5AIPA

Crystal structure of nadr in complex with 4-hydroxyphenylacetate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 46
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aipA00
3GWZA 4ENJA 2NAZA 2VT3A 3CO7C 2K4JA 5FLXK 5BMZA 2YX4A 2A69F 3EDPA 4BHCA 4AVPA 1ZGJA 2VC1A 4HDUA 5LGNA 4RS8A 5D8KB 2M87A 4HOBA 1YS7A 1OYWA 3ULQB 4L5IA 4PGHA 1SFUA 4IPAA 2JT1A 2R7FA 1ON1A 2DLLA 2DPDA 1LDDA 1XGMA 5DDGA 1ZLJA 2EK5A 2KKOA 4MEXF 3BWGA 3WTTC 2EJRA 5FFZA 4DQ2A 1CF7A 2OU2A 3GX4X 2KIMA 5D5UB 3V8KA 2RN7A 4BNCA 3J81K 2OZUA 1PP7U 1XGSA 4P96A 3KLOA 3JSOA 3GYHX 2GXBA 1KU2A 1EH6A 4UNOA 5K5OA 5D6FA 5DD4A 1YW9A 3U9GA 1ZGAA 1U78A 1ZAOA 3KZYA 1G6NA 3HRTA 1WSUA 1UB9A 3IKTA 2ISZA 1I5ZA 2PI0A 4NQWA 1ON2A 1SFEA 2O6GE 1Z6TA 4F7ZA 4U0VA 5LRSA 1W7PA 4EJUA 1MDMA 1TBXA 4G8XA 4I98B 3BPVA 2IW5A 2KJCA 5HDGA 1FP2A 3HSRA 1VTNC 3ECOA 3E97A 3FMSA 4JQFA 1I1SA 4CHUA 3VFZA 2EWNA 5L3BA 4LLLA 3SFZA 2XGXA 3BJAA 1ZG3A 4LJZF 3RIRA 2QWWA 2HTJA 2A3SA 2RGVA 5ILSA 4ZYEA 4WK8F 2FMLA 2UWMA 2A61A 1T39A 2ZNYA 1GHCA 1ZLKA 2XAJA 3GO5A 2DBBA 1ZARA 4D0PA 4ENMA 3KFWX 2KIFA 1IXSB 1XGNA 4HQMA 2QQAA 3Q9VA 3E5UA 2STWA 3BJOA 4ZZDA 2FF4A 2TDXA 3E6BA 2V1DA 4AD9A 1FOKA 1YYVA 3B73A 1NHAA 4FHTA 3U1DA 5LGTA 4ASNA 1BBYA 2VOPA 2MLKA 4CICA 2GQQA 3ABUA 2VE9A 1HSJA 3TO7A 1XSVA 5LGUA 1IRFA 4HAMA 1TNSA 2GZWA 2XROA 2NRAC 2CFXA 1RI7A 4M6XA 2E7XA 1SAXA 3RPQA 3QU6A 3KP3A 2XHKA 2HYFA 4GYGA 5DUKA 4U0YA 5CVRA 1YS6A 4XBFA 1XDUA 3O6BB 2WC2A 2PJPA 3KEOA 1T0FA 4U0WA 2R3SA 3WU0A 3G73A 4M73A 3TO9A 3G3ZA 4OINF 4A5MA 3HIFA 1CF7B 4BXUA 2FRHA 2G7HA 2VE8A 1R58A 5HDNA 1TQMA 4P9UA 3KEQA 1R1TA 4YFXF 2EV0A 3V8JA 3RKXA 4UV9A 3I53A 2STTA 3V8LA 4GGGA 1O7FA 1ZREA 1V3FA 5D6EA 3WGGA 1MZBA 5F1RA 3M7GA 1MJAA 3FXUA 2M1BA 2XVCA 4MQVA 3TQNA 4UUVA 1W7PB 2GAUA 4OU0A 2JPBA 3CTAA 1YFHA 1G3TA 3PFIA 5DUIA 2FOKA 1K78A 2QM3A 1I6XA 2ACJA 3REOA 3ZMTA 1BIAA 5JVTA 4WXHA 1HSTA 4XLPF 1KYWA 2C6YA 3E6MA 3BP8A 1GXQA 2ESNA 3WODF 4IHSA 2PMHA 1FBUA 2CSOA 2ESHA 1S7OA 3ABTA 3O2PE 3GW2A 3H3UA 4JBAA 5E1ZB 1BN5A 1PUEE 2ZKZA 1U8RA 2JRTA 3VEPA 2HS5A 3VB2A 3TDZC 4XLNF 3DF8A 2HWVA 1S3JA 2EA2A 1ONVA 4U7BA 1ZRFA 1J7KA 2AS5F 1I1GA 3GFMA 3WTVC 5JHUA 5HLIA 2P6SA 3CUOA 4TV7A 5FO5A 2DK8A 2LF7A 3RTRA 1C0WA 4M6YA 2HDCA 1W4MA 3MZHA 2X4HA 1JGSA 3RYPA 4GO1A 2E1CA 4HV6A 4RGUA 5DV5A 4MTDA 3L09A 5JFRA 5LEJA 3I4PA 4P9FA 4CYDA 3PQKA 4OIRF 2Y75A 2UXNA 4IHTA 5JR3A 2CO5A 3QOPA 4UVAA 1OR7A 5DD8A 1D5VA 4ENKA 3HOTA 4OMYA 4I0BA 2JPCA 4HX7A 4XSXF 2A07F 3V7RA 2Y0MA 4EGYA 4DNCA 1F1ZA 3L9FA 4G7OF 4KMFA 4PZJA 4ZZLA 1SFXA 4IXAA 4WXDA 3WGIA 4FX0A 2L4MA 2ZMEA 1G3WA 1HKTA 1XB4A 4Q5SF 5H6QA 1R5GA 2YPRA 3TGNA 2K02A 1CGPA 2PN6A 2M8EA 4A12A 3KCCA 3I54A 4GXOA 5CJ9A 2VBXA 1LJ9A 3SHFA 5LLQA 2MA3A 1K78B 3J81Z 5FGMA 2GXGA 3C3WA 5E8IA 4EMSA 1T2KA 3R6SA 2ETHA 2EFNA 2F5EA 3FMQA 4CO8A 2XV4S 2DU9A 2VBYA 3D5LA 2GA2A 3R4KA 3IHUA 1IN7A 1KQ8A 1IAWA 4ZYGA 1XSXA 1YIOA 3GZ5A 1U5TA 3K1PA 5JI6A 4L18B 2ZCWA 1DPRA 1L0OC 4P5OA 4M71A 5E17F 4Q48A 1EH8A 3F72A 4UV8A 3J80K 2IPQX 2QUFA 1OYIA 2F5CA 3T8TA 2Z99A 3BOQA 5EEHA 3U2RA 3WG9A 4KFCA 2YR2A 1Z9CA 1OYYA 5ICCA 2QENA 2YU3A 5LBQA 2DI3A 2IA0A 1KA8A 4ZYDA 3WTWC 1R7JA 3TO6A 3AAFA 2HZTA 4Z2YA 2V1XA 2GWRA 2Q8KA 1SD7A 1Z7UA 4MHGA 3WU1B 3ECHA 3P9KA 1W7PD 2FSWA 3HYIA 2Z3YA 3K0LA 4A6DA 2H6BA 2ISYA 1FT9A 1F4KA 2H94A 2IVMA 1ZH5A 1AWCA 5ICEA 4IF4A 1H9TA 3BY6A 3DEUA 3S2WA 3QRFF 2P5VA 1L3LA 2DO7A 2HKXA 3VODA 1MKMA 4NB5A 4MQ9F 2KJBA 3QPHA 2Y48A 3IWFA 3R0JA 2VN2A 3E5XA 1TLHB 4Y13A 3V7SA 4N0BA 4KN7X 3FF5A 2K86A 5TJJA 2DQRA 1SD5A 2ZMEB 1IN5A 4UXNA 1JXSA 4JK1X 3FXQA 3ISPA 1G3YA 4WCGA 1O3SA 3JW4A 1MJ9A 2A6HF 3DFGA 5D4SA 4Q4ZF 4ZH4F 2D45A 5J6XA 2M45A 2Z5UA 2BEOA 3LA7A 3IC7A 5CVJA 3NQOA 2PMUA 4KIGA 3LQRA 2O03A 4LB5A 4RB2C 2DFIA 5D4RA 4Y15A 1R1UA 4RGXA 2PG4A 2PFBA 4OIPF 4CZZA 3V4GA 4GCVA 2ZNZA 1XGOA 4E70A 2HKOA 3MEXA 4I0AA 2IRFG 1J75A 5K5QA 2J5PA 2QLZA 1ZG1A 5LHIA 1KU7A 1XMKA 1U5TB 1B59A 2XAQA 4G6QA 4KIBA 1O7LA 4HF1A 2KIUA 3DPTA 1FPQA 2P7CB 5E1WA 1KYZA 5LHGA 4FT8A 1WI9A 3RYRA 1J0RA 1MGTA 2LSOA 5ICFA 1UCRA 4N9HA 1TQPA 5HS9A 5L3GA 2MH9A 3E5QA 4ENNA 1H9GA 3MCZA 1LQ1A 2FMYA 2QYOA 3RPUA 1SMYF 1SD4A 4KMUX 1FNNA 1PP8F 1HXDA 2K7LA 1FYMA 3TOBA 3GLXA 4A0ZA 3F6VA 4KIFA 3H3ZA 3E3VA 3KE2A 5IT9Z 1HBXG 1FWZA 2HEOA 3WE3A 2JZYA 1YO5C 3Q5FA 3I0TA 2V9VA 2LDUA 2MLGA 2HFHA 3T8RA 4G6DA 1HKQA 2W25A 3P9IA 2CG4A 2XAGA 5CVVA 5HOOA 1QQIA 1FP1D 1ZYRF 2ZO4A 4EJOA 2YX7A 4KDPA 1IN4A 3M9AA 4G94A 4EM1A 5L3FA 3Q9SA 2J5OA 4MEYF 2VC0A 4EJTA 2DAOA 3V7CA 1U6GA 4S04A 2RC4A 3CDHA 1HW1A 4B09A 3LQQA 3SQNA 4KA4A 2DK5A 2CYYA 1T6SA 1J2XA 2YSRA 4M9ZA 2OQRA 1B4AA 2BV6A 4I2OA 2VONA 3KZZA 3WTXC 3C18A 5H20A 2QQ9A 3F8MA 3TDUC 1I27A 2EFPA 5EEGA 5ILVA 3KETA 4WXCA 4H0EA 1O57A 3ZMVA 1BIBA 4HDVA 1G4DA 2HYGD 4HV5A 2OBPA 4A0XA 2EV5A 2JSCA 3DQVC 2ZFWA 4L9VA 2FA5A 2MC3A 3DXJF 3HRMA 4HQEA 2H09A 2GA1A 5HVQC 4BHPA 2COMA 2QQBA 4IRHA 3SZTA 2KRFA 1LB2A 2A6EF 4YG2F 2FXAA 4L9JA 3H92A 3BROA 2O3FA 3COAC 5F6FA 3C1DA 1S6LA 3GZ6A 3FX3A 1TQIA 1UFMA 1Z1DA 1V4RA 3FM5A 4PGGA 2W84A 1D8JA 3R0AA 1S29A 1HW5A 1TNTA 4MTEA 3MAJA 4G7HF 4M74A 1ZRCA 1HW2A 1LNWA 3EQLF 4L0YB 2B0LA 4OIOF 3WTZA 4IRGA 3WTYC 3R60A 3LA2A 4EM2A 2HOEA 4MNUA 1RIOH 1P4XA 3EYIA 2A68F 1W5SA 4Y17A 3FMRA 3KP6A 4MGRA 4RB3C 1XDSA 3K2ZA 5FLXZ 3CUQA 3LAJA 1ZG5A 3CLOA 3N97A 2PBIA 4XRFA 4R79A 4HW0A 1Q1HA 2NYXA 2IT0A 1XCBA 4LG0B 3ELKA 5L3CA 1G3SA 3I58A 1BJAA 3GF2A 2D1HA 5TRDA 3LWFA 2F5FA 4RAYA 5DYMA 1YW7A 1IUYA 2V79A 3QP6A 1BI3A 2LKPA 2W24A 2VODA 1BM9A 3SXYA 1WWXA 4LK1F 1FLIA 3O3KA 5AIQA 5D5XB 1KQ9A 5K5RA 2RNJA 4L9NA 4AIHA 2IJLA 3HHGA 4KICA 5DCFA 2QVOA 5HLHA 3WE2A 3M8FA 2V1UA 2RQPA 3T1BA 3W6KB 2VXZA 4ESFA 2PEXA 2QBYB 4BAYA 1B9MA 3F22A 1RUOA 4EV0A 3GXOA 2P5LC 1QGPA 3GVAA 2GIVA 1LDJA 1GVJA 4K2EA 3HSEA 3ZMDA 1P92A 2NNNA 1K6OA 2VBZA 3ZMUA 3JAMK 5DCMB 3LSTA 4LGWA 1QZZA 4A6EA 4KNYA 3EETA 1TTYA 2FNPA 2EB7A 2M5WA 1YW8A 2X0LA 2XKOA 3IKVA 5ICGA 3MZYA 4M72A 2OZ6A 1EH7A 1KU9A 3F8NA 2RDPA 1Y0UA 4O3MA 2MH2A 5BS6A 2ADUA 1YG2A 2RV8A 1IW7F 4LMYA 2XRNA 1S8NA 3RKWA 4G9YA 4PDKA 1WRJA 2WWYA 1X3UA 4LLGF 3HTUA 2ZJ2A 4U7DA 3F6OA 2FNAA 1KQ0A 2RVCA 3DPLC 2BYVE 5IT3A 3SZPA 4OOIA 5L3EA 1U2WA 1R5HA 1XN7A 1FYLA 2HQNA 3F23A 5LRRA 1LEAA 1E17A 2UZKA 4IJAA 2QZ8A 1IN8A 3QP5A 3F8CA 5AIPA 5AONA 3RDIA 2L54A 1LDKB 4IVNA 3P9CA 1REPC 4UVCA 3CUQB 3D0SA 4CDGA 2FBIA 3ZN1A 3BJ6A 1SD6A 3L7WA 4RB1A 1KU3A 3RJPA 1RNLA 2M30A 1FYKA 4NHJA 4BYYA 3GFJA 5HDKA 3ZMZA 1H0MA 2MD5A 3HOSA 5CLSA 1ZRDA 2L4AA 5H6RA 5FD6A 5J8FA 4R8HA 1STZA 5BPIA 1DP7P 1P4WA 4CGZA 2P4WA 2FBKA 1FSEA 2F2EA 5KVRA 4EJVA 4I01A 3KLNA 1UHMA 3ZMSA 3QU3A 4BHBA 3LFKA 4FX4A 4R1HA 5HLGA 4KUMA 4M9XA 3GUDA 2DTRA 5CVIA 2L3DA 5E20A 3ML6A 4I02A 4RGSA 4G7ZF 1W5TA 2OD5A 4P55A 2R7DA 3MFKA 4B8XA 1LVAA 1AOYA 2V6CA 2CW0F 4HLYA 5A2QK 3FWEA 1D8KA 2EFWA 3BDDA 3B02A 2L02A 5KK1A 1FY7A 5E8GA 2ELHA 2FE3A 5CVUA 1R00A 1O3QA 4HA8A 2XAHA 3ZQ7A 1A04A 3I64A 1IXCA 4ETSA 5DEQA 4O5VA 2VT2A 4HYEA 5E1XA 3DP7A 1B6AA 2VBWA 1XMAA 3ROUA 1P2FA 3T0YA 2O61A 2WTEA 4GYIA 3IWZA 1E2XA 3BZ6A 2K27A 4HF2A 3HUGA 2LNBA 3T5XA 1BI1A 3HHHA 1IN6A 5D8LB 5HS7A 3KP5A 3PQJA 4QWQA 2XIGA 3K1NA 2G9WA 3KP4A 3N4MA 1RZ4A 2LF8A 3E6DA 2CGPA 3I59A 1GXPA 5BQTA 3J7AO 2E1NA 2PLYA 3HSFA 4ZYHA 1F9NA 1YLFA 4I09A 4Q47A 4A0YA 5E18F 2DQLA 1K79A 2XAFA 1DDNA 5ED4A 2EFOA 3M8EA 4LFUA 4BH9A 3JTGA 3ERED 1WQ2A 3MQ0A 1PDNC 2P7VB 4RB0A 1FX7A 3GFLA 2W85A 1HQCA 4EM0B 2W57A 3HRSA 4LG0A 4ON0A 5L3DA 3FHZA 1ZHFA 1B9NA 1IF1A 1WKMA 2IA2A 1USTA 4UVBA 1TW2A 4A5NA 1U3EM 4UHTA 2G7UA 2E7WA 4L9TA 1MD0A 1QZYA 3IL2A 3L00A 4YIIA 2FEZA 4O6JA 4EJWA 2NNYA 3OOPA 1O3TA 2DPUA 4LD5A 3K69A 2HTSA 2AXLA 4HX8A 4OIQF 4AIKA 3FXRA 1R36A 2HQRA 1MDMB 2K4BA 1HKSA 2O8XA 3HTSB 2PQ8A 1SMTA 2BE5F 5FB2A 3KP2A 4ESJA 1QO0D 5CYVA 2H27A 4ESBA 2P6TA 4EVIA 3ZPLA 1KGSA 4OMZA 2QBYA 1OMIA 2D2WA 4EGZA 3WGHA 3CUQC 1BOAA 3QAHA 1J59A 1XD7A 3JTHA 3VOEA 4I7HA 3L2CA 1J9IA 1USSA 3F21A 1YTYA 2EFQA 4YIFA 4KYWA 1O3RA 5DCMA 3MWMA 4KN4X 3I71A 3K9TA 3WTUC 4KT5C 3KP7A 5D5VB 3CJNA 3FZVA 1Z6RA 3QPTA 5IT9K 4WX9A 1JE8A 1UHWA 1IXRC 3E6CC 4L5JA 2EV6A 1FBQA 1Z91A 1J5YA 1ODDA 2OA4A 1R1VA 5FD5A 2Z9OA 3LAPA 3HRUA 1XSDA 2XKPA 2FQ3A 2BBYA 1K7AA 5HS8A 1IZ1A 3F8BA 5LHHA 2D1VA 3JAMZ 3ZP5A 3F3XA 5F64A 5FFXA 3J80Z 1MJBA 1B1BA 3M1EA 1OPCA 1OKRA 4RAZA 3RI4A 3I59B 3JSPA 2RKHA 2Q0OA 2HGCA 3P7NA 4N9IA 3W6JB 3WTSC 1EV7A 1U5TC 1QPMA 3GFIA 3F8FA 1BC7C 1TW3A 4YFNF 1DUXC 1JHHA 4BQAA 4YFKF 3DKWA 2FU4A 1F5TA 2P8TA 4AWXB 3C7JA 4U88A 4S05A 4LK0F 2BGCA 2XASA 1ZN2A 2CWEA 1RUNA 1JHFA 4LB6B 3IRQA 4HF0A 2DT5A 3EYYA 5D5WB 1BC8C 4IRIA 5ILUA 1ULYA 1Z05A 5LEKA 1D3YA 2O0YA 2P5KA 2DW4A 4HBLA 2XUBA 3TOAA 2FBHA 4WWCA 4HLXA 2IP2A 6PAXA 3CO6C 4PCQA 5K1YA 3FM3A 4LLNA 2L01A 1QNTA 3DV8A 3K1MA 4M9SA 1P6RA 1BI0A 1T98A 5BOXA 4AIJA 3R61A 1R22A 2OAZA 2VOOA 1FZPB 2JTVA 1YQAA 2Z33A 1T38A 1R23A 2MBFA 3I5UA 2ZXJA 1BI2A 2NS0A 4XSZF 1QBJA 3NRVA 2CQKA 2OQGA 1LEBA 3BPXA 1FSHA 2H6CA 4L0ZB 1XCVA 4RGRA 3IRRA 1S7AA 4A2UA 3EUHA 3GEZA 2IA1A 5J8CA 4CXFA 2F5DA 4WF2A 4EQQA 4QLCU 3RKYA 2ZBKA 3NEUA 2WV0A 5BPDA 2A5YB 3OV8A 2Q2EA 1FC3A 3ZN0A 2HR3A 2EA4A 2UXXA 1DPUA 4HX4A 5ERIA 1FBSA 3TKYA 1IRGA 5A2QZ 1P4AA 4HZFA 3LA3A
chains in the Genus database with same CATH superfamily
3GWZA 1YX5A 2W1OA 3GMEA 2JA8J 1JJ8C 4ENJA 2NAZA 2IBDA 1A6IA 4RA2A 1XS9A 1N78A 5IY5H 1K4TA 2VT3A 4IQ4A 2VIXA 1BR2A 2K4JA 3QODA 3CO7C 5BMZA 5FLXK 2YX4A 2A69F 3EDPA 4BHCA 4AVPA 2K40A 1ZGJA 2PMZN 2VC1A 4HDUA 5LGNA 2XRLA 4RS8A 5D8KB 2M87A 5IPAA 2DMUA 4HOBA 1YS7A 1OYWA 1V5FA 3ULQB 4L5IA 4PGHA 1SFUA 4IPAA 1K61A 2JT1A 2R7FA 1ON1A 5E79C 2DDAA 5CQGA 2MC4A 2MSYA 2DLLA 3KPHA 1LE8B 2DPDA 1LDDA 3RZOJ 1XGMA 3H5RA 5DTDA 2K5CA 5DDGA 2OUMA 1ZLJA 2EK5A 4PJLA 1TL8A 2KKOA 2A5WA 2DMPA 4MEXF 3BWGA 2OCEA 3WTTC 3BTLA 1NG7A 2EJRA 5FFZA 3G2BA 4DQ2A 3TW6A 3JRAA 1CF7A 2OU2A 2MD0A 2KIMA 3GX4X 2H8WA 3C2HA 5D5UB 1V5GA 3A2KA 3V8KA 2RN7A 4IOCF 4BNCA 4XORA 3J81K 2OZUA 1WZ2A 1PP7U 1XGSA 3H9JA 4P96A 3KLOA 2E34A 3JSOA 3GYHX 2GXBA 3OYKA 3U1KA 5FKKA 1KU2A 1EH6A 4UNOA 5IP7J 3BCBA 3K4CA 5D6FA 5K5OA 3PM1A 5DD4A 1YW9A 1MMAA 4XOPA 3U9GA 1ZGAA 1U78A 3LSGA 1ZAOA 3KZYA 1G6NA 1PVEA 1ETOA 1R5ID 3HRTA 4D7MA 2X51A 2HVRA 1Y39A 3CCMI 4M3DA 1VQNI 1WSUA 4AC0A 1UB9A 1W36C 3IKTA 2E2HJ 3I4NJ 1AA7A 2ISZA 3GTPJ 2LK2A 5K7HA 1Q1VA 2HOTA 1I5ZA 2PI0A 4FCYA 4NQWA 3J7YJ 1ON2A 2CMPA 3CLQA 3ZXSA 1W36D 3PJRA 1SFEA 2ZC2A 2O6GE 2VASA 2XF5A 1Z6TA 4F7ZA 4PJMA 1E0EA 2KPMA 4CCJA 4U0VA 5LRSA 1W7PA 4EJUA 3K10A 1MDMA 1TBXA 3LSIA 1KONA 3S3NA 4G8XA 4I98B 5IP6A 3BR5A 3BPVA 3BZKA 2DTZA 2IW5A 2KJCA 4BXXJ 5HDGA 2NVYJ 1FP2A 3HSRA 2HI3A 3TMOA 1VTNC 1Y8QB 3ECOA 1ZR2A 3E97A 3QYEA 3FMSA 1WH7A 4JQFA 3W2AA 1I1SA 3LSHA 1RR8C 4CHUA 3VFZA 2EIJH 2OF7A 2EWNA 5L3BA 4LLLA 1I50J 3SFZA 2XGXA 2HNHA 4BJ6C 2OV7A 4BDZA 3BJAA 1ZG3A 2Z16A 1LUJB 4LJZF 4ZDPA 1SVOA 2Y69H 3RIRA 3ABMH 1WJ5A 4B47A 3CMYA 2ZJQF 2QWWA 4MFEA 2HTJA 1HDDC 2R5YB 1WI3A 2VKHA 4KISA 3A01B 2IEKA 2F5VA 4YELA 4YRVA 2A3SA 2RGVA 4B3AA 2A6TA 5ILSA 4ZYEA 2X6XA 4WK8F 3CDLA 2FMLA 1TWFJ 2UWMA 2A61A 1T39A 2ZNYA 1HA8A 1GHCA 3DCFA 3A03A 1ZLKA 3ASNH 2XAJA 3CP8A 1A36A 2QA4I 1LFBA 1X4OA 4AUXA 3GO5A 2DBBA 1ZARA 1JI8A 1TWGJ 4D0PA 1I39A 3KFWX 4ENMA 2KIFA 4M3EA 1IXSB 4C2UA 2Q2EB 2X9DA 1XGNA 4A3MJ 4HQMA 2QQAA 2K9SA 3K6GA 3L1PA 2OTLI 3MKWB 2V1NA 2HVQA 3E5UA 3Q9VA 2STWA 3CC7I 3BG3A 3BJOA 5E3OA 3DU6A 2FX0A 4ZZDA 2HDWA 2FF4A 4UUSA 2TDXA 3E6BA 2V1DA 4AD9A 1FOKA 4EATA 5E3NA 3OR2C 3QYBA 1HOMA 1YYVA 3B73A 2CQNA 1NHAA 2K9QA 4FHTA 1ZK8A 3U1DA 5LGTA 4ASNA 1BBYA 2R92J 4F55A 2VOPA 4E7ZA 4BDYA 2JA5J 2MLKA 4HNVA 4CICA 2R7VA 1IRZA 2GQQA 4LIVA 2ID3A 3ABUA 3DWLE 3SEQA 2VE9A 1HSJA 3TO7A 1XSVA 5LGUA 1IRFA 4HAMA 3BR2A 3DTIA 2LREA 4XRMA 4BQQA 2W4SA 3BQZA 1MBHA 5FLVA 4YIRX 1TNSA 2GZWA 2XROA 4IHYA 3S1MJ 2NRAC 5M5WJ 2CFXA 3CMMA 1RI7A 4M6XA 4BJTA 2E7XA 4XKCA 2DA1A 1SAXA 3RPQA 3E1SA 4B1RA 3QU6A 3KP3A 1EKEA 2XHKA 2HYFA 4GYGA 5DUKA 4U0YA 5CVRA 4A3CJ 1YS6A 3NARA 3K4KA 4XBFA 1XDUA 3O6BB 2WC2A 4KT6A 2BVMA 2NS8A 3M8JA 2PJPA 3KEOA 2ZFUA 1T0FA 4BY1J 4U0WA 2R3SA 3WU0A 5EYRA 3G73A 4M73A 4JX4A 3TO9A 2DYRH 5E3MA 2BY3A 3G3ZA 4OINF 4A5MA 3HIFA 1CF7B 4BXUA 1TWHJ 2FRHA 4XKBA 5C44J 1X1CA 2E1MB 3NWSA 2G7HA 2JUCA 4D7NA 3B6AA 1JT0A 2VE8A 2MGQA 1R58A 5HDNA 3Q3SA 2L9VA 1TQMA 1VQPI 2M3AA 4II3A 4P9UA 3KEQA 2HDDA 1R1TA 1ACIA 4YFXF 3JREA 4XNFA 3QPLA 2EV0A 3V8JA 2WY8Q 3IH2A 3WG7H 5FRNA 1YJ9I 4H4KC 3RKXA 5HODA 2DJNA 4UV9A 4E7KA 2Y0SA 2BHZA 3I53A 4DIQA 2O5RA 3FK6A 1WFXA 1TT0A 5HNFA 2STTA 1MBFA 4GGGA 3V8LA 3ZCOA 1O7FA 1ZREA 1V3FA 2CUEA 3PFYA 3ABKH 5D6EA 3WGGA 5M3FJ 3M4OJ 1MZBA 4CZCA 5F1RA 3M7GA 1MJAA 1X19A 3CCEI 1T33A 4HSTA 3CCYA 3FXUA 4NQWB 1X58A 2JRMA 2M1BA 2ZXHA 2B9SA 2DFEA 2XVCA 4MQVA 3ZQGA 2CQXA 2Y9ZA 3BR1A 1FOYA 3TQNA 4UUVA 1W7PB 2NVXJ 4XM3A 2GAUA 2JPBA 3CTAA 4OU0A 3OYMA 1YFHA 1G3TA 3PFIA 5DUIA 5B5EC 2FOKA 2Y2ZA 1K78A 1YHQI 2QM3A 1TWAJ 1I6XA 1QRYA 2ACJA 3REOA 3D5SC 2DOAA 4BKXA 3ZMTA 1V5EA 2R7TA 1BIAA 2ZXWH 3BQYA 4B3XA 5JVTA 3GTGJ 3O8HA 4WXHA 2JWTA 1HSTA 1QZEA 3QYFA 2WY7Q 4XLPF 2ZJPF 1KYWA 5F0CA 1SFKA 2C6YA 3E6MA 3BP8A 1GXQA 2ESNA 3CJQB 1QHHD 3WODF 4IHSA 2PMHA 4IO9F 1FBUA 3OSGA 1VI0A 4PFOA 2XAUA 2DMQA 3CP2A 2CSOA 2ESHA 1S7OA 2L5QA 3ABTA 3O2PE 4M3GA 3GW2A 2R7XA 3H3UA 4ANJA 4JBAA 2X1DA 2IGNA 4PK4A 2WADA 5E1ZB 1BN5A 4FETA 3GTLJ 1PUEE 2ZKZA 3DBHB 2OJED 1U8RA 3H9QA 2JRTA 3VEPA 1YITI 2HS5A 3VB2A 3TDZC 4CCNA 3OSFA 2EBIA 4XLNF 5C4XJ 3DF8A 2HWVA 3BTCA 1S3JA 3OOUA 2EA2A 1ONVA 4U7BA 1ZRFA 1J7KA 5KNLA 3Q0VA 4BU2A 2AS5F 2YS9A 1I1GA 3GFMA 1TP4A 4UUSB 2LD5A 4JP0A 2NXNB 3BG7A 2M9HA 4E7LA 5LFAA 3WTVC 1Y1WJ 1QVUA 4M3FA 5JHUA 1MSFC 5HLIA 2P6SA 3CUOA 1UELB 1ETXA 2CRGA 4TV7A 4BS9A 3OS0A 5FO5A 2DK8A 1IV8A 2LF7A 2DODA 2E60A 1OQYA 3RTRA 1C0WA 3MKLA 4D5CA 1A31A 4M6YA 2HDCA 1W4MA 3MZHA 1YOVB 2X4HA 1JGSA 3RYPA 4GO1A 4ITVA 5M3MJ 1Z3XA 2FJ1A 2E1CA 4HV6A 3OIOA 4RGUA 5DV5A 1OCRH 4MTDA 3BR6A 2XB0X 3L09A 2KISA 3SEZA 5B3SH 3FKJA 5FLMJ 5JFRA 4PUSA 5LEJA 2D5VA 2L9RA 3I4PA 4MO7A 4P9FA 1T08B 3K4JA 3EPZA 4CYDA 3PQKA 1LE8A 4OIRF 4HRIA 3BR0A 2Y75A 3HC7A 2UXNA 2LRDA 2KZGA 2VKEA 4IHTA 3VPRA 1MBGA 5JR3A 2CO5A 1GDTA 3FKIJ 2VB6A 3IAM2 3QOPA 1HF0A 2L0KA 4RM3A 4UVAA 3ZR8X 2EINH 3EUHC 1OR7A 3HKZA 5DD8A 4ENKA 1D5VA 3HOTA 4OMYA 1HC8A 4I0BA 2JPCA 3K7AJ 1PYVA 5EZGA 5J40A 4HX7A 4N4OB 1R6RA 1X4PA 4XSXF 4CCLA 2VQLA 2A07F 1YIJI 2CV0A 3V7RA 2WA0A 2Y0MA 4E7JA 4EGYA 3TP3A 4A3FJ 3VYUB 4DNCA 1F1ZA 3K4LA 3L9FA 3S1QJ 3DBRB 4G7OF 4KMFA 3FBIB 3K4MA 4PZJA 4ZZLA 1SFXA 4IXAA 4WXDA 1MMGA 3WGIA 4FX0A 3VSLA 2LVSA 2L4MA 2ZMEA 3HG9A 1G3WA 3H5AA 1HKTA 1XB4A 1EJ9A 4Q5SF 5H6QA 1R5GA 2YPRA 3TGNA 3CCRI 2W00A 1YJWI 2TCTA 1DP3A 2COBA 4RMNA 2K02A 1CGPA 1IRXA 2IGKA 2PN6A 2M8EA 4LITA 1W5CC 4A12A 1VQ9I 4CSWA 1UJ8A 3KCCA 3I54A 2H1KA 3IP4B 4GXOA 5CJ9A 1MIJA 4RBOA 1MSEC 2E5ZA 2VBXA 1LJ9A 1Z0XA 3SHFA 5LLQA 5J3LA 2MA3A 1K78B 2L7KA 1X2MA 2K9NA 3GTQJ 3J81Z 5FGMA 3D5RC 2GXGA 3C3WA 5E8IA 4EMSA 1P7JA 2ECBA 2KIQA 1U9NA 1T2KA 3R6SA 2ETHA 2VJ5A 2BW3A 3RSNA 2EFNA 2F4IA 2F5EA 3ZQLA 2JVGA 3FMQA 4CO8A 2XV4S 2DU9A 3PNYA 2VBYA 4BQOA 3VYSB 3D5LA 5EF6A 2W82A 2GA2A 2R5YA 4UUTA 1WVRA 3R4KA 3IHUA 4XIDA 1IN7A 4KJZA 3OIQA 3H3VK 2I10A 1Y8RB 3BC8A 1K6YA 1KQ8A 1IAWA 3HOZJ 2B7EA 2BXYA 3A0BC 1RRJA 4ZYGA 1H88C 1QA6A 2QKMB 1XSXA 1YIOA 2WV1A 3GZ5A 1U5TA 3K1PA 5JI6A 4L18B 1MMSA 2ZCWA 1DPRA 1AKHA 2LY1A 1L0OC 4A3LJ 4AM3A 4P5OA 2CUZA 2GBYA 4M71A 4C2MJ 1BW6A 4AVZA 5E17F 1IDYA 4Q48A 1VFCA 1IV6A 1EH8A 3VWBA 3F72A 5KAFC 4B4CA 2VJ4A 3DTEA 4UV8A 2X85A 3FHNA 3RQ4A 3J80K 5C4JJ 2IPQX 2X1CA 1ZKGA 4CYCA 1IG7A 5J1UA 5GPCA 2QUFA 3EUAA 1OYIA 2F5CA 3T8TA 2Z99A 3BOQA 5EEHA 2WAQA 4BGDA 3U2RA 4E7IA 3WG9A 2ME0A 4KFCA 3HZJA 2YR2A 1Z9CA 1OYYA 5ICCA 4MLOA 2QENA 2YU3A 5LBQA 3AFHA 3SFIA 2DI3A 2IA0A 2I8DA 2DA4A 1KA8A 3LSKA 4ZYDA 3WTWC 3D1NI 4AU7A 1R7JA 3TO6A 3AAFA 2HZTA 3S1RJ 4Z2YA 2V1XA 2GWRA 2Q8KA 1SD7A 1Z7UA 2F4MB 3CCLI 1MBJA 4MHGA 3WU1B 4JOMA 1BR4A 3ECHA 1FTZA 3BR3A 1OCPA 1W7PD 3P9KA 4D5FA 2DN0A 3S2DJ 2FSWA 3HYIA 2Z3YA 3K0LA 1OCOH 4A6DA 3GTJJ 4S0HB 3W6VA 1MH4A 2H6BA 2ISYA 1FT9A 1F4KA 3BLYA 3S3MA 2H94A 2JA7J 3IH3A 4C2TA 1VQ7I 2CS3A 2HQ5A 4QTRA 2IVMA 1ZH5A 5B1AH 1P7IA 1AWCA 5ICEA 1RKWA 3WU2C 4NNJA 3CCUI 2HVSA 1U9OA 3S16J 4B48A 4IF4A 1H9TA 2WB1A 4RAFA 2GOXB 1VNDA 1FOXA 3BY6A 4GDFA 3DEUA 3S2WA 3QRFF 2P5VA 1L3LA 2DO7A 3E7LA 1LFPA 2HKXA 2JQ7A 1UG2A 3VODA 1JT6A 2JK3A 1HCRA 1MKMA 2ZB9A 4NB5A 1VQ6I 1D1CA 2QSFX 4MQ9F 2KJBA 3QPHA 3KEYA 1BOBA 3OYIA 2Y48A 3IWFA 3CD6I 3R0JA 1VQLI 4GFBA 2VN2A 1NK2P 5DM6F 3E5XA 1TLHB 3TL4X 1YRNA 4QPQA 4IKFA 1W1WE 1S5LC 3H35A 4DOZA 3V7SA 4Y13A 4N0BA 3LL7A 4KN7X 3FF5A 4UB6C 2K86A 3KYDB 5TJJA 1UZCA 2DQRA 5J4VA 1SD5A 2ZMEB 4DW6A 2KT0A 1IN5A 3AL0B 4UXNA 1JXSA 4JK1X 3FXQA 3ISPA 4PSXA 1G3YA 2EIKH 1BA5A 1ZTRA 3GCMA 4WCGA 1O3SA 4X1EA 2L7FP 1OFCX 3JW4A 1VQMI 4CCOA 1FIPA 1MJ9A 2A6HF 1IO2A 3DFGA 5D4SA 3SZGA 2KFDA 3QOEA 4Q4ZF 4ZH4F 3OS1A 2RQQA 2D45A 1U0JA 4LG3A 4YEJA 2M45A 2CU7A 2Z5UA 5J6XA 4IOAF 2BEOA 4XN0A 3LA7A 5JVGF 5F0HA 1Z21A 3IC7A 3G6EI 2N8GA 5CVJA 3NQOA 3PIPF 2TRTA 5HNHA 2E19A 1DU6A 2PMUA 2F4OB 3H1CA 3Q0UA 4KIGA 3LQRA 4QPOA 2O03A 4X0GA 4RB2C 2DFIA 4LB5A 3G4SI 4PFPA 2KHMA 5D4RA 4Y15A 2BW3B 1R1UA 4RGXA 1NTCA 2PG4A 3X2QH 2PFBA 4OIPF 4CZZA 3V4GA 2IS6A 4GCVA 1T0FC 1D1BA 2ZNZA 4CUGA 1IGNA 1XGOA 4E70A 2DMNA 4XN3A 2HKOA 3MEXA 4I0AA 4FASD 2IRFG 2M34A 3GTOJ 4HSRA 5FKMA 5GTHC 1J75A 5K5QA 2R4GA 2J5PA 2QLZA 1ZG1A 5LHIA 1KU7A 1XMKA 4M3BA 2MABA 1U5TB 1X1BA 5B1BH 2NVQJ 1XG1A 2VXDA 1B59A 2XAQA 4G6QA 4KIBA 2BY0A 4C9YA 1O7LA 1AKHB 3JRIA 3H0DA 3QWLA 2XSJC 4HF1A 2KDOA 2KIUA 3KIOA 3CCJI 2LMDA 3LSJA 4MIMA 3DPTA 1FPQA 2P7CB 2HQAA 4DZJA 2GXAA 1WGXA 5E1WA 1B72B 2XPWA 3HOWJ 1RC9A 1KYZA 4CYCB 5LHGA 4FT8A 1QU3A 1WI9A 3RYRA 2V4JC 1J0RA 1MGTA 1YX3A 2LSOA 5ICFA 2EPFA 1ITYA 4U87A 1UCRA 2CUJA 2E5NA 2Y9YA 2H1LA 3I3LA 4LIUA 4N9HA 1TQPA 1I6HJ 5HS9A 3UNGC 3FXOA 3NAUA 4XKWA 5L3GA 3FK7A 2MH9A 3E5QA 3ESWB 3HKZN 4ENNA 1H9GA 3BZCA 3MCZA 4A3BJ 2X6YA 1LQ1A 2LC2A 2K3FA 2FMYA 5LD2C 2QYOA 3RPUA 1SC7A 1SMYF 3A1YA 1SD4A 3CC2I 4KMUX 1JUSA 1FNNA 3HOYJ 5J4YA 1PP8F 1Z3YA 1HXDA 2LLKA 3OYNA 2K7LA 1FYMA 3TOBA 3GLXA 4A0ZA 3F6VA 4A3IJ 4F93B 4KIFA 1FMWA 2CFOA 1H89C 2ID6A 1GLNA 2P81A 3H3ZA 3E3VA 3KE2A 5IT9Z 2ZJRF 1HBXG 1FWZA 2HEOA 3WE3A 2NVTJ 4XLAA 3PL8A 1W0TA 2JZYA 1YO5C 4Y4RA 1Z7LA 3Q5FA 3I0TA 3JCUC 4DYQA 4HNTA 2V9VA 1WHUA 4FISA 3FISA 2LDUA 3LSMA 2H8RA 2MLGA 1D0YA 3TW7A 2ECCA 3V42A 2HFHA 3T8RA 4G6DA 1FIAA 1HKQA 2R7QA 2W25A 3P9IA 3OYDA 3MKZA 2CG4A 2XAGA 5CVVA 1QQIA 1FP1D 1ZYRF 2ZO4A 5F08A 4EJOA 2YX7A 5HOOA 4KDPA 3G71I 1IN4A 4P1WA 4E7HA 4PSWA 3M9AA 4G94A 1T8IA 4DGWB 4EM1A 5L3FA 3Q9SA 2VQHA 4JX5A 1YRNB 3W2VA 2CV2A 4DYRA 2J5OA 2LY2A 2GM4A 4MEYF 3DTKA 2VC0A 4EJTA 2DAOA 3V7CA 1U6GA 4S04A 2XPUA 4AIDA 1JKPC 2RC4A 1J09A 2YUSA 1QHGA 3CDHA 1HW1A 4B09A 3M07A 3LQQA 4F92B 3SQNA 4KA4A 2DK5A 1FTTA 4Y3OA 2VI6A 1T6SA 2CYYA 1J2XA 2FOWA 4B44A 2YSRA 4M9ZA 1VQ8I 3CF2A 2OQRA 1B4AA 2DFFA 2RREA 2IS2A 2BV6A 5HLTA 4I2OA 2R0QC 4RAGA 2VONA 2OTJI 3KZZA 4Z6YA 4V19K 3WTXC 3C18A 3P5JA 5H20A 2QQ9A 3F8MA 2VJJA 3MVPA 3TDUC 1I27A 4E7SA 2QSGX 1QVTA 2EFPA 5EEGA 5EG0A 3AG2H 5IOYA 3N05A 1F43A 5ILVA 3KETA 1Y0NA 4XICA 3OYBA 4WXCA 2L2OA 4H0EA 1X1PA 1A6QA 2Q1ZB 2R7OA 5EJCA 4IHVA 1XTAA 5EEAA 1ETKA 3FIWA 1BW5A 1O57A 3H36A 3ZMVA 1BIBA 4F91B 4HDVA 1G4DA 2HYGD 4EEFG 4I99C 4BACA 4HV5A 3OS2A 4Y7NJ 2OBPA 3JRGA 2EH3A 4A0XA 2E35A 2EV5A 4XONA 2JSCA 3TEDA 4BBSJ 2NOJB 4DBQA 3DQVC 1OR7C 3W3CA 2ZFWA 4L9VA 5FKNA 2FA5A 2MC3A 3DXJF 2QEXI 3HRMA 2DA3A 1F36A 3HL2A 5GAEJ 2KP6A 3L2UA 5CKTA 2K85A 4HQEA 2H09A 2GA1A 3OYHA 2JUGA 5HVQC 1ZR4A 4BHPA 4NBQA 3BG9A 3FXMA 4W97A 4ZTJA 3PNTA 3CMAI 2COMA 2QQBA 4IRHA 3SZTA 4XRSA 1MNEA 1XPXA 2KRFA 5J47A 1LB2A 2A6EF 3GLLA 2ICWG 4YG2F 2FXAA 5K7ZA 4L9JA 1IC8A 3H92A 3BROA 1MW7A 4C3JJ 2LTPA 2O3FA 3COAC 5F6FA 3C1DA 1S6LA 3GZ6A 3FX3A 1TQIA 3HDDA 1GT0C 1UFMA 1Z1DA 1V4RA 3FM5A 3H0GJ 4PGGA 2W84A 4II2A 1JUPA 1D8JA 5F0FA 3R0AA 1S29A 4XRSG 1HW5A 1TNTA 2AQFA 2DA7A 4MTEA 1ENHA 3MAJA 4G7HF 1V54H 4M74A 4MFDA 1ZRCA 1TWCJ 1JKOC 2XF6A 1HW2A 1LNWA 4XOTA 2IGMA 3EQLF 2V6EA 4L0YB 4XK4A 2B0LA 2IAIA 1WJEA 4A69C 4OIOF 3VSKA 3WTZA 3DU5A 4IRGA 4XQFA 3WTYC 3R60A 3LA2A 4EM2A 2HOEA 4MNUA 1RIOH 4CCKA 1P4XA 3EYIA 2A68F 3S8PA 1W5SA 3ZQQA 4Y17A 4BEHA 3FMRA 4XR6A 3S14J 2BHYA 2Y31A 3DLAA 4G6TB 3KP6A 1X1DA 2E2JJ 4BY7J 1R4MB 4MGRA 4RB3C 1XDSA 1T56A 3K2ZA 3DLLF 1TC3C 3M3YJ 4E4HA 3RKQA 3PSFA 3S93A 1NG6A 5FLXZ 1Z67A 3CUQA 3A0HC 3LAJA 3HOXJ 2FUG2 1ZG5A 3JRCA 1ZELA 2E36A 3UKGA 2DA2A 2DXIA 3CLOA 4FE4A 3N97A 2XC7A 1T95A 2DYSH 2PBIA 4NC8A 3S3OA 5K7FA 2XSDC 1D5YA 2IS1A 4XRFA 2PX9A 3OYLA 4R79A 4PJJA 4HW0A 1Q1HA 2NYXA 2RNGA 2NVUB 2IT0A 1XCBA 3G1OA 4LG0B 2FD5A 3ELKA 2GIZA 3G1MA 5L3CA 1G3SA 3I58A 1YJNI 1BJAA 3GF2A 2D1HA 1LFUP 4I6ZA 3MKYB 5TRDA 3LWFA 2F5FA 4RAYA 5DYMA 3K2AA 1YW7A 2LH9A 2AXTC 2HXIA 1IUYA 2JVHA 4BE0A 2V79A 3QP6A 2M4KA 1BI3A 2LKPA 3WHCA 2W24A 3CZ6A 3HGYA 1GUUA 2VODA 1PJRA 1BM9A 3SXYA 3IH4A 3VYRB 2L7MP 2I5UA 3DBLB 1WWXA 3JRDA 1K4SA 1EF4A 4LK1F 1WJBA 1FLIA 1ETWA 3O3KA 5EG0B 5AIQA 2ME6A 3VYTB 1WJDA 5D5XB 1SAUA 1KQ9A 5K5RA 2IS4A 2RNJA 4L9NA 1LKXA 2DDBA 4AIHA 2IJLA 2LY9A 4RLQA 3JRFA 3HHGA 3Q0WA 2LP0A 2HYJA 4KICA 5DCFA 2QVOA 5HLHA 5B66C 1MBEA 2BY2A 2F48A 2KDZA 4LOCA 1FJLA 2CW7A 2E1OA 3PIOF 3CCSI 4IEJA 3WE2A 4OAYA 2CV1A 3TP0A 3I56I 4I76A 3M8FA 2V1UA 2OPTA 2RQPA 3T1BA 3W6KB 2VXZA 2DT7B 2E1MC 4UB8C 4ESFA 2PEXA 2QBYB 4RM2A 2VQGA 4BAYA 3MN2A 1B9MA 3F22A 1RUOA 1POGA 4GRIA 4EV0A 1R49A 2IXSA 3GXOA 2P5LC 3OY9A 2V7FA 1QGPA 3H9GA 3GVAA 2GIVA 1LDJA 4BL0B 3GBGA 1GVJA 3K70C 4K2EA 3HSEA 3ZMDA 1P92A 2JJ7A 1DGWY 2NNNA 1K6OA 1NK3P 2VBZA 3ZMUA 1ERDA 3JAMK 1B72A 5DCMB 3HEFA 3LSTA 1OJLA 4LGWA 1QZZA 4HG2A 3K70D 4A6EA 1NH3A 4KNYA 4X6AJ 3IAS2 1FEXA 1FOWA 4RLFA 3EETA 1TTYA 2FNPA 2FQ4A 1RKTA 2A05A 2EB7A 2M5WA 1YW8A 2W7NA 2X0LA 2AQEA 3PNVA 2XKOA 2HPIA 3IKVA 3MZYA 4M72A 3SYTA 5ICGA 2OZ6A 1EH7A 1KU9A 3F8NA 2RDPA 1YI2I 3CCVI 1Y0UA 4O3MA 3CCQI 4Y52J 2MH2A 1BL0A 5BS6A 2JMWA 2ADUA 1YG2A 2LKSA 2RV8A 1IW7F 4LMYA 2XRNA 1S8NA 4BE2A 3RKWA 3S32A 2VPRA 1ETYA 4G9YA 4PDKA 1JUMA 2EZLA 1WRJA 2LFBA 1SFOJ 1WH5A 2WWYA 4G12A 1X3UA 2DA6A 2P0WA 2Y0SN 3KYCB 3OIPA 4LLGF 2XGEA 3HTUA 1MNDA 2ZJ2A 4U7DA 2K3PA 4BJ5C 3AG3H 3F6OA 2FNAA 3F0CA 2QGUA 4IHXA 1KQ0A 2RVCA 3DPLC 3OWTA 2BYVE 4JX6A 3OYAA 5KAIC 5IT3A 3SZPA 1HDPA 3OR1C 4OOIA 5L3EA 4F52A 1U2WA 1D0XA 1GV2A 1R5HA 1XN7A 2X1EA 1FYLA 2HQNA 5LRRA 3F23A 3ONQA 1LEAA 1ZQ3P 5EZHA 1E17A 1DGRM 2UZKA 4BEHB 1I3AA 4XLFA 2KRCA 4IJAA 1APLC 2QZ8A 1IN8A 3QP5A 2CW8A 3F8CA 5AIPA 1PUFA 5AONA 3RDIA 2L54A 1LDKB 4HNUA 4IVNA 4C3HJ 4XLHA 3P9CA 3U21A 4BQNA 1REPC 4UVCA 3CUQB 3D0SA 4XMYA 4CDGA 1JTXA 3FDYA 2QQ8A 2FBIA 1N77A 3ZN1A 3BJ6A 1SD6A 3L7WA 3SDGA 4RB1A 2XF7A 3OL4A 1KU3A 3RJPA 1RNLA 2M30A 1P9QC 2R5ZA 4BBRJ 1FYKA 2BXZA 2LR8A 4NHJA 5CQEA 4BYYA 3GFJA 5HDKA 3ZMZA 1H0MA 2MD5A 3HOSA 5CPRB 3L2QA 2DOFA 5CLSA 2L4AA 1ZRDA 4A3GJ 5H6RA 2E2IJ 5FD6A 5J8FA 3MZ8A 2F6CA 5E3LA 2EQRA 2JA2A 3I9V2 4R8HA 4A3DJ 1D1AA 1ORKA 1XX5A 1O4XA 1STZA 4OAZA 5BPIA 1DP7P 1P4WA 4CGZA 2P4WA 2VLAA 2FBKA 2Y30A 1FSEA 2BVLA 1D0ZA 2F2EA 2MFZA 5KVRA 1VZ0A 2NOGA 2KZVA 4EJVA 3JR9A 4I01A 1FMVA 3KLNA 1UHMA 1MMDA 3ZMSA 3QU3A 4BHBA 3RPUD 3CDIA 2OCCH 3LFKA 4ZTFA 4V2FA 4FX4A 4AYBA 4R1HA 3S1NJ 5HLGA 4KUMA 4M9XA 2XGDA 3HPGA 2CQ7A 4BUPA 1MH3A 2EZKA 3GUDA 2DTRA 3A02A 3HPHA 1TT5B 5KCMA 1SANA 4FTHA 5CVIA 2L3DA 5E20A 4CCMA 3ML6A 2IGOA 5DS9A 2EZIA 3LSPA 4I02A 4RGSA 4G7ZF 1W5TA 2DFHA 3OYEA 1U8BA 2OD5A 4P55A 2R7DA 3MFKA 1BJZA 4B8XA 1LVAA 3HM5A 3ZQHA 2X6OA 1VQ5I 1A5JA 2V6CA 1AOYA 2LYCA 2CW0F 4HLYA 3FXKA 5A2QK 1RPWA 1UMQA 2L9NA 3FWEA 3PUBA 4PJNA 2DMTA 1WJCA 1E3HA 2R7WA 1D8KA 2EFWA 2W48A 3BDDA 3B02A 2L02A 5KK1A 1FY7A 5E8GA 2ELHA 4ZJZA 1SVLA 5FJ8J 3I4MJ 3QPSA 2FE3A 5CVUA 2R7RA 1R00A 1O3QA 2BY1A 3ZOBA 4C3IJ 4N4NB 4HA8A 2XAHA 3ZQ7A 3SDBA 2O8KA 1A04A 1JTYA 2DA5A 4UY8I 2VL8A 3I64A 1SEUA 1UHSA 3L2RA 4E6KG 2BOLA 1IXCA 3MD2A 4QSHA 2ELJA 4ETSA 5DEQA 4M6VA 2V9KA 4O5VA 2JA6J 2VT2A 4HYEA 5E1XA 3J7AY 1RR7A 1LPQA 3AG4H 3BTIA 3DP7A 4ZC3A 1N75A 1B6AA 2DCEA 4IQJA 2VBWA 1TZLA 2KLOA 1V55H 1XMAA 3J7ZI 2KRHA 5FROA 3ROUA 3S2HJ 4IZZA 1P2FA 3T0YA 2MG4A 2WBMA 2O61A 2WTEA 4KITB 3LSRA 1OLTA 1B8IB 5J1YA 2PJRA 1EA3A 2VKDA 2LOOA 1S72I 4GYIA 3B6CA 3IWZA 1E2XA 3BZ6A 3BG5A 3AKZA 2K27A 2QKLB 3ERMA 4HF2A 3L2VA 1SVMA 3HUGA 2LNBA 4IL6C 2VJIA 3T5XA 1BI1A 3HHHA 1IN6A 1Y6IA 5D8LB 4DYCA 2DJIA 3OYGA 3IV5A 5HS7A 3LNQA 3KP5A 3PQJA 4BE1A 4QWQA 2XIGA 2Z2SB 2LBFA 3K1NA 3HXLA 3FBNB 5F1JA 2G9WA 2KL4A 3KP4A 3N4MA 1RZ4A 1RESA 2G0EA 2LF8A 3E6DA 2CGPA 3I59A 1PUFB 3QQAA 1GXPA 5BQTA 3J7AO 4ABZA 2E1NA 3E0JB 1S7EA 2PLYA 3HSFA 4ZYHA 3S17J 1F9NA 4ZYAA 1YLFA 1JGGA 4I09A 4XKVA 2X48A 4Q47A 4A0YA 5E18F 2DQLA 1K79A 2XAFA 1BR1A 3LOCA 1DDNA 2E71A 3BG6A 3AG1H 5ED4A 4A93J 2EFOA 3DKXA 3M8EA 4LFUA 4BH9A 3JTGA 3ERED 1WQ2A 2MW8A 2ZSIB 2HXOA 3MQ0A 1PDNC 5C3EJ 2DOEA 2HU9A 2P7VB 3HOUJ 3CMEI 2R5ZB 4RB0A 1FX7A 3GFLA 2W85A 1HQCA 3NWTA 5EGOA 1S9HA 2V26A 2W57A 3HRSA 2PMZA 4LG0A 4EM0B 4ON0A 4Y33A 5L3DA 3BCAA 5M5YJ 3FHZA 1GVDA 2ZXIA 3H5NA 5KHDA 2UUZA 2K9MA 5GP9A 1ZHFA 1B9NA 1IF1A 3W2WA 2ZSHB 1DU0A 3FXJA 1WKMA 2IA2A 3ABLH 3RCOA 1USTA 4UVBA 1TW2A 4A5NA 1U3EM 1AU7A 3WHBA 4UHTA 2G7UA 2E7WA 3CESA 4L9TA 1MD0A 1QZYA 4JYKA 3IL2A 3L00A 4YIIA 2FEZA 4O6JA 5J1RA 4EJWA 4J01A 2LKXA 5JHFA 2NNYA 1E3OC 1R9TJ 3OOPA 2WAEA 1O3TA 1ETVA 2DPUA 9ANTA 4A3EJ 4LD5A 2EIMH 1M1EB 3K69A 4NC7A 2HTSA 2AXLA 4HX8A 4OIQF 4AIKA 4C30A 4HPQA 4FE7A 3HJEA 1W0UA 2O7OA 1R36A 2HQRA 3FXRA 1MDMB 2K4BA 1HKSA 1JJ6C 2O8XA 2WAQN 3HTSB 1YE9A 2PQ8A 1GV5A 2WAFA 3KZIC 1SMTA 2BE5F 5FB2A 5GAHJ 3KP2A 1OISA 4ESJA 1QO0D 1WJFA 5CYVA 1XMXA 4XL9A 3HOVJ 2K9LA 5IYCJ 3IUOA 3K4NA 2H27A 4ESBA 2P6TA 4EVIA 3ZPLA 4NDLA 2DT6A 1KGSA 4OMZA 2B63J 5GAGJ 2QBYA 3S15J 1OMIA 1AHDP 2MYSA 2JSPA 2D2WA 3C2BA 2CH0A 3OL3A 4NC6A 4EGZA 3WGHA 2XB5A 2CQQA 3CUQC 3KX2A 1BOAA 3QAHA 1J59A 1XD7A 3JTHA 2R7SA 3VOEA 4DBRA 1R4NB 3CF5F 4I7HA 5GTIC 3L2CA 1J9IA 1USSA 2VKVA 3F21A 4J00A 2LG4A 5TISC 1YTYA 2EFQA 2M7AA 4YIFA 1R71A 4KYWA 4D9JA 1O3RA 5DCMA 1G8XA 3MWMA 2XGCA 3BT9A 4KN4X 3I71A 4CH7A 3PUFA 4ZDOA 3K9TA 3WTUC 2ZMEC 4KT5C 4DJAA 2V9PA 3DEWA 3AL0C 3KP7A 5D5VB 1OCCH 2WB1N 1VQOI 3I55I 3CQZJ 3VDXA 1OCTC 1ZGWA 3HB9A 3CJNA 3FZVA 2M0MA 3BTJA 1Z6RA 1XC5A 3QPTA 2NS7A 5IYBJ 4WX9A 5IT9K 1JE8A 1UHWA 5JLWA 1IXRC 3E6CC 1E3PA 4L5JA 2EV6A 1MBKA 1Y56A 1FBQA 3JRBA 1Z91A 1VQ4I 1CQTA 1QPIA 1J5YA 1ODDA 1K83J 2PJRB 2OA4A 3ZQCA 4A3JJ 1R1VA 2ELKA 2QF7A 5FD5A 5H2FC 2Z9OA 1X1AA 3HRUA 3LAPA 1XSDA 2XKPA 2VUMJ 4ZDLA 2FQ3A 4IHWA 4J19A 5GPAA 2BBYA 1K7AA 5HS8A 1IZ1A 3F8BA 5LHHA 3HUGB 2D1VA 1I3QJ 3JAMZ 1MNMC 3ZP5A 3F3XA 2GOMA 4F3QA 5F64A 5FFXA 3J80Z 2OC6A 2HZDA 2EILH 1MJBA 1DQUA 2CJJA 4RDUA 1B1BA 3M1EA 2LBFB 2R7ZJ 3PO3J 5EDNA 1OPCA 1OKRA 4RAZA 3RI4A 5F27A 4HEA2 3I59B 3JSPA 2M4GA 1X3ZB 3PSIA 2RKHA 2Q0OA 2HGCA 3HBLA 3P7NA 3CC4I 2KMUA 4N9IA 3W6JB 3CJTB 3G1LA 1KZHA 3WTSC 3OYCA 1EV7A 5M5XJ 1U5TC 4XLCA 1QPMA 3GFIA 2VQCA 3F8FA 1BC7C 1TW3A 4YFNF 4NUBA 1DUXC 5FKOA 5FKLA 3CJRB 1JHHA 3K4BA 4BQAA 4AYBN 4A3KJ 4YFKF 3DKWA 2FU4A 1F5TA 4XLEA 2P8TA 3PO2J 1MMNA 3OYJA 5IYDJ 2L9SA 4AWXB 3C7JA 4U88A 4S05A 2UV1A 4LK0F 4OWRB 1LVKA 2BGCA 2XASA 3GZNB 1IUFA 1ZN2A 2CWEA 1RUNA 1JHFA 3M1CA 4CA0A 4LB6B 3IRQA 5EGOB 2QCOA 1G59A 4HF0A 3OYFA 1X3WB 2DT5A 3EYYA 4D1QA 2Z1DA 5D5WB 2BZTA 1BC8C 4IRIA 5ILUA 1H8AC 1ULYA 1Z05A 5LEKA 1D3YA 2O0YA 4B43A 2P5KA 1WCMJ 2DW4A 2GLOA 4HBLA 3F9KA 1VQKI 2XUBA 3TOAA 1JKRC 2VPLA 1HLVA 2FBHA 4WWCA 2L7ZA 5JLXA 4HLXA 1A35A 2M2EA 2IP2A 2XDVA 6PAXA 5TGTA 3CO6C 3LFUA 4QIWN 2HOSA 3UR3C 1ETQA 4PCQA 5K1YA 2O9LA 3MMYB 5GADJ 3FM3A 1G2HA 4LLNA 1RETA 2L01A 3A4CA 1QNTA 3DV8A 3FXLA 3K1MA 4M9SA 1P6RA 1BI0A 1T98A 3ASOH 4V2GA 5BOXA 4AIJA 3EUKL 2JN6A 1R22A 2OAZA 3R61A 2HOAA 2VOOA 1FZPB 2JTVA 3RQIA 1YQAA 2Z33A 3SJMA 1T38A 1JKQC 1R23A 2MBFA 4L5EA 2QSHX 3I5UA 2ZXJA 4FQGA 1BI2A 2NS0A 4XSZF 1IJWC 3JRHA 2XPVA 4DZPA 1QBJA 3OMYA 4BXFA 3NRVA 3O8GA 4IX7A 2CQKA 1WJAA 2OQGA 1LEBA 3BPXA 1FSHA 1N25A 2AHQA 4W1UA 2RAEA 5BNGA 5IP9J 2H6CA 3A01A 4L0ZB 1XCVA 3ZGKA 5FRMA 4RGRA 3HGGA 1OCZH 3IRRA 2AO9A 1S7AA 1WPKA 4A2UA 3EUHA 4PJ0C 3GEZA 2IA1A 3RZDJ 5J8CA 5DM7F 2X6WA 3ZQFA 1Y1VJ 1Z77A 3ZQIA 3GTMJ 4CXFA 2F5DA 4WF2A 4EQQA 4QLCU 3RKYA 3C2GA 2ZBKA 3NEUA 2WV0A 1UG0A 3KYLA 5BPDA 3GTKJ 2A5YB 3OV8A 2M8GX 2Q2EA 1FC3A 3ZN0A 2R93J 2HR3A 2EA4A 1VF9A 3DPUA 2KQRA 3TBIA 3L2WA 2UXXA 2EZHA 1DPUA 3LMMA 1X2NA 4HX4A 5ERIA 3DKYA 1FBSA 1UAAA 3TKYA 3ZRGA 1IDZA 1IRGA 5A2QZ 2M7BA 2CUFA 2HPMA 5IOZA 2YU9J 2R7UA 1P4AA 4HZFA 5F04A 3LA3A 1B8IA 2M0CA 3DEEA
chains in the Genus database with same CATH topology
3GWZA 4ENJA 2NAZA 2VT3A 3CO7C 2K4JA 5FLXK 5BMZA 2YX4A 2A69F 3EDPA 4BHCA 4AVPA 1ZGJA 2VC1A 4HDUA 5LGNA 4RS8A 5D8KB 2M87A 4HOBA 1YS7A 1OYWA 3ULQB 4L5IA 4PGHA 1SFUA 4IPAA 2JT1A 2R7FA 1ON1A 2DLLA 2DPDA 1LDDA 1XGMA 5DDGA 1ZLJA 2EK5A 2KKOA 4MEXF 3BWGA 3WTTC 2EJRA 5FFZA 4DQ2A 1CF7A 2OU2A 3GX4X 2KIMA 5D5UB 3V8KA 2RN7A 4BNCA 3J81K 2OZUA 1PP7U 1XGSA 4P96A 3KLOA 3JSOA 3GYHX 2GXBA 1KU2A 1EH6A 4UNOA 5K5OA 5D6FA 5DD4A 1YW9A 3U9GA 1ZGAA 1U78A 1ZAOA 3KZYA 1G6NA 3HRTA 1WSUA 1UB9A 3IKTA 2ISZA 1I5ZA 2PI0A 4NQWA 1ON2A 1SFEA 2O6GE 1Z6TA 4F7ZA 4U0VA 5LRSA 1W7PA 4EJUA 1MDMA 1TBXA 4G8XA 4I98B 3BPVA 2IW5A 2KJCA 5HDGA 1FP2A 3HSRA 1VTNC 3ECOA 3E97A 3FMSA 4JQFA 1I1SA 4CHUA 3VFZA 2EWNA 5L3BA 4LLLA 3SFZA 2XGXA 3BJAA 1ZG3A 4LJZF 3RIRA 2QWWA 2HTJA 2A3SA 2RGVA 5ILSA 4ZYEA 4WK8F 2FMLA 2UWMA 2A61A 1T39A 2ZNYA 1GHCA 1ZLKA 2XAJA 3GO5A 2DBBA 1ZARA 4D0PA 4ENMA 3KFWX 2KIFA 1IXSB 1XGNA 4HQMA 2QQAA 3Q9VA 3E5UA 2STWA 3BJOA 4ZZDA 2FF4A 2TDXA 3E6BA 2V1DA 4AD9A 1FOKA 1YYVA 3B73A 1NHAA 4FHTA 3U1DA 5LGTA 4ASNA 1BBYA 2VOPA 2MLKA 4CICA 2GQQA 3ABUA 2VE9A 1HSJA 3TO7A 1XSVA 5LGUA 1IRFA 4HAMA 1TNSA 2GZWA 2XROA 2NRAC 2CFXA 1RI7A 4M6XA 2E7XA 1SAXA 3RPQA 3QU6A 3KP3A 2XHKA 2HYFA 4GYGA 5DUKA 4U0YA 5CVRA 1YS6A 4XBFA 1XDUA 3O6BB 2WC2A 2PJPA 3KEOA 1T0FA 4U0WA 2R3SA 3WU0A 3G73A 4M73A 3TO9A 3G3ZA 4OINF 4A5MA 3HIFA 1CF7B 4BXUA 2FRHA 2G7HA 2VE8A 1R58A 5HDNA 1TQMA 4P9UA 3KEQA 1R1TA 4YFXF 2EV0A 3V8JA 3RKXA 4UV9A 3I53A 2STTA 3V8LA 4GGGA 1O7FA 1ZREA 1V3FA 5D6EA 3WGGA 1MZBA 5F1RA 3M7GA 1MJAA 3FXUA 2M1BA 2XVCA 4MQVA 3TQNA 4UUVA 1W7PB 2GAUA 4OU0A 2JPBA 3CTAA 1YFHA 1G3TA 3PFIA 5DUIA 2FOKA 1K78A 2QM3A 1I6XA 2ACJA 3REOA 3ZMTA 1BIAA 5JVTA 4WXHA 1HSTA 4XLPF 1KYWA 2C6YA 3E6MA 3BP8A 1GXQA 2ESNA 3WODF 4IHSA 2PMHA 1FBUA 2CSOA 2ESHA 1S7OA 3ABTA 3O2PE 3GW2A 3H3UA 4JBAA 5E1ZB 1BN5A 1PUEE 2ZKZA 1U8RA 2JRTA 3VEPA 2HS5A 3VB2A 3TDZC 4XLNF 3DF8A 2HWVA 1S3JA 2EA2A 1ONVA 4U7BA 1ZRFA 1J7KA 2AS5F 1I1GA 3GFMA 3WTVC 5JHUA 5HLIA 2P6SA 3CUOA 4TV7A 5FO5A 2DK8A 2LF7A 3RTRA 1C0WA 4M6YA 2HDCA 1W4MA 3MZHA 2X4HA 1JGSA 3RYPA 4GO1A 2E1CA 4HV6A 4RGUA 5DV5A 4MTDA 3L09A 5JFRA 5LEJA 3I4PA 4P9FA 4CYDA 3PQKA 4OIRF 2Y75A 2UXNA 4IHTA 5JR3A 2CO5A 3QOPA 4UVAA 1OR7A 5DD8A 1D5VA 4ENKA 3HOTA 4OMYA 4I0BA 2JPCA 4HX7A 4XSXF 2A07F 3V7RA 2Y0MA 4EGYA 4DNCA 1F1ZA 3L9FA 4G7OF 4KMFA 4PZJA 4ZZLA 1SFXA 4IXAA 4WXDA 3WGIA 4FX0A 2L4MA 2ZMEA 1G3WA 1HKTA 1XB4A 4Q5SF 5H6QA 1R5GA 2YPRA 3TGNA 2K02A 1CGPA 2PN6A 2M8EA 4A12A 3KCCA 3I54A 4GXOA 5CJ9A 2VBXA 1LJ9A 3SHFA 5LLQA 2MA3A 1K78B 3J81Z 5FGMA 2GXGA 3C3WA 5E8IA 4EMSA 1T2KA 3R6SA 2ETHA 2EFNA 2F5EA 3FMQA 4CO8A 2XV4S 2DU9A 2VBYA 3D5LA 2GA2A 3R4KA 3IHUA 1IN7A 1KQ8A 1IAWA 4ZYGA 1XSXA 1YIOA 3GZ5A 1U5TA 3K1PA 5JI6A 4L18B 2ZCWA 1DPRA 1L0OC 4P5OA 4M71A 5E17F 4Q48A 1EH8A 3F72A 4UV8A 3J80K 2IPQX 2QUFA 1OYIA 2F5CA 3T8TA 2Z99A 3BOQA 5EEHA 3U2RA 3WG9A 4KFCA 2YR2A 1Z9CA 1OYYA 5ICCA 2QENA 2YU3A 5LBQA 2DI3A 2IA0A 1KA8A 4ZYDA 3WTWC 1R7JA 3TO6A 3AAFA 2HZTA 4Z2YA 2V1XA 2GWRA 2Q8KA 1SD7A 1Z7UA 4MHGA 3WU1B 3ECHA 3P9KA 1W7PD 2FSWA 3HYIA 2Z3YA 3K0LA 4A6DA 2H6BA 2ISYA 1FT9A 1F4KA 2H94A 2IVMA 1ZH5A 1AWCA 5ICEA 4IF4A 1H9TA 3BY6A 3DEUA 3S2WA 3QRFF 2P5VA 1L3LA 2DO7A 2HKXA 3VODA 1MKMA 4NB5A 4MQ9F 2KJBA 3QPHA 2Y48A 3IWFA 3R0JA 2VN2A 3E5XA 1TLHB 4Y13A 3V7SA 4N0BA 4KN7X 3FF5A 2K86A 5TJJA 2DQRA 1SD5A 2ZMEB 1IN5A 4UXNA 1JXSA 4JK1X 3FXQA 3ISPA 1G3YA 4WCGA 1O3SA 3JW4A 1MJ9A 2A6HF 3DFGA 5D4SA 4Q4ZF 4ZH4F 2D45A 5J6XA 2M45A 2Z5UA 2BEOA 3LA7A 3IC7A 5CVJA 3NQOA 2PMUA 4KIGA 3LQRA 2O03A 4LB5A 4RB2C 2DFIA 5D4RA 4Y15A 1R1UA 4RGXA 2PG4A 2PFBA 4OIPF 4CZZA 3V4GA 4GCVA 2ZNZA 1XGOA 4E70A 2HKOA 3MEXA 4I0AA 2IRFG 1J75A 5K5QA 2J5PA 2QLZA 1ZG1A 5LHIA 1KU7A 1XMKA 1U5TB 1B59A 2XAQA 4G6QA 4KIBA 1O7LA 4HF1A 2KIUA 3DPTA 1FPQA 2P7CB 5E1WA 1KYZA 5LHGA 4FT8A 1WI9A 3RYRA 1J0RA 1MGTA 2LSOA 5ICFA 1UCRA 4N9HA 1TQPA 5HS9A 5L3GA 2MH9A 3E5QA 4ENNA 1H9GA 3MCZA 1LQ1A 2FMYA 2QYOA 3RPUA 1SMYF 1SD4A 4KMUX 1FNNA 1PP8F 1HXDA 2K7LA 1FYMA 3TOBA 3GLXA 4A0ZA 3F6VA 4KIFA 3H3ZA 3E3VA 3KE2A 5IT9Z 1HBXG 1FWZA 2HEOA 3WE3A 2JZYA 1YO5C 3Q5FA 3I0TA 2V9VA 2LDUA 2MLGA 2HFHA 3T8RA 4G6DA 1HKQA 2W25A 3P9IA 2CG4A 2XAGA 5CVVA 5HOOA 1QQIA 1FP1D 1ZYRF 2ZO4A 4EJOA 2YX7A 4KDPA 1IN4A 3M9AA 4G94A 4EM1A 5L3FA 3Q9SA 2J5OA 4MEYF 2VC0A 4EJTA 2DAOA 3V7CA 1U6GA 4S04A 2RC4A 3CDHA 1HW1A 4B09A 3LQQA 3SQNA 4KA4A 2DK5A 2CYYA 1T6SA 1J2XA 2YSRA 4M9ZA 2OQRA 1B4AA 2BV6A 4I2OA 2VONA 3KZZA 3WTXC 3C18A 5H20A 2QQ9A 3F8MA 3TDUC 1I27A 2EFPA 5EEGA 5ILVA 3KETA 4WXCA 4H0EA 1O57A 3ZMVA 1BIBA 4HDVA 1G4DA 2HYGD 4HV5A 2OBPA 4A0XA 2EV5A 2JSCA 3DQVC 2ZFWA 4L9VA 2FA5A 2MC3A 3DXJF 3HRMA 4HQEA 2H09A 2GA1A 5HVQC 4BHPA 2COMA 2QQBA 4IRHA 3SZTA 2KRFA 1LB2A 2A6EF 4YG2F 2FXAA 4L9JA 3H92A 3BROA 2O3FA 3COAC 5F6FA 3C1DA 1S6LA 3GZ6A 3FX3A 1TQIA 1UFMA 1Z1DA 1V4RA 3FM5A 4PGGA 2W84A 1D8JA 3R0AA 1S29A 1HW5A 1TNTA 4MTEA 3MAJA 4G7HF 4M74A 1ZRCA 1HW2A 1LNWA 3EQLF 4L0YB 2B0LA 4OIOF 3WTZA 4IRGA 3WTYC 3R60A 3LA2A 4EM2A 2HOEA 4MNUA 1RIOH 1P4XA 3EYIA 2A68F 1W5SA 4Y17A 3FMRA 3KP6A 4MGRA 4RB3C 1XDSA 3K2ZA 5FLXZ 3CUQA 3LAJA 1ZG5A 3CLOA 3N97A 2PBIA 4XRFA 4R79A 4HW0A 1Q1HA 2NYXA 2IT0A 1XCBA 4LG0B 3ELKA 5L3CA 1G3SA 3I58A 1BJAA 3GF2A 2D1HA 5TRDA 3LWFA 2F5FA 4RAYA 5DYMA 1YW7A 1IUYA 2V79A 3QP6A 1BI3A 2LKPA 2W24A 2VODA 1BM9A 3SXYA 1WWXA 4LK1F 1FLIA 3O3KA 5AIQA 5D5XB 1KQ9A 5K5RA 2RNJA 4L9NA 4AIHA 2IJLA 3HHGA 4KICA 5DCFA 2QVOA 5HLHA 3WE2A 3M8FA 2V1UA 2RQPA 3T1BA 3W6KB 2VXZA 4ESFA 2PEXA 2QBYB 4BAYA 1B9MA 3F22A 1RUOA 4EV0A 3GXOA 2P5LC 1QGPA 3GVAA 2GIVA 1LDJA 1GVJA 4K2EA 3HSEA 3ZMDA 1P92A 2NNNA 1K6OA 2VBZA 3ZMUA 3JAMK 5DCMB 3LSTA 4LGWA 1QZZA 4A6EA 4KNYA 3EETA 1TTYA 2FNPA 2EB7A 2M5WA 1YW8A 2X0LA 2XKOA 3IKVA 5ICGA 3MZYA 4M72A 2OZ6A 1EH7A 1KU9A 3F8NA 2RDPA 1Y0UA 4O3MA 2MH2A 5BS6A 2ADUA 1YG2A 2RV8A 1IW7F 4LMYA 2XRNA 1S8NA 3RKWA 4G9YA 4PDKA 1WRJA 2WWYA 1X3UA 4LLGF 3HTUA 2ZJ2A 4U7DA 3F6OA 2FNAA 1KQ0A 2RVCA 3DPLC 2BYVE 5IT3A 3SZPA 4OOIA 5L3EA 1U2WA 1R5HA 1XN7A 1FYLA 2HQNA 3F23A 5LRRA 1LEAA 1E17A 2UZKA 4IJAA 2QZ8A 1IN8A 3QP5A 3F8CA 5AIPA 5AONA 3RDIA 2L54A 1LDKB 4IVNA 3P9CA 1REPC 4UVCA 3CUQB 3D0SA 4CDGA 2FBIA 3ZN1A 3BJ6A 1SD6A 3L7WA 4RB1A 1KU3A 3RJPA 1RNLA 2M30A 1FYKA 4NHJA 4BYYA 3GFJA 5HDKA 3ZMZA 1H0MA 2MD5A 3HOSA 5CLSA 1ZRDA 2L4AA 5H6RA 5FD6A 5J8FA 4R8HA 1STZA 5BPIA 1DP7P 1P4WA 4CGZA 2P4WA 2FBKA 1FSEA 2F2EA 5KVRA 4EJVA 4I01A 3KLNA 1UHMA 3ZMSA 3QU3A 4BHBA 3LFKA 4FX4A 4R1HA 5HLGA 4KUMA 4M9XA 3GUDA 2DTRA 5CVIA 2L3DA 5E20A 3ML6A 4I02A 4RGSA 4G7ZF 1W5TA 2OD5A 4P55A 2R7DA 3MFKA 4B8XA 1LVAA 1AOYA 2V6CA 2CW0F 4HLYA 5A2QK 3FWEA 1D8KA 2EFWA 3BDDA 3B02A 2L02A 5KK1A 1FY7A 5E8GA 2ELHA 2FE3A 5CVUA 1R00A 1O3QA 4HA8A 2XAHA 3ZQ7A 1A04A 3I64A 1IXCA 4ETSA 5DEQA 4O5VA 2VT2A 4HYEA 5E1XA 3DP7A 1B6AA 2VBWA 1XMAA 3ROUA 1P2FA 3T0YA 2O61A 2WTEA 4GYIA 3IWZA 1E2XA 3BZ6A 2K27A 4HF2A 3HUGA 2LNBA 3T5XA 1BI1A 3HHHA 1IN6A 5D8LB 5HS7A 3KP5A 3PQJA 4QWQA 2XIGA 3K1NA 2G9WA 3KP4A 3N4MA 1RZ4A 2LF8A 3E6DA 2CGPA 3I59A 1GXPA 5BQTA 3J7AO 2E1NA 2PLYA 3HSFA 4ZYHA 1F9NA 1YLFA 4I09A 4Q47A 4A0YA 5E18F 2DQLA 1K79A 2XAFA 1DDNA 5ED4A 2EFOA 3M8EA 4LFUA 4BH9A 3JTGA 3ERED 1WQ2A 3MQ0A 1PDNC 2P7VB 4RB0A 1FX7A 3GFLA 2W85A 1HQCA 4EM0B 2W57A 3HRSA 4LG0A 4ON0A 5L3DA 3FHZA 1ZHFA 1B9NA 1IF1A 1WKMA 2IA2A 1USTA 4UVBA 1TW2A 4A5NA 1U3EM 4UHTA 2G7UA 2E7WA 4L9TA 1MD0A 1QZYA 3IL2A 3L00A 4YIIA 2FEZA 4O6JA 4EJWA 2NNYA 3OOPA 1O3TA 2DPUA 4LD5A 3K69A 2HTSA 2AXLA 4HX8A 4OIQF 4AIKA 3FXRA 1R36A 2HQRA 1MDMB 2K4BA 1HKSA 2O8XA 3HTSB 2PQ8A 1SMTA 2BE5F 5FB2A 3KP2A 4ESJA 1QO0D 5CYVA 2H27A 4ESBA 2P6TA 4EVIA 3ZPLA 1KGSA 4OMZA 2QBYA 1OMIA 2D2WA 4EGZA 3WGHA 3CUQC 1BOAA 3QAHA 1J59A 1XD7A 3JTHA 3VOEA 4I7HA 3L2CA 1J9IA 1USSA 3F21A 1YTYA 2EFQA 4YIFA 4KYWA 1O3RA 5DCMA 3MWMA 4KN4X 3I71A 3K9TA 3WTUC 4KT5C 3KP7A 5D5VB 3CJNA 3FZVA 1Z6RA 3QPTA 5IT9K 4WX9A 1JE8A 1UHWA 1IXRC 3E6CC 4L5JA 2EV6A 1FBQA 1Z91A 1J5YA 1ODDA 2OA4A 1R1VA 5FD5A 2Z9OA 3LAPA 3HRUA 1XSDA 2XKPA 2FQ3A 2BBYA 1K7AA 5HS8A 1IZ1A 3F8BA 5LHHA 2D1VA 3JAMZ 3ZP5A 3F3XA 5F64A 5FFXA 3J80Z 1MJBA 1B1BA 3M1EA 1OPCA 1OKRA 4RAZA 3RI4A 3I59B 3JSPA 2RKHA 2Q0OA 2HGCA 3P7NA 4N9IA 3W6JB 3WTSC 1EV7A 1U5TC 1QPMA 3GFIA 3F8FA 1BC7C 1TW3A 4YFNF 1DUXC 1JHHA 4BQAA 4YFKF 3DKWA 2FU4A 1F5TA 2P8TA 4AWXB 3C7JA 4U88A 4S05A 4LK0F 2BGCA 2XASA 1ZN2A 2CWEA 1RUNA 1JHFA 4LB6B 3IRQA 4HF0A 2DT5A 3EYYA 5D5WB 1BC8C 4IRIA 5ILUA 1ULYA 1Z05A 5LEKA 1D3YA 2O0YA 2P5KA 2DW4A 4HBLA 2XUBA 3TOAA 2FBHA 4WWCA 4HLXA 2IP2A 6PAXA 3CO6C 4PCQA 5K1YA 3FM3A 4LLNA 2L01A 1QNTA 3DV8A 3K1MA 4M9SA 1P6RA 1BI0A 1T98A 5BOXA 4AIJA 3R61A 1R22A 2OAZA 2VOOA 1FZPB 2JTVA 1YQAA 2Z33A 1T38A 1R23A 2MBFA 3I5UA 2ZXJA 1BI2A 2NS0A 4XSZF 1QBJA 3NRVA 2CQKA 2OQGA 1LEBA 3BPXA 1FSHA 2H6CA 4L0ZB 1XCVA 4RGRA 3IRRA 1S7AA 4A2UA 3EUHA 3GEZA 2IA1A 5J8CA 4CXFA 2F5DA 4WF2A 4EQQA 4QLCU 3RKYA 2ZBKA 3NEUA 2WV0A 5BPDA 2A5YB 3OV8A 2Q2EA 1FC3A 3ZN0A 2HR3A 2EA4A 2UXXA 1DPUA 4HX4A 5ERIA 1FBSA 3TKYA 1IRGA 5A2QZ 1P4AA 4HZFA 3LA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWZ A;  4ENJ A;  2NAZ A;  2VT3 A;  3CO7 C;  2K4J A;  5FLX K;  5BMZ A;  2YX4 A;  2A69 F;  3EDP A;  4BHC A;  4AVP A;  1ZGJ A;  2VC1 A;  4HDU A;  5LGN A;  4RS8 A;  5D8K B;  2M87 A;  4HOB A;  1YS7 A;  1OYW A;  3ULQ B;  4L5I A;  4PGH A;  1SFU A;  4IPA A;  2JT1 A;  2R7F A;  1ON1 A;  2DLL A;  2DPD A;  1LDD A;  1XGM A;  5DDG A;  1ZLJ A;  2EK5 A;  2KKO A;  4MEX F;  3BWG A;  3WTT C;  2EJR A;  5FFZ A;  4DQ2 A;  1CF7 A;  2OU2 A;  3GX4 X;  2KIM A;  5D5U B;  3V8K A;  2RN7 A;  4BNC A;  3J81 K;  2OZU A;  1PP7 U;  1XGS A;  4P96 A;  3KLO A;  3JSO A;  3GYH X;  2GXB A;  1KU2 A;  1EH6 A;  4UNO A;  5K5O A;  5D6F A;  5DD4 A;  1YW9 A;  3U9G A;  1ZGA A;  1U78 A;  1ZAO A;  3KZY A;  1G6N A;  3HRT A;  1WSU A;  1UB9 A;  3IKT A;  2ISZ A;  1I5Z A;  2PI0 A;  4NQW A;  1ON2 A;  1SFE A;  2O6G E;  1Z6T A;  4F7Z A;  4U0V A;  5LRS A;  1W7P A;  4EJU A;  1MDM A;  1TBX A;  4G8X A;  4I98 B;  3BPV A;  2IW5 A;  2KJC A;  5HDG A;  1FP2 A;  3HSR A;  1VTN C;  3ECO A;  3E97 A;  3FMS A;  4JQF A;  1I1S A;  4CHU A;  3VFZ A;  2EWN A;  5L3B A;  4LLL A;  3SFZ A;  2XGX A;  3BJA A;  1ZG3 A;  4LJZ F;  3RIR A;  2QWW A;  2HTJ A;  2A3S A;  2RGV A;  5ILS A;  4ZYE A;  4WK8 F;  2FML A;  2UWM A;  2A61 A;  1T39 A;  2ZNY A;  1GHC A;  1ZLK A;  2XAJ A;  3GO5 A;  2DBB A;  1ZAR A;  4D0P A;  4ENM A;  3KFW X;  2KIF A;  1IXS B;  1XGN A;  4HQM A;  2QQA A;  3Q9V A;  3E5U A;  2STW A;  3BJO A;  4ZZD A;  2FF4 A;  2TDX A;  3E6B A;  2V1D A;  4AD9 A;  1FOK A;  1YYV A;  3B73 A;  1NHA A;  4FHT A;  3U1D A;  5LGT A;  4ASN A;  1BBY A;  2VOP A;  2MLK A;  4CIC A;  2GQQ A;  3ABU A;  2VE9 A;  1HSJ A;  3TO7 A;  1XSV A;  5LGU A;  1IRF A;  4HAM A;  1TNS A;  2GZW A;  2XRO A;  2NRA C;  2CFX A;  1RI7 A;  4M6X A;  2E7X A;  1SAX A;  3RPQ A;  3QU6 A;  3KP3 A;  2XHK A;  2HYF A;  4GYG A;  5DUK A;  4U0Y A;  5CVR A;  1YS6 A;  4XBF A;  1XDU A;  3O6B B;  2WC2 A;  2PJP A;  3KEO A;  1T0F A;  4U0W A;  2R3S A;  3WU0 A;  3G73 A;  4M73 A;  3TO9 A;  3G3Z A;  4OIN F;  4A5M A;  3HIF A;  1CF7 B;  4BXU A;  2FRH A;  2G7H A;  2VE8 A;  1R58 A;  5HDN A;  1TQM A;  4P9U A;  3KEQ A;  1R1T A;  4YFX F;  2EV0 A;  3V8J A;  3RKX A;  4UV9 A;  3I53 A;  2STT A;  3V8L A;  4GGG A;  1O7F A;  1ZRE A;  1V3F A;  5D6E A;  3WGG A;  1MZB A;  5F1R A;  3M7G A;  1MJA A;  3FXU A;  2M1B A;  2XVC A;  4MQV A;  3TQN A;  4UUV A;  1W7P B;  2GAU A;  4OU0 A;  2JPB A;  3CTA A;  1YFH A;  1G3T A;  3PFI A;  5DUI A;  2FOK A;  1K78 A;  2QM3 A;  1I6X A;  2ACJ A;  3REO A;  3ZMT A;  1BIA A;  5JVT A;  4WXH A;  1HST A;  4XLP F;  1KYW A;  2C6Y A;  3E6M A;  3BP8 A;  1GXQ A;  2ESN A;  3WOD F;  4IHS A;  2PMH A;  1FBU A;  2CSO A;  2ESH A;  1S7O A;  3ABT A;  3O2P E;  3GW2 A;  3H3U A;  4JBA A;  5E1Z B;  1BN5 A;  1PUE E;  2ZKZ A;  1U8R A;  2JRT A;  3VEP A;  2HS5 A;  3VB2 A;  3TDZ C;  4XLN F;  3DF8 A;  2HWV A;  1S3J A;  2EA2 A;  1ONV A;  4U7B A;  1ZRF A;  1J7K A;  2AS5 F;  1I1G A;  3GFM A;  3WTV C;  5JHU A;  5HLI A;  2P6S A;  3CUO A;  4TV7 A;  5FO5 A;  2DK8 A;  2LF7 A;  3RTR A;  1C0W A;  4M6Y A;  2HDC A;  1W4M A;  3MZH A;  2X4H A;  1JGS A;  3RYP A;  4GO1 A;  2E1C A;  4HV6 A;  4RGU A;  5DV5 A;  4MTD A;  3L09 A;  5JFR A;  5LEJ A;  3I4P A;  4P9F A;  4CYD A;  3PQK A;  4OIR F;  2Y75 A;  2UXN A;  4IHT A;  5JR3 A;  2CO5 A;  3QOP A;  4UVA A;  1OR7 A;  5DD8 A;  1D5V A;  4ENK A;  3HOT A;  4OMY A;  4I0B A;  2JPC A;  4HX7 A;  4XSX F;  2A07 F;  3V7R A;  2Y0M A;  4EGY A;  4DNC A;  1F1Z A;  3L9F A;  4G7O F;  4KMF A;  4PZJ A;  4ZZL A;  1SFX A;  4IXA A;  4WXD A;  3WGI A;  4FX0 A;  2L4M A;  2ZME A;  1G3W A;  1HKT A;  1XB4 A;  4Q5S F;  5H6Q A;  1R5G A;  2YPR A;  3TGN A;  2K02 A;  1CGP A;  2PN6 A;  2M8E A;  4A12 A;  3KCC A;  3I54 A;  4GXO A;  5CJ9 A;  2VBX A;  1LJ9 A;  3SHF A;  5LLQ A;  2MA3 A;  1K78 B;  3J81 Z;  5FGM A;  2GXG A;  3C3W A;  5E8I A;  4EMS A;  1T2K A;  3R6S A;  2ETH A;  2EFN A;  2F5E A;  3FMQ A;  4CO8 A;  2XV4 S;  2DU9 A;  2VBY A;  3D5L A;  2GA2 A;  3R4K A;  3IHU A;  1IN7 A;  1KQ8 A;  1IAW A;  4ZYG A;  1XSX A;  1YIO A;  3GZ5 A;  1U5T A;  3K1P A;  5JI6 A;  4L18 B;  2ZCW A;  1DPR A;  1L0O C;  4P5O A;  4M71 A;  5E17 F;  4Q48 A;  1EH8 A;  3F72 A;  4UV8 A;  3J80 K;  2IPQ X;  2QUF A;  1OYI A;  2F5C A;  3T8T A;  2Z99 A;  3BOQ A;  5EEH A;  3U2R A;  3WG9 A;  4KFC A;  2YR2 A;  1Z9C A;  1OYY A;  5ICC A;  2QEN A;  2YU3 A;  5LBQ A;  2DI3 A;  2IA0 A;  1KA8 A;  4ZYD A;  3WTW C;  1R7J A;  3TO6 A;  3AAF A;  2HZT A;  4Z2Y A;  2V1X A;  2GWR A;  2Q8K A;  1SD7 A;  1Z7U A;  4MHG A;  3WU1 B;  3ECH A;  3P9K A;  1W7P D;  2FSW A;  3HYI A;  2Z3Y A;  3K0L A;  4A6D A;  2H6B A;  2ISY A;  1FT9 A;  1F4K A;  2H94 A;  2IVM A;  1ZH5 A;  1AWC A;  5ICE A;  4IF4 A;  1H9T A;  3BY6 A;  3DEU A;  3S2W A;  3QRF F;  2P5V A;  1L3L A;  2DO7 A;  2HKX A;  3VOD A;  1MKM A;  4NB5 A;  4MQ9 F;  2KJB A;  3QPH A;  2Y48 A;  3IWF A;  3R0J A;  2VN2 A;  3E5X A;  1TLH B;  4Y13 A;  3V7S A;  4N0B A;  4KN7 X;  3FF5 A;  2K86 A;  5TJJ A;  2DQR A;  1SD5 A;  2ZME B;  1IN5 A;  4UXN A;  1JXS A;  4JK1 X;  3FXQ A;  3ISP A;  1G3Y A;  4WCG A;  1O3S A;  3JW4 A;  1MJ9 A;  2A6H F;  3DFG A;  5D4S A;  4Q4Z F;  4ZH4 F;  2D45 A;  5J6X A;  2M45 A;  2Z5U A;  2BEO A;  3LA7 A;  3IC7 A;  5CVJ A;  3NQO A;  2PMU A;  4KIG A;  3LQR A;  2O03 A;  4LB5 A;  4RB2 C;  2DFI A;  5D4R A;  4Y15 A;  1R1U A;  4RGX A;  2PG4 A;  2PFB A;  4OIP F;  4CZZ A;  3V4G A;  4GCV A;  2ZNZ A;  1XGO A;  4E70 A;  2HKO A;  3MEX A;  4I0A A;  2IRF G;  1J75 A;  5K5Q A;  2J5P A;  2QLZ A;  1ZG1 A;  5LHI A;  1KU7 A;  1XMK A;  1U5T B;  1B59 A;  2XAQ A;  4G6Q A;  4KIB A;  1O7L A;  4HF1 A;  2KIU A;  3DPT A;  1FPQ A;  2P7C B;  5E1W A;  1KYZ A;  5LHG A;  4FT8 A;  1WI9 A;  3RYR A;  1J0R A;  1MGT A;  2LSO A;  5ICF A;  1UCR A;  4N9H A;  1TQP A;  5HS9 A;  5L3G A;  2MH9 A;  3E5Q A;  4ENN A;  1H9G A;  3MCZ A;  1LQ1 A;  2FMY A;  2QYO A;  3RPU A;  1SMY F;  1SD4 A;  4KMU X;  1FNN A;  1PP8 F;  1HXD A;  2K7L A;  1FYM A;  3TOB A;  3GLX A;  4A0Z A;  3F6V A;  4KIF A;  3H3Z A;  3E3V A;  3KE2 A;  5IT9 Z;  1HBX G;  1FWZ A;  2HEO A;  3WE3 A;  2JZY A;  1YO5 C;  3Q5F A;  3I0T A;  2V9V A;  2LDU A;  2MLG A;  2HFH A;  3T8R A;  4G6D A;  1HKQ A;  2W25 A;  3P9I A;  2CG4 A;  2XAG A;  5CVV A;  5HOO A;  1QQI A;  1FP1 D;  1ZYR F;  2ZO4 A;  4EJO A;  2YX7 A;  4KDP A;  1IN4 A;  3M9A A;  4G94 A;  4EM1 A;  5L3F A;  3Q9S A;  2J5O A;  4MEY F;  2VC0 A;  4EJT A;  2DAO A;  3V7C A;  1U6G A;  4S04 A;  2RC4 A;  3CDH A;  1HW1 A;  4B09 A;  3LQQ A;  3SQN A;  4KA4 A;  2DK5 A;  2CYY A;  1T6S A;  1J2X A;  2YSR A;  4M9Z A;  2OQR A;  1B4A A;  2BV6 A;  4I2O A;  2VON A;  3KZZ A;  3WTX C;  3C18 A;  5H20 A;  2QQ9 A;  3F8M A;  3TDU C;  1I27 A;  2EFP A;  5EEG A;  5ILV A;  3KET A;  4WXC A;  4H0E A;  1O57 A;  3ZMV A;  1BIB A;  4HDV A;  1G4D A;  2HYG D;  4HV5 A;  2OBP A;  4A0X A;  2EV5 A;  2JSC A;  3DQV C;  2ZFW A;  4L9V A;  2FA5 A;  2MC3 A;  3DXJ F;  3HRM A;  4HQE A;  2H09 A;  2GA1 A;  5HVQ C;  4BHP A;  2COM A;  2QQB A;  4IRH A;  3SZT A;  2KRF A;  1LB2 A;  2A6E F;  4YG2 F;  2FXA A;  4L9J A;  3H92 A;  3BRO A;  2O3F A;  3COA C;  5F6F A;  3C1D A;  1S6L A;  3GZ6 A;  3FX3 A;  1TQI A;  1UFM A;  1Z1D A;  1V4R A;  3FM5 A;  4PGG A;  2W84 A;  1D8J A;  3R0A A;  1S29 A;  1HW5 A;  1TNT A;  4MTE A;  3MAJ A;  4G7H F;  4M74 A;  1ZRC A;  1HW2 A;  1LNW A;  3EQL F;  4L0Y B;  2B0L A;  4OIO F;  3WTZ A;  4IRG A;  3WTY C;  3R60 A;  3LA2 A;  4EM2 A;  2HOE A;  4MNU A;  1RIO H;  1P4X A;  3EYI A;  2A68 F;  1W5S A;  4Y17 A;  3FMR A;  3KP6 A;  4MGR A;  4RB3 C;  1XDS A;  3K2Z A;  5FLX Z;  3CUQ A;  3LAJ A;  1ZG5 A;  3CLO A;  3N97 A;  2PBI A;  4XRF A;  4R79 A;  4HW0 A;  1Q1H A;  2NYX A;  2IT0 A;  1XCB A;  4LG0 B;  3ELK A;  5L3C A;  1G3S A;  3I58 A;  1BJA A;  3GF2 A;  2D1H A;  5TRD A;  3LWF A;  2F5F A;  4RAY A;  5DYM A;  1YW7 A;  1IUY A;  2V79 A;  3QP6 A;  1BI3 A;  2LKP A;  2W24 A;  2VOD A;  1BM9 A;  3SXY A;  1WWX A;  4LK1 F;  1FLI A;  3O3K A;  5AIQ A;  5D5X B;  1KQ9 A;  5K5R A;  2RNJ A;  4L9N A;  4AIH A;  2IJL A;  3HHG A;  4KIC A;  5DCF A;  2QVO A;  5HLH A;  3WE2 A;  3M8F A;  2V1U A;  2RQP A;  3T1B A;  3W6K B;  2VXZ A;  4ESF A;  2PEX A;  2QBY B;  4BAY A;  1B9M A;  3F22 A;  1RUO A;  4EV0 A;  3GXO A;  2P5L C;  1QGP A;  3GVA A;  2GIV A;  1LDJ A;  1GVJ A;  4K2E A;  3HSE A;  3ZMD A;  1P92 A;  2NNN A;  1K6O A;  2VBZ A;  3ZMU A;  3JAM K;  5DCM B;  3LST A;  4LGW A;  1QZZ A;  4A6E A;  4KNY A;  3EET A;  1TTY A;  2FNP A;  2EB7 A;  2M5W A;  1YW8 A;  2X0L A;  2XKO A;  3IKV A;  5ICG A;  3MZY A;  4M72 A;  2OZ6 A;  1EH7 A;  1KU9 A;  3F8N A;  2RDP A;  1Y0U A;  4O3M A;  2MH2 A;  5BS6 A;  2ADU A;  1YG2 A;  2RV8 A;  1IW7 F;  4LMY A;  2XRN A;  1S8N A;  3RKW A;  4G9Y A;  4PDK A;  1WRJ A;  2WWY A;  1X3U A;  4LLG F;  3HTU A;  2ZJ2 A;  4U7D A;  3F6O A;  2FNA A;  1KQ0 A;  2RVC A;  3DPL C;  2BYV E;  5IT3 A;  3SZP A;  4OOI A;  5L3E A;  1U2W A;  1R5H A;  1XN7 A;  1FYL A;  2HQN A;  3F23 A;  5LRR A;  1LEA A;  1E17 A;  2UZK A;  4IJA A;  2QZ8 A;  1IN8 A;  3QP5 A;  3F8C A;  5AIP A;  5AON A;  3RDI A;  2L54 A;  1LDK B;  4IVN A;  3P9C A;  1REP C;  4UVC A;  3CUQ B;  3D0S A;  4CDG A;  2FBI A;  3ZN1 A;  3BJ6 A;  1SD6 A;  3L7W A;  4RB1 A;  1KU3 A;  3RJP A;  1RNL A;  2M30 A;  1FYK A;  4NHJ A;  4BYY A;  3GFJ A;  5HDK A;  3ZMZ A;  1H0M A;  2MD5 A;  3HOS A;  5CLS A;  1ZRD A;  2L4A A;  5H6R A;  5FD6 A;  5J8F A;  4R8H A;  1STZ A;  5BPI A;  1DP7 P;  1P4W A;  4CGZ A;  2P4W A;  2FBK A;  1FSE A;  2F2E A;  5KVR A;  4EJV A;  4I01 A;  3KLN A;  1UHM A;  3ZMS A;  3QU3 A;  4BHB A;  3LFK A;  4FX4 A;  4R1H A;  5HLG A;  4KUM A;  4M9X A;  3GUD A;  2DTR A;  5CVI A;  2L3D A;  5E20 A;  3ML6 A;  4I02 A;  4RGS A;  4G7Z F;  1W5T A;  2OD5 A;  4P55 A;  2R7D A;  3MFK A;  4B8X A;  1LVA A;  1AOY A;  2V6C A;  2CW0 F;  4HLY A;  5A2Q K;  3FWE A;  1D8K A;  2EFW A;  3BDD A;  3B02 A;  2L02 A;  5KK1 A;  1FY7 A;  5E8G A;  2ELH A;  2FE3 A;  5CVU A;  1R00 A;  1O3Q A;  4HA8 A;  2XAH A;  3ZQ7 A;  1A04 A;  3I64 A;  1IXC A;  4ETS A;  5DEQ A;  4O5V A;  2VT2 A;  4HYE A;  5E1X A;  3DP7 A;  1B6A A;  2VBW A;  1XMA A;  3ROU A;  1P2F A;  3T0Y A;  2O61 A;  2WTE A;  4GYI A;  3IWZ A;  1E2X A;  3BZ6 A;  2K27 A;  4HF2 A;  3HUG A;  2LNB A;  3T5X A;  1BI1 A;  3HHH A;  1IN6 A;  5D8L B;  5HS7 A;  3KP5 A;  3PQJ A;  4QWQ A;  2XIG A;  3K1N A;  2G9W A;  3KP4 A;  3N4M A;  1RZ4 A;  2LF8 A;  3E6D A;  2CGP A;  3I59 A;  1GXP A;  5BQT A;  3J7A O;  2E1N A;  2PLY A;  3HSF A;  4ZYH A;  1F9N A;  1YLF A;  4I09 A;  4Q47 A;  4A0Y A;  5E18 F;  2DQL A;  1K79 A;  2XAF A;  1DDN A;  5ED4 A;  2EFO A;  3M8E A;  4LFU A;  4BH9 A;  3JTG A;  3ERE D;  1WQ2 A;  3MQ0 A;  1PDN C;  2P7V B;  4RB0 A;  1FX7 A;  3GFL A;  2W85 A;  1HQC A;  4EM0 B;  2W57 A;  3HRS A;  4LG0 A;  4ON0 A;  5L3D A;  3FHZ A;  1ZHF A;  1B9N A;  1IF1 A;  1WKM A;  2IA2 A;  1UST A;  4UVB A;  1TW2 A;  4A5N A;  1U3E M;  4UHT A;  2G7U A;  2E7W A;  4L9T A;  1MD0 A;  1QZY A;  3IL2 A;  3L00 A;  4YII A;  2FEZ A;  4O6J A;  4EJW A;  2NNY A;  3OOP A;  1O3T A;  2DPU A;  4LD5 A;  3K69 A;  2HTS A;  2AXL A;  4HX8 A;  4OIQ F;  4AIK A;  3FXR A;  1R36 A;  2HQR A;  1MDM B;  2K4B A;  1HKS A;  2O8X A;  3HTS B;  2PQ8 A;  1SMT A;  2BE5 F;  5FB2 A;  3KP2 A;  4ESJ A;  1QO0 D;  5CYV A;  2H27 A;  4ESB A;  2P6T A;  4EVI A;  3ZPL A;  1KGS A;  4OMZ A;  2QBY A;  1OMI A;  2D2W A;  4EGZ A;  3WGH A;  3CUQ C;  1BOA A;  3QAH A;  1J59 A;  1XD7 A;  3JTH A;  3VOE A;  4I7H A;  3L2C A;  1J9I A;  1USS A;  3F21 A;  1YTY A;  2EFQ A;  4YIF A;  4KYW A;  1O3R A;  5DCM A;  3MWM A;  4KN4 X;  3I71 A;  3K9T A;  3WTU C;  4KT5 C;  3KP7 A;  5D5V B;  3CJN A;  3FZV A;  1Z6R A;  3QPT A;  5IT9 K;  4WX9 A;  1JE8 A;  1UHW A;  1IXR C;  3E6C C;  4L5J A;  2EV6 A;  1FBQ A;  1Z91 A;  1J5Y A;  1ODD A;  2OA4 A;  1R1V A;  5FD5 A;  2Z9O A;  3LAP A;  3HRU A;  1XSD A;  2XKP A;  2FQ3 A;  2BBY A;  1K7A A;  5HS8 A;  1IZ1 A;  3F8B A;  5LHH A;  2D1V A;  3JAM Z;  3ZP5 A;  3F3X A;  5F64 A;  5FFX A;  3J80 Z;  1MJB A;  1B1B A;  3M1E A;  1OPC A;  1OKR A;  4RAZ A;  3RI4 A;  3I59 B;  3JSP A;  2RKH A;  2Q0O A;  2HGC A;  3P7N A;  4N9I A;  3W6J B;  3WTS C;  1EV7 A;  1U5T C;  1QPM A;  3GFI A;  3F8F A;  1BC7 C;  1TW3 A;  4YFN F;  1DUX C;  1JHH A;  4BQA A;  4YFK F;  3DKW A;  2FU4 A;  1F5T A;  2P8T A;  4AWX B;  3C7J A;  4U88 A;  4S05 A;  4LK0 F;  2BGC A;  2XAS A;  1ZN2 A;  2CWE A;  1RUN A;  1JHF A;  4LB6 B;  3IRQ A;  4HF0 A;  2DT5 A;  3EYY A;  5D5W B;  1BC8 C;  4IRI A;  5ILU A;  1ULY A;  1Z05 A;  5LEK A;  1D3Y A;  2O0Y A;  2P5K A;  2DW4 A;  4HBL A;  2XUB A;  3TOA A;  2FBH A;  4WWC A;  4HLX A;  2IP2 A;  6PAX A;  3CO6 C;  4PCQ A;  5K1Y A;  3FM3 A;  4LLN A;  2L01 A;  1QNT A;  3DV8 A;  3K1M A;  4M9S A;  1P6R A;  1BI0 A;  1T98 A;  5BOX A;  4AIJ A;  3R61 A;  1R22 A;  2OAZ A;  2VOO A;  1FZP B;  2JTV A;  1YQA A;  2Z33 A;  1T38 A;  1R23 A;  2MBF A;  3I5U A;  2ZXJ A;  1BI2 A;  2NS0 A;  4XSZ F;  1QBJ A;  3NRV A;  2CQK A;  2OQG A;  1LEB A;  3BPX A;  1FSH A;  2H6C A;  4L0Z B;  1XCV A;  4RGR A;  3IRR A;  1S7A A;  4A2U A;  3EUH A;  3GEZ A;  2IA1 A;  5J8C A;  4CXF A;  2F5D A;  4WF2 A;  4EQQ A;  4QLC U;  3RKY A;  2ZBK A;  3NEU A;  2WV0 A;  5BPD A;  2A5Y B;  3OV8 A;  2Q2E A;  1FC3 A;  3ZN0 A;  2HR3 A;  2EA4 A;  2UXX A;  1DPU A;  4HX4 A;  5ERI A;  1FBS A;  3TKY A;  1IRG A;  5A2Q Z;  1P4A A;  4HZF A;  3LA3 A; 
#chains in the Genus database with same CATH topology
 3GWZ A;  1YX5 A;  2W1O A;  3GME A;  2JA8 J;  1JJ8 C;  4ENJ A;  2NAZ A;  2IBD A;  1A6I A;  4RA2 A;  1XS9 A;  1N78 A;  5IY5 H;  1K4T A;  2VT3 A;  4IQ4 A;  2VIX A;  1BR2 A;  2K4J A;  3QOD A;  3CO7 C;  5BMZ A;  5FLX K;  2YX4 A;  2A69 F;  3EDP A;  4BHC A;  4AVP A;  2K40 A;  1ZGJ A;  2PMZ N;  2VC1 A;  4HDU A;  5LGN A;  2XRL A;  4RS8 A;  5D8K B;  2M87 A;  5IPA A;  2DMU A;  4HOB A;  1YS7 A;  1OYW A;  1V5F A;  3ULQ B;  4L5I A;  4PGH A;  1SFU A;  4IPA A;  1K61 A;  2JT1 A;  2R7F A;  1ON1 A;  5E79 C;  2DDA A;  5CQG A;  2MC4 A;  2MSY A;  2DLL A;  3KPH A;  1LE8 B;  2DPD A;  1LDD A;  3RZO J;  1XGM A;  3H5R A;  5DTD A;  2K5C A;  5DDG A;  2OUM A;  1ZLJ A;  2EK5 A;  4PJL A;  1TL8 A;  2KKO A;  2A5W A;  2DMP A;  4MEX F;  3BWG A;  2OCE A;  3WTT C;  3BTL A;  1NG7 A;  2EJR A;  5FFZ A;  3G2B A;  4DQ2 A;  3TW6 A;  3JRA A;  1CF7 A;  2OU2 A;  2MD0 A;  2KIM A;  3GX4 X;  2H8W A;  3C2H A;  5D5U B;  1V5G A;  3A2K A;  3V8K A;  2RN7 A;  4IOC F;  4BNC A;  4XOR A;  3J81 K;  2OZU A;  1WZ2 A;  1PP7 U;  1XGS A;  3H9J A;  4P96 A;  3KLO A;  2E34 A;  3JSO A;  3GYH X;  2GXB A;  3OYK A;  3U1K A;  5FKK A;  1KU2 A;  1EH6 A;  4UNO A;  5IP7 J;  3BCB A;  3K4C A;  5D6F A;  5K5O A;  3PM1 A;  5DD4 A;  1YW9 A;  1MMA A;  4XOP A;  3U9G A;  1ZGA A;  1U78 A;  3LSG A;  1ZAO A;  3KZY A;  1G6N A;  1PVE A;  1ETO A;  1R5I D;  3HRT A;  4D7M A;  2X51 A;  2HVR A;  1Y39 A;  3CCM I;  4M3D A;  1VQN I;  1WSU A;  4AC0 A;  1UB9 A;  1W36 C;  3IKT A;  2E2H J;  3I4N J;  1AA7 A;  2ISZ A;  3GTP J;  2LK2 A;  5K7H A;  1Q1V A;  2HOT A;  1I5Z A;  2PI0 A;  4FCY A;  4NQW A;  3J7Y J;  1ON2 A;  2CMP A;  3CLQ A;  3ZXS A;  1W36 D;  3PJR A;  1SFE A;  2ZC2 A;  2O6G E;  2VAS A;  2XF5 A;  1Z6T A;  4F7Z A;  4PJM A;  1E0E A;  2KPM A;  4CCJ A;  4U0V A;  5LRS A;  1W7P A;  4EJU A;  3K10 A;  1MDM A;  1TBX A;  3LSI A;  1KON A;  3S3N A;  4G8X A;  4I98 B;  5IP6 A;  3BR5 A;  3BPV A;  3BZK A;  2DTZ A;  2IW5 A;  2KJC A;  4BXX J;  5HDG A;  2NVY J;  1FP2 A;  3HSR A;  2HI3 A;  3TMO A;  1VTN C;  1Y8Q B;  3ECO A;  1ZR2 A;  3E97 A;  3QYE A;  3FMS A;  1WH7 A;  4JQF A;  3W2A A;  1I1S A;  3LSH A;  1RR8 C;  4CHU A;  3VFZ A;  2EIJ H;  2OF7 A;  2EWN A;  5L3B A;  4LLL A;  1I50 J;  3SFZ A;  2XGX A;  2HNH A;  4BJ6 C;  2OV7 A;  4BDZ A;  3BJA A;  1ZG3 A;  2Z16 A;  1LUJ B;  4LJZ F;  4ZDP A;  1SVO A;  2Y69 H;  3RIR A;  3ABM H;  1WJ5 A;  4B47 A;  3CMY A;  2ZJQ F;  2QWW A;  4MFE A;  2HTJ A;  1HDD C;  2R5Y B;  1WI3 A;  2VKH A;  4KIS A;  3A01 B;  2IEK A;  2F5V A;  4YEL A;  4YRV A;  2A3S A;  2RGV A;  4B3A A;  2A6T A;  5ILS A;  4ZYE A;  2X6X A;  4WK8 F;  3CDL A;  2FML A;  1TWF J;  2UWM A;  2A61 A;  1T39 A;  2ZNY A;  1HA8 A;  1GHC A;  3DCF A;  3A03 A;  1ZLK A;  3ASN H;  2XAJ A;  3CP8 A;  1A36 A;  2QA4 I;  1LFB A;  1X4O A;  4AUX A;  3GO5 A;  2DBB A;  1ZAR A;  1JI8 A;  1TWG J;  4D0P A;  1I39 A;  3KFW X;  4ENM A;  2KIF A;  4M3E A;  1IXS B;  4C2U A;  2Q2E B;  2X9D A;  1XGN A;  4A3M J;  4HQM A;  2QQA A;  2K9S A;  3K6G A;  3L1P A;  2OTL I;  3MKW B;  2V1N A;  2HVQ A;  3E5U A;  3Q9V A;  2STW A;  3CC7 I;  3BG3 A;  3BJO A;  5E3O A;  3DU6 A;  2FX0 A;  4ZZD A;  2HDW A;  2FF4 A;  4UUS A;  2TDX A;  3E6B A;  2V1D A;  4AD9 A;  1FOK A;  4EAT A;  5E3N A;  3OR2 C;  3QYB A;  1HOM A;  1YYV A;  3B73 A;  2CQN A;  1NHA A;  2K9Q A;  4FHT A;  1ZK8 A;  3U1D A;  5LGT A;  4ASN A;  1BBY A;  2R92 J;  4F55 A;  2VOP A;  4E7Z A;  4BDY A;  2JA5 J;  2MLK A;  4HNV A;  4CIC A;  2R7V A;  1IRZ A;  2GQQ A;  4LIV A;  2ID3 A;  3ABU A;  3DWL E;  3SEQ A;  2VE9 A;  1HSJ A;  3TO7 A;  1XSV A;  5LGU A;  1IRF A;  4HAM A;  3BR2 A;  3DTI A;  2LRE A;  4XRM A;  4BQQ A;  2W4S A;  3BQZ A;  1MBH A;  5FLV A;  4YIR X;  1TNS A;  2GZW A;  2XRO A;  4IHY A;  3S1M J;  2NRA C;  5M5W J;  2CFX A;  3CMM A;  1RI7 A;  4M6X A;  4BJT A;  2E7X A;  4XKC A;  2DA1 A;  1SAX A;  3RPQ A;  3E1S A;  4B1R A;  3QU6 A;  3KP3 A;  1EKE A;  2XHK A;  2HYF A;  4GYG A;  5DUK A;  4U0Y A;  5CVR A;  4A3C J;  1YS6 A;  3NAR A;  3K4K A;  4XBF A;  1XDU A;  3O6B B;  2WC2 A;  4KT6 A;  2BVM A;  2NS8 A;  3M8J A;  2PJP A;  3KEO A;  2ZFU A;  1T0F A;  4BY1 J;  4U0W A;  2R3S A;  3WU0 A;  5EYR A;  3G73 A;  4M73 A;  4JX4 A;  3TO9 A;  2DYR H;  5E3M A;  2BY3 A;  3G3Z A;  4OIN F;  4A5M A;  3HIF A;  1CF7 B;  4BXU A;  1TWH J;  2FRH A;  4XKB A;  5C44 J;  1X1C A;  2E1M B;  3NWS A;  2G7H A;  2JUC A;  4D7N A;  3B6A A;  1JT0 A;  2VE8 A;  2MGQ A;  1R58 A;  5HDN A;  3Q3S A;  2L9V A;  1TQM A;  1VQP I;  2M3A A;  4II3 A;  4P9U A;  3KEQ A;  2HDD A;  1R1T A;  1ACI A;  4YFX F;  3JRE A;  4XNF A;  3QPL A;  2EV0 A;  3V8J A;  2WY8 Q;  3IH2 A;  3WG7 H;  5FRN A;  1YJ9 I;  4H4K C;  3RKX A;  5HOD A;  2DJN A;  4UV9 A;  4E7K A;  2Y0S A;  2BHZ A;  3I53 A;  4DIQ A;  2O5R A;  3FK6 A;  1WFX A;  1TT0 A;  5HNF A;  2STT A;  1MBF A;  4GGG A;  3V8L A;  3ZCO A;  1O7F A;  1ZRE A;  1V3F A;  2CUE A;  3PFY A;  3ABK H;  5D6E A;  3WGG A;  5M3F J;  3M4O J;  1MZB A;  4CZC A;  5F1R A;  3M7G A;  1MJA A;  1X19 A;  3CCE I;  1T33 A;  4HST A;  3CCY A;  3FXU A;  4NQW B;  1X58 A;  2JRM A;  2M1B A;  2ZXH A;  2B9S A;  2DFE A;  2XVC A;  4MQV A;  3ZQG A;  2CQX A;  2Y9Z A;  3BR1 A;  1FOY A;  3TQN A;  4UUV A;  1W7P B;  2NVX J;  4XM3 A;  2GAU A;  2JPB A;  3CTA A;  4OU0 A;  3OYM A;  1YFH A;  1G3T A;  3PFI A;  5DUI A;  5B5E C;  2FOK A;  2Y2Z A;  1K78 A;  1YHQ I;  2QM3 A;  1TWA J;  1I6X A;  1QRY A;  2ACJ A;  3REO A;  3D5S C;  2DOA A;  4BKX A;  3ZMT A;  1V5E A;  2R7T A;  1BIA A;  2ZXW H;  3BQY A;  4B3X A;  5JVT A;  3GTG J;  3O8H A;  4WXH A;  2JWT A;  1HST A;  1QZE A;  3QYF A;  2WY7 Q;  4XLP F;  2ZJP F;  1KYW A;  5F0C A;  1SFK A;  2C6Y A;  3E6M A;  3BP8 A;  1GXQ A;  2ESN A;  3CJQ B;  1QHH D;  3WOD F;  4IHS A;  2PMH A;  4IO9 F;  1FBU A;  3OSG A;  1VI0 A;  4PFO A;  2XAU A;  2DMQ A;  3CP2 A;  2CSO A;  2ESH A;  1S7O A;  2L5Q A;  3ABT A;  3O2P E;  4M3G A;  3GW2 A;  2R7X A;  3H3U A;  4ANJ A;  4JBA A;  2X1D A;  2IGN A;  4PK4 A;  2WAD A;  5E1Z B;  1BN5 A;  4FET A;  3GTL J;  1PUE E;  2ZKZ A;  3DBH B;  2OJE D;  1U8R A;  3H9Q A;  2JRT A;  3VEP A;  1YIT I;  2HS5 A;  3VB2 A;  3TDZ C;  4CCN A;  3OSF A;  2EBI A;  4XLN F;  5C4X J;  3DF8 A;  2HWV A;  3BTC A;  1S3J A;  3OOU A;  2EA2 A;  1ONV A;  4U7B A;  1ZRF A;  1J7K A;  5KNL A;  3Q0V A;  4BU2 A;  2AS5 F;  2YS9 A;  1I1G A;  3GFM A;  1TP4 A;  4UUS B;  2LD5 A;  4JP0 A;  2NXN B;  3BG7 A;  2M9H A;  4E7L A;  5LFA A;  3WTV C;  1Y1W J;  1QVU A;  4M3F A;  5JHU A;  1MSF C;  5HLI A;  2P6S A;  3CUO A;  1UEL B;  1ETX A;  2CRG A;  4TV7 A;  4BS9 A;  3OS0 A;  5FO5 A;  2DK8 A;  1IV8 A;  2LF7 A;  2DOD A;  2E60 A;  1OQY A;  3RTR A;  1C0W A;  3MKL A;  4D5C A;  1A31 A;  4M6Y A;  2HDC A;  1W4M A;  3MZH A;  1YOV B;  2X4H A;  1JGS A;  3RYP A;  4GO1 A;  4ITV A;  5M3M J;  1Z3X A;  2FJ1 A;  2E1C A;  4HV6 A;  3OIO A;  4RGU A;  5DV5 A;  1OCR H;  4MTD A;  3BR6 A;  2XB0 X;  3L09 A;  2KIS A;  3SEZ A;  5B3S H;  3FKJ A;  5FLM J;  5JFR A;  4PUS A;  5LEJ A;  2D5V A;  2L9R A;  3I4P A;  4MO7 A;  4P9F A;  1T08 B;  3K4J A;  3EPZ A;  4CYD A;  3PQK A;  1LE8 A;  4OIR F;  4HRI A;  3BR0 A;  2Y75 A;  3HC7 A;  2UXN A;  2LRD A;  2KZG A;  2VKE A;  4IHT A;  3VPR A;  1MBG A;  5JR3 A;  2CO5 A;  1GDT A;  3FKI J;  2VB6 A;  3IAM 2;  3QOP A;  1HF0 A;  2L0K A;  4RM3 A;  4UVA A;  3ZR8 X;  2EIN H;  3EUH C;  1OR7 A;  3HKZ A;  5DD8 A;  4ENK A;  1D5V A;  3HOT A;  4OMY A;  1HC8 A;  4I0B A;  2JPC A;  3K7A J;  1PYV A;  5EZG A;  5J40 A;  4HX7 A;  4N4O B;  1R6R A;  1X4P A;  4XSX F;  4CCL A;  2VQL A;  2A07 F;  1YIJ I;  2CV0 A;  3V7R A;  2WA0 A;  2Y0M A;  4E7J A;  4EGY A;  3TP3 A;  4A3F J;  3VYU B;  4DNC A;  1F1Z A;  3K4L A;  3L9F A;  3S1Q J;  3DBR B;  4G7O F;  4KMF A;  3FBI B;  3K4M A;  4PZJ A;  4ZZL A;  1SFX A;  4IXA A;  4WXD A;  1MMG A;  3WGI A;  4FX0 A;  3VSL A;  2LVS A;  2L4M A;  2ZME A;  3HG9 A;  1G3W A;  3H5A A;  1HKT A;  1XB4 A;  1EJ9 A;  4Q5S F;  5H6Q A;  1R5G A;  2YPR A;  3TGN A;  3CCR I;  2W00 A;  1YJW I;  2TCT A;  1DP3 A;  2COB A;  4RMN A;  2K02 A;  1CGP A;  1IRX A;  2IGK A;  2PN6 A;  2M8E A;  4LIT A;  1W5C C;  4A12 A;  1VQ9 I;  4CSW A;  1UJ8 A;  3KCC A;  3I54 A;  2H1K A;  3IP4 B;  4GXO A;  5CJ9 A;  1MIJ A;  4RBO A;  1MSE C;  2E5Z A;  2VBX A;  1LJ9 A;  1Z0X A;  3SHF A;  5LLQ A;  5J3L A;  2MA3 A;  1K78 B;  2L7K A;  1X2M A;  2K9N A;  3GTQ J;  3J81 Z;  5FGM A;  3D5R C;  2GXG A;  3C3W A;  5E8I A;  4EMS A;  1P7J A;  2ECB A;  2KIQ A;  1U9N A;  1T2K A;  3R6S A;  2ETH A;  2VJ5 A;  2BW3 A;  3RSN A;  2EFN A;  2F4I A;  2F5E A;  3ZQL A;  2JVG A;  3FMQ A;  4CO8 A;  2XV4 S;  2DU9 A;  3PNY A;  2VBY A;  4BQO A;  3VYS B;  3D5L A;  5EF6 A;  2W82 A;  2GA2 A;  2R5Y A;  4UUT A;  1WVR A;  3R4K A;  3IHU A;  4XID A;  1IN7 A;  4KJZ A;  3OIQ A;  3H3V K;  2I10 A;  1Y8R B;  3BC8 A;  1K6Y A;  1KQ8 A;  1IAW A;  3HOZ J;  2B7E A;  2BXY A;  3A0B C;  1RRJ A;  4ZYG A;  1H88 C;  1QA6 A;  2QKM B;  1XSX A;  1YIO A;  2WV1 A;  3GZ5 A;  1U5T A;  3K1P A;  5JI6 A;  4L18 B;  1MMS A;  2ZCW A;  1DPR A;  1AKH A;  2LY1 A;  1L0O C;  4A3L J;  4AM3 A;  4P5O A;  2CUZ A;  2GBY A;  4M71 A;  4C2M J;  1BW6 A;  4AVZ A;  5E17 F;  1IDY A;  4Q48 A;  1VFC A;  1IV6 A;  1EH8 A;  3VWB A;  3F72 A;  5KAF C;  4B4C A;  2VJ4 A;  3DTE A;  4UV8 A;  2X85 A;  3FHN A;  3RQ4 A;  3J80 K;  5C4J J;  2IPQ X;  2X1C A;  1ZKG A;  4CYC A;  1IG7 A;  5J1U A;  5GPC A;  2QUF A;  3EUA A;  1OYI A;  2F5C A;  3T8T A;  2Z99 A;  3BOQ A;  5EEH A;  2WAQ A;  4BGD A;  3U2R A;  4E7I A;  3WG9 A;  2ME0 A;  4KFC A;  3HZJ A;  2YR2 A;  1Z9C A;  1OYY A;  5ICC A;  4MLO A;  2QEN A;  2YU3 A;  5LBQ A;  3AFH A;  3SFI A;  2DI3 A;  2IA0 A;  2I8D A;  2DA4 A;  1KA8 A;  3LSK A;  4ZYD A;  3WTW C;  3D1N I;  4AU7 A;  1R7J A;  3TO6 A;  3AAF A;  2HZT A;  3S1R J;  4Z2Y A;  2V1X A;  2GWR A;  2Q8K A;  1SD7 A;  1Z7U A;  2F4M B;  3CCL I;  1MBJ A;  4MHG A;  3WU1 B;  4JOM A;  1BR4 A;  3ECH A;  1FTZ A;  3BR3 A;  1OCP A;  1W7P D;  3P9K A;  4D5F A;  2DN0 A;  3S2D J;  2FSW A;  3HYI A;  2Z3Y A;  3K0L A;  1OCO H;  4A6D A;  3GTJ J;  4S0H B;  3W6V A;  1MH4 A;  2H6B A;  2ISY A;  1FT9 A;  1F4K A;  3BLY A;  3S3M A;  2H94 A;  2JA7 J;  3IH3 A;  4C2T A;  1VQ7 I;  2CS3 A;  2HQ5 A;  4QTR A;  2IVM A;  1ZH5 A;  5B1A H;  1P7I A;  1AWC A;  5ICE A;  1RKW A;  3WU2 C;  4NNJ A;  3CCU I;  2HVS A;  1U9O A;  3S16 J;  4B48 A;  4IF4 A;  1H9T A;  2WB1 A;  4RAF A;  2GOX B;  1VND A;  1FOX A;  3BY6 A;  4GDF A;  3DEU A;  3S2W A;  3QRF F;  2P5V A;  1L3L A;  2DO7 A;  3E7L A;  1LFP A;  2HKX A;  2JQ7 A;  1UG2 A;  3VOD A;  1JT6 A;  2JK3 A;  1HCR A;  1MKM A;  2ZB9 A;  4NB5 A;  1VQ6 I;  1D1C A;  2QSF X;  4MQ9 F;  2KJB A;  3QPH A;  3KEY A;  1BOB A;  3OYI A;  2Y48 A;  3IWF A;  3CD6 I;  3R0J A;  1VQL I;  4GFB A;  2VN2 A;  1NK2 P;  5DM6 F;  3E5X A;  1TLH B;  3TL4 X;  1YRN A;  4QPQ A;  4IKF A;  1W1W E;  1S5L C;  3H35 A;  4DOZ A;  3V7S A;  4Y13 A;  4N0B A;  3LL7 A;  4KN7 X;  3FF5 A;  4UB6 C;  2K86 A;  3KYD B;  5TJJ A;  1UZC A;  2DQR A;  5J4V A;  1SD5 A;  2ZME B;  4DW6 A;  2KT0 A;  1IN5 A;  3AL0 B;  4UXN A;  1JXS A;  4JK1 X;  3FXQ A;  3ISP A;  4PSX A;  1G3Y A;  2EIK H;  1BA5 A;  1ZTR A;  3GCM A;  4WCG A;  1O3S A;  4X1E A;  2L7F P;  1OFC X;  3JW4 A;  1VQM I;  4CCO A;  1FIP A;  1MJ9 A;  2A6H F;  1IO2 A;  3DFG A;  5D4S A;  3SZG A;  2KFD A;  3QOE A;  4Q4Z F;  4ZH4 F;  3OS1 A;  2RQQ A;  2D45 A;  1U0J A;  4LG3 A;  4YEJ A;  2M45 A;  2CU7 A;  2Z5U A;  5J6X A;  4IOA F;  2BEO A;  4XN0 A;  3LA7 A;  5JVG F;  5F0H A;  1Z21 A;  3IC7 A;  3G6E I;  2N8G A;  5CVJ A;  3NQO A;  3PIP F;  2TRT A;  5HNH A;  2E19 A;  1DU6 A;  2PMU A;  2F4O B;  3H1C A;  3Q0U A;  4KIG A;  3LQR A;  4QPO A;  2O03 A;  4X0G A;  4RB2 C;  2DFI A;  4LB5 A;  3G4S I;  4PFP A;  2KHM A;  5D4R A;  4Y15 A;  2BW3 B;  1R1U A;  4RGX A;  1NTC A;  2PG4 A;  3X2Q H;  2PFB A;  4OIP F;  4CZZ A;  3V4G A;  2IS6 A;  4GCV A;  1T0F C;  1D1B A;  2ZNZ A;  4CUG A;  1IGN A;  1XGO A;  4E70 A;  2DMN A;  4XN3 A;  2HKO A;  3MEX A;  4I0A A;  4FAS D;  2IRF G;  2M34 A;  3GTO J;  4HSR A;  5FKM A;  5GTH C;  1J75 A;  5K5Q A;  2R4G A;  2J5P A;  2QLZ A;  1ZG1 A;  5LHI A;  1KU7 A;  1XMK A;  4M3B A;  2MAB A;  1U5T B;  1X1B A;  5B1B H;  2NVQ J;  1XG1 A;  2VXD A;  1B59 A;  2XAQ A;  4G6Q A;  4KIB A;  2BY0 A;  4C9Y A;  1O7L A;  1AKH B;  3JRI A;  3H0D A;  3QWL A;  2XSJ C;  4HF1 A;  2KDO A;  2KIU A;  3KIO A;  3CCJ I;  2LMD A;  3LSJ A;  4MIM A;  3DPT A;  1FPQ A;  2P7C B;  2HQA A;  4DZJ A;  2GXA A;  1WGX A;  5E1W A;  1B72 B;  2XPW A;  3HOW J;  1RC9 A;  1KYZ A;  4CYC B;  5LHG A;  4FT8 A;  1QU3 A;  1WI9 A;  3RYR A;  2V4J C;  1J0R A;  1MGT A;  1YX3 A;  2LSO A;  5ICF A;  2EPF A;  1ITY A;  4U87 A;  1UCR A;  2CUJ A;  2E5N A;  2Y9Y A;  2H1L A;  3I3L A;  4LIU A;  4N9H A;  1TQP A;  1I6H J;  5HS9 A;  3UNG C;  3FXO A;  3NAU A;  4XKW A;  5L3G A;  3FK7 A;  2MH9 A;  3E5Q A;  3ESW B;  3HKZ N;  4ENN A;  1H9G A;  3BZC A;  3MCZ A;  4A3B J;  2X6Y A;  1LQ1 A;  2LC2 A;  2K3F A;  2FMY A;  5LD2 C;  2QYO A;  3RPU A;  1SC7 A;  1SMY F;  3A1Y A;  1SD4 A;  3CC2 I;  4KMU X;  1JUS A;  1FNN A;  3HOY J;  5J4Y A;  1PP8 F;  1Z3Y A;  1HXD A;  2LLK A;  3OYN A;  2K7L A;  1FYM A;  3TOB A;  3GLX A;  4A0Z A;  3F6V A;  4A3I J;  4F93 B;  4KIF A;  1FMW A;  2CFO A;  1H89 C;  2ID6 A;  1GLN A;  2P81 A;  3H3Z A;  3E3V A;  3KE2 A;  5IT9 Z;  2ZJR F;  1HBX G;  1FWZ A;  2HEO A;  3WE3 A;  2NVT J;  4XLA A;  3PL8 A;  1W0T A;  2JZY A;  1YO5 C;  4Y4R A;  1Z7L A;  3Q5F A;  3I0T A;  3JCU C;  4DYQ A;  4HNT A;  2V9V A;  1WHU A;  4FIS A;  3FIS A;  2LDU A;  3LSM A;  2H8R A;  2MLG A;  1D0Y A;  3TW7 A;  2ECC A;  3V42 A;  2HFH A;  3T8R A;  4G6D A;  1FIA A;  1HKQ A;  2R7Q A;  2W25 A;  3P9I A;  3OYD A;  3MKZ A;  2CG4 A;  2XAG A;  5CVV A;  1QQI A;  1FP1 D;  1ZYR F;  2ZO4 A;  5F08 A;  4EJO A;  2YX7 A;  5HOO A;  4KDP A;  3G71 I;  1IN4 A;  4P1W A;  4E7H A;  4PSW A;  3M9A A;  4G94 A;  1T8I A;  4DGW B;  4EM1 A;  5L3F A;  3Q9S A;  2VQH A;  4JX5 A;  1YRN B;  3W2V A;  2CV2 A;  4DYR A;  2J5O A;  2LY2 A;  2GM4 A;  4MEY F;  3DTK A;  2VC0 A;  4EJT A;  2DAO A;  3V7C A;  1U6G A;  4S04 A;  2XPU A;  4AID A;  1JKP C;  2RC4 A;  1J09 A;  2YUS A;  1QHG A;  3CDH A;  1HW1 A;  4B09 A;  3M07 A;  3LQQ A;  4F92 B;  3SQN A;  4KA4 A;  2DK5 A;  1FTT A;  4Y3O A;  2VI6 A;  1T6S A;  2CYY A;  1J2X A;  2FOW A;  4B44 A;  2YSR A;  4M9Z A;  1VQ8 I;  3CF2 A;  2OQR A;  1B4A A;  2DFF A;  2RRE A;  2IS2 A;  2BV6 A;  5HLT A;  4I2O A;  2R0Q C;  4RAG A;  2VON A;  2OTJ I;  3KZZ A;  4Z6Y A;  4V19 K;  3WTX C;  3C18 A;  3P5J A;  5H20 A;  2QQ9 A;  3F8M A;  2VJJ A;  3MVP A;  3TDU C;  1I27 A;  4E7S A;  2QSG X;  1QVT A;  2EFP A;  5EEG A;  5EG0 A;  3AG2 H;  5IOY A;  3N05 A;  1F43 A;  5ILV A;  3KET A;  1Y0N A;  4XIC A;  3OYB A;  4WXC A;  2L2O A;  4H0E A;  1X1P A;  1A6Q A;  2Q1Z B;  2R7O A;  5EJC A;  4IHV A;  1XTA A;  5EEA A;  1ETK A;  3FIW A;  1BW5 A;  1O57 A;  3H36 A;  3ZMV A;  1BIB A;  4F91 B;  4HDV A;  1G4D A;  2HYG D;  4EEF G;  4I99 C;  4BAC A;  4HV5 A;  3OS2 A;  4Y7N J;  2OBP A;  3JRG A;  2EH3 A;  4A0X A;  2E35 A;  2EV5 A;  4XON A;  2JSC A;  3TED A;  4BBS J;  2NOJ B;  4DBQ A;  3DQV C;  1OR7 C;  3W3C A;  2ZFW A;  4L9V A;  5FKN A;  2FA5 A;  2MC3 A;  3DXJ F;  2QEX I;  3HRM A;  2DA3 A;  1F36 A;  3HL2 A;  5GAE J;  2KP6 A;  3L2U A;  5CKT A;  2K85 A;  4HQE A;  2H09 A;  2GA1 A;  3OYH A;  2JUG A;  5HVQ C;  1ZR4 A;  4BHP A;  4NBQ A;  3BG9 A;  3FXM A;  4W97 A;  4ZTJ A;  3PNT A;  3CMA I;  2COM A;  2QQB A;  4IRH A;  3SZT A;  4XRS A;  1MNE A;  1XPX A;  2KRF A;  5J47 A;  1LB2 A;  2A6E F;  3GLL A;  2ICW G;  4YG2 F;  2FXA A;  5K7Z A;  4L9J A;  1IC8 A;  3H92 A;  3BRO A;  1MW7 A;  4C3J J;  2LTP A;  2O3F A;  3COA C;  5F6F A;  3C1D A;  1S6L A;  3GZ6 A;  3FX3 A;  1TQI A;  3HDD A;  1GT0 C;  1UFM A;  1Z1D A;  1V4R A;  3FM5 A;  3H0G J;  4PGG A;  2W84 A;  4II2 A;  1JUP A;  1D8J A;  5F0F A;  3R0A A;  1S29 A;  4XRS G;  1HW5 A;  1TNT A;  2AQF A;  2DA7 A;  4MTE A;  1ENH A;  3MAJ A;  4G7H F;  1V54 H;  4M74 A;  4MFD A;  1ZRC A;  1TWC J;  1JKO C;  2XF6 A;  1HW2 A;  1LNW A;  4XOT A;  2IGM A;  3EQL F;  2V6E A;  4L0Y B;  4XK4 A;  2B0L A;  2IAI A;  1WJE A;  4A69 C;  4OIO F;  3VSK A;  3WTZ A;  3DU5 A;  4IRG A;  4XQF A;  3WTY C;  3R60 A;  3LA2 A;  4EM2 A;  2HOE A;  4MNU A;  1RIO H;  4CCK A;  1P4X A;  3EYI A;  2A68 F;  3S8P A;  1W5S A;  3ZQQ A;  4Y17 A;  4BEH A;  3FMR A;  4XR6 A;  3S14 J;  2BHY A;  2Y31 A;  3DLA A;  4G6T B;  3KP6 A;  1X1D A;  2E2J J;  4BY7 J;  1R4M B;  4MGR A;  4RB3 C;  1XDS A;  1T56 A;  3K2Z A;  3DLL F;  1TC3 C;  3M3Y J;  4E4H A;  3RKQ A;  3PSF A;  3S93 A;  1NG6 A;  5FLX Z;  1Z67 A;  3CUQ A;  3A0H C;  3LAJ A;  3HOX J;  2FUG 2;  1ZG5 A;  3JRC A;  1ZEL A;  2E36 A;  3UKG A;  2DA2 A;  2DXI A;  3CLO A;  4FE4 A;  3N97 A;  2XC7 A;  1T95 A;  2DYS H;  2PBI A;  4NC8 A;  3S3O A;  5K7F A;  2XSD C;  1D5Y A;  2IS1 A;  4XRF A;  2PX9 A;  3OYL A;  4R79 A;  4PJJ A;  4HW0 A;  1Q1H A;  2NYX A;  2RNG A;  2NVU B;  2IT0 A;  1XCB A;  3G1O A;  4LG0 B;  2FD5 A;  3ELK A;  2GIZ A;  3G1M A;  5L3C A;  1G3S A;  3I58 A;  1YJN I;  1BJA A;  3GF2 A;  2D1H A;  1LFU P;  4I6Z A;  3MKY B;  5TRD A;  3LWF A;  2F5F A;  4RAY A;  5DYM A;  3K2A A;  1YW7 A;  2LH9 A;  2AXT C;  2HXI A;  1IUY A;  2JVH A;  4BE0 A;  2V79 A;  3QP6 A;  2M4K A;  1BI3 A;  2LKP A;  3WHC A;  2W24 A;  3CZ6 A;  3HGY A;  1GUU A;  2VOD A;  1PJR A;  1BM9 A;  3SXY A;  3IH4 A;  3VYR B;  2L7M P;  2I5U A;  3DBL B;  1WWX A;  3JRD A;  1K4S A;  1EF4 A;  4LK1 F;  1WJB A;  1FLI A;  1ETW A;  3O3K A;  5EG0 B;  5AIQ A;  2ME6 A;  3VYT B;  1WJD A;  5D5X B;  1SAU A;  1KQ9 A;  5K5R A;  2IS4 A;  2RNJ A;  4L9N A;  1LKX A;  2DDB A;  4AIH A;  2IJL A;  2LY9 A;  4RLQ A;  3JRF A;  3HHG A;  3Q0W A;  2LP0 A;  2HYJ A;  4KIC A;  5DCF A;  2QVO A;  5HLH A;  5B66 C;  1MBE A;  2BY2 A;  2F48 A;  2KDZ A;  4LOC A;  1FJL A;  2CW7 A;  2E1O A;  3PIO F;  3CCS I;  4IEJ A;  3WE2 A;  4OAY A;  2CV1 A;  3TP0 A;  3I56 I;  4I76 A;  3M8F A;  2V1U A;  2OPT A;  2RQP A;  3T1B A;  3W6K B;  2VXZ A;  2DT7 B;  2E1M C;  4UB8 C;  4ESF A;  2PEX A;  2QBY B;  4RM2 A;  2VQG A;  4BAY A;  3MN2 A;  1B9M A;  3F22 A;  1RUO A;  1POG A;  4GRI A;  4EV0 A;  1R49 A;  2IXS A;  3GXO A;  2P5L C;  3OY9 A;  2V7F A;  1QGP A;  3H9G A;  3GVA A;  2GIV A;  1LDJ A;  4BL0 B;  3GBG A;  1GVJ A;  3K70 C;  4K2E A;  3HSE A;  3ZMD A;  1P92 A;  2JJ7 A;  1DGW Y;  2NNN A;  1K6O A;  1NK3 P;  2VBZ A;  3ZMU A;  1ERD A;  3JAM K;  1B72 A;  5DCM B;  3HEF A;  3LST A;  1OJL A;  4LGW A;  1QZZ A;  4HG2 A;  3K70 D;  4A6E A;  1NH3 A;  4KNY A;  4X6A J;  3IAS 2;  1FEX A;  1FOW A;  4RLF A;  3EET A;  1TTY A;  2FNP A;  2FQ4 A;  1RKT A;  2A05 A;  2EB7 A;  2M5W A;  1YW8 A;  2W7N A;  2X0L A;  2AQE A;  3PNV A;  2XKO A;  2HPI A;  3IKV A;  3MZY A;  4M72 A;  3SYT A;  5ICG A;  2OZ6 A;  1EH7 A;  1KU9 A;  3F8N A;  2RDP A;  1YI2 I;  3CCV I;  1Y0U A;  4O3M A;  3CCQ I;  4Y52 J;  2MH2 A;  1BL0 A;  5BS6 A;  2JMW A;  2ADU A;  1YG2 A;  2LKS A;  2RV8 A;  1IW7 F;  4LMY A;  2XRN A;  1S8N A;  4BE2 A;  3RKW A;  3S32 A;  2VPR A;  1ETY A;  4G9Y A;  4PDK A;  1JUM A;  2EZL A;  1WRJ A;  2LFB A;  1SFO J;  1WH5 A;  2WWY A;  4G12 A;  1X3U A;  2DA6 A;  2P0W A;  2Y0S N;  3KYC B;  3OIP A;  4LLG F;  2XGE A;  3HTU A;  1MND A;  2ZJ2 A;  4U7D A;  2K3P A;  4BJ5 C;  3AG3 H;  3F6O A;  2FNA A;  3F0C A;  2QGU A;  4IHX A;  1KQ0 A;  2RVC A;  3DPL C;  3OWT A;  2BYV E;  4JX6 A;  3OYA A;  5KAI C;  5IT3 A;  3SZP A;  1HDP A;  3OR1 C;  4OOI A;  5L3E A;  4F52 A;  1U2W A;  1D0X A;  1GV2 A;  1R5H A;  1XN7 A;  2X1E A;  1FYL A;  2HQN A;  5LRR A;  3F23 A;  3ONQ A;  1LEA A;  1ZQ3 P;  5EZH A;  1E17 A;  1DGR M;  2UZK A;  4BEH B;  1I3A A;  4XLF A;  2KRC A;  4IJA A;  1APL C;  2QZ8 A;  1IN8 A;  3QP5 A;  2CW8 A;  3F8C A;  5AIP A;  1PUF A;  5AON A;  3RDI A;  2L54 A;  1LDK B;  4HNU A;  4IVN A;  4C3H J;  4XLH A;  3P9C A;  3U21 A;  4BQN A;  1REP C;  4UVC A;  3CUQ B;  3D0S A;  4XMY A;  4CDG A;  1JTX A;  3FDY A;  2QQ8 A;  2FBI A;  1N77 A;  3ZN1 A;  3BJ6 A;  1SD6 A;  3L7W A;  3SDG A;  4RB1 A;  2XF7 A;  3OL4 A;  1KU3 A;  3RJP A;  1RNL A;  2M30 A;  1P9Q C;  2R5Z A;  4BBR J;  1FYK A;  2BXZ A;  2LR8 A;  4NHJ A;  5CQE A;  4BYY A;  3GFJ A;  5HDK A;  3ZMZ A;  1H0M A;  2MD5 A;  3HOS A;  5CPR B;  3L2Q A;  2DOF A;  5CLS A;  2L4A A;  1ZRD A;  4A3G J;  5H6R A;  2E2I J;  5FD6 A;  5J8F A;  3MZ8 A;  2F6C A;  5E3L A;  2EQR A;  2JA2 A;  3I9V 2;  4R8H A;  4A3D J;  1D1A A;  1ORK A;  1XX5 A;  1O4X A;  1STZ A;  4OAZ A;  5BPI A;  1DP7 P;  1P4W A;  4CGZ A;  2P4W A;  2VLA A;  2FBK A;  2Y30 A;  1FSE A;  2BVL A;  1D0Z A;  2F2E A;  2MFZ A;  5KVR A;  1VZ0 A;  2NOG A;  2KZV A;  4EJV A;  3JR9 A;  4I01 A;  1FMV A;  3KLN A;  1UHM A;  1MMD A;  3ZMS A;  3QU3 A;  4BHB A;  3RPU D;  3CDI A;  2OCC H;  3LFK A;  4ZTF A;  4V2F A;  4FX4 A;  4AYB A;  4R1H A;  3S1N J;  5HLG A;  4KUM A;  4M9X A;  2XGD A;  3HPG A;  2CQ7 A;  4BUP A;  1MH3 A;  2EZK A;  3GUD A;  2DTR A;  3A02 A;  3HPH A;  1TT5 B;  5KCM A;  1SAN A;  4FTH A;  5CVI A;  2L3D A;  5E20 A;  4CCM A;  3ML6 A;  2IGO A;  5DS9 A;  2EZI A;  3LSP A;  4I02 A;  4RGS A;  4G7Z F;  1W5T A;  2DFH A;  3OYE A;  1U8B A;  2OD5 A;  4P55 A;  2R7D A;  3MFK A;  1BJZ A;  4B8X A;  1LVA A;  3HM5 A;  3ZQH A;  2X6O A;  1VQ5 I;  1A5J A;  2V6C A;  1AOY A;  2LYC A;  2CW0 F;  4HLY A;  3FXK A;  5A2Q K;  1RPW A;  1UMQ A;  2L9N A;  3FWE A;  3PUB A;  4PJN A;  2DMT A;  1WJC A;  1E3H A;  2R7W A;  1D8K A;  2EFW A;  2W48 A;  3BDD A;  3B02 A;  2L02 A;  5KK1 A;  1FY7 A;  5E8G A;  2ELH A;  4ZJZ A;  1SVL A;  5FJ8 J;  3I4M J;  3QPS A;  2FE3 A;  5CVU A;  2R7R A;  1R00 A;  1O3Q A;  2BY1 A;  3ZOB A;  4C3I J;  4N4N B;  4HA8 A;  2XAH A;  3ZQ7 A;  3SDB A;  2O8K A;  1A04 A;  1JTY A;  2DA5 A;  4UY8 I;  2VL8 A;  3I64 A;  1SEU A;  1UHS A;  3L2R A;  4E6K G;  2BOL A;  1IXC A;  3MD2 A;  4QSH A;  2ELJ A;  4ETS A;  5DEQ A;  4M6V A;  2V9K A;  4O5V A;  2JA6 J;  2VT2 A;  4HYE A;  5E1X A;  3J7A Y;  1RR7 A;  1LPQ A;  3AG4 H;  3BTI A;  3DP7 A;  4ZC3 A;  1N75 A;  1B6A A;  2DCE A;  4IQJ A;  2VBW A;  1TZL A;  2KLO A;  1V55 H;  1XMA A;  3J7Z I;  2KRH A;  5FRO A;  3ROU A;  3S2H J;  4IZZ A;  1P2F A;  3T0Y A;  2MG4 A;  2WBM A;  2O61 A;  2WTE A;  4KIT B;  3LSR A;  1OLT A;  1B8I B;  5J1Y A;  2PJR A;  1EA3 A;  2VKD A;  2LOO A;  1S72 I;  4GYI A;  3B6C A;  3IWZ A;  1E2X A;  3BZ6 A;  3BG5 A;  3AKZ A;  2K27 A;  2QKL B;  3ERM A;  4HF2 A;  3L2V A;  1SVM A;  3HUG A;  2LNB A;  4IL6 C;  2VJI A;  3T5X A;  1BI1 A;  3HHH A;  1IN6 A;  1Y6I A;  5D8L B;  4DYC A;  2DJI A;  3OYG A;  3IV5 A;  5HS7 A;  3LNQ A;  3KP5 A;  3PQJ A;  4BE1 A;  4QWQ A;  2XIG A;  2Z2S B;  2LBF A;  3K1N A;  3HXL A;  3FBN B;  5F1J A;  2G9W A;  2KL4 A;  3KP4 A;  3N4M A;  1RZ4 A;  1RES A;  2G0E A;  2LF8 A;  3E6D A;  2CGP A;  3I59 A;  1PUF B;  3QQA A;  1GXP A;  5BQT A;  3J7A O;  4ABZ A;  2E1N A;  3E0J B;  1S7E A;  2PLY A;  3HSF A;  4ZYH A;  3S17 J;  1F9N A;  4ZYA A;  1YLF A;  1JGG A;  4I09 A;  4XKV A;  2X48 A;  4Q47 A;  4A0Y A;  5E18 F;  2DQL A;  1K79 A;  2XAF A;  1BR1 A;  3LOC A;  1DDN A;  2E71 A;  3BG6 A;  3AG1 H;  5ED4 A;  4A93 J;  2EFO A;  3DKX A;  3M8E A;  4LFU A;  4BH9 A;  3JTG A;  3ERE D;  1WQ2 A;  2MW8 A;  2ZSI B;  2HXO A;  3MQ0 A;  1PDN C;  5C3E J;  2DOE A;  2HU9 A;  2P7V B;  3HOU J;  3CME I;  2R5Z B;  4RB0 A;  1FX7 A;  3GFL A;  2W85 A;  1HQC A;  3NWT A;  5EGO A;  1S9H A;  2V26 A;  2W57 A;  3HRS A;  2PMZ A;  4LG0 A;  4EM0 B;  4ON0 A;  4Y33 A;  5L3D A;  3BCA A;  5M5Y J;  3FHZ A;  1GVD A;  2ZXI A;  3H5N A;  5KHD A;  2UUZ A;  2K9M A;  5GP9 A;  1ZHF A;  1B9N A;  1IF1 A;  3W2W A;  2ZSH B;  1DU0 A;  3FXJ A;  1WKM A;  2IA2 A;  3ABL H;  3RCO A;  1UST A;  4UVB A;  1TW2 A;  4A5N A;  1U3E M;  1AU7 A;  3WHB A;  4UHT A;  2G7U A;  2E7W A;  3CES A;  4L9T A;  1MD0 A;  1QZY A;  4JYK A;  3IL2 A;  3L00 A;  4YII A;  2FEZ A;  4O6J A;  5J1R A;  4EJW A;  4J01 A;  2LKX A;  5JHF A;  2NNY A;  1E3O C;  1R9T J;  3OOP A;  2WAE A;  1O3T A;  1ETV A;  2DPU A;  9ANT A;  4A3E J;  4LD5 A;  2EIM H;  1M1E B;  3K69 A;  4NC7 A;  2HTS A;  2AXL A;  4HX8 A;  4OIQ F;  4AIK A;  4C30 A;  4HPQ A;  4FE7 A;  3HJE A;  1W0U A;  2O7O A;  1R36 A;  2HQR A;  3FXR A;  1MDM B;  2K4B A;  1HKS A;  1JJ6 C;  2O8X A;  2WAQ N;  3HTS B;  1YE9 A;  2PQ8 A;  1GV5 A;  2WAF A;  3KZI C;  1SMT A;  2BE5 F;  5FB2 A;  5GAH J;  3KP2 A;  1OIS A;  4ESJ A;  1QO0 D;  1WJF A;  5CYV A;  1XMX A;  4XL9 A;  3HOV J;  2K9L A;  5IYC J;  3IUO A;  3K4N A;  2H27 A;  4ESB A;  2P6T A;  4EVI A;  3ZPL A;  4NDL A;  2DT6 A;  1KGS A;  4OMZ A;  2B63 J;  5GAG J;  2QBY A;  3S15 J;  1OMI A;  1AHD P;  2MYS A;  2JSP A;  2D2W A;  3C2B A;  2CH0 A;  3OL3 A;  4NC6 A;  4EGZ A;  3WGH A;  2XB5 A;  2CQQ A;  3CUQ C;  3KX2 A;  1BOA A;  3QAH A;  1J59 A;  1XD7 A;  3JTH A;  2R7S A;  3VOE A;  4DBR A;  1R4N B;  3CF5 F;  4I7H A;  5GTI C;  3L2C A;  1J9I A;  1USS A;  2VKV A;  3F21 A;  4J00 A;  2LG4 A;  5TIS C;  1YTY A;  2EFQ A;  2M7A A;  4YIF A;  1R71 A;  4KYW A;  4D9J A;  1O3R A;  5DCM A;  1G8X A;  3MWM A;  2XGC A;  3BT9 A;  4KN4 X;  3I71 A;  4CH7 A;  3PUF A;  4ZDO A;  3K9T A;  3WTU C;  2ZME C;  4KT5 C;  4DJA A;  2V9P A;  3DEW A;  3AL0 C;  3KP7 A;  5D5V B;  1OCC H;  2WB1 N;  1VQO I;  3I55 I;  3CQZ J;  3VDX A;  1OCT C;  1ZGW A;  3HB9 A;  3CJN A;  3FZV A;  2M0M A;  3BTJ A;  1Z6R A;  1XC5 A;  3QPT A;  2NS7 A;  5IYB J;  4WX9 A;  5IT9 K;  1JE8 A;  1UHW A;  5JLW A;  1IXR C;  3E6C C;  1E3P A;  4L5J A;  2EV6 A;  1MBK A;  1Y56 A;  1FBQ A;  3JRB A;  1Z91 A;  1VQ4 I;  1CQT A;  1QPI A;  1J5Y A;  1ODD A;  1K83 J;  2PJR B;  2OA4 A;  3ZQC A;  4A3J J;  1R1V A;  2ELK A;  2QF7 A;  5FD5 A;  5H2F C;  2Z9O A;  1X1A A;  3HRU A;  3LAP A;  1XSD A;  2XKP A;  2VUM J;  4ZDL A;  2FQ3 A;  4IHW A;  4J19 A;  5GPA A;  2BBY A;  1K7A A;  5HS8 A;  1IZ1 A;  3F8B A;  5LHH A;  3HUG B;  2D1V A;  1I3Q J;  3JAM Z;  1MNM C;  3ZP5 A;  3F3X A;  2GOM A;  4F3Q A;  5F64 A;  5FFX A;  3J80 Z;  2OC6 A;  2HZD A;  2EIL H;  1MJB A;  1DQU A;  2CJJ A;  4RDU A;  1B1B A;  3M1E A;  2LBF B;  2R7Z J;  3PO3 J;  5EDN A;  1OPC A;  1OKR A;  4RAZ A;  3RI4 A;  5F27 A;  4HEA 2;  3I59 B;  3JSP A;  2M4G A;  1X3Z B;  3PSI A;  2RKH A;  2Q0O A;  2HGC A;  3HBL A;  3P7N A;  3CC4 I;  2KMU A;  4N9I A;  3W6J B;  3CJT B;  3G1L A;  1KZH A;  3WTS C;  3OYC A;  1EV7 A;  5M5X J;  1U5T C;  4XLC A;  1QPM A;  3GFI A;  2VQC A;  3F8F A;  1BC7 C;  1TW3 A;  4YFN F;  4NUB A;  1DUX C;  5FKO A;  5FKL A;  3CJR B;  1JHH A;  3K4B A;  4BQA A;  4AYB N;  4A3K J;  4YFK F;  3DKW A;  2FU4 A;  1F5T A;  4XLE A;  2P8T A;  3PO2 J;  1MMN A;  3OYJ A;  5IYD J;  2L9S A;  4AWX B;  3C7J A;  4U88 A;  4S05 A;  2UV1 A;  4LK0 F;  4OWR B;  1LVK A;  2BGC A;  2XAS A;  3GZN B;  1IUF A;  1ZN2 A;  2CWE A;  1RUN A;  1JHF A;  3M1C A;  4CA0 A;  4LB6 B;  3IRQ A;  5EGO B;  2QCO A;  1G59 A;  4HF0 A;  3OYF A;  1X3W B;  2DT5 A;  3EYY A;  4D1Q A;  2Z1D A;  5D5W B;  2BZT A;  1BC8 C;  4IRI A;  5ILU A;  1H8A C;  1ULY A;  1Z05 A;  5LEK A;  1D3Y A;  2O0Y A;  4B43 A;  2P5K A;  1WCM J;  2DW4 A;  2GLO A;  4HBL A;  3F9K A;  1VQK I;  2XUB A;  3TOA A;  1JKR C;  2VPL A;  1HLV A;  2FBH A;  4WWC A;  2L7Z A;  5JLX A;  4HLX A;  1A35 A;  2M2E A;  2IP2 A;  2XDV A;  6PAX A;  5TGT A;  3CO6 C;  3LFU A;  4QIW N;  2HOS A;  3UR3 C;  1ETQ A;  4PCQ A;  5K1Y A;  2O9L A;  3MMY B;  5GAD J;  3FM3 A;  1G2H A;  4LLN A;  1RET A;  2L01 A;  3A4C A;  1QNT A;  3DV8 A;  3FXL A;  3K1M A;  4M9S A;  1P6R A;  1BI0 A;  1T98 A;  3ASO H;  4V2G A;  5BOX A;  4AIJ A;  3EUK L;  2JN6 A;  1R22 A;  2OAZ A;  3R61 A;  2HOA A;  2VOO A;  1FZP B;  2JTV A;  3RQI A;  1YQA A;  2Z33 A;  3SJM A;  1T38 A;  1JKQ C;  1R23 A;  2MBF A;  4L5E A;  2QSH X;  3I5U A;  2ZXJ A;  4FQG A;  1BI2 A;  2NS0 A;  4XSZ F;  1IJW C;  3JRH A;  2XPV A;  4DZP A;  1QBJ A;  3OMY A;  4BXF A;  3NRV A;  3O8G A;  4IX7 A;  2CQK A;  1WJA A;  2OQG A;  1LEB A;  3BPX A;  1FSH A;  1N25 A;  2AHQ A;  4W1U A;  2RAE A;  5BNG A;  5IP9 J;  2H6C A;  3A01 A;  4L0Z B;  1XCV A;  3ZGK A;  5FRM A;  4RGR A;  3HGG A;  1OCZ H;  3IRR A;  2AO9 A;  1S7A A;  1WPK A;  4A2U A;  3EUH A;  4PJ0 C;  3GEZ A;  2IA1 A;  3RZD J;  5J8C A;  5DM7 F;  2X6W A;  3ZQF A;  1Y1V J;  1Z77 A;  3ZQI A;  3GTM J;  4CXF A;  2F5D A;  4WF2 A;  4EQQ A;  4QLC U;  3RKY A;  3C2G A;  2ZBK A;  3NEU A;  2WV0 A;  1UG0 A;  3KYL A;  5BPD A;  3GTK J;  2A5Y B;  3OV8 A;  2M8G X;  2Q2E A;  1FC3 A;  3ZN0 A;  2R93 J;  2HR3 A;  2EA4 A;  1VF9 A;  3DPU A;  2KQR A;  3TBI A;  3L2W A;  2UXX A;  2EZH A;  1DPU A;  3LMM A;  1X2N A;  4HX4 A;  5ERI A;  3DKY A;  1FBS A;  1UAA A;  3TKY A;  3ZRG A;  1IDZ A;  1IRG A;  5A2Q Z;  2M7B A;  2CUF A;  2HPM A;  5IOZ A;  2YU9 J;  2R7U A;  1P4A A;  4HZF A;  5F04 A;  3LA3 A;  1B8I A;  2M0C A;  3DEE A; 
#chains in the Genus database with same CATH homology
 3GWZ A;  4ENJ A;  2NAZ A;  2VT3 A;  3CO7 C;  2K4J A;  5FLX K;  5BMZ A;  2YX4 A;  2A69 F;  3EDP A;  4BHC A;  4AVP A;  1ZGJ A;  2VC1 A;  4HDU A;  5LGN A;  4RS8 A;  5D8K B;  2M87 A;  4HOB A;  1YS7 A;  1OYW A;  3ULQ B;  4L5I A;  4PGH A;  1SFU A;  4IPA A;  2JT1 A;  2R7F A;  1ON1 A;  2DLL A;  2DPD A;  1LDD A;  1XGM A;  5DDG A;  1ZLJ A;  2EK5 A;  2KKO A;  4MEX F;  3BWG A;  3WTT C;  2EJR A;  5FFZ A;  4DQ2 A;  1CF7 A;  2OU2 A;  3GX4 X;  2KIM A;  5D5U B;  3V8K A;  2RN7 A;  4BNC A;  3J81 K;  2OZU A;  1PP7 U;  1XGS A;  4P96 A;  3KLO A;  3JSO A;  3GYH X;  2GXB A;  1KU2 A;  1EH6 A;  4UNO A;  5K5O A;  5D6F A;  5DD4 A;  1YW9 A;  3U9G A;  1ZGA A;  1U78 A;  1ZAO A;  3KZY A;  1G6N A;  3HRT A;  1WSU A;  1UB9 A;  3IKT A;  2ISZ A;  1I5Z A;  2PI0 A;  4NQW A;  1ON2 A;  1SFE A;  2O6G E;  1Z6T A;  4F7Z A;  4U0V A;  5LRS A;  1W7P A;  4EJU A;  1MDM A;  1TBX A;  4G8X A;  4I98 B;  3BPV A;  2IW5 A;  2KJC A;  5HDG A;  1FP2 A;  3HSR A;  1VTN C;  3ECO A;  3E97 A;  3FMS A;  4JQF A;  1I1S A;  4CHU A;  3VFZ A;  2EWN A;  5L3B A;  4LLL A;  3SFZ A;  2XGX A;  3BJA A;  1ZG3 A;  4LJZ F;  3RIR A;  2QWW A;  2HTJ A;  2A3S A;  2RGV A;  5ILS A;  4ZYE A;  4WK8 F;  2FML A;  2UWM A;  2A61 A;  1T39 A;  2ZNY A;  1GHC A;  1ZLK A;  2XAJ A;  3GO5 A;  2DBB A;  1ZAR A;  4D0P A;  4ENM A;  3KFW X;  2KIF A;  1IXS B;  1XGN A;  4HQM A;  2QQA A;  3Q9V A;  3E5U A;  2STW A;  3BJO A;  4ZZD A;  2FF4 A;  2TDX A;  3E6B A;  2V1D A;  4AD9 A;  1FOK A;  1YYV A;  3B73 A;  1NHA A;  4FHT A;  3U1D A;  5LGT A;  4ASN A;  1BBY A;  2VOP A;  2MLK A;  4CIC A;  2GQQ A;  3ABU A;  2VE9 A;  1HSJ A;  3TO7 A;  1XSV A;  5LGU A;  1IRF A;  4HAM A;  1TNS A;  2GZW A;  2XRO A;  2NRA C;  2CFX A;  1RI7 A;  4M6X A;  2E7X A;  1SAX A;  3RPQ A;  3QU6 A;  3KP3 A;  2XHK A;  2HYF A;  4GYG A;  5DUK A;  4U0Y A;  5CVR A;  1YS6 A;  4XBF A;  1XDU A;  3O6B B;  2WC2 A;  2PJP A;  3KEO A;  1T0F A;  4U0W A;  2R3S A;  3WU0 A;  3G73 A;  4M73 A;  3TO9 A;  3G3Z A;  4OIN F;  4A5M A;  3HIF A;  1CF7 B;  4BXU A;  2FRH A;  2G7H A;  2VE8 A;  1R58 A;  5HDN A;  1TQM A;  4P9U A;  3KEQ A;  1R1T A;  4YFX F;  2EV0 A;  3V8J A;  3RKX A;  4UV9 A;  3I53 A;  2STT A;  3V8L A;  4GGG A;  1O7F A;  1ZRE A;  1V3F A;  5D6E A;  3WGG A;  1MZB A;  5F1R A;  3M7G A;  1MJA A;  3FXU A;  2M1B A;  2XVC A;  4MQV A;  3TQN A;  4UUV A;  1W7P B;  2GAU A;  4OU0 A;  2JPB A;  3CTA A;  1YFH A;  1G3T A;  3PFI A;  5DUI A;  2FOK A;  1K78 A;  2QM3 A;  1I6X A;  2ACJ A;  3REO A;  3ZMT A;  1BIA A;  5JVT A;  4WXH A;  1HST A;  4XLP F;  1KYW A;  2C6Y A;  3E6M A;  3BP8 A;  1GXQ A;  2ESN A;  3WOD F;  4IHS A;  2PMH A;  1FBU A;  2CSO A;  2ESH A;  1S7O A;  3ABT A;  3O2P E;  3GW2 A;  3H3U A;  4JBA A;  5E1Z B;  1BN5 A;  1PUE E;  2ZKZ A;  1U8R A;  2JRT A;  3VEP A;  2HS5 A;  3VB2 A;  3TDZ C;  4XLN F;  3DF8 A;  2HWV A;  1S3J A;  2EA2 A;  1ONV A;  4U7B A;  1ZRF A;  1J7K A;  2AS5 F;  1I1G A;  3GFM A;  3WTV C;  5JHU A;  5HLI A;  2P6S A;  3CUO A;  4TV7 A;  5FO5 A;  2DK8 A;  2LF7 A;  3RTR A;  1C0W A;  4M6Y A;  2HDC A;  1W4M A;  3MZH A;  2X4H A;  1JGS A;  3RYP A;  4GO1 A;  2E1C A;  4HV6 A;  4RGU A;  5DV5 A;  4MTD A;  3L09 A;  5JFR A;  5LEJ A;  3I4P A;  4P9F A;  4CYD A;  3PQK A;  4OIR F;  2Y75 A;  2UXN A;  4IHT A;  5JR3 A;  2CO5 A;  3QOP A;  4UVA A;  1OR7 A;  5DD8 A;  1D5V A;  4ENK A;  3HOT A;  4OMY A;  4I0B A;  2JPC A;  4HX7 A;  4XSX F;  2A07 F;  3V7R A;  2Y0M A;  4EGY A;  4DNC A;  1F1Z A;  3L9F A;  4G7O F;  4KMF A;  4PZJ A;  4ZZL A;  1SFX A;  4IXA A;  4WXD A;  3WGI A;  4FX0 A;  2L4M A;  2ZME A;  1G3W A;  1HKT A;  1XB4 A;  4Q5S F;  5H6Q A;  1R5G A;  2YPR A;  3TGN A;  2K02 A;  1CGP A;  2PN6 A;  2M8E A;  4A12 A;  3KCC A;  3I54 A;  4GXO A;  5CJ9 A;  2VBX A;  1LJ9 A;  3SHF A;  5LLQ A;  2MA3 A;  1K78 B;  3J81 Z;  5FGM A;  2GXG A;  3C3W A;  5E8I A;  4EMS A;  1T2K A;  3R6S A;  2ETH A;  2EFN A;  2F5E A;  3FMQ A;  4CO8 A;  2XV4 S;  2DU9 A;  2VBY A;  3D5L A;  2GA2 A;  3R4K A;  3IHU A;  1IN7 A;  1KQ8 A;  1IAW A;  4ZYG A;  1XSX A;  1YIO A;  3GZ5 A;  1U5T A;  3K1P A;  5JI6 A;  4L18 B;  2ZCW A;  1DPR A;  1L0O C;  4P5O A;  4M71 A;  5E17 F;  4Q48 A;  1EH8 A;  3F72 A;  4UV8 A;  3J80 K;  2IPQ X;  2QUF A;  1OYI A;  2F5C A;  3T8T A;  2Z99 A;  3BOQ A;  5EEH A;  3U2R A;  3WG9 A;  4KFC A;  2YR2 A;  1Z9C A;  1OYY A;  5ICC A;  2QEN A;  2YU3 A;  5LBQ A;  2DI3 A;  2IA0 A;  1KA8 A;  4ZYD A;  3WTW C;  1R7J A;  3TO6 A;  3AAF A;  2HZT A;  4Z2Y A;  2V1X A;  2GWR A;  2Q8K A;  1SD7 A;  1Z7U A;  4MHG A;  3WU1 B;  3ECH A;  3P9K A;  1W7P D;  2FSW A;  3HYI A;  2Z3Y A;  3K0L A;  4A6D A;  2H6B A;  2ISY A;  1FT9 A;  1F4K A;  2H94 A;  2IVM A;  1ZH5 A;  1AWC A;  5ICE A;  4IF4 A;  1H9T A;  3BY6 A;  3DEU A;  3S2W A;  3QRF F;  2P5V A;  1L3L A;  2DO7 A;  2HKX A;  3VOD A;  1MKM A;  4NB5 A;  4MQ9 F;  2KJB A;  3QPH A;  2Y48 A;  3IWF A;  3R0J A;  2VN2 A;  3E5X A;  1TLH B;  4Y13 A;  3V7S A;  4N0B A;  4KN7 X;  3FF5 A;  2K86 A;  5TJJ A;  2DQR A;  1SD5 A;  2ZME B;  1IN5 A;  4UXN A;  1JXS A;  4JK1 X;  3FXQ A;  3ISP A;  1G3Y A;  4WCG A;  1O3S A;  3JW4 A;  1MJ9 A;  2A6H F;  3DFG A;  5D4S A;  4Q4Z F;  4ZH4 F;  2D45 A;  5J6X A;  2M45 A;  2Z5U A;  2BEO A;  3LA7 A;  3IC7 A;  5CVJ A;  3NQO A;  2PMU A;  4KIG A;  3LQR A;  2O03 A;  4LB5 A;  4RB2 C;  2DFI A;  5D4R A;  4Y15 A;  1R1U A;  4RGX A;  2PG4 A;  2PFB A;  4OIP F;  4CZZ A;  3V4G A;  4GCV A;  2ZNZ A;  1XGO A;  4E70 A;  2HKO A;  3MEX A;  4I0A A;  2IRF G;  1J75 A;  5K5Q A;  2J5P A;  2QLZ A;  1ZG1 A;  5LHI A;  1KU7 A;  1XMK A;  1U5T B;  1B59 A;  2XAQ A;  4G6Q A;  4KIB A;  1O7L A;  4HF1 A;  2KIU A;  3DPT A;  1FPQ A;  2P7C B;  5E1W A;  1KYZ A;  5LHG A;  4FT8 A;  1WI9 A;  3RYR A;  1J0R A;  1MGT A;  2LSO A;  5ICF A;  1UCR A;  4N9H A;  1TQP A;  5HS9 A;  5L3G A;  2MH9 A;  3E5Q A;  4ENN A;  1H9G A;  3MCZ A;  1LQ1 A;  2FMY A;  2QYO A;  3RPU A;  1SMY F;  1SD4 A;  4KMU X;  1FNN A;  1PP8 F;  1HXD A;  2K7L A;  1FYM A;  3TOB A;  3GLX A;  4A0Z A;  3F6V A;  4KIF A;  3H3Z A;  3E3V A;  3KE2 A;  5IT9 Z;  1HBX G;  1FWZ A;  2HEO A;  3WE3 A;  2JZY A;  1YO5 C;  3Q5F A;  3I0T A;  2V9V A;  2LDU A;  2MLG A;  2HFH A;  3T8R A;  4G6D A;  1HKQ A;  2W25 A;  3P9I A;  2CG4 A;  2XAG A;  5CVV A;  5HOO A;  1QQI A;  1FP1 D;  1ZYR F;  2ZO4 A;  4EJO A;  2YX7 A;  4KDP A;  1IN4 A;  3M9A A;  4G94 A;  4EM1 A;  5L3F A;  3Q9S A;  2J5O A;  4MEY F;  2VC0 A;  4EJT A;  2DAO A;  3V7C A;  1U6G A;  4S04 A;  2RC4 A;  3CDH A;  1HW1 A;  4B09 A;  3LQQ A;  3SQN A;  4KA4 A;  2DK5 A;  2CYY A;  1T6S A;  1J2X A;  2YSR A;  4M9Z A;  2OQR A;  1B4A A;  2BV6 A;  4I2O A;  2VON A;  3KZZ A;  3WTX C;  3C18 A;  5H20 A;  2QQ9 A;  3F8M A;  3TDU C;  1I27 A;  2EFP A;  5EEG A;  5ILV A;  3KET A;  4WXC A;  4H0E A;  1O57 A;  3ZMV A;  1BIB A;  4HDV A;  1G4D A;  2HYG D;  4HV5 A;  2OBP A;  4A0X A;  2EV5 A;  2JSC A;  3DQV C;  2ZFW A;  4L9V A;  2FA5 A;  2MC3 A;  3DXJ F;  3HRM A;  4HQE A;  2H09 A;  2GA1 A;  5HVQ C;  4BHP A;  2COM A;  2QQB A;  4IRH A;  3SZT A;  2KRF A;  1LB2 A;  2A6E F;  4YG2 F;  2FXA A;  4L9J A;  3H92 A;  3BRO A;  2O3F A;  3COA C;  5F6F A;  3C1D A;  1S6L A;  3GZ6 A;  3FX3 A;  1TQI A;  1UFM A;  1Z1D A;  1V4R A;  3FM5 A;  4PGG A;  2W84 A;  1D8J A;  3R0A A;  1S29 A;  1HW5 A;  1TNT A;  4MTE A;  3MAJ A;  4G7H F;  4M74 A;  1ZRC A;  1HW2 A;  1LNW A;  3EQL F;  4L0Y B;  2B0L A;  4OIO F;  3WTZ A;  4IRG A;  3WTY C;  3R60 A;  3LA2 A;  4EM2 A;  2HOE A;  4MNU A;  1RIO H;  1P4X A;  3EYI A;  2A68 F;  1W5S A;  4Y17 A;  3FMR A;  3KP6 A;  4MGR A;  4RB3 C;  1XDS A;  3K2Z A;  5FLX Z;  3CUQ A;  3LAJ A;  1ZG5 A;  3CLO A;  3N97 A;  2PBI A;  4XRF A;  4R79 A;  4HW0 A;  1Q1H A;  2NYX A;  2IT0 A;  1XCB A;  4LG0 B;  3ELK A;  5L3C A;  1G3S A;  3I58 A;  1BJA A;  3GF2 A;  2D1H A;  5TRD A;  3LWF A;  2F5F A;  4RAY A;  5DYM A;  1YW7 A;  1IUY A;  2V79 A;  3QP6 A;  1BI3 A;  2LKP A;  2W24 A;  2VOD A;  1BM9 A;  3SXY A;  1WWX A;  4LK1 F;  1FLI A;  3O3K A;  5AIQ A;  5D5X B;  1KQ9 A;  5K5R A;  2RNJ A;  4L9N A;  4AIH A;  2IJL A;  3HHG A;  4KIC A;  5DCF A;  2QVO A;  5HLH A;  3WE2 A;  3M8F A;  2V1U A;  2RQP A;  3T1B A;  3W6K B;  2VXZ A;  4ESF A;  2PEX A;  2QBY B;  4BAY A;  1B9M A;  3F22 A;  1RUO A;  4EV0 A;  3GXO A;  2P5L C;  1QGP A;  3GVA A;  2GIV A;  1LDJ A;  1GVJ A;  4K2E A;  3HSE A;  3ZMD A;  1P92 A;  2NNN A;  1K6O A;  2VBZ A;  3ZMU A;  3JAM K;  5DCM B;  3LST A;  4LGW A;  1QZZ A;  4A6E A;  4KNY A;  3EET A;  1TTY A;  2FNP A;  2EB7 A;  2M5W A;  1YW8 A;  2X0L A;  2XKO A;  3IKV A;  5ICG A;  3MZY A;  4M72 A;  2OZ6 A;  1EH7 A;  1KU9 A;  3F8N A;  2RDP A;  1Y0U A;  4O3M A;  2MH2 A;  5BS6 A;  2ADU A;  1YG2 A;  2RV8 A;  1IW7 F;  4LMY A;  2XRN A;  1S8N A;  3RKW A;  4G9Y A;  4PDK A;  1WRJ A;  2WWY A;  1X3U A;  4LLG F;  3HTU A;  2ZJ2 A;  4U7D A;  3F6O A;  2FNA A;  1KQ0 A;  2RVC A;  3DPL C;  2BYV E;  5IT3 A;  3SZP A;  4OOI A;  5L3E A;  1U2W A;  1R5H A;  1XN7 A;  1FYL A;  2HQN A;  3F23 A;  5LRR A;  1LEA A;  1E17 A;  2UZK A;  4IJA A;  2QZ8 A;  1IN8 A;  3QP5 A;  3F8C A;  5AIP A;  5AON A;  3RDI A;  2L54 A;  1LDK B;  4IVN A;  3P9C A;  1REP C;  4UVC A;  3CUQ B;  3D0S A;  4CDG A;  2FBI A;  3ZN1 A;  3BJ6 A;  1SD6 A;  3L7W A;  4RB1 A;  1KU3 A;  3RJP A;  1RNL A;  2M30 A;  1FYK A;  4NHJ A;  4BYY A;  3GFJ A;  5HDK A;  3ZMZ A;  1H0M A;  2MD5 A;  3HOS A;  5CLS A;  1ZRD A;  2L4A A;  5H6R A;  5FD6 A;  5J8F A;  4R8H A;  1STZ A;  5BPI A;  1DP7 P;  1P4W A;  4CGZ A;  2P4W A;  2FBK A;  1FSE A;  2F2E A;  5KVR A;  4EJV A;  4I01 A;  3KLN A;  1UHM A;  3ZMS A;  3QU3 A;  4BHB A;  3LFK A;  4FX4 A;  4R1H A;  5HLG A;  4KUM A;  4M9X A;  3GUD A;  2DTR A;  5CVI A;  2L3D A;  5E20 A;  3ML6 A;  4I02 A;  4RGS A;  4G7Z F;  1W5T A;  2OD5 A;  4P55 A;  2R7D A;  3MFK A;  4B8X A;  1LVA A;  1AOY A;  2V6C A;  2CW0 F;  4HLY A;  5A2Q K;  3FWE A;  1D8K A;  2EFW A;  3BDD A;  3B02 A;  2L02 A;  5KK1 A;  1FY7 A;  5E8G A;  2ELH A;  2FE3 A;  5CVU A;  1R00 A;  1O3Q A;  4HA8 A;  2XAH A;  3ZQ7 A;  1A04 A;  3I64 A;  1IXC A;  4ETS A;  5DEQ A;  4O5V A;  2VT2 A;  4HYE A;  5E1X A;  3DP7 A;  1B6A A;  2VBW A;  1XMA A;  3ROU A;  1P2F A;  3T0Y A;  2O61 A;  2WTE A;  4GYI A;  3IWZ A;  1E2X A;  3BZ6 A;  2K27 A;  4HF2 A;  3HUG A;  2LNB A;  3T5X A;  1BI1 A;  3HHH A;  1IN6 A;  5D8L B;  5HS7 A;  3KP5 A;  3PQJ A;  4QWQ A;  2XIG A;  3K1N A;  2G9W A;  3KP4 A;  3N4M A;  1RZ4 A;  2LF8 A;  3E6D A;  2CGP A;  3I59 A;  1GXP A;  5BQT A;  3J7A O;  2E1N A;  2PLY A;  3HSF A;  4ZYH A;  1F9N A;  1YLF A;  4I09 A;  4Q47 A;  4A0Y A;  5E18 F;  2DQL A;  1K79 A;  2XAF A;  1DDN A;  5ED4 A;  2EFO A;  3M8E A;  4LFU A;  4BH9 A;  3JTG A;  3ERE D;  1WQ2 A;  3MQ0 A;  1PDN C;  2P7V B;  4RB0 A;  1FX7 A;  3GFL A;  2W85 A;  1HQC A;  4EM0 B;  2W57 A;  3HRS A;  4LG0 A;  4ON0 A;  5L3D A;  3FHZ A;  1ZHF A;  1B9N A;  1IF1 A;  1WKM A;  2IA2 A;  1UST A;  4UVB A;  1TW2 A;  4A5N A;  1U3E M;  4UHT A;  2G7U A;  2E7W A;  4L9T A;  1MD0 A;  1QZY A;  3IL2 A;  3L00 A;  4YII A;  2FEZ A;  4O6J A;  4EJW A;  2NNY A;  3OOP A;  1O3T A;  2DPU A;  4LD5 A;  3K69 A;  2HTS A;  2AXL A;  4HX8 A;  4OIQ F;  4AIK A;  3FXR A;  1R36 A;  2HQR A;  1MDM B;  2K4B A;  1HKS A;  2O8X A;  3HTS B;  2PQ8 A;  1SMT A;  2BE5 F;  5FB2 A;  3KP2 A;  4ESJ A;  1QO0 D;  5CYV A;  2H27 A;  4ESB A;  2P6T A;  4EVI A;  3ZPL A;  1KGS A;  4OMZ A;  2QBY A;  1OMI A;  2D2W A;  4EGZ A;  3WGH A;  3CUQ C;  1BOA A;  3QAH A;  1J59 A;  1XD7 A;  3JTH A;  3VOE A;  4I7H A;  3L2C A;  1J9I A;  1USS A;  3F21 A;  1YTY A;  2EFQ A;  4YIF A;  4KYW A;  1O3R A;  5DCM A;  3MWM A;  4KN4 X;  3I71 A;  3K9T A;  3WTU C;  4KT5 C;  3KP7 A;  5D5V B;  3CJN A;  3FZV A;  1Z6R A;  3QPT A;  5IT9 K;  4WX9 A;  1JE8 A;  1UHW A;  1IXR C;  3E6C C;  4L5J A;  2EV6 A;  1FBQ A;  1Z91 A;  1J5Y A;  1ODD A;  2OA4 A;  1R1V A;  5FD5 A;  2Z9O A;  3LAP A;  3HRU A;  1XSD A;  2XKP A;  2FQ3 A;  2BBY A;  1K7A A;  5HS8 A;  1IZ1 A;  3F8B A;  5LHH A;  2D1V A;  3JAM Z;  3ZP5 A;  3F3X A;  5F64 A;  5FFX A;  3J80 Z;  1MJB A;  1B1B A;  3M1E A;  1OPC A;  1OKR A;  4RAZ A;  3RI4 A;  3I59 B;  3JSP A;  2RKH A;  2Q0O A;  2HGC A;  3P7N A;  4N9I A;  3W6J B;  3WTS C;  1EV7 A;  1U5T C;  1QPM A;  3GFI A;  3F8F A;  1BC7 C;  1TW3 A;  4YFN F;  1DUX C;  1JHH A;  4BQA A;  4YFK F;  3DKW A;  2FU4 A;  1F5T A;  2P8T A;  4AWX B;  3C7J A;  4U88 A;  4S05 A;  4LK0 F;  2BGC A;  2XAS A;  1ZN2 A;  2CWE A;  1RUN A;  1JHF A;  4LB6 B;  3IRQ A;  4HF0 A;  2DT5 A;  3EYY A;  5D5W B;  1BC8 C;  4IRI A;  5ILU A;  1ULY A;  1Z05 A;  5LEK A;  1D3Y A;  2O0Y A;  2P5K A;  2DW4 A;  4HBL A;  2XUB A;  3TOA A;  2FBH A;  4WWC A;  4HLX A;  2IP2 A;  6PAX A;  3CO6 C;  4PCQ A;  5K1Y A;  3FM3 A;  4LLN A;  2L01 A;  1QNT A;  3DV8 A;  3K1M A;  4M9S A;  1P6R A;  1BI0 A;  1T98 A;  5BOX A;  4AIJ A;  3R61 A;  1R22 A;  2OAZ A;  2VOO A;  1FZP B;  2JTV A;  1YQA A;  2Z33 A;  1T38 A;  1R23 A;  2MBF A;  3I5U A;  2ZXJ A;  1BI2 A;  2NS0 A;  4XSZ F;  1QBJ A;  3NRV A;  2CQK A;  2OQG A;  1LEB A;  3BPX A;  1FSH A;  2H6C A;  4L0Z B;  1XCV A;  4RGR A;  3IRR A;  1S7A A;  4A2U A;  3EUH A;  3GEZ A;  2IA1 A;  5J8C A;  4CXF A;  2F5D A;  4WF2 A;  4EQQ A;  4QLC U;  3RKY A;  2ZBK A;  3NEU A;  2WV0 A;  5BPD A;  2A5Y B;  3OV8 A;  2Q2E A;  1FC3 A;  3ZN0 A;  2HR3 A;  2EA4 A;  2UXX A;  1DPU A;  4HX4 A;  5ERI A;  1FBS A;  3TKY A;  1IRG A;  5A2Q Z;  1P4A A;  4HZF A;  3LA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...