4L9NA

Crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
137
Chain Sequence
b'EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MepR
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 52
structure length 137
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9nA00
2JRTA 2FRHA 1FBQA 3QP5A 3DV8A 2RC4A 3BOQA 4A12A 3R61A 1JHHA 1Z6RA 4OIRF 2KIFA 3ZMVA 5AIQA 1ZH5A 5LGNA 1GXPA 3HIFA 2ZKZA 4U88A 1IUYA 1BI1A 3RTRA 3BDDA 2XVCA 3KP6A 3TO9A 5LGTA 2STWA 1MJAA 3I58A 3KFWX 3N97A 4RAYA 3F22A 1UHWA 2ZJ2A 3WTTC 4D0PA 2O03A 3TDUC 2JPCA 1TTYA 4O3MA 4HYEA 1I1SA 4G7ZF 3IKTA 3BY6A 1G6NA 1V4RA 2EV5A 1R58A 2LKPA 4ASNA 1XDUA 1QPMA 2FBIA 3WE2A 1ZRCA 1HW2A 1FYLA 3AAFA 5FB2A 1YYVA 2OZUA 2BGCA 2ISZA 2XAJA 3ABTA 4GGGA 3DPLC 1FPQA 2IA1A 5HLIA 2MLKA 1J0RA 2HKOA 1LVAA 3E5UA 2EV6A 2DW4A 5H6RA 2XRNA 5F6FA 1KU2A 3C1DA 4EGZA 1W7PA 3U2RA 1FYMA 1T6SA 4U0WA 3JSOA 3WTSC 1BN5A 3R4KA 4RB2C 3LA2A 4A6DA 4KN4X 2OAZA 1B59A 2HYGD 3ISPA 4Q5SF 4P5OA 1XGSA 1J2XA 5D5VB 5K5OA 2QUFA 4PCQA 5DEQA 1WKMA 3GFJA 5ICFA 2FA5A 1EH6A 1DPRA 4Q48A 2GA2A 3JTGA 2J5OA 1CF7A 5DCMA 2VT3A 1IN5A 2M5WA 5CVJA 5ERIA 1S7AA 1KYWA 1XSXA 4UHTA 2IP2A 2XGXA 1FSHA 2VXZA 1O7FA 1YQAA 5J8FA 1IRGA 3KEQA 2G7UA 4GXOA 1GVJA 2OD5A 2LNBA 1S3JA 1BI2A 1LEAA 2P5VA 3RPQA 1FBSA 1T2KA 3QP6A 3DKWA 3TQNA 3CUQB 4N9HA 1MJ9A 5AONA 4LK0F 2L02A 1SD4A 3CUQC 4AIJA 3KP4A 5LGUA 4L0ZB 5D5XB 1YLFA 1P92A 1OMIA 5D5WB 3TOAA 2CG4A 3MWMA 1R22A 1R1VA 2OU2A 3V7RA 2VE8A 3L7WA 2GA1A 1IF1A 3HYIA 1HSTA 3Q9VA 1TNSA 2BE5F 4MEYF 1FP1D 3D0SA 3FMSA 3O3KA 4EM1A 3H3ZA 2VN2A 3KLOA 3M7GA 3F8NA 3KLNA 2VBWA 4KDPA 3CO7C 3ML6A 3I59B 1FNNA 2K7LA 4L9VA 5DD8A 3CJNA 3K1MA 4NQWA 5JR3A 1H0MA 2PJPA 3JSPA 3G73A 4BHBA 5D8KB 4LG0B 2G7HA 4OIPF 3N4MA 5HDKA 1R5GA 2P7VB 2YPRA 4G7OF 1L0OC 3J81Z 3DXJF 2EFPA 4P96A 2XAFA 1FYKA 2Z5UA 3FM3A 2H94A 3U9GA 1S8NA 5IT3A 4P55A 4Q47A 3HHHA 3C3WA 2XAGA 2EK5A 2WV0A 4MTDA 5H6QA 2OZ6A 1B9MA 2FBKA 4PGHA 4GYIA 3KP3A 4LFUA 2M45A 2K86A 3DPTA 1MDMA 4XSZF 2O6GE 3WU0A 1YS7A 1LDDA 3ERED 1ZGAA 2Z99A 5BS6A 3FF5A 1U3EM 3BJ6A 3E97A 3LAJA 1F5TA 4Z2YA 4EV0A 1P6RA 2Z3YA 1IN7A 1U6GA 3R6SA 4NHJA 4PDKA 3KP5A 2XASA 1S7OA 2IVMA 2HDCA 4IRGA 2CWEA 2PN6A 3H3UA 1J9IA 1XD7A 2DLLA 1LEBA 1BBYA 2DO7A 1PUEE 3FXRA 4UNOA 4LLLA 4QWQA 3GXOA 1OYWA 2XIGA 2ZFWA 3GFMA 3HOTA 5HLGA 1ZLKA 4BHPA 3ULQB 4UV8A 3T1BA 5A2QZ 1B9NA 1U8RA 2K02A 1G3TA 1LDKB 3LQQA 3K9TA 3BPVA 4LK1F 1USSA 3FMRA 3Q5FA 4IRHA 3HOSA 2B0LA 3V4GA 1IRFA 2A69F 2LSOA 4IF4A 5E8GA 4OINF 1D8KA 5HS8A 2W25A 2FNAA 2QBYA 5IT9Z 1WRJA 4L5IA 5F1RA 2KIMA 4N0BA 3BZ6A 4A0XA 5ED4A 4JBAA 1W7PB 1O57A 1SFEA 3HRMA 3MZHA 5E20A 1FP2A 1GHCA 4I98B 2Z33A 2A5YB 4HQEA 5DDGA 1BJAA 4OOIA 4HLXA 2W57A 2IRFG 1Y0UA 4HZFA 1X3UA 1RUOA 4EQQA 1YG2A 4HOBA 5FGMA 3I64A 3WODF 1PP8F 1FZPB 3QU6A 5BMZA 4KN7X 2XV4S 4BAYA 4I7HA 3FM5A 2EA4A 2EA2A 3HRTA 2VONA 1CF7B 5DCMB 2Z9OA 2VE9A 5L3DA 3Q9SA 2P8TA 4LD5A 3F6VA 3JW4A 1OYIA 1YW8A 3E6CC 2L4AA 2L4MA 6PAXA 4BH9A 1G3WA 1G3YA 2UWMA 1LJ9A 1YS6A 4HLYA 3WTWC 5DUIA 1TW2A 3PQKA 2ZCWA 2EV0A 2KIUA 2PMHA 3KETA 1G4DA 4I01A 2ZNYA 4M72A 1O3SA 1ZRFA 3ZN0A 3MQ0A 2GZWA 1XB4A 2HKXA 2NAZA 4IHTA 1Q1HA 1IAWA 2XKOA 2TDXA 3J7AO 3ECHA 5CJ9A 1KYZA 4RS8A 2QQBA 3S2WA 2HQNA 1R00A 5ILVA 4AWXB 4LLGF 3K0LA 1E2XA 4EJWA 1JHFA 1JGSA 4B8XA 2RNJA 5LEKA 1XGMA 2M87A 2VOPA 2NRAC 3GFIA 3WTVC 2A61A 4BXUA 1QZYA 2ZO4A 3U1DA 2DI3A 4KNYA 4Y15A 4NB5A 3GLXA 2VODA 4PGGA 3EYIA 3VOEA 2W24A 3T8TA 4I0BA 3RKYA 1B1BA 4IPAA 1DP7P 3I5UA 1F4KA 2HFHA 3SQNA 4WXHA 4Y17A 1YW7A 1DDNA 3BP8A 4B09A 2MBFA 2DK8A 4IRIA 1U5TC 3V7SA 5ILSA 4YFNF 3QPHA 1EH8A 4DNCA 4RB3C 4CZZA 1UCRA 1T38A 4KUMA 1MDMB 2VBXA 2PFBA 5EEGA 2KRFA 3I53A 3RYRA 5LHGA 5BOXA 5E1WA 5LHIA 1R36A 2F5FA 2PBIA 2V1DA 4UXNA 3W6JB 5DV5A 3GYHX 5CVIA 4P9UA 2P7CB 3HTSB 2BBYA 3CO6C 3P9CA 3HTUA 2VOOA 2MH9A 2NNNA 1FBUA 3ZP5A 2KKOA 3I54A 4I02A 5HVQC 3IL2A 2L01A 4LB5A 2M1BA 3C7JA 2NYXA 2YU3A 3CTAA 1RIOH 5CLSA 3DF8A 5BPIA 5DCFA 5IT9K 4DQ2A 5HS9A 2YX7A 3W6KB 5KK1A 3M9AA 5HLHA 4YG2F 4KIGA 4KT5C 2QLZA 3E6BA 2O61A 5JHUA 2F5CA 4WK8F 5CYVA 1J75A 2RQPA 5D6FA 4KFCA 2FMYA 2FXAA 4RGSA 5FLXK 2CSOA 4M6XA 4Y13A 3I71A 3GVAA 4EJTA 3REOA 1T0FA 3HSEA 2QBYB 4HAMA 4HF0A 1RNLA 2EFOA 2NS0A 4UUVA 3ELKA 4AVPA 5CVRA 3HSRA 1ZN2A 3EETA 1SFUA 1ONVA 2JT1A 4A6EA 4ZYGA 1GXQA 2FSWA 2VBYA 1XN7A 4LGWA 3E3VA 2V1UA 4ENJA 2LF8A 2DTRA 1D5VA 2JZYA 3J80K 4I09A 2JSCA 5BQTA 2D2WA 5JVTA 4XRFA 1O3RA 3O6BB 3OV8A 4BNCA 1TBXA 1QBJA 2XHKA 4M73A 1TNTA 2M30A 3TO7A 2ZBKA 2O8XA 4IHSA 1YFHA 1FY7A 2A3SA 1V3FA 3RKXA 1IN8A 3R60A 2A6EF 2QQAA 3E5QA 1ZG3A 2F2EA 3LSTA 5L3EA 4RB0A 2FBHA 3QU3A 4UVAA 4ENKA 2JTVA 4HBLA 1SD5A 4EMSA 1HXDA 4LJZF 4O6JA 1WQ2A 4EJOA 2FMLA 3P7NA 3L09A 1QGPA 5EEHA 4HX8A 3KP2A 3RPUA 4KIBA 3F8BA 1U5TA 3ROUA 3DFGA 1T39A 3LFKA 4WXCA 1BC7C 4XBFA 2XUBA 1BIBA 1SD6A 3EQLF 3DQVC 4RGXA 1FWZA 1RI7A 4A5NA 2OQRA 3MAJA 4ZYDA 3M8EA 5J8CA 1KU3A 2J5PA 2IA2A 3P9IA 4ESBA 2KJBA 4ETSA 3VODA 4JQFA 3VFZA 4U0VA 4BHCA 2P5KA 1LNWA 1JXSA 1UHMA 1DUXC 2LF7A 2BEOA 2PLYA 2FNPA 1D3YA 5DYMA 3F8FA 4A0ZA 4FT8A 1XCVA 2G9WA 3GO5A 1HKTA 3L2CA 2D1VA 5D5UB 2W84A 4AIHA 5FFZA 2Y0MA 1MZBA 1WWXA 5DUKA 2ISYA 2QENA 4OIQF 4EM2A 2MH2A 2XROA 2Q0OA 3GW2A 3L9FA 1ODDA 2XKPA 1ZLJA 2CYYA 3LQRA 4H0EA 2D45A 1HKQA 2YX4A 1WSUA 3IRRA 1WI9A 4MGRA 2QM3A 2DFIA 1ZHFA 5E17F 1TW3A 2R7FA 4ZZLA 3SHFA 3M8FA 1IZ1A 4G8XA 1EV7A 3F3XA 2MA3A 1NHAA 3BWGA 1B4AA 3KZZA 5HS7A 1HW5A 2AXLA 3GZ6A 3C18A 1ZRDA 4YFKF 4OMYA 4MQ9F 1IXCA 3P9KA 1PDNC 3DEUA 2Q8KA 3PQJA 4CO8A 4A2UA 3LWFA 1T98A 3IWZA 1LDJA 1S6LA 4CICA 1DPUA 4IXAA 3LA7A 1XSDA 3ZMUA 2WWYA 1H9TA 4MQVA 2RGVA 5H20A 1OPCA 2A68F 3RIRA 1XSVA 5LRSA 3E6DA 2FEZA 2BYVE 3RJPA 3WGHA 1TQIA 4MHGA 3ZPLA 1ZG1A 2RKHA 5LLQA 2IA0A 2Y48A 2P6TA 5K5QA 1MKMA 4L9TA 3B02A 4M74A 1USTA 5D6EA 3RI4A 1XCBA 2ZMEA 4U7DA 2EJRA 4L0YB 1ZARA 3NQOA 4MEXF 2MLGA 4MNUA 1QZZA 1R5HA 2UXXA 1SMYF 2X4HA 1SMTA 2HTJA 1P2FA 2COMA 2EB7A 2FE3A 2KJCA 1CGPA 2FQ3A 2CO5A 2OQGA 4HF1A 4GCVA 4HV5A 1FSEA 3FXQA 1RZ4A 3BPXA 4CHUA 2HWVA 5D4SA 2ESHA 4G6QA 1AWCA 3BROA 1FC3A 3MZYA 4XSXF 5CVUA 1JE8A 3WG9A 3GUDA 1IXRC 5D8LB 2GWRA 4L9NA 1XGNA 4UVBA 4RAZA 1K78A 3NEUA 1OR7A 2HQRA 5ILUA 5ICEA 1K79A 1TLHB 1XDSA 1ZYRF 3LAPA 1R1TA 4A0YA 1O7LA 2HGCA 2GXGA 3HHGA 2GAUA 4YIFA 4Q4ZF 2MC3A 1UFMA 4YIIA 1MGTA 1YO5C 3J81K 4EVIA 2PQ8A 2R7DA 4N9IA 3K69A 4P9FA 1A04A 5E18F 1ZGJA 5HDNA 2ACJA 2GQQA 2STTA 1HW1A 2BV6A 1HQCA 4G6DA 2A07F 2XAHA 5JI6A 1TQPA 4M6YA 4OMZA 2YR2A 2ZNZA 1RUNA 2E1CA 2OA4A 2D1HA 4MTEA 3QOPA 2A6HF 3KEOA 3V8JA 4ZYHA 1H9GA 3TDZC 4EM0B 1ON2A 2LDUA 2ESNA 1BI3A 4IVNA 1F1ZA 1S29A 3T8RA 4KMFA 1IXSB 4R1HA 4HA8A 3FWEA 3K1PA 2CW0F 4FX4A 4KICA 5ICCA 3MCZA 5LEJA 1HSJA 4LMYA 3ZQ7A 1W7PD 4GO1A 3KCCA 2FU4A 3LA3A 5FD5A 4KIFA 5BPDA 3L00A 1U5TB 3O2PE 2VC0A 3I0TA 4R79A 4U0YA 2FF4A 3ECOA 4QLCU 3SXYA 5FD6A 2HEOA 2K4BA 3V8KA 3HSFA 1E17A 3EUHA 5AIPA 1VTNC 3DP7A 1STZA 4HV6A 2CGPA 1BC8C 4L9JA 1J5YA 1MJBA 3F23A 1ON1A 2HYFA 1REPC 2QQ9A 3TGNA 4HF2A 5F64A 3FHZA 2V1XA 3HUGA 3COAC 2M8EA 4R8HA 4S05A 5A2QK 3WTYC 2MD5A 1XMKA 3TO6A 2AS5F 2RV8A 5L3GA 2DAOA 2V79A 1G3SA 3WTXC 2HR3A 4HDVA 1W4MA 1BM9A 1P4AA 1SFXA 5E1ZB 2VBZA 2HTSA 3CDHA 3EYYA 1UB9A 1KA8A 4GYGA 5E1XA 1LB2A 2Q2EA 1YW9A 3RKWA 2ETHA 4I0AA 3GZ5A 3TOBA 2RDPA 5LBQA 3ZMZA 5DD4A 2E1NA 4PZJA 2K4JA 2P5LC 4RGRA 1SAXA 1R23A 5CVVA 2E7WA 3BJOA 2UXNA 3ABUA 5J6XA 3VEPA 4UVCA 4F7ZA 5L3BA 2Y75A 4FHTA 4HX4A 1O3TA 1F9NA 2JPBA 2C6YA 2NNYA 1KQ8A 2EFWA 2F5DA 1XGOA 3E5XA 2IJLA 4HW0A 3RYPA 2W85A 3ZMTA 3R0JA 4L18B 1Z1DA 2DBBA 2EFQA 1KU9A 3QPTA 3FZVA 1D8JA 3WTZA 3GF2A 3JAMZ 3GWZA 3FMQA 2QWWA 3E6MA 3MFKA 5L3CA 4XLPF 2CFXA 4ON0A 4LLNA 1FT9A 2ZMEB 4ENMA 2DQRA 2GXBA 3FX3A 4CYDA 2OBPA 4FX0A 1BI0A 2K27A 2XAQA 1KQ9A 3F8MA 4S04A 2F5EA 1FOKA 2V9VA 4CXFA 3OOPA 3WGGA 4CDGA 3GEZA 2WTEA 4E70A 4M9SA 3KE2A 3WU1B 2O0YA 2EWNA 2VC1A 1B6AA 2P6SA 3V8LA 3BJAA 2HZTA 4JK1X 2PMUA 3HRSA 1W5SA 2H09A 3IC7A 4WXDA 4A5MA 5K1YA 4OIOF 2RVCA 3FXUA 1C0WA 5L3FA 5JFRA 2V6CA 1HBXG 2RN7A 5ICGA 3KZYA 1K78B 4LB6B 2DPDA 4EGYA 2HS5A 3QAHA 3GFLA 3HRUA 3IKVA 1AOYA 1QNTA 2GIVA 4BYYA 2YSRA 2R3SA 2ADUA 1ZREA 3F6OA 3V7CA 2PEXA 1W5TA 4G9YA 1IN4A 5HDGA 4KA4A 4WF2A 5LRRA 3WGIA 3WE3A 3G3ZA 1P4XA 4ESFA 4HX7A 1L3LA 1R7JA 1EH7A 2ZXJA 4BQAA 4ESJA 4HDUA 1U2WA 3ZMDA 1LQ1A 2DU9A 4XLNF 4AD9A 1O3QA 3F72A 1TQMA 4ENNA 1KU7A 1YTYA 1OYYA 2O3FA 5FO5A 2P4WA 3F21A 1OKRA 2PG4A 1XMAA 4K2EA 1IN6A 3GX4X 3K1NA 3IWFA 2QYOA 3JTHA 3B73A 1Z91A 1Z9CA 4ZYEA 3RDIA 3SFZA 4TV7A 4AIKA 1ZG5A 1R1UA 1J7KA 3CUQA 2H27A 2QZ8A 2L3DA 4RGUA 4EJUA 2DQLA 4KMUX 1YIOA 2HOEA 2CQKA 3CUOA 2FOKA 3QRFF 1J59A 2E7XA 2UZKA 3T5XA 1HKSA 3SZPA 4ZZDA 2VT2A 3IHUA 3MEXA 1MD0A 5HOOA 4IJAA 4WX9A 4WCGA 1KQ0A 4OU0A 4HQMA 1I6XA 3D5LA 5LHHA 5TRDA 4G94A 3I59A 4G7HF 2DPUA 2DT5A 4KYWA 1BOAA 2ELHA 5FLXZ 4CGZA 3F8CA 2DK5A 2L54A 1I27A 4LG0A 1QQIA 5TJJA 3WTUC 3R0AA 1ULYA 1IW7F 1FX7A 5FFXA 4YFXF 3CLOA 3H92A 1K6OA 1U78A 3ZN1A 4L5JA 3K2ZA 5E8IA 3T0YA 5K5RA 4M9ZA 1PP7U 1SD7A 4M71A 3I4PA 3EDPA 5KVRA 5D4RA 1I5ZA 1Z7UA 3PFIA 1KGSA 3KP7A 4I2OA 3J80Z 4M9XA 1ZAOA 4ZH4F 2PI0A 4WWCA 2H6CA 1P4WA 2IW5A 3M1EA 1QO0D 3JAMK 3IRQA 2H6BA 2IT0A 4UV9A 3NRVA 2WC2A 4U7BA 1I1GA 2X0LA 1Z6TA 2QVOA 3TKYA 1BIAA 2IPQX 4O5VA 4EJVA 3SZTA 3VB2A 1FLIA 1K7AA 4RB1A 2EFNA 3ZMSA 1Z05A
chains in the Genus database with same CATH superfamily
2JRTA 1MBHA 2XPVA 3Q0VA 2FRHA 3S2DJ 1VF9A 1FBQA 3LOCA 3QP5A 5IP6A 4A3EJ 3DV8A 2RC4A 2XSDC 1VI0A 2R5ZA 3BOQA 1TWFJ 4A12A 2R7SA 4HPQA 4PJNA 3R61A 1JHHA 2KL4A 4IQ4A 4PUSA 1B8IA 2H8WA 3GTLJ 5F08A 1Z6RA 3L2WA 3A4CA 2KRCA 3QOEA 4OIRF 2KIFA 3ZMVA 5IOYA 2X9DA 5AIQA 1ZH5A 5LGNA 3MKZA 1GXPA 3S8PA 3HC7A 3HIFA 2ZKZA 4U88A 1Z21A 4HSTA 2E34A 2L7FP 1IUYA 1BI1A 2E19A 4KT6A 1MBKA 3RTRA 3BDDA 2R5YA 2XVCA 3KP6A 4W1UA 2NVUB 4RAFA 3TO9A 2X85A 4PSXA 5LGTA 1H88C 2ZJPF 2STWA 1NG6A 2DA6A 1MJAA 3I58A 1RC9A 3KFWX 4B47A 3VYUB 3DLLF 3N97A 4RAYA 3F22A 1UHWA 3OS2A 2ZJ2A 4X0GA 3WTTC 4BE0A 4D0PA 2O03A 3TDUC 1A35A 2JMWA 2JPCA 1TTYA 2LKSA 2KQRA 4HYEA 4O3MA 1I1SA 1D0YA 2ZJQF 2HQAA 2LYCA 4G7ZF 3IH4A 3IKTA 3BY6A 1G6NA 1V4RA 2EV5A 1R58A 5IYBJ 3W2WA 2KZVA 2L9NA 2LKPA 4ASNA 1XDUA 1NH3A 1QPMA 4BJ5C 2FBIA 3WE2A 3CCLI 1ZRCA 1HW2A 1FYLA 3AAFA 5FB2A 1YYVA 4CCMA 4JP0A 2DOFA 1Y56A 4UB6C 4HEA2 2OZUA 2CV2A 2BGCA 2ISZA 4QPQA 4BJTA 3Q0WA 3CP2A 2XAJA 1GT0C 3ABTA 4GGGA 1HF0A 3DPLC 2VQLA 2CW8A 1FPQA 2IA1A 1RESA 3Q0UA 5HLIA 2MLKA 1J0RA 4DZJA 2HKOA 4QIWN 1LVAA 4Z6YA 3A01B 4JYKA 3CMAI 3E5UA 1MIJA 2X6OA 2Y0SN 2HU9A 2KMUA 2XAUA 3CCYA 3LMMA 5EF6A 2EV6A 2DW4A 5H6RA 2XRNA 5F6FA 1FTTA 1KU2A 3C1DA 4EGZA 1W7PA 3CJRB 2Y2ZA 1OCZH 1VQOI 1T56A 2NVQJ 3U2RA 1FYMA 2R7WA 1T6SA 3TL4X 1JKPC 2CV1A 4U0WA 3JSOA 3WTSC 4IO9F 1BN5A 3R4KA 4RB2C 3A0HC 4X6AJ 3LA2A 4A6DA 4AUXA 1W1WE 4KN4X 1MNDA 2OJED 2OAZA 5F27A 1B59A 1GLNA 2HYGD 3ISPA 3DKXA 4Q5SF 2E1OA 1SVLA 2JUGA 1XGSA 4P5OA 1J2XA 1BW5A 5IP7J 5D5VB 3H5AA 4D1QA 1U8BA 3ERMA 5K5OA 2QUFA 4PCQA 5DEQA 4BGDA 3L2UA 1WKMA 3GFJA 5ICFA 2FA5A 1V5FA 1R5ID 1W0TA 1IC8A 4ITVA 1EH6A 1DPRA 4AYBA 3GMEA 2K85A 3LSKA 4Q48A 2GA2A 2L7ZA 3JTGA 2J5OA 1VQPI 2VXDA 3OYLA 5DCMA 2VT3A 1CF7A 2JA6J 1IV8A 1DP3A 3G2BA 1IN5A 4QPOA 2M5WA 5CVJA 4ZTFA 5ERIA 1S7AA 1KYWA 4P1WA 1XSXA 4UHTA 2IP2A 2XGXA 3MKLA 1SAUA 4OWRB 1FSHA 2VXZA 1O7FA 1YQAA 2W4SA 5J8FA 3TBIA 1VFCA 2CFOA 4IHVA 3CCMI 1IRGA 3KEQA 4DJAA 1A31A 3JRIA 1WHUA 1MBEA 2G7UA 2DMQA 2HVQA 1W0UA 4C2TA 3OYKA 4GXOA 1VQLI 1GVJA 2KPMA 2OD5A 2LNBA 1S3JA 1BI2A 2VKHA 1HOMA 1ZR4A 1LEAA 2P5VA 2WAQA 3RPQA 1FBSA 1T2KA 4IEJA 3QP6A 3DKWA 3TQNA 2ECBA 3TP0A 3CUQB 1Y6IA 5K7HA 4N9HA 3H9JA 1OQYA 2OV7A 1X1AA 1MJ9A 4AC0A 5AONA 4LK0F 2L02A 3VYRB 1BR4A 4V2GA 1WJFA 1SD4A 3CUQC 1A36A 4AIJA 3KP4A 5LGUA 1RRJA 4L0ZB 3MD2A 5D5XB 1YLFA 1P92A 1OMIA 5CQEA 3TMOA 5D5WB 3TOAA 2CG4A 3MWMA 1R22A 1R1VA 2OU2A 3V7RA 2VE8A 3L7WA 1BR2A 2GA1A 4DBQA 1IF1A 3HYIA 1HSTA 3Q9VA 2LY1A 1OISA 4B43A 1TNSA 2BE5F 3AFHA 4MEYF 3H3VK 1FP1D 3D0SA 1TL8A 2ZXHA 3FMSA 3O3KA 4EM1A 3FBNB 3H3ZA 3PUFA 2VN2A 3KLOA 3WHBA 3M7GA 3PUBA 3F8NA 3KLNA 4X1EA 2R7XA 2VBWA 3PJRA 4KDPA 3CO7C 3NARA 4FETA 5C4XJ 3ML6A 3RZOJ 3I59B 1FNNA 2K7LA 4L9VA 5DD8A 3CJNA 1H8AC 3LSGA 3K1MA 4NQWA 1QVTA 2JK3A 2IAIA 3WU2C 5JR3A 1H0MA 3RPUD 2PJPA 3JSPA 3DTIA 1D0ZA 2NOGA 3G73A 5EDNA 3AG1H 3QQAA 4S0HB 3UR3C 3AG3H 3BTJA 1MSEC 1Y0NA 1G2HA 5LD2C 3PSFA 5D8KB 4BHBA 5EGOB 2G7HA 4LG0B 3O8HA 4OIPF 4RBOA 2HNHA 2CH0A 3N4MA 4EATA 1RPWA 5HDKA 4A3BJ 1R5GA 2P7VB 2YPRA 3QPLA 2F4OB 5F0FA 4XICA 4G7OF 2K9LA 3S16J 1VQMI 3S32A 3K4JA 2E1MB 3K4LA 3DU5A 2E36A 1L0OC 3J81Z 3JRHA 3DXJF 4E7HA 3HOZJ 5FKMA 1TT5B 1Y8QB 3IH3A 3MVPA 1Z77A 2EFPA 4P96A 1DU0A 5J4VA 2XAFA 1FYKA 2LK2A 3VSLA 2R4GA 2Z5UA 4BL0B 5K7FA 3FM3A 1MMGA 1PYVA 2M9HA 2H94A 1MMNA 3FXLA 3U9GA 1S8NA 5IT3A 4P55A 3OL4A 2XGCA 4Q47A 3HHHA 3HOWJ 4UUSB 1YHQI 3C3WA 2XAGA 2EK5A 4IX7A 2WV0A 4OAYA 4CYCA 4MTDA 3HKZN 2NOJB 5C4JJ 5J47A 2LD5A 3S3MA 5H6QA 3DBHB 2OZ6A 1B9MA 2COBA 2FBKA 2VJJA 4PGHA 1DGWY 4GYIA 4E7JA 3KP3A 4LFUA 3S3OA 2M45A 3AKZA 1YRNB 4HNTA 2K86A 3G71I 1W36C 3DPTA 1MDMA 1VZ0A 4HSRA 4YELA 2N8GA 4XSZF 4BE1A 2O6GE 3BT9A 3WU0A 1YS7A 2CMPA 1LDDA 4C3IJ 3GTKJ 3ERED 1VQNI 1ZGAA 2Z99A 1K61A 2EINH 3L2QA 5BS6A 2I8DA 4XK4A 1VQ8I 1ERDA 2R5ZB 3C2HA 4M3FA 4CUGA 3FF5A 1U3EM 3BJ6A 2Q1ZB 3E97A 1TWHJ 3LAJA 1F5TA 2NVTJ 2RREA 4Z2YA 4EV0A 3PM1A 2DA4A 1B8IB 2BXYA 1P6RA 2Z3YA 1IN7A 3UNGC 3DWLE 2WAFA 3JRCA 1U6GA 4IHYA 5M5WJ 2V9PA 1WVRA 3R6SA 4NHJA 4PDKA 3BQYA 2XASA 3KP5A 3CMMA 2L0KA 2M0MA 1S7OA 2IVMA 2HDCA 2KP6A 4IRGA 2CWEA 2R5YB 2PN6A 3H3UA 3K4MA 1J9IA 3IV5A 2DMTA 1XD7A 2DLLA 1LEBA 2X1CA 1FIPA 5DS9A 1BBYA 3EPZA 2DO7A 1PUEE 3FXRA 4UNOA 4LLLA 4CZCA 4Y4RA 4QWQA 3GXOA 4IHWA 2W82A 1OYWA 2XIGA 3TW7A 2ELJA 2ZFWA 3GFMA 3HOTA 3G4SI 1S5LC 5HLGA 1ZLKA 2IBDA 4BQQA 4BHPA 3E1SA 4IZZA 3ULQB 2LC2A 2JA5J 4UV8A 4IL6C 3T1BA 5FKKA 1MW7A 5A2QZ 1B9NA 2BY3A 4BS9A 1U8RA 4AM3A 3BC8A 2K02A 1G3TA 4XKVA 1LDKB 3LQQA 3K9TA 4Y52J 1WJEA 3M07A 3BPVA 1USSA 4LK1F 2MABA 3FMRA 4E7ZA 3Q5FA 4IRHA 1JT0A 3J7ZI 3HOSA 2B0LA 3V4GA 1VQ5I 1IRFA 2A69F 2DT6A 2LSOA 1FIAA 4IF4A 5E8GA 1E3HA 4OINF 1D8KA 5HS8A 2MFZA 1R49A 2W25A 5IYDJ 2FNAA 2QBYA 5IT9Z 4C2UA 1DGRM 1WRJA 2XF6A 4RM3A 2QSHX 2TRTA 4L5IA 2OTJI 2MYSA 5F1RA 4CCJA 2WB1N 2KIMA 4N0BA 3BZ6A 3CCRI 3HPHA 4A0XA 3FDYA 1GV5A 2K9SA 5ED4A 4JBAA 2O9LA 2OTLI 1W7PB 1O57A 2X1EA 1SFEA 3HRMA 3I56I 4I6ZA 3MZHA 3DLAA 5E20A 1FOWA 1APLC 1FP2A 3GTQJ 3ABMH 2V6EA 3BCBA 1GHCA 4I98B 2Z33A 2A5YB 2CRGA 4HQEA 5DDGA 1BJAA 4OOIA 2L9SA 4HLXA 1QHHD 3TW6A 2W57A 2IRFG 3D5RC 2Z1DA 2JQ7A 1MMDA 1Y0UA 4HZFA 2OF7A 1X3UA 2CQXA 4EQQA 1YG2A 1RUOA 4BKXA 4HOBA 4NC7A 2K3FA 5FGMA 3I64A 3WODF 3OOUA 1PP8F 1FZPB 3QU6A 5BMZA 4KN7X 2XV4S 4BAYA 2FD5A 4I7HA 3JRDA 3FM5A 2EA4A 5KAFC 4N4NB 3LSPA 2R7QA 2EA2A 3HRTA 1D1AA 2NVXJ 2VONA 2M3AA 1CF7B 5DCMB 2Z9OA 3BR5A 3KYDB 2VUMJ 3BR6A 2VE9A 4XNFA 2R7TA 1MH3A 5L3DA 2R7RA 3Q9SA 2P8TA 4LD5A 3F6VA 4ZDLA 3JW4A 3CD6I 3ZQIA 1OYIA 1YW8A 4F3QA 3E6CC 2L4AA 5EYRA 2L4MA 1BJZA 6PAXA 4BH9A 2A5WA 4UUSA 1G3WA 5E79C 2HVRA 3E0JB 1G3YA 3SEZA 2UWMA 1LJ9A 3HEFA 2XGDA 2P81A 1YS6A 4E6KG 2DJIA 1MMSA 4HLYA 3HGYA 4E7LA 3WTWC 3H0DA 2IGOA 5DUIA 2CQ7A 1TW2A 4NNJA 3PQKA 1S9HA 1O4XA 2ZCWA 5FROA 5KCMA 2EV0A 2XF7A 2KIUA 2XB0X 2B9SA 2PMHA 4IKFA 3KETA 1G4DA 2JVGA 4I01A 5C3EJ 2ZNYA 4M72A 1O3SA 2EIMH 2ZC2A 1RETA 5CKTA 1ZRFA 3ZN0A 4GRIA 1BA5A 3MQ0A 2GZWA 2PMZA 2FQ4A 1XB4A 2HKXA 3UKGA 2NAZA 4IHTA 1Q1HA 2GOXB 2RQQA 1IAWA 2XKOA 2TDXA 3J7AO 2IS2A 2CU7A 3OYGA 3ECHA 3B6AA 1V5GA 2EZLA 4RLFA 2E2HJ 2LFBA 5CJ9A 1KYZA 3BR3A 4RS8A 1T0FC 2QQBA 2KDZA 2M7AA 4D5FA 1IRZA 3S2WA 2O7OA 2HQNA 5HNHA 1R00A 5ILVA 1HDPA 4AWXB 4LLGF 3LSIA 3K0LA 2OCEA 3DEWA 3SZGA 3CMEI 4ZDOA 1YITI 1E2XA 4JX4A 4EJWA 1JHFA 4RM2A 4NQWB 2JA8J 1JGSA 2RAEA 4UY8I 4B8XA 2RNJA 5LEKA 5DM6F 2ZJRF 1X4PA 1XGMA 4D7NA 2LRDA 3VDXA 1UAAA 3S1MJ 5EG0A 2M87A 2VOPA 2JWTA 2ZB9A 3S17J 2NRAC 1FMVA 3GFIA 4E7SA 2QF7A 3K4NA 2BW3A 4DYCA 3WTVC 1ZELA 2A61A 4BXUA 1QZYA 1R9TJ 4YRVA 2DMUA 3RQ4A 2ZO4A 2CW7A 2LY2A 3U1DA 1D1CA 2BHZA 4PFPA 1MH4A 5J1UA 1G8XA 2DTZA 2DI3A 2MW8A 4IQJA 4E4HA 4KNYA 4Y15A 4NB5A 3GLXA 2VODA 4PGGA 5F1JA 4B44A 3EYIA 1WZ2A 3VOEA 3W2AA 2XF5A 5E3OA 2W24A 2CUFA 4I0BA 3RKYA 3T8TA 1TWAJ 1B1BA 4IPAA 1DP7P 3I5UA 1F4KA 4RA2A 2HFHA 3SQNA 3VYSB 4WXHA 1N78A 4Y17A 4CCKA 1FOYA 1YW7A 2EZIA 3CDIA 3GTPJ 1DDNA 2DFEA 1I6HJ 4W97A 4XMYA 1V5EA 3BP8A 4B09A 5M3FJ 4M3EA 4J00A 2MBFA 3NWSA 4CYCB 1IG7A 3IAS2 3PSIA 2DK8A 4IRIA 1U5TC 3V7SA 1WCMJ 1XMXA 4XLAA 2HPIA 3WHCA 1Y1VJ 5ILSA 4YFNF 1LUJB 3QPHA 1EH8A 4DNCA 4RB3C 5F04A 1XG1A 1D0XA 3SEQA 4CZZA 3LL7A 1UCRA 1SC7A 1P7IA 5GTHC 1T38A 4B4CA 3I4NJ 4KUMA 1MDMB 2P0WA 2VBXA 3J7AY 2EPFA 2F48A 2PFBA 1JUPA 5EEGA 2GLOA 1B72A 2M7BA 2QA4I 1WPKA 2KRFA 3I53A 2D5VA 4DYRA 3HBLA 3J7YJ 4BDYA 3RYRA 5LHGA 5BOXA 5E1WA 3KPHA 4YEJA 1OLTA 3OS0A 5LHIA 1X1DA 1R36A 2F5FA 4NC8A 2IGMA 2PBIA 4PK4A 2V1DA 1QVUA 4UXNA 1JUMA 3W6JB 5DV5A 3GYHX 5CVIA 3BTIA 1OFCX 4P9UA 4NUBA 2P7CB 3HTSB 1R71A 2BBYA 2WY8Q 1ORKA 3FHNA 2DXIA 2M4GA 3CO6C 1UHSA 3P9CA 3A2KA 2V1NA 2VKVA 4YIRX 1F36A 3HTUA 2VOOA 3RKQA 2MH9A 2NNNA 2EIKH 1FBUA 4FISA 3ZP5A 2KKOA 3I54A 4I02A 2VLAA 4MO7A 5HVQC 1JUSA 1OCOH 3IL2A 4XOTA 3AG2H 1MBJA 3D5SC 2L01A 4LB5A 3OYAA 2M1BA 3C7JA 2NYXA 2YU3A 3CTAA 3EUKL 5CLSA 1RIOH 1JJ6C 3S2HJ 3DF8A 3DTKA 2I10A 4DW6A 5BPIA 5IOZA 3FK7A 5DCFA 5IT9K 1EF4A 4DQ2A 5HS9A 3S3NA 2YX7A 2K9NA 3W6KB 3JRAA 5KK1A 1FMWA 3ZRGA 4XORA 3M9AA 5HLHA 4YG2F 4KIGA 4KT5C 3K4CA 1KONA 2KHMA 2QLZA 2LR8A 3E6BA 3CJQB 2O61A 2EZHA 3BG6A 5JHUA 2F5CA 4IHXA 5JHFA 4WK8F 4CH7A 3CCJI 5CYVA 1DU6A 1P9QC 1J75A 2RQPA 5D6FA 5DTDA 5IY5H 4KFCA 4BBSJ 3OYDA 2FMYA 3OSFA 1GDTA 2PX9A 2FXAA 4RGSA 2R7UA 5FLXK 2R0QC 2CSOA 4M6XA 2UV1A 3ZR8X 4C9YA 4Y13A 5CQGA 3I71A 2ID6A 4M3BA 3GVAA 2CUEA 3D1NI 4HNUA 3H5NA 4BE2A 4EJTA 3REOA 1T0FA 1T8IA 1OCRH 3HSEA 2MD0A 2QBYB 4HAMA 4HF0A 3HDDA 3I3LA 1RNLA 2EFOA 1Z05A 5K7ZA 2NS0A 2GOMA 3W6VA 2KT0A 3K4KA 4UUVA 3G1LA 2DOAA 4FE7A 3ELKA 4AVPA 1JTXA 5CVRA 3BCAA 3HSRA 1ZN2A 1W5CC 3EETA 2IXSA 1SFUA 4E7IA 1ONVA 1PVEA 2JT1A 2DODA 2M2EA 3FXKA 2ME6A 1GXQA 4A6EA 4ZYGA 2FSWA 5DM7F 2HZDA 2QGUA 4ZJZA 3ZQGA 2QEXI 4ZYAA 2VBYA 1XN7A 4LGWA 3E3VA 4ZDPA 2V1UA 4ENJA 2O8KA 2LF8A 2DTRA 1D5VA 2JZYA 3J80K 4FE4A 2JRMA 4I09A 3HOXJ 4XRMA 3NAUA 5B5EC 2JSCA 5BQTA 2D2WA 3HZJA 3PIOF 2LVSA 5JVTA 2JA7J 4XRFA 5TGTA 4RAGA 4FCYA 1O3RA 3O6BB 3X2QH 5FKLA 1AHDP 3OV8A 4BNCA 1E3PA 2EH3A 2DA5A 1TBXA 1XTAA 1QBJA 2XHKA 4M73A 3FXOA 4GDFA 1TNTA 2M30A 3TO7A 2ZBKA 2O8XA 4IHSA 4B1RA 1YFHA 1FY7A 2A3SA 1V3FA 3RKXA 1IN8A 3R60A 1IRXA 3OYHA 5B1BH 2A6EF 2QQAA 3E5QA 1ZG3A 3A0BC 2W1OA 2F2EA 2NXNB 3ESWB 3LSTA 1ETVA 5L3EA 2ZMEC 4RB0A 3RCOA 2FBHA 3QU3A 4BJ6C 4UVAA 4ENKA 2VIXA 3H36A 4C2MJ 1ZR2A 2JTVA 2QSFX 1YJNI 4HBLA 5C44J 1ZKGA 5JLWA 5B1AH 1SD5A 3CF5F 4EMSA 1HXDA 1D5YA 4C30A 4LJZF 4O6JA 1WQ2A 4EJOA 2FMLA 3P7NA 3L09A 1QGPA 5EEHA 4B3XA 4BUPA 3SJMA 2W48A 3KIOA 4HX8A 4JOMA 2LKXA 4II2A 1FEXA 3MMYB 1RKWA 3KP2A 5TISC 2DYSH 4G6TB 4MIMA 3RPUA 1WJBA 3FKJA 1BR1A 4KIBA 3F8BA 2X6XA 4XLHA 1U5TA 3ROUA 3DFGA 1T39A 2EBIA 3LFKA 2AXTC 4WXCA 3H0GJ 1LFUP 2ZXIA 4XQFA 1BC7C 2E35A 2LY9A 4XBFA 5GP9A 2XUBA 1BIBA 1SD6A 3EQLF 4C3HJ 3DQVC 4RGXA 1FWZA 1RI7A 4ZC3A 4A5NA 1YIJI 1IO2A 2OQRA 3M4OJ 3MAJA 4M3DA 4ZYDA 4PJMA 2XB5A 3L1PA 3B6CA 2JA2A 5FLVA 1AKHA 3M8EA 3DBRB 5J8CA 3OYJA 3H5RA 1KU3A 3DBLB 2CUJA 2J5PA 1QU3A 2IA2A 3P9IA 4ESBA 2KJBA 4ETSA 3VODA 1BL0A 3W2VA 2Y31A 2VPLA 2BVLA 4JQFA 1ZGWA 3VFZA 4U0VA 3OIQA 4BHCA 2DA2A 3PO3J 2P5KA 1UZCA 1LNWA 3SFIA 3F0CA 1K4SA 1JXSA 2WBMA 4F93B 1UHMA 4EEFG 4XONA 5M5XJ 1DUXC 2LF7A 2BEOA 1JGGA 1X58A 2PLYA 2FNPA 3FK6A 1D3YA 5DYMA 2ELKA 3F8FA 4A0ZA 1F43A 5M5YJ 4FT8A 1XCVA 2G9WA 1JKOC 3GO5A 1JKQC 2XDVA 3L2CA 1HKTA 2D1VA 5D5UB 3LSJA 2ZFUA 3M8JA 2QKLB 5EJCA 3L2VA 2W84A 4BQOA 4AIHA 5FFZA 1X1BA 2Y0MA 1MZBA 1WWXA 5DUKA 2ISYA 4XN3A 2QENA 4AYBN 2VJ5A 4Y33A 4OIQF 4EM2A 2MH2A 1YJ9I 3BG5A 2V9KA 2XROA 5EG0B 2Q0OA 2F4IA 2HDDA 3GW2A 3L9FA 3TEDA 1ODDA 3NWTA 2BHYA 2XKPA 4A3GJ 1ZLJA 2BW3B 2CYYA 3LQRA 4KJZA 4H0EA 2D45A 3ZGKA 2JN6A 2VJIA 1HKQA 3K70C 2YX4A 3IH2A 1WSUA 3IRRA 2IS6A 1WI9A 2DOEA 2L7KA 3BR2A 4MGRA 2QM3A 1Z3YA 1GV2A 1A6IA 2DFIA 1GVDA 1ZHFA 5E17F 2YU9J 1TW3A 2R7FA 1SEUA 4ZZLA 3SHFA 3M8FA 4FASD 1IZ1A 4G8XA 4AU7A 1EV7A 3F3XA 4RMNA 2MA3A 1NHAA 3F9KA 3BWGA 3G1MA 1B4AA 2G0EA 4ANJA 4FTHA 3KZZA 3FISA 2WAQN 4II3A 5HS7A 1HW5A 5EZGA 2AXLA 3GZ6A 2VQGA 3C18A 1ZRDA 1G59A 4YFKF 2BZTA 3RSNA 4OMYA 4MQ9F 1IXCA 3P9KA 1PDNC 3OR1C 3DEUA 2Q8KA 3PQJA 4CO8A 1UMQA 1Y8RB 3LWFA 4A2UA 1T98A 1QZEA 3IWZA 3BTCA 1XS9A 4F55A 5BNGA 1LDJA 1S6LA 3PNVA 4CICA 1DPUA 4KITB 4IXAA 3LA7A 4D5CA 1XSDA 3ZMUA 2CS3A 2WWYA 1H9TA 2VQCA 4MQVA 2WAEA 3OY9A 2RGVA 5H20A 1OPCA 4HG2A 2A68F 2ZSHB 4V19K 3RIRA 1X19A 3S1RJ 2HI3A 1PJRA 1XSVA 2EIJH 4XIDA 5LRSA 3E6DA 2Y9ZA 2HPMA 2FEZA 2BYVE 3RJPA 3WGHA 2Y0SA 1TQIA 4MHGA 3ZPLA 1R4NB 2IGKA 4IOAF 1B72B 3VWBA 1ZG1A 2RKHA 2WADA 5LLQA 2IA0A 3H35A 2X48A 4CCOA 1H89C 2Y48A 5FRNA 3QYEA 3VPRA 2P6TA 1TWGJ 3SDBA 2JSPA 5K5QA 3IAM2 1EJ9A 1MKMA 4L9TA 3B02A 4M74A 1USTA 4AVZA 2DA7A 5D6EA 2XPWA 3RI4A 3MN2A 1XCBA 3LNQA 2ZMEA 2VJ4A 4BU2A 4U7DA 1MMAA 2CQNA 3EUAA 2EJRA 1XPXA 2A05A 1TP4A 1U9NA 1X4OA 1VQ7I 4L0YB 1TZLA 1ZARA 1I50J 3NQOA 4MEXF 2MLGA 2JVHA 5FKNA 4MNUA 1QZZA 3U21A 3IUOA 3QODA 4BEHA 1R5HA 4MFDA 2UXXA 3HM5A 2DA3A 1W36D 1BOBA 1SMYF 2X4HA 5GAGJ 1AU7A 2LH9A 4LIVA 1SMTA 2HTJA 3M1CA 1P2FA 1M1EB 1QRYA 2LMDA 2COMA 3A1YA 2EB7A 2FE3A 2KJCA 1XX5A 1CGPA 2FQ3A 4OAZA 2CO5A 2HOTA 2OQGA 2X6YA 4HF1A 4GCVA 1WH5A 4HV5A 1FSEA 3FXQA 1RZ4A 2DCEA 3CQZJ 1ZTRA 2VKDA 3BPXA 1LE8B 2HWVA 4CHUA 5JVGF 5D4SA 3KYCB 2ESHA 4G6QA 3ZXSA 2FJ1A 4BACA 3BROA 1AWCA 3ZCOA 3JRBA 1YJWI 1FC3A 3MZYA 4XSXF 5CVUA 1JE8A 4L5EA 3WG9A 2QCOA 3GUDA 1IXRC 5D8LB 2E2IJ 3FXJA 4A3MJ 2GWRA 2ID3A 3L2RA 3BZKA 4L9NA 2VASA 1XGNA 4LG3A 1V54H 1NG7A 4UVBA 1R4MB 4RAZA 1K78A 3PO2J 3NEUA 1OR7A 1UELB 3CESA 2X6WA 1HDDC 2HQRA 5ILUA 5ICEA 1K79A 1TLHB 2M4KA 3CP8A 1JKRC 1XDSA 1ZYRF 3QYBA 1R1TA 3LAPA 2W00A 4BDZA 2R93J 4QTRA 2BY0A 1TC3C 4A0YA 3BG9A 3HXLA 1O7LA 1N75A 2EILH 2HGCA 2GXGA 1KZHA 3GTJJ 1ZQ3P 2HYJA 3HHGA 2GAUA 4YIFA 4Q4ZF 3DKYA 1IGNA 4PSWA 3HOVJ 1P7JA 2FX0A 2DA1A 2MC3A 4A93J 1UFMA 4YIIA 1MGTA 3HOUJ 4M3GA 2HOAA 1YO5C 4CA0A 3J81K 4EVIA 1T95A 1OCCH 3ZOBA 2PQ8A 1MNEA 2R7DA 4GFBA 4N9IA 3K69A 4P9FA 1LVKA 1A04A 3RZDJ 5E18F 4F52A 1ZGJA 2LLKA 5HDNA 1DQUA 1VQ6I 2ACJA 1X1PA 4NC6A 3GTOJ 2TCTA 2GQQA 2STTA 2LG4A 1HW1A 2BV6A 1HQCA 4G6DA 4I76A 2DT7B 2A07F 2L5QA 2XAHA 4PFOA 2CUZA 2KRHA 4G12A 1ETOA 1TQPA 5JI6A 3JR9A 4M6YA 4OMZA 4HNVA 1XC5A 2YR2A 2ZNZA 1SANA 2F6CA 1RUNA 1GUUA 4XL9A 2FUG2 2E1CA 2OA4A 2D1HA 2LREA 1HA8A 4MTEA 3H1CA 1T08B 3QOPA 5IP9J 2A6HF 2HXOA 3KEOA 3V8JA 4ZTJA 4ZYHA 3BLYA 1H9GA 3TDZC 1Q1VA 4EM0B 2ZXWH 4A3DJ 5E3MA 3K7AJ 5M3MJ 1ON2A 2LDUA 3FXMA 4A3CJ 3S15J 2ESNA 1BI3A 4IVNA 1F1ZA 1S29A 3T8RA 4A3IJ 1ETWA 4DBRA 3V42A 4KMFA 1IXSB 4R1HA 4HA8A 2IEKA 3FWEA 2B7EA 5E3LA 3K1PA 4JX6A 1MSFC 2CW0F 4FX4A 4KICA 5ICCA 3JRGA 3HPGA 3MCZA 3BR1A 3DPUA 5LEJA 3PFYA 1HSJA 4LMYA 3HL2A 4RLQA 4BY1J 2JUCA 3ZQ7A 4XKWA 2QKMB 1W7PD 3P5JA 4GO1A 3KCCA 2FU4A 4A3JJ 3LA3A 5FD5A 4KIFA 1TT0A 2L7MP 5BPDA 1LFBA 3L00A 3VSKA 1U5TB 4DIQA 1VQKI 3O2PE 2VC0A 3I0TA 4R79A 4U0YA 2FF4A 3ECOA 4QLCU 3G6EI 3SXYA 5FD6A 2HEOA 3RQIA 2DN0A 2K4BA 3V8KA 5B66C 1NTCA 3HSFA 3E7LA 4LITA 1FJLA 3HKZA 1LPQA 1E17A 3EUHA 3C2GA 3OYIA 1AKHB 3GZNB 5AIPA 5HNFA 1VTNC 3DP7A 1STZA 4HV6A 2VL8A 3HJEA 3OSGA 2CGPA 4XN0A 1N77A 1BC8C 3KZIC 4L9JA 3KX2A 4NDLA 3ZQFA 5FLMJ 1J5YA 1U0JA 3OYFA 3OWTA 4BY7J 5JLXA 1MJBA 2VKEA 3F23A 2ICWG 2EZKA 1ON1A 2HYFA 3QWLA 1X2NA 2AQFA 3C2BA 4Y7NJ 1REPC 1R6RA 2QQ9A 3TGNA 4HF2A 1LKXA 2VB6A 5F64A 3FHZA 2I5UA 2V1XA 2DDAA 3ZQHA 3HUGA 1WJ5A 3PIPF 3S14J 3S93A 1X3ZB 3COAC 1JJ8C 2M8EA 3CDLA 3HB9A 2GM4A 4R8HA 4S05A 4XOPA 2BVMA 5A2QK 3WTYC 1PUFA 2MD5A 1XMKA 3CCEI 2HDWA 3BQZA 3TO6A 2AS5F 2R7ZJ 2RV8A 5L3GA 2DAOA 2V79A 1G3SA 3WTXC 1I39A 2HR3A 2KISA 5F0HA 4HDVA 4NBQA 3OYNA 4Y3OA 3CZ6A 1W4MA 1BM9A 2X51A 4A69C 3ZQQA 1YI2I 1P4AA 1WI3A 2OUMA 1SFXA 2LTPA 5E1ZB 2VBZA 4XRSG 5HODA 3OYMA 2HTSA 2NVYJ 1SFOJ 3CDHA 3EYYA 4F91B 3CCSI 1UB9A 1LE8A 1KA8A 4GYGA 3MZ8A 3OIOA 5E1XA 4V2FA 4F92B 2AO9A 1LB2A 3Q3SA 3N05A 2A6TA 3K6GA 2Q2EA 1QHGA 1YW9A 3RKWA 2ETHA 4I0AA 4CCNA 2HVSA 3GZ5A 3TOBA 2RDPA 5KHDA 5J3LA 1MBGA 4UUTA 3ZMZA 5LBQA 2H1LA 4I99C 1X3WB 5DD4A 3I55I 2E1NA 4PZJA 2K4JA 3CC7I 2P5LC 4RGRA 3W3CA 4BQNA 1SAXA 5EEAA 2FOWA 1R23A 1A6QA 1ETYA 5CVVA 2PJRA 2E7WA 3BJOA 2RNGA 3ASNH 1IDZA 5E3NA 2UXNA 1ACIA 1POGA 4IOCF 3H9QA 3ABUA 3CC4I 5J6XA 2E71A 1VQ9I 3VEPA 4UVCA 4F7ZA 3PNYA 5L3BA 2Y75A 2KDOA 3OMYA 4FHTA 4HX4A 1O3TA 1F9NA 2JPBA 1RKTA 2C6YA 2NNYA 1KQ8A 3BG7A 1E3OC 4DGWB 5J1RA 3FKIJ 5GADJ 3LSRA 1WJAA 2PMZN 5CPRB 3MKWB 1RR8C 4CSWA 2EFWA 2F5DA 1Y1WJ 1XGOA 3E5XA 1MBFA 2IJLA 2KLOA 4HW0A 3RYPA 2W85A 2QSGX 5FJ8J 2WB1A 3ZMTA 2K40A 5GPAA 3R0JA 4E7KA 1HLVA 4L18B 3S1QJ 2F5VA 2H8RA 1Z1DA 2DBBA 2EFQA 1KU9A 4PJ0C 3QPTA 3FZVA 1D8JA 2ECCA 3WTZA 2XPUA 3GF2A 4LIUA 3JAMZ 4MLOA 3GWZA 2CQQA 3FMQA 2QWWA 2LBFB 3E6MA 2KFDA 3MFKA 3OL3A 5L3CA 1HC8A 4RDUA 2R7VA 1YOVB 4XLPF 4BXXJ 3HGGA 4KISA 2CFXA 4ON0A 3PNTA 4LLNA 3U1KA 1FT9A 2MSYA 2ZMEB 3I4MJ 4ENMA 2DQRA 2GXBA 3FX3A 4CYDA 2OBPA 4FX0A 1Z3XA 1BI0A 2K27A 2QQ8A 1KQ9A 1T33A 2XAQA 1K83J 3F8MA 4S04A 3GBGA 2F5EA 3QPSA 2L9RA 2VI6A 2Y69H 1FOKA 1D1BA 2V9VA 4CXFA 3ABLH 1Y39A 4A3KJ 4BEHB 4UB8C 1ENHA 3OOPA 3WGGA 4CDGA 3DU6A 2GIZA 2HQ5A 4XLCA 3GEZA 2WTEA 4E70A 4M9SA 3CMYA 2HXIA 3CLQA 1OCPA 3S1NJ 9ANTA 2OC6A 1LFPA 5EZHA 1MNMC 3GTMJ 3KE2A 1SVOA 4ABZA 4DYQA 5J1YA 3WU1B 2XC7A 2Z2SB 2O0YA 2EWNA 2VC1A 1B6AA 1N25A 2P6SA 3V8LA 3BJAA 2HZTA 1WJDA 4JK1X 2E1MC 2PMUA 2Z16A 2BXZA 3HRSA 1W5SA 1AA7A 2H09A 4D9JA 3IC7A 4WXDA 4A5MA 4AIDA 3A02A 3FIWA 2WV1A 1EA3A 5K1YA 4OIOF 2E2JJ 1FTZA 2RVCA 3FXUA 3BG3A 2K5CA 2NS7A 1C0WA 3OYEA 2GXAA 1FOXA 5L3FA 5JFRA 4XKBA 2V6CA 1HBXG 1S72I 1CQTA 2RN7A 2OPTA 2XSJC 5ICGA 3KZYA 1X1CA 2CJJA 4H4KC 1K78B 4LB6B 1QA6A 2DPDA 5KAIC 4EGYA 3ZQLA 2GBYA 2HS5A 3BZCA 3QAHA 3DCFA 3GFLA 3HRUA 3A01A 2H1KA 3AL0B 3IKVA 3CC2I 3WG7H 3A03A 3FBIB 1OR7C 1AOYA 1QNTA 2GIVA 4BYYA 2YSRA 2R3SA 1YE9A 2ADUA 4XRSA 2CV0A 3AL0C 1BW6A 2L9VA 1ZREA 3F6OA 3PL8A 3V7CA 2AQEA 2PEXA 1W5TA 5GAEJ 1NK2P 3ABKH 3CF2A 2DMNA 4G9YA 1IN4A 4XR6A 5HDGA 5GAHJ 4KA4A 4WF2A 5LRRA 3WGIA 3OYBA 3WE3A 3DEEA 3G3ZA 3IP4B 1P4XA 4HRIA 4ESFA 3GLLA 4HX7A 3JRFA 1L3LA 2MC4A 1R7JA 1EH7A 1K6YA 2WA0A 3GCMA 2M0CA 2DFFA 2E5NA 2ZXJA 4BQAA 1QPIA 4J01A 4N4OB 4ESJA 4HDUA 1U2WA 2IS1A 3ZMDA 2X1DA 5KNLA 1WFXA 1ZK8A 1TWCJ 2DU9A 1LQ1A 1OCTC 1HCRA 4XLNF 2IS4A 4AD9A 1Z7LA 1O3QA 4CCLA 2E60A 2Y30A 2K9QA 3F72A 1JT6A 1TQMA 4JX5A 4ENNA 1KU7A 1YTYA 1OYYA 5GTIC 2O3FA 4M6VA 4XKCA 3OYCA 5FO5A 3MKYB 2P4WA 4XM3A 2V7FA 3K2AA 3F21A 1YX3A 1JTYA 1OKRA 2PG4A 5FKOA 1XMAA 4K2EA 3LFUA 1A5JA 1IN6A 5H2FC 3GX4X 3K1NA 3O8GA 3IWFA 4A3FJ 2QYOA 3JTHA 3B73A 1ITYA 1EKEA 1IV6A 1Z91A 4B48A 1Z9CA 4ZYEA 3RDIA 2L2OA 3SFZA 2NS8A 4TV7A 4AIKA 1ZG5A 2HOSA 1ETKA 1UG0A 2B63J 1R1UA 1J7KA 2EQRA 5LFAA 3CCQI 3CUQA 1ETQA 2H27A 2DFHA 2K9MA 1OJLA 2QZ8A 2L3DA 4RGUA 4EJUA 2DQLA 4KMUX 3BTLA 1U9OA 3K4BA 1YIOA 2HOEA 2CQKA 2DYRH 2YUSA 3OR2C 2V26A 3CUOA 5GPCA 2FOKA 2W7NA 3QRFF 5F0CA 4C3JJ 5IPAA 3H9GA 2YS9A 3LSHA 1J59A 2E7XA 2UZKA 3T5XA 1HKSA 4QSHA 3SZPA 2XRLA 5B3SH 1J09A 3G1OA 1I3AA 3LSMA 4ZZDA 4BBRJ 3CCVI 3M3YJ 2VT2A 2DJNA 3K10A 3EUHC 1VNDA 3IHUA 3MEXA 1MD0A 1YX5A 5HOOA 4BXFA 3HG9A 4IJAA 4WX9A 4XLEA 2R7OA 4D7MA 4DZPA 3CJTB 4WCGA 1KQ0A 2LBFA 2UUZA 4OU0A 1NK3P 4HQMA 1I6XA 3D5LA 5LHHA 5HLTA 5TRDA 3HUGB 2BY1A 1RR7A 2V4JC 4G94A 3I59A 4PJJA 4G7HF 1VQ4I 2DPUA 2DT5A 4KYWA 5J40A 1BOAA 2R92J 4XLFA 2ELHA 2MGQA 1PUFB 5FLXZ 3ONQA 2AHQA 1WH7A 4CGZA 1IDYA 1IUFA 1Z67A 3F8CA 2DK5A 3I9V2 2L54A 1I27A 4LG0A 5EGOA 1QQIA 5TJJA 1V55H 1WJCA 2ZSIB 3R0AA 2BY2A 3WTUC 2BOLA 4MFEA 1K4TA 1E0EA 1ULYA 1IW7F 1FX7A 2VPRA 5FFXA 4YFXF 3CCUI 3SDGA 2KZGA 3CLOA 2E5ZA 4DOZA 3H92A 1K6OA 2MG4A 3ZN1A 1U78A 4L5JA 3OIPA 3VYTB 1SFKA 3K2ZA 5E8IA 2JJ7A 2WY7Q 2XGEA 2ME0A 3T0YA 3QYFA 5K5RA 1X2MA 4M9ZA 3KYLA 2LOOA 1PP7U 5IYCJ 1I3QJ 1SD7A 4M71A 2M34A 3I4PA 2KIQA 3EDPA 2DMPA 5KVRA 3DTEA 2OCCH 1I5ZA 1Z7UA 2Q2EB 3PFIA 5J4YA 5D4RA 1KGSA 1IJWC 3GTGJ 3KP7A 3OS1A 3ASOH 4I2OA 3J80Z 4M9XA 2O5RA 1UG2A 3KEYA 1ZAOA 4U87A 2K3PA 3SYTA 4ZH4F 5FRMA 3ZQCA 1JI8A 1S7EA 2Y9YA 2PI0A 1WGXA 4WWCA 2H6CA 1Z0XA 1P4WA 2IW5A 3M1EA 1QO0D 3TP3A 3JAMK 2PJRB 3IRQA 2H6BA 2IT0A 4UV9A 3AG4H 1ETXA 4B3AA 3NRVA 3JCUC 2WC2A 4U7BA 3JREA 1I1GA 2X0LA 1Z6TA 3BR0A 4LOCA 2QVOA 2VQHA 3TKYA 1BIAA 2IPQX 1YRNA 4FQGA 4O5VA 4EJVA 3SZTA 2M8GX 3VB2A 2DDBA 3K70D 3HOYJ 4A3LJ 4J19A 1UJ8A 1FLIA 2LP0A 1K7AA 1SVMA 4RB1A 4PJLA 2EFNA 3ZMSA 2F4MB 2IGNA
chains in the Genus database with same CATH topology
2JRTA 2FRHA 1FBQA 3QP5A 3DV8A 2RC4A 3BOQA 4A12A 3R61A 1JHHA 1Z6RA 4OIRF 2KIFA 3ZMVA 5AIQA 1ZH5A 5LGNA 1GXPA 3HIFA 2ZKZA 4U88A 1IUYA 1BI1A 3RTRA 3BDDA 2XVCA 3KP6A 3TO9A 5LGTA 2STWA 1MJAA 3I58A 3KFWX 3N97A 4RAYA 3F22A 1UHWA 2ZJ2A 3WTTC 4D0PA 2O03A 3TDUC 2JPCA 1TTYA 4O3MA 4HYEA 1I1SA 4G7ZF 3IKTA 3BY6A 1G6NA 1V4RA 2EV5A 1R58A 2LKPA 4ASNA 1XDUA 1QPMA 2FBIA 3WE2A 1ZRCA 1HW2A 1FYLA 3AAFA 5FB2A 1YYVA 2OZUA 2BGCA 2ISZA 2XAJA 3ABTA 4GGGA 3DPLC 1FPQA 2IA1A 5HLIA 2MLKA 1J0RA 2HKOA 1LVAA 3E5UA 2EV6A 2DW4A 5H6RA 2XRNA 5F6FA 1KU2A 3C1DA 4EGZA 1W7PA 3U2RA 1FYMA 1T6SA 4U0WA 3JSOA 3WTSC 1BN5A 3R4KA 4RB2C 3LA2A 4A6DA 4KN4X 2OAZA 1B59A 2HYGD 3ISPA 4Q5SF 4P5OA 1XGSA 1J2XA 5D5VB 5K5OA 2QUFA 4PCQA 5DEQA 1WKMA 3GFJA 5ICFA 2FA5A 1EH6A 1DPRA 4Q48A 2GA2A 3JTGA 2J5OA 1CF7A 5DCMA 2VT3A 1IN5A 2M5WA 5CVJA 5ERIA 1S7AA 1KYWA 1XSXA 4UHTA 2IP2A 2XGXA 1FSHA 2VXZA 1O7FA 1YQAA 5J8FA 1IRGA 3KEQA 2G7UA 4GXOA 1GVJA 2OD5A 2LNBA 1S3JA 1BI2A 1LEAA 2P5VA 3RPQA 1FBSA 1T2KA 3QP6A 3DKWA 3TQNA 3CUQB 4N9HA 1MJ9A 5AONA 4LK0F 2L02A 1SD4A 3CUQC 4AIJA 3KP4A 5LGUA 4L0ZB 5D5XB 1YLFA 1P92A 1OMIA 5D5WB 3TOAA 2CG4A 3MWMA 1R22A 1R1VA 2OU2A 3V7RA 2VE8A 3L7WA 2GA1A 1IF1A 3HYIA 1HSTA 3Q9VA 1TNSA 2BE5F 4MEYF 1FP1D 3D0SA 3FMSA 3O3KA 4EM1A 3H3ZA 2VN2A 3KLOA 3M7GA 3F8NA 3KLNA 2VBWA 4KDPA 3CO7C 3ML6A 3I59B 1FNNA 2K7LA 4L9VA 5DD8A 3CJNA 3K1MA 4NQWA 5JR3A 1H0MA 2PJPA 3JSPA 3G73A 4BHBA 5D8KB 4LG0B 2G7HA 4OIPF 3N4MA 5HDKA 1R5GA 2P7VB 2YPRA 4G7OF 1L0OC 3J81Z 3DXJF 2EFPA 4P96A 2XAFA 1FYKA 2Z5UA 3FM3A 2H94A 3U9GA 1S8NA 5IT3A 4P55A 4Q47A 3HHHA 3C3WA 2XAGA 2EK5A 2WV0A 4MTDA 5H6QA 2OZ6A 1B9MA 2FBKA 4PGHA 4GYIA 3KP3A 4LFUA 2M45A 2K86A 3DPTA 1MDMA 4XSZF 2O6GE 3WU0A 1YS7A 1LDDA 3ERED 1ZGAA 2Z99A 5BS6A 3FF5A 1U3EM 3BJ6A 3E97A 3LAJA 1F5TA 4Z2YA 4EV0A 1P6RA 2Z3YA 1IN7A 1U6GA 3R6SA 4NHJA 4PDKA 3KP5A 2XASA 1S7OA 2IVMA 2HDCA 4IRGA 2CWEA 2PN6A 3H3UA 1J9IA 1XD7A 2DLLA 1LEBA 1BBYA 2DO7A 1PUEE 3FXRA 4UNOA 4LLLA 4QWQA 3GXOA 1OYWA 2XIGA 2ZFWA 3GFMA 3HOTA 5HLGA 1ZLKA 4BHPA 3ULQB 4UV8A 3T1BA 5A2QZ 1B9NA 1U8RA 2K02A 1G3TA 1LDKB 3LQQA 3K9TA 3BPVA 4LK1F 1USSA 3FMRA 3Q5FA 4IRHA 3HOSA 2B0LA 3V4GA 1IRFA 2A69F 2LSOA 4IF4A 5E8GA 4OINF 1D8KA 5HS8A 2W25A 2FNAA 2QBYA 5IT9Z 1WRJA 4L5IA 5F1RA 2KIMA 4N0BA 3BZ6A 4A0XA 5ED4A 4JBAA 1W7PB 1O57A 1SFEA 3HRMA 3MZHA 5E20A 1FP2A 1GHCA 4I98B 2Z33A 2A5YB 4HQEA 5DDGA 1BJAA 4OOIA 4HLXA 2W57A 2IRFG 1Y0UA 4HZFA 1X3UA 1RUOA 4EQQA 1YG2A 4HOBA 5FGMA 3I64A 3WODF 1PP8F 1FZPB 3QU6A 5BMZA 4KN7X 2XV4S 4BAYA 4I7HA 3FM5A 2EA4A 2EA2A 3HRTA 2VONA 1CF7B 5DCMB 2Z9OA 2VE9A 5L3DA 3Q9SA 2P8TA 4LD5A 3F6VA 3JW4A 1OYIA 1YW8A 3E6CC 2L4AA 2L4MA 6PAXA 4BH9A 1G3WA 1G3YA 2UWMA 1LJ9A 1YS6A 4HLYA 3WTWC 5DUIA 1TW2A 3PQKA 2ZCWA 2EV0A 2KIUA 2PMHA 3KETA 1G4DA 4I01A 2ZNYA 4M72A 1O3SA 1ZRFA 3ZN0A 3MQ0A 2GZWA 1XB4A 2HKXA 2NAZA 4IHTA 1Q1HA 1IAWA 2XKOA 2TDXA 3J7AO 3ECHA 5CJ9A 1KYZA 4RS8A 2QQBA 3S2WA 2HQNA 1R00A 5ILVA 4AWXB 4LLGF 3K0LA 1E2XA 4EJWA 1JHFA 1JGSA 4B8XA 2RNJA 5LEKA 1XGMA 2M87A 2VOPA 2NRAC 3GFIA 3WTVC 2A61A 4BXUA 1QZYA 2ZO4A 3U1DA 2DI3A 4KNYA 4Y15A 4NB5A 3GLXA 2VODA 4PGGA 3EYIA 3VOEA 2W24A 3T8TA 4I0BA 3RKYA 1B1BA 4IPAA 1DP7P 3I5UA 1F4KA 2HFHA 3SQNA 4WXHA 4Y17A 1YW7A 1DDNA 3BP8A 4B09A 2MBFA 2DK8A 4IRIA 1U5TC 3V7SA 5ILSA 4YFNF 3QPHA 1EH8A 4DNCA 4RB3C 4CZZA 1UCRA 1T38A 4KUMA 1MDMB 2VBXA 2PFBA 5EEGA 2KRFA 3I53A 3RYRA 5LHGA 5BOXA 5E1WA 5LHIA 1R36A 2F5FA 2PBIA 2V1DA 4UXNA 3W6JB 5DV5A 3GYHX 5CVIA 4P9UA 2P7CB 3HTSB 2BBYA 3CO6C 3P9CA 3HTUA 2VOOA 2MH9A 2NNNA 1FBUA 3ZP5A 2KKOA 3I54A 4I02A 5HVQC 3IL2A 2L01A 4LB5A 2M1BA 3C7JA 2NYXA 2YU3A 3CTAA 1RIOH 5CLSA 3DF8A 5BPIA 5DCFA 5IT9K 4DQ2A 5HS9A 2YX7A 3W6KB 5KK1A 3M9AA 5HLHA 4YG2F 4KIGA 4KT5C 2QLZA 3E6BA 2O61A 5JHUA 2F5CA 4WK8F 5CYVA 1J75A 2RQPA 5D6FA 4KFCA 2FMYA 2FXAA 4RGSA 5FLXK 2CSOA 4M6XA 4Y13A 3I71A 3GVAA 4EJTA 3REOA 1T0FA 3HSEA 2QBYB 4HAMA 4HF0A 1RNLA 2EFOA 2NS0A 4UUVA 3ELKA 4AVPA 5CVRA 3HSRA 1ZN2A 3EETA 1SFUA 1ONVA 2JT1A 4A6EA 4ZYGA 1GXQA 2FSWA 2VBYA 1XN7A 4LGWA 3E3VA 2V1UA 4ENJA 2LF8A 2DTRA 1D5VA 2JZYA 3J80K 4I09A 2JSCA 5BQTA 2D2WA 5JVTA 4XRFA 1O3RA 3O6BB 3OV8A 4BNCA 1TBXA 1QBJA 2XHKA 4M73A 1TNTA 2M30A 3TO7A 2ZBKA 2O8XA 4IHSA 1YFHA 1FY7A 2A3SA 1V3FA 3RKXA 1IN8A 3R60A 2A6EF 2QQAA 3E5QA 1ZG3A 2F2EA 3LSTA 5L3EA 4RB0A 2FBHA 3QU3A 4UVAA 4ENKA 2JTVA 4HBLA 1SD5A 4EMSA 1HXDA 4LJZF 4O6JA 1WQ2A 4EJOA 2FMLA 3P7NA 3L09A 1QGPA 5EEHA 4HX8A 3KP2A 3RPUA 4KIBA 3F8BA 1U5TA 3ROUA 3DFGA 1T39A 3LFKA 4WXCA 1BC7C 4XBFA 2XUBA 1BIBA 1SD6A 3EQLF 3DQVC 4RGXA 1FWZA 1RI7A 4A5NA 2OQRA 3MAJA 4ZYDA 3M8EA 5J8CA 1KU3A 2J5PA 2IA2A 3P9IA 4ESBA 2KJBA 4ETSA 3VODA 4JQFA 3VFZA 4U0VA 4BHCA 2P5KA 1LNWA 1JXSA 1UHMA 1DUXC 2LF7A 2BEOA 2PLYA 2FNPA 1D3YA 5DYMA 3F8FA 4A0ZA 4FT8A 1XCVA 2G9WA 3GO5A 1HKTA 3L2CA 2D1VA 5D5UB 2W84A 4AIHA 5FFZA 2Y0MA 1MZBA 1WWXA 5DUKA 2ISYA 2QENA 4OIQF 4EM2A 2MH2A 2XROA 2Q0OA 3GW2A 3L9FA 1ODDA 2XKPA 1ZLJA 2CYYA 3LQRA 4H0EA 2D45A 1HKQA 2YX4A 1WSUA 3IRRA 1WI9A 4MGRA 2QM3A 2DFIA 1ZHFA 5E17F 1TW3A 2R7FA 4ZZLA 3SHFA 3M8FA 1IZ1A 4G8XA 1EV7A 3F3XA 2MA3A 1NHAA 3BWGA 1B4AA 3KZZA 5HS7A 1HW5A 2AXLA 3GZ6A 3C18A 1ZRDA 4YFKF 4OMYA 4MQ9F 1IXCA 3P9KA 1PDNC 3DEUA 2Q8KA 3PQJA 4CO8A 4A2UA 3LWFA 1T98A 3IWZA 1LDJA 1S6LA 4CICA 1DPUA 4IXAA 3LA7A 1XSDA 3ZMUA 2WWYA 1H9TA 4MQVA 2RGVA 5H20A 1OPCA 2A68F 3RIRA 1XSVA 5LRSA 3E6DA 2FEZA 2BYVE 3RJPA 3WGHA 1TQIA 4MHGA 3ZPLA 1ZG1A 2RKHA 5LLQA 2IA0A 2Y48A 2P6TA 5K5QA 1MKMA 4L9TA 3B02A 4M74A 1USTA 5D6EA 3RI4A 1XCBA 2ZMEA 4U7DA 2EJRA 4L0YB 1ZARA 3NQOA 4MEXF 2MLGA 4MNUA 1QZZA 1R5HA 2UXXA 1SMYF 2X4HA 1SMTA 2HTJA 1P2FA 2COMA 2EB7A 2FE3A 2KJCA 1CGPA 2FQ3A 2CO5A 2OQGA 4HF1A 4GCVA 4HV5A 1FSEA 3FXQA 1RZ4A 3BPXA 4CHUA 2HWVA 5D4SA 2ESHA 4G6QA 1AWCA 3BROA 1FC3A 3MZYA 4XSXF 5CVUA 1JE8A 3WG9A 3GUDA 1IXRC 5D8LB 2GWRA 4L9NA 1XGNA 4UVBA 4RAZA 1K78A 3NEUA 1OR7A 2HQRA 5ILUA 5ICEA 1K79A 1TLHB 1XDSA 1ZYRF 3LAPA 1R1TA 4A0YA 1O7LA 2HGCA 2GXGA 3HHGA 2GAUA 4YIFA 4Q4ZF 2MC3A 1UFMA 4YIIA 1MGTA 1YO5C 3J81K 4EVIA 2PQ8A 2R7DA 4N9IA 3K69A 4P9FA 1A04A 5E18F 1ZGJA 5HDNA 2ACJA 2GQQA 2STTA 1HW1A 2BV6A 1HQCA 4G6DA 2A07F 2XAHA 5JI6A 1TQPA 4M6YA 4OMZA 2YR2A 2ZNZA 1RUNA 2E1CA 2OA4A 2D1HA 4MTEA 3QOPA 2A6HF 3KEOA 3V8JA 4ZYHA 1H9GA 3TDZC 4EM0B 1ON2A 2LDUA 2ESNA 1BI3A 4IVNA 1F1ZA 1S29A 3T8RA 4KMFA 1IXSB 4R1HA 4HA8A 3FWEA 3K1PA 2CW0F 4FX4A 4KICA 5ICCA 3MCZA 5LEJA 1HSJA 4LMYA 3ZQ7A 1W7PD 4GO1A 3KCCA 2FU4A 3LA3A 5FD5A 4KIFA 5BPDA 3L00A 1U5TB 3O2PE 2VC0A 3I0TA 4R79A 4U0YA 2FF4A 3ECOA 4QLCU 3SXYA 5FD6A 2HEOA 2K4BA 3V8KA 3HSFA 1E17A 3EUHA 5AIPA 1VTNC 3DP7A 1STZA 4HV6A 2CGPA 1BC8C 4L9JA 1J5YA 1MJBA 3F23A 1ON1A 2HYFA 1REPC 2QQ9A 3TGNA 4HF2A 5F64A 3FHZA 2V1XA 3HUGA 3COAC 2M8EA 4R8HA 4S05A 5A2QK 3WTYC 2MD5A 1XMKA 3TO6A 2AS5F 2RV8A 5L3GA 2DAOA 2V79A 1G3SA 3WTXC 2HR3A 4HDVA 1W4MA 1BM9A 1P4AA 1SFXA 5E1ZB 2VBZA 2HTSA 3CDHA 3EYYA 1UB9A 1KA8A 4GYGA 5E1XA 1LB2A 2Q2EA 1YW9A 3RKWA 2ETHA 4I0AA 3GZ5A 3TOBA 2RDPA 5LBQA 3ZMZA 5DD4A 2E1NA 4PZJA 2K4JA 2P5LC 4RGRA 1SAXA 1R23A 5CVVA 2E7WA 3BJOA 2UXNA 3ABUA 5J6XA 3VEPA 4UVCA 4F7ZA 5L3BA 2Y75A 4FHTA 4HX4A 1O3TA 1F9NA 2JPBA 2C6YA 2NNYA 1KQ8A 2EFWA 2F5DA 1XGOA 3E5XA 2IJLA 4HW0A 3RYPA 2W85A 3ZMTA 3R0JA 4L18B 1Z1DA 2DBBA 2EFQA 1KU9A 3QPTA 3FZVA 1D8JA 3WTZA 3GF2A 3JAMZ 3GWZA 3FMQA 2QWWA 3E6MA 3MFKA 5L3CA 4XLPF 2CFXA 4ON0A 4LLNA 1FT9A 2ZMEB 4ENMA 2DQRA 2GXBA 3FX3A 4CYDA 2OBPA 4FX0A 1BI0A 2K27A 2XAQA 1KQ9A 3F8MA 4S04A 2F5EA 1FOKA 2V9VA 4CXFA 3OOPA 3WGGA 4CDGA 3GEZA 2WTEA 4E70A 4M9SA 3KE2A 3WU1B 2O0YA 2EWNA 2VC1A 1B6AA 2P6SA 3V8LA 3BJAA 2HZTA 4JK1X 2PMUA 3HRSA 1W5SA 2H09A 3IC7A 4WXDA 4A5MA 5K1YA 4OIOF 2RVCA 3FXUA 1C0WA 5L3FA 5JFRA 2V6CA 1HBXG 2RN7A 5ICGA 3KZYA 1K78B 4LB6B 2DPDA 4EGYA 2HS5A 3QAHA 3GFLA 3HRUA 3IKVA 1AOYA 1QNTA 2GIVA 4BYYA 2YSRA 2R3SA 2ADUA 1ZREA 3F6OA 3V7CA 2PEXA 1W5TA 4G9YA 1IN4A 5HDGA 4KA4A 4WF2A 5LRRA 3WGIA 3WE3A 3G3ZA 1P4XA 4ESFA 4HX7A 1L3LA 1R7JA 1EH7A 2ZXJA 4BQAA 4ESJA 4HDUA 1U2WA 3ZMDA 1LQ1A 2DU9A 4XLNF 4AD9A 1O3QA 3F72A 1TQMA 4ENNA 1KU7A 1YTYA 1OYYA 2O3FA 5FO5A 2P4WA 3F21A 1OKRA 2PG4A 1XMAA 4K2EA 1IN6A 3GX4X 3K1NA 3IWFA 2QYOA 3JTHA 3B73A 1Z91A 1Z9CA 4ZYEA 3RDIA 3SFZA 4TV7A 4AIKA 1ZG5A 1R1UA 1J7KA 3CUQA 2H27A 2QZ8A 2L3DA 4RGUA 4EJUA 2DQLA 4KMUX 1YIOA 2HOEA 2CQKA 3CUOA 2FOKA 3QRFF 1J59A 2E7XA 2UZKA 3T5XA 1HKSA 3SZPA 4ZZDA 2VT2A 3IHUA 3MEXA 1MD0A 5HOOA 4IJAA 4WX9A 4WCGA 1KQ0A 4OU0A 4HQMA 1I6XA 3D5LA 5LHHA 5TRDA 4G94A 3I59A 4G7HF 2DPUA 2DT5A 4KYWA 1BOAA 2ELHA 5FLXZ 4CGZA 3F8CA 2DK5A 2L54A 1I27A 4LG0A 1QQIA 5TJJA 3WTUC 3R0AA 1ULYA 1IW7F 1FX7A 5FFXA 4YFXF 3CLOA 3H92A 1K6OA 1U78A 3ZN1A 4L5JA 3K2ZA 5E8IA 3T0YA 5K5RA 4M9ZA 1PP7U 1SD7A 4M71A 3I4PA 3EDPA 5KVRA 5D4RA 1I5ZA 1Z7UA 3PFIA 1KGSA 3KP7A 4I2OA 3J80Z 4M9XA 1ZAOA 4ZH4F 2PI0A 4WWCA 2H6CA 1P4WA 2IW5A 3M1EA 1QO0D 3JAMK 3IRQA 2H6BA 2IT0A 4UV9A 3NRVA 2WC2A 4U7BA 1I1GA 2X0LA 1Z6TA 2QVOA 3TKYA 1BIAA 2IPQX 4O5VA 4EJVA 3SZTA 3VB2A 1FLIA 1K7AA 4RB1A 2EFNA 3ZMSA 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRT A;  2FRH A;  1FBQ A;  3QP5 A;  3DV8 A;  2RC4 A;  3BOQ A;  4A12 A;  3R61 A;  1JHH A;  1Z6R A;  4OIR F;  2KIF A;  3ZMV A;  5AIQ A;  1ZH5 A;  5LGN A;  1GXP A;  3HIF A;  2ZKZ A;  4U88 A;  1IUY A;  1BI1 A;  3RTR A;  3BDD A;  2XVC A;  3KP6 A;  3TO9 A;  5LGT A;  2STW A;  1MJA A;  3I58 A;  3KFW X;  3N97 A;  4RAY A;  3F22 A;  1UHW A;  2ZJ2 A;  3WTT C;  4D0P A;  2O03 A;  3TDU C;  2JPC A;  1TTY A;  4O3M A;  4HYE A;  1I1S A;  4G7Z F;  3IKT A;  3BY6 A;  1G6N A;  1V4R A;  2EV5 A;  1R58 A;  2LKP A;  4ASN A;  1XDU A;  1QPM A;  2FBI A;  3WE2 A;  1ZRC A;  1HW2 A;  1FYL A;  3AAF A;  5FB2 A;  1YYV A;  2OZU A;  2BGC A;  2ISZ A;  2XAJ A;  3ABT A;  4GGG A;  3DPL C;  1FPQ A;  2IA1 A;  5HLI A;  2MLK A;  1J0R A;  2HKO A;  1LVA A;  3E5U A;  2EV6 A;  2DW4 A;  5H6R A;  2XRN A;  5F6F A;  1KU2 A;  3C1D A;  4EGZ A;  1W7P A;  3U2R A;  1FYM A;  1T6S A;  4U0W A;  3JSO A;  3WTS C;  1BN5 A;  3R4K A;  4RB2 C;  3LA2 A;  4A6D A;  4KN4 X;  2OAZ A;  1B59 A;  2HYG D;  3ISP A;  4Q5S F;  4P5O A;  1XGS A;  1J2X A;  5D5V B;  5K5O A;  2QUF A;  4PCQ A;  5DEQ A;  1WKM A;  3GFJ A;  5ICF A;  2FA5 A;  1EH6 A;  1DPR A;  4Q48 A;  2GA2 A;  3JTG A;  2J5O A;  1CF7 A;  5DCM A;  2VT3 A;  1IN5 A;  2M5W A;  5CVJ A;  5ERI A;  1S7A A;  1KYW A;  1XSX A;  4UHT A;  2IP2 A;  2XGX A;  1FSH A;  2VXZ A;  1O7F A;  1YQA A;  5J8F A;  1IRG A;  3KEQ A;  2G7U A;  4GXO A;  1GVJ A;  2OD5 A;  2LNB A;  1S3J A;  1BI2 A;  1LEA A;  2P5V A;  3RPQ A;  1FBS A;  1T2K A;  3QP6 A;  3DKW A;  3TQN A;  3CUQ B;  4N9H A;  1MJ9 A;  5AON A;  4LK0 F;  2L02 A;  1SD4 A;  3CUQ C;  4AIJ A;  3KP4 A;  5LGU A;  4L0Z B;  5D5X B;  1YLF A;  1P92 A;  1OMI A;  5D5W B;  3TOA A;  2CG4 A;  3MWM A;  1R22 A;  1R1V A;  2OU2 A;  3V7R A;  2VE8 A;  3L7W A;  2GA1 A;  1IF1 A;  3HYI A;  1HST A;  3Q9V A;  1TNS A;  2BE5 F;  4MEY F;  1FP1 D;  3D0S A;  3FMS A;  3O3K A;  4EM1 A;  3H3Z A;  2VN2 A;  3KLO A;  3M7G A;  3F8N A;  3KLN A;  2VBW A;  4KDP A;  3CO7 C;  3ML6 A;  3I59 B;  1FNN A;  2K7L A;  4L9V A;  5DD8 A;  3CJN A;  3K1M A;  4NQW A;  5JR3 A;  1H0M A;  2PJP A;  3JSP A;  3G73 A;  4BHB A;  5D8K B;  4LG0 B;  2G7H A;  4OIP F;  3N4M A;  5HDK A;  1R5G A;  2P7V B;  2YPR A;  4G7O F;  1L0O C;  3J81 Z;  3DXJ F;  2EFP A;  4P96 A;  2XAF A;  1FYK A;  2Z5U A;  3FM3 A;  2H94 A;  3U9G A;  1S8N A;  5IT3 A;  4P55 A;  4Q47 A;  3HHH A;  3C3W A;  2XAG A;  2EK5 A;  2WV0 A;  4MTD A;  5H6Q A;  2OZ6 A;  1B9M A;  2FBK A;  4PGH A;  4GYI A;  3KP3 A;  4LFU A;  2M45 A;  2K86 A;  3DPT A;  1MDM A;  4XSZ F;  2O6G E;  3WU0 A;  1YS7 A;  1LDD A;  3ERE D;  1ZGA A;  2Z99 A;  5BS6 A;  3FF5 A;  1U3E M;  3BJ6 A;  3E97 A;  3LAJ A;  1F5T A;  4Z2Y A;  4EV0 A;  1P6R A;  2Z3Y A;  1IN7 A;  1U6G A;  3R6S A;  4NHJ A;  4PDK A;  3KP5 A;  2XAS A;  1S7O A;  2IVM A;  2HDC A;  4IRG A;  2CWE A;  2PN6 A;  3H3U A;  1J9I A;  1XD7 A;  2DLL A;  1LEB A;  1BBY A;  2DO7 A;  1PUE E;  3FXR A;  4UNO A;  4LLL A;  4QWQ A;  3GXO A;  1OYW A;  2XIG A;  2ZFW A;  3GFM A;  3HOT A;  5HLG A;  1ZLK A;  4BHP A;  3ULQ B;  4UV8 A;  3T1B A;  5A2Q Z;  1B9N A;  1U8R A;  2K02 A;  1G3T A;  1LDK B;  3LQQ A;  3K9T A;  3BPV A;  4LK1 F;  1USS A;  3FMR A;  3Q5F A;  4IRH A;  3HOS A;  2B0L A;  3V4G A;  1IRF A;  2A69 F;  2LSO A;  4IF4 A;  5E8G A;  4OIN F;  1D8K A;  5HS8 A;  2W25 A;  2FNA A;  2QBY A;  5IT9 Z;  1WRJ A;  4L5I A;  5F1R A;  2KIM A;  4N0B A;  3BZ6 A;  4A0X A;  5ED4 A;  4JBA A;  1W7P B;  1O57 A;  1SFE A;  3HRM A;  3MZH A;  5E20 A;  1FP2 A;  1GHC A;  4I98 B;  2Z33 A;  2A5Y B;  4HQE A;  5DDG A;  1BJA A;  4OOI A;  4HLX A;  2W57 A;  2IRF G;  1Y0U A;  4HZF A;  1X3U A;  1RUO A;  4EQQ A;  1YG2 A;  4HOB A;  5FGM A;  3I64 A;  3WOD F;  1PP8 F;  1FZP B;  3QU6 A;  5BMZ A;  4KN7 X;  2XV4 S;  4BAY A;  4I7H A;  3FM5 A;  2EA4 A;  2EA2 A;  3HRT A;  2VON A;  1CF7 B;  5DCM B;  2Z9O A;  2VE9 A;  5L3D A;  3Q9S A;  2P8T A;  4LD5 A;  3F6V A;  3JW4 A;  1OYI A;  1YW8 A;  3E6C C;  2L4A A;  2L4M A;  6PAX A;  4BH9 A;  1G3W A;  1G3Y A;  2UWM A;  1LJ9 A;  1YS6 A;  4HLY A;  3WTW C;  5DUI A;  1TW2 A;  3PQK A;  2ZCW A;  2EV0 A;  2KIU A;  2PMH A;  3KET A;  1G4D A;  4I01 A;  2ZNY A;  4M72 A;  1O3S A;  1ZRF A;  3ZN0 A;  3MQ0 A;  2GZW A;  1XB4 A;  2HKX A;  2NAZ A;  4IHT A;  1Q1H A;  1IAW A;  2XKO A;  2TDX A;  3J7A O;  3ECH A;  5CJ9 A;  1KYZ A;  4RS8 A;  2QQB A;  3S2W A;  2HQN A;  1R00 A;  5ILV A;  4AWX B;  4LLG F;  3K0L A;  1E2X A;  4EJW A;  1JHF A;  1JGS A;  4B8X A;  2RNJ A;  5LEK A;  1XGM A;  2M87 A;  2VOP A;  2NRA C;  3GFI A;  3WTV C;  2A61 A;  4BXU A;  1QZY A;  2ZO4 A;  3U1D A;  2DI3 A;  4KNY A;  4Y15 A;  4NB5 A;  3GLX A;  2VOD A;  4PGG A;  3EYI A;  3VOE A;  2W24 A;  3T8T A;  4I0B A;  3RKY A;  1B1B A;  4IPA A;  1DP7 P;  3I5U A;  1F4K A;  2HFH A;  3SQN A;  4WXH A;  4Y17 A;  1YW7 A;  1DDN A;  3BP8 A;  4B09 A;  2MBF A;  2DK8 A;  4IRI A;  1U5T C;  3V7S A;  5ILS A;  4YFN F;  3QPH A;  1EH8 A;  4DNC A;  4RB3 C;  4CZZ A;  1UCR A;  1T38 A;  4KUM A;  1MDM B;  2VBX A;  2PFB A;  5EEG A;  2KRF A;  3I53 A;  3RYR A;  5LHG A;  5BOX A;  5E1W A;  5LHI A;  1R36 A;  2F5F A;  2PBI A;  2V1D A;  4UXN A;  3W6J B;  5DV5 A;  3GYH X;  5CVI A;  4P9U A;  2P7C B;  3HTS B;  2BBY A;  3CO6 C;  3P9C A;  3HTU A;  2VOO A;  2MH9 A;  2NNN A;  1FBU A;  3ZP5 A;  2KKO A;  3I54 A;  4I02 A;  5HVQ C;  3IL2 A;  2L01 A;  4LB5 A;  2M1B A;  3C7J A;  2NYX A;  2YU3 A;  3CTA A;  1RIO H;  5CLS A;  3DF8 A;  5BPI A;  5DCF A;  5IT9 K;  4DQ2 A;  5HS9 A;  2YX7 A;  3W6K B;  5KK1 A;  3M9A A;  5HLH A;  4YG2 F;  4KIG A;  4KT5 C;  2QLZ A;  3E6B A;  2O61 A;  5JHU A;  2F5C A;  4WK8 F;  5CYV A;  1J75 A;  2RQP A;  5D6F A;  4KFC A;  2FMY A;  2FXA A;  4RGS A;  5FLX K;  2CSO A;  4M6X A;  4Y13 A;  3I71 A;  3GVA A;  4EJT A;  3REO A;  1T0F A;  3HSE A;  2QBY B;  4HAM A;  4HF0 A;  1RNL A;  2EFO A;  2NS0 A;  4UUV A;  3ELK A;  4AVP A;  5CVR A;  3HSR A;  1ZN2 A;  3EET A;  1SFU A;  1ONV A;  2JT1 A;  4A6E A;  4ZYG A;  1GXQ A;  2FSW A;  2VBY A;  1XN7 A;  4LGW A;  3E3V A;  2V1U A;  4ENJ A;  2LF8 A;  2DTR A;  1D5V A;  2JZY A;  3J80 K;  4I09 A;  2JSC A;  5BQT A;  2D2W A;  5JVT A;  4XRF A;  1O3R A;  3O6B B;  3OV8 A;  4BNC A;  1TBX A;  1QBJ A;  2XHK A;  4M73 A;  1TNT A;  2M30 A;  3TO7 A;  2ZBK A;  2O8X A;  4IHS A;  1YFH A;  1FY7 A;  2A3S A;  1V3F A;  3RKX A;  1IN8 A;  3R60 A;  2A6E F;  2QQA A;  3E5Q A;  1ZG3 A;  2F2E A;  3LST A;  5L3E A;  4RB0 A;  2FBH A;  3QU3 A;  4UVA A;  4ENK A;  2JTV A;  4HBL A;  1SD5 A;  4EMS A;  1HXD A;  4LJZ F;  4O6J A;  1WQ2 A;  4EJO A;  2FML A;  3P7N A;  3L09 A;  1QGP A;  5EEH A;  4HX8 A;  3KP2 A;  3RPU A;  4KIB A;  3F8B A;  1U5T A;  3ROU A;  3DFG A;  1T39 A;  3LFK A;  4WXC A;  1BC7 C;  4XBF A;  2XUB A;  1BIB A;  1SD6 A;  3EQL F;  3DQV C;  4RGX A;  1FWZ A;  1RI7 A;  4A5N A;  2OQR A;  3MAJ A;  4ZYD A;  3M8E A;  5J8C A;  1KU3 A;  2J5P A;  2IA2 A;  3P9I A;  4ESB A;  2KJB A;  4ETS A;  3VOD A;  4JQF A;  3VFZ A;  4U0V A;  4BHC A;  2P5K A;  1LNW A;  1JXS A;  1UHM A;  1DUX C;  2LF7 A;  2BEO A;  2PLY A;  2FNP A;  1D3Y A;  5DYM A;  3F8F A;  4A0Z A;  4FT8 A;  1XCV A;  2G9W A;  3GO5 A;  1HKT A;  3L2C A;  2D1V A;  5D5U B;  2W84 A;  4AIH A;  5FFZ A;  2Y0M A;  1MZB A;  1WWX A;  5DUK A;  2ISY A;  2QEN A;  4OIQ F;  4EM2 A;  2MH2 A;  2XRO A;  2Q0O A;  3GW2 A;  3L9F A;  1ODD A;  2XKP A;  1ZLJ A;  2CYY A;  3LQR A;  4H0E A;  2D45 A;  1HKQ A;  2YX4 A;  1WSU A;  3IRR A;  1WI9 A;  4MGR A;  2QM3 A;  2DFI A;  1ZHF A;  5E17 F;  1TW3 A;  2R7F A;  4ZZL A;  3SHF A;  3M8F A;  1IZ1 A;  4G8X A;  1EV7 A;  3F3X A;  2MA3 A;  1NHA A;  3BWG A;  1B4A A;  3KZZ A;  5HS7 A;  1HW5 A;  2AXL A;  3GZ6 A;  3C18 A;  1ZRD A;  4YFK F;  4OMY A;  4MQ9 F;  1IXC A;  3P9K A;  1PDN C;  3DEU A;  2Q8K A;  3PQJ A;  4CO8 A;  4A2U A;  3LWF A;  1T98 A;  3IWZ A;  1LDJ A;  1S6L A;  4CIC A;  1DPU A;  4IXA A;  3LA7 A;  1XSD A;  3ZMU A;  2WWY A;  1H9T A;  4MQV A;  2RGV A;  5H20 A;  1OPC A;  2A68 F;  3RIR A;  1XSV A;  5LRS A;  3E6D A;  2FEZ A;  2BYV E;  3RJP A;  3WGH A;  1TQI A;  4MHG A;  3ZPL A;  1ZG1 A;  2RKH A;  5LLQ A;  2IA0 A;  2Y48 A;  2P6T A;  5K5Q A;  1MKM A;  4L9T A;  3B02 A;  4M74 A;  1UST A;  5D6E A;  3RI4 A;  1XCB A;  2ZME A;  4U7D A;  2EJR A;  4L0Y B;  1ZAR A;  3NQO A;  4MEX F;  2MLG A;  4MNU A;  1QZZ A;  1R5H A;  2UXX A;  1SMY F;  2X4H A;  1SMT A;  2HTJ A;  1P2F A;  2COM A;  2EB7 A;  2FE3 A;  2KJC A;  1CGP A;  2FQ3 A;  2CO5 A;  2OQG A;  4HF1 A;  4GCV A;  4HV5 A;  1FSE A;  3FXQ A;  1RZ4 A;  3BPX A;  4CHU A;  2HWV A;  5D4S A;  2ESH A;  4G6Q A;  1AWC A;  3BRO A;  1FC3 A;  3MZY A;  4XSX F;  5CVU A;  1JE8 A;  3WG9 A;  3GUD A;  1IXR C;  5D8L B;  2GWR A;  4L9N A;  1XGN A;  4UVB A;  4RAZ A;  1K78 A;  3NEU A;  1OR7 A;  2HQR A;  5ILU A;  5ICE A;  1K79 A;  1TLH B;  1XDS A;  1ZYR F;  3LAP A;  1R1T A;  4A0Y A;  1O7L A;  2HGC A;  2GXG A;  3HHG A;  2GAU A;  4YIF A;  4Q4Z F;  2MC3 A;  1UFM A;  4YII A;  1MGT A;  1YO5 C;  3J81 K;  4EVI A;  2PQ8 A;  2R7D A;  4N9I A;  3K69 A;  4P9F A;  1A04 A;  5E18 F;  1ZGJ A;  5HDN A;  2ACJ A;  2GQQ A;  2STT A;  1HW1 A;  2BV6 A;  1HQC A;  4G6D A;  2A07 F;  2XAH A;  5JI6 A;  1TQP A;  4M6Y A;  4OMZ A;  2YR2 A;  2ZNZ A;  1RUN A;  2E1C A;  2OA4 A;  2D1H A;  4MTE A;  3QOP A;  2A6H F;  3KEO A;  3V8J A;  4ZYH A;  1H9G A;  3TDZ C;  4EM0 B;  1ON2 A;  2LDU A;  2ESN A;  1BI3 A;  4IVN A;  1F1Z A;  1S29 A;  3T8R A;  4KMF A;  1IXS B;  4R1H A;  4HA8 A;  3FWE A;  3K1P A;  2CW0 F;  4FX4 A;  4KIC A;  5ICC A;  3MCZ A;  5LEJ A;  1HSJ A;  4LMY A;  3ZQ7 A;  1W7P D;  4GO1 A;  3KCC A;  2FU4 A;  3LA3 A;  5FD5 A;  4KIF A;  5BPD A;  3L00 A;  1U5T B;  3O2P E;  2VC0 A;  3I0T A;  4R79 A;  4U0Y A;  2FF4 A;  3ECO A;  4QLC U;  3SXY A;  5FD6 A;  2HEO A;  2K4B A;  3V8K A;  3HSF A;  1E17 A;  3EUH A;  5AIP A;  1VTN C;  3DP7 A;  1STZ A;  4HV6 A;  2CGP A;  1BC8 C;  4L9J A;  1J5Y A;  1MJB A;  3F23 A;  1ON1 A;  2HYF A;  1REP C;  2QQ9 A;  3TGN A;  4HF2 A;  5F64 A;  3FHZ A;  2V1X A;  3HUG A;  3COA C;  2M8E A;  4R8H A;  4S05 A;  5A2Q K;  3WTY C;  2MD5 A;  1XMK A;  3TO6 A;  2AS5 F;  2RV8 A;  5L3G A;  2DAO A;  2V79 A;  1G3S A;  3WTX C;  2HR3 A;  4HDV A;  1W4M A;  1BM9 A;  1P4A A;  1SFX A;  5E1Z B;  2VBZ A;  2HTS A;  3CDH A;  3EYY A;  1UB9 A;  1KA8 A;  4GYG A;  5E1X A;  1LB2 A;  2Q2E A;  1YW9 A;  3RKW A;  2ETH A;  4I0A A;  3GZ5 A;  3TOB A;  2RDP A;  5LBQ A;  3ZMZ A;  5DD4 A;  2E1N A;  4PZJ A;  2K4J A;  2P5L C;  4RGR A;  1SAX A;  1R23 A;  5CVV A;  2E7W A;  3BJO A;  2UXN A;  3ABU A;  5J6X A;  3VEP A;  4UVC A;  4F7Z A;  5L3B A;  2Y75 A;  4FHT A;  4HX4 A;  1O3T A;  1F9N A;  2JPB A;  2C6Y A;  2NNY A;  1KQ8 A;  2EFW A;  2F5D A;  1XGO A;  3E5X A;  2IJL A;  4HW0 A;  3RYP A;  2W85 A;  3ZMT A;  3R0J A;  4L18 B;  1Z1D A;  2DBB A;  2EFQ A;  1KU9 A;  3QPT A;  3FZV A;  1D8J A;  3WTZ A;  3GF2 A;  3JAM Z;  3GWZ A;  3FMQ A;  2QWW A;  3E6M A;  3MFK A;  5L3C A;  4XLP F;  2CFX A;  4ON0 A;  4LLN A;  1FT9 A;  2ZME B;  4ENM A;  2DQR A;  2GXB A;  3FX3 A;  4CYD A;  2OBP A;  4FX0 A;  1BI0 A;  2K27 A;  2XAQ A;  1KQ9 A;  3F8M A;  4S04 A;  2F5E A;  1FOK A;  2V9V A;  4CXF A;  3OOP A;  3WGG A;  4CDG A;  3GEZ A;  2WTE A;  4E70 A;  4M9S A;  3KE2 A;  3WU1 B;  2O0Y A;  2EWN A;  2VC1 A;  1B6A A;  2P6S A;  3V8L A;  3BJA A;  2HZT A;  4JK1 X;  2PMU A;  3HRS A;  1W5S A;  2H09 A;  3IC7 A;  4WXD A;  4A5M A;  5K1Y A;  4OIO F;  2RVC A;  3FXU A;  1C0W A;  5L3F A;  5JFR A;  2V6C A;  1HBX G;  2RN7 A;  5ICG A;  3KZY A;  1K78 B;  4LB6 B;  2DPD A;  4EGY A;  2HS5 A;  3QAH A;  3GFL A;  3HRU A;  3IKV A;  1AOY A;  1QNT A;  2GIV A;  4BYY A;  2YSR A;  2R3S A;  2ADU A;  1ZRE A;  3F6O A;  3V7C A;  2PEX A;  1W5T A;  4G9Y A;  1IN4 A;  5HDG A;  4KA4 A;  4WF2 A;  5LRR A;  3WGI A;  3WE3 A;  3G3Z A;  1P4X A;  4ESF A;  4HX7 A;  1L3L A;  1R7J A;  1EH7 A;  2ZXJ A;  4BQA A;  4ESJ A;  4HDU A;  1U2W A;  3ZMD A;  1LQ1 A;  2DU9 A;  4XLN F;  4AD9 A;  1O3Q A;  3F72 A;  1TQM A;  4ENN A;  1KU7 A;  1YTY A;  1OYY A;  2O3F A;  5FO5 A;  2P4W A;  3F21 A;  1OKR A;  2PG4 A;  1XMA A;  4K2E A;  1IN6 A;  3GX4 X;  3K1N A;  3IWF A;  2QYO A;  3JTH A;  3B73 A;  1Z91 A;  1Z9C A;  4ZYE A;  3RDI A;  3SFZ A;  4TV7 A;  4AIK A;  1ZG5 A;  1R1U A;  1J7K A;  3CUQ A;  2H27 A;  2QZ8 A;  2L3D A;  4RGU A;  4EJU A;  2DQL A;  4KMU X;  1YIO A;  2HOE A;  2CQK A;  3CUO A;  2FOK A;  3QRF F;  1J59 A;  2E7X A;  2UZK A;  3T5X A;  1HKS A;  3SZP A;  4ZZD A;  2VT2 A;  3IHU A;  3MEX A;  1MD0 A;  5HOO A;  4IJA A;  4WX9 A;  4WCG A;  1KQ0 A;  4OU0 A;  4HQM A;  1I6X A;  3D5L A;  5LHH A;  5TRD A;  4G94 A;  3I59 A;  4G7H F;  2DPU A;  2DT5 A;  4KYW A;  1BOA A;  2ELH A;  5FLX Z;  4CGZ A;  3F8C A;  2DK5 A;  2L54 A;  1I27 A;  4LG0 A;  1QQI A;  5TJJ A;  3WTU C;  3R0A A;  1ULY A;  1IW7 F;  1FX7 A;  5FFX A;  4YFX F;  3CLO A;  3H92 A;  1K6O A;  1U78 A;  3ZN1 A;  4L5J A;  3K2Z A;  5E8I A;  3T0Y A;  5K5R A;  4M9Z A;  1PP7 U;  1SD7 A;  4M71 A;  3I4P A;  3EDP A;  5KVR A;  5D4R A;  1I5Z A;  1Z7U A;  3PFI A;  1KGS A;  3KP7 A;  4I2O A;  3J80 Z;  4M9X A;  1ZAO A;  4ZH4 F;  2PI0 A;  4WWC A;  2H6C A;  1P4W A;  2IW5 A;  3M1E A;  1QO0 D;  3JAM K;  3IRQ A;  2H6B A;  2IT0 A;  4UV9 A;  3NRV A;  2WC2 A;  4U7B A;  1I1G A;  2X0L A;  1Z6T A;  2QVO A;  3TKY A;  1BIA A;  2IPQ X;  4O5V A;  4EJV A;  3SZT A;  3VB2 A;  1FLI A;  1K7A A;  4RB1 A;  2EFN A;  3ZMS A;  1Z05 A; 
#chains in the Genus database with same CATH topology
 2JRT A;  1MBH A;  2XPV A;  3Q0V A;  2FRH A;  3S2D J;  1VF9 A;  1FBQ A;  3LOC A;  3QP5 A;  5IP6 A;  4A3E J;  3DV8 A;  2RC4 A;  2XSD C;  1VI0 A;  2R5Z A;  3BOQ A;  1TWF J;  4A12 A;  2R7S A;  4HPQ A;  4PJN A;  3R61 A;  1JHH A;  2KL4 A;  4IQ4 A;  4PUS A;  1B8I A;  2H8W A;  3GTL J;  5F08 A;  1Z6R A;  3L2W A;  3A4C A;  2KRC A;  3QOE A;  4OIR F;  2KIF A;  3ZMV A;  5IOY A;  2X9D A;  5AIQ A;  1ZH5 A;  5LGN A;  3MKZ A;  1GXP A;  3S8P A;  3HC7 A;  3HIF A;  2ZKZ A;  4U88 A;  1Z21 A;  4HST A;  2E34 A;  2L7F P;  1IUY A;  1BI1 A;  2E19 A;  4KT6 A;  1MBK A;  3RTR A;  3BDD A;  2R5Y A;  2XVC A;  3KP6 A;  4W1U A;  2NVU B;  4RAF A;  3TO9 A;  2X85 A;  4PSX A;  5LGT A;  1H88 C;  2ZJP F;  2STW A;  1NG6 A;  2DA6 A;  1MJA A;  3I58 A;  1RC9 A;  3KFW X;  4B47 A;  3VYU B;  3DLL F;  3N97 A;  4RAY A;  3F22 A;  1UHW A;  3OS2 A;  2ZJ2 A;  4X0G A;  3WTT C;  4BE0 A;  4D0P A;  2O03 A;  3TDU C;  1A35 A;  2JMW A;  2JPC A;  1TTY A;  2LKS A;  2KQR A;  4HYE A;  4O3M A;  1I1S A;  1D0Y A;  2ZJQ F;  2HQA A;  2LYC A;  4G7Z F;  3IH4 A;  3IKT A;  3BY6 A;  1G6N A;  1V4R A;  2EV5 A;  1R58 A;  5IYB J;  3W2W A;  2KZV A;  2L9N A;  2LKP A;  4ASN A;  1XDU A;  1NH3 A;  1QPM A;  4BJ5 C;  2FBI A;  3WE2 A;  3CCL I;  1ZRC A;  1HW2 A;  1FYL A;  3AAF A;  5FB2 A;  1YYV A;  4CCM A;  4JP0 A;  2DOF A;  1Y56 A;  4UB6 C;  4HEA 2;  2OZU A;  2CV2 A;  2BGC A;  2ISZ A;  4QPQ A;  4BJT A;  3Q0W A;  3CP2 A;  2XAJ A;  1GT0 C;  3ABT A;  4GGG A;  1HF0 A;  3DPL C;  2VQL A;  2CW8 A;  1FPQ A;  2IA1 A;  1RES A;  3Q0U A;  5HLI A;  2MLK A;  1J0R A;  4DZJ A;  2HKO A;  4QIW N;  1LVA A;  4Z6Y A;  3A01 B;  4JYK A;  3CMA I;  3E5U A;  1MIJ A;  2X6O A;  2Y0S N;  2HU9 A;  2KMU A;  2XAU A;  3CCY A;  3LMM A;  5EF6 A;  2EV6 A;  2DW4 A;  5H6R A;  2XRN A;  5F6F A;  1FTT A;  1KU2 A;  3C1D A;  4EGZ A;  1W7P A;  3CJR B;  2Y2Z A;  1OCZ H;  1VQO I;  1T56 A;  2NVQ J;  3U2R A;  1FYM A;  2R7W A;  1T6S A;  3TL4 X;  1JKP C;  2CV1 A;  4U0W A;  3JSO A;  3WTS C;  4IO9 F;  1BN5 A;  3R4K A;  4RB2 C;  3A0H C;  4X6A J;  3LA2 A;  4A6D A;  4AUX A;  1W1W E;  4KN4 X;  1MND A;  2OJE D;  2OAZ A;  5F27 A;  1B59 A;  1GLN A;  2HYG D;  3ISP A;  3DKX A;  4Q5S F;  2E1O A;  1SVL A;  2JUG A;  1XGS A;  4P5O A;  1J2X A;  1BW5 A;  5IP7 J;  5D5V B;  3H5A A;  4D1Q A;  1U8B A;  3ERM A;  5K5O A;  2QUF A;  4PCQ A;  5DEQ A;  4BGD A;  3L2U A;  1WKM A;  3GFJ A;  5ICF A;  2FA5 A;  1V5F A;  1R5I D;  1W0T A;  1IC8 A;  4ITV A;  1EH6 A;  1DPR A;  4AYB A;  3GME A;  2K85 A;  3LSK A;  4Q48 A;  2GA2 A;  2L7Z A;  3JTG A;  2J5O A;  1VQP I;  2VXD A;  3OYL A;  5DCM A;  2VT3 A;  1CF7 A;  2JA6 J;  1IV8 A;  1DP3 A;  3G2B A;  1IN5 A;  4QPO A;  2M5W A;  5CVJ A;  4ZTF A;  5ERI A;  1S7A A;  1KYW A;  4P1W A;  1XSX A;  4UHT A;  2IP2 A;  2XGX A;  3MKL A;  1SAU A;  4OWR B;  1FSH A;  2VXZ A;  1O7F A;  1YQA A;  2W4S A;  5J8F A;  3TBI A;  1VFC A;  2CFO A;  4IHV A;  3CCM I;  1IRG A;  3KEQ A;  4DJA A;  1A31 A;  3JRI A;  1WHU A;  1MBE A;  2G7U A;  2DMQ A;  2HVQ A;  1W0U A;  4C2T A;  3OYK A;  4GXO A;  1VQL I;  1GVJ A;  2KPM A;  2OD5 A;  2LNB A;  1S3J A;  1BI2 A;  2VKH A;  1HOM A;  1ZR4 A;  1LEA A;  2P5V A;  2WAQ A;  3RPQ A;  1FBS A;  1T2K A;  4IEJ A;  3QP6 A;  3DKW A;  3TQN A;  2ECB A;  3TP0 A;  3CUQ B;  1Y6I A;  5K7H A;  4N9H A;  3H9J A;  1OQY A;  2OV7 A;  1X1A A;  1MJ9 A;  4AC0 A;  5AON A;  4LK0 F;  2L02 A;  3VYR B;  1BR4 A;  4V2G A;  1WJF A;  1SD4 A;  3CUQ C;  1A36 A;  4AIJ A;  3KP4 A;  5LGU A;  1RRJ A;  4L0Z B;  3MD2 A;  5D5X B;  1YLF A;  1P92 A;  1OMI A;  5CQE A;  3TMO A;  5D5W B;  3TOA A;  2CG4 A;  3MWM A;  1R22 A;  1R1V A;  2OU2 A;  3V7R A;  2VE8 A;  3L7W A;  1BR2 A;  2GA1 A;  4DBQ A;  1IF1 A;  3HYI A;  1HST A;  3Q9V A;  2LY1 A;  1OIS A;  4B43 A;  1TNS A;  2BE5 F;  3AFH A;  4MEY F;  3H3V K;  1FP1 D;  3D0S A;  1TL8 A;  2ZXH A;  3FMS A;  3O3K A;  4EM1 A;  3FBN B;  3H3Z A;  3PUF A;  2VN2 A;  3KLO A;  3WHB A;  3M7G A;  3PUB A;  3F8N A;  3KLN A;  4X1E A;  2R7X A;  2VBW A;  3PJR A;  4KDP A;  3CO7 C;  3NAR A;  4FET A;  5C4X J;  3ML6 A;  3RZO J;  3I59 B;  1FNN A;  2K7L A;  4L9V A;  5DD8 A;  3CJN A;  1H8A C;  3LSG A;  3K1M A;  4NQW A;  1QVT A;  2JK3 A;  2IAI A;  3WU2 C;  5JR3 A;  1H0M A;  3RPU D;  2PJP A;  3JSP A;  3DTI A;  1D0Z A;  2NOG A;  3G73 A;  5EDN A;  3AG1 H;  3QQA A;  4S0H B;  3UR3 C;  3AG3 H;  3BTJ A;  1MSE C;  1Y0N A;  1G2H A;  5LD2 C;  3PSF A;  5D8K B;  4BHB A;  5EGO B;  2G7H A;  4LG0 B;  3O8H A;  4OIP F;  4RBO A;  2HNH A;  2CH0 A;  3N4M A;  4EAT A;  1RPW A;  5HDK A;  4A3B J;  1R5G A;  2P7V B;  2YPR A;  3QPL A;  2F4O B;  5F0F A;  4XIC A;  4G7O F;  2K9L A;  3S16 J;  1VQM I;  3S32 A;  3K4J A;  2E1M B;  3K4L A;  3DU5 A;  2E36 A;  1L0O C;  3J81 Z;  3JRH A;  3DXJ F;  4E7H A;  3HOZ J;  5FKM A;  1TT5 B;  1Y8Q B;  3IH3 A;  3MVP A;  1Z77 A;  2EFP A;  4P96 A;  1DU0 A;  5J4V A;  2XAF A;  1FYK A;  2LK2 A;  3VSL A;  2R4G A;  2Z5U A;  4BL0 B;  5K7F A;  3FM3 A;  1MMG A;  1PYV A;  2M9H A;  2H94 A;  1MMN A;  3FXL A;  3U9G A;  1S8N A;  5IT3 A;  4P55 A;  3OL4 A;  2XGC A;  4Q47 A;  3HHH A;  3HOW J;  4UUS B;  1YHQ I;  3C3W A;  2XAG A;  2EK5 A;  4IX7 A;  2WV0 A;  4OAY A;  4CYC A;  4MTD A;  3HKZ N;  2NOJ B;  5C4J J;  5J47 A;  2LD5 A;  3S3M A;  5H6Q A;  3DBH B;  2OZ6 A;  1B9M A;  2COB A;  2FBK A;  2VJJ A;  4PGH A;  1DGW Y;  4GYI A;  4E7J A;  3KP3 A;  4LFU A;  3S3O A;  2M45 A;  3AKZ A;  1YRN B;  4HNT A;  2K86 A;  3G71 I;  1W36 C;  3DPT A;  1MDM A;  1VZ0 A;  4HSR A;  4YEL A;  2N8G A;  4XSZ F;  4BE1 A;  2O6G E;  3BT9 A;  3WU0 A;  1YS7 A;  2CMP A;  1LDD A;  4C3I J;  3GTK J;  3ERE D;  1VQN I;  1ZGA A;  2Z99 A;  1K61 A;  2EIN H;  3L2Q A;  5BS6 A;  2I8D A;  4XK4 A;  1VQ8 I;  1ERD A;  2R5Z B;  3C2H A;  4M3F A;  4CUG A;  3FF5 A;  1U3E M;  3BJ6 A;  2Q1Z B;  3E97 A;  1TWH J;  3LAJ A;  1F5T A;  2NVT J;  2RRE A;  4Z2Y A;  4EV0 A;  3PM1 A;  2DA4 A;  1B8I B;  2BXY A;  1P6R A;  2Z3Y A;  1IN7 A;  3UNG C;  3DWL E;  2WAF A;  3JRC A;  1U6G A;  4IHY A;  5M5W J;  2V9P A;  1WVR A;  3R6S A;  4NHJ A;  4PDK A;  3BQY A;  2XAS A;  3KP5 A;  3CMM A;  2L0K A;  2M0M A;  1S7O A;  2IVM A;  2HDC A;  2KP6 A;  4IRG A;  2CWE A;  2R5Y B;  2PN6 A;  3H3U A;  3K4M A;  1J9I A;  3IV5 A;  2DMT A;  1XD7 A;  2DLL A;  1LEB A;  2X1C A;  1FIP A;  5DS9 A;  1BBY A;  3EPZ A;  2DO7 A;  1PUE E;  3FXR A;  4UNO A;  4LLL A;  4CZC A;  4Y4R A;  4QWQ A;  3GXO A;  4IHW A;  2W82 A;  1OYW A;  2XIG A;  3TW7 A;  2ELJ A;  2ZFW A;  3GFM A;  3HOT A;  3G4S I;  1S5L C;  5HLG A;  1ZLK A;  2IBD A;  4BQQ A;  4BHP A;  3E1S A;  4IZZ A;  3ULQ B;  2LC2 A;  2JA5 J;  4UV8 A;  4IL6 C;  3T1B A;  5FKK A;  1MW7 A;  5A2Q Z;  1B9N A;  2BY3 A;  4BS9 A;  1U8R A;  4AM3 A;  3BC8 A;  2K02 A;  1G3T A;  4XKV A;  1LDK B;  3LQQ A;  3K9T A;  4Y52 J;  1WJE A;  3M07 A;  3BPV A;  1USS A;  4LK1 F;  2MAB A;  3FMR A;  4E7Z A;  3Q5F A;  4IRH A;  1JT0 A;  3J7Z I;  3HOS A;  2B0L A;  3V4G A;  1VQ5 I;  1IRF A;  2A69 F;  2DT6 A;  2LSO A;  1FIA A;  4IF4 A;  5E8G A;  1E3H A;  4OIN F;  1D8K A;  5HS8 A;  2MFZ A;  1R49 A;  2W25 A;  5IYD J;  2FNA A;  2QBY A;  5IT9 Z;  4C2U A;  1DGR M;  1WRJ A;  2XF6 A;  4RM3 A;  2QSH X;  2TRT A;  4L5I A;  2OTJ I;  2MYS A;  5F1R A;  4CCJ A;  2WB1 N;  2KIM A;  4N0B A;  3BZ6 A;  3CCR I;  3HPH A;  4A0X A;  3FDY A;  1GV5 A;  2K9S A;  5ED4 A;  4JBA A;  2O9L A;  2OTL I;  1W7P B;  1O57 A;  2X1E A;  1SFE A;  3HRM A;  3I56 I;  4I6Z A;  3MZH A;  3DLA A;  5E20 A;  1FOW A;  1APL C;  1FP2 A;  3GTQ J;  3ABM H;  2V6E A;  3BCB A;  1GHC A;  4I98 B;  2Z33 A;  2A5Y B;  2CRG A;  4HQE A;  5DDG A;  1BJA A;  4OOI A;  2L9S A;  4HLX A;  1QHH D;  3TW6 A;  2W57 A;  2IRF G;  3D5R C;  2Z1D A;  2JQ7 A;  1MMD A;  1Y0U A;  4HZF A;  2OF7 A;  1X3U A;  2CQX A;  4EQQ A;  1YG2 A;  1RUO A;  4BKX A;  4HOB A;  4NC7 A;  2K3F A;  5FGM A;  3I64 A;  3WOD F;  3OOU A;  1PP8 F;  1FZP B;  3QU6 A;  5BMZ A;  4KN7 X;  2XV4 S;  4BAY A;  2FD5 A;  4I7H A;  3JRD A;  3FM5 A;  2EA4 A;  5KAF C;  4N4N B;  3LSP A;  2R7Q A;  2EA2 A;  3HRT A;  1D1A A;  2NVX J;  2VON A;  2M3A A;  1CF7 B;  5DCM B;  2Z9O A;  3BR5 A;  3KYD B;  2VUM J;  3BR6 A;  2VE9 A;  4XNF A;  2R7T A;  1MH3 A;  5L3D A;  2R7R A;  3Q9S A;  2P8T A;  4LD5 A;  3F6V A;  4ZDL A;  3JW4 A;  3CD6 I;  3ZQI A;  1OYI A;  1YW8 A;  4F3Q A;  3E6C C;  2L4A A;  5EYR A;  2L4M A;  1BJZ A;  6PAX A;  4BH9 A;  2A5W A;  4UUS A;  1G3W A;  5E79 C;  2HVR A;  3E0J B;  1G3Y A;  3SEZ A;  2UWM A;  1LJ9 A;  3HEF A;  2XGD A;  2P81 A;  1YS6 A;  4E6K G;  2DJI A;  1MMS A;  4HLY A;  3HGY A;  4E7L A;  3WTW C;  3H0D A;  2IGO A;  5DUI A;  2CQ7 A;  1TW2 A;  4NNJ A;  3PQK A;  1S9H A;  1O4X A;  2ZCW A;  5FRO A;  5KCM A;  2EV0 A;  2XF7 A;  2KIU A;  2XB0 X;  2B9S A;  2PMH A;  4IKF A;  3KET A;  1G4D A;  2JVG A;  4I01 A;  5C3E J;  2ZNY A;  4M72 A;  1O3S A;  2EIM H;  2ZC2 A;  1RET A;  5CKT A;  1ZRF A;  3ZN0 A;  4GRI A;  1BA5 A;  3MQ0 A;  2GZW A;  2PMZ A;  2FQ4 A;  1XB4 A;  2HKX A;  3UKG A;  2NAZ A;  4IHT A;  1Q1H A;  2GOX B;  2RQQ A;  1IAW A;  2XKO A;  2TDX A;  3J7A O;  2IS2 A;  2CU7 A;  3OYG A;  3ECH A;  3B6A A;  1V5G A;  2EZL A;  4RLF A;  2E2H J;  2LFB A;  5CJ9 A;  1KYZ A;  3BR3 A;  4RS8 A;  1T0F C;  2QQB A;  2KDZ A;  2M7A A;  4D5F A;  1IRZ A;  3S2W A;  2O7O A;  2HQN A;  5HNH A;  1R00 A;  5ILV A;  1HDP A;  4AWX B;  4LLG F;  3LSI A;  3K0L A;  2OCE A;  3DEW A;  3SZG A;  3CME I;  4ZDO A;  1YIT I;  1E2X A;  4JX4 A;  4EJW A;  1JHF A;  4RM2 A;  4NQW B;  2JA8 J;  1JGS A;  2RAE A;  4UY8 I;  4B8X A;  2RNJ A;  5LEK A;  5DM6 F;  2ZJR F;  1X4P A;  1XGM A;  4D7N A;  2LRD A;  3VDX A;  1UAA A;  3S1M J;  5EG0 A;  2M87 A;  2VOP A;  2JWT A;  2ZB9 A;  3S17 J;  2NRA C;  1FMV A;  3GFI A;  4E7S A;  2QF7 A;  3K4N A;  2BW3 A;  4DYC A;  3WTV C;  1ZEL A;  2A61 A;  4BXU A;  1QZY A;  1R9T J;  4YRV A;  2DMU A;  3RQ4 A;  2ZO4 A;  2CW7 A;  2LY2 A;  3U1D A;  1D1C A;  2BHZ A;  4PFP A;  1MH4 A;  5J1U A;  1G8X A;  2DTZ A;  2DI3 A;  2MW8 A;  4IQJ A;  4E4H A;  4KNY A;  4Y15 A;  4NB5 A;  3GLX A;  2VOD A;  4PGG A;  5F1J A;  4B44 A;  3EYI A;  1WZ2 A;  3VOE A;  3W2A A;  2XF5 A;  5E3O A;  2W24 A;  2CUF A;  4I0B A;  3RKY A;  3T8T A;  1TWA J;  1B1B A;  4IPA A;  1DP7 P;  3I5U A;  1F4K A;  4RA2 A;  2HFH A;  3SQN A;  3VYS B;  4WXH A;  1N78 A;  4Y17 A;  4CCK A;  1FOY A;  1YW7 A;  2EZI A;  3CDI A;  3GTP J;  1DDN A;  2DFE A;  1I6H J;  4W97 A;  4XMY A;  1V5E A;  3BP8 A;  4B09 A;  5M3F J;  4M3E A;  4J00 A;  2MBF A;  3NWS A;  4CYC B;  1IG7 A;  3IAS 2;  3PSI A;  2DK8 A;  4IRI A;  1U5T C;  3V7S A;  1WCM J;  1XMX A;  4XLA A;  2HPI A;  3WHC A;  1Y1V J;  5ILS A;  4YFN F;  1LUJ B;  3QPH A;  1EH8 A;  4DNC A;  4RB3 C;  5F04 A;  1XG1 A;  1D0X A;  3SEQ A;  4CZZ A;  3LL7 A;  1UCR A;  1SC7 A;  1P7I A;  5GTH C;  1T38 A;  4B4C A;  3I4N J;  4KUM A;  1MDM B;  2P0W A;  2VBX A;  3J7A Y;  2EPF A;  2F48 A;  2PFB A;  1JUP A;  5EEG A;  2GLO A;  1B72 A;  2M7B A;  2QA4 I;  1WPK A;  2KRF A;  3I53 A;  2D5V A;  4DYR A;  3HBL A;  3J7Y J;  4BDY A;  3RYR A;  5LHG A;  5BOX A;  5E1W A;  3KPH A;  4YEJ A;  1OLT A;  3OS0 A;  5LHI A;  1X1D A;  1R36 A;  2F5F A;  4NC8 A;  2IGM A;  2PBI A;  4PK4 A;  2V1D A;  1QVU A;  4UXN A;  1JUM A;  3W6J B;  5DV5 A;  3GYH X;  5CVI A;  3BTI A;  1OFC X;  4P9U A;  4NUB A;  2P7C B;  3HTS B;  1R71 A;  2BBY A;  2WY8 Q;  1ORK A;  3FHN A;  2DXI A;  2M4G A;  3CO6 C;  1UHS A;  3P9C A;  3A2K A;  2V1N A;  2VKV A;  4YIR X;  1F36 A;  3HTU A;  2VOO A;  3RKQ A;  2MH9 A;  2NNN A;  2EIK H;  1FBU A;  4FIS A;  3ZP5 A;  2KKO A;  3I54 A;  4I02 A;  2VLA A;  4MO7 A;  5HVQ C;  1JUS A;  1OCO H;  3IL2 A;  4XOT A;  3AG2 H;  1MBJ A;  3D5S C;  2L01 A;  4LB5 A;  3OYA A;  2M1B A;  3C7J A;  2NYX A;  2YU3 A;  3CTA A;  3EUK L;  5CLS A;  1RIO H;  1JJ6 C;  3S2H J;  3DF8 A;  3DTK A;  2I10 A;  4DW6 A;  5BPI A;  5IOZ A;  3FK7 A;  5DCF A;  5IT9 K;  1EF4 A;  4DQ2 A;  5HS9 A;  3S3N A;  2YX7 A;  2K9N A;  3W6K B;  3JRA A;  5KK1 A;  1FMW A;  3ZRG A;  4XOR A;  3M9A A;  5HLH A;  4YG2 F;  4KIG A;  4KT5 C;  3K4C A;  1KON A;  2KHM A;  2QLZ A;  2LR8 A;  3E6B A;  3CJQ B;  2O61 A;  2EZH A;  3BG6 A;  5JHU A;  2F5C A;  4IHX A;  5JHF A;  4WK8 F;  4CH7 A;  3CCJ I;  5CYV A;  1DU6 A;  1P9Q C;  1J75 A;  2RQP A;  5D6F A;  5DTD A;  5IY5 H;  4KFC A;  4BBS J;  3OYD A;  2FMY A;  3OSF A;  1GDT A;  2PX9 A;  2FXA A;  4RGS A;  2R7U A;  5FLX K;  2R0Q C;  2CSO A;  4M6X A;  2UV1 A;  3ZR8 X;  4C9Y A;  4Y13 A;  5CQG A;  3I71 A;  2ID6 A;  4M3B A;  3GVA A;  2CUE A;  3D1N I;  4HNU A;  3H5N A;  4BE2 A;  4EJT A;  3REO A;  1T0F A;  1T8I A;  1OCR H;  3HSE A;  2MD0 A;  2QBY B;  4HAM A;  4HF0 A;  3HDD A;  3I3L A;  1RNL A;  2EFO A;  1Z05 A;  5K7Z A;  2NS0 A;  2GOM A;  3W6V A;  2KT0 A;  3K4K A;  4UUV A;  3G1L A;  2DOA A;  4FE7 A;  3ELK A;  4AVP A;  1JTX A;  5CVR A;  3BCA A;  3HSR A;  1ZN2 A;  1W5C C;  3EET A;  2IXS A;  1SFU A;  4E7I A;  1ONV A;  1PVE A;  2JT1 A;  2DOD A;  2M2E A;  3FXK A;  2ME6 A;  1GXQ A;  4A6E A;  4ZYG A;  2FSW A;  5DM7 F;  2HZD A;  2QGU A;  4ZJZ A;  3ZQG A;  2QEX I;  4ZYA A;  2VBY A;  1XN7 A;  4LGW A;  3E3V A;  4ZDP A;  2V1U A;  4ENJ A;  2O8K A;  2LF8 A;  2DTR A;  1D5V A;  2JZY A;  3J80 K;  4FE4 A;  2JRM A;  4I09 A;  3HOX J;  4XRM A;  3NAU A;  5B5E C;  2JSC A;  5BQT A;  2D2W A;  3HZJ A;  3PIO F;  2LVS A;  5JVT A;  2JA7 J;  4XRF A;  5TGT A;  4RAG A;  4FCY A;  1O3R A;  3O6B B;  3X2Q H;  5FKL A;  1AHD P;  3OV8 A;  4BNC A;  1E3P A;  2EH3 A;  2DA5 A;  1TBX A;  1XTA A;  1QBJ A;  2XHK A;  4M73 A;  3FXO A;  4GDF A;  1TNT A;  2M30 A;  3TO7 A;  2ZBK A;  2O8X A;  4IHS A;  4B1R A;  1YFH A;  1FY7 A;  2A3S A;  1V3F A;  3RKX A;  1IN8 A;  3R60 A;  1IRX A;  3OYH A;  5B1B H;  2A6E F;  2QQA A;  3E5Q A;  1ZG3 A;  3A0B C;  2W1O A;  2F2E A;  2NXN B;  3ESW B;  3LST A;  1ETV A;  5L3E A;  2ZME C;  4RB0 A;  3RCO A;  2FBH A;  3QU3 A;  4BJ6 C;  4UVA A;  4ENK A;  2VIX A;  3H36 A;  4C2M J;  1ZR2 A;  2JTV A;  2QSF X;  1YJN I;  4HBL A;  5C44 J;  1ZKG A;  5JLW A;  5B1A H;  1SD5 A;  3CF5 F;  4EMS A;  1HXD A;  1D5Y A;  4C30 A;  4LJZ F;  4O6J A;  1WQ2 A;  4EJO A;  2FML A;  3P7N A;  3L09 A;  1QGP A;  5EEH A;  4B3X A;  4BUP A;  3SJM A;  2W48 A;  3KIO A;  4HX8 A;  4JOM A;  2LKX A;  4II2 A;  1FEX A;  3MMY B;  1RKW A;  3KP2 A;  5TIS C;  2DYS H;  4G6T B;  4MIM A;  3RPU A;  1WJB A;  3FKJ A;  1BR1 A;  4KIB A;  3F8B A;  2X6X A;  4XLH A;  1U5T A;  3ROU A;  3DFG A;  1T39 A;  2EBI A;  3LFK A;  2AXT C;  4WXC A;  3H0G J;  1LFU P;  2ZXI A;  4XQF A;  1BC7 C;  2E35 A;  2LY9 A;  4XBF A;  5GP9 A;  2XUB A;  1BIB A;  1SD6 A;  3EQL F;  4C3H J;  3DQV C;  4RGX A;  1FWZ A;  1RI7 A;  4ZC3 A;  4A5N A;  1YIJ I;  1IO2 A;  2OQR A;  3M4O J;  3MAJ A;  4M3D A;  4ZYD A;  4PJM A;  2XB5 A;  3L1P A;  3B6C A;  2JA2 A;  5FLV A;  1AKH A;  3M8E A;  3DBR B;  5J8C A;  3OYJ A;  3H5R A;  1KU3 A;  3DBL B;  2CUJ A;  2J5P A;  1QU3 A;  2IA2 A;  3P9I A;  4ESB A;  2KJB A;  4ETS A;  3VOD A;  1BL0 A;  3W2V A;  2Y31 A;  2VPL A;  2BVL A;  4JQF A;  1ZGW A;  3VFZ A;  4U0V A;  3OIQ A;  4BHC A;  2DA2 A;  3PO3 J;  2P5K A;  1UZC A;  1LNW A;  3SFI A;  3F0C A;  1K4S A;  1JXS A;  2WBM A;  4F93 B;  1UHM A;  4EEF G;  4XON A;  5M5X J;  1DUX C;  2LF7 A;  2BEO A;  1JGG A;  1X58 A;  2PLY A;  2FNP A;  3FK6 A;  1D3Y A;  5DYM A;  2ELK A;  3F8F A;  4A0Z A;  1F43 A;  5M5Y J;  4FT8 A;  1XCV A;  2G9W A;  1JKO C;  3GO5 A;  1JKQ C;  2XDV A;  3L2C A;  1HKT A;  2D1V A;  5D5U B;  3LSJ A;  2ZFU A;  3M8J A;  2QKL B;  5EJC A;  3L2V A;  2W84 A;  4BQO A;  4AIH A;  5FFZ A;  1X1B A;  2Y0M A;  1MZB A;  1WWX A;  5DUK A;  2ISY A;  4XN3 A;  2QEN A;  4AYB N;  2VJ5 A;  4Y33 A;  4OIQ F;  4EM2 A;  2MH2 A;  1YJ9 I;  3BG5 A;  2V9K A;  2XRO A;  5EG0 B;  2Q0O A;  2F4I A;  2HDD A;  3GW2 A;  3L9F A;  3TED A;  1ODD A;  3NWT A;  2BHY A;  2XKP A;  4A3G J;  1ZLJ A;  2BW3 B;  2CYY A;  3LQR A;  4KJZ A;  4H0E A;  2D45 A;  3ZGK A;  2JN6 A;  2VJI A;  1HKQ A;  3K70 C;  2YX4 A;  3IH2 A;  1WSU A;  3IRR A;  2IS6 A;  1WI9 A;  2DOE A;  2L7K A;  3BR2 A;  4MGR A;  2QM3 A;  1Z3Y A;  1GV2 A;  1A6I A;  2DFI A;  1GVD A;  1ZHF A;  5E17 F;  2YU9 J;  1TW3 A;  2R7F A;  1SEU A;  4ZZL A;  3SHF A;  3M8F A;  4FAS D;  1IZ1 A;  4G8X A;  4AU7 A;  1EV7 A;  3F3X A;  4RMN A;  2MA3 A;  1NHA A;  3F9K A;  3BWG A;  3G1M A;  1B4A A;  2G0E A;  4ANJ A;  4FTH A;  3KZZ A;  3FIS A;  2WAQ N;  4II3 A;  5HS7 A;  1HW5 A;  5EZG A;  2AXL A;  3GZ6 A;  2VQG A;  3C18 A;  1ZRD A;  1G59 A;  4YFK F;  2BZT A;  3RSN A;  4OMY A;  4MQ9 F;  1IXC A;  3P9K A;  1PDN C;  3OR1 C;  3DEU A;  2Q8K A;  3PQJ A;  4CO8 A;  1UMQ A;  1Y8R B;  3LWF A;  4A2U A;  1T98 A;  1QZE A;  3IWZ A;  3BTC A;  1XS9 A;  4F55 A;  5BNG A;  1LDJ A;  1S6L A;  3PNV A;  4CIC A;  1DPU A;  4KIT B;  4IXA A;  3LA7 A;  4D5C A;  1XSD A;  3ZMU A;  2CS3 A;  2WWY A;  1H9T A;  2VQC A;  4MQV A;  2WAE A;  3OY9 A;  2RGV A;  5H20 A;  1OPC A;  4HG2 A;  2A68 F;  2ZSH B;  4V19 K;  3RIR A;  1X19 A;  3S1R J;  2HI3 A;  1PJR A;  1XSV A;  2EIJ H;  4XID A;  5LRS A;  3E6D A;  2Y9Z A;  2HPM A;  2FEZ A;  2BYV E;  3RJP A;  3WGH A;  2Y0S A;  1TQI A;  4MHG A;  3ZPL A;  1R4N B;  2IGK A;  4IOA F;  1B72 B;  3VWB A;  1ZG1 A;  2RKH A;  2WAD A;  5LLQ A;  2IA0 A;  3H35 A;  2X48 A;  4CCO A;  1H89 C;  2Y48 A;  5FRN A;  3QYE A;  3VPR A;  2P6T A;  1TWG J;  3SDB A;  2JSP A;  5K5Q A;  3IAM 2;  1EJ9 A;  1MKM A;  4L9T A;  3B02 A;  4M74 A;  1UST A;  4AVZ A;  2DA7 A;  5D6E A;  2XPW A;  3RI4 A;  3MN2 A;  1XCB A;  3LNQ A;  2ZME A;  2VJ4 A;  4BU2 A;  4U7D A;  1MMA A;  2CQN A;  3EUA A;  2EJR A;  1XPX A;  2A05 A;  1TP4 A;  1U9N A;  1X4O A;  1VQ7 I;  4L0Y B;  1TZL A;  1ZAR A;  1I50 J;  3NQO A;  4MEX F;  2MLG A;  2JVH A;  5FKN A;  4MNU A;  1QZZ A;  3U21 A;  3IUO A;  3QOD A;  4BEH A;  1R5H A;  4MFD A;  2UXX A;  3HM5 A;  2DA3 A;  1W36 D;  1BOB A;  1SMY F;  2X4H A;  5GAG J;  1AU7 A;  2LH9 A;  4LIV A;  1SMT A;  2HTJ A;  3M1C A;  1P2F A;  1M1E B;  1QRY A;  2LMD A;  2COM A;  3A1Y A;  2EB7 A;  2FE3 A;  2KJC A;  1XX5 A;  1CGP A;  2FQ3 A;  4OAZ A;  2CO5 A;  2HOT A;  2OQG A;  2X6Y A;  4HF1 A;  4GCV A;  1WH5 A;  4HV5 A;  1FSE A;  3FXQ A;  1RZ4 A;  2DCE A;  3CQZ J;  1ZTR A;  2VKD A;  3BPX A;  1LE8 B;  2HWV A;  4CHU A;  5JVG F;  5D4S A;  3KYC B;  2ESH A;  4G6Q A;  3ZXS A;  2FJ1 A;  4BAC A;  3BRO A;  1AWC A;  3ZCO A;  3JRB A;  1YJW I;  1FC3 A;  3MZY A;  4XSX F;  5CVU A;  1JE8 A;  4L5E A;  3WG9 A;  2QCO A;  3GUD A;  1IXR C;  5D8L B;  2E2I J;  3FXJ A;  4A3M J;  2GWR A;  2ID3 A;  3L2R A;  3BZK A;  4L9N A;  2VAS A;  1XGN A;  4LG3 A;  1V54 H;  1NG7 A;  4UVB A;  1R4M B;  4RAZ A;  1K78 A;  3PO2 J;  3NEU A;  1OR7 A;  1UEL B;  3CES A;  2X6W A;  1HDD C;  2HQR A;  5ILU A;  5ICE A;  1K79 A;  1TLH B;  2M4K A;  3CP8 A;  1JKR C;  1XDS A;  1ZYR F;  3QYB A;  1R1T A;  3LAP A;  2W00 A;  4BDZ A;  2R93 J;  4QTR A;  2BY0 A;  1TC3 C;  4A0Y A;  3BG9 A;  3HXL A;  1O7L A;  1N75 A;  2EIL H;  2HGC A;  2GXG A;  1KZH A;  3GTJ J;  1ZQ3 P;  2HYJ A;  3HHG A;  2GAU A;  4YIF A;  4Q4Z F;  3DKY A;  1IGN A;  4PSW A;  3HOV J;  1P7J A;  2FX0 A;  2DA1 A;  2MC3 A;  4A93 J;  1UFM A;  4YII A;  1MGT A;  3HOU J;  4M3G A;  2HOA A;  1YO5 C;  4CA0 A;  3J81 K;  4EVI A;  1T95 A;  1OCC H;  3ZOB A;  2PQ8 A;  1MNE A;  2R7D A;  4GFB A;  4N9I A;  3K69 A;  4P9F A;  1LVK A;  1A04 A;  3RZD J;  5E18 F;  4F52 A;  1ZGJ A;  2LLK A;  5HDN A;  1DQU A;  1VQ6 I;  2ACJ A;  1X1P A;  4NC6 A;  3GTO J;  2TCT A;  2GQQ A;  2STT A;  2LG4 A;  1HW1 A;  2BV6 A;  1HQC A;  4G6D A;  4I76 A;  2DT7 B;  2A07 F;  2L5Q A;  2XAH A;  4PFO A;  2CUZ A;  2KRH A;  4G12 A;  1ETO A;  1TQP A;  5JI6 A;  3JR9 A;  4M6Y A;  4OMZ A;  4HNV A;  1XC5 A;  2YR2 A;  2ZNZ A;  1SAN A;  2F6C A;  1RUN A;  1GUU A;  4XL9 A;  2FUG 2;  2E1C A;  2OA4 A;  2D1H A;  2LRE A;  1HA8 A;  4MTE A;  3H1C A;  1T08 B;  3QOP A;  5IP9 J;  2A6H F;  2HXO A;  3KEO A;  3V8J A;  4ZTJ A;  4ZYH A;  3BLY A;  1H9G A;  3TDZ C;  1Q1V A;  4EM0 B;  2ZXW H;  4A3D J;  5E3M A;  3K7A J;  5M3M J;  1ON2 A;  2LDU A;  3FXM A;  4A3C J;  3S15 J;  2ESN A;  1BI3 A;  4IVN A;  1F1Z A;  1S29 A;  3T8R A;  4A3I J;  1ETW A;  4DBR A;  3V42 A;  4KMF A;  1IXS B;  4R1H A;  4HA8 A;  2IEK A;  3FWE A;  2B7E A;  5E3L A;  3K1P A;  4JX6 A;  1MSF C;  2CW0 F;  4FX4 A;  4KIC A;  5ICC A;  3JRG A;  3HPG A;  3MCZ A;  3BR1 A;  3DPU A;  5LEJ A;  3PFY A;  1HSJ A;  4LMY A;  3HL2 A;  4RLQ A;  4BY1 J;  2JUC A;  3ZQ7 A;  4XKW A;  2QKM B;  1W7P D;  3P5J A;  4GO1 A;  3KCC A;  2FU4 A;  4A3J J;  3LA3 A;  5FD5 A;  4KIF A;  1TT0 A;  2L7M P;  5BPD A;  1LFB A;  3L00 A;  3VSK A;  1U5T B;  4DIQ A;  1VQK I;  3O2P E;  2VC0 A;  3I0T A;  4R79 A;  4U0Y A;  2FF4 A;  3ECO A;  4QLC U;  3G6E I;  3SXY A;  5FD6 A;  2HEO A;  3RQI A;  2DN0 A;  2K4B A;  3V8K A;  5B66 C;  1NTC A;  3HSF A;  3E7L A;  4LIT A;  1FJL A;  3HKZ A;  1LPQ A;  1E17 A;  3EUH A;  3C2G A;  3OYI A;  1AKH B;  3GZN B;  5AIP A;  5HNF A;  1VTN C;  3DP7 A;  1STZ A;  4HV6 A;  2VL8 A;  3HJE A;  3OSG A;  2CGP A;  4XN0 A;  1N77 A;  1BC8 C;  3KZI C;  4L9J A;  3KX2 A;  4NDL A;  3ZQF A;  5FLM J;  1J5Y A;  1U0J A;  3OYF A;  3OWT A;  4BY7 J;  5JLX A;  1MJB A;  2VKE A;  3F23 A;  2ICW G;  2EZK A;  1ON1 A;  2HYF A;  3QWL A;  1X2N A;  2AQF A;  3C2B A;  4Y7N J;  1REP C;  1R6R A;  2QQ9 A;  3TGN A;  4HF2 A;  1LKX A;  2VB6 A;  5F64 A;  3FHZ A;  2I5U A;  2V1X A;  2DDA A;  3ZQH A;  3HUG A;  1WJ5 A;  3PIP F;  3S14 J;  3S93 A;  1X3Z B;  3COA C;  1JJ8 C;  2M8E A;  3CDL A;  3HB9 A;  2GM4 A;  4R8H A;  4S05 A;  4XOP A;  2BVM A;  5A2Q K;  3WTY C;  1PUF A;  2MD5 A;  1XMK A;  3CCE I;  2HDW A;  3BQZ A;  3TO6 A;  2AS5 F;  2R7Z J;  2RV8 A;  5L3G A;  2DAO A;  2V79 A;  1G3S A;  3WTX C;  1I39 A;  2HR3 A;  2KIS A;  5F0H A;  4HDV A;  4NBQ A;  3OYN A;  4Y3O A;  3CZ6 A;  1W4M A;  1BM9 A;  2X51 A;  4A69 C;  3ZQQ A;  1YI2 I;  1P4A A;  1WI3 A;  2OUM A;  1SFX A;  2LTP A;  5E1Z B;  2VBZ A;  4XRS G;  5HOD A;  3OYM A;  2HTS A;  2NVY J;  1SFO J;  3CDH A;  3EYY A;  4F91 B;  3CCS I;  1UB9 A;  1LE8 A;  1KA8 A;  4GYG A;  3MZ8 A;  3OIO A;  5E1X A;  4V2F A;  4F92 B;  2AO9 A;  1LB2 A;  3Q3S A;  3N05 A;  2A6T A;  3K6G A;  2Q2E A;  1QHG A;  1YW9 A;  3RKW A;  2ETH A;  4I0A A;  4CCN A;  2HVS A;  3GZ5 A;  3TOB A;  2RDP A;  5KHD A;  5J3L A;  1MBG A;  4UUT A;  3ZMZ A;  5LBQ A;  2H1L A;  4I99 C;  1X3W B;  5DD4 A;  3I55 I;  2E1N A;  4PZJ A;  2K4J A;  3CC7 I;  2P5L C;  4RGR A;  3W3C A;  4BQN A;  1SAX A;  5EEA A;  2FOW A;  1R23 A;  1A6Q A;  1ETY A;  5CVV A;  2PJR A;  2E7W A;  3BJO A;  2RNG A;  3ASN H;  1IDZ A;  5E3N A;  2UXN A;  1ACI A;  1POG A;  4IOC F;  3H9Q A;  3ABU A;  3CC4 I;  5J6X A;  2E71 A;  1VQ9 I;  3VEP A;  4UVC A;  4F7Z A;  3PNY A;  5L3B A;  2Y75 A;  2KDO A;  3OMY A;  4FHT A;  4HX4 A;  1O3T A;  1F9N A;  2JPB A;  1RKT A;  2C6Y A;  2NNY A;  1KQ8 A;  3BG7 A;  1E3O C;  4DGW B;  5J1R A;  3FKI J;  5GAD J;  3LSR A;  1WJA A;  2PMZ N;  5CPR B;  3MKW B;  1RR8 C;  4CSW A;  2EFW A;  2F5D A;  1Y1W J;  1XGO A;  3E5X A;  1MBF A;  2IJL A;  2KLO A;  4HW0 A;  3RYP A;  2W85 A;  2QSG X;  5FJ8 J;  2WB1 A;  3ZMT A;  2K40 A;  5GPA A;  3R0J A;  4E7K A;  1HLV A;  4L18 B;  3S1Q J;  2F5V A;  2H8R A;  1Z1D A;  2DBB A;  2EFQ A;  1KU9 A;  4PJ0 C;  3QPT A;  3FZV A;  1D8J A;  2ECC A;  3WTZ A;  2XPU A;  3GF2 A;  4LIU A;  3JAM Z;  4MLO A;  3GWZ A;  2CQQ A;  3FMQ A;  2QWW A;  2LBF B;  3E6M A;  2KFD A;  3MFK A;  3OL3 A;  5L3C A;  1HC8 A;  4RDU A;  2R7V A;  1YOV B;  4XLP F;  4BXX J;  3HGG A;  4KIS A;  2CFX A;  4ON0 A;  3PNT A;  4LLN A;  3U1K A;  1FT9 A;  2MSY A;  2ZME B;  3I4M J;  4ENM A;  2DQR A;  2GXB A;  3FX3 A;  4CYD A;  2OBP A;  4FX0 A;  1Z3X A;  1BI0 A;  2K27 A;  2QQ8 A;  1KQ9 A;  1T33 A;  2XAQ A;  1K83 J;  3F8M A;  4S04 A;  3GBG A;  2F5E A;  3QPS A;  2L9R A;  2VI6 A;  2Y69 H;  1FOK A;  1D1B A;  2V9V A;  4CXF A;  3ABL H;  1Y39 A;  4A3K J;  4BEH B;  4UB8 C;  1ENH A;  3OOP A;  3WGG A;  4CDG A;  3DU6 A;  2GIZ A;  2HQ5 A;  4XLC A;  3GEZ A;  2WTE A;  4E70 A;  4M9S A;  3CMY A;  2HXI A;  3CLQ A;  1OCP A;  3S1N J;  9ANT A;  2OC6 A;  1LFP A;  5EZH A;  1MNM C;  3GTM J;  3KE2 A;  1SVO A;  4ABZ A;  4DYQ A;  5J1Y A;  3WU1 B;  2XC7 A;  2Z2S B;  2O0Y A;  2EWN A;  2VC1 A;  1B6A A;  1N25 A;  2P6S A;  3V8L A;  3BJA A;  2HZT A;  1WJD A;  4JK1 X;  2E1M C;  2PMU A;  2Z16 A;  2BXZ A;  3HRS A;  1W5S A;  1AA7 A;  2H09 A;  4D9J A;  3IC7 A;  4WXD A;  4A5M A;  4AID A;  3A02 A;  3FIW A;  2WV1 A;  1EA3 A;  5K1Y A;  4OIO F;  2E2J J;  1FTZ A;  2RVC A;  3FXU A;  3BG3 A;  2K5C A;  2NS7 A;  1C0W A;  3OYE A;  2GXA A;  1FOX A;  5L3F A;  5JFR A;  4XKB A;  2V6C A;  1HBX G;  1S72 I;  1CQT A;  2RN7 A;  2OPT A;  2XSJ C;  5ICG A;  3KZY A;  1X1C A;  2CJJ A;  4H4K C;  1K78 B;  4LB6 B;  1QA6 A;  2DPD A;  5KAI C;  4EGY A;  3ZQL A;  2GBY A;  2HS5 A;  3BZC A;  3QAH A;  3DCF A;  3GFL A;  3HRU A;  3A01 A;  2H1K A;  3AL0 B;  3IKV A;  3CC2 I;  3WG7 H;  3A03 A;  3FBI B;  1OR7 C;  1AOY A;  1QNT A;  2GIV A;  4BYY A;  2YSR A;  2R3S A;  1YE9 A;  2ADU A;  4XRS A;  2CV0 A;  3AL0 C;  1BW6 A;  2L9V A;  1ZRE A;  3F6O A;  3PL8 A;  3V7C A;  2AQE A;  2PEX A;  1W5T A;  5GAE J;  1NK2 P;  3ABK H;  3CF2 A;  2DMN A;  4G9Y A;  1IN4 A;  4XR6 A;  5HDG A;  5GAH J;  4KA4 A;  4WF2 A;  5LRR A;  3WGI A;  3OYB A;  3WE3 A;  3DEE A;  3G3Z A;  3IP4 B;  1P4X A;  4HRI A;  4ESF A;  3GLL A;  4HX7 A;  3JRF A;  1L3L A;  2MC4 A;  1R7J A;  1EH7 A;  1K6Y A;  2WA0 A;  3GCM A;  2M0C A;  2DFF A;  2E5N A;  2ZXJ A;  4BQA A;  1QPI A;  4J01 A;  4N4O B;  4ESJ A;  4HDU A;  1U2W A;  2IS1 A;  3ZMD A;  2X1D A;  5KNL A;  1WFX A;  1ZK8 A;  1TWC J;  2DU9 A;  1LQ1 A;  1OCT C;  1HCR A;  4XLN F;  2IS4 A;  4AD9 A;  1Z7L A;  1O3Q A;  4CCL A;  2E60 A;  2Y30 A;  2K9Q A;  3F72 A;  1JT6 A;  1TQM A;  4JX5 A;  4ENN A;  1KU7 A;  1YTY A;  1OYY A;  5GTI C;  2O3F A;  4M6V A;  4XKC A;  3OYC A;  5FO5 A;  3MKY B;  2P4W A;  4XM3 A;  2V7F A;  3K2A A;  3F21 A;  1YX3 A;  1JTY A;  1OKR A;  2PG4 A;  5FKO A;  1XMA A;  4K2E A;  3LFU A;  1A5J A;  1IN6 A;  5H2F C;  3GX4 X;  3K1N A;  3O8G A;  3IWF A;  4A3F J;  2QYO A;  3JTH A;  3B73 A;  1ITY A;  1EKE A;  1IV6 A;  1Z91 A;  4B48 A;  1Z9C A;  4ZYE A;  3RDI A;  2L2O A;  3SFZ A;  2NS8 A;  4TV7 A;  4AIK A;  1ZG5 A;  2HOS A;  1ETK A;  1UG0 A;  2B63 J;  1R1U A;  1J7K A;  2EQR A;  5LFA A;  3CCQ I;  3CUQ A;  1ETQ A;  2H27 A;  2DFH A;  2K9M A;  1OJL A;  2QZ8 A;  2L3D A;  4RGU A;  4EJU A;  2DQL A;  4KMU X;  3BTL A;  1U9O A;  3K4B A;  1YIO A;  2HOE A;  2CQK A;  2DYR H;  2YUS A;  3OR2 C;  2V26 A;  3CUO A;  5GPC A;  2FOK A;  2W7N A;  3QRF F;  5F0C A;  4C3J J;  5IPA A;  3H9G A;  2YS9 A;  3LSH A;  1J59 A;  2E7X A;  2UZK A;  3T5X A;  1HKS A;  4QSH A;  3SZP A;  2XRL A;  5B3S H;  1J09 A;  3G1O A;  1I3A A;  3LSM A;  4ZZD A;  4BBR J;  3CCV I;  3M3Y J;  2VT2 A;  2DJN A;  3K10 A;  3EUH C;  1VND A;  3IHU A;  3MEX A;  1MD0 A;  1YX5 A;  5HOO A;  4BXF A;  3HG9 A;  4IJA A;  4WX9 A;  4XLE A;  2R7O A;  4D7M A;  4DZP A;  3CJT B;  4WCG A;  1KQ0 A;  2LBF A;  2UUZ A;  4OU0 A;  1NK3 P;  4HQM A;  1I6X A;  3D5L A;  5LHH A;  5HLT A;  5TRD A;  3HUG B;  2BY1 A;  1RR7 A;  2V4J C;  4G94 A;  3I59 A;  4PJJ A;  4G7H F;  1VQ4 I;  2DPU A;  2DT5 A;  4KYW A;  5J40 A;  1BOA A;  2R92 J;  4XLF A;  2ELH A;  2MGQ A;  1PUF B;  5FLX Z;  3ONQ A;  2AHQ A;  1WH7 A;  4CGZ A;  1IDY A;  1IUF A;  1Z67 A;  3F8C A;  2DK5 A;  3I9V 2;  2L54 A;  1I27 A;  4LG0 A;  5EGO A;  1QQI A;  5TJJ A;  1V55 H;  1WJC A;  2ZSI B;  3R0A A;  2BY2 A;  3WTU C;  2BOL A;  4MFE A;  1K4T A;  1E0E A;  1ULY A;  1IW7 F;  1FX7 A;  2VPR A;  5FFX A;  4YFX F;  3CCU I;  3SDG A;  2KZG A;  3CLO A;  2E5Z A;  4DOZ A;  3H92 A;  1K6O A;  2MG4 A;  3ZN1 A;  1U78 A;  4L5J A;  3OIP A;  3VYT B;  1SFK A;  3K2Z A;  5E8I A;  2JJ7 A;  2WY7 Q;  2XGE A;  2ME0 A;  3T0Y A;  3QYF A;  5K5R A;  1X2M A;  4M9Z A;  3KYL A;  2LOO A;  1PP7 U;  5IYC J;  1I3Q J;  1SD7 A;  4M71 A;  2M34 A;  3I4P A;  2KIQ A;  3EDP A;  2DMP A;  5KVR A;  3DTE A;  2OCC H;  1I5Z A;  1Z7U A;  2Q2E B;  3PFI A;  5J4Y A;  5D4R A;  1KGS A;  1IJW C;  3GTG J;  3KP7 A;  3OS1 A;  3ASO H;  4I2O A;  3J80 Z;  4M9X A;  2O5R A;  1UG2 A;  3KEY A;  1ZAO A;  4U87 A;  2K3P A;  3SYT A;  4ZH4 F;  5FRM A;  3ZQC A;  1JI8 A;  1S7E A;  2Y9Y A;  2PI0 A;  1WGX A;  4WWC A;  2H6C A;  1Z0X A;  1P4W A;  2IW5 A;  3M1E A;  1QO0 D;  3TP3 A;  3JAM K;  2PJR B;  3IRQ A;  2H6B A;  2IT0 A;  4UV9 A;  3AG4 H;  1ETX A;  4B3A A;  3NRV A;  3JCU C;  2WC2 A;  4U7B A;  3JRE A;  1I1G A;  2X0L A;  1Z6T A;  3BR0 A;  4LOC A;  2QVO A;  2VQH A;  3TKY A;  1BIA A;  2IPQ X;  1YRN A;  4FQG A;  4O5V A;  4EJV A;  3SZT A;  2M8G X;  3VB2 A;  2DDB A;  3K70 D;  3HOY J;  4A3L J;  4J19 A;  1UJ8 A;  1FLI A;  2LP0 A;  1K7A A;  1SVM A;  4RB1 A;  4PJL A;  2EFN A;  3ZMS A;  2F4M B;  2IGN A; 
#chains in the Genus database with same CATH homology
 2JRT A;  2FRH A;  1FBQ A;  3QP5 A;  3DV8 A;  2RC4 A;  3BOQ A;  4A12 A;  3R61 A;  1JHH A;  1Z6R A;  4OIR F;  2KIF A;  3ZMV A;  5AIQ A;  1ZH5 A;  5LGN A;  1GXP A;  3HIF A;  2ZKZ A;  4U88 A;  1IUY A;  1BI1 A;  3RTR A;  3BDD A;  2XVC A;  3KP6 A;  3TO9 A;  5LGT A;  2STW A;  1MJA A;  3I58 A;  3KFW X;  3N97 A;  4RAY A;  3F22 A;  1UHW A;  2ZJ2 A;  3WTT C;  4D0P A;  2O03 A;  3TDU C;  2JPC A;  1TTY A;  4O3M A;  4HYE A;  1I1S A;  4G7Z F;  3IKT A;  3BY6 A;  1G6N A;  1V4R A;  2EV5 A;  1R58 A;  2LKP A;  4ASN A;  1XDU A;  1QPM A;  2FBI A;  3WE2 A;  1ZRC A;  1HW2 A;  1FYL A;  3AAF A;  5FB2 A;  1YYV A;  2OZU A;  2BGC A;  2ISZ A;  2XAJ A;  3ABT A;  4GGG A;  3DPL C;  1FPQ A;  2IA1 A;  5HLI A;  2MLK A;  1J0R A;  2HKO A;  1LVA A;  3E5U A;  2EV6 A;  2DW4 A;  5H6R A;  2XRN A;  5F6F A;  1KU2 A;  3C1D A;  4EGZ A;  1W7P A;  3U2R A;  1FYM A;  1T6S A;  4U0W A;  3JSO A;  3WTS C;  1BN5 A;  3R4K A;  4RB2 C;  3LA2 A;  4A6D A;  4KN4 X;  2OAZ A;  1B59 A;  2HYG D;  3ISP A;  4Q5S F;  4P5O A;  1XGS A;  1J2X A;  5D5V B;  5K5O A;  2QUF A;  4PCQ A;  5DEQ A;  1WKM A;  3GFJ A;  5ICF A;  2FA5 A;  1EH6 A;  1DPR A;  4Q48 A;  2GA2 A;  3JTG A;  2J5O A;  1CF7 A;  5DCM A;  2VT3 A;  1IN5 A;  2M5W A;  5CVJ A;  5ERI A;  1S7A A;  1KYW A;  1XSX A;  4UHT A;  2IP2 A;  2XGX A;  1FSH A;  2VXZ A;  1O7F A;  1YQA A;  5J8F A;  1IRG A;  3KEQ A;  2G7U A;  4GXO A;  1GVJ A;  2OD5 A;  2LNB A;  1S3J A;  1BI2 A;  1LEA A;  2P5V A;  3RPQ A;  1FBS A;  1T2K A;  3QP6 A;  3DKW A;  3TQN A;  3CUQ B;  4N9H A;  1MJ9 A;  5AON A;  4LK0 F;  2L02 A;  1SD4 A;  3CUQ C;  4AIJ A;  3KP4 A;  5LGU A;  4L0Z B;  5D5X B;  1YLF A;  1P92 A;  1OMI A;  5D5W B;  3TOA A;  2CG4 A;  3MWM A;  1R22 A;  1R1V A;  2OU2 A;  3V7R A;  2VE8 A;  3L7W A;  2GA1 A;  1IF1 A;  3HYI A;  1HST A;  3Q9V A;  1TNS A;  2BE5 F;  4MEY F;  1FP1 D;  3D0S A;  3FMS A;  3O3K A;  4EM1 A;  3H3Z A;  2VN2 A;  3KLO A;  3M7G A;  3F8N A;  3KLN A;  2VBW A;  4KDP A;  3CO7 C;  3ML6 A;  3I59 B;  1FNN A;  2K7L A;  4L9V A;  5DD8 A;  3CJN A;  3K1M A;  4NQW A;  5JR3 A;  1H0M A;  2PJP A;  3JSP A;  3G73 A;  4BHB A;  5D8K B;  4LG0 B;  2G7H A;  4OIP F;  3N4M A;  5HDK A;  1R5G A;  2P7V B;  2YPR A;  4G7O F;  1L0O C;  3J81 Z;  3DXJ F;  2EFP A;  4P96 A;  2XAF A;  1FYK A;  2Z5U A;  3FM3 A;  2H94 A;  3U9G A;  1S8N A;  5IT3 A;  4P55 A;  4Q47 A;  3HHH A;  3C3W A;  2XAG A;  2EK5 A;  2WV0 A;  4MTD A;  5H6Q A;  2OZ6 A;  1B9M A;  2FBK A;  4PGH A;  4GYI A;  3KP3 A;  4LFU A;  2M45 A;  2K86 A;  3DPT A;  1MDM A;  4XSZ F;  2O6G E;  3WU0 A;  1YS7 A;  1LDD A;  3ERE D;  1ZGA A;  2Z99 A;  5BS6 A;  3FF5 A;  1U3E M;  3BJ6 A;  3E97 A;  3LAJ A;  1F5T A;  4Z2Y A;  4EV0 A;  1P6R A;  2Z3Y A;  1IN7 A;  1U6G A;  3R6S A;  4NHJ A;  4PDK A;  3KP5 A;  2XAS A;  1S7O A;  2IVM A;  2HDC A;  4IRG A;  2CWE A;  2PN6 A;  3H3U A;  1J9I A;  1XD7 A;  2DLL A;  1LEB A;  1BBY A;  2DO7 A;  1PUE E;  3FXR A;  4UNO A;  4LLL A;  4QWQ A;  3GXO A;  1OYW A;  2XIG A;  2ZFW A;  3GFM A;  3HOT A;  5HLG A;  1ZLK A;  4BHP A;  3ULQ B;  4UV8 A;  3T1B A;  5A2Q Z;  1B9N A;  1U8R A;  2K02 A;  1G3T A;  1LDK B;  3LQQ A;  3K9T A;  3BPV A;  4LK1 F;  1USS A;  3FMR A;  3Q5F A;  4IRH A;  3HOS A;  2B0L A;  3V4G A;  1IRF A;  2A69 F;  2LSO A;  4IF4 A;  5E8G A;  4OIN F;  1D8K A;  5HS8 A;  2W25 A;  2FNA A;  2QBY A;  5IT9 Z;  1WRJ A;  4L5I A;  5F1R A;  2KIM A;  4N0B A;  3BZ6 A;  4A0X A;  5ED4 A;  4JBA A;  1W7P B;  1O57 A;  1SFE A;  3HRM A;  3MZH A;  5E20 A;  1FP2 A;  1GHC A;  4I98 B;  2Z33 A;  2A5Y B;  4HQE A;  5DDG A;  1BJA A;  4OOI A;  4HLX A;  2W57 A;  2IRF G;  1Y0U A;  4HZF A;  1X3U A;  1RUO A;  4EQQ A;  1YG2 A;  4HOB A;  5FGM A;  3I64 A;  3WOD F;  1PP8 F;  1FZP B;  3QU6 A;  5BMZ A;  4KN7 X;  2XV4 S;  4BAY A;  4I7H A;  3FM5 A;  2EA4 A;  2EA2 A;  3HRT A;  2VON A;  1CF7 B;  5DCM B;  2Z9O A;  2VE9 A;  5L3D A;  3Q9S A;  2P8T A;  4LD5 A;  3F6V A;  3JW4 A;  1OYI A;  1YW8 A;  3E6C C;  2L4A A;  2L4M A;  6PAX A;  4BH9 A;  1G3W A;  1G3Y A;  2UWM A;  1LJ9 A;  1YS6 A;  4HLY A;  3WTW C;  5DUI A;  1TW2 A;  3PQK A;  2ZCW A;  2EV0 A;  2KIU A;  2PMH A;  3KET A;  1G4D A;  4I01 A;  2ZNY A;  4M72 A;  1O3S A;  1ZRF A;  3ZN0 A;  3MQ0 A;  2GZW A;  1XB4 A;  2HKX A;  2NAZ A;  4IHT A;  1Q1H A;  1IAW A;  2XKO A;  2TDX A;  3J7A O;  3ECH A;  5CJ9 A;  1KYZ A;  4RS8 A;  2QQB A;  3S2W A;  2HQN A;  1R00 A;  5ILV A;  4AWX B;  4LLG F;  3K0L A;  1E2X A;  4EJW A;  1JHF A;  1JGS A;  4B8X A;  2RNJ A;  5LEK A;  1XGM A;  2M87 A;  2VOP A;  2NRA C;  3GFI A;  3WTV C;  2A61 A;  4BXU A;  1QZY A;  2ZO4 A;  3U1D A;  2DI3 A;  4KNY A;  4Y15 A;  4NB5 A;  3GLX A;  2VOD A;  4PGG A;  3EYI A;  3VOE A;  2W24 A;  3T8T A;  4I0B A;  3RKY A;  1B1B A;  4IPA A;  1DP7 P;  3I5U A;  1F4K A;  2HFH A;  3SQN A;  4WXH A;  4Y17 A;  1YW7 A;  1DDN A;  3BP8 A;  4B09 A;  2MBF A;  2DK8 A;  4IRI A;  1U5T C;  3V7S A;  5ILS A;  4YFN F;  3QPH A;  1EH8 A;  4DNC A;  4RB3 C;  4CZZ A;  1UCR A;  1T38 A;  4KUM A;  1MDM B;  2VBX A;  2PFB A;  5EEG A;  2KRF A;  3I53 A;  3RYR A;  5LHG A;  5BOX A;  5E1W A;  5LHI A;  1R36 A;  2F5F A;  2PBI A;  2V1D A;  4UXN A;  3W6J B;  5DV5 A;  3GYH X;  5CVI A;  4P9U A;  2P7C B;  3HTS B;  2BBY A;  3CO6 C;  3P9C A;  3HTU A;  2VOO A;  2MH9 A;  2NNN A;  1FBU A;  3ZP5 A;  2KKO A;  3I54 A;  4I02 A;  5HVQ C;  3IL2 A;  2L01 A;  4LB5 A;  2M1B A;  3C7J A;  2NYX A;  2YU3 A;  3CTA A;  1RIO H;  5CLS A;  3DF8 A;  5BPI A;  5DCF A;  5IT9 K;  4DQ2 A;  5HS9 A;  2YX7 A;  3W6K B;  5KK1 A;  3M9A A;  5HLH A;  4YG2 F;  4KIG A;  4KT5 C;  2QLZ A;  3E6B A;  2O61 A;  5JHU A;  2F5C A;  4WK8 F;  5CYV A;  1J75 A;  2RQP A;  5D6F A;  4KFC A;  2FMY A;  2FXA A;  4RGS A;  5FLX K;  2CSO A;  4M6X A;  4Y13 A;  3I71 A;  3GVA A;  4EJT A;  3REO A;  1T0F A;  3HSE A;  2QBY B;  4HAM A;  4HF0 A;  1RNL A;  2EFO A;  2NS0 A;  4UUV A;  3ELK A;  4AVP A;  5CVR A;  3HSR A;  1ZN2 A;  3EET A;  1SFU A;  1ONV A;  2JT1 A;  4A6E A;  4ZYG A;  1GXQ A;  2FSW A;  2VBY A;  1XN7 A;  4LGW A;  3E3V A;  2V1U A;  4ENJ A;  2LF8 A;  2DTR A;  1D5V A;  2JZY A;  3J80 K;  4I09 A;  2JSC A;  5BQT A;  2D2W A;  5JVT A;  4XRF A;  1O3R A;  3O6B B;  3OV8 A;  4BNC A;  1TBX A;  1QBJ A;  2XHK A;  4M73 A;  1TNT A;  2M30 A;  3TO7 A;  2ZBK A;  2O8X A;  4IHS A;  1YFH A;  1FY7 A;  2A3S A;  1V3F A;  3RKX A;  1IN8 A;  3R60 A;  2A6E F;  2QQA A;  3E5Q A;  1ZG3 A;  2F2E A;  3LST A;  5L3E A;  4RB0 A;  2FBH A;  3QU3 A;  4UVA A;  4ENK A;  2JTV A;  4HBL A;  1SD5 A;  4EMS A;  1HXD A;  4LJZ F;  4O6J A;  1WQ2 A;  4EJO A;  2FML A;  3P7N A;  3L09 A;  1QGP A;  5EEH A;  4HX8 A;  3KP2 A;  3RPU A;  4KIB A;  3F8B A;  1U5T A;  3ROU A;  3DFG A;  1T39 A;  3LFK A;  4WXC A;  1BC7 C;  4XBF A;  2XUB A;  1BIB A;  1SD6 A;  3EQL F;  3DQV C;  4RGX A;  1FWZ A;  1RI7 A;  4A5N A;  2OQR A;  3MAJ A;  4ZYD A;  3M8E A;  5J8C A;  1KU3 A;  2J5P A;  2IA2 A;  3P9I A;  4ESB A;  2KJB A;  4ETS A;  3VOD A;  4JQF A;  3VFZ A;  4U0V A;  4BHC A;  2P5K A;  1LNW A;  1JXS A;  1UHM A;  1DUX C;  2LF7 A;  2BEO A;  2PLY A;  2FNP A;  1D3Y A;  5DYM A;  3F8F A;  4A0Z A;  4FT8 A;  1XCV A;  2G9W A;  3GO5 A;  1HKT A;  3L2C A;  2D1V A;  5D5U B;  2W84 A;  4AIH A;  5FFZ A;  2Y0M A;  1MZB A;  1WWX A;  5DUK A;  2ISY A;  2QEN A;  4OIQ F;  4EM2 A;  2MH2 A;  2XRO A;  2Q0O A;  3GW2 A;  3L9F A;  1ODD A;  2XKP A;  1ZLJ A;  2CYY A;  3LQR A;  4H0E A;  2D45 A;  1HKQ A;  2YX4 A;  1WSU A;  3IRR A;  1WI9 A;  4MGR A;  2QM3 A;  2DFI A;  1ZHF A;  5E17 F;  1TW3 A;  2R7F A;  4ZZL A;  3SHF A;  3M8F A;  1IZ1 A;  4G8X A;  1EV7 A;  3F3X A;  2MA3 A;  1NHA A;  3BWG A;  1B4A A;  3KZZ A;  5HS7 A;  1HW5 A;  2AXL A;  3GZ6 A;  3C18 A;  1ZRD A;  4YFK F;  4OMY A;  4MQ9 F;  1IXC A;  3P9K A;  1PDN C;  3DEU A;  2Q8K A;  3PQJ A;  4CO8 A;  4A2U A;  3LWF A;  1T98 A;  3IWZ A;  1LDJ A;  1S6L A;  4CIC A;  1DPU A;  4IXA A;  3LA7 A;  1XSD A;  3ZMU A;  2WWY A;  1H9T A;  4MQV A;  2RGV A;  5H20 A;  1OPC A;  2A68 F;  3RIR A;  1XSV A;  5LRS A;  3E6D A;  2FEZ A;  2BYV E;  3RJP A;  3WGH A;  1TQI A;  4MHG A;  3ZPL A;  1ZG1 A;  2RKH A;  5LLQ A;  2IA0 A;  2Y48 A;  2P6T A;  5K5Q A;  1MKM A;  4L9T A;  3B02 A;  4M74 A;  1UST A;  5D6E A;  3RI4 A;  1XCB A;  2ZME A;  4U7D A;  2EJR A;  4L0Y B;  1ZAR A;  3NQO A;  4MEX F;  2MLG A;  4MNU A;  1QZZ A;  1R5H A;  2UXX A;  1SMY F;  2X4H A;  1SMT A;  2HTJ A;  1P2F A;  2COM A;  2EB7 A;  2FE3 A;  2KJC A;  1CGP A;  2FQ3 A;  2CO5 A;  2OQG A;  4HF1 A;  4GCV A;  4HV5 A;  1FSE A;  3FXQ A;  1RZ4 A;  3BPX A;  4CHU A;  2HWV A;  5D4S A;  2ESH A;  4G6Q A;  1AWC A;  3BRO A;  1FC3 A;  3MZY A;  4XSX F;  5CVU A;  1JE8 A;  3WG9 A;  3GUD A;  1IXR C;  5D8L B;  2GWR A;  4L9N A;  1XGN A;  4UVB A;  4RAZ A;  1K78 A;  3NEU A;  1OR7 A;  2HQR A;  5ILU A;  5ICE A;  1K79 A;  1TLH B;  1XDS A;  1ZYR F;  3LAP A;  1R1T A;  4A0Y A;  1O7L A;  2HGC A;  2GXG A;  3HHG A;  2GAU A;  4YIF A;  4Q4Z F;  2MC3 A;  1UFM A;  4YII A;  1MGT A;  1YO5 C;  3J81 K;  4EVI A;  2PQ8 A;  2R7D A;  4N9I A;  3K69 A;  4P9F A;  1A04 A;  5E18 F;  1ZGJ A;  5HDN A;  2ACJ A;  2GQQ A;  2STT A;  1HW1 A;  2BV6 A;  1HQC A;  4G6D A;  2A07 F;  2XAH A;  5JI6 A;  1TQP A;  4M6Y A;  4OMZ A;  2YR2 A;  2ZNZ A;  1RUN A;  2E1C A;  2OA4 A;  2D1H A;  4MTE A;  3QOP A;  2A6H F;  3KEO A;  3V8J A;  4ZYH A;  1H9G A;  3TDZ C;  4EM0 B;  1ON2 A;  2LDU A;  2ESN A;  1BI3 A;  4IVN A;  1F1Z A;  1S29 A;  3T8R A;  4KMF A;  1IXS B;  4R1H A;  4HA8 A;  3FWE A;  3K1P A;  2CW0 F;  4FX4 A;  4KIC A;  5ICC A;  3MCZ A;  5LEJ A;  1HSJ A;  4LMY A;  3ZQ7 A;  1W7P D;  4GO1 A;  3KCC A;  2FU4 A;  3LA3 A;  5FD5 A;  4KIF A;  5BPD A;  3L00 A;  1U5T B;  3O2P E;  2VC0 A;  3I0T A;  4R79 A;  4U0Y A;  2FF4 A;  3ECO A;  4QLC U;  3SXY A;  5FD6 A;  2HEO A;  2K4B A;  3V8K A;  3HSF A;  1E17 A;  3EUH A;  5AIP A;  1VTN C;  3DP7 A;  1STZ A;  4HV6 A;  2CGP A;  1BC8 C;  4L9J A;  1J5Y A;  1MJB A;  3F23 A;  1ON1 A;  2HYF A;  1REP C;  2QQ9 A;  3TGN A;  4HF2 A;  5F64 A;  3FHZ A;  2V1X A;  3HUG A;  3COA C;  2M8E A;  4R8H A;  4S05 A;  5A2Q K;  3WTY C;  2MD5 A;  1XMK A;  3TO6 A;  2AS5 F;  2RV8 A;  5L3G A;  2DAO A;  2V79 A;  1G3S A;  3WTX C;  2HR3 A;  4HDV A;  1W4M A;  1BM9 A;  1P4A A;  1SFX A;  5E1Z B;  2VBZ A;  2HTS A;  3CDH A;  3EYY A;  1UB9 A;  1KA8 A;  4GYG A;  5E1X A;  1LB2 A;  2Q2E A;  1YW9 A;  3RKW A;  2ETH A;  4I0A A;  3GZ5 A;  3TOB A;  2RDP A;  5LBQ A;  3ZMZ A;  5DD4 A;  2E1N A;  4PZJ A;  2K4J A;  2P5L C;  4RGR A;  1SAX A;  1R23 A;  5CVV A;  2E7W A;  3BJO A;  2UXN A;  3ABU A;  5J6X A;  3VEP A;  4UVC A;  4F7Z A;  5L3B A;  2Y75 A;  4FHT A;  4HX4 A;  1O3T A;  1F9N A;  2JPB A;  2C6Y A;  2NNY A;  1KQ8 A;  2EFW A;  2F5D A;  1XGO A;  3E5X A;  2IJL A;  4HW0 A;  3RYP A;  2W85 A;  3ZMT A;  3R0J A;  4L18 B;  1Z1D A;  2DBB A;  2EFQ A;  1KU9 A;  3QPT A;  3FZV A;  1D8J A;  3WTZ A;  3GF2 A;  3JAM Z;  3GWZ A;  3FMQ A;  2QWW A;  3E6M A;  3MFK A;  5L3C A;  4XLP F;  2CFX A;  4ON0 A;  4LLN A;  1FT9 A;  2ZME B;  4ENM A;  2DQR A;  2GXB A;  3FX3 A;  4CYD A;  2OBP A;  4FX0 A;  1BI0 A;  2K27 A;  2XAQ A;  1KQ9 A;  3F8M A;  4S04 A;  2F5E A;  1FOK A;  2V9V A;  4CXF A;  3OOP A;  3WGG A;  4CDG A;  3GEZ A;  2WTE A;  4E70 A;  4M9S A;  3KE2 A;  3WU1 B;  2O0Y A;  2EWN A;  2VC1 A;  1B6A A;  2P6S A;  3V8L A;  3BJA A;  2HZT A;  4JK1 X;  2PMU A;  3HRS A;  1W5S A;  2H09 A;  3IC7 A;  4WXD A;  4A5M A;  5K1Y A;  4OIO F;  2RVC A;  3FXU A;  1C0W A;  5L3F A;  5JFR A;  2V6C A;  1HBX G;  2RN7 A;  5ICG A;  3KZY A;  1K78 B;  4LB6 B;  2DPD A;  4EGY A;  2HS5 A;  3QAH A;  3GFL A;  3HRU A;  3IKV A;  1AOY A;  1QNT A;  2GIV A;  4BYY A;  2YSR A;  2R3S A;  2ADU A;  1ZRE A;  3F6O A;  3V7C A;  2PEX A;  1W5T A;  4G9Y A;  1IN4 A;  5HDG A;  4KA4 A;  4WF2 A;  5LRR A;  3WGI A;  3WE3 A;  3G3Z A;  1P4X A;  4ESF A;  4HX7 A;  1L3L A;  1R7J A;  1EH7 A;  2ZXJ A;  4BQA A;  4ESJ A;  4HDU A;  1U2W A;  3ZMD A;  1LQ1 A;  2DU9 A;  4XLN F;  4AD9 A;  1O3Q A;  3F72 A;  1TQM A;  4ENN A;  1KU7 A;  1YTY A;  1OYY A;  2O3F A;  5FO5 A;  2P4W A;  3F21 A;  1OKR A;  2PG4 A;  1XMA A;  4K2E A;  1IN6 A;  3GX4 X;  3K1N A;  3IWF A;  2QYO A;  3JTH A;  3B73 A;  1Z91 A;  1Z9C A;  4ZYE A;  3RDI A;  3SFZ A;  4TV7 A;  4AIK A;  1ZG5 A;  1R1U A;  1J7K A;  3CUQ A;  2H27 A;  2QZ8 A;  2L3D A;  4RGU A;  4EJU A;  2DQL A;  4KMU X;  1YIO A;  2HOE A;  2CQK A;  3CUO A;  2FOK A;  3QRF F;  1J59 A;  2E7X A;  2UZK A;  3T5X A;  1HKS A;  3SZP A;  4ZZD A;  2VT2 A;  3IHU A;  3MEX A;  1MD0 A;  5HOO A;  4IJA A;  4WX9 A;  4WCG A;  1KQ0 A;  4OU0 A;  4HQM A;  1I6X A;  3D5L A;  5LHH A;  5TRD A;  4G94 A;  3I59 A;  4G7H F;  2DPU A;  2DT5 A;  4KYW A;  1BOA A;  2ELH A;  5FLX Z;  4CGZ A;  3F8C A;  2DK5 A;  2L54 A;  1I27 A;  4LG0 A;  1QQI A;  5TJJ A;  3WTU C;  3R0A A;  1ULY A;  1IW7 F;  1FX7 A;  5FFX A;  4YFX F;  3CLO A;  3H92 A;  1K6O A;  1U78 A;  3ZN1 A;  4L5J A;  3K2Z A;  5E8I A;  3T0Y A;  5K5R A;  4M9Z A;  1PP7 U;  1SD7 A;  4M71 A;  3I4P A;  3EDP A;  5KVR A;  5D4R A;  1I5Z A;  1Z7U A;  3PFI A;  1KGS A;  3KP7 A;  4I2O A;  3J80 Z;  4M9X A;  1ZAO A;  4ZH4 F;  2PI0 A;  4WWC A;  2H6C A;  1P4W A;  2IW5 A;  3M1E A;  1QO0 D;  3JAM K;  3IRQ A;  2H6B A;  2IT0 A;  4UV9 A;  3NRV A;  2WC2 A;  4U7B A;  1I1G A;  2X0L A;  1Z6T A;  2QVO A;  3TKY A;  1BIA A;  2IPQ X;  4O5V A;  4EJV A;  3SZT A;  3VB2 A;  1FLI A;  1K7A A;  4RB1 A;  2EFN A;  3ZMS A;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...