2M7AA

Enteropathogenic escherichia coli 0111:h- str. 11128 orf ec0111_1119 similar to bacteriophage lambda ea8.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
EDQEQWAMQTLMGSGVLARCRIHNDVILDSGNDASSAYKLGTYLYQKDNSCNLFNTLTEARDAIKDAYESYCGIDDCPQCSKYIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The Solution Structures of Two Prophage Homologues of the Bacteriophage lambda Ea8.5 Protein Reveal a Newly Discovered Hybrid Homeodomain/Zinc-Finger Fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1920 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m7aA00
2M7AA 2M7BA
chains in the Genus database with same CATH superfamily
5FKOA 1BM9A 3RYRA 4AVZA 3ZQFA 3CCVI 2LKPA 1KA8A 2X85A 4BNCA 3AL0B 3WTUC 2F6CA 3FWEA 5BOXA 4RS8A 5FFXA 2Y0MA 2PEXA 1LDDA 1OMIA 1U78A 4BS9A 2BXZA 2DFEA 5LHIA 2NRAC 2HZTA 4HF1A 3J7YJ 2RDPA 2VBWA 2R7OA 1SVOA 2ESHA 2DBBA 1Q1HA 4XR6A 2CYYA 2Y9YA 2CQQA 2CQ7A 4GYIA 3E5UA 2K02A 2JRTA 4OMZA 4A3MJ 2CJJA 3FXQA 1G59A 1HDPA 4DBQA 2ZXWH 2UXNA 3FXMA 4QSHA 1U8RA 3OOUA 2G7UA 4J19A 4EJTA 4U7BA 5FROA 2OA4A 3D5LA 3RYPA 1MDMB 4KYWA 1WQ2A 3DBLB 2P6TA 1MKMA 3GTJJ 4HNTA 2XASA 4GXOA 4PJMA 2Q8KA 2HVSA 3T8RA 2OU2A 1VQ5I 4CSWA 1PDNC 3TP3A 3A02A 3DKYA 1DPRA 4N4OB 5H6RA 4RB3C 1JGSA 2HPIA 1QZYA 5CQGA 1A6IA 1A5JA 3FXUA 2V9PA 1FMVA 4B4CA 4UVBA 4AVPA 4Y3OA 1TWGJ 5CVJA 2ZNZA 2R7FA 2QCOA 2VLAA 1MNEA 2BZTA 1OR7A 1JUPA 2M3AA 2NVTJ 2MLGA 4HSTA 3O8GA 4BHPA 1CQTA 1LPQA 4XQFA 3S1NJ 2VE9A 1D5VA 3VYTB 1R22A 1BR2A 3LFUA 2DT5A 4HF2A 2E7WA 4XM3A 5D6EA 1MSEC 2DK8A 2NYXA 2VKDA 4XKCA 3KETA 5HDKA 1MH4A 4DZJA 2R7XA 1N75A 4D7NA 1LFUP 1QZEA 4LB6B 2I5UA 1ZTRA 5B66C 3BR6A 1N25A 4BDZA 3HOZJ 2RQPA 3ABLH 5EEAA 2IEKA 2XGEA 5ILVA 2E60A 1VQOI 1NG6A 4HNVA 2OJED 2V1UA 2V7FA 4XOPA 4UV8A 3DTIA 4HLYA 4GGGA 3BLYA 4IKFA 4OU0A 4F55A 1G3SA 5FKMA 4IHVA 5LRRA 4Z6YA 4XRSG 2L7KA 4RAGA 4BQOA 4EMSA 4F91B 5F64A 2L54A 5J6XA 1IF1A 3WGIA 3GFLA 1IN7A 4QIWN 5GAEJ 5CJ9A 5FGMA 4CCMA 4E7KA 4D0PA 2YS9A 2X1DA 5B3SH 3HC7A 4M6YA 1HQCA 4AIKA 2NS7A 4RGRA 3FBNB 1YO5C 2RN7A 1OCZH 4PSWA 3PM1A 4FETA 3RPQA 4LG0A 1IDYA 2R3SA 2Z16A 3WG7H 5IP7J 2W85A 2EV6A 3BJ6A 5D8LB 1V54H 1RNLA 3CMAI 1ZRFA 1Z67A 4B8XA 2ELKA 2ZXHA 3A2KA 4RB0A 3Q5FA 2FQ3A 2DXIA 4GO1A 1FYMA 3HG9A 1B8IA 1P9QC 2LK2A 4HDUA 4F7ZA 5EJCA 3KIOA 5KK1A 1WCMJ 5CVUA 2HYJA 5EYRA 5ICFA 2RGVA 5M3FJ 1TQMA 2KDOA 3CJQB 4KN7X 1FT9A 3ONQA 3O2PE 3P9CA 4XKBA 1K79A 3V7SA 5E18F 1JT6A 1Z6RA 2DJIA 3ZQGA 2UZKA 2BY1A 5J40A 3I55I 3Q0UA 2E1CA 2CV2A 5HNHA 3WU2C 3L1PA 4B48A 2MLKA 4AYBN 1Y8QB 1VQLI 1X4PA 3AG1H 5JLXA 1K78A 4ZDOA 3PUBA 4I0AA 4BY7J 3RKYA 2WAEA 4ZYEA 2B9SA 3BPVA 2HKXA 2R4GA 4B09A 3ZQCA 1E2XA 4M3FA 4L5EA 4PGHA 4EEFG 2BE5F 2Q2EA 4U7DA 2H1KA 1S7EA 1APLC 4BQQA 4HAMA 3WTSC 1QQIA 4A3JJ 4A12A 3A0HC 2OUMA 3LA3A 3MN2A 1NK2P 3P9IA 3ABKH 1FOWA 2QWWA 4EV0A 3K4NA 3QPLA 1YS6A 2E7XA 2H8WA 1GV2A 2LH9A 3WU0A 1FPQA 3FIWA 1H0MA 3S3MA 1WKMA 5C4JJ 2CUJA 2QF7A 3MQ0A 3E0JB 1J7KA 3IWZA 3PO3J 2ZMEB 2ACJA 4FT8A 3BG7A 1MMNA 2HQRA 3QPTA 3PSIA 3E5QA 5IOZA 2VXDA 2VOPA 1IAWA 3OOPA 1FLIA 3KFWX 3BQZA 4UY8I 1FTZA 3H9JA 3DPTA 3JAMZ 3OYMA 3K4LA 3CD6I 2ADUA 2DFFA 4I09A 3VPRA 3I3LA 1LDKB 2R7UA 4UVAA 2BY0A 1OQYA 3FMRA 2R7SA 4WK8F 4KIFA 3A01A 2RQQA 4Y33A 3RKQA 3K4CA 2O6GE 3GF2A 3IAM2 1PUEE 3CDHA 1O3TA 2L4MA 1TWHJ 2OBPA 1BIAA 4MQVA 4CCOA 1SD5A 2LBFB 3CJNA 3C2HA 1TNTA 4CZCA 1HKTA 1P4WA 1VQMI 1Z7LA 3VB2A 1SMYF 1EA3A 2ZSHB 1XCBA 3ZMVA 2O3FA 1O3SA 2VPLA 4BE0A 3DPUA 1HW2A 3PUFA 3IH4A 3MAJA 2VIXA 3KP6A 5K7FA 3OIQA 5GTHC 3QYFA 1F5TA 1KU2A 3GFMA 3VYRB 1AOYA 2DYRH 1TTYA 1Z6TA 5K7HA 4M73A 2IA1A 1K61A 3UKGA 5LEKA 1TW3A 5K1YA 1LQ1A 5E17F 1FTTA 4KN4X 1HW5A 2COMA 3HPHA 1V55H 3H3ZA 2YU3A 2D45A 3F8BA 3I0TA 1XGMA 2Y30A 1MJAA 2DMNA 1S8NA 2A5YB 3HGGA 3TO9A 3H3VK 2XDVA 4M3GA 1J5YA 2L3DA 4PSXA 5EG0A 3DP7A 3CO6C 3E5XA 1JE8A 1OYYA 3CF5F 2OQGA 4ENNA 2XGCA 3HZJA 4HQMA 4MFEA 3PIOF 2K40A 2VPRA 4RLQA 3OYJA 1GT0C 1AWCA 1T98A 2EV0A 5D6FA 4M6XA 4A3BJ 2JVGA 2C6YA 4JX5A 5CVVA 1R6RA 4QPOA 4E70A 2HPMA 2HNHA 2XAJA 2L02A 3K7AJ 5GTIC 1ZLJA 3CCRI 2R5YA 3FZVA 5CLSA 1A35A 5J4YA 1XG1A 2A69F 2VKVA 2LR8A 5FD6A 2DTRA 3ASNH 1AHDP 2VJIA 2IA2A 3Q9SA 4EJWA 3DEWA 3IRQA 1T8IA 3R4KA 1GLNA 2E1MB 1W5SA 4E4HA 2PJPA 5LHGA 1PP8F 1OLTA 2VKHA 3BT9A 4FHTA 2HYGD 3OV8A 2R5ZA 4XIDA 1DU6A 1AA7A 5HODA 3A03A 3OSGA 3QPHA 1RKWA 2EFNA 1ZG5A 3NWTA 3CESA 4ANJA 2UWMA 3F6OA 4PZJA 4P9FA 4BGDA 2XRNA 3QP6A 5GPCA 5C3EJ 1WJAA 4ESBA 1IC8A 1W5TA 3H5NA 3V42A 4BJ5C 1D0ZA 3H9GA 3O8HA 3ZGKA 2GBYA 2OV7A 4BEHA 1U5TA 2XPWA 2IS6A 4XORA 3HRUA 3OR2C 1VQNI 2LNBA 2ZJPF 1X1AA 2XHKA 3QYBA 3CDIA 2EZLA 2KZGA 3CTAA 1RETA 4Z2YA 2Z99A 2X1EA 2OC6A 1ETXA 4DYRA 3ZN1A 3RPUA 2ZB9A 3VOEA 3LA7A 2MYSA 1MMSA 4UB6C 3HSRA 2LMDA 2PBIA 2LSOA 5EZHA 3MFKA 2X48A 2LY2A 2KJCA 4S0HB 4XOTA 2CMPA 5DDGA 3LWFA 3L2UA 2NS8A 2FQ4A 2GZWA 2M8GX 4A3DJ 5EEGA 1D3YA 3TW7A 2NS0A 4L5JA 2CV1A 3AKZA 3CMYA 3WTVC 1VQ9I 4I7HA 3QWLA 1E3PA 4KITB 4HSRA 1Z7UA 3SZTA 3BR1A 2OZ6A 2IBDA 3IC7A 3OYEA 2ECBA 3OIPA 5J1YA 2PLYA 4CA0A 1OYIA 4AUXA 5L3FA 5DUKA 1U9OA 2FBHA 4CH7A 2NAZA 3HHGA 2XPVA 2HYFA 2X51A 1FIPA 1WPKA 4CCLA 3IWFA 4BHBA 3GO5A 1WJFA 2NOJB 3TMOA 3FXKA 4F52A 1LE8B 1P2FA 2KFDA 1IW7F 2MFZA 2O03A 2VQCA 2BW3A 5BMZA 3GTPJ 3VYSB 4I98B 4L18B 4OAYA 3KZIC 3J80K 5M5WJ 3S2WA 3TDZC 5D4RA 1KU3A 4EJUA 4EM1A 1U9NA 3RQ4A 4LMYA 4A3GJ 3SYTA 2V6EA 2DFIA 5FO5A 1NG7A 3K1NA 2L0KA 4Y7NJ 4M72A 4XNFA 3F72A 4F3QA 4IRIA 1BIBA 2K3FA 3LSGA 3EYIA 2FEZA 2L9RA 3BP8A 4M3EA 1X4OA 3LSHA 4IRHA 3AL0C 1Y1WJ 3FDYA 3O3KA 2ZCWA 2K27A 1K4SA 1XSVA 4BE2A 1T95A 4EGYA 4XRFA 4P1WA 4HV5A 3DEEA 3HOVJ 5D8KB 2R0QC 3N97A 4OMYA 1YIJI 2QSGX 4QTRA 1PUFB 2AO9A 2W4SA 2FOWA 2K9MA 4PGGA 4XLEA 4CYDA 2PI0A 2BY3A 3S1QJ 3KCCA 3HOYJ 1VI0A 2KQRA 2PQ8A 1H89C 1IRXA 4CYCA 2XAHA 2KRHA 4ETSA 3LAPA 5IPAA 5DM7F 2GIVA 3FK6A 2MG4A 2YX7A 4RAYA 4A3CJ 1W1WE 1Y56A 3HB9A 3F9KA 3FM5A 2V9VA 4JP0A 3ZXSA 2HFHA 2F4IA 1JT0A 2XGDA 4AC0A 1ORKA 2H94A 3CLOA 1HXDA 3KYDB 3BR3A 3TL4X 3RIRA 4IHXA 2V6CA 4JQFA 5J4VA 4ZC3A 5F0FA 1T08B 2IS4A 4GCVA 1XB4A 2DDAA 3MZ8A 1T0FA 4NC6A 3L2RA 4A0XA 2XVCA 2E34A 3F8MA 3S32A 3DBRB 1B4AA 1ENHA 2KIMA 2AQFA 2HOTA 4PJJA 3MEXA 2P5LC 3GW2A 4RGSA 1XX5A 3LL7A 4J00A 3CJTB 4F92B 4D5CA 4CCKA 1LEBA 2LRDA 4ABZA 3RZDJ 5J3LA 4FX4A 3FF5A 1QHHD 3CCEI 3OR1C 2LYCA 5J1UA 1V4RA 2HXIA 1IN5A 3BCBA 3GWZA 3NQOA 2VN2A 3AAFA 5CVRA 3M8JA 3CC4I 3L2WA 4CHUA 4NC8A 2H1LA 4D9JA 3E6DA 2VJJA 5ICEA 2EA4A 1O7FA 1NTCA 2A05A 3MD2A 3S3NA 1OJLA 3JAMK 1MGTA 3ECHA 2GXAA 2FSWA 1NK3P 1OISA 3RSNA 2EWNA 2QENA 4IRGA 3CDLA 4XKVA 4HEA2 4X6AJ 5FLXZ 2F5DA 2JJ7A 4RA2A 3A1YA 3V7CA 2R92J 4BAYA 3HOXJ 1S3JA 3ZP5A 1YG2A 3I56I 2WV1A 4FX0A 2V1NA 4XLFA 4V19K 4M9ZA 2TCTA 3CCMI 2DCEA 1FJLA 5E1WA 5DTDA 1O3RA 3H35A 1KQ0A 3QU3A 1TW2A 1BW5A 1ZQ3P 2E1NA 2L9VA 4JOMA 4U88A 1K83J 1HLVA 2B63J 2OAZA 4PCQA 2KKOA 2AXLA 3KYLA 3CCLI 2DA1A 1TZLA 3CO7C 3LQRA 1YHQI 1WHUA 2XUBA 3V8LA 1W36C 5F27A 3TP0A 1XGOA 2WADA 5K7ZA 3JRFA 3OS2A 2NNYA 1JJ6C 3VODA 1QZZA 1X3UA 4UUSA 5JLWA 4QPQA 2LKSA 2WWYA 3RZOJ 1MMDA 4M74A 2FBKA 2FNAA 1X1BA 2P7VB 2DI3A 3CUQA 3OIOA 1LFPA 3ULQB 2Y0SN 3J81K 4DYCA 3AFHA 2QKLB 3C3WA 1ZAOA 4RAZA 2ME0A 2V9KA 4UVCA 1T56A 4IL6C 3S2HJ 4OIQF 3GFIA 5IT9Z 1SANA 2JRMA 1WSUA 3M4OJ 1I6XA 1OFCX 3M8EA 3FISA 5TJJA 1H88C 5LBQA 1SD6A 3KZYA 5IYBJ 3RI4A 1FWZA 3DTKA 2AHQA 4K2EA 5E20A 4PFOA 2PJRA 4MIMA 1YYVA 2V1DA 2F48A 1GXQA 4A0ZA 2VONA 3PO2J 3OYCA 4YIFA 3BG3A 3BJOA 3KEQA 2JA7J 3KX2A 4MEXF 3L00A 1GV5A 1DPUA 3G3ZA 2PN6A 2QQBA 4DZPA 4BUPA 2EFOA 1Z3XA 5LHHA 1BOAA 2Y69H 4XLAA 1EH6A 2DTZA 1H9TA 1X1CA 2EZKA 5GPAA 1MBKA 4A5MA 2L7FP 2WAQA 1CF7B 4CXFA 2Y9ZA 2XSDC 4PJNA 1BI3A 4BYYA 1IV6A 2H8RA 4KMUX 2OZUA 4ZDPA 3BG6A 2DU9A 5F1RA 3CQZJ 4CUGA 3CJRB 3I71A 1YJNI 2K86A 5EGOA 3ZR8X 3DQVC 4LK0F 4OIRF 4NQWB 3VSLA 3ZQ7A 1Q1VA 2CQXA 2GXBA 2A6TA 1RR7A 1ZARA 1BW6A 1PVEA 3VFZA 4EM2A 5E1ZB 3HGYA 3ZMSA 3WU1B 3CCSI 1KYWA 5BS6A 3F6VA 1BR1A 3J7ZI 4XRMA 1B72A 2HZDA 2ZMEC 5E8IA 5DCFA 4ASNA 2FX0A 1D5YA 3H0DA 2M4GA 1K4TA 1LJ9A 1Z9CA 1RC9A 4AM3A 2A3SA 5B5EC 5DUIA 3OYBA 3WHCA 1I3QJ 1GVJA 3S1RJ 5FRNA 3OWTA 1J9IA 2GAUA 4EM0B 3R0AA 5K5QA 1ZH5A 3M3YJ 5LEJA 2R7QA 3FHZA 2DOAA 2KL4A 3LOCA 2BBYA 2QM3A 3MZYA 3OMYA 3RCOA 4IHSA 1E0EA 4O3MA 3OY9A 3HPGA 4PJLA 3IL2A 5HDNA 5J1RA 2GM4A 1F43A 3SZGA 4I01A 3NWSA 3BZCA 4DOZA 1FOKA 1FZPB 2PFBA 2DN0A 5JHUA 3FXJA 3JSOA 4NUBA 1O4XA 5GAGJ 4CGZA 2RVCA 4XL9A 1QGPA 1FC3A 1Z3YA 2VT2A 1R49A 1B9NA 2JMWA 2W00A 4Y17A 3CCUI 1R00A 2X4HA 3WODF 1J09A 1GVDA 2FMYA 2FMLA 4M71A 1FEXA 5DD4A 3F8FA 4WF2A 4E6KG 5J47A 3HUGA 3ZMZA 2OCEA 4RM2A 2DW4A 5TGTA 5ILSA 1QVTA 3GCMA 3L7WA 2IVMA 2LFBA 2KRCA 4FASD 4OIOF 3PNYA 1SEUA 5FKLA 1Y39A 4HX4A 2ETHA 3BG5A 4MNUA 1J59A 2DT7B 1BJZA 2IJLA 1WWXA 4ZYDA 3OYFA 1OCOH 3FKJA 5DM6F 5E79C 5LGNA 4PK4A 2EIJH 3I59B 1TLHB 2V79A 3S3OA 2HDCA 3GUDA 2M2EA 2P0WA 4AIHA 3PJRA 2MGQA 3KP7A 4GYGA 4A6DA 5K5RA 3V4GA 1IN6A 1J2XA 4IVNA 2OD5A 3K4JA 3MKLA 3MMYB 1B9MA 1YIOA 1P6RA 2NNNA 3JRDA 5FLVA 1R1TA 3RTRA 1RZ4A 3O6BB 2HDDA 3X2QH 2KP6A 4ON0A 3TO7A 4M6VA 1TBXA 2J5OA 2OF7A 1SFOJ 2WB1A 5KVRA 3OS1A 3HOTA 3CCJI 5C44J 4I02A 3FXRA 2IGOA 2Z9OA 4YELA 3QODA 4PUSA 2D1HA 1FOYA 4Q47A 4ZZDA 2ZJRF 4IO9F 1BC8C 2KISA 1SFXA 2UUZA 5E3LA 2JSCA 2XV4S 5HLTA 2GA2A 4QLCU 1D8JA 3PFYA 5D5UB 4DNCA 1R58A 2KPMA 2R7RA 1K7AA 1SD7A 3HTSB 1S5LC 1UAAA 3F22A 2BY2A 3JRCA 2P6SA 1ETWA 4IXAA 1STZA 1QA6A 1DP7P 3H3UA 3G6EI 2ZXIA 3B6CA 3CC2I 1G3TA 4NC7A 1XC5A 1X1PA 2E1MC 2QGUA 3G1MA 1NHAA 5DCMA 4ITVA 1M1EB 3UR3C 2L4AA 4G94A 3U1DA 1YW7A 2QVOA 3E3VA 1UZCA 5IOYA 1G3WA 3E97A 3T0YA 2R7ZJ 4LG0B 1G2HA 2FD5A 2DOEA 3QQAA 4BXFA 5FJ8J 2K4BA 1FSHA 3R0JA 2V26A 4YIIA 4MGRA 1DGWY 2ICWG 2JUCA 1UG0A 2AXTC 2LD5A 1ETVA 2Z5UA 4LLGF 5IP9J 3F8NA 1YFHA 3ML6A 3H5AA 2JSPA 1E17A 2R7DA 1IN4A 2DO7A 2FBIA 3W2VA 5GP9A 1SVMA 1ON2A 2XC7A 2MBFA 2ZNYA 1LUJB 2QZ8A 3QOPA 1YJ9I 2GOMA 3S15J 4OIPF 3BZKA 3GBGA 3T8TA 1R36A 3OYIA 2F5CA 1BBYA 1AKHA 3L2CA 3CMEI 2K7LA 1D0YA 1G6NA 4DBRA 1MSFC 2R93J 4J01A 2ELHA 2EJRA 2IGKA 4N4NB 3G4SI 1XMKA 3LQQA 4V2FA 2DK5A 1K78B 5D5WB 4ZH4F 2IGMA 2H27A 4X1EA 2IAIA 2O5RA 2VBYA 2AS5F 1MBEA 3JCUC 3S8PA 2STTA 3I64A 3TDUC 3HEFA 3COAC 5AIQA 2GLOA 2LOOA 4A6EA 2HXOA 2VC0A 1FP2A 2M7AA 2O0YA 2Q2EB 2QSHX 2HU9A 2H6BA 2LY9A 2RKHA 4L5IA 3W3CA 1JKQC 1DU0A 4WCGA 3FMSA 4JX6A 4KDPA 1BI1A 3EYYA 1L0OC 2HTSA 4HRIA 2XAUA 1V5GA 5EDNA 5L3DA 3P9KA 2LKXA 2CSOA 1HCRA 2CS3A 4RDUA 1MBGA 1ZK8A 3HTUA 4LITA 5H20A 2X6OA 4ZTFA 1SC7A 1K6OA 5KAIC 1BL0A 1JUSA 2KJBA 5BPIA 4A3EJ 2DMQA 3G1LA 2XSJC 3MVPA 2DFHA 1JHFA 3PL8A 2COBA 3OL3A 4D1QA 3RJPA 4R8HA 2DQRA 4B43A 2CWEA 4XLNF 4A3LJ 3LSRA 2BVLA 4LFUA 3CUOA 3S93A 1OCTC 2VUMJ 1L3LA 2BVMA 4DJAA 2WY7Q 3QOEA 3K0LA 4EJVA 5LLQA 5JVTA 3K1PA 3A01B 4I0BA 1W36D 5IT9K 3GZ5A 3EUHC 3I9V2 2IT0A 4YG2F 2HS5A 1MD0A 4BBSJ 2PMHA 3IP4B 4UV9A 1FBUA 3GTQJ 1TC3C 2L7ZA 2IRFG 2BGCA 2EPFA 2KIQA 2EZIA 2KHMA 3G1OA 3IKVA 2CV0A 5M3MJ 2XAFA 1IJWC 3JR9A 1RKTA 2UXXA 3L9FA 1W7PA 4KFCA 5ED4A 3LMMA 3F21A 2WBMA 5TISC 2WTEA 4G6QA 3VEPA 3ROUA 1I3AA 1S6LA 2MSYA 4ESJA 3BG9A 3U21A 2E2JJ 1XDUA 4BU2A 4UUVA 1WI9A 1RPWA 4R79A 1F36A 4RLFA 5F0CA 1J75A 2BHYA 3U1KA 2ID6A 2M0CA 2QA4I 3IAS2 1PJRA 2ME6A 3ZCOA 3VYUB 2ZBKA 1TP4A 2ID3A 4C9YA 5K5OA 2I10A 1KONA 4IQJA 1IDZA 1I27A 1YS7A 3D5RC 2MH9A 1R4MB 5EG0B 1VQPI 4MQ9F 1A36A 3B6AA 4IX7A 1OPCA 3G71I 2LF7A 3DWLE 1WRJA 5L3GA 2LTPA 4L9TA 1ODDA 4M9XA 5FLMJ 4I99C 5ERIA 3CMMA 2BHZA 2MD0A 1YW8A 3ZQQA 4FE4A 2QQAA 4II3A 3DCFA 2VL8A 2KMUA 1QRYA 4ESFA 1R5GA 2DQLA 2VB6A 4NBQA 3JTGA 3KPHA 1YE9A 2JPCA 5FRMA 3PSFA 4A3FJ 3DLLF 3HRMA 3HOWJ 1ZN2A 2FA5A 3BCAA 2Q1ZB 1IGNA 3CCQI 3QU6A 2P5KA 2CW0F 2FF4A 2X0LA 5C4XJ 5GADJ 3DKXA 3NEUA 2LF8A 2HKOA 3RDIA 3SZPA 2R5ZB 3OYLA 3BWGA 2EH3A 4HLXA 4HYEA 3ERED 2RNJA 2HWVA 2QBYA 1T39A 2OTJI 3HSEA 4BXUA 1PUFA 5IYCJ 3U2RA 3E6BA 3ZQIA 2WV0A 2E35A 2XIGA 1VZ0A 3LSTA 1A04A 4XBFA 3OYNA 1FP1D 4OAZA 4BEHB 1U5TB 1O57A 4KISA 1B59A 3S17J 2XAQA 4CCNA 2F4OB 4B47A 1MNDA 4YEJA 3RKXA 3PQKA 1JKPC 3ABTA 1A6QA 4A2UA 3HL2A 2KT0A 4UHTA 3HRTA 3UNGC 2Y75A 4N0BA 2L9SA 4BQAA 1KU7A 3T5XA 3A4CA 3GZ6A 4IQ4A 3FMQA 2M8EA 2W1OA 2GXGA 2KZVA 2P81A 2VBZA 1YITI 3G2BA 1FMWA 1F9NA 3BY6A 1P7IA 3ZMDA 1VQ8I 1ZKGA 3PQJA 3B73A 5LFAA 1TWCJ 5HNFA 4UUTA 2MH2A 1RESA 6PAXA 1USTA 1JKRC 2WC2A 3HSFA 1XTAA 1TQPA 2JA5J 5ICGA 4BJTA 2M0MA 4FCYA 4D5FA 2EQRA 2DA6A 1Z77A 1ON1A 4ENKA 2HI3A 2XF6A 4ZYGA 3KZZA 5CYVA 4KUMA 4I2OA 1XS9A 5FD5A 3M1CA 2GWRA 4JX4A 2LDUA 5L3EA 5D5XB 2XPUA 2VJ4A 1Y8RB 5E1XA 2E71A 4P55A 4IHTA 1UHMA 3SHFA 1LEAA 2DLLA 1UMQA 1VTNC 1FX7A 1YRNA 1YX5A 2CW7A 2JA2A 3K6GA 3JW4A 2W48A 2L7MP 3K2AA 4DGWB 1MJ9A 4A3KJ 2NVQJ 4LJZF 3C1DA 1ZG3A 2JVHA 4OINF 3JSPA 4UNOA 4IOAF 2O7OA 3HIFA 2ZJ2A 2DA2A 4U0WA 1X58A 4HNUA 3NRVA 1HOMA 1HDDC 3TGNA 2M1BA 1JJ8C 2LY1A 3DKWA 2W7NA 1KZHA 3F23A 3WTWC 2HOAA 3ECOA 3F8CA 4NHJA 1DDNA 2H09A 2PX9A 3PIPF 2Z2SB 5FB2A 3QYEA 1LDJA 5CVIA 3D0SA 4IPAA 3F3XA 3JRHA 3ZRGA 3J7AO 1ZGAA 2EK5A 3BTCA 1NH3A 1TWAJ 4YIRX 3JRAA 3GX4X 4JBAA 2CFXA 1IV8A 2EZHA 3W6VA 1IXCA 3GTKJ 2RREA 5CKTA 2H6CA 1SD4A 2KDZA 3SFZA 4CYCB 2B0LA 1DP3A 2IP2A 3K4BA 1ZRCA 2L2OA 5KHDA 1VFCA 2P7CB 1HBXG 3AG4H 2D5VA 4L0YB 1RUOA 1XMXA 4HV6A 4I76A 3J7AY 1FOXA 3TQNA 2V1XA 1ZG1A 3GZNB 4IEJA 4C2UA 1VNDA 3MKYB 4LK1F 2RAEA 3H5RA 2E2IJ 1G3YA 2HQAA 4BE1A 2A6EF 2VASA 3GFJA 1R7JA 4A5NA 1LNWA 4ZDLA 1B6AA 5ILUA 5LRSA 3Q3SA 3HOSA 2HR3A 2CQNA 3M7GA 1Z21A 2DOFA 1I1SA 4P9UA 2ZFWA 2PMUA 4AD9A 2VC1A 2XB5A 3FXOA 1WJEA 2JA8J 1MDMA 5HLGA 1HSJA 3SDBA 2CGPA 4KICA 4A93J 1OR7C 2DA5A 4RAFA 3TOBA 1MIJA 1QHGA 5HOOA 2ELJA 4XICA 1TL8A 1ZHFA 1X3WB 1R1UA 4ENMA 1QNTA 2P4WA 2M34A 2DPUA 1KQ8A 4WXHA 2EFPA 4BL0B 1EF4A 4NQWA 3K2ZA 4KMFA 3W6JB 4IF4A 2CO5A 2Q0OA 4XKWA 1XD7A 4CICA 2J5PA 3CF2A 4XN3A 1ETQA 2WAFA 2IS2A 4BKXA 2K9NA 3WTZA 2WY8Q 3ZMUA 4EGZA 2K5CA 3C2BA 1XDSA 2F4MB 2QYOA 3HJEA 2VE8A 3NARA 3BJAA 3TEDA 4H0EA 1ONVA 5KNLA 5L3BA 3OL4A 3QRFF 2VODA 3DV8A 3HM5A 4HZFA 5CQEA 1EJ9A 3IRRA 1JI8A 1T6SA 4RB2C 3QPSA 3PFIA 4Y52J 1X19A 1UJ8A 2B7EA 4BACA 3K4MA 1Z05A 2OQRA 3OSFA 3EPZA 1ZGWA 1FY7A 1X2MA 5F04A 1TT5B 3RPUD 5LD2C 3KLOA 1XCVA 2K9QA 4ZYHA 2QQ9A 4PFPA 4ZTJA 4W97A 3L2VA 1Z91A 5ICCA 2LP0A 2XF7A 2Z33A 1SVLA 3ZN0A 3ZQHA 4UUSB 1XN7A 3BC8A 4Q4ZF 3SQNA 1OKRA 5FKNA 1XGSA 4M3DA 3DEUA 2LG4A 3CUQB 2K85A 4OOIA 1FYLA 1UFMA 2PMZA 2NVUB 1SFEA 3OYAA 1ZGJA 4M9SA 4XLCA 2QEXI 5EZGA 1H8AC 3BZ6A 1POGA 1D0XA 1ZREA 2EIMH 4OWRB 2XB0X 5DS9A 3EUAA 1GUUA 3HBLA 3I54A 4HBLA 3R61A 1YOVB 2KLOA 2DA3A 3DXJF 5F0HA 2O8KA 2PJRB 3I59A 1FNNA 3GMEA 4XK4A 2HOSA 5A2QZ 2D2WA 2ISYA 1V5FA 4MTDA 3OYDA 1ZRDA 1JHHA 2CH0A 2X9DA 3EQLF 2OPTA 3LSMA 2L5QA 3BPXA 3Q9VA 2YX4A 2Y31A 1IG7A 4FTHA 4E7LA 4PDKA 4E7ZA 4BJ6C 4B3XA 3V8KA 1ERDA 3HXLA 2E5ZA 3FBIB 1R5ID 4C2MJ 3IV5A 1YI2I 3CZ6A 3FX3A 3M8FA 4R1HA 4Y13A 2F2EA 1EH7A 3G73A 4AU7A 1XGNA 2JWTA 5H6QA 3A0BC 2DJNA 2CQKA 1O7LA 2XROA 3SJMA 2ZSIB 2BV6A 5EGOB 5HLIA 4B44A 1R1VA 5KCMA 4MTEA 3ZMTA 4G7HF 3IH2A 2K4JA 2NOGA 4U87A 1D1AA 2DMTA 2DODA 5J8FA 2E19A 2LREA 3FM3A 4BDYA 1JTYA 4MHGA 3E7LA 1BN5A 4YFXF 1OCCH 3HOUJ 1B72B 2XKPA 2M7BA 5LGUA 2CG4A 4N9HA 1BOBA 1I5ZA 4E7JA 3J80Z 4KJZA 2L9NA 1T2KA 1IUFA 3HKZA 5BNGA 3HHHA 2CW8A 3M9AA 4CCJA 1RR8C 3LFKA 1F4KA 2DPDA 1T33A 3LSKA 1RIOH 3D1NI 3OS0A 2E36A 3SEQA 2TDXA 2ZJQF 1ZELA 2L01A 1RUNA 3HRSA 2MA3A 3DFGA 4XLPF 2KRFA 2HEOA 4WWCA 4XRSA 3GTOJ 2ZMEA 4XSZF 3RQIA 4MLOA 3W2WA 4RGUA 3AG2H 5DV5A 3JTHA 4HX7A 3JRIA 1KYZA 4RM3A 3I4PA 1EV7A 1XMAA 2JN6A 2P5VA 1Z1DA 1MMAA 2IPQX 3H1CA 1E3HA 3HUGB 2HQ5A 2IS1A 4HW0A 4C30A 1Y0UA 1U6GA 1QVUA 3KE2A 3FXLA 2GOXB 2G7HA 3ZQLA 3ISPA 2VQGA 2X6WA 3GTMJ 1OYWA 3M1EA 3CLQA 1RI7A 2MC3A 2E5NA 3QAHA 1S7OA 1UG2A 2YPRA 5HS8A 5IT3A 2ZO4A 4ZZLA 4Y15A 3I4NJ 3ELKA 4G7OF 2LBFA 3C7JA 2P8TA 4L0ZB 3IKTA 4L9VA 5E3MA 1I50J 1KQ9A 1R71A 4NDLA 3IUOA 4C3JJ 4FISA 3VWBA 2MW8A 1U3EM 3P7NA 1YTYA 2JZYA 1ETKA 3DPLC 3DTEA 5AONA 3LSPA 3ABMH 4KIGA 1BR4A 4B3AA 3TBIA 2VJ5A 4KIBA 3BTJA 1B8IB 2FJ1A 2EIKH 4RB1A 4P96A 2Y48A 1UHSA 3K9TA 4AIJA 4XONA 3JRBA 1SFKA 2LC2A 3TOAA 4EATA 5GAHJ 3KP4A 1D1BA 1J0RA 5EF6A 3ASOH 3BQYA 1U8BA 1P92A 1FIAA 4XN0A 1JUMA 2FXAA 2KIUA 1P7JA 2BEOA 2YR2A 1ACIA 2K3PA 2CUEA 2HVQA 4LD5A 4P5OA 1UCRA 5L3CA 3ESWB 1F1ZA 3GXOA 4LGWA 1Z0XA 4XLHA 1XSDA 3S14J 1V5EA 4HDVA 3H0GJ 4BXXJ 4BHCA 3BROA 5IYDJ 2CU7A 4M3BA 2XRLA 4LIVA 4H4KC 5KAFC 4Q48A 3C2GA 3EUKL 5HDGA 3S2DJ 3HDDA 1WGXA 5DEQA 2VT3A 5FLXK 2W57A 5E3NA 2QQ8A 1IRZA 2FE3A 5DCMB 2VKEA 3LA2A 2ZXJA 1HC8A 4EVIA 1BJAA 1S29A 3MCZA 5B1BH 4DQ2A 2NVXJ 4X0GA 4S05A 2A5WA 5JI6A 3JRGA 4IHYA 1RRJA 4KT5C 2EILH 1ZLKA 4HA8A 2YUSA 2EFWA 4C3HJ 3EDPA 3TO6A 1U5TC 1QBJA 5J8CA 2AQEA 4E7IA 3BDDA 1I39A 5F08A 2A68F 1MBFA 2Y0SA 2A6HF 3S1MJ 1TQIA 1K6YA 1OCPA 4DW6A 1USSA 3BR5A 1YJWI 1ZR2A 2OCCH 5M5XJ 3OYKA 2HOEA 2DMUA 3D5SC 2M9HA 1U0JA 1Y6IA 3MZHA 1MMGA 2NVYJ 4DIQA 1JTXA 5HS7A 4HOBA 4GRIA 1UB9A 4YFNF 2HVRA 4LG3A 3K70D 1SAUA 1AKHB 3J81Z 2M30A 1IRGA 1VF9A 4MFDA 1FBSA 4C3IJ 1ULYA 1X2NA 4RBOA 2ECCA 1X3ZB 1HW1A 1R23A 2HGCA 3N4MA 2DMPA 1LFBA 3EETA 1TWFJ 1UELB 3FKIJ 1QPMA 5DYMA 3JREA 3TW6A 2LVSA 5JHFA 1HSTA 3W2AA 1BA5A 2O61A 2XF5A 4RGXA 3LNQA 3WHBA 1V3FA 1ITYA 1EH8A 5IP6A 3MKZA 1AU7A 3BTIA 1UHWA 4ZYAA 5M5YJ 1A31A 2FRHA 3WTTC 1EKEA 2DYSH 3QP5A 3S16J 2D1VA 3H36A 3WE2A 1Y0NA 1REPC 2IA0A 2ZFUA 5CPRB 3GLXA 1HKSA 4BH9A 4ZJZA 4B1RA 5HVQC 5IY5H 3I58A 3GTGJ 1SMTA 2DDBA 1B1BA 1YQAA 5HLHA 3K1MA 5DD8A 2XGXA 5D4SA 4O5VA 1MJBA 3E6MA 4PJ0C 2STWA 1I1GA 2CRGA 2E2HJ 2QSFX 1TNSA 2X6YA 4QWQA 3M07A 2HTJA 5FKKA 3SFIA 4MO7A 3N05A 4EQQA 2WAQN 3E1SA 1IO2A 4WX9A 1D1CA 4GDFA 4WXCA 2V4JC 3Q0VA 1IXRC 3I53A 3IHUA 1LE8A 2JUGA 2YSRA 1PYVA 2MD5A 4F93B 3SXYA 1N78A 1Y1VJ 2R7TA 4NB5A 2N8GA 2GQQA 1MW7A 2ZC2A 3MWMA 2R5YB 1MBHA 1S7AA 1D8KA 1HA8A 4TV7A 1W5CC 1W0UA 1E3OC 3BTLA 3B02A 1SAXA 2DA7A 2ESNA 2JT1A 4IJAA 3GVAA 4LOCA 1YW9A 2QKMB 2PMZN 4U0YA 4G12A 2EBIA 3K10A 3REOA 2GIZA 3ERMA 3WGGA 1JKOC 5A2QK 1C0WA 1QU3A 1MH3A 2MABA 1HKQA 3OYGA 4XSXF 1R9TJ 1ZR4A 3EUHA 1ETOA 5TRDA 4YFKF 3SDGA 1W7PB 3RKWA 2Z3YA 4BY1J 1N77A 5BPDA 3WGHA 2ZKZA 2F5FA 2FNPA 1WZ2A 2RNGA 3Q0WA 1LVAA 3KP3A 1MZBA 3CP8A 4KA4A 4C2TA 1FSEA 3LSJA 2W24A 2QLZA 2A61A 1SFUA 4BQNA 4MEYF 1T0FC 4KT6A 4L9NA 2Y2ZA 2UV1A 1W4MA 1DUXC 2FOKA 2VBXA 3GEZA 3NAUA 2VQHA 2RC4A 1IRFA 2DA4A 3DLAA 3GLLA 3PNVA 4HX8A 2BYVE 3KP2A 3LAJA 3H92A 4JYKA 2ISZA 4V2GA 4I6ZA 4Q5SF 2IXSA 2W82A 1VQ6I 1BI0A 2F5VA 2VI6A 1WH5A 2JK3A 2I8DA 2KIFA 4UB8C 4ENJA 1TT0A 4LIUA 1IZ1A 4AWXB 4WXDA 4W1UA 2MC4A 1I6HJ 2VXZA 2M45A 4U0VA 3F0CA 3PNTA 1LVKA 4II2A 2XAGA 4BBRJ 1MNMC 4EJOA 2IW5A 3KLNA 2VOOA 2O8XA 2K9SA 2GA1A 4FE7A 1KGSA 2F5EA 4AYBA 3TKYA 5JFRA 5B1AH 3K4KA 4CDGA 4KNYA 3L2QA 1VQ4I 5F1JA 4G6TB 3VDXA 2G0EA 1XSXA 3HKZN 4LLLA 4HQEA 1P4AA 5F6FA 3IH3A 3WTYC 1LB2A 3I4MJ 2EV5A 1FYKA 1G4DA 2JTVA 2QUFA 2QBYB 3KEYA 2M5WA 5JVGF 2WB1N 4IZZA 2PG4A 3LSIA 4FQGA 3V8JA 1IUYA 1QO0D 1U2WA 2M87A 2X6XA 1XPXA 1CGPA 3BR2A 2DAOA 2R7WA 2EA2A 4S04A 3AG3H 2XKOA 1QPIA 4DYQA 4N9IA 2R7VA 2BW3B 3CC7I 5E8GA 3ZOBA 4LLNA 2CUZA 1JXSA 3WTXC 2VQLA 1WJBA 1W0TA 2M4KA 4HPQA 1S72I 1GXPA 5JR3A 2BOLA 2JQ7A 4HF0A 1O3QA 2E1OA 4JK1X 3I5UA 1KU9A 3HYIA 2O9LA 3CUQC 4G8XA 3DF8A 4HG2A 3R60A 4UXNA 9ANTA 1FBQA 1GHCA 5D5VB 4XMYA 3BOQA 3SEZA 2Z1DA 3P5JA 4NNJA 1X1DA 4A69C 4AIDA 1VQ7I 3L09A 2OTLI 3R6SA 5FFZA 1WI3A 5EEHA 4E7HA 1HF0A 3WG9A 1GDTA 1YX3A 4RMNA 1BC7C 2W84A 4CO8A 4Y4RA 1P4XA 4YRVA 2RV8A 3DU5A 4O6JA 1IN8A 2BXYA 2DT6A 2NXNB 3K69A 3KEOA 3V7RA 1G8XA 2W25A 5E3OA 4G7ZF 2WA0A 1PP7U 3CCYA 5H2FC 1YLFA 1DQUA 2A07F 3E6CC 3WE3A 1H9GA 2IGNA 1LKXA 1YRNB 5AIPA 4A3IJ 3VSKA 3DU6A 3GYHX 1R5HA 4G6DA 2FU4A 3K70C 3DBHB 3GTLJ 1WH7A 3C18A 4LB5A 1MBJA 2JPBA 1WFXA 2EFQA 1S9HA 3T1BA 2YU9J 2K9LA 3CP2A 5BQTA 3KYCB 2HDWA 4E7SA 1ZYRF 1WVRA 4A0YA 4CZZA 1DGRM 1BI2A 1R4NB 3ZPLA 1OCRH 2CFOA 2EB7A 2X1CA 3ABUA 1ETYA 1T38A 3FHNA 3U9GA 2G9WA 3H9QA 3FK7A 5HS9A 1JGGA 1CF7A 5LGTA 4D7MA 1WJCA 2LLKA 4L9JA 2EINH 2TRTA 2HQNA 1WJ5A 3BR0A 4GFBA 1WJDA 2FUG2 3KP5A 3W6KB 1VQKI 3MKWB 4G9YA 1W7PD 2CUFA 4IOCF 1IXSB 4IHWA 2JA6J 3OYHA
chains in the Genus database with same CATH topology
4F3QA 2BVLA 3S93A 3SEQA 3OS0A 3LSGA 4AVZA 1ZELA 2BVMA 4DJAA 1X4OA 2X85A 3LSHA 3AL0B 3AL0C 2WY7Q 3FDYA 3QOEA 2F6CA 4BE2A 1T95A 4P1WA 4MLOA 1W36D 3W2WA 3EUHC 3DEEA 3I9V2 4BS9A 4RM3A 3IP4B 2W4SA 2K9MA 4XLEA 1MMAA 2R7OA 2KQRA 1IRXA 4XR6A 3HUGB 2KRHA 2IS1A 4C30A 2KHMA 2GOXB 2CV0A 1G59A 1Y56A 4DBQA 2VQGA 2X6WA 3F9KA 3ZXSA 2F4IA 2E5NA 3OOUA 3LMMA 2WBMA 4U7BA 5FROA 3TL4X 3D5LA 2LBFA 3U21A 4JQFA 4ZC3A 4BU2A 4HNTA 4R79A 4PJMA 3IUOA 2IS4A 4RLFA 3VWBA 2HVSA 3L2RA 4CSWA 3S32A 3DPLC 3DTEA 3DKYA 3IAS2 1PJRA 3ZCOA 2AQFA 3VYUB 1BR4A 4PJJA 4C9YA 4N4OB 3TBIA 2VJ5A 2HPIA 5CQGA 1KONA 4IQJA 3LL7A 4J00A 4F92B 4CCKA 3D5RC 4XONA 1SFKA 2LRDA 1FMVA 2LC2A 4EATA 4Y3OA 1D1BA 1QHHD 3OR1C 2LYCA 4IX7A 3DWLE 3BCBA 4XN0A 2VLAA 1MNEA 2M3AA 3M8JA 4HSTA 2K3PA 2HVQA 4P5OA 3L2WA 4XQFA 3CMMA 4NC8A 4XLHA 2MD0A 3ZQQA 3VYTB 1BR2A 4II3A 4D9JA 3LFUA 1V5EA 2VJJA 2KMUA 2VL8A 3MD2A 4XM3A 3S3NA 2VB6A 2VKDA 4XKCA 3RSNA 2R7XA 1N75A 4LIVA 1YE9A 5FRMA 4H4KC 3PSFA 4XKVA 3C2GA 3EUKL 4HEA2 4BDZA 3BCAA 2Q1ZB 3A1YA 2E60A 2V1NA 3DKXA 1NG6A 4XLFA 2V7FA 4XOPA 3OYLA 2DCEA 3DTIA 3BLYA 3H35A 4X0GA 4F55A 4IKFA 2A5WA 2L7KA 4BQOA 4F91B 4JOMA 1VZ0A 3OYNA 3KYLA 4CCMA 4E7KA 4OAZA 4BEHB 1TZLA 4KISA 2AQEA 2X1DA 4E7IA 3HC7A 4CCNA 1W36C 4B47A 2Y0SA 1MNDA 4YEJA 1K6YA 3HL2A 2WADA 3FBNB 3OS2A 3OYKA 4PSWA 3D5SC 4FETA 1U0JA 1Y6IA 1MMGA 4QPQA 1MMDA 4DIQA 3UNGC 2L9SA 1X1BA 2Z16A 4GRIA 1LFPA 3A4CA 2HVRA 4LG3A 3K70D 1SAUA 4IQ4A 2W1OA 2ZXHA 2KZVA 2QKLB 3AFHA 3G2BA 2V9KA 3A2KA 1FMWA 5LFAA 5HNFA 3HG9A 1P9QC 4BJTA 1UELB 3DTKA 2M0MA 2KDOA 3CJQB 4PFOA 2PJRA 3ONQA 2XF6A 5JHFA 4XKBA 3W2AA 3OYCA 2XF5A 2DJIA 3M1CA 3KX2A 2CV2A 5HNHA 3MKZA 2VJ4A 4B48A 4ZYAA 1X4PA 4BUPA 4ZDOA 1Z3XA 3PUBA 1YX5A 4XLAA 2CW7A 1X1CA 2WAEA 2JA2A 2ZFUA 3K6GA 5CPRB 2WAQA 4DGWB 4PJNA 2R4GA 4ZJZA 4ZDPA 5HVQC 3BG6A 2JVHA 4BQQA 4CUGA 3CJRB 2OUMA 4HNUA 3ZR8X 3DQVC 3VSLA 4NQWB 2A6TA 2X6YA 2LY1A 3K4NA 2W7NA 3N05A 3E1SA 2LH9A 1D1CA 2V4JC 3S3MA 2Z2SB 2JUGA 2CUJA 1BR1A 1PYVA 3QYEA 2HZDA 3E0JB 4F93B 1N78A 3BG7A 1MMNA 2R7TA 3ZRGA 3PSIA 3H0DA 2M4GA 2VXDA 1MW7A 3H9JA 3DPTA 1HA8A 3OYBA 5FRNA 3OYMA 3OWTA 3K4LA 2RREA 5CKTA 2QKMB 3I3LA 1LDKB 2R7UA 2R7QA 2DOAA 2KL4A 3OMYA 3RCOA 1DP3A 3K4BA 1E0EA 3K10A 2L2OA 3OY9A 3HPGA 4PJLA 2R7SA 5KHDA 1QU3A 3SZGA 2MABA 3NWSA 4DOZA 2RQQA 4Y33A 3OYGA 3K4CA 3J7AY 4NUBA 3IAM2 4XL9A 1Z3YA 1N77A 2W00A 4C2UA 3MKYB 4CCOA 2LBFB 1J09A 2RNGA 3H5RA 2HQAA 3C2HA 3CP8A 4C2TA 4CZCA 4BE1A 2VASA 4E6KG 4RM2A 4BQNA 4ZDLA 1T0FC 4KT6A 3HOSA 1Z7LA 5TGTA 1EA3A 2UV1A 1Z21A 2ZSHB 2KRCA 2VPLA 4FASD 2VQHA 3PNYA 4BE0A 3DLAA 3DPUA 3PNVA 2VIXA 2DT7B 3OYFA 2IXSA 1WJEA 2W82A 3OIQA 2F5VA 3FKJA 3QYFA 4PK4A 3VYRB 2I8DA 3SDBA 3S3OA 2P0WA 1OR7C 1TT0A 3PJRA 4LIUA 5HOOA 1QHGA 2ELJA 2MC4A 2VXZA 3HPHA 2DXIA 3K4JA 3MMYB 3PNTA 1LVKA 4II2A 4BL0B 3RTRA 4AYBA 2KP6A 2XDVA 4PSXA 4XKWA 3K4KA 3CF2A 4XN3A 2WB1A 3OS1A 3HOTA 2WAFA 2IS2A 3OYJA 2IGOA 2WY8Q 3L2QA 4RLQA 4YELA 3QODA 2K5CA 4PUSA 4G6TB 3VDXA 2JVGA 2UUZA 1R6RA 4QPOA 2HPMA 2HNHA 5KNLA 5HLTA 3OL4A 3PFYA 5CQEA 2KPMA 2R7RA 1JI8A 3KEYA 1X19A 1UAAA 4BACA 3K4MA 4IZZA 3LSIA 3EPZA 2X6XA 2VJIA 2ZXIA 2R7WA 3RPUD 4NC7A 5LD2C 1GLNA 2E1MC 2E1MB 2R7VA 4E4HA 4PFPA 4ZTJA 2BW3B 1OLTA 2VKHA 3L2VA 2CUZA 4ITVA 3UR3C 2XF7A 2VQLA 1AA7A 1WJBA 2M4KA 4HPQA 3BC8A 2BOLA 3NWTA 3CESA 4ANJA 2UWMA 4BXFA 4BGDA 2LG4A 1WJAA 3H5NA 2V26A 2PMZA 3V42A 4BJ5C 1D0ZA 3H9GA 4HG2A 3OYAA 3ZGKA 1DGWY 2OV7A 4BEHA 1UG0A 4XLCA 2IS6A 4XMYA 4XORA 3SEZA 2Z1DA 4NNJA 1D0XA 1X1DA 3OR2C 3H5AA 4OWRB 2JSPA 1X1AA 3QYBA 3EUAA 3W2VA 4E7HA 2XC7A 1YX3A 4RMNA 2X1EA 2OC6A 4Y4RA 4YRVA 2KLOA 3DU5A 2GOMA 2MYSA 2PJRB 2DT6A 3GBGA 3OYIA 1V5FA 3OYDA 1G8XA 2CH0A 1D0YA 2WA0A 3LSMA 4DBRA 2LY2A 2L5QA 4J01A 4XOTA 2CMPA 1DQUA 3L2UA 4E7LA 2IGKA 4N4NB 4E7ZA 4BJ6C 2IGNA 4B3XA 1ERDA 3HXLA 1LKXA 2E5ZA 2CV1A 2IGMA 3AKZA 3FBIB 2O5RA 3S8PA 3VSKA 3DU6A 3CZ6A 3K70C 2LOOA 4KITB 4HSRA 1WFXA 2M7AA 4AU7A 1S9HA 2Q2EB 2HU9A 2K9LA 3OYEA 3W3CA 3CP2A 3OIPA 2HDWA 4CA0A 4E7SA 2ZSIB 4B44A 5KCMA 1DGRM 4CH7A 4HRIA 2CFOA 2X1CA 2XAUA 1V5GA 4U87A 1D1AA 3FHNA 2X51A 2LREA 4CCLA 4BDYA 2CS3A 1WJFA 2NOJB 3H9QA 3TMOA 4F52A 4LITA 4ZTFA 2MFZA 1WJCA 2M7BA 2VQCA 2BW3A 3VYSB 1BOBA 4OAYA 4E7JA 2XSJC 4KJZA 2L9NA 1WJ5A 3PL8A 3HKZA 3OL3A 4D1QA 1WJDA 2FUG2 3RQ4A 2CW8A 3MKWB 3SYTA 2V6EA 1NG7A 4CCJA 4B43A 4XNFA 3OYHA 3LSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7A A;  2M7B A; 
#chains in the Genus database with same CATH topology
 5FKO A;  1BM9 A;  3RYR A;  4AVZ A;  3ZQF A;  3CCV I;  2LKP A;  1KA8 A;  2X85 A;  4BNC A;  3AL0 B;  3WTU C;  2F6C A;  3FWE A;  5BOX A;  4RS8 A;  5FFX A;  2Y0M A;  2PEX A;  1LDD A;  1OMI A;  1U78 A;  4BS9 A;  2BXZ A;  2DFE A;  5LHI A;  2NRA C;  2HZT A;  4HF1 A;  3J7Y J;  2RDP A;  2VBW A;  2R7O A;  1SVO A;  2ESH A;  2DBB A;  1Q1H A;  4XR6 A;  2CYY A;  2Y9Y A;  2CQQ A;  2CQ7 A;  4GYI A;  3E5U A;  2K02 A;  2JRT A;  4OMZ A;  4A3M J;  2CJJ A;  3FXQ A;  1G59 A;  1HDP A;  4DBQ A;  2ZXW H;  2UXN A;  3FXM A;  4QSH A;  1U8R A;  3OOU A;  2G7U A;  4J19 A;  4EJT A;  4U7B A;  5FRO A;  2OA4 A;  3D5L A;  3RYP A;  1MDM B;  4KYW A;  1WQ2 A;  3DBL B;  2P6T A;  1MKM A;  3GTJ J;  4HNT A;  2XAS A;  4GXO A;  4PJM A;  2Q8K A;  2HVS A;  3T8R A;  2OU2 A;  1VQ5 I;  4CSW A;  1PDN C;  3TP3 A;  3A02 A;  3DKY A;  1DPR A;  4N4O B;  5H6R A;  4RB3 C;  1JGS A;  2HPI A;  1QZY A;  5CQG A;  1A6I A;  1A5J A;  3FXU A;  2V9P A;  1FMV A;  4B4C A;  4UVB A;  4AVP A;  4Y3O A;  1TWG J;  5CVJ A;  2ZNZ A;  2R7F A;  2QCO A;  2VLA A;  1MNE A;  2BZT A;  1OR7 A;  1JUP A;  2M3A A;  2NVT J;  2MLG A;  4HST A;  3O8G A;  4BHP A;  1CQT A;  1LPQ A;  4XQF A;  3S1N J;  2VE9 A;  1D5V A;  3VYT B;  1R22 A;  1BR2 A;  3LFU A;  2DT5 A;  4HF2 A;  2E7W A;  4XM3 A;  5D6E A;  1MSE C;  2DK8 A;  2NYX A;  2VKD A;  4XKC A;  3KET A;  5HDK A;  1MH4 A;  4DZJ A;  2R7X A;  1N75 A;  4D7N A;  1LFU P;  1QZE A;  4LB6 B;  2I5U A;  1ZTR A;  5B66 C;  3BR6 A;  1N25 A;  4BDZ A;  3HOZ J;  2RQP A;  3ABL H;  5EEA A;  2IEK A;  2XGE A;  5ILV A;  2E60 A;  1VQO I;  1NG6 A;  4HNV A;  2OJE D;  2V1U A;  2V7F A;  4XOP A;  4UV8 A;  3DTI A;  4HLY A;  4GGG A;  3BLY A;  4IKF A;  4OU0 A;  4F55 A;  1G3S A;  5FKM A;  4IHV A;  5LRR A;  4Z6Y A;  4XRS G;  2L7K A;  4RAG A;  4BQO A;  4EMS A;  4F91 B;  5F64 A;  2L54 A;  5J6X A;  1IF1 A;  3WGI A;  3GFL A;  1IN7 A;  4QIW N;  5GAE J;  5CJ9 A;  5FGM A;  4CCM A;  4E7K A;  4D0P A;  2YS9 A;  2X1D A;  5B3S H;  3HC7 A;  4M6Y A;  1HQC A;  4AIK A;  2NS7 A;  4RGR A;  3FBN B;  1YO5 C;  2RN7 A;  1OCZ H;  4PSW A;  3PM1 A;  4FET A;  3RPQ A;  4LG0 A;  1IDY A;  2R3S A;  2Z16 A;  3WG7 H;  5IP7 J;  2W85 A;  2EV6 A;  3BJ6 A;  5D8L B;  1V54 H;  1RNL A;  3CMA I;  1ZRF A;  1Z67 A;  4B8X A;  2ELK A;  2ZXH A;  3A2K A;  4RB0 A;  3Q5F A;  2FQ3 A;  2DXI A;  4GO1 A;  1FYM A;  3HG9 A;  1B8I A;  1P9Q C;  2LK2 A;  4HDU A;  4F7Z A;  5EJC A;  3KIO A;  5KK1 A;  1WCM J;  5CVU A;  2HYJ A;  5EYR A;  5ICF A;  2RGV A;  5M3F J;  1TQM A;  2KDO A;  3CJQ B;  4KN7 X;  1FT9 A;  3ONQ A;  3O2P E;  3P9C A;  4XKB A;  1K79 A;  3V7S A;  5E18 F;  1JT6 A;  1Z6R A;  2DJI A;  3ZQG A;  2UZK A;  2BY1 A;  5J40 A;  3I55 I;  3Q0U A;  2E1C A;  2CV2 A;  5HNH A;  3WU2 C;  3L1P A;  4B48 A;  2MLK A;  4AYB N;  1Y8Q B;  1VQL I;  1X4P A;  3AG1 H;  5JLX A;  1K78 A;  4ZDO A;  3PUB A;  4I0A A;  4BY7 J;  3RKY A;  2WAE A;  4ZYE A;  2B9S A;  3BPV A;  2HKX A;  2R4G A;  4B09 A;  3ZQC A;  1E2X A;  4M3F A;  4L5E A;  4PGH A;  4EEF G;  2BE5 F;  2Q2E A;  4U7D A;  2H1K A;  1S7E A;  1APL C;  4BQQ A;  4HAM A;  3WTS C;  1QQI A;  4A3J J;  4A12 A;  3A0H C;  2OUM A;  3LA3 A;  3MN2 A;  1NK2 P;  3P9I A;  3ABK H;  1FOW A;  2QWW A;  4EV0 A;  3K4N A;  3QPL A;  1YS6 A;  2E7X A;  2H8W A;  1GV2 A;  2LH9 A;  3WU0 A;  1FPQ A;  3FIW A;  1H0M A;  3S3M A;  1WKM A;  5C4J J;  2CUJ A;  2QF7 A;  3MQ0 A;  3E0J B;  1J7K A;  3IWZ A;  3PO3 J;  2ZME B;  2ACJ A;  4FT8 A;  3BG7 A;  1MMN A;  2HQR A;  3QPT A;  3PSI A;  3E5Q A;  5IOZ A;  2VXD A;  2VOP A;  1IAW A;  3OOP A;  1FLI A;  3KFW X;  3BQZ A;  4UY8 I;  1FTZ A;  3H9J A;  3DPT A;  3JAM Z;  3OYM A;  3K4L A;  3CD6 I;  2ADU A;  2DFF A;  4I09 A;  3VPR A;  3I3L A;  1LDK B;  2R7U A;  4UVA A;  2BY0 A;  1OQY A;  3FMR A;  2R7S A;  4WK8 F;  4KIF A;  3A01 A;  2RQQ A;  4Y33 A;  3RKQ A;  3K4C A;  2O6G E;  3GF2 A;  3IAM 2;  1PUE E;  3CDH A;  1O3T A;  2L4M A;  1TWH J;  2OBP A;  1BIA A;  4MQV A;  4CCO A;  1SD5 A;  2LBF B;  3CJN A;  3C2H A;  1TNT A;  4CZC A;  1HKT A;  1P4W A;  1VQM I;  1Z7L A;  3VB2 A;  1SMY F;  1EA3 A;  2ZSH B;  1XCB A;  3ZMV A;  2O3F A;  1O3S A;  2VPL A;  4BE0 A;  3DPU A;  1HW2 A;  3PUF A;  3IH4 A;  3MAJ A;  2VIX A;  3KP6 A;  5K7F A;  3OIQ A;  5GTH C;  3QYF A;  1F5T A;  1KU2 A;  3GFM A;  3VYR B;  1AOY A;  2DYR H;  1TTY A;  1Z6T A;  5K7H A;  4M73 A;  2IA1 A;  1K61 A;  3UKG A;  5LEK A;  1TW3 A;  5K1Y A;  1LQ1 A;  5E17 F;  1FTT A;  4KN4 X;  1HW5 A;  2COM A;  3HPH A;  1V55 H;  3H3Z A;  2YU3 A;  2D45 A;  3F8B A;  3I0T A;  1XGM A;  2Y30 A;  1MJA A;  2DMN A;  1S8N A;  2A5Y B;  3HGG A;  3TO9 A;  3H3V K;  2XDV A;  4M3G A;  1J5Y A;  2L3D A;  4PSX A;  5EG0 A;  3DP7 A;  3CO6 C;  3E5X A;  1JE8 A;  1OYY A;  3CF5 F;  2OQG A;  4ENN A;  2XGC A;  3HZJ A;  4HQM A;  4MFE A;  3PIO F;  2K40 A;  2VPR A;  4RLQ A;  3OYJ A;  1GT0 C;  1AWC A;  1T98 A;  2EV0 A;  5D6F A;  4M6X A;  4A3B J;  2JVG A;  2C6Y A;  4JX5 A;  5CVV A;  1R6R A;  4QPO A;  4E70 A;  2HPM A;  2HNH A;  2XAJ A;  2L02 A;  3K7A J;  5GTI C;  1ZLJ A;  3CCR I;  2R5Y A;  3FZV A;  5CLS A;  1A35 A;  5J4Y A;  1XG1 A;  2A69 F;  2VKV A;  2LR8 A;  5FD6 A;  2DTR A;  3ASN H;  1AHD P;  2VJI A;  2IA2 A;  3Q9S A;  4EJW A;  3DEW A;  3IRQ A;  1T8I A;  3R4K A;  1GLN A;  2E1M B;  1W5S A;  4E4H A;  2PJP A;  5LHG A;  1PP8 F;  1OLT A;  2VKH A;  3BT9 A;  4FHT A;  2HYG D;  3OV8 A;  2R5Z A;  4XID A;  1DU6 A;  1AA7 A;  5HOD A;  3A03 A;  3OSG A;  3QPH A;  1RKW A;  2EFN A;  1ZG5 A;  3NWT A;  3CES A;  4ANJ A;  2UWM A;  3F6O A;  4PZJ A;  4P9F A;  4BGD A;  2XRN A;  3QP6 A;  5GPC A;  5C3E J;  1WJA A;  4ESB A;  1IC8 A;  1W5T A;  3H5N A;  3V42 A;  4BJ5 C;  1D0Z A;  3H9G A;  3O8H A;  3ZGK A;  2GBY A;  2OV7 A;  4BEH A;  1U5T A;  2XPW A;  2IS6 A;  4XOR A;  3HRU A;  3OR2 C;  1VQN I;  2LNB A;  2ZJP F;  1X1A A;  2XHK A;  3QYB A;  3CDI A;  2EZL A;  2KZG A;  3CTA A;  1RET A;  4Z2Y A;  2Z99 A;  2X1E A;  2OC6 A;  1ETX A;  4DYR A;  3ZN1 A;  3RPU A;  2ZB9 A;  3VOE A;  3LA7 A;  2MYS A;  1MMS A;  4UB6 C;  3HSR A;  2LMD A;  2PBI A;  2LSO A;  5EZH A;  3MFK A;  2X48 A;  2LY2 A;  2KJC A;  4S0H B;  4XOT A;  2CMP A;  5DDG A;  3LWF A;  3L2U A;  2NS8 A;  2FQ4 A;  2GZW A;  2M8G X;  4A3D J;  5EEG A;  1D3Y A;  3TW7 A;  2NS0 A;  4L5J A;  2CV1 A;  3AKZ A;  3CMY A;  3WTV C;  1VQ9 I;  4I7H A;  3QWL A;  1E3P A;  4KIT B;  4HSR A;  1Z7U A;  3SZT A;  3BR1 A;  2OZ6 A;  2IBD A;  3IC7 A;  3OYE A;  2ECB A;  3OIP A;  5J1Y A;  2PLY A;  4CA0 A;  1OYI A;  4AUX A;  5L3F A;  5DUK A;  1U9O A;  2FBH A;  4CH7 A;  2NAZ A;  3HHG A;  2XPV A;  2HYF A;  2X51 A;  1FIP A;  1WPK A;  4CCL A;  3IWF A;  4BHB A;  3GO5 A;  1WJF A;  2NOJ B;  3TMO A;  3FXK A;  4F52 A;  1LE8 B;  1P2F A;  2KFD A;  1IW7 F;  2MFZ A;  2O03 A;  2VQC A;  2BW3 A;  5BMZ A;  3GTP J;  3VYS B;  4I98 B;  4L18 B;  4OAY A;  3KZI C;  3J80 K;  5M5W J;  3S2W A;  3TDZ C;  5D4R A;  1KU3 A;  4EJU A;  4EM1 A;  1U9N A;  3RQ4 A;  4LMY A;  4A3G J;  3SYT A;  2V6E A;  2DFI A;  5FO5 A;  1NG7 A;  3K1N A;  2L0K A;  4Y7N J;  4M72 A;  4XNF A;  3F72 A;  4F3Q A;  4IRI A;  1BIB A;  2K3F A;  3LSG A;  3EYI A;  2FEZ A;  2L9R A;  3BP8 A;  4M3E A;  1X4O A;  3LSH A;  4IRH A;  3AL0 C;  1Y1W J;  3FDY A;  3O3K A;  2ZCW A;  2K27 A;  1K4S A;  1XSV A;  4BE2 A;  1T95 A;  4EGY A;  4XRF A;  4P1W A;  4HV5 A;  3DEE A;  3HOV J;  5D8K B;  2R0Q C;  3N97 A;  4OMY A;  1YIJ I;  2QSG X;  4QTR A;  1PUF B;  2AO9 A;  2W4S A;  2FOW A;  2K9M A;  4PGG A;  4XLE A;  4CYD A;  2PI0 A;  2BY3 A;  3S1Q J;  3KCC A;  3HOY J;  1VI0 A;  2KQR A;  2PQ8 A;  1H89 C;  1IRX A;  4CYC A;  2XAH A;  2KRH A;  4ETS A;  3LAP A;  5IPA A;  5DM7 F;  2GIV A;  3FK6 A;  2MG4 A;  2YX7 A;  4RAY A;  4A3C J;  1W1W E;  1Y56 A;  3HB9 A;  3F9K A;  3FM5 A;  2V9V A;  4JP0 A;  3ZXS A;  2HFH A;  2F4I A;  1JT0 A;  2XGD A;  4AC0 A;  1ORK A;  2H94 A;  3CLO A;  1HXD A;  3KYD B;  3BR3 A;  3TL4 X;  3RIR A;  4IHX A;  2V6C A;  4JQF A;  5J4V A;  4ZC3 A;  5F0F A;  1T08 B;  2IS4 A;  4GCV A;  1XB4 A;  2DDA A;  3MZ8 A;  1T0F A;  4NC6 A;  3L2R A;  4A0X A;  2XVC A;  2E34 A;  3F8M A;  3S32 A;  3DBR B;  1B4A A;  1ENH A;  2KIM A;  2AQF A;  2HOT A;  4PJJ A;  3MEX A;  2P5L C;  3GW2 A;  4RGS A;  1XX5 A;  3LL7 A;  4J00 A;  3CJT B;  4F92 B;  4D5C A;  4CCK A;  1LEB A;  2LRD A;  4ABZ A;  3RZD J;  5J3L A;  4FX4 A;  3FF5 A;  1QHH D;  3CCE I;  3OR1 C;  2LYC A;  5J1U A;  1V4R A;  2HXI A;  1IN5 A;  3BCB A;  3GWZ A;  3NQO A;  2VN2 A;  3AAF A;  5CVR A;  3M8J A;  3CC4 I;  3L2W A;  4CHU A;  4NC8 A;  2H1L A;  4D9J A;  3E6D A;  2VJJ A;  5ICE A;  2EA4 A;  1O7F A;  1NTC A;  2A05 A;  3MD2 A;  3S3N A;  1OJL A;  3JAM K;  1MGT A;  3ECH A;  2GXA A;  2FSW A;  1NK3 P;  1OIS A;  3RSN A;  2EWN A;  2QEN A;  4IRG A;  3CDL A;  4XKV A;  4HEA 2;  4X6A J;  5FLX Z;  2F5D A;  2JJ7 A;  4RA2 A;  3A1Y A;  3V7C A;  2R92 J;  4BAY A;  3HOX J;  1S3J A;  3ZP5 A;  1YG2 A;  3I56 I;  2WV1 A;  4FX0 A;  2V1N A;  4XLF A;  4V19 K;  4M9Z A;  2TCT A;  3CCM I;  2DCE A;  1FJL A;  5E1W A;  5DTD A;  1O3R A;  3H35 A;  1KQ0 A;  3QU3 A;  1TW2 A;  1BW5 A;  1ZQ3 P;  2E1N A;  2L9V A;  4JOM A;  4U88 A;  1K83 J;  1HLV A;  2B63 J;  2OAZ A;  4PCQ A;  2KKO A;  2AXL A;  3KYL A;  3CCL I;  2DA1 A;  1TZL A;  3CO7 C;  3LQR A;  1YHQ I;  1WHU A;  2XUB A;  3V8L A;  1W36 C;  5F27 A;  3TP0 A;  1XGO A;  2WAD A;  5K7Z A;  3JRF A;  3OS2 A;  2NNY A;  1JJ6 C;  3VOD A;  1QZZ A;  1X3U A;  4UUS A;  5JLW A;  4QPQ A;  2LKS A;  2WWY A;  3RZO J;  1MMD A;  4M74 A;  2FBK A;  2FNA A;  1X1B A;  2P7V B;  2DI3 A;  3CUQ A;  3OIO A;  1LFP A;  3ULQ B;  2Y0S N;  3J81 K;  4DYC A;  3AFH A;  2QKL B;  3C3W A;  1ZAO A;  4RAZ A;  2ME0 A;  2V9K A;  4UVC A;  1T56 A;  4IL6 C;  3S2H J;  4OIQ F;  3GFI A;  5IT9 Z;  1SAN A;  2JRM A;  1WSU A;  3M4O J;  1I6X A;  1OFC X;  3M8E A;  3FIS A;  5TJJ A;  1H88 C;  5LBQ A;  1SD6 A;  3KZY A;  5IYB J;  3RI4 A;  1FWZ A;  3DTK A;  2AHQ A;  4K2E A;  5E20 A;  4PFO A;  2PJR A;  4MIM A;  1YYV A;  2V1D A;  2F48 A;  1GXQ A;  4A0Z A;  2VON A;  3PO2 J;  3OYC A;  4YIF A;  3BG3 A;  3BJO A;  3KEQ A;  2JA7 J;  3KX2 A;  4MEX F;  3L00 A;  1GV5 A;  1DPU A;  3G3Z A;  2PN6 A;  2QQB A;  4DZP A;  4BUP A;  2EFO A;  1Z3X A;  5LHH A;  1BOA A;  2Y69 H;  4XLA A;  1EH6 A;  2DTZ A;  1H9T A;  1X1C A;  2EZK A;  5GPA A;  1MBK A;  4A5M A;  2L7F P;  2WAQ A;  1CF7 B;  4CXF A;  2Y9Z A;  2XSD C;  4PJN A;  1BI3 A;  4BYY A;  1IV6 A;  2H8R A;  4KMU X;  2OZU A;  4ZDP A;  3BG6 A;  2DU9 A;  5F1R A;  3CQZ J;  4CUG A;  3CJR B;  3I71 A;  1YJN I;  2K86 A;  5EGO A;  3ZR8 X;  3DQV C;  4LK0 F;  4OIR F;  4NQW B;  3VSL A;  3ZQ7 A;  1Q1V A;  2CQX A;  2GXB A;  2A6T A;  1RR7 A;  1ZAR A;  1BW6 A;  1PVE A;  3VFZ A;  4EM2 A;  5E1Z B;  3HGY A;  3ZMS A;  3WU1 B;  3CCS I;  1KYW A;  5BS6 A;  3F6V A;  1BR1 A;  3J7Z I;  4XRM A;  1B72 A;  2HZD A;  2ZME C;  5E8I A;  5DCF A;  4ASN A;  2FX0 A;  1D5Y A;  3H0D A;  2M4G A;  1K4T A;  1LJ9 A;  1Z9C A;  1RC9 A;  4AM3 A;  2A3S A;  5B5E C;  5DUI A;  3OYB A;  3WHC A;  1I3Q J;  1GVJ A;  3S1R J;  5FRN A;  3OWT A;  1J9I A;  2GAU A;  4EM0 B;  3R0A A;  5K5Q A;  1ZH5 A;  3M3Y J;  5LEJ A;  2R7Q A;  3FHZ A;  2DOA A;  2KL4 A;  3LOC A;  2BBY A;  2QM3 A;  3MZY A;  3OMY A;  3RCO A;  4IHS A;  1E0E A;  4O3M A;  3OY9 A;  3HPG A;  4PJL A;  3IL2 A;  5HDN A;  5J1R A;  2GM4 A;  1F43 A;  3SZG A;  4I01 A;  3NWS A;  3BZC A;  4DOZ A;  1FOK A;  1FZP B;  2PFB A;  2DN0 A;  5JHU A;  3FXJ A;  3JSO A;  4NUB A;  1O4X A;  5GAG J;  4CGZ A;  2RVC A;  4XL9 A;  1QGP A;  1FC3 A;  1Z3Y A;  2VT2 A;  1R49 A;  1B9N A;  2JMW A;  2W00 A;  4Y17 A;  3CCU I;  1R00 A;  2X4H A;  3WOD F;  1J09 A;  1GVD A;  2FMY A;  2FML A;  4M71 A;  1FEX A;  5DD4 A;  3F8F A;  4WF2 A;  4E6K G;  5J47 A;  3HUG A;  3ZMZ A;  2OCE A;  4RM2 A;  2DW4 A;  5TGT A;  5ILS A;  1QVT A;  3GCM A;  3L7W A;  2IVM A;  2LFB A;  2KRC A;  4FAS D;  4OIO F;  3PNY A;  1SEU A;  5FKL A;  1Y39 A;  4HX4 A;  2ETH A;  3BG5 A;  4MNU A;  1J59 A;  2DT7 B;  1BJZ A;  2IJL A;  1WWX A;  4ZYD A;  3OYF A;  1OCO H;  3FKJ A;  5DM6 F;  5E79 C;  5LGN A;  4PK4 A;  2EIJ H;  3I59 B;  1TLH B;  2V79 A;  3S3O A;  2HDC A;  3GUD A;  2M2E A;  2P0W A;  4AIH A;  3PJR A;  2MGQ A;  3KP7 A;  4GYG A;  4A6D A;  5K5R A;  3V4G A;  1IN6 A;  1J2X A;  4IVN A;  2OD5 A;  3K4J A;  3MKL A;  3MMY B;  1B9M A;  1YIO A;  1P6R A;  2NNN A;  3JRD A;  5FLV A;  1R1T A;  3RTR A;  1RZ4 A;  3O6B B;  2HDD A;  3X2Q H;  2KP6 A;  4ON0 A;  3TO7 A;  4M6V A;  1TBX A;  2J5O A;  2OF7 A;  1SFO J;  2WB1 A;  5KVR A;  3OS1 A;  3HOT A;  3CCJ I;  5C44 J;  4I02 A;  3FXR A;  2IGO A;  2Z9O A;  4YEL A;  3QOD A;  4PUS A;  2D1H A;  1FOY A;  4Q47 A;  4ZZD A;  2ZJR F;  4IO9 F;  1BC8 C;  2KIS A;  1SFX A;  2UUZ A;  5E3L A;  2JSC A;  2XV4 S;  5HLT A;  2GA2 A;  4QLC U;  1D8J A;  3PFY A;  5D5U B;  4DNC A;  1R58 A;  2KPM A;  2R7R A;  1K7A A;  1SD7 A;  3HTS B;  1S5L C;  1UAA A;  3F22 A;  2BY2 A;  3JRC A;  2P6S A;  1ETW A;  4IXA A;  1STZ A;  1QA6 A;  1DP7 P;  3H3U A;  3G6E I;  2ZXI A;  3B6C A;  3CC2 I;  1G3T A;  4NC7 A;  1XC5 A;  1X1P A;  2E1M C;  2QGU A;  3G1M A;  1NHA A;  5DCM A;  4ITV A;  1M1E B;  3UR3 C;  2L4A A;  4G94 A;  3U1D A;  1YW7 A;  2QVO A;  3E3V A;  1UZC A;  5IOY A;  1G3W A;  3E97 A;  3T0Y A;  2R7Z J;  4LG0 B;  1G2H A;  2FD5 A;  2DOE A;  3QQA A;  4BXF A;  5FJ8 J;  2K4B A;  1FSH A;  3R0J A;  2V26 A;  4YII A;  4MGR A;  1DGW Y;  2ICW G;  2JUC A;  1UG0 A;  2AXT C;  2LD5 A;  1ETV A;  2Z5U A;  4LLG F;  5IP9 J;  3F8N A;  1YFH A;  3ML6 A;  3H5A A;  2JSP A;  1E17 A;  2R7D A;  1IN4 A;  2DO7 A;  2FBI A;  3W2V A;  5GP9 A;  1SVM A;  1ON2 A;  2XC7 A;  2MBF A;  2ZNY A;  1LUJ B;  2QZ8 A;  3QOP A;  1YJ9 I;  2GOM A;  3S15 J;  4OIP F;  3BZK A;  3GBG A;  3T8T A;  1R36 A;  3OYI A;  2F5C A;  1BBY A;  1AKH A;  3L2C A;  3CME I;  2K7L A;  1D0Y A;  1G6N A;  4DBR A;  1MSF C;  2R93 J;  4J01 A;  2ELH A;  2EJR A;  2IGK A;  4N4N B;  3G4S I;  1XMK A;  3LQQ A;  4V2F A;  2DK5 A;  1K78 B;  5D5W B;  4ZH4 F;  2IGM A;  2H27 A;  4X1E A;  2IAI A;  2O5R A;  2VBY A;  2AS5 F;  1MBE A;  3JCU C;  3S8P A;  2STT A;  3I64 A;  3TDU C;  3HEF A;  3COA C;  5AIQ A;  2GLO A;  2LOO A;  4A6E A;  2HXO A;  2VC0 A;  1FP2 A;  2M7A A;  2O0Y A;  2Q2E B;  2QSH X;  2HU9 A;  2H6B A;  2LY9 A;  2RKH A;  4L5I A;  3W3C A;  1JKQ C;  1DU0 A;  4WCG A;  3FMS A;  4JX6 A;  4KDP A;  1BI1 A;  3EYY A;  1L0O C;  2HTS A;  4HRI A;  2XAU A;  1V5G A;  5EDN A;  5L3D A;  3P9K A;  2LKX A;  2CSO A;  1HCR A;  2CS3 A;  4RDU A;  1MBG A;  1ZK8 A;  3HTU A;  4LIT A;  5H20 A;  2X6O A;  4ZTF A;  1SC7 A;  1K6O A;  5KAI C;  1BL0 A;  1JUS A;  2KJB A;  5BPI A;  4A3E J;  2DMQ A;  3G1L A;  2XSJ C;  3MVP A;  2DFH A;  1JHF A;  3PL8 A;  2COB A;  3OL3 A;  4D1Q A;  3RJP A;  4R8H A;  2DQR A;  4B43 A;  2CWE A;  4XLN F;  4A3L J;  3LSR A;  2BVL A;  4LFU A;  3CUO A;  3S93 A;  1OCT C;  2VUM J;  1L3L A;  2BVM A;  4DJA A;  2WY7 Q;  3QOE A;  3K0L A;  4EJV A;  5LLQ A;  5JVT A;  3K1P A;  3A01 B;  4I0B A;  1W36 D;  5IT9 K;  3GZ5 A;  3EUH C;  3I9V 2;  2IT0 A;  4YG2 F;  2HS5 A;  1MD0 A;  4BBS J;  2PMH A;  3IP4 B;  4UV9 A;  1FBU A;  3GTQ J;  1TC3 C;  2L7Z A;  2IRF G;  2BGC A;  2EPF A;  2KIQ A;  2EZI A;  2KHM A;  3G1O A;  3IKV A;  2CV0 A;  5M3M J;  2XAF A;  1IJW C;  3JR9 A;  1RKT A;  2UXX A;  3L9F A;  1W7P A;  4KFC A;  5ED4 A;  3LMM A;  3F21 A;  2WBM A;  5TIS C;  2WTE A;  4G6Q A;  3VEP A;  3ROU A;  1I3A A;  1S6L A;  2MSY A;  4ESJ A;  3BG9 A;  3U21 A;  2E2J J;  1XDU A;  4BU2 A;  4UUV A;  1WI9 A;  1RPW A;  4R79 A;  1F36 A;  4RLF A;  5F0C A;  1J75 A;  2BHY A;  3U1K A;  2ID6 A;  2M0C A;  2QA4 I;  3IAS 2;  1PJR A;  2ME6 A;  3ZCO A;  3VYU B;  2ZBK A;  1TP4 A;  2ID3 A;  4C9Y A;  5K5O A;  2I10 A;  1KON A;  4IQJ A;  1IDZ A;  1I27 A;  1YS7 A;  3D5R C;  2MH9 A;  1R4M B;  5EG0 B;  1VQP I;  4MQ9 F;  1A36 A;  3B6A A;  4IX7 A;  1OPC A;  3G71 I;  2LF7 A;  3DWL E;  1WRJ A;  5L3G A;  2LTP A;  4L9T A;  1ODD A;  4M9X A;  5FLM J;  4I99 C;  5ERI A;  3CMM A;  2BHZ A;  2MD0 A;  1YW8 A;  3ZQQ A;  4FE4 A;  2QQA A;  4II3 A;  3DCF A;  2VL8 A;  2KMU A;  1QRY A;  4ESF A;  1R5G A;  2DQL A;  2VB6 A;  4NBQ A;  3JTG A;  3KPH A;  1YE9 A;  2JPC A;  5FRM A;  3PSF A;  4A3F J;  3DLL F;  3HRM A;  3HOW J;  1ZN2 A;  2FA5 A;  3BCA A;  2Q1Z B;  1IGN A;  3CCQ I;  3QU6 A;  2P5K A;  2CW0 F;  2FF4 A;  2X0L A;  5C4X J;  5GAD J;  3DKX A;  3NEU A;  2LF8 A;  2HKO A;  3RDI A;  3SZP A;  2R5Z B;  3OYL A;  3BWG A;  2EH3 A;  4HLX A;  4HYE A;  3ERE D;  2RNJ A;  2HWV A;  2QBY A;  1T39 A;  2OTJ I;  3HSE A;  4BXU A;  1PUF A;  5IYC J;  3U2R A;  3E6B A;  3ZQI A;  2WV0 A;  2E35 A;  2XIG A;  1VZ0 A;  3LST A;  1A04 A;  4XBF A;  3OYN A;  1FP1 D;  4OAZ A;  4BEH B;  1U5T B;  1O57 A;  4KIS A;  1B59 A;  3S17 J;  2XAQ A;  4CCN A;  2F4O B;  4B47 A;  1MND A;  4YEJ A;  3RKX A;  3PQK A;  1JKP C;  3ABT A;  1A6Q A;  4A2U A;  3HL2 A;  2KT0 A;  4UHT A;  3HRT A;  3UNG C;  2Y75 A;  4N0B A;  2L9S A;  4BQA A;  1KU7 A;  3T5X A;  3A4C A;  3GZ6 A;  4IQ4 A;  3FMQ A;  2M8E A;  2W1O A;  2GXG A;  2KZV A;  2P81 A;  2VBZ A;  1YIT I;  3G2B A;  1FMW A;  1F9N A;  3BY6 A;  1P7I A;  3ZMD A;  1VQ8 I;  1ZKG A;  3PQJ A;  3B73 A;  5LFA A;  1TWC J;  5HNF A;  4UUT A;  2MH2 A;  1RES A;  6PAX A;  1UST A;  1JKR C;  2WC2 A;  3HSF A;  1XTA A;  1TQP A;  2JA5 J;  5ICG A;  4BJT A;  2M0M A;  4FCY A;  4D5F A;  2EQR A;  2DA6 A;  1Z77 A;  1ON1 A;  4ENK A;  2HI3 A;  2XF6 A;  4ZYG A;  3KZZ A;  5CYV A;  4KUM A;  4I2O A;  1XS9 A;  5FD5 A;  3M1C A;  2GWR A;  4JX4 A;  2LDU A;  5L3E A;  5D5X B;  2XPU A;  2VJ4 A;  1Y8R B;  5E1X A;  2E71 A;  4P55 A;  4IHT A;  1UHM A;  3SHF A;  1LEA A;  2DLL A;  1UMQ A;  1VTN C;  1FX7 A;  1YRN A;  1YX5 A;  2CW7 A;  2JA2 A;  3K6G A;  3JW4 A;  2W48 A;  2L7M P;  3K2A A;  4DGW B;  1MJ9 A;  4A3K J;  2NVQ J;  4LJZ F;  3C1D A;  1ZG3 A;  2JVH A;  4OIN F;  3JSP A;  4UNO A;  4IOA F;  2O7O A;  3HIF A;  2ZJ2 A;  2DA2 A;  4U0W A;  1X58 A;  4HNU A;  3NRV A;  1HOM A;  1HDD C;  3TGN A;  2M1B A;  1JJ8 C;  2LY1 A;  3DKW A;  2W7N A;  1KZH A;  3F23 A;  3WTW C;  2HOA A;  3ECO A;  3F8C A;  4NHJ A;  1DDN A;  2H09 A;  2PX9 A;  3PIP F;  2Z2S B;  5FB2 A;  3QYE A;  1LDJ A;  5CVI A;  3D0S A;  4IPA A;  3F3X A;  3JRH A;  3ZRG A;  3J7A O;  1ZGA A;  2EK5 A;  3BTC A;  1NH3 A;  1TWA J;  4YIR X;  3JRA A;  3GX4 X;  4JBA A;  2CFX A;  1IV8 A;  2EZH A;  3W6V A;  1IXC A;  3GTK J;  2RRE A;  5CKT A;  2H6C A;  1SD4 A;  2KDZ A;  3SFZ A;  4CYC B;  2B0L A;  1DP3 A;  2IP2 A;  3K4B A;  1ZRC A;  2L2O A;  5KHD A;  1VFC A;  2P7C B;  1HBX G;  3AG4 H;  2D5V A;  4L0Y B;  1RUO A;  1XMX A;  4HV6 A;  4I76 A;  3J7A Y;  1FOX A;  3TQN A;  2V1X A;  1ZG1 A;  3GZN B;  4IEJ A;  4C2U A;  1VND A;  3MKY B;  4LK1 F;  2RAE A;  3H5R A;  2E2I J;  1G3Y A;  2HQA A;  4BE1 A;  2A6E F;  2VAS A;  3GFJ A;  1R7J A;  4A5N A;  1LNW A;  4ZDL A;  1B6A A;  5ILU A;  5LRS A;  3Q3S A;  3HOS A;  2HR3 A;  2CQN A;  3M7G A;  1Z21 A;  2DOF A;  1I1S A;  4P9U A;  2ZFW A;  2PMU A;  4AD9 A;  2VC1 A;  2XB5 A;  3FXO A;  1WJE A;  2JA8 J;  1MDM A;  5HLG A;  1HSJ A;  3SDB A;  2CGP A;  4KIC A;  4A93 J;  1OR7 C;  2DA5 A;  4RAF A;  3TOB A;  1MIJ A;  1QHG A;  5HOO A;  2ELJ A;  4XIC A;  1TL8 A;  1ZHF A;  1X3W B;  1R1U A;  4ENM A;  1QNT A;  2P4W A;  2M34 A;  2DPU A;  1KQ8 A;  4WXH A;  2EFP A;  4BL0 B;  1EF4 A;  4NQW A;  3K2Z A;  4KMF A;  3W6J B;  4IF4 A;  2CO5 A;  2Q0O A;  4XKW A;  1XD7 A;  4CIC A;  2J5P A;  3CF2 A;  4XN3 A;  1ETQ A;  2WAF A;  2IS2 A;  4BKX A;  2K9N A;  3WTZ A;  2WY8 Q;  3ZMU A;  4EGZ A;  2K5C A;  3C2B A;  1XDS A;  2F4M B;  2QYO A;  3HJE A;  2VE8 A;  3NAR A;  3BJA A;  3TED A;  4H0E A;  1ONV A;  5KNL A;  5L3B A;  3OL4 A;  3QRF F;  2VOD A;  3DV8 A;  3HM5 A;  4HZF A;  5CQE A;  1EJ9 A;  3IRR A;  1JI8 A;  1T6S A;  4RB2 C;  3QPS A;  3PFI A;  4Y52 J;  1X19 A;  1UJ8 A;  2B7E A;  4BAC A;  3K4M A;  1Z05 A;  2OQR A;  3OSF A;  3EPZ A;  1ZGW A;  1FY7 A;  1X2M A;  5F04 A;  1TT5 B;  3RPU D;  5LD2 C;  3KLO A;  1XCV A;  2K9Q A;  4ZYH A;  2QQ9 A;  4PFP A;  4ZTJ A;  4W97 A;  3L2V A;  1Z91 A;  5ICC A;  2LP0 A;  2XF7 A;  2Z33 A;  1SVL A;  3ZN0 A;  3ZQH A;  4UUS B;  1XN7 A;  3BC8 A;  4Q4Z F;  3SQN A;  1OKR A;  5FKN A;  1XGS A;  4M3D A;  3DEU A;  2LG4 A;  3CUQ B;  2K85 A;  4OOI A;  1FYL A;  1UFM A;  2PMZ A;  2NVU B;  1SFE A;  3OYA A;  1ZGJ A;  4M9S A;  4XLC A;  2QEX I;  5EZG A;  1H8A C;  3BZ6 A;  1POG A;  1D0X A;  1ZRE A;  2EIM H;  4OWR B;  2XB0 X;  5DS9 A;  3EUA A;  1GUU A;  3HBL A;  3I54 A;  4HBL A;  3R61 A;  1YOV B;  2KLO A;  2DA3 A;  3DXJ F;  5F0H A;  2O8K A;  2PJR B;  3I59 A;  1FNN A;  3GME A;  4XK4 A;  2HOS A;  5A2Q Z;  2D2W A;  2ISY A;  1V5F A;  4MTD A;  3OYD A;  1ZRD A;  1JHH A;  2CH0 A;  2X9D A;  3EQL F;  2OPT A;  3LSM A;  2L5Q A;  3BPX A;  3Q9V A;  2YX4 A;  2Y31 A;  1IG7 A;  4FTH A;  4E7L A;  4PDK A;  4E7Z A;  4BJ6 C;  4B3X A;  3V8K A;  1ERD A;  3HXL A;  2E5Z A;  3FBI B;  1R5I D;  4C2M J;  3IV5 A;  1YI2 I;  3CZ6 A;  3FX3 A;  3M8F A;  4R1H A;  4Y13 A;  2F2E A;  1EH7 A;  3G73 A;  4AU7 A;  1XGN A;  2JWT A;  5H6Q A;  3A0B C;  2DJN A;  2CQK A;  1O7L A;  2XRO A;  3SJM A;  2ZSI B;  2BV6 A;  5EGO B;  5HLI A;  4B44 A;  1R1V A;  5KCM A;  4MTE A;  3ZMT A;  4G7H F;  3IH2 A;  2K4J A;  2NOG A;  4U87 A;  1D1A A;  2DMT A;  2DOD A;  5J8F A;  2E19 A;  2LRE A;  3FM3 A;  4BDY A;  1JTY A;  4MHG A;  3E7L A;  1BN5 A;  4YFX F;  1OCC H;  3HOU J;  1B72 B;  2XKP A;  2M7B A;  5LGU A;  2CG4 A;  4N9H A;  1BOB A;  1I5Z A;  4E7J A;  3J80 Z;  4KJZ A;  2L9N A;  1T2K A;  1IUF A;  3HKZ A;  5BNG A;  3HHH A;  2CW8 A;  3M9A A;  4CCJ A;  1RR8 C;  3LFK A;  1F4K A;  2DPD A;  1T33 A;  3LSK A;  1RIO H;  3D1N I;  3OS0 A;  2E36 A;  3SEQ A;  2TDX A;  2ZJQ F;  1ZEL A;  2L01 A;  1RUN A;  3HRS A;  2MA3 A;  3DFG A;  4XLP F;  2KRF A;  2HEO A;  4WWC A;  4XRS A;  3GTO J;  2ZME A;  4XSZ F;  3RQI A;  4MLO A;  3W2W A;  4RGU A;  3AG2 H;  5DV5 A;  3JTH A;  4HX7 A;  3JRI A;  1KYZ A;  4RM3 A;  3I4P A;  1EV7 A;  1XMA A;  2JN6 A;  2P5V A;  1Z1D A;  1MMA A;  2IPQ X;  3H1C A;  1E3H A;  3HUG B;  2HQ5 A;  2IS1 A;  4HW0 A;  4C30 A;  1Y0U A;  1U6G A;  1QVU A;  3KE2 A;  3FXL A;  2GOX B;  2G7H A;  3ZQL A;  3ISP A;  2VQG A;  2X6W A;  3GTM J;  1OYW A;  3M1E A;  3CLQ A;  1RI7 A;  2MC3 A;  2E5N A;  3QAH A;  1S7O A;  1UG2 A;  2YPR A;  5HS8 A;  5IT3 A;  2ZO4 A;  4ZZL A;  4Y15 A;  3I4N J;  3ELK A;  4G7O F;  2LBF A;  3C7J A;  2P8T A;  4L0Z B;  3IKT A;  4L9V A;  5E3M A;  1I50 J;  1KQ9 A;  1R71 A;  4NDL A;  3IUO A;  4C3J J;  4FIS A;  3VWB A;  2MW8 A;  1U3E M;  3P7N A;  1YTY A;  2JZY A;  1ETK A;  3DPL C;  3DTE A;  5AON A;  3LSP A;  3ABM H;  4KIG A;  1BR4 A;  4B3A A;  3TBI A;  2VJ5 A;  4KIB A;  3BTJ A;  1B8I B;  2FJ1 A;  2EIK H;  4RB1 A;  4P96 A;  2Y48 A;  1UHS A;  3K9T A;  4AIJ A;  4XON A;  3JRB A;  1SFK A;  2LC2 A;  3TOA A;  4EAT A;  5GAH J;  3KP4 A;  1D1B A;  1J0R A;  5EF6 A;  3ASO H;  3BQY A;  1U8B A;  1P92 A;  1FIA A;  4XN0 A;  1JUM A;  2FXA A;  2KIU A;  1P7J A;  2BEO A;  2YR2 A;  1ACI A;  2K3P A;  2CUE A;  2HVQ A;  4LD5 A;  4P5O A;  1UCR A;  5L3C A;  3ESW B;  1F1Z A;  3GXO A;  4LGW A;  1Z0X A;  4XLH A;  1XSD A;  3S14 J;  1V5E A;  4HDV A;  3H0G J;  4BXX J;  4BHC A;  3BRO A;  5IYD J;  2CU7 A;  4M3B A;  2XRL A;  4LIV A;  4H4K C;  5KAF C;  4Q48 A;  3C2G A;  3EUK L;  5HDG A;  3S2D J;  3HDD A;  1WGX A;  5DEQ A;  2VT3 A;  5FLX K;  2W57 A;  5E3N A;  2QQ8 A;  1IRZ A;  2FE3 A;  5DCM B;  2VKE A;  3LA2 A;  2ZXJ A;  1HC8 A;  4EVI A;  1BJA A;  1S29 A;  3MCZ A;  5B1B H;  4DQ2 A;  2NVX J;  4X0G A;  4S05 A;  2A5W A;  5JI6 A;  3JRG A;  4IHY A;  1RRJ A;  4KT5 C;  2EIL H;  1ZLK A;  4HA8 A;  2YUS A;  2EFW A;  4C3H J;  3EDP A;  3TO6 A;  1U5T C;  1QBJ A;  5J8C A;  2AQE A;  4E7I A;  3BDD A;  1I39 A;  5F08 A;  2A68 F;  1MBF A;  2Y0S A;  2A6H F;  3S1M J;  1TQI A;  1K6Y A;  1OCP A;  4DW6 A;  1USS A;  3BR5 A;  1YJW I;  1ZR2 A;  2OCC H;  5M5X J;  3OYK A;  2HOE A;  2DMU A;  3D5S C;  2M9H A;  1U0J A;  1Y6I A;  3MZH A;  1MMG A;  2NVY J;  4DIQ A;  1JTX A;  5HS7 A;  4HOB A;  4GRI A;  1UB9 A;  4YFN F;  2HVR A;  4LG3 A;  3K70 D;  1SAU A;  1AKH B;  3J81 Z;  2M30 A;  1IRG A;  1VF9 A;  4MFD A;  1FBS A;  4C3I J;  1ULY A;  1X2N A;  4RBO A;  2ECC A;  1X3Z B;  1HW1 A;  1R23 A;  2HGC A;  3N4M A;  2DMP A;  1LFB A;  3EET A;  1TWF J;  1UEL B;  3FKI J;  1QPM A;  5DYM A;  3JRE A;  3TW6 A;  2LVS A;  5JHF A;  1HST A;  3W2A A;  1BA5 A;  2O61 A;  2XF5 A;  4RGX A;  3LNQ A;  3WHB A;  1V3F A;  1ITY A;  1EH8 A;  5IP6 A;  3MKZ A;  1AU7 A;  3BTI A;  1UHW A;  4ZYA A;  5M5Y J;  1A31 A;  2FRH A;  3WTT C;  1EKE A;  2DYS H;  3QP5 A;  3S16 J;  2D1V A;  3H36 A;  3WE2 A;  1Y0N A;  1REP C;  2IA0 A;  2ZFU A;  5CPR B;  3GLX A;  1HKS A;  4BH9 A;  4ZJZ A;  4B1R A;  5HVQ C;  5IY5 H;  3I58 A;  3GTG J;  1SMT A;  2DDB A;  1B1B A;  1YQA A;  5HLH A;  3K1M A;  5DD8 A;  2XGX A;  5D4S A;  4O5V A;  1MJB A;  3E6M A;  4PJ0 C;  2STW A;  1I1G A;  2CRG A;  2E2H J;  2QSF X;  1TNS A;  2X6Y A;  4QWQ A;  3M07 A;  2HTJ A;  5FKK A;  3SFI A;  4MO7 A;  3N05 A;  4EQQ A;  2WAQ N;  3E1S A;  1IO2 A;  4WX9 A;  1D1C A;  4GDF A;  4WXC A;  2V4J C;  3Q0V A;  1IXR C;  3I53 A;  3IHU A;  1LE8 A;  2JUG A;  2YSR A;  1PYV A;  2MD5 A;  4F93 B;  3SXY A;  1N78 A;  1Y1V J;  2R7T A;  4NB5 A;  2N8G A;  2GQQ A;  1MW7 A;  2ZC2 A;  3MWM A;  2R5Y B;  1MBH A;  1S7A A;  1D8K A;  1HA8 A;  4TV7 A;  1W5C C;  1W0U A;  1E3O C;  3BTL A;  3B02 A;  1SAX A;  2DA7 A;  2ESN A;  2JT1 A;  4IJA A;  3GVA A;  4LOC A;  1YW9 A;  2QKM B;  2PMZ N;  4U0Y A;  4G12 A;  2EBI A;  3K10 A;  3REO A;  2GIZ A;  3ERM A;  3WGG A;  1JKO C;  5A2Q K;  1C0W A;  1QU3 A;  1MH3 A;  2MAB A;  1HKQ A;  3OYG A;  4XSX F;  1R9T J;  1ZR4 A;  3EUH A;  1ETO A;  5TRD A;  4YFK F;  3SDG A;  1W7P B;  3RKW A;  2Z3Y A;  4BY1 J;  1N77 A;  5BPD A;  3WGH A;  2ZKZ A;  2F5F A;  2FNP A;  1WZ2 A;  2RNG A;  3Q0W A;  1LVA A;  3KP3 A;  1MZB A;  3CP8 A;  4KA4 A;  4C2T A;  1FSE A;  3LSJ A;  2W24 A;  2QLZ A;  2A61 A;  1SFU A;  4BQN A;  4MEY F;  1T0F C;  4KT6 A;  4L9N A;  2Y2Z A;  2UV1 A;  1W4M A;  1DUX C;  2FOK A;  2VBX A;  3GEZ A;  3NAU A;  2VQH A;  2RC4 A;  1IRF A;  2DA4 A;  3DLA A;  3GLL A;  3PNV A;  4HX8 A;  2BYV E;  3KP2 A;  3LAJ A;  3H92 A;  4JYK A;  2ISZ A;  4V2G A;  4I6Z A;  4Q5S F;  2IXS A;  2W82 A;  1VQ6 I;  1BI0 A;  2F5V A;  2VI6 A;  1WH5 A;  2JK3 A;  2I8D A;  2KIF A;  4UB8 C;  4ENJ A;  1TT0 A;  4LIU A;  1IZ1 A;  4AWX B;  4WXD A;  4W1U A;  2MC4 A;  1I6H J;  2VXZ A;  2M45 A;  4U0V A;  3F0C A;  3PNT A;  1LVK A;  4II2 A;  2XAG A;  4BBR J;  1MNM C;  4EJO A;  2IW5 A;  3KLN A;  2VOO A;  2O8X A;  2K9S A;  2GA1 A;  4FE7 A;  1KGS A;  2F5E A;  4AYB A;  3TKY A;  5JFR A;  5B1A H;  3K4K A;  4CDG A;  4KNY A;  3L2Q A;  1VQ4 I;  5F1J A;  4G6T B;  3VDX A;  2G0E A;  1XSX A;  3HKZ N;  4LLL A;  4HQE A;  1P4A A;  5F6F A;  3IH3 A;  3WTY C;  1LB2 A;  3I4M J;  2EV5 A;  1FYK A;  1G4D A;  2JTV A;  2QUF A;  2QBY B;  3KEY A;  2M5W A;  5JVG F;  2WB1 N;  4IZZ A;  2PG4 A;  3LSI A;  4FQG A;  3V8J A;  1IUY A;  1QO0 D;  1U2W A;  2M87 A;  2X6X A;  1XPX A;  1CGP A;  3BR2 A;  2DAO A;  2R7W A;  2EA2 A;  4S04 A;  3AG3 H;  2XKO A;  1QPI A;  4DYQ A;  4N9I A;  2R7V A;  2BW3 B;  3CC7 I;  5E8G A;  3ZOB A;  4LLN A;  2CUZ A;  1JXS A;  3WTX C;  2VQL A;  1WJB A;  1W0T A;  2M4K A;  4HPQ A;  1S72 I;  1GXP A;  5JR3 A;  2BOL A;  2JQ7 A;  4HF0 A;  1O3Q A;  2E1O A;  4JK1 X;  3I5U A;  1KU9 A;  3HYI A;  2O9L A;  3CUQ C;  4G8X A;  3DF8 A;  4HG2 A;  3R60 A;  4UXN A;  9ANT A;  1FBQ A;  1GHC A;  5D5V B;  4XMY A;  3BOQ A;  3SEZ A;  2Z1D A;  3P5J A;  4NNJ A;  1X1D A;  4A69 C;  4AID A;  1VQ7 I;  3L09 A;  2OTL I;  3R6S A;  5FFZ A;  1WI3 A;  5EEH A;  4E7H A;  1HF0 A;  3WG9 A;  1GDT A;  1YX3 A;  4RMN A;  1BC7 C;  2W84 A;  4CO8 A;  4Y4R A;  1P4X A;  4YRV A;  2RV8 A;  3DU5 A;  4O6J A;  1IN8 A;  2BXY A;  2DT6 A;  2NXN B;  3K69 A;  3KEO A;  3V7R A;  1G8X A;  2W25 A;  5E3O A;  4G7Z F;  2WA0 A;  1PP7 U;  3CCY A;  5H2F C;  1YLF A;  1DQU A;  2A07 F;  3E6C C;  3WE3 A;  1H9G A;  2IGN A;  1LKX A;  1YRN B;  5AIP A;  4A3I J;  3VSK A;  3DU6 A;  3GYH X;  1R5H A;  4G6D A;  2FU4 A;  3K70 C;  3DBH B;  3GTL J;  1WH7 A;  3C18 A;  4LB5 A;  1MBJ A;  2JPB A;  1WFX A;  2EFQ A;  1S9H A;  3T1B A;  2YU9 J;  2K9L A;  3CP2 A;  5BQT A;  3KYC B;  2HDW A;  4E7S A;  1ZYR F;  1WVR A;  4A0Y A;  4CZZ A;  1DGR M;  1BI2 A;  1R4N B;  3ZPL A;  1OCR H;  2CFO A;  2EB7 A;  2X1C A;  3ABU A;  1ETY A;  1T38 A;  3FHN A;  3U9G A;  2G9W A;  3H9Q A;  3FK7 A;  5HS9 A;  1JGG A;  1CF7 A;  5LGT A;  4D7M A;  1WJC A;  2LLK A;  4L9J A;  2EIN H;  2TRT A;  2HQN A;  1WJ5 A;  3BR0 A;  4GFB A;  1WJD A;  2FUG 2;  3KP5 A;  3W6K B;  1VQK I;  3MKW B;  4G9Y A;  1W7P D;  2CUF A;  4IOC F;  1IXS B;  4IHW A;  2JA6 J;  3OYH A; 
#chains in the Genus database with same CATH homology
 4F3Q A;  2BVL A;  3S93 A;  3SEQ A;  3OS0 A;  3LSG A;  4AVZ A;  1ZEL A;  2BVM A;  4DJA A;  1X4O A;  2X85 A;  3LSH A;  3AL0 B;  3AL0 C;  2WY7 Q;  3FDY A;  3QOE A;  2F6C A;  4BE2 A;  1T95 A;  4P1W A;  4MLO A;  1W36 D;  3W2W A;  3EUH C;  3DEE A;  3I9V 2;  4BS9 A;  4RM3 A;  3IP4 B;  2W4S A;  2K9M A;  4XLE A;  1MMA A;  2R7O A;  2KQR A;  1IRX A;  4XR6 A;  3HUG B;  2KRH A;  2IS1 A;  4C30 A;  2KHM A;  2GOX B;  2CV0 A;  1G59 A;  1Y56 A;  4DBQ A;  2VQG A;  2X6W A;  3F9K A;  3ZXS A;  2F4I A;  2E5N A;  3OOU A;  3LMM A;  2WBM A;  4U7B A;  5FRO A;  3TL4 X;  3D5L A;  2LBF A;  3U21 A;  4JQF A;  4ZC3 A;  4BU2 A;  4HNT A;  4R79 A;  4PJM A;  3IUO A;  2IS4 A;  4RLF A;  3VWB A;  2HVS A;  3L2R A;  4CSW A;  3S32 A;  3DPL C;  3DTE A;  3DKY A;  3IAS 2;  1PJR A;  3ZCO A;  2AQF A;  3VYU B;  1BR4 A;  4PJJ A;  4C9Y A;  4N4O B;  3TBI A;  2VJ5 A;  2HPI A;  5CQG A;  1KON A;  4IQJ A;  3LL7 A;  4J00 A;  4F92 B;  4CCK A;  3D5R C;  4XON A;  1SFK A;  2LRD A;  1FMV A;  2LC2 A;  4EAT A;  4Y3O A;  1D1B A;  1QHH D;  3OR1 C;  2LYC A;  4IX7 A;  3DWL E;  3BCB A;  4XN0 A;  2VLA A;  1MNE A;  2M3A A;  3M8J A;  4HST A;  2K3P A;  2HVQ A;  4P5O A;  3L2W A;  4XQF A;  3CMM A;  4NC8 A;  4XLH A;  2MD0 A;  3ZQQ A;  3VYT B;  1BR2 A;  4II3 A;  4D9J A;  3LFU A;  1V5E A;  2VJJ A;  2KMU A;  2VL8 A;  3MD2 A;  4XM3 A;  3S3N A;  2VB6 A;  2VKD A;  4XKC A;  3RSN A;  2R7X A;  1N75 A;  4LIV A;  1YE9 A;  5FRM A;  4H4K C;  3PSF A;  4XKV A;  3C2G A;  3EUK L;  4HEA 2;  4BDZ A;  3BCA A;  2Q1Z B;  3A1Y A;  2E60 A;  2V1N A;  3DKX A;  1NG6 A;  4XLF A;  2V7F A;  4XOP A;  3OYL A;  2DCE A;  3DTI A;  3BLY A;  3H35 A;  4X0G A;  4F55 A;  4IKF A;  2A5W A;  2L7K A;  4BQO A;  4F91 B;  4JOM A;  1VZ0 A;  3OYN A;  3KYL A;  4CCM A;  4E7K A;  4OAZ A;  4BEH B;  1TZL A;  4KIS A;  2AQE A;  2X1D A;  4E7I A;  3HC7 A;  4CCN A;  1W36 C;  4B47 A;  2Y0S A;  1MND A;  4YEJ A;  1K6Y A;  3HL2 A;  2WAD A;  3FBN B;  3OS2 A;  3OYK A;  4PSW A;  3D5S C;  4FET A;  1U0J A;  1Y6I A;  1MMG A;  4QPQ A;  1MMD A;  4DIQ A;  3UNG C;  2L9S A;  1X1B A;  2Z16 A;  4GRI A;  1LFP A;  3A4C A;  2HVR A;  4LG3 A;  3K70 D;  1SAU A;  4IQ4 A;  2W1O A;  2ZXH A;  2KZV A;  2QKL B;  3AFH A;  3G2B A;  2V9K A;  3A2K A;  1FMW A;  5LFA A;  5HNF A;  3HG9 A;  1P9Q C;  4BJT A;  1UEL B;  3DTK A;  2M0M A;  2KDO A;  3CJQ B;  4PFO A;  2PJR A;  3ONQ A;  2XF6 A;  5JHF A;  4XKB A;  3W2A A;  3OYC A;  2XF5 A;  2DJI A;  3M1C A;  3KX2 A;  2CV2 A;  5HNH A;  3MKZ A;  2VJ4 A;  4B48 A;  4ZYA A;  1X4P A;  4BUP A;  4ZDO A;  1Z3X A;  3PUB A;  1YX5 A;  4XLA A;  2CW7 A;  1X1C A;  2WAE A;  2JA2 A;  2ZFU A;  3K6G A;  5CPR B;  2WAQ A;  4DGW B;  4PJN A;  2R4G A;  4ZJZ A;  4ZDP A;  5HVQ C;  3BG6 A;  2JVH A;  4BQQ A;  4CUG A;  3CJR B;  2OUM A;  4HNU A;  3ZR8 X;  3DQV C;  3VSL A;  4NQW B;  2A6T A;  2X6Y A;  2LY1 A;  3K4N A;  2W7N A;  3N05 A;  3E1S A;  2LH9 A;  1D1C A;  2V4J C;  3S3M A;  2Z2S B;  2JUG A;  2CUJ A;  1BR1 A;  1PYV A;  3QYE A;  2HZD A;  3E0J B;  4F93 B;  1N78 A;  3BG7 A;  1MMN A;  2R7T A;  3ZRG A;  3PSI A;  3H0D A;  2M4G A;  2VXD A;  1MW7 A;  3H9J A;  3DPT A;  1HA8 A;  3OYB A;  5FRN A;  3OYM A;  3OWT A;  3K4L A;  2RRE A;  5CKT A;  2QKM B;  3I3L A;  1LDK B;  2R7U A;  2R7Q A;  2DOA A;  2KL4 A;  3OMY A;  3RCO A;  1DP3 A;  3K4B A;  1E0E A;  3K10 A;  2L2O A;  3OY9 A;  3HPG A;  4PJL A;  2R7S A;  5KHD A;  1QU3 A;  3SZG A;  2MAB A;  3NWS A;  4DOZ A;  2RQQ A;  4Y33 A;  3OYG A;  3K4C A;  3J7A Y;  4NUB A;  3IAM 2;  4XL9 A;  1Z3Y A;  1N77 A;  2W00 A;  4C2U A;  3MKY B;  4CCO A;  2LBF B;  1J09 A;  2RNG A;  3H5R A;  2HQA A;  3C2H A;  3CP8 A;  4C2T A;  4CZC A;  4BE1 A;  2VAS A;  4E6K G;  4RM2 A;  4BQN A;  4ZDL A;  1T0F C;  4KT6 A;  3HOS A;  1Z7L A;  5TGT A;  1EA3 A;  2UV1 A;  1Z21 A;  2ZSH B;  2KRC A;  2VPL A;  4FAS D;  2VQH A;  3PNY A;  4BE0 A;  3DLA A;  3DPU A;  3PNV A;  2VIX A;  2DT7 B;  3OYF A;  2IXS A;  1WJE A;  2W82 A;  3OIQ A;  2F5V A;  3FKJ A;  3QYF A;  4PK4 A;  3VYR B;  2I8D A;  3SDB A;  3S3O A;  2P0W A;  1OR7 C;  1TT0 A;  3PJR A;  4LIU A;  5HOO A;  1QHG A;  2ELJ A;  2MC4 A;  2VXZ A;  3HPH A;  2DXI A;  3K4J A;  3MMY B;  3PNT A;  1LVK A;  4II2 A;  4BL0 B;  3RTR A;  4AYB A;  2KP6 A;  2XDV A;  4PSX A;  4XKW A;  3K4K A;  3CF2 A;  4XN3 A;  2WB1 A;  3OS1 A;  3HOT A;  2WAF A;  2IS2 A;  3OYJ A;  2IGO A;  2WY8 Q;  3L2Q A;  4RLQ A;  4YEL A;  3QOD A;  2K5C A;  4PUS A;  4G6T B;  3VDX A;  2JVG A;  2UUZ A;  1R6R A;  4QPO A;  2HPM A;  2HNH A;  5KNL A;  5HLT A;  3OL4 A;  3PFY A;  5CQE A;  2KPM A;  2R7R A;  1JI8 A;  3KEY A;  1X19 A;  1UAA A;  4BAC A;  3K4M A;  4IZZ A;  3LSI A;  3EPZ A;  2X6X A;  2VJI A;  2ZXI A;  2R7W A;  3RPU D;  4NC7 A;  5LD2 C;  1GLN A;  2E1M C;  2E1M B;  2R7V A;  4E4H A;  4PFP A;  4ZTJ A;  2BW3 B;  1OLT A;  2VKH A;  3L2V A;  2CUZ A;  4ITV A;  3UR3 C;  2XF7 A;  2VQL A;  1AA7 A;  1WJB A;  2M4K A;  4HPQ A;  3BC8 A;  2BOL A;  3NWT A;  3CES A;  4ANJ A;  2UWM A;  4BXF A;  4BGD A;  2LG4 A;  1WJA A;  3H5N A;  2V26 A;  2PMZ A;  3V42 A;  4BJ5 C;  1D0Z A;  3H9G A;  4HG2 A;  3OYA A;  3ZGK A;  1DGW Y;  2OV7 A;  4BEH A;  1UG0 A;  4XLC A;  2IS6 A;  4XMY A;  4XOR A;  3SEZ A;  2Z1D A;  4NNJ A;  1D0X A;  1X1D A;  3OR2 C;  3H5A A;  4OWR B;  2JSP A;  1X1A A;  3QYB A;  3EUA A;  3W2V A;  4E7H A;  2XC7 A;  1YX3 A;  4RMN A;  2X1E A;  2OC6 A;  4Y4R A;  4YRV A;  2KLO A;  3DU5 A;  2GOM A;  2MYS A;  2PJR B;  2DT6 A;  3GBG A;  3OYI A;  1V5F A;  3OYD A;  1G8X A;  2CH0 A;  1D0Y A;  2WA0 A;  3LSM A;  4DBR A;  2LY2 A;  2L5Q A;  4J01 A;  4XOT A;  2CMP A;  1DQU A;  3L2U A;  4E7L A;  2IGK A;  4N4N B;  4E7Z A;  4BJ6 C;  2IGN A;  4B3X A;  1ERD A;  3HXL A;  1LKX A;  2E5Z A;  2CV1 A;  2IGM A;  3AKZ A;  3FBI B;  2O5R A;  3S8P A;  3VSK A;  3DU6 A;  3CZ6 A;  3K70 C;  2LOO A;  4KIT B;  4HSR A;  1WFX A;  2M7A A;  4AU7 A;  1S9H A;  2Q2E B;  2HU9 A;  2K9L A;  3OYE A;  3W3C A;  3CP2 A;  3OIP A;  2HDW A;  4CA0 A;  4E7S A;  2ZSI B;  4B44 A;  5KCM A;  1DGR M;  4CH7 A;  4HRI A;  2CFO A;  2X1C A;  2XAU A;  1V5G A;  4U87 A;  1D1A A;  3FHN A;  2X51 A;  2LRE A;  4CCL A;  4BDY A;  2CS3 A;  1WJF A;  2NOJ B;  3H9Q A;  3TMO A;  4F52 A;  4LIT A;  4ZTF A;  2MFZ A;  1WJC A;  2M7B A;  2VQC A;  2BW3 A;  3VYS B;  1BOB A;  4OAY A;  4E7J A;  2XSJ C;  4KJZ A;  2L9N A;  1WJ5 A;  3PL8 A;  3HKZ A;  3OL3 A;  4D1Q A;  1WJD A;  2FUG 2;  3RQ4 A;  2CW8 A;  3MKW B;  3SYT A;  2V6E A;  1NG7 A;  4CCJ A;  4B43 A;  4XNF A;  3OYH A;  3LSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...