2OC6A

Crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
GMDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords YdhG protein
publication title Crystal structure of hypothetical protein (NP_388456.1) from Bacillus subtilis at 1.75 A resolution
rcsb
source organism Bacillus subtilis
total genus 35
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oc6A01
2I8DA 2OC6A 2KL4A
chains in the Genus database with same CATH superfamily
4PUSA 4AYBN 3C1DA 3FXLA 1YO5C 1U8RA 4X0GA 1TQMA 2XRNA 4FQGA 2CV2A 1ZG1A 1CQTA 1FBSA 3HEFA 2V79A 5B66C 2CS3A 4LIUA 4BY1J 5EYRA 1WHUA 2ZJQF 1I6HJ 4XICA 2OUMA 3E6BA 2HU9A 3H5AA 1FPQA 4RM3A 3ULQB 1P7JA 2EH3A 2KQRA 4ENNA 5CVRA 5H20A 2W1OA 1MSEC 1IF1A 1T8IA 2LSOA 4CGZA 5FLMJ 4A0YA 4E70A 2HS5A 4U87A 1KGSA 4IF4A 2CW7A 3K70D 1JTYA 5DM7F 3LAJA 3VWBA 2QKMB 4IQJA 1OCOH 2NNYA 3EQLF 1I5ZA 1A31A 1D1BA 2QSGX 4B47A 5L3CA 3WHCA 4NC8A 1SD5A 3TW6A 2NS7A 4L5JA 2N8GA 4HX8A 4AIDA 5IP6A 4LMYA 4HRIA 2IGOA 2XGCA 3CTAA 4BY7J 1UG0A 5HS9A 3P5JA 2EB7A 4CCJA 2BGCA 3LA3A 4LITA 5IOZA 1UB9A 4HEA2 3ZQFA 5JVTA 3U9GA 1XGOA 2A05A 2DFHA 4U0WA 5BNGA 1OCPA 5CVIA 4XIDA 2X51A 4NQWB 1JUPA 2OQRA 1FSEA 4ESFA 1WVRA 3K2AA 4H4KC 4P9FA 2IRFG 3ZMUA 5DV5A 3J81Z 1WRJA 2H27A 2VKHA 5H6RA 2HQAA 1YIOA 5D8KB 1IZ1A 4D1QA 1KU9A 2VJ4A 2MGQA 1ZGAA 5LEKA 2HDDA 3ZPLA 4A2UA 1N25A 4Y52J 2PG4A 2VKEA 3TQNA 3W6JB 2ZC2A 2ZXWH 4LFUA 2YX7A 2L2OA 2PX9A 2AHQA 2QSHX 2E1OA 4HV5A 3MKLA 3QPHA 3LFUA 2R7OA 5A2QK 4BEHA 3LQRA 3ZOBA 3FM5A 1GVDA 5AIPA 3I59B 4A0ZA 3LSKA 2OF7A 2E2JJ 2E1MC 3HDDA 1R58A 4M3BA 5HLIA 4L0YB 1U78A 3OYEA 3DEUA 4GCVA 3CDLA 4J19A 4M72A 3BCBA 2BE5F 3M1CA 4A3IJ 3M07A 3F3XA 5HLHA 2QENA 4BQQA 1MJAA 1MJ9A 2FNAA 2MLKA 5D5UB 3PUFA 2GZWA 3R61A 3V8JA 4S05A 5LBQA 1HC8A 2QCOA 5J4VA 3Q3SA 4GRIA 4RGUA 3BTLA 2LD5A 5D8LB 1P4WA 1WJDA 2E60A 2UXXA 1J9IA 2R7ZJ 4RAGA 3ECOA 4BNCA 4OIOF 1V4RA 5CVVA 9ANTA 1NG7A 4ZZDA 2O7OA 1ZELA 5J8CA 2QEXI 4XKVA 2A6HF 1U2WA 2XB5A 3CZ6A 4RAZA 3S3MA 3NQOA 4UB6C 4B3AA 1DU0A 4DW6A 5EEGA 4LLLA 1FT9A 3MZHA 4JYKA 1K79A 2JJ7A 1IN5A 4KIGA 1JHFA 1TP4A 2K27A 1MDMB 2DA5A 3W6VA 4XRFA 2HYGD 4XN3A 2PN6A 1BC8C 1Y1WJ 4Q5SF 4UUVA 4AVZA 3O8GA 1MDMA 3CMYA 2VJ5A 2VBYA 2Q0OA 4YEJA 3I0TA 3V7CA 1D1CA 1CF7A 3NRVA 4DBRA 5D6EA 3L2WA 1BI3A 5DDGA 5H2FC 3MFKA 3F23A 1R5HA 2DBBA 3UNGC 1TW2A 1JKQC 2FSWA 4ESBA 4F91B 2GXAA 1QU3A 2HWVA 3BG9A 1HSJA 1YX3A 2IBDA 2OCCH 3PFIA 5DCFA 4L5EA 2HOAA 1B6AA 1WI3A 1RR7A 3QODA 2R7WA 1HBXG 5H6QA 2NVYJ 4IJAA 1K4TA 1EV7A 4QTRA 2R3SA 3DF8A 3LOCA 2XGEA 2D45A 3REOA 3NWSA 2LR8A 3T1BA 4XR6A 1U8BA 1V5EA 3OOPA 5K5RA 1PP8F 2Z9OA 2HXOA 5DUKA 2XPWA 2JUGA 1WJEA 4IRHA 4ZH4F 4E7JA 3A01B 4B4CA 2R7UA 5FGMA 1JGSA 2K9QA 2JMWA 2KISA 3PFYA 1TLHB 2K9MA 2RC4A 1HW1A 3HG9A 4XKBA 4DYQA 3A01A 4DZPA 1OCTC 3ZCOA 3HGGA 3B6CA 3K10A 3LSIA 5CLSA 5EZHA 2MFZA 1R6RA 1G2HA 1DGRM 1TTYA 1X1AA 4IHXA 2KRCA 3Q5FA 1RKWA 4CICA 3K1NA 2KJCA 1JI8A 2P7VB 2VBWA 2FU4A 1YITI 3FBNB 2IT0A 3AL0B 2GOXB 3KX2A 1XCBA 4IRIA 3Q9SA 2BVLA 4HYEA 2VT3A 3GTLJ 1MBFA 3KZZA 3CO6C 3ZMDA 2L4AA 2JUCA 2BY1A 2DYSH 2PMZA 2L54A 1UFMA 5DCMB 4A3MJ 2L9VA 1D0XA 3HOWJ 1MIJA 4A3DJ 2HTJA 2X6XA 3GTKJ 4KJZA 2KZGA 1KZHA 1FOYA 4RAYA 5DCMA 2HI3A 5CJ9A 2K02A 4E7LA 2JZYA 1MSFC 2K3FA 3G73A 2VASA 2A07F 4PSXA 2X6WA 2Y9YA 4RBOA 5LEJA 4RM2A 3WGGA 2GXGA 3N97A 3DEWA 5DD4A 4BQAA 5BQTA 2JQ7A 4N4OB 3S2WA 4L9JA 4NNJA 4S04A 3EYIA 1O3QA 1E3HA 2CO5A 2L7KA 3V7RA 5FB2A 4U7DA 4BXXJ 3AG1H 3C2GA 4E7HA 4LG0A 1A6IA 2WV0A 1ZAOA 2EA2A 2H09A 2M87A 4BL0B 4AM3A 1HSTA 2FQ3A 2ZMEA 2F48A 2P8TA 4XLFA 1SFOJ 2JA7J 1OISA 4Y15A 1EKEA 2JSCA 2HQRA 4IX7A 3IL2A 1R4MB 3QAHA 4EJWA 5DS9A 4I99C 4XL9A 1XSDA 3GF2A 1B72A 2IS4A 2ZNYA 3M8EA 4I98B 4UUTA 2VBZA 4C9YA 2I5UA 2ZXJA 1E17A 5GTHC 1SD6A 4RB0A 2PBIA 3KZYA 4ETSA 2Q8KA 1G59A 3DTKA 5JLXA 1ZRCA 5EG0B 2LMDA 2VL8A 3KP4A 3D1NI 4A6EA 1BIBA 3P9IA 3A1YA 1BJZA 2TDXA 4YIFA 5IP9J 2KDZA 1OCCH 5EG0A 2BXZA 4XONA 2QGUA 3GTOJ 5JHUA 4HDVA 5LGUA 3GFJA 5J1UA 2NVTJ 5FD6A 4W1UA 5FKLA 5D5XB 3DPTA 4Y33A 2VJJA 4KICA 1SEUA 1ITYA 1S29A 2PMZN 2Y0MA 2JK3A 3CC7I 3V7SA 2HXIA 2QQ8A 1V5FA 3DBHB 4U0VA 2MH9A 2FNPA 4M9ZA 4XN0A 1R22A 1JKRC 3IAS2 3FXKA 2EILH 1ZRDA 5L3EA 4CZZA 4IO9F 4N0BA 5F6FA 3A02A 4UVBA 2WB1A 4ITVA 1HKTA 2VLAA 3RPUD 3KZIC 5BOXA 4ZYHA 2E19A 2LG4A 2Z99A 2GOMA 4OINF 5FJ8J 2H6CA 2ZB9A 3I3LA 1QZEA 4F93B 1X1PA 2DOEA 3GXOA 5F0HA 1MJBA 2VIXA 4M6VA 3ABMH 1YJWI 3SXYA 1G6NA 2R93J 2COBA 2V1XA 3QYEA 4G7OF 2XASA 2D1VA 4XMYA 3S1RJ 3R60A 2IEKA 1V5GA 3VEPA 3QOPA 3CLOA 3KETA 1W7PB 2MH2A 1KQ8A 4WXCA 1OYWA 5F27A 2FMYA 4Y17A 1ZLKA 3AL0C 3W2VA 1WFXA 1DP3A 2IA2A 3WE2A 3WTXC 3V4GA 1DU6A 5FKOA 3CDIA 3RKWA 2HOSA 2FBHA 3BR1A 2WAQA 5D5WB 1MNDA 3OIQA 3S15J 3ISPA 1JGGA 2F5FA 3TO6A 1SFUA 1UJ8A 3H5NA 4GYGA 2M7BA 5ICFA 2DMTA 3HC7A 3KYLA 3MD2A 2M30A 5FROA 1IN8A 3UKGA 3A4CA 1MNMC 4ABZA 1Z3YA 3BTIA 2DK8A 1ETOA 4KIBA 2IGKA 2BHYA 3U2RA 2ISZA 4IZZA 3H0DA 4L0ZB 1P92A 2M4GA 4MGRA 3DTEA 2E71A 3FWEA 3CC4I 2A5YB 3TBIA 3K4CA 5ILSA 2DPUA 4RLFA 4B43A 2JA5J 4Z2YA 2O0YA 2I10A 4H0EA 1IN7A 1FSHA 2YUSA 1H9TA 3G6EI 2LVSA 3EUHA 3G1MA 3JR9A 1IRGA 3RDIA 2DTZA 1U9OA 2ZMEC 1MBEA 2K3PA 3K2ZA 2QQAA 1YFHA 3BDDA 2F5EA 3BR2A 1Y8QB 4R8HA 1QNTA 3SYTA 4L9VA 2LY2A 2WB1N 4BDYA 5FRNA 5JFRA 1RC9A 3DKXA 1R9TJ 3KYCB 2HPMA 4XRSG 4G7HF 5J40A 2NXNB 3G2BA 1K78A 1BW5A 3MEXA 3OYFA 3RI4A 3J80K 1UAAA 3CCLI 1YIJI 1IG7A 3DU5A 1MGTA 1CGPA 1JE8A 3BWGA 5GTIC 4A3BJ 3KLOA 3S3NA 2GAUA 3QQAA 2PMHA 2XKPA 4PGHA 4A3KJ 2HGCA 1FEXA 2LDUA 3V42A 5ED4A 1ZH5A 1Z05A 2CWEA 3L2UA 2DPDA 2ELKA 5K7ZA 4XLEA 1BR1A 3QU6A 2HTSA 1FTTA 3I5UA 1FYLA 4PFOA 3G71I 4ENMA 2JTVA 1GDTA 2MD5A 2V1DA 2WWYA 2Y2ZA 2QM3A 3CCSI 2FF4A 4CYCA 2F4MB 3DPLC 2XSJC 1D1AA 1O7LA 4KNYA 5KAIC 4BE2A 4FETA 2K9LA 1XCVA 2LP0A 4U88A 1T2KA 3GWZA 1J59A 4D0PA 3Q0UA 2NYXA 4Y4RA 4A3JJ 4YG2F 4BAYA 2DA7A 2K5CA 3HYIA 2L7ZA 5M3FJ 4UY8I 3GZ5A 3BJAA 3TW7A 2IXSA 3JREA 2OD5A 4DQ2A 3ZQQA 5K7HA 1XDUA 5ICCA 4D7NA 4Q4ZF 2BV6A 4J00A 2KIMA 2QQBA 4EQQA 2CFOA 4KT5C 4RGXA 2LBFB 4HSRA 5J6XA 3DWLE 1OCZH 3HGYA 5F1RA 2JPCA 2ZO4A 1VQ7I 1A36A 1FOKA 1Z9CA 1OJLA 3OIPA 5E8IA 4UVAA 2R7XA 1IUYA 3NARA 3ERED 3HHHA 2DDAA 2MSYA 4B1RA 1J75A 1MBKA 4DIQA 3RYPA 4HV6A 2RVCA 4E7SA 4E7ZA 4OU0A 3HOYJ 3S32A 3M9AA 1AA7A 2DAOA 5FFZA 3RPUA 3WTYC 1X2NA 3EYYA 3KLNA 2XHKA 4E6KG 4MIMA 1VQ6I 4OIPF 2MW8A 2WADA 3LSJA 3K1MA 3IH3A 5M5XJ 1Z3XA 2OU2A 3HSFA 2DXIA 3B73A 2V1NA 2ZJRF 1R5GA 3JSOA 2W24A 1SFXA 3HIFA 2KRHA 3HXLA 4OOIA 4OAYA 2LRDA 3PNVA 3NEUA 1BR4A 5IP7J 1R23A 3RKYA 3EETA 3A03A 4BHBA 5C4JJ 4XSZF 2BBYA 2LF7A 1XN7A 2VQHA 1GHCA 4V2GA 1YYVA 4PCQA 2IS1A 3OYJA 4I0AA 3EUHC 1Z21A 2RV8A 2VPRA 1MD0A 4HQMA 4JBAA 2M9HA 4DYCA 1TL8A 2NVXJ 1WZ2A 2Z5UA 4F3QA 4YFNF 1FX7A 3I58A 3KP7A 3TP3A 4X6AJ 4HX4A 1YRNA 1QPMA 2ZSHB 3BG7A 3UR3C 4ZC3A 1FP2A 1P4XA 1ZK8A 2CQ7A 2CRGA 3PSIA 3JRFA 2JN6A 5BPIA 1XPXA 3FHNA 2CUZA 3KEQA 3VDXA 1T56A 4XSXF 1PYVA 5J1YA 1TZLA 1ETWA 4KN4X 3CJNA 3HB9A 2QLZA 2TRTA 2CQNA 2YPRA 4F92B 2EFOA 2HDCA 1W0UA 3OYDA 3HSEA 3HZJA 4BKXA 1LDKB 2F5DA 4FT8A 1HDDC 3OYGA 3S1NJ 2Z16A 4XOTA 1E0EA 2M5WA 2E34A 1DP7P 3IHUA 3VYRB 3OOUA 1ZG5A 3MQ0A 2LC2A 4A3CJ 1TWAJ 5M5YJ 2QBYB 4BGDA 2HDWA 3OS2A 1X1DA 3J7ZI 2B0LA 2WAFA 3I4NJ 4ON0A 1MMDA 2E36A 2KLOA 3CUQC 3BP8A 3GTPJ 2B7EA 1IXSB 2KHMA 1ZR4A 2JSPA 1ZARA 2IP2A 2LKXA 2ISYA 2KPMA 3U1KA 3HL2A 2UXNA 3MMYB 5CKTA 1R4NB 2F2EA 2KJBA 2GBYA 5C3EJ 2VE8A 3FK7A 3MKWB 4II3A 1MZBA 3G1OA 2QZ8A 1V55H 3M8JA 3S2HJ 1EH8A 4D9JA 1IRXA 2DK5A 2OPTA 4G9YA 5FD5A 3KCCA 1W1WE 2EV0A 3BLYA 5HLGA 3CCRI 1LEAA 1TT0A 3VSKA 1AHDP 1BR2A 1EH6A 1F9NA 2XKOA 1B59A 2LKSA 3CQZJ 1HF0A 3WU0A 1TQIA 1HDPA 2HNHA 1H0MA 1WQ2A 1LDDA 4BYYA 1LB2A 4M6XA 1APLC 4NQWA 5E1ZB 1DPRA 2R7DA 1F5TA 2EFWA 4G94A 2O8KA 3AG2H 3K0LA 3JAMZ 4O3MA 1UHWA 2DMPA 3PO2J 2QSFX 1FC3A 1VTNC 2B9SA 3E5UA 1B9MA 4O6JA 3WTWC 2YSRA 1RETA 4YFKF 4C30A 2P5VA 5GPAA 4BU2A 4XLAA 1ONVA 2XPVA 1QBJA 1Y6IA 2X9DA 3H9QA 3LL7A 2DTRA 3GFIA 1QVTA 1VF9A 1H89C 3D5SC 3K4MA 4JOMA 4QLCU 2AQEA 2WC2A 2OZ6A 1Y56A 1Z1DA 3F8FA 3BQYA 3WGIA 3P7NA 1W5SA 3L2VA 2EFQA 1FOWA 3BJOA 3TP0A 2Y48A 4IXAA 2FXAA 3I59A 1ERDA 2VC0A 3J7AO 2EV5A 4NC7A 2R7RA 1A5JA 4MEYF 2YU3A 5CPRB 1F1ZA 2FBIA 3C2BA 2RAEA 4UV8A 4DGWB 3GTQJ 1GUUA 3KP5A 1KQ0A 1YE9A 1Z7LA 1Z6TA 4GGGA 4A5NA 4XBFA 2LF8A 5D4SA 3DFGA 5HNFA 3QWLA 2UWMA 3CCMI 4RDUA 3H1CA 3KP3A 3RKXA 5JLWA 5FLXZ 2Z1DA 2G7UA 1A6QA 4GXOA 2XIGA 3CCJI 4M9SA 3COAC 3F22A 2VE9A 3IH4A 4DZJA 1ODDA 1IUFA 2YS9A 1B8IB 4RLQA 1LPQA 4G6TB 2FD5A 3CLQA 5DYMA 4UUSB 3R0JA 2J5OA 4MTDA 3PQJA 2L02A 2M8EA 1S7AA 4HQEA 1ETXA 2PMUA 1B8IA 5E3MA 3HUGB 5L3GA 1KYZA 1ZGWA 2QA4I 1FP1D 1VI0A 2LFBA 4A12A 1EH7A 4G12A 2VPLA 1R7JA 1YLFA 3KEYA 3CCYA 3HUGA 1ZYRF 1QQIA 4BJ5C 4KA4A 2NRAC 3BCAA 1SC7A 1Z91A 3GZ6A 4BBSJ 4ZTFA 5LD2C 3T8TA 1ON1A 1OPCA 5F1JA 4KN7X 2HR3A 3PSFA 3ZQHA 2L4MA 3OS1A 2L7FP 5B3SH 2LYCA 3HOTA 2AO9A 1QHHD 3ECHA 3SZPA 1A04A 1NK3P 3BG6A 2NS8A 1YOVB 1VQ4I 5TJJA 1RRJA 1I3AA 2FJ1A 3LNQA 1U5TB 3OSGA 4AUXA 5BPDA 5L3DA 2Y9ZA 3BZ6A 3FXJA 4HLXA 2GA2A 4G6QA 3W3CA 1V54H 3ERMA 2ZXHA 2IGMA 5D4RA 3ONQA 1XMAA 3TEDA 4QWQA 3BR5A 4BHCA 3CESA 4EGZA 1G3YA 5HODA 4LG3A 4EMSA 4RB2C 4KDPA 3DXJF 1ZTRA 4HG2A 4UNOA 2A6EF 3BTJA 2JRMA 2EJRA 2CG4A 3H3ZA 2JPBA 3S16J 1W7PD 2CH0A 1G3SA 1RR8C 5HS7A 4CCOA 1I50J 4JK1X 2X0LA 1NH3A 1GV5A 4P5OA 3IC7A 4JP0A 4QIWN 1IDYA 4PSWA 4PJJA 1LFBA 1PVEA 1MH4A 1KYWA 2RKHA 4CHUA 4IOAF 3HOVJ 2CFXA 3LSHA 2P7CB 4XKCA 3DBRB 3Q0VA 3AG3H 4KYWA 2Q2EB 3OR1C 2W85A 1FOXA 4Z6YA 1TNSA 3TMOA 1IN6A 5FKKA 4AVPA 4B09A 3LMMA 1O3SA 2Q2EA 1L0OC 3L2CA 1WCMJ 3DLAA 3K4JA 3WU2C 4JX4A 2DA6A 3E6MA 2M0MA 2Z33A 2HOTA 2R7TA 3PJRA 5E3OA 2QVOA 3MAJA 1DPUA 3I64A 4BH9A 4AIHA 4ENJA 3HTUA 2IW5A 1N77A 1ZR2A 1YTYA 1RESA 1F36A 1P9QC 1X3WB 3DPUA 3A0HC 4MNUA 3V8KA 2BVMA 4IVNA 2VJIA 4YIRX 3N05A 2H1KA 4FHTA 2O6GE 2CQXA 4BE1A 5JVGF 5E79C 3FXOA 2E7XA 2DT6A 2VXZA 2COMA 2H8RA 2KP6A 3HKZN 5HNHA 1KU2A 1NG6A 2CMPA 3LAPA 3IH2A 5J47A 4M6YA 3RKQA 2GIZA 1EA3A 1R00A 1FY7A 3CMMA 1HW5A 4XM3A 2XDVA 3HBLA 2BYVE 4WCGA 1S72I 3RSNA 1X4OA 1LVKA 4P96A 3AKZA 3T0YA 2VB6A 2DCEA 1FBQA 4HF1A 4Y13A 1G4DA 2HQNA 3T5XA 1D8JA 2XAGA 1BOBA 3GLXA 5IPAA 3J81K 3ZMZA 4ZYGA 5D5VB 3ABKH 3RYRA 2XROA 1WWXA 1U0JA 4I09A 2XF5A 3BR3A 4M3DA 2GA1A 1FZPB 5DTDA 3O2PE 4LB6B 1B4AA 3EDPA 2K9SA 1PP7U 1XSVA 2EZHA 4AD9A 1AKHB 1Q1VA 3C2HA 5LLQA 1DDNA 4I6ZA 5F0FA 4X1EA 2XAUA 2J5PA 1A35A 4P9UA 5KCMA 1AKHA 4OMYA 4LB5A 3RZOJ 4BXFA 5DD8A 3WGHA 1LFPA 2CU7A 1X1BA 4PJMA 4HLYA 1F43A 2IGNA 4WXHA 3JTGA 3IWZA 4BQOA 1D5YA 1D3YA 2XAQA 1OR7A 4XKWA 1ETYA 2M0CA 3GEZA 4GDFA 2EFPA 1H8AC 3S17J 2EA4A 1XTAA 1W36D 3H92A 2LY1A 2BY3A 1BW6A 3F6OA 3LSRA 1XMKA 2EINH 4CSWA 1ON2A 1MMAA 2WA0A 1X3ZB 2CV0A 3BQZA 4IPAA 3SHFA 3K70C 2Q1ZB 2IS2A 1IJWC 3KFWX 3IWFA 3KP2A 3H0GJ 3P9KA 3RJPA 3WG7H 3CP8A 3NAUA 3BG3A 1I6XA 3E97A 3GTJJ 2E2HJ 1UHMA 1LKXA 3HOUJ 1VQMI 2M1BA 3F8MA 4EV0A 3WTSC 4FISA 5E18F 1XGMA 2PI0A 4BJ6C 1OQYA 3C3WA 1K83J 1S8NA 5HS8A 3H5RA 2HKXA 4MFEA 2HPIA 3BR6A 2ECBA 2VUMJ 1STZA 4DOZA 3SEQA 1YS7A 4XNFA 4ZZLA 3M1EA 4V19K 5EDNA 2XAHA 4JX5A 4MQ9F 1X1CA 2JRTA 1R36A 1YW9A 2ADUA 1FMVA 3FMQA 4CH7A 1RPWA 2AQFA 3GUDA 2V9PA 3K4BA 3MVPA 4G8XA 4IHYA 4MHGA 2HFHA 2ID3A 3RZDJ 2F5VA 2P6TA 3HOSA 2R0QC 1W7PA 2CJJA 2K85A 4IHSA 2QUFA 4IRGA 2DLLA 2IS6A 1YHQI 1OCRH 4IEJA 3BROA 2STTA 4JQFA 1TQPA 1JHHA 2W57A 1SFKA 2C6YA 2BXYA 1XGSA 3JW4A 1T98A 1DGWY 1GLNA 4LOCA 2W25A 1MH3A 1G3TA 2PQ8A 4IKFA 5TRDA 4NUBA 3OWTA 1BL0A 4EATA 4KIFA 4PK4A 2FQ4A 2JVGA 3E1SA 2VT2A 4KMUX 3L09A 3RCOA 1RI7A 1VQOI 3HPGA 2FOWA 2CGPA 3ZQCA 1P4AA 3CCQI 2E2IJ 4XK4A 5C44J 2ZBKA 4IOCF 2LY9A 4Q47A 4NBQA 5FRMA 3ZMSA 1GVJA 1VQ9I 2P5LC 1N78A 2M4KA 3IUOA 2JA8J 5D6FA 3R0AA 5L3BA 1XC5A 3PM1A 2IA1A 2JA2A 5E3LA 4LGWA 3CMEI 4I7HA 3GBGA 4NB5A 3F0CA 2X85A 4XORA 5IT9Z 1TW3A 3CJTB 3HTSB 2K86A 1S3JA 3PIOF 3K9TA 1OMIA 2XAFA 1LFUP 2EWNA 1Z0XA 1SVMA 2NOGA 2CW0F 5LRRA 1L3LA 1VZ0A 3ASNH 2UV1A 3ML6A 1JT6A 3EUAA 2ICWG 1BI2A 2HOEA 1S9HA 2VC1A 3AFHA 3CMAI 3F6VA 4M3EA 4M9XA 1TNTA 3HSRA 5DEQA 1HA8A 2NAZA 4OMZA 1FNNA 2XAJA 2F5CA 2M2EA 2STWA 2XF6A 1ZN2A 3CP2A 3RTRA 3KPHA 1GXPA 2DODA 3HOZJ 3WE3A 1ZQ3P 4RGSA 3N4MA 2R7VA 2DA4A 1SMTA 2R4GA 2ELJA 4C3HJ 3DKYA 5J3LA 2XB0X 4DNCA 3K69A 5L3FA 1IRFA 1I3QJ 2VONA 1BBYA 3O8HA 1Z6RA 2FRHA 1R71A 1RKTA 2P81A 2XGXA 3OV8A 3WTZA 3E6DA 1HW2A 3HRMA 4ZYAA 2RQQA 2EIMH 4WWCA 2LTPA 1VQPI 2E1CA 5ILVA 1R49A 1YG2A 1X58A 2ZFUA 2GWRA 1Z67A 3GVAA 3T8RA 1QGPA 4EJOA 5EGOB 3ZQGA 3JRDA 2CV1A 2XRLA 5KVRA 2R5YB 1T39A 1LDJA 1FIAA 3VOEA 4C3IJ 3BY6A 2LBFA 2VODA 4J01A 2EV6A 2ESHA 3D5LA 1UG2A 5LHGA 3BTCA 1MNEA 2DJNA 5J8FA 3LFKA 4O5VA 1Z7UA 2Y31A 2KMUA 1C0WA 2BHZA 1IN4A 1D0YA 3WTUC 2MC4A 3ESWB 4ZDPA 5EJCA 1XDSA 4DJAA 1WJFA 3OYLA 1T6SA 3CUOA 4BJTA 3PIPF 1YJNI 3S3OA 4PJLA 1XSXA 3ABUA 3FXMA 1VFCA 3CJRB 2P0WA 2P6SA 4I0BA 3TL4X 1QHGA 3VSLA 4HNVA 2VQCA 1FYKA 4KMFA 3RPQA 5E17F 1MW7A 5LHIA 3BG5A 3FXQA 2VBXA 2VKVA 4N9IA 1ZKGA 1MBHA 2E35A 3S1MJ 1BA5A 1YJ9I 2VOOA 1ORKA 2KRFA 3OYKA 2HYFA 2DJIA 2DA2A 1DUXC 2O3FA 2LNBA 2M3AA 4AU7A 1SAXA 4LLGF 1USTA 2BZTA 2NS0A 4L9NA 2E1MB 2ZJPF 1POGA 2L01A 4RB3C 4HF2A 3LWFA 3ZQIA 3A0BC 2BY0A 3U1DA 4ZTJA 1ZGJA 2O61A 2X1CA 5CQEA 1ETQA 3I53A 3VFZA 1PJRA 1P7IA 3ELKA 5IY5H 5E3NA 2R7FA 2IPQX 3SQNA 3I4PA 4UV9A 2K40A 2KKOA 4YIIA 2DOFA 1N75A 2ZFWA 4F55A 3QYFA 4CYDA 4MLOA 4XRSA 3SJMA 2CUJA 2L7MP 3M4OJ 1RNLA 1LNWA 4A6DA 2GM4A 1LVAA 2W48A 1LE8B 1Y1VJ 3OYCA 2IVMA 5LRSA 1K6YA 3QU3A 2A61A 2EPFA 5C4XJ 2HVQA 2QBYA 2OC6A 2DFFA 1LE8A 4B44A 3S2DJ 1RZ4A 4A0XA 1MBGA 3TO9A 4LD5A 1IW7F 2FBKA 3ZGKA 4KITB 5TISC 3F8NA 1OKRA 5GAEJ 1U6GA 3FXUA 3CCUI 4AIKA 1FLIA 5ILUA 3VYSB 3OL3A 4IL6C 4V2FA 1WH5A 3D0SA 2DA3A 4QPOA 5KAFC 1IO2A 2VN2A 4CUGA 1T08B 2DU9A 3QPLA 4HPQA 4I02A 1JUMA 1U9NA 4XQFA 4LLNA 4BUPA 2HYJA 3RQ4A 2JWTA 3F21A 1O7FA 2KFDA 3K7AJ 5LFAA 2K9NA 1TC3C 5EF6A 2MG4A 3IAM2 3KIOA 1P2FA 2PFBA 3I54A 5F08A 2HZDA 2XUBA 3GW2A 3KE2A 1W36C 3E0JB 4HNTA 4EJVA 1I27A 1ETKA 4CXFA 5FLVA 2I8DA 4FX0A 1X4PA 2DT7B 5M3MJ 1UCRA 2OZUA 3A2KA 1RIOH 4FE7A 1Z77A 2ETHA 2D2WA 4XLNF 3D5RC 2V4JC 1T0FA 1IXRC 3OIOA 2OA4A 2G9WA 3O6BB 2R7SA 1K7AA 3ASOH 3JRCA 2M7AA 1I39A 2EZIA 1AOYA 1OYYA 2OTJI 3QPTA 1HLVA 5IT9K 4QSHA 2O9LA 1H88C 2A68F 1ZLJA 2CUEA 3ZQ7A 3WTVC 2OCEA 2MYSA 4UHTA 1V3FA 2HKOA 2DO7A 2HVRA 1YX5A 2WAEA 2O5RA 2MLGA 5B1BH 4HAMA 1MKMA 2RNJA 1JJ6C 2W4SA 2FA5A 3F8BA 4A3LJ 5E20A 5IYBJ 5FKMA 1ENHA 1YQAA 4BE0A 3C7JA 3TDUC 2CQKA 2Y75A 3CD6I 1LJ9A 3JRGA 1D8KA 1XB4A 2LLKA 3K1PA 4BEHB 4ANJA 4KFCA 4HA8A 2ZJ2A 3DEEA 5KNLA 4HDUA 1XX5A 4FE4A 4XLCA 1SVLA 2V9VA 3J7YJ 2EZLA 1SD4A 3L7WA 5CQGA 1QPIA 3FKJA 2DQRA 2RDPA 1WGXA 2Y0SA 3LSGA 3PL8A 4CDGA 5E8GA 2VI6A 5ERIA 2X4HA 5FFXA 4D7MA 2L3DA 2MA3A 3QYBA 3FHZA 4A3GJ 3IKTA 1BJAA 3HOXJ 1IC8A 2ID6A 2XV4S 4MQVA 5AIQA 3JRHA 3TDZC 3W2AA 3G4SI 2CQQA 5FO5A 3RIRA 2OBPA 4LIVA 2Z3YA 3LQQA 1R1VA 4RAFA 4YELA 5HVQC 4U7BA 4HBLA 5BMZA 1WSUA 3VYUB 3OYAA 3BPVA 4B48A 2L9NA 2QQ9A 1TBXA 4UUSA 1VQ8I 4GFBA 3KEOA 4BACA 1YW8A 1R1TA 1XMXA 3IRRA 3HM5A 2KIUA 2ME0A 1UELB 2QYOA 1FMWA 4I01A 4A93J 1IGNA 2XC7A 4FX4A 2E5ZA 3OS0A 2ZNZA 5IYDJ 3RQIA 3ZN0A 1I1SA 2H1LA 2V6EA 4U0YA 1ZG3A 2Y30A 4ASNA 1REPC 1GXQA 3EPZA 3ZR8X 2A5WA 5ICEA 4IHTA 2DW4A 2L9SA 4LK0F 3QP6A 2D1HA 2VXDA 4EJTA 3AG4H 3K4LA 2OJED 3FF5A 5E1WA 3OYHA 3IV5A 3CC2I 1WH7A 2OQGA 2PEXA 2R92J 3HKZA 2X6OA 2JA6J 3P9CA 4KISA 3MN2A 4R1HA 4D5FA 3OYBA 2WV1A 3G3ZA 1CF7B 1U5TA 1WKMA 4OIRF 5IT3A 1J5YA 3BT9A 4WXDA 1K4SA 2XGDA 3S14J 3V8LA 1PDNC 3SDBA 2DYRH 5GAHJ 5F0CA 1KONA 1S6LA 3ZQLA 4GYIA 3H36A 3LA7A 1ETVA 4WX9A 2DOAA 5EEHA 4HNUA 1T38A 1J0RA 3SEZA 5KHDA 3GO5A 1AWCA 4PDKA 1X2MA 3FX3A 3LSPA 4XLHA 1WJCA 1QZYA 2Y0SN 3ZP5A 1HQCA 3MZYA 1T0FC 2NOJB 4HW0A 2BW3B 2DFIA 3L1PA 4CZCA 3JRIA 5K7FA 4EM2A 2RQPA 1LQ1A 2LK2A 2BW3A 1VQ5I 5CVJA 2IA0A 3E7LA 1IAWA 3IKVA 4BS9A 2DDBA 2FEZA 4W97A 4PFPA 5FKNA 2V26A 2PJPA 2JVHA 4UXNA 4M3GA 2A69F 2Y69H 5GP9A 3SZTA 4M71A 2R7QA 2M45A 3QRFF 1BM9A 2HVSA 3DTIA 4E7KA 3J80Z 2ZCWA 1B1BA 5M5WJ 3JRBA 2UUZA 2WTEA 2BOLA 2ZSIB 4FCYA 2AS5F 2PLYA 1NHAA 3FDYA 2IAIA 4ZDOA 1BOAA 3HHGA 4HSTA 4NDLA 2ACJA 5JR3A 1J2XA 5E1XA 1MMSA 3DKWA 2RREA 2F6CA 3HJEA 3WHBA 5GAGJ 4MO7A 1MMNA 4GO1A 4EGYA 2FMLA 3JRAA 4WK8F 3IRQA 2L0KA 2MBFA 2E7WA 3DLLF 4I2OA 2LKPA 2XVCA 2V6CA 2OV7A 3H9JA 4RMNA 3H9GA 1O3RA 3BC8A 4MEXF 1SANA 3CF5F 3TGNA 4S0HB 1KU3A 2EQRA 4OWRB 1S7OA 4A5MA 3MKYB 5DM6F 2EZKA 2BEOA 2LOOA 3IP4B 3MWMA 3MKZA 3H35A 4PJ0C 1BI1A 3PNTA 1JUSA 3G1LA 1LEBA 3FMRA 2LH9A 5K1YA 2NNNA 4Q48A 3X2QH 1PUFB 3HPHA 3O3KA 1IDZA 1O57A 1Y0UA 1DQUA 1PUEE 2RNGA 1O4XA 5AONA 3GFMA 3L2QA 1PUFA 1G3WA 4LG0B 3S1QJ 2HZTA 3JAMK 1WJ5A 4C2TA 2ZMEB 3BR0A 3S8PA 2UZKA 3GMEA 2E5NA 1IXCA 2DQLA 4C3JJ 5HLTA 3BZCA 2CSOA 5B1AH 6PAXA 2NVQJ 3HRUA 1B72B 4IQ4A 2BY2A 3GLLA 4IHVA 4HX7A 4AC0A 2CW8A 2GLOA 3I71A 2ME6A 1JTXA 1KQ9A 2DMNA 3NWTA 4Y7NJ 1U5TC 1SMYF 5B5EC 2D5VA 2QKLB 2DI3A 1SD7A 1YS6A 4E7IA 1S7EA 2K4JA 3FMSA 1MMGA 2IJLA 1M1EB 1KA8A 2LREA 3ROUA 3TOAA 5DUIA 4IHWA 3M8FA 2E1NA 4EM1A 4ZYDA 3BOQA 1RUNA 4E4HA 2XF7A 2YX4A 3EUKL 3HRTA 2R5ZB 1LUJB 1NK2P 5IYCJ 3DU6A 4OIQF 2KZVA 1W5TA 3QOEA 4A3FJ 2V1UA 5ICGA 4ZDLA 2EK5A 2P4WA 3KP6A 1J09A 1MBJA 4CCMA 3B6AA 2R5ZA 3FXRA 5FLXK 3CJQB 5JI6A 1W4MA 3FBIB 4LK1F 1IV8A 3QPSA 3WG9A 5IOYA 2ZKZA 2FE3A 3B02A 1BN5A 4JX6A 3MCZA 2KT0A 2W84A 1VNDA 1USSA 1E3PA 3LSTA 2DMQA 4EEFG 1WPKA 3PUBA 4K2EA 4N4NB 5JHFA 4YFXF 3TOBA 5KK1A 2ZXIA 1VQKI 4ENKA 2WBMA 1W0TA 4N9HA 5J4YA 3SFIA 3K6GA 4YRVA 2HQ5A 2K7LA 1Y39A 3ZN1A 3Q0WA 4QPQA 1GT0C 4RS8A 1FTZA 3H3VK 4RGRA 2CUFA 3I9V2 2MABA 1NTCA 5LGTA 1HCRA 2G0EA 2P5KA 5EZGA 1IV6A 5HDGA 3U21A 4FASD 2MD0A 4F7ZA 3CCVI 3CO7C 3GFLA 2DFEA 4XLPF 2GIVA 3OYMA 2F4IA 1IRZA 3E3VA 1TWFJ 4G6DA 3TKYA 5K5QA 3PO3J 2TCTA 3MZ8A 1TT5B 3AAFA 1S5LC 5HDKA 2X1DA 2DT5A 2A6TA 1F4KA 3BZKA 3CCEI 1X3UA 2ELHA 2VQGA 1SFEA 4ZYEA 2PJRB 4A69C 2AXLA 3W6KB 2JT1A 1UZCA 5HOOA 2A3SA 3LSMA 3TO7A 2W7NA 1QRYA 1T33A 2PJRA 5F04A 3J7AY 3I55I 1QVUA 1B9NA 1HKQA 1E2XA 2H8WA 3F9KA 2H94A 4DYRA 4P1WA 3WTTC 1ULYA 5CYVA 4KUMA 3BPXA 2RN7A 3GX4X 1XD7A 3FM3A 1KU7A 1WI9A 4M74A 3OL4A 1YI2I 1JKOC 4LJZF 1OFCX 3CDHA 3CF2A 3C18A 2NVUB 5EEAA 2XSDC 2EIJH 3FISA 3VODA 4EM0B 1K6OA 1EF4A 3H3UA 3K4NA 3OSFA 4BQNA 3QP5A 2QWWA 5TGTA 4P55A 4XOPA 4M3FA 2GXBA 1K78B 4PZJA 4ESJA 4BXUA 4HF0A 2DMUA 4PGGA 2FX0A 1U3EM 5LGNA 1Y8RB 4HZFA 3E5XA 1ACIA 4L18B 1OR7C 4RB1A 4BBRJ 3F72A 2O8XA 1H9GA 2MC3A 2F4OB 1JT0A 3VYTB 2W82A 4L9TA 2Z2SB 1YW7A 1SVOA 4I76A 3FZVA 1W5CC 4C2UA 3S93A 5BS6A 3GTGJ 4R79A 1ZREA 5A2QZ 1K61A 2L5QA 3SFZA 4AIJA 2DA1A 4C2MJ 1XS9A 3CUQB 1HKSA 1SAUA 1X19A 3BJ6A 3FKIJ 3OYIA 3DP7A 1ZHFA 3E5QA 4ZJZA 3Q9VA 2KIFA 4UB8C 1O3TA 1P6RA 3CUQA 2EBIA 2WAQN 2H6BA 4CYCB 1R5ID 3PNYA 3OYNA 3PQKA 2VQLA 4B8XA 1FWZA 3WU1B 2GQQA 4RA2A 1ZRFA 2M34A 3JTHA 5F64A 3OMYA 3DQVC 4HOBA 2FUG2 3L9FA 4MTEA 1TWCJ 1FYMA 3I56I 4BDZA 5K5OA 2K4BA 2KIQA 1QZZA 3F8CA 4CA0A 1J7KA 5EGOA 3OY9A 1WJAA 2RGVA 1I1GA 4UVCA 2R5YA 1JKPC 1JXSA 1VQNI 4G7ZF 4AYBA 2KDOA 4PJNA 4EVIA 2AXTC 3VPRA 4AWXB 3JSPA 2G7HA 2YR2A 1XGNA 1VQLI 2DN0A 3JCUC 2QF7A 4Y3OA 3KYDB 3LA2A 1BIAA 3M7GA 1WJBA 4D5CA 1XG1A 1FBUA 1BI0A 2B63J 4TV7A 1RUOA 1E3OC 2EFNA 3WODF 4WF2A 4NC6A 4B3XA 2ECCA 5GPCA 3FK6A 3L00A 2X48A 3DBLB 2ESNA 3VB2A 3L2RA 3ABTA 2XPUA 1TWGJ 1GV2A 1JJ8C 1TWHJ 4OAZA 4F52A 5LHHA 1BC7C 2YU9J 3I4MJ 1QO0D 2O03A 4CCLA 4FTHA 3ZMTA 1Y0NA 3OR2C 2WY8Q 4CO8A 4M73A 4II2A 2X1EA 3R6SA 3ZRGA 4BHPA 3FIWA 2OTLI 2EIKH 1FJLA 5HDNA 1HXDA 1UMQA 2VKDA 1D5VA 1R1UA 1G8XA 3ABLH 1EJ9A 2HEOA 4L5IA 4NHJA 1HOMA 2FOKA 1UHSA 3GCMA 3K4KA 2V7FA 3E6CC 1T95A 5J1RA 3SZGA 2KL4A 2OAZA 1FIPA 4A3EJ 4KT6A 3ZMVA 5GADJ 3DCFA 2CYYA 1D0ZA 1YRNB 1OYIA 2V9KA 1QA6A 3GYHX 3DV8A 4EJUA 3R4KA 4MFDA 4DBQA 3M3YJ 2WY7Q 2VOPA 4CCKA 4CCNA 4XRMA 5CVUA 3HRSA 2M8GX 3GTMJ 2L9RA 2X6YA 1Q1HA 3GZNB 1AU7A 3ZXSA 1OLTA 3SDGA 2W00A 3W2WA
chains in the Genus database with same CATH topology
1U0JA 3OYFA 2XF5A 4PUSA 2E5ZA 2XC7A 1UAAA 4X0GA 3OS0A 3DU5A 2CV2A 2V6EA 2CS3A 4LIUA 3EPZA 3ZR8X 3C2HA 2A5WA 3S3NA 2L9SA 2XAUA 2OUMA 2VXDA 2HU9A 3H5AA 4RM3A 3K4LA 5KCMA 3OYHA 2KQRA 4BXFA 1LFPA 1X1BA 4PJMA 3V42A 2W1OA 2IGNA 3HKZA 3L2UA 4BQOA 4KISA 4XLEA 1BR1A 3OYBA 4XKWA 4U87A 1W36D 4PFOA 2CW7A 2LY1A 3SDBA 3K70D 1KONA 3VWBA 2QKMB 4IQJA 4CSWA 2DOAA 3DPLC 4HNUA 1D1BA 1MMAA 2XSJC 1D1AA 2WA0A 2CV0A 3K70C 3SEZA 2IS2A 2Q1ZB 4B47A 5KHDA 4BE2A 3CP8A 4FETA 4NC8A 2K9LA 4XLHA 1WJCA 1T0FC 2NOJB 1LKXA 2BW3B 4Y4RA 4CZCA 3W2WA 4HRIA 2IGOA 2K5CA 1UG0A 2IXSA 4BJ6C 3ZQQA 4CCJA 2BW3A 4LITA 4HEA2 3H5RA 2HPIA 4J00A 4BS9A 2CFOA 2LBFB 2X51A 4HSRA 4DOZA 4NQWB 3SEQA 4PFPA 3DWLE 2V26A 4XNFA 2JVHA 4H4KC 1X1CA 3OIPA 2R7XA 2R7QA 2VKHA 1FMVA 2HQAA 4D1QA 4CH7A 2HVSA 2VJ4A 3DTIA 2AQFA 4DIQA 4E7KA 3K4BA 2F5VA 3HOSA 2UUZA 4E7SA 2BOLA 2ZSIB 4E7ZA 4ZDOA 3FDYA 3S32A 4HSTA 1AA7A 2IS6A 4E6KG 2RREA 2F6CA 2WADA 4JQFA 1MMNA 2L2OA 1Z3XA 1SFKA 2DXIA 2V1NA 1DGWY 2R7OA 1GLNA 3LFUA 4BEHA 2KRHA 3HXLA 3LSKA 4OAYA 2LRDA 2E1MC 4IKFA 3PNVA 1BR4A 4NUBA 3OWTA 4EATA 4PK4A 2OV7A 3H9JA 4RMNA 3H9GA 2JVGA 3BC8A 3E1SA 3OYEA 2VQHA 3RCOA 2IS1A 3HPGA 3OYJA 3EUHC 4OWRB 1Z21A 3BCBA 3MKYB 3M1CA 4BQQA 2LOOA 3IP4B 4F3QA 3MKZA 3H35A 5FRMA 3PNTA 2LH9A 2ZSHB 3BG7A 3UR3C 1N78A 2M4KA 3IUOA 4ZC3A 3PSIA 4GRIA 3HPHA 3FHNA 2CUZA 3VDXA 1DQUA 1WJDA 2RNGA 2E60A 1PYVA 2JA2A 1TZLA 3L2QA 3GBGA 4F92B 2X85A 4XORA 1WJ5A 1NG7A 3OYDA 4C2TA 1LDKB 1ZELA 3S8PA 4XKVA 3OYGA 3CZ6A 3S3MA 2Z16A 4XOTA 1E0EA 2E5NA 5HLTA 3VYRB 1VZ0A 3OOUA 2LC2A 2UV1A 3EUAA 4BGDA 4IQ4A 2HDWA 3OS2A 1S9HA 3AFHA 1X1DA 2CW8A 4XN3A 2WAFA 1MMDA 3NWTA 2KLOA 4AVZA 1HA8A 2QKLB 2KHMA 2VJ5A 2XF6A 2JSPA 4E7IA 4YEJA 3CP2A 3RTRA 1MMGA 2LREA 2KPMA 1D1CA 3HL2A 4DBRA 3L2WA 3MMYB 5CKTA 4E4HA 2XF7A 2R7VA 3EUKL 2R4GA 2ELJA 3UNGC 3MKWB 3DKYA 4II3A 3DU6A 4F91B 2KZVA 3QOEA 1QU3A 3M8JA 4ZDLA 4D9JA 1IRXA 1YX3A 1J09A 4CCMA 3QODA 2R7WA 3CJQB 3FBIB 3BLYA 1TT0A 4ZYAA 2RQQA 3VSKA 1BR2A 3NWSA 2ZFUA 1FMWA 4XR6A 1V5EA 2CV1A 2HNHA 3PUBA 4N4NB 2JUGA 5JHFA 1WJEA 2LBFA 4J01A 2ZXIA 3D5LA 2WBMA 4E7JA 1MNEA 2R7UA 2KMUA 3K6GA 3PFYA 4YRVA 1D0YA 2K9MA 4QPQA 2MC4A 3HG9A 4XKBA 4ZDPA 3ZCOA 3K10A 4C30A 3LSIA 3I9V2 2MABA 4DJAA 2MFZA 1R6RA 1WJFA 3OYLA 4BU2A 1DGRM 1X1AA 4XLAA 3U21A 2KRCA 4FASD 4BJTA 1Y6IA 2MD0A 3H9QA 3LL7A 1JI8A 3S3OA 4PJLA 3OYMA 3FBNB 3AL0B 2GOXB 2F4IA 3CJRB 3D5SC 3K4MA 3KX2A 4JOMA 2BVLA 2P0WA 3TL4X 1QHGA 3VSLA 2AQEA 2VQCA 1Y56A 3L2VA 1MW7A 2X1DA 2A6TA 2PMZA 1D0XA 2VQGA 1ERDA 2PJRB 4NC7A 2X6XA 4KJZA 2R7RA 3OYKA 5HOOA 3LSMA 2DJIA 5CPRB 2W7NA 4DGWB 2PJRA 2M3AA 4AU7A 4E7LA 1YE9A 1Z7LA 3J7AY 2E1MB 2VASA 4PSXA 2X6WA 3F9KA 5HNFA 2UWMA 4P1WA 4RM2A 4ZTJA 2Z1DA 3OL4A 4N4OB 2X1CA 4NNJA 5CQEA 2L7KA 3CF2A 1PJRA 4RLQA 4G6TB 3C2GA 4E7HA 3K4NA 4BL0B 4BQNA 1N75A 3HUGB 4F55A 3QYFA 5TGTA 4MLOA 4XOPA 2CUJA 4XLFA 2VPLA 3KEYA 4IX7A 4BJ5C 3BCAA 3OYCA 1OR7C 4XL9A 1K6YA 2IS4A 4ZTFA 2HVQA 5LD2C 3VYTB 2W82A 2OC6A 4C9YA 3PSFA 3OS1A 4B44A 3HOTA 2LYCA 2Z2SB 1G59A 3DTKA 1QHHD 2VL8A 4C2UA 3S93A 3ZGKA 3A1YA 4R79A 3BG6A 4KITB 2L5QA 4XONA 3VYSB 3OL3A 4QPOA 1SAUA 1X19A 3OYIA 4CUGA 4ZJZA 3DPTA 4HPQA 4Y33A 2VJJA 3W3CA 4XQFA 4BUPA 2ZXHA 2IGMA 3ONQA 3RQ4A 3PNYA 3OYNA 5LFAA 2VQLA 3CESA 3IAM2 1V5FA 4LG3A 2HZDA 3OMYA 3DQVC 4HG2A 2FUG2 1W36C 4XN0A 3E0JB 3IAS2 4HNTA 4BDZA 2I8DA 1X4PA 2DT7B 2CH0A 3A2KA 2WB1A 4ITVA 4CA0A 4CCOA 2VLAA 3RPUD 3OY9A 1WJAA 4P5OA 2LG4A 2V4JC 2GOMA 3D5RC 4PSWA 4PJJA 3I3LA 4AYBA 2R7SA 2KDOA 4PJNA 4F93B 2M7AA 3LSHA 4XKCA 2VIXA 2Q2EB 4Y3OA 3OR1C 3QYEA 1WJBA 3TMOA 4XMYA 2MYSA 3LMMA 1V5GA 4B3XA 2HVRA 3DLAA 3K4JA 1YX5A 2WAEA 3AL0C 2O5RA 3W2VA 1WFXA 3L2RA 1DP3A 2M0MA 2R7TA 2W4SA 3PJRA 4OAZA 4F52A 2WAQA 1N77A 1MNDA 3OIQA 4CCLA 4BE0A 3OR2C 2WY8Q 3H5NA 4BEHB 3DPUA 1P9QC 2M7BA 4ANJA 3HC7A 3KYLA 2BVMA 3MD2A 4II2A 5FROA 2X1EA 3A4CA 2VJIA 3ZRGA 3DEEA 3N05A 5KNLA 1Z3YA 4XLCA 4BE1A 2IGKA 2VKDA 1G8XA 5CQGA 2DT6A 3FKJA 2Y0SA 2VXZA 3LSGA 3PL8A 2KP6A 3H0DA 5HNHA 4IZZA 3QYBA 2M4GA 1NG6A 2CMPA 3K4KA 3DTEA 2V7FA 1T95A 3SZGA 3TBIA 3K4CA 2KL4A 3W2AA 1EA3A 4KT6A 4RLFA 4B43A 4LIVA 3CMMA 5HVQC 4YELA 1D0ZA 2V9KA 4XM3A 4U7BA 2XDVA 4DBQA 2WY7Q 3RSNA 3VYUB 1X4OA 1LVKA 2K3PA 4B48A 3OYAA 3AKZA 2L9NA 4CCKA 2VB6A 4CCNA 2DCEA 2X6YA 3SYTA 4BACA 2LY2A 1BOBA 4BDYA 5FRNA 3ZXSA 1OLTA 3DKXA 2HPMA 1UELB 2W00A 3G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I8D A;  2OC6 A;  2KL4 A; 
#chains in the Genus database with same CATH topology
 4PUS A;  4AYB N;  3C1D A;  3FXL A;  1YO5 C;  1U8R A;  4X0G A;  1TQM A;  2XRN A;  4FQG A;  2CV2 A;  1ZG1 A;  1CQT A;  1FBS A;  3HEF A;  2V79 A;  5B66 C;  2CS3 A;  4LIU A;  4BY1 J;  5EYR A;  1WHU A;  2ZJQ F;  1I6H J;  4XIC A;  2OUM A;  3E6B A;  2HU9 A;  3H5A A;  1FPQ A;  4RM3 A;  3ULQ B;  1P7J A;  2EH3 A;  2KQR A;  4ENN A;  5CVR A;  5H20 A;  2W1O A;  1MSE C;  1IF1 A;  1T8I A;  2LSO A;  4CGZ A;  5FLM J;  4A0Y A;  4E70 A;  2HS5 A;  4U87 A;  1KGS A;  4IF4 A;  2CW7 A;  3K70 D;  1JTY A;  5DM7 F;  3LAJ A;  3VWB A;  2QKM B;  4IQJ A;  1OCO H;  2NNY A;  3EQL F;  1I5Z A;  1A31 A;  1D1B A;  2QSG X;  4B47 A;  5L3C A;  3WHC A;  4NC8 A;  1SD5 A;  3TW6 A;  2NS7 A;  4L5J A;  2N8G A;  4HX8 A;  4AID A;  5IP6 A;  4LMY A;  4HRI A;  2IGO A;  2XGC A;  3CTA A;  4BY7 J;  1UG0 A;  5HS9 A;  3P5J A;  2EB7 A;  4CCJ A;  2BGC A;  3LA3 A;  4LIT A;  5IOZ A;  1UB9 A;  4HEA 2;  3ZQF A;  5JVT A;  3U9G A;  1XGO A;  2A05 A;  2DFH A;  4U0W A;  5BNG A;  1OCP A;  5CVI A;  4XID A;  2X51 A;  4NQW B;  1JUP A;  2OQR A;  1FSE A;  4ESF A;  1WVR A;  3K2A A;  4H4K C;  4P9F A;  2IRF G;  3ZMU A;  5DV5 A;  3J81 Z;  1WRJ A;  2H27 A;  2VKH A;  5H6R A;  2HQA A;  1YIO A;  5D8K B;  1IZ1 A;  4D1Q A;  1KU9 A;  2VJ4 A;  2MGQ A;  1ZGA A;  5LEK A;  2HDD A;  3ZPL A;  4A2U A;  1N25 A;  4Y52 J;  2PG4 A;  2VKE A;  3TQN A;  3W6J B;  2ZC2 A;  2ZXW H;  4LFU A;  2YX7 A;  2L2O A;  2PX9 A;  2AHQ A;  2QSH X;  2E1O A;  4HV5 A;  3MKL A;  3QPH A;  3LFU A;  2R7O A;  5A2Q K;  4BEH A;  3LQR A;  3ZOB A;  3FM5 A;  1GVD A;  5AIP A;  3I59 B;  4A0Z A;  3LSK A;  2OF7 A;  2E2J J;  2E1M C;  3HDD A;  1R58 A;  4M3B A;  5HLI A;  4L0Y B;  1U78 A;  3OYE A;  3DEU A;  4GCV A;  3CDL A;  4J19 A;  4M72 A;  3BCB A;  2BE5 F;  3M1C A;  4A3I J;  3M07 A;  3F3X A;  5HLH A;  2QEN A;  4BQQ A;  1MJA A;  1MJ9 A;  2FNA A;  2MLK A;  5D5U B;  3PUF A;  2GZW A;  3R61 A;  3V8J A;  4S05 A;  5LBQ A;  1HC8 A;  2QCO A;  5J4V A;  3Q3S A;  4GRI A;  4RGU A;  3BTL A;  2LD5 A;  5D8L B;  1P4W A;  1WJD A;  2E60 A;  2UXX A;  1J9I A;  2R7Z J;  4RAG A;  3ECO A;  4BNC A;  4OIO F;  1V4R A;  5CVV A;  9ANT A;  1NG7 A;  4ZZD A;  2O7O A;  1ZEL A;  5J8C A;  2QEX I;  4XKV A;  2A6H F;  1U2W A;  2XB5 A;  3CZ6 A;  4RAZ A;  3S3M A;  3NQO A;  4UB6 C;  4B3A A;  1DU0 A;  4DW6 A;  5EEG A;  4LLL A;  1FT9 A;  3MZH A;  4JYK A;  1K79 A;  2JJ7 A;  1IN5 A;  4KIG A;  1JHF A;  1TP4 A;  2K27 A;  1MDM B;  2DA5 A;  3W6V A;  4XRF A;  2HYG D;  4XN3 A;  2PN6 A;  1BC8 C;  1Y1W J;  4Q5S F;  4UUV A;  4AVZ A;  3O8G A;  1MDM A;  3CMY A;  2VJ5 A;  2VBY A;  2Q0O A;  4YEJ A;  3I0T A;  3V7C A;  1D1C A;  1CF7 A;  3NRV A;  4DBR A;  5D6E A;  3L2W A;  1BI3 A;  5DDG A;  5H2F C;  3MFK A;  3F23 A;  1R5H A;  2DBB A;  3UNG C;  1TW2 A;  1JKQ C;  2FSW A;  4ESB A;  4F91 B;  2GXA A;  1QU3 A;  2HWV A;  3BG9 A;  1HSJ A;  1YX3 A;  2IBD A;  2OCC H;  3PFI A;  5DCF A;  4L5E A;  2HOA A;  1B6A A;  1WI3 A;  1RR7 A;  3QOD A;  2R7W A;  1HBX G;  5H6Q A;  2NVY J;  4IJA A;  1K4T A;  1EV7 A;  4QTR A;  2R3S A;  3DF8 A;  3LOC A;  2XGE A;  2D45 A;  3REO A;  3NWS A;  2LR8 A;  3T1B A;  4XR6 A;  1U8B A;  1V5E A;  3OOP A;  5K5R A;  1PP8 F;  2Z9O A;  2HXO A;  5DUK A;  2XPW A;  2JUG A;  1WJE A;  4IRH A;  4ZH4 F;  4E7J A;  3A01 B;  4B4C A;  2R7U A;  5FGM A;  1JGS A;  2K9Q A;  2JMW A;  2KIS A;  3PFY A;  1TLH B;  2K9M A;  2RC4 A;  1HW1 A;  3HG9 A;  4XKB A;  4DYQ A;  3A01 A;  4DZP A;  1OCT C;  3ZCO A;  3HGG A;  3B6C A;  3K10 A;  3LSI A;  5CLS A;  5EZH A;  2MFZ A;  1R6R A;  1G2H A;  1DGR M;  1TTY A;  1X1A A;  4IHX A;  2KRC A;  3Q5F A;  1RKW A;  4CIC A;  3K1N A;  2KJC A;  1JI8 A;  2P7V B;  2VBW A;  2FU4 A;  1YIT I;  3FBN B;  2IT0 A;  3AL0 B;  2GOX B;  3KX2 A;  1XCB A;  4IRI A;  3Q9S A;  2BVL A;  4HYE A;  2VT3 A;  3GTL J;  1MBF A;  3KZZ A;  3CO6 C;  3ZMD A;  2L4A A;  2JUC A;  2BY1 A;  2DYS H;  2PMZ A;  2L54 A;  1UFM A;  5DCM B;  4A3M J;  2L9V A;  1D0X A;  3HOW J;  1MIJ A;  4A3D J;  2HTJ A;  2X6X A;  3GTK J;  4KJZ A;  2KZG A;  1KZH A;  1FOY A;  4RAY A;  5DCM A;  2HI3 A;  5CJ9 A;  2K02 A;  4E7L A;  2JZY A;  1MSF C;  2K3F A;  3G73 A;  2VAS A;  2A07 F;  4PSX A;  2X6W A;  2Y9Y A;  4RBO A;  5LEJ A;  4RM2 A;  3WGG A;  2GXG A;  3N97 A;  3DEW A;  5DD4 A;  4BQA A;  5BQT A;  2JQ7 A;  4N4O B;  3S2W A;  4L9J A;  4NNJ A;  4S04 A;  3EYI A;  1O3Q A;  1E3H A;  2CO5 A;  2L7K A;  3V7R A;  5FB2 A;  4U7D A;  4BXX J;  3AG1 H;  3C2G A;  4E7H A;  4LG0 A;  1A6I A;  2WV0 A;  1ZAO A;  2EA2 A;  2H09 A;  2M87 A;  4BL0 B;  4AM3 A;  1HST A;  2FQ3 A;  2ZME A;  2F48 A;  2P8T A;  4XLF A;  1SFO J;  2JA7 J;  1OIS A;  4Y15 A;  1EKE A;  2JSC A;  2HQR A;  4IX7 A;  3IL2 A;  1R4M B;  3QAH A;  4EJW A;  5DS9 A;  4I99 C;  4XL9 A;  1XSD A;  3GF2 A;  1B72 A;  2IS4 A;  2ZNY A;  3M8E A;  4I98 B;  4UUT A;  2VBZ A;  4C9Y A;  2I5U A;  2ZXJ A;  1E17 A;  5GTH C;  1SD6 A;  4RB0 A;  2PBI A;  3KZY A;  4ETS A;  2Q8K A;  1G59 A;  3DTK A;  5JLX A;  1ZRC A;  5EG0 B;  2LMD A;  2VL8 A;  3KP4 A;  3D1N I;  4A6E A;  1BIB A;  3P9I A;  3A1Y A;  1BJZ A;  2TDX A;  4YIF A;  5IP9 J;  2KDZ A;  1OCC H;  5EG0 A;  2BXZ A;  4XON A;  2QGU A;  3GTO J;  5JHU A;  4HDV A;  5LGU A;  3GFJ A;  5J1U A;  2NVT J;  5FD6 A;  4W1U A;  5FKL A;  5D5X B;  3DPT A;  4Y33 A;  2VJJ A;  4KIC A;  1SEU A;  1ITY A;  1S29 A;  2PMZ N;  2Y0M A;  2JK3 A;  3CC7 I;  3V7S A;  2HXI A;  2QQ8 A;  1V5F A;  3DBH B;  4U0V A;  2MH9 A;  2FNP A;  4M9Z A;  4XN0 A;  1R22 A;  1JKR C;  3IAS 2;  3FXK A;  2EIL H;  1ZRD A;  5L3E A;  4CZZ A;  4IO9 F;  4N0B A;  5F6F A;  3A02 A;  4UVB A;  2WB1 A;  4ITV A;  1HKT A;  2VLA A;  3RPU D;  3KZI C;  5BOX A;  4ZYH A;  2E19 A;  2LG4 A;  2Z99 A;  2GOM A;  4OIN F;  5FJ8 J;  2H6C A;  2ZB9 A;  3I3L A;  1QZE A;  4F93 B;  1X1P A;  2DOE A;  3GXO A;  5F0H A;  1MJB A;  2VIX A;  4M6V A;  3ABM H;  1YJW I;  3SXY A;  1G6N A;  2R93 J;  2COB A;  2V1X A;  3QYE A;  4G7O F;  2XAS A;  2D1V A;  4XMY A;  3S1R J;  3R60 A;  2IEK A;  1V5G A;  3VEP A;  3QOP A;  3CLO A;  3KET A;  1W7P B;  2MH2 A;  1KQ8 A;  4WXC A;  1OYW A;  5F27 A;  2FMY A;  4Y17 A;  1ZLK A;  3AL0 C;  3W2V A;  1WFX A;  1DP3 A;  2IA2 A;  3WE2 A;  3WTX C;  3V4G A;  1DU6 A;  5FKO A;  3CDI A;  3RKW A;  2HOS A;  2FBH A;  3BR1 A;  2WAQ A;  5D5W B;  1MND A;  3OIQ A;  3S15 J;  3ISP A;  1JGG A;  2F5F A;  3TO6 A;  1SFU A;  1UJ8 A;  3H5N A;  4GYG A;  2M7B A;  5ICF A;  2DMT A;  3HC7 A;  3KYL A;  3MD2 A;  2M30 A;  5FRO A;  1IN8 A;  3UKG A;  3A4C A;  1MNM C;  4ABZ A;  1Z3Y A;  3BTI A;  2DK8 A;  1ETO A;  4KIB A;  2IGK A;  2BHY A;  3U2R A;  2ISZ A;  4IZZ A;  3H0D A;  4L0Z B;  1P92 A;  2M4G A;  4MGR A;  3DTE A;  2E71 A;  3FWE A;  3CC4 I;  2A5Y B;  3TBI A;  3K4C A;  5ILS A;  2DPU A;  4RLF A;  4B43 A;  2JA5 J;  4Z2Y A;  2O0Y A;  2I10 A;  4H0E A;  1IN7 A;  1FSH A;  2YUS A;  1H9T A;  3G6E I;  2LVS A;  3EUH A;  3G1M A;  3JR9 A;  1IRG A;  3RDI A;  2DTZ A;  1U9O A;  2ZME C;  1MBE A;  2K3P A;  3K2Z A;  2QQA A;  1YFH A;  3BDD A;  2F5E A;  3BR2 A;  1Y8Q B;  4R8H A;  1QNT A;  3SYT A;  4L9V A;  2LY2 A;  2WB1 N;  4BDY A;  5FRN A;  5JFR A;  1RC9 A;  3DKX A;  1R9T J;  3KYC B;  2HPM A;  4XRS G;  4G7H F;  5J40 A;  2NXN B;  3G2B A;  1K78 A;  1BW5 A;  3MEX A;  3OYF A;  3RI4 A;  3J80 K;  1UAA A;  3CCL I;  1YIJ I;  1IG7 A;  3DU5 A;  1MGT A;  1CGP A;  1JE8 A;  3BWG A;  5GTI C;  4A3B J;  3KLO A;  3S3N A;  2GAU A;  3QQA A;  2PMH A;  2XKP A;  4PGH A;  4A3K J;  2HGC A;  1FEX A;  2LDU A;  3V42 A;  5ED4 A;  1ZH5 A;  1Z05 A;  2CWE A;  3L2U A;  2DPD A;  2ELK A;  5K7Z A;  4XLE A;  1BR1 A;  3QU6 A;  2HTS A;  1FTT A;  3I5U A;  1FYL A;  4PFO A;  3G71 I;  4ENM A;  2JTV A;  1GDT A;  2MD5 A;  2V1D A;  2WWY A;  2Y2Z A;  2QM3 A;  3CCS I;  2FF4 A;  4CYC A;  2F4M B;  3DPL C;  2XSJ C;  1D1A A;  1O7L A;  4KNY A;  5KAI C;  4BE2 A;  4FET A;  2K9L A;  1XCV A;  2LP0 A;  4U88 A;  1T2K A;  3GWZ A;  1J59 A;  4D0P A;  3Q0U A;  2NYX A;  4Y4R A;  4A3J J;  4YG2 F;  4BAY A;  2DA7 A;  2K5C A;  3HYI A;  2L7Z A;  5M3F J;  4UY8 I;  3GZ5 A;  3BJA A;  3TW7 A;  2IXS A;  3JRE A;  2OD5 A;  4DQ2 A;  3ZQQ A;  5K7H A;  1XDU A;  5ICC A;  4D7N A;  4Q4Z F;  2BV6 A;  4J00 A;  2KIM A;  2QQB A;  4EQQ A;  2CFO A;  4KT5 C;  4RGX A;  2LBF B;  4HSR A;  5J6X A;  3DWL E;  1OCZ H;  3HGY A;  5F1R A;  2JPC A;  2ZO4 A;  1VQ7 I;  1A36 A;  1FOK A;  1Z9C A;  1OJL A;  3OIP A;  5E8I A;  4UVA A;  2R7X A;  1IUY A;  3NAR A;  3ERE D;  3HHH A;  2DDA A;  2MSY A;  4B1R A;  1J75 A;  1MBK A;  4DIQ A;  3RYP A;  4HV6 A;  2RVC A;  4E7S A;  4E7Z A;  4OU0 A;  3HOY J;  3S32 A;  3M9A A;  1AA7 A;  2DAO A;  5FFZ A;  3RPU A;  3WTY C;  1X2N A;  3EYY A;  3KLN A;  2XHK A;  4E6K G;  4MIM A;  1VQ6 I;  4OIP F;  2MW8 A;  2WAD A;  3LSJ A;  3K1M A;  3IH3 A;  5M5X J;  1Z3X A;  2OU2 A;  3HSF A;  2DXI A;  3B73 A;  2V1N A;  2ZJR F;  1R5G A;  3JSO A;  2W24 A;  1SFX A;  3HIF A;  2KRH A;  3HXL A;  4OOI A;  4OAY A;  2LRD A;  3PNV A;  3NEU A;  1BR4 A;  5IP7 J;  1R23 A;  3RKY A;  3EET A;  3A03 A;  4BHB A;  5C4J J;  4XSZ F;  2BBY A;  2LF7 A;  1XN7 A;  2VQH A;  1GHC A;  4V2G A;  1YYV A;  4PCQ A;  2IS1 A;  3OYJ A;  4I0A A;  3EUH C;  1Z21 A;  2RV8 A;  2VPR A;  1MD0 A;  4HQM A;  4JBA A;  2M9H A;  4DYC A;  1TL8 A;  2NVX J;  1WZ2 A;  2Z5U A;  4F3Q A;  4YFN F;  1FX7 A;  3I58 A;  3KP7 A;  3TP3 A;  4X6A J;  4HX4 A;  1YRN A;  1QPM A;  2ZSH B;  3BG7 A;  3UR3 C;  4ZC3 A;  1FP2 A;  1P4X A;  1ZK8 A;  2CQ7 A;  2CRG A;  3PSI A;  3JRF A;  2JN6 A;  5BPI A;  1XPX A;  3FHN A;  2CUZ A;  3KEQ A;  3VDX A;  1T56 A;  4XSX F;  1PYV A;  5J1Y A;  1TZL A;  1ETW A;  4KN4 X;  3CJN A;  3HB9 A;  2QLZ A;  2TRT A;  2CQN A;  2YPR A;  4F92 B;  2EFO A;  2HDC A;  1W0U A;  3OYD A;  3HSE A;  3HZJ A;  4BKX A;  1LDK B;  2F5D A;  4FT8 A;  1HDD C;  3OYG A;  3S1N J;  2Z16 A;  4XOT A;  1E0E A;  2M5W A;  2E34 A;  1DP7 P;  3IHU A;  3VYR B;  3OOU A;  1ZG5 A;  3MQ0 A;  2LC2 A;  4A3C J;  1TWA J;  5M5Y J;  2QBY B;  4BGD A;  2HDW A;  3OS2 A;  1X1D A;  3J7Z I;  2B0L A;  2WAF A;  3I4N J;  4ON0 A;  1MMD A;  2E36 A;  2KLO A;  3CUQ C;  3BP8 A;  3GTP J;  2B7E A;  1IXS B;  2KHM A;  1ZR4 A;  2JSP A;  1ZAR A;  2IP2 A;  2LKX A;  2ISY A;  2KPM A;  3U1K A;  3HL2 A;  2UXN A;  3MMY B;  5CKT A;  1R4N B;  2F2E A;  2KJB A;  2GBY A;  5C3E J;  2VE8 A;  3FK7 A;  3MKW B;  4II3 A;  1MZB A;  3G1O A;  2QZ8 A;  1V55 H;  3M8J A;  3S2H J;  1EH8 A;  4D9J A;  1IRX A;  2DK5 A;  2OPT A;  4G9Y A;  5FD5 A;  3KCC A;  1W1W E;  2EV0 A;  3BLY A;  5HLG A;  3CCR I;  1LEA A;  1TT0 A;  3VSK A;  1AHD P;  1BR2 A;  1EH6 A;  1F9N A;  2XKO A;  1B59 A;  2LKS A;  3CQZ J;  1HF0 A;  3WU0 A;  1TQI A;  1HDP A;  2HNH A;  1H0M A;  1WQ2 A;  1LDD A;  4BYY A;  1LB2 A;  4M6X A;  1APL C;  4NQW A;  5E1Z B;  1DPR A;  2R7D A;  1F5T A;  2EFW A;  4G94 A;  2O8K A;  3AG2 H;  3K0L A;  3JAM Z;  4O3M A;  1UHW A;  2DMP A;  3PO2 J;  2QSF X;  1FC3 A;  1VTN C;  2B9S A;  3E5U A;  1B9M A;  4O6J A;  3WTW C;  2YSR A;  1RET A;  4YFK F;  4C30 A;  2P5V A;  5GPA A;  4BU2 A;  4XLA A;  1ONV A;  2XPV A;  1QBJ A;  1Y6I A;  2X9D A;  3H9Q A;  3LL7 A;  2DTR A;  3GFI A;  1QVT A;  1VF9 A;  1H89 C;  3D5S C;  3K4M A;  4JOM A;  4QLC U;  2AQE A;  2WC2 A;  2OZ6 A;  1Y56 A;  1Z1D A;  3F8F A;  3BQY A;  3WGI A;  3P7N A;  1W5S A;  3L2V A;  2EFQ A;  1FOW A;  3BJO A;  3TP0 A;  2Y48 A;  4IXA A;  2FXA A;  3I59 A;  1ERD A;  2VC0 A;  3J7A O;  2EV5 A;  4NC7 A;  2R7R A;  1A5J A;  4MEY F;  2YU3 A;  5CPR B;  1F1Z A;  2FBI A;  3C2B A;  2RAE A;  4UV8 A;  4DGW B;  3GTQ J;  1GUU A;  3KP5 A;  1KQ0 A;  1YE9 A;  1Z7L A;  1Z6T A;  4GGG A;  4A5N A;  4XBF A;  2LF8 A;  5D4S A;  3DFG A;  5HNF A;  3QWL A;  2UWM A;  3CCM I;  4RDU A;  3H1C A;  3KP3 A;  3RKX A;  5JLW A;  5FLX Z;  2Z1D A;  2G7U A;  1A6Q A;  4GXO A;  2XIG A;  3CCJ I;  4M9S A;  3COA C;  3F22 A;  2VE9 A;  3IH4 A;  4DZJ A;  1ODD A;  1IUF A;  2YS9 A;  1B8I B;  4RLQ A;  1LPQ A;  4G6T B;  2FD5 A;  3CLQ A;  5DYM A;  4UUS B;  3R0J A;  2J5O A;  4MTD A;  3PQJ A;  2L02 A;  2M8E A;  1S7A A;  4HQE A;  1ETX A;  2PMU A;  1B8I A;  5E3M A;  3HUG B;  5L3G A;  1KYZ A;  1ZGW A;  2QA4 I;  1FP1 D;  1VI0 A;  2LFB A;  4A12 A;  1EH7 A;  4G12 A;  2VPL A;  1R7J A;  1YLF A;  3KEY A;  3CCY A;  3HUG A;  1ZYR F;  1QQI A;  4BJ5 C;  4KA4 A;  2NRA C;  3BCA A;  1SC7 A;  1Z91 A;  3GZ6 A;  4BBS J;  4ZTF A;  5LD2 C;  3T8T A;  1ON1 A;  1OPC A;  5F1J A;  4KN7 X;  2HR3 A;  3PSF A;  3ZQH A;  2L4M A;  3OS1 A;  2L7F P;  5B3S H;  2LYC A;  3HOT A;  2AO9 A;  1QHH D;  3ECH A;  3SZP A;  1A04 A;  1NK3 P;  3BG6 A;  2NS8 A;  1YOV B;  1VQ4 I;  5TJJ A;  1RRJ A;  1I3A A;  2FJ1 A;  3LNQ A;  1U5T B;  3OSG A;  4AUX A;  5BPD A;  5L3D A;  2Y9Z A;  3BZ6 A;  3FXJ A;  4HLX A;  2GA2 A;  4G6Q A;  3W3C A;  1V54 H;  3ERM A;  2ZXH A;  2IGM A;  5D4R A;  3ONQ A;  1XMA A;  3TED A;  4QWQ A;  3BR5 A;  4BHC A;  3CES A;  4EGZ A;  1G3Y A;  5HOD A;  4LG3 A;  4EMS A;  4RB2 C;  4KDP A;  3DXJ F;  1ZTR A;  4HG2 A;  4UNO A;  2A6E F;  3BTJ A;  2JRM A;  2EJR A;  2CG4 A;  3H3Z A;  2JPB A;  3S16 J;  1W7P D;  2CH0 A;  1G3S A;  1RR8 C;  5HS7 A;  4CCO A;  1I50 J;  4JK1 X;  2X0L A;  1NH3 A;  1GV5 A;  4P5O A;  3IC7 A;  4JP0 A;  4QIW N;  1IDY A;  4PSW A;  4PJJ A;  1LFB A;  1PVE A;  1MH4 A;  1KYW A;  2RKH A;  4CHU A;  4IOA F;  3HOV J;  2CFX A;  3LSH A;  2P7C B;  4XKC A;  3DBR B;  3Q0V A;  3AG3 H;  4KYW A;  2Q2E B;  3OR1 C;  2W85 A;  1FOX A;  4Z6Y A;  1TNS A;  3TMO A;  1IN6 A;  5FKK A;  4AVP A;  4B09 A;  3LMM A;  1O3S A;  2Q2E A;  1L0O C;  3L2C A;  1WCM J;  3DLA A;  3K4J A;  3WU2 C;  4JX4 A;  2DA6 A;  3E6M A;  2M0M A;  2Z33 A;  2HOT A;  2R7T A;  3PJR A;  5E3O A;  2QVO A;  3MAJ A;  1DPU A;  3I64 A;  4BH9 A;  4AIH A;  4ENJ A;  3HTU A;  2IW5 A;  1N77 A;  1ZR2 A;  1YTY A;  1RES A;  1F36 A;  1P9Q C;  1X3W B;  3DPU A;  3A0H C;  4MNU A;  3V8K A;  2BVM A;  4IVN A;  2VJI A;  4YIR X;  3N05 A;  2H1K A;  4FHT A;  2O6G E;  2CQX A;  4BE1 A;  5JVG F;  5E79 C;  3FXO A;  2E7X A;  2DT6 A;  2VXZ A;  2COM A;  2H8R A;  2KP6 A;  3HKZ N;  5HNH A;  1KU2 A;  1NG6 A;  2CMP A;  3LAP A;  3IH2 A;  5J47 A;  4M6Y A;  3RKQ A;  2GIZ A;  1EA3 A;  1R00 A;  1FY7 A;  3CMM A;  1HW5 A;  4XM3 A;  2XDV A;  3HBL A;  2BYV E;  4WCG A;  1S72 I;  3RSN A;  1X4O A;  1LVK A;  4P96 A;  3AKZ A;  3T0Y A;  2VB6 A;  2DCE A;  1FBQ A;  4HF1 A;  4Y13 A;  1G4D A;  2HQN A;  3T5X A;  1D8J A;  2XAG A;  1BOB A;  3GLX A;  5IPA A;  3J81 K;  3ZMZ A;  4ZYG A;  5D5V B;  3ABK H;  3RYR A;  2XRO A;  1WWX A;  1U0J A;  4I09 A;  2XF5 A;  3BR3 A;  4M3D A;  2GA1 A;  1FZP B;  5DTD A;  3O2P E;  4LB6 B;  1B4A A;  3EDP A;  2K9S A;  1PP7 U;  1XSV A;  2EZH A;  4AD9 A;  1AKH B;  1Q1V A;  3C2H A;  5LLQ A;  1DDN A;  4I6Z A;  5F0F A;  4X1E A;  2XAU A;  2J5P A;  1A35 A;  4P9U A;  5KCM A;  1AKH A;  4OMY A;  4LB5 A;  3RZO J;  4BXF A;  5DD8 A;  3WGH A;  1LFP A;  2CU7 A;  1X1B A;  4PJM A;  4HLY A;  1F43 A;  2IGN A;  4WXH A;  3JTG A;  3IWZ A;  4BQO A;  1D5Y A;  1D3Y A;  2XAQ A;  1OR7 A;  4XKW A;  1ETY A;  2M0C A;  3GEZ A;  4GDF A;  2EFP A;  1H8A C;  3S17 J;  2EA4 A;  1XTA A;  1W36 D;  3H92 A;  2LY1 A;  2BY3 A;  1BW6 A;  3F6O A;  3LSR A;  1XMK A;  2EIN H;  4CSW A;  1ON2 A;  1MMA A;  2WA0 A;  1X3Z B;  2CV0 A;  3BQZ A;  4IPA A;  3SHF A;  3K70 C;  2Q1Z B;  2IS2 A;  1IJW C;  3KFW X;  3IWF A;  3KP2 A;  3H0G J;  3P9K A;  3RJP A;  3WG7 H;  3CP8 A;  3NAU A;  3BG3 A;  1I6X A;  3E97 A;  3GTJ J;  2E2H J;  1UHM A;  1LKX A;  3HOU J;  1VQM I;  2M1B A;  3F8M A;  4EV0 A;  3WTS C;  4FIS A;  5E18 F;  1XGM A;  2PI0 A;  4BJ6 C;  1OQY A;  3C3W A;  1K83 J;  1S8N A;  5HS8 A;  3H5R A;  2HKX A;  4MFE A;  2HPI A;  3BR6 A;  2ECB A;  2VUM J;  1STZ A;  4DOZ A;  3SEQ A;  1YS7 A;  4XNF A;  4ZZL A;  3M1E A;  4V19 K;  5EDN A;  2XAH A;  4JX5 A;  4MQ9 F;  1X1C A;  2JRT A;  1R36 A;  1YW9 A;  2ADU A;  1FMV A;  3FMQ A;  4CH7 A;  1RPW A;  2AQF A;  3GUD A;  2V9P A;  3K4B A;  3MVP A;  4G8X A;  4IHY A;  4MHG A;  2HFH A;  2ID3 A;  3RZD J;  2F5V A;  2P6T A;  3HOS A;  2R0Q C;  1W7P A;  2CJJ A;  2K85 A;  4IHS A;  2QUF A;  4IRG A;  2DLL A;  2IS6 A;  1YHQ I;  1OCR H;  4IEJ A;  3BRO A;  2STT A;  4JQF A;  1TQP A;  1JHH A;  2W57 A;  1SFK A;  2C6Y A;  2BXY A;  1XGS A;  3JW4 A;  1T98 A;  1DGW Y;  1GLN A;  4LOC A;  2W25 A;  1MH3 A;  1G3T A;  2PQ8 A;  4IKF A;  5TRD A;  4NUB A;  3OWT A;  1BL0 A;  4EAT A;  4KIF A;  4PK4 A;  2FQ4 A;  2JVG A;  3E1S A;  2VT2 A;  4KMU X;  3L09 A;  3RCO A;  1RI7 A;  1VQO I;  3HPG A;  2FOW A;  2CGP A;  3ZQC A;  1P4A A;  3CCQ I;  2E2I J;  4XK4 A;  5C44 J;  2ZBK A;  4IOC F;  2LY9 A;  4Q47 A;  4NBQ A;  5FRM A;  3ZMS A;  1GVJ A;  1VQ9 I;  2P5L C;  1N78 A;  2M4K A;  3IUO A;  2JA8 J;  5D6F A;  3R0A A;  5L3B A;  1XC5 A;  3PM1 A;  2IA1 A;  2JA2 A;  5E3L A;  4LGW A;  3CME I;  4I7H A;  3GBG A;  4NB5 A;  3F0C A;  2X85 A;  4XOR A;  5IT9 Z;  1TW3 A;  3CJT B;  3HTS B;  2K86 A;  1S3J A;  3PIO F;  3K9T A;  1OMI A;  2XAF A;  1LFU P;  2EWN A;  1Z0X A;  1SVM A;  2NOG A;  2CW0 F;  5LRR A;  1L3L A;  1VZ0 A;  3ASN H;  2UV1 A;  3ML6 A;  1JT6 A;  3EUA A;  2ICW G;  1BI2 A;  2HOE A;  1S9H A;  2VC1 A;  3AFH A;  3CMA I;  3F6V A;  4M3E A;  4M9X A;  1TNT A;  3HSR A;  5DEQ A;  1HA8 A;  2NAZ A;  4OMZ A;  1FNN A;  2XAJ A;  2F5C A;  2M2E A;  2STW A;  2XF6 A;  1ZN2 A;  3CP2 A;  3RTR A;  3KPH A;  1GXP A;  2DOD A;  3HOZ J;  3WE3 A;  1ZQ3 P;  4RGS A;  3N4M A;  2R7V A;  2DA4 A;  1SMT A;  2R4G A;  2ELJ A;  4C3H J;  3DKY A;  5J3L A;  2XB0 X;  4DNC A;  3K69 A;  5L3F A;  1IRF A;  1I3Q J;  2VON A;  1BBY A;  3O8H A;  1Z6R A;  2FRH A;  1R71 A;  1RKT A;  2P81 A;  2XGX A;  3OV8 A;  3WTZ A;  3E6D A;  1HW2 A;  3HRM A;  4ZYA A;  2RQQ A;  2EIM H;  4WWC A;  2LTP A;  1VQP I;  2E1C A;  5ILV A;  1R49 A;  1YG2 A;  1X58 A;  2ZFU A;  2GWR A;  1Z67 A;  3GVA A;  3T8R A;  1QGP A;  4EJO A;  5EGO B;  3ZQG A;  3JRD A;  2CV1 A;  2XRL A;  5KVR A;  2R5Y B;  1T39 A;  1LDJ A;  1FIA A;  3VOE A;  4C3I J;  3BY6 A;  2LBF A;  2VOD A;  4J01 A;  2EV6 A;  2ESH A;  3D5L A;  1UG2 A;  5LHG A;  3BTC A;  1MNE A;  2DJN A;  5J8F A;  3LFK A;  4O5V A;  1Z7U A;  2Y31 A;  2KMU A;  1C0W A;  2BHZ A;  1IN4 A;  1D0Y A;  3WTU C;  2MC4 A;  3ESW B;  4ZDP A;  5EJC A;  1XDS A;  4DJA A;  1WJF A;  3OYL A;  1T6S A;  3CUO A;  4BJT A;  3PIP F;  1YJN I;  3S3O A;  4PJL A;  1XSX A;  3ABU A;  3FXM A;  1VFC A;  3CJR B;  2P0W A;  2P6S A;  4I0B A;  3TL4 X;  1QHG A;  3VSL A;  4HNV A;  2VQC A;  1FYK A;  4KMF A;  3RPQ A;  5E17 F;  1MW7 A;  5LHI A;  3BG5 A;  3FXQ A;  2VBX A;  2VKV A;  4N9I A;  1ZKG A;  1MBH A;  2E35 A;  3S1M J;  1BA5 A;  1YJ9 I;  2VOO A;  1ORK A;  2KRF A;  3OYK A;  2HYF A;  2DJI A;  2DA2 A;  1DUX C;  2O3F A;  2LNB A;  2M3A A;  4AU7 A;  1SAX A;  4LLG F;  1UST A;  2BZT A;  2NS0 A;  4L9N A;  2E1M B;  2ZJP F;  1POG A;  2L01 A;  4RB3 C;  4HF2 A;  3LWF A;  3ZQI A;  3A0B C;  2BY0 A;  3U1D A;  4ZTJ A;  1ZGJ A;  2O61 A;  2X1C A;  5CQE A;  1ETQ A;  3I53 A;  3VFZ A;  1PJR A;  1P7I A;  3ELK A;  5IY5 H;  5E3N A;  2R7F A;  2IPQ X;  3SQN A;  3I4P A;  4UV9 A;  2K40 A;  2KKO A;  4YII A;  2DOF A;  1N75 A;  2ZFW A;  4F55 A;  3QYF A;  4CYD A;  4MLO A;  4XRS A;  3SJM A;  2CUJ A;  2L7M P;  3M4O J;  1RNL A;  1LNW A;  4A6D A;  2GM4 A;  1LVA A;  2W48 A;  1LE8 B;  1Y1V J;  3OYC A;  2IVM A;  5LRS A;  1K6Y A;  3QU3 A;  2A61 A;  2EPF A;  5C4X J;  2HVQ A;  2QBY A;  2OC6 A;  2DFF A;  1LE8 A;  4B44 A;  3S2D J;  1RZ4 A;  4A0X A;  1MBG A;  3TO9 A;  4LD5 A;  1IW7 F;  2FBK A;  3ZGK A;  4KIT B;  5TIS C;  3F8N A;  1OKR A;  5GAE J;  1U6G A;  3FXU A;  3CCU I;  4AIK A;  1FLI A;  5ILU A;  3VYS B;  3OL3 A;  4IL6 C;  4V2F A;  1WH5 A;  3D0S A;  2DA3 A;  4QPO A;  5KAF C;  1IO2 A;  2VN2 A;  4CUG A;  1T08 B;  2DU9 A;  3QPL A;  4HPQ A;  4I02 A;  1JUM A;  1U9N A;  4XQF A;  4LLN A;  4BUP A;  2HYJ A;  3RQ4 A;  2JWT A;  3F21 A;  1O7F A;  2KFD A;  3K7A J;  5LFA A;  2K9N A;  1TC3 C;  5EF6 A;  2MG4 A;  3IAM 2;  3KIO A;  1P2F A;  2PFB A;  3I54 A;  5F08 A;  2HZD A;  2XUB A;  3GW2 A;  3KE2 A;  1W36 C;  3E0J B;  4HNT A;  4EJV A;  1I27 A;  1ETK A;  4CXF A;  5FLV A;  2I8D A;  4FX0 A;  1X4P A;  2DT7 B;  5M3M J;  1UCR A;  2OZU A;  3A2K A;  1RIO H;  4FE7 A;  1Z77 A;  2ETH A;  2D2W A;  4XLN F;  3D5R C;  2V4J C;  1T0F A;  1IXR C;  3OIO A;  2OA4 A;  2G9W A;  3O6B B;  2R7S A;  1K7A A;  3ASO H;  3JRC A;  2M7A A;  1I39 A;  2EZI A;  1AOY A;  1OYY A;  2OTJ I;  3QPT A;  1HLV A;  5IT9 K;  4QSH A;  2O9L A;  1H88 C;  2A68 F;  1ZLJ A;  2CUE A;  3ZQ7 A;  3WTV C;  2OCE A;  2MYS A;  4UHT A;  1V3F A;  2HKO A;  2DO7 A;  2HVR A;  1YX5 A;  2WAE A;  2O5R A;  2MLG A;  5B1B H;  4HAM A;  1MKM A;  2RNJ A;  1JJ6 C;  2W4S A;  2FA5 A;  3F8B A;  4A3L J;  5E20 A;  5IYB J;  5FKM A;  1ENH A;  1YQA A;  4BE0 A;  3C7J A;  3TDU C;  2CQK A;  2Y75 A;  3CD6 I;  1LJ9 A;  3JRG A;  1D8K A;  1XB4 A;  2LLK A;  3K1P A;  4BEH B;  4ANJ A;  4KFC A;  4HA8 A;  2ZJ2 A;  3DEE A;  5KNL A;  4HDU A;  1XX5 A;  4FE4 A;  4XLC A;  1SVL A;  2V9V A;  3J7Y J;  2EZL A;  1SD4 A;  3L7W A;  5CQG A;  1QPI A;  3FKJ A;  2DQR A;  2RDP A;  1WGX A;  2Y0S A;  3LSG A;  3PL8 A;  4CDG A;  5E8G A;  2VI6 A;  5ERI A;  2X4H A;  5FFX A;  4D7M A;  2L3D A;  2MA3 A;  3QYB A;  3FHZ A;  4A3G J;  3IKT A;  1BJA A;  3HOX J;  1IC8 A;  2ID6 A;  2XV4 S;  4MQV A;  5AIQ A;  3JRH A;  3TDZ C;  3W2A A;  3G4S I;  2CQQ A;  5FO5 A;  3RIR A;  2OBP A;  4LIV A;  2Z3Y A;  3LQQ A;  1R1V A;  4RAF A;  4YEL A;  5HVQ C;  4U7B A;  4HBL A;  5BMZ A;  1WSU A;  3VYU B;  3OYA A;  3BPV A;  4B48 A;  2L9N A;  2QQ9 A;  1TBX A;  4UUS A;  1VQ8 I;  4GFB A;  3KEO A;  4BAC A;  1YW8 A;  1R1T A;  1XMX A;  3IRR A;  3HM5 A;  2KIU A;  2ME0 A;  1UEL B;  2QYO A;  1FMW A;  4I01 A;  4A93 J;  1IGN A;  2XC7 A;  4FX4 A;  2E5Z A;  3OS0 A;  2ZNZ A;  5IYD J;  3RQI A;  3ZN0 A;  1I1S A;  2H1L A;  2V6E A;  4U0Y A;  1ZG3 A;  2Y30 A;  4ASN A;  1REP C;  1GXQ A;  3EPZ A;  3ZR8 X;  2A5W A;  5ICE A;  4IHT A;  2DW4 A;  2L9S A;  4LK0 F;  3QP6 A;  2D1H A;  2VXD A;  4EJT A;  3AG4 H;  3K4L A;  2OJE D;  3FF5 A;  5E1W A;  3OYH A;  3IV5 A;  3CC2 I;  1WH7 A;  2OQG A;  2PEX A;  2R92 J;  3HKZ A;  2X6O A;  2JA6 J;  3P9C A;  4KIS A;  3MN2 A;  4R1H A;  4D5F A;  3OYB A;  2WV1 A;  3G3Z A;  1CF7 B;  1U5T A;  1WKM A;  4OIR F;  5IT3 A;  1J5Y A;  3BT9 A;  4WXD A;  1K4S A;  2XGD A;  3S14 J;  3V8L A;  1PDN C;  3SDB A;  2DYR H;  5GAH J;  5F0C A;  1KON A;  1S6L A;  3ZQL A;  4GYI A;  3H36 A;  3LA7 A;  1ETV A;  4WX9 A;  2DOA A;  5EEH A;  4HNU A;  1T38 A;  1J0R A;  3SEZ A;  5KHD A;  3GO5 A;  1AWC A;  4PDK A;  1X2M A;  3FX3 A;  3LSP A;  4XLH A;  1WJC A;  1QZY A;  2Y0S N;  3ZP5 A;  1HQC A;  3MZY A;  1T0F C;  2NOJ B;  4HW0 A;  2BW3 B;  2DFI A;  3L1P A;  4CZC A;  3JRI A;  5K7F A;  4EM2 A;  2RQP A;  1LQ1 A;  2LK2 A;  2BW3 A;  1VQ5 I;  5CVJ A;  2IA0 A;  3E7L A;  1IAW A;  3IKV A;  4BS9 A;  2DDB A;  2FEZ A;  4W97 A;  4PFP A;  5FKN A;  2V26 A;  2PJP A;  2JVH A;  4UXN A;  4M3G A;  2A69 F;  2Y69 H;  5GP9 A;  3SZT A;  4M71 A;  2R7Q A;  2M45 A;  3QRF F;  1BM9 A;  2HVS A;  3DTI A;  4E7K A;  3J80 Z;  2ZCW A;  1B1B A;  5M5W J;  3JRB A;  2UUZ A;  2WTE A;  2BOL A;  2ZSI B;  4FCY A;  2AS5 F;  2PLY A;  1NHA A;  3FDY A;  2IAI A;  4ZDO A;  1BOA A;  3HHG A;  4HST A;  4NDL A;  2ACJ A;  5JR3 A;  1J2X A;  5E1X A;  1MMS A;  3DKW A;  2RRE A;  2F6C A;  3HJE A;  3WHB A;  5GAG J;  4MO7 A;  1MMN A;  4GO1 A;  4EGY A;  2FML A;  3JRA A;  4WK8 F;  3IRQ A;  2L0K A;  2MBF A;  2E7W A;  3DLL F;  4I2O A;  2LKP A;  2XVC A;  2V6C A;  2OV7 A;  3H9J A;  4RMN A;  3H9G A;  1O3R A;  3BC8 A;  4MEX F;  1SAN A;  3CF5 F;  3TGN A;  4S0H B;  1KU3 A;  2EQR A;  4OWR B;  1S7O A;  4A5M A;  3MKY B;  5DM6 F;  2EZK A;  2BEO A;  2LOO A;  3IP4 B;  3MWM A;  3MKZ A;  3H35 A;  4PJ0 C;  1BI1 A;  3PNT A;  1JUS A;  3G1L A;  1LEB A;  3FMR A;  2LH9 A;  5K1Y A;  2NNN A;  4Q48 A;  3X2Q H;  1PUF B;  3HPH A;  3O3K A;  1IDZ A;  1O57 A;  1Y0U A;  1DQU A;  1PUE E;  2RNG A;  1O4X A;  5AON A;  3GFM A;  3L2Q A;  1PUF A;  1G3W A;  4LG0 B;  3S1Q J;  2HZT A;  3JAM K;  1WJ5 A;  4C2T A;  2ZME B;  3BR0 A;  3S8P A;  2UZK A;  3GME A;  2E5N A;  1IXC A;  2DQL A;  4C3J J;  5HLT A;  3BZC A;  2CSO A;  5B1A H;  6PAX A;  2NVQ J;  3HRU A;  1B72 B;  4IQ4 A;  2BY2 A;  3GLL A;  4IHV A;  4HX7 A;  4AC0 A;  2CW8 A;  2GLO A;  3I71 A;  2ME6 A;  1JTX A;  1KQ9 A;  2DMN A;  3NWT A;  4Y7N J;  1U5T C;  1SMY F;  5B5E C;  2D5V A;  2QKL B;  2DI3 A;  1SD7 A;  1YS6 A;  4E7I A;  1S7E A;  2K4J A;  3FMS A;  1MMG A;  2IJL A;  1M1E B;  1KA8 A;  2LRE A;  3ROU A;  3TOA A;  5DUI A;  4IHW A;  3M8F A;  2E1N A;  4EM1 A;  4ZYD A;  3BOQ A;  1RUN A;  4E4H A;  2XF7 A;  2YX4 A;  3EUK L;  3HRT A;  2R5Z B;  1LUJ B;  1NK2 P;  5IYC J;  3DU6 A;  4OIQ F;  2KZV A;  1W5T A;  3QOE A;  4A3F J;  2V1U A;  5ICG A;  4ZDL A;  2EK5 A;  2P4W A;  3KP6 A;  1J09 A;  1MBJ A;  4CCM A;  3B6A A;  2R5Z A;  3FXR A;  5FLX K;  3CJQ B;  5JI6 A;  1W4M A;  3FBI B;  4LK1 F;  1IV8 A;  3QPS A;  3WG9 A;  5IOY A;  2ZKZ A;  2FE3 A;  3B02 A;  1BN5 A;  4JX6 A;  3MCZ A;  2KT0 A;  2W84 A;  1VND A;  1USS A;  1E3P A;  3LST A;  2DMQ A;  4EEF G;  1WPK A;  3PUB A;  4K2E A;  4N4N B;  5JHF A;  4YFX F;  3TOB A;  5KK1 A;  2ZXI A;  1VQK I;  4ENK A;  2WBM A;  1W0T A;  4N9H A;  5J4Y A;  3SFI A;  3K6G A;  4YRV A;  2HQ5 A;  2K7L A;  1Y39 A;  3ZN1 A;  3Q0W A;  4QPQ A;  1GT0 C;  4RS8 A;  1FTZ A;  3H3V K;  4RGR A;  2CUF A;  3I9V 2;  2MAB A;  1NTC A;  5LGT A;  1HCR A;  2G0E A;  2P5K A;  5EZG A;  1IV6 A;  5HDG A;  3U21 A;  4FAS D;  2MD0 A;  4F7Z A;  3CCV I;  3CO7 C;  3GFL A;  2DFE A;  4XLP F;  2GIV A;  3OYM A;  2F4I A;  1IRZ A;  3E3V A;  1TWF J;  4G6D A;  3TKY A;  5K5Q A;  3PO3 J;  2TCT A;  3MZ8 A;  1TT5 B;  3AAF A;  1S5L C;  5HDK A;  2X1D A;  2DT5 A;  2A6T A;  1F4K A;  3BZK A;  3CCE I;  1X3U A;  2ELH A;  2VQG A;  1SFE A;  4ZYE A;  2PJR B;  4A69 C;  2AXL A;  3W6K B;  2JT1 A;  1UZC A;  5HOO A;  2A3S A;  3LSM A;  3TO7 A;  2W7N A;  1QRY A;  1T33 A;  2PJR A;  5F04 A;  3J7A Y;  3I55 I;  1QVU A;  1B9N A;  1HKQ A;  1E2X A;  2H8W A;  3F9K A;  2H94 A;  4DYR A;  4P1W A;  3WTT C;  1ULY A;  5CYV A;  4KUM A;  3BPX A;  2RN7 A;  3GX4 X;  1XD7 A;  3FM3 A;  1KU7 A;  1WI9 A;  4M74 A;  3OL4 A;  1YI2 I;  1JKO C;  4LJZ F;  1OFC X;  3CDH A;  3CF2 A;  3C18 A;  2NVU B;  5EEA A;  2XSD C;  2EIJ H;  3FIS A;  3VOD A;  4EM0 B;  1K6O A;  1EF4 A;  3H3U A;  3K4N A;  3OSF A;  4BQN A;  3QP5 A;  2QWW A;  5TGT A;  4P55 A;  4XOP A;  4M3F A;  2GXB A;  1K78 B;  4PZJ A;  4ESJ A;  4BXU A;  4HF0 A;  2DMU A;  4PGG A;  2FX0 A;  1U3E M;  5LGN A;  1Y8R B;  4HZF A;  3E5X A;  1ACI A;  4L18 B;  1OR7 C;  4RB1 A;  4BBR J;  3F72 A;  2O8X A;  1H9G A;  2MC3 A;  2F4O B;  1JT0 A;  3VYT B;  2W82 A;  4L9T A;  2Z2S B;  1YW7 A;  1SVO A;  4I76 A;  3FZV A;  1W5C C;  4C2U A;  3S93 A;  5BS6 A;  3GTG J;  4R79 A;  1ZRE A;  5A2Q Z;  1K61 A;  2L5Q A;  3SFZ A;  4AIJ A;  2DA1 A;  4C2M J;  1XS9 A;  3CUQ B;  1HKS A;  1SAU A;  1X19 A;  3BJ6 A;  3FKI J;  3OYI A;  3DP7 A;  1ZHF A;  3E5Q A;  4ZJZ A;  3Q9V A;  2KIF A;  4UB8 C;  1O3T A;  1P6R A;  3CUQ A;  2EBI A;  2WAQ N;  2H6B A;  4CYC B;  1R5I D;  3PNY A;  3OYN A;  3PQK A;  2VQL A;  4B8X A;  1FWZ A;  3WU1 B;  2GQQ A;  4RA2 A;  1ZRF A;  2M34 A;  3JTH A;  5F64 A;  3OMY A;  3DQV C;  4HOB A;  2FUG 2;  3L9F A;  4MTE A;  1TWC J;  1FYM A;  3I56 I;  4BDZ A;  5K5O A;  2K4B A;  2KIQ A;  1QZZ A;  3F8C A;  4CA0 A;  1J7K A;  5EGO A;  3OY9 A;  1WJA A;  2RGV A;  1I1G A;  4UVC A;  2R5Y A;  1JKP C;  1JXS A;  1VQN I;  4G7Z F;  4AYB A;  2KDO A;  4PJN A;  4EVI A;  2AXT C;  3VPR A;  4AWX B;  3JSP A;  2G7H A;  2YR2 A;  1XGN A;  1VQL I;  2DN0 A;  3JCU C;  2QF7 A;  4Y3O A;  3KYD B;  3LA2 A;  1BIA A;  3M7G A;  1WJB A;  4D5C A;  1XG1 A;  1FBU A;  1BI0 A;  2B63 J;  4TV7 A;  1RUO A;  1E3O C;  2EFN A;  3WOD F;  4WF2 A;  4NC6 A;  4B3X A;  2ECC A;  5GPC A;  3FK6 A;  3L00 A;  2X48 A;  3DBL B;  2ESN A;  3VB2 A;  3L2R A;  3ABT A;  2XPU A;  1TWG J;  1GV2 A;  1JJ8 C;  1TWH J;  4OAZ A;  4F52 A;  5LHH A;  1BC7 C;  2YU9 J;  3I4M J;  1QO0 D;  2O03 A;  4CCL A;  4FTH A;  3ZMT A;  1Y0N A;  3OR2 C;  2WY8 Q;  4CO8 A;  4M73 A;  4II2 A;  2X1E A;  3R6S A;  3ZRG A;  4BHP A;  3FIW A;  2OTL I;  2EIK H;  1FJL A;  5HDN A;  1HXD A;  1UMQ A;  2VKD A;  1D5V A;  1R1U A;  1G8X A;  3ABL H;  1EJ9 A;  2HEO A;  4L5I A;  4NHJ A;  1HOM A;  2FOK A;  1UHS A;  3GCM A;  3K4K A;  2V7F A;  3E6C C;  1T95 A;  5J1R A;  3SZG A;  2KL4 A;  2OAZ A;  1FIP A;  4A3E J;  4KT6 A;  3ZMV A;  5GAD J;  3DCF A;  2CYY A;  1D0Z A;  1YRN B;  1OYI A;  2V9K A;  1QA6 A;  3GYH X;  3DV8 A;  4EJU A;  3R4K A;  4MFD A;  4DBQ A;  3M3Y J;  2WY7 Q;  2VOP A;  4CCK A;  4CCN A;  4XRM A;  5CVU A;  3HRS A;  2M8G X;  3GTM J;  2L9R A;  2X6Y A;  1Q1H A;  3GZN B;  1AU7 A;  3ZXS A;  1OLT A;  3SDG A;  2W00 A;  3W2W A; 
#chains in the Genus database with same CATH homology
 1U0J A;  3OYF A;  2XF5 A;  4PUS A;  2E5Z A;  2XC7 A;  1UAA A;  4X0G A;  3OS0 A;  3DU5 A;  2CV2 A;  2V6E A;  2CS3 A;  4LIU A;  3EPZ A;  3ZR8 X;  3C2H A;  2A5W A;  3S3N A;  2L9S A;  2XAU A;  2OUM A;  2VXD A;  2HU9 A;  3H5A A;  4RM3 A;  3K4L A;  5KCM A;  3OYH A;  2KQR A;  4BXF A;  1LFP A;  1X1B A;  4PJM A;  3V42 A;  2W1O A;  2IGN A;  3HKZ A;  3L2U A;  4BQO A;  4KIS A;  4XLE A;  1BR1 A;  3OYB A;  4XKW A;  4U87 A;  1W36 D;  4PFO A;  2CW7 A;  2LY1 A;  3SDB A;  3K70 D;  1KON A;  3VWB A;  2QKM B;  4IQJ A;  4CSW A;  2DOA A;  3DPL C;  4HNU A;  1D1B A;  1MMA A;  2XSJ C;  1D1A A;  2WA0 A;  2CV0 A;  3K70 C;  3SEZ A;  2IS2 A;  2Q1Z B;  4B47 A;  5KHD A;  4BE2 A;  3CP8 A;  4FET A;  4NC8 A;  2K9L A;  4XLH A;  1WJC A;  1T0F C;  2NOJ B;  1LKX A;  2BW3 B;  4Y4R A;  4CZC A;  3W2W A;  4HRI A;  2IGO A;  2K5C A;  1UG0 A;  2IXS A;  4BJ6 C;  3ZQQ A;  4CCJ A;  2BW3 A;  4LIT A;  4HEA 2;  3H5R A;  2HPI A;  4J00 A;  4BS9 A;  2CFO A;  2LBF B;  2X51 A;  4HSR A;  4DOZ A;  4NQW B;  3SEQ A;  4PFP A;  3DWL E;  2V26 A;  4XNF A;  2JVH A;  4H4K C;  1X1C A;  3OIP A;  2R7X A;  2R7Q A;  2VKH A;  1FMV A;  2HQA A;  4D1Q A;  4CH7 A;  2HVS A;  2VJ4 A;  3DTI A;  2AQF A;  4DIQ A;  4E7K A;  3K4B A;  2F5V A;  3HOS A;  2UUZ A;  4E7S A;  2BOL A;  2ZSI B;  4E7Z A;  4ZDO A;  3FDY A;  3S32 A;  4HST A;  1AA7 A;  2IS6 A;  4E6K G;  2RRE A;  2F6C A;  2WAD A;  4JQF A;  1MMN A;  2L2O A;  1Z3X A;  1SFK A;  2DXI A;  2V1N A;  1DGW Y;  2R7O A;  1GLN A;  3LFU A;  4BEH A;  2KRH A;  3HXL A;  3LSK A;  4OAY A;  2LRD A;  2E1M C;  4IKF A;  3PNV A;  1BR4 A;  4NUB A;  3OWT A;  4EAT A;  4PK4 A;  2OV7 A;  3H9J A;  4RMN A;  3H9G A;  2JVG A;  3BC8 A;  3E1S A;  3OYE A;  2VQH A;  3RCO A;  2IS1 A;  3HPG A;  3OYJ A;  3EUH C;  4OWR B;  1Z21 A;  3BCB A;  3MKY B;  3M1C A;  4BQQ A;  2LOO A;  3IP4 B;  4F3Q A;  3MKZ A;  3H35 A;  5FRM A;  3PNT A;  2LH9 A;  2ZSH B;  3BG7 A;  3UR3 C;  1N78 A;  2M4K A;  3IUO A;  4ZC3 A;  3PSI A;  4GRI A;  3HPH A;  3FHN A;  2CUZ A;  3VDX A;  1DQU A;  1WJD A;  2RNG A;  2E60 A;  1PYV A;  2JA2 A;  1TZL A;  3L2Q A;  3GBG A;  4F92 B;  2X85 A;  4XOR A;  1WJ5 A;  1NG7 A;  3OYD A;  4C2T A;  1LDK B;  1ZEL A;  3S8P A;  4XKV A;  3OYG A;  3CZ6 A;  3S3M A;  2Z16 A;  4XOT A;  1E0E A;  2E5N A;  5HLT A;  3VYR B;  1VZ0 A;  3OOU A;  2LC2 A;  2UV1 A;  3EUA A;  4BGD A;  4IQ4 A;  2HDW A;  3OS2 A;  1S9H A;  3AFH A;  1X1D A;  2CW8 A;  4XN3 A;  2WAF A;  1MMD A;  3NWT A;  2KLO A;  4AVZ A;  1HA8 A;  2QKL B;  2KHM A;  2VJ5 A;  2XF6 A;  2JSP A;  4E7I A;  4YEJ A;  3CP2 A;  3RTR A;  1MMG A;  2LRE A;  2KPM A;  1D1C A;  3HL2 A;  4DBR A;  3L2W A;  3MMY B;  5CKT A;  4E4H A;  2XF7 A;  2R7V A;  3EUK L;  2R4G A;  2ELJ A;  3UNG C;  3MKW B;  3DKY A;  4II3 A;  3DU6 A;  4F91 B;  2KZV A;  3QOE A;  1QU3 A;  3M8J A;  4ZDL A;  4D9J A;  1IRX A;  1YX3 A;  1J09 A;  4CCM A;  3QOD A;  2R7W A;  3CJQ B;  3FBI B;  3BLY A;  1TT0 A;  4ZYA A;  2RQQ A;  3VSK A;  1BR2 A;  3NWS A;  2ZFU A;  1FMW A;  4XR6 A;  1V5E A;  2CV1 A;  2HNH A;  3PUB A;  4N4N B;  2JUG A;  5JHF A;  1WJE A;  2LBF A;  4J01 A;  2ZXI A;  3D5L A;  2WBM A;  4E7J A;  1MNE A;  2R7U A;  2KMU A;  3K6G A;  3PFY A;  4YRV A;  1D0Y A;  2K9M A;  4QPQ A;  2MC4 A;  3HG9 A;  4XKB A;  4ZDP A;  3ZCO A;  3K10 A;  4C30 A;  3LSI A;  3I9V 2;  2MAB A;  4DJA A;  2MFZ A;  1R6R A;  1WJF A;  3OYL A;  4BU2 A;  1DGR M;  1X1A A;  4XLA A;  3U21 A;  2KRC A;  4FAS D;  4BJT A;  1Y6I A;  2MD0 A;  3H9Q A;  3LL7 A;  1JI8 A;  3S3O A;  4PJL A;  3OYM A;  3FBN B;  3AL0 B;  2GOX B;  2F4I A;  3CJR B;  3D5S C;  3K4M A;  3KX2 A;  4JOM A;  2BVL A;  2P0W A;  3TL4 X;  1QHG A;  3VSL A;  2AQE A;  2VQC A;  1Y56 A;  3L2V A;  1MW7 A;  2X1D A;  2A6T A;  2PMZ A;  1D0X A;  2VQG A;  1ERD A;  2PJR B;  4NC7 A;  2X6X A;  4KJZ A;  2R7R A;  3OYK A;  5HOO A;  3LSM A;  2DJI A;  5CPR B;  2W7N A;  4DGW B;  2PJR A;  2M3A A;  4AU7 A;  4E7L A;  1YE9 A;  1Z7L A;  3J7A Y;  2E1M B;  2VAS A;  4PSX A;  2X6W A;  3F9K A;  5HNF A;  2UWM A;  4P1W A;  4RM2 A;  4ZTJ A;  2Z1D A;  3OL4 A;  4N4O B;  2X1C A;  4NNJ A;  5CQE A;  2L7K A;  3CF2 A;  1PJR A;  4RLQ A;  4G6T B;  3C2G A;  4E7H A;  3K4N A;  4BL0 B;  4BQN A;  1N75 A;  3HUG B;  4F55 A;  3QYF A;  5TGT A;  4MLO A;  4XOP A;  2CUJ A;  4XLF A;  2VPL A;  3KEY A;  4IX7 A;  4BJ5 C;  3BCA A;  3OYC A;  1OR7 C;  4XL9 A;  1K6Y A;  2IS4 A;  4ZTF A;  2HVQ A;  5LD2 C;  3VYT B;  2W82 A;  2OC6 A;  4C9Y A;  3PSF A;  3OS1 A;  4B44 A;  3HOT A;  2LYC A;  2Z2S B;  1G59 A;  3DTK A;  1QHH D;  2VL8 A;  4C2U A;  3S93 A;  3ZGK A;  3A1Y A;  4R79 A;  3BG6 A;  4KIT B;  2L5Q A;  4XON A;  3VYS B;  3OL3 A;  4QPO A;  1SAU A;  1X19 A;  3OYI A;  4CUG A;  4ZJZ A;  3DPT A;  4HPQ A;  4Y33 A;  2VJJ A;  3W3C A;  4XQF A;  4BUP A;  2ZXH A;  2IGM A;  3ONQ A;  3RQ4 A;  3PNY A;  3OYN A;  5LFA A;  2VQL A;  3CES A;  3IAM 2;  1V5F A;  4LG3 A;  2HZD A;  3OMY A;  3DQV C;  4HG2 A;  2FUG 2;  1W36 C;  4XN0 A;  3E0J B;  3IAS 2;  4HNT A;  4BDZ A;  2I8D A;  1X4P A;  2DT7 B;  2CH0 A;  3A2K A;  2WB1 A;  4ITV A;  4CA0 A;  4CCO A;  2VLA A;  3RPU D;  3OY9 A;  1WJA A;  4P5O A;  2LG4 A;  2V4J C;  2GOM A;  3D5R C;  4PSW A;  4PJJ A;  3I3L A;  4AYB A;  2R7S A;  2KDO A;  4PJN A;  4F93 B;  2M7A A;  3LSH A;  4XKC A;  2VIX A;  2Q2E B;  4Y3O A;  3OR1 C;  3QYE A;  1WJB A;  3TMO A;  4XMY A;  2MYS A;  3LMM A;  1V5G A;  4B3X A;  2HVR A;  3DLA A;  3K4J A;  1YX5 A;  2WAE A;  3AL0 C;  2O5R A;  3W2V A;  1WFX A;  3L2R A;  1DP3 A;  2M0M A;  2R7T A;  2W4S A;  3PJR A;  4OAZ A;  4F52 A;  2WAQ A;  1N77 A;  1MND A;  3OIQ A;  4CCL A;  4BE0 A;  3OR2 C;  2WY8 Q;  3H5N A;  4BEH B;  3DPU A;  1P9Q C;  2M7B A;  4ANJ A;  3HC7 A;  3KYL A;  2BVM A;  3MD2 A;  4II2 A;  5FRO A;  2X1E A;  3A4C A;  2VJI A;  3ZRG A;  3DEE A;  3N05 A;  5KNL A;  1Z3Y A;  4XLC A;  4BE1 A;  2IGK A;  2VKD A;  1G8X A;  5CQG A;  2DT6 A;  3FKJ A;  2Y0S A;  2VXZ A;  3LSG A;  3PL8 A;  2KP6 A;  3H0D A;  5HNH A;  4IZZ A;  3QYB A;  2M4G A;  1NG6 A;  2CMP A;  3K4K A;  3DTE A;  2V7F A;  1T95 A;  3SZG A;  3TBI A;  3K4C A;  2KL4 A;  3W2A A;  1EA3 A;  4KT6 A;  4RLF A;  4B43 A;  4LIV A;  3CMM A;  5HVQ C;  4YEL A;  1D0Z A;  2V9K A;  4XM3 A;  4U7B A;  2XDV A;  4DBQ A;  2WY7 Q;  3RSN A;  3VYU B;  1X4O A;  1LVK A;  2K3P A;  4B48 A;  3OYA A;  3AKZ A;  2L9N A;  4CCK A;  2VB6 A;  4CCN A;  2DCE A;  2X6Y A;  3SYT A;  4BAC A;  2LY2 A;  1BOB A;  4BDY A;  5FRN A;  3ZXS A;  1OLT A;  3DKX A;  2HPM A;  1UEL B;  2W00 A;  3G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...