5AIPA

Crystal structure of nadr in complex with 4-hydroxyphenylacetate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
141
structure length
141
Chain Sequence
b'MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 46
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aipA00
5L3DA 1O3QA 3COAC 1B9NA 1BI0A 2HGCA 3JTHA 3F8FA 5CJ9A 4BH9A 2WWYA 1GVJA 1IZ1A 1SMTA 1ON1A 2VT2A 1KU3A 3QPHA 2G7HA 1BM9A 5AIPA 1KQ0A 2PFBA 1ZREA 3LQRA 1I5ZA 4S04A 2DTRA 3WGIA 5FLXK 2ESHA 1P4WA 4HF0A 1REPC 2F5CA 2XUBA 2XGXA 1HQCA 4ZYGA 3T1BA 2EB7A 2K4JA 2D1VA 4HYEA 4EM0B 1J0RA 3HOSA 1OPCA 2IA0A 2KIUA 3EYIA 4P5OA 4HQEA 1QO0D 4O5VA 3RKXA 2CWEA 2RV8A 1R1TA 3T0YA 3CUQC 1TW2A 3H3UA 3OV8A 4EMSA 5DEQA 3V8LA 1T98A 4M73A 4IJAA 4EVIA 3WTXC 5CVUA 1J59A 2VXZA 2M1BA 2QQ9A 4I2OA 5FD6A 3GF2A 5FB2A 3HTSB 3HIFA 2A5YB 3M9AA 4U88A 2XVCA 1SD4A 2O6GE 3V8KA 2RC4A 3V7RA 3T8RA 2TDXA 1XCBA 4BYYA 5K1YA 5E8IA 2ISZA 1SFUA 5AIQA 1LNWA 3TGNA 2A68F 3R0AA 3D5LA 1P4XA 5L3FA 3ZN1A 1BBYA 2PG4A 2BV6A 4CZZA 3G3ZA 2XAQA 1BN5A 4RB3C 5LBQA 4CICA 4RB1A 2FSWA 1ODDA 5DCFA 1W7PD 1IN7A 1PP7U 3E6BA 2HR3A 5ED4A 5E1XA 1MZBA 3HSEA 4EJOA 4R79A 4A6DA 4XLNF 2BBYA 2GA2A 1Z7UA 3RI4A 4ETSA 3ZMVA 2YU3A 1J5YA 3BOQA 3KEOA 2DAOA 4XSZF 3BPXA 5TRDA 2ZMEA 2P5LC 3CO6C 5L3BA 4NB5A 2IA2A 4HA8A 2G9WA 4P9FA 2O03A 3M7GA 1RNLA 3PFIA 4KIGA 1QPMA 4BHBA 2ZXJA 4HLXA 2HTJA 4KMFA 3E3VA 6PAXA 2F5DA 3H92A 4IRIA 3F22A 1DPUA 1D3YA 5JFRA 1LDDA 1K78B 5KK1A 2L4AA 1FBQA 2QVOA 3QAHA 5K5QA 1YYVA 2LF7A 2VT3A 1K6OA 3MEXA 1U5TB 5L3GA 2Q8KA 2DPDA 2VBZA 3J81Z 1XMKA 1R7JA 3TDZC 3GFJA 1R36A 3MQ0A 2YR2A 1RUOA 2K27A 3FMSA 3GEZA 3IKVA 4HBLA 2QZ8A 1DDNA 1DUXC 2HDCA 3Q9VA 3E6CC 3MZHA 1YS6A 1Z9CA 2L3DA 2P8TA 3ZMTA 3BZ6A 2F5EA 3MCZA 2PMHA 1R00A 1IN5A 3E5XA 2PEXA 5HOOA 2CSOA 3BJOA 2DPUA 4U0YA 4HV6A 1IRGA 4AIJA 4ENMA 2A61A 3HOTA 1ZLJA 2VE9A 1R22A 4L9NA 3QRFF 4D0PA 1B59A 4EQQA 2F5FA 4FX0A 3BROA 3KLNA 4ZYEA 4ZZLA 2M8EA 3CUOA 1R1UA 1P92A 3GZ5A 5HS7A 1SAXA 3J80K 3D0SA 5L3EA 4OIRF 4RGRA 4Y15A 2HKOA 3VB2A 3WE3A 4LG0B 2QENA 2ZJ2A 1FY7A 2IT0A 4G7HF 1SD6A 1R5GA 1W7PB 5E8GA 1U6GA 2E1NA 2XAJA 1FNNA 4LLNA 4P55A 4RS8A 3U9GA 4PDKA 1BC8C 1CF7A 4JBAA 2R3SA 2M5WA 2ELHA 4EJWA 1XDUA 3EDPA 5ICCA 3F8BA 3C18A 4ENJA 1WI9A 2O3FA 1R1VA 4LMYA 1O57A 4G6QA 4LGWA 1XN7A 2COMA 2CFXA 2L4MA 1OYYA 5F6FA 3TOAA 2JTVA 4PGHA 2P4WA 2UWMA 2R7DA 3F3XA 3DXJF 2KKOA 3KP6A 4CGZA 5D8KB 2V9VA 3K69A 4YFKF 2IRFG 2M30A 2PI0A 2H27A 3F6VA 3K9TA 3ZPLA 5BPDA 4I0AA 4L9TA 4CO8A 3G73A 2GWRA 5D4RA 1B6AA 3CJNA 4PGGA 2P5KA 5E1WA 2DO7A 4OIPF 3SQNA 3J81K 1SD7A 3V8JA 3IWFA 1MDMA 1S7OA 4G6DA 4M71A 1PUEE 1H0MA 2MD5A 5AONA 3R4KA 1G6NA 2FMYA 1G3WA 2DW4A 2DFIA 1XGMA 3M8FA 3FMRA 1IXSB 2IW5A 4EJVA 1FZPB 3VODA 3HSRA 1KYWA 5J6XA 3VOEA 4KIFA 2ESNA 4WF2A 4CXFA 1UHWA 2PMUA 2VBYA 2BGCA 1HSJA 1LVAA 3R60A 4RGXA 1V3FA 2STWA 1O3RA 3I59B 4L18B 3HRSA 2HFHA 2EA2A 4IPAA 3L2CA 1BOAA 4XLPF 1DPRA 2XIGA 3K1PA 1XMAA 4PCQA 2A3SA 1KU9A 3TO9A 1G3TA 4WWCA 2OZ6A 3QPTA 5JI6A 2EV5A 2ZBKA 2P7VB 3K0LA 3P9IA 3GZ6A 3I5UA 2O8XA 1J7KA 2XASA 5LGNA 1VTNC 1K78A 3GFMA 5J8FA 1HBXG 4BNCA 5ERIA 2P5VA 2DQRA 3GO5A 4FT8A 3F8NA 3KP5A 5D5WB 2M87A 3OOPA 3EUHA 1U5TA 2PLYA 5LEKA 4L9JA 4ZYDA 2RGVA 2NNYA 1L3LA 1YW7A 1R23A 2XAHA 4L5IA 3JSOA 4P9UA 2ZCWA 5BS6A 4U7BA 3LA2A 3ULQB 4KDPA 2MC3A 4KUMA 3KP2A 3IL2A 4I02A 4MQVA 1H9TA 3BY6A 3SZTA 3B02A 4QWQA 1RIOH 5F1RA 2DU9A 1FLIA 1LQ1A 4MTDA 2FXAA 2DT5A 1FYKA 4G7ZF 2MA3A 3FX3A 1QQIA 1O3SA 1G3YA 2VBWA 4FX4A 5FFZA 3REOA 4AIHA 1WQ2A 4ESBA 2HTSA 3JAMK 2EFPA 5EEHA 4I0BA 4BAYA 4HAMA 2H6CA 4L0ZB 3AAFA 3FXUA 3DV8A 5LHHA 5DUIA 1K7AA 5EEGA 2QUFA 5CLSA 2VBXA 1GHCA 2P6SA 1X3UA 5J8CA 2KIMA 1RZ4A 3KETA 1XCVA 4LG0A 2HYGD 4KFCA 1W7PA 1CF7B 3BDDA 4NHJA 4BHPA 3GYHX 5ILUA 2BE5F 3L9FA 4RAYA 2RDPA 5H6RA 1R5HA 2OZUA 4M72A 3CO7C 1ONVA 2GA1A 4MNUA 2C6YA 3PQJA 1H9GA 1YLFA 4WXHA 4N0BA 3KE2A 1LB2A 2ETHA 3WG9A 3L09A 1RI7A 2E7WA 1W5TA 3MFKA 2X0LA 3JW4A 3KEQA 3CTAA 3Q9SA 1F9NA 2HKXA 3H3ZA 1U2WA 2F2EA 2EV0A 1MDMB 1BI3A 3RKWA 1IN8A 3T5XA 2DLLA 3BWGA 3VEPA 3WGGA 3BP8A 4ESFA 3RIRA 4LFUA 4AD9A 3M1EA 3GX4X 3FF5A 2FBIA 2B0LA 4A5NA 2OD5A 2FRHA 4MQ9F 1JXSA 3KZYA 4L9VA 2KRFA 4OINF 1D8JA 4S05A 2ZO4A 1FP2A 1LDJA 1T0FA 2Z9OA 2RVCA 2FMLA 2HQRA 2EFWA 2KJCA 4N9HA 1KU7A 2IPQX 1JE8A 2VOOA 2JZYA 1ZARA 4GYGA 3ZMUA 4UVBA 5DD8A 3I0TA 3PQKA 4HX7A 4G7OF 3I59A 4XBFA 1MJBA 1OYIA 3TO7A 1OR7A 1IAWA 1B9MA 2LNBA 4MTEA 5FGMA 1S3JA 3TDUC 4IHSA 2FU4A 2V6CA 2JT1A 1ZAOA 3I54A 2ADUA 3ECHA 2QWWA 2FBHA 4OMZA 3O2PE 5CVIA 2L02A 1HXDA 2FOKA 3ML6A 4ZZDA 2JSCA 3IRRA 5D5XB 1USTA 1TQMA 3EQLF 1TQPA 3DP7A 1U8RA 3E5UA 4WXCA 1S29A 1ZYRF 2H09A 3F8MA 5DYMA 4I7HA 1SFEA 2YPRA 1Z05A 2Q0OA 1I27A 5FFXA 1ZHFA 2CW0F 5LGUA 1ON2A 4EJUA 3B73A 3DQVC 2HQNA 4I09A 3GVAA 1P2FA 4G9YA 4A0YA 1CGPA 3C7JA 3RYRA 1TLHB 3KFWX 3RTRA 3LSTA 4HDVA 3HSFA 1B1BA 4GCVA 2CYYA 3E6DA 3I58A 4R8HA 5HS9A 2VE8A 4MEXF 2O0YA 1S7AA 3ZMZA 3DFGA 3WU0A 3WU1B 3LAPA 2W85A 3I71A 3RKYA 2DBBA 1J75A 4U0WA 1EH7A 1IN6A 2X4HA 4EV0A 2STTA 2MH9A 1TNSA 2ISYA 2FNPA 2EK5A 3T8TA 3P7NA 2D45A 1KQ9A 3V7SA 1K79A 1ZLKA 2XRNA 1FSEA 4M9SA 2W84A 4P96A 4UHTA 5ILVA 1ZRCA 4G94A 1UCRA 1QZZA 3SHFA 4DQ2A 1I1GA 1OYWA 1YFHA 2NAZA 4O6JA 4UV9A 2M45A 3W6KB 1LDKB 1IRFA 5LHIA 3P9KA 4BQAA 3FM3A 1FBUA 3FXQA 1Z6RA 4KA4A 5BPIA 3P9CA 4A5MA 4AIKA 4HX8A 1GXPA 2Z99A 3HHGA 2ACJA 3S2WA 4B09A 5HLHA 1U5TC 2KIFA 3K1NA 2VC1A 5FLXZ 3KCCA 2VODA 3IHUA 4RB2C 3FXRA 1YQAA 5E18F 1KA8A 3WTUC 1WRJA 3F8CA 1KQ8A 2IP2A 4KN7X 4ZH4F 3IWZA 2A6EF 2FBKA 5DUKA 4LK1F 3R0JA 1TNTA 1YO5C 2VC0A 5DD4A 2A6HF 2GQQA 1ZN2A 1FP1D 4MEYF 3V7CA 2WTEA 4UUVA 1EH8A 1ZG5A 4CDGA 1SMYF 4ZYHA 4IRGA 1FBSA 1FT9A 3WTTC 1ZRDA 3WTVC 2FE3A 4HDUA 3ERED 5D4SA 3DF8A 3FZVA 3BPVA 4HV5A 2HEOA 4MHGA 4LD5A 2NRAC 1U78A 2FF4A 1XGSA 2AXLA 2W24A 2YX4A 4WCGA 1AOYA 4ENNA 2D2WA 2Y75A 1I1SA 1Z6TA 3LAJA 2IA1A 4EGZA 1WKMA 2BYVE 3JSPA 3DPLC 2VN2A 3LQQA 4FHTA 4UVCA 2G7UA 2V1DA 3CUQB 2MLKA 4PZJA 3L7WA 5HVQC 2Z3YA 3LA7A 4MGRA 2DQLA 5A2QZ 2WV0A 3I64A 2CO5A 4NQWA 2A07F 4M9XA 3WTSC 2EFOA 1LEBA 5FO5A 3IKTA 2IVMA 3QP6A 1A04A 2BEOA 1ZG3A 1J9IA 4F7ZA 3TKYA 4UXNA 3GUDA 2JPBA 2KJBA 4HZFA 5LGTA 3KP4A 1STZA 1TTYA 2L54A 1OMIA 2LKPA 1E2XA 4G8XA 4HW0A 4U7DA 1QZYA 1Z91A 1QBJA 1U3EM 2J5OA 2Z5UA 1KGSA 3ZQ7A 3GWZA 2WC2A 1C0WA 3KP7A 1XSXA 4HQMA 3I53A 3C1DA 5HS8A 1P4AA 3SFZA 2FNAA 1JGSA 5K5RA 3WE2A 2HZTA 4R1HA 2GZWA 2PJPA 3KLOA 3MWMA 5DCMB 3O3KA 1XD7A 2QQBA 1USSA 3N97A 1IXCA 1O7LA 5BMZA 2XROA 1MD0A 3ISPA 5LEJA 5HLGA 1BIAA 2HWVA 2MLGA 2D1HA 4RB0A 4YG2F 4LB5A 3L00A 3WTZA 4H0EA 2Q2EA 4RAZA 2V79A 3GLXA 4LLGF 2XHKA 4EM1A 1WSUA 1DP7P 1J2XA 4HF2A 3DPTA 1T38A 1B4AA 1L0OC 3LWFA 3W6JB 1HW5A 3MAJA 3QU6A 2DI3A 4GXOA 4IF4A 5HDGA 5CVRA 5BOXA 5ICGA 4IXAA 2NS0A 5H6QA 2O61A 3QU3A 1BIBA 4E70A 4Q5SF 2JPCA 2XV4S 2OBPA 2MH2A 3KZZA 3F6OA 3NQOA 2UZKA 1ULYA 3RYPA 4M9ZA 2JRTA 4OIOF 3JTGA 3CDHA 2QYOA 5HDKA 5L3CA 4I01A 1TBXA 5D6FA 4M6YA 2LSOA 3GFIA 4EJTA 1KYZA 1P6RA 3RDIA 1LJ9A 3HYIA 1W4MA 3J7AO 4KICA 4EGYA 1T6SA 5K5OA 2QBYA 4GYIA 2PN6A 1FOKA 5A2QK 1TQIA 2RNJA 2ZKZA 2OU2A 1HW2A 1HKQA 3QOPA 3N4MA 1F1ZA 1UB9A 4LJZF 3DKWA 4A2UA 4CHUA 3BJAA 3E6MA 1OKRA 3QP5A 1JHHA 1QGPA 1V4RA 1Q1HA 4OIQF 5LRRA 3ABUA 3SZPA 2GXBA 4YIFA 2AS5F 4LK0F 4CYDA 3TO6A 1WWXA 5LRSA 3BJ6A 2IJLA 3R61A 2OAZA 1E17A 2DK8A 3J80Z 2P6TA 4Q47A 2CGPA 3O6BB 2W25A 5CYVA 3WTWC 1MJAA 1XB4A 2LDUA 4ESJA 2QM3A 2EFQA 4ON0A 3FWEA 3K2ZA 3KP3A 3TOBA 3RPUA 5E1ZB 2K7LA 2H94A 3GXOA 2QLZA 3HRUA 4K2EA 1KU2A 1YW8A 1XSVA 4JK1X 3E5QA 1FC3A 3M8EA 2K02A 1YG2A 3HTUA 1BC7C 4M6XA 3CUQA 4ASNA 2EJRA 4YIIA 1ZH5A 5IT9Z 3F21A 4HF1A 1XGOA 1HKTA 4Y13A 1SFXA 3F72A 3HHHA 4XRFA 3Q5FA 1R58A 2LF8A 5E20A 4A0ZA 1YIOA 2QQAA 1W5SA 1PDNC 1YTYA 4OOIA 4AWXB 3ELKA 2A69F 5HDNA 1Y0UA 2V1XA 1FWZA 2VONA 2MBFA 1MKMA 2Y48A 2GAUA 3TQNA 4KN4X 1TW3A 5KVRA 4IHTA 2RQPA 2EA4A 2NYXA 4LLLA 4YFNF 4OU0A 5BQTA 5DDGA 3EYYA 1I6XA 1IXRC 3E97A 4Y17A 1BI1A 4WXDA 1HW1A 4IVNA 1FPQA 4Z2YA 5D8LB 2E1CA 4YFXF 5DCMA 4UV8A 3HRMA 2K86A 2XKOA 3IRQA 3SXYA 3GFLA 4GGGA 4O3MA 2P7CB 4KNYA 3WTYC 1RUNA 3MZYA 5E17F 2UXXA 4LB6B 2NNNA 3ROUA 2XAFA 5F64A 5ICEA 1XDSA 3ZN0A 1ZGJA 5CVJA 2RKHA 2Y0MA 4BXUA 1ZRFA 3DEUA 2K4BA 4WX9A 1AWCA 5LHGA 4GO1A 4UNOA 1O3TA 2L01A 3VFZA 2OQGA 4U0VA 2PQ8A 2FQ3A 4QLCU 3C3WA 3U2RA 3K1MA 4WK8F 1BJAA 2EWNA 5FD5A 1MJ9A 2W57A 3EETA 2R7FA 1ZG1A 1FYMA 1XSDA 1QNTA 2EFNA 3LFKA 2YSRA 2H6BA 3HRTA 3ECOA 4ENKA 4JQFA 2QBYB 2FEZA 4HX4A 1Z1DA 1EV7A 3FMQA 2OQRA 1YW9A 1UHMA 4KYWA 3NRVA 1G4DA 5D5UB 3NEUA 1S6LA 1MGTA 3V4GA 4TV7A 4KIBA 4BHCA 4IRHA 1FSHA 1EH6A 4EM2A 5IT9K 5DV5A 3WGHA 4Q48A 4KMUX 5ILSA 1D8KA 2HYFA 4B8XA 2CG4A 4DNCA 1HKSA 2ZFWA 3ZMSA 4A12A 3LA3A 3ZP5A 1PP8F 5D5VB 1IUYA 1IF1A 3RJPA 1JHFA 1BI2A 1G3SA 4N9IA 3JAMZ 3GW2A 3U1DA 2V1UA 4AVPA 2CQKA 4RGUA 1ZGAA 1GXQA 2XAGA 4UVAA 5JHUA 1XGNA 3F23A 2J5PA 3R6SA 1IN4A 1O7FA 4OMYA 1F5TA 1HSTA 3RPQA 2YX7A 4I98B 1NHAA 4A6EA 3HUGA 5JR3A 2E7XA 2EV6A 4M74A 4RGSA 2DK5A 1SD5A 5LLQA 2ZMEB 5TJJA 5HLIA 4L0YB 4XSXF 4Q4ZF 1FX7A 3ZMDA 1S8NA 4HLYA 1T2KA 1LEAA 1F4KA 2PBIA 2Z33A 2UXNA 4KT5C 4A0XA 5H20A 3FM5A 4HOBA 2GIVA 2XKPA 5CVVA 1IW7F 2OA4A 3ABTA 4L5JA 3FHZA 5JVTA 1T39A 2HS5A 2ZNZA 1YS7A 1D5VA 5ICFA 2ZNYA 2FA5A 2VOPA 3WODF 2GXGA 3CLOA 2HOEA 3I4PA 5D6EA 1UFMA 5IT3A 1FYLA 2RN7A 3IC7A
chains in the Genus database with same CATH superfamily
3HKZN 3IUOA 5M5YJ 5L3DA 1ZTRA 4RAFA 1O3QA 3COAC 1B9NA 3GTOJ 1BI0A 2HGCA 2QCOA 3JTHA 4DGWB 4BXXJ 5GPAA 3F8FA 5CJ9A 2V1NA 4YRVA 4BH9A 1I3QJ 2WWYA 1GVJA 3IAM2 1IZ1A 1SMTA 4E7SA 4J00A 3BR5A 1ON1A 2DMNA 2VT2A 1T33A 1KU3A 4DOZA 3QPHA 2NS8A 2G7HA 4XNFA 1U8BA 2GM4A 1BM9A 1FIPA 3OWTA 5AIPA 3B6AA 2DMUA 3PJRA 3S3OA 3LSMA 1KQ0A 4LITA 2PFBA 3G1MA 1ZREA 3LQRA 1I5ZA 4S04A 2DTRA 3WGIA 1EJ9A 5FLXK 1QHHD 4LIUA 2ESHA 1P4WA 4HF0A 1REPC 1MNDA 2F5CA 2P0WA 2XUBA 2XGXA 2HOSA 3HGGA 1HQCA 2IAIA 3SJMA 2VASA 2MABA 4ZYGA 3T1BA 1V55H 2R5ZB 1HDDC 3MKYB 1LE8A 2EB7A 2K4JA 2D1VA 5HODA 4HYEA 4GFBA 1RKTA 2JUCA 4EM0B 1J0RA 2CW8A 2EILH 3ONQA 3HOSA 3U1KA 1OPCA 2OV7A 2IBDA 1Y39A 2IA0A 2KIUA 1NG6A 1XC5A 1A31A 3BTCA 2PJRA 3EYIA 3W3CA 2VI6A 3UKGA 4BBSJ 4P5OA 4HQEA 3HOUJ 1QO0D 4O5VA 1SVOA 1T95A 3RKXA 3OSGA 1MMSA 2CWEA 2RV8A 2QEXI 2K9SA 1R1TA 4RLFA 3T0YA 1OCCH 3CUQC 1TW2A 3BTJA 2CUJA 4HEA2 1OR7C 3ZQQA 4LG3A 1JTXA 2W1OA 1B72A 3A0BC 3H3UA 3CJRB 5FKMA 3OV8A 3S3NA 4EMSA 5DEQA 3V8LA 3QOEA 1T98A 2N8GA 4IJAA 4M73A 4EVIA 2ID3A 1JUPA 2YU9J 3FXMA 3ZR8X 3WTXC 5CQGA 3KPHA 5CVUA 1J59A 2VXZA 2M1BA 2ZJQF 1IRXA 2QQ9A 4I2OA 5FD6A 1R4NB 3GF2A 1YHQI 5FB2A 1VZ0A 3HTSB 2NXNB 2E36A 1A35A 3PNVA 3HIFA 3HM5A 5J3LA 4D9JA 2A5YB 3M9AA 4U88A 5F1JA 2XVCA 2E71A 1SD4A 2E34A 3I3LA 2O6GE 3V8KA 1HOMA 2HNHA 2RC4A 1NK2P 3V7RA 3T8RA 2TDXA 1XCBA 1SEUA 5CPRB 4NBQA 2GIZA 2JA2A 5CKTA 4BYYA 1JJ6C 4CCOA 3CMYA 4A3MJ 5K1YA 2Y2ZA 5E8IA 3VYRB 2ISZA 1SFUA 2KLOA 5AIQA 1LNWA 3TGNA 5FJ8J 2CV2A 2A68F 3R0AA 3D5LA 2V6EA 1P4XA 5L3FA 2H1KA 3ZN1A 1BBYA 4A3GJ 2PG4A 2BV6A 2VKEA 2K85A 5EJCA 3A01B 4CZZA 3G3ZA 5IPAA 1UG0A 2LBFB 5KAIC 2Y0SA 4RBOA 2KRHA 3W2WA 4XKBA 4CCLA 5B3SH 2XAQA 2DA3A 1BN5A 4RB3C 3KYCB 2O8KA 4CUGA 3AG3H 3GTKJ 5LBQA 1DQUA 4XLFA 3DWLE 1ETWA 3CCJI 2MC4A 4CICA 4RB1A 3JRIA 2FSWA 3BZCA 1ODDA 3G71I 2GBYA 2VJ5A 1VFCA 2GOXB 5DCFA 1W7PD 1QHGA 1IN7A 1PP7U 1HC8A 3E6BA 2HR3A 1D1AA 3AG2H 5ED4A 4JX6A 5E1XA 1MZBA 3HSEA 2M2EA 4EJOA 2WAFA 3HEFA 4R79A 3S1QJ 4A6DA 2XB5A 1V5FA 4XLNF 2KHMA 3TW6A 2BBYA 2GA2A 2HU9A 3S2HJ 1Z7UA 1Y0NA 3RI4A 1I6HJ 2M9HA 4BJ5C 4ETSA 3ZMVA 3K2AA 1WFXA 3GTJJ 2YU3A 1J5YA 3BOQA 3KEOA 1B8IB 2B63J 2DAOA 2R5YA 3IV5A 4XSZF 5EF6A 2EZHA 4KT6A 3TBIA 2M0MA 2KQRA 4DBRA 4XLHA 3K70D 2QSFX 4IHWA 1SC7A 3BPXA 2IS2A 1X3ZB 5TRDA 2ZMEA 2P5LC 3QODA 4A3BJ 3CO6C 4IX7A 2FQ4A 3PUBA 3PSIA 5L3BA 3OYEA 4NB5A 3J7YJ 3I9V2 3I56I 2IA2A 4HA8A 1FOXA 2G9WA 4P9FA 2B9SA 3HDDA 3CP8A 2O03A 3M7GA 3WG7H 1RNLA 3PUFA 3PFIA 3LSPA 4KIGA 1QPMA 3HBLA 3ZQFA 1LFUP 3P5JA 4BHBA 2L0KA 2ZXJA 4HLXA 2VLAA 4B3XA 2HTJA 4KMFA 2HXOA 1JKPC 3E3VA 1E3PA 3BG9A 5C4JJ 1VQOI 2F5DA 6PAXA 2EZKA 5K7FA 3H92A 2Y30A 4IRIA 3F22A 1DPUA 1D3YA 5JFRA 1LDDA 2CW7A 2BVLA 1K78B 5KK1A 2L4AA 1FBQA 1AA7A 3ZOBA 2QVOA 5IYCJ 3QAHA 5K5QA 1YYVA 2LF7A 2VT3A 3SEZA 1K6OA 1VQ9I 3MEXA 4C3JJ 4W1UA 3M07A 1S72I 4PJ0C 1U5TB 2ZFUA 2MG4A 5L3GA 2VJIA 3E7LA 2Q8KA 2DPDA 2KZGA 1OFCX 1S7EA 2IS1A 5M5WJ 1R71A 3M4OJ 1AKHA 2VBZA 3J81Z 4ZDLA 1XMKA 1OCOH 1R7JA 3TDZC 4F3QA 2JK3A 3GFJA 2E2JJ 4M3BA 2OCCH 4A3DJ 1R36A 3MQ0A 2YR2A 1RUOA 2K27A 1YRNA 2VL8A 2NOGA 3FMSA 3GEZA 3IKVA 1MH4A 1K6YA 2QZ8A 4HBLA 3S14J 1DDNA 2DFHA 1DUXC 2HDCA 1ETKA 3Q9VA 4P1WA 4ZTJA 5F27A 3E6CC 1YITI 4M6VA 4C3IJ 3DKXA 2MW8A 3MZHA 1YS6A 4FQGA 3W6VA 3FIWA 2M7AA 5DS9A 2ZJRF 1Z9CA 4V19K 2L3DA 2I8DA 3ERMA 2P8TA 3ZMTA 3CCSI 4IHYA 1OQYA 3BZ6A 2F5EA 3MCZA 1R5ID 2PMHA 2DA1A 1LE8B 1MW7A 2VKDA 1R00A 1IN5A 2KDZA 3E5XA 1QVTA 4X6AJ 2PEXA 5HOOA 2XC7A 2CSOA 3H3VK 4BACA 3NWSA 3BJOA 4QIWN 2DPUA 1JKQC 4U0YA 4HV6A 1IRGA 1IDYA 4RA2A 4AIJA 1P7IA 4ENMA 2Y31A 2A61A 3HOTA 1ZLJA 3BT9A 2VE9A 1ORKA 1R22A 2R5ZA 5EYRA 1GV2A 4L9NA 3QRFF 4D0PA 4DJAA 4ZTFA 1B59A 4IHVA 2M0CA 3ASNH 3RQIA 2LY1A 4BGDA 4EQQA 2F5FA 2XRLA 4FX0A 3BROA 3KLNA 4ZYEA 3MKWB 4ZZLA 5HNFA 2XDVA 2D5VA 3HOVJ 4V2FA 2CV1A 2BHYA 3S1MJ 2M8EA 1B72B 3CUOA 3VYSB 3L1PA 1R1UA 1BJZA 4MIMA 1P92A 3JRBA 3GZ5A 2HXIA 2HDDA 2X1DA 5HS7A 1SAXA 2M4KA 3KEYA 1FIAA 3J80K 4RDUA 5F08A 3D0SA 3GMEA 2FD5A 5L3EA 2M3AA 4OIRF 4AVZA 4RGRA 4NC6A 4Y15A 2TCTA 2HKOA 1RR7A 5FROA 3VB2A 3WE3A 2XB0X 4LG0B 2QENA 2ZJ2A 1FY7A 2XSDC 2R7XA 2IT0A 4G7HF 1SD6A 1X4PA 1ETOA 1R5GA 4IKFA 1W7PB 4XKCA 5E8GA 3GBGA 1U6GA 1R49A 2E1NA 1I39A 2CUEA 2XF7A 2XAJA 4IHXA 2LKXA 1FNNA 3CF5F 4LLNA 2WY8Q 1JTYA 4P55A 4RS8A 3U9GA 4JX5A 4PDKA 3OR1C 1BC8C 3DBLB 3DEEA 4QPQA 1NH3A 1CF7A 3BC8A 2DXIA 4JBAA 1I50J 2R3SA 1Z21A 2M5WA 2ELHA 4EJWA 1XDUA 3EDPA 3OS2A 5ICCA 3F8BA 3C18A 4ENJA 1WI9A 1MBHA 1R9TJ 2O3FA 4M3DA 3M8JA 1R1VA 4L5EA 4LMYA 1TWGJ 1O57A 4G6QA 4LGWA 2DCEA 1XN7A 2COMA 1X1CA 2CU7A 2OCEA 3EUKL 2CFXA 4S0HB 2L4MA 2W48A 1OYYA 1MBJA 5F6FA 3TOAA 4ZYAA 2JTVA 4PGHA 2P4WA 3LNQA 2UWMA 3AFHA 2R7DA 5GP9A 3F3XA 3BG7A 3DXJF 1OLTA 4HG2A 2KKOA 1RKWA 4BQQA 3KP6A 2OTLI 4CGZA 3LSKA 5D8KB 2V9VA 2X6WA 3K69A 4YFKF 3OYDA 2IRFG 3VPRA 2M30A 1E3HA 3TP0A 4XRSG 2PI0A 2H27A 3F6VA 3K9TA 2XAUA 3Q0WA 2WADA 2K9QA 3ZPLA 2FOWA 5BPDA 1VQ7I 2VJJA 4I0AA 4L9TA 2NS7A 1Y56A 3FDYA 4CO8A 3G73A 4BY7J 5FRMA 2GWRA 2CUZA 1WJBA 5D4RA 1B6AA 1MSFC 3CJNA 4PGGA 2P5KA 3LSGA 4YEJA 1BW6A 2AQEA 4XIDA 5E1WA 2DO7A 4OIPF 3H5AA 3SQNA 3J81K 1SD7A 3V8JA 3IWFA 3DTIA 1DGWY 4F91B 1MDMA 3BR0A 1S7OA 4G6DA 4XKVA 4A69C 4M71A 1PUEE 1D5YA 2L9NA 2BY1A 2WB1A 4PJNA 5E79C 4X0GA 4E7KA 2JN6A 2MD5A 5AONA 3WHBA 1H0MA 1IRZA 3R4KA 1G6NA 2QSHX 2FMYA 2XGCA 1G3WA 2DW4A 2R7RA 2DFIA 1XGMA 3M8FA 3FMRA 1IXSB 2IW5A 4EJVA 1FZPB 2BZTA 3LSHA 4QSHA 3VODA 2R4GA 3RCOA 3HSRA 4CCNA 1KYWA 5J6XA 4H4KC 3BR2A 4KIFA 3A0HC 2ESNA 1ENHA 3VOEA 4BEHB 2Z1DA 4WF2A 2ZJPF 4CXFA 1UHWA 2PMUA 3A03A 2VBYA 2BGCA 2XSJC 1W36C 1HSJA 3JR9A 5JLWA 1LVAA 1WJFA 1BA5A 3R60A 2BHZA 2MFZA 4RGXA 1V3FA 2LR8A 3OL3A 3CP2A 3K10A 2STWA 1O3RA 3I59B 2DYRH 3CZ6A 4L18B 3HRSA 1JKOC 2VIXA 1MNEA 3BCBA 2HFHA 2EA2A 2X6YA 4IPAA 3FHNA 3L2CA 5LFAA 1BOAA 3C2GA 4XLPF 4AM3A 1OJLA 1PYVA 1DPRA 2XIGA 4CH7A 3K1PA 1XMAA 4PCQA 1W0TA 2A3SA 1KU9A 4DW6A 3TO9A 1G3TA 4WWCA 3CCUI 2OZ6A 3QPTA 5JI6A 1UAAA 2EV5A 2ZBKA 2GLOA 2P7VB 3K0LA 1FJLA 1H89C 3P9IA 3GZ6A 3I5UA 3A4CA 1AKHB 2O8XA 1J7KA 2XASA 3IH3A 5LGNA 1VTNC 1K78A 3GFMA 3HB9A 5J8FA 3CLQA 1HBXG 2HDWA 4BNCA 2X51A 5ERIA 1X1AA 1PJRA 1NG7A 2DQRA 2P5VA 2V9PA 3DTKA 3GO5A 4FT8A 4JX4A 3F8NA 3KP5A 4AYBN 5B66C 1WJDA 2M87A 5D5WB 1FTTA 3HL2A 3OOPA 1VQKI 3EUHA 1YRNB 1U5TA 2NVTJ 2PLYA 4NDLA 5LEKA 2L9SA 3HGYA 4L9JA 4MFEA 4ZYDA 2W82A 5EZGA 2H8WA 3L2VA 5DTDA 2IGMA 1HA8A 2RGVA 2NNYA 1L3LA 2M4GA 4FE7A 3S93A 1YW7A 1R23A 3OYKA 2XAHA 4HNUA 4L5IA 3JSOA 2OC6A 3VSKA 4P9UA 3K4CA 2ZCWA 5BS6A 4U7BA 2HQ5A 3LA2A 3ULQB 4KDPA 2MC3A 4ZC3A 4KUMA 3GTMJ 4XOPA 2XGEA 3RQ4A 5GAGJ 2DTZA 3W2AA 5GTHC 1X2MA 2AQFA 2X1EA 3KP2A 5EDNA 3CQZJ 3EUAA 4M3GA 3VWBA 3IL2A 4I02A 4MQVA 2F4OB 1H9TA 2ZSIB 1N25A 2DDAA 2VQCA 2OJED 3U21A 3ZGKA 3BY6A 3SZTA 5J4VA 3B02A 4QWQA 1RIOH 5F1RA 2DU9A 1FLIA 1LQ1A 4MTDA 2FXAA 2DT5A 1FYKA 3OSFA 2MA3A 4Z6YA 4G7ZF 3FX3A 2WAQA 1VQ4I 1QQIA 1O3SA 3JCUC 1G3YA 2LTPA 2VBWA 4RMNA 4FX4A 2DJNA 3G2BA 5FFZA 3WHCA 3K6GA 1IC8A 2ECBA 1EA3A 2I5UA 3C2BA 3REOA 1WHUA 4C3HJ 4AIHA 1IDZA 4Y7NJ 1WQ2A 2L7KA 4ESBA 2HTSA 3JAMK 2EFPA 2ZXWH 5EEHA 4I0BA 5FKNA 4BAYA 4HAMA 2H6CA 4L0ZB 1ZR2A 2GXAA 3AAFA 2VUMJ 4XR6A 1MH3A 3FXUA 3SEQA 2BXZA 2XF5A 3DV8A 4XL9A 3TL4X 5LHHA 5DUIA 3BTIA 1R4MB 2LH9A 5EEGA 1K7AA 4RM2A 1N78A 3NAUA 2QUFA 1P7JA 5CLSA 2VBXA 5E3OA 4UB8C 1GHCA 2P6SA 1X3UA 2OF7A 5J8CA 2KMUA 2KIMA 3OMYA 1RZ4A 2W4SA 3KETA 2CMPA 3J7ZI 1XCVA 2ELKA 2ZXIA 2HYGD 4LG0A 1VF9A 3CF2A 3PO3J 4V2GA 3VDXA 4KFCA 4RLQA 1W7PA 1CF7B 4HNVA 5IP9J 3BDDA 2JVHA 1ZGWA 4NHJA 5GTIC 3LSRA 4GRIA 4BHPA 3VYUB 4PUSA 1GV5A 3GYHX 4A3LJ 5ILUA 4C30A 1SVLA 2BE5F 1ERDA 3FKJA 3L9FA 4XN3A 2KDOA 2M8GX 3BTLA 3OOUA 3JRHA 4RAYA 4IOAF 1FTZA 2RDPA 3KYLA 5H6RA 1R5HA 2OZUA 4M72A 2BY3A 3CO7C 2KT0A 5DM7F 2XPWA 2KL4A 4BE2A 4HRIA 1ACIA 1ONVA 2GA1A 4MNUA 2DN0A 2C6YA 3MD2A 3PQJA 4M3EA 4NNJA 4PJLA 4BUPA 3H0GJ 1H9GA 1YLFA 4NUBA 4M3FA 4BXFA 4A3EJ 4WXHA 2DFEA 2NVUB 3DU5A 2DA2A 1VQ8I 4N0BA 3KE2A 1LB2A 2ETHA 4CCJA 4E7JA 4FETA 3RKQA 2AO9A 4EEFG 3HOZJ 3WG9A 2V9KA 1MBKA 3CJQB 3L09A 3H9QA 4I76A 2IGOA 3CDIA 1RI7A 2E7WA 1W5TA 2PX9A 2F4IA 2R93J 3A2KA 3MFKA 1WZ2A 1GLNA 3AG1H 2X0LA 2VKVA 3FK6A 3JW4A 3KEQA 3CTAA 3Q9SA 1F9NA 2DOFA 3CCEI 2HKXA 3H3ZA 1U2WA 4DZJA 2F2EA 3GTPJ 2EV0A 3H9GA 1MDMB 1BI3A 5F04A 5B1AH 3RKWA 1H8AC 1IN8A 2CS3A 4C2TA 3T5XA 2E2IJ 2DLLA 3BWGA 3VEPA 3W2VA 2RREA 3WGGA 4DYCA 2IXSA 1UG2A 3BP8A 4ESFA 4YELA 3RIRA 4LFUA 4AD9A 2ME0A 3K4JA 5K7ZA 2R7VA 3DBHB 2DA4A 3LOCA 1EF4A 1IO2A 3M1EA 4F52A 3GX4X 2X6XA 5C44J 3FF5A 1T56A 3L2UA 3FXOA 1Y8QB 2FBIA 2B0LA 3GTLJ 3MKLA 2OD5A 2FRHA 4MQ9F 4A5NA 1JXSA 2BXYA 5FRNA 3KZYA 4L9VA 1IV6A 2KRFA 4OINF 1D8JA 2M34A 3OYAA 4S05A 2JWTA 1TZLA 2ZO4A 1UJ8A 5IYDJ 4PK4A 1FP2A 5TGTA 1LDJA 1T0FA 1ZQ3P 3K4LA 2Z9OA 2RVCA 3Q0UA 2ZXHA 2FMLA 1D1BA 1APLC 4BEHA 3GTQJ 2HQRA 2EFWA 2KJCA 2JVGA 4N9HA 1KU7A 2IPQX 4C2UA 1JE8A 2VOOA 3IAS2 3ZQIA 1QA6A 2JZYA 2E2HJ 1E0EA 1ZARA 4GYGA 2LY2A 1BL0A 3ZMUA 4UVBA 5DD8A 4B4CA 3I0TA 3PQKA 4HX7A 4G7OF 3I59A 1HDPA 1WH7A 2Y69H 4XBFA 1VI0A 1MJBA 1OYIA 2L7FP 1OR7A 1S5LC 3TO7A 2X85A 4IL6C 1IAWA 1B9MA 2LNBA 1SFKA 1JGGA 4I99C 3LL7A 4XONA 2F48A 4MTEA 5FGMA 1S3JA 3TDUC 4IHSA 2FU4A 2V6CA 4IQ4A 1U9OA 2JT1A 5JHFA 3ZQCA 1ZAOA 1QPIA 3I54A 4ITVA 2ADUA 3ECHA 2QKMB 4BQNA 2QWWA 3A02A 1YX5A 2FBHA 2X9DA 4OMZA 2BW3A 3O2PE 5CVIA 2L02A 1HXDA 4BDYA 2FOKA 3ML6A 4ZZDA 5B5EC 2JSCA 1Y1WJ 4N4NB 3IRRA 2CUFA 5D5XB 3K4MA 1USTA 1TQMA 3DKYA 3EQLF 1TQPA 1IUFA 1JUMA 3DP7A 2PMZA 3E5UA 1U8RA 4WXCA 1S29A 2LRDA 1ZYRF 3QYBA 2H09A 3F8MA 3ABMH 5DYMA 1A36A 4I7HA 1SFEA 4Y4RA 2YPRA 1OCTC 3S8PA 1Z05A 2Q0OA 1I27A 3I4MJ 5FFXA 4AIDA 1ZHFA 2CW0F 3HKZA 4XMYA 1ZR4A 5C3EJ 5DM6F 4XKWA 5LGUA 4HPQA 3CJTB 1ON2A 4EJUA 3LFUA 1POGA 1HCRA 3BR6A 3B73A 5JLXA 2XGDA 1D0YA 3DQVC 2HQNA 1A6IA 3M1CA 4I09A 2BOLA 4E7LA 3GVAA 3HOWJ 1P2FA 4G9YA 4A0YA 1CGPA 3C7JA 2LP0A 2HOTA 3RYRA 1MSEC 1TLHB 3OYMA 1E3OC 3DLAA 4B44A 3KFWX 3DCFA 2KIQA 3RTRA 4LOCA 1Y8RB 3LSTA 4HDVA 3CC4I 3HSFA 4HNTA 2ID6A 1B1BA 4GCVA 2E5NA 2CYYA 3E6DA 5CQEA 3I58A 4R8HA 5HS9A 4DYQA 3CESA 2VE8A 4MEXF 2O0YA 4IO9F 1S7AA 3ZMZA 3DFGA 3WU0A 2NVYJ 4OWRB 2JA8J 2UV1A 3E1SA 3WU1B 4ZJZA 2W85A 4IEJA 3LAPA 3I71A 5EZHA 3Q3SA 4XLAA 1KZHA 3RKYA 1T8IA 2DBBA 2KRCA 5F0CA 1J75A 3O8HA 3SZGA 3DLLF 4U0WA 1EH7A 1IN6A 3H5RA 3OYNA 2BVMA 2X4HA 4EV0A 1LKXA 2STTA 2MH9A 2K3FA 1TNSA 3X2QH 2ISYA 2FNPA 2EK5A 3T8TA 1NK3P 1LVKA 1P9QC 3FXKA 1PUFB 3P7NA 2D45A 4XLEA 1HF0A 1KQ9A 4PFPA 4RAGA 2Y9ZA 3N05A 2EBIA 3V7SA 3FBNB 1K79A 3VSLA 1ZLKA 3CCVI 1Y1VJ 2XRNA 1FSEA 4M9SA 2W84A 4F93B 4P96A 4UHTA 2AXTC 5ILVA 3CCLI 3GTGJ 5F0FA 1BR2A 1ZRCA 4G94A 3BG6A 1TL8A 1UCRA 4XQFA 4ANJA 1QZZA 2IEKA 1X1DA 3SHFA 1JI8A 3ZRGA 1AU7A 4DQ2A 2LOOA 1I1GA 1OYWA 1YFHA 3FXLA 2WBMA 2E19A 4II2A 2NAZA 3KX2A 4O6JA 3SYTA 4UV9A 1RESA 1IV8A 2M45A 1MIJA 3OYBA 2Z16A 4DZPA 1FMVA 1WCMJ 2JSPA 1LDKB 1IRFA 3W6KB 5LHIA 2R0QC 5E3LA 2X1CA 3P9KA 4BQAA 3FM3A 2O9LA 3HJEA 3IH2A 1FBUA 3FXQA 1Z6RA 4KA4A 1YIJI 5BPIA 1TP4A 5E3MA 3P9CA 4A5MA 2QGUA 4AIKA 1M1EB 1QVUA 2M7BA 4HX8A 1YJNI 4UB6C 3GLLA 2KPMA 1GXPA 2Z99A 3K4KA 3HHGA 2VQGA 2X6OA 4XLCA 3S2WA 2ACJA 4B09A 5HLHA 1U5TC 2E1MB 2KIFA 3K1NA 2VC1A 5FLXZ 3KCCA 4UY8I 2VODA 3IHUA 4RB2C 1FMWA 3HOXJ 4A3CJ 3FXRA 1YQAA 5E18F 2LYCA 1YI2I 1KA8A 2EZLA 1WJEA 3CD6I 3WTUC 1WRJA 3F8CA 1KQ8A 1XX5A 2IP2A 2QF7A 4JP0A 1VQLI 4KN7X 4ZH4F 1DU6A 4JYKA 3IWZA 3I4NJ 2A6EF 4QTRA 2FBKA 5DUKA 4LK1F 3R0JA 2HYJA 2L7ZA 2Y0SN 2LG4A 1TNTA 3BR1A 1YO5C 2XPVA 2VC0A 5DD4A 2A6HF 1OCPA 2GQQA 4XORA 1ZN2A 5BNGA 4CCKA 1FP1D 4MEYF 3V7CA 2WTEA 4UUVA 1X3WB 2F4MB 3DEWA 3CDLA 1EH8A 2EH3A 1ZG5A 3M3YJ 4CDGA 4AC0A 1SMYF 4ZYHA 2V7FA 4IRGA 1FBSA 1FT9A 3WTTC 1ZRDA 4D1QA 1MNMC 3WTVC 2FE3A 4HDUA 4UUSB 3ERED 5D4SA 3DF8A 2DYSH 3FZVA 3BPVA 1JKRC 2VPRA 1QZEA 2VQHA 5F0HA 4HV5A 3FK7A 3F9KA 1GUUA 2HEOA 5C4XJ 3OIOA 2QA4I 4MHGA 2JA5J 2CV0A 4LD5A 5IYBJ 4BKXA 2NRAC 1X4OA 2JRMA 1U78A 2O7OA 2FF4A 2YS9A 3L2QA 1XGSA 2AXLA 2W24A 2YX4A 4WCGA 1AOYA 2LVSA 2R7OA 3OR2C 3L2WA 4ENNA 2AHQA 3BQZA 2D2WA 2Y75A 1I1SA 1Z6TA 3FKIJ 5GAEJ 3LAJA 2IA1A 4EGZA 4KISA 9ANTA 1WKMA 3MZ8A 4C9YA 2BYVE 3JSPA 5B1BH 3DPLC 2VN2A 3LQQA 4FHTA 4UVCA 4B3AA 3A1YA 5GPCA 5E3NA 2G7UA 2EQRA 2V1DA 4A93J 3AG4H 3CUQB 2MLKA 3H5NA 3L7WA 4PZJA 5HVQC 2Z3YA 1OCZH 3LA7A 4MGRA 3WU2C 2IS6A 2HVSA 2XF6A 4XRMA 2DQLA 5A2QZ 2WV0A 3I64A 2CO5A 4NQWA 2A07F 4M9XA 1BR4A 5FKLA 5FLVA 3WTSC 2EFOA 1LEBA 2K9MA 5FO5A 1D1CA 1TT5B 2IVMA 3D5RC 3IKTA 1Y6IA 3QP6A 1A04A 2BW3B 2BEOA 4I6ZA 1ZG3A 1XMXA 1X19A 1J9IA 3CMAI 4F7ZA 3FISA 1Z3YA 2DMTA 3TKYA 3H0DA 1VQMI 4UXNA 3GUDA 2JPBA 4E7HA 4AU7A 2JUGA 2IS4A 3KIOA 2KJBA 4HZFA 2COBA 5LGTA 1U9NA 3KP4A 3AKZA 2MSYA 2E1OA 3G1OA 4Y52J 4LIVA 2O5RA 1STZA 1TTYA 3JRFA 2L54A 1OMIA 2LKPA 1E2XA 4G8XA 4HW0A 3S32A 2MYSA 5HNHA 3CC7I 4U7DA 3QQAA 2XPUA 1QZYA 1Z91A 1QBJA 4KJZA 4A3FJ 1U3EM 2QQ8A 1CQTA 4N4OB 2J5OA 2Z5UA 1KGSA 3ZQ7A 2DMQA 3GWZA 5K7HA 2WC2A 4II3A 1C0WA 2ELJA 3KP7A 1W1WE 3JRGA 3H1CA 1XSXA 2LFBA 2VPLA 1JT0A 4HQMA 1XG1A 3I53A 3C1DA 2IGKA 5HS8A 1P4AA 3SFZA 2OUMA 4CZCA 2FNAA 1JGSA 5K5RA 2HZDA 3WE2A 2HZTA 2K5CA 2P81A 3JREA 2DFFA 4R1HA 3TEDA 3CCYA 4D5FA 4FE4A 2GZWA 3F0CA 4BL0B 5M3FJ 1ETQA 1WI3A 3RZDJ 2PJPA 3KLOA 3MWMA 5DCMB 3O3KA 1XD7A 2QQBA 1X2NA 1USSA 5J47A 3OYLA 1PVEA 1VQ6I 3N97A 4XK4A 3UNGC 3BQYA 1IXCA 1D0XA 1QRYA 2CFOA 1O7LA 5BMZA 2CQQA 5GADJ 2XROA 1LFBA 1MD0A 2VJ4A 2V26A 1VQ5I 3ISPA 5LEJA 2CQXA 5HLGA 3K4NA 4YIRX 1BIAA 2HWVA 2Q1ZB 2MLGA 2D1HA 4RB0A 4YG2F 4LB5A 1FEXA 5IOZA 3L00A 3WTZA 4H0EA 2RAEA 2Q2EA 4RAZA 2V79A 2LLKA 4GDFA 3GLXA 4LLGF 5FKKA 4CYCB 2XHKA 4EM1A 1WSUA 1MMNA 4BQOA 4Y3OA 1J2XA 1DP7P 3J7AY 3CC2I 4HF2A 3S15J 3DPTA 2HVQA 1T38A 1B4AA 3G6EI 1L0OC 2BY2A 3LWFA 1HW5A 3MAJA 3QU6A 2ZMEC 3W6JB 2DI3A 1T0FC 4GXOA 3DBRB 4IF4A 5M3MJ 5HDGA 4F55A 3L2RA 5CVRA 2R7TA 2EIJH 5BOXA 1PUFA 5ICGA 1YJ9I 1HLVA 4IXAA 3LMMA 2NS0A 1XS9A 4BY1J 5H6QA 1FOYA 2KZVA 2O61A 3QU3A 3MMYB 1S9HA 1MMGA 2ECCA 1BW5A 1TT0A 1BIBA 4HSRA 2JQ7A 4E70A 3SDGA 4Q5SF 2JPCA 2XV4S 3OYJA 2OBPA 3HG9A 4MFDA 3BZKA 1EKEA 2MH2A 1UMQA 3KZZA 3F6OA 5TISC 3NQOA 3OL4A 3LSJA 1BR1A 1ULYA 3RYPA 2UZKA 1MBFA 2K9NA 1ZELA 2JA6J 1SAUA 4M9ZA 3PIPF 2JRTA 3H36A 4OIOF 3NARA 3JTGA 3CDHA 4FISA 2QYOA 2VB6A 1FOWA 4B43A 3JRDA 5HDKA 5L3CA 2R92J 4I01A 1TBXA 5D6FA 4M6YA 2LSOA 3GFIA 1Q1VA 3ASOH 1VQPI 4BE0A 1VQNI 4EJTA 1KYZA 3HPHA 1P6RA 3RDIA 1LJ9A 3HYIA 3HC7A 1W4MA 3J7AO 4KICA 3I55I 4EGYA 2F6CA 1T6SA 5K5OA 3AL0C 2QBYA 3BG3A 3MVPA 4GYIA 5J40A 1V54H 2PN6A 1FOKA 5A2QK 2HVRA 1TQIA 2Y9YA 2RNJA 1K4TA 2ZKZA 3ZQLA 1LFPA 1JUSA 2OU2A 1HW2A 1SVMA 2KFDA 1HKQA 3QOPA 3N4MA 5M5XJ 3OYIA 2W00A 2E60A 1F1ZA 1UB9A 4LJZF 3DKWA 4A2UA 1W36D 3MN2A 4CHUA 1F43A 2CRGA 4PSXA 3BJAA 3E6MA 1OKRA 3QP5A 5IP7J 1JHHA 3CCMI 3DU6A 1ZK8A 2VQLA 1QGPA 1ITYA 1V4RA 4F92B 1X1PA 1K83J 2NOJB 1Q1HA 1IGNA 4OIQF 1ZKGA 2JJ7A 3ABUA 5LRRA 3SZPA 1W0UA 3OYFA 1TWCJ 2GXBA 4ZDOA 4YIFA 3S3MA 1IG7A 2AS5F 4LK0F 4CYDA 1LPQA 5KAFC 3TO6A 2Z2SB 4J01A 1WWXA 5LRSA 1UZCA 3BJ6A 2IJLA 1K61A 3ZQHA 3R61A 2OAZA 1E17A 3E0JB 3V42A 2UUZA 2DK8A 2I10A 4UUSA 3J80Z 4FCYA 1YOVB 4XICA 2P6TA 4A3IJ 4FTHA 4BJTA 4G6TB 4Q47A 2A05A 3O6BB 2W25A 5CYVA 2CGPA 3WTWC 1MJAA 1XB4A 4XRSA 2L9VA 2CQ7A 2LDUA 4ESJA 1XTAA 2WY7Q 2WB1N 5FLMJ 2QM3A 2EFQA 4PJMA 1SFOJ 4ON0A 3HUGB 3CMEI 3FWEA 3K2ZA 4DIQA 3KP3A 4B48A 1GVDA 3RPUA 3TOBA 1MMDA 2ZC2A 2R7UA 5E1ZB 3BLYA 3PL8A 2K7LA 4Y33A 2H94A 3GXOA 1AHDP 3KYDB 2QLZA 3HRUA 3QPSA 1W5CC 1KONA 4K2EA 3S16J 1KU2A 2X48A 1YW8A 3VYTB 1G2HA 4NQWB 1XSVA 4JK1X 4EATA 3E5QA 1G59A 3OYHA 1FC3A 3M8EA 2K02A 5J1RA 1YG2A 3HTUA 4D5CA 1SANA 1BC7C 2GOMA 4M6XA 3CUQA 3BCAA 3HXLA 3C2HA 4ASNA 1ETVA 2EJRA 4YIIA 1ZH5A 1OISA 5IT9Z 3F21A 4RM3A 1RPWA 4HF1A 1X1BA 2FX0A 1XGOA 1HKTA 2DDBA 3PFYA 4DYRA 4Y13A 2LREA 1ETYA 1SFXA 5LD2C 4A3JJ 3F72A 3HPGA 1D0ZA 3BR3A 3HHHA 4XRFA 3Q5FA 3PSFA 1R58A 1Z67A 3QYEA 2LF8A 3PNYA 1A6QA 5E20A 4A0ZA 2R7SA 1XPXA 1RETA 3IH4A 4W97A 1YIOA 2OTJI 2QQAA 4IQJA 1W5SA 1WJAA 3RPUD 4E7IA 1YTYA 1PDNC 2DOEA 4OOIA 5EG0A 5J4YA 4AWXB 2DA5A 1ETXA 3ELKA 4AYBA 3ESWB 3FXJA 2A69F 5HDNA 1Y0UA 5KHDA 2V1XA 1FWZA 1DU0A 2VONA 4C2MJ 1MBEA 2MBFA 5FKOA 1MKMA 5IOYA 2FUG2 2Y48A 5EGOA 2GAUA 3TQNA 4PFOA 2VKHA 2DT6A 4KN4X 4HSTA 1TW3A 5H2FC 4JOMA 1WPKA 4IZZA 5KVRA 3CMMA 4IHTA 2RQPA 2EA4A 2NYXA 4LLLA 4YFNF 4OU0A 4XN0A 5DDGA 5BQTA 2LD5A 3EYYA 2HPMA 1I6XA 1IXRC 1V5EA 3E97A 4Y17A 1BI1A 3QYFA 3S2DJ 3B6CA 4WXDA 1HW1A 4BDZA 4BU2A 4IVNA 3G4SI 3OS1A 1JJ8C 2LY9A 3OYCA 1FPQA 3OYGA 4Z2YA 5D8LB 2E1CA 4G12A 2LMDA 4YFXF 2KISA 5DCMA 1UHSA 4UV8A 3H35A 4D7NA 3HRMA 4IOCF 2K86A 2XKOA 1OCRH 2Q2EB 3IRQA 3SXYA 3GFLA 4GGGA 4E4HA 2L9RA 4O3MA 3K7AJ 4OAZA 2P7CB 4KNYA 3WTYC 1RUNA 2LC2A 3MZYA 5E17F 2UXXA 2H8RA 4LB6B 2NNNA 3ROUA 2XAFA 5HLTA 5F64A 5ICEA 1XDSA 1ZGJA 3ZN0A 1UELB 3ZQGA 5CVJA 2ME6A 2A5WA 2DA6A 2WAQN 5EEAA 2PJRB 2RKHA 4A3KJ 1TC3C 2Y0MA 4CYCA 3TW7A 1VNDA 4BXUA 1JT6A 4UUTA 1ZRFA 2FJ1A 3QWLA 3DEUA 1WJCA 2K4BA 2IGNA 4WX9A 3PIOF 1AWCA 5LHGA 4GO1A 4BE1A 4UNOA 1RR8C 2E35A 3DTEA 1O3TA 3OS0A 2K3PA 2DMPA 2L01A 3VFZA 2OQGA 4U0VA 1R6RA 2PQ8A 2FQ3A 4QLCU 3C3WA 3U2RA 2TRTA 3K1MA 1RC9A 4WK8F 1I3AA 1BJAA 2EWNA 5FD5A 1MJ9A 3NWTA 2W57A 3EETA 2R7FA 1ZG1A 3KZIC 4KITB 1FYMA 2DA7A 3JRAA 3JRCA 2HQAA 2L7MP 2LKSA 2YUSA 3G1LA 2MGQA 2NVXJ 5IY5H 3QPLA 1X58A 1GDTA 1XSDA 1TWAJ 3UR3C 5J1UA 1QNTA 1WGXA 2EFNA 3LFKA 2YSRA 2R7QA 1BOBA 3SDBA 2MD0A 2H6BA 1Z77A 3HRTA 1TWFJ 3ECOA 4ENKA 3ABLH 2LK2A 3ZXSA 4JQFA 2QBYB 2FEZA 4HX4A 1Z1DA 1O4XA 1Z3XA 1EV7A 3FMQA 2OQRA 1YW9A 2G0EA 4U87A 3S1RJ 1UHMA 3EUHC 3HOYJ 2KP6A 4XOTA 1GT0C 2EIKH 4KYWA 2ZB9A 1F36A 3NRVA 1YX3A 3Q0VA 1G4DA 1K4SA 4MO7A 3TMOA 5D5UB 3NEUA 2B7EA 5JVGF 1S6LA 1MGTA 3V4GA 4TV7A 4KIBA 4BHCA 4IRHA 1FSHA 1EH6A 4B47A 4EM2A 5IT9K 5DV5A 4QPOA 3WGHA 1RRJA 2DOAA 2HOAA 5IP6A 3H9JA 2K9LA 4AUXA 2F5VA 4Q48A 2DJIA 4KMUX 5ILSA 1D8KA 2WAEA 2WV1A 2HYFA 4B8XA 2CG4A 4DNCA 1HKSA 3GCMA 1N77A 2ZFWA 1YJWI 3CCRI 3ZMSA 4A12A 3LA3A 1LUJB 3ZP5A 1PP8F 5D5VB 5GAHJ 2ICWG 3A01A 2EPFA 1IUYA 2LBFA 2ZSHB 1IF1A 3RJPA 1JHFA 1BI2A 3OIPA 2QSGX 1G3SA 4N9IA 2L2OA 1WVRA 3HZJA 3JAMZ 3GW2A 1QU3A 2RQQA 3D5SC 3K4BA 3O8GA 3U1DA 4BJ6C 3IP4B 2H1LA 2V1UA 1U0JA 2RNGA 4AVPA 2R7ZJ 2CQKA 2L5QA 3GZNB 3S17J 1MBGA 1V5GA 4RGUA 1ZGAA 1A5JA 1GXQA 3MKZA 2BY0A 1T08B 4BBRJ 1G8XA 2XAGA 3RZOJ 3CCQI 4UVAA 5JHUA 1XGNA 2HI3A 3F23A 2J5PA 3RSNA 2R7WA 3R6SA 3PM1A 1IN4A 1J09A 4OAYA 1O7FA 4ZDPA 4OMYA 1YE9A 1F5TA 1HSTA 1DGRM 4E6KG 1WJ5A 4NC7A 4B1RA 4BS9A 3RPQA 2YX7A 2R5YB 4I98B 3OY9A 1NHAA 4A6EA 2WA0A 3HUGA 2W7NA 5JR3A 3FBIB 1MMAA 4J19A 2E7XA 2EV6A 4M74A 4RGSA 2CJJA 2DK5A 3S1NJ 1SD5A 5LLQA 2ZMEB 5TJJA 5HLIA 4L0YB 1NTCA 1Z7LA 2QKLB 4XSXF 4Q4ZF 1FX7A 3ZMDA 3ABKH 1TWHJ 2CQNA 1B8IA 2DT7B 1N75A 1S8NA 2A6TA 2EIMH 4PJJA 4DBQA 1H88C 4HLYA 1T2KA 1LEAA 1F4KA 2PBIA 2Z33A 2JMWA 3PNTA 2UXNA 4KT5C 4A0XA 2EINH 5H20A 5KNLA 2NVQJ 3FM5A 4HOBA 1IJWC 2GIVA 2XKPA 5CVVA 3OIQA 3EPZA 1IW7F 4E7ZA 2OA4A 1WH5A 3ABTA 4ABZA 4L5JA 2DODA 3FHZA 4CCMA 4D7MA 2EZIA 4PSWA 3DPUA 2HPIA 5JVTA 5EG0B 2V4JC 3TP3A 4X1EA 3SFIA 1T39A 2E5ZA 2CH0A 3BG5A 2HS5A 2VXDA 5EGOB 3D1NI 4FASD 4CA0A 2ZNZA 2PMZN 1Z0XA 1YS7A 4XM3A 2OPTA 1D5VA 1DP3A 3LSIA 2ZNYA 5ICFA 3ZCOA 2FA5A 2E1MC 2VOPA 5KCMA 3AL0B 3CLOA 2GXGA 3WODF 4NC8A 2HOEA 2K40A 3I4PA 3PO2J 5D6EA 1UFMA 5IT3A 2JA7J 1FYLA 2RN7A 5J1YA 3K70C 3IC7A 4MLOA 4CSWA
chains in the Genus database with same CATH topology
5L3DA 1O3QA 3COAC 1B9NA 1BI0A 2HGCA 3JTHA 3F8FA 5CJ9A 4BH9A 2WWYA 1GVJA 1IZ1A 1SMTA 1ON1A 2VT2A 1KU3A 3QPHA 2G7HA 1BM9A 5AIPA 1KQ0A 2PFBA 1ZREA 3LQRA 1I5ZA 4S04A 2DTRA 3WGIA 5FLXK 2ESHA 1P4WA 4HF0A 1REPC 2F5CA 2XUBA 2XGXA 1HQCA 4ZYGA 3T1BA 2EB7A 2K4JA 2D1VA 4HYEA 4EM0B 1J0RA 3HOSA 1OPCA 2IA0A 2KIUA 3EYIA 4P5OA 4HQEA 1QO0D 4O5VA 3RKXA 2CWEA 2RV8A 1R1TA 3T0YA 3CUQC 1TW2A 3H3UA 3OV8A 4EMSA 5DEQA 3V8LA 1T98A 4M73A 4IJAA 4EVIA 3WTXC 5CVUA 1J59A 2VXZA 2M1BA 2QQ9A 4I2OA 5FD6A 3GF2A 5FB2A 3HTSB 3HIFA 2A5YB 3M9AA 4U88A 2XVCA 1SD4A 2O6GE 3V8KA 2RC4A 3V7RA 3T8RA 2TDXA 1XCBA 4BYYA 5K1YA 5E8IA 2ISZA 1SFUA 5AIQA 1LNWA 3TGNA 2A68F 3R0AA 3D5LA 1P4XA 5L3FA 3ZN1A 1BBYA 2PG4A 2BV6A 4CZZA 3G3ZA 2XAQA 1BN5A 4RB3C 5LBQA 4CICA 4RB1A 2FSWA 1ODDA 5DCFA 1W7PD 1IN7A 1PP7U 3E6BA 2HR3A 5ED4A 5E1XA 1MZBA 3HSEA 4EJOA 4R79A 4A6DA 4XLNF 2BBYA 2GA2A 1Z7UA 3RI4A 4ETSA 3ZMVA 2YU3A 1J5YA 3BOQA 3KEOA 2DAOA 4XSZF 3BPXA 5TRDA 2ZMEA 2P5LC 3CO6C 5L3BA 4NB5A 2IA2A 4HA8A 2G9WA 4P9FA 2O03A 3M7GA 1RNLA 3PFIA 4KIGA 1QPMA 4BHBA 2ZXJA 4HLXA 2HTJA 4KMFA 3E3VA 6PAXA 2F5DA 3H92A 4IRIA 3F22A 1DPUA 1D3YA 5JFRA 1LDDA 1K78B 5KK1A 2L4AA 1FBQA 2QVOA 3QAHA 5K5QA 1YYVA 2LF7A 2VT3A 1K6OA 3MEXA 1U5TB 5L3GA 2Q8KA 2DPDA 2VBZA 3J81Z 1XMKA 1R7JA 3TDZC 3GFJA 1R36A 3MQ0A 2YR2A 1RUOA 2K27A 3FMSA 3GEZA 3IKVA 4HBLA 2QZ8A 1DDNA 1DUXC 2HDCA 3Q9VA 3E6CC 3MZHA 1YS6A 1Z9CA 2L3DA 2P8TA 3ZMTA 3BZ6A 2F5EA 3MCZA 2PMHA 1R00A 1IN5A 3E5XA 2PEXA 5HOOA 2CSOA 3BJOA 2DPUA 4U0YA 4HV6A 1IRGA 4AIJA 4ENMA 2A61A 3HOTA 1ZLJA 2VE9A 1R22A 4L9NA 3QRFF 4D0PA 1B59A 4EQQA 2F5FA 4FX0A 3BROA 3KLNA 4ZYEA 4ZZLA 2M8EA 3CUOA 1R1UA 1P92A 3GZ5A 5HS7A 1SAXA 3J80K 3D0SA 5L3EA 4OIRF 4RGRA 4Y15A 2HKOA 3VB2A 3WE3A 4LG0B 2QENA 2ZJ2A 1FY7A 2IT0A 4G7HF 1SD6A 1R5GA 1W7PB 5E8GA 1U6GA 2E1NA 2XAJA 1FNNA 4LLNA 4P55A 4RS8A 3U9GA 4PDKA 1BC8C 1CF7A 4JBAA 2R3SA 2M5WA 2ELHA 4EJWA 1XDUA 3EDPA 5ICCA 3F8BA 3C18A 4ENJA 1WI9A 2O3FA 1R1VA 4LMYA 1O57A 4G6QA 4LGWA 1XN7A 2COMA 2CFXA 2L4MA 1OYYA 5F6FA 3TOAA 2JTVA 4PGHA 2P4WA 2UWMA 2R7DA 3F3XA 3DXJF 2KKOA 3KP6A 4CGZA 5D8KB 2V9VA 3K69A 4YFKF 2IRFG 2M30A 2PI0A 2H27A 3F6VA 3K9TA 3ZPLA 5BPDA 4I0AA 4L9TA 4CO8A 3G73A 2GWRA 5D4RA 1B6AA 3CJNA 4PGGA 2P5KA 5E1WA 2DO7A 4OIPF 3SQNA 3J81K 1SD7A 3V8JA 3IWFA 1MDMA 1S7OA 4G6DA 4M71A 1PUEE 1H0MA 2MD5A 5AONA 3R4KA 1G6NA 2FMYA 1G3WA 2DW4A 2DFIA 1XGMA 3M8FA 3FMRA 1IXSB 2IW5A 4EJVA 1FZPB 3VODA 3HSRA 1KYWA 5J6XA 3VOEA 4KIFA 2ESNA 4WF2A 4CXFA 1UHWA 2PMUA 2VBYA 2BGCA 1HSJA 1LVAA 3R60A 4RGXA 1V3FA 2STWA 1O3RA 3I59B 4L18B 3HRSA 2HFHA 2EA2A 4IPAA 3L2CA 1BOAA 4XLPF 1DPRA 2XIGA 3K1PA 1XMAA 4PCQA 2A3SA 1KU9A 3TO9A 1G3TA 4WWCA 2OZ6A 3QPTA 5JI6A 2EV5A 2ZBKA 2P7VB 3K0LA 3P9IA 3GZ6A 3I5UA 2O8XA 1J7KA 2XASA 5LGNA 1VTNC 1K78A 3GFMA 5J8FA 1HBXG 4BNCA 5ERIA 2P5VA 2DQRA 3GO5A 4FT8A 3F8NA 3KP5A 5D5WB 2M87A 3OOPA 3EUHA 1U5TA 2PLYA 5LEKA 4L9JA 4ZYDA 2RGVA 2NNYA 1L3LA 1YW7A 1R23A 2XAHA 4L5IA 3JSOA 4P9UA 2ZCWA 5BS6A 4U7BA 3LA2A 3ULQB 4KDPA 2MC3A 4KUMA 3KP2A 3IL2A 4I02A 4MQVA 1H9TA 3BY6A 3SZTA 3B02A 4QWQA 1RIOH 5F1RA 2DU9A 1FLIA 1LQ1A 4MTDA 2FXAA 2DT5A 1FYKA 4G7ZF 2MA3A 3FX3A 1QQIA 1O3SA 1G3YA 2VBWA 4FX4A 5FFZA 3REOA 4AIHA 1WQ2A 4ESBA 2HTSA 3JAMK 2EFPA 5EEHA 4I0BA 4BAYA 4HAMA 2H6CA 4L0ZB 3AAFA 3FXUA 3DV8A 5LHHA 5DUIA 1K7AA 5EEGA 2QUFA 5CLSA 2VBXA 1GHCA 2P6SA 1X3UA 5J8CA 2KIMA 1RZ4A 3KETA 1XCVA 4LG0A 2HYGD 4KFCA 1W7PA 1CF7B 3BDDA 4NHJA 4BHPA 3GYHX 5ILUA 2BE5F 3L9FA 4RAYA 2RDPA 5H6RA 1R5HA 2OZUA 4M72A 3CO7C 1ONVA 2GA1A 4MNUA 2C6YA 3PQJA 1H9GA 1YLFA 4WXHA 4N0BA 3KE2A 1LB2A 2ETHA 3WG9A 3L09A 1RI7A 2E7WA 1W5TA 3MFKA 2X0LA 3JW4A 3KEQA 3CTAA 3Q9SA 1F9NA 2HKXA 3H3ZA 1U2WA 2F2EA 2EV0A 1MDMB 1BI3A 3RKWA 1IN8A 3T5XA 2DLLA 3BWGA 3VEPA 3WGGA 3BP8A 4ESFA 3RIRA 4LFUA 4AD9A 3M1EA 3GX4X 3FF5A 2FBIA 2B0LA 4A5NA 2OD5A 2FRHA 4MQ9F 1JXSA 3KZYA 4L9VA 2KRFA 4OINF 1D8JA 4S05A 2ZO4A 1FP2A 1LDJA 1T0FA 2Z9OA 2RVCA 2FMLA 2HQRA 2EFWA 2KJCA 4N9HA 1KU7A 2IPQX 1JE8A 2VOOA 2JZYA 1ZARA 4GYGA 3ZMUA 4UVBA 5DD8A 3I0TA 3PQKA 4HX7A 4G7OF 3I59A 4XBFA 1MJBA 1OYIA 3TO7A 1OR7A 1IAWA 1B9MA 2LNBA 4MTEA 5FGMA 1S3JA 3TDUC 4IHSA 2FU4A 2V6CA 2JT1A 1ZAOA 3I54A 2ADUA 3ECHA 2QWWA 2FBHA 4OMZA 3O2PE 5CVIA 2L02A 1HXDA 2FOKA 3ML6A 4ZZDA 2JSCA 3IRRA 5D5XB 1USTA 1TQMA 3EQLF 1TQPA 3DP7A 1U8RA 3E5UA 4WXCA 1S29A 1ZYRF 2H09A 3F8MA 5DYMA 4I7HA 1SFEA 2YPRA 1Z05A 2Q0OA 1I27A 5FFXA 1ZHFA 2CW0F 5LGUA 1ON2A 4EJUA 3B73A 3DQVC 2HQNA 4I09A 3GVAA 1P2FA 4G9YA 4A0YA 1CGPA 3C7JA 3RYRA 1TLHB 3KFWX 3RTRA 3LSTA 4HDVA 3HSFA 1B1BA 4GCVA 2CYYA 3E6DA 3I58A 4R8HA 5HS9A 2VE8A 4MEXF 2O0YA 1S7AA 3ZMZA 3DFGA 3WU0A 3WU1B 3LAPA 2W85A 3I71A 3RKYA 2DBBA 1J75A 4U0WA 1EH7A 1IN6A 2X4HA 4EV0A 2STTA 2MH9A 1TNSA 2ISYA 2FNPA 2EK5A 3T8TA 3P7NA 2D45A 1KQ9A 3V7SA 1K79A 1ZLKA 2XRNA 1FSEA 4M9SA 2W84A 4P96A 4UHTA 5ILVA 1ZRCA 4G94A 1UCRA 1QZZA 3SHFA 4DQ2A 1I1GA 1OYWA 1YFHA 2NAZA 4O6JA 4UV9A 2M45A 3W6KB 1LDKB 1IRFA 5LHIA 3P9KA 4BQAA 3FM3A 1FBUA 3FXQA 1Z6RA 4KA4A 5BPIA 3P9CA 4A5MA 4AIKA 4HX8A 1GXPA 2Z99A 3HHGA 2ACJA 3S2WA 4B09A 5HLHA 1U5TC 2KIFA 3K1NA 2VC1A 5FLXZ 3KCCA 2VODA 3IHUA 4RB2C 3FXRA 1YQAA 5E18F 1KA8A 3WTUC 1WRJA 3F8CA 1KQ8A 2IP2A 4KN7X 4ZH4F 3IWZA 2A6EF 2FBKA 5DUKA 4LK1F 3R0JA 1TNTA 1YO5C 2VC0A 5DD4A 2A6HF 2GQQA 1ZN2A 1FP1D 4MEYF 3V7CA 2WTEA 4UUVA 1EH8A 1ZG5A 4CDGA 1SMYF 4ZYHA 4IRGA 1FBSA 1FT9A 3WTTC 1ZRDA 3WTVC 2FE3A 4HDUA 3ERED 5D4SA 3DF8A 3FZVA 3BPVA 4HV5A 2HEOA 4MHGA 4LD5A 2NRAC 1U78A 2FF4A 1XGSA 2AXLA 2W24A 2YX4A 4WCGA 1AOYA 4ENNA 2D2WA 2Y75A 1I1SA 1Z6TA 3LAJA 2IA1A 4EGZA 1WKMA 2BYVE 3JSPA 3DPLC 2VN2A 3LQQA 4FHTA 4UVCA 2G7UA 2V1DA 3CUQB 2MLKA 4PZJA 3L7WA 5HVQC 2Z3YA 3LA7A 4MGRA 2DQLA 5A2QZ 2WV0A 3I64A 2CO5A 4NQWA 2A07F 4M9XA 3WTSC 2EFOA 1LEBA 5FO5A 3IKTA 2IVMA 3QP6A 1A04A 2BEOA 1ZG3A 1J9IA 4F7ZA 3TKYA 4UXNA 3GUDA 2JPBA 2KJBA 4HZFA 5LGTA 3KP4A 1STZA 1TTYA 2L54A 1OMIA 2LKPA 1E2XA 4G8XA 4HW0A 4U7DA 1QZYA 1Z91A 1QBJA 1U3EM 2J5OA 2Z5UA 1KGSA 3ZQ7A 3GWZA 2WC2A 1C0WA 3KP7A 1XSXA 4HQMA 3I53A 3C1DA 5HS8A 1P4AA 3SFZA 2FNAA 1JGSA 5K5RA 3WE2A 2HZTA 4R1HA 2GZWA 2PJPA 3KLOA 3MWMA 5DCMB 3O3KA 1XD7A 2QQBA 1USSA 3N97A 1IXCA 1O7LA 5BMZA 2XROA 1MD0A 3ISPA 5LEJA 5HLGA 1BIAA 2HWVA 2MLGA 2D1HA 4RB0A 4YG2F 4LB5A 3L00A 3WTZA 4H0EA 2Q2EA 4RAZA 2V79A 3GLXA 4LLGF 2XHKA 4EM1A 1WSUA 1DP7P 1J2XA 4HF2A 3DPTA 1T38A 1B4AA 1L0OC 3LWFA 3W6JB 1HW5A 3MAJA 3QU6A 2DI3A 4GXOA 4IF4A 5HDGA 5CVRA 5BOXA 5ICGA 4IXAA 2NS0A 5H6QA 2O61A 3QU3A 1BIBA 4E70A 4Q5SF 2JPCA 2XV4S 2OBPA 2MH2A 3KZZA 3F6OA 3NQOA 2UZKA 1ULYA 3RYPA 4M9ZA 2JRTA 4OIOF 3JTGA 3CDHA 2QYOA 5HDKA 5L3CA 4I01A 1TBXA 5D6FA 4M6YA 2LSOA 3GFIA 4EJTA 1KYZA 1P6RA 3RDIA 1LJ9A 3HYIA 1W4MA 3J7AO 4KICA 4EGYA 1T6SA 5K5OA 2QBYA 4GYIA 2PN6A 1FOKA 5A2QK 1TQIA 2RNJA 2ZKZA 2OU2A 1HW2A 1HKQA 3QOPA 3N4MA 1F1ZA 1UB9A 4LJZF 3DKWA 4A2UA 4CHUA 3BJAA 3E6MA 1OKRA 3QP5A 1JHHA 1QGPA 1V4RA 1Q1HA 4OIQF 5LRRA 3ABUA 3SZPA 2GXBA 4YIFA 2AS5F 4LK0F 4CYDA 3TO6A 1WWXA 5LRSA 3BJ6A 2IJLA 3R61A 2OAZA 1E17A 2DK8A 3J80Z 2P6TA 4Q47A 2CGPA 3O6BB 2W25A 5CYVA 3WTWC 1MJAA 1XB4A 2LDUA 4ESJA 2QM3A 2EFQA 4ON0A 3FWEA 3K2ZA 3KP3A 3TOBA 3RPUA 5E1ZB 2K7LA 2H94A 3GXOA 2QLZA 3HRUA 4K2EA 1KU2A 1YW8A 1XSVA 4JK1X 3E5QA 1FC3A 3M8EA 2K02A 1YG2A 3HTUA 1BC7C 4M6XA 3CUQA 4ASNA 2EJRA 4YIIA 1ZH5A 5IT9Z 3F21A 4HF1A 1XGOA 1HKTA 4Y13A 1SFXA 3F72A 3HHHA 4XRFA 3Q5FA 1R58A 2LF8A 5E20A 4A0ZA 1YIOA 2QQAA 1W5SA 1PDNC 1YTYA 4OOIA 4AWXB 3ELKA 2A69F 5HDNA 1Y0UA 2V1XA 1FWZA 2VONA 2MBFA 1MKMA 2Y48A 2GAUA 3TQNA 4KN4X 1TW3A 5KVRA 4IHTA 2RQPA 2EA4A 2NYXA 4LLLA 4YFNF 4OU0A 5BQTA 5DDGA 3EYYA 1I6XA 1IXRC 3E97A 4Y17A 1BI1A 4WXDA 1HW1A 4IVNA 1FPQA 4Z2YA 5D8LB 2E1CA 4YFXF 5DCMA 4UV8A 3HRMA 2K86A 2XKOA 3IRQA 3SXYA 3GFLA 4GGGA 4O3MA 2P7CB 4KNYA 3WTYC 1RUNA 3MZYA 5E17F 2UXXA 4LB6B 2NNNA 3ROUA 2XAFA 5F64A 5ICEA 1XDSA 3ZN0A 1ZGJA 5CVJA 2RKHA 2Y0MA 4BXUA 1ZRFA 3DEUA 2K4BA 4WX9A 1AWCA 5LHGA 4GO1A 4UNOA 1O3TA 2L01A 3VFZA 2OQGA 4U0VA 2PQ8A 2FQ3A 4QLCU 3C3WA 3U2RA 3K1MA 4WK8F 1BJAA 2EWNA 5FD5A 1MJ9A 2W57A 3EETA 2R7FA 1ZG1A 1FYMA 1XSDA 1QNTA 2EFNA 3LFKA 2YSRA 2H6BA 3HRTA 3ECOA 4ENKA 4JQFA 2QBYB 2FEZA 4HX4A 1Z1DA 1EV7A 3FMQA 2OQRA 1YW9A 1UHMA 4KYWA 3NRVA 1G4DA 5D5UB 3NEUA 1S6LA 1MGTA 3V4GA 4TV7A 4KIBA 4BHCA 4IRHA 1FSHA 1EH6A 4EM2A 5IT9K 5DV5A 3WGHA 4Q48A 4KMUX 5ILSA 1D8KA 2HYFA 4B8XA 2CG4A 4DNCA 1HKSA 2ZFWA 3ZMSA 4A12A 3LA3A 3ZP5A 1PP8F 5D5VB 1IUYA 1IF1A 3RJPA 1JHFA 1BI2A 1G3SA 4N9IA 3JAMZ 3GW2A 3U1DA 2V1UA 4AVPA 2CQKA 4RGUA 1ZGAA 1GXQA 2XAGA 4UVAA 5JHUA 1XGNA 3F23A 2J5PA 3R6SA 1IN4A 1O7FA 4OMYA 1F5TA 1HSTA 3RPQA 2YX7A 4I98B 1NHAA 4A6EA 3HUGA 5JR3A 2E7XA 2EV6A 4M74A 4RGSA 2DK5A 1SD5A 5LLQA 2ZMEB 5TJJA 5HLIA 4L0YB 4XSXF 4Q4ZF 1FX7A 3ZMDA 1S8NA 4HLYA 1T2KA 1LEAA 1F4KA 2PBIA 2Z33A 2UXNA 4KT5C 4A0XA 5H20A 3FM5A 4HOBA 2GIVA 2XKPA 5CVVA 1IW7F 2OA4A 3ABTA 4L5JA 3FHZA 5JVTA 1T39A 2HS5A 2ZNZA 1YS7A 1D5VA 5ICFA 2ZNYA 2FA5A 2VOPA 3WODF 2GXGA 3CLOA 2HOEA 3I4PA 5D6EA 1UFMA 5IT3A 1FYLA 2RN7A 3IC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3D A;  1O3Q A;  3COA C;  1B9N A;  1BI0 A;  2HGC A;  3JTH A;  3F8F A;  5CJ9 A;  4BH9 A;  2WWY A;  1GVJ A;  1IZ1 A;  1SMT A;  1ON1 A;  2VT2 A;  1KU3 A;  3QPH A;  2G7H A;  1BM9 A;  5AIP A;  1KQ0 A;  2PFB A;  1ZRE A;  3LQR A;  1I5Z A;  4S04 A;  2DTR A;  3WGI A;  5FLX K;  2ESH A;  1P4W A;  4HF0 A;  1REP C;  2F5C A;  2XUB A;  2XGX A;  1HQC A;  4ZYG A;  3T1B A;  2EB7 A;  2K4J A;  2D1V A;  4HYE A;  4EM0 B;  1J0R A;  3HOS A;  1OPC A;  2IA0 A;  2KIU A;  3EYI A;  4P5O A;  4HQE A;  1QO0 D;  4O5V A;  3RKX A;  2CWE A;  2RV8 A;  1R1T A;  3T0Y A;  3CUQ C;  1TW2 A;  3H3U A;  3OV8 A;  4EMS A;  5DEQ A;  3V8L A;  1T98 A;  4M73 A;  4IJA A;  4EVI A;  3WTX C;  5CVU A;  1J59 A;  2VXZ A;  2M1B A;  2QQ9 A;  4I2O A;  5FD6 A;  3GF2 A;  5FB2 A;  3HTS B;  3HIF A;  2A5Y B;  3M9A A;  4U88 A;  2XVC A;  1SD4 A;  2O6G E;  3V8K A;  2RC4 A;  3V7R A;  3T8R A;  2TDX A;  1XCB A;  4BYY A;  5K1Y A;  5E8I A;  2ISZ A;  1SFU A;  5AIQ A;  1LNW A;  3TGN A;  2A68 F;  3R0A A;  3D5L A;  1P4X A;  5L3F A;  3ZN1 A;  1BBY A;  2PG4 A;  2BV6 A;  4CZZ A;  3G3Z A;  2XAQ A;  1BN5 A;  4RB3 C;  5LBQ A;  4CIC A;  4RB1 A;  2FSW A;  1ODD A;  5DCF A;  1W7P D;  1IN7 A;  1PP7 U;  3E6B A;  2HR3 A;  5ED4 A;  5E1X A;  1MZB A;  3HSE A;  4EJO A;  4R79 A;  4A6D A;  4XLN F;  2BBY A;  2GA2 A;  1Z7U A;  3RI4 A;  4ETS A;  3ZMV A;  2YU3 A;  1J5Y A;  3BOQ A;  3KEO A;  2DAO A;  4XSZ F;  3BPX A;  5TRD A;  2ZME A;  2P5L C;  3CO6 C;  5L3B A;  4NB5 A;  2IA2 A;  4HA8 A;  2G9W A;  4P9F A;  2O03 A;  3M7G A;  1RNL A;  3PFI A;  4KIG A;  1QPM A;  4BHB A;  2ZXJ A;  4HLX A;  2HTJ A;  4KMF A;  3E3V A;  6PAX A;  2F5D A;  3H92 A;  4IRI A;  3F22 A;  1DPU A;  1D3Y A;  5JFR A;  1LDD A;  1K78 B;  5KK1 A;  2L4A A;  1FBQ A;  2QVO A;  3QAH A;  5K5Q A;  1YYV A;  2LF7 A;  2VT3 A;  1K6O A;  3MEX A;  1U5T B;  5L3G A;  2Q8K A;  2DPD A;  2VBZ A;  3J81 Z;  1XMK A;  1R7J A;  3TDZ C;  3GFJ A;  1R36 A;  3MQ0 A;  2YR2 A;  1RUO A;  2K27 A;  3FMS A;  3GEZ A;  3IKV A;  4HBL A;  2QZ8 A;  1DDN A;  1DUX C;  2HDC A;  3Q9V A;  3E6C C;  3MZH A;  1YS6 A;  1Z9C A;  2L3D A;  2P8T A;  3ZMT A;  3BZ6 A;  2F5E A;  3MCZ A;  2PMH A;  1R00 A;  1IN5 A;  3E5X A;  2PEX A;  5HOO A;  2CSO A;  3BJO A;  2DPU A;  4U0Y A;  4HV6 A;  1IRG A;  4AIJ A;  4ENM A;  2A61 A;  3HOT A;  1ZLJ A;  2VE9 A;  1R22 A;  4L9N A;  3QRF F;  4D0P A;  1B59 A;  4EQQ A;  2F5F A;  4FX0 A;  3BRO A;  3KLN A;  4ZYE A;  4ZZL A;  2M8E A;  3CUO A;  1R1U A;  1P92 A;  3GZ5 A;  5HS7 A;  1SAX A;  3J80 K;  3D0S A;  5L3E A;  4OIR F;  4RGR A;  4Y15 A;  2HKO A;  3VB2 A;  3WE3 A;  4LG0 B;  2QEN A;  2ZJ2 A;  1FY7 A;  2IT0 A;  4G7H F;  1SD6 A;  1R5G A;  1W7P B;  5E8G A;  1U6G A;  2E1N A;  2XAJ A;  1FNN A;  4LLN A;  4P55 A;  4RS8 A;  3U9G A;  4PDK A;  1BC8 C;  1CF7 A;  4JBA A;  2R3S A;  2M5W A;  2ELH A;  4EJW A;  1XDU A;  3EDP A;  5ICC A;  3F8B A;  3C18 A;  4ENJ A;  1WI9 A;  2O3F A;  1R1V A;  4LMY A;  1O57 A;  4G6Q A;  4LGW A;  1XN7 A;  2COM A;  2CFX A;  2L4M A;  1OYY A;  5F6F A;  3TOA A;  2JTV A;  4PGH A;  2P4W A;  2UWM A;  2R7D A;  3F3X A;  3DXJ F;  2KKO A;  3KP6 A;  4CGZ A;  5D8K B;  2V9V A;  3K69 A;  4YFK F;  2IRF G;  2M30 A;  2PI0 A;  2H27 A;  3F6V A;  3K9T A;  3ZPL A;  5BPD A;  4I0A A;  4L9T A;  4CO8 A;  3G73 A;  2GWR A;  5D4R A;  1B6A A;  3CJN A;  4PGG A;  2P5K A;  5E1W A;  2DO7 A;  4OIP F;  3SQN A;  3J81 K;  1SD7 A;  3V8J A;  3IWF A;  1MDM A;  1S7O A;  4G6D A;  4M71 A;  1PUE E;  1H0M A;  2MD5 A;  5AON A;  3R4K A;  1G6N A;  2FMY A;  1G3W A;  2DW4 A;  2DFI A;  1XGM A;  3M8F A;  3FMR A;  1IXS B;  2IW5 A;  4EJV A;  1FZP B;  3VOD A;  3HSR A;  1KYW A;  5J6X A;  3VOE A;  4KIF A;  2ESN A;  4WF2 A;  4CXF A;  1UHW A;  2PMU A;  2VBY A;  2BGC A;  1HSJ A;  1LVA A;  3R60 A;  4RGX A;  1V3F A;  2STW A;  1O3R A;  3I59 B;  4L18 B;  3HRS A;  2HFH A;  2EA2 A;  4IPA A;  3L2C A;  1BOA A;  4XLP F;  1DPR A;  2XIG A;  3K1P A;  1XMA A;  4PCQ A;  2A3S A;  1KU9 A;  3TO9 A;  1G3T A;  4WWC A;  2OZ6 A;  3QPT A;  5JI6 A;  2EV5 A;  2ZBK A;  2P7V B;  3K0L A;  3P9I A;  3GZ6 A;  3I5U A;  2O8X A;  1J7K A;  2XAS A;  5LGN A;  1VTN C;  1K78 A;  3GFM A;  5J8F A;  1HBX G;  4BNC A;  5ERI A;  2P5V A;  2DQR A;  3GO5 A;  4FT8 A;  3F8N A;  3KP5 A;  5D5W B;  2M87 A;  3OOP A;  3EUH A;  1U5T A;  2PLY A;  5LEK A;  4L9J A;  4ZYD A;  2RGV A;  2NNY A;  1L3L A;  1YW7 A;  1R23 A;  2XAH A;  4L5I A;  3JSO A;  4P9U A;  2ZCW A;  5BS6 A;  4U7B A;  3LA2 A;  3ULQ B;  4KDP A;  2MC3 A;  4KUM A;  3KP2 A;  3IL2 A;  4I02 A;  4MQV A;  1H9T A;  3BY6 A;  3SZT A;  3B02 A;  4QWQ A;  1RIO H;  5F1R A;  2DU9 A;  1FLI A;  1LQ1 A;  4MTD A;  2FXA A;  2DT5 A;  1FYK A;  4G7Z F;  2MA3 A;  3FX3 A;  1QQI A;  1O3S A;  1G3Y A;  2VBW A;  4FX4 A;  5FFZ A;  3REO A;  4AIH A;  1WQ2 A;  4ESB A;  2HTS A;  3JAM K;  2EFP A;  5EEH A;  4I0B A;  4BAY A;  4HAM A;  2H6C A;  4L0Z B;  3AAF A;  3FXU A;  3DV8 A;  5LHH A;  5DUI A;  1K7A A;  5EEG A;  2QUF A;  5CLS A;  2VBX A;  1GHC A;  2P6S A;  1X3U A;  5J8C A;  2KIM A;  1RZ4 A;  3KET A;  1XCV A;  4LG0 A;  2HYG D;  4KFC A;  1W7P A;  1CF7 B;  3BDD A;  4NHJ A;  4BHP A;  3GYH X;  5ILU A;  2BE5 F;  3L9F A;  4RAY A;  2RDP A;  5H6R A;  1R5H A;  2OZU A;  4M72 A;  3CO7 C;  1ONV A;  2GA1 A;  4MNU A;  2C6Y A;  3PQJ A;  1H9G A;  1YLF A;  4WXH A;  4N0B A;  3KE2 A;  1LB2 A;  2ETH A;  3WG9 A;  3L09 A;  1RI7 A;  2E7W A;  1W5T A;  3MFK A;  2X0L A;  3JW4 A;  3KEQ A;  3CTA A;  3Q9S A;  1F9N A;  2HKX A;  3H3Z A;  1U2W A;  2F2E A;  2EV0 A;  1MDM B;  1BI3 A;  3RKW A;  1IN8 A;  3T5X A;  2DLL A;  3BWG A;  3VEP A;  3WGG A;  3BP8 A;  4ESF A;  3RIR A;  4LFU A;  4AD9 A;  3M1E A;  3GX4 X;  3FF5 A;  2FBI A;  2B0L A;  4A5N A;  2OD5 A;  2FRH A;  4MQ9 F;  1JXS A;  3KZY A;  4L9V A;  2KRF A;  4OIN F;  1D8J A;  4S05 A;  2ZO4 A;  1FP2 A;  1LDJ A;  1T0F A;  2Z9O A;  2RVC A;  2FML A;  2HQR A;  2EFW A;  2KJC A;  4N9H A;  1KU7 A;  2IPQ X;  1JE8 A;  2VOO A;  2JZY A;  1ZAR A;  4GYG A;  3ZMU A;  4UVB A;  5DD8 A;  3I0T A;  3PQK A;  4HX7 A;  4G7O F;  3I59 A;  4XBF A;  1MJB A;  1OYI A;  3TO7 A;  1OR7 A;  1IAW A;  1B9M A;  2LNB A;  4MTE A;  5FGM A;  1S3J A;  3TDU C;  4IHS A;  2FU4 A;  2V6C A;  2JT1 A;  1ZAO A;  3I54 A;  2ADU A;  3ECH A;  2QWW A;  2FBH A;  4OMZ A;  3O2P E;  5CVI A;  2L02 A;  1HXD A;  2FOK A;  3ML6 A;  4ZZD A;  2JSC A;  3IRR A;  5D5X B;  1UST A;  1TQM A;  3EQL F;  1TQP A;  3DP7 A;  1U8R A;  3E5U A;  4WXC A;  1S29 A;  1ZYR F;  2H09 A;  3F8M A;  5DYM A;  4I7H A;  1SFE A;  2YPR A;  1Z05 A;  2Q0O A;  1I27 A;  5FFX A;  1ZHF A;  2CW0 F;  5LGU A;  1ON2 A;  4EJU A;  3B73 A;  3DQV C;  2HQN A;  4I09 A;  3GVA A;  1P2F A;  4G9Y A;  4A0Y A;  1CGP A;  3C7J A;  3RYR A;  1TLH B;  3KFW X;  3RTR A;  3LST A;  4HDV A;  3HSF A;  1B1B A;  4GCV A;  2CYY A;  3E6D A;  3I58 A;  4R8H A;  5HS9 A;  2VE8 A;  4MEX F;  2O0Y A;  1S7A A;  3ZMZ A;  3DFG A;  3WU0 A;  3WU1 B;  3LAP A;  2W85 A;  3I71 A;  3RKY A;  2DBB A;  1J75 A;  4U0W A;  1EH7 A;  1IN6 A;  2X4H A;  4EV0 A;  2STT A;  2MH9 A;  1TNS A;  2ISY A;  2FNP A;  2EK5 A;  3T8T A;  3P7N A;  2D45 A;  1KQ9 A;  3V7S A;  1K79 A;  1ZLK A;  2XRN A;  1FSE A;  4M9S A;  2W84 A;  4P96 A;  4UHT A;  5ILV A;  1ZRC A;  4G94 A;  1UCR A;  1QZZ A;  3SHF A;  4DQ2 A;  1I1G A;  1OYW A;  1YFH A;  2NAZ A;  4O6J A;  4UV9 A;  2M45 A;  3W6K B;  1LDK B;  1IRF A;  5LHI A;  3P9K A;  4BQA A;  3FM3 A;  1FBU A;  3FXQ A;  1Z6R A;  4KA4 A;  5BPI A;  3P9C A;  4A5M A;  4AIK A;  4HX8 A;  1GXP A;  2Z99 A;  3HHG A;  2ACJ A;  3S2W A;  4B09 A;  5HLH A;  1U5T C;  2KIF A;  3K1N A;  2VC1 A;  5FLX Z;  3KCC A;  2VOD A;  3IHU A;  4RB2 C;  3FXR A;  1YQA A;  5E18 F;  1KA8 A;  3WTU C;  1WRJ A;  3F8C A;  1KQ8 A;  2IP2 A;  4KN7 X;  4ZH4 F;  3IWZ A;  2A6E F;  2FBK A;  5DUK A;  4LK1 F;  3R0J A;  1TNT A;  1YO5 C;  2VC0 A;  5DD4 A;  2A6H F;  2GQQ A;  1ZN2 A;  1FP1 D;  4MEY F;  3V7C A;  2WTE A;  4UUV A;  1EH8 A;  1ZG5 A;  4CDG A;  1SMY F;  4ZYH A;  4IRG A;  1FBS A;  1FT9 A;  3WTT C;  1ZRD A;  3WTV C;  2FE3 A;  4HDU A;  3ERE D;  5D4S A;  3DF8 A;  3FZV A;  3BPV A;  4HV5 A;  2HEO A;  4MHG A;  4LD5 A;  2NRA C;  1U78 A;  2FF4 A;  1XGS A;  2AXL A;  2W24 A;  2YX4 A;  4WCG A;  1AOY A;  4ENN A;  2D2W A;  2Y75 A;  1I1S A;  1Z6T A;  3LAJ A;  2IA1 A;  4EGZ A;  1WKM A;  2BYV E;  3JSP A;  3DPL C;  2VN2 A;  3LQQ A;  4FHT A;  4UVC A;  2G7U A;  2V1D A;  3CUQ B;  2MLK A;  4PZJ A;  3L7W A;  5HVQ C;  2Z3Y A;  3LA7 A;  4MGR A;  2DQL A;  5A2Q Z;  2WV0 A;  3I64 A;  2CO5 A;  4NQW A;  2A07 F;  4M9X A;  3WTS C;  2EFO A;  1LEB A;  5FO5 A;  3IKT A;  2IVM A;  3QP6 A;  1A04 A;  2BEO A;  1ZG3 A;  1J9I A;  4F7Z A;  3TKY A;  4UXN A;  3GUD A;  2JPB A;  2KJB A;  4HZF A;  5LGT A;  3KP4 A;  1STZ A;  1TTY A;  2L54 A;  1OMI A;  2LKP A;  1E2X A;  4G8X A;  4HW0 A;  4U7D A;  1QZY A;  1Z91 A;  1QBJ A;  1U3E M;  2J5O A;  2Z5U A;  1KGS A;  3ZQ7 A;  3GWZ A;  2WC2 A;  1C0W A;  3KP7 A;  1XSX A;  4HQM A;  3I53 A;  3C1D A;  5HS8 A;  1P4A A;  3SFZ A;  2FNA A;  1JGS A;  5K5R A;  3WE2 A;  2HZT A;  4R1H A;  2GZW A;  2PJP A;  3KLO A;  3MWM A;  5DCM B;  3O3K A;  1XD7 A;  2QQB A;  1USS A;  3N97 A;  1IXC A;  1O7L A;  5BMZ A;  2XRO A;  1MD0 A;  3ISP A;  5LEJ A;  5HLG A;  1BIA A;  2HWV A;  2MLG A;  2D1H A;  4RB0 A;  4YG2 F;  4LB5 A;  3L00 A;  3WTZ A;  4H0E A;  2Q2E A;  4RAZ A;  2V79 A;  3GLX A;  4LLG F;  2XHK A;  4EM1 A;  1WSU A;  1DP7 P;  1J2X A;  4HF2 A;  3DPT A;  1T38 A;  1B4A A;  1L0O C;  3LWF A;  3W6J B;  1HW5 A;  3MAJ A;  3QU6 A;  2DI3 A;  4GXO A;  4IF4 A;  5HDG A;  5CVR A;  5BOX A;  5ICG A;  4IXA A;  2NS0 A;  5H6Q A;  2O61 A;  3QU3 A;  1BIB A;  4E70 A;  4Q5S F;  2JPC A;  2XV4 S;  2OBP A;  2MH2 A;  3KZZ A;  3F6O A;  3NQO A;  2UZK A;  1ULY A;  3RYP A;  4M9Z A;  2JRT A;  4OIO F;  3JTG A;  3CDH A;  2QYO A;  5HDK A;  5L3C A;  4I01 A;  1TBX A;  5D6F A;  4M6Y A;  2LSO A;  3GFI A;  4EJT A;  1KYZ A;  1P6R A;  3RDI A;  1LJ9 A;  3HYI A;  1W4M A;  3J7A O;  4KIC A;  4EGY A;  1T6S A;  5K5O A;  2QBY A;  4GYI A;  2PN6 A;  1FOK A;  5A2Q K;  1TQI A;  2RNJ A;  2ZKZ A;  2OU2 A;  1HW2 A;  1HKQ A;  3QOP A;  3N4M A;  1F1Z A;  1UB9 A;  4LJZ F;  3DKW A;  4A2U A;  4CHU A;  3BJA A;  3E6M A;  1OKR A;  3QP5 A;  1JHH A;  1QGP A;  1V4R A;  1Q1H A;  4OIQ F;  5LRR A;  3ABU A;  3SZP A;  2GXB A;  4YIF A;  2AS5 F;  4LK0 F;  4CYD A;  3TO6 A;  1WWX A;  5LRS A;  3BJ6 A;  2IJL A;  3R61 A;  2OAZ A;  1E17 A;  2DK8 A;  3J80 Z;  2P6T A;  4Q47 A;  2CGP A;  3O6B B;  2W25 A;  5CYV A;  3WTW C;  1MJA A;  1XB4 A;  2LDU A;  4ESJ A;  2QM3 A;  2EFQ A;  4ON0 A;  3FWE A;  3K2Z A;  3KP3 A;  3TOB A;  3RPU A;  5E1Z B;  2K7L A;  2H94 A;  3GXO A;  2QLZ A;  3HRU A;  4K2E A;  1KU2 A;  1YW8 A;  1XSV A;  4JK1 X;  3E5Q A;  1FC3 A;  3M8E A;  2K02 A;  1YG2 A;  3HTU A;  1BC7 C;  4M6X A;  3CUQ A;  4ASN A;  2EJR A;  4YII A;  1ZH5 A;  5IT9 Z;  3F21 A;  4HF1 A;  1XGO A;  1HKT A;  4Y13 A;  1SFX A;  3F72 A;  3HHH A;  4XRF A;  3Q5F A;  1R58 A;  2LF8 A;  5E20 A;  4A0Z A;  1YIO A;  2QQA A;  1W5S A;  1PDN C;  1YTY A;  4OOI A;  4AWX B;  3ELK A;  2A69 F;  5HDN A;  1Y0U A;  2V1X A;  1FWZ A;  2VON A;  2MBF A;  1MKM A;  2Y48 A;  2GAU A;  3TQN A;  4KN4 X;  1TW3 A;  5KVR A;  4IHT A;  2RQP A;  2EA4 A;  2NYX A;  4LLL A;  4YFN F;  4OU0 A;  5BQT A;  5DDG A;  3EYY A;  1I6X A;  1IXR C;  3E97 A;  4Y17 A;  1BI1 A;  4WXD A;  1HW1 A;  4IVN A;  1FPQ A;  4Z2Y A;  5D8L B;  2E1C A;  4YFX F;  5DCM A;  4UV8 A;  3HRM A;  2K86 A;  2XKO A;  3IRQ A;  3SXY A;  3GFL A;  4GGG A;  4O3M A;  2P7C B;  4KNY A;  3WTY C;  1RUN A;  3MZY A;  5E17 F;  2UXX A;  4LB6 B;  2NNN A;  3ROU A;  2XAF A;  5F64 A;  5ICE A;  1XDS A;  3ZN0 A;  1ZGJ A;  5CVJ A;  2RKH A;  2Y0M A;  4BXU A;  1ZRF A;  3DEU A;  2K4B A;  4WX9 A;  1AWC A;  5LHG A;  4GO1 A;  4UNO A;  1O3T A;  2L01 A;  3VFZ A;  2OQG A;  4U0V A;  2PQ8 A;  2FQ3 A;  4QLC U;  3C3W A;  3U2R A;  3K1M A;  4WK8 F;  1BJA A;  2EWN A;  5FD5 A;  1MJ9 A;  2W57 A;  3EET A;  2R7F A;  1ZG1 A;  1FYM A;  1XSD A;  1QNT A;  2EFN A;  3LFK A;  2YSR A;  2H6B A;  3HRT A;  3ECO A;  4ENK A;  4JQF A;  2QBY B;  2FEZ A;  4HX4 A;  1Z1D A;  1EV7 A;  3FMQ A;  2OQR A;  1YW9 A;  1UHM A;  4KYW A;  3NRV A;  1G4D A;  5D5U B;  3NEU A;  1S6L A;  1MGT A;  3V4G A;  4TV7 A;  4KIB A;  4BHC A;  4IRH A;  1FSH A;  1EH6 A;  4EM2 A;  5IT9 K;  5DV5 A;  3WGH A;  4Q48 A;  4KMU X;  5ILS A;  1D8K A;  2HYF A;  4B8X A;  2CG4 A;  4DNC A;  1HKS A;  2ZFW A;  3ZMS A;  4A12 A;  3LA3 A;  3ZP5 A;  1PP8 F;  5D5V B;  1IUY A;  1IF1 A;  3RJP A;  1JHF A;  1BI2 A;  1G3S A;  4N9I A;  3JAM Z;  3GW2 A;  3U1D A;  2V1U A;  4AVP A;  2CQK A;  4RGU A;  1ZGA A;  1GXQ A;  2XAG A;  4UVA A;  5JHU A;  1XGN A;  3F23 A;  2J5P A;  3R6S A;  1IN4 A;  1O7F A;  4OMY A;  1F5T A;  1HST A;  3RPQ A;  2YX7 A;  4I98 B;  1NHA A;  4A6E A;  3HUG A;  5JR3 A;  2E7X A;  2EV6 A;  4M74 A;  4RGS A;  2DK5 A;  1SD5 A;  5LLQ A;  2ZME B;  5TJJ A;  5HLI A;  4L0Y B;  4XSX F;  4Q4Z F;  1FX7 A;  3ZMD A;  1S8N A;  4HLY A;  1T2K A;  1LEA A;  1F4K A;  2PBI A;  2Z33 A;  2UXN A;  4KT5 C;  4A0X A;  5H20 A;  3FM5 A;  4HOB A;  2GIV A;  2XKP A;  5CVV A;  1IW7 F;  2OA4 A;  3ABT A;  4L5J A;  3FHZ A;  5JVT A;  1T39 A;  2HS5 A;  2ZNZ A;  1YS7 A;  1D5V A;  5ICF A;  2ZNY A;  2FA5 A;  2VOP A;  3WOD F;  2GXG A;  3CLO A;  2HOE A;  3I4P A;  5D6E A;  1UFM A;  5IT3 A;  1FYL A;  2RN7 A;  3IC7 A; 
#chains in the Genus database with same CATH topology
 3HKZ N;  3IUO A;  5M5Y J;  5L3D A;  1ZTR A;  4RAF A;  1O3Q A;  3COA C;  1B9N A;  3GTO J;  1BI0 A;  2HGC A;  2QCO A;  3JTH A;  4DGW B;  4BXX J;  5GPA A;  3F8F A;  5CJ9 A;  2V1N A;  4YRV A;  4BH9 A;  1I3Q J;  2WWY A;  1GVJ A;  3IAM 2;  1IZ1 A;  1SMT A;  4E7S A;  4J00 A;  3BR5 A;  1ON1 A;  2DMN A;  2VT2 A;  1T33 A;  1KU3 A;  4DOZ A;  3QPH A;  2NS8 A;  2G7H A;  4XNF A;  1U8B A;  2GM4 A;  1BM9 A;  1FIP A;  3OWT A;  5AIP A;  3B6A A;  2DMU A;  3PJR A;  3S3O A;  3LSM A;  1KQ0 A;  4LIT A;  2PFB A;  3G1M A;  1ZRE A;  3LQR A;  1I5Z A;  4S04 A;  2DTR A;  3WGI A;  1EJ9 A;  5FLX K;  1QHH D;  4LIU A;  2ESH A;  1P4W A;  4HF0 A;  1REP C;  1MND A;  2F5C A;  2P0W A;  2XUB A;  2XGX A;  2HOS A;  3HGG A;  1HQC A;  2IAI A;  3SJM A;  2VAS A;  2MAB A;  4ZYG A;  3T1B A;  1V55 H;  2R5Z B;  1HDD C;  3MKY B;  1LE8 A;  2EB7 A;  2K4J A;  2D1V A;  5HOD A;  4HYE A;  4GFB A;  1RKT A;  2JUC A;  4EM0 B;  1J0R A;  2CW8 A;  2EIL H;  3ONQ A;  3HOS A;  3U1K A;  1OPC A;  2OV7 A;  2IBD A;  1Y39 A;  2IA0 A;  2KIU A;  1NG6 A;  1XC5 A;  1A31 A;  3BTC A;  2PJR A;  3EYI A;  3W3C A;  2VI6 A;  3UKG A;  4BBS J;  4P5O A;  4HQE A;  3HOU J;  1QO0 D;  4O5V A;  1SVO A;  1T95 A;  3RKX A;  3OSG A;  1MMS A;  2CWE A;  2RV8 A;  2QEX I;  2K9S A;  1R1T A;  4RLF A;  3T0Y A;  1OCC H;  3CUQ C;  1TW2 A;  3BTJ A;  2CUJ A;  4HEA 2;  1OR7 C;  3ZQQ A;  4LG3 A;  1JTX A;  2W1O A;  1B72 A;  3A0B C;  3H3U A;  3CJR B;  5FKM A;  3OV8 A;  3S3N A;  4EMS A;  5DEQ A;  3V8L A;  3QOE A;  1T98 A;  2N8G A;  4IJA A;  4M73 A;  4EVI A;  2ID3 A;  1JUP A;  2YU9 J;  3FXM A;  3ZR8 X;  3WTX C;  5CQG A;  3KPH A;  5CVU A;  1J59 A;  2VXZ A;  2M1B A;  2ZJQ F;  1IRX A;  2QQ9 A;  4I2O A;  5FD6 A;  1R4N B;  3GF2 A;  1YHQ I;  5FB2 A;  1VZ0 A;  3HTS B;  2NXN B;  2E36 A;  1A35 A;  3PNV A;  3HIF A;  3HM5 A;  5J3L A;  4D9J A;  2A5Y B;  3M9A A;  4U88 A;  5F1J A;  2XVC A;  2E71 A;  1SD4 A;  2E34 A;  3I3L A;  2O6G E;  3V8K A;  1HOM A;  2HNH A;  2RC4 A;  1NK2 P;  3V7R A;  3T8R A;  2TDX A;  1XCB A;  1SEU A;  5CPR B;  4NBQ A;  2GIZ A;  2JA2 A;  5CKT A;  4BYY A;  1JJ6 C;  4CCO A;  3CMY A;  4A3M J;  5K1Y A;  2Y2Z A;  5E8I A;  3VYR B;  2ISZ A;  1SFU A;  2KLO A;  5AIQ A;  1LNW A;  3TGN A;  5FJ8 J;  2CV2 A;  2A68 F;  3R0A A;  3D5L A;  2V6E A;  1P4X A;  5L3F A;  2H1K A;  3ZN1 A;  1BBY A;  4A3G J;  2PG4 A;  2BV6 A;  2VKE A;  2K85 A;  5EJC A;  3A01 B;  4CZZ A;  3G3Z A;  5IPA A;  1UG0 A;  2LBF B;  5KAI C;  2Y0S A;  4RBO A;  2KRH A;  3W2W A;  4XKB A;  4CCL A;  5B3S H;  2XAQ A;  2DA3 A;  1BN5 A;  4RB3 C;  3KYC B;  2O8K A;  4CUG A;  3AG3 H;  3GTK J;  5LBQ A;  1DQU A;  4XLF A;  3DWL E;  1ETW A;  3CCJ I;  2MC4 A;  4CIC A;  4RB1 A;  3JRI A;  2FSW A;  3BZC A;  1ODD A;  3G71 I;  2GBY A;  2VJ5 A;  1VFC A;  2GOX B;  5DCF A;  1W7P D;  1QHG A;  1IN7 A;  1PP7 U;  1HC8 A;  3E6B A;  2HR3 A;  1D1A A;  3AG2 H;  5ED4 A;  4JX6 A;  5E1X A;  1MZB A;  3HSE A;  2M2E A;  4EJO A;  2WAF A;  3HEF A;  4R79 A;  3S1Q J;  4A6D A;  2XB5 A;  1V5F A;  4XLN F;  2KHM A;  3TW6 A;  2BBY A;  2GA2 A;  2HU9 A;  3S2H J;  1Z7U A;  1Y0N A;  3RI4 A;  1I6H J;  2M9H A;  4BJ5 C;  4ETS A;  3ZMV A;  3K2A A;  1WFX A;  3GTJ J;  2YU3 A;  1J5Y A;  3BOQ A;  3KEO A;  1B8I B;  2B63 J;  2DAO A;  2R5Y A;  3IV5 A;  4XSZ F;  5EF6 A;  2EZH A;  4KT6 A;  3TBI A;  2M0M A;  2KQR A;  4DBR A;  4XLH A;  3K70 D;  2QSF X;  4IHW A;  1SC7 A;  3BPX A;  2IS2 A;  1X3Z B;  5TRD A;  2ZME A;  2P5L C;  3QOD A;  4A3B J;  3CO6 C;  4IX7 A;  2FQ4 A;  3PUB A;  3PSI A;  5L3B A;  3OYE A;  4NB5 A;  3J7Y J;  3I9V 2;  3I56 I;  2IA2 A;  4HA8 A;  1FOX A;  2G9W A;  4P9F A;  2B9S A;  3HDD A;  3CP8 A;  2O03 A;  3M7G A;  3WG7 H;  1RNL A;  3PUF A;  3PFI A;  3LSP A;  4KIG A;  1QPM A;  3HBL A;  3ZQF A;  1LFU P;  3P5J A;  4BHB A;  2L0K A;  2ZXJ A;  4HLX A;  2VLA A;  4B3X A;  2HTJ A;  4KMF A;  2HXO A;  1JKP C;  3E3V A;  1E3P A;  3BG9 A;  5C4J J;  1VQO I;  2F5D A;  6PAX A;  2EZK A;  5K7F A;  3H92 A;  2Y30 A;  4IRI A;  3F22 A;  1DPU A;  1D3Y A;  5JFR A;  1LDD A;  2CW7 A;  2BVL A;  1K78 B;  5KK1 A;  2L4A A;  1FBQ A;  1AA7 A;  3ZOB A;  2QVO A;  5IYC J;  3QAH A;  5K5Q A;  1YYV A;  2LF7 A;  2VT3 A;  3SEZ A;  1K6O A;  1VQ9 I;  3MEX A;  4C3J J;  4W1U A;  3M07 A;  1S72 I;  4PJ0 C;  1U5T B;  2ZFU A;  2MG4 A;  5L3G A;  2VJI A;  3E7L A;  2Q8K A;  2DPD A;  2KZG A;  1OFC X;  1S7E A;  2IS1 A;  5M5W J;  1R71 A;  3M4O J;  1AKH A;  2VBZ A;  3J81 Z;  4ZDL A;  1XMK A;  1OCO H;  1R7J A;  3TDZ C;  4F3Q A;  2JK3 A;  3GFJ A;  2E2J J;  4M3B A;  2OCC H;  4A3D J;  1R36 A;  3MQ0 A;  2YR2 A;  1RUO A;  2K27 A;  1YRN A;  2VL8 A;  2NOG A;  3FMS A;  3GEZ A;  3IKV A;  1MH4 A;  1K6Y A;  2QZ8 A;  4HBL A;  3S14 J;  1DDN A;  2DFH A;  1DUX C;  2HDC A;  1ETK A;  3Q9V A;  4P1W A;  4ZTJ A;  5F27 A;  3E6C C;  1YIT I;  4M6V A;  4C3I J;  3DKX A;  2MW8 A;  3MZH A;  1YS6 A;  4FQG A;  3W6V A;  3FIW A;  2M7A A;  5DS9 A;  2ZJR F;  1Z9C A;  4V19 K;  2L3D A;  2I8D A;  3ERM A;  2P8T A;  3ZMT A;  3CCS I;  4IHY A;  1OQY A;  3BZ6 A;  2F5E A;  3MCZ A;  1R5I D;  2PMH A;  2DA1 A;  1LE8 B;  1MW7 A;  2VKD A;  1R00 A;  1IN5 A;  2KDZ A;  3E5X A;  1QVT A;  4X6A J;  2PEX A;  5HOO A;  2XC7 A;  2CSO A;  3H3V K;  4BAC A;  3NWS A;  3BJO A;  4QIW N;  2DPU A;  1JKQ C;  4U0Y A;  4HV6 A;  1IRG A;  1IDY A;  4RA2 A;  4AIJ A;  1P7I A;  4ENM A;  2Y31 A;  2A61 A;  3HOT A;  1ZLJ A;  3BT9 A;  2VE9 A;  1ORK A;  1R22 A;  2R5Z A;  5EYR A;  1GV2 A;  4L9N A;  3QRF F;  4D0P A;  4DJA A;  4ZTF A;  1B59 A;  4IHV A;  2M0C A;  3ASN H;  3RQI A;  2LY1 A;  4BGD A;  4EQQ A;  2F5F A;  2XRL A;  4FX0 A;  3BRO A;  3KLN A;  4ZYE A;  3MKW B;  4ZZL A;  5HNF A;  2XDV A;  2D5V A;  3HOV J;  4V2F A;  2CV1 A;  2BHY A;  3S1M J;  2M8E A;  1B72 B;  3CUO A;  3VYS B;  3L1P A;  1R1U A;  1BJZ A;  4MIM A;  1P92 A;  3JRB A;  3GZ5 A;  2HXI A;  2HDD A;  2X1D A;  5HS7 A;  1SAX A;  2M4K A;  3KEY A;  1FIA A;  3J80 K;  4RDU A;  5F08 A;  3D0S A;  3GME A;  2FD5 A;  5L3E A;  2M3A A;  4OIR F;  4AVZ A;  4RGR A;  4NC6 A;  4Y15 A;  2TCT A;  2HKO A;  1RR7 A;  5FRO A;  3VB2 A;  3WE3 A;  2XB0 X;  4LG0 B;  2QEN A;  2ZJ2 A;  1FY7 A;  2XSD C;  2R7X A;  2IT0 A;  4G7H F;  1SD6 A;  1X4P A;  1ETO A;  1R5G A;  4IKF A;  1W7P B;  4XKC A;  5E8G A;  3GBG A;  1U6G A;  1R49 A;  2E1N A;  1I39 A;  2CUE A;  2XF7 A;  2XAJ A;  4IHX A;  2LKX A;  1FNN A;  3CF5 F;  4LLN A;  2WY8 Q;  1JTY A;  4P55 A;  4RS8 A;  3U9G A;  4JX5 A;  4PDK A;  3OR1 C;  1BC8 C;  3DBL B;  3DEE A;  4QPQ A;  1NH3 A;  1CF7 A;  3BC8 A;  2DXI A;  4JBA A;  1I50 J;  2R3S A;  1Z21 A;  2M5W A;  2ELH A;  4EJW A;  1XDU A;  3EDP A;  3OS2 A;  5ICC A;  3F8B A;  3C18 A;  4ENJ A;  1WI9 A;  1MBH A;  1R9T J;  2O3F A;  4M3D A;  3M8J A;  1R1V A;  4L5E A;  4LMY A;  1TWG J;  1O57 A;  4G6Q A;  4LGW A;  2DCE A;  1XN7 A;  2COM A;  1X1C A;  2CU7 A;  2OCE A;  3EUK L;  2CFX A;  4S0H B;  2L4M A;  2W48 A;  1OYY A;  1MBJ A;  5F6F A;  3TOA A;  4ZYA A;  2JTV A;  4PGH A;  2P4W A;  3LNQ A;  2UWM A;  3AFH A;  2R7D A;  5GP9 A;  3F3X A;  3BG7 A;  3DXJ F;  1OLT A;  4HG2 A;  2KKO A;  1RKW A;  4BQQ A;  3KP6 A;  2OTL I;  4CGZ A;  3LSK A;  5D8K B;  2V9V A;  2X6W A;  3K69 A;  4YFK F;  3OYD A;  2IRF G;  3VPR A;  2M30 A;  1E3H A;  3TP0 A;  4XRS G;  2PI0 A;  2H27 A;  3F6V A;  3K9T A;  2XAU A;  3Q0W A;  2WAD A;  2K9Q A;  3ZPL A;  2FOW A;  5BPD A;  1VQ7 I;  2VJJ A;  4I0A A;  4L9T A;  2NS7 A;  1Y56 A;  3FDY A;  4CO8 A;  3G73 A;  4BY7 J;  5FRM A;  2GWR A;  2CUZ A;  1WJB A;  5D4R A;  1B6A A;  1MSF C;  3CJN A;  4PGG A;  2P5K A;  3LSG A;  4YEJ A;  1BW6 A;  2AQE A;  4XID A;  5E1W A;  2DO7 A;  4OIP F;  3H5A A;  3SQN A;  3J81 K;  1SD7 A;  3V8J A;  3IWF A;  3DTI A;  1DGW Y;  4F91 B;  1MDM A;  3BR0 A;  1S7O A;  4G6D A;  4XKV A;  4A69 C;  4M71 A;  1PUE E;  1D5Y A;  2L9N A;  2BY1 A;  2WB1 A;  4PJN A;  5E79 C;  4X0G A;  4E7K A;  2JN6 A;  2MD5 A;  5AON A;  3WHB A;  1H0M A;  1IRZ A;  3R4K A;  1G6N A;  2QSH X;  2FMY A;  2XGC A;  1G3W A;  2DW4 A;  2R7R A;  2DFI A;  1XGM A;  3M8F A;  3FMR A;  1IXS B;  2IW5 A;  4EJV A;  1FZP B;  2BZT A;  3LSH A;  4QSH A;  3VOD A;  2R4G A;  3RCO A;  3HSR A;  4CCN A;  1KYW A;  5J6X A;  4H4K C;  3BR2 A;  4KIF A;  3A0H C;  2ESN A;  1ENH A;  3VOE A;  4BEH B;  2Z1D A;  4WF2 A;  2ZJP F;  4CXF A;  1UHW A;  2PMU A;  3A03 A;  2VBY A;  2BGC A;  2XSJ C;  1W36 C;  1HSJ A;  3JR9 A;  5JLW A;  1LVA A;  1WJF A;  1BA5 A;  3R60 A;  2BHZ A;  2MFZ A;  4RGX A;  1V3F A;  2LR8 A;  3OL3 A;  3CP2 A;  3K10 A;  2STW A;  1O3R A;  3I59 B;  2DYR H;  3CZ6 A;  4L18 B;  3HRS A;  1JKO C;  2VIX A;  1MNE A;  3BCB A;  2HFH A;  2EA2 A;  2X6Y A;  4IPA A;  3FHN A;  3L2C A;  5LFA A;  1BOA A;  3C2G A;  4XLP F;  4AM3 A;  1OJL A;  1PYV A;  1DPR A;  2XIG A;  4CH7 A;  3K1P A;  1XMA A;  4PCQ A;  1W0T A;  2A3S A;  1KU9 A;  4DW6 A;  3TO9 A;  1G3T A;  4WWC A;  3CCU I;  2OZ6 A;  3QPT A;  5JI6 A;  1UAA A;  2EV5 A;  2ZBK A;  2GLO A;  2P7V B;  3K0L A;  1FJL A;  1H89 C;  3P9I A;  3GZ6 A;  3I5U A;  3A4C A;  1AKH B;  2O8X A;  1J7K A;  2XAS A;  3IH3 A;  5LGN A;  1VTN C;  1K78 A;  3GFM A;  3HB9 A;  5J8F A;  3CLQ A;  1HBX G;  2HDW A;  4BNC A;  2X51 A;  5ERI A;  1X1A A;  1PJR A;  1NG7 A;  2DQR A;  2P5V A;  2V9P A;  3DTK A;  3GO5 A;  4FT8 A;  4JX4 A;  3F8N A;  3KP5 A;  4AYB N;  5B66 C;  1WJD A;  2M87 A;  5D5W B;  1FTT A;  3HL2 A;  3OOP A;  1VQK I;  3EUH A;  1YRN B;  1U5T A;  2NVT J;  2PLY A;  4NDL A;  5LEK A;  2L9S A;  3HGY A;  4L9J A;  4MFE A;  4ZYD A;  2W82 A;  5EZG A;  2H8W A;  3L2V A;  5DTD A;  2IGM A;  1HA8 A;  2RGV A;  2NNY A;  1L3L A;  2M4G A;  4FE7 A;  3S93 A;  1YW7 A;  1R23 A;  3OYK A;  2XAH A;  4HNU A;  4L5I A;  3JSO A;  2OC6 A;  3VSK A;  4P9U A;  3K4C A;  2ZCW A;  5BS6 A;  4U7B A;  2HQ5 A;  3LA2 A;  3ULQ B;  4KDP A;  2MC3 A;  4ZC3 A;  4KUM A;  3GTM J;  4XOP A;  2XGE A;  3RQ4 A;  5GAG J;  2DTZ A;  3W2A A;  5GTH C;  1X2M A;  2AQF A;  2X1E A;  3KP2 A;  5EDN A;  3CQZ J;  3EUA A;  4M3G A;  3VWB A;  3IL2 A;  4I02 A;  4MQV A;  2F4O B;  1H9T A;  2ZSI B;  1N25 A;  2DDA A;  2VQC A;  2OJE D;  3U21 A;  3ZGK A;  3BY6 A;  3SZT A;  5J4V A;  3B02 A;  4QWQ A;  1RIO H;  5F1R A;  2DU9 A;  1FLI A;  1LQ1 A;  4MTD A;  2FXA A;  2DT5 A;  1FYK A;  3OSF A;  2MA3 A;  4Z6Y A;  4G7Z F;  3FX3 A;  2WAQ A;  1VQ4 I;  1QQI A;  1O3S A;  3JCU C;  1G3Y A;  2LTP A;  2VBW A;  4RMN A;  4FX4 A;  2DJN A;  3G2B A;  5FFZ A;  3WHC A;  3K6G A;  1IC8 A;  2ECB A;  1EA3 A;  2I5U A;  3C2B A;  3REO A;  1WHU A;  4C3H J;  4AIH A;  1IDZ A;  4Y7N J;  1WQ2 A;  2L7K A;  4ESB A;  2HTS A;  3JAM K;  2EFP A;  2ZXW H;  5EEH A;  4I0B A;  5FKN A;  4BAY A;  4HAM A;  2H6C A;  4L0Z B;  1ZR2 A;  2GXA A;  3AAF A;  2VUM J;  4XR6 A;  1MH3 A;  3FXU A;  3SEQ A;  2BXZ A;  2XF5 A;  3DV8 A;  4XL9 A;  3TL4 X;  5LHH A;  5DUI A;  3BTI A;  1R4M B;  2LH9 A;  5EEG A;  1K7A A;  4RM2 A;  1N78 A;  3NAU A;  2QUF A;  1P7J A;  5CLS A;  2VBX A;  5E3O A;  4UB8 C;  1GHC A;  2P6S A;  1X3U A;  2OF7 A;  5J8C A;  2KMU A;  2KIM A;  3OMY A;  1RZ4 A;  2W4S A;  3KET A;  2CMP A;  3J7Z I;  1XCV A;  2ELK A;  2ZXI A;  2HYG D;  4LG0 A;  1VF9 A;  3CF2 A;  3PO3 J;  4V2G A;  3VDX A;  4KFC A;  4RLQ A;  1W7P A;  1CF7 B;  4HNV A;  5IP9 J;  3BDD A;  2JVH A;  1ZGW A;  4NHJ A;  5GTI C;  3LSR A;  4GRI A;  4BHP A;  3VYU B;  4PUS A;  1GV5 A;  3GYH X;  4A3L J;  5ILU A;  4C30 A;  1SVL A;  2BE5 F;  1ERD A;  3FKJ A;  3L9F A;  4XN3 A;  2KDO A;  2M8G X;  3BTL A;  3OOU A;  3JRH A;  4RAY A;  4IOA F;  1FTZ A;  2RDP A;  3KYL A;  5H6R A;  1R5H A;  2OZU A;  4M72 A;  2BY3 A;  3CO7 C;  2KT0 A;  5DM7 F;  2XPW A;  2KL4 A;  4BE2 A;  4HRI A;  1ACI A;  1ONV A;  2GA1 A;  4MNU A;  2DN0 A;  2C6Y A;  3MD2 A;  3PQJ A;  4M3E A;  4NNJ A;  4PJL A;  4BUP A;  3H0G J;  1H9G A;  1YLF A;  4NUB A;  4M3F A;  4BXF A;  4A3E J;  4WXH A;  2DFE A;  2NVU B;  3DU5 A;  2DA2 A;  1VQ8 I;  4N0B A;  3KE2 A;  1LB2 A;  2ETH A;  4CCJ A;  4E7J A;  4FET A;  3RKQ A;  2AO9 A;  4EEF G;  3HOZ J;  3WG9 A;  2V9K A;  1MBK A;  3CJQ B;  3L09 A;  3H9Q A;  4I76 A;  2IGO A;  3CDI A;  1RI7 A;  2E7W A;  1W5T A;  2PX9 A;  2F4I A;  2R93 J;  3A2K A;  3MFK A;  1WZ2 A;  1GLN A;  3AG1 H;  2X0L A;  2VKV A;  3FK6 A;  3JW4 A;  3KEQ A;  3CTA A;  3Q9S A;  1F9N A;  2DOF A;  3CCE I;  2HKX A;  3H3Z A;  1U2W A;  4DZJ A;  2F2E A;  3GTP J;  2EV0 A;  3H9G A;  1MDM B;  1BI3 A;  5F04 A;  5B1A H;  3RKW A;  1H8A C;  1IN8 A;  2CS3 A;  4C2T A;  3T5X A;  2E2I J;  2DLL A;  3BWG A;  3VEP A;  3W2V A;  2RRE A;  3WGG A;  4DYC A;  2IXS A;  1UG2 A;  3BP8 A;  4ESF A;  4YEL A;  3RIR A;  4LFU A;  4AD9 A;  2ME0 A;  3K4J A;  5K7Z A;  2R7V A;  3DBH B;  2DA4 A;  3LOC A;  1EF4 A;  1IO2 A;  3M1E A;  4F52 A;  3GX4 X;  2X6X A;  5C44 J;  3FF5 A;  1T56 A;  3L2U A;  3FXO A;  1Y8Q B;  2FBI A;  2B0L A;  3GTL J;  3MKL A;  2OD5 A;  2FRH A;  4MQ9 F;  4A5N A;  1JXS A;  2BXY A;  5FRN A;  3KZY A;  4L9V A;  1IV6 A;  2KRF A;  4OIN F;  1D8J A;  2M34 A;  3OYA A;  4S05 A;  2JWT A;  1TZL A;  2ZO4 A;  1UJ8 A;  5IYD J;  4PK4 A;  1FP2 A;  5TGT A;  1LDJ A;  1T0F A;  1ZQ3 P;  3K4L A;  2Z9O A;  2RVC A;  3Q0U A;  2ZXH A;  2FML A;  1D1B A;  1APL C;  4BEH A;  3GTQ J;  2HQR A;  2EFW A;  2KJC A;  2JVG A;  4N9H A;  1KU7 A;  2IPQ X;  4C2U A;  1JE8 A;  2VOO A;  3IAS 2;  3ZQI A;  1QA6 A;  2JZY A;  2E2H J;  1E0E A;  1ZAR A;  4GYG A;  2LY2 A;  1BL0 A;  3ZMU A;  4UVB A;  5DD8 A;  4B4C A;  3I0T A;  3PQK A;  4HX7 A;  4G7O F;  3I59 A;  1HDP A;  1WH7 A;  2Y69 H;  4XBF A;  1VI0 A;  1MJB A;  1OYI A;  2L7F P;  1OR7 A;  1S5L C;  3TO7 A;  2X85 A;  4IL6 C;  1IAW A;  1B9M A;  2LNB A;  1SFK A;  1JGG A;  4I99 C;  3LL7 A;  4XON A;  2F48 A;  4MTE A;  5FGM A;  1S3J A;  3TDU C;  4IHS A;  2FU4 A;  2V6C A;  4IQ4 A;  1U9O A;  2JT1 A;  5JHF A;  3ZQC A;  1ZAO A;  1QPI A;  3I54 A;  4ITV A;  2ADU A;  3ECH A;  2QKM B;  4BQN A;  2QWW A;  3A02 A;  1YX5 A;  2FBH A;  2X9D A;  4OMZ A;  2BW3 A;  3O2P E;  5CVI A;  2L02 A;  1HXD A;  4BDY A;  2FOK A;  3ML6 A;  4ZZD A;  5B5E C;  2JSC A;  1Y1W J;  4N4N B;  3IRR A;  2CUF A;  5D5X B;  3K4M A;  1UST A;  1TQM A;  3DKY A;  3EQL F;  1TQP A;  1IUF A;  1JUM A;  3DP7 A;  2PMZ A;  3E5U A;  1U8R A;  4WXC A;  1S29 A;  2LRD A;  1ZYR F;  3QYB A;  2H09 A;  3F8M A;  3ABM H;  5DYM A;  1A36 A;  4I7H A;  1SFE A;  4Y4R A;  2YPR A;  1OCT C;  3S8P A;  1Z05 A;  2Q0O A;  1I27 A;  3I4M J;  5FFX A;  4AID A;  1ZHF A;  2CW0 F;  3HKZ A;  4XMY A;  1ZR4 A;  5C3E J;  5DM6 F;  4XKW A;  5LGU A;  4HPQ A;  3CJT B;  1ON2 A;  4EJU A;  3LFU A;  1POG A;  1HCR A;  3BR6 A;  3B73 A;  5JLX A;  2XGD A;  1D0Y A;  3DQV C;  2HQN A;  1A6I A;  3M1C A;  4I09 A;  2BOL A;  4E7L A;  3GVA A;  3HOW J;  1P2F A;  4G9Y A;  4A0Y A;  1CGP A;  3C7J A;  2LP0 A;  2HOT A;  3RYR A;  1MSE C;  1TLH B;  3OYM A;  1E3O C;  3DLA A;  4B44 A;  3KFW X;  3DCF A;  2KIQ A;  3RTR A;  4LOC A;  1Y8R B;  3LST A;  4HDV A;  3CC4 I;  3HSF A;  4HNT A;  2ID6 A;  1B1B A;  4GCV A;  2E5N A;  2CYY A;  3E6D A;  5CQE A;  3I58 A;  4R8H A;  5HS9 A;  4DYQ A;  3CES A;  2VE8 A;  4MEX F;  2O0Y A;  4IO9 F;  1S7A A;  3ZMZ A;  3DFG A;  3WU0 A;  2NVY J;  4OWR B;  2JA8 J;  2UV1 A;  3E1S A;  3WU1 B;  4ZJZ A;  2W85 A;  4IEJ A;  3LAP A;  3I71 A;  5EZH A;  3Q3S A;  4XLA A;  1KZH A;  3RKY A;  1T8I A;  2DBB A;  2KRC A;  5F0C A;  1J75 A;  3O8H A;  3SZG A;  3DLL F;  4U0W A;  1EH7 A;  1IN6 A;  3H5R A;  3OYN A;  2BVM A;  2X4H A;  4EV0 A;  1LKX A;  2STT A;  2MH9 A;  2K3F A;  1TNS A;  3X2Q H;  2ISY A;  2FNP A;  2EK5 A;  3T8T A;  1NK3 P;  1LVK A;  1P9Q C;  3FXK A;  1PUF B;  3P7N A;  2D45 A;  4XLE A;  1HF0 A;  1KQ9 A;  4PFP A;  4RAG A;  2Y9Z A;  3N05 A;  2EBI A;  3V7S A;  3FBN B;  1K79 A;  3VSL A;  1ZLK A;  3CCV I;  1Y1V J;  2XRN A;  1FSE A;  4M9S A;  2W84 A;  4F93 B;  4P96 A;  4UHT A;  2AXT C;  5ILV A;  3CCL I;  3GTG J;  5F0F A;  1BR2 A;  1ZRC A;  4G94 A;  3BG6 A;  1TL8 A;  1UCR A;  4XQF A;  4ANJ A;  1QZZ A;  2IEK A;  1X1D A;  3SHF A;  1JI8 A;  3ZRG A;  1AU7 A;  4DQ2 A;  2LOO A;  1I1G A;  1OYW A;  1YFH A;  3FXL A;  2WBM A;  2E19 A;  4II2 A;  2NAZ A;  3KX2 A;  4O6J A;  3SYT A;  4UV9 A;  1RES A;  1IV8 A;  2M45 A;  1MIJ A;  3OYB A;  2Z16 A;  4DZP A;  1FMV A;  1WCM J;  2JSP A;  1LDK B;  1IRF A;  3W6K B;  5LHI A;  2R0Q C;  5E3L A;  2X1C A;  3P9K A;  4BQA A;  3FM3 A;  2O9L A;  3HJE A;  3IH2 A;  1FBU A;  3FXQ A;  1Z6R A;  4KA4 A;  1YIJ I;  5BPI A;  1TP4 A;  5E3M A;  3P9C A;  4A5M A;  2QGU A;  4AIK A;  1M1E B;  1QVU A;  2M7B A;  4HX8 A;  1YJN I;  4UB6 C;  3GLL A;  2KPM A;  1GXP A;  2Z99 A;  3K4K A;  3HHG A;  2VQG A;  2X6O A;  4XLC A;  3S2W A;  2ACJ A;  4B09 A;  5HLH A;  1U5T C;  2E1M B;  2KIF A;  3K1N A;  2VC1 A;  5FLX Z;  3KCC A;  4UY8 I;  2VOD A;  3IHU A;  4RB2 C;  1FMW A;  3HOX J;  4A3C J;  3FXR A;  1YQA A;  5E18 F;  2LYC A;  1YI2 I;  1KA8 A;  2EZL A;  1WJE A;  3CD6 I;  3WTU C;  1WRJ A;  3F8C A;  1KQ8 A;  1XX5 A;  2IP2 A;  2QF7 A;  4JP0 A;  1VQL I;  4KN7 X;  4ZH4 F;  1DU6 A;  4JYK A;  3IWZ A;  3I4N J;  2A6E F;  4QTR A;  2FBK A;  5DUK A;  4LK1 F;  3R0J A;  2HYJ A;  2L7Z A;  2Y0S N;  2LG4 A;  1TNT A;  3BR1 A;  1YO5 C;  2XPV A;  2VC0 A;  5DD4 A;  2A6H F;  1OCP A;  2GQQ A;  4XOR A;  1ZN2 A;  5BNG A;  4CCK A;  1FP1 D;  4MEY F;  3V7C A;  2WTE A;  4UUV A;  1X3W B;  2F4M B;  3DEW A;  3CDL A;  1EH8 A;  2EH3 A;  1ZG5 A;  3M3Y J;  4CDG A;  4AC0 A;  1SMY F;  4ZYH A;  2V7F A;  4IRG A;  1FBS A;  1FT9 A;  3WTT C;  1ZRD A;  4D1Q A;  1MNM C;  3WTV C;  2FE3 A;  4HDU A;  4UUS B;  3ERE D;  5D4S A;  3DF8 A;  2DYS H;  3FZV A;  3BPV A;  1JKR C;  2VPR A;  1QZE A;  2VQH A;  5F0H A;  4HV5 A;  3FK7 A;  3F9K A;  1GUU A;  2HEO A;  5C4X J;  3OIO A;  2QA4 I;  4MHG A;  2JA5 J;  2CV0 A;  4LD5 A;  5IYB J;  4BKX A;  2NRA C;  1X4O A;  2JRM A;  1U78 A;  2O7O A;  2FF4 A;  2YS9 A;  3L2Q A;  1XGS A;  2AXL A;  2W24 A;  2YX4 A;  4WCG A;  1AOY A;  2LVS A;  2R7O A;  3OR2 C;  3L2W A;  4ENN A;  2AHQ A;  3BQZ A;  2D2W A;  2Y75 A;  1I1S A;  1Z6T A;  3FKI J;  5GAE J;  3LAJ A;  2IA1 A;  4EGZ A;  4KIS A;  9ANT A;  1WKM A;  3MZ8 A;  4C9Y A;  2BYV E;  3JSP A;  5B1B H;  3DPL C;  2VN2 A;  3LQQ A;  4FHT A;  4UVC A;  4B3A A;  3A1Y A;  5GPC A;  5E3N A;  2G7U A;  2EQR A;  2V1D A;  4A93 J;  3AG4 H;  3CUQ B;  2MLK A;  3H5N A;  3L7W A;  4PZJ A;  5HVQ C;  2Z3Y A;  1OCZ H;  3LA7 A;  4MGR A;  3WU2 C;  2IS6 A;  2HVS A;  2XF6 A;  4XRM A;  2DQL A;  5A2Q Z;  2WV0 A;  3I64 A;  2CO5 A;  4NQW A;  2A07 F;  4M9X A;  1BR4 A;  5FKL A;  5FLV A;  3WTS C;  2EFO A;  1LEB A;  2K9M A;  5FO5 A;  1D1C A;  1TT5 B;  2IVM A;  3D5R C;  3IKT A;  1Y6I A;  3QP6 A;  1A04 A;  2BW3 B;  2BEO A;  4I6Z A;  1ZG3 A;  1XMX A;  1X19 A;  1J9I A;  3CMA I;  4F7Z A;  3FIS A;  1Z3Y A;  2DMT A;  3TKY A;  3H0D A;  1VQM I;  4UXN A;  3GUD A;  2JPB A;  4E7H A;  4AU7 A;  2JUG A;  2IS4 A;  3KIO A;  2KJB A;  4HZF A;  2COB A;  5LGT A;  1U9N A;  3KP4 A;  3AKZ A;  2MSY A;  2E1O A;  3G1O A;  4Y52 J;  4LIV A;  2O5R A;  1STZ A;  1TTY A;  3JRF A;  2L54 A;  1OMI A;  2LKP A;  1E2X A;  4G8X A;  4HW0 A;  3S32 A;  2MYS A;  5HNH A;  3CC7 I;  4U7D A;  3QQA A;  2XPU A;  1QZY A;  1Z91 A;  1QBJ A;  4KJZ A;  4A3F J;  1U3E M;  2QQ8 A;  1CQT A;  4N4O B;  2J5O A;  2Z5U A;  1KGS A;  3ZQ7 A;  2DMQ A;  3GWZ A;  5K7H A;  2WC2 A;  4II3 A;  1C0W A;  2ELJ A;  3KP7 A;  1W1W E;  3JRG A;  3H1C A;  1XSX A;  2LFB A;  2VPL A;  1JT0 A;  4HQM A;  1XG1 A;  3I53 A;  3C1D A;  2IGK A;  5HS8 A;  1P4A A;  3SFZ A;  2OUM A;  4CZC A;  2FNA A;  1JGS A;  5K5R A;  2HZD A;  3WE2 A;  2HZT A;  2K5C A;  2P81 A;  3JRE A;  2DFF A;  4R1H A;  3TED A;  3CCY A;  4D5F A;  4FE4 A;  2GZW A;  3F0C A;  4BL0 B;  5M3F J;  1ETQ A;  1WI3 A;  3RZD J;  2PJP A;  3KLO A;  3MWM A;  5DCM B;  3O3K A;  1XD7 A;  2QQB A;  1X2N A;  1USS A;  5J47 A;  3OYL A;  1PVE A;  1VQ6 I;  3N97 A;  4XK4 A;  3UNG C;  3BQY A;  1IXC A;  1D0X A;  1QRY A;  2CFO A;  1O7L A;  5BMZ A;  2CQQ A;  5GAD J;  2XRO A;  1LFB A;  1MD0 A;  2VJ4 A;  2V26 A;  1VQ5 I;  3ISP A;  5LEJ A;  2CQX A;  5HLG A;  3K4N A;  4YIR X;  1BIA A;  2HWV A;  2Q1Z B;  2MLG A;  2D1H A;  4RB0 A;  4YG2 F;  4LB5 A;  1FEX A;  5IOZ A;  3L00 A;  3WTZ A;  4H0E A;  2RAE A;  2Q2E A;  4RAZ A;  2V79 A;  2LLK A;  4GDF A;  3GLX A;  4LLG F;  5FKK A;  4CYC B;  2XHK A;  4EM1 A;  1WSU A;  1MMN A;  4BQO A;  4Y3O A;  1J2X A;  1DP7 P;  3J7A Y;  3CC2 I;  4HF2 A;  3S15 J;  3DPT A;  2HVQ A;  1T38 A;  1B4A A;  3G6E I;  1L0O C;  2BY2 A;  3LWF A;  1HW5 A;  3MAJ A;  3QU6 A;  2ZME C;  3W6J B;  2DI3 A;  1T0F C;  4GXO A;  3DBR B;  4IF4 A;  5M3M J;  5HDG A;  4F55 A;  3L2R A;  5CVR A;  2R7T A;  2EIJ H;  5BOX A;  1PUF A;  5ICG A;  1YJ9 I;  1HLV A;  4IXA A;  3LMM A;  2NS0 A;  1XS9 A;  4BY1 J;  5H6Q A;  1FOY A;  2KZV A;  2O61 A;  3QU3 A;  3MMY B;  1S9H A;  1MMG A;  2ECC A;  1BW5 A;  1TT0 A;  1BIB A;  4HSR A;  2JQ7 A;  4E70 A;  3SDG A;  4Q5S F;  2JPC A;  2XV4 S;  3OYJ A;  2OBP A;  3HG9 A;  4MFD A;  3BZK A;  1EKE A;  2MH2 A;  1UMQ A;  3KZZ A;  3F6O A;  5TIS C;  3NQO A;  3OL4 A;  3LSJ A;  1BR1 A;  1ULY A;  3RYP A;  2UZK A;  1MBF A;  2K9N A;  1ZEL A;  2JA6 J;  1SAU A;  4M9Z A;  3PIP F;  2JRT A;  3H36 A;  4OIO F;  3NAR A;  3JTG A;  3CDH A;  4FIS A;  2QYO A;  2VB6 A;  1FOW A;  4B43 A;  3JRD A;  5HDK A;  5L3C A;  2R92 J;  4I01 A;  1TBX A;  5D6F A;  4M6Y A;  2LSO A;  3GFI A;  1Q1V A;  3ASO H;  1VQP I;  4BE0 A;  1VQN I;  4EJT A;  1KYZ A;  3HPH A;  1P6R A;  3RDI A;  1LJ9 A;  3HYI A;  3HC7 A;  1W4M A;  3J7A O;  4KIC A;  3I55 I;  4EGY A;  2F6C A;  1T6S A;  5K5O A;  3AL0 C;  2QBY A;  3BG3 A;  3MVP A;  4GYI A;  5J40 A;  1V54 H;  2PN6 A;  1FOK A;  5A2Q K;  2HVR A;  1TQI A;  2Y9Y A;  2RNJ A;  1K4T A;  2ZKZ A;  3ZQL A;  1LFP A;  1JUS A;  2OU2 A;  1HW2 A;  1SVM A;  2KFD A;  1HKQ A;  3QOP A;  3N4M A;  5M5X J;  3OYI A;  2W00 A;  2E60 A;  1F1Z A;  1UB9 A;  4LJZ F;  3DKW A;  4A2U A;  1W36 D;  3MN2 A;  4CHU A;  1F43 A;  2CRG A;  4PSX A;  3BJA A;  3E6M A;  1OKR A;  3QP5 A;  5IP7 J;  1JHH A;  3CCM I;  3DU6 A;  1ZK8 A;  2VQL A;  1QGP A;  1ITY A;  1V4R A;  4F92 B;  1X1P A;  1K83 J;  2NOJ B;  1Q1H A;  1IGN A;  4OIQ F;  1ZKG A;  2JJ7 A;  3ABU A;  5LRR A;  3SZP A;  1W0U A;  3OYF A;  1TWC J;  2GXB A;  4ZDO A;  4YIF A;  3S3M A;  1IG7 A;  2AS5 F;  4LK0 F;  4CYD A;  1LPQ A;  5KAF C;  3TO6 A;  2Z2S B;  4J01 A;  1WWX A;  5LRS A;  1UZC A;  3BJ6 A;  2IJL A;  1K61 A;  3ZQH A;  3R61 A;  2OAZ A;  1E17 A;  3E0J B;  3V42 A;  2UUZ A;  2DK8 A;  2I10 A;  4UUS A;  3J80 Z;  4FCY A;  1YOV B;  4XIC A;  2P6T A;  4A3I J;  4FTH A;  4BJT A;  4G6T B;  4Q47 A;  2A05 A;  3O6B B;  2W25 A;  5CYV A;  2CGP A;  3WTW C;  1MJA A;  1XB4 A;  4XRS A;  2L9V A;  2CQ7 A;  2LDU A;  4ESJ A;  1XTA A;  2WY7 Q;  2WB1 N;  5FLM J;  2QM3 A;  2EFQ A;  4PJM A;  1SFO J;  4ON0 A;  3HUG B;  3CME I;  3FWE A;  3K2Z A;  4DIQ A;  3KP3 A;  4B48 A;  1GVD A;  3RPU A;  3TOB A;  1MMD A;  2ZC2 A;  2R7U A;  5E1Z B;  3BLY A;  3PL8 A;  2K7L A;  4Y33 A;  2H94 A;  3GXO A;  1AHD P;  3KYD B;  2QLZ A;  3HRU A;  3QPS A;  1W5C C;  1KON A;  4K2E A;  3S16 J;  1KU2 A;  2X48 A;  1YW8 A;  3VYT B;  1G2H A;  4NQW B;  1XSV A;  4JK1 X;  4EAT A;  3E5Q A;  1G59 A;  3OYH A;  1FC3 A;  3M8E A;  2K02 A;  5J1R A;  1YG2 A;  3HTU A;  4D5C A;  1SAN A;  1BC7 C;  2GOM A;  4M6X A;  3CUQ A;  3BCA A;  3HXL A;  3C2H A;  4ASN A;  1ETV A;  2EJR A;  4YII A;  1ZH5 A;  1OIS A;  5IT9 Z;  3F21 A;  4RM3 A;  1RPW A;  4HF1 A;  1X1B A;  2FX0 A;  1XGO A;  1HKT A;  2DDB A;  3PFY A;  4DYR A;  4Y13 A;  2LRE A;  1ETY A;  1SFX A;  5LD2 C;  4A3J J;  3F72 A;  3HPG A;  1D0Z A;  3BR3 A;  3HHH A;  4XRF A;  3Q5F A;  3PSF A;  1R58 A;  1Z67 A;  3QYE A;  2LF8 A;  3PNY A;  1A6Q A;  5E20 A;  4A0Z A;  2R7S A;  1XPX A;  1RET A;  3IH4 A;  4W97 A;  1YIO A;  2OTJ I;  2QQA A;  4IQJ A;  1W5S A;  1WJA A;  3RPU D;  4E7I A;  1YTY A;  1PDN C;  2DOE A;  4OOI A;  5EG0 A;  5J4Y A;  4AWX B;  2DA5 A;  1ETX A;  3ELK A;  4AYB A;  3ESW B;  3FXJ A;  2A69 F;  5HDN A;  1Y0U A;  5KHD A;  2V1X A;  1FWZ A;  1DU0 A;  2VON A;  4C2M J;  1MBE A;  2MBF A;  5FKO A;  1MKM A;  5IOY A;  2FUG 2;  2Y48 A;  5EGO A;  2GAU A;  3TQN A;  4PFO A;  2VKH A;  2DT6 A;  4KN4 X;  4HST A;  1TW3 A;  5H2F C;  4JOM A;  1WPK A;  4IZZ A;  5KVR A;  3CMM A;  4IHT A;  2RQP A;  2EA4 A;  2NYX A;  4LLL A;  4YFN F;  4OU0 A;  4XN0 A;  5DDG A;  5BQT A;  2LD5 A;  3EYY A;  2HPM A;  1I6X A;  1IXR C;  1V5E A;  3E97 A;  4Y17 A;  1BI1 A;  3QYF A;  3S2D J;  3B6C A;  4WXD A;  1HW1 A;  4BDZ A;  4BU2 A;  4IVN A;  3G4S I;  3OS1 A;  1JJ8 C;  2LY9 A;  3OYC A;  1FPQ A;  3OYG A;  4Z2Y A;  5D8L B;  2E1C A;  4G12 A;  2LMD A;  4YFX F;  2KIS A;  5DCM A;  1UHS A;  4UV8 A;  3H35 A;  4D7N A;  3HRM A;  4IOC F;  2K86 A;  2XKO A;  1OCR H;  2Q2E B;  3IRQ A;  3SXY A;  3GFL A;  4GGG A;  4E4H A;  2L9R A;  4O3M A;  3K7A J;  4OAZ A;  2P7C B;  4KNY A;  3WTY C;  1RUN A;  2LC2 A;  3MZY A;  5E17 F;  2UXX A;  2H8R A;  4LB6 B;  2NNN A;  3ROU A;  2XAF A;  5HLT A;  5F64 A;  5ICE A;  1XDS A;  1ZGJ A;  3ZN0 A;  1UEL B;  3ZQG A;  5CVJ A;  2ME6 A;  2A5W A;  2DA6 A;  2WAQ N;  5EEA A;  2PJR B;  2RKH A;  4A3K J;  1TC3 C;  2Y0M A;  4CYC A;  3TW7 A;  1VND A;  4BXU A;  1JT6 A;  4UUT A;  1ZRF A;  2FJ1 A;  3QWL A;  3DEU A;  1WJC A;  2K4B A;  2IGN A;  4WX9 A;  3PIO F;  1AWC A;  5LHG A;  4GO1 A;  4BE1 A;  4UNO A;  1RR8 C;  2E35 A;  3DTE A;  1O3T A;  3OS0 A;  2K3P A;  2DMP A;  2L01 A;  3VFZ A;  2OQG A;  4U0V A;  1R6R A;  2PQ8 A;  2FQ3 A;  4QLC U;  3C3W A;  3U2R A;  2TRT A;  3K1M A;  1RC9 A;  4WK8 F;  1I3A A;  1BJA A;  2EWN A;  5FD5 A;  1MJ9 A;  3NWT A;  2W57 A;  3EET A;  2R7F A;  1ZG1 A;  3KZI C;  4KIT B;  1FYM A;  2DA7 A;  3JRA A;  3JRC A;  2HQA A;  2L7M P;  2LKS A;  2YUS A;  3G1L A;  2MGQ A;  2NVX J;  5IY5 H;  3QPL A;  1X58 A;  1GDT A;  1XSD A;  1TWA J;  3UR3 C;  5J1U A;  1QNT A;  1WGX A;  2EFN A;  3LFK A;  2YSR A;  2R7Q A;  1BOB A;  3SDB A;  2MD0 A;  2H6B A;  1Z77 A;  3HRT A;  1TWF J;  3ECO A;  4ENK A;  3ABL H;  2LK2 A;  3ZXS A;  4JQF A;  2QBY B;  2FEZ A;  4HX4 A;  1Z1D A;  1O4X A;  1Z3X A;  1EV7 A;  3FMQ A;  2OQR A;  1YW9 A;  2G0E A;  4U87 A;  3S1R J;  1UHM A;  3EUH C;  3HOY J;  2KP6 A;  4XOT A;  1GT0 C;  2EIK H;  4KYW A;  2ZB9 A;  1F36 A;  3NRV A;  1YX3 A;  3Q0V A;  1G4D A;  1K4S A;  4MO7 A;  3TMO A;  5D5U B;  3NEU A;  2B7E A;  5JVG F;  1S6L A;  1MGT A;  3V4G A;  4TV7 A;  4KIB A;  4BHC A;  4IRH A;  1FSH A;  1EH6 A;  4B47 A;  4EM2 A;  5IT9 K;  5DV5 A;  4QPO A;  3WGH A;  1RRJ A;  2DOA A;  2HOA A;  5IP6 A;  3H9J A;  2K9L A;  4AUX A;  2F5V A;  4Q48 A;  2DJI A;  4KMU X;  5ILS A;  1D8K A;  2WAE A;  2WV1 A;  2HYF A;  4B8X A;  2CG4 A;  4DNC A;  1HKS A;  3GCM A;  1N77 A;  2ZFW A;  1YJW I;  3CCR I;  3ZMS A;  4A12 A;  3LA3 A;  1LUJ B;  3ZP5 A;  1PP8 F;  5D5V B;  5GAH J;  2ICW G;  3A01 A;  2EPF A;  1IUY A;  2LBF A;  2ZSH B;  1IF1 A;  3RJP A;  1JHF A;  1BI2 A;  3OIP A;  2QSG X;  1G3S A;  4N9I A;  2L2O A;  1WVR A;  3HZJ A;  3JAM Z;  3GW2 A;  1QU3 A;  2RQQ A;  3D5S C;  3K4B A;  3O8G A;  3U1D A;  4BJ6 C;  3IP4 B;  2H1L A;  2V1U A;  1U0J A;  2RNG A;  4AVP A;  2R7Z J;  2CQK A;  2L5Q A;  3GZN B;  3S17 J;  1MBG A;  1V5G A;  4RGU A;  1ZGA A;  1A5J A;  1GXQ A;  3MKZ A;  2BY0 A;  1T08 B;  4BBR J;  1G8X A;  2XAG A;  3RZO J;  3CCQ I;  4UVA A;  5JHU A;  1XGN A;  2HI3 A;  3F23 A;  2J5P A;  3RSN A;  2R7W A;  3R6S A;  3PM1 A;  1IN4 A;  1J09 A;  4OAY A;  1O7F A;  4ZDP A;  4OMY A;  1YE9 A;  1F5T A;  1HST A;  1DGR M;  4E6K G;  1WJ5 A;  4NC7 A;  4B1R A;  4BS9 A;  3RPQ A;  2YX7 A;  2R5Y B;  4I98 B;  3OY9 A;  1NHA A;  4A6E A;  2WA0 A;  3HUG A;  2W7N A;  5JR3 A;  3FBI B;  1MMA A;  4J19 A;  2E7X A;  2EV6 A;  4M74 A;  4RGS A;  2CJJ A;  2DK5 A;  3S1N J;  1SD5 A;  5LLQ A;  2ZME B;  5TJJ A;  5HLI A;  4L0Y B;  1NTC A;  1Z7L A;  2QKL B;  4XSX F;  4Q4Z F;  1FX7 A;  3ZMD A;  3ABK H;  1TWH J;  2CQN A;  1B8I A;  2DT7 B;  1N75 A;  1S8N A;  2A6T A;  2EIM H;  4PJJ A;  4DBQ A;  1H88 C;  4HLY A;  1T2K A;  1LEA A;  1F4K A;  2PBI A;  2Z33 A;  2JMW A;  3PNT A;  2UXN A;  4KT5 C;  4A0X A;  2EIN H;  5H20 A;  5KNL A;  2NVQ J;  3FM5 A;  4HOB A;  1IJW C;  2GIV A;  2XKP A;  5CVV A;  3OIQ A;  3EPZ A;  1IW7 F;  4E7Z A;  2OA4 A;  1WH5 A;  3ABT A;  4ABZ A;  4L5J A;  2DOD A;  3FHZ A;  4CCM A;  4D7M A;  2EZI A;  4PSW A;  3DPU A;  2HPI A;  5JVT A;  5EG0 B;  2V4J C;  3TP3 A;  4X1E A;  3SFI A;  1T39 A;  2E5Z A;  2CH0 A;  3BG5 A;  2HS5 A;  2VXD A;  5EGO B;  3D1N I;  4FAS D;  4CA0 A;  2ZNZ A;  2PMZ N;  1Z0X A;  1YS7 A;  4XM3 A;  2OPT A;  1D5V A;  1DP3 A;  3LSI A;  2ZNY A;  5ICF A;  3ZCO A;  2FA5 A;  2E1M C;  2VOP A;  5KCM A;  3AL0 B;  3CLO A;  2GXG A;  3WOD F;  4NC8 A;  2HOE A;  2K40 A;  3I4P A;  3PO2 J;  5D6E A;  1UFM A;  5IT3 A;  2JA7 J;  1FYL A;  2RN7 A;  5J1Y A;  3K70 C;  3IC7 A;  4MLO A;  4CSW A; 
#chains in the Genus database with same CATH homology
 5L3D A;  1O3Q A;  3COA C;  1B9N A;  1BI0 A;  2HGC A;  3JTH A;  3F8F A;  5CJ9 A;  4BH9 A;  2WWY A;  1GVJ A;  1IZ1 A;  1SMT A;  1ON1 A;  2VT2 A;  1KU3 A;  3QPH A;  2G7H A;  1BM9 A;  5AIP A;  1KQ0 A;  2PFB A;  1ZRE A;  3LQR A;  1I5Z A;  4S04 A;  2DTR A;  3WGI A;  5FLX K;  2ESH A;  1P4W A;  4HF0 A;  1REP C;  2F5C A;  2XUB A;  2XGX A;  1HQC A;  4ZYG A;  3T1B A;  2EB7 A;  2K4J A;  2D1V A;  4HYE A;  4EM0 B;  1J0R A;  3HOS A;  1OPC A;  2IA0 A;  2KIU A;  3EYI A;  4P5O A;  4HQE A;  1QO0 D;  4O5V A;  3RKX A;  2CWE A;  2RV8 A;  1R1T A;  3T0Y A;  3CUQ C;  1TW2 A;  3H3U A;  3OV8 A;  4EMS A;  5DEQ A;  3V8L A;  1T98 A;  4M73 A;  4IJA A;  4EVI A;  3WTX C;  5CVU A;  1J59 A;  2VXZ A;  2M1B A;  2QQ9 A;  4I2O A;  5FD6 A;  3GF2 A;  5FB2 A;  3HTS B;  3HIF A;  2A5Y B;  3M9A A;  4U88 A;  2XVC A;  1SD4 A;  2O6G E;  3V8K A;  2RC4 A;  3V7R A;  3T8R A;  2TDX A;  1XCB A;  4BYY A;  5K1Y A;  5E8I A;  2ISZ A;  1SFU A;  5AIQ A;  1LNW A;  3TGN A;  2A68 F;  3R0A A;  3D5L A;  1P4X A;  5L3F A;  3ZN1 A;  1BBY A;  2PG4 A;  2BV6 A;  4CZZ A;  3G3Z A;  2XAQ A;  1BN5 A;  4RB3 C;  5LBQ A;  4CIC A;  4RB1 A;  2FSW A;  1ODD A;  5DCF A;  1W7P D;  1IN7 A;  1PP7 U;  3E6B A;  2HR3 A;  5ED4 A;  5E1X A;  1MZB A;  3HSE A;  4EJO A;  4R79 A;  4A6D A;  4XLN F;  2BBY A;  2GA2 A;  1Z7U A;  3RI4 A;  4ETS A;  3ZMV A;  2YU3 A;  1J5Y A;  3BOQ A;  3KEO A;  2DAO A;  4XSZ F;  3BPX A;  5TRD A;  2ZME A;  2P5L C;  3CO6 C;  5L3B A;  4NB5 A;  2IA2 A;  4HA8 A;  2G9W A;  4P9F A;  2O03 A;  3M7G A;  1RNL A;  3PFI A;  4KIG A;  1QPM A;  4BHB A;  2ZXJ A;  4HLX A;  2HTJ A;  4KMF A;  3E3V A;  6PAX A;  2F5D A;  3H92 A;  4IRI A;  3F22 A;  1DPU A;  1D3Y A;  5JFR A;  1LDD A;  1K78 B;  5KK1 A;  2L4A A;  1FBQ A;  2QVO A;  3QAH A;  5K5Q A;  1YYV A;  2LF7 A;  2VT3 A;  1K6O A;  3MEX A;  1U5T B;  5L3G A;  2Q8K A;  2DPD A;  2VBZ A;  3J81 Z;  1XMK A;  1R7J A;  3TDZ C;  3GFJ A;  1R36 A;  3MQ0 A;  2YR2 A;  1RUO A;  2K27 A;  3FMS A;  3GEZ A;  3IKV A;  4HBL A;  2QZ8 A;  1DDN A;  1DUX C;  2HDC A;  3Q9V A;  3E6C C;  3MZH A;  1YS6 A;  1Z9C A;  2L3D A;  2P8T A;  3ZMT A;  3BZ6 A;  2F5E A;  3MCZ A;  2PMH A;  1R00 A;  1IN5 A;  3E5X A;  2PEX A;  5HOO A;  2CSO A;  3BJO A;  2DPU A;  4U0Y A;  4HV6 A;  1IRG A;  4AIJ A;  4ENM A;  2A61 A;  3HOT A;  1ZLJ A;  2VE9 A;  1R22 A;  4L9N A;  3QRF F;  4D0P A;  1B59 A;  4EQQ A;  2F5F A;  4FX0 A;  3BRO A;  3KLN A;  4ZYE A;  4ZZL A;  2M8E A;  3CUO A;  1R1U A;  1P92 A;  3GZ5 A;  5HS7 A;  1SAX A;  3J80 K;  3D0S A;  5L3E A;  4OIR F;  4RGR A;  4Y15 A;  2HKO A;  3VB2 A;  3WE3 A;  4LG0 B;  2QEN A;  2ZJ2 A;  1FY7 A;  2IT0 A;  4G7H F;  1SD6 A;  1R5G A;  1W7P B;  5E8G A;  1U6G A;  2E1N A;  2XAJ A;  1FNN A;  4LLN A;  4P55 A;  4RS8 A;  3U9G A;  4PDK A;  1BC8 C;  1CF7 A;  4JBA A;  2R3S A;  2M5W A;  2ELH A;  4EJW A;  1XDU A;  3EDP A;  5ICC A;  3F8B A;  3C18 A;  4ENJ A;  1WI9 A;  2O3F A;  1R1V A;  4LMY A;  1O57 A;  4G6Q A;  4LGW A;  1XN7 A;  2COM A;  2CFX A;  2L4M A;  1OYY A;  5F6F A;  3TOA A;  2JTV A;  4PGH A;  2P4W A;  2UWM A;  2R7D A;  3F3X A;  3DXJ F;  2KKO A;  3KP6 A;  4CGZ A;  5D8K B;  2V9V A;  3K69 A;  4YFK F;  2IRF G;  2M30 A;  2PI0 A;  2H27 A;  3F6V A;  3K9T A;  3ZPL A;  5BPD A;  4I0A A;  4L9T A;  4CO8 A;  3G73 A;  2GWR A;  5D4R A;  1B6A A;  3CJN A;  4PGG A;  2P5K A;  5E1W A;  2DO7 A;  4OIP F;  3SQN A;  3J81 K;  1SD7 A;  3V8J A;  3IWF A;  1MDM A;  1S7O A;  4G6D A;  4M71 A;  1PUE E;  1H0M A;  2MD5 A;  5AON A;  3R4K A;  1G6N A;  2FMY A;  1G3W A;  2DW4 A;  2DFI A;  1XGM A;  3M8F A;  3FMR A;  1IXS B;  2IW5 A;  4EJV A;  1FZP B;  3VOD A;  3HSR A;  1KYW A;  5J6X A;  3VOE A;  4KIF A;  2ESN A;  4WF2 A;  4CXF A;  1UHW A;  2PMU A;  2VBY A;  2BGC A;  1HSJ A;  1LVA A;  3R60 A;  4RGX A;  1V3F A;  2STW A;  1O3R A;  3I59 B;  4L18 B;  3HRS A;  2HFH A;  2EA2 A;  4IPA A;  3L2C A;  1BOA A;  4XLP F;  1DPR A;  2XIG A;  3K1P A;  1XMA A;  4PCQ A;  2A3S A;  1KU9 A;  3TO9 A;  1G3T A;  4WWC A;  2OZ6 A;  3QPT A;  5JI6 A;  2EV5 A;  2ZBK A;  2P7V B;  3K0L A;  3P9I A;  3GZ6 A;  3I5U A;  2O8X A;  1J7K A;  2XAS A;  5LGN A;  1VTN C;  1K78 A;  3GFM A;  5J8F A;  1HBX G;  4BNC A;  5ERI A;  2P5V A;  2DQR A;  3GO5 A;  4FT8 A;  3F8N A;  3KP5 A;  5D5W B;  2M87 A;  3OOP A;  3EUH A;  1U5T A;  2PLY A;  5LEK A;  4L9J A;  4ZYD A;  2RGV A;  2NNY A;  1L3L A;  1YW7 A;  1R23 A;  2XAH A;  4L5I A;  3JSO A;  4P9U A;  2ZCW A;  5BS6 A;  4U7B A;  3LA2 A;  3ULQ B;  4KDP A;  2MC3 A;  4KUM A;  3KP2 A;  3IL2 A;  4I02 A;  4MQV A;  1H9T A;  3BY6 A;  3SZT A;  3B02 A;  4QWQ A;  1RIO H;  5F1R A;  2DU9 A;  1FLI A;  1LQ1 A;  4MTD A;  2FXA A;  2DT5 A;  1FYK A;  4G7Z F;  2MA3 A;  3FX3 A;  1QQI A;  1O3S A;  1G3Y A;  2VBW A;  4FX4 A;  5FFZ A;  3REO A;  4AIH A;  1WQ2 A;  4ESB A;  2HTS A;  3JAM K;  2EFP A;  5EEH A;  4I0B A;  4BAY A;  4HAM A;  2H6C A;  4L0Z B;  3AAF A;  3FXU A;  3DV8 A;  5LHH A;  5DUI A;  1K7A A;  5EEG A;  2QUF A;  5CLS A;  2VBX A;  1GHC A;  2P6S A;  1X3U A;  5J8C A;  2KIM A;  1RZ4 A;  3KET A;  1XCV A;  4LG0 A;  2HYG D;  4KFC A;  1W7P A;  1CF7 B;  3BDD A;  4NHJ A;  4BHP A;  3GYH X;  5ILU A;  2BE5 F;  3L9F A;  4RAY A;  2RDP A;  5H6R A;  1R5H A;  2OZU A;  4M72 A;  3CO7 C;  1ONV A;  2GA1 A;  4MNU A;  2C6Y A;  3PQJ A;  1H9G A;  1YLF A;  4WXH A;  4N0B A;  3KE2 A;  1LB2 A;  2ETH A;  3WG9 A;  3L09 A;  1RI7 A;  2E7W A;  1W5T A;  3MFK A;  2X0L A;  3JW4 A;  3KEQ A;  3CTA A;  3Q9S A;  1F9N A;  2HKX A;  3H3Z A;  1U2W A;  2F2E A;  2EV0 A;  1MDM B;  1BI3 A;  3RKW A;  1IN8 A;  3T5X A;  2DLL A;  3BWG A;  3VEP A;  3WGG A;  3BP8 A;  4ESF A;  3RIR A;  4LFU A;  4AD9 A;  3M1E A;  3GX4 X;  3FF5 A;  2FBI A;  2B0L A;  4A5N A;  2OD5 A;  2FRH A;  4MQ9 F;  1JXS A;  3KZY A;  4L9V A;  2KRF A;  4OIN F;  1D8J A;  4S05 A;  2ZO4 A;  1FP2 A;  1LDJ A;  1T0F A;  2Z9O A;  2RVC A;  2FML A;  2HQR A;  2EFW A;  2KJC A;  4N9H A;  1KU7 A;  2IPQ X;  1JE8 A;  2VOO A;  2JZY A;  1ZAR A;  4GYG A;  3ZMU A;  4UVB A;  5DD8 A;  3I0T A;  3PQK A;  4HX7 A;  4G7O F;  3I59 A;  4XBF A;  1MJB A;  1OYI A;  3TO7 A;  1OR7 A;  1IAW A;  1B9M A;  2LNB A;  4MTE A;  5FGM A;  1S3J A;  3TDU C;  4IHS A;  2FU4 A;  2V6C A;  2JT1 A;  1ZAO A;  3I54 A;  2ADU A;  3ECH A;  2QWW A;  2FBH A;  4OMZ A;  3O2P E;  5CVI A;  2L02 A;  1HXD A;  2FOK A;  3ML6 A;  4ZZD A;  2JSC A;  3IRR A;  5D5X B;  1UST A;  1TQM A;  3EQL F;  1TQP A;  3DP7 A;  1U8R A;  3E5U A;  4WXC A;  1S29 A;  1ZYR F;  2H09 A;  3F8M A;  5DYM A;  4I7H A;  1SFE A;  2YPR A;  1Z05 A;  2Q0O A;  1I27 A;  5FFX A;  1ZHF A;  2CW0 F;  5LGU A;  1ON2 A;  4EJU A;  3B73 A;  3DQV C;  2HQN A;  4I09 A;  3GVA A;  1P2F A;  4G9Y A;  4A0Y A;  1CGP A;  3C7J A;  3RYR A;  1TLH B;  3KFW X;  3RTR A;  3LST A;  4HDV A;  3HSF A;  1B1B A;  4GCV A;  2CYY A;  3E6D A;  3I58 A;  4R8H A;  5HS9 A;  2VE8 A;  4MEX F;  2O0Y A;  1S7A A;  3ZMZ A;  3DFG A;  3WU0 A;  3WU1 B;  3LAP A;  2W85 A;  3I71 A;  3RKY A;  2DBB A;  1J75 A;  4U0W A;  1EH7 A;  1IN6 A;  2X4H A;  4EV0 A;  2STT A;  2MH9 A;  1TNS A;  2ISY A;  2FNP A;  2EK5 A;  3T8T A;  3P7N A;  2D45 A;  1KQ9 A;  3V7S A;  1K79 A;  1ZLK A;  2XRN A;  1FSE A;  4M9S A;  2W84 A;  4P96 A;  4UHT A;  5ILV A;  1ZRC A;  4G94 A;  1UCR A;  1QZZ A;  3SHF A;  4DQ2 A;  1I1G A;  1OYW A;  1YFH A;  2NAZ A;  4O6J A;  4UV9 A;  2M45 A;  3W6K B;  1LDK B;  1IRF A;  5LHI A;  3P9K A;  4BQA A;  3FM3 A;  1FBU A;  3FXQ A;  1Z6R A;  4KA4 A;  5BPI A;  3P9C A;  4A5M A;  4AIK A;  4HX8 A;  1GXP A;  2Z99 A;  3HHG A;  2ACJ A;  3S2W A;  4B09 A;  5HLH A;  1U5T C;  2KIF A;  3K1N A;  2VC1 A;  5FLX Z;  3KCC A;  2VOD A;  3IHU A;  4RB2 C;  3FXR A;  1YQA A;  5E18 F;  1KA8 A;  3WTU C;  1WRJ A;  3F8C A;  1KQ8 A;  2IP2 A;  4KN7 X;  4ZH4 F;  3IWZ A;  2A6E F;  2FBK A;  5DUK A;  4LK1 F;  3R0J A;  1TNT A;  1YO5 C;  2VC0 A;  5DD4 A;  2A6H F;  2GQQ A;  1ZN2 A;  1FP1 D;  4MEY F;  3V7C A;  2WTE A;  4UUV A;  1EH8 A;  1ZG5 A;  4CDG A;  1SMY F;  4ZYH A;  4IRG A;  1FBS A;  1FT9 A;  3WTT C;  1ZRD A;  3WTV C;  2FE3 A;  4HDU A;  3ERE D;  5D4S A;  3DF8 A;  3FZV A;  3BPV A;  4HV5 A;  2HEO A;  4MHG A;  4LD5 A;  2NRA C;  1U78 A;  2FF4 A;  1XGS A;  2AXL A;  2W24 A;  2YX4 A;  4WCG A;  1AOY A;  4ENN A;  2D2W A;  2Y75 A;  1I1S A;  1Z6T A;  3LAJ A;  2IA1 A;  4EGZ A;  1WKM A;  2BYV E;  3JSP A;  3DPL C;  2VN2 A;  3LQQ A;  4FHT A;  4UVC A;  2G7U A;  2V1D A;  3CUQ B;  2MLK A;  4PZJ A;  3L7W A;  5HVQ C;  2Z3Y A;  3LA7 A;  4MGR A;  2DQL A;  5A2Q Z;  2WV0 A;  3I64 A;  2CO5 A;  4NQW A;  2A07 F;  4M9X A;  3WTS C;  2EFO A;  1LEB A;  5FO5 A;  3IKT A;  2IVM A;  3QP6 A;  1A04 A;  2BEO A;  1ZG3 A;  1J9I A;  4F7Z A;  3TKY A;  4UXN A;  3GUD A;  2JPB A;  2KJB A;  4HZF A;  5LGT A;  3KP4 A;  1STZ A;  1TTY A;  2L54 A;  1OMI A;  2LKP A;  1E2X A;  4G8X A;  4HW0 A;  4U7D A;  1QZY A;  1Z91 A;  1QBJ A;  1U3E M;  2J5O A;  2Z5U A;  1KGS A;  3ZQ7 A;  3GWZ A;  2WC2 A;  1C0W A;  3KP7 A;  1XSX A;  4HQM A;  3I53 A;  3C1D A;  5HS8 A;  1P4A A;  3SFZ A;  2FNA A;  1JGS A;  5K5R A;  3WE2 A;  2HZT A;  4R1H A;  2GZW A;  2PJP A;  3KLO A;  3MWM A;  5DCM B;  3O3K A;  1XD7 A;  2QQB A;  1USS A;  3N97 A;  1IXC A;  1O7L A;  5BMZ A;  2XRO A;  1MD0 A;  3ISP A;  5LEJ A;  5HLG A;  1BIA A;  2HWV A;  2MLG A;  2D1H A;  4RB0 A;  4YG2 F;  4LB5 A;  3L00 A;  3WTZ A;  4H0E A;  2Q2E A;  4RAZ A;  2V79 A;  3GLX A;  4LLG F;  2XHK A;  4EM1 A;  1WSU A;  1DP7 P;  1J2X A;  4HF2 A;  3DPT A;  1T38 A;  1B4A A;  1L0O C;  3LWF A;  3W6J B;  1HW5 A;  3MAJ A;  3QU6 A;  2DI3 A;  4GXO A;  4IF4 A;  5HDG A;  5CVR A;  5BOX A;  5ICG A;  4IXA A;  2NS0 A;  5H6Q A;  2O61 A;  3QU3 A;  1BIB A;  4E70 A;  4Q5S F;  2JPC A;  2XV4 S;  2OBP A;  2MH2 A;  3KZZ A;  3F6O A;  3NQO A;  2UZK A;  1ULY A;  3RYP A;  4M9Z A;  2JRT A;  4OIO F;  3JTG A;  3CDH A;  2QYO A;  5HDK A;  5L3C A;  4I01 A;  1TBX A;  5D6F A;  4M6Y A;  2LSO A;  3GFI A;  4EJT A;  1KYZ A;  1P6R A;  3RDI A;  1LJ9 A;  3HYI A;  1W4M A;  3J7A O;  4KIC A;  4EGY A;  1T6S A;  5K5O A;  2QBY A;  4GYI A;  2PN6 A;  1FOK A;  5A2Q K;  1TQI A;  2RNJ A;  2ZKZ A;  2OU2 A;  1HW2 A;  1HKQ A;  3QOP A;  3N4M A;  1F1Z A;  1UB9 A;  4LJZ F;  3DKW A;  4A2U A;  4CHU A;  3BJA A;  3E6M A;  1OKR A;  3QP5 A;  1JHH A;  1QGP A;  1V4R A;  1Q1H A;  4OIQ F;  5LRR A;  3ABU A;  3SZP A;  2GXB A;  4YIF A;  2AS5 F;  4LK0 F;  4CYD A;  3TO6 A;  1WWX A;  5LRS A;  3BJ6 A;  2IJL A;  3R61 A;  2OAZ A;  1E17 A;  2DK8 A;  3J80 Z;  2P6T A;  4Q47 A;  2CGP A;  3O6B B;  2W25 A;  5CYV A;  3WTW C;  1MJA A;  1XB4 A;  2LDU A;  4ESJ A;  2QM3 A;  2EFQ A;  4ON0 A;  3FWE A;  3K2Z A;  3KP3 A;  3TOB A;  3RPU A;  5E1Z B;  2K7L A;  2H94 A;  3GXO A;  2QLZ A;  3HRU A;  4K2E A;  1KU2 A;  1YW8 A;  1XSV A;  4JK1 X;  3E5Q A;  1FC3 A;  3M8E A;  2K02 A;  1YG2 A;  3HTU A;  1BC7 C;  4M6X A;  3CUQ A;  4ASN A;  2EJR A;  4YII A;  1ZH5 A;  5IT9 Z;  3F21 A;  4HF1 A;  1XGO A;  1HKT A;  4Y13 A;  1SFX A;  3F72 A;  3HHH A;  4XRF A;  3Q5F A;  1R58 A;  2LF8 A;  5E20 A;  4A0Z A;  1YIO A;  2QQA A;  1W5S A;  1PDN C;  1YTY A;  4OOI A;  4AWX B;  3ELK A;  2A69 F;  5HDN A;  1Y0U A;  2V1X A;  1FWZ A;  2VON A;  2MBF A;  1MKM A;  2Y48 A;  2GAU A;  3TQN A;  4KN4 X;  1TW3 A;  5KVR A;  4IHT A;  2RQP A;  2EA4 A;  2NYX A;  4LLL A;  4YFN F;  4OU0 A;  5BQT A;  5DDG A;  3EYY A;  1I6X A;  1IXR C;  3E97 A;  4Y17 A;  1BI1 A;  4WXD A;  1HW1 A;  4IVN A;  1FPQ A;  4Z2Y A;  5D8L B;  2E1C A;  4YFX F;  5DCM A;  4UV8 A;  3HRM A;  2K86 A;  2XKO A;  3IRQ A;  3SXY A;  3GFL A;  4GGG A;  4O3M A;  2P7C B;  4KNY A;  3WTY C;  1RUN A;  3MZY A;  5E17 F;  2UXX A;  4LB6 B;  2NNN A;  3ROU A;  2XAF A;  5F64 A;  5ICE A;  1XDS A;  3ZN0 A;  1ZGJ A;  5CVJ A;  2RKH A;  2Y0M A;  4BXU A;  1ZRF A;  3DEU A;  2K4B A;  4WX9 A;  1AWC A;  5LHG A;  4GO1 A;  4UNO A;  1O3T A;  2L01 A;  3VFZ A;  2OQG A;  4U0V A;  2PQ8 A;  2FQ3 A;  4QLC U;  3C3W A;  3U2R A;  3K1M A;  4WK8 F;  1BJA A;  2EWN A;  5FD5 A;  1MJ9 A;  2W57 A;  3EET A;  2R7F A;  1ZG1 A;  1FYM A;  1XSD A;  1QNT A;  2EFN A;  3LFK A;  2YSR A;  2H6B A;  3HRT A;  3ECO A;  4ENK A;  4JQF A;  2QBY B;  2FEZ A;  4HX4 A;  1Z1D A;  1EV7 A;  3FMQ A;  2OQR A;  1YW9 A;  1UHM A;  4KYW A;  3NRV A;  1G4D A;  5D5U B;  3NEU A;  1S6L A;  1MGT A;  3V4G A;  4TV7 A;  4KIB A;  4BHC A;  4IRH A;  1FSH A;  1EH6 A;  4EM2 A;  5IT9 K;  5DV5 A;  3WGH A;  4Q48 A;  4KMU X;  5ILS A;  1D8K A;  2HYF A;  4B8X A;  2CG4 A;  4DNC A;  1HKS A;  2ZFW A;  3ZMS A;  4A12 A;  3LA3 A;  3ZP5 A;  1PP8 F;  5D5V B;  1IUY A;  1IF1 A;  3RJP A;  1JHF A;  1BI2 A;  1G3S A;  4N9I A;  3JAM Z;  3GW2 A;  3U1D A;  2V1U A;  4AVP A;  2CQK A;  4RGU A;  1ZGA A;  1GXQ A;  2XAG A;  4UVA A;  5JHU A;  1XGN A;  3F23 A;  2J5P A;  3R6S A;  1IN4 A;  1O7F A;  4OMY A;  1F5T A;  1HST A;  3RPQ A;  2YX7 A;  4I98 B;  1NHA A;  4A6E A;  3HUG A;  5JR3 A;  2E7X A;  2EV6 A;  4M74 A;  4RGS A;  2DK5 A;  1SD5 A;  5LLQ A;  2ZME B;  5TJJ A;  5HLI A;  4L0Y B;  4XSX F;  4Q4Z F;  1FX7 A;  3ZMD A;  1S8N A;  4HLY A;  1T2K A;  1LEA A;  1F4K A;  2PBI A;  2Z33 A;  2UXN A;  4KT5 C;  4A0X A;  5H20 A;  3FM5 A;  4HOB A;  2GIV A;  2XKP A;  5CVV A;  1IW7 F;  2OA4 A;  3ABT A;  4L5J A;  3FHZ A;  5JVT A;  1T39 A;  2HS5 A;  2ZNZ A;  1YS7 A;  1D5V A;  5ICF A;  2ZNY A;  2FA5 A;  2VOP A;  3WOD F;  2GXG A;  3CLO A;  2HOE A;  3I4P A;  5D6E A;  1UFM A;  5IT3 A;  1FYL A;  2RN7 A;  3IC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...