4DZPA

Crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFAWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 1 protein
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dzpA01
1ETWA 1VI0A 2CQXA 1I50J 1HF0A 1MBGA 4BBSJ 3FKIJ 3JREA 5F0CA 4IHYA 4BKXA 2H8RA 1R9TJ 4B3AA 4BY1J 1P7IA 3S14J 4M3FA 2IAIA 1MBFA 1ETQA 3A01B 1F36A 3BTCA 1VFCA 2VKVA 2MG4A 4A93J 5EZHA 5BNGA 1YRNA 1GUUA 1JGGA 3BR5A 1K61A 4LOCA 2NVXJ 3WHCA 1I6HJ 3K2AA 5FKLA 2DMTA 4FTHA 3FIWA 2DN0A 2XGEA 3W6VA 1ETXA 1ZQ3P 1Z77A 3CCYA 3ZQFA 1RKWA 3RQIA 5FKNA 2TCTA 2Y0SN 3F0CA 1CQTA 1RKTA 2Y30A 2X9DA 3HOXJ 2K9NA 3S16J 2K9SA 1QRYA 1QVUA 1UG2A 4CYCB 3BR2A 5FKOA 5K7FA 2VUMJ 3HOZJ 9ANTA 2TRTA 1VF9A 2E2IJ 3BQZA 5E3OA 5FLMJ 4C2MJ 2WAQN 2XB0X 5GP9A 3JRBA 2HOTA 2CRGA 1AKHA 1IDYA 4I6ZA 1ZGWA 4I76A 2LK2A 2MGQA 4DZPA 1H88C 5FKKA 1MBKA 4M3BA 4A3IJ 1JKQC 4XIDA 2OPTA 1SANA 2FQ4A 2M0CA 1U8BA 1IRZA 1NK2P 1JTYA 3H3VK 1U9NA 3QQAA 1LFBA 2VI6A 2QF7A 2WV1A 3JRGA 3CQZJ 1JKOC 3SJMA 4A3KJ 4BBRJ 1H8AC 1IC8A 3GBGA 2JMWA 4MIMA 1IDZA 2GM4A 2DA6A 4V2GA 4B1RA 3BR1A 4BY7J 3JRCA 3S1MJ 2RAEA 3HBLA 2G0EA 3BG3A 2NVYJ 3BQYA 2R93J 2XPWA 2ECCA 2ME6A 5IYCJ 5IP6A 4W1UA 2WB1N 3IV5A 3GTKJ 2XRLA 3K7AJ 1X58A 2DMUA 4FE4A 1GV5A 1B8IA 5EG0A 4QIWN 3HKZN 2LVSA 2H1KA 2EZKA 1F43A 1E3OC 1JUSA 4L5EA 4D7MA 3JRAA 1GDTA 1B72A 1HOMA 3HM5A 1MH4A 1QVTA 1ZK8A 3B6CA 5J1RA 3LNQA 2Y2ZA 1ETVA 2NOGA 5M5YJ 2ME0A 1P7JA 1JUMA 4X6AJ 2HI3A 1DU6A 3IH3A 1YRNB 3Q0UA 3SDGA 1XC5A 4JX4A 1MBJA 2IEKA 5E3LA 5C3EJ 3UKGA 5C44J 3S1RJ 3M3YJ 2DMPA 3JRFA 3PO2J 3S1NJ 5FLVA 4A3GJ 1FIPA 5EZGA 3HGGA 1A6IA 4UUSA 4IHWA 1MBEA 2K9QA 3I4NJ 5EYRA 1HLVA 2MW8A 3NAUA 3HEFA 4HNVA 1X2NA 4FISA 3IH4A 5EGOA 2D5VA 1TWGJ 5IYBJ 2CQQA 2QCOA 2E2JJ 4QSHA 3BR6A 4W97A 4C3JJ 1K83J 1LE8A 1MNMC 1NTCA 2O7OA 4JP0A 4Y52J 2VKEA 4DYQA 2M34A 3HB9A 1OJLA 1AKHB 2HOSA 4RDUA 2LTPA 4S0HB 1JT0A 4D7NA 4DYRA 5IOYA 4ABZA 4A3FJ 4IHXA 2E2HJ 2HOAA 4D5FA 1VNDA 3G1MA 5FJ8J 1BJZA 2EBIA 1ORKA 1ZR2A 3IH2A 2JN6A 1Z0XA 4JYKA 1BL0A 2FX0A 4C3HJ 4G12A 4A69C 4JX6A 3HDDA 1S7EA 4M3EA 2M2EA 3S2HJ 2DA7A 1IG7A 2LD5A 1ITYA 2FJ1A 2M8GX 1T56A 3ZQCA 4M6VA 4A3DJ 1ZKGA 1RPWA 3PM1A 3CDLA 5IPAA 2EQRA 2NVQJ 1PUFA 2LR8A 5C4XJ 2HDDA 2COBA 2DA4A 5E3NA 1U78A 3FK7A 1GT0C 5M3FJ 2P81A 1B8IB 1APLC 3D1NI 2PMZN 2MSYA 2E19A 2R5ZA 1DU0A 2XPVA 1JUPA 2L0KA 2Y31A 3GTPJ 2FD5A 1X2MA 4A3JJ 4DZJA 3O8GA 1B72B 2R5YA 2Y9ZA 3TP3A 4J19A 3DEWA 3C2BA 3O8HA 3Q3SA 2L7FP 1SFOJ 3LSRA 2R0QC 2JWTA 3OIOA 3TP0A 5F1JA 5M5WJ 2NS7A 2YU9J 2DMNA 4M3GA 3TEDA 1EF4A 5EEAA 5GPCA 2Y9YA 4IEJA 2YS9A 2DTZA 3GTOJ 1U9OA 3RZDJ 4A3CJ 2EZLA 2HXOA 3BTIA 1RR7A 3FK6A 4UUSB 2NVTJ 3M4OJ 4XK4A 1OCTC 1TWAJ 1ENHA 2M9HA 3RKQA 2JA5J 3HOVJ 5F04A 5EGOB 3GTMJ 3QPSA 4AYBN 1O4XA 3GTGJ 1ZR4A 5M3MJ 1Y1WJ 2OF7A 5E3MA 1LE8B 1TWFJ 2DJNA 1LFUP 1ETKA 3JRHA 4RBOA 4B4CA 3GTQJ 2EZHA 2LKXA 3ZOBA 1W0TA 2X48A 4XICA 4NDLA 5JLXA 4BXXJ 2B63J 3LSGA 1MH3A 2JA8J 2HYJA 5GPAA 1MSFC 4XRSA 3JRIA 4A3BJ 2AHQA 2I10A 3VPRA 4FE7A 3S15J 3S2DJ 2HXIA 1RESA 3OSGA 2ID3A 5F0FA 4M3DA 1UMQA 2HQ5A 1POGA 4XRMA 2LP0A 2CJJA 1NK3P 4GFBA 3A02A 3ZQHA 4DYCA 1FTZA 2CU7A 3OSFA 3Q0VA 2JA7J 2DA5A 1UHSA 4MFEA 3GTJJ 1PUFB 2EH3A 1T33A 1G2HA 3LSPA 1MBHA 1A5JA 5IP7J 4V2FA 1WGXA 3MKLA 4MO7A 3LSJA 2YUSA 1AU7A 2W48A 5HODA 2KDZA 2R5ZB 3LOCA 2N8GA 3TW6A 4FCYA 4QTRA 3MN2A 1I3QJ 2R5YB 3BG9A 1IGNA 1JJ6C 5JLWA 2XSDC 4C3IJ 1JKPC 2ELKA 1BW6A 5F27A 1XS9A 5EDNA 1Y1VJ 5J1UA 1ETYA 2DA2A 2L9RA 4Y7NJ 3FISA 5F08A 1TC3C 2DA3A 3BTJA 3CMYA 1OFCX 3MVPA 3HGYA 1FJLA 2JA6J 2DA1A 1ZTRA 2LFBA 2AO9A 1JT6A 4DW6A 2CUFA 1WPKA 5DTDA 5EG0B 3S17J 1IJWC 3BG5A 1JTXA 4MFDA 3SFIA 1AHDP 1HCRA 3A01A 4JX5A 1JJ8C 3G1LA 2IBDA 3B6AA 1JKRC 1RETA 4MLOA 4IHVA 1GVDA 3DCFA 1WH7A 5F0HA 1FEXA 3ZQLA 1TWCJ 5IOZA 3A03A 4AUXA 2CUEA 2X6OA 1IUFA 3ZQGA 1Q1VA 2XGCA 4EEFG 3GTLJ 2K40A 1WH5A 2NS8A 1BA5A 1FIAA 2XPUA 3BTLA 5EF6A 4XRSG 1D5YA 1MSEC 2GBYA 1W0UA 5DS9A 3TW7A 2JK3A 3WHBA 4UUTA 2XGDA 4CYCA 5J1YA 5IYDJ 1XG1A 2E1OA 2R7ZJ 5FKMA 2JJ7A 3ZQIA 3PO3J 4AC0A 2R92J 2ZB9A 3JR9A 3H0GJ 1WI3A 1IV6A 3I4MJ 4A3MJ 2L7MP 3E7LA 2LY9A 1WCMJ 3NARA 3L1PA 3BR3A 1FTTA 3RZOJ 1OCPA 1BW5A 1HDDC 2GLOA 3HOYJ 5K7ZA 3G1OA 3HOWJ 2O9LA 1H89C 5C4JJ 4A3EJ 4D5CA 2XB5A 2EZIA 5J3LA 2L7ZA 5K7HA 2LLKA 3QPLA 2O8KA 2DMQA 5IP9J 1QPIA 1GV2A 3BR0A 3JRDA 5M5XJ 4X1EA 3S1QJ 3Q0WA 1ETOA 2VPRA 1HDPA 1TWHJ 2KT0A 3HOUJ 3BT9A 4A3LJ 3OOUA 2ID6A 2ECBA
chains in the Genus database with same CATH superfamily
1ETWA 2AQFA 5D6EA 4UV9A 2O61A 4IXAA 3CESA 4BE0A 4BBSJ 3FKIJ 1OMIA 3JREA 3DTEA 4BKXA 1R9TJ 4FHTA 2E7XA 1YTYA 2J5PA 3ASNH 2DDBA 4C2TA 2HNHA 4A6EA 1R5HA 1YW8A 1MBFA 3QOEA 3P5JA 1F36A 2VKVA 2MG4A 5EZHA 2F4MB 2H09A 3Q9VA 3JSPA 4PJNA 1JGGA 4HOBA 4M6XA 3TKYA 1WJCA 1I6HJ 1TNTA 1D0ZA 2DN0A 2BEOA 3HXLA 3SFZA 1YYVA 2Y0SA 4KIGA 1Z77A 4WXCA 4HPQA 2E34A 2X6WA 2VJIA 2JTVA 3I9V2 1TL8A 4P9FA 4F93B 2TCTA 3R61A 4BHBA 1DQUA 1WZ2A 2YX7A 5LGUA 3OMYA 3S16J 4HNUA 1QVUA 3JW4A 2A05A 3HC7A 4DNCA 3HOZJ 1VF9A 1WFXA 2H6CA 3QYBA 1LJ9A 1P92A 2E2IJ 3PNYA 1OCRH 2WAQN 2XB0X 3EYYA 1AKHA 2ELJA 3HHGA 3MFKA 1A04A 2LK2A 3E6MA 2FNAA 3DV8A 4BJ6C 4ANJA 1H88C 1D1BA 1T2KA 4OMYA 2OUMA 5EJCA 3F22A 3CCLI 3LL7A 2OU2A 1WSUA 1U5TC 2M0CA 3V8KA 2VPLA 3GYHX 1QA6A 5J40A 3V8JA 3H3VK 2XVCA 2P5KA 2QF7A 1M1EB 2EB7A 1CF7B 2XAFA 5E1XA 4K2EA 1OYWA 3JRGA 1T8IA 3CQZJ 4L9TA 1ZLKA 2XRNA 4NC7A 4BBRJ 3LAPA 1H9TA 2JMWA 2W85A 3K1NA 3SYTA 4PDKA 1MDMA 5IT9Z 3S1MJ 3HBLA 1T08B 1Z7UA 4ZH4F 2XPWA 2ECCA 1AOYA 4BEHA 2VXZA 5IP6A 1UHMA 4W1UA 3CZ6A 2WB1N 2ZJQF 2VKHA 3OR2C 3EETA 1YJNI 4FE4A 1B8IA 5EG0A 3KP6A 1FOWA 2R7UA 5H6QA 5J8CA 5E79C 2JA2A 2LVSA 2H1KA 1F43A 2ZNZA 1WJBA 4I7HA 3GFLA 1LEAA 2QVOA 2NXNB 3QAHA 3ZCOA 1T39A 1HOMA 1ZK8A 2ME0A 4MQVA 4NQWB 1JUMA 4XKWA 1ZREA 3OOPA 4A6DA 2OC6A 3AG1H 1VQOI 4Y13A 4NHJA 4ETSA 1U0JA 1ZGJA 3IH3A 4HEA2 3F23A 3N4MA 2EFOA 2K3FA 3SDGA 5D5XB 1NHAA 4IL6C 1MBJA 1LB2A 5C3EJ 5C44J 2K9LA 3M3YJ 3WU0A 3LAJA 4ON0A 4A5NA 5FLVA 1FNNA 4YFXF 4LLNA 3V8LA 2B0LA 3K0LA 3J81K 1DDNA 3MQ0A 4IHWA 4Q48A 5KNLA 1MBEA 2BVMA 2DQLA 3GEZA 3DTIA 2FU4A 3KYCB 2MW8A 1VQLI 4OIOF 4BXFA 1X19A 4HNVA 2VOPA 1TWGJ 3J7AO 2QCOA 2LG4A 4HV6A 3BR6A 3GUDA 4W97A 5HDKA 1T98A 4C3JJ 1K83J 4BE1A 2PG4A 3HRTA 2Q8KA 5KCMA 3HOTA 4JP0A 1MJBA 2JPBA 1AKHB 2HZTA 1L3LA 1JT0A 2R7WA 4M72A 3K4MA 1Z21A 1X1DA 2RQQA 4IHXA 2E2HJ 5FD5A 4D5FA 5E20A 1VNDA 2DJIA 1MJAA 3BPXA 5D4SA 1Z0XA 3FX3A 1HW2A 1BL0A 2OCEA 1IF1A 3L2WA 5ILSA 3FMRA 3PSIA 2BVLA 5EEGA 2M2EA 4ZDPA 3V7CA 3RDIA 1VQ7I 5E1ZB 4F91B 3BY6A 4DOZA 3I64A 4A3DJ 2AXLA 4PCQA 2OQGA 5BPDA 4E6KG 3CDLA 3F6OA 4Z6YA 2PFBA 1SC7A 2R7VA 2LR8A 2CO5A 5C4XJ 2HDDA 3PL8A 2PMZA 4I09A 1U78A 1I3AA 3HZJA 2IS2A 1R22A 5M3FJ 2B7EA 2KQRA 2P81A 5F6FA 1B8IB 4CCLA 2MFZA 2ZFUA 1JGSA 3BROA 4XKVA 2XAJA 2Z3YA 5BS6A 2IT0A 2MBFA 1VZ0A 2W84A 4MNUA 1G3SA 3PQJA 2O3FA 3O8GA 3ZMZA 1R58A 1IN8A 1XD7A 3FWEA 2DOFA 4HF0A 1BIBA 1UG0A 2O0YA 2L7FP 2BE5F 2OA4A 3W2VA 1SFOJ 1R7JA 2R0QC 3OYHA 1YE9A 3F8NA 4HF1A 2PJPA 3TL4X 2XROA 3LA2A 3PUFA 3JTGA 2W00A 1BR2A 1EV7A 2O8XA 3TEDA 1QZZA 1YO5C 2RKHA 3RIRA 4HLYA 4S04A 4IEJA 4U0VA 5L3GA 4A3CJ 2EZLA 1JI8A 1SVLA 1S7AA 2GQQA 1RR7A 4BU2A 5DUIA 2FEZA 3ML6A 2NVTJ 2DI3A 2ZMEA 3CLQA 2R7DA 1TWAJ 4A0ZA 3GMEA 4RGSA 3GXOA 4XN0A 4GCVA 3KP3A 2F4IA 1XDSA 3QPSA 3SZGA 4U0YA 2FF4A 1XB4A 2OF7A 1YITI 2KZGA 2E35A 2ISZA 3K10A 2DW4A 3OYNA 4RB0A 3TOAA 2VODA 3GTQJ 2KKOA 2EZHA 4O6JA 3F3XA 3EUHA 1YX5A 4F55A 3H3UA 3H5NA 3VSLA 5CVJA 2ESHA 1UZCA 3LSGA 1IXCA 1OKRA 4OWRB 2HYFA 4RLQA 2HVRA 3LA7A 2L9SA 4XRSA 1J09A 2P5VA 1HSJA 1GXQA 2L01A 1TQPA 4LK0F 4BS9A 1UMQA 4GYIA 4P5OA 2HQ5A 2VJJA 4Q5SF 1S72I 4XMYA 3AAFA 1F4KA 4RAFA 3PUBA 1UHSA 4IZZA 4H4KC 4XR6A 1DP7P 2EH3A 2EPFA 1G2HA 2VE9A 3AKZA 1KONA 3ZQQA 5J6XA 4XLCA 3MKYB 2YUSA 1FOKA 1AU7A 2W48A 5HODA 2E5ZA 2M7AA 4CICA 3E5XA 2W1OA 1W7PD 4HA8A 4FCYA 4QTRA 4IQ4A 1I3QJ 1IGNA 1JJ6C 2X1DA 2XSDC 2HZDA 5D4RA 3ABMH 1NG6A 4HYEA 3CCVI 2ZKZA 3DU6A 1XS9A 1FC3A 3SQNA 1ETYA 4I0BA 1TC3C 3CMAI 3FXMA 1OFCX 3HGYA 3ABLH 4BQOA 4A12A 3QU3A 1IN7A 2D1HA 4BJTA 3OYFA 1CGPA 2LFBA 4XOPA 1G8XA 1ZG3A 4G6TB 3FMSA 3FXRA 3L7WA 1KYZA 1Z6RA 4EQQA 2IA2A 1IJWC 3SFIA 1UJ8A 3BDDA 2ZMEB 4G9YA 2ZXWH 5KVRA 1JJ8C 3G1LA 1BR4A 2IBDA 4XL9A 4CDGA 4MLOA 4IKFA 1BI1A 5CVVA 4IHTA 4RB2C 3OYMA 4IHVA 4XNFA 1GVDA 3KX2A 5F0HA 5K5QA 4LK1F 2BY0A 2LKSA 2V1DA 2CUEA 2X6OA 3ROUA 1IUFA 1TW2A 3ZQGA 1S9HA 1YIJI 2K27A 4U7DA 1YW7A 2NS8A 2M1BA 3OYLA 5EF6A 2CW0F 4Q4ZF 1MSEC 4OU0A 3LSTA 2DOEA 3I53A 2MD5A 2FMLA 1XMAA 1BI0A 2V9PA 1I39A 5BPIA 1J59A 2JK3A 2HGCA 5DUKA 3ERMA 3D5LA 2QEXI 2JVGA 4ESFA 4KNYA 2HQRA 2RREA 2QLZA 1V54H 2H27A 3H0GJ 1W7PB 3I4MJ 4A3MJ 3FXKA 4E70A 2KLOA 4OIRF 2LY9A 2PN6A 2V79A 3GW2A 2VE8A 2VJ4A 4XSXF 3CC7I 1OCPA 3RZOJ 1BW5A 4Y15A 1K78A 1H9GA 2DFIA 1KQ0A 3BPVA 4Z2YA 2VN2A 1RRJA 1VQ5I 3KCCA 2Q2EA 3CJQB 3DU5A 3WTVC 4IRHA 3E97A 3C7JA 3S3OA 3DWLE 4UB6C 1I27A 1X4PA 5C4JJ 4GXOA 4D5CA 1TP4A 4I98B 4A3EJ 1XSDA 3M07A 3QOPA 3QPLA 5L3CA 2V1UA 2M87A 1QPIA 5GAGJ 1S6LA 3E6CC 3S93A 3T5XA 3MWMA 4X1EA 4E4HA 3S1QJ 3ZN1A 3X2QH 2VPRA 1EH7A 2FMYA 3BT9A 1SFEA 3AG2H 2BW3A 4P9UA 3E0JB 1S8NA 2EIJH 1W1WE 2A5YB 4E7SA 1QU3A 1HW1A 3OWTA 4CCMA 4HBLA 1XGNA 1BOBA 3KP4A 1VI0A 1WKMA 1I50J 2CQXA 3I59A 1D3YA 4AU7A 3RJPA 1MBGA 5LBQA 3HTUA 3CCUI 5F0CA 4CH7A 2X6XA 3K9TA 2K86A 3S14J 3GFIA 3GZ5A 4AVPA 3H9QA 1ETQA 3OS2A 1OYYA 3BTCA 3I54A 2IGNA 4OAZA 5AONA 1I6XA 4A93J 3VDXA 1YRNA 1XTAA 3WGIA 4M9ZA 2W24A 2XAQA 4PJMA 1OISA 2K4JA 4U0WA 3CO6C 2K3PA 4FETA 1N25A 2LC2A 2FSWA 1V5GA 2NVXJ 3EPZA 2PI0A 2F5CA 2GWRA 2CS3A 3K2AA 5FKLA 2BHZA 4FTHA 3FIWA 3RSNA 2XGEA 3R0AA 5LHGA 1ETXA 4L5JA 2A69F 2V6EA 2OQRA 4UUVA 1IXRC 3GX4X 4MTDA 1XSXA 4KIFA 1RKTA 1FSHA 2PLYA 5FO5A 1B1BA 1R00A 1QRYA 2QQ8A 1ZGAA 2CFOA 2EWNA 3BR2A 2KZVA 3ZR8X 1XGSA 2WAQA 1G59A 2L54A 2JT1A 2FRHA 3BQZA 1FT9A 4C2MJ 3MAJA 1MMNA 5GP9A 2OZUA 1LQ1A 4I76A 2MGQA 4HAMA 4XLEA 4UY8I 2R7XA 3NEUA 4GYGA 3W6KB 1K78B 4XSZF 2QKLB 2YSRA 1U8BA 5FRMA 1W36D 2PMUA 3LQRA 4HDVA 4CA0A 1U9NA 4X0GA 3QQAA 2Q2EB 2VI6A 1T95A 4HDUA 1Y8RB 3A0BC 5L3FA 3SJMA 1E3HA 4A3KJ 2E1CA 4GDFA 4EGYA 1YIOA 2K5CA 5D6FA 3LQQA 2Z9OA 1IDZA 2F6CA 2CMPA 3I4PA 4BY7J 3DEEA 2RAEA 1J2XA 1DUXC 2IPQX 2WB1A 3BCBA 3BG3A 3JAMK 3ZMTA 2R93J 2ME6A 3MCZA 1RNLA 5IYCJ 3LA3A 5E8GA 5KK1A 2BW3B 2V9VA 4EJWA 3OIPA 4M74A 4V19K 1X58A 2DMUA 3KLOA 4ZDLA 3GZ6A 1YQAA 1UHWA 3B02A 2CQNA 2H1LA 3I59B 1BM9A 2XHKA 3ZN0A 2BHYA 4YRVA 1JUSA 4L5EA 3DLLF 2FXAA 5ICGA 1T0FC 1A35A 2HOEA 2X4HA 4BYYA 1W36C 2Y2ZA 1ETVA 1G3YA 2NOGA 2F5DA 3H35A 1JE8A 2MA3A 1YI2I 2PMHA 1W5TA 2KJCA 3FXQA 1KQ8A 4S05A 3CO7C 3S8PA 1YRNB 3VYUB 2K4BA 3Q0UA 1LFPA 2FE3A 1YHQI 2IS6A 1XC5A 1LKXA 4JX4A 2H8WA 2OCCH 3GVAA 3UKGA 1FYLA 5E3LA 3IL2A 1Y8QB 2IJLA 3S1RJ 5CLSA 3S1NJ 2KRCA 4A3GJ 3A4CA 4ZYDA 1B4AA 1S5LC 1XN7A 3HGGA 2V26A 1XX5A 4J01A 1A6IA 2R3SA 4QWQA 1DPRA 4LIUA 2Z5UA 1USSA 2K9QA 3RPUD 1TW3A 2P6SA 1XCBA 3NAUA 1X2NA 1V4RA 4FISA 2DK5A 3OYBA 1ON2A 2CQQA 5LLQA 4HSRA 4QSHA 1LNWA 2DLLA 1MNMC 1Q1HA 2VKEA 4DYQA 4IX7A 2M34A 2GXBA 3GO5A 2ISYA 2A68F 1BI3A 3VODA 2DU9A 5IOYA 1ODDA 3BJ6A 3DPLC 3M1CA 2XGXA 3IAS2 4C2UA 1BJZA 1TTYA 1ORKA 1FLIA 4XLPF 1ZR2A 1QNTA 2A6TA 3CC2I 3PNVA 2EILH 3KP7A 2EV5A 2M4KA 3KZZA 5GTIC 3A1YA 4OOIA 3S2HJ 2DA7A 1IG7A 3T0YA 1W5SA 2LD5A 5FLXK 1ITYA 2CV2A 3KEYA 2FJ1A 4JK1X 2M8GX 2LOOA 2QKMB 3IWZA 3OYCA 5HLGA 4M6VA 4B48A 4ZZDA 1DGRM 2L4MA 2ACJA 5IPAA 3LSKA 4CO8A 2NAZA 1A36A 1PUFA 3DBRB 1UCRA 3WTWC 2CWEA 3ZMSA 2PQ8A 3F21A 1GT0C 4ZYEA 4AD9A 3L2VA 5AIPA 1APLC 4U88A 5ILUA 2LNBA 3CDIA 2MSYA 4DQ2A 1PJRA 2K7LA 2OZ6A 4L9NA 2Y31A 1JUPA 3GTPJ 2FD5A 4HW0A 4DZJA 3MMYB 2DO7A 2R5YA 4BDZA 4LD5A 2Y9ZA 3QWLA 2QBYA 4BL0B 2MC3A 4I2OA 5KHDA 3W6JB 3DTKA 1R23A 3H5AA 3RYPA 4PFPA 3LSRA 4IVNA 3GFMA 3C3WA 4JQFA 1U3EM 5CVUA 1RUNA 1D1AA 1LVKA 1XGOA 2ZJ2A 3T8TA 4IO9F 2M5WA 4LMYA 2EA2A 3HKZA 4YIIA 4RB3C 2Y9YA 2M3AA 2R7SA 4HG2A 3C1DA 2DTZA 5FRNA 3KEOA 3M8JA 5HDGA 1U9OA 2RQPA 2HS5A 3UNGC 1R1TA 2KIMA 3RZDJ 3BTIA 3OIQA 3KEQA 3M4OJ 3K2ZA 1ZRFA 1OCTC 5FB2A 3Q9SA 3RKQA 3HOVJ 3S2WA 4EGZA 5TISC 5HLHA 2XC7A 1XDUA 2QA4I 1ZG1A 4AYBN 1O4XA 1USTA 1Y1WJ 3HIFA 2Y48A 2XSJC 4AWXB 3VYTB 2OAZA 3I56I 4I0AA 2DJNA 2H6BA 1VTNC 3JRHA 4RBOA 2BZTA 5ED4A 2OTJI 2M0MA 4NUBA 4KT6A 3PNTA 3U1KA 3ZOBA 3C18A 2X48A 4F3QA 4BXXJ 2B63J 2LKPA 2ZXIA 3WGGA 1MH3A 1JXSA 2HYJA 4D0PA 4UVBA 2IXSA 3DKYA 4A3BJ 4A0YA 2ZJRF 2CGPA 4XKBA 3S2DJ 2HXIA 4I02A 2QM3A 4PGHA 2QSHX 1IRGA 3HRMA 3OSGA 4EM1A 3BG7A 4M73A 2ID3A 1IW7F 4HLXA 2RC4A 5F0FA 5ERIA 4ENNA 1POGA 4XRMA 2LP0A 3GZNB 5KAIC 5JVGF 1OYIA 3HG9A 4GFBA 4IHSA 3OSFA 3JAMZ 2DA5A 2JSCA 2MD0A 2UWMA 3GTJJ 3PJRA 1PUFB 3QPTA 2EJRA 3WE2A 1YW9A 1MBHA 4KDPA 1A5JA 4MO7A 3K69A 4UVAA 2HQNA 1G4DA 2D45A 1KU7A 4PGGA 2HPMA 2R7RA 3DP7A 2RNJA 3TW6A 1SAXA 1I1GA 1D8JA 4BACA 2R5YB 1D8KA 2QBYB 1V55H 2K02A 3OR1C 5JLWA 4ESBA 2L7KA 5HNHA 4RMNA 4AIJA 5H20A 3FBNB 1MDMB 5EDNA 1Y1VJ 2CSOA 2Q1ZB 1TT0A 2WBMA 3E1SA 3MD2A 3TOBA 5A2QZ 1FYMA 2CQ7A 4NC8A 5GTHC 2BXZA 3T1BA 3BTJA 4BEHB 3E5QA 2FNPA 2YPRA 3G6EI 3KPHA 5LEKA 3KIOA 3U21A 1S29A 3OS1A 2FOKA 2ZJPF 3WG9A 2MC4A 1ZH5A 3LSMA 5EG0B 2V6CA 3L2UA 1KA8A 4MFDA 1AA7A 5F1RA 2OTLI 1AHDP 1HCRA 3F6VA 1BC7C 2STTA 4ENMA 5J8FA 3B6AA 2HWVA 2KFDA 2VJ5A 2VC0A 3JTHA 1ZN2A 4IPAA 2A5WA 2E71A 3ZQLA 1TWCJ 3IP4B 3A03A 3SEQA 3RKWA 4AUXA 4GRIA 2COMA 3D5SC 4XONA 1Q1VA 2Y69H 2XGCA 3H0DA 1S7OA 1SD6A 2LY1A 4II3A 3CD6I 5DM7F 1BA5A 1K79A 4XRSG 1MZBA 2RV8A 1O3TA 1R4MB 4BQNA 5DEQA 3LWFA 3I58A 4FT8A 1OR7A 3J7AY 1WJAA 3WHBA 2GXAA 3K4JA 1XG1A 3ZXSA 3ZQIA 3PO3J 2XF7A 2R92J 5DV5A 1WI3A 1EJ9A 1IV6A 5E8IA 1XCVA 2CFXA 2L7MP 2QWWA 4ENJA 1T38A 2UUZA 2BY3A 2V1XA 5FLXZ 3NARA 1WI9A 3HPGA 4AIKA 3BR3A 2KRHA 4I99C 3WE3A 2GOXB 2VOOA 3K4BA 2GIVA 2LBFA 3LSHA 2OJED 3BZ6A 5K7ZA 4ENKA 2LRDA 1VQ8I 3HHHA 5HS7A 2O9LA 1GVJA 2A3SA 4DGWB 4DBQA 1X3UA 2XB5A 3Q5FA 5J3LA 1Z6TA 2L7ZA 2LH9A 4OAYA 5K7HA 2LLKA 4Y33A 1KQ9A 1QGPA 2O8KA 2DOAA 1UFMA 2CW8A 2WTEA 3I71A 1QPMA 1MD0A 3Q0WA 1ETOA 2CW7A 4C9YA 3ULQB 2KT0A 2L9VA 3HOUJ 4KITB 1YJ9I 5CKTA 2A61A 3OOUA 1IXSB 2YX4A 1HDDC 2WA0A 1FSEA 2K9MA 3G4SI 1FYKA 3AFHA 3V4GA 4ZZLA 1HF0A 2DDAA 4LLLA 4G94A 3SXYA 3DXJF 1LVAA 4IHYA 2IS1A 1FOYA 2VONA 1Y6IA 4P1WA 3UR3C 1HW5A 3ZP5A 1P7IA 2M45A 3LFUA 4KIBA 2JVHA 2JQ7A 5KAFC 1MNEA 1Y39A 1H0MA 2QZ8A 3U1DA 4L0ZB 3S3MA 1WRJA 3MKZA 1GUUA 2GOMA 3K4CA 4DBRA 2ZMEC 3HOSA 3P9CA 1UB9A 5K1YA 5CVRA 2IRFG 3WHCA 5J4VA 2DMTA 3TDZC 2ZBKA 2O6GE 3W6VA 4TV7A 2DXIA 2VIXA 1ZQ3P 3RKYA 3CCYA 4XBFA 4GO1A 2ELHA 2KISA 3ZQFA 3KYLA 3VOEA 4LFUA 5CQEA 1FMWA 2ADUA 3EUKL 5EEHA 3SEZA 2VXDA 3EUHC 1LDJA 3HOXJ 5LD2C 2K9SA 3MEXA 3L2CA 1UG2A 3CTAA 5FKOA 2JPCA 5LHIA 3CUQA 9ANTA 2IS4A 2X1EA 3J81Z 4BGDA 4KISA 5H6RA 2Z1DA 1DGWY 5E3OA 4RM3A 4UHTA 5FLMJ 1VQNI 4IOAF 5HNFA 2HOTA 5CQGA 5BOXA 1RUOA 5CYVA 2W4SA 1DPUA 4A3IJ 3MZHA 4XIDA 2HKXA 1J7KA 2ESNA 1SANA 3ELKA 4IRIA 4MHGA 2LBFB 1JTYA 4HZFA 1LFBA 3C2HA 2VT2A 3OS0A 2CQKA 1YS6A 4FX0A 4BQAA 1P2FA 1DP3A 1JKOC 3PIOF 1B59A 3EDPA 1H8AC 2R7QA 1EKEA 2HKOA 4UV8A 4MIMA 2Z99A 2IGOA 2GM4A 5IY5H 1Z7LA 1ZAOA 2Z16A 4B1RA 3JRCA 5F64A 2TDXA 3AG4H 3G73A 3A0HC 3OYKA 2G0EA 4HX8A 2PEXA 2AXTC 2NVYJ 3RQ4A 3QP6A 3F8FA 2F4OB 3GTKJ 4PJ0C 2XRLA 3K7AJ 1GV5A 2R4GA 4QIWN 3I5UA 5LEJA 3OYAA 4WWCA 2EZKA 2L3DA 3S3NA 1MGTA 4D7MA 3JRAA 2HTJA 2FOWA 1QQIA 3HM5A 4Y3OA 4L9JA 3K4LA 3CP8A 2HQAA 3CMMA 1EH6A 2GZWA 3ZRGA 2IGMA 5LGTA 5LFAA 5M5YJ 1P7JA 6PAXA 4XOTA 5CJ9A 3V42A 2XIGA 3RCOA 1J9IA 2Y75A 3N97A 4KN4X 3CUQC 4EJUA 3ZPLA 2P4WA 1SD4A 1WJDA 2OBPA 3OY9A 1Z67A 4L5IA 3DEUA 2IEKA 3H5RA 4M71A 1ULYA 2NVUB 4YELA 4BXUA 4WXHA 2DMPA 3D0SA 3D5RC 3CF5F 2ZSHB 5BQTA 3PO2J 5K5OA 4XQFA 1PUEE 1FIPA 1IV8A 2XDVA 5EZGA 5D5WB 3G71I 4A0XA 3I4NJ 4E7HA 4BJ5C 4RLFA 3HEFA 2D5VA 3K70D 2DYRH 4EV0A 1YFHA 5IYBJ 4B09A 2Y0MA 1REPC 2IW5A 2ZC2A 3WU2C 3CUQB 2XAHA 1FX7A 3FZVA 1NTCA 1RR8C 5JFRA 3CMEI 4QPOA 2LDUA 1J5YA 1LDKB 3BG6A 2GAUA 2HOSA 2QENA 2LTPA 4RDUA 3MZYA 4ZTFA 4G7ZF 2X85A 4A3FJ 3SDBA 3H36A 1YJWI 1R1UA 2HOAA 3G1MA 3I0TA 1STZA 3EQLF 4MTEA 2CV0A 4JYKA 1GHCA 2FX0A 2KMUA 2OD5A 1FP1D 4A69C 2HPIA 1B9NA 3RPQA 4M3EA 5L3BA 1MMAA 3LFKA 4EVIA 2HR3A 1SVOA 2BGCA 4MEXF 1NH3A 3M8EA 2VBXA 1IRXA 2X51A 4NBQA 5D8KB 4BUPA 4KFCA 3A2KA 3HTSB 3ZQCA 2FBKA 1SFXA 1RPWA 1R71A 3PM1A 3K70C 3M9AA 4HX4A 2LY2A 2QQAA 3F8CA 3M7GA 2NVQJ 2VQCA 5JR3A 3FHZA 1MW7A 5HS9A 3ZQ7A 3FK7A 5FD6A 3GFJA 1P9QC 2V4JC 1VQMI 2QSFX 3W3CA 1B6AA 1ZYRF 2R5ZA 4UNOA 3K4NA 4LJZF 3OYJA 2XPVA 2L0KA 4Q47A 4ZTJA 1LEBA 1ZELA 3IRQA 3J7ZI 1HA8A 2ZNYA 3P9KA 4J19A 5FGMA 3HL2A 1U6GA 3DEWA 2GIZA 2A07F 2VBWA 3C2BA 3B73A 3O8HA 3CF2A 3Q3SA 2C6YA 1KU3A 2NRAC 4OMZA 5H2FC 3TP0A 4B8XA 2NS7A 2YU9J 1BJAA 3OYDA 2PBIA 1QBJA 2DMNA 2EINH 3RYRA 5DM6F 3HSFA 4D9JA 2DT7B 3T8RA 2M30A 2DAOA 2L4AA 5GPCA 1IN4A 3MZ8A 3WTSC 1KU2A 3SZTA 2NNNA 4RM2A 3HSEA 2HXOA 4DJAA 3KETA 1W5CC 2IA1A 4YIFA 3FK6A 2CV1A 1J0RA 4AYBA 3U9GA 1MMGA 1ENHA 2JA5J 1GXPA 5F04A 3GTMJ 1R36A 1TT5B 2M8EA 1YOVB 4E7IA 4XORA 1LFUP 3PSFA 4B4CA 4XLAA 2LKXA 1LDDA 1D5VA 3V7RA 1B9MA 3LMMA 2W7NA 5JLXA 1IRFA 2VQGA 1TZLA 2CYYA 1PVEA 1MSFC 3JRIA 1ZRDA 2AHQA 2I10A 4LB6B 1P6RA 4FE7A 1W4MA 3FHNA 5DYMA 1RESA 3HYIA 3NRVA 3DKWA 4FASD 1HKQA 1U5TA 1MMSA 2VL8A 2CJJA 1NK3P 2VB6A 3ZQHA 4DYCA 3BC8A 2DCEA 5L3EA 2BXYA 3Q0VA 4IQJA 2JA7J 1YS7A 3DPTA 4CUGA 1MIJA 1WJFA 2F5VA 2P7VB 4G6QA 4V2FA 1WGXA 3MKLA 1C0WA 3EYIA 2KIUA 2BV6A 1SMYF 3U2RA 2KDZA 2R5ZB 5AIQA 3J80K 2FBIA 3LOCA 1OCZH 4NQWA 4XN3A 1BC8C 3WTUC 3HRSA 3AL0C 4JBAA 3ZMUA 2XASA 3L9FA 3JCUC 1FBSA 5F27A 4O3MA 5J1UA 1IUYA 3KZIC 2L9RA 2XAUA 3FISA 1WJEA 2EFNA 1O57A 2DA3A 2EFQA 2M4GA 1E3PA 2ZCWA 3CMYA 2WC2A 1HKSA 2JA6J 2F48A 2DA1A 3CCMI 1O3QA 2CUFA 1WPKA 5DTDA 2ZFWA 3TO7A 2YR2A 3BG5A 1JTXA 3AL0B 3CCJI 5HOOA 3R6SA 4PJLA 3FXOA 4A2UA 4HQEA 2PJRA 2RVCA 3A01A 2DT5A 3ERED 4CHUA 3K1PA 2RDPA 3VB2A 4G7OF 4N0BA 1JKRC 4LB5A 4CCNA 2G9WA 3QODA 4CYDA 1WH7A 2GA2A 3TO9A 4U87A 2WAEA 4LG3A 1OLTA 5ICEA 3VSKA 1RIOH 1R6RA 1VQKI 1XSVA 4EEFG 2B9SA 5E18F 3DPUA 1JHHA 2XPUA 3BTLA 3FF5A 3HUGA 3I55I 4RGUA 1D5YA 4L18B 3TBIA 2GBYA 4B44A 2EIKH 1FY7A 4YG2F 1I1SA 1QZEA 4LGWA 4LG0A 1W0UA 2R7OA 5DS9A 2E36A 3TW7A 2P6TA 5BMZA 1WQ2A 4MQ9F 1P4WA 3FBIB 4BE2A 4CYCA 1QHHD 1ZARA 1X1CA 5J1YA 2E5NA 2R7ZJ 3CLOA 3SZPA 4YIRX 4RGXA 4YFNF 3CJRB 2O5RA 2QQBA 2KIQA 2ZB9A 3JR9A 3FKJA 3CJTB 2P8TA 4RGRA 3NWSA 3NWTA 3L09A 1WCMJ 1FBQA 2XV4S 3R4KA 4L0YB 4B47A 3DF8A 2LMDA 2HDWA 3L1PA 1A6QA 1XMXA 2VQLA 1U5TB 2W57A 3RKXA 4CSWA 3DKXA 4P55A 3WTZA 4CCOA 4PSWA 1TNSA 3E6DA 1OCCH 1TLHB 2W25A 1SEUA 1VQ4I 4MEYF 4ESJA 2XUBA 3H9JA 3HOYJ 5DCFA 1N75A 2KHMA 1ERDA 4DIQA 1K4TA 1PDNC 1H89C 3R0JA 4HQMA 1WHUA 1IO2A 4RS8A 1N78A 3HSRA 3QP5A 2EFWA 1IZ1A 2KP6A 1O3SA 4PK4A 2HVQA 3WTTC 4F52A 3ZGKA 2V1NA 5GAHJ 3CCQI 1GV2A 1R4NB 3BR0A 3JRDA 5M5XJ 4BNCA 1R5GA 1HDPA 2DYSH 4XRFA 1TWHJ 3KE2A 2STWA 4A3LJ 3K6GA 4ZC3A 1ZHFA 4OINF 4N9HA 4P96A 2ID6A 3ONQA 2ECBA 4PJJA 2BY1A 4CXFA 2WAFA 5LHHA 4EJVA 4RAGA 4ZDOA 2DT6A 4II2A 5TGTA 4BQQA 1D1CA 2J5OA 3K1MA 3H1CA 2H8RA 4ZYAA 1VQ9I 3QYFA 4B3AA 5D8LB 4BY1J 4M3FA 1WWXA 2IAIA 3VWBA 2PJRB 1I5ZA 3A01B 1VFCA 5BNGA 1HQCA 5DDGA 4WCGA 1ACIA 3BR5A 1K6OA 1K61A 2IVMA 5HDNA 2VT3A 4LOCA 4CZCA 2Z2SB 4BAYA 3M8FA 4EM0B 3BLYA 4F7ZA 2L5QA 3PFYA 1RC9A 3HUGB 3DLAA 4HX7A 5FROA 1RKWA 2BY2A 3RQIA 3KLNA 5FFXA 1ZLJA 3GWZA 4E7JA 5IT3A 3HPHA 5FKNA 2Y0SN 4LG0B 3F0CA 3VYRB 1CQTA 1BIAA 3BZCA 2Y30A 2X9DA 5ICCA 3KZYA 2K9NA 2EA4A 1U8RA 4CYCB 2RN7A 5K7FA 3MKWB 2VUMJ 1Z05A 2NNYA 4YFKF 1UELB 1FZPB 2TRTA 2G7UA 2QQ9A 1SFUA 4UB8C 1MKMA 5CPRB 4N4OB 1A31A 2ETHA 3BJAA 3JRBA 1X4OA 2CRGA 3FM5A 1IDYA 5GAEJ 1Z1DA 2IGKA 2WY7Q 4I6ZA 2I5UA 1ZGWA 1AWCA 4DZPA 2R7TA 2JRTA 2DK8A 5B3SH 1SD5A 1MBKA 2ICWG 4M3BA 5FKKA 4E7KA 1JKQC 2OPTA 1F9NA 4KN7X 3L2QA 3IWFA 4WXDA 2FQ4A 3R60A 3BZKA 1IRZA 1NK2P 2XF6A 2BOLA 3OV8A 2JRMA 1D0YA 2WV1A 3PQKA 3V7SA 3IRRA 4BH9A 2F5EA 2FQ3A 1HSTA 2MH9A 4QPQA 3CCEI 5K5RA 3GBGA 1IC8A 2JUGA 3ECHA 2X1CA 2UXXA 3BP8A 3REOA 2DA6A 4V2GA 3IKTA 2L9NA 3J80Z 3BR1A 3O2PE 2MLGA 3RI4A 3F8BA 4PSXA 2RGVA 3QYEA 5B1AH 1E0EA 1WVRA 4U7BA 1JHFA 5LRRA 3BQYA 5TJJA 4YEJA 4Y17A 2VKDA 1XGMA 1O3RA 3IV5A 2NOJB 2BYVE 1WJ5A 1RI7A 2EIMH 4UVCA 3OL3A 2DPDA 1EA3A 2VBYA 3CP2A 3HKZN 2DTRA 3N05A 2Q0OA 3M1EA 5D5VB 1E3OC 4LLGF 1Z3YA 2KPMA 1GDTA 1B72A 3GLLA 3FXLA 1MH4A 1QVTA 3LSIA 2XAGA 3B6CA 2EK5A 5J1RA 3LNQA 3ABTA 3SHFA 3I3LA 5E17F 1FWZA 4X6AJ 2HI3A 1DU6A 4KICA 2MLKA 3G3ZA 1G3TA 1MMDA 1Z3XA 1MNDA 3HJEA 1VQPI 3BJOA 4EJTA 4HF2A 2VASA 1KYWA 5ILVA 1Y0UA 4CZZA 3WTXC 3VYSB 4KUMA 2A6EF 2GXGA 3JRFA 4KMFA 4HNTA 1R49A 1X3WB 1RZ4A 1BN5A 1KZHA 4HSTA 4AVZA 3IC7A 1E17A 3S32A 3EUAA 2F5FA 4UUSA 4R1HA 5ICFA 5EYRA 1HLVA 1FOXA 2EV0A 1W7PA 2WV0A 1K6YA 3IH4A 5EGOA 1OR7C 2IA0A 2E2JJ 4PFOA 2EV6A 1SAUA 2VLAA 5GADJ 3DBLB 1LE8A 2MABA 2PX9A 4CCJA 1G3WA 3WGHA 2IP2A 2O7OA 4Y52J 4F92B 2HU9A 4RB1A 3HB9A 1OJLA 2P5LC 1V5FA 3CCSI 4S0HB 4D7NA 4DYRA 4ABZA 2GA1A 3DFGA 3L2RA 2V9KA 4B3XA 1V3FA 5FJ8J 1HC8A 2EBIA 4RAZA 1Z91A 2KDOA 4OIQF 3IH2A 1R1VA 2JN6A 5E1WA 4G7HF 5TRDA 5B66C 4C3HJ 1J75A 3CCRI 4G12A 4FX4A 4ZYHA 3CJNA 4JX6A 3HDDA 1YG2A 1S7EA 1XPXA 4OIPF 1YLFA 2RNGA 2XF5A 1KGSA 2HDCA 3VFZA 3COAC 2YU3A 4I01A 3ZMVA 3OYEA 1T56A 1R5ID 1SFKA 3ASOH 2HTSA 1ON1A 1ZKGA 3KP2A 2KL4A 3E5UA 5HVQC 3FMQA 2EQRA 3FM3A 1PYVA 3L00A 3FXJA 5JHUA 2COBA 2DA4A 5E3NA 1FP2A 5DD8A 2E7WA 2KRFA 2FA5A 2DPUA 5DCMA 1HBXG 3FXUA 3D1NI 1QZYA 2Z33A 2PMZN 4CGZA 2E19A 3IHUA 3ZMDA 4EM2A 1D0XA 1DU0A 2NYXA 5HLTA 3PIPF 4CCKA 1X2MA 4A3JJ 1PP8F 3GCMA 1B72B 3BOQA 3TP3A 4BHPA 4WF2A 1IAWA 1YX3A 1ZRCA 2D2WA 2L2OA 3H92A 2DBBA 1O7LA 4R79A 3ABKH 4XLFA 2JWTA 3GLXA 4HRIA 3CUOA 3TO6A 3OIOA 4ZYGA 5F1JA 5M5WJ 1EH8A 5FFZA 2E60A 4IJAA 4KA4A 2BBYA 4M3GA 4GGGA 3ECOA 1PP7U 1BBYA 1FPQA 2QSGX 1EF4A 5EEAA 4XLHA 2QGUA 3GF2A 4IRGA 4QLCU 1SMTA 2YS9A 2VBZA 4B43A 3GTOJ 1N77A 2EFPA 4KYWA 1P4AA 4UUSB 4KMUX 4IOCF 3F72A 2LSOA 4XK4A 1ONVA 4AIDA 2M9HA 5EGOB 3QPHA 3TGNA 1ZG5A 5JHFA 3GTGJ 1ZR4A 5M3MJ 1SD7A 2WWYA 5E3MA 4H0EA 2E1MC 1LE8B 4WK8F 4NB5A 1TWFJ 3G2BA 2D1VA 1ETKA 1LPQA 3H9GA 2LREA 4BHCA 3CC4I 1BR1A 1Z9CA 2E1NA 4N9IA 1W0TA 1MJ9A 2X0LA 4XICA 3NQOA 4NDLA 2FBHA 4WX9A 2HFHA 4E7ZA 2JA8J 2ZSIB 1TQIA 2A6HF 5GPAA 1E2XA 1FMVA 3VPRA 4PZJA 3S15J 2ZXJA 2JSPA 2E1MB 2VC1A 4EATA 3WTYC 3JSOA 3H3ZA 3TMOA 3WU1B 2MYSA 4M3DA 5J4YA 5CVIA 3K4KA 2DODA 3A02A 1FTZA 2CU7A 2HVSA 4HV5A 1NG7A 1OPCA 4MFEA 3E3VA 1T33A 3AG3H 4KJZA 1XMKA 3LSPA 3BWGA 5IP7J 5D5UB 1X1PA 5DCMB 3LSJA 4AIHA 1F5TA 2MH2A 1P4XA 4ITVA 3IUOA 2N8GA 5IT9K 1GLNA 4O5VA 2LF8A 3MN2A 2WADA 3PFIA 3BG9A 5HS8A 3HRUA 2XKOA 1X1BA 3QU6A 1HXDA 4C3IJ 4G8XA 1K4SA 2ZO4A 2CG4A 2ELKA 1JKPC 3KP5A 3OL4A 1BW6A 4XM3A 2LF7A 3P9IA 2P7CB 2DA2A 4A5MA 4Y7NJ 5F08A 2O03A 3P7NA 4Y4RA 1IN5A 1S3JA 3TDUC 2QYOA 3MVPA 1FJLA 1T0FA 2AQEA 4M6YA 3KFWX 3E6BA 1ZTRA 2G7HA 2AO9A 1QHGA 1KU9A 1JT6A 4DW6A 2HYGD 1X3ZB 2HEOA 3W2WA 3S17J 2OV7A 1FBUA 4MGRA 5HLIA 2DFEA 2L02A 1V5EA 3TQNA 1X1AA 3CDHA 1HKTA 4JX5A 3IAM2 4PUSA 1RETA 4IF4A 2UV1A 3RTRA 1TQMA 3DCFA 1BI2A 3C2GA 3O6BB 1OQYA 4C30A 4E7LA 2ZXHA 2AS5F 1FEXA 4EMSA 2WY8Q 5IOZA 5DD4A 3ABUA 1U2WA 4LIVA 2DQRA 2UXNA 3GTLJ 2K40A 1K7AA 1L0OC 3BCAA 1QO0D 1WH5A 1FIAA 2FUG2 4LITA 2P0WA 2CH0A 4N4NB 3DBHB 1Y0NA 4ZJZA 4RAYA 3J7YJ 2I8DA 2DFHA 2XGDA 4UUTA 5IYDJ 2E1OA 5LGNA 5FKMA 5B1BH 4XLNF 2JJ7A 3OYIA 4AC0A 1UAAA 3IKVA 4NNJA 3O3KA 1IN6A 2V7FA 4AM3A 3E7LA 4KT5C 1O7FA 4ASNA 4J00A 1Y56A 1G6NA 4NC6A 3F9KA 2X6YA 4D1QA 1FTTA 5J47A 1T6SA 5JI6A 2KJBA 5B5EC 5L3DA 4JOMA 2GLOA 2CUJA 4UXNA 3VEPA 2XKPA 5JVTA 2QUFA 2VQHA 2KIFA 4FQGA 4RA2A 1CF7A 5LRSA 2K85A 2UZKA 4M9SA 3G1OA 3HOWJ 2JZYA 4EJOA 2M7BA 3W2AA 3RPUA 1TBXA 2EZIA 3ISPA 3WG7H 2R7FA 3OYGA 2H94A 5A2QK 1SVMA 3WODF 2DMQA 5IP9J 3F8MA 1LUJB 2CUZA 3ESWB 1F1ZA 1VQ6I 2W82A 2JUCA 4BDYA 4L9VA 4XKCA 2LYCA 3DQVC 4R8HA 2F2EA 4G6DA 3FDYA 3KYDB 4M9XA 1BOAA 2DFFA 1OCOH 3QRFF 2NS0A
chains in the Genus database with same CATH topology
1ETWA 1VI0A 2CQXA 1I50J 1HF0A 1MBGA 4BBSJ 3FKIJ 3JREA 5F0CA 4IHYA 4BKXA 2H8RA 1R9TJ 4B3AA 4BY1J 1P7IA 3S14J 4M3FA 2IAIA 1MBFA 1ETQA 3A01B 1F36A 3BTCA 1VFCA 2VKVA 2MG4A 4A93J 5EZHA 5BNGA 1YRNA 1GUUA 1JGGA 3BR5A 1K61A 4LOCA 2NVXJ 3WHCA 1I6HJ 3K2AA 5FKLA 2DMTA 4FTHA 3FIWA 2DN0A 2XGEA 3W6VA 1ETXA 1ZQ3P 1Z77A 3CCYA 3ZQFA 1RKWA 3RQIA 5FKNA 2TCTA 2Y0SN 3F0CA 1CQTA 1RKTA 2Y30A 2X9DA 3HOXJ 2K9NA 3S16J 2K9SA 1QRYA 1QVUA 1UG2A 4CYCB 3BR2A 5FKOA 5K7FA 2VUMJ 3HOZJ 9ANTA 2TRTA 1VF9A 2E2IJ 3BQZA 5E3OA 5FLMJ 4C2MJ 2WAQN 2XB0X 5GP9A 3JRBA 2HOTA 2CRGA 1AKHA 1IDYA 4I6ZA 1ZGWA 4I76A 2LK2A 2MGQA 4DZPA 1H88C 5FKKA 1MBKA 4M3BA 4A3IJ 1JKQC 4XIDA 2OPTA 1SANA 2FQ4A 2M0CA 1U8BA 1IRZA 1NK2P 1JTYA 3H3VK 1U9NA 3QQAA 1LFBA 2VI6A 2QF7A 2WV1A 3JRGA 3CQZJ 1JKOC 3SJMA 4A3KJ 4BBRJ 1H8AC 1IC8A 3GBGA 2JMWA 4MIMA 1IDZA 2GM4A 2DA6A 4V2GA 4B1RA 3BR1A 4BY7J 3JRCA 3S1MJ 2RAEA 3HBLA 2G0EA 3BG3A 2NVYJ 3BQYA 2R93J 2XPWA 2ECCA 2ME6A 5IYCJ 5IP6A 4W1UA 2WB1N 3IV5A 3GTKJ 2XRLA 3K7AJ 1X58A 2DMUA 4FE4A 1GV5A 1B8IA 5EG0A 4QIWN 3HKZN 2LVSA 2H1KA 2EZKA 1F43A 1E3OC 1JUSA 4L5EA 4D7MA 3JRAA 1GDTA 1B72A 1HOMA 3HM5A 1MH4A 1QVTA 1ZK8A 3B6CA 5J1RA 3LNQA 2Y2ZA 1ETVA 2NOGA 5M5YJ 2ME0A 1P7JA 1JUMA 4X6AJ 2HI3A 1DU6A 3IH3A 1YRNB 3Q0UA 3SDGA 1XC5A 4JX4A 1MBJA 2IEKA 5E3LA 5C3EJ 3UKGA 5C44J 3S1RJ 3M3YJ 2DMPA 3JRFA 3PO2J 3S1NJ 5FLVA 4A3GJ 1FIPA 5EZGA 3HGGA 1A6IA 4UUSA 4IHWA 1MBEA 2K9QA 3I4NJ 5EYRA 1HLVA 2MW8A 3NAUA 3HEFA 4HNVA 1X2NA 4FISA 3IH4A 5EGOA 2D5VA 1TWGJ 5IYBJ 2CQQA 2QCOA 2E2JJ 4QSHA 3BR6A 4W97A 4C3JJ 1K83J 1LE8A 1MNMC 1NTCA 2O7OA 4JP0A 4Y52J 2VKEA 4DYQA 2M34A 3HB9A 1OJLA 1AKHB 2HOSA 4RDUA 2LTPA 4S0HB 1JT0A 4D7NA 4DYRA 5IOYA 4ABZA 4A3FJ 4IHXA 2E2HJ 2HOAA 4D5FA 1VNDA 3G1MA 5FJ8J 1BJZA 2EBIA 1ORKA 1ZR2A 3IH2A 2JN6A 1Z0XA 4JYKA 1BL0A 2FX0A 4C3HJ 4G12A 4A69C 4JX6A 3HDDA 1S7EA 4M3EA 2M2EA 3S2HJ 2DA7A 1IG7A 2LD5A 1ITYA 2FJ1A 2M8GX 1T56A 3ZQCA 4M6VA 4A3DJ 1ZKGA 1RPWA 3PM1A 3CDLA 5IPAA 2EQRA 2NVQJ 1PUFA 2LR8A 5C4XJ 2HDDA 2COBA 2DA4A 5E3NA 1U78A 3FK7A 1GT0C 5M3FJ 2P81A 1B8IB 1APLC 3D1NI 2PMZN 2MSYA 2E19A 2R5ZA 1DU0A 2XPVA 1JUPA 2L0KA 2Y31A 3GTPJ 2FD5A 1X2MA 4A3JJ 4DZJA 3O8GA 1B72B 2R5YA 2Y9ZA 3TP3A 4J19A 3DEWA 3C2BA 3O8HA 3Q3SA 2L7FP 1SFOJ 3LSRA 2R0QC 2JWTA 3OIOA 3TP0A 5F1JA 5M5WJ 2NS7A 2YU9J 2DMNA 4M3GA 3TEDA 1EF4A 5EEAA 5GPCA 2Y9YA 4IEJA 2YS9A 2DTZA 3GTOJ 1U9OA 3RZDJ 4A3CJ 2EZLA 2HXOA 3BTIA 1RR7A 3FK6A 4UUSB 2NVTJ 3M4OJ 4XK4A 1OCTC 1TWAJ 1ENHA 2M9HA 3RKQA 2JA5J 3HOVJ 5F04A 5EGOB 3GTMJ 3QPSA 4AYBN 1O4XA 3GTGJ 1ZR4A 5M3MJ 1Y1WJ 2OF7A 5E3MA 1LE8B 1TWFJ 2DJNA 1LFUP 1ETKA 3JRHA 4RBOA 4B4CA 3GTQJ 2EZHA 2LKXA 3ZOBA 1W0TA 2X48A 4XICA 4NDLA 5JLXA 4BXXJ 2B63J 3LSGA 1MH3A 2JA8J 2HYJA 5GPAA 1MSFC 4XRSA 3JRIA 4A3BJ 2AHQA 2I10A 3VPRA 4FE7A 3S15J 3S2DJ 2HXIA 1RESA 3OSGA 2ID3A 5F0FA 4M3DA 1UMQA 2HQ5A 1POGA 4XRMA 2LP0A 2CJJA 1NK3P 4GFBA 3A02A 3ZQHA 4DYCA 1FTZA 2CU7A 3OSFA 3Q0VA 2JA7J 2DA5A 1UHSA 4MFEA 3GTJJ 1PUFB 2EH3A 1T33A 1G2HA 3LSPA 1MBHA 1A5JA 5IP7J 4V2FA 1WGXA 3MKLA 4MO7A 3LSJA 2YUSA 1AU7A 2W48A 5HODA 2KDZA 2R5ZB 3LOCA 2N8GA 3TW6A 4FCYA 4QTRA 3MN2A 1I3QJ 2R5YB 3BG9A 1IGNA 1JJ6C 5JLWA 2XSDC 4C3IJ 1JKPC 2ELKA 1BW6A 5F27A 1XS9A 5EDNA 1Y1VJ 5J1UA 1ETYA 2DA2A 2L9RA 4Y7NJ 3FISA 5F08A 1TC3C 2DA3A 3BTJA 3CMYA 1OFCX 3MVPA 3HGYA 1FJLA 2JA6J 2DA1A 1ZTRA 2LFBA 2AO9A 1JT6A 4DW6A 2CUFA 1WPKA 5DTDA 5EG0B 3S17J 1IJWC 3BG5A 1JTXA 4MFDA 3SFIA 1AHDP 1HCRA 3A01A 4JX5A 1JJ8C 3G1LA 2IBDA 3B6AA 1JKRC 1RETA 4MLOA 4IHVA 1GVDA 3DCFA 1WH7A 5F0HA 1FEXA 3ZQLA 1TWCJ 5IOZA 3A03A 4AUXA 2CUEA 2X6OA 1IUFA 3ZQGA 1Q1VA 2XGCA 4EEFG 3GTLJ 2K40A 1WH5A 2NS8A 1BA5A 1FIAA 2XPUA 3BTLA 5EF6A 4XRSG 1D5YA 1MSEC 2GBYA 1W0UA 5DS9A 3TW7A 2JK3A 3WHBA 4UUTA 2XGDA 4CYCA 5J1YA 5IYDJ 1XG1A 2E1OA 2R7ZJ 5FKMA 2JJ7A 3ZQIA 3PO3J 4AC0A 2R92J 2ZB9A 3JR9A 3H0GJ 1WI3A 1IV6A 3I4MJ 4A3MJ 2L7MP 3E7LA 2LY9A 1WCMJ 3NARA 3L1PA 3BR3A 1FTTA 3RZOJ 1OCPA 1BW5A 1HDDC 2GLOA 3HOYJ 5K7ZA 3G1OA 3HOWJ 2O9LA 1H89C 5C4JJ 4A3EJ 4D5CA 2XB5A 2EZIA 5J3LA 2L7ZA 5K7HA 2LLKA 3QPLA 2O8KA 2DMQA 5IP9J 1QPIA 1GV2A 3BR0A 3JRDA 5M5XJ 4X1EA 3S1QJ 3Q0WA 1ETOA 2VPRA 1HDPA 1TWHJ 2KT0A 3HOUJ 3BT9A 4A3LJ 3OOUA 2ID6A 2ECBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETW A;  1VI0 A;  2CQX A;  1I50 J;  1HF0 A;  1MBG A;  4BBS J;  3FKI J;  3JRE A;  5F0C A;  4IHY A;  4BKX A;  2H8R A;  1R9T J;  4B3A A;  4BY1 J;  1P7I A;  3S14 J;  4M3F A;  2IAI A;  1MBF A;  1ETQ A;  3A01 B;  1F36 A;  3BTC A;  1VFC A;  2VKV A;  2MG4 A;  4A93 J;  5EZH A;  5BNG A;  1YRN A;  1GUU A;  1JGG A;  3BR5 A;  1K61 A;  4LOC A;  2NVX J;  3WHC A;  1I6H J;  3K2A A;  5FKL A;  2DMT A;  4FTH A;  3FIW A;  2DN0 A;  2XGE A;  3W6V A;  1ETX A;  1ZQ3 P;  1Z77 A;  3CCY A;  3ZQF A;  1RKW A;  3RQI A;  5FKN A;  2TCT A;  2Y0S N;  3F0C A;  1CQT A;  1RKT A;  2Y30 A;  2X9D A;  3HOX J;  2K9N A;  3S16 J;  2K9S A;  1QRY A;  1QVU A;  1UG2 A;  4CYC B;  3BR2 A;  5FKO A;  5K7F A;  2VUM J;  3HOZ J;  9ANT A;  2TRT A;  1VF9 A;  2E2I J;  3BQZ A;  5E3O A;  5FLM J;  4C2M J;  2WAQ N;  2XB0 X;  5GP9 A;  3JRB A;  2HOT A;  2CRG A;  1AKH A;  1IDY A;  4I6Z A;  1ZGW A;  4I76 A;  2LK2 A;  2MGQ A;  4DZP A;  1H88 C;  5FKK A;  1MBK A;  4M3B A;  4A3I J;  1JKQ C;  4XID A;  2OPT A;  1SAN A;  2FQ4 A;  2M0C A;  1U8B A;  1IRZ A;  1NK2 P;  1JTY A;  3H3V K;  1U9N A;  3QQA A;  1LFB A;  2VI6 A;  2QF7 A;  2WV1 A;  3JRG A;  3CQZ J;  1JKO C;  3SJM A;  4A3K J;  4BBR J;  1H8A C;  1IC8 A;  3GBG A;  2JMW A;  4MIM A;  1IDZ A;  2GM4 A;  2DA6 A;  4V2G A;  4B1R A;  3BR1 A;  4BY7 J;  3JRC A;  3S1M J;  2RAE A;  3HBL A;  2G0E A;  3BG3 A;  2NVY J;  3BQY A;  2R93 J;  2XPW A;  2ECC A;  2ME6 A;  5IYC J;  5IP6 A;  4W1U A;  2WB1 N;  3IV5 A;  3GTK J;  2XRL A;  3K7A J;  1X58 A;  2DMU A;  4FE4 A;  1GV5 A;  1B8I A;  5EG0 A;  4QIW N;  3HKZ N;  2LVS A;  2H1K A;  2EZK A;  1F43 A;  1E3O C;  1JUS A;  4L5E A;  4D7M A;  3JRA A;  1GDT A;  1B72 A;  1HOM A;  3HM5 A;  1MH4 A;  1QVT A;  1ZK8 A;  3B6C A;  5J1R A;  3LNQ A;  2Y2Z A;  1ETV A;  2NOG A;  5M5Y J;  2ME0 A;  1P7J A;  1JUM A;  4X6A J;  2HI3 A;  1DU6 A;  3IH3 A;  1YRN B;  3Q0U A;  3SDG A;  1XC5 A;  4JX4 A;  1MBJ A;  2IEK A;  5E3L A;  5C3E J;  3UKG A;  5C44 J;  3S1R J;  3M3Y J;  2DMP A;  3JRF A;  3PO2 J;  3S1N J;  5FLV A;  4A3G J;  1FIP A;  5EZG A;  3HGG A;  1A6I A;  4UUS A;  4IHW A;  1MBE A;  2K9Q A;  3I4N J;  5EYR A;  1HLV A;  2MW8 A;  3NAU A;  3HEF A;  4HNV A;  1X2N A;  4FIS A;  3IH4 A;  5EGO A;  2D5V A;  1TWG J;  5IYB J;  2CQQ A;  2QCO A;  2E2J J;  4QSH A;  3BR6 A;  4W97 A;  4C3J J;  1K83 J;  1LE8 A;  1MNM C;  1NTC A;  2O7O A;  4JP0 A;  4Y52 J;  2VKE A;  4DYQ A;  2M34 A;  3HB9 A;  1OJL A;  1AKH B;  2HOS A;  4RDU A;  2LTP A;  4S0H B;  1JT0 A;  4D7N A;  4DYR A;  5IOY A;  4ABZ A;  4A3F J;  4IHX A;  2E2H J;  2HOA A;  4D5F A;  1VND A;  3G1M A;  5FJ8 J;  1BJZ A;  2EBI A;  1ORK A;  1ZR2 A;  3IH2 A;  2JN6 A;  1Z0X A;  4JYK A;  1BL0 A;  2FX0 A;  4C3H J;  4G12 A;  4A69 C;  4JX6 A;  3HDD A;  1S7E A;  4M3E A;  2M2E A;  3S2H J;  2DA7 A;  1IG7 A;  2LD5 A;  1ITY A;  2FJ1 A;  2M8G X;  1T56 A;  3ZQC A;  4M6V A;  4A3D J;  1ZKG A;  1RPW A;  3PM1 A;  3CDL A;  5IPA A;  2EQR A;  2NVQ J;  1PUF A;  2LR8 A;  5C4X J;  2HDD A;  2COB A;  2DA4 A;  5E3N A;  1U78 A;  3FK7 A;  1GT0 C;  5M3F J;  2P81 A;  1B8I B;  1APL C;  3D1N I;  2PMZ N;  2MSY A;  2E19 A;  2R5Z A;  1DU0 A;  2XPV A;  1JUP A;  2L0K A;  2Y31 A;  3GTP J;  2FD5 A;  1X2M A;  4A3J J;  4DZJ A;  3O8G A;  1B72 B;  2R5Y A;  2Y9Z A;  3TP3 A;  4J19 A;  3DEW A;  3C2B A;  3O8H A;  3Q3S A;  2L7F P;  1SFO J;  3LSR A;  2R0Q C;  2JWT A;  3OIO A;  3TP0 A;  5F1J A;  5M5W J;  2NS7 A;  2YU9 J;  2DMN A;  4M3G A;  3TED A;  1EF4 A;  5EEA A;  5GPC A;  2Y9Y A;  4IEJ A;  2YS9 A;  2DTZ A;  3GTO J;  1U9O A;  3RZD J;  4A3C J;  2EZL A;  2HXO A;  3BTI A;  1RR7 A;  3FK6 A;  4UUS B;  2NVT J;  3M4O J;  4XK4 A;  1OCT C;  1TWA J;  1ENH A;  2M9H A;  3RKQ A;  2JA5 J;  3HOV J;  5F04 A;  5EGO B;  3GTM J;  3QPS A;  4AYB N;  1O4X A;  3GTG J;  1ZR4 A;  5M3M J;  1Y1W J;  2OF7 A;  5E3M A;  1LE8 B;  1TWF J;  2DJN A;  1LFU P;  1ETK A;  3JRH A;  4RBO A;  4B4C A;  3GTQ J;  2EZH A;  2LKX A;  3ZOB A;  1W0T A;  2X48 A;  4XIC A;  4NDL A;  5JLX A;  4BXX J;  2B63 J;  3LSG A;  1MH3 A;  2JA8 J;  2HYJ A;  5GPA A;  1MSF C;  4XRS A;  3JRI A;  4A3B J;  2AHQ A;  2I10 A;  3VPR A;  4FE7 A;  3S15 J;  3S2D J;  2HXI A;  1RES A;  3OSG A;  2ID3 A;  5F0F A;  4M3D A;  1UMQ A;  2HQ5 A;  1POG A;  4XRM A;  2LP0 A;  2CJJ A;  1NK3 P;  4GFB A;  3A02 A;  3ZQH A;  4DYC A;  1FTZ A;  2CU7 A;  3OSF A;  3Q0V A;  2JA7 J;  2DA5 A;  1UHS A;  4MFE A;  3GTJ J;  1PUF B;  2EH3 A;  1T33 A;  1G2H A;  3LSP A;  1MBH A;  1A5J A;  5IP7 J;  4V2F A;  1WGX A;  3MKL A;  4MO7 A;  3LSJ A;  2YUS A;  1AU7 A;  2W48 A;  5HOD A;  2KDZ A;  2R5Z B;  3LOC A;  2N8G A;  3TW6 A;  4FCY A;  4QTR A;  3MN2 A;  1I3Q J;  2R5Y B;  3BG9 A;  1IGN A;  1JJ6 C;  5JLW A;  2XSD C;  4C3I J;  1JKP C;  2ELK A;  1BW6 A;  5F27 A;  1XS9 A;  5EDN A;  1Y1V J;  5J1U A;  1ETY A;  2DA2 A;  2L9R A;  4Y7N J;  3FIS A;  5F08 A;  1TC3 C;  2DA3 A;  3BTJ A;  3CMY A;  1OFC X;  3MVP A;  3HGY A;  1FJL A;  2JA6 J;  2DA1 A;  1ZTR A;  2LFB A;  2AO9 A;  1JT6 A;  4DW6 A;  2CUF A;  1WPK A;  5DTD A;  5EG0 B;  3S17 J;  1IJW C;  3BG5 A;  1JTX A;  4MFD A;  3SFI A;  1AHD P;  1HCR A;  3A01 A;  4JX5 A;  1JJ8 C;  3G1L A;  2IBD A;  3B6A A;  1JKR C;  1RET A;  4MLO A;  4IHV A;  1GVD A;  3DCF A;  1WH7 A;  5F0H A;  1FEX A;  3ZQL A;  1TWC J;  5IOZ A;  3A03 A;  4AUX A;  2CUE A;  2X6O A;  1IUF A;  3ZQG A;  1Q1V A;  2XGC A;  4EEF G;  3GTL J;  2K40 A;  1WH5 A;  2NS8 A;  1BA5 A;  1FIA A;  2XPU A;  3BTL A;  5EF6 A;  4XRS G;  1D5Y A;  1MSE C;  2GBY A;  1W0U A;  5DS9 A;  3TW7 A;  2JK3 A;  3WHB A;  4UUT A;  2XGD A;  4CYC A;  5J1Y A;  5IYD J;  1XG1 A;  2E1O A;  2R7Z J;  5FKM A;  2JJ7 A;  3ZQI A;  3PO3 J;  4AC0 A;  2R92 J;  2ZB9 A;  3JR9 A;  3H0G J;  1WI3 A;  1IV6 A;  3I4M J;  4A3M J;  2L7M P;  3E7L A;  2LY9 A;  1WCM J;  3NAR A;  3L1P A;  3BR3 A;  1FTT A;  3RZO J;  1OCP A;  1BW5 A;  1HDD C;  2GLO A;  3HOY J;  5K7Z A;  3G1O A;  3HOW J;  2O9L A;  1H89 C;  5C4J J;  4A3E J;  4D5C A;  2XB5 A;  2EZI A;  5J3L A;  2L7Z A;  5K7H A;  2LLK A;  3QPL A;  2O8K A;  2DMQ A;  5IP9 J;  1QPI A;  1GV2 A;  3BR0 A;  3JRD A;  5M5X J;  4X1E A;  3S1Q J;  3Q0W A;  1ETO A;  2VPR A;  1HDP A;  1TWH J;  2KT0 A;  3HOU J;  3BT9 A;  4A3L J;  3OOU A;  2ID6 A;  2ECB A; 
#chains in the Genus database with same CATH topology
 1ETW A;  2AQF A;  5D6E A;  4UV9 A;  2O61 A;  4IXA A;  3CES A;  4BE0 A;  4BBS J;  3FKI J;  1OMI A;  3JRE A;  3DTE A;  4BKX A;  1R9T J;  4FHT A;  2E7X A;  1YTY A;  2J5P A;  3ASN H;  2DDB A;  4C2T A;  2HNH A;  4A6E A;  1R5H A;  1YW8 A;  1MBF A;  3QOE A;  3P5J A;  1F36 A;  2VKV A;  2MG4 A;  5EZH A;  2F4M B;  2H09 A;  3Q9V A;  3JSP A;  4PJN A;  1JGG A;  4HOB A;  4M6X A;  3TKY A;  1WJC A;  1I6H J;  1TNT A;  1D0Z A;  2DN0 A;  2BEO A;  3HXL A;  3SFZ A;  1YYV A;  2Y0S A;  4KIG A;  1Z77 A;  4WXC A;  4HPQ A;  2E34 A;  2X6W A;  2VJI A;  2JTV A;  3I9V 2;  1TL8 A;  4P9F A;  4F93 B;  2TCT A;  3R61 A;  4BHB A;  1DQU A;  1WZ2 A;  2YX7 A;  5LGU A;  3OMY A;  3S16 J;  4HNU A;  1QVU A;  3JW4 A;  2A05 A;  3HC7 A;  4DNC A;  3HOZ J;  1VF9 A;  1WFX A;  2H6C A;  3QYB A;  1LJ9 A;  1P92 A;  2E2I J;  3PNY A;  1OCR H;  2WAQ N;  2XB0 X;  3EYY A;  1AKH A;  2ELJ A;  3HHG A;  3MFK A;  1A04 A;  2LK2 A;  3E6M A;  2FNA A;  3DV8 A;  4BJ6 C;  4ANJ A;  1H88 C;  1D1B A;  1T2K A;  4OMY A;  2OUM A;  5EJC A;  3F22 A;  3CCL I;  3LL7 A;  2OU2 A;  1WSU A;  1U5T C;  2M0C A;  3V8K A;  2VPL A;  3GYH X;  1QA6 A;  5J40 A;  3V8J A;  3H3V K;  2XVC A;  2P5K A;  2QF7 A;  1M1E B;  2EB7 A;  1CF7 B;  2XAF A;  5E1X A;  4K2E A;  1OYW A;  3JRG A;  1T8I A;  3CQZ J;  4L9T A;  1ZLK A;  2XRN A;  4NC7 A;  4BBR J;  3LAP A;  1H9T A;  2JMW A;  2W85 A;  3K1N A;  3SYT A;  4PDK A;  1MDM A;  5IT9 Z;  3S1M J;  3HBL A;  1T08 B;  1Z7U A;  4ZH4 F;  2XPW A;  2ECC A;  1AOY A;  4BEH A;  2VXZ A;  5IP6 A;  1UHM A;  4W1U A;  3CZ6 A;  2WB1 N;  2ZJQ F;  2VKH A;  3OR2 C;  3EET A;  1YJN I;  4FE4 A;  1B8I A;  5EG0 A;  3KP6 A;  1FOW A;  2R7U A;  5H6Q A;  5J8C A;  5E79 C;  2JA2 A;  2LVS A;  2H1K A;  1F43 A;  2ZNZ A;  1WJB A;  4I7H A;  3GFL A;  1LEA A;  2QVO A;  2NXN B;  3QAH A;  3ZCO A;  1T39 A;  1HOM A;  1ZK8 A;  2ME0 A;  4MQV A;  4NQW B;  1JUM A;  4XKW A;  1ZRE A;  3OOP A;  4A6D A;  2OC6 A;  3AG1 H;  1VQO I;  4Y13 A;  4NHJ A;  4ETS A;  1U0J A;  1ZGJ A;  3IH3 A;  4HEA 2;  3F23 A;  3N4M A;  2EFO A;  2K3F A;  3SDG A;  5D5X B;  1NHA A;  4IL6 C;  1MBJ A;  1LB2 A;  5C3E J;  5C44 J;  2K9L A;  3M3Y J;  3WU0 A;  3LAJ A;  4ON0 A;  4A5N A;  5FLV A;  1FNN A;  4YFX F;  4LLN A;  3V8L A;  2B0L A;  3K0L A;  3J81 K;  1DDN A;  3MQ0 A;  4IHW A;  4Q48 A;  5KNL A;  1MBE A;  2BVM A;  2DQL A;  3GEZ A;  3DTI A;  2FU4 A;  3KYC B;  2MW8 A;  1VQL I;  4OIO F;  4BXF A;  1X19 A;  4HNV A;  2VOP A;  1TWG J;  3J7A O;  2QCO A;  2LG4 A;  4HV6 A;  3BR6 A;  3GUD A;  4W97 A;  5HDK A;  1T98 A;  4C3J J;  1K83 J;  4BE1 A;  2PG4 A;  3HRT A;  2Q8K A;  5KCM A;  3HOT A;  4JP0 A;  1MJB A;  2JPB A;  1AKH B;  2HZT A;  1L3L A;  1JT0 A;  2R7W A;  4M72 A;  3K4M A;  1Z21 A;  1X1D A;  2RQQ A;  4IHX A;  2E2H J;  5FD5 A;  4D5F A;  5E20 A;  1VND A;  2DJI A;  1MJA A;  3BPX A;  5D4S A;  1Z0X A;  3FX3 A;  1HW2 A;  1BL0 A;  2OCE A;  1IF1 A;  3L2W A;  5ILS A;  3FMR A;  3PSI A;  2BVL A;  5EEG A;  2M2E A;  4ZDP A;  3V7C A;  3RDI A;  1VQ7 I;  5E1Z B;  4F91 B;  3BY6 A;  4DOZ A;  3I64 A;  4A3D J;  2AXL A;  4PCQ A;  2OQG A;  5BPD A;  4E6K G;  3CDL A;  3F6O A;  4Z6Y A;  2PFB A;  1SC7 A;  2R7V A;  2LR8 A;  2CO5 A;  5C4X J;  2HDD A;  3PL8 A;  2PMZ A;  4I09 A;  1U78 A;  1I3A A;  3HZJ A;  2IS2 A;  1R22 A;  5M3F J;  2B7E A;  2KQR A;  2P81 A;  5F6F A;  1B8I B;  4CCL A;  2MFZ A;  2ZFU A;  1JGS A;  3BRO A;  4XKV A;  2XAJ A;  2Z3Y A;  5BS6 A;  2IT0 A;  2MBF A;  1VZ0 A;  2W84 A;  4MNU A;  1G3S A;  3PQJ A;  2O3F A;  3O8G A;  3ZMZ A;  1R58 A;  1IN8 A;  1XD7 A;  3FWE A;  2DOF A;  4HF0 A;  1BIB A;  1UG0 A;  2O0Y A;  2L7F P;  2BE5 F;  2OA4 A;  3W2V A;  1SFO J;  1R7J A;  2R0Q C;  3OYH A;  1YE9 A;  3F8N A;  4HF1 A;  2PJP A;  3TL4 X;  2XRO A;  3LA2 A;  3PUF A;  3JTG A;  2W00 A;  1BR2 A;  1EV7 A;  2O8X A;  3TED A;  1QZZ A;  1YO5 C;  2RKH A;  3RIR A;  4HLY A;  4S04 A;  4IEJ A;  4U0V A;  5L3G A;  4A3C J;  2EZL A;  1JI8 A;  1SVL A;  1S7A A;  2GQQ A;  1RR7 A;  4BU2 A;  5DUI A;  2FEZ A;  3ML6 A;  2NVT J;  2DI3 A;  2ZME A;  3CLQ A;  2R7D A;  1TWA J;  4A0Z A;  3GME A;  4RGS A;  3GXO A;  4XN0 A;  4GCV A;  3KP3 A;  2F4I A;  1XDS A;  3QPS A;  3SZG A;  4U0Y A;  2FF4 A;  1XB4 A;  2OF7 A;  1YIT I;  2KZG A;  2E35 A;  2ISZ A;  3K10 A;  2DW4 A;  3OYN A;  4RB0 A;  3TOA A;  2VOD A;  3GTQ J;  2KKO A;  2EZH A;  4O6J A;  3F3X A;  3EUH A;  1YX5 A;  4F55 A;  3H3U A;  3H5N A;  3VSL A;  5CVJ A;  2ESH A;  1UZC A;  3LSG A;  1IXC A;  1OKR A;  4OWR B;  2HYF A;  4RLQ A;  2HVR A;  3LA7 A;  2L9S A;  4XRS A;  1J09 A;  2P5V A;  1HSJ A;  1GXQ A;  2L01 A;  1TQP A;  4LK0 F;  4BS9 A;  1UMQ A;  4GYI A;  4P5O A;  2HQ5 A;  2VJJ A;  4Q5S F;  1S72 I;  4XMY A;  3AAF A;  1F4K A;  4RAF A;  3PUB A;  1UHS A;  4IZZ A;  4H4K C;  4XR6 A;  1DP7 P;  2EH3 A;  2EPF A;  1G2H A;  2VE9 A;  3AKZ A;  1KON A;  3ZQQ A;  5J6X A;  4XLC A;  3MKY B;  2YUS A;  1FOK A;  1AU7 A;  2W48 A;  5HOD A;  2E5Z A;  2M7A A;  4CIC A;  3E5X A;  2W1O A;  1W7P D;  4HA8 A;  4FCY A;  4QTR A;  4IQ4 A;  1I3Q J;  1IGN A;  1JJ6 C;  2X1D A;  2XSD C;  2HZD A;  5D4R A;  3ABM H;  1NG6 A;  4HYE A;  3CCV I;  2ZKZ A;  3DU6 A;  1XS9 A;  1FC3 A;  3SQN A;  1ETY A;  4I0B A;  1TC3 C;  3CMA I;  3FXM A;  1OFC X;  3HGY A;  3ABL H;  4BQO A;  4A12 A;  3QU3 A;  1IN7 A;  2D1H A;  4BJT A;  3OYF A;  1CGP A;  2LFB A;  4XOP A;  1G8X A;  1ZG3 A;  4G6T B;  3FMS A;  3FXR A;  3L7W A;  1KYZ A;  1Z6R A;  4EQQ A;  2IA2 A;  1IJW C;  3SFI A;  1UJ8 A;  3BDD A;  2ZME B;  4G9Y A;  2ZXW H;  5KVR A;  1JJ8 C;  3G1L A;  1BR4 A;  2IBD A;  4XL9 A;  4CDG A;  4MLO A;  4IKF A;  1BI1 A;  5CVV A;  4IHT A;  4RB2 C;  3OYM A;  4IHV A;  4XNF A;  1GVD A;  3KX2 A;  5F0H A;  5K5Q A;  4LK1 F;  2BY0 A;  2LKS A;  2V1D A;  2CUE A;  2X6O A;  3ROU A;  1IUF A;  1TW2 A;  3ZQG A;  1S9H A;  1YIJ I;  2K27 A;  4U7D A;  1YW7 A;  2NS8 A;  2M1B A;  3OYL A;  5EF6 A;  2CW0 F;  4Q4Z F;  1MSE C;  4OU0 A;  3LST A;  2DOE A;  3I53 A;  2MD5 A;  2FML A;  1XMA A;  1BI0 A;  2V9P A;  1I39 A;  5BPI A;  1J59 A;  2JK3 A;  2HGC A;  5DUK A;  3ERM A;  3D5L A;  2QEX I;  2JVG A;  4ESF A;  4KNY A;  2HQR A;  2RRE A;  2QLZ A;  1V54 H;  2H27 A;  3H0G J;  1W7P B;  3I4M J;  4A3M J;  3FXK A;  4E70 A;  2KLO A;  4OIR F;  2LY9 A;  2PN6 A;  2V79 A;  3GW2 A;  2VE8 A;  2VJ4 A;  4XSX F;  3CC7 I;  1OCP A;  3RZO J;  1BW5 A;  4Y15 A;  1K78 A;  1H9G A;  2DFI A;  1KQ0 A;  3BPV A;  4Z2Y A;  2VN2 A;  1RRJ A;  1VQ5 I;  3KCC A;  2Q2E A;  3CJQ B;  3DU5 A;  3WTV C;  4IRH A;  3E97 A;  3C7J A;  3S3O A;  3DWL E;  4UB6 C;  1I27 A;  1X4P A;  5C4J J;  4GXO A;  4D5C A;  1TP4 A;  4I98 B;  4A3E J;  1XSD A;  3M07 A;  3QOP A;  3QPL A;  5L3C A;  2V1U A;  2M87 A;  1QPI A;  5GAG J;  1S6L A;  3E6C C;  3S93 A;  3T5X A;  3MWM A;  4X1E A;  4E4H A;  3S1Q J;  3ZN1 A;  3X2Q H;  2VPR A;  1EH7 A;  2FMY A;  3BT9 A;  1SFE A;  3AG2 H;  2BW3 A;  4P9U A;  3E0J B;  1S8N A;  2EIJ H;  1W1W E;  2A5Y B;  4E7S A;  1QU3 A;  1HW1 A;  3OWT A;  4CCM A;  4HBL A;  1XGN A;  1BOB A;  3KP4 A;  1VI0 A;  1WKM A;  1I50 J;  2CQX A;  3I59 A;  1D3Y A;  4AU7 A;  3RJP A;  1MBG A;  5LBQ A;  3HTU A;  3CCU I;  5F0C A;  4CH7 A;  2X6X A;  3K9T A;  2K86 A;  3S14 J;  3GFI A;  3GZ5 A;  4AVP A;  3H9Q A;  1ETQ A;  3OS2 A;  1OYY A;  3BTC A;  3I54 A;  2IGN A;  4OAZ A;  5AON A;  1I6X A;  4A93 J;  3VDX A;  1YRN A;  1XTA A;  3WGI A;  4M9Z A;  2W24 A;  2XAQ A;  4PJM A;  1OIS A;  2K4J A;  4U0W A;  3CO6 C;  2K3P A;  4FET A;  1N25 A;  2LC2 A;  2FSW A;  1V5G A;  2NVX J;  3EPZ A;  2PI0 A;  2F5C A;  2GWR A;  2CS3 A;  3K2A A;  5FKL A;  2BHZ A;  4FTH A;  3FIW A;  3RSN A;  2XGE A;  3R0A A;  5LHG A;  1ETX A;  4L5J A;  2A69 F;  2V6E A;  2OQR A;  4UUV A;  1IXR C;  3GX4 X;  4MTD A;  1XSX A;  4KIF A;  1RKT A;  1FSH A;  2PLY A;  5FO5 A;  1B1B A;  1R00 A;  1QRY A;  2QQ8 A;  1ZGA A;  2CFO A;  2EWN A;  3BR2 A;  2KZV A;  3ZR8 X;  1XGS A;  2WAQ A;  1G59 A;  2L54 A;  2JT1 A;  2FRH A;  3BQZ A;  1FT9 A;  4C2M J;  3MAJ A;  1MMN A;  5GP9 A;  2OZU A;  1LQ1 A;  4I76 A;  2MGQ A;  4HAM A;  4XLE A;  4UY8 I;  2R7X A;  3NEU A;  4GYG A;  3W6K B;  1K78 B;  4XSZ F;  2QKL B;  2YSR A;  1U8B A;  5FRM A;  1W36 D;  2PMU A;  3LQR A;  4HDV A;  4CA0 A;  1U9N A;  4X0G A;  3QQA A;  2Q2E B;  2VI6 A;  1T95 A;  4HDU A;  1Y8R B;  3A0B C;  5L3F A;  3SJM A;  1E3H A;  4A3K J;  2E1C A;  4GDF A;  4EGY A;  1YIO A;  2K5C A;  5D6F A;  3LQQ A;  2Z9O A;  1IDZ A;  2F6C A;  2CMP A;  3I4P A;  4BY7 J;  3DEE A;  2RAE A;  1J2X A;  1DUX C;  2IPQ X;  2WB1 A;  3BCB A;  3BG3 A;  3JAM K;  3ZMT A;  2R93 J;  2ME6 A;  3MCZ A;  1RNL A;  5IYC J;  3LA3 A;  5E8G A;  5KK1 A;  2BW3 B;  2V9V A;  4EJW A;  3OIP A;  4M74 A;  4V19 K;  1X58 A;  2DMU A;  3KLO A;  4ZDL A;  3GZ6 A;  1YQA A;  1UHW A;  3B02 A;  2CQN A;  2H1L A;  3I59 B;  1BM9 A;  2XHK A;  3ZN0 A;  2BHY A;  4YRV A;  1JUS A;  4L5E A;  3DLL F;  2FXA A;  5ICG A;  1T0F C;  1A35 A;  2HOE A;  2X4H A;  4BYY A;  1W36 C;  2Y2Z A;  1ETV A;  1G3Y A;  2NOG A;  2F5D A;  3H35 A;  1JE8 A;  2MA3 A;  1YI2 I;  2PMH A;  1W5T A;  2KJC A;  3FXQ A;  1KQ8 A;  4S05 A;  3CO7 C;  3S8P A;  1YRN B;  3VYU B;  2K4B A;  3Q0U A;  1LFP A;  2FE3 A;  1YHQ I;  2IS6 A;  1XC5 A;  1LKX A;  4JX4 A;  2H8W A;  2OCC H;  3GVA A;  3UKG A;  1FYL A;  5E3L A;  3IL2 A;  1Y8Q B;  2IJL A;  3S1R J;  5CLS A;  3S1N J;  2KRC A;  4A3G J;  3A4C A;  4ZYD A;  1B4A A;  1S5L C;  1XN7 A;  3HGG A;  2V26 A;  1XX5 A;  4J01 A;  1A6I A;  2R3S A;  4QWQ A;  1DPR A;  4LIU A;  2Z5U A;  1USS A;  2K9Q A;  3RPU D;  1TW3 A;  2P6S A;  1XCB A;  3NAU A;  1X2N A;  1V4R A;  4FIS A;  2DK5 A;  3OYB A;  1ON2 A;  2CQQ A;  5LLQ A;  4HSR A;  4QSH A;  1LNW A;  2DLL A;  1MNM C;  1Q1H A;  2VKE A;  4DYQ A;  4IX7 A;  2M34 A;  2GXB A;  3GO5 A;  2ISY A;  2A68 F;  1BI3 A;  3VOD A;  2DU9 A;  5IOY A;  1ODD A;  3BJ6 A;  3DPL C;  3M1C A;  2XGX A;  3IAS 2;  4C2U A;  1BJZ A;  1TTY A;  1ORK A;  1FLI A;  4XLP F;  1ZR2 A;  1QNT A;  2A6T A;  3CC2 I;  3PNV A;  2EIL H;  3KP7 A;  2EV5 A;  2M4K A;  3KZZ A;  5GTI C;  3A1Y A;  4OOI A;  3S2H J;  2DA7 A;  1IG7 A;  3T0Y A;  1W5S A;  2LD5 A;  5FLX K;  1ITY A;  2CV2 A;  3KEY A;  2FJ1 A;  4JK1 X;  2M8G X;  2LOO A;  2QKM B;  3IWZ A;  3OYC A;  5HLG A;  4M6V A;  4B48 A;  4ZZD A;  1DGR M;  2L4M A;  2ACJ A;  5IPA A;  3LSK A;  4CO8 A;  2NAZ A;  1A36 A;  1PUF A;  3DBR B;  1UCR A;  3WTW C;  2CWE A;  3ZMS A;  2PQ8 A;  3F21 A;  1GT0 C;  4ZYE A;  4AD9 A;  3L2V A;  5AIP A;  1APL C;  4U88 A;  5ILU A;  2LNB A;  3CDI A;  2MSY A;  4DQ2 A;  1PJR A;  2K7L A;  2OZ6 A;  4L9N A;  2Y31 A;  1JUP A;  3GTP J;  2FD5 A;  4HW0 A;  4DZJ A;  3MMY B;  2DO7 A;  2R5Y A;  4BDZ A;  4LD5 A;  2Y9Z A;  3QWL A;  2QBY A;  4BL0 B;  2MC3 A;  4I2O A;  5KHD A;  3W6J B;  3DTK A;  1R23 A;  3H5A A;  3RYP A;  4PFP A;  3LSR A;  4IVN A;  3GFM A;  3C3W A;  4JQF A;  1U3E M;  5CVU A;  1RUN A;  1D1A A;  1LVK A;  1XGO A;  2ZJ2 A;  3T8T A;  4IO9 F;  2M5W A;  4LMY A;  2EA2 A;  3HKZ A;  4YII A;  4RB3 C;  2Y9Y A;  2M3A A;  2R7S A;  4HG2 A;  3C1D A;  2DTZ A;  5FRN A;  3KEO A;  3M8J A;  5HDG A;  1U9O A;  2RQP A;  2HS5 A;  3UNG C;  1R1T A;  2KIM A;  3RZD J;  3BTI A;  3OIQ A;  3KEQ A;  3M4O J;  3K2Z A;  1ZRF A;  1OCT C;  5FB2 A;  3Q9S A;  3RKQ A;  3HOV J;  3S2W A;  4EGZ A;  5TIS C;  5HLH A;  2XC7 A;  1XDU A;  2QA4 I;  1ZG1 A;  4AYB N;  1O4X A;  1UST A;  1Y1W J;  3HIF A;  2Y48 A;  2XSJ C;  4AWX B;  3VYT B;  2OAZ A;  3I56 I;  4I0A A;  2DJN A;  2H6B A;  1VTN C;  3JRH A;  4RBO A;  2BZT A;  5ED4 A;  2OTJ I;  2M0M A;  4NUB A;  4KT6 A;  3PNT A;  3U1K A;  3ZOB A;  3C18 A;  2X48 A;  4F3Q A;  4BXX J;  2B63 J;  2LKP A;  2ZXI A;  3WGG A;  1MH3 A;  1JXS A;  2HYJ A;  4D0P A;  4UVB A;  2IXS A;  3DKY A;  4A3B J;  4A0Y A;  2ZJR F;  2CGP A;  4XKB A;  3S2D J;  2HXI A;  4I02 A;  2QM3 A;  4PGH A;  2QSH X;  1IRG A;  3HRM A;  3OSG A;  4EM1 A;  3BG7 A;  4M73 A;  2ID3 A;  1IW7 F;  4HLX A;  2RC4 A;  5F0F A;  5ERI A;  4ENN A;  1POG A;  4XRM A;  2LP0 A;  3GZN B;  5KAI C;  5JVG F;  1OYI A;  3HG9 A;  4GFB A;  4IHS A;  3OSF A;  3JAM Z;  2DA5 A;  2JSC A;  2MD0 A;  2UWM A;  3GTJ J;  3PJR A;  1PUF B;  3QPT A;  2EJR A;  3WE2 A;  1YW9 A;  1MBH A;  4KDP A;  1A5J A;  4MO7 A;  3K69 A;  4UVA A;  2HQN A;  1G4D A;  2D45 A;  1KU7 A;  4PGG A;  2HPM A;  2R7R A;  3DP7 A;  2RNJ A;  3TW6 A;  1SAX A;  1I1G A;  1D8J A;  4BAC A;  2R5Y B;  1D8K A;  2QBY B;  1V55 H;  2K02 A;  3OR1 C;  5JLW A;  4ESB A;  2L7K A;  5HNH A;  4RMN A;  4AIJ A;  5H20 A;  3FBN B;  1MDM B;  5EDN A;  1Y1V J;  2CSO A;  2Q1Z B;  1TT0 A;  2WBM A;  3E1S A;  3MD2 A;  3TOB A;  5A2Q Z;  1FYM A;  2CQ7 A;  4NC8 A;  5GTH C;  2BXZ A;  3T1B A;  3BTJ A;  4BEH B;  3E5Q A;  2FNP A;  2YPR A;  3G6E I;  3KPH A;  5LEK A;  3KIO A;  3U21 A;  1S29 A;  3OS1 A;  2FOK A;  2ZJP F;  3WG9 A;  2MC4 A;  1ZH5 A;  3LSM A;  5EG0 B;  2V6C A;  3L2U A;  1KA8 A;  4MFD A;  1AA7 A;  5F1R A;  2OTL I;  1AHD P;  1HCR A;  3F6V A;  1BC7 C;  2STT A;  4ENM A;  5J8F A;  3B6A A;  2HWV A;  2KFD A;  2VJ5 A;  2VC0 A;  3JTH A;  1ZN2 A;  4IPA A;  2A5W A;  2E71 A;  3ZQL A;  1TWC J;  3IP4 B;  3A03 A;  3SEQ A;  3RKW A;  4AUX A;  4GRI A;  2COM A;  3D5S C;  4XON A;  1Q1V A;  2Y69 H;  2XGC A;  3H0D A;  1S7O A;  1SD6 A;  2LY1 A;  4II3 A;  3CD6 I;  5DM7 F;  1BA5 A;  1K79 A;  4XRS G;  1MZB A;  2RV8 A;  1O3T A;  1R4M B;  4BQN A;  5DEQ A;  3LWF A;  3I58 A;  4FT8 A;  1OR7 A;  3J7A Y;  1WJA A;  3WHB A;  2GXA A;  3K4J A;  1XG1 A;  3ZXS A;  3ZQI A;  3PO3 J;  2XF7 A;  2R92 J;  5DV5 A;  1WI3 A;  1EJ9 A;  1IV6 A;  5E8I A;  1XCV A;  2CFX A;  2L7M P;  2QWW A;  4ENJ A;  1T38 A;  2UUZ A;  2BY3 A;  2V1X A;  5FLX Z;  3NAR A;  1WI9 A;  3HPG A;  4AIK A;  3BR3 A;  2KRH A;  4I99 C;  3WE3 A;  2GOX B;  2VOO A;  3K4B A;  2GIV A;  2LBF A;  3LSH A;  2OJE D;  3BZ6 A;  5K7Z A;  4ENK A;  2LRD A;  1VQ8 I;  3HHH A;  5HS7 A;  2O9L A;  1GVJ A;  2A3S A;  4DGW B;  4DBQ A;  1X3U A;  2XB5 A;  3Q5F A;  5J3L A;  1Z6T A;  2L7Z A;  2LH9 A;  4OAY A;  5K7H A;  2LLK A;  4Y33 A;  1KQ9 A;  1QGP A;  2O8K A;  2DOA A;  1UFM A;  2CW8 A;  2WTE A;  3I71 A;  1QPM A;  1MD0 A;  3Q0W A;  1ETO A;  2CW7 A;  4C9Y A;  3ULQ B;  2KT0 A;  2L9V A;  3HOU J;  4KIT B;  1YJ9 I;  5CKT A;  2A61 A;  3OOU A;  1IXS B;  2YX4 A;  1HDD C;  2WA0 A;  1FSE A;  2K9M A;  3G4S I;  1FYK A;  3AFH A;  3V4G A;  4ZZL A;  1HF0 A;  2DDA A;  4LLL A;  4G94 A;  3SXY A;  3DXJ F;  1LVA A;  4IHY A;  2IS1 A;  1FOY A;  2VON A;  1Y6I A;  4P1W A;  3UR3 C;  1HW5 A;  3ZP5 A;  1P7I A;  2M45 A;  3LFU A;  4KIB A;  2JVH A;  2JQ7 A;  5KAF C;  1MNE A;  1Y39 A;  1H0M A;  2QZ8 A;  3U1D A;  4L0Z B;  3S3M A;  1WRJ A;  3MKZ A;  1GUU A;  2GOM A;  3K4C A;  4DBR A;  2ZME C;  3HOS A;  3P9C A;  1UB9 A;  5K1Y A;  5CVR A;  2IRF G;  3WHC A;  5J4V A;  2DMT A;  3TDZ C;  2ZBK A;  2O6G E;  3W6V A;  4TV7 A;  2DXI A;  2VIX A;  1ZQ3 P;  3RKY A;  3CCY A;  4XBF A;  4GO1 A;  2ELH A;  2KIS A;  3ZQF A;  3KYL A;  3VOE A;  4LFU A;  5CQE A;  1FMW A;  2ADU A;  3EUK L;  5EEH A;  3SEZ A;  2VXD A;  3EUH C;  1LDJ A;  3HOX J;  5LD2 C;  2K9S A;  3MEX A;  3L2C A;  1UG2 A;  3CTA A;  5FKO A;  2JPC A;  5LHI A;  3CUQ A;  9ANT A;  2IS4 A;  2X1E A;  3J81 Z;  4BGD A;  4KIS A;  5H6R A;  2Z1D A;  1DGW Y;  5E3O A;  4RM3 A;  4UHT A;  5FLM J;  1VQN I;  4IOA F;  5HNF A;  2HOT A;  5CQG A;  5BOX A;  1RUO A;  5CYV A;  2W4S A;  1DPU A;  4A3I J;  3MZH A;  4XID A;  2HKX A;  1J7K A;  2ESN A;  1SAN A;  3ELK A;  4IRI A;  4MHG A;  2LBF B;  1JTY A;  4HZF A;  1LFB A;  3C2H A;  2VT2 A;  3OS0 A;  2CQK A;  1YS6 A;  4FX0 A;  4BQA A;  1P2F A;  1DP3 A;  1JKO C;  3PIO F;  1B59 A;  3EDP A;  1H8A C;  2R7Q A;  1EKE A;  2HKO A;  4UV8 A;  4MIM A;  2Z99 A;  2IGO A;  2GM4 A;  5IY5 H;  1Z7L A;  1ZAO A;  2Z16 A;  4B1R A;  3JRC A;  5F64 A;  2TDX A;  3AG4 H;  3G73 A;  3A0H C;  3OYK A;  2G0E A;  4HX8 A;  2PEX A;  2AXT C;  2NVY J;  3RQ4 A;  3QP6 A;  3F8F A;  2F4O B;  3GTK J;  4PJ0 C;  2XRL A;  3K7A J;  1GV5 A;  2R4G A;  4QIW N;  3I5U A;  5LEJ A;  3OYA A;  4WWC A;  2EZK A;  2L3D A;  3S3N A;  1MGT A;  4D7M A;  3JRA A;  2HTJ A;  2FOW A;  1QQI A;  3HM5 A;  4Y3O A;  4L9J A;  3K4L A;  3CP8 A;  2HQA A;  3CMM A;  1EH6 A;  2GZW A;  3ZRG A;  2IGM A;  5LGT A;  5LFA A;  5M5Y J;  1P7J A;  6PAX A;  4XOT A;  5CJ9 A;  3V42 A;  2XIG A;  3RCO A;  1J9I A;  2Y75 A;  3N97 A;  4KN4 X;  3CUQ C;  4EJU A;  3ZPL A;  2P4W A;  1SD4 A;  1WJD A;  2OBP A;  3OY9 A;  1Z67 A;  4L5I A;  3DEU A;  2IEK A;  3H5R A;  4M71 A;  1ULY A;  2NVU B;  4YEL A;  4BXU A;  4WXH A;  2DMP A;  3D0S A;  3D5R C;  3CF5 F;  2ZSH B;  5BQT A;  3PO2 J;  5K5O A;  4XQF A;  1PUE E;  1FIP A;  1IV8 A;  2XDV A;  5EZG A;  5D5W B;  3G71 I;  4A0X A;  3I4N J;  4E7H A;  4BJ5 C;  4RLF A;  3HEF A;  2D5V A;  3K70 D;  2DYR H;  4EV0 A;  1YFH A;  5IYB J;  4B09 A;  2Y0M A;  1REP C;  2IW5 A;  2ZC2 A;  3WU2 C;  3CUQ B;  2XAH A;  1FX7 A;  3FZV A;  1NTC A;  1RR8 C;  5JFR A;  3CME I;  4QPO A;  2LDU A;  1J5Y A;  1LDK B;  3BG6 A;  2GAU A;  2HOS A;  2QEN A;  2LTP A;  4RDU A;  3MZY A;  4ZTF A;  4G7Z F;  2X85 A;  4A3F J;  3SDB A;  3H36 A;  1YJW I;  1R1U A;  2HOA A;  3G1M A;  3I0T A;  1STZ A;  3EQL F;  4MTE A;  2CV0 A;  4JYK A;  1GHC A;  2FX0 A;  2KMU A;  2OD5 A;  1FP1 D;  4A69 C;  2HPI A;  1B9N A;  3RPQ A;  4M3E A;  5L3B A;  1MMA A;  3LFK A;  4EVI A;  2HR3 A;  1SVO A;  2BGC A;  4MEX F;  1NH3 A;  3M8E A;  2VBX A;  1IRX A;  2X51 A;  4NBQ A;  5D8K B;  4BUP A;  4KFC A;  3A2K A;  3HTS B;  3ZQC A;  2FBK A;  1SFX A;  1RPW A;  1R71 A;  3PM1 A;  3K70 C;  3M9A A;  4HX4 A;  2LY2 A;  2QQA A;  3F8C A;  3M7G A;  2NVQ J;  2VQC A;  5JR3 A;  3FHZ A;  1MW7 A;  5HS9 A;  3ZQ7 A;  3FK7 A;  5FD6 A;  3GFJ A;  1P9Q C;  2V4J C;  1VQM I;  2QSF X;  3W3C A;  1B6A A;  1ZYR F;  2R5Z A;  4UNO A;  3K4N A;  4LJZ F;  3OYJ A;  2XPV A;  2L0K A;  4Q47 A;  4ZTJ A;  1LEB A;  1ZEL A;  3IRQ A;  3J7Z I;  1HA8 A;  2ZNY A;  3P9K A;  4J19 A;  5FGM A;  3HL2 A;  1U6G A;  3DEW A;  2GIZ A;  2A07 F;  2VBW A;  3C2B A;  3B73 A;  3O8H A;  3CF2 A;  3Q3S A;  2C6Y A;  1KU3 A;  2NRA C;  4OMZ A;  5H2F C;  3TP0 A;  4B8X A;  2NS7 A;  2YU9 J;  1BJA A;  3OYD A;  2PBI A;  1QBJ A;  2DMN A;  2EIN H;  3RYR A;  5DM6 F;  3HSF A;  4D9J A;  2DT7 B;  3T8R A;  2M30 A;  2DAO A;  2L4A A;  5GPC A;  1IN4 A;  3MZ8 A;  3WTS C;  1KU2 A;  3SZT A;  2NNN A;  4RM2 A;  3HSE A;  2HXO A;  4DJA A;  3KET A;  1W5C C;  2IA1 A;  4YIF A;  3FK6 A;  2CV1 A;  1J0R A;  4AYB A;  3U9G A;  1MMG A;  1ENH A;  2JA5 J;  1GXP A;  5F04 A;  3GTM J;  1R36 A;  1TT5 B;  2M8E A;  1YOV B;  4E7I A;  4XOR A;  1LFU P;  3PSF A;  4B4C A;  4XLA A;  2LKX A;  1LDD A;  1D5V A;  3V7R A;  1B9M A;  3LMM A;  2W7N A;  5JLX A;  1IRF A;  2VQG A;  1TZL A;  2CYY A;  1PVE A;  1MSF C;  3JRI A;  1ZRD A;  2AHQ A;  2I10 A;  4LB6 B;  1P6R A;  4FE7 A;  1W4M A;  3FHN A;  5DYM A;  1RES A;  3HYI A;  3NRV A;  3DKW A;  4FAS D;  1HKQ A;  1U5T A;  1MMS A;  2VL8 A;  2CJJ A;  1NK3 P;  2VB6 A;  3ZQH A;  4DYC A;  3BC8 A;  2DCE A;  5L3E A;  2BXY A;  3Q0V A;  4IQJ A;  2JA7 J;  1YS7 A;  3DPT A;  4CUG A;  1MIJ A;  1WJF A;  2F5V A;  2P7V B;  4G6Q A;  4V2F A;  1WGX A;  3MKL A;  1C0W A;  3EYI A;  2KIU A;  2BV6 A;  1SMY F;  3U2R A;  2KDZ A;  2R5Z B;  5AIQ A;  3J80 K;  2FBI A;  3LOC A;  1OCZ H;  4NQW A;  4XN3 A;  1BC8 C;  3WTU C;  3HRS A;  3AL0 C;  4JBA A;  3ZMU A;  2XAS A;  3L9F A;  3JCU C;  1FBS A;  5F27 A;  4O3M A;  5J1U A;  1IUY A;  3KZI C;  2L9R A;  2XAU A;  3FIS A;  1WJE A;  2EFN A;  1O57 A;  2DA3 A;  2EFQ A;  2M4G A;  1E3P A;  2ZCW A;  3CMY A;  2WC2 A;  1HKS A;  2JA6 J;  2F48 A;  2DA1 A;  3CCM I;  1O3Q A;  2CUF A;  1WPK A;  5DTD A;  2ZFW A;  3TO7 A;  2YR2 A;  3BG5 A;  1JTX A;  3AL0 B;  3CCJ I;  5HOO A;  3R6S A;  4PJL A;  3FXO A;  4A2U A;  4HQE A;  2PJR A;  2RVC A;  3A01 A;  2DT5 A;  3ERE D;  4CHU A;  3K1P A;  2RDP A;  3VB2 A;  4G7O F;  4N0B A;  1JKR C;  4LB5 A;  4CCN A;  2G9W A;  3QOD A;  4CYD A;  1WH7 A;  2GA2 A;  3TO9 A;  4U87 A;  2WAE A;  4LG3 A;  1OLT A;  5ICE A;  3VSK A;  1RIO H;  1R6R A;  1VQK I;  1XSV A;  4EEF G;  2B9S A;  5E18 F;  3DPU A;  1JHH A;  2XPU A;  3BTL A;  3FF5 A;  3HUG A;  3I55 I;  4RGU A;  1D5Y A;  4L18 B;  3TBI A;  2GBY A;  4B44 A;  2EIK H;  1FY7 A;  4YG2 F;  1I1S A;  1QZE A;  4LGW A;  4LG0 A;  1W0U A;  2R7O A;  5DS9 A;  2E36 A;  3TW7 A;  2P6T A;  5BMZ A;  1WQ2 A;  4MQ9 F;  1P4W A;  3FBI B;  4BE2 A;  4CYC A;  1QHH D;  1ZAR A;  1X1C A;  5J1Y A;  2E5N A;  2R7Z J;  3CLO A;  3SZP A;  4YIR X;  4RGX A;  4YFN F;  3CJR B;  2O5R A;  2QQB A;  2KIQ A;  2ZB9 A;  3JR9 A;  3FKJ A;  3CJT B;  2P8T A;  4RGR A;  3NWS A;  3NWT A;  3L09 A;  1WCM J;  1FBQ A;  2XV4 S;  3R4K A;  4L0Y B;  4B47 A;  3DF8 A;  2LMD A;  2HDW A;  3L1P A;  1A6Q A;  1XMX A;  2VQL A;  1U5T B;  2W57 A;  3RKX A;  4CSW A;  3DKX A;  4P55 A;  3WTZ A;  4CCO A;  4PSW A;  1TNS A;  3E6D A;  1OCC H;  1TLH B;  2W25 A;  1SEU A;  1VQ4 I;  4MEY F;  4ESJ A;  2XUB A;  3H9J A;  3HOY J;  5DCF A;  1N75 A;  2KHM A;  1ERD A;  4DIQ A;  1K4T A;  1PDN C;  1H89 C;  3R0J A;  4HQM A;  1WHU A;  1IO2 A;  4RS8 A;  1N78 A;  3HSR A;  3QP5 A;  2EFW A;  1IZ1 A;  2KP6 A;  1O3S A;  4PK4 A;  2HVQ A;  3WTT C;  4F52 A;  3ZGK A;  2V1N A;  5GAH J;  3CCQ I;  1GV2 A;  1R4N B;  3BR0 A;  3JRD A;  5M5X J;  4BNC A;  1R5G A;  1HDP A;  2DYS H;  4XRF A;  1TWH J;  3KE2 A;  2STW A;  4A3L J;  3K6G A;  4ZC3 A;  1ZHF A;  4OIN F;  4N9H A;  4P96 A;  2ID6 A;  3ONQ A;  2ECB A;  4PJJ A;  2BY1 A;  4CXF A;  2WAF A;  5LHH A;  4EJV A;  4RAG A;  4ZDO A;  2DT6 A;  4II2 A;  5TGT A;  4BQQ A;  1D1C A;  2J5O A;  3K1M A;  3H1C A;  2H8R A;  4ZYA A;  1VQ9 I;  3QYF A;  4B3A A;  5D8L B;  4BY1 J;  4M3F A;  1WWX A;  2IAI A;  3VWB A;  2PJR B;  1I5Z A;  3A01 B;  1VFC A;  5BNG A;  1HQC A;  5DDG A;  4WCG A;  1ACI A;  3BR5 A;  1K6O A;  1K61 A;  2IVM A;  5HDN A;  2VT3 A;  4LOC A;  4CZC A;  2Z2S B;  4BAY A;  3M8F A;  4EM0 B;  3BLY A;  4F7Z A;  2L5Q A;  3PFY A;  1RC9 A;  3HUG B;  3DLA A;  4HX7 A;  5FRO A;  1RKW A;  2BY2 A;  3RQI A;  3KLN A;  5FFX A;  1ZLJ A;  3GWZ A;  4E7J A;  5IT3 A;  3HPH A;  5FKN A;  2Y0S N;  4LG0 B;  3F0C A;  3VYR B;  1CQT A;  1BIA A;  3BZC A;  2Y30 A;  2X9D A;  5ICC A;  3KZY A;  2K9N A;  2EA4 A;  1U8R A;  4CYC B;  2RN7 A;  5K7F A;  3MKW B;  2VUM J;  1Z05 A;  2NNY A;  4YFK F;  1UEL B;  1FZP B;  2TRT A;  2G7U A;  2QQ9 A;  1SFU A;  4UB8 C;  1MKM A;  5CPR B;  4N4O B;  1A31 A;  2ETH A;  3BJA A;  3JRB A;  1X4O A;  2CRG A;  3FM5 A;  1IDY A;  5GAE J;  1Z1D A;  2IGK A;  2WY7 Q;  4I6Z A;  2I5U A;  1ZGW A;  1AWC A;  4DZP A;  2R7T A;  2JRT A;  2DK8 A;  5B3S H;  1SD5 A;  1MBK A;  2ICW G;  4M3B A;  5FKK A;  4E7K A;  1JKQ C;  2OPT A;  1F9N A;  4KN7 X;  3L2Q A;  3IWF A;  4WXD A;  2FQ4 A;  3R60 A;  3BZK A;  1IRZ A;  1NK2 P;  2XF6 A;  2BOL A;  3OV8 A;  2JRM A;  1D0Y A;  2WV1 A;  3PQK A;  3V7S A;  3IRR A;  4BH9 A;  2F5E A;  2FQ3 A;  1HST A;  2MH9 A;  4QPQ A;  3CCE I;  5K5R A;  3GBG A;  1IC8 A;  2JUG A;  3ECH A;  2X1C A;  2UXX A;  3BP8 A;  3REO A;  2DA6 A;  4V2G A;  3IKT A;  2L9N A;  3J80 Z;  3BR1 A;  3O2P E;  2MLG A;  3RI4 A;  3F8B A;  4PSX A;  2RGV A;  3QYE A;  5B1A H;  1E0E A;  1WVR A;  4U7B A;  1JHF A;  5LRR A;  3BQY A;  5TJJ A;  4YEJ A;  4Y17 A;  2VKD A;  1XGM A;  1O3R A;  3IV5 A;  2NOJ B;  2BYV E;  1WJ5 A;  1RI7 A;  2EIM H;  4UVC A;  3OL3 A;  2DPD A;  1EA3 A;  2VBY A;  3CP2 A;  3HKZ N;  2DTR A;  3N05 A;  2Q0O A;  3M1E A;  5D5V B;  1E3O C;  4LLG F;  1Z3Y A;  2KPM A;  1GDT A;  1B72 A;  3GLL A;  3FXL A;  1MH4 A;  1QVT A;  3LSI A;  2XAG A;  3B6C A;  2EK5 A;  5J1R A;  3LNQ A;  3ABT A;  3SHF A;  3I3L A;  5E17 F;  1FWZ A;  4X6A J;  2HI3 A;  1DU6 A;  4KIC A;  2MLK A;  3G3Z A;  1G3T A;  1MMD A;  1Z3X A;  1MND A;  3HJE A;  1VQP I;  3BJO A;  4EJT A;  4HF2 A;  2VAS A;  1KYW A;  5ILV A;  1Y0U A;  4CZZ A;  3WTX C;  3VYS B;  4KUM A;  2A6E F;  2GXG A;  3JRF A;  4KMF A;  4HNT A;  1R49 A;  1X3W B;  1RZ4 A;  1BN5 A;  1KZH A;  4HST A;  4AVZ A;  3IC7 A;  1E17 A;  3S32 A;  3EUA A;  2F5F A;  4UUS A;  4R1H A;  5ICF A;  5EYR A;  1HLV A;  1FOX A;  2EV0 A;  1W7P A;  2WV0 A;  1K6Y A;  3IH4 A;  5EGO A;  1OR7 C;  2IA0 A;  2E2J J;  4PFO A;  2EV6 A;  1SAU A;  2VLA A;  5GAD J;  3DBL B;  1LE8 A;  2MAB A;  2PX9 A;  4CCJ A;  1G3W A;  3WGH A;  2IP2 A;  2O7O A;  4Y52 J;  4F92 B;  2HU9 A;  4RB1 A;  3HB9 A;  1OJL A;  2P5L C;  1V5F A;  3CCS I;  4S0H B;  4D7N A;  4DYR A;  4ABZ A;  2GA1 A;  3DFG A;  3L2R A;  2V9K A;  4B3X A;  1V3F A;  5FJ8 J;  1HC8 A;  2EBI A;  4RAZ A;  1Z91 A;  2KDO A;  4OIQ F;  3IH2 A;  1R1V A;  2JN6 A;  5E1W A;  4G7H F;  5TRD A;  5B66 C;  4C3H J;  1J75 A;  3CCR I;  4G12 A;  4FX4 A;  4ZYH A;  3CJN A;  4JX6 A;  3HDD A;  1YG2 A;  1S7E A;  1XPX A;  4OIP F;  1YLF A;  2RNG A;  2XF5 A;  1KGS A;  2HDC A;  3VFZ A;  3COA C;  2YU3 A;  4I01 A;  3ZMV A;  3OYE A;  1T56 A;  1R5I D;  1SFK A;  3ASO H;  2HTS A;  1ON1 A;  1ZKG A;  3KP2 A;  2KL4 A;  3E5U A;  5HVQ C;  3FMQ A;  2EQR A;  3FM3 A;  1PYV A;  3L00 A;  3FXJ A;  5JHU A;  2COB A;  2DA4 A;  5E3N A;  1FP2 A;  5DD8 A;  2E7W A;  2KRF A;  2FA5 A;  2DPU A;  5DCM A;  1HBX G;  3FXU A;  3D1N I;  1QZY A;  2Z33 A;  2PMZ N;  4CGZ A;  2E19 A;  3IHU A;  3ZMD A;  4EM2 A;  1D0X A;  1DU0 A;  2NYX A;  5HLT A;  3PIP F;  4CCK A;  1X2M A;  4A3J J;  1PP8 F;  3GCM A;  1B72 B;  3BOQ A;  3TP3 A;  4BHP A;  4WF2 A;  1IAW A;  1YX3 A;  1ZRC A;  2D2W A;  2L2O A;  3H92 A;  2DBB A;  1O7L A;  4R79 A;  3ABK H;  4XLF A;  2JWT A;  3GLX A;  4HRI A;  3CUO A;  3TO6 A;  3OIO A;  4ZYG A;  5F1J A;  5M5W J;  1EH8 A;  5FFZ A;  2E60 A;  4IJA A;  4KA4 A;  2BBY A;  4M3G A;  4GGG A;  3ECO A;  1PP7 U;  1BBY A;  1FPQ A;  2QSG X;  1EF4 A;  5EEA A;  4XLH A;  2QGU A;  3GF2 A;  4IRG A;  4QLC U;  1SMT A;  2YS9 A;  2VBZ A;  4B43 A;  3GTO J;  1N77 A;  2EFP A;  4KYW A;  1P4A A;  4UUS B;  4KMU X;  4IOC F;  3F72 A;  2LSO A;  4XK4 A;  1ONV A;  4AID A;  2M9H A;  5EGO B;  3QPH A;  3TGN A;  1ZG5 A;  5JHF A;  3GTG J;  1ZR4 A;  5M3M J;  1SD7 A;  2WWY A;  5E3M A;  4H0E A;  2E1M C;  1LE8 B;  4WK8 F;  4NB5 A;  1TWF J;  3G2B A;  2D1V A;  1ETK A;  1LPQ A;  3H9G A;  2LRE A;  4BHC A;  3CC4 I;  1BR1 A;  1Z9C A;  2E1N A;  4N9I A;  1W0T A;  1MJ9 A;  2X0L A;  4XIC A;  3NQO A;  4NDL A;  2FBH A;  4WX9 A;  2HFH A;  4E7Z A;  2JA8 J;  2ZSI B;  1TQI A;  2A6H F;  5GPA A;  1E2X A;  1FMV A;  3VPR A;  4PZJ A;  3S15 J;  2ZXJ A;  2JSP A;  2E1M B;  2VC1 A;  4EAT A;  3WTY C;  3JSO A;  3H3Z A;  3TMO A;  3WU1 B;  2MYS A;  4M3D A;  5J4Y A;  5CVI A;  3K4K A;  2DOD A;  3A02 A;  1FTZ A;  2CU7 A;  2HVS A;  4HV5 A;  1NG7 A;  1OPC A;  4MFE A;  3E3V A;  1T33 A;  3AG3 H;  4KJZ A;  1XMK A;  3LSP A;  3BWG A;  5IP7 J;  5D5U B;  1X1P A;  5DCM B;  3LSJ A;  4AIH A;  1F5T A;  2MH2 A;  1P4X A;  4ITV A;  3IUO A;  2N8G A;  5IT9 K;  1GLN A;  4O5V A;  2LF8 A;  3MN2 A;  2WAD A;  3PFI A;  3BG9 A;  5HS8 A;  3HRU A;  2XKO A;  1X1B A;  3QU6 A;  1HXD A;  4C3I J;  4G8X A;  1K4S A;  2ZO4 A;  2CG4 A;  2ELK A;  1JKP C;  3KP5 A;  3OL4 A;  1BW6 A;  4XM3 A;  2LF7 A;  3P9I A;  2P7C B;  2DA2 A;  4A5M A;  4Y7N J;  5F08 A;  2O03 A;  3P7N A;  4Y4R A;  1IN5 A;  1S3J A;  3TDU C;  2QYO A;  3MVP A;  1FJL A;  1T0F A;  2AQE A;  4M6Y A;  3KFW X;  3E6B A;  1ZTR A;  2G7H A;  2AO9 A;  1QHG A;  1KU9 A;  1JT6 A;  4DW6 A;  2HYG D;  1X3Z B;  2HEO A;  3W2W A;  3S17 J;  2OV7 A;  1FBU A;  4MGR A;  5HLI A;  2DFE A;  2L02 A;  1V5E A;  3TQN A;  1X1A A;  3CDH A;  1HKT A;  4JX5 A;  3IAM 2;  4PUS A;  1RET A;  4IF4 A;  2UV1 A;  3RTR A;  1TQM A;  3DCF A;  1BI2 A;  3C2G A;  3O6B B;  1OQY A;  4C30 A;  4E7L A;  2ZXH A;  2AS5 F;  1FEX A;  4EMS A;  2WY8 Q;  5IOZ A;  5DD4 A;  3ABU A;  1U2W A;  4LIV A;  2DQR A;  2UXN A;  3GTL J;  2K40 A;  1K7A A;  1L0O C;  3BCA A;  1QO0 D;  1WH5 A;  1FIA A;  2FUG 2;  4LIT A;  2P0W A;  2CH0 A;  4N4N B;  3DBH B;  1Y0N A;  4ZJZ A;  4RAY A;  3J7Y J;  2I8D A;  2DFH A;  2XGD A;  4UUT A;  5IYD J;  2E1O A;  5LGN A;  5FKM A;  5B1B H;  4XLN F;  2JJ7 A;  3OYI A;  4AC0 A;  1UAA A;  3IKV A;  4NNJ A;  3O3K A;  1IN6 A;  2V7F A;  4AM3 A;  3E7L A;  4KT5 C;  1O7F A;  4ASN A;  4J00 A;  1Y56 A;  1G6N A;  4NC6 A;  3F9K A;  2X6Y A;  4D1Q A;  1FTT A;  5J47 A;  1T6S A;  5JI6 A;  2KJB A;  5B5E C;  5L3D A;  4JOM A;  2GLO A;  2CUJ A;  4UXN A;  3VEP A;  2XKP A;  5JVT A;  2QUF A;  2VQH A;  2KIF A;  4FQG A;  4RA2 A;  1CF7 A;  5LRS A;  2K85 A;  2UZK A;  4M9S A;  3G1O A;  3HOW J;  2JZY A;  4EJO A;  2M7B A;  3W2A A;  3RPU A;  1TBX A;  2EZI A;  3ISP A;  3WG7 H;  2R7F A;  3OYG A;  2H94 A;  5A2Q K;  1SVM A;  3WOD F;  2DMQ A;  5IP9 J;  3F8M A;  1LUJ B;  2CUZ A;  3ESW B;  1F1Z A;  1VQ6 I;  2W82 A;  2JUC A;  4BDY A;  4L9V A;  4XKC A;  2LYC A;  3DQV C;  4R8H A;  2F2E A;  4G6D A;  3FDY A;  3KYD B;  4M9X A;  1BOA A;  2DFF A;  1OCO H;  3QRF F;  2NS0 A; 
#chains in the Genus database with same CATH homology
 1ETW A;  1VI0 A;  2CQX A;  1I50 J;  1HF0 A;  1MBG A;  4BBS J;  3FKI J;  3JRE A;  5F0C A;  4IHY A;  4BKX A;  2H8R A;  1R9T J;  4B3A A;  4BY1 J;  1P7I A;  3S14 J;  4M3F A;  2IAI A;  1MBF A;  1ETQ A;  3A01 B;  1F36 A;  3BTC A;  1VFC A;  2VKV A;  2MG4 A;  4A93 J;  5EZH A;  5BNG A;  1YRN A;  1GUU A;  1JGG A;  3BR5 A;  1K61 A;  4LOC A;  2NVX J;  3WHC A;  1I6H J;  3K2A A;  5FKL A;  2DMT A;  4FTH A;  3FIW A;  2DN0 A;  2XGE A;  3W6V A;  1ETX A;  1ZQ3 P;  1Z77 A;  3CCY A;  3ZQF A;  1RKW A;  3RQI A;  5FKN A;  2TCT A;  2Y0S N;  3F0C A;  1CQT A;  1RKT A;  2Y30 A;  2X9D A;  3HOX J;  2K9N A;  3S16 J;  2K9S A;  1QRY A;  1QVU A;  1UG2 A;  4CYC B;  3BR2 A;  5FKO A;  5K7F A;  2VUM J;  3HOZ J;  9ANT A;  2TRT A;  1VF9 A;  2E2I J;  3BQZ A;  5E3O A;  5FLM J;  4C2M J;  2WAQ N;  2XB0 X;  5GP9 A;  3JRB A;  2HOT A;  2CRG A;  1AKH A;  1IDY A;  4I6Z A;  1ZGW A;  4I76 A;  2LK2 A;  2MGQ A;  4DZP A;  1H88 C;  5FKK A;  1MBK A;  4M3B A;  4A3I J;  1JKQ C;  4XID A;  2OPT A;  1SAN A;  2FQ4 A;  2M0C A;  1U8B A;  1IRZ A;  1NK2 P;  1JTY A;  3H3V K;  1U9N A;  3QQA A;  1LFB A;  2VI6 A;  2QF7 A;  2WV1 A;  3JRG A;  3CQZ J;  1JKO C;  3SJM A;  4A3K J;  4BBR J;  1H8A C;  1IC8 A;  3GBG A;  2JMW A;  4MIM A;  1IDZ A;  2GM4 A;  2DA6 A;  4V2G A;  4B1R A;  3BR1 A;  4BY7 J;  3JRC A;  3S1M J;  2RAE A;  3HBL A;  2G0E A;  3BG3 A;  2NVY J;  3BQY A;  2R93 J;  2XPW A;  2ECC A;  2ME6 A;  5IYC J;  5IP6 A;  4W1U A;  2WB1 N;  3IV5 A;  3GTK J;  2XRL A;  3K7A J;  1X58 A;  2DMU A;  4FE4 A;  1GV5 A;  1B8I A;  5EG0 A;  4QIW N;  3HKZ N;  2LVS A;  2H1K A;  2EZK A;  1F43 A;  1E3O C;  1JUS A;  4L5E A;  4D7M A;  3JRA A;  1GDT A;  1B72 A;  1HOM A;  3HM5 A;  1MH4 A;  1QVT A;  1ZK8 A;  3B6C A;  5J1R A;  3LNQ A;  2Y2Z A;  1ETV A;  2NOG A;  5M5Y J;  2ME0 A;  1P7J A;  1JUM A;  4X6A J;  2HI3 A;  1DU6 A;  3IH3 A;  1YRN B;  3Q0U A;  3SDG A;  1XC5 A;  4JX4 A;  1MBJ A;  2IEK A;  5E3L A;  5C3E J;  3UKG A;  5C44 J;  3S1R J;  3M3Y J;  2DMP A;  3JRF A;  3PO2 J;  3S1N J;  5FLV A;  4A3G J;  1FIP A;  5EZG A;  3HGG A;  1A6I A;  4UUS A;  4IHW A;  1MBE A;  2K9Q A;  3I4N J;  5EYR A;  1HLV A;  2MW8 A;  3NAU A;  3HEF A;  4HNV A;  1X2N A;  4FIS A;  3IH4 A;  5EGO A;  2D5V A;  1TWG J;  5IYB J;  2CQQ A;  2QCO A;  2E2J J;  4QSH A;  3BR6 A;  4W97 A;  4C3J J;  1K83 J;  1LE8 A;  1MNM C;  1NTC A;  2O7O A;  4JP0 A;  4Y52 J;  2VKE A;  4DYQ A;  2M34 A;  3HB9 A;  1OJL A;  1AKH B;  2HOS A;  4RDU A;  2LTP A;  4S0H B;  1JT0 A;  4D7N A;  4DYR A;  5IOY A;  4ABZ A;  4A3F J;  4IHX A;  2E2H J;  2HOA A;  4D5F A;  1VND A;  3G1M A;  5FJ8 J;  1BJZ A;  2EBI A;  1ORK A;  1ZR2 A;  3IH2 A;  2JN6 A;  1Z0X A;  4JYK A;  1BL0 A;  2FX0 A;  4C3H J;  4G12 A;  4A69 C;  4JX6 A;  3HDD A;  1S7E A;  4M3E A;  2M2E A;  3S2H J;  2DA7 A;  1IG7 A;  2LD5 A;  1ITY A;  2FJ1 A;  2M8G X;  1T56 A;  3ZQC A;  4M6V A;  4A3D J;  1ZKG A;  1RPW A;  3PM1 A;  3CDL A;  5IPA A;  2EQR A;  2NVQ J;  1PUF A;  2LR8 A;  5C4X J;  2HDD A;  2COB A;  2DA4 A;  5E3N A;  1U78 A;  3FK7 A;  1GT0 C;  5M3F J;  2P81 A;  1B8I B;  1APL C;  3D1N I;  2PMZ N;  2MSY A;  2E19 A;  2R5Z A;  1DU0 A;  2XPV A;  1JUP A;  2L0K A;  2Y31 A;  3GTP J;  2FD5 A;  1X2M A;  4A3J J;  4DZJ A;  3O8G A;  1B72 B;  2R5Y A;  2Y9Z A;  3TP3 A;  4J19 A;  3DEW A;  3C2B A;  3O8H A;  3Q3S A;  2L7F P;  1SFO J;  3LSR A;  2R0Q C;  2JWT A;  3OIO A;  3TP0 A;  5F1J A;  5M5W J;  2NS7 A;  2YU9 J;  2DMN A;  4M3G A;  3TED A;  1EF4 A;  5EEA A;  5GPC A;  2Y9Y A;  4IEJ A;  2YS9 A;  2DTZ A;  3GTO J;  1U9O A;  3RZD J;  4A3C J;  2EZL A;  2HXO A;  3BTI A;  1RR7 A;  3FK6 A;  4UUS B;  2NVT J;  3M4O J;  4XK4 A;  1OCT C;  1TWA J;  1ENH A;  2M9H A;  3RKQ A;  2JA5 J;  3HOV J;  5F04 A;  5EGO B;  3GTM J;  3QPS A;  4AYB N;  1O4X A;  3GTG J;  1ZR4 A;  5M3M J;  1Y1W J;  2OF7 A;  5E3M A;  1LE8 B;  1TWF J;  2DJN A;  1LFU P;  1ETK A;  3JRH A;  4RBO A;  4B4C A;  3GTQ J;  2EZH A;  2LKX A;  3ZOB A;  1W0T A;  2X48 A;  4XIC A;  4NDL A;  5JLX A;  4BXX J;  2B63 J;  3LSG A;  1MH3 A;  2JA8 J;  2HYJ A;  5GPA A;  1MSF C;  4XRS A;  3JRI A;  4A3B J;  2AHQ A;  2I10 A;  3VPR A;  4FE7 A;  3S15 J;  3S2D J;  2HXI A;  1RES A;  3OSG A;  2ID3 A;  5F0F A;  4M3D A;  1UMQ A;  2HQ5 A;  1POG A;  4XRM A;  2LP0 A;  2CJJ A;  1NK3 P;  4GFB A;  3A02 A;  3ZQH A;  4DYC A;  1FTZ A;  2CU7 A;  3OSF A;  3Q0V A;  2JA7 J;  2DA5 A;  1UHS A;  4MFE A;  3GTJ J;  1PUF B;  2EH3 A;  1T33 A;  1G2H A;  3LSP A;  1MBH A;  1A5J A;  5IP7 J;  4V2F A;  1WGX A;  3MKL A;  4MO7 A;  3LSJ A;  2YUS A;  1AU7 A;  2W48 A;  5HOD A;  2KDZ A;  2R5Z B;  3LOC A;  2N8G A;  3TW6 A;  4FCY A;  4QTR A;  3MN2 A;  1I3Q J;  2R5Y B;  3BG9 A;  1IGN A;  1JJ6 C;  5JLW A;  2XSD C;  4C3I J;  1JKP C;  2ELK A;  1BW6 A;  5F27 A;  1XS9 A;  5EDN A;  1Y1V J;  5J1U A;  1ETY A;  2DA2 A;  2L9R A;  4Y7N J;  3FIS A;  5F08 A;  1TC3 C;  2DA3 A;  3BTJ A;  3CMY A;  1OFC X;  3MVP A;  3HGY A;  1FJL A;  2JA6 J;  2DA1 A;  1ZTR A;  2LFB A;  2AO9 A;  1JT6 A;  4DW6 A;  2CUF A;  1WPK A;  5DTD A;  5EG0 B;  3S17 J;  1IJW C;  3BG5 A;  1JTX A;  4MFD A;  3SFI A;  1AHD P;  1HCR A;  3A01 A;  4JX5 A;  1JJ8 C;  3G1L A;  2IBD A;  3B6A A;  1JKR C;  1RET A;  4MLO A;  4IHV A;  1GVD A;  3DCF A;  1WH7 A;  5F0H A;  1FEX A;  3ZQL A;  1TWC J;  5IOZ A;  3A03 A;  4AUX A;  2CUE A;  2X6O A;  1IUF A;  3ZQG A;  1Q1V A;  2XGC A;  4EEF G;  3GTL J;  2K40 A;  1WH5 A;  2NS8 A;  1BA5 A;  1FIA A;  2XPU A;  3BTL A;  5EF6 A;  4XRS G;  1D5Y A;  1MSE C;  2GBY A;  1W0U A;  5DS9 A;  3TW7 A;  2JK3 A;  3WHB A;  4UUT A;  2XGD A;  4CYC A;  5J1Y A;  5IYD J;  1XG1 A;  2E1O A;  2R7Z J;  5FKM A;  2JJ7 A;  3ZQI A;  3PO3 J;  4AC0 A;  2R92 J;  2ZB9 A;  3JR9 A;  3H0G J;  1WI3 A;  1IV6 A;  3I4M J;  4A3M J;  2L7M P;  3E7L A;  2LY9 A;  1WCM J;  3NAR A;  3L1P A;  3BR3 A;  1FTT A;  3RZO J;  1OCP A;  1BW5 A;  1HDD C;  2GLO A;  3HOY J;  5K7Z A;  3G1O A;  3HOW J;  2O9L A;  1H89 C;  5C4J J;  4A3E J;  4D5C A;  2XB5 A;  2EZI A;  5J3L A;  2L7Z A;  5K7H A;  2LLK A;  3QPL A;  2O8K A;  2DMQ A;  5IP9 J;  1QPI A;  1GV2 A;  3BR0 A;  3JRD A;  5M5X J;  4X1E A;  3S1Q J;  3Q0W A;  1ETO A;  2VPR A;  1HDP A;  1TWH J;  2KT0 A;  3HOU J;  3BT9 A;  4A3L J;  3OOU A;  2ID6 A;  2ECB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...