2OC6A

Crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
GMDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_388456.1) from Bacillus subtilis at 1.75 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Unknown function
molecule keywords YdhG protein
total genus 35
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08818 DUF1801 Domain of unknown function (DU1801)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.810 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2oc6A01
2OC6A 2KL4A 2I8DA
chains in the Genus database with same CATH superfamily
4RLFA 1OPCA 3H9GA 5AONA 1BW6A 4R79A 2IPQX 5HODA 3JRFA 1LDKB 1YRNA 4IOAF 3F8CA 2EJRA 2YR2A 4JK1X 1X3UA 2CV1A 2ESNA 1TBXA 3I59A 4YEJA 1ZELA 3VSLA 1DGRM 3HRTA 3BR3A 3ZXSA 2R7UA 4HAMA 1V5GA 2ELKA 3ECHA 3OWTA 5EGOA 5F1JA 4GCVA 1UELB 1K6YA 4E70A 4GYIA 3K4LA 1J7KA 1Z6TA 1AOYA 5LRSA 3KETA 2R5YB 2Z1DA 1TWAJ 2HPIA 1K4SA 4M71A 3FMRA 1HKSA 2J5OA 2K3PA 2NNYA 2RGVA 3U2RA 4BQOA 1W0TA 1D8KA 1SAUA 2WA0A 5F27A 2ZCWA 1VQLI 4XRFA 1ON2A 4PDKA 3TGNA 1GV5A 3N97A 3EUKL 1S6LA 3NWSA 3IH3A 4B1RA 4XLPF 1RUNA 1X1AA 4Y17A 1UZCA 3HGGA 3FXRA 1WQ2A 3ULQB 5CKTA 3DU5A 2BHZA 2L3DA 2L2OA 1VQOI 3H9JA 3BCAA 3P5JA 3T1BA 1NH3A 1U9OA 1K78B 2QCOA 2LC2A 3KCCA 3SZGA 3HG9A 1JGGA 1Z7LA 1F5TA 1PJRA 1A5JA 5IP7J 4BL0B 3VYTB 3MAJA 3FXJA 4FCYA 1MDMA 1R1VA 4S05A 1YJNI 3ZPLA 1MBHA 1IXRC 4XNFA 3S3MA 4Z2YA 1GVJA 1VNDA 2YX7A 3I56I 3QPHA 2BY2A 2NRAC 2VBWA 3QYBA 2VJ5A 4M6XA 3F9KA 2K5CA 4QPQA 4RB1A 3RKQA 2IVMA 1FTZA 1IXCA 1XGMA 4ZYEA 2W7NA 4UV9A 2XGEA 5TISC 3LA2A 2LKSA 4YELA 4E4HA 3DU6A 2VE9A 4KIGA 2CW8A 1TNTA 4BQQA 2QSHX 4PSWA 3OYDA 1T95A 4GXOA 4O5VA 4KN7X 2UZKA 4MFDA 4BBRJ 1TW3A 3PL8A 2L4AA 3PNTA 1RZ4A 1P4XA 3S1MJ 2XSDC 2DT6A 3R4KA 1ZGAA 4II2A 1DP7P 5LD2C 3KLNA 4IQ4A 2N8GA 4A5NA 3W6VA 3IUOA 1A35A 1R58A 3HBLA 2V9KA 2MFZA 4JP0A 5HLHA 4E7HA 2Y9ZA 1M1EB 4LOCA 2O8KA 3CCQI 2EZHA 5FKOA 2IRFG 2VOOA 2PQ8A 2TCTA 3FWEA 1LQ1A 4KMFA 4EGZA 1ZLKA 1D0XA 2CUZA 2I8DA 2OCCH 5FFZA 4EJWA 3K10A 1IZ1A 3A02A 4XONA 1LVKA 4KJZA 1Z3XA 1NG6A 1USTA 3LSHA 3VYSB 2CFOA 1Y56A 2JA6J 2DK8A 2EFNA 2RKHA 4CCMA 2H8RA 2O03A 1XG1A 4BEHA 5DD8A 3ISPA 2G9WA 3D0SA 3DKWA 5J8FA 4A3EJ 3DEWA 1FBUA 2Y69H 1YI2I 3VODA 3AAFA 2O3FA 3LSMA 2Z5UA 3FMSA 5EDNA 2EFQA 2NOGA 2L9VA 3J7AO 2D2WA 4I09A 3FBNB 4D0PA 2DA2A 2MGQA 2P7CB 3H3VK 4IHTA 2ZO4A 3LQRA 1WWXA 4I98B 3D1NI 4FE7A 2WV0A 4BHBA 4CCNA 2R93J 2DJIA 3K6GA 3DEEA 3OL4A 2AS5F 4Y33A 2NVQJ 2QZ8A 4AU7A 2KDZA 1L0OC 3O8HA 5ED4A 1QRYA 3VFZA 2HOSA 2VKHA 3GW2A 1W1WE 4CYCB 3CD6I 3BLYA 3JCUC 1D5VA 1HDDC 1ZKGA 3TBIA 1O57A 1EH7A 3RKXA 3GZ6A 4RM3A 2VQLA 3OIPA 1V55H 4BKXA 3E6CC 2PLYA 4RGUA 2VC1A 3EYIA 1SD6A 4Q48A 5HDGA 3VOEA 2JWTA 4A5MA 4Y52J 2EH3A 1QU3A 1XMXA 2EK5A 2LK2A 4B3AA 3Q9VA 3VB2A 1AWCA 3G6EI 2R92J 2AO9A 2EPFA 2CSOA 3LA7A 2VONA 2ZMEB 3F22A 4FT8A 3LFUA 3JRBA 1IRGA 2ELJA 2FBHA 3BTCA 2CUFA 4F91B 1SFOJ 2FQ4A 2M3AA 4A0XA 4XICA 4HSRA 4IRIA 4IPAA 4BXFA 4G9YA 4RB0A 5GAGJ 3Q5FA 2FF4A 2I5UA 3UR3C 5LHGA 3BDDA 4UNOA 2LKXA 1TW2A 1UFMA 4UY8I 3C7JA 2BY1A 3FKIJ 3CCEI 1MNEA 4BEHB 1YW7A 5AIQA 3DV8A 2LSOA 1GUUA 4L5JA 3ZRGA 2P5VA 5JLWA 3J80K 3A2KA 3OOUA 3HGYA 3HIFA 3G1MA 2K9NA 3HB9A 4EM2A 4C2TA 1TT5B 2K3FA 4AM3A 2Q2EA 3EDPA 2CWEA 4HX4A 1OYYA 4UVCA 5CLSA 4IRGA 1MMSA 1NTCA 3F3XA 2COBA 2HWVA 3KYCB 1O7LA 3EETA 5IP6A 2KPMA 3SHFA 2QEXI 5LRRA 4ETSA 3OOPA 1X19A 2VKEA 3OYAA 4FETA 1XTAA 2BV6A 5D4SA 2TRTA 1H89C 1FP2A 4ESFA 3JTGA 3E5XA 2XAGA 3PQKA 2WV1A 1BA5A 1JGSA 5IYBJ 1FMVA 3L2CA 3OIOA 5D5WB 3RYRA 1W4MA 1P6RA 3ROUA 3FIWA 3SDBA 2JSCA 5D6FA 4IHSA 4EJVA 1HKTA 2BXYA 3PFIA 5LEKA 1ZG1A 4M9XA 4YFNF 3E1SA 2LFBA 4V2FA 4PCQA 2OCEA 4F93B 1NK2P 1JXSA 3HRSA 2UXNA 1JT0A 3Q0VA 2ADUA 4LIVA 1MBKA 2A3SA 2ZJPF 4MQ9F 3H5AA 4U88A 2O9LA 2JT1A 1I27A 2DDAA 2VJ4A 1YE9A 2Y0SN 1KQ0A 2NVTJ 2COMA 5BMZA 3SEQA 1K78A 3L1PA 3V8LA 1MJ9A 3HOTA 4UB6C 4XLEA 1WRJA 2HDWA 3K1MA 3QPTA 3U1KA 4E7ZA 5GTIC 1RC9A 2DN0A 5ICFA 4YFKF 2W57A 2OTJI 2ID3A 2H1KA 3IWZA 2OPTA 2UXXA 2XRNA 3HPHA 2CO5A 1S3JA 1B72B 1FNNA 3DKYA 3TP0A 1T6SA 2O5RA 2KP6A 1CGPA 4NC8A 3FHNA 1IXSB 1AKHB 4IHXA 2B63J 2M8GX 1XCVA 3HKZA 3NQOA 5IPAA 3WTYC 3JRAA 5J3LA 1AA7A 2BXZA 1P7IA 4RA2A 2VOPA 1WI3A 3TP3A 4FHTA 3N05A 2W25A 2M45A 1MNDA 5FB2A 1E3OC 1ZR2A 5EZHA 5BS6A 5HVQC 5KNLA 3BR2A 1U9NA 1D1BA 3EUAA 5EGOB 4ZH4F 3B02A 1YQAA 1TWCJ 4G6QA 4B3XA 2FX0A 1VQ4I 3HOUJ 3FMQA 2UV1A 3MZ8A 4XSZF 2FOWA 3L7WA 5DM7F 2R5YA 5DEQA 5GP9A 4KYWA 2LKPA 3F6VA 3HOSA 2LOOA 1FBSA 2LTPA 4BH9A 5IP9J 5LHHA 2VLAA 3BWGA 1MJBA 3MEXA 4W1UA 1FZPB 3ERMA 3QAHA 5LGTA 1R36A 3BJ6A 4XOPA 2PFBA 3CJNA 3NAUA 3HJEA 4LLNA 4XL9A 4BQNA 1VQNI 2DJNA 3GLLA 5GTHC 3U1DA 2J5PA 1W0UA 1FMWA 2HYFA 4BXXJ 1ETVA 5FLMJ 2JSPA 3HUGB 2RREA 1YW9A 3HPGA 1B8IB 3DTKA 2O6GE 2L7MP 5IT3A 2KT0A 2HQNA 1OLTA 2A61A 1HW1A 3PNYA 3K4CA 4WCGA 4EGYA 2XF6A 3MKYB 3OYLA 4FISA 3BOQA 2KIQA 4IVNA 5TRDA 1WFXA 2VJJA 4LLGF 3L2VA 2FMYA 3W6JB 3TEDA 2OAZA 1ZHFA 2E36A 3CLQA 3H0GJ 2JRTA 5JHUA 4N4OB 2DA4A 2DQRA 2PN6A 3WTZA 1WH7A 5DV5A 2KRHA 2RN7A 3WGHA 2A6HF 2MH2A 3RIRA 3SYTA 1WI9A 3FHZA 2GA2A 1T33A 2DAOA 1XPXA 4G6TB 1U8RA 3LFKA 3J7YJ 5FO5A 4A3DJ 3SJMA 2CQ7A 2Y48A 4HEA2 2F5DA 4D5FA 3J80Z 3CF5F 5JLXA 5ERIA 1WJFA 1X4PA 2CH0A 2VJIA 3GZNB 1Z9CA 2FU4A 4F3QA 1IN7A 3PM1A 4LG3A 4RAFA 2QSFX 3IRRA 1F36A 3BROA 4XN0A 2LBFB 4BAYA 5KCMA 1XD7A 5JHFA 1I1GA 2GZWA 4HX8A 2LH9A 2VT3A 3WU1B 3WU2C 2XAHA 2ZXHA 5F0CA 4HV5A 4EV0A 5HNHA 2DA5A 1XMKA 5HOOA 2DFFA 1W5SA 1BW5A 2P8TA 3VSKA 4YIIA 2E1OA 4A3JJ 3I54A 1VI0A 1YS6A 1N25A 2X9DA 5K5RA 2FEZA 3COAC 3LSPA 4UV8A 2L01A 1Z7UA 2ETHA 3B73A 4Z6YA 2XF5A 4HQEA 2BW3B 3I4MJ 1VQ6I 2MA3A 1FTTA 4KFCA 4I76A 1R1TA 2EQRA 4XRSA 3K4MA 1ETWA 1V3FA 4A6DA 3I0TA 4EJUA 2BY0A 1FX7A 2HU9A 1GXPA 4XOTA 1DGWY 3W2VA 2HKXA 2MD5A 5EEAA 4AIJA 3N4MA 2IGOA 3CCLI 1DQUA 5ILVA 3SEZA 1K61A 1F43A 1FYKA 5IT9Z 3TOBA 1D0ZA 3GTLJ 4UB8C 1PUEE 2H6BA 2ZXJA 2CUJA 3JRDA 5FRMA 1K6OA 1D0YA 4H4KC 3FXQA 4ENJA 2EFPA 3ABUA 1T56A 3LA3A 2L9RA 4I0AA 1T8IA 4BHPA 1UMQA 2DOAA 1KQ9A 1U3EM 2V79A 4CA0A 2QM3A 4LK0F 3GXOA 4ZZDA 2JA5J 2DA6A 3CC7I 1RETA 2ISZA 2NNNA 2HFHA 3I53A 2D45A 2BVMA 2XB0X 4M3EA 3GCMA 2Z33A 2FOKA 1RIOH 3S17J 2EIJH 2P4WA 3KP4A 1VQPI 1Z77A 3K4KA 2VIXA 3HHGA 3I5UA 1LFUP 2E1NA 4AD9A 4M73A 2R5ZA 4BXUA 1Z0XA 1TWGJ 2L4MA 5FKLA 2H1LA 2IA1A 2XGXA 2XGCA 3HSRA 1R1UA 4BGDA 5LEJA 5LBQA 4BDZA 3UKGA 1FP1D 3FZVA 2VUMJ 4HBLA 2HVQA 2NAZA 2VC0A 2A07F 2IXSA 4KICA 1NHAA 4CYCA 1RR7A 5EJCA 1MD0A 1G3WA 2Z2SB 4GDFA 5IYCJ 3LSRA 2EILH 2K7LA 3HSFA 2KJBA 1LNWA 3HOZJ 1WHUA 2HTSA 5J40A 4ABZA 3BR5A 1U5TB 2EA2A 2L7ZA 1FIPA 4QWQA 5E79C 5HDKA 2DQLA 1WSUA 4PFOA 3OYGA 1VQMI 1N77A 4G94A 3G73A 1ZN2A 4G7HF 4F92B 1ZLJA 3CJTB 2LYCA 2LY2A 4B8XA 2ZXWH 3DXJF 3I4NJ 1T2KA 2KDOA 3FXLA 1I50J 5ILUA 3CCJI 5K7FA 2W85A 2LLKA 2EIKH 1QPIA 3L2QA 2NOJB 3QPLA 3SFZA 4PSXA 1BN5A 1H9GA 1ERDA 4E7SA 1R6RA 1USSA 4AYBA 1QZYA 4G7ZF 3RCOA 3ZQIA 4LITA 2QKMB 1JKRC 3BG3A 4QSHA 4ZC3A 3GEZA 1QZEA 4KA4A 5DUIA 1YJWI 4A3IJ 2EFOA 5CVIA 2NS0A 5L3GA 4AC0A 3GFLA 1RPWA 2FRHA 2DA3A 4U7BA 2LNBA 2GWRA 1V54H 1QVUA 1YS7A 4KISA 2HOEA 1O7FA 4UVBA 3J7AY 1NK3P 2R5ZB 1I3AA 4II3A 3MQ0A 3CCMI 5FLXK 4XKBA 2X1CA 1J75A 2K27A 3PSFA 4DZJA 1JTYA 4XBFA 3ZMTA 1D8JA 3HOYJ 2JTVA 1E3HA 1P4AA 3LSKA 2WB1A 2VASA 1ENHA 2WWYA 1XDUA 3MWMA 3TDZC 3ZQGA 1L3LA 2VE8A 1IV8A 3NARA 4CHUA 2DTZA 4EJTA 2ACJA 1SANA 3V7RA 1SC7A 3CMEI 3BZ6A 1X1CA 1XDSA 3VDXA 1SFEA 4P5OA 5DDGA 3KZZA 4XMYA 2DPUA 1N75A 3K9TA 2ELHA 4DZPA 3S2WA 3H0DA 4PJNA 4KUMA 4J19A 1BR4A 1YX5A 1WJAA 4HLYA 5BQTA 2DMUA 5EYRA 3RZDJ 3NWTA 1BC7C 1OCRH 3V8KA 4ZYDA 2QWWA 1PP8F 2RNGA 4LB5A 5EG0A 3JR9A 3BG7A 2L9NA 4E7LA 3PUFA 3GTGJ 2F5FA 3JRIA 4ZYGA 4JYKA 3KYLA 4A3CJ 2HEOA 1Z91A 1ACIA 1TP4A 1TWFJ 4DOZA 3VYRB 4BQAA 1T0FC 3KZIC 3HC7A 1LE8B 3B6CA 2PMZA 1XS9A 5F1RA 1BJAA 2XPWA 3CLOA 3HTUA 2KKOA 4D5CA 1REPC 1QZZA 2CS3A 1KU3A 3BZKA 2P81A 2XAJA 1W36D 1JUSA 2DA1A 3A4CA 3ZQLA 3QU6A 2GIVA 1ZREA 4BJ6C 5DD4A 3GO5A 2B7EA 2XB5A 1Y6IA 2FD5A 4OAZA 4S0HB 5AIPA 1IN6A 1MGTA 1VQ7I 2LBFA 4M74A 5H2FC 2EA4A 4CUGA 4RGXA 3REOA 2OQGA 5ICCA 3WGIA 1HDPA 2ME0A 5KAIC 3RTRA 3PFYA 2OF7A 1S7AA 2D1HA 3EYYA 1V5EA 3C2BA 2KQRA 2HTJA 1O3TA 4IX7A 1YO5C 2E7XA 3HOWJ 3U9GA 1YIJI 2JN6A 2Y2ZA 4I7HA 4XRSG 1BI0A 4LLLA 2L54A 2KRFA 3MD2A 3EPZA 3IP4B 1WH5A 4DQ2A 3MKWB 5CYVA 1A6QA 3CDHA 1T98A 3GWZA 3Q9SA 1D3YA 2F48A 1SD4A 3V7SA 3KZYA 4XSXF 3TOAA 3K70D 2QBYA 3C1DA 2R7OA 3CESA 2ZKZA 4LK1F 3HZJA 4PK4A 2XKPA 3ZMZA 3F23A 3U21A 4O6JA 1EV7A 3H92A 3MZYA 1I3QJ 4Y13A 3CTAA 4AUXA 1T39A 2O0YA 2EZLA 2QBYB 4PZJA 2ZJQF 4EJOA 1TQIA 4ZTFA 4KIFA 3PUBA 3LNQA 2PMZN 3ZP5A 1OYWA 3CUQB 5LGNA 3ZMSA 4MHGA 1WJBA 3KP6A 1JUMA 2JPCA 4ZTJA 2XPVA 3S14J 2P5KA 3ZR8X 3S2DJ 1BC8C 2VBYA 1T08B 2E2JJ 3V7CA 1HSJA 2EIMH 3K2ZA 1X1DA 3ABLH 3SQNA 4EATA 5K7HA 4ENKA 2PJRB 1J5YA 4X0GA 2KL4A 2M0MA 5L3BA 3E97A 4Q4ZF 1I6HJ 2MLKA 3AG1H 2LMDA 3CCVI 1B4AA 4BE2A 4HG2A 2H09A 4CSWA 3TO6A 2DLLA 3Q3SA 2QA4I 4A3BJ 3EQLF 2MW8A 1YRNB 4DYQA 3JAMK 1BJZA 3BTJA 1HW2A 1DUXC 4L18B 4RDUA 5E1XA 2KJCA 3K7AJ 3NRVA 2HR3A 3EUHC 1LE8A 2ECBA 3E6MA 2OV7A 4PJLA 1AKHA 3GBGA 2OQRA 4MFEA 3PNVA 3BG6A 2ZNYA 4DW6A 1GV2A 4E7KA 2GXGA 2DXIA 4LGWA 4MIMA 5M5XJ 4BUPA 2JVHA 2CW0F 5FKNA 3OR1C 4JOMA 3ML6A 3W3CA 3RPUD 2X6OA 4Y3OA 3A01B 2Q2EB 1KONA 2LR8A 1KYZA 1YOVB 3FK6A 1T38A 1D1AA 3OIQA 3FF5A 3S1NJ 2G7UA 2F5VA 3M8EA 4BY1J 1R23A 2QKLB 1OR7A 2UUZA 2VPRA 3BPVA 3BCBA 1XB4A 3IH2A 2DFIA 5GAEJ 1MMNA 5CQEA 2R7RA 5J8CA 3RZOJ 2JJ7A 4HV6A 5C44J 1TWHJ 2GOXB 3ERED 1EA3A 1IF1A 2DTRA 4R1HA 3VPRA 3CMAI 1IDZA 1S29A 2K9QA 3MCZA 2RQPA 3GUDA 3C3WA 3A0BC 4A0YA 4Y7NJ 2RC4A 4Q5SF 2ZC2A 4D1QA 2IP2A 1W7PB 2PG4A 2VL8A 3WG9A 2DA7A 1LKXA 2KLOA 1WJDA 3G2BA 4AYBN 1EH6A 3S93A 2R7XA 2BY3A 3BQZA 2BYVE 5FROA 5IY5H 2ZBKA 2LG4A 5DCFA 2IA2A 3DBLB 5FLXZ 2PX9A 2PJPA 2O7OA 1U6GA 1A36A 1OCPA 5DS9A 3LAPA 3JW4A 4BJ5C 2VKDA 3DLLF 1GDTA 1FOXA 2VT2A 1DDNA 3IKVA 3PO2J 3LQQA 1LUJB 1I6XA 2DFHA 3K0LA 4CCJA 2D5VA 3AL0C 1TLHB 1ZAOA 1ZRFA 4WXCA 2VQHA 3G1LA 4M3DA 1TC3C 3W2AA 1QO0D 1GT0C 2KZGA 5K1YA 1EKEA 3GZ5A 2XAFA 3CZ6A 5DYMA 1BOBA 2M34A 3PO3J 3KPHA 4HPQA 5E3OA 4RS8A 1EH8A 3AG2H 1FSEA 4HDUA 2A6TA 2VXDA 3OYKA 2XHKA 2ZSIB 3BR0A 4CZCA 1X1PA 2RDPA 5IOZA 2P6TA 2Z99A 1B8IA 2XUBA 5E8GA 5BPIA 1ZRDA 4JQFA 1R5ID 3LSIA 3L00A 1B6AA 5DCMA 3EUHA 4AIKA 2V4JC 1KQ8A 1MH4A 4L9JA 3QP5A 1BBYA 1XGSA 2R7WA 2RNJA 5HS7A 4BE0A 2FJ1A 4RB3C 3WTSC 5J4YA 2HYGD 2CMPA 2JPBA 5E1ZB 2K86A 3ONQA 4DBQA 3GMEA 2ZXIA 2EWNA 4IJAA 4RMNA 3ASOH 3RKYA 3GLXA 1XC5A 3RJPA 4RLQA 4FASD 1YW8A 2K4JA 1Y0UA 2Z9OA 5J1RA 5LLQA 2Y30A 3V8JA 3E3VA 4LMYA 1B1BA 3OYMA 2LDUA 2YPRA 3VWBA 4CGZA 4L9VA 3W2WA 2Y0MA 3C2HA 3DQVC 1ZG3A 3T8RA 3J7ZI 2EFWA 1WZ2A 1VQ9I 4IHYA 4IZZA 1ON1A 4P96A 3QRFF 1XCBA 4KMUX 4B48A 4DJAA 1DP3A 2W24A 3S2HJ 2VQCA 2Z16A 5GPAA 2XAUA 4NDLA 3BR6A 1LEAA 3S3NA 3K1NA 3OYNA 3MKLA 2WAEA 2NS7A 3RKWA 4ZYHA 3TO9A 3WTTC 1UJ8A 2Q8KA 1H88C 3DPTA 2XSJC 3L2WA 1IO2A 4DNCA 3ZMDA 1O3SA 1RNLA 1S7EA 2WAFA 5IOYA 3ZQ7A 4I0BA 3FKJA 3X2QH 1WGXA 3P9KA 4HF2A 2E71A 1OKRA 4LG0A 3L2UA 2PMHA 2HQ5A 4MTDA 1KGSA 1S7OA 4G7OF 3QPSA 5H20A 2E2HJ 4FE4A 2FXAA 4P1WA 5HLIA 1S9HA 3DF8A 4M3FA 2GBYA 1KYWA 1Y8QB 4L0YB 3ZQCA 1IN5A 2ISYA 1MH3A 1RRJA 3OMYA 3KEQA 2W4SA 4DBRA 1P4WA 3LSJA 1I39A 1X3ZB 3OV8A 1MSFC 1ZG5A 2BZTA 3WE2A 3DEUA 1BI2A 4OIOF 5B1BH 1YJ9I 1YX3A 3OYJA 3BTIA 2QENA 3FXOA 2M9HA 1RKTA 3LSGA 1TL8A 4WK8F 4Q47A 4D7NA 1BM9A 5A2QZ 2IBDA 1MSEC 2CYYA 1RUOA 3CO6C 5TGTA 1HSTA 1YLFA 2EBIA 1D5YA 3M3YJ 3VYUB 5E18F 1MBJA 4C2UA 1HOMA 1MKMA 2IA0A 2E19A 3TMOA 2VN2A 4KNYA 4RGSA 1ZQ3P 3GTQJ 1R7JA 3FISA 5E1WA 4A12A 2WB1N 5H6QA 4AVZA 2DI3A 2OTLI 2HDCA 3KE2A 2XAQA 3HKZN 1P92A 4BHCA 1B72A 2CU7A 1SFUA 3BJAA 3QQAA 3V42A 2MABA 1XSXA 2VBXA 1K4TA 3ABKH 4EVIA 2C6YA 2K9LA 5E3LA 4M72A 1H9TA 2F5EA 2QQ9A 1R00A 3QYEA 3GYHX 3WG7H 3R60A 2EB7A 2X48A 1ZGJA 2KIUA 2HYJA 3WTVC 4MEYF 1X3WB 1IW7F 3LOCA 5D6EA 4CCKA 4D7MA 2HI3A 3G4SI 2VPLA 4EEFG 5F0HA 3WTUC 2YS9A 3T5XA 4PJJA 2Y0SA 4U0YA 3S16J 5F6FA 5BNGA 4KT5C 2XC7A 1OISA 1QQIA 2QYOA 1H0MA 4XKWA 3MFKA 1VQ8I 1S8NA 1ZARA 2GM4A 2IGKA 1PUFB 3M4OJ 4NB5A 4OWRB 5HLTA 4NNJA 2HPMA 1SEUA 3HTSB 1Y0NA 1J9IA 2QQBA 2R7TA 3FXUA 2WY8Q 3TL4X 1P9QC 4A3KJ 3SFIA 1ODDA 3S1RJ 1NG7A 5D8LB 1TZLA 2X6XA 2DT5A 2HGCA 4MEXF 2XPUA 1W36C 2STWA 4Y4RA 4RM2A 2H94A 2Y31A 3W6KB 2E34A 4LB6B 1H8AC 1OCTC 4H0EA 3CC4I 2BOLA 2XGDA 2KHMA 3LWFA 4KITB 3T8TA 2CQXA 4MNUA 2HXIA 1PDNC 5E3NA 5LGUA 4J01A 3IWFA 4A6EA 5B66C 5EEHA 3I3LA 1MMDA 3IAM2 3O8GA 1X2MA 4XIDA 2W48A 2NYXA 1K79A 2YSRA 4MO7A 2DYSH 3KYDB 1WJCA 2EV0A 1ZYRF 2A5YB 4UUSB 4EQQA 1KA8A 3ZCOA 2D1VA 4DGWB 2M1BA 2DT7B 2JZYA 2CW7A 3DTEA 4XORA 2VODA 1KU2A 5FFXA 1PUFA 4IL6C 3IL2A 4YFXF 2K85A 2FBKA 6PAXA 2CJJA 1LFPA 2VBZA 3BP8A 3HEFA 2FUG2 2W1OA 4HSTA 1W7PD 4HW0A 4LG0B 4DYRA 3IRQA 3P7NA 4LIUA 3H5RA 3JTHA 1IRFA 4R8HA 2LD5A 5EF6A 1QHGA 5IT9K 2DFEA 1FLIA 3HRMA 4BACA 1AU7A 1APLC 1OFCX 4IKFA 5F08A 4ANJA 4A0ZA 2ESHA 2NVUB 2Q1ZB 1F9NA 5HDNA 3GX4X 3BT9A 4RAZA 4GYGA 4EM1A 3BJOA 4ZJZA 5C3EJ 4IXAA 2PBIA 5L3DA 4U7DA 4IQJA 2FQ3A 2OBPA 3PIOF 2CQQA 5LFAA 1HCRA 4V2GA 2DMPA 2HQRA 1HW5A 3KIOA 1G3YA 4B4CA 3OYFA 1IDYA 2PEXA 4K2EA 4X6AJ 3ABMH 2QQAA 3GTPJ 2VXZA 4PJMA 4P9FA 4XQFA 2IS1A 3F8FA 4QIWN 1A31A 2VKVA 3DCFA 1RKWA 1R4MB 3KX2A 5K5OA 2CGPA 2CG4A 2XASA 1ETYA 2JUCA 1VTNC 3PJRA 1JTXA 3TO7A 2JA7J 4O3MA 4CZZA 1SVOA 5BPDA 3JRCA 3S32A 4I99C 5BOXA 4L5EA 2YU9J 2H8WA 1MMAA 3OL3A 4A3LJ 4NBQA 1FYMA 5EEGA 3F21A 2MYSA 3F8NA 1UCRA 1PYVA 4OU0A 4CCLA 1SD5A 5E8IA 4QPOA 2ME6A 2EV5A 5M3FJ 5FLVA 1JT6A 2NXNB 1ZGWA 2MSYA 1B9NA 2V1UA 2LVSA 1FOWA 1S72I 4WF2A 4ENMA 4L0ZB 5D5VB 4C9YA 2HZDA 5K5QA 4L9TA 2JA2A 5M3MJ 1PVEA 2K4BA 3MMYB 3BY6A 3E0JB 3CDIA 3F6OA 5L3CA 2DO7A 5FD5A 1FPQA 1VF9A 2OA4A 4KT6A 3R6SA 1FIAA 3HDDA 3H5NA 4YIFA 2FA5A 3BG5A 4G12A 5B5EC 3IC7A 4ENNA 1Z21A 2ECCA 1HXDA 3CJQB 3CMMA 3AL0B 3WHBA 4NC7A 4N9IA 4S04A 4L9NA 4U87A 3RPQA 3SDGA 3OS2A 1QPMA 2X1DA 3E5UA 4V19K 2ZNZA 2V9PA 4NHJA 2F5CA 1BL0A 1CF7A 2HQAA 5C4JJ 2Y9YA 2LF7A 4BE1A 4UXNA 1YIOA 3ZN0A 1Z3YA 4I02A 4HA8A 2MD0A 3CQZJ 2MG4A 3M1EA 2HS5A 5FJ8J 3JRHA 3CCSI 1ZH5A 1DU6A 2V6CA 1TT0A 3FDYA 3LMMA 2Y75A 3M1CA 2WY7Q 5HNFA 4PJ0C 1MBEA 4Y15A 3FXMA 1MIJA 5M5WJ 4GRIA 1IG7A 3J81K 4AIHA 1A04A 3I59B 1ULYA 1R5GA 4XKCA 1XSDA 3GFJA 4ZZLA 2G0EA 2DCEA 1DU0A 3ZN1A 2XRLA 2W82A 3UNGC 5B1AH 2P5LC 2BVLA 3Q0UA 5DM6F 4C2MJ 3JSOA 1S5LC 2M2EA 4A2UA 2KMUA 2WAQN 1W5TA 1GLNA 3PIPF 2JQ7A 4M6VA 4U0VA 3QU3A 2DMNA 1XN7A 4UUSA 1SMYF 2M7BA 4QLCU 1G59A 3JAMZ 1G4DA 2JRMA 1JE8A 2XKOA 4WX9A 2K9SA 3HUGA 4ON0A 1VQKI 2L7KA 2V26A 2O8XA 3R0JA 4OINF 3WHCA 1TQMA 4A3MJ 2X51A 2GOMA 5DTDA 3BG9A 1EJ9A 1IRXA 1MBGA 3WODF 1JUPA 2DMTA 3IAS2 2R7SA 2QSGX 1SAXA 1SD7A 3L09A 1W5CC 2AXLA 2F4IA 5J47A 1WJ5A 2K40A 3JREA 4XLCA 1O4XA 4PUSA 2HOAA 1B59A 3CP2A 2KISA 4UUVA 1SVLA 2AQFA 2OJED 2E35A 1GHCA 2L0KA 3HOXJ 2A5WA 4CH7A 1O3RA 2M4GA 3DFGA 1OCOH 3TKYA 1ZR4A 4HF1A 2QLZA 2B9SA 5JR3A 1IUYA 4ZYAA 3OSGA 1R4NB 4IHVA 1UHMA 3QYFA 2R7FA 1N78A 2BGCA 5ICEA 3E5QA 1G8XA 4M3BA 1BR1A 3ZOBA 1V4RA 4OMZA 3OY9A 2MC3A 3ESWB 3HRUA 1IC8A 1ETOA 3IHUA 3FM3A 4MLOA 4BYYA 3P9CA 1U2WA 1Y39A 1E3PA 3IV5A 2W84A 2NS8A 2GXAA 1YFHA 4ESJA 2X0LA 1J2XA 2R7DA 5B3SH 5HS8A 1FBQA 3S8PA 1Q1VA 1VFCA 3O2PE 1X1BA 3M9AA 1RESA 3NEUA 2L5QA 1JJ6C 1XMAA 2VB6A 4G8XA 4UVAA 5HS9A 4YIRX 3OR2C 3OYBA 3GFIA 2FMLA 3CUQC 4XLNF 1XX5A 3CP8A 4LFUA 4XN3A 4FX4A 2STTA 4YRVA 3GTKJ 1MMGA 3DPUA 4W97A 1YTYA 4XLAA 3ZMUA 3H1CA 3CC2I 1LEBA 2HZTA 1LJ9A 3KFWX 2OU2A 1R9TJ 3DKXA 2IEKA 1MDMB 4RBOA 4IEJA 1FY7A 5D8KB 4BDYA 2G7HA 9ANTA 2LY9A 2E5NA 1BIBA 3IH4A 3HL2A 1GXQA 1BR2A 3FX3A 2ZMEC 3QOPA 2DODA 4BNCA 2V6EA 2BE5F 2CFXA 2JK3A 3CCYA 1HA8A 2WC2A 5ILSA 3D5LA 4C30A 3CO7C 2AXTC 2CUEA 4IO9F 2R7VA 4HNTA 3BPXA 3TW6A 2M5WA 3TQNA 4PGGA 2M87A 1PP7U 3K4NA 3BC8A 2HNHA 2WADA 3FXKA 3D5SC 2OUMA 1DPRA 2CV2A 4XLHA 2OC6A 2CQKA 2ID6A 2L7FP 4CICA 3QODA 3AKZA 4G6DA 2DW4A 2K02A 4MTEA 4NUBA 1QHHD 3OS0A 2CV0A 3MVPA 3R61A 4XLFA 5FKKA 1JI8A 4CCOA 5J4VA 2DPDA 1DPUA 2R7QA 5ICGA 4OIRF 1WJEA 4GGGA 4CDGA 2AQEA 1FSHA 1WPKA 4A3FJ 2M30A 3L9FA 5F0FA 4E6KG 4CYDA 1RI7A 2ZSHB 3KLOA 1E17A 4AIDA 1XSVA 1YYVA 3KEOA 2HVRA 4HRIA 1QA6A 2DDBA 2IGMA 2RVCA 1UAAA 3GTJJ 4JBAA 3LSTA 1BIAA 2DMQA 3CJRB 3L2RA 1BOAA 3V4GA 3I64A 1ZK8A 1SFXA 5D4RA 2OZ6A 2OD5A 2V7FA 4GO1A 3R0AA 4KDPA 5CVRA 1ETKA 2ZMEA 4XK4A 1ZTRA 5F64A 2DBBA 1OQYA 3WGGA 2LREA 3I9V2 4PGHA 3TW7A 1X58A 2JMWA 4C3IJ 4BS9A 1KU7A 4IF4A 2IT0A 5FGMA 3QP6A 3I71A 5JFRA 3SXYA 1U78A 4XR6A 2W00A 2GXBA 1SVMA 2NVXJ 1MJAA 2RAEA 2ICWG 3K2AA 3T0YA 2P6SA 3KEYA 2WTEA 3BTLA 4EMSA 3BR1A 3AFHA 3G1OA 4P55A 2ZFWA 1QVTA 5D5XB 3QOEA 2IS6A 1IJWC 1X2NA 3CUOA 4N9HA 2GIZA 2RV8A 2PMUA 2AHQA 2RQQA 2YU3A 4U0WA 1U0JA 2QVOA 4TV7A 3C2GA 1Z05A 3GVAA 2A05A 1LVAA 4LD5A 2TDXA 1I5ZA 4A93J 2E5ZA 2IJLA 1ETQA 2ZB9A 4IOCF 2EV6A 2M0CA 3DTIA 3I58A 4RAYA 4WXHA 1B9MA 1UG2A 1P2FA 3B6AA 4RGRA 2E2IJ 4UUTA 3CCUI 1O3QA 1Q1HA 2MBFA 1Y1WJ 5E17F 4XM3A 2X4HA 1OMIA 4HDVA 4HLXA 1R5HA 2FNPA 2MLGA 5KVRA 5CVVA 2HVSA 2HOTA 2V9VA 4DYCA 2I10A 2HXOA 1I1SA 1ORKA 2OZUA 3J81Z 3M07A 1CF7B 4IHWA 1IUFA 4HQMA 1V5FA 1LDDA 3RQ4A 2R3SA 2X1EA 2Q0OA 3A1YA 1JHHA 3KP2A 1FT9A 4ZDLA 3MKZA 2GA1A 2B0LA 2DK5A 4CXFA 4XRMA 4JX4A 2R4GA 5JVGF 4C3JJ 2CRGA 2F4OB 3PSIA 3KP5A 4NQWB 2E1CA 1FC3A 4WXDA 1Y1VJ 2QUFA 5EZGA 1Z67A 3E6BA 3MN2A 5IYDJ 2M7AA 1POGA 5CQGA 1ONVA 1IAWA 3HYIA 5JI6A 5HLGA 1KZHA 3VEPA 3K4BA 1XGNA 4E7JA 1JHFA 2A69F 3S3OA 1UHWA 3ELKA 4JX5A 3E6DA 4M9SA 1HQCA 1OCZH 1J59A 2QQ8A 1IRZA 5JVTA 4ZDPA 5D5UB 3M8JA 1FOKA 3ECOA 2L9SA 1MBFA 4IRHA 1WVRA 2WBMA 5GAHJ 5GPCA 3FM5A 1UG0A 2LP0A 1YG2A 1HKQA 2X6WA 3DP7A 1OYIA 3ZMVA 3OYIA 5J6XA 1U8BA 4OIQF 1XGOA 3GTOJ 4M9ZA 3TDUC 1UHSA 3HHHA 1BI1A 3RQIA 3A01A 1FEXA 3H36A 3ZQFA 2VI6A 3WE3A 2BBYA 3RDIA 4ZDOA 2XVCA 3G71I 4HYEA 1HC8A 2F4MB 2F6CA 4WWCA 2P7VB 4B43A 1A6IA 5DCMB 2FBIA 1AHDP 4C3HJ 4ASNA 1K83J 4B47A 3ASNH 2IAIA 3M7GA 5C4XJ 2VQGA 5FD6A 1U5TA 1MNMC 2H27A 3WTXC 1WKMA 2E7WA 3FBIB 3Q0WA 4OAYA 1FJLA 2XIGA 3OYHA 2NVYJ 3BZCA 3LL7A 4M6YA 3QWLA 1IV6A 2DOFA 4CO8A 5FRNA 1R49A 1HBXG 2ZJRF 3GF2A 2BHYA 5DUKA 3I55I 1J09A 4X1EA 3ZQQA 3GTMJ 2XDVA 1YITI 3HSEA 4UHTA 1T0FA 3F8BA 3LAJA 2FE3A 1J0RA 3DLAA 1ETXA 3CDLA 3P9IA 3RYPA 4YG2F 5LHIA 4ITVA 4F52A 1FWZA 1LDJA 2FSWA 4FTHA 4BU2A 1FYLA 2V1NA 4KIBA 4ESBA 4F7ZA 1C0WA 3H35A 2EZKA 3FK7A 5CVUA 1R22A 3K69A 5F04A 5A2QK 1HF0A 1ITYA 4MQVA 1HLVA 3SZTA 3H9QA 1GVDA 4M3GA 1E0EA 3OYEA 2XF7A 2HDDA 1W7PA 4DIQA 4BBSJ 2PJRA 1SMTA 4RAGA 2IS4A 1JKQC 2X6YA 3F8MA 5TJJA 4NC6A 4E7IA 3F0CA 1ZRCA 1CQTA 3ZQHA 3I4PA 3DBRB 4HNUA 1JKOC 2KIMA 2H6CA 1Z1DA 4OIPF 1LPQA 3K4JA 4J00A 1VZ0A 1TQPA 4QTRA 5CPRB 3RI4A 4N0BA 2IGNA 3WTWC 4XKVA 1JKPC 3GFMA 4I2OA 2EINH 1G6NA 3IKTA 1EF4A 2GLOA 2F2EA 3MZHA 1UB9A 2GAUA 4BY7J 3DWLE 4L5IA 3HOVJ 3H3UA 2KRCA 5L3FA 1F4KA 3S15J 3HM5A 2CQNA 2WAQA 2IS2A 2DU9A 1KU9A 2A6EF 3OYCA 2R0QC 2LRDA 5KHDA 1Y8RB 5CVJA 3JSPA 3O6BB 4NQWA 2ZJ2A 1JJ8C 2KIFA 2QGUA 1IN8A 4I01A 5KK1A 2GQQA 3S1QJ 3K70C 1WCMJ 1U5TC 1MZBA 3ABTA 3PQJA 1X4OA 2BW3A 2L02A 4EM0B 1TNSA 4B09A 2FNAA 4HNVA 5GADJ 1QGPA 1R71A 4B44A 3BQYA 2E1MC 1K7AA 3K1PA 3C18A 4HX7A 3CMYA 2KFDA 3G3ZA 3DPLC 4P9UA 3D5RC 5FKMA 2JA8J 4LJZF 4PFPA 3E7LA 3RPUA 3AG3H 3ZGKA 3HXLA 5E20A 4AVPA 1LB2A 1QBJA 1STZA 4A69C 2UWMA 2YX4A 1E2XA 3CCRI 4HF0A 5EG0B 1SFKA 3JRGA 1Z6RA 5K7ZA 2Z3YA 1G3TA 4GFBA 3CF2A 3KP3A 3F72A 1P7JA 2IW5A 2ZFUA 2KZVA 3RSNA 3H3ZA 1G3SA 2XV4S 5CJ9A 4D9JA 4FQGA 1G2HA 1VQ5I 2PI0A 2JUGA 2M4KA 3AG4H 4OMYA 1BI3A 4HOBA 2E60A 2V1XA 1FOYA 2JVGA 3A03A 4JX6A 1TTYA 4KN4X 4N4NB 5M5YJ 1QNTA 3CUQA 2O61A 3SZPA 2P0WA 4RB2C 1LFBA 5J1YA 2QF7A 1MW7A 2LF8A 3O3KA 1D1CA 1IGNA 1RR8C 5J1UA 2HKOA 2BEOA 2M8EA 4HZFA 4BJTA 2R7ZJ 2MC4A 4FX0A 2E1MB 2YUSA 5KAFC 4A3GJ 2A68F 3KP7A 2DOEA 2EZIA 4AWXB 2K9MA 1OR7C 5L3EA 3WU0A 1YHQI 2MH9A 4MGRA 2V1DA 3DBHB 5E3MA 3OS1A 2XROA 3M8FA 1IN4A 4OOIA 4I6ZA 1F1ZA 1OJLA 2DYRH 3OSFA 2LY1A 5H6RA 4F55A 2X85A 3A0HC 1OCCH
chains in the Genus database with same CATH topology
4RLFA 3H9GA 4R79A 2R7WA 1LDKB 4BE0A 4MLOA 2XF5A 2CV1A 2BW3B 4YEJA 3VSLA 1ZELA 1DGRM 2CMPA 3ZXSA 2R7UA 1V5GA 3ONQA 4DBQA 2ZXIA 3K4MA 4RMNA 3OWTA 4RLQA 1UELB 1K6YA 4FASD 3K4LA 3S8PA 1X1BA 2HPIA 2Z1DA 3OYMA 2HU9A 4XOTA 1DGWY 2K3PA 2L5QA 2VB6A 3W2VA 4BQOA 3VWBA 3OYBA 3OR2C 3W2WA 1SAUA 2WA0A 3C2HA 3DQVC 2IGOA 1DQUA 3SEZA 3CP8A 3EUKL 3NWSA 4XN3A 1D0ZA 4YRVA 1MMGA 3DPUA 4XLAA 5FRMA 1X1AA 2CUJA 1D0YA 4H4KC 4IZZA 3DKXA 4B48A 4DJAA 1DP3A 5CKTA 3DU5A 2VQCA 2Z16A 2L2OA 2XAUA 3S3NA 3H9JA 3OYNA 3BCAA 2WAEA 2DOAA 4CA0A 2LC2A 4BDYA 3DPTA 2XSJC 3SZGA 3HG9A 3L2WA 2WAFA 1Z7LA 2E5NA 1PJRA 3HL2A 4BL0B 1BR2A 3FKJA 3VYTB 2V6EA 2BVMA 1HA8A 3D5LA 4C30A 3L2UA 3K4KA 2VIXA 2R7VA 4HNTA 4XNFA 3S3MA 3K4NA 3BC8A 4P1WA 3QYBA 2VJ5A 2HNHA 1S9HA 2WADA 3F9KA 3D5SC 2K5CA 2OUMA 2CV2A 4XLHA 2OC6A 4QPQA 4BDZA 4BGDA 3QODA 3AKZA 3OMYA 2W4SA 1QHHD 2HVQA 4NUBA 4DBRA 3OS0A 2W7NA 2CV0A 4XLFA 2IXSA 1JI8A 4CCOA 4YELA 4E4HA 2R7QA 3DU6A 2Z2SB 1WJEA 2AQEA 2CW8A 4BQQA 4E6KG 4PSWA 1YX3A 3OYDA 3OYJA 2ZSHB 1T95A 3LSGA 2HVRA 4HRIA 5TGTA 2IGMA 3PL8A 3PNTA 4PFOA 3OYGA 1UAAA 1N77A 2DT6A 4II2A 3VYUB 3CJRB 4F92B 3L2RA 4C2UA 5LD2C 2LYCA 2LY2A 4IQ4A 2KDOA 3TMOA 3IUOA 2V7FA 2V9KA 3L2QA 2MFZA 2NOJB 4E7HA 4PSXA 4AVZA 1ERDA 4E7SA 1R6RA 2LREA 3I9V2 4AYBA 4BS9A 3RCOA 3V42A 2MABA 4LITA 2QKMB 1D0XA 2CUZA 2I8DA 4XR6A 2W00A 2K9LA 4ZC3A 3K10A 3QYEA 4XONA 1LVKA 4KJZA 1Z3XA 3KEYA 1NG6A 3AFHA 3LSHA 3VYSB 2CFOA 1Y56A 3QOEA 4CCKA 4CCMA 4U7BA 2VPLA 2IS6A 4BEHA 2RQQA 4KISA 1U0JA 4PJJA 3J7AY 2Y0SA 3LSMA 3C2GA 4II3A 4XKBA 2XC7A 3FBNB 2E5ZA 2X1CA 4XKWA 3DTIA 3PSFA 2IGKA 4CCNA 2DJIA 3K6GA 3DEEA 3OL4A 4OWRB 3LSKA 4NNJA 2WB1A 2VASA 4Y33A 5HLTA 2HPMA 4AU7A 2R7TA 2WY8Q 3TL4X 1P9QC 4XM3A 1NG7A 2VKHA 1TZLA 2X6XA 3BLYA 2HVSA 1X1CA 3VDXA 1W36C 4P5OA 4Y4RA 3TBIA 4RM2A 2BOLA 4RM3A 4XMYA 1N75A 2KHMA 2VQLA 1V5FA 3OIPA 3RQ4A 4KITB 2X1EA 3H0DA 3A1YA 4PJNA 4ZDLA 3MKZA 4J01A 1YX5A 1BR4A 1WJAA 3I3LA 1MMDA 3IAM2 3NWTA 2R4GA 1QU3A 4NQWB 3PSIA 1WJCA 2RNGA 3BG7A 2L9NA 3ZCOA 4E7LA 4DGWB 2DT7B 3LFUA 2M7AA 2CW7A 2ELJA 3DTEA 4XORA 5CQGA 3KYLA 4F91B 2M3AA 3K4BA 4DOZA 3VYRB 4HSRA 4E7JA 3S3OA 1T0FC 4BXFA 1LFPA 3HC7A 2PMZA 2FUG2 2W1OA 3UR3C 4HSTA 4ZDPA 3M8JA 2L9SA 2WBMA 2CS3A 4LIUA 3H5RA 1W36D 1MNEA 3A4CA 4BEHB 1UG0A 1QHGA 2X6WA 3ZRGA 3OYIA 4BJ6C 3A2KA 3OOUA 4BACA 1Y6IA 4OAZA 4IKFA 4ANJA 4C2TA 2Q1ZB 2LBFA 4CUGA 4ZDOA 3RTRA 3PFYA 4ZJZA 2F6CA 2KPMA 1V5EA 4IQJA 4B43A 2KQRA 1X19A 3OYAA 4FETA 4B47A 5LFAA 4IX7A 3OYFA 2VQGA 3FBIB 4OAYA 3MD2A 2VXZA 3EPZA 4PJMA 4XQFA 3IP4B 2IS1A 3OYHA 3MKWB 3LL7A 1FMVA 3KX2A 3K70D 5FRNA 2R7OA 3PJRA 3CESA 1J09A 4PK4A 3ZQQA 2XDVA 3U21A 3SDBA 3S32A 3DLAA 4ITVA 4F52A 3E1SA 1MMAA 4ZTFA 3OL3A 4BU2A 4F93B 2V1NA 2MYSA 3PUBA 1PYVA 3H35A 4CCLA 4LIVA 1WJBA 4QPOA 3H5AA 4ZTJA 3H9QA 1E0EA 3OYEA 2XF7A 2VJ4A 1YE9A 3ZR8X 4DIQA 2PJRA 2IS4A 3SEQA 4C9YA 2HZDA 2X6YA 2JA2A 3MMYB 4E7IA 3E0JB 3HOTA 4XLEA 2HDWA 4E7ZA 4HNUA 1X1DA 3HPHA 4EATA 4KT6A 2PJRB 3DKYA 4X0GA 2KL4A 2M0MA 3H5NA 2O5RA 2KP6A 4BE2A 3K4JA 4NC8A 4J00A 4HG2A 3FHNA 1VZ0A 4CSWA 1Z21A 3CJQB 3CMMA 5CPRB 3AL0B 2IGNA 4XKVA 3HKZA 4NC7A 4U87A 1AA7A 3OS2A 2X1DA 3N05A 1MNDA 3EUHC 3DWLE 5KNLA 5HVQC 2KRCA 2OV7A 1D1BA 3EUAA 4PJLA 3GBGA 2HQAA 3PNVA 3BG6A 2WAQA 2IS2A 4BE1A 4E7KA 4B3XA 1Z3YA 3OYCA 2DXIA 2UV1A 2MD0A 4BUPA 2JVHA 2LRDA 3OR1C 4JOMA 3W3CA 5KHDA 3RPUD 4Y3OA 1TT0A 2Q2EB 3FDYA 1KONA 3LMMA 3M1CA 3HOSA 2LOOA 2WY7Q 2VLAA 5HNFA 1D1AA 4GRIA 3K70C 3OIQA 4XKCA 2F5VA 1X4OA 4XOPA 2BW3A 2DCEA 2QKLB 2UUZA 3BCBA 2W82A 3UNGC 1MMNA 5CQEA 2R7RA 4XL9A 4B44A 4BQNA 2E1MC 2BVLA 1FMWA 3DPLC 3D5RC 2GOXB 1EA3A 2JSPA 3HUGB 4PFPA 2RREA 3HPGA 3DTKA 2KMUA 3ZGKA 3HXLA 1GLNA 1OLTA 2UWMA 3PNYA 3K4CA 4D1QA 2XF6A 3MKYB 2VL8A 3OYLA 1SFKA 1WFXA 2M7BA 2VJJA 3L2VA 1LKXA 2KLOA 1WJDA 3G2BA 3CF2A 1G59A 2ZFUA 3S93A 2R7XA 2KZVA 2L7KA 3RSNA 4N4OB 2V26A 5FROA 2LG4A 4D9JA 2KRHA 2X51A 2GOMA 1IRXA 2JUGA 3SYTA 2M4KA 2E60A 4BJ5C 2VKDA 3IAS2 2JVGA 4G6TB 2R7SA 2F4IA 4N4NB 1WJ5A 4XLCA 4CCJA 4PUSA 4HEA2 2P0WA 3AL0C 3CP2A 1WJFA 1X4PA 1MW7A 2CH0A 1D1CA 2VQHA 2VJIA 3W2AA 2AQFA 4BJTA 3CZ6A 4F3QA 2A5WA 4LG3A 2MC4A 4CH7A 2E1MB 1BOBA 2M4GA 4XN0A 2LBFB 4HPQA 5KCMA 4ZYAA 2K9MA 1OR7C 5JHFA 2A6TA 2LH9A 2VXDA 3OYKA 2ZSIB 4CZCA 3QYFA 2ZXHA 5HNHA 3OS1A 1N78A 4JQFA 5HOOA 2LY1A 3LSIA 4F55A 2X85A 3VSKA 1G8XA 1BR1A 2V4JC 3OY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OC6 A;  2KL4 A;  2I8D A; 
#chains in the Genus database with same CATH topology
 4RLF A;  1OPC A;  3H9G A;  5AON A;  1BW6 A;  4R79 A;  2IPQ X;  5HOD A;  3JRF A;  1LDK B;  1YRN A;  4IOA F;  3F8C A;  2EJR A;  2YR2 A;  4JK1 X;  1X3U A;  2CV1 A;  2ESN A;  1TBX A;  3I59 A;  4YEJ A;  1ZEL A;  3VSL A;  1DGR M;  3HRT A;  3BR3 A;  3ZXS A;  2R7U A;  4HAM A;  1V5G A;  2ELK A;  3ECH A;  3OWT A;  5EGO A;  5F1J A;  4GCV A;  1UEL B;  1K6Y A;  4E70 A;  4GYI A;  3K4L A;  1J7K A;  1Z6T A;  1AOY A;  5LRS A;  3KET A;  2R5Y B;  2Z1D A;  1TWA J;  2HPI A;  1K4S A;  4M71 A;  3FMR A;  1HKS A;  2J5O A;  2K3P A;  2NNY A;  2RGV A;  3U2R A;  4BQO A;  1W0T A;  1D8K A;  1SAU A;  2WA0 A;  5F27 A;  2ZCW A;  1VQL I;  4XRF A;  1ON2 A;  4PDK A;  3TGN A;  1GV5 A;  3N97 A;  3EUK L;  1S6L A;  3NWS A;  3IH3 A;  4B1R A;  4XLP F;  1RUN A;  1X1A A;  4Y17 A;  1UZC A;  3HGG A;  3FXR A;  1WQ2 A;  3ULQ B;  5CKT A;  3DU5 A;  2BHZ A;  2L3D A;  2L2O A;  1VQO I;  3H9J A;  3BCA A;  3P5J A;  3T1B A;  1NH3 A;  1U9O A;  1K78 B;  2QCO A;  2LC2 A;  3KCC A;  3SZG A;  3HG9 A;  1JGG A;  1Z7L A;  1F5T A;  1PJR A;  1A5J A;  5IP7 J;  4BL0 B;  3VYT B;  3MAJ A;  3FXJ A;  4FCY A;  1MDM A;  1R1V A;  4S05 A;  1YJN I;  3ZPL A;  1MBH A;  1IXR C;  4XNF A;  3S3M A;  4Z2Y A;  1GVJ A;  1VND A;  2YX7 A;  3I56 I;  3QPH A;  2BY2 A;  2NRA C;  2VBW A;  3QYB A;  2VJ5 A;  4M6X A;  3F9K A;  2K5C A;  4QPQ A;  4RB1 A;  3RKQ A;  2IVM A;  1FTZ A;  1IXC A;  1XGM A;  4ZYE A;  2W7N A;  4UV9 A;  2XGE A;  5TIS C;  3LA2 A;  2LKS A;  4YEL A;  4E4H A;  3DU6 A;  2VE9 A;  4KIG A;  2CW8 A;  1TNT A;  4BQQ A;  2QSH X;  4PSW A;  3OYD A;  1T95 A;  4GXO A;  4O5V A;  4KN7 X;  2UZK A;  4MFD A;  4BBR J;  1TW3 A;  3PL8 A;  2L4A A;  3PNT A;  1RZ4 A;  1P4X A;  3S1M J;  2XSD C;  2DT6 A;  3R4K A;  1ZGA A;  4II2 A;  1DP7 P;  5LD2 C;  3KLN A;  4IQ4 A;  2N8G A;  4A5N A;  3W6V A;  3IUO A;  1A35 A;  1R58 A;  3HBL A;  2V9K A;  2MFZ A;  4JP0 A;  5HLH A;  4E7H A;  2Y9Z A;  1M1E B;  4LOC A;  2O8K A;  3CCQ I;  2EZH A;  5FKO A;  2IRF G;  2VOO A;  2PQ8 A;  2TCT A;  3FWE A;  1LQ1 A;  4KMF A;  4EGZ A;  1ZLK A;  1D0X A;  2CUZ A;  2I8D A;  2OCC H;  5FFZ A;  4EJW A;  3K10 A;  1IZ1 A;  3A02 A;  4XON A;  1LVK A;  4KJZ A;  1Z3X A;  1NG6 A;  1UST A;  3LSH A;  3VYS B;  2CFO A;  1Y56 A;  2JA6 J;  2DK8 A;  2EFN A;  2RKH A;  4CCM A;  2H8R A;  2O03 A;  1XG1 A;  4BEH A;  5DD8 A;  3ISP A;  2G9W A;  3D0S A;  3DKW A;  5J8F A;  4A3E J;  3DEW A;  1FBU A;  2Y69 H;  1YI2 I;  3VOD A;  3AAF A;  2O3F A;  3LSM A;  2Z5U A;  3FMS A;  5EDN A;  2EFQ A;  2NOG A;  2L9V A;  3J7A O;  2D2W A;  4I09 A;  3FBN B;  4D0P A;  2DA2 A;  2MGQ A;  2P7C B;  3H3V K;  4IHT A;  2ZO4 A;  3LQR A;  1WWX A;  4I98 B;  3D1N I;  4FE7 A;  2WV0 A;  4BHB A;  4CCN A;  2R93 J;  2DJI A;  3K6G A;  3DEE A;  3OL4 A;  2AS5 F;  4Y33 A;  2NVQ J;  2QZ8 A;  4AU7 A;  2KDZ A;  1L0O C;  3O8H A;  5ED4 A;  1QRY A;  3VFZ A;  2HOS A;  2VKH A;  3GW2 A;  1W1W E;  4CYC B;  3CD6 I;  3BLY A;  3JCU C;  1D5V A;  1HDD C;  1ZKG A;  3TBI A;  1O57 A;  1EH7 A;  3RKX A;  3GZ6 A;  4RM3 A;  2VQL A;  3OIP A;  1V55 H;  4BKX A;  3E6C C;  2PLY A;  4RGU A;  2VC1 A;  3EYI A;  1SD6 A;  4Q48 A;  5HDG A;  3VOE A;  2JWT A;  4A5M A;  4Y52 J;  2EH3 A;  1QU3 A;  1XMX A;  2EK5 A;  2LK2 A;  4B3A A;  3Q9V A;  3VB2 A;  1AWC A;  3G6E I;  2R92 J;  2AO9 A;  2EPF A;  2CSO A;  3LA7 A;  2VON A;  2ZME B;  3F22 A;  4FT8 A;  3LFU A;  3JRB A;  1IRG A;  2ELJ A;  2FBH A;  3BTC A;  2CUF A;  4F91 B;  1SFO J;  2FQ4 A;  2M3A A;  4A0X A;  4XIC A;  4HSR A;  4IRI A;  4IPA A;  4BXF A;  4G9Y A;  4RB0 A;  5GAG J;  3Q5F A;  2FF4 A;  2I5U A;  3UR3 C;  5LHG A;  3BDD A;  4UNO A;  2LKX A;  1TW2 A;  1UFM A;  4UY8 I;  3C7J A;  2BY1 A;  3FKI J;  3CCE I;  1MNE A;  4BEH B;  1YW7 A;  5AIQ A;  3DV8 A;  2LSO A;  1GUU A;  4L5J A;  3ZRG A;  2P5V A;  5JLW A;  3J80 K;  3A2K A;  3OOU A;  3HGY A;  3HIF A;  3G1M A;  2K9N A;  3HB9 A;  4EM2 A;  4C2T A;  1TT5 B;  2K3F A;  4AM3 A;  2Q2E A;  3EDP A;  2CWE A;  4HX4 A;  1OYY A;  4UVC A;  5CLS A;  4IRG A;  1MMS A;  1NTC A;  3F3X A;  2COB A;  2HWV A;  3KYC B;  1O7L A;  3EET A;  5IP6 A;  2KPM A;  3SHF A;  2QEX I;  5LRR A;  4ETS A;  3OOP A;  1X19 A;  2VKE A;  3OYA A;  4FET A;  1XTA A;  2BV6 A;  5D4S A;  2TRT A;  1H89 C;  1FP2 A;  4ESF A;  3JTG A;  3E5X A;  2XAG A;  3PQK A;  2WV1 A;  1BA5 A;  1JGS A;  5IYB J;  1FMV A;  3L2C A;  3OIO A;  5D5W B;  3RYR A;  1W4M A;  1P6R A;  3ROU A;  3FIW A;  3SDB A;  2JSC A;  5D6F A;  4IHS A;  4EJV A;  1HKT A;  2BXY A;  3PFI A;  5LEK A;  1ZG1 A;  4M9X A;  4YFN F;  3E1S A;  2LFB A;  4V2F A;  4PCQ A;  2OCE A;  4F93 B;  1NK2 P;  1JXS A;  3HRS A;  2UXN A;  1JT0 A;  3Q0V A;  2ADU A;  4LIV A;  1MBK A;  2A3S A;  2ZJP F;  4MQ9 F;  3H5A A;  4U88 A;  2O9L A;  2JT1 A;  1I27 A;  2DDA A;  2VJ4 A;  1YE9 A;  2Y0S N;  1KQ0 A;  2NVT J;  2COM A;  5BMZ A;  3SEQ A;  1K78 A;  3L1P A;  3V8L A;  1MJ9 A;  3HOT A;  4UB6 C;  4XLE A;  1WRJ A;  2HDW A;  3K1M A;  3QPT A;  3U1K A;  4E7Z A;  5GTI C;  1RC9 A;  2DN0 A;  5ICF A;  4YFK F;  2W57 A;  2OTJ I;  2ID3 A;  2H1K A;  3IWZ A;  2OPT A;  2UXX A;  2XRN A;  3HPH A;  2CO5 A;  1S3J A;  1B72 B;  1FNN A;  3DKY A;  3TP0 A;  1T6S A;  2O5R A;  2KP6 A;  1CGP A;  4NC8 A;  3FHN A;  1IXS B;  1AKH B;  4IHX A;  2B63 J;  2M8G X;  1XCV A;  3HKZ A;  3NQO A;  5IPA A;  3WTY C;  3JRA A;  5J3L A;  1AA7 A;  2BXZ A;  1P7I A;  4RA2 A;  2VOP A;  1WI3 A;  3TP3 A;  4FHT A;  3N05 A;  2W25 A;  2M45 A;  1MND A;  5FB2 A;  1E3O C;  1ZR2 A;  5EZH A;  5BS6 A;  5HVQ C;  5KNL A;  3BR2 A;  1U9N A;  1D1B A;  3EUA A;  5EGO B;  4ZH4 F;  3B02 A;  1YQA A;  1TWC J;  4G6Q A;  4B3X A;  2FX0 A;  1VQ4 I;  3HOU J;  3FMQ A;  2UV1 A;  3MZ8 A;  4XSZ F;  2FOW A;  3L7W A;  5DM7 F;  2R5Y A;  5DEQ A;  5GP9 A;  4KYW A;  2LKP A;  3F6V A;  3HOS A;  2LOO A;  1FBS A;  2LTP A;  4BH9 A;  5IP9 J;  5LHH A;  2VLA A;  3BWG A;  1MJB A;  3MEX A;  4W1U A;  1FZP B;  3ERM A;  3QAH A;  5LGT A;  1R36 A;  3BJ6 A;  4XOP A;  2PFB A;  3CJN A;  3NAU A;  3HJE A;  4LLN A;  4XL9 A;  4BQN A;  1VQN I;  2DJN A;  3GLL A;  5GTH C;  3U1D A;  2J5P A;  1W0U A;  1FMW A;  2HYF A;  4BXX J;  1ETV A;  5FLM J;  2JSP A;  3HUG B;  2RRE A;  1YW9 A;  3HPG A;  1B8I B;  3DTK A;  2O6G E;  2L7M P;  5IT3 A;  2KT0 A;  2HQN A;  1OLT A;  2A61 A;  1HW1 A;  3PNY A;  3K4C A;  4WCG A;  4EGY A;  2XF6 A;  3MKY B;  3OYL A;  4FIS A;  3BOQ A;  2KIQ A;  4IVN A;  5TRD A;  1WFX A;  2VJJ A;  4LLG F;  3L2V A;  2FMY A;  3W6J B;  3TED A;  2OAZ A;  1ZHF A;  2E36 A;  3CLQ A;  3H0G J;  2JRT A;  5JHU A;  4N4O B;  2DA4 A;  2DQR A;  2PN6 A;  3WTZ A;  1WH7 A;  5DV5 A;  2KRH A;  2RN7 A;  3WGH A;  2A6H F;  2MH2 A;  3RIR A;  3SYT A;  1WI9 A;  3FHZ A;  2GA2 A;  1T33 A;  2DAO A;  1XPX A;  4G6T B;  1U8R A;  3LFK A;  3J7Y J;  5FO5 A;  4A3D J;  3SJM A;  2CQ7 A;  2Y48 A;  4HEA 2;  2F5D A;  4D5F A;  3J80 Z;  3CF5 F;  5JLX A;  5ERI A;  1WJF A;  1X4P A;  2CH0 A;  2VJI A;  3GZN B;  1Z9C A;  2FU4 A;  4F3Q A;  1IN7 A;  3PM1 A;  4LG3 A;  4RAF A;  2QSF X;  3IRR A;  1F36 A;  3BRO A;  4XN0 A;  2LBF B;  4BAY A;  5KCM A;  1XD7 A;  5JHF A;  1I1G A;  2GZW A;  4HX8 A;  2LH9 A;  2VT3 A;  3WU1 B;  3WU2 C;  2XAH A;  2ZXH A;  5F0C A;  4HV5 A;  4EV0 A;  5HNH A;  2DA5 A;  1XMK A;  5HOO A;  2DFF A;  1W5S A;  1BW5 A;  2P8T A;  3VSK A;  4YII A;  2E1O A;  4A3J J;  3I54 A;  1VI0 A;  1YS6 A;  1N25 A;  2X9D A;  5K5R A;  2FEZ A;  3COA C;  3LSP A;  4UV8 A;  2L01 A;  1Z7U A;  2ETH A;  3B73 A;  4Z6Y A;  2XF5 A;  4HQE A;  2BW3 B;  3I4M J;  1VQ6 I;  2MA3 A;  1FTT A;  4KFC A;  4I76 A;  1R1T A;  2EQR A;  4XRS A;  3K4M A;  1ETW A;  1V3F A;  4A6D A;  3I0T A;  4EJU A;  2BY0 A;  1FX7 A;  2HU9 A;  1GXP A;  4XOT A;  1DGW Y;  3W2V A;  2HKX A;  2MD5 A;  5EEA A;  4AIJ A;  3N4M A;  2IGO A;  3CCL I;  1DQU A;  5ILV A;  3SEZ A;  1K61 A;  1F43 A;  1FYK A;  5IT9 Z;  3TOB A;  1D0Z A;  3GTL J;  4UB8 C;  1PUE E;  2H6B A;  2ZXJ A;  2CUJ A;  3JRD A;  5FRM A;  1K6O A;  1D0Y A;  4H4K C;  3FXQ A;  4ENJ A;  2EFP A;  3ABU A;  1T56 A;  3LA3 A;  2L9R A;  4I0A A;  1T8I A;  4BHP A;  1UMQ A;  2DOA A;  1KQ9 A;  1U3E M;  2V79 A;  4CA0 A;  2QM3 A;  4LK0 F;  3GXO A;  4ZZD A;  2JA5 J;  2DA6 A;  3CC7 I;  1RET A;  2ISZ A;  2NNN A;  2HFH A;  3I53 A;  2D45 A;  2BVM A;  2XB0 X;  4M3E A;  3GCM A;  2Z33 A;  2FOK A;  1RIO H;  3S17 J;  2EIJ H;  2P4W A;  3KP4 A;  1VQP I;  1Z77 A;  3K4K A;  2VIX A;  3HHG A;  3I5U A;  1LFU P;  2E1N A;  4AD9 A;  4M73 A;  2R5Z A;  4BXU A;  1Z0X A;  1TWG J;  2L4M A;  5FKL A;  2H1L A;  2IA1 A;  2XGX A;  2XGC A;  3HSR A;  1R1U A;  4BGD A;  5LEJ A;  5LBQ A;  4BDZ A;  3UKG A;  1FP1 D;  3FZV A;  2VUM J;  4HBL A;  2HVQ A;  2NAZ A;  2VC0 A;  2A07 F;  2IXS A;  4KIC A;  1NHA A;  4CYC A;  1RR7 A;  5EJC A;  1MD0 A;  1G3W A;  2Z2S B;  4GDF A;  5IYC J;  3LSR A;  2EIL H;  2K7L A;  3HSF A;  2KJB A;  1LNW A;  3HOZ J;  1WHU A;  2HTS A;  5J40 A;  4ABZ A;  3BR5 A;  1U5T B;  2EA2 A;  2L7Z A;  1FIP A;  4QWQ A;  5E79 C;  5HDK A;  2DQL A;  1WSU A;  4PFO A;  3OYG A;  1VQM I;  1N77 A;  4G94 A;  3G73 A;  1ZN2 A;  4G7H F;  4F92 B;  1ZLJ A;  3CJT B;  2LYC A;  2LY2 A;  4B8X A;  2ZXW H;  3DXJ F;  3I4N J;  1T2K A;  2KDO A;  3FXL A;  1I50 J;  5ILU A;  3CCJ I;  5K7F A;  2W85 A;  2LLK A;  2EIK H;  1QPI A;  3L2Q A;  2NOJ B;  3QPL A;  3SFZ A;  4PSX A;  1BN5 A;  1H9G A;  1ERD A;  4E7S A;  1R6R A;  1USS A;  4AYB A;  1QZY A;  4G7Z F;  3RCO A;  3ZQI A;  4LIT A;  2QKM B;  1JKR C;  3BG3 A;  4QSH A;  4ZC3 A;  3GEZ A;  1QZE A;  4KA4 A;  5DUI A;  1YJW I;  4A3I J;  2EFO A;  5CVI A;  2NS0 A;  5L3G A;  4AC0 A;  3GFL A;  1RPW A;  2FRH A;  2DA3 A;  4U7B A;  2LNB A;  2GWR A;  1V54 H;  1QVU A;  1YS7 A;  4KIS A;  2HOE A;  1O7F A;  4UVB A;  3J7A Y;  1NK3 P;  2R5Z B;  1I3A A;  4II3 A;  3MQ0 A;  3CCM I;  5FLX K;  4XKB A;  2X1C A;  1J75 A;  2K27 A;  3PSF A;  4DZJ A;  1JTY A;  4XBF A;  3ZMT A;  1D8J A;  3HOY J;  2JTV A;  1E3H A;  1P4A A;  3LSK A;  2WB1 A;  2VAS A;  1ENH A;  2WWY A;  1XDU A;  3MWM A;  3TDZ C;  3ZQG A;  1L3L A;  2VE8 A;  1IV8 A;  3NAR A;  4CHU A;  2DTZ A;  4EJT A;  2ACJ A;  1SAN A;  3V7R A;  1SC7 A;  3CME I;  3BZ6 A;  1X1C A;  1XDS A;  3VDX A;  1SFE A;  4P5O A;  5DDG A;  3KZZ A;  4XMY A;  2DPU A;  1N75 A;  3K9T A;  2ELH A;  4DZP A;  3S2W A;  3H0D A;  4PJN A;  4KUM A;  4J19 A;  1BR4 A;  1YX5 A;  1WJA A;  4HLY A;  5BQT A;  2DMU A;  5EYR A;  3RZD J;  3NWT A;  1BC7 C;  1OCR H;  3V8K A;  4ZYD A;  2QWW A;  1PP8 F;  2RNG A;  4LB5 A;  5EG0 A;  3JR9 A;  3BG7 A;  2L9N A;  4E7L A;  3PUF A;  3GTG J;  2F5F A;  3JRI A;  4ZYG A;  4JYK A;  3KYL A;  4A3C J;  2HEO A;  1Z91 A;  1ACI A;  1TP4 A;  1TWF J;  4DOZ A;  3VYR B;  4BQA A;  1T0F C;  3KZI C;  3HC7 A;  1LE8 B;  3B6C A;  2PMZ A;  1XS9 A;  5F1R A;  1BJA A;  2XPW A;  3CLO A;  3HTU A;  2KKO A;  4D5C A;  1REP C;  1QZZ A;  2CS3 A;  1KU3 A;  3BZK A;  2P81 A;  2XAJ A;  1W36 D;  1JUS A;  2DA1 A;  3A4C A;  3ZQL A;  3QU6 A;  2GIV A;  1ZRE A;  4BJ6 C;  5DD4 A;  3GO5 A;  2B7E A;  2XB5 A;  1Y6I A;  2FD5 A;  4OAZ A;  4S0H B;  5AIP A;  1IN6 A;  1MGT A;  1VQ7 I;  2LBF A;  4M74 A;  5H2F C;  2EA4 A;  4CUG A;  4RGX A;  3REO A;  2OQG A;  5ICC A;  3WGI A;  1HDP A;  2ME0 A;  5KAI C;  3RTR A;  3PFY A;  2OF7 A;  1S7A A;  2D1H A;  3EYY A;  1V5E A;  3C2B A;  2KQR A;  2HTJ A;  1O3T A;  4IX7 A;  1YO5 C;  2E7X A;  3HOW J;  3U9G A;  1YIJ I;  2JN6 A;  2Y2Z A;  4I7H A;  4XRS G;  1BI0 A;  4LLL A;  2L54 A;  2KRF A;  3MD2 A;  3EPZ A;  3IP4 B;  1WH5 A;  4DQ2 A;  3MKW B;  5CYV A;  1A6Q A;  3CDH A;  1T98 A;  3GWZ A;  3Q9S A;  1D3Y A;  2F48 A;  1SD4 A;  3V7S A;  3KZY A;  4XSX F;  3TOA A;  3K70 D;  2QBY A;  3C1D A;  2R7O A;  3CES A;  2ZKZ A;  4LK1 F;  3HZJ A;  4PK4 A;  2XKP A;  3ZMZ A;  3F23 A;  3U21 A;  4O6J A;  1EV7 A;  3H92 A;  3MZY A;  1I3Q J;  4Y13 A;  3CTA A;  4AUX A;  1T39 A;  2O0Y A;  2EZL A;  2QBY B;  4PZJ A;  2ZJQ F;  4EJO A;  1TQI A;  4ZTF A;  4KIF A;  3PUB A;  3LNQ A;  2PMZ N;  3ZP5 A;  1OYW A;  3CUQ B;  5LGN A;  3ZMS A;  4MHG A;  1WJB A;  3KP6 A;  1JUM A;  2JPC A;  4ZTJ A;  2XPV A;  3S14 J;  2P5K A;  3ZR8 X;  3S2D J;  1BC8 C;  2VBY A;  1T08 B;  2E2J J;  3V7C A;  1HSJ A;  2EIM H;  3K2Z A;  1X1D A;  3ABL H;  3SQN A;  4EAT A;  5K7H A;  4ENK A;  2PJR B;  1J5Y A;  4X0G A;  2KL4 A;  2M0M A;  5L3B A;  3E97 A;  4Q4Z F;  1I6H J;  2MLK A;  3AG1 H;  2LMD A;  3CCV I;  1B4A A;  4BE2 A;  4HG2 A;  2H09 A;  4CSW A;  3TO6 A;  2DLL A;  3Q3S A;  2QA4 I;  4A3B J;  3EQL F;  2MW8 A;  1YRN B;  4DYQ A;  3JAM K;  1BJZ A;  3BTJ A;  1HW2 A;  1DUX C;  4L18 B;  4RDU A;  5E1X A;  2KJC A;  3K7A J;  3NRV A;  2HR3 A;  3EUH C;  1LE8 A;  2ECB A;  3E6M A;  2OV7 A;  4PJL A;  1AKH A;  3GBG A;  2OQR A;  4MFE A;  3PNV A;  3BG6 A;  2ZNY A;  4DW6 A;  1GV2 A;  4E7K A;  2GXG A;  2DXI A;  4LGW A;  4MIM A;  5M5X J;  4BUP A;  2JVH A;  2CW0 F;  5FKN A;  3OR1 C;  4JOM A;  3ML6 A;  3W3C A;  3RPU D;  2X6O A;  4Y3O A;  3A01 B;  2Q2E B;  1KON A;  2LR8 A;  1KYZ A;  1YOV B;  3FK6 A;  1T38 A;  1D1A A;  3OIQ A;  3FF5 A;  3S1N J;  2G7U A;  2F5V A;  3M8E A;  4BY1 J;  1R23 A;  2QKL B;  1OR7 A;  2UUZ A;  2VPR A;  3BPV A;  3BCB A;  1XB4 A;  3IH2 A;  2DFI A;  5GAE J;  1MMN A;  5CQE A;  2R7R A;  5J8C A;  3RZO J;  2JJ7 A;  4HV6 A;  5C44 J;  1TWH J;  2GOX B;  3ERE D;  1EA3 A;  1IF1 A;  2DTR A;  4R1H A;  3VPR A;  3CMA I;  1IDZ A;  1S29 A;  2K9Q A;  3MCZ A;  2RQP A;  3GUD A;  3C3W A;  3A0B C;  4A0Y A;  4Y7N J;  2RC4 A;  4Q5S F;  2ZC2 A;  4D1Q A;  2IP2 A;  1W7P B;  2PG4 A;  2VL8 A;  3WG9 A;  2DA7 A;  1LKX A;  2KLO A;  1WJD A;  3G2B A;  4AYB N;  1EH6 A;  3S93 A;  2R7X A;  2BY3 A;  3BQZ A;  2BYV E;  5FRO A;  5IY5 H;  2ZBK A;  2LG4 A;  5DCF A;  2IA2 A;  3DBL B;  5FLX Z;  2PX9 A;  2PJP A;  2O7O A;  1U6G A;  1A36 A;  1OCP A;  5DS9 A;  3LAP A;  3JW4 A;  4BJ5 C;  2VKD A;  3DLL F;  1GDT A;  1FOX A;  2VT2 A;  1DDN A;  3IKV A;  3PO2 J;  3LQQ A;  1LUJ B;  1I6X A;  2DFH A;  3K0L A;  4CCJ A;  2D5V A;  3AL0 C;  1TLH B;  1ZAO A;  1ZRF A;  4WXC A;  2VQH A;  3G1L A;  4M3D A;  1TC3 C;  3W2A A;  1QO0 D;  1GT0 C;  2KZG A;  5K1Y A;  1EKE A;  3GZ5 A;  2XAF A;  3CZ6 A;  5DYM A;  1BOB A;  2M34 A;  3PO3 J;  3KPH A;  4HPQ A;  5E3O A;  4RS8 A;  1EH8 A;  3AG2 H;  1FSE A;  4HDU A;  2A6T A;  2VXD A;  3OYK A;  2XHK A;  2ZSI B;  3BR0 A;  4CZC A;  1X1P A;  2RDP A;  5IOZ A;  2P6T A;  2Z99 A;  1B8I A;  2XUB A;  5E8G A;  5BPI A;  1ZRD A;  4JQF A;  1R5I D;  3LSI A;  3L00 A;  1B6A A;  5DCM A;  3EUH A;  4AIK A;  2V4J C;  1KQ8 A;  1MH4 A;  4L9J A;  3QP5 A;  1BBY A;  1XGS A;  2R7W A;  2RNJ A;  5HS7 A;  4BE0 A;  2FJ1 A;  4RB3 C;  3WTS C;  5J4Y A;  2HYG D;  2CMP A;  2JPB A;  5E1Z B;  2K86 A;  3ONQ A;  4DBQ A;  3GME A;  2ZXI A;  2EWN A;  4IJA A;  4RMN A;  3ASO H;  3RKY A;  3GLX A;  1XC5 A;  3RJP A;  4RLQ A;  4FAS D;  1YW8 A;  2K4J A;  1Y0U A;  2Z9O A;  5J1R A;  5LLQ A;  2Y30 A;  3V8J A;  3E3V A;  4LMY A;  1B1B A;  3OYM A;  2LDU A;  2YPR A;  3VWB A;  4CGZ A;  4L9V A;  3W2W A;  2Y0M A;  3C2H A;  3DQV C;  1ZG3 A;  3T8R A;  3J7Z I;  2EFW A;  1WZ2 A;  1VQ9 I;  4IHY A;  4IZZ A;  1ON1 A;  4P96 A;  3QRF F;  1XCB A;  4KMU X;  4B48 A;  4DJA A;  1DP3 A;  2W24 A;  3S2H J;  2VQC A;  2Z16 A;  5GPA A;  2XAU A;  4NDL A;  3BR6 A;  1LEA A;  3S3N A;  3K1N A;  3OYN A;  3MKL A;  2WAE A;  2NS7 A;  3RKW A;  4ZYH A;  3TO9 A;  3WTT C;  1UJ8 A;  2Q8K A;  1H88 C;  3DPT A;  2XSJ C;  3L2W A;  1IO2 A;  4DNC A;  3ZMD A;  1O3S A;  1RNL A;  1S7E A;  2WAF A;  5IOY A;  3ZQ7 A;  4I0B A;  3FKJ A;  3X2Q H;  1WGX A;  3P9K A;  4HF2 A;  2E71 A;  1OKR A;  4LG0 A;  3L2U A;  2PMH A;  2HQ5 A;  4MTD A;  1KGS A;  1S7O A;  4G7O F;  3QPS A;  5H20 A;  2E2H J;  4FE4 A;  2FXA A;  4P1W A;  5HLI A;  1S9H A;  3DF8 A;  4M3F A;  2GBY A;  1KYW A;  1Y8Q B;  4L0Y B;  3ZQC A;  1IN5 A;  2ISY A;  1MH3 A;  1RRJ A;  3OMY A;  3KEQ A;  2W4S A;  4DBR A;  1P4W A;  3LSJ A;  1I39 A;  1X3Z B;  3OV8 A;  1MSF C;  1ZG5 A;  2BZT A;  3WE2 A;  3DEU A;  1BI2 A;  4OIO F;  5B1B H;  1YJ9 I;  1YX3 A;  3OYJ A;  3BTI A;  2QEN A;  3FXO A;  2M9H A;  1RKT A;  3LSG A;  1TL8 A;  4WK8 F;  4Q47 A;  4D7N A;  1BM9 A;  5A2Q Z;  2IBD A;  1MSE C;  2CYY A;  1RUO A;  3CO6 C;  5TGT A;  1HST A;  1YLF A;  2EBI A;  1D5Y A;  3M3Y J;  3VYU B;  5E18 F;  1MBJ A;  4C2U A;  1HOM A;  1MKM A;  2IA0 A;  2E19 A;  3TMO A;  2VN2 A;  4KNY A;  4RGS A;  1ZQ3 P;  3GTQ J;  1R7J A;  3FIS A;  5E1W A;  4A12 A;  2WB1 N;  5H6Q A;  4AVZ A;  2DI3 A;  2OTL I;  2HDC A;  3KE2 A;  2XAQ A;  3HKZ N;  1P92 A;  4BHC A;  1B72 A;  2CU7 A;  1SFU A;  3BJA A;  3QQA A;  3V42 A;  2MAB A;  1XSX A;  2VBX A;  1K4T A;  3ABK H;  4EVI A;  2C6Y A;  2K9L A;  5E3L A;  4M72 A;  1H9T A;  2F5E A;  2QQ9 A;  1R00 A;  3QYE A;  3GYH X;  3WG7 H;  3R60 A;  2EB7 A;  2X48 A;  1ZGJ A;  2KIU A;  2HYJ A;  3WTV C;  4MEY F;  1X3W B;  1IW7 F;  3LOC A;  5D6E A;  4CCK A;  4D7M A;  2HI3 A;  3G4S I;  2VPL A;  4EEF G;  5F0H A;  3WTU C;  2YS9 A;  3T5X A;  4PJJ A;  2Y0S A;  4U0Y A;  3S16 J;  5F6F A;  5BNG A;  4KT5 C;  2XC7 A;  1OIS A;  1QQI A;  2QYO A;  1H0M A;  4XKW A;  3MFK A;  1VQ8 I;  1S8N A;  1ZAR A;  2GM4 A;  2IGK A;  1PUF B;  3M4O J;  4NB5 A;  4OWR B;  5HLT A;  4NNJ A;  2HPM A;  1SEU A;  3HTS B;  1Y0N A;  1J9I A;  2QQB A;  2R7T A;  3FXU A;  2WY8 Q;  3TL4 X;  1P9Q C;  4A3K J;  3SFI A;  1ODD A;  3S1R J;  1NG7 A;  5D8L B;  1TZL A;  2X6X A;  2DT5 A;  2HGC A;  4MEX F;  2XPU A;  1W36 C;  2STW A;  4Y4R A;  4RM2 A;  2H94 A;  2Y31 A;  3W6K B;  2E34 A;  4LB6 B;  1H8A C;  1OCT C;  4H0E A;  3CC4 I;  2BOL A;  2XGD A;  2KHM A;  3LWF A;  4KIT B;  3T8T A;  2CQX A;  4MNU A;  2HXI A;  1PDN C;  5E3N A;  5LGU A;  4J01 A;  3IWF A;  4A6E A;  5B66 C;  5EEH A;  3I3L A;  1MMD A;  3IAM 2;  3O8G A;  1X2M A;  4XID A;  2W48 A;  2NYX A;  1K79 A;  2YSR A;  4MO7 A;  2DYS H;  3KYD B;  1WJC A;  2EV0 A;  1ZYR F;  2A5Y B;  4UUS B;  4EQQ A;  1KA8 A;  3ZCO A;  2D1V A;  4DGW B;  2M1B A;  2DT7 B;  2JZY A;  2CW7 A;  3DTE A;  4XOR A;  2VOD A;  1KU2 A;  5FFX A;  1PUF A;  4IL6 C;  3IL2 A;  4YFX F;  2K85 A;  2FBK A;  6PAX A;  2CJJ A;  1LFP A;  2VBZ A;  3BP8 A;  3HEF A;  2FUG 2;  2W1O A;  4HST A;  1W7P D;  4HW0 A;  4LG0 B;  4DYR A;  3IRQ A;  3P7N A;  4LIU A;  3H5R A;  3JTH A;  1IRF A;  4R8H A;  2LD5 A;  5EF6 A;  1QHG A;  5IT9 K;  2DFE A;  1FLI A;  3HRM A;  4BAC A;  1AU7 A;  1APL C;  1OFC X;  4IKF A;  5F08 A;  4ANJ A;  4A0Z A;  2ESH A;  2NVU B;  2Q1Z B;  1F9N A;  5HDN A;  3GX4 X;  3BT9 A;  4RAZ A;  4GYG A;  4EM1 A;  3BJO A;  4ZJZ A;  5C3E J;  4IXA A;  2PBI A;  5L3D A;  4U7D A;  4IQJ A;  2FQ3 A;  2OBP A;  3PIO F;  2CQQ A;  5LFA A;  1HCR A;  4V2G A;  2DMP A;  2HQR A;  1HW5 A;  3KIO A;  1G3Y A;  4B4C A;  3OYF A;  1IDY A;  2PEX A;  4K2E A;  4X6A J;  3ABM H;  2QQA A;  3GTP J;  2VXZ A;  4PJM A;  4P9F A;  4XQF A;  2IS1 A;  3F8F A;  4QIW N;  1A31 A;  2VKV A;  3DCF A;  1RKW A;  1R4M B;  3KX2 A;  5K5O A;  2CGP A;  2CG4 A;  2XAS A;  1ETY A;  2JUC A;  1VTN C;  3PJR A;  1JTX A;  3TO7 A;  2JA7 J;  4O3M A;  4CZZ A;  1SVO A;  5BPD A;  3JRC A;  3S32 A;  4I99 C;  5BOX A;  4L5E A;  2YU9 J;  2H8W A;  1MMA A;  3OL3 A;  4A3L J;  4NBQ A;  1FYM A;  5EEG A;  3F21 A;  2MYS A;  3F8N A;  1UCR A;  1PYV A;  4OU0 A;  4CCL A;  1SD5 A;  5E8I A;  4QPO A;  2ME6 A;  2EV5 A;  5M3F J;  5FLV A;  1JT6 A;  2NXN B;  1ZGW A;  2MSY A;  1B9N A;  2V1U A;  2LVS A;  1FOW A;  1S72 I;  4WF2 A;  4ENM A;  4L0Z B;  5D5V B;  4C9Y A;  2HZD A;  5K5Q A;  4L9T A;  2JA2 A;  5M3M J;  1PVE A;  2K4B A;  3MMY B;  3BY6 A;  3E0J B;  3CDI A;  3F6O A;  5L3C A;  2DO7 A;  5FD5 A;  1FPQ A;  1VF9 A;  2OA4 A;  4KT6 A;  3R6S A;  1FIA A;  3HDD A;  3H5N A;  4YIF A;  2FA5 A;  3BG5 A;  4G12 A;  5B5E C;  3IC7 A;  4ENN A;  1Z21 A;  2ECC A;  1HXD A;  3CJQ B;  3CMM A;  3AL0 B;  3WHB A;  4NC7 A;  4N9I A;  4S04 A;  4L9N A;  4U87 A;  3RPQ A;  3SDG A;  3OS2 A;  1QPM A;  2X1D A;  3E5U A;  4V19 K;  2ZNZ A;  2V9P A;  4NHJ A;  2F5C A;  1BL0 A;  1CF7 A;  2HQA A;  5C4J J;  2Y9Y A;  2LF7 A;  4BE1 A;  4UXN A;  1YIO A;  3ZN0 A;  1Z3Y A;  4I02 A;  4HA8 A;  2MD0 A;  3CQZ J;  2MG4 A;  3M1E A;  2HS5 A;  5FJ8 J;  3JRH A;  3CCS I;  1ZH5 A;  1DU6 A;  2V6C A;  1TT0 A;  3FDY A;  3LMM A;  2Y75 A;  3M1C A;  2WY7 Q;  5HNF A;  4PJ0 C;  1MBE A;  4Y15 A;  3FXM A;  1MIJ A;  5M5W J;  4GRI A;  1IG7 A;  3J81 K;  4AIH A;  1A04 A;  3I59 B;  1ULY A;  1R5G A;  4XKC A;  1XSD A;  3GFJ A;  4ZZL A;  2G0E A;  2DCE A;  1DU0 A;  3ZN1 A;  2XRL A;  2W82 A;  3UNG C;  5B1A H;  2P5L C;  2BVL A;  3Q0U A;  5DM6 F;  4C2M J;  3JSO A;  1S5L C;  2M2E A;  4A2U A;  2KMU A;  2WAQ N;  1W5T A;  1GLN A;  3PIP F;  2JQ7 A;  4M6V A;  4U0V A;  3QU3 A;  2DMN A;  1XN7 A;  4UUS A;  1SMY F;  2M7B A;  4QLC U;  1G59 A;  3JAM Z;  1G4D A;  2JRM A;  1JE8 A;  2XKO A;  4WX9 A;  2K9S A;  3HUG A;  4ON0 A;  1VQK I;  2L7K A;  2V26 A;  2O8X A;  3R0J A;  4OIN F;  3WHC A;  1TQM A;  4A3M J;  2X51 A;  2GOM A;  5DTD A;  3BG9 A;  1EJ9 A;  1IRX A;  1MBG A;  3WOD F;  1JUP A;  2DMT A;  3IAS 2;  2R7S A;  2QSG X;  1SAX A;  1SD7 A;  3L09 A;  1W5C C;  2AXL A;  2F4I A;  5J47 A;  1WJ5 A;  2K40 A;  3JRE A;  4XLC A;  1O4X A;  4PUS A;  2HOA A;  1B59 A;  3CP2 A;  2KIS A;  4UUV A;  1SVL A;  2AQF A;  2OJE D;  2E35 A;  1GHC A;  2L0K A;  3HOX J;  2A5W A;  4CH7 A;  1O3R A;  2M4G A;  3DFG A;  1OCO H;  3TKY A;  1ZR4 A;  4HF1 A;  2QLZ A;  2B9S A;  5JR3 A;  1IUY A;  4ZYA A;  3OSG A;  1R4N B;  4IHV A;  1UHM A;  3QYF A;  2R7F A;  1N78 A;  2BGC A;  5ICE A;  3E5Q A;  1G8X A;  4M3B A;  1BR1 A;  3ZOB A;  1V4R A;  4OMZ A;  3OY9 A;  2MC3 A;  3ESW B;  3HRU A;  1IC8 A;  1ETO A;  3IHU A;  3FM3 A;  4MLO A;  4BYY A;  3P9C A;  1U2W A;  1Y39 A;  1E3P A;  3IV5 A;  2W84 A;  2NS8 A;  2GXA A;  1YFH A;  4ESJ A;  2X0L A;  1J2X A;  2R7D A;  5B3S H;  5HS8 A;  1FBQ A;  3S8P A;  1Q1V A;  1VFC A;  3O2P E;  1X1B A;  3M9A A;  1RES A;  3NEU A;  2L5Q A;  1JJ6 C;  1XMA A;  2VB6 A;  4G8X A;  4UVA A;  5HS9 A;  4YIR X;  3OR2 C;  3OYB A;  3GFI A;  2FML A;  3CUQ C;  4XLN F;  1XX5 A;  3CP8 A;  4LFU A;  4XN3 A;  4FX4 A;  2STT A;  4YRV A;  3GTK J;  1MMG A;  3DPU A;  4W97 A;  1YTY A;  4XLA A;  3ZMU A;  3H1C A;  3CC2 I;  1LEB A;  2HZT A;  1LJ9 A;  3KFW X;  2OU2 A;  1R9T J;  3DKX A;  2IEK A;  1MDM B;  4RBO A;  4IEJ A;  1FY7 A;  5D8K B;  4BDY A;  2G7H A;  9ANT A;  2LY9 A;  2E5N A;  1BIB A;  3IH4 A;  3HL2 A;  1GXQ A;  1BR2 A;  3FX3 A;  2ZME C;  3QOP A;  2DOD A;  4BNC A;  2V6E A;  2BE5 F;  2CFX A;  2JK3 A;  3CCY A;  1HA8 A;  2WC2 A;  5ILS A;  3D5L A;  4C30 A;  3CO7 C;  2AXT C;  2CUE A;  4IO9 F;  2R7V A;  4HNT A;  3BPX A;  3TW6 A;  2M5W A;  3TQN A;  4PGG A;  2M87 A;  1PP7 U;  3K4N A;  3BC8 A;  2HNH A;  2WAD A;  3FXK A;  3D5S C;  2OUM A;  1DPR A;  2CV2 A;  4XLH A;  2OC6 A;  2CQK A;  2ID6 A;  2L7F P;  4CIC A;  3QOD A;  3AKZ A;  4G6D A;  2DW4 A;  2K02 A;  4MTE A;  4NUB A;  1QHH D;  3OS0 A;  2CV0 A;  3MVP A;  3R61 A;  4XLF A;  5FKK A;  1JI8 A;  4CCO A;  5J4V A;  2DPD A;  1DPU A;  2R7Q A;  5ICG A;  4OIR F;  1WJE A;  4GGG A;  4CDG A;  2AQE A;  1FSH A;  1WPK A;  4A3F J;  2M30 A;  3L9F A;  5F0F A;  4E6K G;  4CYD A;  1RI7 A;  2ZSH B;  3KLO A;  1E17 A;  4AID A;  1XSV A;  1YYV A;  3KEO A;  2HVR A;  4HRI A;  1QA6 A;  2DDB A;  2IGM A;  2RVC A;  1UAA A;  3GTJ J;  4JBA A;  3LST A;  1BIA A;  2DMQ A;  3CJR B;  3L2R A;  1BOA A;  3V4G A;  3I64 A;  1ZK8 A;  1SFX A;  5D4R A;  2OZ6 A;  2OD5 A;  2V7F A;  4GO1 A;  3R0A A;  4KDP A;  5CVR A;  1ETK A;  2ZME A;  4XK4 A;  1ZTR A;  5F64 A;  2DBB A;  1OQY A;  3WGG A;  2LRE A;  3I9V 2;  4PGH A;  3TW7 A;  1X58 A;  2JMW A;  4C3I J;  4BS9 A;  1KU7 A;  4IF4 A;  2IT0 A;  5FGM A;  3QP6 A;  3I71 A;  5JFR A;  3SXY A;  1U78 A;  4XR6 A;  2W00 A;  2GXB A;  1SVM A;  2NVX J;  1MJA A;  2RAE A;  2ICW G;  3K2A A;  3T0Y A;  2P6S A;  3KEY A;  2WTE A;  3BTL A;  4EMS A;  3BR1 A;  3AFH A;  3G1O A;  4P55 A;  2ZFW A;  1QVT A;  5D5X B;  3QOE A;  2IS6 A;  1IJW C;  1X2N A;  3CUO A;  4N9H A;  2GIZ A;  2RV8 A;  2PMU A;  2AHQ A;  2RQQ A;  2YU3 A;  4U0W A;  1U0J A;  2QVO A;  4TV7 A;  3C2G A;  1Z05 A;  3GVA A;  2A05 A;  1LVA A;  4LD5 A;  2TDX A;  1I5Z A;  4A93 J;  2E5Z A;  2IJL A;  1ETQ A;  2ZB9 A;  4IOC F;  2EV6 A;  2M0C A;  3DTI A;  3I58 A;  4RAY A;  4WXH A;  1B9M A;  1UG2 A;  1P2F A;  3B6A A;  4RGR A;  2E2I J;  4UUT A;  3CCU I;  1O3Q A;  1Q1H A;  2MBF A;  1Y1W J;  5E17 F;  4XM3 A;  2X4H A;  1OMI A;  4HDV A;  4HLX A;  1R5H A;  2FNP A;  2MLG A;  5KVR A;  5CVV A;  2HVS A;  2HOT A;  2V9V A;  4DYC A;  2I10 A;  2HXO A;  1I1S A;  1ORK A;  2OZU A;  3J81 Z;  3M07 A;  1CF7 B;  4IHW A;  1IUF A;  4HQM A;  1V5F A;  1LDD A;  3RQ4 A;  2R3S A;  2X1E A;  2Q0O A;  3A1Y A;  1JHH A;  3KP2 A;  1FT9 A;  4ZDL A;  3MKZ A;  2GA1 A;  2B0L A;  2DK5 A;  4CXF A;  4XRM A;  4JX4 A;  2R4G A;  5JVG F;  4C3J J;  2CRG A;  2F4O B;  3PSI A;  3KP5 A;  4NQW B;  2E1C A;  1FC3 A;  4WXD A;  1Y1V J;  2QUF A;  5EZG A;  1Z67 A;  3E6B A;  3MN2 A;  5IYD J;  2M7A A;  1POG A;  5CQG A;  1ONV A;  1IAW A;  3HYI A;  5JI6 A;  5HLG A;  1KZH A;  3VEP A;  3K4B A;  1XGN A;  4E7J A;  1JHF A;  2A69 F;  3S3O A;  1UHW A;  3ELK A;  4JX5 A;  3E6D A;  4M9S A;  1HQC A;  1OCZ H;  1J59 A;  2QQ8 A;  1IRZ A;  5JVT A;  4ZDP A;  5D5U B;  3M8J A;  1FOK A;  3ECO A;  2L9S A;  1MBF A;  4IRH A;  1WVR A;  2WBM A;  5GAH J;  5GPC A;  3FM5 A;  1UG0 A;  2LP0 A;  1YG2 A;  1HKQ A;  2X6W A;  3DP7 A;  1OYI A;  3ZMV A;  3OYI A;  5J6X A;  1U8B A;  4OIQ F;  1XGO A;  3GTO J;  4M9Z A;  3TDU C;  1UHS A;  3HHH A;  1BI1 A;  3RQI A;  3A01 A;  1FEX A;  3H36 A;  3ZQF A;  2VI6 A;  3WE3 A;  2BBY A;  3RDI A;  4ZDO A;  2XVC A;  3G71 I;  4HYE A;  1HC8 A;  2F4M B;  2F6C A;  4WWC A;  2P7V B;  4B43 A;  1A6I A;  5DCM B;  2FBI A;  1AHD P;  4C3H J;  4ASN A;  1K83 J;  4B47 A;  3ASN H;  2IAI A;  3M7G A;  5C4X J;  2VQG A;  5FD6 A;  1U5T A;  1MNM C;  2H27 A;  3WTX C;  1WKM A;  2E7W A;  3FBI B;  3Q0W A;  4OAY A;  1FJL A;  2XIG A;  3OYH A;  2NVY J;  3BZC A;  3LL7 A;  4M6Y A;  3QWL A;  1IV6 A;  2DOF A;  4CO8 A;  5FRN A;  1R49 A;  1HBX G;  2ZJR F;  3GF2 A;  2BHY A;  5DUK A;  3I55 I;  1J09 A;  4X1E A;  3ZQQ A;  3GTM J;  2XDV A;  1YIT I;  3HSE A;  4UHT A;  1T0F A;  3F8B A;  3LAJ A;  2FE3 A;  1J0R A;  3DLA A;  1ETX A;  3CDL A;  3P9I A;  3RYP A;  4YG2 F;  5LHI A;  4ITV A;  4F52 A;  1FWZ A;  1LDJ A;  2FSW A;  4FTH A;  4BU2 A;  1FYL A;  2V1N A;  4KIB A;  4ESB A;  4F7Z A;  1C0W A;  3H35 A;  2EZK A;  3FK7 A;  5CVU A;  1R22 A;  3K69 A;  5F04 A;  5A2Q K;  1HF0 A;  1ITY A;  4MQV A;  1HLV A;  3SZT A;  3H9Q A;  1GVD A;  4M3G A;  1E0E A;  3OYE A;  2XF7 A;  2HDD A;  1W7P A;  4DIQ A;  4BBS J;  2PJR A;  1SMT A;  4RAG A;  2IS4 A;  1JKQ C;  2X6Y A;  3F8M A;  5TJJ A;  4NC6 A;  4E7I A;  3F0C A;  1ZRC A;  1CQT A;  3ZQH A;  3I4P A;  3DBR B;  4HNU A;  1JKO C;  2KIM A;  2H6C A;  1Z1D A;  4OIP F;  1LPQ A;  3K4J A;  4J00 A;  1VZ0 A;  1TQP A;  4QTR A;  5CPR B;  3RI4 A;  4N0B A;  2IGN A;  3WTW C;  4XKV A;  1JKP C;  3GFM A;  4I2O A;  2EIN H;  1G6N A;  3IKT A;  1EF4 A;  2GLO A;  2F2E A;  3MZH A;  1UB9 A;  2GAU A;  4BY7 J;  3DWL E;  4L5I A;  3HOV J;  3H3U A;  2KRC A;  5L3F A;  1F4K A;  3S15 J;  3HM5 A;  2CQN A;  2WAQ A;  2IS2 A;  2DU9 A;  1KU9 A;  2A6E F;  3OYC A;  2R0Q C;  2LRD A;  5KHD A;  1Y8R B;  5CVJ A;  3JSP A;  3O6B B;  4NQW A;  2ZJ2 A;  1JJ8 C;  2KIF A;  2QGU A;  1IN8 A;  4I01 A;  5KK1 A;  2GQQ A;  3S1Q J;  3K70 C;  1WCM J;  1U5T C;  1MZB A;  3ABT A;  3PQJ A;  1X4O A;  2BW3 A;  2L02 A;  4EM0 B;  1TNS A;  4B09 A;  2FNA A;  4HNV A;  5GAD J;  1QGP A;  1R71 A;  4B44 A;  3BQY A;  2E1M C;  1K7A A;  3K1P A;  3C18 A;  4HX7 A;  3CMY A;  2KFD A;  3G3Z A;  3DPL C;  4P9U A;  3D5R C;  5FKM A;  2JA8 J;  4LJZ F;  4PFP A;  3E7L A;  3RPU A;  3AG3 H;  3ZGK A;  3HXL A;  5E20 A;  4AVP A;  1LB2 A;  1QBJ A;  1STZ A;  4A69 C;  2UWM A;  2YX4 A;  1E2X A;  3CCR I;  4HF0 A;  5EG0 B;  1SFK A;  3JRG A;  1Z6R A;  5K7Z A;  2Z3Y A;  1G3T A;  4GFB A;  3CF2 A;  3KP3 A;  3F72 A;  1P7J A;  2IW5 A;  2ZFU A;  2KZV A;  3RSN A;  3H3Z A;  1G3S A;  2XV4 S;  5CJ9 A;  4D9J A;  4FQG A;  1G2H A;  1VQ5 I;  2PI0 A;  2JUG A;  2M4K A;  3AG4 H;  4OMY A;  1BI3 A;  4HOB A;  2E60 A;  2V1X A;  1FOY A;  2JVG A;  3A03 A;  4JX6 A;  1TTY A;  4KN4 X;  4N4N B;  5M5Y J;  1QNT A;  3CUQ A;  2O61 A;  3SZP A;  2P0W A;  4RB2 C;  1LFB A;  5J1Y A;  2QF7 A;  1MW7 A;  2LF8 A;  3O3K A;  1D1C A;  1IGN A;  1RR8 C;  5J1U A;  2HKO A;  2BEO A;  2M8E A;  4HZF A;  4BJT A;  2R7Z J;  2MC4 A;  4FX0 A;  2E1M B;  2YUS A;  5KAF C;  4A3G J;  2A68 F;  3KP7 A;  2DOE A;  2EZI A;  4AWX B;  2K9M A;  1OR7 C;  5L3E A;  3WU0 A;  1YHQ I;  2MH9 A;  4MGR A;  2V1D A;  3DBH B;  5E3M A;  3OS1 A;  2XRO A;  3M8F A;  1IN4 A;  4OOI A;  4I6Z A;  1F1Z A;  1OJL A;  2DYR H;  3OSF A;  2LY1 A;  5H6R A;  4F55 A;  2X85 A;  3A0H C;  1OCC H; 
#chains in the Genus database with same CATH homology
 4RLF A;  3H9G A;  4R79 A;  2R7W A;  1LDK B;  4BE0 A;  4MLO A;  2XF5 A;  2CV1 A;  2BW3 B;  4YEJ A;  3VSL A;  1ZEL A;  1DGR M;  2CMP A;  3ZXS A;  2R7U A;  1V5G A;  3ONQ A;  4DBQ A;  2ZXI A;  3K4M A;  4RMN A;  3OWT A;  4RLQ A;  1UEL B;  1K6Y A;  4FAS D;  3K4L A;  3S8P A;  1X1B A;  2HPI A;  2Z1D A;  3OYM A;  2HU9 A;  4XOT A;  1DGW Y;  2K3P A;  2L5Q A;  2VB6 A;  3W2V A;  4BQO A;  3VWB A;  3OYB A;  3OR2 C;  3W2W A;  1SAU A;  2WA0 A;  3C2H A;  3DQV C;  2IGO A;  1DQU A;  3SEZ A;  3CP8 A;  3EUK L;  3NWS A;  4XN3 A;  1D0Z A;  4YRV A;  1MMG A;  3DPU A;  4XLA A;  5FRM A;  1X1A A;  2CUJ A;  1D0Y A;  4H4K C;  4IZZ A;  3DKX A;  4B48 A;  4DJA A;  1DP3 A;  5CKT A;  3DU5 A;  2VQC A;  2Z16 A;  2L2O A;  2XAU A;  3S3N A;  3H9J A;  3OYN A;  3BCA A;  2WAE A;  2DOA A;  4CA0 A;  2LC2 A;  4BDY A;  3DPT A;  2XSJ C;  3SZG A;  3HG9 A;  3L2W A;  2WAF A;  1Z7L A;  2E5N A;  1PJR A;  3HL2 A;  4BL0 B;  1BR2 A;  3FKJ A;  3VYT B;  2V6E A;  2BVM A;  1HA8 A;  3D5L A;  4C30 A;  3L2U A;  3K4K A;  2VIX A;  2R7V A;  4HNT A;  4XNF A;  3S3M A;  3K4N A;  3BC8 A;  4P1W A;  3QYB A;  2VJ5 A;  2HNH A;  1S9H A;  2WAD A;  3F9K A;  3D5S C;  2K5C A;  2OUM A;  2CV2 A;  4XLH A;  2OC6 A;  4QPQ A;  4BDZ A;  4BGD A;  3QOD A;  3AKZ A;  3OMY A;  2W4S A;  1QHH D;  2HVQ A;  4NUB A;  4DBR A;  3OS0 A;  2W7N A;  2CV0 A;  4XLF A;  2IXS A;  1JI8 A;  4CCO A;  4YEL A;  4E4H A;  2R7Q A;  3DU6 A;  2Z2S B;  1WJE A;  2AQE A;  2CW8 A;  4BQQ A;  4E6K G;  4PSW A;  1YX3 A;  3OYD A;  3OYJ A;  2ZSH B;  1T95 A;  3LSG A;  2HVR A;  4HRI A;  5TGT A;  2IGM A;  3PL8 A;  3PNT A;  4PFO A;  3OYG A;  1UAA A;  1N77 A;  2DT6 A;  4II2 A;  3VYU B;  3CJR B;  4F92 B;  3L2R A;  4C2U A;  5LD2 C;  2LYC A;  2LY2 A;  4IQ4 A;  2KDO A;  3TMO A;  3IUO A;  2V7F A;  2V9K A;  3L2Q A;  2MFZ A;  2NOJ B;  4E7H A;  4PSX A;  4AVZ A;  1ERD A;  4E7S A;  1R6R A;  2LRE A;  3I9V 2;  4AYB A;  4BS9 A;  3RCO A;  3V42 A;  2MAB A;  4LIT A;  2QKM B;  1D0X A;  2CUZ A;  2I8D A;  4XR6 A;  2W00 A;  2K9L A;  4ZC3 A;  3K10 A;  3QYE A;  4XON A;  1LVK A;  4KJZ A;  1Z3X A;  3KEY A;  1NG6 A;  3AFH A;  3LSH A;  3VYS B;  2CFO A;  1Y56 A;  3QOE A;  4CCK A;  4CCM A;  4U7B A;  2VPL A;  2IS6 A;  4BEH A;  2RQQ A;  4KIS A;  1U0J A;  4PJJ A;  3J7A Y;  2Y0S A;  3LSM A;  3C2G A;  4II3 A;  4XKB A;  2XC7 A;  3FBN B;  2E5Z A;  2X1C A;  4XKW A;  3DTI A;  3PSF A;  2IGK A;  4CCN A;  2DJI A;  3K6G A;  3DEE A;  3OL4 A;  4OWR B;  3LSK A;  4NNJ A;  2WB1 A;  2VAS A;  4Y33 A;  5HLT A;  2HPM A;  4AU7 A;  2R7T A;  2WY8 Q;  3TL4 X;  1P9Q C;  4XM3 A;  1NG7 A;  2VKH A;  1TZL A;  2X6X A;  3BLY A;  2HVS A;  1X1C A;  3VDX A;  1W36 C;  4P5O A;  4Y4R A;  3TBI A;  4RM2 A;  2BOL A;  4RM3 A;  4XMY A;  1N75 A;  2KHM A;  2VQL A;  1V5F A;  3OIP A;  3RQ4 A;  4KIT B;  2X1E A;  3H0D A;  3A1Y A;  4PJN A;  4ZDL A;  3MKZ A;  4J01 A;  1YX5 A;  1BR4 A;  1WJA A;  3I3L A;  1MMD A;  3IAM 2;  3NWT A;  2R4G A;  1QU3 A;  4NQW B;  3PSI A;  1WJC A;  2RNG A;  3BG7 A;  2L9N A;  3ZCO A;  4E7L A;  4DGW B;  2DT7 B;  3LFU A;  2M7A A;  2CW7 A;  2ELJ A;  3DTE A;  4XOR A;  5CQG A;  3KYL A;  4F91 B;  2M3A A;  3K4B A;  4DOZ A;  3VYR B;  4HSR A;  4E7J A;  3S3O A;  1T0F C;  4BXF A;  1LFP A;  3HC7 A;  2PMZ A;  2FUG 2;  2W1O A;  3UR3 C;  4HST A;  4ZDP A;  3M8J A;  2L9S A;  2WBM A;  2CS3 A;  4LIU A;  3H5R A;  1W36 D;  1MNE A;  3A4C A;  4BEH B;  1UG0 A;  1QHG A;  2X6W A;  3ZRG A;  3OYI A;  4BJ6 C;  3A2K A;  3OOU A;  4BAC A;  1Y6I A;  4OAZ A;  4IKF A;  4ANJ A;  4C2T A;  2Q1Z B;  2LBF A;  4CUG A;  4ZDO A;  3RTR A;  3PFY A;  4ZJZ A;  2F6C A;  2KPM A;  1V5E A;  4IQJ A;  4B43 A;  2KQR A;  1X19 A;  3OYA A;  4FET A;  4B47 A;  5LFA A;  4IX7 A;  3OYF A;  2VQG A;  3FBI B;  4OAY A;  3MD2 A;  2VXZ A;  3EPZ A;  4PJM A;  4XQF A;  3IP4 B;  2IS1 A;  3OYH A;  3MKW B;  3LL7 A;  1FMV A;  3KX2 A;  3K70 D;  5FRN A;  2R7O A;  3PJR A;  3CES A;  1J09 A;  4PK4 A;  3ZQQ A;  2XDV A;  3U21 A;  3SDB A;  3S32 A;  3DLA A;  4ITV A;  4F52 A;  3E1S A;  1MMA A;  4ZTF A;  3OL3 A;  4BU2 A;  4F93 B;  2V1N A;  2MYS A;  3PUB A;  1PYV A;  3H35 A;  4CCL A;  4LIV A;  1WJB A;  4QPO A;  3H5A A;  4ZTJ A;  3H9Q A;  1E0E A;  3OYE A;  2XF7 A;  2VJ4 A;  1YE9 A;  3ZR8 X;  4DIQ A;  2PJR A;  2IS4 A;  3SEQ A;  4C9Y A;  2HZD A;  2X6Y A;  2JA2 A;  3MMY B;  4E7I A;  3E0J B;  3HOT A;  4XLE A;  2HDW A;  4E7Z A;  4HNU A;  1X1D A;  3HPH A;  4EAT A;  4KT6 A;  2PJR B;  3DKY A;  4X0G A;  2KL4 A;  2M0M A;  3H5N A;  2O5R A;  2KP6 A;  4BE2 A;  3K4J A;  4NC8 A;  4J00 A;  4HG2 A;  3FHN A;  1VZ0 A;  4CSW A;  1Z21 A;  3CJQ B;  3CMM A;  5CPR B;  3AL0 B;  2IGN A;  4XKV A;  3HKZ A;  4NC7 A;  4U87 A;  1AA7 A;  3OS2 A;  2X1D A;  3N05 A;  1MND A;  3EUH C;  3DWL E;  5KNL A;  5HVQ C;  2KRC A;  2OV7 A;  1D1B A;  3EUA A;  4PJL A;  3GBG A;  2HQA A;  3PNV A;  3BG6 A;  2WAQ A;  2IS2 A;  4BE1 A;  4E7K A;  4B3X A;  1Z3Y A;  3OYC A;  2DXI A;  2UV1 A;  2MD0 A;  4BUP A;  2JVH A;  2LRD A;  3OR1 C;  4JOM A;  3W3C A;  5KHD A;  3RPU D;  4Y3O A;  1TT0 A;  2Q2E B;  3FDY A;  1KON A;  3LMM A;  3M1C A;  3HOS A;  2LOO A;  2WY7 Q;  2VLA A;  5HNF A;  1D1A A;  4GRI A;  3K70 C;  3OIQ A;  4XKC A;  2F5V A;  1X4O A;  4XOP A;  2BW3 A;  2DCE A;  2QKL B;  2UUZ A;  3BCB A;  2W82 A;  3UNG C;  1MMN A;  5CQE A;  2R7R A;  4XL9 A;  4B44 A;  4BQN A;  2E1M C;  2BVL A;  1FMW A;  3DPL C;  3D5R C;  2GOX B;  1EA3 A;  2JSP A;  3HUG B;  4PFP A;  2RRE A;  3HPG A;  3DTK A;  2KMU A;  3ZGK A;  3HXL A;  1GLN A;  1OLT A;  2UWM A;  3PNY A;  3K4C A;  4D1Q A;  2XF6 A;  3MKY B;  2VL8 A;  3OYL A;  1SFK A;  1WFX A;  2M7B A;  2VJJ A;  3L2V A;  1LKX A;  2KLO A;  1WJD A;  3G2B A;  3CF2 A;  1G59 A;  2ZFU A;  3S93 A;  2R7X A;  2KZV A;  2L7K A;  3RSN A;  4N4O B;  2V26 A;  5FRO A;  2LG4 A;  4D9J A;  2KRH A;  2X51 A;  2GOM A;  1IRX A;  2JUG A;  3SYT A;  2M4K A;  2E60 A;  4BJ5 C;  2VKD A;  3IAS 2;  2JVG A;  4G6T B;  2R7S A;  2F4I A;  4N4N B;  1WJ5 A;  4XLC A;  4CCJ A;  4PUS A;  4HEA 2;  2P0W A;  3AL0 C;  3CP2 A;  1WJF A;  1X4P A;  1MW7 A;  2CH0 A;  1D1C A;  2VQH A;  2VJI A;  3W2A A;  2AQF A;  4BJT A;  3CZ6 A;  4F3Q A;  2A5W A;  4LG3 A;  2MC4 A;  4CH7 A;  2E1M B;  1BOB A;  2M4G A;  4XN0 A;  2LBF B;  4HPQ A;  5KCM A;  4ZYA A;  2K9M A;  1OR7 C;  5JHF A;  2A6T A;  2LH9 A;  2VXD A;  3OYK A;  2ZSI B;  4CZC A;  3QYF A;  2ZXH A;  5HNH A;  3OS1 A;  1N78 A;  4JQF A;  5HOO A;  2LY1 A;  3LSI A;  4F55 A;  2X85 A;  3VSK A;  1G8X A;  1BR1 A;  2V4J C;  3OY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...