2OC6A

Crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
GMDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_388456.1) from Bacillus subtilis at 1.75 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Unknown function
molecule keywords YdhG protein
total genus 35
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oc6A01
2OC6A 2KL4A 2I8DA
chains in the Genus database with same CATH superfamily
3RCOA 1TNTA 4BGDA 1FWZA 1IJWC 3LA3A 3DLLF 2L3DA 3O2PE 2XDVA 4MIMA 3VWBA 3L2RA 5C3EJ 2CV2A 5ERIA 1IDYA 4R8HA 3LA7A 3QOPA 2E35A 4IL6C 2F48A 2ID6A 4C3HJ 1WJEA 2R5YA 2WA0A 5FB2A 1N78A 5L3GA 4YG2F 2HYGD 1I1SA 3I4PA 1EH6A 2DJNA 1QNTA 3ZQIA 2O03A 1FMWA 5HDKA 1R58A 2KZVA 1DPUA 4EJWA 4Y15A 2PEXA 2EZKA 3BJ6A 3WTSC 3E1SA 2EV6A 2RDPA 2FBHA 3KZYA 1WI3A 1KQ0A 4CCNA 3RPUD 3TDUC 1IN5A 3CDIA 5LRSA 1U0JA 5TJJA 3BTIA 2C6YA 3CMEI 1E0EA 2GAUA 2R5YB 4EJTA 1S9HA 2ACJA 2HS5A 2V1NA 1T33A 3FXUA 1ZG1A 3OOPA 5H2FC 2O5RA 1VF9A 2TRTA 3ZQCA 2OTJI 1LVKA 4MNUA 5JLXA 5M5XJ 3Q0UA 3FXJA 5BPIA 1FP2A 4DYRA 2DA7A 2YU9J 2VL8A 3HPHA 1LDJA 2OCCH 4KMUX 5KVRA 4KMFA 1OCOH 1WFXA 2PG4A 4MFEA 2J5OA 3F21A 4IHYA 1X2MA 2V7FA 1T0FC 2CW0F 3B6AA 5KAIC 2ZJ2A 1JHFA 1EJ9A 5LLQA 2EFOA 2E5ZA 2V9VA 3HKZA 1Z7UA 2DK8A 1RZ4A 3OOUA 3WHCA 5F0FA 5JR3A 2X85A 3CD6I 2LYCA 5M3MJ 1MD0A 4ZYEA 2ME0A 3LSKA 1GV5A 1BR1A 3ULQB 3CCVI 3IP4B 3AL0C 3JTHA 1I50J 4CYCB 4ZDOA 1OMIA 3IWFA 4WK8F 1VI0A 2STWA 4BL0B 2JA8J 1IAWA 3OL3A 1ZK8A 2HYFA 3ZN1A 1YITI 2IA0A 1O7LA 1PUEE 5FRMA 4Y17A 3FM3A 1QVUA 2VT3A 2IXSA 4RA2A 3RKWA 3FXQA 2ESNA 4HZFA 1FZPB 3BZKA 3KE2A 5K5RA 2DFIA 2Y9ZA 2KRHA 1JKRC 3QPTA 3L2UA 4KFCA 2GBYA 2E2IJ 3K1NA 3PSFA 2M0CA 2RN7A 2Q1ZB 1XCBA 2K9MA 5FROA 3PIPF 3ZQHA 4EM0B 1ULYA 1ZKGA 3R4KA 3FHNA 2LREA 4U0VA 1HSJA 1POGA 4G6DA 4ITVA 4A6DA 3GX4X 3DPTA 3CCUI 3HEFA 4QPOA 1VQKI 3ASNH 3GFJA 3JSOA 3A0HC 3EDPA 3RKXA 4G7HF 5D5XB 4HX8A 1C0WA 3CCQI 5CQEA 3SFZA 2IA1A 3ZQGA 3KLNA 1HLVA 4HG2A 1X58A 1G3SA 2VQCA 4NC7A 4L0ZB 4I7HA 1A31A 1IRZA 2CUFA 3ABTA 2L0KA 2F5CA 3RYPA 3QYFA 3C3WA 4DNCA 4N4NB 1I27A 4OMZA 5HS8A 4IQJA 4KIFA 5HDGA 3DP7A 3CJQB 1QHHD 4BDYA 2D2WA 4O5VA 2IS2A 5D4SA 1SAUA 2MBFA 1USTA 1ZYRF 2DMTA 2PN6A 3BP8A 3WTZA 1LFUP 3N05A 1S5LC 2P7VB 1IUYA 1BW5A 5E1XA 3E6CC 2YR2A 2W7NA 4AWXB 3S2HJ 1XTAA 1SFOJ 1Z05A 2Z5UA 3JRHA 5DCMB 3ABLH 1B9NA 2A05A 2DO7A 2EFQA 3G1LA 5EEAA 2L4AA 2VPLA 3ZPLA 3FZVA 4BH9A 2ZB9A 5FO5A 2R3SA 4BXUA 1ZG5A 1GVDA 2FMLA 2DW4A 4S05A 3KZIC 2D1VA 3IKTA 2DN0A 5F1RA 2F4IA 3BZCA 3K7AJ 4BQNA 1X4OA 1H0MA 1ITYA 4CYDA 2QBYB 2DMUA 3DEUA 3ABMH 2CS3A 5B1BH 2WY7Q 2K86A 4IRHA 1P9QC 4NHJA 1HDDC 1PUFB 2K9LA 3BT9A 4BE2A 2JSPA 4NBQA 4IHWA 2BV6A 2M0MA 2ELJA 2KMUA 1FYKA 5HNHA 1R71A 4IOAF 4EGZA 2K85A 4B8XA 1T98A 2LP0A 5EZHA 2JN6A 2PJPA 2B63J 2L2OA 1XS9A 2YS9A 4HNVA 1B72A 5L3DA 3HOUJ 1GXQA 1YJ9I 3HG9A 2JRMA 4RAFA 1G8XA 3GMEA 3IH4A 1YQAA 2CQKA 2A6EF 3JR9A 2FXAA 1XSVA 2NNNA 4E7HA 2KJBA 3MKYB 3E3VA 1XPXA 1KYWA 4DW6A 3CUQC 2OQRA 4A5MA 3DKXA 2HTJA 4XMYA 3G2BA 2KJCA 2EBIA 1VQMI 2ADUA 1LFPA 1T95A 3DLAA 4AYBN 2YSRA 2R7WA 4L5IA 1O7FA 3CO6C 1LDKB 4LMYA 3GLLA 2HQ5A 1V54H 4I2OA 1MNEA 4E70A 1MMDA 2FUG2 2K3PA 4XLNF 4U87A 4LIVA 3BC8A 3WU2C 1TP4A 1AHDP 3PO2J 2QKMB 3PNYA 3OR1C 4I6ZA 5IT9Z 4DYQA 3DEEA 1JKPC 4OIOF 3S16J 1KGSA 4FX0A 4BHBA 4HV5A 2Y75A 1K79A 1NG6A 3Q5FA 1JJ8C 2LKPA 1H8AC 4YFXF 2E2JJ 3BTLA 3GBGA 3QAHA 4F52A 1SD5A 2VN2A 3QWLA 2QWWA 3B73A 3T1BA 1W5TA 4E4HA 3MWMA 3R61A 5D4RA 3CMMA 3S3OA 1I6XA 2RVCA 2RQPA 4PJNA 2DQLA 3WG7H 1RUNA 2HDCA 2NVQJ 2X9DA 1T08B 1OYIA 3LNQA 1WJDA 2VUMJ 5LGUA 3DBHB 3IC7A 1DGWY 4HYEA 1X1AA 3DTEA 3KP7A 4G6QA 2HVRA 3K2ZA 2OTLI 1YW7A 3DKWA 4IKFA 1QPIA 2Z99A 4CCKA 1QBJA 2RREA 3GZ5A 3L1PA 4XOPA 1P7JA 4DBRA 2BXZA 3TW6A 1YLFA 3K4BA 4XKWA 1W4MA 3D5LA 3V8KA 4KT5C 3NWSA 3B02A 1Y39A 1I1GA 1FTTA 5CVRA 1UHSA 2IAIA 3PIOF 2ZJQF 4A0ZA 1JGSA 1O57A 2XGDA 4CGZA 1MW7A 2ZC2A 3HYIA 2DOEA 1O3TA 2EB7A 3WU0A 2JJ7A 3PNTA 1HKSA 2CQ7A 4XRFA 1WCMJ 2QENA 4Z2YA 2ELKA 2VQLA 3V42A 1IRFA 1OKRA 3ASOH 2GLOA 1XGMA 3JRGA 2DCEA 1P4XA 2OZUA 2PX9A 4TV7A 2MFZA 2JTVA 2QSGX 5L3FA 3HSEA 2VBYA 5EJCA 2K02A 3K70D 3OYKA 3SZTA 2FNPA 4LGWA 5ILVA 3QQAA 3WODF 2K27A 3HGGA 1I5ZA 1SANA 4WX9A 1D0ZA 1IDZA 2VBZA 2MC3A 5FKMA 2EILH 3RTRA 2VXDA 5E3LA 1ETXA 3CCJI 4LB5A 3P7NA 1V5EA 1Z1DA 3OS0A 2K9SA 3IL2A 2DJIA 3S1MJ 2FRHA 2VXZA 1Z67A 3M9AA 4I0AA 3LAJA 3FKIJ 4UUSA 2L9NA 2W57A 2OUMA 3IAS2 2D5VA 5EGOA 1T6SA 1K6YA 2YX4A 2O8KA 2HFHA 2XSJC 2JWTA 4F7ZA 3RKQA 5DDGA 4Y7NJ 4EJVA 1WGXA 3OV8A 4M6VA 1FBUA 1OCTC 3BQYA 2VJ5A 4ZTJA 5FRNA 1D8KA 3OYJA 3ZMSA 1XC5A 2DLLA 2WBMA 4FT8A 4J19A 4F91B 4HV6A 3K1MA 3RKYA 2H8RA 1FMVA 3O6BB 2CW7A 5A2QK 4I09A 3R0JA 2R7ZJ 5KNLA 4M3BA 2BBYA 1MMGA 2VI6A 2BY1A 3HM5A 3HTUA 1VQ7I 3RQ4A 1IRXA 2CV0A 1S6LA 2UUZA 2MYSA 1RETA 3ISPA 3CP2A 2OA4A 1VQ8I 3H3VK 3RSNA 1BIAA 2AHQA 3CJRB 3HXLA 3HHGA 1D0YA 4A0YA 4E6KG 2FD5A 2M7BA 1IW7F 3N4MA 2CYYA 3H92A 4AC0A 3G4SI 2HQNA 1BA5A 1RI7A 2K9QA 4CCJA 4DIQA 2EIMH 2V6EA 4RS8A 5HVQC 1BI0A 3MD2A 2CUEA 4MTDA 1FNNA 1Y6IA 2QF7A 4S0HB 2E2HJ 1NHAA 3BR0A 4EVIA 1DU6A 2E71A 3HC7A 3KP4A 1LPQA 4IJAA 2ZNZA 3BQZA 5EEGA 2XAUA 3GTKJ 2UXNA 3ZGKA 5IYBJ 1XCVA 1EA3A 3RQIA 1STZA 3M8EA 3UKGA 1HF0A 1TQMA 3GWZA 3OS1A 1SEUA 3HRUA 4H0EA 4Y4RA 1K78A 2VC1A 5DD4A 1S7AA 1M1EB 5GAHJ 3FISA 1XDSA 2LR8A 1MJ9A 2XHKA 1HKTA 1I3QJ 4QWQA 1SVLA 3BOQA 1CQTA 2M4GA 3MZHA 2MH9A 1KONA 1R23A 2OQGA 4LLLA 5D5VB 4GYGA 3DQVC 2BHZA 2CMPA 3RZDJ 1VQNI 3F22A 4BUPA 2EQRA 2DT7B 4KT6A 2LOOA 4Y3OA 2XAJA 1MMSA 1W5SA 2OJED 4MLOA 4ENJA 1UAAA 5J6XA 3SFIA 4NUBA 1IZ1A 3KLOA 4U7DA 3J81K 4I76A 4C3IJ 4MO7A 2KRCA 3EETA 2JPBA 2K40A 4A3KJ 3WG9A 4HOBA 1VQPI 4PFPA 5FLXZ 1ZGJA 4A3DJ 2VJJA 4WXHA 1LDDA 1R5ID 5FLMJ 1U5TC 3VOEA 3L9FA 3VEPA 2HYJA 2W25A 2FBKA 2XGCA 2X1CA 2R7TA 2E1NA 5IT3A 3HUGB 4L9JA 2HQRA 2L9SA 1FBSA 4HBLA 2F2EA 2ZFWA 3DCFA 2CWEA 3FM5A 4QIWN 3ECHA 3TMOA 1BJZA 2KQRA 3K70C 3VSKA 2JA6J 1ZLKA 4BBSJ 3WE3A 4ABZA 3ONQA 2H27A 2VKHA 1SFKA 3GCMA 3H9QA 2XV4S 1U8RA 1ORKA 3S15J 4RGUA 1IC8A 2L5QA 5EEHA 2N8GA 4A0XA 2OC6A 4D7NA 2XRLA 4HRIA 2XPWA 4Y52J 1HOMA 2BXYA 2IA2A 2CQNA 2IRFG 2LG4A 3E6MA 3PL8A 2ZJRF 1QO0D 3CC4I 3ZRGA 4I99C 4HQEA 2AO9A 2G7HA 3PUFA 2EA4A 2HZTA 1G6NA 4LFUA 1H89C 1LKXA 3DF8A 2A5WA 4U0YA 2EIKH 2JA5J 2IVMA 5E1WA 1UG2A 1KZHA 1UHWA 4ZYDA 5BOXA 1HW1A 3DXJF 3K6GA 1FEXA 1UJ8A 5JHFA 1ENHA 2F4OB 3L2CA 2DA3A 5IYDJ 4E7ZA 3VDXA 1I39A 4F93B 4V2FA 2W1OA 1F36A 3H9GA 1KA8A 2ECCA 4RB1A 4GCVA 1LE8A 2IPQX 2QGUA 3A02A 1D5YA 4B4CA 3M1EA 3A01B 2MLKA 4F92B 3GTMJ 4A3BJ 4HSRA 3S3NA 3OSFA 1VQ4I 3TKYA 3A2KA 1D1CA 2R7UA 4BQAA 3RJPA 5F64A 2AXLA 2DU9A 2P6TA 3PUBA 4NC8A 2PJRB 3U9GA 4RBOA 4M9ZA 1UG0A 4MEYF 1Z0XA 3HSFA 4RAGA 3WTYC 1FIAA 3BJAA 3GW2A 5DYMA 1FP1D 2Q2EB 1FYLA 4CXFA 2FBIA 4KUMA 5M5YJ 3OYAA 2A69F 4RAYA 4P5OA 2HNHA 3BLYA 5BMZA 1IRGA 4XN0A 3WE2A 4AU7A 3LQQA 3N97A 2WY8Q 3U2RA 1TQIA 3CLOA 1U5TA 2EINH 4HPQA 1OYWA 2HR3A 3K2AA 5J8FA 5B5EC 4KA4A 1DDNA 4BY1J 2VBWA 3OYCA 2ZMEA 1JT6A 1BN5A 3JRCA 1F5TA 3JRAA 1Z91A 3I55I 4ESJA 3WTUC 1D1AA 3BR1A 2UWMA 2Z16A 3MMYB 1FOWA 1XG1A 3GUDA 1Z3XA 1SD4A 3KEYA 3MCZA 4NC6A 1LNWA 2VBXA 4BJTA 3OIPA 3F8MA 1X19A 3LSHA 2PMHA 1IF1A 3ZOBA 1OJLA 1JKQC 4HF1A 3HOXJ 4EGYA 4C2UA 2XIGA 1YOVB 1J2XA 2TCTA 2VPRA 3E5XA 4Q48A 4IEJA 1MSEC 1XGOA 1AA7A 2CUJA 4X6AJ 2LY9A 2DDAA 1FIPA 1TQPA 4RMNA 1I6HJ 2RNJA 3BPXA 4LLGF 1Y8QB 2DQRA 4QLCU 3TL4X 1LUJB 1MJBA 2EH3A 2KZGA 1IGNA 3F23A 1JUPA 4MGRA 1W5CC 5J4VA 5LEKA 2K9NA 5E20A 3ZMUA 2NRAC 1VNDA 4ETSA 2M45A 5GP9A 3DWLE 1X2NA 3M8FA 3NAUA 1QZEA 2XB0X 1V3FA 4KISA 2GWRA 2QBYA 4B48A 2A3SA 2GIVA 2FU4A 3BY6A 5J1YA 5JLWA 2QQ8A 1JI8A 3A03A 5CVVA 5KAFC 3I59B 4L9VA 1MSFC 1OFCX 1UMQA 2DOAA 2WAFA 3ABKH 2PJRA 4IXAA 5CKTA 2JZYA 4MHGA 2M9HA 3S93A 3KX2A 4FCYA 4M9SA 3MN2A 2DA1A 5IT9K 4XSZF 4CYCA 2BGCA 2Y31A 1ZELA 2Q8KA 3CCLI 4HEA2 2DAOA 2CV1A 1R36A 2E1OA 4I0BA 3DKYA 1B72B 1ZLJA 4AYBA 2LLKA 1E17A 4P9FA 2WADA 3JTGA 2M5WA 1SMTA 5FFXA 1YRNA 1FY7A 4A5NA 5EG0B 2L9VA 2R7OA 2X4HA 3HOTA 3F72A 4WXCA 4HLXA 4C30A 3IHUA 1MZBA 2X51A 4KDPA 4N9HA 4QTRA 4YIRX 4GGGA 4KJZA 2WWYA 1YFHA 1S8NA 2CW8A 4IVNA 5FFZA 2BY0A 2B0LA 1IN6A 4JP0A 1ZTRA 4E7LA 4IHXA 4D1QA 3AAFA 3QU3A 4RGXA 5ICCA 2IS6A 1O4XA 2ZMEB 3BROA 3R6SA 2KDZA 3OYLA 2V1DA 3ZMTA 2EPFA 2M7AA 1B1BA 2R7QA 3CESA 1T0FA 4HLYA 2VKVA 3I5UA 4UUVA 4ZJZA 2O6GE 1MH4A 3AG2H 3L00A 3UNGC 3J80K 2ESHA 2Z2SB 1BC7C 3RDIA 1YS6A 1FBQA 5K5QA 1AU7A 3R0AA 1ZRFA 4BNCA 1ZR4A 4BAYA 2MLGA 3LA2A 2R5ZA 5BQTA 1N25A 2F4MB 3HOWJ 3HBLA 4CA0A 3T0YA 1RIOH 1R22A 1KU9A 3H36A 3TDZC 2LDUA 1FSHA 3ERMA 5ILUA 2R7XA 4I01A 1ON2A 4ENMA 3FBNB 3OIOA 1MBEA 4RLQA 4OINF 2A6HF 4M3DA 1ETVA 2Y0SA 3JSPA 1R7JA 3ZMVA 3CJTB 1HQCA 2NS8A 2LMDA 3P9CA 3A0BC 1X3ZB 2EFPA 4BXFA 5BPDA 5CYVA 2VKEA 3QRFF 5J40A 2HVSA 1SFXA 2XC7A 1K61A 4UXNA 1QVTA 2E34A 3H5AA 3O8HA 4P1WA 2P8TA 2VC0A 4XRSG 2QZ8A 5ILSA 2GZWA 4N0BA 2HPIA 1F4KA 5J47A 3C18A 1X1PA 2HKOA 3DU6A 3PM1A 3ZN0A 2ZXWH 2XF6A 5EG0A 5K5OA 3V7RA 3J7YJ 2FOKA 4WXDA 1UFMA 4LOCA 4ZH4F 1REPC 1VQOI 2R4GA 2G9WA 4CZCA 3MKZA 3FK6A 5E3MA 1OCCH 5D5UB 1ODDA 3PQKA 4HF0A 2DXIA 3H0GJ 3H3ZA 3BR5A 4NDLA 4QSHA 2LFBA 3HOYJ 3EYIA 3MQ0A 4G6TB 3VYTB 1KU7A 1JTYA 3NEUA 3CDHA 2CRGA 2E36A 3K4CA 4II3A 2BVLA 5CVJA 1E3PA 2NS0A 3AG3H 1V4RA 1Y1VJ 1MGTA 3CF5F 2XAFA 2G7UA 1HDPA 3BR2A 3W2WA 3QPHA 5EGOB 3HGYA 5IP6A 2ZCWA 2RAEA 3TO6A 2HDWA 3GF2A 3WGGA 4BXXJ 1CF7B 4YIIA 1WJFA 2V1XA 4LG3A 2EA2A 5GPCA 2GXAA 2BVMA 3I53A 5BS6A 1EF4A 3SEQA 3VSLA 1X3UA 3GZNB 5DTDA 5E17F 4LB6B 2OF7A 4E7SA 1YYVA 3C1DA 4BY7J 3M1CA 5IY5H 1MNDA 2PMUA 4A3FJ 3O3KA 4GO1A 3KFWX 3T5XA 1W36C 1TWFJ 4ENNA 2TDXA 4XR6A 1NH3A 1UB9A 5C4JJ 2KIQA 3IWZA 4N9IA 4BHCA 1Q1VA 3ZR8X 4IX7A 2EZHA 3I9V2 1J59A 2MC4A 1J7KA 2CJJA 2LD5A 4D7MA 2XF7A 2KT0A 2QEXI 2HOAA 2Z1DA 2O0YA 1B8IA 4DQ2A 4PDKA 2L7MP 5J8CA 3HRMA 4XRSA 2KFDA 4A3JJ 3CCEI 1YI2I 2DA5A 3OYBA 4FTHA 3MKWB 1OCPA 1BI3A 2E7WA 1UELB 1R5HA 3OL4A 4XLAA 3I0TA 4RLFA 3BR3A 4D5FA 2O8XA 5GPAA 3GXOA 2JMWA 1MMNA 2UV1A 2V79A 3CCSI 4RM2A 5J1RA 5HLHA 4PGGA 2E60A 4WWCA 4A3MJ 3WTXC 1D8JA 1DQUA 4YEJA 3F8CA 1SFUA 1W7PA 2L7FP 4WF2A 1MKMA 1RNLA 1YHQI 3QU6A 1E2XA 3L2VA 2PLYA 5FJ8J 4FE4A 3U21A 1FPQA 4ZZLA 2W48A 2ZXIA 3TOAA 2MA3A 4RB2C 2D45A 1NG7A 2WC2A 4J00A 3CCRI 3H1CA 2A6TA 4X1EA 3HRTA 5M5WJ 1VZ0A 2H94A 1WVRA 2COBA 5FD5A 1GDTA 1A36A 1J75A 3AFHA 2FEZA 2R7VA 1S7EA 4BU2A 1RKWA 2DA4A 3OR2C 4M71A 5H6QA 2RQQA 2DT6A 1X3WB 2VQHA 2XGXA 2R93J 2ZBKA 1RR7A 2QQBA 2ZMEC 4BS9A 6PAXA 2KRFA 3L7WA 5LGTA 1Y0UA 4NQWA 1BC8C 4CCMA 1R00A 3LL7A 3FWEA 2CFOA 2YPRA 4MTEA 1IXRC 1TT0A 2HOEA 4GYIA 4BBRJ 2IS4A 2BZTA 4F3QA 3ESWB 3KIOA 2M87A 3ROUA 3VB2A 1KU2A 2CUZA 2LK2A 1SFEA 3GEZA 3KP5A 3QP6A 2OZ6A 2R7DA 4L18B 2X48A 5E79C 5BNGA 3ML6A 3CLQA 3MAJA 2W00A 3CP8A 4IF4A 5CQGA 4ESBA 3HUGA 2XVCA 2H09A 2KP6A 3ZQFA 3BPVA 3RYRA 3V8JA 2K3FA 1PVEA 2ICWG 4Y33A 1RESA 3MZYA 4H4KC 4XLFA 5LGNA 3TP3A 3M07A 4XBFA 1XN7A 5J4YA 5E3OA 1FT9A 2RGVA 5LBQA 1FSEA 2BE5F 5M3FJ 3V8LA 1YX5A 5AIQA 3FMQA 3K10A 2H1KA 2HEOA 3OY9A 2CQXA 2QA4I 1F1ZA 5ICFA 2D1HA 5L3EA 3ERED 3E97A 2KISA 3LSIA 3J80Z 5D6FA 3SZPA 5DS9A 2X6WA 3C2GA 1E3OC 4UV9A 3W3CA 1WHUA 1P4WA 2W4SA 4PGHA 4ZTFA 1X1BA 3B6CA 1XGNA 2GIZA 2IGMA 1OR7A 3G73A 3K4MA 4BJ5C 2V9PA 2DMPA 4DBQA 3IRRA 5K7FA 3SEZA 1FOKA 4F55A 4CCOA 2DMNA 3S1NJ 1WJBA 2X1DA 2P5KA 1LE8B 1HC8A 1O3QA 1R49A 2L7ZA 2P5VA 3LWFA 1G3TA 4WCGA 2OBPA 3KEOA 4YIFA 1Z7LA 3S17J 2VOOA 3FMRA 4OOIA 1ZRCA 2O3FA 4XOTA 2VLAA 2BHYA 4OIQF 1LJ9A 4XQFA 3HL2A 4LD5A 3WGIA 3OYDA 1ONVA 4IQ4A 3W6KB 5DCFA 2MG4A 5HOOA 1K78B 1V55H 4DGWB 4M3EA 5ICEA 2IBDA 1WSUA 2XF5A 3I4MJ 1NK2P 4RGSA 2KIFA 4OWRB 1ZH5A 5IYCJ 1U6GA 1ZREA 4CH7A 3JRFA 2YU3A 5KCMA 4UUSB 2W85A 5F0HA 2I10A 3MEXA 3AG4H 3QPSA 3I71A 4FQGA 5IOYA 1RPWA 5FKNA 1IN4A 3W6JB 3S32A 1VTNC 2GQQA 2NVXJ 1IN8A 3W6VA 3P9IA 4KIGA 1SMYF 2L7KA 1VQ6I 2DDBA 4B3XA 4FHTA 2HZDA 5L3BA 5C44J 3CDLA 3H9JA 4G7OF 3FKJA 1J9IA 1K4TA 2VE9A 2M8GX 1APLC 2X6OA 5JHUA 2EV5A 2FQ4A 1D3YA 1LFBA 2R92J 5DM6F 3GLXA 1PJRA 5HLGA 2VODA 3CCMI 2ZXHA 2GA2A 1F43A 4II2A 4L9NA 5F27A 4HNUA 5GTIC 2EFNA 3BG6A 2E1MC 5LHGA 3SDBA 1T39A 1JXSA 2WB1A 5A2QZ 1XX5A 2VE8A 3BWGA 3R60A 4P9UA 3LAPA 4IO9F 2O61A 2MW8A 5LRRA 2QVOA 4KN7X 2JVGA 2X0LA 1FOXA 1A04A 5LFAA 1T56A 4XICA 1LB2A 2CU7A 1V5FA 3Q0VA 3C2BA 3KETA 3WTTC 3BG9A 2A61A 4CCLA 4JYKA 4LK1F 3OWTA 1JGGA 2Z3YA 4ZZDA 1WQ2A 1JT0A 4HA8A 1G59A 3F8BA 4JBAA 4N4OB 2G0EA 4JX5A 1B59A 1R4NB 4FISA 3OS2A 2VOPA 1BOBA 4ENKA 1SC7A 3K4JA 2KIMA 2LTPA 1B9MA 4ANJA 2MSYA 3V4GA 1TWHJ 4S04A 2JPCA 2DK5A 2VIXA 3D5RC 4D5CA 1Z9CA 2IGOA 1R1TA 1IG7A 1Y8RB 2FNAA 4LIUA 2JA7J 1FOYA 1S3JA 2L01A 3FXOA 3BG3A 3FK7A 2E7XA 2JT1A 3BCBA 5K7HA 1GXPA 1ZHFA 4ZDPA 4LG0A 2PI0A 2V1UA 1DU0A 1USSA 3ABUA 4W97A 2L9RA 5FLVA 3VYSB 2GA1A 3S1RJ 4L9TA 2I5UA 3OYIA 3V7SA 4EEFG 2M3AA 3OYMA 2QLZA 5HDNA 2PBIA 4HX7A 2XKPA 4IHTA 2P6SA 2ETHA 2PMZA 3NQOA 5F04A 2MGQA 2QYOA 3ZMDA 3CTAA 2Y2ZA 1BIBA 2KHMA 3CUQB 4ZDLA 3DV8A 4HW0A 4G9YA 3K9TA 2OAZA 3K4LA 1SD7A 3K4NA 2NS7A 3OIQA 2HPMA 3M4OJ 2J5PA 2Y48A 4A3GJ 1U5TB 3HOZJ 2BW3B 4D9JA 4JK1X 3VYUB 2H8WA 4UV8A 2BYVE 2HOSA 3H3UA 3L2WA 2H6CA 3G1MA 1ZR2A 2EWNA 3TO9A 3G3ZA 3OYGA 3D1NI 1JTXA 1FC3A 4UVBA 1WPKA 5DD8A 5IP7J 1XMXA 4OAYA 3SHFA 4IZZA 2I8DA 1H9GA 1TL8A 2KL4A 3JW4A 5FKLA 4AD9A 3S2DJ 3SDGA 4BKXA 3I58A 3F0CA 2K4JA 1ACIA 1YG2A 5JVTA 4AIJA 3JRDA 1YJNI 4B09A 3GTJJ 4U7BA 4B3AA 2EZLA 5E3NA 2ZSHB 2W82A 2R7FA 3DBLB 2O9LA 3VFZA 4R1HA 1S72I 1WRJA 1XB4A 3QYEA 1D0XA 1BI2A 2EJRA 2COMA 2BY2A 4A3EJ 2XAHA 5CPRB 3HRSA 4P55A 2LH9A 3MVPA 5TISC 1IXSB 4XKVA 3CMYA 1K4SA 2QCOA 3ZCOA 3BTCA 4XSXF 2P0WA 2K5CA 1RRJA 3Q3SA 5CVUA 4C9YA 1W0TA 1S29A 3V7CA 3RZOJ 1L3LA 4QPQA 3L09A 2Y0SN 4LK0F 5JI6A 1SD6A 3J81Z 4AM3A 1G3YA 3DBRB 4PJLA 4OU0A 2W24A 3MKLA 3KPHA 5ICGA 1TW3A 1Y0NA 2ZO4A 3CZ6A 3EQLF 4IPAA 4I02A 2UXXA 2A07F 5B3SH 1FLIA 4BQOA 1TWGJ 1B4AA 1P4AA 4M3GA 3WHBA 4GFBA 5L3CA 2RKHA 3HB9A 4LG0B 3OYHA 4L5JA 3GFLA 4KYWA 1Y1WJ 5F08A 1ZRDA 5D5WB 1QPMA 4XONA 4LJZF 2OD5A 3GTPJ 2E1MB 1P7IA 1V5GA 2V4JC 1XSXA 2LKSA 3TQNA 3GZ6A 1PP8F 1LVAA 2WV0A 2X1EA 2BW3A 2RNGA 4B1RA 3KCCA 5D8KB 1T38A 2LNBA 5K1YA 4CZZA 1H88C 4HDUA 3GO5A 2NVTJ 1KQ8A 2K4BA 2P81A 2H6BA 1ZG3A 2HU9A 3KP3A 4UB6C 3SXYA 3GYHX 2MD5A 2Z33A 4JX6A 2NVUB 4UNOA 4RGRA 4MEXF 1TBXA 1QU3A 2XROA 2XAGA 2EK5A 5EF6A 1O3SA 2F5FA 2Y9YA 5CJ9A 3VODA 5IOZA 1AKHB 1ETQA 1NTCA 3FHZA 3C2HA 3LMMA 4AIHA 1YJWI 4B44A 1ZQ3P 2DFEA 1UHMA 2L02A 4IRIA 5FD6A 1W7PD 3CMAI 2QQAA 1BBYA 2OU2A 1BJAA 1R4MB 2K7LA 3O8GA 4CHUA 1E3HA 1RC9A 2A68F 1PDNC 2ZFUA 3PFIA 4IHVA 2R0QC 2XB5A 4PK4A 2JRTA 1TLHB 2DFFA 4GXOA 3PO3J 2CO5A 2FF4A 3LQRA 4C2MJ 3H5RA 2QM3A 3TW7A 1O3RA 3J7AY 3LSJA 2DOFA 3C7JA 5JVGF 3FXMA 4BEHB 4UVAA 3ZXSA 3I56I 3S14J 1ERDA 2GXGA 3EYYA 5KHDA 3KYCB 5CVIA 1B8IB 3EUHC 4HSTA 2V9KA 4XKBA 3S2WA 1ZGAA 1XMKA 2VB6A 3QODA 1VFCA 3NARA 3LOCA 3M7GA 4BACA 2LF7A 1U78A 3BTJA 3VYRB 3ZQ7A 5IP9J 5FGMA 1QA6A 1MH3A 1HXDA 5ED4A 2XPUA 4GDFA 2YX7A 3SJMA 4UVCA 2ZSIB 1YO5C 1NK3P 2CGPA 2E19A 4XK4A 3OMYA 5K7ZA 3REOA 4RDUA 2HQAA 2FX0A 3CF2A 5EYRA 4BEHA 4XKCA 2QSHX 2FOWA 1P92A 4Q47A 4RAZA 5IPAA 3IH3A 3COAC 5E8GA 1XDUA 3K4KA 1MBKA 3ELKA 1TWCJ 4DOZA 1YRNB 2F5EA 3K1PA 3F3XA 2GOXB 2HI3A 3I3LA 4ZYGA 2E1CA 4YFNF 5HS7A 3E7LA 4XLPF 1IO2A 3OSGA 1OCRH 4AVZA 1SVMA 4E7KA 4JQFA 2NOJB 2F5DA 1JE8A 4Y13A 1D5VA 2ISYA 1U9NA 1Z21A 3OYFA 1BR2A 3UR3C 2IGKA 2IP2A 4L0YB 2IJLA 5DUIA 3M8JA 5FLXK 1FJLA 3JAMK 3Q9VA 4NQWB 2HOTA 3P5JA 3CQZJ 4ZYHA 3EPZA 1ZGWA 1AKHA 2R5ZB 1DGRM 5DCMA 4ZC3A 1T2KA 2Q0OA 2B9SA 2XSDC 1R1UA 2M2EA 5EZGA 2GXBA 4OMYA 4UB8C 1HW2A 2BOLA 2RC4A 4G12A 3ZMZA 4ON0A 1SVOA 1A6IA 2IT0A 1CF7A 2X6YA 3HHHA 1R6RA 2EIJH 3SZGA 1RKTA 2NVYJ 2O7OA 3E6DA 2A5YB 1OYYA 1LQ1A 3J7AO 1OLTA 1H9TA 3WGHA 1WJCA 1PYVA 3ZQLA 1FYMA 3W2AA 2GM4A 3KP2A 4XLHA 3CO7C 1PUFA 3SQNA 5J3LA 2VJ4A 3WTVC 2YUSA 2KPMA 5DEQA 2ZNYA 2QKLB 2M34A 3IUOA 3FXKA 4CDGA 3QYBA 3EUAA 1CGPA 1EH8A 2OV7A 1IN7A 3F9KA 3TP0A 2AXTC 1AWCA 4HF2A 2STTA 1XMAA 2CSOA 2JVHA 4OAZA 2CQQA 2HGCA 4UY8I 1QHGA 1U3EM 2F6CA 1Q1HA 3FX3A 2VKDA 1GHCA 2MABA 1MBHA 2Y30A 5D6EA 1Z3YA 3HPGA 4KITB 1Z77A 1YX3A 5F6FA 1U9OA 1GUUA 1MBJA 1EH7A 4KIBA 4OIRF 4EJOA 3DPLC 2KLOA 4M3FA 2LVSA 3FMSA 2JUGA 4W1UA 4CUGA 3RPQA 4JX4A 3QP5A 1U2WA 3CJNA 3T8RA 1MJAA 3G6EI 3F6VA 4A3CJ 4HNTA 1KQ9A 2MH2A 1IV8A 1YW8A 5H20A 2HXIA 3D5SC 4U0WA 4DYCA 1R1VA 4IHSA 1J0RA 2L4MA 1VQ9I 2NAZA 3JCUC 3RPUA 2LY2A 5HLIA 2WAQN 3BDDA 2M4KA 1YIOA 3L2QA 1XGSA 4NB5A 5LEJA 2IS1A 1J5YA 3BJOA 3ECOA 4B43A 4U88A 3GFMA 4L5EA 4HDVA 3KYDB 5GAEJ 2Z9OA 1N75A 1YS7A 2ZKZA 1HA8A 2FE3A 3P9KA 3IAM2 1WH5A 3H5NA 4EM1A 5B66C 1BR4A 2Y0MA 3GTLJ 3E5QA 2NYXA 3PNVA 1TWAJ 1GV2A 2LC2A 2XPVA 1A35A 2ZXJA 4O6JA 4CO8A 1L0OC 5LHIA 3ZP5A 1ETKA 1X1CA 1I3AA 2KIUA 4EQQA 4B47A 1QQIA 3H35A 3IH2A 2VQGA 1MDMA 4KNYA 3KEQA 1FTZA 3M3YJ 1HW5A 4MFDA 3HIFA 2NXNB 4ZYAA 1J09A 1ON1A 1TZLA 4EATA 1GVJA 4BDZA 2NOGA 4DJAA 4IRGA 2DA2A 3MFKA 2R7RA 3I4NJ 1OISA 3DFGA 4E7IA 3A4CA 1MMAA 4M73A 3LSPA 3JRIA 1MNMC 2JA2A 1QRYA 3TGNA 3F6OA 3D0SA 5E1ZB 4ESFA 2XAQA 1JUSA 2AQFA 5HODA 1BL0A 1RR8C 1PP7U 3GVAA 4PJ0C 3K0LA 4BQQA 3NRVA 1IV6A 1WJ5A 5CLSA 2EFWA 3CC7I 4UHTA 1WJAA 1ZARA 2QUFA 2LF8A 2W84A 5B1AH 1MDMB 1W7PB 2DYRH 3EUKL 1K83J 4EV0A 4BHPA 4HX4A 4G8XA 4C3JJ 4M6YA 3HOVJ 3BR6A 1Z6RA 2ISZA 2RV8A 3WTWC 4HQMA 1DP3A 3GTGJ 2LY1A 4XLEA 5AONA 4RM3A 4PFOA 3FDYA 4ASNA 1F9NA 3JREA 2FJ1A 2DMQA 3DPUA 2BEOA 2M1BA 3DEWA 4FASD 3J7ZI 3G71I 2DTZA 4MQVA 1W1WE 5HNFA 2B7EA 3ZQQA 1K6OA 1WH7A 2DFHA 3FXLA 4PJJA 2DYSH 4FETA 4XL9A 2FA5A 2DBBA 3SYTA 3S1QJ 2Q2EA 2VASA 4JOMA 3OYEA 1EV7A 4LITA 4PZJA 1KYZA 1N77A 2VT2A 4GRIA 2PMZN 1WWXA 3RI4A 3I64A 1G4DA 2DPDA 4I98B 1ETWA 2XRNA 2EV0A 1A5JA 2WTEA 2LRDA 3X2QH 2ELHA 3S8PA 4PCQA 1WZ2A 1BW6A 3I54A 3U1DA 3FF5A 2WAEA 3LSRA 3HZJA 3QOEA 4EM2A 2VJIA 3BZ6A 3DTKA 1VQLI 1KU3A 2GOMA 2HWVA 4EJUA 4PUSA 3VPRA 2HKXA 3LFKA 3GTQJ 1W0UA 2WAQA 3TBIA 5F0CA 4DZJA 4YRVA 2FQ3A 4IOCF 3CUQA 2F5VA 3PSIA 3A1YA 1Z6TA 3KZZA 5GTHC 2M8EA 5E18F 2Y69H 5C4XJ 4M6XA 2QQ9A 3FXRA 1QZZA 1R5GA 4A12A 1HBXG 2BY3A 3KYLA 1TC3C 2WV1A 4PJMA 1TNSA 3F8NA 4C2TA 1P6RA 4O3MA 4AIDA 4PSXA 1FX7A 1DPRA 2FSWA 4EMSA 4A3IJ 4A93J 4XNFA 3LSMA 5DUKA 1XSDA 3W2VA 2DI3A 2XUBA 1TTYA 4BE0A 3S3MA 3TEDA 1OPCA 1VQ5I 4V2GA 1AOYA 2OCEA 3IKVA 4G7ZF 3DTIA 3T8TA 1ZN2A 2HXOA 3PJRA 4YFKF 1QZYA 1Y56A 3BCAA 4RB0A 2LKXA 4M72A 2JQ7A 1HCRA 1U8BA 1G2HA 1BI1A 1UZCA 2AS5F 1B6AA 3G1OA 3HJEA 4DZPA 2AQEA 2DTRA 1LEAA 3KP6A 2R7SA 2LBFB 1R9TJ 4P96A 2DA6A 2UZKA 5AIPA 5J1UA 2DODA 1MIJA 2P5LC 1UCRA 3HKZN 4XM3A 1A6QA 2E5NA 3HOSA 4BE1A 3DU5A 4G94A 3RIRA 2MD0A 4HAMA 3QPLA 1W36D 1GT0C 2XASA 2WB1N 1ETYA 4UUTA 2IW5A 4M9XA 1DUXC 4LLNA 5HLTA 3A01A 1JJ6C 2XKOA 2ZJPF 2M30A 4XLCA 1TT5B 2HVQA 4D0PA 5GADJ 3Q0WA 3GFIA 2IEKA 2VONA 3LFUA 1OCZH 9ANTA 5KK1A 3H0DA 3JAMZ 2PFBA 3AL0B 3FIWA 2HTSA 3E6BA 1HSTA 3PFYA 4YELA 2CG4A 2NNYA 4XORA 2DPUA 5F1JA 1ETOA 5TGTA 5EDNA 3EUHA 3JRBA 1ZAOA 1TW2A 1G3WA 4A3LJ 3TOBA 3NWTA 5JFRA 3HTSB 2ECBA 1MBGA 3MZ8A 3AG1H 4FX4A 1HKQA 2ID3A 3LSTA 3CUOA 3E5UA 4OIPF 1X1DA 3E0JB 3HSRA 5LD2C 1S7OA 1DP7P 3IRQA 2P7CB 4BJ6C 4V19K 1YTYA 1IXCA 4KICA 4A6EA 3GTOJ 5D8LB 1JUMA 4R79A 3AKZA 2FMYA 2X6XA 2JUCA 3BG7A 5FKKA 2HDDA 5H6RA 5DV5A 5GAGJ 1OQYA 1JKOC 4BYYA 1MBFA 2CFXA 3FBIB 1QGPA 5LHHA 3BG5A 3U1KA 4Z6YA 2KDOA 5E8IA 4Q4ZF 1YW9A 4KN4X 4XRMA 1JHHA 2EZIA 1XD7A 1WKMA 2OPTA 1X4PA 3LSGA 3OYNA 4MQ9F 2ME6A 2JK3A 2LSOA 5HS9A 1T8IA 1YE9A 1K7AA 4A69C 4Q5SF 1SAXA 3Q9SA 3WU1B 4AUXA 4A2UA 2L54A 5TRDA 1LEBA 2V26A 2IGNA 1RUOA 2LBFA 4RB3C 2XGEA 4X0GA 3PQJA 2QSFX 1D1BA 4XIDA 4E7JA 4AIKA 2DT5A 3CC2I 4PSWA 1IUFA 1P2FA 5DM7F 3IV5A 1EKEA 2JSCA 3F8FA 4XN3A 4FE7A 4M74A 2P4WA 1BOAA 2H1LA 2KKOA 4AVPA 3HDDA 1GLNA 5FKOA 2CH0A 3I59A 3K69A 1BM9A 4CSWA 4NNJA 1YIJI 3TO7A 2PQ8A 2V6CA 1OR7C 3CCYA 4K2EA 1WI9A 4J01A 4CICA
chains in the Genus database with same CATH topology
3RCOA 4BGDA 3K4KA 1VZ0A 2XDVA 4DOZA 3VWBA 2M4GA 3AFHA 3L2RA 2CV2A 1KONA 2GOXB 2R7VA 3I3LA 3DQVC 2CMPA 1WJEA 4BU2A 4BUPA 2WA0A 2DT7B 4KT6A 1N78A 2LOOA 4Y3OA 4AVZA 4E7KA 4MLOA 4JQFA 2NOJB 1UAAA 3OR2C 2RQQA 2DT6A 2VQHA 4NUBA 1FMWA 2KRCA 2KZVA 4BS9A 1Z21A 4PFPA 3OYFA 1BR2A 3E1SA 3UR3C 4CCMA 2IGKA 2VJJA 3LL7A 2CFOA 1TT0A 3M8JA 2IS4A 4CCNA 3RPUD 4F3QA 4NQWB 1U0JA 2X1CA 2R7TA 2CUZA 1E0EA 3HUGB 2L9SA 3EPZA 1S9HA 1DGRM 2V1NA 2W00A 3CP8A 5CQGA 4ZC3A 2KQRA 3TMOA 3K70C 3VSKA 2KP6A 2O5RA 3ONQA 2VKHA 1LVKA 1SFKA 3H9QA 2BOLA 4Y33A 4XLFA 4H4KC 2L5QA 2X6YA 2OC6A 4HRIA 1R6RA 3SZGA 2LG4A 3PL8A 2VL8A 3HPHA 3ZRGA 1OLTA 1WFXA 2V7FA 1T0FC 1LKXA 1WJCA 1YX5A 3K10A 2A5WA 1PYVA 3W2AA 3OY9A 2E5ZA 4XLHA 3LSIA 2VJ4A 3K6GA 3HKZA 2KPMA 5JHFA 3OOUA 2X6WA 2X85A 2LYCA 2QKLB 3C2GA 3IUOA 3W3CA 2W4SA 3LSKA 3QYBA 4E7ZA 3EUAA 3VDXA 4ZTFA 1BR1A 3IP4B 1X1BA 2OV7A 4F93B 3AL0C 3F9KA 2W1OA 4ZDOA 3H9GA 2IGMA 4BL0B 2JVHA 4OAZA 3OL3A 3K4MA 1QHGA 2F6CA 4BJ5C 4DBQA 5FRMA 2VKDA 3SEZA 2MABA 4F55A 4CCOA 4F92B 1Z3YA 3HPGA 4KITB 1WJBA 2X1DA 2IXSA 4HSRA 1YX3A 3S3NA 3A2KA 1D1CA 3DPLC 2R7UA 2KLOA 2KRHA 1Z7LA 3L2UA 2JUGA 3PUBA 4XOTA 2VLAA 4NC8A 4CUGA 2PJRB 1UG0A 4XQFA 3HL2A 3OYDA 4IQ4A 3PSFA 2Q1ZB 5HOOA 2K9MA 2Q2EB 5FROA 4DGWB 2XF5A 3OYAA 4OWRB 3FHNA 4P5OA 2LREA 4HNTA 2HNHA 3BLYA 4CH7A 4ITVA 3D5SC 5KCMA 3DPTA 4QPOA 4XN0A 4AU7A 2WY8Q 4HPQA 2LY2A 3S32A 2M4KA 3L2QA 3OYCA 2L7KA 5CQEA 4B3XA 2IS1A 2HZDA 3H9JA 4B43A 3FKJA 4HG2A 2VQCA 4NC7A 1D1AA 1N75A 1HA8A 2UWMA 2Z16A 3MMYB 3IAM2 3QYFA 3H5NA 4N4NB 4IQJA 1BR4A 1Z3XA 3PNVA 3KEYA 1PJRA 2LC2A 3CJQB 1QHHD 4BJTA 4BDYA 3OIPA 2ZXHA 4II2A 1X19A 1X1CA 2IS2A 3LSHA 1SAUA 4HNUA 3BG6A 4B47A 2E1MC 3H35A 3SDBA 2VQGA 3N05A 2WB1A 4C2UA 2W7NA 4ZYAA 1J09A 1TZLA 4EATA 2JVGA 4BDZA 5LFAA 4DJAA 1AA7A 2R7RA 2CUJA 4E7IA 3A4CA 2VPLA 1V5FA 4RMNA 1MMAA 2JA2A 3TL4X 4CCLA 2AQFA 2F4IA 4BQQA 3OWTA 4BQNA 1X4OA 1WJ5A 1WJAA 2CS3A 3DWLE 2WY7Q 1G59A 4N4OB 3EUKL 3OS2A 4KISA 1BOBA 3K4JA 4B48A 1DP3A 1JI8A 1P9QC 2LY1A 4ANJA 4XLEA 2K9LA 2DOAA 4PFOA 2WAFA 4RM3A 3FDYA 4BE2A 2JSPA 2PJRA 5CKTA 2VIXA 3D5RC 2M0MA 2ELJA 2KMUA 2IGOA 5HNHA 3S93A 3DPUA 3KX2A 4LIUA 4FASD 2L2OA 5HNFA 3ZQQA 1ZELA 3BCBA 4PJJA 4FETA 3HG9A 4HEA2 4XL9A 4ZDPA 2CV1A 1G8XA 3SYTA 3DKYA 4AYBA 2VASA 4JOMA 3VYSB 3OYEA 4LITA 1N77A 2WADA 4GRIA 4E7HA 3OYIA 3MKYB 2R7OA 3HOTA 2M3AA 4C30A 3OYMA 2X51A 2LRDA 3S8PA 3DKXA 4KJZA 4XMYA 2PMZA 2WAEA 2CW8A 3G2BA 3QOEA 1LFPA 1T95A 2VJIA 3DTKA 3DLAA 4D1QA 2R7WA 4E7LA 1LDKB 2GOMA 2IS6A 4PUSA 2KHMA 4ZDLA 1MNEA 3OYLA 2M7AA 1MMDA 2R7QA 2FUG2 3CESA 2WAQA 2K3PA 3K4NA 3K4LA 3OIQA 4U87A 3TBIA 2HPMA 4LIVA 4YRVA 2BW3B 3BC8A 4D9JA 2QKMB 3PNYA 2F5VA 3VYUB 3OR1C 3PSIA 3A1YA 4ZJZA 3DEEA 3UNGC 2Z2SB 3L2WA 3OYGA 1NG6A 4OAYA 4IZZA 2I8DA 3GBGA 3KYLA 4PJMA 4F52A 4C2TA 2KL4A 4PSXA 4CA0A 4E4HA 3CMMA 3S3OA 4XNFA 3LSMA 4PJNA 3W2VA 2R7XA 4BE0A 3S3MA 3FBNB 4RLQA 4U7BA 1WJDA 3DTIA 2ZSHB 2W82A 2Y0SA 3PJRA 1DGWY 1Y56A 1X1AA 3BCAA 3DTEA 2HVRA 3QYEA 1D0XA 4IKFA 4CCKA 5CPRB 2AQEA 2RREA 4BXFA 2LH9A 2R7SA 4XOPA 2LBFB 4XKVA 4DBRA 3ZCOA 2HVSA 3K4BA 4XKWA 2P0WA 3D5LA 2K5CA 3NWSA 2XC7A 3HOSA 4XM3A 4C9YA 2E5NA 3H5AA 4P1WA 4BE1A 3DU5A 4QPQA 2MD0A 1W36D 1MW7A 2HPIA 4PJLA 3DU6A 3PNTA 2XF6A 3CZ6A 5HLTA 2VQLA 3V42A 4XLCA 4BQOA 2DCEA 2HVQA 2MFZA 2R4GA 4CZCA 3MKZA 3OYHA 3K70D 3OYKA 3LFUA 1D0ZA 4XONA 2DXIA 3RTRA 2E1MB 3H0DA 2VXDA 3AL0B 1V5GA 2V4JC 1V5EA 3PFYA 4YELA 3VYTB 4G6TB 3OS0A 4XORA 2DJIA 2X1EA 2BW3A 2RNGA 3K4CA 2VXZA 5TGTA 4II3A 2BVLA 2L9NA 2OUMA 3IAS2 3NWTA 1K6YA 2HU9A 2XSJC 3W2WA 1QU3A 2HDWA 1WJFA 2VJ5A 1X1DA 3E0JB 4LG3A 5LD2C 4ZTJA 2BVMA 5FRNA 3C2HA 3LMMA 3SEQA 3VSLA 3OYJA 4B44A 4BJ6C 2WBMA 4E7SA 4F91B 3M1CA 4R79A 3AKZA 1FMVA 2CW7A 1MNDA 2X6XA 5KNLA 1MMGA 3BG7A 1W36C 3RQ4A 1IRXA 2CV0A 4XR6A 2UUZA 2MYSA 3CP2A 2ZFUA 3RSNA 3ZR8X 4PK4A 4IX7A 3CJRB 3HXLA 3I9V2 3FBIB 2MC4A 1D0YA 4E6KG 2M7BA 2XF7A 3H5RA 2KDOA 2Z1DA 3J7AY 1X4PA 3LSGA 3OYNA 4BEHB 4CCJA 4DIQA 3ZXSA 3OYBA 3MKWB 5HVQC 2V6EA 1ERDA 5KHDA 3MD2A 1YE9A 1UELB 3EUHC 3OL4A 4HSTA 4XLAA 1Y6IA 4RLFA 2V9KA 4XKBA 1MMNA 2UV1A 2VB6A 2V26A 3QODA 2IGNA 4RM2A 2LBFA 2E60A 3HC7A 4X0GA 4E7JA 1D1BA 4BACA 2XAUA 4PSWA 1DQUA 3VYRB 4YEJA 3ZGKA 4XN3A 1EA3A 3L2VA 2ZSIB 3OS1A 3U21A 4Y4RA 1GLNA 4CSWA 2CH0A 2ZXIA 3OMYA 4NNJA 2HQAA 3CF2A 4BEHA 4XKCA 1NG7A 4J00A 1OR7C 4J01A 2A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OC6 A;  2KL4 A;  2I8D A; 
#chains in the Genus database with same CATH topology
 3RCO A;  1TNT A;  4BGD A;  1FWZ A;  1IJW C;  3LA3 A;  3DLL F;  2L3D A;  3O2P E;  2XDV A;  4MIM A;  3VWB A;  3L2R A;  5C3E J;  2CV2 A;  5ERI A;  1IDY A;  4R8H A;  3LA7 A;  3QOP A;  2E35 A;  4IL6 C;  2F48 A;  2ID6 A;  4C3H J;  1WJE A;  2R5Y A;  2WA0 A;  5FB2 A;  1N78 A;  5L3G A;  4YG2 F;  2HYG D;  1I1S A;  3I4P A;  1EH6 A;  2DJN A;  1QNT A;  3ZQI A;  2O03 A;  1FMW A;  5HDK A;  1R58 A;  2KZV A;  1DPU A;  4EJW A;  4Y15 A;  2PEX A;  2EZK A;  3BJ6 A;  3WTS C;  3E1S A;  2EV6 A;  2RDP A;  2FBH A;  3KZY A;  1WI3 A;  1KQ0 A;  4CCN A;  3RPU D;  3TDU C;  1IN5 A;  3CDI A;  5LRS A;  1U0J A;  5TJJ A;  3BTI A;  2C6Y A;  3CME I;  1E0E A;  2GAU A;  2R5Y B;  4EJT A;  1S9H A;  2ACJ A;  2HS5 A;  2V1N A;  1T33 A;  3FXU A;  1ZG1 A;  3OOP A;  5H2F C;  2O5R A;  1VF9 A;  2TRT A;  3ZQC A;  2OTJ I;  1LVK A;  4MNU A;  5JLX A;  5M5X J;  3Q0U A;  3FXJ A;  5BPI A;  1FP2 A;  4DYR A;  2DA7 A;  2YU9 J;  2VL8 A;  3HPH A;  1LDJ A;  2OCC H;  4KMU X;  5KVR A;  4KMF A;  1OCO H;  1WFX A;  2PG4 A;  4MFE A;  2J5O A;  3F21 A;  4IHY A;  1X2M A;  2V7F A;  1T0F C;  2CW0 F;  3B6A A;  5KAI C;  2ZJ2 A;  1JHF A;  1EJ9 A;  5LLQ A;  2EFO A;  2E5Z A;  2V9V A;  3HKZ A;  1Z7U A;  2DK8 A;  1RZ4 A;  3OOU A;  3WHC A;  5F0F A;  5JR3 A;  2X85 A;  3CD6 I;  2LYC A;  5M3M J;  1MD0 A;  4ZYE A;  2ME0 A;  3LSK A;  1GV5 A;  1BR1 A;  3ULQ B;  3CCV I;  3IP4 B;  3AL0 C;  3JTH A;  1I50 J;  4CYC B;  4ZDO A;  1OMI A;  3IWF A;  4WK8 F;  1VI0 A;  2STW A;  4BL0 B;  2JA8 J;  1IAW A;  3OL3 A;  1ZK8 A;  2HYF A;  3ZN1 A;  1YIT I;  2IA0 A;  1O7L A;  1PUE E;  5FRM A;  4Y17 A;  3FM3 A;  1QVU A;  2VT3 A;  2IXS A;  4RA2 A;  3RKW A;  3FXQ A;  2ESN A;  4HZF A;  1FZP B;  3BZK A;  3KE2 A;  5K5R A;  2DFI A;  2Y9Z A;  2KRH A;  1JKR C;  3QPT A;  3L2U A;  4KFC A;  2GBY A;  2E2I J;  3K1N A;  3PSF A;  2M0C A;  2RN7 A;  2Q1Z B;  1XCB A;  2K9M A;  5FRO A;  3PIP F;  3ZQH A;  4EM0 B;  1ULY A;  1ZKG A;  3R4K A;  3FHN A;  2LRE A;  4U0V A;  1HSJ A;  1POG A;  4G6D A;  4ITV A;  4A6D A;  3GX4 X;  3DPT A;  3CCU I;  3HEF A;  4QPO A;  1VQK I;  3ASN H;  3GFJ A;  3JSO A;  3A0H C;  3EDP A;  3RKX A;  4G7H F;  5D5X B;  4HX8 A;  1C0W A;  3CCQ I;  5CQE A;  3SFZ A;  2IA1 A;  3ZQG A;  3KLN A;  1HLV A;  4HG2 A;  1X58 A;  1G3S A;  2VQC A;  4NC7 A;  4L0Z B;  4I7H A;  1A31 A;  1IRZ A;  2CUF A;  3ABT A;  2L0K A;  2F5C A;  3RYP A;  3QYF A;  3C3W A;  4DNC A;  4N4N B;  1I27 A;  4OMZ A;  5HS8 A;  4IQJ A;  4KIF A;  5HDG A;  3DP7 A;  3CJQ B;  1QHH D;  4BDY A;  2D2W A;  4O5V A;  2IS2 A;  5D4S A;  1SAU A;  2MBF A;  1UST A;  1ZYR F;  2DMT A;  2PN6 A;  3BP8 A;  3WTZ A;  1LFU P;  3N05 A;  1S5L C;  2P7V B;  1IUY A;  1BW5 A;  5E1X A;  3E6C C;  2YR2 A;  2W7N A;  4AWX B;  3S2H J;  1XTA A;  1SFO J;  1Z05 A;  2Z5U A;  3JRH A;  5DCM B;  3ABL H;  1B9N A;  2A05 A;  2DO7 A;  2EFQ A;  3G1L A;  5EEA A;  2L4A A;  2VPL A;  3ZPL A;  3FZV A;  4BH9 A;  2ZB9 A;  5FO5 A;  2R3S A;  4BXU A;  1ZG5 A;  1GVD A;  2FML A;  2DW4 A;  4S05 A;  3KZI C;  2D1V A;  3IKT A;  2DN0 A;  5F1R A;  2F4I A;  3BZC A;  3K7A J;  4BQN A;  1X4O A;  1H0M A;  1ITY A;  4CYD A;  2QBY B;  2DMU A;  3DEU A;  3ABM H;  2CS3 A;  5B1B H;  2WY7 Q;  2K86 A;  4IRH A;  1P9Q C;  4NHJ A;  1HDD C;  1PUF B;  2K9L A;  3BT9 A;  4BE2 A;  2JSP A;  4NBQ A;  4IHW A;  2BV6 A;  2M0M A;  2ELJ A;  2KMU A;  1FYK A;  5HNH A;  1R71 A;  4IOA F;  4EGZ A;  2K85 A;  4B8X A;  1T98 A;  2LP0 A;  5EZH A;  2JN6 A;  2PJP A;  2B63 J;  2L2O A;  1XS9 A;  2YS9 A;  4HNV A;  1B72 A;  5L3D A;  3HOU J;  1GXQ A;  1YJ9 I;  3HG9 A;  2JRM A;  4RAF A;  1G8X A;  3GME A;  3IH4 A;  1YQA A;  2CQK A;  2A6E F;  3JR9 A;  2FXA A;  1XSV A;  2NNN A;  4E7H A;  2KJB A;  3MKY B;  3E3V A;  1XPX A;  1KYW A;  4DW6 A;  3CUQ C;  2OQR A;  4A5M A;  3DKX A;  2HTJ A;  4XMY A;  3G2B A;  2KJC A;  2EBI A;  1VQM I;  2ADU A;  1LFP A;  1T95 A;  3DLA A;  4AYB N;  2YSR A;  2R7W A;  4L5I A;  1O7F A;  3CO6 C;  1LDK B;  4LMY A;  3GLL A;  2HQ5 A;  1V54 H;  4I2O A;  1MNE A;  4E70 A;  1MMD A;  2FUG 2;  2K3P A;  4XLN F;  4U87 A;  4LIV A;  3BC8 A;  3WU2 C;  1TP4 A;  1AHD P;  3PO2 J;  2QKM B;  3PNY A;  3OR1 C;  4I6Z A;  5IT9 Z;  4DYQ A;  3DEE A;  1JKP C;  4OIO F;  3S16 J;  1KGS A;  4FX0 A;  4BHB A;  4HV5 A;  2Y75 A;  1K79 A;  1NG6 A;  3Q5F A;  1JJ8 C;  2LKP A;  1H8A C;  4YFX F;  2E2J J;  3BTL A;  3GBG A;  3QAH A;  4F52 A;  1SD5 A;  2VN2 A;  3QWL A;  2QWW A;  3B73 A;  3T1B A;  1W5T A;  4E4H A;  3MWM A;  3R61 A;  5D4R A;  3CMM A;  3S3O A;  1I6X A;  2RVC A;  2RQP A;  4PJN A;  2DQL A;  3WG7 H;  1RUN A;  2HDC A;  2NVQ J;  2X9D A;  1T08 B;  1OYI A;  3LNQ A;  1WJD A;  2VUM J;  5LGU A;  3DBH B;  3IC7 A;  1DGW Y;  4HYE A;  1X1A A;  3DTE A;  3KP7 A;  4G6Q A;  2HVR A;  3K2Z A;  2OTL I;  1YW7 A;  3DKW A;  4IKF A;  1QPI A;  2Z99 A;  4CCK A;  1QBJ A;  2RRE A;  3GZ5 A;  3L1P A;  4XOP A;  1P7J A;  4DBR A;  2BXZ A;  3TW6 A;  1YLF A;  3K4B A;  4XKW A;  1W4M A;  3D5L A;  3V8K A;  4KT5 C;  3NWS A;  3B02 A;  1Y39 A;  1I1G A;  1FTT A;  5CVR A;  1UHS A;  2IAI A;  3PIO F;  2ZJQ F;  4A0Z A;  1JGS A;  1O57 A;  2XGD A;  4CGZ A;  1MW7 A;  2ZC2 A;  3HYI A;  2DOE A;  1O3T A;  2EB7 A;  3WU0 A;  2JJ7 A;  3PNT A;  1HKS A;  2CQ7 A;  4XRF A;  1WCM J;  2QEN A;  4Z2Y A;  2ELK A;  2VQL A;  3V42 A;  1IRF A;  1OKR A;  3ASO H;  2GLO A;  1XGM A;  3JRG A;  2DCE A;  1P4X A;  2OZU A;  2PX9 A;  4TV7 A;  2MFZ A;  2JTV A;  2QSG X;  5L3F A;  3HSE A;  2VBY A;  5EJC A;  2K02 A;  3K70 D;  3OYK A;  3SZT A;  2FNP A;  4LGW A;  5ILV A;  3QQA A;  3WOD F;  2K27 A;  3HGG A;  1I5Z A;  1SAN A;  4WX9 A;  1D0Z A;  1IDZ A;  2VBZ A;  2MC3 A;  5FKM A;  2EIL H;  3RTR A;  2VXD A;  5E3L A;  1ETX A;  3CCJ I;  4LB5 A;  3P7N A;  1V5E A;  1Z1D A;  3OS0 A;  2K9S A;  3IL2 A;  2DJI A;  3S1M J;  2FRH A;  2VXZ A;  1Z67 A;  3M9A A;  4I0A A;  3LAJ A;  3FKI J;  4UUS A;  2L9N A;  2W57 A;  2OUM A;  3IAS 2;  2D5V A;  5EGO A;  1T6S A;  1K6Y A;  2YX4 A;  2O8K A;  2HFH A;  2XSJ C;  2JWT A;  4F7Z A;  3RKQ A;  5DDG A;  4Y7N J;  4EJV A;  1WGX A;  3OV8 A;  4M6V A;  1FBU A;  1OCT C;  3BQY A;  2VJ5 A;  4ZTJ A;  5FRN A;  1D8K A;  3OYJ A;  3ZMS A;  1XC5 A;  2DLL A;  2WBM A;  4FT8 A;  4J19 A;  4F91 B;  4HV6 A;  3K1M A;  3RKY A;  2H8R A;  1FMV A;  3O6B B;  2CW7 A;  5A2Q K;  4I09 A;  3R0J A;  2R7Z J;  5KNL A;  4M3B A;  2BBY A;  1MMG A;  2VI6 A;  2BY1 A;  3HM5 A;  3HTU A;  1VQ7 I;  3RQ4 A;  1IRX A;  2CV0 A;  1S6L A;  2UUZ A;  2MYS A;  1RET A;  3ISP A;  3CP2 A;  2OA4 A;  1VQ8 I;  3H3V K;  3RSN A;  1BIA A;  2AHQ A;  3CJR B;  3HXL A;  3HHG A;  1D0Y A;  4A0Y A;  4E6K G;  2FD5 A;  2M7B A;  1IW7 F;  3N4M A;  2CYY A;  3H92 A;  4AC0 A;  3G4S I;  2HQN A;  1BA5 A;  1RI7 A;  2K9Q A;  4CCJ A;  4DIQ A;  2EIM H;  2V6E A;  4RS8 A;  5HVQ C;  1BI0 A;  3MD2 A;  2CUE A;  4MTD A;  1FNN A;  1Y6I A;  2QF7 A;  4S0H B;  2E2H J;  1NHA A;  3BR0 A;  4EVI A;  1DU6 A;  2E71 A;  3HC7 A;  3KP4 A;  1LPQ A;  4IJA A;  2ZNZ A;  3BQZ A;  5EEG A;  2XAU A;  3GTK J;  2UXN A;  3ZGK A;  5IYB J;  1XCV A;  1EA3 A;  3RQI A;  1STZ A;  3M8E A;  3UKG A;  1HF0 A;  1TQM A;  3GWZ A;  3OS1 A;  1SEU A;  3HRU A;  4H0E A;  4Y4R A;  1K78 A;  2VC1 A;  5DD4 A;  1S7A A;  1M1E B;  5GAH J;  3FIS A;  1XDS A;  2LR8 A;  1MJ9 A;  2XHK A;  1HKT A;  1I3Q J;  4QWQ A;  1SVL A;  3BOQ A;  1CQT A;  2M4G A;  3MZH A;  2MH9 A;  1KON A;  1R23 A;  2OQG A;  4LLL A;  5D5V B;  4GYG A;  3DQV C;  2BHZ A;  2CMP A;  3RZD J;  1VQN I;  3F22 A;  4BUP A;  2EQR A;  2DT7 B;  4KT6 A;  2LOO A;  4Y3O A;  2XAJ A;  1MMS A;  1W5S A;  2OJE D;  4MLO A;  4ENJ A;  1UAA A;  5J6X A;  3SFI A;  4NUB A;  1IZ1 A;  3KLO A;  4U7D A;  3J81 K;  4I76 A;  4C3I J;  4MO7 A;  2KRC A;  3EET A;  2JPB A;  2K40 A;  4A3K J;  3WG9 A;  4HOB A;  1VQP I;  4PFP A;  5FLX Z;  1ZGJ A;  4A3D J;  2VJJ A;  4WXH A;  1LDD A;  1R5I D;  5FLM J;  1U5T C;  3VOE A;  3L9F A;  3VEP A;  2HYJ A;  2W25 A;  2FBK A;  2XGC A;  2X1C A;  2R7T A;  2E1N A;  5IT3 A;  3HUG B;  4L9J A;  2HQR A;  2L9S A;  1FBS A;  4HBL A;  2F2E A;  2ZFW A;  3DCF A;  2CWE A;  3FM5 A;  4QIW N;  3ECH A;  3TMO A;  1BJZ A;  2KQR A;  3K70 C;  3VSK A;  2JA6 J;  1ZLK A;  4BBS J;  3WE3 A;  4ABZ A;  3ONQ A;  2H27 A;  2VKH A;  1SFK A;  3GCM A;  3H9Q A;  2XV4 S;  1U8R A;  1ORK A;  3S15 J;  4RGU A;  1IC8 A;  2L5Q A;  5EEH A;  2N8G A;  4A0X A;  2OC6 A;  4D7N A;  2XRL A;  4HRI A;  2XPW A;  4Y52 J;  1HOM A;  2BXY A;  2IA2 A;  2CQN A;  2IRF G;  2LG4 A;  3E6M A;  3PL8 A;  2ZJR F;  1QO0 D;  3CC4 I;  3ZRG A;  4I99 C;  4HQE A;  2AO9 A;  2G7H A;  3PUF A;  2EA4 A;  2HZT A;  1G6N A;  4LFU A;  1H89 C;  1LKX A;  3DF8 A;  2A5W A;  4U0Y A;  2EIK H;  2JA5 J;  2IVM A;  5E1W A;  1UG2 A;  1KZH A;  1UHW A;  4ZYD A;  5BOX A;  1HW1 A;  3DXJ F;  3K6G A;  1FEX A;  1UJ8 A;  5JHF A;  1ENH A;  2F4O B;  3L2C A;  2DA3 A;  5IYD J;  4E7Z A;  3VDX A;  1I39 A;  4F93 B;  4V2F A;  2W1O A;  1F36 A;  3H9G A;  1KA8 A;  2ECC A;  4RB1 A;  4GCV A;  1LE8 A;  2IPQ X;  2QGU A;  3A02 A;  1D5Y A;  4B4C A;  3M1E A;  3A01 B;  2MLK A;  4F92 B;  3GTM J;  4A3B J;  4HSR A;  3S3N A;  3OSF A;  1VQ4 I;  3TKY A;  3A2K A;  1D1C A;  2R7U A;  4BQA A;  3RJP A;  5F64 A;  2AXL A;  2DU9 A;  2P6T A;  3PUB A;  4NC8 A;  2PJR B;  3U9G A;  4RBO A;  4M9Z A;  1UG0 A;  4MEY F;  1Z0X A;  3HSF A;  4RAG A;  3WTY C;  1FIA A;  3BJA A;  3GW2 A;  5DYM A;  1FP1 D;  2Q2E B;  1FYL A;  4CXF A;  2FBI A;  4KUM A;  5M5Y J;  3OYA A;  2A69 F;  4RAY A;  4P5O A;  2HNH A;  3BLY A;  5BMZ A;  1IRG A;  4XN0 A;  3WE2 A;  4AU7 A;  3LQQ A;  3N97 A;  2WY8 Q;  3U2R A;  1TQI A;  3CLO A;  1U5T A;  2EIN H;  4HPQ A;  1OYW A;  2HR3 A;  3K2A A;  5J8F A;  5B5E C;  4KA4 A;  1DDN A;  4BY1 J;  2VBW A;  3OYC A;  2ZME A;  1JT6 A;  1BN5 A;  3JRC A;  1F5T A;  3JRA A;  1Z91 A;  3I55 I;  4ESJ A;  3WTU C;  1D1A A;  3BR1 A;  2UWM A;  2Z16 A;  3MMY B;  1FOW A;  1XG1 A;  3GUD A;  1Z3X A;  1SD4 A;  3KEY A;  3MCZ A;  4NC6 A;  1LNW A;  2VBX A;  4BJT A;  3OIP A;  3F8M A;  1X19 A;  3LSH A;  2PMH A;  1IF1 A;  3ZOB A;  1OJL A;  1JKQ C;  4HF1 A;  3HOX J;  4EGY A;  4C2U A;  2XIG A;  1YOV B;  1J2X A;  2TCT A;  2VPR A;  3E5X A;  4Q48 A;  4IEJ A;  1MSE C;  1XGO A;  1AA7 A;  2CUJ A;  4X6A J;  2LY9 A;  2DDA A;  1FIP A;  1TQP A;  4RMN A;  1I6H J;  2RNJ A;  3BPX A;  4LLG F;  1Y8Q B;  2DQR A;  4QLC U;  3TL4 X;  1LUJ B;  1MJB A;  2EH3 A;  2KZG A;  1IGN A;  3F23 A;  1JUP A;  4MGR A;  1W5C C;  5J4V A;  5LEK A;  2K9N A;  5E20 A;  3ZMU A;  2NRA C;  1VND A;  4ETS A;  2M45 A;  5GP9 A;  3DWL E;  1X2N A;  3M8F A;  3NAU A;  1QZE A;  2XB0 X;  1V3F A;  4KIS A;  2GWR A;  2QBY A;  4B48 A;  2A3S A;  2GIV A;  2FU4 A;  3BY6 A;  5J1Y A;  5JLW A;  2QQ8 A;  1JI8 A;  3A03 A;  5CVV A;  5KAF C;  3I59 B;  4L9V A;  1MSF C;  1OFC X;  1UMQ A;  2DOA A;  2WAF A;  3ABK H;  2PJR A;  4IXA A;  5CKT A;  2JZY A;  4MHG A;  2M9H A;  3S93 A;  3KX2 A;  4FCY A;  4M9S A;  3MN2 A;  2DA1 A;  5IT9 K;  4XSZ F;  4CYC A;  2BGC A;  2Y31 A;  1ZEL A;  2Q8K A;  3CCL I;  4HEA 2;  2DAO A;  2CV1 A;  1R36 A;  2E1O A;  4I0B A;  3DKY A;  1B72 B;  1ZLJ A;  4AYB A;  2LLK A;  1E17 A;  4P9F A;  2WAD A;  3JTG A;  2M5W A;  1SMT A;  5FFX A;  1YRN A;  1FY7 A;  4A5N A;  5EG0 B;  2L9V A;  2R7O A;  2X4H A;  3HOT A;  3F72 A;  4WXC A;  4HLX A;  4C30 A;  3IHU A;  1MZB A;  2X51 A;  4KDP A;  4N9H A;  4QTR A;  4YIR X;  4GGG A;  4KJZ A;  2WWY A;  1YFH A;  1S8N A;  2CW8 A;  4IVN A;  5FFZ A;  2BY0 A;  2B0L A;  1IN6 A;  4JP0 A;  1ZTR A;  4E7L A;  4IHX A;  4D1Q A;  3AAF A;  3QU3 A;  4RGX A;  5ICC A;  2IS6 A;  1O4X A;  2ZME B;  3BRO A;  3R6S A;  2KDZ A;  3OYL A;  2V1D A;  3ZMT A;  2EPF A;  2M7A A;  1B1B A;  2R7Q A;  3CES A;  1T0F A;  4HLY A;  2VKV A;  3I5U A;  4UUV A;  4ZJZ A;  2O6G E;  1MH4 A;  3AG2 H;  3L00 A;  3UNG C;  3J80 K;  2ESH A;  2Z2S B;  1BC7 C;  3RDI A;  1YS6 A;  1FBQ A;  5K5Q A;  1AU7 A;  3R0A A;  1ZRF A;  4BNC A;  1ZR4 A;  4BAY A;  2MLG A;  3LA2 A;  2R5Z A;  5BQT A;  1N25 A;  2F4M B;  3HOW J;  3HBL A;  4CA0 A;  3T0Y A;  1RIO H;  1R22 A;  1KU9 A;  3H36 A;  3TDZ C;  2LDU A;  1FSH A;  3ERM A;  5ILU A;  2R7X A;  4I01 A;  1ON2 A;  4ENM A;  3FBN B;  3OIO A;  1MBE A;  4RLQ A;  4OIN F;  2A6H F;  4M3D A;  1ETV A;  2Y0S A;  3JSP A;  1R7J A;  3ZMV A;  3CJT B;  1HQC A;  2NS8 A;  2LMD A;  3P9C A;  3A0B C;  1X3Z B;  2EFP A;  4BXF A;  5BPD A;  5CYV A;  2VKE A;  3QRF F;  5J40 A;  2HVS A;  1SFX A;  2XC7 A;  1K61 A;  4UXN A;  1QVT A;  2E34 A;  3H5A A;  3O8H A;  4P1W A;  2P8T A;  2VC0 A;  4XRS G;  2QZ8 A;  5ILS A;  2GZW A;  4N0B A;  2HPI A;  1F4K A;  5J47 A;  3C18 A;  1X1P A;  2HKO A;  3DU6 A;  3PM1 A;  3ZN0 A;  2ZXW H;  2XF6 A;  5EG0 A;  5K5O A;  3V7R A;  3J7Y J;  2FOK A;  4WXD A;  1UFM A;  4LOC A;  4ZH4 F;  1REP C;  1VQO I;  2R4G A;  2G9W A;  4CZC A;  3MKZ A;  3FK6 A;  5E3M A;  1OCC H;  5D5U B;  1ODD A;  3PQK A;  4HF0 A;  2DXI A;  3H0G J;  3H3Z A;  3BR5 A;  4NDL A;  4QSH A;  2LFB A;  3HOY J;  3EYI A;  3MQ0 A;  4G6T B;  3VYT B;  1KU7 A;  1JTY A;  3NEU A;  3CDH A;  2CRG A;  2E36 A;  3K4C A;  4II3 A;  2BVL A;  5CVJ A;  1E3P A;  2NS0 A;  3AG3 H;  1V4R A;  1Y1V J;  1MGT A;  3CF5 F;  2XAF A;  2G7U A;  1HDP A;  3BR2 A;  3W2W A;  3QPH A;  5EGO B;  3HGY A;  5IP6 A;  2ZCW A;  2RAE A;  3TO6 A;  2HDW A;  3GF2 A;  3WGG A;  4BXX J;  1CF7 B;  4YII A;  1WJF A;  2V1X A;  4LG3 A;  2EA2 A;  5GPC A;  2GXA A;  2BVM A;  3I53 A;  5BS6 A;  1EF4 A;  3SEQ A;  3VSL A;  1X3U A;  3GZN B;  5DTD A;  5E17 F;  4LB6 B;  2OF7 A;  4E7S A;  1YYV A;  3C1D A;  4BY7 J;  3M1C A;  5IY5 H;  1MND A;  2PMU A;  4A3F J;  3O3K A;  4GO1 A;  3KFW X;  3T5X A;  1W36 C;  1TWF J;  4ENN A;  2TDX A;  4XR6 A;  1NH3 A;  1UB9 A;  5C4J J;  2KIQ A;  3IWZ A;  4N9I A;  4BHC A;  1Q1V A;  3ZR8 X;  4IX7 A;  2EZH A;  3I9V 2;  1J59 A;  2MC4 A;  1J7K A;  2CJJ A;  2LD5 A;  4D7M A;  2XF7 A;  2KT0 A;  2QEX I;  2HOA A;  2Z1D A;  2O0Y A;  1B8I A;  4DQ2 A;  4PDK A;  2L7M P;  5J8C A;  3HRM A;  4XRS A;  2KFD A;  4A3J J;  3CCE I;  1YI2 I;  2DA5 A;  3OYB A;  4FTH A;  3MKW B;  1OCP A;  1BI3 A;  2E7W A;  1UEL B;  1R5H A;  3OL4 A;  4XLA A;  3I0T A;  4RLF A;  3BR3 A;  4D5F A;  2O8X A;  5GPA A;  3GXO A;  2JMW A;  1MMN A;  2UV1 A;  2V79 A;  3CCS I;  4RM2 A;  5J1R A;  5HLH A;  4PGG A;  2E60 A;  4WWC A;  4A3M J;  3WTX C;  1D8J A;  1DQU A;  4YEJ A;  3F8C A;  1SFU A;  1W7P A;  2L7F P;  4WF2 A;  1MKM A;  1RNL A;  1YHQ I;  3QU6 A;  1E2X A;  3L2V A;  2PLY A;  5FJ8 J;  4FE4 A;  3U21 A;  1FPQ A;  4ZZL A;  2W48 A;  2ZXI A;  3TOA A;  2MA3 A;  4RB2 C;  2D45 A;  1NG7 A;  2WC2 A;  4J00 A;  3CCR I;  3H1C A;  2A6T A;  4X1E A;  3HRT A;  5M5W J;  1VZ0 A;  2H94 A;  1WVR A;  2COB A;  5FD5 A;  1GDT A;  1A36 A;  1J75 A;  3AFH A;  2FEZ A;  2R7V A;  1S7E A;  4BU2 A;  1RKW A;  2DA4 A;  3OR2 C;  4M71 A;  5H6Q A;  2RQQ A;  2DT6 A;  1X3W B;  2VQH A;  2XGX A;  2R93 J;  2ZBK A;  1RR7 A;  2QQB A;  2ZME C;  4BS9 A;  6PAX A;  2KRF A;  3L7W A;  5LGT A;  1Y0U A;  4NQW A;  1BC8 C;  4CCM A;  1R00 A;  3LL7 A;  3FWE A;  2CFO A;  2YPR A;  4MTE A;  1IXR C;  1TT0 A;  2HOE A;  4GYI A;  4BBR J;  2IS4 A;  2BZT A;  4F3Q A;  3ESW B;  3KIO A;  2M87 A;  3ROU A;  3VB2 A;  1KU2 A;  2CUZ A;  2LK2 A;  1SFE A;  3GEZ A;  3KP5 A;  3QP6 A;  2OZ6 A;  2R7D A;  4L18 B;  2X48 A;  5E79 C;  5BNG A;  3ML6 A;  3CLQ A;  3MAJ A;  2W00 A;  3CP8 A;  4IF4 A;  5CQG A;  4ESB A;  3HUG A;  2XVC A;  2H09 A;  2KP6 A;  3ZQF A;  3BPV A;  3RYR A;  3V8J A;  2K3F A;  1PVE A;  2ICW G;  4Y33 A;  1RES A;  3MZY A;  4H4K C;  4XLF A;  5LGN A;  3TP3 A;  3M07 A;  4XBF A;  1XN7 A;  5J4Y A;  5E3O A;  1FT9 A;  2RGV A;  5LBQ A;  1FSE A;  2BE5 F;  5M3F J;  3V8L A;  1YX5 A;  5AIQ A;  3FMQ A;  3K10 A;  2H1K A;  2HEO A;  3OY9 A;  2CQX A;  2QA4 I;  1F1Z A;  5ICF A;  2D1H A;  5L3E A;  3ERE D;  3E97 A;  2KIS A;  3LSI A;  3J80 Z;  5D6F A;  3SZP A;  5DS9 A;  2X6W A;  3C2G A;  1E3O C;  4UV9 A;  3W3C A;  1WHU A;  1P4W A;  2W4S A;  4PGH A;  4ZTF A;  1X1B A;  3B6C A;  1XGN A;  2GIZ A;  2IGM A;  1OR7 A;  3G73 A;  3K4M A;  4BJ5 C;  2V9P A;  2DMP A;  4DBQ A;  3IRR A;  5K7F A;  3SEZ A;  1FOK A;  4F55 A;  4CCO A;  2DMN A;  3S1N J;  1WJB A;  2X1D A;  2P5K A;  1LE8 B;  1HC8 A;  1O3Q A;  1R49 A;  2L7Z A;  2P5V A;  3LWF A;  1G3T A;  4WCG A;  2OBP A;  3KEO A;  4YIF A;  1Z7L A;  3S17 J;  2VOO A;  3FMR A;  4OOI A;  1ZRC A;  2O3F A;  4XOT A;  2VLA A;  2BHY A;  4OIQ F;  1LJ9 A;  4XQF A;  3HL2 A;  4LD5 A;  3WGI A;  3OYD A;  1ONV A;  4IQ4 A;  3W6K B;  5DCF A;  2MG4 A;  5HOO A;  1K78 B;  1V55 H;  4DGW B;  4M3E A;  5ICE A;  2IBD A;  1WSU A;  2XF5 A;  3I4M J;  1NK2 P;  4RGS A;  2KIF A;  4OWR B;  1ZH5 A;  5IYC J;  1U6G A;  1ZRE A;  4CH7 A;  3JRF A;  2YU3 A;  5KCM A;  4UUS B;  2W85 A;  5F0H A;  2I10 A;  3MEX A;  3AG4 H;  3QPS A;  3I71 A;  4FQG A;  5IOY A;  1RPW A;  5FKN A;  1IN4 A;  3W6J B;  3S32 A;  1VTN C;  2GQQ A;  2NVX J;  1IN8 A;  3W6V A;  3P9I A;  4KIG A;  1SMY F;  2L7K A;  1VQ6 I;  2DDB A;  4B3X A;  4FHT A;  2HZD A;  5L3B A;  5C44 J;  3CDL A;  3H9J A;  4G7O F;  3FKJ A;  1J9I A;  1K4T A;  2VE9 A;  2M8G X;  1APL C;  2X6O A;  5JHU A;  2EV5 A;  2FQ4 A;  1D3Y A;  1LFB A;  2R92 J;  5DM6 F;  3GLX A;  1PJR A;  5HLG A;  2VOD A;  3CCM I;  2ZXH A;  2GA2 A;  1F43 A;  4II2 A;  4L9N A;  5F27 A;  4HNU A;  5GTI C;  2EFN A;  3BG6 A;  2E1M C;  5LHG A;  3SDB A;  1T39 A;  1JXS A;  2WB1 A;  5A2Q Z;  1XX5 A;  2VE8 A;  3BWG A;  3R60 A;  4P9U A;  3LAP A;  4IO9 F;  2O61 A;  2MW8 A;  5LRR A;  2QVO A;  4KN7 X;  2JVG A;  2X0L A;  1FOX A;  1A04 A;  5LFA A;  1T56 A;  4XIC A;  1LB2 A;  2CU7 A;  1V5F A;  3Q0V A;  3C2B A;  3KET A;  3WTT C;  3BG9 A;  2A61 A;  4CCL A;  4JYK A;  4LK1 F;  3OWT A;  1JGG A;  2Z3Y A;  4ZZD A;  1WQ2 A;  1JT0 A;  4HA8 A;  1G59 A;  3F8B A;  4JBA A;  4N4O B;  2G0E A;  4JX5 A;  1B59 A;  1R4N B;  4FIS A;  3OS2 A;  2VOP A;  1BOB A;  4ENK A;  1SC7 A;  3K4J A;  2KIM A;  2LTP A;  1B9M A;  4ANJ A;  2MSY A;  3V4G A;  1TWH J;  4S04 A;  2JPC A;  2DK5 A;  2VIX A;  3D5R C;  4D5C A;  1Z9C A;  2IGO A;  1R1T A;  1IG7 A;  1Y8R B;  2FNA A;  4LIU A;  2JA7 J;  1FOY A;  1S3J A;  2L01 A;  3FXO A;  3BG3 A;  3FK7 A;  2E7X A;  2JT1 A;  3BCB A;  5K7H A;  1GXP A;  1ZHF A;  4ZDP A;  4LG0 A;  2PI0 A;  2V1U A;  1DU0 A;  1USS A;  3ABU A;  4W97 A;  2L9R A;  5FLV A;  3VYS B;  2GA1 A;  3S1R J;  4L9T A;  2I5U A;  3OYI A;  3V7S A;  4EEF G;  2M3A A;  3OYM A;  2QLZ A;  5HDN A;  2PBI A;  4HX7 A;  2XKP A;  4IHT A;  2P6S A;  2ETH A;  2PMZ A;  3NQO A;  5F04 A;  2MGQ A;  2QYO A;  3ZMD A;  3CTA A;  2Y2Z A;  1BIB A;  2KHM A;  3CUQ B;  4ZDL A;  3DV8 A;  4HW0 A;  4G9Y A;  3K9T A;  2OAZ A;  3K4L A;  1SD7 A;  3K4N A;  2NS7 A;  3OIQ A;  2HPM A;  3M4O J;  2J5P A;  2Y48 A;  4A3G J;  1U5T B;  3HOZ J;  2BW3 B;  4D9J A;  4JK1 X;  3VYU B;  2H8W A;  4UV8 A;  2BYV E;  2HOS A;  3H3U A;  3L2W A;  2H6C A;  3G1M A;  1ZR2 A;  2EWN A;  3TO9 A;  3G3Z A;  3OYG A;  3D1N I;  1JTX A;  1FC3 A;  4UVB A;  1WPK A;  5DD8 A;  5IP7 J;  1XMX A;  4OAY A;  3SHF A;  4IZZ A;  2I8D A;  1H9G A;  1TL8 A;  2KL4 A;  3JW4 A;  5FKL A;  4AD9 A;  3S2D J;  3SDG A;  4BKX A;  3I58 A;  3F0C A;  2K4J A;  1ACI A;  1YG2 A;  5JVT A;  4AIJ A;  3JRD A;  1YJN I;  4B09 A;  3GTJ J;  4U7B A;  4B3A A;  2EZL A;  5E3N A;  2ZSH B;  2W82 A;  2R7F A;  3DBL B;  2O9L A;  3VFZ A;  4R1H A;  1S72 I;  1WRJ A;  1XB4 A;  3QYE A;  1D0X A;  1BI2 A;  2EJR A;  2COM A;  2BY2 A;  4A3E J;  2XAH A;  5CPR B;  3HRS A;  4P55 A;  2LH9 A;  3MVP A;  5TIS C;  1IXS B;  4XKV A;  3CMY A;  1K4S A;  2QCO A;  3ZCO A;  3BTC A;  4XSX F;  2P0W A;  2K5C A;  1RRJ A;  3Q3S A;  5CVU A;  4C9Y A;  1W0T A;  1S29 A;  3V7C A;  3RZO J;  1L3L A;  4QPQ A;  3L09 A;  2Y0S N;  4LK0 F;  5JI6 A;  1SD6 A;  3J81 Z;  4AM3 A;  1G3Y A;  3DBR B;  4PJL A;  4OU0 A;  2W24 A;  3MKL A;  3KPH A;  5ICG A;  1TW3 A;  1Y0N A;  2ZO4 A;  3CZ6 A;  3EQL F;  4IPA A;  4I02 A;  2UXX A;  2A07 F;  5B3S H;  1FLI A;  4BQO A;  1TWG J;  1B4A A;  1P4A A;  4M3G A;  3WHB A;  4GFB A;  5L3C A;  2RKH A;  3HB9 A;  4LG0 B;  3OYH A;  4L5J A;  3GFL A;  4KYW A;  1Y1W J;  5F08 A;  1ZRD A;  5D5W B;  1QPM A;  4XON A;  4LJZ F;  2OD5 A;  3GTP J;  2E1M B;  1P7I A;  1V5G A;  2V4J C;  1XSX A;  2LKS A;  3TQN A;  3GZ6 A;  1PP8 F;  1LVA A;  2WV0 A;  2X1E A;  2BW3 A;  2RNG A;  4B1R A;  3KCC A;  5D8K B;  1T38 A;  2LNB A;  5K1Y A;  4CZZ A;  1H88 C;  4HDU A;  3GO5 A;  2NVT J;  1KQ8 A;  2K4B A;  2P81 A;  2H6B A;  1ZG3 A;  2HU9 A;  3KP3 A;  4UB6 C;  3SXY A;  3GYH X;  2MD5 A;  2Z33 A;  4JX6 A;  2NVU B;  4UNO A;  4RGR A;  4MEX F;  1TBX A;  1QU3 A;  2XRO A;  2XAG A;  2EK5 A;  5EF6 A;  1O3S A;  2F5F A;  2Y9Y A;  5CJ9 A;  3VOD A;  5IOZ A;  1AKH B;  1ETQ A;  1NTC A;  3FHZ A;  3C2H A;  3LMM A;  4AIH A;  1YJW I;  4B44 A;  1ZQ3 P;  2DFE A;  1UHM A;  2L02 A;  4IRI A;  5FD6 A;  1W7P D;  3CMA I;  2QQA A;  1BBY A;  2OU2 A;  1BJA A;  1R4M B;  2K7L A;  3O8G A;  4CHU A;  1E3H A;  1RC9 A;  2A68 F;  1PDN C;  2ZFU A;  3PFI A;  4IHV A;  2R0Q C;  2XB5 A;  4PK4 A;  2JRT A;  1TLH B;  2DFF A;  4GXO A;  3PO3 J;  2CO5 A;  2FF4 A;  3LQR A;  4C2M J;  3H5R A;  2QM3 A;  3TW7 A;  1O3R A;  3J7A Y;  3LSJ A;  2DOF A;  3C7J A;  5JVG F;  3FXM A;  4BEH B;  4UVA A;  3ZXS A;  3I56 I;  3S14 J;  1ERD A;  2GXG A;  3EYY A;  5KHD A;  3KYC B;  5CVI A;  1B8I B;  3EUH C;  4HST A;  2V9K A;  4XKB A;  3S2W A;  1ZGA A;  1XMK A;  2VB6 A;  3QOD A;  1VFC A;  3NAR A;  3LOC A;  3M7G A;  4BAC A;  2LF7 A;  1U78 A;  3BTJ A;  3VYR B;  3ZQ7 A;  5IP9 J;  5FGM A;  1QA6 A;  1MH3 A;  1HXD A;  5ED4 A;  2XPU A;  4GDF A;  2YX7 A;  3SJM A;  4UVC A;  2ZSI B;  1YO5 C;  1NK3 P;  2CGP A;  2E19 A;  4XK4 A;  3OMY A;  5K7Z A;  3REO A;  4RDU A;  2HQA A;  2FX0 A;  3CF2 A;  5EYR A;  4BEH A;  4XKC A;  2QSH X;  2FOW A;  1P92 A;  4Q47 A;  4RAZ A;  5IPA A;  3IH3 A;  3COA C;  5E8G A;  1XDU A;  3K4K A;  1MBK A;  3ELK A;  1TWC J;  4DOZ A;  1YRN B;  2F5E A;  3K1P A;  3F3X A;  2GOX B;  2HI3 A;  3I3L A;  4ZYG A;  2E1C A;  4YFN F;  5HS7 A;  3E7L A;  4XLP F;  1IO2 A;  3OSG A;  1OCR H;  4AVZ A;  1SVM A;  4E7K A;  4JQF A;  2NOJ B;  2F5D A;  1JE8 A;  4Y13 A;  1D5V A;  2ISY A;  1U9N A;  1Z21 A;  3OYF A;  1BR2 A;  3UR3 C;  2IGK A;  2IP2 A;  4L0Y B;  2IJL A;  5DUI A;  3M8J A;  5FLX K;  1FJL A;  3JAM K;  3Q9V A;  4NQW B;  2HOT A;  3P5J A;  3CQZ J;  4ZYH A;  3EPZ A;  1ZGW A;  1AKH A;  2R5Z B;  1DGR M;  5DCM A;  4ZC3 A;  1T2K A;  2Q0O A;  2B9S A;  2XSD C;  1R1U A;  2M2E A;  5EZG A;  2GXB A;  4OMY A;  4UB8 C;  1HW2 A;  2BOL A;  2RC4 A;  4G12 A;  3ZMZ A;  4ON0 A;  1SVO A;  1A6I A;  2IT0 A;  1CF7 A;  2X6Y A;  3HHH A;  1R6R A;  2EIJ H;  3SZG A;  1RKT A;  2NVY J;  2O7O A;  3E6D A;  2A5Y B;  1OYY A;  1LQ1 A;  3J7A O;  1OLT A;  1H9T A;  3WGH A;  1WJC A;  1PYV A;  3ZQL A;  1FYM A;  3W2A A;  2GM4 A;  3KP2 A;  4XLH A;  3CO7 C;  1PUF A;  3SQN A;  5J3L A;  2VJ4 A;  3WTV C;  2YUS A;  2KPM A;  5DEQ A;  2ZNY A;  2QKL B;  2M34 A;  3IUO A;  3FXK A;  4CDG A;  3QYB A;  3EUA A;  1CGP A;  1EH8 A;  2OV7 A;  1IN7 A;  3F9K A;  3TP0 A;  2AXT C;  1AWC A;  4HF2 A;  2STT A;  1XMA A;  2CSO A;  2JVH A;  4OAZ A;  2CQQ A;  2HGC A;  4UY8 I;  1QHG A;  1U3E M;  2F6C A;  1Q1H A;  3FX3 A;  2VKD A;  1GHC A;  2MAB A;  1MBH A;  2Y30 A;  5D6E A;  1Z3Y A;  3HPG A;  4KIT B;  1Z77 A;  1YX3 A;  5F6F A;  1U9O A;  1GUU A;  1MBJ A;  1EH7 A;  4KIB A;  4OIR F;  4EJO A;  3DPL C;  2KLO A;  4M3F A;  2LVS A;  3FMS A;  2JUG A;  4W1U A;  4CUG A;  3RPQ A;  4JX4 A;  3QP5 A;  1U2W A;  3CJN A;  3T8R A;  1MJA A;  3G6E I;  3F6V A;  4A3C J;  4HNT A;  1KQ9 A;  2MH2 A;  1IV8 A;  1YW8 A;  5H20 A;  2HXI A;  3D5S C;  4U0W A;  4DYC A;  1R1V A;  4IHS A;  1J0R A;  2L4M A;  1VQ9 I;  2NAZ A;  3JCU C;  3RPU A;  2LY2 A;  5HLI A;  2WAQ N;  3BDD A;  2M4K A;  1YIO A;  3L2Q A;  1XGS A;  4NB5 A;  5LEJ A;  2IS1 A;  1J5Y A;  3BJO A;  3ECO A;  4B43 A;  4U88 A;  3GFM A;  4L5E A;  4HDV A;  3KYD B;  5GAE J;  2Z9O A;  1N75 A;  1YS7 A;  2ZKZ A;  1HA8 A;  2FE3 A;  3P9K A;  3IAM 2;  1WH5 A;  3H5N A;  4EM1 A;  5B66 C;  1BR4 A;  2Y0M A;  3GTL J;  3E5Q A;  2NYX A;  3PNV A;  1TWA J;  1GV2 A;  2LC2 A;  2XPV A;  1A35 A;  2ZXJ A;  4O6J A;  4CO8 A;  1L0O C;  5LHI A;  3ZP5 A;  1ETK A;  1X1C A;  1I3A A;  2KIU A;  4EQQ A;  4B47 A;  1QQI A;  3H35 A;  3IH2 A;  2VQG A;  1MDM A;  4KNY A;  3KEQ A;  1FTZ A;  3M3Y J;  1HW5 A;  4MFD A;  3HIF A;  2NXN B;  4ZYA A;  1J09 A;  1ON1 A;  1TZL A;  4EAT A;  1GVJ A;  4BDZ A;  2NOG A;  4DJA A;  4IRG A;  2DA2 A;  3MFK A;  2R7R A;  3I4N J;  1OIS A;  3DFG A;  4E7I A;  3A4C A;  1MMA A;  4M73 A;  3LSP A;  3JRI A;  1MNM C;  2JA2 A;  1QRY A;  3TGN A;  3F6O A;  3D0S A;  5E1Z B;  4ESF A;  2XAQ A;  1JUS A;  2AQF A;  5HOD A;  1BL0 A;  1RR8 C;  1PP7 U;  3GVA A;  4PJ0 C;  3K0L A;  4BQQ A;  3NRV A;  1IV6 A;  1WJ5 A;  5CLS A;  2EFW A;  3CC7 I;  4UHT A;  1WJA A;  1ZAR A;  2QUF A;  2LF8 A;  2W84 A;  5B1A H;  1MDM B;  1W7P B;  2DYR H;  3EUK L;  1K83 J;  4EV0 A;  4BHP A;  4HX4 A;  4G8X A;  4C3J J;  4M6Y A;  3HOV J;  3BR6 A;  1Z6R A;  2ISZ A;  2RV8 A;  3WTW C;  4HQM A;  1DP3 A;  3GTG J;  2LY1 A;  4XLE A;  5AON A;  4RM3 A;  4PFO A;  3FDY A;  4ASN A;  1F9N A;  3JRE A;  2FJ1 A;  2DMQ A;  3DPU A;  2BEO A;  2M1B A;  3DEW A;  4FAS D;  3J7Z I;  3G71 I;  2DTZ A;  4MQV A;  1W1W E;  5HNF A;  2B7E A;  3ZQQ A;  1K6O A;  1WH7 A;  2DFH A;  3FXL A;  4PJJ A;  2DYS H;  4FET A;  4XL9 A;  2FA5 A;  2DBB A;  3SYT A;  3S1Q J;  2Q2E A;  2VAS A;  4JOM A;  3OYE A;  1EV7 A;  4LIT A;  4PZJ A;  1KYZ A;  1N77 A;  2VT2 A;  4GRI A;  2PMZ N;  1WWX A;  3RI4 A;  3I64 A;  1G4D A;  2DPD A;  4I98 B;  1ETW A;  2XRN A;  2EV0 A;  1A5J A;  2WTE A;  2LRD A;  3X2Q H;  2ELH A;  3S8P A;  4PCQ A;  1WZ2 A;  1BW6 A;  3I54 A;  3U1D A;  3FF5 A;  2WAE A;  3LSR A;  3HZJ A;  3QOE A;  4EM2 A;  2VJI A;  3BZ6 A;  3DTK A;  1VQL I;  1KU3 A;  2GOM A;  2HWV A;  4EJU A;  4PUS A;  3VPR A;  2HKX A;  3LFK A;  3GTQ J;  1W0U A;  2WAQ A;  3TBI A;  5F0C A;  4DZJ A;  4YRV A;  2FQ3 A;  4IOC F;  3CUQ A;  2F5V A;  3PSI A;  3A1Y A;  1Z6T A;  3KZZ A;  5GTH C;  2M8E A;  5E18 F;  2Y69 H;  5C4X J;  4M6X A;  2QQ9 A;  3FXR A;  1QZZ A;  1R5G A;  4A12 A;  1HBX G;  2BY3 A;  3KYL A;  1TC3 C;  2WV1 A;  4PJM A;  1TNS A;  3F8N A;  4C2T A;  1P6R A;  4O3M A;  4AID A;  4PSX A;  1FX7 A;  1DPR A;  2FSW A;  4EMS A;  4A3I J;  4A93 J;  4XNF A;  3LSM A;  5DUK A;  1XSD A;  3W2V A;  2DI3 A;  2XUB A;  1TTY A;  4BE0 A;  3S3M A;  3TED A;  1OPC A;  1VQ5 I;  4V2G A;  1AOY A;  2OCE A;  3IKV A;  4G7Z F;  3DTI A;  3T8T A;  1ZN2 A;  2HXO A;  3PJR A;  4YFK F;  1QZY A;  1Y56 A;  3BCA A;  4RB0 A;  2LKX A;  4M72 A;  2JQ7 A;  1HCR A;  1U8B A;  1G2H A;  1BI1 A;  1UZC A;  2AS5 F;  1B6A A;  3G1O A;  3HJE A;  4DZP A;  2AQE A;  2DTR A;  1LEA A;  3KP6 A;  2R7S A;  2LBF B;  1R9T J;  4P96 A;  2DA6 A;  2UZK A;  5AIP A;  5J1U A;  2DOD A;  1MIJ A;  2P5L C;  1UCR A;  3HKZ N;  4XM3 A;  1A6Q A;  2E5N A;  3HOS A;  4BE1 A;  3DU5 A;  4G94 A;  3RIR A;  2MD0 A;  4HAM A;  3QPL A;  1W36 D;  1GT0 C;  2XAS A;  2WB1 N;  1ETY A;  4UUT A;  2IW5 A;  4M9X A;  1DUX C;  4LLN A;  5HLT A;  3A01 A;  1JJ6 C;  2XKO A;  2ZJP F;  2M30 A;  4XLC A;  1TT5 B;  2HVQ A;  4D0P A;  5GAD J;  3Q0W A;  3GFI A;  2IEK A;  2VON A;  3LFU A;  1OCZ H;  9ANT A;  5KK1 A;  3H0D A;  3JAM Z;  2PFB A;  3AL0 B;  3FIW A;  2HTS A;  3E6B A;  1HST A;  3PFY A;  4YEL A;  2CG4 A;  2NNY A;  4XOR A;  2DPU A;  5F1J A;  1ETO A;  5TGT A;  5EDN A;  3EUH A;  3JRB A;  1ZAO A;  1TW2 A;  1G3W A;  4A3L J;  3TOB A;  3NWT A;  5JFR A;  3HTS B;  2ECB A;  1MBG A;  3MZ8 A;  3AG1 H;  4FX4 A;  1HKQ A;  2ID3 A;  3LST A;  3CUO A;  3E5U A;  4OIP F;  1X1D A;  3E0J B;  3HSR A;  5LD2 C;  1S7O A;  1DP7 P;  3IRQ A;  2P7C B;  4BJ6 C;  4V19 K;  1YTY A;  1IXC A;  4KIC A;  4A6E A;  3GTO J;  5D8L B;  1JUM A;  4R79 A;  3AKZ A;  2FMY A;  2X6X A;  2JUC A;  3BG7 A;  5FKK A;  2HDD A;  5H6R A;  5DV5 A;  5GAG J;  1OQY A;  1JKO C;  4BYY A;  1MBF A;  2CFX A;  3FBI B;  1QGP A;  5LHH A;  3BG5 A;  3U1K A;  4Z6Y A;  2KDO A;  5E8I A;  4Q4Z F;  1YW9 A;  4KN4 X;  4XRM A;  1JHH A;  2EZI A;  1XD7 A;  1WKM A;  2OPT A;  1X4P A;  3LSG A;  3OYN A;  4MQ9 F;  2ME6 A;  2JK3 A;  2LSO A;  5HS9 A;  1T8I A;  1YE9 A;  1K7A A;  4A69 C;  4Q5S F;  1SAX A;  3Q9S A;  3WU1 B;  4AUX A;  4A2U A;  2L54 A;  5TRD A;  1LEB A;  2V26 A;  2IGN A;  1RUO A;  2LBF A;  4RB3 C;  2XGE A;  4X0G A;  3PQJ A;  2QSF X;  1D1B A;  4XID A;  4E7J A;  4AIK A;  2DT5 A;  3CC2 I;  4PSW A;  1IUF A;  1P2F A;  5DM7 F;  3IV5 A;  1EKE A;  2JSC A;  3F8F A;  4XN3 A;  4FE7 A;  4M74 A;  2P4W A;  1BOA A;  2H1L A;  2KKO A;  4AVP A;  3HDD A;  1GLN A;  5FKO A;  2CH0 A;  3I59 A;  3K69 A;  1BM9 A;  4CSW A;  4NNJ A;  1YIJ I;  3TO7 A;  2PQ8 A;  2V6C A;  1OR7 C;  3CCY A;  4K2E A;  1WI9 A;  4J01 A;  4CIC A; 
#chains in the Genus database with same CATH homology
 3RCO A;  4BGD A;  3K4K A;  1VZ0 A;  2XDV A;  4DOZ A;  3VWB A;  2M4G A;  3AFH A;  3L2R A;  2CV2 A;  1KON A;  2GOX B;  2R7V A;  3I3L A;  3DQV C;  2CMP A;  1WJE A;  4BU2 A;  4BUP A;  2WA0 A;  2DT7 B;  4KT6 A;  1N78 A;  2LOO A;  4Y3O A;  4AVZ A;  4E7K A;  4MLO A;  4JQF A;  2NOJ B;  1UAA A;  3OR2 C;  2RQQ A;  2DT6 A;  2VQH A;  4NUB A;  1FMW A;  2KRC A;  2KZV A;  4BS9 A;  1Z21 A;  4PFP A;  3OYF A;  1BR2 A;  3E1S A;  3UR3 C;  4CCM A;  2IGK A;  2VJJ A;  3LL7 A;  2CFO A;  1TT0 A;  3M8J A;  2IS4 A;  4CCN A;  3RPU D;  4F3Q A;  4NQW B;  1U0J A;  2X1C A;  2R7T A;  2CUZ A;  1E0E A;  3HUG B;  2L9S A;  3EPZ A;  1S9H A;  1DGR M;  2V1N A;  2W00 A;  3CP8 A;  5CQG A;  4ZC3 A;  2KQR A;  3TMO A;  3K70 C;  3VSK A;  2KP6 A;  2O5R A;  3ONQ A;  2VKH A;  1LVK A;  1SFK A;  3H9Q A;  2BOL A;  4Y33 A;  4XLF A;  4H4K C;  2L5Q A;  2X6Y A;  2OC6 A;  4HRI A;  1R6R A;  3SZG A;  2LG4 A;  3PL8 A;  2VL8 A;  3HPH A;  3ZRG A;  1OLT A;  1WFX A;  2V7F A;  1T0F C;  1LKX A;  1WJC A;  1YX5 A;  3K10 A;  2A5W A;  1PYV A;  3W2A A;  3OY9 A;  2E5Z A;  4XLH A;  3LSI A;  2VJ4 A;  3K6G A;  3HKZ A;  2KPM A;  5JHF A;  3OOU A;  2X6W A;  2X85 A;  2LYC A;  2QKL B;  3C2G A;  3IUO A;  3W3C A;  2W4S A;  3LSK A;  3QYB A;  4E7Z A;  3EUA A;  3VDX A;  4ZTF A;  1BR1 A;  3IP4 B;  1X1B A;  2OV7 A;  4F93 B;  3AL0 C;  3F9K A;  2W1O A;  4ZDO A;  3H9G A;  2IGM A;  4BL0 B;  2JVH A;  4OAZ A;  3OL3 A;  3K4M A;  1QHG A;  2F6C A;  4BJ5 C;  4DBQ A;  5FRM A;  2VKD A;  3SEZ A;  2MAB A;  4F55 A;  4CCO A;  4F92 B;  1Z3Y A;  3HPG A;  4KIT B;  1WJB A;  2X1D A;  2IXS A;  4HSR A;  1YX3 A;  3S3N A;  3A2K A;  1D1C A;  3DPL C;  2R7U A;  2KLO A;  2KRH A;  1Z7L A;  3L2U A;  2JUG A;  3PUB A;  4XOT A;  2VLA A;  4NC8 A;  4CUG A;  2PJR B;  1UG0 A;  4XQF A;  3HL2 A;  3OYD A;  4IQ4 A;  3PSF A;  2Q1Z B;  5HOO A;  2K9M A;  2Q2E B;  5FRO A;  4DGW B;  2XF5 A;  3OYA A;  4OWR B;  3FHN A;  4P5O A;  2LRE A;  4HNT A;  2HNH A;  3BLY A;  4CH7 A;  4ITV A;  3D5S C;  5KCM A;  3DPT A;  4QPO A;  4XN0 A;  4AU7 A;  2WY8 Q;  4HPQ A;  2LY2 A;  3S32 A;  2M4K A;  3L2Q A;  3OYC A;  2L7K A;  5CQE A;  4B3X A;  2IS1 A;  2HZD A;  3H9J A;  4B43 A;  3FKJ A;  4HG2 A;  2VQC A;  4NC7 A;  1D1A A;  1N75 A;  1HA8 A;  2UWM A;  2Z16 A;  3MMY B;  3IAM 2;  3QYF A;  3H5N A;  4N4N B;  4IQJ A;  1BR4 A;  1Z3X A;  3PNV A;  3KEY A;  1PJR A;  2LC2 A;  3CJQ B;  1QHH D;  4BJT A;  4BDY A;  3OIP A;  2ZXH A;  4II2 A;  1X19 A;  1X1C A;  2IS2 A;  3LSH A;  1SAU A;  4HNU A;  3BG6 A;  4B47 A;  2E1M C;  3H35 A;  3SDB A;  2VQG A;  3N05 A;  2WB1 A;  4C2U A;  2W7N A;  4ZYA A;  1J09 A;  1TZL A;  4EAT A;  2JVG A;  4BDZ A;  5LFA A;  4DJA A;  1AA7 A;  2R7R A;  2CUJ A;  4E7I A;  3A4C A;  2VPL A;  1V5F A;  4RMN A;  1MMA A;  2JA2 A;  3TL4 X;  4CCL A;  2AQF A;  2F4I A;  4BQQ A;  3OWT A;  4BQN A;  1X4O A;  1WJ5 A;  1WJA A;  2CS3 A;  3DWL E;  2WY7 Q;  1G59 A;  4N4O B;  3EUK L;  3OS2 A;  4KIS A;  1BOB A;  3K4J A;  4B48 A;  1DP3 A;  1JI8 A;  1P9Q C;  2LY1 A;  4ANJ A;  4XLE A;  2K9L A;  2DOA A;  4PFO A;  2WAF A;  4RM3 A;  3FDY A;  4BE2 A;  2JSP A;  2PJR A;  5CKT A;  2VIX A;  3D5R C;  2M0M A;  2ELJ A;  2KMU A;  2IGO A;  5HNH A;  3S93 A;  3DPU A;  3KX2 A;  4LIU A;  4FAS D;  2L2O A;  5HNF A;  3ZQQ A;  1ZEL A;  3BCB A;  4PJJ A;  4FET A;  3HG9 A;  4HEA 2;  4XL9 A;  4ZDP A;  2CV1 A;  1G8X A;  3SYT A;  3DKY A;  4AYB A;  2VAS A;  4JOM A;  3VYS B;  3OYE A;  4LIT A;  1N77 A;  2WAD A;  4GRI A;  4E7H A;  3OYI A;  3MKY B;  2R7O A;  3HOT A;  2M3A A;  4C30 A;  3OYM A;  2X51 A;  2LRD A;  3S8P A;  3DKX A;  4KJZ A;  4XMY A;  2PMZ A;  2WAE A;  2CW8 A;  3G2B A;  3QOE A;  1LFP A;  1T95 A;  2VJI A;  3DTK A;  3DLA A;  4D1Q A;  2R7W A;  4E7L A;  1LDK B;  2GOM A;  2IS6 A;  4PUS A;  2KHM A;  4ZDL A;  1MNE A;  3OYL A;  2M7A A;  1MMD A;  2R7Q A;  2FUG 2;  3CES A;  2WAQ A;  2K3P A;  3K4N A;  3K4L A;  3OIQ A;  4U87 A;  3TBI A;  2HPM A;  4LIV A;  4YRV A;  2BW3 B;  3BC8 A;  4D9J A;  2QKM B;  3PNY A;  2F5V A;  3VYU B;  3OR1 C;  3PSI A;  3A1Y A;  4ZJZ A;  3DEE A;  3UNG C;  2Z2S B;  3L2W A;  3OYG A;  1NG6 A;  4OAY A;  4IZZ A;  2I8D A;  3GBG A;  3KYL A;  4PJM A;  4F52 A;  4C2T A;  2KL4 A;  4PSX A;  4CA0 A;  4E4H A;  3CMM A;  3S3O A;  4XNF A;  3LSM A;  4PJN A;  3W2V A;  2R7X A;  4BE0 A;  3S3M A;  3FBN B;  4RLQ A;  4U7B A;  1WJD A;  3DTI A;  2ZSH B;  2W82 A;  2Y0S A;  3PJR A;  1DGW Y;  1Y56 A;  1X1A A;  3BCA A;  3DTE A;  2HVR A;  3QYE A;  1D0X A;  4IKF A;  4CCK A;  5CPR B;  2AQE A;  2RRE A;  4BXF A;  2LH9 A;  2R7S A;  4XOP A;  2LBF B;  4XKV A;  4DBR A;  3ZCO A;  2HVS A;  3K4B A;  4XKW A;  2P0W A;  3D5L A;  2K5C A;  3NWS A;  2XC7 A;  3HOS A;  4XM3 A;  4C9Y A;  2E5N A;  3H5A A;  4P1W A;  4BE1 A;  3DU5 A;  4QPQ A;  2MD0 A;  1W36 D;  1MW7 A;  2HPI A;  4PJL A;  3DU6 A;  3PNT A;  2XF6 A;  3CZ6 A;  5HLT A;  2VQL A;  3V42 A;  4XLC A;  4BQO A;  2DCE A;  2HVQ A;  2MFZ A;  2R4G A;  4CZC A;  3MKZ A;  3OYH A;  3K70 D;  3OYK A;  3LFU A;  1D0Z A;  4XON A;  2DXI A;  3RTR A;  2E1M B;  3H0D A;  2VXD A;  3AL0 B;  1V5G A;  2V4J C;  1V5E A;  3PFY A;  4YEL A;  3VYT B;  4G6T B;  3OS0 A;  4XOR A;  2DJI A;  2X1E A;  2BW3 A;  2RNG A;  3K4C A;  2VXZ A;  5TGT A;  4II3 A;  2BVL A;  2L9N A;  2OUM A;  3IAS 2;  3NWT A;  1K6Y A;  2HU9 A;  2XSJ C;  3W2W A;  1QU3 A;  2HDW A;  1WJF A;  2VJ5 A;  1X1D A;  3E0J B;  4LG3 A;  5LD2 C;  4ZTJ A;  2BVM A;  5FRN A;  3C2H A;  3LMM A;  3SEQ A;  3VSL A;  3OYJ A;  4B44 A;  4BJ6 C;  2WBM A;  4E7S A;  4F91 B;  3M1C A;  4R79 A;  3AKZ A;  1FMV A;  2CW7 A;  1MND A;  2X6X A;  5KNL A;  1MMG A;  3BG7 A;  1W36 C;  3RQ4 A;  1IRX A;  2CV0 A;  4XR6 A;  2UUZ A;  2MYS A;  3CP2 A;  2ZFU A;  3RSN A;  3ZR8 X;  4PK4 A;  4IX7 A;  3CJR B;  3HXL A;  3I9V 2;  3FBI B;  2MC4 A;  1D0Y A;  4E6K G;  2M7B A;  2XF7 A;  3H5R A;  2KDO A;  2Z1D A;  3J7A Y;  1X4P A;  3LSG A;  3OYN A;  4BEH B;  4CCJ A;  4DIQ A;  3ZXS A;  3OYB A;  3MKW B;  5HVQ C;  2V6E A;  1ERD A;  5KHD A;  3MD2 A;  1YE9 A;  1UEL B;  3EUH C;  3OL4 A;  4HST A;  4XLA A;  1Y6I A;  4RLF A;  2V9K A;  4XKB A;  1MMN A;  2UV1 A;  2VB6 A;  2V26 A;  3QOD A;  2IGN A;  4RM2 A;  2LBF A;  2E60 A;  3HC7 A;  4X0G A;  4E7J A;  1D1B A;  4BAC A;  2XAU A;  4PSW A;  1DQU A;  3VYR B;  4YEJ A;  3ZGK A;  4XN3 A;  1EA3 A;  3L2V A;  2ZSI B;  3OS1 A;  3U21 A;  4Y4R A;  1GLN A;  4CSW A;  2CH0 A;  2ZXI A;  3OMY A;  4NNJ A;  2HQA A;  3CF2 A;  4BEH A;  4XKC A;  1NG7 A;  4J00 A;  1OR7 C;  4J01 A;  2A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...