4DZPA

Crystal structure of the terminase small subunit gp1 with r48a mutation of the bacterial virus sf6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
PSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFAWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Phage Sf6 Terminase Small Subunit Reveal a DNA-Spooling Device Facilitated by Structural Plasticity.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
molecule keywords Gene 1 protein
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4dzpA01
1Q1VA 2NVTJ 2CJJA 5JLXA 3G1OA 3CQZJ 1QPIA 2DA5A 2JWTA 4ABZA 3LSPA 1GDTA 2L7FP 3UKGA 2M0CA 2XB0X 2WAQN 3HOYJ 1JUMA 4C3IJ 2XPVA 5EF6A 3I4NJ 2Y30A 1JTXA 5M3MJ 5IP7J 2B63J 3S16J 2M2EA 1FJLA 1PUFA 5J3LA 1WGXA 2TRTA 1ETXA 4HNVA 3TW7A 2FD5A 4UUTA 5C44J 1ZR2A 1GV5A 2DMUA 1BL0A 1IUFA 5K7HA 2XRLA 1DU6A 1X2NA 5FJ8J 2LVSA 2XB5A 1D5YA 3S14J 2KT0A 1TWCJ 3DCFA 3O8HA 3JREA 3FK6A 2R5YB 1K83J 5J1UA 4A93J 3H3VK 5EGOB 2Y9YA 1SANA 1WPKA 3TP3A 4MFDA 1VNDA 4AYBN 1HOMA 1LFUP 4M3GA 4Y52J 3JRIA 2R5YA 4M3FA 3JRGA 3HKZN 2CQXA 5DS9A 1LFBA 1YRNA 3PO3J 3OOUA 3TEDA 3SFIA 4BBRJ 5K7ZA 2OF7A 2FQ4A 4D5CA 2DJNA 3GBGA 4AC0A 4D7NA 1VFCA 2DA4A 4QTRA 2HQ5A 3BG3A 2Y31A 5F27A 1APLC 1BW5A 5IYDJ 1H88C 2R5ZB 2NOGA 1ETVA 3LSJA 1U78A 2HI3A 9ANTA 2R92J 3FKIJ 3MVPA 3ZQHA 2JK3A 2GLOA 3K7AJ 5FKLA 5C3EJ 2EZLA 3QPSA 1E3OC 1IDZA 4DZPA 5EGOA 2Y9ZA 3JRHA 4C2MJ 1OCTC 4JYKA 5IOYA 1MSFC 1WH7A 5DTDA 2E19A 4DYCA 4UUSB 1ORKA 2JA5J 4QIWN 3BR5A 2VI6A 2HOAA 3RZDJ 3JRCA 1GT0C 2X48A 4GFBA 3G1MA 2K9QA 3JRDA 1FTZA 1X2MA 2R93J 4IHVA 2Y2ZA 2VPRA 2LTPA 2M34A 3H0GJ 1VI0A 2XGDA 4NDLA 3IV5A 1QVUA 3CCYA 3Q0WA 3L1PA 2KDZA 4Y7NJ 4L5EA 2E1OA 3HOZJ 1AHDP 5E3OA 3Q3SA 1RETA 4A3EJ 2IAIA 1TWFJ 3QPLA 3ZQIA 5IPAA 4A3FJ 4A3MJ 3HOVJ 5JLWA 4UUSA 1UMQA 2L0KA 1H8AC 1UHSA 2K40A 3MN2A 1ETWA 1BW6A 1LE8A 2PMZN 4C3JJ 5EEAA 3BR2A 1JJ6C 5EDNA 1IG7A 2WB1N 3S1MJ 4IHXA 5E3NA 2AO9A 4X1EA 5FKOA 5K7FA 4A3CJ 4I76A 5E3MA 1MBJA 3JRFA 2XSDC 5C4JJ 4BBSJ 1LE8B 2O7OA 2DA7A 2JA6J 2G0EA 3RKQA 3BT9A 2TCTA 3A01B 2LLKA 2LFBA 4IEJA 1VF9A 2XPUA 5IP9J 1IRZA 4EEFG 2L9RA 4JX4A 2HOSA 1MBGA 5IP6A 3GTJJ 2HXIA 3LNQA 4V2GA 5HODA 1JKQC 4A3IJ 1B8IA 1ZKGA 3CMYA 2DTZA 1ENHA 2VKVA 1MH4A 4W97A 4BKXA 4XRSG 3CDLA 3WHBA 1DU0A 3A01A 2P81A 3BQZA 4JX5A 1B8IB 4A3JJ 5EG0B 2JJ7A 3B6CA 3QQAA 3Q0VA 1JKRC 3ZOBA 5FKMA 3W6VA 2L7ZA 1NK2P 2HXOA 1ITYA 1TWGJ 1Z0XA 3HGYA 1ETQA 2ELKA 4A3DJ 2Y0SN 4A3GJ 5FKKA 2ME6A 4M6VA 2E2JJ 4BXXJ 1RR7A 1SFOJ 2YUSA 3GTQJ 3F0CA 3WHCA 3SDGA 2NVQJ 1B72A 2K9SA 3BR0A 4X6AJ 1GUUA 3GTMJ 1AU7A 3OSFA 1RPWA 4MIMA 4M3BA 1GVDA 1JTYA 1TWHJ 5M5XJ 2MG4A 2DA3A 4XRMA 1Y1WJ 1JJ8C 2JA7J 3BG9A 1JUPA 3M3YJ 1BJZA 3BR6A 3PO2J 1MBEA 3M4OJ 2X9DA 4DZJA 4G12A 1K61A 3S2HJ 3OSGA 1W0TA 1B72B 4IHYA 2XGEA 2QF7A 2DA1A 2IEKA 3D1NI 3HDDA 1WCMJ 5M5WJ 1GV2A 2O9LA 1H89C 5F0CA 3RQIA 1ETKA 3A03A 1HCRA 1FIPA 1HDPA 2CQQA 3IH2A 3BTIA 4JX6A 1ZGWA 2DMTA 5EG0A 4XIDA 2ECBA 2JN6A 2ME0A 1I50J 2CRGA 3BG5A 4LOCA 5F0HA 1ZK8A 4FE7A 3S1RJ 3S1NJ 2I10A 3NARA 2LK2A 2IBDA 5GPCA 2FJ1A 1IGNA 2LY9A 3VPRA 1WI3A 3JRAA 1OJLA 3Q0UA 3ZQFA 4AUXA 2WV1A 1MNMC 2EZHA 2W48A 2CU7A 4B1RA 1I6HJ 5IOZA 2DN0A 4RDUA 1F43A 1R9TJ 3BTLA 2NS8A 2DA2A 1ZR4A 3RZOJ 1W0UA 2NVXJ 3BTJA 1JUSA 1OCPA 1MH3A 5EZHA 2H8RA 2MGQA 2L7MP 1HLVA 2H1KA 2ID6A 4IHWA 2XPWA 3NAUA 3TW6A 2E2HJ 1G2HA 1CQTA 1JGGA 1Y1VJ 3S15J 5F1JA 2LR8A 1EF4A 1XG1A 2GM4A 4B4CA 3B6AA 4DW6A 3GTGJ 2N8GA 3HBLA 3GTOJ 3MKLA 2DMNA 1ZTRA 1U8BA 1ETOA 4A3KJ 4MLOA 1IDYA 2NVYJ 3OIOA 4DYQA 1JT0A 2E2IJ 1I3QJ 2HOTA 1FIAA 1MBKA 4J19A 4XRSA 3HB9A 2CUFA 1RKTA 1P7IA 2EBIA 3HOWJ 1RESA 1NTCA 2M8GX 2MSYA 3PM1A 2YS9A 3JR9A 3S2DJ 3ZQCA 1TC3C 2LP0A 1MBFA 2K9NA 2M9HA 5GP9A 4MO7A 2VKEA 4A3LJ 1S7EA 2MW8A 2HDDA 1XC5A 1AKHA 3BR3A 3BR1A 2DMPA 1POGA 1XS9A 3GTPJ 3FIWA 3IH4A 3GTKJ 5F08A 2LD5A 5M3FJ 5EZGA 2EH3A 4S0HB 1IJWC 2EZIA 2JMWA 4BY1J 4V2FA 2ZB9A 4W1UA 2LKXA 5EYRA 1OFCX 1AKHB 4FCYA 1ETYA 4FISA 2R0QC 2VUMJ 3ZQGA 1P7JA 2COBA 4CYCA 1UG2A 4JP0A 3S1QJ 1FTTA 5E3LA 3DEWA 3O8GA 4RBOA 3ZQLA 5M5YJ 1FEXA 1IV6A 2D5VA 1A5JA 3C2BA 2R7ZJ 2NS7A 1HDDC 3IH3A 5F04A 3HGGA 1U9OA 3K2AA 4M3DA 1MSEC 1ZQ3P 1PUFB 3HOXJ 4MFEA 3G1LA 3BQYA 3GTLJ 2DA6A 3LOCA 3E7LA 2X6OA 4CYCB 3TP0A 2EQRA 4D5FA 1T56A 5FKNA 2O8KA 5IYBJ 4C3HJ 1WH5A 3LSGA 1A6IA 2CUEA 3SJMA 3HEFA 2R5ZA 4B3AA 5BNGA 4I6ZA 1Z77A 2YU9J 2ID3A 3JRBA 4XICA 4D7MA 3FK7A 4XK4A 3S17J 2HYJA 5GPAA 5IYCJ 1T33A 4FTHA 1F36A 2JA8J 4M3EA 1JKPC 5FLVA 5C4XJ 2OPTA 1QVTA 2XGCA 2QCOA 5J1YA 1O4XA 4FE4A 5J1RA 3FISA 1YRNB 5F0FA 1NK3P 1MBHA 2FX0A 3HOUJ 3LSRA 2AHQA 4A69C 3I4MJ 4BY7J 1RKWA 2ECCA 1JT6A 5FLMJ 1HF0A 2GBYA 1X58A 4DYRA 3BTCA 1TWAJ 2EZKA 4QSHA 4A3BJ 1IC8A 2RAEA 3HM5A 2DMQA 1JKOC 3A02A 1U9NA 1QRYA 1BA5A
chains in the Genus database with same CATH superfamily
4CDGA 1Z9CA 5D5UB 2CJJA 5JLXA 3OYNA 2HDWA 3CQZJ 2KFDA 2DA5A 5F6FA 4DNCA 3NEUA 4ENKA 3WODF 3BCBA 2Z33A 3QYBA 3HOYJ 1JUMA 3D0SA 1IN5A 4C3IJ 4KICA 2Y30A 4MGRA 2VQGA 3OYHA 5IP7J 2UXXA 3G2BA 2B63J 2QGUA 4PJMA 2M2EA 1D0XA 1SFXA 1WGXA 2TRTA 3EUHA 2VB6A 1ETXA 1BI1A 3TW7A 5JR3A 1Y0NA 2FD5A 1MJBA 2H94A 2Z2SB 3TOAA 3ZCOA 4F52A 3MCZA 3CUQC 2Q8KA 2XRLA 3C2HA 4EGZA 3BJ6A 1DU6A 3O3KA 1ZGAA 3LA7A 3DXJF 1D5YA 3S14J 3CCSI 1MNDA 2CV2A 1UELB 4ESBA 3AL0C 1FOWA 2HOEA 2M8EA 4UV9A 4A93J 2UWMA 2J5OA 1QPMA 2JUGA 3TP3A 4HYEA 1BI3A 2Y48A 1IV8A 1OPCA 2FNAA 2YR2A 1LFUP 4JBAA 4M3GA 1GLNA 4Y52J 2HEOA 2QA4I 2R5YA 4GGGA 4M3FA 2AQFA 3HKZN 3ERED 2F5DA 2XSJC 4BBRJ 1I6XA 2IXSA 3GZ6A 3D5SC 1Q1HA 2IS4A 2F2EA 4NHJA 2BEOA 4P5OA 3U9GA 4QTRA 1OLTA 2LSOA 3IRRA 3DBRB 3SZPA 1ZAOA 3OYKA 3QYEA 3BDDA 5F27A 3I5UA 1A04A 2CUZA 3KP2A 3OL3A 3LSJA 1YTYA 4ZDOA 3ZGKA 4IRGA 3HPGA 3TGNA 3TO7A 3ZQHA 1VQKI 4L9JA 1QBJA 5HNFA 2QEXI 2Z1DA 4DZPA 3CJQB 1ULYA 2QBYB 4TV7A 5IOYA 1MSFC 5AONA 2V26A 2E19A 2JPBA 1WZ2A 1FSEA 3J81K 4Z6YA 3P9CA 4HV6A 4QIWN 5LEKA 1HW2A 4I02A 1J09A 2X1DA 2HOAA 2ZJQF 2VJ4A 2R7OA 4AM3A 4X0GA 1IW7F 3G3ZA 2V7FA 2VLAA 4MTDA 1ERDA 1SFEA 1X2MA 1YO5C 4IVNA 1UG0A 5HDKA 3T8RA 2VPRA 1ZG3A 2E71A 3OMYA 3M7GA 1BM9A 2OBPA 2HKXA 2K4JA 3H35A 1O7FA 4BQNA 1FT9A 3H0GJ 4MEXF 4WX9A 2XGDA 1FNNA 3E5UA 3DPTA 4G9YA 2RKHA 2QQBA 3S2WA 3L1PA 4L0YB 4Y7NJ 2H1LA 2O03A 4AYBA 4UVBA 3HOZJ 1L0OC 2X85A 2L9NA 2JRMA 3LWFA 1EKEA 1RETA 3LSMA 1R49A 4A3EJ 2DOFA 4UY8I 2MLKA 1H8AC 4B09A 3DKWA 2KMUA 4LLGF 3IAS2 1DGRM 5HLIA 5K5OA 2GQQA 2KJCA 4EM2A 3WU1B 3IWFA 1Z3YA 4RB2C 2WB1N 4M71A 4KNYA 1A31A 2AO9A 5FKOA 3CC2I 1ZRDA 4I76A 1X3WB 3JRFA 2XSDC 2KRFA 3HOSA 5L3DA 2JZYA 2O7OA 1UFMA 2OUMA 2DFFA 5HOOA 4U0WA 4HX7A 2Z3YA 3PL8A 4RM2A 3IHUA 2LOOA 4XOPA 1K4TA 4ZZLA 1YS7A 3J7AY 2GAUA 4EEFG 3OV8A 3WTSC 3J80Z 3AG4H 5L3CA 5CLSA 4PGGA 5L3FA 2KRCA 5HODA 2DBBA 1FP2A 1B8IA 1ZKGA 3I55I 3O6BB 2VKVA 3E3VA 1MH4A 2TDXA 3R0AA 2QSGX 2IGOA 3FMSA 3FM5A 3PFIA 2LY2A 2LF8A 5D5VB 4OOIA 4KFCA 2A5YB 1B8IB 2JJ7A 2X1CA 2WADA 3H3ZA 3W6VA 2CW0F 2WB1A 1ITYA 1KQ0A 2FUG2 4G6QA 2X6XA 1NH3A 4CZCA 3HGYA 3CCRI 2A69F 2L01A 1P4AA 3WTVC 4A3DJ 1TQIA 5FKKA 2BVMA 5E20A 1ZLJA 1HSTA 3WHCA 2F48A 2HQAA 4ESFA 1B72A 1GUUA 5K5QA 2ZXIA 3P9KA 1AU7A 3FMRA 3CCQI 1P9QC 4LB6B 3HYIA 1SFUA 3KX2A 1HXDA 1UZCA 4D9JA 5CYVA 2MC4A 5B1AH 1FBSA 4BACA 3C18A 5M5XJ 5GADJ 3QU6A 4XRMA 2P6TA 1FYMA 2XAFA 3REOA 3KEOA 1BBYA 1I1SA 1X1PA 1BJZA 3Q9SA 3SZGA 3EUAA 1HKTA 1ZYRF 4QPOA 3F3XA 4IPAA 2A6HF 1B72B 4IHYA 2XGEA 3GWZA 4ZYAA 2JTVA 2E60A 3R4KA 3R61A 4LK1F 4P9FA 1J2XA 1HBXG 2GA1A 4RB0A 2CW7A 1GV2A 2O9LA 4EGYA 1H89C 2IVMA 2HU9A 3PFYA 4KN7X 3I64A 4ETSA 2NAZA 1BC8C 3SEZA 5IT9K 2XVCA 2IGMA 1HCRA 2IGNA 3ZR8X 2QYOA 4LG0A 4XIDA 2ECBA 5FRNA 1R36A 2WTEA 2DI3A 1TNTA 2CRGA 4HSRA 4XONA 2JVGA 4LLNA 2DTRA 4FE7A 2L7KA 5B3SH 2FSWA 4ENNA 1HW1A 1LQ1A 1K6OA 4OAYA 5GPCA 2FJ1A 3CO7C 1R23A 1I27A 2LY9A 3K69A 1WI3A 3QOEA 4BQQA 5K5RA 3ZQFA 1LDDA 1V54H 3CDIA 4PJLA 4A6EA 4D0PA 3S3NA 2W48A 2CU7A 1VQ5I 1QU3A 5FLXZ 5IOZA 4RDUA 1BJAA 5D5WB 1R9TJ 2DA2A 1ZR4A 1WQ2A 4II3A 3BTJA 3LFKA 2NVXJ 4PJJA 3FXJA 1AA7A 2RDPA 3LFUA 3MEXA 2R7XA 5EZHA 4E6KG 4KA4A 3C3WA 4RAYA 4ZTJA 1YFHA 4MQ9F 2FMLA 2L7MP 2H1KA 2XPWA 2YX4A 1YW7A 1S5LC 3TW6A 2FE3A 3S15J 4BGDA 1EF4A 2LR8A 3FXOA 2V9KA 2K3PA 1QHHD 3J7YJ 3E6DA 1XB4A 1YG2A 2D45A 4YELA 3MKLA 1U8BA 2RVCA 2F5EA 5J4VA 4IX7A 1JT0A 2EK5A 3N97A 5BOXA 1IN7A 2IGKA 1OR7A 2HOTA 1MBKA 2XF6A 1G3YA 3CCJI 3CCMI 2CUFA 4WF2A 1SD7A 1XMAA 1RKTA 2OQRA 1XN7A 2V1DA 1RESA 2M8GX 5FB2A 2FF4A 4MEYF 3SYTA 3S2DJ 2EB7A 3R6SA 2VJIA 4E7ZA 1K6YA 5GP9A 3HSRA 2CGPA 2HVSA 3KCCA 1S7EA 2QSHX 1PDNC 3RYPA 2STTA 5DYMA 1XS9A 2RNGA 3IH4A 4E7IA 2CV1A 4XLHA 5F08A 4KIGA 4WXCA 1W4MA 3V7CA 2BZTA 3BOQA 5EZGA 1T0FC 2EV0A 1IUYA 2VT3A 3DPLC 1Y56A 3FXLA 4XKVA 1MDMB 1FMWA 1NG7A 2B9SA 4N0BA 3EETA 5EYRA 2FNPA 2MD0A 2E1CA 2COBA 1XGOA 2B7EA 3SHFA 3MAJA 1UG2A 3CZ6A 3JW4A 5DCMB 3DEWA 3L9FA 2Z9OA 1X1AA 3ZQLA 5M5YJ 4LJZF 1IV6A 1FEXA 3TO6A 1A5JA 2PJRA 3V42A 2R7ZJ 4XBFA 5HLHA 2BHYA 3RPQA 2NS7A 1U2WA 4AIDA 4CCKA 4JOMA 3HGGA 1EJ9A 1U9OA 3BG6A 3RSNA 1FOXA 4M9XA 3KLNA 1ZQ3P 2ZSIB 2R7RA 3K9TA 4ASNA 3HOXJ 2HWVA 1SVOA 2QZ8A 1RIOH 3GTLJ 4PSWA 5FLXK 3A4CA 3LOCA 1Z05A 3E7LA 1D0ZA 5FD6A 3KE2A 4MNUA 3TP0A 2EQRA 4Y33A 4ZDLA 4XLCA 1K78B 2P5VA 1BI2A 1WH5A 2ZXHA 4HG2A 4DJAA 2DPUA 1DUXC 1Z67A 4G6DA 2XAJA 4RGXA 2R5ZA 4B3AA 1YS6A 4XR6A 4BXFA 2YU9J 2ID3A 3JRBA 4XICA 3S17J 4HV5A 4PJ0C 3QPTA 3AFHA 3RPUA 2MFZA 1ZREA 3MZHA 2HKOA 3F8CA 4BUPA 3ML6A 2W4SA 1QVTA 3W2AA 5J4YA 2XGCA 2QCOA 1B4AA 2X51A 5LD2C 3QODA 3L2VA 1O4XA 2LF7A 2F4IA 5BPDA 1SVMA 3F23A 1K79A 2FX0A 1WKMA 3HOUJ 3QOPA 3DFGA 3LSRA 3PNVA 4U7DA 4NQWB 4YRVA 4UUVA 5EEGA 2BY3A 3BPXA 3MFKA 1OKRA 1S8NA 4QSHA 4A3BJ 5J40A 5K1YA 4HQEA 2P4WA 3GW2A 1XD7A 1W7PD 1G3TA 4Y4RA 4IQJA 2VL8A 1LUJB 1BA5A 4RAGA 2ZJRF 1P4XA 2AXLA 5D8KB 3H5RA 3W6JB 3FHZA 2M7BA 3MWMA 2IA0A 3LSPA 2XIGA 1T0FA 2ZJPF 2MH9A 3UKGA 2EA2A 2M0CA 1GDTA 2HFHA 4IHTA 3ZMZA 3ZMSA 4NC8A 5A2QK 2G9WA 3M1CA 3I4NJ 2NNYA 4UXNA 5FD5A 4HZFA 3GCMA 3COAC 4ON0A 3S16J 4IHSA 3GXOA 3OYIA 1DPUA 1JXSA 2L2OA 4HF0A 2A61A 1FWZA 3V7SA 4HNVA 3ZMVA 4P55A 3VYTB 3HJEA 3H1CA 3TMOA 3I4PA 1XMXA 1MMAA 1N77A 3KP5A 1I39A 1HSJA 2KT0A 5L3GA 2L02A 1TWCJ 3O8HA 1XSDA 4G6TB 1IRFA 1VQNI 1K83J 3K4BA 5J1UA 3WTXC 4EVIA 2F5VA 5EGOB 1YQAA 1SANA 3FBNB 5JVGF 2PLYA 3OS0A 1WPKA 2L4MA 5LGUA 5CVVA 4GCVA 4AYBN 1VNDA 3E1SA 2DO7A 2K02A 1TP4A 2P0WA 3K4MA 3ZXSA 3ELKA 4XNFA 1LFBA 5DS9A 4PCQA 3PO3J 4E7SA 2K7LA 3OOUA 2WAQA 3GX4X 1N78A 3WGGA 3DTIA 2XROA 3EYYA 3TEDA 2OF7A 2FQ4A 2I5UA 5EJCA 3BLYA 5KAIC 3HTSB 3DU6A 2KQRA 3LMMA 1A36A 5LLQA 2Y31A 2AQEA 2JPCA 3F8FA 4AU7A 5J8FA 2JT1A 3ZQQA 1Y39A 1APLC 5IYDJ 5E1XA 2EIKH 2E5NA 1X3ZB 1JHFA 3KP6A 1YX3A 4IF4A 4EJOA 2HI3A 1IXSB 9ANTA 1KONA 1D8KA 3ZMDA 4H0EA 2R92J 1YW9A 3MVPA 2JK3A 2RN7A 5C3EJ 3G6EI 3VOEA 2EA4A 4IRIA 4C2MJ 2KIQA 2CS3A 5DTDA 2NRAC 2BBYA 4DYCA 4IRHA 3WTZA 5DM6F 4UUSB 2DFEA 4R79A 2BY1A 2ZJ2A 1V3FA 2VI6A 3RZDJ 1HW5A 3DLLF 4Y3OA 3BPVA 2VKDA 1PJRA 4GFBA 4BE0A 1PP7U 1D1CA 1E2XA 3BG7A 2QENA 4J01A 2XRNA 4P96A 2LTPA 4DOZA 1D8JA 3MZYA 4BXUA 1VI0A 1MMSA 3HTUA 1JHHA 2IW5A 4YG2F 3CCYA 3FDYA 4B43A 4RGUA 2FEZA 2EV6A 2F4MB 4L5EA 3IRQA 2P6SA 2WAEA 2E1OA 3Q5FA 1AHDP 3E5XA 3DKXA 1YLFA 2QWWA 4XORA 2OV7A 1FX7A 1WSUA 3JAMZ 4DBQA 1UMQA 5LEJA 1ZN2A 2L0KA 1T2KA 2L5QA 4B47A 5HS8A 2QVOA 1BW6A 2VBXA 3HIFA 4LFUA 3HKZA 5LGNA 3KZYA 1LE8A 4G94A 4HRIA 4C3JJ 5EEAA 2DYRH 3BR2A 5D4SA 1T38A 2KIUA 3S1MJ 3OS2A 4IHXA 2RC4A 3H9QA 5E3NA 3SDBA 4X1EA 4N4NB 4XKWA 2G7UA 3OL4A 5C4JJ 2ISYA 3WG9A 4HDUA 3ROUA 4BHBA 2E1MB 2JA6J 2G0EA 4OIPF 1QQIA 1T08B 2CO5A 2TCTA 4OIRF 2LLKA 3SEQA 2LFBA 1ZHFA 1RUNA 2XPUA 5IP9J 5LBQA 1VQPI 2FU4A 3P5JA 4PUSA 4XQFA 5IT9Z 2L9RA 5GTHC 4BJTA 2H8WA 3GTJJ 3OYBA 2HXIA 4F93B 1JKQC 3K0LA 4CCLA 4A3IJ 1RI7A 3ZPLA 2OJED 3CMYA 2DTZA 1ENHA 1SD4A 2VIXA 3I3LA 4XMYA 2HR3A 4XRSG 3CDLA 4ZC3A 2OC6A 2ZMEB 3UNGC 3W6KB 1LVKA 2P81A 3BQZA 2JRTA 3FWEA 1CF7A 3EUKL 4KYWA 4A3JJ 4L9NA 2R7SA 2VJ5A 4YIFA 3BY6A 3G71I 1UCRA 3GFIA 5DCFA 1KU7A 2STWA 1FC3A 5DDGA 5AIPA 2GZWA 2ELKA 1IRGA 2EILH 2Y75A 2Y0SN 4A3GJ 4M6VA 2E2JJ 2BXYA 2BYVE 2MC3A 3RCOA 2GXAA 4XLEA 2F6CA 3GTQJ 3F0CA 3FX3A 1RZ4A 3IP4B 3BR0A 3AAFA 3I53A 4X6AJ 2R7TA 1PUEE 1X1BA 3CCUI 3WTUC 4MIMA 2CQKA 1JTYA 2M4KA 2ZO4A 2MG4A 2DA3A 1SD5A 2PBIA 2DT5A 1GHCA 3FZVA 3BZ6A 1S9HA 1LDJA 3C1DA 4G12A 1B59A 5B5EC 1K61A 3S2HJ 4FX0A 2XHKA 2LC2A 3CUOA 4ZYGA 2LBFB 4HQMA 4D1QA 2ZXWH 3S93A 2QF7A 2DA1A 1P92A 4KISA 3D1NI 3ERMA 3SFZA 2BHZA 2NOJB 3BWGA 2Z5UA 5M5WJ 4LLLA 3K4NA 4M6XA 2WV0A 2GIZA 1FIPA 1HDPA 3WE3A 1S7OA 1I5ZA 4AIKA 2HNHA 4JX6A 5HLGA 5EG0A 5JHUA 3OYMA 3AL0B 2NS0A 3PUFA 2BOLA 3OYFA 4HEA2 2QQ9A 3V4GA 3S1RJ 2DXIA 1Z91A 2LK2A 5DD8A 5CQGA 1IO2A 4LITA 1J5YA 3VPRA 5LHGA 3JRAA 1OJLA 3Q0UA 3TL4X 4LG0B 4B1RA 1W36D 5KK1A 3VSLA 1RNLA 2DN0A 3JSPA 2CV0A 2ESNA 3HL2A 4YFXF 1VQ6I 2M1BA 3ZMTA 5TGTA 1W0UA 4B44A 2X6WA 2ZFUA 3LSIA 4I0BA 5EEHA 2H8RA 2CFOA 4HX4A 2JSPA 2IA2A 2ID6A 2K5CA 3NAUA 4XLNF 4J00A 1G2HA 3H36A 4RGRA 2Z99A 1XG1A 2MD5A 3RYRA 4B4CA 1HC8A 3A0BC 3PSIA 3DV8A 3TDUC 1SAXA 3PQJA 3IL2A 3CUQB 3I59A 1K7AA 2ZSHB 2GWRA 2VQCA 3H3UA 3KEQA 1VTNC 2L4AA 4A0ZA 4A3KJ 4XSZF 4I2OA 1ODDA 4DYQA 3OIOA 4KIFA 3CP2A 1OCZH 3W3CA 3TOBA 4S04A 3I9V2 1FIAA 1YYVA 4U7BA 4XRSA 3KZZA 4IQ4A 1K78A 3F8MA 3JTHA 2FOKA 3RKXA 1JGSA 4DBRA 1RRJA 3HG9A 4KITB 1TL8A 2LG4A 1YX5A 2CQNA 4IJAA 4MO7A 3IUOA 2H6BA 1WJ5A 3IC7A 2HDDA 3F6VA 3FIWA 3DBHB 1TT5B 4HPQA 2HS5A 2M87A 4M73A 5DCMA 3SXYA 4AD9A 2JVHA 3OR2C 2LD5A 4CHUA 3FHNA 4S0HB 4W1UA 1OCOH 2R0QC 1P7JA 3EQLF 4C30A 1XPXA 3V7RA 2OA4A 5HNHA 1REPC 4KT5C 2LBFA 2JQ7A 1XGMA 2BV6A 4E7LA 4OU0A 5H20A 3N4MA 3VDXA 5LHIA 4UB6C 1QHGA 5LRSA 1YHQI 4YFNF 4Y17A 1OISA 2FQ3A 2RQPA 3ABUA 1HDDC 3IH3A 2M30A 1G3SA 5F04A 1R6RA 3NQOA 4M3DA 1R7JA 4BHCA 3NWSA 1MSEC 1PUFB 2CWEA 2YX7A 3WG7H 4PK4A 1LDKB 2DCEA 3BQYA 2ZNZA 2DA6A 1T39A 2X6OA 4KJZA 2BY2A 3AG2H 3F8NA 4RMNA 3KFWX 4CYCB 1K4SA 1VQ7I 3FMQA 1D3YA 1LJ9A 1TZLA 4HAMA 1YE9A 4C3HJ 3LSGA 3K1NA 2Q0OA 3HC7A 5KVRA 4MTEA 4UB8C 1USTA 4I6ZA 2F5FA 3KPHA 3AKZA 3F6OA 3OYCA 2FMYA 4D7MA 4XK4A 4RLFA 1FZPB 2GOXB 2RNJA 4M72A 4XKCA 5CVRA 4PZJA 4BJ6C 3CCVI 1NHAA 4EQQA 2Y0MA 1F36A 1S6LA 2VT2A 5FLVA 5C4XJ 2A5WA 2KIFA 2EFOA 3BCAA 3CMAI 1U6GA 1XSXA 2LY1A 3A0HC 4FE4A 5J1RA 1YRNB 3ONQA 1V5GA 3K6GA 4RAZA 1T98A 4BHPA 1ZG5A 3PUBA 1BR4A 1MNEA 2PMZA 3CLQA 4KN4X 3RQ4A 6PAXA 3GLXA 1N25A 5CPRB 3QAHA 1Z1DA 3ABTA 2YSRA 3I4MJ 3WTTC 3IWZA 1J9IA 1RKWA 1OCRH 5FLMJ 2GBYA 1X58A 2DU9A 2A6TA 3BTCA 4RB1A 1WVRA 1LNWA 4Q47A 2KL4A 1YITI 2ZCWA 3OYAA 2DPDA 3R60A 3L2WA 2VOPA 4NC7A 5BS6A 3C2GA 4RS8A 5ICGA 1VQLI 1X4PA 1IZ1A 1QRYA 4LIVA 2ETHA 4PFOA 2IT0A 4I01A 2IS6A 3KIOA 4FHTA 2JWTA 2X6YA 4ABZA 4QLCU 2P8TA 3H9JA 3DWLE 4WXDA 2E5ZA 1O3RA 4N9IA 4BYYA 1HKQA 3WE2A 2DK5A 4PDKA 5M3MJ 2R7DA 1OYWA 2XAGA 2UV1A 1XGNA 1O57A 5J3LA 1PUFA 5L3EA 3EPZA 2HTJA 1H0MA 3PQKA 2DQLA 2P5LC 3CD6I 1GV5A 4E4HA 5FRMA 2D1VA 2W25A 2L9VA 2XB5A 1D5VA 4EV0A 2VN2A 3OYDA 3VEPA 3DCFA 2H6CA 4A2UA 1B9MA 3JREA 3FK6A 5D6EA 2R5YB 5BQTA 1W7PA 2GOMA 3RKWA 1M1EB 2XUBA 1W5SA 1R5HA 4CGZA 3TBIA 1X4OA 3GUDA 5F64A 3EYIA 4MFDA 1HOMA 2V9PA 2CG4A 1UAAA 3JRGA 1D1AA 4NBQA 1YRNA 2W7NA 3RTRA 3E0JB 5J47A 1ZRFA 1U3EM 3TO9A 3HHHA 4K2EA 2XAQA 3PNYA 1MJAA 5CKTA 2M5WA 4BEHB 3S3MA 3ZMUA 1B1BA 4PFPA 3JTGA 4N4OB 1VFCA 2K4BA 2DA4A 3VYSB 2HQ5A 4HBLA 4EJVA 2W1OA 2VQLA 1H88C 3KP4A 1X1DA 1U78A 2HQRA 3FBIB 1YIOA 4NUBA 2R4GA 5J8CA 4Q4ZF 3K70C 3K7AJ 5FKLA 3HRMA 2EZLA 3QPSA 4F55A 3CLOA 3JRHA 3F72A 2E1NA 3FXRA 4JYKA 1DP7P 2EFQA 1WH7A 2MH2A 4ITVA 5KHDA 2M45A 4CO8A 1IN4A 2HYGD 1KU2A 1ORKA 4A0XA 2JA5J 2F4OB 3GZ5A 3BR5A 3PIPF 3PJRA 4CCNA 3WGIA 1V55H 1GT0C 1J75A 4II2A 4U0VA 1AWCA 2K9QA 4RLQA 1SC7A 2FBKA 1BOBA 1FTZA 3F9KA 1IXRC 2DYSH 3T0YA 4IHVA 2Y2ZA 4DIQA 4MQVA 2XKOA 2DDAA 4WWCA 3CTAA 2RQQA 1I1GA 4F91B 4WK8F 3N05A 2M7AA 4OIQF 3LQQA 2VPLA 4CYDA 1E0EA 1FOKA 3IV5A 1CF7B 1QVUA 1MGTA 5HDNA 3Q0WA 2KDZA 2OCCH 2PMHA 3F22A 3OYGA 2CYYA 2YPRA 4XL9A 3Q3SA 4CCJA 2IAIA 1TWFJ 4OMZA 3ZQIA 5IPAA 3HOVJ 1Z6TA 3L00A 4UUSA 3ASNH 4R8HA 1UHSA 2K40A 2HVRA 1ETWA 3BZKA 2PMZN 3CESA 5LFAA 4HX8A 2LNBA 4NC6A 1IG7A 2HGCA 1QNTA 3TKYA 5CVUA 2W00A 2UZKA 1LEBA 3DTKA 4M9SA 4NNJA 1R00A 4A3CJ 2MYSA 2ZFWA 2O6GE 5CVIA 3Q9VA 2CMPA 3WTWC 2DA7A 3RKQA 3BT9A 3S3OA 3A01B 5ILSA 1R58A 2JSCA 2E7WA 2ICWG 4IEJA 1VF9A 4I09A 2R3SA 5DEQA 4JX4A 5FO5A 4EATA 5LHHA 1SMYF 3W2WA 1MBGA 4IL6C 3LNQA 2IRFG 3RDIA 1BOAA 2VXDA 5FFZA 1IXCA 3ASOH 1TT0A 5BMZA 2Y0SA 3HUGA 4W97A 4BKXA 1FY7A 1VQ9I 1D0YA 4BU2A 2CFXA 3U1DA 3VYRB 4JX5A 2ESHA 3MKZA 2DOEA 3B6CA 1E3PA 1KU3A 1V4RA 2JUCA 2Z16A 3Q0VA 1JKRC 1GXQA 1AOYA 5FKMA 4F3QA 2KIMA 2PJRB 1EH7A 1ON2A 3LSTA 2Q1ZB 3ZN0A 4Y13A 3L2UA 5KAFC 3DPUA 3HUGB 2ME6A 1WWXA 4DQ2A 4BXXJ 2E7XA 2Y69H 1RR7A 2YUSA 5DUKA 5A2QZ 3BJOA 4LIUA 2VJJA 1Z21A 1OYYA 4HDVA 4YIRX 3K4JA 2XASA 3P9IA 4KT6A 3OSFA 3ZRGA 3V8LA 1ON1A 2DJIA 4BH9A 2CW8A 2V1XA 1TWHJ 1Y0UA 4P9UA 4CH7A 3B73A 3OYLA 1JJ8C 3BG9A 1JUPA 1O3TA 3M3YJ 3I0TA 2HQNA 3BR6A 3PO2J 1MBEA 4RA2A 3M1EA 2WAFA 2X9DA 3LAPA 2PI0A 3M9AA 3OSGA 4OINF 1W0TA 1A35A 2A05A 3ECHA 4RGSA 2W84A 2IEKA 1RUOA 1R71A 3HDDA 1WCMJ 2IA1A 1KYWA 4L9TA 1R1UA 3DBLB 1MMDA 1ETKA 1MMNA 4NQWA 2K85A 3TDZC 3IH2A 3BTIA 3FF5A 2PFBA 1WJCA 3E5QA 2JN6A 2ME0A 1I50J 2QM3A 3BG5A 3DKYA 4LOCA 1ZK8A 4A0YA 3S1NJ 4IXAA 3HPHA 3QYFA 2I10A 5D8LB 3NARA 2IBDA 3I71A 2QUFA 2M0MA 1TQMA 1IAWA 4FT8A 4AUXA 2VXZA 3RPUD 2LDUA 1I3AA 1MNMC 1R22A 1XTAA 2VKHA 4EJWA 4F7ZA 4AVZA 3KETA 5HS9A 4OWRB 1N75A 4RM3A 2RREA 2R7UA 3BTLA 2NS8A 1E3HA 2XDVA 1XDSA 4ANJA 3RZOJ 5E79C 2QSFX 1FYKA 1HQCA 1G59A 4XN0A 1OCPA 1MH3A 3GZNB 2MGQA 3HSFA 3K4KA 3VFZA 2A07F 1W5CC 2OZUA 3HRSA 4IHWA 1TBXA 1CQTA 2ADUA 3ZP5A 1Y1VJ 1JGGA 5F1JA 4Y15A 4L5IA 2HPMA 2GM4A 4IZZA 3B6AA 4DW6A 3GTGJ 2N8GA 1B6AA 2K86A 3GTOJ 3M8EA 5IY5H 1ZTRA 1VZ0A 4A12A 2R7FA 5HVQC 1ETOA 1F9NA 2RV8A 4L0ZB 2V6CA 4MLOA 5TRDA 1SEUA 2NNNA 4HLYA 2E2IJ 1I3QJ 1X19A 3DLAA 4XKBA 4O3MA 1YJ9I 4FASD 4GXOA 3JSOA 1EH8A 3HB9A 2CQ7A 1Y8RB 3K4LA 1KYZA 2H09A 1MJ9A 2EWNA 1P7IA 1VQOI 1MDMA 2OTLI 2EBIA 1IN6A 1UHWA 1NTCA 3AG3H 3PM1A 3I59B 3JR9A 3DP7A 5CJ9A 3ZQCA 2LP0A 1MBFA 2K9NA 2M9HA 3FXKA 2VKEA 5E1ZB 2DLLA 4IKFA 1BR1A 3CF2A 2MW8A 4BEHA 1Y8QB 3KYLA 4CCOA 3E6CC 3GTPJ 4B3XA 5ERIA 5D6FA 1IN8A 5M3FJ 1J59A 2EH3A 3CC7I 3K70D 1IJWC 2EZIA 4BY1J 4V2FA 5DUIA 2ZB9A 3HHGA 2K27A 2G7HA 4FCYA 1AKHB 5DM7F 1V5EA 2CUJA 3GF2A 3ZQGA 5E8IA 4CYCA 2LRDA 2OZ6A 3IAM2 2UUZA 4YIIA 4JP0A 4P1WA 1H9TA 3O8GA 4RBOA 3T8TA 4AIJA 1F4KA 2E34A 2OU2A 4HA8A 3CUQA 4ENJA 1BR2A 1GVJA 1YI2I 3TQNA 4XLFA 2WA0A 3G1LA 2DT6A 3GFJA 4F92B 2E1MC 4PSXA 2ZXJA 1WJBA 4IOCF 1V5FA 5H6QA 1KZHA 1T56A 5FKNA 4QPQA 5ICFA 2WY8Q 2ISZA 3LAJA 1BN5A 3VYUB 1A6IA 3SJMA 3WGHA 4BNCA 1R5ID 5BNGA 1WFXA 4KUMA 3FK7A 3G73A 1FMVA 1TLHB 2P7VB 3OS1A 1YIJI 1FOYA 2HYJA 5GPAA 5IYCJ 1T33A 4FTHA 2QBYA 2C6YA 2BY0A 2X1EA 1Z6RA 2DFIA 3GO5A 4M3EA 4AWXB 1JKPC 2OPTA 3RJPA 3CF5F 2X4HA 1WJAA 5J1YA 2VODA 3UR3C 3FISA 2AXTC 1XSVA 3B02A 2OTJI 2I8DA 3ISPA 3MQ0A 1A6QA 5IT3A 4E7KA 2ECCA 1JT6A 1WJDA 4M74A 2IPQX 4O5VA 4HSTA 1YJWI 1TWAJ 3ZN1A 4HNUA 2ZBKA 2RAEA 1IC8A 3OWTA 1JKOC 3A02A 2W24A 1BI0A 1O3QA 1LPQA 1Q1VA 2NVTJ 3G1OA 1S29A 2GA2A 3D5LA 4E7JA 1QPIA 4LK0F 5ICCA 4YFKF 3RIRA 2L7FP 2PMUA 2XB0X 3FXMA 2WAQN 3JAMK 3OIPA 2WC2A 5D5XB 5D4RA 4N9HA 2XPVA 5EF6A 3KP3A 1JTXA 2XF5A 3HRUA 2KHMA 4LD5A 4M6YA 1ZH5A 4KDPA 2EPFA 3T5XA 2HTSA 1FJLA 2EFNA 1CGPA 3KZIC 2ZMEC 4GRIA 3WTYC 2HVQA 5FROA 3HOTA 2P5KA 1QA6A 1WHUA 3CJTB 1EH6A 3GFMA 4U87A 4UUTA 5C44J 1ZR2A 4G7HF 4KMFA 2DMUA 1RC9A 3BJAA 4BL0B 1O3SA 1BL0A 2XV4S 3J80K 3HSEA 3QPHA 1IUFA 2A3SA 5K7HA 1D1BA 4UV8A 2Q2EB 1X2NA 2K9LA 5FJ8J 2LVSA 2KLOA 4HF1A 1TW2A 2M3AA 2ELJA 2DDBA 5HLTA 2DT7B 1KQ8A 2R7WA 1LKXA 3S32A 2FBIA 5J6XA 1SFKA 2VC1A 3H3VK 2Y9YA 2O3FA 3U2RA 2FOWA 4A5MA 2NYXA 4HNTA 1ACIA 4CA0A 5H6RA 5CQEA 5B66C 3JRIA 4GDFA 4R1HA 2CQXA 1LB2A 1LEAA 4C9YA 2VBWA 1Z7UA 4CSWA 1VQMI 3FXUA 4CCMA 3SFIA 1XDUA 5K7ZA 2J5PA 2BE5F 4D5CA 2DJNA 3GBGA 1OQYA 1R4MB 2XF7A 4AC0A 4D7NA 2HPIA 5AIQA 4IOAF 2BXZA 5ED4A 1JI8A 3FKJA 4LMYA 3BG3A 1DDNA 3KYDB 1BW5A 2IP2A 2W85A 1ONVA 5JFRA 1Z7LA 1EV7A 1MIJA 2MLGA 2NOGA 1ETVA 2R5ZB 1HA8A 4DGWB 2PN6A 2LREA 1OR7C 4XLAA 3FKIJ 2D2WA 1O7LA 1TNSA 2GLOA 1IDZA 2HZTA 1E3OC 5L3BA 4ZYHA 5EGOA 3BZCA 2Y9ZA 3IKVA 4EJUA 4LGWA 3S8PA 3SQNA 4A6DA 3K1PA 1OCTC 2KZVA 2QQ8A 4OIOF 4RB3C 1STZA 2FXAA 5GAEJ 3I56I 4UVCA 3NWTA 5E8GA 2XC7A 1GXPA 4I7HA 3JCUC 1YOVB 2ELHA 4CICA 1WJEA 4L5JA 1QZZA 4HF2A 3JRCA 2OAZA 1VQ4I 4BAYA 2X48A 3ECOA 1E17A 2LYCA 3G1MA 3A1YA 3U1KA 3JRDA 1S3JA 5ILVA 2R93J 1OCCH 4B8XA 1PYVA 4B48A 2M34A 1UB9A 3LSHA 2NVUB 1FBUA 2WY7Q 3NRVA 3LA2A 5KCMA 3PIOF 1NG6A 4ZZDA 3DEUA 3RI4A 2NXNB 4NDLA 5JI6A 2KZGA 2H27A 4UVAA 1BIBA 2EV5A 2V1NA 2V79A 3J81Z 1YW8A 3OYJA 1X1CA 2DW4A 3KYCB 3OY9A 1PVEA 1VQ8I 2CH0A 2IS1A 4KIBA 4I98B 4FQGA 2CSOA 5E3OA 2KRHA 2KDOA 2ZC2A 3CMEI 2MBFA 3QPLA 2E35A 4A3FJ 4A3MJ 4H4KC 4UNOA 5JLWA 1SMTA 4FETA 3DTEA 3MN2A 2DFHA 2EINH 2JA2A 2LKSA 5TJJA 1SVLA 2F5CA 2PG4A 3LQRA 1C0WA 1LVAA 1JJ6C 5EDNA 2XAHA 2OCEA 4HW0A 2V1UA 4LG3A 5K7FA 4XRFA 1TTYA 5E3MA 1MBJA 5GAGJ 1UHMA 2L54A 1R1VA 1T95A 2RGVA 4BBSJ 1LE8B 1MMGA 2EIJH 3QP5A 4AVPA 2ZMEA 3EUHC 3L2RA 4Z2YA 1IRZA 4ENMA 2HOSA 3H92A 4L18B 2VE9A 5IP6A 1WJFA 2EFPA 1IF1A 2WWYA 4GO1A 1T6SA 4V2GA 3OYEA 4E70A 3KP7A 1FBQA 2V4JC 4BE2A 3VB2A 3CDHA 1J7KA 1MD0A 3QP6A 5DD4A 2DQRA 3L09A 3L2QA 4NB5A 1S72I 3WHBA 1DU0A 1W1WE 3CCLI 3A01A 3I58A 4L9VA 3O2PE 3OOPA 1P2FA 5EG0B 4KMUX 4OAZA 3QQAA 2W57A 4E7HA 4O6JA 5DV5A 2KP6A 2GIVA 2HYFA 4U88A 3ZOBA 2HDCA 1ZGJA 2L7ZA 4PJNA 4EMSA 1NK2P 2HXOA 1QZYA 1TWGJ 1Z0XA 4XSXF 1ETQA 3BP8A 4C2TA 4G7OF 2V9VA 4M9ZA 2VE8A 2LKPA 3M07A 5ILUA 3F8BA 1BC7C 1ZLKA 3M8JA 1SFOJ 2O8XA 3KEYA 3SDGA 2NVQJ 2K9SA 1J0RA 4GYIA 2PEXA 3OIQA 1ZARA 1U5TC 3GTMJ 2BW3A 3X2QH 1RPWA 4M3BA 5FFXA 1GVDA 4GYGA 5E17F 1Y1WJ 4BDZA 3GFLA 2JA7J 2A68F 1F5TA 1OMIA 3ESWB 2X0LA 3M4OJ 2YU3A 4DZJA 5JHFA 1ZRCA 3PNTA 4V19K 3C7JA 3CMMA 3L7WA 4FX4A 1XX5A 3DU5A 3GVAA 4BS9A 3MD2A 3WU2C 2XAUA 4CUGA 3LA3A 1FPQA 3F21A 2XGXA 2KISA 4EM1A 5F0CA 2R7VA 3RQIA 3A03A 2VASA 3MMYB 3H0DA 2AS5F 2CQQA 2KPMA 3CP8A 3M8FA 2COMA 3OR1C 4ESJA 4I99C 1ZGWA 1QO0D 2DMTA 2VBYA 1UJ8A 2A6EF 3PSFA 3V8JA 2PQ8A 1EA3A 2ACJA 2QLZA 5CVJA 1MKMA 5F0HA 2FA5A 5H2FC 2L3DA 1X3UA 2D1HA 1IGNA 3IKTA 3ABKH 2ZKZA 3LSKA 2DODA 2WV1A 1FP1D 2DAOA 2EZHA 1SAUA 1KQ9A 2E36A 1I6HJ 2QKLB 2VOOA 4HLXA 1F43A 1IRXA 4JQFA 4WCGA 3LL7A 1G4DA 2BW3B 1W5TA 3R0JA 1JUSA 1SD6A 5ICEA 1BIAA 2M4GA 4HOBA 4XOTA 1ZELA 3RKYA 1G6NA 3VSKA 1Y6IA 1HLVA 4YEJA 3DF8A 2FBHA 2E2HJ 1TW3A 5GTIC 5B1BH 1YJNI 3CO6C 3VODA 3K4CA 2QKMB 2W82A 1QZEA 4WXHA 1QGPA 2PJPA 3DQVC 1R5GA 3HBLA 1MZBA 3J7ZI 2DMNA 2OD5A 2VC0A 3GEZA 2QQAA 4Q48A 5E18F 2K9MA 4CXFA 2B0LA 3HZJA 2HZDA 1IDYA 2MA3A 2GXGA 2NVYJ 4ZJZA 1U0JA 2MABA 1FSHA 3P7NA 4J19A 4QWQA 1RR8C 3MKWB 4EJTA 2K3FA 1XCVA 4XN3A 3QWLA 1G8XA 1WI9A 3E97A 4JK1X 3CJNA 2P7CB 2XKPA 1P6RA 2VONA 3ZQ7A 3K2ZA 5HS7A 3HOWJ 4CZZA 3D5RC 2MSYA 4OMYA 5JVTA 2O5RA 3W2VA 2FRHA 2KJBA 2YS9A 4BJ5C 2UXNA 4G7ZF 1ZG1A 1TC3C 1FYLA 4A3LJ 5F1RA 3ABLH 1XCBA 3E6MA 1U5TB 1XC5A 3K1MA 1AKHA 1LFPA 3BR3A 3ABMH 3BR1A 2DMPA 1POGA 3T1BA 3GTKJ 4G8XA 4ZH4F 4ZTFA 3CC4I 3KLOA 5BPIA 4LB5A 4UHTA 3K10A 2EFWA 2JMWA 3QU3A 1USSA 3DEEA 1TQPA 2LKXA 1OFCX 3MZ8A 2EIMH 1ETYA 4FISA 3ULQB 3CCEI 2VUMJ 2DK8A 3GLLA 2WBMA 3S1QJ 1FTTA 5E3LA 1DGWY 3HXLA 3WU0A 1JE8A 4C2UA 4U0YA 2D5VA 3C2BA 2GXBA 1G3WA 3J7AO 3H9GA 3A2KA 3BC8A 2EJRA 3K2AA 2IS2A 4RAFA 1MW7A 1R4NB 3QRFF 4I0AA 4MFEA 1DP3A 3U21A 5FGMA 5TISC 3GMEA 4EM0B 3GYHX 4D5FA 1B9NA 2ZNYA 3VWBA 5HDGA 2O8KA 2LMDA 3H5AA 2Q2EA 4ZYDA 5IYBJ 2O0YA 1WRJA 1W36C 1U8RA 3EDPA 2CUEA 4AIHA 3SZTA 5LRRA 3HEFA 2BVLA 1XMKA 1DPRA 1Z77A 1W7PB 1HKSA 1H9GA 2IJLA 4S05A 4A5NA 4BQAA 4Q5SF 1FLIA 3L2CA 1L3LA 3FXQA 2JA8J 5E1WA 4BDYA 2KKOA 4PGHA 4ZYEA 4XLPF 3E6BA 1R1TA 2DOAA 2R7QA 4IO9F 1Z3XA 3BROA 3AG1H 5F0FA 1XGSA 1NK3P 1MBHA 2VQHA 1DQUA 1OYIA 2BGCA 2AHQA 2V6EA 4A69C 4ZDPA 3G4SI 1T8IA 1PP8F 1U5TA 5GAHJ 4BY7J 4BE1A 2PX9A 1HF0A 1KA8A 5LGTA 1KGSA 4MHGA 4DYRA 3HRTA 4XM3A 2EZKA 1S7AA 2LH9A 5KNLA 1F1ZA 1P4WA 3HM5A 2DMQA 4BQOA 3MKYB 1KU9A 2VBZA 3FM3A 3CJRB 3I54A 2L9SA 3V8KA 2O61A 2OQGA 3H5NA 1U9NA
chains in the Genus database with same CATH topology
1Q1VA 2NVTJ 2CJJA 5JLXA 3G1OA 3CQZJ 1QPIA 2DA5A 2JWTA 4ABZA 3LSPA 1GDTA 2L7FP 3UKGA 2M0CA 2XB0X 2WAQN 3HOYJ 1JUMA 4C3IJ 2XPVA 5EF6A 3I4NJ 2Y30A 1JTXA 5M3MJ 5IP7J 2B63J 3S16J 2M2EA 1FJLA 1PUFA 5J3LA 1WGXA 2TRTA 1ETXA 4HNVA 3TW7A 2FD5A 4UUTA 5C44J 1ZR2A 1GV5A 2DMUA 1BL0A 1IUFA 5K7HA 2XRLA 1DU6A 1X2NA 5FJ8J 2LVSA 2XB5A 1D5YA 3S14J 2KT0A 1TWCJ 3DCFA 3O8HA 3JREA 3FK6A 2R5YB 1K83J 5J1UA 4A93J 3H3VK 5EGOB 2Y9YA 1SANA 1WPKA 3TP3A 4MFDA 1VNDA 4AYBN 1HOMA 1LFUP 4M3GA 4Y52J 3JRIA 2R5YA 4M3FA 3JRGA 3HKZN 2CQXA 5DS9A 1LFBA 1YRNA 3PO3J 3OOUA 3TEDA 3SFIA 4BBRJ 5K7ZA 2OF7A 2FQ4A 4D5CA 2DJNA 3GBGA 4AC0A 4D7NA 1VFCA 2DA4A 4QTRA 2HQ5A 3BG3A 2Y31A 5F27A 1APLC 1BW5A 5IYDJ 1H88C 2R5ZB 2NOGA 1ETVA 3LSJA 1U78A 2HI3A 9ANTA 2R92J 3FKIJ 3MVPA 3ZQHA 2JK3A 2GLOA 3K7AJ 5FKLA 5C3EJ 2EZLA 3QPSA 1E3OC 1IDZA 4DZPA 5EGOA 2Y9ZA 3JRHA 4C2MJ 1OCTC 4JYKA 5IOYA 1MSFC 1WH7A 5DTDA 2E19A 4DYCA 4UUSB 1ORKA 2JA5J 4QIWN 3BR5A 2VI6A 2HOAA 3RZDJ 3JRCA 1GT0C 2X48A 4GFBA 3G1MA 2K9QA 3JRDA 1FTZA 1X2MA 2R93J 4IHVA 2Y2ZA 2VPRA 2LTPA 2M34A 3H0GJ 1VI0A 2XGDA 4NDLA 3IV5A 1QVUA 3CCYA 3Q0WA 3L1PA 2KDZA 4Y7NJ 4L5EA 2E1OA 3HOZJ 1AHDP 5E3OA 3Q3SA 1RETA 4A3EJ 2IAIA 1TWFJ 3QPLA 3ZQIA 5IPAA 4A3FJ 4A3MJ 3HOVJ 5JLWA 4UUSA 1UMQA 2L0KA 1H8AC 1UHSA 2K40A 3MN2A 1ETWA 1BW6A 1LE8A 2PMZN 4C3JJ 5EEAA 3BR2A 1JJ6C 5EDNA 1IG7A 2WB1N 3S1MJ 4IHXA 5E3NA 2AO9A 4X1EA 5FKOA 5K7FA 4A3CJ 4I76A 5E3MA 1MBJA 3JRFA 2XSDC 5C4JJ 4BBSJ 1LE8B 2O7OA 2DA7A 2JA6J 2G0EA 3RKQA 3BT9A 2TCTA 3A01B 2LLKA 2LFBA 4IEJA 1VF9A 2XPUA 5IP9J 1IRZA 4EEFG 2L9RA 4JX4A 2HOSA 1MBGA 5IP6A 3GTJJ 2HXIA 3LNQA 4V2GA 5HODA 1JKQC 4A3IJ 1B8IA 1ZKGA 3CMYA 2DTZA 1ENHA 2VKVA 1MH4A 4W97A 4BKXA 4XRSG 3CDLA 3WHBA 1DU0A 3A01A 2P81A 3BQZA 4JX5A 1B8IB 4A3JJ 5EG0B 2JJ7A 3B6CA 3QQAA 3Q0VA 1JKRC 3ZOBA 5FKMA 3W6VA 2L7ZA 1NK2P 2HXOA 1ITYA 1TWGJ 1Z0XA 3HGYA 1ETQA 2ELKA 4A3DJ 2Y0SN 4A3GJ 5FKKA 2ME6A 4M6VA 2E2JJ 4BXXJ 1RR7A 1SFOJ 2YUSA 3GTQJ 3F0CA 3WHCA 3SDGA 2NVQJ 1B72A 2K9SA 3BR0A 4X6AJ 1GUUA 3GTMJ 1AU7A 3OSFA 1RPWA 4MIMA 4M3BA 1GVDA 1JTYA 1TWHJ 5M5XJ 2MG4A 2DA3A 4XRMA 1Y1WJ 1JJ8C 2JA7J 3BG9A 1JUPA 3M3YJ 1BJZA 3BR6A 3PO2J 1MBEA 3M4OJ 2X9DA 4DZJA 4G12A 1K61A 3S2HJ 3OSGA 1W0TA 1B72B 4IHYA 2XGEA 2QF7A 2DA1A 2IEKA 3D1NI 3HDDA 1WCMJ 5M5WJ 1GV2A 2O9LA 1H89C 5F0CA 3RQIA 1ETKA 3A03A 1HCRA 1FIPA 1HDPA 2CQQA 3IH2A 3BTIA 4JX6A 1ZGWA 2DMTA 5EG0A 4XIDA 2ECBA 2JN6A 2ME0A 1I50J 2CRGA 3BG5A 4LOCA 5F0HA 1ZK8A 4FE7A 3S1RJ 3S1NJ 2I10A 3NARA 2LK2A 2IBDA 5GPCA 2FJ1A 1IGNA 2LY9A 3VPRA 1WI3A 3JRAA 1OJLA 3Q0UA 3ZQFA 4AUXA 2WV1A 1MNMC 2EZHA 2W48A 2CU7A 4B1RA 1I6HJ 5IOZA 2DN0A 4RDUA 1F43A 1R9TJ 3BTLA 2NS8A 2DA2A 1ZR4A 3RZOJ 1W0UA 2NVXJ 3BTJA 1JUSA 1OCPA 1MH3A 5EZHA 2H8RA 2MGQA 2L7MP 1HLVA 2H1KA 2ID6A 4IHWA 2XPWA 3NAUA 3TW6A 2E2HJ 1G2HA 1CQTA 1JGGA 1Y1VJ 3S15J 5F1JA 2LR8A 1EF4A 1XG1A 2GM4A 4B4CA 3B6AA 4DW6A 3GTGJ 2N8GA 3HBLA 3GTOJ 3MKLA 2DMNA 1ZTRA 1U8BA 1ETOA 4A3KJ 4MLOA 1IDYA 2NVYJ 3OIOA 4DYQA 1JT0A 2E2IJ 1I3QJ 2HOTA 1FIAA 1MBKA 4J19A 4XRSA 3HB9A 2CUFA 1RKTA 1P7IA 2EBIA 3HOWJ 1RESA 1NTCA 2M8GX 2MSYA 3PM1A 2YS9A 3JR9A 3S2DJ 3ZQCA 1TC3C 2LP0A 1MBFA 2K9NA 2M9HA 5GP9A 4MO7A 2VKEA 4A3LJ 1S7EA 2MW8A 2HDDA 1XC5A 1AKHA 3BR3A 3BR1A 2DMPA 1POGA 1XS9A 3GTPJ 3FIWA 3IH4A 3GTKJ 5F08A 2LD5A 5M3FJ 5EZGA 2EH3A 4S0HB 1IJWC 2EZIA 2JMWA 4BY1J 4V2FA 2ZB9A 4W1UA 2LKXA 5EYRA 1OFCX 1AKHB 4FCYA 1ETYA 4FISA 2R0QC 2VUMJ 3ZQGA 1P7JA 2COBA 4CYCA 1UG2A 4JP0A 3S1QJ 1FTTA 5E3LA 3DEWA 3O8GA 4RBOA 3ZQLA 5M5YJ 1FEXA 1IV6A 2D5VA 1A5JA 3C2BA 2R7ZJ 2NS7A 1HDDC 3IH3A 5F04A 3HGGA 1U9OA 3K2AA 4M3DA 1MSEC 1ZQ3P 1PUFB 3HOXJ 4MFEA 3G1LA 3BQYA 3GTLJ 2DA6A 3LOCA 3E7LA 2X6OA 4CYCB 3TP0A 2EQRA 4D5FA 1T56A 5FKNA 2O8KA 5IYBJ 4C3HJ 1WH5A 3LSGA 1A6IA 2CUEA 3SJMA 3HEFA 2R5ZA 4B3AA 5BNGA 4I6ZA 1Z77A 2YU9J 2ID3A 3JRBA 4XICA 4D7MA 3FK7A 4XK4A 3S17J 2HYJA 5GPAA 5IYCJ 1T33A 4FTHA 1F36A 2JA8J 4M3EA 1JKPC 5FLVA 5C4XJ 2OPTA 1QVTA 2XGCA 2QCOA 5J1YA 1O4XA 4FE4A 5J1RA 3FISA 1YRNB 5F0FA 1NK3P 1MBHA 2FX0A 3HOUJ 3LSRA 2AHQA 4A69C 3I4MJ 4BY7J 1RKWA 2ECCA 1JT6A 5FLMJ 1HF0A 2GBYA 1X58A 4DYRA 3BTCA 1TWAJ 2EZKA 4QSHA 4A3BJ 1IC8A 2RAEA 3HM5A 2DMQA 1JKOC 3A02A 1U9NA 1QRYA 1BA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1V A;  2NVT J;  2CJJ A;  5JLX A;  3G1O A;  3CQZ J;  1QPI A;  2DA5 A;  2JWT A;  4ABZ A;  3LSP A;  1GDT A;  2L7F P;  3UKG A;  2M0C A;  2XB0 X;  2WAQ N;  3HOY J;  1JUM A;  4C3I J;  2XPV A;  5EF6 A;  3I4N J;  2Y30 A;  1JTX A;  5M3M J;  5IP7 J;  2B63 J;  3S16 J;  2M2E A;  1FJL A;  1PUF A;  5J3L A;  1WGX A;  2TRT A;  1ETX A;  4HNV A;  3TW7 A;  2FD5 A;  4UUT A;  5C44 J;  1ZR2 A;  1GV5 A;  2DMU A;  1BL0 A;  1IUF A;  5K7H A;  2XRL A;  1DU6 A;  1X2N A;  5FJ8 J;  2LVS A;  2XB5 A;  1D5Y A;  3S14 J;  2KT0 A;  1TWC J;  3DCF A;  3O8H A;  3JRE A;  3FK6 A;  2R5Y B;  1K83 J;  5J1U A;  4A93 J;  3H3V K;  5EGO B;  2Y9Y A;  1SAN A;  1WPK A;  3TP3 A;  4MFD A;  1VND A;  4AYB N;  1HOM A;  1LFU P;  4M3G A;  4Y52 J;  3JRI A;  2R5Y A;  4M3F A;  3JRG A;  3HKZ N;  2CQX A;  5DS9 A;  1LFB A;  1YRN A;  3PO3 J;  3OOU A;  3TED A;  3SFI A;  4BBR J;  5K7Z A;  2OF7 A;  2FQ4 A;  4D5C A;  2DJN A;  3GBG A;  4AC0 A;  4D7N A;  1VFC A;  2DA4 A;  4QTR A;  2HQ5 A;  3BG3 A;  2Y31 A;  5F27 A;  1APL C;  1BW5 A;  5IYD J;  1H88 C;  2R5Z B;  2NOG A;  1ETV A;  3LSJ A;  1U78 A;  2HI3 A;  9ANT A;  2R92 J;  3FKI J;  3MVP A;  3ZQH A;  2JK3 A;  2GLO A;  3K7A J;  5FKL A;  5C3E J;  2EZL A;  3QPS A;  1E3O C;  1IDZ A;  4DZP A;  5EGO A;  2Y9Z A;  3JRH A;  4C2M J;  1OCT C;  4JYK A;  5IOY A;  1MSF C;  1WH7 A;  5DTD A;  2E19 A;  4DYC A;  4UUS B;  1ORK A;  2JA5 J;  4QIW N;  3BR5 A;  2VI6 A;  2HOA A;  3RZD J;  3JRC A;  1GT0 C;  2X48 A;  4GFB A;  3G1M A;  2K9Q A;  3JRD A;  1FTZ A;  1X2M A;  2R93 J;  4IHV A;  2Y2Z A;  2VPR A;  2LTP A;  2M34 A;  3H0G J;  1VI0 A;  2XGD A;  4NDL A;  3IV5 A;  1QVU A;  3CCY A;  3Q0W A;  3L1P A;  2KDZ A;  4Y7N J;  4L5E A;  2E1O A;  3HOZ J;  1AHD P;  5E3O A;  3Q3S A;  1RET A;  4A3E J;  2IAI A;  1TWF J;  3QPL A;  3ZQI A;  5IPA A;  4A3F J;  4A3M J;  3HOV J;  5JLW A;  4UUS A;  1UMQ A;  2L0K A;  1H8A C;  1UHS A;  2K40 A;  3MN2 A;  1ETW A;  1BW6 A;  1LE8 A;  2PMZ N;  4C3J J;  5EEA A;  3BR2 A;  1JJ6 C;  5EDN A;  1IG7 A;  2WB1 N;  3S1M J;  4IHX A;  5E3N A;  2AO9 A;  4X1E A;  5FKO A;  5K7F A;  4A3C J;  4I76 A;  5E3M A;  1MBJ A;  3JRF A;  2XSD C;  5C4J J;  4BBS J;  1LE8 B;  2O7O A;  2DA7 A;  2JA6 J;  2G0E A;  3RKQ A;  3BT9 A;  2TCT A;  3A01 B;  2LLK A;  2LFB A;  4IEJ A;  1VF9 A;  2XPU A;  5IP9 J;  1IRZ A;  4EEF G;  2L9R A;  4JX4 A;  2HOS A;  1MBG A;  5IP6 A;  3GTJ J;  2HXI A;  3LNQ A;  4V2G A;  5HOD A;  1JKQ C;  4A3I J;  1B8I A;  1ZKG A;  3CMY A;  2DTZ A;  1ENH A;  2VKV A;  1MH4 A;  4W97 A;  4BKX A;  4XRS G;  3CDL A;  3WHB A;  1DU0 A;  3A01 A;  2P81 A;  3BQZ A;  4JX5 A;  1B8I B;  4A3J J;  5EG0 B;  2JJ7 A;  3B6C A;  3QQA A;  3Q0V A;  1JKR C;  3ZOB A;  5FKM A;  3W6V A;  2L7Z A;  1NK2 P;  2HXO A;  1ITY A;  1TWG J;  1Z0X A;  3HGY A;  1ETQ A;  2ELK A;  4A3D J;  2Y0S N;  4A3G J;  5FKK A;  2ME6 A;  4M6V A;  2E2J J;  4BXX J;  1RR7 A;  1SFO J;  2YUS A;  3GTQ J;  3F0C A;  3WHC A;  3SDG A;  2NVQ J;  1B72 A;  2K9S A;  3BR0 A;  4X6A J;  1GUU A;  3GTM J;  1AU7 A;  3OSF A;  1RPW A;  4MIM A;  4M3B A;  1GVD A;  1JTY A;  1TWH J;  5M5X J;  2MG4 A;  2DA3 A;  4XRM A;  1Y1W J;  1JJ8 C;  2JA7 J;  3BG9 A;  1JUP A;  3M3Y J;  1BJZ A;  3BR6 A;  3PO2 J;  1MBE A;  3M4O J;  2X9D A;  4DZJ A;  4G12 A;  1K61 A;  3S2H J;  3OSG A;  1W0T A;  1B72 B;  4IHY A;  2XGE A;  2QF7 A;  2DA1 A;  2IEK A;  3D1N I;  3HDD A;  1WCM J;  5M5W J;  1GV2 A;  2O9L A;  1H89 C;  5F0C A;  3RQI A;  1ETK A;  3A03 A;  1HCR A;  1FIP A;  1HDP A;  2CQQ A;  3IH2 A;  3BTI A;  4JX6 A;  1ZGW A;  2DMT A;  5EG0 A;  4XID A;  2ECB A;  2JN6 A;  2ME0 A;  1I50 J;  2CRG A;  3BG5 A;  4LOC A;  5F0H A;  1ZK8 A;  4FE7 A;  3S1R J;  3S1N J;  2I10 A;  3NAR A;  2LK2 A;  2IBD A;  5GPC A;  2FJ1 A;  1IGN A;  2LY9 A;  3VPR A;  1WI3 A;  3JRA A;  1OJL A;  3Q0U A;  3ZQF A;  4AUX A;  2WV1 A;  1MNM C;  2EZH A;  2W48 A;  2CU7 A;  4B1R A;  1I6H J;  5IOZ A;  2DN0 A;  4RDU A;  1F43 A;  1R9T J;  3BTL A;  2NS8 A;  2DA2 A;  1ZR4 A;  3RZO J;  1W0U A;  2NVX J;  3BTJ A;  1JUS A;  1OCP A;  1MH3 A;  5EZH A;  2H8R A;  2MGQ A;  2L7M P;  1HLV A;  2H1K A;  2ID6 A;  4IHW A;  2XPW A;  3NAU A;  3TW6 A;  2E2H J;  1G2H A;  1CQT A;  1JGG A;  1Y1V J;  3S15 J;  5F1J A;  2LR8 A;  1EF4 A;  1XG1 A;  2GM4 A;  4B4C A;  3B6A A;  4DW6 A;  3GTG J;  2N8G A;  3HBL A;  3GTO J;  3MKL A;  2DMN A;  1ZTR A;  1U8B A;  1ETO A;  4A3K J;  4MLO A;  1IDY A;  2NVY J;  3OIO A;  4DYQ A;  1JT0 A;  2E2I J;  1I3Q J;  2HOT A;  1FIA A;  1MBK A;  4J19 A;  4XRS A;  3HB9 A;  2CUF A;  1RKT A;  1P7I A;  2EBI A;  3HOW J;  1RES A;  1NTC A;  2M8G X;  2MSY A;  3PM1 A;  2YS9 A;  3JR9 A;  3S2D J;  3ZQC A;  1TC3 C;  2LP0 A;  1MBF A;  2K9N A;  2M9H A;  5GP9 A;  4MO7 A;  2VKE A;  4A3L J;  1S7E A;  2MW8 A;  2HDD A;  1XC5 A;  1AKH A;  3BR3 A;  3BR1 A;  2DMP A;  1POG A;  1XS9 A;  3GTP J;  3FIW A;  3IH4 A;  3GTK J;  5F08 A;  2LD5 A;  5M3F J;  5EZG A;  2EH3 A;  4S0H B;  1IJW C;  2EZI A;  2JMW A;  4BY1 J;  4V2F A;  2ZB9 A;  4W1U A;  2LKX A;  5EYR A;  1OFC X;  1AKH B;  4FCY A;  1ETY A;  4FIS A;  2R0Q C;  2VUM J;  3ZQG A;  1P7J A;  2COB A;  4CYC A;  1UG2 A;  4JP0 A;  3S1Q J;  1FTT A;  5E3L A;  3DEW A;  3O8G A;  4RBO A;  3ZQL A;  5M5Y J;  1FEX A;  1IV6 A;  2D5V A;  1A5J A;  3C2B A;  2R7Z J;  2NS7 A;  1HDD C;  3IH3 A;  5F04 A;  3HGG A;  1U9O A;  3K2A A;  4M3D A;  1MSE C;  1ZQ3 P;  1PUF B;  3HOX J;  4MFE A;  3G1L A;  3BQY A;  3GTL J;  2DA6 A;  3LOC A;  3E7L A;  2X6O A;  4CYC B;  3TP0 A;  2EQR A;  4D5F A;  1T56 A;  5FKN A;  2O8K A;  5IYB J;  4C3H J;  1WH5 A;  3LSG A;  1A6I A;  2CUE A;  3SJM A;  3HEF A;  2R5Z A;  4B3A A;  5BNG A;  4I6Z A;  1Z77 A;  2YU9 J;  2ID3 A;  3JRB A;  4XIC A;  4D7M A;  3FK7 A;  4XK4 A;  3S17 J;  2HYJ A;  5GPA A;  5IYC J;  1T33 A;  4FTH A;  1F36 A;  2JA8 J;  4M3E A;  1JKP C;  5FLV A;  5C4X J;  2OPT A;  1QVT A;  2XGC A;  2QCO A;  5J1Y A;  1O4X A;  4FE4 A;  5J1R A;  3FIS A;  1YRN B;  5F0F A;  1NK3 P;  1MBH A;  2FX0 A;  3HOU J;  3LSR A;  2AHQ A;  4A69 C;  3I4M J;  4BY7 J;  1RKW A;  2ECC A;  1JT6 A;  5FLM J;  1HF0 A;  2GBY A;  1X58 A;  4DYR A;  3BTC A;  1TWA J;  2EZK A;  4QSH A;  4A3B J;  1IC8 A;  2RAE A;  3HM5 A;  2DMQ A;  1JKO C;  3A02 A;  1U9N A;  1QRY A;  1BA5 A; 
#chains in the Genus database with same CATH topology
 4CDG A;  1Z9C A;  5D5U B;  2CJJ A;  5JLX A;  3OYN A;  2HDW A;  3CQZ J;  2KFD A;  2DA5 A;  5F6F A;  4DNC A;  3NEU A;  4ENK A;  3WOD F;  3BCB A;  2Z33 A;  3QYB A;  3HOY J;  1JUM A;  3D0S A;  1IN5 A;  4C3I J;  4KIC A;  2Y30 A;  4MGR A;  2VQG A;  3OYH A;  5IP7 J;  2UXX A;  3G2B A;  2B63 J;  2QGU A;  4PJM A;  2M2E A;  1D0X A;  1SFX A;  1WGX A;  2TRT A;  3EUH A;  2VB6 A;  1ETX A;  1BI1 A;  3TW7 A;  5JR3 A;  1Y0N A;  2FD5 A;  1MJB A;  2H94 A;  2Z2S B;  3TOA A;  3ZCO A;  4F52 A;  3MCZ A;  3CUQ C;  2Q8K A;  2XRL A;  3C2H A;  4EGZ A;  3BJ6 A;  1DU6 A;  3O3K A;  1ZGA A;  3LA7 A;  3DXJ F;  1D5Y A;  3S14 J;  3CCS I;  1MND A;  2CV2 A;  1UEL B;  4ESB A;  3AL0 C;  1FOW A;  2HOE A;  2M8E A;  4UV9 A;  4A93 J;  2UWM A;  2J5O A;  1QPM A;  2JUG A;  3TP3 A;  4HYE A;  1BI3 A;  2Y48 A;  1IV8 A;  1OPC A;  2FNA A;  2YR2 A;  1LFU P;  4JBA A;  4M3G A;  1GLN A;  4Y52 J;  2HEO A;  2QA4 I;  2R5Y A;  4GGG A;  4M3F A;  2AQF A;  3HKZ N;  3ERE D;  2F5D A;  2XSJ C;  4BBR J;  1I6X A;  2IXS A;  3GZ6 A;  3D5S C;  1Q1H A;  2IS4 A;  2F2E A;  4NHJ A;  2BEO A;  4P5O A;  3U9G A;  4QTR A;  1OLT A;  2LSO A;  3IRR A;  3DBR B;  3SZP A;  1ZAO A;  3OYK A;  3QYE A;  3BDD A;  5F27 A;  3I5U A;  1A04 A;  2CUZ A;  3KP2 A;  3OL3 A;  3LSJ A;  1YTY A;  4ZDO A;  3ZGK A;  4IRG A;  3HPG A;  3TGN A;  3TO7 A;  3ZQH A;  1VQK I;  4L9J A;  1QBJ A;  5HNF A;  2QEX I;  2Z1D A;  4DZP A;  3CJQ B;  1ULY A;  2QBY B;  4TV7 A;  5IOY A;  1MSF C;  5AON A;  2V26 A;  2E19 A;  2JPB A;  1WZ2 A;  1FSE A;  3J81 K;  4Z6Y A;  3P9C A;  4HV6 A;  4QIW N;  5LEK A;  1HW2 A;  4I02 A;  1J09 A;  2X1D A;  2HOA A;  2ZJQ F;  2VJ4 A;  2R7O A;  4AM3 A;  4X0G A;  1IW7 F;  3G3Z A;  2V7F A;  2VLA A;  4MTD A;  1ERD A;  1SFE A;  1X2M A;  1YO5 C;  4IVN A;  1UG0 A;  5HDK A;  3T8R A;  2VPR A;  1ZG3 A;  2E71 A;  3OMY A;  3M7G A;  1BM9 A;  2OBP A;  2HKX A;  2K4J A;  3H35 A;  1O7F A;  4BQN A;  1FT9 A;  3H0G J;  4MEX F;  4WX9 A;  2XGD A;  1FNN A;  3E5U A;  3DPT A;  4G9Y A;  2RKH A;  2QQB A;  3S2W A;  3L1P A;  4L0Y B;  4Y7N J;  2H1L A;  2O03 A;  4AYB A;  4UVB A;  3HOZ J;  1L0O C;  2X85 A;  2L9N A;  2JRM A;  3LWF A;  1EKE A;  1RET A;  3LSM A;  1R49 A;  4A3E J;  2DOF A;  4UY8 I;  2MLK A;  1H8A C;  4B09 A;  3DKW A;  2KMU A;  4LLG F;  3IAS 2;  1DGR M;  5HLI A;  5K5O A;  2GQQ A;  2KJC A;  4EM2 A;  3WU1 B;  3IWF A;  1Z3Y A;  4RB2 C;  2WB1 N;  4M71 A;  4KNY A;  1A31 A;  2AO9 A;  5FKO A;  3CC2 I;  1ZRD A;  4I76 A;  1X3W B;  3JRF A;  2XSD C;  2KRF A;  3HOS A;  5L3D A;  2JZY A;  2O7O A;  1UFM A;  2OUM A;  2DFF A;  5HOO A;  4U0W A;  4HX7 A;  2Z3Y A;  3PL8 A;  4RM2 A;  3IHU A;  2LOO A;  4XOP A;  1K4T A;  4ZZL A;  1YS7 A;  3J7A Y;  2GAU A;  4EEF G;  3OV8 A;  3WTS C;  3J80 Z;  3AG4 H;  5L3C A;  5CLS A;  4PGG A;  5L3F A;  2KRC A;  5HOD A;  2DBB A;  1FP2 A;  1B8I A;  1ZKG A;  3I55 I;  3O6B B;  2VKV A;  3E3V A;  1MH4 A;  2TDX A;  3R0A A;  2QSG X;  2IGO A;  3FMS A;  3FM5 A;  3PFI A;  2LY2 A;  2LF8 A;  5D5V B;  4OOI A;  4KFC A;  2A5Y B;  1B8I B;  2JJ7 A;  2X1C A;  2WAD A;  3H3Z A;  3W6V A;  2CW0 F;  2WB1 A;  1ITY A;  1KQ0 A;  2FUG 2;  4G6Q A;  2X6X A;  1NH3 A;  4CZC A;  3HGY A;  3CCR I;  2A69 F;  2L01 A;  1P4A A;  3WTV C;  4A3D J;  1TQI A;  5FKK A;  2BVM A;  5E20 A;  1ZLJ A;  1HST A;  3WHC A;  2F48 A;  2HQA A;  4ESF A;  1B72 A;  1GUU A;  5K5Q A;  2ZXI A;  3P9K A;  1AU7 A;  3FMR A;  3CCQ I;  1P9Q C;  4LB6 B;  3HYI A;  1SFU A;  3KX2 A;  1HXD A;  1UZC A;  4D9J A;  5CYV A;  2MC4 A;  5B1A H;  1FBS A;  4BAC A;  3C18 A;  5M5X J;  5GAD J;  3QU6 A;  4XRM A;  2P6T A;  1FYM A;  2XAF A;  3REO A;  3KEO A;  1BBY A;  1I1S A;  1X1P A;  1BJZ A;  3Q9S A;  3SZG A;  3EUA A;  1HKT A;  1ZYR F;  4QPO A;  3F3X A;  4IPA A;  2A6H F;  1B72 B;  4IHY A;  2XGE A;  3GWZ A;  4ZYA A;  2JTV A;  2E60 A;  3R4K A;  3R61 A;  4LK1 F;  4P9F A;  1J2X A;  1HBX G;  2GA1 A;  4RB0 A;  2CW7 A;  1GV2 A;  2O9L A;  4EGY A;  1H89 C;  2IVM A;  2HU9 A;  3PFY A;  4KN7 X;  3I64 A;  4ETS A;  2NAZ A;  1BC8 C;  3SEZ A;  5IT9 K;  2XVC A;  2IGM A;  1HCR A;  2IGN A;  3ZR8 X;  2QYO A;  4LG0 A;  4XID A;  2ECB A;  5FRN A;  1R36 A;  2WTE A;  2DI3 A;  1TNT A;  2CRG A;  4HSR A;  4XON A;  2JVG A;  4LLN A;  2DTR A;  4FE7 A;  2L7K A;  5B3S H;  2FSW A;  4ENN A;  1HW1 A;  1LQ1 A;  1K6O A;  4OAY A;  5GPC A;  2FJ1 A;  3CO7 C;  1R23 A;  1I27 A;  2LY9 A;  3K69 A;  1WI3 A;  3QOE A;  4BQQ A;  5K5R A;  3ZQF A;  1LDD A;  1V54 H;  3CDI A;  4PJL A;  4A6E A;  4D0P A;  3S3N A;  2W48 A;  2CU7 A;  1VQ5 I;  1QU3 A;  5FLX Z;  5IOZ A;  4RDU A;  1BJA A;  5D5W B;  1R9T J;  2DA2 A;  1ZR4 A;  1WQ2 A;  4II3 A;  3BTJ A;  3LFK A;  2NVX J;  4PJJ A;  3FXJ A;  1AA7 A;  2RDP A;  3LFU A;  3MEX A;  2R7X A;  5EZH A;  4E6K G;  4KA4 A;  3C3W A;  4RAY A;  4ZTJ A;  1YFH A;  4MQ9 F;  2FML A;  2L7M P;  2H1K A;  2XPW A;  2YX4 A;  1YW7 A;  1S5L C;  3TW6 A;  2FE3 A;  3S15 J;  4BGD A;  1EF4 A;  2LR8 A;  3FXO A;  2V9K A;  2K3P A;  1QHH D;  3J7Y J;  3E6D A;  1XB4 A;  1YG2 A;  2D45 A;  4YEL A;  3MKL A;  1U8B A;  2RVC A;  2F5E A;  5J4V A;  4IX7 A;  1JT0 A;  2EK5 A;  3N97 A;  5BOX A;  1IN7 A;  2IGK A;  1OR7 A;  2HOT A;  1MBK A;  2XF6 A;  1G3Y A;  3CCJ I;  3CCM I;  2CUF A;  4WF2 A;  1SD7 A;  1XMA A;  1RKT A;  2OQR A;  1XN7 A;  2V1D A;  1RES A;  2M8G X;  5FB2 A;  2FF4 A;  4MEY F;  3SYT A;  3S2D J;  2EB7 A;  3R6S A;  2VJI A;  4E7Z A;  1K6Y A;  5GP9 A;  3HSR A;  2CGP A;  2HVS A;  3KCC A;  1S7E A;  2QSH X;  1PDN C;  3RYP A;  2STT A;  5DYM A;  1XS9 A;  2RNG A;  3IH4 A;  4E7I A;  2CV1 A;  4XLH A;  5F08 A;  4KIG A;  4WXC A;  1W4M A;  3V7C A;  2BZT A;  3BOQ A;  5EZG A;  1T0F C;  2EV0 A;  1IUY A;  2VT3 A;  3DPL C;  1Y56 A;  3FXL A;  4XKV A;  1MDM B;  1FMW A;  1NG7 A;  2B9S A;  4N0B A;  3EET A;  5EYR A;  2FNP A;  2MD0 A;  2E1C A;  2COB A;  1XGO A;  2B7E A;  3SHF A;  3MAJ A;  1UG2 A;  3CZ6 A;  3JW4 A;  5DCM B;  3DEW A;  3L9F A;  2Z9O A;  1X1A A;  3ZQL A;  5M5Y J;  4LJZ F;  1IV6 A;  1FEX A;  3TO6 A;  1A5J A;  2PJR A;  3V42 A;  2R7Z J;  4XBF A;  5HLH A;  2BHY A;  3RPQ A;  2NS7 A;  1U2W A;  4AID A;  4CCK A;  4JOM A;  3HGG A;  1EJ9 A;  1U9O A;  3BG6 A;  3RSN A;  1FOX A;  4M9X A;  3KLN A;  1ZQ3 P;  2ZSI B;  2R7R A;  3K9T A;  4ASN A;  3HOX J;  2HWV A;  1SVO A;  2QZ8 A;  1RIO H;  3GTL J;  4PSW A;  5FLX K;  3A4C A;  3LOC A;  1Z05 A;  3E7L A;  1D0Z A;  5FD6 A;  3KE2 A;  4MNU A;  3TP0 A;  2EQR A;  4Y33 A;  4ZDL A;  4XLC A;  1K78 B;  2P5V A;  1BI2 A;  1WH5 A;  2ZXH A;  4HG2 A;  4DJA A;  2DPU A;  1DUX C;  1Z67 A;  4G6D A;  2XAJ A;  4RGX A;  2R5Z A;  4B3A A;  1YS6 A;  4XR6 A;  4BXF A;  2YU9 J;  2ID3 A;  3JRB A;  4XIC A;  3S17 J;  4HV5 A;  4PJ0 C;  3QPT A;  3AFH A;  3RPU A;  2MFZ A;  1ZRE A;  3MZH A;  2HKO A;  3F8C A;  4BUP A;  3ML6 A;  2W4S A;  1QVT A;  3W2A A;  5J4Y A;  2XGC A;  2QCO A;  1B4A A;  2X51 A;  5LD2 C;  3QOD A;  3L2V A;  1O4X A;  2LF7 A;  2F4I A;  5BPD A;  1SVM A;  3F23 A;  1K79 A;  2FX0 A;  1WKM A;  3HOU J;  3QOP A;  3DFG A;  3LSR A;  3PNV A;  4U7D A;  4NQW B;  4YRV A;  4UUV A;  5EEG A;  2BY3 A;  3BPX A;  3MFK A;  1OKR A;  1S8N A;  4QSH A;  4A3B J;  5J40 A;  5K1Y A;  4HQE A;  2P4W A;  3GW2 A;  1XD7 A;  1W7P D;  1G3T A;  4Y4R A;  4IQJ A;  2VL8 A;  1LUJ B;  1BA5 A;  4RAG A;  2ZJR F;  1P4X A;  2AXL A;  5D8K B;  3H5R A;  3W6J B;  3FHZ A;  2M7B A;  3MWM A;  2IA0 A;  3LSP A;  2XIG A;  1T0F A;  2ZJP F;  2MH9 A;  3UKG A;  2EA2 A;  2M0C A;  1GDT A;  2HFH A;  4IHT A;  3ZMZ A;  3ZMS A;  4NC8 A;  5A2Q K;  2G9W A;  3M1C A;  3I4N J;  2NNY A;  4UXN A;  5FD5 A;  4HZF A;  3GCM A;  3COA C;  4ON0 A;  3S16 J;  4IHS A;  3GXO A;  3OYI A;  1DPU A;  1JXS A;  2L2O A;  4HF0 A;  2A61 A;  1FWZ A;  3V7S A;  4HNV A;  3ZMV A;  4P55 A;  3VYT B;  3HJE A;  3H1C A;  3TMO A;  3I4P A;  1XMX A;  1MMA A;  1N77 A;  3KP5 A;  1I39 A;  1HSJ A;  2KT0 A;  5L3G A;  2L02 A;  1TWC J;  3O8H A;  1XSD A;  4G6T B;  1IRF A;  1VQN I;  1K83 J;  3K4B A;  5J1U A;  3WTX C;  4EVI A;  2F5V A;  5EGO B;  1YQA A;  1SAN A;  3FBN B;  5JVG F;  2PLY A;  3OS0 A;  1WPK A;  2L4M A;  5LGU A;  5CVV A;  4GCV A;  4AYB N;  1VND A;  3E1S A;  2DO7 A;  2K02 A;  1TP4 A;  2P0W A;  3K4M A;  3ZXS A;  3ELK A;  4XNF A;  1LFB A;  5DS9 A;  4PCQ A;  3PO3 J;  4E7S A;  2K7L A;  3OOU A;  2WAQ A;  3GX4 X;  1N78 A;  3WGG A;  3DTI A;  2XRO A;  3EYY A;  3TED A;  2OF7 A;  2FQ4 A;  2I5U A;  5EJC A;  3BLY A;  5KAI C;  3HTS B;  3DU6 A;  2KQR A;  3LMM A;  1A36 A;  5LLQ A;  2Y31 A;  2AQE A;  2JPC A;  3F8F A;  4AU7 A;  5J8F A;  2JT1 A;  3ZQQ A;  1Y39 A;  1APL C;  5IYD J;  5E1X A;  2EIK H;  2E5N A;  1X3Z B;  1JHF A;  3KP6 A;  1YX3 A;  4IF4 A;  4EJO A;  2HI3 A;  1IXS B;  9ANT A;  1KON A;  1D8K A;  3ZMD A;  4H0E A;  2R92 J;  1YW9 A;  3MVP A;  2JK3 A;  2RN7 A;  5C3E J;  3G6E I;  3VOE A;  2EA4 A;  4IRI A;  4C2M J;  2KIQ A;  2CS3 A;  5DTD A;  2NRA C;  2BBY A;  4DYC A;  4IRH A;  3WTZ A;  5DM6 F;  4UUS B;  2DFE A;  4R79 A;  2BY1 A;  2ZJ2 A;  1V3F A;  2VI6 A;  3RZD J;  1HW5 A;  3DLL F;  4Y3O A;  3BPV A;  2VKD A;  1PJR A;  4GFB A;  4BE0 A;  1PP7 U;  1D1C A;  1E2X A;  3BG7 A;  2QEN A;  4J01 A;  2XRN A;  4P96 A;  2LTP A;  4DOZ A;  1D8J A;  3MZY A;  4BXU A;  1VI0 A;  1MMS A;  3HTU A;  1JHH A;  2IW5 A;  4YG2 F;  3CCY A;  3FDY A;  4B43 A;  4RGU A;  2FEZ A;  2EV6 A;  2F4M B;  4L5E A;  3IRQ A;  2P6S A;  2WAE A;  2E1O A;  3Q5F A;  1AHD P;  3E5X A;  3DKX A;  1YLF A;  2QWW A;  4XOR A;  2OV7 A;  1FX7 A;  1WSU A;  3JAM Z;  4DBQ A;  1UMQ A;  5LEJ A;  1ZN2 A;  2L0K A;  1T2K A;  2L5Q A;  4B47 A;  5HS8 A;  2QVO A;  1BW6 A;  2VBX A;  3HIF A;  4LFU A;  3HKZ A;  5LGN A;  3KZY A;  1LE8 A;  4G94 A;  4HRI A;  4C3J J;  5EEA A;  2DYR H;  3BR2 A;  5D4S A;  1T38 A;  2KIU A;  3S1M J;  3OS2 A;  4IHX A;  2RC4 A;  3H9Q A;  5E3N A;  3SDB A;  4X1E A;  4N4N B;  4XKW A;  2G7U A;  3OL4 A;  5C4J J;  2ISY A;  3WG9 A;  4HDU A;  3ROU A;  4BHB A;  2E1M B;  2JA6 J;  2G0E A;  4OIP F;  1QQI A;  1T08 B;  2CO5 A;  2TCT A;  4OIR F;  2LLK A;  3SEQ A;  2LFB A;  1ZHF A;  1RUN A;  2XPU A;  5IP9 J;  5LBQ A;  1VQP I;  2FU4 A;  3P5J A;  4PUS A;  4XQF A;  5IT9 Z;  2L9R A;  5GTH C;  4BJT A;  2H8W A;  3GTJ J;  3OYB A;  2HXI A;  4F93 B;  1JKQ C;  3K0L A;  4CCL A;  4A3I J;  1RI7 A;  3ZPL A;  2OJE D;  3CMY A;  2DTZ A;  1ENH A;  1SD4 A;  2VIX A;  3I3L A;  4XMY A;  2HR3 A;  4XRS G;  3CDL A;  4ZC3 A;  2OC6 A;  2ZME B;  3UNG C;  3W6K B;  1LVK A;  2P81 A;  3BQZ A;  2JRT A;  3FWE A;  1CF7 A;  3EUK L;  4KYW A;  4A3J J;  4L9N A;  2R7S A;  2VJ5 A;  4YIF A;  3BY6 A;  3G71 I;  1UCR A;  3GFI A;  5DCF A;  1KU7 A;  2STW A;  1FC3 A;  5DDG A;  5AIP A;  2GZW A;  2ELK A;  1IRG A;  2EIL H;  2Y75 A;  2Y0S N;  4A3G J;  4M6V A;  2E2J J;  2BXY A;  2BYV E;  2MC3 A;  3RCO A;  2GXA A;  4XLE A;  2F6C A;  3GTQ J;  3F0C A;  3FX3 A;  1RZ4 A;  3IP4 B;  3BR0 A;  3AAF A;  3I53 A;  4X6A J;  2R7T A;  1PUE E;  1X1B A;  3CCU I;  3WTU C;  4MIM A;  2CQK A;  1JTY A;  2M4K A;  2ZO4 A;  2MG4 A;  2DA3 A;  1SD5 A;  2PBI A;  2DT5 A;  1GHC A;  3FZV A;  3BZ6 A;  1S9H A;  1LDJ A;  3C1D A;  4G12 A;  1B59 A;  5B5E C;  1K61 A;  3S2H J;  4FX0 A;  2XHK A;  2LC2 A;  3CUO A;  4ZYG A;  2LBF B;  4HQM A;  4D1Q A;  2ZXW H;  3S93 A;  2QF7 A;  2DA1 A;  1P92 A;  4KIS A;  3D1N I;  3ERM A;  3SFZ A;  2BHZ A;  2NOJ B;  3BWG A;  2Z5U A;  5M5W J;  4LLL A;  3K4N A;  4M6X A;  2WV0 A;  2GIZ A;  1FIP A;  1HDP A;  3WE3 A;  1S7O A;  1I5Z A;  4AIK A;  2HNH A;  4JX6 A;  5HLG A;  5EG0 A;  5JHU A;  3OYM A;  3AL0 B;  2NS0 A;  3PUF A;  2BOL A;  3OYF A;  4HEA 2;  2QQ9 A;  3V4G A;  3S1R J;  2DXI A;  1Z91 A;  2LK2 A;  5DD8 A;  5CQG A;  1IO2 A;  4LIT A;  1J5Y A;  3VPR A;  5LHG A;  3JRA A;  1OJL A;  3Q0U A;  3TL4 X;  4LG0 B;  4B1R A;  1W36 D;  5KK1 A;  3VSL A;  1RNL A;  2DN0 A;  3JSP A;  2CV0 A;  2ESN A;  3HL2 A;  4YFX F;  1VQ6 I;  2M1B A;  3ZMT A;  5TGT A;  1W0U A;  4B44 A;  2X6W A;  2ZFU A;  3LSI A;  4I0B A;  5EEH A;  2H8R A;  2CFO A;  4HX4 A;  2JSP A;  2IA2 A;  2ID6 A;  2K5C A;  3NAU A;  4XLN F;  4J00 A;  1G2H A;  3H36 A;  4RGR A;  2Z99 A;  1XG1 A;  2MD5 A;  3RYR A;  4B4C A;  1HC8 A;  3A0B C;  3PSI A;  3DV8 A;  3TDU C;  1SAX A;  3PQJ A;  3IL2 A;  3CUQ B;  3I59 A;  1K7A A;  2ZSH B;  2GWR A;  2VQC A;  3H3U A;  3KEQ A;  1VTN C;  2L4A A;  4A0Z A;  4A3K J;  4XSZ F;  4I2O A;  1ODD A;  4DYQ A;  3OIO A;  4KIF A;  3CP2 A;  1OCZ H;  3W3C A;  3TOB A;  4S04 A;  3I9V 2;  1FIA A;  1YYV A;  4U7B A;  4XRS A;  3KZZ A;  4IQ4 A;  1K78 A;  3F8M A;  3JTH A;  2FOK A;  3RKX A;  1JGS A;  4DBR A;  1RRJ A;  3HG9 A;  4KIT B;  1TL8 A;  2LG4 A;  1YX5 A;  2CQN A;  4IJA A;  4MO7 A;  3IUO A;  2H6B A;  1WJ5 A;  3IC7 A;  2HDD A;  3F6V A;  3FIW A;  3DBH B;  1TT5 B;  4HPQ A;  2HS5 A;  2M87 A;  4M73 A;  5DCM A;  3SXY A;  4AD9 A;  2JVH A;  3OR2 C;  2LD5 A;  4CHU A;  3FHN A;  4S0H B;  4W1U A;  1OCO H;  2R0Q C;  1P7J A;  3EQL F;  4C30 A;  1XPX A;  3V7R A;  2OA4 A;  5HNH A;  1REP C;  4KT5 C;  2LBF A;  2JQ7 A;  1XGM A;  2BV6 A;  4E7L A;  4OU0 A;  5H20 A;  3N4M A;  3VDX A;  5LHI A;  4UB6 C;  1QHG A;  5LRS A;  1YHQ I;  4YFN F;  4Y17 A;  1OIS A;  2FQ3 A;  2RQP A;  3ABU A;  1HDD C;  3IH3 A;  2M30 A;  1G3S A;  5F04 A;  1R6R A;  3NQO A;  4M3D A;  1R7J A;  4BHC A;  3NWS A;  1MSE C;  1PUF B;  2CWE A;  2YX7 A;  3WG7 H;  4PK4 A;  1LDK B;  2DCE A;  3BQY A;  2ZNZ A;  2DA6 A;  1T39 A;  2X6O A;  4KJZ A;  2BY2 A;  3AG2 H;  3F8N A;  4RMN A;  3KFW X;  4CYC B;  1K4S A;  1VQ7 I;  3FMQ A;  1D3Y A;  1LJ9 A;  1TZL A;  4HAM A;  1YE9 A;  4C3H J;  3LSG A;  3K1N A;  2Q0O A;  3HC7 A;  5KVR A;  4MTE A;  4UB8 C;  1UST A;  4I6Z A;  2F5F A;  3KPH A;  3AKZ A;  3F6O A;  3OYC A;  2FMY A;  4D7M A;  4XK4 A;  4RLF A;  1FZP B;  2GOX B;  2RNJ A;  4M72 A;  4XKC A;  5CVR A;  4PZJ A;  4BJ6 C;  3CCV I;  1NHA A;  4EQQ A;  2Y0M A;  1F36 A;  1S6L A;  2VT2 A;  5FLV A;  5C4X J;  2A5W A;  2KIF A;  2EFO A;  3BCA A;  3CMA I;  1U6G A;  1XSX A;  2LY1 A;  3A0H C;  4FE4 A;  5J1R A;  1YRN B;  3ONQ A;  1V5G A;  3K6G A;  4RAZ A;  1T98 A;  4BHP A;  1ZG5 A;  3PUB A;  1BR4 A;  1MNE A;  2PMZ A;  3CLQ A;  4KN4 X;  3RQ4 A;  6PAX A;  3GLX A;  1N25 A;  5CPR B;  3QAH A;  1Z1D A;  3ABT A;  2YSR A;  3I4M J;  3WTT C;  3IWZ A;  1J9I A;  1RKW A;  1OCR H;  5FLM J;  2GBY A;  1X58 A;  2DU9 A;  2A6T A;  3BTC A;  4RB1 A;  1WVR A;  1LNW A;  4Q47 A;  2KL4 A;  1YIT I;  2ZCW A;  3OYA A;  2DPD A;  3R60 A;  3L2W A;  2VOP A;  4NC7 A;  5BS6 A;  3C2G A;  4RS8 A;  5ICG A;  1VQL I;  1X4P A;  1IZ1 A;  1QRY A;  4LIV A;  2ETH A;  4PFO A;  2IT0 A;  4I01 A;  2IS6 A;  3KIO A;  4FHT A;  2JWT A;  2X6Y A;  4ABZ A;  4QLC U;  2P8T A;  3H9J A;  3DWL E;  4WXD A;  2E5Z A;  1O3R A;  4N9I A;  4BYY A;  1HKQ A;  3WE2 A;  2DK5 A;  4PDK A;  5M3M J;  2R7D A;  1OYW A;  2XAG A;  2UV1 A;  1XGN A;  1O57 A;  5J3L A;  1PUF A;  5L3E A;  3EPZ A;  2HTJ A;  1H0M A;  3PQK A;  2DQL A;  2P5L C;  3CD6 I;  1GV5 A;  4E4H A;  5FRM A;  2D1V A;  2W25 A;  2L9V A;  2XB5 A;  1D5V A;  4EV0 A;  2VN2 A;  3OYD A;  3VEP A;  3DCF A;  2H6C A;  4A2U A;  1B9M A;  3JRE A;  3FK6 A;  5D6E A;  2R5Y B;  5BQT A;  1W7P A;  2GOM A;  3RKW A;  1M1E B;  2XUB A;  1W5S A;  1R5H A;  4CGZ A;  3TBI A;  1X4O A;  3GUD A;  5F64 A;  3EYI A;  4MFD A;  1HOM A;  2V9P A;  2CG4 A;  1UAA A;  3JRG A;  1D1A A;  4NBQ A;  1YRN A;  2W7N A;  3RTR A;  3E0J B;  5J47 A;  1ZRF A;  1U3E M;  3TO9 A;  3HHH A;  4K2E A;  2XAQ A;  3PNY A;  1MJA A;  5CKT A;  2M5W A;  4BEH B;  3S3M A;  3ZMU A;  1B1B A;  4PFP A;  3JTG A;  4N4O B;  1VFC A;  2K4B A;  2DA4 A;  3VYS B;  2HQ5 A;  4HBL A;  4EJV A;  2W1O A;  2VQL A;  1H88 C;  3KP4 A;  1X1D A;  1U78 A;  2HQR A;  3FBI B;  1YIO A;  4NUB A;  2R4G A;  5J8C A;  4Q4Z F;  3K70 C;  3K7A J;  5FKL A;  3HRM A;  2EZL A;  3QPS A;  4F55 A;  3CLO A;  3JRH A;  3F72 A;  2E1N A;  3FXR A;  4JYK A;  1DP7 P;  2EFQ A;  1WH7 A;  2MH2 A;  4ITV A;  5KHD A;  2M45 A;  4CO8 A;  1IN4 A;  2HYG D;  1KU2 A;  1ORK A;  4A0X A;  2JA5 J;  2F4O B;  3GZ5 A;  3BR5 A;  3PIP F;  3PJR A;  4CCN A;  3WGI A;  1V55 H;  1GT0 C;  1J75 A;  4II2 A;  4U0V A;  1AWC A;  2K9Q A;  4RLQ A;  1SC7 A;  2FBK A;  1BOB A;  1FTZ A;  3F9K A;  1IXR C;  2DYS H;  3T0Y A;  4IHV A;  2Y2Z A;  4DIQ A;  4MQV A;  2XKO A;  2DDA A;  4WWC A;  3CTA A;  2RQQ A;  1I1G A;  4F91 B;  4WK8 F;  3N05 A;  2M7A A;  4OIQ F;  3LQQ A;  2VPL A;  4CYD A;  1E0E A;  1FOK A;  3IV5 A;  1CF7 B;  1QVU A;  1MGT A;  5HDN A;  3Q0W A;  2KDZ A;  2OCC H;  2PMH A;  3F22 A;  3OYG A;  2CYY A;  2YPR A;  4XL9 A;  3Q3S A;  4CCJ A;  2IAI A;  1TWF J;  4OMZ A;  3ZQI A;  5IPA A;  3HOV J;  1Z6T A;  3L00 A;  4UUS A;  3ASN H;  4R8H A;  1UHS A;  2K40 A;  2HVR A;  1ETW A;  3BZK A;  2PMZ N;  3CES A;  5LFA A;  4HX8 A;  2LNB A;  4NC6 A;  1IG7 A;  2HGC A;  1QNT A;  3TKY A;  5CVU A;  2W00 A;  2UZK A;  1LEB A;  3DTK A;  4M9S A;  4NNJ A;  1R00 A;  4A3C J;  2MYS A;  2ZFW A;  2O6G E;  5CVI A;  3Q9V A;  2CMP A;  3WTW C;  2DA7 A;  3RKQ A;  3BT9 A;  3S3O A;  3A01 B;  5ILS A;  1R58 A;  2JSC A;  2E7W A;  2ICW G;  4IEJ A;  1VF9 A;  4I09 A;  2R3S A;  5DEQ A;  4JX4 A;  5FO5 A;  4EAT A;  5LHH A;  1SMY F;  3W2W A;  1MBG A;  4IL6 C;  3LNQ A;  2IRF G;  3RDI A;  1BOA A;  2VXD A;  5FFZ A;  1IXC A;  3ASO H;  1TT0 A;  5BMZ A;  2Y0S A;  3HUG A;  4W97 A;  4BKX A;  1FY7 A;  1VQ9 I;  1D0Y A;  4BU2 A;  2CFX A;  3U1D A;  3VYR B;  4JX5 A;  2ESH A;  3MKZ A;  2DOE A;  3B6C A;  1E3P A;  1KU3 A;  1V4R A;  2JUC A;  2Z16 A;  3Q0V A;  1JKR C;  1GXQ A;  1AOY A;  5FKM A;  4F3Q A;  2KIM A;  2PJR B;  1EH7 A;  1ON2 A;  3LST A;  2Q1Z B;  3ZN0 A;  4Y13 A;  3L2U A;  5KAF C;  3DPU A;  3HUG B;  2ME6 A;  1WWX A;  4DQ2 A;  4BXX J;  2E7X A;  2Y69 H;  1RR7 A;  2YUS A;  5DUK A;  5A2Q Z;  3BJO A;  4LIU A;  2VJJ A;  1Z21 A;  1OYY A;  4HDV A;  4YIR X;  3K4J A;  2XAS A;  3P9I A;  4KT6 A;  3OSF A;  3ZRG A;  3V8L A;  1ON1 A;  2DJI A;  4BH9 A;  2CW8 A;  2V1X A;  1TWH J;  1Y0U A;  4P9U A;  4CH7 A;  3B73 A;  3OYL A;  1JJ8 C;  3BG9 A;  1JUP A;  1O3T A;  3M3Y J;  3I0T A;  2HQN A;  3BR6 A;  3PO2 J;  1MBE A;  4RA2 A;  3M1E A;  2WAF A;  2X9D A;  3LAP A;  2PI0 A;  3M9A A;  3OSG A;  4OIN F;  1W0T A;  1A35 A;  2A05 A;  3ECH A;  4RGS A;  2W84 A;  2IEK A;  1RUO A;  1R71 A;  3HDD A;  1WCM J;  2IA1 A;  1KYW A;  4L9T A;  1R1U A;  3DBL B;  1MMD A;  1ETK A;  1MMN A;  4NQW A;  2K85 A;  3TDZ C;  3IH2 A;  3BTI A;  3FF5 A;  2PFB A;  1WJC A;  3E5Q A;  2JN6 A;  2ME0 A;  1I50 J;  2QM3 A;  3BG5 A;  3DKY A;  4LOC A;  1ZK8 A;  4A0Y A;  3S1N J;  4IXA A;  3HPH A;  3QYF A;  2I10 A;  5D8L B;  3NAR A;  2IBD A;  3I71 A;  2QUF A;  2M0M A;  1TQM A;  1IAW A;  4FT8 A;  4AUX A;  2VXZ A;  3RPU D;  2LDU A;  1I3A A;  1MNM C;  1R22 A;  1XTA A;  2VKH A;  4EJW A;  4F7Z A;  4AVZ A;  3KET A;  5HS9 A;  4OWR B;  1N75 A;  4RM3 A;  2RRE A;  2R7U A;  3BTL A;  2NS8 A;  1E3H A;  2XDV A;  1XDS A;  4ANJ A;  3RZO J;  5E79 C;  2QSF X;  1FYK A;  1HQC A;  1G59 A;  4XN0 A;  1OCP A;  1MH3 A;  3GZN B;  2MGQ A;  3HSF A;  3K4K A;  3VFZ A;  2A07 F;  1W5C C;  2OZU A;  3HRS A;  4IHW A;  1TBX A;  1CQT A;  2ADU A;  3ZP5 A;  1Y1V J;  1JGG A;  5F1J A;  4Y15 A;  4L5I A;  2HPM A;  2GM4 A;  4IZZ A;  3B6A A;  4DW6 A;  3GTG J;  2N8G A;  1B6A A;  2K86 A;  3GTO J;  3M8E A;  5IY5 H;  1ZTR A;  1VZ0 A;  4A12 A;  2R7F A;  5HVQ C;  1ETO A;  1F9N A;  2RV8 A;  4L0Z B;  2V6C A;  4MLO A;  5TRD A;  1SEU A;  2NNN A;  4HLY A;  2E2I J;  1I3Q J;  1X19 A;  3DLA A;  4XKB A;  4O3M A;  1YJ9 I;  4FAS D;  4GXO A;  3JSO A;  1EH8 A;  3HB9 A;  2CQ7 A;  1Y8R B;  3K4L A;  1KYZ A;  2H09 A;  1MJ9 A;  2EWN A;  1P7I A;  1VQO I;  1MDM A;  2OTL I;  2EBI A;  1IN6 A;  1UHW A;  1NTC A;  3AG3 H;  3PM1 A;  3I59 B;  3JR9 A;  3DP7 A;  5CJ9 A;  3ZQC A;  2LP0 A;  1MBF A;  2K9N A;  2M9H A;  3FXK A;  2VKE A;  5E1Z B;  2DLL A;  4IKF A;  1BR1 A;  3CF2 A;  2MW8 A;  4BEH A;  1Y8Q B;  3KYL A;  4CCO A;  3E6C C;  3GTP J;  4B3X A;  5ERI A;  5D6F A;  1IN8 A;  5M3F J;  1J59 A;  2EH3 A;  3CC7 I;  3K70 D;  1IJW C;  2EZI A;  4BY1 J;  4V2F A;  5DUI A;  2ZB9 A;  3HHG A;  2K27 A;  2G7H A;  4FCY A;  1AKH B;  5DM7 F;  1V5E A;  2CUJ A;  3GF2 A;  3ZQG A;  5E8I A;  4CYC A;  2LRD A;  2OZ6 A;  3IAM 2;  2UUZ A;  4YII A;  4JP0 A;  4P1W A;  1H9T A;  3O8G A;  4RBO A;  3T8T A;  4AIJ A;  1F4K A;  2E34 A;  2OU2 A;  4HA8 A;  3CUQ A;  4ENJ A;  1BR2 A;  1GVJ A;  1YI2 I;  3TQN A;  4XLF A;  2WA0 A;  3G1L A;  2DT6 A;  3GFJ A;  4F92 B;  2E1M C;  4PSX A;  2ZXJ A;  1WJB A;  4IOC F;  1V5F A;  5H6Q A;  1KZH A;  1T56 A;  5FKN A;  4QPQ A;  5ICF A;  2WY8 Q;  2ISZ A;  3LAJ A;  1BN5 A;  3VYU B;  1A6I A;  3SJM A;  3WGH A;  4BNC A;  1R5I D;  5BNG A;  1WFX A;  4KUM A;  3FK7 A;  3G73 A;  1FMV A;  1TLH B;  2P7V B;  3OS1 A;  1YIJ I;  1FOY A;  2HYJ A;  5GPA A;  5IYC J;  1T33 A;  4FTH A;  2QBY A;  2C6Y A;  2BY0 A;  2X1E A;  1Z6R A;  2DFI A;  3GO5 A;  4M3E A;  4AWX B;  1JKP C;  2OPT A;  3RJP A;  3CF5 F;  2X4H A;  1WJA A;  5J1Y A;  2VOD A;  3UR3 C;  3FIS A;  2AXT C;  1XSV A;  3B02 A;  2OTJ I;  2I8D A;  3ISP A;  3MQ0 A;  1A6Q A;  5IT3 A;  4E7K A;  2ECC A;  1JT6 A;  1WJD A;  4M74 A;  2IPQ X;  4O5V A;  4HST A;  1YJW I;  1TWA J;  3ZN1 A;  4HNU A;  2ZBK A;  2RAE A;  1IC8 A;  3OWT A;  1JKO C;  3A02 A;  2W24 A;  1BI0 A;  1O3Q A;  1LPQ A;  1Q1V A;  2NVT J;  3G1O A;  1S29 A;  2GA2 A;  3D5L A;  4E7J A;  1QPI A;  4LK0 F;  5ICC A;  4YFK F;  3RIR A;  2L7F P;  2PMU A;  2XB0 X;  3FXM A;  2WAQ N;  3JAM K;  3OIP A;  2WC2 A;  5D5X B;  5D4R A;  4N9H A;  2XPV A;  5EF6 A;  3KP3 A;  1JTX A;  2XF5 A;  3HRU A;  2KHM A;  4LD5 A;  4M6Y A;  1ZH5 A;  4KDP A;  2EPF A;  3T5X A;  2HTS A;  1FJL A;  2EFN A;  1CGP A;  3KZI C;  2ZME C;  4GRI A;  3WTY C;  2HVQ A;  5FRO A;  3HOT A;  2P5K A;  1QA6 A;  1WHU A;  3CJT B;  1EH6 A;  3GFM A;  4U87 A;  4UUT A;  5C44 J;  1ZR2 A;  4G7H F;  4KMF A;  2DMU A;  1RC9 A;  3BJA A;  4BL0 B;  1O3S A;  1BL0 A;  2XV4 S;  3J80 K;  3HSE A;  3QPH A;  1IUF A;  2A3S A;  5K7H A;  1D1B A;  4UV8 A;  2Q2E B;  1X2N A;  2K9L A;  5FJ8 J;  2LVS A;  2KLO A;  4HF1 A;  1TW2 A;  2M3A A;  2ELJ A;  2DDB A;  5HLT A;  2DT7 B;  1KQ8 A;  2R7W A;  1LKX A;  3S32 A;  2FBI A;  5J6X A;  1SFK A;  2VC1 A;  3H3V K;  2Y9Y A;  2O3F A;  3U2R A;  2FOW A;  4A5M A;  2NYX A;  4HNT A;  1ACI A;  4CA0 A;  5H6R A;  5CQE A;  5B66 C;  3JRI A;  4GDF A;  4R1H A;  2CQX A;  1LB2 A;  1LEA A;  4C9Y A;  2VBW A;  1Z7U A;  4CSW A;  1VQM I;  3FXU A;  4CCM A;  3SFI A;  1XDU A;  5K7Z A;  2J5P A;  2BE5 F;  4D5C A;  2DJN A;  3GBG A;  1OQY A;  1R4M B;  2XF7 A;  4AC0 A;  4D7N A;  2HPI A;  5AIQ A;  4IOA F;  2BXZ A;  5ED4 A;  1JI8 A;  3FKJ A;  4LMY A;  3BG3 A;  1DDN A;  3KYD B;  1BW5 A;  2IP2 A;  2W85 A;  1ONV A;  5JFR A;  1Z7L A;  1EV7 A;  1MIJ A;  2MLG A;  2NOG A;  1ETV A;  2R5Z B;  1HA8 A;  4DGW B;  2PN6 A;  2LRE A;  1OR7 C;  4XLA A;  3FKI J;  2D2W A;  1O7L A;  1TNS A;  2GLO A;  1IDZ A;  2HZT A;  1E3O C;  5L3B A;  4ZYH A;  5EGO A;  3BZC A;  2Y9Z A;  3IKV A;  4EJU A;  4LGW A;  3S8P A;  3SQN A;  4A6D A;  3K1P A;  1OCT C;  2KZV A;  2QQ8 A;  4OIO F;  4RB3 C;  1STZ A;  2FXA A;  5GAE J;  3I56 I;  4UVC A;  3NWT A;  5E8G A;  2XC7 A;  1GXP A;  4I7H A;  3JCU C;  1YOV B;  2ELH A;  4CIC A;  1WJE A;  4L5J A;  1QZZ A;  4HF2 A;  3JRC A;  2OAZ A;  1VQ4 I;  4BAY A;  2X48 A;  3ECO A;  1E17 A;  2LYC A;  3G1M A;  3A1Y A;  3U1K A;  3JRD A;  1S3J A;  5ILV A;  2R93 J;  1OCC H;  4B8X A;  1PYV A;  4B48 A;  2M34 A;  1UB9 A;  3LSH A;  2NVU B;  1FBU A;  2WY7 Q;  3NRV A;  3LA2 A;  5KCM A;  3PIO F;  1NG6 A;  4ZZD A;  3DEU A;  3RI4 A;  2NXN B;  4NDL A;  5JI6 A;  2KZG A;  2H27 A;  4UVA A;  1BIB A;  2EV5 A;  2V1N A;  2V79 A;  3J81 Z;  1YW8 A;  3OYJ A;  1X1C A;  2DW4 A;  3KYC B;  3OY9 A;  1PVE A;  1VQ8 I;  2CH0 A;  2IS1 A;  4KIB A;  4I98 B;  4FQG A;  2CSO A;  5E3O A;  2KRH A;  2KDO A;  2ZC2 A;  3CME I;  2MBF A;  3QPL A;  2E35 A;  4A3F J;  4A3M J;  4H4K C;  4UNO A;  5JLW A;  1SMT A;  4FET A;  3DTE A;  3MN2 A;  2DFH A;  2EIN H;  2JA2 A;  2LKS A;  5TJJ A;  1SVL A;  2F5C A;  2PG4 A;  3LQR A;  1C0W A;  1LVA A;  1JJ6 C;  5EDN A;  2XAH A;  2OCE A;  4HW0 A;  2V1U A;  4LG3 A;  5K7F A;  4XRF A;  1TTY A;  5E3M A;  1MBJ A;  5GAG J;  1UHM A;  2L54 A;  1R1V A;  1T95 A;  2RGV A;  4BBS J;  1LE8 B;  1MMG A;  2EIJ H;  3QP5 A;  4AVP A;  2ZME A;  3EUH C;  3L2R A;  4Z2Y A;  1IRZ A;  4ENM A;  2HOS A;  3H92 A;  4L18 B;  2VE9 A;  5IP6 A;  1WJF A;  2EFP A;  1IF1 A;  2WWY A;  4GO1 A;  1T6S A;  4V2G A;  3OYE A;  4E70 A;  3KP7 A;  1FBQ A;  2V4J C;  4BE2 A;  3VB2 A;  3CDH A;  1J7K A;  1MD0 A;  3QP6 A;  5DD4 A;  2DQR A;  3L09 A;  3L2Q A;  4NB5 A;  1S72 I;  3WHB A;  1DU0 A;  1W1W E;  3CCL I;  3A01 A;  3I58 A;  4L9V A;  3O2P E;  3OOP A;  1P2F A;  5EG0 B;  4KMU X;  4OAZ A;  3QQA A;  2W57 A;  4E7H A;  4O6J A;  5DV5 A;  2KP6 A;  2GIV A;  2HYF A;  4U88 A;  3ZOB A;  2HDC A;  1ZGJ A;  2L7Z A;  4PJN A;  4EMS A;  1NK2 P;  2HXO A;  1QZY A;  1TWG J;  1Z0X A;  4XSX F;  1ETQ A;  3BP8 A;  4C2T A;  4G7O F;  2V9V A;  4M9Z A;  2VE8 A;  2LKP A;  3M07 A;  5ILU A;  3F8B A;  1BC7 C;  1ZLK A;  3M8J A;  1SFO J;  2O8X A;  3KEY A;  3SDG A;  2NVQ J;  2K9S A;  1J0R A;  4GYI A;  2PEX A;  3OIQ A;  1ZAR A;  1U5T C;  3GTM J;  2BW3 A;  3X2Q H;  1RPW A;  4M3B A;  5FFX A;  1GVD A;  4GYG A;  5E17 F;  1Y1W J;  4BDZ A;  3GFL A;  2JA7 J;  2A68 F;  1F5T A;  1OMI A;  3ESW B;  2X0L A;  3M4O J;  2YU3 A;  4DZJ A;  5JHF A;  1ZRC A;  3PNT A;  4V19 K;  3C7J A;  3CMM A;  3L7W A;  4FX4 A;  1XX5 A;  3DU5 A;  3GVA A;  4BS9 A;  3MD2 A;  3WU2 C;  2XAU A;  4CUG A;  3LA3 A;  1FPQ A;  3F21 A;  2XGX A;  2KIS A;  4EM1 A;  5F0C A;  2R7V A;  3RQI A;  3A03 A;  2VAS A;  3MMY B;  3H0D A;  2AS5 F;  2CQQ A;  2KPM A;  3CP8 A;  3M8F A;  2COM A;  3OR1 C;  4ESJ A;  4I99 C;  1ZGW A;  1QO0 D;  2DMT A;  2VBY A;  1UJ8 A;  2A6E F;  3PSF A;  3V8J A;  2PQ8 A;  1EA3 A;  2ACJ A;  2QLZ A;  5CVJ A;  1MKM A;  5F0H A;  2FA5 A;  5H2F C;  2L3D A;  1X3U A;  2D1H A;  1IGN A;  3IKT A;  3ABK H;  2ZKZ A;  3LSK A;  2DOD A;  2WV1 A;  1FP1 D;  2DAO A;  2EZH A;  1SAU A;  1KQ9 A;  2E36 A;  1I6H J;  2QKL B;  2VOO A;  4HLX A;  1F43 A;  1IRX A;  4JQF A;  4WCG A;  3LL7 A;  1G4D A;  2BW3 B;  1W5T A;  3R0J A;  1JUS A;  1SD6 A;  5ICE A;  1BIA A;  2M4G A;  4HOB A;  4XOT A;  1ZEL A;  3RKY A;  1G6N A;  3VSK A;  1Y6I A;  1HLV A;  4YEJ A;  3DF8 A;  2FBH A;  2E2H J;  1TW3 A;  5GTI C;  5B1B H;  1YJN I;  3CO6 C;  3VOD A;  3K4C A;  2QKM B;  2W82 A;  1QZE A;  4WXH A;  1QGP A;  2PJP A;  3DQV C;  1R5G A;  3HBL A;  1MZB A;  3J7Z I;  2DMN A;  2OD5 A;  2VC0 A;  3GEZ A;  2QQA A;  4Q48 A;  5E18 F;  2K9M A;  4CXF A;  2B0L A;  3HZJ A;  2HZD A;  1IDY A;  2MA3 A;  2GXG A;  2NVY J;  4ZJZ A;  1U0J A;  2MAB A;  1FSH A;  3P7N A;  4J19 A;  4QWQ A;  1RR8 C;  3MKW B;  4EJT A;  2K3F A;  1XCV A;  4XN3 A;  3QWL A;  1G8X A;  1WI9 A;  3E97 A;  4JK1 X;  3CJN A;  2P7C B;  2XKP A;  1P6R A;  2VON A;  3ZQ7 A;  3K2Z A;  5HS7 A;  3HOW J;  4CZZ A;  3D5R C;  2MSY A;  4OMY A;  5JVT A;  2O5R A;  3W2V A;  2FRH A;  2KJB A;  2YS9 A;  4BJ5 C;  2UXN A;  4G7Z F;  1ZG1 A;  1TC3 C;  1FYL A;  4A3L J;  5F1R A;  3ABL H;  1XCB A;  3E6M A;  1U5T B;  1XC5 A;  3K1M A;  1AKH A;  1LFP A;  3BR3 A;  3ABM H;  3BR1 A;  2DMP A;  1POG A;  3T1B A;  3GTK J;  4G8X A;  4ZH4 F;  4ZTF A;  3CC4 I;  3KLO A;  5BPI A;  4LB5 A;  4UHT A;  3K10 A;  2EFW A;  2JMW A;  3QU3 A;  1USS A;  3DEE A;  1TQP A;  2LKX A;  1OFC X;  3MZ8 A;  2EIM H;  1ETY A;  4FIS A;  3ULQ B;  3CCE I;  2VUM J;  2DK8 A;  3GLL A;  2WBM A;  3S1Q J;  1FTT A;  5E3L A;  1DGW Y;  3HXL A;  3WU0 A;  1JE8 A;  4C2U A;  4U0Y A;  2D5V A;  3C2B A;  2GXB A;  1G3W A;  3J7A O;  3H9G A;  3A2K A;  3BC8 A;  2EJR A;  3K2A A;  2IS2 A;  4RAF A;  1MW7 A;  1R4N B;  3QRF F;  4I0A A;  4MFE A;  1DP3 A;  3U21 A;  5FGM A;  5TIS C;  3GME A;  4EM0 B;  3GYH X;  4D5F A;  1B9N A;  2ZNY A;  3VWB A;  5HDG A;  2O8K A;  2LMD A;  3H5A A;  2Q2E A;  4ZYD A;  5IYB J;  2O0Y A;  1WRJ A;  1W36 C;  1U8R A;  3EDP A;  2CUE A;  4AIH A;  3SZT A;  5LRR A;  3HEF A;  2BVL A;  1XMK A;  1DPR A;  1Z77 A;  1W7P B;  1HKS A;  1H9G A;  2IJL A;  4S05 A;  4A5N A;  4BQA A;  4Q5S F;  1FLI A;  3L2C A;  1L3L A;  3FXQ A;  2JA8 J;  5E1W A;  4BDY A;  2KKO A;  4PGH A;  4ZYE A;  4XLP F;  3E6B A;  1R1T A;  2DOA A;  2R7Q A;  4IO9 F;  1Z3X A;  3BRO A;  3AG1 H;  5F0F A;  1XGS A;  1NK3 P;  1MBH A;  2VQH A;  1DQU A;  1OYI A;  2BGC A;  2AHQ A;  2V6E A;  4A69 C;  4ZDP A;  3G4S I;  1T8I A;  1PP8 F;  1U5T A;  5GAH J;  4BY7 J;  4BE1 A;  2PX9 A;  1HF0 A;  1KA8 A;  5LGT A;  1KGS A;  4MHG A;  4DYR A;  3HRT A;  4XM3 A;  2EZK A;  1S7A A;  2LH9 A;  5KNL A;  1F1Z A;  1P4W A;  3HM5 A;  2DMQ A;  4BQO A;  3MKY B;  1KU9 A;  2VBZ A;  3FM3 A;  3CJR B;  3I54 A;  2L9S A;  3V8K A;  2O61 A;  2OQG A;  3H5N A;  1U9N A; 
#chains in the Genus database with same CATH homology
 1Q1V A;  2NVT J;  2CJJ A;  5JLX A;  3G1O A;  3CQZ J;  1QPI A;  2DA5 A;  2JWT A;  4ABZ A;  3LSP A;  1GDT A;  2L7F P;  3UKG A;  2M0C A;  2XB0 X;  2WAQ N;  3HOY J;  1JUM A;  4C3I J;  2XPV A;  5EF6 A;  3I4N J;  2Y30 A;  1JTX A;  5M3M J;  5IP7 J;  2B63 J;  3S16 J;  2M2E A;  1FJL A;  1PUF A;  5J3L A;  1WGX A;  2TRT A;  1ETX A;  4HNV A;  3TW7 A;  2FD5 A;  4UUT A;  5C44 J;  1ZR2 A;  1GV5 A;  2DMU A;  1BL0 A;  1IUF A;  5K7H A;  2XRL A;  1DU6 A;  1X2N A;  5FJ8 J;  2LVS A;  2XB5 A;  1D5Y A;  3S14 J;  2KT0 A;  1TWC J;  3DCF A;  3O8H A;  3JRE A;  3FK6 A;  2R5Y B;  1K83 J;  5J1U A;  4A93 J;  3H3V K;  5EGO B;  2Y9Y A;  1SAN A;  1WPK A;  3TP3 A;  4MFD A;  1VND A;  4AYB N;  1HOM A;  1LFU P;  4M3G A;  4Y52 J;  3JRI A;  2R5Y A;  4M3F A;  3JRG A;  3HKZ N;  2CQX A;  5DS9 A;  1LFB A;  1YRN A;  3PO3 J;  3OOU A;  3TED A;  3SFI A;  4BBR J;  5K7Z A;  2OF7 A;  2FQ4 A;  4D5C A;  2DJN A;  3GBG A;  4AC0 A;  4D7N A;  1VFC A;  2DA4 A;  4QTR A;  2HQ5 A;  3BG3 A;  2Y31 A;  5F27 A;  1APL C;  1BW5 A;  5IYD J;  1H88 C;  2R5Z B;  2NOG A;  1ETV A;  3LSJ A;  1U78 A;  2HI3 A;  9ANT A;  2R92 J;  3FKI J;  3MVP A;  3ZQH A;  2JK3 A;  2GLO A;  3K7A J;  5FKL A;  5C3E J;  2EZL A;  3QPS A;  1E3O C;  1IDZ A;  4DZP A;  5EGO A;  2Y9Z A;  3JRH A;  4C2M J;  1OCT C;  4JYK A;  5IOY A;  1MSF C;  1WH7 A;  5DTD A;  2E19 A;  4DYC A;  4UUS B;  1ORK A;  2JA5 J;  4QIW N;  3BR5 A;  2VI6 A;  2HOA A;  3RZD J;  3JRC A;  1GT0 C;  2X48 A;  4GFB A;  3G1M A;  2K9Q A;  3JRD A;  1FTZ A;  1X2M A;  2R93 J;  4IHV A;  2Y2Z A;  2VPR A;  2LTP A;  2M34 A;  3H0G J;  1VI0 A;  2XGD A;  4NDL A;  3IV5 A;  1QVU A;  3CCY A;  3Q0W A;  3L1P A;  2KDZ A;  4Y7N J;  4L5E A;  2E1O A;  3HOZ J;  1AHD P;  5E3O A;  3Q3S A;  1RET A;  4A3E J;  2IAI A;  1TWF J;  3QPL A;  3ZQI A;  5IPA A;  4A3F J;  4A3M J;  3HOV J;  5JLW A;  4UUS A;  1UMQ A;  2L0K A;  1H8A C;  1UHS A;  2K40 A;  3MN2 A;  1ETW A;  1BW6 A;  1LE8 A;  2PMZ N;  4C3J J;  5EEA A;  3BR2 A;  1JJ6 C;  5EDN A;  1IG7 A;  2WB1 N;  3S1M J;  4IHX A;  5E3N A;  2AO9 A;  4X1E A;  5FKO A;  5K7F A;  4A3C J;  4I76 A;  5E3M A;  1MBJ A;  3JRF A;  2XSD C;  5C4J J;  4BBS J;  1LE8 B;  2O7O A;  2DA7 A;  2JA6 J;  2G0E A;  3RKQ A;  3BT9 A;  2TCT A;  3A01 B;  2LLK A;  2LFB A;  4IEJ A;  1VF9 A;  2XPU A;  5IP9 J;  1IRZ A;  4EEF G;  2L9R A;  4JX4 A;  2HOS A;  1MBG A;  5IP6 A;  3GTJ J;  2HXI A;  3LNQ A;  4V2G A;  5HOD A;  1JKQ C;  4A3I J;  1B8I A;  1ZKG A;  3CMY A;  2DTZ A;  1ENH A;  2VKV A;  1MH4 A;  4W97 A;  4BKX A;  4XRS G;  3CDL A;  3WHB A;  1DU0 A;  3A01 A;  2P81 A;  3BQZ A;  4JX5 A;  1B8I B;  4A3J J;  5EG0 B;  2JJ7 A;  3B6C A;  3QQA A;  3Q0V A;  1JKR C;  3ZOB A;  5FKM A;  3W6V A;  2L7Z A;  1NK2 P;  2HXO A;  1ITY A;  1TWG J;  1Z0X A;  3HGY A;  1ETQ A;  2ELK A;  4A3D J;  2Y0S N;  4A3G J;  5FKK A;  2ME6 A;  4M6V A;  2E2J J;  4BXX J;  1RR7 A;  1SFO J;  2YUS A;  3GTQ J;  3F0C A;  3WHC A;  3SDG A;  2NVQ J;  1B72 A;  2K9S A;  3BR0 A;  4X6A J;  1GUU A;  3GTM J;  1AU7 A;  3OSF A;  1RPW A;  4MIM A;  4M3B A;  1GVD A;  1JTY A;  1TWH J;  5M5X J;  2MG4 A;  2DA3 A;  4XRM A;  1Y1W J;  1JJ8 C;  2JA7 J;  3BG9 A;  1JUP A;  3M3Y J;  1BJZ A;  3BR6 A;  3PO2 J;  1MBE A;  3M4O J;  2X9D A;  4DZJ A;  4G12 A;  1K61 A;  3S2H J;  3OSG A;  1W0T A;  1B72 B;  4IHY A;  2XGE A;  2QF7 A;  2DA1 A;  2IEK A;  3D1N I;  3HDD A;  1WCM J;  5M5W J;  1GV2 A;  2O9L A;  1H89 C;  5F0C A;  3RQI A;  1ETK A;  3A03 A;  1HCR A;  1FIP A;  1HDP A;  2CQQ A;  3IH2 A;  3BTI A;  4JX6 A;  1ZGW A;  2DMT A;  5EG0 A;  4XID A;  2ECB A;  2JN6 A;  2ME0 A;  1I50 J;  2CRG A;  3BG5 A;  4LOC A;  5F0H A;  1ZK8 A;  4FE7 A;  3S1R J;  3S1N J;  2I10 A;  3NAR A;  2LK2 A;  2IBD A;  5GPC A;  2FJ1 A;  1IGN A;  2LY9 A;  3VPR A;  1WI3 A;  3JRA A;  1OJL A;  3Q0U A;  3ZQF A;  4AUX A;  2WV1 A;  1MNM C;  2EZH A;  2W48 A;  2CU7 A;  4B1R A;  1I6H J;  5IOZ A;  2DN0 A;  4RDU A;  1F43 A;  1R9T J;  3BTL A;  2NS8 A;  2DA2 A;  1ZR4 A;  3RZO J;  1W0U A;  2NVX J;  3BTJ A;  1JUS A;  1OCP A;  1MH3 A;  5EZH A;  2H8R A;  2MGQ A;  2L7M P;  1HLV A;  2H1K A;  2ID6 A;  4IHW A;  2XPW A;  3NAU A;  3TW6 A;  2E2H J;  1G2H A;  1CQT A;  1JGG A;  1Y1V J;  3S15 J;  5F1J A;  2LR8 A;  1EF4 A;  1XG1 A;  2GM4 A;  4B4C A;  3B6A A;  4DW6 A;  3GTG J;  2N8G A;  3HBL A;  3GTO J;  3MKL A;  2DMN A;  1ZTR A;  1U8B A;  1ETO A;  4A3K J;  4MLO A;  1IDY A;  2NVY J;  3OIO A;  4DYQ A;  1JT0 A;  2E2I J;  1I3Q J;  2HOT A;  1FIA A;  1MBK A;  4J19 A;  4XRS A;  3HB9 A;  2CUF A;  1RKT A;  1P7I A;  2EBI A;  3HOW J;  1RES A;  1NTC A;  2M8G X;  2MSY A;  3PM1 A;  2YS9 A;  3JR9 A;  3S2D J;  3ZQC A;  1TC3 C;  2LP0 A;  1MBF A;  2K9N A;  2M9H A;  5GP9 A;  4MO7 A;  2VKE A;  4A3L J;  1S7E A;  2MW8 A;  2HDD A;  1XC5 A;  1AKH A;  3BR3 A;  3BR1 A;  2DMP A;  1POG A;  1XS9 A;  3GTP J;  3FIW A;  3IH4 A;  3GTK J;  5F08 A;  2LD5 A;  5M3F J;  5EZG A;  2EH3 A;  4S0H B;  1IJW C;  2EZI A;  2JMW A;  4BY1 J;  4V2F A;  2ZB9 A;  4W1U A;  2LKX A;  5EYR A;  1OFC X;  1AKH B;  4FCY A;  1ETY A;  4FIS A;  2R0Q C;  2VUM J;  3ZQG A;  1P7J A;  2COB A;  4CYC A;  1UG2 A;  4JP0 A;  3S1Q J;  1FTT A;  5E3L A;  3DEW A;  3O8G A;  4RBO A;  3ZQL A;  5M5Y J;  1FEX A;  1IV6 A;  2D5V A;  1A5J A;  3C2B A;  2R7Z J;  2NS7 A;  1HDD C;  3IH3 A;  5F04 A;  3HGG A;  1U9O A;  3K2A A;  4M3D A;  1MSE C;  1ZQ3 P;  1PUF B;  3HOX J;  4MFE A;  3G1L A;  3BQY A;  3GTL J;  2DA6 A;  3LOC A;  3E7L A;  2X6O A;  4CYC B;  3TP0 A;  2EQR A;  4D5F A;  1T56 A;  5FKN A;  2O8K A;  5IYB J;  4C3H J;  1WH5 A;  3LSG A;  1A6I A;  2CUE A;  3SJM A;  3HEF A;  2R5Z A;  4B3A A;  5BNG A;  4I6Z A;  1Z77 A;  2YU9 J;  2ID3 A;  3JRB A;  4XIC A;  4D7M A;  3FK7 A;  4XK4 A;  3S17 J;  2HYJ A;  5GPA A;  5IYC J;  1T33 A;  4FTH A;  1F36 A;  2JA8 J;  4M3E A;  1JKP C;  5FLV A;  5C4X J;  2OPT A;  1QVT A;  2XGC A;  2QCO A;  5J1Y A;  1O4X A;  4FE4 A;  5J1R A;  3FIS A;  1YRN B;  5F0F A;  1NK3 P;  1MBH A;  2FX0 A;  3HOU J;  3LSR A;  2AHQ A;  4A69 C;  3I4M J;  4BY7 J;  1RKW A;  2ECC A;  1JT6 A;  5FLM J;  1HF0 A;  2GBY A;  1X58 A;  4DYR A;  3BTC A;  1TWA J;  2EZK A;  4QSH A;  4A3B J;  1IC8 A;  2RAE A;  3HM5 A;  2DMQ A;  1JKO C;  3A02 A;  1U9N A;  1QRY A;  1BA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...