5AIPA

Crystal structure of nadr in complex with 4-hydroxyphenylacetate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 46
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aipA00
1FP2A 2HYGD 5D6FA 5E18F 3T8TA 2O03A 2PBIA 3LQQA 3KE2A 2YR2A 2H09A 1O3RA 3WTZA 2FU4A 3L7WA 3BWGA 5ILVA 2NYXA 2YU3A 5D5VB 3KZYA 1MDMA 3KCCA 1IXSB 3PQKA 4CO8A 2QBYA 4HX7A 3KLNA 1XGSA 2TDXA 4FX4A 3S2WA 2MH2A 4ZYEA 2HS5A 1FP1D 5DEQA 5IT9Z 1HSJA 1XN7A 5D8LB 4LLNA 5LGUA 1U5TA 2BYVE 2F5FA 2VE9A 2V6CA 1XSVA 2GQQA 3IHUA 1ON2A 4EVIA 3K69A 4LLGF 4JK1X 3IWFA 4U0WA 1HW5A 3ULQB 3V7RA 1KQ0A 2EV5A 3CLOA 2FMLA 5E8GA 2HFHA 5HLIA 5DD4A 3COAC 3ZMUA 1XDUA 5D4RA 5H6QA 4PGHA 2P5LC 4AIHA 1LDDA 1XDSA 1BC8C 3H3ZA 1TW3A 4A5MA 3LAPA 4RB0A 5TJJA 1K78B 4PGGA 2W24A 5HS9A 1T2KA 1R22A 3NQOA 1D8JA 4KN4X 4RGSA 4EGYA 4TV7A 1ZN2A 4ZYHA 2FXAA 5JI6A 4HX4A 3HRMA 2A6EF 3IL2A 4OIRF 3KEQA 4RS8A 1YLFA 3SZPA 2M30A 4KN7X 3V8KA 1K7AA 3ECHA 3ZMTA 3H92A 1F4KA 1MD0A 2P4WA 4KMUX 2ISYA 3KLOA 4M9SA 3JSOA 3LQRA 1U8RA 4OMZA 1L0OC 2P5KA 2RDPA 2IP2A 2HKXA 3P9IA 1USSA 1AOYA 2CG4A 3V8LA 3V7SA 3WGHA 1IN7A 1G3YA 3FMSA 1WWXA 4HV5A 1MZBA 2PN6A 5J8CA 3KP6A 1BIBA 1HW1A 1LNWA 2H27A 3KP7A 2OQRA 2XRNA 2YX4A 2PI0A 4Q47A 2WTEA 2IW5A 2Y0MA 4L5IA 3V4GA 3ML6A 3WTYC 2ZO4A 5DV5A 4KMFA 3MWMA 2F2EA 1D8KA 1ZAOA 3WTSC 4HOBA 2PJPA 2XVCA 1P4WA 4HLXA 4KIBA 3O2PE 1QO0D 2QZ8A 4IXAA 1U5TC 4OOIA 3LWFA 2W85A 4M72A 3I58A 4HQEA 2OQGA 2VBZA 2LKPA 1BI2A 1BIAA 4IHTA 3ELKA 1QZZA 3IKTA 3TO7A 2GAUA 4IF4A 3QU3A 3MQ0A 1T6SA 2XAHA 2XUBA 1T39A 3L2CA 5AIQA 1XMAA 2RGVA 3SXYA 2P5VA 4M9ZA 3R61A 1WKMA 1YW8A 4GCVA 3M8EA 2L3DA 3RIRA 5TRDA 3ZMDA 1FT9A 3T8RA 5HDGA 4S04A 2COMA 2KIFA 2OBPA 4UNOA 1Z6TA 4LMYA 4YFXF 2P6SA 3K0LA 1YS6A 4A6EA 2AS5F 3IRRA 2FBKA 1OMIA 4G94A 2NNYA 4ESJA 2ACJA 3BROA 4UVCA 3NRVA 3C18A 2QWWA 2HWVA 3BPVA 1FWZA 3ZPLA 1O3TA 1H0MA 1P4XA 4YFKF 4I98B 5CVJA 1BI1A 3OV8A 3KETA 4ON0A 1RUOA 1CGPA 5E20A 2CQKA 2HKOA 5CYVA 3GUDA 1OKRA 4ZZDA 3V8JA 5E1ZB 2DW4A 1V3FA 2MLKA 2YPRA 2ZXJA 5BPDA 4P9FA 4HA8A 2IVMA 1BI3A 1EH6A 1LB2A 1DP7P 4MNUA 3ECOA 2ZMEB 1G3TA 5FGMA 3SQNA 1YQAA 5E1XA 5DDGA 3IC7A 4A5NA 2HR3A 2BV6A 2P8TA 1KGSA 2C6YA 3GLXA 1XGMA 2BBYA 2VT2A 3P7NA 5ICGA 3ERED 2JPCA 1Y0UA 1O3SA 1ZRCA 2ZKZA 1YFHA 3DFGA 2CGPA 5DD8A 3PFIA 1IN4A 3REOA 1BC7C 1Q1HA 3J80K 3TO6A 4HBLA 2XV4S 1G6NA 2HEOA 4OU0A 2Q2EA 1MKMA 3DPLC 5LBQA 4R1HA 1V4RA 3Q9SA 2GXGA 1HKSA 3N4MA 3DV8A 4MEYF 5HDKA 2F5DA 2YSRA 2ZFWA 2QQ9A 3CUOA 1FBQA 2DBBA 2V1DA 5ILUA 4Z2YA 5LGNA 5FLXK 3KP2A 2MBFA 1UHWA 4K2EA 2A3SA 1FSEA 3QRFF 3M9AA 3BJ6A 3WG9A 2EB7A 4I02A 1ZRFA 3B73A 1FYMA 3RKYA 2E7XA 2XAQA 4MEXF 4LK1F 4CDGA 1CF7B 3HOTA 1TW2A 3PQJA 4WF2A 4HF1A 4AWXB 3I0TA 4BH9A 4LK0F 2V1XA 5K5OA 2L01A 2OD5A 2X0LA 2JSCA 1GVJA 1BN5A 2W25A 4EJOA 3JSPA 4KICA 1R36A 2FRHA 1B9NA 1FSHA 3IRQA 5DCMB 2VBXA 1SD7A 3WU0A 1RIOH 4RGUA 3F21A 5L3FA 4RGRA 2VC0A 2PFBA 2XGXA 3BJAA 3NEUA 4BHBA 3I54A 2IPQX 4H0EA 1TQPA 2IRFG 2P6TA 3GO5A 3J80Z 4MHGA 5D6EA 4HDVA 2HYFA 2R7DA 4EJWA 4U0YA 4P96A 1KQ9A 4KNYA 1J59A 3SZTA 1HW2A 2M45A 3GEZA 3CUQB 1W7PA 2CW0F 4XSZF 4OIQF 4BHPA 1HKQA 3WTXC 3WTVC 3DF8A 3I5UA 2VONA 4RAZA 3WGIA 3F8FA 3C1DA 5FLXZ 1TQIA 1WI9A 1SAXA 3JTGA 2H94A 1R5HA 3HTUA 5F6FA 5FD5A 1PP8F 4KA4A 5K5QA 3KP4A 2HQRA 4FHTA 4WXCA 4HF2A 4M6YA 5CVIA 5IT3A 1YW9A 4M9XA 1ZG5A 4HLYA 4AIJA 4EJTA 3GYHX 2NS0A 2HTJA 1LEBA 3I64A 4EM1A 3FHZA 2EFOA 4U0VA 1JHFA 1KYZA 3GVAA 1W4MA 3BPXA 3QP6A 5JHUA 4IPAA 4A12A 2A69F 4ZYGA 3GFJA 3RTRA 2RVCA 3F8BA 3RKXA 1H9TA 2ISZA 4F7ZA 2HGCA 3LFKA 4YIFA 3MEXA 4EJVA 4RB1A 2EFPA 1REPC 1S3JA 3VODA 3T0YA 4ZYDA 4EM0B 4I0AA 5D5WB 1QGPA 3F8MA 4G6DA 3JAMK 1O7FA 4MTEA 4ENMA 2K4JA 3RJPA 3E5UA 1J7KA 2L54A 3TO9A 5J6XA 4LG0A 2NNNA 6PAXA 2F5CA 3TKYA 4IJAA 4PDKA 5KVRA 2MC3A 4XRFA 5K5RA 5LRRA 3EYIA 1IXCA 1G4DA 1QBJA 2ESNA 4JBAA 1WSUA 5EEHA 5CVUA 4N9IA 1RUNA 1EH8A 3QP5A 1TBXA 1IN6A 4ENNA 1FYKA 1TNSA 1ZRDA 2STWA 2XASA 1BBYA 4L9NA 2P7CB 4MQ9F 4EGZA 1KQ8A 4FX0A 2J5PA 1TQMA 1WQ2A 1BI0A 4LB5A 1EV7A 3FMRA 4ZH4F 1DUXC 3R0JA 2EK5A 4Q4ZF 1T38A 5J8FA 4L9JA 2Z9OA 2HTSA 3CO6C 2O6GE 4S05A 4OMYA 1QNTA 5BMZA 1NHAA 2UXNA 5ILSA 2A68F 4RB2C 1YIOA 5K1YA 3N97A 2NRAC 3FM5A 3K9TA 4ZZLA 1K78A 4L18B 5LLQA 1BOAA 2AXLA 3F8CA 5L3BA 3RPUA 1PUEE 3TDZC 3ABTA 4IHSA 1FBSA 1OYIA 1L3LA 2XAGA 4O6JA 4GO1A 4GYGA 3TQNA 3GXOA 1P6RA 2PMHA 5LHHA 4ESFA 1QQIA 2ZNYA 1IN8A 2LNBA 2Q8KA 4BXUA 3VEPA 4O5VA 3RYPA 2XKOA 3FXUA 2FQ3A 3HHHA 4G8XA 2YX7A 1OYYA 4UV9A 4QLCU 4UUVA 2FA5A 1ZREA 4I2OA 1XCVA 3MZYA 1RZ4A 4NB5A 4RAYA 3GFIA 1FOKA 4UV8A 4UHTA 2Z5UA 2W57A 3AAFA 4A6DA 4JQFA 5DCFA 5FD6A 4CGZA 2RNJA 1FBUA 3E3VA 1DPRA 5L3GA 4BYYA 2VODA 1UHMA 4GYIA 2XROA 2XKPA 2JTVA 1Z1DA 5ICCA 4LB6B 5DYMA 1K6OA 3DPTA 1YG2A 2BE5F 3HUGA 3ZMVA 2CWEA 1TLHB 2A5YB 5DUIA 1S7AA 3E6DA 2QLZA 1ZARA 2M5WA 1T98A 1C0WA 1A04A 1R1UA 5CLSA 1F5TA 2LF8A 5HDNA 3F8NA 2K02A 3I4PA 1P92A 3Q5FA 2RC4A 2IA2A 2FBIA 3WODF 3WE2A 4CZZA 2CFXA 3RI4A 2DT5A 2DFIA 2QUFA 5FO5A 2VOPA 1IF1A 2HDCA 1XGNA 3GW2A 4N9HA 2L02A 3HYIA 3JW4A 1ONVA 3GZ5A 1ZH5A 4I09A 1FYLA 4G6QA 5L3DA 5CVVA 3GFMA 2WWYA 4MQVA 2VBWA 4KUMA 1PP7U 4ESBA 3LSTA 5FFZA 2O3FA 2QYOA 3I59B 1LVAA 1SD4A 4OINF 2L4AA 2L4MA 2WV0A 2FNAA 1RNLA 5BOXA 2PG4A 4EMSA 2KRFA 1S8NA 2X4HA 1IZ1A 1MJAA 5FB2A 2R3SA 4BQAA 2PLYA 3WGGA 4KT5C 3GF2A 4LFUA 3O3KA 5JR3A 2Z33A 2EA2A 2XIGA 1KU2A 3W6KB 2GWRA 2BEOA 4BHCA 2K27A 2IT0A 3T5XA 1E17A 3KFWX 3J7AO 3HRUA 3HHGA 2UWMA 3R4KA 3TGNA 2JPBA 2ZBKA 4G7ZF 1I6XA 3QAHA 4YG2F 2E1NA 5ICFA 1Z05A 2P7VB 4YFNF 1DDNA 4EQQA 1B9MA 2G9WA 3OOPA 4L5JA 2OU2A 1IW7F 4Y13A 4KIGA 2IA0A 4PCQA 3U2RA 4B09A 4HW0A 4ENJA 2E7WA 1KU3A 2ZMEA 3TDUC 4G7HF 1J0RA 2GZWA 5HS7A 3FMQA 1D3YA 3G73A 3QU6A 2EFNA 1ZHFA 1Z7UA 4WCGA 3U9GA 2D1HA 1HSTA 2EV6A 3R60A 5CVRA 3V7CA 2OA4A 1R00A 3BZ6A 5LEJA 3HTSB 3J81K 2VXZA 3ZMSA 2G7HA 2V1UA 1HKTA 5F64A 2IJLA 1W5SA 5KK1A 3F23A 3K2ZA 1QZYA 1MDMB 4HQMA 1FPQA 2K7LA 2JRTA 3CO7C 2QBYB 4OIOF 1ZYRF 5DUKA 4HV6A 5ED4A 1SMTA 1UB9A 5ERIA 2DU9A 4I7HA 4KFCA 4AVPA 1U5TB 2DI3A 4NQWA 4M73A 3EUHA 2ADUA 1YYVA 3RDIA 5F1RA 4I01A 4QWQA 2MLGA 1IRGA 4E70A 1FLIA 2KJBA 2RV8A 2M8EA 2G7UA 1XSDA 2B0LA 1CF7A 1LDKB 2F5EA 1XCBA 5CJ9A 1SD6A 4DQ2A 2NAZA 2DQLA 3EQLF 5D8KB 5HLGA 3QOPA 2Y75A 3DQVC 1F1ZA 3EDPA 3WTUC 2DPUA 2VBYA 1LJ9A 5EEGA 3ZN0A 2QVOA 2DTRA 1LEAA 3Q9VA 5LEKA 5DCMA 1GXQA 5LRSA 4PZJA 1MJ9A 4KIFA 2FEZA 1SFXA 1R58A 3DP7A 1KA8A 1XGOA 3HSFA 3KEOA 3R6SA 1OR7A 3J81Z 3C7JA 2RN7A 3ZN1A 3E5XA 3LAJA 2OAZA 2DK8A 3WE3A 3BJOA 3GX4X 3EETA 2VT3A 4CYDA 4I0BA 3MCZA 1J9IA 4P5OA 3ZQ7A 2M1BA 3MAJA 4L9VA 2GXBA 1Z9CA 1MJBA 5LHIA 3CJNA 4XLPF 5E17F 5D5UB 4LJZF 1ULYA 4EJUA 4B8XA 3CUQA 2XAJA 3BP8A 4BAYA 2R7FA 1JXSA 4NHJA 4HYEA 5FFXA 1USTA 2IA1A 3IWZA 5LGTA 2OZUA 3WTWC 4DNCA 3DKWA 5AONA 1IRFA 1SFUA 3K1PA 3MZHA 1I5ZA 3VB2A 2MA3A 1J5YA 1XMKA 3LA3A 5BS6A 1BJAA 2GIVA 2PQ8A 1FY7A 3K1MA 3P9CA 1ODDA 1RI7A 3M8FA 1I1SA 4LGWA 4Y15A 2RKHA 4L0ZB 4HZFA 2EJRA 1KYWA 3EYYA 3ROUA 1H9GA 3DXJF 4WK8F 3E5QA 4G9YA 3FF5A 2D1VA 4HAMA 3W6JB 1SFEA 3HRTA 3K1NA 1U2WA 3BY6A 3BDDA 4GXOA 4A2UA 4HDUA 1U78A 3D5LA 3SFZA 1J2XA 3ABUA 2O61A 4CICA 2DLLA 1YW7A 3F6VA 1JE8A 1E2XA 1IAWA 4P55A 5HLHA 3FWEA 4UVBA 3M7GA 1B59A 4WWCA 1Z6RA 4R8HA 3BOQA 1S6LA 2ELHA 4M6XA 3FXQA 3JAMZ 2K86A 2EV0A 4A0ZA 1W5TA 2W84A 1DPUA 1FZPB 2Z3YA 3G3ZA 2RQPA 4ETSA 1G3WA 5E8IA 2LDUA 4G7OF 1UCRA 5LHGA 1ON1A 4L9TA 2LSOA 3H3UA 1S7OA 1YTYA 2MD5A 5BPIA 4M74A 2FMYA 2VN2A 2FBHA 2D45A 1SD5A 1SMYF 3CUQC 2VE8A 1O3QA 1W7PD 1X3UA 2LF7A 1U6GA 2H6CA 4Q48A 1ZG3A 3L09A 3KP3A 3CDHA 5HVQC 4R79A 1KU7A 4XSXF 2QM3A 4MGRA 5JVTA 2FE3A 2OZ6A 2V9VA 1T0FA 2PMUA 2O0YA 1P2FA 2HQNA 4IRHA 2EA4A 2ZJ2A 3F72A 5H20A 4ASNA 5A2QK 4BNCA 4L0YB 2JZYA 4OIPF 5ICEA 1Z91A 2E1CA 4Q5SF 2JT1A 1HXDA 3I71A 4U7BA 3GZ6A 4CHUA 2Y48A 1R7JA 3CTAA 3ZP5A 2ESHA 4KDPA 1JHHA 1ZGAA 1R5GA 2VC1A 3M1EA 2ZCWA 4IRGA 2GA2A 4AIKA 3HOSA 2KIMA 4AD9A 2KKOA 3QPHA 5D5XB 1YS7A 1IN5A 1VTNC 1ZG1A 2Z99A 1ZGJA 4YIIA 2EFWA 2KIUA 2UZKA 2ZNZA 4IRIA 5D4SA 1XB4A 2V79A 4XLNF 2ETHA 2QQBA 3GFLA 3MFKA 4ENKA 4O3MA 5AIPA 1GHCA 2HZTA 2QQAA 3RKWA 4UXNA 3O6BB 1XD7A 1EH7A 3LA7A 2DPDA 2CSOA 1R1TA 2GA1A 5H6RA 4MTDA 1OYWA 5HS8A 3L9FA 3KZZA 1HQCA 5BQTA 1LDJA 4EV0A 3RPQA 4LLLA 1P4AA 2DQRA 1I1GA 4M71A 3GWZA 1U3EM 1QPMA 2UXXA 3KP5A 3E6BA 3R0AA 1JGSA 3FXRA 3LA2A 5A2QZ 4N0BA 1UFMA 1PDNC 2WC2A 4GGGA 1KU9A 1LQ1A 1I27A 1BM9A 2CYYA 2MH9A 1R23A 3FM3A 5JFRA 1B4AA 2DO7A 1FC3A 2J5OA 2XAFA 4UVAA 3HIFA 1ZLJA 1OPCA 3E6MA 3ZMZA 3HSEA 1S29A 3HRSA 4HF0A 3U1DA 2PEXA 3L00A 1W7PB 1TTYA 3I53A 1IXRC 1XSXA 3I59A 3TOBA 4XBFA 4U7DA 3F6OA 3QPTA 5HOOA 3D0SA 2CO5A 2DAOA 1WRJA 3F3XA 1HBXG 1J75A 5E1WA 1AWCA 3T1BA 3WTTC 5L3CA 3E97A 3IKVA 3HSRA 3SHFA 4Y17A 4RB3C 1O57A 4LD5A 3FZVA 3C3WA 4WXHA 1GXPA 2FOKA 3JTHA 3FX3A 2STTA 5IT9K 3VOEA 1F9NA 2A61A 1YO5C 4U88A 4HX8A 2Q0OA 1TNTA 3E6CC 2HOEA 1FX7A 2O8XA 1MGTA 3B02A 5L3EA 4EM2A 1G3SA 2H6BA 4IVNA 1STZA 4KYWA 2K4BA 2QENA 3F22A 4FT8A 1O7LA 2A07F 1B6AA 1K79A 1B1BA 4RGXA 3WU1B 1D5VA 4WXDA 2A6HF 3RYRA 1FNNA 3P9KA 1ZLKA 2XHKA 2EFQA 2KJCA 4D0PA 2D2WA 4A0YA 3ISPA 4CXFA 2FSWA 3VFZA 4WX9A 1IUYA 2EWNA 4A0XA 2VOOA 3DEUA 4P9UA 1R1VA 2FNPA 2M87A 2FF4A 2DK5A 2BGCA 3TOAA 4LG0B
chains in the Genus database with same CATH superfamily
1FP2A 2K9MA 3LSGA 2HYGD 5D6FA 2JK3A 5E18F 5C3EJ 3T8TA 2O03A 3BR5A 2PBIA 3LQQA 1F43A 3KE2A 2BZTA 2YR2A 2H09A 1O3RA 2M0CA 2CQNA 3WTZA 2FU4A 3L7WA 3BWGA 3OS1A 5ILVA 2NYXA 2YU3A 5D5VB 3KZYA 2WAFA 1OLTA 1MDMA 1A35A 2LR8A 4HRIA 3KCCA 1IXSB 3PQKA 4II2A 4BS9A 4BQQA 4C9YA 4CO8A 1K4SA 1LPQA 2QBYA 4HX7A 3CCVI 2KIQA 1GLNA 3KIOA 3KLNA 4CCMA 1XGSA 2TDXA 5CQGA 4FX4A 3S2WA 2MH2A 3IH2A 4ZYEA 2HS5A 1FP1D 5DEQA 5IT9Z 2ZFUA 1E3PA 2JA2A 3J7AY 1HSJA 1XN7A 2DDAA 5EZGA 5D8LB 5LGUA 4LLNA 5E3MA 5F0FA 1U5TA 5CQEA 2BYVE 2F5FA 4BE1A 1I3QJ 2CS3A 2CRGA 2VE9A 2V6CA 1XSVA 2GQQA 3IHUA 4BXXJ 1ON2A 4BBSJ 4EVIA 1QZEA 4LG3A 3K69A 4LLGF 4JK1X 3IWFA 4U0WA 4MLOA 1HW5A 4DJAA 1HDDC 1WFXA 3DWLE 3QYBA 5KHDA 3ULQB 1HA8A 3V7RA 1MMGA 3W3CA 1KQ0A 1V55H 2DJIA 2EV5A 1YRNA 2OJED 3CLOA 2FMLA 3JRFA 5E8GA 2HFHA 2XB0X 5HLIA 1DGWY 5DD4A 5J40A 1B8IB 3COAC 2HPIA 4XKVA 3ZMUA 1XDUA 4IOAF 2CQXA 5D4RA 5H6QA 2K9QA 4PGHA 2PMZN 4BKXA 3KZIC 1QA6A 3RCOA 2P5LC 2QEXI 4OWRB 3RZOJ 4AIHA 2ZSHB 3A2KA 1LDDA 1XDSA 1VI0A 1BC8C 2HI3A 3H3ZA 1TW3A 1WPKA 4A5MA 1G59A 2IS4A 3IH4A 2BVMA 3LAPA 4RB0A 2UUZA 2X85A 5TJJA 4GRIA 1YJWI 1K78B 4PGGA 2W48A 2W24A 2FQ4A 2ZB9A 5HS9A 2E2HJ 1T2KA 1R22A 3NQOA 4FQGA 3L2VA 1D8JA 2VJIA 3OS2A 4KN4X 4RGSA 2DA5A 4EGYA 4TV7A 1TC3C 1ZN2A 4ZYHA 2FXAA 5JI6A 4HX4A 1X1DA 3HRMA 1I3AA 1PYVA 2A6EF 3LSRA 3IL2A 4OIRF 2E2JJ 1UG2A 3KEQA 2HQAA 4RS8A 1YLFA 3SZPA 3DTEA 2JVGA 2M30A 4KN7X 3V8KA 1K7AA 4ZYAA 3ECHA 3VYRB 3ZMTA 3NARA 3H92A 1FMWA 4F91B 2FOWA 3JREA 1F4KA 3AG3H 3S2HJ 2IGOA 1MD0A 2P4WA 1MH3A 3G1MA 2XSDC 1BR4A 4KMUX 2ISYA 2HZDA 3LMMA 4B43A 4D7MA 3L2UA 3KLOA 1I39A 3MKLA 1LFUP 4M9SA 3JSOA 3LQRA 2Y9YA 1U8RA 2Y2ZA 4OMZA 2OF7A 1L0OC 2P5KA 2RDPA 2IP2A 2HKXA 3P9IA 1USSA 1Z0XA 1AOYA 2JUCA 2CG4A 4B3AA 2L7KA 4X0GA 3V8LA 3V7SA 4PJJA 3WGHA 1IN7A 1G3YA 2HYJA 3BCBA 3FMSA 2DT6A 1JJ8C 1WWXA 4HV5A 4JYKA 1F36A 3Q0VA 1MZBA 2PN6A 1ITYA 5J8CA 2ICWG 3K4LA 1EKEA 2XB5A 3KP6A 1BIBA 3L2RA 2DDBA 4AU7A 1A5JA 1HW1A 1LNWA 2VASA 2X6OA 5F0CA 3QOEA 2RAEA 2H27A 4QPOA 3KP7A 1RPWA 2OQRA 2XRNA 4E6KG 2YX4A 2PI0A 4Q47A 2GM4A 5GAGJ 2WTEA 2IW5A 3CCSI 3Q3SA 2Y0MA 4L5IA 3V4GA 1W5CC 3ML6A 3WTYC 2ZO4A 5DV5A 5EDNA 3HUGB 4BUPA 2W82A 3BR2A 3MWMA 4KMFA 3HC7A 3N05A 4G12A 2F2EA 1FEXA 1D8KA 1ZAOA 3WTSC 4HOBA 4CCNA 2PJPA 2WB1A 2XVCA 1P4WA 2JMWA 4HLXA 4KIBA 2XGCA 3O2PE 4NC7A 4E7JA 1QO0D 1TZLA 2XPUA 2QZ8A 4IXAA 1OCPA 1U5TC 2VQCA 4C2UA 5FKMA 4OOIA 3LWFA 4JX4A 2W85A 2M34A 3ZQCA 1W0TA 1SVMA 3A01B 2ECCA 3SDGA 3HDDA 4N4OB 4M72A 3I58A 4HQEA 2EBIA 2OQGA 4DZPA 2VBZA 2MSYA 2JQ7A 2R7SA 1MMAA 2CV1A 2JA6J 2EIKH 2LKPA 1BI2A 1BIAA 4YRVA 3ELKA 4IHTA 1QZZA 3IKTA 4XKCA 3B6CA 3D5SC 3TO7A 2GAUA 4IF4A 3QU3A 3MQ0A 4HSRA 5EYRA 1FIPA 1NH3A 1T6SA 2XAHA 3PUBA 2XUBA 3H9JA 2R7ZJ 1T39A 3CMMA 1TT0A 3DBRB 4OAZA 3L2CA 3K70C 1M1EB 3MMYB 3M8JA 1A6QA 5AIQA 3M07A 3VDXA 1T33A 2XRLA 3G6EI 1XMAA 2RGVA 3DTKA 2P5VA 3SXYA 4M9ZA 3R61A 3DEWA 1WKMA 1YW8A 3DBLB 4GCVA 4CCLA 3M8EA 3SEZA 2L3DA 3WHBA 2NVUB 4Y52J 3DCFA 3QODA 2VXDA 3RIRA 5TRDA 1OCOH 3ZMDA 3BCAA 2DODA 2EQRA 1FT9A 3T8RA 1VZ0A 3H35A 5HDGA 4S04A 2LMDA 4DBQA 2COMA 2KIFA 2OBPA 2XAUA 4UNOA 1Z6TA 5EGOB 5BNGA 4JOMA 2F4MB 3PO2J 4B3XA 1Z77A 4LMYA 3KYDB 4YFXF 2VJJA 2P6SA 3K0LA 1P7JA 3C2BA 1YS6A 4A3FJ 4A6EA 2AS5F 1BOBA 4BGDA 3IRRA 1BW5A 2FBKA 1JKPC 3S1NJ 2B7EA 1OMIA 4G94A 2AQFA 2NNYA 3S1MJ 2W7NA 4ESJA 2ACJA 1MMNA 3BROA 4DZJA 4UVCA 3NRVA 1YJ9I 2KHMA 4BXFA 4CUGA 3C18A 3BT9A 3MZ8A 2QWWA 1VQ4I 2HWVA 3L2WA 4RMNA 2MABA 2NOGA 3BPVA 1FWZA 4XOPA 4NDLA 1EJ9A 2EZHA 3ZPLA 5M5XJ 1O3TA 3GTGJ 3S16J 4B48A 1H0MA 1P4XA 3ZXSA 1P9QC 4YFKF 4I98B 5CVJA 3MKZA 1BI1A 3OV8A 1ZTRA 2XGEA 3KETA 4PSWA 4ON0A 1RUOA 1CGPA 3PSFA 5E20A 2CQKA 2HKOA 5CYVA 3GUDA 2M7AA 1LFBA 1LUJB 3ASOH 1JTXA 4BY1J 1WJEA 1OKRA 4ZZDA 3V8JA 5E1ZB 2DW4A 1V3FA 2MLKA 2ZXJA 2YPRA 5BPDA 1X19A 4P9FA 2R92J 4HA8A 2IVMA 2EZIA 4B4CA 1BI3A 1EH6A 3V42A 2HOAA 1JJ6C 1MNEA 1KONA 2A6TA 2ZXHA 1LB2A 1DP7P 2H1LA 4MNUA 3ECOA 2ZMEB 1G3TA 3TEDA 3FXMA 2R93J 5FLMJ 2VKHA 5FGMA 1YQAA 1ORKA 3SQNA 2DMUA 2EZKA 5E1XA 5DDGA 3IC7A 4A5NA 4A3GJ 3CCMI 1FTZA 2HR3A 2BV6A 1U0JA 1KGSA 2P8TA 2C6YA 3GLXA 2DA7A 1XGMA 2BBYA 2VKEA 3MN2A 2PMZA 4P1WA 4XLHA 5J1YA 4PK4A 2VT2A 3SZGA 3P7NA 2QQ8A 5ICGA 2CUZA 2M7BA 2JPCA 3ERED 1Y0UA 1O3SA 1OCTC 1ZRCA 3E1SA 2I10A 4IHWA 1AKHB 1Y8QB 5EF6A 2ZKZA 1YFHA 3DFGA 3OYHA 2LTPA 2CGPA 5DD8A 3FXJA 3PFIA 1IN4A 3REOA 1BC7C 1JKQC 1Q1HA 3J80K 1PJRA 3BTCA 3TO6A 2FD5A 4HBLA 2XV4S 1G6NA 1E3OC 2WAEA 1D5YA 2KISA 2HEOA 4OU0A 3TW6A 2Q2EA 1MKMA 1TWCJ 1WHUA 2KT0A 3DPLC 5LBQA 2AHQA 4R1HA 3OY9A 1NG7A 3I4NJ 1V4RA 3Q9SA 2R7OA 2F4OB 2GXGA 1HKSA 3N4MA 3DV8A 3BR0A 4MEYF 5HDKA 2F6CA 1G8XA 3GTJJ 2F5DA 2WBMA 2YSRA 3PSIA 2ZFWA 2V1NA 2QCOA 2F5VA 1JUPA 1IDYA 3JRDA 3JRBA 2QQ9A 3CUOA 1FBQA 2DBBA 1CQTA 2V1DA 5ILUA 3BG5A 4NQWB 2L9RA 4Z2YA 5LGNA 3I56I 5FLXK 3KP2A 2MBFA 1UHWA 4K2EA 2A3SA 1ETXA 2BW3B 3H5NA 2GOXB 1FSEA 3QRFF 3M9AA 3BJ6A 1Z67A 1B72A 3WG9A 4YIRX 2EB7A 4I02A 1XG1A 1ZRFA 3B73A 4XN3A 1FYMA 2R7RA 3RKYA 1HDPA 2E7XA 2XAQA 1XMXA 4MEXF 4LK1F 4CDGA 1CF7B 3RPUD 3HOTA 1TW2A 2HDDA 3HOXJ 3PQJA 1SANA 4WF2A 1Y39A 4HF1A 1TP4A 4AWXB 3I0TA 4BH9A 2EPFA 4IOCF 4LK0F 1YIJI 2V1XA 3AG1H 3HOWJ 5K5OA 2L01A 1Z3XA 2OD5A 3GCMA 2X0LA 1LVKA 2JSCA 2L0KA 4DW6A 2B9SA 1GVJA 1BN5A 2L5QA 2W25A 5TISC 1X1CA 4EJOA 1BL0A 2DMNA 3JSPA 4KICA 3CDLA 1R36A 2FRHA 4BQOA 1B9NA 1FSHA 1X58A 3IRQA 5DCMB 2LG4A 2VBXA 2Z2SB 2LC2A 1SD7A 2B63J 3DBHB 3WU0A 1QHHD 4UY8I 2VPRA 4QSHA 4M3FA 1RIOH 4RGUA 4D9JA 3F21A 5L3FA 3K4KA 4RGRA 5E3LA 2WAQA 2VC0A 2PFBA 2XGXA 2R4GA 1X1PA 2BY3A 2Z16A 3BJAA 3NEUA 1OFCX 4BHBA 3I54A 4NUBA 2H8WA 2IPQX 2BXZA 3BG7A 4H0EA 1TQPA 3BG6A 2IRFG 5DM6F 4XKBA 1ACIA 2P6TA 2R7XA 3GO5A 4M3DA 3S93A 3ERMA 3J80Z 2KLOA 4MHGA 2DMPA 1RR8C 5D6EA 4HDVA 4MO7A 5IP7J 1Y8RB 2HYFA 4MFDA 4NC6A 4XR6A 4BDZA 2R7DA 4EJWA 4U0YA 4P96A 3IP4B 1KQ9A 4KNYA 1J59A 3SZTA 3EPZA 1VQ9I 3WG7H 3CC4I 1HW2A 1LE8B 2M45A 3BR3A 3GEZA 4Y7NJ 3CUQB 4LIVA 1W7PA 2KZGA 1AA7A 2CW0F 5KAFC 3D1NI 4XSZF 4OIQF 4BHPA 1HKQA 5FROA 3WTXC 3WTVC 3DF8A 1D1BA 2EINH 2W1OA 3I5UA 4AC0A 4RAZA 5B5EC 3WGIA 5IP6A 3F8FA 2E5ZA 2VONA 4HSTA 1SVOA 3C1DA 2X1CA 1TQIA 5FLXZ 1H89C 2X9DA 1DU6A 4EEFG 4N4NB 4W97A 1WI9A 3FDYA 1SAXA 5J47A 2K9SA 1NTCA 3JTGA 2H94A 1R5HA 3HTUA 5F6FA 5FD5A 4C30A 4DYRA 1APLC 1PP8F 4JX6A 4AYBN 2VL8A 4C3JJ 4KA4A 5K5QA 3KP4A 2HQRA 1I6HJ 4FHTA 4WXCA 4HF2A 2HXOA 4M6YA 2LBFB 3ZQFA 5CVIA 5IT3A 4LITA 2QSHX 4UUSA 1YW9A 4M9XA 5DS9A 1ZG5A 2PJRA 2VI6A 1MIJA 4HLYA 4AIJA 4EJTA 3GYHX 2NS0A 3QWLA 2HTJA 3F9KA 3OIPA 1NK2P 1LEBA 3I64A 2A5WA 4EM1A 3FHZA 2EFOA 1RKTA 1V54H 1D1AA 4U0VA 4XRSA 1JHFA 1X1BA 1VQPI 3OYCA 1KYZA 3GVAA 1X1AA 3HOVJ 2BXYA 1W4MA 3BPXA 3QP6A 3ZQQA 1IGNA 1RETA 4PSXA 3A4CA 3A0HC 3HEFA 5GAHJ 2R7WA 5JHUA 1VQNI 4IPAA 4A12A 2A69F 3FISA 2WV1A 4ZYGA 3GFJA 3LSJA 3RTRA 2RVCA 3F8BA 3PFYA 3ZCOA 3GTPJ 3RKXA 1H9TA 2ISZA 4F7ZA 3M1CA 3RQ4A 2LREA 1ETOA 2HGCA 3LFKA 4YIFA 2QSGX 3BTLA 3FXOA 3MEXA 4LIUA 4ZDPA 3CC2I 4EJVA 4M6VA 2DOFA 2LY1A 3ABMH 4RB1A 2EFPA 3CCUI 1REPC 1IDZA 1S3JA 4XOTA 2E1MC 3VODA 3T0YA 3DU5A 3S17J 2CUJA 1MBGA 4ZYDA 3ZOBA 4EM0B 2QSFX 4D7NA 4I0AA 4CA0A 4UB6C 4UUTA 4XORA 5D5WB 4L5EA 1Q1VA 1QGPA 2G0EA 3F8MA 4CYCA 4GFBA 2ME0A 4G6DA 3JAMK 1WJDA 2O9LA 2E60A 4RBOA 2R5YA 5M5WJ 1O7FA 4MTEA 3RZDJ 4ENMA 3PIPF 2K4JA 3RJPA 3E5UA 3H9GA 1J7KA 2L54A 3TO9A 3G4SI 1Z3YA 5J6XA 3GTLJ 2H8RA 4LG0A 3K4BA 1VQLI 3OYGA 2NNNA 6PAXA 2F5CA 3TKYA 4IJAA 4PDKA 1Y1VJ 4MIMA 5KVRA 2MC3A 5KNLA 2Y9ZA 4XRFA 5K5RA 1D1CA 3S3MA 1ZELA 5LRRA 3I4MJ 2WADA 3H9QA 3EYIA 3HGYA 1IXCA 2BOLA 1G4DA 1QBJA 1WI3A 2ESNA 3WU2C 5GTIC 4FTHA 5J1UA 4BACA 2Y69H 4JBAA 1WSUA 3BC8A 3PNTA 5EEHA 5CVUA 3FK6A 3BLYA 4H4KC 4N9IA 3ZQIA 1EH8A 1TL8A 1RUNA 3OSFA 1SFKA 3CD6I 1MMDA 3G1LA 3QP5A 1TBXA 1VF9A 3PIOF 1IN6A 4ENNA 2LKXA 2VQHA 1JT0A 1TNSA 4XL9A 1FYKA 4HNTA 1ZRDA 2O7OA 2STWA 2XASA 1BBYA 2HPMA 4F3QA 5HNFA 3LSPA 1U8BA 5EZHA 2KL4A 1FJLA 3HL2A 5K7FA 3AL0C 4L9NA 4I6ZA 2P7CB 5C4JJ 4RM3A 3CC7I 4MQ9F 4EGZA 1KQ8A 2JUGA 4FX0A 2ZXWH 2J5PA 2LD5A 1TQMA 1WQ2A 1K61A 5GAEJ 1BI0A 2HNHA 4LB5A 1IO2A 1EV7A 4UB8C 3OYJA 1K4TA 2DMQA 2E35A 2HDWA 4XRSG 1AHDP 1WJBA 1IV6A 3FMRA 1HCRA 3VSKA 4X6AJ 1D0YA 5M5YJ 4Y3OA 5M3MJ 3MD2A 4ZH4F 3QQAA 2E2IJ 1DUXC 3R0JA 2EK5A 4Q4ZF 1T38A 4IEJA 1Y1WJ 5J8FA 2VB6A 4L9JA 2Z9OA 3CCRI 2HTSA 3CO6C 5K7HA 1B8IA 2O6GE 4S05A 4OMYA 1QNTA 4IL6C 5BMZA 4BEHA 1NHAA 3LSIA 2UXNA 1R9TJ 3CCJI 5ILSA 1ETQA 2R5ZB 2A68F 1BR2A 1OJLA 4RB2C 1YIOA 1ETKA 5B3SH 3OYMA 3OYIA 5K1YA 2W00A 3N97A 2NRAC 3FM5A 1S9HA 3K9TA 4ZZLA 3TMOA 1K78A 1ZK8A 3G71I 4L18B 5LLQA 1BOAA 5JLXA 2K3PA 4CSWA 2TCTA 2AXLA 3F8CA 4FCYA 5L3BA 2YS9A 3RPUA 5KCMA 1PUEE 3TDZC 3ABTA 1JTYA 4IHSA 3BQYA 1FBSA 1OYIA 2QKMB 3IV5A 4ZJZA 1L3LA 1JGGA 1JUSA 2XAGA 5IYCJ 3K7AJ 4O6JA 4GO1A 3MKWB 4GYGA 3HKZN 1Y0NA 3ZQLA 3VYTB 1TWHJ 4JX5A 3TQNA 3GXOA 2KFDA 1P6RA 5DTDA 2DOEA 2PMHA 5LHHA 4ESFA 1IG7A 4QTRA 4U87A 1QQIA 4E7KA 2ZNYA 1QPIA 2DCEA 3ASNH 4ANJA 2KQRA 3IH3A 1WVRA 1IN8A 4ZTFA 2LNBA 2Q8KA 5IPAA 4BXUA 4E7HA 3VEPA 4O5VA 3RYPA 3MVPA 4ABZA 2XKOA 3FXUA 2FQ3A 4HEA2 3HHHA 4G8XA 1IJWC 2YX7A 2BY0A 1OYYA 1R4MB 4UV9A 4XICA 4QLCU 4UUVA 2FA5A 1ZREA 4IX7A 4QIWN 3VYUB 3ZQHA 3OYEA 4I2OA 1XCVA 5F08A 3MZYA 4XONA 2LH9A 3OYDA 2BY1A 1RZ4A 2ELKA 2O8KA 4NB5A 2KDOA 4RAYA 4XRMA 2VQGA 4A69C 4XLEA 3GFIA 1FOKA 1VQ5I 2K9LA 4UV8A 4UHTA 2Z5UA 2EIMH 2W57A 2DOAA 4BY7J 5TGTA 3AAFA 4A6DA 4JQFA 4BE2A 2HQ5A 5DCFA 1GVDA 5FD6A 1MSFC 3RQIA 1UELB 4CGZA 1ZGWA 4A3EJ 2L7MP 2RNJA 3SEQA 4M3BA 1YE9A 1FBUA 3E3VA 1PUFA 4I76A 1DPRA 5L3GA 4BYYA 2YUSA 3H0GJ 2IS6A 2VODA 4RAFA 4XMYA 5IOYA 1UHMA 4GYIA 2XROA 2XKPA 2MGQA 1UZCA 2JTVA 2TRTA 1Z1DA 5ICCA 2WA0A 4LB6B 5DYMA 3J7ZI 2OCEA 1K6OA 2OC6A 3FHNA 4D1QA 4DYCA 5K7ZA 3D5RC 3DPTA 1YG2A 2BE5F 3HUGA 4AYBA 3ZMVA 1R71A 2CWEA 3OIQA 2LY9A 1TLHB 2A5YB 5DUIA 4AUXA 2LY2A 1S7AA 3E6DA 2QLZA 2XSJC 1ZARA 2I5UA 2A05A 2M5WA 3M4OJ 1T98A 3K4MA 1E0EA 1ENHA 1C0WA 2MW8A 3BZCA 1A04A 1R1UA 3K10A 5CLSA 2WY7Q 4M3GA 3CZ6A 1F5TA 2LF8A 3A01A 2DJNA 5HDNA 2ID6A 2X6WA 3F8NA 1WJ5A 2K02A 2W4SA 3I4PA 5C4XJ 5M3FJ 1P92A 3Q5FA 2M3AA 3K2AA 2RC4A 2IA2A 2Q2EB 2FBIA 3WODF 3WE2A 1Y6IA 4CZZA 2ECBA 4FETA 4E7ZA 2CFXA 3UR3C 3RI4A 1BW6A 3DKYA 2CH0A 2DT5A 1KZHA 2DFIA 3VYSB 1WJFA 2QUFA 5FO5A 2VOPA 1IF1A 4FASD 2IEKA 2HDCA 1XGNA 3GW2A 1RC9A 2JJ7A 4N9HA 2L02A 1S7EA 3HYIA 3JW4A 1ONVA 1YOVB 3OWTA 3GZ5A 1ZH5A 4I09A 1FYLA 4G6QA 3S15J 1R4NB 3K70D 5L3DA 5CVVA 3GFMA 1VQKI 2WWYA 4XKWA 2HVSA 3VWBA 4MQVA 2RREA 4RLQA 2VBWA 4KUMA 1PP7U 2CW8A 2O5RA 4ESBA 3LSTA 5FFZA 2O3FA 2QYOA 3I59B 1LVAA 1SD4A 2AXTC 4OINF 2L4AA 4A3MJ 2OPTA 3BTIA 4AVZA 2L4MA 2WV0A 1ETYA 3OS0A 4XLAA 2FNAA 1RNLA 2V9KA 4EATA 3K4NA 5B66C 5BOXA 2PG4A 3HXLA 5EGOA 2JA7J 4EMSA 1P7IA 2KRFA 1HLVA 4PJ0C 3JRAA 2HOTA 3DPUA 1S8NA 2X4HA 1IZ1A 1MJAA 5FB2A 2R3SA 4BQAA 2PLYA 1XPXA 5H2FC 2V6EA 2VQLA 3WGGA 3QPSA 4KT5C 3GF2A 4LFUA 4E7SA 2JA5J 3O3KA 5JR3A 2Z33A 4II3A 2EA2A 1XS9A 1ERDA 3TL4X 2XIGA 4FE7A 4V19K 3IAS2 1KU2A 4KJZA 2GWRA 2BEOA 2AQEA 3W6KB 4BHCA 2K27A 2DFHA 2L7ZA 2IT0A 1QVTA 3T5XA 1E17A 3KFWX 3J7AO 2ZJQF 3HRUA 1PVEA 3HHGA 5JLWA 3OOUA 2UWMA 3EUAA 3R4KA 3OYKA 4RLFA 3ZRGA 3TGNA 2FUG2 5J4YA 1N77A 3JR9A 2NOJB 2JPBA 2XF7A 2ZBKA 2R7TA 2ZXIA 4G7ZF 4BU2A 3CMAI 1I6XA 3FBIB 2OCCH 3MKYB 1ZR2A 3BZKA 3QAHA 4E4HA 1VQMI 4YG2F 2M2EA 2E1NA 2XDVA 5FKKA 5ICFA 1Z05A 2CUFA 2P7VB 4YFNF 1DDNA 5JVGF 1NG6A 3J7YJ 4EQQA 1B9MA 2G9WA 2ELJA 3OOPA 4L5JA 2JRMA 2LYCA 2OU2A 4F55A 1IW7F 4Y13A 4KIGA 2CFOA 2IA0A 3QYFA 4PCQA 3U2RA 4DBRA 3HPGA 4B09A 4PFOA 4HW0A 3A0BC 4ENJA 2E7WA 1KU3A 1GV2A 2ZMEA 3AG4H 3TDUC 5FJ8J 4G7HF 2DMTA 4IHXA 1J0RA 2E1OA 2BHZA 2GZWA 3HB9A 5HS7A 3FMQA 1Z7LA 1D3YA 1RKWA 3G73A 2OV7A 1NK3P 3QU6A 2EFNA 1ZHFA 1Z7UA 2K40A 3L1PA 1QHGA 4WCGA 3U9GA 2D1HA 1UHSA 3OMYA 2K9NA 4C2MJ 1HSTA 4IZZA 4XIDA 3SFIA 1MNDA 2EV6A 2LLKA 2KP6A 3R60A 5CVRA 2KPMA 3V7CA 2OA4A 1R00A 3BZ6A 5LEJA 1AKHA 3HPHA 3PNVA 3HTSB 3HOZJ 4JP0A 1MBKA 3J81K 2VXZA 4ZTJA 2X1EA 3ZMSA 1T08B 1XC5A 2G7HA 2V4JC 3H0DA 1A31A 4IQJA 2V1UA 2IXSA 3K4CA 4PFPA 1D0XA 1HKTA 4F52A 4ZDLA 2DA4A 2GOMA 5F64A 5B1AH 2IJLA 1IRZA 1W5SA 5KK1A 3F23A 4IO9F 3K2ZA 2PJRB 1QZYA 1RRJA 1MDMB 2BY2A 4HQMA 5FLVA 4AM3A 2EZLA 1FPQA 3S32A 5IY5H 2K7LA 1TWFJ 2JRTA 3CO7C 3P5JA 2QBYB 3HKZA 1J09A 1QRYA 4CCJA 4OIOF 1ZYRF 5DUKA 4HV6A 3CESA 1IC8A 3K6GA 5ED4A 2VPLA 1SMTA 1UB9A 1FMVA 5EJCA 5ERIA 1SEUA 1S72I 2DU9A 2HOSA 4I7HA 4KFCA 4AVPA 2ME6A 1U5TB 2DI3A 5IYBJ 4NQWA 4M73A 1VQ6I 3U21A 3EUHA 2ADUA 1ETWA 1YYVA 2LP0A 2X6YA 3RDIA 2BW3A 5F1RA 4CH7A 2UV1A 3CDIA 4I01A 4QWQA 2MLGA 3PNYA 1X3WB 1IRGA 1VNDA 4E70A 1R6RA 1FLIA 1MBFA 3BG3A 2KJBA 3CF2A 2QF7A 3TW7A 1WH5A 1RESA 3LSMA 2RV8A 1YRNB 2M8EA 2G7UA 3Q0UA 4CZCA 1XSDA 2B0LA 1CF7A 1LDKB 2F5EA 3CP2A 1XCBA 1GDTA 1WCMJ 4ZDOA 2BHYA 4I99C 5CJ9A 1SD6A 3GZNB 3SYTA 4DQ2A 1FIAA 2NAZA 2DQLA 3EQLF 4GDFA 2HVQA 5D8KB 5HODA 3NWTA 3NWSA 5HLGA 3QOPA 2Y75A 2VUMJ 2DFFA 3DQVC 1F1ZA 3EDPA 3WTUC 3AG2H 2DPUA 4NNJA 4X1EA 2VBYA 1DP3A 1LJ9A 5EEGA 3ZN0A 4A3JJ 4HG2A 2QVOA 3KX2A 2DTRA 2RNGA 2JWTA 1LEAA 3Q9VA 5LEKA 2RQQA 2VJ4A 5DCMA 1GXQA 2DYSH 3LL7A 5LRSA 2R0QC 1T56A 3ZQGA 4PZJA 3HOYJ 1MJ9A 3FKJA 4KIFA 2FEZA 5EG0A 1VQ8I 4DYQA 1SFXA 1R58A 5CKTA 3DP7A 3BR1A 1KA8A 1XGOA 3HSFA 3KEOA 4J01A 1VFCA 3R6SA 2GBYA 1W36D 2XPWA 1OR7A 2M0MA 3J81Z 1MBJA 3C7JA 2RN7A 5F27A 1IRXA 3ZN1A 3I55I 2VKVA 5FRMA 3E5XA 5IP9J 2M4KA 3LAJA 2OAZA 3DLLF 3E7LA 2DK8A 2VKDA 2HXIA 3WE3A 2Y31A 3BJOA 3GX4X 3DEEA 1X4OA 2DA2A 3EETA 2VT3A 1Y56A 1W1WE 4E7LA 4CCOA 4CYDA 4I0BA 2ZMEC 3MCZA 3OYBA 4P5OA 1J9IA 1FOXA 3X2QH 3ZQ7A 3PL8A 5F0HA 1MBHA 2M1BA 3MAJA 4L9VA 2EIJH 5GTHC 2GXBA 1Z9CA 1QU3A 1MJBA 1X3ZB 5LHIA 3CJNA 4XLPF 5E17F 1LE8A 5D5UB 4LJZF 3ABLH 1ULYA 4EJUA 4B8XA 3CUQA 1T8IA 2XAJA 3BP8A 4BAYA 2KMUA 2F4IA 4M3EA 2IGMA 2R7FA 2X48A 1JXSA 2KZVA 2JN6A 3AFHA 2R7QA 4HYEA 3SJMA 3W6VA 4NHJA 2FX0A 2Y0SN 1ETVA 5FFXA 1USTA 2IA1A 3S3OA 2DA6A 2MFZA 1EF4A 3IWZA 4DIQA 5LGTA 1H8AC 5IYDJ 2D5VA 4FE4A 2OZUA 2EH3A 3WTWC 3FKIJ 1SC7A 4DNCA 3DKWA 4BEHB 5AONA 1IRFA 1SFUA 3K1PA 2IGNA 2DYRH 1I5ZA 3MZHA 2AO9A 3VB2A 1V5EA 1YJNI 3ABKH 5J1RA 2MA3A 3OYFA 1J5YA 1XMKA 3LA3A 1LFPA 2M9HA 5BS6A 1BJAA 2LBFA 5FKLA 1S5LC 1YITI 3CMYA 1E3HA 2IGKA 4OAYA 4HNVA 2GIVA 1V5FA 1UG0A 4ITVA 2PQ8A 1FY7A 3K1MA 1XX5A 2X6XA 3P9CA 2ZJPF 1DGRM 1ODDA 3S1RJ 1RI7A 3M8FA 1IUFA 3OYLA 1I1SA 4LGWA 2NS8A 2Z1DA 4Y15A 3GLLA 3CJQB 3KYLA 2RKHA 2LFBA 2P0WA 4HZFA 4L0ZB 1W0UA 2EJRA 1IV8A 4BBRJ 1KYWA 3EYYA 3C2HA 2CMPA 3ROUA 4DOZA 3EUHC 1H9GA 2LOOA 1R49A 2DA3A 3DXJF 3QYEA 5GPAA 3TP0A 4WK8F 3E5QA 4G9YA 1T95A 3FF5A 4A3DJ 1HF0A 2D1VA 1YI2I 4HAMA 3W6JB 1SFEA 2NS7A 3HRTA 3K1NA 4C3HJ 1K6YA 3HM5A 1U2WA 3CF5F 2JVHA 3BY6A 3CJTB 3HGGA 3BDDA 4GXOA 3JRGA 4A2UA 1X2MA 3BQZA 4HDUA 1U78A 3D5LA 4RDUA 3SFZA 1J2XA 3ABUA 1ZQ3P 2O61A 5J3LA 4CICA 2DLLA 1YW7A 3F6VA 2V7FA 1JE8A 1E2XA 1IAWA 4P55A 4CCKA 5HLHA 3FWEA 4UVBA 3M7GA 9ANTA 1B59A 2X1DA 4WWCA 5DM7F 5B1BH 1Z6RA 2CJJA 1WH7A 1WJAA 3F0CA 4KITB 2E34A 3DLAA 3H1CA 4R8HA 3BOQA 1S6LA 2ELHA 2IAIA 4M6XA 1O4XA 1R5ID 1YX5A 2ZSIB 3FXQA 3RKQA 4XK4A 3JAMZ 2K86A 2EV0A 4A0ZA 1W5TA 2W84A 1DPUA 4A3KJ 1FZPB 3W2VA 1PUFB 3CLQA 2Z3YA 3DU6A 3G3ZA 2DT7B 2QKLB 1U9OA 2RQPA 4NC8A 4ETSA 5F1JA 1G3WA 4KT6A 5E8IA 1OR7C 1GUUA 4XM3A 4B1RA 2LDUA 4G7OF 2ZJRF 3S1QJ 1UAAA 1UCRA 2R7VA 5LHGA 1ON1A 2CU7A 2XGDA 3VPRA 4L9TA 3W2AA 2LSOA 3H3UA 1MNMC 1S7OA 2MD0A 1YTYA 2KDZA 2MD5A 5BPIA 2L9VA 3I3LA 3JRIA 3H5RA 2CV0A 2WAQN 4M74A 2IBDA 2FMYA 2XF5A 4F92B 3B6AA 2VN2A 3OSGA 2FBHA 4DGWB 3U1KA 2HU9A 3RSNA 2D45A 1SD5A 4YEJA 3A1YA 4XNFA 1SMYF 3CJRB 3CUQC 2VE8A 2VLAA 1O3QA 1MSEC 2HVRA 4G6TB 1W7PD 1MW7A 5GPCA 4XQFA 2NVXJ 1X3UA 2LF7A 1U6GA 2H6CA 3HG9A 4Q48A 4FISA 1ZG3A 3L09A 1I50J 3KP3A 4BJ6C 3CDHA 5E3OA 5HVQC 1G2HA 4R79A 1KU7A 1UJ8A 3L2QA 4QPQA 2COBA 4PUSA 4XSXF 1X4PA 4V2GA 2QM3A 4MGRA 4A3BJ 5JVTA 3OL3A 2MG4A 1WGXA 2L2OA 2FE3A 2DA1A 1YX3A 2OZ6A 2V9VA 4BJ5C 1T0FA 2PMUA 4D5CA 2M4GA 2O0YA 2R5ZA 3UKGA 4NBQA 3H3VK 2XF6A 1P2FA 1SAUA 1JUMA 1Z21A 2HQNA 4IRHA 2EA4A 2ZJ2A 3Q0WA 3S3NA 4IQ4A 1GV5A 3F72A 5H20A 4ASNA 4RAGA 5A2QK 3LSHA 1N25A 2KRCA 4BNCA 4L0YB 2JZYA 3W2WA 4OIPF 5ICEA 1N78A 2F48A 1WZ2A 3OYAA 1ZR4A 1Z91A 2MYSA 2CV2A 4IKFA 2EILH 2E1CA 4Q5SF 3BTJA 4RA2A 2H1KA 2JT1A 1HXDA 1DU0A 3I71A 4U7BA 3GZ6A 1MMSA 4CHUA 3KPHA 2Y48A 4Z6YA 3AKZA 3CQZJ 1R7JA 3CTAA 3ZP5A 3CCQI 2R7UA 2ESHA 4BJTA 4KDPA 3VSLA 1JHHA 1ZGAA 1R5GA 2DXIA 1MBEA 2VC1A 3M1EA 5JHFA 1AU7A 2CUEA 2ZCWA 3A02A 4IRGA 2GA2A 4AIKA 1A6IA 2KIMA 3HOSA 2V26A 4V2FA 4AD9A 2KKOA 2L9SA 1TWAJ 3QPHA 5D5XB 1JI8A 1YS7A 1IN5A 4PJMA 2E71A 2WY8Q 3G1OA 1JT6A 1GT0C 1VTNC 2NVYJ 2Y30A 1ZG1A 4IHYA 2IS2A 2MC4A 2NXNB 3FBNB 2Z99A 1ZGJA 1JKRC 4YIIA 3I9V2 2EFWA 4B47A 2KIUA 1HC8A 2UZKA 2M8GX 2ZNZA 4IRIA 5D4SA 1BJZA 1XB4A 2V79A 4XLNF 2ETHA 2QQBA 3GFLA 3MFKA 4ENKA 4O3MA 4ZC3A 3LNQA 5AIPA 3GTMJ 1GHCA 2VIXA 1OCRH 2HZTA 4D5FA 2LRDA 1B72B 2QQAA 5LD2C 3RKWA 3CCEI 4UXNA 2JSPA 5FRNA 3O6BB 2XPVA 1XD7A 1EH7A 2Y0SA 3LA7A 4A3IJ 2DPDA 2CSOA 1R1TA 3M3YJ 3A03A 3TBIA 2GA1A 3S2DJ 2E1MB 5H6RA 4MTDA 1OYWA 5HS8A 3L9FA 3KZZA 4MFEA 1HQCA 5CPRB 5HLTA 5BQTA 2N8GA 1OISA 1LDJA 2VJ5A 4XLFA 1LKXA 4EV0A 2LKSA 3RPQA 4LLLA 4HNUA 1P4AA 1FOYA 5FKOA 3OR1C 4XN0A 1X2NA 5J4VA 2DQRA 2DFEA 1I1GA 4LOCA 2LVSA 4M71A 4E7IA 4A3LJ 3IUOA 3GWZA 1U3EM 3GBGA 1QPMA 3LOCA 2UXXA 3KP5A 2XC7A 3E6BA 3R0AA 5F04A 1JGSA 3FXRA 2GIZA 3LA2A 1OCZH 5A2QZ 4N0BA 1SVLA 2YU9J 3WHCA 1UFMA 3CP8A 2DN0A 3FIWA 3OYNA 1PDNC 2WC2A 3S8PA 3LSKA 4GGGA 1KU9A 1LQ1A 1I27A 2K5CA 1BM9A 1ZKGA 4BE0A 1RR7A 2CYYA 1YHQI 2MH9A 5IOZA 1R23A 2GLOA 2V9PA 1FTTA 2PX9A 3FM3A 2QGUA 2LK2A 5JFRA 1V5GA 1B4AA 4YELA 3CCYA 4AIDA 4IHVA 1JKOC 4C3IJ 1TWGJ 3PJRA 4A3CJ 2DO7A 1FC3A 2IS1A 2J5OA 3EUKL 5KAIC 3GTQJ 2XAFA 1UMQA 4UVAA 3HIFA 2QA4I 1T0FC 1ZLJA 2E19A 3DTIA 5FKNA 1OPCA 1DQUA 3E6MA 2OUMA 3ZMZA 4B44A 2E36A 3HSEA 3NAUA 3ESWB 1S29A 3HRSA 3PUFA 4Y4RA 3E0JB 4HF0A 1D0ZA 3U1DA 2PEXA 3L00A 3K4JA 1W7PB 3AL0B 1U9NA 1TTYA 2ID3A 1OQYA 1N75A 3I53A 3ONQA 2L7FP 4PJLA 4W1UA 1IXRC 1TT5B 1XSXA 3I59A 3TOBA 4XBFA 4F93B 4XLCA 1MH4A 4U7DA 1QVUA 2OTJI 3F6OA 3JCUC 4BQNA 5LFAA 3G2BA 3QPTA 5HOOA 3D0SA 2CO5A 2DAOA 2JA8J 3ZR8X 1WRJA 3F3XA 4BDYA 1HBXG 2Q1ZB 3KYCB 1J75A 5E1WA 3UNGC 1FOWA 2NVTJ 1AWCA 2X51A 3T1BA 3WTTC 3PM1A 5L3CA 2BVLA 3E97A 3IKVA 5HNHA 3HSRA 2CW7A 3SHFA 4Y17A 4HPQA 1O57A 1POGA 4RB3C 4LD5A 3O8GA 2ZC2A 3BR6A 3H5AA 3FZVA 2WB1N 5E3NA 3HJEA 3C3WA 3DKXA 4WXHA 1GXPA 3IAM2 4PJNA 4BL0B 4UUSB 3HOUJ 2FOKA 1BR1A 2CQ7A 2K3FA 2K85A 3JTHA 3FX3A 1VQ7I 2STTA 5IT9K 3QPLA 3VOEA 1F9NA 2A61A 2CQQA 3GTOJ 1YO5C 4U88A 4HX8A 2Q0OA 1SFOJ 1TNTA 4S0HB 1WJCA 5EG0B 3E6CC 2HOEA 2L9NA 3FK7A 1FX7A 4J19A 2O8XA 3OR2C 3FXKA 1MGTA 5EEAA 1W36C 3B02A 5L3EA 2KRHA 2I8DA 4EM2A 1G3SA 3HBLA 2H6BA 5GADJ 3BG9A 4IVNA 2FJ1A 2DTZA 1BA5A 2P81A 3ZGKA 5E79C 1STZA 2GXAA 4KYWA 2K4BA 3KEYA 4Y33A 2QENA 1A36A 3F22A 4FT8A 1VQOI 2E5NA 1O7LA 1XTAA 4A93J 3C2GA 2A07F 1B6AA 3H36A 1K79A 1B1BA 4RGXA 3WU1B 1OCCH 1K83J 4KISA 3PO3J 3CMEI 3GTKJ 1D5VA 4WXDA 3JRCA 2A6HF 3RYRA 1FNNA 3P9KA 2NVQJ 1ZLKA 2XHKA 2EFQA 3O8HA 4C2TA 3S14J 2KJCA 4D0PA 3JRHA 2D2WA 3FXLA 4A0YA 1H88C 3ISPA 4CXFA 2FSWA 4CYCB 4RM2A 3VFZA 3SDBA 4WX9A 3OL4A 1IUYA 2R5YB 5GP9A 1EA3A 3LFUA 2OTLI 3HZJA 2EWNA 3GMEA 3TP3A 5C44J 4A0XA 2VOOA 3DEUA 4P9UA 1R1VA 2FNPA 3OIOA 2M87A 2FF4A 1HOMA 3CCLI 2DK5A 2BGCA 3TOAA 4LG0B 4J00A
chains in the Genus database with same CATH topology
1FP2A 2HYGD 5D6FA 5E18F 3T8TA 2O03A 2PBIA 3LQQA 3KE2A 2YR2A 2H09A 1O3RA 3WTZA 2FU4A 3L7WA 3BWGA 5ILVA 2NYXA 2YU3A 5D5VB 3KZYA 1MDMA 3KCCA 1IXSB 3PQKA 4CO8A 2QBYA 4HX7A 3KLNA 1XGSA 2TDXA 4FX4A 3S2WA 2MH2A 4ZYEA 2HS5A 1FP1D 5DEQA 5IT9Z 1HSJA 1XN7A 5D8LB 4LLNA 5LGUA 1U5TA 2BYVE 2F5FA 2VE9A 2V6CA 1XSVA 2GQQA 3IHUA 1ON2A 4EVIA 3K69A 4LLGF 4JK1X 3IWFA 4U0WA 1HW5A 3ULQB 3V7RA 1KQ0A 2EV5A 3CLOA 2FMLA 5E8GA 2HFHA 5HLIA 5DD4A 3COAC 3ZMUA 1XDUA 5D4RA 5H6QA 4PGHA 2P5LC 4AIHA 1LDDA 1XDSA 1BC8C 3H3ZA 1TW3A 4A5MA 3LAPA 4RB0A 5TJJA 1K78B 4PGGA 2W24A 5HS9A 1T2KA 1R22A 3NQOA 1D8JA 4KN4X 4RGSA 4EGYA 4TV7A 1ZN2A 4ZYHA 2FXAA 5JI6A 4HX4A 3HRMA 2A6EF 3IL2A 4OIRF 3KEQA 4RS8A 1YLFA 3SZPA 2M30A 4KN7X 3V8KA 1K7AA 3ECHA 3ZMTA 3H92A 1F4KA 1MD0A 2P4WA 4KMUX 2ISYA 3KLOA 4M9SA 3JSOA 3LQRA 1U8RA 4OMZA 1L0OC 2P5KA 2RDPA 2IP2A 2HKXA 3P9IA 1USSA 1AOYA 2CG4A 3V8LA 3V7SA 3WGHA 1IN7A 1G3YA 3FMSA 1WWXA 4HV5A 1MZBA 2PN6A 5J8CA 3KP6A 1BIBA 1HW1A 1LNWA 2H27A 3KP7A 2OQRA 2XRNA 2YX4A 2PI0A 4Q47A 2WTEA 2IW5A 2Y0MA 4L5IA 3V4GA 3ML6A 3WTYC 2ZO4A 5DV5A 4KMFA 3MWMA 2F2EA 1D8KA 1ZAOA 3WTSC 4HOBA 2PJPA 2XVCA 1P4WA 4HLXA 4KIBA 3O2PE 1QO0D 2QZ8A 4IXAA 1U5TC 4OOIA 3LWFA 2W85A 4M72A 3I58A 4HQEA 2OQGA 2VBZA 2LKPA 1BI2A 1BIAA 4IHTA 3ELKA 1QZZA 3IKTA 3TO7A 2GAUA 4IF4A 3QU3A 3MQ0A 1T6SA 2XAHA 2XUBA 1T39A 3L2CA 5AIQA 1XMAA 2RGVA 3SXYA 2P5VA 4M9ZA 3R61A 1WKMA 1YW8A 4GCVA 3M8EA 2L3DA 3RIRA 5TRDA 3ZMDA 1FT9A 3T8RA 5HDGA 4S04A 2COMA 2KIFA 2OBPA 4UNOA 1Z6TA 4LMYA 4YFXF 2P6SA 3K0LA 1YS6A 4A6EA 2AS5F 3IRRA 2FBKA 1OMIA 4G94A 2NNYA 4ESJA 2ACJA 3BROA 4UVCA 3NRVA 3C18A 2QWWA 2HWVA 3BPVA 1FWZA 3ZPLA 1O3TA 1H0MA 1P4XA 4YFKF 4I98B 5CVJA 1BI1A 3OV8A 3KETA 4ON0A 1RUOA 1CGPA 5E20A 2CQKA 2HKOA 5CYVA 3GUDA 1OKRA 4ZZDA 3V8JA 5E1ZB 2DW4A 1V3FA 2MLKA 2YPRA 2ZXJA 5BPDA 4P9FA 4HA8A 2IVMA 1BI3A 1EH6A 1LB2A 1DP7P 4MNUA 3ECOA 2ZMEB 1G3TA 5FGMA 3SQNA 1YQAA 5E1XA 5DDGA 3IC7A 4A5NA 2HR3A 2BV6A 2P8TA 1KGSA 2C6YA 3GLXA 1XGMA 2BBYA 2VT2A 3P7NA 5ICGA 3ERED 2JPCA 1Y0UA 1O3SA 1ZRCA 2ZKZA 1YFHA 3DFGA 2CGPA 5DD8A 3PFIA 1IN4A 3REOA 1BC7C 1Q1HA 3J80K 3TO6A 4HBLA 2XV4S 1G6NA 2HEOA 4OU0A 2Q2EA 1MKMA 3DPLC 5LBQA 4R1HA 1V4RA 3Q9SA 2GXGA 1HKSA 3N4MA 3DV8A 4MEYF 5HDKA 2F5DA 2YSRA 2ZFWA 2QQ9A 3CUOA 1FBQA 2DBBA 2V1DA 5ILUA 4Z2YA 5LGNA 5FLXK 3KP2A 2MBFA 1UHWA 4K2EA 2A3SA 1FSEA 3QRFF 3M9AA 3BJ6A 3WG9A 2EB7A 4I02A 1ZRFA 3B73A 1FYMA 3RKYA 2E7XA 2XAQA 4MEXF 4LK1F 4CDGA 1CF7B 3HOTA 1TW2A 3PQJA 4WF2A 4HF1A 4AWXB 3I0TA 4BH9A 4LK0F 2V1XA 5K5OA 2L01A 2OD5A 2X0LA 2JSCA 1GVJA 1BN5A 2W25A 4EJOA 3JSPA 4KICA 1R36A 2FRHA 1B9NA 1FSHA 3IRQA 5DCMB 2VBXA 1SD7A 3WU0A 1RIOH 4RGUA 3F21A 5L3FA 4RGRA 2VC0A 2PFBA 2XGXA 3BJAA 3NEUA 4BHBA 3I54A 2IPQX 4H0EA 1TQPA 2IRFG 2P6TA 3GO5A 3J80Z 4MHGA 5D6EA 4HDVA 2HYFA 2R7DA 4EJWA 4U0YA 4P96A 1KQ9A 4KNYA 1J59A 3SZTA 1HW2A 2M45A 3GEZA 3CUQB 1W7PA 2CW0F 4XSZF 4OIQF 4BHPA 1HKQA 3WTXC 3WTVC 3DF8A 3I5UA 2VONA 4RAZA 3WGIA 3F8FA 3C1DA 5FLXZ 1TQIA 1WI9A 1SAXA 3JTGA 2H94A 1R5HA 3HTUA 5F6FA 5FD5A 1PP8F 4KA4A 5K5QA 3KP4A 2HQRA 4FHTA 4WXCA 4HF2A 4M6YA 5CVIA 5IT3A 1YW9A 4M9XA 1ZG5A 4HLYA 4AIJA 4EJTA 3GYHX 2NS0A 2HTJA 1LEBA 3I64A 4EM1A 3FHZA 2EFOA 4U0VA 1JHFA 1KYZA 3GVAA 1W4MA 3BPXA 3QP6A 5JHUA 4IPAA 4A12A 2A69F 4ZYGA 3GFJA 3RTRA 2RVCA 3F8BA 3RKXA 1H9TA 2ISZA 4F7ZA 2HGCA 3LFKA 4YIFA 3MEXA 4EJVA 4RB1A 2EFPA 1REPC 1S3JA 3VODA 3T0YA 4ZYDA 4EM0B 4I0AA 5D5WB 1QGPA 3F8MA 4G6DA 3JAMK 1O7FA 4MTEA 4ENMA 2K4JA 3RJPA 3E5UA 1J7KA 2L54A 3TO9A 5J6XA 4LG0A 2NNNA 6PAXA 2F5CA 3TKYA 4IJAA 4PDKA 5KVRA 2MC3A 4XRFA 5K5RA 5LRRA 3EYIA 1IXCA 1G4DA 1QBJA 2ESNA 4JBAA 1WSUA 5EEHA 5CVUA 4N9IA 1RUNA 1EH8A 3QP5A 1TBXA 1IN6A 4ENNA 1FYKA 1TNSA 1ZRDA 2STWA 2XASA 1BBYA 4L9NA 2P7CB 4MQ9F 4EGZA 1KQ8A 4FX0A 2J5PA 1TQMA 1WQ2A 1BI0A 4LB5A 1EV7A 3FMRA 4ZH4F 1DUXC 3R0JA 2EK5A 4Q4ZF 1T38A 5J8FA 4L9JA 2Z9OA 2HTSA 3CO6C 2O6GE 4S05A 4OMYA 1QNTA 5BMZA 1NHAA 2UXNA 5ILSA 2A68F 4RB2C 1YIOA 5K1YA 3N97A 2NRAC 3FM5A 3K9TA 4ZZLA 1K78A 4L18B 5LLQA 1BOAA 2AXLA 3F8CA 5L3BA 3RPUA 1PUEE 3TDZC 3ABTA 4IHSA 1FBSA 1OYIA 1L3LA 2XAGA 4O6JA 4GO1A 4GYGA 3TQNA 3GXOA 1P6RA 2PMHA 5LHHA 4ESFA 1QQIA 2ZNYA 1IN8A 2LNBA 2Q8KA 4BXUA 3VEPA 4O5VA 3RYPA 2XKOA 3FXUA 2FQ3A 3HHHA 4G8XA 2YX7A 1OYYA 4UV9A 4QLCU 4UUVA 2FA5A 1ZREA 4I2OA 1XCVA 3MZYA 1RZ4A 4NB5A 4RAYA 3GFIA 1FOKA 4UV8A 4UHTA 2Z5UA 2W57A 3AAFA 4A6DA 4JQFA 5DCFA 5FD6A 4CGZA 2RNJA 1FBUA 3E3VA 1DPRA 5L3GA 4BYYA 2VODA 1UHMA 4GYIA 2XROA 2XKPA 2JTVA 1Z1DA 5ICCA 4LB6B 5DYMA 1K6OA 3DPTA 1YG2A 2BE5F 3HUGA 3ZMVA 2CWEA 1TLHB 2A5YB 5DUIA 1S7AA 3E6DA 2QLZA 1ZARA 2M5WA 1T98A 1C0WA 1A04A 1R1UA 5CLSA 1F5TA 2LF8A 5HDNA 3F8NA 2K02A 3I4PA 1P92A 3Q5FA 2RC4A 2IA2A 2FBIA 3WODF 3WE2A 4CZZA 2CFXA 3RI4A 2DT5A 2DFIA 2QUFA 5FO5A 2VOPA 1IF1A 2HDCA 1XGNA 3GW2A 4N9HA 2L02A 3HYIA 3JW4A 1ONVA 3GZ5A 1ZH5A 4I09A 1FYLA 4G6QA 5L3DA 5CVVA 3GFMA 2WWYA 4MQVA 2VBWA 4KUMA 1PP7U 4ESBA 3LSTA 5FFZA 2O3FA 2QYOA 3I59B 1LVAA 1SD4A 4OINF 2L4AA 2L4MA 2WV0A 2FNAA 1RNLA 5BOXA 2PG4A 4EMSA 2KRFA 1S8NA 2X4HA 1IZ1A 1MJAA 5FB2A 2R3SA 4BQAA 2PLYA 3WGGA 4KT5C 3GF2A 4LFUA 3O3KA 5JR3A 2Z33A 2EA2A 2XIGA 1KU2A 3W6KB 2GWRA 2BEOA 4BHCA 2K27A 2IT0A 3T5XA 1E17A 3KFWX 3J7AO 3HRUA 3HHGA 2UWMA 3R4KA 3TGNA 2JPBA 2ZBKA 4G7ZF 1I6XA 3QAHA 4YG2F 2E1NA 5ICFA 1Z05A 2P7VB 4YFNF 1DDNA 4EQQA 1B9MA 2G9WA 3OOPA 4L5JA 2OU2A 1IW7F 4Y13A 4KIGA 2IA0A 4PCQA 3U2RA 4B09A 4HW0A 4ENJA 2E7WA 1KU3A 2ZMEA 3TDUC 4G7HF 1J0RA 2GZWA 5HS7A 3FMQA 1D3YA 3G73A 3QU6A 2EFNA 1ZHFA 1Z7UA 4WCGA 3U9GA 2D1HA 1HSTA 2EV6A 3R60A 5CVRA 3V7CA 2OA4A 1R00A 3BZ6A 5LEJA 3HTSB 3J81K 2VXZA 3ZMSA 2G7HA 2V1UA 1HKTA 5F64A 2IJLA 1W5SA 5KK1A 3F23A 3K2ZA 1QZYA 1MDMB 4HQMA 1FPQA 2K7LA 2JRTA 3CO7C 2QBYB 4OIOF 1ZYRF 5DUKA 4HV6A 5ED4A 1SMTA 1UB9A 5ERIA 2DU9A 4I7HA 4KFCA 4AVPA 1U5TB 2DI3A 4NQWA 4M73A 3EUHA 2ADUA 1YYVA 3RDIA 5F1RA 4I01A 4QWQA 2MLGA 1IRGA 4E70A 1FLIA 2KJBA 2RV8A 2M8EA 2G7UA 1XSDA 2B0LA 1CF7A 1LDKB 2F5EA 1XCBA 5CJ9A 1SD6A 4DQ2A 2NAZA 2DQLA 3EQLF 5D8KB 5HLGA 3QOPA 2Y75A 3DQVC 1F1ZA 3EDPA 3WTUC 2DPUA 2VBYA 1LJ9A 5EEGA 3ZN0A 2QVOA 2DTRA 1LEAA 3Q9VA 5LEKA 5DCMA 1GXQA 5LRSA 4PZJA 1MJ9A 4KIFA 2FEZA 1SFXA 1R58A 3DP7A 1KA8A 1XGOA 3HSFA 3KEOA 3R6SA 1OR7A 3J81Z 3C7JA 2RN7A 3ZN1A 3E5XA 3LAJA 2OAZA 2DK8A 3WE3A 3BJOA 3GX4X 3EETA 2VT3A 4CYDA 4I0BA 3MCZA 1J9IA 4P5OA 3ZQ7A 2M1BA 3MAJA 4L9VA 2GXBA 1Z9CA 1MJBA 5LHIA 3CJNA 4XLPF 5E17F 5D5UB 4LJZF 1ULYA 4EJUA 4B8XA 3CUQA 2XAJA 3BP8A 4BAYA 2R7FA 1JXSA 4NHJA 4HYEA 5FFXA 1USTA 2IA1A 3IWZA 5LGTA 2OZUA 3WTWC 4DNCA 3DKWA 5AONA 1IRFA 1SFUA 3K1PA 3MZHA 1I5ZA 3VB2A 2MA3A 1J5YA 1XMKA 3LA3A 5BS6A 1BJAA 2GIVA 2PQ8A 1FY7A 3K1MA 3P9CA 1ODDA 1RI7A 3M8FA 1I1SA 4LGWA 4Y15A 2RKHA 4L0ZB 4HZFA 2EJRA 1KYWA 3EYYA 3ROUA 1H9GA 3DXJF 4WK8F 3E5QA 4G9YA 3FF5A 2D1VA 4HAMA 3W6JB 1SFEA 3HRTA 3K1NA 1U2WA 3BY6A 3BDDA 4GXOA 4A2UA 4HDUA 1U78A 3D5LA 3SFZA 1J2XA 3ABUA 2O61A 4CICA 2DLLA 1YW7A 3F6VA 1JE8A 1E2XA 1IAWA 4P55A 5HLHA 3FWEA 4UVBA 3M7GA 1B59A 4WWCA 1Z6RA 4R8HA 3BOQA 1S6LA 2ELHA 4M6XA 3FXQA 3JAMZ 2K86A 2EV0A 4A0ZA 1W5TA 2W84A 1DPUA 1FZPB 2Z3YA 3G3ZA 2RQPA 4ETSA 1G3WA 5E8IA 2LDUA 4G7OF 1UCRA 5LHGA 1ON1A 4L9TA 2LSOA 3H3UA 1S7OA 1YTYA 2MD5A 5BPIA 4M74A 2FMYA 2VN2A 2FBHA 2D45A 1SD5A 1SMYF 3CUQC 2VE8A 1O3QA 1W7PD 1X3UA 2LF7A 1U6GA 2H6CA 4Q48A 1ZG3A 3L09A 3KP3A 3CDHA 5HVQC 4R79A 1KU7A 4XSXF 2QM3A 4MGRA 5JVTA 2FE3A 2OZ6A 2V9VA 1T0FA 2PMUA 2O0YA 1P2FA 2HQNA 4IRHA 2EA4A 2ZJ2A 3F72A 5H20A 4ASNA 5A2QK 4BNCA 4L0YB 2JZYA 4OIPF 5ICEA 1Z91A 2E1CA 4Q5SF 2JT1A 1HXDA 3I71A 4U7BA 3GZ6A 4CHUA 2Y48A 1R7JA 3CTAA 3ZP5A 2ESHA 4KDPA 1JHHA 1ZGAA 1R5GA 2VC1A 3M1EA 2ZCWA 4IRGA 2GA2A 4AIKA 3HOSA 2KIMA 4AD9A 2KKOA 3QPHA 5D5XB 1YS7A 1IN5A 1VTNC 1ZG1A 2Z99A 1ZGJA 4YIIA 2EFWA 2KIUA 2UZKA 2ZNZA 4IRIA 5D4SA 1XB4A 2V79A 4XLNF 2ETHA 2QQBA 3GFLA 3MFKA 4ENKA 4O3MA 5AIPA 1GHCA 2HZTA 2QQAA 3RKWA 4UXNA 3O6BB 1XD7A 1EH7A 3LA7A 2DPDA 2CSOA 1R1TA 2GA1A 5H6RA 4MTDA 1OYWA 5HS8A 3L9FA 3KZZA 1HQCA 5BQTA 1LDJA 4EV0A 3RPQA 4LLLA 1P4AA 2DQRA 1I1GA 4M71A 3GWZA 1U3EM 1QPMA 2UXXA 3KP5A 3E6BA 3R0AA 1JGSA 3FXRA 3LA2A 5A2QZ 4N0BA 1UFMA 1PDNC 2WC2A 4GGGA 1KU9A 1LQ1A 1I27A 1BM9A 2CYYA 2MH9A 1R23A 3FM3A 5JFRA 1B4AA 2DO7A 1FC3A 2J5OA 2XAFA 4UVAA 3HIFA 1ZLJA 1OPCA 3E6MA 3ZMZA 3HSEA 1S29A 3HRSA 4HF0A 3U1DA 2PEXA 3L00A 1W7PB 1TTYA 3I53A 1IXRC 1XSXA 3I59A 3TOBA 4XBFA 4U7DA 3F6OA 3QPTA 5HOOA 3D0SA 2CO5A 2DAOA 1WRJA 3F3XA 1HBXG 1J75A 5E1WA 1AWCA 3T1BA 3WTTC 5L3CA 3E97A 3IKVA 3HSRA 3SHFA 4Y17A 4RB3C 1O57A 4LD5A 3FZVA 3C3WA 4WXHA 1GXPA 2FOKA 3JTHA 3FX3A 2STTA 5IT9K 3VOEA 1F9NA 2A61A 1YO5C 4U88A 4HX8A 2Q0OA 1TNTA 3E6CC 2HOEA 1FX7A 2O8XA 1MGTA 3B02A 5L3EA 4EM2A 1G3SA 2H6BA 4IVNA 1STZA 4KYWA 2K4BA 2QENA 3F22A 4FT8A 1O7LA 2A07F 1B6AA 1K79A 1B1BA 4RGXA 3WU1B 1D5VA 4WXDA 2A6HF 3RYRA 1FNNA 3P9KA 1ZLKA 2XHKA 2EFQA 2KJCA 4D0PA 2D2WA 4A0YA 3ISPA 4CXFA 2FSWA 3VFZA 4WX9A 1IUYA 2EWNA 4A0XA 2VOOA 3DEUA 4P9UA 1R1VA 2FNPA 2M87A 2FF4A 2DK5A 2BGCA 3TOAA 4LG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP2 A;  2HYG D;  5D6F A;  5E18 F;  3T8T A;  2O03 A;  2PBI A;  3LQQ A;  3KE2 A;  2YR2 A;  2H09 A;  1O3R A;  3WTZ A;  2FU4 A;  3L7W A;  3BWG A;  5ILV A;  2NYX A;  2YU3 A;  5D5V B;  3KZY A;  1MDM A;  3KCC A;  1IXS B;  3PQK A;  4CO8 A;  2QBY A;  4HX7 A;  3KLN A;  1XGS A;  2TDX A;  4FX4 A;  3S2W A;  2MH2 A;  4ZYE A;  2HS5 A;  1FP1 D;  5DEQ A;  5IT9 Z;  1HSJ A;  1XN7 A;  5D8L B;  4LLN A;  5LGU A;  1U5T A;  2BYV E;  2F5F A;  2VE9 A;  2V6C A;  1XSV A;  2GQQ A;  3IHU A;  1ON2 A;  4EVI A;  3K69 A;  4LLG F;  4JK1 X;  3IWF A;  4U0W A;  1HW5 A;  3ULQ B;  3V7R A;  1KQ0 A;  2EV5 A;  3CLO A;  2FML A;  5E8G A;  2HFH A;  5HLI A;  5DD4 A;  3COA C;  3ZMU A;  1XDU A;  5D4R A;  5H6Q A;  4PGH A;  2P5L C;  4AIH A;  1LDD A;  1XDS A;  1BC8 C;  3H3Z A;  1TW3 A;  4A5M A;  3LAP A;  4RB0 A;  5TJJ A;  1K78 B;  4PGG A;  2W24 A;  5HS9 A;  1T2K A;  1R22 A;  3NQO A;  1D8J A;  4KN4 X;  4RGS A;  4EGY A;  4TV7 A;  1ZN2 A;  4ZYH A;  2FXA A;  5JI6 A;  4HX4 A;  3HRM A;  2A6E F;  3IL2 A;  4OIR F;  3KEQ A;  4RS8 A;  1YLF A;  3SZP A;  2M30 A;  4KN7 X;  3V8K A;  1K7A A;  3ECH A;  3ZMT A;  3H92 A;  1F4K A;  1MD0 A;  2P4W A;  4KMU X;  2ISY A;  3KLO A;  4M9S A;  3JSO A;  3LQR A;  1U8R A;  4OMZ A;  1L0O C;  2P5K A;  2RDP A;  2IP2 A;  2HKX A;  3P9I A;  1USS A;  1AOY A;  2CG4 A;  3V8L A;  3V7S A;  3WGH A;  1IN7 A;  1G3Y A;  3FMS A;  1WWX A;  4HV5 A;  1MZB A;  2PN6 A;  5J8C A;  3KP6 A;  1BIB A;  1HW1 A;  1LNW A;  2H27 A;  3KP7 A;  2OQR A;  2XRN A;  2YX4 A;  2PI0 A;  4Q47 A;  2WTE A;  2IW5 A;  2Y0M A;  4L5I A;  3V4G A;  3ML6 A;  3WTY C;  2ZO4 A;  5DV5 A;  4KMF A;  3MWM A;  2F2E A;  1D8K A;  1ZAO A;  3WTS C;  4HOB A;  2PJP A;  2XVC A;  1P4W A;  4HLX A;  4KIB A;  3O2P E;  1QO0 D;  2QZ8 A;  4IXA A;  1U5T C;  4OOI A;  3LWF A;  2W85 A;  4M72 A;  3I58 A;  4HQE A;  2OQG A;  2VBZ A;  2LKP A;  1BI2 A;  1BIA A;  4IHT A;  3ELK A;  1QZZ A;  3IKT A;  3TO7 A;  2GAU A;  4IF4 A;  3QU3 A;  3MQ0 A;  1T6S A;  2XAH A;  2XUB A;  1T39 A;  3L2C A;  5AIQ A;  1XMA A;  2RGV A;  3SXY A;  2P5V A;  4M9Z A;  3R61 A;  1WKM A;  1YW8 A;  4GCV A;  3M8E A;  2L3D A;  3RIR A;  5TRD A;  3ZMD A;  1FT9 A;  3T8R A;  5HDG A;  4S04 A;  2COM A;  2KIF A;  2OBP A;  4UNO A;  1Z6T A;  4LMY A;  4YFX F;  2P6S A;  3K0L A;  1YS6 A;  4A6E A;  2AS5 F;  3IRR A;  2FBK A;  1OMI A;  4G94 A;  2NNY A;  4ESJ A;  2ACJ A;  3BRO A;  4UVC A;  3NRV A;  3C18 A;  2QWW A;  2HWV A;  3BPV A;  1FWZ A;  3ZPL A;  1O3T A;  1H0M A;  1P4X A;  4YFK F;  4I98 B;  5CVJ A;  1BI1 A;  3OV8 A;  3KET A;  4ON0 A;  1RUO A;  1CGP A;  5E20 A;  2CQK A;  2HKO A;  5CYV A;  3GUD A;  1OKR A;  4ZZD A;  3V8J A;  5E1Z B;  2DW4 A;  1V3F A;  2MLK A;  2YPR A;  2ZXJ A;  5BPD A;  4P9F A;  4HA8 A;  2IVM A;  1BI3 A;  1EH6 A;  1LB2 A;  1DP7 P;  4MNU A;  3ECO A;  2ZME B;  1G3T A;  5FGM A;  3SQN A;  1YQA A;  5E1X A;  5DDG A;  3IC7 A;  4A5N A;  2HR3 A;  2BV6 A;  2P8T A;  1KGS A;  2C6Y A;  3GLX A;  1XGM A;  2BBY A;  2VT2 A;  3P7N A;  5ICG A;  3ERE D;  2JPC A;  1Y0U A;  1O3S A;  1ZRC A;  2ZKZ A;  1YFH A;  3DFG A;  2CGP A;  5DD8 A;  3PFI A;  1IN4 A;  3REO A;  1BC7 C;  1Q1H A;  3J80 K;  3TO6 A;  4HBL A;  2XV4 S;  1G6N A;  2HEO A;  4OU0 A;  2Q2E A;  1MKM A;  3DPL C;  5LBQ A;  4R1H A;  1V4R A;  3Q9S A;  2GXG A;  1HKS A;  3N4M A;  3DV8 A;  4MEY F;  5HDK A;  2F5D A;  2YSR A;  2ZFW A;  2QQ9 A;  3CUO A;  1FBQ A;  2DBB A;  2V1D A;  5ILU A;  4Z2Y A;  5LGN A;  5FLX K;  3KP2 A;  2MBF A;  1UHW A;  4K2E A;  2A3S A;  1FSE A;  3QRF F;  3M9A A;  3BJ6 A;  3WG9 A;  2EB7 A;  4I02 A;  1ZRF A;  3B73 A;  1FYM A;  3RKY A;  2E7X A;  2XAQ A;  4MEX F;  4LK1 F;  4CDG A;  1CF7 B;  3HOT A;  1TW2 A;  3PQJ A;  4WF2 A;  4HF1 A;  4AWX B;  3I0T A;  4BH9 A;  4LK0 F;  2V1X A;  5K5O A;  2L01 A;  2OD5 A;  2X0L A;  2JSC A;  1GVJ A;  1BN5 A;  2W25 A;  4EJO A;  3JSP A;  4KIC A;  1R36 A;  2FRH A;  1B9N A;  1FSH A;  3IRQ A;  5DCM B;  2VBX A;  1SD7 A;  3WU0 A;  1RIO H;  4RGU A;  3F21 A;  5L3F A;  4RGR A;  2VC0 A;  2PFB A;  2XGX A;  3BJA A;  3NEU A;  4BHB A;  3I54 A;  2IPQ X;  4H0E A;  1TQP A;  2IRF G;  2P6T A;  3GO5 A;  3J80 Z;  4MHG A;  5D6E A;  4HDV A;  2HYF A;  2R7D A;  4EJW A;  4U0Y A;  4P96 A;  1KQ9 A;  4KNY A;  1J59 A;  3SZT A;  1HW2 A;  2M45 A;  3GEZ A;  3CUQ B;  1W7P A;  2CW0 F;  4XSZ F;  4OIQ F;  4BHP A;  1HKQ A;  3WTX C;  3WTV C;  3DF8 A;  3I5U A;  2VON A;  4RAZ A;  3WGI A;  3F8F A;  3C1D A;  5FLX Z;  1TQI A;  1WI9 A;  1SAX A;  3JTG A;  2H94 A;  1R5H A;  3HTU A;  5F6F A;  5FD5 A;  1PP8 F;  4KA4 A;  5K5Q A;  3KP4 A;  2HQR A;  4FHT A;  4WXC A;  4HF2 A;  4M6Y A;  5CVI A;  5IT3 A;  1YW9 A;  4M9X A;  1ZG5 A;  4HLY A;  4AIJ A;  4EJT A;  3GYH X;  2NS0 A;  2HTJ A;  1LEB A;  3I64 A;  4EM1 A;  3FHZ A;  2EFO A;  4U0V A;  1JHF A;  1KYZ A;  3GVA A;  1W4M A;  3BPX A;  3QP6 A;  5JHU A;  4IPA A;  4A12 A;  2A69 F;  4ZYG A;  3GFJ A;  3RTR A;  2RVC A;  3F8B A;  3RKX A;  1H9T A;  2ISZ A;  4F7Z A;  2HGC A;  3LFK A;  4YIF A;  3MEX A;  4EJV A;  4RB1 A;  2EFP A;  1REP C;  1S3J A;  3VOD A;  3T0Y A;  4ZYD A;  4EM0 B;  4I0A A;  5D5W B;  1QGP A;  3F8M A;  4G6D A;  3JAM K;  1O7F A;  4MTE A;  4ENM A;  2K4J A;  3RJP A;  3E5U A;  1J7K A;  2L54 A;  3TO9 A;  5J6X A;  4LG0 A;  2NNN A;  6PAX A;  2F5C A;  3TKY A;  4IJA A;  4PDK A;  5KVR A;  2MC3 A;  4XRF A;  5K5R A;  5LRR A;  3EYI A;  1IXC A;  1G4D A;  1QBJ A;  2ESN A;  4JBA A;  1WSU A;  5EEH A;  5CVU A;  4N9I A;  1RUN A;  1EH8 A;  3QP5 A;  1TBX A;  1IN6 A;  4ENN A;  1FYK A;  1TNS A;  1ZRD A;  2STW A;  2XAS A;  1BBY A;  4L9N A;  2P7C B;  4MQ9 F;  4EGZ A;  1KQ8 A;  4FX0 A;  2J5P A;  1TQM A;  1WQ2 A;  1BI0 A;  4LB5 A;  1EV7 A;  3FMR A;  4ZH4 F;  1DUX C;  3R0J A;  2EK5 A;  4Q4Z F;  1T38 A;  5J8F A;  4L9J A;  2Z9O A;  2HTS A;  3CO6 C;  2O6G E;  4S05 A;  4OMY A;  1QNT A;  5BMZ A;  1NHA A;  2UXN A;  5ILS A;  2A68 F;  4RB2 C;  1YIO A;  5K1Y A;  3N97 A;  2NRA C;  3FM5 A;  3K9T A;  4ZZL A;  1K78 A;  4L18 B;  5LLQ A;  1BOA A;  2AXL A;  3F8C A;  5L3B A;  3RPU A;  1PUE E;  3TDZ C;  3ABT A;  4IHS A;  1FBS A;  1OYI A;  1L3L A;  2XAG A;  4O6J A;  4GO1 A;  4GYG A;  3TQN A;  3GXO A;  1P6R A;  2PMH A;  5LHH A;  4ESF A;  1QQI A;  2ZNY A;  1IN8 A;  2LNB A;  2Q8K A;  4BXU A;  3VEP A;  4O5V A;  3RYP A;  2XKO A;  3FXU A;  2FQ3 A;  3HHH A;  4G8X A;  2YX7 A;  1OYY A;  4UV9 A;  4QLC U;  4UUV A;  2FA5 A;  1ZRE A;  4I2O A;  1XCV A;  3MZY A;  1RZ4 A;  4NB5 A;  4RAY A;  3GFI A;  1FOK A;  4UV8 A;  4UHT A;  2Z5U A;  2W57 A;  3AAF A;  4A6D A;  4JQF A;  5DCF A;  5FD6 A;  4CGZ A;  2RNJ A;  1FBU A;  3E3V A;  1DPR A;  5L3G A;  4BYY A;  2VOD A;  1UHM A;  4GYI A;  2XRO A;  2XKP A;  2JTV A;  1Z1D A;  5ICC A;  4LB6 B;  5DYM A;  1K6O A;  3DPT A;  1YG2 A;  2BE5 F;  3HUG A;  3ZMV A;  2CWE A;  1TLH B;  2A5Y B;  5DUI A;  1S7A A;  3E6D A;  2QLZ A;  1ZAR A;  2M5W A;  1T98 A;  1C0W A;  1A04 A;  1R1U A;  5CLS A;  1F5T A;  2LF8 A;  5HDN A;  3F8N A;  2K02 A;  3I4P A;  1P92 A;  3Q5F A;  2RC4 A;  2IA2 A;  2FBI A;  3WOD F;  3WE2 A;  4CZZ A;  2CFX A;  3RI4 A;  2DT5 A;  2DFI A;  2QUF A;  5FO5 A;  2VOP A;  1IF1 A;  2HDC A;  1XGN A;  3GW2 A;  4N9H A;  2L02 A;  3HYI A;  3JW4 A;  1ONV A;  3GZ5 A;  1ZH5 A;  4I09 A;  1FYL A;  4G6Q A;  5L3D A;  5CVV A;  3GFM A;  2WWY A;  4MQV A;  2VBW A;  4KUM A;  1PP7 U;  4ESB A;  3LST A;  5FFZ A;  2O3F A;  2QYO A;  3I59 B;  1LVA A;  1SD4 A;  4OIN F;  2L4A A;  2L4M A;  2WV0 A;  2FNA A;  1RNL A;  5BOX A;  2PG4 A;  4EMS A;  2KRF A;  1S8N A;  2X4H A;  1IZ1 A;  1MJA A;  5FB2 A;  2R3S A;  4BQA A;  2PLY A;  3WGG A;  4KT5 C;  3GF2 A;  4LFU A;  3O3K A;  5JR3 A;  2Z33 A;  2EA2 A;  2XIG A;  1KU2 A;  3W6K B;  2GWR A;  2BEO A;  4BHC A;  2K27 A;  2IT0 A;  3T5X A;  1E17 A;  3KFW X;  3J7A O;  3HRU A;  3HHG A;  2UWM A;  3R4K A;  3TGN A;  2JPB A;  2ZBK A;  4G7Z F;  1I6X A;  3QAH A;  4YG2 F;  2E1N A;  5ICF A;  1Z05 A;  2P7V B;  4YFN F;  1DDN A;  4EQQ A;  1B9M A;  2G9W A;  3OOP A;  4L5J A;  2OU2 A;  1IW7 F;  4Y13 A;  4KIG A;  2IA0 A;  4PCQ A;  3U2R A;  4B09 A;  4HW0 A;  4ENJ A;  2E7W A;  1KU3 A;  2ZME A;  3TDU C;  4G7H F;  1J0R A;  2GZW A;  5HS7 A;  3FMQ A;  1D3Y A;  3G73 A;  3QU6 A;  2EFN A;  1ZHF A;  1Z7U A;  4WCG A;  3U9G A;  2D1H A;  1HST A;  2EV6 A;  3R60 A;  5CVR A;  3V7C A;  2OA4 A;  1R00 A;  3BZ6 A;  5LEJ A;  3HTS B;  3J81 K;  2VXZ A;  3ZMS A;  2G7H A;  2V1U A;  1HKT A;  5F64 A;  2IJL A;  1W5S A;  5KK1 A;  3F23 A;  3K2Z A;  1QZY A;  1MDM B;  4HQM A;  1FPQ A;  2K7L A;  2JRT A;  3CO7 C;  2QBY B;  4OIO F;  1ZYR F;  5DUK A;  4HV6 A;  5ED4 A;  1SMT A;  1UB9 A;  5ERI A;  2DU9 A;  4I7H A;  4KFC A;  4AVP A;  1U5T B;  2DI3 A;  4NQW A;  4M73 A;  3EUH A;  2ADU A;  1YYV A;  3RDI A;  5F1R A;  4I01 A;  4QWQ A;  2MLG A;  1IRG A;  4E70 A;  1FLI A;  2KJB A;  2RV8 A;  2M8E A;  2G7U A;  1XSD A;  2B0L A;  1CF7 A;  1LDK B;  2F5E A;  1XCB A;  5CJ9 A;  1SD6 A;  4DQ2 A;  2NAZ A;  2DQL A;  3EQL F;  5D8K B;  5HLG A;  3QOP A;  2Y75 A;  3DQV C;  1F1Z A;  3EDP A;  3WTU C;  2DPU A;  2VBY A;  1LJ9 A;  5EEG A;  3ZN0 A;  2QVO A;  2DTR A;  1LEA A;  3Q9V A;  5LEK A;  5DCM A;  1GXQ A;  5LRS A;  4PZJ A;  1MJ9 A;  4KIF A;  2FEZ A;  1SFX A;  1R58 A;  3DP7 A;  1KA8 A;  1XGO A;  3HSF A;  3KEO A;  3R6S A;  1OR7 A;  3J81 Z;  3C7J A;  2RN7 A;  3ZN1 A;  3E5X A;  3LAJ A;  2OAZ A;  2DK8 A;  3WE3 A;  3BJO A;  3GX4 X;  3EET A;  2VT3 A;  4CYD A;  4I0B A;  3MCZ A;  1J9I A;  4P5O A;  3ZQ7 A;  2M1B A;  3MAJ A;  4L9V A;  2GXB A;  1Z9C A;  1MJB A;  5LHI A;  3CJN A;  4XLP F;  5E17 F;  5D5U B;  4LJZ F;  1ULY A;  4EJU A;  4B8X A;  3CUQ A;  2XAJ A;  3BP8 A;  4BAY A;  2R7F A;  1JXS A;  4NHJ A;  4HYE A;  5FFX A;  1UST A;  2IA1 A;  3IWZ A;  5LGT A;  2OZU A;  3WTW C;  4DNC A;  3DKW A;  5AON A;  1IRF A;  1SFU A;  3K1P A;  3MZH A;  1I5Z A;  3VB2 A;  2MA3 A;  1J5Y A;  1XMK A;  3LA3 A;  5BS6 A;  1BJA A;  2GIV A;  2PQ8 A;  1FY7 A;  3K1M A;  3P9C A;  1ODD A;  1RI7 A;  3M8F A;  1I1S A;  4LGW A;  4Y15 A;  2RKH A;  4L0Z B;  4HZF A;  2EJR A;  1KYW A;  3EYY A;  3ROU A;  1H9G A;  3DXJ F;  4WK8 F;  3E5Q A;  4G9Y A;  3FF5 A;  2D1V A;  4HAM A;  3W6J B;  1SFE A;  3HRT A;  3K1N A;  1U2W A;  3BY6 A;  3BDD A;  4GXO A;  4A2U A;  4HDU A;  1U78 A;  3D5L A;  3SFZ A;  1J2X A;  3ABU A;  2O61 A;  4CIC A;  2DLL A;  1YW7 A;  3F6V A;  1JE8 A;  1E2X A;  1IAW A;  4P55 A;  5HLH A;  3FWE A;  4UVB A;  3M7G A;  1B59 A;  4WWC A;  1Z6R A;  4R8H A;  3BOQ A;  1S6L A;  2ELH A;  4M6X A;  3FXQ A;  3JAM Z;  2K86 A;  2EV0 A;  4A0Z A;  1W5T A;  2W84 A;  1DPU A;  1FZP B;  2Z3Y A;  3G3Z A;  2RQP A;  4ETS A;  1G3W A;  5E8I A;  2LDU A;  4G7O F;  1UCR A;  5LHG A;  1ON1 A;  4L9T A;  2LSO A;  3H3U A;  1S7O A;  1YTY A;  2MD5 A;  5BPI A;  4M74 A;  2FMY A;  2VN2 A;  2FBH A;  2D45 A;  1SD5 A;  1SMY F;  3CUQ C;  2VE8 A;  1O3Q A;  1W7P D;  1X3U A;  2LF7 A;  1U6G A;  2H6C A;  4Q48 A;  1ZG3 A;  3L09 A;  3KP3 A;  3CDH A;  5HVQ C;  4R79 A;  1KU7 A;  4XSX F;  2QM3 A;  4MGR A;  5JVT A;  2FE3 A;  2OZ6 A;  2V9V A;  1T0F A;  2PMU A;  2O0Y A;  1P2F A;  2HQN A;  4IRH A;  2EA4 A;  2ZJ2 A;  3F72 A;  5H20 A;  4ASN A;  5A2Q K;  4BNC A;  4L0Y B;  2JZY A;  4OIP F;  5ICE A;  1Z91 A;  2E1C A;  4Q5S F;  2JT1 A;  1HXD A;  3I71 A;  4U7B A;  3GZ6 A;  4CHU A;  2Y48 A;  1R7J A;  3CTA A;  3ZP5 A;  2ESH A;  4KDP A;  1JHH A;  1ZGA A;  1R5G A;  2VC1 A;  3M1E A;  2ZCW A;  4IRG A;  2GA2 A;  4AIK A;  3HOS A;  2KIM A;  4AD9 A;  2KKO A;  3QPH A;  5D5X B;  1YS7 A;  1IN5 A;  1VTN C;  1ZG1 A;  2Z99 A;  1ZGJ A;  4YII A;  2EFW A;  2KIU A;  2UZK A;  2ZNZ A;  4IRI A;  5D4S A;  1XB4 A;  2V79 A;  4XLN F;  2ETH A;  2QQB A;  3GFL A;  3MFK A;  4ENK A;  4O3M A;  5AIP A;  1GHC A;  2HZT A;  2QQA A;  3RKW A;  4UXN A;  3O6B B;  1XD7 A;  1EH7 A;  3LA7 A;  2DPD A;  2CSO A;  1R1T A;  2GA1 A;  5H6R A;  4MTD A;  1OYW A;  5HS8 A;  3L9F A;  3KZZ A;  1HQC A;  5BQT A;  1LDJ A;  4EV0 A;  3RPQ A;  4LLL A;  1P4A A;  2DQR A;  1I1G A;  4M71 A;  3GWZ A;  1U3E M;  1QPM A;  2UXX A;  3KP5 A;  3E6B A;  3R0A A;  1JGS A;  3FXR A;  3LA2 A;  5A2Q Z;  4N0B A;  1UFM A;  1PDN C;  2WC2 A;  4GGG A;  1KU9 A;  1LQ1 A;  1I27 A;  1BM9 A;  2CYY A;  2MH9 A;  1R23 A;  3FM3 A;  5JFR A;  1B4A A;  2DO7 A;  1FC3 A;  2J5O A;  2XAF A;  4UVA A;  3HIF A;  1ZLJ A;  1OPC A;  3E6M A;  3ZMZ A;  3HSE A;  1S29 A;  3HRS A;  4HF0 A;  3U1D A;  2PEX A;  3L00 A;  1W7P B;  1TTY A;  3I53 A;  1IXR C;  1XSX A;  3I59 A;  3TOB A;  4XBF A;  4U7D A;  3F6O A;  3QPT A;  5HOO A;  3D0S A;  2CO5 A;  2DAO A;  1WRJ A;  3F3X A;  1HBX G;  1J75 A;  5E1W A;  1AWC A;  3T1B A;  3WTT C;  5L3C A;  3E97 A;  3IKV A;  3HSR A;  3SHF A;  4Y17 A;  4RB3 C;  1O57 A;  4LD5 A;  3FZV A;  3C3W A;  4WXH A;  1GXP A;  2FOK A;  3JTH A;  3FX3 A;  2STT A;  5IT9 K;  3VOE A;  1F9N A;  2A61 A;  1YO5 C;  4U88 A;  4HX8 A;  2Q0O A;  1TNT A;  3E6C C;  2HOE A;  1FX7 A;  2O8X A;  1MGT A;  3B02 A;  5L3E A;  4EM2 A;  1G3S A;  2H6B A;  4IVN A;  1STZ A;  4KYW A;  2K4B A;  2QEN A;  3F22 A;  4FT8 A;  1O7L A;  2A07 F;  1B6A A;  1K79 A;  1B1B A;  4RGX A;  3WU1 B;  1D5V A;  4WXD A;  2A6H F;  3RYR A;  1FNN A;  3P9K A;  1ZLK A;  2XHK A;  2EFQ A;  2KJC A;  4D0P A;  2D2W A;  4A0Y A;  3ISP A;  4CXF A;  2FSW A;  3VFZ A;  4WX9 A;  1IUY A;  2EWN A;  4A0X A;  2VOO A;  3DEU A;  4P9U A;  1R1V A;  2FNP A;  2M87 A;  2FF4 A;  2DK5 A;  2BGC A;  3TOA A;  4LG0 B; 
#chains in the Genus database with same CATH topology
 1FP2 A;  2K9M A;  3LSG A;  2HYG D;  5D6F A;  2JK3 A;  5E18 F;  5C3E J;  3T8T A;  2O03 A;  3BR5 A;  2PBI A;  3LQQ A;  1F43 A;  3KE2 A;  2BZT A;  2YR2 A;  2H09 A;  1O3R A;  2M0C A;  2CQN A;  3WTZ A;  2FU4 A;  3L7W A;  3BWG A;  3OS1 A;  5ILV A;  2NYX A;  2YU3 A;  5D5V B;  3KZY A;  2WAF A;  1OLT A;  1MDM A;  1A35 A;  2LR8 A;  4HRI A;  3KCC A;  1IXS B;  3PQK A;  4II2 A;  4BS9 A;  4BQQ A;  4C9Y A;  4CO8 A;  1K4S A;  1LPQ A;  2QBY A;  4HX7 A;  3CCV I;  2KIQ A;  1GLN A;  3KIO A;  3KLN A;  4CCM A;  1XGS A;  2TDX A;  5CQG A;  4FX4 A;  3S2W A;  2MH2 A;  3IH2 A;  4ZYE A;  2HS5 A;  1FP1 D;  5DEQ A;  5IT9 Z;  2ZFU A;  1E3P A;  2JA2 A;  3J7A Y;  1HSJ A;  1XN7 A;  2DDA A;  5EZG A;  5D8L B;  5LGU A;  4LLN A;  5E3M A;  5F0F A;  1U5T A;  5CQE A;  2BYV E;  2F5F A;  4BE1 A;  1I3Q J;  2CS3 A;  2CRG A;  2VE9 A;  2V6C A;  1XSV A;  2GQQ A;  3IHU A;  4BXX J;  1ON2 A;  4BBS J;  4EVI A;  1QZE A;  4LG3 A;  3K69 A;  4LLG F;  4JK1 X;  3IWF A;  4U0W A;  4MLO A;  1HW5 A;  4DJA A;  1HDD C;  1WFX A;  3DWL E;  3QYB A;  5KHD A;  3ULQ B;  1HA8 A;  3V7R A;  1MMG A;  3W3C A;  1KQ0 A;  1V55 H;  2DJI A;  2EV5 A;  1YRN A;  2OJE D;  3CLO A;  2FML A;  3JRF A;  5E8G A;  2HFH A;  2XB0 X;  5HLI A;  1DGW Y;  5DD4 A;  5J40 A;  1B8I B;  3COA C;  2HPI A;  4XKV A;  3ZMU A;  1XDU A;  4IOA F;  2CQX A;  5D4R A;  5H6Q A;  2K9Q A;  4PGH A;  2PMZ N;  4BKX A;  3KZI C;  1QA6 A;  3RCO A;  2P5L C;  2QEX I;  4OWR B;  3RZO J;  4AIH A;  2ZSH B;  3A2K A;  1LDD A;  1XDS A;  1VI0 A;  1BC8 C;  2HI3 A;  3H3Z A;  1TW3 A;  1WPK A;  4A5M A;  1G59 A;  2IS4 A;  3IH4 A;  2BVM A;  3LAP A;  4RB0 A;  2UUZ A;  2X85 A;  5TJJ A;  4GRI A;  1YJW I;  1K78 B;  4PGG A;  2W48 A;  2W24 A;  2FQ4 A;  2ZB9 A;  5HS9 A;  2E2H J;  1T2K A;  1R22 A;  3NQO A;  4FQG A;  3L2V A;  1D8J A;  2VJI A;  3OS2 A;  4KN4 X;  4RGS A;  2DA5 A;  4EGY A;  4TV7 A;  1TC3 C;  1ZN2 A;  4ZYH A;  2FXA A;  5JI6 A;  4HX4 A;  1X1D A;  3HRM A;  1I3A A;  1PYV A;  2A6E F;  3LSR A;  3IL2 A;  4OIR F;  2E2J J;  1UG2 A;  3KEQ A;  2HQA A;  4RS8 A;  1YLF A;  3SZP A;  3DTE A;  2JVG A;  2M30 A;  4KN7 X;  3V8K A;  1K7A A;  4ZYA A;  3ECH A;  3VYR B;  3ZMT A;  3NAR A;  3H92 A;  1FMW A;  4F91 B;  2FOW A;  3JRE A;  1F4K A;  3AG3 H;  3S2H J;  2IGO A;  1MD0 A;  2P4W A;  1MH3 A;  3G1M A;  2XSD C;  1BR4 A;  4KMU X;  2ISY A;  2HZD A;  3LMM A;  4B43 A;  4D7M A;  3L2U A;  3KLO A;  1I39 A;  3MKL A;  1LFU P;  4M9S A;  3JSO A;  3LQR A;  2Y9Y A;  1U8R A;  2Y2Z A;  4OMZ A;  2OF7 A;  1L0O C;  2P5K A;  2RDP A;  2IP2 A;  2HKX A;  3P9I A;  1USS A;  1Z0X A;  1AOY A;  2JUC A;  2CG4 A;  4B3A A;  2L7K A;  4X0G A;  3V8L A;  3V7S A;  4PJJ A;  3WGH A;  1IN7 A;  1G3Y A;  2HYJ A;  3BCB A;  3FMS A;  2DT6 A;  1JJ8 C;  1WWX A;  4HV5 A;  4JYK A;  1F36 A;  3Q0V A;  1MZB A;  2PN6 A;  1ITY A;  5J8C A;  2ICW G;  3K4L A;  1EKE A;  2XB5 A;  3KP6 A;  1BIB A;  3L2R A;  2DDB A;  4AU7 A;  1A5J A;  1HW1 A;  1LNW A;  2VAS A;  2X6O A;  5F0C A;  3QOE A;  2RAE A;  2H27 A;  4QPO A;  3KP7 A;  1RPW A;  2OQR A;  2XRN A;  4E6K G;  2YX4 A;  2PI0 A;  4Q47 A;  2GM4 A;  5GAG J;  2WTE A;  2IW5 A;  3CCS I;  3Q3S A;  2Y0M A;  4L5I A;  3V4G A;  1W5C C;  3ML6 A;  3WTY C;  2ZO4 A;  5DV5 A;  5EDN A;  3HUG B;  4BUP A;  2W82 A;  3BR2 A;  3MWM A;  4KMF A;  3HC7 A;  3N05 A;  4G12 A;  2F2E A;  1FEX A;  1D8K A;  1ZAO A;  3WTS C;  4HOB A;  4CCN A;  2PJP A;  2WB1 A;  2XVC A;  1P4W A;  2JMW A;  4HLX A;  4KIB A;  2XGC A;  3O2P E;  4NC7 A;  4E7J A;  1QO0 D;  1TZL A;  2XPU A;  2QZ8 A;  4IXA A;  1OCP A;  1U5T C;  2VQC A;  4C2U A;  5FKM A;  4OOI A;  3LWF A;  4JX4 A;  2W85 A;  2M34 A;  3ZQC A;  1W0T A;  1SVM A;  3A01 B;  2ECC A;  3SDG A;  3HDD A;  4N4O B;  4M72 A;  3I58 A;  4HQE A;  2EBI A;  2OQG A;  4DZP A;  2VBZ A;  2MSY A;  2JQ7 A;  2R7S A;  1MMA A;  2CV1 A;  2JA6 J;  2EIK H;  2LKP A;  1BI2 A;  1BIA A;  4YRV A;  3ELK A;  4IHT A;  1QZZ A;  3IKT A;  4XKC A;  3B6C A;  3D5S C;  3TO7 A;  2GAU A;  4IF4 A;  3QU3 A;  3MQ0 A;  4HSR A;  5EYR A;  1FIP A;  1NH3 A;  1T6S A;  2XAH A;  3PUB A;  2XUB A;  3H9J A;  2R7Z J;  1T39 A;  3CMM A;  1TT0 A;  3DBR B;  4OAZ A;  3L2C A;  3K70 C;  1M1E B;  3MMY B;  3M8J A;  1A6Q A;  5AIQ A;  3M07 A;  3VDX A;  1T33 A;  2XRL A;  3G6E I;  1XMA A;  2RGV A;  3DTK A;  2P5V A;  3SXY A;  4M9Z A;  3R61 A;  3DEW A;  1WKM A;  1YW8 A;  3DBL B;  4GCV A;  4CCL A;  3M8E A;  3SEZ A;  2L3D A;  3WHB A;  2NVU B;  4Y52 J;  3DCF A;  3QOD A;  2VXD A;  3RIR A;  5TRD A;  1OCO H;  3ZMD A;  3BCA A;  2DOD A;  2EQR A;  1FT9 A;  3T8R A;  1VZ0 A;  3H35 A;  5HDG A;  4S04 A;  2LMD A;  4DBQ A;  2COM A;  2KIF A;  2OBP A;  2XAU A;  4UNO A;  1Z6T A;  5EGO B;  5BNG A;  4JOM A;  2F4M B;  3PO2 J;  4B3X A;  1Z77 A;  4LMY A;  3KYD B;  4YFX F;  2VJJ A;  2P6S A;  3K0L A;  1P7J A;  3C2B A;  1YS6 A;  4A3F J;  4A6E A;  2AS5 F;  1BOB A;  4BGD A;  3IRR A;  1BW5 A;  2FBK A;  1JKP C;  3S1N J;  2B7E A;  1OMI A;  4G94 A;  2AQF A;  2NNY A;  3S1M J;  2W7N A;  4ESJ A;  2ACJ A;  1MMN A;  3BRO A;  4DZJ A;  4UVC A;  3NRV A;  1YJ9 I;  2KHM A;  4BXF A;  4CUG A;  3C18 A;  3BT9 A;  3MZ8 A;  2QWW A;  1VQ4 I;  2HWV A;  3L2W A;  4RMN A;  2MAB A;  2NOG A;  3BPV A;  1FWZ A;  4XOP A;  4NDL A;  1EJ9 A;  2EZH A;  3ZPL A;  5M5X J;  1O3T A;  3GTG J;  3S16 J;  4B48 A;  1H0M A;  1P4X A;  3ZXS A;  1P9Q C;  4YFK F;  4I98 B;  5CVJ A;  3MKZ A;  1BI1 A;  3OV8 A;  1ZTR A;  2XGE A;  3KET A;  4PSW A;  4ON0 A;  1RUO A;  1CGP A;  3PSF A;  5E20 A;  2CQK A;  2HKO A;  5CYV A;  3GUD A;  2M7A A;  1LFB A;  1LUJ B;  3ASO H;  1JTX A;  4BY1 J;  1WJE A;  1OKR A;  4ZZD A;  3V8J A;  5E1Z B;  2DW4 A;  1V3F A;  2MLK A;  2ZXJ A;  2YPR A;  5BPD A;  1X19 A;  4P9F A;  2R92 J;  4HA8 A;  2IVM A;  2EZI A;  4B4C A;  1BI3 A;  1EH6 A;  3V42 A;  2HOA A;  1JJ6 C;  1MNE A;  1KON A;  2A6T A;  2ZXH A;  1LB2 A;  1DP7 P;  2H1L A;  4MNU A;  3ECO A;  2ZME B;  1G3T A;  3TED A;  3FXM A;  2R93 J;  5FLM J;  2VKH A;  5FGM A;  1YQA A;  1ORK A;  3SQN A;  2DMU A;  2EZK A;  5E1X A;  5DDG A;  3IC7 A;  4A5N A;  4A3G J;  3CCM I;  1FTZ A;  2HR3 A;  2BV6 A;  1U0J A;  1KGS A;  2P8T A;  2C6Y A;  3GLX A;  2DA7 A;  1XGM A;  2BBY A;  2VKE A;  3MN2 A;  2PMZ A;  4P1W A;  4XLH A;  5J1Y A;  4PK4 A;  2VT2 A;  3SZG A;  3P7N A;  2QQ8 A;  5ICG A;  2CUZ A;  2M7B A;  2JPC A;  3ERE D;  1Y0U A;  1O3S A;  1OCT C;  1ZRC A;  3E1S A;  2I10 A;  4IHW A;  1AKH B;  1Y8Q B;  5EF6 A;  2ZKZ A;  1YFH A;  3DFG A;  3OYH A;  2LTP A;  2CGP A;  5DD8 A;  3FXJ A;  3PFI A;  1IN4 A;  3REO A;  1BC7 C;  1JKQ C;  1Q1H A;  3J80 K;  1PJR A;  3BTC A;  3TO6 A;  2FD5 A;  4HBL A;  2XV4 S;  1G6N A;  1E3O C;  2WAE A;  1D5Y A;  2KIS A;  2HEO A;  4OU0 A;  3TW6 A;  2Q2E A;  1MKM A;  1TWC J;  1WHU A;  2KT0 A;  3DPL C;  5LBQ A;  2AHQ A;  4R1H A;  3OY9 A;  1NG7 A;  3I4N J;  1V4R A;  3Q9S A;  2R7O A;  2F4O B;  2GXG A;  1HKS A;  3N4M A;  3DV8 A;  3BR0 A;  4MEY F;  5HDK A;  2F6C A;  1G8X A;  3GTJ J;  2F5D A;  2WBM A;  2YSR A;  3PSI A;  2ZFW A;  2V1N A;  2QCO A;  2F5V A;  1JUP A;  1IDY A;  3JRD A;  3JRB A;  2QQ9 A;  3CUO A;  1FBQ A;  2DBB A;  1CQT A;  2V1D A;  5ILU A;  3BG5 A;  4NQW B;  2L9R A;  4Z2Y A;  5LGN A;  3I56 I;  5FLX K;  3KP2 A;  2MBF A;  1UHW A;  4K2E A;  2A3S A;  1ETX A;  2BW3 B;  3H5N A;  2GOX B;  1FSE A;  3QRF F;  3M9A A;  3BJ6 A;  1Z67 A;  1B72 A;  3WG9 A;  4YIR X;  2EB7 A;  4I02 A;  1XG1 A;  1ZRF A;  3B73 A;  4XN3 A;  1FYM A;  2R7R A;  3RKY A;  1HDP A;  2E7X A;  2XAQ A;  1XMX A;  4MEX F;  4LK1 F;  4CDG A;  1CF7 B;  3RPU D;  3HOT A;  1TW2 A;  2HDD A;  3HOX J;  3PQJ A;  1SAN A;  4WF2 A;  1Y39 A;  4HF1 A;  1TP4 A;  4AWX B;  3I0T A;  4BH9 A;  2EPF A;  4IOC F;  4LK0 F;  1YIJ I;  2V1X A;  3AG1 H;  3HOW J;  5K5O A;  2L01 A;  1Z3X A;  2OD5 A;  3GCM A;  2X0L A;  1LVK A;  2JSC A;  2L0K A;  4DW6 A;  2B9S A;  1GVJ A;  1BN5 A;  2L5Q A;  2W25 A;  5TIS C;  1X1C A;  4EJO A;  1BL0 A;  2DMN A;  3JSP A;  4KIC A;  3CDL A;  1R36 A;  2FRH A;  4BQO A;  1B9N A;  1FSH A;  1X58 A;  3IRQ A;  5DCM B;  2LG4 A;  2VBX A;  2Z2S B;  2LC2 A;  1SD7 A;  2B63 J;  3DBH B;  3WU0 A;  1QHH D;  4UY8 I;  2VPR A;  4QSH A;  4M3F A;  1RIO H;  4RGU A;  4D9J A;  3F21 A;  5L3F A;  3K4K A;  4RGR A;  5E3L A;  2WAQ A;  2VC0 A;  2PFB A;  2XGX A;  2R4G A;  1X1P A;  2BY3 A;  2Z16 A;  3BJA A;  3NEU A;  1OFC X;  4BHB A;  3I54 A;  4NUB A;  2H8W A;  2IPQ X;  2BXZ A;  3BG7 A;  4H0E A;  1TQP A;  3BG6 A;  2IRF G;  5DM6 F;  4XKB A;  1ACI A;  2P6T A;  2R7X A;  3GO5 A;  4M3D A;  3S93 A;  3ERM A;  3J80 Z;  2KLO A;  4MHG A;  2DMP A;  1RR8 C;  5D6E A;  4HDV A;  4MO7 A;  5IP7 J;  1Y8R B;  2HYF A;  4MFD A;  4NC6 A;  4XR6 A;  4BDZ A;  2R7D A;  4EJW A;  4U0Y A;  4P96 A;  3IP4 B;  1KQ9 A;  4KNY A;  1J59 A;  3SZT A;  3EPZ A;  1VQ9 I;  3WG7 H;  3CC4 I;  1HW2 A;  1LE8 B;  2M45 A;  3BR3 A;  3GEZ A;  4Y7N J;  3CUQ B;  4LIV A;  1W7P A;  2KZG A;  1AA7 A;  2CW0 F;  5KAF C;  3D1N I;  4XSZ F;  4OIQ F;  4BHP A;  1HKQ A;  5FRO A;  3WTX C;  3WTV C;  3DF8 A;  1D1B A;  2EIN H;  2W1O A;  3I5U A;  4AC0 A;  4RAZ A;  5B5E C;  3WGI A;  5IP6 A;  3F8F A;  2E5Z A;  2VON A;  4HST A;  1SVO A;  3C1D A;  2X1C A;  1TQI A;  5FLX Z;  1H89 C;  2X9D A;  1DU6 A;  4EEF G;  4N4N B;  4W97 A;  1WI9 A;  3FDY A;  1SAX A;  5J47 A;  2K9S A;  1NTC A;  3JTG A;  2H94 A;  1R5H A;  3HTU A;  5F6F A;  5FD5 A;  4C30 A;  4DYR A;  1APL C;  1PP8 F;  4JX6 A;  4AYB N;  2VL8 A;  4C3J J;  4KA4 A;  5K5Q A;  3KP4 A;  2HQR A;  1I6H J;  4FHT A;  4WXC A;  4HF2 A;  2HXO A;  4M6Y A;  2LBF B;  3ZQF A;  5CVI A;  5IT3 A;  4LIT A;  2QSH X;  4UUS A;  1YW9 A;  4M9X A;  5DS9 A;  1ZG5 A;  2PJR A;  2VI6 A;  1MIJ A;  4HLY A;  4AIJ A;  4EJT A;  3GYH X;  2NS0 A;  3QWL A;  2HTJ A;  3F9K A;  3OIP A;  1NK2 P;  1LEB A;  3I64 A;  2A5W A;  4EM1 A;  3FHZ A;  2EFO A;  1RKT A;  1V54 H;  1D1A A;  4U0V A;  4XRS A;  1JHF A;  1X1B A;  1VQP I;  3OYC A;  1KYZ A;  3GVA A;  1X1A A;  3HOV J;  2BXY A;  1W4M A;  3BPX A;  3QP6 A;  3ZQQ A;  1IGN A;  1RET A;  4PSX A;  3A4C A;  3A0H C;  3HEF A;  5GAH J;  2R7W A;  5JHU A;  1VQN I;  4IPA A;  4A12 A;  2A69 F;  3FIS A;  2WV1 A;  4ZYG A;  3GFJ A;  3LSJ A;  3RTR A;  2RVC A;  3F8B A;  3PFY A;  3ZCO A;  3GTP J;  3RKX A;  1H9T A;  2ISZ A;  4F7Z A;  3M1C A;  3RQ4 A;  2LRE A;  1ETO A;  2HGC A;  3LFK A;  4YIF A;  2QSG X;  3BTL A;  3FXO A;  3MEX A;  4LIU A;  4ZDP A;  3CC2 I;  4EJV A;  4M6V A;  2DOF A;  2LY1 A;  3ABM H;  4RB1 A;  2EFP A;  3CCU I;  1REP C;  1IDZ A;  1S3J A;  4XOT A;  2E1M C;  3VOD A;  3T0Y A;  3DU5 A;  3S17 J;  2CUJ A;  1MBG A;  4ZYD A;  3ZOB A;  4EM0 B;  2QSF X;  4D7N A;  4I0A A;  4CA0 A;  4UB6 C;  4UUT A;  4XOR A;  5D5W B;  4L5E A;  1Q1V A;  1QGP A;  2G0E A;  3F8M A;  4CYC A;  4GFB A;  2ME0 A;  4G6D A;  3JAM K;  1WJD A;  2O9L A;  2E60 A;  4RBO A;  2R5Y A;  5M5W J;  1O7F A;  4MTE A;  3RZD J;  4ENM A;  3PIP F;  2K4J A;  3RJP A;  3E5U A;  3H9G A;  1J7K A;  2L54 A;  3TO9 A;  3G4S I;  1Z3Y A;  5J6X A;  3GTL J;  2H8R A;  4LG0 A;  3K4B A;  1VQL I;  3OYG A;  2NNN A;  6PAX A;  2F5C A;  3TKY A;  4IJA A;  4PDK A;  1Y1V J;  4MIM A;  5KVR A;  2MC3 A;  5KNL A;  2Y9Z A;  4XRF A;  5K5R A;  1D1C A;  3S3M A;  1ZEL A;  5LRR A;  3I4M J;  2WAD A;  3H9Q A;  3EYI A;  3HGY A;  1IXC A;  2BOL A;  1G4D A;  1QBJ A;  1WI3 A;  2ESN A;  3WU2 C;  5GTI C;  4FTH A;  5J1U A;  4BAC A;  2Y69 H;  4JBA A;  1WSU A;  3BC8 A;  3PNT A;  5EEH A;  5CVU A;  3FK6 A;  3BLY A;  4H4K C;  4N9I A;  3ZQI A;  1EH8 A;  1TL8 A;  1RUN A;  3OSF A;  1SFK A;  3CD6 I;  1MMD A;  3G1L A;  3QP5 A;  1TBX A;  1VF9 A;  3PIO F;  1IN6 A;  4ENN A;  2LKX A;  2VQH A;  1JT0 A;  1TNS A;  4XL9 A;  1FYK A;  4HNT A;  1ZRD A;  2O7O A;  2STW A;  2XAS A;  1BBY A;  2HPM A;  4F3Q A;  5HNF A;  3LSP A;  1U8B A;  5EZH A;  2KL4 A;  1FJL A;  3HL2 A;  5K7F A;  3AL0 C;  4L9N A;  4I6Z A;  2P7C B;  5C4J J;  4RM3 A;  3CC7 I;  4MQ9 F;  4EGZ A;  1KQ8 A;  2JUG A;  4FX0 A;  2ZXW H;  2J5P A;  2LD5 A;  1TQM A;  1WQ2 A;  1K61 A;  5GAE J;  1BI0 A;  2HNH A;  4LB5 A;  1IO2 A;  1EV7 A;  4UB8 C;  3OYJ A;  1K4T A;  2DMQ A;  2E35 A;  2HDW A;  4XRS G;  1AHD P;  1WJB A;  1IV6 A;  3FMR A;  1HCR A;  3VSK A;  4X6A J;  1D0Y A;  5M5Y J;  4Y3O A;  5M3M J;  3MD2 A;  4ZH4 F;  3QQA A;  2E2I J;  1DUX C;  3R0J A;  2EK5 A;  4Q4Z F;  1T38 A;  4IEJ A;  1Y1W J;  5J8F A;  2VB6 A;  4L9J A;  2Z9O A;  3CCR I;  2HTS A;  3CO6 C;  5K7H A;  1B8I A;  2O6G E;  4S05 A;  4OMY A;  1QNT A;  4IL6 C;  5BMZ A;  4BEH A;  1NHA A;  3LSI A;  2UXN A;  1R9T J;  3CCJ I;  5ILS A;  1ETQ A;  2R5Z B;  2A68 F;  1BR2 A;  1OJL A;  4RB2 C;  1YIO A;  1ETK A;  5B3S H;  3OYM A;  3OYI A;  5K1Y A;  2W00 A;  3N97 A;  2NRA C;  3FM5 A;  1S9H A;  3K9T A;  4ZZL A;  3TMO A;  1K78 A;  1ZK8 A;  3G71 I;  4L18 B;  5LLQ A;  1BOA A;  5JLX A;  2K3P A;  4CSW A;  2TCT A;  2AXL A;  3F8C A;  4FCY A;  5L3B A;  2YS9 A;  3RPU A;  5KCM A;  1PUE E;  3TDZ C;  3ABT A;  1JTY A;  4IHS A;  3BQY A;  1FBS A;  1OYI A;  2QKM B;  3IV5 A;  4ZJZ A;  1L3L A;  1JGG A;  1JUS A;  2XAG A;  5IYC J;  3K7A J;  4O6J A;  4GO1 A;  3MKW B;  4GYG A;  3HKZ N;  1Y0N A;  3ZQL A;  3VYT B;  1TWH J;  4JX5 A;  3TQN A;  3GXO A;  2KFD A;  1P6R A;  5DTD A;  2DOE A;  2PMH A;  5LHH A;  4ESF A;  1IG7 A;  4QTR A;  4U87 A;  1QQI A;  4E7K A;  2ZNY A;  1QPI A;  2DCE A;  3ASN H;  4ANJ A;  2KQR A;  3IH3 A;  1WVR A;  1IN8 A;  4ZTF A;  2LNB A;  2Q8K A;  5IPA A;  4BXU A;  4E7H A;  3VEP A;  4O5V A;  3RYP A;  3MVP A;  4ABZ A;  2XKO A;  3FXU A;  2FQ3 A;  4HEA 2;  3HHH A;  4G8X A;  1IJW C;  2YX7 A;  2BY0 A;  1OYY A;  1R4M B;  4UV9 A;  4XIC A;  4QLC U;  4UUV A;  2FA5 A;  1ZRE A;  4IX7 A;  4QIW N;  3VYU B;  3ZQH A;  3OYE A;  4I2O A;  1XCV A;  5F08 A;  3MZY A;  4XON A;  2LH9 A;  3OYD A;  2BY1 A;  1RZ4 A;  2ELK A;  2O8K A;  4NB5 A;  2KDO A;  4RAY A;  4XRM A;  2VQG A;  4A69 C;  4XLE A;  3GFI A;  1FOK A;  1VQ5 I;  2K9L A;  4UV8 A;  4UHT A;  2Z5U A;  2EIM H;  2W57 A;  2DOA A;  4BY7 J;  5TGT A;  3AAF A;  4A6D A;  4JQF A;  4BE2 A;  2HQ5 A;  5DCF A;  1GVD A;  5FD6 A;  1MSF C;  3RQI A;  1UEL B;  4CGZ A;  1ZGW A;  4A3E J;  2L7M P;  2RNJ A;  3SEQ A;  4M3B A;  1YE9 A;  1FBU A;  3E3V A;  1PUF A;  4I76 A;  1DPR A;  5L3G A;  4BYY A;  2YUS A;  3H0G J;  2IS6 A;  2VOD A;  4RAF A;  4XMY A;  5IOY A;  1UHM A;  4GYI A;  2XRO A;  2XKP A;  2MGQ A;  1UZC A;  2JTV A;  2TRT A;  1Z1D A;  5ICC A;  2WA0 A;  4LB6 B;  5DYM A;  3J7Z I;  2OCE A;  1K6O A;  2OC6 A;  3FHN A;  4D1Q A;  4DYC A;  5K7Z A;  3D5R C;  3DPT A;  1YG2 A;  2BE5 F;  3HUG A;  4AYB A;  3ZMV A;  1R71 A;  2CWE A;  3OIQ A;  2LY9 A;  1TLH B;  2A5Y B;  5DUI A;  4AUX A;  2LY2 A;  1S7A A;  3E6D A;  2QLZ A;  2XSJ C;  1ZAR A;  2I5U A;  2A05 A;  2M5W A;  3M4O J;  1T98 A;  3K4M A;  1E0E A;  1ENH A;  1C0W A;  2MW8 A;  3BZC A;  1A04 A;  1R1U A;  3K10 A;  5CLS A;  2WY7 Q;  4M3G A;  3CZ6 A;  1F5T A;  2LF8 A;  3A01 A;  2DJN A;  5HDN A;  2ID6 A;  2X6W A;  3F8N A;  1WJ5 A;  2K02 A;  2W4S A;  3I4P A;  5C4X J;  5M3F J;  1P92 A;  3Q5F A;  2M3A A;  3K2A A;  2RC4 A;  2IA2 A;  2Q2E B;  2FBI A;  3WOD F;  3WE2 A;  1Y6I A;  4CZZ A;  2ECB A;  4FET A;  4E7Z A;  2CFX A;  3UR3 C;  3RI4 A;  1BW6 A;  3DKY A;  2CH0 A;  2DT5 A;  1KZH A;  2DFI A;  3VYS B;  1WJF A;  2QUF A;  5FO5 A;  2VOP A;  1IF1 A;  4FAS D;  2IEK A;  2HDC A;  1XGN A;  3GW2 A;  1RC9 A;  2JJ7 A;  4N9H A;  2L02 A;  1S7E A;  3HYI A;  3JW4 A;  1ONV A;  1YOV B;  3OWT A;  3GZ5 A;  1ZH5 A;  4I09 A;  1FYL A;  4G6Q A;  3S15 J;  1R4N B;  3K70 D;  5L3D A;  5CVV A;  3GFM A;  1VQK I;  2WWY A;  4XKW A;  2HVS A;  3VWB A;  4MQV A;  2RRE A;  4RLQ A;  2VBW A;  4KUM A;  1PP7 U;  2CW8 A;  2O5R A;  4ESB A;  3LST A;  5FFZ A;  2O3F A;  2QYO A;  3I59 B;  1LVA A;  1SD4 A;  2AXT C;  4OIN F;  2L4A A;  4A3M J;  2OPT A;  3BTI A;  4AVZ A;  2L4M A;  2WV0 A;  1ETY A;  3OS0 A;  4XLA A;  2FNA A;  1RNL A;  2V9K A;  4EAT A;  3K4N A;  5B66 C;  5BOX A;  2PG4 A;  3HXL A;  5EGO A;  2JA7 J;  4EMS A;  1P7I A;  2KRF A;  1HLV A;  4PJ0 C;  3JRA A;  2HOT A;  3DPU A;  1S8N A;  2X4H A;  1IZ1 A;  1MJA A;  5FB2 A;  2R3S A;  4BQA A;  2PLY A;  1XPX A;  5H2F C;  2V6E A;  2VQL A;  3WGG A;  3QPS A;  4KT5 C;  3GF2 A;  4LFU A;  4E7S A;  2JA5 J;  3O3K A;  5JR3 A;  2Z33 A;  4II3 A;  2EA2 A;  1XS9 A;  1ERD A;  3TL4 X;  2XIG A;  4FE7 A;  4V19 K;  3IAS 2;  1KU2 A;  4KJZ A;  2GWR A;  2BEO A;  2AQE A;  3W6K B;  4BHC A;  2K27 A;  2DFH A;  2L7Z A;  2IT0 A;  1QVT A;  3T5X A;  1E17 A;  3KFW X;  3J7A O;  2ZJQ F;  3HRU A;  1PVE A;  3HHG A;  5JLW A;  3OOU A;  2UWM A;  3EUA A;  3R4K A;  3OYK A;  4RLF A;  3ZRG A;  3TGN A;  2FUG 2;  5J4Y A;  1N77 A;  3JR9 A;  2NOJ B;  2JPB A;  2XF7 A;  2ZBK A;  2R7T A;  2ZXI A;  4G7Z F;  4BU2 A;  3CMA I;  1I6X A;  3FBI B;  2OCC H;  3MKY B;  1ZR2 A;  3BZK A;  3QAH A;  4E4H A;  1VQM I;  4YG2 F;  2M2E A;  2E1N A;  2XDV A;  5FKK A;  5ICF A;  1Z05 A;  2CUF A;  2P7V B;  4YFN F;  1DDN A;  5JVG F;  1NG6 A;  3J7Y J;  4EQQ A;  1B9M A;  2G9W A;  2ELJ A;  3OOP A;  4L5J A;  2JRM A;  2LYC A;  2OU2 A;  4F55 A;  1IW7 F;  4Y13 A;  4KIG A;  2CFO A;  2IA0 A;  3QYF A;  4PCQ A;  3U2R A;  4DBR A;  3HPG A;  4B09 A;  4PFO A;  4HW0 A;  3A0B C;  4ENJ A;  2E7W A;  1KU3 A;  1GV2 A;  2ZME A;  3AG4 H;  3TDU C;  5FJ8 J;  4G7H F;  2DMT A;  4IHX A;  1J0R A;  2E1O A;  2BHZ A;  2GZW A;  3HB9 A;  5HS7 A;  3FMQ A;  1Z7L A;  1D3Y A;  1RKW A;  3G73 A;  2OV7 A;  1NK3 P;  3QU6 A;  2EFN A;  1ZHF A;  1Z7U A;  2K40 A;  3L1P A;  1QHG A;  4WCG A;  3U9G A;  2D1H A;  1UHS A;  3OMY A;  2K9N A;  4C2M J;  1HST A;  4IZZ A;  4XID A;  3SFI A;  1MND A;  2EV6 A;  2LLK A;  2KP6 A;  3R60 A;  5CVR A;  2KPM A;  3V7C A;  2OA4 A;  1R00 A;  3BZ6 A;  5LEJ A;  1AKH A;  3HPH A;  3PNV A;  3HTS B;  3HOZ J;  4JP0 A;  1MBK A;  3J81 K;  2VXZ A;  4ZTJ A;  2X1E A;  3ZMS A;  1T08 B;  1XC5 A;  2G7H A;  2V4J C;  3H0D A;  1A31 A;  4IQJ A;  2V1U A;  2IXS A;  3K4C A;  4PFP A;  1D0X A;  1HKT A;  4F52 A;  4ZDL A;  2DA4 A;  2GOM A;  5F64 A;  5B1A H;  2IJL A;  1IRZ A;  1W5S A;  5KK1 A;  3F23 A;  4IO9 F;  3K2Z A;  2PJR B;  1QZY A;  1RRJ A;  1MDM B;  2BY2 A;  4HQM A;  5FLV A;  4AM3 A;  2EZL A;  1FPQ A;  3S32 A;  5IY5 H;  2K7L A;  1TWF J;  2JRT A;  3CO7 C;  3P5J A;  2QBY B;  3HKZ A;  1J09 A;  1QRY A;  4CCJ A;  4OIO F;  1ZYR F;  5DUK A;  4HV6 A;  3CES A;  1IC8 A;  3K6G A;  5ED4 A;  2VPL A;  1SMT A;  1UB9 A;  1FMV A;  5EJC A;  5ERI A;  1SEU A;  1S72 I;  2DU9 A;  2HOS A;  4I7H A;  4KFC A;  4AVP A;  2ME6 A;  1U5T B;  2DI3 A;  5IYB J;  4NQW A;  4M73 A;  1VQ6 I;  3U21 A;  3EUH A;  2ADU A;  1ETW A;  1YYV A;  2LP0 A;  2X6Y A;  3RDI A;  2BW3 A;  5F1R A;  4CH7 A;  2UV1 A;  3CDI A;  4I01 A;  4QWQ A;  2MLG A;  3PNY A;  1X3W B;  1IRG A;  1VND A;  4E70 A;  1R6R A;  1FLI A;  1MBF A;  3BG3 A;  2KJB A;  3CF2 A;  2QF7 A;  3TW7 A;  1WH5 A;  1RES A;  3LSM A;  2RV8 A;  1YRN B;  2M8E A;  2G7U A;  3Q0U A;  4CZC A;  1XSD A;  2B0L A;  1CF7 A;  1LDK B;  2F5E A;  3CP2 A;  1XCB A;  1GDT A;  1WCM J;  4ZDO A;  2BHY A;  4I99 C;  5CJ9 A;  1SD6 A;  3GZN B;  3SYT A;  4DQ2 A;  1FIA A;  2NAZ A;  2DQL A;  3EQL F;  4GDF A;  2HVQ A;  5D8K B;  5HOD A;  3NWT A;  3NWS A;  5HLG A;  3QOP A;  2Y75 A;  2VUM J;  2DFF A;  3DQV C;  1F1Z A;  3EDP A;  3WTU C;  3AG2 H;  2DPU A;  4NNJ A;  4X1E A;  2VBY A;  1DP3 A;  1LJ9 A;  5EEG A;  3ZN0 A;  4A3J J;  4HG2 A;  2QVO A;  3KX2 A;  2DTR A;  2RNG A;  2JWT A;  1LEA A;  3Q9V A;  5LEK A;  2RQQ A;  2VJ4 A;  5DCM A;  1GXQ A;  2DYS H;  3LL7 A;  5LRS A;  2R0Q C;  1T56 A;  3ZQG A;  4PZJ A;  3HOY J;  1MJ9 A;  3FKJ A;  4KIF A;  2FEZ A;  5EG0 A;  1VQ8 I;  4DYQ A;  1SFX A;  1R58 A;  5CKT A;  3DP7 A;  3BR1 A;  1KA8 A;  1XGO A;  3HSF A;  3KEO A;  4J01 A;  1VFC A;  3R6S A;  2GBY A;  1W36 D;  2XPW A;  1OR7 A;  2M0M A;  3J81 Z;  1MBJ A;  3C7J A;  2RN7 A;  5F27 A;  1IRX A;  3ZN1 A;  3I55 I;  2VKV A;  5FRM A;  3E5X A;  5IP9 J;  2M4K A;  3LAJ A;  2OAZ A;  3DLL F;  3E7L A;  2DK8 A;  2VKD A;  2HXI A;  3WE3 A;  2Y31 A;  3BJO A;  3GX4 X;  3DEE A;  1X4O A;  2DA2 A;  3EET A;  2VT3 A;  1Y56 A;  1W1W E;  4E7L A;  4CCO A;  4CYD A;  4I0B A;  2ZME C;  3MCZ A;  3OYB A;  4P5O A;  1J9I A;  1FOX A;  3X2Q H;  3ZQ7 A;  3PL8 A;  5F0H A;  1MBH A;  2M1B A;  3MAJ A;  4L9V A;  2EIJ H;  5GTH C;  2GXB A;  1Z9C A;  1QU3 A;  1MJB A;  1X3Z B;  5LHI A;  3CJN A;  4XLP F;  5E17 F;  1LE8 A;  5D5U B;  4LJZ F;  3ABL H;  1ULY A;  4EJU A;  4B8X A;  3CUQ A;  1T8I A;  2XAJ A;  3BP8 A;  4BAY A;  2KMU A;  2F4I A;  4M3E A;  2IGM A;  2R7F A;  2X48 A;  1JXS A;  2KZV A;  2JN6 A;  3AFH A;  2R7Q A;  4HYE A;  3SJM A;  3W6V A;  4NHJ A;  2FX0 A;  2Y0S N;  1ETV A;  5FFX A;  1UST A;  2IA1 A;  3S3O A;  2DA6 A;  2MFZ A;  1EF4 A;  3IWZ A;  4DIQ A;  5LGT A;  1H8A C;  5IYD J;  2D5V A;  4FE4 A;  2OZU A;  2EH3 A;  3WTW C;  3FKI J;  1SC7 A;  4DNC A;  3DKW A;  4BEH B;  5AON A;  1IRF A;  1SFU A;  3K1P A;  2IGN A;  2DYR H;  1I5Z A;  3MZH A;  2AO9 A;  3VB2 A;  1V5E A;  1YJN I;  3ABK H;  5J1R A;  2MA3 A;  3OYF A;  1J5Y A;  1XMK A;  3LA3 A;  1LFP A;  2M9H A;  5BS6 A;  1BJA A;  2LBF A;  5FKL A;  1S5L C;  1YIT I;  3CMY A;  1E3H A;  2IGK A;  4OAY A;  4HNV A;  2GIV A;  1V5F A;  1UG0 A;  4ITV A;  2PQ8 A;  1FY7 A;  3K1M A;  1XX5 A;  2X6X A;  3P9C A;  2ZJP F;  1DGR M;  1ODD A;  3S1R J;  1RI7 A;  3M8F A;  1IUF A;  3OYL A;  1I1S A;  4LGW A;  2NS8 A;  2Z1D A;  4Y15 A;  3GLL A;  3CJQ B;  3KYL A;  2RKH A;  2LFB A;  2P0W A;  4HZF A;  4L0Z B;  1W0U A;  2EJR A;  1IV8 A;  4BBR J;  1KYW A;  3EYY A;  3C2H A;  2CMP A;  3ROU A;  4DOZ A;  3EUH C;  1H9G A;  2LOO A;  1R49 A;  2DA3 A;  3DXJ F;  3QYE A;  5GPA A;  3TP0 A;  4WK8 F;  3E5Q A;  4G9Y A;  1T95 A;  3FF5 A;  4A3D J;  1HF0 A;  2D1V A;  1YI2 I;  4HAM A;  3W6J B;  1SFE A;  2NS7 A;  3HRT A;  3K1N A;  4C3H J;  1K6Y A;  3HM5 A;  1U2W A;  3CF5 F;  2JVH A;  3BY6 A;  3CJT B;  3HGG A;  3BDD A;  4GXO A;  3JRG A;  4A2U A;  1X2M A;  3BQZ A;  4HDU A;  1U78 A;  3D5L A;  4RDU A;  3SFZ A;  1J2X A;  3ABU A;  1ZQ3 P;  2O61 A;  5J3L A;  4CIC A;  2DLL A;  1YW7 A;  3F6V A;  2V7F A;  1JE8 A;  1E2X A;  1IAW A;  4P55 A;  4CCK A;  5HLH A;  3FWE A;  4UVB A;  3M7G A;  9ANT A;  1B59 A;  2X1D A;  4WWC A;  5DM7 F;  5B1B H;  1Z6R A;  2CJJ A;  1WH7 A;  1WJA A;  3F0C A;  4KIT B;  2E34 A;  3DLA A;  3H1C A;  4R8H A;  3BOQ A;  1S6L A;  2ELH A;  2IAI A;  4M6X A;  1O4X A;  1R5I D;  1YX5 A;  2ZSI B;  3FXQ A;  3RKQ A;  4XK4 A;  3JAM Z;  2K86 A;  2EV0 A;  4A0Z A;  1W5T A;  2W84 A;  1DPU A;  4A3K J;  1FZP B;  3W2V A;  1PUF B;  3CLQ A;  2Z3Y A;  3DU6 A;  3G3Z A;  2DT7 B;  2QKL B;  1U9O A;  2RQP A;  4NC8 A;  4ETS A;  5F1J A;  1G3W A;  4KT6 A;  5E8I A;  1OR7 C;  1GUU A;  4XM3 A;  4B1R A;  2LDU A;  4G7O F;  2ZJR F;  3S1Q J;  1UAA A;  1UCR A;  2R7V A;  5LHG A;  1ON1 A;  2CU7 A;  2XGD A;  3VPR A;  4L9T A;  3W2A A;  2LSO A;  3H3U A;  1MNM C;  1S7O A;  2MD0 A;  1YTY A;  2KDZ A;  2MD5 A;  5BPI A;  2L9V A;  3I3L A;  3JRI A;  3H5R A;  2CV0 A;  2WAQ N;  4M74 A;  2IBD A;  2FMY A;  2XF5 A;  4F92 B;  3B6A A;  2VN2 A;  3OSG A;  2FBH A;  4DGW B;  3U1K A;  2HU9 A;  3RSN A;  2D45 A;  1SD5 A;  4YEJ A;  3A1Y A;  4XNF A;  1SMY F;  3CJR B;  3CUQ C;  2VE8 A;  2VLA A;  1O3Q A;  1MSE C;  2HVR A;  4G6T B;  1W7P D;  1MW7 A;  5GPC A;  4XQF A;  2NVX J;  1X3U A;  2LF7 A;  1U6G A;  2H6C A;  3HG9 A;  4Q48 A;  4FIS A;  1ZG3 A;  3L09 A;  1I50 J;  3KP3 A;  4BJ6 C;  3CDH A;  5E3O A;  5HVQ C;  1G2H A;  4R79 A;  1KU7 A;  1UJ8 A;  3L2Q A;  4QPQ A;  2COB A;  4PUS A;  4XSX F;  1X4P A;  4V2G A;  2QM3 A;  4MGR A;  4A3B J;  5JVT A;  3OL3 A;  2MG4 A;  1WGX A;  2L2O A;  2FE3 A;  2DA1 A;  1YX3 A;  2OZ6 A;  2V9V A;  4BJ5 C;  1T0F A;  2PMU A;  4D5C A;  2M4G A;  2O0Y A;  2R5Z A;  3UKG A;  4NBQ A;  3H3V K;  2XF6 A;  1P2F A;  1SAU A;  1JUM A;  1Z21 A;  2HQN A;  4IRH A;  2EA4 A;  2ZJ2 A;  3Q0W A;  3S3N A;  4IQ4 A;  1GV5 A;  3F72 A;  5H20 A;  4ASN A;  4RAG A;  5A2Q K;  3LSH A;  1N25 A;  2KRC A;  4BNC A;  4L0Y B;  2JZY A;  3W2W A;  4OIP F;  5ICE A;  1N78 A;  2F48 A;  1WZ2 A;  3OYA A;  1ZR4 A;  1Z91 A;  2MYS A;  2CV2 A;  4IKF A;  2EIL H;  2E1C A;  4Q5S F;  3BTJ A;  4RA2 A;  2H1K A;  2JT1 A;  1HXD A;  1DU0 A;  3I71 A;  4U7B A;  3GZ6 A;  1MMS A;  4CHU A;  3KPH A;  2Y48 A;  4Z6Y A;  3AKZ A;  3CQZ J;  1R7J A;  3CTA A;  3ZP5 A;  3CCQ I;  2R7U A;  2ESH A;  4BJT A;  4KDP A;  3VSL A;  1JHH A;  1ZGA A;  1R5G A;  2DXI A;  1MBE A;  2VC1 A;  3M1E A;  5JHF A;  1AU7 A;  2CUE A;  2ZCW A;  3A02 A;  4IRG A;  2GA2 A;  4AIK A;  1A6I A;  2KIM A;  3HOS A;  2V26 A;  4V2F A;  4AD9 A;  2KKO A;  2L9S A;  1TWA J;  3QPH A;  5D5X B;  1JI8 A;  1YS7 A;  1IN5 A;  4PJM A;  2E71 A;  2WY8 Q;  3G1O A;  1JT6 A;  1GT0 C;  1VTN C;  2NVY J;  2Y30 A;  1ZG1 A;  4IHY A;  2IS2 A;  2MC4 A;  2NXN B;  3FBN B;  2Z99 A;  1ZGJ A;  1JKR C;  4YII A;  3I9V 2;  2EFW A;  4B47 A;  2KIU A;  1HC8 A;  2UZK A;  2M8G X;  2ZNZ A;  4IRI A;  5D4S A;  1BJZ A;  1XB4 A;  2V79 A;  4XLN F;  2ETH A;  2QQB A;  3GFL A;  3MFK A;  4ENK A;  4O3M A;  4ZC3 A;  3LNQ A;  5AIP A;  3GTM J;  1GHC A;  2VIX A;  1OCR H;  2HZT A;  4D5F A;  2LRD A;  1B72 B;  2QQA A;  5LD2 C;  3RKW A;  3CCE I;  4UXN A;  2JSP A;  5FRN A;  3O6B B;  2XPV A;  1XD7 A;  1EH7 A;  2Y0S A;  3LA7 A;  4A3I J;  2DPD A;  2CSO A;  1R1T A;  3M3Y J;  3A03 A;  3TBI A;  2GA1 A;  3S2D J;  2E1M B;  5H6R A;  4MTD A;  1OYW A;  5HS8 A;  3L9F A;  3KZZ A;  4MFE A;  1HQC A;  5CPR B;  5HLT A;  5BQT A;  2N8G A;  1OIS A;  1LDJ A;  2VJ5 A;  4XLF A;  1LKX A;  4EV0 A;  2LKS A;  3RPQ A;  4LLL A;  4HNU A;  1P4A A;  1FOY A;  5FKO A;  3OR1 C;  4XN0 A;  1X2N A;  5J4V A;  2DQR A;  2DFE A;  1I1G A;  4LOC A;  2LVS A;  4M71 A;  4E7I A;  4A3L J;  3IUO A;  3GWZ A;  1U3E M;  3GBG A;  1QPM A;  3LOC A;  2UXX A;  3KP5 A;  2XC7 A;  3E6B A;  3R0A A;  5F04 A;  1JGS A;  3FXR A;  2GIZ A;  3LA2 A;  1OCZ H;  5A2Q Z;  4N0B A;  1SVL A;  2YU9 J;  3WHC A;  1UFM A;  3CP8 A;  2DN0 A;  3FIW A;  3OYN A;  1PDN C;  2WC2 A;  3S8P A;  3LSK A;  4GGG A;  1KU9 A;  1LQ1 A;  1I27 A;  2K5C A;  1BM9 A;  1ZKG A;  4BE0 A;  1RR7 A;  2CYY A;  1YHQ I;  2MH9 A;  5IOZ A;  1R23 A;  2GLO A;  2V9P A;  1FTT A;  2PX9 A;  3FM3 A;  2QGU A;  2LK2 A;  5JFR A;  1V5G A;  1B4A A;  4YEL A;  3CCY A;  4AID A;  4IHV A;  1JKO C;  4C3I J;  1TWG J;  3PJR A;  4A3C J;  2DO7 A;  1FC3 A;  2IS1 A;  2J5O A;  3EUK L;  5KAI C;  3GTQ J;  2XAF A;  1UMQ A;  4UVA A;  3HIF A;  2QA4 I;  1T0F C;  1ZLJ A;  2E19 A;  3DTI A;  5FKN A;  1OPC A;  1DQU A;  3E6M A;  2OUM A;  3ZMZ A;  4B44 A;  2E36 A;  3HSE A;  3NAU A;  3ESW B;  1S29 A;  3HRS A;  3PUF A;  4Y4R A;  3E0J B;  4HF0 A;  1D0Z A;  3U1D A;  2PEX A;  3L00 A;  3K4J A;  1W7P B;  3AL0 B;  1U9N A;  1TTY A;  2ID3 A;  1OQY A;  1N75 A;  3I53 A;  3ONQ A;  2L7F P;  4PJL A;  4W1U A;  1IXR C;  1TT5 B;  1XSX A;  3I59 A;  3TOB A;  4XBF A;  4F93 B;  4XLC A;  1MH4 A;  4U7D A;  1QVU A;  2OTJ I;  3F6O A;  3JCU C;  4BQN A;  5LFA A;  3G2B A;  3QPT A;  5HOO A;  3D0S A;  2CO5 A;  2DAO A;  2JA8 J;  3ZR8 X;  1WRJ A;  3F3X A;  4BDY A;  1HBX G;  2Q1Z B;  3KYC B;  1J75 A;  5E1W A;  3UNG C;  1FOW A;  2NVT J;  1AWC A;  2X51 A;  3T1B A;  3WTT C;  3PM1 A;  5L3C A;  2BVL A;  3E97 A;  3IKV A;  5HNH A;  3HSR A;  2CW7 A;  3SHF A;  4Y17 A;  4HPQ A;  1O57 A;  1POG A;  4RB3 C;  4LD5 A;  3O8G A;  2ZC2 A;  3BR6 A;  3H5A A;  3FZV A;  2WB1 N;  5E3N A;  3HJE A;  3C3W A;  3DKX A;  4WXH A;  1GXP A;  3IAM 2;  4PJN A;  4BL0 B;  4UUS B;  3HOU J;  2FOK A;  1BR1 A;  2CQ7 A;  2K3F A;  2K85 A;  3JTH A;  3FX3 A;  1VQ7 I;  2STT A;  5IT9 K;  3QPL A;  3VOE A;  1F9N A;  2A61 A;  2CQQ A;  3GTO J;  1YO5 C;  4U88 A;  4HX8 A;  2Q0O A;  1SFO J;  1TNT A;  4S0H B;  1WJC A;  5EG0 B;  3E6C C;  2HOE A;  2L9N A;  3FK7 A;  1FX7 A;  4J19 A;  2O8X A;  3OR2 C;  3FXK A;  1MGT A;  5EEA A;  1W36 C;  3B02 A;  5L3E A;  2KRH A;  2I8D A;  4EM2 A;  1G3S A;  3HBL A;  2H6B A;  5GAD J;  3BG9 A;  4IVN A;  2FJ1 A;  2DTZ A;  1BA5 A;  2P81 A;  3ZGK A;  5E79 C;  1STZ A;  2GXA A;  4KYW A;  2K4B A;  3KEY A;  4Y33 A;  2QEN A;  1A36 A;  3F22 A;  4FT8 A;  1VQO I;  2E5N A;  1O7L A;  1XTA A;  4A93 J;  3C2G A;  2A07 F;  1B6A A;  3H36 A;  1K79 A;  1B1B A;  4RGX A;  3WU1 B;  1OCC H;  1K83 J;  4KIS A;  3PO3 J;  3CME I;  3GTK J;  1D5V A;  4WXD A;  3JRC A;  2A6H F;  3RYR A;  1FNN A;  3P9K A;  2NVQ J;  1ZLK A;  2XHK A;  2EFQ A;  3O8H A;  4C2T A;  3S14 J;  2KJC A;  4D0P A;  3JRH A;  2D2W A;  3FXL A;  4A0Y A;  1H88 C;  3ISP A;  4CXF A;  2FSW A;  4CYC B;  4RM2 A;  3VFZ A;  3SDB A;  4WX9 A;  3OL4 A;  1IUY A;  2R5Y B;  5GP9 A;  1EA3 A;  3LFU A;  2OTL I;  3HZJ A;  2EWN A;  3GME A;  3TP3 A;  5C44 J;  4A0X A;  2VOO A;  3DEU A;  4P9U A;  1R1V A;  2FNP A;  3OIO A;  2M87 A;  2FF4 A;  1HOM A;  3CCL I;  2DK5 A;  2BGC A;  3TOA A;  4LG0 B;  4J00 A; 
#chains in the Genus database with same CATH homology
 1FP2 A;  2HYG D;  5D6F A;  5E18 F;  3T8T A;  2O03 A;  2PBI A;  3LQQ A;  3KE2 A;  2YR2 A;  2H09 A;  1O3R A;  3WTZ A;  2FU4 A;  3L7W A;  3BWG A;  5ILV A;  2NYX A;  2YU3 A;  5D5V B;  3KZY A;  1MDM A;  3KCC A;  1IXS B;  3PQK A;  4CO8 A;  2QBY A;  4HX7 A;  3KLN A;  1XGS A;  2TDX A;  4FX4 A;  3S2W A;  2MH2 A;  4ZYE A;  2HS5 A;  1FP1 D;  5DEQ A;  5IT9 Z;  1HSJ A;  1XN7 A;  5D8L B;  4LLN A;  5LGU A;  1U5T A;  2BYV E;  2F5F A;  2VE9 A;  2V6C A;  1XSV A;  2GQQ A;  3IHU A;  1ON2 A;  4EVI A;  3K69 A;  4LLG F;  4JK1 X;  3IWF A;  4U0W A;  1HW5 A;  3ULQ B;  3V7R A;  1KQ0 A;  2EV5 A;  3CLO A;  2FML A;  5E8G A;  2HFH A;  5HLI A;  5DD4 A;  3COA C;  3ZMU A;  1XDU A;  5D4R A;  5H6Q A;  4PGH A;  2P5L C;  4AIH A;  1LDD A;  1XDS A;  1BC8 C;  3H3Z A;  1TW3 A;  4A5M A;  3LAP A;  4RB0 A;  5TJJ A;  1K78 B;  4PGG A;  2W24 A;  5HS9 A;  1T2K A;  1R22 A;  3NQO A;  1D8J A;  4KN4 X;  4RGS A;  4EGY A;  4TV7 A;  1ZN2 A;  4ZYH A;  2FXA A;  5JI6 A;  4HX4 A;  3HRM A;  2A6E F;  3IL2 A;  4OIR F;  3KEQ A;  4RS8 A;  1YLF A;  3SZP A;  2M30 A;  4KN7 X;  3V8K A;  1K7A A;  3ECH A;  3ZMT A;  3H92 A;  1F4K A;  1MD0 A;  2P4W A;  4KMU X;  2ISY A;  3KLO A;  4M9S A;  3JSO A;  3LQR A;  1U8R A;  4OMZ A;  1L0O C;  2P5K A;  2RDP A;  2IP2 A;  2HKX A;  3P9I A;  1USS A;  1AOY A;  2CG4 A;  3V8L A;  3V7S A;  3WGH A;  1IN7 A;  1G3Y A;  3FMS A;  1WWX A;  4HV5 A;  1MZB A;  2PN6 A;  5J8C A;  3KP6 A;  1BIB A;  1HW1 A;  1LNW A;  2H27 A;  3KP7 A;  2OQR A;  2XRN A;  2YX4 A;  2PI0 A;  4Q47 A;  2WTE A;  2IW5 A;  2Y0M A;  4L5I A;  3V4G A;  3ML6 A;  3WTY C;  2ZO4 A;  5DV5 A;  4KMF A;  3MWM A;  2F2E A;  1D8K A;  1ZAO A;  3WTS C;  4HOB A;  2PJP A;  2XVC A;  1P4W A;  4HLX A;  4KIB A;  3O2P E;  1QO0 D;  2QZ8 A;  4IXA A;  1U5T C;  4OOI A;  3LWF A;  2W85 A;  4M72 A;  3I58 A;  4HQE A;  2OQG A;  2VBZ A;  2LKP A;  1BI2 A;  1BIA A;  4IHT A;  3ELK A;  1QZZ A;  3IKT A;  3TO7 A;  2GAU A;  4IF4 A;  3QU3 A;  3MQ0 A;  1T6S A;  2XAH A;  2XUB A;  1T39 A;  3L2C A;  5AIQ A;  1XMA A;  2RGV A;  3SXY A;  2P5V A;  4M9Z A;  3R61 A;  1WKM A;  1YW8 A;  4GCV A;  3M8E A;  2L3D A;  3RIR A;  5TRD A;  3ZMD A;  1FT9 A;  3T8R A;  5HDG A;  4S04 A;  2COM A;  2KIF A;  2OBP A;  4UNO A;  1Z6T A;  4LMY A;  4YFX F;  2P6S A;  3K0L A;  1YS6 A;  4A6E A;  2AS5 F;  3IRR A;  2FBK A;  1OMI A;  4G94 A;  2NNY A;  4ESJ A;  2ACJ A;  3BRO A;  4UVC A;  3NRV A;  3C18 A;  2QWW A;  2HWV A;  3BPV A;  1FWZ A;  3ZPL A;  1O3T A;  1H0M A;  1P4X A;  4YFK F;  4I98 B;  5CVJ A;  1BI1 A;  3OV8 A;  3KET A;  4ON0 A;  1RUO A;  1CGP A;  5E20 A;  2CQK A;  2HKO A;  5CYV A;  3GUD A;  1OKR A;  4ZZD A;  3V8J A;  5E1Z B;  2DW4 A;  1V3F A;  2MLK A;  2YPR A;  2ZXJ A;  5BPD A;  4P9F A;  4HA8 A;  2IVM A;  1BI3 A;  1EH6 A;  1LB2 A;  1DP7 P;  4MNU A;  3ECO A;  2ZME B;  1G3T A;  5FGM A;  3SQN A;  1YQA A;  5E1X A;  5DDG A;  3IC7 A;  4A5N A;  2HR3 A;  2BV6 A;  2P8T A;  1KGS A;  2C6Y A;  3GLX A;  1XGM A;  2BBY A;  2VT2 A;  3P7N A;  5ICG A;  3ERE D;  2JPC A;  1Y0U A;  1O3S A;  1ZRC A;  2ZKZ A;  1YFH A;  3DFG A;  2CGP A;  5DD8 A;  3PFI A;  1IN4 A;  3REO A;  1BC7 C;  1Q1H A;  3J80 K;  3TO6 A;  4HBL A;  2XV4 S;  1G6N A;  2HEO A;  4OU0 A;  2Q2E A;  1MKM A;  3DPL C;  5LBQ A;  4R1H A;  1V4R A;  3Q9S A;  2GXG A;  1HKS A;  3N4M A;  3DV8 A;  4MEY F;  5HDK A;  2F5D A;  2YSR A;  2ZFW A;  2QQ9 A;  3CUO A;  1FBQ A;  2DBB A;  2V1D A;  5ILU A;  4Z2Y A;  5LGN A;  5FLX K;  3KP2 A;  2MBF A;  1UHW A;  4K2E A;  2A3S A;  1FSE A;  3QRF F;  3M9A A;  3BJ6 A;  3WG9 A;  2EB7 A;  4I02 A;  1ZRF A;  3B73 A;  1FYM A;  3RKY A;  2E7X A;  2XAQ A;  4MEX F;  4LK1 F;  4CDG A;  1CF7 B;  3HOT A;  1TW2 A;  3PQJ A;  4WF2 A;  4HF1 A;  4AWX B;  3I0T A;  4BH9 A;  4LK0 F;  2V1X A;  5K5O A;  2L01 A;  2OD5 A;  2X0L A;  2JSC A;  1GVJ A;  1BN5 A;  2W25 A;  4EJO A;  3JSP A;  4KIC A;  1R36 A;  2FRH A;  1B9N A;  1FSH A;  3IRQ A;  5DCM B;  2VBX A;  1SD7 A;  3WU0 A;  1RIO H;  4RGU A;  3F21 A;  5L3F A;  4RGR A;  2VC0 A;  2PFB A;  2XGX A;  3BJA A;  3NEU A;  4BHB A;  3I54 A;  2IPQ X;  4H0E A;  1TQP A;  2IRF G;  2P6T A;  3GO5 A;  3J80 Z;  4MHG A;  5D6E A;  4HDV A;  2HYF A;  2R7D A;  4EJW A;  4U0Y A;  4P96 A;  1KQ9 A;  4KNY A;  1J59 A;  3SZT A;  1HW2 A;  2M45 A;  3GEZ A;  3CUQ B;  1W7P A;  2CW0 F;  4XSZ F;  4OIQ F;  4BHP A;  1HKQ A;  3WTX C;  3WTV C;  3DF8 A;  3I5U A;  2VON A;  4RAZ A;  3WGI A;  3F8F A;  3C1D A;  5FLX Z;  1TQI A;  1WI9 A;  1SAX A;  3JTG A;  2H94 A;  1R5H A;  3HTU A;  5F6F A;  5FD5 A;  1PP8 F;  4KA4 A;  5K5Q A;  3KP4 A;  2HQR A;  4FHT A;  4WXC A;  4HF2 A;  4M6Y A;  5CVI A;  5IT3 A;  1YW9 A;  4M9X A;  1ZG5 A;  4HLY A;  4AIJ A;  4EJT A;  3GYH X;  2NS0 A;  2HTJ A;  1LEB A;  3I64 A;  4EM1 A;  3FHZ A;  2EFO A;  4U0V A;  1JHF A;  1KYZ A;  3GVA A;  1W4M A;  3BPX A;  3QP6 A;  5JHU A;  4IPA A;  4A12 A;  2A69 F;  4ZYG A;  3GFJ A;  3RTR A;  2RVC A;  3F8B A;  3RKX A;  1H9T A;  2ISZ A;  4F7Z A;  2HGC A;  3LFK A;  4YIF A;  3MEX A;  4EJV A;  4RB1 A;  2EFP A;  1REP C;  1S3J A;  3VOD A;  3T0Y A;  4ZYD A;  4EM0 B;  4I0A A;  5D5W B;  1QGP A;  3F8M A;  4G6D A;  3JAM K;  1O7F A;  4MTE A;  4ENM A;  2K4J A;  3RJP A;  3E5U A;  1J7K A;  2L54 A;  3TO9 A;  5J6X A;  4LG0 A;  2NNN A;  6PAX A;  2F5C A;  3TKY A;  4IJA A;  4PDK A;  5KVR A;  2MC3 A;  4XRF A;  5K5R A;  5LRR A;  3EYI A;  1IXC A;  1G4D A;  1QBJ A;  2ESN A;  4JBA A;  1WSU A;  5EEH A;  5CVU A;  4N9I A;  1RUN A;  1EH8 A;  3QP5 A;  1TBX A;  1IN6 A;  4ENN A;  1FYK A;  1TNS A;  1ZRD A;  2STW A;  2XAS A;  1BBY A;  4L9N A;  2P7C B;  4MQ9 F;  4EGZ A;  1KQ8 A;  4FX0 A;  2J5P A;  1TQM A;  1WQ2 A;  1BI0 A;  4LB5 A;  1EV7 A;  3FMR A;  4ZH4 F;  1DUX C;  3R0J A;  2EK5 A;  4Q4Z F;  1T38 A;  5J8F A;  4L9J A;  2Z9O A;  2HTS A;  3CO6 C;  2O6G E;  4S05 A;  4OMY A;  1QNT A;  5BMZ A;  1NHA A;  2UXN A;  5ILS A;  2A68 F;  4RB2 C;  1YIO A;  5K1Y A;  3N97 A;  2NRA C;  3FM5 A;  3K9T A;  4ZZL A;  1K78 A;  4L18 B;  5LLQ A;  1BOA A;  2AXL A;  3F8C A;  5L3B A;  3RPU A;  1PUE E;  3TDZ C;  3ABT A;  4IHS A;  1FBS A;  1OYI A;  1L3L A;  2XAG A;  4O6J A;  4GO1 A;  4GYG A;  3TQN A;  3GXO A;  1P6R A;  2PMH A;  5LHH A;  4ESF A;  1QQI A;  2ZNY A;  1IN8 A;  2LNB A;  2Q8K A;  4BXU A;  3VEP A;  4O5V A;  3RYP A;  2XKO A;  3FXU A;  2FQ3 A;  3HHH A;  4G8X A;  2YX7 A;  1OYY A;  4UV9 A;  4QLC U;  4UUV A;  2FA5 A;  1ZRE A;  4I2O A;  1XCV A;  3MZY A;  1RZ4 A;  4NB5 A;  4RAY A;  3GFI A;  1FOK A;  4UV8 A;  4UHT A;  2Z5U A;  2W57 A;  3AAF A;  4A6D A;  4JQF A;  5DCF A;  5FD6 A;  4CGZ A;  2RNJ A;  1FBU A;  3E3V A;  1DPR A;  5L3G A;  4BYY A;  2VOD A;  1UHM A;  4GYI A;  2XRO A;  2XKP A;  2JTV A;  1Z1D A;  5ICC A;  4LB6 B;  5DYM A;  1K6O A;  3DPT A;  1YG2 A;  2BE5 F;  3HUG A;  3ZMV A;  2CWE A;  1TLH B;  2A5Y B;  5DUI A;  1S7A A;  3E6D A;  2QLZ A;  1ZAR A;  2M5W A;  1T98 A;  1C0W A;  1A04 A;  1R1U A;  5CLS A;  1F5T A;  2LF8 A;  5HDN A;  3F8N A;  2K02 A;  3I4P A;  1P92 A;  3Q5F A;  2RC4 A;  2IA2 A;  2FBI A;  3WOD F;  3WE2 A;  4CZZ A;  2CFX A;  3RI4 A;  2DT5 A;  2DFI A;  2QUF A;  5FO5 A;  2VOP A;  1IF1 A;  2HDC A;  1XGN A;  3GW2 A;  4N9H A;  2L02 A;  3HYI A;  3JW4 A;  1ONV A;  3GZ5 A;  1ZH5 A;  4I09 A;  1FYL A;  4G6Q A;  5L3D A;  5CVV A;  3GFM A;  2WWY A;  4MQV A;  2VBW A;  4KUM A;  1PP7 U;  4ESB A;  3LST A;  5FFZ A;  2O3F A;  2QYO A;  3I59 B;  1LVA A;  1SD4 A;  4OIN F;  2L4A A;  2L4M A;  2WV0 A;  2FNA A;  1RNL A;  5BOX A;  2PG4 A;  4EMS A;  2KRF A;  1S8N A;  2X4H A;  1IZ1 A;  1MJA A;  5FB2 A;  2R3S A;  4BQA A;  2PLY A;  3WGG A;  4KT5 C;  3GF2 A;  4LFU A;  3O3K A;  5JR3 A;  2Z33 A;  2EA2 A;  2XIG A;  1KU2 A;  3W6K B;  2GWR A;  2BEO A;  4BHC A;  2K27 A;  2IT0 A;  3T5X A;  1E17 A;  3KFW X;  3J7A O;  3HRU A;  3HHG A;  2UWM A;  3R4K A;  3TGN A;  2JPB A;  2ZBK A;  4G7Z F;  1I6X A;  3QAH A;  4YG2 F;  2E1N A;  5ICF A;  1Z05 A;  2P7V B;  4YFN F;  1DDN A;  4EQQ A;  1B9M A;  2G9W A;  3OOP A;  4L5J A;  2OU2 A;  1IW7 F;  4Y13 A;  4KIG A;  2IA0 A;  4PCQ A;  3U2R A;  4B09 A;  4HW0 A;  4ENJ A;  2E7W A;  1KU3 A;  2ZME A;  3TDU C;  4G7H F;  1J0R A;  2GZW A;  5HS7 A;  3FMQ A;  1D3Y A;  3G73 A;  3QU6 A;  2EFN A;  1ZHF A;  1Z7U A;  4WCG A;  3U9G A;  2D1H A;  1HST A;  2EV6 A;  3R60 A;  5CVR A;  3V7C A;  2OA4 A;  1R00 A;  3BZ6 A;  5LEJ A;  3HTS B;  3J81 K;  2VXZ A;  3ZMS A;  2G7H A;  2V1U A;  1HKT A;  5F64 A;  2IJL A;  1W5S A;  5KK1 A;  3F23 A;  3K2Z A;  1QZY A;  1MDM B;  4HQM A;  1FPQ A;  2K7L A;  2JRT A;  3CO7 C;  2QBY B;  4OIO F;  1ZYR F;  5DUK A;  4HV6 A;  5ED4 A;  1SMT A;  1UB9 A;  5ERI A;  2DU9 A;  4I7H A;  4KFC A;  4AVP A;  1U5T B;  2DI3 A;  4NQW A;  4M73 A;  3EUH A;  2ADU A;  1YYV A;  3RDI A;  5F1R A;  4I01 A;  4QWQ A;  2MLG A;  1IRG A;  4E70 A;  1FLI A;  2KJB A;  2RV8 A;  2M8E A;  2G7U A;  1XSD A;  2B0L A;  1CF7 A;  1LDK B;  2F5E A;  1XCB A;  5CJ9 A;  1SD6 A;  4DQ2 A;  2NAZ A;  2DQL A;  3EQL F;  5D8K B;  5HLG A;  3QOP A;  2Y75 A;  3DQV C;  1F1Z A;  3EDP A;  3WTU C;  2DPU A;  2VBY A;  1LJ9 A;  5EEG A;  3ZN0 A;  2QVO A;  2DTR A;  1LEA A;  3Q9V A;  5LEK A;  5DCM A;  1GXQ A;  5LRS A;  4PZJ A;  1MJ9 A;  4KIF A;  2FEZ A;  1SFX A;  1R58 A;  3DP7 A;  1KA8 A;  1XGO A;  3HSF A;  3KEO A;  3R6S A;  1OR7 A;  3J81 Z;  3C7J A;  2RN7 A;  3ZN1 A;  3E5X A;  3LAJ A;  2OAZ A;  2DK8 A;  3WE3 A;  3BJO A;  3GX4 X;  3EET A;  2VT3 A;  4CYD A;  4I0B A;  3MCZ A;  1J9I A;  4P5O A;  3ZQ7 A;  2M1B A;  3MAJ A;  4L9V A;  2GXB A;  1Z9C A;  1MJB A;  5LHI A;  3CJN A;  4XLP F;  5E17 F;  5D5U B;  4LJZ F;  1ULY A;  4EJU A;  4B8X A;  3CUQ A;  2XAJ A;  3BP8 A;  4BAY A;  2R7F A;  1JXS A;  4NHJ A;  4HYE A;  5FFX A;  1UST A;  2IA1 A;  3IWZ A;  5LGT A;  2OZU A;  3WTW C;  4DNC A;  3DKW A;  5AON A;  1IRF A;  1SFU A;  3K1P A;  3MZH A;  1I5Z A;  3VB2 A;  2MA3 A;  1J5Y A;  1XMK A;  3LA3 A;  5BS6 A;  1BJA A;  2GIV A;  2PQ8 A;  1FY7 A;  3K1M A;  3P9C A;  1ODD A;  1RI7 A;  3M8F A;  1I1S A;  4LGW A;  4Y15 A;  2RKH A;  4L0Z B;  4HZF A;  2EJR A;  1KYW A;  3EYY A;  3ROU A;  1H9G A;  3DXJ F;  4WK8 F;  3E5Q A;  4G9Y A;  3FF5 A;  2D1V A;  4HAM A;  3W6J B;  1SFE A;  3HRT A;  3K1N A;  1U2W A;  3BY6 A;  3BDD A;  4GXO A;  4A2U A;  4HDU A;  1U78 A;  3D5L A;  3SFZ A;  1J2X A;  3ABU A;  2O61 A;  4CIC A;  2DLL A;  1YW7 A;  3F6V A;  1JE8 A;  1E2X A;  1IAW A;  4P55 A;  5HLH A;  3FWE A;  4UVB A;  3M7G A;  1B59 A;  4WWC A;  1Z6R A;  4R8H A;  3BOQ A;  1S6L A;  2ELH A;  4M6X A;  3FXQ A;  3JAM Z;  2K86 A;  2EV0 A;  4A0Z A;  1W5T A;  2W84 A;  1DPU A;  1FZP B;  2Z3Y A;  3G3Z A;  2RQP A;  4ETS A;  1G3W A;  5E8I A;  2LDU A;  4G7O F;  1UCR A;  5LHG A;  1ON1 A;  4L9T A;  2LSO A;  3H3U A;  1S7O A;  1YTY A;  2MD5 A;  5BPI A;  4M74 A;  2FMY A;  2VN2 A;  2FBH A;  2D45 A;  1SD5 A;  1SMY F;  3CUQ C;  2VE8 A;  1O3Q A;  1W7P D;  1X3U A;  2LF7 A;  1U6G A;  2H6C A;  4Q48 A;  1ZG3 A;  3L09 A;  3KP3 A;  3CDH A;  5HVQ C;  4R79 A;  1KU7 A;  4XSX F;  2QM3 A;  4MGR A;  5JVT A;  2FE3 A;  2OZ6 A;  2V9V A;  1T0F A;  2PMU A;  2O0Y A;  1P2F A;  2HQN A;  4IRH A;  2EA4 A;  2ZJ2 A;  3F72 A;  5H20 A;  4ASN A;  5A2Q K;  4BNC A;  4L0Y B;  2JZY A;  4OIP F;  5ICE A;  1Z91 A;  2E1C A;  4Q5S F;  2JT1 A;  1HXD A;  3I71 A;  4U7B A;  3GZ6 A;  4CHU A;  2Y48 A;  1R7J A;  3CTA A;  3ZP5 A;  2ESH A;  4KDP A;  1JHH A;  1ZGA A;  1R5G A;  2VC1 A;  3M1E A;  2ZCW A;  4IRG A;  2GA2 A;  4AIK A;  3HOS A;  2KIM A;  4AD9 A;  2KKO A;  3QPH A;  5D5X B;  1YS7 A;  1IN5 A;  1VTN C;  1ZG1 A;  2Z99 A;  1ZGJ A;  4YII A;  2EFW A;  2KIU A;  2UZK A;  2ZNZ A;  4IRI A;  5D4S A;  1XB4 A;  2V79 A;  4XLN F;  2ETH A;  2QQB A;  3GFL A;  3MFK A;  4ENK A;  4O3M A;  5AIP A;  1GHC A;  2HZT A;  2QQA A;  3RKW A;  4UXN A;  3O6B B;  1XD7 A;  1EH7 A;  3LA7 A;  2DPD A;  2CSO A;  1R1T A;  2GA1 A;  5H6R A;  4MTD A;  1OYW A;  5HS8 A;  3L9F A;  3KZZ A;  1HQC A;  5BQT A;  1LDJ A;  4EV0 A;  3RPQ A;  4LLL A;  1P4A A;  2DQR A;  1I1G A;  4M71 A;  3GWZ A;  1U3E M;  1QPM A;  2UXX A;  3KP5 A;  3E6B A;  3R0A A;  1JGS A;  3FXR A;  3LA2 A;  5A2Q Z;  4N0B A;  1UFM A;  1PDN C;  2WC2 A;  4GGG A;  1KU9 A;  1LQ1 A;  1I27 A;  1BM9 A;  2CYY A;  2MH9 A;  1R23 A;  3FM3 A;  5JFR A;  1B4A A;  2DO7 A;  1FC3 A;  2J5O A;  2XAF A;  4UVA A;  3HIF A;  1ZLJ A;  1OPC A;  3E6M A;  3ZMZ A;  3HSE A;  1S29 A;  3HRS A;  4HF0 A;  3U1D A;  2PEX A;  3L00 A;  1W7P B;  1TTY A;  3I53 A;  1IXR C;  1XSX A;  3I59 A;  3TOB A;  4XBF A;  4U7D A;  3F6O A;  3QPT A;  5HOO A;  3D0S A;  2CO5 A;  2DAO A;  1WRJ A;  3F3X A;  1HBX G;  1J75 A;  5E1W A;  1AWC A;  3T1B A;  3WTT C;  5L3C A;  3E97 A;  3IKV A;  3HSR A;  3SHF A;  4Y17 A;  4RB3 C;  1O57 A;  4LD5 A;  3FZV A;  3C3W A;  4WXH A;  1GXP A;  2FOK A;  3JTH A;  3FX3 A;  2STT A;  5IT9 K;  3VOE A;  1F9N A;  2A61 A;  1YO5 C;  4U88 A;  4HX8 A;  2Q0O A;  1TNT A;  3E6C C;  2HOE A;  1FX7 A;  2O8X A;  1MGT A;  3B02 A;  5L3E A;  4EM2 A;  1G3S A;  2H6B A;  4IVN A;  1STZ A;  4KYW A;  2K4B A;  2QEN A;  3F22 A;  4FT8 A;  1O7L A;  2A07 F;  1B6A A;  1K79 A;  1B1B A;  4RGX A;  3WU1 B;  1D5V A;  4WXD A;  2A6H F;  3RYR A;  1FNN A;  3P9K A;  1ZLK A;  2XHK A;  2EFQ A;  2KJC A;  4D0P A;  2D2W A;  4A0Y A;  3ISP A;  4CXF A;  2FSW A;  3VFZ A;  4WX9 A;  1IUY A;  2EWN A;  4A0X A;  2VOO A;  3DEU A;  4P9U A;  1R1V A;  2FNP A;  2M87 A;  2FF4 A;  2DK5 A;  2BGC A;  3TOA A;  4LG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...