4L9NA

Crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
138
structure length
137
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular mechanisms of allosteric mutations impairing MepR repressor function in multidrug-resistant strains of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords MepR
total genus 52
structure length 137
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4l9nA00
3C18A 3SXYA 2HDCA 3T5XA 2L02A 2P6TA 1FP2A 1I27A 1USTA 4JBAA 4KDPA 2M87A 2MLKA 2M8EA 3M9AA 2DU9A 5DDGA 4WXCA 1IAWA 1ZH5A 3D5LA 3KP4A 4YIFA 4I09A 1YTYA 2E7WA 3HOTA 2VBZA 4UHTA 1G3TA 4MGRA 2MH2A 3GXOA 3AAFA 2RV8A 3WTWC 3SHFA 4M6XA 4HF0A 1BC7C 5JR3A 2ZBKA 4IRGA 3KE2A 4XSXF 1MKMA 1PP7U 4DQ2A 5DCMA 1KGSA 3RTRA 3PQJA 2Z3YA 5AIPA 1J9IA 3HUGA 2M30A 5BQTA 3CO6C 1XMAA 2OAZA 3KLNA 3E3VA 3WTXC 2E1NA 1FY7A 1J2XA 1G3SA 3ECHA 3TKYA 3V8JA 4I0AA 2ELHA 2FF4A 4EMSA 2O8XA 1BOAA 2F5DA 1G3YA 4ON0A 4MQ9F 3U2RA 4YIIA 4HF2A 3TDUC 4Y15A 4HOBA 3J81K 2MC3A 3CTAA 3U9GA 3I4PA 5L3CA 3V7RA 4AVPA 1YW9A 3J80Z 2O61A 1Z9CA 3DF8A 2IA0A 1U8RA 1O3QA 1ZGAA 4L9TA 5ED4A 3WTSC 3ABTA 1D8KA 2XV4S 4M9XA 4OU0A 1R00A 4RS8A 2BV6A 4OOIA 2QYOA 2D2WA 1DUXC 1VTNC 5HLGA 2CSOA 1DPUA 5IT9Z 2GXBA 4CO8A 4MEXF 2YX4A 2RN7A 1WWXA 2RDPA 3IHUA 3RKXA 1J5YA 2H6CA 2YPRA 3SFZA 2R3SA 5DCMB 2Z99A 4U0WA 3W6JB 2Q8KA 4N9HA 2IA2A 3M1EA 2HQRA 3ZMSA 1V4RA 2AXLA 2D1HA 2HWVA 4BYYA 4U0VA 3B73A 5FFXA 4FHTA 1GVJA 2OD5A 2EFNA 3F3XA 1H9GA 4Z2YA 2FOKA 3ZPLA 1HSJA 2EV6A 2A07F 5DCFA 3EYYA 4TV7A 2HTSA 5FFZA 5LRSA 4IRIA 2A68F 1XB4A 3FWEA 5TJJA 4OIRF 5LGTA 3KP5A 3FM5A 1XDSA 5JI6A 1IN5A 1FBSA 1FPQA 4G94A 1H0MA 2KIMA 2G9WA 1LNWA 3KZZA 4RGSA 1YO5C 3ZN0A 3JW4A 3HSRA 2GQQA 4D0PA 2KJCA 1O57A 3R0AA 1RUOA 2GXGA 1XD7A 4ZH4F 3D0SA 3EETA 4KIBA 1O3SA 1O7LA 1SD6A 1ULYA 4L0YB 4I0BA 2EK5A 1FSHA 4ESBA 4MTDA 4G7OF 3MAJA 2XAHA 2JTVA 3W6KB 3E5QA 1CF7A 4IF4A 3F23A 1QGPA 4ESJA 2P7VB 4YFKF 2EA2A 2O6GE 5E8GA 2XUBA 3GFMA 2FA5A 1GHCA 1L3LA 2QWWA 6PAXA 1R5HA 1XN7A 3E97A 1UHMA 1ZARA 2PBIA 1KQ0A 1LDKB 3E6CC 5H6QA 4A2UA 3QAHA 5K1YA 2YX7A 3O2PE 1F9NA 1KYWA 1YQAA 4A5NA 2FMLA 1SD4A 2J5PA 1WKMA 1IXRC 3SQNA 1LDDA 1JGSA 2EFQA 5ERIA 4LJZF 4L9NA 1OMIA 1GXPA 1ON2A 1B4AA 3K2ZA 3TGNA 2V6CA 1LVAA 5L3FA 1KYZA 3G3ZA 5HS7A 4M71A 2H6BA 1HBXG 4BQAA 2XASA 1K78B 3R61A 4HV5A 2HFHA 4HX7A 2FXAA 4BAYA 1WSUA 2KIFA 3ZMZA 2JSCA 2MA3A 2QZ8A 3I59A 4XSZF 4ZYEA 4MTEA 1Z1DA 2LKPA 2UXNA 2IRFG 3KLOA 1IRGA 2NRAC 2MH9A 4L9JA 1IW7F 4P55A 3NRVA 1K79A 2P6SA 2QQBA 3GW2A 3BPVA 1MGTA 4IJAA 2LF7A 4O5VA 3LQQA 2O03A 3TO7A 1MJBA 1FYMA 1D8JA 3I58A 2WTEA 3L7WA 3KP2A 3RDIA 1J59A 5D5UB 2JZYA 4L9VA 4KIGA 2HOEA 5K5RA 4I01A 2DBBA 2K4JA 4HW0A 1B6AA 1W5TA 1S3JA 2XROA 4LG0A 1Z6TA 3JAMZ 2ZNYA 3NQOA 3IRQA 2H94A 2P7CB 5AIQA 4AWXB 5DEQA 5ICFA 5FO5A 2NYXA 3DKWA 1UFMA 3LFKA 2LSOA 2V1UA 3M8EA 4Y17A 4S05A 4WCGA 5LHGA 3V8LA 4RGXA 4LGWA 3KFWX 1SAXA 1QBJA 3MZYA 1XSXA 3CUOA 2MBFA 2IVMA 4KN7X 5D6EA 2PI0A 5IT3A 4EM2A 1BIAA 2RC4A 4HLXA 1LB2A 2FBKA 2DW4A 2Y75A 3FMRA 3E5UA 1P2FA 1ZG1A 1FZPB 3FHZA 2XIGA 5D8LB 4LMYA 1R22A 4HA8A 1OKRA 1R5GA 1QQIA 4WXDA 2HTJA 2W57A 3FMQA 3GFJA 3IWFA 1Z7UA 5D8KB 3F8FA 3F8BA 2OZUA 5CVVA 3EQLF 1UB9A 3RKYA 2LF8A 5LEJA 1OYWA 5D4RA 2IW5A 3HRUA 4EGZA 3T1BA 3QU3A 1XMKA 3NEUA 2DI3A 1QNTA 2DQLA 1J75A 5ILUA 3CUQB 4RB1A 2Z5UA 4HX4A 3LA2A 1SFEA 3IKTA 4MQVA 3WGHA 5BPDA 2VXZA 3CLOA 3QPHA 3RYRA 3JSPA 3J7AO 3E5XA 4A6DA 4P9UA 3OV8A 3CO7C 1V3FA 4K2EA 2A6EF 3FM3A 2COMA 1BI3A 3EUHA 4WWCA 1WQ2A 2F2EA 2IT0A 3MQ0A 2HYFA 5J8CA 2ISZA 2M45A 2QVOA 2DT5A 2L54A 4EQQA 3QP5A 4FX4A 2STWA 5ILVA 2TDXA 5E18F 4GCVA 1XGMA 1U6GA 4EM1A 1EH7A 5FB2A 1KU7A 2CYYA 2HEOA 5FGMA 4IHTA 4U88A 3T0YA 3K1NA 5HLHA 2K86A 1EH6A 2CFXA 2E7XA 1B59A 4HX8A 5IT9K 4M9SA 5LEKA 3IKVA 3RI4A 3F72A 3J81Z 1TLHB 2PMHA 1IN6A 5J6XA 3TO6A 4A6EA 1S8NA 4CHUA 1HXDA 2PJPA 1BI0A 2KJBA 3VODA 5L3GA 3HIFA 4M72A 4CDGA 2P4WA 4GYIA 2ZKZA 4N9IA 1ZG5A 2EV0A 4XBFA 1ZYRF 4G6DA 5FD6A 1RIOH 2OU2A 3ZMTA 3B02A 5F1RA 4YFNF 5E17F 1TW3A 3P9CA 1FBQA 2GZWA 3GVAA 4WK8F 4UVCA 4HYEA 4ZYHA 2RQPA 5HVQC 1W4MA 2OQGA 4RGUA 4EM0B 1T2KA 3WU1B 3QPTA 4OMYA 2UZKA 4FX0A 1BI2A 2FSWA 3IL2A 3TOAA 3BY6A 4RAZA 2G7HA 3TDZC 4ENNA 1RUNA 1LDJA 1Y0UA 5DV5A 4R1HA 3HOSA 2ZFWA 4P96A 4L0ZB 1S29A 1G4DA 4IPAA 2AS5F 1OR7A 1K7AA 1S6LA 3I0TA 2FRHA 3LSTA 4LB6B 1G3WA 3MEXA 3OOPA 1I1GA 2ACJA 2OZ6A 3T8TA 3R6SA 3RPQA 3BJOA 1XSVA 4HV6A 3BZ6A 3WE2A 3F6OA 4ENKA 1I6XA 4EJWA 4GYGA 1P4WA 3ML6A 3P7NA 1W7PA 2ZNZA 3WGGA 5AONA 2IP2A 2Y0MA 1B9NA 1HW1A 2O3FA 1U5TC 4JK1X 1KU9A 3I54A 4LB5A 3GFIA 3V7SA 4KN4X 3CUQC 1ON1A 1I5ZA 2F5CA 1TBXA 4NQWA 3ZMVA 4BXUA 4EV0A 5BMZA 5D6FA 2ZCWA 1ODDA 5DUIA 2P5LC 5D4SA 3QOPA 4LK1F 4YFXF 4ETSA 4OIQF 5HS9A 4KFCA 3I71A 3ZN1A 1HW5A 2O0YA 5D5XB 3SZPA 1LEBA 3Q5FA 4MHGA 3BPXA 4O3MA 3VEPA 1WRJA 4CXFA 2XKPA 2EFWA 4U7DA 3VOEA 4HDUA 4BNCA 2VC0A 4ZYDA 3HHHA 2Q0OA 4PCQA 4HQMA 3WU0A 3BDDA 3LQRA 4BHCA 5E1WA 1KU3A 3KP7A 5H20A 4FT8A 2HKOA 2CG4A 2FMYA 5DUKA 2C6YA 2V1DA 2VBYA 4Q48A 1F4KA 3GYHX 2K02A 1FT9A 5JHUA 1R58A 3HTUA 1F5TA 1WI9A 2NS0A 1P4XA 4Q4ZF 3WTTC 3H3ZA 2KRFA 3KCCA 5DD8A 2BBYA 3CJNA 4B8XA 3ELKA 3KEOA 1DPRA 1STZA 2L4AA 4EJOA 1T38A 2CQKA 4OIOF 1MJ9A 1YS6A 4R8HA 2L01A 1HKSA 4IHSA 2F5EA 3KETA 2A61A 3HRTA 4LK0F 1EV7A 2BGCA 3V4GA 3GZ5A 4A0YA 3U1DA 3ZMUA 3JTGA 3LAJA 3HRSA 1ZGJA 1TW2A 1FYKA 2KKOA 4KMFA 5BS6A 1BIBA 2IPQX 4KT5C 2ESHA 1SFUA 4XLPF 3SZTA 3ULQB 1BN5A 3FXUA 2GA1A 4LLGF 2XAFA 3BJAA 4GXOA 1IXSB 1R1VA 1R7JA 3H3UA 2Y48A 4EJTA 1TQPA 4LD5A 2DK5A 5K5QA 4M74A 4KICA 4KYWA 3JSOA 1U5TB 1ZRCA 3QRFF 2EA4A 5EEHA 5E1XA 3FXQA 1ZHFA 3FXRA 3S2WA 4KUMA 1MJAA 1MDMB 4ZZLA 2L3DA 3VB2A 4S04A 4M6YA 2A5YB 5DD4A 1OYIA 4HAMA 1TNTA 4HBLA 3K69A 4H0EA 5LHHA 3F6VA 1O3RA 4BHPA 2V9VA 1B1BA 2CW0F 1ZG3A 2QBYA 5F64A 3E6BA 4G7HF 4EVIA 3L9FA 3R4KA 2B0LA 1Q1HA 2HYGD 3EDPA 1R23A 1ZAOA 1MD0A 3BROA 4RB0A 2QQAA 1YW8A 2HZTA 4WF2A 4EGYA 1YLFA 2HS5A 4L5IA 3F22A 1AOYA 1LEAA 5E20A 1ZLJA 1O7FA 1UHWA 4Y13A 3GEZA 4HLYA 1FYLA 2PFBA 2Z9OA 5L3DA 1BBYA 2ETHA 2FNPA 3L00A 4G7ZF 4A5MA 2D1VA 3ROUA 2EFOA 4OIPF 5LGUA 1P92A 3KEQA 2KIUA 2VONA 1PUEE 5HDKA 4Q5SF 1U3EM 1L0OC 3ZMDA 5CLSA 5EEGA 1T0FA 3DFGA 1C0WA 2VT3A 3HYIA 5KVRA 3TOBA 2VOPA 5LBQA 1XCBA 4IRHA 5ICCA 5A2QK 3HRMA 1R1TA 3GO5A 1ZREA 5FLXK 4UV8A 2ZXJA 3GWZA 3RKWA 1QZZA 2DK8A 1XCVA 4I2OA 3FZVA 1P4AA 2FNAA 3DXJF 4XRFA 3MFKA 4HF1A 4ESFA 4RGRA 1S7AA 2JPCA 5HLIA 1JHFA 3ABUA 1S7OA 5H6RA 2YU3A 2ZJ2A 1ZRFA 3BWGA 4G6QA 5D5VB 2HR3A 2NAZA 2ISYA 3E6DA 4A0XA 3ISPA 1W5SA 2EJRA 2ZMEA 1KA8A 1Z6RA 4R79A 1SFXA 1MZBA 1FC3A 2QBYB 5K5OA 3LWFA 5F6FA 2XAJA 2LDUA 2JPBA 2XAQA 3FX3A 3K1MA 1TNSA 3HSFA 5HDGA 4LG0B 4I7HA 3PFIA 4UVBA 1ONVA 5KK1A 4UNOA 5ILSA 2PQ8A 1YW7A 2WWYA 1UCRA 3EYIA 4UUVA 1IZ1A 1U2WA 2W84A 4MNUA 1U5TA 3MWMA 2PLYA 2M1BA 1D5VA 1JHHA 3HHGA 2XVCA 3GLXA 4I02A 2EWNA 1P6RA 1JE8A 4CICA 4OMZA 1RZ4A 1K6OA 3WGIA 4KA4A 2UWMA 4HQEA 3JAMK 3GX4X 2FU4A 3JTHA 3LAPA 2IJLA 5E1ZB 2EFPA 3LA7A 5L3EA 4P5OA 1HW2A 2W25A 4OINF 1IRFA 1R36A 1U78A 5JFRA 1ZRDA 4NB5A 2JRTA 3REOA 1W7PD 2LNBA 1FX7A 1LJ9A 2HGCA 2R7DA 3WTYC 2VBWA 2FEZA 4ENMA 1T98A 5TRDA 1YYVA 1ZLKA 1EH8A 2XGXA 3J80K 4P9FA 2XRNA 4PGGA 4BHBA 4G9YA 5BPIA 4KNYA 1OYYA 3QP6A 4QLCU 1JXSA 3HTSB 1BI1A 2P5KA 2GIVA 3CDHA 2PG4A 2FBHA 3RJPA 2K27A 2Z33A 2QENA 1O3TA 4M73A 4U7BA 5DYMA 3M7GA 3O6BB 1XGSA 2F5FA 2CGPA 2BYVE 3COAC 4YG2F 4CYDA 3GZ6A 3IRRA 5L3BA 2Q2EA 2V79A 3HSEA 2UXXA 3C3WA 1FWZA 2X4HA 3Q9VA 3L2CA 4EJVA 4JQFA 1FLIA 2DAOA 2DQRA 2STTA 1FP1D 2CWEA 3GFLA 2OA4A 3BP8A 1PP8F 2DPDA 3ZP5A 1TQMA 3C7JA 2H27A 2NNNA 3IC7A 4KIFA 1USSA 3GUDA 4N0BA 5CVJA 4PDKA 5CVIA 5HDNA 1IN4A 1LQ1A 1SD5A 2EV5A 2D45A 1XGNA 3DPTA 1B9MA 1YFHA 3DQVC 2PN6A 4LFUA 4ZZDA 2JT1A 1BM9A 1E2XA 3C1DA 2K7LA 2XHKA 1SMTA 4LLNA 1YS7A 4A0ZA 1FSEA 1R1UA 3H92A 5A2QZ 3F8MA 3P9IA 4ENJA 2QUFA 5LHIA 3MZHA 3DV8A 4IXAA 2EB7A 4MEYF 1DDNA 3T8RA 4WXHA 5E8IA 2HKXA 5BOXA 5FLXZ 4IVNA 5JVTA 2A6HF 3I64A 3RPUA 4A12A 3Q9SA 3FMSA 5LRRA 4AIHA 4G8XA 3KP6A 4O6JA 2VT2A 3V8KA 1YIOA 1KU2A 2WC2A 1J7KA 3ZQ7A 2GWRA 1XDUA 4HZFA 1F1ZA 1FBUA 4DNCA 1ZN2A 1IF1A 1FOKA 1DP7P 1QZYA 2QLZA 1IN7A 2NNYA 2PEXA 3DEUA 3E6MA 1SMYF 2ZMEB 4UXNA 2MD5A 4CGZA 3TO9A 1REPC 1X3UA 2QQ9A 1GXQA 3N4MA 4RB2C 1HSTA 3P9KA 1D3YA 5FD5A 2OBPA 3PQKA 1YG2A 3ECOA 5D5WB 5LLQA 4KMUX 2V1XA 3N97A 4RB3C 5CJ9A 4LLLA 1XGOA 4F7ZA 2RGVA 4ZYGA 4AIJA 3RIRA 1E17A 2W24A 4AD9A 3F8NA 5HOOA 1T39A 4RAYA 2DO7A 2ADUA 1FNNA 4EJUA 3GF2A 3K9TA 1BC8C 4QWQA 4GGGA 3WTVC 4BH9A 1QPMA 2RNJA 4ASNA 2G7UA 5J8FA 1T6SA 1HKQA 1Z05A 1K78A 2W85A 2VBXA 2ESNA 3QU6A 4E70A 1A04A 2BE5F 3F21A 2P5VA 2FBIA 3M8FA 2QM3A 3WODF 4L5JA 3KZYA 3L09A 3RYPA 2YSRA 3FF5A 1W7PB 1HKTA 1XSDA 2PMUA 1AWCA 4GO1A 1SD7A 2H09A 3BOQA 2ZO4A 2A69F 2RKHA 3I59B 1CGPA 1PDNC 3DPLC 4U0YA 3WTUC 1KQ8A 5CVUA 3K1PA 2OQRA 1IN8A 2K4BA 1J0RA 3V7CA 4HDVA 4WX9A 2VN2A 3G73A 2GAUA 2HQNA 2DPUA 1TQIA 2YR2A 4UVAA 3DP7A 2MLGA 4L18B 2RVCA 4UV9A 1IUYA 2DFIA 2A3SA 4NHJA 1H9TA 3TQNA 4B09A 2X0LA 2P8TA 3K0LA 2GA2A 4M9ZA 3WTZA 1QO0D 5ICEA 3MCZA 1RI7A 2FE3A 3VFZA 1RNLA 3R60A 5CYVA 2L4MA 2VODA 3O3KA 3F8CA 3R0JA 5ICGA 4XLNF 3WE3A 2IA1A 5LGNA 2XAGA 3I5UA 4AIKA 3BJ6A 2J5OA 3CUQA 1G6NA 1MDMA 1TTYA 2VOOA 2VE9A 2R7FA 4CZZA 2VC1A 3WG9A 1I1SA 1KQ9A 1OPCA 1CF7B 4PGHA 2DLLA 5HS8A 2XKOA 2M5WA 2E1CA 2BEOA 2DTRA 3IWZA 3KP3A 3LA3A 4I98B 1Z91A 2CO5A 3I53A 1HQCA 4Q47A 2VE8A 2WV0A 3ERED 1NHAA 1BJAA 5CVRA 2FQ3A 1IXCA 4PZJA
chains in the Genus database with same CATH superfamily
3C18A 3IH2A 3CCQI 3SXYA 2HDCA 3T5XA 2L02A 2P6TA 1FP2A 1I27A 1USTA 4JBAA 4BACA 4KDPA 2LR8A 1WJEA 2M87A 1OCTC 2MLKA 2M8EA 3M9AA 1O4XA 2MFZA 2DU9A 1X58A 5DDGA 4WXCA 2WAQA 3ZRGA 1IAWA 1MSEC 1ZH5A 2HXOA 3D5LA 3KP4A 1PJRA 4RA2A 4YIFA 4I09A 2VJ4A 1JI8A 1YTYA 4RM2A 2E7WA 1QU3A 2IBDA 1B8IB 3HOTA 5F0FA 3CMMA 1GUUA 2VBZA 4UHTA 3FDYA 1G3TA 4MGRA 2PX9A 3H35A 2MH2A 1SEUA 3CLQA 1GT0C 3GXOA 3AAFA 3H1CA 2OUMA 2RV8A 3WTWC 3SHFA 2LFBA 4RDUA 4M6XA 3PFYA 1MH4A 4HF0A 1BC7C 5JR3A 2ZBKA 2OC6A 3WHBA 4IRGA 2R7QA 2X48A 3KE2A 4XSXF 4M6VA 5IYBJ 4A3LJ 1MKMA 3OYKA 1PP7U 1ZTRA 4DQ2A 5DCMA 3GTGJ 2M2EA 2Y9ZA 1KGSA 2Y0SN 2WY8Q 3RTRA 3PQJA 4XIDA 1X4PA 4E7HA 2D5VA 2Z3YA 2V7FA 5AIPA 2CUEA 1J9IA 3HUGA 2X6WA 3ZQFA 1VQLI 2ZMEC 2M30A 5BQTA 3CO6C 1XMAA 2OAZA 3KLNA 1S72I 3KYCB 1Z21A 5F0CA 3E3VA 1MBFA 3WTXC 2E1NA 1J2XA 1FY7A 1Z0XA 1V5GA 3O8GA 1QVTA 1G3SA 3ECHA 1MMSA 3TKYA 3V8JA 4I0AA 3VYTB 3S3OA 5B1BH 3CJRB 2ELHA 1D1BA 2FF4A 4EMSA 1XS9A 2O8XA 2QGUA 5J4YA 2K3PA 1BOAA 4CA0A 2CFOA 2F5DA 5CQEA 1G3YA 2L7ZA 4JYKA 2WB1A 4ON0A 2CMPA 3ZR8X 4MQ9F 1W36D 5TGTA 3U2RA 2JA2A 3M07A 4YIIA 3ZQGA 5M5XJ 4HF2A 3TDUC 4FASD 2XF5A 2XGDA 4Y15A 2HOTA 4HOBA 3J81K 3CD6I 1V5FA 2MC3A 3CTAA 2IEKA 3U9GA 3I4PA 2VPRA 5L3CA 2NVXJ 1MBKA 1RRJA 4A3GJ 2DA3A 3V7RA 3GTKJ 4AVPA 1YW9A 1X19A 3J80Z 2O61A 3DEEA 1Z9CA 4RAFA 2JVHA 2KT0A 5KCMA 3DF8A 3FHNA 2VQGA 2IA0A 1U8RA 1E0EA 1O3QA 1WGXA 1ZGAA 4L9TA 5ED4A 3WTSC 3ABTA 2BOLA 1BJZA 4PFOA 3JRFA 1D8KA 2XV4S 3OYLA 4YEJA 2KRHA 4M9XA 4OU0A 1R00A 4RS8A 2BV6A 4OOIA 3LFUA 3K4MA 2QYOA 2D2WA 1MSFC 1DUXC 5FJ8J 1VTNC 5HLGA 2Y2ZA 3IP4B 1M1EB 2CSOA 1DPUA 5IT9Z 3F9KA 3TL4X 4E7IA 4PUSA 1CQTA 3CDIA 1ZQ3P 2GXBA 4LIVA 4IQ4A 4CO8A 3BR0A 4MEXF 4FQGA 2M7AA 2YX4A 3X2QH 1A6IA 2RN7A 1WWXA 2RDPA 4A3MJ 1VQ6I 3IHUA 1YJWI 2DMTA 1J5YA 2FX0A 2HZDA 3RKXA 2LOOA 1FIPA 2H6CA 1JT6A 2YPRA 3SFZA 4RLFA 2X6XA 2R3SA 3G6EI 5DCMB 4BQNA 2Z99A 2ID3A 1WVRA 2ZB9A 4U0WA 5E3MA 3W6JB 2HDDA 2W7NA 2Q8KA 3A03A 4N9HA 3EUKL 2IA2A 3BG7A 3M1EA 1KONA 2HQRA 1K61A 1FTZA 3AL0C 3ZMSA 3H36A 1S5LC 3PNVA 2A05A 2LREA 5IYCJ 1E3OC 3TW6A 4IZZA 1OCOH 1V4RA 2AXLA 2D1HA 2HWVA 4A3BJ 4JOMA 4BYYA 4U0VA 4B48A 3SDBA 3SEZA 3B73A 3G1LA 5FFXA 4FHTA 2LD5A 4KISA 2V1NA 5J1UA 4BS9A 3PO2J 4UUSA 3CC4I 1GVJA 4XQFA 3DPUA 2OD5A 4NBQA 2ZXIA 2EFNA 3MVPA 2DN0A 3F3XA 2LLKA 5FLMJ 1H9GA 4Z2YA 2B9SA 2FOKA 3ZPLA 1HSJA 4II3A 2Y69H 2EV6A 2A07F 3RQIA 4ITVA 4ABZA 5DCFA 4EATA 3EYYA 4TV7A 2HTSA 3S2HJ 5FFZA 1UMQA 5LRSA 1H8AC 2F48A 1WZ2A 4IRIA 3OS2A 4UY8I 2A68F 5GAGJ 2IGKA 2KIQA 3H9QA 3BR6A 3QYEA 5F08A 3G4SI 2QKMB 1XB4A 3FWEA 5TJJA 4OIRF 5LGTA 3KP5A 3FM5A 1XDSA 3K4CA 4FISA 4HNTA 2R7RA 5JI6A 1IN5A 3H0GJ 1FBSA 1FPQA 1I39A 2BXYA 4G94A 3MKWB 2JA8J 1H0MA 2KIMA 1T8IA 3NWSA 2G9WA 1TZLA 2B7EA 2CQ7A 1LNWA 2YS9A 3KZZA 3OYIA 3HL2A 4X6AJ 1WFXA 4RGSA 1YO5C 1GDTA 2XB5A 3ZQCA 3CC7I 3ZN0A 3BR1A 3JW4A 5EGOB 1YIJI 1JJ8C 4YELA 3HSRA 1G2HA 2GQQA 4D0PA 2KJCA 1O57A 3R0AA 2DFEA 2W82A 2HNHA 4F52A 4B4CA 3K70D 2MGQA 1RUOA 2GXGA 2DXIA 1XD7A 2X1EA 3Q0UA 5F1JA 1H89C 1Z77A 1GV5A 4FE4A 2DA6A 4CH7A 1EKEA 4ZH4F 3D0SA 3EETA 4KIBA 1O3SA 3CCSI 1O7LA 3L1PA 1SD6A 1JTXA 1ULYA 4XLEA 4L0YB 3M1CA 4PJLA 4I0BA 4P1WA 2EK5A 1FSHA 2LMDA 1QHHD 2OF7A 4ESBA 2AO9A 4MTDA 4BBSJ 1R9TJ 3HKZN 1JKPC 4G7OF 3MAJA 2XAHA 2K3FA 3HOWJ 2JTVA 1VZ0A 3MZ8A 1JTYA 3W6KB 3E5QA 1XTAA 1TL8A 1CF7A 2CQXA 1V54H 4IF4A 3ZGKA 3OMYA 4Y52J 3F23A 1JKOC 1QGPA 4ESJA 2P7VB 1XX5A 4V2GA 3OYCA 3OYMA 1SFKA 3E7LA 4YFKF 1VI0A 2E34A 3LSRA 1XPXA 2EA2A 2LH9A 2GLOA 2M4KA 3VYSB 2O6GE 3FXKA 1N25A 5E8GA 3VDXA 2XUBA 5KAFC 2IGOA 5J3LA 3CCMI 3E0JB 3GFMA 2FA5A 1GHCA 3AG4H 1ZELA 1L3LA 3JRAA 3HGYA 2QWWA 2P0WA 6PAXA 5GAEJ 1R5HA 1XN7A 2WAFA 1IV6A 1WCMJ 3E97A 2KP6A 1UHMA 1ZARA 3OIOA 1YRNA 2PBIA 1KQ0A 1X1PA 2RAEA 1LDKB 1WJBA 4XL9A 3OS1A 3E6CC 5H6QA 4A2UA 3QAHA 2L9NA 3GTPJ 5K1YA 2YX7A 3O2PE 4XMYA 4UB8C 3KPHA 1F9NA 1KYWA 3IAM2 1YQAA 3HPGA 2VLAA 4A5NA 2FMLA 1SD4A 1ERDA 2RREA 1J09A 2J5PA 1WKMA 1IXRC 1U9OA 1IRXA 2UV1A 3SQNA 2GOXB 4YRVA 2IGMA 2JMWA 4M3GA 1LDDA 1IJWC 3K4JA 1JGSA 3A2KA 1ETYA 2EFQA 5ERIA 4DOZA 3K70C 4LJZF 4E6KG 4L9NA 1OMIA 1GXPA 1ON2A 3P5JA 1B4AA 4IO9F 5E79C 1WJCA 4V19K 3K2ZA 3TGNA 2K85A 5C3EJ 2V6CA 1LVAA 1VQMI 5L3FA 4CYCA 1KYZA 3G3ZA 5HS7A 4M71A 3KYLA 2H6BA 1HBXG 4BQAA 2BXZA 2XASA 4C9YA 3R61A 1K78B 4HV5A 2HFHA 4HX7A 4MIMA 2KL4A 3LSIA 2E5NA 2FXAA 4BAYA 1S7EA 2MD0A 1WSUA 4E7ZA 2KIFA 3ZMZA 2DMUA 1T33A 2JSCA 3ESWB 3TP3A 2MA3A 2QZ8A 4OWRB 3I59A 4XSZF 4ZYEA 4I76A 4MTEA 3CMEI 1JT0A 1Z1DA 3I3LA 3GLLA 2LKPA 2BHZA 2X51A 1MMDA 3PJRA 1RPWA 2JJ7A 1ETOA 1JUPA 2UXNA 2ZJPF 4QSHA 2IRFG 3KLOA 1IRGA 3PIOF 2NRAC 2MH9A 4L9JA 1IW7F 4P55A 3NRVA 4X1EA 1K79A 4NQWB 1LPQA 5EDNA 2IXSA 2P6SA 3BZCA 2QQBA 3LSMA 3GW2A 3BPVA 2JWTA 2EINH 2ICWG 4J19A 4PFPA 1MGTA 2R7WA 3KZIC 2LF7A 1OISA 2MG4A 4IJAA 4O5VA 4QIWN 1V5EA 3LQQA 1AA7A 5DM7F 2O03A 3TO7A 1MJBA 3RZOJ 2L9VA 1FYMA 4NNJA 3CC2I 2WAEA 1D8JA 3I58A 1ORKA 3SJMA 1R5ID 2WTEA 3L7WA 3KP2A 3RDIA 1J59A 4OAZA 5D5UB 2JZYA 4L9VA 1T0FC 4KIGA 4IOAF 2HOEA 5K5RA 4BDZA 4I01A 2DBBA 2EZLA 3I4NJ 1FOYA 5EYRA 2K4JA 4ZC3A 4HW0A 1BR4A 1B6AA 3CCRI 2HI3A 1W5TA 9ANTA 1S3JA 1FEXA 4XLAA 2W1OA 1TT5B 2XROA 3UKGA 4LG0A 2XDVA 1Z6TA 3A01B 1OR7C 3OR2C 3I56I 2F4OB 3JAMZ 2ZNYA 3KEYA 3NQOA 2XAUA 3K2AA 3IRQA 4J01A 4CSWA 2H94A 1JUSA 5JHFA 2P7CB 5AIQA 2E2HJ 1TWGJ 1X3WB 3BC8A 4AWXB 5DEQA 1R4NB 4G6TB 1DU0A 2DOEA 5FO5A 2BVLA 5ICFA 3A01A 2N8GA 2CV0A 2NYXA 3DKWA 2HYJA 3FXMA 1UFMA 3LFKA 2LSOA 3PIPF 1BR1A 1BOBA 3I55I 3AL0B 3M8JA 1SFOJ 3PO3J 2V1UA 4D7MA 2GIZA 3W3CA 3M8EA 4Y17A 2CH0A 3FK6A 1VQNI 4S05A 4WCGA 5LHGA 3V8LA 4RGXA 4LGWA 3TW7A 3KFWX 3NWTA 1BW6A 1SAXA 3FKIJ 1QBJA 3MZYA 1XSXA 2VQLA 3CUOA 2MBFA 4AIDA 3BLYA 4XICA 2M4GA 3DWLE 2IVMA 3M4OJ 3GBGA 3CF2A 1Y8RB 4KN7X 3GTMJ 2Z1DA 5D6EA 2HQ5A 2L0KA 2PI0A 3SEQA 3PNYA 5IT3A 4EM2A 1BIAA 2F4MB 2RC4A 3QQAA 1MBGA 4HLXA 1DGRM 4EEFG 4DW6A 5EZGA 5HNHA 1LB2A 2LP0A 2FBKA 4C2MJ 1AKHB 4C3HJ 2DW4A 2LC2A 2BY2A 2Y75A 1BW5A 3FMRA 3E5UA 2IS6A 1P2FA 1ZG1A 1YJNI 1FZPB 3HUGB 2NS7A 4HNVA 4NDLA 3FHZA 1FIAA 2XIGA 5D8LB 4BL0B 4LMYA 4DZPA 1R22A 1VQ8I 4HA8A 2LG4A 5C4JJ 2WY7Q 2L5QA 2ME0A 4M3EA 1DGWY 1OKRA 1R5GA 2AQFA 3Q0VA 3W6VA 4XRMA 1QQIA 2VKEA 2KZVA 4WXDA 4IKFA 3DTIA 2HTJA 2W57A 3FMQA 3BTLA 1W1WE 2E36A 3H9JA 3GFJA 2X1DA 3IWFA 2LKXA 1Z7UA 5D8KB 3LOCA 3F8FA 3F8BA 2OZUA 5CVVA 1LFBA 4BY7J 1SVMA 3EQLF 5EZHA 1UB9A 3RKYA 2LF8A 5LEJA 1OYWA 3OOUA 4D5CA 5D4RA 2IW5A 2DFFA 2DT7B 3HRUA 4XN0A 4EGZA 1N77A 3T1BA 4IHXA 1FOXA 5GP9A 3H0DA 4CCOA 3QU3A 1XMKA 4XK4A 5B3SH 2CV1A 3BTIA 4A3CJ 4JX4A 1D0YA 2Y9YA 3NEUA 2DI3A 3HBLA 1QNTA 1Z67A 3D1NI 1MBEA 4E7LA 2DQLA 1J75A 5ILUA 2V9PA 2EBIA 3CUQB 3HKZA 5GPCA 5DS9A 2HVQA 1FOWA 2H8WA 5K7FA 3S1QJ 1LKXA 4RB1A 2Z5UA 4HX4A 4I99C 1Y1WJ 1VNDA 3IAS2 3LA2A 1SFEA 3IKTA 1IDZA 5TISC 4MQVA 3TBIA 2HOSA 1FMWA 3HEFA 5H2FC 3QODA 3S32A 3WGHA 4BKXA 3IV5A 4FCYA 5BPDA 2VXZA 3C2GA 1MNEA 2XRLA 1YOVB 4IHVA 3OYGA 3CLOA 3QPHA 3RYRA 3JSPA 3J7AO 2I8DA 3HG9A 3PNTA 3RSNA 2JA6J 4BEHA 4AVZA 3E5XA 5B66C 4H4KC 1LUJB 2NVYJ 4A6DA 4P9UA 2DDAA 1BA5A 3OV8A 3CO7C 3OYBA 3OYNA 1V3FA 3S2DJ 1QHGA 4K2EA 2DA5A 2A6EF 1N78A 3FM3A 4QPOA 5CPRB 3UNGC 2COMA 1BI3A 2EH3A 3EUHA 2DOFA 4WWCA 5IOZA 2VL8A 3H5NA 1WQ2A 2F2EA 2IT0A 1F43A 3MQ0A 2HYFA 1MW7A 2Z2SB 2PJRA 5J8CA 2ISZA 3OS0A 2M45A 3S14J 5IYDJ 2QVOA 3V42A 3C2BA 4J00A 4DJAA 2DT5A 4CCMA 5J40A 2IS2A 5JLWA 3BCAA 3W2WA 2L54A 4EQQA 3QP5A 2R92J 1RKTA 2DDBA 2R5ZB 2M3AA 4FX4A 3HOZJ 2STWA 1X2MA 2Q2EB 5ILVA 2TDXA 5E18F 4RAGA 4GCVA 3LSKA 4ZDPA 1MMNA 1U9NA 3LL7A 5M3FJ 1XGMA 1U6GA 4AYBA 4EM1A 3KX2A 1EH7A 2VQCA 2Y31A 3EUHC 5FB2A 1KU7A 2CYYA 2HEOA 1HC8A 5GAHJ 5FGMA 4IHTA 1VQPI 4U88A 4IEJA 3T0YA 3Q0WA 2L7KA 4C3JJ 4W97A 1MH3A 1TWAJ 3K1NA 5HLHA 2ELJA 1PVEA 2K86A 1EH6A 2WADA 2ME6A 2CFXA 2E7XA 1B59A 4HX8A 1OFCX 5IT9K 2XPVA 3ABKH 4M9SA 3Q3SA 5LEKA 4A3EJ 2L9RA 3IKVA 1OJLA 3OL3A 3RI4A 1NK3P 3F72A 2QQ8A 1UG0A 4DIQA 4BGDA 3J81Z 1TLHB 4A3IJ 2PMHA 3H5AA 1IN6A 3HJEA 5J6XA 3TO6A 4A6EA 5FRMA 4S0HB 3K4BA 1S8NA 1T95A 5E3NA 4CHUA 1HXDA 2PJPA 1BI0A 4PJMA 1B72B 3QPSA 3IUOA 3FBIB 2KJBA 3VODA 5L3GA 3CJTB 2B63J 2G0EA 3HIFA 4M72A 4AYBN 4CDGA 4LIUA 2P4WA 4GYIA 3DTEA 3FK7A 2ECBA 2ZKZA 5KHDA 4XRSA 4N9IA 2KHMA 4HPQA 3AG1H 2KQRA 3DCFA 3W2AA 4C2TA 1ZG5A 3TEDA 2VPLA 5J47A 2EV0A 2I10A 4L5EA 4XBFA 3GCMA 1XC5A 3E1SA 1ZYRF 4C2UA 2WA0A 4G6DA 2R7SA 5FD6A 5FKKA 5EGOA 2AHQA 5J1YA 1RIOH 2OU2A 3ZMTA 4E7KA 4W1UA 4UUSB 3B02A 1LE8B 5F1RA 2BVMA 1AKHA 4YFNF 1V55H 5E17F 1TW3A 2FQ4A 1ACIA 5FROA 3P9CA 1YITI 1FBQA 2GZWA 4N4NB 4ZTJA 1IG7A 1QPIA 3GVAA 3CMYA 4WK8F 4UVCA 3DKXA 4Z6YA 5J1RA 4HYEA 2H1LA 3FIWA 5KAIC 4ZYHA 1H88C 2RQPA 3CDLA 5HVQC 1W4MA 1RKWA 2OQGA 3VYUB 4RGUA 4EM0B 3G2BA 1T2KA 3WU1B 1JUMA 2CUZA 3GTOJ 3QPTA 2DODA 2K9LA 4XOTA 4OMYA 2UZKA 3A0HC 4FX0A 1BI2A 4KITB 2FSWA 3HZJA 2NXNB 3IL2A 1JJ6C 3TOAA 3BY6A 4A93J 4RAZA 1E3PA 2G7HA 3TDZC 4NUBA 4ENNA 2VJIA 1RUNA 1LDJA 1Y0UA 4CCNA 5DV5A 4R1HA 2R7VA 3HOSA 2ZFWA 4P96A 4L0ZB 3CMAI 1YX3A 5EF6A 3VYRB 1S29A 2R7XA 1MBJA 2WV1A 1G4DA 3DU5A 4IPAA 3ZXSA 2AS5F 1OR7A 1K7AA 2WBMA 2X9DA 4JP0A 4ZJZA 1S6LA 3I0TA 3B6AA 2FRHA 2VUMJ 3ABMH 1TWCJ 3LSTA 4LB6B 1G3WA 3MEXA 4PZJA 3OOPA 1I1GA 3LMMA 1ZK8A 2ACJA 4DGWB 2OZ6A 3J7AY 3T8TA 3R6SA 3RPQA 1U0JA 2VQHA 2XSJC 3BJOA 3SYTA 1XSVA 3BTJA 1WJAA 4HV6A 3BZ6A 3WE2A 2KISA 1RR7A 2EIKH 2ZJQF 3F6OA 1I6XA 4EJWA 4ENKA 1S9HA 4GYGA 1P4WA 2VJ5A 3ML6A 3P7NA 1W7PA 1DU6A 2ZNZA 1YX5A 3WGGA 1OQYA 2VXDA 5AONA 1A5JA 2PMZA 3S8PA 2IP2A 2Y0MA 1B9NA 3TP0A 3JRHA 3A1YA 2L9SA 5IOYA 1HW1A 2O3FA 1TWFJ 4UUTA 1U5TC 4F92B 4JK1X 1KU9A 3I54A 4LB5A 3A02A 2W48A 3GFIA 3V7SA 3CCYA 4KN4X 5C44J 3BZKA 4QPQA 3CUQC 1ON1A 1I5ZA 4CCLA 2BY3A 2F5CA 3AKZA 1TBXA 2ZFUA 4NQWA 1OCPA 3ZMVA 1X4OA 4JX6A 4BXUA 3SZGA 4EV0A 5BMZA 5HLTA 3DU6A 2OCEA 1VQ7I 1TC3C 2KFDA 2RQQA 5D6FA 2ZCWA 1ODDA 5DUIA 2P5LC 4A69C 3QOPA 4LK1F 2QSFX 5D4SA 1OCCH 5FRNA 1JGGA 2E35A 4YFXF 4ETSA 2CQNA 4OIQF 2JUCA 5HS9A 2HVRA 1F36A 2R7OA 4BJTA 2IGNA 1FJLA 4KFCA 2UUZA 1X1DA 2O5RA 2M7BA 2MC4A 4BBRJ 1UELB 3CQZJ 3I71A 3ZN1A 3L2RA 3O8HA 5HNFA 1HW5A 2O0YA 3BR3A 5D5XB 4ZTFA 3MMYB 3SZPA 1AU7A 1G8XA 1MIJA 3H5RA 1LEBA 3BR5A 3Q5FA 4ZDLA 4MHGA 3BPXA 4O3MA 1DQUA 1ITYA 2K9MA 4PJNA 3VEPA 2KLOA 2MSYA 1WRJA 4CXFA 3CESA 3WG7H 2XKPA 2EFWA 1WPKA 4U7DA 3VOEA 4HDUA 1WH7A 3JCUC 1N75A 1HF0A 2XF7A 2VC0A 3B6CA 4ANJA 4BNCA 2DMPA 4DBQA 4ZYDA 3M3YJ 3HHHA 2Q0OA 4PCQA 2NS8A 3DBLB 4HQMA 2EZKA 3WU0A 4BE0A 3BDDA 3LQRA 4BHCA 4MLOA 5E1WA 1KU3A 3ASNH 2CS3A 3KP7A 1WJ5A 1SANA 5H20A 4FT8A 3VPRA 2HKOA 3OSGA 2CG4A 2M9HA 2M8GX 2FMYA 5DUKA 2C6YA 2V1DA 2VBYA 3S1NJ 4GDFA 4Q48A 1F4KA 3GYHX 3VWBA 1RESA 1Y6IA 1FT9A 1UJ8A 2K02A 5JHUA 1R58A 3HTUA 1F5TA 3L2WA 1WI9A 3BR2A 2NS0A 1P4XA 1VQ5I 4Q4ZF 1R49A 1PUFB 3WTTC 3H3ZA 1K83J 2KRFA 3KCCA 1QVUA 5DD8A 4BDYA 1UZCA 4CCJA 2R93J 2BBYA 5IP6A 3CJNA 4PK4A 4B8XA 3ELKA 3KEOA 1DPRA 1STZA 2L4AA 4EJOA 3RPUD 2V9KA 2VI6A 1T38A 2DT6A 2CQKA 4OIOF 1MJ9A 4UB6C 1YS6A 3K4NA 2L01A 4R8HA 1HKSA 2F5EA 3KETA 4IHSA 2A61A 3HRTA 4LK0F 3K6GA 2R7UA 2O9LA 1EV7A 5FKMA 2BGCA 1ZR4A 3BG9A 5FKOA 3V4GA 3GZ5A 2LY2A 3K4KA 4A0YA 2EIMH 3K4LA 3S1RJ 1MMAA 3U1DA 3ZMUA 3JTGA 3LAJA 3HRSA 1ZGJA 5JLXA 3J7YJ 1TW2A 1FYKA 1YI2I 2KKOA 3W2VA 4KMFA 5BS6A 3MD2A 5F0HA 2MYSA 2E19A 1BIBA 2IPQX 2NOGA 4KT5C 2ESHA 4PSXA 1SFUA 4XLPF 3SZTA 4A3JJ 3U21A 1K6YA 3I9V2 3ULQB 2HU9A 1BN5A 3FXUA 4ZYAA 2GA1A 2VJJA 4LLGF 4DYRA 2XAFA 3BJAA 4GXOA 1IXSB 1R1VA 4GRIA 4I6ZA 1EF4A 4B44A 1R7JA 3H3UA 2KMUA 2QSHX 2Y48A 4EJTA 2K5CA 4OAYA 1Y1VJ 2L7MP 1TQPA 2JQ7A 4XORA 4LD5A 4Y33A 2DK5A 5K5QA 1I50J 4KICA 4M74A 5F27A 1W0UA 1EJ9A 4KYWA 3JSOA 1HDDC 1U5TB 1XMXA 1B72A 1ZRCA 3QRFF 2IS4A 1G59A 2EA4A 5EEHA 1ZR2A 5E1XA 3FXQA 4M3BA 1ZHFA 3FXRA 3S2WA 4KUMA 3ABLH 3ONQA 2L7FP 4BQQA 3RKQA 1MJAA 1MDMB 4RM3A 4ZZLA 2L3DA 3VB2A 4S04A 4M6YA 2A5YB 2CW8A 4MFDA 5DD4A 1OYIA 4HAMA 1IUFA 1TNTA 2HPMA 4HBLA 3JRCA 3C2HA 3K69A 2CV2A 4XN3A 3ZOBA 3LSGA 4H0EA 5LHHA 3F6VA 4AUXA 2XPWA 1O3RA 4BHPA 2AXTC 2V9VA 1B1BA 1ZG3A 2CW0F 4XM3A 2QBYA 1ETQA 5F64A 3E6BA 3LSHA 3JRDA 4G7HF 3FBNB 2HQAA 4EVIA 3L9FA 3R4KA 3PSIA 2B0LA 1Q1HA 2HYGD 3EDPA 1R23A 3BG3A 1ZAOA 3OY9A 2R5ZA 5E3OA 3HOUJ 1A35A 1MD0A 2X1CA 3BROA 4RB0A 2QQAA 1ENHA 1YW8A 2HZTA 4WF2A 4EGYA 1YLFA 4IHWA 2HS5A 4L5IA 3F22A 1AOYA 3PL8A 1LEAA 5E20A 3PUBA 1ZLJA 1O7FA 3ZQIA 4FTHA 1UHWA 4Y13A 3K10A 3GEZA 1DP3A 4HLYA 1FYLA 3HB9A 4Y7NJ 2PFBA 1U8BA 2Z9OA 3DLAA 5L3DA 1BBYA 2ETHA 2FNPA 3BG6A 3L00A 1NG6A 2PMZN 4G7ZF 2DJIA 4A5MA 2D1VA 3BT9A 3SDGA 3ROUA 5M5WJ 2EFOA 2FJ1A 3DTKA 4OIPF 1PUFA 1SVOA 4B47A 5GTHC 2KRCA 1P92A 3KEQA 5LGUA 1ETVA 4LOCA 4JX5A 3VSKA 2KIUA 2OPTA 2E2JJ 1SVLA 2VONA 3BTCA 1PUEE 5HDKA 4Q5SF 2BW3A 1U3EM 1L0OC 3ZMDA 4GFBA 5CLSA 2XGEA 1MBHA 1UG2A 5EEGA 1T0FA 4XLFA 3AG3H 3DFGA 3I4MJ 1C0WA 2K9NA 2VT3A 4D9JA 1APLC 4HG2A 3HYIA 5KVRA 3TOBA 2VOPA 4II2A 5LBQA 2CUJA 1XCBA 2LTPA 3DKYA 4IRHA 5ICCA 4NC8A 1YJ9I 3FXLA 2JRMA 2QCOA 5A2QK 2F5VA 3HRMA 1IDYA 1R1TA 3GO5A 1ZREA 5FLXK 1HDPA 4UV8A 5B5EC 4AU7A 2ZXJA 2QEXI 3GWZA 3RKWA 1QZZA 2DK8A 3CCJI 1XCVA 3QWLA 4XNFA 1VFCA 2DCEA 2M0CA 2Y0SA 2NVTJ 4I2OA 2CW7A 3FZVA 5BNGA 4B1RA 1P4AA 2FNAA 3DXJF 5FKLA 4XRFA 2GOMA 3MFKA 1NH3A 1RR8C 4HF1A 4ESFA 4RGRA 1S7AA 2JPCA 4KT6A 5HLIA 5J4VA 1JHFA 3ABUA 1S7OA 5GADJ 3QOEA 5H6RA 2YU3A 1SC7A 4BXFA 1TWHJ 2ZJ2A 2DOAA 4G6QA 3BWGA 5D5VB 1ZRFA 2HR3A 2NAZA 4BE2A 2ISYA 3E6DA 4A0XA 3ISPA 1W5SA 3PUFA 1QA6A 2EJRA 2X6OA 2ZMEA 3OYFA 1KA8A 1Z6RA 4R79A 2ZJRF 1SFXA 1MZBA 5EJCA 5E3LA 1FC3A 2QBYB 5K5OA 2F6CA 3LWFA 3OYJA 5F6FA 2XAJA 2LDUA 4DZJA 1NK2P 1ETWA 3ZCOA 2KPMA 2JPBA 2XAQA 3FX3A 3K1MA 1TNSA 1WH5A 1A6QA 2OJED 1K4SA 3HSFA 5HDGA 2Y30A 1E3HA 2X6YA 2OTLI 4LG0B 3MN2A 4I7HA 2L2OA 3PFIA 1A31A 2QF7A 1Y0NA 4UVBA 1ONVA 5KK1A 4UNOA 5ILSA 2IAIA 2PQ8A 1YW7A 3RZDJ 1X1CA 2VKDA 1QRYA 4ZDOA 2COBA 3S93A 1OCRH 2XPUA 3JREA 3WHCA 2WWYA 1UCRA 3EYIA 4UUVA 1IZ1A 1U2WA 2W84A 4MNUA 1WHUA 1U5TA 2CJJA 3MWMA 2K9SA 3EUAA 2PLYA 2M1BA 1D5VA 1JHHA 3HHGA 2XVCA 1YHQI 3GLXA 4I02A 2EWNA 1P6RA 1JE8A 5GTIC 4CICA 4NC6A 4OMZA 1RZ4A 1K6OA 3WGIA 1T08B 4KA4A 2UWMA 4HQEA 3JAMK 3GX4X 2FU4A 3HM5A 3JTHA 2XC7A 2CUFA 3LAPA 1LE8A 2HVSA 2X85A 2E2IJ 1MMGA 2IJLA 4YIRX 5KNLA 5E1ZB 2ZXWH 2EFPA 3A4CA 3LA7A 2XSDC 5L3EA 1UAAA 3AFHA 4P5OA 4IX7A 1HW2A 2W25A 4OINF 2HXIA 1IRFA 3CZ6A 2BZTA 1R36A 1U78A 5JFRA 1ZRDA 4NB5A 2JRTA 3REOA 1R71A 3HOYJ 1W7PD 1WI3A 2LNBA 1FX7A 2HOAA 4BQOA 1LJ9A 1Y39A 2HGCA 3CCUI 2R7DA 4XLHA 3WTYC 2JK3A 2VBWA 4A3DJ 3OYDA 2YU9J 2FEZA 4C3IJ 3F0CA 4ENMA 4CYCB 1T98A 5TRDA 1YYVA 1ZLKA 1EH8A 2XGXA 3J80K 2AQEA 3H3VK 4BY1J 4MFEA 3GTLJ 4HSTA 3QYFA 4P9FA 4XKVA 2XRNA 4PGGA 4BHBA 4G9YA 3MKZA 3CCEI 3A0BC 5BPIA 1JKQC 4KNYA 2M34A 4XRSG 2E71A 1OYYA 4HEA2 3QP6A 1XG1A 4B43A 4QLCU 4BEHB 1I6HJ 1JXSA 1GVDA 3HTSB 1BI1A 2CQQA 5DTDA 2P5KA 2GIVA 3CDHA 1D0XA 2PG4A 2FBHA 3G1MA 2DMQA 2M0MA 3DEWA 3RJPA 2DA2A 2K27A 3HGGA 2Z33A 2QENA 1O3TA 4M73A 2V4JC 4U7BA 5DYMA 3M7GA 1W5CC 3O6BB 1XGSA 2F5FA 4RLQA 2CGPA 3H9GA 2BYVE 3COAC 4YG2F 4CYDA 2EPFA 4C30A 4LITA 3GZ6A 3IRRA 4HRIA 4XONA 1RETA 5L3BA 2Q2EA 2V79A 3HSEA 3SFIA 2UXXA 2H8RA 2CU7A 3C3WA 4HSRA 1FWZA 2X4HA 3Q9VA 3L2CA 2NVQJ 2VASA 4EJVA 1JKRC 4JQFA 1FLIA 3S16J 3BG5A 2DAOA 2DQRA 1Q1VA 2STTA 1FP1D 2CWEA 2Z16A 3GFLA 4BXXJ 4XOPA 2OA4A 1MNMC 3BP8A 4IHYA 1TP4A 1PP8F 2DPDA 1HA8A 3ZP5A 2CRGA 3S17J 4DYQA 1TQMA 3OSFA 2TCTA 3C7JA 4XKBA 5IP7J 1P9QC 2NNNA 2H27A 2GXAA 2O7OA 3DBRB 3IC7A 2E1MC 2WB1N 2KDOA 2WAQN 2BHYA 3IH4A 4KIFA 1IRZA 3MKLA 1USSA 3KIOA 3GUDA 1RC9A 4N0BA 5CVJA 1GV2A 2ZXHA 4PDKA 5CVIA 1BR2A 5HDNA 4X0GA 2F4IA 1IN4A 4HNUA 1LQ1A 2HDWA 2I5UA 4NC7A 1SD5A 4F3QA 3PSFA 2OTJI 2KDZA 1LFPA 2EV5A 2IS1A 2D45A 1XGNA 4MO7A 3DPTA 1YRNB 1B9MA 2LBFA 1YFHA 3DQVC 2YUSA 3CF5F 2PN6A 2DA4A 3DBHB 4BJ6C 2LYCA 4LFUA 4ZZDA 2JT1A 1BM9A 1E2XA 3C1DA 2K7LA 2XHKA 1SMTA 4PSWA 4LLNA 1YS7A 4A0ZA 1ETXA 1FSEA 1R1UA 3H92A 5A2QZ 3F8MA 1Z3YA 3P9IA 3ZQHA 4ENJA 2QUFA 5LHIA 3MZHA 3DV8A 1K4TA 2XF6A 1X1BA 3CCLI 1NTCA 4IXAA 2EB7A 4KJZA 5DM6F 1HCRA 4MEYF 3J7ZI 1DDNA 3T8RA 3QYBA 4WXHA 5E8IA 2BY1A 2HKXA 3NARA 5M3MJ 5BOXA 4F55A 3LSPA 5FLXZ 2JVGA 3N05A 4IVNA 5JVTA 3CCVI 2A6HF 2LY9A 1BL0A 3I64A 3RPUA 1SAUA 4A12A 2LVSA 1YE9A 3FMSA 3KYDB 3Q9SA 4M3FA 5LRRA 4AIHA 4G8XA 3KP6A 4O6JA 2VT2A 3V8KA 1YIOA 2R5YA 1KU2A 3HOVJ 2WC2A 4XKWA 1J7KA 3ZQ7A 2GWRA 1XDUA 4HZFA 1F1ZA 4IQJA 1OLTA 4V2FA 1FBUA 4BU2A 1ETKA 4DNCA 1EA3A 1ZN2A 1IF1A 1FOKA 1DP7P 1QZYA 2QLZA 4M3DA 3CJQB 5JVGF 5LFAA 3DLLF 2JN6A 1IN7A 4RMNA 4XLCA 3ZQLA 2EILH 4D5FA 2NNYA 4B3AA 2PEXA 3DEUA 3E6MA 5EEAA 1SMYF 2ZMEB 4UXNA 2MD5A 4CGZA 4N4OB 3TO9A 4CZCA 1REPC 1X3UA 3CP2A 2QQ9A 1GXQA 4Y3OA 4A3KJ 3S3MA 5GPAA 3N4MA 3ZQQA 4PJJA 1UHSA 4IL6C 2DYRH 1D1AA 2K9QA 3FISA 4RB2C 3L2QA 5C4XJ 1HSTA 3P9KA 1D3YA 1HOMA 1VF9A 5FD5A 3G1OA 2OBPA 4RBOA 5EG0B 3HC7A 2JA5J 3PQKA 1IV8A 1YG2A 1I3QJ 1VQKI 3L2VA 3ECOA 2LY1A 5D5WB 1D1CA 5LLQA 4KMUX 2LK2A 2V1XA 1X3ZB 4F93B 3N97A 4RB3C 4Y4RA 2DFHA 3PM1A 5CJ9A 4LLLA 1XGOA 2DMNA 1IC8A 3NAUA 1KZHA 4F7ZA 2RGVA 4A3FJ 3G71I 4ZYGA 4AIJA 3RIRA 1E17A 2EZIA 2JSPA 1D0ZA 2W24A 4AD9A 3F8NA 5HOOA 1T39A 4RAYA 2DO7A 5B1AH 2VKHA 1D5YA 2H1KA 4QTRA 2A5WA 3GZNB 2ADUA 1FNNA 2RNGA 1WJDA 4EJUA 2EZHA 3OR1C 3GF2A 3K9TA 2V6EA 1BC8C 2DTZA 1IO2A 4QWQA 1VQ4I 4GGGA 1W36C 1Z7LA 3WTVC 4BH9A 2GBYA 3MKYB 3S3NA 1QPMA 5CKTA 2RNJA 2R5YB 3FXJA 4ASNA 4BJ5C 2G7UA 2BW3B 3GMEA 5J8FA 1T6SA 1HKQA 2E5ZA 3K7AJ 1I3AA 2QSGX 2JA7J 4E7SA 1Z05A 4F91B 1K78A 2W85A 1Y56A 2GM4A 2VBXA 2ESNA 3EPZA 3QU6A 4E70A 1A04A 2BE5F 3OIQA 2OV7A 2EQRA 5EG0A 3F21A 2O8KA 2V26A 5F04A 2P5VA 2ELKA 2FUG2 3OYHA 2FBIA 3M8FA 3ASOH 4D7NA 2DYSH 2QM3A 2HPIA 3WODF 4L5JA 2DJNA 3KZYA 3JRGA 2DA1A 5LD2C 3L09A 1WJFA 3RYPA 2NOJB 3JR9A 2YSRA 3FF5A 1W7PB 2ID6A 3OWTA 5K7ZA 2TRTA 1HKTA 1XSDA 2PMUA 4LG3A 2NVUB 3D5SC 4E7JA 1AWCA 5M5YJ 1Y8QB 4GO1A 1SD7A 3S1MJ 2H09A 3BOQA 2MABA 2ZO4A 3L2UA 1VQOI 2A69F 1P7JA 2K40A 2RKHA 3I59B 3AG2H 4CUGA 3LSJA 2LBFB 5IPAA 1CGPA 1PDNC 3DPLC 4U0YA 3HPHA 4PJ0C 3WTUC 1KQ8A 3OYAA 2LKSA 2VKVA 5CQGA 2KZGA 5CVUA 4D1QA 3K1PA 2VIXA 3HDDA 2OQRA 4DYCA 1IN8A 2K4BA 1AHDP 4G12A 1J0RA 1LFUP 3V7CA 4HDVA 4AC0A 4WX9A 2VN2A 1X1AA 4XKCA 2GAUA 3G73A 5FLVA 2HQNA 2PJRB 2DPUA 1TQIA 4FETA 2YR2A 1R6RA 4UVAA 3DP7A 3BCBA 3OIPA 2MLGA 4DBRA 4L18B 2RVCA 4UV9A 2XGCA 1IUYA 1MNDA 2DFIA 3HXLA 3IH3A 2A3SA 4NHJA 1H9TA 2W00A 3TQNA 3WU2C 4B09A 1R4MB 1QZEA 2XB0X 2E60A 2EIJH 2DA7A 2X0LA 3GTQJ 1P7IA 2R7TA 3OYEA 2P8TA 3K0LA 1HLVA 1LVKA 2GA2A 4M9ZA 5FKNA 3HOXJ 1FMVA 1QO0D 1T56A 3WTZA 5ICEA 2Q1ZB 3MCZA 4AM3A 3FXOA 1RI7A 2FE3A 3UR3C 3VFZA 1GLNA 1RNLA 3R60A 2OCCH 5CYVA 2VB6A 2L4MA 2VODA 3O3KA 3F8CA 1X2NA 1B8IA 3R0JA 1W0TA 3U1KA 5ICGA 2BY0A 3FKJA 1FTTA 3RQ4A 4XLNF 5HODA 3WE3A 2IA1A 5LGNA 1ZKGA 3GTJJ 2XAGA 3I5UA 1A36A 4AIKA 3D5RC 2QKLB 3CP8A 3RCOA 3BJ6A 3QPLA 4IOCF 2J5OA 1TT0A 3CUQA 4B3XA 2R7ZJ 1G6NA 3VSLA 1MDMA 2ZSIB 1TTYA 3LNQA 2R0QC 2VOOA 2E1MB 2VE9A 2ZSHB 3BQYA 4CCKA 2P81A 2R7FA 4CZZA 1OCZH 2VC1A 2ZC2A 1Z3XA 3JRIA 2LRDA 1IGNA 3WG9A 1I1SA 2JUGA 1VQ9I 1KQ9A 1OPCA 4XR6A 1CF7B 2W4SA 4PGHA 2DLLA 3BQZA 3OL4A 2R4GA 1NG7A 5HS8A 4E4HA 2XKOA 2M5WA 2FD5A 2E1CA 2BEOA 2DTRA 3IWZA 1ZGWA 2ECCA 3KP3A 3LA3A 4I98B 2QA4I 2E1OA 2FOWA 1Z91A 3JRBA 2CO5A 3I53A 5K7HA 4FE7A 1HQCA 2MW8A 4Q47A 1PYVA 3ERMA 3S15J 2VE8A 4U87A 2WV0A 3TMOA 3ERED 1NHAA 1BJAA 4BUPA 4BE1A 5CVRA 2A6TA 5IP9J 2FQ3A 1IXCA 1POGA 5IY5H
chains in the Genus database with same CATH topology
3C18A 3SXYA 2HDCA 3T5XA 2L02A 2P6TA 1FP2A 1I27A 1USTA 4JBAA 4KDPA 2M87A 2MLKA 2M8EA 3M9AA 2DU9A 5DDGA 4WXCA 1IAWA 1ZH5A 3D5LA 3KP4A 4YIFA 4I09A 1YTYA 2E7WA 3HOTA 2VBZA 4UHTA 1G3TA 4MGRA 2MH2A 3GXOA 3AAFA 2RV8A 3WTWC 3SHFA 4M6XA 4HF0A 1BC7C 5JR3A 2ZBKA 4IRGA 3KE2A 4XSXF 1MKMA 1PP7U 4DQ2A 5DCMA 1KGSA 3RTRA 3PQJA 2Z3YA 5AIPA 1J9IA 3HUGA 2M30A 5BQTA 3CO6C 1XMAA 2OAZA 3KLNA 3E3VA 3WTXC 2E1NA 1FY7A 1J2XA 1G3SA 3ECHA 3TKYA 3V8JA 4I0AA 2ELHA 2FF4A 4EMSA 2O8XA 1BOAA 2F5DA 1G3YA 4ON0A 4MQ9F 3U2RA 4YIIA 4HF2A 3TDUC 4Y15A 4HOBA 3J81K 2MC3A 3CTAA 3U9GA 3I4PA 5L3CA 3V7RA 4AVPA 1YW9A 3J80Z 2O61A 1Z9CA 3DF8A 2IA0A 1U8RA 1O3QA 1ZGAA 4L9TA 5ED4A 3WTSC 3ABTA 1D8KA 2XV4S 4M9XA 4OU0A 1R00A 4RS8A 2BV6A 4OOIA 2QYOA 2D2WA 1DUXC 1VTNC 5HLGA 2CSOA 1DPUA 5IT9Z 2GXBA 4CO8A 4MEXF 2YX4A 2RN7A 1WWXA 2RDPA 3IHUA 3RKXA 1J5YA 2H6CA 2YPRA 3SFZA 2R3SA 5DCMB 2Z99A 4U0WA 3W6JB 2Q8KA 4N9HA 2IA2A 3M1EA 2HQRA 3ZMSA 1V4RA 2AXLA 2D1HA 2HWVA 4BYYA 4U0VA 3B73A 5FFXA 4FHTA 1GVJA 2OD5A 2EFNA 3F3XA 1H9GA 4Z2YA 2FOKA 3ZPLA 1HSJA 2EV6A 2A07F 5DCFA 3EYYA 4TV7A 2HTSA 5FFZA 5LRSA 4IRIA 2A68F 1XB4A 3FWEA 5TJJA 4OIRF 5LGTA 3KP5A 3FM5A 1XDSA 5JI6A 1IN5A 1FBSA 1FPQA 4G94A 1H0MA 2KIMA 2G9WA 1LNWA 3KZZA 4RGSA 1YO5C 3ZN0A 3JW4A 3HSRA 2GQQA 4D0PA 2KJCA 1O57A 3R0AA 1RUOA 2GXGA 1XD7A 4ZH4F 3D0SA 3EETA 4KIBA 1O3SA 1O7LA 1SD6A 1ULYA 4L0YB 4I0BA 2EK5A 1FSHA 4ESBA 4MTDA 4G7OF 3MAJA 2XAHA 2JTVA 3W6KB 3E5QA 1CF7A 4IF4A 3F23A 1QGPA 4ESJA 2P7VB 4YFKF 2EA2A 2O6GE 5E8GA 2XUBA 3GFMA 2FA5A 1GHCA 1L3LA 2QWWA 6PAXA 1R5HA 1XN7A 3E97A 1UHMA 1ZARA 2PBIA 1KQ0A 1LDKB 3E6CC 5H6QA 4A2UA 3QAHA 5K1YA 2YX7A 3O2PE 1F9NA 1KYWA 1YQAA 4A5NA 2FMLA 1SD4A 2J5PA 1WKMA 1IXRC 3SQNA 1LDDA 1JGSA 2EFQA 5ERIA 4LJZF 4L9NA 1OMIA 1GXPA 1ON2A 1B4AA 3K2ZA 3TGNA 2V6CA 1LVAA 5L3FA 1KYZA 3G3ZA 5HS7A 4M71A 2H6BA 1HBXG 4BQAA 2XASA 1K78B 3R61A 4HV5A 2HFHA 4HX7A 2FXAA 4BAYA 1WSUA 2KIFA 3ZMZA 2JSCA 2MA3A 2QZ8A 3I59A 4XSZF 4ZYEA 4MTEA 1Z1DA 2LKPA 2UXNA 2IRFG 3KLOA 1IRGA 2NRAC 2MH9A 4L9JA 1IW7F 4P55A 3NRVA 1K79A 2P6SA 2QQBA 3GW2A 3BPVA 1MGTA 4IJAA 2LF7A 4O5VA 3LQQA 2O03A 3TO7A 1MJBA 1FYMA 1D8JA 3I58A 2WTEA 3L7WA 3KP2A 3RDIA 1J59A 5D5UB 2JZYA 4L9VA 4KIGA 2HOEA 5K5RA 4I01A 2DBBA 2K4JA 4HW0A 1B6AA 1W5TA 1S3JA 2XROA 4LG0A 1Z6TA 3JAMZ 2ZNYA 3NQOA 3IRQA 2H94A 2P7CB 5AIQA 4AWXB 5DEQA 5ICFA 5FO5A 2NYXA 3DKWA 1UFMA 3LFKA 2LSOA 2V1UA 3M8EA 4Y17A 4S05A 4WCGA 5LHGA 3V8LA 4RGXA 4LGWA 3KFWX 1SAXA 1QBJA 3MZYA 1XSXA 3CUOA 2MBFA 2IVMA 4KN7X 5D6EA 2PI0A 5IT3A 4EM2A 1BIAA 2RC4A 4HLXA 1LB2A 2FBKA 2DW4A 2Y75A 3FMRA 3E5UA 1P2FA 1ZG1A 1FZPB 3FHZA 2XIGA 5D8LB 4LMYA 1R22A 4HA8A 1OKRA 1R5GA 1QQIA 4WXDA 2HTJA 2W57A 3FMQA 3GFJA 3IWFA 1Z7UA 5D8KB 3F8FA 3F8BA 2OZUA 5CVVA 3EQLF 1UB9A 3RKYA 2LF8A 5LEJA 1OYWA 5D4RA 2IW5A 3HRUA 4EGZA 3T1BA 3QU3A 1XMKA 3NEUA 2DI3A 1QNTA 2DQLA 1J75A 5ILUA 3CUQB 4RB1A 2Z5UA 4HX4A 3LA2A 1SFEA 3IKTA 4MQVA 3WGHA 5BPDA 2VXZA 3CLOA 3QPHA 3RYRA 3JSPA 3J7AO 3E5XA 4A6DA 4P9UA 3OV8A 3CO7C 1V3FA 4K2EA 2A6EF 3FM3A 2COMA 1BI3A 3EUHA 4WWCA 1WQ2A 2F2EA 2IT0A 3MQ0A 2HYFA 5J8CA 2ISZA 2M45A 2QVOA 2DT5A 2L54A 4EQQA 3QP5A 4FX4A 2STWA 5ILVA 2TDXA 5E18F 4GCVA 1XGMA 1U6GA 4EM1A 1EH7A 5FB2A 1KU7A 2CYYA 2HEOA 5FGMA 4IHTA 4U88A 3T0YA 3K1NA 5HLHA 2K86A 1EH6A 2CFXA 2E7XA 1B59A 4HX8A 5IT9K 4M9SA 5LEKA 3IKVA 3RI4A 3F72A 3J81Z 1TLHB 2PMHA 1IN6A 5J6XA 3TO6A 4A6EA 1S8NA 4CHUA 1HXDA 2PJPA 1BI0A 2KJBA 3VODA 5L3GA 3HIFA 4M72A 4CDGA 2P4WA 4GYIA 2ZKZA 4N9IA 1ZG5A 2EV0A 4XBFA 1ZYRF 4G6DA 5FD6A 1RIOH 2OU2A 3ZMTA 3B02A 5F1RA 4YFNF 5E17F 1TW3A 3P9CA 1FBQA 2GZWA 3GVAA 4WK8F 4UVCA 4HYEA 4ZYHA 2RQPA 5HVQC 1W4MA 2OQGA 4RGUA 4EM0B 1T2KA 3WU1B 3QPTA 4OMYA 2UZKA 4FX0A 1BI2A 2FSWA 3IL2A 3TOAA 3BY6A 4RAZA 2G7HA 3TDZC 4ENNA 1RUNA 1LDJA 1Y0UA 5DV5A 4R1HA 3HOSA 2ZFWA 4P96A 4L0ZB 1S29A 1G4DA 4IPAA 2AS5F 1OR7A 1K7AA 1S6LA 3I0TA 2FRHA 3LSTA 4LB6B 1G3WA 3MEXA 3OOPA 1I1GA 2ACJA 2OZ6A 3T8TA 3R6SA 3RPQA 3BJOA 1XSVA 4HV6A 3BZ6A 3WE2A 3F6OA 4ENKA 1I6XA 4EJWA 4GYGA 1P4WA 3ML6A 3P7NA 1W7PA 2ZNZA 3WGGA 5AONA 2IP2A 2Y0MA 1B9NA 1HW1A 2O3FA 1U5TC 4JK1X 1KU9A 3I54A 4LB5A 3GFIA 3V7SA 4KN4X 3CUQC 1ON1A 1I5ZA 2F5CA 1TBXA 4NQWA 3ZMVA 4BXUA 4EV0A 5BMZA 5D6FA 2ZCWA 1ODDA 5DUIA 2P5LC 5D4SA 3QOPA 4LK1F 4YFXF 4ETSA 4OIQF 5HS9A 4KFCA 3I71A 3ZN1A 1HW5A 2O0YA 5D5XB 3SZPA 1LEBA 3Q5FA 4MHGA 3BPXA 4O3MA 3VEPA 1WRJA 4CXFA 2XKPA 2EFWA 4U7DA 3VOEA 4HDUA 4BNCA 2VC0A 4ZYDA 3HHHA 2Q0OA 4PCQA 4HQMA 3WU0A 3BDDA 3LQRA 4BHCA 5E1WA 1KU3A 3KP7A 5H20A 4FT8A 2HKOA 2CG4A 2FMYA 5DUKA 2C6YA 2V1DA 2VBYA 4Q48A 1F4KA 3GYHX 2K02A 1FT9A 5JHUA 1R58A 3HTUA 1F5TA 1WI9A 2NS0A 1P4XA 4Q4ZF 3WTTC 3H3ZA 2KRFA 3KCCA 5DD8A 2BBYA 3CJNA 4B8XA 3ELKA 3KEOA 1DPRA 1STZA 2L4AA 4EJOA 1T38A 2CQKA 4OIOF 1MJ9A 1YS6A 4R8HA 2L01A 1HKSA 4IHSA 2F5EA 3KETA 2A61A 3HRTA 4LK0F 1EV7A 2BGCA 3V4GA 3GZ5A 4A0YA 3U1DA 3ZMUA 3JTGA 3LAJA 3HRSA 1ZGJA 1TW2A 1FYKA 2KKOA 4KMFA 5BS6A 1BIBA 2IPQX 4KT5C 2ESHA 1SFUA 4XLPF 3SZTA 3ULQB 1BN5A 3FXUA 2GA1A 4LLGF 2XAFA 3BJAA 4GXOA 1IXSB 1R1VA 1R7JA 3H3UA 2Y48A 4EJTA 1TQPA 4LD5A 2DK5A 5K5QA 4M74A 4KICA 4KYWA 3JSOA 1U5TB 1ZRCA 3QRFF 2EA4A 5EEHA 5E1XA 3FXQA 1ZHFA 3FXRA 3S2WA 4KUMA 1MJAA 1MDMB 4ZZLA 2L3DA 3VB2A 4S04A 4M6YA 2A5YB 5DD4A 1OYIA 4HAMA 1TNTA 4HBLA 3K69A 4H0EA 5LHHA 3F6VA 1O3RA 4BHPA 2V9VA 1B1BA 2CW0F 1ZG3A 2QBYA 5F64A 3E6BA 4G7HF 4EVIA 3L9FA 3R4KA 2B0LA 1Q1HA 2HYGD 3EDPA 1R23A 1ZAOA 1MD0A 3BROA 4RB0A 2QQAA 1YW8A 2HZTA 4WF2A 4EGYA 1YLFA 2HS5A 4L5IA 3F22A 1AOYA 1LEAA 5E20A 1ZLJA 1O7FA 1UHWA 4Y13A 3GEZA 4HLYA 1FYLA 2PFBA 2Z9OA 5L3DA 1BBYA 2ETHA 2FNPA 3L00A 4G7ZF 4A5MA 2D1VA 3ROUA 2EFOA 4OIPF 5LGUA 1P92A 3KEQA 2KIUA 2VONA 1PUEE 5HDKA 4Q5SF 1U3EM 1L0OC 3ZMDA 5CLSA 5EEGA 1T0FA 3DFGA 1C0WA 2VT3A 3HYIA 5KVRA 3TOBA 2VOPA 5LBQA 1XCBA 4IRHA 5ICCA 5A2QK 3HRMA 1R1TA 3GO5A 1ZREA 5FLXK 4UV8A 2ZXJA 3GWZA 3RKWA 1QZZA 2DK8A 1XCVA 4I2OA 3FZVA 1P4AA 2FNAA 3DXJF 4XRFA 3MFKA 4HF1A 4ESFA 4RGRA 1S7AA 2JPCA 5HLIA 1JHFA 3ABUA 1S7OA 5H6RA 2YU3A 2ZJ2A 1ZRFA 3BWGA 4G6QA 5D5VB 2HR3A 2NAZA 2ISYA 3E6DA 4A0XA 3ISPA 1W5SA 2EJRA 2ZMEA 1KA8A 1Z6RA 4R79A 1SFXA 1MZBA 1FC3A 2QBYB 5K5OA 3LWFA 5F6FA 2XAJA 2LDUA 2JPBA 2XAQA 3FX3A 3K1MA 1TNSA 3HSFA 5HDGA 4LG0B 4I7HA 3PFIA 4UVBA 1ONVA 5KK1A 4UNOA 5ILSA 2PQ8A 1YW7A 2WWYA 1UCRA 3EYIA 4UUVA 1IZ1A 1U2WA 2W84A 4MNUA 1U5TA 3MWMA 2PLYA 2M1BA 1D5VA 1JHHA 3HHGA 2XVCA 3GLXA 4I02A 2EWNA 1P6RA 1JE8A 4CICA 4OMZA 1RZ4A 1K6OA 3WGIA 4KA4A 2UWMA 4HQEA 3JAMK 3GX4X 2FU4A 3JTHA 3LAPA 2IJLA 5E1ZB 2EFPA 3LA7A 5L3EA 4P5OA 1HW2A 2W25A 4OINF 1IRFA 1R36A 1U78A 5JFRA 1ZRDA 4NB5A 2JRTA 3REOA 1W7PD 2LNBA 1FX7A 1LJ9A 2HGCA 2R7DA 3WTYC 2VBWA 2FEZA 4ENMA 1T98A 5TRDA 1YYVA 1ZLKA 1EH8A 2XGXA 3J80K 4P9FA 2XRNA 4PGGA 4BHBA 4G9YA 5BPIA 4KNYA 1OYYA 3QP6A 4QLCU 1JXSA 3HTSB 1BI1A 2P5KA 2GIVA 3CDHA 2PG4A 2FBHA 3RJPA 2K27A 2Z33A 2QENA 1O3TA 4M73A 4U7BA 5DYMA 3M7GA 3O6BB 1XGSA 2F5FA 2CGPA 2BYVE 3COAC 4YG2F 4CYDA 3GZ6A 3IRRA 5L3BA 2Q2EA 2V79A 3HSEA 2UXXA 3C3WA 1FWZA 2X4HA 3Q9VA 3L2CA 4EJVA 4JQFA 1FLIA 2DAOA 2DQRA 2STTA 1FP1D 2CWEA 3GFLA 2OA4A 3BP8A 1PP8F 2DPDA 3ZP5A 1TQMA 3C7JA 2H27A 2NNNA 3IC7A 4KIFA 1USSA 3GUDA 4N0BA 5CVJA 4PDKA 5CVIA 5HDNA 1IN4A 1LQ1A 1SD5A 2EV5A 2D45A 1XGNA 3DPTA 1B9MA 1YFHA 3DQVC 2PN6A 4LFUA 4ZZDA 2JT1A 1BM9A 1E2XA 3C1DA 2K7LA 2XHKA 1SMTA 4LLNA 1YS7A 4A0ZA 1FSEA 1R1UA 3H92A 5A2QZ 3F8MA 3P9IA 4ENJA 2QUFA 5LHIA 3MZHA 3DV8A 4IXAA 2EB7A 4MEYF 1DDNA 3T8RA 4WXHA 5E8IA 2HKXA 5BOXA 5FLXZ 4IVNA 5JVTA 2A6HF 3I64A 3RPUA 4A12A 3Q9SA 3FMSA 5LRRA 4AIHA 4G8XA 3KP6A 4O6JA 2VT2A 3V8KA 1YIOA 1KU2A 2WC2A 1J7KA 3ZQ7A 2GWRA 1XDUA 4HZFA 1F1ZA 1FBUA 4DNCA 1ZN2A 1IF1A 1FOKA 1DP7P 1QZYA 2QLZA 1IN7A 2NNYA 2PEXA 3DEUA 3E6MA 1SMYF 2ZMEB 4UXNA 2MD5A 4CGZA 3TO9A 1REPC 1X3UA 2QQ9A 1GXQA 3N4MA 4RB2C 1HSTA 3P9KA 1D3YA 5FD5A 2OBPA 3PQKA 1YG2A 3ECOA 5D5WB 5LLQA 4KMUX 2V1XA 3N97A 4RB3C 5CJ9A 4LLLA 1XGOA 4F7ZA 2RGVA 4ZYGA 4AIJA 3RIRA 1E17A 2W24A 4AD9A 3F8NA 5HOOA 1T39A 4RAYA 2DO7A 2ADUA 1FNNA 4EJUA 3GF2A 3K9TA 1BC8C 4QWQA 4GGGA 3WTVC 4BH9A 1QPMA 2RNJA 4ASNA 2G7UA 5J8FA 1T6SA 1HKQA 1Z05A 1K78A 2W85A 2VBXA 2ESNA 3QU6A 4E70A 1A04A 2BE5F 3F21A 2P5VA 2FBIA 3M8FA 2QM3A 3WODF 4L5JA 3KZYA 3L09A 3RYPA 2YSRA 3FF5A 1W7PB 1HKTA 1XSDA 2PMUA 1AWCA 4GO1A 1SD7A 2H09A 3BOQA 2ZO4A 2A69F 2RKHA 3I59B 1CGPA 1PDNC 3DPLC 4U0YA 3WTUC 1KQ8A 5CVUA 3K1PA 2OQRA 1IN8A 2K4BA 1J0RA 3V7CA 4HDVA 4WX9A 2VN2A 3G73A 2GAUA 2HQNA 2DPUA 1TQIA 2YR2A 4UVAA 3DP7A 2MLGA 4L18B 2RVCA 4UV9A 1IUYA 2DFIA 2A3SA 4NHJA 1H9TA 3TQNA 4B09A 2X0LA 2P8TA 3K0LA 2GA2A 4M9ZA 3WTZA 1QO0D 5ICEA 3MCZA 1RI7A 2FE3A 3VFZA 1RNLA 3R60A 5CYVA 2L4MA 2VODA 3O3KA 3F8CA 3R0JA 5ICGA 4XLNF 3WE3A 2IA1A 5LGNA 2XAGA 3I5UA 4AIKA 3BJ6A 2J5OA 3CUQA 1G6NA 1MDMA 1TTYA 2VOOA 2VE9A 2R7FA 4CZZA 2VC1A 3WG9A 1I1SA 1KQ9A 1OPCA 1CF7B 4PGHA 2DLLA 5HS8A 2XKOA 2M5WA 2E1CA 2BEOA 2DTRA 3IWZA 3KP3A 3LA3A 4I98B 1Z91A 2CO5A 3I53A 1HQCA 4Q47A 2VE8A 2WV0A 3ERED 1NHAA 1BJAA 5CVRA 2FQ3A 1IXCA 4PZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  3SXY A;  2HDC A;  3T5X A;  2L02 A;  2P6T A;  1FP2 A;  1I27 A;  1UST A;  4JBA A;  4KDP A;  2M87 A;  2MLK A;  2M8E A;  3M9A A;  2DU9 A;  5DDG A;  4WXC A;  1IAW A;  1ZH5 A;  3D5L A;  3KP4 A;  4YIF A;  4I09 A;  1YTY A;  2E7W A;  3HOT A;  2VBZ A;  4UHT A;  1G3T A;  4MGR A;  2MH2 A;  3GXO A;  3AAF A;  2RV8 A;  3WTW C;  3SHF A;  4M6X A;  4HF0 A;  1BC7 C;  5JR3 A;  2ZBK A;  4IRG A;  3KE2 A;  4XSX F;  1MKM A;  1PP7 U;  4DQ2 A;  5DCM A;  1KGS A;  3RTR A;  3PQJ A;  2Z3Y A;  5AIP A;  1J9I A;  3HUG A;  2M30 A;  5BQT A;  3CO6 C;  1XMA A;  2OAZ A;  3KLN A;  3E3V A;  3WTX C;  2E1N A;  1FY7 A;  1J2X A;  1G3S A;  3ECH A;  3TKY A;  3V8J A;  4I0A A;  2ELH A;  2FF4 A;  4EMS A;  2O8X A;  1BOA A;  2F5D A;  1G3Y A;  4ON0 A;  4MQ9 F;  3U2R A;  4YII A;  4HF2 A;  3TDU C;  4Y15 A;  4HOB A;  3J81 K;  2MC3 A;  3CTA A;  3U9G A;  3I4P A;  5L3C A;  3V7R A;  4AVP A;  1YW9 A;  3J80 Z;  2O61 A;  1Z9C A;  3DF8 A;  2IA0 A;  1U8R A;  1O3Q A;  1ZGA A;  4L9T A;  5ED4 A;  3WTS C;  3ABT A;  1D8K A;  2XV4 S;  4M9X A;  4OU0 A;  1R00 A;  4RS8 A;  2BV6 A;  4OOI A;  2QYO A;  2D2W A;  1DUX C;  1VTN C;  5HLG A;  2CSO A;  1DPU A;  5IT9 Z;  2GXB A;  4CO8 A;  4MEX F;  2YX4 A;  2RN7 A;  1WWX A;  2RDP A;  3IHU A;  3RKX A;  1J5Y A;  2H6C A;  2YPR A;  3SFZ A;  2R3S A;  5DCM B;  2Z99 A;  4U0W A;  3W6J B;  2Q8K A;  4N9H A;  2IA2 A;  3M1E A;  2HQR A;  3ZMS A;  1V4R A;  2AXL A;  2D1H A;  2HWV A;  4BYY A;  4U0V A;  3B73 A;  5FFX A;  4FHT A;  1GVJ A;  2OD5 A;  2EFN A;  3F3X A;  1H9G A;  4Z2Y A;  2FOK A;  3ZPL A;  1HSJ A;  2EV6 A;  2A07 F;  5DCF A;  3EYY A;  4TV7 A;  2HTS A;  5FFZ A;  5LRS A;  4IRI A;  2A68 F;  1XB4 A;  3FWE A;  5TJJ A;  4OIR F;  5LGT A;  3KP5 A;  3FM5 A;  1XDS A;  5JI6 A;  1IN5 A;  1FBS A;  1FPQ A;  4G94 A;  1H0M A;  2KIM A;  2G9W A;  1LNW A;  3KZZ A;  4RGS A;  1YO5 C;  3ZN0 A;  3JW4 A;  3HSR A;  2GQQ A;  4D0P A;  2KJC A;  1O57 A;  3R0A A;  1RUO A;  2GXG A;  1XD7 A;  4ZH4 F;  3D0S A;  3EET A;  4KIB A;  1O3S A;  1O7L A;  1SD6 A;  1ULY A;  4L0Y B;  4I0B A;  2EK5 A;  1FSH A;  4ESB A;  4MTD A;  4G7O F;  3MAJ A;  2XAH A;  2JTV A;  3W6K B;  3E5Q A;  1CF7 A;  4IF4 A;  3F23 A;  1QGP A;  4ESJ A;  2P7V B;  4YFK F;  2EA2 A;  2O6G E;  5E8G A;  2XUB A;  3GFM A;  2FA5 A;  1GHC A;  1L3L A;  2QWW A;  6PAX A;  1R5H A;  1XN7 A;  3E97 A;  1UHM A;  1ZAR A;  2PBI A;  1KQ0 A;  1LDK B;  3E6C C;  5H6Q A;  4A2U A;  3QAH A;  5K1Y A;  2YX7 A;  3O2P E;  1F9N A;  1KYW A;  1YQA A;  4A5N A;  2FML A;  1SD4 A;  2J5P A;  1WKM A;  1IXR C;  3SQN A;  1LDD A;  1JGS A;  2EFQ A;  5ERI A;  4LJZ F;  4L9N A;  1OMI A;  1GXP A;  1ON2 A;  1B4A A;  3K2Z A;  3TGN A;  2V6C A;  1LVA A;  5L3F A;  1KYZ A;  3G3Z A;  5HS7 A;  4M71 A;  2H6B A;  1HBX G;  4BQA A;  2XAS A;  1K78 B;  3R61 A;  4HV5 A;  2HFH A;  4HX7 A;  2FXA A;  4BAY A;  1WSU A;  2KIF A;  3ZMZ A;  2JSC A;  2MA3 A;  2QZ8 A;  3I59 A;  4XSZ F;  4ZYE A;  4MTE A;  1Z1D A;  2LKP A;  2UXN A;  2IRF G;  3KLO A;  1IRG A;  2NRA C;  2MH9 A;  4L9J A;  1IW7 F;  4P55 A;  3NRV A;  1K79 A;  2P6S A;  2QQB A;  3GW2 A;  3BPV A;  1MGT A;  4IJA A;  2LF7 A;  4O5V A;  3LQQ A;  2O03 A;  3TO7 A;  1MJB A;  1FYM A;  1D8J A;  3I58 A;  2WTE A;  3L7W A;  3KP2 A;  3RDI A;  1J59 A;  5D5U B;  2JZY A;  4L9V A;  4KIG A;  2HOE A;  5K5R A;  4I01 A;  2DBB A;  2K4J A;  4HW0 A;  1B6A A;  1W5T A;  1S3J A;  2XRO A;  4LG0 A;  1Z6T A;  3JAM Z;  2ZNY A;  3NQO A;  3IRQ A;  2H94 A;  2P7C B;  5AIQ A;  4AWX B;  5DEQ A;  5ICF A;  5FO5 A;  2NYX A;  3DKW A;  1UFM A;  3LFK A;  2LSO A;  2V1U A;  3M8E A;  4Y17 A;  4S05 A;  4WCG A;  5LHG A;  3V8L A;  4RGX A;  4LGW A;  3KFW X;  1SAX A;  1QBJ A;  3MZY A;  1XSX A;  3CUO A;  2MBF A;  2IVM A;  4KN7 X;  5D6E A;  2PI0 A;  5IT3 A;  4EM2 A;  1BIA A;  2RC4 A;  4HLX A;  1LB2 A;  2FBK A;  2DW4 A;  2Y75 A;  3FMR A;  3E5U A;  1P2F A;  1ZG1 A;  1FZP B;  3FHZ A;  2XIG A;  5D8L B;  4LMY A;  1R22 A;  4HA8 A;  1OKR A;  1R5G A;  1QQI A;  4WXD A;  2HTJ A;  2W57 A;  3FMQ A;  3GFJ A;  3IWF A;  1Z7U A;  5D8K B;  3F8F A;  3F8B A;  2OZU A;  5CVV A;  3EQL F;  1UB9 A;  3RKY A;  2LF8 A;  5LEJ A;  1OYW A;  5D4R A;  2IW5 A;  3HRU A;  4EGZ A;  3T1B A;  3QU3 A;  1XMK A;  3NEU A;  2DI3 A;  1QNT A;  2DQL A;  1J75 A;  5ILU A;  3CUQ B;  4RB1 A;  2Z5U A;  4HX4 A;  3LA2 A;  1SFE A;  3IKT A;  4MQV A;  3WGH A;  5BPD A;  2VXZ A;  3CLO A;  3QPH A;  3RYR A;  3JSP A;  3J7A O;  3E5X A;  4A6D A;  4P9U A;  3OV8 A;  3CO7 C;  1V3F A;  4K2E A;  2A6E F;  3FM3 A;  2COM A;  1BI3 A;  3EUH A;  4WWC A;  1WQ2 A;  2F2E A;  2IT0 A;  3MQ0 A;  2HYF A;  5J8C A;  2ISZ A;  2M45 A;  2QVO A;  2DT5 A;  2L54 A;  4EQQ A;  3QP5 A;  4FX4 A;  2STW A;  5ILV A;  2TDX A;  5E18 F;  4GCV A;  1XGM A;  1U6G A;  4EM1 A;  1EH7 A;  5FB2 A;  1KU7 A;  2CYY A;  2HEO A;  5FGM A;  4IHT A;  4U88 A;  3T0Y A;  3K1N A;  5HLH A;  2K86 A;  1EH6 A;  2CFX A;  2E7X A;  1B59 A;  4HX8 A;  5IT9 K;  4M9S A;  5LEK A;  3IKV A;  3RI4 A;  3F72 A;  3J81 Z;  1TLH B;  2PMH A;  1IN6 A;  5J6X A;  3TO6 A;  4A6E A;  1S8N A;  4CHU A;  1HXD A;  2PJP A;  1BI0 A;  2KJB A;  3VOD A;  5L3G A;  3HIF A;  4M72 A;  4CDG A;  2P4W A;  4GYI A;  2ZKZ A;  4N9I A;  1ZG5 A;  2EV0 A;  4XBF A;  1ZYR F;  4G6D A;  5FD6 A;  1RIO H;  2OU2 A;  3ZMT A;  3B02 A;  5F1R A;  4YFN F;  5E17 F;  1TW3 A;  3P9C A;  1FBQ A;  2GZW A;  3GVA A;  4WK8 F;  4UVC A;  4HYE A;  4ZYH A;  2RQP A;  5HVQ C;  1W4M A;  2OQG A;  4RGU A;  4EM0 B;  1T2K A;  3WU1 B;  3QPT A;  4OMY A;  2UZK A;  4FX0 A;  1BI2 A;  2FSW A;  3IL2 A;  3TOA A;  3BY6 A;  4RAZ A;  2G7H A;  3TDZ C;  4ENN A;  1RUN A;  1LDJ A;  1Y0U A;  5DV5 A;  4R1H A;  3HOS A;  2ZFW A;  4P96 A;  4L0Z B;  1S29 A;  1G4D A;  4IPA A;  2AS5 F;  1OR7 A;  1K7A A;  1S6L A;  3I0T A;  2FRH A;  3LST A;  4LB6 B;  1G3W A;  3MEX A;  3OOP A;  1I1G A;  2ACJ A;  2OZ6 A;  3T8T A;  3R6S A;  3RPQ A;  3BJO A;  1XSV A;  4HV6 A;  3BZ6 A;  3WE2 A;  3F6O A;  4ENK A;  1I6X A;  4EJW A;  4GYG A;  1P4W A;  3ML6 A;  3P7N A;  1W7P A;  2ZNZ A;  3WGG A;  5AON A;  2IP2 A;  2Y0M A;  1B9N A;  1HW1 A;  2O3F A;  1U5T C;  4JK1 X;  1KU9 A;  3I54 A;  4LB5 A;  3GFI A;  3V7S A;  4KN4 X;  3CUQ C;  1ON1 A;  1I5Z A;  2F5C A;  1TBX A;  4NQW A;  3ZMV A;  4BXU A;  4EV0 A;  5BMZ A;  5D6F A;  2ZCW A;  1ODD A;  5DUI A;  2P5L C;  5D4S A;  3QOP A;  4LK1 F;  4YFX F;  4ETS A;  4OIQ F;  5HS9 A;  4KFC A;  3I71 A;  3ZN1 A;  1HW5 A;  2O0Y A;  5D5X B;  3SZP A;  1LEB A;  3Q5F A;  4MHG A;  3BPX A;  4O3M A;  3VEP A;  1WRJ A;  4CXF A;  2XKP A;  2EFW A;  4U7D A;  3VOE A;  4HDU A;  4BNC A;  2VC0 A;  4ZYD A;  3HHH A;  2Q0O A;  4PCQ A;  4HQM A;  3WU0 A;  3BDD A;  3LQR A;  4BHC A;  5E1W A;  1KU3 A;  3KP7 A;  5H20 A;  4FT8 A;  2HKO A;  2CG4 A;  2FMY A;  5DUK A;  2C6Y A;  2V1D A;  2VBY A;  4Q48 A;  1F4K A;  3GYH X;  2K02 A;  1FT9 A;  5JHU A;  1R58 A;  3HTU A;  1F5T A;  1WI9 A;  2NS0 A;  1P4X A;  4Q4Z F;  3WTT C;  3H3Z A;  2KRF A;  3KCC A;  5DD8 A;  2BBY A;  3CJN A;  4B8X A;  3ELK A;  3KEO A;  1DPR A;  1STZ A;  2L4A A;  4EJO A;  1T38 A;  2CQK A;  4OIO F;  1MJ9 A;  1YS6 A;  4R8H A;  2L01 A;  1HKS A;  4IHS A;  2F5E A;  3KET A;  2A61 A;  3HRT A;  4LK0 F;  1EV7 A;  2BGC A;  3V4G A;  3GZ5 A;  4A0Y A;  3U1D A;  3ZMU A;  3JTG A;  3LAJ A;  3HRS A;  1ZGJ A;  1TW2 A;  1FYK A;  2KKO A;  4KMF A;  5BS6 A;  1BIB A;  2IPQ X;  4KT5 C;  2ESH A;  1SFU A;  4XLP F;  3SZT A;  3ULQ B;  1BN5 A;  3FXU A;  2GA1 A;  4LLG F;  2XAF A;  3BJA A;  4GXO A;  1IXS B;  1R1V A;  1R7J A;  3H3U A;  2Y48 A;  4EJT A;  1TQP A;  4LD5 A;  2DK5 A;  5K5Q A;  4M74 A;  4KIC A;  4KYW A;  3JSO A;  1U5T B;  1ZRC A;  3QRF F;  2EA4 A;  5EEH A;  5E1X A;  3FXQ A;  1ZHF A;  3FXR A;  3S2W A;  4KUM A;  1MJA A;  1MDM B;  4ZZL A;  2L3D A;  3VB2 A;  4S04 A;  4M6Y A;  2A5Y B;  5DD4 A;  1OYI A;  4HAM A;  1TNT A;  4HBL A;  3K69 A;  4H0E A;  5LHH A;  3F6V A;  1O3R A;  4BHP A;  2V9V A;  1B1B A;  2CW0 F;  1ZG3 A;  2QBY A;  5F64 A;  3E6B A;  4G7H F;  4EVI A;  3L9F A;  3R4K A;  2B0L A;  1Q1H A;  2HYG D;  3EDP A;  1R23 A;  1ZAO A;  1MD0 A;  3BRO A;  4RB0 A;  2QQA A;  1YW8 A;  2HZT A;  4WF2 A;  4EGY A;  1YLF A;  2HS5 A;  4L5I A;  3F22 A;  1AOY A;  1LEA A;  5E20 A;  1ZLJ A;  1O7F A;  1UHW A;  4Y13 A;  3GEZ A;  4HLY A;  1FYL A;  2PFB A;  2Z9O A;  5L3D A;  1BBY A;  2ETH A;  2FNP A;  3L00 A;  4G7Z F;  4A5M A;  2D1V A;  3ROU A;  2EFO A;  4OIP F;  5LGU A;  1P92 A;  3KEQ A;  2KIU A;  2VON A;  1PUE E;  5HDK A;  4Q5S F;  1U3E M;  1L0O C;  3ZMD A;  5CLS A;  5EEG A;  1T0F A;  3DFG A;  1C0W A;  2VT3 A;  3HYI A;  5KVR A;  3TOB A;  2VOP A;  5LBQ A;  1XCB A;  4IRH A;  5ICC A;  5A2Q K;  3HRM A;  1R1T A;  3GO5 A;  1ZRE A;  5FLX K;  4UV8 A;  2ZXJ A;  3GWZ A;  3RKW A;  1QZZ A;  2DK8 A;  1XCV A;  4I2O A;  3FZV A;  1P4A A;  2FNA A;  3DXJ F;  4XRF A;  3MFK A;  4HF1 A;  4ESF A;  4RGR A;  1S7A A;  2JPC A;  5HLI A;  1JHF A;  3ABU A;  1S7O A;  5H6R A;  2YU3 A;  2ZJ2 A;  1ZRF A;  3BWG A;  4G6Q A;  5D5V B;  2HR3 A;  2NAZ A;  2ISY A;  3E6D A;  4A0X A;  3ISP A;  1W5S A;  2EJR A;  2ZME A;  1KA8 A;  1Z6R A;  4R79 A;  1SFX A;  1MZB A;  1FC3 A;  2QBY B;  5K5O A;  3LWF A;  5F6F A;  2XAJ A;  2LDU A;  2JPB A;  2XAQ A;  3FX3 A;  3K1M A;  1TNS A;  3HSF A;  5HDG A;  4LG0 B;  4I7H A;  3PFI A;  4UVB A;  1ONV A;  5KK1 A;  4UNO A;  5ILS A;  2PQ8 A;  1YW7 A;  2WWY A;  1UCR A;  3EYI A;  4UUV A;  1IZ1 A;  1U2W A;  2W84 A;  4MNU A;  1U5T A;  3MWM A;  2PLY A;  2M1B A;  1D5V A;  1JHH A;  3HHG A;  2XVC A;  3GLX A;  4I02 A;  2EWN A;  1P6R A;  1JE8 A;  4CIC A;  4OMZ A;  1RZ4 A;  1K6O A;  3WGI A;  4KA4 A;  2UWM A;  4HQE A;  3JAM K;  3GX4 X;  2FU4 A;  3JTH A;  3LAP A;  2IJL A;  5E1Z B;  2EFP A;  3LA7 A;  5L3E A;  4P5O A;  1HW2 A;  2W25 A;  4OIN F;  1IRF A;  1R36 A;  1U78 A;  5JFR A;  1ZRD A;  4NB5 A;  2JRT A;  3REO A;  1W7P D;  2LNB A;  1FX7 A;  1LJ9 A;  2HGC A;  2R7D A;  3WTY C;  2VBW A;  2FEZ A;  4ENM A;  1T98 A;  5TRD A;  1YYV A;  1ZLK A;  1EH8 A;  2XGX A;  3J80 K;  4P9F A;  2XRN A;  4PGG A;  4BHB A;  4G9Y A;  5BPI A;  4KNY A;  1OYY A;  3QP6 A;  4QLC U;  1JXS A;  3HTS B;  1BI1 A;  2P5K A;  2GIV A;  3CDH A;  2PG4 A;  2FBH A;  3RJP A;  2K27 A;  2Z33 A;  2QEN A;  1O3T A;  4M73 A;  4U7B A;  5DYM A;  3M7G A;  3O6B B;  1XGS A;  2F5F A;  2CGP A;  2BYV E;  3COA C;  4YG2 F;  4CYD A;  3GZ6 A;  3IRR A;  5L3B A;  2Q2E A;  2V79 A;  3HSE A;  2UXX A;  3C3W A;  1FWZ A;  2X4H A;  3Q9V A;  3L2C A;  4EJV A;  4JQF A;  1FLI A;  2DAO A;  2DQR A;  2STT A;  1FP1 D;  2CWE A;  3GFL A;  2OA4 A;  3BP8 A;  1PP8 F;  2DPD A;  3ZP5 A;  1TQM A;  3C7J A;  2H27 A;  2NNN A;  3IC7 A;  4KIF A;  1USS A;  3GUD A;  4N0B A;  5CVJ A;  4PDK A;  5CVI A;  5HDN A;  1IN4 A;  1LQ1 A;  1SD5 A;  2EV5 A;  2D45 A;  1XGN A;  3DPT A;  1B9M A;  1YFH A;  3DQV C;  2PN6 A;  4LFU A;  4ZZD A;  2JT1 A;  1BM9 A;  1E2X A;  3C1D A;  2K7L A;  2XHK A;  1SMT A;  4LLN A;  1YS7 A;  4A0Z A;  1FSE A;  1R1U A;  3H92 A;  5A2Q Z;  3F8M A;  3P9I A;  4ENJ A;  2QUF A;  5LHI A;  3MZH A;  3DV8 A;  4IXA A;  2EB7 A;  4MEY F;  1DDN A;  3T8R A;  4WXH A;  5E8I A;  2HKX A;  5BOX A;  5FLX Z;  4IVN A;  5JVT A;  2A6H F;  3I64 A;  3RPU A;  4A12 A;  3Q9S A;  3FMS A;  5LRR A;  4AIH A;  4G8X A;  3KP6 A;  4O6J A;  2VT2 A;  3V8K A;  1YIO A;  1KU2 A;  2WC2 A;  1J7K A;  3ZQ7 A;  2GWR A;  1XDU A;  4HZF A;  1F1Z A;  1FBU A;  4DNC A;  1ZN2 A;  1IF1 A;  1FOK A;  1DP7 P;  1QZY A;  2QLZ A;  1IN7 A;  2NNY A;  2PEX A;  3DEU A;  3E6M A;  1SMY F;  2ZME B;  4UXN A;  2MD5 A;  4CGZ A;  3TO9 A;  1REP C;  1X3U A;  2QQ9 A;  1GXQ A;  3N4M A;  4RB2 C;  1HST A;  3P9K A;  1D3Y A;  5FD5 A;  2OBP A;  3PQK A;  1YG2 A;  3ECO A;  5D5W B;  5LLQ A;  4KMU X;  2V1X A;  3N97 A;  4RB3 C;  5CJ9 A;  4LLL A;  1XGO A;  4F7Z A;  2RGV A;  4ZYG A;  4AIJ A;  3RIR A;  1E17 A;  2W24 A;  4AD9 A;  3F8N A;  5HOO A;  1T39 A;  4RAY A;  2DO7 A;  2ADU A;  1FNN A;  4EJU A;  3GF2 A;  3K9T A;  1BC8 C;  4QWQ A;  4GGG A;  3WTV C;  4BH9 A;  1QPM A;  2RNJ A;  4ASN A;  2G7U A;  5J8F A;  1T6S A;  1HKQ A;  1Z05 A;  1K78 A;  2W85 A;  2VBX A;  2ESN A;  3QU6 A;  4E70 A;  1A04 A;  2BE5 F;  3F21 A;  2P5V A;  2FBI A;  3M8F A;  2QM3 A;  3WOD F;  4L5J A;  3KZY A;  3L09 A;  3RYP A;  2YSR A;  3FF5 A;  1W7P B;  1HKT A;  1XSD A;  2PMU A;  1AWC A;  4GO1 A;  1SD7 A;  2H09 A;  3BOQ A;  2ZO4 A;  2A69 F;  2RKH A;  3I59 B;  1CGP A;  1PDN C;  3DPL C;  4U0Y A;  3WTU C;  1KQ8 A;  5CVU A;  3K1P A;  2OQR A;  1IN8 A;  2K4B A;  1J0R A;  3V7C A;  4HDV A;  4WX9 A;  2VN2 A;  3G73 A;  2GAU A;  2HQN A;  2DPU A;  1TQI A;  2YR2 A;  4UVA A;  3DP7 A;  2MLG A;  4L18 B;  2RVC A;  4UV9 A;  1IUY A;  2DFI A;  2A3S A;  4NHJ A;  1H9T A;  3TQN A;  4B09 A;  2X0L A;  2P8T A;  3K0L A;  2GA2 A;  4M9Z A;  3WTZ A;  1QO0 D;  5ICE A;  3MCZ A;  1RI7 A;  2FE3 A;  3VFZ A;  1RNL A;  3R60 A;  5CYV A;  2L4M A;  2VOD A;  3O3K A;  3F8C A;  3R0J A;  5ICG A;  4XLN F;  3WE3 A;  2IA1 A;  5LGN A;  2XAG A;  3I5U A;  4AIK A;  3BJ6 A;  2J5O A;  3CUQ A;  1G6N A;  1MDM A;  1TTY A;  2VOO A;  2VE9 A;  2R7F A;  4CZZ A;  2VC1 A;  3WG9 A;  1I1S A;  1KQ9 A;  1OPC A;  1CF7 B;  4PGH A;  2DLL A;  5HS8 A;  2XKO A;  2M5W A;  2E1C A;  2BEO A;  2DTR A;  3IWZ A;  3KP3 A;  3LA3 A;  4I98 B;  1Z91 A;  2CO5 A;  3I53 A;  1HQC A;  4Q47 A;  2VE8 A;  2WV0 A;  3ERE D;  1NHA A;  1BJA A;  5CVR A;  2FQ3 A;  1IXC A;  4PZJ A; 
#chains in the Genus database with same CATH topology
 3C18 A;  3IH2 A;  3CCQ I;  3SXY A;  2HDC A;  3T5X A;  2L02 A;  2P6T A;  1FP2 A;  1I27 A;  1UST A;  4JBA A;  4BAC A;  4KDP A;  2LR8 A;  1WJE A;  2M87 A;  1OCT C;  2MLK A;  2M8E A;  3M9A A;  1O4X A;  2MFZ A;  2DU9 A;  1X58 A;  5DDG A;  4WXC A;  2WAQ A;  3ZRG A;  1IAW A;  1MSE C;  1ZH5 A;  2HXO A;  3D5L A;  3KP4 A;  1PJR A;  4RA2 A;  4YIF A;  4I09 A;  2VJ4 A;  1JI8 A;  1YTY A;  4RM2 A;  2E7W A;  1QU3 A;  2IBD A;  1B8I B;  3HOT A;  5F0F A;  3CMM A;  1GUU A;  2VBZ A;  4UHT A;  3FDY A;  1G3T A;  4MGR A;  2PX9 A;  3H35 A;  2MH2 A;  1SEU A;  3CLQ A;  1GT0 C;  3GXO A;  3AAF A;  3H1C A;  2OUM A;  2RV8 A;  3WTW C;  3SHF A;  2LFB A;  4RDU A;  4M6X A;  3PFY A;  1MH4 A;  4HF0 A;  1BC7 C;  5JR3 A;  2ZBK A;  2OC6 A;  3WHB A;  4IRG A;  2R7Q A;  2X48 A;  3KE2 A;  4XSX F;  4M6V A;  5IYB J;  4A3L J;  1MKM A;  3OYK A;  1PP7 U;  1ZTR A;  4DQ2 A;  5DCM A;  3GTG J;  2M2E A;  2Y9Z A;  1KGS A;  2Y0S N;  2WY8 Q;  3RTR A;  3PQJ A;  4XID A;  1X4P A;  4E7H A;  2D5V A;  2Z3Y A;  2V7F A;  5AIP A;  2CUE A;  1J9I A;  3HUG A;  2X6W A;  3ZQF A;  1VQL I;  2ZME C;  2M30 A;  5BQT A;  3CO6 C;  1XMA A;  2OAZ A;  3KLN A;  1S72 I;  3KYC B;  1Z21 A;  5F0C A;  3E3V A;  1MBF A;  3WTX C;  2E1N A;  1J2X A;  1FY7 A;  1Z0X A;  1V5G A;  3O8G A;  1QVT A;  1G3S A;  3ECH A;  1MMS A;  3TKY A;  3V8J A;  4I0A A;  3VYT B;  3S3O A;  5B1B H;  3CJR B;  2ELH A;  1D1B A;  2FF4 A;  4EMS A;  1XS9 A;  2O8X A;  2QGU A;  5J4Y A;  2K3P A;  1BOA A;  4CA0 A;  2CFO A;  2F5D A;  5CQE A;  1G3Y A;  2L7Z A;  4JYK A;  2WB1 A;  4ON0 A;  2CMP A;  3ZR8 X;  4MQ9 F;  1W36 D;  5TGT A;  3U2R A;  2JA2 A;  3M07 A;  4YII A;  3ZQG A;  5M5X J;  4HF2 A;  3TDU C;  4FAS D;  2XF5 A;  2XGD A;  4Y15 A;  2HOT A;  4HOB A;  3J81 K;  3CD6 I;  1V5F A;  2MC3 A;  3CTA A;  2IEK A;  3U9G A;  3I4P A;  2VPR A;  5L3C A;  2NVX J;  1MBK A;  1RRJ A;  4A3G J;  2DA3 A;  3V7R A;  3GTK J;  4AVP A;  1YW9 A;  1X19 A;  3J80 Z;  2O61 A;  3DEE A;  1Z9C A;  4RAF A;  2JVH A;  2KT0 A;  5KCM A;  3DF8 A;  3FHN A;  2VQG A;  2IA0 A;  1U8R A;  1E0E A;  1O3Q A;  1WGX A;  1ZGA A;  4L9T A;  5ED4 A;  3WTS C;  3ABT A;  2BOL A;  1BJZ A;  4PFO A;  3JRF A;  1D8K A;  2XV4 S;  3OYL A;  4YEJ A;  2KRH A;  4M9X A;  4OU0 A;  1R00 A;  4RS8 A;  2BV6 A;  4OOI A;  3LFU A;  3K4M A;  2QYO A;  2D2W A;  1MSF C;  1DUX C;  5FJ8 J;  1VTN C;  5HLG A;  2Y2Z A;  3IP4 B;  1M1E B;  2CSO A;  1DPU A;  5IT9 Z;  3F9K A;  3TL4 X;  4E7I A;  4PUS A;  1CQT A;  3CDI A;  1ZQ3 P;  2GXB A;  4LIV A;  4IQ4 A;  4CO8 A;  3BR0 A;  4MEX F;  4FQG A;  2M7A A;  2YX4 A;  3X2Q H;  1A6I A;  2RN7 A;  1WWX A;  2RDP A;  4A3M J;  1VQ6 I;  3IHU A;  1YJW I;  2DMT A;  1J5Y A;  2FX0 A;  2HZD A;  3RKX A;  2LOO A;  1FIP A;  2H6C A;  1JT6 A;  2YPR A;  3SFZ A;  4RLF A;  2X6X A;  2R3S A;  3G6E I;  5DCM B;  4BQN A;  2Z99 A;  2ID3 A;  1WVR A;  2ZB9 A;  4U0W A;  5E3M A;  3W6J B;  2HDD A;  2W7N A;  2Q8K A;  3A03 A;  4N9H A;  3EUK L;  2IA2 A;  3BG7 A;  3M1E A;  1KON A;  2HQR A;  1K61 A;  1FTZ A;  3AL0 C;  3ZMS A;  3H36 A;  1S5L C;  3PNV A;  2A05 A;  2LRE A;  5IYC J;  1E3O C;  3TW6 A;  4IZZ A;  1OCO H;  1V4R A;  2AXL A;  2D1H A;  2HWV A;  4A3B J;  4JOM A;  4BYY A;  4U0V A;  4B48 A;  3SDB A;  3SEZ A;  3B73 A;  3G1L A;  5FFX A;  4FHT A;  2LD5 A;  4KIS A;  2V1N A;  5J1U A;  4BS9 A;  3PO2 J;  4UUS A;  3CC4 I;  1GVJ A;  4XQF A;  3DPU A;  2OD5 A;  4NBQ A;  2ZXI A;  2EFN A;  3MVP A;  2DN0 A;  3F3X A;  2LLK A;  5FLM J;  1H9G A;  4Z2Y A;  2B9S A;  2FOK A;  3ZPL A;  1HSJ A;  4II3 A;  2Y69 H;  2EV6 A;  2A07 F;  3RQI A;  4ITV A;  4ABZ A;  5DCF A;  4EAT A;  3EYY A;  4TV7 A;  2HTS A;  3S2H J;  5FFZ A;  1UMQ A;  5LRS A;  1H8A C;  2F48 A;  1WZ2 A;  4IRI A;  3OS2 A;  4UY8 I;  2A68 F;  5GAG J;  2IGK A;  2KIQ A;  3H9Q A;  3BR6 A;  3QYE A;  5F08 A;  3G4S I;  2QKM B;  1XB4 A;  3FWE A;  5TJJ A;  4OIR F;  5LGT A;  3KP5 A;  3FM5 A;  1XDS A;  3K4C A;  4FIS A;  4HNT A;  2R7R A;  5JI6 A;  1IN5 A;  3H0G J;  1FBS A;  1FPQ A;  1I39 A;  2BXY A;  4G94 A;  3MKW B;  2JA8 J;  1H0M A;  2KIM A;  1T8I A;  3NWS A;  2G9W A;  1TZL A;  2B7E A;  2CQ7 A;  1LNW A;  2YS9 A;  3KZZ A;  3OYI A;  3HL2 A;  4X6A J;  1WFX A;  4RGS A;  1YO5 C;  1GDT A;  2XB5 A;  3ZQC A;  3CC7 I;  3ZN0 A;  3BR1 A;  3JW4 A;  5EGO B;  1YIJ I;  1JJ8 C;  4YEL A;  3HSR A;  1G2H A;  2GQQ A;  4D0P A;  2KJC A;  1O57 A;  3R0A A;  2DFE A;  2W82 A;  2HNH A;  4F52 A;  4B4C A;  3K70 D;  2MGQ A;  1RUO A;  2GXG A;  2DXI A;  1XD7 A;  2X1E A;  3Q0U A;  5F1J A;  1H89 C;  1Z77 A;  1GV5 A;  4FE4 A;  2DA6 A;  4CH7 A;  1EKE A;  4ZH4 F;  3D0S A;  3EET A;  4KIB A;  1O3S A;  3CCS I;  1O7L A;  3L1P A;  1SD6 A;  1JTX A;  1ULY A;  4XLE A;  4L0Y B;  3M1C A;  4PJL A;  4I0B A;  4P1W A;  2EK5 A;  1FSH A;  2LMD A;  1QHH D;  2OF7 A;  4ESB A;  2AO9 A;  4MTD A;  4BBS J;  1R9T J;  3HKZ N;  1JKP C;  4G7O F;  3MAJ A;  2XAH A;  2K3F A;  3HOW J;  2JTV A;  1VZ0 A;  3MZ8 A;  1JTY A;  3W6K B;  3E5Q A;  1XTA A;  1TL8 A;  1CF7 A;  2CQX A;  1V54 H;  4IF4 A;  3ZGK A;  3OMY A;  4Y52 J;  3F23 A;  1JKO C;  1QGP A;  4ESJ A;  2P7V B;  1XX5 A;  4V2G A;  3OYC A;  3OYM A;  1SFK A;  3E7L A;  4YFK F;  1VI0 A;  2E34 A;  3LSR A;  1XPX A;  2EA2 A;  2LH9 A;  2GLO A;  2M4K A;  3VYS B;  2O6G E;  3FXK A;  1N25 A;  5E8G A;  3VDX A;  2XUB A;  5KAF C;  2IGO A;  5J3L A;  3CCM I;  3E0J B;  3GFM A;  2FA5 A;  1GHC A;  3AG4 H;  1ZEL A;  1L3L A;  3JRA A;  3HGY A;  2QWW A;  2P0W A;  6PAX A;  5GAE J;  1R5H A;  1XN7 A;  2WAF A;  1IV6 A;  1WCM J;  3E97 A;  2KP6 A;  1UHM A;  1ZAR A;  3OIO A;  1YRN A;  2PBI A;  1KQ0 A;  1X1P A;  2RAE A;  1LDK B;  1WJB A;  4XL9 A;  3OS1 A;  3E6C C;  5H6Q A;  4A2U A;  3QAH A;  2L9N A;  3GTP J;  5K1Y A;  2YX7 A;  3O2P E;  4XMY A;  4UB8 C;  3KPH A;  1F9N A;  1KYW A;  3IAM 2;  1YQA A;  3HPG A;  2VLA A;  4A5N A;  2FML A;  1SD4 A;  1ERD A;  2RRE A;  1J09 A;  2J5P A;  1WKM A;  1IXR C;  1U9O A;  1IRX A;  2UV1 A;  3SQN A;  2GOX B;  4YRV A;  2IGM A;  2JMW A;  4M3G A;  1LDD A;  1IJW C;  3K4J A;  1JGS A;  3A2K A;  1ETY A;  2EFQ A;  5ERI A;  4DOZ A;  3K70 C;  4LJZ F;  4E6K G;  4L9N A;  1OMI A;  1GXP A;  1ON2 A;  3P5J A;  1B4A A;  4IO9 F;  5E79 C;  1WJC A;  4V19 K;  3K2Z A;  3TGN A;  2K85 A;  5C3E J;  2V6C A;  1LVA A;  1VQM I;  5L3F A;  4CYC A;  1KYZ A;  3G3Z A;  5HS7 A;  4M71 A;  3KYL A;  2H6B A;  1HBX G;  4BQA A;  2BXZ A;  2XAS A;  4C9Y A;  3R61 A;  1K78 B;  4HV5 A;  2HFH A;  4HX7 A;  4MIM A;  2KL4 A;  3LSI A;  2E5N A;  2FXA A;  4BAY A;  1S7E A;  2MD0 A;  1WSU A;  4E7Z A;  2KIF A;  3ZMZ A;  2DMU A;  1T33 A;  2JSC A;  3ESW B;  3TP3 A;  2MA3 A;  2QZ8 A;  4OWR B;  3I59 A;  4XSZ F;  4ZYE A;  4I76 A;  4MTE A;  3CME I;  1JT0 A;  1Z1D A;  3I3L A;  3GLL A;  2LKP A;  2BHZ A;  2X51 A;  1MMD A;  3PJR A;  1RPW A;  2JJ7 A;  1ETO A;  1JUP A;  2UXN A;  2ZJP F;  4QSH A;  2IRF G;  3KLO A;  1IRG A;  3PIO F;  2NRA C;  2MH9 A;  4L9J A;  1IW7 F;  4P55 A;  3NRV A;  4X1E A;  1K79 A;  4NQW B;  1LPQ A;  5EDN A;  2IXS A;  2P6S A;  3BZC A;  2QQB A;  3LSM A;  3GW2 A;  3BPV A;  2JWT A;  2EIN H;  2ICW G;  4J19 A;  4PFP A;  1MGT A;  2R7W A;  3KZI C;  2LF7 A;  1OIS A;  2MG4 A;  4IJA A;  4O5V A;  4QIW N;  1V5E A;  3LQQ A;  1AA7 A;  5DM7 F;  2O03 A;  3TO7 A;  1MJB A;  3RZO J;  2L9V A;  1FYM A;  4NNJ A;  3CC2 I;  2WAE A;  1D8J A;  3I58 A;  1ORK A;  3SJM A;  1R5I D;  2WTE A;  3L7W A;  3KP2 A;  3RDI A;  1J59 A;  4OAZ A;  5D5U B;  2JZY A;  4L9V A;  1T0F C;  4KIG A;  4IOA F;  2HOE A;  5K5R A;  4BDZ A;  4I01 A;  2DBB A;  2EZL A;  3I4N J;  1FOY A;  5EYR A;  2K4J A;  4ZC3 A;  4HW0 A;  1BR4 A;  1B6A A;  3CCR I;  2HI3 A;  1W5T A;  9ANT A;  1S3J A;  1FEX A;  4XLA A;  2W1O A;  1TT5 B;  2XRO A;  3UKG A;  4LG0 A;  2XDV A;  1Z6T A;  3A01 B;  1OR7 C;  3OR2 C;  3I56 I;  2F4O B;  3JAM Z;  2ZNY A;  3KEY A;  3NQO A;  2XAU A;  3K2A A;  3IRQ A;  4J01 A;  4CSW A;  2H94 A;  1JUS A;  5JHF A;  2P7C B;  5AIQ A;  2E2H J;  1TWG J;  1X3W B;  3BC8 A;  4AWX B;  5DEQ A;  1R4N B;  4G6T B;  1DU0 A;  2DOE A;  5FO5 A;  2BVL A;  5ICF A;  3A01 A;  2N8G A;  2CV0 A;  2NYX A;  3DKW A;  2HYJ A;  3FXM A;  1UFM A;  3LFK A;  2LSO A;  3PIP F;  1BR1 A;  1BOB A;  3I55 I;  3AL0 B;  3M8J A;  1SFO J;  3PO3 J;  2V1U A;  4D7M A;  2GIZ A;  3W3C A;  3M8E A;  4Y17 A;  2CH0 A;  3FK6 A;  1VQN I;  4S05 A;  4WCG A;  5LHG A;  3V8L A;  4RGX A;  4LGW A;  3TW7 A;  3KFW X;  3NWT A;  1BW6 A;  1SAX A;  3FKI J;  1QBJ A;  3MZY A;  1XSX A;  2VQL A;  3CUO A;  2MBF A;  4AID A;  3BLY A;  4XIC A;  2M4G A;  3DWL E;  2IVM A;  3M4O J;  3GBG A;  3CF2 A;  1Y8R B;  4KN7 X;  3GTM J;  2Z1D A;  5D6E A;  2HQ5 A;  2L0K A;  2PI0 A;  3SEQ A;  3PNY A;  5IT3 A;  4EM2 A;  1BIA A;  2F4M B;  2RC4 A;  3QQA A;  1MBG A;  4HLX A;  1DGR M;  4EEF G;  4DW6 A;  5EZG A;  5HNH A;  1LB2 A;  2LP0 A;  2FBK A;  4C2M J;  1AKH B;  4C3H J;  2DW4 A;  2LC2 A;  2BY2 A;  2Y75 A;  1BW5 A;  3FMR A;  3E5U A;  2IS6 A;  1P2F A;  1ZG1 A;  1YJN I;  1FZP B;  3HUG B;  2NS7 A;  4HNV A;  4NDL A;  3FHZ A;  1FIA A;  2XIG A;  5D8L B;  4BL0 B;  4LMY A;  4DZP A;  1R22 A;  1VQ8 I;  4HA8 A;  2LG4 A;  5C4J J;  2WY7 Q;  2L5Q A;  2ME0 A;  4M3E A;  1DGW Y;  1OKR A;  1R5G A;  2AQF A;  3Q0V A;  3W6V A;  4XRM A;  1QQI A;  2VKE A;  2KZV A;  4WXD A;  4IKF A;  3DTI A;  2HTJ A;  2W57 A;  3FMQ A;  3BTL A;  1W1W E;  2E36 A;  3H9J A;  3GFJ A;  2X1D A;  3IWF A;  2LKX A;  1Z7U A;  5D8K B;  3LOC A;  3F8F A;  3F8B A;  2OZU A;  5CVV A;  1LFB A;  4BY7 J;  1SVM A;  3EQL F;  5EZH A;  1UB9 A;  3RKY A;  2LF8 A;  5LEJ A;  1OYW A;  3OOU A;  4D5C A;  5D4R A;  2IW5 A;  2DFF A;  2DT7 B;  3HRU A;  4XN0 A;  4EGZ A;  1N77 A;  3T1B A;  4IHX A;  1FOX A;  5GP9 A;  3H0D A;  4CCO A;  3QU3 A;  1XMK A;  4XK4 A;  5B3S H;  2CV1 A;  3BTI A;  4A3C J;  4JX4 A;  1D0Y A;  2Y9Y A;  3NEU A;  2DI3 A;  3HBL A;  1QNT A;  1Z67 A;  3D1N I;  1MBE A;  4E7L A;  2DQL A;  1J75 A;  5ILU A;  2V9P A;  2EBI A;  3CUQ B;  3HKZ A;  5GPC A;  5DS9 A;  2HVQ A;  1FOW A;  2H8W A;  5K7F A;  3S1Q J;  1LKX A;  4RB1 A;  2Z5U A;  4HX4 A;  4I99 C;  1Y1W J;  1VND A;  3IAS 2;  3LA2 A;  1SFE A;  3IKT A;  1IDZ A;  5TIS C;  4MQV A;  3TBI A;  2HOS A;  1FMW A;  3HEF A;  5H2F C;  3QOD A;  3S32 A;  3WGH A;  4BKX A;  3IV5 A;  4FCY A;  5BPD A;  2VXZ A;  3C2G A;  1MNE A;  2XRL A;  1YOV B;  4IHV A;  3OYG A;  3CLO A;  3QPH A;  3RYR A;  3JSP A;  3J7A O;  2I8D A;  3HG9 A;  3PNT A;  3RSN A;  2JA6 J;  4BEH A;  4AVZ A;  3E5X A;  5B66 C;  4H4K C;  1LUJ B;  2NVY J;  4A6D A;  4P9U A;  2DDA A;  1BA5 A;  3OV8 A;  3CO7 C;  3OYB A;  3OYN A;  1V3F A;  3S2D J;  1QHG A;  4K2E A;  2DA5 A;  2A6E F;  1N78 A;  3FM3 A;  4QPO A;  5CPR B;  3UNG C;  2COM A;  1BI3 A;  2EH3 A;  3EUH A;  2DOF A;  4WWC A;  5IOZ A;  2VL8 A;  3H5N A;  1WQ2 A;  2F2E A;  2IT0 A;  1F43 A;  3MQ0 A;  2HYF A;  1MW7 A;  2Z2S B;  2PJR A;  5J8C A;  2ISZ A;  3OS0 A;  2M45 A;  3S14 J;  5IYD J;  2QVO A;  3V42 A;  3C2B A;  4J00 A;  4DJA A;  2DT5 A;  4CCM A;  5J40 A;  2IS2 A;  5JLW A;  3BCA A;  3W2W A;  2L54 A;  4EQQ A;  3QP5 A;  2R92 J;  1RKT A;  2DDB A;  2R5Z B;  2M3A A;  4FX4 A;  3HOZ J;  2STW A;  1X2M A;  2Q2E B;  5ILV A;  2TDX A;  5E18 F;  4RAG A;  4GCV A;  3LSK A;  4ZDP A;  1MMN A;  1U9N A;  3LL7 A;  5M3F J;  1XGM A;  1U6G A;  4AYB A;  4EM1 A;  3KX2 A;  1EH7 A;  2VQC A;  2Y31 A;  3EUH C;  5FB2 A;  1KU7 A;  2CYY A;  2HEO A;  1HC8 A;  5GAH J;  5FGM A;  4IHT A;  1VQP I;  4U88 A;  4IEJ A;  3T0Y A;  3Q0W A;  2L7K A;  4C3J J;  4W97 A;  1MH3 A;  1TWA J;  3K1N A;  5HLH A;  2ELJ A;  1PVE A;  2K86 A;  1EH6 A;  2WAD A;  2ME6 A;  2CFX A;  2E7X A;  1B59 A;  4HX8 A;  1OFC X;  5IT9 K;  2XPV A;  3ABK H;  4M9S A;  3Q3S A;  5LEK A;  4A3E J;  2L9R A;  3IKV A;  1OJL A;  3OL3 A;  3RI4 A;  1NK3 P;  3F72 A;  2QQ8 A;  1UG0 A;  4DIQ A;  4BGD A;  3J81 Z;  1TLH B;  4A3I J;  2PMH A;  3H5A A;  1IN6 A;  3HJE A;  5J6X A;  3TO6 A;  4A6E A;  5FRM A;  4S0H B;  3K4B A;  1S8N A;  1T95 A;  5E3N A;  4CHU A;  1HXD A;  2PJP A;  1BI0 A;  4PJM A;  1B72 B;  3QPS A;  3IUO A;  3FBI B;  2KJB A;  3VOD A;  5L3G A;  3CJT B;  2B63 J;  2G0E A;  3HIF A;  4M72 A;  4AYB N;  4CDG A;  4LIU A;  2P4W A;  4GYI A;  3DTE A;  3FK7 A;  2ECB A;  2ZKZ A;  5KHD A;  4XRS A;  4N9I A;  2KHM A;  4HPQ A;  3AG1 H;  2KQR A;  3DCF A;  3W2A A;  4C2T A;  1ZG5 A;  3TED A;  2VPL A;  5J47 A;  2EV0 A;  2I10 A;  4L5E A;  4XBF A;  3GCM A;  1XC5 A;  3E1S A;  1ZYR F;  4C2U A;  2WA0 A;  4G6D A;  2R7S A;  5FD6 A;  5FKK A;  5EGO A;  2AHQ A;  5J1Y A;  1RIO H;  2OU2 A;  3ZMT A;  4E7K A;  4W1U A;  4UUS B;  3B02 A;  1LE8 B;  5F1R A;  2BVM A;  1AKH A;  4YFN F;  1V55 H;  5E17 F;  1TW3 A;  2FQ4 A;  1ACI A;  5FRO A;  3P9C A;  1YIT I;  1FBQ A;  2GZW A;  4N4N B;  4ZTJ A;  1IG7 A;  1QPI A;  3GVA A;  3CMY A;  4WK8 F;  4UVC A;  3DKX A;  4Z6Y A;  5J1R A;  4HYE A;  2H1L A;  3FIW A;  5KAI C;  4ZYH A;  1H88 C;  2RQP A;  3CDL A;  5HVQ C;  1W4M A;  1RKW A;  2OQG A;  3VYU B;  4RGU A;  4EM0 B;  3G2B A;  1T2K A;  3WU1 B;  1JUM A;  2CUZ A;  3GTO J;  3QPT A;  2DOD A;  2K9L A;  4XOT A;  4OMY A;  2UZK A;  3A0H C;  4FX0 A;  1BI2 A;  4KIT B;  2FSW A;  3HZJ A;  2NXN B;  3IL2 A;  1JJ6 C;  3TOA A;  3BY6 A;  4A93 J;  4RAZ A;  1E3P A;  2G7H A;  3TDZ C;  4NUB A;  4ENN A;  2VJI A;  1RUN A;  1LDJ A;  1Y0U A;  4CCN A;  5DV5 A;  4R1H A;  2R7V A;  3HOS A;  2ZFW A;  4P96 A;  4L0Z B;  3CMA I;  1YX3 A;  5EF6 A;  3VYR B;  1S29 A;  2R7X A;  1MBJ A;  2WV1 A;  1G4D A;  3DU5 A;  4IPA A;  3ZXS A;  2AS5 F;  1OR7 A;  1K7A A;  2WBM A;  2X9D A;  4JP0 A;  4ZJZ A;  1S6L A;  3I0T A;  3B6A A;  2FRH A;  2VUM J;  3ABM H;  1TWC J;  3LST A;  4LB6 B;  1G3W A;  3MEX A;  4PZJ A;  3OOP A;  1I1G A;  3LMM A;  1ZK8 A;  2ACJ A;  4DGW B;  2OZ6 A;  3J7A Y;  3T8T A;  3R6S A;  3RPQ A;  1U0J A;  2VQH A;  2XSJ C;  3BJO A;  3SYT A;  1XSV A;  3BTJ A;  1WJA A;  4HV6 A;  3BZ6 A;  3WE2 A;  2KIS A;  1RR7 A;  2EIK H;  2ZJQ F;  3F6O A;  1I6X A;  4EJW A;  4ENK A;  1S9H A;  4GYG A;  1P4W A;  2VJ5 A;  3ML6 A;  3P7N A;  1W7P A;  1DU6 A;  2ZNZ A;  1YX5 A;  3WGG A;  1OQY A;  2VXD A;  5AON A;  1A5J A;  2PMZ A;  3S8P A;  2IP2 A;  2Y0M A;  1B9N A;  3TP0 A;  3JRH A;  3A1Y A;  2L9S A;  5IOY A;  1HW1 A;  2O3F A;  1TWF J;  4UUT A;  1U5T C;  4F92 B;  4JK1 X;  1KU9 A;  3I54 A;  4LB5 A;  3A02 A;  2W48 A;  3GFI A;  3V7S A;  3CCY A;  4KN4 X;  5C44 J;  3BZK A;  4QPQ A;  3CUQ C;  1ON1 A;  1I5Z A;  4CCL A;  2BY3 A;  2F5C A;  3AKZ A;  1TBX A;  2ZFU A;  4NQW A;  1OCP A;  3ZMV A;  1X4O A;  4JX6 A;  4BXU A;  3SZG A;  4EV0 A;  5BMZ A;  5HLT A;  3DU6 A;  2OCE A;  1VQ7 I;  1TC3 C;  2KFD A;  2RQQ A;  5D6F A;  2ZCW A;  1ODD A;  5DUI A;  2P5L C;  4A69 C;  3QOP A;  4LK1 F;  2QSF X;  5D4S A;  1OCC H;  5FRN A;  1JGG A;  2E35 A;  4YFX F;  4ETS A;  2CQN A;  4OIQ F;  2JUC A;  5HS9 A;  2HVR A;  1F36 A;  2R7O A;  4BJT A;  2IGN A;  1FJL A;  4KFC A;  2UUZ A;  1X1D A;  2O5R A;  2M7B A;  2MC4 A;  4BBR J;  1UEL B;  3CQZ J;  3I71 A;  3ZN1 A;  3L2R A;  3O8H A;  5HNF A;  1HW5 A;  2O0Y A;  3BR3 A;  5D5X B;  4ZTF A;  3MMY B;  3SZP A;  1AU7 A;  1G8X A;  1MIJ A;  3H5R A;  1LEB A;  3BR5 A;  3Q5F A;  4ZDL A;  4MHG A;  3BPX A;  4O3M A;  1DQU A;  1ITY A;  2K9M A;  4PJN A;  3VEP A;  2KLO A;  2MSY A;  1WRJ A;  4CXF A;  3CES A;  3WG7 H;  2XKP A;  2EFW A;  1WPK A;  4U7D A;  3VOE A;  4HDU A;  1WH7 A;  3JCU C;  1N75 A;  1HF0 A;  2XF7 A;  2VC0 A;  3B6C A;  4ANJ A;  4BNC A;  2DMP A;  4DBQ A;  4ZYD A;  3M3Y J;  3HHH A;  2Q0O A;  4PCQ A;  2NS8 A;  3DBL B;  4HQM A;  2EZK A;  3WU0 A;  4BE0 A;  3BDD A;  3LQR A;  4BHC A;  4MLO A;  5E1W A;  1KU3 A;  3ASN H;  2CS3 A;  3KP7 A;  1WJ5 A;  1SAN A;  5H20 A;  4FT8 A;  3VPR A;  2HKO A;  3OSG A;  2CG4 A;  2M9H A;  2M8G X;  2FMY A;  5DUK A;  2C6Y A;  2V1D A;  2VBY A;  3S1N J;  4GDF A;  4Q48 A;  1F4K A;  3GYH X;  3VWB A;  1RES A;  1Y6I A;  1FT9 A;  1UJ8 A;  2K02 A;  5JHU A;  1R58 A;  3HTU A;  1F5T A;  3L2W A;  1WI9 A;  3BR2 A;  2NS0 A;  1P4X A;  1VQ5 I;  4Q4Z F;  1R49 A;  1PUF B;  3WTT C;  3H3Z A;  1K83 J;  2KRF A;  3KCC A;  1QVU A;  5DD8 A;  4BDY A;  1UZC A;  4CCJ A;  2R93 J;  2BBY A;  5IP6 A;  3CJN A;  4PK4 A;  4B8X A;  3ELK A;  3KEO A;  1DPR A;  1STZ A;  2L4A A;  4EJO A;  3RPU D;  2V9K A;  2VI6 A;  1T38 A;  2DT6 A;  2CQK A;  4OIO F;  1MJ9 A;  4UB6 C;  1YS6 A;  3K4N A;  2L01 A;  4R8H A;  1HKS A;  2F5E A;  3KET A;  4IHS A;  2A61 A;  3HRT A;  4LK0 F;  3K6G A;  2R7U A;  2O9L A;  1EV7 A;  5FKM A;  2BGC A;  1ZR4 A;  3BG9 A;  5FKO A;  3V4G A;  3GZ5 A;  2LY2 A;  3K4K A;  4A0Y A;  2EIM H;  3K4L A;  3S1R J;  1MMA A;  3U1D A;  3ZMU A;  3JTG A;  3LAJ A;  3HRS A;  1ZGJ A;  5JLX A;  3J7Y J;  1TW2 A;  1FYK A;  1YI2 I;  2KKO A;  3W2V A;  4KMF A;  5BS6 A;  3MD2 A;  5F0H A;  2MYS A;  2E19 A;  1BIB A;  2IPQ X;  2NOG A;  4KT5 C;  2ESH A;  4PSX A;  1SFU A;  4XLP F;  3SZT A;  4A3J J;  3U21 A;  1K6Y A;  3I9V 2;  3ULQ B;  2HU9 A;  1BN5 A;  3FXU A;  4ZYA A;  2GA1 A;  2VJJ A;  4LLG F;  4DYR A;  2XAF A;  3BJA A;  4GXO A;  1IXS B;  1R1V A;  4GRI A;  4I6Z A;  1EF4 A;  4B44 A;  1R7J A;  3H3U A;  2KMU A;  2QSH X;  2Y48 A;  4EJT A;  2K5C A;  4OAY A;  1Y1V J;  2L7M P;  1TQP A;  2JQ7 A;  4XOR A;  4LD5 A;  4Y33 A;  2DK5 A;  5K5Q A;  1I50 J;  4KIC A;  4M74 A;  5F27 A;  1W0U A;  1EJ9 A;  4KYW A;  3JSO A;  1HDD C;  1U5T B;  1XMX A;  1B72 A;  1ZRC A;  3QRF F;  2IS4 A;  1G59 A;  2EA4 A;  5EEH A;  1ZR2 A;  5E1X A;  3FXQ A;  4M3B A;  1ZHF A;  3FXR A;  3S2W A;  4KUM A;  3ABL H;  3ONQ A;  2L7F P;  4BQQ A;  3RKQ A;  1MJA A;  1MDM B;  4RM3 A;  4ZZL A;  2L3D A;  3VB2 A;  4S04 A;  4M6Y A;  2A5Y B;  2CW8 A;  4MFD A;  5DD4 A;  1OYI A;  4HAM A;  1IUF A;  1TNT A;  2HPM A;  4HBL A;  3JRC A;  3C2H A;  3K69 A;  2CV2 A;  4XN3 A;  3ZOB A;  3LSG A;  4H0E A;  5LHH A;  3F6V A;  4AUX A;  2XPW A;  1O3R A;  4BHP A;  2AXT C;  2V9V A;  1B1B A;  1ZG3 A;  2CW0 F;  4XM3 A;  2QBY A;  1ETQ A;  5F64 A;  3E6B A;  3LSH A;  3JRD A;  4G7H F;  3FBN B;  2HQA A;  4EVI A;  3L9F A;  3R4K A;  3PSI A;  2B0L A;  1Q1H A;  2HYG D;  3EDP A;  1R23 A;  3BG3 A;  1ZAO A;  3OY9 A;  2R5Z A;  5E3O A;  3HOU J;  1A35 A;  1MD0 A;  2X1C A;  3BRO A;  4RB0 A;  2QQA A;  1ENH A;  1YW8 A;  2HZT A;  4WF2 A;  4EGY A;  1YLF A;  4IHW A;  2HS5 A;  4L5I A;  3F22 A;  1AOY A;  3PL8 A;  1LEA A;  5E20 A;  3PUB A;  1ZLJ A;  1O7F A;  3ZQI A;  4FTH A;  1UHW A;  4Y13 A;  3K10 A;  3GEZ A;  1DP3 A;  4HLY A;  1FYL A;  3HB9 A;  4Y7N J;  2PFB A;  1U8B A;  2Z9O A;  3DLA A;  5L3D A;  1BBY A;  2ETH A;  2FNP A;  3BG6 A;  3L00 A;  1NG6 A;  2PMZ N;  4G7Z F;  2DJI A;  4A5M A;  2D1V A;  3BT9 A;  3SDG A;  3ROU A;  5M5W J;  2EFO A;  2FJ1 A;  3DTK A;  4OIP F;  1PUF A;  1SVO A;  4B47 A;  5GTH C;  2KRC A;  1P92 A;  3KEQ A;  5LGU A;  1ETV A;  4LOC A;  4JX5 A;  3VSK A;  2KIU A;  2OPT A;  2E2J J;  1SVL A;  2VON A;  3BTC A;  1PUE E;  5HDK A;  4Q5S F;  2BW3 A;  1U3E M;  1L0O C;  3ZMD A;  4GFB A;  5CLS A;  2XGE A;  1MBH A;  1UG2 A;  5EEG A;  1T0F A;  4XLF A;  3AG3 H;  3DFG A;  3I4M J;  1C0W A;  2K9N A;  2VT3 A;  4D9J A;  1APL C;  4HG2 A;  3HYI A;  5KVR A;  3TOB A;  2VOP A;  4II2 A;  5LBQ A;  2CUJ A;  1XCB A;  2LTP A;  3DKY A;  4IRH A;  5ICC A;  4NC8 A;  1YJ9 I;  3FXL A;  2JRM A;  2QCO A;  5A2Q K;  2F5V A;  3HRM A;  1IDY A;  1R1T A;  3GO5 A;  1ZRE A;  5FLX K;  1HDP A;  4UV8 A;  5B5E C;  4AU7 A;  2ZXJ A;  2QEX I;  3GWZ A;  3RKW A;  1QZZ A;  2DK8 A;  3CCJ I;  1XCV A;  3QWL A;  4XNF A;  1VFC A;  2DCE A;  2M0C A;  2Y0S A;  2NVT J;  4I2O A;  2CW7 A;  3FZV A;  5BNG A;  4B1R A;  1P4A A;  2FNA A;  3DXJ F;  5FKL A;  4XRF A;  2GOM A;  3MFK A;  1NH3 A;  1RR8 C;  4HF1 A;  4ESF A;  4RGR A;  1S7A A;  2JPC A;  4KT6 A;  5HLI A;  5J4V A;  1JHF A;  3ABU A;  1S7O A;  5GAD J;  3QOE A;  5H6R A;  2YU3 A;  1SC7 A;  4BXF A;  1TWH J;  2ZJ2 A;  2DOA A;  4G6Q A;  3BWG A;  5D5V B;  1ZRF A;  2HR3 A;  2NAZ A;  4BE2 A;  2ISY A;  3E6D A;  4A0X A;  3ISP A;  1W5S A;  3PUF A;  1QA6 A;  2EJR A;  2X6O A;  2ZME A;  3OYF A;  1KA8 A;  1Z6R A;  4R79 A;  2ZJR F;  1SFX A;  1MZB A;  5EJC A;  5E3L A;  1FC3 A;  2QBY B;  5K5O A;  2F6C A;  3LWF A;  3OYJ A;  5F6F A;  2XAJ A;  2LDU A;  4DZJ A;  1NK2 P;  1ETW A;  3ZCO A;  2KPM A;  2JPB A;  2XAQ A;  3FX3 A;  3K1M A;  1TNS A;  1WH5 A;  1A6Q A;  2OJE D;  1K4S A;  3HSF A;  5HDG A;  2Y30 A;  1E3H A;  2X6Y A;  2OTL I;  4LG0 B;  3MN2 A;  4I7H A;  2L2O A;  3PFI A;  1A31 A;  2QF7 A;  1Y0N A;  4UVB A;  1ONV A;  5KK1 A;  4UNO A;  5ILS A;  2IAI A;  2PQ8 A;  1YW7 A;  3RZD J;  1X1C A;  2VKD A;  1QRY A;  4ZDO A;  2COB A;  3S93 A;  1OCR H;  2XPU A;  3JRE A;  3WHC A;  2WWY A;  1UCR A;  3EYI A;  4UUV A;  1IZ1 A;  1U2W A;  2W84 A;  4MNU A;  1WHU A;  1U5T A;  2CJJ A;  3MWM A;  2K9S A;  3EUA A;  2PLY A;  2M1B A;  1D5V A;  1JHH A;  3HHG A;  2XVC A;  1YHQ I;  3GLX A;  4I02 A;  2EWN A;  1P6R A;  1JE8 A;  5GTI C;  4CIC A;  4NC6 A;  4OMZ A;  1RZ4 A;  1K6O A;  3WGI A;  1T08 B;  4KA4 A;  2UWM A;  4HQE A;  3JAM K;  3GX4 X;  2FU4 A;  3HM5 A;  3JTH A;  2XC7 A;  2CUF A;  3LAP A;  1LE8 A;  2HVS A;  2X85 A;  2E2I J;  1MMG A;  2IJL A;  4YIR X;  5KNL A;  5E1Z B;  2ZXW H;  2EFP A;  3A4C A;  3LA7 A;  2XSD C;  5L3E A;  1UAA A;  3AFH A;  4P5O A;  4IX7 A;  1HW2 A;  2W25 A;  4OIN F;  2HXI A;  1IRF A;  3CZ6 A;  2BZT A;  1R36 A;  1U78 A;  5JFR A;  1ZRD A;  4NB5 A;  2JRT A;  3REO A;  1R71 A;  3HOY J;  1W7P D;  1WI3 A;  2LNB A;  1FX7 A;  2HOA A;  4BQO A;  1LJ9 A;  1Y39 A;  2HGC A;  3CCU I;  2R7D A;  4XLH A;  3WTY C;  2JK3 A;  2VBW A;  4A3D J;  3OYD A;  2YU9 J;  2FEZ A;  4C3I J;  3F0C A;  4ENM A;  4CYC B;  1T98 A;  5TRD A;  1YYV A;  1ZLK A;  1EH8 A;  2XGX A;  3J80 K;  2AQE A;  3H3V K;  4BY1 J;  4MFE A;  3GTL J;  4HST A;  3QYF A;  4P9F A;  4XKV A;  2XRN A;  4PGG A;  4BHB A;  4G9Y A;  3MKZ A;  3CCE I;  3A0B C;  5BPI A;  1JKQ C;  4KNY A;  2M34 A;  4XRS G;  2E71 A;  1OYY A;  4HEA 2;  3QP6 A;  1XG1 A;  4B43 A;  4QLC U;  4BEH B;  1I6H J;  1JXS A;  1GVD A;  3HTS B;  1BI1 A;  2CQQ A;  5DTD A;  2P5K A;  2GIV A;  3CDH A;  1D0X A;  2PG4 A;  2FBH A;  3G1M A;  2DMQ A;  2M0M A;  3DEW A;  3RJP A;  2DA2 A;  2K27 A;  3HGG A;  2Z33 A;  2QEN A;  1O3T A;  4M73 A;  2V4J C;  4U7B A;  5DYM A;  3M7G A;  1W5C C;  3O6B B;  1XGS A;  2F5F A;  4RLQ A;  2CGP A;  3H9G A;  2BYV E;  3COA C;  4YG2 F;  4CYD A;  2EPF A;  4C30 A;  4LIT A;  3GZ6 A;  3IRR A;  4HRI A;  4XON A;  1RET A;  5L3B A;  2Q2E A;  2V79 A;  3HSE A;  3SFI A;  2UXX A;  2H8R A;  2CU7 A;  3C3W A;  4HSR A;  1FWZ A;  2X4H A;  3Q9V A;  3L2C A;  2NVQ J;  2VAS A;  4EJV A;  1JKR C;  4JQF A;  1FLI A;  3S16 J;  3BG5 A;  2DAO A;  2DQR A;  1Q1V A;  2STT A;  1FP1 D;  2CWE A;  2Z16 A;  3GFL A;  4BXX J;  4XOP A;  2OA4 A;  1MNM C;  3BP8 A;  4IHY A;  1TP4 A;  1PP8 F;  2DPD A;  1HA8 A;  3ZP5 A;  2CRG A;  3S17 J;  4DYQ A;  1TQM A;  3OSF A;  2TCT A;  3C7J A;  4XKB A;  5IP7 J;  1P9Q C;  2NNN A;  2H27 A;  2GXA A;  2O7O A;  3DBR B;  3IC7 A;  2E1M C;  2WB1 N;  2KDO A;  2WAQ N;  2BHY A;  3IH4 A;  4KIF A;  1IRZ A;  3MKL A;  1USS A;  3KIO A;  3GUD A;  1RC9 A;  4N0B A;  5CVJ A;  1GV2 A;  2ZXH A;  4PDK A;  5CVI A;  1BR2 A;  5HDN A;  4X0G A;  2F4I A;  1IN4 A;  4HNU A;  1LQ1 A;  2HDW A;  2I5U A;  4NC7 A;  1SD5 A;  4F3Q A;  3PSF A;  2OTJ I;  2KDZ A;  1LFP A;  2EV5 A;  2IS1 A;  2D45 A;  1XGN A;  4MO7 A;  3DPT A;  1YRN B;  1B9M A;  2LBF A;  1YFH A;  3DQV C;  2YUS A;  3CF5 F;  2PN6 A;  2DA4 A;  3DBH B;  4BJ6 C;  2LYC A;  4LFU A;  4ZZD A;  2JT1 A;  1BM9 A;  1E2X A;  3C1D A;  2K7L A;  2XHK A;  1SMT A;  4PSW A;  4LLN A;  1YS7 A;  4A0Z A;  1ETX A;  1FSE A;  1R1U A;  3H92 A;  5A2Q Z;  3F8M A;  1Z3Y A;  3P9I A;  3ZQH A;  4ENJ A;  2QUF A;  5LHI A;  3MZH A;  3DV8 A;  1K4T A;  2XF6 A;  1X1B A;  3CCL I;  1NTC A;  4IXA A;  2EB7 A;  4KJZ A;  5DM6 F;  1HCR A;  4MEY F;  3J7Z I;  1DDN A;  3T8R A;  3QYB A;  4WXH A;  5E8I A;  2BY1 A;  2HKX A;  3NAR A;  5M3M J;  5BOX A;  4F55 A;  3LSP A;  5FLX Z;  2JVG A;  3N05 A;  4IVN A;  5JVT A;  3CCV I;  2A6H F;  2LY9 A;  1BL0 A;  3I64 A;  3RPU A;  1SAU A;  4A12 A;  2LVS A;  1YE9 A;  3FMS A;  3KYD B;  3Q9S A;  4M3F A;  5LRR A;  4AIH A;  4G8X A;  3KP6 A;  4O6J A;  2VT2 A;  3V8K A;  1YIO A;  2R5Y A;  1KU2 A;  3HOV J;  2WC2 A;  4XKW A;  1J7K A;  3ZQ7 A;  2GWR A;  1XDU A;  4HZF A;  1F1Z A;  4IQJ A;  1OLT A;  4V2F A;  1FBU A;  4BU2 A;  1ETK A;  4DNC A;  1EA3 A;  1ZN2 A;  1IF1 A;  1FOK A;  1DP7 P;  1QZY A;  2QLZ A;  4M3D A;  3CJQ B;  5JVG F;  5LFA A;  3DLL F;  2JN6 A;  1IN7 A;  4RMN A;  4XLC A;  3ZQL A;  2EIL H;  4D5F A;  2NNY A;  4B3A A;  2PEX A;  3DEU A;  3E6M A;  5EEA A;  1SMY F;  2ZME B;  4UXN A;  2MD5 A;  4CGZ A;  4N4O B;  3TO9 A;  4CZC A;  1REP C;  1X3U A;  3CP2 A;  2QQ9 A;  1GXQ A;  4Y3O A;  4A3K J;  3S3M A;  5GPA A;  3N4M A;  3ZQQ A;  4PJJ A;  1UHS A;  4IL6 C;  2DYR H;  1D1A A;  2K9Q A;  3FIS A;  4RB2 C;  3L2Q A;  5C4X J;  1HST A;  3P9K A;  1D3Y A;  1HOM A;  1VF9 A;  5FD5 A;  3G1O A;  2OBP A;  4RBO A;  5EG0 B;  3HC7 A;  2JA5 J;  3PQK A;  1IV8 A;  1YG2 A;  1I3Q J;  1VQK I;  3L2V A;  3ECO A;  2LY1 A;  5D5W B;  1D1C A;  5LLQ A;  4KMU X;  2LK2 A;  2V1X A;  1X3Z B;  4F93 B;  3N97 A;  4RB3 C;  4Y4R A;  2DFH A;  3PM1 A;  5CJ9 A;  4LLL A;  1XGO A;  2DMN A;  1IC8 A;  3NAU A;  1KZH A;  4F7Z A;  2RGV A;  4A3F J;  3G71 I;  4ZYG A;  4AIJ A;  3RIR A;  1E17 A;  2EZI A;  2JSP A;  1D0Z A;  2W24 A;  4AD9 A;  3F8N A;  5HOO A;  1T39 A;  4RAY A;  2DO7 A;  5B1A H;  2VKH A;  1D5Y A;  2H1K A;  4QTR A;  2A5W A;  3GZN B;  2ADU A;  1FNN A;  2RNG A;  1WJD A;  4EJU A;  2EZH A;  3OR1 C;  3GF2 A;  3K9T A;  2V6E A;  1BC8 C;  2DTZ A;  1IO2 A;  4QWQ A;  1VQ4 I;  4GGG A;  1W36 C;  1Z7L A;  3WTV C;  4BH9 A;  2GBY A;  3MKY B;  3S3N A;  1QPM A;  5CKT A;  2RNJ A;  2R5Y B;  3FXJ A;  4ASN A;  4BJ5 C;  2G7U A;  2BW3 B;  3GME A;  5J8F A;  1T6S A;  1HKQ A;  2E5Z A;  3K7A J;  1I3A A;  2QSG X;  2JA7 J;  4E7S A;  1Z05 A;  4F91 B;  1K78 A;  2W85 A;  1Y56 A;  2GM4 A;  2VBX A;  2ESN A;  3EPZ A;  3QU6 A;  4E70 A;  1A04 A;  2BE5 F;  3OIQ A;  2OV7 A;  2EQR A;  5EG0 A;  3F21 A;  2O8K A;  2V26 A;  5F04 A;  2P5V A;  2ELK A;  2FUG 2;  3OYH A;  2FBI A;  3M8F A;  3ASO H;  4D7N A;  2DYS H;  2QM3 A;  2HPI A;  3WOD F;  4L5J A;  2DJN A;  3KZY A;  3JRG A;  2DA1 A;  5LD2 C;  3L09 A;  1WJF A;  3RYP A;  2NOJ B;  3JR9 A;  2YSR A;  3FF5 A;  1W7P B;  2ID6 A;  3OWT A;  5K7Z A;  2TRT A;  1HKT A;  1XSD A;  2PMU A;  4LG3 A;  2NVU B;  3D5S C;  4E7J A;  1AWC A;  5M5Y J;  1Y8Q B;  4GO1 A;  1SD7 A;  3S1M J;  2H09 A;  3BOQ A;  2MAB A;  2ZO4 A;  3L2U A;  1VQO I;  2A69 F;  1P7J A;  2K40 A;  2RKH A;  3I59 B;  3AG2 H;  4CUG A;  3LSJ A;  2LBF B;  5IPA A;  1CGP A;  1PDN C;  3DPL C;  4U0Y A;  3HPH A;  4PJ0 C;  3WTU C;  1KQ8 A;  3OYA A;  2LKS A;  2VKV A;  5CQG A;  2KZG A;  5CVU A;  4D1Q A;  3K1P A;  2VIX A;  3HDD A;  2OQR A;  4DYC A;  1IN8 A;  2K4B A;  1AHD P;  4G12 A;  1J0R A;  1LFU P;  3V7C A;  4HDV A;  4AC0 A;  4WX9 A;  2VN2 A;  1X1A A;  4XKC A;  2GAU A;  3G73 A;  5FLV A;  2HQN A;  2PJR B;  2DPU A;  1TQI A;  4FET A;  2YR2 A;  1R6R A;  4UVA A;  3DP7 A;  3BCB A;  3OIP A;  2MLG A;  4DBR A;  4L18 B;  2RVC A;  4UV9 A;  2XGC A;  1IUY A;  1MND A;  2DFI A;  3HXL A;  3IH3 A;  2A3S A;  4NHJ A;  1H9T A;  2W00 A;  3TQN A;  3WU2 C;  4B09 A;  1R4M B;  1QZE A;  2XB0 X;  2E60 A;  2EIJ H;  2DA7 A;  2X0L A;  3GTQ J;  1P7I A;  2R7T A;  3OYE A;  2P8T A;  3K0L A;  1HLV A;  1LVK A;  2GA2 A;  4M9Z A;  5FKN A;  3HOX J;  1FMV A;  1QO0 D;  1T56 A;  3WTZ A;  5ICE A;  2Q1Z B;  3MCZ A;  4AM3 A;  3FXO A;  1RI7 A;  2FE3 A;  3UR3 C;  3VFZ A;  1GLN A;  1RNL A;  3R60 A;  2OCC H;  5CYV A;  2VB6 A;  2L4M A;  2VOD A;  3O3K A;  3F8C A;  1X2N A;  1B8I A;  3R0J A;  1W0T A;  3U1K A;  5ICG A;  2BY0 A;  3FKJ A;  1FTT A;  3RQ4 A;  4XLN F;  5HOD A;  3WE3 A;  2IA1 A;  5LGN A;  1ZKG A;  3GTJ J;  2XAG A;  3I5U A;  1A36 A;  4AIK A;  3D5R C;  2QKL B;  3CP8 A;  3RCO A;  3BJ6 A;  3QPL A;  4IOC F;  2J5O A;  1TT0 A;  3CUQ A;  4B3X A;  2R7Z J;  1G6N A;  3VSL A;  1MDM A;  2ZSI B;  1TTY A;  3LNQ A;  2R0Q C;  2VOO A;  2E1M B;  2VE9 A;  2ZSH B;  3BQY A;  4CCK A;  2P81 A;  2R7F A;  4CZZ A;  1OCZ H;  2VC1 A;  2ZC2 A;  1Z3X A;  3JRI A;  2LRD A;  1IGN A;  3WG9 A;  1I1S A;  2JUG A;  1VQ9 I;  1KQ9 A;  1OPC A;  4XR6 A;  1CF7 B;  2W4S A;  4PGH A;  2DLL A;  3BQZ A;  3OL4 A;  2R4G A;  1NG7 A;  5HS8 A;  4E4H A;  2XKO A;  2M5W A;  2FD5 A;  2E1C A;  2BEO A;  2DTR A;  3IWZ A;  1ZGW A;  2ECC A;  3KP3 A;  3LA3 A;  4I98 B;  2QA4 I;  2E1O A;  2FOW A;  1Z91 A;  3JRB A;  2CO5 A;  3I53 A;  5K7H A;  4FE7 A;  1HQC A;  2MW8 A;  4Q47 A;  1PYV A;  3ERM A;  3S15 J;  2VE8 A;  4U87 A;  2WV0 A;  3TMO A;  3ERE D;  1NHA A;  1BJA A;  4BUP A;  4BE1 A;  5CVR A;  2A6T A;  5IP9 J;  2FQ3 A;  1IXC A;  1POG A;  5IY5 H; 
#chains in the Genus database with same CATH homology
 3C18 A;  3SXY A;  2HDC A;  3T5X A;  2L02 A;  2P6T A;  1FP2 A;  1I27 A;  1UST A;  4JBA A;  4KDP A;  2M87 A;  2MLK A;  2M8E A;  3M9A A;  2DU9 A;  5DDG A;  4WXC A;  1IAW A;  1ZH5 A;  3D5L A;  3KP4 A;  4YIF A;  4I09 A;  1YTY A;  2E7W A;  3HOT A;  2VBZ A;  4UHT A;  1G3T A;  4MGR A;  2MH2 A;  3GXO A;  3AAF A;  2RV8 A;  3WTW C;  3SHF A;  4M6X A;  4HF0 A;  1BC7 C;  5JR3 A;  2ZBK A;  4IRG A;  3KE2 A;  4XSX F;  1MKM A;  1PP7 U;  4DQ2 A;  5DCM A;  1KGS A;  3RTR A;  3PQJ A;  2Z3Y A;  5AIP A;  1J9I A;  3HUG A;  2M30 A;  5BQT A;  3CO6 C;  1XMA A;  2OAZ A;  3KLN A;  3E3V A;  3WTX C;  2E1N A;  1FY7 A;  1J2X A;  1G3S A;  3ECH A;  3TKY A;  3V8J A;  4I0A A;  2ELH A;  2FF4 A;  4EMS A;  2O8X A;  1BOA A;  2F5D A;  1G3Y A;  4ON0 A;  4MQ9 F;  3U2R A;  4YII A;  4HF2 A;  3TDU C;  4Y15 A;  4HOB A;  3J81 K;  2MC3 A;  3CTA A;  3U9G A;  3I4P A;  5L3C A;  3V7R A;  4AVP A;  1YW9 A;  3J80 Z;  2O61 A;  1Z9C A;  3DF8 A;  2IA0 A;  1U8R A;  1O3Q A;  1ZGA A;  4L9T A;  5ED4 A;  3WTS C;  3ABT A;  1D8K A;  2XV4 S;  4M9X A;  4OU0 A;  1R00 A;  4RS8 A;  2BV6 A;  4OOI A;  2QYO A;  2D2W A;  1DUX C;  1VTN C;  5HLG A;  2CSO A;  1DPU A;  5IT9 Z;  2GXB A;  4CO8 A;  4MEX F;  2YX4 A;  2RN7 A;  1WWX A;  2RDP A;  3IHU A;  3RKX A;  1J5Y A;  2H6C A;  2YPR A;  3SFZ A;  2R3S A;  5DCM B;  2Z99 A;  4U0W A;  3W6J B;  2Q8K A;  4N9H A;  2IA2 A;  3M1E A;  2HQR A;  3ZMS A;  1V4R A;  2AXL A;  2D1H A;  2HWV A;  4BYY A;  4U0V A;  3B73 A;  5FFX A;  4FHT A;  1GVJ A;  2OD5 A;  2EFN A;  3F3X A;  1H9G A;  4Z2Y A;  2FOK A;  3ZPL A;  1HSJ A;  2EV6 A;  2A07 F;  5DCF A;  3EYY A;  4TV7 A;  2HTS A;  5FFZ A;  5LRS A;  4IRI A;  2A68 F;  1XB4 A;  3FWE A;  5TJJ A;  4OIR F;  5LGT A;  3KP5 A;  3FM5 A;  1XDS A;  5JI6 A;  1IN5 A;  1FBS A;  1FPQ A;  4G94 A;  1H0M A;  2KIM A;  2G9W A;  1LNW A;  3KZZ A;  4RGS A;  1YO5 C;  3ZN0 A;  3JW4 A;  3HSR A;  2GQQ A;  4D0P A;  2KJC A;  1O57 A;  3R0A A;  1RUO A;  2GXG A;  1XD7 A;  4ZH4 F;  3D0S A;  3EET A;  4KIB A;  1O3S A;  1O7L A;  1SD6 A;  1ULY A;  4L0Y B;  4I0B A;  2EK5 A;  1FSH A;  4ESB A;  4MTD A;  4G7O F;  3MAJ A;  2XAH A;  2JTV A;  3W6K B;  3E5Q A;  1CF7 A;  4IF4 A;  3F23 A;  1QGP A;  4ESJ A;  2P7V B;  4YFK F;  2EA2 A;  2O6G E;  5E8G A;  2XUB A;  3GFM A;  2FA5 A;  1GHC A;  1L3L A;  2QWW A;  6PAX A;  1R5H A;  1XN7 A;  3E97 A;  1UHM A;  1ZAR A;  2PBI A;  1KQ0 A;  1LDK B;  3E6C C;  5H6Q A;  4A2U A;  3QAH A;  5K1Y A;  2YX7 A;  3O2P E;  1F9N A;  1KYW A;  1YQA A;  4A5N A;  2FML A;  1SD4 A;  2J5P A;  1WKM A;  1IXR C;  3SQN A;  1LDD A;  1JGS A;  2EFQ A;  5ERI A;  4LJZ F;  4L9N A;  1OMI A;  1GXP A;  1ON2 A;  1B4A A;  3K2Z A;  3TGN A;  2V6C A;  1LVA A;  5L3F A;  1KYZ A;  3G3Z A;  5HS7 A;  4M71 A;  2H6B A;  1HBX G;  4BQA A;  2XAS A;  1K78 B;  3R61 A;  4HV5 A;  2HFH A;  4HX7 A;  2FXA A;  4BAY A;  1WSU A;  2KIF A;  3ZMZ A;  2JSC A;  2MA3 A;  2QZ8 A;  3I59 A;  4XSZ F;  4ZYE A;  4MTE A;  1Z1D A;  2LKP A;  2UXN A;  2IRF G;  3KLO A;  1IRG A;  2NRA C;  2MH9 A;  4L9J A;  1IW7 F;  4P55 A;  3NRV A;  1K79 A;  2P6S A;  2QQB A;  3GW2 A;  3BPV A;  1MGT A;  4IJA A;  2LF7 A;  4O5V A;  3LQQ A;  2O03 A;  3TO7 A;  1MJB A;  1FYM A;  1D8J A;  3I58 A;  2WTE A;  3L7W A;  3KP2 A;  3RDI A;  1J59 A;  5D5U B;  2JZY A;  4L9V A;  4KIG A;  2HOE A;  5K5R A;  4I01 A;  2DBB A;  2K4J A;  4HW0 A;  1B6A A;  1W5T A;  1S3J A;  2XRO A;  4LG0 A;  1Z6T A;  3JAM Z;  2ZNY A;  3NQO A;  3IRQ A;  2H94 A;  2P7C B;  5AIQ A;  4AWX B;  5DEQ A;  5ICF A;  5FO5 A;  2NYX A;  3DKW A;  1UFM A;  3LFK A;  2LSO A;  2V1U A;  3M8E A;  4Y17 A;  4S05 A;  4WCG A;  5LHG A;  3V8L A;  4RGX A;  4LGW A;  3KFW X;  1SAX A;  1QBJ A;  3MZY A;  1XSX A;  3CUO A;  2MBF A;  2IVM A;  4KN7 X;  5D6E A;  2PI0 A;  5IT3 A;  4EM2 A;  1BIA A;  2RC4 A;  4HLX A;  1LB2 A;  2FBK A;  2DW4 A;  2Y75 A;  3FMR A;  3E5U A;  1P2F A;  1ZG1 A;  1FZP B;  3FHZ A;  2XIG A;  5D8L B;  4LMY A;  1R22 A;  4HA8 A;  1OKR A;  1R5G A;  1QQI A;  4WXD A;  2HTJ A;  2W57 A;  3FMQ A;  3GFJ A;  3IWF A;  1Z7U A;  5D8K B;  3F8F A;  3F8B A;  2OZU A;  5CVV A;  3EQL F;  1UB9 A;  3RKY A;  2LF8 A;  5LEJ A;  1OYW A;  5D4R A;  2IW5 A;  3HRU A;  4EGZ A;  3T1B A;  3QU3 A;  1XMK A;  3NEU A;  2DI3 A;  1QNT A;  2DQL A;  1J75 A;  5ILU A;  3CUQ B;  4RB1 A;  2Z5U A;  4HX4 A;  3LA2 A;  1SFE A;  3IKT A;  4MQV A;  3WGH A;  5BPD A;  2VXZ A;  3CLO A;  3QPH A;  3RYR A;  3JSP A;  3J7A O;  3E5X A;  4A6D A;  4P9U A;  3OV8 A;  3CO7 C;  1V3F A;  4K2E A;  2A6E F;  3FM3 A;  2COM A;  1BI3 A;  3EUH A;  4WWC A;  1WQ2 A;  2F2E A;  2IT0 A;  3MQ0 A;  2HYF A;  5J8C A;  2ISZ A;  2M45 A;  2QVO A;  2DT5 A;  2L54 A;  4EQQ A;  3QP5 A;  4FX4 A;  2STW A;  5ILV A;  2TDX A;  5E18 F;  4GCV A;  1XGM A;  1U6G A;  4EM1 A;  1EH7 A;  5FB2 A;  1KU7 A;  2CYY A;  2HEO A;  5FGM A;  4IHT A;  4U88 A;  3T0Y A;  3K1N A;  5HLH A;  2K86 A;  1EH6 A;  2CFX A;  2E7X A;  1B59 A;  4HX8 A;  5IT9 K;  4M9S A;  5LEK A;  3IKV A;  3RI4 A;  3F72 A;  3J81 Z;  1TLH B;  2PMH A;  1IN6 A;  5J6X A;  3TO6 A;  4A6E A;  1S8N A;  4CHU A;  1HXD A;  2PJP A;  1BI0 A;  2KJB A;  3VOD A;  5L3G A;  3HIF A;  4M72 A;  4CDG A;  2P4W A;  4GYI A;  2ZKZ A;  4N9I A;  1ZG5 A;  2EV0 A;  4XBF A;  1ZYR F;  4G6D A;  5FD6 A;  1RIO H;  2OU2 A;  3ZMT A;  3B02 A;  5F1R A;  4YFN F;  5E17 F;  1TW3 A;  3P9C A;  1FBQ A;  2GZW A;  3GVA A;  4WK8 F;  4UVC A;  4HYE A;  4ZYH A;  2RQP A;  5HVQ C;  1W4M A;  2OQG A;  4RGU A;  4EM0 B;  1T2K A;  3WU1 B;  3QPT A;  4OMY A;  2UZK A;  4FX0 A;  1BI2 A;  2FSW A;  3IL2 A;  3TOA A;  3BY6 A;  4RAZ A;  2G7H A;  3TDZ C;  4ENN A;  1RUN A;  1LDJ A;  1Y0U A;  5DV5 A;  4R1H A;  3HOS A;  2ZFW A;  4P96 A;  4L0Z B;  1S29 A;  1G4D A;  4IPA A;  2AS5 F;  1OR7 A;  1K7A A;  1S6L A;  3I0T A;  2FRH A;  3LST A;  4LB6 B;  1G3W A;  3MEX A;  3OOP A;  1I1G A;  2ACJ A;  2OZ6 A;  3T8T A;  3R6S A;  3RPQ A;  3BJO A;  1XSV A;  4HV6 A;  3BZ6 A;  3WE2 A;  3F6O A;  4ENK A;  1I6X A;  4EJW A;  4GYG A;  1P4W A;  3ML6 A;  3P7N A;  1W7P A;  2ZNZ A;  3WGG A;  5AON A;  2IP2 A;  2Y0M A;  1B9N A;  1HW1 A;  2O3F A;  1U5T C;  4JK1 X;  1KU9 A;  3I54 A;  4LB5 A;  3GFI A;  3V7S A;  4KN4 X;  3CUQ C;  1ON1 A;  1I5Z A;  2F5C A;  1TBX A;  4NQW A;  3ZMV A;  4BXU A;  4EV0 A;  5BMZ A;  5D6F A;  2ZCW A;  1ODD A;  5DUI A;  2P5L C;  5D4S A;  3QOP A;  4LK1 F;  4YFX F;  4ETS A;  4OIQ F;  5HS9 A;  4KFC A;  3I71 A;  3ZN1 A;  1HW5 A;  2O0Y A;  5D5X B;  3SZP A;  1LEB A;  3Q5F A;  4MHG A;  3BPX A;  4O3M A;  3VEP A;  1WRJ A;  4CXF A;  2XKP A;  2EFW A;  4U7D A;  3VOE A;  4HDU A;  4BNC A;  2VC0 A;  4ZYD A;  3HHH A;  2Q0O A;  4PCQ A;  4HQM A;  3WU0 A;  3BDD A;  3LQR A;  4BHC A;  5E1W A;  1KU3 A;  3KP7 A;  5H20 A;  4FT8 A;  2HKO A;  2CG4 A;  2FMY A;  5DUK A;  2C6Y A;  2V1D A;  2VBY A;  4Q48 A;  1F4K A;  3GYH X;  2K02 A;  1FT9 A;  5JHU A;  1R58 A;  3HTU A;  1F5T A;  1WI9 A;  2NS0 A;  1P4X A;  4Q4Z F;  3WTT C;  3H3Z A;  2KRF A;  3KCC A;  5DD8 A;  2BBY A;  3CJN A;  4B8X A;  3ELK A;  3KEO A;  1DPR A;  1STZ A;  2L4A A;  4EJO A;  1T38 A;  2CQK A;  4OIO F;  1MJ9 A;  1YS6 A;  4R8H A;  2L01 A;  1HKS A;  4IHS A;  2F5E A;  3KET A;  2A61 A;  3HRT A;  4LK0 F;  1EV7 A;  2BGC A;  3V4G A;  3GZ5 A;  4A0Y A;  3U1D A;  3ZMU A;  3JTG A;  3LAJ A;  3HRS A;  1ZGJ A;  1TW2 A;  1FYK A;  2KKO A;  4KMF A;  5BS6 A;  1BIB A;  2IPQ X;  4KT5 C;  2ESH A;  1SFU A;  4XLP F;  3SZT A;  3ULQ B;  1BN5 A;  3FXU A;  2GA1 A;  4LLG F;  2XAF A;  3BJA A;  4GXO A;  1IXS B;  1R1V A;  1R7J A;  3H3U A;  2Y48 A;  4EJT A;  1TQP A;  4LD5 A;  2DK5 A;  5K5Q A;  4M74 A;  4KIC A;  4KYW A;  3JSO A;  1U5T B;  1ZRC A;  3QRF F;  2EA4 A;  5EEH A;  5E1X A;  3FXQ A;  1ZHF A;  3FXR A;  3S2W A;  4KUM A;  1MJA A;  1MDM B;  4ZZL A;  2L3D A;  3VB2 A;  4S04 A;  4M6Y A;  2A5Y B;  5DD4 A;  1OYI A;  4HAM A;  1TNT A;  4HBL A;  3K69 A;  4H0E A;  5LHH A;  3F6V A;  1O3R A;  4BHP A;  2V9V A;  1B1B A;  2CW0 F;  1ZG3 A;  2QBY A;  5F64 A;  3E6B A;  4G7H F;  4EVI A;  3L9F A;  3R4K A;  2B0L A;  1Q1H A;  2HYG D;  3EDP A;  1R23 A;  1ZAO A;  1MD0 A;  3BRO A;  4RB0 A;  2QQA A;  1YW8 A;  2HZT A;  4WF2 A;  4EGY A;  1YLF A;  2HS5 A;  4L5I A;  3F22 A;  1AOY A;  1LEA A;  5E20 A;  1ZLJ A;  1O7F A;  1UHW A;  4Y13 A;  3GEZ A;  4HLY A;  1FYL A;  2PFB A;  2Z9O A;  5L3D A;  1BBY A;  2ETH A;  2FNP A;  3L00 A;  4G7Z F;  4A5M A;  2D1V A;  3ROU A;  2EFO A;  4OIP F;  5LGU A;  1P92 A;  3KEQ A;  2KIU A;  2VON A;  1PUE E;  5HDK A;  4Q5S F;  1U3E M;  1L0O C;  3ZMD A;  5CLS A;  5EEG A;  1T0F A;  3DFG A;  1C0W A;  2VT3 A;  3HYI A;  5KVR A;  3TOB A;  2VOP A;  5LBQ A;  1XCB A;  4IRH A;  5ICC A;  5A2Q K;  3HRM A;  1R1T A;  3GO5 A;  1ZRE A;  5FLX K;  4UV8 A;  2ZXJ A;  3GWZ A;  3RKW A;  1QZZ A;  2DK8 A;  1XCV A;  4I2O A;  3FZV A;  1P4A A;  2FNA A;  3DXJ F;  4XRF A;  3MFK A;  4HF1 A;  4ESF A;  4RGR A;  1S7A A;  2JPC A;  5HLI A;  1JHF A;  3ABU A;  1S7O A;  5H6R A;  2YU3 A;  2ZJ2 A;  1ZRF A;  3BWG A;  4G6Q A;  5D5V B;  2HR3 A;  2NAZ A;  2ISY A;  3E6D A;  4A0X A;  3ISP A;  1W5S A;  2EJR A;  2ZME A;  1KA8 A;  1Z6R A;  4R79 A;  1SFX A;  1MZB A;  1FC3 A;  2QBY B;  5K5O A;  3LWF A;  5F6F A;  2XAJ A;  2LDU A;  2JPB A;  2XAQ A;  3FX3 A;  3K1M A;  1TNS A;  3HSF A;  5HDG A;  4LG0 B;  4I7H A;  3PFI A;  4UVB A;  1ONV A;  5KK1 A;  4UNO A;  5ILS A;  2PQ8 A;  1YW7 A;  2WWY A;  1UCR A;  3EYI A;  4UUV A;  1IZ1 A;  1U2W A;  2W84 A;  4MNU A;  1U5T A;  3MWM A;  2PLY A;  2M1B A;  1D5V A;  1JHH A;  3HHG A;  2XVC A;  3GLX A;  4I02 A;  2EWN A;  1P6R A;  1JE8 A;  4CIC A;  4OMZ A;  1RZ4 A;  1K6O A;  3WGI A;  4KA4 A;  2UWM A;  4HQE A;  3JAM K;  3GX4 X;  2FU4 A;  3JTH A;  3LAP A;  2IJL A;  5E1Z B;  2EFP A;  3LA7 A;  5L3E A;  4P5O A;  1HW2 A;  2W25 A;  4OIN F;  1IRF A;  1R36 A;  1U78 A;  5JFR A;  1ZRD A;  4NB5 A;  2JRT A;  3REO A;  1W7P D;  2LNB A;  1FX7 A;  1LJ9 A;  2HGC A;  2R7D A;  3WTY C;  2VBW A;  2FEZ A;  4ENM A;  1T98 A;  5TRD A;  1YYV A;  1ZLK A;  1EH8 A;  2XGX A;  3J80 K;  4P9F A;  2XRN A;  4PGG A;  4BHB A;  4G9Y A;  5BPI A;  4KNY A;  1OYY A;  3QP6 A;  4QLC U;  1JXS A;  3HTS B;  1BI1 A;  2P5K A;  2GIV A;  3CDH A;  2PG4 A;  2FBH A;  3RJP A;  2K27 A;  2Z33 A;  2QEN A;  1O3T A;  4M73 A;  4U7B A;  5DYM A;  3M7G A;  3O6B B;  1XGS A;  2F5F A;  2CGP A;  2BYV E;  3COA C;  4YG2 F;  4CYD A;  3GZ6 A;  3IRR A;  5L3B A;  2Q2E A;  2V79 A;  3HSE A;  2UXX A;  3C3W A;  1FWZ A;  2X4H A;  3Q9V A;  3L2C A;  4EJV A;  4JQF A;  1FLI A;  2DAO A;  2DQR A;  2STT A;  1FP1 D;  2CWE A;  3GFL A;  2OA4 A;  3BP8 A;  1PP8 F;  2DPD A;  3ZP5 A;  1TQM A;  3C7J A;  2H27 A;  2NNN A;  3IC7 A;  4KIF A;  1USS A;  3GUD A;  4N0B A;  5CVJ A;  4PDK A;  5CVI A;  5HDN A;  1IN4 A;  1LQ1 A;  1SD5 A;  2EV5 A;  2D45 A;  1XGN A;  3DPT A;  1B9M A;  1YFH A;  3DQV C;  2PN6 A;  4LFU A;  4ZZD A;  2JT1 A;  1BM9 A;  1E2X A;  3C1D A;  2K7L A;  2XHK A;  1SMT A;  4LLN A;  1YS7 A;  4A0Z A;  1FSE A;  1R1U A;  3H92 A;  5A2Q Z;  3F8M A;  3P9I A;  4ENJ A;  2QUF A;  5LHI A;  3MZH A;  3DV8 A;  4IXA A;  2EB7 A;  4MEY F;  1DDN A;  3T8R A;  4WXH A;  5E8I A;  2HKX A;  5BOX A;  5FLX Z;  4IVN A;  5JVT A;  2A6H F;  3I64 A;  3RPU A;  4A12 A;  3Q9S A;  3FMS A;  5LRR A;  4AIH A;  4G8X A;  3KP6 A;  4O6J A;  2VT2 A;  3V8K A;  1YIO A;  1KU2 A;  2WC2 A;  1J7K A;  3ZQ7 A;  2GWR A;  1XDU A;  4HZF A;  1F1Z A;  1FBU A;  4DNC A;  1ZN2 A;  1IF1 A;  1FOK A;  1DP7 P;  1QZY A;  2QLZ A;  1IN7 A;  2NNY A;  2PEX A;  3DEU A;  3E6M A;  1SMY F;  2ZME B;  4UXN A;  2MD5 A;  4CGZ A;  3TO9 A;  1REP C;  1X3U A;  2QQ9 A;  1GXQ A;  3N4M A;  4RB2 C;  1HST A;  3P9K A;  1D3Y A;  5FD5 A;  2OBP A;  3PQK A;  1YG2 A;  3ECO A;  5D5W B;  5LLQ A;  4KMU X;  2V1X A;  3N97 A;  4RB3 C;  5CJ9 A;  4LLL A;  1XGO A;  4F7Z A;  2RGV A;  4ZYG A;  4AIJ A;  3RIR A;  1E17 A;  2W24 A;  4AD9 A;  3F8N A;  5HOO A;  1T39 A;  4RAY A;  2DO7 A;  2ADU A;  1FNN A;  4EJU A;  3GF2 A;  3K9T A;  1BC8 C;  4QWQ A;  4GGG A;  3WTV C;  4BH9 A;  1QPM A;  2RNJ A;  4ASN A;  2G7U A;  5J8F A;  1T6S A;  1HKQ A;  1Z05 A;  1K78 A;  2W85 A;  2VBX A;  2ESN A;  3QU6 A;  4E70 A;  1A04 A;  2BE5 F;  3F21 A;  2P5V A;  2FBI A;  3M8F A;  2QM3 A;  3WOD F;  4L5J A;  3KZY A;  3L09 A;  3RYP A;  2YSR A;  3FF5 A;  1W7P B;  1HKT A;  1XSD A;  2PMU A;  1AWC A;  4GO1 A;  1SD7 A;  2H09 A;  3BOQ A;  2ZO4 A;  2A69 F;  2RKH A;  3I59 B;  1CGP A;  1PDN C;  3DPL C;  4U0Y A;  3WTU C;  1KQ8 A;  5CVU A;  3K1P A;  2OQR A;  1IN8 A;  2K4B A;  1J0R A;  3V7C A;  4HDV A;  4WX9 A;  2VN2 A;  3G73 A;  2GAU A;  2HQN A;  2DPU A;  1TQI A;  2YR2 A;  4UVA A;  3DP7 A;  2MLG A;  4L18 B;  2RVC A;  4UV9 A;  1IUY A;  2DFI A;  2A3S A;  4NHJ A;  1H9T A;  3TQN A;  4B09 A;  2X0L A;  2P8T A;  3K0L A;  2GA2 A;  4M9Z A;  3WTZ A;  1QO0 D;  5ICE A;  3MCZ A;  1RI7 A;  2FE3 A;  3VFZ A;  1RNL A;  3R60 A;  5CYV A;  2L4M A;  2VOD A;  3O3K A;  3F8C A;  3R0J A;  5ICG A;  4XLN F;  3WE3 A;  2IA1 A;  5LGN A;  2XAG A;  3I5U A;  4AIK A;  3BJ6 A;  2J5O A;  3CUQ A;  1G6N A;  1MDM A;  1TTY A;  2VOO A;  2VE9 A;  2R7F A;  4CZZ A;  2VC1 A;  3WG9 A;  1I1S A;  1KQ9 A;  1OPC A;  1CF7 B;  4PGH A;  2DLL A;  5HS8 A;  2XKO A;  2M5W A;  2E1C A;  2BEO A;  2DTR A;  3IWZ A;  3KP3 A;  3LA3 A;  4I98 B;  1Z91 A;  2CO5 A;  3I53 A;  1HQC A;  4Q47 A;  2VE8 A;  2WV0 A;  3ERE D;  1NHA A;  1BJA A;  5CVR A;  2FQ3 A;  1IXC A;  4PZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...