4DZPA

Crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFAWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dzpA01
3S1NJ 4CYCB 5HODA 3SFIA 5E3LA 2LP0A 2DA3A 1GVDA 4IHXA 4A3KJ 3HDDA 3S2HJ 5F27A 2KDZA 3HOWJ 2R92J 2CQXA 2OPTA 2N8GA 3OIOA 2ELKA 2LD5A 2DMTA 4UUSA 2MG4A 2NOGA 3JRBA 1JGGA 1WI3A 4A3CJ 4M3BA 5EGOA 4L5EA 2IEKA 5E3OA 2XB5A 2Y0SN 2YUSA 3TP3A 3W6VA 4XRSG 1MH4A 3MKLA 1B72B 2ECCA 1IJWC 2G0EA 1VFCA 5J3LA 3TW7A 1UG2A 4HNVA 2FX0A 2CJJA 1IUFA 1MSEC 1TWAJ 2LLKA 4LOCA 1OJLA 1I50J 4UUTA 3IH2A 5J1YA 1F36A 3OSGA 1ZR4A 3G1LA 2R5ZA 4ABZA 2L7ZA 3NAUA 5E3NA 3FISA 5EZGA 1Z77A 4B3AA 1MBGA 2DA2A 5FLVA 2AO9A 5F0HA 3HGYA 4W97A 4M3EA 4X6AJ 1HLVA 1Q1VA 3K2AA 3RKQA 3WHCA 3SDGA 2YS9A 4M6VA 1U9NA 3HOZJ 1XG1A 4DYQA 1U9OA 5FKLA 3LSRA 2DA7A 1POGA 3CDLA 3JREA 2X6OA 2ID3A 3S17J 4UUSB 1RR7A 1IGNA 1SANA 2HOTA 1H89C 3I4MJ 5EGOB 5FJ8J 1R9TJ 1HOMA 4A3FJ 3QPSA 2ME0A 9ANTA 1FIAA 1E3OC 2JWTA 2JJ7A 3LOCA 1Z0XA 4DZPA 4QSHA 2NVQJ 1GV5A 4FCYA 3HM5A 3BTIA 1RKTA 2GBYA 3M4OJ 3I4NJ 1IDYA 1ETXA 2CUEA 1FTTA 3G1OA 1NK2P 3HBLA 4MO7A 3GTGJ 2HDDA 1T33A 1JKPC 2CU7A 2P81A 2OF7A 2ZB9A 2CRGA 5J1RA 2HXIA 2R5ZB 3UKGA 4BBSJ 1QVTA 2O9LA 4C3JJ 1MNMC 1LFUP 4DW6A 5IYCJ 1BW5A 1ETYA 1IRZA 3S1QJ 3LSJA 1U78A 3NARA 3G1MA 3M3YJ 5E3MA 1JT6A 2NVXJ 1ETVA 2HYJA 1A5JA 2L7MP 4AC0A 2QF7A 1QVUA 4XK4A 2DA1A 3BG9A 3BG3A 3JRAA 4BY7J 1TWGJ 1JUPA 4A3IJ 3CMYA 2PMZN 5GPCA 3GBGA 1YRNB 3MVPA 1JJ8C 1OCTC 5JLWA 2MSYA 1XC5A 2JK3A 1WH5A 2QCOA 2XPVA 1JT0A 2K40A 2E19A 4D7MA 1D5YA 3JRDA 1HDPA 3FK6A 1HCRA 3TEDA 3CCYA 5EG0B 5K7ZA 1U8BA 2DA5A 2DMUA 2DJNA 2COBA 2EZKA 2M8GX 4A3JJ 3S16J 2MGQA 3BR1A 4XIDA 3Q0VA 3HKZN 2K9NA 4D7NA 4IHVA 3ZQGA 2M0CA 3TW6A 1UHSA 4V2FA 4C3HJ 1BA5A 2CUFA 5F0FA 4A3DJ 3BTCA 1MBFA 1T56A 3DEWA 1ZQ3P 2XSDC 1JUSA 2FD5A 2NS7A 4DZJA 3GTKJ 1K83J 1LFBA 1MBHA 1IC8A 5IP6A 3B6CA 3QQAA 5M5WJ 5M3FJ 3BR3A 2JA8J 1ITYA 3OSFA 4IHYA 1AKHB 5IP9J 2L0KA 3K7AJ 3ZQFA 1Y1WJ 1FJLA 2DA4A 3FKIJ 2XPWA 1X2NA 3Q3SA 1ORKA 3BQZA 4JYKA 2LVSA 1X58A 1QPIA 2LK2A 2Y31A 4A93J 4JP0A 2XB0X 4RBOA 2Y9ZA 2IBDA 5EYRA 1ETQA 3BR5A 1G2HA 1TWHJ 3VPRA 1NK3P 1AHDP 3BQYA 2TRTA 1F43A 2DMNA 4XRSA 2E1OA 5EZHA 3BG5A 2KT0A 2EQRA 2Y2ZA 4W1UA 5C44J 3GTJJ 3RQIA 2L9RA 5C3EJ 5M5XJ 2M2EA 1FTZA 4IEJA 1BJZA 1X2MA 1I6HJ 3S2DJ 3BR2A 1A6IA 1RPWA 3JR9A 1AU7A 1BW6A 4D5FA 1ETKA 4A3GJ 3A02A 1ZK8A 2K9SA 2DTZA 3FK7A 5EEAA 1HDDC 1LE8A 4FE7A 3GTQJ 1WH7A 1NTCA 3ZQCA 2JA6J 3ZQLA 2GLOA 3OOUA 1CQTA 2R93J 1XS9A 2LFBA 4C3IJ 4XRMA 2EH3A 5J1UA 2CQQA 4A3EJ 3CQZJ 1GV2A 2FQ4A 5C4JJ 2JA7J 3IV5A 1ETOA 2HQ5A 5JLXA 5IYDJ 1P7IA 4FTHA 5IYBJ 2ID6A 3C2BA 1TC3C 3WHBA 3LSGA 4A3MJ 3HOUJ 1RKWA 2JN6A 3LSPA 3L1PA 1MBJA 3S14J 1DU6A 2VKVA 3GTLJ 1APLC 1DU0A 4M3FA 3S1MJ 5IOZA 3IH4A 2L7FP 2E2IJ 2O7OA 5EDNA 5FKMA 5IOYA 1MBKA 2IAIA 3B6AA 3O8GA 2LR8A 3DCFA 1SFOJ 2HOAA 3JRCA 2XGCA 1TWFJ 4S0HB 3JRIA 5M5YJ 2DN0A 2WV1A 4BBRJ 4QTRA 1H8AC 2ME6A 5FKKA 1JUMA 5F08A 1WPKA 3E7LA 1LE8B 3PO2J 1GT0C 3HGGA 2ECBA 4A69C 1S7EA 4Y52J 1ZTRA 4B4CA 1JKOC 1GDTA 1JTYA 2H8RA 4BY1J 3QPLA 4G12A 1JKRC 2VI6A 2O8KA 4IHWA 5EF6A 2X48A 2LY9A 3JRFA 3SJMA 1QRYA 3Q0UA 3PO3J 3Q0WA 4GFBA 2E2JJ 2K9QA 5K7FA 4JX6A 4C2MJ 3ZQIA 2H1KA 2D5VA 1ZGWA 3HOVJ 5DS9A 4M3DA 2M34A 4D5CA 3BT9A 4JX4A 1UMQA 1VF9A 1PUFA 1JJ6C 3RZOJ 3LNQA 1W0TA 3JRHA 4BXXJ 3IH3A 3ZQHA 3GTOJ 1MH3A 2NVYJ 2VUMJ 2JA5J 3PM1A 2WAQN 1I3QJ 3GTMJ 2HI3A 2EZIA 2VKEA 5IP7J 3FIWA 1HF0A 1VNDA 5C4XJ 2VPRA 2WB1N 1WGXA 1FIPA 3JRGA 4XICA 3O8HA 5M3MJ 2EBIA 3BTLA 1W0UA 3GTPJ 2EZHA 3BR6A 2M9HA 2MW8A 3BTJA 4NDLA 5F1JA 2E2HJ 4JX5A 1ETWA 2HXOA 5GP9A 1BL0A 2NS8A 3S1RJ 4I76A 4MFEA 5IPAA 3H3VK 5DTDA 5K7HA 3TP0A 4MLOA 4RDUA 3A01A 3F0CA 1B8IA 1OCPA 1Y1VJ 3D1NI 2R5YA 3RZDJ 5GPAA 3BR0A 2FJ1A 2NVTJ 4MFDA 1ZR2A 4DYCA 1YRNA 4Y7NJ 2R0QC 1VI0A 4CYCA 4J19A 4FE4A 2LTPA 2DA6A 2Y30A 1IV6A 1MBEA 3HOXJ 5F04A 1H88C 1PUFB 5FLMJ 2RAEA 2AHQA 2B63J 2XPUA 4DYRA 1ZKGA 5EG0A 2XGDA 1OFCX 1JKQC 4AUXA 1JTXA 1IDZA 3A03A 2TCTA 1IG7A 3MN2A 1FEXA 2I10A 4MIMA 2LKXA 3ZOBA 2XGEA 1O4XA 3S15J 4BKXA 1WCMJ 4A3LJ 2X9DA 3H0GJ 4X1EA 1B72A 2DMPA 4FISA 5F0CA 1K61A 2JMWA 3HB9A 5FKOA 5FKNA 1ENHA 2HOSA 3HOYJ 4AYBN 4QIWN 4A3BJ 2YU9J 4EEFG 1EF4A 1RETA 2EZLA 2W48A 3A01B 1P7JA 1AKHA 2R7ZJ 4B1RA 1B8IB 1RESA 5BNGA 1GUUA 2GM4A 2R5YB 1MSFC 1TWCJ 2XRLA 4M3GA 2DMQA 3HEFA 4V2GA 2Y9YA 4I6ZA
chains in the Genus database with same CATH superfamily
5E3LA 1KA8A 2OZ6A 2KIQA 4YELA 4IHXA 2GIZA 2HEOA 3BWGA 4UHTA 4E4HA 2WAFA 1J7KA 2CWEA 2LBFB 3S2HJ 4XKVA 3VYRB 2R92J 3K1NA 2OPTA 3TL4X 3MKYB 4HLXA 4NC7A 3JAMK 2O3FA 1TP4A 2NOGA 2K9MA 3PUBA 5EGOA 4ENKA 1FOWA 1HW1A 1FBSA 4HSRA 1B9NA 2V1UA 3RI4A 3ML6A 2DQRA 1MH4A 4XRSG 2KJCA 4RLFA 3GX4X 1B72B 4LLGF 2K86A 4A12A 4ZDLA 3L09A 1VFCA 4QWQA 3EETA 2FX0A 2HVQA 3RJPA 3CP8A 4B47A 4BE0A 1X1DA 1TWAJ 3W6JB 5D5XB 1OJLA 4DGWB 1YS7A 3BZ6A 1G59A 3QU6A 4Y13A 2WC2A 1O3QA 4PFOA 1V3FA 4G9YA 1PP8F 3RDIA 2ZXJA 3LA7A 4IO9F 3W3CA 2VQLA 4F93B 2VBZA 3QODA 3F8CA 4B3AA 3GMEA 2Q0OA 2ZJ2A 3SXYA 4OWRB 1ZREA 4Q48A 1T0FC 4BJTA 3R60A 4KDPA 1EV7A 2XAGA 3IKVA 1Q1VA 2EV5A 2D1HA 3WHCA 1HW2A 4L9JA 2Y69H 1K6OA 2LSOA 1U9NA 4XONA 5JI6A 2VIXA 2VODA 2FBHA 2DAOA 4YIIA 5FKLA 4ASNA 4AVPA 1I5ZA 1SANA 1R9TJ 6PAXA 3WG7H 4N4NB 2JUGA 2KKOA 3DU6A 4A3FJ 2MH2A 2OCCH 3KZYA 5A2QZ 1B9MA 2YX7A 1U2WA 2NVQJ 2VE9A 4EJWA 2DFHA 3HM5A 4ZYHA 1TNSA 1LJ9A 2QBYA 1O57A 3MKZA 3G1OA 4FASD 4HW0A 1FTTA 1OYWA 2NNNA 3UR3C 3RPUD 1YLFA 3ZRGA 3I55I 1EKEA 1NK2P 5D4RA 2GWRA 3HBLA 2HDDA 1T33A 3M8JA 2HWVA 2P81A 2OF7A 5J1RA 4KICA 2E35A 1CF7B 4ZJZA 1AOYA 1ON1A 5J6XA 5KHDA 4M72A 1OKRA 2EILH 1D5VA 1XGSA 3I53A 4A0XA 4ANJA 4EJOA 2H8WA 1BR2A 1QO0D 5FROA 2NVXJ 2HYJA 5FD5A 5BMZA 4H4KC 2BV6A 2ZFWA 4EQQA 2B7EA 3TQNA 2DA1A 3BG3A 2QGUA 3OOPA 3QOEA 4BY7J 1HA8A 2QQ9A 3OIQA 5GPCA 4RAYA 2GXGA 3QAHA 2MSYA 1XC5A 2XF6A 3BPVA 2CUJA 1R00A 2QCOA 1JT0A 4J00A 2W1OA 3AG3H 1D5YA 2BY1A 1WJBA 3F21A 1HDPA 3FK6A 4RAFA 2XKOA 2ZJRF 1NG7A 4X0GA 5CVVA 4II3A 4O5VA 2VLAA 3CC4I 5K7ZA 2CW8A 2R7OA 4RB1A 4PGHA 4RLQA 3MZHA 2W84A 2EZKA 4XSZF 2IS4A 3S16J 1SMYF 3HKZN 3I54A 4IHVA 2ZNZA 1R1UA 3BPXA 2M0CA 2M30A 2VQHA 3QP6A 2H1LA 3L7WA 4HYEA 4XM3A 4C3HJ 3J7YJ 1ZRCA 1BA5A 2XGXA 3J7ZI 5F0FA 3K1PA 3DEWA 1G3WA 3HXLA 4DZJA 5ICCA 1QBJA 1LFBA 3DP7A 4LJZF 3B6CA 3KETA 3FHNA 1R22A 5KAIC 3HG9A 2DJIA 1JGSA 2JA8J 3KZZA 1OQYA 2YR2A 5E1XA 2G7UA 2Y0MA 4HDUA 3OSFA 2GXAA 2ZJPF 1BR4A 3K2ZA 4C2TA 3JSPA 2DA4A 2EIKH 2XPWA 3Q3SA 2HNHA 2R7VA 1ORKA 3DU5A 3BQZA 3C1DA 5HNHA 2R7QA 3O6BB 5CPRB 3HIFA 4U87A 2MC3A 1OCZH 1ETQA 5EYRA 2BVMA 4XLHA 1VQ7I 3DXJF 2HGCA 1X4PA 3A0BC 4XKCA 3OYKA 5FLXK 1AHDP 2F5EA 2BXZA 3BQYA 2KIMA 1USTA 4YG2F 2IVMA 3DTEA 3BG5A 2Y2ZA 3ZPLA 5C44J 4GCVA 1UZCA 2W4SA 3RQIA 2L9RA 3HKZA 2BY0A 1OYYA 3JAMZ 4YIRX 3S3MA 1I6HJ 1T2KA 4PJNA 3T0YA 1WHUA 4UB8C 2D1VA 1RPWA 3JR9A 1AU7A 3KP2A 1ETKA 1Z91A 4A3GJ 3DLAA 2M7BA 4CCLA 3OIPA 2KIUA 3WU2C 1WFXA 1ZARA 4KITB 1KU9A 3ZQCA 2XRNA 3KCCA 2JA6J 3M1CA 4U0VA 2BBYA 1W36C 2GLOA 3KYCB 2NVUB 3I4PA 2D45A 4L0YB 3P9KA 5IT3A 1MMSA 3ZQQA 5FO5A 4ENJA 3PUFA 5J40A 4A3EJ 4D1QA 3H36A 4EM1A 5C4JJ 3U21A 5IYDJ 1P7IA 5IYBJ 2ID6A 2K27A 3C2BA 3T1BA 4N9IA 4J01A 4A3MJ 2R4GA 1RKWA 2CGPA 2NXNB 3L1PA 3MFKA 2EV6A 1MBJA 3I5UA 3S14J 1N25A 2GOXB 3HUGA 1GVJA 3FXLA 2WB1A 4K2EA 2HOEA 2X6XA 3DBLB 3FBIB 1NH3A 4IF4A 2QEXI 1XMKA 2HS5A 3S1MJ 3MAJA 5EDNA 3K4KA 1XSXA 3RCOA 3B6AA 4ENMA 4CHUA 2LR8A 1SFOJ 5TJJA 2CO5A 1MNDA 2XGCA 4JOMA 1TWFJ 1G4DA 2BY2A 2VJJA 1K78A 2XVCA 2RVCA 3C18A 4ESJA 5E1WA 4JBAA 3JSOA 2A6HF 3PQJA 1XD7A 2QKLB 2JSPA 1Z3XA 2V1DA 2WTEA 3I59B 5CKTA 1GT0C 4M9XA 2OQGA 5K5QA 3F72A 5F64A 1ZG3A 1O3RA 4XBFA 2VXDA 1YE9A 3HPHA 3MQ0A 4BE2A 1SD5A 2ADUA 3SEZA 1P92A 4BE1A 2H8RA 4XKWA 2W57A 3J7AY 3EYIA 4XOTA 3HRMA 4M74A 3HYIA 3FBNB 1E3HA 3KX2A 1C0WA 1OYIA 2E60A 3L2QA 5FB2A 1QRYA 1IXRC 3Q0UA 2XSJC 3Q0WA 3KP3A 4GFBA 3BG6A 3PNVA 4JX6A 3OS2A 1MDMA 3ZQIA 4Q5SF 2YX4A 4N0BA 1S9HA 4XLFA 2K02A 1JI8A 3TBIA 2M34A 3BT9A 5CVJA 1X19A 2MA3A 3KZIC 2XAJA 5E79C 1YOVB 2F5DA 5FRNA 4Y3OA 3GTOJ 1MH3A 1UHMA 3IWFA 4IKFA 4ZYAA 4Y33A 2WAQN 3OR1C 3GTMJ 3FIWA 1HF0A 3MWMA 5D4SA 5B66C 2QSGX 2BW3A 2RNJA 3JRGA 3WTZA 4XICA 3D5LA 2QENA 2EBIA 3BTLA 3F6OA 4LG0B 5JHFA 1U8RA 1WVRA 3L00A 3MCZA 3SEQA 2MC4A 5F1JA 1BL0A 2KDOA 4CH7A 3HHGA 3GFJA 3WU1B 1SVMA 3LA3A 5EEHA 2JUCA 2DO7A 4MFEA 3RPUA 3TP0A 2E7XA 3ABMH 3H5AA 4YFNF 2QWWA 3K4CA 2FBIA 4G94A 3I58A 1B8IA 2IT0A 2UUZA 2ZSHB 3D1NI 5GPAA 4OMZA 2V7FA 1A31A 3DBHB 4JQFA 2BEOA 2NVTJ 4DYCA 2DPUA 1V5EA 2PFBA 2EA4A 2K9LA 5E20A 4OAZA 3RSNA 3H9GA 3GWZA 4J19A 3WU0A 4A5NA 2XAQA 1GXPA 1TLHB 1V55H 5LFAA 1IV6A 2GA2A 2QLZA 3N4MA 1IV8A 4P9UA 4BQQA 3RKYA 2IS2A 4E7KA 1Z67A 2J5PA 2RAEA 1SVOA 2AHQA 4LK0F 3EUAA 1PUFB 2F5FA 2B63J 4DYRA 5EG0A 3ASNH 4AUXA 1MNEA 2WAQA 3LMMA 2TCTA 2CSOA 4YRVA 1FEXA 4FT8A 4MIMA 2LYCA 3S15J 1J75A 4PJ0C 5ICFA 1S72I 4A3LJ 2DI3A 2JRTA 4ZYGA 5D6EA 4CGZA 3H0GJ 4X1EA 1R49A 4OU0A 4XR6A 3CCVI 3P7NA 4D0PA 2DQLA 1T39A 2RC4A 5FLXZ 2JMWA 5FKOA 3I56I 2PJPA 4IHTA 4AYBN 4HA8A 1YW7A 2R7DA 1QA6A 4HF0A 2P6TA 4P55A 3JCUC 1X3ZB 2DLLA 2LKSA 1I1SA 3IRQA 2STTA 2R7ZJ 4XLPF 1RESA 3REOA 5BNGA 3A0HC 1V5GA 2Z33A 1KQ0A 1VQ9I 5BS6A 2KLOA 1TWCJ 2XRLA 3LSMA 1DPRA 4S04A 3HEFA 4KIFA 4V2GA 4I6ZA 2FQ3A 4MGRA 3E6CC 1XMXA 2W25A 1GVDA 4NNJA 3G73A 2EIMH 4A3KJ 2A07F 2CFOA 1XGMA 3HOWJ 2CQXA 4HG2A 2N8GA 1R5GA 2VT2A 1Z3YA 4FX0A 4KMUX 1SD6A 2DMTA 3FM5A 4UUSA 2H27A 1W7PB 1WI3A 2MBFA 2E7WA 5DM6F 3DKYA 1PVEA 1YFHA 1TQPA 5A2QK 5E3OA 2DYSH 1MJ9A 2LC2A 4RGUA 4RAZA 1VQMI 2RDPA 1IJWC 2G0EA 2VQGA 1UG2A 2OTLI 1IUFA 2ZXWH 4F3QA 3F8MA 1ZAOA 4AYBA 2A5YB 3WTWC 1Z21A 3E97A 1MSEC 4HRIA 4AIJA 4XOPA 3ZGKA 3OYIA 4PZJA 2F5VA 4IJAA 5J8CA 1LQ1A 2TDXA 1OMIA 1ZR4A 3G1LA 1QZZA 5LHGA 2ZCWA 1Z6TA 3AL0B 2R5ZA 2L7ZA 3CDIA 2AQEA 5E3NA 3ESWB 1TQMA 5L3EA 5EZGA 3L2RA 1Z77A 4B43A 1YITI 2ELJA 2K4BA 5FLVA 5HVQC 5DUIA 4X6AJ 1BR1A 3EPZA 2PG4A 4XQFA 3PSIA 3RKQA 4AIHA 4CUGA 2YS9A 1FPQA 3GFIA 4ZTJA 1S3JA 2OAZA 4B48A 1E17A 1WZ2A 2HKXA 3CLOA 3LSRA 2DA7A 2V6CA 1E2XA 2ZMEB 3JREA 3K69A 1LUJB 1CGPA 2ISYA 1RR7A 1IGNA 5D8KB 1H89C 5EGOB 4B44A 4KFCA 1ODDA 3H35A 3S2WA 3WE2A 5DDGA 9ANTA 5BOXA 1FYKA 1R4NB 3CMAI 2JWTA 1E3OC 4U88A 5K1YA 1Z0XA 2KRHA 4DOZA 3ZR8X 4FCYA 2IGNA 5LD2C 3M4OJ 3I9V2 1IDYA 1J0RA 1BIAA 1J5YA 2G9WA 2UWMA 2MLKA 1ZRFA 4ZC3A 1MMDA 5BPDA 2LF7A 3R61A 2E34A 2P5KA 3RKXA 1ZN2A 4MO7A 4Q47A 4BBSJ 3HTUA 1BIBA 1LB2A 3B02A 3WTYC 1MNMC 1LFUP 4DW6A 2PQ8A 3QYEA 1BC8C 3CF2A 1ZELA 3K4LA 5L3DA 3DTKA 5IYCJ 1YW9A 2EWNA 4PJJA 3S1QJ 1UFMA 2CMPA 1W36D 1ZG1A 1X3UA 2DBBA 3NARA 3G1MA 5ILVA 1MMGA 1JT6A 3B73A 2DT5A 2OCEA 3H5RA 1XSVA 4ZH4F 1SFXA 4Z2YA 3ZMTA 1Z1DA 3TDZC 4BJ6C 2F4IA 2FBKA 5B1BH 3FXRA 4LG3A 3JRAA 1VQOI 2YU3A 2PMZN 5DYMA 2P5VA 3PL8A 4BQNA 1YRNB 5ILSA 4HV6A 2MFZA 5HS9A 1JJ8C 4QLCU 4NHJA 1V54H 2VN2A 1WH5A 2EK5A 2XPVA 2E19A 3WODF 4BEHA 4EJTA 3AL0C 2Z1DA 3JRDA 1HCRA 3ZMVA 2BZTA 4WXDA 4G6TB 3CCYA 1U8BA 3JW4A 2FUG2 2DJNA 3OMYA 3SFZA 3L9FA 2QBYB 3WG9A 3BR1A 2KZVA 3GZNB 5IT9K 4XIDA 2K9NA 4D9JA 1YO5C 3I3LA 1UHSA 2X6YA 4V2FA 5H6RA 4XL9A 4ESBA 3SZTA 4A3DJ 3BTCA 3H9JA 1TL8A 1T56A 1N75A 1F9NA 1ZQ3P 1Y56A 2XSDC 2FD5A 2ZMEC 3EUKL 1KZHA 2EJRA 4MEXF 1STZA 5IP6A 5HS8A 1IXSB 2DFIA 4G7ZF 1RUOA 3AFHA 2I5UA 3HTSB 3E3VA 2GZWA 5CJ9A 3GLXA 2FOKA 2IP2A 3CLQA 4M9SA 2XDVA 1LVKA 3ZCOA 4EGYA 1AKHB 4IHYA 1QZYA 4GRIA 5E8IA 1RI7A 2L0KA 3DPTA 3K7AJ 1RC9A 3ZQFA 4BNCA 2PMZA 3VYUB 1X2NA 2KRCA 5JFRA 3S3NA 4JYKA 1X58A 1VTNC 1QPIA 3FMRA 4A93J 2DYRH 4RBOA 5GAEJ 1OLTA 1XDSA 1T0FA 3V7CA 4IOAF 2DOEA 3E6DA 1NK3P 3H3UA 2TRTA 1IRFA 4XNFA 2KQRA 2A61A 3C2HA 2EQRA 1MJAA 3W2WA 4XKBA 2VT3A 2A3SA 4XLNF 5M5XJ 2DPDA 4O3MA 4GYIA 1X2MA 4NQWB 3FXKA 3M9AA 3S2DJ 3RQ4A 1HSJA 3V7SA 1U5TB 2A6EF 1FYMA 2HVSA 4E7IA 1D0ZA 2OC6A 1ZK8A 3F8BA 2E71A 1K7AA 3GTQJ 2HTJA 2XAUA 3GYHX 1WH7A 1BM9A 1NTCA 5DCMA 2EIJH 3OR2C 3S93A 4EV0A 4LITA 5LEKA 3ZQLA 1PJRA 4P9FA 1IUYA 2R3SA 2RN7A 3OYJA 4ZZDA 4RS8A 3SZGA 2ZKZA 1IRXA 2EFNA 4G8XA 3DPUA 3N97A 3D5SC 4RB0A 4XRFA 2LBFA 3M1EA 3CQZJ 1GV2A 1QQIA 3ABKH 3IV5A 2BVLA 1IN6A 3KLOA 1TC3C 4L9NA 4OIPF 1MZBA 3OYCA 3LSPA 4CCKA 5BPIA 2F4MB 2K7LA 1HQCA 1OISA 1APLC 4HV5A 1S5LC 4CZCA 3IH4A 2L7FP 3Q9VA 2RGVA 1MBKA 3BJOA 3CJQB 3RTRA 3O8GA 3CMEI 3DCFA 1Q1HA 2HOAA 1K79A 4C2UA 2MD5A 2VBWA 3V8JA 4XLAA 2Q8KA 2EFOA 2STWA 1Y6IA 1U0JA 2L3DA 2IRFG 5FRMA 1LEAA 1P4XA 3F8NA 5M5YJ 1H8AC 1W5CC 2BHYA 5F08A 4DBRA 5CLSA 1WPKA 4KA4A 3E7LA 1L0OC 3GZ5A 2IA2A 2V6EA 3BP8A 2ECBA 4EJUA 4Y52J 4B4CA 1GDTA 1JKOC 2P8TA 3H1CA 3TKYA 5HDKA 4L9TA 1B6AA 4R1HA 4BJ5C 2FNAA 1QNTA 2O8KA 4DIQA 2KMUA 3FKJA 5LRRA 4MEYF 2X48A 5EF6A 2X85A 2W24A 1IO2A 2JSCA 3JRFA 4DBQA 3GXOA 1A6QA 2VKDA 3PO3J 2K9QA 5K7FA 5L3FA 2V26A 2H1KA 3T5XA 1ZGWA 2UZKA 3A2KA 4IL6C 3HUGB 1U5TC 4D5CA 2W00A 3U1KA 3G2BA 4JX4A 1VF9A 2M45A 4RMNA 1TNTA 3VWBA 3X2QH 2R7FA 1JJ6C 2CUZA 3M7GA 2F4OB 5J4YA 1ZLJA 4BXXJ 3IH3A 3TOBA 4ZYDA 1JE8A 3FXOA 1S6LA 1FMWA 3DPLC 3MZ8A 2JA5J 2H6BA 1I3QJ 2HI3A 4HEA2 2VKEA 4OIRF 5KK1A 2FF4A 1UB9A 2ESHA 2WV0A 2VPRA 3ZXSA 1OCCH 1K78B 2ZNYA 2WB1N 4AIDA 1ON2A 1O3TA 4KNYA 1TZLA 3O8HA 1W0UA 2CQKA 4NDLA 5AIQA 4JX5A 4A2UA 4E6KG 5GP9A 2A68F 5HNFA 3CMMA 3LA2A 2P5LC 2HPMA 3GZ6A 1Z05A 5IT9Z 3O2PE 2VXZA 5FD6A 3LSHA 3IP4B 1EH6A 1SFKA 4R8HA 4RDUA 2R7SA 3A01A 2OUMA 5IY5H 1OCPA 1Y1VJ 1XB4A 3BZCA 3SHFA 2Q1ZB 2HDCA 1RR8C 1ZLKA 1SFEA 3MKWB 2FJ1A 4V19K 2FNPA 1MDMB 3VSLA 5D5WB 1DP3A 4CYCA 1R5ID 5ICGA 2DA6A 1MBEA 2ZO4A 1MJBA 2MH9A 1H88C 3AAFA 1YIOA 1ZKGA 1EH7A 2COMA 3RIRA 5E1ZB 2OQRA 1DPUA 2K4JA 1ZGAA 2OZUA 5D6FA 2I10A 2XIGA 2M3AA 3ZOBA 4KT6A 1YS6A 3HZJA 4CYDA 2R7WA 4HX8A 2DXIA 2BW3B 3VDXA 2PI0A 4CXFA 2CQNA 2DMPA 4FISA 2M1BA 3IL2A 1P6RA 3S3OA 3ECOA 2QYOA 1J9IA 3HOYJ 5B1AH 3ISPA 3T8TA 4NB5A 4C9YA 3LQQA 3VOEA 2L4MA 2CW7A 4QIWN 3M07A 2NNYA 2L5QA 3DQVC 1RETA 2LDUA 2VASA 2WAEA 2EZLA 4M6XA 2QUFA 1B8IB 3PJRA 1PDNC 1IN4A 1IN8A 2GM4A 3PFIA 3ZMZA 1J59A 5J8FA 4M3GA 2E1NA 3T8RA 5E18F 2Y9YA 4S05A 4BHBA 1HC8A 2A69F 3HSRA 2VE8A 5GTIC 3SFIA 5HODA 4KISA 2LP0A 4GYGA 2DA3A 3K4MA 1BI3A 3FXMA 4RM2A 3HDDA 5GAHJ 5L3BA 1T08B 5F27A 2QSHX 5L3GA 1FSEA 2KDZA 1BOAA 3CDHA 4ZZLA 1YYVA 3KIOA 1OR7A 1YX3A 5JVTA 1USSA 5GAGJ 2LD5A 3KP4A 1Z7UA 4B09A 1JGGA 2DDBA 3DV8A 1F1ZA 1KYZA 4EATA 2HYGD 4I98B 2XB5A 2Y0SN 1WI9A 2YUSA 3NQOA 3TP3A 3WTVC 4OIQF 2GOMA 4B8XA 3MKLA 3IUOA 4BUPA 3CUQA 1RNLA 4BDZA 2KIFA 3HSEA 1QZEA 1RUNA 1R7JA 4HNVA 2CJJA 3WTUC 2K85A 2LLKA 1UJ8A 3C2GA 3IH2A 1B59A 2XKPA 5J1YA 3BY6A 3BOQA 3IKTA 2P4WA 3OSGA 2JA2A 3AG4H 4I02A 2UXXA 2VL8A 2O8XA 2CV0A 4AD9A 1FMVA 3OYEA 4ABZA 5TRDA 1ZRDA 2GXBA 1B4AA 2V9KA 3FX3A 3OS0A 3H5NA 3FXUA 4RA2A 3MZYA 3P9IA 1MBGA 1YJNI 2VONA 2OA4A 4LGWA 5F0HA 2E1MB 4RGRA 4WF2A 4M3EA 3ERED 4KN7X 2FSWA 4LFUA 1FZPB 1LKXA 3GVAA 2L9VA 4A5MA 3F22A 3H92A 5BQTA 2JVHA 1SD7A 3DKXA 3HOZJ 2IGOA 1MMNA 3ZMDA 3KE2A 4DYQA 2JPCA 1KU7A 5J4VA 4UNOA 3LSKA 2LF8A 3CDLA 3S17J 3EUHA 4UUSB 4NUBA 2HOTA 4CCMA 3QYFA 2ESNA 2HZDA 3DEEA 1MIJA 1BOBA 1VQKI 4AM3A 2Y0SA 1Y0NA 3KEOA 3H0DA 4WXCA 1G6NA 4XLCA 1FIAA 2JJ7A 3LOCA 3RKWA 4DZPA 4QSHA 1Z7LA 3KEYA 1GLNA 2CV1A 1TW3A 4LLNA 1RKTA 4EM2A 2GBYA 1Y0UA 2JPBA 4U0YA 3I59A 3I4NJ 4GO1A 2P7CB 2CUEA 4FX4A 4R79A 1R5HA 3CCRI 1QGPA 1HBXG 2IGKA 1AWCA 3GTGJ 1X3WB 1L3LA 4PCQA 3KFWX 3UKGA 2R5ZB 1QVTA 3HRTA 4UXNA 3IWZA 3CC7I 1ETYA 2VB6A 4A6EA 1U78A 2WBMA 4PJMA 1VQ8I 4HF1A 3HOSA 3LFUA 3L2WA 5HOOA 1A5JA 5EJCA 2LMDA 4U0WA 3BZKA 5CQGA 4H0EA 2V79A 1ULYA 2QF7A 4AC0A 2NYXA 1S29A 1QHHD 1ZH5A 2DK5A 2KRFA 3ABTA 3CMYA 3PSFA 4XN3A 5DD8A 3GBGA 3MD2A 2LNBA 5F1RA 1OCTC 3HSFA 2K40A 4HZFA 1Y8RB 4NC8A 5KAFC 4AWXB 4TV7A 3KP5A 1G3SA 5AONA 1VQLI 4HBLA 5TISC 4MTDA 1VQ4I 5LHHA 1XCVA 2DA5A 1FBUA 2CS3A 1V4RA 2COBA 3HRSA 2M8GX 3PQKA 2E1MC 4A3JJ 2MGQA 1MKMA 3Q0VA 4D7NA 1A35A 1DGWY 1XMAA 3ZQGA 2EINH 5CQEA 3CCSI 3E6MA 4XORA 3K10A 4MHGA 3V4GA 1HSTA 4LIVA 1MBFA 4KIBA 1SAXA 1IAWA 1Z9CA 1TQIA 2NS7A 4DNCA 1FP2A 1K83J 3OV8A 2X1CA 1MBHA 1IC8A 2EFQA 4I09A 1BI2A 3QQAA 2A5WA 5M3FJ 2M0MA 3VB2A 3BR3A 3SYTA 3HPGA 4OOIA 1ITYA 2PN6A 2VC1A 4OINF 2XAHA 3TO6A 1O3SA 4UV9A 3CJRB 2IA0A 4UVBA 4HSTA 4MTEA 1Y1WJ 1FJLA 2D2WA 2AQFA 5HLGA 4QPQA 5KNLA 3CO7C 4F7ZA 3O3KA 2Y31A 4JP0A 2XB0X 1T98A 4U7DA 3KYLA 2IBDA 2UXNA 3F23A 4BEHB 3BR5A 4XN0A 2KL4A 5CYVA 2X6WA 5KVRA 1WJ5A 2PJRA 4IQJA 4UV8A 2E1OA 2DTRA 1FYLA 4W1UA 2RREA 1F4KA 1REPC 2RKHA 3OYBA 4C30A 4HF2A 2JZYA 2CW0F 5C3EJ 4PDKA 3DEUA 2M2EA 5H6QA 4YFXF 1SC7A 3MMYB 4IEJA 1BJZA 4BACA 3TMOA 4G7HF 1FTZA 3ZMUA 3OYHA 4PGGA 1BW6A 3BJAA 3A02A 1WWXA 2FA5A 3FK7A 1HKQA 5EEAA 3P5JA 3W2AA 3P9CA 1LE8A 2HKOA 2VJ4A 4M71A 2RQPA 4I7HA 1D8KA 1YIJI 2HR3A 3M8FA 2LY1A 4IXAA 5CVRA 1T6SA 5HS7A 3KLNA 4I01A 3C7JA 3CTAA 1QU3A 1XS9A 2LFBA 1IN5A 1PP7U 4C3IJ 3SZPA 4ZDPA 3OYLA 2ZJQF 1VQPI 2EH3A 5J1UA 1D3YA 1DDNA 3PNTA 2IPQX 2EV0A 3AG1H 2JA7J 1ETOA 3KPHA 3QP5A 1IZ1A 2OJED 4FETA 2BHZA 1LFPA 3ROUA 5ICEA 1DU6A 4Y4RA 3W2VA 2VKVA 4CCNA 3GTLJ 1DU0A 3EQLF 1U6GA 2IXSA 3OY9A 1N78A 2E2IJ 2ETHA 4LIUA 5IOYA 5DEQA 5HLTA 3WGGA 2DK8A 2A05A 1G3YA 5ED4A 1W4MA 4LB5A 2RV8A 2VQCA 1K6YA 3JRCA 1KONA 3CP2A 2Q2EA 1WJEA 3HC7A 4ON0A 3OYMA 2IGMA 1Y39A 5LBQA 3JRIA 1D0XA 4I99C 4CDGA 3JTGA 1ZG5A 1YTYA 2WV1A 4BBRJ 2B0LA 2XF5A 3CF5F 3HRUA 2NRAC 2ZFUA 1P2FA 3SDBA 3PO2J 2F5CA 3IHUA 3HGGA 4A69C 3WGIA 1QHGA 4EGZA 5DV5A 5DCMB 1TT0A 1KYWA 2HPIA 4RAGA 4L9VA 3DTIA 1G3TA 1MMAA 4BY1J 4G12A 1JKRC 4P96A 4EVIA 1D1BA 1MW7A 3DFGA 4PSXA 4CCJA 4P1WA 3SJMA 2XF7A 5KCMA 2DOAA 2L02A 4BHCA 3DF8A 4RGXA 2ZMEA 3K1MA 3CZ6A 3H3ZA 2M4KA 5L3CA 1VQ5I 2L2OA 2VOOA 4IVNA 4BQAA 1D1CA 2ACJA 2D5VA 3RYPA 4F92B 4G6DA 5DS9A 4YIFA 1UELB 2VJIA 3W6KB 2JTVA 1M1EB 2DFEA 3CJNA 4CZZA 5J47A 1UMQA 4Y17A 3D5RC 2DDAA 2QZ8A 5F6FA 3ULQB 3RZOJ 3J80Z 3KEQA 4DJAA 4BS9A 3ZQHA 5HLHA 2NVYJ 3KP6A 3ZMSA 3PM1A 3OYFA 2FEZA 4KT5C 1VNDA 2R7XA 3IRRA 3FXQA 3I64A 1FIPA 3D0SA 1YJ9I 1DGRM 1JXSA 3GTPJ 2EZHA 3BR6A 1FLIA 1FY7A 4UVAA 1KQ8A 5LHIA 1ETWA 1FOYA 2Z16A 3S1RJ 1EA3A 3U2RA 2O03A 2CFXA 5H20A 1YQAA 4N4OB 3ELKA 3HJEA 5DTDA 5IPAA 3J81Z 3H3VK 2R7UA 3ZN0A 4MLOA 3PIOF 2FMYA 2OBPA 2E5NA 5FFZA 1I1GA 2LH9A 1EH8A 2MLGA 3BJ6A 4BL0B 2WY7Q 2LREA 4CA0A 1ERDA 2R5YA 4HDVA 4ETSA 3RZDJ 3BR0A 4P5OA 4YEJA 1YW8A 4MFDA 1ZR2A 1IF1A 3OWTA 4IX7A 1YRNA 4GXOA 1DUXC 2R0QC 3K9TA 3GW2A 5DCFA 2LG4A 1R6RA 1OPCA 4FE4A 4ITVA 2Y30A 1H9GA 1SVLA 3DWLE 3OL3A 3HOXJ 5F04A 4HQMA 3CC2I 5FLMJ 1O7LA 3L2CA 2LY2A 5AIPA 2XPUA 3LL7A 2ICWG 2XGDA 1OFCX 4KJZA 2PMHA 3WTSC 1IDZA 3A03A 2EFWA 3MEXA 3MN2A 3LSTA 3K4JA 1LDJA 4F55A 4BYYA 4CCOA 1O4XA 1ACIA 3K70C 5ERIA 3SQNA 4G7OF 1XGNA 2MD0A 4LMYA 1FOXA 1P4AA 4KUMA 1B72A 2OV7A 2DT7B 1E0EA 1PUEE 1D1AA 3IAM2 2ISZA 2CG4A 3HB9A 5FKNA 2V9VA 2HQNA 3LQRA 4KIGA 3FZVA 2EFPA 4HNTA 1TTYA 5LRSA 4HLYA 4A3BJ 3COAC 2HQRA 4M6YA 4XMYA 5HDNA 2L9SA 3ONQA 1PYVA 2MABA 4QPOA 1EF4A 3Q5FA 2W48A 4BHPA 1P7JA 3A01B 1AKHA 2V9PA 1BJAA 1GUUA 2Z5UA 2HZTA 3E5UA 2B9SA 2H09A 2HQAA 1SEUA 1GHCA 1FWZA 3K4BA 3S1NJ 2GAUA 1EJ9A 4CYCB 4FHTA 4PJLA 4IRGA 2BGCA 3TOAA 4A0ZA 4HNUA 1DP7P 2V1XA 3L2UA 2QM3A 2W85A 4BGDA 3ZP5A 2M5WA 1UAAA 4E70A 5HDGA 3OIOA 4L0ZB 1J09A 2ELKA 4HX4A 2MG4A 3JRBA 1BI1A 4A3CJ 4M3BA 3A1YA 4L5EA 2IEKA 1U3EM 2Z3YA 4O6JA 4NQWA 2G7HA 4L5IA 2DW4A 2GQQA 3R0AA 5DD4A 3W6VA 1ZGJA 3IC7A 1WSUA 2QQBA 1U5TA 2R7RA 2ECCA 5J3LA 3TW7A 2XAFA 3CCMI 2QSFX 3EDPA 4DQ2A 5LGNA 1BBYA 1RIOH 4LOCA 2O61A 5K5RA 3OYNA 1I50J 2FOWA 4UUTA 2FU4A 1R4MB 1WRJA 1F36A 4LK1F 4XLEA 1XPXA 1NHAA 2MYSA 1LDKB 2CQ7A 1K4TA 1CF7A 3NAUA 3FISA 1XSDA 5D5VB 3RPQA 3I71A 3BDDA 2FMLA 1H9TA 1SD4A 3E5XA 2DA2A 4E7SA 5K5OA 2AO9A 2K5CA 3S8PA 3HGYA 4W97A 3VYSB 1A36A 2K3FA 2PEXA 2R7TA 1HLVA 1F5TA 3K2AA 2Y48A 2LOOA 3SDGA 3G71I 2JT1A 2NOJB 4M6VA 4MQVA 2HFHA 2CYYA 1XG1A 4CO8A 2VOPA 1A04A 4IOCF 2QKMB 1U9OA 5D5UB 4U7BA 1POGA 2FRHA 2XUBA 1FOKA 4GGGA 4IRIA 2X6OA 2ID3A 1ZHFA 4HPQA 3I4MJ 1HOMA 5FJ8J 1B1BA 2JVGA 1UHWA 4HOBA 3QPSA 1P9QC 2E5ZA 2ME0A 1MD0A 2VKHA 3QPTA 5JVGF 1XDUA 3CUQB 3FF5A 1GV5A 5FGMA 1TT5B 3BTIA 3IAS2 5GADJ 4ZYEA 4WK8F 1I39A 3FM3A 3TDUC 2KP6A 1ETXA 3G3ZA 4BH9A 3GUDA 2AXLA 2OTJI 3E6BA 4ZDOA 1Y8QB 1LPQA 3QYBA 2IS6A 2WY8Q 1JKPC 2EPFA 2CU7A 2ZB9A 5LLQA 2CRGA 2ZC2A 2HXIA 1YJWI 1FBQA 1FC3A 2P0WA 4C3JJ 2O9LA 1P4WA 2DT6A 2IJLA 3FWEA 5LGUA 2J5OA 3GFMA 4L18B 3AG2H 4RB2C 3CD6I 1FNNA 1BW5A 1I6XA 3BROA 2BE5F 3NEUA 3VSKA 1IRZA 3LSJA 1Z6RA 2I8DA 2DCEA 3M3YJ 5E3MA 2PX9A 2BXYA 2XV4S 1VZ0A 1ETVA 1HXDA 3H9QA 4KYWA 1X1AA 4PK4A 2HTSA 2L7MP 1GXQA 1RZ4A 2A6TA 1ZYRF 2VPLA 1T8IA 4LLLA 1QVUA 4XK4A 3BG9A 3CESA 1TWGJ 1JUPA 3A4CA 4A3IJ 1W7PD 4UUVA 4HAMA 4OMYA 2FE3A 3QU3A 3MVPA 3ZQ7A 5JLWA 2JK3A 2AXTC 4D7MA 2W82A 2Y75A 4I0BA 1W5TA 2EA2A 3LAJA 2K3PA 3TEDA 1W1WE 2PBIA 1I3AA 4IQ4A 3TGNA 2ZXHA 5CVIA 2QQ8A 5EG0B 3L2VA 3WE3A 4AU7A 2XROA 2DMUA 1NG6A 3OYDA 2BOLA 3DLLF 4JK1X 2GIVA 3F9KA 3CCJI 2NAZA 3TW6A 2WA0A 2X51A 3K4NA 4BQOA 2CUFA 2ZXIA 5B5EC 3GCMA 2DU9A 3GF2A 3J7AO 1SFUA 5LEJA 1R58A 1OR7C 1JUSA 2WWYA 1TW2A 3GTKJ 2E1CA 4Q4ZF 2YSRA 2H94A 1FX7A 5M5WJ 4A6DA 1XN7A 2KJBA 3U1DA 1YX5A 3NWSA 4F52A 3PNYA 1XCBA 4EM0B 3CUQC 3WTTC 5IP9J 1LNWA 1FSHA 4HX7A 3CCLI 3CCQI 4NBQA 1E3PA 3FKIJ 4F91B 2H6CA 1W5SA 2E36A 4N9HA 3M8EA 3ABUA 2LVSA 4WXHA 2HYFA 2LK2A 3Q9SA 2XHKA 1UG0A 4CSWA 4I0AA 2O6GE 1KQ9A 4PFPA 2C6YA 3CJTB 2Y9ZA 1HKTA 2V4JC 3ABLH 4Z6YA 1G2HA 1TWHJ 2F48A 3CUOA 3I0TA 3VPRA 1JHHA 3U9GA 4OAYA 3V7RA 3VYTB 1F43A 2DMNA 1OCRH 4XRSA 5EZHA 1WKMA 2KT0A 2CH0A 3GTJJ 4AVZA 1BN5A 2KFDA 1R71A 1HKSA 3UNGC 4FQGA 3K0LA 4XSXF 1FT9A 2Z2SB 1QPMA 5JR3A 3V8KA 3BR2A 4M73A 3OL4A 1X4OA 1A6IA 3LSIA 3HL2A 4D5FA 1T95A 2K9SA 2DTZA 2M8EA 3FHZA 1HDDC 2O5RA 3NRVA 4FE7A 4E7JA 1S7OA 3EUHC 2JQ7A 2CV2A 3E5QA 4WX9A 3FMSA 4IHSA 1R1VA 3OS1A 3OOUA 2RNGA 3V42A 1CQTA 2R93J 3NWTA 2M87A 4XRMA 2HDWA 1S8NA 1TBXA 2VJ5A 2CQQA 2OD5A 5HLIA 3HOTA 3ECHA 3PFYA 4IZZA 3F3XA 4WWCA 1UCRA 1J2XA 2FQ4A 3F8FA 5GTHC 1K4SA 3GEZA 2HQ5A 3BCBA 3CCUI 3QWLA 5JLXA 4FTHA 4ZTFA 5DM7F 3WHBA 4CICA 3LSGA 2AS5F 2BY3A 1JHFA 1YG2A 2JN6A 2X1DA 3R6SA 4HQEA 2KISA 3HOUJ 1LEBA 3BC8A 1R1TA 3R4KA 3J80K 4BXUA 3CO6C 3F6VA 2PJRB 4M3FA 5IOZA 4E7HA 4BXFA 2O7OA 5FKMA 2XASA 2IAIA 3G6EI 4IRHA 3WTXC 4EJVA 4UY8I 1ONVA 4LD5A 3LWFA 3K70D 1WJFA 5E8GA 4S0HB 1XTAA 2M7AA 2NS0A 3OYGA 4IPAA 2DN0A 4QTRA 2ME6A 2P6SA 1JUMA 5FKKA 4OIOF 4LG0A 2FXAA 3WGHA 1LE8B 4BAYA 1DQUA 1R23A 3V8LA 4E7ZA 3FMQA 1RRJA 3DBRB 4MQ9F 3J81K 1S7EA 3AKZA 1ZTRA 4RGSA 1JTYA 3QPLA 3BLYA 2X4HA 2X0LA 3JTHA 4ESFA 3LFKA 1XX5A 2QQAA 2VI6A 4BU2A 2X1EA 1R36A 2M4GA 4IHWA 4EMSA 2LY9A 1LDDA 1H0MA 2PMUA 4WCGA 3VFZA 3FXJA 2VC0A 2E2JJ 5JHUA 1VQNI 4L5JA 4UVCA 4C2MJ 4ENNA 2XC7A 1X1PA 2Z99A 3RYRA 1LVAA 1OCOH 3KP7A 1HW5A 3HOVJ 3N05A 1MGTA 4G6QA 1SAUA 2KHMA 4M3DA 3QPHA 4MNUA 3TO9A 5LGTA 5D8LB 2ELHA 3ASOH 4I2OA 4GDFA 1PUFA 1V5FA 3K6GA 3BG7A 4PUSA 1KGSA 3E1SA 5EEGA 3LNQA 3JRHA 1W0TA 5B3SH 1XGOA 1YHQI 2F6CA 2VUMJ 3VODA 3QOPA 2EZIA 2DODA 4LB6B 1IW7F 5IP7J 4A0YA 2Q2EB 5C4XJ 1S7AA 3LAPA 2OU2A 2HU9A 1WGXA 5DUKA 1WQ2A 2DOFA 5CVUA 5M3MJ 2M9HA 2MW8A 3BTJA 3ERMA 3PIPF 2E2HJ 2HXOA 1I27A 2NS8A 5TGTA 2JRMA 4UB6C 2GA1A 2IW5A 4BDYA 2EB7A 1N77A 2WADA 2V1NA 4M9ZA 4I76A 3CCEI 2YPRA 2O0YA 5K7HA 5ILUA 1WJDA 3F0CA 2VBYA 1WJAA 1X1BA 2L4AA 1D8JA 2KZGA 2L7KA 3ZN1A 4YFKF 2KPMA 3VEPA 1VI0A 4Y7NJ 1IXCA 5FFXA 2QVOA 4RB3C 2LTPA 4B3XA 2IA1A 3TO7A 2L9NA 2RQQA 2DFFA 2F2EA 1FP1D 1YI2I 1O7FA 4Y15A 3KYDB 2ZSIB 3BCAA 5E17F 1JKQC 2BYVE 1JTXA 4KN4X 3S32A 1W7PA 2UV1A 1IG7A 5H2FC 4AIKA 2ZBKA 2LKXA 2XGEA 1BI0A 3FDYA 4BKXA 1IRGA 1WCMJ 1VQ6I 3E0JB 1G8XA 2X9DA 2Z9OA 3DKWA 2L01A 1IN7A 3OYAA 3GLLA 5F0CA 1T38A 1K61A 3EYYA 2HOSA 1X1CA 1D0YA 1ENHA 2P7VB 2PLYA 4PSWA 3GFLA 2LKPA 2L54A 4NC6A 1AA7A 3GO5A 2YU9J 4EEFG 2LRDA 3R0JA 4E7LA 2HVRA 3G4SI 2VBXA 2QA4I 4B1RA 3C3WA 1BC7C 1KU3A 4II2A 4RM3A 2R5YB 1WJCA 3QRFF 1MSFC 2IS1A 1KU2A 4KMFA 2DMQA 2W7NA 3HHHA 1SMTA
chains in the Genus database with same CATH topology
3S1NJ 4CYCB 5HODA 3SFIA 5E3LA 2LP0A 2DA3A 1GVDA 4IHXA 4A3KJ 3HDDA 3S2HJ 5F27A 2KDZA 3HOWJ 2R92J 2CQXA 2OPTA 2N8GA 3OIOA 2ELKA 2LD5A 2DMTA 4UUSA 2MG4A 2NOGA 3JRBA 1JGGA 1WI3A 4A3CJ 4M3BA 5EGOA 4L5EA 2IEKA 5E3OA 2XB5A 2Y0SN 2YUSA 3TP3A 3W6VA 4XRSG 1MH4A 3MKLA 1B72B 2ECCA 1IJWC 2G0EA 1VFCA 5J3LA 3TW7A 1UG2A 4HNVA 2FX0A 2CJJA 1IUFA 1MSEC 1TWAJ 2LLKA 4LOCA 1OJLA 1I50J 4UUTA 3IH2A 5J1YA 1F36A 3OSGA 1ZR4A 3G1LA 2R5ZA 4ABZA 2L7ZA 3NAUA 5E3NA 3FISA 5EZGA 1Z77A 4B3AA 1MBGA 2DA2A 5FLVA 2AO9A 5F0HA 3HGYA 4W97A 4M3EA 4X6AJ 1HLVA 1Q1VA 3K2AA 3RKQA 3WHCA 3SDGA 2YS9A 4M6VA 1U9NA 3HOZJ 1XG1A 4DYQA 1U9OA 5FKLA 3LSRA 2DA7A 1POGA 3CDLA 3JREA 2X6OA 2ID3A 3S17J 4UUSB 1RR7A 1IGNA 1SANA 2HOTA 1H89C 3I4MJ 5EGOB 5FJ8J 1R9TJ 1HOMA 4A3FJ 3QPSA 2ME0A 9ANTA 1FIAA 1E3OC 2JWTA 2JJ7A 3LOCA 1Z0XA 4DZPA 4QSHA 2NVQJ 1GV5A 4FCYA 3HM5A 3BTIA 1RKTA 2GBYA 3M4OJ 3I4NJ 1IDYA 1ETXA 2CUEA 1FTTA 3G1OA 1NK2P 3HBLA 4MO7A 3GTGJ 2HDDA 1T33A 1JKPC 2CU7A 2P81A 2OF7A 2ZB9A 2CRGA 5J1RA 2HXIA 2R5ZB 3UKGA 4BBSJ 1QVTA 2O9LA 4C3JJ 1MNMC 1LFUP 4DW6A 5IYCJ 1BW5A 1ETYA 1IRZA 3S1QJ 3LSJA 1U78A 3NARA 3G1MA 3M3YJ 5E3MA 1JT6A 2NVXJ 1ETVA 2HYJA 1A5JA 2L7MP 4AC0A 2QF7A 1QVUA 4XK4A 2DA1A 3BG9A 3BG3A 3JRAA 4BY7J 1TWGJ 1JUPA 4A3IJ 3CMYA 2PMZN 5GPCA 3GBGA 1YRNB 3MVPA 1JJ8C 1OCTC 5JLWA 2MSYA 1XC5A 2JK3A 1WH5A 2QCOA 2XPVA 1JT0A 2K40A 2E19A 4D7MA 1D5YA 3JRDA 1HDPA 3FK6A 1HCRA 3TEDA 3CCYA 5EG0B 5K7ZA 1U8BA 2DA5A 2DMUA 2DJNA 2COBA 2EZKA 2M8GX 4A3JJ 3S16J 2MGQA 3BR1A 4XIDA 3Q0VA 3HKZN 2K9NA 4D7NA 4IHVA 3ZQGA 2M0CA 3TW6A 1UHSA 4V2FA 4C3HJ 1BA5A 2CUFA 5F0FA 4A3DJ 3BTCA 1MBFA 1T56A 3DEWA 1ZQ3P 2XSDC 1JUSA 2FD5A 2NS7A 4DZJA 3GTKJ 1K83J 1LFBA 1MBHA 1IC8A 5IP6A 3B6CA 3QQAA 5M5WJ 5M3FJ 3BR3A 2JA8J 1ITYA 3OSFA 4IHYA 1AKHB 5IP9J 2L0KA 3K7AJ 3ZQFA 1Y1WJ 1FJLA 2DA4A 3FKIJ 2XPWA 1X2NA 3Q3SA 1ORKA 3BQZA 4JYKA 2LVSA 1X58A 1QPIA 2LK2A 2Y31A 4A93J 4JP0A 2XB0X 4RBOA 2Y9ZA 2IBDA 5EYRA 1ETQA 3BR5A 1G2HA 1TWHJ 3VPRA 1NK3P 1AHDP 3BQYA 2TRTA 1F43A 2DMNA 4XRSA 2E1OA 5EZHA 3BG5A 2KT0A 2EQRA 2Y2ZA 4W1UA 5C44J 3GTJJ 3RQIA 2L9RA 5C3EJ 5M5XJ 2M2EA 1FTZA 4IEJA 1BJZA 1X2MA 1I6HJ 3S2DJ 3BR2A 1A6IA 1RPWA 3JR9A 1AU7A 1BW6A 4D5FA 1ETKA 4A3GJ 3A02A 1ZK8A 2K9SA 2DTZA 3FK7A 5EEAA 1HDDC 1LE8A 4FE7A 3GTQJ 1WH7A 1NTCA 3ZQCA 2JA6J 3ZQLA 2GLOA 3OOUA 1CQTA 2R93J 1XS9A 2LFBA 4C3IJ 4XRMA 2EH3A 5J1UA 2CQQA 4A3EJ 3CQZJ 1GV2A 2FQ4A 5C4JJ 2JA7J 3IV5A 1ETOA 2HQ5A 5JLXA 5IYDJ 1P7IA 4FTHA 5IYBJ 2ID6A 3C2BA 1TC3C 3WHBA 3LSGA 4A3MJ 3HOUJ 1RKWA 2JN6A 3LSPA 3L1PA 1MBJA 3S14J 1DU6A 2VKVA 3GTLJ 1APLC 1DU0A 4M3FA 3S1MJ 5IOZA 3IH4A 2L7FP 2E2IJ 2O7OA 5EDNA 5FKMA 5IOYA 1MBKA 2IAIA 3B6AA 3O8GA 2LR8A 3DCFA 1SFOJ 2HOAA 3JRCA 2XGCA 1TWFJ 4S0HB 3JRIA 5M5YJ 2DN0A 2WV1A 4BBRJ 4QTRA 1H8AC 2ME6A 5FKKA 1JUMA 5F08A 1WPKA 3E7LA 1LE8B 3PO2J 1GT0C 3HGGA 2ECBA 4A69C 1S7EA 4Y52J 1ZTRA 4B4CA 1JKOC 1GDTA 1JTYA 2H8RA 4BY1J 3QPLA 4G12A 1JKRC 2VI6A 2O8KA 4IHWA 5EF6A 2X48A 2LY9A 3JRFA 3SJMA 1QRYA 3Q0UA 3PO3J 3Q0WA 4GFBA 2E2JJ 2K9QA 5K7FA 4JX6A 4C2MJ 3ZQIA 2H1KA 2D5VA 1ZGWA 3HOVJ 5DS9A 4M3DA 2M34A 4D5CA 3BT9A 4JX4A 1UMQA 1VF9A 1PUFA 1JJ6C 3RZOJ 3LNQA 1W0TA 3JRHA 4BXXJ 3IH3A 3ZQHA 3GTOJ 1MH3A 2NVYJ 2VUMJ 2JA5J 3PM1A 2WAQN 1I3QJ 3GTMJ 2HI3A 2EZIA 2VKEA 5IP7J 3FIWA 1HF0A 1VNDA 5C4XJ 2VPRA 2WB1N 1WGXA 1FIPA 3JRGA 4XICA 3O8HA 5M3MJ 2EBIA 3BTLA 1W0UA 3GTPJ 2EZHA 3BR6A 2M9HA 2MW8A 3BTJA 4NDLA 5F1JA 2E2HJ 4JX5A 1ETWA 2HXOA 5GP9A 1BL0A 2NS8A 3S1RJ 4I76A 4MFEA 5IPAA 3H3VK 5DTDA 5K7HA 3TP0A 4MLOA 4RDUA 3A01A 3F0CA 1B8IA 1OCPA 1Y1VJ 3D1NI 2R5YA 3RZDJ 5GPAA 3BR0A 2FJ1A 2NVTJ 4MFDA 1ZR2A 4DYCA 1YRNA 4Y7NJ 2R0QC 1VI0A 4CYCA 4J19A 4FE4A 2LTPA 2DA6A 2Y30A 1IV6A 1MBEA 3HOXJ 5F04A 1H88C 1PUFB 5FLMJ 2RAEA 2AHQA 2B63J 2XPUA 4DYRA 1ZKGA 5EG0A 2XGDA 1OFCX 1JKQC 4AUXA 1JTXA 1IDZA 3A03A 2TCTA 1IG7A 3MN2A 1FEXA 2I10A 4MIMA 2LKXA 3ZOBA 2XGEA 1O4XA 3S15J 4BKXA 1WCMJ 4A3LJ 2X9DA 3H0GJ 4X1EA 1B72A 2DMPA 4FISA 5F0CA 1K61A 2JMWA 3HB9A 5FKOA 5FKNA 1ENHA 2HOSA 3HOYJ 4AYBN 4QIWN 4A3BJ 2YU9J 4EEFG 1EF4A 1RETA 2EZLA 2W48A 3A01B 1P7JA 1AKHA 2R7ZJ 4B1RA 1B8IB 1RESA 5BNGA 1GUUA 2GM4A 2R5YB 1MSFC 1TWCJ 2XRLA 4M3GA 2DMQA 3HEFA 4V2GA 2Y9YA 4I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N J;  4CYC B;  5HOD A;  3SFI A;  5E3L A;  2LP0 A;  2DA3 A;  1GVD A;  4IHX A;  4A3K J;  3HDD A;  3S2H J;  5F27 A;  2KDZ A;  3HOW J;  2R92 J;  2CQX A;  2OPT A;  2N8G A;  3OIO A;  2ELK A;  2LD5 A;  2DMT A;  4UUS A;  2MG4 A;  2NOG A;  3JRB A;  1JGG A;  1WI3 A;  4A3C J;  4M3B A;  5EGO A;  4L5E A;  2IEK A;  5E3O A;  2XB5 A;  2Y0S N;  2YUS A;  3TP3 A;  3W6V A;  4XRS G;  1MH4 A;  3MKL A;  1B72 B;  2ECC A;  1IJW C;  2G0E A;  1VFC A;  5J3L A;  3TW7 A;  1UG2 A;  4HNV A;  2FX0 A;  2CJJ A;  1IUF A;  1MSE C;  1TWA J;  2LLK A;  4LOC A;  1OJL A;  1I50 J;  4UUT A;  3IH2 A;  5J1Y A;  1F36 A;  3OSG A;  1ZR4 A;  3G1L A;  2R5Z A;  4ABZ A;  2L7Z A;  3NAU A;  5E3N A;  3FIS A;  5EZG A;  1Z77 A;  4B3A A;  1MBG A;  2DA2 A;  5FLV A;  2AO9 A;  5F0H A;  3HGY A;  4W97 A;  4M3E A;  4X6A J;  1HLV A;  1Q1V A;  3K2A A;  3RKQ A;  3WHC A;  3SDG A;  2YS9 A;  4M6V A;  1U9N A;  3HOZ J;  1XG1 A;  4DYQ A;  1U9O A;  5FKL A;  3LSR A;  2DA7 A;  1POG A;  3CDL A;  3JRE A;  2X6O A;  2ID3 A;  3S17 J;  4UUS B;  1RR7 A;  1IGN A;  1SAN A;  2HOT A;  1H89 C;  3I4M J;  5EGO B;  5FJ8 J;  1R9T J;  1HOM A;  4A3F J;  3QPS A;  2ME0 A;  9ANT A;  1FIA A;  1E3O C;  2JWT A;  2JJ7 A;  3LOC A;  1Z0X A;  4DZP A;  4QSH A;  2NVQ J;  1GV5 A;  4FCY A;  3HM5 A;  3BTI A;  1RKT A;  2GBY A;  3M4O J;  3I4N J;  1IDY A;  1ETX A;  2CUE A;  1FTT A;  3G1O A;  1NK2 P;  3HBL A;  4MO7 A;  3GTG J;  2HDD A;  1T33 A;  1JKP C;  2CU7 A;  2P81 A;  2OF7 A;  2ZB9 A;  2CRG A;  5J1R A;  2HXI A;  2R5Z B;  3UKG A;  4BBS J;  1QVT A;  2O9L A;  4C3J J;  1MNM C;  1LFU P;  4DW6 A;  5IYC J;  1BW5 A;  1ETY A;  1IRZ A;  3S1Q J;  3LSJ A;  1U78 A;  3NAR A;  3G1M A;  3M3Y J;  5E3M A;  1JT6 A;  2NVX J;  1ETV A;  2HYJ A;  1A5J A;  2L7M P;  4AC0 A;  2QF7 A;  1QVU A;  4XK4 A;  2DA1 A;  3BG9 A;  3BG3 A;  3JRA A;  4BY7 J;  1TWG J;  1JUP A;  4A3I J;  3CMY A;  2PMZ N;  5GPC A;  3GBG A;  1YRN B;  3MVP A;  1JJ8 C;  1OCT C;  5JLW A;  2MSY A;  1XC5 A;  2JK3 A;  1WH5 A;  2QCO A;  2XPV A;  1JT0 A;  2K40 A;  2E19 A;  4D7M A;  1D5Y A;  3JRD A;  1HDP A;  3FK6 A;  1HCR A;  3TED A;  3CCY A;  5EG0 B;  5K7Z A;  1U8B A;  2DA5 A;  2DMU A;  2DJN A;  2COB A;  2EZK A;  2M8G X;  4A3J J;  3S16 J;  2MGQ A;  3BR1 A;  4XID A;  3Q0V A;  3HKZ N;  2K9N A;  4D7N A;  4IHV A;  3ZQG A;  2M0C A;  3TW6 A;  1UHS A;  4V2F A;  4C3H J;  1BA5 A;  2CUF A;  5F0F A;  4A3D J;  3BTC A;  1MBF A;  1T56 A;  3DEW A;  1ZQ3 P;  2XSD C;  1JUS A;  2FD5 A;  2NS7 A;  4DZJ A;  3GTK J;  1K83 J;  1LFB A;  1MBH A;  1IC8 A;  5IP6 A;  3B6C A;  3QQA A;  5M5W J;  5M3F J;  3BR3 A;  2JA8 J;  1ITY A;  3OSF A;  4IHY A;  1AKH B;  5IP9 J;  2L0K A;  3K7A J;  3ZQF A;  1Y1W J;  1FJL A;  2DA4 A;  3FKI J;  2XPW A;  1X2N A;  3Q3S A;  1ORK A;  3BQZ A;  4JYK A;  2LVS A;  1X58 A;  1QPI A;  2LK2 A;  2Y31 A;  4A93 J;  4JP0 A;  2XB0 X;  4RBO A;  2Y9Z A;  2IBD A;  5EYR A;  1ETQ A;  3BR5 A;  1G2H A;  1TWH J;  3VPR A;  1NK3 P;  1AHD P;  3BQY A;  2TRT A;  1F43 A;  2DMN A;  4XRS A;  2E1O A;  5EZH A;  3BG5 A;  2KT0 A;  2EQR A;  2Y2Z A;  4W1U A;  5C44 J;  3GTJ J;  3RQI A;  2L9R A;  5C3E J;  5M5X J;  2M2E A;  1FTZ A;  4IEJ A;  1BJZ A;  1X2M A;  1I6H J;  3S2D J;  3BR2 A;  1A6I A;  1RPW A;  3JR9 A;  1AU7 A;  1BW6 A;  4D5F A;  1ETK A;  4A3G J;  3A02 A;  1ZK8 A;  2K9S A;  2DTZ A;  3FK7 A;  5EEA A;  1HDD C;  1LE8 A;  4FE7 A;  3GTQ J;  1WH7 A;  1NTC A;  3ZQC A;  2JA6 J;  3ZQL A;  2GLO A;  3OOU A;  1CQT A;  2R93 J;  1XS9 A;  2LFB A;  4C3I J;  4XRM A;  2EH3 A;  5J1U A;  2CQQ A;  4A3E J;  3CQZ J;  1GV2 A;  2FQ4 A;  5C4J J;  2JA7 J;  3IV5 A;  1ETO A;  2HQ5 A;  5JLX A;  5IYD J;  1P7I A;  4FTH A;  5IYB J;  2ID6 A;  3C2B A;  1TC3 C;  3WHB A;  3LSG A;  4A3M J;  3HOU J;  1RKW A;  2JN6 A;  3LSP A;  3L1P A;  1MBJ A;  3S14 J;  1DU6 A;  2VKV A;  3GTL J;  1APL C;  1DU0 A;  4M3F A;  3S1M J;  5IOZ A;  3IH4 A;  2L7F P;  2E2I J;  2O7O A;  5EDN A;  5FKM A;  5IOY A;  1MBK A;  2IAI A;  3B6A A;  3O8G A;  2LR8 A;  3DCF A;  1SFO J;  2HOA A;  3JRC A;  2XGC A;  1TWF J;  4S0H B;  3JRI A;  5M5Y J;  2DN0 A;  2WV1 A;  4BBR J;  4QTR A;  1H8A C;  2ME6 A;  5FKK A;  1JUM A;  5F08 A;  1WPK A;  3E7L A;  1LE8 B;  3PO2 J;  1GT0 C;  3HGG A;  2ECB A;  4A69 C;  1S7E A;  4Y52 J;  1ZTR A;  4B4C A;  1JKO C;  1GDT A;  1JTY A;  2H8R A;  4BY1 J;  3QPL A;  4G12 A;  1JKR C;  2VI6 A;  2O8K A;  4IHW A;  5EF6 A;  2X48 A;  2LY9 A;  3JRF A;  3SJM A;  1QRY A;  3Q0U A;  3PO3 J;  3Q0W A;  4GFB A;  2E2J J;  2K9Q A;  5K7F A;  4JX6 A;  4C2M J;  3ZQI A;  2H1K A;  2D5V A;  1ZGW A;  3HOV J;  5DS9 A;  4M3D A;  2M34 A;  4D5C A;  3BT9 A;  4JX4 A;  1UMQ A;  1VF9 A;  1PUF A;  1JJ6 C;  3RZO J;  3LNQ A;  1W0T A;  3JRH A;  4BXX J;  3IH3 A;  3ZQH A;  3GTO J;  1MH3 A;  2NVY J;  2VUM J;  2JA5 J;  3PM1 A;  2WAQ N;  1I3Q J;  3GTM J;  2HI3 A;  2EZI A;  2VKE A;  5IP7 J;  3FIW A;  1HF0 A;  1VND A;  5C4X J;  2VPR A;  2WB1 N;  1WGX A;  1FIP A;  3JRG A;  4XIC A;  3O8H A;  5M3M J;  2EBI A;  3BTL A;  1W0U A;  3GTP J;  2EZH A;  3BR6 A;  2M9H A;  2MW8 A;  3BTJ A;  4NDL A;  5F1J A;  2E2H J;  4JX5 A;  1ETW A;  2HXO A;  5GP9 A;  1BL0 A;  2NS8 A;  3S1R J;  4I76 A;  4MFE A;  5IPA A;  3H3V K;  5DTD A;  5K7H A;  3TP0 A;  4MLO A;  4RDU A;  3A01 A;  3F0C A;  1B8I A;  1OCP A;  1Y1V J;  3D1N I;  2R5Y A;  3RZD J;  5GPA A;  3BR0 A;  2FJ1 A;  2NVT J;  4MFD A;  1ZR2 A;  4DYC A;  1YRN A;  4Y7N J;  2R0Q C;  1VI0 A;  4CYC A;  4J19 A;  4FE4 A;  2LTP A;  2DA6 A;  2Y30 A;  1IV6 A;  1MBE A;  3HOX J;  5F04 A;  1H88 C;  1PUF B;  5FLM J;  2RAE A;  2AHQ A;  2B63 J;  2XPU A;  4DYR A;  1ZKG A;  5EG0 A;  2XGD A;  1OFC X;  1JKQ C;  4AUX A;  1JTX A;  1IDZ A;  3A03 A;  2TCT A;  1IG7 A;  3MN2 A;  1FEX A;  2I10 A;  4MIM A;  2LKX A;  3ZOB A;  2XGE A;  1O4X A;  3S15 J;  4BKX A;  1WCM J;  4A3L J;  2X9D A;  3H0G J;  4X1E A;  1B72 A;  2DMP A;  4FIS A;  5F0C A;  1K61 A;  2JMW A;  3HB9 A;  5FKO A;  5FKN A;  1ENH A;  2HOS A;  3HOY J;  4AYB N;  4QIW N;  4A3B J;  2YU9 J;  4EEF G;  1EF4 A;  1RET A;  2EZL A;  2W48 A;  3A01 B;  1P7J A;  1AKH A;  2R7Z J;  4B1R A;  1B8I B;  1RES A;  5BNG A;  1GUU A;  2GM4 A;  2R5Y B;  1MSF C;  1TWC J;  2XRL A;  4M3G A;  2DMQ A;  3HEF A;  4V2G A;  2Y9Y A;  4I6Z A; 
#chains in the Genus database with same CATH topology
 5E3L A;  1KA8 A;  2OZ6 A;  2KIQ A;  4YEL A;  4IHX A;  2GIZ A;  2HEO A;  3BWG A;  4UHT A;  4E4H A;  2WAF A;  1J7K A;  2CWE A;  2LBF B;  3S2H J;  4XKV A;  3VYR B;  2R92 J;  3K1N A;  2OPT A;  3TL4 X;  3MKY B;  4HLX A;  4NC7 A;  3JAM K;  2O3F A;  1TP4 A;  2NOG A;  2K9M A;  3PUB A;  5EGO A;  4ENK A;  1FOW A;  1HW1 A;  1FBS A;  4HSR A;  1B9N A;  2V1U A;  3RI4 A;  3ML6 A;  2DQR A;  1MH4 A;  4XRS G;  2KJC A;  4RLF A;  3GX4 X;  1B72 B;  4LLG F;  2K86 A;  4A12 A;  4ZDL A;  3L09 A;  1VFC A;  4QWQ A;  3EET A;  2FX0 A;  2HVQ A;  3RJP A;  3CP8 A;  4B47 A;  4BE0 A;  1X1D A;  1TWA J;  3W6J B;  5D5X B;  1OJL A;  4DGW B;  1YS7 A;  3BZ6 A;  1G59 A;  3QU6 A;  4Y13 A;  2WC2 A;  1O3Q A;  4PFO A;  1V3F A;  4G9Y A;  1PP8 F;  3RDI A;  2ZXJ A;  3LA7 A;  4IO9 F;  3W3C A;  2VQL A;  4F93 B;  2VBZ A;  3QOD A;  3F8C A;  4B3A A;  3GME A;  2Q0O A;  2ZJ2 A;  3SXY A;  4OWR B;  1ZRE A;  4Q48 A;  1T0F C;  4BJT A;  3R60 A;  4KDP A;  1EV7 A;  2XAG A;  3IKV A;  1Q1V A;  2EV5 A;  2D1H A;  3WHC A;  1HW2 A;  4L9J A;  2Y69 H;  1K6O A;  2LSO A;  1U9N A;  4XON A;  5JI6 A;  2VIX A;  2VOD A;  2FBH A;  2DAO A;  4YII A;  5FKL A;  4ASN A;  4AVP A;  1I5Z A;  1SAN A;  1R9T J;  6PAX A;  3WG7 H;  4N4N B;  2JUG A;  2KKO A;  3DU6 A;  4A3F J;  2MH2 A;  2OCC H;  3KZY A;  5A2Q Z;  1B9M A;  2YX7 A;  1U2W A;  2NVQ J;  2VE9 A;  4EJW A;  2DFH A;  3HM5 A;  4ZYH A;  1TNS A;  1LJ9 A;  2QBY A;  1O57 A;  3MKZ A;  3G1O A;  4FAS D;  4HW0 A;  1FTT A;  1OYW A;  2NNN A;  3UR3 C;  3RPU D;  1YLF A;  3ZRG A;  3I55 I;  1EKE A;  1NK2 P;  5D4R A;  2GWR A;  3HBL A;  2HDD A;  1T33 A;  3M8J A;  2HWV A;  2P81 A;  2OF7 A;  5J1R A;  4KIC A;  2E35 A;  1CF7 B;  4ZJZ A;  1AOY A;  1ON1 A;  5J6X A;  5KHD A;  4M72 A;  1OKR A;  2EIL H;  1D5V A;  1XGS A;  3I53 A;  4A0X A;  4ANJ A;  4EJO A;  2H8W A;  1BR2 A;  1QO0 D;  5FRO A;  2NVX J;  2HYJ A;  5FD5 A;  5BMZ A;  4H4K C;  2BV6 A;  2ZFW A;  4EQQ A;  2B7E A;  3TQN A;  2DA1 A;  3BG3 A;  2QGU A;  3OOP A;  3QOE A;  4BY7 J;  1HA8 A;  2QQ9 A;  3OIQ A;  5GPC A;  4RAY A;  2GXG A;  3QAH A;  2MSY A;  1XC5 A;  2XF6 A;  3BPV A;  2CUJ A;  1R00 A;  2QCO A;  1JT0 A;  4J00 A;  2W1O A;  3AG3 H;  1D5Y A;  2BY1 A;  1WJB A;  3F21 A;  1HDP A;  3FK6 A;  4RAF A;  2XKO A;  2ZJR F;  1NG7 A;  4X0G A;  5CVV A;  4II3 A;  4O5V A;  2VLA A;  3CC4 I;  5K7Z A;  2CW8 A;  2R7O A;  4RB1 A;  4PGH A;  4RLQ A;  3MZH A;  2W84 A;  2EZK A;  4XSZ F;  2IS4 A;  3S16 J;  1SMY F;  3HKZ N;  3I54 A;  4IHV A;  2ZNZ A;  1R1U A;  3BPX A;  2M0C A;  2M30 A;  2VQH A;  3QP6 A;  2H1L A;  3L7W A;  4HYE A;  4XM3 A;  4C3H J;  3J7Y J;  1ZRC A;  1BA5 A;  2XGX A;  3J7Z I;  5F0F A;  3K1P A;  3DEW A;  1G3W A;  3HXL A;  4DZJ A;  5ICC A;  1QBJ A;  1LFB A;  3DP7 A;  4LJZ F;  3B6C A;  3KET A;  3FHN A;  1R22 A;  5KAI C;  3HG9 A;  2DJI A;  1JGS A;  2JA8 J;  3KZZ A;  1OQY A;  2YR2 A;  5E1X A;  2G7U A;  2Y0M A;  4HDU A;  3OSF A;  2GXA A;  2ZJP F;  1BR4 A;  3K2Z A;  4C2T A;  3JSP A;  2DA4 A;  2EIK H;  2XPW A;  3Q3S A;  2HNH A;  2R7V A;  1ORK A;  3DU5 A;  3BQZ A;  3C1D A;  5HNH A;  2R7Q A;  3O6B B;  5CPR B;  3HIF A;  4U87 A;  2MC3 A;  1OCZ H;  1ETQ A;  5EYR A;  2BVM A;  4XLH A;  1VQ7 I;  3DXJ F;  2HGC A;  1X4P A;  3A0B C;  4XKC A;  3OYK A;  5FLX K;  1AHD P;  2F5E A;  2BXZ A;  3BQY A;  2KIM A;  1UST A;  4YG2 F;  2IVM A;  3DTE A;  3BG5 A;  2Y2Z A;  3ZPL A;  5C44 J;  4GCV A;  1UZC A;  2W4S A;  3RQI A;  2L9R A;  3HKZ A;  2BY0 A;  1OYY A;  3JAM Z;  4YIR X;  3S3M A;  1I6H J;  1T2K A;  4PJN A;  3T0Y A;  1WHU A;  4UB8 C;  2D1V A;  1RPW A;  3JR9 A;  1AU7 A;  3KP2 A;  1ETK A;  1Z91 A;  4A3G J;  3DLA A;  2M7B A;  4CCL A;  3OIP A;  2KIU A;  3WU2 C;  1WFX A;  1ZAR A;  4KIT B;  1KU9 A;  3ZQC A;  2XRN A;  3KCC A;  2JA6 J;  3M1C A;  4U0V A;  2BBY A;  1W36 C;  2GLO A;  3KYC B;  2NVU B;  3I4P A;  2D45 A;  4L0Y B;  3P9K A;  5IT3 A;  1MMS A;  3ZQQ A;  5FO5 A;  4ENJ A;  3PUF A;  5J40 A;  4A3E J;  4D1Q A;  3H36 A;  4EM1 A;  5C4J J;  3U21 A;  5IYD J;  1P7I A;  5IYB J;  2ID6 A;  2K27 A;  3C2B A;  3T1B A;  4N9I A;  4J01 A;  4A3M J;  2R4G A;  1RKW A;  2CGP A;  2NXN B;  3L1P A;  3MFK A;  2EV6 A;  1MBJ A;  3I5U A;  3S14 J;  1N25 A;  2GOX B;  3HUG A;  1GVJ A;  3FXL A;  2WB1 A;  4K2E A;  2HOE A;  2X6X A;  3DBL B;  3FBI B;  1NH3 A;  4IF4 A;  2QEX I;  1XMK A;  2HS5 A;  3S1M J;  3MAJ A;  5EDN A;  3K4K A;  1XSX A;  3RCO A;  3B6A A;  4ENM A;  4CHU A;  2LR8 A;  1SFO J;  5TJJ A;  2CO5 A;  1MND A;  2XGC A;  4JOM A;  1TWF J;  1G4D A;  2BY2 A;  2VJJ A;  1K78 A;  2XVC A;  2RVC A;  3C18 A;  4ESJ A;  5E1W A;  4JBA A;  3JSO A;  2A6H F;  3PQJ A;  1XD7 A;  2QKL B;  2JSP A;  1Z3X A;  2V1D A;  2WTE A;  3I59 B;  5CKT A;  1GT0 C;  4M9X A;  2OQG A;  5K5Q A;  3F72 A;  5F64 A;  1ZG3 A;  1O3R A;  4XBF A;  2VXD A;  1YE9 A;  3HPH A;  3MQ0 A;  4BE2 A;  1SD5 A;  2ADU A;  3SEZ A;  1P92 A;  4BE1 A;  2H8R A;  4XKW A;  2W57 A;  3J7A Y;  3EYI A;  4XOT A;  3HRM A;  4M74 A;  3HYI A;  3FBN B;  1E3H A;  3KX2 A;  1C0W A;  1OYI A;  2E60 A;  3L2Q A;  5FB2 A;  1QRY A;  1IXR C;  3Q0U A;  2XSJ C;  3Q0W A;  3KP3 A;  4GFB A;  3BG6 A;  3PNV A;  4JX6 A;  3OS2 A;  1MDM A;  3ZQI A;  4Q5S F;  2YX4 A;  4N0B A;  1S9H A;  4XLF A;  2K02 A;  1JI8 A;  3TBI A;  2M34 A;  3BT9 A;  5CVJ A;  1X19 A;  2MA3 A;  3KZI C;  2XAJ A;  5E79 C;  1YOV B;  2F5D A;  5FRN A;  4Y3O A;  3GTO J;  1MH3 A;  1UHM A;  3IWF A;  4IKF A;  4ZYA A;  4Y33 A;  2WAQ N;  3OR1 C;  3GTM J;  3FIW A;  1HF0 A;  3MWM A;  5D4S A;  5B66 C;  2QSG X;  2BW3 A;  2RNJ A;  3JRG A;  3WTZ A;  4XIC A;  3D5L A;  2QEN A;  2EBI A;  3BTL A;  3F6O A;  4LG0 B;  5JHF A;  1U8R A;  1WVR A;  3L00 A;  3MCZ A;  3SEQ A;  2MC4 A;  5F1J A;  1BL0 A;  2KDO A;  4CH7 A;  3HHG A;  3GFJ A;  3WU1 B;  1SVM A;  3LA3 A;  5EEH A;  2JUC A;  2DO7 A;  4MFE A;  3RPU A;  3TP0 A;  2E7X A;  3ABM H;  3H5A A;  4YFN F;  2QWW A;  3K4C A;  2FBI A;  4G94 A;  3I58 A;  1B8I A;  2IT0 A;  2UUZ A;  2ZSH B;  3D1N I;  5GPA A;  4OMZ A;  2V7F A;  1A31 A;  3DBH B;  4JQF A;  2BEO A;  2NVT J;  4DYC A;  2DPU A;  1V5E A;  2PFB A;  2EA4 A;  2K9L A;  5E20 A;  4OAZ A;  3RSN A;  3H9G A;  3GWZ A;  4J19 A;  3WU0 A;  4A5N A;  2XAQ A;  1GXP A;  1TLH B;  1V55 H;  5LFA A;  1IV6 A;  2GA2 A;  2QLZ A;  3N4M A;  1IV8 A;  4P9U A;  4BQQ A;  3RKY A;  2IS2 A;  4E7K A;  1Z67 A;  2J5P A;  2RAE A;  1SVO A;  2AHQ A;  4LK0 F;  3EUA A;  1PUF B;  2F5F A;  2B63 J;  4DYR A;  5EG0 A;  3ASN H;  4AUX A;  1MNE A;  2WAQ A;  3LMM A;  2TCT A;  2CSO A;  4YRV A;  1FEX A;  4FT8 A;  4MIM A;  2LYC A;  3S15 J;  1J75 A;  4PJ0 C;  5ICF A;  1S72 I;  4A3L J;  2DI3 A;  2JRT A;  4ZYG A;  5D6E A;  4CGZ A;  3H0G J;  4X1E A;  1R49 A;  4OU0 A;  4XR6 A;  3CCV I;  3P7N A;  4D0P A;  2DQL A;  1T39 A;  2RC4 A;  5FLX Z;  2JMW A;  5FKO A;  3I56 I;  2PJP A;  4IHT A;  4AYB N;  4HA8 A;  1YW7 A;  2R7D A;  1QA6 A;  4HF0 A;  2P6T A;  4P55 A;  3JCU C;  1X3Z B;  2DLL A;  2LKS A;  1I1S A;  3IRQ A;  2STT A;  2R7Z J;  4XLP F;  1RES A;  3REO A;  5BNG A;  3A0H C;  1V5G A;  2Z33 A;  1KQ0 A;  1VQ9 I;  5BS6 A;  2KLO A;  1TWC J;  2XRL A;  3LSM A;  1DPR A;  4S04 A;  3HEF A;  4KIF A;  4V2G A;  4I6Z A;  2FQ3 A;  4MGR A;  3E6C C;  1XMX A;  2W25 A;  1GVD A;  4NNJ A;  3G73 A;  2EIM H;  4A3K J;  2A07 F;  2CFO A;  1XGM A;  3HOW J;  2CQX A;  4HG2 A;  2N8G A;  1R5G A;  2VT2 A;  1Z3Y A;  4FX0 A;  4KMU X;  1SD6 A;  2DMT A;  3FM5 A;  4UUS A;  2H27 A;  1W7P B;  1WI3 A;  2MBF A;  2E7W A;  5DM6 F;  3DKY A;  1PVE A;  1YFH A;  1TQP A;  5A2Q K;  5E3O A;  2DYS H;  1MJ9 A;  2LC2 A;  4RGU A;  4RAZ A;  1VQM I;  2RDP A;  1IJW C;  2G0E A;  2VQG A;  1UG2 A;  2OTL I;  1IUF A;  2ZXW H;  4F3Q A;  3F8M A;  1ZAO A;  4AYB A;  2A5Y B;  3WTW C;  1Z21 A;  3E97 A;  1MSE C;  4HRI A;  4AIJ A;  4XOP A;  3ZGK A;  3OYI A;  4PZJ A;  2F5V A;  4IJA A;  5J8C A;  1LQ1 A;  2TDX A;  1OMI A;  1ZR4 A;  3G1L A;  1QZZ A;  5LHG A;  2ZCW A;  1Z6T A;  3AL0 B;  2R5Z A;  2L7Z A;  3CDI A;  2AQE A;  5E3N A;  3ESW B;  1TQM A;  5L3E A;  5EZG A;  3L2R A;  1Z77 A;  4B43 A;  1YIT I;  2ELJ A;  2K4B A;  5FLV A;  5HVQ C;  5DUI A;  4X6A J;  1BR1 A;  3EPZ A;  2PG4 A;  4XQF A;  3PSI A;  3RKQ A;  4AIH A;  4CUG A;  2YS9 A;  1FPQ A;  3GFI A;  4ZTJ A;  1S3J A;  2OAZ A;  4B48 A;  1E17 A;  1WZ2 A;  2HKX A;  3CLO A;  3LSR A;  2DA7 A;  2V6C A;  1E2X A;  2ZME B;  3JRE A;  3K69 A;  1LUJ B;  1CGP A;  2ISY A;  1RR7 A;  1IGN A;  5D8K B;  1H89 C;  5EGO B;  4B44 A;  4KFC A;  1ODD A;  3H35 A;  3S2W A;  3WE2 A;  5DDG A;  9ANT A;  5BOX A;  1FYK A;  1R4N B;  3CMA I;  2JWT A;  1E3O C;  4U88 A;  5K1Y A;  1Z0X A;  2KRH A;  4DOZ A;  3ZR8 X;  4FCY A;  2IGN A;  5LD2 C;  3M4O J;  3I9V 2;  1IDY A;  1J0R A;  1BIA A;  1J5Y A;  2G9W A;  2UWM A;  2MLK A;  1ZRF A;  4ZC3 A;  1MMD A;  5BPD A;  2LF7 A;  3R61 A;  2E34 A;  2P5K A;  3RKX A;  1ZN2 A;  4MO7 A;  4Q47 A;  4BBS J;  3HTU A;  1BIB A;  1LB2 A;  3B02 A;  3WTY C;  1MNM C;  1LFU P;  4DW6 A;  2PQ8 A;  3QYE A;  1BC8 C;  3CF2 A;  1ZEL A;  3K4L A;  5L3D A;  3DTK A;  5IYC J;  1YW9 A;  2EWN A;  4PJJ A;  3S1Q J;  1UFM A;  2CMP A;  1W36 D;  1ZG1 A;  1X3U A;  2DBB A;  3NAR A;  3G1M A;  5ILV A;  1MMG A;  1JT6 A;  3B73 A;  2DT5 A;  2OCE A;  3H5R A;  1XSV A;  4ZH4 F;  1SFX A;  4Z2Y A;  3ZMT A;  1Z1D A;  3TDZ C;  4BJ6 C;  2F4I A;  2FBK A;  5B1B H;  3FXR A;  4LG3 A;  3JRA A;  1VQO I;  2YU3 A;  2PMZ N;  5DYM A;  2P5V A;  3PL8 A;  4BQN A;  1YRN B;  5ILS A;  4HV6 A;  2MFZ A;  5HS9 A;  1JJ8 C;  4QLC U;  4NHJ A;  1V54 H;  2VN2 A;  1WH5 A;  2EK5 A;  2XPV A;  2E19 A;  3WOD F;  4BEH A;  4EJT A;  3AL0 C;  2Z1D A;  3JRD A;  1HCR A;  3ZMV A;  2BZT A;  4WXD A;  4G6T B;  3CCY A;  1U8B A;  3JW4 A;  2FUG 2;  2DJN A;  3OMY A;  3SFZ A;  3L9F A;  2QBY B;  3WG9 A;  3BR1 A;  2KZV A;  3GZN B;  5IT9 K;  4XID A;  2K9N A;  4D9J A;  1YO5 C;  3I3L A;  1UHS A;  2X6Y A;  4V2F A;  5H6R A;  4XL9 A;  4ESB A;  3SZT A;  4A3D J;  3BTC A;  3H9J A;  1TL8 A;  1T56 A;  1N75 A;  1F9N A;  1ZQ3 P;  1Y56 A;  2XSD C;  2FD5 A;  2ZME C;  3EUK L;  1KZH A;  2EJR A;  4MEX F;  1STZ A;  5IP6 A;  5HS8 A;  1IXS B;  2DFI A;  4G7Z F;  1RUO A;  3AFH A;  2I5U A;  3HTS B;  3E3V A;  2GZW A;  5CJ9 A;  3GLX A;  2FOK A;  2IP2 A;  3CLQ A;  4M9S A;  2XDV A;  1LVK A;  3ZCO A;  4EGY A;  1AKH B;  4IHY A;  1QZY A;  4GRI A;  5E8I A;  1RI7 A;  2L0K A;  3DPT A;  3K7A J;  1RC9 A;  3ZQF A;  4BNC A;  2PMZ A;  3VYU B;  1X2N A;  2KRC A;  5JFR A;  3S3N A;  4JYK A;  1X58 A;  1VTN C;  1QPI A;  3FMR A;  4A93 J;  2DYR H;  4RBO A;  5GAE J;  1OLT A;  1XDS A;  1T0F A;  3V7C A;  4IOA F;  2DOE A;  3E6D A;  1NK3 P;  3H3U A;  2TRT A;  1IRF A;  4XNF A;  2KQR A;  2A61 A;  3C2H A;  2EQR A;  1MJA A;  3W2W A;  4XKB A;  2VT3 A;  2A3S A;  4XLN F;  5M5X J;  2DPD A;  4O3M A;  4GYI A;  1X2M A;  4NQW B;  3FXK A;  3M9A A;  3S2D J;  3RQ4 A;  1HSJ A;  3V7S A;  1U5T B;  2A6E F;  1FYM A;  2HVS A;  4E7I A;  1D0Z A;  2OC6 A;  1ZK8 A;  3F8B A;  2E71 A;  1K7A A;  3GTQ J;  2HTJ A;  2XAU A;  3GYH X;  1WH7 A;  1BM9 A;  1NTC A;  5DCM A;  2EIJ H;  3OR2 C;  3S93 A;  4EV0 A;  4LIT A;  5LEK A;  3ZQL A;  1PJR A;  4P9F A;  1IUY A;  2R3S A;  2RN7 A;  3OYJ A;  4ZZD A;  4RS8 A;  3SZG A;  2ZKZ A;  1IRX A;  2EFN A;  4G8X A;  3DPU A;  3N97 A;  3D5S C;  4RB0 A;  4XRF A;  2LBF A;  3M1E A;  3CQZ J;  1GV2 A;  1QQI A;  3ABK H;  3IV5 A;  2BVL A;  1IN6 A;  3KLO A;  1TC3 C;  4L9N A;  4OIP F;  1MZB A;  3OYC A;  3LSP A;  4CCK A;  5BPI A;  2F4M B;  2K7L A;  1HQC A;  1OIS A;  1APL C;  4HV5 A;  1S5L C;  4CZC A;  3IH4 A;  2L7F P;  3Q9V A;  2RGV A;  1MBK A;  3BJO A;  3CJQ B;  3RTR A;  3O8G A;  3CME I;  3DCF A;  1Q1H A;  2HOA A;  1K79 A;  4C2U A;  2MD5 A;  2VBW A;  3V8J A;  4XLA A;  2Q8K A;  2EFO A;  2STW A;  1Y6I A;  1U0J A;  2L3D A;  2IRF G;  5FRM A;  1LEA A;  1P4X A;  3F8N A;  5M5Y J;  1H8A C;  1W5C C;  2BHY A;  5F08 A;  4DBR A;  5CLS A;  1WPK A;  4KA4 A;  3E7L A;  1L0O C;  3GZ5 A;  2IA2 A;  2V6E A;  3BP8 A;  2ECB A;  4EJU A;  4Y52 J;  4B4C A;  1GDT A;  1JKO C;  2P8T A;  3H1C A;  3TKY A;  5HDK A;  4L9T A;  1B6A A;  4R1H A;  4BJ5 C;  2FNA A;  1QNT A;  2O8K A;  4DIQ A;  2KMU A;  3FKJ A;  5LRR A;  4MEY F;  2X48 A;  5EF6 A;  2X85 A;  2W24 A;  1IO2 A;  2JSC A;  3JRF A;  4DBQ A;  3GXO A;  1A6Q A;  2VKD A;  3PO3 J;  2K9Q A;  5K7F A;  5L3F A;  2V26 A;  2H1K A;  3T5X A;  1ZGW A;  2UZK A;  3A2K A;  4IL6 C;  3HUG B;  1U5T C;  4D5C A;  2W00 A;  3U1K A;  3G2B A;  4JX4 A;  1VF9 A;  2M45 A;  4RMN A;  1TNT A;  3VWB A;  3X2Q H;  2R7F A;  1JJ6 C;  2CUZ A;  3M7G A;  2F4O B;  5J4Y A;  1ZLJ A;  4BXX J;  3IH3 A;  3TOB A;  4ZYD A;  1JE8 A;  3FXO A;  1S6L A;  1FMW A;  3DPL C;  3MZ8 A;  2JA5 J;  2H6B A;  1I3Q J;  2HI3 A;  4HEA 2;  2VKE A;  4OIR F;  5KK1 A;  2FF4 A;  1UB9 A;  2ESH A;  2WV0 A;  2VPR A;  3ZXS A;  1OCC H;  1K78 B;  2ZNY A;  2WB1 N;  4AID A;  1ON2 A;  1O3T A;  4KNY A;  1TZL A;  3O8H A;  1W0U A;  2CQK A;  4NDL A;  5AIQ A;  4JX5 A;  4A2U A;  4E6K G;  5GP9 A;  2A68 F;  5HNF A;  3CMM A;  3LA2 A;  2P5L C;  2HPM A;  3GZ6 A;  1Z05 A;  5IT9 Z;  3O2P E;  2VXZ A;  5FD6 A;  3LSH A;  3IP4 B;  1EH6 A;  1SFK A;  4R8H A;  4RDU A;  2R7S A;  3A01 A;  2OUM A;  5IY5 H;  1OCP A;  1Y1V J;  1XB4 A;  3BZC A;  3SHF A;  2Q1Z B;  2HDC A;  1RR8 C;  1ZLK A;  1SFE A;  3MKW B;  2FJ1 A;  4V19 K;  2FNP A;  1MDM B;  3VSL A;  5D5W B;  1DP3 A;  4CYC A;  1R5I D;  5ICG A;  2DA6 A;  1MBE A;  2ZO4 A;  1MJB A;  2MH9 A;  1H88 C;  3AAF A;  1YIO A;  1ZKG A;  1EH7 A;  2COM A;  3RIR A;  5E1Z B;  2OQR A;  1DPU A;  2K4J A;  1ZGA A;  2OZU A;  5D6F A;  2I10 A;  2XIG A;  2M3A A;  3ZOB A;  4KT6 A;  1YS6 A;  3HZJ A;  4CYD A;  2R7W A;  4HX8 A;  2DXI A;  2BW3 B;  3VDX A;  2PI0 A;  4CXF A;  2CQN A;  2DMP A;  4FIS A;  2M1B A;  3IL2 A;  1P6R A;  3S3O A;  3ECO A;  2QYO A;  1J9I A;  3HOY J;  5B1A H;  3ISP A;  3T8T A;  4NB5 A;  4C9Y A;  3LQQ A;  3VOE A;  2L4M A;  2CW7 A;  4QIW N;  3M07 A;  2NNY A;  2L5Q A;  3DQV C;  1RET A;  2LDU A;  2VAS A;  2WAE A;  2EZL A;  4M6X A;  2QUF A;  1B8I B;  3PJR A;  1PDN C;  1IN4 A;  1IN8 A;  2GM4 A;  3PFI A;  3ZMZ A;  1J59 A;  5J8F A;  4M3G A;  2E1N A;  3T8R A;  5E18 F;  2Y9Y A;  4S05 A;  4BHB A;  1HC8 A;  2A69 F;  3HSR A;  2VE8 A;  5GTI C;  3SFI A;  5HOD A;  4KIS A;  2LP0 A;  4GYG A;  2DA3 A;  3K4M A;  1BI3 A;  3FXM A;  4RM2 A;  3HDD A;  5GAH J;  5L3B A;  1T08 B;  5F27 A;  2QSH X;  5L3G A;  1FSE A;  2KDZ A;  1BOA A;  3CDH A;  4ZZL A;  1YYV A;  3KIO A;  1OR7 A;  1YX3 A;  5JVT A;  1USS A;  5GAG J;  2LD5 A;  3KP4 A;  1Z7U A;  4B09 A;  1JGG A;  2DDB A;  3DV8 A;  1F1Z A;  1KYZ A;  4EAT A;  2HYG D;  4I98 B;  2XB5 A;  2Y0S N;  1WI9 A;  2YUS A;  3NQO A;  3TP3 A;  3WTV C;  4OIQ F;  2GOM A;  4B8X A;  3MKL A;  3IUO A;  4BUP A;  3CUQ A;  1RNL A;  4BDZ A;  2KIF A;  3HSE A;  1QZE A;  1RUN A;  1R7J A;  4HNV A;  2CJJ A;  3WTU C;  2K85 A;  2LLK A;  1UJ8 A;  3C2G A;  3IH2 A;  1B59 A;  2XKP A;  5J1Y A;  3BY6 A;  3BOQ A;  3IKT A;  2P4W A;  3OSG A;  2JA2 A;  3AG4 H;  4I02 A;  2UXX A;  2VL8 A;  2O8X A;  2CV0 A;  4AD9 A;  1FMV A;  3OYE A;  4ABZ A;  5TRD A;  1ZRD A;  2GXB A;  1B4A A;  2V9K A;  3FX3 A;  3OS0 A;  3H5N A;  3FXU A;  4RA2 A;  3MZY A;  3P9I A;  1MBG A;  1YJN I;  2VON A;  2OA4 A;  4LGW A;  5F0H A;  2E1M B;  4RGR A;  4WF2 A;  4M3E A;  3ERE D;  4KN7 X;  2FSW A;  4LFU A;  1FZP B;  1LKX A;  3GVA A;  2L9V A;  4A5M A;  3F22 A;  3H92 A;  5BQT A;  2JVH A;  1SD7 A;  3DKX A;  3HOZ J;  2IGO A;  1MMN A;  3ZMD A;  3KE2 A;  4DYQ A;  2JPC A;  1KU7 A;  5J4V A;  4UNO A;  3LSK A;  2LF8 A;  3CDL A;  3S17 J;  3EUH A;  4UUS B;  4NUB A;  2HOT A;  4CCM A;  3QYF A;  2ESN A;  2HZD A;  3DEE A;  1MIJ A;  1BOB A;  1VQK I;  4AM3 A;  2Y0S A;  1Y0N A;  3KEO A;  3H0D A;  4WXC A;  1G6N A;  4XLC A;  1FIA A;  2JJ7 A;  3LOC A;  3RKW A;  4DZP A;  4QSH A;  1Z7L A;  3KEY A;  1GLN A;  2CV1 A;  1TW3 A;  4LLN A;  1RKT A;  4EM2 A;  2GBY A;  1Y0U A;  2JPB A;  4U0Y A;  3I59 A;  3I4N J;  4GO1 A;  2P7C B;  2CUE A;  4FX4 A;  4R79 A;  1R5H A;  3CCR I;  1QGP A;  1HBX G;  2IGK A;  1AWC A;  3GTG J;  1X3W B;  1L3L A;  4PCQ A;  3KFW X;  3UKG A;  2R5Z B;  1QVT A;  3HRT A;  4UXN A;  3IWZ A;  3CC7 I;  1ETY A;  2VB6 A;  4A6E A;  1U78 A;  2WBM A;  4PJM A;  1VQ8 I;  4HF1 A;  3HOS A;  3LFU A;  3L2W A;  5HOO A;  1A5J A;  5EJC A;  2LMD A;  4U0W A;  3BZK A;  5CQG A;  4H0E A;  2V79 A;  1ULY A;  2QF7 A;  4AC0 A;  2NYX A;  1S29 A;  1QHH D;  1ZH5 A;  2DK5 A;  2KRF A;  3ABT A;  3CMY A;  3PSF A;  4XN3 A;  5DD8 A;  3GBG A;  3MD2 A;  2LNB A;  5F1R A;  1OCT C;  3HSF A;  2K40 A;  4HZF A;  1Y8R B;  4NC8 A;  5KAF C;  4AWX B;  4TV7 A;  3KP5 A;  1G3S A;  5AON A;  1VQL I;  4HBL A;  5TIS C;  4MTD A;  1VQ4 I;  5LHH A;  1XCV A;  2DA5 A;  1FBU A;  2CS3 A;  1V4R A;  2COB A;  3HRS A;  2M8G X;  3PQK A;  2E1M C;  4A3J J;  2MGQ A;  1MKM A;  3Q0V A;  4D7N A;  1A35 A;  1DGW Y;  1XMA A;  3ZQG A;  2EIN H;  5CQE A;  3CCS I;  3E6M A;  4XOR A;  3K10 A;  4MHG A;  3V4G A;  1HST A;  4LIV A;  1MBF A;  4KIB A;  1SAX A;  1IAW A;  1Z9C A;  1TQI A;  2NS7 A;  4DNC A;  1FP2 A;  1K83 J;  3OV8 A;  2X1C A;  1MBH A;  1IC8 A;  2EFQ A;  4I09 A;  1BI2 A;  3QQA A;  2A5W A;  5M3F J;  2M0M A;  3VB2 A;  3BR3 A;  3SYT A;  3HPG A;  4OOI A;  1ITY A;  2PN6 A;  2VC1 A;  4OIN F;  2XAH A;  3TO6 A;  1O3S A;  4UV9 A;  3CJR B;  2IA0 A;  4UVB A;  4HST A;  4MTE A;  1Y1W J;  1FJL A;  2D2W A;  2AQF A;  5HLG A;  4QPQ A;  5KNL A;  3CO7 C;  4F7Z A;  3O3K A;  2Y31 A;  4JP0 A;  2XB0 X;  1T98 A;  4U7D A;  3KYL A;  2IBD A;  2UXN A;  3F23 A;  4BEH B;  3BR5 A;  4XN0 A;  2KL4 A;  5CYV A;  2X6W A;  5KVR A;  1WJ5 A;  2PJR A;  4IQJ A;  4UV8 A;  2E1O A;  2DTR A;  1FYL A;  4W1U A;  2RRE A;  1F4K A;  1REP C;  2RKH A;  3OYB A;  4C30 A;  4HF2 A;  2JZY A;  2CW0 F;  5C3E J;  4PDK A;  3DEU A;  2M2E A;  5H6Q A;  4YFX F;  1SC7 A;  3MMY B;  4IEJ A;  1BJZ A;  4BAC A;  3TMO A;  4G7H F;  1FTZ A;  3ZMU A;  3OYH A;  4PGG A;  1BW6 A;  3BJA A;  3A02 A;  1WWX A;  2FA5 A;  3FK7 A;  1HKQ A;  5EEA A;  3P5J A;  3W2A A;  3P9C A;  1LE8 A;  2HKO A;  2VJ4 A;  4M71 A;  2RQP A;  4I7H A;  1D8K A;  1YIJ I;  2HR3 A;  3M8F A;  2LY1 A;  4IXA A;  5CVR A;  1T6S A;  5HS7 A;  3KLN A;  4I01 A;  3C7J A;  3CTA A;  1QU3 A;  1XS9 A;  2LFB A;  1IN5 A;  1PP7 U;  4C3I J;  3SZP A;  4ZDP A;  3OYL A;  2ZJQ F;  1VQP I;  2EH3 A;  5J1U A;  1D3Y A;  1DDN A;  3PNT A;  2IPQ X;  2EV0 A;  3AG1 H;  2JA7 J;  1ETO A;  3KPH A;  3QP5 A;  1IZ1 A;  2OJE D;  4FET A;  2BHZ A;  1LFP A;  3ROU A;  5ICE A;  1DU6 A;  4Y4R A;  3W2V A;  2VKV A;  4CCN A;  3GTL J;  1DU0 A;  3EQL F;  1U6G A;  2IXS A;  3OY9 A;  1N78 A;  2E2I J;  2ETH A;  4LIU A;  5IOY A;  5DEQ A;  5HLT A;  3WGG A;  2DK8 A;  2A05 A;  1G3Y A;  5ED4 A;  1W4M A;  4LB5 A;  2RV8 A;  2VQC A;  1K6Y A;  3JRC A;  1KON A;  3CP2 A;  2Q2E A;  1WJE A;  3HC7 A;  4ON0 A;  3OYM A;  2IGM A;  1Y39 A;  5LBQ A;  3JRI A;  1D0X A;  4I99 C;  4CDG A;  3JTG A;  1ZG5 A;  1YTY A;  2WV1 A;  4BBR J;  2B0L A;  2XF5 A;  3CF5 F;  3HRU A;  2NRA C;  2ZFU A;  1P2F A;  3SDB A;  3PO2 J;  2F5C A;  3IHU A;  3HGG A;  4A69 C;  3WGI A;  1QHG A;  4EGZ A;  5DV5 A;  5DCM B;  1TT0 A;  1KYW A;  2HPI A;  4RAG A;  4L9V A;  3DTI A;  1G3T A;  1MMA A;  4BY1 J;  4G12 A;  1JKR C;  4P96 A;  4EVI A;  1D1B A;  1MW7 A;  3DFG A;  4PSX A;  4CCJ A;  4P1W A;  3SJM A;  2XF7 A;  5KCM A;  2DOA A;  2L02 A;  4BHC A;  3DF8 A;  4RGX A;  2ZME A;  3K1M A;  3CZ6 A;  3H3Z A;  2M4K A;  5L3C A;  1VQ5 I;  2L2O A;  2VOO A;  4IVN A;  4BQA A;  1D1C A;  2ACJ A;  2D5V A;  3RYP A;  4F92 B;  4G6D A;  5DS9 A;  4YIF A;  1UEL B;  2VJI A;  3W6K B;  2JTV A;  1M1E B;  2DFE A;  3CJN A;  4CZZ A;  5J47 A;  1UMQ A;  4Y17 A;  3D5R C;  2DDA A;  2QZ8 A;  5F6F A;  3ULQ B;  3RZO J;  3J80 Z;  3KEQ A;  4DJA A;  4BS9 A;  3ZQH A;  5HLH A;  2NVY J;  3KP6 A;  3ZMS A;  3PM1 A;  3OYF A;  2FEZ A;  4KT5 C;  1VND A;  2R7X A;  3IRR A;  3FXQ A;  3I64 A;  1FIP A;  3D0S A;  1YJ9 I;  1DGR M;  1JXS A;  3GTP J;  2EZH A;  3BR6 A;  1FLI A;  1FY7 A;  4UVA A;  1KQ8 A;  5LHI A;  1ETW A;  1FOY A;  2Z16 A;  3S1R J;  1EA3 A;  3U2R A;  2O03 A;  2CFX A;  5H20 A;  1YQA A;  4N4O B;  3ELK A;  3HJE A;  5DTD A;  5IPA A;  3J81 Z;  3H3V K;  2R7U A;  3ZN0 A;  4MLO A;  3PIO F;  2FMY A;  2OBP A;  2E5N A;  5FFZ A;  1I1G A;  2LH9 A;  1EH8 A;  2MLG A;  3BJ6 A;  4BL0 B;  2WY7 Q;  2LRE A;  4CA0 A;  1ERD A;  2R5Y A;  4HDV A;  4ETS A;  3RZD J;  3BR0 A;  4P5O A;  4YEJ A;  1YW8 A;  4MFD A;  1ZR2 A;  1IF1 A;  3OWT A;  4IX7 A;  1YRN A;  4GXO A;  1DUX C;  2R0Q C;  3K9T A;  3GW2 A;  5DCF A;  2LG4 A;  1R6R A;  1OPC A;  4FE4 A;  4ITV A;  2Y30 A;  1H9G A;  1SVL A;  3DWL E;  3OL3 A;  3HOX J;  5F04 A;  4HQM A;  3CC2 I;  5FLM J;  1O7L A;  3L2C A;  2LY2 A;  5AIP A;  2XPU A;  3LL7 A;  2ICW G;  2XGD A;  1OFC X;  4KJZ A;  2PMH A;  3WTS C;  1IDZ A;  3A03 A;  2EFW A;  3MEX A;  3MN2 A;  3LST A;  3K4J A;  1LDJ A;  4F55 A;  4BYY A;  4CCO A;  1O4X A;  1ACI A;  3K70 C;  5ERI A;  3SQN A;  4G7O F;  1XGN A;  2MD0 A;  4LMY A;  1FOX A;  1P4A A;  4KUM A;  1B72 A;  2OV7 A;  2DT7 B;  1E0E A;  1PUE E;  1D1A A;  3IAM 2;  2ISZ A;  2CG4 A;  3HB9 A;  5FKN A;  2V9V A;  2HQN A;  3LQR A;  4KIG A;  3FZV A;  2EFP A;  4HNT A;  1TTY A;  5LRS A;  4HLY A;  4A3B J;  3COA C;  2HQR A;  4M6Y A;  4XMY A;  5HDN A;  2L9S A;  3ONQ A;  1PYV A;  2MAB A;  4QPO A;  1EF4 A;  3Q5F A;  2W48 A;  4BHP A;  1P7J A;  3A01 B;  1AKH A;  2V9P A;  1BJA A;  1GUU A;  2Z5U A;  2HZT A;  3E5U A;  2B9S A;  2H09 A;  2HQA A;  1SEU A;  1GHC A;  1FWZ A;  3K4B A;  3S1N J;  2GAU A;  1EJ9 A;  4CYC B;  4FHT A;  4PJL A;  4IRG A;  2BGC A;  3TOA A;  4A0Z A;  4HNU A;  1DP7 P;  2V1X A;  3L2U A;  2QM3 A;  2W85 A;  4BGD A;  3ZP5 A;  2M5W A;  1UAA A;  4E70 A;  5HDG A;  3OIO A;  4L0Z B;  1J09 A;  2ELK A;  4HX4 A;  2MG4 A;  3JRB A;  1BI1 A;  4A3C J;  4M3B A;  3A1Y A;  4L5E A;  2IEK A;  1U3E M;  2Z3Y A;  4O6J A;  4NQW A;  2G7H A;  4L5I A;  2DW4 A;  2GQQ A;  3R0A A;  5DD4 A;  3W6V A;  1ZGJ A;  3IC7 A;  1WSU A;  2QQB A;  1U5T A;  2R7R A;  2ECC A;  5J3L A;  3TW7 A;  2XAF A;  3CCM I;  2QSF X;  3EDP A;  4DQ2 A;  5LGN A;  1BBY A;  1RIO H;  4LOC A;  2O61 A;  5K5R A;  3OYN A;  1I50 J;  2FOW A;  4UUT A;  2FU4 A;  1R4M B;  1WRJ A;  1F36 A;  4LK1 F;  4XLE A;  1XPX A;  1NHA A;  2MYS A;  1LDK B;  2CQ7 A;  1K4T A;  1CF7 A;  3NAU A;  3FIS A;  1XSD A;  5D5V B;  3RPQ A;  3I71 A;  3BDD A;  2FML A;  1H9T A;  1SD4 A;  3E5X A;  2DA2 A;  4E7S A;  5K5O A;  2AO9 A;  2K5C A;  3S8P A;  3HGY A;  4W97 A;  3VYS B;  1A36 A;  2K3F A;  2PEX A;  2R7T A;  1HLV A;  1F5T A;  3K2A A;  2Y48 A;  2LOO A;  3SDG A;  3G71 I;  2JT1 A;  2NOJ B;  4M6V A;  4MQV A;  2HFH A;  2CYY A;  1XG1 A;  4CO8 A;  2VOP A;  1A04 A;  4IOC F;  2QKM B;  1U9O A;  5D5U B;  4U7B A;  1POG A;  2FRH A;  2XUB A;  1FOK A;  4GGG A;  4IRI A;  2X6O A;  2ID3 A;  1ZHF A;  4HPQ A;  3I4M J;  1HOM A;  5FJ8 J;  1B1B A;  2JVG A;  1UHW A;  4HOB A;  3QPS A;  1P9Q C;  2E5Z A;  2ME0 A;  1MD0 A;  2VKH A;  3QPT A;  5JVG F;  1XDU A;  3CUQ B;  3FF5 A;  1GV5 A;  5FGM A;  1TT5 B;  3BTI A;  3IAS 2;  5GAD J;  4ZYE A;  4WK8 F;  1I39 A;  3FM3 A;  3TDU C;  2KP6 A;  1ETX A;  3G3Z A;  4BH9 A;  3GUD A;  2AXL A;  2OTJ I;  3E6B A;  4ZDO A;  1Y8Q B;  1LPQ A;  3QYB A;  2IS6 A;  2WY8 Q;  1JKP C;  2EPF A;  2CU7 A;  2ZB9 A;  5LLQ A;  2CRG A;  2ZC2 A;  2HXI A;  1YJW I;  1FBQ A;  1FC3 A;  2P0W A;  4C3J J;  2O9L A;  1P4W A;  2DT6 A;  2IJL A;  3FWE A;  5LGU A;  2J5O A;  3GFM A;  4L18 B;  3AG2 H;  4RB2 C;  3CD6 I;  1FNN A;  1BW5 A;  1I6X A;  3BRO A;  2BE5 F;  3NEU A;  3VSK A;  1IRZ A;  3LSJ A;  1Z6R A;  2I8D A;  2DCE A;  3M3Y J;  5E3M A;  2PX9 A;  2BXY A;  2XV4 S;  1VZ0 A;  1ETV A;  1HXD A;  3H9Q A;  4KYW A;  1X1A A;  4PK4 A;  2HTS A;  2L7M P;  1GXQ A;  1RZ4 A;  2A6T A;  1ZYR F;  2VPL A;  1T8I A;  4LLL A;  1QVU A;  4XK4 A;  3BG9 A;  3CES A;  1TWG J;  1JUP A;  3A4C A;  4A3I J;  1W7P D;  4UUV A;  4HAM A;  4OMY A;  2FE3 A;  3QU3 A;  3MVP A;  3ZQ7 A;  5JLW A;  2JK3 A;  2AXT C;  4D7M A;  2W82 A;  2Y75 A;  4I0B A;  1W5T A;  2EA2 A;  3LAJ A;  2K3P A;  3TED A;  1W1W E;  2PBI A;  1I3A A;  4IQ4 A;  3TGN A;  2ZXH A;  5CVI A;  2QQ8 A;  5EG0 B;  3L2V A;  3WE3 A;  4AU7 A;  2XRO A;  2DMU A;  1NG6 A;  3OYD A;  2BOL A;  3DLL F;  4JK1 X;  2GIV A;  3F9K A;  3CCJ I;  2NAZ A;  3TW6 A;  2WA0 A;  2X51 A;  3K4N A;  4BQO A;  2CUF A;  2ZXI A;  5B5E C;  3GCM A;  2DU9 A;  3GF2 A;  3J7A O;  1SFU A;  5LEJ A;  1R58 A;  1OR7 C;  1JUS A;  2WWY A;  1TW2 A;  3GTK J;  2E1C A;  4Q4Z F;  2YSR A;  2H94 A;  1FX7 A;  5M5W J;  4A6D A;  1XN7 A;  2KJB A;  3U1D A;  1YX5 A;  3NWS A;  4F52 A;  3PNY A;  1XCB A;  4EM0 B;  3CUQ C;  3WTT C;  5IP9 J;  1LNW A;  1FSH A;  4HX7 A;  3CCL I;  3CCQ I;  4NBQ A;  1E3P A;  3FKI J;  4F91 B;  2H6C A;  1W5S A;  2E36 A;  4N9H A;  3M8E A;  3ABU A;  2LVS A;  4WXH A;  2HYF A;  2LK2 A;  3Q9S A;  2XHK A;  1UG0 A;  4CSW A;  4I0A A;  2O6G E;  1KQ9 A;  4PFP A;  2C6Y A;  3CJT B;  2Y9Z A;  1HKT A;  2V4J C;  3ABL H;  4Z6Y A;  1G2H A;  1TWH J;  2F48 A;  3CUO A;  3I0T A;  3VPR A;  1JHH A;  3U9G A;  4OAY A;  3V7R A;  3VYT B;  1F43 A;  2DMN A;  1OCR H;  4XRS A;  5EZH A;  1WKM A;  2KT0 A;  2CH0 A;  3GTJ J;  4AVZ A;  1BN5 A;  2KFD A;  1R71 A;  1HKS A;  3UNG C;  4FQG A;  3K0L A;  4XSX F;  1FT9 A;  2Z2S B;  1QPM A;  5JR3 A;  3V8K A;  3BR2 A;  4M73 A;  3OL4 A;  1X4O A;  1A6I A;  3LSI A;  3HL2 A;  4D5F A;  1T95 A;  2K9S A;  2DTZ A;  2M8E A;  3FHZ A;  1HDD C;  2O5R A;  3NRV A;  4FE7 A;  4E7J A;  1S7O A;  3EUH C;  2JQ7 A;  2CV2 A;  3E5Q A;  4WX9 A;  3FMS A;  4IHS A;  1R1V A;  3OS1 A;  3OOU A;  2RNG A;  3V42 A;  1CQT A;  2R93 J;  3NWT A;  2M87 A;  4XRM A;  2HDW A;  1S8N A;  1TBX A;  2VJ5 A;  2CQQ A;  2OD5 A;  5HLI A;  3HOT A;  3ECH A;  3PFY A;  4IZZ A;  3F3X A;  4WWC A;  1UCR A;  1J2X A;  2FQ4 A;  3F8F A;  5GTH C;  1K4S A;  3GEZ A;  2HQ5 A;  3BCB A;  3CCU I;  3QWL A;  5JLX A;  4FTH A;  4ZTF A;  5DM7 F;  3WHB A;  4CIC A;  3LSG A;  2AS5 F;  2BY3 A;  1JHF A;  1YG2 A;  2JN6 A;  2X1D A;  3R6S A;  4HQE A;  2KIS A;  3HOU J;  1LEB A;  3BC8 A;  1R1T A;  3R4K A;  3J80 K;  4BXU A;  3CO6 C;  3F6V A;  2PJR B;  4M3F A;  5IOZ A;  4E7H A;  4BXF A;  2O7O A;  5FKM A;  2XAS A;  2IAI A;  3G6E I;  4IRH A;  3WTX C;  4EJV A;  4UY8 I;  1ONV A;  4LD5 A;  3LWF A;  3K70 D;  1WJF A;  5E8G A;  4S0H B;  1XTA A;  2M7A A;  2NS0 A;  3OYG A;  4IPA A;  2DN0 A;  4QTR A;  2ME6 A;  2P6S A;  1JUM A;  5FKK A;  4OIO F;  4LG0 A;  2FXA A;  3WGH A;  1LE8 B;  4BAY A;  1DQU A;  1R23 A;  3V8L A;  4E7Z A;  3FMQ A;  1RRJ A;  3DBR B;  4MQ9 F;  3J81 K;  1S7E A;  3AKZ A;  1ZTR A;  4RGS A;  1JTY A;  3QPL A;  3BLY A;  2X4H A;  2X0L A;  3JTH A;  4ESF A;  3LFK A;  1XX5 A;  2QQA A;  2VI6 A;  4BU2 A;  2X1E A;  1R36 A;  2M4G A;  4IHW A;  4EMS A;  2LY9 A;  1LDD A;  1H0M A;  2PMU A;  4WCG A;  3VFZ A;  3FXJ A;  2VC0 A;  2E2J J;  5JHU A;  1VQN I;  4L5J A;  4UVC A;  4C2M J;  4ENN A;  2XC7 A;  1X1P A;  2Z99 A;  3RYR A;  1LVA A;  1OCO H;  3KP7 A;  1HW5 A;  3HOV J;  3N05 A;  1MGT A;  4G6Q A;  1SAU A;  2KHM A;  4M3D A;  3QPH A;  4MNU A;  3TO9 A;  5LGT A;  5D8L B;  2ELH A;  3ASO H;  4I2O A;  4GDF A;  1PUF A;  1V5F A;  3K6G A;  3BG7 A;  4PUS A;  1KGS A;  3E1S A;  5EEG A;  3LNQ A;  3JRH A;  1W0T A;  5B3S H;  1XGO A;  1YHQ I;  2F6C A;  2VUM J;  3VOD A;  3QOP A;  2EZI A;  2DOD A;  4LB6 B;  1IW7 F;  5IP7 J;  4A0Y A;  2Q2E B;  5C4X J;  1S7A A;  3LAP A;  2OU2 A;  2HU9 A;  1WGX A;  5DUK A;  1WQ2 A;  2DOF A;  5CVU A;  5M3M J;  2M9H A;  2MW8 A;  3BTJ A;  3ERM A;  3PIP F;  2E2H J;  2HXO A;  1I27 A;  2NS8 A;  5TGT A;  2JRM A;  4UB6 C;  2GA1 A;  2IW5 A;  4BDY A;  2EB7 A;  1N77 A;  2WAD A;  2V1N A;  4M9Z A;  4I76 A;  3CCE I;  2YPR A;  2O0Y A;  5K7H A;  5ILU A;  1WJD A;  3F0C A;  2VBY A;  1WJA A;  1X1B A;  2L4A A;  1D8J A;  2KZG A;  2L7K A;  3ZN1 A;  4YFK F;  2KPM A;  3VEP A;  1VI0 A;  4Y7N J;  1IXC A;  5FFX A;  2QVO A;  4RB3 C;  2LTP A;  4B3X A;  2IA1 A;  3TO7 A;  2L9N A;  2RQQ A;  2DFF A;  2F2E A;  1FP1 D;  1YI2 I;  1O7F A;  4Y15 A;  3KYD B;  2ZSI B;  3BCA A;  5E17 F;  1JKQ C;  2BYV E;  1JTX A;  4KN4 X;  3S32 A;  1W7P A;  2UV1 A;  1IG7 A;  5H2F C;  4AIK A;  2ZBK A;  2LKX A;  2XGE A;  1BI0 A;  3FDY A;  4BKX A;  1IRG A;  1WCM J;  1VQ6 I;  3E0J B;  1G8X A;  2X9D A;  2Z9O A;  3DKW A;  2L01 A;  1IN7 A;  3OYA A;  3GLL A;  5F0C A;  1T38 A;  1K61 A;  3EYY A;  2HOS A;  1X1C A;  1D0Y A;  1ENH A;  2P7V B;  2PLY A;  4PSW A;  3GFL A;  2LKP A;  2L54 A;  4NC6 A;  1AA7 A;  3GO5 A;  2YU9 J;  4EEF G;  2LRD A;  3R0J A;  4E7L A;  2HVR A;  3G4S I;  2VBX A;  2QA4 I;  4B1R A;  3C3W A;  1BC7 C;  1KU3 A;  4II2 A;  4RM3 A;  2R5Y B;  1WJC A;  3QRF F;  1MSF C;  2IS1 A;  1KU2 A;  4KMF A;  2DMQ A;  2W7N A;  3HHH A;  1SMT A; 
#chains in the Genus database with same CATH homology
 3S1N J;  4CYC B;  5HOD A;  3SFI A;  5E3L A;  2LP0 A;  2DA3 A;  1GVD A;  4IHX A;  4A3K J;  3HDD A;  3S2H J;  5F27 A;  2KDZ A;  3HOW J;  2R92 J;  2CQX A;  2OPT A;  2N8G A;  3OIO A;  2ELK A;  2LD5 A;  2DMT A;  4UUS A;  2MG4 A;  2NOG A;  3JRB A;  1JGG A;  1WI3 A;  4A3C J;  4M3B A;  5EGO A;  4L5E A;  2IEK A;  5E3O A;  2XB5 A;  2Y0S N;  2YUS A;  3TP3 A;  3W6V A;  4XRS G;  1MH4 A;  3MKL A;  1B72 B;  2ECC A;  1IJW C;  2G0E A;  1VFC A;  5J3L A;  3TW7 A;  1UG2 A;  4HNV A;  2FX0 A;  2CJJ A;  1IUF A;  1MSE C;  1TWA J;  2LLK A;  4LOC A;  1OJL A;  1I50 J;  4UUT A;  3IH2 A;  5J1Y A;  1F36 A;  3OSG A;  1ZR4 A;  3G1L A;  2R5Z A;  4ABZ A;  2L7Z A;  3NAU A;  5E3N A;  3FIS A;  5EZG A;  1Z77 A;  4B3A A;  1MBG A;  2DA2 A;  5FLV A;  2AO9 A;  5F0H A;  3HGY A;  4W97 A;  4M3E A;  4X6A J;  1HLV A;  1Q1V A;  3K2A A;  3RKQ A;  3WHC A;  3SDG A;  2YS9 A;  4M6V A;  1U9N A;  3HOZ J;  1XG1 A;  4DYQ A;  1U9O A;  5FKL A;  3LSR A;  2DA7 A;  1POG A;  3CDL A;  3JRE A;  2X6O A;  2ID3 A;  3S17 J;  4UUS B;  1RR7 A;  1IGN A;  1SAN A;  2HOT A;  1H89 C;  3I4M J;  5EGO B;  5FJ8 J;  1R9T J;  1HOM A;  4A3F J;  3QPS A;  2ME0 A;  9ANT A;  1FIA A;  1E3O C;  2JWT A;  2JJ7 A;  3LOC A;  1Z0X A;  4DZP A;  4QSH A;  2NVQ J;  1GV5 A;  4FCY A;  3HM5 A;  3BTI A;  1RKT A;  2GBY A;  3M4O J;  3I4N J;  1IDY A;  1ETX A;  2CUE A;  1FTT A;  3G1O A;  1NK2 P;  3HBL A;  4MO7 A;  3GTG J;  2HDD A;  1T33 A;  1JKP C;  2CU7 A;  2P81 A;  2OF7 A;  2ZB9 A;  2CRG A;  5J1R A;  2HXI A;  2R5Z B;  3UKG A;  4BBS J;  1QVT A;  2O9L A;  4C3J J;  1MNM C;  1LFU P;  4DW6 A;  5IYC J;  1BW5 A;  1ETY A;  1IRZ A;  3S1Q J;  3LSJ A;  1U78 A;  3NAR A;  3G1M A;  3M3Y J;  5E3M A;  1JT6 A;  2NVX J;  1ETV A;  2HYJ A;  1A5J A;  2L7M P;  4AC0 A;  2QF7 A;  1QVU A;  4XK4 A;  2DA1 A;  3BG9 A;  3BG3 A;  3JRA A;  4BY7 J;  1TWG J;  1JUP A;  4A3I J;  3CMY A;  2PMZ N;  5GPC A;  3GBG A;  1YRN B;  3MVP A;  1JJ8 C;  1OCT C;  5JLW A;  2MSY A;  1XC5 A;  2JK3 A;  1WH5 A;  2QCO A;  2XPV A;  1JT0 A;  2K40 A;  2E19 A;  4D7M A;  1D5Y A;  3JRD A;  1HDP A;  3FK6 A;  1HCR A;  3TED A;  3CCY A;  5EG0 B;  5K7Z A;  1U8B A;  2DA5 A;  2DMU A;  2DJN A;  2COB A;  2EZK A;  2M8G X;  4A3J J;  3S16 J;  2MGQ A;  3BR1 A;  4XID A;  3Q0V A;  3HKZ N;  2K9N A;  4D7N A;  4IHV A;  3ZQG A;  2M0C A;  3TW6 A;  1UHS A;  4V2F A;  4C3H J;  1BA5 A;  2CUF A;  5F0F A;  4A3D J;  3BTC A;  1MBF A;  1T56 A;  3DEW A;  1ZQ3 P;  2XSD C;  1JUS A;  2FD5 A;  2NS7 A;  4DZJ A;  3GTK J;  1K83 J;  1LFB A;  1MBH A;  1IC8 A;  5IP6 A;  3B6C A;  3QQA A;  5M5W J;  5M3F J;  3BR3 A;  2JA8 J;  1ITY A;  3OSF A;  4IHY A;  1AKH B;  5IP9 J;  2L0K A;  3K7A J;  3ZQF A;  1Y1W J;  1FJL A;  2DA4 A;  3FKI J;  2XPW A;  1X2N A;  3Q3S A;  1ORK A;  3BQZ A;  4JYK A;  2LVS A;  1X58 A;  1QPI A;  2LK2 A;  2Y31 A;  4A93 J;  4JP0 A;  2XB0 X;  4RBO A;  2Y9Z A;  2IBD A;  5EYR A;  1ETQ A;  3BR5 A;  1G2H A;  1TWH J;  3VPR A;  1NK3 P;  1AHD P;  3BQY A;  2TRT A;  1F43 A;  2DMN A;  4XRS A;  2E1O A;  5EZH A;  3BG5 A;  2KT0 A;  2EQR A;  2Y2Z A;  4W1U A;  5C44 J;  3GTJ J;  3RQI A;  2L9R A;  5C3E J;  5M5X J;  2M2E A;  1FTZ A;  4IEJ A;  1BJZ A;  1X2M A;  1I6H J;  3S2D J;  3BR2 A;  1A6I A;  1RPW A;  3JR9 A;  1AU7 A;  1BW6 A;  4D5F A;  1ETK A;  4A3G J;  3A02 A;  1ZK8 A;  2K9S A;  2DTZ A;  3FK7 A;  5EEA A;  1HDD C;  1LE8 A;  4FE7 A;  3GTQ J;  1WH7 A;  1NTC A;  3ZQC A;  2JA6 J;  3ZQL A;  2GLO A;  3OOU A;  1CQT A;  2R93 J;  1XS9 A;  2LFB A;  4C3I J;  4XRM A;  2EH3 A;  5J1U A;  2CQQ A;  4A3E J;  3CQZ J;  1GV2 A;  2FQ4 A;  5C4J J;  2JA7 J;  3IV5 A;  1ETO A;  2HQ5 A;  5JLX A;  5IYD J;  1P7I A;  4FTH A;  5IYB J;  2ID6 A;  3C2B A;  1TC3 C;  3WHB A;  3LSG A;  4A3M J;  3HOU J;  1RKW A;  2JN6 A;  3LSP A;  3L1P A;  1MBJ A;  3S14 J;  1DU6 A;  2VKV A;  3GTL J;  1APL C;  1DU0 A;  4M3F A;  3S1M J;  5IOZ A;  3IH4 A;  2L7F P;  2E2I J;  2O7O A;  5EDN A;  5FKM A;  5IOY A;  1MBK A;  2IAI A;  3B6A A;  3O8G A;  2LR8 A;  3DCF A;  1SFO J;  2HOA A;  3JRC A;  2XGC A;  1TWF J;  4S0H B;  3JRI A;  5M5Y J;  2DN0 A;  2WV1 A;  4BBR J;  4QTR A;  1H8A C;  2ME6 A;  5FKK A;  1JUM A;  5F08 A;  1WPK A;  3E7L A;  1LE8 B;  3PO2 J;  1GT0 C;  3HGG A;  2ECB A;  4A69 C;  1S7E A;  4Y52 J;  1ZTR A;  4B4C A;  1JKO C;  1GDT A;  1JTY A;  2H8R A;  4BY1 J;  3QPL A;  4G12 A;  1JKR C;  2VI6 A;  2O8K A;  4IHW A;  5EF6 A;  2X48 A;  2LY9 A;  3JRF A;  3SJM A;  1QRY A;  3Q0U A;  3PO3 J;  3Q0W A;  4GFB A;  2E2J J;  2K9Q A;  5K7F A;  4JX6 A;  4C2M J;  3ZQI A;  2H1K A;  2D5V A;  1ZGW A;  3HOV J;  5DS9 A;  4M3D A;  2M34 A;  4D5C A;  3BT9 A;  4JX4 A;  1UMQ A;  1VF9 A;  1PUF A;  1JJ6 C;  3RZO J;  3LNQ A;  1W0T A;  3JRH A;  4BXX J;  3IH3 A;  3ZQH A;  3GTO J;  1MH3 A;  2NVY J;  2VUM J;  2JA5 J;  3PM1 A;  2WAQ N;  1I3Q J;  3GTM J;  2HI3 A;  2EZI A;  2VKE A;  5IP7 J;  3FIW A;  1HF0 A;  1VND A;  5C4X J;  2VPR A;  2WB1 N;  1WGX A;  1FIP A;  3JRG A;  4XIC A;  3O8H A;  5M3M J;  2EBI A;  3BTL A;  1W0U A;  3GTP J;  2EZH A;  3BR6 A;  2M9H A;  2MW8 A;  3BTJ A;  4NDL A;  5F1J A;  2E2H J;  4JX5 A;  1ETW A;  2HXO A;  5GP9 A;  1BL0 A;  2NS8 A;  3S1R J;  4I76 A;  4MFE A;  5IPA A;  3H3V K;  5DTD A;  5K7H A;  3TP0 A;  4MLO A;  4RDU A;  3A01 A;  3F0C A;  1B8I A;  1OCP A;  1Y1V J;  3D1N I;  2R5Y A;  3RZD J;  5GPA A;  3BR0 A;  2FJ1 A;  2NVT J;  4MFD A;  1ZR2 A;  4DYC A;  1YRN A;  4Y7N J;  2R0Q C;  1VI0 A;  4CYC A;  4J19 A;  4FE4 A;  2LTP A;  2DA6 A;  2Y30 A;  1IV6 A;  1MBE A;  3HOX J;  5F04 A;  1H88 C;  1PUF B;  5FLM J;  2RAE A;  2AHQ A;  2B63 J;  2XPU A;  4DYR A;  1ZKG A;  5EG0 A;  2XGD A;  1OFC X;  1JKQ C;  4AUX A;  1JTX A;  1IDZ A;  3A03 A;  2TCT A;  1IG7 A;  3MN2 A;  1FEX A;  2I10 A;  4MIM A;  2LKX A;  3ZOB A;  2XGE A;  1O4X A;  3S15 J;  4BKX A;  1WCM J;  4A3L J;  2X9D A;  3H0G J;  4X1E A;  1B72 A;  2DMP A;  4FIS A;  5F0C A;  1K61 A;  2JMW A;  3HB9 A;  5FKO A;  5FKN A;  1ENH A;  2HOS A;  3HOY J;  4AYB N;  4QIW N;  4A3B J;  2YU9 J;  4EEF G;  1EF4 A;  1RET A;  2EZL A;  2W48 A;  3A01 B;  1P7J A;  1AKH A;  2R7Z J;  4B1R A;  1B8I B;  1RES A;  5BNG A;  1GUU A;  2GM4 A;  2R5Y B;  1MSF C;  1TWC J;  2XRL A;  4M3G A;  2DMQ A;  3HEF A;  4V2G A;  2Y9Y A;  4I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...