2M7AA

Enteropathogenic escherichia coli 0111:h- str. 11128 orf ec0111_1119 similar to bacteriophage lambda ea8.5
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'EDQEQWAMQTLMGSGVLARCRIHNDVILDSGNDASSAYKLGTYLYQKDNSCNLFNTLTEARDAIKDAYESYCGIDDCPQCSKYIDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The Solution Structures of Two Prophage Homologues of the Bacteriophage lambda Ea8.5 Protein Reveal a Newly Discovered Hybrid Homeodomain/Zinc-Finger Fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1920 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2m7aA00
2M7BA 2M7AA
chains in the Genus database with same CATH superfamily
1HDDC 3K7AJ 2FNAA 3R0JA 1R5ID 4M6XA 2ZFUA 3FWEA 4HV6A 3QP6A 3BJOA 1J7KA 2E19A 2RAEA 3BCBA 3G2BA 3NQOA 3W6KB 3OSFA 1OQYA 2UZKA 3IAM2 3FXLA 4DQ2A 2IS1A 5IT9K 2XRLA 3DP7A 5EZGA 1V3FA 1D1BA 2P7VB 3R6SA 4DBQA 1R49A 2KP6A 2UXNA 3GO5A 1RKTA 2HGCA 3D5RC 4KIBA 3F8NA 3GTKJ 4XBFA 2O3FA 3P7NA 5GPCA 2LREA 1J9IA 3IAS2 2VKVA 2R5YB 2IVMA 2BY2A 1UHWA 1FY7A 3JTGA 2ZXHA 1GT0C 2XV4S 3B02A 1QA6A 4HAMA 2VBYA 2NOJB 1FZPB 2XKPA 3KP2A 3V7CA 3K2ZA 2QEXI 2PJPA 3T8RA 4OIPF 4IEJA 2QKMB 1N77A 3KP7A 3IH4A 3NAUA 4OWRB 2VBWA 4RAFA 2X9DA 3BJ6A 2V9KA 4Z6YA 2DN0A 1E3PA 4XSXF 2VQLA 1T0FC 2DMPA 3BWGA 4M73A 3PJRA 1KU7A 1D8JA 1OKRA 1TZLA 1TNSA 4YFNF 2DK8A 1WRJA 3LA3A 5DS9A 1JGSA 4K2EA 2WC2A 4MEXF 4CXFA 3Q9SA 1YS6A 1U9NA 1FTZA 4CO8A 1GUUA 1SMTA 1O4XA 4NQWB 4E70A 2LSOA 2Z3YA 3F8CA 1ZG5A 2OZ6A 3FXUA 3H35A 3LSPA 2L4AA 3LSJA 3IP4B 3SFZA 5HNFA 3FMQA 4IQ4A 5H2FC 4HW0A 1XCVA 1WGXA 4IVNA 5J8CA 2PMUA 1DGWY 4L5EA 2WAFA 2JTVA 2J5OA 3JREA 5EEAA 2PQ8A 1A35A 1MKMA 1RPWA 5M5WJ 2M3AA 3SEQA 3IKTA 4V19K 2ADUA 1YTYA 2O8KA 3QYEA 2JT1A 1H88C 1TWHJ 1ZARA 1JHFA 4QLCU 2V1UA 2XB0X 3L2WA 5CVJA 2ZJQF 3RYRA 2ISYA 4DOZA 2JN6A 3K2AA 4JYKA 3D0SA 1L3LA 1G4DA 3GZNB 4NC7A 4ZC3A 2WWYA 2XPUA 2M5WA 1TT5B 3HYIA 1XMXA 3CUQB 4L5JA 2XGDA 4X6AJ 3VDXA 1TP4A 2EV6A 5FLXK 3PSIA 1A6QA 4FISA 2E34A 2AO9A 2KIQA 3BTJA 2O61A 3HTUA 3OIOA 3CJNA 2F5EA 2JRTA 3IWFA 2GZWA 1T8IA 1LEAA 1ETKA 2QGUA 4M3FA 1XC5A 3S15J 4A3CJ 5JFRA 5HODA 3OYCA 3K9TA 1Y56A 1IN4A 3WG9A 1BJAA 2D1HA 4U87A 5F0CA 3VOEA 1SVMA 1FP2A 4U88A 4ZZLA 5E1XA 3ROUA 3CJQB 3EUAA 4AVPA 1O3TA 2K5CA 1U78A 1ITYA 1X3UA 2R4GA 3GZ5A 2K4JA 4L9NA 1Z05A 4HDUA 2E1NA 4R79A 1FT9A 2ZXWH 4DZPA 3WE2A 1Z0XA 2XF7A 3Q5FA 2K9LA 1ZK8A 1RI7A 2PLYA 4E7HA 2HPMA 1G6NA 4D5FA 3I56I 2F48A 2Q8KA 2Y9YA 4MGRA 5KCMA 1VQOI 3GZ6A 3A02A 3B73A 2CJJA 3C7JA 3HGGA 5CVUA 3ZCOA 1LPQA 5J3LA 4CDGA 1R36A 4L9JA 1MH3A 2V1NA 5ERIA 3U1KA 3RSNA 3DXJF 3W2AA 4OAYA 5FD5A 1A36A 4P55A 4A69C 1T39A 3MKZA 3FKIJ 1O7FA 3LL7A 2DMQA 1K61A 4HF1A 5FKNA 4WCGA 2VJ4A 1BC7C 3LSMA 1IXSB 1PYVA 1V54H 2DLLA 2ZSHB 3CMYA 4D7MA 2FBKA 1IG7A 3L9FA 4PGHA 5K5QA 5L3DA 4HNTA 2OTLI 3DFGA 4A0XA 4M9XA 4BAYA 2H1LA 4YEJA 3S2WA 2XGEA 4G6QA 4BHCA 3BJAA 1WJEA 3REOA 2CFOA 1FEXA 1OCOH 1WJDA 3U2RA 2OTJI 2AQEA 1RNLA 2CWEA 4RB3C 3K1MA 1XD7A 1QZZA 3HUGB 1IRZA 3Q0VA 3K4BA 4ENKA 4RS8A 2OPTA 4IQJA 2VQCA 1D3YA 2R0QC 4CICA 1B9MA 3JRHA 1BOAA 2MH9A 2ESHA 3CCVI 3CMEI 2IGNA 4AWXB 1HLVA 1W5SA 4NNJA 1ERDA 1JI8A 4F55A 4IOCF 1ODDA 1Y1VJ 3VYSB 5BOXA 4HNVA 2MABA 4BDZA 4BE0A 3QOPA 1ETWA 1T2KA 1N78A 3RIRA 4G7ZF 1J5YA 3BR6A 2AHQA 1QO0D 2HFHA 1TQMA 2FOKA 2H94A 4PDKA 1I5ZA 1BN5A 2IS6A 2VB6A 3KP5A 4JX6A 3FHNA 2ACJA 4AC0A 2EIJH 2CFXA 2NOGA 3FMSA 2DJIA 4A0ZA 1DP3A 1XN7A 4AIDA 3QPTA 1AOYA 1KGSA 4KT6A 3HOYJ 5H6RA 2G0EA 1LE8B 4Q5SF 2DDBA 1P4WA 1YI2I 3MZHA 5LLQA 4XSZF 2ZCWA 3EETA 5FRNA 2KDZA 3BG7A 2DA3A 2GAUA 2WADA 2VXZA 4UV9A 4F52A 1ZGAA 3FBNB 2DMNA 1UELB 4BBSJ 2YU9J 2CUEA 5GAHJ 1HKQA 2BXYA 1MH4A 2FQ4A 2RDPA 2MD0A 4KISA 3KEQA 4A2UA 2ID3A 3ECOA 4HX4A 1I3QJ 4EJUA 1VI0A 1S7AA 4HEA2 3WG7H 4BQQA 3QU3A 1R1UA 5D6EA 3DU5A 3F21A 1G8XA 1P92A 3S3MA 2R7VA 2XC7A 4C30A 1W5TA 2DA1A 1TL8A 3GTLJ 1OR7A 2GXBA 1JJ8C 4A3BJ 2VJIA 4JP0A 2KLOA 3WGHA 3HBLA 2VKDA 3T0YA 1WI3A 2W57A 4NDLA 4AIJA 1PUFA 2CV0A 1YYVA 5EZHA 2AQFA 2DDAA 3JRCA 5DD8A 2EZIA 2D2WA 2P5LC 5DUIA 2VPRA 1RESA 4B3XA 3D5SC 4BH9A 5F64A 3PSFA 4HDVA 1LVKA 1YS7A 3BQYA 2QWWA 3ABUA 2EB7A 1VQNI 1OFCX 4EVIA 4ZYEA 3FBIB 2NXNB 1QVUA 5CPRB 4YIFA 3I59A 2IA1A 1EV7A 3BQZA 2LRDA 2W82A 3J7YJ 4DIQA 4DNCA 2LKPA 2M34A 1LJ9A 3ASNH 5CQEA 2I8DA 3H1CA 2I5UA 2L54A 2X0LA 3DTKA 3N05A 3I4MJ 1FOYA 4S05A 1B9NA 2A6TA 1WJBA 4L9TA 5D5UB 4AUXA 2FX0A 3TW6A 1XSDA 3X2QH 5C44J 2FOWA 1OMIA 3S1NJ 2QBYB 3BTCA 4F91B 2CS3A 2WB1N 1XG1A 2V6CA 5HLGA 2MLKA 5F6FA 4EM1A 4PGGA 3JAMZ 3K70C 2PMZA 1H9GA 1J2XA 3R60A 4HZFA 2O9LA 3J7AY 2VKHA 2A6EF 2F4MB 1Z67A 3DPLC 3VEPA 5L3BA 4G8XA 1DGRM 2B0LA 4BJ6C 3RPQA 3IKVA 1MW7A 1QNTA 5FD6A 1RC9A 3R61A 2RC4A 3I54A 1Y8RB 2M87A 1IJWC 2RVCA 1WSUA 3VPRA 2VJJA 4NQWA 1T56A 2E7WA 1HQCA 2QCOA 5DEQA 2CUZA 3SHFA 2RREA 1WJFA 5ICGA 3CCYA 5E8GA 2HDWA 1WWXA 2F4IA 3A03A 1AA7A 3CJRB 4A3FJ 1G3TA 5F27A 3FKJA 3GXOA 4LOCA 1X2MA 5LRSA 2ZMEB 1QVTA 2EILH 5LRRA 3RTRA 3H9QA 4XLFA 2P81A 2VI6A 2XB5A 3DKWA 3C18A 3UKGA 5E3MA 1F4KA 2BVLA 4FCYA 3EUKL 2X4HA 4R1HA 2VE8A 2KRFA 5DDGA 2X6OA 2CQKA 5TRDA 1BW6A 3T5XA 4I0BA 1HF0A 3ZQ7A 1JUMA 4XNFA 5J1RA 2XUBA 2JVGA 2P0WA 1BR2A 4CZZA 2M4KA 3TL4X 3FX3A 3CUQA 4CCNA 4U0VA 2E2HJ 3PFYA 4BHPA 1GDTA 1BI2A 4CCMA 3PNYA 3FM3A 4B48A 1P9QC 3CO7C 4A6EA 3O8HA 1Z3XA 1LFPA 2DCEA 3V8LA 5H20A 3QP5A 1TWFJ 3V8JA 3MKYB 3S1QJ 2G7HA 3O3KA 4B47A 1SVLA 2B63J 1O3RA 2CRGA 3AL0B 4W1UA 4U0WA 1X1DA 1JKRC 2DA7A 2RV8A 3LA7A 3BROA 4ENMA 2FRHA 3CCRI 3A01A 4XKVA 1ZR2A 1IN7A 3OMYA 3KCCA 1UB9A 1YE9A 1IDZA 3C2BA 3DQVC 1XMKA 1KU2A 1W7PA 4XRSG 3LSRA 4I76A 1JHHA 2R7ZJ 5B5EC 1HC8A 2DK5A 3AKZA 3MQ0A 4GYGA 3BDDA 4EATA 2L9RA 2QQ8A 3HOVJ 2EPFA 6PAXA 2E71A 1CF7B 4XLAA 1TBXA 3Q0WA 5ED4A 2NVTJ 2XAHA 4XKWA 1WI9A 2KJCA 2EK5A 5DTDA 1X3ZB 4DBRA 2L3DA 1YJNI 2IXSA 2OV7A 4IPAA 2V79A 4D9JA 1NHAA 3SDGA 2LTPA 1Z7UA 3CCQI 2QF7A 2E60A 2ZXJA 1XB4A 1EH7A 2E1MB 1K7AA 2BZTA 2FF4A 3DLAA 3LNQA 2HXIA 3PQKA 1VFCA 4KICA 2OQRA 2M7BA 2H6CA 3FK6A 2L4MA 1LQ1A 3CLOA 2ZB9A 2Y0SN 1Z77A 2CG4A 3G3ZA 4FASD 2DI3A 4II2A 1D0ZA 1TW2A 2ELKA 3OYBA 1PVEA 2JVHA 4N0BA 3E7LA 3HG9A 4XL9A 4IOAF 1GXQA 5M3MJ 4BACA 3M3YJ 2CQXA 1DPRA 3HUGA 4MTDA 3P9IA 2R7XA 3S17J 5ICFA 2BHYA 3EPZA 2G7UA 4A3JJ 2ISZA 4BHBA 1K6OA 2RGVA 3WTYC 1RRJA 1YX3A 2DQLA 2W24A 4RGXA 1ZQ3P 4FX4A 2BW3B 3TKYA 2RNGA 3I0TA 2E35A 3S1MJ 4N9HA 3CUOA 3WU0A 2XPVA 2VL8A 3OS0A 5LFAA 1S7EA 2DA4A 2LG4A 2JWTA 1YO5C 2W1OA 2CUFA 1U8RA 1HDPA 1B59A 3KP3A 4MLOA 4XN3A 4ZYHA 1JUSA 5KK1A 4OIQF 4CGZA 2A5YB 4II3A 5DCMB 5DYMA 3V7SA 5BS6A 4IXAA 2BVMA 4OOIA 4BXFA 2ICWG 5IYCJ 1QGPA 2W84A 1S9HA 1O3SA 5HLTA 3J81Z 3IRQA 2MD5A 1HSTA 1L0OC 1SFKA 1RZ4A 1UHMA 3F8BA 1RUOA 3C2HA 3ZOBA 3LQQA 5CQGA 3E3VA 1CGPA 2GOXB 1Q1HA 3ECHA 2F5FA 1Z1DA 2A6HF 4ZYAA 1MMNA 3TDUC 2YX7A 4KITB 2ELJA 4PFPA 1J09A 3GX4X 3HTSB 2W85A 3BC8A 1VQKI 4EMSA 2HTJA 5H6QA 4E7JA 2FMLA 3FMRA 3LQRA 1RR7A 1ULYA 2DTZA 2KRCA 4OAZA 2HZDA 5EDNA 3PIOF 1PUFB 3TO9A 3IL2A 5C4JJ 5L3GA 2CU7A 1W4MA 2IAIA 2DT7B 3BZCA 4E7LA 1Y8QB 2XAUA 3GMEA 4A3MJ 3KEYA 1LVAA 5A2QK 4A5NA 4UXNA 2CQNA 5CVRA 2IRFG 1R7JA 1MSEC 4WK8F 1Q1VA 3K6GA 2UWMA 2YSRA 2Z9OA 3I59B 1EH6A 2HYGD 3J80K 4EV0A 1FPQA 5IT9Z 4KDPA 3OOUA 2HOEA 1IAWA 3ZQQA 1F36A 1XDUA 1YLFA 2JA2A 4DYQA 2Z99A 1Y0UA 3HRUA 2L9VA 2CGPA 1OCPA 3L2QA 5IP7J 4KMFA 2HEOA 1IRFA 2F5VA 4ZYDA 3CCMI 2VLAA 2L7KA 3V8KA 5IOYA 9ANTA 4HRIA 2KL4A 1UCRA 1K4SA 2NNNA 4AYBN 1XS9A 4XONA 3JRGA 4QPOA 1LB2A 4ZDOA 4XN0A 1ETXA 3S93A 4IHVA 2EFQA 4EJWA 3LMMA 3TGNA 3OOPA 3WHBA 4LD5A 3WTUC 2V26A 5HLIA 2BEOA 2R92J 3WU1B 1BIAA 2XAQA 2PFBA 2ECCA 2HOAA 4M3GA 2OAZA 1SD7A 4XLCA 5C3EJ 3VYRB 3BR0A 2NS7A 2JRMA 2YPRA 4L9VA 3RKYA 1WH7A 3NWSA 4RGSA 3KZIC 4RDUA 3BG6A 2W25A 2QBYA 3PO2J 1YW8A 1Y6IA 4LLGF 3HZJA 2OU2A 1TLHB 4GDFA 3TO6A 4EQQA 3CP2A 4P9FA 2MC3A 4I6ZA 3PUBA 4AM3A 1SVOA 2VBZA 4KT5C 1I3AA 1ZG1A 4AIKA 4HOBA 5IYBJ 3GUDA 1UJ8A 2FE3A 2QM3A 3Q0UA 2OD5A 1K4TA 1UZCA 4MFDA 1JKPC 4Y17A 1XDSA 1LEBA 1A04A 4B43A 4HX8A 4I2OA 2DMUA 2VASA 3E0JB 1ORKA 1W36D 3S2HJ 4LIVA 1KA8A 5TGTA 1MDMA 3ZMSA 1H0MA 1B8IA 2Y31A 2MH2A 3MFKA 4S0HB 2M45A 4U7BA 1HCRA 1TWAJ 1B4AA 2R7DA 4KN7X 5JVTA 5E18F 2XKOA 2HVQA 2ZMEA 1NG7A 5EGOA 4E7ZA 3MEXA 4HF2A 5GAGJ 1ETQA 4GO1A 1WFXA 2QSGX 5GP9A 5D8LB 4LG3A 3HHHA 2ZJPF 5JLWA 4B3AA 1NTCA 4G7HF 4UUTA 3H3VK 5ILUA 1MBKA 2JMWA 3DKYA 1SD6A 1BM9A 2Q0OA 5FROA 4B8XA 2DA2A 2HZTA 3PIPF 1HXDA 1W1WE 2DA6A 2STTA 3GW2A 1SFOJ 4IF4A 2EJRA 1VF9A 1UG2A 4M3EA 3CQZJ 2Y0SA 1IRGA 1PP7U 2YU3A 5AIQA 3L00A 1IC8A 5K7HA 3A01B 3WTXC 2X6WA 1OCCH 5FGMA 2DTRA 3ZQLA 5M5XJ 1JE8A 4I01A 2QA4I 1JT0A 1MJAA 4A3GJ 1ZGJA 1W7PB 4C3JJ 5FLMJ 1BI1A 4ZZDA 3S32A 3KYCB 5K5OA 2XPWA 4LLNA 4PSWA 2K9QA 4LIUA 3EUHA 3CTAA 4AU7A 4XLPF 4DYRA 1GHCA 1ETOA 3W2VA 2QVOA 2PJRB 2XAFA 2WAEA 5K5RA 2EIMH 1LDJA 2XROA 3VSKA 4OU0A 1X58A 5D8KB 2M7AA 4NC8A 3JRBA 1V5EA 1HKSA 2X6XA 1VQ5I 3QRFF 2IJLA 1HW5A 2TRTA 3MN2A 1MMSA 5CJ9A 1FP1D 1JTYA 3Q9VA 4HQEA 2W4SA 4PJNA 3V42A 5D4RA 1X1BA 2HNHA 1PUEE 2WV1A 3PM1A 4OINF 1XGSA 1Z21A 2IPQX 2QKLB 3OYAA 1LKXA 5CKTA 1CF7A 4IHXA 2R5ZB 2KIMA 3HHGA 1FYMA 3IWZA 3L2RA 3BOQA 3ULQB 3ML6A 3T1BA 2DJNA 2LF8A 1MBHA 4G12A 1U5TC 2O03A 4HA8A 1Y39A 3PL8A 1K6YA 2HYFA 4CA0A 2RKHA 1PJRA 1OCTC 1E0EA 1T33A 1V4RA 1DQUA 2CUJA 3DPTA 2PI0A 2KDOA 1MBEA 2R7TA 2LVSA 2LF7A 2M9HA 3ABMH 3RYPA 4WXCA 1Z7LA 3DEEA 3FXQA 3HPGA 5FFZA 4PJMA 1MIJA 3E6DA 1IUFA 2H8WA 4XK4A 4ESBA 4BY7J 2K9NA 1KQ9A 5B3SH 3M8JA 5BMZA 5E3LA 1VZ0A 4YG2F 2BHZA 2K40A 4N4NB 1WH5A 4E4HA 1VQ9I 2JA7J 1I1SA 1G59A 4QPQA 2LY9A 4RBOA 1H89C 4C3HJ 2OF7A 3PO3J 2CMPA 2ETHA 1JKQC 2LOOA 4MEYF 2M1BA 4FTHA 2LKXA 3E6BA 5FLVA 3JR9A 1F5TA 2NS8A 3OYEA 2IGKA 1JTXA 2BW3A 3KZZA 1RKWA 2FMYA 4RLQA 2L9SA 3ZMUA 3K1NA 2BV6A 4DJAA 3I5UA 4N4OB 1VQ6I 4F93B 1SD5A 2PN6A 1R4MB 3ABLH 5J47A 4D7NA 4L0ZB 4JK1X 2OA4A 1MMGA 3HOZJ 2P5KA 5DCMA 4AYBA 4KIGA 3E5UA 3FDYA 1W0UA 3TEDA 3RKWA 1OCRH 5JVGF 2GLOA 2XHKA 1POGA 2ZSIB 3QAHA 1T08B 3CJTB 4UV8A 4CUGA 3MMYB 4WX9A 1A6IA 3L09A 4EGZA 4ZH4F 5DUKA 1P7JA 1DDNA 3L2UA 4Y4RA 1ETVA 4BYYA 2JZYA 1LFUP 2K9SA 4XRFA 1WJCA 4C2UA 3DLLF 1NG6A 3E1SA 3O6BB 4MHGA 1TNTA 5CYVA 3I71A 3C1DA 3GLXA 1T0FA 1JGGA 3ZMZA 5E17F 4PJJA 2DO7A 3H3UA 4HYEA 1XCBA 3KYDB 5IPAA 3A4CA 2GQQA 1O7LA 1YW7A 2Y30A 4RAZA 1JT6A 2Y9ZA 2HDDA 1WPKA 1IDYA 1IW7F 1OCZH 3P9KA 3W3CA 3KX2A 3OYIA 2G9WA 1MMDA 4WF2A 3VSLA 5BQTA 1V5GA 2DOEA 2XSJC 3I4NJ 1D5VA 2RQQA 2EFWA 1E3OC 3ZQFA 4C9YA 1S7OA 2L7FP 1YRNA 2HVSA 2O5RA 2CQ7A 3HOUJ 4HV5A 1BW5A 1WCMJ 4BQOA 4BE2A 5LBQA 2WV0A 1P6RA 3A0BC 4FHTA 4RM2A 4BQAA 3OSGA 2VBXA 2O8XA 1NK3P 4HBLA 1Y1WJ 1SAUA 4YIIA 3CCJI 2JA6J 4WXHA 2D5VA 5J1YA 4UB8C 2STWA 4U0YA 4HLXA 2I10A 1IZ1A 1OLTA 2EINH 5BPIA 3E5QA 4KNYA 1KZHA 2DBBA 4RA2A 5KVRA 1FSHA 5F0FA 3DF8A 5J6XA 4DZJA 2M30A 3EYYA 3WTZA 5J4VA 2XF6A 1PDNC 2K02A 3HKZN 4XM3A 2DOAA 2OCEA 1XPXA 1J0RA 1FMVA 1QHGA 4HSRA 1MSFC 5LEKA 1OJLA 3U21A 2V1DA 2K3PA 4YRVA 2EIKH 3R4KA 1IN6A 1QQIA 3ZQIA 1W5CC 3F23A 5BNGA 4YELA 5HLHA 2K9MA 2LYCA 2DAOA 1MBJA 3OIQA 2XIGA 3AG3H 3L2CA 3HIFA 5HVQC 1B1BA 2ELHA 3HEFA 4XOPA 4KA4A 3S3OA 3JAMK 1U8BA 4GXOA 2YX4A 3TW7A 3L2VA 4R8HA 4XORA 4CSWA 5L3FA 5D5VB 2DODA 1MDMB 2DQRA 1B8IB 5JR3A 4XIDA 4YFXF 2HOSA 3AG4H 3LWFA 1TWGJ 4KIFA 4G94A 4BKXA 3OYNA 4Y13A 3H9JA 3HL2A 2H8RA 4BXUA 1SFUA 5EGOB 2WTEA 2VE9A 1FBUA 2JPBA 5L3EA 3J7ZI 3FXMA 1DUXC 2N8GA 2GBYA 3GTOJ 1BOBA 1FBSA 3PFIA 4GCVA 4XKCA 1B72B 1YFHA 3MKWB 1FOXA 2H6BA 5LGNA 1V55H 1U2WA 3BTLA 1KU9A 2R93J 5DCFA 1YIJI 4NHJA 2OQGA 3HGYA 2CV1A 2B7EA 4JOMA 2JA5J 4NUBA 1TQIA 3BLYA 3TDZC 2CYYA 2ZNZA 3IUOA 3LSHA 2K85A 1ON2A 1SEUA 1M1EB 3U1DA 3VWBA 1KQ0A 4IHSA 2IGOA 1WZ2A 3BR2A 2F4OB 1X2NA 3CP8A 2VQGA 4X0GA 5J4YA 3RQIA 4C2MJ 2IEKA 3V4GA 1A31A 2RNJA 3DPUA 1P4XA 3MCZA 2DPDA 3MZ8A 3GTGJ 1Z6RA 1IF1A 4IKFA 5M5YJ 1P2FA 2QQAA 3K0LA 2Q2EB 1J59A 2X6YA 1ZH5A 1W7PD 1S29A 2K86A 3LSGA 4MIMA 1R5HA 2V9VA 3JRFA 2OC6A 3WTVC 5D6FA 1FOKA 1IV6A 1XTAA 4P5OA 5TJJA 1G3WA 1HBXG 2PEXA 2R7OA 4M72A 5DD4A 5GPAA 1MBFA 2ME6A 4HF0A 3SZPA 3H9GA 2PJRA 4M9SA 2NS0A 2E2JJ 2VC1A 4A93J 1W36C 1EF4A 2IT0A 3C2GA 2TCTA 2LMDA 5IYDJ 2MW8A 3LAPA 2KKOA 4M6VA 3W2WA 3JSPA 3FISA 3SYTA 5DM7F 1AHDP 5LGTA 4GGGA 3HSRA 1F1ZA 2EA4A 2RQPA 4LITA 2R7FA 3RPUA 2LFBA 1XGOA 1IO2A 1D5YA 4XKBA 2VJ5A 3BZKA 1KYWA 3E5XA 4CYCA 4EJTA 1WJ5A 2ZKZA 3LAJA 3COAC 2V9PA 3TMOA 4QSHA 4ASNA 1VNDA 3E6MA 3BPXA 2OCCH 5E1ZB 1UHSA 2CSOA 3GLLA 3KETA 2R5ZA 3GTMJ 3WHCA 2XAGA 5F1RA 2X51A 5HS9A 4IRGA 2OZUA 1LNWA 2VC0A 1FYLA 1D0XA 4HQMA 3HRSA 1K78A 3DEUA 4A3IJ 3RZOJ 1WQ2A 2DYSH 3MWMA 4OIOF 3GTJJ 5FKKA 1VQ4I 1X19A 3K4MA 2Y2ZA 3LSTA 2W7NA 2YUSA 4LJZF 5GADJ 5CVVA 3CCLI 5HNHA 4L5IA 4CCJA 2V4JC 2LBFB 3SEZA 2Y75A 2F5DA 1KYZA 3AL0C 3LOCA 3HM5A 5L3CA 2YR2A 2E5NA 2MG4A 2LY2A 4Y15A 4FQGA 1N25A 4IL6C 2V6EA 2NNYA 2LLKA 1K83J 2YS9A 4OIRF 4HNUA 3QPSA 1TC3C 1T38A 1ETYA 3KEOA 3TOAA 4IRHA 3OS2A 4I99C 2IA2A 2E2IJ 2PMHA 5KAFC 2VOOA 2MFZA 1WJAA 2BE5F 2X1EA 3ZGKA 2K4BA 2BBYA 3MAJA 4I7HA 2Z33A 3H92A 3OYFA 1EH8A 1OYYA 1ZHFA 1XX5A 4UVAA 2MA3A 1I6HJ 2M8EA 4KN4X 3KIOA 3JRAA 2VUMJ 2A61A 2QLZA 2WB1A 4PSXA 3U9GA 4AIHA 4LGWA 3GWZA 3I9V2 2E1MC 4QWQA 4XLEA 3HRMA 1XGNA 5E3NA 2X48A 4RLFA 1E17A 4BY1J 1H8AC 1R4NB 2DFHA 2M0CA 3HKZA 2Z1DA 4ENJA 2KHMA 5JHUA 4G6TB 3ERMA 2LNBA 4FX0A 4GYIA 4GFBA 5KHDA 4BEHA 5A2QZ 2E1CA 3S3NA 2ME0A 3A0HC 4I0AA 5FJ8J 1P4AA 1BC8C 1HW2A 2EFOA 2KIFA 2O7OA 3WTTC 1YRNB 2KMUA 3OL3A 1ACIA 3S1RJ 4JX4A 4Z2YA 4E7KA 2VT2A 4LK0F 2HDCA 3FXJA 3RKQA 1USSA 2M2EA 4BS9A 2EZLA 2FU4A 3CCEI 2ZBKA 5M3FJ 5EEGA 2LY1A 1MJBA 2L9NA 1ZELA 3FXRA 2A68F 3BP8A 4BNCA 2KRHA 3GTQJ 1S5LC 4IO9F 3ZPLA 3F0CA 2DPUA 2VOPA 2AXLA 3Q3SA 4ZTFA 3UR3C 1VQLI 1BBYA 3ZMVA 2M4GA 3CCUI 1IRXA 4FT8A 2Y0MA 3FK7A 3HC7A 2HU9A 3ZQCA 3SXYA 3F3XA 1OYIA 1G2HA 1ON1A 1TTYA 2Z5UA 4KYWA 4LG0B 3OYJA 1YQAA 1UFMA 3H3ZA 1UG0A 5E3OA 1GV2A 4FETA 5E20A 4BQNA 2CO5A 4P1WA 2IGMA 1USTA 4M9ZA 3DEWA 1RIOH 1GXPA 3BR3A 1PP8F 3ZR8X 2GIVA 5EJCA 3S8PA 1QRYA 1JUPA 2GOMA 5HOOA 3OYHA 2J5PA 2JPCA 4C2TA 4IJAA 4PFOA 3JCUC 4J00A 1OR7C 4BJTA 5E79C 1IGNA 1D1CA 2HWVA 3CCSI 4RAGA 4LFUA 3KZYA 2FXAA 3OIPA 1SFEA 4L0YB 4XMYA 1QBJA 2NVQJ 1QU3A 3NARA 3AG2H 4XQFA 4IHWA 4JX5A 1X1PA 3GFLA 2EQRA 3N4MA 3CDIA 2D1VA 1Z9CA 2GA1A 3ZQHA 3HDDA 4G9YA 2OUMA 4M6YA 5TISC 5HDKA 3EQLF 1ZR4A 3H5RA 3NEUA 3DBLB 4O3MA 5JHFA 2IS4A 4QTRA 4ETSA 4IZZA 1X1CA 4EEFG 1BJZA 2A69F 5KAIC 5GTIC 3GCMA 5FLXZ 1MD0A 2NYXA 3FM5A 5HDGA 1D0YA 4XICA 2KPMA 4UHTA 4B09A 5F1JA 3RI4A 2H27A 2DMTA 3OWTA 5F04A 2HPIA 2VXDA 3LFKA 2H09A 2EFNA 3K69A 1B72A 2DT6A 3ZMTA 4J19A 4Q4ZF 1R6RA 2K27A 4RMNA 5FKMA 4UVBA 4UUSB 2LD5A 2ZO4A 1APLC 3CC2I 3W6VA 2VONA 1T98A 5B1BH 4XOTA 3VB2A 1QZYA 2VQHA 1R9TJ 1U5TB 1R1TA 1ZLJA 2KJBA 2QENA 5E1WA 2E5ZA 3ELKA 2DOFA 2QYOA 5FFXA 2EZHA 4PUSA 3ZN0A 3WGGA 2BY0A 4JBAA 5J1UA 2PMZN 3ONQA 1QPIA 3O2PE 3I58A 3M8FA 4ZJZA 1SMYF 4MFEA 2BY3A 3QOEA 2IA0A 4P96A 5D4SA 3HPHA 4QIWN 4J01A 4F92B 3ZRGA 4D0PA 4DW6A 2HQAA 4PZJA 4RAYA 1ZRFA 2H1KA 4UNOA 3LFUA 3H36A 4MO7A 1TWCJ 4ESJA 3E97A 2QZ8A 2L7MP 1SANA 1FYKA 4MQVA 2PBIA 3I64A 4UVCA 2E1OA 2A5WA 4BJ5C 3AFHA 4TV7A 1H9TA 2Q2EA 1YX5A 1OPCA 3LSIA 3M7GA 3SZTA 2LDUA 4RM3A 3DTEA 1DPUA 1YJ9I 4RGRA 4EM2A 1R58A 4M3DA 4M3BA 2L5QA 2E36A 1TT0A 4CYCB 1VQPI 1UAAA 4WXDA 1ZTRA 4A6DA 2R3SA 1P7IA 4HLYA 4KMUX 1ZN2A 2DYRH 5EG0A 4G6DA 3ISPA 4S04A 2A07F 4WWCA 1T95A 2ID6A 4A5MA 3CUQC 3SQNA 1GLNA 2NVUB 4MQ9F 1G3YA 2EA2A 1K78B 5FO5A 3TOBA 1ONVA 1XMAA 2E7XA 3ZN1A 4CZCA 3L1PA 5ILSA 3G1OA 1HKTA 1FLIA 4FE7A 1ENHA 2KISA 4LMYA 3DTIA 2GM4A 1EKEA 2Y48A 4O6JA 3M4OJ 3F6OA 2DA5A 4I09A 3TO7A 1FIPA 2IP2A 3DKXA 3QU6A 5AIPA 3H0DA 3OR2C 3OYMA 3G4SI 3M07A 3DBHB 4H0EA 4M74A 2HQRA 2MBFA 5E8IA 1AKHA 4N9IA 2XSDC 3GEZA 1I39A 1MNDA 4XLHA 2DFFA 4V2FA 4A0YA 3QYFA 3HB9A 4A3DJ 3VFZA 1AU7A 2JUCA 5CLSA 3FF5A 2KIUA 3HXLA 3M1CA 2W00A 5LEJA 2QSFX 4H4KC 3BTIA 1R1VA 3G1MA 3M9AA 4PJ0C 1X4OA 2PG4A 3CMMA 5DV5A 1C0WA 3MZYA 4BGDA 2FNPA 2LBFA 1I1GA 2KT0A 5EYRA 1NK2P 3WE3A 3BZ6A 2AXTC 3OS1A 1FWZA 3WGIA 3IV5A 2F2EA 2BYVE 1S72I 2WA0A 5LHGA 2JQ7A 3IRRA 2OJED 1FBQA 3P9CA 1FOWA 3CD6I 4ANJA 3CC4I 2FJ1A 4UUVA 2HQ5A 3CF5F 3F9KA 1FC3A 3L7WA 3H0GJ 2O6GE 3BR5A 3KLNA 3F72A 1O3QA 2A05A 3I3LA 4BEHB 1R22A 4PK4A 1VQ7I 1ZGWA 2EV5A 1IXRC 4BBRJ 4IHTA 1QHHD 4U7DA 3DV8A 1JXSA 1G3SA 2Q1ZB 3KP6A 1AWCA 4IX7A 4D1QA 1BR1A 5BPDA 5B1AH 2UXXA 2GA2A 2W48A 3G6EI 4LB5A 3K4KA 4EGYA 4JQFA 1TW3A 1KONA 2KZVA 2XASA 5IP6A 2HVRA 3OY9A 2ZNYA 1YHQI 1S8NA 3I53A 1YIOA 4RB1A 3C3WA 3QQAA 4ZDLA 1ZYRF 2XRNA 4XRSA 3SFIA 4KUMA 2MLGA 4Q48A 2ZC2A 5DM6F 2DFIA 4ON0A 2JA8J 2KZGA 2CW7A 2XGCA 5FRMA 4MTEA 2KFDA 2EZKA 2IW5A 2R7RA 1LFBA 1SAXA 4AVZA 2HOTA 2ZFWA 2HQNA 4OMZA 2R7SA 4P9UA 2ZJRF 3GFMA 1MJ9A 1W0TA 4G7OF 5FKLA 3S16J 4YIRX 1WKMA 3HSFA 3K10A 4B1RA 4CH7A 1S3JA 2Z2SB 1BA5A 3FIWA 4O5VA 3CF2A 2O0YA 3OYGA 3FXKA 3K4NA 1VQMI 1MZBA 3A2KA 2Z16A 3CDHA 2GIZA 4BU2A 3BG3A 3DWLE 1XSVA 2EV0A 2NVXJ 4AD9A 3OYLA 2UUZA 3MD2A 3AAFA 1IN5A 2EWNA 2LC2A 1TQPA 1BI3A 2DFEA 3D1NI 5LHIA 5F08A 2KQRA 2FA5A 4MNUA 2R5YA 2VIXA 3H5NA 2EFPA 3QPLA 4LG0A 4A3EJ 1S6LA 4LK1F 4Y33A 3RJPA 1X3WB 3BT9A 1V5FA 4HX7A 4ZYGA 3F8FA 2COBA 2COMA 2EH3A 4A3KJ 1ZG3A 1F9NA 3M1EA 1DU0A 1REPC 3B6CA 3ERED 2D45A 4V2GA 3HOWJ 5C4XJ 2P6SA 3LA2A 2WAQN 5CVIA 1JJ6C 1WVRA 2QQ9A 3IHUA 3QWLA 5K7ZA 1IV8A 1ZRDA 4XLNF 4ABZA 3LSKA 1Z3YA 1UMQA 3WODF 2FSWA 3E6CC 5EF6A 3CO6C 1I50J 2X85A 4ITVA 4RGUA 5FB2A 2DXIA 3TQNA 2L01A 2GXGA 3DU6A 3EDPA 4NBQA 1FX7A 2R7WA 1LUJB 4CYDA 5IY5H 4XRMA 2EBIA 3RKXA 3K4LA 5B66C 1NH3A 3T8TA 3P5JA 2XDVA 3PQJA 2XF5A 1D8KA 2AS5F 2NRAC 3HOSA 2CW0F 1SC7A 2B9SA 3SJMA 4LLLA 1X1AA 5LGUA 2XVCA 2MSYA 2WBMA 4UB6C 3TP3A 1YOVB 2ESNA 3W6JB 4E6KG 2X1CA 5ILVA 2DT5A 1U9OA 2BY1A 1GVJA 1FIAA 4KFCA 1ZKGA 2XAJA 5LHHA 5ICEA 4B4CA 5LD2C 1YITI 2WY8Q 2LKSA 1HW1A 2DU9A 4BE1A 4I98B 2L0KA 1RUNA 3PNVA 1MNEA 5D5WB 1YW9A 2P8TA 2QQBA 1U0JA 2HXOA 4UUSA 2HKXA 4W97A 1R71A 1I6XA 5F0HA 2VT3A 5AONA 3G71I 1MGTA 1VTNC 1U5TA 1ZLKA 3KPHA 3OYDA 1FNNA 1BR4A 1Z6TA 2CW8A 1FSEA 4HPQA 3CMAI 1IN8A 1KQ8A 1ZAOA 4EJVA 1KU3A 2VKEA 3F8MA 3ABTA 5J40A 2HS5A 2M0MA 3FZVA 1MNMC 3K4JA 1F43A 4Y3OA 5FKOA 3R0AA 1GVDA 1R23A 2LH9A 3VYUB 1T6SA 3HOTA 3MKLA 3D5LA 3WU2C 4BDYA 4CCOA 2HYJA 3PUFA 1EJ9A 2L02A 3AG1H 2FBHA 4GRIA 2JK3A 1STZA 2CH0A 2K7LA 3K1PA 2P4WA 5ICCA 3BPVA 4E7IA 2BGCA 3BR1A 1B6AA 1MBGA 4HG2A 4NC6A 1YG2A 5EG0B 3OV8A 5K7FA 1IUYA 4C3IJ 4EJOA 4A12A 2BOLA 1K79A 2L2OA 3ZQGA 2JSCA 1J75A 2ZMEC 4A3LJ 3BG9A 3RPUD 5GAEJ 4F7ZA 2LR8A 4IRIA 1D1AA 2C6YA 2HR3A 3RCOA 3JTHA 1LDDA 3RDIA 2R7QA 3KFWX 4E7SA 2M8GX 2X1DA 3IH3A 1A5JA 4Y52J 5IT3A 1E2XA 4IHYA 3BCAA 1GV5A 1BL0A 1QPMA 1U6GA 2Y69H 4YFKF 3ZP5A 4L18B 1Y0NA 1X4PA 1R00A 3H5AA 3M8EA 1FJLA 2LP0A 2HTSA 1QZEA 2F6CA 3G1LA 4RB2C 5JI6A 1AKHB 5IP9J 5IOZA 4I02A 3S14J 1DP7P 4PJLA 2P5VA 2JUGA 4CCLA 2VPLA 4FE4A 3WTWC 3A1YA 3GVAA 3TBIA 2CV2A 1MMAA 4CCKA 1OYWA 2NVYJ 4X1EA 3HJEA 2F5CA 2PX9A 3OL4A 4OMYA 2VN2A 2FUG2 2K3FA 4UY8I 3V7RA 3SZGA 3EUHC 2MC4A 1FMWA 3PNTA 1E3HA 2V1XA 3O8GA 3GFJA 2FQ3A 4ZDPA 2QUFA 5JLXA 1HSJA 3G73A 3JW4A 2VODA 3CDLA 1CQTA 2TDXA 5HDNA 2P6TA 4DGWB 3IC7A 3F6VA 3JRDA 4LB6B 2IBDA 3IH2A 3HSEA 3CC7I 1WHUA 2JJ7A 3UNGC 4ESFA 4M71A 3CESA 1XGMA 3BY6A 3I55I 3NRVA 5KNLA 3OYKA 3B6AA 3VYTB 3OR1C 1U3EM 3EYIA 3CZ6A 4CHUA 2UV1A 3QODA 2DW4A 4Q47A 2MGQA 2ZJ2A 1RR8C 3QPHA 3VODA 4KJZA 1LDKB 5EEHA 1IXCA 3TP0A 2FEZA 1I27A 2CQQA 2JSPA 2NAZA 2XGXA 3ESWB 3QYBA 5GTHC 3BG5A 2OBPA 1ZRCA 2HKOA 3JSOA 4F3QA 4ZTJA 2BXZA 1HOMA 2WY7Q 3GYHX 3N97A 1OISA 5D5XB 1HA8A 1DU6A 3ZXSA 3F22A 3J81K 4BXXJ 3NWTA 3I4PA 1SFXA 2GWRA 2R7UA 2V7FA 3RQ4A 5J8FA 2L7ZA 3ABKH 4RB0A 2ECBA 3FHZA 4PCQA 1XSXA 2MYSA 3SDBA 4BUPA 2LK2A 3MVPA 3K70D 3S2DJ 4B44A 4HSTA 1YJWI 2FBIA 3KE2A 1N75A 3HOXJ 1LE8A 4Y7NJ 3GTPJ 3GF2A 3GBGA 2GXAA 1O57A 2P7CB 3KP4A 4DYCA 3J7AO 2FD5A 4XR6A 3GFIA 3ASOH 1VQ8I 5HS8A 1BIBA 2A3SA 3DBRB 5HS7A 5K1YA 3KYLA 3K4CA 3RZDJ 3J80Z 1FTTA 2HI3A 3ZMDA 2ZXIA 1BI0A 3DCFA 2QSHX 3HRTA 3KLOA 3CLQA 4NB5A 2IS2A 3WTSC 3JRIA 1JKOC 1SD4A 1ZREA 2RN7A 1RETA 2WAQA 1R5GA 1Z91A 4EM0B 1EA3A 3FXOA 4BL0B 4D5CA 4ENNA
chains in the Genus database with same CATH topology
1V5GA 2XSJC 2A5WA 2ZFUA 4XKVA 3AFHA 2RQQA 3OMYA 4BJ5C 1YX5A 1YE9A 2VPLA 3DQVC 3LSIA 4C9YA 3BCBA 3G2BA 2HVSA 4RM3A 2O5RA 3DTEA 3IAM2 2IS1A 1D1BA 4BQOA 2L5QA 3AKZA 4BE2A 1TT0A 4DBQA 2KP6A 4EATA 1UAAA 4RM2A 3D5RC 4XLAA 2LREA 3IAS2 4XKWA 1SAUA 4DBRA 2ZXHA 2IXSA 2OV7A 2NOJB 1T95A 4D9JA 2E60A 1OLTA 2E1MB 1GLNA 3DLAA 2QKMB 4CZCA 1N77A 2XF6A 4OWRB 4XM3A 2DOAA 2M7BA 2V9KA 2VQLA 1T0FC 3DTIA 3PJRA 1FMVA 4HSRA 1QHGA 1TZLA 3U21A 4FASD 2K3PA 4II2A 4YRVA 1D0ZA 3DKXA 3H0DA 3OYBA 3OR2C 4YELA 2K9MA 2LYCA 3OYMA 3OIQA 2JVHA 4NQWB 3HG9A 4XL9A 4BACA 5HVQC 4XOPA 1MNDA 3H35A 3S3OA 4XLHA 2R7XA 3EPZA 3IP4B 3QYFA 5HNFA 3L2VA 4XORA 4IQ4A 4CSWA 3HXLA 1YX3A 3M1CA 2W00A 3K70C 4H4KC 1DGWY 2BW3B 2RNGA 2WAFA 1X4OA 3CMMA 3H9JA 3OYNA 3HL2A 4BGDA 2LBFA 2VL8A 2M3AA 3SEQA 3OS0A 5LFAA 3QYEA 3OS1A 2LG4A 2W1OA 1BOBA 2WA0A 4MLOA 4XN3A 3L2WA 4II3A 4ANJA 2BVMA 4XKCA 4BXFA 4DOZA 1S9HA 3F9KA 3MKWB 5HLTA 4NC7A 4ZC3A 1SFKA 3C2HA 5CQGA 2CV1A 4JOMA 2GOXB 3I3LA 4BEHB 4PK4A 4NUBA 4ZYAA 3BLYA 3VDXA 1MMNA 3IUOA 3LSHA 3PSIA 4KITB 1QHHD 2ELJA 4PFPA 1J09A 2Q1ZB 4IX7A 3VWBA 4D1QA 3BC8A 1BR1A 2IGOA 4E7JA 3K4KA 4JQFA 3CP8A 2VQGA 1KONA 2KRCA 2HZDA 2KZVA 4OAZA 4X0GA 2HVRA 3OY9A 2DT7B 4E7LA 3OYCA 2XAUA 3DPUA 1Y56A 3KEYA 4U87A 4IKFA 4ZDLA 3CJQB 3EUAA 2K5CA 2Q2EB 2X6YA 2R4GA 3K6GA 2UWMA 3LSGA 4R79A 2CW7A 5FRMA 2OC6A 2XF7A 2K9LA 4P5OA 3OOUA 3ZQQA 4E7HA 2HPMA 2R7RA 2JA2A 2R7OA 4AVZA 5KCMA 2R7SA 3L2QA 3ZCOA 2F5VA 3H9GA 2PJRA 2VLAA 2L7KA 1W36C 3K10A 4CH7A 3C2GA 4HRIA 2V1NA 2Z2SB 3CF2A 3OYGA 2KL4A 3W2WA 3RSNA 3W2AA 3K4NA 4OAYA 3SYTA 3A2KA 2Z16A 4BU2A 4XONA 4ZDOA 4QPOA 4XN0A 3S93A 3MKZA 3DWLE 3LL7A 3LMMA 4LITA 3OYLA 2UUZA 2VJ4A 2V26A 2LC2A 2VJ5A 1PYVA 2ZSHB 3LSMA 3MD2A 4XKBA 1WJ5A 3TMOA 4HNTA 4XLCA 2KQRA 3VYRB 4YEJA 2VIXA 3H5NA 1WJEA 2CFOA 3NWSA 4Y33A 2X51A 1V5FA 1WJDA 3BG6A 2AQEA 1Y6IA 1D0XA 3HUGB 3K4BA 3CP2A 4IQJA 1X19A 3K4MA 2VQCA 3PUBA 2W7NA 3LSKA 2IGNA 1Z3YA 5HNHA 4NNJA 2X85A 1ERDA 4CCJA 2V4JC 4ITVA 2LBFB 3SEZA 4F55A 1JI8A 3VYSB 2DXIA 2MABA 4BDZA 3DU6A 3AL0C 4BE0A 2R7WA 1N78A 2E5NA 2LY2A 3K4LA 2V6EA 4B43A 2IS6A 2XDVA 2VB6A 2XF5A 2VASA 3E0JB 3HOSA 3FHNA 4LIVA 5TGTA 4HNUA 1W36D 1X1AA 3OS2A 2WBMA 2DJIA 4U7BA 1DP3A 4E6KG 2MFZA 2X1CA 1WJAA 2HVQA 1NG7A 2X1EA 4E7ZA 4KT6A 3ZGKA 1WFXA 5LD2C 3OYFA 2WY8Q 4LG3A 4BE1A 5FRNA 3PNVA 1MNEA 3DKYA 2WADA 3BG7A 4F52A 2VXZA 2WB1A 4PSXA 5FROA 3FBNB 3I9V2 2E1MC 4XLEA 1UELB 1U0JA 4RLFA 3HKZA 2MD0A 2Z1DA 2KHMA 4G6TB 4KISA 5KHDA 4BEHA 3OYDA 2Y0SA 4HEA2 1BR4A 4BQQA 3S3NA 2CW8A 4HPQA 3DU5A 2X6WA 1G8XA 3S3MA 2R7VA 2XC7A 4C30A 2M0MA 3K4JA 2KMUA 3OL3A 4Y3OA 3VYUB 3HOTA 2LH9A 2VJIA 2KLOA 4E7KA 3S32A 3D5LA 2VKDA 4BDYA 4CCOA 4PSWA 4LIUA 2CV0A 4GRIA 4AU7A 4BS9A 2CH0A 2AQFA 3W2VA 2PJRB 4B3XA 2WAEA 3D5SC 2LY1A 4E7IA 3PSFA 1LVKA 1ZELA 2L9NA 4HG2A 3VSKA 2KRHA 2M7AA 4NC8A 1V5EA 2BOLA 2L2OA 2X6XA 3FBIB 5CPRB 4ZTFA 3RPUD 3UR3C 2LRDA 2M4GA 2W82A 1IRXA 4DIQA 1D1AA 3RCOA 2W4SA 2R7QA 5CQEA 2I8DA 4E7SA 4PJNA 3V42A 2X1DA 3HC7A 1X1BA 2HU9A 2HNHA 3OYAA 2QKLB 1Z21A 1LKXA 3DTKA 3N05A 5CKTA 3BCAA 2A6TA 1WJBA 3L2RA 3OYJA 1UG0A 1X4PA 4FETA 3H5AA 4BQNA 4P1WA 2IGMA 2F6CA 4F91B 3PL8A 1K6YA 2CS3A 4CA0A 3ZR8X 1PJRA 4PJLA 1E0EA 2JUGA 3S8PA 4CCLA 1DQUA 2CUJA 2PMZA 3DPTA 2GOMA 3A1YA 3TBIA 5HOOA 3OYHA 2VKHA 2CV2A 3J7AY 2KDOA 4C2TA 1MMAA 2R7TA 4PFOA 4CCKA 3DPLC 4J00A 1OR7C 1Z7LA 3DEEA 3HPGA 1DGRM 4BJTA 4BJ6C 3OL4A 1MW7A 4PJMA 1D1CA 2FUG2 3SZGA 3EUHC 2MC4A 1FMWA 3PNTA 4ZDPA 3OIPA 3M8JA 1VZ0A 4XMYA 1QU3A 2VJJA 4N4NB 4E4HA 4XQFA 4DGWB 2CUZA 1G59A 4QPQA 2RREA 1WJFA 2CMPA 2HDWA 2LOOA 2F4IA 3UNGC 2OUMA 1AA7A 3CJRB 3CESA 3H5RA 5KNLA 3OYEA 3FKJA 3OYKA 2IGKA 3OR1C 3VYTB 5JHFA 2BW3A 3CZ6A 2IS4A 2UV1A 3QODA 4RLQA 2L9SA 4IZZA 3RTRA 3H9QA 4XLFA 4DJAA 4KJZA 1LDKB 1X1CA 4N4OB 4F93B 2JSPA 3QYBA 2BVLA 1D0YA 2KPMA 1MMGA 3EUKL 3OWTA 2HPIA 2VXDA 4F3QA 4ZTJA 2WY7Q 4AYBA 3FDYA 2DT6A 1HA8A 1R6RA 3ZXSA 4RMNA 3NWTA 2R7UA 2V7FA 2ZSIB 4XNFA 3RQ4A 2JVGA 2P0WA 1BR2A 4XOTA 4CUGA 2VQHA 3MMYB 2M4KA 3TL4X 2MYSA 3SDBA 2E5ZA 4BUPA 4CCNA 3K70D 4B44A 4HSTA 3PFYA 1N75A 4Y4RA 3L2UA 4PUSA 4CCMA 3PNYA 4B48A 3GBGA 1P9QC 1WJCA 4C2UA 3ONQA 1NG6A 3E1SA 4XR6A 1Z3XA 1LFPA 2DCEA 4ZJZA 3QOEA 3KYLA 3K4CA 4PJJA 2ZXIA 3HPHA 3MKYB 3A4CA 2IS2A 4J01A 4B47A 4F92B 3ZRGA 2WAQA 2HQAA 3AL0B 1EA3A 4BL0B 1X1DA 3LFUA 3W3CA 3KX2A 3OYIA 1MMDA 3VSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7B A;  2M7A A; 
#chains in the Genus database with same CATH topology
 1HDD C;  3K7A J;  2FNA A;  3R0J A;  1R5I D;  4M6X A;  2ZFU A;  3FWE A;  4HV6 A;  3QP6 A;  3BJO A;  1J7K A;  2E19 A;  2RAE A;  3BCB A;  3G2B A;  3NQO A;  3W6K B;  3OSF A;  1OQY A;  2UZK A;  3IAM 2;  3FXL A;  4DQ2 A;  2IS1 A;  5IT9 K;  2XRL A;  3DP7 A;  5EZG A;  1V3F A;  1D1B A;  2P7V B;  3R6S A;  4DBQ A;  1R49 A;  2KP6 A;  2UXN A;  3GO5 A;  1RKT A;  2HGC A;  3D5R C;  4KIB A;  3F8N A;  3GTK J;  4XBF A;  2O3F A;  3P7N A;  5GPC A;  2LRE A;  1J9I A;  3IAS 2;  2VKV A;  2R5Y B;  2IVM A;  2BY2 A;  1UHW A;  1FY7 A;  3JTG A;  2ZXH A;  1GT0 C;  2XV4 S;  3B02 A;  1QA6 A;  4HAM A;  2VBY A;  2NOJ B;  1FZP B;  2XKP A;  3KP2 A;  3V7C A;  3K2Z A;  2QEX I;  2PJP A;  3T8R A;  4OIP F;  4IEJ A;  2QKM B;  1N77 A;  3KP7 A;  3IH4 A;  3NAU A;  4OWR B;  2VBW A;  4RAF A;  2X9D A;  3BJ6 A;  2V9K A;  4Z6Y A;  2DN0 A;  1E3P A;  4XSX F;  2VQL A;  1T0F C;  2DMP A;  3BWG A;  4M73 A;  3PJR A;  1KU7 A;  1D8J A;  1OKR A;  1TZL A;  1TNS A;  4YFN F;  2DK8 A;  1WRJ A;  3LA3 A;  5DS9 A;  1JGS A;  4K2E A;  2WC2 A;  4MEX F;  4CXF A;  3Q9S A;  1YS6 A;  1U9N A;  1FTZ A;  4CO8 A;  1GUU A;  1SMT A;  1O4X A;  4NQW B;  4E70 A;  2LSO A;  2Z3Y A;  3F8C A;  1ZG5 A;  2OZ6 A;  3FXU A;  3H35 A;  3LSP A;  2L4A A;  3LSJ A;  3IP4 B;  3SFZ A;  5HNF A;  3FMQ A;  4IQ4 A;  5H2F C;  4HW0 A;  1XCV A;  1WGX A;  4IVN A;  5J8C A;  2PMU A;  1DGW Y;  4L5E A;  2WAF A;  2JTV A;  2J5O A;  3JRE A;  5EEA A;  2PQ8 A;  1A35 A;  1MKM A;  1RPW A;  5M5W J;  2M3A A;  3SEQ A;  3IKT A;  4V19 K;  2ADU A;  1YTY A;  2O8K A;  3QYE A;  2JT1 A;  1H88 C;  1TWH J;  1ZAR A;  1JHF A;  4QLC U;  2V1U A;  2XB0 X;  3L2W A;  5CVJ A;  2ZJQ F;  3RYR A;  2ISY A;  4DOZ A;  2JN6 A;  3K2A A;  4JYK A;  3D0S A;  1L3L A;  1G4D A;  3GZN B;  4NC7 A;  4ZC3 A;  2WWY A;  2XPU A;  2M5W A;  1TT5 B;  3HYI A;  1XMX A;  3CUQ B;  4L5J A;  2XGD A;  4X6A J;  3VDX A;  1TP4 A;  2EV6 A;  5FLX K;  3PSI A;  1A6Q A;  4FIS A;  2E34 A;  2AO9 A;  2KIQ A;  3BTJ A;  2O61 A;  3HTU A;  3OIO A;  3CJN A;  2F5E A;  2JRT A;  3IWF A;  2GZW A;  1T8I A;  1LEA A;  1ETK A;  2QGU A;  4M3F A;  1XC5 A;  3S15 J;  4A3C J;  5JFR A;  5HOD A;  3OYC A;  3K9T A;  1Y56 A;  1IN4 A;  3WG9 A;  1BJA A;  2D1H A;  4U87 A;  5F0C A;  3VOE A;  1SVM A;  1FP2 A;  4U88 A;  4ZZL A;  5E1X A;  3ROU A;  3CJQ B;  3EUA A;  4AVP A;  1O3T A;  2K5C A;  1U78 A;  1ITY A;  1X3U A;  2R4G A;  3GZ5 A;  2K4J A;  4L9N A;  1Z05 A;  4HDU A;  2E1N A;  4R79 A;  1FT9 A;  2ZXW H;  4DZP A;  3WE2 A;  1Z0X A;  2XF7 A;  3Q5F A;  2K9L A;  1ZK8 A;  1RI7 A;  2PLY A;  4E7H A;  2HPM A;  1G6N A;  4D5F A;  3I56 I;  2F48 A;  2Q8K A;  2Y9Y A;  4MGR A;  5KCM A;  1VQO I;  3GZ6 A;  3A02 A;  3B73 A;  2CJJ A;  3C7J A;  3HGG A;  5CVU A;  3ZCO A;  1LPQ A;  5J3L A;  4CDG A;  1R36 A;  4L9J A;  1MH3 A;  2V1N A;  5ERI A;  3U1K A;  3RSN A;  3DXJ F;  3W2A A;  4OAY A;  5FD5 A;  1A36 A;  4P55 A;  4A69 C;  1T39 A;  3MKZ A;  3FKI J;  1O7F A;  3LL7 A;  2DMQ A;  1K61 A;  4HF1 A;  5FKN A;  4WCG A;  2VJ4 A;  1BC7 C;  3LSM A;  1IXS B;  1PYV A;  1V54 H;  2DLL A;  2ZSH B;  3CMY A;  4D7M A;  2FBK A;  1IG7 A;  3L9F A;  4PGH A;  5K5Q A;  5L3D A;  4HNT A;  2OTL I;  3DFG A;  4A0X A;  4M9X A;  4BAY A;  2H1L A;  4YEJ A;  3S2W A;  2XGE A;  4G6Q A;  4BHC A;  3BJA A;  1WJE A;  3REO A;  2CFO A;  1FEX A;  1OCO H;  1WJD A;  3U2R A;  2OTJ I;  2AQE A;  1RNL A;  2CWE A;  4RB3 C;  3K1M A;  1XD7 A;  1QZZ A;  3HUG B;  1IRZ A;  3Q0V A;  3K4B A;  4ENK A;  4RS8 A;  2OPT A;  4IQJ A;  2VQC A;  1D3Y A;  2R0Q C;  4CIC A;  1B9M A;  3JRH A;  1BOA A;  2MH9 A;  2ESH A;  3CCV I;  3CME I;  2IGN A;  4AWX B;  1HLV A;  1W5S A;  4NNJ A;  1ERD A;  1JI8 A;  4F55 A;  4IOC F;  1ODD A;  1Y1V J;  3VYS B;  5BOX A;  4HNV A;  2MAB A;  4BDZ A;  4BE0 A;  3QOP A;  1ETW A;  1T2K A;  1N78 A;  3RIR A;  4G7Z F;  1J5Y A;  3BR6 A;  2AHQ A;  1QO0 D;  2HFH A;  1TQM A;  2FOK A;  2H94 A;  4PDK A;  1I5Z A;  1BN5 A;  2IS6 A;  2VB6 A;  3KP5 A;  4JX6 A;  3FHN A;  2ACJ A;  4AC0 A;  2EIJ H;  2CFX A;  2NOG A;  3FMS A;  2DJI A;  4A0Z A;  1DP3 A;  1XN7 A;  4AID A;  3QPT A;  1AOY A;  1KGS A;  4KT6 A;  3HOY J;  5H6R A;  2G0E A;  1LE8 B;  4Q5S F;  2DDB A;  1P4W A;  1YI2 I;  3MZH A;  5LLQ A;  4XSZ F;  2ZCW A;  3EET A;  5FRN A;  2KDZ A;  3BG7 A;  2DA3 A;  2GAU A;  2WAD A;  2VXZ A;  4UV9 A;  4F52 A;  1ZGA A;  3FBN B;  2DMN A;  1UEL B;  4BBS J;  2YU9 J;  2CUE A;  5GAH J;  1HKQ A;  2BXY A;  1MH4 A;  2FQ4 A;  2RDP A;  2MD0 A;  4KIS A;  3KEQ A;  4A2U A;  2ID3 A;  3ECO A;  4HX4 A;  1I3Q J;  4EJU A;  1VI0 A;  1S7A A;  4HEA 2;  3WG7 H;  4BQQ A;  3QU3 A;  1R1U A;  5D6E A;  3DU5 A;  3F21 A;  1G8X A;  1P92 A;  3S3M A;  2R7V A;  2XC7 A;  4C30 A;  1W5T A;  2DA1 A;  1TL8 A;  3GTL J;  1OR7 A;  2GXB A;  1JJ8 C;  4A3B J;  2VJI A;  4JP0 A;  2KLO A;  3WGH A;  3HBL A;  2VKD A;  3T0Y A;  1WI3 A;  2W57 A;  4NDL A;  4AIJ A;  1PUF A;  2CV0 A;  1YYV A;  5EZH A;  2AQF A;  2DDA A;  3JRC A;  5DD8 A;  2EZI A;  2D2W A;  2P5L C;  5DUI A;  2VPR A;  1RES A;  4B3X A;  3D5S C;  4BH9 A;  5F64 A;  3PSF A;  4HDV A;  1LVK A;  1YS7 A;  3BQY A;  2QWW A;  3ABU A;  2EB7 A;  1VQN I;  1OFC X;  4EVI A;  4ZYE A;  3FBI B;  2NXN B;  1QVU A;  5CPR B;  4YIF A;  3I59 A;  2IA1 A;  1EV7 A;  3BQZ A;  2LRD A;  2W82 A;  3J7Y J;  4DIQ A;  4DNC A;  2LKP A;  2M34 A;  1LJ9 A;  3ASN H;  5CQE A;  2I8D A;  3H1C A;  2I5U A;  2L54 A;  2X0L A;  3DTK A;  3N05 A;  3I4M J;  1FOY A;  4S05 A;  1B9N A;  2A6T A;  1WJB A;  4L9T A;  5D5U B;  4AUX A;  2FX0 A;  3TW6 A;  1XSD A;  3X2Q H;  5C44 J;  2FOW A;  1OMI A;  3S1N J;  2QBY B;  3BTC A;  4F91 B;  2CS3 A;  2WB1 N;  1XG1 A;  2V6C A;  5HLG A;  2MLK A;  5F6F A;  4EM1 A;  4PGG A;  3JAM Z;  3K70 C;  2PMZ A;  1H9G A;  1J2X A;  3R60 A;  4HZF A;  2O9L A;  3J7A Y;  2VKH A;  2A6E F;  2F4M B;  1Z67 A;  3DPL C;  3VEP A;  5L3B A;  4G8X A;  1DGR M;  2B0L A;  4BJ6 C;  3RPQ A;  3IKV A;  1MW7 A;  1QNT A;  5FD6 A;  1RC9 A;  3R61 A;  2RC4 A;  3I54 A;  1Y8R B;  2M87 A;  1IJW C;  2RVC A;  1WSU A;  3VPR A;  2VJJ A;  4NQW A;  1T56 A;  2E7W A;  1HQC A;  2QCO A;  5DEQ A;  2CUZ A;  3SHF A;  2RRE A;  1WJF A;  5ICG A;  3CCY A;  5E8G A;  2HDW A;  1WWX A;  2F4I A;  3A03 A;  1AA7 A;  3CJR B;  4A3F J;  1G3T A;  5F27 A;  3FKJ A;  3GXO A;  4LOC A;  1X2M A;  5LRS A;  2ZME B;  1QVT A;  2EIL H;  5LRR A;  3RTR A;  3H9Q A;  4XLF A;  2P81 A;  2VI6 A;  2XB5 A;  3DKW A;  3C18 A;  3UKG A;  5E3M A;  1F4K A;  2BVL A;  4FCY A;  3EUK L;  2X4H A;  4R1H A;  2VE8 A;  2KRF A;  5DDG A;  2X6O A;  2CQK A;  5TRD A;  1BW6 A;  3T5X A;  4I0B A;  1HF0 A;  3ZQ7 A;  1JUM A;  4XNF A;  5J1R A;  2XUB A;  2JVG A;  2P0W A;  1BR2 A;  4CZZ A;  2M4K A;  3TL4 X;  3FX3 A;  3CUQ A;  4CCN A;  4U0V A;  2E2H J;  3PFY A;  4BHP A;  1GDT A;  1BI2 A;  4CCM A;  3PNY A;  3FM3 A;  4B48 A;  1P9Q C;  3CO7 C;  4A6E A;  3O8H A;  1Z3X A;  1LFP A;  2DCE A;  3V8L A;  5H20 A;  3QP5 A;  1TWF J;  3V8J A;  3MKY B;  3S1Q J;  2G7H A;  3O3K A;  4B47 A;  1SVL A;  2B63 J;  1O3R A;  2CRG A;  3AL0 B;  4W1U A;  4U0W A;  1X1D A;  1JKR C;  2DA7 A;  2RV8 A;  3LA7 A;  3BRO A;  4ENM A;  2FRH A;  3CCR I;  3A01 A;  4XKV A;  1ZR2 A;  1IN7 A;  3OMY A;  3KCC A;  1UB9 A;  1YE9 A;  1IDZ A;  3C2B A;  3DQV C;  1XMK A;  1KU2 A;  1W7P A;  4XRS G;  3LSR A;  4I76 A;  1JHH A;  2R7Z J;  5B5E C;  1HC8 A;  2DK5 A;  3AKZ A;  3MQ0 A;  4GYG A;  3BDD A;  4EAT A;  2L9R A;  2QQ8 A;  3HOV J;  2EPF A;  6PAX A;  2E71 A;  1CF7 B;  4XLA A;  1TBX A;  3Q0W A;  5ED4 A;  2NVT J;  2XAH A;  4XKW A;  1WI9 A;  2KJC A;  2EK5 A;  5DTD A;  1X3Z B;  4DBR A;  2L3D A;  1YJN I;  2IXS A;  2OV7 A;  4IPA A;  2V79 A;  4D9J A;  1NHA A;  3SDG A;  2LTP A;  1Z7U A;  3CCQ I;  2QF7 A;  2E60 A;  2ZXJ A;  1XB4 A;  1EH7 A;  2E1M B;  1K7A A;  2BZT A;  2FF4 A;  3DLA A;  3LNQ A;  2HXI A;  3PQK A;  1VFC A;  4KIC A;  2OQR A;  2M7B A;  2H6C A;  3FK6 A;  2L4M A;  1LQ1 A;  3CLO A;  2ZB9 A;  2Y0S N;  1Z77 A;  2CG4 A;  3G3Z A;  4FAS D;  2DI3 A;  4II2 A;  1D0Z A;  1TW2 A;  2ELK A;  3OYB A;  1PVE A;  2JVH A;  4N0B A;  3E7L A;  3HG9 A;  4XL9 A;  4IOA F;  1GXQ A;  5M3M J;  4BAC A;  3M3Y J;  2CQX A;  1DPR A;  3HUG A;  4MTD A;  3P9I A;  2R7X A;  3S17 J;  5ICF A;  2BHY A;  3EPZ A;  2G7U A;  4A3J J;  2ISZ A;  4BHB A;  1K6O A;  2RGV A;  3WTY C;  1RRJ A;  1YX3 A;  2DQL A;  2W24 A;  4RGX A;  1ZQ3 P;  4FX4 A;  2BW3 B;  3TKY A;  2RNG A;  3I0T A;  2E35 A;  3S1M J;  4N9H A;  3CUO A;  3WU0 A;  2XPV A;  2VL8 A;  3OS0 A;  5LFA A;  1S7E A;  2DA4 A;  2LG4 A;  2JWT A;  1YO5 C;  2W1O A;  2CUF A;  1U8R A;  1HDP A;  1B59 A;  3KP3 A;  4MLO A;  4XN3 A;  4ZYH A;  1JUS A;  5KK1 A;  4OIQ F;  4CGZ A;  2A5Y B;  4II3 A;  5DCM B;  5DYM A;  3V7S A;  5BS6 A;  4IXA A;  2BVM A;  4OOI A;  4BXF A;  2ICW G;  5IYC J;  1QGP A;  2W84 A;  1S9H A;  1O3S A;  5HLT A;  3J81 Z;  3IRQ A;  2MD5 A;  1HST A;  1L0O C;  1SFK A;  1RZ4 A;  1UHM A;  3F8B A;  1RUO A;  3C2H A;  3ZOB A;  3LQQ A;  5CQG A;  3E3V A;  1CGP A;  2GOX B;  1Q1H A;  3ECH A;  2F5F A;  1Z1D A;  2A6H F;  4ZYA A;  1MMN A;  3TDU C;  2YX7 A;  4KIT B;  2ELJ A;  4PFP A;  1J09 A;  3GX4 X;  3HTS B;  2W85 A;  3BC8 A;  1VQK I;  4EMS A;  2HTJ A;  5H6Q A;  4E7J A;  2FML A;  3FMR A;  3LQR A;  1RR7 A;  1ULY A;  2DTZ A;  2KRC A;  4OAZ A;  2HZD A;  5EDN A;  3PIO F;  1PUF B;  3TO9 A;  3IL2 A;  5C4J J;  5L3G A;  2CU7 A;  1W4M A;  2IAI A;  2DT7 B;  3BZC A;  4E7L A;  1Y8Q B;  2XAU A;  3GME A;  4A3M J;  3KEY A;  1LVA A;  5A2Q K;  4A5N A;  4UXN A;  2CQN A;  5CVR A;  2IRF G;  1R7J A;  1MSE C;  4WK8 F;  1Q1V A;  3K6G A;  2UWM A;  2YSR A;  2Z9O A;  3I59 B;  1EH6 A;  2HYG D;  3J80 K;  4EV0 A;  1FPQ A;  5IT9 Z;  4KDP A;  3OOU A;  2HOE A;  1IAW A;  3ZQQ A;  1F36 A;  1XDU A;  1YLF A;  2JA2 A;  4DYQ A;  2Z99 A;  1Y0U A;  3HRU A;  2L9V A;  2CGP A;  1OCP A;  3L2Q A;  5IP7 J;  4KMF A;  2HEO A;  1IRF A;  2F5V A;  4ZYD A;  3CCM I;  2VLA A;  2L7K A;  3V8K A;  5IOY A;  9ANT A;  4HRI A;  2KL4 A;  1UCR A;  1K4S A;  2NNN A;  4AYB N;  1XS9 A;  4XON A;  3JRG A;  4QPO A;  1LB2 A;  4ZDO A;  4XN0 A;  1ETX A;  3S93 A;  4IHV A;  2EFQ A;  4EJW A;  3LMM A;  3TGN A;  3OOP A;  3WHB A;  4LD5 A;  3WTU C;  2V26 A;  5HLI A;  2BEO A;  2R92 J;  3WU1 B;  1BIA A;  2XAQ A;  2PFB A;  2ECC A;  2HOA A;  4M3G A;  2OAZ A;  1SD7 A;  4XLC A;  5C3E J;  3VYR B;  3BR0 A;  2NS7 A;  2JRM A;  2YPR A;  4L9V A;  3RKY A;  1WH7 A;  3NWS A;  4RGS A;  3KZI C;  4RDU A;  3BG6 A;  2W25 A;  2QBY A;  3PO2 J;  1YW8 A;  1Y6I A;  4LLG F;  3HZJ A;  2OU2 A;  1TLH B;  4GDF A;  3TO6 A;  4EQQ A;  3CP2 A;  4P9F A;  2MC3 A;  4I6Z A;  3PUB A;  4AM3 A;  1SVO A;  2VBZ A;  4KT5 C;  1I3A A;  1ZG1 A;  4AIK A;  4HOB A;  5IYB J;  3GUD A;  1UJ8 A;  2FE3 A;  2QM3 A;  3Q0U A;  2OD5 A;  1K4T A;  1UZC A;  4MFD A;  1JKP C;  4Y17 A;  1XDS A;  1LEB A;  1A04 A;  4B43 A;  4HX8 A;  4I2O A;  2DMU A;  2VAS A;  3E0J B;  1ORK A;  1W36 D;  3S2H J;  4LIV A;  1KA8 A;  5TGT A;  1MDM A;  3ZMS A;  1H0M A;  1B8I A;  2Y31 A;  2MH2 A;  3MFK A;  4S0H B;  2M45 A;  4U7B A;  1HCR A;  1TWA J;  1B4A A;  2R7D A;  4KN7 X;  5JVT A;  5E18 F;  2XKO A;  2HVQ A;  2ZME A;  1NG7 A;  5EGO A;  4E7Z A;  3MEX A;  4HF2 A;  5GAG J;  1ETQ A;  4GO1 A;  1WFX A;  2QSG X;  5GP9 A;  5D8L B;  4LG3 A;  3HHH A;  2ZJP F;  5JLW A;  4B3A A;  1NTC A;  4G7H F;  4UUT A;  3H3V K;  5ILU A;  1MBK A;  2JMW A;  3DKY A;  1SD6 A;  1BM9 A;  2Q0O A;  5FRO A;  4B8X A;  2DA2 A;  2HZT A;  3PIP F;  1HXD A;  1W1W E;  2DA6 A;  2STT A;  3GW2 A;  1SFO J;  4IF4 A;  2EJR A;  1VF9 A;  1UG2 A;  4M3E A;  3CQZ J;  2Y0S A;  1IRG A;  1PP7 U;  2YU3 A;  5AIQ A;  3L00 A;  1IC8 A;  5K7H A;  3A01 B;  3WTX C;  2X6W A;  1OCC H;  5FGM A;  2DTR A;  3ZQL A;  5M5X J;  1JE8 A;  4I01 A;  2QA4 I;  1JT0 A;  1MJA A;  4A3G J;  1ZGJ A;  1W7P B;  4C3J J;  5FLM J;  1BI1 A;  4ZZD A;  3S32 A;  3KYC B;  5K5O A;  2XPW A;  4LLN A;  4PSW A;  2K9Q A;  4LIU A;  3EUH A;  3CTA A;  4AU7 A;  4XLP F;  4DYR A;  1GHC A;  1ETO A;  3W2V A;  2QVO A;  2PJR B;  2XAF A;  2WAE A;  5K5R A;  2EIM H;  1LDJ A;  2XRO A;  3VSK A;  4OU0 A;  1X58 A;  5D8K B;  2M7A A;  4NC8 A;  3JRB A;  1V5E A;  1HKS A;  2X6X A;  1VQ5 I;  3QRF F;  2IJL A;  1HW5 A;  2TRT A;  3MN2 A;  1MMS A;  5CJ9 A;  1FP1 D;  1JTY A;  3Q9V A;  4HQE A;  2W4S A;  4PJN A;  3V42 A;  5D4R A;  1X1B A;  2HNH A;  1PUE E;  2WV1 A;  3PM1 A;  4OIN F;  1XGS A;  1Z21 A;  2IPQ X;  2QKL B;  3OYA A;  1LKX A;  5CKT A;  1CF7 A;  4IHX A;  2R5Z B;  2KIM A;  3HHG A;  1FYM A;  3IWZ A;  3L2R A;  3BOQ A;  3ULQ B;  3ML6 A;  3T1B A;  2DJN A;  2LF8 A;  1MBH A;  4G12 A;  1U5T C;  2O03 A;  4HA8 A;  1Y39 A;  3PL8 A;  1K6Y A;  2HYF A;  4CA0 A;  2RKH A;  1PJR A;  1OCT C;  1E0E A;  1T33 A;  1V4R A;  1DQU A;  2CUJ A;  3DPT A;  2PI0 A;  2KDO A;  1MBE A;  2R7T A;  2LVS A;  2LF7 A;  2M9H A;  3ABM H;  3RYP A;  4WXC A;  1Z7L A;  3DEE A;  3FXQ A;  3HPG A;  5FFZ A;  4PJM A;  1MIJ A;  3E6D A;  1IUF A;  2H8W A;  4XK4 A;  4ESB A;  4BY7 J;  2K9N A;  1KQ9 A;  5B3S H;  3M8J A;  5BMZ A;  5E3L A;  1VZ0 A;  4YG2 F;  2BHZ A;  2K40 A;  4N4N B;  1WH5 A;  4E4H A;  1VQ9 I;  2JA7 J;  1I1S A;  1G59 A;  4QPQ A;  2LY9 A;  4RBO A;  1H89 C;  4C3H J;  2OF7 A;  3PO3 J;  2CMP A;  2ETH A;  1JKQ C;  2LOO A;  4MEY F;  2M1B A;  4FTH A;  2LKX A;  3E6B A;  5FLV A;  3JR9 A;  1F5T A;  2NS8 A;  3OYE A;  2IGK A;  1JTX A;  2BW3 A;  3KZZ A;  1RKW A;  2FMY A;  4RLQ A;  2L9S A;  3ZMU A;  3K1N A;  2BV6 A;  4DJA A;  3I5U A;  4N4O B;  1VQ6 I;  4F93 B;  1SD5 A;  2PN6 A;  1R4M B;  3ABL H;  5J47 A;  4D7N A;  4L0Z B;  4JK1 X;  2OA4 A;  1MMG A;  3HOZ J;  2P5K A;  5DCM A;  4AYB A;  4KIG A;  3E5U A;  3FDY A;  1W0U A;  3TED A;  3RKW A;  1OCR H;  5JVG F;  2GLO A;  2XHK A;  1POG A;  2ZSI B;  3QAH A;  1T08 B;  3CJT B;  4UV8 A;  4CUG A;  3MMY B;  4WX9 A;  1A6I A;  3L09 A;  4EGZ A;  4ZH4 F;  5DUK A;  1P7J A;  1DDN A;  3L2U A;  4Y4R A;  1ETV A;  4BYY A;  2JZY A;  1LFU P;  2K9S A;  4XRF A;  1WJC A;  4C2U A;  3DLL F;  1NG6 A;  3E1S A;  3O6B B;  4MHG A;  1TNT A;  5CYV A;  3I71 A;  3C1D A;  3GLX A;  1T0F A;  1JGG A;  3ZMZ A;  5E17 F;  4PJJ A;  2DO7 A;  3H3U A;  4HYE A;  1XCB A;  3KYD B;  5IPA A;  3A4C A;  2GQQ A;  1O7L A;  1YW7 A;  2Y30 A;  4RAZ A;  1JT6 A;  2Y9Z A;  2HDD A;  1WPK A;  1IDY A;  1IW7 F;  1OCZ H;  3P9K A;  3W3C A;  3KX2 A;  3OYI A;  2G9W A;  1MMD A;  4WF2 A;  3VSL A;  5BQT A;  1V5G A;  2DOE A;  2XSJ C;  3I4N J;  1D5V A;  2RQQ A;  2EFW A;  1E3O C;  3ZQF A;  4C9Y A;  1S7O A;  2L7F P;  1YRN A;  2HVS A;  2O5R A;  2CQ7 A;  3HOU J;  4HV5 A;  1BW5 A;  1WCM J;  4BQO A;  4BE2 A;  5LBQ A;  2WV0 A;  1P6R A;  3A0B C;  4FHT A;  4RM2 A;  4BQA A;  3OSG A;  2VBX A;  2O8X A;  1NK3 P;  4HBL A;  1Y1W J;  1SAU A;  4YII A;  3CCJ I;  2JA6 J;  4WXH A;  2D5V A;  5J1Y A;  4UB8 C;  2STW A;  4U0Y A;  4HLX A;  2I10 A;  1IZ1 A;  1OLT A;  2EIN H;  5BPI A;  3E5Q A;  4KNY A;  1KZH A;  2DBB A;  4RA2 A;  5KVR A;  1FSH A;  5F0F A;  3DF8 A;  5J6X A;  4DZJ A;  2M30 A;  3EYY A;  3WTZ A;  5J4V A;  2XF6 A;  1PDN C;  2K02 A;  3HKZ N;  4XM3 A;  2DOA A;  2OCE A;  1XPX A;  1J0R A;  1FMV A;  1QHG A;  4HSR A;  1MSF C;  5LEK A;  1OJL A;  3U21 A;  2V1D A;  2K3P A;  4YRV A;  2EIK H;  3R4K A;  1IN6 A;  1QQI A;  3ZQI A;  1W5C C;  3F23 A;  5BNG A;  4YEL A;  5HLH A;  2K9M A;  2LYC A;  2DAO A;  1MBJ A;  3OIQ A;  2XIG A;  3AG3 H;  3L2C A;  3HIF A;  5HVQ C;  1B1B A;  2ELH A;  3HEF A;  4XOP A;  4KA4 A;  3S3O A;  3JAM K;  1U8B A;  4GXO A;  2YX4 A;  3TW7 A;  3L2V A;  4R8H A;  4XOR A;  4CSW A;  5L3F A;  5D5V B;  2DOD A;  1MDM B;  2DQR A;  1B8I B;  5JR3 A;  4XID A;  4YFX F;  2HOS A;  3AG4 H;  3LWF A;  1TWG J;  4KIF A;  4G94 A;  4BKX A;  3OYN A;  4Y13 A;  3H9J A;  3HL2 A;  2H8R A;  4BXU A;  1SFU A;  5EGO B;  2WTE A;  2VE9 A;  1FBU A;  2JPB A;  5L3E A;  3J7Z I;  3FXM A;  1DUX C;  2N8G A;  2GBY A;  3GTO J;  1BOB A;  1FBS A;  3PFI A;  4GCV A;  4XKC A;  1B72 B;  1YFH A;  3MKW B;  1FOX A;  2H6B A;  5LGN A;  1V55 H;  1U2W A;  3BTL A;  1KU9 A;  2R93 J;  5DCF A;  1YIJ I;  4NHJ A;  2OQG A;  3HGY A;  2CV1 A;  2B7E A;  4JOM A;  2JA5 J;  4NUB A;  1TQI A;  3BLY A;  3TDZ C;  2CYY A;  2ZNZ A;  3IUO A;  3LSH A;  2K85 A;  1ON2 A;  1SEU A;  1M1E B;  3U1D A;  3VWB A;  1KQ0 A;  4IHS A;  2IGO A;  1WZ2 A;  3BR2 A;  2F4O B;  1X2N A;  3CP8 A;  2VQG A;  4X0G A;  5J4Y A;  3RQI A;  4C2M J;  2IEK A;  3V4G A;  1A31 A;  2RNJ A;  3DPU A;  1P4X A;  3MCZ A;  2DPD A;  3MZ8 A;  3GTG J;  1Z6R A;  1IF1 A;  4IKF A;  5M5Y J;  1P2F A;  2QQA A;  3K0L A;  2Q2E B;  1J59 A;  2X6Y A;  1ZH5 A;  1W7P D;  1S29 A;  2K86 A;  3LSG A;  4MIM A;  1R5H A;  2V9V A;  3JRF A;  2OC6 A;  3WTV C;  5D6F A;  1FOK A;  1IV6 A;  1XTA A;  4P5O A;  5TJJ A;  1G3W A;  1HBX G;  2PEX A;  2R7O A;  4M72 A;  5DD4 A;  5GPA A;  1MBF A;  2ME6 A;  4HF0 A;  3SZP A;  3H9G A;  2PJR A;  4M9S A;  2NS0 A;  2E2J J;  2VC1 A;  4A93 J;  1W36 C;  1EF4 A;  2IT0 A;  3C2G A;  2TCT A;  2LMD A;  5IYD J;  2MW8 A;  3LAP A;  2KKO A;  4M6V A;  3W2W A;  3JSP A;  3FIS A;  3SYT A;  5DM7 F;  1AHD P;  5LGT A;  4GGG A;  3HSR A;  1F1Z A;  2EA4 A;  2RQP A;  4LIT A;  2R7F A;  3RPU A;  2LFB A;  1XGO A;  1IO2 A;  1D5Y A;  4XKB A;  2VJ5 A;  3BZK A;  1KYW A;  3E5X A;  4CYC A;  4EJT A;  1WJ5 A;  2ZKZ A;  3LAJ A;  3COA C;  2V9P A;  3TMO A;  4QSH A;  4ASN A;  1VND A;  3E6M A;  3BPX A;  2OCC H;  5E1Z B;  1UHS A;  2CSO A;  3GLL A;  3KET A;  2R5Z A;  3GTM J;  3WHC A;  2XAG A;  5F1R A;  2X51 A;  5HS9 A;  4IRG A;  2OZU A;  1LNW A;  2VC0 A;  1FYL A;  1D0X A;  4HQM A;  3HRS A;  1K78 A;  3DEU A;  4A3I J;  3RZO J;  1WQ2 A;  2DYS H;  3MWM A;  4OIO F;  3GTJ J;  5FKK A;  1VQ4 I;  1X19 A;  3K4M A;  2Y2Z A;  3LST A;  2W7N A;  2YUS A;  4LJZ F;  5GAD J;  5CVV A;  3CCL I;  5HNH A;  4L5I A;  4CCJ A;  2V4J C;  2LBF B;  3SEZ A;  2Y75 A;  2F5D A;  1KYZ A;  3AL0 C;  3LOC A;  3HM5 A;  5L3C A;  2YR2 A;  2E5N A;  2MG4 A;  2LY2 A;  4Y15 A;  4FQG A;  1N25 A;  4IL6 C;  2V6E A;  2NNY A;  2LLK A;  1K83 J;  2YS9 A;  4OIR F;  4HNU A;  3QPS A;  1TC3 C;  1T38 A;  1ETY A;  3KEO A;  3TOA A;  4IRH A;  3OS2 A;  4I99 C;  2IA2 A;  2E2I J;  2PMH A;  5KAF C;  2VOO A;  2MFZ A;  1WJA A;  2BE5 F;  2X1E A;  3ZGK A;  2K4B A;  2BBY A;  3MAJ A;  4I7H A;  2Z33 A;  3H92 A;  3OYF A;  1EH8 A;  1OYY A;  1ZHF A;  1XX5 A;  4UVA A;  2MA3 A;  1I6H J;  2M8E A;  4KN4 X;  3KIO A;  3JRA A;  2VUM J;  2A61 A;  2QLZ A;  2WB1 A;  4PSX A;  3U9G A;  4AIH A;  4LGW A;  3GWZ A;  3I9V 2;  2E1M C;  4QWQ A;  4XLE A;  3HRM A;  1XGN A;  5E3N A;  2X48 A;  4RLF A;  1E17 A;  4BY1 J;  1H8A C;  1R4N B;  2DFH A;  2M0C A;  3HKZ A;  2Z1D A;  4ENJ A;  2KHM A;  5JHU A;  4G6T B;  3ERM A;  2LNB A;  4FX0 A;  4GYI A;  4GFB A;  5KHD A;  4BEH A;  5A2Q Z;  2E1C A;  3S3N A;  2ME0 A;  3A0H C;  4I0A A;  5FJ8 J;  1P4A A;  1BC8 C;  1HW2 A;  2EFO A;  2KIF A;  2O7O A;  3WTT C;  1YRN B;  2KMU A;  3OL3 A;  1ACI A;  3S1R J;  4JX4 A;  4Z2Y A;  4E7K A;  2VT2 A;  4LK0 F;  2HDC A;  3FXJ A;  3RKQ A;  1USS A;  2M2E A;  4BS9 A;  2EZL A;  2FU4 A;  3CCE I;  2ZBK A;  5M3F J;  5EEG A;  2LY1 A;  1MJB A;  2L9N A;  1ZEL A;  3FXR A;  2A68 F;  3BP8 A;  4BNC A;  2KRH A;  3GTQ J;  1S5L C;  4IO9 F;  3ZPL A;  3F0C A;  2DPU A;  2VOP A;  2AXL A;  3Q3S A;  4ZTF A;  3UR3 C;  1VQL I;  1BBY A;  3ZMV A;  2M4G A;  3CCU I;  1IRX A;  4FT8 A;  2Y0M A;  3FK7 A;  3HC7 A;  2HU9 A;  3ZQC A;  3SXY A;  3F3X A;  1OYI A;  1G2H A;  1ON1 A;  1TTY A;  2Z5U A;  4KYW A;  4LG0 B;  3OYJ A;  1YQA A;  1UFM A;  3H3Z A;  1UG0 A;  5E3O A;  1GV2 A;  4FET A;  5E20 A;  4BQN A;  2CO5 A;  4P1W A;  2IGM A;  1UST A;  4M9Z A;  3DEW A;  1RIO H;  1GXP A;  3BR3 A;  1PP8 F;  3ZR8 X;  2GIV A;  5EJC A;  3S8P A;  1QRY A;  1JUP A;  2GOM A;  5HOO A;  3OYH A;  2J5P A;  2JPC A;  4C2T A;  4IJA A;  4PFO A;  3JCU C;  4J00 A;  1OR7 C;  4BJT A;  5E79 C;  1IGN A;  1D1C A;  2HWV A;  3CCS I;  4RAG A;  4LFU A;  3KZY A;  2FXA A;  3OIP A;  1SFE A;  4L0Y B;  4XMY A;  1QBJ A;  2NVQ J;  1QU3 A;  3NAR A;  3AG2 H;  4XQF A;  4IHW A;  4JX5 A;  1X1P A;  3GFL A;  2EQR A;  3N4M A;  3CDI A;  2D1V A;  1Z9C A;  2GA1 A;  3ZQH A;  3HDD A;  4G9Y A;  2OUM A;  4M6Y A;  5TIS C;  5HDK A;  3EQL F;  1ZR4 A;  3H5R A;  3NEU A;  3DBL B;  4O3M A;  5JHF A;  2IS4 A;  4QTR A;  4ETS A;  4IZZ A;  1X1C A;  4EEF G;  1BJZ A;  2A69 F;  5KAI C;  5GTI C;  3GCM A;  5FLX Z;  1MD0 A;  2NYX A;  3FM5 A;  5HDG A;  1D0Y A;  4XIC A;  2KPM A;  4UHT A;  4B09 A;  5F1J A;  3RI4 A;  2H27 A;  2DMT A;  3OWT A;  5F04 A;  2HPI A;  2VXD A;  3LFK A;  2H09 A;  2EFN A;  3K69 A;  1B72 A;  2DT6 A;  3ZMT A;  4J19 A;  4Q4Z F;  1R6R A;  2K27 A;  4RMN A;  5FKM A;  4UVB A;  4UUS B;  2LD5 A;  2ZO4 A;  1APL C;  3CC2 I;  3W6V A;  2VON A;  1T98 A;  5B1B H;  4XOT A;  3VB2 A;  1QZY A;  2VQH A;  1R9T J;  1U5T B;  1R1T A;  1ZLJ A;  2KJB A;  2QEN A;  5E1W A;  2E5Z A;  3ELK A;  2DOF A;  2QYO A;  5FFX A;  2EZH A;  4PUS A;  3ZN0 A;  3WGG A;  2BY0 A;  4JBA A;  5J1U A;  2PMZ N;  3ONQ A;  1QPI A;  3O2P E;  3I58 A;  3M8F A;  4ZJZ A;  1SMY F;  4MFE A;  2BY3 A;  3QOE A;  2IA0 A;  4P96 A;  5D4S A;  3HPH A;  4QIW N;  4J01 A;  4F92 B;  3ZRG A;  4D0P A;  4DW6 A;  2HQA A;  4PZJ A;  4RAY A;  1ZRF A;  2H1K A;  4UNO A;  3LFU A;  3H36 A;  4MO7 A;  1TWC J;  4ESJ A;  3E97 A;  2QZ8 A;  2L7M P;  1SAN A;  1FYK A;  4MQV A;  2PBI A;  3I64 A;  4UVC A;  2E1O A;  2A5W A;  4BJ5 C;  3AFH A;  4TV7 A;  1H9T A;  2Q2E A;  1YX5 A;  1OPC A;  3LSI A;  3M7G A;  3SZT A;  2LDU A;  4RM3 A;  3DTE A;  1DPU A;  1YJ9 I;  4RGR A;  4EM2 A;  1R58 A;  4M3D A;  4M3B A;  2L5Q A;  2E36 A;  1TT0 A;  4CYC B;  1VQP I;  1UAA A;  4WXD A;  1ZTR A;  4A6D A;  2R3S A;  1P7I A;  4HLY A;  4KMU X;  1ZN2 A;  2DYR H;  5EG0 A;  4G6D A;  3ISP A;  4S04 A;  2A07 F;  4WWC A;  1T95 A;  2ID6 A;  4A5M A;  3CUQ C;  3SQN A;  1GLN A;  2NVU B;  4MQ9 F;  1G3Y A;  2EA2 A;  1K78 B;  5FO5 A;  3TOB A;  1ONV A;  1XMA A;  2E7X A;  3ZN1 A;  4CZC A;  3L1P A;  5ILS A;  3G1O A;  1HKT A;  1FLI A;  4FE7 A;  1ENH A;  2KIS A;  4LMY A;  3DTI A;  2GM4 A;  1EKE A;  2Y48 A;  4O6J A;  3M4O J;  3F6O A;  2DA5 A;  4I09 A;  3TO7 A;  1FIP A;  2IP2 A;  3DKX A;  3QU6 A;  5AIP A;  3H0D A;  3OR2 C;  3OYM A;  3G4S I;  3M07 A;  3DBH B;  4H0E A;  4M74 A;  2HQR A;  2MBF A;  5E8I A;  1AKH A;  4N9I A;  2XSD C;  3GEZ A;  1I39 A;  1MND A;  4XLH A;  2DFF A;  4V2F A;  4A0Y A;  3QYF A;  3HB9 A;  4A3D J;  3VFZ A;  1AU7 A;  2JUC A;  5CLS A;  3FF5 A;  2KIU A;  3HXL A;  3M1C A;  2W00 A;  5LEJ A;  2QSF X;  4H4K C;  3BTI A;  1R1V A;  3G1M A;  3M9A A;  4PJ0 C;  1X4O A;  2PG4 A;  3CMM A;  5DV5 A;  1C0W A;  3MZY A;  4BGD A;  2FNP A;  2LBF A;  1I1G A;  2KT0 A;  5EYR A;  1NK2 P;  3WE3 A;  3BZ6 A;  2AXT C;  3OS1 A;  1FWZ A;  3WGI A;  3IV5 A;  2F2E A;  2BYV E;  1S72 I;  2WA0 A;  5LHG A;  2JQ7 A;  3IRR A;  2OJE D;  1FBQ A;  3P9C A;  1FOW A;  3CD6 I;  4ANJ A;  3CC4 I;  2FJ1 A;  4UUV A;  2HQ5 A;  3CF5 F;  3F9K A;  1FC3 A;  3L7W A;  3H0G J;  2O6G E;  3BR5 A;  3KLN A;  3F72 A;  1O3Q A;  2A05 A;  3I3L A;  4BEH B;  1R22 A;  4PK4 A;  1VQ7 I;  1ZGW A;  2EV5 A;  1IXR C;  4BBR J;  4IHT A;  1QHH D;  4U7D A;  3DV8 A;  1JXS A;  1G3S A;  2Q1Z B;  3KP6 A;  1AWC A;  4IX7 A;  4D1Q A;  1BR1 A;  5BPD A;  5B1A H;  2UXX A;  2GA2 A;  2W48 A;  3G6E I;  4LB5 A;  3K4K A;  4EGY A;  4JQF A;  1TW3 A;  1KON A;  2KZV A;  2XAS A;  5IP6 A;  2HVR A;  3OY9 A;  2ZNY A;  1YHQ I;  1S8N A;  3I53 A;  1YIO A;  4RB1 A;  3C3W A;  3QQA A;  4ZDL A;  1ZYR F;  2XRN A;  4XRS A;  3SFI A;  4KUM A;  2MLG A;  4Q48 A;  2ZC2 A;  5DM6 F;  2DFI A;  4ON0 A;  2JA8 J;  2KZG A;  2CW7 A;  2XGC A;  5FRM A;  4MTE A;  2KFD A;  2EZK A;  2IW5 A;  2R7R A;  1LFB A;  1SAX A;  4AVZ A;  2HOT A;  2ZFW A;  2HQN A;  4OMZ A;  2R7S A;  4P9U A;  2ZJR F;  3GFM A;  1MJ9 A;  1W0T A;  4G7O F;  5FKL A;  3S16 J;  4YIR X;  1WKM A;  3HSF A;  3K10 A;  4B1R A;  4CH7 A;  1S3J A;  2Z2S B;  1BA5 A;  3FIW A;  4O5V A;  3CF2 A;  2O0Y A;  3OYG A;  3FXK A;  3K4N A;  1VQM I;  1MZB A;  3A2K A;  2Z16 A;  3CDH A;  2GIZ A;  4BU2 A;  3BG3 A;  3DWL E;  1XSV A;  2EV0 A;  2NVX J;  4AD9 A;  3OYL A;  2UUZ A;  3MD2 A;  3AAF A;  1IN5 A;  2EWN A;  2LC2 A;  1TQP A;  1BI3 A;  2DFE A;  3D1N I;  5LHI A;  5F08 A;  2KQR A;  2FA5 A;  4MNU A;  2R5Y A;  2VIX A;  3H5N A;  2EFP A;  3QPL A;  4LG0 A;  4A3E J;  1S6L A;  4LK1 F;  4Y33 A;  3RJP A;  1X3W B;  3BT9 A;  1V5F A;  4HX7 A;  4ZYG A;  3F8F A;  2COB A;  2COM A;  2EH3 A;  4A3K J;  1ZG3 A;  1F9N A;  3M1E A;  1DU0 A;  1REP C;  3B6C A;  3ERE D;  2D45 A;  4V2G A;  3HOW J;  5C4X J;  2P6S A;  3LA2 A;  2WAQ N;  5CVI A;  1JJ6 C;  1WVR A;  2QQ9 A;  3IHU A;  3QWL A;  5K7Z A;  1IV8 A;  1ZRD A;  4XLN F;  4ABZ A;  3LSK A;  1Z3Y A;  1UMQ A;  3WOD F;  2FSW A;  3E6C C;  5EF6 A;  3CO6 C;  1I50 J;  2X85 A;  4ITV A;  4RGU A;  5FB2 A;  2DXI A;  3TQN A;  2L01 A;  2GXG A;  3DU6 A;  3EDP A;  4NBQ A;  1FX7 A;  2R7W A;  1LUJ B;  4CYD A;  5IY5 H;  4XRM A;  2EBI A;  3RKX A;  3K4L A;  5B66 C;  1NH3 A;  3T8T A;  3P5J A;  2XDV A;  3PQJ A;  2XF5 A;  1D8K A;  2AS5 F;  2NRA C;  3HOS A;  2CW0 F;  1SC7 A;  2B9S A;  3SJM A;  4LLL A;  1X1A A;  5LGU A;  2XVC A;  2MSY A;  2WBM A;  4UB6 C;  3TP3 A;  1YOV B;  2ESN A;  3W6J B;  4E6K G;  2X1C A;  5ILV A;  2DT5 A;  1U9O A;  2BY1 A;  1GVJ A;  1FIA A;  4KFC A;  1ZKG A;  2XAJ A;  5LHH A;  5ICE A;  4B4C A;  5LD2 C;  1YIT I;  2WY8 Q;  2LKS A;  1HW1 A;  2DU9 A;  4BE1 A;  4I98 B;  2L0K A;  1RUN A;  3PNV A;  1MNE A;  5D5W B;  1YW9 A;  2P8T A;  2QQB A;  1U0J A;  2HXO A;  4UUS A;  2HKX A;  4W97 A;  1R71 A;  1I6X A;  5F0H A;  2VT3 A;  5AON A;  3G71 I;  1MGT A;  1VTN C;  1U5T A;  1ZLK A;  3KPH A;  3OYD A;  1FNN A;  1BR4 A;  1Z6T A;  2CW8 A;  1FSE A;  4HPQ A;  3CMA I;  1IN8 A;  1KQ8 A;  1ZAO A;  4EJV A;  1KU3 A;  2VKE A;  3F8M A;  3ABT A;  5J40 A;  2HS5 A;  2M0M A;  3FZV A;  1MNM C;  3K4J A;  1F43 A;  4Y3O A;  5FKO A;  3R0A A;  1GVD A;  1R23 A;  2LH9 A;  3VYU B;  1T6S A;  3HOT A;  3MKL A;  3D5L A;  3WU2 C;  4BDY A;  4CCO A;  2HYJ A;  3PUF A;  1EJ9 A;  2L02 A;  3AG1 H;  2FBH A;  4GRI A;  2JK3 A;  1STZ A;  2CH0 A;  2K7L A;  3K1P A;  2P4W A;  5ICC A;  3BPV A;  4E7I A;  2BGC A;  3BR1 A;  1B6A A;  1MBG A;  4HG2 A;  4NC6 A;  1YG2 A;  5EG0 B;  3OV8 A;  5K7F A;  1IUY A;  4C3I J;  4EJO A;  4A12 A;  2BOL A;  1K79 A;  2L2O A;  3ZQG A;  2JSC A;  1J75 A;  2ZME C;  4A3L J;  3BG9 A;  3RPU D;  5GAE J;  4F7Z A;  2LR8 A;  4IRI A;  1D1A A;  2C6Y A;  2HR3 A;  3RCO A;  3JTH A;  1LDD A;  3RDI A;  2R7Q A;  3KFW X;  4E7S A;  2M8G X;  2X1D A;  3IH3 A;  1A5J A;  4Y52 J;  5IT3 A;  1E2X A;  4IHY A;  3BCA A;  1GV5 A;  1BL0 A;  1QPM A;  1U6G A;  2Y69 H;  4YFK F;  3ZP5 A;  4L18 B;  1Y0N A;  1X4P A;  1R00 A;  3H5A A;  3M8E A;  1FJL A;  2LP0 A;  2HTS A;  1QZE A;  2F6C A;  3G1L A;  4RB2 C;  5JI6 A;  1AKH B;  5IP9 J;  5IOZ A;  4I02 A;  3S14 J;  1DP7 P;  4PJL A;  2P5V A;  2JUG A;  4CCL A;  2VPL A;  4FE4 A;  3WTW C;  3A1Y A;  3GVA A;  3TBI A;  2CV2 A;  1MMA A;  4CCK A;  1OYW A;  2NVY J;  4X1E A;  3HJE A;  2F5C A;  2PX9 A;  3OL4 A;  4OMY A;  2VN2 A;  2FUG 2;  2K3F A;  4UY8 I;  3V7R A;  3SZG A;  3EUH C;  2MC4 A;  1FMW A;  3PNT A;  1E3H A;  2V1X A;  3O8G A;  3GFJ A;  2FQ3 A;  4ZDP A;  2QUF A;  5JLX A;  1HSJ A;  3G73 A;  3JW4 A;  2VOD A;  3CDL A;  1CQT A;  2TDX A;  5HDN A;  2P6T A;  4DGW B;  3IC7 A;  3F6V A;  3JRD A;  4LB6 B;  2IBD A;  3IH2 A;  3HSE A;  3CC7 I;  1WHU A;  2JJ7 A;  3UNG C;  4ESF A;  4M71 A;  3CES A;  1XGM A;  3BY6 A;  3I55 I;  3NRV A;  5KNL A;  3OYK A;  3B6A A;  3VYT B;  3OR1 C;  1U3E M;  3EYI A;  3CZ6 A;  4CHU A;  2UV1 A;  3QOD A;  2DW4 A;  4Q47 A;  2MGQ A;  2ZJ2 A;  1RR8 C;  3QPH A;  3VOD A;  4KJZ A;  1LDK B;  5EEH A;  1IXC A;  3TP0 A;  2FEZ A;  1I27 A;  2CQQ A;  2JSP A;  2NAZ A;  2XGX A;  3ESW B;  3QYB A;  5GTH C;  3BG5 A;  2OBP A;  1ZRC A;  2HKO A;  3JSO A;  4F3Q A;  4ZTJ A;  2BXZ A;  1HOM A;  2WY7 Q;  3GYH X;  3N97 A;  1OIS A;  5D5X B;  1HA8 A;  1DU6 A;  3ZXS A;  3F22 A;  3J81 K;  4BXX J;  3NWT A;  3I4P A;  1SFX A;  2GWR A;  2R7U A;  2V7F A;  3RQ4 A;  5J8F A;  2L7Z A;  3ABK H;  4RB0 A;  2ECB A;  3FHZ A;  4PCQ A;  1XSX A;  2MYS A;  3SDB A;  4BUP A;  2LK2 A;  3MVP A;  3K70 D;  3S2D J;  4B44 A;  4HST A;  1YJW I;  2FBI A;  3KE2 A;  1N75 A;  3HOX J;  1LE8 A;  4Y7N J;  3GTP J;  3GF2 A;  3GBG A;  2GXA A;  1O57 A;  2P7C B;  3KP4 A;  4DYC A;  3J7A O;  2FD5 A;  4XR6 A;  3GFI A;  3ASO H;  1VQ8 I;  5HS8 A;  1BIB A;  2A3S A;  3DBR B;  5HS7 A;  5K1Y A;  3KYL A;  3K4C A;  3RZD J;  3J80 Z;  1FTT A;  2HI3 A;  3ZMD A;  2ZXI A;  1BI0 A;  3DCF A;  2QSH X;  3HRT A;  3KLO A;  3CLQ A;  4NB5 A;  2IS2 A;  3WTS C;  3JRI A;  1JKO C;  1SD4 A;  1ZRE A;  2RN7 A;  1RET A;  2WAQ A;  1R5G A;  1Z91 A;  4EM0 B;  1EA3 A;  3FXO A;  4BL0 B;  4D5C A;  4ENN A; 
#chains in the Genus database with same CATH homology
 1V5G A;  2XSJ C;  2A5W A;  2ZFU A;  4XKV A;  3AFH A;  2RQQ A;  3OMY A;  4BJ5 C;  1YX5 A;  1YE9 A;  2VPL A;  3DQV C;  3LSI A;  4C9Y A;  3BCB A;  3G2B A;  2HVS A;  4RM3 A;  2O5R A;  3DTE A;  3IAM 2;  2IS1 A;  1D1B A;  4BQO A;  2L5Q A;  3AKZ A;  4BE2 A;  1TT0 A;  4DBQ A;  2KP6 A;  4EAT A;  1UAA A;  4RM2 A;  3D5R C;  4XLA A;  2LRE A;  3IAS 2;  4XKW A;  1SAU A;  4DBR A;  2ZXH A;  2IXS A;  2OV7 A;  2NOJ B;  1T95 A;  4D9J A;  2E60 A;  1OLT A;  2E1M B;  1GLN A;  3DLA A;  2QKM B;  4CZC A;  1N77 A;  2XF6 A;  4OWR B;  4XM3 A;  2DOA A;  2M7B A;  2V9K A;  2VQL A;  1T0F C;  3DTI A;  3PJR A;  1FMV A;  4HSR A;  1QHG A;  1TZL A;  3U21 A;  4FAS D;  2K3P A;  4II2 A;  4YRV A;  1D0Z A;  3DKX A;  3H0D A;  3OYB A;  3OR2 C;  4YEL A;  2K9M A;  2LYC A;  3OYM A;  3OIQ A;  2JVH A;  4NQW B;  3HG9 A;  4XL9 A;  4BAC A;  5HVQ C;  4XOP A;  1MND A;  3H35 A;  3S3O A;  4XLH A;  2R7X A;  3EPZ A;  3IP4 B;  3QYF A;  5HNF A;  3L2V A;  4XOR A;  4IQ4 A;  4CSW A;  3HXL A;  1YX3 A;  3M1C A;  2W00 A;  3K70 C;  4H4K C;  1DGW Y;  2BW3 B;  2RNG A;  2WAF A;  1X4O A;  3CMM A;  3H9J A;  3OYN A;  3HL2 A;  4BGD A;  2LBF A;  2VL8 A;  2M3A A;  3SEQ A;  3OS0 A;  5LFA A;  3QYE A;  3OS1 A;  2LG4 A;  2W1O A;  1BOB A;  2WA0 A;  4MLO A;  4XN3 A;  3L2W A;  4II3 A;  4ANJ A;  2BVM A;  4XKC A;  4BXF A;  4DOZ A;  1S9H A;  3F9K A;  3MKW B;  5HLT A;  4NC7 A;  4ZC3 A;  1SFK A;  3C2H A;  5CQG A;  2CV1 A;  4JOM A;  2GOX B;  3I3L A;  4BEH B;  4PK4 A;  4NUB A;  4ZYA A;  3BLY A;  3VDX A;  1MMN A;  3IUO A;  3LSH A;  3PSI A;  4KIT B;  1QHH D;  2ELJ A;  4PFP A;  1J09 A;  2Q1Z B;  4IX7 A;  3VWB A;  4D1Q A;  3BC8 A;  1BR1 A;  2IGO A;  4E7J A;  3K4K A;  4JQF A;  3CP8 A;  2VQG A;  1KON A;  2KRC A;  2HZD A;  2KZV A;  4OAZ A;  4X0G A;  2HVR A;  3OY9 A;  2DT7 B;  4E7L A;  3OYC A;  2XAU A;  3DPU A;  1Y56 A;  3KEY A;  4U87 A;  4IKF A;  4ZDL A;  3CJQ B;  3EUA A;  2K5C A;  2Q2E B;  2X6Y A;  2R4G A;  3K6G A;  2UWM A;  3LSG A;  4R79 A;  2CW7 A;  5FRM A;  2OC6 A;  2XF7 A;  2K9L A;  4P5O A;  3OOU A;  3ZQQ A;  4E7H A;  2HPM A;  2R7R A;  2JA2 A;  2R7O A;  4AVZ A;  5KCM A;  2R7S A;  3L2Q A;  3ZCO A;  2F5V A;  3H9G A;  2PJR A;  2VLA A;  2L7K A;  1W36 C;  3K10 A;  4CH7 A;  3C2G A;  4HRI A;  2V1N A;  2Z2S B;  3CF2 A;  3OYG A;  2KL4 A;  3W2W A;  3RSN A;  3W2A A;  3K4N A;  4OAY A;  3SYT A;  3A2K A;  2Z16 A;  4BU2 A;  4XON A;  4ZDO A;  4QPO A;  4XN0 A;  3S93 A;  3MKZ A;  3DWL E;  3LL7 A;  3LMM A;  4LIT A;  3OYL A;  2UUZ A;  2VJ4 A;  2V26 A;  2LC2 A;  2VJ5 A;  1PYV A;  2ZSH B;  3LSM A;  3MD2 A;  4XKB A;  1WJ5 A;  3TMO A;  4HNT A;  4XLC A;  2KQR A;  3VYR B;  4YEJ A;  2VIX A;  3H5N A;  1WJE A;  2CFO A;  3NWS A;  4Y33 A;  2X51 A;  1V5F A;  1WJD A;  3BG6 A;  2AQE A;  1Y6I A;  1D0X A;  3HUG B;  3K4B A;  3CP2 A;  4IQJ A;  1X19 A;  3K4M A;  2VQC A;  3PUB A;  2W7N A;  3LSK A;  2IGN A;  1Z3Y A;  5HNH A;  4NNJ A;  2X85 A;  1ERD A;  4CCJ A;  2V4J C;  4ITV A;  2LBF B;  3SEZ A;  4F55 A;  1JI8 A;  3VYS B;  2DXI A;  2MAB A;  4BDZ A;  3DU6 A;  3AL0 C;  4BE0 A;  2R7W A;  1N78 A;  2E5N A;  2LY2 A;  3K4L A;  2V6E A;  4B43 A;  2IS6 A;  2XDV A;  2VB6 A;  2XF5 A;  2VAS A;  3E0J B;  3HOS A;  3FHN A;  4LIV A;  5TGT A;  4HNU A;  1W36 D;  1X1A A;  3OS2 A;  2WBM A;  2DJI A;  4U7B A;  1DP3 A;  4E6K G;  2MFZ A;  2X1C A;  1WJA A;  2HVQ A;  1NG7 A;  2X1E A;  4E7Z A;  4KT6 A;  3ZGK A;  1WFX A;  5LD2 C;  3OYF A;  2WY8 Q;  4LG3 A;  4BE1 A;  5FRN A;  3PNV A;  1MNE A;  3DKY A;  2WAD A;  3BG7 A;  4F52 A;  2VXZ A;  2WB1 A;  4PSX A;  5FRO A;  3FBN B;  3I9V 2;  2E1M C;  4XLE A;  1UEL B;  1U0J A;  4RLF A;  3HKZ A;  2MD0 A;  2Z1D A;  2KHM A;  4G6T B;  4KIS A;  5KHD A;  4BEH A;  3OYD A;  2Y0S A;  4HEA 2;  1BR4 A;  4BQQ A;  3S3N A;  2CW8 A;  4HPQ A;  3DU5 A;  2X6W A;  1G8X A;  3S3M A;  2R7V A;  2XC7 A;  4C30 A;  2M0M A;  3K4J A;  2KMU A;  3OL3 A;  4Y3O A;  3VYU B;  3HOT A;  2LH9 A;  2VJI A;  2KLO A;  4E7K A;  3S32 A;  3D5L A;  2VKD A;  4BDY A;  4CCO A;  4PSW A;  4LIU A;  2CV0 A;  4GRI A;  4AU7 A;  4BS9 A;  2CH0 A;  2AQF A;  3W2V A;  2PJR B;  4B3X A;  2WAE A;  3D5S C;  2LY1 A;  4E7I A;  3PSF A;  1LVK A;  1ZEL A;  2L9N A;  4HG2 A;  3VSK A;  2KRH A;  2M7A A;  4NC8 A;  1V5E A;  2BOL A;  2L2O A;  2X6X A;  3FBI B;  5CPR B;  4ZTF A;  3RPU D;  3UR3 C;  2LRD A;  2M4G A;  2W82 A;  1IRX A;  4DIQ A;  1D1A A;  3RCO A;  2W4S A;  2R7Q A;  5CQE A;  2I8D A;  4E7S A;  4PJN A;  3V42 A;  2X1D A;  3HC7 A;  1X1B A;  2HU9 A;  2HNH A;  3OYA A;  2QKL B;  1Z21 A;  1LKX A;  3DTK A;  3N05 A;  5CKT A;  3BCA A;  2A6T A;  1WJB A;  3L2R A;  3OYJ A;  1UG0 A;  1X4P A;  4FET A;  3H5A A;  4BQN A;  4P1W A;  2IGM A;  2F6C A;  4F91 B;  3PL8 A;  1K6Y A;  2CS3 A;  4CA0 A;  3ZR8 X;  1PJR A;  4PJL A;  1E0E A;  2JUG A;  3S8P A;  4CCL A;  1DQU A;  2CUJ A;  2PMZ A;  3DPT A;  2GOM A;  3A1Y A;  3TBI A;  5HOO A;  3OYH A;  2VKH A;  2CV2 A;  3J7A Y;  2KDO A;  4C2T A;  1MMA A;  2R7T A;  4PFO A;  4CCK A;  3DPL C;  4J00 A;  1OR7 C;  1Z7L A;  3DEE A;  3HPG A;  1DGR M;  4BJT A;  4BJ6 C;  3OL4 A;  1MW7 A;  4PJM A;  1D1C A;  2FUG 2;  3SZG A;  3EUH C;  2MC4 A;  1FMW A;  3PNT A;  4ZDP A;  3OIP A;  3M8J A;  1VZ0 A;  4XMY A;  1QU3 A;  2VJJ A;  4N4N B;  4E4H A;  4XQF A;  4DGW B;  2CUZ A;  1G59 A;  4QPQ A;  2RRE A;  1WJF A;  2CMP A;  2HDW A;  2LOO A;  2F4I A;  3UNG C;  2OUM A;  1AA7 A;  3CJR B;  3CES A;  3H5R A;  5KNL A;  3OYE A;  3FKJ A;  3OYK A;  2IGK A;  3OR1 C;  3VYT B;  5JHF A;  2BW3 A;  3CZ6 A;  2IS4 A;  2UV1 A;  3QOD A;  4RLQ A;  2L9S A;  4IZZ A;  3RTR A;  3H9Q A;  4XLF A;  4DJA A;  4KJZ A;  1LDK B;  1X1C A;  4N4O B;  4F93 B;  2JSP A;  3QYB A;  2BVL A;  1D0Y A;  2KPM A;  1MMG A;  3EUK L;  3OWT A;  2HPI A;  2VXD A;  4F3Q A;  4ZTJ A;  2WY7 Q;  4AYB A;  3FDY A;  2DT6 A;  1HA8 A;  1R6R A;  3ZXS A;  4RMN A;  3NWT A;  2R7U A;  2V7F A;  2ZSI B;  4XNF A;  3RQ4 A;  2JVG A;  2P0W A;  1BR2 A;  4XOT A;  4CUG A;  2VQH A;  3MMY B;  2M4K A;  3TL4 X;  2MYS A;  3SDB A;  2E5Z A;  4BUP A;  4CCN A;  3K70 D;  4B44 A;  4HST A;  3PFY A;  1N75 A;  4Y4R A;  3L2U A;  4PUS A;  4CCM A;  3PNY A;  4B48 A;  3GBG A;  1P9Q C;  1WJC A;  4C2U A;  3ONQ A;  1NG6 A;  3E1S A;  4XR6 A;  1Z3X A;  1LFP A;  2DCE A;  4ZJZ A;  3QOE A;  3KYL A;  3K4C A;  4PJJ A;  2ZXI A;  3HPH A;  3MKY B;  3A4C A;  2IS2 A;  4J01 A;  4B47 A;  4F92 B;  3ZRG A;  2WAQ A;  2HQA A;  3AL0 B;  1EA3 A;  4BL0 B;  1X1D A;  3LFU A;  3W3C A;  3KX2 A;  3OYI A;  1MMD A;  3VSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...