2M7AA

Enteropathogenic escherichia coli 0111:h- str. 11128 orf ec0111_1119 similar to bacteriophage lambda ea8.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
EDQEQWAMQTLMGSGVLARCRIHNDVILDSGNDASSAYKLGTYLYQKDNSCNLFNTLTEARDAIKDAYESYCGIDDCPQCSKYIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title The Solution Structures of Two Prophage Homologues of the Bacteriophage lambda Ea8.5 Protein Reveal a Newly Discovered Hybrid Homeodomain/Zinc-Finger Fold.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1920 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m7aA00
2M7AA 2M7BA
chains in the Genus database with same CATH superfamily
3P9IA 1KU3A 2JQ7A 3DPUA 1XX5A 3LQRA 4UVAA 4E7HA 2R5ZA 3JSOA 5D4SA 3HOYJ 2DDAA 1BI0A 3LAPA 2V1UA 2VASA 4AC0A 2M4GA 4A6DA 4RS8A 2I5UA 3GLLA 1R23A 5E8GA 3K6GA 3BR0A 2K40A 2R7TA 3BOQA 3HOTA 4CUGA 2MBFA 2RREA 2HYFA 2VPRA 3LSRA 1WH5A 2VKDA 1ZG3A 1VF9A 2VT3A 1D0XA 2ZNZA 2VL8A 3JRIA 3VEPA 2WC2A 2XROA 4HPQA 2XF5A 4IJAA 5DD8A 3KZZA 4CYCB 2DI3A 5FLMJ 1I6XA 1YJWI 5CYVA 4ASNA 3MD2A 2EV5A 3DWLE 2JA8J 1RRJA 2LDUA 1SD4A 2F4IA 2E19A 2BYVE 4DIQA 3U1KA 3I9V2 1I1GA 4FHTA 2IAIA 3CJTB 2R7SA 3MKZA 4WWCA 1UZCA 3EDPA 3N97A 4XKVA 4X0GA 5GAEJ 2M2EA 1LFPA 5DYMA 1SFOJ 1BJAA 2AXTC 4Y4RA 5LEJA 4A3KJ 2O3FA 3F72A 3C2BA 3BG5A 3TEDA 2QKMB 2QSFX 4O3MA 2ZXWH 1Z7UA 3H5RA 1RKWA 2RKHA 1EKEA 4CZZA 1QRYA 2R7DA 3HOSA 2DMTA 2VKHA 2XUBA 4GDFA 1IZ1A 4A0ZA 5IYDJ 2HTSA 2I10A 2ZMEA 4B44A 5FO5A 4EGZA 5IT9Z 3BC8A 1O57A 3GZNB 4G6TB 4MFDA 1FLIA 1R5GA 3ULQB 2LFBA 2CRGA 4EJUA 2F5VA 1ZELA 2QF7A 4HOBA 2DOFA 3NRVA 4BYYA 2F6CA 4U0WA 2PEXA 1YHQI 1W36D 5DDGA 4CZCA 2QQ9A 1FP2A 2G9WA 3FF5A 3CP2A 3KZYA 4PGHA 2LLKA 1U8BA 2X6WA 2BE5F 3B6CA 1J0RA 1FT9A 1KONA 1LDKB 1ETXA 2LY1A 2A3SA 5TJJA 2E2JJ 1BR4A 1T33A 5HLIA 2STTA 3SYTA 2MC4A 3JTHA 4WK8F 1MNDA 1TW3A 5BOXA 2IBDA 4OIRF 3KP7A 1BBYA 3CUQC 4EQQA 4MFEA 4AWXB 1Y0UA 5HS7A 1PP7U 4YRVA 5FKOA 3FXQA 3M1CA 3GTGJ 4A3LJ 2DAOA 2DMNA 5CVVA 3RPQA 5ICCA 1DUXC 3UKGA 3L2VA 2ZJ2A 5J1YA 2R92J 1W5SA 1A6QA 2EBIA 3S2WA 1Y6IA 3ZP5A 1XSDA 5DUIA 3I4MJ 5H6RA 5D5WB 3GUDA 4AYBN 2RGVA 4RGRA 4M6VA 3GXOA 3ZMSA 2DCEA 3S1NJ 1R49A 2CMPA 5D8KB 3Q5FA 2X9DA 4ZTJA 3OWTA 1V5GA 2PBIA 2VBXA 4WCGA 2OPTA 4A5MA 3RKQA 4A3GJ 2IP2A 5KVRA 4RBOA 1ZGWA 2G7HA 2HOTA 4LB6B 3BJ6A 2QCOA 3IV5A 2ME6A 1DP3A 2MLGA 1R00A 1Z05A 4L0ZB 1POGA 5K1YA 2X51A 2CUJA 4PJNA 1YTYA 1J9IA 4XK4A 3KETA 1HOMA 1TQPA 4IKFA 1W5TA 2JZYA 2PMHA 2RN7A 2L3DA 2W48A 3HUGA 5CJ9A 1LDDA 3CMAI 1H8AC 5DUKA 3IL2A 2V6EA 3S1QJ 3WTTC 2TCTA 3QOEA 2L01A 2Q2EB 2D1HA 4XKBA 4XSXF 1HBXG 1ZTRA 3BY6A 6PAXA 2XKPA 5FKLA 1XDSA 2XAGA 4UV9A 4I0BA 1IN6A 2EINH 2IEKA 1E17A 3HKZN 1D1CA 4JX6A 4EEFG 4A3FJ 1F4KA 3NARA 3IUOA 1AOYA 3K70D 3EQLF 2DT5A 3NWSA 3TW7A 4JP0A 2PI0A 3LL7A 2XAJA 3HRMA 1W7PD 4G94A 3L2CA 4CXFA 2XGEA 2LKPA 3HRUA 4RB0A 2XV4S 1QPIA 3EPZA 3FXJA 3DLAA 3K4JA 4HEA2 2NNYA 1BOAA 2BOLA 1TW2A 2DTRA 1FZPB 3J81Z 1BI1A 1UHMA 2RQQA 1X1CA 4HBLA 2VE9A 2R7RA 4U88A 2H8WA 4NUBA 2FBIA 2CQ7A 3BDDA 1WJEA 2L7KA 2QQAA 3BPXA 1S29A 3SFIA 3CCMI 2IT0A 4HDVA 3T8TA 2JUCA 1QHHD 4LIUA 1MBHA 3OR1C 5M3FJ 2HGCA 3DXJF 3WHBA 1SAXA 2K27A 1FBUA 3I53A 3V7CA 1OR7C 1Q1VA 3VODA 3PM1A 3DF8A 3GFJA 2HKOA 2HXOA 3K10A 3PNYA 1R1VA 3LSMA 3RCOA 4EM0B 2NVQJ 4JK1X 1T08B 3MCZA 1EV7A 2G0EA 2KRHA 4AD9A 5L3EA 5B3SH 1B8IA 1QZEA 1AKHB 1XD7A 2R4GA 2M8GX 3DKWA 3WTUC 4IF4A 1TWFJ 4B47A 1E3OC 1XC5A 2QQ8A 3HRSA 5D4RA 1JUPA 2ZB9A 4A3BJ 1TWGJ 3FKIJ 3HJEA 1YOVB 4JX5A 5JHUA 1OCCH 3W6KB 1JI8A 3CD6I 4G7HF 3MFKA 5EGOB 5HOOA 1SEUA 2HDWA 1KU7A 4L5IA 3T1BA 1XPXA 4EJTA 3IH4A 3E6BA 1FTZA 1RETA 2K9SA 1FBQA 3ASNH 1ODDA 2EIJH 1BC7C 3L1PA 4M74A 3OYGA 1D1BA 1A36A 3I5UA 2QKLB 2RV8A 2JMWA 2X1CA 3MEXA 1WJAA 4G9YA 2UV1A 4LIVA 4NQWB 3FIWA 1ZGAA 3CC4I 3TMOA 2ELJA 5ERIA 5FRNA 4AIJA 4G7OF 2GXGA 5L3DA 1WVRA 3GF2A 2ELKA 1X3ZB 5FKKA 1H9GA 3L7WA 3W2WA 4KFCA 4NDLA 3HB9A 5HLGA 4E7KA 3MKLA 3FHZA 1W0UA 2W7NA 2E71A 2A07F 1KU9A 4ENMA 4UUSB 2TRTA 1TNSA 1MBJA 2V9VA 3BG6A 2UUZA 3DBRB 4AM3A 4RAFA 3H9QA 3RYRA 3Q0WA 2MH2A 4KIBA 4ZZLA 2V9PA 5EF6A 5F08A 1NK2P 4RM2A 3VB2A 3PO3J 1QPMA 3RQIA 4LMYA 3CJRB 2HDDA 5CVUA 1LQ1A 2FD5A 1BI2A 1FYLA 2EJRA 3E1SA 2L0KA 1VI0A 2KDZA 2MD0A 1D1AA 4RGUA 2XGXA 3OV8A 4RAGA 3RIRA 1QGPA 3IWZA 5F1JA 2KJBA 3BG9A 3E7LA 2XF7A 2ZKZA 3LA3A 3Q9VA 4HYEA 3VYUB 4LITA 1LE8B 1K4TA 1W4MA 5K5OA 2A6EF 3HSRA 3OYDA 2DFFA 2XPWA 2V79A 1J7KA 3I55I 4BS9A 3QYEA 1I6HJ 4ZYEA 3HOUJ 2COMA 3LSPA 1HDDC 2VC0A 4F55A 4HNTA 2IVMA 2DLLA 5FD5A 1RKTA 2XAHA 2VI6A 3K4LA 4CYDA 2CSOA 3HKZA 1FMVA 3SXYA 2R7FA 4N9IA 3K4BA 5CQGA 3LSKA 4L9TA 1WJ5A 1A6IA 3QP5A 2H8RA 1ACIA 3ECOA 2VLAA 2EIKH 2VE8A 2FU4A 4BQAA 1CF7B 4HAMA 1DP7P 3R61A 2QGUA 3ZQLA 1IGNA 3I59A 2HQAA 5J47A 2P8TA 2Z33A 1K61A 2HFHA 4GFBA 3DEWA 2BBYA 4N4NB 2BVMA 4G6DA 3SDBA 3NEUA 3BR1A 3WG9A 2FNPA 1WJBA 1ZHFA 1RC9A 3S17J 4HF2A 1HSTA 2QSGX 1KQ0A 1SC7A 3FXOA 4XRMA 4CICA 1PJRA 2EPFA 1FPQA 1PUFA 1JKOC 1WQ2A 1SVOA 4I01A 5LD2C 4DYQA 4RA2A 3HOXJ 1WZ2A 3A01B 4P1WA 3F8NA 4NB5A 2ECBA 4ZDPA 4XLPF 2VQLA 1JUSA 2F48A 4BACA 1B59A 1ZR4A 2QBYB 5JVTA 2KIFA 2Z3YA 5GP9A 5ICEA 2F4OB 1ZN2A 5LGUA 1SD6A 3CDIA 3IKTA 3CMEI 3T8RA 1E2XA 1NG6A 3TDZC 4A69C 2IS2A 2R0QC 1OCZH 1VQ4I 2VOPA 3HHHA 3RPUD 4UNOA 4IL6C 3FX3A 5BS6A 2P81A 3E3VA 2BGCA 2BY0A 2M0MA 1XSVA 2K9QA 1B9MA 5BMZA 4PSWA 1Z77A 3OMYA 2IS1A 4L0YB 1GLNA 3U2RA 1QU3A 2FXAA 2K3FA 4BQOA 2ISZA 2CG4A 1F5TA 4WXHA 2XF6A 3KP5A 3MWMA 4MTDA 2D1VA 3W2VA 1BI3A 3GTKJ 2OTLI 1RPWA 4F3QA 4I76A 5J4YA 3ZQCA 1TBXA 1JTXA 1J75A 2DT7B 2H94A 1L3LA 4ETSA 3OYLA 3S3NA 2VBZA 4Z6YA 2X1DA 3J80K 2E1OA 4F7ZA 4CCNA 2CWEA 1LJ9A 2Y69H 3HHGA 3DU5A 2E36A 5J4VA 4OU0A 2GA2A 2M7AA 2YX4A 3ZMZA 3JRBA 4N4OB 4L9JA 3C18A 1YIJI 3GCMA 4N0BA 2H6CA 5L3CA 1WPKA 2JJ7A 2GIVA 3OS1A 1QO0D 4HX7A 4CYCA 1Z6TA 2BY3A 5J1UA 4XM3A 1MZBA 2IRFG 3PQJA 2Y75A 4GYIA 5IOYA 3T0YA 1WH7A 3RPUA 3ERED 3JRCA 1GHCA 1F36A 1V5EA 4WXCA 5B1BH 2HQ5A 5HLTA 1P9QC 4IHYA 1V55H 1F1ZA 2X48A 1R71A 2LVSA 2RNJA 3SZTA 2WAFA 2VUMJ 1OLTA 2LTPA 2EWNA 4XLAA 4FTHA 4HQMA 2HPIA 5E1WA 2F5EA 3WTVC 1QA6A 1MJ9A 3IAS2 4OIPF 1MMNA 2N8GA 2LD5A 4MHGA 5TGTA 3R6SA 5HDKA 2A05A 1IRGA 3PIPF 1PVEA 4MEYF 1HLVA 5AONA 1BN5A 2YX7A 5DM7F 3OIPA 3CTAA 4DQ2A 4A3CJ 1GVDA 4HV5A 3B6AA 1RNLA 2HVQA 2GLOA 1MBGA 3OYJA 2J5PA 5EZHA 1N25A 3LAJA 4RAYA 3WE3A 3FDYA 1V3FA 2CUEA 3JW4A 2K9NA 3L2UA 2A68F 2RNGA 3H0DA 3QAHA 4J01A 2KZGA 2HQNA 2P7VB 2MC3A 2DMPA 1X4PA 4A3EJ 4D5CA 5J40A 5HDNA 1LEAA 2GQQA 1XSXA 4KIFA 5LEKA 3G73A 2V1XA 5LBQA 2Y48A 5H6QA 1R1UA 2QM3A 3H5NA 1UCRA 2EFOA 2WB1N 3VOEA 1DU6A 4PZJA 5K7HA 2EFPA 5TRDA 2QLZA 1UHWA 4PSXA 4IOAF 2H1KA 1E3HA 3R4KA 1LDJA 4V2GA 5CLSA 4NC8A 3N05A 4A0XA 2L9NA 2GBYA 3DU6A 3A0HC 3I71A 4P9FA 3QWLA 3FBIB 2EFNA 3DTKA 1YI2I 2A61A 4EATA 2HR3A 2L9RA 1MNEA 1OKRA 1MBEA 2FQ3A 4HW0A 3CF5F 2AS5F 5FKMA 2LNBA 3AL0C 3IH2A 4OMZA 5FRMA 2FUG2 1SVMA 3K1PA 3QPSA 3V8JA 2OZ6A 5HS8A 3QODA 2WV0A 2PMZN 3CMMA 1U5TB 1Z91A 3BR2A 2DPUA 2W24A 1GT0C 3AKZA 3K0LA 3ABTA 3BTCA 4UVBA 3BR5A 3M8JA 1IXRC 2L7FP 4S0HB 1K6YA 3W6VA 4CCLA 1KGSA 1RIOH 2PJRB 4FE7A 2ZSIB 1D5VA 3DP7A 1HKQA 2DA4A 2HYJA 2W00A 3Q0VA 2MW8A 2OF7A 2M5WA 2COBA 1K78B 3M3YJ 2EA2A 1MW7A 4DZJA 3CO6C 2CGPA 1OQYA 4CDGA 5F04A 5K7FA 3ECHA 2DJIA 5E8IA 3OL4A 1JHHA 5LRRA 3K4CA 4DNCA 2XRNA 4Q48A 1X1DA 5E3LA 5D8LB 4EMSA 2BZTA 2VJ4A 3EUHA 1IN8A 3GVAA 3X2QH 5JFRA 3HM5A 3CCSI 1B72B 4XKWA 3E6CC 4IQJA 1USSA 1XCVA 4LG0B 2OTJI 5LHIA 2FSWA 2LMDA 3UR3C 2O61A 4YEJA 3QPTA 2ACJA 2Q2EA 1TL8A 3QPLA 4M3FA 4RGXA 4M3EA 1Z1DA 5LLQA 1MH3A 2KLOA 3KIOA 1IC8A 4UUVA 2L7ZA 4W97A 1LFBA 5IT9K 1GVJA 2BVLA 5F0CA 1KU2A 2K9MA 1BA5A 1W5CC 2IGNA 2YSRA 3Q9SA 2VQCA 2HU9A 4A6EA 1HKSA 1MMDA 2JA7J 1HC8A 1ULYA 3IWFA 3TP3A 2HWVA 2DYRH 1VFCA 1O7LA 2HOEA 5D5VB 2JK3A 1ZK8A 1YS7A 1TNTA 2EK5A 1BOBA 1CGPA 1A31A 2FOKA 2NVYJ 1ZRDA 1P7IA 4I02A 1TWHJ 4II2A 5BPIA 1IG7A 1RUNA 4PDKA 2P4WA 2K02A 3ZQHA 4ABZA 3SEQA 1T0FA 1GV2A 4FT8A 3JREA 4O5VA 4C2TA 3CJQB 5GTIC 3HBLA 5B66C 4QWQA 2VQHA 3BROA 3K2AA 4MNUA 2ZXHA 2VKEA 3ERMA 2VODA 9ANTA 3TKYA 3KP3A 2FE3A 1ZLKA 1IRXA 4KNYA 3H5AA 1X3WB 2GA1A 2WWYA 3MZHA 1U8RA 3R60A 4F93B 3G3ZA 5JI6A 3KP2A 1PYVA 1AKHA 5IT3A 1ZQ3P 2KIMA 4MTEA 2L9SA 4XLHA 2DA2A 4C3IJ 1J5YA 4L9VA 5D6FA 2KIQA 3A02A 2NAZA 1I3QJ 1EA3A 2WB1A 4BBRJ 4XQFA 1X3UA 4BJ6C 3OYHA 2DOEA 3JSPA 2R5YB 3RZOJ 5GPCA 2LR8A 3A2KA 4Q47A 2FOWA 1A5JA 5ED4A 3OR2C 5EGOA 2E60A 4X6AJ 1O3TA 3B02A 3LA2A 4E7JA 3H36A 2CQNA 2IW5A 2DW4A 1IN4A 2DMUA 4XLEA 3ZMDA 1S3JA 1V4RA 2EZIA 4J19A 3CC2I 4NQWA 2CV0A 1YW9A 5HDGA 2XRLA 3RTRA 4HLXA 2FQ4A 3U9GA 3ZOBA 3OY9A 5ICFA 2UWMA 4JYKA 2O9LA 3SDGA 2LC2A 1FOWA 3B73A 3Q0UA 5E20A 4UUSA 1BJZA 1XG1A 1IXCA 2VOOA 3GW2A 2PMZA 2W84A 2XGCA 2BY2A 3TO7A 2VBWA 3HGGA 1TZLA 3L00A 2ZFWA 1RI7A 5A2QZ 1UELB 5KK1A 3FXLA 1I39A 1SFUA 4XBFA 1XGOA 3DKXA 2XGDA 2FBHA 1X19A 1ERDA 4ZH4F 3KLOA 3ZQGA 4JBAA 3P5JA 2HXIA 3R0AA 3VYSB 4XRSG 4G7ZF 2KMUA 3FKJA 3DEUA 1H0MA 2KFDA 4ZDLA 5J8FA 4B4CA 4E7SA 4JQFA 4C2MJ 2XVCA 3WTSC 1A35A 2VT2A 1J09A 4Y52J 1D8JA 3OSGA 3BWGA 1R7JA 1ZRFA 3J81K 1LE8A 2CV1A 2DFHA 1VQNI 1F9NA 3FHNA 3PJRA 3WG7H 3GFMA 1APLC 5FJ8J 1MJBA 4BJ5C 5F6FA 3JAMZ 3D5SC 3DFGA 4IX7A 3ZR8X 2YR2A 1USTA 3JRAA 1OJLA 3ZN0A 3RDIA 1NH3A 1IDZA 1OYYA 2YUSA 3QQAA 2V4JC 4AU7A 4DGWB 4B1RA 4AIKA 1Y39A 5EEAA 3D5RC 2BXYA 4V2FA 4M9ZA 4RDUA 3RI4A 3MZ8A 4A3MJ 3K70C 3V7SA 1CF7A 5M5YJ 2XAFA 1TTYA 5J8CA 3AL0B 4XSZF 4UB6C 3ELKA 4GXOA 4LK0F 3VFZA 5IP9J 4BY1J 2B0LA 1BIBA 1ETQA 1OYIA 5LFAA 2NVXJ 3DEEA 2EB7A 3H3ZA 1K7AA 4MQVA 3OL3A 3S93A 2VBYA 1KZHA 3L2RA 3S16J 4DW6A 2F5FA 1FMWA 3U1DA 1R9TJ 1YX5A 2H27A 1ZR2A 4E4HA 3ABLH 4QTRA 2EQRA 3ZQ7A 2Q0OA 1IAWA 3S2DJ 2OZUA 3DKYA 2HZTA 3FXUA 3A01A 3TOBA 2W85A 3A03A 2O6GE 3I4NJ 4JX4A 1QVUA 2ECCA 4PFOA 3I4PA 5DCMB 5IY5H 2W4SA 1VQMI 2FEZA 4G6QA 2PJPA 3F3XA 2I8DA 1XCBA 3TO6A 4E7ZA 4HNUA 3JRHA 1X58A 4H0EA 3ABKH 5JVGF 1XGMA 2XKOA 2WTEA 2CQXA 2PMUA 4ZTFA 3CQZJ 1IN5A 4D0PA 2LKXA 3K4NA 1OCOH 2LREA 3LWFA 2EZLA 3K4MA 1SMYF 2LY9A 2OAZA 3L2WA 4IO9F 3QRFF 3GTLJ 3KZIC 3P7NA 2R7OA 3DBLB 2P6SA 2DODA 1OCTC 4LGWA 2NNNA 2QENA 4X1EA 4AVPA 1JHFA 1WJDA 2ID3A 1MD0A 4A3DJ 1WKMA 2LP0A 5HNHA 1DPRA 3HXLA 1Y56A 2MH9A 1QNTA 3CCEI 3S14J 2OQGA 2LY2A 3IAM2 4L9NA 4XRFA 1ORKA 1AHDP 2A69F 5E3MA 3GTQJ 4IRGA 1IN7A 5C4JJ 2PQ8A 3MAJA 1SFXA 1AA7A 3GX4X 4MLOA 2P5VA 3MN2A 5E1ZB 3W2AA 2IA1A 2LG4A 4CCMA 3M7GA 3PUBA 3WODF 2XSJC 1RZ4A 4XRSA 3J7AY 3LA7A 1Q1HA 3C1DA 2O8KA 1MMSA 1NTCA 2ZJPF 4A2UA 2ELHA 4RB2C 2KRCA 4OOIA 1SD7A 2LH9A 1ZAOA 2IA2A 2HVRA 3CO7C 1XB4A 4BHBA 4II3A 4ENNA 3KYDB 1WHUA 1W1WE 1QQIA 3ZQIA 3FM5A 2IS4A 3I64A 3WTXC 1OR7A 3WTWC 1YFHA 2RQPA 4Y33A 4J00A 1XS9A 3PL8A 4ON0A 1HSJA 4ZC3A 3JCUC 3NAUA 5TISC 2UXNA 2JT1A 2VN2A 3V8KA 4XIDA 1Y8RB 5IYBJ 1L0OC 4ZYHA 5IPAA 4EJWA 1GXQA 4RM3A 4BE2A 2M45A 2XASA 3CCYA 1TLHB 1U9NA 4HSRA 5KCMA 4BQQA 3WTZA 3TBIA 1Y8QB 3H0GJ 2B7EA 2K5CA 2Q8KA 4U7DA 1HA8A 1N78A 3CZ6A 1WFXA 3IH3A 3LSTA 5EEHA 2R7QA 5K5RA 1KA8A 5JLWA 5F27A 2WAQA 4C3HJ 4ZJZA 1MDMB 4KJZA 1EH8A 1Z6RA 4I0AA 3IRQA 1RESA 5LHHA 2L2OA 1D3YA 4WXDA 3KX2A 4ITVA 2AHQA 1K4SA 2PX9A 1YRNB 1FYKA 2M7BA 2XPVA 3DPLC 3E5XA 2WADA 1UAAA 2DT6A 2IXSA 2BHYA 2CQQA 3K1NA 1WRJA 1U6GA 3V8LA 2QQBA 2HKXA 4H4KC 3CUQB 4ENKA 4BXUA 3PNTA 1MKMA 4B8XA 3GLXA 5E17F 2AQEA 5BQTA 2BY1A 3C2HA 2VC1A 2HNHA 4BU2A 1JKPC 2Q1ZB 1G3TA 1IDYA 3BR3A 3KYCB 5BNGA 3C7JA 1AWCA 3C3WA 2NVTJ 4Y13A 5HNFA 2DDBA 4KT6A 1KYWA 4QPOA 5EYRA 2ETHA 3BZKA 3BPVA 3F8BA 1XMAA 4Y7NJ 4D7NA 4D9JA 4HG2A 3QPHA 4IZZA 3GZ6A 4Y17A 2CFXA 2TDXA 4BAYA 4I6ZA 2WAEA 4G12A 3OS2A 1IXSB 1WGXA 3IC7A 1BW6A 2P6TA 3FWEA 2DFEA 2JVHA 4AUXA 1G59A 2MFZA 1S7AA 1UFMA 2GWRA 2VJJA 4D7MA 5FLXZ 1EH7A 3MKWB 1IJWC 4LB5A 1REPC 1SAUA 1OYWA 3BLYA 3OYEA 4XLNF 3MKYB 2ADUA 4PJLA 1SFKA 2M34A 2ME0A 3BG3A 2QZ8A 3Q3SA 3PSFA 1Y1VJ 2KRFA 2O7OA 3EETA 3V42A 4BDYA 1I5ZA 5E18F 1U5TA 1HQCA 3IKVA 3OYKA 3OOUA 5LRSA 2DBBA 2LKSA 2DPDA 1E3PA 4C3JJ 2ZCWA 4U7BA 1P4XA 3CCQI 2JRTA 2PJRA 1Z0XA 2BV6A 3WGIA 2DJNA 1XGSA 1K78A 1LEBA 3BZ6A 2EZKA 3BQZA 2DA3A 1MMAA 1P2FA 3CLQA 4A12A 3A0BC 5E3OA 3WU2C 1ZKGA 1JE8A 1W7PB 4HDUA 2W82A 1IRFA 2OV7A 3RJPA 4HF1A 1R1TA 4BNCA 4UHTA 5GPAA 1YYVA 2XC7A 1FYMA 1S9HA 3WGGA 1Z21A 5K7ZA 1B72A 5F0FA 1YX3A 4LG0A 3ISPA 4M3DA 4ANJA 4XR6A 4RLQA 1FNNA 2GXAA 2M8EA 3GZ5A 5EG0B 3BTIA 2E2IJ 5FROA 1D8KA 3U21A 5L3FA 4CCJA 5JR3A 5M5WJ 2L5QA 3KFWX 4YELA 2Z16A 2LF8A 2HDCA 1ITYA 3DQVC 3DLLF 2M30A 3F21A 2OBPA 2OA4A 4WF2A 3PFIA 3H9JA 2HOAA 3ZGKA 1ETOA 3ASOH 2STWA 2DTZA 1PDNC 2WBMA 1VQ5I 1S6LA 2VB6A 1IUFA 5HODA 3WHCA 4GGGA 4OMYA 3KLNA 5KAFC 3EYYA 4M3BA 5E79C 2LF7A 1G4DA 3OYNA 3T5XA 1OISA 3ZMVA 3F22A 1R5ID 2GOXB 4FISA 1R4NB 4QSHA 3K4KA 1JT0A 1S7EA 3RKXA 2CW7A 1B4AA 3H1CA 2DXIA 2W57A 2KKOA 4XN3A 4IXAA 3DTEA 1JJ8C 2QVOA 3CCLI 1LKXA 3F0CA 3ZN1A 2QEXI 2AQFA 4Y15A 3SQNA 1WI3A 3FISA 2AXLA 2CU7A 2NS8A 2EFWA 2CUZA 1EF4A 1WWXA 4DBRA 2Y0SN 2JTVA 3GO5A 3BP8A 5IOZA 4MQ9F 3S3OA 2MLKA 3A4CA 4BUPA 2PFBA 2R5YA 1FSEA 1HDPA 3FK7A 4LLGF 4B3AA 1U2WA 1Z7LA 1Z3YA 3VSKA 2KT0A 4EJVA 2ZXIA 2MD5A 1WSUA 2ICWG 5B1AH 4I7HA 1G3WA 4BBSJ 4EJOA 1R5HA 4ZYDA 1UB9A 1V5FA 5DV5A 4PFPA 5FB2A 2NVUB 3CDHA 3SFZA 5JHFA 2D2WA 1ENHA 5D5XB 4BE1A 2RAEA 1ZG1A 1HXDA 1B1BA 1ZGJA 4LOCA 2H1LA 4LFUA 3BJAA 1ZRCA 1YW8A 2Y2ZA 2CW8A 3G71I 4B09A 2M1BA 1I50J 4M73A 2J5OA 2ZC2A 1ETWA 2WV1A 2R7ZJ 1TWAJ 4RB1A 4YG2F 4ESFA 2IJLA 2E5ZA 1IW7F 1ETKA 3M07A 2DA7A 2KL4A 3K7AJ 4IPAA 2LRDA 1QBJA 3F23A 4NC6A 2OD5A 4RMNA 3REOA 3BT9A 3CUOA 3KEOA 4BY7J 1A04A 2DMQA 3CMYA 1D5YA 2CFOA 3ZMTA 2GIZA 1ETYA 4PUSA 2KZVA 2XB0X 3C2GA 4KYWA 1P92A 2KJCA 3I58A 3F6OA 2NS0A 2E35A 4M3GA 2CH0A 4NNJA 2ID6A 4I99C 1O3QA 5CPRB 3PSIA 4UB8C 1LNWA 1B9NA 1U9OA 2WY8Q 4MGRA 1GDTA 4IEJA 2ZMEC 4S04A 1SMTA 4UUTA 3KYLA 3S8PA 3TO9A 3CLOA 3J7AO 2L9VA 1VNDA 4RLFA 4NC7A 3S32A 3WE2A 1QZYA 1T95A 2X1EA 1T8IA 2CJJA 3GFIA 3OIQA 1MSEC 1TQIA 2DFIA 4TV7A 3F8FA 3O2PE 3AG3H 2EA4A 2KIUA 3QOPA 3IP4B 4UXNA 3LSJA 5FFXA 4BL0B 3OYIA 4IQ4A 1TT0A 2L7MP 3GTJJ 3HZJA 3ZPLA 1U0JA 4BXXJ 3KP4A 1O4XA 4XICA 4M9XA 3TQNA 3GMEA 5HVQC 3GEZA 4Q5SF 2LBFB 3N4MA 3PFYA 2A5YB 2OQRA 4B3XA 4XLFA 2R7WA 5E3NA 1HKTA 1DDNA 3LNQA 2LOOA 2ZNYA 3OYFA 3O6BB 5F64A 4P55A 1MH4A 2IGOA 4E6KG 2VIXA 2F5CA 2LYCA 2L02A 2E1MC 2W25A 3S1MJ 2X0LA 1EJ9A 2Y31A 3H9GA 5D5UB 2ZJRF 1O3SA 1IUYA 3FXMA 3SZPA 2HOSA 1FSHA 2K3PA 1UMQA 3J7ZI 1MGTA 4Q4ZF 3E5UA 1JTYA 1XMKA 3E97A 3ROUA 3AFHA 4HQEA 5DCMA 1CQTA 3RQ4A 2IS6A 1MJAA 2VJ5A 1HW5A 2H6BA 2RDPA 3OS0A 3K69A 2JA5J 2Y0SA 3IRRA 1YITI 2CYYA 4OIOF 4I09A 2HVSA 5BPDA 1DGRM 3TOAA 3H3VK 4V19K 2Z2SB 4Z2YA 1WJFA 2W1OA 4XN0A 1W36C 2QWWA 4KITB 5J1RA 1RR8C 1WCMJ 4LJZF 2P7CB 2O03A 5A2QK 3JR9A 4IHSA 3R0JA 4MO7A 1P6RA 4YFNF 5ILUA 4ESBA 1XMXA 4E7LA 3EUAA 4EGYA 2F5DA 1OCPA 2DOAA 1OFCX 4PGGA 3ZQFA 5J6XA 3L09A 1TT5B 1X4OA 3VSLA 4F92B 2X4HA 4AVZA 1I3AA 3G6EI 2OU2A 4YFXF 1OMIA 3O3KA 2R7UA 1JKQC 3L2QA 1AU7A 4M72A 4G8XA 3V4GA 1DGWY 5H2FC 2BW3B 4W1UA 4R79A 3JAMK 4S05A 5FFZA 1HCRA 4BKXA 2O8XA 3VYTB 1ON2A 1TQMA 5LGNA 1E0EA 3AG1H 2VXDA 3SZGA 1QVTA 1J2XA 2A6HF 4RAZA 3FM3A 1J59A 4OAYA 3HYIA 1X1AA 3G4SI 2K7LA 1VQ6I 3F8MA 1I27A 1LB2A 5LHGA 1FOKA 3RYPA 2PLYA 3LMMA 2JA6J 2VXZA 2K4BA 2PG4A 2QA4I 4CGZA 2YU3A 3S2HJ 2K85A 1YQAA 3QYBA 4EV0A 3M8FA 4M6XA 2CUFA 4BEHB 4P9UA 4CHUA 1LPQA 3P9KA 1X1PA 4EM2A 2F4MB 3BQYA 4KIGA 3W3CA 4DOZA 4QPQA 3LSGA 1YJ9I 1F43A 2E7WA 3OYCA 3CCUI 2CW0F 2XAQA 4YIIA 1C0WA 4ZDOA 2HEOA 5H20A 4R1HA 2MSYA 2ZFUA 4CCKA 4FX0A 1JUMA 2WAQN 2CS3A 2R5ZB 4I98B 1MDMA 3I56I 1YE9A 3K2ZA 5DS9A 4BGDA 4OIQF 1GXPA 2KISA 2IPQX 4GCVA 1YRNA 2FF4A 1SD5A 2E7XA 3GFLA 1VQOI 2QUFA 1NHAA 2JPCA 5GAGJ 4FETA 3HIFA 3RKWA 1XTAA 3FMRA 2EILH 1BM9A 3ML6A 5AIQA 4BHCA 3QU3A 3HOWJ 3CUQA 2LSOA 1TC3C 4RGSA 4LK1F 5J3LA 1VQPI 1T2KA 4KMFA 3ABMH 3I3LA 1JKRC 4HX8A 4JOMA 3WTYC 1PP8F 4OWRB 1IV6A 5FKNA 2VJIA 2IGMA 4PK4A 3CJNA 5GAHJ 2Y0MA 3KEQA 1S7OA 1S8NA 5L3BA 4A3IJ 2P5LC 4L18B 1FIAA 3M9AA 5AIPA 5FGMA 2OJED 1T6SA 4LLLA 1KQ9A 5CQEA 3QYFA 2VQGA 1FOXA 3PUFA 2YS9A 1M1EB 3BCBA 1Z9CA 2CO5A 3NWTA 3JRFA 3WU1B 2FMYA 1T38A 1SVLA 4FASD 2QBYA 3ZQQA 2FA5A 3BTJA 4DJAA 4KUMA 5KAIC 2R7XA 4HF0A 3SEZA 2VKVA 1BC8C 4QIWN 1G3YA 2A5WA 1UG2A 4BDZA 4N9HA 1N77A 3BTLA 2ZMEB 1ON1A 4IHXA 2Y9YA 2JA2A 3CESA 1VQLI 1FBSA 1UG0A 2JSPA 1YS6A 1HW2A 1H89C 2V9KA 3ZXSA 2M4KA 2HI3A 3GBGA 2NYXA 2LK2A 3CDLA 2ZO4A 3CP8A 3ZMUA 1Z67A 1IO2A 4P96A 2R93J 3EUKL 2MYSA 3GTMJ 3ESWB 4L5JA 2B9SA 3D0SA 4KN7X 4UY8I 3AAFA 4NHJA 4CSWA 2L54A 4OINF 1Z3XA 1YO5C 4ZYAA 1O3RA 2X85A 5B5EC 1W7PA 2V26A 2M0CA 5DTDA 2OUMA 2FNAA 4OAZA 5CVJA 5K5QA 2XAUA 1XDUA 4BH9A 3E0JB 1B6AA 3TL4X 3J7YJ 2E34A 3HSFA 1JGGA 2XB5A 2E1MB 3F6VA 5IP7J 3VWBA 4IRIA 3O8HA 2HYGD 1K79A 3LSHA 2FX0A 3RZDJ 2IGKA 2Y30A 4CO8A 3FXRA 5EG0A 5IYCJ 1X1BA 3PQKA 3D5LA 1ZYRF 4WX9A 2GZWA 1N75A 4P5OA 1MIJA 3G1OA 3BG7A 5LGTA 3GTOJ 3TDUC 5C4XJ 3ZCOA 2QYOA 2KDOA 3E5QA 1VTNC 1MBKA 2DN0A 4PCQA 4HNVA 2L4AA 4AYBA 2XSDC 3ZRGA 4AIDA 2OC6A 1BL0A 3PO2J 2JN6A 2EFQA 1STZA 3CF2A 4CCOA 4ESJA 4IHTA 2M9HA 1YIOA 1T98A 3HOVJ 2FJ1A 3CCJI 4A93J 5FD6A 2BEOA 5M5XJ 4FQGA 1P7JA 3QU6A 3VYRB 4C30A 2L4MA 2JUGA 3BZCA 5HS9A 4HRIA 2X6XA 2MABA 3OYAA 4I2OA 3M8EA 2P5KA 3NQOA 3HRTA 5DCFA 1GV5A 3H35A 3KCCA 2DA6A 1ZREA 3FMQA 4CA0A 3PNVA 4E70A 2D5VA 3JTGA 5ICGA 1GUUA 2O0YA 3HUGB 5FLXK 1P4AA 3I54A 2XIGA 4FCYA 4KA4A 4M9SA 3I0TA 1RR7A 1G8XA 4UVCA 5C44J 4HZFA 1U5TC 2BHZA 1HF0A 4KISA 1ETVA 4XMYA 3TW6A 3TP0A 1K6OA 1BIAA 2KPMA 4U0VA 4XOTA 4XL9A 4LLNA 1VZ0A 2XPUA 1BR2A 3SHFA 4BXFA 1R36A 2DA5A 1KYZA 5D6EA 2MA3A 4DYCA 2DYSH 3UNGC 1IV8A 3GWZA 1DQUA 4B48A 4CH7A 1O7FA 2DU9A 1SFEA 4NBQA 5DEQA 2OCEA 3L9FA 4U0YA 1RUOA 4IHWA 4YIFA 3CCVI 3DV8A 4DYRA 2O5RA 4GRIA 1FC3A 3S1RJ 3CC7I 1BR1A 1I1SA 1IRZA 4O6JA 3RSNA 4D5FA 2ESNA 3HPHA 4BHPA 1JXSA 3DCFA 1S72I 1S5LC 4LD5A 1ONVA 3FK6A 3W6JB 4XKCA 2ISYA 3FZVA 2RVCA 1FIPA 4XNFA 4ZYGA 2DA1A 4F91B 4A5NA 1YJNI 3HGYA 2M87A 2P0WA 4IHVA 2RC4A 2DK8A 1U3EM 4HX4A 1FEXA 3FXKA 1MNMC 4XOPA 5JLXA 1X2MA 2DO7A 1YG2A 1B8IB 5CKTA 3OOPA 2EZHA 2PN6A 2GXBA 1FTTA 1IF1A 1G3SA 3ABUA 3TGNA 4HSTA 3DPTA 2CQKA 1U78A 1W0TA 2E5NA 3DTIA 2EIMH 2YPRA 2UZKA 4U87A 5C3EJ 2OCCH 4E7IA 3G1LA 2KQRA 1EH6A 4PJ0C 3S3MA 1YLFA 2C6YA 2FBKA 1VQ8I 3S15J 2ZJQF 5CVRA 3AG4H 4FX4A 3O8GA 3AG2H 5IP6A 3BR6A 3LFKA 4GYGA 4UV8A 1FY7A 3MZYA 4KMUX 3H92A 2EV6A 1XGNA 2BXZA 2GOMA 4D1QA 1DU0A 4PJJA 4C9YA 2MG4A 3OYMA 3KPHA 3OIOA 4EM1A 1P4WA 4DBQA 1FX7A 1ZLJA 3LFUA 2NRAC 4R8HA 1BW5A 3BJOA 2HS5A 2UXXA 1SANA 1FWZA 3E6MA 5EZGA 1OPCA 5EEGA 3M4OJ 4L5EA 1TP4A 1R22A 4KT5C 2Z99A 2EV0A 2LBFA 1MSFC 1JT6A 1LVAA 4PJMA 2GAUA 2XHKA 1Y1WJ 3VPRA 4MIMA 3KP6A 3FBNB 2HPMA 3F8CA 3KEYA 3MQ0A 3BCAA 3MVPA 4IVNA 4QLCU 4IRHA 1D0YA 2KHMA 3WGHA 3SJMA 2E2HJ 3E6DA 2EH3A 1R58A 1MBFA 2V1DA 2WA0A 1KQ8A 4LG3A 1JGSA 3ONQA 3OYBA 4A3JJ 4MEXF 3JRDA 3LOCA 4FE4A 3V7RA 3J80Z 2HQRA 2H09A 4M6YA 1LVKA 1NG7A 1TWCJ 4BQNA 3H3UA 1OCRH 4ZZDA 2DQLA 2FRHA 2XDVA 3HTSB 3HSEA 2F2EA 3QP6A 4K2EA 3HC7A 5M3MJ 5ILVA 5DD4A 3JRGA 2YU9J 1LFUP 3CCRI 5EJCA 4DZPA 1ZARA 2Z1DA 3LSIA 2GM4A 5F1RA 1MMGA 1G2HA 2K9LA 3LQQA 1X2NA 3OSFA 3HEFA 1H9TA 3G1MA 1UHSA 5GADJ 2R7VA 4KN4X 5GTHC 5KNLA 2VPLA 4YIRX 4HV6A 5HLHA 3I59B 1XN7A 5DM6F 1H88C 1FOYA 3HG9A 4XLCA 1PUEE 3EYIA 4C2UA 3D1NI 1VQ7I 4BJTA 1G6NA 2JWTA 5FLVA 2ESHA 5L3GA 3GYHX 2E1CA 2NS7A 2QSHX 2WY7Q 1FP1D 1FJLA 2V7FA 3EUHC 3FMSA 1T56A 1Y0NA 3GTPJ 2NXNB 3HPGA 1HW1A 2M3AA 1PUFB 1UJ8A 2JSCA 1K83J 2MGQA 2JPBA 4HA8A 3HL2A 2NOJB 2V6CA 2X6YA 3DBHB 4F52A 3K1MA 2A6TA 2Z5UA 4Y3OA 1LUJB 1R6RA 2BW3A 1VQ9I 1D0ZA 2G7UA 2Z9OA 3HTUA 2ZBKA 3PIOF 1WJCA 2K4JA 4RB3C 3COAC 3K9TA 1ZG5A 3RKYA 4XONA 1JJ6C 2X6OA 2K86A 3KE2A 4GO1A 4KICA 1YW7A 5EDNA 4A0YA 2KP6A 5F0HA 2DK5A 2Y9ZA 1ZH5A 5CVIA 3WU0A 1NK3P 2HZDA 1V54H 2JVGA 3M1EA 2E1NA 3IHUA 3MMYB 4EVIA 4HLYA 3G2BA 3VDXA 3HOZJ 1DPUA 2JRMA 1T39A 4BE0A 2CV2A 1QZZA 4YFKF 4ENJA 2DQRA 3HDDA 2HTJA 5KHDA 2B63J 2D45A 1R4MB 5E1XA 4BEHA 4B43A 1VQKI 1T0FC 2IA0A 4M71A 3F9KA 4AIHA 2VONA 1QHGA 2ZXJA 3P9CA 2ZSHB 3A1YA 2FMLA 4IOCF 4KDPA 4XORA 2R3SA 2NOGA 2AO9A 5ILSA 1WI9A 2V1NA
chains in the Genus database with same CATH topology
2HVRA 3DU5A 3QYBA 3DPUA 4II3A 2M7AA 4BEHB 4N4OB 4E7HA 2IS4A 3W3CA 4DOZA 4QPQA 3LSGA 2VASA 2M4GA 4Y33A 3OYCA 4J00A 3PL8A 4ZDOA 3K6GA 4ZC3A 3OS1A 2ZFUA 2R7TA 3HOTA 4CCKA 4XM3A 4CUGA 2RREA 2CS3A 4RM3A 4BE2A 5KCMA 4BQQA 1V5EA 4HSRA 2VKDA 1YE9A 5HLTA 3TBIA 1P9QC 4BGDA 1D0XA 2VL8A 2K5CA 2WAFA 4HPQA 2XF5A 1HA8A 1OLTA 1N78A 3CZ6A 1WFXA 2R7QA 4FETA 3MD2A 4XLAA 2WAQA 3DWLE 4ZJZA 2HPIA 4KJZA 3IAS2 1MMNA 2F4IA 2L2OA 5TGTA 3KX2A 4DIQA 4ITVA 3I3LA 3I9V2 2M7BA 3DPLC 4JOMA 4OWRB 2WADA 2R7SA 1UAAA 2VJIA 3MKZA 2IGMA 2DT6A 2IXSA 3OIPA 4PK4A 4XKVA 4X0GA 4H4KC 1LFPA 2HVQA 4Y4RA 3OYJA 3PNTA 2QKMB 5CQEA 3FDYA 3QYFA 2AQEA 2VQGA 3C2HA 2HNHA 4BU2A 2Q1ZB 3L2UA 2RNGA 3BCBA 3H5RA 3H0DA 4J01A 3NWTA 1X4PA 5HNFA 4KT6A 4QPOA 4FASD 3HOSA 3ZQQA 4DJAA 2VKHA 4B44A 4HG2A 4D9JA 2R7XA 3H5NA 4IZZA 3BC8A 3SEZA 4G6TB 2WAEA 2F5VA 3OS2A 4PSXA 1ZELA 2A5WA 4BDZA 2JVHA 4NC8A 3N05A 2L9NA 1N77A 1G59A 2F6CA 2MFZA 2VJJA 3DU6A 2JA2A 3CESA 3MKWB 1UG0A 3FBIB 1W36D 2JSPA 1SAUA 3OYEA 3BLYA 4CZCA 3MKYB 4PJLA 3DTKA 2V9KA 1SFKA 3ZXSA 2M4KA 3GBGA 4EATA 3CP2A 1MNEA 3CP8A 3PSFA 3V42A 2X6WA 4BDYA 3AL0C 3EUKL 2MYSA 1KONA 1LDKB 5FRMA 2FUG2 2LY1A 3OYKA 3OOUA 1BR4A 4CSWA 3QODA 3SYTA 2MC4A 1Z3XA 4ZYAA 1MNDA 4U7BA 2X85A 2PJRA 2V26A 2OUMA 4OAZA 2XAUA 3CMMA 3E0JB 3TL4X 4YRVA 3AKZA 3M1CA 1MMAA 2E1MB 3M8JA 3VWBA 3L2VA 1K6YA 4CCLA 3LSHA 2PJRB 2ZSIB 1Y6IA 2W82A 2IGKA 2W00A 2OV7A 1X1BA 3D5LA 1MW7A 2XC7A 1N75A 1S9HA 2DCEA 4P5OA 1Z21A 2CMPA 1YX3A 3BG7A 2DJIA 3OL4A 3OWTA 1V5GA 3ZCOA 4ANJA 4ZTJA 4XR6A 4RLQA 2KDOA 3K4CA 5FROA 1X1DA 2VJ4A 3U21A 4AYBA 3ZRGA 4CCJA 2OC6A 2L5QA 1DP3A 4XKWA 4IQJA 4YELA 3CF2A 4CCOA 2Z16A 3UR3C 4YEJA 2X51A 3DQVC 2CUJA 4PJNA 3H9JA 4IKFA 2KLOA 3ZGKA 3VYRB 2WBMA 4C30A 2VB6A 2JUGA 2BVLA 4HRIA 2K9MA 2V6EA 2X6XA 2IGNA 2MABA 3OYAA 2VQCA 2HU9A 3QOEA 1MMDA 2Q2EB 4XKBA 3H35A 4CA0A 3PNVA 3OYNA 1D1CA 3HUGB 2GOXB 1BOBA 3K4KA 3IUOA 3K70D 3NWSA 2CW7A 1G8XA 2DXIA 4XN3A 3DTEA 3LL7A 4II2A 4KISA 4XMYA 1LKXA 2KPMA 2AQFA 3SEQA 3EPZA 4HEA2 3DLAA 3K4JA 4XL9A 4XOTA 1VZ0A 4C2TA 3CJQB 2BOLA 1BR2A 4BXFA 2CUZA 2VQHA 2RQQA 1X1CA 4DBRA 2R7RA 2ZXHA 4NUBA 3UNGC 3S3OA 1DQUA 3A4CA 4B48A 4CH7A 1WJEA 2L7KA 1IRXA 4BUPA 3H5AA 1QHHD 4LIUA 4F93B 3OR1C 1PYVA 1Z7LA 1Z3YA 3VSKA 2O5RA 2L9SA 2ZXIA 4GRIA 4XLHA 1BR1A 1OR7C 4XQFA 3RSNA 2WB1A 1EA3A 3OYHA 1V5FA 3K10A 3HPHA 3LSMA 3PNYA 4PFPA 3RCOA 4BJ6C 2KRHA 3A2KA 4XKCA 5JHFA 2R4GA 3OR2C 2E60A 4BE1A 4B47A 4XNFA 4F91B 4E7JA 2P0WA 4XLEA 4XOPA 5CKTA 2CW8A 1JI8A 5HOOA 2CV0A 2HDWA 3RTRA 4HSTA 3DPTA 2E5NA 3DTIA 3OY9A 2E5ZA 1D1BA 3OYGA 4U87A 2UWMA 2QKLB 4E7IA 2X1CA 1WJAA 2KQRA 2LC2A 2UV1A 4LIVA 4NQWB 3S3MA 2KL4A 3TMOA 2LRDA 2ELJA 2PMZA 5FRNA 4RMNA 1TZLA 3W2WA 1UELB 2GOMA 2CFOA 4D1QA 4E7KA 4PJJA 2W7NA 4PUSA 4C9YA 2KZVA 3C2GA 3OYMA 3DKXA 1X19A 1ERDA 3BG6A 4DBQA 2CH0A 4NNJA 2UUZA 3LFUA 3H9QA 5CPRB 3VYSB 3PSIA 2KMUA 2WY8Q 3FKJA 4RM2A 4ZDLA 3CJRB 4E7SA 4JQFA 3KYLA 3S8PA 4RLFA 1J09A 4NC7A 3S32A 2LBFA 1T95A 2X1EA 3E1SA 2CV1A 3OIQA 3FHNA 4PJMA 3PJRA 2MD0A 1D1AA 4BL0B 3IP4B 3FBNB 3OYIA 4BJ5C 4IQ4A 2HPMA 1TT0A 2XF7A 3D5SC 1U0JA 3KEYA 3VYUB 4IX7A 3ZR8X 4LITA 3BCAA 5HVQC 1D0YA 2KHMA 2LBFB 3PFYA 2R7WA 4B3XA 4XLFA 3OYDA 2LOOA 2WA0A 3OYFA 4LG3A 4BS9A 2V4JC 4AU7A 3ONQA 4DGWB 3QYEA 3OYBA 3D5RC 2IGOA 4E6KG 2VIXA 4F55A 4HNTA 1LVKA 3K70C 1NG7A 2LYCA 4BQNA 2E1MC 3K4LA 3AL0B 3HKZA 1FMVA 2XDVA 3K4BA 5CQGA 3LSKA 5LFAA 3DEEA 1WJ5A 3H9GA 3HC7A 3OL3A 3S93A 2VLAA 3L2RA 2K3PA 1FMWA 1YX5A 2Z1DA 3LSIA 3AFHA 2HQAA 1MMGA 4E4HA 3RQ4A 2K9LA 2IS6A 2VJ5A 4N4NB 2BVMA 3DKYA 3SDBA 2R7VA 2VPLA 5KNLA 1WJBA 3OS0A 2Y0SA 4PFOA 2HVSA 1PJRA 2W4SA 3HG9A 4XLCA 4C2UA 1DGRM 2I8DA 2Z2SB 4BJTA 1WJFA 4E7ZA 2W1OA 4HNUA 4XN0A 5LD2C 1W36C 4KITB 4P1WA 2WY7Q 2V7FA 3EUHC 4ZDPA 2VQLA 4ZTFA 4BACA 3HPGA 2M3AA 4E7LA 3EUAA 3K4NA 2LREA 3HL2A 2NOJB 2X6YA 4F52A 2DOAA 3K4MA 2A6TA 4Y3OA 3L2WA 1R6RA 2BW3A 1NG6A 1D0ZA 2IS2A 2R7OA 1X4OA 3RPUD 3VSLA 4F92B 4AVZA 1WJCA 1WJDA 4XONA 2M0MA 4PSWA 2R7UA 3OMYA 3L2QA 5HNHA 2IS1A 2KP6A 1DGWY 3HXLA 1Y56A 1GLNA 2BW3B 1QU3A 4BQOA 4R79A 3IAM2 2HZDA 2LY2A 2JVGA 3MMYB 2XF6A 3G2BA 3VYTB 3VDXA 1E0EA 3W2VA 1AA7A 2VXDA 4MLOA 3SZGA 4BE0A 2CV2A 4F3QA 3W2AA 2LG4A 4OAYA 3PUBA 1X1AA 4CCMA 5KHDA 2XSJC 3J7AY 2DT7B 4BEHA 4B43A 3OYLA 1T0FC 3S3NA 3F9KA 1QHGA 2X1DA 2KRCA 2ZSHB 3A1YA 3LMMA 4XORA 4CCNA 2VXZA 2LH9A 2V1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7A A;  2M7B A; 
#chains in the Genus database with same CATH topology
 3P9I A;  1KU3 A;  2JQ7 A;  3DPU A;  1XX5 A;  3LQR A;  4UVA A;  4E7H A;  2R5Z A;  3JSO A;  5D4S A;  3HOY J;  2DDA A;  1BI0 A;  3LAP A;  2V1U A;  2VAS A;  4AC0 A;  2M4G A;  4A6D A;  4RS8 A;  2I5U A;  3GLL A;  1R23 A;  5E8G A;  3K6G A;  3BR0 A;  2K40 A;  2R7T A;  3BOQ A;  3HOT A;  4CUG A;  2MBF A;  2RRE A;  2HYF A;  2VPR A;  3LSR A;  1WH5 A;  2VKD A;  1ZG3 A;  1VF9 A;  2VT3 A;  1D0X A;  2ZNZ A;  2VL8 A;  3JRI A;  3VEP A;  2WC2 A;  2XRO A;  4HPQ A;  2XF5 A;  4IJA A;  5DD8 A;  3KZZ A;  4CYC B;  2DI3 A;  5FLM J;  1I6X A;  1YJW I;  5CYV A;  4ASN A;  3MD2 A;  2EV5 A;  3DWL E;  2JA8 J;  1RRJ A;  2LDU A;  1SD4 A;  2F4I A;  2E19 A;  2BYV E;  4DIQ A;  3U1K A;  3I9V 2;  1I1G A;  4FHT A;  2IAI A;  3CJT B;  2R7S A;  3MKZ A;  4WWC A;  1UZC A;  3EDP A;  3N97 A;  4XKV A;  4X0G A;  5GAE J;  2M2E A;  1LFP A;  5DYM A;  1SFO J;  1BJA A;  2AXT C;  4Y4R A;  5LEJ A;  4A3K J;  2O3F A;  3F72 A;  3C2B A;  3BG5 A;  3TED A;  2QKM B;  2QSF X;  4O3M A;  2ZXW H;  1Z7U A;  3H5R A;  1RKW A;  2RKH A;  1EKE A;  4CZZ A;  1QRY A;  2R7D A;  3HOS A;  2DMT A;  2VKH A;  2XUB A;  4GDF A;  1IZ1 A;  4A0Z A;  5IYD J;  2HTS A;  2I10 A;  2ZME A;  4B44 A;  5FO5 A;  4EGZ A;  5IT9 Z;  3BC8 A;  1O57 A;  3GZN B;  4G6T B;  4MFD A;  1FLI A;  1R5G A;  3ULQ B;  2LFB A;  2CRG A;  4EJU A;  2F5V A;  1ZEL A;  2QF7 A;  4HOB A;  2DOF A;  3NRV A;  4BYY A;  2F6C A;  4U0W A;  2PEX A;  1YHQ I;  1W36 D;  5DDG A;  4CZC A;  2QQ9 A;  1FP2 A;  2G9W A;  3FF5 A;  3CP2 A;  3KZY A;  4PGH A;  2LLK A;  1U8B A;  2X6W A;  2BE5 F;  3B6C A;  1J0R A;  1FT9 A;  1KON A;  1LDK B;  1ETX A;  2LY1 A;  2A3S A;  5TJJ A;  2E2J J;  1BR4 A;  1T33 A;  5HLI A;  2STT A;  3SYT A;  2MC4 A;  3JTH A;  4WK8 F;  1MND A;  1TW3 A;  5BOX A;  2IBD A;  4OIR F;  3KP7 A;  1BBY A;  3CUQ C;  4EQQ A;  4MFE A;  4AWX B;  1Y0U A;  5HS7 A;  1PP7 U;  4YRV A;  5FKO A;  3FXQ A;  3M1C A;  3GTG J;  4A3L J;  2DAO A;  2DMN A;  5CVV A;  3RPQ A;  5ICC A;  1DUX C;  3UKG A;  3L2V A;  2ZJ2 A;  5J1Y A;  2R92 J;  1W5S A;  1A6Q A;  2EBI A;  3S2W A;  1Y6I A;  3ZP5 A;  1XSD A;  5DUI A;  3I4M J;  5H6R A;  5D5W B;  3GUD A;  4AYB N;  2RGV A;  4RGR A;  4M6V A;  3GXO A;  3ZMS A;  2DCE A;  3S1N J;  1R49 A;  2CMP A;  5D8K B;  3Q5F A;  2X9D A;  4ZTJ A;  3OWT A;  1V5G A;  2PBI A;  2VBX A;  4WCG A;  2OPT A;  4A5M A;  3RKQ A;  4A3G J;  2IP2 A;  5KVR A;  4RBO A;  1ZGW A;  2G7H A;  2HOT A;  4LB6 B;  3BJ6 A;  2QCO A;  3IV5 A;  2ME6 A;  1DP3 A;  2MLG A;  1R00 A;  1Z05 A;  4L0Z B;  1POG A;  5K1Y A;  2X51 A;  2CUJ A;  4PJN A;  1YTY A;  1J9I A;  4XK4 A;  3KET A;  1HOM A;  1TQP A;  4IKF A;  1W5T A;  2JZY A;  2PMH A;  2RN7 A;  2L3D A;  2W48 A;  3HUG A;  5CJ9 A;  1LDD A;  3CMA I;  1H8A C;  5DUK A;  3IL2 A;  2V6E A;  3S1Q J;  3WTT C;  2TCT A;  3QOE A;  2L01 A;  2Q2E B;  2D1H A;  4XKB A;  4XSX F;  1HBX G;  1ZTR A;  3BY6 A;  6PAX A;  2XKP A;  5FKL A;  1XDS A;  2XAG A;  4UV9 A;  4I0B A;  1IN6 A;  2EIN H;  2IEK A;  1E17 A;  3HKZ N;  1D1C A;  4JX6 A;  4EEF G;  4A3F J;  1F4K A;  3NAR A;  3IUO A;  1AOY A;  3K70 D;  3EQL F;  2DT5 A;  3NWS A;  3TW7 A;  4JP0 A;  2PI0 A;  3LL7 A;  2XAJ A;  3HRM A;  1W7P D;  4G94 A;  3L2C A;  4CXF A;  2XGE A;  2LKP A;  3HRU A;  4RB0 A;  2XV4 S;  1QPI A;  3EPZ A;  3FXJ A;  3DLA A;  3K4J A;  4HEA 2;  2NNY A;  1BOA A;  2BOL A;  1TW2 A;  2DTR A;  1FZP B;  3J81 Z;  1BI1 A;  1UHM A;  2RQQ A;  1X1C A;  4HBL A;  2VE9 A;  2R7R A;  4U88 A;  2H8W A;  4NUB A;  2FBI A;  2CQ7 A;  3BDD A;  1WJE A;  2L7K A;  2QQA A;  3BPX A;  1S29 A;  3SFI A;  3CCM I;  2IT0 A;  4HDV A;  3T8T A;  2JUC A;  1QHH D;  4LIU A;  1MBH A;  3OR1 C;  5M3F J;  2HGC A;  3DXJ F;  3WHB A;  1SAX A;  2K27 A;  1FBU A;  3I53 A;  3V7C A;  1OR7 C;  1Q1V A;  3VOD A;  3PM1 A;  3DF8 A;  3GFJ A;  2HKO A;  2HXO A;  3K10 A;  3PNY A;  1R1V A;  3LSM A;  3RCO A;  4EM0 B;  2NVQ J;  4JK1 X;  1T08 B;  3MCZ A;  1EV7 A;  2G0E A;  2KRH A;  4AD9 A;  5L3E A;  5B3S H;  1B8I A;  1QZE A;  1AKH B;  1XD7 A;  2R4G A;  2M8G X;  3DKW A;  3WTU C;  4IF4 A;  1TWF J;  4B47 A;  1E3O C;  1XC5 A;  2QQ8 A;  3HRS A;  5D4R A;  1JUP A;  2ZB9 A;  4A3B J;  1TWG J;  3FKI J;  3HJE A;  1YOV B;  4JX5 A;  5JHU A;  1OCC H;  3W6K B;  1JI8 A;  3CD6 I;  4G7H F;  3MFK A;  5EGO B;  5HOO A;  1SEU A;  2HDW A;  1KU7 A;  4L5I A;  3T1B A;  1XPX A;  4EJT A;  3IH4 A;  3E6B A;  1FTZ A;  1RET A;  2K9S A;  1FBQ A;  3ASN H;  1ODD A;  2EIJ H;  1BC7 C;  3L1P A;  4M74 A;  3OYG A;  1D1B A;  1A36 A;  3I5U A;  2QKL B;  2RV8 A;  2JMW A;  2X1C A;  3MEX A;  1WJA A;  4G9Y A;  2UV1 A;  4LIV A;  4NQW B;  3FIW A;  1ZGA A;  3CC4 I;  3TMO A;  2ELJ A;  5ERI A;  5FRN A;  4AIJ A;  4G7O F;  2GXG A;  5L3D A;  1WVR A;  3GF2 A;  2ELK A;  1X3Z B;  5FKK A;  1H9G A;  3L7W A;  3W2W A;  4KFC A;  4NDL A;  3HB9 A;  5HLG A;  4E7K A;  3MKL A;  3FHZ A;  1W0U A;  2W7N A;  2E71 A;  2A07 F;  1KU9 A;  4ENM A;  4UUS B;  2TRT A;  1TNS A;  1MBJ A;  2V9V A;  3BG6 A;  2UUZ A;  3DBR B;  4AM3 A;  4RAF A;  3H9Q A;  3RYR A;  3Q0W A;  2MH2 A;  4KIB A;  4ZZL A;  2V9P A;  5EF6 A;  5F08 A;  1NK2 P;  4RM2 A;  3VB2 A;  3PO3 J;  1QPM A;  3RQI A;  4LMY A;  3CJR B;  2HDD A;  5CVU A;  1LQ1 A;  2FD5 A;  1BI2 A;  1FYL A;  2EJR A;  3E1S A;  2L0K A;  1VI0 A;  2KDZ A;  2MD0 A;  1D1A A;  4RGU A;  2XGX A;  3OV8 A;  4RAG A;  3RIR A;  1QGP A;  3IWZ A;  5F1J A;  2KJB A;  3BG9 A;  3E7L A;  2XF7 A;  2ZKZ A;  3LA3 A;  3Q9V A;  4HYE A;  3VYU B;  4LIT A;  1LE8 B;  1K4T A;  1W4M A;  5K5O A;  2A6E F;  3HSR A;  3OYD A;  2DFF A;  2XPW A;  2V79 A;  1J7K A;  3I55 I;  4BS9 A;  3QYE A;  1I6H J;  4ZYE A;  3HOU J;  2COM A;  3LSP A;  1HDD C;  2VC0 A;  4F55 A;  4HNT A;  2IVM A;  2DLL A;  5FD5 A;  1RKT A;  2XAH A;  2VI6 A;  3K4L A;  4CYD A;  2CSO A;  3HKZ A;  1FMV A;  3SXY A;  2R7F A;  4N9I A;  3K4B A;  5CQG A;  3LSK A;  4L9T A;  1WJ5 A;  1A6I A;  3QP5 A;  2H8R A;  1ACI A;  3ECO A;  2VLA A;  2EIK H;  2VE8 A;  2FU4 A;  4BQA A;  1CF7 B;  4HAM A;  1DP7 P;  3R61 A;  2QGU A;  3ZQL A;  1IGN A;  3I59 A;  2HQA A;  5J47 A;  2P8T A;  2Z33 A;  1K61 A;  2HFH A;  4GFB A;  3DEW A;  2BBY A;  4N4N B;  2BVM A;  4G6D A;  3SDB A;  3NEU A;  3BR1 A;  3WG9 A;  2FNP A;  1WJB A;  1ZHF A;  1RC9 A;  3S17 J;  4HF2 A;  1HST A;  2QSG X;  1KQ0 A;  1SC7 A;  3FXO A;  4XRM A;  4CIC A;  1PJR A;  2EPF A;  1FPQ A;  1PUF A;  1JKO C;  1WQ2 A;  1SVO A;  4I01 A;  5LD2 C;  4DYQ A;  4RA2 A;  3HOX J;  1WZ2 A;  3A01 B;  4P1W A;  3F8N A;  4NB5 A;  2ECB A;  4ZDP A;  4XLP F;  2VQL A;  1JUS A;  2F48 A;  4BAC A;  1B59 A;  1ZR4 A;  2QBY B;  5JVT A;  2KIF A;  2Z3Y A;  5GP9 A;  5ICE A;  2F4O B;  1ZN2 A;  5LGU A;  1SD6 A;  3CDI A;  3IKT A;  3CME I;  3T8R A;  1E2X A;  1NG6 A;  3TDZ C;  4A69 C;  2IS2 A;  2R0Q C;  1OCZ H;  1VQ4 I;  2VOP A;  3HHH A;  3RPU D;  4UNO A;  4IL6 C;  3FX3 A;  5BS6 A;  2P81 A;  3E3V A;  2BGC A;  2BY0 A;  2M0M A;  1XSV A;  2K9Q A;  1B9M A;  5BMZ A;  4PSW A;  1Z77 A;  3OMY A;  2IS1 A;  4L0Y B;  1GLN A;  3U2R A;  1QU3 A;  2FXA A;  2K3F A;  4BQO A;  2ISZ A;  2CG4 A;  1F5T A;  4WXH A;  2XF6 A;  3KP5 A;  3MWM A;  4MTD A;  2D1V A;  3W2V A;  1BI3 A;  3GTK J;  2OTL I;  1RPW A;  4F3Q A;  4I76 A;  5J4Y A;  3ZQC A;  1TBX A;  1JTX A;  1J75 A;  2DT7 B;  2H94 A;  1L3L A;  4ETS A;  3OYL A;  3S3N A;  2VBZ A;  4Z6Y A;  2X1D A;  3J80 K;  2E1O A;  4F7Z A;  4CCN A;  2CWE A;  1LJ9 A;  2Y69 H;  3HHG A;  3DU5 A;  2E36 A;  5J4V A;  4OU0 A;  2GA2 A;  2M7A A;  2YX4 A;  3ZMZ A;  3JRB A;  4N4O B;  4L9J A;  3C18 A;  1YIJ I;  3GCM A;  4N0B A;  2H6C A;  5L3C A;  1WPK A;  2JJ7 A;  2GIV A;  3OS1 A;  1QO0 D;  4HX7 A;  4CYC A;  1Z6T A;  2BY3 A;  5J1U A;  4XM3 A;  1MZB A;  2IRF G;  3PQJ A;  2Y75 A;  4GYI A;  5IOY A;  3T0Y A;  1WH7 A;  3RPU A;  3ERE D;  3JRC A;  1GHC A;  1F36 A;  1V5E A;  4WXC A;  5B1B H;  2HQ5 A;  5HLT A;  1P9Q C;  4IHY A;  1V55 H;  1F1Z A;  2X48 A;  1R71 A;  2LVS A;  2RNJ A;  3SZT A;  2WAF A;  2VUM J;  1OLT A;  2LTP A;  2EWN A;  4XLA A;  4FTH A;  4HQM A;  2HPI A;  5E1W A;  2F5E A;  3WTV C;  1QA6 A;  1MJ9 A;  3IAS 2;  4OIP F;  1MMN A;  2N8G A;  2LD5 A;  4MHG A;  5TGT A;  3R6S A;  5HDK A;  2A05 A;  1IRG A;  3PIP F;  1PVE A;  4MEY F;  1HLV A;  5AON A;  1BN5 A;  2YX7 A;  5DM7 F;  3OIP A;  3CTA A;  4DQ2 A;  4A3C J;  1GVD A;  4HV5 A;  3B6A A;  1RNL A;  2HVQ A;  2GLO A;  1MBG A;  3OYJ A;  2J5P A;  5EZH A;  1N25 A;  3LAJ A;  4RAY A;  3WE3 A;  3FDY A;  1V3F A;  2CUE A;  3JW4 A;  2K9N A;  3L2U A;  2A68 F;  2RNG A;  3H0D A;  3QAH A;  4J01 A;  2KZG A;  2HQN A;  2P7V B;  2MC3 A;  2DMP A;  1X4P A;  4A3E J;  4D5C A;  5J40 A;  5HDN A;  1LEA A;  2GQQ A;  1XSX A;  4KIF A;  5LEK A;  3G73 A;  2V1X A;  5LBQ A;  2Y48 A;  5H6Q A;  1R1U A;  2QM3 A;  3H5N A;  1UCR A;  2EFO A;  2WB1 N;  3VOE A;  1DU6 A;  4PZJ A;  5K7H A;  2EFP A;  5TRD A;  2QLZ A;  1UHW A;  4PSX A;  4IOA F;  2H1K A;  1E3H A;  3R4K A;  1LDJ A;  4V2G A;  5CLS A;  4NC8 A;  3N05 A;  4A0X A;  2L9N A;  2GBY A;  3DU6 A;  3A0H C;  3I71 A;  4P9F A;  3QWL A;  3FBI B;  2EFN A;  3DTK A;  1YI2 I;  2A61 A;  4EAT A;  2HR3 A;  2L9R A;  1MNE A;  1OKR A;  1MBE A;  2FQ3 A;  4HW0 A;  3CF5 F;  2AS5 F;  5FKM A;  2LNB A;  3AL0 C;  3IH2 A;  4OMZ A;  5FRM A;  2FUG 2;  1SVM A;  3K1P A;  3QPS A;  3V8J A;  2OZ6 A;  5HS8 A;  3QOD A;  2WV0 A;  2PMZ N;  3CMM A;  1U5T B;  1Z91 A;  3BR2 A;  2DPU A;  2W24 A;  1GT0 C;  3AKZ A;  3K0L A;  3ABT A;  3BTC A;  4UVB A;  3BR5 A;  3M8J A;  1IXR C;  2L7F P;  4S0H B;  1K6Y A;  3W6V A;  4CCL A;  1KGS A;  1RIO H;  2PJR B;  4FE7 A;  2ZSI B;  1D5V A;  3DP7 A;  1HKQ A;  2DA4 A;  2HYJ A;  2W00 A;  3Q0V A;  2MW8 A;  2OF7 A;  2M5W A;  2COB A;  1K78 B;  3M3Y J;  2EA2 A;  1MW7 A;  4DZJ A;  3CO6 C;  2CGP A;  1OQY A;  4CDG A;  5F04 A;  5K7F A;  3ECH A;  2DJI A;  5E8I A;  3OL4 A;  1JHH A;  5LRR A;  3K4C A;  4DNC A;  2XRN A;  4Q48 A;  1X1D A;  5E3L A;  5D8L B;  4EMS A;  2BZT A;  2VJ4 A;  3EUH A;  1IN8 A;  3GVA A;  3X2Q H;  5JFR A;  3HM5 A;  3CCS I;  1B72 B;  4XKW A;  3E6C C;  4IQJ A;  1USS A;  1XCV A;  4LG0 B;  2OTJ I;  5LHI A;  2FSW A;  2LMD A;  3UR3 C;  2O61 A;  4YEJ A;  3QPT A;  2ACJ A;  2Q2E A;  1TL8 A;  3QPL A;  4M3F A;  4RGX A;  4M3E A;  1Z1D A;  5LLQ A;  1MH3 A;  2KLO A;  3KIO A;  1IC8 A;  4UUV A;  2L7Z A;  4W97 A;  1LFB A;  5IT9 K;  1GVJ A;  2BVL A;  5F0C A;  1KU2 A;  2K9M A;  1BA5 A;  1W5C C;  2IGN A;  2YSR A;  3Q9S A;  2VQC A;  2HU9 A;  4A6E A;  1HKS A;  1MMD A;  2JA7 J;  1HC8 A;  1ULY A;  3IWF A;  3TP3 A;  2HWV A;  2DYR H;  1VFC A;  1O7L A;  2HOE A;  5D5V B;  2JK3 A;  1ZK8 A;  1YS7 A;  1TNT A;  2EK5 A;  1BOB A;  1CGP A;  1A31 A;  2FOK A;  2NVY J;  1ZRD A;  1P7I A;  4I02 A;  1TWH J;  4II2 A;  5BPI A;  1IG7 A;  1RUN A;  4PDK A;  2P4W A;  2K02 A;  3ZQH A;  4ABZ A;  3SEQ A;  1T0F A;  1GV2 A;  4FT8 A;  3JRE A;  4O5V A;  4C2T A;  3CJQ B;  5GTI C;  3HBL A;  5B66 C;  4QWQ A;  2VQH A;  3BRO A;  3K2A A;  4MNU A;  2ZXH A;  2VKE A;  3ERM A;  2VOD A;  9ANT A;  3TKY A;  3KP3 A;  2FE3 A;  1ZLK A;  1IRX A;  4KNY A;  3H5A A;  1X3W B;  2GA1 A;  2WWY A;  3MZH A;  1U8R A;  3R60 A;  4F93 B;  3G3Z A;  5JI6 A;  3KP2 A;  1PYV A;  1AKH A;  5IT3 A;  1ZQ3 P;  2KIM A;  4MTE A;  2L9S A;  4XLH A;  2DA2 A;  4C3I J;  1J5Y A;  4L9V A;  5D6F A;  2KIQ A;  3A02 A;  2NAZ A;  1I3Q J;  1EA3 A;  2WB1 A;  4BBR J;  4XQF A;  1X3U A;  4BJ6 C;  3OYH A;  2DOE A;  3JSP A;  2R5Y B;  3RZO J;  5GPC A;  2LR8 A;  3A2K A;  4Q47 A;  2FOW A;  1A5J A;  5ED4 A;  3OR2 C;  5EGO A;  2E60 A;  4X6A J;  1O3T A;  3B02 A;  3LA2 A;  4E7J A;  3H36 A;  2CQN A;  2IW5 A;  2DW4 A;  1IN4 A;  2DMU A;  4XLE A;  3ZMD A;  1S3J A;  1V4R A;  2EZI A;  4J19 A;  3CC2 I;  4NQW A;  2CV0 A;  1YW9 A;  5HDG A;  2XRL A;  3RTR A;  4HLX A;  2FQ4 A;  3U9G A;  3ZOB A;  3OY9 A;  5ICF A;  2UWM A;  4JYK A;  2O9L A;  3SDG A;  2LC2 A;  1FOW A;  3B73 A;  3Q0U A;  5E20 A;  4UUS A;  1BJZ A;  1XG1 A;  1IXC A;  2VOO A;  3GW2 A;  2PMZ A;  2W84 A;  2XGC A;  2BY2 A;  3TO7 A;  2VBW A;  3HGG A;  1TZL A;  3L00 A;  2ZFW A;  1RI7 A;  5A2Q Z;  1UEL B;  5KK1 A;  3FXL A;  1I39 A;  1SFU A;  4XBF A;  1XGO A;  3DKX A;  2XGD A;  2FBH A;  1X19 A;  1ERD A;  4ZH4 F;  3KLO A;  3ZQG A;  4JBA A;  3P5J A;  2HXI A;  3R0A A;  3VYS B;  4XRS G;  4G7Z F;  2KMU A;  3FKJ A;  3DEU A;  1H0M A;  2KFD A;  4ZDL A;  5J8F A;  4B4C A;  4E7S A;  4JQF A;  4C2M J;  2XVC A;  3WTS C;  1A35 A;  2VT2 A;  1J09 A;  4Y52 J;  1D8J A;  3OSG A;  3BWG A;  1R7J A;  1ZRF A;  3J81 K;  1LE8 A;  2CV1 A;  2DFH A;  1VQN I;  1F9N A;  3FHN A;  3PJR A;  3WG7 H;  3GFM A;  1APL C;  5FJ8 J;  1MJB A;  4BJ5 C;  5F6F A;  3JAM Z;  3D5S C;  3DFG A;  4IX7 A;  3ZR8 X;  2YR2 A;  1UST A;  3JRA A;  1OJL A;  3ZN0 A;  3RDI A;  1NH3 A;  1IDZ A;  1OYY A;  2YUS A;  3QQA A;  2V4J C;  4AU7 A;  4DGW B;  4B1R A;  4AIK A;  1Y39 A;  5EEA A;  3D5R C;  2BXY A;  4V2F A;  4M9Z A;  4RDU A;  3RI4 A;  3MZ8 A;  4A3M J;  3K70 C;  3V7S A;  1CF7 A;  5M5Y J;  2XAF A;  1TTY A;  5J8C A;  3AL0 B;  4XSZ F;  4UB6 C;  3ELK A;  4GXO A;  4LK0 F;  3VFZ A;  5IP9 J;  4BY1 J;  2B0L A;  1BIB A;  1ETQ A;  1OYI A;  5LFA A;  2NVX J;  3DEE A;  2EB7 A;  3H3Z A;  1K7A A;  4MQV A;  3OL3 A;  3S93 A;  2VBY A;  1KZH A;  3L2R A;  3S16 J;  4DW6 A;  2F5F A;  1FMW A;  3U1D A;  1R9T J;  1YX5 A;  2H27 A;  1ZR2 A;  4E4H A;  3ABL H;  4QTR A;  2EQR A;  3ZQ7 A;  2Q0O A;  1IAW A;  3S2D J;  2OZU A;  3DKY A;  2HZT A;  3FXU A;  3A01 A;  3TOB A;  2W85 A;  3A03 A;  2O6G E;  3I4N J;  4JX4 A;  1QVU A;  2ECC A;  4PFO A;  3I4P A;  5DCM B;  5IY5 H;  2W4S A;  1VQM I;  2FEZ A;  4G6Q A;  2PJP A;  3F3X A;  2I8D A;  1XCB A;  3TO6 A;  4E7Z A;  4HNU A;  3JRH A;  1X58 A;  4H0E A;  3ABK H;  5JVG F;  1XGM A;  2XKO A;  2WTE A;  2CQX A;  2PMU A;  4ZTF A;  3CQZ J;  1IN5 A;  4D0P A;  2LKX A;  3K4N A;  1OCO H;  2LRE A;  3LWF A;  2EZL A;  3K4M A;  1SMY F;  2LY9 A;  2OAZ A;  3L2W A;  4IO9 F;  3QRF F;  3GTL J;  3KZI C;  3P7N A;  2R7O A;  3DBL B;  2P6S A;  2DOD A;  1OCT C;  4LGW A;  2NNN A;  2QEN A;  4X1E A;  4AVP A;  1JHF A;  1WJD A;  2ID3 A;  1MD0 A;  4A3D J;  1WKM A;  2LP0 A;  5HNH A;  1DPR A;  3HXL A;  1Y56 A;  2MH9 A;  1QNT A;  3CCE I;  3S14 J;  2OQG A;  2LY2 A;  3IAM 2;  4L9N A;  4XRF A;  1ORK A;  1AHD P;  2A69 F;  5E3M A;  3GTQ J;  4IRG A;  1IN7 A;  5C4J J;  2PQ8 A;  3MAJ A;  1SFX A;  1AA7 A;  3GX4 X;  4MLO A;  2P5V A;  3MN2 A;  5E1Z B;  3W2A A;  2IA1 A;  2LG4 A;  4CCM A;  3M7G A;  3PUB A;  3WOD F;  2XSJ C;  1RZ4 A;  4XRS A;  3J7A Y;  3LA7 A;  1Q1H A;  3C1D A;  2O8K A;  1MMS A;  1NTC A;  2ZJP F;  4A2U A;  2ELH A;  4RB2 C;  2KRC A;  4OOI A;  1SD7 A;  2LH9 A;  1ZAO A;  2IA2 A;  2HVR A;  3CO7 C;  1XB4 A;  4BHB A;  4II3 A;  4ENN A;  3KYD B;  1WHU A;  1W1W E;  1QQI A;  3ZQI A;  3FM5 A;  2IS4 A;  3I64 A;  3WTX C;  1OR7 A;  3WTW C;  1YFH A;  2RQP A;  4Y33 A;  4J00 A;  1XS9 A;  3PL8 A;  4ON0 A;  1HSJ A;  4ZC3 A;  3JCU C;  3NAU A;  5TIS C;  2UXN A;  2JT1 A;  2VN2 A;  3V8K A;  4XID A;  1Y8R B;  5IYB J;  1L0O C;  4ZYH A;  5IPA A;  4EJW A;  1GXQ A;  4RM3 A;  4BE2 A;  2M45 A;  2XAS A;  3CCY A;  1TLH B;  1U9N A;  4HSR A;  5KCM A;  4BQQ A;  3WTZ A;  3TBI A;  1Y8Q B;  3H0G J;  2B7E A;  2K5C A;  2Q8K A;  4U7D A;  1HA8 A;  1N78 A;  3CZ6 A;  1WFX A;  3IH3 A;  3LST A;  5EEH A;  2R7Q A;  5K5R A;  1KA8 A;  5JLW A;  5F27 A;  2WAQ A;  4C3H J;  4ZJZ A;  1MDM B;  4KJZ A;  1EH8 A;  1Z6R A;  4I0A A;  3IRQ A;  1RES A;  5LHH A;  2L2O A;  1D3Y A;  4WXD A;  3KX2 A;  4ITV A;  2AHQ A;  1K4S A;  2PX9 A;  1YRN B;  1FYK A;  2M7B A;  2XPV A;  3DPL C;  3E5X A;  2WAD A;  1UAA A;  2DT6 A;  2IXS A;  2BHY A;  2CQQ A;  3K1N A;  1WRJ A;  1U6G A;  3V8L A;  2QQB A;  2HKX A;  4H4K C;  3CUQ B;  4ENK A;  4BXU A;  3PNT A;  1MKM A;  4B8X A;  3GLX A;  5E17 F;  2AQE A;  5BQT A;  2BY1 A;  3C2H A;  2VC1 A;  2HNH A;  4BU2 A;  1JKP C;  2Q1Z B;  1G3T A;  1IDY A;  3BR3 A;  3KYC B;  5BNG A;  3C7J A;  1AWC A;  3C3W A;  2NVT J;  4Y13 A;  5HNF A;  2DDB A;  4KT6 A;  1KYW A;  4QPO A;  5EYR A;  2ETH A;  3BZK A;  3BPV A;  3F8B A;  1XMA A;  4Y7N J;  4D7N A;  4D9J A;  4HG2 A;  3QPH A;  4IZZ A;  3GZ6 A;  4Y17 A;  2CFX A;  2TDX A;  4BAY A;  4I6Z A;  2WAE A;  4G12 A;  3OS2 A;  1IXS B;  1WGX A;  3IC7 A;  1BW6 A;  2P6T A;  3FWE A;  2DFE A;  2JVH A;  4AUX A;  1G59 A;  2MFZ A;  1S7A A;  1UFM A;  2GWR A;  2VJJ A;  4D7M A;  5FLX Z;  1EH7 A;  3MKW B;  1IJW C;  4LB5 A;  1REP C;  1SAU A;  1OYW A;  3BLY A;  3OYE A;  4XLN F;  3MKY B;  2ADU A;  4PJL A;  1SFK A;  2M34 A;  2ME0 A;  3BG3 A;  2QZ8 A;  3Q3S A;  3PSF A;  1Y1V J;  2KRF A;  2O7O A;  3EET A;  3V42 A;  4BDY A;  1I5Z A;  5E18 F;  1U5T A;  1HQC A;  3IKV A;  3OYK A;  3OOU A;  5LRS A;  2DBB A;  2LKS A;  2DPD A;  1E3P A;  4C3J J;  2ZCW A;  4U7B A;  1P4X A;  3CCQ I;  2JRT A;  2PJR A;  1Z0X A;  2BV6 A;  3WGI A;  2DJN A;  1XGS A;  1K78 A;  1LEB A;  3BZ6 A;  2EZK A;  3BQZ A;  2DA3 A;  1MMA A;  1P2F A;  3CLQ A;  4A12 A;  3A0B C;  5E3O A;  3WU2 C;  1ZKG A;  1JE8 A;  1W7P B;  4HDU A;  2W82 A;  1IRF A;  2OV7 A;  3RJP A;  4HF1 A;  1R1T A;  4BNC A;  4UHT A;  5GPA A;  1YYV A;  2XC7 A;  1FYM A;  1S9H A;  3WGG A;  1Z21 A;  5K7Z A;  1B72 A;  5F0F A;  1YX3 A;  4LG0 A;  3ISP A;  4M3D A;  4ANJ A;  4XR6 A;  4RLQ A;  1FNN A;  2GXA A;  2M8E A;  3GZ5 A;  5EG0 B;  3BTI A;  2E2I J;  5FRO A;  1D8K A;  3U21 A;  5L3F A;  4CCJ A;  5JR3 A;  5M5W J;  2L5Q A;  3KFW X;  4YEL A;  2Z16 A;  2LF8 A;  2HDC A;  1ITY A;  3DQV C;  3DLL F;  2M30 A;  3F21 A;  2OBP A;  2OA4 A;  4WF2 A;  3PFI A;  3H9J A;  2HOA A;  3ZGK A;  1ETO A;  3ASO H;  2STW A;  2DTZ A;  1PDN C;  2WBM A;  1VQ5 I;  1S6L A;  2VB6 A;  1IUF A;  5HOD A;  3WHC A;  4GGG A;  4OMY A;  3KLN A;  5KAF C;  3EYY A;  4M3B A;  5E79 C;  2LF7 A;  1G4D A;  3OYN A;  3T5X A;  1OIS A;  3ZMV A;  3F22 A;  1R5I D;  2GOX B;  4FIS A;  1R4N B;  4QSH A;  3K4K A;  1JT0 A;  1S7E A;  3RKX A;  2CW7 A;  1B4A A;  3H1C A;  2DXI A;  2W57 A;  2KKO A;  4XN3 A;  4IXA A;  3DTE A;  1JJ8 C;  2QVO A;  3CCL I;  1LKX A;  3F0C A;  3ZN1 A;  2QEX I;  2AQF A;  4Y15 A;  3SQN A;  1WI3 A;  3FIS A;  2AXL A;  2CU7 A;  2NS8 A;  2EFW A;  2CUZ A;  1EF4 A;  1WWX A;  4DBR A;  2Y0S N;  2JTV A;  3GO5 A;  3BP8 A;  5IOZ A;  4MQ9 F;  3S3O A;  2MLK A;  3A4C A;  4BUP A;  2PFB A;  2R5Y A;  1FSE A;  1HDP A;  3FK7 A;  4LLG F;  4B3A A;  1U2W A;  1Z7L A;  1Z3Y A;  3VSK A;  2KT0 A;  4EJV A;  2ZXI A;  2MD5 A;  1WSU A;  2ICW G;  5B1A H;  4I7H A;  1G3W A;  4BBS J;  4EJO A;  1R5H A;  4ZYD A;  1UB9 A;  1V5F A;  5DV5 A;  4PFP A;  5FB2 A;  2NVU B;  3CDH A;  3SFZ A;  5JHF A;  2D2W A;  1ENH A;  5D5X B;  4BE1 A;  2RAE A;  1ZG1 A;  1HXD A;  1B1B A;  1ZGJ A;  4LOC A;  2H1L A;  4LFU A;  3BJA A;  1ZRC A;  1YW8 A;  2Y2Z A;  2CW8 A;  3G71 I;  4B09 A;  2M1B A;  1I50 J;  4M73 A;  2J5O A;  2ZC2 A;  1ETW A;  2WV1 A;  2R7Z J;  1TWA J;  4RB1 A;  4YG2 F;  4ESF A;  2IJL A;  2E5Z A;  1IW7 F;  1ETK A;  3M07 A;  2DA7 A;  2KL4 A;  3K7A J;  4IPA A;  2LRD A;  1QBJ A;  3F23 A;  4NC6 A;  2OD5 A;  4RMN A;  3REO A;  3BT9 A;  3CUO A;  3KEO A;  4BY7 J;  1A04 A;  2DMQ A;  3CMY A;  1D5Y A;  2CFO A;  3ZMT A;  2GIZ A;  1ETY A;  4PUS A;  2KZV A;  2XB0 X;  3C2G A;  4KYW A;  1P92 A;  2KJC A;  3I58 A;  3F6O A;  2NS0 A;  2E35 A;  4M3G A;  2CH0 A;  4NNJ A;  2ID6 A;  4I99 C;  1O3Q A;  5CPR B;  3PSI A;  4UB8 C;  1LNW A;  1B9N A;  1U9O A;  2WY8 Q;  4MGR A;  1GDT A;  4IEJ A;  2ZME C;  4S04 A;  1SMT A;  4UUT A;  3KYL A;  3S8P A;  3TO9 A;  3CLO A;  3J7A O;  2L9V A;  1VND A;  4RLF A;  4NC7 A;  3S32 A;  3WE2 A;  1QZY A;  1T95 A;  2X1E A;  1T8I A;  2CJJ A;  3GFI A;  3OIQ A;  1MSE C;  1TQI A;  2DFI A;  4TV7 A;  3F8F A;  3O2P E;  3AG3 H;  2EA4 A;  2KIU A;  3QOP A;  3IP4 B;  4UXN A;  3LSJ A;  5FFX A;  4BL0 B;  3OYI A;  4IQ4 A;  1TT0 A;  2L7M P;  3GTJ J;  3HZJ A;  3ZPL A;  1U0J A;  4BXX J;  3KP4 A;  1O4X A;  4XIC A;  4M9X A;  3TQN A;  3GME A;  5HVQ C;  3GEZ A;  4Q5S F;  2LBF B;  3N4M A;  3PFY A;  2A5Y B;  2OQR A;  4B3X A;  4XLF A;  2R7W A;  5E3N A;  1HKT A;  1DDN A;  3LNQ A;  2LOO A;  2ZNY A;  3OYF A;  3O6B B;  5F64 A;  4P55 A;  1MH4 A;  2IGO A;  4E6K G;  2VIX A;  2F5C A;  2LYC A;  2L02 A;  2E1M C;  2W25 A;  3S1M J;  2X0L A;  1EJ9 A;  2Y31 A;  3H9G A;  5D5U B;  2ZJR F;  1O3S A;  1IUY A;  3FXM A;  3SZP A;  2HOS A;  1FSH A;  2K3P A;  1UMQ A;  3J7Z I;  1MGT A;  4Q4Z F;  3E5U A;  1JTY A;  1XMK A;  3E97 A;  3ROU A;  3AFH A;  4HQE A;  5DCM A;  1CQT A;  3RQ4 A;  2IS6 A;  1MJA A;  2VJ5 A;  1HW5 A;  2H6B A;  2RDP A;  3OS0 A;  3K69 A;  2JA5 J;  2Y0S A;  3IRR A;  1YIT I;  2CYY A;  4OIO F;  4I09 A;  2HVS A;  5BPD A;  1DGR M;  3TOA A;  3H3V K;  4V19 K;  2Z2S B;  4Z2Y A;  1WJF A;  2W1O A;  4XN0 A;  1W36 C;  2QWW A;  4KIT B;  5J1R A;  1RR8 C;  1WCM J;  4LJZ F;  2P7C B;  2O03 A;  5A2Q K;  3JR9 A;  4IHS A;  3R0J A;  4MO7 A;  1P6R A;  4YFN F;  5ILU A;  4ESB A;  1XMX A;  4E7L A;  3EUA A;  4EGY A;  2F5D A;  1OCP A;  2DOA A;  1OFC X;  4PGG A;  3ZQF A;  5J6X A;  3L09 A;  1TT5 B;  1X4O A;  3VSL A;  4F92 B;  2X4H A;  4AVZ A;  1I3A A;  3G6E I;  2OU2 A;  4YFX F;  1OMI A;  3O3K A;  2R7U A;  1JKQ C;  3L2Q A;  1AU7 A;  4M72 A;  4G8X A;  3V4G A;  1DGW Y;  5H2F C;  2BW3 B;  4W1U A;  4R79 A;  3JAM K;  4S05 A;  5FFZ A;  1HCR A;  4BKX A;  2O8X A;  3VYT B;  1ON2 A;  1TQM A;  5LGN A;  1E0E A;  3AG1 H;  2VXD A;  3SZG A;  1QVT A;  1J2X A;  2A6H F;  4RAZ A;  3FM3 A;  1J59 A;  4OAY A;  3HYI A;  1X1A A;  3G4S I;  2K7L A;  1VQ6 I;  3F8M A;  1I27 A;  1LB2 A;  5LHG A;  1FOK A;  3RYP A;  2PLY A;  3LMM A;  2JA6 J;  2VXZ A;  2K4B A;  2PG4 A;  2QA4 I;  4CGZ A;  2YU3 A;  3S2H J;  2K85 A;  1YQA A;  3QYB A;  4EV0 A;  3M8F A;  4M6X A;  2CUF A;  4BEH B;  4P9U A;  4CHU A;  1LPQ A;  3P9K A;  1X1P A;  4EM2 A;  2F4M B;  3BQY A;  4KIG A;  3W3C A;  4DOZ A;  4QPQ A;  3LSG A;  1YJ9 I;  1F43 A;  2E7W A;  3OYC A;  3CCU I;  2CW0 F;  2XAQ A;  4YII A;  1C0W A;  4ZDO A;  2HEO A;  5H20 A;  4R1H A;  2MSY A;  2ZFU A;  4CCK A;  4FX0 A;  1JUM A;  2WAQ N;  2CS3 A;  2R5Z B;  4I98 B;  1MDM A;  3I56 I;  1YE9 A;  3K2Z A;  5DS9 A;  4BGD A;  4OIQ F;  1GXP A;  2KIS A;  2IPQ X;  4GCV A;  1YRN A;  2FF4 A;  1SD5 A;  2E7X A;  3GFL A;  1VQO I;  2QUF A;  1NHA A;  2JPC A;  5GAG J;  4FET A;  3HIF A;  3RKW A;  1XTA A;  3FMR A;  2EIL H;  1BM9 A;  3ML6 A;  5AIQ A;  4BHC A;  3QU3 A;  3HOW J;  3CUQ A;  2LSO A;  1TC3 C;  4RGS A;  4LK1 F;  5J3L A;  1VQP I;  1T2K A;  4KMF A;  3ABM H;  3I3L A;  1JKR C;  4HX8 A;  4JOM A;  3WTY C;  1PP8 F;  4OWR B;  1IV6 A;  5FKN A;  2VJI A;  2IGM A;  4PK4 A;  3CJN A;  5GAH J;  2Y0M A;  3KEQ A;  1S7O A;  1S8N A;  5L3B A;  4A3I J;  2P5L C;  4L18 B;  1FIA A;  3M9A A;  5AIP A;  5FGM A;  2OJE D;  1T6S A;  4LLL A;  1KQ9 A;  5CQE A;  3QYF A;  2VQG A;  1FOX A;  3PUF A;  2YS9 A;  1M1E B;  3BCB A;  1Z9C A;  2CO5 A;  3NWT A;  3JRF A;  3WU1 B;  2FMY A;  1T38 A;  1SVL A;  4FAS D;  2QBY A;  3ZQQ A;  2FA5 A;  3BTJ A;  4DJA A;  4KUM A;  5KAI C;  2R7X A;  4HF0 A;  3SEZ A;  2VKV A;  1BC8 C;  4QIW N;  1G3Y A;  2A5W A;  1UG2 A;  4BDZ A;  4N9H A;  1N77 A;  3BTL A;  2ZME B;  1ON1 A;  4IHX A;  2Y9Y A;  2JA2 A;  3CES A;  1VQL I;  1FBS A;  1UG0 A;  2JSP A;  1YS6 A;  1HW2 A;  1H89 C;  2V9K A;  3ZXS A;  2M4K A;  2HI3 A;  3GBG A;  2NYX A;  2LK2 A;  3CDL A;  2ZO4 A;  3CP8 A;  3ZMU A;  1Z67 A;  1IO2 A;  4P96 A;  2R93 J;  3EUK L;  2MYS A;  3GTM J;  3ESW B;  4L5J A;  2B9S A;  3D0S A;  4KN7 X;  4UY8 I;  3AAF A;  4NHJ A;  4CSW A;  2L54 A;  4OIN F;  1Z3X A;  1YO5 C;  4ZYA A;  1O3R A;  2X85 A;  5B5E C;  1W7P A;  2V26 A;  2M0C A;  5DTD A;  2OUM A;  2FNA A;  4OAZ A;  5CVJ A;  5K5Q A;  2XAU A;  1XDU A;  4BH9 A;  3E0J B;  1B6A A;  3TL4 X;  3J7Y J;  2E34 A;  3HSF A;  1JGG A;  2XB5 A;  2E1M B;  3F6V A;  5IP7 J;  3VWB A;  4IRI A;  3O8H A;  2HYG D;  1K79 A;  3LSH A;  2FX0 A;  3RZD J;  2IGK A;  2Y30 A;  4CO8 A;  3FXR A;  5EG0 A;  5IYC J;  1X1B A;  3PQK A;  3D5L A;  1ZYR F;  4WX9 A;  2GZW A;  1N75 A;  4P5O A;  1MIJ A;  3G1O A;  3BG7 A;  5LGT A;  3GTO J;  3TDU C;  5C4X J;  3ZCO A;  2QYO A;  2KDO A;  3E5Q A;  1VTN C;  1MBK A;  2DN0 A;  4PCQ A;  4HNV A;  2L4A A;  4AYB A;  2XSD C;  3ZRG A;  4AID A;  2OC6 A;  1BL0 A;  3PO2 J;  2JN6 A;  2EFQ A;  1STZ A;  3CF2 A;  4CCO A;  4ESJ A;  4IHT A;  2M9H A;  1YIO A;  1T98 A;  3HOV J;  2FJ1 A;  3CCJ I;  4A93 J;  5FD6 A;  2BEO A;  5M5X J;  4FQG A;  1P7J A;  3QU6 A;  3VYR B;  4C30 A;  2L4M A;  2JUG A;  3BZC A;  5HS9 A;  4HRI A;  2X6X A;  2MAB A;  3OYA A;  4I2O A;  3M8E A;  2P5K A;  3NQO A;  3HRT A;  5DCF A;  1GV5 A;  3H35 A;  3KCC A;  2DA6 A;  1ZRE A;  3FMQ A;  4CA0 A;  3PNV A;  4E70 A;  2D5V A;  3JTG A;  5ICG A;  1GUU A;  2O0Y A;  3HUG B;  5FLX K;  1P4A A;  3I54 A;  2XIG A;  4FCY A;  4KA4 A;  4M9S A;  3I0T A;  1RR7 A;  1G8X A;  4UVC A;  5C44 J;  4HZF A;  1U5T C;  2BHZ A;  1HF0 A;  4KIS A;  1ETV A;  4XMY A;  3TW6 A;  3TP0 A;  1K6O A;  1BIA A;  2KPM A;  4U0V A;  4XOT A;  4XL9 A;  4LLN A;  1VZ0 A;  2XPU A;  1BR2 A;  3SHF A;  4BXF A;  1R36 A;  2DA5 A;  1KYZ A;  5D6E A;  2MA3 A;  4DYC A;  2DYS H;  3UNG C;  1IV8 A;  3GWZ A;  1DQU A;  4B48 A;  4CH7 A;  1O7F A;  2DU9 A;  1SFE A;  4NBQ A;  5DEQ A;  2OCE A;  3L9F A;  4U0Y A;  1RUO A;  4IHW A;  4YIF A;  3CCV I;  3DV8 A;  4DYR A;  2O5R A;  4GRI A;  1FC3 A;  3S1R J;  3CC7 I;  1BR1 A;  1I1S A;  1IRZ A;  4O6J A;  3RSN A;  4D5F A;  2ESN A;  3HPH A;  4BHP A;  1JXS A;  3DCF A;  1S72 I;  1S5L C;  4LD5 A;  1ONV A;  3FK6 A;  3W6J B;  4XKC A;  2ISY A;  3FZV A;  2RVC A;  1FIP A;  4XNF A;  4ZYG A;  2DA1 A;  4F91 B;  4A5N A;  1YJN I;  3HGY A;  2M87 A;  2P0W A;  4IHV A;  2RC4 A;  2DK8 A;  1U3E M;  4HX4 A;  1FEX A;  3FXK A;  1MNM C;  4XOP A;  5JLX A;  1X2M A;  2DO7 A;  1YG2 A;  1B8I B;  5CKT A;  3OOP A;  2EZH A;  2PN6 A;  2GXB A;  1FTT A;  1IF1 A;  1G3S A;  3ABU A;  3TGN A;  4HST A;  3DPT A;  2CQK A;  1U78 A;  1W0T A;  2E5N A;  3DTI A;  2EIM H;  2YPR A;  2UZK A;  4U87 A;  5C3E J;  2OCC H;  4E7I A;  3G1L A;  2KQR A;  1EH6 A;  4PJ0 C;  3S3M A;  1YLF A;  2C6Y A;  2FBK A;  1VQ8 I;  3S15 J;  2ZJQ F;  5CVR A;  3AG4 H;  4FX4 A;  3O8G A;  3AG2 H;  5IP6 A;  3BR6 A;  3LFK A;  4GYG A;  4UV8 A;  1FY7 A;  3MZY A;  4KMU X;  3H92 A;  2EV6 A;  1XGN A;  2BXZ A;  2GOM A;  4D1Q A;  1DU0 A;  4PJJ A;  4C9Y A;  2MG4 A;  3OYM A;  3KPH A;  3OIO A;  4EM1 A;  1P4W A;  4DBQ A;  1FX7 A;  1ZLJ A;  3LFU A;  2NRA C;  4R8H A;  1BW5 A;  3BJO A;  2HS5 A;  2UXX A;  1SAN A;  1FWZ A;  3E6M A;  5EZG A;  1OPC A;  5EEG A;  3M4O J;  4L5E A;  1TP4 A;  1R22 A;  4KT5 C;  2Z99 A;  2EV0 A;  2LBF A;  1MSF C;  1JT6 A;  1LVA A;  4PJM A;  2GAU A;  2XHK A;  1Y1W J;  3VPR A;  4MIM A;  3KP6 A;  3FBN B;  2HPM A;  3F8C A;  3KEY A;  3MQ0 A;  3BCA A;  3MVP A;  4IVN A;  4QLC U;  4IRH A;  1D0Y A;  2KHM A;  3WGH A;  3SJM A;  2E2H J;  3E6D A;  2EH3 A;  1R58 A;  1MBF A;  2V1D A;  2WA0 A;  1KQ8 A;  4LG3 A;  1JGS A;  3ONQ A;  3OYB A;  4A3J J;  4MEX F;  3JRD A;  3LOC A;  4FE4 A;  3V7R A;  3J80 Z;  2HQR A;  2H09 A;  4M6Y A;  1LVK A;  1NG7 A;  1TWC J;  4BQN A;  3H3U A;  1OCR H;  4ZZD A;  2DQL A;  2FRH A;  2XDV A;  3HTS B;  3HSE A;  2F2E A;  3QP6 A;  4K2E A;  3HC7 A;  5M3M J;  5ILV A;  5DD4 A;  3JRG A;  2YU9 J;  1LFU P;  3CCR I;  5EJC A;  4DZP A;  1ZAR A;  2Z1D A;  3LSI A;  2GM4 A;  5F1R A;  1MMG A;  1G2H A;  2K9L A;  3LQQ A;  1X2N A;  3OSF A;  3HEF A;  1H9T A;  3G1M A;  1UHS A;  5GAD J;  2R7V A;  4KN4 X;  5GTH C;  5KNL A;  2VPL A;  4YIR X;  4HV6 A;  5HLH A;  3I59 B;  1XN7 A;  5DM6 F;  1H88 C;  1FOY A;  3HG9 A;  4XLC A;  1PUE E;  3EYI A;  4C2U A;  3D1N I;  1VQ7 I;  4BJT A;  1G6N A;  2JWT A;  5FLV A;  2ESH A;  5L3G A;  3GYH X;  2E1C A;  2NS7 A;  2QSH X;  2WY7 Q;  1FP1 D;  1FJL A;  2V7F A;  3EUH C;  3FMS A;  1T56 A;  1Y0N A;  3GTP J;  2NXN B;  3HPG A;  1HW1 A;  2M3A A;  1PUF B;  1UJ8 A;  2JSC A;  1K83 J;  2MGQ A;  2JPB A;  4HA8 A;  3HL2 A;  2NOJ B;  2V6C A;  2X6Y A;  3DBH B;  4F52 A;  3K1M A;  2A6T A;  2Z5U A;  4Y3O A;  1LUJ B;  1R6R A;  2BW3 A;  1VQ9 I;  1D0Z A;  2G7U A;  2Z9O A;  3HTU A;  2ZBK A;  3PIO F;  1WJC A;  2K4J A;  4RB3 C;  3COA C;  3K9T A;  1ZG5 A;  3RKY A;  4XON A;  1JJ6 C;  2X6O A;  2K86 A;  3KE2 A;  4GO1 A;  4KIC A;  1YW7 A;  5EDN A;  4A0Y A;  2KP6 A;  5F0H A;  2DK5 A;  2Y9Z A;  1ZH5 A;  5CVI A;  3WU0 A;  1NK3 P;  2HZD A;  1V54 H;  2JVG A;  3M1E A;  2E1N A;  3IHU A;  3MMY B;  4EVI A;  4HLY A;  3G2B A;  3VDX A;  3HOZ J;  1DPU A;  2JRM A;  1T39 A;  4BE0 A;  2CV2 A;  1QZZ A;  4YFK F;  4ENJ A;  2DQR A;  3HDD A;  2HTJ A;  5KHD A;  2B63 J;  2D45 A;  1R4M B;  5E1X A;  4BEH A;  4B43 A;  1VQK I;  1T0F C;  2IA0 A;  4M71 A;  3F9K A;  4AIH A;  2VON A;  1QHG A;  2ZXJ A;  3P9C A;  2ZSH B;  3A1Y A;  2FML A;  4IOC F;  4KDP A;  4XOR A;  2R3S A;  2NOG A;  2AO9 A;  5ILS A;  1WI9 A;  2V1N A; 
#chains in the Genus database with same CATH homology
 2HVR A;  3DU5 A;  3QYB A;  3DPU A;  4II3 A;  2M7A A;  4BEH B;  4N4O B;  4E7H A;  2IS4 A;  3W3C A;  4DOZ A;  4QPQ A;  3LSG A;  2VAS A;  2M4G A;  4Y33 A;  3OYC A;  4J00 A;  3PL8 A;  4ZDO A;  3K6G A;  4ZC3 A;  3OS1 A;  2ZFU A;  2R7T A;  3HOT A;  4CCK A;  4XM3 A;  4CUG A;  2RRE A;  2CS3 A;  4RM3 A;  4BE2 A;  5KCM A;  4BQQ A;  1V5E A;  4HSR A;  2VKD A;  1YE9 A;  5HLT A;  3TBI A;  1P9Q C;  4BGD A;  1D0X A;  2VL8 A;  2K5C A;  2WAF A;  4HPQ A;  2XF5 A;  1HA8 A;  1OLT A;  1N78 A;  3CZ6 A;  1WFX A;  2R7Q A;  4FET A;  3MD2 A;  4XLA A;  2WAQ A;  3DWL E;  4ZJZ A;  2HPI A;  4KJZ A;  3IAS 2;  1MMN A;  2F4I A;  2L2O A;  5TGT A;  3KX2 A;  4DIQ A;  4ITV A;  3I3L A;  3I9V 2;  2M7B A;  3DPL C;  4JOM A;  4OWR B;  2WAD A;  2R7S A;  1UAA A;  2VJI A;  3MKZ A;  2IGM A;  2DT6 A;  2IXS A;  3OIP A;  4PK4 A;  4XKV A;  4X0G A;  4H4K C;  1LFP A;  2HVQ A;  4Y4R A;  3OYJ A;  3PNT A;  2QKM B;  5CQE A;  3FDY A;  3QYF A;  2AQE A;  2VQG A;  3C2H A;  2HNH A;  4BU2 A;  2Q1Z B;  3L2U A;  2RNG A;  3BCB A;  3H5R A;  3H0D A;  4J01 A;  3NWT A;  1X4P A;  5HNF A;  4KT6 A;  4QPO A;  4FAS D;  3HOS A;  3ZQQ A;  4DJA A;  2VKH A;  4B44 A;  4HG2 A;  4D9J A;  2R7X A;  3H5N A;  4IZZ A;  3BC8 A;  3SEZ A;  4G6T B;  2WAE A;  2F5V A;  3OS2 A;  4PSX A;  1ZEL A;  2A5W A;  4BDZ A;  2JVH A;  4NC8 A;  3N05 A;  2L9N A;  1N77 A;  1G59 A;  2F6C A;  2MFZ A;  2VJJ A;  3DU6 A;  2JA2 A;  3CES A;  3MKW B;  1UG0 A;  3FBI B;  1W36 D;  2JSP A;  1SAU A;  3OYE A;  3BLY A;  4CZC A;  3MKY B;  4PJL A;  3DTK A;  2V9K A;  1SFK A;  3ZXS A;  2M4K A;  3GBG A;  4EAT A;  3CP2 A;  1MNE A;  3CP8 A;  3PSF A;  3V42 A;  2X6W A;  4BDY A;  3AL0 C;  3EUK L;  2MYS A;  1KON A;  1LDK B;  5FRM A;  2FUG 2;  2LY1 A;  3OYK A;  3OOU A;  1BR4 A;  4CSW A;  3QOD A;  3SYT A;  2MC4 A;  1Z3X A;  4ZYA A;  1MND A;  4U7B A;  2X85 A;  2PJR A;  2V26 A;  2OUM A;  4OAZ A;  2XAU A;  3CMM A;  3E0J B;  3TL4 X;  4YRV A;  3AKZ A;  3M1C A;  1MMA A;  2E1M B;  3M8J A;  3VWB A;  3L2V A;  1K6Y A;  4CCL A;  3LSH A;  2PJR B;  2ZSI B;  1Y6I A;  2W82 A;  2IGK A;  2W00 A;  2OV7 A;  1X1B A;  3D5L A;  1MW7 A;  2XC7 A;  1N75 A;  1S9H A;  2DCE A;  4P5O A;  1Z21 A;  2CMP A;  1YX3 A;  3BG7 A;  2DJI A;  3OL4 A;  3OWT A;  1V5G A;  3ZCO A;  4ANJ A;  4ZTJ A;  4XR6 A;  4RLQ A;  2KDO A;  3K4C A;  5FRO A;  1X1D A;  2VJ4 A;  3U21 A;  4AYB A;  3ZRG A;  4CCJ A;  2OC6 A;  2L5Q A;  1DP3 A;  4XKW A;  4IQJ A;  4YEL A;  3CF2 A;  4CCO A;  2Z16 A;  3UR3 C;  4YEJ A;  2X51 A;  3DQV C;  2CUJ A;  4PJN A;  3H9J A;  4IKF A;  2KLO A;  3ZGK A;  3VYR B;  2WBM A;  4C30 A;  2VB6 A;  2JUG A;  2BVL A;  4HRI A;  2K9M A;  2V6E A;  2X6X A;  2IGN A;  2MAB A;  3OYA A;  2VQC A;  2HU9 A;  3QOE A;  1MMD A;  2Q2E B;  4XKB A;  3H35 A;  4CA0 A;  3PNV A;  3OYN A;  1D1C A;  3HUG B;  2GOX B;  1BOB A;  3K4K A;  3IUO A;  3K70 D;  3NWS A;  2CW7 A;  1G8X A;  2DXI A;  4XN3 A;  3DTE A;  3LL7 A;  4II2 A;  4KIS A;  4XMY A;  1LKX A;  2KPM A;  2AQF A;  3SEQ A;  3EPZ A;  4HEA 2;  3DLA A;  3K4J A;  4XL9 A;  4XOT A;  1VZ0 A;  4C2T A;  3CJQ B;  2BOL A;  1BR2 A;  4BXF A;  2CUZ A;  2VQH A;  2RQQ A;  1X1C A;  4DBR A;  2R7R A;  2ZXH A;  4NUB A;  3UNG C;  3S3O A;  1DQU A;  3A4C A;  4B48 A;  4CH7 A;  1WJE A;  2L7K A;  1IRX A;  4BUP A;  3H5A A;  1QHH D;  4LIU A;  4F93 B;  3OR1 C;  1PYV A;  1Z7L A;  1Z3Y A;  3VSK A;  2O5R A;  2L9S A;  2ZXI A;  4GRI A;  4XLH A;  1BR1 A;  1OR7 C;  4XQF A;  3RSN A;  2WB1 A;  1EA3 A;  3OYH A;  1V5F A;  3K10 A;  3HPH A;  3LSM A;  3PNY A;  4PFP A;  3RCO A;  4BJ6 C;  2KRH A;  3A2K A;  4XKC A;  5JHF A;  2R4G A;  3OR2 C;  2E60 A;  4BE1 A;  4B47 A;  4XNF A;  4F91 B;  4E7J A;  2P0W A;  4XLE A;  4XOP A;  5CKT A;  2CW8 A;  1JI8 A;  5HOO A;  2CV0 A;  2HDW A;  3RTR A;  4HST A;  3DPT A;  2E5N A;  3DTI A;  3OY9 A;  2E5Z A;  1D1B A;  3OYG A;  4U87 A;  2UWM A;  2QKL B;  4E7I A;  2X1C A;  1WJA A;  2KQR A;  2LC2 A;  2UV1 A;  4LIV A;  4NQW B;  3S3M A;  2KL4 A;  3TMO A;  2LRD A;  2ELJ A;  2PMZ A;  5FRN A;  4RMN A;  1TZL A;  3W2W A;  1UEL B;  2GOM A;  2CFO A;  4D1Q A;  4E7K A;  4PJJ A;  2W7N A;  4PUS A;  4C9Y A;  2KZV A;  3C2G A;  3OYM A;  3DKX A;  1X19 A;  1ERD A;  3BG6 A;  4DBQ A;  2CH0 A;  4NNJ A;  2UUZ A;  3LFU A;  3H9Q A;  5CPR B;  3VYS B;  3PSI A;  2KMU A;  2WY8 Q;  3FKJ A;  4RM2 A;  4ZDL A;  3CJR B;  4E7S A;  4JQF A;  3KYL A;  3S8P A;  4RLF A;  1J09 A;  4NC7 A;  3S32 A;  2LBF A;  1T95 A;  2X1E A;  3E1S A;  2CV1 A;  3OIQ A;  3FHN A;  4PJM A;  3PJR A;  2MD0 A;  1D1A A;  4BL0 B;  3IP4 B;  3FBN B;  3OYI A;  4BJ5 C;  4IQ4 A;  2HPM A;  1TT0 A;  2XF7 A;  3D5S C;  1U0J A;  3KEY A;  3VYU B;  4IX7 A;  3ZR8 X;  4LIT A;  3BCA A;  5HVQ C;  1D0Y A;  2KHM A;  2LBF B;  3PFY A;  2R7W A;  4B3X A;  4XLF A;  3OYD A;  2LOO A;  2WA0 A;  3OYF A;  4LG3 A;  4BS9 A;  2V4J C;  4AU7 A;  3ONQ A;  4DGW B;  3QYE A;  3OYB A;  3D5R C;  2IGO A;  4E6K G;  2VIX A;  4F55 A;  4HNT A;  1LVK A;  3K70 C;  1NG7 A;  2LYC A;  4BQN A;  2E1M C;  3K4L A;  3AL0 B;  3HKZ A;  1FMV A;  2XDV A;  3K4B A;  5CQG A;  3LSK A;  5LFA A;  3DEE A;  1WJ5 A;  3H9G A;  3HC7 A;  3OL3 A;  3S93 A;  2VLA A;  3L2R A;  2K3P A;  1FMW A;  1YX5 A;  2Z1D A;  3LSI A;  3AFH A;  2HQA A;  1MMG A;  4E4H A;  3RQ4 A;  2K9L A;  2IS6 A;  2VJ5 A;  4N4N B;  2BVM A;  3DKY A;  3SDB A;  2R7V A;  2VPL A;  5KNL A;  1WJB A;  3OS0 A;  2Y0S A;  4PFO A;  2HVS A;  1PJR A;  2W4S A;  3HG9 A;  4XLC A;  4C2U A;  1DGR M;  2I8D A;  2Z2S B;  4BJT A;  1WJF A;  4E7Z A;  2W1O A;  4HNU A;  4XN0 A;  5LD2 C;  1W36 C;  4KIT B;  4P1W A;  2WY7 Q;  2V7F A;  3EUH C;  4ZDP A;  2VQL A;  4ZTF A;  4BAC A;  3HPG A;  2M3A A;  4E7L A;  3EUA A;  3K4N A;  2LRE A;  3HL2 A;  2NOJ B;  2X6Y A;  4F52 A;  2DOA A;  3K4M A;  2A6T A;  4Y3O A;  3L2W A;  1R6R A;  2BW3 A;  1NG6 A;  1D0Z A;  2IS2 A;  2R7O A;  1X4O A;  3RPU D;  3VSL A;  4F92 B;  4AVZ A;  1WJC A;  1WJD A;  4XON A;  2M0M A;  4PSW A;  2R7U A;  3OMY A;  3L2Q A;  5HNH A;  2IS1 A;  2KP6 A;  1DGW Y;  3HXL A;  1Y56 A;  1GLN A;  2BW3 B;  1QU3 A;  4BQO A;  4R79 A;  3IAM 2;  2HZD A;  2LY2 A;  2JVG A;  3MMY B;  2XF6 A;  3G2B A;  3VYT B;  3VDX A;  1E0E A;  3W2V A;  1AA7 A;  2VXD A;  4MLO A;  3SZG A;  4BE0 A;  2CV2 A;  4F3Q A;  3W2A A;  2LG4 A;  4OAY A;  3PUB A;  1X1A A;  4CCM A;  5KHD A;  2XSJ C;  3J7A Y;  2DT7 B;  4BEH A;  4B43 A;  3OYL A;  1T0F C;  3S3N A;  3F9K A;  1QHG A;  2X1D A;  2KRC A;  2ZSH B;  3A1Y A;  3LMM A;  4XOR A;  4CCN A;  2VXZ A;  2LH9 A;  2V1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...