFNF 2QVOA 4ZH4F 3M1EA 3QU3A 2HTJA 3SXYA 4ZZDA 5E1WA 1IAWA 4CHUA 1R7JA 2ACJA 5FD5A 2IW5A 1B4AA 1G4DA 3SZTA 1J75A 2RGVA 2LKPA 3CLOA 3QU6A 3ABUA 1W5SA 3T0YA 5L3BA 3I71A 3LQQA 2RN7A 1XSDA 5L3GA 4ON0A 1U5TB 4HAMA 2DQRA 2G7UA 3EYIA 1Z6RA 1UB9A 5DD4A 3HSEA 2M45A 2L3DA 2FRHA 2VOOA 4HDUA 2YU3A 1CF7A 4FX0A 4IPAA 3TO6A 2M1BA 2OBPA 2KKOA 2LDUA 3BY6A 4RGUA 4RGSA 3WE3A 1BI1A 3HRSA 1I5ZA 2XAQA 3F72A 2XAFA 3HTUA 4U88A 6PAXA 4K2EA 1W7PB 4CO8A 2PQ8A 3HRMA 2GAUA 2V1DA 4Q47A 4A0YA 2D45A 5H6QA 2FMYA 2O8XA 4BYYA 2K4JA 3L9FA 1QNTA 2ADUA 5LEKA 2RVCA 2X4HA 3TDZC 2PI0A 1LDDA 3GW2A 3K69A 4L0ZB 4IJAA 4U0VA 1ZG3A 2Z3YA 2JRTA 3FZVA 5D8KB 2VE9A 2V6CA 1T6SA 2RC4A 3CTAA 3NEUA 3QAHA 1FOKA 1FX7A 1JGSA 1GVJA 4XBFA 1DPUA 2HDCA 4LD5A 1F9NA 3VODA 2DI3A 2NAZA 1KQ0A 3ECHA 3V4GA 1B6AA 2K02A 4LJZF 1T0FA 4KN7X 4ETSA 4A5MA 1JXSA 2GA1A 1YS6A 4OIOF 2P7CB 1YFHA 2FE3A 5EEGA 1BIAA 1U5TA 4XRFA 2RDPA 4YFKF 2WC2A 1P4AA 4M9SA 3RKXA 2A3SA 2ESNA 3FWEA 3E6DA 2EFPA 5HS7A 2F5CA 3L7WA 2STTA 4AWXB 2EV6A 2Z5UA 1E17A 2R3SA 2NRAC 1OPCA 5AONA 2ZKZA 1BI3A 3SQNA 4P9UA 2OA4A 4OMYA 2QBYB 5LGNA 5LRSA 4U0YA 3HTSB 2XIGA 1ZRFA 1B1BA 2GWRA 3QRFF 3GZ5A 1Z6TA 2HQNA 2OZ6A 1RUOA 1U5TC 2ZNZA 3DKWA 3C18A 4I7HA 2FBKA 1HW2A 1Y0UA 2DK5A 3F8BA 2ZNYA 2KIUA 3LFKA 1D5VA 3D5LA 3KP5A 3QP5A 3WTUC 3RI4A 4KIGA 1BJAA 1MJBA 5ERIA 3ZMZA 2AXLA 4HX8A 1J59A 3J80Z 2R7DA 3J7AO 5ILVA 1AOYA 5HLIA 1XD7A 3P9CA 4KMFA 5FGMA 4HA8A 3BWGA 1JHHA 4QLCU 1FBQA 4LFUA 2L4AA 2K4BA 4MTDA 3GFMA 4A6DA 1ZG1A 2DBBA 5BPDA 5F1RA 1IUYA 2GA2A 2DU9A 1IXSB 5J8CA 1I27A 4ESJA 2IA0A 2KIFA 2VC1A 4FX4A 3ECOA 2QLZA 4G7OF 2ZJ2A 2H94A 3WTTC 5IT9Z 4KT5C 2Q0OA 1UCRA 5DCMB 4EM2A 1Q1HA 4RB3C 5FO5A 4UV8A 4KN4X 1O3RA 4MQVA 1J0RA 4FT8A 2W25A 1TW3A 1YIOA 1ZRCA 4M9ZA 1T98A 3H92A 1IXCA 3IWFA 1T38A 4UVBA 1ZGAA 4GGGA 1G6NA 3F23A 1K78A 1Z9CA 1SFUA 4S04A 4EJUA 5DCFA 1QPMA 1ZARA 5KK1A 1PDNC 4EJWA 3G3ZA 2C6YA 1R00A 2CO5A 3EYYA 4OOIA 3U2RA 4JK1X 4BHBA 2DT5A 1FSEA 1S3JA 3F6VA 3FXQA 1P2FA 1WWXA 3V7RA 2B0LA 5BMZA 4L0YB 1U8RA 3F8NA 5F64A 2GXGA 1STZA 2A69F 1H9TA 1SMTA 1KQ8A 4KNYA 1TQIA 2Y75A 1H9GA 2K86A 5DDGA 5L3FA 3NQOA 3FMSA 1ON1A 5FFZA 1R1UA 2FSWA 3MEXA 2P7VB 2UWMA 1FY7A 3BPXA 3LWFA 2FF4A 1SAXA 1P4XA 3E6MA 3TO9A 1IN8A 1LEAA 3VOEA 3CUQA 2KIMA 2Z99A 2VC0A 3V7SA 1TQPA 3V7CA 1YTYA 2EFQA 2V79A 4A12A 1UHWA 1ZG5A 3R61A 3RJPA 4RB1A 2JPCA 1D8KA 4Y15A 4BXUA 1ZAOA 2J5OA 2OD5A 3F8FA 1GXQA 1HSTA 1WI9A 4U7DA 1U6GA 1G3WA 3DPLC 2Q2EA 1OR7A 4RAZA 3E3VA 4HV6A 5HVQC 2D1HA 1FT9A 3MAJA 5E8IA 4A0XA 3TOAA 5JHUA 3GX4X 1K6OA 1FPQA 2M30A 2XASA 2OQGA 1FC3A 3F6OA 5K5OA 1E2XA 4M9XA 2QUFA 2L4MA 2RQPA 1TW2A 4F7ZA 4WXCA 3HOTA 2IP2A 1B9MA 2FXAA 3ULQB 3M8FA 5J6XA 2A07F 1KGSA 3PFIA 2P4WA 4N0BA 3EUHA 1BC8C 3HHHA 3N97A 4P55A 4RGXA 5LBQA 1DP7P 3LAJA 1UHMA 4A5NA 3ZQ7A 4I02A 1X3UA 4ZYGA 5E17F 4ESFA 5CVUA 1XSVA 2F5DA 4N9IA 4UHTA 1W5TA 2YSRA 1FBSA 4HYEA 4B8XA 3GZ6A 3EETA 2NNYA 5D5VB 3BP8A 2EFWA 5FD6A 2WTEA 1SD6A 3BDDA 4HZFA 3F3XA 4PDKA 1I6XA 3WTSC 2YX4A 4IRIA 4OU0A 3P9IA 1Z05A 3W6JB 2VBWA 1G3TA 1L3LA 5FB2A 2DTRA 1WSUA 2J5PA 4DQ2A 1SFEA 3KEOA 4LLLA 5HS8A 2BGCA 1LVAA 5D4SA 3W6KB 1KQ9A 1IZ1A 1R5GA 2XHKA 5LLQA 3COAC 5HS9A 4XLNF 1P4WA 2G7HA 5CVRA 1G3YA 2YX7A 3RKWA 1G3SA 2VBZA 4BHPA 5K1YA 1FSHA 1S8NA 1U78A 2ZFWA 4PGHA 4WK8F 1VTNC 3E5UA 2ZXJA 2CQKA 2FOKA 4ENNA 4PZJA 4I01A 2OZUA 3GXOA 4IVNA 1ZRDA 1IN6A 2R7FA 4BQAA 3ML6A 2Y48A 3QPTA 1DPRA 5H6RA 4EJOA 1LB2A 4ENMA 5TRDA 3WTZA 5JVTA 1IN7A 3GO5A 2EFNA 4G9YA 5CVIA 5FFXA 1ZLKA 2YPRA 2HOEA 4CGZA 2W24A 3GFIA 4GXOA 2NS0A 2BEOA 4HOBA 5DV5A 3KE2A 2A5YB 3KP4A 3WU1B 3O2PE 3WODF 1XGMA 1BN5A 1GXPA 3GFJA 2ZMEB 2GIVA 2QQBA 1USSA 4CYDA 1PP8F 3BZ6A 1QGPA 2XGXA 1HKQA 4M72A 1XGOA 2RV8A 3JAMZ 4YIFA 3CO6C 5D6FA 5CVVA 2HYGD 1SD4A 2D1VA 5D5WB 2L02A 1F4KA 3CO7C 2E7XA 2H6CA 4WXHA 3GYHX 4HLXA 2QENA 3MZYA 4R79A 2OAZA 4ZYEA 2COMA 4CZZA 3C3WA 3KLNA 4EM0B 1P92A 3ELKA 1KYWA 3IC7A 2BYVE 4HLYA 4RAYA 1ZH5A 1W7PD 4P9FA 2CG4A 4EMSA 1J7KA 1OMIA 4LK1F 2IRFG 1BIBA 2RKHA 5L3CA 4P5OA 2ZBKA 2HQRA 4L9JA 3HHGA 2PN6A 1TBXA 5CYVA 1W7PA 2CGPA 2BV6A 2FMLA 4LMYA 2WV0A 2JT1A 2EK5A 5HLHA 1SD5A 1MGTA 1O57A 1LEBA 3WU0A 1IW7F 4HQEA 1RZ4A 5E1XA 3ZPLA 3WGIA 2IA1A 2F2EA 2EA2A 1UFMA 4NHJA 2IPQX 5LHHA 3FXRA 5J8FA 3I54A 2KJBA 2DK8A 4HF2A 3OOPA 2VT3A 3E6CC 1F5TA 1S7OA 4XLPF 3P7NA 1EH6A 2GZWA 2VBYA 3K2ZA 4ZZLA 4ASNA 1EV7A 3QPHA 2GXBA 3U1DA 3KCCA 1YQAA 3C7JA 2XAHA 2EV0A 1T39A 3LA2A 1XMAA 1MDMB 3CDHA 3LAPA 3E6BA 2STWA 1L0OC 2P6TA 1S29A 4Z2YA 2Q8KA 4N9HA 1XMKA 2F5FA 1V3FA 1EH8A 3ZN0A 4LG0B 1OKRA 4ENKA 2PJPA 1O3TA 1LQ1A 4UXNA 3H3ZA 2HR3A 3SZPA 2ZO4A 2KRFA 2PMUA 4WF2A 2P8TA 3WTYC 2CW0F 4ENJA 3K9TA 3KP2A 4U0WA 1EH7A 5D6EA 2UXXA 3DP7A 1B9NA 2QBYA 4BH9A 3L09A 2M87A 3I4PA 1XSXA 2IT0A 1NHAA 1MD0A 1DDNA 3IHUA 2FQ3A 2PFBA 4QWQA 1A04A 3KZYA 4HF1A 3FX3A 1BM9A 2O3FA 5D5UB 3JAMK 2FA5A 2ESHA 5EEHA 1U2WA 3RKYA 3RYRA 3BOQA 3TO7A 3KFWX 4Q5SF 2ISZA 5E1ZB 4S05A 1MKMA 2AS5F 1ZLJA 2VOPA 3I5UA 1XB4A 2CWEA 3WE2A 1R1VA 1TNSA 1B59A 3SHFA 1SD7A 1XCBA 3HUGA 1SFXA 4IHSA 2VN2A
chains in the Genus database with same CATH superfamily
4G94A 3BG5A 1R36A 4XLCA 2K9SA 1SFKA 1Z91A 3A03A 3OIOA 5IP7J 3LA7A 4V2GA 2Y9YA 1BW5A 1I1GA 3IRQA 2XPUA 3CUOA 5ED4A 4F93B 1LDJA 2L5QA 2COBA 4ESBA 1QVUA 2JZYA 4HG2A 1JT0A 4OIRF 2ME6A 1YRNB 1IN5A 2IGNA 2ZJRF 3LA3A 3HYIA 4I2OA 4LB6B 4AC0A 1O3QA 4M3DA 5DCMA 4NQWB 1PUFB 1MDMA 4EQQA 3RKQA 3WGGA 5L3EA 2BY3A 4C2MJ 2HZTA 4G6QA 1FP1D 2BBYA 2W7NA 1RETA 1XPXA 4RM3A 2LR8A 5E20A 2X1DA 1WJBA 1KA8A 3R4KA 4BE0A 2F5VA 1OLTA 1EA3A 3T1BA 4AYBN 2DPDA 1V54H 2IEKA 4E70A 4XLHA 3B73A 2EA4A 1JE8A 4Y17A 1R9TJ 5IT3A 3L2RA 3G73A 3I9V2 3LSKA 3OIPA 4M6YA 2R7UA 3K0LA 1FYKA 1ZGJA 3OSFA 2O03A 1BC7C 1HSJA 1MBFA 4DYRA 2L9RA 5ICFA 5ILSA 1HKSA 1O7LA 2BOLA 2K9LA 2HFHA 4XQFA 3BG7A 4KUMA 3I56I 4A6EA 2HQ5A 1E3OC 2XAGA 1QBJA 2QQ9A 4M3FA 4L9TA 3CJQB 3OWTA 1UAAA 3K2AA 2QM3A 2VONA 2LSOA 1FMWA 2ZXIA 5M5XJ 1S7AA 2MABA 4HF0A 5L3DA 4E6KG 3CCSI 4EM1A 1JUMA 4MLOA 3J7YJ 4AVZA 2EJRA 3JTGA 1ZR2A 1K4SA 3LSTA 3ZMSA 3HKZA 2O8KA 2XDVA 1H8AC 4MQ9F 3D5SC 3DFGA 1GDTA 1TTYA 4XNFA 2W85A 5FLVA 1CQTA 3M9AA 3IKVA 2Y2ZA 2ZC2A 4ANJA 2D2WA 2QA4I 1J5YA 3C2HA 4PJNA 5CVJA 3P9KA 1XMXA 2CV0A 3NAUA 4Q4ZF 2FBIA 2R7XA 2Y0MA 4GCVA 2VT2A 1U3EM 3L1PA 2MA3A 2KJCA 3U9GA 1I3AA 4BE1A 3EQLF 2XGDA 1CGPA 4U7BA 1ODDA 2O6GE 1HQCA 2TDXA 1O3SA 2M8EA 2DYRH 1NK2P 1JKOC 1NTCA 3CJTB 3KLOA 1DGRM 3X2QH 5LRRA 1RI7A 1UHSA 4MGRA 3H35A 1U9OA 4DYQA 4E7SA 3S16J 2PLYA 4KFCA 3HSRA 1BR1A 5JI6A 5BOXA 4O6JA 3ZMUA 1I39A 4D0PA 2K9NA 4XSZF 3I59B 3R0AA 1YE9A 4M6XA 2EFOA 2M2EA 2VXZA 4CDGA 3H3UA 3FF5A 5ICCA 4UUVA 2LKXA 4L5JA 4CA0A 2DLLA 2QF7A 4I98B 2V1XA 4KICA 2VBXA 3KP3A 1TL8A 3WU2C 5JFRA 2V26A 3AAFA 4CYCA 1OYWA 3Q9SA 2LC2A 3ISPA 5D8LB 3DQVC 2EWNA 4DW6A 2BZTA 5M5WJ 2QKMB 2LF7A 5DUKA 2BVMA 5ILUA 2E5ZA 2L7MP 3LQRA 5M5YJ 3S3MA 1LPQA 4NQWA 3SJMA 1PUFA 2QQAA 2LMDA 4JX4A 2WAQN 3TP0A 1SEUA 1R22A 1FYLA 3A1YA 2LRDA 2KZGA 5BQTA 1ZN2A 2A6TA 3JW4A 3R6SA 4P1WA 3BROA 2KRCA 1GLNA 2X85A 3K4JA 3Q0VA 4RGRA 2HTSA 4L9VA 5GPCA 1FEXA 3ZOBA 3OYFA 4M74A 5A2QZ 2BY1A 5DUIA 4RB2C 4FE7A 3WHBA 1HCRA 1QQIA 3OYCA 1O7FA 1DU0A 4P96A 2WY7Q 3KP6A 1ZR4A 1UG0A 3FXLA 4CICA 4BACA 4FISA 3KEYA 2CH0A 1WH7A 3E5XA 3VB2A 4IF4A 3CZ6A 4OIQF 5F6FA 5IYBJ 4GYGA 3L00A 1ZHFA 4NBQA 3BZKA 2YR2A 4LIVA 1HKTA 4S0HB 1R1TA 2A6EF 1VFCA 2CS3A 3Q5FA 5KNLA 3HOSA 1VNDA 3LSHA 3ABMH 3GLXA 2DDAA 2E1NA 1OFCX 2DFIA 2JJ7A 2L2OA 3VYRB 3HG9A 3NWSA 4PGGA 3BPVA 2JA5J 4KDPA 4LGWA 1FIPA 4IEJA 4LLNA 5JR3A 1BOAA 2CYYA 2HEOA 4PJLA 1FJLA 1PUEE 4LK0F 2DYSH 1ULYA 2LP0A 2H09A 1QO0D 1XDSA 3L2CA 1VQOI 4D5FA 3GTPJ 1FTZA 1OYIA 2IVMA 3JSOA 2DMQA 1G8XA 3RDIA 3H3VK 5EJCA 3CJNA 4BHCA 1TLHB 2XVCA 3I0TA 1YW7A 1SFOJ 2H8RA 5AIQA 1FTTA 1IRFA 2IXSA 1JT6A 1YI2I 2O61A 4D1QA 1X1PA 2R7RA 3GWZA 4II3A 2OF7A 3WTWC 2MH2A 3JRIA 3BJOA 1YO5C 4UVCA 3PQJA 3V8JA 4XK4A 3ZQHA 5FJ8J 1P6RA 3TDUC 4GDFA 1YJ9I 4YRVA 1IRZA 1U8BA 3F21A 1VQ7I 1FP2A 2Z1DA 4G8XA 3HIFA 3QOPA 2VODA 4BXFA 3VFZA 3S3NA 4A3LJ 1Z7UA 4IHTA 1YX3A 3D0SA 3RTRA 3BZCA 2A61A 3FMQA 2DA1A 4PUSA 1KU9A 4XKCA 4OINF 3HC7A 1YS7A 1IF1A 1WPKA 2W57A 4I0AA 1ETYA 3HEFA 2OUMA 1MNDA 1X3ZB 4ZDOA 5B1BH 1QZZA 3U21A 5C4JJ 3PNTA 3I59A 4AD9A 5ICGA 4HQMA 1LFPA 2FU4A 3ROUA 2FQ4A 2WA0A 5LGUA 2JN6A 2A05A 2K9MA 1C0WA 4GO1A 5E8GA 2UZKA 2VQHA 1YYVA 3L2UA 5FLXZ 2JVGA 2X48A 5H2FC 4A3GJ 5H20A 4M3EA 1YG2A 2EQRA 4UNOA 3KZIC 3TKYA 2XKOA 4L5EA 3K1MA 1JJ6C 4QPQA 3IAM2 1YW8A 4QIWN 1UG2A 3P5JA 3AFHA 4L18B 4MEYF 3BJ6A 3S8PA 4I0BA 1R4NB 5DEQA 3ZP5A 4J01A 1ETXA 2LREA 3CMMA 1R5ID 3GVAA 4E7HA 1VQ5I 5D5XB 1HDPA 3LNQA 2F5EA 2Q1ZB 2V9KA 4MFDA 4NB5A 3PIOF 1HXDA 3GTOJ 2FEZA 4EV0A 3O8HA 5DS9A 3O6BB 2DW4A 1F1ZA 2FNPA 1R49A 2W84A 1V4RA 3AG3H 1T2KA 4XSXF 4CSWA 3BTIA 4B4CA 4A3EJ 5CLSA 1TP4A 3C2GA 3WGHA 5B1AH 5J47A 1XTAA 3JTHA 3FK6A 4MEXF 1FBUA 2GBYA 1USTA 2V1UA 3N4MA 3H9GA 3K1PA 3FXUA 2GM4A 3GFLA 1HOMA 4RS8A 2CQNA 3ZQCA 4UV9A 1ONVA 4DIQA 3S93A 3HPHA 1HW5A 2ID3A 3ZRGA 4AIKA 3OL4A 4E4HA 1MZBA 4GYIA 2VLAA 2HZDA 3DTKA 5F04A 1O4XA 3ERED 2LBFA 1E0EA 3KEQA 3IL2A 3JRAA 3EUKL 2DQLA 1WQ2A 2QWWA 2VB6A 5LGTA 5M3MJ 4EEFG 2DA6A 1K78B 2RNJA 2HS5A 1A35A 4FCYA 2E1CA 1WJEA 1SVOA 2GOXB 1XGNA 2ZB9A 3HRUA 2CSOA 1LNWA 2QSHX 4U87A 4B44A 2JTVA 1YW9A 2LFBA 3TOBA 2P5LC 2VQGA 2A5WA 2Y31A 2VE8A 4RB0A 2IS6A 3G2BA 1IJWC 3MKYB 1Z1DA 1WCMJ 2Z9OA 3AG1H 3ZMVA 4M3GA 3HDDA 1A6QA 1RNLA 5EDNA 2WY8Q 2QEXI 4IZZA 2GQQA 3ZQIA 1FWZA 3CCJI 4RM2A 3IUOA 4BDZA 2ETHA 5JLWA 4IHWA 2WWYA 1BBYA 2UV1A 4HW0A 5A2QK 9ANTA 1EF4A 1TT5B 3FKJA 5BPIA 2O7OA 2DA3A 3RPUD 2OV7A 3B02A 5GTHC 2K7LA 3J81Z 2JSCA 4D7MA 2NVXJ 4V2FA 2LY9A 3EDPA 1XN7A 2ZMEA 3GBGA 2KLOA 4NDLA 2RREA 2L54A 3SFZA 1TWFJ 5GADJ 4E7ZA 3G4SI 4B09A 3ABKH 3BR6A 3GTQJ 1WJAA 3VEPA 2XV4S 4RAFA 4D5CA 4OMZA 4XIDA 4Y13A 1TQMA 1A36A 3K4KA 5LHIA 1K4TA 1REPC 5LHGA 3T8TA 1MJ9A 2W4SA 3G1MA 1W0TA 3IRRA 4O3MA 2L01A 3K4MA 2TRTA 3RPUA 3DPTA 2DAOA 5CJ9A 3T5XA 3G6EI 3A0HC 4BJ6C 4YG2F 2GXAA 4I09A 3CUQB 4AVPA 4O5VA 2E35A 5DD8A 2XSJC 1JKRC 3HGGA 3RSNA 3FM3A 3OYAA 4ZYHA 1XGSA 3F9KA 1R23A 2H6BA 2FBHA 4CXFA 2HKOA 4G7HF 4BNCA 3RPQA 5HDKA 2HGCA 4BQOA 2VL8A 3FKIJ 5AIPA 5FKMA 1HF0A 1VQLI 3GF2A 3TQNA 2I10A 1G2HA 4RBOA 1AWCA 4FHTA 1LJ9A 2BVLA 2VPRA 3M4OJ 4DZJA 1ETVA 4EGYA 1PP7U 1XDUA 1BI2A 2MLGA 5ICEA 3UKGA 3PO2J 3I4NJ 1FLIA 2HKXA 3PIPF 1K7AA 1U0JA 4CCOA 1XC5A 4C30A 1KU7A 1T8IA 4TV7A 2XB5A 3KZZA 2X0LA 2WAEA 2FUG2 4BL0B 3KYCB 3FXMA 3WHCA 3IKTA 3BR0A 3WTVC 2BY2A 1IXRC 3DU5A 3VPRA 2M3AA 3HB9A 3I58A 4A0ZA 4ZYDA 1XCVA 2Q2EB 2O0YA 1FNNA 2IS4A 4PCQA 1V5GA 3DF8A 2K40A 2XRNA 2R7OA 3KIOA 4Y3OA 4XICA 3ZQQA 5HOOA 2K5CA 2LF8A 1W4MA 3DV8A 2E1OA 2KDZA 3PJRA 3PM1A 2XKPA 5FLXK 1NK3P 4LOCA 1AKHB 4M73A 4HSTA 1OCOH 1WRJA 2EV5A 1IC8A 2X6XA 2NVQJ 5GAGJ 1V5FA 1F36A 3IWZA 3GZNB 1GHCA 2V9VA 4XONA 5TISC 2KIQA 2MD5A 2R7SA 5EGOB 2RQQA 5D4RA 1DUXC 2EZHA 5IP9J 2A68F 3W2VA 2ZCWA 5KVRA 2QYOA 3BCBA 2ZXWH 4KA4A 3WG7H 4PK4A 2VKVA 4BGDA 1RUNA 3KETA 4BUPA 2P6SA 3F8MA 3V8KA 3PQKA 3OYDA 1APLC 1K79A 4ZC3A 4KIFA 4G6DA 4NC7A 4WCGA 2P0WA 5IY5H 2R93J 2AXTC 3WG9A 3ZMTA 1VQ6I 3BG6A 3HL2A 2E34A 5K5RA 1E3PA 3FM5A 2K27A 3K1NA 3WTXC 5E18F 3M7GA 1MW7A 5F08A 3VSLA 4G12A 4H4KC 4QPOA 2PEXA 3OR2C 4Z6YA 5K7HA 2VASA 2UXNA 2G9WA 3IH4A 3M1CA 2DPUA 1H0MA 2JVHA 3ABTA 1R5HA 3T8RA 1VQNI 2K9QA 3GEZA 3Q9VA 1M1EB 3R60A 1JTYA 3MQ0A 2HVRA 2E7WA 5DYMA 1T08B 2ZSHB 5CQEA 3I64A 3OYMA 4LITA 4KIBA 5FRMA 4IXAA 4IQ4A 4CCJA 2LY2A 2XGCA 1OYYA 3BJAA 3REOA 2DOEA 2H27A 3RIRA 4CZCA 2L9NA 1BI0A 2HDWA 3LFUA 3R0JA 4HV5A 4W97A 4YIIA 1KYZA 4DNCA 2VIXA 2DFHA 4PSWA 3GUDA 2H8WA 4EJVA 3QYEA 1ACIA 1FIAA 2X9DA 3I53A 4OIPF 4MNUA 4X0GA 3C1DA 3L2WA 2W82A 3LL7A 3DWLE 3O3KA 1I1SA 3MD2A 2MLKA 4Y33A 4EGZA 1NH3A 2JWTA 1KU3A 1QZYA 4R8HA 3ZQLA 5EZGA 4FETA 4RLFA 5FRNA 1Y8QB 4WX9A 4LG0A 2EZLA 3LSGA 2NYXA 4HBLA 2B7EA 2JPBA 3GTGJ 2EB7A 1AA7A 1HW1A 2L9VA 3MKLA 3PSIA 4EJTA 1KU2A 2MBFA 2P5VA 1SAUA 4BEHB 4CCKA 1D3YA 3S2WA 3QOEA 3ZR8X 2PBIA 2ME0A 3HM5A 2NXNB 1SVMA 4HX4A 2BE5F 2XUBA 4WXDA 4BBSJ 2PJRB 1IV8A 2CW8A 2QZ8A 1LKXA 3K7AJ 3K70D 1MH4A 2AHQA 4H0EA 4IRGA 2E1MB 1J9IA 1IN4A 3JSPA 2R5ZA 2X6WA 3LMMA 4IHXA 3KP7A 4AIHA 1YLFA 3CCRI 5LEJA 2ELHA 3F8CA 3IAS2 3FHZA 4KYWA 3RYPA 4LB5A 1WVRA 3QP6A 1Y39A 2ECBA 1IRGA 2R5YB 4C2TA 2EH3A 2KL4A 3ASOH 4A3DJ 4IRHA 3J81K 1J2XA 3DEUA 4W1UA 1FZPB 4UUSB 3DBHB 4N4OB 4PFOA 4G7ZF 1MJAA 2A6HF 5E3MA 5EG0B 1ON2A 1ZYRF 5BS6A 5HDGA 4YFXF 2M5WA 3CUQC 3I55I 2HVSA 1D0YA 2XAJA 4ABZA 3OV8A 1CF7B 1JHFA 3ZMDA 2XRLA 3VSKA 5HDNA 3DBLB 3J80K 3HOUJ 2VI6A 3IV5A 1WKMA 2CUZA 4XKWA 1X58A 4IO9F 4JQFA 1YJWI 4L9NA 3F22A 4Q48A 1TNTA 5TJJA 1SMYF 4MTEA 3ZN1A 5IOZA 2KP6A 3HRTA 3MCZA 4CCMA 5FKKA 3V42A 1FYMA 5JLXA 4LLGF 2XC7A 4F55A 3SYTA 4R1HA 4NUBA 5HNHA 1XS9A 2AO9A 4XORA 3MZHA 2FNAA 3OS2A 4KMUX 4MHGA 1HBXG 1MNEA 4HDVA 1LDKB 4BAYA 4GFBA 2CFXA 2MC3A 1ZREA 5K5QA 4HX7A 2PMHA 2PG4A 2WB1A 3CP8A 3E5QA 2IJLA 3FIWA 1BOBA 3PUFA 4CH7A 1Z67A 1OR7C 2XGEA 3FHNA 3GTLJ 2HYFA 2XROA 2OU2A 3MFKA 1MMDA 5IT9K 3MWMA 2OQRA 1NG6A 2NNNA 1R58A 1ZK8A 4AUXA 3HSFA 3K4NA 4L5IA 4IL6C 2BW3B 5E3NA 4UVAA 2ISYA 1X4PA 2LNBA 3NRVA 2P5KA 3FMRA 2EPFA 4AIJA 3AL0B 4XKBA 4JBAA 1D0ZA 2HWVA 1RIOH 4PFPA 4WWCA 2IA2A 5HLGA 1YRNA 2EIKH 3JCUC 3G71I 3L2QA 3O8GA 3K70C 4EVIA 3BTCA 2MH9A 2Z33A 3DXJF 4M71A 3M8EA 2F4IA 3TBIA 2FOWA 3V8LA 5IYCJ 3GTMJ 1D8JA 1S6LA 4A2UA 1WI3A 3E97A 2DO7A 3PSFA 3TGNA 4YFNF 4Y52J 1IRXA 2QVOA 2W00A 4ZH4F 3TW7A 3M1EA 3QU3A 2HTJA 3SXYA 4ZZDA 4C2UA 5E1WA 1IAWA 4CHUA 4UB8C 2OTJI 1R7JA 1B8IB 3UR3C 2K85A 4E7LA 3MVPA 2ACJA 5FKOA 5F1JA 5FD5A 2H1KA 3EUHC 2IW5A 4XRSG 1B4AA 2ZSIB 1G4DA 1W5CC 3SZTA 1J75A 3K4LA 2RGVA 2LKPA 4DZPA 1J09A 3CLOA 4X1EA 3QU6A 2M8GX 3ABUA 2PJRA 1I6HJ 2PMZA 2QSGX 2R92J 1W5SA 4II2A 3T0YA 2ELJA 3CQZJ 4IOAF 1JI8A 5L3BA 3I71A 3LQQA 2RN7A 1XSDA 5L3GA 3QYFA 1ZELA 2MG4A 2O5RA 4XR6A 4ON0A 1U5TB 3DEWA 2R5YA 4HAMA 2DQRA 1JUPA 2G7UA 2R7WA 3EYIA 1Z6RA 1UB9A 3DPUA 3DEEA 5DD4A 2X6OA 1V5EA 3HSEA 2CFOA 2R0QC 5EG0A 2M45A 2L3DA 4XMYA 2FRHA 4DOZA 3KYLA 1RKTA 4HDUA 2VOOA 2FJ1A 2VJ5A 2YU3A 1CF7A 4FX0A 2QSFX 2CQ7A 2MD0A 2NVYJ 2QQ8A 2HU9A 4FQGA 3A01B 4IPAA 3TO6A 3RZOJ 3OY9A 2M1BA 3G1LA 2OBPA 4JX5A 3ZQFA 1X3WB 1WGXA 2VKDA 3Q0UA 3TEDA 3ESWB 4IX7A 4CCNA 2KKOA 2LDUA 3HKZN 2HOTA 3BY6A 3MMYB 3OS0A 4RGUA 2Y69H 4RGSA 3DTEA 3WE3A 2DA4A 1BI1A 3AG2H 1KZHA 1X1BA 3HRSA 2E1MC 2LK2A 1I5ZA 3GLLA 2XAQA 3F72A 2XAFA 4IQJA 1MIJA 3HTUA 2BY0A 4U88A 6PAXA 4I76A 4K2EA 1W7PB 4CO8A 1ZQ3P 2VPLA 2PQ8A 3HRMA 3CC2I 2JA2A 2WAFA 2FX0A 2GAUA 3BCAA 4RAGA 3SDGA 2V1DA 4Q47A 4A0YA 2D45A 2Y9ZA 1VZ0A 1B72B 2F48A 5H6QA 2FMYA 3JRGA 1ENHA 2E36A 4MIMA 2O8XA 3HJEA 3HZJA 2GLOA 4BYYA 2K4JA 3L9FA 4JP0A 1QNTA 4DBRA 2ADUA 5LEKA 2IGMA 3MZ8A 2RVCA 2X4HA 1WJ5A 3J7ZI 2MGQA 4HPQA 3TDZC 2PI0A 1LDDA 3GW2A 3K69A 4RMNA 4N4NB 4L0ZB 4IJAA 1MBKA 1R71A 4BKXA 4PSXA 4U0VA 3OSGA 1ZG3A 2Z3YA 3ASNH 2JRTA 3DKYA 3FZVA 5D8KB 2VE9A 2AQEA 2V6CA 1T6SA 2RC4A 3CTAA 3LSMA 3NEUA 3QAHA 1FX7A 1FOKA 1JGSA 1GVJA 1MMAA 1Y6IA 4XBFA 1B8IA 1A5JA 1DPUA 2HDCA 2JQ7A 4LD5A 1F9NA 3VODA 2DI3A 1Y1WJ 2ECCA 4D7NA 2NAZA 2N8GA 2R7TA 1KQ0A 5K7ZA 3ECHA 1BJZA 2I5UA 3V4GA 4HNTA 1EJ9A 4BQQA 3HOYJ 1B6AA 2K02A 2NS7A 4LJZF 1T0FA 4KN7X 4ETSA 4A5MA 2Z2SB 1JXSA 2GA1A 1YS6A 1JUSA 4OIOF 2P7CB 2KPMA 1YFHA 2FE3A 5EEGA 1BIAA 2DDBA 1U5TA 3EUAA 3OYBA 4XRFA 2KHMA 3L2VA 3AL0C 5IOYA 2RDPA 4YFKF 3HOZJ 4C3JJ 2MFZA 3VDXA 4IKFA 2WC2A 1MMSA 1P4AA 4M9SA 3RKXA 2A3SA 2ESNA 3OOUA 1MBJA 3FWEA 1WJCA 2VUMJ 3E6DA 2EFPA 3OYGA 2CV1A 1OCPA 5HS7A 2F5CA 3L7WA 1VF9A 3LSIA 4MO7A 2STTA 4AWXB 2EV6A 4HEA2 2QCOA 2WBMA 2Z5UA 1T95A 1IG7A 2CQQA 3PFYA 3TW6A 1E17A 2R3SA 4V19K 4YELA 2NRAC 4AIDA 1OPCA 2RNGA 5AONA 3K10A 2IS2A 4OAZA 4F91B 1LFUP 2V1NA 3BR3A 2F6CA 2ZKZA 1BI3A 3SQNA 1QU3A 1ITYA 3CDLA 4P9UA 2OA4A 4OMYA 2CQXA 2X6YA 2QBYB 5LGNA 2Y0SA 3B6AA 1WJDA 1N75A 5LRSA 1LFBA 4U0YA 2XIGA 3HTSB 1ZRFA 3ERMA 4C3IJ 1P9QC 1B1BA 1T0FC 2GWRA 4XL9A 3QRFF 3GZ5A 2DXIA 1X4OA 1Z6TA 2HQNA 2OZ6A 1JJ8C 5CKTA 1H89C 2DT7B 1RUOA 4BU2A 3SDBA 1U5TC 3W3CA 4RLQA 1RKWA 2ZNZA 3C18A 3DKWA 1W1WE 3S1RJ 4I7HA 1IV6A 2IBDA 2FBKA 1HW2A 1Y0UA 2DK5A 1D0XA 4XN0A 1LE8B 3F8BA 4ZDLA 3OYJA 2M0MA 2ZNYA 3G1OA 2KIUA 3LFKA 4HRIA 1D5VA 3D5LA 3KP5A 3QP5A 2JUGA 1MMNA 3H0DA 4BE2A 3NARA 3WTUC 1MMGA 3RI4A 4KIGA 1BJAA 3QYBA 1MJBA 4BS9A 1FMVA 5ERIA 3ZMZA 5C4XJ 3CLQA 2AXLA 1F43A 1X2NA 4HX8A 1J59A 1RC9A 3ONQA 3D5RC 2R7DA 3J80Z 1Z77A 3J7AO 2HXOA 1Z21A 5ILVA 5FROA 1AOYA 5HLIA 1XD7A 2NOGA 3P9CA 4KMFA 1SVLA 5FGMA 4HA8A 1SANA 1JHHA 3BWGA 4QLCU 5LD2C 1FBQA 2CW7A 2L4AA 4LFUA 2K4BA 1Z3XA 4MTDA 3GFMA 3H5RA 4A6DA 1ZG1A 2DBBA 5BPDA 5F1RA 3Q3SA 1IUYA 2CUEA 2GA2A 3Q0WA 2DU9A 5EZHA 1IXSB 5J8CA 3S15J 3HUGB 3SEZA 1I27A 4ESJA 2IA0A 2KIFA 4XRMA 1GT0C 4EATA 3F0CA 3OYIA 3OIQA 2VC1A 4FX4A 3ECOA 2QLZA 4G7OF 2ZJ2A 2H94A 1UMQA 3WTTC 3CC4I 4AYBA 2DODA 5DM6F 2DOFA 5IT9Z 4KT5C 2E2HJ 2W48A 1MH3A 5J40A 1BR2A 2Q0OA 3K4BA 5F0FA 1UCRA 5DCMB 4EM2A 3LSJA 1Q1HA 4RB3C 5FO5A 2H1LA 2PX9A 4UV8A 4KN4X 3CESA 2X1EA 1O3RA 2X1CA 4MQVA 3CMYA 2BXYA 5J1RA 1J0RA 4FT8A 2W25A 4ITVA 2NVTJ 1W36C 2JA8J 2XF7A 1TW3A 4KITB 4XLEA 2NVUB 1YIOA 1VQKI 1T33A 1RR8C 1ZRCA 2HDDA 4M9ZA 4NC8A 1T98A 4DBQA 3H92A 2DOAA 1IXCA 3OR1C 2EILH 1S72I 3IWFA 4A93J 1T38A 4UVBA 2V4JC 2KDOA 1ZGAA 4GGGA 1G6NA 3OS1A 3F23A 1K78A 1Z9CA 1VQ4I 4XM3A 1SFUA 4S04A 4EJUA 4BQNA 2KFDA 5DCFA 1QPMA 1ZARA 5KK1A 1VQPI 1PDNC 4EJWA 3G3ZA 2C6YA 1R00A 2CO5A 3CD6I 2HI3A 3EYYA 4OOIA 1XG1A 3U2RA 1QA6A 4JK1X 4BHBA 2DT5A 3HBLA 1FSEA 3BQYA 3E7LA 5IYDJ 1S3JA 3F6VA 3FXQA 1P2FA 1WWXA 3V7RA 4RA2A 5TGTA 3DCFA 5KAFC 2B0LA 2XSDC 3FBNB 5BMZA 3OYEA 4L0YB 4QSHA 1OJLA 1U8RA 3F8NA 5F64A 2GOMA 2GXGA 1PVEA 1STZA 1LE8A 2R7ZJ 2A69F 4JOMA 5F0CA 3OYKA 1H9TA 1SMTA 1HA8A 1UZCA 1KQ8A 4KNYA 1TQIA 2Y75A 4LG3A 1H9GA 2K86A 4FTHA 2UUZA 2R7QA 5DDGA 5L3FA 3NQOA 3FMSA 4RDUA 1IGNA 1TT0A 2R4GA 3GMEA 4E7JA 2IGOA 1ON1A 1FOYA 3C2BA 5FFZA 4BJTA 2E60A 1R1UA 2FSWA 3MEXA 2P7VB 2CV2A 3PNVA 1SC7A 3OYNA 1FY7A 2UWMA 3M3YJ 4X6AJ 3BPXA 4I99C 3BTLA 3LWFA 2FF4A 1GUUA 1SAXA 3BG9A 1P4XA 3E6MA 3TO9A 2LG4A 1IN8A 2LY1A 3SEQA 1ETKA 1LEAA 2JK3A 3BLYA 1AHDP 3VOEA 1QVTA 3CUQA 4C9YA 2XAUA 2KIMA 2WAQA 2Z99A 2KQRA 2VC0A 3DBRB 3V7SA 3GTKJ 1TQPA 3SZGA 3V7CA 3CCLI 4CYCB 1YTYA 2EFQA 2V79A 2HPIA 3H1CA 1G59A 1Z0XA 1HDDC 4JX6A 4A12A 3PO3J 2V9PA 1UHWA 3IP4B 2V6EA 4QTRA 3OMYA 5BNGA 3R61A 5JHFA 1ZG5A 5GAHJ 2OTLI 2DCEA 3RJPA 2DJIA 4RB1A 5B5EC 2JPCA 1YHQI 1D8KA 4Y15A 4BXUA 2KISA 1RRJA 3S1NJ 1ZAOA 4UUTA 2J5OA 3JRCA 1ETWA 2OD5A 3F8FA 1ETOA 1GXQA 2HYJA 3CF5F 3W2AA 1HSTA 2OJED 2OCCH 5K7FA 1WI9A 1MBGA 1N78A 4U7DA 1U6GA 3JRBA 1G3WA 3DPLC 2Q2EA 1OR7A 1TC3C 3JRHA 4RAZA 3BT9A 3E3VA 2JMWA 4HV6A 5HVQC 2LLKA 2VQCA 2BHZA 1FT9A 2D1HA 3MAJA 5E8IA 2MC4A 3S1MJ 3U1KA 1PJRA 3QWLA 1AKHA 4DJAA 1MSFC 4A0XA 1GV2A 2P81A 2NS8A 3KYDB 1JGGA 1GVDA 3TOAA 1RESA 1T56A 5JHUA 5DM7F 5EYRA 1TWCJ 3DLLF 2ZFUA 3GX4X 1FPQA 1K6OA 2M30A 3CMEI 2XASA 3D1NI 2OQGA 1D1BA 5EGOA 1OCZH 2BHYA 1FC3A 3VWBA 3F6OA 5K5OA 2B9SA 1WJFA 2DMTA 3N05A 1E2XA 4M9XA 2QUFA 2DFEA 2JSPA 4F92B 2L4MA 1DGWY 3CCYA 5KHDA 1QPIA 3M8JA 1KONA 3LSRA 2RQPA 3DKXA 1TW2A 4F7ZA 4WXCA 3HOTA 2IP2A 1B9MA 1Q1VA 1QHHD 2FXAA 3ULQB 3M8FA 5J6XA 2A07F 1KGSA 3PFIA 2P4WA 3QPSA 5GTIC 3BC8A 4N0BA 3JR9A 1D1CA 3EUHA 1BC8C 3HHHA 3TP3A 1X1CA 4DGWB 3N97A 1TWHJ 1NG7A 1JKQC 4P55A 4RGXA 5LBQA 1DP7P 2LOOA 3LAJA 4A3CJ 1UHMA 4AM3A 4A5NA 1P7JA 3FISA 4I02A 4YEJA 3ZQ7A 3B6CA 1X3UA 3JRFA 1BW6A 4ZYGA 2DMUA 5E17F 4ESFA 5CVUA 1BA5A 1XSVA 3GTJJ 3S14J 3J7AY 2F5DA 4Y7NJ 4N9IA 4UHTA 1W5TA 3W2WA 3MKZA 2YSRA 1GV5A 1FBSA 4XLFA 3DTIA 1WHUA 3CCVI 2EIMH 4HYEA 4B8XA 3GZ6A 1YJNI 3EETA 2NNYA 5D5VB 3BP8A 3ZCOA 2E71A 2EFWA 3FK7A 1QHGA 3VYTB 2OCEA 5FD6A 2WTEA 3W6VA 1SD6A 3BDDA 1YOVB 1DQUA 4HZFA 3F3XA 4M6VA 2YS9A 1I6XA 4PDKA 3KX2A 3WTSC 5B3SH 4A3JJ 3K6GA 2YX4A 2VKEA 4IRIA 5E79C 1OISA 4OU0A 3P9IA 4XOPA 2DTZA 2MSYA 2XF6A 1Z05A 3W6JB 1HLVA 2VBWA 1G3TA 1L3LA 3CJRB 5FB2A 2EIJH 2DTRA 2QKLB 1WSUA 2J5PA 2DJNA 3M07A 2FD5A 1SFEA 4DQ2A 3KEOA 3ZQGA 4XRSA 4LLLA 5HS8A 5J4YA 4OAYA 4BEHA 4IHYA 1VQMI 2M7AA 1X19A 2BGCA 1LVAA 2LYCA 2M4KA 3PL8A 5D4SA 3W6KB 4PJ0C 5E3OA 1KQ9A 1IZ1A 3SFIA 1R5GA 2XHKA 5LLQA 3COAC 3ABLH 5HS9A 1Z3YA 2LH9A 3S1QJ 4XLNF 2M34A 3IH3A 1K83J 1PYVA 4UY8I 4FASD 3HXLA 1P4WA 2G0EA 4HNVA 2G7HA 3BR2A 5CVRA 1G3YA 2YX7A 2D5VA 3GCMA 4UUSA 2DN0A 3FXJA 3RKWA 2WV1A 4KJZA 2F4MB 1D5YA 4G6TB 1ZTRA 3QODA 1RPWA 2HVQA 1G3SA 2VBZA 4BHPA 5K1YA 3CMAI 3I4MJ 1FSHA 1S8NA 1U78A 2ZFWA 1TWAJ 2CMPA 1XX5A 4PGHA 2GIZA 5KAIC 4WK8F 2CRGA 1OQYA 3LSPA 5GP9A 3A02A 1VTNC 3E5UA 2ZXJA 3NWTA 5J3LA 4A3BJ 2CQKA 2FOKA 2HNHA 4ENNA 4PZJA 3S3OA 4I01A 2E2IJ 2OZUA 1IDZA 2IS1A 3GXOA 4IVNA 2LBFB 1IN6A 1ZRDA 4CUGA 2R7FA 3IH2A 4BQAA 3HOVJ 3CF2A 3ML6A 4MFEA 2HOAA 2Y48A 1HC8A 3QPTA 5HLTA 3VYSB 2OPTA 3S17J 1DPRA 5H6RA 4OWRB 4EJOA 2R7VA 1LB2A 1QRYA 3AG4H 2E19A 4BY7J 4ENMA 3S2DJ 3OYLA 3WTZA 5TRDA 1I3QJ 5JVTA 1IN7A 3GO5A 4XOTA 2EFNA 4G9YA 5CVIA 5FFXA 2E5NA 1IDYA 2ID6A 2BW3A 2VJJA 1N77A 2EINH 2M7BA 2YPRA 1ZLKA 2HOEA 2K3FA 4CGZA 2X51A 2W24A 2WB1N 4UB6C 1IUFA 3GFIA 3VYUB 2WADA 2ZJPF 2QGUA 2XF5A 4GXOA 1Y8RB 3CCMI 3CCQI 5DTDA 4A3MJ 4BJ5C 2NS0A 1TZLA 2L7KA 4B48A 2BEOA 3HOWJ 2F4OB 1X1AA 4HOBA 5DV5A 2L7ZA 3KE2A 4B43A 2XPVA 2A5YB 3KP4A 3WU1B 3O2PE 3WODF 1Y56A 2B63J 2JA6J 1XGMA 1BN5A 1GXPA 3GFJA 2LKSA 2ZMEB 4B47A 2GIVA 2QQBA 1USSA 4CYDA 1PP8F 3BZ6A 1QGPA 2XGXA 1X1DA 1YITI 1HKQA 4A69C 2LD5A 5J1UA 4M72A 2ICWG 1XGOA 2RV8A 3KPHA 4FE4A 3JAMZ 4YIFA 3CO6C 5D6FA 5CVVA 2HYGD 2JA7J 2KMUA 2TCTA 1SD4A 2D1VA 5D5WB 2CUFA 4Y4RA 4ZDPA 2MYSA 2L02A 1F4KA 2HQAA 3CO7C 2E7XA 2H6CA 3HGYA 1VI0A 4WXHA 3GYHX 4HLXA 3OYHA 2QENA 3MZYA 3BG3A 4XLAA 1Y0NA 5IPAA 1JKPC 4E7KA 2DA5A 4R79A 2IAIA 2L0KA 2OAZA 4ZYEA 2COMA 1WZ2A 2PMZN 4CZZA 2M9HA 2JUCA 3S32A 4ZTJA 3S2HJ 3C3WA 3KLNA 5GPAA 4PJMA 4EM0B 1P92A 1ZKGA 3ELKA 1S7EA 1V55H 5EEAA 3FBIB 2AQFA 1KYWA 3IC7A 1LVKA 2BYVE 5IP6A 1ZGWA 3LOCA 4RAYA 4HLYA 1ZH5A 3A01A 1W7PD 1QZEA 4P9FA 3H5NA 2CG4A 4HSRA 4EMSA 1UJ8A 1J7KA 3TMOA 1OMIA 4NNJA 2EBIA 4LK1F 2IRFG 2O9LA 1BIBA 2RKHA 2XPWA 4J00A 1FOXA 2CU7A 3H5AA 5L3CA 1H88C 4P5OA 1OCCH 4IOCF 1FOWA 5E3LA 1JTXA 2ZBKA 2HQRA 4L9JA 5KCMA 3HHGA 2PN6A 3RCOA 4HNUA 3CC7I 3BTJA 1TBXA 1W36D 4GRIA 3FXOA 5CYVA 1W7PA 2OC6A 3A4CA 3ZGKA 1BL0A 2IGKA 2CGPA 2BV6A 3FXKA 4CCLA 2FMLA 3RQ4A 4LMYA 2WV0A 2JT1A 5HODA 3H0GJ 1OCRH 2EK5A 5HLHA 3CP2A 1SD5A 2VQLA 1MGTA 1O57A 1B72A 1E3HA 1LEBA 1A31A 3WU0A 4B3XA 3QQAA 4DYCA 4NC6A 1IW7F 4HQEA 3RQIA 1RZ4A 5E1XA 5C3EJ 3ZPLA 3WGIA 2IA1A 2F2EA 5C44J 2EA2A 5FKLA 1UFMA 4NHJA 2IPQX 5LHHA 2DA2A 2MW8A 4AU7A 3FXRA 5J1YA 5J8FA 2I8DA 3I54A 5F27A 2KJBA 2DK8A 3FDYA 1LUJB 4HF2A 3OOPA 2VKHA 2VT3A 3E6CC 1Z7LA 3MKWB 5CQGA 2VJ4A 1F5TA 1S7OA 1DP3A 1UELB 3EPZA 2DA7A 3K4CA 4A3IJ 1VQ9I 2DMNA 4XLPF 3P7NA 3BR5A 1ETQA 1EH6A 2GZWA 2Z16A 5FKNA 1TWGJ 2VBYA 5GAEJ 3K2ZA 3JREA 4BXXJ 3MN2A 3PUBA 4ZZLA 1ERDA 4ASNA 1EV7A 2CJJA 3QPHA 2GXBA 2VJIA 2BXZA 1OCTC 1MNMC 1VQ8I 3U1DA 1WH5A 4A3KJ 3KCCA 1YQAA 1S9HA 3C7JA 2XAHA 1RR7A 2EV0A 1T39A 3LA2A 1XMAA 1I50J 2W1OA 1MDMB 3CDHA 1R4MB 3CDIA 3LAPA 2K3PA 3E6BA 4B3AA 2STWA 2YU9J 1L0OC 2P6TA 1S29A 4Z2YA 2Q8KA 4PJJA 2VXDA 4N9HA 3HOXJ 5F0HA 1S5LC 4F52A 1XMKA 3CCUI 4BY1J 4BBRJ 2F5FA 1V3FA 2KZVA 1X2MA 4D9JA 1EH8A 3ZN0A 1YIJI 4LG0B 2ELKA 5JVGF 2DMPA 1OKRA 1YX5A 3CCEI 4ENKA 2PJPA 5B66C 1O3TA 1LQ1A 4UXNA 2XB0X 3H3ZA 4ZJZA 4C3HJ 2HPMA 2HR3A 3SZPA 2ZMEC 2ZO4A 2KRFA 4J19A 2L9SA 2PMUA 5FLMJ 3JRDA 4A3FJ 4WF2A 1A6IA 2KT0A 2P8TA 4B1RA 3WTYC 2CW0F 2DFFA 3DLAA 2Y30A 4ENJA 1Y1VJ 3K9TA 3KP2A 4U0WA 4ZTFA 2DT6A 2R5ZB 1EH7A 5D6EA 2UXXA 3H36A 3HPGA 4BDYA 1D1AA 3DP7A 3RZDJ 1B9NA 5EF6A 4JYKA 3H9QA 3DU6A 2QBYA 3PNYA 4BH9A 3L09A 2L7FP 1U9NA 2M87A 3I4PA 1MBEA 1K61A 4E7IA 1AU7A 1XSXA 2IT0A 1NHAA 1MD0A 2JRMA 1DDNA 3IHUA 2FQ3A 2PFBA 4QWQA 5M3FJ 2M4GA 1A04A 3KZYA 4HF1A 1ORKA 3A2KA 3BR1A 1N25A 2CUJA 3H9JA 3FX3A 4YIRX 1BM9A 2O3FA 2Y0SN 3ZXSA 5HNFA 3UNGC 5D5UB 3JAMK 2FA5A 5LFAA 2ZJQF 2ESHA 5EEHA 1W0UA 2EZIA 1U2WA 3RKYA 2HXIA 3RYRA 1DU6A 3I3LA 2M0CA 1POGA 3BOQA 4XN3A 3TO7A 3KFWX 1BR4A 4Q5SF 2ISZA 1EKEA 5E1ZB 4S05A 1MKMA 2ZXHA 4F3QA 2AS5F 4XKVA 3OL3A 4KISA 1ZLJA 3A0BC 2VOPA 2LVSA 2EZKA 2LTPA 2HOSA 1MSEC 1WFXA 3AKZA 3I5UA 1K6YA 1IO2A 2YUSA 2V7FA 2RAEA 1XB4A 2CWEA 1R6RA 3QPLA 4LIUA 1P7IA 5CPRB 3WE2A 3E1SA 1R1VA 1MBHA 1TNSA 1B59A 3SHFA 2E2JJ 4ZYAA 3TL4X 4KT6A 5J4VA 3E0JB 1SD7A 4M3BA 1XCBA 2NOJB 4IHVA 3HUGA 2KRHA 1SFXA 4IHSA 3BQZA 2VN2A 4I6ZA
chains in the Genus database with same CATH topology
4G94A 1R36A 1Z91A 3LA7A 1I1GA 3IRQA 3CUOA 5ED4A 1LDJA 4ESBA 2JZYA 4OIRF 1IN5A 3LA3A 3HYIA 4I2OA 4LB6B 1O3QA 5DCMA 1MDMA 4EQQA 3WGGA 5L3EA 2HZTA 4G6QA 1FP1D 2BBYA 5E20A 1KA8A 3R4KA 3T1BA 2DPDA 4E70A 3B73A 2EA4A 1JE8A 4Y17A 5IT3A 3G73A 4M6YA 3K0LA 1FYKA 1ZGJA 2O03A 1BC7C 1HSJA 5ICFA 5ILSA 1HKSA 1O7LA 2HFHA 4KUMA 4A6EA 2XAGA 1QBJA 2QQ9A 4L9TA 2QM3A 2VONA 2LSOA 1S7AA 5L3DA 4HF0A 4EM1A 2EJRA 3JTGA 3LSTA 3ZMSA 4MQ9F 3DFGA 1TTYA 2W85A 3M9AA 3IKVA 2D2WA 1J5YA 5CVJA 3P9KA 4Q4ZF 2FBIA 2Y0MA 4GCVA 2VT2A 1U3EM 2MA3A 2KJCA 3U9GA 3EQLF 1CGPA 4U7BA 1ODDA 2O6GE 1HQCA 2TDXA 1O3SA 2M8EA 3KLOA 5LRRA 1RI7A 4MGRA 2PLYA 4KFCA 3HSRA 5JI6A 5BOXA 4O6JA 3ZMUA 4D0PA 4XSZF 3I59B 3R0AA 4M6XA 2EFOA 2VXZA 4CDGA 3H3UA 3FF5A 5ICCA 4UUVA 4L5JA 2DLLA 4I98B 2V1XA 4KICA 2VBXA 3KP3A 5JFRA 3AAFA 1OYWA 3Q9SA 3ISPA 5D8LB 3DQVC 2EWNA 5DUKA 2LF7A 5ILUA 3LQRA 4NQWA 2QQAA 1R22A 1FYLA 5BQTA 1ZN2A 3JW4A 3R6SA 3BROA 4RGRA 2HTSA 4L9VA 4M74A 5A2QZ 5DUIA 4RB2C 1QQIA 1O7FA 4P96A 3KP6A 4CICA 3E5XA 3VB2A 4IF4A 4OIQF 5F6FA 4GYGA 3L00A 1ZHFA 2YR2A 1HKTA 1R1TA 2A6EF 3Q5FA 3HOSA 3GLXA 2E1NA 2DFIA 4PGGA 3BPVA 4KDPA 4LGWA 4LLNA 5JR3A 1BOAA 2CYYA 2HEOA 1PUEE 4LK0F 1ULYA 2H09A 1QO0D 1XDSA 3L2CA 1OYIA 2IVMA 3JSOA 3RDIA 3CJNA 4BHCA 1TLHB 2XVCA 3I0TA 1YW7A 5AIQA 1IRFA 2O61A 3GWZA 3WTWC 2MH2A 3BJOA 1YO5C 4UVCA 3PQJA 3V8JA 1P6RA 3TDUC 3F21A 1FP2A 4G8XA 3HIFA 3QOPA 2VODA 3VFZA 1Z7UA 4IHTA 3D0SA 3RTRA 2A61A 3FMQA 4OINF 1KU9A 1YS7A 1IF1A 2W57A 4I0AA 1QZZA 3I59A 4AD9A 5ICGA 4HQMA 3ROUA 2FU4A 5LGUA 1C0WA 4GO1A 5E8GA 2UZKA 1YYVA 5FLXZ 5H20A 1YG2A 4UNOA 3TKYA 2XKOA 3K1MA 1YW8A 4L18B 4MEYF 3BJ6A 4I0BA 5DEQA 3ZP5A 3GVAA 5D5XB 2F5EA 4NB5A 1HXDA 2FEZA 4EV0A 3O6BB 2DW4A 1F1ZA 2FNPA 2W84A 1V4RA 1T2KA 4XSXF 5CLSA 3WGHA 3JTHA 4MEXF 1FBUA 1USTA 2V1UA 3N4MA 3K1PA 3FXUA 3GFLA 4RS8A 4UV9A 1ONVA 1HW5A 4AIKA 1MZBA 4GYIA 3ERED 3KEQA 3IL2A 2DQLA 1WQ2A 2QWWA 5LGTA 1K78B 2RNJA 2HS5A 2E1CA 3HRUA 1XGNA 2CSOA 1LNWA 2JTVA 1YW9A 3TOBA 2P5LC 2VE8A 4RB0A 1Z1DA 2Z9OA 3ZMVA 1RNLA 2GQQA 1FWZA 2ETHA 2WWYA 1BBYA 4HW0A 5A2QK 5BPIA 3B02A 2K7LA 3J81Z 2JSCA 3EDPA 1XN7A 2ZMEA 3SFZA 2L54A 4B09A 3VEPA 2XV4S 4OMZA 4Y13A 1TQMA 5LHIA 1REPC 5LHGA 3T8TA 1MJ9A 3IRRA 4O3MA 2L01A 3RPUA 3DPTA 2DAOA 5CJ9A 3T5XA 4YG2F 4I09A 3CUQB 4AVPA 4O5VA 5DD8A 3FM3A 4ZYHA 1XGSA 1R23A 2H6BA 2FBHA 4CXFA 2HKOA 4G7HF 4BNCA 3RPQA 5HDKA 2HGCA 5AIPA 3GF2A 3TQNA 1AWCA 4FHTA 1LJ9A 4EGYA 1PP7U 1XDUA 1BI2A 2MLGA 5ICEA 1FLIA 2HKXA 1K7AA 1KU7A 4TV7A 3KZZA 2X0LA 3IKTA 3WTVC 1IXRC 3I58A 4A0ZA 4ZYDA 1XCVA 2O0YA 1FNNA 4PCQA 3DF8A 2XRNA 5HOOA 2LF8A 1W4MA 3DV8A 2XKPA 5FLXK 4M73A 1WRJA 2EV5A 3IWZA 1GHCA 2V9VA 2MD5A 5D4RA 1DUXC 2A68F 2ZCWA 5KVRA 2QYOA 4KA4A 1RUNA 3KETA 2P6SA 3F8MA 3V8KA 3PQKA 1K79A 4KIFA 4G6DA 4WCGA 3WG9A 3ZMTA 5K5RA 3WTXC 3FM5A 2K27A 3K1NA 5E18F 3M7GA 2PEXA 2DPUA 2UXNA 2G9WA 1H0MA 3ABTA 1R5HA 3T8RA 3GEZA 3Q9VA 3R60A 3MQ0A 2E7WA 5DYMA 3I64A 4KIBA 4IXAA 1OYYA 3BJAA 3REOA 2H27A 3RIRA 1BI0A 3R0JA 4HV5A 4YIIA 1KYZA 4DNCA 3GUDA 4EJVA 3I53A 4OIPF 4MNUA 3C1DA 3O3KA 1I1SA 2MLKA 4EGZA 1KU3A 1QZYA 4R8HA 4WX9A 4LG0A 2NYXA 4HBLA 2JPBA 2EB7A 1HW1A 4EJTA 1KU2A 2MBFA 2P5VA 1D3YA 3S2WA 2PBIA 4HX4A 2BE5F 2XUBA 4WXDA 2QZ8A 4H0EA 4IRGA 1J9IA 1IN4A 3JSPA 3KP7A 4AIHA 1YLFA 5LEJA 2ELHA 3F8CA 3FHZA 4KYWA 3RYPA 4LB5A 3QP6A 1IRGA 4IRHA 3J81K 1J2XA 3DEUA 1FZPB 4G7ZF 1MJAA 2A6HF 1ON2A 1ZYRF 5BS6A 5HDGA 4YFXF 2M5WA 3CUQC 2XAJA 3OV8A 1CF7B 1JHFA 3ZMDA 5HDNA 3J80K 1WKMA 4JQFA 4L9NA 3F22A 4Q48A 1TNTA 5TJJA 1SMYF 4MTEA 3ZN1A 3HRTA 3MCZA 1FYMA 4LLGF 4R1HA 3MZHA 2FNAA 4KMUX 4MHGA 1HBXG 4HDVA 1LDKB 4BAYA 2CFXA 2MC3A 1ZREA 5K5QA 4HX7A 2PMHA 2PG4A 3E5QA 2IJLA 2HYFA 2XROA 2OU2A 3MFKA 5IT9K 3MWMA 2OQRA 2NNNA 1R58A 3HSFA 4L5IA 4UVAA 2ISYA 2LNBA 3NRVA 2P5KA 3FMRA 4AIJA 4JBAA 1RIOH 2HWVA 4WWCA 2IA2A 5HLGA 4EVIA 2MH9A 2Z33A 3DXJF 4M71A 3M8EA 3V8LA 1D8JA 1S6LA 4A2UA 3E97A 2DO7A 3TGNA 4YFNF 2QVOA 4ZH4F 3M1EA 3QU3A 2HTJA 3SXYA 4ZZDA 5E1WA 1IAWA 4CHUA 1R7JA 2ACJA 5FD5A 2IW5A 1B4AA 1G4DA 3SZTA 1J75A 2RGVA 2LKPA 3CLOA 3QU6A 3ABUA 1W5SA 3T0YA 5L3BA 3I71A 3LQQA 2RN7A 1XSDA 5L3GA 4ON0A 1U5TB 4HAMA 2DQRA 2G7UA 3EYIA 1Z6RA 1UB9A 5DD4A 3HSEA 2M45A 2L3DA 2FRHA 2VOOA 4HDUA 2YU3A 1CF7A 4FX0A 4IPAA 3TO6A 2M1BA 2OBPA 2KKOA 2LDUA 3BY6A 4RGUA 4RGSA 3WE3A 1BI1A 3HRSA 1I5ZA 2XAQA 3F72A 2XAFA 3HTUA 4U88A 6PAXA 4K2EA 1W7PB 4CO8A 2PQ8A 3HRMA 2GAUA 2V1DA 4Q47A 4A0YA 2D45A 5H6QA 2FMYA 2O8XA 4BYYA 2K4JA 3L9FA 1QNTA 2ADUA 5LEKA 2RVCA 2X4HA 3TDZC 2PI0A 1LDDA 3GW2A 3K69A 4L0ZB 4IJAA 4U0VA 1ZG3A 2Z3YA 2JRTA 3FZVA 5D8KB 2VE9A 2V6CA 1T6SA 2RC4A 3CTAA 3NEUA 3QAHA 1FOKA 1FX7A 1JGSA 1GVJA 4XBFA 1DPUA 2HDCA 4LD5A 1F9NA 3VODA 2DI3A 2NAZA 1KQ0A 3ECHA 3V4GA 1B6AA 2K02A 4LJZF 1T0FA 4KN7X 4ETSA 4A5MA 1JXSA 2GA1A 1YS6A 4OIOF 2P7CB 1YFHA 2FE3A 5EEGA 1BIAA 1U5TA 4XRFA 2RDPA 4YFKF 2WC2A 1P4AA 4M9SA 3RKXA 2A3SA 2ESNA 3FWEA 3E6DA 2EFPA 5HS7A 2F5CA 3L7WA 2STTA 4AWXB 2EV6A 2Z5UA 1E17A 2R3SA 2NRAC 1OPCA 5AONA 2ZKZA 1BI3A 3SQNA 4P9UA 2OA4A 4OMYA 2QBYB 5LGNA 5LRSA 4U0YA 3HTSB 2XIGA 1ZRFA 1B1BA 2GWRA 3QRFF 3GZ5A 1Z6TA 2HQNA 2OZ6A 1RUOA 1U5TC 2ZNZA 3DKWA 3C18A 4I7HA 2FBKA 1HW2A 1Y0UA 2DK5A 3F8BA 2ZNYA 2KIUA 3LFKA 1D5VA 3D5LA 3KP5A 3QP5A 3WTUC 3RI4A 4KIGA 1BJAA 1MJBA 5ERIA 3ZMZA 2AXLA 4HX8A 1J59A 3J80Z 2R7DA 3J7AO 5ILVA 1AOYA 5HLIA 1XD7A 3P9CA 4KMFA 5FGMA 4HA8A 3BWGA 1JHHA 4QLCU 1FBQA 4LFUA 2L4AA 2K4BA 4MTDA 3GFMA 4A6DA 1ZG1A 2DBBA 5BPDA 5F1RA 1IUYA 2GA2A 2DU9A 1IXSB 5J8CA 1I27A 4ESJA 2IA0A 2KIFA 2VC1A 4FX4A 3ECOA 2QLZA 4G7OF 2ZJ2A 2H94A 3WTTC 5IT9Z 4KT5C 2Q0OA 1UCRA 5DCMB 4EM2A 1Q1HA 4RB3C 5FO5A 4UV8A 4KN4X 1O3RA 4MQVA 1J0RA 4FT8A 2W25A 1TW3A 1YIOA 1ZRCA 4M9ZA 1T98A 3H92A 1IXCA 3IWFA 1T38A 4UVBA 1ZGAA 4GGGA 1G6NA 3F23A 1K78A 1Z9CA 1SFUA 4S04A 4EJUA 5DCFA 1QPMA 1ZARA 5KK1A 1PDNC 4EJWA 3G3ZA 2C6YA 1R00A 2CO5A 3EYYA 4OOIA 3U2RA 4JK1X 4BHBA 2DT5A 1FSEA 1S3JA 3F6VA 3FXQA 1P2FA 1WWXA 3V7RA 2B0LA 5BMZA 4L0YB 1U8RA 3F8NA 5F64A 2GXGA 1STZA 2A69F 1H9TA 1SMTA 1KQ8A 4KNYA 1TQIA 2Y75A 1H9GA 2K86A 5DDGA 5L3FA 3NQOA 3FMSA 1ON1A 5FFZA 1R1UA 2FSWA 3MEXA 2P7VB 2UWMA 1FY7A 3BPXA 3LWFA 2FF4A 1SAXA 1P4XA 3E6MA 3TO9A 1IN8A 1LEAA 3VOEA 3CUQA 2KIMA 2Z99A 2VC0A 3V7SA 1TQPA 3V7CA 1YTYA 2EFQA 2V79A 4A12A 1UHWA 1ZG5A 3R61A 3RJPA 4RB1A 2JPCA 1D8KA 4Y15A 4BXUA 1ZAOA 2J5OA 2OD5A 3F8FA 1GXQA 1HSTA 1WI9A 4U7DA 1U6GA 1G3WA 3DPLC 2Q2EA 1OR7A 4RAZA 3E3VA 4HV6A 5HVQC 2D1HA 1FT9A 3MAJA 5E8IA 4A0XA 3TOAA 5JHUA 3GX4X 1K6OA 1FPQA 2M30A 2XASA 2OQGA 1FC3A 3F6OA 5K5OA 1E2XA 4M9XA 2QUFA 2L4MA 2RQPA 1TW2A 4F7ZA 4WXCA 3HOTA 2IP2A 1B9MA 2FXAA 3ULQB 3M8FA 5J6XA 2A07F 1KGSA 3PFIA 2P4WA 4N0BA 3EUHA 1BC8C 3HHHA 3N97A 4P55A 4RGXA 5LBQA 1DP7P 3LAJA 1UHMA 4A5NA 3ZQ7A 4I02A 1X3UA 4ZYGA 5E17F 4ESFA 5CVUA 1XSVA 2F5DA 4N9IA 4UHTA 1W5TA 2YSRA 1FBSA 4HYEA 4B8XA 3GZ6A 3EETA 2NNYA 5D5VB 3BP8A 2EFWA 5FD6A 2WTEA 1SD6A 3BDDA 4HZFA 3F3XA 4PDKA 1I6XA 3WTSC 2YX4A 4IRIA 4OU0A 3P9IA 1Z05A 3W6JB 2VBWA 1G3TA 1L3LA 5FB2A 2DTRA 1WSUA 2J5PA 4DQ2A 1SFEA 3KEOA 4LLLA 5HS8A 2BGCA 1LVAA 5D4SA 3W6KB 1KQ9A 1IZ1A 1R5GA 2XHKA 5LLQA 3COAC 5HS9A 4XLNF 1P4WA 2G7HA 5CVRA 1G3YA 2YX7A 3RKWA 1G3SA 2VBZA 4BHPA 5K1YA 1FSHA 1S8NA 1U78A 2ZFWA 4PGHA 4WK8F 1VTNC 3E5UA 2ZXJA 2CQKA 2FOKA 4ENNA 4PZJA 4I01A 2OZUA 3GXOA 4IVNA 1ZRDA 1IN6A 2R7FA 4BQAA 3ML6A 2Y48A 3QPTA 1DPRA 5H6RA 4EJOA 1LB2A 4ENMA 5TRDA 3WTZA 5JVTA 1IN7A 3GO5A 2EFNA 4G9YA 5CVIA 5FFXA 1ZLKA 2YPRA 2HOEA 4CGZA 2W24A 3GFIA 4GXOA 2NS0A 2BEOA 4HOBA 5DV5A 3KE2A 2A5YB 3KP4A 3WU1B 3O2PE 3WODF 1XGMA 1BN5A 1GXPA 3GFJA 2ZMEB 2GIVA 2QQBA 1USSA 4CYDA 1PP8F 3BZ6A 1QGPA 2XGXA 1HKQA 4M72A 1XGOA 2RV8A 3JAMZ 4YIFA 3CO6C 5D6FA 5CVVA 2HYGD 1SD4A 2D1VA 5D5WB 2L02A 1F4KA 3CO7C 2E7XA 2H6CA 4WXHA 3GYHX 4HLXA 2QENA 3MZYA 4R79A 2OAZA 4ZYEA 2COMA 4CZZA 3C3WA 3KLNA 4EM0B 1P92A 3ELKA 1KYWA 3IC7A 2BYVE 4HLYA 4RAYA 1ZH5A 1W7PD 4P9FA 2CG4A 4EMSA 1J7KA 1OMIA 4LK1F 2IRFG 1BIBA 2RKHA 5L3CA 4P5OA 2ZBKA 2HQRA 4L9JA 3HHGA 2PN6A 1TBXA 5CYVA 1W7PA 2CGPA 2BV6A 2FMLA 4LMYA 2WV0A 2JT1A 2EK5A 5HLHA 1SD5A 1MGTA 1O57A 1LEBA 3WU0A 1IW7F 4HQEA 1RZ4A 5E1XA 3ZPLA 3WGIA 2IA1A 2F2EA 2EA2A 1UFMA 4NHJA 2IPQX 5LHHA 3FXRA 5J8FA 3I54A 2KJBA 2DK8A 4HF2A 3OOPA 2VT3A 3E6CC 1F5TA 1S7OA 4XLPF 3P7NA 1EH6A 2GZWA 2VBYA 3K2ZA 4ZZLA 4ASNA 1EV7A 3QPHA 2GXBA 3U1DA 3KCCA 1YQAA 3C7JA 2XAHA 2EV0A 1T39A 3LA2A 1XMAA 1MDMB 3CDHA 3LAPA 3E6BA 2STWA 1L0OC 2P6TA 1S29A 4Z2YA 2Q8KA 4N9HA 1XMKA 2F5FA 1V3FA 1EH8A 3ZN0A 4LG0B 1OKRA 4ENKA 2PJPA 1O3TA 1LQ1A 4UXNA 3H3ZA 2HR3A 3SZPA 2ZO4A 2KRFA 2PMUA 4WF2A 2P8TA 3WTYC 2CW0F 4ENJA 3K9TA 3KP2A 4U0WA 1EH7A 5D6EA 2UXXA 3DP7A 1B9NA 2QBYA 4BH9A 3L09A 2M87A 3I4PA 1XSXA 2IT0A 1NHAA 1MD0A 1DDNA 3IHUA 2FQ3A 2PFBA 4QWQA 1A04A 3KZYA 4HF1A 3FX3A 1BM9A 2O3FA 5D5UB 3JAMK 2FA5A 2ESHA 5EEHA 1U2WA 3RKYA 3RYRA 3BOQA 3TO7A 3KFWX 4Q5SF 2ISZA 5E1ZB 4S05A 1MKMA 2AS5F 1ZLJA 2VOPA 3I5UA 1XB4A 2CWEA 3WE2A 1R1VA 1TNSA 1B59A 3SHFA 1SD7A 1XCBA 3HUGA 1SFXA 4IHSA 2VN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G94 A;  1R36 A;  1Z91 A;  3LA7 A;  1I1G A;  3IRQ A;  3CUO A;  5ED4 A;  1LDJ A;  4ESB A;  2JZY A;  4OIR F;  1IN5 A;  3LA3 A;  3HYI A;  4I2O A;  4LB6 B;  1O3Q A;  5DCM A;  1MDM A;  4EQQ A;  3WGG A;  5L3E A;  2HZT A;  4G6Q A;  1FP1 D;  2BBY A;  5E20 A;  1KA8 A;  3R4K A;  3T1B A;  2DPD A;  4E70 A;  3B73 A;  2EA4 A;  1JE8 A;  4Y17 A;  5IT3 A;  3G73 A;  4M6Y A;  3K0L A;  1FYK A;  1ZGJ A;  2O03 A;  1BC7 C;  1HSJ A;  5ICF A;  5ILS A;  1HKS A;  1O7L A;  2HFH A;  4KUM A;  4A6E A;  2XAG A;  1QBJ A;  2QQ9 A;  4L9T A;  2QM3 A;  2VON A;  2LSO A;  1S7A A;  5L3D A;  4HF0 A;  4EM1 A;  2EJR A;  3JTG A;  3LST A;  3ZMS A;  4MQ9 F;  3DFG A;  1TTY A;  2W85 A;  3M9A A;  3IKV A;  2D2W A;  1J5Y A;  5CVJ A;  3P9K A;  4Q4Z F;  2FBI A;  2Y0M A;  4GCV A;  2VT2 A;  1U3E M;  2MA3 A;  2KJC A;  3U9G A;  3EQL F;  1CGP A;  4U7B A;  1ODD A;  2O6G E;  1HQC A;  2TDX A;  1O3S A;  2M8E A;  3KLO A;  5LRR A;  1RI7 A;  4MGR A;  2PLY A;  4KFC A;  3HSR A;  5JI6 A;  5BOX A;  4O6J A;  3ZMU A;  4D0P A;  4XSZ F;  3I59 B;  3R0A A;  4M6X A;  2EFO A;  2VXZ A;  4CDG A;  3H3U A;  3FF5 A;  5ICC A;  4UUV A;  4L5J A;  2DLL A;  4I98 B;  2V1X A;  4KIC A;  2VBX A;  3KP3 A;  5JFR A;  3AAF A;  1OYW A;  3Q9S A;  3ISP A;  5D8L B;  3DQV C;  2EWN A;  5DUK A;  2LF7 A;  5ILU A;  3LQR A;  4NQW A;  2QQA A;  1R22 A;  1FYL A;  5BQT A;  1ZN2 A;  3JW4 A;  3R6S A;  3BRO A;  4RGR A;  2HTS A;  4L9V A;  4M74 A;  5A2Q Z;  5DUI A;  4RB2 C;  1QQI A;  1O7F A;  4P96 A;  3KP6 A;  4CIC A;  3E5X A;  3VB2 A;  4IF4 A;  4OIQ F;  5F6F A;  4GYG A;  3L00 A;  1ZHF A;  2YR2 A;  1HKT A;  1R1T A;  2A6E F;  3Q5F A;  3HOS A;  3GLX A;  2E1N A;  2DFI A;  4PGG A;  3BPV A;  4KDP A;  4LGW A;  4LLN A;  5JR3 A;  1BOA A;  2CYY A;  2HEO A;  1PUE E;  4LK0 F;  1ULY A;  2H09 A;  1QO0 D;  1XDS A;  3L2C A;  1OYI A;  2IVM A;  3JSO A;  3RDI A;  3CJN A;  4BHC A;  1TLH B;  2XVC A;  3I0T A;  1YW7 A;  5AIQ A;  1IRF A;  2O61 A;  3GWZ A;  3WTW C;  2MH2 A;  3BJO A;  1YO5 C;  4UVC A;  3PQJ A;  3V8J A;  1P6R A;  3TDU C;  3F21 A;  1FP2 A;  4G8X A;  3HIF A;  3QOP A;  2VOD A;  3VFZ A;  1Z7U A;  4IHT A;  3D0S A;  3RTR A;  2A61 A;  3FMQ A;  4OIN F;  1KU9 A;  1YS7 A;  1IF1 A;  2W57 A;  4I0A A;  1QZZ A;  3I59 A;  4AD9 A;  5ICG A;  4HQM A;  3ROU A;  2FU4 A;  5LGU A;  1C0W A;  4GO1 A;  5E8G A;  2UZK A;  1YYV A;  5FLX Z;  5H20 A;  1YG2 A;  4UNO A;  3TKY A;  2XKO A;  3K1M A;  1YW8 A;  4L18 B;  4MEY F;  3BJ6 A;  4I0B A;  5DEQ A;  3ZP5 A;  3GVA A;  5D5X B;  2F5E A;  4NB5 A;  1HXD A;  2FEZ A;  4EV0 A;  3O6B B;  2DW4 A;  1F1Z A;  2FNP A;  2W84 A;  1V4R A;  1T2K A;  4XSX F;  5CLS A;  3WGH A;  3JTH A;  4MEX F;  1FBU A;  1UST A;  2V1U A;  3N4M A;  3K1P A;  3FXU A;  3GFL A;  4RS8 A;  4UV9 A;  1ONV A;  1HW5 A;  4AIK A;  1MZB A;  4GYI A;  3ERE D;  3KEQ A;  3IL2 A;  2DQL A;  1WQ2 A;  2QWW A;  5LGT A;  1K78 B;  2RNJ A;  2HS5 A;  2E1C A;  3HRU A;  1XGN A;  2CSO A;  1LNW A;  2JTV A;  1YW9 A;  3TOB A;  2P5L C;  2VE8 A;  4RB0 A;  1Z1D A;  2Z9O A;  3ZMV A;  1RNL A;  2GQQ A;  1FWZ A;  2ETH A;  2WWY A;  1BBY A;  4HW0 A;  5A2Q K;  5BPI A;  3B02 A;  2K7L A;  3J81 Z;  2JSC A;  3EDP A;  1XN7 A;  2ZME A;  3SFZ A;  2L54 A;  4B09 A;  3VEP A;  2XV4 S;  4OMZ A;  4Y13 A;  1TQM A;  5LHI A;  1REP C;  5LHG A;  3T8T A;  1MJ9 A;  3IRR A;  4O3M A;  2L01 A;  3RPU A;  3DPT A;  2DAO A;  5CJ9 A;  3T5X A;  4YG2 F;  4I09 A;  3CUQ B;  4AVP A;  4O5V A;  5DD8 A;  3FM3 A;  4ZYH A;  1XGS A;  1R23 A;  2H6B A;  2FBH A;  4CXF A;  2HKO A;  4G7H F;  4BNC A;  3RPQ A;  5HDK A;  2HGC A;  5AIP A;  3GF2 A;  3TQN A;  1AWC A;  4FHT A;  1LJ9 A;  4EGY A;  1PP7 U;  1XDU A;  1BI2 A;  2MLG A;  5ICE A;  1FLI A;  2HKX A;  1K7A A;  1KU7 A;  4TV7 A;  3KZZ A;  2X0L A;  3IKT A;  3WTV C;  1IXR C;  3I58 A;  4A0Z A;  4ZYD A;  1XCV A;  2O0Y A;  1FNN A;  4PCQ A;  3DF8 A;  2XRN A;  5HOO A;  2LF8 A;  1W4M A;  3DV8 A;  2XKP A;  5FLX K;  4M73 A;  1WRJ A;  2EV5 A;  3IWZ A;  1GHC A;  2V9V A;  2MD5 A;  5D4R A;  1DUX C;  2A68 F;  2ZCW A;  5KVR A;  2QYO A;  4KA4 A;  1RUN A;  3KET A;  2P6S A;  3F8M A;  3V8K A;  3PQK A;  1K79 A;  4KIF A;  4G6D A;  4WCG A;  3WG9 A;  3ZMT A;  5K5R A;  3WTX C;  3FM5 A;  2K27 A;  3K1N A;  5E18 F;  3M7G A;  2PEX A;  2DPU A;  2UXN A;  2G9W A;  1H0M A;  3ABT A;  1R5H A;  3T8R A;  3GEZ A;  3Q9V A;  3R60 A;  3MQ0 A;  2E7W A;  5DYM A;  3I64 A;  4KIB A;  4IXA A;  1OYY A;  3BJA A;  3REO A;  2H27 A;  3RIR A;  1BI0 A;  3R0J A;  4HV5 A;  4YII A;  1KYZ A;  4DNC A;  3GUD A;  4EJV A;  3I53 A;  4OIP F;  4MNU A;  3C1D A;  3O3K A;  1I1S A;  2MLK A;  4EGZ A;  1KU3 A;  1QZY A;  4R8H A;  4WX9 A;  4LG0 A;  2NYX A;  4HBL A;  2JPB A;  2EB7 A;  1HW1 A;  4EJT A;  1KU2 A;  2MBF A;  2P5V A;  1D3Y A;  3S2W A;  2PBI A;  4HX4 A;  2BE5 F;  2XUB A;  4WXD A;  2QZ8 A;  4H0E A;  4IRG A;  1J9I A;  1IN4 A;  3JSP A;  3KP7 A;  4AIH A;  1YLF A;  5LEJ A;  2ELH A;  3F8C A;  3FHZ A;  4KYW A;  3RYP A;  4LB5 A;  3QP6 A;  1IRG A;  4IRH A;  3J81 K;  1J2X A;  3DEU A;  1FZP B;  4G7Z F;  1MJA A;  2A6H F;  1ON2 A;  1ZYR F;  5BS6 A;  5HDG A;  4YFX F;  2M5W A;  3CUQ C;  2XAJ A;  3OV8 A;  1CF7 B;  1JHF A;  3ZMD A;  5HDN A;  3J80 K;  1WKM A;  4JQF A;  4L9N A;  3F22 A;  4Q48 A;  1TNT A;  5TJJ A;  1SMY F;  4MTE A;  3ZN1 A;  3HRT A;  3MCZ A;  1FYM A;  4LLG F;  4R1H A;  3MZH A;  2FNA A;  4KMU X;  4MHG A;  1HBX G;  4HDV A;  1LDK B;  4BAY A;  2CFX A;  2MC3 A;  1ZRE A;  5K5Q A;  4HX7 A;  2PMH A;  2PG4 A;  3E5Q A;  2IJL A;  2HYF A;  2XRO A;  2OU2 A;  3MFK A;  5IT9 K;  3MWM A;  2OQR A;  2NNN A;  1R58 A;  3HSF A;  4L5I A;  4UVA A;  2ISY A;  2LNB A;  3NRV A;  2P5K A;  3FMR A;  4AIJ A;  4JBA A;  1RIO H;  2HWV A;  4WWC A;  2IA2 A;  5HLG A;  4EVI A;  2MH9 A;  2Z33 A;  3DXJ F;  4M71 A;  3M8E A;  3V8L A;  1D8J A;  1S6L A;  4A2U A;  3E97 A;  2DO7 A;  3TGN A;  4YFN F;  2QVO A;  4ZH4 F;  3M1E A;  3QU3 A;  2HTJ A;  3SXY A;  4ZZD A;  5E1W A;  1IAW A;  4CHU A;  1R7J A;  2ACJ A;  5FD5 A;  2IW5 A;  1B4A A;  1G4D A;  3SZT A;  1J75 A;  2RGV A;  2LKP A;  3CLO A;  3QU6 A;  3ABU A;  1W5S A;  3T0Y A;  5L3B A;  3I71 A;  3LQQ A;  2RN7 A;  1XSD A;  5L3G A;  4ON0 A;  1U5T B;  4HAM A;  2DQR A;  2G7U A;  3EYI A;  1Z6R A;  1UB9 A;  5DD4 A;  3HSE A;  2M45 A;  2L3D A;  2FRH A;  2VOO A;  4HDU A;  2YU3 A;  1CF7 A;  4FX0 A;  4IPA A;  3TO6 A;  2M1B A;  2OBP A;  2KKO A;  2LDU A;  3BY6 A;  4RGU A;  4RGS A;  3WE3 A;  1BI1 A;  3HRS A;  1I5Z A;  2XAQ A;  3F72 A;  2XAF A;  3HTU A;  4U88 A;  6PAX A;  4K2E A;  1W7P B;  4CO8 A;  2PQ8 A;  3HRM A;  2GAU A;  2V1D A;  4Q47 A;  4A0Y A;  2D45 A;  5H6Q A;  2FMY A;  2O8X A;  4BYY A;  2K4J A;  3L9F A;  1QNT A;  2ADU A;  5LEK A;  2RVC A;  2X4H A;  3TDZ C;  2PI0 A;  1LDD A;  3GW2 A;  3K69 A;  4L0Z B;  4IJA A;  4U0V A;  1ZG3 A;  2Z3Y A;  2JRT A;  3FZV A;  5D8K B;  2VE9 A;  2V6C A;  1T6S A;  2RC4 A;  3CTA A;  3NEU A;  3QAH A;  1FOK A;  1FX7 A;  1JGS A;  1GVJ A;  4XBF A;  1DPU A;  2HDC A;  4LD5 A;  1F9N A;  3VOD A;  2DI3 A;  2NAZ A;  1KQ0 A;  3ECH A;  3V4G A;  1B6A A;  2K02 A;  4LJZ F;  1T0F A;  4KN7 X;  4ETS A;  4A5M A;  1JXS A;  2GA1 A;  1YS6 A;  4OIO F;  2P7C B;  1YFH A;  2FE3 A;  5EEG A;  1BIA A;  1U5T A;  4XRF A;  2RDP A;  4YFK F;  2WC2 A;  1P4A A;  4M9S A;  3RKX A;  2A3S A;  2ESN A;  3FWE A;  3E6D A;  2EFP A;  5HS7 A;  2F5C A;  3L7W A;  2STT A;  4AWX B;  2EV6 A;  2Z5U A;  1E17 A;  2R3S A;  2NRA C;  1OPC A;  5AON A;  2ZKZ A;  1BI3 A;  3SQN A;  4P9U A;  2OA4 A;  4OMY A;  2QBY B;  5LGN A;  5LRS A;  4U0Y A;  3HTS B;  2XIG A;  1ZRF A;  1B1B A;  2GWR A;  3QRF F;  3GZ5 A;  1Z6T A;  2HQN A;  2OZ6 A;  1RUO A;  1U5T C;  2ZNZ A;  3DKW A;  3C18 A;  4I7H A;  2FBK A;  1HW2 A;  1Y0U A;  2DK5 A;  3F8B A;  2ZNY A;  2KIU A;  3LFK A;  1D5V A;  3D5L A;  3KP5 A;  3QP5 A;  3WTU C;  3RI4 A;  4KIG A;  1BJA A;  1MJB A;  5ERI A;  3ZMZ A;  2AXL A;  4HX8 A;  1J59 A;  3J80 Z;  2R7D A;  3J7A O;  5ILV A;  1AOY A;  5HLI A;  1XD7 A;  3P9C A;  4KMF A;  5FGM A;  4HA8 A;  3BWG A;  1JHH A;  4QLC U;  1FBQ A;  4LFU A;  2L4A A;  2K4B A;  4MTD A;  3GFM A;  4A6D A;  1ZG1 A;  2DBB A;  5BPD A;  5F1R A;  1IUY A;  2GA2 A;  2DU9 A;  1IXS B;  5J8C A;  1I27 A;  4ESJ A;  2IA0 A;  2KIF A;  2VC1 A;  4FX4 A;  3ECO A;  2QLZ A;  4G7O F;  2ZJ2 A;  2H94 A;  3WTT C;  5IT9 Z;  4KT5 C;  2Q0O A;  1UCR A;  5DCM B;  4EM2 A;  1Q1H A;  4RB3 C;  5FO5 A;  4UV8 A;  4KN4 X;  1O3R A;  4MQV A;  1J0R A;  4FT8 A;  2W25 A;  1TW3 A;  1YIO A;  1ZRC A;  4M9Z A;  1T98 A;  3H92 A;  1IXC A;  3IWF A;  1T38 A;  4UVB A;  1ZGA A;  4GGG A;  1G6N A;  3F23 A;  1K78 A;  1Z9C A;  1SFU A;  4S04 A;  4EJU A;  5DCF A;  1QPM A;  1ZAR A;  5KK1 A;  1PDN C;  4EJW A;  3G3Z A;  2C6Y A;  1R00 A;  2CO5 A;  3EYY A;  4OOI A;  3U2R A;  4JK1 X;  4BHB A;  2DT5 A;  1FSE A;  1S3J A;  3F6V A;  3FXQ A;  1P2F A;  1WWX A;  3V7R A;  2B0L A;  5BMZ A;  4L0Y B;  1U8R A;  3F8N A;  5F64 A;  2GXG A;  1STZ A;  2A69 F;  1H9T A;  1SMT A;  1KQ8 A;  4KNY A;  1TQI A;  2Y75 A;  1H9G A;  2K86 A;  5DDG A;  5L3F A;  3NQO A;  3FMS A;  1ON1 A;  5FFZ A;  1R1U A;  2FSW A;  3MEX A;  2P7V B;  2UWM A;  1FY7 A;  3BPX A;  3LWF A;  2FF4 A;  1SAX A;  1P4X A;  3E6M A;  3TO9 A;  1IN8 A;  1LEA A;  3VOE A;  3CUQ A;  2KIM A;  2Z99 A;  2VC0 A;  3V7S A;  1TQP A;  3V7C A;  1YTY A;  2EFQ A;  2V79 A;  4A12 A;  1UHW A;  1ZG5 A;  3R61 A;  3RJP A;  4RB1 A;  2JPC A;  1D8K A;  4Y15 A;  4BXU A;  1ZAO A;  2J5O A;  2OD5 A;  3F8F A;  1GXQ A;  1HST A;  1WI9 A;  4U7D A;  1U6G A;  1G3W A;  3DPL C;  2Q2E A;  1OR7 A;  4RAZ A;  3E3V A;  4HV6 A;  5HVQ C;  2D1H A;  1FT9 A;  3MAJ A;  5E8I A;  4A0X A;  3TOA A;  5JHU A;  3GX4 X;  1K6O A;  1FPQ A;  2M30 A;  2XAS A;  2OQG A;  1FC3 A;  3F6O A;  5K5O A;  1E2X A;  4M9X A;  2QUF A;  2L4M A;  2RQP A;  1TW2 A;  4F7Z A;  4WXC A;  3HOT A;  2IP2 A;  1B9M A;  2FXA A;  3ULQ B;  3M8F A;  5J6X A;  2A07 F;  1KGS A;  3PFI A;  2P4W A;  4N0B A;  3EUH A;  1BC8 C;  3HHH A;  3N97 A;  4P55 A;  4RGX A;  5LBQ A;  1DP7 P;  3LAJ A;  1UHM A;  4A5N A;  3ZQ7 A;  4I02 A;  1X3U A;  4ZYG A;  5E17 F;  4ESF A;  5CVU A;  1XSV A;  2F5D A;  4N9I A;  4UHT A;  1W5T A;  2YSR A;  1FBS A;  4HYE A;  4B8X A;  3GZ6 A;  3EET A;  2NNY A;  5D5V B;  3BP8 A;  2EFW A;  5FD6 A;  2WTE A;  1SD6 A;  3BDD A;  4HZF A;  3F3X A;  4PDK A;  1I6X A;  3WTS C;  2YX4 A;  4IRI A;  4OU0 A;  3P9I A;  1Z05 A;  3W6J B;  2VBW A;  1G3T A;  1L3L A;  5FB2 A;  2DTR A;  1WSU A;  2J5P A;  4DQ2 A;  1SFE A;  3KEO A;  4LLL A;  5HS8 A;  2BGC A;  1LVA A;  5D4S A;  3W6K B;  1KQ9 A;  1IZ1 A;  1R5G A;  2XHK A;  5LLQ A;  3COA C;  5HS9 A;  4XLN F;  1P4W A;  2G7H A;  5CVR A;  1G3Y A;  2YX7 A;  3RKW A;  1G3S A;  2VBZ A;  4BHP A;  5K1Y A;  1FSH A;  1S8N A;  1U78 A;  2ZFW A;  4PGH A;  4WK8 F;  1VTN C;  3E5U A;  2ZXJ A;  2CQK A;  2FOK A;  4ENN A;  4PZJ A;  4I01 A;  2OZU A;  3GXO A;  4IVN A;  1ZRD A;  1IN6 A;  2R7F A;  4BQA A;  3ML6 A;  2Y48 A;  3QPT A;  1DPR A;  5H6R A;  4EJO A;  1LB2 A;  4ENM A;  5TRD A;  3WTZ A;  5JVT A;  1IN7 A;  3GO5 A;  2EFN A;  4G9Y A;  5CVI A;  5FFX A;  1ZLK A;  2YPR A;  2HOE A;  4CGZ A;  2W24 A;  3GFI A;  4GXO A;  2NS0 A;  2BEO A;  4HOB A;  5DV5 A;  3KE2 A;  2A5Y B;  3KP4 A;  3WU1 B;  3O2P E;  3WOD F;  1XGM A;  1BN5 A;  1GXP A;  3GFJ A;  2ZME B;  2GIV A;  2QQB A;  1USS A;  4CYD A;  1PP8 F;  3BZ6 A;  1QGP A;  2XGX A;  1HKQ A;  4M72 A;  1XGO A;  2RV8 A;  3JAM Z;  4YIF A;  3CO6 C;  5D6F A;  5CVV A;  2HYG D;  1SD4 A;  2D1V A;  5D5W B;  2L02 A;  1F4K A;  3CO7 C;  2E7X A;  2H6C A;  4WXH A;  3GYH X;  4HLX A;  2QEN A;  3MZY A;  4R79 A;  2OAZ A;  4ZYE A;  2COM A;  4CZZ A;  3C3W A;  3KLN A;  4EM0 B;  1P92 A;  3ELK A;  1KYW A;  3IC7 A;  2BYV E;  4HLY A;  4RAY A;  1ZH5 A;  1W7P D;  4P9F A;  2CG4 A;  4EMS A;  1J7K A;  1OMI A;  4LK1 F;  2IRF G;  1BIB A;  2RKH A;  5L3C A;  4P5O A;  2ZBK A;  2HQR A;  4L9J A;  3HHG A;  2PN6 A;  1TBX A;  5CYV A;  1W7P A;  2CGP A;  2BV6 A;  2FML A;  4LMY A;  2WV0 A;  2JT1 A;  2EK5 A;  5HLH A;  1SD5 A;  1MGT A;  1O57 A;  1LEB A;  3WU0 A;  1IW7 F;  4HQE A;  1RZ4 A;  5E1X A;  3ZPL A;  3WGI A;  2IA1 A;  2F2E A;  2EA2 A;  1UFM A;  4NHJ A;  2IPQ X;  5LHH A;  3FXR A;  5J8F A;  3I54 A;  2KJB A;  2DK8 A;  4HF2 A;  3OOP A;  2VT3 A;  3E6C C;  1F5T A;  1S7O A;  4XLP F;  3P7N A;  1EH6 A;  2GZW A;  2VBY A;  3K2Z A;  4ZZL A;  4ASN A;  1EV7 A;  3QPH A;  2GXB A;  3U1D A;  3KCC A;  1YQA A;  3C7J A;  2XAH A;  2EV0 A;  1T39 A;  3LA2 A;  1XMA A;  1MDM B;  3CDH A;  3LAP A;  3E6B A;  2STW A;  1L0O C;  2P6T A;  1S29 A;  4Z2Y A;  2Q8K A;  4N9H A;  1XMK A;  2F5F A;  1V3F A;  1EH8 A;  3ZN0 A;  4LG0 B;  1OKR A;  4ENK A;  2PJP A;  1O3T A;  1LQ1 A;  4UXN A;  3H3Z A;  2HR3 A;  3SZP A;  2ZO4 A;  2KRF A;  2PMU A;  4WF2 A;  2P8T A;  3WTY C;  2CW0 F;  4ENJ A;  3K9T A;  3KP2 A;  4U0W A;  1EH7 A;  5D6E A;  2UXX A;  3DP7 A;  1B9N A;  2QBY A;  4BH9 A;  3L09 A;  2M87 A;  3I4P A;  1XSX A;  2IT0 A;  1NHA A;  1MD0 A;  1DDN A;  3IHU A;  2FQ3 A;  2PFB A;  4QWQ A;  1A04 A;  3KZY A;  4HF1 A;  3FX3 A;  1BM9 A;  2O3F A;  5D5U B;  3JAM K;  2FA5 A;  2ESH A;  5EEH A;  1U2W A;  3RKY A;  3RYR A;  3BOQ A;  3TO7 A;  3KFW X;  4Q5S F;  2ISZ A;  5E1Z B;  4S05 A;  1MKM A;  2AS5 F;  1ZLJ A;  2VOP A;  3I5U A;  1XB4 A;  2CWE A;  3WE2 A;  1R1V A;  1TNS A;  1B59 A;  3SHF A;  1SD7 A;  1XCB A;  3HUG A;  1SFX A;  4IHS A;  2VN2 A; 
#chains in the Genus database with same CATH topology
 4G94 A;  3BG5 A;  1R36 A;  4XLC A;  2K9S A;  1SFK A;  1Z91 A;  3A03 A;  3OIO A;  5IP7 J;  3LA7 A;  4V2G A;  2Y9Y A;  1BW5 A;  1I1G A;  3IRQ A;  2XPU A;  3CUO A;  5ED4 A;  4F93 B;  1LDJ A;  2L5Q A;  2COB A;  4ESB A;  1QVU A;  2JZY A;  4HG2 A;  1JT0 A;  4OIR F;  2ME6 A;  1YRN B;  1IN5 A;  2IGN A;  2ZJR F;  3LA3 A;  3HYI A;  4I2O A;  4LB6 B;  4AC0 A;  1O3Q A;  4M3D A;  5DCM A;  4NQW B;  1PUF B;  1MDM A;  4EQQ A;  3RKQ A;  3WGG A;  5L3E A;  2BY3 A;  4C2M J;  2HZT A;  4G6Q A;  1FP1 D;  2BBY A;  2W7N A;  1RET A;  1XPX A;  4RM3 A;  2LR8 A;  5E20 A;  2X1D A;  1WJB A;  1KA8 A;  3R4K A;  4BE0 A;  2F5V A;  1OLT A;  1EA3 A;  3T1B A;  4AYB N;  2DPD A;  1V54 H;  2IEK A;  4E70 A;  4XLH A;  3B73 A;  2EA4 A;  1JE8 A;  4Y17 A;  1R9T J;  5IT3 A;  3L2R A;  3G73 A;  3I9V 2;  3LSK A;  3OIP A;  4M6Y A;  2R7U A;  3K0L A;  1FYK A;  1ZGJ A;  3OSF A;  2O03 A;  1BC7 C;  1HSJ A;  1MBF A;  4DYR A;  2L9R A;  5ICF A;  5ILS A;  1HKS A;  1O7L A;  2BOL A;  2K9L A;  2HFH A;  4XQF A;  3BG7 A;  4KUM A;  3I56 I;  4A6E A;  2HQ5 A;  1E3O C;  2XAG A;  1QBJ A;  2QQ9 A;  4M3F A;  4L9T A;  3CJQ B;  3OWT A;  1UAA A;  3K2A A;  2QM3 A;  2VON A;  2LSO A;  1FMW A;  2ZXI A;  5M5X J;  1S7A A;  2MAB A;  4HF0 A;  5L3D A;  4E6K G;  3CCS I;  4EM1 A;  1JUM A;  4MLO A;  3J7Y J;  4AVZ A;  2EJR A;  3JTG A;  1ZR2 A;  1K4S A;  3LST A;  3ZMS A;  3HKZ A;  2O8K A;  2XDV A;  1H8A C;  4MQ9 F;  3D5S C;  3DFG A;  1GDT A;  1TTY A;  4XNF A;  2W85 A;  5FLV A;  1CQT A;  3M9A A;  3IKV A;  2Y2Z A;  2ZC2 A;  4ANJ A;  2D2W A;  2QA4 I;  1J5Y A;  3C2H A;  4PJN A;  5CVJ A;  3P9K A;  1XMX A;  2CV0 A;  3NAU A;  4Q4Z F;  2FBI A;  2R7X A;  2Y0M A;  4GCV A;  2VT2 A;  1U3E M;  3L1P A;  2MA3 A;  2KJC A;  3U9G A;  1I3A A;  4BE1 A;  3EQL F;  2XGD A;  1CGP A;  4U7B A;  1ODD A;  2O6G E;  1HQC A;  2TDX A;  1O3S A;  2M8E A;  2DYR H;  1NK2 P;  1JKO C;  1NTC A;  3CJT B;  3KLO A;  1DGR M;  3X2Q H;  5LRR A;  1RI7 A;  1UHS A;  4MGR A;  3H35 A;  1U9O A;  4DYQ A;  4E7S A;  3S16 J;  2PLY A;  4KFC A;  3HSR A;  1BR1 A;  5JI6 A;  5BOX A;  4O6J A;  3ZMU A;  1I39 A;  4D0P A;  2K9N A;  4XSZ F;  3I59 B;  3R0A A;  1YE9 A;  4M6X A;  2EFO A;  2M2E A;  2VXZ A;  4CDG A;  3H3U A;  3FF5 A;  5ICC A;  4UUV A;  2LKX A;  4L5J A;  4CA0 A;  2DLL A;  2QF7 A;  4I98 B;  2V1X A;  4KIC A;  2VBX A;  3KP3 A;  1TL8 A;  3WU2 C;  5JFR A;  2V26 A;  3AAF A;  4CYC A;  1OYW A;  3Q9S A;  2LC2 A;  3ISP A;  5D8L B;  3DQV C;  2EWN A;  4DW6 A;  2BZT A;  5M5W J;  2QKM B;  2LF7 A;  5DUK A;  2BVM A;  5ILU A;  2E5Z A;  2L7M P;  3LQR A;  5M5Y J;  3S3M A;  1LPQ A;  4NQW A;  3SJM A;  1PUF A;  2QQA A;  2LMD A;  4JX4 A;  2WAQ N;  3TP0 A;  1SEU A;  1R22 A;  1FYL A;  3A1Y A;  2LRD A;  2KZG A;  5BQT A;  1ZN2 A;  2A6T A;  3JW4 A;  3R6S A;  4P1W A;  3BRO A;  2KRC A;  1GLN A;  2X85 A;  3K4J A;  3Q0V A;  4RGR A;  2HTS A;  4L9V A;  5GPC A;  1FEX A;  3ZOB A;  3OYF A;  4M74 A;  5A2Q Z;  2BY1 A;  5DUI A;  4RB2 C;  4FE7 A;  3WHB A;  1HCR A;  1QQI A;  3OYC A;  1O7F A;  1DU0 A;  4P96 A;  2WY7 Q;  3KP6 A;  1ZR4 A;  1UG0 A;  3FXL A;  4CIC A;  4BAC A;  4FIS A;  3KEY A;  2CH0 A;  1WH7 A;  3E5X A;  3VB2 A;  4IF4 A;  3CZ6 A;  4OIQ F;  5F6F A;  5IYB J;  4GYG A;  3L00 A;  1ZHF A;  4NBQ A;  3BZK A;  2YR2 A;  4LIV A;  1HKT A;  4S0H B;  1R1T A;  2A6E F;  1VFC A;  2CS3 A;  3Q5F A;  5KNL A;  3HOS A;  1VND A;  3LSH A;  3ABM H;  3GLX A;  2DDA A;  2E1N A;  1OFC X;  2DFI A;  2JJ7 A;  2L2O A;  3VYR B;  3HG9 A;  3NWS A;  4PGG A;  3BPV A;  2JA5 J;  4KDP A;  4LGW A;  1FIP A;  4IEJ A;  4LLN A;  5JR3 A;  1BOA A;  2CYY A;  2HEO A;  4PJL A;  1FJL A;  1PUE E;  4LK0 F;  2DYS H;  1ULY A;  2LP0 A;  2H09 A;  1QO0 D;  1XDS A;  3L2C A;  1VQO I;  4D5F A;  3GTP J;  1FTZ A;  1OYI A;  2IVM A;  3JSO A;  2DMQ A;  1G8X A;  3RDI A;  3H3V K;  5EJC A;  3CJN A;  4BHC A;  1TLH B;  2XVC A;  3I0T A;  1YW7 A;  1SFO J;  2H8R A;  5AIQ A;  1FTT A;  1IRF A;  2IXS A;  1JT6 A;  1YI2 I;  2O61 A;  4D1Q A;  1X1P A;  2R7R A;  3GWZ A;  4II3 A;  2OF7 A;  3WTW C;  2MH2 A;  3JRI A;  3BJO A;  1YO5 C;  4UVC A;  3PQJ A;  3V8J A;  4XK4 A;  3ZQH A;  5FJ8 J;  1P6R A;  3TDU C;  4GDF A;  1YJ9 I;  4YRV A;  1IRZ A;  1U8B A;  3F21 A;  1VQ7 I;  1FP2 A;  2Z1D A;  4G8X A;  3HIF A;  3QOP A;  2VOD A;  4BXF A;  3VFZ A;  3S3N A;  4A3L J;  1Z7U A;  4IHT A;  1YX3 A;  3D0S A;  3RTR A;  3BZC A;  2A61 A;  3FMQ A;  2DA1 A;  4PUS A;  1KU9 A;  4XKC A;  4OIN F;  3HC7 A;  1YS7 A;  1IF1 A;  1WPK A;  2W57 A;  4I0A A;  1ETY A;  3HEF A;  2OUM A;  1MND A;  1X3Z B;  4ZDO A;  5B1B H;  1QZZ A;  3U21 A;  5C4J J;  3PNT A;  3I59 A;  4AD9 A;  5ICG A;  4HQM A;  1LFP A;  2FU4 A;  3ROU A;  2FQ4 A;  2WA0 A;  5LGU A;  2JN6 A;  2A05 A;  2K9M A;  1C0W A;  4GO1 A;  5E8G A;  2UZK A;  2VQH A;  1YYV A;  3L2U A;  5FLX Z;  2JVG A;  2X48 A;  5H2F C;  4A3G J;  5H20 A;  4M3E A;  1YG2 A;  2EQR A;  4UNO A;  3KZI C;  3TKY A;  2XKO A;  4L5E A;  3K1M A;  1JJ6 C;  4QPQ A;  3IAM 2;  1YW8 A;  4QIW N;  1UG2 A;  3P5J A;  3AFH A;  4L18 B;  4MEY F;  3BJ6 A;  3S8P A;  4I0B A;  1R4N B;  5DEQ A;  3ZP5 A;  4J01 A;  1ETX A;  2LRE A;  3CMM A;  1R5I D;  3GVA A;  4E7H A;  1VQ5 I;  5D5X B;  1HDP A;  3LNQ A;  2F5E A;  2Q1Z B;  2V9K A;  4MFD A;  4NB5 A;  3PIO F;  1HXD A;  3GTO J;  2FEZ A;  4EV0 A;  3O8H A;  5DS9 A;  3O6B B;  2DW4 A;  1F1Z A;  2FNP A;  1R49 A;  2W84 A;  1V4R A;  3AG3 H;  1T2K A;  4XSX F;  4CSW A;  3BTI A;  4B4C A;  4A3E J;  5CLS A;  1TP4 A;  3C2G A;  3WGH A;  5B1A H;  5J47 A;  1XTA A;  3JTH A;  3FK6 A;  4MEX F;  1FBU A;  2GBY A;  1UST A;  2V1U A;  3N4M A;  3H9G A;  3K1P A;  3FXU A;  2GM4 A;  3GFL A;  1HOM A;  4RS8 A;  2CQN A;  3ZQC A;  4UV9 A;  1ONV A;  4DIQ A;  3S93 A;  3HPH A;  1HW5 A;  2ID3 A;  3ZRG A;  4AIK A;  3OL4 A;  4E4H A;  1MZB A;  4GYI A;  2VLA A;  2HZD A;  3DTK A;  5F04 A;  1O4X A;  3ERE D;  2LBF A;  1E0E A;  3KEQ A;  3IL2 A;  3JRA A;  3EUK L;  2DQL A;  1WQ2 A;  2QWW A;  2VB6 A;  5LGT A;  5M3M J;  4EEF G;  2DA6 A;  1K78 B;  2RNJ A;  2HS5 A;  1A35 A;  4FCY A;  2E1C A;  1WJE A;  1SVO A;  2GOX B;  1XGN A;  2ZB9 A;  3HRU A;  2CSO A;  1LNW A;  2QSH X;  4U87 A;  4B44 A;  2JTV A;  1YW9 A;  2LFB A;  3TOB A;  2P5L C;  2VQG A;  2A5W A;  2Y31 A;  2VE8 A;  4RB0 A;  2IS6 A;  3G2B A;  1IJW C;  3MKY B;  1Z1D A;  1WCM J;  2Z9O A;  3AG1 H;  3ZMV A;  4M3G A;  3HDD A;  1A6Q A;  1RNL A;  5EDN A;  2WY8 Q;  2QEX I;  4IZZ A;  2GQQ A;  3ZQI A;  1FWZ A;  3CCJ I;  4RM2 A;  3IUO A;  4BDZ A;  2ETH A;  5JLW A;  4IHW A;  2WWY A;  1BBY A;  2UV1 A;  4HW0 A;  5A2Q K;  9ANT A;  1EF4 A;  1TT5 B;  3FKJ A;  5BPI A;  2O7O A;  2DA3 A;  3RPU D;  2OV7 A;  3B02 A;  5GTH C;  2K7L A;  3J81 Z;  2JSC A;  4D7M A;  2NVX J;  4V2F A;  2LY9 A;  3EDP A;  1XN7 A;  2ZME A;  3GBG A;  2KLO A;  4NDL A;  2RRE A;  2L54 A;  3SFZ A;  1TWF J;  5GAD J;  4E7Z A;  3G4S I;  4B09 A;  3ABK H;  3BR6 A;  3GTQ J;  1WJA A;  3VEP A;  2XV4 S;  4RAF A;  4D5C A;  4OMZ A;  4XID A;  4Y13 A;  1TQM A;  1A36 A;  3K4K A;  5LHI A;  1K4T A;  1REP C;  5LHG A;  3T8T A;  1MJ9 A;  2W4S A;  3G1M A;  1W0T A;  3IRR A;  4O3M A;  2L01 A;  3K4M A;  2TRT A;  3RPU A;  3DPT A;  2DAO A;  5CJ9 A;  3T5X A;  3G6E I;  3A0H C;  4BJ6 C;  4YG2 F;  2GXA A;  4I09 A;  3CUQ B;  4AVP A;  4O5V A;  2E35 A;  5DD8 A;  2XSJ C;  1JKR C;  3HGG A;  3RSN A;  3FM3 A;  3OYA A;  4ZYH A;  1XGS A;  3F9K A;  1R23 A;  2H6B A;  2FBH A;  4CXF A;  2HKO A;  4G7H F;  4BNC A;  3RPQ A;  5HDK A;  2HGC A;  4BQO A;  2VL8 A;  3FKI J;  5AIP A;  5FKM A;  1HF0 A;  1VQL I;  3GF2 A;  3TQN A;  2I10 A;  1G2H A;  4RBO A;  1AWC A;  4FHT A;  1LJ9 A;  2BVL A;  2VPR A;  3M4O J;  4DZJ A;  1ETV A;  4EGY A;  1PP7 U;  1XDU A;  1BI2 A;  2MLG A;  5ICE A;  3UKG A;  3PO2 J;  3I4N J;  1FLI A;  2HKX A;  3PIP F;  1K7A A;  1U0J A;  4CCO A;  1XC5 A;  4C30 A;  1KU7 A;  1T8I A;  4TV7 A;  2XB5 A;  3KZZ A;  2X0L A;  2WAE A;  2FUG 2;  4BL0 B;  3KYC B;  3FXM A;  3WHC A;  3IKT A;  3BR0 A;  3WTV C;  2BY2 A;  1IXR C;  3DU5 A;  3VPR A;  2M3A A;  3HB9 A;  3I58 A;  4A0Z A;  4ZYD A;  1XCV A;  2Q2E B;  2O0Y A;  1FNN A;  2IS4 A;  4PCQ A;  1V5G A;  3DF8 A;  2K40 A;  2XRN A;  2R7O A;  3KIO A;  4Y3O A;  4XIC A;  3ZQQ A;  5HOO A;  2K5C A;  2LF8 A;  1W4M A;  3DV8 A;  2E1O A;  2KDZ A;  3PJR A;  3PM1 A;  2XKP A;  5FLX K;  1NK3 P;  4LOC A;  1AKH B;  4M73 A;  4HST A;  1OCO H;  1WRJ A;  2EV5 A;  1IC8 A;  2X6X A;  2NVQ J;  5GAG J;  1V5F A;  1F36 A;  3IWZ A;  3GZN B;  1GHC A;  2V9V A;  4XON A;  5TIS C;  2KIQ A;  2MD5 A;  2R7S A;  5EGO B;  2RQQ A;  5D4R A;  1DUX C;  2EZH A;  5IP9 J;  2A68 F;  3W2V A;  2ZCW A;  5KVR A;  2QYO A;  3BCB A;  2ZXW H;  4KA4 A;  3WG7 H;  4PK4 A;  2VKV A;  4BGD A;  1RUN A;  3KET A;  4BUP A;  2P6S A;  3F8M A;  3V8K A;  3PQK A;  3OYD A;  1APL C;  1K79 A;  4ZC3 A;  4KIF A;  4G6D A;  4NC7 A;  4WCG A;  2P0W A;  5IY5 H;  2R93 J;  2AXT C;  3WG9 A;  3ZMT A;  1VQ6 I;  3BG6 A;  3HL2 A;  2E34 A;  5K5R A;  1E3P A;  3FM5 A;  2K27 A;  3K1N A;  3WTX C;  5E18 F;  3M7G A;  1MW7 A;  5F08 A;  3VSL A;  4G12 A;  4H4K C;  4QPO A;  2PEX A;  3OR2 C;  4Z6Y A;  5K7H A;  2VAS A;  2UXN A;  2G9W A;  3IH4 A;  3M1C A;  2DPU A;  1H0M A;  2JVH A;  3ABT A;  1R5H A;  3T8R A;  1VQN I;  2K9Q A;  3GEZ A;  3Q9V A;  1M1E B;  3R60 A;  1JTY A;  3MQ0 A;  2HVR A;  2E7W A;  5DYM A;  1T08 B;  2ZSH B;  5CQE A;  3I64 A;  3OYM A;  4LIT A;  4KIB A;  5FRM A;  4IXA A;  4IQ4 A;  4CCJ A;  2LY2 A;  2XGC A;  1OYY A;  3BJA A;  3REO A;  2DOE A;  2H27 A;  3RIR A;  4CZC A;  2L9N A;  1BI0 A;  2HDW A;  3LFU A;  3R0J A;  4HV5 A;  4W97 A;  4YII A;  1KYZ A;  4DNC A;  2VIX A;  2DFH A;  4PSW A;  3GUD A;  2H8W A;  4EJV A;  3QYE A;  1ACI A;  1FIA A;  2X9D A;  3I53 A;  4OIP F;  4MNU A;  4X0G A;  3C1D A;  3L2W A;  2W82 A;  3LL7 A;  3DWL E;  3O3K A;  1I1S A;  3MD2 A;  2MLK A;  4Y33 A;  4EGZ A;  1NH3 A;  2JWT A;  1KU3 A;  1QZY A;  4R8H A;  3ZQL A;  5EZG A;  4FET A;  4RLF A;  5FRN A;  1Y8Q B;  4WX9 A;  4LG0 A;  2EZL A;  3LSG A;  2NYX A;  4HBL A;  2B7E A;  2JPB A;  3GTG J;  2EB7 A;  1AA7 A;  1HW1 A;  2L9V A;  3MKL A;  3PSI A;  4EJT A;  1KU2 A;  2MBF A;  2P5V A;  1SAU A;  4BEH B;  4CCK A;  1D3Y A;  3S2W A;  3QOE A;  3ZR8 X;  2PBI A;  2ME0 A;  3HM5 A;  2NXN B;  1SVM A;  4HX4 A;  2BE5 F;  2XUB A;  4WXD A;  4BBS J;  2PJR B;  1IV8 A;  2CW8 A;  2QZ8 A;  1LKX A;  3K7A J;  3K70 D;  1MH4 A;  2AHQ A;  4H0E A;  4IRG A;  2E1M B;  1J9I A;  1IN4 A;  3JSP A;  2R5Z A;  2X6W A;  3LMM A;  4IHX A;  3KP7 A;  4AIH A;  1YLF A;  3CCR I;  5LEJ A;  2ELH A;  3F8C A;  3IAS 2;  3FHZ A;  4KYW A;  3RYP A;  4LB5 A;  1WVR A;  3QP6 A;  1Y39 A;  2ECB A;  1IRG A;  2R5Y B;  4C2T A;  2EH3 A;  2KL4 A;  3ASO H;  4A3D J;  4IRH A;  3J81 K;  1J2X A;  3DEU A;  4W1U A;  1FZP B;  4UUS B;  3DBH B;  4N4O B;  4PFO A;  4G7Z F;  1MJA A;  2A6H F;  5E3M A;  5EG0 B;  1ON2 A;  1ZYR F;  5BS6 A;  5HDG A;  4YFX F;  2M5W A;  3CUQ C;  3I55 I;  2HVS A;  1D0Y A;  2XAJ A;  4ABZ A;  3OV8 A;  1CF7 B;  1JHF A;  3ZMD A;  2XRL A;  3VSK A;  5HDN A;  3DBL B;  3J80 K;  3HOU J;  2VI6 A;  3IV5 A;  1WKM A;  2CUZ A;  4XKW A;  1X58 A;  4IO9 F;  4JQF A;  1YJW I;  4L9N A;  3F22 A;  4Q48 A;  1TNT A;  5TJJ A;  1SMY F;  4MTE A;  3ZN1 A;  5IOZ A;  2KP6 A;  3HRT A;  3MCZ A;  4CCM A;  5FKK A;  3V42 A;  1FYM A;  5JLX A;  4LLG F;  2XC7 A;  4F55 A;  3SYT A;  4R1H A;  4NUB A;  5HNH A;  1XS9 A;  2AO9 A;  4XOR A;  3MZH A;  2FNA A;  3OS2 A;  4KMU X;  4MHG A;  1HBX G;  1MNE A;  4HDV A;  1LDK B;  4BAY A;  4GFB A;  2CFX A;  2MC3 A;  1ZRE A;  5K5Q A;  4HX7 A;  2PMH A;  2PG4 A;  2WB1 A;  3CP8 A;  3E5Q A;  2IJL A;  3FIW A;  1BOB A;  3PUF A;  4CH7 A;  1Z67 A;  1OR7 C;  2XGE A;  3FHN A;  3GTL J;  2HYF A;  2XRO A;  2OU2 A;  3MFK A;  1MMD A;  5IT9 K;  3MWM A;  2OQR A;  1NG6 A;  2NNN A;  1R58 A;  1ZK8 A;  4AUX A;  3HSF A;  3K4N A;  4L5I A;  4IL6 C;  2BW3 B;  5E3N A;  4UVA A;  2ISY A;  1X4P A;  2LNB A;  3NRV A;  2P5K A;  3FMR A;  2EPF A;  4AIJ A;  3AL0 B;  4XKB A;  4JBA A;  1D0Z A;  2HWV A;  1RIO H;  4PFP A;  4WWC A;  2IA2 A;  5HLG A;  1YRN A;  2EIK H;  3JCU C;  3G71 I;  3L2Q A;  3O8G A;  3K70 C;  4EVI A;  3BTC A;  2MH9 A;  2Z33 A;  3DXJ F;  4M71 A;  3M8E A;  2F4I A;  3TBI A;  2FOW A;  3V8L A;  5IYC J;  3GTM J;  1D8J A;  1S6L A;  4A2U A;  1WI3 A;  3E97 A;  2DO7 A;  3PSF A;  3TGN A;  4YFN F;  4Y52 J;  1IRX A;  2QVO A;  2W00 A;  4ZH4 F;  3TW7 A;  3M1E A;  3QU3 A;  2HTJ A;  3SXY A;  4ZZD A;  4C2U A;  5E1W A;  1IAW A;  4CHU A;  4UB8 C;  2OTJ I;  1R7J A;  1B8I B;  3UR3 C;  2K85 A;  4E7L A;  3MVP A;  2ACJ A;  5FKO A;  5F1J A;  5FD5 A;  2H1K A;  3EUH C;  2IW5 A;  4XRS G;  1B4A A;  2ZSI B;  1G4D A;  1W5C C;  3SZT A;  1J75 A;  3K4L A;  2RGV A;  2LKP A;  4DZP A;  1J09 A;  3CLO A;  4X1E A;  3QU6 A;  2M8G X;  3ABU A;  2PJR A;  1I6H J;  2PMZ A;  2QSG X;  2R92 J;  1W5S A;  4II2 A;  3T0Y A;  2ELJ A;  3CQZ J;  4IOA F;  1JI8 A;  5L3B A;  3I71 A;  3LQQ A;  2RN7 A;  1XSD A;  5L3G A;  3QYF A;  1ZEL A;  2MG4 A;  2O5R A;  4XR6 A;  4ON0 A;  1U5T B;  3DEW A;  2R5Y A;  4HAM A;  2DQR A;  1JUP A;  2G7U A;  2R7W A;  3EYI A;  1Z6R A;  1UB9 A;  3DPU A;  3DEE A;  5DD4 A;  2X6O A;  1V5E A;  3HSE A;  2CFO A;  2R0Q C;  5EG0 A;  2M45 A;  2L3D A;  4XMY A;  2FRH A;  4DOZ A;  3KYL A;  1RKT A;  4HDU A;  2VOO A;  2FJ1 A;  2VJ5 A;  2YU3 A;  1CF7 A;  4FX0 A;  2QSF X;  2CQ7 A;  2MD0 A;  2NVY J;  2QQ8 A;  2HU9 A;  4FQG A;  3A01 B;  4IPA A;  3TO6 A;  3RZO J;  3OY9 A;  2M1B A;  3G1L A;  2OBP A;  4JX5 A;  3ZQF A;  1X3W B;  1WGX A;  2VKD A;  3Q0U A;  3TED A;  3ESW B;  4IX7 A;  4CCN A;  2KKO A;  2LDU A;  3HKZ N;  2HOT A;  3BY6 A;  3MMY B;  3OS0 A;  4RGU A;  2Y69 H;  4RGS A;  3DTE A;  3WE3 A;  2DA4 A;  1BI1 A;  3AG2 H;  1KZH A;  1X1B A;  3HRS A;  2E1M C;  2LK2 A;  1I5Z A;  3GLL A;  2XAQ A;  3F72 A;  2XAF A;  4IQJ A;  1MIJ A;  3HTU A;  2BY0 A;  4U88 A;  6PAX A;  4I76 A;  4K2E A;  1W7P B;  4CO8 A;  1ZQ3 P;  2VPL A;  2PQ8 A;  3HRM A;  3CC2 I;  2JA2 A;  2WAF A;  2FX0 A;  2GAU A;  3BCA A;  4RAG A;  3SDG A;  2V1D A;  4Q47 A;  4A0Y A;  2D45 A;  2Y9Z A;  1VZ0 A;  1B72 B;  2F48 A;  5H6Q A;  2FMY A;  3JRG A;  1ENH A;  2E36 A;  4MIM A;  2O8X A;  3HJE A;  3HZJ A;  2GLO A;  4BYY A;  2K4J A;  3L9F A;  4JP0 A;  1QNT A;  4DBR A;  2ADU A;  5LEK A;  2IGM A;  3MZ8 A;  2RVC A;  2X4H A;  1WJ5 A;  3J7Z I;  2MGQ A;  4HPQ A;  3TDZ C;  2PI0 A;  1LDD A;  3GW2 A;  3K69 A;  4RMN A;  4N4N B;  4L0Z B;  4IJA A;  1MBK A;  1R71 A;  4BKX A;  4PSX A;  4U0V A;  3OSG A;  1ZG3 A;  2Z3Y A;  3ASN H;  2JRT A;  3DKY A;  3FZV A;  5D8K B;  2VE9 A;  2AQE A;  2V6C A;  1T6S A;  2RC4 A;  3CTA A;  3LSM A;  3NEU A;  3QAH A;  1FX7 A;  1FOK A;  1JGS A;  1GVJ A;  1MMA A;  1Y6I A;  4XBF A;  1B8I A;  1A5J A;  1DPU A;  2HDC A;  2JQ7 A;  4LD5 A;  1F9N A;  3VOD A;  2DI3 A;  1Y1W J;  2ECC A;  4D7N A;  2NAZ A;  2N8G A;  2R7T A;  1KQ0 A;  5K7Z A;  3ECH A;  1BJZ A;  2I5U A;  3V4G A;  4HNT A;  1EJ9 A;  4BQQ A;  3HOY J;  1B6A A;  2K02 A;  2NS7 A;  4LJZ F;  1T0F A;  4KN7 X;  4ETS A;  4A5M A;  2Z2S B;  1JXS A;  2GA1 A;  1YS6 A;  1JUS A;  4OIO F;  2P7C B;  2KPM A;  1YFH A;  2FE3 A;  5EEG A;  1BIA A;  2DDB A;  1U5T A;  3EUA A;  3OYB A;  4XRF A;  2KHM A;  3L2V A;  3AL0 C;  5IOY A;  2RDP A;  4YFK F;  3HOZ J;  4C3J J;  2MFZ A;  3VDX A;  4IKF A;  2WC2 A;  1MMS A;  1P4A A;  4M9S A;  3RKX A;  2A3S A;  2ESN A;  3OOU A;  1MBJ A;  3FWE A;  1WJC A;  2VUM J;  3E6D A;  2EFP A;  3OYG A;  2CV1 A;  1OCP A;  5HS7 A;  2F5C A;  3L7W A;  1VF9 A;  3LSI A;  4MO7 A;  2STT A;  4AWX B;  2EV6 A;  4HEA 2;  2QCO A;  2WBM A;  2Z5U A;  1T95 A;  1IG7 A;  2CQQ A;  3PFY A;  3TW6 A;  1E17 A;  2R3S A;  4V19 K;  4YEL A;  2NRA C;  4AID A;  1OPC A;  2RNG A;  5AON A;  3K10 A;  2IS2 A;  4OAZ A;  4F91 B;  1LFU P;  2V1N A;  3BR3 A;  2F6C A;  2ZKZ A;  1BI3 A;  3SQN A;  1QU3 A;  1ITY A;  3CDL A;  4P9U A;  2OA4 A;  4OMY A;  2CQX A;  2X6Y A;  2QBY B;  5LGN A;  2Y0S A;  3B6A A;  1WJD A;  1N75 A;  5LRS A;  1LFB A;  4U0Y A;  2XIG A;  3HTS B;  1ZRF A;  3ERM A;  4C3I J;  1P9Q C;  1B1B A;  1T0F C;  2GWR A;  4XL9 A;  3QRF F;  3GZ5 A;  2DXI A;  1X4O A;  1Z6T A;  2HQN A;  2OZ6 A;  1JJ8 C;  5CKT A;  1H89 C;  2DT7 B;  1RUO A;  4BU2 A;  3SDB A;  1U5T C;  3W3C A;  4RLQ A;  1RKW A;  2ZNZ A;  3C18 A;  3DKW A;  1W1W E;  3S1R J;  4I7H A;  1IV6 A;  2IBD A;  2FBK A;  1HW2 A;  1Y0U A;  2DK5 A;  1D0X A;  4XN0 A;  1LE8 B;  3F8B A;  4ZDL A;  3OYJ A;  2M0M A;  2ZNY A;  3G1O A;  2KIU A;  3LFK A;  4HRI A;  1D5V A;  3D5L A;  3KP5 A;  3QP5 A;  2JUG A;  1MMN A;  3H0D A;  4BE2 A;  3NAR A;  3WTU C;  1MMG A;  3RI4 A;  4KIG A;  1BJA A;  3QYB A;  1MJB A;  4BS9 A;  1FMV A;  5ERI A;  3ZMZ A;  5C4X J;  3CLQ A;  2AXL A;  1F43 A;  1X2N A;  4HX8 A;  1J59 A;  1RC9 A;  3ONQ A;  3D5R C;  2R7D A;  3J80 Z;  1Z77 A;  3J7A O;  2HXO A;  1Z21 A;  5ILV A;  5FRO A;  1AOY A;  5HLI A;  1XD7 A;  2NOG A;  3P9C A;  4KMF A;  1SVL A;  5FGM A;  4HA8 A;  1SAN A;  1JHH A;  3BWG A;  4QLC U;  5LD2 C;  1FBQ A;  2CW7 A;  2L4A A;  4LFU A;  2K4B A;  1Z3X A;  4MTD A;  3GFM A;  3H5R A;  4A6D A;  1ZG1 A;  2DBB A;  5BPD A;  5F1R A;  3Q3S A;  1IUY A;  2CUE A;  2GA2 A;  3Q0W A;  2DU9 A;  5EZH A;  1IXS B;  5J8C A;  3S15 J;  3HUG B;  3SEZ A;  1I27 A;  4ESJ A;  2IA0 A;  2KIF A;  4XRM A;  1GT0 C;  4EAT A;  3F0C A;  3OYI A;  3OIQ A;  2VC1 A;  4FX4 A;  3ECO A;  2QLZ A;  4G7O F;  2ZJ2 A;  2H94 A;  1UMQ A;  3WTT C;  3CC4 I;  4AYB A;  2DOD A;  5DM6 F;  2DOF A;  5IT9 Z;  4KT5 C;  2E2H J;  2W48 A;  1MH3 A;  5J40 A;  1BR2 A;  2Q0O A;  3K4B A;  5F0F A;  1UCR A;  5DCM B;  4EM2 A;  3LSJ A;  1Q1H A;  4RB3 C;  5FO5 A;  2H1L A;  2PX9 A;  4UV8 A;  4KN4 X;  3CES A;  2X1E A;  1O3R A;  2X1C A;  4MQV A;  3CMY A;  2BXY A;  5J1R A;  1J0R A;  4FT8 A;  2W25 A;  4ITV A;  2NVT J;  1W36 C;  2JA8 J;  2XF7 A;  1TW3 A;  4KIT B;  4XLE A;  2NVU B;  1YIO A;  1VQK I;  1T33 A;  1RR8 C;  1ZRC A;  2HDD A;  4M9Z A;  4NC8 A;  1T98 A;  4DBQ A;  3H92 A;  2DOA A;  1IXC A;  3OR1 C;  2EIL H;  1S72 I;  3IWF A;  4A93 J;  1T38 A;  4UVB A;  2V4J C;  2KDO A;  1ZGA A;  4GGG A;  1G6N A;  3OS1 A;  3F23 A;  1K78 A;  1Z9C A;  1VQ4 I;  4XM3 A;  1SFU A;  4S04 A;  4EJU A;  4BQN A;  2KFD A;  5DCF A;  1QPM A;  1ZAR A;  5KK1 A;  1VQP I;  1PDN C;  4EJW A;  3G3Z A;  2C6Y A;  1R00 A;  2CO5 A;  3CD6 I;  2HI3 A;  3EYY A;  4OOI A;  1XG1 A;  3U2R A;  1QA6 A;  4JK1 X;  4BHB A;  2DT5 A;  3HBL A;  1FSE A;  3BQY A;  3E7L A;  5IYD J;  1S3J A;  3F6V A;  3FXQ A;  1P2F A;  1WWX A;  3V7R A;  4RA2 A;  5TGT A;  3DCF A;  5KAF C;  2B0L A;  2XSD C;  3FBN B;  5BMZ A;  3OYE A;  4L0Y B;  4QSH A;  1OJL A;  1U8R A;  3F8N A;  5F64 A;  2GOM A;  2GXG A;  1PVE A;  1STZ A;  1LE8 A;  2R7Z J;  2A69 F;  4JOM A;  5F0C A;  3OYK A;  1H9T A;  1SMT A;  1HA8 A;  1UZC A;  1KQ8 A;  4KNY A;  1TQI A;  2Y75 A;  4LG3 A;  1H9G A;  2K86 A;  4FTH A;  2UUZ A;  2R7Q A;  5DDG A;  5L3F A;  3NQO A;  3FMS A;  4RDU A;  1IGN A;  1TT0 A;  2R4G A;  3GME A;  4E7J A;  2IGO A;  1ON1 A;  1FOY A;  3C2B A;  5FFZ A;  4BJT A;  2E60 A;  1R1U A;  2FSW A;  3MEX A;  2P7V B;  2CV2 A;  3PNV A;  1SC7 A;  3OYN A;  1FY7 A;  2UWM A;  3M3Y J;  4X6A J;  3BPX A;  4I99 C;  3BTL A;  3LWF A;  2FF4 A;  1GUU A;  1SAX A;  3BG9 A;  1P4X A;  3E6M A;  3TO9 A;  2LG4 A;  1IN8 A;  2LY1 A;  3SEQ A;  1ETK A;  1LEA A;  2JK3 A;  3BLY A;  1AHD P;  3VOE A;  1QVT A;  3CUQ A;  4C9Y A;  2XAU A;  2KIM A;  2WAQ A;  2Z99 A;  2KQR A;  2VC0 A;  3DBR B;  3V7S A;  3GTK J;  1TQP A;  3SZG A;  3V7C A;  3CCL I;  4CYC B;  1YTY A;  2EFQ A;  2V79 A;  2HPI A;  3H1C A;  1G59 A;  1Z0X A;  1HDD C;  4JX6 A;  4A12 A;  3PO3 J;  2V9P A;  1UHW A;  3IP4 B;  2V6E A;  4QTR A;  3OMY A;  5BNG A;  3R61 A;  5JHF A;  1ZG5 A;  5GAH J;  2OTL I;  2DCE A;  3RJP A;  2DJI A;  4RB1 A;  5B5E C;  2JPC A;  1YHQ I;  1D8K A;  4Y15 A;  4BXU A;  2KIS A;  1RRJ A;  3S1N J;  1ZAO A;  4UUT A;  2J5O A;  3JRC A;  1ETW A;  2OD5 A;  3F8F A;  1ETO A;  1GXQ A;  2HYJ A;  3CF5 F;  3W2A A;  1HST A;  2OJE D;  2OCC H;  5K7F A;  1WI9 A;  1MBG A;  1N78 A;  4U7D A;  1U6G A;  3JRB A;  1G3W A;  3DPL C;  2Q2E A;  1OR7 A;  1TC3 C;  3JRH A;  4RAZ A;  3BT9 A;  3E3V A;  2JMW A;  4HV6 A;  5HVQ C;  2LLK A;  2VQC A;  2BHZ A;  1FT9 A;  2D1H A;  3MAJ A;  5E8I A;  2MC4 A;  3S1M J;  3U1K A;  1PJR A;  3QWL A;  1AKH A;  4DJA A;  1MSF C;  4A0X A;  1GV2 A;  2P81 A;  2NS8 A;  3KYD B;  1JGG A;  1GVD A;  3TOA A;  1RES A;  1T56 A;  5JHU A;  5DM7 F;  5EYR A;  1TWC J;  3DLL F;  2ZFU A;  3GX4 X;  1FPQ A;  1K6O A;  2M30 A;  3CME I;  2XAS A;  3D1N I;  2OQG A;  1D1B A;  5EGO A;  1OCZ H;  2BHY A;  1FC3 A;  3VWB A;  3F6O A;  5K5O A;  2B9S A;  1WJF A;  2DMT A;  3N05 A;  1E2X A;  4M9X A;  2QUF A;  2DFE A;  2JSP A;  4F92 B;  2L4M A;  1DGW Y;  3CCY A;  5KHD A;  1QPI A;  3M8J A;  1KON A;  3LSR A;  2RQP A;  3DKX A;  1TW2 A;  4F7Z A;  4WXC A;  3HOT A;  2IP2 A;  1B9M A;  1Q1V A;  1QHH D;  2FXA A;  3ULQ B;  3M8F A;  5J6X A;  2A07 F;  1KGS A;  3PFI A;  2P4W A;  3QPS A;  5GTI C;  3BC8 A;  4N0B A;  3JR9 A;  1D1C A;  3EUH A;  1BC8 C;  3HHH A;  3TP3 A;  1X1C A;  4DGW B;  3N97 A;  1TWH J;  1NG7 A;  1JKQ C;  4P55 A;  4RGX A;  5LBQ A;  1DP7 P;  2LOO A;  3LAJ A;  4A3C J;  1UHM A;  4AM3 A;  4A5N A;  1P7J A;  3FIS A;  4I02 A;  4YEJ A;  3ZQ7 A;  3B6C A;  1X3U A;  3JRF A;  1BW6 A;  4ZYG A;  2DMU A;  5E17 F;  4ESF A;  5CVU A;  1BA5 A;  1XSV A;  3GTJ J;  3S14 J;  3J7A Y;  2F5D A;  4Y7N J;  4N9I A;  4UHT A;  1W5T A;  3W2W A;  3MKZ A;  2YSR A;  1GV5 A;  1FBS A;  4XLF A;  3DTI A;  1WHU A;  3CCV I;  2EIM H;  4HYE A;  4B8X A;  3GZ6 A;  1YJN I;  3EET A;  2NNY A;  5D5V B;  3BP8 A;  3ZCO A;  2E71 A;  2EFW A;  3FK7 A;  1QHG A;  3VYT B;  2OCE A;  5FD6 A;  2WTE A;  3W6V A;  1SD6 A;  3BDD A;  1YOV B;  1DQU A;  4HZF A;  3F3X A;  4M6V A;  2YS9 A;  1I6X A;  4PDK A;  3KX2 A;  3WTS C;  5B3S H;  4A3J J;  3K6G A;  2YX4 A;  2VKE A;  4IRI A;  5E79 C;  1OIS A;  4OU0 A;  3P9I A;  4XOP A;  2DTZ A;  2MSY A;  2XF6 A;  1Z05 A;  3W6J B;  1HLV A;  2VBW A;  1G3T A;  1L3L A;  3CJR B;  5FB2 A;  2EIJ H;  2DTR A;  2QKL B;  1WSU A;  2J5P A;  2DJN A;  3M07 A;  2FD5 A;  1SFE A;  4DQ2 A;  3KEO A;  3ZQG A;  4XRS A;  4LLL A;  5HS8 A;  5J4Y A;  4OAY A;  4BEH A;  4IHY A;  1VQM I;  2M7A A;  1X19 A;  2BGC A;  1LVA A;  2LYC A;  2M4K A;  3PL8 A;  5D4S A;  3W6K B;  4PJ0 C;  5E3O A;  1KQ9 A;  1IZ1 A;  3SFI A;  1R5G A;  2XHK A;  5LLQ A;  3COA C;  3ABL H;  5HS9 A;  1Z3Y A;  2LH9 A;  3S1Q J;  4XLN F;  2M34 A;  3IH3 A;  1K83 J;  1PYV A;  4UY8 I;  4FAS D;  3HXL A;  1P4W A;  2G0E A;  4HNV A;  2G7H A;  3BR2 A;  5CVR A;  1G3Y A;  2YX7 A;  2D5V A;  3GCM A;  4UUS A;  2DN0 A;  3FXJ A;  3RKW A;  2WV1 A;  4KJZ A;  2F4M B;  1D5Y A;  4G6T B;  1ZTR A;  3QOD A;  1RPW A;  2HVQ A;  1G3S A;  2VBZ A;  4BHP A;  5K1Y A;  3CMA I;  3I4M J;  1FSH A;  1S8N A;  1U78 A;  2ZFW A;  1TWA J;  2CMP A;  1XX5 A;  4PGH A;  2GIZ A;  5KAI C;  4WK8 F;  2CRG A;  1OQY A;  3LSP A;  5GP9 A;  3A02 A;  1VTN C;  3E5U A;  2ZXJ A;  3NWT A;  5J3L A;  4A3B J;  2CQK A;  2FOK A;  2HNH A;  4ENN A;  4PZJ A;  3S3O A;  4I01 A;  2E2I J;  2OZU A;  1IDZ A;  2IS1 A;  3GXO A;  4IVN A;  2LBF B;  1IN6 A;  1ZRD A;  4CUG A;  2R7F A;  3IH2 A;  4BQA A;  3HOV J;  3CF2 A;  3ML6 A;  4MFE A;  2HOA A;  2Y48 A;  1HC8 A;  3QPT A;  5HLT A;  3VYS B;  2OPT A;  3S17 J;  1DPR A;  5H6R A;  4OWR B;  4EJO A;  2R7V A;  1LB2 A;  1QRY A;  3AG4 H;  2E19 A;  4BY7 J;  4ENM A;  3S2D J;  3OYL A;  3WTZ A;  5TRD A;  1I3Q J;  5JVT A;  1IN7 A;  3GO5 A;  4XOT A;  2EFN A;  4G9Y A;  5CVI A;  5FFX A;  2E5N A;  1IDY A;  2ID6 A;  2BW3 A;  2VJJ A;  1N77 A;  2EIN H;  2M7B A;  2YPR A;  1ZLK A;  2HOE A;  2K3F A;  4CGZ A;  2X51 A;  2W24 A;  2WB1 N;  4UB6 C;  1IUF A;  3GFI A;  3VYU B;  2WAD A;  2ZJP F;  2QGU A;  2XF5 A;  4GXO A;  1Y8R B;  3CCM I;  3CCQ I;  5DTD A;  4A3M J;  4BJ5 C;  2NS0 A;  1TZL A;  2L7K A;  4B48 A;  2BEO A;  3HOW J;  2F4O B;  1X1A A;  4HOB A;  5DV5 A;  2L7Z A;  3KE2 A;  4B43 A;  2XPV A;  2A5Y B;  3KP4 A;  3WU1 B;  3O2P E;  3WOD F;  1Y56 A;  2B63 J;  2JA6 J;  1XGM A;  1BN5 A;  1GXP A;  3GFJ A;  2LKS A;  2ZME B;  4B47 A;  2GIV A;  2QQB A;  1USS A;  4CYD A;  1PP8 F;  3BZ6 A;  1QGP A;  2XGX A;  1X1D A;  1YIT I;  1HKQ A;  4A69 C;  2LD5 A;  5J1U A;  4M72 A;  2ICW G;  1XGO A;  2RV8 A;  3KPH A;  4FE4 A;  3JAM Z;  4YIF A;  3CO6 C;  5D6F A;  5CVV A;  2HYG D;  2JA7 J;  2KMU A;  2TCT A;  1SD4 A;  2D1V A;  5D5W B;  2CUF A;  4Y4R A;  4ZDP A;  2MYS A;  2L02 A;  1F4K A;  2HQA A;  3CO7 C;  2E7X A;  2H6C A;  3HGY A;  1VI0 A;  4WXH A;  3GYH X;  4HLX A;  3OYH A;  2QEN A;  3MZY A;  3BG3 A;  4XLA A;  1Y0N A;  5IPA A;  1JKP C;  4E7K A;  2DA5 A;  4R79 A;  2IAI A;  2L0K A;  2OAZ A;  4ZYE A;  2COM A;  1WZ2 A;  2PMZ N;  4CZZ A;  2M9H A;  2JUC A;  3S32 A;  4ZTJ A;  3S2H J;  3C3W A;  3KLN A;  5GPA A;  4PJM A;  4EM0 B;  1P92 A;  1ZKG A;  3ELK A;  1S7E A;  1V55 H;  5EEA A;  3FBI B;  2AQF A;  1KYW A;  3IC7 A;  1LVK A;  2BYV E;  5IP6 A;  1ZGW A;  3LOC A;  4RAY A;  4HLY A;  1ZH5 A;  3A01 A;  1W7P D;  1QZE A;  4P9F A;  3H5N A;  2CG4 A;  4HSR A;  4EMS A;  1UJ8 A;  1J7K A;  3TMO A;  1OMI A;  4NNJ A;  2EBI A;  4LK1 F;  2IRF G;  2O9L A;  1BIB A;  2RKH A;  2XPW A;  4J00 A;  1FOX A;  2CU7 A;  3H5A A;  5L3C A;  1H88 C;  4P5O A;  1OCC H;  4IOC F;  1FOW A;  5E3L A;  1JTX A;  2ZBK A;  2HQR A;  4L9J A;  5KCM A;  3HHG A;  2PN6 A;  3RCO A;  4HNU A;  3CC7 I;  3BTJ A;  1TBX A;  1W36 D;  4GRI A;  3FXO A;  5CYV A;  1W7P A;  2OC6 A;  3A4C A;  3ZGK A;  1BL0 A;  2IGK A;  2CGP A;  2BV6 A;  3FXK A;  4CCL A;  2FML A;  3RQ4 A;  4LMY A;  2WV0 A;  2JT1 A;  5HOD A;  3H0G J;  1OCR H;  2EK5 A;  5HLH A;  3CP2 A;  1SD5 A;  2VQL A;  1MGT A;  1O57 A;  1B72 A;  1E3H A;  1LEB A;  1A31 A;  3WU0 A;  4B3X A;  3QQA A;  4DYC A;  4NC6 A;  1IW7 F;  4HQE A;  3RQI A;  1RZ4 A;  5E1X A;  5C3E J;  3ZPL A;  3WGI A;  2IA1 A;  2F2E A;  5C44 J;  2EA2 A;  5FKL A;  1UFM A;  4NHJ A;  2IPQ X;  5LHH A;  2DA2 A;  2MW8 A;  4AU7 A;  3FXR A;  5J1Y A;  5J8F A;  2I8D A;  3I54 A;  5F27 A;  2KJB A;  2DK8 A;  3FDY A;  1LUJ B;  4HF2 A;  3OOP A;  2VKH A;  2VT3 A;  3E6C C;  1Z7L A;  3MKW B;  5CQG A;  2VJ4 A;  1F5T A;  1S7O A;  1DP3 A;  1UEL B;  3EPZ A;  2DA7 A;  3K4C A;  4A3I J;  1VQ9 I;  2DMN A;  4XLP F;  3P7N A;  3BR5 A;  1ETQ A;  1EH6 A;  2GZW A;  2Z16 A;  5FKN A;  1TWG J;  2VBY A;  5GAE J;  3K2Z A;  3JRE A;  4BXX J;  3MN2 A;  3PUB A;  4ZZL A;  1ERD A;  4ASN A;  1EV7 A;  2CJJ A;  3QPH A;  2GXB A;  2VJI A;  2BXZ A;  1OCT C;  1MNM C;  1VQ8 I;  3U1D A;  1WH5 A;  4A3K J;  3KCC A;  1YQA A;  1S9H A;  3C7J A;  2XAH A;  1RR7 A;  2EV0 A;  1T39 A;  3LA2 A;  1XMA A;  1I50 J;  2W1O A;  1MDM B;  3CDH A;  1R4M B;  3CDI A;  3LAP A;  2K3P A;  3E6B A;  4B3A A;  2STW A;  2YU9 J;  1L0O C;  2P6T A;  1S29 A;  4Z2Y A;  2Q8K A;  4PJJ A;  2VXD A;  4N9H A;  3HOX J;  5F0H A;  1S5L C;  4F52 A;  1XMK A;  3CCU I;  4BY1 J;  4BBR J;  2F5F A;  1V3F A;  2KZV A;  1X2M A;  4D9J A;  1EH8 A;  3ZN0 A;  1YIJ I;  4LG0 B;  2ELK A;  5JVG F;  2DMP A;  1OKR A;  1YX5 A;  3CCE I;  4ENK A;  2PJP A;  5B66 C;  1O3T A;  1LQ1 A;  4UXN A;  2XB0 X;  3H3Z A;  4ZJZ A;  4C3H J;  2HPM A;  2HR3 A;  3SZP A;  2ZME C;  2ZO4 A;  2KRF A;  4J19 A;  2L9S A;  2PMU A;  5FLM J;  3JRD A;  4A3F J;  4WF2 A;  1A6I A;  2KT0 A;  2P8T A;  4B1R A;  3WTY C;  2CW0 F;  2DFF A;  3DLA A;  2Y30 A;  4ENJ A;  1Y1V J;  3K9T A;  3KP2 A;  4U0W A;  4ZTF A;  2DT6 A;  2R5Z B;  1EH7 A;  5D6E A;  2UXX A;  3H36 A;  3HPG A;  4BDY A;  1D1A A;  3DP7 A;  3RZD J;  1B9N A;  5EF6 A;  4JYK A;  3H9Q A;  3DU6 A;  2QBY A;  3PNY A;  4BH9 A;  3L09 A;  2L7F P;  1U9N A;  2M87 A;  3I4P A;  1MBE A;  1K61 A;  4E7I A;  1AU7 A;  1XSX A;  2IT0 A;  1NHA A;  1MD0 A;  2JRM A;  1DDN A;  3IHU A;  2FQ3 A;  2PFB A;  4QWQ A;  5M3F J;  2M4G A;  1A04 A;  3KZY A;  4HF1 A;  1ORK A;  3A2K A;  3BR1 A;  1N25 A;  2CUJ A;  3H9J A;  3FX3 A;  4YIR X;  1BM9 A;  2O3F A;  2Y0S N;  3ZXS A;  5HNF A;  3UNG C;  5D5U B;  3JAM K;  2FA5 A;  5LFA A;  2ZJQ F;  2ESH A;  5EEH A;  1W0U A;  2EZI A;  1U2W A;  3RKY A;  2HXI A;  3RYR A;  1DU6 A;  3I3L A;  2M0C A;  1POG A;  3BOQ A;  4XN3 A;  3TO7 A;  3KFW X;  1BR4 A;  4Q5S F;  2ISZ A;  1EKE A;  5E1Z B;  4S05 A;  1MKM A;  2ZXH A;  4F3Q A;  2AS5 F;  4XKV A;  3OL3 A;  4KIS A;  1ZLJ A;  3A0B C;  2VOP A;  2LVS A;  2EZK A;  2LTP A;  2HOS A;  1MSE C;  1WFX A;  3AKZ A;  3I5U A;  1K6Y A;  1IO2 A;  2YUS A;  2V7F A;  2RAE A;  1XB4 A;  2CWE A;  1R6R A;  3QPL A;  4LIU A;  1P7I A;  5CPR B;  3WE2 A;  3E1S A;  1R1V A;  1MBH A;  1TNS A;  1B59 A;  3SHF A;  2E2J J;  4ZYA A;  3TL4 X;  4KT6 A;  5J4V A;  3E0J B;  1SD7 A;  4M3B A;  1XCB A;  2NOJ B;  4IHV A;  3HUG A;  2KRH A;  1SFX A;  4IHS A;  3BQZ A;  2VN2 A;  4I6Z A; 
#chains in the Genus database with same CATH homology
 4G94 A;  1R36 A;  1Z91 A;  3LA7 A;  1I1G A;  3IRQ A;  3CUO A;  5ED4 A;  1LDJ A;  4ESB A;  2JZY A;  4OIR F;  1IN5 A;  3LA3 A;  3HYI A;  4I2O A;  4LB6 B;  1O3Q A;  5DCM A;  1MDM A;  4EQQ A;  3WGG A;  5L3E A;  2HZT A;  4G6Q A;  1FP1 D;  2BBY A;  5E20 A;  1KA8 A;  3R4K A;  3T1B A;  2DPD A;  4E70 A;  3B73 A;  2EA4 A;  1JE8 A;  4Y17 A;  5IT3 A;  3G73 A;  4M6Y A;  3K0L A;  1FYK A;  1ZGJ A;  2O03 A;  1BC7 C;  1HSJ A;  5ICF A;  5ILS A;  1HKS A;  1O7L A;  2HFH A;  4KUM A;  4A6E A;  2XAG A;  1QBJ A;  2QQ9 A;  4L9T A;  2QM3 A;  2VON A;  2LSO A;  1S7A A;  5L3D A;  4HF0 A;  4EM1 A;  2EJR A;  3JTG A;  3LST A;  3ZMS A;  4MQ9 F;  3DFG A;  1TTY A;  2W85 A;  3M9A A;  3IKV A;  2D2W A;  1J5Y A;  5CVJ A;  3P9K A;  4Q4Z F;  2FBI A;  2Y0M A;  4GCV A;  2VT2 A;  1U3E M;  2MA3 A;  2KJC A;  3U9G A;  3EQL F;  1CGP A;  4U7B A;  1ODD A;  2O6G E;  1HQC A;  2TDX A;  1O3S A;  2M8E A;  3KLO A;  5LRR A;  1RI7 A;  4MGR A;  2PLY A;  4KFC A;  3HSR A;  5JI6 A;  5BOX A;  4O6J A;  3ZMU A;  4D0P A;  4XSZ F;  3I59 B;  3R0A A;  4M6X A;  2EFO A;  2VXZ A;  4CDG A;  3H3U A;  3FF5 A;  5ICC A;  4UUV A;  4L5J A;  2DLL A;  4I98 B;  2V1X A;  4KIC A;  2VBX A;  3KP3 A;  5JFR A;  3AAF A;  1OYW A;  3Q9S A;  3ISP A;  5D8L B;  3DQV C;  2EWN A;  5DUK A;  2LF7 A;  5ILU A;  3LQR A;  4NQW A;  2QQA A;  1R22 A;  1FYL A;  5BQT A;  1ZN2 A;  3JW4 A;  3R6S A;  3BRO A;  4RGR A;  2HTS A;  4L9V A;  4M74 A;  5A2Q Z;  5DUI A;  4RB2 C;  1QQI A;  1O7F A;  4P96 A;  3KP6 A;  4CIC A;  3E5X A;  3VB2 A;  4IF4 A;  4OIQ F;  5F6F A;  4GYG A;  3L00 A;  1ZHF A;  2YR2 A;  1HKT A;  1R1T A;  2A6E F;  3Q5F A;  3HOS A;  3GLX A;  2E1N A;  2DFI A;  4PGG A;  3BPV A;  4KDP A;  4LGW A;  4LLN A;  5JR3 A;  1BOA A;  2CYY A;  2HEO A;  1PUE E;  4LK0 F;  1ULY A;  2H09 A;  1QO0 D;  1XDS A;  3L2C A;  1OYI A;  2IVM A;  3JSO A;  3RDI A;  3CJN A;  4BHC A;  1TLH B;  2XVC A;  3I0T A;  1YW7 A;  5AIQ A;  1IRF A;  2O61 A;  3GWZ A;  3WTW C;  2MH2 A;  3BJO A;  1YO5 C;  4UVC A;  3PQJ A;  3V8J A;  1P6R A;  3TDU C;  3F21 A;  1FP2 A;  4G8X A;  3HIF A;  3QOP A;  2VOD A;  3VFZ A;  1Z7U A;  4IHT A;  3D0S A;  3RTR A;  2A61 A;  3FMQ A;  4OIN F;  1KU9 A;  1YS7 A;  1IF1 A;  2W57 A;  4I0A A;  1QZZ A;  3I59 A;  4AD9 A;  5ICG A;  4HQM A;  3ROU A;  2FU4 A;  5LGU A;  1C0W A;  4GO1 A;  5E8G A;  2UZK A;  1YYV A;  5FLX Z;  5H20 A;  1YG2 A;  4UNO A;  3TKY A;  2XKO A;  3K1M A;  1YW8 A;  4L18 B;  4MEY F;  3BJ6 A;  4I0B A;  5DEQ A;  3ZP5 A;  3GVA A;  5D5X B;  2F5E A;  4NB5 A;  1HXD A;  2FEZ A;  4EV0 A;  3O6B B;  2DW4 A;  1F1Z A;  2FNP A;  2W84 A;  1V4R A;  1T2K A;  4XSX F;  5CLS A;  3WGH A;  3JTH A;  4MEX F;  1FBU A;  1UST A;  2V1U A;  3N4M A;  3K1P A;  3FXU A;  3GFL A;  4RS8 A;  4UV9 A;  1ONV A;  1HW5 A;  4AIK A;  1MZB A;  4GYI A;  3ERE D;  3KEQ A;  3IL2 A;  2DQL A;  1WQ2 A;  2QWW A;  5LGT A;  1K78 B;  2RNJ A;  2HS5 A;  2E1C A;  3HRU A;  1XGN A;  2CSO A;  1LNW A;  2JTV A;  1YW9 A;  3TOB A;  2P5L C;  2VE8 A;  4RB0 A;  1Z1D A;  2Z9O A;  3ZMV A;  1RNL A;  2GQQ A;  1FWZ A;  2ETH A;  2WWY A;  1BBY A;  4HW0 A;  5A2Q K;  5BPI A;  3B02 A;  2K7L A;  3J81 Z;  2JSC A;  3EDP A;  1XN7 A;  2ZME A;  3SFZ A;  2L54 A;  4B09 A;  3VEP A;  2XV4 S;  4OMZ A;  4Y13 A;  1TQM A;  5LHI A;  1REP C;  5LHG A;  3T8T A;  1MJ9 A;  3IRR A;  4O3M A;  2L01 A;  3RPU A;  3DPT A;  2DAO A;  5CJ9 A;  3T5X A;  4YG2 F;  4I09 A;  3CUQ B;  4AVP A;  4O5V A;  5DD8 A;  3FM3 A;  4ZYH A;  1XGS A;  1R23 A;  2H6B A;  2FBH A;  4CXF A;  2HKO A;  4G7H F;  4BNC A;  3RPQ A;  5HDK A;  2HGC A;  5AIP A;  3GF2 A;  3TQN A;  1AWC A;  4FHT A;  1LJ9 A;  4EGY A;  1PP7 U;  1XDU A;  1BI2 A;  2MLG A;  5ICE A;  1FLI A;  2HKX A;  1K7A A;  1KU7 A;  4TV7 A;  3KZZ A;  2X0L A;  3IKT A;  3WTV C;  1IXR C;  3I58 A;  4A0Z A;  4ZYD A;  1XCV A;  2O0Y A;  1FNN A;  4PCQ A;  3DF8 A;  2XRN A;  5HOO A;  2LF8 A;  1W4M A;  3DV8 A;  2XKP A;  5FLX K;  4M73 A;  1WRJ A;  2EV5 A;  3IWZ A;  1GHC A;  2V9V A;  2MD5 A;  5D4R A;  1DUX C;  2A68 F;  2ZCW A;  5KVR A;  2QYO A;  4KA4 A;  1RUN A;  3KET A;  2P6S A;  3F8M A;  3V8K A;  3PQK A;  1K79 A;  4KIF A;  4G6D A;  4WCG A;  3WG9 A;  3ZMT A;  5K5R A;  3WTX C;  3FM5 A;  2K27 A;  3K1N A;  5E18 F;  3M7G A;  2PEX A;  2DPU A;  2UXN A;  2G9W A;  1H0M A;  3ABT A;  1R5H A;  3T8R A;  3GEZ A;  3Q9V A;  3R60 A;  3MQ0 A;  2E7W A;  5DYM A;  3I64 A;  4KIB A;  4IXA A;  1OYY A;  3BJA A;  3REO A;  2H27 A;  3RIR A;  1BI0 A;  3R0J A;  4HV5 A;  4YII A;  1KYZ A;  4DNC A;  3GUD A;  4EJV A;  3I53 A;  4OIP F;  4MNU A;  3C1D A;  3O3K A;  1I1S A;  2MLK A;  4EGZ A;  1KU3 A;  1QZY A;  4R8H A;  4WX9 A;  4LG0 A;  2NYX A;  4HBL A;  2JPB A;  2EB7 A;  1HW1 A;  4EJT A;  1KU2 A;  2MBF A;  2P5V A;  1D3Y A;  3S2W A;  2PBI A;  4HX4 A;  2BE5 F;  2XUB A;  4WXD A;  2QZ8 A;  4H0E A;  4IRG A;  1J9I A;  1IN4 A;  3JSP A;  3KP7 A;  4AIH A;  1YLF A;  5LEJ A;  2ELH A;  3F8C A;  3FHZ A;  4KYW A;  3RYP A;  4LB5 A;  3QP6 A;  1IRG A;  4IRH A;  3J81 K;  1J2X A;  3DEU A;  1FZP B;  4G7Z F;  1MJA A;  2A6H F;  1ON2 A;  1ZYR F;  5BS6 A;  5HDG A;  4YFX F;  2M5W A;  3CUQ C;  2XAJ A;  3OV8 A;  1CF7 B;  1JHF A;  3ZMD A;  5HDN A;  3J80 K;  1WKM A;  4JQF A;  4L9N A;  3F22 A;  4Q48 A;  1TNT A;  5TJJ A;  1SMY F;  4MTE A;  3ZN1 A;  3HRT A;  3MCZ A;  1FYM A;  4LLG F;  4R1H A;  3MZH A;  2FNA A;  4KMU X;  4MHG A;  1HBX G;  4HDV A;  1LDK B;  4BAY A;  2CFX A;  2MC3 A;  1ZRE A;  5K5Q A;  4HX7 A;  2PMH A;  2PG4 A;  3E5Q A;  2IJL A;  2HYF A;  2XRO A;  2OU2 A;  3MFK A;  5IT9 K;  3MWM A;  2OQR A;  2NNN A;  1R58 A;  3HSF A;  4L5I A;  4UVA A;  2ISY A;  2LNB A;  3NRV A;  2P5K A;  3FMR A;  4AIJ A;  4JBA A;  1RIO H;  2HWV A;  4WWC A;  2IA2 A;  5HLG A;  4EVI A;  2MH9 A;  2Z33 A;  3DXJ F;  4M71 A;  3M8E A;  3V8L A;  1D8J A;  1S6L A;  4A2U A;  3E97 A;  2DO7 A;  3TGN A;  4YFN F;  2QVO A;  4ZH4 F;  3M1E A;  3QU3 A;  2HTJ A;  3SXY A;  4ZZD A;  5E1W A;  1IAW A;  4CHU A;  1R7J A;  2ACJ A;  5FD5 A;  2IW5 A;  1B4A A;  1G4D A;  3SZT A;  1J75 A;  2RGV A;  2LKP A;  3CLO A;  3QU6 A;  3ABU A;  1W5S A;  3T0Y A;  5L3B A;  3I71 A;  3LQQ A;  2RN7 A;  1XSD A;  5L3G A;  4ON0 A;  1U5T B;  4HAM A;  2DQR A;  2G7U A;  3EYI A;  1Z6R A;  1UB9 A;  5DD4 A;  3HSE A;  2M45 A;  2L3D A;  2FRH A;  2VOO A;  4HDU A;  2YU3 A;  1CF7 A;  4FX0 A;  4IPA A;  3TO6 A;  2M1B A;  2OBP A;  2KKO A;  2LDU A;  3BY6 A;  4RGU A;  4RGS A;  3WE3 A;  1BI1 A;  3HRS A;  1I5Z A;  2XAQ A;  3F72 A;  2XAF A;  3HTU A;  4U88 A;  6PAX A;  4K2E A;  1W7P B;  4CO8 A;  2PQ8 A;  3HRM A;  2GAU A;  2V1D A;  4Q47 A;  4A0Y A;  2D45 A;  5H6Q A;  2FMY A;  2O8X A;  4BYY A;  2K4J A;  3L9F A;  1QNT A;  2ADU A;  5LEK A;  2RVC A;  2X4H A;  3TDZ C;  2PI0 A;  1LDD A;  3GW2 A;  3K69 A;  4L0Z B;  4IJA A;  4U0V A;  1ZG3 A;  2Z3Y A;  2JRT A;  3FZV A;  5D8K B;  2VE9 A;  2V6C A;  1T6S A;  2RC4 A;  3CTA A;  3NEU A;  3QAH A;  1FOK A;  1FX7 A;  1JGS A;  1GVJ A;  4XBF A;  1DPU A;  2HDC A;  4LD5 A;  1F9N A;  3VOD A;  2DI3 A;  2NAZ A;  1KQ0 A;  3ECH A;  3V4G A;  1B6A A;  2K02 A;  4LJZ F;  1T0F A;  4KN7 X;  4ETS A;  4A5M A;  1JXS A;  2GA1 A;  1YS6 A;  4OIO F;  2P7C B;  1YFH A;  2FE3 A;  5EEG A;  1BIA A;  1U5T A;  4XRF A;  2RDP A;  4YFK F;  2WC2 A;  1P4A A;  4M9S A;  3RKX A;  2A3S A;  2ESN A;  3FWE A;  3E6D A;  2EFP A;  5HS7 A;  2F5C A;  3L7W A;  2STT A;  4AWX B;  2EV6 A;  2Z5U A;  1E17 A;  2R3S A;  2NRA C;  1OPC A;  5AON A;  2ZKZ A;  1BI3 A;  3SQN A;  4P9U A;  2OA4 A;  4OMY A;  2QBY B;  5LGN A;  5LRS A;  4U0Y A;  3HTS B;  2XIG A;  1ZRF A;  1B1B A;  2GWR A;  3QRF F;  3GZ5 A;  1Z6T A;  2HQN A;  2OZ6 A;  1RUO A;  1U5T C;  2ZNZ A;  3DKW A;  3C18 A;  4I7H A;  2FBK A;  1HW2 A;  1Y0U A;  2DK5 A;  3F8B A;  2ZNY A;  2KIU A;  3LFK A;  1D5V A;  3D5L A;  3KP5 A;  3QP5 A;  3WTU C;  3RI4 A;  4KIG A;  1BJA A;  1MJB A;  5ERI A;  3ZMZ A;  2AXL A;  4HX8 A;  1J59 A;  3J80 Z;  2R7D A;  3J7A O;  5ILV A;  1AOY A;  5HLI A;  1XD7 A;  3P9C A;  4KMF A;  5FGM A;  4HA8 A;  3BWG A;  1JHH A;  4QLC U;  1FBQ A;  4LFU A;  2L4A A;  2K4B A;  4MTD A;  3GFM A;  4A6D A;  1ZG1 A;  2DBB A;  5BPD A;  5F1R A;  1IUY A;  2GA2 A;  2DU9 A;  1IXS B;  5J8C A;  1I27 A;  4ESJ A;  2IA0 A;  2KIF A;  2VC1 A;  4FX4 A;  3ECO A;  2QLZ A;  4G7O F;  2ZJ2 A;  2H94 A;  3WTT C;  5IT9 Z;  4KT5 C;  2Q0O A;  1UCR A;  5DCM B;  4EM2 A;  1Q1H A;  4RB3 C;  5FO5 A;  4UV8 A;  4KN4 X;  1O3R A;  4MQV A;  1J0R A;  4FT8 A;  2W25 A;  1TW3 A;  1YIO A;  1ZRC A;  4M9Z A;  1T98 A;  3H92 A;  1IXC A;  3IWF A;  1T38 A;  4UVB A;  1ZGA A;  4GGG A;  1G6N A;  3F23 A;  1K78 A;  1Z9C A;  1SFU A;  4S04 A;  4EJU A;  5DCF A;  1QPM A;  1ZAR A;  5KK1 A;  1PDN C;  4EJW A;  3G3Z A;  2C6Y A;  1R00 A;  2CO5 A;  3EYY A;  4OOI A;  3U2R A;  4JK1 X;  4BHB A;  2DT5 A;  1FSE A;  1S3J A;  3F6V A;  3FXQ A;  1P2F A;  1WWX A;  3V7R A;  2B0L A;  5BMZ A;  4L0Y B;  1U8R A;  3F8N A;  5F64 A;  2GXG A;  1STZ A;  2A69 F;  1H9T A;  1SMT A;  1KQ8 A;  4KNY A;  1TQI A;  2Y75 A;  1H9G A;  2K86 A;  5DDG A;  5L3F A;  3NQO A;  3FMS A;  1ON1 A;  5FFZ A;  1R1U A;  2FSW A;  3MEX A;  2P7V B;  2UWM A;  1FY7 A;  3BPX A;  3LWF A;  2FF4 A;  1SAX A;  1P4X A;  3E6M A;  3TO9 A;  1IN8 A;  1LEA A;  3VOE A;  3CUQ A;  2KIM A;  2Z99 A;  2VC0 A;  3V7S A;  1TQP A;  3V7C A;  1YTY A;  2EFQ A;  2V79 A;  4A12 A;  1UHW A;  1ZG5 A;  3R61 A;  3RJP A;  4RB1 A;  2JPC A;  1D8K A;  4Y15 A;  4BXU A;  1ZAO A;  2J5O A;  2OD5 A;  3F8F A;  1GXQ A;  1HST A;  1WI9 A;  4U7D A;  1U6G A;  1G3W A;  3DPL C;  2Q2E A;  1OR7 A;  4RAZ A;  3E3V A;  4HV6 A;  5HVQ C;  2D1H A;  1FT9 A;  3MAJ A;  5E8I A;  4A0X A;  3TOA A;  5JHU A;  3GX4 X;  1K6O A;  1FPQ A;  2M30 A;  2XAS A;  2OQG A;  1FC3 A;  3F6O A;  5K5O A;  1E2X A;  4M9X A;  2QUF A;  2L4M A;  2RQP A;  1TW2 A;  4F7Z A;  4WXC A;  3HOT A;  2IP2 A;  1B9M A;  2FXA A;  3ULQ B;  3M8F A;  5J6X A;  2A07 F;  1KGS A;  3PFI A;  2P4W A;  4N0B A;  3EUH A;  1BC8 C;  3HHH A;  3N97 A;  4P55 A;  4RGX A;  5LBQ A;  1DP7 P;  3LAJ A;  1UHM A;  4A5N A;  3ZQ7 A;  4I02 A;  1X3U A;  4ZYG A;  5E17 F;  4ESF A;  5CVU A;  1XSV A;  2F5D A;  4N9I A;  4UHT A;  1W5T A;  2YSR A;  1FBS A;  4HYE A;  4B8X A;  3GZ6 A;  3EET A;  2NNY A;  5D5V B;  3BP8 A;  2EFW A;  5FD6 A;  2WTE A;  1SD6 A;  3BDD A;  4HZF A;  3F3X A;  4PDK A;  1I6X A;  3WTS C;  2YX4 A;  4IRI A;  4OU0 A;  3P9I A;  1Z05 A;  3W6J B;  2VBW A;  1G3T A;  1L3L A;  5FB2 A;  2DTR A;  1WSU A;  2J5P A;  4DQ2 A;  1SFE A;  3KEO A;  4LLL A;  5HS8 A;  2BGC A;  1LVA A;  5D4S A;  3W6K B;  1KQ9 A;  1IZ1 A;  1R5G A;  2XHK A;  5LLQ A;  3COA C;  5HS9 A;  4XLN F;  1P4W A;  2G7H A;  5CVR A;  1G3Y A;  2YX7 A;  3RKW A;  1G3S A;  2VBZ A;  4BHP A;  5K1Y A;  1FSH A;  1S8N A;  1U78 A;  2ZFW A;  4PGH A;  4WK8 F;  1VTN C;  3E5U A;  2ZXJ A;  2CQK A;  2FOK A;  4ENN A;  4PZJ A;  4I01 A;  2OZU A;  3GXO A;  4IVN A;  1ZRD A;  1IN6 A;  2R7F A;  4BQA A;  3ML6 A;  2Y48 A;  3QPT A;  1DPR A;  5H6R A;  4EJO A;  1LB2 A;  4ENM A;  5TRD A;  3WTZ A;  5JVT A;  1IN7 A;  3GO5 A;  2EFN A;  4G9Y A;  5CVI A;  5FFX A;  1ZLK A;  2YPR A;  2HOE A;  4CGZ A;  2W24 A;  3GFI A;  4GXO A;  2NS0 A;  2BEO A;  4HOB A;  5DV5 A;  3KE2 A;  2A5Y B;  3KP4 A;  3WU1 B;  3O2P E;  3WOD F;  1XGM A;  1BN5 A;  1GXP A;  3GFJ A;  2ZME B;  2GIV A;  2QQB A;  1USS A;  4CYD A;  1PP8 F;  3BZ6 A;  1QGP A;  2XGX A;  1HKQ A;  4M72 A;  1XGO A;  2RV8 A;  3JAM Z;  4YIF A;  3CO6 C;  5D6F A;  5CVV A;  2HYG D;  1SD4 A;  2D1V A;  5D5W B;  2L02 A;  1F4K A;  3CO7 C;  2E7X A;  2H6C A;  4WXH A;  3GYH X;  4HLX A;  2QEN A;  3MZY A;  4R79 A;  2OAZ A;  4ZYE A;  2COM A;  4CZZ A;  3C3W A;  3KLN A;  4EM0 B;  1P92 A;  3ELK A;  1KYW A;  3IC7 A;  2BYV E;  4HLY A;  4RAY A;  1ZH5 A;  1W7P D;  4P9F A;  2CG4 A;  4EMS A;  1J7K A;  1OMI A;  4LK1 F;  2IRF G;  1BIB A;  2RKH A;  5L3C A;  4P5O A;  2ZBK A;  2HQR A;  4L9J A;  3HHG A;  2PN6 A;  1TBX A;  5CYV A;  1W7P A;  2CGP A;  2BV6 A;  2FML A;  4LMY A;  2WV0 A;  2JT1 A;  2EK5 A;  5HLH A;  1SD5 A;  1MGT A;  1O57 A;  1LEB A;  3WU0 A;  1IW7 F;  4HQE A;  1RZ4 A;  5E1X A;  3ZPL A;  3WGI A;  2IA1 A;  2F2E A;  2EA2 A;  1UFM A;  4NHJ A;  2IPQ X;  5LHH A;  3FXR A;  5J8F A;  3I54 A;  2KJB A;  2DK8 A;  4HF2 A;  3OOP A;  2VT3 A;  3E6C C;  1F5T A;  1S7O A;  4XLP F;  3P7N A;  1EH6 A;  2GZW A;  2VBY A;  3K2Z A;  4ZZL A;  4ASN A;  1EV7 A;  3QPH A;  2GXB A;  3U1D A;  3KCC A;  1YQA A;  3C7J A;  2XAH A;  2EV0 A;  1T39 A;  3LA2 A;  1XMA A;  1MDM B;  3CDH A;  3LAP A;  3E6B A;  2STW A;  1L0O C;  2P6T A;  1S29 A;  4Z2Y A;  2Q8K A;  4N9H A;  1XMK A;  2F5F A;  1V3F A;  1EH8 A;  3ZN0 A;  4LG0 B;  1OKR A;  4ENK A;  2PJP A;  1O3T A;  1LQ1 A;  4UXN A;  3H3Z A;  2HR3 A;  3SZP A;  2ZO4 A;  2KRF A;  2PMU A;  4WF2 A;  2P8T A;  3WTY C;  2CW0 F;  4ENJ A;  3K9T A;  3KP2 A;  4U0W A;  1EH7 A;  5D6E A;  2UXX A;  3DP7 A;  1B9N A;  2QBY A;  4BH9 A;  3L09 A;  2M87 A;  3I4P A;  1XSX A;  2IT0 A;  1NHA A;  1MD0 A;  1DDN A;  3IHU A;  2FQ3 A;  2PFB A;  4QWQ A;  1A04 A;  3KZY A;  4HF1 A;  3FX3 A;  1BM9 A;  2O3F A;  5D5U B;  3JAM K;  2FA5 A;  2ESH A;  5EEH A;  1U2W A;  3RKY A;  3RYR A;  3BOQ A;  3TO7 A;  3KFW X;  4Q5S F;  2ISZ A;  5E1Z B;  4S05 A;  1MKM A;  2AS5 F;  1ZLJ A;  2VOP A;  3I5U A;  1XB4 A;  2CWE A;  3WE2 A;  1R1V A;  1TNS A;  1B59 A;  3SHF A;  1SD7 A;  1XCB A;  3HUG A;  1SFX A;  4IHS A;  2VN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...