5AIPA

Crystal structure of nadr in complex with 4-hydroxyphenylacetate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 46
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aipA00
2P8TA 1ZYRF 2CW0F 5FGMA 4CICA 3F23A 2LSOA 1XD7A 3DFGA 2O61A 5TRDA 4TV7A 3G3ZA 3L09A 1FC3A 4ENJA 1SMTA 2H94A 2RC4A 1DPRA 4BXUA 1T98A 1ZG1A 3PQJA 4IJAA 5D5WB 4NQWA 3M8FA 1BIBA 5AIQA 4IHTA 4YFNF 3J7AO 3E6CC 4I7HA 4LK1F 3GYHX 2YR2A 2ZKZA 3HRTA 1C0WA 5L3DA 5E1ZB 3M1EA 2R7FA 4KN4X 1RZ4A 1XGSA 4RGSA 3P9IA 1KQ0A 3K1NA 3P7NA 5DUIA 2IA1A 4F7ZA 1LB2A 2MLKA 2CFXA 2VXZA 5HS8A 4OU0A 1R5HA 2ZO4A 1B9NA 1QO0D 4EGZA 1S29A 3FF5A 2FNAA 2K7LA 1ZH5A 2ESHA 2MC3A 2O6GE 1UCRA 1KU2A 2JRTA 1OPCA 1XSXA 5DDGA 3IKTA 2Y0MA 3B02A 3E6MA 2DK5A 2DQLA 5HS9A 5L3GA 4CHUA 3HIFA 1FPQA 3F8BA 1ZHFA 5JHUA 1ZRDA 4G6QA 2CYYA 2FMYA 1SFEA 1XN7A 3R0JA 2ZXJA 5FD5A 4S05A 1QNTA 3JAMZ 3M9AA 1IRGA 2BV6A 2PI0A 2XASA 3HOSA 1LDDA 2QM3A 3IC7A 2ZMEB 1FZPB 3R0AA 4P55A 1FT9A 3QAHA 2IPQX 2EA4A 2MH2A 5LRRA 4HDUA 2ETHA 4XSZF 4FX4A 2RQPA 4MNUA 2Q0OA 4OIQF 2DBBA 2OZ6A 3KP5A 4MQ9F 1F1ZA 1FYKA 1STZA 2K02A 4KN7X 3HTUA 4HX7A 2K86A 3FXQA 5H6QA 2NNNA 1XDSA 1ZN2A 1T6SA 3B73A 5ICCA 1U78A 5JFRA 4P5OA 4WXDA 2YPRA 2FBHA 2QQ9A 3GFJA 2ZMEA 1AOYA 3KZYA 2ESNA 1CF7B 3LAJA 5L3CA 4U7DA 5BPDA 4AD9A 1G3WA 3LA3A 4UV9A 3FXRA 4YIFA 4I98B 3MZYA 5LGUA 1YS6A 3GFLA 1GXQA 2P6SA 1R7JA 3EYIA 4IXAA 4KICA 1SD7A 5CLSA 4KIFA 5FO5A 2EV5A 3C1DA 1NHAA 3IRQA 1XGMA 3VFZA 4CDGA 4K2EA 2ZNZA 4OIPF 2Z5UA 3WE3A 4NHJA 4ESJA 2HQRA 3I4PA 4ESFA 4L5IA 2TDXA 4N0BA 4ZYGA 2HYGD 3Q9VA 1CF7A 4CGZA 3GXOA 1REPC 2M5WA 3V8KA 1JHFA 5D6EA 4RGXA 4N9IA 5ERIA 3WGIA 3BPVA 1EH7A 1YW8A 2DTRA 4HAMA 2O03A 5DD4A 2VT3A 4LGWA 4A0ZA 1R1TA 2IJLA 2O8XA 3GZ6A 2Q2EA 1J75A 1D5VA 5FLXZ 5LLQA 4R79A 4M71A 5F6FA 2FRHA 3J80K 4EM1A 1J2XA 4OMZA 3V7SA 3V8LA 2RN7A 1LNWA 3H3ZA 3ZMVA 2A68F 3BPXA 2H6CA 1HKSA 2X0LA 3CLOA 3M7GA 3ECOA 1PDNC 3ABTA 4PCQA 4UUVA 2A6EF 3GFMA 2GQQA 1B9MA 3GWZA 1FP1D 4E70A 5CVIA 2D2WA 1G3TA 3RPUA 4GO1A 3J81K 1DPUA 4OINF 2AS5F 3I71A 3F6OA 5FFZA 1ZREA 2B0LA 4GYIA 5D5XB 4P9UA 4Y13A 3WTUC 2W25A 4HBLA 2E1CA 3L9FA 4HZFA 2DQRA 2M45A 2NNYA 1B59A 1UHMA 4HW0A 3RJPA 3O3KA 3HRMA 5BOXA 3HOTA 3Q9SA 4WX9A 2FOKA 3WTTC 4WWCA 2QENA 4GYGA 3GZ5A 5DV5A 3QPHA 4Q4ZF 4G8XA 3NRVA 1J5YA 4KT5C 3L00A 1TNTA 5D5VB 1DP7P 4UV8A 3TO6A 1LEAA 1P4XA 1HKTA 2OZUA 3DKWA 2WC2A 3PQKA 4JQFA 2VONA 1TNSA 3LA7A 2AXLA 5F64A 3HHHA 1H0MA 5DCMB 5FB2A 1KU7A 4IRIA 2K27A 1JE8A 4HV5A 2ACJA 3F21A 3ZN1A 1T39A 4HX4A 1IZ1A 4MTEA 4HF0A 4HF2A 1USSA 2OBPA 1R5GA 3P9KA 1HSJA 1KA8A 3ULQB 4EJWA 2H6BA 5LHGA 5E18F 3KFWX 2MBFA 1SD5A 4ZZDA 2GIVA 3K1PA 4G7OF 5L3EA 4LB5A 3V4GA 2QUFA 4FHTA 4WXCA 2R3SA 3QOPA 2JZYA 4ON0A 3PFIA 2KIMA 3I0TA 5DCMA 1S6LA 1Q1HA 1RUNA 1G6NA 4LFUA 3ECHA 1WWXA 4KIBA 1BI1A 5A2QK 2GA2A 2CSOA 2NS0A 4B09A 2A69F 3ZQ7A 2L3DA 2IW5A 5D8KB 4DQ2A 5AIPA 2A07F 2MH9A 1PP7U 4BHCA 2R7DA 4AIHA 3RIRA 3FWEA 4ZYDA 5LHIA 2KKOA 5ILVA 4ZZLA 1OR7A 4CO8A 5D4SA 4IRHA 1WI9A 4OIRF 5KK1A 1FYLA 1UFMA 1MJ9A 5K5RA 4FX0A 1HSTA 4M73A 1S3JA 2M1BA 3TGNA 4HOBA 2VBXA 2RKHA 5LRSA 4HF1A 2XIGA 3TO7A 5E1WA 4OIOF 4M72A 4EM0B 5E17F 1U6GA 3NQOA 4M9SA 1XMAA 4UVCA 3BROA 2HEOA 4IF4A 3QPTA 4PGHA 1MDMB 1ZRCA 1BBYA 1R58A 1FBSA 3EDPA 1B1BA 4EM2A 1UB9A 3TDZC 3GVAA 2W57A 1EV7A 2ZNYA 2PLYA 3MAJA 2Z9OA 2NRAC 3WTZA 2OU2A 3ABUA 3EQLF 3COAC 5LEJA 1J9IA 3WTVC 3QP6A 1W5TA 4GCVA 4Y17A 1XGOA 2QQBA 1Z05A 4Y15A 2ZBKA 1ZGJA 3SZTA 3FX3A 5HLGA 2ISYA 1SMYF 5IT9Z 4L9NA 4GGGA 5E8IA 2JT1A 2FE3A 2HDCA 5J6XA 5HLHA 1VTNC 3HRSA 1QGPA 1RUOA 5LEKA 1MDMA 4ZYEA 1XSDA 2DLLA 5HDKA 3V7RA 3DQVC 3BWGA 4EV0A 2RGVA 1U5TC 2P5VA 2KJCA 1E17A 2NAZA 2FQ3A 4BHPA 4ENNA 2VN2A 2GAUA 1LEBA 2FBIA 5CVUA 5FFXA 2VBWA 1H9TA 1ON2A 1YIOA 1ODDA 1SD4A 4O6JA 3DPTA 1MKMA 3ZMUA 2PJPA 3VEPA 4MEXF 2GXBA 2VE8A 5JVTA 3OOPA 3CO6C 2FSWA 1YYVA 3E6BA 4RAYA 1U5TB 3ERED 5D5UB 3ZMTA 1O3SA 3ROUA 3DPLC 2X4HA 5J8CA 1J7KA 3HTSB 3DF8A 3V8JA 3E6DA 3R60A 1BJAA 3GW2A 4I0BA 4L9VA 2VOPA 4Q48A 2D45A 2YSRA 5HOOA 3HHGA 1BN5A 1LQ1A 3K1MA 4LD5A 1SFUA 1SAXA 3OV8A 4B8XA 2F2EA 3E5UA 4AVPA 1UHWA 5H6RA 3LFKA 2VC1A 3MWMA 3FMQA 4AIJA 1FSHA 2BGCA 1QBJA 3RTRA 1RIOH 1G3SA 4RB0A 1ZARA 1U5TA 4RB3C 4XRFA 3REOA 3VOEA 3W6KB 1TW3A 3ISPA 1YW7A 4I0AA 5AONA 3GX4X 1T2KA 2HTSA 2XVCA 1HBXG 4L9JA 2QYOA 2YX4A 3LWFA 1XCBA 5LGNA 3L2CA 3WE2A 3H92A 2DPDA 3ZN0A 1P6RA 1TQPA 1DDNA 1P92A 4U0VA 3GEZA 5K5QA 3K9TA 3JSPA 4L0YB 2PMUA 4MHGA 1JHHA 4ZYHA 3SZPA 2EV6A 4HYEA 2FU4A 1ULYA 3TKYA 4RGUA 3JW4A 4EJOA 3N4MA 3KP7A 2EWNA 2CQKA 4MQVA 5K1YA 1ZRFA 5H20A 2FNPA 2H09A 1WQ2A 2VBZA 2XRNA 4BNCA 1G3YA 2VC0A 1FY7A 3K0LA 3HRUA 3FZVA 2FBKA 1OKRA 4EJVA 2HQNA 2OAZA 1L0OC 1IXSB 3BDDA 5L3BA 2EFQA 1I1GA 4CYDA 4XBFA 4L5JA 3I58A 2P6TA 1QZZA 2ELHA 4YG2F 1W7PB 2HS5A 2F5DA 4PZJA 2DPUA 3TOAA 2W84A 1R1VA 2PFBA 4LLNA 3E5XA 2M30A 4MGRA 2MD5A 3LA2A 2FMLA 3KEQA 3KP4A 4I02A 1WSUA 4LLLA 4UVAA 3HUGA 3T8TA 2VOOA 4UVBA 3G73A 1U2WA 4G7ZF 3I54A 5ILSA 4MEYF 2PMHA 2L01A 1LJ9A 4I01A 1FBUA 2EV0A 4HDVA 3MZHA 1BC7C 5L3FA 2IVMA 1MZBA 4A6EA 4U88A 3F8NA 3F8CA 1W7PA 4JBAA 4FT8A 1YS7A 1HQCA 2Z33A 3HSEA 2UWMA 4OMYA 3F6VA 2FXAA 2DT5A 5DUKA 2VT2A 1BI0A 1KYWA 5J8FA 2V9VA 1OYWA 2ZCWA 3J80Z 2STWA 1W7PD 4HV6A 1Z9CA 2XROA 3KEOA 2A5YB 2FEZA 4HX8A 2W24A 1IN4A 1JGSA 1QZYA 4ENMA 4H0EA 2IP2A 3I59B 1YFHA 4G7HF 3R4KA 1QPMA 4QLCU 3BJAA 3ZMZA 3K69A 2HWVA 3KZZA 4KA4A 1I27A 3J81Z 3MEXA 4KFCA 1J0RA 1FP2A 2XAFA 2A61A 1HW2A 1FSEA 2V1DA 3KP3A 4BQAA 2YX7A 1SFXA 2RNJA 4RAZA 1O3TA 3BOQA 3TO9A 2DO7A 2HTJA 3RI4A 3ZMDA 2EFNA 2CWEA 1L3LA 4S04A 4HLXA 3F3XA 4JK1X 3I59A 1YQAA 4BYYA 1A04A 3TDUC 1FX7A 3QRFF 1XCVA 3DXJF 3U9GA 3SXYA 3AAFA 2WTEA 2XAJA 4QWQA 3WU1B 2GWRA 2DAOA 2M87A 5DYMA 3IHUA 4LMYA 1XDUA 4EVIA 4LK0F 2F5EA 4O5VA 4RGRA 4A6DA 1FWZA 3HSRA 3C18A 3FM3A 4YFXF 3KE2A 4EJUA 1S7AA 1IW7F 2Y48A 2HZTA 4DNCA 2HOEA 5ED4A 4WXHA 3EETA 1ON1A 3SHFA 1X3UA 3BY6A 3RDIA 1ZAOA 1Z1DA 2PG4A 2XHKA 4M6XA 4Z2YA 2BYVE 2XAQA 4U7BA 2G7UA 3JAMK 4EGYA 2YU3A 2DK8A 4HA8A 1TQMA 2FA5A 2L54A 3JTGA 4KYWA 2HKXA 3WTYC 4GXOA 3RYRA 2XKPA 5EEGA 3E97A 4UHTA 3LQRA 2WV0A 3ML6A 4IRGA 1LDKB 4R8HA 1PP8F 1YW9A 2ZFWA 1SD6A 3C7JA 4R1HA 1R36A 1F5TA 3CTAA 3RPQA 4ETSA 4L18B 2JTVA 3HSFA 2BBYA 4IHSA 1TLHB 3WTSC 3BZ6A 4EMSA 4XLNF 3C3WA 5A2QZ 1TTYA 2G9WA 3RKXA 3WGGA 2NYXA 2XV4S 5DCFA 2F5FA 3LAPA 4CXFA 2P4WA 3GF2A 3IWZA 2JPCA 5HS7A 2ADUA 2E1NA 5FD6A 1S7OA 1CGPA 1O57A 3F8FA 5D4RA 1F4KA 2L02A 1HKQA 3LSTA 1K7AA 4KMFA 1BOAA 1D8JA 2KJBA 3D5LA 3CDHA 3GO5A 2UZKA 1D8KA 3H3UA 3EUHA 2Q8KA 1B4AA 4LG0B 2PEXA 2QWWA 2VODA 3W6JB 3EYYA 2GXGA 2P5LC 4MTDA 2V6CA 1ZLKA 2DI3A 3F8MA 1QQIA 3O2PE 5ICEA 2O3FA 4NB5A 2IRFG 2E7XA 1IF1A 1IN7A 4XSXF 4HQMA 2A6HF 2LF7A 1BIAA 5EEHA 4PDKA 1V4RA 1R23A 3CJNA 2IT0A 3T0YA 3CUQC 3GUDA 2DFIA 3SQNA 1EH6A 2HYFA 2W85A 1R1UA 4LG0A 1W5SA 3I53A 1ZGAA 3U1DA 1FNNA 4KMUX 4M74A 1MGTA 4IPAA 1OYYA 3KLOA 2XAGA 3S2WA 4WCGA 2KRFA 5HLIA 5FLXK 3GLXA 3TOBA 6PAXA 2DU9A 2OA4A 2XAHA 2C6YA 2CO5A 2M8EA 1I1SA 3HYIA 1JXSA 4A12A 1ZLJA 2D1VA 3CUQB 1OMIA 2XGXA 3R6SA 3TQNA 1IRFA 1WRJA 2QZ8A 5BMZA 1XMKA 1MJAA 4U0WA 3QP5A 4RB2C 4L9TA 4A0YA 3IL2A 2PBIA 1R00A 1P4WA 1DUXC 2QBYB 4HQEA 1LVAA 2CGPA 1TQIA 2RDPA 3JSOA 1K6OA 2LDUA 4BHBA 2K4BA 2JPBA 2DW4A 1GXPA 2EFWA 1P4AA 3ZPLA 5F1RA 3MFKA 1GHCA 1BC8C 2UXXA 5LGTA 3I64A 2K4JA 1BM9A 1RI7A 1E2XA 4YFKF 2QQAA 3CUQA 4LB6B 2PQ8A 3I5UA 1EH8A 5CJ9A 3QU6A 2IA2A 3BP8A 3L7WA 5K5OA 1O7LA 5ILUA 4UXNA 1ZG5A 2QBYA 4XLPF 3WTXC 2LNBA 4I2OA 4ZH4F 1T38A 2E7WA 4EJTA 1XB4A 3F22A 2VBYA 1U3EM 4HLYA 2OQRA 2V1UA 4RS8A 2RV8A 4RB1A 2ISZA 2P5KA 4UNOA 2EK5A 2HFHA 2ZJ2A 1HXDA 4KIGA 1W4MA 4WK8F 3KETA 4EQQA 4OOIA 4AIKA 2L4MA 3M8EA 1FBQA 2HKOA 3DV8A 4Q5SF 2RVCA 1S8NA 5HDNA 1IAWA 1HW1A 2V79A 2WWYA 4G9YA 4N9HA 4G94A 5BQTA 1GVJA 4G6DA 2Z99A 2H27A 1K79A 1FLIA 1XSVA 4ESBA 5HVQC 1RNLA 3VODA 2FF4A 3IWFA 4M9ZA 3FM5A 2LKPA 5D6FA 5E1XA 1IN8A 3WODF 2A3SA 1YG2A 1WKMA 1O3RA 3WG9A 2MLGA 1XGNA 2F5CA 1BI3A 5KVRA 3CUOA 1F9NA 3BJOA 4A5MA 1KYZA 5TJJA 1O3QA 1TW2A 4M9XA 3FXUA 3U2RA 1B6AA 2XKOA 3V7CA 2J5OA 2EB7A 2EFOA 4KUMA 1IN6A 2EFPA 3FMSA 3O6BB 4Q47A 4CZZA 3KP2A 1KQ9A 1V3FA 1Z6TA 4YIIA 1J59A 1KGSA 3T8RA 2JSCA 5HDGA 4U0YA 3CO7C 1IXRC 3ZMSA 2XUBA 4LJZF 3T1BA 1TBXA 2G7HA 4AWXB 3MCZA 3JTHA 1I6XA 5DD8A 5CYVA 3Q5FA 2UXNA 3WU0A 2HGCA 4A2UA 1G4DA 1IN5A 1Z6RA 3BJ6A 1FYMA 5ICGA 5JR3A 1YO5C 4KNYA 1ZG3A 5JI6A 3KCCA 1AWCA 5E8GA 5CVJA 1U8RA 3F72A 2L4AA 1K78B 5DEQA 2BEOA 4WF2A 3KLNA 1T0FA 5BS6A 2GA1A 3FHZA 4LLGF 1H9GA 3N97A 2VE9A 1FOKA 3RKWA 3E5QA 3VB2A 3GFIA 1O7FA 4P9FA 2P7VB 4ASNA 4L0ZB 3FMRA 3D0SA 1Z7UA 1OYIA 2IA0A 1P2FA 3KP6A 4KDPA 5LBQA 2COMA 3T5XA 1USTA 5LHHA 5IT3A 2Z3YA 2P7CB 2OQGA 4BH9A 1IXCA 3MQ0A 4I09A 5BPIA 5CVVA 2J5PA 3IKVA 1KQ8A 3WGHA 4ENKA 3WTWC 1PUEE 4BAYA 3SFZA 4O3MA 2O0YA 1K78A 1Z91A 2CG4A 2BE5F 1HW5A 5CVRA 2D1HA 1BI2A 4IVNA 2QVOA 3R61A 1LDJA 3RYPA 3K2ZA 3NEUA 3ELKA 2MA3A 1ONVA 1MJBA 3QU3A 1R22A 1IUYA 5E20A 1YTYA 2Y75A 3DP7A 2EA2A 2KIFA 2HR3A 4D0PA 2EJRA 2PN6A 1KU3A 5D8LB 4P96A 2OD5A 2V1XA 4PGGA 2KIUA 5IT9K 3ZP5A 1KU9A 4A5NA 3LQQA 1Y0UA 1D3YA 4A0XA 1I5ZA 3E3VA 3P9CA 1MD0A 2STTA 4M6YA 1YLFA 2LF8A 2QLZA 2GZWA 3DEUA 3IRRA 3RKYA 5ICFA
chains in the Genus database with same CATH superfamily
2P8TA 1ZYRF 2CW0F 5FGMA 4CICA 3F23A 2LSOA 5EG0B 4A3JJ 1EF4A 1XD7A 3DFGA 2O61A 4XKBA 5TRDA 2KLOA 4TV7A 3E7LA 3H36A 2DMQA 4IZZA 1FMVA 3G3ZA 3L09A 1B8IB 1FC3A 4ENJA 1SMTA 2H94A 2RC4A 1DPRA 4BXUA 1T98A 2GBYA 3GTJJ 1ZG1A 3PQJA 3LSGA 1V55H 4IJAA 5D5WB 4NQWA 2BW3B 3GTPJ 2EINH 3M8FA 1BIBA 3K4BA 3ABKH 5AIQA 4IHTA 2HYJA 4YFNF 3J7AO 3E6CC 3OOUA 3E0JB 4I7HA 2NXNB 4B3XA 4LK1F 3GYHX 1N25A 2YR2A 2ZKZA 1BL0A 3U1KA 5IYDJ 3HRTA 1U0JA 1C0WA 5L3DA 2BHYA 4UUSB 5E1ZB 1NTCA 1VQ4I 3ZQCA 3OS0A 1WH7A 3M1EA 3OYAA 2R7FA 2K9NA 2EIMH 1E3OC 1ENHA 4P1WA 4KN4X 3F0CA 1IDZA 1AKHB 4X0GA 1RZ4A 1XGSA 4RGSA 3P9IA 3QYEA 2BY0A 5IPAA 2XF7A 2IS1A 2KDOA 1KQ0A 3K1NA 5EG0A 3P7NA 5DUIA 2OUMA 2IA1A 2ZSHB 3HOUJ 5EF6A 4F7ZA 5HODA 1LB2A 2MLKA 3GBGA 3ZQGA 5FROA 3CP8A 1B8IA 2CFXA 2VXZA 2Y31A 5HS8A 3HOVJ 3BTLA 4OU0A 1R5HA 1XTAA 2ZO4A 1B9NA 4C30A 1QO0D 3ZGKA 3PIOF 3B6AA 2BW3A 4EGZA 1S29A 1X1DA 3FF5A 2FNAA 2K7LA 3EPZA 1X1AA 3KIOA 1ZH5A 2ESHA 2MC3A 1W5CC 2KIQA 2O6GE 1UCRA 2HVRA 2HOTA 1KU2A 2JRTA 1IO2A 4RBOA 1WJAA 2L7ZA 1OPCA 1XSXA 3PM1A 5DDGA 2LY1A 3IKTA 3B02A 2Y0MA 3E6MA 4XL9A 2MGQA 1R71A 1YHQI 5LD2C 1FOWA 2DK5A 2DQLA 2HDDA 2QKMB 4BE0A 5HS9A 4BXFA 5L3GA 4UUSA 4CHUA 1DU6A 2UUZA 2KPMA 1FPQA 3HIFA 3F8BA 4BDZA 1ZHFA 3DBHB 3ZRGA 3JRCA 1IRXA 5JHUA 1ZRDA 4G6QA 2CYYA 2FMYA 2VQGA 3L2WA 1SFEA 2F4MB 4J01A 4A93J 1XN7A 2M0CA 3R0JA 2ZXJA 1WGXA 1AKHA 5FD5A 4S05A 3G2BA 2WY8Q 1ZTRA 4Y52J 1QNTA 3JAMZ 3M9AA 3FBNB 1IRGA 2W1OA 1TWFJ 2BV6A 2Z16A 2PI0A 5CKTA 2XASA 1K6YA 1X3ZB 2O7OA 3OYFA 3AKZA 3H3VK 2ELJA 3HOSA 1LDDA 2QM3A 3IC7A 2ZMEB 1FZPB 3R0AA 4P55A 1FT9A 3QAHA 3BTCA 3TP3A 1IDYA 4D7NA 2IPQX 2EA4A 2MH2A 5LRRA 1FIPA 2LYCA 1T95A 3F9KA 4HDUA 2ETHA 2Z1DA 1XPXA 3NARA 1AA7A 4XSZF 2O5RA 3RZOJ 4FX4A 2RQPA 2XF6A 4MNUA 2ZJPF 2H8RA 2Q0OA 4OIQF 1LUJB 3GTOJ 3PSFA 2DBBA 3ERMA 2XF5A 2OZ6A 5KCMA 3KP5A 4MQ9F 2XGEA 2FX0A 2OCEA 3LSKA 5KHDA 1F1ZA 2Q1ZB 1D0ZA 2NVXJ 4D1QA 1FYKA 1STZA 2K02A 4KN7X 3HTUA 4D5CA 2MSYA 4HX7A 5BNGA 2K86A 3FXQA 5H6QA 2NNNA 1JUPA 1XDSA 1ZN2A 4XKVA 1WHUA 2JQ7A 1T6SA 3B73A 2JA5J 4PJJA 5ICCA 1Y39A 1U78A 3I3LA 1APLC 3BR5A 5JFRA 4P5OA 2R5ZB 4WXDA 2XAUA 2YPRA 2I5UA 2WB1A 4B3AA 2FBHA 2QQ9A 3GFJA 2ZMEA 1AOYA 4JYKA 3KZYA 2ESNA 1CF7B 3LAJA 2ZJRF 5L3CA 4U7DA 1LFBA 5BPDA 4AD9A 3HM5A 2XSDC 1G3WA 2F48A 2Z2SB 2E19A 3EUKL 2MW8A 3LA3A 1W0TA 4E7JA 2HOSA 4D7MA 2VQHA 4UV9A 3FXRA 3CLQA 1HLVA 4YIFA 4I98B 1RRJA 2R7SA 2VJ5A 2QA4I 3MZYA 5LGUA 1YS6A 2LY9A 3GFLA 1GXQA 1Y8QB 5J1UA 2VKEA 5E3MA 2P6SA 1ETWA 1R7JA 2Q2EB 3EYIA 4IXAA 4KICA 1TWGJ 3RKQA 2ECCA 1SD7A 2DDBA 5CLSA 1R4NB 3PNTA 4KIFA 1ETOA 5FO5A 2LBFB 4D9JA 2Y0SN 3IV5A 2EV5A 3C1DA 1NHAA 3A1YA 3OYEA 3IRQA 1XGMA 3VFZA 4CDGA 1TT0A 1YOVB 2ZNZA 4K2EA 1A36A 1MMSA 2JA6J 4OIPF 1JJ8C 2Z5UA 4OWRB 1XC5A 3WE3A 3OYIA 4NHJA 5IYCJ 4BE2A 1VQOI 4ESJA 2R5ZA 2HQRA 3I4PA 4ESFA 9ANTA 3OL3A 4L5IA 2V7FA 2TDXA 2MFZA 4XN3A 2ZXWH 4N0BA 1WH5A 3VYRB 4ZYGA 2HYGD 3Q9VA 1CF7A 4CGZA 3GXOA 1REPC 2M5WA 2NOGA 3IAM2 3V8KA 1JHFA 3BTJA 5D6EA 4RGXA 1DGWY 3AG2H 2DT6A 4N9IA 5ERIA 3WGIA 3BPVA 4NBQA 4FE7A 1EH7A 1YW8A 2DTRA 4HAMA 3JR9A 1H88C 2O03A 5DD4A 2VT3A 5JLXA 3S2DJ 4LGWA 4DBQA 4A0ZA 4CCJA 2R7VA 2AHQA 3C2BA 1X1CA 2KHMA 3L2RA 1R1TA 4QSHA 2IJLA 1X4OA 2O8XA 2XDVA 5EJCA 3GZ6A 2Q2EA 1Y6IA 1J75A 1D5VA 5FLXZ 3K4LA 3DKXA 1OCOH 5LLQA 4R79A 4IEJA 1F43A 2LBFA 4M71A 5F6FA 2FRHA 3J80K 4EM1A 1J2XA 2KMUA 4OMZA 3V7SA 3V8LA 2R7WA 2RN7A 1LNWA 4MO7A 4XKWA 1FMWA 2BY1A 3H3ZA 3ZMVA 3BQZA 2A68F 3BPXA 2H6CA 3FK6A 2IGMA 1G2HA 1HKSA 3LSIA 1WJCA 2X0LA 3OYLA 1LKXA 4C9YA 1SAUA 1T0FC 3G1OA 4ZYAA 3CLOA 3M7GA 4E7ZA 3ECOA 3OYKA 1PDNC 3ABTA 3DTIA 3ONQA 4PCQA 1BJZA 1ZQ3P 4UUVA 2IEKA 2A6EF 3GFMA 2GQQA 5CQGA 3V42A 1B9MA 1IV8A 4BKXA 3GWZA 1FP1D 4BQOA 3CCRI 3G6EI 3OSGA 2KL4A 3OYMA 2K40A 4E70A 5CVIA 5TGTA 2D2WA 1G3TA 3RPUA 4GO1A 3J81K 1DPUA 4OINF 2AS5F 3I71A 3J7AY 4HNVA 1IV6A 3F6OA 5FFZA 1ZREA 3PO3J 2B0LA 4GYIA 5F0FA 5D5XB 1GDTA 2R0QC 4BDYA 3H0GJ 3I4NJ 3N05A 4P9UA 4Y13A 1HCRA 3WTUC 2W25A 4HBLA 2R7OA 3ZOBA 2E1CA 4IHXA 3L9FA 4HZFA 2DQRA 2M45A 2HPIA 2CQ7A 3RPUD 2NNYA 3OIPA 1B59A 1UHMA 4A69C 2ZC2A 4HW0A 2VQCA 1ZR4A 4PK4A 3RJPA 2OC6A 3O3KA 1K83J 3L1PA 2ZFUA 3HRMA 3A03A 4M6VA 2R7ZJ 4PFPA 1MMDA 2K9QA 5BOXA 2F4OB 1V5FA 3HOTA 1P7JA 1D1CA 3Q9SA 2AQEA 4BQQA 2BOLA 4WX9A 1YE9A 2FOKA 3WTTC 3CCEI 4WWCA 2ZB9A 1O4XA 1Z3YA 2CRGA 4HRIA 2QENA 3CMMA 2JA2A 4GYGA 1N77A 3SDGA 4A3KJ 1VQ5I 3GZ5A 2WV1A 4MFDA 5DV5A 1JUSA 3QPHA 4Q4ZF 2M7AA 1X2MA 2KRCA 2WA0A 4G8XA 3NRVA 1J5YA 4KT5C 3W2WA 3L00A 1TNTA 4BU2A 1KONA 4IX7A 2NVTJ 5D5VB 2WAQN 1DP7P 4UV8A 3S14J 3TO6A 1LEAA 1P4XA 1HKTA 2OZUA 3DKWA 3S1RJ 1I6HJ 2WC2A 1ACIA 3PQKA 3JRBA 1NG7A 3HKZN 1SVLA 3KEYA 4JX5A 5FKNA 5CQEA 4JQFA 2VKHA 2OTJI 2VONA 4A3BJ 1GLNA 3BR2A 1EKEA 3PNVA 2ME6A 2V9KA 1UZCA 1TNSA 3LA7A 3KYDB 1IUFA 4IHWA 1MH3A 1HDPA 1JGGA 2AXLA 4I76A 3KYLA 5FRNA 2CV1A 5F64A 3HHHA 4XQFA 1H0MA 4QPOA 5DCMB 5FB2A 3HOWJ 4RA2A 5HLTA 1MNEA 2LKSA 2RNGA 1KU7A 4IRIA 2K27A 1OR7C 1JE8A 3PSIA 3TL4X 4HV5A 2ACJA 3F21A 3ZN1A 2LRDA 1T39A 2CU7A 4HX4A 3IH4A 1IZ1A 4MTEA 3S17J 4HF0A 4BL0B 1VQKI 4HF2A 1USSA 2EIJH 2OBPA 1R5GA 3H35A 2CQNA 2VQLA 4Z6YA 3P9KA 3FIWA 1QU3A 3Q0WA 2F6CA 1HSJA 1KA8A 3VYTB 3ULQB 4EJWA 1Y56A 4AC0A 4C3IJ 1R49A 2DXIA 2H6BA 2P0WA 1GVDA 5LHGA 5E18F 1S7EA 3KFWX 1MBGA 4ITVA 5JVGF 2JA7J 2MBFA 1AHDP 1SD5A 5M5YJ 4ZZDA 2GIVA 3K1PA 3BCBA 4H4KC 1UG2A 3OYDA 4G7OF 5L3EA 4LB5A 3V4GA 2QUFA 4FHTA 4M3BA 2QCOA 1YJ9I 1XG1A 4WXCA 2R3SA 3QOPA 2L7FP 1ITYA 2JZYA 2BZTA 4BEHA 1A35A 4ON0A 1W0UA 1V54H 1Z7LA 1QVTA 3PFIA 3L2QA 2KIMA 3I0TA 5DCMA 5J4VA 1S6LA 1ERDA 1Q1HA 2A6TA 1RUNA 1G6NA 4LFUA 2B7EA 2DA4A 3O8HA 3ECHA 1WWXA 4KIBA 3AL0C 2DA1A 1BI1A 5A2QK 2QGUA 2GA2A 4A3IJ 2CSOA 2NS0A 4B09A 3CCMI 4XM3A 1OCCH 2A69F 3ZQ7A 2L3DA 2IW5A 3FKIJ 5D8KB 2ICWG 4DQ2A 5AIPA 2A07F 2MH9A 3MKLA 1K4SA 1MMAA 1WFXA 1QPIA 4NC6A 3K6GA 2PX9A 1PP7U 1IGNA 4BHCA 2R7DA 1T56A 1PYVA 4AIHA 1VZ0A 3RIRA 3FWEA 2GM4A 3CC4I 3NAUA 1VQLI 4DZPA 4XONA 1R9TJ 4ZYDA 3OS2A 5LHIA 3RZDJ 2KKOA 3CF2A 2K5CA 5ILVA 4ZZLA 2X1CA 1OR7A 2LP0A 4UUTA 2L2OA 3SYTA 1RKWA 2EIKH 4DYCA 3FKJA 4CO8A 5D4SA 1A6IA 2DJIA 4IRHA 1WI9A 4F55A 4OIRF 1X2NA 5KK1A 1FYLA 2RQQA 1TL8A 4YELA 4XKCA 1RR7A 2N8GA 2EILH 1UFMA 1D0YA 1MJ9A 5K5RA 4FX0A 1HSTA 4M73A 1S3JA 2M1BA 3TGNA 4HOBA 3CESA 4XK4A 2VBXA 2DTZA 3I56I 2AO9A 1UAAA 3M4OJ 2M7BA 2RKHA 5LRSA 2DA3A 2K9SA 4HF1A 2XIGA 2W48A 1V5EA 3TO7A 1PUFB 2IXSA 5E1WA 2E34A 1R6RA 4XRMA 1YX5A 1TWCJ 4LG3A 4OIOF 4M72A 4EM0B 5E17F 1U6GA 3NQOA 2FOWA 4M9SA 2DFEA 4XNFA 2O8KA 3MKWB 4GFBA 1XMAA 4E7HA 5IP7J 3VWBA 4UVCA 3BROA 2HEOA 3OIOA 4IF4A 3QPTA 3QPSA 4PGHA 2PMZN 3ZR8X 1P7IA 2WBMA 5C3EJ 1MDMB 1ZRCA 1BBYA 2DT7B 3RQ4A 1R58A 1FBSA 3EDPA 2PJRB 2NVUB 3VYSB 4A3GJ 2MYSA 2GXAA 1FTTA 2HXIA 1B1BA 4EM2A 4KISA 4XN0A 4CH7A 1UB9A 3TDZC 3VDXA 2E35A 3GVAA 2W57A 1ETVA 1EV7A 1OCPA 2ZNYA 2PLYA 2VPLA 3MAJA 2Z9OA 5K7ZA 2NRAC 1K4TA 3TEDA 2BXZA 3WTZA 2OU2A 2Y0SA 4HEA2 3ABUA 3EQLF 5E79C 2XB0X 3COAC 2CUEA 1D1AA 5GPCA 5LEJA 1J9IA 3WTVC 4YRVA 1WJ5A 3QP6A 1W5TA 4GCVA 4Y17A 2L9VA 1VI0A 1XGOA 2GOMA 1PUFA 2QQBA 1Z05A 4Y15A 2ZBKA 1ZGJA 3SZTA 3FX3A 5FKKA 2LOOA 2ZMEC 5HLGA 5E3LA 2M8GX 2JJ7A 2HOAA 2ISYA 5DS9A 5F27A 1OCTC 3QYFA 3KPHA 1SMYF 5J3LA 5IT9Z 1Y0NA 1GT0C 4L9NA 4GGGA 5E8IA 2JT1A 3HEFA 2FE3A 2L9SA 4Y3OA 2HDCA 5B66C 5J6XA 5HLHA 2QF7A 4BXXJ 1VTNC 3HRSA 1QGPA 1RUOA 2VKVA 3MZ8A 1UG0A 4B1RA 5JHFA 5LEKA 1MDMA 4ZYEA 1LPQA 1XSDA 3ASNH 2DLLA 2LH9A 5HDKA 3HG9A 5GAGJ 2PJRA 2E5ZA 2R7TA 3V7RA 3FXMA 1X19A 4BJ5C 3DQVC 1Q1VA 3FXKA 4BBSJ 3BWGA 4V2FA 4EV0A 4DIQA 2RGVA 3DU6A 1U5TC 2P5VA 4LIUA 2KJCA 1E17A 5FKOA 2COBA 2CQQA 1VFCA 1JUMA 2FQ3A 2NAZA 4F92B 1PJRA 3AG3H 4IO9F 4BHPA 2E2HJ 1T8IA 2XPVA 1FEXA 4ENNA 4BBRJ 1J09A 5LFAA 2VN2A 3BC8A 3HPGA 2GAUA 1LEBA 1ETXA 1MMGA 2FBIA 5CVUA 5FFXA 2VBWA 1VNDA 3UR3C 2V26A 1H9TA 3K7AJ 1WI3A 4IHYA 1ON2A 1OCRH 1YIOA 1ODDA 5GAHJ 2K9LA 1SD4A 2EBIA 2EZLA 4O6JA 1OLTA 2G0EA 3DPTA 1MKMA 3ZMUA 4UB8C 2PJPA 3VEPA 5FJ8J 4MEXF 2GXBA 5J47A 1PVEA 2VE8A 4U87A 2ME0A 4QIWN 5JVTA 3OOPA 4NC7A 3CO6C 2XPUA 2FSWA 4DW6A 1YYVA 2JWTA 3E6BA 4RAYA 1U5TB 5EYRA 1RKTA 3ERED 3LOCA 4Y4RA 3S3OA 3H0DA 2X9DA 3E1SA 5D5UB 3ZMTA 3S1QJ 1O3SA 3ROUA 4JX6A 2CQXA 3DPLC 2DA5A 3PO2J 2IBDA 2X4HA 5J8CA 3L2VA 2I8DA 3BR3A 1J7KA 3HTSB 3DKYA 3DF8A 1JT6A 2DMNA 2M2EA 3V8JA 3E6DA 2XGCA 3R60A 1BJAA 5GADJ 1Z77A 5EZGA 3GW2A 1D0XA 4I0BA 4L9VA 4IQJA 2L9RA 3DLLF 1XX5A 2VOPA 2JUGA 2V4JC 2IGKA 4Q48A 5B1BH 2D45A 2YSRA 3S1NJ 2P81A 5HOOA 3HHGA 1BN5A 1LQ1A 4I6ZA 2X6OA 3K1MA 4LD5A 3CMAI 1SFUA 1SAXA 3OV8A 1VQ6I 3S2HJ 4A3LJ 3MMYB 3JRIA 3CCYA 2X6XA 4B8XA 2F2EA 3E5UA 2O9LA 3GLLA 2HVSA 4AVPA 2LR8A 1UHWA 4FE4A 2CV2A 3DEWA 1SEUA 3BG5A 3LFKA 5H6RA 3WG7H 3K4NA 2HU9A 2VC1A 1ZR2A 3MWMA 4M3DA 3FMQA 4AIJA 2R92J 1FSHA 1QZEA 3PUBA 2BGCA 5M3MJ 2ZXHA 2B9SA 1QBJA 2B63J 3KYCB 3RTRA 1RIOH 3X2QH 1G3SA 4RB0A 1ZARA 1U5TA 4RB3C 4XRFA 3REOA 4HNUA 4HPQA 3VOEA 4CA0A 3CCQI 3W6KB 1TW3A 4XLCA 3CJQB 3H1CA 3ISPA 1YW7A 3BQYA 4I0AA 5AONA 3GX4X 3CMYA 2Y9ZA 1T2KA 1ETYA 2HTSA 1DQUA 2XVCA 1HBXG 4L9JA 1MNDA 2QYOA 1LFUP 2LKXA 2YX4A 3LL7A 1GV5A 1BR1A 4B4CA 3LWFA 1YRNB 1XCBA 3M07A 5LGNA 3L2CA 3WE2A 2HI3A 1Z67A 3H92A 2DPDA 3ZN0A 1P6RA 5B1AH 3BG7A 1TQPA 2IAIA 1DDNA 1YX3A 3CMEI 2IS2A 1P92A 2A05A 2L0KA 1I39A 4E7KA 4CCLA 4U0VA 3GEZA 5K5QA 3OS1A 2WAFA 3K9TA 1XS9A 3JREA 5IP9J 3JSPA 1JTYA 3HZJA 2KT0A 1MBEA 4PFOA 1UMQA 4L0YB 4XRSG 2PMUA 4MHGA 2MD0A 1ETKA 1JHHA 1TWHJ 5F0CA 4ZYHA 3SZPA 2EV6A 4HYEA 3SZGA 2FU4A 4M3EA 1ULYA 3TKYA 2HPMA 4RGUA 3JW4A 4AYBN 4L5EA 4EJOA 3N4MA 3KP7A 2EWNA 1DP3A 4J19A 2CQKA 2NS8A 4MQVA 5K1YA 1ZRFA 5H20A 2FNPA 2H09A 5IYBJ 1WQ2A 2WAEA 3CDIA 4W97A 3HUGB 2VBZA 2XRNA 4BNCA 1G3YA 2VC0A 1FY7A 3K0LA 3CQZJ 4CCNA 3HRUA 5GAEJ 3BG6A 3FZVA 2LFBA 4J00A 2FBKA 1OKRA 3BG3A 4DZJA 2KISA 3D5SC 4EJVA 2HQNA 2OAZA 1NK3P 1L0OC 1YRNA 2R5YB 1IXSB 3VSKA 3AFHA 3BDDA 5L3BA 5J4YA 2EFQA 2GIZA 2DJNA 1I1GA 4CYDA 1CQTA 3SEZA 1KZHA 1D5YA 4XBFA 1SVMA 4A3EJ 4L5JA 3I58A 1FTZA 2P6TA 1T08B 1RC9A 1QZZA 2ELHA 4YG2F 3SDBA 1W7PB 2HS5A 1TZLA 3BR1A 2F5DA 1TP4A 4PZJA 2DPUA 3TOAA 2W84A 2E1MC 3OYNA 3LSRA 1R1VA 1X4PA 2EQRA 2PFBA 4DJAA 5GP9A 4D5FA 4FCYA 4LLNA 3E5XA 2M30A 5EDNA 4MGRA 2MD5A 1MW7A 2FMLA 3KEQA 3LA2A 2E5NA 3KP4A 3W2VA 2DODA 3FK7A 4XLAA 2ELKA 4I02A 2M4KA 1WSUA 4PJ0C 3BT9A 3K4KA 2TCTA 5F08A 4LLLA 4UVAA 3HUGA 3G1LA 3T8TA 2ZJQF 2VOOA 4UVBA 3G73A 1U2WA 4G7ZF 4E7IA 3I54A 5ILSA 3HBLA 4MEYF 2PMHA 3QQAA 1OFCX 1LJ9A 2L01A 4I01A 4A3MJ 5DM6F 2R7QA 3DLAA 4CCKA 2R5YA 4FETA 1FBUA 4ANJA 1JKQC 2QQ8A 4MFEA 2M9HA 3DCFA 1YITI 2EV0A 4HDVA 3RSNA 3MZHA 1BC7C 2VASA 2E1MB 5L3FA 2IVMA 3QOEA 1U9OA 1X58A 2E36A 2L5QA 1MZBA 4LOCA 4A6EA 4BS9A 2AXTC 3ABMH 3JRHA 5C4XJ 4U88A 3F8NA 3F8CA 4F91B 3QPLA 1T33A 1W7PA 1WJEA 2QKLB 4JBAA 2NS7A 4FT8A 1YS7A 1HQCA 2HNHA 2RAEA 2Z33A 3HSEA 2UWMA 4OMYA 3F6VA 1YIJI 2FXAA 2DT5A 5DUKA 3JRGA 3ZCOA 4EEFG 1R4MB 2VT2A 1BI0A 4RAGA 4KITB 1SC7A 3DU5A 1KYWA 5J8FA 2X6WA 2V9VA 3CD6I 1LFPA 4AIDA 5FRMA 3C2HA 1OYWA 3NWSA 3S15J 4MIMA 2ZCWA 3J80Z 3GZNB 2FUG2 1YI2I 1W7PD 4HV6A 1Z9CA 2STWA 2L9NA 4AM3A 2XROA 1QA6A 1FOYA 3HOYJ 3KEOA 5KAFC 3ZQFA 2A5YB 2HQAA 2FEZA 2JN6A 4HX8A 4XORA 2W24A 4S0HB 1IN4A 5EGOB 3HDDA 1JGSA 1QZYA 4ENMA 4H0EA 1I50J 3D5RC 2IP2A 3I59B 1YFHA 1U9NA 3LMMA 3R4KA 4FASD 4G7HF 4BEHB 1G8XA 3H9GA 2D5VA 2KDZA 2K9MA 1QPMA 1S5LC 1Y1VJ 3BJAA 4QLCU 5FKLA 3ZMZA 3K69A 2JMWA 3C2GA 2DOFA 2HWVA 3GTMJ 2H8WA 1TWAJ 3QODA 3G4SI 3KZZA 4KA4A 3A01B 1I27A 4RDUA 3J81Z 3MEXA 4UY8I 1SFOJ 5DTDA 4KFCA 1J0RA 4CCOA 2X48A 1FP2A 2XAFA 2A61A 4E4HA 1HW2A 4RLQA 1FSEA 3W6VA 2V1DA 5IOYA 3GTQJ 3KP3A 1Z3XA 4BQAA 2W7NA 3CJRB 3CCVI 2YX7A 4GDFA 1BR2A 1SFXA 2RNJA 4RAZA 1O3TA 2GLOA 3BOQA 3TO9A 3WHCA 1ZGWA 4ZDLA 2DO7A 4BACA 2HTJA 3RI4A 3ZMDA 2EFNA 3ZQIA 2X85A 2CWEA 1L3LA 2W82A 4S04A 4HLXA 1A5JA 5GPAA 3FXOA 5M5XJ 3F3XA 4JK1X 5EGOA 1SANA 2LVSA 4RM3A 3I59A 1YQAA 4BYYA 1A04A 2V9PA 2DMPA 3Q0VA 3TDUC 4BJ6C 4AUXA 1FX7A 4N4OB 5IP6A 3QRFF 1XCVA 3BR6A 1V5GA 3DXJF 3U9GA 3W2AA 3SXYA 3AAFA 4EATA 3WU2C 2WTEA 2XC7A 2XAJA 1JKRC 1ZELA 4QWQA 3CCSI 3WU1B 3A01A 2X1DA 2GWRA 2DAOA 2M87A 3I9V2 4EJTA 5DYMA 3IHUA 4XIDA 4IOAF 3PL8A 4LMYA 3K70C 1XDUA 4X1EA 1QRYA 4EVIA 4LK0F 2HZDA 2K3PA 3ZQLA 4BGDA 2M4GA 1OCZH 3DBRB 2WY7Q 4JP0A 1HDDC 2F5EA 4O5VA 4RGRA 4XLHA 3H5RA 3OIQA 3GMEA 4A6DA 1FWZA 3HSRA 3C18A 2ZSIB 3MKYB 2DA2A 3FM3A 2L7MP 4YFXF 3JRFA 3VPRA 3FDYA 3KE2A 4JOMA 1OQYA 4EJUA 2R93J 1S7AA 1IW7F 2OV7A 3BLYA 4I99C 2JUCA 5FLMJ 2Y48A 3OWTA 2GOXB 3FISA 2HZTA 2HVQA 4HSTA 4DNCA 4II3A 3CZ6A 2XSJC 2HOEA 1H8AC 3SFIA 5ED4A 2BVMA 4WXHA 1G59A 5F1JA 3HOZJ 3EETA 1ON1A 3SHFA 1N75A 2HDWA 1RESA 1X3UA 3BY6A 3RDIA 1Z21A 4G6TB 5TISC 1ZAOA 3AG4H 1Z1DA 1MBKA 2PG4A 2EZKA 2XHKA 3EUHC 4M6XA 2EH3A 5IOZA 4Z2YA 3CCUI 1JTXA 4ZJZA 2VB6A 1W36C 2BYVE 4JX4A 4B48A 2XAQA 4Y33A 4U7BA 2VL8A 3A02A 4IQ4A 1JKOC 5H2FC 2E1OA 2M3AA 4CYCB 2H1LA 4E6KG 2G7UA 3JAMK 1HF0A 3FXJA 4EGYA 1D1BA 2JA8J 4PSWA 5C44J 2YU3A 2DK8A 2LREA 4HA8A 1TQMA 2JK3A 2FA5A 2L54A 3W3CA 4MLOA 3DTEA 3JTGA 2LY2A 3CCJI 2HKXA 4KYWA 4IL6C 4AU7A 3WTYC 2OTLI 4GXOA 3RYRA 2XKPA 2HQ5A 3BZKA 5EEGA 3E97A 4FTHA 1ORKA 4UHTA 2OCCH 3DBLB 5F0HA 2DFHA 1B72B 1X3WB 3LQRA 1BOBA 2WV0A 3ML6A 3NWTA 4IRGA 1W1WE 3S3NA 1VQ7I 1LDKB 4R8HA 3D1NI 4QPQA 1PP8F 1YW9A 3SJMA 2ZFWA 1I3QJ 4DOZA 1SD6A 3C7JA 1XMXA 4R1HA 4YIRX 3LNQA 1R36A 3FHNA 1F5TA 1I3AA 3CTAA 2MABA 3DTKA 3RPQA 4ETSA 4L18B 2JTVA 3HSFA 1VQMI 2KQRA 2IS6A 2BBYA 4IHSA 1TLHB 3WTSC 3BZ6A 4EMSA 2UV1A 4E7LA 3PFYA 4XLNF 3C3WA 5A2QZ 1HOMA 2W4SA 1TTYA 2NVQJ 3TMOA 2G9WA 2JVGA 3ESWB 3RKXA 3WGGA 2NYXA 2XV4S 5DCFA 3A0HC 2F5FA 4CYCA 3WHBA 3LAPA 4CXFA 2P4WA 3EUAA 2E71A 3GF2A 4B44A 1N78A 3K70D 3IWZA 2JPCA 5HS7A 2ADUA 2E1NA 1S9HA 1S7OA 5FD6A 1CGPA 5KAIC 2EZHA 1O57A 3F8FA 3M1CA 5D4RA 2BY2A 1F4KA 2L02A 2DMUA 2OPTA 2YUSA 1JKPC 3IAS2 1HKQA 3LSTA 2L7KA 1K7AA 4KMFA 1B72A 1MMNA 1BOAA 3J7YJ 1D8JA 2R7UA 2KJBA 3OY9A 3D5LA 3UKGA 4BJTA 4XMYA 2IGNA 3CDHA 3LSHA 3IUOA 1YJWI 1H89C 3GO5A 3IH2A 2UZKA 1D8KA 3H3UA 4ZDOA 3EUHA 2Q8KA 1EA3A 1B4AA 4LG0B 1NH3A 3HJEA 4GRIA 1WJFA 2E60A 4AYBA 1BW6A 1TC3C 2PEXA 2QWWA 5FKMA 2VODA 5GTIC 1IG7A 3W6JB 4C2TA 2FJ1A 4B43A 3EYYA 3ZXSA 2GXGA 2P5LC 4RAFA 4MTDA 3MKZA 2W00A 2DDAA 3LFUA 4NDLA 4DGWB 2V6CA 3AG1H 1ZLKA 1S72I 2DI3A 2H1KA 3F8MA 1QQIA 3O2PE 2DA6A 5ICEA 5CPRB 2O3FA 4NB5A 2IRFG 3RCOA 3OYGA 2E7XA 2XPWA 1IF1A 1IN7A 4XSXF 2X1EA 4HQMA 1W36D 4ZC3A 1U8BA 4A3FJ 2A6HF 5M3FJ 4CCMA 3G71I 2LF7A 1BIAA 5EEHA 3S32A 3H9JA 3CP2A 4PDKA 1VQ8I 1V4RA 1R23A 3M3YJ 3CJNA 2IT0A 3PIPF 2DOEA 1LVKA 3A0BC 3I55I 3T0YA 5DM7F 3Q0UA 3CUQC 4OAYA 4CZCA 3GUDA 4HNTA 2DFIA 2R4GA 2VJJA 1EH6A 2HYFA 2W85A 3SQNA 1R1UA 4LG0A 1W5SA 5KNLA 3CDLA 2KP6A 2DYRH 3I53A 1ZGAA 3U1DA 1FNNA 4KMUX 4M74A 4G12A 1MGTA 3TW6A 2CMPA 4IPAA 1OYYA 3KLOA 1GUUA 3A4CA 2CJJA 3HGYA 4C2MJ 2XAGA 3S2WA 1ZKGA 4WCGA 2KRFA 5HLIA 5FLXK 3GLXA 3TOBA 3CJTB 6PAXA 2DU9A 3OL4A 2OA4A 2XAHA 1ZK8A 2C6YA 4M3GA 2CO5A 2M8EA 4ABZA 2EZIA 4HG2A 1I1SA 3S93A 4XLFA 1UHSA 3S3MA 3HYIA 2VJ4A 1JXSA 4A12A 2V6EA 4C3HJ 1NK2P 1ZLJA 2D1VA 3OYBA 4F93B 3CUQB 1OMIA 2XGXA 3R6SA 4AVZA 3TQNA 3Q3SA 5B3SH 3OYJA 1IRFA 1WRJA 2AQFA 2QZ8A 1JT0A 5BMZA 1XMKA 1MJAA 4U0WA 4BE1A 3QP5A 4RB2C 4L9TA 4A0YA 1IRZA 3IL2A 1QHGA 5HNFA 2PBIA 2I10A 2QSGX 4PJLA 2FD5A 1R00A 1WJBA 4IHVA 1P4WA 1DUXC 2KFDA 1A6QA 1UJ8A 2QBYB 4HQEA 1LVAA 1RETA 2CGPA 1TQIA 2K3FA 3B6CA 2RDPA 1E3PA 3JSOA 4LITA 3IP4B 2X51A 2EPFA 5F04A 3K4JA 1K6OA 3ZQHA 3GTLJ 2LDUA 1FIAA 2WAQA 3BCAA 2YU9J 4BHBA 3LSMA 2K4BA 4A3DJ 2JPBA 3ASOH 1VQ9I 2DW4A 1GXPA 2EFWA 4DYRA 4RLFA 3TP0A 3HKZA 1P4AA 3ZPLA 5F1RA 3MFKA 1GHCA 1BC8C 2UXXA 5LGTA 1F36A 4N4NB 1TT5B 1WPKA 4F3QA 3I64A 2K4JA 1BM9A 2XB5A 1RI7A 1E2XA 4YFKF 3S16J 2MG4A 2V1NA 3UNGC 4DYQA 4E7SA 2QQAA 4NNJA 2VJIA 1RPWA 2CH0A 4V2GA 3BTIA 3CUQA 1VQNI 4LB6B 4C3JJ 2WADA 1NG6A 4KT6A 2PQ8A 3I5UA 1EH8A 3OYCA 2ID3A 3QWLA 5CJ9A 1M1EB 3L2UA 2Y2ZA 3M8JA 4ZDPA 4OAZA 3QU6A 5IY5H 4FQGA 2IA2A 3BP8A 3L7WA 5K5OA 1O7LA 5ILUA 4UXNA 2QSHX 1ZG5A 2XGDA 1A31A 2QBYA 2ID6A 3LSJA 4XLPF 1Y1WJ 3BG9A 2VIXA 5K7FA 3WTXC 2LNBA 4ZTJA 4I2OA 4ZH4F 5EZHA 2A5WA 1T38A 2E7WA 2M34A 3DWLE 1ETQA 4II2A 1XB4A 5JLWA 1MH4A 3S8PA 3F22A 1VQPI 1E3HA 2BHZA 2VBYA 2KZVA 4HLYA 4RMNA 1U3EM 3KZIC 1Y8RB 1JI8A 2OQRA 2V1UA 3MD2A 4RS8A 1OISA 4M3FA 2RV8A 4RB1A 2ISZA 3KX2A 2K85A 3HL2A 2P5KA 4UNOA 2EK5A 2HFHA 3TW7A 1QHHD 2ZJ2A 3JRDA 1HXDA 4KIGA 1W4MA 4WK8F 3KETA 4EQQA 4OOIA 3MN2A 1JJ6C 4AIKA 2L4MA 3M8EA 1FBQA 3MVPA 2HKOA 4KJZA 5C4JJ 3DV8A 3CC2I 2DYSH 1DU0A 1X1BA 2JVHA 3HOXJ 4Q5SF 2Y9YA 2RVCA 3K2AA 1S8NA 3I4MJ 5HDNA 3K4MA 1IAWA 1HW1A 2V79A 1MBHA 2WWYA 4G9YA 2YS9A 3DPUA 4N9HA 3G1MA 4G94A 4XLEA 5BQTA 1GVJA 4G6DA 2Z99A 2H27A 2OF7A 2LK2A 3OR2C 2R7RA 4ZTFA 2CV0A 1K79A 1FLIA 1XSVA 4W1UA 4ESBA 5HVQC 3OSFA 5J1RA 2JRMA 1RNLA 3VODA 1HC8A 2FF4A 3FXLA 3IWFA 4FISA 4M9ZA 2F5VA 1YJNI 3FM5A 2VLAA 3BZCA 2LKPA 5D6FA 1AU7A 5E1XA 1IN8A 3HXLA 3WODF 2A3SA 1YG2A 1WKMA 3U21A 3WG9A 1O3RA 2MLGA 4BQNA 1XGNA 2F5CA 1BI3A 2VXDA 5J40A 1GV2A 5KVRA 3CC7I 3CUOA 4V19K 1F9NA 3ZQQA 2JSPA 3BJOA 3PJRA 4A5MA 1KYZA 2BVLA 2WB1N 5TJJA 1O3QA 1TW2A 4M9XA 3FXUA 3U2RA 1B6AA 2NOJB 2XKOA 2ZXIA 4IKFA 3O8GA 2DN0A 1VF9A 3V7CA 2LMDA 1WJDA 3J7ZI 2QSFX 1UELB 2EB7A 2EFOA 2J5OA 4KUMA 3P5JA 1IN6A 3IH3A 4IOCF 1P9QC 3OR1C 2EFPA 3FMSA 3O6BB 4Q47A 4CZZA 4BY1J 3KP2A 1KQ9A 1DGRM 1MSEC 1V3FA 1Z6TA 4YIIA 1J59A 1KGSA 2LTPA 3T8RA 2VUMJ 2JSCA 5HDGA 2M0MA 1WCMJ 4U0YA 3CO7C 2BXYA 1IXRC 3ZMSA 3H9QA 2XUBA 4LJZF 2DFFA 3T1BA 1TBXA 2FQ4A 2G7HA 3MCZA 4AWXB 4PJMA 3JTHA 1I6XA 5DD8A 5CYVA 3Q5FA 2UXNA 3WU0A 5FLVA 2HGCA 2VKDA 5K7HA 4QTRA 4A2UA 3RQIA 2LG4A 3A2KA 2DCEA 1G4DA 1IN5A 3VYUB 2VPRA 2Y69H 4NC8A 2CUFA 1LE8B 3OMYA 1Z6RA 3HPHA 4XOPA 3BJ6A 1WVRA 2DMTA 1FYMA 5ICGA 5JR3A 3S1MJ 1YO5C 2DA7A 4KNYA 1SVOA 5M5WJ 1ZG3A 5GTHC 5JI6A 4XR6A 3OYHA 4Y7NJ 3VSLA 2E2JJ 3KCCA 1MBFA 2X6YA 1AWCA 5E8GA 1MSFC 5CVJA 1U8RA 1E0EA 3F72A 2L4AA 3FBIB 1K78B 5DEQA 2BEOA 4WF2A 1BW5A 2PMZA 3KLNA 1T0FA 3HGGA 5BS6A 2GA1A 3FHZA 2CS3A 1MBJA 3DEEA 4LLGF 4BY7J 1H9GA 3N97A 3H5NA 1WZ2A 2VE9A 1FOKA 3RKWA 3E5QA 3VB2A 3JCUC 2LD5A 3GFIA 1O7FA 4P9FA 1IC8A 4HSRA 1R5ID 1IJWC 2P7VB 4ASNA 4L0ZB 3FMRA 2R7XA 3D0SA 2ECBA 2E2IJ 2DOAA 1Z7UA 2Y30A 2LLKA 1OYIA 4NUBA 2F4IA 2IA0A 1P2FA 3KP6A 4KDPA 3CF5F 5LBQA 2COMA 5J1YA 3T5XA 5E3OA 3SEQA 1USTA 5LHHA 5IT3A 2Z3YA 3BR0A 2P7CB 2OQGA 1LE8A 4BH9A 1IXCA 3MQ0A 1EJ9A 4I09A 5BPIA 5CVVA 2J5PA 3IKVA 1KQ8A 3K10A 3WGHA 4ENKA 2KRHA 4UB6C 3WTWC 1PUEE 2BY3A 3SFZA 4BAYA 4O3MA 1BA5A 2IGOA 2O0YA 1K78A 2CW8A 1Z91A 2IS4A 2MC4A 2CG4A 4BUPA 4DBRA 2BE5F 3CCLI 4CSWA 1HW5A 5CVRA 4XRSA 2D1HA 4RM2A 1BI2A 3H5AA 1SFKA 4IVNA 2QVOA 3R61A 1LDJA 3RYPA 3QYBA 4PSXA 1MIJA 3K2ZA 3NEUA 1MNMC 4PJNA 3ELKA 2MA3A 3JRAA 1ONVA 2KZGA 1POGA 1X1PA 4X6AJ 1FOXA 2HXOA 1MJBA 3GTKJ 3QU3A 1K61A 1FJLA 2CUZA 1R22A 2NVYJ 4CUGA 5EEAA 1IUYA 5E20A 2RREA 1HA8A 3GCMA 3LSPA 1YTYA 4LIVA 2Y75A 3ABLH 2CUJA 3DP7A 2EA2A 2KIFA 2OJED 2HR3A 4D0PA 4NQWB 5HNHA 2XRLA 2EJRA 4PUSA 5E3NA 1QVUA 2LC2A 2PN6A 4B47A 3HC7A 2QEXI 1Z0XA 1KU3A 4F52A 5B5EC 5D8LB 4C2UA 4P96A 2OD5A 2V1XA 3GTGJ 4PGGA 2KIUA 5IT9K 4XICA 3TBIA 3PNYA 3K4CA 4XOTA 3ZP5A 2TRTA 1KU9A 4A5NA 2CFOA 3LQQA 1Y0UA 4YEJA 1D3YA 4A0XA 1I5ZA 3E3VA 3P9CA 4A3CJ 1MD0A 2CW7A 2STTA 4M6YA 2VI6A 1YLFA 1BR4A 1RR8C 2LF8A 2QLZA 2GZWA 1OJLA 3DEUA 3IRRA 3RKYA 3AL0B 3PUFA 3HB9A 5ICFA
chains in the Genus database with same CATH topology
2P8TA 1ZYRF 2CW0F 5FGMA 4CICA 3F23A 2LSOA 1XD7A 3DFGA 2O61A 5TRDA 4TV7A 3G3ZA 3L09A 1FC3A 4ENJA 1SMTA 2H94A 2RC4A 1DPRA 4BXUA 1T98A 1ZG1A 3PQJA 4IJAA 5D5WB 4NQWA 3M8FA 1BIBA 5AIQA 4IHTA 4YFNF 3J7AO 3E6CC 4I7HA 4LK1F 3GYHX 2YR2A 2ZKZA 3HRTA 1C0WA 5L3DA 5E1ZB 3M1EA 2R7FA 4KN4X 1RZ4A 1XGSA 4RGSA 3P9IA 1KQ0A 3K1NA 3P7NA 5DUIA 2IA1A 4F7ZA 1LB2A 2MLKA 2CFXA 2VXZA 5HS8A 4OU0A 1R5HA 2ZO4A 1B9NA 1QO0D 4EGZA 1S29A 3FF5A 2FNAA 2K7LA 1ZH5A 2ESHA 2MC3A 2O6GE 1UCRA 1KU2A 2JRTA 1OPCA 1XSXA 5DDGA 3IKTA 2Y0MA 3B02A 3E6MA 2DK5A 2DQLA 5HS9A 5L3GA 4CHUA 3HIFA 1FPQA 3F8BA 1ZHFA 5JHUA 1ZRDA 4G6QA 2CYYA 2FMYA 1SFEA 1XN7A 3R0JA 2ZXJA 5FD5A 4S05A 1QNTA 3JAMZ 3M9AA 1IRGA 2BV6A 2PI0A 2XASA 3HOSA 1LDDA 2QM3A 3IC7A 2ZMEB 1FZPB 3R0AA 4P55A 1FT9A 3QAHA 2IPQX 2EA4A 2MH2A 5LRRA 4HDUA 2ETHA 4XSZF 4FX4A 2RQPA 4MNUA 2Q0OA 4OIQF 2DBBA 2OZ6A 3KP5A 4MQ9F 1F1ZA 1FYKA 1STZA 2K02A 4KN7X 3HTUA 4HX7A 2K86A 3FXQA 5H6QA 2NNNA 1XDSA 1ZN2A 1T6SA 3B73A 5ICCA 1U78A 5JFRA 4P5OA 4WXDA 2YPRA 2FBHA 2QQ9A 3GFJA 2ZMEA 1AOYA 3KZYA 2ESNA 1CF7B 3LAJA 5L3CA 4U7DA 5BPDA 4AD9A 1G3WA 3LA3A 4UV9A 3FXRA 4YIFA 4I98B 3MZYA 5LGUA 1YS6A 3GFLA 1GXQA 2P6SA 1R7JA 3EYIA 4IXAA 4KICA 1SD7A 5CLSA 4KIFA 5FO5A 2EV5A 3C1DA 1NHAA 3IRQA 1XGMA 3VFZA 4CDGA 4K2EA 2ZNZA 4OIPF 2Z5UA 3WE3A 4NHJA 4ESJA 2HQRA 3I4PA 4ESFA 4L5IA 2TDXA 4N0BA 4ZYGA 2HYGD 3Q9VA 1CF7A 4CGZA 3GXOA 1REPC 2M5WA 3V8KA 1JHFA 5D6EA 4RGXA 4N9IA 5ERIA 3WGIA 3BPVA 1EH7A 1YW8A 2DTRA 4HAMA 2O03A 5DD4A 2VT3A 4LGWA 4A0ZA 1R1TA 2IJLA 2O8XA 3GZ6A 2Q2EA 1J75A 1D5VA 5FLXZ 5LLQA 4R79A 4M71A 5F6FA 2FRHA 3J80K 4EM1A 1J2XA 4OMZA 3V7SA 3V8LA 2RN7A 1LNWA 3H3ZA 3ZMVA 2A68F 3BPXA 2H6CA 1HKSA 2X0LA 3CLOA 3M7GA 3ECOA 1PDNC 3ABTA 4PCQA 4UUVA 2A6EF 3GFMA 2GQQA 1B9MA 3GWZA 1FP1D 4E70A 5CVIA 2D2WA 1G3TA 3RPUA 4GO1A 3J81K 1DPUA 4OINF 2AS5F 3I71A 3F6OA 5FFZA 1ZREA 2B0LA 4GYIA 5D5XB 4P9UA 4Y13A 3WTUC 2W25A 4HBLA 2E1CA 3L9FA 4HZFA 2DQRA 2M45A 2NNYA 1B59A 1UHMA 4HW0A 3RJPA 3O3KA 3HRMA 5BOXA 3HOTA 3Q9SA 4WX9A 2FOKA 3WTTC 4WWCA 2QENA 4GYGA 3GZ5A 5DV5A 3QPHA 4Q4ZF 4G8XA 3NRVA 1J5YA 4KT5C 3L00A 1TNTA 5D5VB 1DP7P 4UV8A 3TO6A 1LEAA 1P4XA 1HKTA 2OZUA 3DKWA 2WC2A 3PQKA 4JQFA 2VONA 1TNSA 3LA7A 2AXLA 5F64A 3HHHA 1H0MA 5DCMB 5FB2A 1KU7A 4IRIA 2K27A 1JE8A 4HV5A 2ACJA 3F21A 3ZN1A 1T39A 4HX4A 1IZ1A 4MTEA 4HF0A 4HF2A 1USSA 2OBPA 1R5GA 3P9KA 1HSJA 1KA8A 3ULQB 4EJWA 2H6BA 5LHGA 5E18F 3KFWX 2MBFA 1SD5A 4ZZDA 2GIVA 3K1PA 4G7OF 5L3EA 4LB5A 3V4GA 2QUFA 4FHTA 4WXCA 2R3SA 3QOPA 2JZYA 4ON0A 3PFIA 2KIMA 3I0TA 5DCMA 1S6LA 1Q1HA 1RUNA 1G6NA 4LFUA 3ECHA 1WWXA 4KIBA 1BI1A 5A2QK 2GA2A 2CSOA 2NS0A 4B09A 2A69F 3ZQ7A 2L3DA 2IW5A 5D8KB 4DQ2A 5AIPA 2A07F 2MH9A 1PP7U 4BHCA 2R7DA 4AIHA 3RIRA 3FWEA 4ZYDA 5LHIA 2KKOA 5ILVA 4ZZLA 1OR7A 4CO8A 5D4SA 4IRHA 1WI9A 4OIRF 5KK1A 1FYLA 1UFMA 1MJ9A 5K5RA 4FX0A 1HSTA 4M73A 1S3JA 2M1BA 3TGNA 4HOBA 2VBXA 2RKHA 5LRSA 4HF1A 2XIGA 3TO7A 5E1WA 4OIOF 4M72A 4EM0B 5E17F 1U6GA 3NQOA 4M9SA 1XMAA 4UVCA 3BROA 2HEOA 4IF4A 3QPTA 4PGHA 1MDMB 1ZRCA 1BBYA 1R58A 1FBSA 3EDPA 1B1BA 4EM2A 1UB9A 3TDZC 3GVAA 2W57A 1EV7A 2ZNYA 2PLYA 3MAJA 2Z9OA 2NRAC 3WTZA 2OU2A 3ABUA 3EQLF 3COAC 5LEJA 1J9IA 3WTVC 3QP6A 1W5TA 4GCVA 4Y17A 1XGOA 2QQBA 1Z05A 4Y15A 2ZBKA 1ZGJA 3SZTA 3FX3A 5HLGA 2ISYA 1SMYF 5IT9Z 4L9NA 4GGGA 5E8IA 2JT1A 2FE3A 2HDCA 5J6XA 5HLHA 1VTNC 3HRSA 1QGPA 1RUOA 5LEKA 1MDMA 4ZYEA 1XSDA 2DLLA 5HDKA 3V7RA 3DQVC 3BWGA 4EV0A 2RGVA 1U5TC 2P5VA 2KJCA 1E17A 2NAZA 2FQ3A 4BHPA 4ENNA 2VN2A 2GAUA 1LEBA 2FBIA 5CVUA 5FFXA 2VBWA 1H9TA 1ON2A 1YIOA 1ODDA 1SD4A 4O6JA 3DPTA 1MKMA 3ZMUA 2PJPA 3VEPA 4MEXF 2GXBA 2VE8A 5JVTA 3OOPA 3CO6C 2FSWA 1YYVA 3E6BA 4RAYA 1U5TB 3ERED 5D5UB 3ZMTA 1O3SA 3ROUA 3DPLC 2X4HA 5J8CA 1J7KA 3HTSB 3DF8A 3V8JA 3E6DA 3R60A 1BJAA 3GW2A 4I0BA 4L9VA 2VOPA 4Q48A 2D45A 2YSRA 5HOOA 3HHGA 1BN5A 1LQ1A 3K1MA 4LD5A 1SFUA 1SAXA 3OV8A 4B8XA 2F2EA 3E5UA 4AVPA 1UHWA 5H6RA 3LFKA 2VC1A 3MWMA 3FMQA 4AIJA 1FSHA 2BGCA 1QBJA 3RTRA 1RIOH 1G3SA 4RB0A 1ZARA 1U5TA 4RB3C 4XRFA 3REOA 3VOEA 3W6KB 1TW3A 3ISPA 1YW7A 4I0AA 5AONA 3GX4X 1T2KA 2HTSA 2XVCA 1HBXG 4L9JA 2QYOA 2YX4A 3LWFA 1XCBA 5LGNA 3L2CA 3WE2A 3H92A 2DPDA 3ZN0A 1P6RA 1TQPA 1DDNA 1P92A 4U0VA 3GEZA 5K5QA 3K9TA 3JSPA 4L0YB 2PMUA 4MHGA 1JHHA 4ZYHA 3SZPA 2EV6A 4HYEA 2FU4A 1ULYA 3TKYA 4RGUA 3JW4A 4EJOA 3N4MA 3KP7A 2EWNA 2CQKA 4MQVA 5K1YA 1ZRFA 5H20A 2FNPA 2H09A 1WQ2A 2VBZA 2XRNA 4BNCA 1G3YA 2VC0A 1FY7A 3K0LA 3HRUA 3FZVA 2FBKA 1OKRA 4EJVA 2HQNA 2OAZA 1L0OC 1IXSB 3BDDA 5L3BA 2EFQA 1I1GA 4CYDA 4XBFA 4L5JA 3I58A 2P6TA 1QZZA 2ELHA 4YG2F 1W7PB 2HS5A 2F5DA 4PZJA 2DPUA 3TOAA 2W84A 1R1VA 2PFBA 4LLNA 3E5XA 2M30A 4MGRA 2MD5A 3LA2A 2FMLA 3KEQA 3KP4A 4I02A 1WSUA 4LLLA 4UVAA 3HUGA 3T8TA 2VOOA 4UVBA 3G73A 1U2WA 4G7ZF 3I54A 5ILSA 4MEYF 2PMHA 2L01A 1LJ9A 4I01A 1FBUA 2EV0A 4HDVA 3MZHA 1BC7C 5L3FA 2IVMA 1MZBA 4A6EA 4U88A 3F8NA 3F8CA 1W7PA 4JBAA 4FT8A 1YS7A 1HQCA 2Z33A 3HSEA 2UWMA 4OMYA 3F6VA 2FXAA 2DT5A 5DUKA 2VT2A 1BI0A 1KYWA 5J8FA 2V9VA 1OYWA 2ZCWA 3J80Z 2STWA 1W7PD 4HV6A 1Z9CA 2XROA 3KEOA 2A5YB 2FEZA 4HX8A 2W24A 1IN4A 1JGSA 1QZYA 4ENMA 4H0EA 2IP2A 3I59B 1YFHA 4G7HF 3R4KA 1QPMA 4QLCU 3BJAA 3ZMZA 3K69A 2HWVA 3KZZA 4KA4A 1I27A 3J81Z 3MEXA 4KFCA 1J0RA 1FP2A 2XAFA 2A61A 1HW2A 1FSEA 2V1DA 3KP3A 4BQAA 2YX7A 1SFXA 2RNJA 4RAZA 1O3TA 3BOQA 3TO9A 2DO7A 2HTJA 3RI4A 3ZMDA 2EFNA 2CWEA 1L3LA 4S04A 4HLXA 3F3XA 4JK1X 3I59A 1YQAA 4BYYA 1A04A 3TDUC 1FX7A 3QRFF 1XCVA 3DXJF 3U9GA 3SXYA 3AAFA 2WTEA 2XAJA 4QWQA 3WU1B 2GWRA 2DAOA 2M87A 5DYMA 3IHUA 4LMYA 1XDUA 4EVIA 4LK0F 2F5EA 4O5VA 4RGRA 4A6DA 1FWZA 3HSRA 3C18A 3FM3A 4YFXF 3KE2A 4EJUA 1S7AA 1IW7F 2Y48A 2HZTA 4DNCA 2HOEA 5ED4A 4WXHA 3EETA 1ON1A 3SHFA 1X3UA 3BY6A 3RDIA 1ZAOA 1Z1DA 2PG4A 2XHKA 4M6XA 4Z2YA 2BYVE 2XAQA 4U7BA 2G7UA 3JAMK 4EGYA 2YU3A 2DK8A 4HA8A 1TQMA 2FA5A 2L54A 3JTGA 4KYWA 2HKXA 3WTYC 4GXOA 3RYRA 2XKPA 5EEGA 3E97A 4UHTA 3LQRA 2WV0A 3ML6A 4IRGA 1LDKB 4R8HA 1PP8F 1YW9A 2ZFWA 1SD6A 3C7JA 4R1HA 1R36A 1F5TA 3CTAA 3RPQA 4ETSA 4L18B 2JTVA 3HSFA 2BBYA 4IHSA 1TLHB 3WTSC 3BZ6A 4EMSA 4XLNF 3C3WA 5A2QZ 1TTYA 2G9WA 3RKXA 3WGGA 2NYXA 2XV4S 5DCFA 2F5FA 3LAPA 4CXFA 2P4WA 3GF2A 3IWZA 2JPCA 5HS7A 2ADUA 2E1NA 5FD6A 1S7OA 1CGPA 1O57A 3F8FA 5D4RA 1F4KA 2L02A 1HKQA 3LSTA 1K7AA 4KMFA 1BOAA 1D8JA 2KJBA 3D5LA 3CDHA 3GO5A 2UZKA 1D8KA 3H3UA 3EUHA 2Q8KA 1B4AA 4LG0B 2PEXA 2QWWA 2VODA 3W6JB 3EYYA 2GXGA 2P5LC 4MTDA 2V6CA 1ZLKA 2DI3A 3F8MA 1QQIA 3O2PE 5ICEA 2O3FA 4NB5A 2IRFG 2E7XA 1IF1A 1IN7A 4XSXF 4HQMA 2A6HF 2LF7A 1BIAA 5EEHA 4PDKA 1V4RA 1R23A 3CJNA 2IT0A 3T0YA 3CUQC 3GUDA 2DFIA 3SQNA 1EH6A 2HYFA 2W85A 1R1UA 4LG0A 1W5SA 3I53A 1ZGAA 3U1DA 1FNNA 4KMUX 4M74A 1MGTA 4IPAA 1OYYA 3KLOA 2XAGA 3S2WA 4WCGA 2KRFA 5HLIA 5FLXK 3GLXA 3TOBA 6PAXA 2DU9A 2OA4A 2XAHA 2C6YA 2CO5A 2M8EA 1I1SA 3HYIA 1JXSA 4A12A 1ZLJA 2D1VA 3CUQB 1OMIA 2XGXA 3R6SA 3TQNA 1IRFA 1WRJA 2QZ8A 5BMZA 1XMKA 1MJAA 4U0WA 3QP5A 4RB2C 4L9TA 4A0YA 3IL2A 2PBIA 1R00A 1P4WA 1DUXC 2QBYB 4HQEA 1LVAA 2CGPA 1TQIA 2RDPA 3JSOA 1K6OA 2LDUA 4BHBA 2K4BA 2JPBA 2DW4A 1GXPA 2EFWA 1P4AA 3ZPLA 5F1RA 3MFKA 1GHCA 1BC8C 2UXXA 5LGTA 3I64A 2K4JA 1BM9A 1RI7A 1E2XA 4YFKF 2QQAA 3CUQA 4LB6B 2PQ8A 3I5UA 1EH8A 5CJ9A 3QU6A 2IA2A 3BP8A 3L7WA 5K5OA 1O7LA 5ILUA 4UXNA 1ZG5A 2QBYA 4XLPF 3WTXC 2LNBA 4I2OA 4ZH4F 1T38A 2E7WA 4EJTA 1XB4A 3F22A 2VBYA 1U3EM 4HLYA 2OQRA 2V1UA 4RS8A 2RV8A 4RB1A 2ISZA 2P5KA 4UNOA 2EK5A 2HFHA 2ZJ2A 1HXDA 4KIGA 1W4MA 4WK8F 3KETA 4EQQA 4OOIA 4AIKA 2L4MA 3M8EA 1FBQA 2HKOA 3DV8A 4Q5SF 2RVCA 1S8NA 5HDNA 1IAWA 1HW1A 2V79A 2WWYA 4G9YA 4N9HA 4G94A 5BQTA 1GVJA 4G6DA 2Z99A 2H27A 1K79A 1FLIA 1XSVA 4ESBA 5HVQC 1RNLA 3VODA 2FF4A 3IWFA 4M9ZA 3FM5A 2LKPA 5D6FA 5E1XA 1IN8A 3WODF 2A3SA 1YG2A 1WKMA 1O3RA 3WG9A 2MLGA 1XGNA 2F5CA 1BI3A 5KVRA 3CUOA 1F9NA 3BJOA 4A5MA 1KYZA 5TJJA 1O3QA 1TW2A 4M9XA 3FXUA 3U2RA 1B6AA 2XKOA 3V7CA 2J5OA 2EB7A 2EFOA 4KUMA 1IN6A 2EFPA 3FMSA 3O6BB 4Q47A 4CZZA 3KP2A 1KQ9A 1V3FA 1Z6TA 4YIIA 1J59A 1KGSA 3T8RA 2JSCA 5HDGA 4U0YA 3CO7C 1IXRC 3ZMSA 2XUBA 4LJZF 3T1BA 1TBXA 2G7HA 4AWXB 3MCZA 3JTHA 1I6XA 5DD8A 5CYVA 3Q5FA 2UXNA 3WU0A 2HGCA 4A2UA 1G4DA 1IN5A 1Z6RA 3BJ6A 1FYMA 5ICGA 5JR3A 1YO5C 4KNYA 1ZG3A 5JI6A 3KCCA 1AWCA 5E8GA 5CVJA 1U8RA 3F72A 2L4AA 1K78B 5DEQA 2BEOA 4WF2A 3KLNA 1T0FA 5BS6A 2GA1A 3FHZA 4LLGF 1H9GA 3N97A 2VE9A 1FOKA 3RKWA 3E5QA 3VB2A 3GFIA 1O7FA 4P9FA 2P7VB 4ASNA 4L0ZB 3FMRA 3D0SA 1Z7UA 1OYIA 2IA0A 1P2FA 3KP6A 4KDPA 5LBQA 2COMA 3T5XA 1USTA 5LHHA 5IT3A 2Z3YA 2P7CB 2OQGA 4BH9A 1IXCA 3MQ0A 4I09A 5BPIA 5CVVA 2J5PA 3IKVA 1KQ8A 3WGHA 4ENKA 3WTWC 1PUEE 4BAYA 3SFZA 4O3MA 2O0YA 1K78A 1Z91A 2CG4A 2BE5F 1HW5A 5CVRA 2D1HA 1BI2A 4IVNA 2QVOA 3R61A 1LDJA 3RYPA 3K2ZA 3NEUA 3ELKA 2MA3A 1ONVA 1MJBA 3QU3A 1R22A 1IUYA 5E20A 1YTYA 2Y75A 3DP7A 2EA2A 2KIFA 2HR3A 4D0PA 2EJRA 2PN6A 1KU3A 5D8LB 4P96A 2OD5A 2V1XA 4PGGA 2KIUA 5IT9K 3ZP5A 1KU9A 4A5NA 3LQQA 1Y0UA 1D3YA 4A0XA 1I5ZA 3E3VA 3P9CA 1MD0A 2STTA 4M6YA 1YLFA 2LF8A 2QLZA 2GZWA 3DEUA 3IRRA 3RKYA 5ICFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8T A;  1ZYR F;  2CW0 F;  5FGM A;  4CIC A;  3F23 A;  2LSO A;  1XD7 A;  3DFG A;  2O61 A;  5TRD A;  4TV7 A;  3G3Z A;  3L09 A;  1FC3 A;  4ENJ A;  1SMT A;  2H94 A;  2RC4 A;  1DPR A;  4BXU A;  1T98 A;  1ZG1 A;  3PQJ A;  4IJA A;  5D5W B;  4NQW A;  3M8F A;  1BIB A;  5AIQ A;  4IHT A;  4YFN F;  3J7A O;  3E6C C;  4I7H A;  4LK1 F;  3GYH X;  2YR2 A;  2ZKZ A;  3HRT A;  1C0W A;  5L3D A;  5E1Z B;  3M1E A;  2R7F A;  4KN4 X;  1RZ4 A;  1XGS A;  4RGS A;  3P9I A;  1KQ0 A;  3K1N A;  3P7N A;  5DUI A;  2IA1 A;  4F7Z A;  1LB2 A;  2MLK A;  2CFX A;  2VXZ A;  5HS8 A;  4OU0 A;  1R5H A;  2ZO4 A;  1B9N A;  1QO0 D;  4EGZ A;  1S29 A;  3FF5 A;  2FNA A;  2K7L A;  1ZH5 A;  2ESH A;  2MC3 A;  2O6G E;  1UCR A;  1KU2 A;  2JRT A;  1OPC A;  1XSX A;  5DDG A;  3IKT A;  2Y0M A;  3B02 A;  3E6M A;  2DK5 A;  2DQL A;  5HS9 A;  5L3G A;  4CHU A;  3HIF A;  1FPQ A;  3F8B A;  1ZHF A;  5JHU A;  1ZRD A;  4G6Q A;  2CYY A;  2FMY A;  1SFE A;  1XN7 A;  3R0J A;  2ZXJ A;  5FD5 A;  4S05 A;  1QNT A;  3JAM Z;  3M9A A;  1IRG A;  2BV6 A;  2PI0 A;  2XAS A;  3HOS A;  1LDD A;  2QM3 A;  3IC7 A;  2ZME B;  1FZP B;  3R0A A;  4P55 A;  1FT9 A;  3QAH A;  2IPQ X;  2EA4 A;  2MH2 A;  5LRR A;  4HDU A;  2ETH A;  4XSZ F;  4FX4 A;  2RQP A;  4MNU A;  2Q0O A;  4OIQ F;  2DBB A;  2OZ6 A;  3KP5 A;  4MQ9 F;  1F1Z A;  1FYK A;  1STZ A;  2K02 A;  4KN7 X;  3HTU A;  4HX7 A;  2K86 A;  3FXQ A;  5H6Q A;  2NNN A;  1XDS A;  1ZN2 A;  1T6S A;  3B73 A;  5ICC A;  1U78 A;  5JFR A;  4P5O A;  4WXD A;  2YPR A;  2FBH A;  2QQ9 A;  3GFJ A;  2ZME A;  1AOY A;  3KZY A;  2ESN A;  1CF7 B;  3LAJ A;  5L3C A;  4U7D A;  5BPD A;  4AD9 A;  1G3W A;  3LA3 A;  4UV9 A;  3FXR A;  4YIF A;  4I98 B;  3MZY A;  5LGU A;  1YS6 A;  3GFL A;  1GXQ A;  2P6S A;  1R7J A;  3EYI A;  4IXA A;  4KIC A;  1SD7 A;  5CLS A;  4KIF A;  5FO5 A;  2EV5 A;  3C1D A;  1NHA A;  3IRQ A;  1XGM A;  3VFZ A;  4CDG A;  4K2E A;  2ZNZ A;  4OIP F;  2Z5U A;  3WE3 A;  4NHJ A;  4ESJ A;  2HQR A;  3I4P A;  4ESF A;  4L5I A;  2TDX A;  4N0B A;  4ZYG A;  2HYG D;  3Q9V A;  1CF7 A;  4CGZ A;  3GXO A;  1REP C;  2M5W A;  3V8K A;  1JHF A;  5D6E A;  4RGX A;  4N9I A;  5ERI A;  3WGI A;  3BPV A;  1EH7 A;  1YW8 A;  2DTR A;  4HAM A;  2O03 A;  5DD4 A;  2VT3 A;  4LGW A;  4A0Z A;  1R1T A;  2IJL A;  2O8X A;  3GZ6 A;  2Q2E A;  1J75 A;  1D5V A;  5FLX Z;  5LLQ A;  4R79 A;  4M71 A;  5F6F A;  2FRH A;  3J80 K;  4EM1 A;  1J2X A;  4OMZ A;  3V7S A;  3V8L A;  2RN7 A;  1LNW A;  3H3Z A;  3ZMV A;  2A68 F;  3BPX A;  2H6C A;  1HKS A;  2X0L A;  3CLO A;  3M7G A;  3ECO A;  1PDN C;  3ABT A;  4PCQ A;  4UUV A;  2A6E F;  3GFM A;  2GQQ A;  1B9M A;  3GWZ A;  1FP1 D;  4E70 A;  5CVI A;  2D2W A;  1G3T A;  3RPU A;  4GO1 A;  3J81 K;  1DPU A;  4OIN F;  2AS5 F;  3I71 A;  3F6O A;  5FFZ A;  1ZRE A;  2B0L A;  4GYI A;  5D5X B;  4P9U A;  4Y13 A;  3WTU C;  2W25 A;  4HBL A;  2E1C A;  3L9F A;  4HZF A;  2DQR A;  2M45 A;  2NNY A;  1B59 A;  1UHM A;  4HW0 A;  3RJP A;  3O3K A;  3HRM A;  5BOX A;  3HOT A;  3Q9S A;  4WX9 A;  2FOK A;  3WTT C;  4WWC A;  2QEN A;  4GYG A;  3GZ5 A;  5DV5 A;  3QPH A;  4Q4Z F;  4G8X A;  3NRV A;  1J5Y A;  4KT5 C;  3L00 A;  1TNT A;  5D5V B;  1DP7 P;  4UV8 A;  3TO6 A;  1LEA A;  1P4X A;  1HKT A;  2OZU A;  3DKW A;  2WC2 A;  3PQK A;  4JQF A;  2VON A;  1TNS A;  3LA7 A;  2AXL A;  5F64 A;  3HHH A;  1H0M A;  5DCM B;  5FB2 A;  1KU7 A;  4IRI A;  2K27 A;  1JE8 A;  4HV5 A;  2ACJ A;  3F21 A;  3ZN1 A;  1T39 A;  4HX4 A;  1IZ1 A;  4MTE A;  4HF0 A;  4HF2 A;  1USS A;  2OBP A;  1R5G A;  3P9K A;  1HSJ A;  1KA8 A;  3ULQ B;  4EJW A;  2H6B A;  5LHG A;  5E18 F;  3KFW X;  2MBF A;  1SD5 A;  4ZZD A;  2GIV A;  3K1P A;  4G7O F;  5L3E A;  4LB5 A;  3V4G A;  2QUF A;  4FHT A;  4WXC A;  2R3S A;  3QOP A;  2JZY A;  4ON0 A;  3PFI A;  2KIM A;  3I0T A;  5DCM A;  1S6L A;  1Q1H A;  1RUN A;  1G6N A;  4LFU A;  3ECH A;  1WWX A;  4KIB A;  1BI1 A;  5A2Q K;  2GA2 A;  2CSO A;  2NS0 A;  4B09 A;  2A69 F;  3ZQ7 A;  2L3D A;  2IW5 A;  5D8K B;  4DQ2 A;  5AIP A;  2A07 F;  2MH9 A;  1PP7 U;  4BHC A;  2R7D A;  4AIH A;  3RIR A;  3FWE A;  4ZYD A;  5LHI A;  2KKO A;  5ILV A;  4ZZL A;  1OR7 A;  4CO8 A;  5D4S A;  4IRH A;  1WI9 A;  4OIR F;  5KK1 A;  1FYL A;  1UFM A;  1MJ9 A;  5K5R A;  4FX0 A;  1HST A;  4M73 A;  1S3J A;  2M1B A;  3TGN A;  4HOB A;  2VBX A;  2RKH A;  5LRS A;  4HF1 A;  2XIG A;  3TO7 A;  5E1W A;  4OIO F;  4M72 A;  4EM0 B;  5E17 F;  1U6G A;  3NQO A;  4M9S A;  1XMA A;  4UVC A;  3BRO A;  2HEO A;  4IF4 A;  3QPT A;  4PGH A;  1MDM B;  1ZRC A;  1BBY A;  1R58 A;  1FBS A;  3EDP A;  1B1B A;  4EM2 A;  1UB9 A;  3TDZ C;  3GVA A;  2W57 A;  1EV7 A;  2ZNY A;  2PLY A;  3MAJ A;  2Z9O A;  2NRA C;  3WTZ A;  2OU2 A;  3ABU A;  3EQL F;  3COA C;  5LEJ A;  1J9I A;  3WTV C;  3QP6 A;  1W5T A;  4GCV A;  4Y17 A;  1XGO A;  2QQB A;  1Z05 A;  4Y15 A;  2ZBK A;  1ZGJ A;  3SZT A;  3FX3 A;  5HLG A;  2ISY A;  1SMY F;  5IT9 Z;  4L9N A;  4GGG A;  5E8I A;  2JT1 A;  2FE3 A;  2HDC A;  5J6X A;  5HLH A;  1VTN C;  3HRS A;  1QGP A;  1RUO A;  5LEK A;  1MDM A;  4ZYE A;  1XSD A;  2DLL A;  5HDK A;  3V7R A;  3DQV C;  3BWG A;  4EV0 A;  2RGV A;  1U5T C;  2P5V A;  2KJC A;  1E17 A;  2NAZ A;  2FQ3 A;  4BHP A;  4ENN A;  2VN2 A;  2GAU A;  1LEB A;  2FBI A;  5CVU A;  5FFX A;  2VBW A;  1H9T A;  1ON2 A;  1YIO A;  1ODD A;  1SD4 A;  4O6J A;  3DPT A;  1MKM A;  3ZMU A;  2PJP A;  3VEP A;  4MEX F;  2GXB A;  2VE8 A;  5JVT A;  3OOP A;  3CO6 C;  2FSW A;  1YYV A;  3E6B A;  4RAY A;  1U5T B;  3ERE D;  5D5U B;  3ZMT A;  1O3S A;  3ROU A;  3DPL C;  2X4H A;  5J8C A;  1J7K A;  3HTS B;  3DF8 A;  3V8J A;  3E6D A;  3R60 A;  1BJA A;  3GW2 A;  4I0B A;  4L9V A;  2VOP A;  4Q48 A;  2D45 A;  2YSR A;  5HOO A;  3HHG A;  1BN5 A;  1LQ1 A;  3K1M A;  4LD5 A;  1SFU A;  1SAX A;  3OV8 A;  4B8X A;  2F2E A;  3E5U A;  4AVP A;  1UHW A;  5H6R A;  3LFK A;  2VC1 A;  3MWM A;  3FMQ A;  4AIJ A;  1FSH A;  2BGC A;  1QBJ A;  3RTR A;  1RIO H;  1G3S A;  4RB0 A;  1ZAR A;  1U5T A;  4RB3 C;  4XRF A;  3REO A;  3VOE A;  3W6K B;  1TW3 A;  3ISP A;  1YW7 A;  4I0A A;  5AON A;  3GX4 X;  1T2K A;  2HTS A;  2XVC A;  1HBX G;  4L9J A;  2QYO A;  2YX4 A;  3LWF A;  1XCB A;  5LGN A;  3L2C A;  3WE2 A;  3H92 A;  2DPD A;  3ZN0 A;  1P6R A;  1TQP A;  1DDN A;  1P92 A;  4U0V A;  3GEZ A;  5K5Q A;  3K9T A;  3JSP A;  4L0Y B;  2PMU A;  4MHG A;  1JHH A;  4ZYH A;  3SZP A;  2EV6 A;  4HYE A;  2FU4 A;  1ULY A;  3TKY A;  4RGU A;  3JW4 A;  4EJO A;  3N4M A;  3KP7 A;  2EWN A;  2CQK A;  4MQV A;  5K1Y A;  1ZRF A;  5H20 A;  2FNP A;  2H09 A;  1WQ2 A;  2VBZ A;  2XRN A;  4BNC A;  1G3Y A;  2VC0 A;  1FY7 A;  3K0L A;  3HRU A;  3FZV A;  2FBK A;  1OKR A;  4EJV A;  2HQN A;  2OAZ A;  1L0O C;  1IXS B;  3BDD A;  5L3B A;  2EFQ A;  1I1G A;  4CYD A;  4XBF A;  4L5J A;  3I58 A;  2P6T A;  1QZZ A;  2ELH A;  4YG2 F;  1W7P B;  2HS5 A;  2F5D A;  4PZJ A;  2DPU A;  3TOA A;  2W84 A;  1R1V A;  2PFB A;  4LLN A;  3E5X A;  2M30 A;  4MGR A;  2MD5 A;  3LA2 A;  2FML A;  3KEQ A;  3KP4 A;  4I02 A;  1WSU A;  4LLL A;  4UVA A;  3HUG A;  3T8T A;  2VOO A;  4UVB A;  3G73 A;  1U2W A;  4G7Z F;  3I54 A;  5ILS A;  4MEY F;  2PMH A;  2L01 A;  1LJ9 A;  4I01 A;  1FBU A;  2EV0 A;  4HDV A;  3MZH A;  1BC7 C;  5L3F A;  2IVM A;  1MZB A;  4A6E A;  4U88 A;  3F8N A;  3F8C A;  1W7P A;  4JBA A;  4FT8 A;  1YS7 A;  1HQC A;  2Z33 A;  3HSE A;  2UWM A;  4OMY A;  3F6V A;  2FXA A;  2DT5 A;  5DUK A;  2VT2 A;  1BI0 A;  1KYW A;  5J8F A;  2V9V A;  1OYW A;  2ZCW A;  3J80 Z;  2STW A;  1W7P D;  4HV6 A;  1Z9C A;  2XRO A;  3KEO A;  2A5Y B;  2FEZ A;  4HX8 A;  2W24 A;  1IN4 A;  1JGS A;  1QZY A;  4ENM A;  4H0E A;  2IP2 A;  3I59 B;  1YFH A;  4G7H F;  3R4K A;  1QPM A;  4QLC U;  3BJA A;  3ZMZ A;  3K69 A;  2HWV A;  3KZZ A;  4KA4 A;  1I27 A;  3J81 Z;  3MEX A;  4KFC A;  1J0R A;  1FP2 A;  2XAF A;  2A61 A;  1HW2 A;  1FSE A;  2V1D A;  3KP3 A;  4BQA A;  2YX7 A;  1SFX A;  2RNJ A;  4RAZ A;  1O3T A;  3BOQ A;  3TO9 A;  2DO7 A;  2HTJ A;  3RI4 A;  3ZMD A;  2EFN A;  2CWE A;  1L3L A;  4S04 A;  4HLX A;  3F3X A;  4JK1 X;  3I59 A;  1YQA A;  4BYY A;  1A04 A;  3TDU C;  1FX7 A;  3QRF F;  1XCV A;  3DXJ F;  3U9G A;  3SXY A;  3AAF A;  2WTE A;  2XAJ A;  4QWQ A;  3WU1 B;  2GWR A;  2DAO A;  2M87 A;  5DYM A;  3IHU A;  4LMY A;  1XDU A;  4EVI A;  4LK0 F;  2F5E A;  4O5V A;  4RGR A;  4A6D A;  1FWZ A;  3HSR A;  3C18 A;  3FM3 A;  4YFX F;  3KE2 A;  4EJU A;  1S7A A;  1IW7 F;  2Y48 A;  2HZT A;  4DNC A;  2HOE A;  5ED4 A;  4WXH A;  3EET A;  1ON1 A;  3SHF A;  1X3U A;  3BY6 A;  3RDI A;  1ZAO A;  1Z1D A;  2PG4 A;  2XHK A;  4M6X A;  4Z2Y A;  2BYV E;  2XAQ A;  4U7B A;  2G7U A;  3JAM K;  4EGY A;  2YU3 A;  2DK8 A;  4HA8 A;  1TQM A;  2FA5 A;  2L54 A;  3JTG A;  4KYW A;  2HKX A;  3WTY C;  4GXO A;  3RYR A;  2XKP A;  5EEG A;  3E97 A;  4UHT A;  3LQR A;  2WV0 A;  3ML6 A;  4IRG A;  1LDK B;  4R8H A;  1PP8 F;  1YW9 A;  2ZFW A;  1SD6 A;  3C7J A;  4R1H A;  1R36 A;  1F5T A;  3CTA A;  3RPQ A;  4ETS A;  4L18 B;  2JTV A;  3HSF A;  2BBY A;  4IHS A;  1TLH B;  3WTS C;  3BZ6 A;  4EMS A;  4XLN F;  3C3W A;  5A2Q Z;  1TTY A;  2G9W A;  3RKX A;  3WGG A;  2NYX A;  2XV4 S;  5DCF A;  2F5F A;  3LAP A;  4CXF A;  2P4W A;  3GF2 A;  3IWZ A;  2JPC A;  5HS7 A;  2ADU A;  2E1N A;  5FD6 A;  1S7O A;  1CGP A;  1O57 A;  3F8F A;  5D4R A;  1F4K A;  2L02 A;  1HKQ A;  3LST A;  1K7A A;  4KMF A;  1BOA A;  1D8J A;  2KJB A;  3D5L A;  3CDH A;  3GO5 A;  2UZK A;  1D8K A;  3H3U A;  3EUH A;  2Q8K A;  1B4A A;  4LG0 B;  2PEX A;  2QWW A;  2VOD A;  3W6J B;  3EYY A;  2GXG A;  2P5L C;  4MTD A;  2V6C A;  1ZLK A;  2DI3 A;  3F8M A;  1QQI A;  3O2P E;  5ICE A;  2O3F A;  4NB5 A;  2IRF G;  2E7X A;  1IF1 A;  1IN7 A;  4XSX F;  4HQM A;  2A6H F;  2LF7 A;  1BIA A;  5EEH A;  4PDK A;  1V4R A;  1R23 A;  3CJN A;  2IT0 A;  3T0Y A;  3CUQ C;  3GUD A;  2DFI A;  3SQN A;  1EH6 A;  2HYF A;  2W85 A;  1R1U A;  4LG0 A;  1W5S A;  3I53 A;  1ZGA A;  3U1D A;  1FNN A;  4KMU X;  4M74 A;  1MGT A;  4IPA A;  1OYY A;  3KLO A;  2XAG A;  3S2W A;  4WCG A;  2KRF A;  5HLI A;  5FLX K;  3GLX A;  3TOB A;  6PAX A;  2DU9 A;  2OA4 A;  2XAH A;  2C6Y A;  2CO5 A;  2M8E A;  1I1S A;  3HYI A;  1JXS A;  4A12 A;  1ZLJ A;  2D1V A;  3CUQ B;  1OMI A;  2XGX A;  3R6S A;  3TQN A;  1IRF A;  1WRJ A;  2QZ8 A;  5BMZ A;  1XMK A;  1MJA A;  4U0W A;  3QP5 A;  4RB2 C;  4L9T A;  4A0Y A;  3IL2 A;  2PBI A;  1R00 A;  1P4W A;  1DUX C;  2QBY B;  4HQE A;  1LVA A;  2CGP A;  1TQI A;  2RDP A;  3JSO A;  1K6O A;  2LDU A;  4BHB A;  2K4B A;  2JPB A;  2DW4 A;  1GXP A;  2EFW A;  1P4A A;  3ZPL A;  5F1R A;  3MFK A;  1GHC A;  1BC8 C;  2UXX A;  5LGT A;  3I64 A;  2K4J A;  1BM9 A;  1RI7 A;  1E2X A;  4YFK F;  2QQA A;  3CUQ A;  4LB6 B;  2PQ8 A;  3I5U A;  1EH8 A;  5CJ9 A;  3QU6 A;  2IA2 A;  3BP8 A;  3L7W A;  5K5O A;  1O7L A;  5ILU A;  4UXN A;  1ZG5 A;  2QBY A;  4XLP F;  3WTX C;  2LNB A;  4I2O A;  4ZH4 F;  1T38 A;  2E7W A;  4EJT A;  1XB4 A;  3F22 A;  2VBY A;  1U3E M;  4HLY A;  2OQR A;  2V1U A;  4RS8 A;  2RV8 A;  4RB1 A;  2ISZ A;  2P5K A;  4UNO A;  2EK5 A;  2HFH A;  2ZJ2 A;  1HXD A;  4KIG A;  1W4M A;  4WK8 F;  3KET A;  4EQQ A;  4OOI A;  4AIK A;  2L4M A;  3M8E A;  1FBQ A;  2HKO A;  3DV8 A;  4Q5S F;  2RVC A;  1S8N A;  5HDN A;  1IAW A;  1HW1 A;  2V79 A;  2WWY A;  4G9Y A;  4N9H A;  4G94 A;  5BQT A;  1GVJ A;  4G6D A;  2Z99 A;  2H27 A;  1K79 A;  1FLI A;  1XSV A;  4ESB A;  5HVQ C;  1RNL A;  3VOD A;  2FF4 A;  3IWF A;  4M9Z A;  3FM5 A;  2LKP A;  5D6F A;  5E1X A;  1IN8 A;  3WOD F;  2A3S A;  1YG2 A;  1WKM A;  1O3R A;  3WG9 A;  2MLG A;  1XGN A;  2F5C A;  1BI3 A;  5KVR A;  3CUO A;  1F9N A;  3BJO A;  4A5M A;  1KYZ A;  5TJJ A;  1O3Q A;  1TW2 A;  4M9X A;  3FXU A;  3U2R A;  1B6A A;  2XKO A;  3V7C A;  2J5O A;  2EB7 A;  2EFO A;  4KUM A;  1IN6 A;  2EFP A;  3FMS A;  3O6B B;  4Q47 A;  4CZZ A;  3KP2 A;  1KQ9 A;  1V3F A;  1Z6T A;  4YII A;  1J59 A;  1KGS A;  3T8R A;  2JSC A;  5HDG A;  4U0Y A;  3CO7 C;  1IXR C;  3ZMS A;  2XUB A;  4LJZ F;  3T1B A;  1TBX A;  2G7H A;  4AWX B;  3MCZ A;  3JTH A;  1I6X A;  5DD8 A;  5CYV A;  3Q5F A;  2UXN A;  3WU0 A;  2HGC A;  4A2U A;  1G4D A;  1IN5 A;  1Z6R A;  3BJ6 A;  1FYM A;  5ICG A;  5JR3 A;  1YO5 C;  4KNY A;  1ZG3 A;  5JI6 A;  3KCC A;  1AWC A;  5E8G A;  5CVJ A;  1U8R A;  3F72 A;  2L4A A;  1K78 B;  5DEQ A;  2BEO A;  4WF2 A;  3KLN A;  1T0F A;  5BS6 A;  2GA1 A;  3FHZ A;  4LLG F;  1H9G A;  3N97 A;  2VE9 A;  1FOK A;  3RKW A;  3E5Q A;  3VB2 A;  3GFI A;  1O7F A;  4P9F A;  2P7V B;  4ASN A;  4L0Z B;  3FMR A;  3D0S A;  1Z7U A;  1OYI A;  2IA0 A;  1P2F A;  3KP6 A;  4KDP A;  5LBQ A;  2COM A;  3T5X A;  1UST A;  5LHH A;  5IT3 A;  2Z3Y A;  2P7C B;  2OQG A;  4BH9 A;  1IXC A;  3MQ0 A;  4I09 A;  5BPI A;  5CVV A;  2J5P A;  3IKV A;  1KQ8 A;  3WGH A;  4ENK A;  3WTW C;  1PUE E;  4BAY A;  3SFZ A;  4O3M A;  2O0Y A;  1K78 A;  1Z91 A;  2CG4 A;  2BE5 F;  1HW5 A;  5CVR A;  2D1H A;  1BI2 A;  4IVN A;  2QVO A;  3R61 A;  1LDJ A;  3RYP A;  3K2Z A;  3NEU A;  3ELK A;  2MA3 A;  1ONV A;  1MJB A;  3QU3 A;  1R22 A;  1IUY A;  5E20 A;  1YTY A;  2Y75 A;  3DP7 A;  2EA2 A;  2KIF A;  2HR3 A;  4D0P A;  2EJR A;  2PN6 A;  1KU3 A;  5D8L B;  4P96 A;  2OD5 A;  2V1X A;  4PGG A;  2KIU A;  5IT9 K;  3ZP5 A;  1KU9 A;  4A5N A;  3LQQ A;  1Y0U A;  1D3Y A;  4A0X A;  1I5Z A;  3E3V A;  3P9C A;  1MD0 A;  2STT A;  4M6Y A;  1YLF A;  2LF8 A;  2QLZ A;  2GZW A;  3DEU A;  3IRR A;  3RKY A;  5ICF A; 
#chains in the Genus database with same CATH topology
 2P8T A;  1ZYR F;  2CW0 F;  5FGM A;  4CIC A;  3F23 A;  2LSO A;  5EG0 B;  4A3J J;  1EF4 A;  1XD7 A;  3DFG A;  2O61 A;  4XKB A;  5TRD A;  2KLO A;  4TV7 A;  3E7L A;  3H36 A;  2DMQ A;  4IZZ A;  1FMV A;  3G3Z A;  3L09 A;  1B8I B;  1FC3 A;  4ENJ A;  1SMT A;  2H94 A;  2RC4 A;  1DPR A;  4BXU A;  1T98 A;  2GBY A;  3GTJ J;  1ZG1 A;  3PQJ A;  3LSG A;  1V55 H;  4IJA A;  5D5W B;  4NQW A;  2BW3 B;  3GTP J;  2EIN H;  3M8F A;  1BIB A;  3K4B A;  3ABK H;  5AIQ A;  4IHT A;  2HYJ A;  4YFN F;  3J7A O;  3E6C C;  3OOU A;  3E0J B;  4I7H A;  2NXN B;  4B3X A;  4LK1 F;  3GYH X;  1N25 A;  2YR2 A;  2ZKZ A;  1BL0 A;  3U1K A;  5IYD J;  3HRT A;  1U0J A;  1C0W A;  5L3D A;  2BHY A;  4UUS B;  5E1Z B;  1NTC A;  1VQ4 I;  3ZQC A;  3OS0 A;  1WH7 A;  3M1E A;  3OYA A;  2R7F A;  2K9N A;  2EIM H;  1E3O C;  1ENH A;  4P1W A;  4KN4 X;  3F0C A;  1IDZ A;  1AKH B;  4X0G A;  1RZ4 A;  1XGS A;  4RGS A;  3P9I A;  3QYE A;  2BY0 A;  5IPA A;  2XF7 A;  2IS1 A;  2KDO A;  1KQ0 A;  3K1N A;  5EG0 A;  3P7N A;  5DUI A;  2OUM A;  2IA1 A;  2ZSH B;  3HOU J;  5EF6 A;  4F7Z A;  5HOD A;  1LB2 A;  2MLK A;  3GBG A;  3ZQG A;  5FRO A;  3CP8 A;  1B8I A;  2CFX A;  2VXZ A;  2Y31 A;  5HS8 A;  3HOV J;  3BTL A;  4OU0 A;  1R5H A;  1XTA A;  2ZO4 A;  1B9N A;  4C30 A;  1QO0 D;  3ZGK A;  3PIO F;  3B6A A;  2BW3 A;  4EGZ A;  1S29 A;  1X1D A;  3FF5 A;  2FNA A;  2K7L A;  3EPZ A;  1X1A A;  3KIO A;  1ZH5 A;  2ESH A;  2MC3 A;  1W5C C;  2KIQ A;  2O6G E;  1UCR A;  2HVR A;  2HOT A;  1KU2 A;  2JRT A;  1IO2 A;  4RBO A;  1WJA A;  2L7Z A;  1OPC A;  1XSX A;  3PM1 A;  5DDG A;  2LY1 A;  3IKT A;  3B02 A;  2Y0M A;  3E6M A;  4XL9 A;  2MGQ A;  1R71 A;  1YHQ I;  5LD2 C;  1FOW A;  2DK5 A;  2DQL A;  2HDD A;  2QKM B;  4BE0 A;  5HS9 A;  4BXF A;  5L3G A;  4UUS A;  4CHU A;  1DU6 A;  2UUZ A;  2KPM A;  1FPQ A;  3HIF A;  3F8B A;  4BDZ A;  1ZHF A;  3DBH B;  3ZRG A;  3JRC A;  1IRX A;  5JHU A;  1ZRD A;  4G6Q A;  2CYY A;  2FMY A;  2VQG A;  3L2W A;  1SFE A;  2F4M B;  4J01 A;  4A93 J;  1XN7 A;  2M0C A;  3R0J A;  2ZXJ A;  1WGX A;  1AKH A;  5FD5 A;  4S05 A;  3G2B A;  2WY8 Q;  1ZTR A;  4Y52 J;  1QNT A;  3JAM Z;  3M9A A;  3FBN B;  1IRG A;  2W1O A;  1TWF J;  2BV6 A;  2Z16 A;  2PI0 A;  5CKT A;  2XAS A;  1K6Y A;  1X3Z B;  2O7O A;  3OYF A;  3AKZ A;  3H3V K;  2ELJ A;  3HOS A;  1LDD A;  2QM3 A;  3IC7 A;  2ZME B;  1FZP B;  3R0A A;  4P55 A;  1FT9 A;  3QAH A;  3BTC A;  3TP3 A;  1IDY A;  4D7N A;  2IPQ X;  2EA4 A;  2MH2 A;  5LRR A;  1FIP A;  2LYC A;  1T95 A;  3F9K A;  4HDU A;  2ETH A;  2Z1D A;  1XPX A;  3NAR A;  1AA7 A;  4XSZ F;  2O5R A;  3RZO J;  4FX4 A;  2RQP A;  2XF6 A;  4MNU A;  2ZJP F;  2H8R A;  2Q0O A;  4OIQ F;  1LUJ B;  3GTO J;  3PSF A;  2DBB A;  3ERM A;  2XF5 A;  2OZ6 A;  5KCM A;  3KP5 A;  4MQ9 F;  2XGE A;  2FX0 A;  2OCE A;  3LSK A;  5KHD A;  1F1Z A;  2Q1Z B;  1D0Z A;  2NVX J;  4D1Q A;  1FYK A;  1STZ A;  2K02 A;  4KN7 X;  3HTU A;  4D5C A;  2MSY A;  4HX7 A;  5BNG A;  2K86 A;  3FXQ A;  5H6Q A;  2NNN A;  1JUP A;  1XDS A;  1ZN2 A;  4XKV A;  1WHU A;  2JQ7 A;  1T6S A;  3B73 A;  2JA5 J;  4PJJ A;  5ICC A;  1Y39 A;  1U78 A;  3I3L A;  1APL C;  3BR5 A;  5JFR A;  4P5O A;  2R5Z B;  4WXD A;  2XAU A;  2YPR A;  2I5U A;  2WB1 A;  4B3A A;  2FBH A;  2QQ9 A;  3GFJ A;  2ZME A;  1AOY A;  4JYK A;  3KZY A;  2ESN A;  1CF7 B;  3LAJ A;  2ZJR F;  5L3C A;  4U7D A;  1LFB A;  5BPD A;  4AD9 A;  3HM5 A;  2XSD C;  1G3W A;  2F48 A;  2Z2S B;  2E19 A;  3EUK L;  2MW8 A;  3LA3 A;  1W0T A;  4E7J A;  2HOS A;  4D7M A;  2VQH A;  4UV9 A;  3FXR A;  3CLQ A;  1HLV A;  4YIF A;  4I98 B;  1RRJ A;  2R7S A;  2VJ5 A;  2QA4 I;  3MZY A;  5LGU A;  1YS6 A;  2LY9 A;  3GFL A;  1GXQ A;  1Y8Q B;  5J1U A;  2VKE A;  5E3M A;  2P6S A;  1ETW A;  1R7J A;  2Q2E B;  3EYI A;  4IXA A;  4KIC A;  1TWG J;  3RKQ A;  2ECC A;  1SD7 A;  2DDB A;  5CLS A;  1R4N B;  3PNT A;  4KIF A;  1ETO A;  5FO5 A;  2LBF B;  4D9J A;  2Y0S N;  3IV5 A;  2EV5 A;  3C1D A;  1NHA A;  3A1Y A;  3OYE A;  3IRQ A;  1XGM A;  3VFZ A;  4CDG A;  1TT0 A;  1YOV B;  2ZNZ A;  4K2E A;  1A36 A;  1MMS A;  2JA6 J;  4OIP F;  1JJ8 C;  2Z5U A;  4OWR B;  1XC5 A;  3WE3 A;  3OYI A;  4NHJ A;  5IYC J;  4BE2 A;  1VQO I;  4ESJ A;  2R5Z A;  2HQR A;  3I4P A;  4ESF A;  9ANT A;  3OL3 A;  4L5I A;  2V7F A;  2TDX A;  2MFZ A;  4XN3 A;  2ZXW H;  4N0B A;  1WH5 A;  3VYR B;  4ZYG A;  2HYG D;  3Q9V A;  1CF7 A;  4CGZ A;  3GXO A;  1REP C;  2M5W A;  2NOG A;  3IAM 2;  3V8K A;  1JHF A;  3BTJ A;  5D6E A;  4RGX A;  1DGW Y;  3AG2 H;  2DT6 A;  4N9I A;  5ERI A;  3WGI A;  3BPV A;  4NBQ A;  4FE7 A;  1EH7 A;  1YW8 A;  2DTR A;  4HAM A;  3JR9 A;  1H88 C;  2O03 A;  5DD4 A;  2VT3 A;  5JLX A;  3S2D J;  4LGW A;  4DBQ A;  4A0Z A;  4CCJ A;  2R7V A;  2AHQ A;  3C2B A;  1X1C A;  2KHM A;  3L2R A;  1R1T A;  4QSH A;  2IJL A;  1X4O A;  2O8X A;  2XDV A;  5EJC A;  3GZ6 A;  2Q2E A;  1Y6I A;  1J75 A;  1D5V A;  5FLX Z;  3K4L A;  3DKX A;  1OCO H;  5LLQ A;  4R79 A;  4IEJ A;  1F43 A;  2LBF A;  4M71 A;  5F6F A;  2FRH A;  3J80 K;  4EM1 A;  1J2X A;  2KMU A;  4OMZ A;  3V7S A;  3V8L A;  2R7W A;  2RN7 A;  1LNW A;  4MO7 A;  4XKW A;  1FMW A;  2BY1 A;  3H3Z A;  3ZMV A;  3BQZ A;  2A68 F;  3BPX A;  2H6C A;  3FK6 A;  2IGM A;  1G2H A;  1HKS A;  3LSI A;  1WJC A;  2X0L A;  3OYL A;  1LKX A;  4C9Y A;  1SAU A;  1T0F C;  3G1O A;  4ZYA A;  3CLO A;  3M7G A;  4E7Z A;  3ECO A;  3OYK A;  1PDN C;  3ABT A;  3DTI A;  3ONQ A;  4PCQ A;  1BJZ A;  1ZQ3 P;  4UUV A;  2IEK A;  2A6E F;  3GFM A;  2GQQ A;  5CQG A;  3V42 A;  1B9M A;  1IV8 A;  4BKX A;  3GWZ A;  1FP1 D;  4BQO A;  3CCR I;  3G6E I;  3OSG A;  2KL4 A;  3OYM A;  2K40 A;  4E70 A;  5CVI A;  5TGT A;  2D2W A;  1G3T A;  3RPU A;  4GO1 A;  3J81 K;  1DPU A;  4OIN F;  2AS5 F;  3I71 A;  3J7A Y;  4HNV A;  1IV6 A;  3F6O A;  5FFZ A;  1ZRE A;  3PO3 J;  2B0L A;  4GYI A;  5F0F A;  5D5X B;  1GDT A;  2R0Q C;  4BDY A;  3H0G J;  3I4N J;  3N05 A;  4P9U A;  4Y13 A;  1HCR A;  3WTU C;  2W25 A;  4HBL A;  2R7O A;  3ZOB A;  2E1C A;  4IHX A;  3L9F A;  4HZF A;  2DQR A;  2M45 A;  2HPI A;  2CQ7 A;  3RPU D;  2NNY A;  3OIP A;  1B59 A;  1UHM A;  4A69 C;  2ZC2 A;  4HW0 A;  2VQC A;  1ZR4 A;  4PK4 A;  3RJP A;  2OC6 A;  3O3K A;  1K83 J;  3L1P A;  2ZFU A;  3HRM A;  3A03 A;  4M6V A;  2R7Z J;  4PFP A;  1MMD A;  2K9Q A;  5BOX A;  2F4O B;  1V5F A;  3HOT A;  1P7J A;  1D1C A;  3Q9S A;  2AQE A;  4BQQ A;  2BOL A;  4WX9 A;  1YE9 A;  2FOK A;  3WTT C;  3CCE I;  4WWC A;  2ZB9 A;  1O4X A;  1Z3Y A;  2CRG A;  4HRI A;  2QEN A;  3CMM A;  2JA2 A;  4GYG A;  1N77 A;  3SDG A;  4A3K J;  1VQ5 I;  3GZ5 A;  2WV1 A;  4MFD A;  5DV5 A;  1JUS A;  3QPH A;  4Q4Z F;  2M7A A;  1X2M A;  2KRC A;  2WA0 A;  4G8X A;  3NRV A;  1J5Y A;  4KT5 C;  3W2W A;  3L00 A;  1TNT A;  4BU2 A;  1KON A;  4IX7 A;  2NVT J;  5D5V B;  2WAQ N;  1DP7 P;  4UV8 A;  3S14 J;  3TO6 A;  1LEA A;  1P4X A;  1HKT A;  2OZU A;  3DKW A;  3S1R J;  1I6H J;  2WC2 A;  1ACI A;  3PQK A;  3JRB A;  1NG7 A;  3HKZ N;  1SVL A;  3KEY A;  4JX5 A;  5FKN A;  5CQE A;  4JQF A;  2VKH A;  2OTJ I;  2VON A;  4A3B J;  1GLN A;  3BR2 A;  1EKE A;  3PNV A;  2ME6 A;  2V9K A;  1UZC A;  1TNS A;  3LA7 A;  3KYD B;  1IUF A;  4IHW A;  1MH3 A;  1HDP A;  1JGG A;  2AXL A;  4I76 A;  3KYL A;  5FRN A;  2CV1 A;  5F64 A;  3HHH A;  4XQF A;  1H0M A;  4QPO A;  5DCM B;  5FB2 A;  3HOW J;  4RA2 A;  5HLT A;  1MNE A;  2LKS A;  2RNG A;  1KU7 A;  4IRI A;  2K27 A;  1OR7 C;  1JE8 A;  3PSI A;  3TL4 X;  4HV5 A;  2ACJ A;  3F21 A;  3ZN1 A;  2LRD A;  1T39 A;  2CU7 A;  4HX4 A;  3IH4 A;  1IZ1 A;  4MTE A;  3S17 J;  4HF0 A;  4BL0 B;  1VQK I;  4HF2 A;  1USS A;  2EIJ H;  2OBP A;  1R5G A;  3H35 A;  2CQN A;  2VQL A;  4Z6Y A;  3P9K A;  3FIW A;  1QU3 A;  3Q0W A;  2F6C A;  1HSJ A;  1KA8 A;  3VYT B;  3ULQ B;  4EJW A;  1Y56 A;  4AC0 A;  4C3I J;  1R49 A;  2DXI A;  2H6B A;  2P0W A;  1GVD A;  5LHG A;  5E18 F;  1S7E A;  3KFW X;  1MBG A;  4ITV A;  5JVG F;  2JA7 J;  2MBF A;  1AHD P;  1SD5 A;  5M5Y J;  4ZZD A;  2GIV A;  3K1P A;  3BCB A;  4H4K C;  1UG2 A;  3OYD A;  4G7O F;  5L3E A;  4LB5 A;  3V4G A;  2QUF A;  4FHT A;  4M3B A;  2QCO A;  1YJ9 I;  1XG1 A;  4WXC A;  2R3S A;  3QOP A;  2L7F P;  1ITY A;  2JZY A;  2BZT A;  4BEH A;  1A35 A;  4ON0 A;  1W0U A;  1V54 H;  1Z7L A;  1QVT A;  3PFI A;  3L2Q A;  2KIM A;  3I0T A;  5DCM A;  5J4V A;  1S6L A;  1ERD A;  1Q1H A;  2A6T A;  1RUN A;  1G6N A;  4LFU A;  2B7E A;  2DA4 A;  3O8H A;  3ECH A;  1WWX A;  4KIB A;  3AL0 C;  2DA1 A;  1BI1 A;  5A2Q K;  2QGU A;  2GA2 A;  4A3I J;  2CSO A;  2NS0 A;  4B09 A;  3CCM I;  4XM3 A;  1OCC H;  2A69 F;  3ZQ7 A;  2L3D A;  2IW5 A;  3FKI J;  5D8K B;  2ICW G;  4DQ2 A;  5AIP A;  2A07 F;  2MH9 A;  3MKL A;  1K4S A;  1MMA A;  1WFX A;  1QPI A;  4NC6 A;  3K6G A;  2PX9 A;  1PP7 U;  1IGN A;  4BHC A;  2R7D A;  1T56 A;  1PYV A;  4AIH A;  1VZ0 A;  3RIR A;  3FWE A;  2GM4 A;  3CC4 I;  3NAU A;  1VQL I;  4DZP A;  4XON A;  1R9T J;  4ZYD A;  3OS2 A;  5LHI A;  3RZD J;  2KKO A;  3CF2 A;  2K5C A;  5ILV A;  4ZZL A;  2X1C A;  1OR7 A;  2LP0 A;  4UUT A;  2L2O A;  3SYT A;  1RKW A;  2EIK H;  4DYC A;  3FKJ A;  4CO8 A;  5D4S A;  1A6I A;  2DJI A;  4IRH A;  1WI9 A;  4F55 A;  4OIR F;  1X2N A;  5KK1 A;  1FYL A;  2RQQ A;  1TL8 A;  4YEL A;  4XKC A;  1RR7 A;  2N8G A;  2EIL H;  1UFM A;  1D0Y A;  1MJ9 A;  5K5R A;  4FX0 A;  1HST A;  4M73 A;  1S3J A;  2M1B A;  3TGN A;  4HOB A;  3CES A;  4XK4 A;  2VBX A;  2DTZ A;  3I56 I;  2AO9 A;  1UAA A;  3M4O J;  2M7B A;  2RKH A;  5LRS A;  2DA3 A;  2K9S A;  4HF1 A;  2XIG A;  2W48 A;  1V5E A;  3TO7 A;  1PUF B;  2IXS A;  5E1W A;  2E34 A;  1R6R A;  4XRM A;  1YX5 A;  1TWC J;  4LG3 A;  4OIO F;  4M72 A;  4EM0 B;  5E17 F;  1U6G A;  3NQO A;  2FOW A;  4M9S A;  2DFE A;  4XNF A;  2O8K A;  3MKW B;  4GFB A;  1XMA A;  4E7H A;  5IP7 J;  3VWB A;  4UVC A;  3BRO A;  2HEO A;  3OIO A;  4IF4 A;  3QPT A;  3QPS A;  4PGH A;  2PMZ N;  3ZR8 X;  1P7I A;  2WBM A;  5C3E J;  1MDM B;  1ZRC A;  1BBY A;  2DT7 B;  3RQ4 A;  1R58 A;  1FBS A;  3EDP A;  2PJR B;  2NVU B;  3VYS B;  4A3G J;  2MYS A;  2GXA A;  1FTT A;  2HXI A;  1B1B A;  4EM2 A;  4KIS A;  4XN0 A;  4CH7 A;  1UB9 A;  3TDZ C;  3VDX A;  2E35 A;  3GVA A;  2W57 A;  1ETV A;  1EV7 A;  1OCP A;  2ZNY A;  2PLY A;  2VPL A;  3MAJ A;  2Z9O A;  5K7Z A;  2NRA C;  1K4T A;  3TED A;  2BXZ A;  3WTZ A;  2OU2 A;  2Y0S A;  4HEA 2;  3ABU A;  3EQL F;  5E79 C;  2XB0 X;  3COA C;  2CUE A;  1D1A A;  5GPC A;  5LEJ A;  1J9I A;  3WTV C;  4YRV A;  1WJ5 A;  3QP6 A;  1W5T A;  4GCV A;  4Y17 A;  2L9V A;  1VI0 A;  1XGO A;  2GOM A;  1PUF A;  2QQB A;  1Z05 A;  4Y15 A;  2ZBK A;  1ZGJ A;  3SZT A;  3FX3 A;  5FKK A;  2LOO A;  2ZME C;  5HLG A;  5E3L A;  2M8G X;  2JJ7 A;  2HOA A;  2ISY A;  5DS9 A;  5F27 A;  1OCT C;  3QYF A;  3KPH A;  1SMY F;  5J3L A;  5IT9 Z;  1Y0N A;  1GT0 C;  4L9N A;  4GGG A;  5E8I A;  2JT1 A;  3HEF A;  2FE3 A;  2L9S A;  4Y3O A;  2HDC A;  5B66 C;  5J6X A;  5HLH A;  2QF7 A;  4BXX J;  1VTN C;  3HRS A;  1QGP A;  1RUO A;  2VKV A;  3MZ8 A;  1UG0 A;  4B1R A;  5JHF A;  5LEK A;  1MDM A;  4ZYE A;  1LPQ A;  1XSD A;  3ASN H;  2DLL A;  2LH9 A;  5HDK A;  3HG9 A;  5GAG J;  2PJR A;  2E5Z A;  2R7T A;  3V7R A;  3FXM A;  1X19 A;  4BJ5 C;  3DQV C;  1Q1V A;  3FXK A;  4BBS J;  3BWG A;  4V2F A;  4EV0 A;  4DIQ A;  2RGV A;  3DU6 A;  1U5T C;  2P5V A;  4LIU A;  2KJC A;  1E17 A;  5FKO A;  2COB A;  2CQQ A;  1VFC A;  1JUM A;  2FQ3 A;  2NAZ A;  4F92 B;  1PJR A;  3AG3 H;  4IO9 F;  4BHP A;  2E2H J;  1T8I A;  2XPV A;  1FEX A;  4ENN A;  4BBR J;  1J09 A;  5LFA A;  2VN2 A;  3BC8 A;  3HPG A;  2GAU A;  1LEB A;  1ETX A;  1MMG A;  2FBI A;  5CVU A;  5FFX A;  2VBW A;  1VND A;  3UR3 C;  2V26 A;  1H9T A;  3K7A J;  1WI3 A;  4IHY A;  1ON2 A;  1OCR H;  1YIO A;  1ODD A;  5GAH J;  2K9L A;  1SD4 A;  2EBI A;  2EZL A;  4O6J A;  1OLT A;  2G0E A;  3DPT A;  1MKM A;  3ZMU A;  4UB8 C;  2PJP A;  3VEP A;  5FJ8 J;  4MEX F;  2GXB A;  5J47 A;  1PVE A;  2VE8 A;  4U87 A;  2ME0 A;  4QIW N;  5JVT A;  3OOP A;  4NC7 A;  3CO6 C;  2XPU A;  2FSW A;  4DW6 A;  1YYV A;  2JWT A;  3E6B A;  4RAY A;  1U5T B;  5EYR A;  1RKT A;  3ERE D;  3LOC A;  4Y4R A;  3S3O A;  3H0D A;  2X9D A;  3E1S A;  5D5U B;  3ZMT A;  3S1Q J;  1O3S A;  3ROU A;  4JX6 A;  2CQX A;  3DPL C;  2DA5 A;  3PO2 J;  2IBD A;  2X4H A;  5J8C A;  3L2V A;  2I8D A;  3BR3 A;  1J7K A;  3HTS B;  3DKY A;  3DF8 A;  1JT6 A;  2DMN A;  2M2E A;  3V8J A;  3E6D A;  2XGC A;  3R60 A;  1BJA A;  5GAD J;  1Z77 A;  5EZG A;  3GW2 A;  1D0X A;  4I0B A;  4L9V A;  4IQJ A;  2L9R A;  3DLL F;  1XX5 A;  2VOP A;  2JUG A;  2V4J C;  2IGK A;  4Q48 A;  5B1B H;  2D45 A;  2YSR A;  3S1N J;  2P81 A;  5HOO A;  3HHG A;  1BN5 A;  1LQ1 A;  4I6Z A;  2X6O A;  3K1M A;  4LD5 A;  3CMA I;  1SFU A;  1SAX A;  3OV8 A;  1VQ6 I;  3S2H J;  4A3L J;  3MMY B;  3JRI A;  3CCY A;  2X6X A;  4B8X A;  2F2E A;  3E5U A;  2O9L A;  3GLL A;  2HVS A;  4AVP A;  2LR8 A;  1UHW A;  4FE4 A;  2CV2 A;  3DEW A;  1SEU A;  3BG5 A;  3LFK A;  5H6R A;  3WG7 H;  3K4N A;  2HU9 A;  2VC1 A;  1ZR2 A;  3MWM A;  4M3D A;  3FMQ A;  4AIJ A;  2R92 J;  1FSH A;  1QZE A;  3PUB A;  2BGC A;  5M3M J;  2ZXH A;  2B9S A;  1QBJ A;  2B63 J;  3KYC B;  3RTR A;  1RIO H;  3X2Q H;  1G3S A;  4RB0 A;  1ZAR A;  1U5T A;  4RB3 C;  4XRF A;  3REO A;  4HNU A;  4HPQ A;  3VOE A;  4CA0 A;  3CCQ I;  3W6K B;  1TW3 A;  4XLC A;  3CJQ B;  3H1C A;  3ISP A;  1YW7 A;  3BQY A;  4I0A A;  5AON A;  3GX4 X;  3CMY A;  2Y9Z A;  1T2K A;  1ETY A;  2HTS A;  1DQU A;  2XVC A;  1HBX G;  4L9J A;  1MND A;  2QYO A;  1LFU P;  2LKX A;  2YX4 A;  3LL7 A;  1GV5 A;  1BR1 A;  4B4C A;  3LWF A;  1YRN B;  1XCB A;  3M07 A;  5LGN A;  3L2C A;  3WE2 A;  2HI3 A;  1Z67 A;  3H92 A;  2DPD A;  3ZN0 A;  1P6R A;  5B1A H;  3BG7 A;  1TQP A;  2IAI A;  1DDN A;  1YX3 A;  3CME I;  2IS2 A;  1P92 A;  2A05 A;  2L0K A;  1I39 A;  4E7K A;  4CCL A;  4U0V A;  3GEZ A;  5K5Q A;  3OS1 A;  2WAF A;  3K9T A;  1XS9 A;  3JRE A;  5IP9 J;  3JSP A;  1JTY A;  3HZJ A;  2KT0 A;  1MBE A;  4PFO A;  1UMQ A;  4L0Y B;  4XRS G;  2PMU A;  4MHG A;  2MD0 A;  1ETK A;  1JHH A;  1TWH J;  5F0C A;  4ZYH A;  3SZP A;  2EV6 A;  4HYE A;  3SZG A;  2FU4 A;  4M3E A;  1ULY A;  3TKY A;  2HPM A;  4RGU A;  3JW4 A;  4AYB N;  4L5E A;  4EJO A;  3N4M A;  3KP7 A;  2EWN A;  1DP3 A;  4J19 A;  2CQK A;  2NS8 A;  4MQV A;  5K1Y A;  1ZRF A;  5H20 A;  2FNP A;  2H09 A;  5IYB J;  1WQ2 A;  2WAE A;  3CDI A;  4W97 A;  3HUG B;  2VBZ A;  2XRN A;  4BNC A;  1G3Y A;  2VC0 A;  1FY7 A;  3K0L A;  3CQZ J;  4CCN A;  3HRU A;  5GAE J;  3BG6 A;  3FZV A;  2LFB A;  4J00 A;  2FBK A;  1OKR A;  3BG3 A;  4DZJ A;  2KIS A;  3D5S C;  4EJV A;  2HQN A;  2OAZ A;  1NK3 P;  1L0O C;  1YRN A;  2R5Y B;  1IXS B;  3VSK A;  3AFH A;  3BDD A;  5L3B A;  5J4Y A;  2EFQ A;  2GIZ A;  2DJN A;  1I1G A;  4CYD A;  1CQT A;  3SEZ A;  1KZH A;  1D5Y A;  4XBF A;  1SVM A;  4A3E J;  4L5J A;  3I58 A;  1FTZ A;  2P6T A;  1T08 B;  1RC9 A;  1QZZ A;  2ELH A;  4YG2 F;  3SDB A;  1W7P B;  2HS5 A;  1TZL A;  3BR1 A;  2F5D A;  1TP4 A;  4PZJ A;  2DPU A;  3TOA A;  2W84 A;  2E1M C;  3OYN A;  3LSR A;  1R1V A;  1X4P A;  2EQR A;  2PFB A;  4DJA A;  5GP9 A;  4D5F A;  4FCY A;  4LLN A;  3E5X A;  2M30 A;  5EDN A;  4MGR A;  2MD5 A;  1MW7 A;  2FML A;  3KEQ A;  3LA2 A;  2E5N A;  3KP4 A;  3W2V A;  2DOD A;  3FK7 A;  4XLA A;  2ELK A;  4I02 A;  2M4K A;  1WSU A;  4PJ0 C;  3BT9 A;  3K4K A;  2TCT A;  5F08 A;  4LLL A;  4UVA A;  3HUG A;  3G1L A;  3T8T A;  2ZJQ F;  2VOO A;  4UVB A;  3G73 A;  1U2W A;  4G7Z F;  4E7I A;  3I54 A;  5ILS A;  3HBL A;  4MEY F;  2PMH A;  3QQA A;  1OFC X;  1LJ9 A;  2L01 A;  4I01 A;  4A3M J;  5DM6 F;  2R7Q A;  3DLA A;  4CCK A;  2R5Y A;  4FET A;  1FBU A;  4ANJ A;  1JKQ C;  2QQ8 A;  4MFE A;  2M9H A;  3DCF A;  1YIT I;  2EV0 A;  4HDV A;  3RSN A;  3MZH A;  1BC7 C;  2VAS A;  2E1M B;  5L3F A;  2IVM A;  3QOE A;  1U9O A;  1X58 A;  2E36 A;  2L5Q A;  1MZB A;  4LOC A;  4A6E A;  4BS9 A;  2AXT C;  3ABM H;  3JRH A;  5C4X J;  4U88 A;  3F8N A;  3F8C A;  4F91 B;  3QPL A;  1T33 A;  1W7P A;  1WJE A;  2QKL B;  4JBA A;  2NS7 A;  4FT8 A;  1YS7 A;  1HQC A;  2HNH A;  2RAE A;  2Z33 A;  3HSE A;  2UWM A;  4OMY A;  3F6V A;  1YIJ I;  2FXA A;  2DT5 A;  5DUK A;  3JRG A;  3ZCO A;  4EEF G;  1R4M B;  2VT2 A;  1BI0 A;  4RAG A;  4KIT B;  1SC7 A;  3DU5 A;  1KYW A;  5J8F A;  2X6W A;  2V9V A;  3CD6 I;  1LFP A;  4AID A;  5FRM A;  3C2H A;  1OYW A;  3NWS A;  3S15 J;  4MIM A;  2ZCW A;  3J80 Z;  3GZN B;  2FUG 2;  1YI2 I;  1W7P D;  4HV6 A;  1Z9C A;  2STW A;  2L9N A;  4AM3 A;  2XRO A;  1QA6 A;  1FOY A;  3HOY J;  3KEO A;  5KAF C;  3ZQF A;  2A5Y B;  2HQA A;  2FEZ A;  2JN6 A;  4HX8 A;  4XOR A;  2W24 A;  4S0H B;  1IN4 A;  5EGO B;  3HDD A;  1JGS A;  1QZY A;  4ENM A;  4H0E A;  1I50 J;  3D5R C;  2IP2 A;  3I59 B;  1YFH A;  1U9N A;  3LMM A;  3R4K A;  4FAS D;  4G7H F;  4BEH B;  1G8X A;  3H9G A;  2D5V A;  2KDZ A;  2K9M A;  1QPM A;  1S5L C;  1Y1V J;  3BJA A;  4QLC U;  5FKL A;  3ZMZ A;  3K69 A;  2JMW A;  3C2G A;  2DOF A;  2HWV A;  3GTM J;  2H8W A;  1TWA J;  3QOD A;  3G4S I;  3KZZ A;  4KA4 A;  3A01 B;  1I27 A;  4RDU A;  3J81 Z;  3MEX A;  4UY8 I;  1SFO J;  5DTD A;  4KFC A;  1J0R A;  4CCO A;  2X48 A;  1FP2 A;  2XAF A;  2A61 A;  4E4H A;  1HW2 A;  4RLQ A;  1FSE A;  3W6V A;  2V1D A;  5IOY A;  3GTQ J;  3KP3 A;  1Z3X A;  4BQA A;  2W7N A;  3CJR B;  3CCV I;  2YX7 A;  4GDF A;  1BR2 A;  1SFX A;  2RNJ A;  4RAZ A;  1O3T A;  2GLO A;  3BOQ A;  3TO9 A;  3WHC A;  1ZGW A;  4ZDL A;  2DO7 A;  4BAC A;  2HTJ A;  3RI4 A;  3ZMD A;  2EFN A;  3ZQI A;  2X85 A;  2CWE A;  1L3L A;  2W82 A;  4S04 A;  4HLX A;  1A5J A;  5GPA A;  3FXO A;  5M5X J;  3F3X A;  4JK1 X;  5EGO A;  1SAN A;  2LVS A;  4RM3 A;  3I59 A;  1YQA A;  4BYY A;  1A04 A;  2V9P A;  2DMP A;  3Q0V A;  3TDU C;  4BJ6 C;  4AUX A;  1FX7 A;  4N4O B;  5IP6 A;  3QRF F;  1XCV A;  3BR6 A;  1V5G A;  3DXJ F;  3U9G A;  3W2A A;  3SXY A;  3AAF A;  4EAT A;  3WU2 C;  2WTE A;  2XC7 A;  2XAJ A;  1JKR C;  1ZEL A;  4QWQ A;  3CCS I;  3WU1 B;  3A01 A;  2X1D A;  2GWR A;  2DAO A;  2M87 A;  3I9V 2;  4EJT A;  5DYM A;  3IHU A;  4XID A;  4IOA F;  3PL8 A;  4LMY A;  3K70 C;  1XDU A;  4X1E A;  1QRY A;  4EVI A;  4LK0 F;  2HZD A;  2K3P A;  3ZQL A;  4BGD A;  2M4G A;  1OCZ H;  3DBR B;  2WY7 Q;  4JP0 A;  1HDD C;  2F5E A;  4O5V A;  4RGR A;  4XLH A;  3H5R A;  3OIQ A;  3GME A;  4A6D A;  1FWZ A;  3HSR A;  3C18 A;  2ZSI B;  3MKY B;  2DA2 A;  3FM3 A;  2L7M P;  4YFX F;  3JRF A;  3VPR A;  3FDY A;  3KE2 A;  4JOM A;  1OQY A;  4EJU A;  2R93 J;  1S7A A;  1IW7 F;  2OV7 A;  3BLY A;  4I99 C;  2JUC A;  5FLM J;  2Y48 A;  3OWT A;  2GOX B;  3FIS A;  2HZT A;  2HVQ A;  4HST A;  4DNC A;  4II3 A;  3CZ6 A;  2XSJ C;  2HOE A;  1H8A C;  3SFI A;  5ED4 A;  2BVM A;  4WXH A;  1G59 A;  5F1J A;  3HOZ J;  3EET A;  1ON1 A;  3SHF A;  1N75 A;  2HDW A;  1RES A;  1X3U A;  3BY6 A;  3RDI A;  1Z21 A;  4G6T B;  5TIS C;  1ZAO A;  3AG4 H;  1Z1D A;  1MBK A;  2PG4 A;  2EZK A;  2XHK A;  3EUH C;  4M6X A;  2EH3 A;  5IOZ A;  4Z2Y A;  3CCU I;  1JTX A;  4ZJZ A;  2VB6 A;  1W36 C;  2BYV E;  4JX4 A;  4B48 A;  2XAQ A;  4Y33 A;  4U7B A;  2VL8 A;  3A02 A;  4IQ4 A;  1JKO C;  5H2F C;  2E1O A;  2M3A A;  4CYC B;  2H1L A;  4E6K G;  2G7U A;  3JAM K;  1HF0 A;  3FXJ A;  4EGY A;  1D1B A;  2JA8 J;  4PSW A;  5C44 J;  2YU3 A;  2DK8 A;  2LRE A;  4HA8 A;  1TQM A;  2JK3 A;  2FA5 A;  2L54 A;  3W3C A;  4MLO A;  3DTE A;  3JTG A;  2LY2 A;  3CCJ I;  2HKX A;  4KYW A;  4IL6 C;  4AU7 A;  3WTY C;  2OTL I;  4GXO A;  3RYR A;  2XKP A;  2HQ5 A;  3BZK A;  5EEG A;  3E97 A;  4FTH A;  1ORK A;  4UHT A;  2OCC H;  3DBL B;  5F0H A;  2DFH A;  1B72 B;  1X3W B;  3LQR A;  1BOB A;  2WV0 A;  3ML6 A;  3NWT A;  4IRG A;  1W1W E;  3S3N A;  1VQ7 I;  1LDK B;  4R8H A;  3D1N I;  4QPQ A;  1PP8 F;  1YW9 A;  3SJM A;  2ZFW A;  1I3Q J;  4DOZ A;  1SD6 A;  3C7J A;  1XMX A;  4R1H A;  4YIR X;  3LNQ A;  1R36 A;  3FHN A;  1F5T A;  1I3A A;  3CTA A;  2MAB A;  3DTK A;  3RPQ A;  4ETS A;  4L18 B;  2JTV A;  3HSF A;  1VQM I;  2KQR A;  2IS6 A;  2BBY A;  4IHS A;  1TLH B;  3WTS C;  3BZ6 A;  4EMS A;  2UV1 A;  4E7L A;  3PFY A;  4XLN F;  3C3W A;  5A2Q Z;  1HOM A;  2W4S A;  1TTY A;  2NVQ J;  3TMO A;  2G9W A;  2JVG A;  3ESW B;  3RKX A;  3WGG A;  2NYX A;  2XV4 S;  5DCF A;  3A0H C;  2F5F A;  4CYC A;  3WHB A;  3LAP A;  4CXF A;  2P4W A;  3EUA A;  2E71 A;  3GF2 A;  4B44 A;  1N78 A;  3K70 D;  3IWZ A;  2JPC A;  5HS7 A;  2ADU A;  2E1N A;  1S9H A;  1S7O A;  5FD6 A;  1CGP A;  5KAI C;  2EZH A;  1O57 A;  3F8F A;  3M1C A;  5D4R A;  2BY2 A;  1F4K A;  2L02 A;  2DMU A;  2OPT A;  2YUS A;  1JKP C;  3IAS 2;  1HKQ A;  3LST A;  2L7K A;  1K7A A;  4KMF A;  1B72 A;  1MMN A;  1BOA A;  3J7Y J;  1D8J A;  2R7U A;  2KJB A;  3OY9 A;  3D5L A;  3UKG A;  4BJT A;  4XMY A;  2IGN A;  3CDH A;  3LSH A;  3IUO A;  1YJW I;  1H89 C;  3GO5 A;  3IH2 A;  2UZK A;  1D8K A;  3H3U A;  4ZDO A;  3EUH A;  2Q8K A;  1EA3 A;  1B4A A;  4LG0 B;  1NH3 A;  3HJE A;  4GRI A;  1WJF A;  2E60 A;  4AYB A;  1BW6 A;  1TC3 C;  2PEX A;  2QWW A;  5FKM A;  2VOD A;  5GTI C;  1IG7 A;  3W6J B;  4C2T A;  2FJ1 A;  4B43 A;  3EYY A;  3ZXS A;  2GXG A;  2P5L C;  4RAF A;  4MTD A;  3MKZ A;  2W00 A;  2DDA A;  3LFU A;  4NDL A;  4DGW B;  2V6C A;  3AG1 H;  1ZLK A;  1S72 I;  2DI3 A;  2H1K A;  3F8M A;  1QQI A;  3O2P E;  2DA6 A;  5ICE A;  5CPR B;  2O3F A;  4NB5 A;  2IRF G;  3RCO A;  3OYG A;  2E7X A;  2XPW A;  1IF1 A;  1IN7 A;  4XSX F;  2X1E A;  4HQM A;  1W36 D;  4ZC3 A;  1U8B A;  4A3F J;  2A6H F;  5M3F J;  4CCM A;  3G71 I;  2LF7 A;  1BIA A;  5EEH A;  3S32 A;  3H9J A;  3CP2 A;  4PDK A;  1VQ8 I;  1V4R A;  1R23 A;  3M3Y J;  3CJN A;  2IT0 A;  3PIP F;  2DOE A;  1LVK A;  3A0B C;  3I55 I;  3T0Y A;  5DM7 F;  3Q0U A;  3CUQ C;  4OAY A;  4CZC A;  3GUD A;  4HNT A;  2DFI A;  2R4G A;  2VJJ A;  1EH6 A;  2HYF A;  2W85 A;  3SQN A;  1R1U A;  4LG0 A;  1W5S A;  5KNL A;  3CDL A;  2KP6 A;  2DYR H;  3I53 A;  1ZGA A;  3U1D A;  1FNN A;  4KMU X;  4M74 A;  4G12 A;  1MGT A;  3TW6 A;  2CMP A;  4IPA A;  1OYY A;  3KLO A;  1GUU A;  3A4C A;  2CJJ A;  3HGY A;  4C2M J;  2XAG A;  3S2W A;  1ZKG A;  4WCG A;  2KRF A;  5HLI A;  5FLX K;  3GLX A;  3TOB A;  3CJT B;  6PAX A;  2DU9 A;  3OL4 A;  2OA4 A;  2XAH A;  1ZK8 A;  2C6Y A;  4M3G A;  2CO5 A;  2M8E A;  4ABZ A;  2EZI A;  4HG2 A;  1I1S A;  3S93 A;  4XLF A;  1UHS A;  3S3M A;  3HYI A;  2VJ4 A;  1JXS A;  4A12 A;  2V6E A;  4C3H J;  1NK2 P;  1ZLJ A;  2D1V A;  3OYB A;  4F93 B;  3CUQ B;  1OMI A;  2XGX A;  3R6S A;  4AVZ A;  3TQN A;  3Q3S A;  5B3S H;  3OYJ A;  1IRF A;  1WRJ A;  2AQF A;  2QZ8 A;  1JT0 A;  5BMZ A;  1XMK A;  1MJA A;  4U0W A;  4BE1 A;  3QP5 A;  4RB2 C;  4L9T A;  4A0Y A;  1IRZ A;  3IL2 A;  1QHG A;  5HNF A;  2PBI A;  2I10 A;  2QSG X;  4PJL A;  2FD5 A;  1R00 A;  1WJB A;  4IHV A;  1P4W A;  1DUX C;  2KFD A;  1A6Q A;  1UJ8 A;  2QBY B;  4HQE A;  1LVA A;  1RET A;  2CGP A;  1TQI A;  2K3F A;  3B6C A;  2RDP A;  1E3P A;  3JSO A;  4LIT A;  3IP4 B;  2X51 A;  2EPF A;  5F04 A;  3K4J A;  1K6O A;  3ZQH A;  3GTL J;  2LDU A;  1FIA A;  2WAQ A;  3BCA A;  2YU9 J;  4BHB A;  3LSM A;  2K4B A;  4A3D J;  2JPB A;  3ASO H;  1VQ9 I;  2DW4 A;  1GXP A;  2EFW A;  4DYR A;  4RLF A;  3TP0 A;  3HKZ A;  1P4A A;  3ZPL A;  5F1R A;  3MFK A;  1GHC A;  1BC8 C;  2UXX A;  5LGT A;  1F36 A;  4N4N B;  1TT5 B;  1WPK A;  4F3Q A;  3I64 A;  2K4J A;  1BM9 A;  2XB5 A;  1RI7 A;  1E2X A;  4YFK F;  3S16 J;  2MG4 A;  2V1N A;  3UNG C;  4DYQ A;  4E7S A;  2QQA A;  4NNJ A;  2VJI A;  1RPW A;  2CH0 A;  4V2G A;  3BTI A;  3CUQ A;  1VQN I;  4LB6 B;  4C3J J;  2WAD A;  1NG6 A;  4KT6 A;  2PQ8 A;  3I5U A;  1EH8 A;  3OYC A;  2ID3 A;  3QWL A;  5CJ9 A;  1M1E B;  3L2U A;  2Y2Z A;  3M8J A;  4ZDP A;  4OAZ A;  3QU6 A;  5IY5 H;  4FQG A;  2IA2 A;  3BP8 A;  3L7W A;  5K5O A;  1O7L A;  5ILU A;  4UXN A;  2QSH X;  1ZG5 A;  2XGD A;  1A31 A;  2QBY A;  2ID6 A;  3LSJ A;  4XLP F;  1Y1W J;  3BG9 A;  2VIX A;  5K7F A;  3WTX C;  2LNB A;  4ZTJ A;  4I2O A;  4ZH4 F;  5EZH A;  2A5W A;  1T38 A;  2E7W A;  2M34 A;  3DWL E;  1ETQ A;  4II2 A;  1XB4 A;  5JLW A;  1MH4 A;  3S8P A;  3F22 A;  1VQP I;  1E3H A;  2BHZ A;  2VBY A;  2KZV A;  4HLY A;  4RMN A;  1U3E M;  3KZI C;  1Y8R B;  1JI8 A;  2OQR A;  2V1U A;  3MD2 A;  4RS8 A;  1OIS A;  4M3F A;  2RV8 A;  4RB1 A;  2ISZ A;  3KX2 A;  2K85 A;  3HL2 A;  2P5K A;  4UNO A;  2EK5 A;  2HFH A;  3TW7 A;  1QHH D;  2ZJ2 A;  3JRD A;  1HXD A;  4KIG A;  1W4M A;  4WK8 F;  3KET A;  4EQQ A;  4OOI A;  3MN2 A;  1JJ6 C;  4AIK A;  2L4M A;  3M8E A;  1FBQ A;  3MVP A;  2HKO A;  4KJZ A;  5C4J J;  3DV8 A;  3CC2 I;  2DYS H;  1DU0 A;  1X1B A;  2JVH A;  3HOX J;  4Q5S F;  2Y9Y A;  2RVC A;  3K2A A;  1S8N A;  3I4M J;  5HDN A;  3K4M A;  1IAW A;  1HW1 A;  2V79 A;  1MBH A;  2WWY A;  4G9Y A;  2YS9 A;  3DPU A;  4N9H A;  3G1M A;  4G94 A;  4XLE A;  5BQT A;  1GVJ A;  4G6D A;  2Z99 A;  2H27 A;  2OF7 A;  2LK2 A;  3OR2 C;  2R7R A;  4ZTF A;  2CV0 A;  1K79 A;  1FLI A;  1XSV A;  4W1U A;  4ESB A;  5HVQ C;  3OSF A;  5J1R A;  2JRM A;  1RNL A;  3VOD A;  1HC8 A;  2FF4 A;  3FXL A;  3IWF A;  4FIS A;  4M9Z A;  2F5V A;  1YJN I;  3FM5 A;  2VLA A;  3BZC A;  2LKP A;  5D6F A;  1AU7 A;  5E1X A;  1IN8 A;  3HXL A;  3WOD F;  2A3S A;  1YG2 A;  1WKM A;  3U21 A;  3WG9 A;  1O3R A;  2MLG A;  4BQN A;  1XGN A;  2F5C A;  1BI3 A;  2VXD A;  5J40 A;  1GV2 A;  5KVR A;  3CC7 I;  3CUO A;  4V19 K;  1F9N A;  3ZQQ A;  2JSP A;  3BJO A;  3PJR A;  4A5M A;  1KYZ A;  2BVL A;  2WB1 N;  5TJJ A;  1O3Q A;  1TW2 A;  4M9X A;  3FXU A;  3U2R A;  1B6A A;  2NOJ B;  2XKO A;  2ZXI A;  4IKF A;  3O8G A;  2DN0 A;  1VF9 A;  3V7C A;  2LMD A;  1WJD A;  3J7Z I;  2QSF X;  1UEL B;  2EB7 A;  2EFO A;  2J5O A;  4KUM A;  3P5J A;  1IN6 A;  3IH3 A;  4IOC F;  1P9Q C;  3OR1 C;  2EFP A;  3FMS A;  3O6B B;  4Q47 A;  4CZZ A;  4BY1 J;  3KP2 A;  1KQ9 A;  1DGR M;  1MSE C;  1V3F A;  1Z6T A;  4YII A;  1J59 A;  1KGS A;  2LTP A;  3T8R A;  2VUM J;  2JSC A;  5HDG A;  2M0M A;  1WCM J;  4U0Y A;  3CO7 C;  2BXY A;  1IXR C;  3ZMS A;  3H9Q A;  2XUB A;  4LJZ F;  2DFF A;  3T1B A;  1TBX A;  2FQ4 A;  2G7H A;  3MCZ A;  4AWX B;  4PJM A;  3JTH A;  1I6X A;  5DD8 A;  5CYV A;  3Q5F A;  2UXN A;  3WU0 A;  5FLV A;  2HGC A;  2VKD A;  5K7H A;  4QTR A;  4A2U A;  3RQI A;  2LG4 A;  3A2K A;  2DCE A;  1G4D A;  1IN5 A;  3VYU B;  2VPR A;  2Y69 H;  4NC8 A;  2CUF A;  1LE8 B;  3OMY A;  1Z6R A;  3HPH A;  4XOP A;  3BJ6 A;  1WVR A;  2DMT A;  1FYM A;  5ICG A;  5JR3 A;  3S1M J;  1YO5 C;  2DA7 A;  4KNY A;  1SVO A;  5M5W J;  1ZG3 A;  5GTH C;  5JI6 A;  4XR6 A;  3OYH A;  4Y7N J;  3VSL A;  2E2J J;  3KCC A;  1MBF A;  2X6Y A;  1AWC A;  5E8G A;  1MSF C;  5CVJ A;  1U8R A;  1E0E A;  3F72 A;  2L4A A;  3FBI B;  1K78 B;  5DEQ A;  2BEO A;  4WF2 A;  1BW5 A;  2PMZ A;  3KLN A;  1T0F A;  3HGG A;  5BS6 A;  2GA1 A;  3FHZ A;  2CS3 A;  1MBJ A;  3DEE A;  4LLG F;  4BY7 J;  1H9G A;  3N97 A;  3H5N A;  1WZ2 A;  2VE9 A;  1FOK A;  3RKW A;  3E5Q A;  3VB2 A;  3JCU C;  2LD5 A;  3GFI A;  1O7F A;  4P9F A;  1IC8 A;  4HSR A;  1R5I D;  1IJW C;  2P7V B;  4ASN A;  4L0Z B;  3FMR A;  2R7X A;  3D0S A;  2ECB A;  2E2I J;  2DOA A;  1Z7U A;  2Y30 A;  2LLK A;  1OYI A;  4NUB A;  2F4I A;  2IA0 A;  1P2F A;  3KP6 A;  4KDP A;  3CF5 F;  5LBQ A;  2COM A;  5J1Y A;  3T5X A;  5E3O A;  3SEQ A;  1UST A;  5LHH A;  5IT3 A;  2Z3Y A;  3BR0 A;  2P7C B;  2OQG A;  1LE8 A;  4BH9 A;  1IXC A;  3MQ0 A;  1EJ9 A;  4I09 A;  5BPI A;  5CVV A;  2J5P A;  3IKV A;  1KQ8 A;  3K10 A;  3WGH A;  4ENK A;  2KRH A;  4UB6 C;  3WTW C;  1PUE E;  2BY3 A;  3SFZ A;  4BAY A;  4O3M A;  1BA5 A;  2IGO A;  2O0Y A;  1K78 A;  2CW8 A;  1Z91 A;  2IS4 A;  2MC4 A;  2CG4 A;  4BUP A;  4DBR A;  2BE5 F;  3CCL I;  4CSW A;  1HW5 A;  5CVR A;  4XRS A;  2D1H A;  4RM2 A;  1BI2 A;  3H5A A;  1SFK A;  4IVN A;  2QVO A;  3R61 A;  1LDJ A;  3RYP A;  3QYB A;  4PSX A;  1MIJ A;  3K2Z A;  3NEU A;  1MNM C;  4PJN A;  3ELK A;  2MA3 A;  3JRA A;  1ONV A;  2KZG A;  1POG A;  1X1P A;  4X6A J;  1FOX A;  2HXO A;  1MJB A;  3GTK J;  3QU3 A;  1K61 A;  1FJL A;  2CUZ A;  1R22 A;  2NVY J;  4CUG A;  5EEA A;  1IUY A;  5E20 A;  2RRE A;  1HA8 A;  3GCM A;  3LSP A;  1YTY A;  4LIV A;  2Y75 A;  3ABL H;  2CUJ A;  3DP7 A;  2EA2 A;  2KIF A;  2OJE D;  2HR3 A;  4D0P A;  4NQW B;  5HNH A;  2XRL A;  2EJR A;  4PUS A;  5E3N A;  1QVU A;  2LC2 A;  2PN6 A;  4B47 A;  3HC7 A;  2QEX I;  1Z0X A;  1KU3 A;  4F52 A;  5B5E C;  5D8L B;  4C2U A;  4P96 A;  2OD5 A;  2V1X A;  3GTG J;  4PGG A;  2KIU A;  5IT9 K;  4XIC A;  3TBI A;  3PNY A;  3K4C A;  4XOT A;  3ZP5 A;  2TRT A;  1KU9 A;  4A5N A;  2CFO A;  3LQQ A;  1Y0U A;  4YEJ A;  1D3Y A;  4A0X A;  1I5Z A;  3E3V A;  3P9C A;  4A3C J;  1MD0 A;  2CW7 A;  2STT A;  4M6Y A;  2VI6 A;  1YLF A;  1BR4 A;  1RR8 C;  2LF8 A;  2QLZ A;  2GZW A;  1OJL A;  3DEU A;  3IRR A;  3RKY A;  3AL0 B;  3PUF A;  3HB9 A;  5ICF A; 
#chains in the Genus database with same CATH homology
 2P8T A;  1ZYR F;  2CW0 F;  5FGM A;  4CIC A;  3F23 A;  2LSO A;  1XD7 A;  3DFG A;  2O61 A;  5TRD A;  4TV7 A;  3G3Z A;  3L09 A;  1FC3 A;  4ENJ A;  1SMT A;  2H94 A;  2RC4 A;  1DPR A;  4BXU A;  1T98 A;  1ZG1 A;  3PQJ A;  4IJA A;  5D5W B;  4NQW A;  3M8F A;  1BIB A;  5AIQ A;  4IHT A;  4YFN F;  3J7A O;  3E6C C;  4I7H A;  4LK1 F;  3GYH X;  2YR2 A;  2ZKZ A;  3HRT A;  1C0W A;  5L3D A;  5E1Z B;  3M1E A;  2R7F A;  4KN4 X;  1RZ4 A;  1XGS A;  4RGS A;  3P9I A;  1KQ0 A;  3K1N A;  3P7N A;  5DUI A;  2IA1 A;  4F7Z A;  1LB2 A;  2MLK A;  2CFX A;  2VXZ A;  5HS8 A;  4OU0 A;  1R5H A;  2ZO4 A;  1B9N A;  1QO0 D;  4EGZ A;  1S29 A;  3FF5 A;  2FNA A;  2K7L A;  1ZH5 A;  2ESH A;  2MC3 A;  2O6G E;  1UCR A;  1KU2 A;  2JRT A;  1OPC A;  1XSX A;  5DDG A;  3IKT A;  2Y0M A;  3B02 A;  3E6M A;  2DK5 A;  2DQL A;  5HS9 A;  5L3G A;  4CHU A;  3HIF A;  1FPQ A;  3F8B A;  1ZHF A;  5JHU A;  1ZRD A;  4G6Q A;  2CYY A;  2FMY A;  1SFE A;  1XN7 A;  3R0J A;  2ZXJ A;  5FD5 A;  4S05 A;  1QNT A;  3JAM Z;  3M9A A;  1IRG A;  2BV6 A;  2PI0 A;  2XAS A;  3HOS A;  1LDD A;  2QM3 A;  3IC7 A;  2ZME B;  1FZP B;  3R0A A;  4P55 A;  1FT9 A;  3QAH A;  2IPQ X;  2EA4 A;  2MH2 A;  5LRR A;  4HDU A;  2ETH A;  4XSZ F;  4FX4 A;  2RQP A;  4MNU A;  2Q0O A;  4OIQ F;  2DBB A;  2OZ6 A;  3KP5 A;  4MQ9 F;  1F1Z A;  1FYK A;  1STZ A;  2K02 A;  4KN7 X;  3HTU A;  4HX7 A;  2K86 A;  3FXQ A;  5H6Q A;  2NNN A;  1XDS A;  1ZN2 A;  1T6S A;  3B73 A;  5ICC A;  1U78 A;  5JFR A;  4P5O A;  4WXD A;  2YPR A;  2FBH A;  2QQ9 A;  3GFJ A;  2ZME A;  1AOY A;  3KZY A;  2ESN A;  1CF7 B;  3LAJ A;  5L3C A;  4U7D A;  5BPD A;  4AD9 A;  1G3W A;  3LA3 A;  4UV9 A;  3FXR A;  4YIF A;  4I98 B;  3MZY A;  5LGU A;  1YS6 A;  3GFL A;  1GXQ A;  2P6S A;  1R7J A;  3EYI A;  4IXA A;  4KIC A;  1SD7 A;  5CLS A;  4KIF A;  5FO5 A;  2EV5 A;  3C1D A;  1NHA A;  3IRQ A;  1XGM A;  3VFZ A;  4CDG A;  4K2E A;  2ZNZ A;  4OIP F;  2Z5U A;  3WE3 A;  4NHJ A;  4ESJ A;  2HQR A;  3I4P A;  4ESF A;  4L5I A;  2TDX A;  4N0B A;  4ZYG A;  2HYG D;  3Q9V A;  1CF7 A;  4CGZ A;  3GXO A;  1REP C;  2M5W A;  3V8K A;  1JHF A;  5D6E A;  4RGX A;  4N9I A;  5ERI A;  3WGI A;  3BPV A;  1EH7 A;  1YW8 A;  2DTR A;  4HAM A;  2O03 A;  5DD4 A;  2VT3 A;  4LGW A;  4A0Z A;  1R1T A;  2IJL A;  2O8X A;  3GZ6 A;  2Q2E A;  1J75 A;  1D5V A;  5FLX Z;  5LLQ A;  4R79 A;  4M71 A;  5F6F A;  2FRH A;  3J80 K;  4EM1 A;  1J2X A;  4OMZ A;  3V7S A;  3V8L A;  2RN7 A;  1LNW A;  3H3Z A;  3ZMV A;  2A68 F;  3BPX A;  2H6C A;  1HKS A;  2X0L A;  3CLO A;  3M7G A;  3ECO A;  1PDN C;  3ABT A;  4PCQ A;  4UUV A;  2A6E F;  3GFM A;  2GQQ A;  1B9M A;  3GWZ A;  1FP1 D;  4E70 A;  5CVI A;  2D2W A;  1G3T A;  3RPU A;  4GO1 A;  3J81 K;  1DPU A;  4OIN F;  2AS5 F;  3I71 A;  3F6O A;  5FFZ A;  1ZRE A;  2B0L A;  4GYI A;  5D5X B;  4P9U A;  4Y13 A;  3WTU C;  2W25 A;  4HBL A;  2E1C A;  3L9F A;  4HZF A;  2DQR A;  2M45 A;  2NNY A;  1B59 A;  1UHM A;  4HW0 A;  3RJP A;  3O3K A;  3HRM A;  5BOX A;  3HOT A;  3Q9S A;  4WX9 A;  2FOK A;  3WTT C;  4WWC A;  2QEN A;  4GYG A;  3GZ5 A;  5DV5 A;  3QPH A;  4Q4Z F;  4G8X A;  3NRV A;  1J5Y A;  4KT5 C;  3L00 A;  1TNT A;  5D5V B;  1DP7 P;  4UV8 A;  3TO6 A;  1LEA A;  1P4X A;  1HKT A;  2OZU A;  3DKW A;  2WC2 A;  3PQK A;  4JQF A;  2VON A;  1TNS A;  3LA7 A;  2AXL A;  5F64 A;  3HHH A;  1H0M A;  5DCM B;  5FB2 A;  1KU7 A;  4IRI A;  2K27 A;  1JE8 A;  4HV5 A;  2ACJ A;  3F21 A;  3ZN1 A;  1T39 A;  4HX4 A;  1IZ1 A;  4MTE A;  4HF0 A;  4HF2 A;  1USS A;  2OBP A;  1R5G A;  3P9K A;  1HSJ A;  1KA8 A;  3ULQ B;  4EJW A;  2H6B A;  5LHG A;  5E18 F;  3KFW X;  2MBF A;  1SD5 A;  4ZZD A;  2GIV A;  3K1P A;  4G7O F;  5L3E A;  4LB5 A;  3V4G A;  2QUF A;  4FHT A;  4WXC A;  2R3S A;  3QOP A;  2JZY A;  4ON0 A;  3PFI A;  2KIM A;  3I0T A;  5DCM A;  1S6L A;  1Q1H A;  1RUN A;  1G6N A;  4LFU A;  3ECH A;  1WWX A;  4KIB A;  1BI1 A;  5A2Q K;  2GA2 A;  2CSO A;  2NS0 A;  4B09 A;  2A69 F;  3ZQ7 A;  2L3D A;  2IW5 A;  5D8K B;  4DQ2 A;  5AIP A;  2A07 F;  2MH9 A;  1PP7 U;  4BHC A;  2R7D A;  4AIH A;  3RIR A;  3FWE A;  4ZYD A;  5LHI A;  2KKO A;  5ILV A;  4ZZL A;  1OR7 A;  4CO8 A;  5D4S A;  4IRH A;  1WI9 A;  4OIR F;  5KK1 A;  1FYL A;  1UFM A;  1MJ9 A;  5K5R A;  4FX0 A;  1HST A;  4M73 A;  1S3J A;  2M1B A;  3TGN A;  4HOB A;  2VBX A;  2RKH A;  5LRS A;  4HF1 A;  2XIG A;  3TO7 A;  5E1W A;  4OIO F;  4M72 A;  4EM0 B;  5E17 F;  1U6G A;  3NQO A;  4M9S A;  1XMA A;  4UVC A;  3BRO A;  2HEO A;  4IF4 A;  3QPT A;  4PGH A;  1MDM B;  1ZRC A;  1BBY A;  1R58 A;  1FBS A;  3EDP A;  1B1B A;  4EM2 A;  1UB9 A;  3TDZ C;  3GVA A;  2W57 A;  1EV7 A;  2ZNY A;  2PLY A;  3MAJ A;  2Z9O A;  2NRA C;  3WTZ A;  2OU2 A;  3ABU A;  3EQL F;  3COA C;  5LEJ A;  1J9I A;  3WTV C;  3QP6 A;  1W5T A;  4GCV A;  4Y17 A;  1XGO A;  2QQB A;  1Z05 A;  4Y15 A;  2ZBK A;  1ZGJ A;  3SZT A;  3FX3 A;  5HLG A;  2ISY A;  1SMY F;  5IT9 Z;  4L9N A;  4GGG A;  5E8I A;  2JT1 A;  2FE3 A;  2HDC A;  5J6X A;  5HLH A;  1VTN C;  3HRS A;  1QGP A;  1RUO A;  5LEK A;  1MDM A;  4ZYE A;  1XSD A;  2DLL A;  5HDK A;  3V7R A;  3DQV C;  3BWG A;  4EV0 A;  2RGV A;  1U5T C;  2P5V A;  2KJC A;  1E17 A;  2NAZ A;  2FQ3 A;  4BHP A;  4ENN A;  2VN2 A;  2GAU A;  1LEB A;  2FBI A;  5CVU A;  5FFX A;  2VBW A;  1H9T A;  1ON2 A;  1YIO A;  1ODD A;  1SD4 A;  4O6J A;  3DPT A;  1MKM A;  3ZMU A;  2PJP A;  3VEP A;  4MEX F;  2GXB A;  2VE8 A;  5JVT A;  3OOP A;  3CO6 C;  2FSW A;  1YYV A;  3E6B A;  4RAY A;  1U5T B;  3ERE D;  5D5U B;  3ZMT A;  1O3S A;  3ROU A;  3DPL C;  2X4H A;  5J8C A;  1J7K A;  3HTS B;  3DF8 A;  3V8J A;  3E6D A;  3R60 A;  1BJA A;  3GW2 A;  4I0B A;  4L9V A;  2VOP A;  4Q48 A;  2D45 A;  2YSR A;  5HOO A;  3HHG A;  1BN5 A;  1LQ1 A;  3K1M A;  4LD5 A;  1SFU A;  1SAX A;  3OV8 A;  4B8X A;  2F2E A;  3E5U A;  4AVP A;  1UHW A;  5H6R A;  3LFK A;  2VC1 A;  3MWM A;  3FMQ A;  4AIJ A;  1FSH A;  2BGC A;  1QBJ A;  3RTR A;  1RIO H;  1G3S A;  4RB0 A;  1ZAR A;  1U5T A;  4RB3 C;  4XRF A;  3REO A;  3VOE A;  3W6K B;  1TW3 A;  3ISP A;  1YW7 A;  4I0A A;  5AON A;  3GX4 X;  1T2K A;  2HTS A;  2XVC A;  1HBX G;  4L9J A;  2QYO A;  2YX4 A;  3LWF A;  1XCB A;  5LGN A;  3L2C A;  3WE2 A;  3H92 A;  2DPD A;  3ZN0 A;  1P6R A;  1TQP A;  1DDN A;  1P92 A;  4U0V A;  3GEZ A;  5K5Q A;  3K9T A;  3JSP A;  4L0Y B;  2PMU A;  4MHG A;  1JHH A;  4ZYH A;  3SZP A;  2EV6 A;  4HYE A;  2FU4 A;  1ULY A;  3TKY A;  4RGU A;  3JW4 A;  4EJO A;  3N4M A;  3KP7 A;  2EWN A;  2CQK A;  4MQV A;  5K1Y A;  1ZRF A;  5H20 A;  2FNP A;  2H09 A;  1WQ2 A;  2VBZ A;  2XRN A;  4BNC A;  1G3Y A;  2VC0 A;  1FY7 A;  3K0L A;  3HRU A;  3FZV A;  2FBK A;  1OKR A;  4EJV A;  2HQN A;  2OAZ A;  1L0O C;  1IXS B;  3BDD A;  5L3B A;  2EFQ A;  1I1G A;  4CYD A;  4XBF A;  4L5J A;  3I58 A;  2P6T A;  1QZZ A;  2ELH A;  4YG2 F;  1W7P B;  2HS5 A;  2F5D A;  4PZJ A;  2DPU A;  3TOA A;  2W84 A;  1R1V A;  2PFB A;  4LLN A;  3E5X A;  2M30 A;  4MGR A;  2MD5 A;  3LA2 A;  2FML A;  3KEQ A;  3KP4 A;  4I02 A;  1WSU A;  4LLL A;  4UVA A;  3HUG A;  3T8T A;  2VOO A;  4UVB A;  3G73 A;  1U2W A;  4G7Z F;  3I54 A;  5ILS A;  4MEY F;  2PMH A;  2L01 A;  1LJ9 A;  4I01 A;  1FBU A;  2EV0 A;  4HDV A;  3MZH A;  1BC7 C;  5L3F A;  2IVM A;  1MZB A;  4A6E A;  4U88 A;  3F8N A;  3F8C A;  1W7P A;  4JBA A;  4FT8 A;  1YS7 A;  1HQC A;  2Z33 A;  3HSE A;  2UWM A;  4OMY A;  3F6V A;  2FXA A;  2DT5 A;  5DUK A;  2VT2 A;  1BI0 A;  1KYW A;  5J8F A;  2V9V A;  1OYW A;  2ZCW A;  3J80 Z;  2STW A;  1W7P D;  4HV6 A;  1Z9C A;  2XRO A;  3KEO A;  2A5Y B;  2FEZ A;  4HX8 A;  2W24 A;  1IN4 A;  1JGS A;  1QZY A;  4ENM A;  4H0E A;  2IP2 A;  3I59 B;  1YFH A;  4G7H F;  3R4K A;  1QPM A;  4QLC U;  3BJA A;  3ZMZ A;  3K69 A;  2HWV A;  3KZZ A;  4KA4 A;  1I27 A;  3J81 Z;  3MEX A;  4KFC A;  1J0R A;  1FP2 A;  2XAF A;  2A61 A;  1HW2 A;  1FSE A;  2V1D A;  3KP3 A;  4BQA A;  2YX7 A;  1SFX A;  2RNJ A;  4RAZ A;  1O3T A;  3BOQ A;  3TO9 A;  2DO7 A;  2HTJ A;  3RI4 A;  3ZMD A;  2EFN A;  2CWE A;  1L3L A;  4S04 A;  4HLX A;  3F3X A;  4JK1 X;  3I59 A;  1YQA A;  4BYY A;  1A04 A;  3TDU C;  1FX7 A;  3QRF F;  1XCV A;  3DXJ F;  3U9G A;  3SXY A;  3AAF A;  2WTE A;  2XAJ A;  4QWQ A;  3WU1 B;  2GWR A;  2DAO A;  2M87 A;  5DYM A;  3IHU A;  4LMY A;  1XDU A;  4EVI A;  4LK0 F;  2F5E A;  4O5V A;  4RGR A;  4A6D A;  1FWZ A;  3HSR A;  3C18 A;  3FM3 A;  4YFX F;  3KE2 A;  4EJU A;  1S7A A;  1IW7 F;  2Y48 A;  2HZT A;  4DNC A;  2HOE A;  5ED4 A;  4WXH A;  3EET A;  1ON1 A;  3SHF A;  1X3U A;  3BY6 A;  3RDI A;  1ZAO A;  1Z1D A;  2PG4 A;  2XHK A;  4M6X A;  4Z2Y A;  2BYV E;  2XAQ A;  4U7B A;  2G7U A;  3JAM K;  4EGY A;  2YU3 A;  2DK8 A;  4HA8 A;  1TQM A;  2FA5 A;  2L54 A;  3JTG A;  4KYW A;  2HKX A;  3WTY C;  4GXO A;  3RYR A;  2XKP A;  5EEG A;  3E97 A;  4UHT A;  3LQR A;  2WV0 A;  3ML6 A;  4IRG A;  1LDK B;  4R8H A;  1PP8 F;  1YW9 A;  2ZFW A;  1SD6 A;  3C7J A;  4R1H A;  1R36 A;  1F5T A;  3CTA A;  3RPQ A;  4ETS A;  4L18 B;  2JTV A;  3HSF A;  2BBY A;  4IHS A;  1TLH B;  3WTS C;  3BZ6 A;  4EMS A;  4XLN F;  3C3W A;  5A2Q Z;  1TTY A;  2G9W A;  3RKX A;  3WGG A;  2NYX A;  2XV4 S;  5DCF A;  2F5F A;  3LAP A;  4CXF A;  2P4W A;  3GF2 A;  3IWZ A;  2JPC A;  5HS7 A;  2ADU A;  2E1N A;  5FD6 A;  1S7O A;  1CGP A;  1O57 A;  3F8F A;  5D4R A;  1F4K A;  2L02 A;  1HKQ A;  3LST A;  1K7A A;  4KMF A;  1BOA A;  1D8J A;  2KJB A;  3D5L A;  3CDH A;  3GO5 A;  2UZK A;  1D8K A;  3H3U A;  3EUH A;  2Q8K A;  1B4A A;  4LG0 B;  2PEX A;  2QWW A;  2VOD A;  3W6J B;  3EYY A;  2GXG A;  2P5L C;  4MTD A;  2V6C A;  1ZLK A;  2DI3 A;  3F8M A;  1QQI A;  3O2P E;  5ICE A;  2O3F A;  4NB5 A;  2IRF G;  2E7X A;  1IF1 A;  1IN7 A;  4XSX F;  4HQM A;  2A6H F;  2LF7 A;  1BIA A;  5EEH A;  4PDK A;  1V4R A;  1R23 A;  3CJN A;  2IT0 A;  3T0Y A;  3CUQ C;  3GUD A;  2DFI A;  3SQN A;  1EH6 A;  2HYF A;  2W85 A;  1R1U A;  4LG0 A;  1W5S A;  3I53 A;  1ZGA A;  3U1D A;  1FNN A;  4KMU X;  4M74 A;  1MGT A;  4IPA A;  1OYY A;  3KLO A;  2XAG A;  3S2W A;  4WCG A;  2KRF A;  5HLI A;  5FLX K;  3GLX A;  3TOB A;  6PAX A;  2DU9 A;  2OA4 A;  2XAH A;  2C6Y A;  2CO5 A;  2M8E A;  1I1S A;  3HYI A;  1JXS A;  4A12 A;  1ZLJ A;  2D1V A;  3CUQ B;  1OMI A;  2XGX A;  3R6S A;  3TQN A;  1IRF A;  1WRJ A;  2QZ8 A;  5BMZ A;  1XMK A;  1MJA A;  4U0W A;  3QP5 A;  4RB2 C;  4L9T A;  4A0Y A;  3IL2 A;  2PBI A;  1R00 A;  1P4W A;  1DUX C;  2QBY B;  4HQE A;  1LVA A;  2CGP A;  1TQI A;  2RDP A;  3JSO A;  1K6O A;  2LDU A;  4BHB A;  2K4B A;  2JPB A;  2DW4 A;  1GXP A;  2EFW A;  1P4A A;  3ZPL A;  5F1R A;  3MFK A;  1GHC A;  1BC8 C;  2UXX A;  5LGT A;  3I64 A;  2K4J A;  1BM9 A;  1RI7 A;  1E2X A;  4YFK F;  2QQA A;  3CUQ A;  4LB6 B;  2PQ8 A;  3I5U A;  1EH8 A;  5CJ9 A;  3QU6 A;  2IA2 A;  3BP8 A;  3L7W A;  5K5O A;  1O7L A;  5ILU A;  4UXN A;  1ZG5 A;  2QBY A;  4XLP F;  3WTX C;  2LNB A;  4I2O A;  4ZH4 F;  1T38 A;  2E7W A;  4EJT A;  1XB4 A;  3F22 A;  2VBY A;  1U3E M;  4HLY A;  2OQR A;  2V1U A;  4RS8 A;  2RV8 A;  4RB1 A;  2ISZ A;  2P5K A;  4UNO A;  2EK5 A;  2HFH A;  2ZJ2 A;  1HXD A;  4KIG A;  1W4M A;  4WK8 F;  3KET A;  4EQQ A;  4OOI A;  4AIK A;  2L4M A;  3M8E A;  1FBQ A;  2HKO A;  3DV8 A;  4Q5S F;  2RVC A;  1S8N A;  5HDN A;  1IAW A;  1HW1 A;  2V79 A;  2WWY A;  4G9Y A;  4N9H A;  4G94 A;  5BQT A;  1GVJ A;  4G6D A;  2Z99 A;  2H27 A;  1K79 A;  1FLI A;  1XSV A;  4ESB A;  5HVQ C;  1RNL A;  3VOD A;  2FF4 A;  3IWF A;  4M9Z A;  3FM5 A;  2LKP A;  5D6F A;  5E1X A;  1IN8 A;  3WOD F;  2A3S A;  1YG2 A;  1WKM A;  1O3R A;  3WG9 A;  2MLG A;  1XGN A;  2F5C A;  1BI3 A;  5KVR A;  3CUO A;  1F9N A;  3BJO A;  4A5M A;  1KYZ A;  5TJJ A;  1O3Q A;  1TW2 A;  4M9X A;  3FXU A;  3U2R A;  1B6A A;  2XKO A;  3V7C A;  2J5O A;  2EB7 A;  2EFO A;  4KUM A;  1IN6 A;  2EFP A;  3FMS A;  3O6B B;  4Q47 A;  4CZZ A;  3KP2 A;  1KQ9 A;  1V3F A;  1Z6T A;  4YII A;  1J59 A;  1KGS A;  3T8R A;  2JSC A;  5HDG A;  4U0Y A;  3CO7 C;  1IXR C;  3ZMS A;  2XUB A;  4LJZ F;  3T1B A;  1TBX A;  2G7H A;  4AWX B;  3MCZ A;  3JTH A;  1I6X A;  5DD8 A;  5CYV A;  3Q5F A;  2UXN A;  3WU0 A;  2HGC A;  4A2U A;  1G4D A;  1IN5 A;  1Z6R A;  3BJ6 A;  1FYM A;  5ICG A;  5JR3 A;  1YO5 C;  4KNY A;  1ZG3 A;  5JI6 A;  3KCC A;  1AWC A;  5E8G A;  5CVJ A;  1U8R A;  3F72 A;  2L4A A;  1K78 B;  5DEQ A;  2BEO A;  4WF2 A;  3KLN A;  1T0F A;  5BS6 A;  2GA1 A;  3FHZ A;  4LLG F;  1H9G A;  3N97 A;  2VE9 A;  1FOK A;  3RKW A;  3E5Q A;  3VB2 A;  3GFI A;  1O7F A;  4P9F A;  2P7V B;  4ASN A;  4L0Z B;  3FMR A;  3D0S A;  1Z7U A;  1OYI A;  2IA0 A;  1P2F A;  3KP6 A;  4KDP A;  5LBQ A;  2COM A;  3T5X A;  1UST A;  5LHH A;  5IT3 A;  2Z3Y A;  2P7C B;  2OQG A;  4BH9 A;  1IXC A;  3MQ0 A;  4I09 A;  5BPI A;  5CVV A;  2J5P A;  3IKV A;  1KQ8 A;  3WGH A;  4ENK A;  3WTW C;  1PUE E;  4BAY A;  3SFZ A;  4O3M A;  2O0Y A;  1K78 A;  1Z91 A;  2CG4 A;  2BE5 F;  1HW5 A;  5CVR A;  2D1H A;  1BI2 A;  4IVN A;  2QVO A;  3R61 A;  1LDJ A;  3RYP A;  3K2Z A;  3NEU A;  3ELK A;  2MA3 A;  1ONV A;  1MJB A;  3QU3 A;  1R22 A;  1IUY A;  5E20 A;  1YTY A;  2Y75 A;  3DP7 A;  2EA2 A;  2KIF A;  2HR3 A;  4D0P A;  2EJR A;  2PN6 A;  1KU3 A;  5D8L B;  4P96 A;  2OD5 A;  2V1X A;  4PGG A;  2KIU A;  5IT9 K;  3ZP5 A;  1KU9 A;  4A5N A;  3LQQ A;  1Y0U A;  1D3Y A;  4A0X A;  1I5Z A;  3E3V A;  3P9C A;  1MD0 A;  2STT A;  4M6Y A;  1YLF A;  2LF8 A;  2QLZ A;  2GZW A;  3DEU A;  3IRR A;  3RKY A;  5ICF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...