2OC6A

Crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
GMDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YdhG protein
publication title Crystal structure of hypothetical protein (NP_388456.1) from Bacillus subtilis at 1.75 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Unknown function
total genus 35
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oc6A01
2OC6A 2KL4A 2I8DA
chains in the Genus database with same CATH superfamily
5IT9K 1R23A 3HOVJ 2G7HA 4HV5A 1B72B 2VKDA 2UXXA 2H6CA 3FX3A 4XRMA 1IXRC 3ASOH 4BAYA 4BQOA 1WH5A 2XHKA 2ZXWH 3BT9A 2WB1N 4BHBA 5FRMA 3BTJA 4UXNA 4CCKA 1IDZA 1X4OA 3I59A 4RBOA 1QZYA 5ILUA 2VQLA 3W2VA 1R71A 3S3NA 4O3MA 1T0FA 3DPLC 2QLZA 4I6ZA 1MMGA 2FNPA 4C3IJ 3ZQQA 2ZO4A 3S2WA 1MBKA 1ON2A 2O9LA 3IH2A 1Y8QB 2P8TA 2VC1A 2R7OA 4TV7A 3LSPA 4EJTA 2O8KA 1GV2A 4RB3C 5FKKA 5LBQA 2KMUA 3IHUA 2K7LA 2LVSA 2W7NA 1XCVA 1ETOA 1JUPA 2A61A 4M6XA 2KIQA 2V7FA 4HF0A 1BOBA 1SD7A 3GX4X 4B3XA 2L3DA 3N97A 1IRFA 2GBYA 2ID3A 4KUMA 1SFKA 2DJNA 1YTYA 2VBXA 3S32A 1FPQA 3O3KA 2F4MB 4MGRA 3OYAA 3AFHA 2V1XA 1FBUA 3MMYB 2V9PA 3OYEA 4KMUX 1WQ2A 2DPUA 4RGXA 4HA8A 5LHHA 4YIFA 4CH7A 4BE2A 1OJLA 5M3MJ 1Y0UA 2Z1DA 1WJCA 1VQ7I 1RPWA 5E3OA 4UVCA 1REPC 4HDVA 2EILH 4B3AA 2IA2A 1QRYA 2BE5F 5LLQA 1WI9A 3FXJA 3AG2H 4WXDA 4DGWB 2O6GE 5AIQA 4ANJA 3VDXA 3J7AO 2P6SA 1ETXA 4XLEA 4LG0A 3T5XA 1KZHA 1YHQI 4A69C 1XGNA 1VQ5I 2RQQA 4FASD 6PAXA 2J5OA 2XSDC 5B5EC 2R93J 1WCMJ 4A3EJ 2VASA 5KAFC 3L2VA 1X58A 3H3UA 1LVKA 3E97A 3I53A 1DPRA 3O2PE 3GTLJ 2VJIA 2R5ZA 1ZH5A 5F1JA 1X3UA 1ZK8A 3BP8A 1MIJA 1K6YA 3CJQB 4ZJZA 2DU9A 4GGGA 1B1BA 1B9MA 5BPIA 2CW8A 2H09A 1L3LA 2VE8A 1MJBA 5K5OA 4NUBA 4OINF 1UB9A 4RLQA 4HSTA 1I5ZA 2F6CA 4FQGA 3K70C 4CICA 3IAS2 2COMA 5JHUA 5D6EA 3OYFA 3VYUB 2HKXA 1L0OC 1U2WA 3QOPA 2Y69H 5KCMA 4EM1A 3L2UA 5DD8A 2DMTA 3DFGA 2DOAA 4M9ZA 2E2JJ 3MKZA 4IHXA 2GOXB 2X1DA 3L2QA 3ERED 1IV6A 2OBPA 3RZOJ 2CYYA 1Y56A 3TOAA 2XAHA 1ETWA 4XRSA 2HKOA 3KYDB 2IS6A 2N8GA 3E7LA 4AD9A 2K02A 2GA1A 2ZKZA 4BKXA 4B09A 5K7FA 1Z9CA 1XX5A 3M1CA 2R7TA 2CV1A 3MZ8A 2AXLA 3F0CA 4X1EA 2P7VB 2WAEA 1MNEA 4BL0B 3G1LA 3BR3A 1P7IA 2COBA 3I5UA 2W25A 1Z0XA 4WXCA 2CG4A 2F4IA 1IN8A 3OR1C 4CYCA 2E5NA 4BQAA 4HX4A 4PGHA 2XGCA 2QF7A 4ENKA 2X6OA 1D8JA 1T08B 3AKZA 1SMYF 1LQ1A 2DK5A 2EQRA 2E34A 2OPTA 5J40A 2ACJA 3QWLA 1QHHD 1ZGAA 2VC0A 1R36A 3LA7A 1TC3C 2EBIA 2H1LA 1LFBA 2AXTC 3K2AA 3FHNA 1GVDA 2ZFUA 3GTQJ 4KT6A 1I6XA 1OCPA 2MW8A 3ZXSA 4B43A 5F0HA 4HLYA 2R7SA 1ULYA 2TDXA 4MO7A 2VQHA 4D7NA 5J1YA 5HOOA 3S8PA 1MBGA 1D0YA 2OJED 3OYMA 5EG0B 2EV0A 5J3LA 1X1PA 1GV5A 2AO9A 2A6TA 4Q5SF 3MFKA 2HPIA 1T39A 2ZJPF 3BG6A 3SFZA 5LFAA 3IRQA 4HRIA 3S1NJ 3HRMA 2M0MA 2GWRA 3U9GA 5HNFA 2A68F 4XLHA 3WGGA 3J7ZI 4E7LA 3B6CA 3LWFA 3ZN0A 2R7XA 4PJMA 4F52A 2QA4I 3BR2A 3A0HC 2H8RA 3TP3A 5LEKA 3BG7A 1JKQC 4IOAF 3ZMZA 2RC4A 4UVBA 1YITI 3RPUD 3MD2A 2Z5UA 4FISA 1YW8A 2WAFA 5KNLA 3GYHX 1AWCA 2LRDA 4M71A 2W1OA 1O3RA 1HKSA 3OOUA 3CO7C 1WFXA 3FMRA 2JUCA 5GAHJ 2LBFB 1FYLA 1OYIA 2FNAA 1GLNA 3MN2A 1A6IA 2E7XA 2KISA 5DM6F 3G1MA 3A0BC 3OV8A 1RI7A 1FOYA 1NH3A 1YX3A 2CV0A 1LVAA 1KYWA 3FM5A 2P81A 1UAAA 1ETYA 5D6FA 4F92B 3HDDA 1OCZH 2ISYA 2H1KA 1R7JA 3IL2A 2QSHX 1A5JA 2ZBKA 4D7MA 1FY7A 1SAUA 2E1MC 2DI3A 1RR7A 3EYYA 2OTLI 3T8TA 2UZKA 4LJZF 1ZG5A 4LLGF 1N75A 4PSXA 4KIGA 1R49A 2RNJA 2OTJI 2HTJA 3TEDA 4LGWA 2MYSA 1QVUA 1X1CA 2O8XA 3C2BA 4HEA2 3E5UA 1RNLA 3CMMA 1R6RA 2MG4A 1FTTA 2ZXJA 2RV8A 4ZTJA 3KZZA 3F22A 1G3WA 1YE9A 1SEUA 5ERIA 4B4CA 2W48A 5FRNA 2R5YB 5IP9J 3R0AA 4H4KC 3CUQB 5KK1A 4BUPA 4FT8A 4IHTA 4ZYAA 1A6QA 3WU0A 2YPRA 2LY2A 3F72A 1DGRM 1G3TA 1TWFJ 3OR2C 3JSOA 3ULQB 3GEZA 4U0WA 4CA0A 1Z3YA 1R58A 2HQNA 4UUVA 3EQLF 1XSXA 2X9DA 1FT9A 2E35A 1MZBA 2CQXA 3MWMA 1TL8A 3WE3A 1IUFA 1TQIA 2OUMA 3ZQHA 2PI0A 2CFOA 4XKVA 2L2OA 3F3XA 3HGGA 3L9FA 1WKMA 2XAJA 1FOXA 3A01A 3ZP5A 3BZCA 3EDPA 3GTJJ 3OYBA 4RGRA 1Z7UA 2OQGA 4DW6A 4DQ2A 1USTA 4UV9A 5JHFA 5HDKA 2KRFA 3MZHA 4F7ZA 2EB7A 2PMZN 3ECOA 2V9VA 2ELHA 4C2TA 4JQFA 1VQ6I 2M3AA 4I02A 1BR2A 2I8DA 1YIOA 2VXZA 1U9NA 4M3FA 1A31A 2BHYA 3BR0A 2KT0A 2A6EF 3FXRA 4XSXF 4Z2YA 1IN5A 3QQAA 1BI2A 3CF5F 2PJRB 3WTVC 1WSUA 1VQLI 3S3OA 3A1YA 2MABA 1PUEE 3HOZJ 2WY8Q 2CSOA 2WAQN 3BG3A 1R1VA 3QP5A 4IO9F 4I2OA 5JR3A 2YU9J 3GO5A 1AA7A 2IGKA 3OYJA 1XD7A 4RB1A 2X85A 3OYCA 3D5RC 3WE2A 4QIWN 3EUAA 3K1PA 3WU1B 1D3YA 3DKWA 3RKXA 5IOZA 5E1XA 1R1UA 2VKEA 5EEHA 2YUSA 3VFZA 5DD4A 1IO2A 4BACA 2M2EA 3ABLH 2XAQA 1D0XA 2Y0SA 3X2QH 4RDUA 5LGTA 5GADJ 4ETSA 1RRJA 1IZ1A 3CCLI 1J9IA 5IPAA 4M9SA 2XIGA 3JAMK 2WBMA 2EH3A 4LITA 5F1RA 2IGOA 1Y6IA 2IA0A 1YI2I 2KIMA 1YW7A 1K79A 3BDDA 4NQWA 4CZCA 3ONQA 2O03A 4DNCA 3GFMA 5GAGJ 2HEOA 2DAOA 4LG3A 1I3AA 2IW5A 3LSHA 1Z1DA 4KA4A 1XG1A 1LB2A 2M9HA 2Y2ZA 3D0SA 4XOPA 3GF2A 3CC7I 2HYGD 3IKVA 2K9SA 1W7PA 5IT3A 2LYCA 4HX7A 3CDLA 4EM2A 4M6YA 1QPMA 5M5XJ 5D4RA 3S1QJ 1S3JA 3BR5A 5K5RA 3DEWA 4YFNF 2CW0F 2BHZA 2DFIA 4S04A 1FNNA 3IC7A 4HW0A 2NVXJ 2PEXA 1JKPC 1JKOC 3EUHC 4CZZA 1DGWY 2P5KA 3HG9A 5L3FA 4UUSA 3K0LA 3CJRB 1FBSA 2QQ8A 3VEPA 3L2RA 2E1CA 2QBYA 5ICGA 1RIOH 4E7JA 2DDAA 2X1CA 2JVHA 1S29A 3CDHA 4XNFA 3GUDA 3ZMTA 4ESFA 2FU4A 4PCQA 3K4JA 2KIUA 1OQYA 5K7ZA 4M73A 3JCUC 2PX9A 1B8IA 5K1YA 2QEXI 4XKCA 1VFCA 4RM2A 1B6AA 4MIMA 1S72I 1OLTA 5E17F 2LK2A 1FEXA 4NDLA 2STWA 3I55I 3KP2A 3SJMA 3U1KA 3CCQI 4XSZF 1I39A 4GRIA 5HLGA 3F23A 1YRNB 1RKWA 2P7CB 3KPHA 2E2HJ 1IG7A 2Q2EB 3KE2A 4AIHA 1A04A 3DTKA 3VYSB 5F0CA 1T95A 3HEFA 2ESNA 2ME6A 2D1HA 2DQRA 2FBIA 2KIFA 4IJAA 2P0WA 1MMAA 1ZHFA 4EV0A 2K9LA 2P6TA 2FA5A 2L7ZA 1U9OA 2KJBA 2MC3A 4G6TB 2FMYA 4Y3OA 4K2EA 3TQNA 3W6JB 2XPVA 2MD5A 3G73A 4CGZA 1Z77A 2BZTA 2DA2A 2IJLA 1CF7B 4AYBA 5C3EJ 2IPQX 1TNSA 1TWAJ 1G3YA 5EZHA 5HS8A 4IZZA 1QO0D 1E3PA 1W5TA 1EH6A 4JX4A 2ZJ2A 2DFHA 1G4DA 1V5FA 2E5ZA 3F21A 2PLYA 3F8MA 3FXMA 4AC0A 4AIKA 3GTGJ 3KYLA 4EM0B 2KP6A 2CRGA 2L7KA 1PYVA 1KQ9A 3WTUC 1MMNA 3RCOA 2OAZA 3R4KA 1W5SA 4RLFA 3BQZA 1ZLJA 4EMSA 3PQKA 2XKPA 3BY6A 3BG9A 3I56I 3UNGC 3K4LA 3MKYB 2ZNZA 2AS5F 2F2EA 2LMDA 2X6WA 3E6CC 5C4XJ 3OWTA 4W97A 5CJ9A 3CJNA 2XAUA 4ENJA 4ITVA 3CQZJ 3ZCOA 3WTYC 2PN6A 1TWGJ 3OYIA 5CQEA 1BR1A 3LL7A 2PBIA 2AQFA 2BGCA 4OIRF 1KYZA 2ZJQF 1H8AC 3W6KB 2B9SA 2DMPA 1MDMA 2IS4A 5E3LA 3G71I 4UB8C 3G2BA 3ERMA 3OSFA 1H9TA 1ZREA 2BBYA 1P4XA 4XRSG 1W4MA 3GFLA 4XICA 2HDDA 2H94A 3HIFA 3HKZA 4WCGA 4RGSA 2ICWG 4HAMA 4AWXB 4IKFA 3DEUA 1YS7A 1PJRA 1YQAA 1JJ8C 4UY8I 3W6VA 2UWMA 2DFFA 2CUJA 4IPAA 4ESJA 1N78A 2V6CA 1PDNC 1OPCA 3RQIA 2X6XA 3OYLA 2DLLA 2DQLA 2GXGA 3K1MA 4HNVA 5E1WA 4CHUA 2R7UA 3L2WA 1PUFA 2EV6A 2MD0A 5J4YA 4G7HF 4YG2F 1FMWA 2WV1A 1IF1A 3HM5A 3PFYA 2MFZA 2W24A 1MBJA 1GT0C 1GUUA 4WK8F 4P1WA 3VODA 4DIQA 1JTYA 2XF5A 3OYNA 5IT9Z 5FO5A 4F3QA 3WU2C 2JK3A 2A6HF 2CGPA 1OFCX 4ZZLA 5FKOA 4AIJA 4HSRA 4XLAA 3S15J 2EA4A 1TQPA 1IXSB 4A6DA 4BE1A 4GCVA 3RSNA 5DEQA 5KAIC 4M74A 4KIFA 3HGYA 3KIOA 5M3FJ 1IN4A 3HPGA 5DUKA 5AONA 3I0TA 4I09A 1KQ8A 4LD5A 3RTRA 3N4MA 1J2XA 3ML6A 1IRZA 5F08A 2FD5A 4HQMA 2QQ9A 1MSFC 3F8FA 5J1RA 3ZMUA 2KDOA 1OYWA 5IP6A 1DP3A 3GFJA 2XF6A 2EZIA 1B9NA 5M5WJ 4FCYA 4PJ0C 1P92A 2FJ1A 4S0HB 1SC7A 2VJ4A 1JE8A 2CQ7A 3Q9SA 2LKXA 3M8JA 5E3MA 3VSKA 3EUHA 2XB5A 4JBAA 1IUYA 2VBWA 1XB4A 2EIMH 3WG7H 1H0MA 3K9TA 3R61A 4ZYEA 2K85A 1H89C 2JTVA 4L0YB 3KCCA 4XR6A 5GTHC 5CVIA 1ETKA 4BE0A 4G94A 3OY9A 2ZSIB 3RYRA 3GBGA 5EGOB 3HC7A 2BY0A 5IYBJ 4BEHB 1B4AA 4HDUA 3NWTA 5HVQC 4XOTA 2GXAA 2HYFA 4CCLA 2K3FA 4XL9A 3DBHB 5D5WB 2VUMJ 2Z2SB 2XKOA 4C30A 4A6EA 2JRTA 2EFPA 3OIPA 2KL4A 3CLOA 4M3BA 3OSGA 2QM3A 3I4MJ 4NC6A 2Y48A 3DP7A 3LSGA 2IEKA 1G6NA 2J5PA 3F8CA 5A2QK 2FQ3A 4MFEA 1FYMA 1PVEA 4V2FA 2UV1A 2X4HA 2BW3B 2LREA 2WB1A 4A0XA 1S5LC 2CWEA 3TO7A 4HV6A 3PM1A 5LHIA 3O8GA 3HOXJ 2HU9A 1OISA 1MKMA 1QVTA 1FOWA 2IA1A 2HQRA 2M4KA 2K4BA 4XRFA 4HBLA 3TMOA 3QPTA 3V7CA 1MBHA 2WA0A 2K9MA 3WGHA 3HSRA 2MH2A 3GW2A 2DDBA 4I7HA 3VPRA 3J7YJ 4GFBA 3Q0UA 3CUOA 4EJUA 3ZRGA 3MVPA 1E2XA 3P9CA 1HF0A 1OMIA 1E17A 5D4SA 3WTSC 4LLLA 2E1NA 5FROA 1LDJA 1F4KA 4J01A 3Q0VA 1HW5A 3G3ZA 3SDBA 1VQ9I 2FUG2 1XDUA 3IAM2 3LFKA 4BDZA 3I59B 3GTMJ 2QCOA 2RGVA 2FXAA 2R92J 2R7WA 2PG4A 2L7MP 3A4CA 4EQQA 4ZH4F 2HTSA 4XN0A 2YX7A 3HOYJ 2KQRA 3FK7A 3PL8A 3CCEI 4XKWA 3IWZA 3D5SC 1U5TA 5E1ZB 2FOWA 3RJPA 3IV5A 2V4JC 5TJJA 5EEGA 4CCNA 4S05A 3ABKH 1YS6A 3ZN1A 5E79C 1Y0NA 2GOMA 5C4JJ 3CCYA 2V26A 4L18B 3D5LA 3RKQA 3S2DJ 4IRIA 1SFEA 2Z16A 3BTCA 2X48A 4Y52J 3RI4A 2DOEA 3QOEA 1RKTA 2YR2A 3BZKA 1T56A 4A3GJ 3MEXA 2E60A 1XGMA 1P6RA 1R22A 1KU9A 1TT0A 3B73A 2GQQA 5CYVA 3V4GA 4PJNA 2DMUA 5KHDA 3OS0A 4UHTA 2NRAC 3U21A 2Y9ZA 1O3SA 1SVOA 3L09A 4UNOA 1O7FA 4CUGA 5CPRB 2XGXA 2YU3A 3HRSA 3FK6A 2ZFWA 3H0GJ 1LE8A 4LG0B 1AKHA 3PSFA 2X6YA 1ERDA 1O4XA 5DCFA 3CF2A 1KONA 5L3BA 2XF7A 1W0UA 1NHAA 2CJJA 3RPUA 5L3EA 2OZUA 4L9TA 2FBKA 2R5ZB 4JX5A 2KHMA 2Y30A 4J19A 1IGNA 4ZDOA 3FDYA 5F64A 3HHHA 4UB6C 2ZMEC 3JRIA 2QSGX 2K40A 2JA5J 3MKWB 4OIQF 2DBBA 4RAFA 2M45A 4R79A 4HNTA 2ZXHA 3E6MA 3W3CA 2ZSHB 1BJZA 3FXQA 2UUZA 4LMYA 3S2HJ 2QSFX 3CJTB 3GMEA 1QGPA 2ZC2A 1S9HA 4MNUA 1I3QJ 2L9RA 2LDUA 4JP0A 1K78A 3QPLA 2OCEA 3GTKJ 2ECBA 2IP2A 1TWHJ 4BHCA 3CCUI 2PMUA 4G7OF 2CU7A 2B7EA 2QWWA 4N9HA 4Z6YA 3MZYA 3FBNB 5K7HA 2HS5A 4L9NA 3LAPA 1W36D 5HODA 2ADUA 2M4GA 3UR3C 3R0JA 1I1SA 5GP9A 1VQ4I 4BY1J 1H9GA 1FTZA 2CV2A 2NVQJ 1X3ZB 1ZARA 4IEJA 2OF7A 5DV5A 2LG4A 1WWXA 5DYMA 1FP2A 2RAEA 1XSVA 2M34A 1YO5C 1ON1A 4N4OB 4PJLA 3RKWA 2OU2A 1O7LA 1ZRCA 2RVCA 4GO1A 3FXOA 1J09A 3ZGKA 3GFIA 1QNTA 2KLOA 4ON0A 3ZMSA 2A07F 5L3GA 2LY9A 4CYCB 3M7GA 1MSEC 2Z33A 1Z05A 4YIIA 4ZC3A 4PK4A 3HTSB 1HLVA 2EFWA 1J59A 3K69A 3BCAA 1MD0A 3ROUA 3D1NI 3V8LA 4AU7A 1LE8B 2HVSA 3COAC 3K1NA 2HGCA 3G4SI 4G7ZF 4GDFA 4LIVA 2FMLA 1MMSA 2BEOA 4A2UA 4P9FA 4XM3A 2ECCA 4EGYA 1ZELA 4X6AJ 2P5LC 4L5JA 2IT0A 3PIOF 1X3WB 2CUFA 1OCOH 2HYJA 4I0BA 3OYDA 3P9KA 2FRHA 3S1MJ 3ZR8X 3LQQA 2X51A 3TL4X 5M5YJ 2W4SA 3J7AY 3FXUA 1USSA 4RAZA 3WHBA 3SXYA 1TNTA 4DYQA 4KT5C 1T8IA 2LC2A 2HOSA 2ELJA 1B59A 2MSYA 3RIRA 4EJWA 2MC4A 2E1OA 2VQCA 5IYCJ 1S8NA 2M7AA 5F04A 2RNGA 4B48A 3RZDJ 2EZHA 4DBQA 3J81K 2QENA 1XGSA 4FE7A 5D5UB 2IXSA 1QU3A 3WTXC 1RC9A 1U0JA 2DYSH 4PUSA 3CO6C 1BC7C 2F5CA 3DEEA 3SEQA 1TBXA 2H8WA 5K5QA 1WJBA 4UUTA 4R8HA 3NEUA 4BGDA 1BW6A 1K7AA 2X0LA 4NC7A 2CUZA 3O8HA 3LSRA 1N25A 1EA3A 2EA2A 1HXDA 3JAMZ 1VQMI 1Q1VA 2R7DA 1JUMA 1BW5A 5FFZA 5DDGA 4E7IA 4KICA 2D2WA 5FGMA 2R7FA 1WJAA 1P4AA 3OL3A 5J8FA 2QKMB 1BI1A 3L1PA 1P2FA 4X0GA 3DTEA 5LGUA 3TKYA 4A12A 3H9QA 2V9KA 1EH8A 2VPLA 2H27A 4XBFA 3ZPLA 1NG6A 3TBIA 3VB2A 3VSLA 2M1BA 3LA2A 5IP7J 3FZVA 4ZTFA 3I3LA 5E8IA 4LFUA 2OCCH 2PMZA 2IBDA 3C3WA 2IGMA 5EDNA 3I54A 5HNHA 1OKRA 2BXYA 2AQEA 4FHTA 4CXFA 1R5ID 1LPQA 4PSWA 3CMAI 1TP4A 5HLIA 4AUXA 2DA1A 4E4HA 2QGUA 2V1DA 2DYRH 2XROA 2HDCA 4BHPA 3HOUJ 1R5HA 1HA8A 1T6SA 3K70D 4ENNA 5F27A 1ITYA 3QU6A 3A01B 3ABTA 3JRFA 4W1UA 1BIAA 4G12A 2JQ7A 2HVRA 5KVRA 1Z67A 5CQGA 5GTIC 2LY1A 1XDSA 4U87A 3QYEA 1VZ0A 1VQNI 1FMVA 4HPQA 4AIDA 2ZMEA 3KP3A 2KFDA 4OU0A 4D9JA 1VI0A 2JN6A 1TLHB 2DFEA 1SVLA 4ZDPA 5D5VB 4A0ZA 2FF4A 3BZ6A 1FOKA 3K7AJ 2ZNYA 1XTAA 2G7UA 3K4NA 3VYTB 2ZJRF 4A3IJ 3LSMA 5CVUA 3TW6A 5H6RA 2JA8J 1VTNC 1I6HJ 5FKLA 5DS9A 3SZGA 3DKXA 1RETA 2A69F 1C0WA 5DCMA 1Y1WJ 4ZYDA 2WC2A 4B1RA 2LH9A 5J47A 1F5TA 5EZGA 1S7AA 1FZPB 2L5QA 2DMQA 2EFOA 2FEZA 2EFNA 1ZGWA 1LFUP 2GM4A 1KU7A 2AHQA 5FKMA 2LF8A 3M9AA 4BJTA 1RR8C 1D0ZA 4C2UA 1WZ2A 3H9JA 4MFDA 1LEBA 3LSIA 1W7PD 4XQFA 1XN7A 3QRFF 1Z91A 2DCEA 2K5CA 4OOIA 4B47A 1ZR4A 1BM9A 3WTZA 1DP7P 3CP2A 4OIOF 2P4WA 1R9TJ 1O3QA 1JHFA 3PO3J 5LD2C 2OV7A 2QQBA 3A02A 3K4KA 3M4OJ 1BA5A 2GXBA 2HXIA 2DT7B 1HKTA 1MGTA 2OC6A 1YX5A 1X1BA 4NQWB 1MBEA 1LNWA 5E20A 1G3SA 2M87A 3LOCA 1LFPA 5CVVA 2G9WA 3QU3A 1EH7A 3E3VA 3FBIB 4KITB 5H20A 4KFCA 4QPOA 1ZTRA 2QKLB 4A3BJ 1OCCH 3PNTA 4A93J 3KP4A 4M3DA 4NBQA 4KYWA 1UMQA 2E19A 2V1NA 1W7PB 1DPUA 4L5IA 5BQTA 5FLXK 4XLPF 3ISPA 1ZGJA 2JSCA 3NAUA 4UV8A 4BDYA 1FYKA 1BJAA 2L4MA 4IF4A 3IH3A 1UG2A 1ORKA 1VQ8I 3IWFA 2DK8A 1R1TA 5LRRA 1HDPA 2CH0A 2NYXA 3M07A 1OYYA 3TP0A 2V79A 3CLQA 3A2KA 3KEOA 2Y0MA 1V5GA 3B02A 3NRVA 4XLCA 4UUSB 3HPHA 2QBYB 3F8BA 1UHWA 1U5TC 1LJ9A 1LEAA 3GWZA 2B0LA 1CGPA 4MQ9F 4G6DA 1D1AA 3TO9A 2VL8A 1HW2A 1FX7A 4A0YA 2MLGA 4JK1X 3ZMVA 2ID6A 3RDIA 2WTEA 1B8IB 4RB0A 3BC8A 3CCVI 3AG1H 3QODA 2JWTA 1FBQA 4ESBA 3CCRI 1XSDA 3DQVC 2HDWA 2KRCA 4KIBA 1B72A 4IHYA 1P9QC 3Q0WA 2ELKA 3K4BA 4ENMA 3Q9VA 2M5WA 2GLOA 1UHMA 2FBHA 4XN3A 2DPDA 4RS8A 2HFHA 2VE9A 1QHGA 3CC4I 4XONA 9ANTA 3CZ6A 4E7SA 1WH7A 2TCTA 4XORA 4QTRA 4U7DA 4OMZA 2VB6A 2CS3A 2XPWA 3GZNB 2GIVA 3CD6I 1SFXA 1Z6RA 2XRNA 3JTGA 1XGOA 4Q4ZF 3KP5A 3ZQ7A 3IKTA 4HYEA 2JSPA 3KEQA 4IHSA 1ENHA 3WTWC 2STTA 4HNUA 1SAXA 3QYBA 2E1MB 1KU2A 1GVJA 4GYIA 1X1DA 2V6EA 2HVQA 2DTZA 4MTDA 3DF8A 1JKRC 1KA8A 3ECHA 1YG2A 1UCRA 4CDGA 5HLTA 3UKGA 3VOEA 5HDGA 3NWSA 3TW7A 1YYVA 1FSEA 3GZ6A 1Q1HA 4A5MA 3F6VA 2EV5A 1AHDP 3CTAA 3BTIA 2MH9A 1SD5A 2L01A 3NQOA 4DZPA 2NVUB 1T98A 3V8KA 4N9IA 4CCMA 1I27A 3OMYA 2HPMA 2KRHA 5CVJA 2E7WA 5B66C 1TZLA 5JI6A 1T2KA 2PQ8A 5LHGA 2A5WA 5EYRA 5HLHA 1XPXA 4G8XA 1D5VA 2BY2A 2MBFA 4E70A 2XRLA 4KN7X 2D45A 2NS0A 4KNYA 1QQIA 3ABMH 3VYRB 3H5RA 1SFUA 5ICCA 2O0YA 3FMSA 5H2FC 3DV8A 5TISC 4GYGA 2KJCA 3IH4A 4LK1F 3M3YJ 2XPUA 2LP0A 3HHGA 2ISZA 1JJ6C 1LDKB 4YRVA 1XMAA 1HOMA 4PZJA 4C3HJ 4L9VA 4ASNA 1DQUA 3QPHA 1MDMB 2IS2A 2LSOA 1LDDA 2RN7A 1ZRDA 2Z99A 4IOCF 2VBZA 2VBYA 1HDDC 2XGDA 3FXLA 1RUNA 4ABZA 4U0VA 3AG4H 3U1DA 3H92A 4MLOA 1SVMA 2JPBA 1G8XA 4A3MJ 3E1SA 2OZ6A 3GTOJ 5HDNA 1IXCA 3BJAA 5J6XA 3V7SA 2FX0A 2KKOA 3BCBA 1SANA 1UG0A 3ELKA 1MH4A 2I10A 1K61A 5DTDA 5A2QZ 2XC7A 1BL0A 3BLYA 4EJOA 3F8NA 3PUFA 1MW7A 1XMXA 3P5JA 3HRTA 3DWLE 3H36A 1R00A 2WWYA 1BOAA 4C3JJ 3SZTA 2CFXA 1U8RA 2G0EA 1K6OA 1PUFB 3SYTA 2VKHA 4PGGA 3ZQCA 1S6LA 4EJVA 2NNYA 1KGSA 2NVTJ 1GXQA 3OYKA 1LUJB 1X2MA 3KLOA 3RPQA 2B63J 1IN6A 2XVCA 1DU0A 5FD6A 3IP4B 3REOA 2DTRA 4MTEA 4EGZA 2L4AA 3ESWB 1JT6A 4F93B 5ICEA 2FE3A 2JA6J 5L3CA 1WI3A 1APLC 4LB5A 2M8EA 3HSFA 4NNJA 5FLVA 1F1ZA 1MJ9A 5JLWA 1JUSA 5D8KB 4Y4RA 5D8LB 2HOAA 3DBLB 1TT5B 2EK5A 4DOZA 2KPMA 1BIBA 3HB9A 2EPFA 5CVRA 3E5QA 1ZG3A 4WWCA 4CSWA 1IV8A 5EEAA 1QBJA 2FOKA 4NB5A 1E3HA 2O61A 3QP6A 3ZQIA 5TRDA 2L9SA 3BPXA 3MCZA 2JT1A 4J00A 2W00A 4BXFA 4ZZDA 4I76A 1TWCJ 4GXOA 3PO2J 5ED4A 2NAZA 3C7JA 5FKNA 3HOWJ 4I98B 3JRBA 2NS7A 3EUKL 4Y13A 3DU6A 3H3VK 1GDTA 1O57A 3K6GA 5GAEJ 3SEZA 2XGEA 3BOQA 1ETQA 4LOCA 1ONVA 5EG0A 3H3ZA 3HL2A 1G2HA 2GIZA 3OYGA 2EIKH 1T38A 2Y9YA 3V42A 1HCRA 3DTIA 1YJ9I 3OS1A 1UHSA 3AG3H 1JGGA 2BOLA 2DA6A 1RZ4A 4M72A 3I4PA 3CP8A 3ZQFA 2M7BA 1HSTA 2R7QA 3EPZA 3V8JA 3E6DA 3MAJA 2LKSA 1K83J 2JVGA 1F43A 4XIDA 4U7BA 2FSWA 4WXHA 4RB2C 1WJFA 2CW7A 2R7VA 5HS7A 1VNDA 1UJ8A 4UVAA 5FD5A 4IHWA 3G1OA 4FX0A 5F0FA 2LBFA 2D5VA 3WG9A 3CMEI 3RQ4A 5ILSA 2LD5A 2L0KA 2LTPA 4RA2A 4JYKA 3PNVA 4LLNA 1UFMA 2CQKA 3ASNH 3KEYA 2BY3A 4B8XA 3WGIA 4LK0F 2VJJA 2DODA 3WODF 1F36A 4M3GA 3DPTA 2L7FP 1BR4A 3GLXA 4HLXA 1K4SA 4IQJA 1YLFA 1VQPI 2PJPA 4WX9A 3FKIJ 2F5DA 1T33A 2BV6A 3I64A 3KYCB 3DCFA 1Y8RB 4OWRB 4PFOA 4DYRA 1IC8A 2LNBA 4NHJA 1YOVB 1FJLA 4OAZA 1Z6TA 1IDYA 2LF7A 2LFBA 3DLAA 3OIOA 4M9XA 1YJNI 1JHHA 1D1CA 2JA2A 1J75A 3AL0C 1ZRFA 4N4NB 1KQ0A 3E6BA 3OOPA 3LMMA 5E18F 1GXPA 3T8RA 2UXNA 2ETHA 1ZYRF 3O6BB 5IY5H 3QPSA 3CCJI 1D5YA 3FXKA 2K9QA 4DYCA 3EETA 1NK2P 1U8BA 2E36A 2CO5A 2O7OA 4V2GA 1HQCA 2RDPA 2EINH 2F5EA 1X19A 5FFXA 4R1HA 3R6SA 1J0RA 2R5YA 3PJRA 1F9NA 4BBRJ 3CUQA 4A3KJ 4DZJA 3KZYA 5B1AH 4FX4A 2IRFG 2QVOA 1W0TA 2OD5A 3C2GA 1H88C 2JUGA 4II2A 1E0EA 2HQ5A 2DW4A 4BYYA 3GCMA 5B1BH 4OIPF 2K86A 1FIAA 1STZA 5EF6A 3BPVA 4XLNF 4BQNA 1FC3A 4BU2A 3AAFA 4BJ5C 1BI3A 1U5TB 2QQAA 3TDUC 4BBSJ 2PFBA 4D1QA 2GAUA 4YFXF 2JMWA 2HZDA 3HBLA 2L9NA 1CQTA 1J7KA 2BYVE 2VLAA 5L3DA 2YSRA 2VONA 2Z9OA 4HOBA 4RAGA 4U88A 2NOGA 1IW7F 4L0ZB 2X1EA 3GXOA 2HWVA 3CDIA 4IQ4A 1MH3A 1OR7C 3KFWX 5HS9A 3U2RA 4BJ6C 3J80Z 3OYHA 1KU3A 3BROA 3NARA 5J4VA 4YFKF 2PJRA 3QYFA 1FSHA 3JRHA 3A03A 4MEXF 3TOBA 2VOOA 5LGNA 2EWNA 4HF2A 4I01A 2VODA 2ZXIA 3F6OA 3BJOA 2Y31A 3BR6A 4HX8A 4Y7NJ 1BN5A 2VJ5A 1AKHB 3J80K 4OMYA 4JOMA 2RKHA 3H9GA 3JREA 2DN0A 3DBRB 1QA6A 2CQNA 5IYDJ 3FISA 1SD6A 1WJEA 1D1BA 1FWZA 2Q8KA 4A3CJ 4EVIA 2TRTA 3I71A 3CC2I 3L2CA 1U6GA 2R0QC 4H0EA 1WVRA 1IRXA 3L00A 3S3MA 4II3A 4F55A 2NXNB 4KDPA 1WJDA 1EF4A 3LSTA 1FLIA 4M3EA 4BNCA 3K2ZA 3N05A 4BXXJ 3M8EA 1ETVA 4E7KA 1DUXC 1FIPA 3VWBA 2V1UA 3J81Z 3BR1A 3GLLA 1K4TA 3E0JB 1V5EA 3HUGA 1EJ9A 3HOTA 1I50J 2EIJH 3DU5A 3KP6A 1IRGA 4YIRX 4NC8A 5FB2A 2DOFA 2BVLA 4CYDA 1POGA 3HTUA 1K78B 3IRRA 3JRAA 1IJWC 1SMTA 2R7ZJ 2NNNA 4FE4A 4DJAA 3CMYA 4OAYA 3SHFA 3IUOA 1RESA 3DLLF 3LSJA 2Y0SN 3FKJA 3GVAA 4DBRA 2BY1A 2CQQA 2W84A 2EZKA 5AIPA 3JRCA 1VF9A 1OCRH 4AVZA 4D0PA 3KZIC 5JFRA 1J5YA 2OA4A 3K4MA 2DT6A 2QZ8A 3FIWA 3G6EI 1P4WA 2ME0A 3SZPA 4YEJA 4IRHA 3T0YA 2VQGA 4Y17A 1U3EM 1YW9A 2R7RA 1P7JA 1WHUA 2DXIA 2IAIA 4XKBA 3ABUA 3CCMI 1FP1D 2D1VA 3CCSI 1PP8F 4M6VA 2Q0OA 3P7NA 1YFHA 2R4GA 3OS2A 4Q48A 1TW2A 2O3FA 2HZTA 4MQVA 3WTTC 1E3OC 1G59A 5J1UA 4BH9A 1UELB 2DT5A 4RMNA 3JRGA 1TTYA 4A3JJ 3TGNA 3JR9A 3TDZC 3HYIA 4Q47A 1I1GA 3BQYA 5C44J 1R4NB 2IVMA 4FETA 4Y33A 3ZOBA 4C2MJ 2DA3A 3JW4A 3PFIA 1AU7A 2Q2EA 3LNQA 1YRNA 4HF1A 5LEJA 3BG5A 3GZ5A 5J8CA 1LKXA 2F5VA 5CLSA 2L02A 1XCBA 2WY7Q 3H35A 3CESA 3DKYA 2DA7A 1Z21A 4P55A 1PP7U 4EATA 1ZR2A 2IS1A 3W2WA 4E6KG 4D5CA 3HOSA 3FF5A 1DDNA 2WAQA 2F48A 1SFOJ 3SDGA 4KJZA 3S1RJ 2E71A 2HOEA 3S93A 1VQOI 1CF7A 4KN4X 3S17J 3F9KA 3ZQLA 3JTHA 2K3PA 3QAHA 3FM3A 3HUGB 4MHGA 1X2NA 3RYPA 1W1WE 1Z3XA 5D5XB 1R5GA 3PUBA 2R3SA 5EJCA 4KMFA 1ZAOA 3C18A 1R4MB 2DMNA 1XC5A 2BVMA 2KZVA 4XMYA 3LAJA 1YJWI 3KX2A 4HG2A 1RUOA 3R60A 4L9JA 4LIUA 1ZQ3P 2HOTA 3SFIA 3FWEA 1V55H 1ZG1A 1HC8A 2L54A 1T0FC 3OIQA 2Y75A 2BXZA 3BTLA 4XLFA 2DO7A 3H5AA 2P5VA 2W82A 5E3NA 3T1BA 5H6QA 2HXOA 2XDVA 1V4RA 2VN2A 2W57A 2MGQA 3HJEA 2VIXA 1TQMA 5BOXA 3H5NA 3RKYA 4AYBN 1Y1VJ 4XK4A 4I99C 2E2IJ 4WF2A 2XUBA 2NVYJ 4P5OA 1GHCA 1MJAA 2KZGA 3K10A 2A05A 1XMKA 4L5EA 1ACIA 4IHVA 4LB6B 4D5FA 4IRGA 5BMZA 2M30A 2K27A 4ZYGA 4P96A 2I5UA 3ZQGA 5JVTA 1HBXG 5E8GA 1IN7A 2LLKA 2DA5A 3MKLA 5IOYA 3P9IA 1DU6A 2XAFA 2NS8A 3LA3A 4CCOA 1OR7A 1UZCA 4ZYHA 2HR3A 3WHCA 5ILVA 1QZZA 2DA4A 4B44A 3PIPF 2F4OB 5F6FA 5FLXZ 4RAYA 2YS9A 3S16J 4BS9A 5FJ8J 2K4JA 4HZFA 2W85A 4FTHA 3LQRA 4BXUA 2XV4S 4A3LJ 2KDZA 4IL6C 2JJ7A 2XAGA 1EV7A 4JX6A 3EYIA 5BS6A 4E7ZA 2K9NA 3PSIA 3KLNA 4G6QA 2NOJB 3BJ6A 5GPAA 3V7RA 3DXJF 4IVNA 4CO8A 1MNDA 1Y39A 4BQQA 2JRMA 1N77A 2IGNA 4Y15A 4P9UA 1S7OA 1IAWA 1BI0A 1D8KA 2HI3A 1XS9A 2F5FA 5TGTA 2QYOA 2A3SA 1ODDA 1JXSA 3S14J 3HKZN 4CCJA 5FLMJ 2JPCA 5JLXA 3AL0B 1NK3P 3I4NJ 1Z7LA 4AVPA 2RQPA 3Q3SA 2ESHA 1W5CC 2H6BA 1X1AA 2ZMEB 1V3FA 1JGSA 1HSJA 2WADA 4QLCU 2CMPA 3TO6A 2QUFA 4O5VA 1MNMC 4KISA 3B6AA 1YIJI 3I58A 1JI8A 2WV0A 3JSPA 2M8GX 4C9YA 2VT3A 4N0BA 3LSKA 4BY7J 4RGUA 1OCTC 3DPUA 5DM7F 4PJJA 3K4CA 2CUEA 5DCMB 1MBFA 1TW3A 1BC8C 2GA2A 2LR8A 2XASA 4V19K 4E7HA 2XSJC 1AOYA 1WGXA 3I9V2 3E5XA 2VKVA 1SD4A 4RM3A 3MQ0A 3FHZA 1WPKA 3C2HA 1HKQA 3PQJA 1NTCA 5CKTA 2HNHA 2O5RA 1WRJA 2RREA 4A3FJ 4PFPA 3OL4A 2M0CA 3C1DA 1O3TA 2VXDA 1QZEA 2JA7J 2Z3YA 4AM3A 3W2AA 1QPIA 2MLKA 2HQAA 1U78A 3M8FA 4IXAA 5EGOA 4QWQA 5ICFA 4QSHA 4BEHA 1NG7A 4IX7A 2L9VA 3HZJA 5DUIA 3H0DA 3HSEA 3GTPJ 2VT2A 3HXLA 1W36C 5B3SH 5JVGF 4QPQA 4U0YA 1ZKGA 3KETA 4A3DJ 2C6YA 1ZN2A 5GPCA 4MEYF 1HW1A 2PMHA 2ZCWA 1A35A 4ZDLA 3JRDA 4HQEA 1M1EB 3LFUA 4G9YA 4EEFG 2A5YB 3PNYA 2VOPA 1X4PA 3CUQC 5BNGA 2BW3A 1ZLKA 2LOOA 5BPDA 2VI6A 4O6JA 1JT0A 2Q1ZB 3KP7A 1A36A 3L7WA 4F91B 3M1EA 2EJRA 2DJIA 3SQNA 3BWGA 3ZMDA 2FQ4A 1V54H 2OQRA 2XB0X 1VQKI 4PDKA 4YELA 4I0AA 1EKEA 1BBYA 5LRSA 2EFQA 1MMDA 3HRUA 2VPRA 3FMQA 1S7EA 2EZLA 2GZWA 2ZB9A 3H1CA 3Q5FA 2JZYA 2LKPA 1JTXA 2YX4A 2MA3A 4A5NA 1WJ5A
chains in the Genus database with same CATH topology
2P0WA 3PNVA 1MMAA 2MC4A 2VQCA 2K9LA 2VKDA 2M7AA 3KEYA 4G6TB 2RNGA 4B48A 2VJJA 4Y3OA 4BQOA 4DBQA 4IQJA 3DPTA 1BR4A 5FRMA 4CCKA 4OWRB 1X4OA 4PFOA 2VQLA 3W2VA 4AYBA 2IXSA 3S3NA 1QU3A 4OAZA 1U0JA 3DPLC 3DLAA 4PUSA 4IZZA 3DEEA 1D1CA 2JA2A 1MMGA 3SEQA 1V5FA 3ZQQA 3AL0C 2E5ZA 1WJBA 4N4NB 3LMMA 2R7OA 4BGDA 3KYLA 2KP6A 2L7KA 1PYVA 2CUZA 4NC7A 1MMNA 3RCOA 1EA3A 4RLFA 1X19A 2KMUA 4E7IA 3PJRA 2W7NA 1WJAA 3OL3A 3UNGC 3K4LA 2V7FA 3C2GA 3MKYB 2JUGA 2QKMB 1BOBA 4II2A 4B3XA 1E0EA 2X6WA 4X0GA 3OWTA 3DTEA 1SFKA 3H9QA 2V9KA 3S32A 2XAUA 4ITVA 2VPLA 3ZCOA 3OYAA 3AFHA 3MMYB 4BQNA 3OYEA 1NG6A 5CQEA 3TBIA 3VSLA 4BU2A 3OYIA 1BR1A 3LL7A 4BJ5C 2AQFA 4ZTFA 4CH7A 4D1QA 3I3LA 4BE2A 2Z1DA 2IS4A 1WJCA 2HZDA 2PMZA 2L9NA 2IGMA 5HNHA 3G2BA 2VLAA 2AQEA 4PSWA 4DGWB 4E4HA 4ANJA 3VDXA 2X1EA 4XLEA 4IQ4A 3HKZA 2RQQA 4FASD 1OR7C 4IKFA 4BJ6C 3OYHA 2VASA 1HA8A 3L2VA 1PJRA 3K70D 2UWMA 1LVKA 2PJRA 2CUJA 1N78A 3QYFA 2VJIA 2HVRA 5CQGA 2LY1A 3CJQB 1K6YA 2X6XA 4ZJZA 3OYLA 4U87A 3QYEA 1VZ0A 2CW8A 1FMVA 2ZXIA 4HPQA 2R7UA 4NUBA 2VJ5A 3L2WA 4D9JA 4JOMA 3H9GA 4RLQA 4HSTA 2MD0A 4ZDPA 1FMWA 1WJEA 1D1BA 2F6CA 3PFYA 2MFZA 3K70C 3K4NA 3IAS2 3VYTB 3LSMA 1IRXA 3OYFA 3VYUB 4P1WA 3S3MA 4DIQA 4II3A 5KCMA 2XF5A 3SZGA 4F55A 1WJDA 3DKXA 4F3QA 3OYNA 3L2UA 2DOAA 3MKZA 2GOXB 3N05A 2LH9A 2X1DA 4HSRA 4XLAA 3L2QA 4E7KA 3VWBA 2L5QA 4BE1A 1Y56A 3E0JB 3RSNA 1V5EA 4BJTA 2IS6A 1D0ZA 4C2UA 3H9JA 3HPGA 3HOTA 3DU5A 3LSIA 4XQFA 4NC8A 2DCEA 2K5CA 3M1CA 3RTRA 2BVLA 4B47A 2CV1A 2R7TA 3CP2A 5LD2C 2OV7A 3K4KA 2WAEA 1MNEA 2KDOA 4BL0B 2DT7B 4DJAA 4OAYA 2OC6A 1YX5A 3IUOA 1DP3A 1X1BA 3FKJA 2XF6A 4NQWB 4DBRA 1LFPA 2F4IA 3OR1C 4AVZA 2E5NA 3FBIB 4KITB 2VJ4A 4QPOA 2QKLB 3K4MA 3M8JA 3VSKA 2DT6A 3AKZA 3PNTA 2V1NA 1QHHD 4YEJA 2VQGA 4XR6A 2R7RA 4BDYA 3FHNA 4BE0A 3OY9A 2ZSIB 4XKBA 3GBGA 2DXIA 2ZFUA 3HC7A 4BEHB 4KT6A 3NWTA 2R4GA 5HVQC 3OS2A 3ZXSA 4B43A 2R7SA 4XOTA 4CCLA 4XL9A 1G59A 2VQHA 2CH0A 5HOOA 1UELB 2Z2SB 3S8PA 4RMNA 3A2KA 1D0YA 3OYMA 1V5GA 4C30A 4XLCA 2A6TA 3HPHA 2HPIA 3OIPA 2KL4A 3BG6A 3LSGA 5LFAA 4FETA 4Y33A 4HRIA 1D1AA 2M0MA 2VL8A 5HNFA 4XLHA 4E7LA 1LKXA 2F5VA 2BW3B 2LREA 2UV1A 2WB1A 3BC8A 3QODA 2HU9A 2R7XA 4PJMA 4F52A 2WY7Q 3DQVC 2HDWA 2KRCA 3CESA 3DKYA 3H35A 1Z21A 1P9QC 2M4KA 4EATA 3BG7A 3K4BA 2IS1A 3W2WA 4E6KG 3TMOA 4XN3A 3RPUD 3MD2A 2WAFA 5KNLA 2WA0A 3HOSA 2LRDA 2K9MA 1QHGA 2W1OA 4XONA 2WAQA 3CZ6A 4E7SA 4XORA 4KJZA 3OOUA 3S93A 3F9KA 1WFXA 3ZRGA 2VB6A 2K3PA 2LBFB 2CS3A 3HUGB 1GLNA 1Z3XA 5FROA 3PUBA 4J01A 1YX3A 2CV0A 1UAAA 4F92B 2BVMA 2KZVA 4XMYA 2JSPA 3SDBA 2FUG2 3IAM2 3KX2A 4HG2A 4HNUA 1SAUA 2E1MC 3QYBA 4LIUA 4BDZA 2E1MB 1T0FC 1X1DA 2V6EA 3OIQA 2HVQA 4XLFA 3H5AA 2R7WA 2W82A 3A4CA 1N75A 4PSXA 5HLTA 3NWSA 2XDVA 4XN0A 2VIXA 2KQRA 2MYSA 3PL8A 1X1CA 4HEA2 3H5NA 4XKWA 3CMMA 3D5SC 1R6RA 4P5OA 4ZTJA 4CCMA 1YE9A 3K10A 3OMYA 2HPMA 2KRHA 2V4JC 1TZLA 4CCNA 5FRNA 2A5WA 4H4KC 4BUPA 2GOMA 4ZYAA 2LY2A 2V26A 1DGRM 3OR2C 3D5LA 3VYRB 3H5RA 2Z16A 4CA0A 1Z3YA 4CCOA 3QOEA 4B44A 2OUMA 2E60A 2CFOA 1LDKB 4XKVA 4YRVA 2L2OA 4BS9A 1TT0A 1DQUA 4PJNA 5KHDA 3OS0A 2IS2A 3U21A 3OYBA 4CUGA 5CPRB 4E7ZA 3PSIA 5JHFA 2NOJB 4MLOA 1G8XA 3E1SA 3PSFA 2X6YA 1ERDA 1MNDA 3CF2A 1KONA 4BQQA 2XF7A 1N77A 2IGNA 4C2TA 4JQFA 2M3AA 1BR2A 2I8DA 3BCBA 2VXZA 1UG0A 5TGTA 2PJRB 2XC7A 3BLYA 4CCJA 2KHMA 3S3OA 3A1YA 2MABA 1MW7A 4ZDOA 3FDYA 2WY8Q 3DWLE 3AL0B 1Z7LA 1X1AA 3MKWB 1AA7A 2IGKA 3OYJA 2WADA 3SYTA 4R79A 2CMPA 2X85A 3OYCA 3D5RC 2VKHA 4HNTA 2ZXHA 3EUAA 4KISA 3W3CA 1JI8A 2ZSHB 4BACA 2UUZA 4C9YA 3OYKA 1D0XA 1S9HA 3LSKA 2Y0SA 3IP4B 3DPUA 4PJJA 3K4CA 2WBMA 4LITA 2IGOA 1Y6IA 4F93B 3FBNB 4CZCA 3ONQA 4E7HA 4NNJA 2XSJC 3I9V2 4LG3A 4Y4RA 1W36D 3LSHA 4RM3A 2M4GA 3UR3C 4DOZA 2KPMA 3C2HA 4XOPA 2CV2A 5CKTA 2HNHA 2O5RA 4CSWA 2RREA 4PFPA 3OL4A 2LG4A 2VXDA 2L9SA 2LYCA 4J00A 2W00A 4N4OB 4BXFA 3W2AA 2HQAA 4PJLA 3ZGKA 1J09A 4BEHA 2KLOA 3EUKL 1NG7A 4IX7A 3DU6A 3K6GA 3SEZA 3H0DA 3HXLA 1W36C 3EUHC 4ZC3A 4QPQA 4PK4A 1DGWY 3HG9A 3HL2A 3BCAA 3OYGA 3CJRB 4AU7A 3L2RA 3V42A 2HVSA 3DTIA 4ZDLA 4E7JA 3OS1A 2X1CA 2JVHA 4XNFA 3LFUA 2BOLA 3K4JA 3PNYA 4LIVA 1X4PA 3CP8A 4XKCA 2BW3A 2M7BA 4RM2A 2LOOA 2R7QA 4XM3A 1ZELA 3EPZA 1OLTA 2Q1ZB 2JVGA 4F91B 4U7BA 3OYDA 2DJIA 1WJFA 3ZR8X 2CW7A 2X51A 3TL4X 2R7VA 2W4SA 4YELA 3J7AY 4GRIA 1MMDA 2Q2EB 3DTKA 3VYSB 2LBFA 2LC2A 2ELJA 1T95A 3RQ4A 1WJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OC6 A;  2KL4 A;  2I8D A; 
#chains in the Genus database with same CATH topology
 5IT9 K;  1R23 A;  3HOV J;  2G7H A;  4HV5 A;  1B72 B;  2VKD A;  2UXX A;  2H6C A;  3FX3 A;  4XRM A;  1IXR C;  3ASO H;  4BAY A;  4BQO A;  1WH5 A;  2XHK A;  2ZXW H;  3BT9 A;  2WB1 N;  4BHB A;  5FRM A;  3BTJ A;  4UXN A;  4CCK A;  1IDZ A;  1X4O A;  3I59 A;  4RBO A;  1QZY A;  5ILU A;  2VQL A;  3W2V A;  1R71 A;  3S3N A;  4O3M A;  1T0F A;  3DPL C;  2QLZ A;  4I6Z A;  1MMG A;  2FNP A;  4C3I J;  3ZQQ A;  2ZO4 A;  3S2W A;  1MBK A;  1ON2 A;  2O9L A;  3IH2 A;  1Y8Q B;  2P8T A;  2VC1 A;  2R7O A;  4TV7 A;  3LSP A;  4EJT A;  2O8K A;  1GV2 A;  4RB3 C;  5FKK A;  5LBQ A;  2KMU A;  3IHU A;  2K7L A;  2LVS A;  2W7N A;  1XCV A;  1ETO A;  1JUP A;  2A61 A;  4M6X A;  2KIQ A;  2V7F A;  4HF0 A;  1BOB A;  1SD7 A;  3GX4 X;  4B3X A;  2L3D A;  3N97 A;  1IRF A;  2GBY A;  2ID3 A;  4KUM A;  1SFK A;  2DJN A;  1YTY A;  2VBX A;  3S32 A;  1FPQ A;  3O3K A;  2F4M B;  4MGR A;  3OYA A;  3AFH A;  2V1X A;  1FBU A;  3MMY B;  2V9P A;  3OYE A;  4KMU X;  1WQ2 A;  2DPU A;  4RGX A;  4HA8 A;  5LHH A;  4YIF A;  4CH7 A;  4BE2 A;  1OJL A;  5M3M J;  1Y0U A;  2Z1D A;  1WJC A;  1VQ7 I;  1RPW A;  5E3O A;  4UVC A;  1REP C;  4HDV A;  2EIL H;  4B3A A;  2IA2 A;  1QRY A;  2BE5 F;  5LLQ A;  1WI9 A;  3FXJ A;  3AG2 H;  4WXD A;  4DGW B;  2O6G E;  5AIQ A;  4ANJ A;  3VDX A;  3J7A O;  2P6S A;  1ETX A;  4XLE A;  4LG0 A;  3T5X A;  1KZH A;  1YHQ I;  4A69 C;  1XGN A;  1VQ5 I;  2RQQ A;  4FAS D;  6PAX A;  2J5O A;  2XSD C;  5B5E C;  2R93 J;  1WCM J;  4A3E J;  2VAS A;  5KAF C;  3L2V A;  1X58 A;  3H3U A;  1LVK A;  3E97 A;  3I53 A;  1DPR A;  3O2P E;  3GTL J;  2VJI A;  2R5Z A;  1ZH5 A;  5F1J A;  1X3U A;  1ZK8 A;  3BP8 A;  1MIJ A;  1K6Y A;  3CJQ B;  4ZJZ A;  2DU9 A;  4GGG A;  1B1B A;  1B9M A;  5BPI A;  2CW8 A;  2H09 A;  1L3L A;  2VE8 A;  1MJB A;  5K5O A;  4NUB A;  4OIN F;  1UB9 A;  4RLQ A;  4HST A;  1I5Z A;  2F6C A;  4FQG A;  3K70 C;  4CIC A;  3IAS 2;  2COM A;  5JHU A;  5D6E A;  3OYF A;  3VYU B;  2HKX A;  1L0O C;  1U2W A;  3QOP A;  2Y69 H;  5KCM A;  4EM1 A;  3L2U A;  5DD8 A;  2DMT A;  3DFG A;  2DOA A;  4M9Z A;  2E2J J;  3MKZ A;  4IHX A;  2GOX B;  2X1D A;  3L2Q A;  3ERE D;  1IV6 A;  2OBP A;  3RZO J;  2CYY A;  1Y56 A;  3TOA A;  2XAH A;  1ETW A;  4XRS A;  2HKO A;  3KYD B;  2IS6 A;  2N8G A;  3E7L A;  4AD9 A;  2K02 A;  2GA1 A;  2ZKZ A;  4BKX A;  4B09 A;  5K7F A;  1Z9C A;  1XX5 A;  3M1C A;  2R7T A;  2CV1 A;  3MZ8 A;  2AXL A;  3F0C A;  4X1E A;  2P7V B;  2WAE A;  1MNE A;  4BL0 B;  3G1L A;  3BR3 A;  1P7I A;  2COB A;  3I5U A;  2W25 A;  1Z0X A;  4WXC A;  2CG4 A;  2F4I A;  1IN8 A;  3OR1 C;  4CYC A;  2E5N A;  4BQA A;  4HX4 A;  4PGH A;  2XGC A;  2QF7 A;  4ENK A;  2X6O A;  1D8J A;  1T08 B;  3AKZ A;  1SMY F;  1LQ1 A;  2DK5 A;  2EQR A;  2E34 A;  2OPT A;  5J40 A;  2ACJ A;  3QWL A;  1QHH D;  1ZGA A;  2VC0 A;  1R36 A;  3LA7 A;  1TC3 C;  2EBI A;  2H1L A;  1LFB A;  2AXT C;  3K2A A;  3FHN A;  1GVD A;  2ZFU A;  3GTQ J;  4KT6 A;  1I6X A;  1OCP A;  2MW8 A;  3ZXS A;  4B43 A;  5F0H A;  4HLY A;  2R7S A;  1ULY A;  2TDX A;  4MO7 A;  2VQH A;  4D7N A;  5J1Y A;  5HOO A;  3S8P A;  1MBG A;  1D0Y A;  2OJE D;  3OYM A;  5EG0 B;  2EV0 A;  5J3L A;  1X1P A;  1GV5 A;  2AO9 A;  2A6T A;  4Q5S F;  3MFK A;  2HPI A;  1T39 A;  2ZJP F;  3BG6 A;  3SFZ A;  5LFA A;  3IRQ A;  4HRI A;  3S1N J;  3HRM A;  2M0M A;  2GWR A;  3U9G A;  5HNF A;  2A68 F;  4XLH A;  3WGG A;  3J7Z I;  4E7L A;  3B6C A;  3LWF A;  3ZN0 A;  2R7X A;  4PJM A;  4F52 A;  2QA4 I;  3BR2 A;  3A0H C;  2H8R A;  3TP3 A;  5LEK A;  3BG7 A;  1JKQ C;  4IOA F;  3ZMZ A;  2RC4 A;  4UVB A;  1YIT I;  3RPU D;  3MD2 A;  2Z5U A;  4FIS A;  1YW8 A;  2WAF A;  5KNL A;  3GYH X;  1AWC A;  2LRD A;  4M71 A;  2W1O A;  1O3R A;  1HKS A;  3OOU A;  3CO7 C;  1WFX A;  3FMR A;  2JUC A;  5GAH J;  2LBF B;  1FYL A;  1OYI A;  2FNA A;  1GLN A;  3MN2 A;  1A6I A;  2E7X A;  2KIS A;  5DM6 F;  3G1M A;  3A0B C;  3OV8 A;  1RI7 A;  1FOY A;  1NH3 A;  1YX3 A;  2CV0 A;  1LVA A;  1KYW A;  3FM5 A;  2P81 A;  1UAA A;  1ETY A;  5D6F A;  4F92 B;  3HDD A;  1OCZ H;  2ISY A;  2H1K A;  1R7J A;  3IL2 A;  2QSH X;  1A5J A;  2ZBK A;  4D7M A;  1FY7 A;  1SAU A;  2E1M C;  2DI3 A;  1RR7 A;  3EYY A;  2OTL I;  3T8T A;  2UZK A;  4LJZ F;  1ZG5 A;  4LLG F;  1N75 A;  4PSX A;  4KIG A;  1R49 A;  2RNJ A;  2OTJ I;  2HTJ A;  3TED A;  4LGW A;  2MYS A;  1QVU A;  1X1C A;  2O8X A;  3C2B A;  4HEA 2;  3E5U A;  1RNL A;  3CMM A;  1R6R A;  2MG4 A;  1FTT A;  2ZXJ A;  2RV8 A;  4ZTJ A;  3KZZ A;  3F22 A;  1G3W A;  1YE9 A;  1SEU A;  5ERI A;  4B4C A;  2W48 A;  5FRN A;  2R5Y B;  5IP9 J;  3R0A A;  4H4K C;  3CUQ B;  5KK1 A;  4BUP A;  4FT8 A;  4IHT A;  4ZYA A;  1A6Q A;  3WU0 A;  2YPR A;  2LY2 A;  3F72 A;  1DGR M;  1G3T A;  1TWF J;  3OR2 C;  3JSO A;  3ULQ B;  3GEZ A;  4U0W A;  4CA0 A;  1Z3Y A;  1R58 A;  2HQN A;  4UUV A;  3EQL F;  1XSX A;  2X9D A;  1FT9 A;  2E35 A;  1MZB A;  2CQX A;  3MWM A;  1TL8 A;  3WE3 A;  1IUF A;  1TQI A;  2OUM A;  3ZQH A;  2PI0 A;  2CFO A;  4XKV A;  2L2O A;  3F3X A;  3HGG A;  3L9F A;  1WKM A;  2XAJ A;  1FOX A;  3A01 A;  3ZP5 A;  3BZC A;  3EDP A;  3GTJ J;  3OYB A;  4RGR A;  1Z7U A;  2OQG A;  4DW6 A;  4DQ2 A;  1UST A;  4UV9 A;  5JHF A;  5HDK A;  2KRF A;  3MZH A;  4F7Z A;  2EB7 A;  2PMZ N;  3ECO A;  2V9V A;  2ELH A;  4C2T A;  4JQF A;  1VQ6 I;  2M3A A;  4I02 A;  1BR2 A;  2I8D A;  1YIO A;  2VXZ A;  1U9N A;  4M3F A;  1A31 A;  2BHY A;  3BR0 A;  2KT0 A;  2A6E F;  3FXR A;  4XSX F;  4Z2Y A;  1IN5 A;  3QQA A;  1BI2 A;  3CF5 F;  2PJR B;  3WTV C;  1WSU A;  1VQL I;  3S3O A;  3A1Y A;  2MAB A;  1PUE E;  3HOZ J;  2WY8 Q;  2CSO A;  2WAQ N;  3BG3 A;  1R1V A;  3QP5 A;  4IO9 F;  4I2O A;  5JR3 A;  2YU9 J;  3GO5 A;  1AA7 A;  2IGK A;  3OYJ A;  1XD7 A;  4RB1 A;  2X85 A;  3OYC A;  3D5R C;  3WE2 A;  4QIW N;  3EUA A;  3K1P A;  3WU1 B;  1D3Y A;  3DKW A;  3RKX A;  5IOZ A;  5E1X A;  1R1U A;  2VKE A;  5EEH A;  2YUS A;  3VFZ A;  5DD4 A;  1IO2 A;  4BAC A;  2M2E A;  3ABL H;  2XAQ A;  1D0X A;  2Y0S A;  3X2Q H;  4RDU A;  5LGT A;  5GAD J;  4ETS A;  1RRJ A;  1IZ1 A;  3CCL I;  1J9I A;  5IPA A;  4M9S A;  2XIG A;  3JAM K;  2WBM A;  2EH3 A;  4LIT A;  5F1R A;  2IGO A;  1Y6I A;  2IA0 A;  1YI2 I;  2KIM A;  1YW7 A;  1K79 A;  3BDD A;  4NQW A;  4CZC A;  3ONQ A;  2O03 A;  4DNC A;  3GFM A;  5GAG J;  2HEO A;  2DAO A;  4LG3 A;  1I3A A;  2IW5 A;  3LSH A;  1Z1D A;  4KA4 A;  1XG1 A;  1LB2 A;  2M9H A;  2Y2Z A;  3D0S A;  4XOP A;  3GF2 A;  3CC7 I;  2HYG D;  3IKV A;  2K9S A;  1W7P A;  5IT3 A;  2LYC A;  4HX7 A;  3CDL A;  4EM2 A;  4M6Y A;  1QPM A;  5M5X J;  5D4R A;  3S1Q J;  1S3J A;  3BR5 A;  5K5R A;  3DEW A;  4YFN F;  2CW0 F;  2BHZ A;  2DFI A;  4S04 A;  1FNN A;  3IC7 A;  4HW0 A;  2NVX J;  2PEX A;  1JKP C;  1JKO C;  3EUH C;  4CZZ A;  1DGW Y;  2P5K A;  3HG9 A;  5L3F A;  4UUS A;  3K0L A;  3CJR B;  1FBS A;  2QQ8 A;  3VEP A;  3L2R A;  2E1C A;  2QBY A;  5ICG A;  1RIO H;  4E7J A;  2DDA A;  2X1C A;  2JVH A;  1S29 A;  3CDH A;  4XNF A;  3GUD A;  3ZMT A;  4ESF A;  2FU4 A;  4PCQ A;  3K4J A;  2KIU A;  1OQY A;  5K7Z A;  4M73 A;  3JCU C;  2PX9 A;  1B8I A;  5K1Y A;  2QEX I;  4XKC A;  1VFC A;  4RM2 A;  1B6A A;  4MIM A;  1S72 I;  1OLT A;  5E17 F;  2LK2 A;  1FEX A;  4NDL A;  2STW A;  3I55 I;  3KP2 A;  3SJM A;  3U1K A;  3CCQ I;  4XSZ F;  1I39 A;  4GRI A;  5HLG A;  3F23 A;  1YRN B;  1RKW A;  2P7C B;  3KPH A;  2E2H J;  1IG7 A;  2Q2E B;  3KE2 A;  4AIH A;  1A04 A;  3DTK A;  3VYS B;  5F0C A;  1T95 A;  3HEF A;  2ESN A;  2ME6 A;  2D1H A;  2DQR A;  2FBI A;  2KIF A;  4IJA A;  2P0W A;  1MMA A;  1ZHF A;  4EV0 A;  2K9L A;  2P6T A;  2FA5 A;  2L7Z A;  1U9O A;  2KJB A;  2MC3 A;  4G6T B;  2FMY A;  4Y3O A;  4K2E A;  3TQN A;  3W6J B;  2XPV A;  2MD5 A;  3G73 A;  4CGZ A;  1Z77 A;  2BZT A;  2DA2 A;  2IJL A;  1CF7 B;  4AYB A;  5C3E J;  2IPQ X;  1TNS A;  1TWA J;  1G3Y A;  5EZH A;  5HS8 A;  4IZZ A;  1QO0 D;  1E3P A;  1W5T A;  1EH6 A;  4JX4 A;  2ZJ2 A;  2DFH A;  1G4D A;  1V5F A;  2E5Z A;  3F21 A;  2PLY A;  3F8M A;  3FXM A;  4AC0 A;  4AIK A;  3GTG J;  3KYL A;  4EM0 B;  2KP6 A;  2CRG A;  2L7K A;  1PYV A;  1KQ9 A;  3WTU C;  1MMN A;  3RCO A;  2OAZ A;  3R4K A;  1W5S A;  4RLF A;  3BQZ A;  1ZLJ A;  4EMS A;  3PQK A;  2XKP A;  3BY6 A;  3BG9 A;  3I56 I;  3UNG C;  3K4L A;  3MKY B;  2ZNZ A;  2AS5 F;  2F2E A;  2LMD A;  2X6W A;  3E6C C;  5C4X J;  3OWT A;  4W97 A;  5CJ9 A;  3CJN A;  2XAU A;  4ENJ A;  4ITV A;  3CQZ J;  3ZCO A;  3WTY C;  2PN6 A;  1TWG J;  3OYI A;  5CQE A;  1BR1 A;  3LL7 A;  2PBI A;  2AQF A;  2BGC A;  4OIR F;  1KYZ A;  2ZJQ F;  1H8A C;  3W6K B;  2B9S A;  2DMP A;  1MDM A;  2IS4 A;  5E3L A;  3G71 I;  4UB8 C;  3G2B A;  3ERM A;  3OSF A;  1H9T A;  1ZRE A;  2BBY A;  1P4X A;  4XRS G;  1W4M A;  3GFL A;  4XIC A;  2HDD A;  2H94 A;  3HIF A;  3HKZ A;  4WCG A;  4RGS A;  2ICW G;  4HAM A;  4AWX B;  4IKF A;  3DEU A;  1YS7 A;  1PJR A;  1YQA A;  1JJ8 C;  4UY8 I;  3W6V A;  2UWM A;  2DFF A;  2CUJ A;  4IPA A;  4ESJ A;  1N78 A;  2V6C A;  1PDN C;  1OPC A;  3RQI A;  2X6X A;  3OYL A;  2DLL A;  2DQL A;  2GXG A;  3K1M A;  4HNV A;  5E1W A;  4CHU A;  2R7U A;  3L2W A;  1PUF A;  2EV6 A;  2MD0 A;  5J4Y A;  4G7H F;  4YG2 F;  1FMW A;  2WV1 A;  1IF1 A;  3HM5 A;  3PFY A;  2MFZ A;  2W24 A;  1MBJ A;  1GT0 C;  1GUU A;  4WK8 F;  4P1W A;  3VOD A;  4DIQ A;  1JTY A;  2XF5 A;  3OYN A;  5IT9 Z;  5FO5 A;  4F3Q A;  3WU2 C;  2JK3 A;  2A6H F;  2CGP A;  1OFC X;  4ZZL A;  5FKO A;  4AIJ A;  4HSR A;  4XLA A;  3S15 J;  2EA4 A;  1TQP A;  1IXS B;  4A6D A;  4BE1 A;  4GCV A;  3RSN A;  5DEQ A;  5KAI C;  4M74 A;  4KIF A;  3HGY A;  3KIO A;  5M3F J;  1IN4 A;  3HPG A;  5DUK A;  5AON A;  3I0T A;  4I09 A;  1KQ8 A;  4LD5 A;  3RTR A;  3N4M A;  1J2X A;  3ML6 A;  1IRZ A;  5F08 A;  2FD5 A;  4HQM A;  2QQ9 A;  1MSF C;  3F8F A;  5J1R A;  3ZMU A;  2KDO A;  1OYW A;  5IP6 A;  1DP3 A;  3GFJ A;  2XF6 A;  2EZI A;  1B9N A;  5M5W J;  4FCY A;  4PJ0 C;  1P92 A;  2FJ1 A;  4S0H B;  1SC7 A;  2VJ4 A;  1JE8 A;  2CQ7 A;  3Q9S A;  2LKX A;  3M8J A;  5E3M A;  3VSK A;  3EUH A;  2XB5 A;  4JBA A;  1IUY A;  2VBW A;  1XB4 A;  2EIM H;  3WG7 H;  1H0M A;  3K9T A;  3R61 A;  4ZYE A;  2K85 A;  1H89 C;  2JTV A;  4L0Y B;  3KCC A;  4XR6 A;  5GTH C;  5CVI A;  1ETK A;  4BE0 A;  4G94 A;  3OY9 A;  2ZSI B;  3RYR A;  3GBG A;  5EGO B;  3HC7 A;  2BY0 A;  5IYB J;  4BEH B;  1B4A A;  4HDU A;  3NWT A;  5HVQ C;  4XOT A;  2GXA A;  2HYF A;  4CCL A;  2K3F A;  4XL9 A;  3DBH B;  5D5W B;  2VUM J;  2Z2S B;  2XKO A;  4C30 A;  4A6E A;  2JRT A;  2EFP A;  3OIP A;  2KL4 A;  3CLO A;  4M3B A;  3OSG A;  2QM3 A;  3I4M J;  4NC6 A;  2Y48 A;  3DP7 A;  3LSG A;  2IEK A;  1G6N A;  2J5P A;  3F8C A;  5A2Q K;  2FQ3 A;  4MFE A;  1FYM A;  1PVE A;  4V2F A;  2UV1 A;  2X4H A;  2BW3 B;  2LRE A;  2WB1 A;  4A0X A;  1S5L C;  2CWE A;  3TO7 A;  4HV6 A;  3PM1 A;  5LHI A;  3O8G A;  3HOX J;  2HU9 A;  1OIS A;  1MKM A;  1QVT A;  1FOW A;  2IA1 A;  2HQR A;  2M4K A;  2K4B A;  4XRF A;  4HBL A;  3TMO A;  3QPT A;  3V7C A;  1MBH A;  2WA0 A;  2K9M A;  3WGH A;  3HSR A;  2MH2 A;  3GW2 A;  2DDB A;  4I7H A;  3VPR A;  3J7Y J;  4GFB A;  3Q0U A;  3CUO A;  4EJU A;  3ZRG A;  3MVP A;  1E2X A;  3P9C A;  1HF0 A;  1OMI A;  1E17 A;  5D4S A;  3WTS C;  4LLL A;  2E1N A;  5FRO A;  1LDJ A;  1F4K A;  4J01 A;  3Q0V A;  1HW5 A;  3G3Z A;  3SDB A;  1VQ9 I;  2FUG 2;  1XDU A;  3IAM 2;  3LFK A;  4BDZ A;  3I59 B;  3GTM J;  2QCO A;  2RGV A;  2FXA A;  2R92 J;  2R7W A;  2PG4 A;  2L7M P;  3A4C A;  4EQQ A;  4ZH4 F;  2HTS A;  4XN0 A;  2YX7 A;  3HOY J;  2KQR A;  3FK7 A;  3PL8 A;  3CCE I;  4XKW A;  3IWZ A;  3D5S C;  1U5T A;  5E1Z B;  2FOW A;  3RJP A;  3IV5 A;  2V4J C;  5TJJ A;  5EEG A;  4CCN A;  4S05 A;  3ABK H;  1YS6 A;  3ZN1 A;  5E79 C;  1Y0N A;  2GOM A;  5C4J J;  3CCY A;  2V26 A;  4L18 B;  3D5L A;  3RKQ A;  3S2D J;  4IRI A;  1SFE A;  2Z16 A;  3BTC A;  2X48 A;  4Y52 J;  3RI4 A;  2DOE A;  3QOE A;  1RKT A;  2YR2 A;  3BZK A;  1T56 A;  4A3G J;  3MEX A;  2E60 A;  1XGM A;  1P6R A;  1R22 A;  1KU9 A;  1TT0 A;  3B73 A;  2GQQ A;  5CYV A;  3V4G A;  4PJN A;  2DMU A;  5KHD A;  3OS0 A;  4UHT A;  2NRA C;  3U21 A;  2Y9Z A;  1O3S A;  1SVO A;  3L09 A;  4UNO A;  1O7F A;  4CUG A;  5CPR B;  2XGX A;  2YU3 A;  3HRS A;  3FK6 A;  2ZFW A;  3H0G J;  1LE8 A;  4LG0 B;  1AKH A;  3PSF A;  2X6Y A;  1ERD A;  1O4X A;  5DCF A;  3CF2 A;  1KON A;  5L3B A;  2XF7 A;  1W0U A;  1NHA A;  2CJJ A;  3RPU A;  5L3E A;  2OZU A;  4L9T A;  2FBK A;  2R5Z B;  4JX5 A;  2KHM A;  2Y30 A;  4J19 A;  1IGN A;  4ZDO A;  3FDY A;  5F64 A;  3HHH A;  4UB6 C;  2ZME C;  3JRI A;  2QSG X;  2K40 A;  2JA5 J;  3MKW B;  4OIQ F;  2DBB A;  4RAF A;  2M45 A;  4R79 A;  4HNT A;  2ZXH A;  3E6M A;  3W3C A;  2ZSH B;  1BJZ A;  3FXQ A;  2UUZ A;  4LMY A;  3S2H J;  2QSF X;  3CJT B;  3GME A;  1QGP A;  2ZC2 A;  1S9H A;  4MNU A;  1I3Q J;  2L9R A;  2LDU A;  4JP0 A;  1K78 A;  3QPL A;  2OCE A;  3GTK J;  2ECB A;  2IP2 A;  1TWH J;  4BHC A;  3CCU I;  2PMU A;  4G7O F;  2CU7 A;  2B7E A;  2QWW A;  4N9H A;  4Z6Y A;  3MZY A;  3FBN B;  5K7H A;  2HS5 A;  4L9N A;  3LAP A;  1W36 D;  5HOD A;  2ADU A;  2M4G A;  3UR3 C;  3R0J A;  1I1S A;  5GP9 A;  1VQ4 I;  4BY1 J;  1H9G A;  1FTZ A;  2CV2 A;  2NVQ J;  1X3Z B;  1ZAR A;  4IEJ A;  2OF7 A;  5DV5 A;  2LG4 A;  1WWX A;  5DYM A;  1FP2 A;  2RAE A;  1XSV A;  2M34 A;  1YO5 C;  1ON1 A;  4N4O B;  4PJL A;  3RKW A;  2OU2 A;  1O7L A;  1ZRC A;  2RVC A;  4GO1 A;  3FXO A;  1J09 A;  3ZGK A;  3GFI A;  1QNT A;  2KLO A;  4ON0 A;  3ZMS A;  2A07 F;  5L3G A;  2LY9 A;  4CYC B;  3M7G A;  1MSE C;  2Z33 A;  1Z05 A;  4YII A;  4ZC3 A;  4PK4 A;  3HTS B;  1HLV A;  2EFW A;  1J59 A;  3K69 A;  3BCA A;  1MD0 A;  3ROU A;  3D1N I;  3V8L A;  4AU7 A;  1LE8 B;  2HVS A;  3COA C;  3K1N A;  2HGC A;  3G4S I;  4G7Z F;  4GDF A;  4LIV A;  2FML A;  1MMS A;  2BEO A;  4A2U A;  4P9F A;  4XM3 A;  2ECC A;  4EGY A;  1ZEL A;  4X6A J;  2P5L C;  4L5J A;  2IT0 A;  3PIO F;  1X3W B;  2CUF A;  1OCO H;  2HYJ A;  4I0B A;  3OYD A;  3P9K A;  2FRH A;  3S1M J;  3ZR8 X;  3LQQ A;  2X51 A;  3TL4 X;  5M5Y J;  2W4S A;  3J7A Y;  3FXU A;  1USS A;  4RAZ A;  3WHB A;  3SXY A;  1TNT A;  4DYQ A;  4KT5 C;  1T8I A;  2LC2 A;  2HOS A;  2ELJ A;  1B59 A;  2MSY A;  3RIR A;  4EJW A;  2MC4 A;  2E1O A;  2VQC A;  5IYC J;  1S8N A;  2M7A A;  5F04 A;  2RNG A;  4B48 A;  3RZD J;  2EZH A;  4DBQ A;  3J81 K;  2QEN A;  1XGS A;  4FE7 A;  5D5U B;  2IXS A;  1QU3 A;  3WTX C;  1RC9 A;  1U0J A;  2DYS H;  4PUS A;  3CO6 C;  1BC7 C;  2F5C A;  3DEE A;  3SEQ A;  1TBX A;  2H8W A;  5K5Q A;  1WJB A;  4UUT A;  4R8H A;  3NEU A;  4BGD A;  1BW6 A;  1K7A A;  2X0L A;  4NC7 A;  2CUZ A;  3O8H A;  3LSR A;  1N25 A;  1EA3 A;  2EA2 A;  1HXD A;  3JAM Z;  1VQM I;  1Q1V A;  2R7D A;  1JUM A;  1BW5 A;  5FFZ A;  5DDG A;  4E7I A;  4KIC A;  2D2W A;  5FGM A;  2R7F A;  1WJA A;  1P4A A;  3OL3 A;  5J8F A;  2QKM B;  1BI1 A;  3L1P A;  1P2F A;  4X0G A;  3DTE A;  5LGU A;  3TKY A;  4A12 A;  3H9Q A;  2V9K A;  1EH8 A;  2VPL A;  2H27 A;  4XBF A;  3ZPL A;  1NG6 A;  3TBI A;  3VB2 A;  3VSL A;  2M1B A;  3LA2 A;  5IP7 J;  3FZV A;  4ZTF A;  3I3L A;  5E8I A;  4LFU A;  2OCC H;  2PMZ A;  2IBD A;  3C3W A;  2IGM A;  5EDN A;  3I54 A;  5HNH A;  1OKR A;  2BXY A;  2AQE A;  4FHT A;  4CXF A;  1R5I D;  1LPQ A;  4PSW A;  3CMA I;  1TP4 A;  5HLI A;  4AUX A;  2DA1 A;  4E4H A;  2QGU A;  2V1D A;  2DYR H;  2XRO A;  2HDC A;  4BHP A;  3HOU J;  1R5H A;  1HA8 A;  1T6S A;  3K70 D;  4ENN A;  5F27 A;  1ITY A;  3QU6 A;  3A01 B;  3ABT A;  3JRF A;  4W1U A;  1BIA A;  4G12 A;  2JQ7 A;  2HVR A;  5KVR A;  1Z67 A;  5CQG A;  5GTI C;  2LY1 A;  1XDS A;  4U87 A;  3QYE A;  1VZ0 A;  1VQN I;  1FMV A;  4HPQ A;  4AID A;  2ZME A;  3KP3 A;  2KFD A;  4OU0 A;  4D9J A;  1VI0 A;  2JN6 A;  1TLH B;  2DFE A;  1SVL A;  4ZDP A;  5D5V B;  4A0Z A;  2FF4 A;  3BZ6 A;  1FOK A;  3K7A J;  2ZNY A;  1XTA A;  2G7U A;  3K4N A;  3VYT B;  2ZJR F;  4A3I J;  3LSM A;  5CVU A;  3TW6 A;  5H6R A;  2JA8 J;  1VTN C;  1I6H J;  5FKL A;  5DS9 A;  3SZG A;  3DKX A;  1RET A;  2A69 F;  1C0W A;  5DCM A;  1Y1W J;  4ZYD A;  2WC2 A;  4B1R A;  2LH9 A;  5J47 A;  1F5T A;  5EZG A;  1S7A A;  1FZP B;  2L5Q A;  2DMQ A;  2EFO A;  2FEZ A;  2EFN A;  1ZGW A;  1LFU P;  2GM4 A;  1KU7 A;  2AHQ A;  5FKM A;  2LF8 A;  3M9A A;  4BJT A;  1RR8 C;  1D0Z A;  4C2U A;  1WZ2 A;  3H9J A;  4MFD A;  1LEB A;  3LSI A;  1W7P D;  4XQF A;  1XN7 A;  3QRF F;  1Z91 A;  2DCE A;  2K5C A;  4OOI A;  4B47 A;  1ZR4 A;  1BM9 A;  3WTZ A;  1DP7 P;  3CP2 A;  4OIO F;  2P4W A;  1R9T J;  1O3Q A;  1JHF A;  3PO3 J;  5LD2 C;  2OV7 A;  2QQB A;  3A02 A;  3K4K A;  3M4O J;  1BA5 A;  2GXB A;  2HXI A;  2DT7 B;  1HKT A;  1MGT A;  2OC6 A;  1YX5 A;  1X1B A;  4NQW B;  1MBE A;  1LNW A;  5E20 A;  1G3S A;  2M87 A;  3LOC A;  1LFP A;  5CVV A;  2G9W A;  3QU3 A;  1EH7 A;  3E3V A;  3FBI B;  4KIT B;  5H20 A;  4KFC A;  4QPO A;  1ZTR A;  2QKL B;  4A3B J;  1OCC H;  3PNT A;  4A93 J;  3KP4 A;  4M3D A;  4NBQ A;  4KYW A;  1UMQ A;  2E19 A;  2V1N A;  1W7P B;  1DPU A;  4L5I A;  5BQT A;  5FLX K;  4XLP F;  3ISP A;  1ZGJ A;  2JSC A;  3NAU A;  4UV8 A;  4BDY A;  1FYK A;  1BJA A;  2L4M A;  4IF4 A;  3IH3 A;  1UG2 A;  1ORK A;  1VQ8 I;  3IWF A;  2DK8 A;  1R1T A;  5LRR A;  1HDP A;  2CH0 A;  2NYX A;  3M07 A;  1OYY A;  3TP0 A;  2V79 A;  3CLQ A;  3A2K A;  3KEO A;  2Y0M A;  1V5G A;  3B02 A;  3NRV A;  4XLC A;  4UUS B;  3HPH A;  2QBY B;  3F8B A;  1UHW A;  1U5T C;  1LJ9 A;  1LEA A;  3GWZ A;  2B0L A;  1CGP A;  4MQ9 F;  4G6D A;  1D1A A;  3TO9 A;  2VL8 A;  1HW2 A;  1FX7 A;  4A0Y A;  2MLG A;  4JK1 X;  3ZMV A;  2ID6 A;  3RDI A;  2WTE A;  1B8I B;  4RB0 A;  3BC8 A;  3CCV I;  3AG1 H;  3QOD A;  2JWT A;  1FBQ A;  4ESB A;  3CCR I;  1XSD A;  3DQV C;  2HDW A;  2KRC A;  4KIB A;  1B72 A;  4IHY A;  1P9Q C;  3Q0W A;  2ELK A;  3K4B A;  4ENM A;  3Q9V A;  2M5W A;  2GLO A;  1UHM A;  2FBH A;  4XN3 A;  2DPD A;  4RS8 A;  2HFH A;  2VE9 A;  1QHG A;  3CC4 I;  4XON A;  9ANT A;  3CZ6 A;  4E7S A;  1WH7 A;  2TCT A;  4XOR A;  4QTR A;  4U7D A;  4OMZ A;  2VB6 A;  2CS3 A;  2XPW A;  3GZN B;  2GIV A;  3CD6 I;  1SFX A;  1Z6R A;  2XRN A;  3JTG A;  1XGO A;  4Q4Z F;  3KP5 A;  3ZQ7 A;  3IKT A;  4HYE A;  2JSP A;  3KEQ A;  4IHS A;  1ENH A;  3WTW C;  2STT A;  4HNU A;  1SAX A;  3QYB A;  2E1M B;  1KU2 A;  1GVJ A;  4GYI A;  1X1D A;  2V6E A;  2HVQ A;  2DTZ A;  4MTD A;  3DF8 A;  1JKR C;  1KA8 A;  3ECH A;  1YG2 A;  1UCR A;  4CDG A;  5HLT A;  3UKG A;  3VOE A;  5HDG A;  3NWS A;  3TW7 A;  1YYV A;  1FSE A;  3GZ6 A;  1Q1H A;  4A5M A;  3F6V A;  2EV5 A;  1AHD P;  3CTA A;  3BTI A;  2MH9 A;  1SD5 A;  2L01 A;  3NQO A;  4DZP A;  2NVU B;  1T98 A;  3V8K A;  4N9I A;  4CCM A;  1I27 A;  3OMY A;  2HPM A;  2KRH A;  5CVJ A;  2E7W A;  5B66 C;  1TZL A;  5JI6 A;  1T2K A;  2PQ8 A;  5LHG A;  2A5W A;  5EYR A;  5HLH A;  1XPX A;  4G8X A;  1D5V A;  2BY2 A;  2MBF A;  4E70 A;  2XRL A;  4KN7 X;  2D45 A;  2NS0 A;  4KNY A;  1QQI A;  3ABM H;  3VYR B;  3H5R A;  1SFU A;  5ICC A;  2O0Y A;  3FMS A;  5H2F C;  3DV8 A;  5TIS C;  4GYG A;  2KJC A;  3IH4 A;  4LK1 F;  3M3Y J;  2XPU A;  2LP0 A;  3HHG A;  2ISZ A;  1JJ6 C;  1LDK B;  4YRV A;  1XMA A;  1HOM A;  4PZJ A;  4C3H J;  4L9V A;  4ASN A;  1DQU A;  3QPH A;  1MDM B;  2IS2 A;  2LSO A;  1LDD A;  2RN7 A;  1ZRD A;  2Z99 A;  4IOC F;  2VBZ A;  2VBY A;  1HDD C;  2XGD A;  3FXL A;  1RUN A;  4ABZ A;  4U0V A;  3AG4 H;  3U1D A;  3H92 A;  4MLO A;  1SVM A;  2JPB A;  1G8X A;  4A3M J;  3E1S A;  2OZ6 A;  3GTO J;  5HDN A;  1IXC A;  3BJA A;  5J6X A;  3V7S A;  2FX0 A;  2KKO A;  3BCB A;  1SAN A;  1UG0 A;  3ELK A;  1MH4 A;  2I10 A;  1K61 A;  5DTD A;  5A2Q Z;  2XC7 A;  1BL0 A;  3BLY A;  4EJO A;  3F8N A;  3PUF A;  1MW7 A;  1XMX A;  3P5J A;  3HRT A;  3DWL E;  3H36 A;  1R00 A;  2WWY A;  1BOA A;  4C3J J;  3SZT A;  2CFX A;  1U8R A;  2G0E A;  1K6O A;  1PUF B;  3SYT A;  2VKH A;  4PGG A;  3ZQC A;  1S6L A;  4EJV A;  2NNY A;  1KGS A;  2NVT J;  1GXQ A;  3OYK A;  1LUJ B;  1X2M A;  3KLO A;  3RPQ A;  2B63 J;  1IN6 A;  2XVC A;  1DU0 A;  5FD6 A;  3IP4 B;  3REO A;  2DTR A;  4MTE A;  4EGZ A;  2L4A A;  3ESW B;  1JT6 A;  4F93 B;  5ICE A;  2FE3 A;  2JA6 J;  5L3C A;  1WI3 A;  1APL C;  4LB5 A;  2M8E A;  3HSF A;  4NNJ A;  5FLV A;  1F1Z A;  1MJ9 A;  5JLW A;  1JUS A;  5D8K B;  4Y4R A;  5D8L B;  2HOA A;  3DBL B;  1TT5 B;  2EK5 A;  4DOZ A;  2KPM A;  1BIB A;  3HB9 A;  2EPF A;  5CVR A;  3E5Q A;  1ZG3 A;  4WWC A;  4CSW A;  1IV8 A;  5EEA A;  1QBJ A;  2FOK A;  4NB5 A;  1E3H A;  2O61 A;  3QP6 A;  3ZQI A;  5TRD A;  2L9S A;  3BPX A;  3MCZ A;  2JT1 A;  4J00 A;  2W00 A;  4BXF A;  4ZZD A;  4I76 A;  1TWC J;  4GXO A;  3PO2 J;  5ED4 A;  2NAZ A;  3C7J A;  5FKN A;  3HOW J;  4I98 B;  3JRB A;  2NS7 A;  3EUK L;  4Y13 A;  3DU6 A;  3H3V K;  1GDT A;  1O57 A;  3K6G A;  5GAE J;  3SEZ A;  2XGE A;  3BOQ A;  1ETQ A;  4LOC A;  1ONV A;  5EG0 A;  3H3Z A;  3HL2 A;  1G2H A;  2GIZ A;  3OYG A;  2EIK H;  1T38 A;  2Y9Y A;  3V42 A;  1HCR A;  3DTI A;  1YJ9 I;  3OS1 A;  1UHS A;  3AG3 H;  1JGG A;  2BOL A;  2DA6 A;  1RZ4 A;  4M72 A;  3I4P A;  3CP8 A;  3ZQF A;  2M7B A;  1HST A;  2R7Q A;  3EPZ A;  3V8J A;  3E6D A;  3MAJ A;  2LKS A;  1K83 J;  2JVG A;  1F43 A;  4XID A;  4U7B A;  2FSW A;  4WXH A;  4RB2 C;  1WJF A;  2CW7 A;  2R7V A;  5HS7 A;  1VND A;  1UJ8 A;  4UVA A;  5FD5 A;  4IHW A;  3G1O A;  4FX0 A;  5F0F A;  2LBF A;  2D5V A;  3WG9 A;  3CME I;  3RQ4 A;  5ILS A;  2LD5 A;  2L0K A;  2LTP A;  4RA2 A;  4JYK A;  3PNV A;  4LLN A;  1UFM A;  2CQK A;  3ASN H;  3KEY A;  2BY3 A;  4B8X A;  3WGI A;  4LK0 F;  2VJJ A;  2DOD A;  3WOD F;  1F36 A;  4M3G A;  3DPT A;  2L7F P;  1BR4 A;  3GLX A;  4HLX A;  1K4S A;  4IQJ A;  1YLF A;  1VQP I;  2PJP A;  4WX9 A;  3FKI J;  2F5D A;  1T33 A;  2BV6 A;  3I64 A;  3KYC B;  3DCF A;  1Y8R B;  4OWR B;  4PFO A;  4DYR A;  1IC8 A;  2LNB A;  4NHJ A;  1YOV B;  1FJL A;  4OAZ A;  1Z6T A;  1IDY A;  2LF7 A;  2LFB A;  3DLA A;  3OIO A;  4M9X A;  1YJN I;  1JHH A;  1D1C A;  2JA2 A;  1J75 A;  3AL0 C;  1ZRF A;  4N4N B;  1KQ0 A;  3E6B A;  3OOP A;  3LMM A;  5E18 F;  1GXP A;  3T8R A;  2UXN A;  2ETH A;  1ZYR F;  3O6B B;  5IY5 H;  3QPS A;  3CCJ I;  1D5Y A;  3FXK A;  2K9Q A;  4DYC A;  3EET A;  1NK2 P;  1U8B A;  2E36 A;  2CO5 A;  2O7O A;  4V2G A;  1HQC A;  2RDP A;  2EIN H;  2F5E A;  1X19 A;  5FFX A;  4R1H A;  3R6S A;  1J0R A;  2R5Y A;  3PJR A;  1F9N A;  4BBR J;  3CUQ A;  4A3K J;  4DZJ A;  3KZY A;  5B1A H;  4FX4 A;  2IRF G;  2QVO A;  1W0T A;  2OD5 A;  3C2G A;  1H88 C;  2JUG A;  4II2 A;  1E0E A;  2HQ5 A;  2DW4 A;  4BYY A;  3GCM A;  5B1B H;  4OIP F;  2K86 A;  1FIA A;  1STZ A;  5EF6 A;  3BPV A;  4XLN F;  4BQN A;  1FC3 A;  4BU2 A;  3AAF A;  4BJ5 C;  1BI3 A;  1U5T B;  2QQA A;  3TDU C;  4BBS J;  2PFB A;  4D1Q A;  2GAU A;  4YFX F;  2JMW A;  2HZD A;  3HBL A;  2L9N A;  1CQT A;  1J7K A;  2BYV E;  2VLA A;  5L3D A;  2YSR A;  2VON A;  2Z9O A;  4HOB A;  4RAG A;  4U88 A;  2NOG A;  1IW7 F;  4L0Z B;  2X1E A;  3GXO A;  2HWV A;  3CDI A;  4IQ4 A;  1MH3 A;  1OR7 C;  3KFW X;  5HS9 A;  3U2R A;  4BJ6 C;  3J80 Z;  3OYH A;  1KU3 A;  3BRO A;  3NAR A;  5J4V A;  4YFK F;  2PJR A;  3QYF A;  1FSH A;  3JRH A;  3A03 A;  4MEX F;  3TOB A;  2VOO A;  5LGN A;  2EWN A;  4HF2 A;  4I01 A;  2VOD A;  2ZXI A;  3F6O A;  3BJO A;  2Y31 A;  3BR6 A;  4HX8 A;  4Y7N J;  1BN5 A;  2VJ5 A;  1AKH B;  3J80 K;  4OMY A;  4JOM A;  2RKH A;  3H9G A;  3JRE A;  2DN0 A;  3DBR B;  1QA6 A;  2CQN A;  5IYD J;  3FIS A;  1SD6 A;  1WJE A;  1D1B A;  1FWZ A;  2Q8K A;  4A3C J;  4EVI A;  2TRT A;  3I71 A;  3CC2 I;  3L2C A;  1U6G A;  2R0Q C;  4H0E A;  1WVR A;  1IRX A;  3L00 A;  3S3M A;  4II3 A;  4F55 A;  2NXN B;  4KDP A;  1WJD A;  1EF4 A;  3LST A;  1FLI A;  4M3E A;  4BNC A;  3K2Z A;  3N05 A;  4BXX J;  3M8E A;  1ETV A;  4E7K A;  1DUX C;  1FIP A;  3VWB A;  2V1U A;  3J81 Z;  3BR1 A;  3GLL A;  1K4T A;  3E0J B;  1V5E A;  3HUG A;  1EJ9 A;  3HOT A;  1I50 J;  2EIJ H;  3DU5 A;  3KP6 A;  1IRG A;  4YIR X;  4NC8 A;  5FB2 A;  2DOF A;  2BVL A;  4CYD A;  1POG A;  3HTU A;  1K78 B;  3IRR A;  3JRA A;  1IJW C;  1SMT A;  2R7Z J;  2NNN A;  4FE4 A;  4DJA A;  3CMY A;  4OAY A;  3SHF A;  3IUO A;  1RES A;  3DLL F;  3LSJ A;  2Y0S N;  3FKJ A;  3GVA A;  4DBR A;  2BY1 A;  2CQQ A;  2W84 A;  2EZK A;  5AIP A;  3JRC A;  1VF9 A;  1OCR H;  4AVZ A;  4D0P A;  3KZI C;  5JFR A;  1J5Y A;  2OA4 A;  3K4M A;  2DT6 A;  2QZ8 A;  3FIW A;  3G6E I;  1P4W A;  2ME0 A;  3SZP A;  4YEJ A;  4IRH A;  3T0Y A;  2VQG A;  4Y17 A;  1U3E M;  1YW9 A;  2R7R A;  1P7J A;  1WHU A;  2DXI A;  2IAI A;  4XKB A;  3ABU A;  3CCM I;  1FP1 D;  2D1V A;  3CCS I;  1PP8 F;  4M6V A;  2Q0O A;  3P7N A;  1YFH A;  2R4G A;  3OS2 A;  4Q48 A;  1TW2 A;  2O3F A;  2HZT A;  4MQV A;  3WTT C;  1E3O C;  1G59 A;  5J1U A;  4BH9 A;  1UEL B;  2DT5 A;  4RMN A;  3JRG A;  1TTY A;  4A3J J;  3TGN A;  3JR9 A;  3TDZ C;  3HYI A;  4Q47 A;  1I1G A;  3BQY A;  5C44 J;  1R4N B;  2IVM A;  4FET A;  4Y33 A;  3ZOB A;  4C2M J;  2DA3 A;  3JW4 A;  3PFI A;  1AU7 A;  2Q2E A;  3LNQ A;  1YRN A;  4HF1 A;  5LEJ A;  3BG5 A;  3GZ5 A;  5J8C A;  1LKX A;  2F5V A;  5CLS A;  2L02 A;  1XCB A;  2WY7 Q;  3H35 A;  3CES A;  3DKY A;  2DA7 A;  1Z21 A;  4P55 A;  1PP7 U;  4EAT A;  1ZR2 A;  2IS1 A;  3W2W A;  4E6K G;  4D5C A;  3HOS A;  3FF5 A;  1DDN A;  2WAQ A;  2F48 A;  1SFO J;  3SDG A;  4KJZ A;  3S1R J;  2E71 A;  2HOE A;  3S93 A;  1VQO I;  1CF7 A;  4KN4 X;  3S17 J;  3F9K A;  3ZQL A;  3JTH A;  2K3P A;  3QAH A;  3FM3 A;  3HUG B;  4MHG A;  1X2N A;  3RYP A;  1W1W E;  1Z3X A;  5D5X B;  1R5G A;  3PUB A;  2R3S A;  5EJC A;  4KMF A;  1ZAO A;  3C18 A;  1R4M B;  2DMN A;  1XC5 A;  2BVM A;  2KZV A;  4XMY A;  3LAJ A;  1YJW I;  3KX2 A;  4HG2 A;  1RUO A;  3R60 A;  4L9J A;  4LIU A;  1ZQ3 P;  2HOT A;  3SFI A;  3FWE A;  1V55 H;  1ZG1 A;  1HC8 A;  2L54 A;  1T0F C;  3OIQ A;  2Y75 A;  2BXZ A;  3BTL A;  4XLF A;  2DO7 A;  3H5A A;  2P5V A;  2W82 A;  5E3N A;  3T1B A;  5H6Q A;  2HXO A;  2XDV A;  1V4R A;  2VN2 A;  2W57 A;  2MGQ A;  3HJE A;  2VIX A;  1TQM A;  5BOX A;  3H5N A;  3RKY A;  4AYB N;  1Y1V J;  4XK4 A;  4I99 C;  2E2I J;  4WF2 A;  2XUB A;  2NVY J;  4P5O A;  1GHC A;  1MJA A;  2KZG A;  3K10 A;  2A05 A;  1XMK A;  4L5E A;  1ACI A;  4IHV A;  4LB6 B;  4D5F A;  4IRG A;  5BMZ A;  2M30 A;  2K27 A;  4ZYG A;  4P96 A;  2I5U A;  3ZQG A;  5JVT A;  1HBX G;  5E8G A;  1IN7 A;  2LLK A;  2DA5 A;  3MKL A;  5IOY A;  3P9I A;  1DU6 A;  2XAF A;  2NS8 A;  3LA3 A;  4CCO A;  1OR7 A;  1UZC A;  4ZYH A;  2HR3 A;  3WHC A;  5ILV A;  1QZZ A;  2DA4 A;  4B44 A;  3PIP F;  2F4O B;  5F6F A;  5FLX Z;  4RAY A;  2YS9 A;  3S16 J;  4BS9 A;  5FJ8 J;  2K4J A;  4HZF A;  2W85 A;  4FTH A;  3LQR A;  4BXU A;  2XV4 S;  4A3L J;  2KDZ A;  4IL6 C;  2JJ7 A;  2XAG A;  1EV7 A;  4JX6 A;  3EYI A;  5BS6 A;  4E7Z A;  2K9N A;  3PSI A;  3KLN A;  4G6Q A;  2NOJ B;  3BJ6 A;  5GPA A;  3V7R A;  3DXJ F;  4IVN A;  4CO8 A;  1MND A;  1Y39 A;  4BQQ A;  2JRM A;  1N77 A;  2IGN A;  4Y15 A;  4P9U A;  1S7O A;  1IAW A;  1BI0 A;  1D8K A;  2HI3 A;  1XS9 A;  2F5F A;  5TGT A;  2QYO A;  2A3S A;  1ODD A;  1JXS A;  3S14 J;  3HKZ N;  4CCJ A;  5FLM J;  2JPC A;  5JLX A;  3AL0 B;  1NK3 P;  3I4N J;  1Z7L A;  4AVP A;  2RQP A;  3Q3S A;  2ESH A;  1W5C C;  2H6B A;  1X1A A;  2ZME B;  1V3F A;  1JGS A;  1HSJ A;  2WAD A;  4QLC U;  2CMP A;  3TO6 A;  2QUF A;  4O5V A;  1MNM C;  4KIS A;  3B6A A;  1YIJ I;  3I58 A;  1JI8 A;  2WV0 A;  3JSP A;  2M8G X;  4C9Y A;  2VT3 A;  4N0B A;  3LSK A;  4BY7 J;  4RGU A;  1OCT C;  3DPU A;  5DM7 F;  4PJJ A;  3K4C A;  2CUE A;  5DCM B;  1MBF A;  1TW3 A;  1BC8 C;  2GA2 A;  2LR8 A;  2XAS A;  4V19 K;  4E7H A;  2XSJ C;  1AOY A;  1WGX A;  3I9V 2;  3E5X A;  2VKV A;  1SD4 A;  4RM3 A;  3MQ0 A;  3FHZ A;  1WPK A;  3C2H A;  1HKQ A;  3PQJ A;  1NTC A;  5CKT A;  2HNH A;  2O5R A;  1WRJ A;  2RRE A;  4A3F J;  4PFP A;  3OL4 A;  2M0C A;  3C1D A;  1O3T A;  2VXD A;  1QZE A;  2JA7 J;  2Z3Y A;  4AM3 A;  3W2A A;  1QPI A;  2MLK A;  2HQA A;  1U78 A;  3M8F A;  4IXA A;  5EGO A;  4QWQ A;  5ICF A;  4QSH A;  4BEH A;  1NG7 A;  4IX7 A;  2L9V A;  3HZJ A;  5DUI A;  3H0D A;  3HSE A;  3GTP J;  2VT2 A;  3HXL A;  1W36 C;  5B3S H;  5JVG F;  4QPQ A;  4U0Y A;  1ZKG A;  3KET A;  4A3D J;  2C6Y A;  1ZN2 A;  5GPC A;  4MEY F;  1HW1 A;  2PMH A;  2ZCW A;  1A35 A;  4ZDL A;  3JRD A;  4HQE A;  1M1E B;  3LFU A;  4G9Y A;  4EEF G;  2A5Y B;  3PNY A;  2VOP A;  1X4P A;  3CUQ C;  5BNG A;  2BW3 A;  1ZLK A;  2LOO A;  5BPD A;  2VI6 A;  4O6J A;  1JT0 A;  2Q1Z B;  3KP7 A;  1A36 A;  3L7W A;  4F91 B;  3M1E A;  2EJR A;  2DJI A;  3SQN A;  3BWG A;  3ZMD A;  2FQ4 A;  1V54 H;  2OQR A;  2XB0 X;  1VQK I;  4PDK A;  4YEL A;  4I0A A;  1EKE A;  1BBY A;  5LRS A;  2EFQ A;  1MMD A;  3HRU A;  2VPR A;  3FMQ A;  1S7E A;  2EZL A;  2GZW A;  2ZB9 A;  3H1C A;  3Q5F A;  2JZY A;  2LKP A;  1JTX A;  2YX4 A;  2MA3 A;  4A5N A;  1WJ5 A; 
#chains in the Genus database with same CATH homology
 2P0W A;  3PNV A;  1MMA A;  2MC4 A;  2VQC A;  2K9L A;  2VKD A;  2M7A A;  3KEY A;  4G6T B;  2RNG A;  4B48 A;  2VJJ A;  4Y3O A;  4BQO A;  4DBQ A;  4IQJ A;  3DPT A;  1BR4 A;  5FRM A;  4CCK A;  4OWR B;  1X4O A;  4PFO A;  2VQL A;  3W2V A;  4AYB A;  2IXS A;  3S3N A;  1QU3 A;  4OAZ A;  1U0J A;  3DPL C;  3DLA A;  4PUS A;  4IZZ A;  3DEE A;  1D1C A;  2JA2 A;  1MMG A;  3SEQ A;  1V5F A;  3ZQQ A;  3AL0 C;  2E5Z A;  1WJB A;  4N4N B;  3LMM A;  2R7O A;  4BGD A;  3KYL A;  2KP6 A;  2L7K A;  1PYV A;  2CUZ A;  4NC7 A;  1MMN A;  3RCO A;  1EA3 A;  4RLF A;  1X19 A;  2KMU A;  4E7I A;  3PJR A;  2W7N A;  1WJA A;  3OL3 A;  3UNG C;  3K4L A;  2V7F A;  3C2G A;  3MKY B;  2JUG A;  2QKM B;  1BOB A;  4II2 A;  4B3X A;  1E0E A;  2X6W A;  4X0G A;  3OWT A;  3DTE A;  1SFK A;  3H9Q A;  2V9K A;  3S32 A;  2XAU A;  4ITV A;  2VPL A;  3ZCO A;  3OYA A;  3AFH A;  3MMY B;  4BQN A;  3OYE A;  1NG6 A;  5CQE A;  3TBI A;  3VSL A;  4BU2 A;  3OYI A;  1BR1 A;  3LL7 A;  4BJ5 C;  2AQF A;  4ZTF A;  4CH7 A;  4D1Q A;  3I3L A;  4BE2 A;  2Z1D A;  2IS4 A;  1WJC A;  2HZD A;  2PMZ A;  2L9N A;  2IGM A;  5HNH A;  3G2B A;  2VLA A;  2AQE A;  4PSW A;  4DGW B;  4E4H A;  4ANJ A;  3VDX A;  2X1E A;  4XLE A;  4IQ4 A;  3HKZ A;  2RQQ A;  4FAS D;  1OR7 C;  4IKF A;  4BJ6 C;  3OYH A;  2VAS A;  1HA8 A;  3L2V A;  1PJR A;  3K70 D;  2UWM A;  1LVK A;  2PJR A;  2CUJ A;  1N78 A;  3QYF A;  2VJI A;  2HVR A;  5CQG A;  2LY1 A;  3CJQ B;  1K6Y A;  2X6X A;  4ZJZ A;  3OYL A;  4U87 A;  3QYE A;  1VZ0 A;  2CW8 A;  1FMV A;  2ZXI A;  4HPQ A;  2R7U A;  4NUB A;  2VJ5 A;  3L2W A;  4D9J A;  4JOM A;  3H9G A;  4RLQ A;  4HST A;  2MD0 A;  4ZDP A;  1FMW A;  1WJE A;  1D1B A;  2F6C A;  3PFY A;  2MFZ A;  3K70 C;  3K4N A;  3IAS 2;  3VYT B;  3LSM A;  1IRX A;  3OYF A;  3VYU B;  4P1W A;  3S3M A;  4DIQ A;  4II3 A;  5KCM A;  2XF5 A;  3SZG A;  4F55 A;  1WJD A;  3DKX A;  4F3Q A;  3OYN A;  3L2U A;  2DOA A;  3MKZ A;  2GOX B;  3N05 A;  2LH9 A;  2X1D A;  4HSR A;  4XLA A;  3L2Q A;  4E7K A;  3VWB A;  2L5Q A;  4BE1 A;  1Y56 A;  3E0J B;  3RSN A;  1V5E A;  4BJT A;  2IS6 A;  1D0Z A;  4C2U A;  3H9J A;  3HPG A;  3HOT A;  3DU5 A;  3LSI A;  4XQF A;  4NC8 A;  2DCE A;  2K5C A;  3M1C A;  3RTR A;  2BVL A;  4B47 A;  2CV1 A;  2R7T A;  3CP2 A;  5LD2 C;  2OV7 A;  3K4K A;  2WAE A;  1MNE A;  2KDO A;  4BL0 B;  2DT7 B;  4DJA A;  4OAY A;  2OC6 A;  1YX5 A;  3IUO A;  1DP3 A;  1X1B A;  3FKJ A;  2XF6 A;  4NQW B;  4DBR A;  1LFP A;  2F4I A;  3OR1 C;  4AVZ A;  2E5N A;  3FBI B;  4KIT B;  2VJ4 A;  4QPO A;  2QKL B;  3K4M A;  3M8J A;  3VSK A;  2DT6 A;  3AKZ A;  3PNT A;  2V1N A;  1QHH D;  4YEJ A;  2VQG A;  4XR6 A;  2R7R A;  4BDY A;  3FHN A;  4BE0 A;  3OY9 A;  2ZSI B;  4XKB A;  3GBG A;  2DXI A;  2ZFU A;  3HC7 A;  4BEH B;  4KT6 A;  3NWT A;  2R4G A;  5HVQ C;  3OS2 A;  3ZXS A;  4B43 A;  2R7S A;  4XOT A;  4CCL A;  4XL9 A;  1G59 A;  2VQH A;  2CH0 A;  5HOO A;  1UEL B;  2Z2S B;  3S8P A;  4RMN A;  3A2K A;  1D0Y A;  3OYM A;  1V5G A;  4C30 A;  4XLC A;  2A6T A;  3HPH A;  2HPI A;  3OIP A;  2KL4 A;  3BG6 A;  3LSG A;  5LFA A;  4FET A;  4Y33 A;  4HRI A;  1D1A A;  2M0M A;  2VL8 A;  5HNF A;  4XLH A;  4E7L A;  1LKX A;  2F5V A;  2BW3 B;  2LRE A;  2UV1 A;  2WB1 A;  3BC8 A;  3QOD A;  2HU9 A;  2R7X A;  4PJM A;  4F52 A;  2WY7 Q;  3DQV C;  2HDW A;  2KRC A;  3CES A;  3DKY A;  3H35 A;  1Z21 A;  1P9Q C;  2M4K A;  4EAT A;  3BG7 A;  3K4B A;  2IS1 A;  3W2W A;  4E6K G;  3TMO A;  4XN3 A;  3RPU D;  3MD2 A;  2WAF A;  5KNL A;  2WA0 A;  3HOS A;  2LRD A;  2K9M A;  1QHG A;  2W1O A;  4XON A;  2WAQ A;  3CZ6 A;  4E7S A;  4XOR A;  4KJZ A;  3OOU A;  3S93 A;  3F9K A;  1WFX A;  3ZRG A;  2VB6 A;  2K3P A;  2LBF B;  2CS3 A;  3HUG B;  1GLN A;  1Z3X A;  5FRO A;  3PUB A;  4J01 A;  1YX3 A;  2CV0 A;  1UAA A;  4F92 B;  2BVM A;  2KZV A;  4XMY A;  2JSP A;  3SDB A;  2FUG 2;  3IAM 2;  3KX2 A;  4HG2 A;  4HNU A;  1SAU A;  2E1M C;  3QYB A;  4LIU A;  4BDZ A;  2E1M B;  1T0F C;  1X1D A;  2V6E A;  3OIQ A;  2HVQ A;  4XLF A;  3H5A A;  2R7W A;  2W82 A;  3A4C A;  1N75 A;  4PSX A;  5HLT A;  3NWS A;  2XDV A;  4XN0 A;  2VIX A;  2KQR A;  2MYS A;  3PL8 A;  1X1C A;  4HEA 2;  3H5N A;  4XKW A;  3CMM A;  3D5S C;  1R6R A;  4P5O A;  4ZTJ A;  4CCM A;  1YE9 A;  3K10 A;  3OMY A;  2HPM A;  2KRH A;  2V4J C;  1TZL A;  4CCN A;  5FRN A;  2A5W A;  4H4K C;  4BUP A;  2GOM A;  4ZYA A;  2LY2 A;  2V26 A;  1DGR M;  3OR2 C;  3D5L A;  3VYR B;  3H5R A;  2Z16 A;  4CA0 A;  1Z3Y A;  4CCO A;  3QOE A;  4B44 A;  2OUM A;  2E60 A;  2CFO A;  1LDK B;  4XKV A;  4YRV A;  2L2O A;  4BS9 A;  1TT0 A;  1DQU A;  4PJN A;  5KHD A;  3OS0 A;  2IS2 A;  3U21 A;  3OYB A;  4CUG A;  5CPR B;  4E7Z A;  3PSI A;  5JHF A;  2NOJ B;  4MLO A;  1G8X A;  3E1S A;  3PSF A;  2X6Y A;  1ERD A;  1MND A;  3CF2 A;  1KON A;  4BQQ A;  2XF7 A;  1N77 A;  2IGN A;  4C2T A;  4JQF A;  2M3A A;  1BR2 A;  2I8D A;  3BCB A;  2VXZ A;  1UG0 A;  5TGT A;  2PJR B;  2XC7 A;  3BLY A;  4CCJ A;  2KHM A;  3S3O A;  3A1Y A;  2MAB A;  1MW7 A;  4ZDO A;  3FDY A;  2WY8 Q;  3DWL E;  3AL0 B;  1Z7L A;  1X1A A;  3MKW B;  1AA7 A;  2IGK A;  3OYJ A;  2WAD A;  3SYT A;  4R79 A;  2CMP A;  2X85 A;  3OYC A;  3D5R C;  2VKH A;  4HNT A;  2ZXH A;  3EUA A;  4KIS A;  3W3C A;  1JI8 A;  2ZSH B;  4BAC A;  2UUZ A;  4C9Y A;  3OYK A;  1D0X A;  1S9H A;  3LSK A;  2Y0S A;  3IP4 B;  3DPU A;  4PJJ A;  3K4C A;  2WBM A;  4LIT A;  2IGO A;  1Y6I A;  4F93 B;  3FBN B;  4CZC A;  3ONQ A;  4E7H A;  4NNJ A;  2XSJ C;  3I9V 2;  4LG3 A;  4Y4R A;  1W36 D;  3LSH A;  4RM3 A;  2M4G A;  3UR3 C;  4DOZ A;  2KPM A;  3C2H A;  4XOP A;  2CV2 A;  5CKT A;  2HNH A;  2O5R A;  4CSW A;  2RRE A;  4PFP A;  3OL4 A;  2LG4 A;  2VXD A;  2L9S A;  2LYC A;  4J00 A;  2W00 A;  4N4O B;  4BXF A;  3W2A A;  2HQA A;  4PJL A;  3ZGK A;  1J09 A;  4BEH A;  2KLO A;  3EUK L;  1NG7 A;  4IX7 A;  3DU6 A;  3K6G A;  3SEZ A;  3H0D A;  3HXL A;  1W36 C;  3EUH C;  4ZC3 A;  4QPQ A;  4PK4 A;  1DGW Y;  3HG9 A;  3HL2 A;  3BCA A;  3OYG A;  3CJR B;  4AU7 A;  3L2R A;  3V42 A;  2HVS A;  3DTI A;  4ZDL A;  4E7J A;  3OS1 A;  2X1C A;  2JVH A;  4XNF A;  3LFU A;  2BOL A;  3K4J A;  3PNY A;  4LIV A;  1X4P A;  3CP8 A;  4XKC A;  2BW3 A;  2M7B A;  4RM2 A;  2LOO A;  2R7Q A;  4XM3 A;  1ZEL A;  3EPZ A;  1OLT A;  2Q1Z B;  2JVG A;  4F91 B;  4U7B A;  3OYD A;  2DJI A;  1WJF A;  3ZR8 X;  2CW7 A;  2X51 A;  3TL4 X;  2R7V A;  2W4S A;  4YEL A;  3J7A Y;  4GRI A;  1MMD A;  2Q2E B;  3DTK A;  3VYS B;  2LBF A;  2LC2 A;  2ELJ A;  1T95 A;  3RQ4 A;  1WJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...